5K36H

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
353
structure length
289
Chain Sequence
VITITKRNGAFQNSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTPSSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 67
structure length 289
sequence length 353
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5k36H01
2JXMB 1HQMC 3FMCA 2V4DA 2ZT9C 1CI3M 1H9SA 2YYZA 3IKJA 3VR4A 2A6HC 3NE5B 1Y8PB 4TKOB 2JEAI 2EJGC 1Q1EA 3I4LA 2PNRC 4KHZA 2NN6G 2BA0A 5K36G 4OO1G 3OW7A 3PUYA 1IW7C 3I73A 1H9RA 2B8GA 3SE0A 1H9JA 2A6ED 3H94A 2KA7A 1A6XA 2DNEA 1HCZA 1Y8NB 3D31A 3LWUA 2E75C 4L8JA 2DN8A 2L5TA 4KKUA 2R6GA 3LNNA 3VA7A 3M7NA 1TU2B 1LACA 3BDOA 1VF7A 2B8FA 3P20A 5BN5A 5KNBA 2BE5D 2JE6I 3CRLC 4KN7C 1VF5C 5C0XH 1FR3A 5JEAH 1ZYRC 1BDOA 2IT1A 1VDZA 1DCZA 4BA1I 1CTMA 3EQLC 4LK1C 3T56B 4DNTB 1DXMA 1E2WA 2AUKA 2A68C 2CW0C 4KI0A 1CFMA 2O5IC 3L7ZC 3A8JE 3MFYA 2AWOA 3VR6A 5BN3A 4DK0A 1O78A 1Y8OB 1Y69U 4HR7B 3TZUA 1GUOA 1GUGA 4GZYC 2D2CC 2DNCA 1SMYC 1EWHA 1B9MA 3ND9A 4XTCS 3CRKC 1GUTA 1YNNC 3VR5A 4KKSA 4DK1A 3AB9A 4IFDH 2BDOA 2NN6I 3M85A 3A8IE 1HPCA 1G291 1K8OA 1E2VA 3QJYA 4KMUC 3WDNA 1ZKOA 3BG3A 1PMRA 1O7LA 1VCIA 2AUJD 3GQBA 2A6HD 2KCCA 2E74C 4KN4C 1HTPA 4OGQC 3PUVA 1GHKA 2K7VA 1H9MA 1E2ZA 2QF7A 1OXXK 3M4YA 1IW7D 1Q12A 4H13C 4I7ZC 3A7LA 2A6EC 2Q8IB 1Z6HA 4BA2I 3OPOA 3PV0A 4TQUS 4RCNA 2EJMA 4IQZA 1DD2A 3HGBA 1ONLA 5C0XG 5KNCA 3D4RA 1Q1BA 1IYUA 2EVBA 5JEAG 3VR3A 5BN4A 1Z7TA 1GUSA 2NN6H 3IFTA 2K33A 2PPBC 4OO1H 1GHJA 3U9SA 5KNDA 2A69C 2JEBI 3KLRA 4H0LC 4PV1C 2BE5C 3I72A 3PUWA 1T5EA 4LJZC 2E76C 1B9NA 1YNJC 4DNRB 4G7ZC 1Q90A 3SDZA 1OXVA 1I6VC 3QIAA 2D62A 2EJFC 4G7HC 1H9SB 1OXUA 4H44C 4XIGS 2A68D 3GD7A 1H9KA 3VR2A 1GJXA 2BA1A 3ND8A 3W3AA 1OXTA 3A8KE 1IYVA 2D5DA 4KKTA 3PUXA 1TKWB 1V8QA 4JK1C 3MXUA 1OXSC 4IFDG 3FPPA 3T51B 3T53B 3N6RA 4G7OC 2O5JC 3DXJC 3QG1A 2PCFB 1V43A 1GUNA 3PUZA 2K32A 4JBWA 3OOCA 5K36H 2A69D 1LABA 2LMCB 1K8MA 3A7AB 3RLFA 5A35A 1FYCA 1QJOA 2EDGA 2F1MA
chains in the Genus database with same CATH superfamily
1A3UA 2EQSA 2NTTA 1HNZQ 4B3ML 2VUMG 4DV1L 2WACA 3GTPH 2EJGC 4QB4A 3I4LA 4IUQA 1JOKA 3J80E 2BA0A 5I4DA 2EYMA 4K2KA 2VQEQ 3V05A 3K7UC 2LFNA 2M00A 4GNXC 1EQQA 3CF5A 4N8X1 2SEBD 1RIPA 1VQAA 2VS1A 4B3RL 1HHVA 2R7ZG 1NJIC 3GTKB 1M4VA 2K14A 1KAWA 2WKCA 1JE5A 1STEA 2Q2IA 5JEAH 3L3OC 4GKJL 2N88A 1BUVT 1EQVA 3A0JA 3PQIA 2O5IC 1VQKA 4QIWE 3MAQA 1A62A 4A3BB 1VQFA 2K50A 3HOWB 1W3SA 3FEWX 4A3MB 5HURA 2MNAA 1EWCA 2JP1A 1VQGA 3OWFA 3BZCA 1WTOA 3S1RB 4YWMA 2NVQB 4FYDA 4C3IH 2DJGC 3D6CA 1LM0A 1MSGA 2NN6I 2RBMA 2YTXA 1HPCA 3JC66 3K57A 1RDPD 5CBAE 1O7LA 1PTOF 3PO2H 1C0AA 2IX3A 1LT3D 4JI3L 2K7VA 2ZJPA 3UDGA 1M1KC 3S1NB 1J8IA 5M3FB 4H13C 4V190 5IYCH 2E5LQ 3AFPA 3S17B 5C4JB 4RCNA 1EQTA 1MJCA 3IFTA 1PVOA 4HSPA 3U9SA 5KNDA 4BBRH 4H0LC 5J3BA 3RN5A 2WP8J 4I7AA 1GD7A 4LJZC 1VQ8A 1EZ6A 2KCMA 1SR3A 1OXVA 3M4PA 4MNOA 1F77A 4LUVA 3GTLB 2NUCA 1CQFA 3SR1A 2N3SA 4DXGA 3UE0A 2ID0A 1PFSA 1I50H 5HY6A 4Y7NH 1TWHB 1SFOB 2D0PA 1IYVA 5T1GA 4IALA 1HRJA 2JSOA 1RTOA 5IGCA 4GNXB 1QNKA 1JWMD 5GAHC 2UUCL 4KJOA 4A3CG 4K2LA 1Y1WB 3UDFA 1OXXK 2BDOA 2EDGA 2FMMA 2Z0SA 1SNMA 3HZXA 5C4ZA 3A56A 2JEAI 1VQOA 1I6HB 1HNWL 4XT3B 4DV0L 4OO1G 1RCVD 5AJ3Q 3HOYH 5C5LA 3DMUA 2MO1A 1D6EC 2K5WA 4IJLA 1HZBA 1LLRD 1Y8NB 5E4WC 3N52A 3C3LA 1TU2B 1VF7A 3HOVB 1D8LA 2X6GA 1UEBA 1PRTB 1QOHA 5BR8Q 2FHTA 5EBCA 4X64Q 2MHVA 5JJIA 1IHZA 1XNQL 1GOZA 2F0EA 4CKEA 3HOXG 2ASBA 1AH9A 1E2WA 1QWYA 3H09A 5CV9A 1UE5A 5C6AA 2F0FA 3FKIB 2JA8H 1VQBA 3F2UA 1XYIA 4L6TB 1NR4A 3HEJA 4LF7L 4GZYC 2BCOA 2IY5B 4DR6L 1V1QA 4A93B 4X65L 1U0LA 1HZAA 1V1OA 2EYOA 4TVAB 1EQRA 5DM73 1QVGA 1VQ5A 1EIFA 4LF5L 2WB1B 3BG3A 2QA4A 4N9PA 1EU3A 2AQ2B 1PA6A 3Q23A 2KBNA 4AQYL 3BVZA 2B29A 5G3LD 2VUMB 2K75A 4AH6A 4MIUA 3RNUA 3HGBA 3S2HB 3TMEA 4DK3C 1IBLQ 4X3SA 2PPBC 2K33A 3X3MA 2WINB 2E8GA 1JR0D 1QVCA 4WFN3 1STGA 5FLXc 3HG9A 5JOBA 4JI4Q 2EY6A 1IKMA 3HOUH 2R7ZB 1IYJB 1YHBA 4DPGA 2H5XA 1E0BA 1TWGH 2JN4A 3ND8A 2A73B 3SEBA 2NWGA 1ILQA 3Q6SA 3HOZG 4YWLA 4IFDG 1CZWA 4GN4B 3T53B 2VB2X 4OELB 2OT2A 1YHQA 2RF4A 1TWFH 2SOBA 2XTIA 2TSSA 3M9BA 3A55A 1DZ1A 4JG2A 1G2TA 2GVBA 3EJIA 4UDUC 3U4VA 3J7YW 2N8NA 3E3XA 2Q2TA 4X6AH 2Q2UA 3ULPA 1IW7C 2JA9A 2KEEA 3PGZA 1G6PA 1CUKA 4RHSA 1VQDA 3OTOQ 1I4RA 2OTJA 4ILWA 2H4OA 4C3JB 1WYDA 2HCIA 1ZEQX 2F0NA 2BE5D 3R93A 2Z1CA 1VF5C 1B4OA 5C0XH 1FR3A 1LTID 5JEAJ 2B2TA 1Q8IA 1KNAA 2EOTA 4O0AA 4LK1C 2JA6G 3RZOB 4JI5Q 4KK7A 4DV7Q 4KD4A 4L63B 1Y8OB 3NTKA 4HJAA 3U4ZA 4X62Q 3WWVA 1D1IA 5AFWA 1SNOA 3F2CA 4HEDA 1C9OA 1QUQB 2EYJA 3DEPA 3RZDH 1EWHA 4BY1G 4A3GH 4OXPA 3VYSA 3J81i 2YTYA 1SYGA 1QVFA 1HH2P 2O4XA 1B3AA 2JQOA 5J22A 3FVQA 2ZXOA 3L9AX 4IJHA 1CA6A 1AN8A 2F52A 5M5XB 4BA2I 2VQEL 3D0FA 3S15H 1WTRA 1K73C 4JBJA 4A3EH 1WFQA 1ILPA 1Q82C 3KYHC 3KLRA 4PV1C 3FDTA 2F0KA 3GTGH 1V1PA 2A5HA 1F2YA 4V0BA 2Z4HA 4B3MQ 1MKHA 1I4XA 3Q0AA 4KHPL 5EKKA 2EYLA 3PO3B 4C56C 2B2UA 1FVIA 1U5KA 4WRDA 3NWSA 2PW7A 1KL9A 4GLAC 4C1NK 4J15A 2B2YA 4NMZA 4ZCKA 1L0WA 2D5DA 2F0MA 3HOXB 4ZUIA 2HD3A 3CCEA 3JAMc 4BY7G 4DR7L 2VNUD 4F7XA 2PCFB 2K32A 1Y14B 4LMQD 4UY8C 4B3RQ 2HIVA 2WAQE 1X3EA 2QDBA 2F0DA 2F3IA 1P8LA 1S5FD 1Z9FA 4B3SL 3K5OA 4GKJQ 2F1MA 3FMCA 4K6DA 4CJ0B 1E1OA 4OONA 2GVAA 3K5LA 1O7IA 3PUYA 1DOKA 4POGA 4POFA 3S16H 1GVPA 1WCMH 2AQ1B 1S5ED 2A6ED 2R61A 4JI8Q 5J39A 1C4QA 1PFNA 2HDLA 4RMFA 4ZK9B 4K8IA 5M9OA 2K04A 1X3PA 3QWNA 2A8VA 5E4XA 1PRTD 4DFAA 3MXNA 1OO9B 2JE6I 2JK8A 3GTKH 1PTOD 1TWCB 2IJ0A 3OHXC 3S24A 1X32A 5EBDA 1D5ZC 3EQLC 1GUWA 3TRZA 2X6LA 4J1MA 4IOCA 4K8JA 4JI3Q 4F88A 2UUAL 5BN3A 1EIGA 2WV6D 3HKZB 5C44G 2IX1A 4A3BH 4HR7B 3TZUA 3HP3A 3TZDA 3HOWH 4A3MH 3J81j 2EYPA 4HMJA 3BDCA 3OW2A 4N9TA 1T5XD 1B9MA 4RGOS 4XTCS 1QCBD 5CORA 3VR5A 4HCEA 2NVQH 3HOZB 4KKSA 1ENAA 2DY7A 5C3EG 1W6JA 2J7ZA 1PH3A 1LO5D 1SYBA 4DUYL 4K0KQ 3PUVA 1I94L 1GXDC 1F9SA 4JC0A 3S1NH 3GO5A 2Q8IB 5AJ3L 4JBMA 4NP5A 5M3FH 1Q86C 1JOOA 1STNA 4JOIA 2PI2E 4BXXG 1EEFD 2QDLA 3S17H 1A2UA 2AKWB 3K0XA 5C4JH 2HHHQ 1F2LA 4ME5A 1HR0Q 3R2TA 1TIID 3MHBA 2B2WC 1X3GA 3ER0A 1SNDA 3SHLA 1K83B 4A3KB 3QIAA 1BXTA 5BR8L 2LKVA 4X64L 1HNWQ 3AMUA 3GTLH 1N36L 4H44C 2KQ3A 3A8KE 1TWHH 1SFOH 1QZGA 5EPKA 3MXUA 3FPPA 3R8BA 3IAYA 2JA6B 2CHBD 5GAGC 2L55A 1VQIA 1QG7A 3EA6A 5IYDG 3J81c 4EQNA 4X3UA 1A3TA 3RLFA 1NAPA 1XNQQ 2ICIA 1TS4A 4OWXB 4DAPA 4IPDA 1Y1WH 1TS2A 1H9SA 4BY1B 2FFKB 1I6HH 3BVGA 5IGBA 1KTKA 3S14B 3DWPA 2IL8A 1HA6A 4XXEA 3H3VC 1H9JA 5H1SE 4P73A 3D31A 4DR6Q 2KJXA 4X65Q 4CHTB 3G6JB 2VW9A 5FK9C 1N32L 2WKDA 4PQXA 4N8FA 2OF1A 1IBLL 2KHSA 1TS5A 1X54A 5IP7G 1TY0A 1YNJD 5C0XJ 5ELOA 1J6QA 3HFZB 4U68A 4DV6Q 3W1BA 1KNEA 4NXMQ 4GLVB 4AQYQ 4JI4L 2F4IA 1SRUA 4ABNA 2AQ3B 2X69A 1BCPF 2PZUA 1QB5D 5IODA 2G9DA 2JYOA 4PZ7A 2IHFA 2E2IH 2VB3X 5C4XG 1WTQA 4BY7B 4CGYB 1BOSA 3WDNA 3H0GB 5EKLA 1HTPA 4LUOA 1EIHA 3BS1A 2HQEA 5I2XA 3MFGA 2K6AA 3OPOA 2R92G 4IQZA 3ZYYX 1CSQA 3J7A5 3NEMA 3K5NA 3PF4A 3S2HH 1J5EQ 1DGSA 2Q2HA 3TP7A 2LXJA 2BE5C 3CAMA 2E76C 4XYOA 1W6KA 2K01A 5I6WA 3I4MG 1KC8C 4UPAA 1EL0A 4G57A 2I0QA 4FF2A 2R7ZH 2CW0D 2JA5G 5ISRA 3NHHA 4HIMA 1E24A 4RCOA 3N6RA 3CMAA 2F4VQ 4X62L 1HTLD 5LMNW 3F2BA 1PYWD 3OOCA 2OEOA 1SYDA 3J80L 5C44B 4JI7L 1IL8A 2NB0A 5GROA 1FYCA 2ZTDA 2KA7A 2ZT9C 4HJ5A 3DM1A 1ET6A 1YJWA 1AFPA 2NN6G 1LTLA 2BDNA 4R4QA 1JWUD 5C3EB 3RN2A 2RKSA 1HUNA 3C1EA 2NYZD 4L5TA 2Z6KA 4LUZA 2CWAA 3LWUA 4ZKCB 1X6OA 3I4NG 3J7ZC 3I55A 5BN5A 3BJUA 5KNBA 4C3JH 2IT1A 3H6MA 4BA1I 2NVXB 1B50A 3LWEA 5JAVA 3M3YB 3U9OA 2F0UA 3MFYA 3RZOH 4DK0A 1PH7A 2MP1A 1EY6A 2JA7G 4Y52H 2XRQD 3BZDB 1ESRA 1GUOA 1GUGA 3CC4A 3VYRA 4XYQA 1C48A 1Q8KA 1KDAA 3TS2A 4CDDC 3DWQA 4HCSA 3CRKC 4OL7A 1KQSA 4KHPQ 2NZ1D 1V1PB 5KYLA 2Q8RE 4DUZL 2N49A 1ZKOA 4NB3A 5LL6X 5C5MA 4JI1L 5ELEA 1NR2A 1R4QB 1I4QA 4P74A 1HNXL 4HTHA 5EJWA 1U9RA 2A6EC 4BBSB 4DR7Q 5M5XH 4DGZA 2I5HA 5I9OA 4A3DG 3M4QA 3KBGA 2RDHA 4P71A 3M4OB 4JI8L 3VYUA 4OO1H 2OQKA 4JBKA 2LS01 1PRTC 2JEBI 4WJWA 4B3SQ 3OWEB 2FXQA 4ZRZA 1U4RA 4HIKA 2MQHA 4OEMB 4DNIA 4EQ5A 2Z8LA 3QOJA 3PO3H 1N34Q 1DOMA 1OXUA 1BBUA 4RGTA 2UUBL 1X9NA 4A3LG 4CJ1B 3UDIA 3HOXH 3TN2A 3WOEA 5EKIA 4HIOA 2N78A 1YITA 1KIXA 2L0CA 1K0SA 5IWAQ 3NE5B 2PZWA 2ZM6Q 2WB1E 5C4XB 2DUDA 2UUAQ 2CVRA 4K0KL 1GM5A 1H9RA 4B9XA 5IYBG 1EYDA 3BDLA 1P16A 2PO4A 2MGSA 3CQZB 2HHHL 1NBWA 1XMQQ 1UNSA 1HR0L 4WJ3M 3F2DA 4Q0FA 3KF6A 4RKLA 3RR5A 4CBVA 2R92B 1FGUA 1YVCA 5HGQA 1TWCH 4DUYQ 1DCZA 1A15A 4DNTB 1TS3A 3D8GA 2NBFA 5CGKA 1RL2A 2EZVA 1I94Q 4JCVE 3FRPB 4C3HG 4B3TQ 5FKAC 1QE6A 4A4IA 3I4MB 4JYAQ 2M2LA 3R2IA 3KLSA 1D1KA 4K5XA 2ZJQA 3NBIA 1E1TA 4JI2L 5EPLA 3CXCA 2LXKA 3NQIA 2EPBA 1HZ9A 4RH6A 1U4PA 2MJ8A 3TP8A 5I6YA 1KAAA 1IBMQ 4OWWB 1YNNC 4IUPA 4YY3Q 4AYBE 3AB9A 3SVMA 3HOZH 2VL6A 4IFDH 2MO0A 4R8IA 3AYHB 1PTOB 2ALYB 2J4XA 1NSNS 4GS3A 1N36Q 4UAIA 3K7AB 4AIMA 3RD4A 3S1QH 1BBXC 2XWJB 3CP0A 1H9MA 4C3IG 2B63H 2WFWA 4QY7A 1NTGA 4FDBA 3CMEA 1CHQD 3GTJB 5M5WB 3P75A 5D3IB 4OIKA 4ZAIA 5BN4A 2QGQA 3MXPA 2E2HH 2A69C 3GDEA 1VMPA 4KTAA 2XN9C 1B9NA 1YNJC 5IYCG 3JAMi 3MA2B 4G7ZC 1K83H 3NENA 3IL8A 5FLMH 1AEXA 3I4NB 4A3KH 4NKLA 4A3JG 1L1OA 4LF8Q 1H9SB 1VS0A 4DV6L 1G8ZD 3S2DH 5KEEA 1WD0A 4BBRG 1CQVA 4NXML 2SNSA 4FXKC 1O7ZA 4HN7A 1VQ9A 4GOPA 2UU9L 2JA6H 1N32Q 3T16A 1YIJA 2ATWA 1CSPA 1SYFA 3A5ZB 1V9PA 3O13A 2JA7B 1IXRA 4K5WA 1CKMA 5EAYA 1EZ8A 3C2PA 4BY1H 2FJ2A 3NQTA 2L11A 1NUCA 4YCUA 4E6IA 3S14H 1A6XA 3EFXD 3CC2A 4GKKQ 4MTNA 2DN8A 2LY7A 5K5PA 1N33L 3VA7A 2HT1A 1ML0D 3DWAA 1J5EL 3OIPA 3HOYG 2CCZA 1FNUA 1A63A 3KF8A 5JJLA 3B6YA 4A3DB 2F0WA 3PSIA 3MC0B 3I8ZA 2EXDA 1CTMA 2CW0C 1Y1VH 3L7ZC 3VR6A 1QNUA 1S72A 1JORA 3K6OA 1CKOA 3MEFA 3KFUA 3I7FA 4DU9A 4DN4M 1D5XC 1EYAA 1KABA 4ME3A 2F4VL 4R4TA 2RHSB 4LFAL 4CJ2C 2CFMA 4CDEC 1SNCA 3KJPA 3T4AC 4C2MB 1JWSD 1S40A 2JA8G 3M85A 5KYIA 4BY7H 3V96A 1E2VA 4KY6A 3H15A 3NBHA 3H0GH 2F0JA 3KLSX 4DR5L 4RG1A 1PFBA 1BF4A 1UE7A 1ONLA 1RF2D 2PZTA 3D4RA 3CPFA 2QILA 3KOJA 3J81L 1LTSD 4F8MA 3NTIA 4JI7Q 3D3RA 1VQCA 4HJ9A 5CV7A 1FL0A 5M5YB 1KHIA 2YV5A 1I6VC 4QUCA 4K6LA 1PH2A 2SNMA 4QUFA 1KRSA 1RD9D 1YI2A 3G48A 5E7NA 5IGGA 3BU2A 4H7BA 1ESFA 2B2VA 3NPPA 1PHJA 1RKNA 2BOSA 4JK1C 1WVLA 4PNYA 5M3MH 2R3ZA 3HKZE 3DXJC 1ET9A 4HMIA 4RFBA 3HOUG 4C3HB 3H3VH 5K36H 1LTTD 1B53A 5D3DA 3FHWA 2L9HA 5C44H 2CKZB 2GN5A 2IHEA 5CR3A 1NMFA 2NVYB 3J81E 4LNQA 5DEHA 1LYLA 1I4PA 1K0RA 4YCWA 1MIUA 4UP9A 5CBEE 4IURA 1KD1C 4JV5Q 4DAVA 4X3KA 5C3EH 1TR5A 2DJFC 3STBD 2MFIA 1XTCD 3HRZC 1LTBD 2K05A 4FF4A 1PZJD 4IUTA 4C3IB 3C46A 2A1AA 4R4IA 5ELCA 4DV4Q 4BXXH 4DUZQ 1I3QH 1HFNA 2Z4IA 4O2DA 4JI1Q 1FJGL 4JI6L 4KI0A 1SLJA 2DGYA 5DM63 3KJOA 2AWOA 1AZQA 1N34L 1HNXQ 3M3YH 5JJKA 3RLNA 2CQAA 1XPRA 2E2JB 5JPMC 4A3JB 3DHQA 3CKIB 1LT5D 1XPUA 4LF6L 3SXHA 1GKHA 2AHOB 3EBEA 2OTLA 4S3SA 4NXNQ 4KJNA 3SK8A 4IFDJ 4IUUA 2K4KA 2R7FA 4U673 4KLKA 4P2CB 4X66L 4DKAC 2FMCA 1EY7A 5IYDH 5IWAL 4Y7NB 2ZM6L 1JICA 2UUBQ 1GHKA 2C9OA 2N55A 3AQQA 1Z6HA 5ELNA 3KDFA 2V1CC 4BBSH 1DD2A 5ELBA 2QCPX 2ICEC 1GUSA 4LFBL 1S5BD 3M4OH 4GN3B 3PUWA 1XMQL 3S1RH 4DR3Q 1E7ZA 2RHQB 4KY7A 1K28A 4A3EG 1XNRQ 3VDYA 5IP7H 2ZXPA 4GNXA 1SROA 2KCTA 4FP5D 4B3TL 1OXSC 4A3FG 5IGDA 1B2TA 3OSOA 4G7OC 4JYAL 1RODA 3S1MB 4KY5A 2I07B 2F0SA 4QF4A 4HJ8A 2F3WA 4I65A 2HIXA 1DJRD 2L4NA 4DR1L 3CCLA 4FF1A 1Q46A 3PIP3 2HCCA 1K8MA 3A7AB 4EX5A 3TEHB 1IBML 2NZOA 1HQMC 4MHEA 1EUJA 2VXWA 4YY3L 5FJ8G 3U50C 3MWYW 2YTVA 1X3FA 5C4XH 3QB3A 3KLWA 5C0XI 2JA8B 4IPHA 2R93G 5IOCA 4JI2Q 1F9QA 2WIIB 4Q5VA 3H94A 2KENA 2Y0SG 1NY4A 1UUPA 1L0XB 3PIO3 3ULLA 3QR8A 3CQZH 3AEVA 1S5CD 3BDOA 3CW2C 2B8FA 2XVSA 3V2TA 1BQQT 2L12A 1WCMG 4OX9L 4O1NA 1LTRD 1JQYD 2F0TA 1TWAB 5E1FA 4LF8L 2F0OA 3I4MH 1VQ4A 3ZJYC 1XJVA 4HJ7A 2EXZA 3ND9A 1JB7A 3H3VI 1DONA 3HOVH 4A3BG 2Q8TA 3D4DA 1G291 1KRTA 3QJYA 2KCNA 2B2TC 4Z9CB 1PMRA 1FD7D 4QGUA 1PTOH 1HUMA 2A6HD 2E74C 2K5QA 4KN4C 5KRUA 2PMZB 3K7AH 3CCMA 4ODGA 1RTNA 3SK4A 2K5DA 1PZID 2C5CA 4I7ZC 2UU9Q 3GTQB 2OQ0A 2M9VA 5G3LF 2EJMA 3FKIH 3ONAB 4OIJA 3PMFA 1IYUA 2EVBA 3VR3A 5M5WH 1TWFB 4B08A 2NN6H 1YHAA 4GKKL 1PDQA 3A54A 4A93H 1F2ZA 5IGFA 1ASYA 1WTWA 1VQMA 2EJFC 2OXPA 3DLLA 4RKBA 1STYA 4QMGA 3CCQA 1ENCA 3GD7A 1GJXA 1OXTA 1STHA 3PUXA 1TKWB 5IE8A 2KECA 1FNVA 1Q81C 2UXDQ 3T51B 3K58A 2O5JC 3ITPA 3QG1A 1N33Q 2HUGA 2VUMH 4EQPA 1X65A 3NTHA 2VQFQ 1SJHD 4LWCA 1XXGA 3MXGA 2JXMB 1CI3M 4TKOB 2B2UC 4NPSA 2DY8A 2KHIA 2B2YC 1B1ZA 1D2BA 4LW1A 3K0YA 1JJ2A 1BVSA 1K3RA 5EGTA 1YEZA 1SE8A 4L5RC 4HAEA 3J7AV 5KIXA 1NMGA 2XSCA 3Q24A 4LFAQ 4KKUA 4DR2L 1AE3A 1LACA 1SN8A 3W5OA 4GLXA 2LSSA 1ASZA 1WTXA 3CRLC 4OWTB 4A76A 4J8QA 1LV9A 2PQAA 1AZPA 3Q8DA 2KUMA 1CFMA 4DR5Q 3NBHB 4XQNA 1SSOA 4XQJA 3CHBD 4DV5L 1Y69U 1F9PA 1EFWA 1MGSA 1BCPB 1B3QA 4A3EB 2YU9B 2RVLA 1BKBA 4L5SA 3BYTB 3NSWA 3OMCA 4A3FB 4A3LH 2CWPA 4C2MH 2UXCL 2IPKD 4CKCA 3SGIA 4ZLTF 3J80i 2AUJD 3F8TA 2KCCA 1II3A 1K9MC 5IT9c 3E5SA 4A3IG 5I2YA 5CYUA 4O42A 3OIQA 2ZTEA 3T1HL 4JV5L 3NWTA 3STBC 1BBWA 1ENFA 2QW7A 1A2TA 3IFDA 4RGNA 3E9IA 2R93B 5LMNQ 4MTKA 5IYBH 3ERSX 3I72A 1WTPA 1GO3E 1T5EA 4FXDA 2Y0SB 5LMUQ 1DOLA 2RQXA 5FLXL 4ZKBB 5M5YH 4DV4L 3NK9A 5CC4A 5EPJA 1U4LA 3D6WA 4LFCQ 4IZ8A 5IGEA 3GTMB 4XIGS 1MHWC 1Z47A 2K03A 3TS0A 3S16B 1WCMB 3W3AA 3TBIB 1YBYA 4DV3Q 4A3CH 1UE1A 1NE3A 4ALPA 4JOIC 5HGTA 1V43A 4FF3A 3PUZA 1BO0A 1S4ZA 5DAUA 2MPMA 1LTAD 1SMXA 1E3PA 4C3HH 4IPCA 5FO9B 3PCOB 2XWBB 4NXNL 1PTOC 1EWIA 1FJGQ 4PMCA 2EY1A 2YYZA 4JI6Q 2NVYH 5C3WA 3CCJA 3OW7A 5COYA 3ULJA 4AYBG 4LAAA 1Q7YC 2D9UA 5FLXE 1IBKQ 1I4GA 4LF6Q 4DA2A 1HCZA 2K1BA 3DM3A 3PIPA 4DV2Q 3GV3A 3G4SA 2R6GA 4ID6A 1F9RA 3KK7A 4PZ8A 4OHJA 3CCUA 1UEAB 3VA5A 2K52A 1PRTF 4X66Q 3CC7A 2F3VA 4DR3L 3E0EA 3MXNB 4L5QA 3T56B 2A19A 3K81C 1M90C 5IP9G 3SK5A 3RUZA 1XNRL 1JMCA 4C3JG 1R9TB 3PIOA 1CA5A 2E2JH 4A3JH 4LFBQ 3KDFB 4RWSC 2RSNA 3I4OA 1JE4A 2PNHA 1YJNA 1FNWA 1G91A 2QEJC 3SK6A 4DR4L 3CCRA 2D0OA 2J0TD 4CKBA 4DK1A 4M8AA 1K8AC 3GTOB 4ZQ3A 1B70B 3A8IE 3GP7A 3ERQA 5I9PA 2RA4A 2O2LD 4OGQC 2K5NA 3G6EA 1EYCA 5C4HA 3T13A 1Q12A 4P72A 3G7LA 5F2DA 1LT4D 3X3NA 2RCFA 1PH6A 5JEAG 3MTSA 4DR1Q 4YHHQ 2JA5B 3DEOA 3CPWA 4R1JA 2ENBA 1Q90A 1S5DD 3I2ZA 2I46A 3TSSA 4QIWB 1NNXA 4XT1B 5A2QL 1JJGA 2A68D 1TY2A 1G51A 3VR2A 2BA1A 4MZ9A 1WTVA 3EN2A 4KKTA 1V8QA 2AWNA 1JC7A 1JJCB 5D65A 3JAML 5CV6A 2NZHA 3PO3G 3S1MH 5FOBB 3PO2G 4ZYSA 4JBWA 1SEBD 1WJJA 3J80c 2F03A 2LMCB 3TP6A 1MD2D 5L37A 1VQJA 4OX9Q 3I91A 3WOFA 1AW7A 2V4DA 3IKJA 3VR4A 3UE1A 1XMOL 2A6HC 2F0PA 1VQLA 2PNRC 3P1HA 3ICEA 2UXBQ 3IRBA 4TRDA 3I73A 2F0VA 2EY5A 2IX0A 4KD3A 2E2IB 2Z6BA 5A2QE 3LNNA 4A3IB 1D5MC 3M7NA 1DYQA 2I5LX 5EQ0A 3TREA 3JAME 2E2DC 1STAA 2HDMA 1VDZA 2C35B 3F1ZA 3Q22A 1X56A 4LF9L 1SYEA 4BS9A 1SE3A 1H95A 2PI2A 2PQEA 2XNAC 5LHY1 1SE2A 1TWAH 3W1GA 1BCPD 3UI2A 1SXTA 1YJ9A 3I90A 2Z6KC 2UXDL 2CH4W 1HZCA 2B3GA 2F0QA 1CM9A 2B2WA 1B44D 4R4OA 3G71A 2CQOA 2VQFL 4FXGC 1IZ6A 3URYA 4LF4Q 1F2MA 3HKZG 4OO1I 1K8OA 1PH5A 4KMUC 2NVTB 1CKNA 5TSSA 1J9OA 3MEHA 4J6HA 1UWVA 4KV6A 2KEDA 2XGTA 4IN3A 4BWGB 4RHRA 3PV0A 1M8AA 3GTQH 1KLGD 2F0HA 1IL2A 2XIWA 1PZKD 1HA5A 1LT6D 4AYBB 5CMDA 2B63G 4X3TA 1SNQA 3T1YQ 1YZ6A 5FO7B 2K28A 4DAYA 2SDFA 1PXUA 3I70A 1A0IA 1ZYRD 1G2SA 2JJQA 3CCVA 4FNFA 2WAQG 1H9KA 2KOLA 1UAPA 1G6ZA 1R4PB 5NUCA 5FLMG 4HSVA 3CCSA 3E0JA 4A3KG 4YIJA 1W2BA 1Q3LA 4DR2Q 3K5MA 5JVG3 3HS0C 4IOAA 1VQNA 1YNXA 3HKSA 1SMYD 1E22A 2QEXA 2EY2A 3UDXA 2G5DA 4APVA 3L2PA 3EVQA 1JB3A 3GTPB 1Q1EA 4DV5Q 2PQAB 2VY3A 3TDQA 1XPOA 2TMPA 1EU4A 5D14A 4HIDA 1ZXTA 1MI2A 4ULLA 5ELDA 1EEID 1CT1D 3U58A 2E75C 3QOLA 4M1UB 4JI0Q 2L5TA 2KVMA 4DXFA 1EY9A 5JPNC 2I5MX 1EIYB 3CD6A 4QQBX 5LMNL 4KN7C 2UXCQ 2PW5A 1PV4A 2GA4B 4KHVA 4ZUJA 1OTCA 1BDOA 4QJFA 4F87A 5C3XA 5LMUL 1HNZL 3BVMA 2AUKA 4IFDI 3NP8A 1D7QA 4LFCL 3T1HQ 1O78A 1T9HA 5J1ZA 1XX8A 3P7JA 4DV3L 3LGJA 2D2CC 2DNCA 2ES2A 2YU9H 1Y1VG 2RDGA 3K80C 4G4KA 4WJ4A 1QILA 1HQRD 4A3FH 4YWKA 4DV1Q 3PO2B 1WTHA 3AFQA 1EY0A 1VCIA 3KUPA 4NW2A 2NVXH 1CK1A 3AU7A 1E2ZA 3RLOA 1CHPD 3E9HA 3M7GA 5DLQE 4TQUS 4YCVA 5FJ8H 5C0XG 5KNCA 4MN3A 1Q1BA 1CZGA 1EY4A 1IBKL 3H0GG 4BBRB 2R93H 4DV2L 3NXWA 3RMHA 1EY8A 1X55A 3BZKA 4QCLA 5DNFA 3CU7A 1SJED 1K8GA 1PH4A 3BYYB 3VYTA 4P75A 2CH4A 1I50B 1SAPA 4FO2A 5IY0A 1C8CA 3GTMH 4EGVA 4K5VA 4TSSA 4A3GG 2RSOA 4XQQA 2K5HA 2E5LL 1HR0W 1VQ7A 2IWHA 1WD1A 4PZ6A 1RJTA 5A35A 1PYSB 1QJOA 5M3MG 1SBBB 1Y8PB 5T1IA 2G9HD 1L1OC 4KHZA 5ELFA 4DK6C 3HOYB 5K36G 1L0YB 1K3BC 1EY5A 2PMZE 3LX0A 3KBXA 2B8GA 1KDCA 4GOPC 2RCNA 2DNEA 4PMWA 1WOCA 1X3QA 4L8JA 5CV4A 2Z9HA 2XRSD 4PMBA 3H91A 4UP7A 4DR4Q 4YHHL 1N9WA 2EE1A 2MUYA 3KF6B 4JPBW 4DAMA 3S9WA 4GN5A 3S1QB 5KGUA 2F0LA 3L0OA 1DXMA 2B63B 2A68C 1AP0A 5IT9L 3A8JE 1B8AA 3PF5A 1A3VA 1KLUD 4B9WA 1I5FA 1R9TH 1VMCA 2PYKA 5JVH3 2WAQB 2E2HB 2UUCQ 4R4CA 2P5ZX 3GTOH 1B7YB 1DM0B 2R92H 4UP8A 4DV0Q 3S2DB 1NCVA 4WORA 1TT2A 5GADC 1JCKB 1HJPA 2QF7A 4K14A 2UXBL 1SNPA 3MVVA 2L1BA 3TP5A 1EYGA 1PLFA 2IW3A 3K8AA 4PG3A 3GV6A 4CDFC 4JVZA 1GHJA 5IT9E 4EQOA 1I4HA 2JA5H 1ICWA 3E6ZX 1YNND 1MJEA 5LL6S 4BBSG 1XMOQ 3HOWG 1XWEA 3HOUB 3W2DA 4IUVA 4A3MG 1SDFA 3TQYA 1TWGB 2BH8A 1A8VA 3R3OA 2EYFA 1N8RC 2F0GA 1BNZA 1FGBD 5FO8B 1BCPC 4A75A 1L1OB 2NTSA 2A74C 4LF7Q 3A74A 2ZJRA 1C7YA 1EOVA 3GTJH 5E3FA 3A5UA 4GOPB 1UE6A 2A69D 3EROA 1LABA 4LF5Q 2FINB 4RAUC 1EFID 4FVMA 5M3FG 3FPUB 1VQPA 1Y1VB 4LF4L 4LF9Q 1PH8A 1JT8A 3I4NH 1LTGD 1VQEA 2L15A 1VQ6A 2VZAA 3I56A 5GAEC 2B2VC 3SE0A 1HXYD 2AMCB 3I3CA 3QO2A 3P20A 1O7YA 1MSHA 1MBYA 4A3IH 1TQOA 1L2FA 1RHPA 4R8NA 4NDXA 4DF7A 2OWOA 2JA7H 1XTDA 1QZHA 3T1YL 1SYCA 3KF8B 2Y0SE 1ZYRC 4IUNA 2ZXRA 3D4WA 5IIFA 1CKNB 4H02A 1Y1WG 3NELA 4RGMA 3RZDB 3OTOL 1SMYC 1AE2A 4A3GB 2ZTCA 3J7AF 1GUTA 1JOQA 2K5VA 1TXYA 4CDCC 4IPGA 3OMGA 4DAYB 4A3DH 3GQBA 2NVTH 3NUCA 1BR9A 3K59A 1HFGA 4JI5L 4DV7L 3M4YA 1IW7D 1STBA 3MZ5A 5M3MB 4R9WA 1PFMA 3A7LA 3HOVG 2EYHA 1QUQA 3S15B 2QKIC 1Z7TA 1IKLA 2OCEA 5CV5A 1U4MA 1O80A 3OYYA 3GTGB 4JI0L 2EIFA 4QL5A 4IO9A 4DNRB 1EOTA 3SDZA 3FKIG 2D62A 4JW0A 4UHVA 1LUZA 4G7HC 1PH1A 2BH2A 1S3OA 4C1NI 2F0IA 2RDFA 4A93G 1VQHA 1KDBA 4EVOA 3C1FA 5GQOA 1SE4A 1WI5A 2R7DA 1GUNA 2WB1G 2KHJA 5IP9H 4RA8A 1TVXA 1KXLA 1ICFB 4XDXA 1PH9A 1PYBA 2H1EA 3DUZA 2B39A 3EIVA 5CV8A 3FP9A 1I3QB 5JJZA 2HQLA
chains in the Genus database with same CATH topology
1A3UA 2NTTA 2WACA 2EJGC 4QB4A 3I4LA 4IUQA 1JOKA 3J80E 2BA0A 5I4DA 2EYMA 4K2KA 3V05A 2LFNA 2M00A 2SEBD 1HHVA 3GTKB 1M4VA 2WKCA 1STEA 5JEAH 3L3OC 2N88A 1BUVT 1EQVA 2O5IC 3MAQA 4A3BB 3HOWB 3FEWX 4A3MB 5HURA 1EWCA 2JP1A 3OWFA 1WTOA 3S1RB 2NVQB 4FYDA 3D6CA 1MSGA 2NN6I 2RBMA 1HPCA 3K57A 1RDPD 5CBAE 1O7LA 1PTOF 2IX3A 1LT3D 2K7VA 3S1NB 1J8IA 5M3FB 4H13C 4V190 3S17B 5C4JB 4RCNA 1EQTA 3IFTA 4HSPA 3U9SA 5KNDA 4H0LC 2WP8J 4LJZC 1EZ6A 1OXVA 1F77A 3GTLB 2NUCA 1CQFA 3SR1A 4DXGA 2ID0A 1TWHB 1SFOB 1IYVA 5T1GA 4IALA 1HRJA 2JSOA 1RTOA 5IGCA 1QNKA 1JWMD 4KJOA 4K2LA 1Y1WB 1OXXK 2BDOA 2EDGA 2FMMA 3HZXA 1SNMA 5C4ZA 3A56A 2JEAI 1I6HB 4XT3B 4OO1G 1RCVD 5C5LA 3DMUA 1D6EC 2K5WA 1LLRD 1Y8NB 5E4WC 3N52A 3C3LA 1TU2B 1VF7A 3HOVB 2X6GA 1PRTB 1QOHA 2FHTA 5EBCA 2MHVA 1IHZA 1GOZA 2F0EA 4CKEA 1E2WA 1QWYA 3H09A 5CV9A 5C6AA 2F0FA 3FKIB 3F2UA 1XYIA 4L6TB 1NR4A 3HEJA 4GZYC 2BCOA 4A93B 1V1OA 2EYOA 5DM73 2WB1B 3BG3A 4N9PA 1EU3A 2AQ2B 3Q23A 3BVZA 5G3LD 2VUMB 4MIUA 3HGBA 3S2HB 3TMEA 4X3SA 2PPBC 2K33A 3X3MA 2WINB 1JR0D 4WFN3 1STGA 3HG9A 5JOBA 2EY6A 1IKMA 2R7ZB 1E0BA 3ND8A 2A73B 3SEBA 2NWGA 1ILQA 3Q6SA 4IFDG 1CZWA 3T53B 2VB2X 2OT2A 2SOBA 2TSSA 3A55A 1DZ1A 1G2TA 3EJIA 4UDUC 3J7YW 1IW7C 2KEEA 4RHSA 1I4RA 4ILWA 2H4OA 4C3JB 2HCIA 1ZEQX 2F0NA 2BE5D 3R93A 2Z1CA 1VF5C 1B4OA 5C0XH 1FR3A 1LTID 5JEAJ 2B2TA 1Q8IA 1KNAA 2EOTA 4LK1C 3RZOB 4KK7A 4KD4A 4L63B 1Y8OB 3NTKA 1D1IA 5AFWA 1SNOA 4HEDA 2EYJA 3DEPA 1EWHA 3VYSA 1SYGA 2O4XA 1B3AA 5J22A 3FVQA 2ZXOA 3L9AX 1CA6A 1AN8A 5M5XB 4BA2I 1WTRA 1ILPA 3KLRA 4PV1C 3FDTA 2F0KA 1V1PA 2A5HA 1F2YA 4V0BA 2Z4HA 1I4XA 3Q0AA 5EKKA 2EYLA 3PO3B 4C56C 2B2UA 4WRDA 3NWSA 2PW7A 4C1NK 2B2YA 4NMZA 2D5DA 2F0MA 3HOXB 4ZUIA 2VNUD 4F7XA 2PCFB 2K32A 4LMQD 2QDBA 2F0DA 1S5FD 3K5OA 2F1MA 3FMCA 4K6DA 4CJ0B 3K5LA 3PUYA 1DOKA 2AQ1B 1S5ED 2A6ED 2R61A 5J39A 1C4QA 1PFNA 2HDLA 4ZK9B 4K8IA 5M9OA 2K04A 1X3PA 3QWNA 5E4XA 4DFAA 1PRTD 3MXNA 1OO9B 2JE6I 1PTOD 1TWCB 2IJ0A 3OHXC 1X32A 5EBDA 1D5ZC 3EQLC 1GUWA 2X6LA 4J1MA 4K8JA 4F88A 5BN3A 1EIGA 2WV6D 3HKZB 2IX1A 4HR7B 3TZUA 3HP3A 3TZDA 2EYPA 4HMJA 3BDCA 4N9TA 1T5XD 1B9MA 4RGOS 4XTCS 1QCBD 5CORA 3VR5A 4HCEA 3HOZB 4KKSA 1ENAA 2DY7A 1W6JA 2J7ZA 1LO5D 1SYBA 3PUVA 1GXDC 1F9SA 2Q8IB 3GO5A 4NP5A 1JOOA 1STNA 1EEFD 1A2UA 1F2LA 4ME5A 3R2TA 1TIID 3MHBA 2B2WC 1SNDA 3SHLA 1K83B 4A3KB 3QIAA 1BXTA 2LKVA 3AMUA 4H44C 2KQ3A 3A8KE 5EPKA 3MXUA 3FPPA 3R8BA 3IAYA 2JA6B 2CHBD 2L55A 3EA6A 1QG7A 4EQNA 4X3UA 1A3TA 3RLFA 1NAPA 2ICIA 1TS4A 4DAPA 1TS2A 1H9SA 4BY1B 2FFKB 3BVGA 5IGBA 1KTKA 3S14B 3DWPA 2IL8A 1HA6A 4XXEA 3H3VC 1H9JA 3D31A 2KJXA 4CHTB 3G6JB 5FK9C 2WKDA 4PQXA 2OF1A 2KHSA 1TS5A 1TY0A 1YNJD 5C0XJ 4U68A 1KNEA 2F4IA 4ABNA 2AQ3B 2X69A 1BCPF 2PZUA 1QB5D 5IODA 2G9DA 2JYOA 2VB3X 1WTQA 4BY7B 4CGYB 1BOSA 3WDNA 3H0GB 5EKLA 1HTPA 1EIHA 3BS1A 2HQEA 5I2XA 3MFGA 2K6AA 3OPOA 4IQZA 3ZYYX 3K5NA 3TP7A 2BE5C 2E76C 4XYOA 1W6KA 2K01A 5I6WA 1EL0A 4G57A 4FF2A 2CW0D 5ISRA 3NHHA 4RCOA 3N6RA 1HTLD 1PYWD 3OOCA 2OEOA 1SYDA 3J80L 5C44B 1IL8A 2NB0A 1FYCA 2KA7A 2ZT9C 3DM1A 1ET6A 1AFPA 2NN6G 2BDNA 1JWUD 5C3EB 2RKSA 1HUNA 3C1EA 2NYZD 3LWUA 4ZKCB 5BN5A 5KNBA 2IT1A 3H6MA 4BA1I 2NVXB 1B50A 3LWEA 5JAVA 3M3YB 3U9OA 2F0UA 3MFYA 4DK0A 2MP1A 1EY6A 2XRQD 3BZDB 1ESRA 1GUOA 1GUGA 3VYRA 4XYQA 1C48A 1KDAA 3DWQA 4HCSA 3CRKC 4OL7A 2NZ1D 1V1PB 5KYLA 2Q8RE 1ZKOA 5LL6X 5C5MA 5ELEA 1NR2A 1R4QB 1I4QA 4HTHA 5EJWA 1U9RA 2A6EC 4BBSB 4DGZA 5I9OA 3KBGA 2RDHA 3M4OB 3VYUA 4OO1H 2LS01 1PRTC 2JEBI 4WJWA 3OWEB 4ZRZA 1U4RA 2Z8LA 3QOJA 1DOMA 1OXUA 4RGTA 4CJ1B 3TN2A 3WOEA 5EKIA 2L0CA 3NE5B 2PZWA 5C4XB 2CVRA 1H9RA 4B9XA 1EYDA 3BDLA 2PO4A 2MGSA 3CQZB 1UNSA 4Q0FA 4RKLA 4CBVA 2R92B 1DCZA 1A15A 4DNTB 1TS3A 3D8GA 2NBFA 5CGKA 2EZVA 4C3HG 3FRPB 5FKAC 1QE6A 3I4MB 2M2LA 3R2IA 3KLSA 1D1KA 4K5XA 3NBIA 5EPLA 3NQIA 2EPBA 4RH6A 1U4PA 2MJ8A 3TP8A 5I6YA 1KAAA 1YNNC 4IUPA 3AB9A 3SVMA 4IFDH 4R8IA 1PTOB 2J4XA 1NSNS 4UAIA 3K7AB 3RD4A 1BBXC 2XWJB 1H9MA 4C3IG 1CHQD 3GTJB 5M5WB 3P75A 5D3IB 4OIKA 4ZAIA 5BN4A 3MXPA 2A69C 1VMPA 4KTAA 2XN9C 1B9NA 1YNJC 4G7ZC 3MA2B 3IL8A 1AEXA 3I4NB 4NKLA 1H9SB 1G8ZD 5KEEA 1WD0A 1CQVA 2SNSA 4FXKC 1O7ZA 4HN7A 3T16A 1SYFA 3O13A 2JA7B 4K5WA 1EZ8A 3C2PA 2FJ2A 3NQTA 2L11A 1NUCA 4E6IA 1A6XA 3EFXD 2DN8A 2LY7A 5K5PA 3VA7A 1ML0D 3DWAA 3OIPA 1FNUA 3KF8A 4A3DB 2F0WA 3MC0B 3I8ZA 1CTMA 2CW0C 3L7ZC 3VR6A 1QNUA 1JORA 3K6OA 4DU9A 4DN4M 1D5XC 1EYAA 1KABA 4CJ2C 1SNCA 3T4AC 4C2MB 1JWSD 3M85A 5KYIA 3V96A 1E2VA 4KY6A 3NBHA 2F0JA 3KLSX 1PFBA 1BF4A 1ONLA 1RF2D 2PZTA 3D4RA 2QILA 3J81L 1LTSD 4F8MA 3NTIA 3D3RA 5CV7A 5M5YB 1I6VC 4QUCA 4K6LA 2SNMA 4QUFA 1RD9D 5IGGA 4H7BA 1ESFA 2B2VA 3NPPA 1RKNA 2BOSA 4JK1C 1WVLA 4PNYA 2R3ZA 3DXJC 1ET9A 4HMIA 4RFBA 4C3HB 5K36H 1LTTD 1B53A 5D3DA 2L9HA 5CR3A 2NVYB 3J81E 5DEHA 1I4PA 5CBEE 4IURA 4DAVA 4X3KA 1TR5A 1XTCD 3HRZC 1LTBD 2K05A 4FF4A 1PZJD 4IUTA 4C3IB 3C46A 5ELCA 1HFNA 2Z4IA 4KI0A 5DM63 1AZQA 2AWOA 2CQAA 2E2JB 5JPMC 4A3JB 3DHQA 3CKIB 1LT5D 3SXHA 4S3SA 4KJNA 3SK8A 4IFDJ 4IUUA 4U673 4P2CB 2FMCA 1EY7A 4Y7NB 1JICA 1GHKA 2C9OA 2N55A 1Z6HA 1DD2A 5ELBA 2QCPX 2ICEC 1GUSA 1S5BD 3PUWA 4KY7A 2ZXPA 4FP5D 1OXSC 5IGDA 1B2TA 3OSOA 4G7OC 1RODA 3S1MB 4KY5A 2I07B 2F0SA 4QF4A 2F3WA 4I65A 1DJRD 2L4NA 4FF1A 3PIP3 2HCCA 1K8MA 3A7AB 1HQMC 4MHEA 2VXWA 3MWYW 3QB3A 5C0XI 2JA8B 5IOCA 1F9QA 2WIIB 4Q5VA 3H94A 1UUPA 1L0XB 3PIO3 1S5CD 3BDOA 2B8FA 2XVSA 3V2TA 1BQQT 2L12A 4O1NA 1LTRD 1JQYD 2F0TA 1TWAB 5E1FA 2F0OA 2EXZA 3ND9A 1DONA 2Q8TA 3D4DA 1G291 3QJYA 2KCNA 2B2TC 4Z9CB 1PMRA 1FD7D 1PTOH 1HUMA 5KRUA 2A6HD 2E74C 2K5QA 4KN4C 2PMZB 4ODGA 1RTNA 3SK4A 2K5DA 1PZID 2C5CA 4I7ZC 3GTQB 2M9VA 5G3LF 2EJMA 3ONAB 4OIJA 3PMFA 1IYUA 2EVBA 3VR3A 1TWFB 4B08A 2NN6H 1PDQA 3A54A 1F2ZA 5IGFA 1WTWA 2EJFC 2OXPA 4RKBA 1STYA 4QMGA 1ENCA 3GD7A 1GJXA 1OXTA 1STHA 3PUXA 1TKWB 2KECA 1FNVA 3T51B 3K58A 2O5JC 3ITPA 3QG1A 2HUGA 4EQPA 3NTHA 1SJHD 1XXGA 3MXGA 2JXMB 1CI3M 4TKOB 2B2UC 2DY8A 2B2YC 1B1ZA 1D2BA 3K0YA 5EGTA 4HAEA 3J7AV 5KIXA 2XSCA 3Q24A 4KKUA 1LACA 1WTXA 3CRLC 4J8QA 1LV9A 1AZPA 2KUMA 1CFMA 4XQNA 1SSOA 4XQJA 3CHBD 1Y69U 1F9PA 1MGSA 1BCPB 4A3EB 2YU9B 2RVLA 3BYTB 3NSWA 3OMCA 4A3FB 2IPKD 4CKCA 4ZLTF 2AUJD 2KCCA 1II3A 3E5SA 5I2YA 5CYUA 4O42A 3OIQA 3NWTA 1ENFA 1A2TA 3IFDA 4RGNA 2R93B 3I72A 1WTPA 1T5EA 4FXDA 2Y0SB 1DOLA 2RQXA 5FLXL 4ZKBB 3NK9A 5CC4A 5EPJA 1U4LA 3D6WA 4IZ8A 5IGEA 3GTMB 4XIGS 1Z47A 2K03A 3S16B 1WCMB 3W3AA 3TBIB 5HGTA 1V43A 4FF3A 3PUZA 1BO0A 1S4ZA 5DAUA 2MPMA 1LTAD 5FO9B 2XWBB 1PTOC 4PMCA 2EY1A 2YYZA 5C3WA 3OW7A 5COYA 4LAAA 2D9UA 5FLXE 1I4GA 4DA2A 1HCZA 2K1BA 3GV3A 2R6GA 4ID6A 1F9RA 3KK7A 4OHJA 1UEAB 3VA5A 1PRTF 2F3VA 3T56B 3SK5A 3RUZA 4C3JG 1R9TB 1CA5A 4RWSC 2RSNA 1JE4A 1FNWA 1G91A 2QEJC 3SK6A 2J0TD 3GTOB 4CKBA 4DK1A 4M8AA 4ZQ3A 3A8IE 3GP7A 3ERQA 5I9PA 2RA4A 2O2LD 4OGQC 1EYCA 5C4HA 3T13A 1Q12A 3G7LA 5F2DA 1LT4D 3X3NA 5JEAG 3MTSA 2JA5B 3DEOA 2ENBA 1Q90A 1S5DD 2I46A 3TSSA 4QIWB 4XT1B 5A2QL 2A68D 1TY2A 3VR2A 2BA1A 1WTVA 4KKTA 1V8QA 2AWNA 1JC7A 5D65A 3JAML 5CV6A 5FOBB 4ZYSA 4JBWA 1SEBD 2F03A 2LMCB 3TP6A 1MD2D 3I91A 3WOFA 1AW7A 2V4DA 3IKJA 3VR4A 2A6HC 2F0PA 2PNRC 3P1HA 4TRDA 3I73A 2F0VA 2EY5A 2IX0A 4KD3A 2E2IB 5A2QE 3LNNA 4A3IB 1D5MC 3M7NA 1DYQA 5EQ0A 3JAME 2E2DC 1STAA 2HDMA 1VDZA 3Q22A 1SYEA 4BS9A 1SE3A 2PQEA 2XNAC 5LHY1 1SE2A 1BCPD 3UI2A 1SXTA 3I90A 2F0QA 1CM9A 2B2WA 1B44D 4FXGC 3URYA 1F2MA 4OO1I 1K8OA 4KMUC 2NVTB 5TSSA 1J9OA 3MEHA 4J6HA 4KV6A 2KEDA 4IN3A 4BWGB 4RHRA 3PV0A 1M8AA 1KLGD 2F0HA 2XIWA 1PZKD 1HA5A 1LT6D 4AYBB 5CMDA 4X3TA 1SNQA 5FO7B 2K28A 4DAYA 2SDFA 1PXUA 3I70A 1ZYRD 1G2SA 4FNFA 1H9KA 2KOLA 1UAPA 1G6ZA 1R4PB 5NUCA 4HSVA 3E0JA 4YIJA 1Q3LA 3K5MA 5JVG3 3HS0C 1SMYD 2EY2A 3EVQA 1JB3A 3GTPB 1Q1EA 3TDQA 2TMPA 1EU4A 5D14A 1ZXTA 1MI2A 4ULLA 5ELDA 1EEID 1CT1D 2E75C 3QOLA 4M1UB 2L5TA 2KVMA 4DXFA 1EY9A 5JPNC 4KN7C 2PW5A 2GA4B 4KHVA 4ZUJA 1BDOA 4F87A 5C3XA 3BVMA 2AUKA 4IFDI 3NP8A 1O78A 5J1ZA 1XX8A 3P7JA 2D2CC 2DNCA 2RDGA 4G4KA 1QILA 1HQRD 3PO2B 1EY0A 1VCIA 3KUPA 4NW2A 1CK1A 3AU7A 1E2ZA 1CHPD 3M7GA 4TQUS 5C0XG 5KNCA 4MN3A 1Q1BA 1CZGA 1EY4A 4BBRB 3NXWA 3RMHA 1EY8A 4QCLA 5DNFA 3CU7A 1SJED 3BYYB 3VYTA 1I50B 1SAPA 4FO2A 1C8CA 4EGVA 4K5VA 4TSSA 2RSOA 4XQQA 2IWHA 1WD1A 1RJTA 5A35A 1QJOA 1SBBB 1Y8PB 5T1IA 2G9HD 3HOYB 4KHZA 5ELFA 5K36G 1L0YB 1EY5A 3LX0A 3KBXA 2B8GA 1KDCA 2DNEA 4PMWA 1X3QA 4L8JA 5CV4A 2XRSD 4PMBA 3H91A 2EE1A 2MUYA 3S9WA 3S1QB 5KGUA 2F0LA 1DXMA 2B63B 2A68C 1AP0A 5IT9L 3A8JE 1A3VA 1KLUD 4B9WA 1VMCA 2PYKA 5JVH3 2WAQB 2E2HB 1DM0B 3S2DB 1NCVA 4WORA 1TT2A 1JCKB 2QF7A 4K14A 1SNPA 3MVVA 2L1BA 3TP5A 1PLFA 2IW3A 3GV6A 1GHJA 5IT9E 4EQOA 1I4HA 1ICWA 3E6ZX 1YNND 5LL6S 1XWEA 3HOUB 3W2DA 4IUVA 1SDFA 1TWGB 1BNZA 3R3OA 2EYFA 2F0GA 1FGBD 5FO8B 1BCPC 2NTSA 2A74C 5E3FA 2A69D 3EROA 1LABA 2FINB 4RAUC 1EFID 4FVMA 3FPUB 1Y1VB 1LTGD 2B2VC 3SE0A 1HXYD 3I3CA 3QO2A 3P20A 1O7YA 1MSHA 1MBYA 1TQOA 1RHPA 4R8NA 4NDXA 4DF7A 1SYCA 1ZYRC 4IUNA 2ZXRA 3D4WA 5IIFA 4RGMA 3RZDB 1SMYC 4A3GB 3J7AF 1GUTA 1JOQA 3OMGA 3GQBA 3NUCA 1BR9A 3K59A 1HFGA 3M4YA 1IW7D 1STBA 3MZ5A 5M3MB 4R9WA 1PFMA 3A7LA 2EYHA 3S15B 2QKIC 1Z7TA 1IKLA 5CV5A 1U4MA 1O80A 3GTGB 4DNRB 1EOTA 3SDZA 2D62A 4G7HC 4C1NI 2F0IA 2RDFA 1KDBA 4EVOA 3C1FA 1SE4A 1GUNA 4RA8A 1TVXA 4XDXA 2H1EA 3DUZA 2B39A 5CV8A 1I3QB 5JJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXM B;  1HQM C;  3FMC A;  2V4D A;  2ZT9 C;  1CI3 M;  1H9S A;  2YYZ A;  3IKJ A;  3VR4 A;  2A6H C;  3NE5 B;  1Y8P B;  4TKO B;  2JEA I;  2EJG C;  1Q1E A;  3I4L A;  2PNR C;  4KHZ A;  2NN6 G;  2BA0 A;  5K36 G;  4OO1 G;  3OW7 A;  3PUY A;  1IW7 C;  3I73 A;  1H9R A;  2B8G A;  3SE0 A;  1H9J A;  2A6E D;  3H94 A;  2KA7 A;  1A6X A;  2DNE A;  1HCZ A;  1Y8N B;  3D31 A;  3LWU A;  2E75 C;  4L8J A;  2DN8 A;  2L5T A;  4KKU A;  2R6G A;  3LNN A;  3VA7 A;  3M7N A;  1TU2 B;  1LAC A;  3BDO A;  1VF7 A;  2B8F A;  3P20 A;  5BN5 A;  5KNB A;  2BE5 D;  2JE6 I;  3CRL C;  4KN7 C;  1VF5 C;  5C0X H;  1FR3 A;  5JEA H;  1ZYR C;  1BDO A;  2IT1 A;  1VDZ A;  1DCZ A;  4BA1 I;  1CTM A;  3EQL C;  4LK1 C;  3T56 B;  4DNT B;  1DXM A;  1E2W A;  2AUK A;  2A68 C;  2CW0 C;  4KI0 A;  1CFM A;  2O5I C;  3L7Z C;  3A8J E;  3MFY A;  2AWO A;  3VR6 A;  5BN3 A;  4DK0 A;  1O78 A;  1Y8O B;  1Y69 U;  4HR7 B;  3TZU A;  1GUO A;  1GUG A;  4GZY C;  2D2C C;  2DNC A;  1SMY C;  1EWH A;  1B9M A;  3ND9 A;  4XTC S;  3CRK C;  1GUT A;  1YNN C;  3VR5 A;  4KKS A;  4DK1 A;  3AB9 A;  4IFD H;  2BDO A;  2NN6 I;  3M85 A;  3A8I E;  1HPC A;  1G29 1;  1K8O A;  1E2V A;  3QJY A;  4KMU C;  3WDN A;  1ZKO A;  3BG3 A;  1PMR A;  1O7L A;  1VCI A;  2AUJ D;  3GQB A;  2A6H D;  2KCC A;  2E74 C;  4KN4 C;  1HTP A;  4OGQ C;  3PUV A;  1GHK A;  2K7V A;  1H9M A;  1E2Z A;  2QF7 A;  1OXX K;  3M4Y A;  1IW7 D;  1Q12 A;  4H13 C;  4I7Z C;  3A7L A;  2A6E C;  2Q8I B;  1Z6H A;  4BA2 I;  3OPO A;  3PV0 A;  4TQU S;  4RCN A;  2EJM A;  4IQZ A;  1DD2 A;  3HGB A;  1ONL A;  5C0X G;  5KNC A;  3D4R A;  1Q1B A;  1IYU A;  2EVB A;  5JEA G;  3VR3 A;  5BN4 A;  1Z7T A;  1GUS A;  2NN6 H;  3IFT A;  2K33 A;  2PPB C;  4OO1 H;  1GHJ A;  3U9S A;  5KND A;  2A69 C;  2JEB I;  3KLR A;  4H0L C;  4PV1 C;  2BE5 C;  3I72 A;  3PUW A;  1T5E A;  4LJZ C;  2E76 C;  1B9N A;  1YNJ C;  4DNR B;  4G7Z C;  1Q90 A;  3SDZ A;  1OXV A;  1I6V C;  3QIA A;  2D62 A;  2EJF C;  4G7H C;  1H9S B;  1OXU A;  4H44 C;  4XIG S;  2A68 D;  3GD7 A;  1H9K A;  3VR2 A;  1GJX A;  2BA1 A;  3ND8 A;  3W3A A;  1OXT A;  3A8K E;  1IYV A;  2D5D A;  4KKT A;  3PUX A;  1TKW B;  1V8Q A;  4JK1 C;  3MXU A;  1OXS C;  4IFD G;  3FPP A;  3T51 B;  3T53 B;  3N6R A;  4G7O C;  2O5J C;  3DXJ C;  3QG1 A;  2PCF B;  1V43 A;  1GUN A;  3PUZ A;  2K32 A;  4JBW A;  3OOC A;  5K36 H;  2A69 D;  1LAB A;  2LMC B;  1K8M A;  3A7A B;  3RLF A;  5A35 A;  1FYC A;  1QJO A;  2EDG A;  2F1M A; 
#chains in the Genus database with same CATH topology
 1A3U A;  2EQS A;  2NTT A;  1HNZ Q;  4B3M L;  2VUM G;  4DV1 L;  2WAC A;  3GTP H;  2EJG C;  4QB4 A;  3I4L A;  4IUQ A;  1JOK A;  3J80 E;  2BA0 A;  5I4D A;  2EYM A;  4K2K A;  2VQE Q;  3V05 A;  3K7U C;  2LFN A;  2M00 A;  4GNX C;  1EQQ A;  3CF5 A;  4N8X 1;  2SEB D;  1RIP A;  1VQA A;  2VS1 A;  4B3R L;  1HHV A;  2R7Z G;  1NJI C;  3GTK B;  1M4V A;  2K14 A;  1KAW A;  2WKC A;  1JE5 A;  1STE A;  2Q2I A;  5JEA H;  3L3O C;  4GKJ L;  2N88 A;  1BUV T;  1EQV A;  3A0J A;  3PQI A;  2O5I C;  1VQK A;  4QIW E;  3MAQ A;  1A62 A;  4A3B B;  1VQF A;  2K50 A;  3HOW B;  1W3S A;  3FEW X;  4A3M B;  5HUR A;  2MNA A;  1EWC A;  2JP1 A;  1VQG A;  3OWF A;  3BZC A;  1WTO A;  3S1R B;  4YWM A;  2NVQ B;  4FYD A;  4C3I H;  2DJG C;  3D6C A;  1LM0 A;  1MSG A;  2NN6 I;  2RBM A;  2YTX A;  1HPC A;  3JC6 6;  3K57 A;  1RDP D;  5CBA E;  1O7L A;  1PTO F;  3PO2 H;  1C0A A;  2IX3 A;  1LT3 D;  4JI3 L;  2K7V A;  2ZJP A;  3UDG A;  1M1K C;  3S1N B;  1J8I A;  5M3F B;  4H13 C;  4V19 0;  5IYC H;  2E5L Q;  3AFP A;  3S17 B;  5C4J B;  4RCN A;  1EQT A;  1MJC A;  3IFT A;  1PVO A;  4HSP A;  3U9S A;  5KND A;  4BBR H;  4H0L C;  5J3B A;  3RN5 A;  2WP8 J;  4I7A A;  1GD7 A;  4LJZ C;  1VQ8 A;  1EZ6 A;  2KCM A;  1SR3 A;  1OXV A;  3M4P A;  4MNO A;  1F77 A;  4LUV A;  3GTL B;  2NUC A;  1CQF A;  3SR1 A;  2N3S A;  4DXG A;  3UE0 A;  2ID0 A;  1PFS A;  1I50 H;  5HY6 A;  4Y7N H;  1TWH B;  1SFO B;  2D0P A;  1IYV A;  5T1G A;  4IAL A;  1HRJ A;  2JSO A;  1RTO A;  5IGC A;  4GNX B;  1QNK A;  1JWM D;  5GAH C;  2UUC L;  4KJO A;  4A3C G;  4K2L A;  1Y1W B;  3UDF A;  1OXX K;  2BDO A;  2EDG A;  2FMM A;  2Z0S A;  1SNM A;  3HZX A;  5C4Z A;  3A56 A;  2JEA I;  1VQO A;  1I6H B;  1HNW L;  4XT3 B;  4DV0 L;  4OO1 G;  1RCV D;  5AJ3 Q;  3HOY H;  5C5L A;  3DMU A;  2MO1 A;  1D6E C;  2K5W A;  4IJL A;  1HZB A;  1LLR D;  1Y8N B;  5E4W C;  3N52 A;  3C3L A;  1TU2 B;  1VF7 A;  3HOV B;  1D8L A;  2X6G A;  1UEB A;  1PRT B;  1QOH A;  5BR8 Q;  2FHT A;  5EBC A;  4X64 Q;  2MHV A;  5JJI A;  1IHZ A;  1XNQ L;  1GOZ A;  2F0E A;  4CKE A;  3HOX G;  2ASB A;  1AH9 A;  1E2W A;  1QWY A;  3H09 A;  5CV9 A;  1UE5 A;  5C6A A;  2F0F A;  3FKI B;  2JA8 H;  1VQB A;  3F2U A;  1XYI A;  4L6T B;  1NR4 A;  3HEJ A;  4LF7 L;  4GZY C;  2BCO A;  2IY5 B;  4DR6 L;  1V1Q A;  4A93 B;  4X65 L;  1U0L A;  1HZA A;  1V1O A;  2EYO A;  4TVA B;  1EQR A;  5DM7 3;  1QVG A;  1VQ5 A;  1EIF A;  4LF5 L;  2WB1 B;  3BG3 A;  2QA4 A;  4N9P A;  1EU3 A;  2AQ2 B;  1PA6 A;  3Q23 A;  2KBN A;  4AQY L;  3BVZ A;  2B29 A;  5G3L D;  2VUM B;  2K75 A;  4AH6 A;  4MIU A;  3RNU A;  3HGB A;  3S2H B;  3TME A;  4DK3 C;  1IBL Q;  4X3S A;  2PPB C;  2K33 A;  3X3M A;  2WIN B;  2E8G A;  1JR0 D;  1QVC A;  4WFN 3;  1STG A;  5FLX c;  3HG9 A;  5JOB A;  4JI4 Q;  2EY6 A;  1IKM A;  3HOU H;  2R7Z B;  1IYJ B;  1YHB A;  4DPG A;  2H5X A;  1E0B A;  1TWG H;  2JN4 A;  3ND8 A;  2A73 B;  3SEB A;  2NWG A;  1ILQ A;  3Q6S A;  3HOZ G;  4YWL A;  4IFD G;  1CZW A;  4GN4 B;  3T53 B;  2VB2 X;  4OEL B;  2OT2 A;  1YHQ A;  2RF4 A;  1TWF H;  2SOB A;  2XTI A;  2TSS A;  3M9B A;  3A55 A;  1DZ1 A;  4JG2 A;  1G2T A;  2GVB A;  3EJI A;  4UDU C;  3U4V A;  3J7Y W;  2N8N A;  3E3X A;  2Q2T A;  4X6A H;  2Q2U A;  3ULP A;  1IW7 C;  2JA9 A;  2KEE A;  3PGZ A;  1G6P A;  1CUK A;  4RHS A;  1VQD A;  3OTO Q;  1I4R A;  2OTJ A;  4ILW A;  2H4O A;  4C3J B;  1WYD A;  2HCI A;  1ZEQ X;  2F0N A;  2BE5 D;  3R93 A;  2Z1C A;  1VF5 C;  1B4O A;  5C0X H;  1FR3 A;  1LTI D;  5JEA J;  2B2T A;  1Q8I A;  1KNA A;  2EOT A;  4O0A A;  4LK1 C;  2JA6 G;  3RZO B;  4JI5 Q;  4KK7 A;  4DV7 Q;  4KD4 A;  4L63 B;  1Y8O B;  3NTK A;  4HJA A;  3U4Z A;  4X62 Q;  3WWV A;  1D1I A;  5AFW A;  1SNO A;  3F2C A;  4HED A;  1C9O A;  1QUQ B;  2EYJ A;  3DEP A;  3RZD H;  1EWH A;  4BY1 G;  4A3G H;  4OXP A;  3VYS A;  3J81 i;  2YTY A;  1SYG A;  1QVF A;  1HH2 P;  2O4X A;  1B3A A;  2JQO A;  5J22 A;  3FVQ A;  2ZXO A;  3L9A X;  4IJH A;  1CA6 A;  1AN8 A;  2F52 A;  5M5X B;  4BA2 I;  2VQE L;  3D0F A;  3S15 H;  1WTR A;  1K73 C;  4JBJ A;  4A3E H;  1WFQ A;  1ILP A;  1Q82 C;  3KYH C;  3KLR A;  4PV1 C;  3FDT A;  2F0K A;  3GTG H;  1V1P A;  2A5H A;  1F2Y A;  4V0B A;  2Z4H A;  4B3M Q;  1MKH A;  1I4X A;  3Q0A A;  4KHP L;  5EKK A;  2EYL A;  3PO3 B;  4C56 C;  2B2U A;  1FVI A;  1U5K A;  4WRD A;  3NWS A;  2PW7 A;  1KL9 A;  4GLA C;  4C1N K;  4J15 A;  2B2Y A;  4NMZ A;  4ZCK A;  1L0W A;  2D5D A;  2F0M A;  3HOX B;  4ZUI A;  2HD3 A;  3CCE A;  3JAM c;  4BY7 G;  4DR7 L;  2VNU D;  4F7X A;  2PCF B;  2K32 A;  1Y14 B;  4LMQ D;  4UY8 C;  4B3R Q;  2HIV A;  2WAQ E;  1X3E A;  2QDB A;  2F0D A;  2F3I A;  1P8L A;  1S5F D;  1Z9F A;  4B3S L;  3K5O A;  4GKJ Q;  2F1M A;  3FMC A;  4K6D A;  4CJ0 B;  1E1O A;  4OON A;  2GVA A;  3K5L A;  1O7I A;  3PUY A;  1DOK A;  4POG A;  4POF A;  3S16 H;  1GVP A;  1WCM H;  2AQ1 B;  1S5E D;  2A6E D;  2R61 A;  4JI8 Q;  5J39 A;  1C4Q A;  1PFN A;  2HDL A;  4RMF A;  4ZK9 B;  4K8I A;  5M9O A;  2K04 A;  1X3P A;  3QWN A;  2A8V A;  5E4X A;  1PRT D;  4DFA A;  3MXN A;  1OO9 B;  2JE6 I;  2JK8 A;  3GTK H;  1PTO D;  1TWC B;  2IJ0 A;  3OHX C;  3S24 A;  1X32 A;  5EBD A;  1D5Z C;  3EQL C;  1GUW A;  3TRZ A;  2X6L A;  4J1M A;  4IOC A;  4K8J A;  4JI3 Q;  4F88 A;  2UUA L;  5BN3 A;  1EIG A;  2WV6 D;  3HKZ B;  5C44 G;  2IX1 A;  4A3B H;  4HR7 B;  3TZU A;  3HP3 A;  3TZD A;  3HOW H;  4A3M H;  3J81 j;  2EYP A;  4HMJ A;  3BDC A;  3OW2 A;  4N9T A;  1T5X D;  1B9M A;  4RGO S;  4XTC S;  1QCB D;  5COR A;  3VR5 A;  4HCE A;  2NVQ H;  3HOZ B;  4KKS A;  1ENA A;  2DY7 A;  5C3E G;  1W6J A;  2J7Z A;  1PH3 A;  1LO5 D;  1SYB A;  4DUY L;  4K0K Q;  3PUV A;  1I94 L;  1GXD C;  1F9S A;  4JC0 A;  3S1N H;  3GO5 A;  2Q8I B;  5AJ3 L;  4JBM A;  4NP5 A;  5M3F H;  1Q86 C;  1JOO A;  1STN A;  4JOI A;  2PI2 E;  4BXX G;  1EEF D;  2QDL A;  3S17 H;  1A2U A;  2AKW B;  3K0X A;  5C4J H;  2HHH Q;  1F2L A;  4ME5 A;  1HR0 Q;  3R2T A;  1TII D;  3MHB A;  2B2W C;  1X3G A;  3ER0 A;  1SND A;  3SHL A;  1K83 B;  4A3K B;  3QIA A;  1BXT A;  5BR8 L;  2LKV A;  4X64 L;  1HNW Q;  3AMU A;  3GTL H;  1N36 L;  4H44 C;  2KQ3 A;  3A8K E;  1TWH H;  1SFO H;  1QZG A;  5EPK A;  3MXU A;  3FPP A;  3R8B A;  3IAY A;  2JA6 B;  2CHB D;  5GAG C;  2L55 A;  1VQI A;  1QG7 A;  3EA6 A;  5IYD G;  3J81 c;  4EQN A;  4X3U A;  1A3T A;  3RLF A;  1NAP A;  1XNQ Q;  2ICI A;  1TS4 A;  4OWX B;  4DAP A;  4IPD A;  1Y1W H;  1TS2 A;  1H9S A;  4BY1 B;  2FFK B;  1I6H H;  3BVG A;  5IGB A;  1KTK A;  3S14 B;  3DWP A;  2IL8 A;  1HA6 A;  4XXE A;  3H3V C;  1H9J A;  5H1S E;  4P73 A;  3D31 A;  4DR6 Q;  2KJX A;  4X65 Q;  4CHT B;  3G6J B;  2VW9 A;  5FK9 C;  1N32 L;  2WKD A;  4PQX A;  4N8F A;  2OF1 A;  1IBL L;  2KHS A;  1TS5 A;  1X54 A;  5IP7 G;  1TY0 A;  1YNJ D;  5C0X J;  5ELO A;  1J6Q A;  3HFZ B;  4U68 A;  4DV6 Q;  3W1B A;  1KNE A;  4NXM Q;  4GLV B;  4AQY Q;  4JI4 L;  2F4I A;  1SRU A;  4ABN A;  2AQ3 B;  2X69 A;  1BCP F;  2PZU A;  1QB5 D;  5IOD A;  2G9D A;  2JYO A;  4PZ7 A;  2IHF A;  2E2I H;  2VB3 X;  5C4X G;  1WTQ A;  4BY7 B;  4CGY B;  1BOS A;  3WDN A;  3H0G B;  5EKL A;  1HTP A;  4LUO A;  1EIH A;  3BS1 A;  2HQE A;  5I2X A;  3MFG A;  2K6A A;  3OPO A;  2R92 G;  4IQZ A;  3ZYY X;  1CSQ A;  3J7A 5;  3NEM A;  3K5N A;  3PF4 A;  3S2H H;  1J5E Q;  1DGS A;  2Q2H A;  3TP7 A;  2LXJ A;  2BE5 C;  3CAM A;  2E76 C;  4XYO A;  1W6K A;  2K01 A;  5I6W A;  3I4M G;  1KC8 C;  4UPA A;  1EL0 A;  4G57 A;  2I0Q A;  4FF2 A;  2R7Z H;  2CW0 D;  2JA5 G;  5ISR A;  3NHH A;  4HIM A;  1E24 A;  4RCO A;  3N6R A;  3CMA A;  2F4V Q;  4X62 L;  1HTL D;  5LMN W;  3F2B A;  1PYW D;  3OOC A;  2OEO A;  1SYD A;  3J80 L;  5C44 B;  4JI7 L;  1IL8 A;  2NB0 A;  5GRO A;  1FYC A;  2ZTD A;  2KA7 A;  2ZT9 C;  4HJ5 A;  3DM1 A;  1ET6 A;  1YJW A;  1AFP A;  2NN6 G;  1LTL A;  2BDN A;  4R4Q A;  1JWU D;  5C3E B;  3RN2 A;  2RKS A;  1HUN A;  3C1E A;  2NYZ D;  4L5T A;  2Z6K A;  4LUZ A;  2CWA A;  3LWU A;  4ZKC B;  1X6O A;  3I4N G;  3J7Z C;  3I55 A;  5BN5 A;  3BJU A;  5KNB A;  4C3J H;  2IT1 A;  3H6M A;  4BA1 I;  2NVX B;  1B50 A;  3LWE A;  5JAV A;  3M3Y B;  3U9O A;  2F0U A;  3MFY A;  3RZO H;  4DK0 A;  1PH7 A;  2MP1 A;  1EY6 A;  2JA7 G;  4Y52 H;  2XRQ D;  3BZD B;  1ESR A;  1GUO A;  1GUG A;  3CC4 A;  3VYR A;  4XYQ A;  1C48 A;  1Q8K A;  1KDA A;  3TS2 A;  4CDD C;  3DWQ A;  4HCS A;  3CRK C;  4OL7 A;  1KQS A;  4KHP Q;  2NZ1 D;  1V1P B;  5KYL A;  2Q8R E;  4DUZ L;  2N49 A;  1ZKO A;  4NB3 A;  5LL6 X;  5C5M A;  4JI1 L;  5ELE A;  1NR2 A;  1R4Q B;  1I4Q A;  4P74 A;  1HNX L;  4HTH A;  5EJW A;  1U9R A;  2A6E C;  4BBS B;  4DR7 Q;  5M5X H;  4DGZ A;  2I5H A;  5I9O A;  4A3D G;  3M4Q A;  3KBG A;  2RDH A;  4P71 A;  3M4O B;  4JI8 L;  3VYU A;  4OO1 H;  2OQK A;  4JBK A;  2LS0 1;  1PRT C;  2JEB I;  4WJW A;  4B3S Q;  3OWE B;  2FXQ A;  4ZRZ A;  1U4R A;  4HIK A;  2MQH A;  4OEM B;  4DNI A;  4EQ5 A;  2Z8L A;  3QOJ A;  3PO3 H;  1N34 Q;  1DOM A;  1OXU A;  1BBU A;  4RGT A;  2UUB L;  1X9N A;  4A3L G;  4CJ1 B;  3UDI A;  3HOX H;  3TN2 A;  3WOE A;  5EKI A;  4HIO A;  2N78 A;  1YIT A;  1KIX A;  2L0C A;  1K0S A;  5IWA Q;  3NE5 B;  2PZW A;  2ZM6 Q;  2WB1 E;  5C4X B;  2DUD A;  2UUA Q;  2CVR A;  4K0K L;  1GM5 A;  1H9R A;  4B9X A;  5IYB G;  1EYD A;  3BDL A;  1P16 A;  2PO4 A;  2MGS A;  3CQZ B;  2HHH L;  1NBW A;  1XMQ Q;  1UNS A;  1HR0 L;  4WJ3 M;  3F2D A;  4Q0F A;  3KF6 A;  4RKL A;  3RR5 A;  4CBV A;  2R92 B;  1FGU A;  1YVC A;  5HGQ A;  1TWC H;  4DUY Q;  1DCZ A;  1A15 A;  4DNT B;  1TS3 A;  3D8G A;  2NBF A;  5CGK A;  1RL2 A;  2EZV A;  1I94 Q;  4JCV E;  3FRP B;  4C3H G;  4B3T Q;  5FKA C;  1QE6 A;  4A4I A;  3I4M B;  4JYA Q;  2M2L A;  3R2I A;  3KLS A;  1D1K A;  4K5X A;  2ZJQ A;  3NBI A;  1E1T A;  4JI2 L;  5EPL A;  3CXC A;  2LXK A;  3NQI A;  2EPB A;  1HZ9 A;  4RH6 A;  1U4P A;  2MJ8 A;  3TP8 A;  5I6Y A;  1KAA A;  1IBM Q;  4OWW B;  1YNN C;  4IUP A;  4YY3 Q;  4AYB E;  3AB9 A;  3SVM A;  3HOZ H;  2VL6 A;  4IFD H;  2MO0 A;  4R8I A;  3AYH B;  1PTO B;  2ALY B;  2J4X A;  1NSN S;  4GS3 A;  1N36 Q;  4UAI A;  3K7A B;  4AIM A;  3RD4 A;  3S1Q H;  1BBX C;  2XWJ B;  3CP0 A;  1H9M A;  4C3I G;  2B63 H;  2WFW A;  4QY7 A;  1NTG A;  4FDB A;  3CME A;  1CHQ D;  3GTJ B;  5M5W B;  3P75 A;  5D3I B;  4OIK A;  4ZAI A;  5BN4 A;  2QGQ A;  3MXP A;  2E2H H;  2A69 C;  3GDE A;  1VMP A;  4KTA A;  2XN9 C;  1B9N A;  1YNJ C;  5IYC G;  3JAM i;  3MA2 B;  4G7Z C;  1K83 H;  3NEN A;  3IL8 A;  5FLM H;  1AEX A;  3I4N B;  4A3K H;  4NKL A;  4A3J G;  1L1O A;  4LF8 Q;  1H9S B;  1VS0 A;  4DV6 L;  1G8Z D;  3S2D H;  5KEE A;  1WD0 A;  4BBR G;  1CQV A;  4NXM L;  2SNS A;  4FXK C;  1O7Z A;  4HN7 A;  1VQ9 A;  4GOP A;  2UU9 L;  2JA6 H;  1N32 Q;  3T16 A;  1YIJ A;  2ATW A;  1CSP A;  1SYF A;  3A5Z B;  1V9P A;  3O13 A;  2JA7 B;  1IXR A;  4K5W A;  1CKM A;  5EAY A;  1EZ8 A;  3C2P A;  4BY1 H;  2FJ2 A;  3NQT A;  2L11 A;  1NUC A;  4YCU A;  4E6I A;  3S14 H;  1A6X A;  3EFX D;  3CC2 A;  4GKK Q;  4MTN A;  2DN8 A;  2LY7 A;  5K5P A;  1N33 L;  3VA7 A;  2HT1 A;  1ML0 D;  3DWA A;  1J5E L;  3OIP A;  3HOY G;  2CCZ A;  1FNU A;  1A63 A;  3KF8 A;  5JJL A;  3B6Y A;  4A3D B;  2F0W A;  3PSI A;  3MC0 B;  3I8Z A;  2EXD A;  1CTM A;  2CW0 C;  1Y1V H;  3L7Z C;  3VR6 A;  1QNU A;  1S72 A;  1JOR A;  3K6O A;  1CKO A;  3MEF A;  3KFU A;  3I7F A;  4DU9 A;  4DN4 M;  1D5X C;  1EYA A;  1KAB A;  4ME3 A;  2F4V L;  4R4T A;  2RHS B;  4LFA L;  4CJ2 C;  2CFM A;  4CDE C;  1SNC A;  3KJP A;  3T4A C;  4C2M B;  1JWS D;  1S40 A;  2JA8 G;  3M85 A;  5KYI A;  4BY7 H;  3V96 A;  1E2V A;  4KY6 A;  3H15 A;  3NBH A;  3H0G H;  2F0J A;  3KLS X;  4DR5 L;  4RG1 A;  1PFB A;  1BF4 A;  1UE7 A;  1ONL A;  1RF2 D;  2PZT A;  3D4R A;  3CPF A;  2QIL A;  3KOJ A;  3J81 L;  1LTS D;  4F8M A;  3NTI A;  4JI7 Q;  3D3R A;  1VQC A;  4HJ9 A;  5CV7 A;  1FL0 A;  5M5Y B;  1KHI A;  2YV5 A;  1I6V C;  4QUC A;  4K6L A;  1PH2 A;  2SNM A;  4QUF A;  1KRS A;  1RD9 D;  1YI2 A;  3G48 A;  5E7N A;  5IGG A;  3BU2 A;  4H7B A;  1ESF A;  2B2V A;  3NPP A;  1PHJ A;  1RKN A;  2BOS A;  4JK1 C;  1WVL A;  4PNY A;  5M3M H;  2R3Z A;  3HKZ E;  3DXJ C;  1ET9 A;  4HMI A;  4RFB A;  3HOU G;  4C3H B;  3H3V H;  5K36 H;  1LTT D;  1B53 A;  5D3D A;  3FHW A;  2L9H A;  5C44 H;  2CKZ B;  2GN5 A;  2IHE A;  5CR3 A;  1NMF A;  2NVY B;  3J81 E;  4LNQ A;  5DEH A;  1LYL A;  1I4P A;  1K0R A;  4YCW A;  1MIU A;  4UP9 A;  5CBE E;  4IUR A;  1KD1 C;  4JV5 Q;  4DAV A;  4X3K A;  5C3E H;  1TR5 A;  2DJF C;  3STB D;  2MFI A;  1XTC D;  3HRZ C;  1LTB D;  2K05 A;  4FF4 A;  1PZJ D;  4IUT A;  4C3I B;  3C46 A;  2A1A A;  4R4I A;  5ELC A;  4DV4 Q;  4BXX H;  4DUZ Q;  1I3Q H;  1HFN A;  2Z4I A;  4O2D A;  4JI1 Q;  1FJG L;  4JI6 L;  4KI0 A;  1SLJ A;  2DGY A;  5DM6 3;  3KJO A;  2AWO A;  1AZQ A;  1N34 L;  1HNX Q;  3M3Y H;  5JJK A;  3RLN A;  2CQA A;  1XPR A;  2E2J B;  5JPM C;  4A3J B;  3DHQ A;  3CKI B;  1LT5 D;  1XPU A;  4LF6 L;  3SXH A;  1GKH A;  2AHO B;  3EBE A;  2OTL A;  4S3S A;  4NXN Q;  4KJN A;  3SK8 A;  4IFD J;  4IUU A;  2K4K A;  2R7F A;  4U67 3;  4KLK A;  4P2C B;  4X66 L;  4DKA C;  2FMC A;  1EY7 A;  5IYD H;  5IWA L;  4Y7N B;  2ZM6 L;  1JIC A;  2UUB Q;  1GHK A;  2C9O A;  2N55 A;  3AQQ A;  1Z6H A;  5ELN A;  3KDF A;  2V1C C;  4BBS H;  1DD2 A;  5ELB A;  2QCP X;  2ICE C;  1GUS A;  4LFB L;  1S5B D;  3M4O H;  4GN3 B;  3PUW A;  1XMQ L;  3S1R H;  4DR3 Q;  1E7Z A;  2RHQ B;  4KY7 A;  1K28 A;  4A3E G;  1XNR Q;  3VDY A;  5IP7 H;  2ZXP A;  4GNX A;  1SRO A;  2KCT A;  4FP5 D;  4B3T L;  1OXS C;  4A3F G;  5IGD A;  1B2T A;  3OSO A;  4G7O C;  4JYA L;  1ROD A;  3S1M B;  4KY5 A;  2I07 B;  2F0S A;  4QF4 A;  4HJ8 A;  2F3W A;  4I65 A;  2HIX A;  1DJR D;  2L4N A;  4DR1 L;  3CCL A;  4FF1 A;  1Q46 A;  3PIP 3;  2HCC A;  1K8M A;  3A7A B;  4EX5 A;  3TEH B;  1IBM L;  2NZO A;  1HQM C;  4MHE A;  1EUJ A;  2VXW A;  4YY3 L;  5FJ8 G;  3U50 C;  3MWY W;  2YTV A;  1X3F A;  5C4X H;  3QB3 A;  3KLW A;  5C0X I;  2JA8 B;  4IPH A;  2R93 G;  5IOC A;  4JI2 Q;  1F9Q A;  2WII B;  4Q5V A;  3H94 A;  2KEN A;  2Y0S G;  1NY4 A;  1UUP A;  1L0X B;  3PIO 3;  3ULL A;  3QR8 A;  3CQZ H;  3AEV A;  1S5C D;  3BDO A;  3CW2 C;  2B8F A;  2XVS A;  3V2T A;  1BQQ T;  2L12 A;  1WCM G;  4OX9 L;  4O1N A;  1LTR D;  1JQY D;  2F0T A;  1TWA B;  5E1F A;  4LF8 L;  2F0O A;  3I4M H;  1VQ4 A;  3ZJY C;  1XJV A;  4HJ7 A;  2EXZ A;  3ND9 A;  1JB7 A;  3H3V I;  1DON A;  3HOV H;  4A3B G;  2Q8T A;  3D4D A;  1G29 1;  1KRT A;  3QJY A;  2KCN A;  2B2T C;  4Z9C B;  1PMR A;  1FD7 D;  4QGU A;  1PTO H;  1HUM A;  2A6H D;  2E74 C;  2K5Q A;  4KN4 C;  5KRU A;  2PMZ B;  3K7A H;  3CCM A;  4ODG A;  1RTN A;  3SK4 A;  2K5D A;  1PZI D;  2C5C A;  4I7Z C;  2UU9 Q;  3GTQ B;  2OQ0 A;  2M9V A;  5G3L F;  2EJM A;  3FKI H;  3ONA B;  4OIJ A;  3PMF A;  1IYU A;  2EVB A;  3VR3 A;  5M5W H;  1TWF B;  4B08 A;  2NN6 H;  1YHA A;  4GKK L;  1PDQ A;  3A54 A;  4A93 H;  1F2Z A;  5IGF A;  1ASY A;  1WTW A;  1VQM A;  2EJF C;  2OXP A;  3DLL A;  4RKB A;  1STY A;  4QMG A;  3CCQ A;  1ENC A;  3GD7 A;  1GJX A;  1OXT A;  1STH A;  3PUX A;  1TKW B;  5IE8 A;  2KEC A;  1FNV A;  1Q81 C;  2UXD Q;  3T51 B;  3K58 A;  2O5J C;  3ITP A;  3QG1 A;  1N33 Q;  2HUG A;  2VUM H;  4EQP A;  1X65 A;  3NTH A;  2VQF Q;  1SJH D;  4LWC A;  1XXG A;  3MXG A;  2JXM B;  1CI3 M;  4TKO B;  2B2U C;  4NPS A;  2DY8 A;  2KHI A;  2B2Y C;  1B1Z A;  1D2B A;  4LW1 A;  3K0Y A;  1JJ2 A;  1BVS A;  1K3R A;  5EGT A;  1YEZ A;  1SE8 A;  4L5R C;  4HAE A;  3J7A V;  5KIX A;  1NMG A;  2XSC A;  3Q24 A;  4LFA Q;  4KKU A;  4DR2 L;  1AE3 A;  1LAC A;  1SN8 A;  3W5O A;  4GLX A;  2LSS A;  1ASZ A;  1WTX A;  3CRL C;  4OWT B;  4A76 A;  4J8Q A;  1LV9 A;  2PQA A;  1AZP A;  3Q8D A;  2KUM A;  1CFM A;  4DR5 Q;  3NBH B;  4XQN A;  1SSO A;  4XQJ A;  3CHB D;  4DV5 L;  1Y69 U;  1F9P A;  1EFW A;  1MGS A;  1BCP B;  1B3Q A;  4A3E B;  2YU9 B;  2RVL A;  1BKB A;  4L5S A;  3BYT B;  3NSW A;  3OMC A;  4A3F B;  4A3L H;  2CWP A;  4C2M H;  2UXC L;  2IPK D;  4CKC A;  3SGI A;  4ZLT F;  3J80 i;  2AUJ D;  3F8T A;  2KCC A;  1II3 A;  1K9M C;  5IT9 c;  3E5S A;  4A3I G;  5I2Y A;  5CYU A;  4O42 A;  3OIQ A;  2ZTE A;  3T1H L;  4JV5 L;  3NWT A;  3STB C;  1BBW A;  1ENF A;  2QW7 A;  1A2T A;  3IFD A;  4RGN A;  3E9I A;  2R93 B;  5LMN Q;  4MTK A;  5IYB H;  3ERS X;  3I72 A;  1WTP A;  1GO3 E;  1T5E A;  4FXD A;  2Y0S B;  5LMU Q;  1DOL A;  2RQX A;  5FLX L;  4ZKB B;  5M5Y H;  4DV4 L;  3NK9 A;  5CC4 A;  5EPJ A;  1U4L A;  3D6W A;  4LFC Q;  4IZ8 A;  5IGE A;  3GTM B;  4XIG S;  1MHW C;  1Z47 A;  2K03 A;  3TS0 A;  3S16 B;  1WCM B;  3W3A A;  3TBI B;  1YBY A;  4DV3 Q;  4A3C H;  1UE1 A;  1NE3 A;  4ALP A;  4JOI C;  5HGT A;  1V43 A;  4FF3 A;  3PUZ A;  1BO0 A;  1S4Z A;  5DAU A;  2MPM A;  1LTA D;  1SMX A;  1E3P A;  4C3H H;  4IPC A;  5FO9 B;  3PCO B;  2XWB B;  4NXN L;  1PTO C;  1EWI A;  1FJG Q;  4PMC A;  2EY1 A;  2YYZ A;  4JI6 Q;  2NVY H;  5C3W A;  3CCJ A;  3OW7 A;  5COY A;  3ULJ A;  4AYB G;  4LAA A;  1Q7Y C;  2D9U A;  5FLX E;  1IBK Q;  1I4G A;  4LF6 Q;  4DA2 A;  1HCZ A;  2K1B A;  3DM3 A;  3PIP A;  4DV2 Q;  3GV3 A;  3G4S A;  2R6G A;  4ID6 A;  1F9R A;  3KK7 A;  4PZ8 A;  4OHJ A;  3CCU A;  1UEA B;  3VA5 A;  2K52 A;  1PRT F;  4X66 Q;  3CC7 A;  2F3V A;  4DR3 L;  3E0E A;  3MXN B;  4L5Q A;  3T56 B;  2A19 A;  3K81 C;  1M90 C;  5IP9 G;  3SK5 A;  3RUZ A;  1XNR L;  1JMC A;  4C3J G;  1R9T B;  3PIO A;  1CA5 A;  2E2J H;  4A3J H;  4LFB Q;  3KDF B;  4RWS C;  2RSN A;  3I4O A;  1JE4 A;  2PNH A;  1YJN A;  1FNW A;  1G91 A;  2QEJ C;  3SK6 A;  4DR4 L;  3CCR A;  2D0O A;  2J0T D;  4CKB A;  4DK1 A;  4M8A A;  1K8A C;  3GTO B;  4ZQ3 A;  1B70 B;  3A8I E;  3GP7 A;  3ERQ A;  5I9P A;  2RA4 A;  2O2L D;  4OGQ C;  2K5N A;  3G6E A;  1EYC A;  5C4H A;  3T13 A;  1Q12 A;  4P72 A;  3G7L A;  5F2D A;  1LT4 D;  3X3N A;  2RCF A;  1PH6 A;  5JEA G;  3MTS A;  4DR1 Q;  4YHH Q;  2JA5 B;  3DEO A;  3CPW A;  4R1J A;  2ENB A;  1Q90 A;  1S5D D;  3I2Z A;  2I46 A;  3TSS A;  4QIW B;  1NNX A;  4XT1 B;  5A2Q L;  1JJG A;  2A68 D;  1TY2 A;  1G51 A;  3VR2 A;  2BA1 A;  4MZ9 A;  1WTV A;  3EN2 A;  4KKT A;  1V8Q A;  2AWN A;  1JC7 A;  1JJC B;  5D65 A;  3JAM L;  5CV6 A;  2NZH A;  3PO3 G;  3S1M H;  5FOB B;  3PO2 G;  4ZYS A;  4JBW A;  1SEB D;  1WJJ A;  3J80 c;  2F03 A;  2LMC B;  3TP6 A;  1MD2 D;  5L37 A;  1VQJ A;  4OX9 Q;  3I91 A;  3WOF A;  1AW7 A;  2V4D A;  3IKJ A;  3VR4 A;  3UE1 A;  1XMO L;  2A6H C;  2F0P A;  1VQL A;  2PNR C;  3P1H A;  3ICE A;  2UXB Q;  3IRB A;  4TRD A;  3I73 A;  2F0V A;  2EY5 A;  2IX0 A;  4KD3 A;  2E2I B;  2Z6B A;  5A2Q E;  3LNN A;  4A3I B;  1D5M C;  3M7N A;  1DYQ A;  2I5L X;  5EQ0 A;  3TRE A;  3JAM E;  2E2D C;  1STA A;  2HDM A;  1VDZ A;  2C35 B;  3F1Z A;  3Q22 A;  1X56 A;  4LF9 L;  1SYE A;  4BS9 A;  1SE3 A;  1H95 A;  2PI2 A;  2PQE A;  2XNA C;  5LHY 1;  1SE2 A;  1TWA H;  3W1G A;  1BCP D;  3UI2 A;  1SXT A;  1YJ9 A;  3I90 A;  2Z6K C;  2UXD L;  2CH4 W;  1HZC A;  2B3G A;  2F0Q A;  1CM9 A;  2B2W A;  1B44 D;  4R4O A;  3G71 A;  2CQO A;  2VQF L;  4FXG C;  1IZ6 A;  3URY A;  4LF4 Q;  1F2M A;  3HKZ G;  4OO1 I;  1K8O A;  1PH5 A;  4KMU C;  2NVT B;  1CKN A;  5TSS A;  1J9O A;  3MEH A;  4J6H A;  1UWV A;  4KV6 A;  2KED A;  2XGT A;  4IN3 A;  4BWG B;  4RHR A;  3PV0 A;  1M8A A;  3GTQ H;  1KLG D;  2F0H A;  1IL2 A;  2XIW A;  1PZK D;  1HA5 A;  1LT6 D;  4AYB B;  5CMD A;  2B63 G;  4X3T A;  1SNQ A;  3T1Y Q;  1YZ6 A;  5FO7 B;  2K28 A;  4DAY A;  2SDF A;  1PXU A;  3I70 A;  1A0I A;  1ZYR D;  1G2S A;  2JJQ A;  3CCV A;  4FNF A;  2WAQ G;  1H9K A;  2KOL A;  1UAP A;  1G6Z A;  1R4P B;  5NUC A;  5FLM G;  4HSV A;  3CCS A;  3E0J A;  4A3K G;  4YIJ A;  1W2B A;  1Q3L A;  4DR2 Q;  3K5M A;  5JVG 3;  3HS0 C;  4IOA A;  1VQN A;  1YNX A;  3HKS A;  1SMY D;  1E22 A;  2QEX A;  2EY2 A;  3UDX A;  2G5D A;  4APV A;  3L2P A;  3EVQ A;  1JB3 A;  3GTP B;  1Q1E A;  4DV5 Q;  2PQA B;  2VY3 A;  3TDQ A;  1XPO A;  2TMP A;  1EU4 A;  5D14 A;  4HID A;  1ZXT A;  1MI2 A;  4ULL A;  5ELD A;  1EEI D;  1CT1 D;  3U58 A;  2E75 C;  3QOL A;  4M1U B;  4JI0 Q;  2L5T A;  2KVM A;  4DXF A;  1EY9 A;  5JPN C;  2I5M X;  1EIY B;  3CD6 A;  4QQB X;  5LMN L;  4KN7 C;  2UXC Q;  2PW5 A;  1PV4 A;  2GA4 B;  4KHV A;  4ZUJ A;  1OTC A;  1BDO A;  4QJF A;  4F87 A;  5C3X A;  5LMU L;  1HNZ L;  3BVM A;  2AUK A;  4IFD I;  3NP8 A;  1D7Q A;  4LFC L;  3T1H Q;  1O78 A;  1T9H A;  5J1Z A;  1XX8 A;  3P7J A;  4DV3 L;  3LGJ A;  2D2C C;  2DNC A;  2ES2 A;  2YU9 H;  1Y1V G;  2RDG A;  3K80 C;  4G4K A;  4WJ4 A;  1QIL A;  1HQR D;  4A3F H;  4YWK A;  4DV1 Q;  3PO2 B;  1WTH A;  3AFQ A;  1EY0 A;  1VCI A;  3KUP A;  4NW2 A;  2NVX H;  1CK1 A;  3AU7 A;  1E2Z A;  3RLO A;  1CHP D;  3E9H A;  3M7G A;  5DLQ E;  4TQU S;  4YCV A;  5FJ8 H;  5C0X G;  5KNC A;  4MN3 A;  1Q1B A;  1CZG A;  1EY4 A;  1IBK L;  3H0G G;  4BBR B;  2R93 H;  4DV2 L;  3NXW A;  3RMH A;  1EY8 A;  1X55 A;  3BZK A;  4QCL A;  5DNF A;  3CU7 A;  1SJE D;  1K8G A;  1PH4 A;  3BYY B;  3VYT A;  4P75 A;  2CH4 A;  1I50 B;  1SAP A;  4FO2 A;  5IY0 A;  1C8C A;  3GTM H;  4EGV A;  4K5V A;  4TSS A;  4A3G G;  2RSO A;  4XQQ A;  2K5H A;  2E5L L;  1HR0 W;  1VQ7 A;  2IWH A;  1WD1 A;  4PZ6 A;  1RJT A;  5A35 A;  1PYS B;  1QJO A;  5M3M G;  1SBB B;  1Y8P B;  5T1I A;  2G9H D;  1L1O C;  4KHZ A;  5ELF A;  4DK6 C;  3HOY B;  5K36 G;  1L0Y B;  1K3B C;  1EY5 A;  2PMZ E;  3LX0 A;  3KBX A;  2B8G A;  1KDC A;  4GOP C;  2RCN A;  2DNE A;  4PMW A;  1WOC A;  1X3Q A;  4L8J A;  5CV4 A;  2Z9H A;  2XRS D;  4PMB A;  3H91 A;  4UP7 A;  4DR4 Q;  4YHH L;  1N9W A;  2EE1 A;  2MUY A;  3KF6 B;  4JPB W;  4DAM A;  3S9W A;  4GN5 A;  3S1Q B;  5KGU A;  2F0L A;  3L0O A;  1DXM A;  2B63 B;  2A68 C;  1AP0 A;  5IT9 L;  3A8J E;  1B8A A;  3PF5 A;  1A3V A;  1KLU D;  4B9W A;  1I5F A;  1R9T H;  1VMC A;  2PYK A;  5JVH 3;  2WAQ B;  2E2H B;  2UUC Q;  4R4C A;  2P5Z X;  3GTO H;  1B7Y B;  1DM0 B;  2R92 H;  4UP8 A;  4DV0 Q;  3S2D B;  1NCV A;  4WOR A;  1TT2 A;  5GAD C;  1JCK B;  1HJP A;  2QF7 A;  4K14 A;  2UXB L;  1SNP A;  3MVV A;  2L1B A;  3TP5 A;  1EYG A;  1PLF A;  2IW3 A;  3K8A A;  4PG3 A;  3GV6 A;  4CDF C;  4JVZ A;  1GHJ A;  5IT9 E;  4EQO A;  1I4H A;  2JA5 H;  1ICW A;  3E6Z X;  1YNN D;  1MJE A;  5LL6 S;  4BBS G;  1XMO Q;  3HOW G;  1XWE A;  3HOU B;  3W2D A;  4IUV A;  4A3M G;  1SDF A;  3TQY A;  1TWG B;  2BH8 A;  1A8V A;  3R3O A;  2EYF A;  1N8R C;  2F0G A;  1BNZ A;  1FGB D;  5FO8 B;  1BCP C;  4A75 A;  1L1O B;  2NTS A;  2A74 C;  4LF7 Q;  3A74 A;  2ZJR A;  1C7Y A;  1EOV A;  3GTJ H;  5E3F A;  3A5U A;  4GOP B;  1UE6 A;  2A69 D;  3ERO A;  1LAB A;  4LF5 Q;  2FIN B;  4RAU C;  1EFI D;  4FVM A;  5M3F G;  3FPU B;  1VQP A;  1Y1V B;  4LF4 L;  4LF9 Q;  1PH8 A;  1JT8 A;  3I4N H;  1LTG D;  1VQE A;  2L15 A;  1VQ6 A;  2VZA A;  3I56 A;  5GAE C;  2B2V C;  3SE0 A;  1HXY D;  2AMC B;  3I3C A;  3QO2 A;  3P20 A;  1O7Y A;  1MSH A;  1MBY A;  4A3I H;  1TQO A;  1L2F A;  1RHP A;  4R8N A;  4NDX A;  4DF7 A;  2OWO A;  2JA7 H;  1XTD A;  1QZH A;  3T1Y L;  1SYC A;  3KF8 B;  2Y0S E;  1ZYR C;  4IUN A;  2ZXR A;  3D4W A;  5IIF A;  1CKN B;  4H02 A;  1Y1W G;  3NEL A;  4RGM A;  3RZD B;  3OTO L;  1SMY C;  1AE2 A;  4A3G B;  2ZTC A;  3J7A F;  1GUT A;  1JOQ A;  2K5V A;  1TXY A;  4CDC C;  4IPG A;  3OMG A;  4DAY B;  4A3D H;  3GQB A;  2NVT H;  3NUC A;  1BR9 A;  3K59 A;  1HFG A;  4JI5 L;  4DV7 L;  3M4Y A;  1IW7 D;  1STB A;  3MZ5 A;  5M3M B;  4R9W A;  1PFM A;  3A7L A;  3HOV G;  2EYH A;  1QUQ A;  3S15 B;  2QKI C;  1Z7T A;  1IKL A;  2OCE A;  5CV5 A;  1U4M A;  1O80 A;  3OYY A;  3GTG B;  4JI0 L;  2EIF A;  4QL5 A;  4IO9 A;  4DNR B;  1EOT A;  3SDZ A;  3FKI G;  2D62 A;  4JW0 A;  4UHV A;  1LUZ A;  4G7H C;  1PH1 A;  2BH2 A;  1S3O A;  4C1N I;  2F0I A;  2RDF A;  4A93 G;  1VQH A;  1KDB A;  4EVO A;  3C1F A;  5GQO A;  1SE4 A;  1WI5 A;  2R7D A;  1GUN A;  2WB1 G;  2KHJ A;  5IP9 H;  4RA8 A;  1TVX A;  1KXL A;  1ICF B;  4XDX A;  1PH9 A;  1PYB A;  2H1E A;  3DUZ A;  2B39 A;  3EIV A;  5CV8 A;  3FP9 A;  1I3Q B;  5JJZ A;  2HQL A; 
#chains in the Genus database with same CATH homology
 1A3U A;  2NTT A;  2WAC A;  2EJG C;  4QB4 A;  3I4L A;  4IUQ A;  1JOK A;  3J80 E;  2BA0 A;  5I4D A;  2EYM A;  4K2K A;  3V05 A;  2LFN A;  2M00 A;  2SEB D;  1HHV A;  3GTK B;  1M4V A;  2WKC A;  1STE A;  5JEA H;  3L3O C;  2N88 A;  1BUV T;  1EQV A;  2O5I C;  3MAQ A;  4A3B B;  3HOW B;  3FEW X;  4A3M B;  5HUR A;  1EWC A;  2JP1 A;  3OWF A;  1WTO A;  3S1R B;  2NVQ B;  4FYD A;  3D6C A;  1MSG A;  2NN6 I;  2RBM A;  1HPC A;  3K57 A;  1RDP D;  5CBA E;  1O7L A;  1PTO F;  2IX3 A;  1LT3 D;  2K7V A;  3S1N B;  1J8I A;  5M3F B;  4H13 C;  4V19 0;  3S17 B;  5C4J B;  4RCN A;  1EQT A;  3IFT A;  4HSP A;  3U9S A;  5KND A;  4H0L C;  2WP8 J;  4LJZ C;  1EZ6 A;  1OXV A;  1F77 A;  3GTL B;  2NUC A;  1CQF A;  3SR1 A;  4DXG A;  2ID0 A;  1TWH B;  1SFO B;  1IYV A;  5T1G A;  4IAL A;  1HRJ A;  2JSO A;  1RTO A;  5IGC A;  1QNK A;  1JWM D;  4KJO A;  4K2L A;  1Y1W B;  1OXX K;  2BDO A;  2EDG A;  2FMM A;  3HZX A;  1SNM A;  5C4Z A;  3A56 A;  2JEA I;  1I6H B;  4XT3 B;  4OO1 G;  1RCV D;  5C5L A;  3DMU A;  1D6E C;  2K5W A;  1LLR D;  1Y8N B;  5E4W C;  3N52 A;  3C3L A;  1TU2 B;  1VF7 A;  3HOV B;  2X6G A;  1PRT B;  1QOH A;  2FHT A;  5EBC A;  2MHV A;  1IHZ A;  1GOZ A;  2F0E A;  4CKE A;  1E2W A;  1QWY A;  3H09 A;  5CV9 A;  5C6A A;  2F0F A;  3FKI B;  3F2U A;  1XYI A;  4L6T B;  1NR4 A;  3HEJ A;  4GZY C;  2BCO A;  4A93 B;  1V1O A;  2EYO A;  5DM7 3;  2WB1 B;  3BG3 A;  4N9P A;  1EU3 A;  2AQ2 B;  3Q23 A;  3BVZ A;  5G3L D;  2VUM B;  4MIU A;  3HGB A;  3S2H B;  3TME A;  4X3S A;  2PPB C;  2K33 A;  3X3M A;  2WIN B;  1JR0 D;  4WFN 3;  1STG A;  3HG9 A;  5JOB A;  2EY6 A;  1IKM A;  2R7Z B;  1E0B A;  3ND8 A;  2A73 B;  3SEB A;  2NWG A;  1ILQ A;  3Q6S A;  4IFD G;  1CZW A;  3T53 B;  2VB2 X;  2OT2 A;  2SOB A;  2TSS A;  3A55 A;  1DZ1 A;  1G2T A;  3EJI A;  4UDU C;  3J7Y W;  1IW7 C;  2KEE A;  4RHS A;  1I4R A;  4ILW A;  2H4O A;  4C3J B;  2HCI A;  1ZEQ X;  2F0N A;  2BE5 D;  3R93 A;  2Z1C A;  1VF5 C;  1B4O A;  5C0X H;  1FR3 A;  1LTI D;  5JEA J;  2B2T A;  1Q8I A;  1KNA A;  2EOT A;  4LK1 C;  3RZO B;  4KK7 A;  4KD4 A;  4L63 B;  1Y8O B;  3NTK A;  1D1I A;  5AFW A;  1SNO A;  4HED A;  2EYJ A;  3DEP A;  1EWH A;  3VYS A;  1SYG A;  2O4X A;  1B3A A;  5J22 A;  3FVQ A;  2ZXO A;  3L9A X;  1CA6 A;  1AN8 A;  5M5X B;  4BA2 I;  1WTR A;  1ILP A;  3KLR A;  4PV1 C;  3FDT A;  2F0K A;  1V1P A;  2A5H A;  1F2Y A;  4V0B A;  2Z4H A;  1I4X A;  3Q0A A;  5EKK A;  2EYL A;  3PO3 B;  4C56 C;  2B2U A;  4WRD A;  3NWS A;  2PW7 A;  4C1N K;  2B2Y A;  4NMZ A;  2D5D A;  2F0M A;  3HOX B;  4ZUI A;  2VNU D;  4F7X A;  2PCF B;  2K32 A;  4LMQ D;  2QDB A;  2F0D A;  1S5F D;  3K5O A;  2F1M A;  3FMC A;  4K6D A;  4CJ0 B;  3K5L A;  3PUY A;  1DOK A;  2AQ1 B;  1S5E D;  2A6E D;  2R61 A;  5J39 A;  1C4Q A;  1PFN A;  2HDL A;  4ZK9 B;  4K8I A;  5M9O A;  2K04 A;  1X3P A;  3QWN A;  5E4X A;  4DFA A;  1PRT D;  3MXN A;  1OO9 B;  2JE6 I;  1PTO D;  1TWC B;  2IJ0 A;  3OHX C;  1X32 A;  5EBD A;  1D5Z C;  3EQL C;  1GUW A;  2X6L A;  4J1M A;  4K8J A;  4F88 A;  5BN3 A;  1EIG A;  2WV6 D;  3HKZ B;  2IX1 A;  4HR7 B;  3TZU A;  3HP3 A;  3TZD A;  2EYP A;  4HMJ A;  3BDC A;  4N9T A;  1T5X D;  1B9M A;  4RGO S;  4XTC S;  1QCB D;  5COR A;  3VR5 A;  4HCE A;  3HOZ B;  4KKS A;  1ENA A;  2DY7 A;  1W6J A;  2J7Z A;  1LO5 D;  1SYB A;  3PUV A;  1GXD C;  1F9S A;  2Q8I B;  3GO5 A;  4NP5 A;  1JOO A;  1STN A;  1EEF D;  1A2U A;  1F2L A;  4ME5 A;  3R2T A;  1TII D;  3MHB A;  2B2W C;  1SND A;  3SHL A;  1K83 B;  4A3K B;  3QIA A;  1BXT A;  2LKV A;  3AMU A;  4H44 C;  2KQ3 A;  3A8K E;  5EPK A;  3MXU A;  3FPP A;  3R8B A;  3IAY A;  2JA6 B;  2CHB D;  2L55 A;  3EA6 A;  1QG7 A;  4EQN A;  4X3U A;  1A3T A;  3RLF A;  1NAP A;  2ICI A;  1TS4 A;  4DAP A;  1TS2 A;  1H9S A;  4BY1 B;  2FFK B;  3BVG A;  5IGB A;  1KTK A;  3S14 B;  3DWP A;  2IL8 A;  1HA6 A;  4XXE A;  3H3V C;  1H9J A;  3D31 A;  2KJX A;  4CHT B;  3G6J B;  5FK9 C;  2WKD A;  4PQX A;  2OF1 A;  2KHS A;  1TS5 A;  1TY0 A;  1YNJ D;  5C0X J;  4U68 A;  1KNE A;  2F4I A;  4ABN A;  2AQ3 B;  2X69 A;  1BCP F;  2PZU A;  1QB5 D;  5IOD A;  2G9D A;  2JYO A;  2VB3 X;  1WTQ A;  4BY7 B;  4CGY B;  1BOS A;  3WDN A;  3H0G B;  5EKL A;  1HTP A;  1EIH A;  3BS1 A;  2HQE A;  5I2X A;  3MFG A;  2K6A A;  3OPO A;  4IQZ A;  3ZYY X;  3K5N A;  3TP7 A;  2BE5 C;  2E76 C;  4XYO A;  1W6K A;  2K01 A;  5I6W A;  1EL0 A;  4G57 A;  4FF2 A;  2CW0 D;  5ISR A;  3NHH A;  4RCO A;  3N6R A;  1HTL D;  1PYW D;  3OOC A;  2OEO A;  1SYD A;  3J80 L;  5C44 B;  1IL8 A;  2NB0 A;  1FYC A;  2KA7 A;  2ZT9 C;  3DM1 A;  1ET6 A;  1AFP A;  2NN6 G;  2BDN A;  1JWU D;  5C3E B;  2RKS A;  1HUN A;  3C1E A;  2NYZ D;  3LWU A;  4ZKC B;  5BN5 A;  5KNB A;  2IT1 A;  3H6M A;  4BA1 I;  2NVX B;  1B50 A;  3LWE A;  5JAV A;  3M3Y B;  3U9O A;  2F0U A;  3MFY A;  4DK0 A;  2MP1 A;  1EY6 A;  2XRQ D;  3BZD B;  1ESR A;  1GUO A;  1GUG A;  3VYR A;  4XYQ A;  1C48 A;  1KDA A;  3DWQ A;  4HCS A;  3CRK C;  4OL7 A;  2NZ1 D;  1V1P B;  5KYL A;  2Q8R E;  1ZKO A;  5LL6 X;  5C5M A;  5ELE A;  1NR2 A;  1R4Q B;  1I4Q A;  4HTH A;  5EJW A;  1U9R A;  2A6E C;  4BBS B;  4DGZ A;  5I9O A;  3KBG A;  2RDH A;  3M4O B;  3VYU A;  4OO1 H;  2LS0 1;  1PRT C;  2JEB I;  4WJW A;  3OWE B;  4ZRZ A;  1U4R A;  2Z8L A;  3QOJ A;  1DOM A;  1OXU A;  4RGT A;  4CJ1 B;  3TN2 A;  3WOE A;  5EKI A;  2L0C A;  3NE5 B;  2PZW A;  5C4X B;  2CVR A;  1H9R A;  4B9X A;  1EYD A;  3BDL A;  2PO4 A;  2MGS A;  3CQZ B;  1UNS A;  4Q0F A;  4RKL A;  4CBV A;  2R92 B;  1DCZ A;  1A15 A;  4DNT B;  1TS3 A;  3D8G A;  2NBF A;  5CGK A;  2EZV A;  4C3H G;  3FRP B;  5FKA C;  1QE6 A;  3I4M B;  2M2L A;  3R2I A;  3KLS A;  1D1K A;  4K5X A;  3NBI A;  5EPL A;  3NQI A;  2EPB A;  4RH6 A;  1U4P A;  2MJ8 A;  3TP8 A;  5I6Y A;  1KAA A;  1YNN C;  4IUP A;  3AB9 A;  3SVM A;  4IFD H;  4R8I A;  1PTO B;  2J4X A;  1NSN S;  4UAI A;  3K7A B;  3RD4 A;  1BBX C;  2XWJ B;  1H9M A;  4C3I G;  1CHQ D;  3GTJ B;  5M5W B;  3P75 A;  5D3I B;  4OIK A;  4ZAI A;  5BN4 A;  3MXP A;  2A69 C;  1VMP A;  4KTA A;  2XN9 C;  1B9N A;  1YNJ C;  4G7Z C;  3MA2 B;  3IL8 A;  1AEX A;  3I4N B;  4NKL A;  1H9S B;  1G8Z D;  5KEE A;  1WD0 A;  1CQV A;  2SNS A;  4FXK C;  1O7Z A;  4HN7 A;  3T16 A;  1SYF A;  3O13 A;  2JA7 B;  4K5W A;  1EZ8 A;  3C2P A;  2FJ2 A;  3NQT A;  2L11 A;  1NUC A;  4E6I A;  1A6X A;  3EFX D;  2DN8 A;  2LY7 A;  5K5P A;  3VA7 A;  1ML0 D;  3DWA A;  3OIP A;  1FNU A;  3KF8 A;  4A3D B;  2F0W A;  3MC0 B;  3I8Z A;  1CTM A;  2CW0 C;  3L7Z C;  3VR6 A;  1QNU A;  1JOR A;  3K6O A;  4DU9 A;  4DN4 M;  1D5X C;  1EYA A;  1KAB A;  4CJ2 C;  1SNC A;  3T4A C;  4C2M B;  1JWS D;  3M85 A;  5KYI A;  3V96 A;  1E2V A;  4KY6 A;  3NBH A;  2F0J A;  3KLS X;  1PFB A;  1BF4 A;  1ONL A;  1RF2 D;  2PZT A;  3D4R A;  2QIL A;  3J81 L;  1LTS D;  4F8M A;  3NTI A;  3D3R A;  5CV7 A;  5M5Y B;  1I6V C;  4QUC A;  4K6L A;  2SNM A;  4QUF A;  1RD9 D;  5IGG A;  4H7B A;  1ESF A;  2B2V A;  3NPP A;  1RKN A;  2BOS A;  4JK1 C;  1WVL A;  4PNY A;  2R3Z A;  3DXJ C;  1ET9 A;  4HMI A;  4RFB A;  4C3H B;  5K36 H;  1LTT D;  1B53 A;  5D3D A;  2L9H A;  5CR3 A;  2NVY B;  3J81 E;  5DEH A;  1I4P A;  5CBE E;  4IUR A;  4DAV A;  4X3K A;  1TR5 A;  1XTC D;  3HRZ C;  1LTB D;  2K05 A;  4FF4 A;  1PZJ D;  4IUT A;  4C3I B;  3C46 A;  5ELC A;  1HFN A;  2Z4I A;  4KI0 A;  5DM6 3;  1AZQ A;  2AWO A;  2CQA A;  2E2J B;  5JPM C;  4A3J B;  3DHQ A;  3CKI B;  1LT5 D;  3SXH A;  4S3S A;  4KJN A;  3SK8 A;  4IFD J;  4IUU A;  4U67 3;  4P2C B;  2FMC A;  1EY7 A;  4Y7N B;  1JIC A;  1GHK A;  2C9O A;  2N55 A;  1Z6H A;  1DD2 A;  5ELB A;  2QCP X;  2ICE C;  1GUS A;  1S5B D;  3PUW A;  4KY7 A;  2ZXP A;  4FP5 D;  1OXS C;  5IGD A;  1B2T A;  3OSO A;  4G7O C;  1ROD A;  3S1M B;  4KY5 A;  2I07 B;  2F0S A;  4QF4 A;  2F3W A;  4I65 A;  1DJR D;  2L4N A;  4FF1 A;  3PIP 3;  2HCC A;  1K8M A;  3A7A B;  1HQM C;  4MHE A;  2VXW A;  3MWY W;  3QB3 A;  5C0X I;  2JA8 B;  5IOC A;  1F9Q A;  2WII B;  4Q5V A;  3H94 A;  1UUP A;  1L0X B;  3PIO 3;  1S5C D;  3BDO A;  2B8F A;  2XVS A;  3V2T A;  1BQQ T;  2L12 A;  4O1N A;  1LTR D;  1JQY D;  2F0T A;  1TWA B;  5E1F A;  2F0O A;  2EXZ A;  3ND9 A;  1DON A;  2Q8T A;  3D4D A;  1G29 1;  3QJY A;  2KCN A;  2B2T C;  4Z9C B;  1PMR A;  1FD7 D;  1PTO H;  1HUM A;  5KRU A;  2A6H D;  2E74 C;  2K5Q A;  4KN4 C;  2PMZ B;  4ODG A;  1RTN A;  3SK4 A;  2K5D A;  1PZI D;  2C5C A;  4I7Z C;  3GTQ B;  2M9V A;  5G3L F;  2EJM A;  3ONA B;  4OIJ A;  3PMF A;  1IYU A;  2EVB A;  3VR3 A;  1TWF B;  4B08 A;  2NN6 H;  1PDQ A;  3A54 A;  1F2Z A;  5IGF A;  1WTW A;  2EJF C;  2OXP A;  4RKB A;  1STY A;  4QMG A;  1ENC A;  3GD7 A;  1GJX A;  1OXT A;  1STH A;  3PUX A;  1TKW B;  2KEC A;  1FNV A;  3T51 B;  3K58 A;  2O5J C;  3ITP A;  3QG1 A;  2HUG A;  4EQP A;  3NTH A;  1SJH D;  1XXG A;  3MXG A;  2JXM B;  1CI3 M;  4TKO B;  2B2U C;  2DY8 A;  2B2Y C;  1B1Z A;  1D2B A;  3K0Y A;  5EGT A;  4HAE A;  3J7A V;  5KIX A;  2XSC A;  3Q24 A;  4KKU A;  1LAC A;  1WTX A;  3CRL C;  4J8Q A;  1LV9 A;  1AZP A;  2KUM A;  1CFM A;  4XQN A;  1SSO A;  4XQJ A;  3CHB D;  1Y69 U;  1F9P A;  1MGS A;  1BCP B;  4A3E B;  2YU9 B;  2RVL A;  3BYT B;  3NSW A;  3OMC A;  4A3F B;  2IPK D;  4CKC A;  4ZLT F;  2AUJ D;  2KCC A;  1II3 A;  3E5S A;  5I2Y A;  5CYU A;  4O42 A;  3OIQ A;  3NWT A;  1ENF A;  1A2T A;  3IFD A;  4RGN A;  2R93 B;  3I72 A;  1WTP A;  1T5E A;  4FXD A;  2Y0S B;  1DOL A;  2RQX A;  5FLX L;  4ZKB B;  3NK9 A;  5CC4 A;  5EPJ A;  1U4L A;  3D6W A;  4IZ8 A;  5IGE A;  3GTM B;  4XIG S;  1Z47 A;  2K03 A;  3S16 B;  1WCM B;  3W3A A;  3TBI B;  5HGT A;  1V43 A;  4FF3 A;  3PUZ A;  1BO0 A;  1S4Z A;  5DAU A;  2MPM A;  1LTA D;  5FO9 B;  2XWB B;  1PTO C;  4PMC A;  2EY1 A;  2YYZ A;  5C3W A;  3OW7 A;  5COY A;  4LAA A;  2D9U A;  5FLX E;  1I4G A;  4DA2 A;  1HCZ A;  2K1B A;  3GV3 A;  2R6G A;  4ID6 A;  1F9R A;  3KK7 A;  4OHJ A;  1UEA B;  3VA5 A;  1PRT F;  2F3V A;  3T56 B;  3SK5 A;  3RUZ A;  4C3J G;  1R9T B;  1CA5 A;  4RWS C;  2RSN A;  1JE4 A;  1FNW A;  1G91 A;  2QEJ C;  3SK6 A;  2J0T D;  3GTO B;  4CKB A;  4DK1 A;  4M8A A;  4ZQ3 A;  3A8I E;  3GP7 A;  3ERQ A;  5I9P A;  2RA4 A;  2O2L D;  4OGQ C;  1EYC A;  5C4H A;  3T13 A;  1Q12 A;  3G7L A;  5F2D A;  1LT4 D;  3X3N A;  5JEA G;  3MTS A;  2JA5 B;  3DEO A;  2ENB A;  1Q90 A;  1S5D D;  2I46 A;  3TSS A;  4QIW B;  4XT1 B;  5A2Q L;  2A68 D;  1TY2 A;  3VR2 A;  2BA1 A;  1WTV A;  4KKT A;  1V8Q A;  2AWN A;  1JC7 A;  5D65 A;  3JAM L;  5CV6 A;  5FOB B;  4ZYS A;  4JBW A;  1SEB D;  2F03 A;  2LMC B;  3TP6 A;  1MD2 D;  3I91 A;  3WOF A;  1AW7 A;  2V4D A;  3IKJ A;  3VR4 A;  2A6H C;  2F0P A;  2PNR C;  3P1H A;  4TRD A;  3I73 A;  2F0V A;  2EY5 A;  2IX0 A;  4KD3 A;  2E2I B;  5A2Q E;  3LNN A;  4A3I B;  1D5M C;  3M7N A;  1DYQ A;  5EQ0 A;  3JAM E;  2E2D C;  1STA A;  2HDM A;  1VDZ A;  3Q22 A;  1SYE A;  4BS9 A;  1SE3 A;  2PQE A;  2XNA C;  5LHY 1;  1SE2 A;  1BCP D;  3UI2 A;  1SXT A;  3I90 A;  2F0Q A;  1CM9 A;  2B2W A;  1B44 D;  4FXG C;  3URY A;  1F2M A;  4OO1 I;  1K8O A;  4KMU C;  2NVT B;  5TSS A;  1J9O A;  3MEH A;  4J6H A;  4KV6 A;  2KED A;  4IN3 A;  4BWG B;  4RHR A;  3PV0 A;  1M8A A;  1KLG D;  2F0H A;  2XIW A;  1PZK D;  1HA5 A;  1LT6 D;  4AYB B;  5CMD A;  4X3T A;  1SNQ A;  5FO7 B;  2K28 A;  4DAY A;  2SDF A;  1PXU A;  3I70 A;  1ZYR D;  1G2S A;  4FNF A;  1H9K A;  2KOL A;  1UAP A;  1G6Z A;  1R4P B;  5NUC A;  4HSV A;  3E0J A;  4YIJ A;  1Q3L A;  3K5M A;  5JVG 3;  3HS0 C;  1SMY D;  2EY2 A;  3EVQ A;  1JB3 A;  3GTP B;  1Q1E A;  3TDQ A;  2TMP A;  1EU4 A;  5D14 A;  1ZXT A;  1MI2 A;  4ULL A;  5ELD A;  1EEI D;  1CT1 D;  2E75 C;  3QOL A;  4M1U B;  2L5T A;  2KVM A;  4DXF A;  1EY9 A;  5JPN C;  4KN7 C;  2PW5 A;  2GA4 B;  4KHV A;  4ZUJ A;  1BDO A;  4F87 A;  5C3X A;  3BVM A;  2AUK A;  4IFD I;  3NP8 A;  1O78 A;  5J1Z A;  1XX8 A;  3P7J A;  2D2C C;  2DNC A;  2RDG A;  4G4K A;  1QIL A;  1HQR D;  3PO2 B;  1EY0 A;  1VCI A;  3KUP A;  4NW2 A;  1CK1 A;  3AU7 A;  1E2Z A;  1CHP D;  3M7G A;  4TQU S;  5C0X G;  5KNC A;  4MN3 A;  1Q1B A;  1CZG A;  1EY4 A;  4BBR B;  3NXW A;  3RMH A;  1EY8 A;  4QCL A;  5DNF A;  3CU7 A;  1SJE D;  3BYY B;  3VYT A;  1I50 B;  1SAP A;  4FO2 A;  1C8C A;  4EGV A;  4K5V A;  4TSS A;  2RSO A;  4XQQ A;  2IWH A;  1WD1 A;  1RJT A;  5A35 A;  1QJO A;  1SBB B;  1Y8P B;  5T1I A;  2G9H D;  3HOY B;  4KHZ A;  5ELF A;  5K36 G;  1L0Y B;  1EY5 A;  3LX0 A;  3KBX A;  2B8G A;  1KDC A;  2DNE A;  4PMW A;  1X3Q A;  4L8J A;  5CV4 A;  2XRS D;  4PMB A;  3H91 A;  2EE1 A;  2MUY A;  3S9W A;  3S1Q B;  5KGU A;  2F0L A;  1DXM A;  2B63 B;  2A68 C;  1AP0 A;  5IT9 L;  3A8J E;  1A3V A;  1KLU D;  4B9W A;  1VMC A;  2PYK A;  5JVH 3;  2WAQ B;  2E2H B;  1DM0 B;  3S2D B;  1NCV A;  4WOR A;  1TT2 A;  1JCK B;  2QF7 A;  4K14 A;  1SNP A;  3MVV A;  2L1B A;  3TP5 A;  1PLF A;  2IW3 A;  3GV6 A;  1GHJ A;  5IT9 E;  4EQO A;  1I4H A;  1ICW A;  3E6Z X;  1YNN D;  5LL6 S;  1XWE A;  3HOU B;  3W2D A;  4IUV A;  1SDF A;  1TWG B;  1BNZ A;  3R3O A;  2EYF A;  2F0G A;  1FGB D;  5FO8 B;  1BCP C;  2NTS A;  2A74 C;  5E3F A;  2A69 D;  3ERO A;  1LAB A;  2FIN B;  4RAU C;  1EFI D;  4FVM A;  3FPU B;  1Y1V B;  1LTG D;  2B2V C;  3SE0 A;  1HXY D;  3I3C A;  3QO2 A;  3P20 A;  1O7Y A;  1MSH A;  1MBY A;  1TQO A;  1RHP A;  4R8N A;  4NDX A;  4DF7 A;  1SYC A;  1ZYR C;  4IUN A;  2ZXR A;  3D4W A;  5IIF A;  4RGM A;  3RZD B;  1SMY C;  4A3G B;  3J7A F;  1GUT A;  1JOQ A;  3OMG A;  3GQB A;  3NUC A;  1BR9 A;  3K59 A;  1HFG A;  3M4Y A;  1IW7 D;  1STB A;  3MZ5 A;  5M3M B;  4R9W A;  1PFM A;  3A7L A;  2EYH A;  3S15 B;  2QKI C;  1Z7T A;  1IKL A;  5CV5 A;  1U4M A;  1O80 A;  3GTG B;  4DNR B;  1EOT A;  3SDZ A;  2D62 A;  4G7H C;  4C1N I;  2F0I A;  2RDF A;  1KDB A;  4EVO A;  3C1F A;  1SE4 A;  1GUN A;  4RA8 A;  1TVX A;  4XDX A;  2H1E A;  3DUZ A;  2B39 A;  5CV8 A;  1I3Q B;  5JJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...