5K36H

Structure of an eleven component nuclear rna exosome complex bound to rna
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
353
structure length
289
Chain Sequence
VITITKRNGAFQNSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTPSSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear RNA Exosome at 3.1 angstrom Reveals Substrate Specificities, RNA Paths, and Allosteric Inhibition of Rrp44/Dis3.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
total genus 67
structure length 289
sequence length 353
ec nomenclature
pdb deposition date 2016-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5k36H01
2O5IC 1TU2B 2EJMA 3GD7A 3A8KE 3QG1A 5A35A 4KMUC 1FR3A 3M4YA 4DK1A 5JEAG 1OXXK 2A6ED 3SDZA 1IYVA 1OXSC 2A69C 1E2ZA 1TKWB 3PV0A 4I7ZC 1IW7C 3OW7A 3TZUA 4XTCS 2JEAI 2O5JC 3LWUA 4JBWA 2CW0C 1B9NA 3MFYA 5JEAH 3CRKC 2EDGA 3BDOA 1CI3M 5BN3A 1VCIA 1VF7A 2BE5D 3M85A 4KN4C 1GUOA 1V43A 4DK0A 4BA2I 3A8IE 3D31A 1OXVA 1H9MA 3OOCA 2AUKA 1Z6HA 3KLRA 1Z7TA 4L8JA 4TQUS 3LNNA 4DNRB 4KN7C 4G7OC 3PUWA 3ND8A 3PUVA 2ZT9C 5K36H 1GJXA 2D5DA 3W3AA 1OXTA 2A69D 1FYCA 4JK1C 3U9SA 1ONLA 1E2VA 1DCZA 5BN4A 1GUNA 1Y8NB 1HTPA 1GUSA 1H9KA 3GQBA 3RLFA 5C0XG 3I73A 1CTMA 1HQMC 1IW7D 3PUZA 5KNBA 3P20A 1T5EA 4H13C 1LABA 2K33A 4LK1C 1Q1BA 1YNJC 2R6GA 1QJOA 1HPCA 2F1MA 4KKSA 3VR5A 3PUXA 4OO1H 1O7LA 1H9RA 3H94A 1ZKOA 2QF7A 4DNTB 1GHJA 5C0XH 4GZYC 1DD2A 2Q8IB 2EVBA 1EWHA 3DXJC 1Y8OB 2NN6H 3CRLC 3N6RA 2K32A 1GUGA 3IKJA 3A7LA 2K7VA 3VR3A 3M7NA 4H44C 1Y8PB 3WDNA 1K8OA 2JXMB 5K36G 2E76C 2D62A 2YYZA 1LACA 3VR6A 1YNNC 3IFTA 1H9SB 2A68D 4KHZA 2A6HD 2JE6I 1H9SA 2NN6G 3VA7A 2KCCA 1Q12A 2L5TA 2LMCB 1E2WA 2DNCA 3PUYA 2BA0A 2A6HC 1GUTA 2E74C 1VDZA 4HR7B 2IT1A 2B8FA 2EJFC 2A6EC 3D4RA 3I4LA 3BG3A 3ND9A 2NN6I 1H9JA 3VR4A 2DNEA 5KNCA 2PPBC 4KI0A 4KKTA 2E75C 3MXUA 4IFDG 2EJGC 1B9MA 1GHKA 2AUJD 3A8JE 3FMCA 3QIAA 1CFMA 4XIGS 1PMRA 4KKUA 1I6VC 4BA1I 4OO1G 2V4DA 3VR2A 2A68C 1SMYC 3T53B 3SE0A 1Q1EA 1G291 3EQLC 4TKOB 4RCNA 1HCZA 1ZYRC 4LJZC 4PV1C 5BN5A 1K8MA 3I72A 1O78A 4G7HC 1OXUA 1V8QA 1DXMA 4H0LC 1Q90A 5KNDA 3AB9A 3A7AB 1VF5C 2JEBI 4G7ZC 2BDOA 2D2CC 2KA7A 3OPOA 1A6XA 2BA1A 2B8GA 3HGBA 4IQZA 3T56B 2PNRC 2AWOA 3L7ZC 2DN8A 2PCFB 3T51B 4OGQC 2BE5C 1IYUA 3QJYA 1Y69U 1BDOA 3NE5B 4IFDH 3FPPA
chains in the Genus database with same CATH superfamily
1CM9A 2O5IC 2CQOA 3CW2C 3K8AA 3KLSX 5ELDA 2K5DA 2L11A 3ZJYC 2A6ED 4FXGC 1JMCA 5IWAQ 3PO3H 1TS5A 3NTHA 4GKJL 3OTOL 4JI2Q 4JI5L 1HR0Q 2QDBA 1VQKA 4PNYA 1Z6HA 1EL0A 4KN7C 3CD6A 3AYHB 4IUVA 3K7AB 1FGBD 2RF4A 3U9SA 5A2QL 2OCEA 2EOTA 1JCKB 1J9OA 4IURA 5TSSA 3S9WA 3HOVG 2G9HD 3K5OA 2JA5G 3G6JB 5I9OA 3UE0A 2KCMA 1HQMC 3STBC 4XQNA 2MNAA 1D1KA 3K0YA 1PH4A 1HRJA 2WAQB 1WD1A 2CH4W 4A3DB 3OHXC 1EWHA 3I3CA 2J4XA 1HFNA 1TY2A 3M3YH 2ID0A 2K32A 4X62Q 3J81c 5LMUQ 2WACA 1QVGA 2MUYA 3WDNA 3PF4A 1MHWC 4YY3L 4A3BG 4RKBA 2AQ2B 1YNNC 2KCCA 2LMCB 3HKSA 3TZDA 5GADC 3EA6A 5IYDH 1QVFA 2A6EC 5E3FA 3BJUA 1SRUA 1FNVA 2QEJC 1B3AA 2PI2E 1CKNA 2Y0SB 3A8JE 4LUVA 2RCFA 5H1SE 2Q2TA 1EZ8A 3HOWB 2R92B 1PTOD 5C4ZA 4JYAL 3IRBA 1YEZA 1Y1VH 1I4RA 2KENA 4JI0Q 2PZUA 3QOJA 4MIUA 4JOIA 1I3QB 1R9TB 3S1NB 2RBMA 5ELOA 5EKKA 1SFOB 1KNEA 3T56B 4F7XA 4A3EB 4JI6Q 1Q3LA 1SROA 4OGQC 2IL8A 4HJ7A 3DM1A 3S1QB 2Q8RE 4NPSA 5KEEA 4X64Q 3OW2A 1NUCA 2F3VA 2NVTB 4FVMA 2RSNA 3H0GH 4BS9A 3J81j 1MKHA 1JR0D 3K57A 2C5CA 4ZAIA 1NR4A 4CJ1B 3LWUA 4QB4A 1RD9D 2IJ0A 4NXNQ 4MHEA 4HIMA 3QWNA 1OXVA 4DNRB 4NW2A 4TQUS 4K5VA 2QW7A 1HHVA 3DUZA 3PSIA 4C1NK 4GOPA 4NXNL 1WTRA 4C3JH 5LHY1 4QGUA 1RHPA 2I5HA 2F0EA 4DAYA 5E1FA 1A0IA 1BBUA 4OX9Q 5JAVA 1HA6A 1Y8NB 1HTPA 1Z47A 3D6WA 4DAPA 3I73A 1A2UA 2M00A 2AMCB 3NELA 2JA7G 1B50A 1LYLA 4QF4A 5JVH3 4BY7G 1VQOA 3H94A 5E4WC 1PFNA 2F3WA 2Q2HA 3EIVA 4GZYC 4P71A 1WTOA 2F4VQ 2K75A 2CVRA 5L37A 4CDCC 3A7LA 2K7VA 3OIPA 3RLOA 1X9NA 1K3BC 1Q81C 3AEVA 2YYZA 3VR6A 1BKBA 4AQYQ 4JI2L 1VMCA 4JV5L 1XMQQ 3GTJB 4WJ3M 1Q12A 2KEEA 3CKIB 2DNCA 1NBWA 2E74C 3WOEA 3I4LA 3NTIA 2AQ1B 5EBCA 4X65Q 4KI0A 5KRUA 4NXML 4NP5A 3CCLA 2F3IA 4HSVA 3R3OA 4KKUA 5CV4A 3SK5A 4I65A 5M3FG 1HCZA 4A3MB 1DOMA 4G7HC 1A62A 1GXDC 1ILPA 2ZXPA 4A3LG 2B2VC 4XXEA 1AFPA 1CSPA 4PMWA 1EEFD 2RHSB 1IL8A 5IYCH 3S24A 2XRQD 1QNKA 1LO5D 4IQZA 3T13A 1B2TA 4JYAQ 4HMIA 4V190 3QJYA 2A5HA 3S17H 4J1MA 3ULPA 1PDQA 5JOBA 4A75A 5IGCA 5JEAG 4IJHA 1E1OA 2X6LA 2H4OA 5JVG3 1N32Q 1X3EA 4AYBG 5AJ3Q 2EY2A 5COYA 3NBIA 1TR5A 3G6EA 2WAQE 4ZLTF 1TS4A 4K6LA 4CDDC 3GTMB 2F0KA 4C3HG 3OOCA 4OHJA 3VYUA 3FRPB 4CKEA 1LTTD 2N3SA 1GJXA 3GTQB 1C4QA 1FYCA 2Z6KC 4HCEA 3HKZG 1VQ6A 4ZYSA 3KBGA 3CCSA 5IGGA 2JN4A 3KF6A 1U5KA 2JSOA 4KHPQ 1IZ6A 3U9OA 3DEPA 4BXXH 2KBNA 2F1MA 3PUXA 3OWEB 3G7LA 1HUNA 3DMUA 4PQXA 5ELBA 1Q8IA 2VUMB 4BBSB 1HJPA 3M7NA 2SEBD 2LY7A 2HD3A 4LMQD 1VQ7A 4XT3B 1L0XB 3PMFA 4JVZA 2E2DC 4IUUA 2JE6I 3B6YA 2UUCL 4IPHA 4J6HA 4C3JB 5IWAL 4C3IB 3CQZB 5IE8A 3CCJA 3GTGH 4HEDA 5M3MH 2K04A 1B9MA 4KD3A 2E2JB 4R4OA 1CFMA 4BA1I 2LSSA 3JC66 5NUCA 4X3UA 5DLQE 4O0AA 3SE0A 2B2YC 1AZQA 1BR9A 4QY7A 5C3EH 4FF3A 1SE8A 3PQIA 1VQCA 1VQPA 4A3GB 1LT3D 1C7YA 1AE3A 1LUZA 1OXUA 4GKJQ 3GTJH 3RNUA 4JV5Q 1B7YB 2HDMA 3UI2A 4ZKBB 1CQFA 3U50C 2PQEA 1EEID 2JEBI 3OMGA 1I94Q 1A6XA 2VQEL 1MBYA 1SYCA 4C2MB 2EY1A 3Q6SA 3K59A 2L12A 4CBVA 1FJGL 1EOVA 1AN8A 3GD7A 3QG1A 3PO2B 5DEHA 3VYSA 4BY7B 3M4OH 3HOUB 1BBXC 4GNXA 1PV4A 3PO2G 1IYVA 1A15A 2MO0A 2UUAL 4KHVA 1PH5A 1JC7A 3NTKA 1B9NA 5IOCA 3BDOA 1L0WA 1S5ED 1ENCA 4B3SQ 3QR8A 1GVPA 3NHHA 1H9MA 4K5XA 4K14A 3TQYA 2AKWB 2ZTDA 2R7ZG 4KJOA 1EQRA 3K80C 3PUWA 1LT6D 2RCNA 1OXTA 4RHSA 3GTMH 1GOZA 3S14B 1DCZA 1RKNA 5EPKA 4DU9A 1M90C 3MXNA 1CHQD 2G5DA 1G8ZD 3GO5A 2EY5A 3P7JA 5FOBB 4A3JB 4A93B 1M8AA 3KOJA 4CDFC 1IBMQ 5C4XG 4KJNA 1PA6A 1EY9A 1ZKOA 1G2TA 4BY1G 4ME5A 3HOVB 2N8NA 3ULJA 4JI7Q 2ATWA 3MC0B 4LFCQ 4RGOS 2HUGA 3PCOB 3GDEA 4DR2Q 5CV7A 3R93A 4KHPL 2RKSA 1C0AA 5JJZA 4KV6A 4A3EH 1YBYA 4KTAA 2A6HD 2VUMH 3R2TA 1XMOL 3TSSA 4BBSH 3D3RA 4FXDA 3HOVH 2R93G 4A3MG 2D0OA 3TMEA 2NN6I 5I2XA 5KNCA 1AH9A 2EXDA 5I6WA 2FMMA 4LF6Q 4A3FH 5M5YH 2B29A 2A68C 4UP8A 3EJIA 1NE3A 2XWBB 1P8LA 1DONA 1YHBA 4PV1C 3I72A 4R4TA 4LNQA 1V8QA 4EQNA 1UNSA 2UXCQ 1QWYA 2JA8B 3MZ5A 4XYOA 4DV3L 2UUBQ 2YTYA 4IPDA 1S4ZA 5CV8A 4NMZA 3K7UC 3NE5B 4DV4L 4A3EG 2PQAA 2NBFA 4S3SA 1ASZA 4AYBE 5C5MA 2K52A 4N8FA 1IW7C 2QDLA 4JPBW 4ZQ3A 4IFDJ 1PTOH 3TP6A 2QCPX 4BBRB 4DR6Q 3WOFA 3CRKC 2OT2A 4A3FG 1AP0A 2VZAA 1CHPD 1YI2A 4C56C 5K36H 4NXMQ 5FLXL 1VQ4A 1PTOC 1FNWA 3NXWA 2Y0SE 1RIPA 2UUAQ 4LWCA 1MSGA 5A2QE 3HKZE 3J81L 4RFBA 2HHHL 4AH6A 3ITPA 4IZ8A 1CZWA 1HPCA 5T1IA 3AFQA 1BUVT 4OO1H 1H9RA 1MGSA 1WCMG 1II3A 4PG3A 2XTIA 2K50A 4FP5D 3D8GA 3IKJA 4IOCA 2WB1G 5M5WH 1KAWA 3AU7A 4DR3Q 1YNJD 1T5XD 5C4HA 1N33Q 4IOAA 1EIGA 3CP0A 1PRTB 2FHTA 1H9SB 1AW7A 3I90A 3VA7A 3HOUH 3A55A 2EYHA 2DJFC 1EU3A 5IGEA 2ZTCA 1ENAA 2DJGC 2MGSA 2DNEA 1O7IA 4FXKC 4BY1H 2R92H 2CWPA 2L1BA 2FJ2A 4DR5Q 3HOWH 3PO3B 1KQSA 3T16A 2YTVA 4DV5Q 3E0JA 3S2HH 2KECA 5IIFA 3SGIA 2PW5A 3U4ZA 4K2KA 2UXBL 1TWHB 4X66L 1FVIA 3NEMA 3CC7A 3RZDB 1I4QA 4H0LC 5KNDA 1PZJD 4DN4M 3CCQA 3A7AB 1JWSD 2BDOA 5M3FB 4RAUC 4A3KB 3GTLB 4UP7A 4L5QA 3T51B 2A19A 4QIWE 4EGVA 2ES2A 2XN9C 4BBRH 4POGA 4RA8A 3HOYG 5IT9L 1CKMA 1XNQL 3H0GB 4HTHA 3T1YQ 3A5ZB 4YY3Q 1F2LA 2B2UC 3NP8A 2Z0SA 1R4PB 1V1OA 2CW0C 1HZAA 5IYDG 3MFYA 4CJ2C 2EDGA 4A3MH 1I3QH 5DM63 1KIXA 4DPGA 1BO0A 1JOKA 4LF6L 4P75A 4PZ7A 1VQ9A 3D31A 2AQ3B 1KDAA 2I0QA 3KF8A 4ZKCB 2XRSD 2WP8J 4C3HB 1L1OC 2HCIA 3E0EA 4DV1Q 2A69D 3ONAB 2A73B 1S5CD 1WTWA 3K81C 5CBEE 2RVLA 1DOKA 4NB3A 3NWTA 4R4QA 1UE5A 3A5UA 2SDFA 5E4XA 4H13C 2E2IB 1ESRA 1SEBD 1UUPA 1O80A 3K6OA 3SVMA 3DEOA 1MSHA 2QKIC 2Z6KA 1PHJA 5CGKA 1SLJA 3M9BA 1KABA 1EY0A 3DXJC 5CV6A 2ZJRA 4DV3Q 2UUBL 2JYOA 1PH8A 1D5XC 1EYAA 4BXXG 4A3BB 2CH4A 1K83B 3BDLA 1Z9FA 4ODGA 1A3VA 1QE6A 2Q2UA 3HFZB 4LF8Q 2E2HH 1XXGA 4X3SA 1HZBA 1SNPA 2NN6G 2WB1E 4JBJA 4DR1L 3UDGA 5IP9H 2F0WA 3NUCA 4HR7B 4CGYB 2IT1A 1VQ5A 2GVBA 1UEBA 1DGSA 2Y0SG 1J8IA 5IGFA 4KKTA 2OQKA 5LMUL 4JBKA 3CCUA 3VA5A 3TRZA 2JA8G 2B2TA 4C3JG 1I6HH 5J3BA 3S1MB 5GAHC 2AWNA 1SYDA 1PH2A 2L0CA 4DXFA 3KLWA 3KBXA 1NJIC 4N8X1 2WINB 2D2CC 3J7A5 4JI7L 4UY8C 2B63G 1B44D 2K03A 4DV5L 1XJVA 1HH2P 3GTQH 3DLLA 4GS3A 4UP9A 5C4XH 2O2LD 3J7ZC 3W1GA 4P74A 1TU2B 4HIKA 3HOXH 4UPAA 3EFXD 4A3FB 2F0JA 4WORA 1HZCA 1M1KC 2K4KA 1E2ZA 4B3TL 2OEOA 1DYQA 3HOUG 4XTCS 2MQHA 4A3BH 4GNXB 1K3RA 2JP1A 1VCIA 1DJRD 1QILA 1TWCB 3F1ZA 1JE5A 4ZUJA 1ET9A 1FL0A 2JA8H 2YU9H 2AUKA 3HOZB 1SXTA 3LNNA 1ILQA 1RTOA 4LFCL 1I50B 1G6ZA 1STAA 3ND8A 2ZT9C 3HOZG 3RN5A 4GLXA 1E1TA 4IUPA 3C1FA 1RDPD 4DR6L 1E24A 4WJWA 4J15A 3GQBA 1KDBA 1X56A 3PUZA 1X6OA 3J81E 1K8GA 5M3MG 1QJOA 3RZDH 3S1MH 1EYDA 5FKAC 3RR5A 4Z9CB 4OWWB 1TWGB 1JOQA 2EQSA 1QB5D 5FO8B 3GTOH 4B3RQ 1TY0A 4ZUIA 1IYJB 2R7ZH 3HOYH 1HNZQ 1JWUD 3FKIH 1X65A 4KHZA 1NMGA 3K5LA 4XDXA 2F0GA 4QIWB 5IYCG 2A6HC 3UDFA 1A63A 3DWQA 2M2LA 3MEFA 3VR4A 1SNDA 2PZTA 2PMZB 4ZCKA 2CFMA 2ENBA 5FLXc 1NR2A 2JA6G 2PNHA 4DV4Q 3I4MG 1I6VC 3W2DA 3KFUA 2B2WA 3H91A 4JI6L 4PMBA 2DGYA 1MJEA 4DR4L 1CUKA 2KEDA 2LS01 4MTNA 1K8MA 4DV2Q 1WTHA 1O78A 1EQTA 1I94L 1LT5D 4JBMA 4P73A 3BZDB 3CAMA 4LF8L 1ET6A 4QUCA 5CR3A 1LT4D 4DR5L 4LF5Q 4IN3A 2NVQB 2PNRC 5I4DA 3KF8B 4POFA 3UDXA 1TS2A 1EQVA 2AHOB 3TEHB 2K5QA 4JI3Q 1JT8A 2GVAA 4A3DH 5AFWA 5FJ8G 3A54A 3RN2A 4X3TA 4DNIA 2EE1A 2B2WC 3KLRA 1VQHA 1SSOA 2F0HA 4JI1L 3D0FA 5BR8L 1PFMA 5JPNC 1V9PA 2NZ1D 4F8MA 1HZ9A 2QGQA 3TP5A 2K05A 1ONLA 2OXPA 3J80E 2K5VA 4V0BA 2VNUD 3MTSA 1JWMD 5FLMG 3F2BA 3I91A 4DV0Q 3MVVA 1GUNA 2ZXOA 1VQEA 1PRTD 5C4JB 2N78A 3H3VH 5FO9B 4B3RL 3ER0A 3R8BA 4DF7A 1Y1VB 5IGDA 4LUOA 4R1JA 4X65L 1BXTA 5IT9c 1S3OA 1GUGA 2FMCA 3TP7A 1TWFH 5FJ8H 5IODA 4A3IB 1PXUA 2LXKA 5IP7G 2D62A 1KD1C 4QCLA 1KAAA 5G3LF 2D0PA 1H9SA 3J7YW 3C46A 3OTOQ 1C9OA 1RF2D 3GTPH 3R2IA 2BA0A 2KQ3A 1EUJA 3O13A 2NTTA 1HR0W 1EFID 1P16A 4GN5A 4ZK9B 5KYLA 3GTKB 4C1NI 1A3TA 1F2YA 3MXPA 1RJTA 1D1IA 1C48A 1SAPA 4XIGS 3CPWA 3ERSX 5JPMC 1SNQA 3VR2A 1SMYC 1K73C 4HJ8A 1WTPA 3W5OA 1HTLD 2F0TA 5M5XH 2B63B 2UXDQ 5J22A 4Q5VA 2H1EA 2FINB 1MIUA 5M9OA 1JICA 1XTCD 4UAIA 2B2TC 4PMCA 3AFPA 5CBAE 4OWXB 3HGBA 4GN4B 2AWOA 2F0QA 2JA6H 1FGUA 1HUMA 2MFIA 3MEHA 2MP1A 4YCVA 1ASYA 4N9PA 1HNXL 4JI8Q 2R7DA 1FR3A 4FDBA 3GTGB 3C3LA 4L5SA 3BVZA 3SDZA 2VQFL 4I7ZC 3D4DA 3TZUA 2F0PA 2J0TD 4LFAQ 1STEA 3F2UA 4B3TQ 4QUFA 2K6AA 5IYBG 3SK8A 3C1EA 3NWSA 2BE5D 2PQAB 4B9WA 2E2HB 1G91A 3A8IE 3GTLH 2YU9B 2N88A 3RZOH 1LV9A 2NYZD 3W1BA 4DR7Q 3C2PA 2RDGA 1SYFA 2D5DA 4NDXA 1SMYD 2WKDA 5C4XB 3PF5A 4F87A 5CV5A 3UDIA 5J1ZA 1BNZA 1EY5A 1VQDA 1HQRD 2F0UA 1B3QA 1PTOF 3TP8A 1I5FA 4JOIC 2EXZA 4X64L 1LABA 1EYGA 4HIDA 1S5DD 5KIXA 3VYRA 1I4XA 2O4XA 1S40A 3I56A 3H15A 5CC4A 5IT9E 2WAQG 5F2DA 5I2YA 2EVBA 5LMNQ 4LW1A 4A3GH 4C3HH 4EVOA 5M5YB 3N52A 1U9RA 2NB0A 1WFQA 4HN7A 4P72A 3PIP3 2VXWA 1NTGA 2L15A 2NZOA 2JA6B 2JQOA 1IKMA 2A68D 2ASBA 1IBKL 2Z4HA 2CKZB 1Q46A 1WI5A 3S17B 3I4NH 3M3YB 4ABNA 1HA5A 4BBSG 4O2DA 3HOWG 4QQBX 1ML0D 2RSOA 1W2BA 2BH2A 4A3CG 3K0XA 1YHAA 4IUQA 4HAEA 1IL2A 1EFWA 1YNND 3HZXA 3A0JA 1F2MA 3EQLC 5KGUA 4JW0A 4HJAA 3K5NA 4K6DA 3MXNB 1TVXA 5HY6A 1K83H 1GKHA 1XWEA 1YIJA 3VYTA 4NKLA 5CMDA 5M3FH 2RQXA 4K2LA 4A3GG 2EY6A 2B8GA 5JJKA 2SNSA 3Q24A 3L7ZC 3H3VI 2EPBA 2PCFB 2PYKA 1IYUA 1A8VA 2Q2IA 3H3VC 1L2FA 3FEWX 3QB3A 2RDHA 1SNOA 4XQJA 3G48A 4DK1A 2BDNA 4AQYL 5DAUA 1OXSC 2L55A 3PV0A 4GNXC 1LM0A 2B39A 3I8ZA 1STGA 2R61A 5CORA 3MWYW 3BDCA 5BN3A 2OTJA 5C3WA 4LFBL 3IL8A 2BOSA 4PZ6A 1QZGA 3RLNA 1OO9B 1E3PA 1STYA 2XGTA 4X6AH 3S16H 2F0LA 4QL5A 5IP7H 3S2DB 1YHQA 2PMZE 1F2ZA 1QG7A 3J7AV 1LTBD 3J80i 5EJWA 2VQFQ 1SDFA 4LF9Q 5KNBA 1N33L 4A93H 1XPOA 4C2MH 2MHVA 1Q1BA 1SMXA 2VB2X 2WB1B 5I9PA 2QA4A 3DHQA 2NVXB 1LTRD 1D2BA 3CCMA 1UE1A 5ISRA 4IUTA 4LFBQ 2N55A 3FVQA 2MJ8A 3Q0AA 4P2CB 1WTXA 1Y1WG 3J80L 4O42A 4GKKL 1PFBA 1LACA 4B9XA 1ZEQX 2K1BA 5CV9A 4KD4A 1SR3A 4DA2A 2UU9Q 4EQ5A 1GD7A 1E2WA 3S1RH 3HS0C 1JJCB 3D4RA 4GKKQ 1XPUA 1PH7A 3MXUA 2Z4IA 4IFDG 4H7BA 1KC8C 2AUJD 1V1PB 1YITA 3FPUB 2L4NA 4ZRZA 1JB7A 1X55A 2K5NA 1K0RA 4RCNA 5FK9C 1N36L 1U4PA 3TREA 3KF6B 3S16B 2F0VA 2E2IH 1UEAB 4OIKA 1F9RA 4A3KG 2IPKD 4R8NA 1BBWA 1NNXA 2Z1CA 1B4OA 1YZ6A 5FO7B 4X62L 1KRTA 4A3CH 4XYQA 3BU2A 1WTQA 1PH1A 1PVOA 3GP7A 4YHHL 1ZXTA 2IW3A 1D5ZC 1IBKQ 4EX5A 4AYBB 2HCCA 3G4SA 4RGMA 1KDCA 1TKWB 1XNQQ 3RMHA 3RD4A 1F9PA 4I7AA 2HDLA 4DR4Q 3Q22A 4MN3A 2NVYB 2F4VL 4DV2L 3KLSA 4DV1L 4QMGA 4A76A 1VF7A 2JA7H 4K0KL 4LUZA 2XNAC 2ZJPA 3OIQA 5EAYA 4MNOA 4KY6A 1TWAH 3CMAA 3J81i 5JEAJ 3I2ZA 5GAEC 1XPRA 3HOXG 1L1OB 1SFOH 5IP9G 1KLGD 4UHVA 2R7FA 3ZYYX 4DK3C 3HOXB 2OWOA 4OL7A 3T4AC 3BVMA 1HNXQ 1VQNA 4KKSA 2BH8A 3M7GA 1A2TA 3I4MH 4DFAA 1TQOA 3CCVA 1JE4A 4MTKA 1CT1D 1NSNS 1Y8OB 3CRLC 1Q7YC 3N6RA 3S2HB 1I50H 3H09A 2K01A 1QVCA 3GV3A 1EY8A 3MHBA 5ELCA 4L63B 3G71A 1YVCA 4OEMB 1SYBA 2L5TA 4JI8L 4DV6Q 5D65A 4IO9A 2A74C 1XMQL 2B2UA 2HIVA 2EJFC 4M1UB 2G9DA 4TRDA 2WIIB 3E6ZX 2EYJA 1PYWD 4DK6C 1R9TH 1WVLA 1EOTA 3CCEA 4RH6A 5FLXE 3V96A 4TKOB 4HSPA 1I4HA 3DWAA 2OQ0A 5BN5A 5EKLA 1EIYB 1RODA 1EQQA 1IBLL 2MPMA 1JORA 4PZ8A 4RMFA 1IXRA 1PYBA 3FKIB 1H95A 5ELEA 1HFGA 4DAYB 1G51A 1O7ZA 4DUZQ 2IX3A 2BA1A 4GOPB 1TWGH 5C3EB 2KHJA 1PH6A 4RG1A 1LTSD 2IX0A 3MFGA 3TS2A 1SNCA 3S1RB 2F0SA 1CA6A 4Q0FA 3I7FA 1VQGA 5D3DA 5A35A 2RA4A 4JI4Q 2E8GA 4CKBA 4ALPA 1JJ2A 4R4IA 5D3IB 1T9HA 3M4QA 2K5WA 1UWVA 2F0IA 5DM73 3CC4A 3NENA 3V2TA 1VQBA 5M5XB 3MXGA 3U4VA 3M85A 4KN4C 4BA2I 1SNMA 4A4IA 4JCVE 3H0GG 4CJ0B 4G7OC 1X32A 3NPPA 4IPGA 2HIXA 2R7ZB 3GV6A 1RTNA 3L2PA 1DM0B 3CHBD 1QNUA 3SXHA 1U0LA 4OO1I 2KHIA 3E9IA 2I07B 3SK6A 4YWKA 3CU7A 4E6IA 4A93G 1VS0A 3FDTA 1CKNB 3X3MA 2EIFA 2WFWA 4XT1B 3AMUA 1KLUD 5K5PA 1SJHD 1TS3A 1Q8KA 3UE1A 1FD7D 1Y8PB 3DWPA 5AJ3L 2HHHQ 4A3LH 3L9AX 2EYOA 2JXMB 4YCUA 4WJ4A 3D6CA 1J6QA 4JI3L 3IFTA 5EKIA 4A3DG 1KRSA 5HURA 1K28A 1BCPD 1VDZA 3K58A 4GLAC 1RCVD 1ESFA 3BG3A 4GN3B 1B70B 3GTKH 3CCRA 3Q23A 3KK7A 2K14A 3PGZA 2E75C 3I4MB 4RKLA 2KCTA 2A1AA 3QIAA 4IPCA 2BCOA 3ERQA 1G291 4ULLA 2NZHA 1JB3A 1YJNA 4X66Q 4LF5L 2EYPA 1CZGA 2JA5H 1N32L 3I4NB 3NBHA 3URYA 4JI0L 1F77A 1SYEA 1EWIA 1SE3A 2XVSA 2DN8A 3EROA 4LJZC 4HJ9A 1VQIA 2PI2A 4FF2A 1KNAA 1EYCA 2Z8LA 4O1NA 4LAAA 3AQQA 2RHQB 4DUYQ 1CI3M 4HMJA 4BBRG 3CC2A 3F8TA 1VQ8A 4DK0A 1SBBB 2TMPA 4HCSA 4YHHQ 2GA4B 1Z7TA 3CMEA 1PZID 2CQAA 4EQOA 2ZTEA 1PFSA 4BY7H 1Y1VG 2X69A 1X3PA 1AE2A 5BN4A 4YWMA 4Y7NH 2J7ZA 2X6GA 1J5EL 2CHBD 2FFKB 2UU9L 5C0XG 2YTXA 2ZXRA 1D5MC 3SHLA 1CTMA 4BWGB 4RGNA 1T5EA 1SJED 2K33A 3EVQA 3P75A 3KJOA 1YNJC 4ID6A 1JJGA 4JI1Q 1TXYA 1O7LA 3X3NA 5C6AA 5HGTA 4DNTB 1GHJA 5C0XH 1OTCA 2D9UA 2VS1A 1ICFB 4C3IG 4HIOA 1TWAB 4A3IG 1U4RA 2CWAA 5M3MB 2UUCQ 2MO1A 1VQAA 5K36G 2KUMA 2F0OA 2YV5A 4L6TB 1IKLA 2XWJB 1NAPA 4H02A 4LFAL 1X54A 4DXGA 3STBD 5JJLA 2IY5B 5IYBH 3S14H 1XYIA 1H9JA 2SNMA 1Y1WB 2IHFA 1R4QB 2F0NA 2CW0D 3EN2A 1BCPF 2C35B 2SOBA 3FMCA 1QOHA 1PMRA 2V4DA 4G4KA 2KCNA 2NVTH 2JK8A 3BYTB 1ZYRC 2Q8TA 1ENFA 4RWSC 4U68A 1Q90A 5LL6S 4YWLA 3S1NH 4YIJA 2NWGA 3H6MA 3PIOA 1IBLQ 4WFN3 1I4GA 1UE6A 2K28A 1TWCH 4LF7Q 1WCMH 1CK1A 1S72A 3M4PA 1Y69U 4RGTA 1TWHH 4ILWA 3HOYB 4R8IA 4IFDH 1SE2A 2K5HA 2EJMA 3A8KE 1XMOQ 4KMUC 4U673 2A8VA 1LTLA 1AEXA 4OONA 5C4JH 3OW7A 3T1HL 2Z6BA 4RCOA 3E9HA 4N9TA 2LXJA 3TN2A 4APVA 2TSSA 2XIWA 1FNUA 2KOLA 5LL6X 3KDFB 1S5BD 2JA5B 2DY8A 1U4LA 3KJPA 2ICIA 4LF7L 1D7QA 1IBML 1DZ1A 5EPJA 1V1QA 3A74A 3MA2B 3PUVA 2V1CC 3CXCA 4DGZA 4R4CA 2ICEC 3NBHB 3JAME 4MZ9A 1YNXA 2KVMA 3BYYB 3OWFA 4YCWA 1ICWA 3J7AF 4IFDI 3SK4A 4BY1B 3I4OA 4KLKA 4B3ML 1YJ9A 1VQMA 1W3SA 1H9KA 4DR2L 4A3JH 1EIHA 4LK1C 1D8LA 2R6GA 2E5LQ 5D14A 3OMCA 1EWCA 4KK7A 4DV7L 1NCVA 2QF7A 3EBEA 2CCZA 1HNWL 2N49A 2FXQA 1QCBD 1PH9A 4DAMA 4KY7A 1M4VA 3HG9A 4FYDA 2R93H 2NTSA 2KHSA 5EGTA 4R9WA 3RUZA 1K8OA 1B1ZA 1XNRQ 1BVSA 1TT2A 2R92G 2NVQH 2B2VA 2HQLA 4JI4L 4B3MQ 5KYIA 3KYHC 3Q8DA 3PUYA 1B8AA 3OSOA 1XNRL 4DKAC 1JQYD 3FP9A 2I5LX 2PPBC 1U4MA 2VW9A 1WTVA 2NVXH 3BS1A 1Q86C 4UDUC 5ELNA 1KXLA 1K8AC 1HR0L 5E7NA 4L5RC 3QO2A 2ZM6L 3L3OC 4G57A 1Q82C 1RL2A 1STNA 3S15B 2RDFA 1BF4A 2EYLA 4ME3A 1DXMA 4F88A 2ZM6Q 3T1YL 1E7ZA 3U58A 1HNZL 1WD0A 1EY4A 3RZOB 1N9WA 5LMNW 3JAMc 1MD2D 2B3GA 1QUQA 1FJGQ 1I4PA 4XQQA 4J8QA 1BDOA 3E3XA 3FKIG 4L5TA 1HXYD 2Z9HA 4A3KH 4LF4L 1IHZA 3IAYA 1Y1WH 1OXXK 3QOLA 3FHWA 3MAQA 4JI5Q 2HT1A 3E5SA 3V05A 2JEAI 1UE7A 4LF4Q 2O5JC 1WYDA 4JBWA 1Y14B 2LFNA 5I6YA 1C8CA 1BCPB 1V43A 1QZHA 4C3IH 1W6JA 3A56A 5JJIA 1CQVA 1EU4A 4B08A 1KHIA 1PRTF 1QUQB 4K5WA 3JAML 2B63H 1WJJA 3W3AA 3WWVA 5C0XI 1E2VA 3BZCA 4DV0L 2M9VA 1WCMB 2HQEA 4Y7NB 3PIO3 2F03A 4FF1A 4DV6L 2OF1A 1BOSA 4TVAB 1GUSA 1PLFA 2WV6D 3I55A 1IW7D 3P20A 3PO2H 3CPFA 1JOOA 2UXDL 3M4OB 2IWHA 3VDYA 3JAMi 1PYSB 1NY4A 4CDEC 5FLMH 1DD2A 4OXPA 3TBIB 2OTLA 1VMPA 1D6EC 3I70A 4EQPA 4DUYL 1GUWA 4A3JG 3GTPB 1GM5A 4LF9L 2E76C 4OX9L 3PO3G 1SN8A 3BZKA 2VB3X 5C5LA 1A3UA 5T1GA 4DR1Q 1GUTA 3IFDA 1S5FD 3J80c 2B8FA 5LMNL 1CA5A 1DOLA 1N34Q 3L0OA 5GROA 1STHA 1L0YB 4X3KA 2EYMA 5ELFA 2WKCA 4K8IA 1LLRD 2E2JH 4FO2A 1ZYRD 4KY5A 1B53A 3PIPA 1K0SA 3LX0A 4IJLA 2ZJQA 3BVGA 3T53B 1AZPA 1SE4A 1N34L 2DY7A 2R93B 2C9OA 1MJCA 3HOZH 1X3QA 2IHEA 3AB9A 2PO4A 2F4IA 3ULLA 1J5EQ 2NVYH 1VF5C 1L1OA 3NSWA 4OWTB 5EPLA 4G7ZC 2KA7A 4OELB 3F2DA 1HNWQ 3LWEA 3I4NG 1K9MC 3S2DH 2JA9A 2JJQA 2BE5C 1KTKA 1GO3E 2VY3A 5IY0A 2I46A 2E5LL 1LTGD 1NMFA 5DNFA 4DV7Q 3KDFA 3NQIA 3HRZC 1I6HB 3M4YA 1UAPA 4CHTB 2UXCL 5C44B 5IGBA 3NK9A 2A69C 5EQ0A 3S15H 5C3XA 1VQFA 3OYYA 5C44G 1F9SA 1CSQA 4OIJA 3TDQA 4QJFA 3T1HQ 5JEAH 1F9QA 3HKZB 1BQQT 4IUNA 1EY7A 1GUOA 2NUCA 1EY6A 2LKVA 4L8JA 1W6KA 2XSCA 2VQEQ 5C44H 4DR7L 4WRDA 2EYFA 5CYUA 1X3FA 4Y52H 2F0DA 4B3SL 4JK1C 2IX1A 4HJ5A 1EZ6A 4TSSA 2ALYB 3NQTA 4GLVB 5EBDA 1YJWA 1WOCA 1LTID 5GQOA 3RLFA 4FNFA 2F52A 1XTDA 2PZWA 2L9HA 1EIFA 1E22A 1TWFB 3CQZH 4IALA 4A3IH 3DM3A 2F0MA 3VR5A 4CKCA 1LTAD 4AIMA 1V1PA 4JC0A 2VUMG 1G2SA 2Q8IB 3D4WA 2NN6H 3HP3A 2H5XA 3VR3A 3LGJA 1PRTC 4H44C 3HEJA 2JA7B 1N8RC 1O7YA 2KJXA 1X3GA 3GTOB 1N36Q 1PZKD 3K5MA 1CKOA 4FF4A 2UXBQ 3K7AH 3ND9A 4DR3L 1XX8A 1PH3A 3KUPA 2B2YA 3ICEA 2EJGC 4GOPC 3SEBA 5GAGC 2EZVA 1GHKA 2DUDA 4K8JA 2F0FA 4DUZL 3SR1A 1G6PA 2GN5A 2VL6A 2QEXA 4OO1G 1E0BA 2R3ZA 3F2CA 1Q1EA 1KL9A 4DAVA 1SYGA 3TS0A 1TIID 1PTOB 4JG2A 3P1HA 2QILA 2P5ZX 3CF5A 1VQJA 2I5MX 2PW7A 4M8AA 5BR8Q 5C3EG 1BCPC 5M5WB 3S1QH 1VQLA 3OPOA 1MI2A 5HGQA 5G3LD 5C0XJ 4RHRA 4K0KQ 1STBA 5J39A 3FPPA
chains in the Genus database with same CATH topology
1CM9A 2O5IC 3KLSX 5ELDA 2K5DA 2L11A 2A6ED 4FXGC 1TS5A 3NTHA 2QDBA 4PNYA 1Z6HA 1EL0A 4KN7C 4IUVA 3K7AB 1FGBD 3U9SA 5A2QL 2EOTA 1JCKB 1J9OA 4IURA 5TSSA 3S9WA 2G9HD 3K5OA 3G6JB 5I9OA 1HQMC 4XQNA 1D1KA 3K0YA 1HRJA 2WAQB 1WD1A 4A3DB 3OHXC 1EWHA 3I3CA 2J4XA 1HFNA 1TY2A 2ID0A 2K32A 2WACA 2MUYA 3WDNA 4RKBA 2AQ2B 1YNNC 2KCCA 2LMCB 3TZDA 3EA6A 2A6EC 5E3FA 1FNVA 2QEJC 1B3AA 2Y0SB 3HOWB 3A8JE 2R92B 1EZ8A 1PTOD 5C4ZA 1I4RA 2PZUA 3QOJA 4MIUA 1I3QB 1R9TB 3S1NB 2RBMA 5EKKA 1SFOB 1KNEA 3T56B 4F7XA 4A3EB 1Q3LA 4OGQC 2IL8A 3DM1A 3S1QB 2Q8RE 5KEEA 1NUCA 2F3VA 2NVTB 4FVMA 2RSNA 4BS9A 1JR0D 3K57A 2C5CA 4ZAIA 1NR4A 4CJ1B 3LWUA 4QB4A 1RD9D 2IJ0A 4MHEA 3QWNA 1OXVA 4DNRB 4NW2A 4TQUS 4K5VA 1HHVA 3DUZA 4C1NK 1WTRA 5LHY1 1RHPA 4DAYA 2F0EA 5E1FA 5JAVA 1HA6A 1Y8NB 1HTPA 1Z47A 3D6WA 4DAPA 3I73A 1A2UA 2M00A 1B50A 4QF4A 5JVH3 3H94A 5E4WC 1PFNA 2F3WA 4GZYC 1WTOA 2CVRA 3A7LA 2K7VA 3OIPA 2YYZA 3VR6A 1VMCA 3GTJB 1Q12A 2KEEA 3CKIB 2DNCA 2E74C 3WOEA 3I4LA 3NTIA 2AQ1B 5EBCA 4KI0A 5KRUA 4NP5A 4HSVA 3R3OA 4KKUA 5CV4A 3SK5A 4I65A 1HCZA 4A3MB 1DOMA 4G7HC 1GXDC 1ILPA 2ZXPA 2B2VC 4XXEA 1AFPA 4PMWA 1EEFD 1IL8A 3T13A 2XRQD 1QNKA 1LO5D 4IQZA 1B2TA 4HMIA 4V190 3QJYA 2A5HA 4J1MA 1PDQA 5JOBA 5IGCA 5JEAG 2X6LA 2H4OA 5JVG3 2EY2A 5COYA 3NBIA 1TR5A 4ZLTF 1TS4A 4K6LA 3GTMB 2F0KA 4C3HG 3OOCA 4OHJA 3VYUA 3FRPB 4CKEA 1LTTD 1GJXA 3GTQB 1C4QA 1FYCA 4HCEA 4ZYSA 3KBGA 5IGGA 2JSOA 3U9OA 3DEPA 2F1MA 3PUXA 3OWEB 3G7LA 1HUNA 3DMUA 4PQXA 5ELBA 1Q8IA 2VUMB 4BBSB 3M7NA 2SEBD 2LY7A 4LMQD 4XT3B 1L0XB 3PMFA 2E2DC 4IUUA 2JE6I 4J6HA 4C3JB 4C3IB 3CQZB 4HEDA 2K04A 1B9MA 4KD3A 2E2JB 1CFMA 4BA1I 5NUCA 4X3UA 3SE0A 2B2YC 1AZQA 4FF3A 1BR9A 4A3GB 1LT3D 1OXUA 2HDMA 3UI2A 4ZKBB 1CQFA 2PQEA 1EEID 2JEBI 3OMGA 1A6XA 1MBYA 1SYCA 4C2MB 2EY1A 3Q6SA 3K59A 2L12A 4CBVA 1AN8A 3GD7A 3QG1A 3PO2B 5DEHA 3VYSA 4BY7B 3HOUB 1BBXC 1IYVA 1A15A 4KHVA 1JC7A 3NTKA 1B9NA 5IOCA 3BDOA 1S5ED 1ENCA 3NHHA 1H9MA 4K5XA 4K14A 4KJOA 3PUWA 1LT6D 1OXTA 4RHSA 1GOZA 3S14B 1DCZA 1RKNA 5EPKA 4DU9A 3MXNA 1CHQD 1G8ZD 3GO5A 2EY5A 3P7JA 5FOBB 4A3JB 4A93B 1M8AA 4KJNA 1EY9A 1ZKOA 1G2TA 4ME5A 3HOVB 3MC0B 4RGOS 2HUGA 5CV7A 3R93A 2RKSA 5JJZA 4KV6A 4KTAA 2A6HD 3R2TA 3TSSA 3D3RA 4FXDA 3TMEA 2NN6I 5I2XA 5KNCA 5I6WA 2FMMA 2A68C 3EJIA 2XWBB 1DONA 4PV1C 3I72A 1V8QA 4EQNA 1UNSA 1QWYA 2JA8B 3MZ5A 4XYOA 1S4ZA 5CV8A 4NMZA 3NE5B 2NBFA 4S3SA 5C5MA 1IW7C 4ZQ3A 4IFDJ 1PTOH 3TP6A 2QCPX 4BBRB 3WOFA 3CRKC 2OT2A 1AP0A 1CHPD 4C56C 5K36H 5FLXL 1PTOC 1FNWA 3NXWA 1MSGA 5A2QE 3J81L 4RFBA 3ITPA 4IZ8A 1CZWA 1HPCA 5T1IA 1BUVT 4OO1H 1H9RA 1MGSA 1II3A 4FP5D 3D8GA 3IKJA 3AU7A 1YNJD 1T5XD 5C4HA 1EIGA 1PRTB 2FHTA 1H9SB 1AW7A 3I90A 3VA7A 3A55A 2EYHA 1EU3A 5IGEA 1ENAA 2MGSA 2DNEA 4FXKC 2L1BA 2FJ2A 3PO3B 3T16A 3E0JA 2KECA 5IIFA 2PW5A 4K2KA 1TWHB 3RZDB 1I4QA 4H0LC 5KNDA 1PZJD 4DN4M 3A7AB 1JWSD 2BDOA 5M3FB 4RAUC 4A3KB 3GTLB 3T51B 4EGVA 2XN9C 4RA8A 5IT9L 3H0GB 4HTHA 1F2LA 2B2UC 3NP8A 1R4PB 1V1OA 2CW0C 3MFYA 4CJ2C 2EDGA 5DM63 1BO0A 1JOKA 3D31A 2AQ3B 1KDAA 3KF8A 4ZKCB 2XRSD 2WP8J 4C3HB 2HCIA 2A69D 3ONAB 2A73B 1S5CD 1WTWA 5CBEE 2RVLA 1DOKA 3NWTA 2SDFA 5E4XA 4H13C 2E2IB 1ESRA 1SEBD 1UUPA 1O80A 3K6OA 3SVMA 3DEOA 1MSHA 2QKIC 5CGKA 1KABA 1EY0A 3DXJC 5CV6A 2JYOA 1D5XC 1EYAA 4A3BB 1K83B 3BDLA 4ODGA 1A3VA 1QE6A 1XXGA 4X3SA 1SNPA 2NN6G 2F0WA 3NUCA 4HR7B 4CGYB 2IT1A 1J8IA 5IGFA 4KKTA 3VA5A 2B2TA 4C3JG 3S1MB 2AWNA 1SYDA 2L0CA 4DXFA 3KBXA 2WINB 2D2CC 1B44D 2K03A 2O2LD 1TU2B 3EFXD 4A3FB 2F0JA 4WORA 1E2ZA 2OEOA 1DYQA 4XTCS 2JP1A 1VCIA 1DJRD 1QILA 1TWCB 4ZUJA 1ET9A 2AUKA 3HOZB 1SXTA 3LNNA 1ILQA 1RTOA 1I50B 1G6ZA 1STAA 3ND8A 2ZT9C 4IUPA 3C1FA 1RDPD 4WJWA 3GQBA 1KDBA 3PUZA 3J81E 1QJOA 1EYDA 5FKAC 4Z9CB 1TWGB 1JOQA 1QB5D 5FO8B 1TY0A 4ZUIA 1JWUD 4KHZA 3K5LA 4XDXA 2F0GA 4QIWB 2A6HC 3DWQA 2M2LA 3VR4A 1SNDA 2PZTA 2PMZB 2ENBA 1NR2A 1I6VC 3W2DA 2B2WA 3H91A 4PMBA 2KEDA 2LS01 1K8MA 1O78A 1EQTA 1LT5D 3BZDB 1ET6A 4QUCA 5CR3A 1LT4D 4IN3A 2NVQB 2PNRC 5I4DA 1TS2A 1EQVA 2K5QA 5AFWA 3A54A 4X3TA 2EE1A 2B2WC 3KLRA 1SSOA 2F0HA 1PFMA 5JPNC 2NZ1D 4F8MA 3TP5A 2K05A 1ONLA 2OXPA 3J80E 4V0BA 2VNUD 3MTSA 1JWMD 3I91A 3MVVA 1GUNA 2ZXOA 1PRTD 5C4JB 5FO9B 3R8BA 4DF7A 1Y1VB 5IGDA 1BXTA 1GUGA 2FMCA 3TP7A 4A3IB 5IODA 1PXUA 4QCLA 2D62A 1KAAA 5G3LF 3J7YW 1H9SA 3C46A 1RF2D 3R2IA 2BA0A 2KQ3A 3O13A 2NTTA 1EFID 4ZK9B 3GTKB 5KYLA 4C1NI 1A3TA 1F2YA 3MXPA 1RJTA 1D1IA 1C48A 1SAPA 4XIGS 5JPMC 1SNQA 3VR2A 1SMYC 1WTPA 2B63B 1HTLD 2F0TA 5J22A 4Q5VA 2H1EA 2FINB 5M9OA 1JICA 1XTCD 4UAIA 2B2TC 4PMCA 5CBAE 3HGBA 2AWOA 2F0QA 1HUMA 3MEHA 2MP1A 4N9PA 1FR3A 3GTGB 3C3LA 3BVZA 3SDZA 4I7ZC 3D4DA 3TZUA 2F0PA 2J0TD 1STEA 3F2UA 4QUFA 2K6AA 3SK8A 3C1EA 3NWSA 2BE5D 4B9WA 2E2HB 1G91A 3A8IE 2YU9B 2N88A 1LV9A 2NYZD 3C2PA 2RDGA 1SYFA 2D5DA 4NDXA 1SMYD 2WKDA 5C4XB 4F87A 5CV5A 5J1ZA 1BNZA 1EY5A 1HQRD 2F0UA 1PTOF 3TP8A 2EXZA 1LABA 1S5DD 5KIXA 3VYRA 1I4XA 2O4XA 5CC4A 5IT9E 5F2DA 5I2YA 2EVBA 5M5YB 4EVOA 3N52A 1U9RA 2NB0A 4HN7A 3PIP3 2VXWA 2JA6B 1IKMA 2A68D 2Z4HA 3S17B 3M3YB 4ABNA 1HA5A 1ML0D 2RSOA 4IUQA 4HAEA 1YNND 3HZXA 1F2MA 3EQLC 5KGUA 3K5NA 4K6DA 1TVXA 1XWEA 3VYTA 4NKLA 5CMDA 2RQXA 4K2LA 2EY6A 2B8GA 2SNSA 3Q24A 3L7ZC 2EPBA 2PCFB 2PYKA 1IYUA 3H3VC 3FEWX 3QB3A 2RDHA 1SNOA 4XQJA 4DK1A 2BDNA 5DAUA 1OXSC 2L55A 3PV0A 2B39A 3I8ZA 1STGA 2R61A 5CORA 3MWYW 3BDCA 5BN3A 5C3WA 3IL8A 2BOSA 1OO9B 1STYA 2F0LA 3S2DB 1F2ZA 1QG7A 3J7AV 1LTBD 5EJWA 1SDFA 5KNBA 2MHVA 1Q1BA 2VB2X 2WB1B 5I9PA 2NVXB 3DHQA 1LTRD 1D2BA 5ISRA 4IUTA 2N55A 3FVQA 2MJ8A 3Q0AA 4P2CB 1WTXA 3J80L 4O42A 1PFBA 1LACA 4B9XA 1ZEQX 2K1BA 5CV9A 4KD4A 4DA2A 1E2WA 3HS0C 3D4RA 3MXUA 2Z4IA 4IFDG 4H7BA 2AUJD 1V1PB 3FPUB 2L4NA 4ZRZA 4RCNA 5FK9C 1U4PA 3S16B 2F0VA 1UEAB 4OIKA 1F9RA 2IPKD 4R8NA 2Z1CA 1B4OA 5FO7B 4XYQA 1WTQA 3GP7A 1ZXTA 2IW3A 1D5ZC 4AYBB 2HCCA 4RGMA 1KDCA 1TKWB 3RMHA 3RD4A 1F9PA 2HDLA 3Q22A 4MN3A 2NVYB 3KLSA 4QMGA 1VF7A 2XNAC 3OIQA 4KY6A 5JEAJ 1KLGD 3ZYYX 3HOXB 4OL7A 3T4AC 3BVMA 4KKSA 3M7GA 1A2TA 4DFAA 1TQOA 1JE4A 1CT1D 1NSNS 1Y8OB 3CRLC 3S2HB 3N6RA 3H09A 2K01A 3GV3A 1EY8A 3MHBA 5ELCA 4L63B 1SYBA 2L5TA 5D65A 2A74C 2B2UA 2EJFC 4M1UB 2G9DA 4TRDA 2WIIB 3E6ZX 2EYJA 1PYWD 1WVLA 1EOTA 4RH6A 5FLXE 3V96A 4TKOB 4HSPA 1I4HA 3DWAA 5BN5A 5EKLA 1RODA 2MPMA 1JORA 3FKIB 5ELEA 1HFGA 1O7ZA 2IX3A 2BA1A 5C3EB 1LTSD 2IX0A 3MFGA 1SNCA 3S1RB 2F0SA 1CA6A 4Q0FA 5D3DA 5A35A 2RA4A 4CKBA 5D3IB 2K5WA 2F0IA 5DM73 3V2TA 5M5XB 3MXGA 3M85A 4KN4C 4BA2I 1SNMA 4CJ0B 4G7OC 1X32A 3NPPA 2R7ZB 3GV6A 1RTNA 1DM0B 3CHBD 1QNUA 3SXHA 4OO1I 2I07B 3SK6A 3CU7A 4E6IA 3FDTA 3X3MA 4XT1B 3AMUA 1KLUD 5K5PA 1SJHD 1TS3A 1FD7D 1Y8PB 3DWPA 3L9AX 2EYOA 2JXMB 3D6CA 3IFTA 5EKIA 5HURA 1BCPD 1VDZA 3K58A 1RCVD 1ESFA 3BG3A 3Q23A 3KK7A 2E75C 3I4MB 4RKLA 3QIAA 2BCOA 3ERQA 1G291 4ULLA 1JB3A 2EYPA 1CZGA 3I4NB 3NBHA 3URYA 1F77A 1SYEA 1SE3A 2XVSA 2DN8A 3EROA 4LJZC 4FF2A 1KNAA 1EYCA 2Z8LA 4O1NA 4LAAA 1CI3M 4HMJA 4DK0A 1SBBB 2TMPA 4HCSA 2GA4B 1Z7TA 1PZID 2CQAA 4EQOA 2X69A 1X3PA 5BN4A 2J7ZA 2X6GA 2CHBD 2FFKB 5C0XG 2ZXRA 1D5MC 3SHLA 1CTMA 4BWGB 4RGNA 1T5EA 1SJED 2K33A 3EVQA 3P75A 1YNJC 4ID6A 1O7LA 3X3NA 5C6AA 5HGTA 4DNTB 1GHJA 5C0XH 2D9UA 4C3IG 1TWAB 1U4RA 5M3MB 5K36G 2KUMA 2F0OA 4L6TB 1IKLA 2XWJB 1NAPA 4DXGA 1XYIA 1H9JA 2SNMA 1Y1WB 1R4QB 2F0NA 2CW0D 1BCPF 2SOBA 3FMCA 1QOHA 1PMRA 2V4DA 4G4KA 2KCNA 3BYTB 1ZYRC 2Q8TA 1ENFA 4RWSC 4U68A 1Q90A 5LL6S 4YIJA 2NWGA 3H6MA 4WFN3 1I4GA 2K28A 1CK1A 1Y69U 4RGTA 4ILWA 4IFDH 3HOYB 4R8IA 1SE2A 2EJMA 3A8KE 4KMUC 4U673 1AEXA 3OW7A 4RCOA 4N9TA 3TN2A 2TSSA 2XIWA 1FNUA 2KOLA 5LL6X 1S5BD 2JA5B 2DY8A 1U4LA 2ICIA 1DZ1A 5EPJA 3MA2B 3PUVA 4DGZA 2ICEC 3JAME 2KVMA 3BYYB 3OWFA 1ICWA 3J7AF 4IFDI 3SK4A 4BY1B 1H9KA 1EIHA 4LK1C 2R6GA 5D14A 3OMCA 1EWCA 4KK7A 1NCVA 2QF7A 1QCBD 4KY7A 1M4VA 3HG9A 4FYDA 2NTSA 2KHSA 5EGTA 4R9WA 3RUZA 1K8OA 1B1ZA 1TT2A 2B2VA 5KYIA 3PUYA 3OSOA 1JQYD 2PPBC 1U4MA 1WTVA 3BS1A 4UDUC 3QO2A 3L3OC 4G57A 1STNA 3S15B 2RDFA 1BF4A 2EYLA 1DXMA 4F88A 1WD0A 1EY4A 3RZOB 1MD2D 1I4PA 4XQQA 4J8QA 1BDOA 1HXYD 1IHZA 3IAYA 1OXXK 3QOLA 3MAQA 3E5SA 3V05A 2JEAI 2O5JC 4JBWA 2LFNA 5I6YA 1C8CA 1BCPB 1V43A 1W6JA 3A56A 1CQVA 1EU4A 4B08A 1PRTF 4K5WA 3JAML 3W3AA 5C0XI 1E2VA 2M9VA 1WCMB 2HQEA 4Y7NB 3PIO3 2F03A 4FF1A 2OF1A 1BOSA 1GUSA 1PLFA 2WV6D 1IW7D 3P20A 1JOOA 3M4OB 2IWHA 1DD2A 3TBIB 1VMPA 1D6EC 3I70A 4EQPA 1GUWA 3GTPB 2E76C 2VB3X 5C5LA 1A3UA 5T1GA 1GUTA 3IFDA 1S5FD 2B8FA 1CA5A 1DOLA 1STHA 1L0YB 4X3KA 2EYMA 5ELFA 2WKCA 4K8IA 1LLRD 4FO2A 1ZYRD 4KY5A 1B53A 3LX0A 3BVGA 3T53B 1AZPA 1SE4A 2DY7A 2R93B 2C9OA 1X3QA 3AB9A 2PO4A 2F4IA 1VF5C 3NSWA 5EPLA 4G7ZC 2KA7A 3LWEA 2BE5C 1KTKA 2I46A 1LTGD 5DNFA 3NQIA 3HRZC 1I6HB 3M4YA 1UAPA 4CHTB 5C44B 5IGBA 3NK9A 2A69C 5EQ0A 5C3XA 1F9SA 4OIJA 3TDQA 5JEAH 1F9QA 3HKZB 1BQQT 4IUNA 1EY7A 1GUOA 2NUCA 1EY6A 2LKVA 4L8JA 1W6KA 2XSCA 4WRDA 2EYFA 5CYUA 2IX1A 2F0DA 4JK1C 1EZ6A 4TSSA 3NQTA 5EBDA 1LTID 3RLFA 4FNFA 2PZWA 2L9HA 4IALA 1TWFB 2F0MA 3VR5A 4CKCA 1LTAD 1V1PA 1G2SA 2Q8IB 3D4WA 2NN6H 3HP3A 3VR3A 1PRTC 4H44C 3HEJA 2JA7B 1O7YA 2KJXA 3GTOB 1PZKD 3K5MA 4FF4A 3ND9A 1XX8A 3KUPA 2B2YA 2EJGC 3SEBA 2EZVA 1GHKA 4K8JA 2F0FA 3SR1A 4OO1G 1E0BA 2R3ZA 1Q1EA 4DAVA 1SYGA 1TIID 1PTOB 3P1HA 2QILA 2PW7A 4M8AA 1BCPC 5M5WB 3OPOA 1MI2A 5G3LD 5C0XJ 4RHRA 1STBA 5J39A 3FPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O5I C;  1TU2 B;  2EJM A;  3GD7 A;  3A8K E;  3QG1 A;  5A35 A;  4KMU C;  1FR3 A;  3M4Y A;  4DK1 A;  5JEA G;  1OXX K;  2A6E D;  3SDZ A;  1IYV A;  1OXS C;  2A69 C;  1E2Z A;  1TKW B;  3PV0 A;  4I7Z C;  1IW7 C;  3OW7 A;  3TZU A;  4XTC S;  2JEA I;  2O5J C;  3LWU A;  4JBW A;  2CW0 C;  1B9N A;  3MFY A;  5JEA H;  3CRK C;  2EDG A;  3BDO A;  1CI3 M;  5BN3 A;  1VCI A;  1VF7 A;  2BE5 D;  3M85 A;  4KN4 C;  1GUO A;  1V43 A;  4DK0 A;  4BA2 I;  3A8I E;  3D31 A;  1OXV A;  1H9M A;  3OOC A;  2AUK A;  1Z6H A;  3KLR A;  1Z7T A;  4L8J A;  4TQU S;  3LNN A;  4DNR B;  4KN7 C;  4G7O C;  3PUW A;  3ND8 A;  3PUV A;  2ZT9 C;  5K36 H;  1GJX A;  2D5D A;  3W3A A;  1OXT A;  2A69 D;  1FYC A;  4JK1 C;  3U9S A;  1ONL A;  1E2V A;  1DCZ A;  5BN4 A;  1GUN A;  1Y8N B;  1HTP A;  1GUS A;  1H9K A;  3GQB A;  3RLF A;  5C0X G;  3I73 A;  1CTM A;  1HQM C;  1IW7 D;  3PUZ A;  5KNB A;  3P20 A;  1T5E A;  4H13 C;  1LAB A;  2K33 A;  4LK1 C;  1Q1B A;  1YNJ C;  2R6G A;  1QJO A;  1HPC A;  2F1M A;  4KKS A;  3VR5 A;  3PUX A;  4OO1 H;  1O7L A;  1H9R A;  3H94 A;  1ZKO A;  2QF7 A;  4DNT B;  1GHJ A;  5C0X H;  4GZY C;  1DD2 A;  2Q8I B;  2EVB A;  1EWH A;  3DXJ C;  1Y8O B;  2NN6 H;  3CRL C;  3N6R A;  2K32 A;  1GUG A;  3IKJ A;  3A7L A;  2K7V A;  3VR3 A;  3M7N A;  4H44 C;  1Y8P B;  3WDN A;  1K8O A;  2JXM B;  5K36 G;  2E76 C;  2D62 A;  2YYZ A;  1LAC A;  3VR6 A;  1YNN C;  3IFT A;  1H9S B;  2A68 D;  4KHZ A;  2A6H D;  2JE6 I;  1H9S A;  2NN6 G;  3VA7 A;  2KCC A;  1Q12 A;  2L5T A;  2LMC B;  1E2W A;  2DNC A;  3PUY A;  2BA0 A;  2A6H C;  1GUT A;  2E74 C;  1VDZ A;  4HR7 B;  2IT1 A;  2B8F A;  2EJF C;  2A6E C;  3D4R A;  3I4L A;  3BG3 A;  3ND9 A;  2NN6 I;  1H9J A;  3VR4 A;  2DNE A;  5KNC A;  2PPB C;  4KI0 A;  4KKT A;  2E75 C;  3MXU A;  4IFD G;  2EJG C;  1B9M A;  1GHK A;  2AUJ D;  3A8J E;  3FMC A;  3QIA A;  1CFM A;  4XIG S;  1PMR A;  4KKU A;  1I6V C;  4BA1 I;  4OO1 G;  2V4D A;  3VR2 A;  2A68 C;  1SMY C;  3T53 B;  3SE0 A;  1Q1E A;  1G29 1;  3EQL C;  4TKO B;  4RCN A;  1HCZ A;  1ZYR C;  4LJZ C;  4PV1 C;  5BN5 A;  1K8M A;  3I72 A;  1O78 A;  4G7H C;  1OXU A;  1V8Q A;  1DXM A;  4H0L C;  1Q90 A;  5KND A;  3AB9 A;  3A7A B;  1VF5 C;  2JEB I;  4G7Z C;  2BDO A;  2D2C C;  2KA7 A;  3OPO A;  1A6X A;  2BA1 A;  2B8G A;  3HGB A;  4IQZ A;  3T56 B;  2PNR C;  2AWO A;  3L7Z C;  2DN8 A;  2PCF B;  3T51 B;  4OGQ C;  2BE5 C;  1IYU A;  3QJY A;  1Y69 U;  1BDO A;  3NE5 B;  4IFD H;  3FPP A; 
#chains in the Genus database with same CATH topology
 1CM9 A;  2O5I C;  2CQO A;  3CW2 C;  3K8A A;  3KLS X;  5ELD A;  2K5D A;  2L11 A;  3ZJY C;  2A6E D;  4FXG C;  1JMC A;  5IWA Q;  3PO3 H;  1TS5 A;  3NTH A;  4GKJ L;  3OTO L;  4JI2 Q;  4JI5 L;  1HR0 Q;  2QDB A;  1VQK A;  4PNY A;  1Z6H A;  1EL0 A;  4KN7 C;  3CD6 A;  3AYH B;  4IUV A;  3K7A B;  1FGB D;  2RF4 A;  3U9S A;  5A2Q L;  2OCE A;  2EOT A;  1JCK B;  1J9O A;  4IUR A;  5TSS A;  3S9W A;  3HOV G;  2G9H D;  3K5O A;  2JA5 G;  3G6J B;  5I9O A;  3UE0 A;  2KCM A;  1HQM C;  3STB C;  4XQN A;  2MNA A;  1D1K A;  3K0Y A;  1PH4 A;  1HRJ A;  2WAQ B;  1WD1 A;  2CH4 W;  4A3D B;  3OHX C;  1EWH A;  3I3C A;  2J4X A;  1HFN A;  1TY2 A;  3M3Y H;  2ID0 A;  2K32 A;  4X62 Q;  3J81 c;  5LMU Q;  2WAC A;  1QVG A;  2MUY A;  3WDN A;  3PF4 A;  1MHW C;  4YY3 L;  4A3B G;  4RKB A;  2AQ2 B;  1YNN C;  2KCC A;  2LMC B;  3HKS A;  3TZD A;  5GAD C;  3EA6 A;  5IYD H;  1QVF A;  2A6E C;  5E3F A;  3BJU A;  1SRU A;  1FNV A;  2QEJ C;  1B3A A;  2PI2 E;  1CKN A;  2Y0S B;  3A8J E;  4LUV A;  2RCF A;  5H1S E;  2Q2T A;  1EZ8 A;  3HOW B;  2R92 B;  1PTO D;  5C4Z A;  4JYA L;  3IRB A;  1YEZ A;  1Y1V H;  1I4R A;  2KEN A;  4JI0 Q;  2PZU A;  3QOJ A;  4MIU A;  4JOI A;  1I3Q B;  1R9T B;  3S1N B;  2RBM A;  5ELO A;  5EKK A;  1SFO B;  1KNE A;  3T56 B;  4F7X A;  4A3E B;  4JI6 Q;  1Q3L A;  1SRO A;  4OGQ C;  2IL8 A;  4HJ7 A;  3DM1 A;  3S1Q B;  2Q8R E;  4NPS A;  5KEE A;  4X64 Q;  3OW2 A;  1NUC A;  2F3V A;  2NVT B;  4FVM A;  2RSN A;  3H0G H;  4BS9 A;  3J81 j;  1MKH A;  1JR0 D;  3K57 A;  2C5C A;  4ZAI A;  1NR4 A;  4CJ1 B;  3LWU A;  4QB4 A;  1RD9 D;  2IJ0 A;  4NXN Q;  4MHE A;  4HIM A;  3QWN A;  1OXV A;  4DNR B;  4NW2 A;  4TQU S;  4K5V A;  2QW7 A;  1HHV A;  3DUZ A;  3PSI A;  4C1N K;  4GOP A;  4NXN L;  1WTR A;  4C3J H;  5LHY 1;  4QGU A;  1RHP A;  2I5H A;  2F0E A;  4DAY A;  5E1F A;  1A0I A;  1BBU A;  4OX9 Q;  5JAV A;  1HA6 A;  1Y8N B;  1HTP A;  1Z47 A;  3D6W A;  4DAP A;  3I73 A;  1A2U A;  2M00 A;  2AMC B;  3NEL A;  2JA7 G;  1B50 A;  1LYL A;  4QF4 A;  5JVH 3;  4BY7 G;  1VQO A;  3H94 A;  5E4W C;  1PFN A;  2F3W A;  2Q2H A;  3EIV A;  4GZY C;  4P71 A;  1WTO A;  2F4V Q;  2K75 A;  2CVR A;  5L37 A;  4CDC C;  3A7L A;  2K7V A;  3OIP A;  3RLO A;  1X9N A;  1K3B C;  1Q81 C;  3AEV A;  2YYZ A;  3VR6 A;  1BKB A;  4AQY Q;  4JI2 L;  1VMC A;  4JV5 L;  1XMQ Q;  3GTJ B;  4WJ3 M;  1Q12 A;  2KEE A;  3CKI B;  2DNC A;  1NBW A;  2E74 C;  3WOE A;  3I4L A;  3NTI A;  2AQ1 B;  5EBC A;  4X65 Q;  4KI0 A;  5KRU A;  4NXM L;  4NP5 A;  3CCL A;  2F3I A;  4HSV A;  3R3O A;  4KKU A;  5CV4 A;  3SK5 A;  4I65 A;  5M3F G;  1HCZ A;  4A3M B;  1DOM A;  4G7H C;  1A62 A;  1GXD C;  1ILP A;  2ZXP A;  4A3L G;  2B2V C;  4XXE A;  1AFP A;  1CSP A;  4PMW A;  1EEF D;  2RHS B;  1IL8 A;  5IYC H;  3S24 A;  2XRQ D;  1QNK A;  1LO5 D;  4IQZ A;  3T13 A;  1B2T A;  4JYA Q;  4HMI A;  4V19 0;  3QJY A;  2A5H A;  3S17 H;  4J1M A;  3ULP A;  1PDQ A;  5JOB A;  4A75 A;  5IGC A;  5JEA G;  4IJH A;  1E1O A;  2X6L A;  2H4O A;  5JVG 3;  1N32 Q;  1X3E A;  4AYB G;  5AJ3 Q;  2EY2 A;  5COY A;  3NBI A;  1TR5 A;  3G6E A;  2WAQ E;  4ZLT F;  1TS4 A;  4K6L A;  4CDD C;  3GTM B;  2F0K A;  4C3H G;  3OOC A;  4OHJ A;  3VYU A;  3FRP B;  4CKE A;  1LTT D;  2N3S A;  1GJX A;  3GTQ B;  1C4Q A;  1FYC A;  2Z6K C;  4HCE A;  3HKZ G;  1VQ6 A;  4ZYS A;  3KBG A;  3CCS A;  5IGG A;  2JN4 A;  3KF6 A;  1U5K A;  2JSO A;  4KHP Q;  1IZ6 A;  3U9O A;  3DEP A;  4BXX H;  2KBN A;  2F1M A;  3PUX A;  3OWE B;  3G7L A;  1HUN A;  3DMU A;  4PQX A;  5ELB A;  1Q8I A;  2VUM B;  4BBS B;  1HJP A;  3M7N A;  2SEB D;  2LY7 A;  2HD3 A;  4LMQ D;  1VQ7 A;  4XT3 B;  1L0X B;  3PMF A;  4JVZ A;  2E2D C;  4IUU A;  2JE6 I;  3B6Y A;  2UUC L;  4IPH A;  4J6H A;  4C3J B;  5IWA L;  4C3I B;  3CQZ B;  5IE8 A;  3CCJ A;  3GTG H;  4HED A;  5M3M H;  2K04 A;  1B9M A;  4KD3 A;  2E2J B;  4R4O A;  1CFM A;  4BA1 I;  2LSS A;  3JC6 6;  5NUC A;  4X3U A;  5DLQ E;  4O0A A;  3SE0 A;  2B2Y C;  1AZQ A;  1BR9 A;  4QY7 A;  5C3E H;  4FF3 A;  1SE8 A;  3PQI A;  1VQC A;  1VQP A;  4A3G B;  1LT3 D;  1C7Y A;  1AE3 A;  1LUZ A;  1OXU A;  4GKJ Q;  3GTJ H;  3RNU A;  4JV5 Q;  1B7Y B;  2HDM A;  3UI2 A;  4ZKB B;  1CQF A;  3U50 C;  2PQE A;  1EEI D;  2JEB I;  3OMG A;  1I94 Q;  1A6X A;  2VQE L;  1MBY A;  1SYC A;  4C2M B;  2EY1 A;  3Q6S A;  3K59 A;  2L12 A;  4CBV A;  1FJG L;  1EOV A;  1AN8 A;  3GD7 A;  3QG1 A;  3PO2 B;  5DEH A;  3VYS A;  4BY7 B;  3M4O H;  3HOU B;  1BBX C;  4GNX A;  1PV4 A;  3PO2 G;  1IYV A;  1A15 A;  2MO0 A;  2UUA L;  4KHV A;  1PH5 A;  1JC7 A;  3NTK A;  1B9N A;  5IOC A;  3BDO A;  1L0W A;  1S5E D;  1ENC A;  4B3S Q;  3QR8 A;  1GVP A;  3NHH A;  1H9M A;  4K5X A;  4K14 A;  3TQY A;  2AKW B;  2ZTD A;  2R7Z G;  4KJO A;  1EQR A;  3K80 C;  3PUW A;  1LT6 D;  2RCN A;  1OXT A;  4RHS A;  3GTM H;  1GOZ A;  3S14 B;  1DCZ A;  1RKN A;  5EPK A;  4DU9 A;  1M90 C;  3MXN A;  1CHQ D;  2G5D A;  1G8Z D;  3GO5 A;  2EY5 A;  3P7J A;  5FOB B;  4A3J B;  4A93 B;  1M8A A;  3KOJ A;  4CDF C;  1IBM Q;  5C4X G;  4KJN A;  1PA6 A;  1EY9 A;  1ZKO A;  1G2T A;  4BY1 G;  4ME5 A;  3HOV B;  2N8N A;  3ULJ A;  4JI7 Q;  2ATW A;  3MC0 B;  4LFC Q;  4RGO S;  2HUG A;  3PCO B;  3GDE A;  4DR2 Q;  5CV7 A;  3R93 A;  4KHP L;  2RKS A;  1C0A A;  5JJZ A;  4KV6 A;  4A3E H;  1YBY A;  4KTA A;  2A6H D;  2VUM H;  3R2T A;  1XMO L;  3TSS A;  4BBS H;  3D3R A;  4FXD A;  3HOV H;  2R93 G;  4A3M G;  2D0O A;  3TME A;  2NN6 I;  5I2X A;  5KNC A;  1AH9 A;  2EXD A;  5I6W A;  2FMM A;  4LF6 Q;  4A3F H;  5M5Y H;  2B29 A;  2A68 C;  4UP8 A;  3EJI A;  1NE3 A;  2XWB B;  1P8L A;  1DON A;  1YHB A;  4PV1 C;  3I72 A;  4R4T A;  4LNQ A;  1V8Q A;  4EQN A;  1UNS A;  2UXC Q;  1QWY A;  2JA8 B;  3MZ5 A;  4XYO A;  4DV3 L;  2UUB Q;  2YTY A;  4IPD A;  1S4Z A;  5CV8 A;  4NMZ A;  3K7U C;  3NE5 B;  4DV4 L;  4A3E G;  2PQA A;  2NBF A;  4S3S A;  1ASZ A;  4AYB E;  5C5M A;  2K52 A;  4N8F A;  1IW7 C;  2QDL A;  4JPB W;  4ZQ3 A;  4IFD J;  1PTO H;  3TP6 A;  2QCP X;  4BBR B;  4DR6 Q;  3WOF A;  3CRK C;  2OT2 A;  4A3F G;  1AP0 A;  2VZA A;  1CHP D;  1YI2 A;  4C56 C;  5K36 H;  4NXM Q;  5FLX L;  1VQ4 A;  1PTO C;  1FNW A;  3NXW A;  2Y0S E;  1RIP A;  2UUA Q;  4LWC A;  1MSG A;  5A2Q E;  3HKZ E;  3J81 L;  4RFB A;  2HHH L;  4AH6 A;  3ITP A;  4IZ8 A;  1CZW A;  1HPC A;  5T1I A;  3AFQ A;  1BUV T;  4OO1 H;  1H9R A;  1MGS A;  1WCM G;  1II3 A;  4PG3 A;  2XTI A;  2K50 A;  4FP5 D;  3D8G A;  3IKJ A;  4IOC A;  2WB1 G;  5M5W H;  1KAW A;  3AU7 A;  4DR3 Q;  1YNJ D;  1T5X D;  5C4H A;  1N33 Q;  4IOA A;  1EIG A;  3CP0 A;  1PRT B;  2FHT A;  1H9S B;  1AW7 A;  3I90 A;  3VA7 A;  3HOU H;  3A55 A;  2EYH A;  2DJF C;  1EU3 A;  5IGE A;  2ZTC A;  1ENA A;  2DJG C;  2MGS A;  2DNE A;  1O7I A;  4FXK C;  4BY1 H;  2R92 H;  2CWP A;  2L1B A;  2FJ2 A;  4DR5 Q;  3HOW H;  3PO3 B;  1KQS A;  3T16 A;  2YTV A;  4DV5 Q;  3E0J A;  3S2H H;  2KEC A;  5IIF A;  3SGI A;  2PW5 A;  3U4Z A;  4K2K A;  2UXB L;  1TWH B;  4X66 L;  1FVI A;  3NEM A;  3CC7 A;  3RZD B;  1I4Q A;  4H0L C;  5KND A;  1PZJ D;  4DN4 M;  3CCQ A;  3A7A B;  1JWS D;  2BDO A;  5M3F B;  4RAU C;  4A3K B;  3GTL B;  4UP7 A;  4L5Q A;  3T51 B;  2A19 A;  4QIW E;  4EGV A;  2ES2 A;  2XN9 C;  4BBR H;  4POG A;  4RA8 A;  3HOY G;  5IT9 L;  1CKM A;  1XNQ L;  3H0G B;  4HTH A;  3T1Y Q;  3A5Z B;  4YY3 Q;  1F2L A;  2B2U C;  3NP8 A;  2Z0S A;  1R4P B;  1V1O A;  2CW0 C;  1HZA A;  5IYD G;  3MFY A;  4CJ2 C;  2EDG A;  4A3M H;  1I3Q H;  5DM6 3;  1KIX A;  4DPG A;  1BO0 A;  1JOK A;  4LF6 L;  4P75 A;  4PZ7 A;  1VQ9 A;  3D31 A;  2AQ3 B;  1KDA A;  2I0Q A;  3KF8 A;  4ZKC B;  2XRS D;  2WP8 J;  4C3H B;  1L1O C;  2HCI A;  3E0E A;  4DV1 Q;  2A69 D;  3ONA B;  2A73 B;  1S5C D;  1WTW A;  3K81 C;  5CBE E;  2RVL A;  1DOK A;  4NB3 A;  3NWT A;  4R4Q A;  1UE5 A;  3A5U A;  2SDF A;  5E4X A;  4H13 C;  2E2I B;  1ESR A;  1SEB D;  1UUP A;  1O80 A;  3K6O A;  3SVM A;  3DEO A;  1MSH A;  2QKI C;  2Z6K A;  1PHJ A;  5CGK A;  1SLJ A;  3M9B A;  1KAB A;  1EY0 A;  3DXJ C;  5CV6 A;  2ZJR A;  4DV3 Q;  2UUB L;  2JYO A;  1PH8 A;  1D5X C;  1EYA A;  4BXX G;  4A3B B;  2CH4 A;  1K83 B;  3BDL A;  1Z9F A;  4ODG A;  1A3V A;  1QE6 A;  2Q2U A;  3HFZ B;  4LF8 Q;  2E2H H;  1XXG A;  4X3S A;  1HZB A;  1SNP A;  2NN6 G;  2WB1 E;  4JBJ A;  4DR1 L;  3UDG A;  5IP9 H;  2F0W A;  3NUC A;  4HR7 B;  4CGY B;  2IT1 A;  1VQ5 A;  2GVB A;  1UEB A;  1DGS A;  2Y0S G;  1J8I A;  5IGF A;  4KKT A;  2OQK A;  5LMU L;  4JBK A;  3CCU A;  3VA5 A;  3TRZ A;  2JA8 G;  2B2T A;  4C3J G;  1I6H H;  5J3B A;  3S1M B;  5GAH C;  2AWN A;  1SYD A;  1PH2 A;  2L0C A;  4DXF A;  3KLW A;  3KBX A;  1NJI C;  4N8X 1;  2WIN B;  2D2C C;  3J7A 5;  4JI7 L;  4UY8 C;  2B63 G;  1B44 D;  2K03 A;  4DV5 L;  1XJV A;  1HH2 P;  3GTQ H;  3DLL A;  4GS3 A;  4UP9 A;  5C4X H;  2O2L D;  3J7Z C;  3W1G A;  4P74 A;  1TU2 B;  4HIK A;  3HOX H;  4UPA A;  3EFX D;  4A3F B;  2F0J A;  4WOR A;  1HZC A;  1M1K C;  2K4K A;  1E2Z A;  4B3T L;  2OEO A;  1DYQ A;  3HOU G;  4XTC S;  2MQH A;  4A3B H;  4GNX B;  1K3R A;  2JP1 A;  1VCI A;  1DJR D;  1QIL A;  1TWC B;  3F1Z A;  1JE5 A;  4ZUJ A;  1ET9 A;  1FL0 A;  2JA8 H;  2YU9 H;  2AUK A;  3HOZ B;  1SXT A;  3LNN A;  1ILQ A;  1RTO A;  4LFC L;  1I50 B;  1G6Z A;  1STA A;  3ND8 A;  2ZT9 C;  3HOZ G;  3RN5 A;  4GLX A;  1E1T A;  4IUP A;  3C1F A;  1RDP D;  4DR6 L;  1E24 A;  4WJW A;  4J15 A;  3GQB A;  1KDB A;  1X56 A;  3PUZ A;  1X6O A;  3J81 E;  1K8G A;  5M3M G;  1QJO A;  3RZD H;  3S1M H;  1EYD A;  5FKA C;  3RR5 A;  4Z9C B;  4OWW B;  1TWG B;  1JOQ A;  2EQS A;  1QB5 D;  5FO8 B;  3GTO H;  4B3R Q;  1TY0 A;  4ZUI A;  1IYJ B;  2R7Z H;  3HOY H;  1HNZ Q;  1JWU D;  3FKI H;  1X65 A;  4KHZ A;  1NMG A;  3K5L A;  4XDX A;  2F0G A;  4QIW B;  5IYC G;  2A6H C;  3UDF A;  1A63 A;  3DWQ A;  2M2L A;  3MEF A;  3VR4 A;  1SND A;  2PZT A;  2PMZ B;  4ZCK A;  2CFM A;  2ENB A;  5FLX c;  1NR2 A;  2JA6 G;  2PNH A;  4DV4 Q;  3I4M G;  1I6V C;  3W2D A;  3KFU A;  2B2W A;  3H91 A;  4JI6 L;  4PMB A;  2DGY A;  1MJE A;  4DR4 L;  1CUK A;  2KED A;  2LS0 1;  4MTN A;  1K8M A;  4DV2 Q;  1WTH A;  1O78 A;  1EQT A;  1I94 L;  1LT5 D;  4JBM A;  4P73 A;  3BZD B;  3CAM A;  4LF8 L;  1ET6 A;  4QUC A;  5CR3 A;  1LT4 D;  4DR5 L;  4LF5 Q;  4IN3 A;  2NVQ B;  2PNR C;  5I4D A;  3KF8 B;  4POF A;  3UDX A;  1TS2 A;  1EQV A;  2AHO B;  3TEH B;  2K5Q A;  4JI3 Q;  1JT8 A;  2GVA A;  4A3D H;  5AFW A;  5FJ8 G;  3A54 A;  3RN2 A;  4X3T A;  4DNI A;  2EE1 A;  2B2W C;  3KLR A;  1VQH A;  1SSO A;  2F0H A;  4JI1 L;  3D0F A;  5BR8 L;  1PFM A;  5JPN C;  1V9P A;  2NZ1 D;  4F8M A;  1HZ9 A;  2QGQ A;  3TP5 A;  2K05 A;  1ONL A;  2OXP A;  3J80 E;  2K5V A;  4V0B A;  2VNU D;  3MTS A;  1JWM D;  5FLM G;  3F2B A;  3I91 A;  4DV0 Q;  3MVV A;  1GUN A;  2ZXO A;  1VQE A;  1PRT D;  5C4J B;  2N78 A;  3H3V H;  5FO9 B;  4B3R L;  3ER0 A;  3R8B A;  4DF7 A;  1Y1V B;  5IGD A;  4LUO A;  4R1J A;  4X65 L;  1BXT A;  5IT9 c;  1S3O A;  1GUG A;  2FMC A;  3TP7 A;  1TWF H;  5FJ8 H;  5IOD A;  4A3I B;  1PXU A;  2LXK A;  5IP7 G;  2D62 A;  1KD1 C;  4QCL A;  1KAA A;  5G3L F;  2D0P A;  1H9S A;  3J7Y W;  3C46 A;  3OTO Q;  1C9O A;  1RF2 D;  3GTP H;  3R2I A;  2BA0 A;  2KQ3 A;  1EUJ A;  3O13 A;  2NTT A;  1HR0 W;  1EFI D;  1P16 A;  4GN5 A;  4ZK9 B;  5KYL A;  3GTK B;  4C1N I;  1A3T A;  1F2Y A;  3MXP A;  1RJT A;  1D1I A;  1C48 A;  1SAP A;  4XIG S;  3CPW A;  3ERS X;  5JPM C;  1SNQ A;  3VR2 A;  1SMY C;  1K73 C;  4HJ8 A;  1WTP A;  3W5O A;  1HTL D;  2F0T A;  5M5X H;  2B63 B;  2UXD Q;  5J22 A;  4Q5V A;  2H1E A;  2FIN B;  1MIU A;  5M9O A;  1JIC A;  1XTC D;  4UAI A;  2B2T C;  4PMC A;  3AFP A;  5CBA E;  4OWX B;  3HGB A;  4GN4 B;  2AWO A;  2F0Q A;  2JA6 H;  1FGU A;  1HUM A;  2MFI A;  3MEH A;  2MP1 A;  4YCV A;  1ASY A;  4N9P A;  1HNX L;  4JI8 Q;  2R7D A;  1FR3 A;  4FDB A;  3GTG B;  3C3L A;  4L5S A;  3BVZ A;  3SDZ A;  2VQF L;  4I7Z C;  3D4D A;  3TZU A;  2F0P A;  2J0T D;  4LFA Q;  1STE A;  3F2U A;  4B3T Q;  4QUF A;  2K6A A;  5IYB G;  3SK8 A;  3C1E A;  3NWS A;  2BE5 D;  2PQA B;  4B9W A;  2E2H B;  1G91 A;  3A8I E;  3GTL H;  2YU9 B;  2N88 A;  3RZO H;  1LV9 A;  2NYZ D;  3W1B A;  4DR7 Q;  3C2P A;  2RDG A;  1SYF A;  2D5D A;  4NDX A;  1SMY D;  2WKD A;  5C4X B;  3PF5 A;  4F87 A;  5CV5 A;  3UDI A;  5J1Z A;  1BNZ A;  1EY5 A;  1VQD A;  1HQR D;  2F0U A;  1B3Q A;  1PTO F;  3TP8 A;  1I5F A;  4JOI C;  2EXZ A;  4X64 L;  1LAB A;  1EYG A;  4HID A;  1S5D D;  5KIX A;  3VYR A;  1I4X A;  2O4X A;  1S40 A;  3I56 A;  3H15 A;  5CC4 A;  5IT9 E;  2WAQ G;  5F2D A;  5I2Y A;  2EVB A;  5LMN Q;  4LW1 A;  4A3G H;  4C3H H;  4EVO A;  5M5Y B;  3N52 A;  1U9R A;  2NB0 A;  1WFQ A;  4HN7 A;  4P72 A;  3PIP 3;  2VXW A;  1NTG A;  2L15 A;  2NZO A;  2JA6 B;  2JQO A;  1IKM A;  2A68 D;  2ASB A;  1IBK L;  2Z4H A;  2CKZ B;  1Q46 A;  1WI5 A;  3S17 B;  3I4N H;  3M3Y B;  4ABN A;  1HA5 A;  4BBS G;  4O2D A;  3HOW G;  4QQB X;  1ML0 D;  2RSO A;  1W2B A;  2BH2 A;  4A3C G;  3K0X A;  1YHA A;  4IUQ A;  4HAE A;  1IL2 A;  1EFW A;  1YNN D;  3HZX A;  3A0J A;  1F2M A;  3EQL C;  5KGU A;  4JW0 A;  4HJA A;  3K5N A;  4K6D A;  3MXN B;  1TVX A;  5HY6 A;  1K83 H;  1GKH A;  1XWE A;  1YIJ A;  3VYT A;  4NKL A;  5CMD A;  5M3F H;  2RQX A;  4K2L A;  4A3G G;  2EY6 A;  2B8G A;  5JJK A;  2SNS A;  3Q24 A;  3L7Z C;  3H3V I;  2EPB A;  2PCF B;  2PYK A;  1IYU A;  1A8V A;  2Q2I A;  3H3V C;  1L2F A;  3FEW X;  3QB3 A;  2RDH A;  1SNO A;  4XQJ A;  3G48 A;  4DK1 A;  2BDN A;  4AQY L;  5DAU A;  1OXS C;  2L55 A;  3PV0 A;  4GNX C;  1LM0 A;  2B39 A;  3I8Z A;  1STG A;  2R61 A;  5COR A;  3MWY W;  3BDC A;  5BN3 A;  2OTJ A;  5C3W A;  4LFB L;  3IL8 A;  2BOS A;  4PZ6 A;  1QZG A;  3RLN A;  1OO9 B;  1E3P A;  1STY A;  2XGT A;  4X6A H;  3S16 H;  2F0L A;  4QL5 A;  5IP7 H;  3S2D B;  1YHQ A;  2PMZ E;  1F2Z A;  1QG7 A;  3J7A V;  1LTB D;  3J80 i;  5EJW A;  2VQF Q;  1SDF A;  4LF9 Q;  5KNB A;  1N33 L;  4A93 H;  1XPO A;  4C2M H;  2MHV A;  1Q1B A;  1SMX A;  2VB2 X;  2WB1 B;  5I9P A;  2QA4 A;  3DHQ A;  2NVX B;  1LTR D;  1D2B A;  3CCM A;  1UE1 A;  5ISR A;  4IUT A;  4LFB Q;  2N55 A;  3FVQ A;  2MJ8 A;  3Q0A A;  4P2C B;  1WTX A;  1Y1W G;  3J80 L;  4O42 A;  4GKK L;  1PFB A;  1LAC A;  4B9X A;  1ZEQ X;  2K1B A;  5CV9 A;  4KD4 A;  1SR3 A;  4DA2 A;  2UU9 Q;  4EQ5 A;  1GD7 A;  1E2W A;  3S1R H;  3HS0 C;  1JJC B;  3D4R A;  4GKK Q;  1XPU A;  1PH7 A;  3MXU A;  2Z4I A;  4IFD G;  4H7B A;  1KC8 C;  2AUJ D;  1V1P B;  1YIT A;  3FPU B;  2L4N A;  4ZRZ A;  1JB7 A;  1X55 A;  2K5N A;  1K0R A;  4RCN A;  5FK9 C;  1N36 L;  1U4P A;  3TRE A;  3KF6 B;  3S16 B;  2F0V A;  2E2I H;  1UEA B;  4OIK A;  1F9R A;  4A3K G;  2IPK D;  4R8N A;  1BBW A;  1NNX A;  2Z1C A;  1B4O A;  1YZ6 A;  5FO7 B;  4X62 L;  1KRT A;  4A3C H;  4XYQ A;  3BU2 A;  1WTQ A;  1PH1 A;  1PVO A;  3GP7 A;  4YHH L;  1ZXT A;  2IW3 A;  1D5Z C;  1IBK Q;  4EX5 A;  4AYB B;  2HCC A;  3G4S A;  4RGM A;  1KDC A;  1TKW B;  1XNQ Q;  3RMH A;  3RD4 A;  1F9P A;  4I7A A;  2HDL A;  4DR4 Q;  3Q22 A;  4MN3 A;  2NVY B;  2F4V L;  4DV2 L;  3KLS A;  4DV1 L;  4QMG A;  4A76 A;  1VF7 A;  2JA7 H;  4K0K L;  4LUZ A;  2XNA C;  2ZJP A;  3OIQ A;  5EAY A;  4MNO A;  4KY6 A;  1TWA H;  3CMA A;  3J81 i;  5JEA J;  3I2Z A;  5GAE C;  1XPR A;  3HOX G;  1L1O B;  1SFO H;  5IP9 G;  1KLG D;  4UHV A;  2R7F A;  3ZYY X;  4DK3 C;  3HOX B;  2OWO A;  4OL7 A;  3T4A C;  3BVM A;  1HNX Q;  1VQN A;  4KKS A;  2BH8 A;  3M7G A;  1A2T A;  3I4M H;  4DFA A;  1TQO A;  3CCV A;  1JE4 A;  4MTK A;  1CT1 D;  1NSN S;  1Y8O B;  3CRL C;  1Q7Y C;  3N6R A;  3S2H B;  1I50 H;  3H09 A;  2K01 A;  1QVC A;  3GV3 A;  1EY8 A;  3MHB A;  5ELC A;  4L63 B;  3G71 A;  1YVC A;  4OEM B;  1SYB A;  2L5T A;  4JI8 L;  4DV6 Q;  5D65 A;  4IO9 A;  2A74 C;  1XMQ L;  2B2U A;  2HIV A;  2EJF C;  4M1U B;  2G9D A;  4TRD A;  2WII B;  3E6Z X;  2EYJ A;  1PYW D;  4DK6 C;  1R9T H;  1WVL A;  1EOT A;  3CCE A;  4RH6 A;  5FLX E;  3V96 A;  4TKO B;  4HSP A;  1I4H A;  3DWA A;  2OQ0 A;  5BN5 A;  5EKL A;  1EIY B;  1ROD A;  1EQQ A;  1IBL L;  2MPM A;  1JOR A;  4PZ8 A;  4RMF A;  1IXR A;  1PYB A;  3FKI B;  1H95 A;  5ELE A;  1HFG A;  4DAY B;  1G51 A;  1O7Z A;  4DUZ Q;  2IX3 A;  2BA1 A;  4GOP B;  1TWG H;  5C3E B;  2KHJ A;  1PH6 A;  4RG1 A;  1LTS D;  2IX0 A;  3MFG A;  3TS2 A;  1SNC A;  3S1R B;  2F0S A;  1CA6 A;  4Q0F A;  3I7F A;  1VQG A;  5D3D A;  5A35 A;  2RA4 A;  4JI4 Q;  2E8G A;  4CKB A;  4ALP A;  1JJ2 A;  4R4I A;  5D3I B;  1T9H A;  3M4Q A;  2K5W A;  1UWV A;  2F0I A;  5DM7 3;  3CC4 A;  3NEN A;  3V2T A;  1VQB A;  5M5X B;  3MXG A;  3U4V A;  3M85 A;  4KN4 C;  4BA2 I;  1SNM A;  4A4I A;  4JCV E;  3H0G G;  4CJ0 B;  4G7O C;  1X32 A;  3NPP A;  4IPG A;  2HIX A;  2R7Z B;  3GV6 A;  1RTN A;  3L2P A;  1DM0 B;  3CHB D;  1QNU A;  3SXH A;  1U0L A;  4OO1 I;  2KHI A;  3E9I A;  2I07 B;  3SK6 A;  4YWK A;  3CU7 A;  4E6I A;  4A93 G;  1VS0 A;  3FDT A;  1CKN B;  3X3M A;  2EIF A;  2WFW A;  4XT1 B;  3AMU A;  1KLU D;  5K5P A;  1SJH D;  1TS3 A;  1Q8K A;  3UE1 A;  1FD7 D;  1Y8P B;  3DWP A;  5AJ3 L;  2HHH Q;  4A3L H;  3L9A X;  2EYO A;  2JXM B;  4YCU A;  4WJ4 A;  3D6C A;  1J6Q A;  4JI3 L;  3IFT A;  5EKI A;  4A3D G;  1KRS A;  5HUR A;  1K28 A;  1BCP D;  1VDZ A;  3K58 A;  4GLA C;  1RCV D;  1ESF A;  3BG3 A;  4GN3 B;  1B70 B;  3GTK H;  3CCR A;  3Q23 A;  3KK7 A;  2K14 A;  3PGZ A;  2E75 C;  3I4M B;  4RKL A;  2KCT A;  2A1A A;  3QIA A;  4IPC A;  2BCO A;  3ERQ A;  1G29 1;  4ULL A;  2NZH A;  1JB3 A;  1YJN A;  4X66 Q;  4LF5 L;  2EYP A;  1CZG A;  2JA5 H;  1N32 L;  3I4N B;  3NBH A;  3URY A;  4JI0 L;  1F77 A;  1SYE A;  1EWI A;  1SE3 A;  2XVS A;  2DN8 A;  3ERO A;  4LJZ C;  4HJ9 A;  1VQI A;  2PI2 A;  4FF2 A;  1KNA A;  1EYC A;  2Z8L A;  4O1N A;  4LAA A;  3AQQ A;  2RHQ B;  4DUY Q;  1CI3 M;  4HMJ A;  4BBR G;  3CC2 A;  3F8T A;  1VQ8 A;  4DK0 A;  1SBB B;  2TMP A;  4HCS A;  4YHH Q;  2GA4 B;  1Z7T A;  3CME A;  1PZI D;  2CQA A;  4EQO A;  2ZTE A;  1PFS A;  4BY7 H;  1Y1V G;  2X69 A;  1X3P A;  1AE2 A;  5BN4 A;  4YWM A;  4Y7N H;  2J7Z A;  2X6G A;  1J5E L;  2CHB D;  2FFK B;  2UU9 L;  5C0X G;  2YTX A;  2ZXR A;  1D5M C;  3SHL A;  1CTM A;  4BWG B;  4RGN A;  1T5E A;  1SJE D;  2K33 A;  3EVQ A;  3P75 A;  3KJO A;  1YNJ C;  4ID6 A;  1JJG A;  4JI1 Q;  1TXY A;  1O7L A;  3X3N A;  5C6A A;  5HGT A;  4DNT B;  1GHJ A;  5C0X H;  1OTC A;  2D9U A;  2VS1 A;  1ICF B;  4C3I G;  4HIO A;  1TWA B;  4A3I G;  1U4R A;  2CWA A;  5M3M B;  2UUC Q;  2MO1 A;  1VQA A;  5K36 G;  2KUM A;  2F0O A;  2YV5 A;  4L6T B;  1IKL A;  2XWJ B;  1NAP A;  4H02 A;  4LFA L;  1X54 A;  4DXG A;  3STB D;  5JJL A;  2IY5 B;  5IYB H;  3S14 H;  1XYI A;  1H9J A;  2SNM A;  1Y1W B;  2IHF A;  1R4Q B;  2F0N A;  2CW0 D;  3EN2 A;  1BCP F;  2C35 B;  2SOB A;  3FMC A;  1QOH A;  1PMR A;  2V4D A;  4G4K A;  2KCN A;  2NVT H;  2JK8 A;  3BYT B;  1ZYR C;  2Q8T A;  1ENF A;  4RWS C;  4U68 A;  1Q90 A;  5LL6 S;  4YWL A;  3S1N H;  4YIJ A;  2NWG A;  3H6M A;  3PIO A;  1IBL Q;  4WFN 3;  1I4G A;  1UE6 A;  2K28 A;  1TWC H;  4LF7 Q;  1WCM H;  1CK1 A;  1S72 A;  3M4P A;  1Y69 U;  4RGT A;  1TWH H;  4ILW A;  3HOY B;  4R8I A;  4IFD H;  1SE2 A;  2K5H A;  2EJM A;  3A8K E;  1XMO Q;  4KMU C;  4U67 3;  2A8V A;  1LTL A;  1AEX A;  4OON A;  5C4J H;  3OW7 A;  3T1H L;  2Z6B A;  4RCO A;  3E9H A;  4N9T A;  2LXJ A;  3TN2 A;  4APV A;  2TSS A;  2XIW A;  1FNU A;  2KOL A;  5LL6 X;  3KDF B;  1S5B D;  2JA5 B;  2DY8 A;  1U4L A;  3KJP A;  2ICI A;  4LF7 L;  1D7Q A;  1IBM L;  1DZ1 A;  5EPJ A;  1V1Q A;  3A74 A;  3MA2 B;  3PUV A;  2V1C C;  3CXC A;  4DGZ A;  4R4C A;  2ICE C;  3NBH B;  3JAM E;  4MZ9 A;  1YNX A;  2KVM A;  3BYY B;  3OWF A;  4YCW A;  1ICW A;  3J7A F;  4IFD I;  3SK4 A;  4BY1 B;  3I4O A;  4KLK A;  4B3M L;  1YJ9 A;  1VQM A;  1W3S A;  1H9K A;  4DR2 L;  4A3J H;  1EIH A;  4LK1 C;  1D8L A;  2R6G A;  2E5L Q;  5D14 A;  3OMC A;  1EWC A;  4KK7 A;  4DV7 L;  1NCV A;  2QF7 A;  3EBE A;  2CCZ A;  1HNW L;  2N49 A;  2FXQ A;  1QCB D;  1PH9 A;  4DAM A;  4KY7 A;  1M4V A;  3HG9 A;  4FYD A;  2R93 H;  2NTS A;  2KHS A;  5EGT A;  4R9W A;  3RUZ A;  1K8O A;  1B1Z A;  1XNR Q;  1BVS A;  1TT2 A;  2R92 G;  2NVQ H;  2B2V A;  2HQL A;  4JI4 L;  4B3M Q;  5KYI A;  3KYH C;  3Q8D A;  3PUY A;  1B8A A;  3OSO A;  1XNR L;  4DKA C;  1JQY D;  3FP9 A;  2I5L X;  2PPB C;  1U4M A;  2VW9 A;  1WTV A;  2NVX H;  3BS1 A;  1Q86 C;  4UDU C;  5ELN A;  1KXL A;  1K8A C;  1HR0 L;  5E7N A;  4L5R C;  3QO2 A;  2ZM6 L;  3L3O C;  4G57 A;  1Q82 C;  1RL2 A;  1STN A;  3S15 B;  2RDF A;  1BF4 A;  2EYL A;  4ME3 A;  1DXM A;  4F88 A;  2ZM6 Q;  3T1Y L;  1E7Z A;  3U58 A;  1HNZ L;  1WD0 A;  1EY4 A;  3RZO B;  1N9W A;  5LMN W;  3JAM c;  1MD2 D;  2B3G A;  1QUQ A;  1FJG Q;  1I4P A;  4XQQ A;  4J8Q A;  1BDO A;  3E3X A;  3FKI G;  4L5T A;  1HXY D;  2Z9H A;  4A3K H;  4LF4 L;  1IHZ A;  3IAY A;  1Y1W H;  1OXX K;  3QOL A;  3FHW A;  3MAQ A;  4JI5 Q;  2HT1 A;  3E5S A;  3V05 A;  2JEA I;  1UE7 A;  4LF4 Q;  2O5J C;  1WYD A;  4JBW A;  1Y14 B;  2LFN A;  5I6Y A;  1C8C A;  1BCP B;  1V43 A;  1QZH A;  4C3I H;  1W6J A;  3A56 A;  5JJI A;  1CQV A;  1EU4 A;  4B08 A;  1KHI A;  1PRT F;  1QUQ B;  4K5W A;  3JAM L;  2B63 H;  1WJJ A;  3W3A A;  3WWV A;  5C0X I;  1E2V A;  3BZC A;  4DV0 L;  2M9V A;  1WCM B;  2HQE A;  4Y7N B;  3PIO 3;  2F03 A;  4FF1 A;  4DV6 L;  2OF1 A;  1BOS A;  4TVA B;  1GUS A;  1PLF A;  2WV6 D;  3I55 A;  1IW7 D;  3P20 A;  3PO2 H;  3CPF A;  1JOO A;  2UXD L;  3M4O B;  2IWH A;  3VDY A;  3JAM i;  1PYS B;  1NY4 A;  4CDE C;  5FLM H;  1DD2 A;  4OXP A;  3TBI B;  2OTL A;  1VMP A;  1D6E C;  3I70 A;  4EQP A;  4DUY L;  1GUW A;  4A3J G;  3GTP B;  1GM5 A;  4LF9 L;  2E76 C;  4OX9 L;  3PO3 G;  1SN8 A;  3BZK A;  2VB3 X;  5C5L A;  1A3U A;  5T1G A;  4DR1 Q;  1GUT A;  3IFD A;  1S5F D;  3J80 c;  2B8F A;  5LMN L;  1CA5 A;  1DOL A;  1N34 Q;  3L0O A;  5GRO A;  1STH A;  1L0Y B;  4X3K A;  2EYM A;  5ELF A;  2WKC A;  4K8I A;  1LLR D;  2E2J H;  4FO2 A;  1ZYR D;  4KY5 A;  1B53 A;  3PIP A;  1K0S A;  3LX0 A;  4IJL A;  2ZJQ A;  3BVG A;  3T53 B;  1AZP A;  1SE4 A;  1N34 L;  2DY7 A;  2R93 B;  2C9O A;  1MJC A;  3HOZ H;  1X3Q A;  2IHE A;  3AB9 A;  2PO4 A;  2F4I A;  3ULL A;  1J5E Q;  2NVY H;  1VF5 C;  1L1O A;  3NSW A;  4OWT B;  5EPL A;  4G7Z C;  2KA7 A;  4OEL B;  3F2D A;  1HNW Q;  3LWE A;  3I4N G;  1K9M C;  3S2D H;  2JA9 A;  2JJQ A;  2BE5 C;  1KTK A;  1GO3 E;  2VY3 A;  5IY0 A;  2I46 A;  2E5L L;  1LTG D;  1NMF A;  5DNF A;  4DV7 Q;  3KDF A;  3NQI A;  3HRZ C;  1I6H B;  3M4Y A;  1UAP A;  4CHT B;  2UXC L;  5C44 B;  5IGB A;  3NK9 A;  2A69 C;  5EQ0 A;  3S15 H;  5C3X A;  1VQF A;  3OYY A;  5C44 G;  1F9S A;  1CSQ A;  4OIJ A;  3TDQ A;  4QJF A;  3T1H Q;  5JEA H;  1F9Q A;  3HKZ B;  1BQQ T;  4IUN A;  1EY7 A;  1GUO A;  2NUC A;  1EY6 A;  2LKV A;  4L8J A;  1W6K A;  2XSC A;  2VQE Q;  5C44 H;  4DR7 L;  4WRD A;  2EYF A;  5CYU A;  1X3F A;  4Y52 H;  2F0D A;  4B3S L;  4JK1 C;  2IX1 A;  4HJ5 A;  1EZ6 A;  4TSS A;  2ALY B;  3NQT A;  4GLV B;  5EBD A;  1YJW A;  1WOC A;  1LTI D;  5GQO A;  3RLF A;  4FNF A;  2F52 A;  1XTD A;  2PZW A;  2L9H A;  1EIF A;  1E22 A;  1TWF B;  3CQZ H;  4IAL A;  4A3I H;  3DM3 A;  2F0M A;  3VR5 A;  4CKC A;  1LTA D;  4AIM A;  1V1P A;  4JC0 A;  2VUM G;  1G2S A;  2Q8I B;  3D4W A;  2NN6 H;  3HP3 A;  2H5X A;  3VR3 A;  3LGJ A;  1PRT C;  4H44 C;  3HEJ A;  2JA7 B;  1N8R C;  1O7Y A;  2KJX A;  1X3G A;  3GTO B;  1N36 Q;  1PZK D;  3K5M A;  1CKO A;  4FF4 A;  2UXB Q;  3K7A H;  3ND9 A;  4DR3 L;  1XX8 A;  1PH3 A;  3KUP A;  2B2Y A;  3ICE A;  2EJG C;  4GOP C;  3SEB A;  5GAG C;  2EZV A;  1GHK A;  2DUD A;  4K8J A;  2F0F A;  4DUZ L;  3SR1 A;  1G6P A;  2GN5 A;  2VL6 A;  2QEX A;  4OO1 G;  1E0B A;  2R3Z A;  3F2C A;  1Q1E A;  1KL9 A;  4DAV A;  1SYG A;  3TS0 A;  1TII D;  1PTO B;  4JG2 A;  3P1H A;  2QIL A;  2P5Z X;  3CF5 A;  1VQJ A;  2I5M X;  2PW7 A;  4M8A A;  5BR8 Q;  5C3E G;  1BCP C;  5M5W B;  3S1Q H;  1VQL A;  3OPO A;  1MI2 A;  5HGQ A;  5G3L D;  5C0X J;  4RHR A;  4K0K Q;  1STB A;  5J39 A;  3FPP A; 
#chains in the Genus database with same CATH homology
 1CM9 A;  2O5I C;  3KLS X;  5ELD A;  2K5D A;  2L11 A;  2A6E D;  4FXG C;  1TS5 A;  3NTH A;  2QDB A;  4PNY A;  1Z6H A;  1EL0 A;  4KN7 C;  4IUV A;  3K7A B;  1FGB D;  3U9S A;  5A2Q L;  2EOT A;  1JCK B;  1J9O A;  4IUR A;  5TSS A;  3S9W A;  2G9H D;  3K5O A;  3G6J B;  5I9O A;  1HQM C;  4XQN A;  1D1K A;  3K0Y A;  1HRJ A;  2WAQ B;  1WD1 A;  4A3D B;  3OHX C;  1EWH A;  3I3C A;  2J4X A;  1HFN A;  1TY2 A;  2ID0 A;  2K32 A;  2WAC A;  2MUY A;  3WDN A;  4RKB A;  2AQ2 B;  1YNN C;  2KCC A;  2LMC B;  3TZD A;  3EA6 A;  2A6E C;  5E3F A;  1FNV A;  2QEJ C;  1B3A A;  2Y0S B;  3HOW B;  3A8J E;  2R92 B;  1EZ8 A;  1PTO D;  5C4Z A;  1I4R A;  2PZU A;  3QOJ A;  4MIU A;  1I3Q B;  1R9T B;  3S1N B;  2RBM A;  5EKK A;  1SFO B;  1KNE A;  3T56 B;  4F7X A;  4A3E B;  1Q3L A;  4OGQ C;  2IL8 A;  3DM1 A;  3S1Q B;  2Q8R E;  5KEE A;  1NUC A;  2F3V A;  2NVT B;  4FVM A;  2RSN A;  4BS9 A;  1JR0 D;  3K57 A;  2C5C A;  4ZAI A;  1NR4 A;  4CJ1 B;  3LWU A;  4QB4 A;  1RD9 D;  2IJ0 A;  4MHE A;  3QWN A;  1OXV A;  4DNR B;  4NW2 A;  4TQU S;  4K5V A;  1HHV A;  3DUZ A;  4C1N K;  1WTR A;  5LHY 1;  1RHP A;  4DAY A;  2F0E A;  5E1F A;  5JAV A;  1HA6 A;  1Y8N B;  1HTP A;  1Z47 A;  3D6W A;  4DAP A;  3I73 A;  1A2U A;  2M00 A;  1B50 A;  4QF4 A;  5JVH 3;  3H94 A;  5E4W C;  1PFN A;  2F3W A;  4GZY C;  1WTO A;  2CVR A;  3A7L A;  2K7V A;  3OIP A;  2YYZ A;  3VR6 A;  1VMC A;  3GTJ B;  1Q12 A;  2KEE A;  3CKI B;  2DNC A;  2E74 C;  3WOE A;  3I4L A;  3NTI A;  2AQ1 B;  5EBC A;  4KI0 A;  5KRU A;  4NP5 A;  4HSV A;  3R3O A;  4KKU A;  5CV4 A;  3SK5 A;  4I65 A;  1HCZ A;  4A3M B;  1DOM A;  4G7H C;  1GXD C;  1ILP A;  2ZXP A;  2B2V C;  4XXE A;  1AFP A;  4PMW A;  1EEF D;  1IL8 A;  3T13 A;  2XRQ D;  1QNK A;  1LO5 D;  4IQZ A;  1B2T A;  4HMI A;  4V19 0;  3QJY A;  2A5H A;  4J1M A;  1PDQ A;  5JOB A;  5IGC A;  5JEA G;  2X6L A;  2H4O A;  5JVG 3;  2EY2 A;  5COY A;  3NBI A;  1TR5 A;  4ZLT F;  1TS4 A;  4K6L A;  3GTM B;  2F0K A;  4C3H G;  3OOC A;  4OHJ A;  3VYU A;  3FRP B;  4CKE A;  1LTT D;  1GJX A;  3GTQ B;  1C4Q A;  1FYC A;  4HCE A;  4ZYS A;  3KBG A;  5IGG A;  2JSO A;  3U9O A;  3DEP A;  2F1M A;  3PUX A;  3OWE B;  3G7L A;  1HUN A;  3DMU A;  4PQX A;  5ELB A;  1Q8I A;  2VUM B;  4BBS B;  3M7N A;  2SEB D;  2LY7 A;  4LMQ D;  4XT3 B;  1L0X B;  3PMF A;  2E2D C;  4IUU A;  2JE6 I;  4J6H A;  4C3J B;  4C3I B;  3CQZ B;  4HED A;  2K04 A;  1B9M A;  4KD3 A;  2E2J B;  1CFM A;  4BA1 I;  5NUC A;  4X3U A;  3SE0 A;  2B2Y C;  1AZQ A;  4FF3 A;  1BR9 A;  4A3G B;  1LT3 D;  1OXU A;  2HDM A;  3UI2 A;  4ZKB B;  1CQF A;  2PQE A;  1EEI D;  2JEB I;  3OMG A;  1A6X A;  1MBY A;  1SYC A;  4C2M B;  2EY1 A;  3Q6S A;  3K59 A;  2L12 A;  4CBV A;  1AN8 A;  3GD7 A;  3QG1 A;  3PO2 B;  5DEH A;  3VYS A;  4BY7 B;  3HOU B;  1BBX C;  1IYV A;  1A15 A;  4KHV A;  1JC7 A;  3NTK A;  1B9N A;  5IOC A;  3BDO A;  1S5E D;  1ENC A;  3NHH A;  1H9M A;  4K5X A;  4K14 A;  4KJO A;  3PUW A;  1LT6 D;  1OXT A;  4RHS A;  1GOZ A;  3S14 B;  1DCZ A;  1RKN A;  5EPK A;  4DU9 A;  3MXN A;  1CHQ D;  1G8Z D;  3GO5 A;  2EY5 A;  3P7J A;  5FOB B;  4A3J B;  4A93 B;  1M8A A;  4KJN A;  1EY9 A;  1ZKO A;  1G2T A;  4ME5 A;  3HOV B;  3MC0 B;  4RGO S;  2HUG A;  5CV7 A;  3R93 A;  2RKS A;  5JJZ A;  4KV6 A;  4KTA A;  2A6H D;  3R2T A;  3TSS A;  3D3R A;  4FXD A;  3TME A;  2NN6 I;  5I2X A;  5KNC A;  5I6W A;  2FMM A;  2A68 C;  3EJI A;  2XWB B;  1DON A;  4PV1 C;  3I72 A;  1V8Q A;  4EQN A;  1UNS A;  1QWY A;  2JA8 B;  3MZ5 A;  4XYO A;  1S4Z A;  5CV8 A;  4NMZ A;  3NE5 B;  2NBF A;  4S3S A;  5C5M A;  1IW7 C;  4ZQ3 A;  4IFD J;  1PTO H;  3TP6 A;  2QCP X;  4BBR B;  3WOF A;  3CRK C;  2OT2 A;  1AP0 A;  1CHP D;  4C56 C;  5K36 H;  5FLX L;  1PTO C;  1FNW A;  3NXW A;  1MSG A;  5A2Q E;  3J81 L;  4RFB A;  3ITP A;  4IZ8 A;  1CZW A;  1HPC A;  5T1I A;  1BUV T;  4OO1 H;  1H9R A;  1MGS A;  1II3 A;  4FP5 D;  3D8G A;  3IKJ A;  3AU7 A;  1YNJ D;  1T5X D;  5C4H A;  1EIG A;  1PRT B;  2FHT A;  1H9S B;  1AW7 A;  3I90 A;  3VA7 A;  3A55 A;  2EYH A;  1EU3 A;  5IGE A;  1ENA A;  2MGS A;  2DNE A;  4FXK C;  2L1B A;  2FJ2 A;  3PO3 B;  3T16 A;  3E0J A;  2KEC A;  5IIF A;  2PW5 A;  4K2K A;  1TWH B;  3RZD B;  1I4Q A;  4H0L C;  5KND A;  1PZJ D;  4DN4 M;  3A7A B;  1JWS D;  2BDO A;  5M3F B;  4RAU C;  4A3K B;  3GTL B;  3T51 B;  4EGV A;  2XN9 C;  4RA8 A;  5IT9 L;  3H0G B;  4HTH A;  1F2L A;  2B2U C;  3NP8 A;  1R4P B;  1V1O A;  2CW0 C;  3MFY A;  4CJ2 C;  2EDG A;  5DM6 3;  1BO0 A;  1JOK A;  3D31 A;  2AQ3 B;  1KDA A;  3KF8 A;  4ZKC B;  2XRS D;  2WP8 J;  4C3H B;  2HCI A;  2A69 D;  3ONA B;  2A73 B;  1S5C D;  1WTW A;  5CBE E;  2RVL A;  1DOK A;  3NWT A;  2SDF A;  5E4X A;  4H13 C;  2E2I B;  1ESR A;  1SEB D;  1UUP A;  1O80 A;  3K6O A;  3SVM A;  3DEO A;  1MSH A;  2QKI C;  5CGK A;  1KAB A;  1EY0 A;  3DXJ C;  5CV6 A;  2JYO A;  1D5X C;  1EYA A;  4A3B B;  1K83 B;  3BDL A;  4ODG A;  1A3V A;  1QE6 A;  1XXG A;  4X3S A;  1SNP A;  2NN6 G;  2F0W A;  3NUC A;  4HR7 B;  4CGY B;  2IT1 A;  1J8I A;  5IGF A;  4KKT A;  3VA5 A;  2B2T A;  4C3J G;  3S1M B;  2AWN A;  1SYD A;  2L0C A;  4DXF A;  3KBX A;  2WIN B;  2D2C C;  1B44 D;  2K03 A;  2O2L D;  1TU2 B;  3EFX D;  4A3F B;  2F0J A;  4WOR A;  1E2Z A;  2OEO A;  1DYQ A;  4XTC S;  2JP1 A;  1VCI A;  1DJR D;  1QIL A;  1TWC B;  4ZUJ A;  1ET9 A;  2AUK A;  3HOZ B;  1SXT A;  3LNN A;  1ILQ A;  1RTO A;  1I50 B;  1G6Z A;  1STA A;  3ND8 A;  2ZT9 C;  4IUP A;  3C1F A;  1RDP D;  4WJW A;  3GQB A;  1KDB A;  3PUZ A;  3J81 E;  1QJO A;  1EYD A;  5FKA C;  4Z9C B;  1TWG B;  1JOQ A;  1QB5 D;  5FO8 B;  1TY0 A;  4ZUI A;  1JWU D;  4KHZ A;  3K5L A;  4XDX A;  2F0G A;  4QIW B;  2A6H C;  3DWQ A;  2M2L A;  3VR4 A;  1SND A;  2PZT A;  2PMZ B;  2ENB A;  1NR2 A;  1I6V C;  3W2D A;  2B2W A;  3H91 A;  4PMB A;  2KED A;  2LS0 1;  1K8M A;  1O78 A;  1EQT A;  1LT5 D;  3BZD B;  1ET6 A;  4QUC A;  5CR3 A;  1LT4 D;  4IN3 A;  2NVQ B;  2PNR C;  5I4D A;  1TS2 A;  1EQV A;  2K5Q A;  5AFW A;  3A54 A;  4X3T A;  2EE1 A;  2B2W C;  3KLR A;  1SSO A;  2F0H A;  1PFM A;  5JPN C;  2NZ1 D;  4F8M A;  3TP5 A;  2K05 A;  1ONL A;  2OXP A;  3J80 E;  4V0B A;  2VNU D;  3MTS A;  1JWM D;  3I91 A;  3MVV A;  1GUN A;  2ZXO A;  1PRT D;  5C4J B;  5FO9 B;  3R8B A;  4DF7 A;  1Y1V B;  5IGD A;  1BXT A;  1GUG A;  2FMC A;  3TP7 A;  4A3I B;  5IOD A;  1PXU A;  4QCL A;  2D62 A;  1KAA A;  5G3L F;  3J7Y W;  1H9S A;  3C46 A;  1RF2 D;  3R2I A;  2BA0 A;  2KQ3 A;  3O13 A;  2NTT A;  1EFI D;  4ZK9 B;  3GTK B;  5KYL A;  4C1N I;  1A3T A;  1F2Y A;  3MXP A;  1RJT A;  1D1I A;  1C48 A;  1SAP A;  4XIG S;  5JPM C;  1SNQ A;  3VR2 A;  1SMY C;  1WTP A;  2B63 B;  1HTL D;  2F0T A;  5J22 A;  4Q5V A;  2H1E A;  2FIN B;  5M9O A;  1JIC A;  1XTC D;  4UAI A;  2B2T C;  4PMC A;  5CBA E;  3HGB A;  2AWO A;  2F0Q A;  1HUM A;  3MEH A;  2MP1 A;  4N9P A;  1FR3 A;  3GTG B;  3C3L A;  3BVZ A;  3SDZ A;  4I7Z C;  3D4D A;  3TZU A;  2F0P A;  2J0T D;  1STE A;  3F2U A;  4QUF A;  2K6A A;  3SK8 A;  3C1E A;  3NWS A;  2BE5 D;  4B9W A;  2E2H B;  1G91 A;  3A8I E;  2YU9 B;  2N88 A;  1LV9 A;  2NYZ D;  3C2P A;  2RDG A;  1SYF A;  2D5D A;  4NDX A;  1SMY D;  2WKD A;  5C4X B;  4F87 A;  5CV5 A;  5J1Z A;  1BNZ A;  1EY5 A;  1HQR D;  2F0U A;  1PTO F;  3TP8 A;  2EXZ A;  1LAB A;  1S5D D;  5KIX A;  3VYR A;  1I4X A;  2O4X A;  5CC4 A;  5IT9 E;  5F2D A;  5I2Y A;  2EVB A;  5M5Y B;  4EVO A;  3N52 A;  1U9R A;  2NB0 A;  4HN7 A;  3PIP 3;  2VXW A;  2JA6 B;  1IKM A;  2A68 D;  2Z4H A;  3S17 B;  3M3Y B;  4ABN A;  1HA5 A;  1ML0 D;  2RSO A;  4IUQ A;  4HAE A;  1YNN D;  3HZX A;  1F2M A;  3EQL C;  5KGU A;  3K5N A;  4K6D A;  1TVX A;  1XWE A;  3VYT A;  4NKL A;  5CMD A;  2RQX A;  4K2L A;  2EY6 A;  2B8G A;  2SNS A;  3Q24 A;  3L7Z C;  2EPB A;  2PCF B;  2PYK A;  1IYU A;  3H3V C;  3FEW X;  3QB3 A;  2RDH A;  1SNO A;  4XQJ A;  4DK1 A;  2BDN A;  5DAU A;  1OXS C;  2L55 A;  3PV0 A;  2B39 A;  3I8Z A;  1STG A;  2R61 A;  5COR A;  3MWY W;  3BDC A;  5BN3 A;  5C3W A;  3IL8 A;  2BOS A;  1OO9 B;  1STY A;  2F0L A;  3S2D B;  1F2Z A;  1QG7 A;  3J7A V;  1LTB D;  5EJW A;  1SDF A;  5KNB A;  2MHV A;  1Q1B A;  2VB2 X;  2WB1 B;  5I9P A;  2NVX B;  3DHQ A;  1LTR D;  1D2B A;  5ISR A;  4IUT A;  2N55 A;  3FVQ A;  2MJ8 A;  3Q0A A;  4P2C B;  1WTX A;  3J80 L;  4O42 A;  1PFB A;  1LAC A;  4B9X A;  1ZEQ X;  2K1B A;  5CV9 A;  4KD4 A;  4DA2 A;  1E2W A;  3HS0 C;  3D4R A;  3MXU A;  2Z4I A;  4IFD G;  4H7B A;  2AUJ D;  1V1P B;  3FPU B;  2L4N A;  4ZRZ A;  4RCN A;  5FK9 C;  1U4P A;  3S16 B;  2F0V A;  1UEA B;  4OIK A;  1F9R A;  2IPK D;  4R8N A;  2Z1C A;  1B4O A;  5FO7 B;  4XYQ A;  1WTQ A;  3GP7 A;  1ZXT A;  2IW3 A;  1D5Z C;  4AYB B;  2HCC A;  4RGM A;  1KDC A;  1TKW B;  3RMH A;  3RD4 A;  1F9P A;  2HDL A;  3Q22 A;  4MN3 A;  2NVY B;  3KLS A;  4QMG A;  1VF7 A;  2XNA C;  3OIQ A;  4KY6 A;  5JEA J;  1KLG D;  3ZYY X;  3HOX B;  4OL7 A;  3T4A C;  3BVM A;  4KKS A;  3M7G A;  1A2T A;  4DFA A;  1TQO A;  1JE4 A;  1CT1 D;  1NSN S;  1Y8O B;  3CRL C;  3S2H B;  3N6R A;  3H09 A;  2K01 A;  3GV3 A;  1EY8 A;  3MHB A;  5ELC A;  4L63 B;  1SYB A;  2L5T A;  5D65 A;  2A74 C;  2B2U A;  2EJF C;  4M1U B;  2G9D A;  4TRD A;  2WII B;  3E6Z X;  2EYJ A;  1PYW D;  1WVL A;  1EOT A;  4RH6 A;  5FLX E;  3V96 A;  4TKO B;  4HSP A;  1I4H A;  3DWA A;  5BN5 A;  5EKL A;  1ROD A;  2MPM A;  1JOR A;  3FKI B;  5ELE A;  1HFG A;  1O7Z A;  2IX3 A;  2BA1 A;  5C3E B;  1LTS D;  2IX0 A;  3MFG A;  1SNC A;  3S1R B;  2F0S A;  1CA6 A;  4Q0F A;  5D3D A;  5A35 A;  2RA4 A;  4CKB A;  5D3I B;  2K5W A;  2F0I A;  5DM7 3;  3V2T A;  5M5X B;  3MXG A;  3M85 A;  4KN4 C;  4BA2 I;  1SNM A;  4CJ0 B;  4G7O C;  1X32 A;  3NPP A;  2R7Z B;  3GV6 A;  1RTN A;  1DM0 B;  3CHB D;  1QNU A;  3SXH A;  4OO1 I;  2I07 B;  3SK6 A;  3CU7 A;  4E6I A;  3FDT A;  3X3M A;  4XT1 B;  3AMU A;  1KLU D;  5K5P A;  1SJH D;  1TS3 A;  1FD7 D;  1Y8P B;  3DWP A;  3L9A X;  2EYO A;  2JXM B;  3D6C A;  3IFT A;  5EKI A;  5HUR A;  1BCP D;  1VDZ A;  3K58 A;  1RCV D;  1ESF A;  3BG3 A;  3Q23 A;  3KK7 A;  2E75 C;  3I4M B;  4RKL A;  3QIA A;  2BCO A;  3ERQ A;  1G29 1;  4ULL A;  1JB3 A;  2EYP A;  1CZG A;  3I4N B;  3NBH A;  3URY A;  1F77 A;  1SYE A;  1SE3 A;  2XVS A;  2DN8 A;  3ERO A;  4LJZ C;  4FF2 A;  1KNA A;  1EYC A;  2Z8L A;  4O1N A;  4LAA A;  1CI3 M;  4HMJ A;  4DK0 A;  1SBB B;  2TMP A;  4HCS A;  2GA4 B;  1Z7T A;  1PZI D;  2CQA A;  4EQO A;  2X69 A;  1X3P A;  5BN4 A;  2J7Z A;  2X6G A;  2CHB D;  2FFK B;  5C0X G;  2ZXR A;  1D5M C;  3SHL A;  1CTM A;  4BWG B;  4RGN A;  1T5E A;  1SJE D;  2K33 A;  3EVQ A;  3P75 A;  1YNJ C;  4ID6 A;  1O7L A;  3X3N A;  5C6A A;  5HGT A;  4DNT B;  1GHJ A;  5C0X H;  2D9U A;  4C3I G;  1TWA B;  1U4R A;  5M3M B;  5K36 G;  2KUM A;  2F0O A;  4L6T B;  1IKL A;  2XWJ B;  1NAP A;  4DXG A;  1XYI A;  1H9J A;  2SNM A;  1Y1W B;  1R4Q B;  2F0N A;  2CW0 D;  1BCP F;  2SOB A;  3FMC A;  1QOH A;  1PMR A;  2V4D A;  4G4K A;  2KCN A;  3BYT B;  1ZYR C;  2Q8T A;  1ENF A;  4RWS C;  4U68 A;  1Q90 A;  5LL6 S;  4YIJ A;  2NWG A;  3H6M A;  4WFN 3;  1I4G A;  2K28 A;  1CK1 A;  1Y69 U;  4RGT A;  4ILW A;  4IFD H;  3HOY B;  4R8I A;  1SE2 A;  2EJM A;  3A8K E;  4KMU C;  4U67 3;  1AEX A;  3OW7 A;  4RCO A;  4N9T A;  3TN2 A;  2TSS A;  2XIW A;  1FNU A;  2KOL A;  5LL6 X;  1S5B D;  2JA5 B;  2DY8 A;  1U4L A;  2ICI A;  1DZ1 A;  5EPJ A;  3MA2 B;  3PUV A;  4DGZ A;  2ICE C;  3JAM E;  2KVM A;  3BYY B;  3OWF A;  1ICW A;  3J7A F;  4IFD I;  3SK4 A;  4BY1 B;  1H9K A;  1EIH A;  4LK1 C;  2R6G A;  5D14 A;  3OMC A;  1EWC A;  4KK7 A;  1NCV A;  2QF7 A;  1QCB D;  4KY7 A;  1M4V A;  3HG9 A;  4FYD A;  2NTS A;  2KHS A;  5EGT A;  4R9W A;  3RUZ A;  1K8O A;  1B1Z A;  1TT2 A;  2B2V A;  5KYI A;  3PUY A;  3OSO A;  1JQY D;  2PPB C;  1U4M A;  1WTV A;  3BS1 A;  4UDU C;  3QO2 A;  3L3O C;  4G57 A;  1STN A;  3S15 B;  2RDF A;  1BF4 A;  2EYL A;  1DXM A;  4F88 A;  1WD0 A;  1EY4 A;  3RZO B;  1MD2 D;  1I4P A;  4XQQ A;  4J8Q A;  1BDO A;  1HXY D;  1IHZ A;  3IAY A;  1OXX K;  3QOL A;  3MAQ A;  3E5S A;  3V05 A;  2JEA I;  2O5J C;  4JBW A;  2LFN A;  5I6Y A;  1C8C A;  1BCP B;  1V43 A;  1W6J A;  3A56 A;  1CQV A;  1EU4 A;  4B08 A;  1PRT F;  4K5W A;  3JAM L;  3W3A A;  5C0X I;  1E2V A;  2M9V A;  1WCM B;  2HQE A;  4Y7N B;  3PIO 3;  2F03 A;  4FF1 A;  2OF1 A;  1BOS A;  1GUS A;  1PLF A;  2WV6 D;  1IW7 D;  3P20 A;  1JOO A;  3M4O B;  2IWH A;  1DD2 A;  3TBI B;  1VMP A;  1D6E C;  3I70 A;  4EQP A;  1GUW A;  3GTP B;  2E76 C;  2VB3 X;  5C5L A;  1A3U A;  5T1G A;  1GUT A;  3IFD A;  1S5F D;  2B8F A;  1CA5 A;  1DOL A;  1STH A;  1L0Y B;  4X3K A;  2EYM A;  5ELF A;  2WKC A;  4K8I A;  1LLR D;  4FO2 A;  1ZYR D;  4KY5 A;  1B53 A;  3LX0 A;  3BVG A;  3T53 B;  1AZP A;  1SE4 A;  2DY7 A;  2R93 B;  2C9O A;  1X3Q A;  3AB9 A;  2PO4 A;  2F4I A;  1VF5 C;  3NSW A;  5EPL A;  4G7Z C;  2KA7 A;  3LWE A;  2BE5 C;  1KTK A;  2I46 A;  1LTG D;  5DNF A;  3NQI A;  3HRZ C;  1I6H B;  3M4Y A;  1UAP A;  4CHT B;  5C44 B;  5IGB A;  3NK9 A;  2A69 C;  5EQ0 A;  5C3X A;  1F9S A;  4OIJ A;  3TDQ A;  5JEA H;  1F9Q A;  3HKZ B;  1BQQ T;  4IUN A;  1EY7 A;  1GUO A;  2NUC A;  1EY6 A;  2LKV A;  4L8J A;  1W6K A;  2XSC A;  4WRD A;  2EYF A;  5CYU A;  2IX1 A;  2F0D A;  4JK1 C;  1EZ6 A;  4TSS A;  3NQT A;  5EBD A;  1LTI D;  3RLF A;  4FNF A;  2PZW A;  2L9H A;  4IAL A;  1TWF B;  2F0M A;  3VR5 A;  4CKC A;  1LTA D;  1V1P A;  1G2S A;  2Q8I B;  3D4W A;  2NN6 H;  3HP3 A;  3VR3 A;  1PRT C;  4H44 C;  3HEJ A;  2JA7 B;  1O7Y A;  2KJX A;  3GTO B;  1PZK D;  3K5M A;  4FF4 A;  3ND9 A;  1XX8 A;  3KUP A;  2B2Y A;  2EJG C;  3SEB A;  2EZV A;  1GHK A;  4K8J A;  2F0F A;  3SR1 A;  4OO1 G;  1E0B A;  2R3Z A;  1Q1E A;  4DAV A;  1SYG A;  1TII D;  1PTO B;  3P1H A;  2QIL A;  2PW7 A;  4M8A A;  1BCP C;  5M5W B;  3OPO A;  1MI2 A;  5G3L D;  5C0X J;  4RHR A;  1STB A;  5J39 A;  3FPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...