4YY3Q

30s ribosomal subunit- higb complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
100
structure length
100
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 21
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4yy3Q00
3STBD 5C44G 3T1YQ 1W2BA 4DUYQ 1SR3A 1B7YB 3HKZG 1VQPA 1T9HA 1PVOA 4P74A 3TEHB 2NN6I 1C0AA 3CCMA 4DV2Q 4NXNL 3VDYA 4TVAB 1VQ7A 4JV5L 2KENA 3F2CA 4DV7L 1HR0L 4DUZL 2Y0SE 3CCJA 4B3MQ 1YBYA 4KHPQ 1P16A 4DAMA 1B70B 1D8LA 2MNAA 3JAMi 3DM3A 1YEZA 1EFWA 1TWAH 2F4VL 1NY4A 5FJ8G 2RCNA 3I4NG 4YHHQ 4B3SL 4DV5L 5ELOA 5GAEC 3CP0A 2VQFQ 3PV0A 1NE3A 2JE6I 2UUAL 1PH8A 5GAGC 1K8AC 3HOXG 3KDFA 2JQOA 5FLMH 4HIMA 2R92H 3TRZA 2I5MX 3EBEA 1FJGQ 2KCMA 2NVTH 4QGUA 1X3GA 3CMEA 1HNXL 2Q2IA 4O0AA 2ZM6Q 4GNXB 2Q2TA 4LFCQ 2BH2A 3U58A 1L1OA 4LFAQ 3BZCA 1AE3A 2VW9A 4LF8L 1YHQA 1V1QA 1WCMG 4KLKA 4X64L 4JI2L 3PO3G 1I6HH 1NMGA 1VQ6A 1HNZL 2HQLA 2V1CC 3GTMH 1SE8A 1XNRQ 3RN2A 4X62Q 3W5OA 3CC2A 4GNXC 4L5RC 4IPDA 4LF6L 3CCSA 3KFUA 2F3IA 5GAHC 4JBMA 4LF9Q 2A19A 3HFZB 5M3FG 1FGUA 2Z0SA 4YWLA 4DR5Q 1YJWA 4C3HH 5JJIA 3AFQA 3A74A 1QUQB 3KF6B 5IYBG 2OTLA 2R93G 3ULLA 3PO2H 1NMFA 4GLXA 3CCRA 1U5KA 1SFOH 1PH9A 1ASZA 1EYGA 4A3GH 1YHBA 4JG2A 1VQFA 2K52A 2YV5A 4A3KH 3GD7A 4A93H 2PNHA 5IYDG 4UP8A 4DR3Q 5LMUL 3F8TA 1QZGA 1I94Q 4GLAC 4QJFA 3GTKH 1BVSA 5LMNL 4JI7L 2K5NA 1SRUA 2R7ZH 1VQIA 1JB7A 3MXNB 4A3CH 1JMCA 3M85A 3K8AA 2ATWA 2B29A 1NBWA 2JA6G 1CKOA 1X65A 3I56A 1LYLA 1OXXK 5HY6A 3EIVA 1ASYA 2A1AA 1VQ5A 3T1HL 3S1QH 4JYAQ 5JEAJ 1X9NA 2VQEQ 1YHAA 1IBLQ 3CD6A 3PCOB 2JA8G 3KOJA 3HOVH 2Z6KA 4R4OA 2Q2UA 2N78A 4JI5L 4JI6Q 2UXBQ 1G6PA 3B6YA 3S14H 2WAQG 2PQAB 4BXXG 1N36Q 2RHQB 3UDFA 4JI8L 1M1KC 2Y0SG 1XNQQ 1OXVA 1Q86C 3NELA 4R4TA 5GROA 1YJ9A 2AWOA 1FL0A 2IX0A 3PUVA 1N32Q 2YTXA 4R4CA 1N34Q 1IBMQ 1HH2P 2CCZA 2NVXH 4A3LH 4DKAC 4GOPA 4GKKQ 1AE2A 1VCIA 3TS0A 2VUMG 1A63A 4L5TA 2IX1A 2JA9A 4A3IH 1K3RA 4JBJA 1LM0A 4JI4L 1Y1WH 1HNWQ 2K5HA 1CSPA 4BBSH 4JI3Q 3I4NH 5C3EG 2CKZB 5JJLA 4DR6Q 3I2ZA 1I5FA 1N33Q 3GTGH 4NPSA 3H15A 4HJ9A 4LUZA 2IY5B 2HIVA 4JBKA 4AYBE 1J6QA 3NBHB 3ERSX 1O7IA 3KDFB 4APVA 4A3BG 2HT1A 2QGQA 3L2PA 1E24A 4LF5L 4A3DH 2BA1A 4B3RL 1U0LA 4JC0A 3A5UA 4DV6Q 3HOUG 3PO3H 5AJ3L 3K0XA 1MKHA 3RLFA 4L5QA 3UE0A 1L1OB 1C9OA 1Q46A 2EIFA 3F2BA 4YCVA 4DR4L 3HOWG 2VY3A 3G4SA 3CF5A 3M4QA 3T1YL 1VQ9A 3S24A 4DUYL 5J3BA 3BJUA 3S15H 4B3TQ 1VQBA 4IPHA 5M3FH 3TREA 3ULPA 3K81C 3I4OA 4DV4Q 1A0IA 3S16H 2LXJA 1JT8A 1L1OC 1VQEA 3KYHC 1TWGH 1UE1A 1L0WA 4DV1Q 1Q82C 1IBKQ 4B3ML 5IWAQ 4LF7L 4GKJQ 1PYSB 1RL2A 4DR2Q 3CQZH 2E5LQ 3M7NA 2QEXA 3Q8DA 2GVAA 2FXQA 3ULJA 4A3EG 1YJNA 4IPGA 4A4IA 1VQJA 1WFQA 4YHHL 1H95A 2VQFL 2NZHA 4IOAA 3CW2C 5FLXc 4EQ5A 2MO1A 3I4MH 5M3MH 1Q12A 4BBRH 1N8RC 3UDGA 2E2IH 2OQ0A 1S40A 1FJGL 3WWVA 4LF4Q 2NZOA 2ZM6L 2F52A 2B63G 4X65Q 4LFCL 1HZCA 3A0JA 1YVCA 2NVYH 1SROA 2D0PA 3HKSA 4QY7A 2BA0A 4LFAL 1HZAA 1GD7A 2CWAA 2JK8A 1EOVA 4PMWA 3CXCA 1XMOL 2JA5G 1XPUA 3LGJA 4OWWB 2B3GA 4MZ9A 5C0XI 3HOZG 1UE6A 1XMQL 1Q7YC 1KIXA 1XNRL 2UXCQ 3M3YH 4X62L 3H0GH 2ASBA 1TWCH 2F4VQ 1PH5A 1WI5A 4HJ7A 2NN6G 3RZOH 4HIOA 1OXSC 3STBC 1OTCA 2UUAQ 4DR5L 1IL2A 3HOYH 4NXMQ 1EWIA 5IYCH 1QVGA 2MFIA 4DNIA 4POGA 4GN5A 3PUWA 2D0OA 4IPCA 2WP8J 3MEFA 4A3FG 2OTJA 4LW1A 1SN8A 1DGSA 5IE8A 4P73A 4AQYQ 3AQQA 4DV0L 3M9BA 2JA7G 4BY7H 2R6GA 3PUYA 1FVIA 1UE5A 4PG3A 1VQMA 2UUCL 1OXUA 2XGTA 2OWOA 3S1NH 1X3EA 4A3JH 1TWHH 4QQBX 4X6AH 1I94L 2OQKA 3CCQA 1QVFA 2Z6KC 3RNUA 3KJOA 1GO3E 5IP7H 2I5HA 4GOPB 4ALPA 4AYBG 4JI0Q 1JE5A 3OTOL 2ES2A 4UY8C 3J7A5 4TQUS 2OCEA 4YY3Q 4OX9L 3CPWA 2IT1A 4XTCS 5C0XJ 4X66Q 1GM5A 4DK6C 3J80c 5IP9H 2K75A 3F1ZA 4IO9A 1A8VA 2MO0A 3ZJYC 1VQ4A 3BZKA 3DLLA 4PZ7A 1SMXA 4JYAL 1NTGA 4LUOA 2RF4A 3EN2A 5JEAG 2VQEL 1IBLL 1PFSA 1Q8KA 3KLWA 1XPRA 1EIYB 4JI6L 4XIGS 5ELNA 4ME3A 3JC66 4DPGA 1YNXA 1VQHA 2DUDA 2KCTA 1L2FA 1N36L 1K73C 1K8GA 3CCLA 4JCVE 2ZTEA 5M5WH 1XNQL 5BR8Q 3CCUA 2R92G 3HOWH 1Q1BA 1X55A 2YU9H 2XTIA 3PUXA 5C44H 1GKHA 1N34L 1IBML 3CC7A 3FKIG 4PZ6A 3W1BA 1BBUA 4POFA 3CCEA 4A76A 5JJKA 2KHIA 4GKKL 1HZBA 4JI1Q 1KQSA 3K7UC 1GVPA 4DR1L 4DR7L 4BY1G 4IFDJ 1E7ZA 3PSIA 2PI2A 4JOIC 1EQRA 3J81i 3UDXA 4R4QA 3PIPA 1HNWL 1XPOA 3KF6A 2PI2E 4JI3L 4LFBQ 1IZ6A 1E3PA 1P8LA 2IHFA 2K5VA 5FJ8H 4C3IH 1YITA 1IXRA 4A75A 3GTPH 3A5ZB 1VQKA 3TS2A 2HIXA 4AIMA 4GN3B 1R9TH 2K50A 3HOXH 1N33L 1J5EL 1W3SA 2ALYB 4A3MG 3CCVA 3CC4A 2LSSA 2B63H 3PO2G 1CKMA 3D0FA 4HJAA 1PH7A 1PYBA 2CWPA 4IJLA 2WB1E 4YWMA 4AH6A 4A3KG 2JA5H 4A93G 1WCMH 3E9HA 4GN4B 4DV6L 1MJEA 2UUBQ 1E22A 4DV3Q 1BBWA 4NB3A 2L15A 4RMFA 4JI4Q 3ER0A 1A62A 2UU9Q 4LF9L 2UXDQ 4K0KQ 3L7ZC 1NJIC 4OONA 1BKBA 2R7ZG 5H1SE 4A3CG 4P72A 4DAYB 2AMCB 1YZ6A 1PA6A 4B3TL 2VNUD 2MQHA 4DV4L 4DV2L 1Y1VG 2H5XA 3FP9A 2KBNA 2EQSA 5IYBH 1WOCA 3KF8B 2BH8A 5IWAL 1IBKL 3H3VH 2R93H 3GO5A 4UP7A 4EX5A 2HHHQ 4KHPL 2JA7H 2DGYA 3J81c 3PUZA 1QZHA 3PF4A 1N9WA 2VL6A 1KD1C 5IYDH 5AJ3Q 2IHEA 1G291 2ZTDA 5C4JH 3FHWA 2CFMA 1G51A 3I7FA 2VZAA 4J15A 4OWXB 1PHJA 1EQQA 4Y7NH 4P75A 4LF4L 1AH9A 2D62A 4X65L 1Q81C 1VQOA 1M90C 4A3LG 2AKWB 3BU2A 5HGQA 2WAQE 1JJCB 3J80i 1VQCA 2JA6H 4NXNQ 4JV5Q 1S72A 2K14A 4DV7Q 5E7NA 1HR0Q 1I50H 1WJJA 4DUZQ 4LF7Q 1UWVA 3AFPA 4A3IG 2UXCL 4QL5A 1KHIA 1S3OA 2EXDA 4IOCA 3RLNA 4HJ8A 1Y1WG 3U4ZA 1HR0W 2E2JH 5IT9c 3H3VI 2ZTCA 4BBSG 4JBWA 2JA8H 1YI2A 1PV4A 4B3SQ 4DV5Q 1K9MC 5C4XG 4BXXH 1VQDA 4NXML 2AHOB 1OXTA 3NENA 2N3SA 3G48A 4FDBA 1CKNA 1PH3A 2YTYA 1YIJA 4HIKA 1VS0A 1HNXQ 3GTLH 2ZJRA 2CQOA 3FKIH 4AQYL 2GN5A 3U4VA 1XMOQ 4A3DG 4LF8Q 4HIDA 3S1MH 4DR3L 4X64Q 2VUMH 1HZ9A 4JI2Q 1XMQQ 1HNZQ 1KRTA 4BY1H 1K83H 4GS3A 2GVBA 4YCUA 1EUJA 4JI0L 1WYDA 3IRBA 4PZ8A 4LF6Q 1VQNA 4IFDI 2WB1G 5IY0A 5C3EH 3E9IA 4YY3L 2A8VA 3CPFA 1K0RA 2N49A 2E2HH 1X3FA 4X66L 5C0XG 2I0QA 1PH1A 3S17H 1UE7A 1X6OA 3S2DH 1X54A 3W1GA 4A3MH 1PH2A 1Z9FA 4GOPC 3SGIA 4YCWA 4DV0Q 1VQ8A 4OWTB 2N8NA 1PH6A 3OYYA 3JAMc 2UUCQ 3PF5A 1TWFH 4LWCA 4A3BH 5M5XH 3HKZE 1D7QA 2UXBL 4L5SA 5GQOA 3HOUH 3ICEA 1XJVA 4GNXA 3D31A 5LMUQ 2ZJQA 5GADC 2I5LX 3I4MG 5BR8L 5M3MG 4BBRG 5LMNQ 2E8GA 4JI7Q 3F2DA 5FLMG 4UP9A 3OTOQ 5EAYA 5DLQE 5LMNW 1N32L 4KI0A 1EIFA 1E1TA 1Q1EA 3GDEA 4OX9Q 2QA4A 2PMZE 4LNQA 1Y1VH 2YYZA 3M4PA 4JI1L 3J81j 2YTVA 3I55A 3PGZA 4BA1I 1V43A 5K36G 4IFDG 3T1HQ 1UEBA 3H0GG 4LUVA 3RLOA 2WFWA 4GLVB 4R1JA 1KAWA 1QUQA 3CMAA 1TXYA 4A3EH 3GTQH 1JJ2A 3M4OH 4JI5Q 4LFBL 2LXKA 2RHSB 1HJPA 3HOYG 4Y52H 4DR6L 4IJHA 5IYCG 1JJGA 4JI8Q 1Z47A 2Q2HA 3TQYA 3J7ZC 1VQGA 4YWKA 3K80C 4C3JH 1IYJB 4O2DA 4BY7G 1XTDA 4KHZA 4BA2I 4OO1I 2JEAI 4A3GG 1KXLA 3S1RH 3L0OA 4MTNA 1E1OA 4A3JG 5M5YH 2UUBL 1KL9A 3AEVA 3HOZH 4DV3L 4DR1Q 2VS1A 4C2MH 2K4KA 4DR7Q 4QIWE 2R7DA 5IP7G 4UPAA 3G6EA 4OXPA 1LTLA 1C7YA 2UU9L 1SLJA 4K0KL 1B8AA 2UXDL 3GTJH 4MNOA 4DK3C 2NVQH 3K7AH 3RZDH 1VQAA 3RR5A 3NEMA 2JEBI 2JJQA 5C4XH 3UDIA 3S2HH 1RIPA 1X56A 1CSQA 4HJ5A 3U50C 4WJ3M 1J5EQ 5IP9G 3G71A 1PH4A 1V9PA 1CUKA 3KJPA 4R4IA 3UE1A 2R7FA 4DV1L 3E0EA 2PQAA 1KRSA 2ID0A 4P71A 3RN5A 4A3FH 4DR2L 2HHHL 4GKJL 2E5LL 3GTOH 1VQLA 1Y14B 3AYHB 2ZJPA 2C35B 3OW2A 1MJCA 1CKNB 4JOIA 4LF5Q 3HOVG 2KHJA 4B3RQ 3CAMA 4WJ4A 1LUZA 2AWNA 1I3QH 1KC8C 1QVCA 4H02A 3PIOA 4DR4Q 1MIUA 4RG1A 4OO1G
chains in the Genus database with same CATH superfamily
4PNYA 4XYOA 1WD0A 3TEHB 3R8BA 4L6TB 2JYOA 1H9KA 4DV7L 2FINB 1QB5D 2MNAA 1O7YA 4FF2A 3DM3A 3HOWB 1TWAH 2RCNA 3DM1A 4B3SL 5ELOA 1BCPB 5GAEC 4N9PA 4FXKC 3KDFA 3CRKC 1GJXA 2I5MX 3EBEA 3X3NA 1I4XA 1X3GA 3CMEA 1HNXL 2Q2IA 4O0AA 3T53B 2LKVA 4GNXB 5A2QL 4LFCQ 5CBAE 2BH2A 3U58A 1L1OA 3RMHA 1BCPC 4XQJA 1LT4D 4KLKA 3PO3G 1S5ED 1E0BA 1WTWA 1GUGA 1HNZL 2V1CC 1VQ6A 1SE8A 4X62Q 2CVRA 4GNXC 3NE5B 3X3MA 2A5HA 3CCSA 2F0UA 4B9XA 2B63B 2V4DA 1EFID 1YJWA 2Z0SA 5LL6X 3AFQA 2KUMA 1QUQB 5IYBG 5C5MA 3PO2H 1NMFA 4GLXA 3HOZB 1EYGA 4A3GH 1JORA 2K52A 3L3OC 1EY6A 5IYDG 3J7AF 3H6MA 5CC4A 3F8TA 1LV9A 3V05A 4GLAC 4MTKA 2VXWA 3MFYA 2K5NA 1SRUA 4RCOA 1VQIA 1JB7A 1IKLA 1JMCA 3KUPA 2RBMA 2B29A 5DAUA 2JA6G 1STHA 1LYLA 3A56A 1KAAA 4FO2A 2WKCA 5JEAJ 3CRLC 2VQEQ 2BDNA 1G6PA 3J7AV 3S14H 1CZWA 2WAQG 4BXXG 2RHQB 4JI8L 1XNQQ 3OWEB 1Q86C 1YJ9A 2J7ZA 4R4CA 3I72A 4A3LH 4GOPA 4ZKCB 2ENBA 5I4DA 2JA8B 1A63A 1EY7A 1K3RA 1LM0A 4G7OC 1LT5D 2Y0SB 1CSPA 3I4NH 4U673 1I5FA 3GTGH 1RJTA 2MUYA 1EU4A 1EWCA 4CDEC 4B9WA 1VMPA 4ZCKA 4JBKA 1AEXA 4XXEA 4AYBE 4BY1B 1QNKA 3KDFB 4A3BG 3EFXD 4HMIA 3QWNA 5C3EB 1L1OB 2EIFA 3HOWG 3BDOA 2B39A 3T1YL 4ABNA 4DUYL 3PO2B 3S15H 3ULPA 5C0XH 4DV4Q 1A0IA 1TWFB 4EQOA 4JW0A 1L1OC 1VQEA 4ZK9B 5M5XB 1B53A 1UE1A 1Q82C 2CQAA 1K8MA 1ONLA 5EGTA 4NW2A 1BOSA 1PZID 4DGZA 1IBKQ 3M7NA 2AQ2B 4OL7A 3ULJA 4A3EG 1SEBD 1H95A 5KIXA 4FVMA 4IOAA 3CW2C 1LTBD 1F9PA 2EY6A 1D5MC 2OQ0A 2B63G 2ZM6L 5J22A 4X65Q 2Z8LA 3PIO3 3D6WA 3HKSA 1CFMA 4HSVA 2BA0A 4LFAL 1GUWA 4MZ9A 3HOZG 4H13C 2ASBA 4KKSA 1RCVD 4XQNA 2JP1A 5I6YA 5HGTA 4K2KA 1SSOA 1I4PA 2KEDA 3HOYH 1JOOA 2H1EA 5IYCH 1QVGA 4RHRA 2D0OA 1D1IA 2WP8J 2OTJA 3I3CA 4LW1A 3OWFA 3PMFA 4C2MB 3AQQA 1I4GA 2R6GA 1UE5A 3S1NH 5EJWA 2Z9HA 1X3EA 3GTJB 4J8QA 1UUPA 1NSNS 2OQKA 3MXUA 4GOPB 2KECA 4ALPA 3GTGB 3S9WA 3DWPA 4HCSA 4UY8C 4K6DA 4TQUS 2OCEA 3CPWA 2IT1A 5LHY1 4X66Q 1Q3LA 3Q22A 4DK6C 5IP9H 1BDOA 3BZKA 1G2TA 3WOEA 1SMXA 2N55A 2B8FA 1BQQT 2RF4A 4G7ZC 3KBGA 2C9OA 5BN3A 1DJRD 4JI6L 5FO9B 4XIGS 2IW3A 3JC66 2F0VA 2F3WA 4O42A 1ILQA 1N36L 3CCLA 1STBA 2ZTEA 1CA5A 1ZYRC 2K05A 1TS3A 3KLSA 5C3WA 2YU9H 1CZGA 5C44H 1S5CD 4N9TA 5I9OA 5AFWA 4CJ0B 3NSWA 5L37A 5J39A 2X6LA 1ZEQX 4JI1Q 3K7UC 4DR7L 4BY1G 2K32A 3PSIA 1QILA 4KN4C 4E6IA 3J81i 4R4QA 3PIPA 1HNWL 2P5ZX 3KF6A 2R92B 4JI3L 1E3PA 4RGTA 5FJ8H 3NK9A 4NMZA 3MA2B 1JR0D 2QILA 1N33L 1VF7A 1D1KA 1MGSA 1W3SA 2ALYB 3PO2G 4QMGA 4EGVA 3VA5A 1QE6A 1PH7A 1PYBA 4KD3A 2JA5H 1PTOH 4DV6L 3GP7A 3HEJA 5KNBA 3QJYA 2PZUA 3LWEA 3ER0A 4C3HB 2UU9Q 3BVMA 2NN6H 4OONA 5H1SE 3J81E 4KY5A 4P72A 2EYMA 1YZ6A 1HTPA 1CQFA 3S1NB 1LTID 4DV2L 1PYWD 4A93B 1WOCA 3J81c 1QZHA 4UDUC 2VL6A 2NYZD 1NAPA 1LTAD 3VR4A 1CK1A 4OWXB 5K5PA 1EQQA 4LF4L 1AH9A 5IT9E 1QOHA 2Q8RE 4A3LG 2AKWB 3BU2A 1W6JA 5HGQA 3HOVB 4JV5Q 1HQMC 1S72A 1HR0Q 1WJJA 4NDXA 2EY2A 4HJ8A 5IT9c 3TMEA 4QUFA 3N6RA 4K5XA 1NR4A 3DEOA 5C44B 1YI2A 3KBXA 4DV5Q 3ONAB 3T16A 1VQDA 2EYHA 2AHOB 1GUSA 2N3SA 3GTLH 3FKIH 4A3IB 3U4VA 5D3DA 3SHLA 3S1MH 2VUMH 4JI2Q 2OEOA 2EJGC 1PFNA 2PYKA 3ND8A 3QG1A 3SR1A 2GVBA 3BZDB 2KQ3A 4JI0L 4LF6Q 2Z6BA 4YY3L 2E2HH 5C0XG 3OMGA 2WKDA 3SGIA 4GZYC 3OYYA 3C2PA 2F0WA 3HKZE 1D7QA 3QO2A 4L5SA 3DEPA 1HPCA 5GQOA 3HOUH 2UXBL 1Q90A 2XIWA 2WB1B 3D31A 4LJZC 5LMUQ 2ZJQA 1SYBA 2Z1CA 2JSOA 3L9AX 5BR8L 5LMNQ 2SNSA 2KCCA 3BVGA 3S16B 1N32L 4KI0A 4G4KA 3M4PA 2YTVA 3I55A 4BA1I 4DXGA 3T1HQ 4WFN3 3MEHA 3MHBA 1YNNC 1JJ2A 2FHTA 4JI5Q 1G91A 2F0OA 3AMUA 3HOYG 2SDFA 5IYCG 3TQYA 3TP7A 2DNEA 2XWJB 5CBEE 4CJ1B 4YWKA 3LX0A 4BA2I 3H0GB 5E4XA 2F4IA 1TWCB 2E74C 2EY5A 5M5YH 3RZOB 2PW7A 4DR7Q 4QIWE 4KJOA 4UPAA 1C7YA 4OXPA 1PFBA 1WTQA 3RZDH 2ICIA 4KKUA 3NEMA 2JEBI 5C4XH 3PIP3 3S2HH 1TS4A 3TP6A 5IP9G 1WTOA 1CUKA 4K5VA 3KJPA 1JE4A 4QF4A 4R4IA 4F7XA 2R7FA 4NKLA 4A3JB 3K5MA 4DV1L 2VUMB 1EL0A 1VMCA 2PQAA 4P71A 2E76C 2E5LL 2BE5D 2C35B 3HOVG 1B9MA 4JOIA 3CAMA 5F2DA 2AWNA 1I3QH 1LT3D 4XYQA 1MIUA 2J0TD 3STBD 5C44G 1W2BA 4X3KA 1E2WA 1SR3A 4RGMA 4P74A 2NN6I 2A69D 4FF3A 4DV2Q 3VDYA 4U68A 3VA7A 2RSNA 1VQ7A 1EYAA 4K14A 4DUZL 1GUNA 4B3MQ 1YBYA 2I07B 2EY1A 5D3IB 1B70B 3JAMi 2B2YA 2F4VL 1NY4A 5FJ8G 2K28A 1H9SA 1SYGA 3CP0A 3PV0A 1PZJD 1NE3A 3NBHA 4HIMA 3RD4A 5FLMH 2NVTH 1FJGQ 4QGUA 2Q2TA 5KRUA 1TQOA 1AE3A 4LF8L 1DOKA 4K6LA 5JVH3 2BDOA 3A8KE 3MZ5A 4TSSA 1I6HH 1NMGA 1ET9A 2A6HC 3GTPB 3RN2A 3CC2A 2L11A 4EQPA 3KFUA 2LMCB 2A19A 1FGUA 4YWLA 5JJIA 1EU3A 4LK1C 2OTLA 1O78A 3CCRA 1SFOH 1F2YA 5ELBA 1SNCA 3HP3A 3ITPA 4KJNA 4CDFC 1ASZA 3DWQA 1SXTA 2PNHA 1F9SA 2BOSA 3D4RA 3A8JE 4UP8A 4QCLA 1J8IA 4PV1C 2F0SA 4QJFA 3GTKH 2PZWA 3NUCA 3V96A 5DM73 2HQEA 2R7ZH 1KLGD 1FNVA 2JA7B 1JWMD 3A54A 3I56A 1PRTF 2O5JC 5HY6A 2NTSA 1VDZA 1PRTD 3JAML 4JYAQ 3S1QH 5C4JB 3D8GA 1KNAA 1YHAA 3CD6A 3PCOB 1EYDA 4HTHA 2UXBQ 5JPNC 2PQAB 2SNMA 3HG9A 4ID6A 4R4TA 5GROA 3S1MB 1N32Q 2YTXA 2G5DA 2CCZA 2F0MA 2NVXH 1R4QB 1VCIA 3K57A 2VUMG 3SK6A 1EY8A 4IQZA 2IX1A 2JA9A 4JBJA 2XWBB 4JI4L 1T5XD 2K5HA 3GV6A 4BBSH 3CKIB 5IOCA 1JB3A 5JJLA 1XTCD 4CBVA 1JICA 1EOTA 1I6HB 1H9SB 2EJFC 2IY5B 2HIVA 3NBHB 1O7IA 4J1MA 4MHEA 4A3DH 3L2PA 4B3RL 1U0LA 3HOUG 2E75C 1FGBD 1MKHA 3H09A 3RLFA 4L5QA 2KEEA 3UE0A 3F2BA 2K03A 4JVZA 5IIFA 2EJMA 2VY3A 3S2DB 3M4QA 2HDLA 3S24A 2IJ0A 1F9RA 3BJUA 3G6JB 4B3TQ 5M3FH 3K81C 3HRZC 4A3BB 1JT8A 3KYHC 3FRPB 1L0WA 4DV1Q 5IWAQ 4M8AA 1RL2A 1CHPD 2E5LQ 4DK1A 3Q8DA 2GVAA 4YHHL 2VB3X 2VQFL 1D2BA 3BG3A 5FO7B 2OT2A 5M3MH 1N8RC 1Y1VB 2E2IH 1S40A 1KTKA 2B2WA 4RWSC 1HZCA 3I70A 2QDLA 5IGBA 5KYLA 4FXGC 1GUOA 1HZAA 2CWAA 2B2VA 2L55A 4PMWA 2O4XA 3LGJA 2B3GA 4A3EB 3BDCA 4CDCC 3GTQB 1Q7YC 1KIXA 1XNRL 2UXCQ 4IFDH 5D14A 5M9OA 2F4VQ 2A6EC 3KF8A 1OXSC 3TZDA 1ICWA 4DR5L 3S1RB 2MFIA 2EVBA 3PUWA 3MEFA 4BY7H 1DGSA 2JA7G 4DV0L 4OELB 3M9BA 1YNJC 4PG3A 1FVIA 1TWHH 1TU2B 3EVQA 3FMCA 2NVQB 5FO8B 1I94L 1TS5A 2CH4W 3D4WA 1T5EA 1GO3E 5KYIA 1IYUA 3KLRA 2MGSA 4AYBG 3J7A5 4TRDA 4XTCS 3SDZA 2K75A 2MO0A 2K33A 5KGUA 4PZ7A 1IBLL 3KLWA 2Z4HA 1XPRA 1EIYB 2XRQD 4DU9A 4ME3A 1O7LA 1R4PB 1VQHA 3NWSA 4JCVE 1C8CA 4OO1H 2M2LA 4V0BA 4H7BA 1N34L 1IBML 3CC7A 1SNMA 3MC0B 3KLSX 4HR7B 4PZ6A 1BBUA 2DN8A 3W1BA 3CCEA 4GKKL 1TWAB 1GVPA 3T13A 3HGBA 2F0DA 3UDXA 2E2IB 2PI2E 1BR9A 3BS1A 2IHFA 2K5VA 4C3IH 1VQKA 2B8GA 2HIXA 1TT2A 2X69A 2NZ1D 4AIMA 1R9TH 2K50A 3HOXH 1L0YB 1EQTA 2IWHA 2RDGA 3CCVA 1CKMA 4HJAA 4YWMA 2NWGA 1WCMH 1XWEA 4GN4B 1K8OA 3BVZA 4DV3Q 2ZXOA 3NP8A 1BBWA 2F1MA 4JI4Q 2UXDQ 4XDXA 4K0KQ 4ZYSA 2R7ZG 1AZQA 2XNAC 1PA6A 5I9PA 2VNUD 1SBBB 2B2WC 2MQHA 4A3GB 1STEA 1BCPF 1Y1VG 4XT3B 2R93H 3KF8B 1MSGA 2BH8A 2B2VC 3GO5A 1BCPD 3TSSA 2G9HD 2LFNA 4KK7A 5CV8A 2D5DA 3PUZA 1AZPA 1PXUA 2IHEA 3FHWA 2CFMA 3I7FA 1D6EC 1PHJA 4Y7NH 1G2SA 4P75A 2D62A 3VYUA 1VQOA 2WAQE 1JJCB 3IFDA 4ZUIA 3NHHA 1PLFA 1V1OA 4DV7Q 1I50H 4CKCA 3S14B 1UWVA 3AFPA 1A3VA 2EXDA 4QL5A 4IOCA 3H3VI 3U4ZA 2E2JH 4BBSG 4JBWA 2EYOA 5CMDA 2KJXA 1G6ZA 4B3SQ 1ILPA 4NXML 5EKLA 1OXTA 3NENA 2R3ZA 3G48A 1CKNA 2I46A 2YTYA 1HNXQ 4DNRB 3OW7A 2CQOA 1LACA 4AQYL 1U4RA 1V1PA 4CKEA 4A3DG 3D6CA 4O1NA 5CV4A 1LTRD 3I4NB 1HZ9A 1HNZQ 1K83H 5EBCA 4PMBA 1R9TB 1A3TA 1FYCA 1NNXA 3H94A 4K5WA 1WYDA 2F0LA 4IFDI 3FEWX 5IY0A 1RTNA 3E9IA 1K0RA 1X3FA 1UE7A 5ELDA 2F0JA 1X54A 3OIPA 4RHSA 2LS01 4A3MH 4GOPC 2AQ3B 4DV0Q 1VQ8A 2N8NA 1PH6A 1B9NA 4ILWA 2NTTA 4X3TA 1DM0B 5G3LF 4R8NA 3S15B 2I5LX 5FOBB 4DN4M 5M3MG 4UP9A 5FK9C 2QA4A 4IUVA 4IALA 2PMZE 4LNQA 4ZQ3A 2YYZA 2RSOA 3J81j 1V43A 4IFDG 1UEBA 3SK4A 2L9HA 1X3QA 3HS0C 4LUVA 4R1JA 3FVQA 4LFBL 2M9VA 4IUPA 5CV6A 3M4OH 1CHQD 2RHSB 4DR6L 2NBFA 1JJGA 4JI8Q 1Z47A 2L1BA 4KY7A 4BY7G 1BO0A 4OO1I 4A3GG 1KXLA 2EPBA 1CA6A 3LNNA 4MTNA 1I4RA 1LTTD 2UUBL 1KL9A 4XQQA 3MXNA 3SK5A 2F0IA 4H0LC 3HOYB 5EQ0A 1RHPA 5J1ZA 3K7AH 1X56A 1CSQA 5NUCA 4HJ5A 3U50C 1PH4A 1V9PA 3RN5A 2HHHL 4GKJL 3VYRA 4CJ2C 1S5FD 4DR2L 5C5LA 3GTOH 1VQLA 4DNTB 1Y14B 2ZJPA 1CKNB 4I7AA 5E3FA 4WJ4A 1LUZA 2F0KA 1QVCA 1V1PB 4OO1G 2QDBA 3SEBA 4C56C 3T1YQ 4KHVA 4DUYQ 3HKZG 2K5QA 1T9HA 1PVOA 1C0AA 3CCMA 4NXNL 3MXPA 3OIQA 3A7LA 3K59A 2KENA 3F2CA 2Y0SE 1P16A 3J81L 5JEAH 1C4QA 1EFWA 1DZ1A 3I4NG 4C3IG 2YU9B 1ET6A 2UUAL 5KEEA 5GAGC 1PH8A 5A35A 4KN7C 1K8AC 3HOXG 2J4XA 2JQOA 1A6XA 3BYTB 2RVLA 1SE4A 2ZM6Q 2QEJC 1LTGD 1SMYC 1WTRA 4LFAQ 4KTAA 1WCMG 4X64L 2BE5C 1SJED 5CORA 3T51B 3GTMH 5IT9L 2K7VA 3VR5A 2B2TA 4L5RC 1QJOA 1NCVA 5JAVA 3I73A 1ZYRD 2K04A 3HFZB 4K8IA 1EEID 2JA5B 2EDGA 3A74A 1SNOA 3KF6B 1PTOB 2R93G 3ULLA 1PH9A 1M4VA 1YHBA 4RCNA 2EYPA 3E5SA 3GD7A 4A3KH 3OHXC 3AB9A 1B44D 1KLUD 2A74C 1S4ZA 1PTOC 1CI3M 1SYDA 3T56B 1BVSA 4JI7L 1XYIA 3MVVA 3MXNB 4A3CH 2KVMA 4IURA 1NUCA 3K8AA 3RUZA 3M85A 2ATWA 4UAIA 4CGYB 1HTLD 3K58A 1OXXK 3EIVA 3Q23A 1RDPD 1F9QA 1X9NA 3KOJA 4R4OA 2Q2UA 4JI6Q 2N78A 3B6YA 2JXMB 1PFMA 3SK8A 1N36Q 1U4PA 3UDFA 3BDLA 1M1KC 2AWOA 2IX0A 3PUVA 3I4LA 2K5WA 1I4HA 1AW7A 1AE2A 1HCZA 4F8MA 4PMCA 3I91A 4FF1A 1LO5D 4L5TA 3LWUA 4DA2A 4IZ8A 4MIUA 2EOTA 1Y1WH 2K1BA 1HNWQ 4ME5A 3EA6A 4DAVA 4JI3Q 5C4ZA 4RFBA 3GTLB 3FKIB 4DR6Q 2B2UA 1N33Q 2KOLA 3H15A 4HJ9A 1DOMA 1FR3A 1BXTA 4XT1B 2WIIB 1HQRD 2PW5A 2WV6D 4KY6A 4APVA 2HT1A 4LF5L 2BA1A 4OIKA 4DV6Q 3PO3H 3QOJA 2D9UA 2AQ1B 1LT6D 2E2HB 1C9OA 4DR4L 1QG7A 4YCVA 5ISRA 3ND9A 3CF5A 1VQ9A 3DHQA 3EQLC 1EZ8A 1II3A 5J3BA 2A68C 3NQTA 4A3KB 1JWUD 3VYSA 2LXJA 5FLXE 1TWGH 3HOUB 4GKJQ 1PYSB 1SYCA 1TY0A 4DR2Q 3CQZH 2QEXA 1AFPA 2FXQA 1YJNA 4IPGA 2B2TC 3QOLA 4A4IA 2CH4A 4FP5D 2NZHA 2KHSA 4FNFA 1JCKB 5FLXc 4FXDA 4BBRH 3WWVA 4LF4Q 3OMCA 4S3SA 3SVMA 3P1HA 3ERQA 4LFCL 1YVCA 2NVYH 2D0PA 3WOFA 4IN3A 2JK8A 1GD7A 2JA5G 1AN8A 5C4HA 3CXCA 1XPUA 4WORA 3SXHA 3C1FA 1UE6A 1XMQL 5K36H 3K0YA 3M3YH 4X62L 2SEBD 1TKWB 2RQXA 2AUKA 4HJ7A 5EBDA 2NN6G 4HIOA 1B3QA 4HCEA 2UUAQ 1CQVA 1EWIA 3D4DA 4POGA 4GN5A 5M5YB 5JPMC 1I6VC 2ZXRA 3WDNA 5IGCA 3PUYA 2UUCL 1VQMA 1OXUA 2XGTA 3MXGA 4QQBX 3K6OA 5ELEA 3J80E 3RZDB 3CCQA 1QVFA 3S2HB 3RNUA 5C4XB 5C6AA 1SYEA 2I5HA 3I8ZA 5DNFA 4JI0Q 5COYA 3OTOL 2ES2A 1WTHA 4YY3Q 4OX9L 4HAEA 5C0XJ 1GM5A 3J80c 1F2ZA 1A8VA 5EKKA 1VQ4A 3DLLA 1JOQA 1NTGA 4LUOA 3EN2A 1I3QB 5JEAG 3Q0AA 2VQEL 1PZKD 1PFSA 1Y69U 5ELNA 3R93A 4AYBB 1HA6A 1WTXA 2X6GA 1K8GA 4K2LA 2MJ8A 1XNQL 5BR8Q 3CCUA 3HOWH 4C1NI 1X55A 4QB4A 2B2UC 1Y8OB 2XTIA 1GKHA 4RGOS 3FKIG 3CQZB 5JJKA 2KHIA 2EYFA 1HZBA 1KQSA 2CW0D 5E4WC 4RKBA 4V190 3NTKA 2HCCA 1E7ZA 5ELFA 4JOIC 1EQRA 1IHZA 1D5ZC 2RA4A 1EWHA 1XPOA 4Q5VA 4F88A 2NVTB 1IZ6A 1P8LA 1YITA 4BS9A 5DM63 2ICEC 1IXRA 3QB3A 3A5ZB 3TS2A 2RKSA 3KK7A 4GN3B 2B63H 2LSSA 4P2CB 4DXFA 2CWPA 4IJLA 2WB1E 4A3KG 1EEFD 1EY4A 2MP1A 1MJEA 1E22A 2H4OA 2B2YC 2PQEA 4PQXA 1A62A 2SOBA 3VR2A 4A3CG 5KNCA 1STAA 2AMCB 1C48A 1SFOB 3C3LA 4DV4L 3TBIB 3FP9A 1JC7A 1STNA 3O13A 1IBKL 3H3VH 3CU7A 4KHPL 3GTKB 2DGYA 3PF4A 1N9WA 5A2QE 1KD1C 1VF5C 2R7ZB 4N8FA 5C3XA 1B1ZA 1FNWA 3PQIA 3R3OA 1G51A 4J15A 2VZAA 4K8JA 1STGA 4X65L 1Q81C 1M90C 1STYA 3S1QB 1HUNA 3D3RA 3GV3A 3K5LA 5CR3A 4G7HC 2ZXPA 2HD3A 4DUZQ 2DY7A 3DUZA 2PO4A 1Y1WG 1HR0W 2L0CA 1GHJA 5DEHA 2JA8H 3FPPA 4B08A 2F0GA 2FMCA 1GHKA 4DK0A 1K9MC 5C4XG 1RTOA 3IFTA 4ZAIA 2TMPA 1O7ZA 4EVOA 2NVXB 1L0XB 3C46A 2WACA 2XN9C 5T1IA 1PH3A 3NWTA 1YIJA 4HIKA 2ZJRA 2F0PA 4LMQD 2GN5A 1CT1D 4LF8Q 4BBSB 4DR3L 3Q24A 2PMZB 1XMQQ 1KRTA 4BY1H 1IW7D 4GS3A 2PPBC 1EUJA 1SNPA 1EY5A 3IRBA 1VQNA 5C3EH 2A8VA 3MAQA 3CPFA 4X66L 2I0QA 1PH1A 3DMUA 3R2TA 4A3DB 4EQNA 1DOLA 2K01A 1EIHA 1Z9FA 4F87A 4OWTB 2XSCA 2UUCQ 3PF5A 1TWFH 4ODGA 5M5XH 1DD2A 3U9SA 1XJVA 1SDFA 5M3FB 1WTVA 4BBRG 5FLMG 3OTOQ 5LMNW 1EIFA 1E1TA 3GDEA 4OX9Q 1GOZA 1BBXC 2QKIC 2K5DA 3J7YW 3R2IA 4JI1L 5K36G 1ESFA 1AP0A 3H3VC 5M3MB 4GLVB 2WFWA 2DJGC 2MHVA 1KAWA 3CMAA 1SJHD 4IJHA 5EPJA 3OSOA 3J7ZC 1B2TA 1VQGA 1U9RA 1TIID 2RDFA 3K80C 4C3JH 1IYJB 5EKIA 4KHZA 3VYTA 3T4AC 3M4YA 4Z9CB 2IL8A 3K5NA 1BNZA 4IUTA 3H91A 4IUUA 2VS1A 4C2MH 2R7DA 1MSHA 3G6EA 1LTLA 2UU9L 1SLJA 1E2ZA 1B8AA 4FYDA 3GTJH 4MNOA 1NR2A 4G57A 1IYVA 1VQAA 2JJQA 3UDIA 4BY7B 3QR8A 2NB0A 2EYLA 3G71A 3UE1A 1TWHB 3E0EA 2ID0A 4A3FH 4L8JA 3AYHB 3A55A 1ICFB 4B3RQ 1MJCA 1JWSD 3M7GA 1GUTA 4KD4A 2DJFC 1X3PA 1D5XC 1SYFA 3OOCA 1HHVA 1KC8C 4H02A 4M1UB 1FNUA 2A6ED 1ENAA 3I90A 4Q0FA 1RKNA 1LTSD 1B7YB 1VQPA 1Q8IA 1QNUA 4ZRZA 3VR3A 4TVAB 4JV5L 4DFAA 1HR0L 3CCJA 3NPPA 4KHPQ 1YNJD 1WD1A 4DAMA 1D8LA 1YEZA 1HFGA 5D65A 4YHHQ 4DV5L 2VQFQ 2JE6I 3UI2A 2IX3A 1LABA 3HKZB 3ZYYX 1B3AA 2R92H 3TRZA 2KCMA 3W2DA 5I2XA 2O2LD 3P20A 4X3SA 1TS2A 3QIAA 2L4NA 2OF1A 3BZCA 2VW9A 1YHQA 1V1QA 4JI2L 3SE0A 4C3IB 2HQLA 4CKBA 1TVXA 1XNRQ 3W5OA 2CHBD 3HOXB 4IPDA 1ENCA 4LF6L 4C1NK 4C3JB 1BUVT 2F3IA 5GAHC 1A2UA 4JBMA 5M3FG 4DR5Q 4C3HH 4OHJA 1HXYD 1WCMB 4ZLTF 1U5KA 3BYYB 2EE1A 1VQFA 2YV5A 4H44C 4JG2A 1DONA 4A93H 4DR3Q 3TZUA 5LMUL 1QZGA 1I94Q 3A8IE 2EZVA 4OEMB 5LMNL 1CM9A 3DXJC 5G3LD 3NBIA 4QIWB 1Z7TA 2R93B 1B4OA 2HDMA 4A3FB 4L63B 3FPUB 1NBWA 4KV6A 1CKOA 1X65A 5I2YA 1ASYA 2JN4A 2A1AA 2Z4IA 2EYJA 2PCFB 5EPKA 1VQ5A 3T1HL 1MI2A 3TDQA 1J9OA 2N88A 1IBLQ 2JA8G 3HOVH 4Y7NB 1MD2D 2Z6KA 4JI5L 4I7ZC 1BF4A 1XX8A 4RH6A 3V2TA 4JPBW 2Y0SG 1OXVA 3NELA 1FL0A 2O5IC 1I50B 1N34Q 1IBMQ 1HH2P 4DKAC 2E2JB 4GKKQ 3TS0A 5JVG3 4KKTA 1EZ6A 3MWYW 4WJWA 4A3IH 2QW7A 5C3EG 2CKZB 4J6HA 5CV7A 1EYCA 3I2ZA 5HURA 1W6KA 1KDBA 4NPSA 1JOKA 3IKJA 1KDAA 4LUZA 4X3UA 1I4QA 1K83B 1J6QA 2DY8A 3ERSX 4ULLA 2QGQA 1E24A 2DNCA 4JC0A 3A5UA 5AJ3L 3K0XA 2D2CC 1Q46A 3FDTA 3NXWA 3G4SA 4A3MB 1SNQA 1EY0A 1VQBA 4OGQC 4IPHA 3TREA 1TY2A 3I4OA 2HCIA 3S16H 4B3ML 4LF7L 5IGEA 4RKLA 2PNRC 1IL8A 1KDCA 2QCPX 1VQJA 1WFQA 5BN4A 1UNSA 1PDQA 2FMMA 2VB2X 4EQ5A 2MO1A 3I4MH 1Q12A 2F0TA 3UDGA 1FJGL 1GXDC 4C3JG 2NZOA 4RGNA 2F52A 3A0JA 1SROA 1V8QA 4QY7A 1QCBD 1XMOL 1EOVA 4OWWB 5C0XI 3M4OB 3IL8A 1SAPA 5CV5A 4DAYA 2GA4B 3H0GH 3HZXA 3E6ZX 1WVLA 1HRJA 1TWCH 5CYUA 1PH5A 1WI5A 3RZOH 3STBC 1OTCA 1IL2A 4NXMQ 1QWYA 1TR5A 4QUCA 2A69C 4DNIA 1F2LA 4IPCA 4UHVA 4A3FG 1SNDA 1SN8A 1O80A 2F0QA 4P73A 5IE8A 4AQYQ 2E2DC 2OWOA 4X6AH 4A3JH 3G7LA 3K7AB 1DXMA 1HUMA 2Z6KC 3KJOA 2FJ2A 5JOBA 5IP7H 2AUJD 1JE5A 1JQYD 2FFKB 1H9MA 3GTOB 3F1ZA 3MTSA 4IO9A 3ZJYC 4JYAL 1UAPA 3TP8A 4R8IA 1B50A 1H9RA 3MFGA 1Q8KA 1MHWC 4FF4A 2MPMA 3U9OA 4DPGA 1YNXA 2DUDA 2KCTA 1L2FA 1K73C 1A2TA 4N8X1 4I65A 2LY7A 5M5WH 2R92G 1Q1BA 2F03A 3PUXA 2K6AA 2F3VA 4DF7A 4POFA 3EROA 3N52A 4A76A 3VR6A 2G9DA 1UEAB 2ZT9C 3DWAA 4DR1L 1IKMA 4IFDJ 2PI2A 3I4MB 4YIJA 3NQIA 4IUNA 4LFBQ 3NTHA 2KA7A 1FD7D 1PRTB 4A75A 3GTPH 4ZKBB 2Q8TA 4C3HG 5T1GA 1J5EL 4A3MG 3CC4A 3D0FA 3GTMB 1PRTC 3W3AA 4AH6A 4A93G 1F77A 3E9HA 1E2VA 2UUBQ 4OIJA 3Q6SA 1Y8PB 2F0HA 2RCFA 5I6WA 1A3UA 4LAAA 4NB3A 5IODA 2L15A 4RMFA 4LF9L 1K0SA 2IPKD 3L7ZC 1NJIC 1BKBA 2OXPA 5LL6S 4HN7A 4DAYB 4B3TL 4NP5A 4ZUJA 1ML0D 1KABA 3URYA 3P7JA 2H5XA 2KBNA 5IGFA 3P75A 2EQSA 2L12A 1SMYD 5IYBH 5IWAL 2CW0C 2HHHQ 4UP7A 4EX5A 2JA7H 2M00A 5JJZA 4CDDC 3A7AB 5IGGA 2Q8IB 5CGKA 1KNEA 5ELCA 5IYDH 1F2MA 2L5TA 2XRSD 3K5OA 5AJ3Q 1G291 2ZTDA 5C4JH 1PMRA 1HA5A 3C1EA 1ESRA 1OO9B 3NTIA 1M8AA 3J80i 1VQCA 2JA6H 4NXNQ 1RODA 3TP5A 4RAUC 2K14A 5E7NA 4LF7Q 2UXCL 4A3IG 1KHIA 1S3OA 1WTPA 5M5WB 3RLNA 1PTOF 1S5BD 4MN3A 2ZTCA 1PTOD 1PV4A 4BWGB 2C5CA 5IGDA 5FLXL 4BXXH 1RD9D 1ZXTA 2A73B 4WRDA 2HUGA 2QF7A 5BN5A 4FDBA 1VS0A 5EPLA 2EXZA 3E3XA 1XMOQ 1S5DD 1Z6HA 1Y1WB 4HIDA 1XXGA 4JK1C 5TSSA 4X64Q 5FKAC 1EY9A 1YNND 4YCUA 4PZ8A 3JAME 2WB1G 1HFNA 2N49A 3S17H 1X6OA 3S2DH 4R9WA 3W1GA 3E0JA 1PH2A 3PO3B 1U4MA 2RDHA 1DCZA 2PZTA 4YCWA 1DYQA 3JAMc 3EJIA 4LWCA 4A3BH 1SE2A 3OPOA 2F0EA 3ICEA 4GNXA 5GADC 1CTMA 3I4MG 1K28A 4JI7Q 2E8GA 3F2DA 5EAYA 5DLQE 1TWGB 1Q1EA 4DAPA 3J80L 1EIGA 1K3BC 1SE3A 2F0FA 1Y1VH 2R61A 5CV9A 3PGZA 1A15A 3H0GG 1IW7C 3AU7A 3RLOA 1X32A 4BBRB 1QUQA 4A3EH 1TXYA 2KCNA 3GTQH 4HSPA 4IUQA 2LXKA 3TN2A 1HJPA 1U4LA 4Y52H 2NVYB 2XVSA 2Q2HA 1EQVA 2JA6B 1LLRD 2TSSA 1MBYA 2A68D 3GQBA 4O2DA 1XTDA 1Y8NB 2JEAI 3M3YB 3S1RH 4TKOB 3L0OA 2NUCA 1E1OA 4KMUC 4A3JG 1ENFA 3AEVA 3HOZH 4DV3L 5E1FA 2WAQB 4DR1Q 2K4KA 5IP7G 2F0NA 2UXDL 4K0KL 1G8ZD 4RA8A 4DK3C 2NVQH 1H9JA 1ZKOA 3RR5A 3IAYA 1RIPA 4CHTB 4WJ3M 1J5EQ 4HMJA 5KNDA 2BCOA 1KRSA 2WINB 3CHBD 4HEDA 1RF2D 3OW2A 4LF5Q 3F2UA 2A6HD 2KHJA 3S17B 3PIOA 4LF9Q 4DR4Q 4RG1A
chains in the Genus database with same CATH topology
3STBD 5C44G 3T1YQ 1W2BA 4DUYQ 1SR3A 1B7YB 3HKZG 1VQPA 1T9HA 1PVOA 4P74A 3TEHB 2NN6I 1C0AA 3CCMA 4DV2Q 4NXNL 3VDYA 4TVAB 1VQ7A 4JV5L 2KENA 3F2CA 4DV7L 1HR0L 4DUZL 2Y0SE 3CCJA 4B3MQ 1YBYA 4KHPQ 1P16A 4DAMA 1B70B 1D8LA 2MNAA 3JAMi 3DM3A 1YEZA 1EFWA 1TWAH 2F4VL 1NY4A 5FJ8G 2RCNA 3I4NG 4YHHQ 4B3SL 4DV5L 5ELOA 5GAEC 3CP0A 2VQFQ 3PV0A 1NE3A 2JE6I 2UUAL 1PH8A 5GAGC 1K8AC 3HOXG 3KDFA 2JQOA 5FLMH 4HIMA 2R92H 3TRZA 2I5MX 3EBEA 1FJGQ 2KCMA 2NVTH 4QGUA 1X3GA 3CMEA 1HNXL 2Q2IA 4O0AA 2ZM6Q 4GNXB 2Q2TA 4LFCQ 2BH2A 3U58A 1L1OA 4LFAQ 3BZCA 1AE3A 2VW9A 4LF8L 1YHQA 1V1QA 1WCMG 4KLKA 4X64L 4JI2L 3PO3G 1I6HH 1NMGA 1VQ6A 1HNZL 2HQLA 2V1CC 3GTMH 1SE8A 1XNRQ 3RN2A 4X62Q 3W5OA 3CC2A 4GNXC 4L5RC 4IPDA 4LF6L 3CCSA 3KFUA 2F3IA 5GAHC 4JBMA 4LF9Q 2A19A 3HFZB 5M3FG 1FGUA 2Z0SA 4YWLA 4DR5Q 1YJWA 4C3HH 5JJIA 3AFQA 3A74A 1QUQB 3KF6B 5IYBG 2OTLA 2R93G 3ULLA 3PO2H 1NMFA 4GLXA 3CCRA 1U5KA 1SFOH 1PH9A 1ASZA 1EYGA 4A3GH 1YHBA 4JG2A 1VQFA 2K52A 2YV5A 4A3KH 3GD7A 4A93H 2PNHA 5IYDG 4UP8A 4DR3Q 5LMUL 3F8TA 1QZGA 1I94Q 4GLAC 4QJFA 3GTKH 1BVSA 5LMNL 4JI7L 2K5NA 1SRUA 2R7ZH 1VQIA 1JB7A 3MXNB 4A3CH 1JMCA 3M85A 3K8AA 2ATWA 2B29A 1NBWA 2JA6G 1CKOA 1X65A 3I56A 1LYLA 1OXXK 5HY6A 3EIVA 1ASYA 2A1AA 1VQ5A 3T1HL 3S1QH 4JYAQ 5JEAJ 1X9NA 2VQEQ 1YHAA 1IBLQ 3CD6A 3PCOB 2JA8G 3KOJA 3HOVH 2Z6KA 4R4OA 2Q2UA 2N78A 4JI5L 4JI6Q 2UXBQ 1G6PA 3B6YA 3S14H 2WAQG 2PQAB 4BXXG 1N36Q 2RHQB 3UDFA 4JI8L 1M1KC 2Y0SG 1XNQQ 1OXVA 1Q86C 3NELA 4R4TA 5GROA 1YJ9A 2AWOA 1FL0A 2IX0A 3PUVA 1N32Q 2YTXA 4R4CA 1N34Q 1IBMQ 1HH2P 2CCZA 2NVXH 4A3LH 4DKAC 4GOPA 4GKKQ 1AE2A 1VCIA 3TS0A 2VUMG 1A63A 4L5TA 2IX1A 2JA9A 4A3IH 1K3RA 4JBJA 1LM0A 4JI4L 1Y1WH 1HNWQ 2K5HA 1CSPA 4BBSH 4JI3Q 3I4NH 5C3EG 2CKZB 5JJLA 4DR6Q 3I2ZA 1I5FA 1N33Q 3GTGH 4NPSA 3H15A 4HJ9A 4LUZA 2IY5B 2HIVA 4JBKA 4AYBE 1J6QA 3NBHB 3ERSX 1O7IA 3KDFB 4APVA 4A3BG 2HT1A 2QGQA 3L2PA 1E24A 4LF5L 4A3DH 2BA1A 4B3RL 1U0LA 4JC0A 3A5UA 4DV6Q 3HOUG 3PO3H 5AJ3L 3K0XA 1MKHA 3RLFA 4L5QA 3UE0A 1L1OB 1C9OA 1Q46A 2EIFA 3F2BA 4YCVA 4DR4L 3HOWG 2VY3A 3G4SA 3CF5A 3M4QA 3T1YL 1VQ9A 3S24A 4DUYL 5J3BA 3BJUA 3S15H 4B3TQ 1VQBA 4IPHA 5M3FH 3TREA 3ULPA 3K81C 3I4OA 4DV4Q 1A0IA 3S16H 2LXJA 1JT8A 1L1OC 1VQEA 3KYHC 1TWGH 1UE1A 1L0WA 4DV1Q 1Q82C 1IBKQ 4B3ML 5IWAQ 4LF7L 4GKJQ 1PYSB 1RL2A 4DR2Q 3CQZH 2E5LQ 3M7NA 2QEXA 3Q8DA 2GVAA 2FXQA 3ULJA 4A3EG 1YJNA 4IPGA 4A4IA 1VQJA 1WFQA 4YHHL 1H95A 2VQFL 2NZHA 4IOAA 3CW2C 5FLXc 4EQ5A 2MO1A 3I4MH 5M3MH 1Q12A 4BBRH 1N8RC 3UDGA 2E2IH 2OQ0A 1S40A 1FJGL 3WWVA 4LF4Q 2NZOA 2ZM6L 2F52A 2B63G 4X65Q 4LFCL 1HZCA 3A0JA 1YVCA 2NVYH 1SROA 2D0PA 3HKSA 4QY7A 2BA0A 4LFAL 1HZAA 1GD7A 2CWAA 2JK8A 1EOVA 4PMWA 3CXCA 1XMOL 2JA5G 1XPUA 3LGJA 4OWWB 2B3GA 4MZ9A 5C0XI 3HOZG 1UE6A 1XMQL 1Q7YC 1KIXA 1XNRL 2UXCQ 3M3YH 4X62L 3H0GH 2ASBA 1TWCH 2F4VQ 1PH5A 1WI5A 4HJ7A 2NN6G 3RZOH 4HIOA 1OXSC 3STBC 1OTCA 2UUAQ 4DR5L 1IL2A 3HOYH 4NXMQ 1EWIA 5IYCH 1QVGA 2MFIA 4DNIA 4POGA 4GN5A 3PUWA 2D0OA 4IPCA 2WP8J 3MEFA 4A3FG 2OTJA 4LW1A 1SN8A 1DGSA 5IE8A 4P73A 4AQYQ 3AQQA 4DV0L 3M9BA 2JA7G 4BY7H 2R6GA 3PUYA 1FVIA 1UE5A 4PG3A 1VQMA 2UUCL 1OXUA 2XGTA 2OWOA 3S1NH 1X3EA 4A3JH 1TWHH 4QQBX 4X6AH 1I94L 2OQKA 3CCQA 1QVFA 2Z6KC 3RNUA 3KJOA 1GO3E 5IP7H 2I5HA 4GOPB 4ALPA 4AYBG 4JI0Q 1JE5A 3OTOL 2ES2A 4UY8C 3J7A5 4TQUS 2OCEA 4YY3Q 4OX9L 3CPWA 2IT1A 4XTCS 5C0XJ 4X66Q 1GM5A 4DK6C 3J80c 5IP9H 2K75A 3F1ZA 4IO9A 1A8VA 2MO0A 3ZJYC 1VQ4A 3BZKA 3DLLA 4PZ7A 1SMXA 4JYAL 1NTGA 4LUOA 2RF4A 3EN2A 5JEAG 2VQEL 1IBLL 1PFSA 1Q8KA 3KLWA 1XPRA 1EIYB 4JI6L 4XIGS 5ELNA 4ME3A 3JC66 4DPGA 1YNXA 1VQHA 2DUDA 2KCTA 1L2FA 1N36L 1K73C 1K8GA 3CCLA 4JCVE 2ZTEA 5M5WH 1XNQL 5BR8Q 3CCUA 2R92G 3HOWH 1Q1BA 1X55A 2YU9H 2XTIA 3PUXA 5C44H 1GKHA 1N34L 1IBML 3CC7A 3FKIG 4PZ6A 3W1BA 1BBUA 4POFA 3CCEA 4A76A 5JJKA 2KHIA 4GKKL 1HZBA 4JI1Q 1KQSA 3K7UC 1GVPA 4DR1L 4DR7L 4BY1G 4IFDJ 1E7ZA 3PSIA 2PI2A 4JOIC 1EQRA 3J81i 3UDXA 4R4QA 3PIPA 1HNWL 1XPOA 3KF6A 2PI2E 4JI3L 4LFBQ 1IZ6A 1E3PA 1P8LA 2IHFA 2K5VA 5FJ8H 4C3IH 1YITA 1IXRA 4A75A 3GTPH 3A5ZB 1VQKA 3TS2A 2HIXA 4AIMA 4GN3B 1R9TH 2K50A 3HOXH 1N33L 1J5EL 1W3SA 2ALYB 4A3MG 3CCVA 3CC4A 2LSSA 2B63H 3PO2G 1CKMA 3D0FA 4HJAA 1PH7A 1PYBA 2CWPA 4IJLA 2WB1E 4YWMA 4AH6A 4A3KG 2JA5H 4A93G 1WCMH 3E9HA 4GN4B 4DV6L 1MJEA 2UUBQ 1E22A 4DV3Q 1BBWA 4NB3A 2L15A 4RMFA 4JI4Q 3ER0A 1A62A 2UU9Q 4LF9L 2UXDQ 4K0KQ 3L7ZC 1NJIC 4OONA 1BKBA 2R7ZG 5H1SE 4A3CG 4P72A 4DAYB 2AMCB 1YZ6A 1PA6A 4B3TL 2VNUD 2MQHA 4DV4L 4DV2L 1Y1VG 2H5XA 3FP9A 2KBNA 2EQSA 5IYBH 1WOCA 3KF8B 2BH8A 5IWAL 1IBKL 3H3VH 2R93H 3GO5A 4UP7A 4EX5A 2HHHQ 4KHPL 2JA7H 2DGYA 3J81c 3PUZA 1QZHA 3PF4A 1N9WA 2VL6A 1KD1C 5IYDH 5AJ3Q 2IHEA 1G291 2ZTDA 5C4JH 3FHWA 2CFMA 1G51A 3I7FA 2VZAA 4J15A 4OWXB 1PHJA 1EQQA 4Y7NH 4P75A 4LF4L 1AH9A 2D62A 4X65L 1Q81C 1VQOA 1M90C 4A3LG 2AKWB 3BU2A 5HGQA 2WAQE 1JJCB 3J80i 1VQCA 2JA6H 4NXNQ 4JV5Q 1S72A 2K14A 4DV7Q 5E7NA 1HR0Q 1I50H 1WJJA 4DUZQ 4LF7Q 1UWVA 3AFPA 4A3IG 2UXCL 4QL5A 1KHIA 1S3OA 2EXDA 4IOCA 3RLNA 4HJ8A 1Y1WG 3U4ZA 1HR0W 2E2JH 5IT9c 3H3VI 2ZTCA 4BBSG 4JBWA 2JA8H 1YI2A 1PV4A 4B3SQ 4DV5Q 1K9MC 5C4XG 4BXXH 1VQDA 4NXML 2AHOB 1OXTA 3NENA 2N3SA 3G48A 4FDBA 1CKNA 1PH3A 2YTYA 1YIJA 4HIKA 1VS0A 1HNXQ 3GTLH 2ZJRA 2CQOA 3FKIH 4AQYL 2GN5A 3U4VA 1XMOQ 4A3DG 4LF8Q 4HIDA 3S1MH 4DR3L 4X64Q 2VUMH 1HZ9A 4JI2Q 1XMQQ 1HNZQ 1KRTA 4BY1H 1K83H 4GS3A 2GVBA 4YCUA 1EUJA 4JI0L 1WYDA 3IRBA 4PZ8A 4LF6Q 1VQNA 4IFDI 2WB1G 5IY0A 5C3EH 3E9IA 4YY3L 2A8VA 3CPFA 1K0RA 2N49A 2E2HH 1X3FA 4X66L 5C0XG 2I0QA 1PH1A 3S17H 1UE7A 1X6OA 3S2DH 1X54A 3W1GA 4A3MH 1PH2A 1Z9FA 4GOPC 3SGIA 4YCWA 4DV0Q 1VQ8A 4OWTB 2N8NA 1PH6A 3OYYA 3JAMc 2UUCQ 3PF5A 1TWFH 4LWCA 4A3BH 5M5XH 3HKZE 1D7QA 2UXBL 4L5SA 5GQOA 3HOUH 3ICEA 1XJVA 4GNXA 3D31A 5LMUQ 2ZJQA 5GADC 2I5LX 3I4MG 5BR8L 5M3MG 4BBRG 5LMNQ 2E8GA 4JI7Q 3F2DA 5FLMG 4UP9A 3OTOQ 5EAYA 5DLQE 5LMNW 1N32L 4KI0A 1EIFA 1E1TA 1Q1EA 3GDEA 4OX9Q 2QA4A 2PMZE 4LNQA 1Y1VH 2YYZA 3M4PA 4JI1L 3J81j 2YTVA 3I55A 3PGZA 4BA1I 1V43A 5K36G 4IFDG 3T1HQ 1UEBA 3H0GG 4LUVA 3RLOA 2WFWA 4GLVB 4R1JA 1KAWA 1QUQA 3CMAA 1TXYA 4A3EH 3GTQH 1JJ2A 3M4OH 4JI5Q 4LFBL 2LXKA 2RHSB 1HJPA 3HOYG 4Y52H 4DR6L 4IJHA 5IYCG 1JJGA 4JI8Q 1Z47A 2Q2HA 3TQYA 3J7ZC 1VQGA 4YWKA 3K80C 4C3JH 1IYJB 4O2DA 4BY7G 1XTDA 4KHZA 4BA2I 4OO1I 2JEAI 4A3GG 1KXLA 3S1RH 3L0OA 4MTNA 1E1OA 4A3JG 5M5YH 2UUBL 1KL9A 3AEVA 3HOZH 4DV3L 4DR1Q 2VS1A 4C2MH 2K4KA 4DR7Q 4QIWE 2R7DA 5IP7G 4UPAA 3G6EA 4OXPA 1LTLA 1C7YA 2UU9L 1SLJA 4K0KL 1B8AA 2UXDL 3GTJH 4MNOA 4DK3C 2NVQH 3K7AH 3RZDH 1VQAA 3RR5A 3NEMA 2JEBI 2JJQA 5C4XH 3UDIA 3S2HH 1RIPA 1X56A 1CSQA 4HJ5A 3U50C 4WJ3M 1J5EQ 5IP9G 3G71A 1PH4A 1V9PA 1CUKA 3KJPA 4R4IA 3UE1A 2R7FA 4DV1L 3E0EA 2PQAA 1KRSA 2ID0A 4P71A 3RN5A 4A3FH 4DR2L 2HHHL 4GKJL 2E5LL 3GTOH 1VQLA 1Y14B 3AYHB 2ZJPA 2C35B 3OW2A 1MJCA 1CKNB 4JOIA 4LF5Q 3HOVG 2KHJA 4B3RQ 3CAMA 4WJ4A 1LUZA 2AWNA 1I3QH 1KC8C 1QVCA 4H02A 3PIOA 4DR4Q 1MIUA 4RG1A 4OO1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STB D;  5C44 G;  3T1Y Q;  1W2B A;  4DUY Q;  1SR3 A;  1B7Y B;  3HKZ G;  1VQP A;  1T9H A;  1PVO A;  4P74 A;  3TEH B;  2NN6 I;  1C0A A;  3CCM A;  4DV2 Q;  4NXN L;  3VDY A;  4TVA B;  1VQ7 A;  4JV5 L;  2KEN A;  3F2C A;  4DV7 L;  1HR0 L;  4DUZ L;  2Y0S E;  3CCJ A;  4B3M Q;  1YBY A;  4KHP Q;  1P16 A;  4DAM A;  1B70 B;  1D8L A;  2MNA A;  3JAM i;  3DM3 A;  1YEZ A;  1EFW A;  1TWA H;  2F4V L;  1NY4 A;  5FJ8 G;  2RCN A;  3I4N G;  4YHH Q;  4B3S L;  4DV5 L;  5ELO A;  5GAE C;  3CP0 A;  2VQF Q;  3PV0 A;  1NE3 A;  2JE6 I;  2UUA L;  1PH8 A;  5GAG C;  1K8A C;  3HOX G;  3KDF A;  2JQO A;  5FLM H;  4HIM A;  2R92 H;  3TRZ A;  2I5M X;  3EBE A;  1FJG Q;  2KCM A;  2NVT H;  4QGU A;  1X3G A;  3CME A;  1HNX L;  2Q2I A;  4O0A A;  2ZM6 Q;  4GNX B;  2Q2T A;  4LFC Q;  2BH2 A;  3U58 A;  1L1O A;  4LFA Q;  3BZC A;  1AE3 A;  2VW9 A;  4LF8 L;  1YHQ A;  1V1Q A;  1WCM G;  4KLK A;  4X64 L;  4JI2 L;  3PO3 G;  1I6H H;  1NMG A;  1VQ6 A;  1HNZ L;  2HQL A;  2V1C C;  3GTM H;  1SE8 A;  1XNR Q;  3RN2 A;  4X62 Q;  3W5O A;  3CC2 A;  4GNX C;  4L5R C;  4IPD A;  4LF6 L;  3CCS A;  3KFU A;  2F3I A;  5GAH C;  4JBM A;  4LF9 Q;  2A19 A;  3HFZ B;  5M3F G;  1FGU A;  2Z0S A;  4YWL A;  4DR5 Q;  1YJW A;  4C3H H;  5JJI A;  3AFQ A;  3A74 A;  1QUQ B;  3KF6 B;  5IYB G;  2OTL A;  2R93 G;  3ULL A;  3PO2 H;  1NMF A;  4GLX A;  3CCR A;  1U5K A;  1SFO H;  1PH9 A;  1ASZ A;  1EYG A;  4A3G H;  1YHB A;  4JG2 A;  1VQF A;  2K52 A;  2YV5 A;  4A3K H;  3GD7 A;  4A93 H;  2PNH A;  5IYD G;  4UP8 A;  4DR3 Q;  5LMU L;  3F8T A;  1QZG A;  1I94 Q;  4GLA C;  4QJF A;  3GTK H;  1BVS A;  5LMN L;  4JI7 L;  2K5N A;  1SRU A;  2R7Z H;  1VQI A;  1JB7 A;  3MXN B;  4A3C H;  1JMC A;  3M85 A;  3K8A A;  2ATW A;  2B29 A;  1NBW A;  2JA6 G;  1CKO A;  1X65 A;  3I56 A;  1LYL A;  1OXX K;  5HY6 A;  3EIV A;  1ASY A;  2A1A A;  1VQ5 A;  3T1H L;  3S1Q H;  4JYA Q;  5JEA J;  1X9N A;  2VQE Q;  1YHA A;  1IBL Q;  3CD6 A;  3PCO B;  2JA8 G;  3KOJ A;  3HOV H;  2Z6K A;  4R4O A;  2Q2U A;  2N78 A;  4JI5 L;  4JI6 Q;  2UXB Q;  1G6P A;  3B6Y A;  3S14 H;  2WAQ G;  2PQA B;  4BXX G;  1N36 Q;  2RHQ B;  3UDF A;  4JI8 L;  1M1K C;  2Y0S G;  1XNQ Q;  1OXV A;  1Q86 C;  3NEL A;  4R4T A;  5GRO A;  1YJ9 A;  2AWO A;  1FL0 A;  2IX0 A;  3PUV A;  1N32 Q;  2YTX A;  4R4C A;  1N34 Q;  1IBM Q;  1HH2 P;  2CCZ A;  2NVX H;  4A3L H;  4DKA C;  4GOP A;  4GKK Q;  1AE2 A;  1VCI A;  3TS0 A;  2VUM G;  1A63 A;  4L5T A;  2IX1 A;  2JA9 A;  4A3I H;  1K3R A;  4JBJ A;  1LM0 A;  4JI4 L;  1Y1W H;  1HNW Q;  2K5H A;  1CSP A;  4BBS H;  4JI3 Q;  3I4N H;  5C3E G;  2CKZ B;  5JJL A;  4DR6 Q;  3I2Z A;  1I5F A;  1N33 Q;  3GTG H;  4NPS A;  3H15 A;  4HJ9 A;  4LUZ A;  2IY5 B;  2HIV A;  4JBK A;  4AYB E;  1J6Q A;  3NBH B;  3ERS X;  1O7I A;  3KDF B;  4APV A;  4A3B G;  2HT1 A;  2QGQ A;  3L2P A;  1E24 A;  4LF5 L;  4A3D H;  2BA1 A;  4B3R L;  1U0L A;  4JC0 A;  3A5U A;  4DV6 Q;  3HOU G;  3PO3 H;  5AJ3 L;  3K0X A;  1MKH A;  3RLF A;  4L5Q A;  3UE0 A;  1L1O B;  1C9O A;  1Q46 A;  2EIF A;  3F2B A;  4YCV A;  4DR4 L;  3HOW G;  2VY3 A;  3G4S A;  3CF5 A;  3M4Q A;  3T1Y L;  1VQ9 A;  3S24 A;  4DUY L;  5J3B A;  3BJU A;  3S15 H;  4B3T Q;  1VQB A;  4IPH A;  5M3F H;  3TRE A;  3ULP A;  3K81 C;  3I4O A;  4DV4 Q;  1A0I A;  3S16 H;  2LXJ A;  1JT8 A;  1L1O C;  1VQE A;  3KYH C;  1TWG H;  1UE1 A;  1L0W A;  4DV1 Q;  1Q82 C;  1IBK Q;  4B3M L;  5IWA Q;  4LF7 L;  4GKJ Q;  1PYS B;  1RL2 A;  4DR2 Q;  3CQZ H;  2E5L Q;  3M7N A;  2QEX A;  3Q8D A;  2GVA A;  2FXQ A;  3ULJ A;  4A3E G;  1YJN A;  4IPG A;  4A4I A;  1VQJ A;  1WFQ A;  4YHH L;  1H95 A;  2VQF L;  2NZH A;  4IOA A;  3CW2 C;  5FLX c;  4EQ5 A;  2MO1 A;  3I4M H;  5M3M H;  1Q12 A;  4BBR H;  1N8R C;  3UDG A;  2E2I H;  2OQ0 A;  1S40 A;  1FJG L;  3WWV A;  4LF4 Q;  2NZO A;  2ZM6 L;  2F52 A;  2B63 G;  4X65 Q;  4LFC L;  1HZC A;  3A0J A;  1YVC A;  2NVY H;  1SRO A;  2D0P A;  3HKS A;  4QY7 A;  2BA0 A;  4LFA L;  1HZA A;  1GD7 A;  2CWA A;  2JK8 A;  1EOV A;  4PMW A;  3CXC A;  1XMO L;  2JA5 G;  1XPU A;  3LGJ A;  4OWW B;  2B3G A;  4MZ9 A;  5C0X I;  3HOZ G;  1UE6 A;  1XMQ L;  1Q7Y C;  1KIX A;  1XNR L;  2UXC Q;  3M3Y H;  4X62 L;  3H0G H;  2ASB A;  1TWC H;  2F4V Q;  1PH5 A;  1WI5 A;  4HJ7 A;  2NN6 G;  3RZO H;  4HIO A;  1OXS C;  3STB C;  1OTC A;  2UUA Q;  4DR5 L;  1IL2 A;  3HOY H;  4NXM Q;  1EWI A;  5IYC H;  1QVG A;  2MFI A;  4DNI A;  4POG A;  4GN5 A;  3PUW A;  2D0O A;  4IPC A;  2WP8 J;  3MEF A;  4A3F G;  2OTJ A;  4LW1 A;  1SN8 A;  1DGS A;  5IE8 A;  4P73 A;  4AQY Q;  3AQQ A;  4DV0 L;  3M9B A;  2JA7 G;  4BY7 H;  2R6G A;  3PUY A;  1FVI A;  1UE5 A;  4PG3 A;  1VQM A;  2UUC L;  1OXU A;  2XGT A;  2OWO A;  3S1N H;  1X3E A;  4A3J H;  1TWH H;  4QQB X;  4X6A H;  1I94 L;  2OQK A;  3CCQ A;  1QVF A;  2Z6K C;  3RNU A;  3KJO A;  1GO3 E;  5IP7 H;  2I5H A;  4GOP B;  4ALP A;  4AYB G;  4JI0 Q;  1JE5 A;  3OTO L;  2ES2 A;  4UY8 C;  3J7A 5;  4TQU S;  2OCE A;  4YY3 Q;  4OX9 L;  3CPW A;  2IT1 A;  4XTC S;  5C0X J;  4X66 Q;  1GM5 A;  4DK6 C;  3J80 c;  5IP9 H;  2K75 A;  3F1Z A;  4IO9 A;  1A8V A;  2MO0 A;  3ZJY C;  1VQ4 A;  3BZK A;  3DLL A;  4PZ7 A;  1SMX A;  4JYA L;  1NTG A;  4LUO A;  2RF4 A;  3EN2 A;  5JEA G;  2VQE L;  1IBL L;  1PFS A;  1Q8K A;  3KLW A;  1XPR A;  1EIY B;  4JI6 L;  4XIG S;  5ELN A;  4ME3 A;  3JC6 6;  4DPG A;  1YNX A;  1VQH A;  2DUD A;  2KCT A;  1L2F A;  1N36 L;  1K73 C;  1K8G A;  3CCL A;  4JCV E;  2ZTE A;  5M5W H;  1XNQ L;  5BR8 Q;  3CCU A;  2R92 G;  3HOW H;  1Q1B A;  1X55 A;  2YU9 H;  2XTI A;  3PUX A;  5C44 H;  1GKH A;  1N34 L;  1IBM L;  3CC7 A;  3FKI G;  4PZ6 A;  3W1B A;  1BBU A;  4POF A;  3CCE A;  4A76 A;  5JJK A;  2KHI A;  4GKK L;  1HZB A;  4JI1 Q;  1KQS A;  3K7U C;  1GVP A;  4DR1 L;  4DR7 L;  4BY1 G;  4IFD J;  1E7Z A;  3PSI A;  2PI2 A;  4JOI C;  1EQR A;  3J81 i;  3UDX A;  4R4Q A;  3PIP A;  1HNW L;  1XPO A;  3KF6 A;  2PI2 E;  4JI3 L;  4LFB Q;  1IZ6 A;  1E3P A;  1P8L A;  2IHF A;  2K5V A;  5FJ8 H;  4C3I H;  1YIT A;  1IXR A;  4A75 A;  3GTP H;  3A5Z B;  1VQK A;  3TS2 A;  2HIX A;  4AIM A;  4GN3 B;  1R9T H;  2K50 A;  3HOX H;  1N33 L;  1J5E L;  1W3S A;  2ALY B;  4A3M G;  3CCV A;  3CC4 A;  2LSS A;  2B63 H;  3PO2 G;  1CKM A;  3D0F A;  4HJA A;  1PH7 A;  1PYB A;  2CWP A;  4IJL A;  2WB1 E;  4YWM A;  4AH6 A;  4A3K G;  2JA5 H;  4A93 G;  1WCM H;  3E9H A;  4GN4 B;  4DV6 L;  1MJE A;  2UUB Q;  1E22 A;  4DV3 Q;  1BBW A;  4NB3 A;  2L15 A;  4RMF A;  4JI4 Q;  3ER0 A;  1A62 A;  2UU9 Q;  4LF9 L;  2UXD Q;  4K0K Q;  3L7Z C;  1NJI C;  4OON A;  1BKB A;  2R7Z G;  5H1S E;  4A3C G;  4P72 A;  4DAY B;  2AMC B;  1YZ6 A;  1PA6 A;  4B3T L;  2VNU D;  2MQH A;  4DV4 L;  4DV2 L;  1Y1V G;  2H5X A;  3FP9 A;  2KBN A;  2EQS A;  5IYB H;  1WOC A;  3KF8 B;  2BH8 A;  5IWA L;  1IBK L;  3H3V H;  2R93 H;  3GO5 A;  4UP7 A;  4EX5 A;  2HHH Q;  4KHP L;  2JA7 H;  2DGY A;  3J81 c;  3PUZ A;  1QZH A;  3PF4 A;  1N9W A;  2VL6 A;  1KD1 C;  5IYD H;  5AJ3 Q;  2IHE A;  1G29 1;  2ZTD A;  5C4J H;  3FHW A;  2CFM A;  1G51 A;  3I7F A;  2VZA A;  4J15 A;  4OWX B;  1PHJ A;  1EQQ A;  4Y7N H;  4P75 A;  4LF4 L;  1AH9 A;  2D62 A;  4X65 L;  1Q81 C;  1VQO A;  1M90 C;  4A3L G;  2AKW B;  3BU2 A;  5HGQ A;  2WAQ E;  1JJC B;  3J80 i;  1VQC A;  2JA6 H;  4NXN Q;  4JV5 Q;  1S72 A;  2K14 A;  4DV7 Q;  5E7N A;  1HR0 Q;  1I50 H;  1WJJ A;  4DUZ Q;  4LF7 Q;  1UWV A;  3AFP A;  4A3I G;  2UXC L;  4QL5 A;  1KHI A;  1S3O A;  2EXD A;  4IOC A;  3RLN A;  4HJ8 A;  1Y1W G;  3U4Z A;  1HR0 W;  2E2J H;  5IT9 c;  3H3V I;  2ZTC A;  4BBS G;  4JBW A;  2JA8 H;  1YI2 A;  1PV4 A;  4B3S Q;  4DV5 Q;  1K9M C;  5C4X G;  4BXX H;  1VQD A;  4NXM L;  2AHO B;  1OXT A;  3NEN A;  2N3S A;  3G48 A;  4FDB A;  1CKN A;  1PH3 A;  2YTY A;  1YIJ A;  4HIK A;  1VS0 A;  1HNX Q;  3GTL H;  2ZJR A;  2CQO A;  3FKI H;  4AQY L;  2GN5 A;  3U4V A;  1XMO Q;  4A3D G;  4LF8 Q;  4HID A;  3S1M H;  4DR3 L;  4X64 Q;  2VUM H;  1HZ9 A;  4JI2 Q;  1XMQ Q;  1HNZ Q;  1KRT A;  4BY1 H;  1K83 H;  4GS3 A;  2GVB A;  4YCU A;  1EUJ A;  4JI0 L;  1WYD A;  3IRB A;  4PZ8 A;  4LF6 Q;  1VQN A;  4IFD I;  2WB1 G;  5IY0 A;  5C3E H;  3E9I A;  4YY3 L;  2A8V A;  3CPF A;  1K0R A;  2N49 A;  2E2H H;  1X3F A;  4X66 L;  5C0X G;  2I0Q A;  1PH1 A;  3S17 H;  1UE7 A;  1X6O A;  3S2D H;  1X54 A;  3W1G A;  4A3M H;  1PH2 A;  1Z9F A;  4GOP C;  3SGI A;  4YCW A;  4DV0 Q;  1VQ8 A;  4OWT B;  2N8N A;  1PH6 A;  3OYY A;  3JAM c;  2UUC Q;  3PF5 A;  1TWF H;  4LWC A;  4A3B H;  5M5X H;  3HKZ E;  1D7Q A;  2UXB L;  4L5S A;  5GQO A;  3HOU H;  3ICE A;  1XJV A;  4GNX A;  3D31 A;  5LMU Q;  2ZJQ A;  5GAD C;  2I5L X;  3I4M G;  5BR8 L;  5M3M G;  4BBR G;  5LMN Q;  2E8G A;  4JI7 Q;  3F2D A;  5FLM G;  4UP9 A;  3OTO Q;  5EAY A;  5DLQ E;  5LMN W;  1N32 L;  4KI0 A;  1EIF A;  1E1T A;  1Q1E A;  3GDE A;  4OX9 Q;  2QA4 A;  2PMZ E;  4LNQ A;  1Y1V H;  2YYZ A;  3M4P A;  4JI1 L;  3J81 j;  2YTV A;  3I55 A;  3PGZ A;  4BA1 I;  1V43 A;  5K36 G;  4IFD G;  3T1H Q;  1UEB A;  3H0G G;  4LUV A;  3RLO A;  2WFW A;  4GLV B;  4R1J A;  1KAW A;  1QUQ A;  3CMA A;  1TXY A;  4A3E H;  3GTQ H;  1JJ2 A;  3M4O H;  4JI5 Q;  4LFB L;  2LXK A;  2RHS B;  1HJP A;  3HOY G;  4Y52 H;  4DR6 L;  4IJH A;  5IYC G;  1JJG A;  4JI8 Q;  1Z47 A;  2Q2H A;  3TQY A;  3J7Z C;  1VQG A;  4YWK A;  3K80 C;  4C3J H;  1IYJ B;  4O2D A;  4BY7 G;  1XTD A;  4KHZ A;  4BA2 I;  4OO1 I;  2JEA I;  4A3G G;  1KXL A;  3S1R H;  3L0O A;  4MTN A;  1E1O A;  4A3J G;  5M5Y H;  2UUB L;  1KL9 A;  3AEV A;  3HOZ H;  4DV3 L;  4DR1 Q;  2VS1 A;  4C2M H;  2K4K A;  4DR7 Q;  4QIW E;  2R7D A;  5IP7 G;  4UPA A;  3G6E A;  4OXP A;  1LTL A;  1C7Y A;  2UU9 L;  1SLJ A;  4K0K L;  1B8A A;  2UXD L;  3GTJ H;  4MNO A;  4DK3 C;  2NVQ H;  3K7A H;  3RZD H;  1VQA A;  3RR5 A;  3NEM A;  2JEB I;  2JJQ A;  5C4X H;  3UDI A;  3S2H H;  1RIP A;  1X56 A;  1CSQ A;  4HJ5 A;  3U50 C;  4WJ3 M;  1J5E Q;  5IP9 G;  3G71 A;  1PH4 A;  1V9P A;  1CUK A;  3KJP A;  4R4I A;  3UE1 A;  2R7F A;  4DV1 L;  3E0E A;  2PQA A;  1KRS A;  2ID0 A;  4P71 A;  3RN5 A;  4A3F H;  4DR2 L;  2HHH L;  4GKJ L;  2E5L L;  3GTO H;  1VQL A;  1Y14 B;  3AYH B;  2ZJP A;  2C35 B;  3OW2 A;  1MJC A;  1CKN B;  4JOI A;  4LF5 Q;  3HOV G;  2KHJ A;  4B3R Q;  3CAM A;  4WJ4 A;  1LUZ A;  2AWN A;  1I3Q H;  1KC8 C;  1QVC A;  4H02 A;  3PIO A;  4DR4 Q;  1MIU A;  4RG1 A;  4OO1 G; 
#chains in the Genus database with same CATH topology
 4PNY A;  4XYO A;  1WD0 A;  3TEH B;  3R8B A;  4L6T B;  2JYO A;  1H9K A;  4DV7 L;  2FIN B;  1QB5 D;  2MNA A;  1O7Y A;  4FF2 A;  3DM3 A;  3HOW B;  1TWA H;  2RCN A;  3DM1 A;  4B3S L;  5ELO A;  1BCP B;  5GAE C;  4N9P A;  4FXK C;  3KDF A;  3CRK C;  1GJX A;  2I5M X;  3EBE A;  3X3N A;  1I4X A;  1X3G A;  3CME A;  1HNX L;  2Q2I A;  4O0A A;  3T53 B;  2LKV A;  4GNX B;  5A2Q L;  4LFC Q;  5CBA E;  2BH2 A;  3U58 A;  1L1O A;  3RMH A;  1BCP C;  4XQJ A;  1LT4 D;  4KLK A;  3PO3 G;  1S5E D;  1E0B A;  1WTW A;  1GUG A;  1HNZ L;  2V1C C;  1VQ6 A;  1SE8 A;  4X62 Q;  2CVR A;  4GNX C;  3NE5 B;  3X3M A;  2A5H A;  3CCS A;  2F0U A;  4B9X A;  2B63 B;  2V4D A;  1EFI D;  1YJW A;  2Z0S A;  5LL6 X;  3AFQ A;  2KUM A;  1QUQ B;  5IYB G;  5C5M A;  3PO2 H;  1NMF A;  4GLX A;  3HOZ B;  1EYG A;  4A3G H;  1JOR A;  2K52 A;  3L3O C;  1EY6 A;  5IYD G;  3J7A F;  3H6M A;  5CC4 A;  3F8T A;  1LV9 A;  3V05 A;  4GLA C;  4MTK A;  2VXW A;  3MFY A;  2K5N A;  1SRU A;  4RCO A;  1VQI A;  1JB7 A;  1IKL A;  1JMC A;  3KUP A;  2RBM A;  2B29 A;  5DAU A;  2JA6 G;  1STH A;  1LYL A;  3A56 A;  1KAA A;  4FO2 A;  2WKC A;  5JEA J;  3CRL C;  2VQE Q;  2BDN A;  1G6P A;  3J7A V;  3S14 H;  1CZW A;  2WAQ G;  4BXX G;  2RHQ B;  4JI8 L;  1XNQ Q;  3OWE B;  1Q86 C;  1YJ9 A;  2J7Z A;  4R4C A;  3I72 A;  4A3L H;  4GOP A;  4ZKC B;  2ENB A;  5I4D A;  2JA8 B;  1A63 A;  1EY7 A;  1K3R A;  1LM0 A;  4G7O C;  1LT5 D;  2Y0S B;  1CSP A;  3I4N H;  4U67 3;  1I5F A;  3GTG H;  1RJT A;  2MUY A;  1EU4 A;  1EWC A;  4CDE C;  4B9W A;  1VMP A;  4ZCK A;  4JBK A;  1AEX A;  4XXE A;  4AYB E;  4BY1 B;  1QNK A;  3KDF B;  4A3B G;  3EFX D;  4HMI A;  3QWN A;  5C3E B;  1L1O B;  2EIF A;  3HOW G;  3BDO A;  2B39 A;  3T1Y L;  4ABN A;  4DUY L;  3PO2 B;  3S15 H;  3ULP A;  5C0X H;  4DV4 Q;  1A0I A;  1TWF B;  4EQO A;  4JW0 A;  1L1O C;  1VQE A;  4ZK9 B;  5M5X B;  1B53 A;  1UE1 A;  1Q82 C;  2CQA A;  1K8M A;  1ONL A;  5EGT A;  4NW2 A;  1BOS A;  1PZI D;  4DGZ A;  1IBK Q;  3M7N A;  2AQ2 B;  4OL7 A;  3ULJ A;  4A3E G;  1SEB D;  1H95 A;  5KIX A;  4FVM A;  4IOA A;  3CW2 C;  1LTB D;  1F9P A;  2EY6 A;  1D5M C;  2OQ0 A;  2B63 G;  2ZM6 L;  5J22 A;  4X65 Q;  2Z8L A;  3PIO 3;  3D6W A;  3HKS A;  1CFM A;  4HSV A;  2BA0 A;  4LFA L;  1GUW A;  4MZ9 A;  3HOZ G;  4H13 C;  2ASB A;  4KKS A;  1RCV D;  4XQN A;  2JP1 A;  5I6Y A;  5HGT A;  4K2K A;  1SSO A;  1I4P A;  2KED A;  3HOY H;  1JOO A;  2H1E A;  5IYC H;  1QVG A;  4RHR A;  2D0O A;  1D1I A;  2WP8 J;  2OTJ A;  3I3C A;  4LW1 A;  3OWF A;  3PMF A;  4C2M B;  3AQQ A;  1I4G A;  2R6G A;  1UE5 A;  3S1N H;  5EJW A;  2Z9H A;  1X3E A;  3GTJ B;  4J8Q A;  1UUP A;  1NSN S;  2OQK A;  3MXU A;  4GOP B;  2KEC A;  4ALP A;  3GTG B;  3S9W A;  3DWP A;  4HCS A;  4UY8 C;  4K6D A;  4TQU S;  2OCE A;  3CPW A;  2IT1 A;  5LHY 1;  4X66 Q;  1Q3L A;  3Q22 A;  4DK6 C;  5IP9 H;  1BDO A;  3BZK A;  1G2T A;  3WOE A;  1SMX A;  2N55 A;  2B8F A;  1BQQ T;  2RF4 A;  4G7Z C;  3KBG A;  2C9O A;  5BN3 A;  1DJR D;  4JI6 L;  5FO9 B;  4XIG S;  2IW3 A;  3JC6 6;  2F0V A;  2F3W A;  4O42 A;  1ILQ A;  1N36 L;  3CCL A;  1STB A;  2ZTE A;  1CA5 A;  1ZYR C;  2K05 A;  1TS3 A;  3KLS A;  5C3W A;  2YU9 H;  1CZG A;  5C44 H;  1S5C D;  4N9T A;  5I9O A;  5AFW A;  4CJ0 B;  3NSW A;  5L37 A;  5J39 A;  2X6L A;  1ZEQ X;  4JI1 Q;  3K7U C;  4DR7 L;  4BY1 G;  2K32 A;  3PSI A;  1QIL A;  4KN4 C;  4E6I A;  3J81 i;  4R4Q A;  3PIP A;  1HNW L;  2P5Z X;  3KF6 A;  2R92 B;  4JI3 L;  1E3P A;  4RGT A;  5FJ8 H;  3NK9 A;  4NMZ A;  3MA2 B;  1JR0 D;  2QIL A;  1N33 L;  1VF7 A;  1D1K A;  1MGS A;  1W3S A;  2ALY B;  3PO2 G;  4QMG A;  4EGV A;  3VA5 A;  1QE6 A;  1PH7 A;  1PYB A;  4KD3 A;  2JA5 H;  1PTO H;  4DV6 L;  3GP7 A;  3HEJ A;  5KNB A;  3QJY A;  2PZU A;  3LWE A;  3ER0 A;  4C3H B;  2UU9 Q;  3BVM A;  2NN6 H;  4OON A;  5H1S E;  3J81 E;  4KY5 A;  4P72 A;  2EYM A;  1YZ6 A;  1HTP A;  1CQF A;  3S1N B;  1LTI D;  4DV2 L;  1PYW D;  4A93 B;  1WOC A;  3J81 c;  1QZH A;  4UDU C;  2VL6 A;  2NYZ D;  1NAP A;  1LTA D;  3VR4 A;  1CK1 A;  4OWX B;  5K5P A;  1EQQ A;  4LF4 L;  1AH9 A;  5IT9 E;  1QOH A;  2Q8R E;  4A3L G;  2AKW B;  3BU2 A;  1W6J A;  5HGQ A;  3HOV B;  4JV5 Q;  1HQM C;  1S72 A;  1HR0 Q;  1WJJ A;  4NDX A;  2EY2 A;  4HJ8 A;  5IT9 c;  3TME A;  4QUF A;  3N6R A;  4K5X A;  1NR4 A;  3DEO A;  5C44 B;  1YI2 A;  3KBX A;  4DV5 Q;  3ONA B;  3T16 A;  1VQD A;  2EYH A;  2AHO B;  1GUS A;  2N3S A;  3GTL H;  3FKI H;  4A3I B;  3U4V A;  5D3D A;  3SHL A;  3S1M H;  2VUM H;  4JI2 Q;  2OEO A;  2EJG C;  1PFN A;  2PYK A;  3ND8 A;  3QG1 A;  3SR1 A;  2GVB A;  3BZD B;  2KQ3 A;  4JI0 L;  4LF6 Q;  2Z6B A;  4YY3 L;  2E2H H;  5C0X G;  3OMG A;  2WKD A;  3SGI A;  4GZY C;  3OYY A;  3C2P A;  2F0W A;  3HKZ E;  1D7Q A;  3QO2 A;  4L5S A;  3DEP A;  1HPC A;  5GQO A;  3HOU H;  2UXB L;  1Q90 A;  2XIW A;  2WB1 B;  3D31 A;  4LJZ C;  5LMU Q;  2ZJQ A;  1SYB A;  2Z1C A;  2JSO A;  3L9A X;  5BR8 L;  5LMN Q;  2SNS A;  2KCC A;  3BVG A;  3S16 B;  1N32 L;  4KI0 A;  4G4K A;  3M4P A;  2YTV A;  3I55 A;  4BA1 I;  4DXG A;  3T1H Q;  4WFN 3;  3MEH A;  3MHB A;  1YNN C;  1JJ2 A;  2FHT A;  4JI5 Q;  1G91 A;  2F0O A;  3AMU A;  3HOY G;  2SDF A;  5IYC G;  3TQY A;  3TP7 A;  2DNE A;  2XWJ B;  5CBE E;  4CJ1 B;  4YWK A;  3LX0 A;  4BA2 I;  3H0G B;  5E4X A;  2F4I A;  1TWC B;  2E74 C;  2EY5 A;  5M5Y H;  3RZO B;  2PW7 A;  4DR7 Q;  4QIW E;  4KJO A;  4UPA A;  1C7Y A;  4OXP A;  1PFB A;  1WTQ A;  3RZD H;  2ICI A;  4KKU A;  3NEM A;  2JEB I;  5C4X H;  3PIP 3;  3S2H H;  1TS4 A;  3TP6 A;  5IP9 G;  1WTO A;  1CUK A;  4K5V A;  3KJP A;  1JE4 A;  4QF4 A;  4R4I A;  4F7X A;  2R7F A;  4NKL A;  4A3J B;  3K5M A;  4DV1 L;  2VUM B;  1EL0 A;  1VMC A;  2PQA A;  4P71 A;  2E76 C;  2E5L L;  2BE5 D;  2C35 B;  3HOV G;  1B9M A;  4JOI A;  3CAM A;  5F2D A;  2AWN A;  1I3Q H;  1LT3 D;  4XYQ A;  1MIU A;  2J0T D;  3STB D;  5C44 G;  1W2B A;  4X3K A;  1E2W A;  1SR3 A;  4RGM A;  4P74 A;  2NN6 I;  2A69 D;  4FF3 A;  4DV2 Q;  3VDY A;  4U68 A;  3VA7 A;  2RSN A;  1VQ7 A;  1EYA A;  4K14 A;  4DUZ L;  1GUN A;  4B3M Q;  1YBY A;  2I07 B;  2EY1 A;  5D3I B;  1B70 B;  3JAM i;  2B2Y A;  2F4V L;  1NY4 A;  5FJ8 G;  2K28 A;  1H9S A;  1SYG A;  3CP0 A;  3PV0 A;  1PZJ D;  1NE3 A;  3NBH A;  4HIM A;  3RD4 A;  5FLM H;  2NVT H;  1FJG Q;  4QGU A;  2Q2T A;  5KRU A;  1TQO A;  1AE3 A;  4LF8 L;  1DOK A;  4K6L A;  5JVH 3;  2BDO A;  3A8K E;  3MZ5 A;  4TSS A;  1I6H H;  1NMG A;  1ET9 A;  2A6H C;  3GTP B;  3RN2 A;  3CC2 A;  2L11 A;  4EQP A;  3KFU A;  2LMC B;  2A19 A;  1FGU A;  4YWL A;  5JJI A;  1EU3 A;  4LK1 C;  2OTL A;  1O78 A;  3CCR A;  1SFO H;  1F2Y A;  5ELB A;  1SNC A;  3HP3 A;  3ITP A;  4KJN A;  4CDF C;  1ASZ A;  3DWQ A;  1SXT A;  2PNH A;  1F9S A;  2BOS A;  3D4R A;  3A8J E;  4UP8 A;  4QCL A;  1J8I A;  4PV1 C;  2F0S A;  4QJF A;  3GTK H;  2PZW A;  3NUC A;  3V96 A;  5DM7 3;  2HQE A;  2R7Z H;  1KLG D;  1FNV A;  2JA7 B;  1JWM D;  3A54 A;  3I56 A;  1PRT F;  2O5J C;  5HY6 A;  2NTS A;  1VDZ A;  1PRT D;  3JAM L;  4JYA Q;  3S1Q H;  5C4J B;  3D8G A;  1KNA A;  1YHA A;  3CD6 A;  3PCO B;  1EYD A;  4HTH A;  2UXB Q;  5JPN C;  2PQA B;  2SNM A;  3HG9 A;  4ID6 A;  4R4T A;  5GRO A;  3S1M B;  1N32 Q;  2YTX A;  2G5D A;  2CCZ A;  2F0M A;  2NVX H;  1R4Q B;  1VCI A;  3K57 A;  2VUM G;  3SK6 A;  1EY8 A;  4IQZ A;  2IX1 A;  2JA9 A;  4JBJ A;  2XWB B;  4JI4 L;  1T5X D;  2K5H A;  3GV6 A;  4BBS H;  3CKI B;  5IOC A;  1JB3 A;  5JJL A;  1XTC D;  4CBV A;  1JIC A;  1EOT A;  1I6H B;  1H9S B;  2EJF C;  2IY5 B;  2HIV A;  3NBH B;  1O7I A;  4J1M A;  4MHE A;  4A3D H;  3L2P A;  4B3R L;  1U0L A;  3HOU G;  2E75 C;  1FGB D;  1MKH A;  3H09 A;  3RLF A;  4L5Q A;  2KEE A;  3UE0 A;  3F2B A;  2K03 A;  4JVZ A;  5IIF A;  2EJM A;  2VY3 A;  3S2D B;  3M4Q A;  2HDL A;  3S24 A;  2IJ0 A;  1F9R A;  3BJU A;  3G6J B;  4B3T Q;  5M3F H;  3K81 C;  3HRZ C;  4A3B B;  1JT8 A;  3KYH C;  3FRP B;  1L0W A;  4DV1 Q;  5IWA Q;  4M8A A;  1RL2 A;  1CHP D;  2E5L Q;  4DK1 A;  3Q8D A;  2GVA A;  4YHH L;  2VB3 X;  2VQF L;  1D2B A;  3BG3 A;  5FO7 B;  2OT2 A;  5M3M H;  1N8R C;  1Y1V B;  2E2I H;  1S40 A;  1KTK A;  2B2W A;  4RWS C;  1HZC A;  3I70 A;  2QDL A;  5IGB A;  5KYL A;  4FXG C;  1GUO A;  1HZA A;  2CWA A;  2B2V A;  2L55 A;  4PMW A;  2O4X A;  3LGJ A;  2B3G A;  4A3E B;  3BDC A;  4CDC C;  3GTQ B;  1Q7Y C;  1KIX A;  1XNR L;  2UXC Q;  4IFD H;  5D14 A;  5M9O A;  2F4V Q;  2A6E C;  3KF8 A;  1OXS C;  3TZD A;  1ICW A;  4DR5 L;  3S1R B;  2MFI A;  2EVB A;  3PUW A;  3MEF A;  4BY7 H;  1DGS A;  2JA7 G;  4DV0 L;  4OEL B;  3M9B A;  1YNJ C;  4PG3 A;  1FVI A;  1TWH H;  1TU2 B;  3EVQ A;  3FMC A;  2NVQ B;  5FO8 B;  1I94 L;  1TS5 A;  2CH4 W;  3D4W A;  1T5E A;  1GO3 E;  5KYI A;  1IYU A;  3KLR A;  2MGS A;  4AYB G;  3J7A 5;  4TRD A;  4XTC S;  3SDZ A;  2K75 A;  2MO0 A;  2K33 A;  5KGU A;  4PZ7 A;  1IBL L;  3KLW A;  2Z4H A;  1XPR A;  1EIY B;  2XRQ D;  4DU9 A;  4ME3 A;  1O7L A;  1R4P B;  1VQH A;  3NWS A;  4JCV E;  1C8C A;  4OO1 H;  2M2L A;  4V0B A;  4H7B A;  1N34 L;  1IBM L;  3CC7 A;  1SNM A;  3MC0 B;  3KLS X;  4HR7 B;  4PZ6 A;  1BBU A;  2DN8 A;  3W1B A;  3CCE A;  4GKK L;  1TWA B;  1GVP A;  3T13 A;  3HGB A;  2F0D A;  3UDX A;  2E2I B;  2PI2 E;  1BR9 A;  3BS1 A;  2IHF A;  2K5V A;  4C3I H;  1VQK A;  2B8G A;  2HIX A;  1TT2 A;  2X69 A;  2NZ1 D;  4AIM A;  1R9T H;  2K50 A;  3HOX H;  1L0Y B;  1EQT A;  2IWH A;  2RDG A;  3CCV A;  1CKM A;  4HJA A;  4YWM A;  2NWG A;  1WCM H;  1XWE A;  4GN4 B;  1K8O A;  3BVZ A;  4DV3 Q;  2ZXO A;  3NP8 A;  1BBW A;  2F1M A;  4JI4 Q;  2UXD Q;  4XDX A;  4K0K Q;  4ZYS A;  2R7Z G;  1AZQ A;  2XNA C;  1PA6 A;  5I9P A;  2VNU D;  1SBB B;  2B2W C;  2MQH A;  4A3G B;  1STE A;  1BCP F;  1Y1V G;  4XT3 B;  2R93 H;  3KF8 B;  1MSG A;  2BH8 A;  2B2V C;  3GO5 A;  1BCP D;  3TSS A;  2G9H D;  2LFN A;  4KK7 A;  5CV8 A;  2D5D A;  3PUZ A;  1AZP A;  1PXU A;  2IHE A;  3FHW A;  2CFM A;  3I7F A;  1D6E C;  1PHJ A;  4Y7N H;  1G2S A;  4P75 A;  2D62 A;  3VYU A;  1VQO A;  2WAQ E;  1JJC B;  3IFD A;  4ZUI A;  3NHH A;  1PLF A;  1V1O A;  4DV7 Q;  1I50 H;  4CKC A;  3S14 B;  1UWV A;  3AFP A;  1A3V A;  2EXD A;  4QL5 A;  4IOC A;  3H3V I;  3U4Z A;  2E2J H;  4BBS G;  4JBW A;  2EYO A;  5CMD A;  2KJX A;  1G6Z A;  4B3S Q;  1ILP A;  4NXM L;  5EKL A;  1OXT A;  3NEN A;  2R3Z A;  3G48 A;  1CKN A;  2I46 A;  2YTY A;  1HNX Q;  4DNR B;  3OW7 A;  2CQO A;  1LAC A;  4AQY L;  1U4R A;  1V1P A;  4CKE A;  4A3D G;  3D6C A;  4O1N A;  5CV4 A;  1LTR D;  3I4N B;  1HZ9 A;  1HNZ Q;  1K83 H;  5EBC A;  4PMB A;  1R9T B;  1A3T A;  1FYC A;  1NNX A;  3H94 A;  4K5W A;  1WYD A;  2F0L A;  4IFD I;  3FEW X;  5IY0 A;  1RTN A;  3E9I A;  1K0R A;  1X3F A;  1UE7 A;  5ELD A;  2F0J A;  1X54 A;  3OIP A;  4RHS A;  2LS0 1;  4A3M H;  4GOP C;  2AQ3 B;  4DV0 Q;  1VQ8 A;  2N8N A;  1PH6 A;  1B9N A;  4ILW A;  2NTT A;  4X3T A;  1DM0 B;  5G3L F;  4R8N A;  3S15 B;  2I5L X;  5FOB B;  4DN4 M;  5M3M G;  4UP9 A;  5FK9 C;  2QA4 A;  4IUV A;  4IAL A;  2PMZ E;  4LNQ A;  4ZQ3 A;  2YYZ A;  2RSO A;  3J81 j;  1V43 A;  4IFD G;  1UEB A;  3SK4 A;  2L9H A;  1X3Q A;  3HS0 C;  4LUV A;  4R1J A;  3FVQ A;  4LFB L;  2M9V A;  4IUP A;  5CV6 A;  3M4O H;  1CHQ D;  2RHS B;  4DR6 L;  2NBF A;  1JJG A;  4JI8 Q;  1Z47 A;  2L1B A;  4KY7 A;  4BY7 G;  1BO0 A;  4OO1 I;  4A3G G;  1KXL A;  2EPB A;  1CA6 A;  3LNN A;  4MTN A;  1I4R A;  1LTT D;  2UUB L;  1KL9 A;  4XQQ A;  3MXN A;  3SK5 A;  2F0I A;  4H0L C;  3HOY B;  5EQ0 A;  1RHP A;  5J1Z A;  3K7A H;  1X56 A;  1CSQ A;  5NUC A;  4HJ5 A;  3U50 C;  1PH4 A;  1V9P A;  3RN5 A;  2HHH L;  4GKJ L;  3VYR A;  4CJ2 C;  1S5F D;  4DR2 L;  5C5L A;  3GTO H;  1VQL A;  4DNT B;  1Y14 B;  2ZJP A;  1CKN B;  4I7A A;  5E3F A;  4WJ4 A;  1LUZ A;  2F0K A;  1QVC A;  1V1P B;  4OO1 G;  2QDB A;  3SEB A;  4C56 C;  3T1Y Q;  4KHV A;  4DUY Q;  3HKZ G;  2K5Q A;  1T9H A;  1PVO A;  1C0A A;  3CCM A;  4NXN L;  3MXP A;  3OIQ A;  3A7L A;  3K59 A;  2KEN A;  3F2C A;  2Y0S E;  1P16 A;  3J81 L;  5JEA H;  1C4Q A;  1EFW A;  1DZ1 A;  3I4N G;  4C3I G;  2YU9 B;  1ET6 A;  2UUA L;  5KEE A;  5GAG C;  1PH8 A;  5A35 A;  4KN7 C;  1K8A C;  3HOX G;  2J4X A;  2JQO A;  1A6X A;  3BYT B;  2RVL A;  1SE4 A;  2ZM6 Q;  2QEJ C;  1LTG D;  1SMY C;  1WTR A;  4LFA Q;  4KTA A;  1WCM G;  4X64 L;  2BE5 C;  1SJE D;  5COR A;  3T51 B;  3GTM H;  5IT9 L;  2K7V A;  3VR5 A;  2B2T A;  4L5R C;  1QJO A;  1NCV A;  5JAV A;  3I73 A;  1ZYR D;  2K04 A;  3HFZ B;  4K8I A;  1EEI D;  2JA5 B;  2EDG A;  3A74 A;  1SNO A;  3KF6 B;  1PTO B;  2R93 G;  3ULL A;  1PH9 A;  1M4V A;  1YHB A;  4RCN A;  2EYP A;  3E5S A;  3GD7 A;  4A3K H;  3OHX C;  3AB9 A;  1B44 D;  1KLU D;  2A74 C;  1S4Z A;  1PTO C;  1CI3 M;  1SYD A;  3T56 B;  1BVS A;  4JI7 L;  1XYI A;  3MVV A;  3MXN B;  4A3C H;  2KVM A;  4IUR A;  1NUC A;  3K8A A;  3RUZ A;  3M85 A;  2ATW A;  4UAI A;  4CGY B;  1HTL D;  3K58 A;  1OXX K;  3EIV A;  3Q23 A;  1RDP D;  1F9Q A;  1X9N A;  3KOJ A;  4R4O A;  2Q2U A;  4JI6 Q;  2N78 A;  3B6Y A;  2JXM B;  1PFM A;  3SK8 A;  1N36 Q;  1U4P A;  3UDF A;  3BDL A;  1M1K C;  2AWO A;  2IX0 A;  3PUV A;  3I4L A;  2K5W A;  1I4H A;  1AW7 A;  1AE2 A;  1HCZ A;  4F8M A;  4PMC A;  3I91 A;  4FF1 A;  1LO5 D;  4L5T A;  3LWU A;  4DA2 A;  4IZ8 A;  4MIU A;  2EOT A;  1Y1W H;  2K1B A;  1HNW Q;  4ME5 A;  3EA6 A;  4DAV A;  4JI3 Q;  5C4Z A;  4RFB A;  3GTL B;  3FKI B;  4DR6 Q;  2B2U A;  1N33 Q;  2KOL A;  3H15 A;  4HJ9 A;  1DOM A;  1FR3 A;  1BXT A;  4XT1 B;  2WII B;  1HQR D;  2PW5 A;  2WV6 D;  4KY6 A;  4APV A;  2HT1 A;  4LF5 L;  2BA1 A;  4OIK A;  4DV6 Q;  3PO3 H;  3QOJ A;  2D9U A;  2AQ1 B;  1LT6 D;  2E2H B;  1C9O A;  4DR4 L;  1QG7 A;  4YCV A;  5ISR A;  3ND9 A;  3CF5 A;  1VQ9 A;  3DHQ A;  3EQL C;  1EZ8 A;  1II3 A;  5J3B A;  2A68 C;  3NQT A;  4A3K B;  1JWU D;  3VYS A;  2LXJ A;  5FLX E;  1TWG H;  3HOU B;  4GKJ Q;  1PYS B;  1SYC A;  1TY0 A;  4DR2 Q;  3CQZ H;  2QEX A;  1AFP A;  2FXQ A;  1YJN A;  4IPG A;  2B2T C;  3QOL A;  4A4I A;  2CH4 A;  4FP5 D;  2NZH A;  2KHS A;  4FNF A;  1JCK B;  5FLX c;  4FXD A;  4BBR H;  3WWV A;  4LF4 Q;  3OMC A;  4S3S A;  3SVM A;  3P1H A;  3ERQ A;  4LFC L;  1YVC A;  2NVY H;  2D0P A;  3WOF A;  4IN3 A;  2JK8 A;  1GD7 A;  2JA5 G;  1AN8 A;  5C4H A;  3CXC A;  1XPU A;  4WOR A;  3SXH A;  3C1F A;  1UE6 A;  1XMQ L;  5K36 H;  3K0Y A;  3M3Y H;  4X62 L;  2SEB D;  1TKW B;  2RQX A;  2AUK A;  4HJ7 A;  5EBD A;  2NN6 G;  4HIO A;  1B3Q A;  4HCE A;  2UUA Q;  1CQV A;  1EWI A;  3D4D A;  4POG A;  4GN5 A;  5M5Y B;  5JPM C;  1I6V C;  2ZXR A;  3WDN A;  5IGC A;  3PUY A;  2UUC L;  1VQM A;  1OXU A;  2XGT A;  3MXG A;  4QQB X;  3K6O A;  5ELE A;  3J80 E;  3RZD B;  3CCQ A;  1QVF A;  3S2H B;  3RNU A;  5C4X B;  5C6A A;  1SYE A;  2I5H A;  3I8Z A;  5DNF A;  4JI0 Q;  5COY A;  3OTO L;  2ES2 A;  1WTH A;  4YY3 Q;  4OX9 L;  4HAE A;  5C0X J;  1GM5 A;  3J80 c;  1F2Z A;  1A8V A;  5EKK A;  1VQ4 A;  3DLL A;  1JOQ A;  1NTG A;  4LUO A;  3EN2 A;  1I3Q B;  5JEA G;  3Q0A A;  2VQE L;  1PZK D;  1PFS A;  1Y69 U;  5ELN A;  3R93 A;  4AYB B;  1HA6 A;  1WTX A;  2X6G A;  1K8G A;  4K2L A;  2MJ8 A;  1XNQ L;  5BR8 Q;  3CCU A;  3HOW H;  4C1N I;  1X55 A;  4QB4 A;  2B2U C;  1Y8O B;  2XTI A;  1GKH A;  4RGO S;  3FKI G;  3CQZ B;  5JJK A;  2KHI A;  2EYF A;  1HZB A;  1KQS A;  2CW0 D;  5E4W C;  4RKB A;  4V19 0;  3NTK A;  2HCC A;  1E7Z A;  5ELF A;  4JOI C;  1EQR A;  1IHZ A;  1D5Z C;  2RA4 A;  1EWH A;  1XPO A;  4Q5V A;  4F88 A;  2NVT B;  1IZ6 A;  1P8L A;  1YIT A;  4BS9 A;  5DM6 3;  2ICE C;  1IXR A;  3QB3 A;  3A5Z B;  3TS2 A;  2RKS A;  3KK7 A;  4GN3 B;  2B63 H;  2LSS A;  4P2C B;  4DXF A;  2CWP A;  4IJL A;  2WB1 E;  4A3K G;  1EEF D;  1EY4 A;  2MP1 A;  1MJE A;  1E22 A;  2H4O A;  2B2Y C;  2PQE A;  4PQX A;  1A62 A;  2SOB A;  3VR2 A;  4A3C G;  5KNC A;  1STA A;  2AMC B;  1C48 A;  1SFO B;  3C3L A;  4DV4 L;  3TBI B;  3FP9 A;  1JC7 A;  1STN A;  3O13 A;  1IBK L;  3H3V H;  3CU7 A;  4KHP L;  3GTK B;  2DGY A;  3PF4 A;  1N9W A;  5A2Q E;  1KD1 C;  1VF5 C;  2R7Z B;  4N8F A;  5C3X A;  1B1Z A;  1FNW A;  3PQI A;  3R3O A;  1G51 A;  4J15 A;  2VZA A;  4K8J A;  1STG A;  4X65 L;  1Q81 C;  1M90 C;  1STY A;  3S1Q B;  1HUN A;  3D3R A;  3GV3 A;  3K5L A;  5CR3 A;  4G7H C;  2ZXP A;  2HD3 A;  4DUZ Q;  2DY7 A;  3DUZ A;  2PO4 A;  1Y1W G;  1HR0 W;  2L0C A;  1GHJ A;  5DEH A;  2JA8 H;  3FPP A;  4B08 A;  2F0G A;  2FMC A;  1GHK A;  4DK0 A;  1K9M C;  5C4X G;  1RTO A;  3IFT A;  4ZAI A;  2TMP A;  1O7Z A;  4EVO A;  2NVX B;  1L0X B;  3C46 A;  2WAC A;  2XN9 C;  5T1I A;  1PH3 A;  3NWT A;  1YIJ A;  4HIK A;  2ZJR A;  2F0P A;  4LMQ D;  2GN5 A;  1CT1 D;  4LF8 Q;  4BBS B;  4DR3 L;  3Q24 A;  2PMZ B;  1XMQ Q;  1KRT A;  4BY1 H;  1IW7 D;  4GS3 A;  2PPB C;  1EUJ A;  1SNP A;  1EY5 A;  3IRB A;  1VQN A;  5C3E H;  2A8V A;  3MAQ A;  3CPF A;  4X66 L;  2I0Q A;  1PH1 A;  3DMU A;  3R2T A;  4A3D B;  4EQN A;  1DOL A;  2K01 A;  1EIH A;  1Z9F A;  4F87 A;  4OWT B;  2XSC A;  2UUC Q;  3PF5 A;  1TWF H;  4ODG A;  5M5X H;  1DD2 A;  3U9S A;  1XJV A;  1SDF A;  5M3F B;  1WTV A;  4BBR G;  5FLM G;  3OTO Q;  5LMN W;  1EIF A;  1E1T A;  3GDE A;  4OX9 Q;  1GOZ A;  1BBX C;  2QKI C;  2K5D A;  3J7Y W;  3R2I A;  4JI1 L;  5K36 G;  1ESF A;  1AP0 A;  3H3V C;  5M3M B;  4GLV B;  2WFW A;  2DJG C;  2MHV A;  1KAW A;  3CMA A;  1SJH D;  4IJH A;  5EPJ A;  3OSO A;  3J7Z C;  1B2T A;  1VQG A;  1U9R A;  1TII D;  2RDF A;  3K80 C;  4C3J H;  1IYJ B;  5EKI A;  4KHZ A;  3VYT A;  3T4A C;  3M4Y A;  4Z9C B;  2IL8 A;  3K5N A;  1BNZ A;  4IUT A;  3H91 A;  4IUU A;  2VS1 A;  4C2M H;  2R7D A;  1MSH A;  3G6E A;  1LTL A;  2UU9 L;  1SLJ A;  1E2Z A;  1B8A A;  4FYD A;  3GTJ H;  4MNO A;  1NR2 A;  4G57 A;  1IYV A;  1VQA A;  2JJQ A;  3UDI A;  4BY7 B;  3QR8 A;  2NB0 A;  2EYL A;  3G71 A;  3UE1 A;  1TWH B;  3E0E A;  2ID0 A;  4A3F H;  4L8J A;  3AYH B;  3A55 A;  1ICF B;  4B3R Q;  1MJC A;  1JWS D;  3M7G A;  1GUT A;  4KD4 A;  2DJF C;  1X3P A;  1D5X C;  1SYF A;  3OOC A;  1HHV A;  1KC8 C;  4H02 A;  4M1U B;  1FNU A;  2A6E D;  1ENA A;  3I90 A;  4Q0F A;  1RKN A;  1LTS D;  1B7Y B;  1VQP A;  1Q8I A;  1QNU A;  4ZRZ A;  3VR3 A;  4TVA B;  4JV5 L;  4DFA A;  1HR0 L;  3CCJ A;  3NPP A;  4KHP Q;  1YNJ D;  1WD1 A;  4DAM A;  1D8L A;  1YEZ A;  1HFG A;  5D65 A;  4YHH Q;  4DV5 L;  2VQF Q;  2JE6 I;  3UI2 A;  2IX3 A;  1LAB A;  3HKZ B;  3ZYY X;  1B3A A;  2R92 H;  3TRZ A;  2KCM A;  3W2D A;  5I2X A;  2O2L D;  3P20 A;  4X3S A;  1TS2 A;  3QIA A;  2L4N A;  2OF1 A;  3BZC A;  2VW9 A;  1YHQ A;  1V1Q A;  4JI2 L;  3SE0 A;  4C3I B;  2HQL A;  4CKB A;  1TVX A;  1XNR Q;  3W5O A;  2CHB D;  3HOX B;  4IPD A;  1ENC A;  4LF6 L;  4C1N K;  4C3J B;  1BUV T;  2F3I A;  5GAH C;  1A2U A;  4JBM A;  5M3F G;  4DR5 Q;  4C3H H;  4OHJ A;  1HXY D;  1WCM B;  4ZLT F;  1U5K A;  3BYY B;  2EE1 A;  1VQF A;  2YV5 A;  4H44 C;  4JG2 A;  1DON A;  4A93 H;  4DR3 Q;  3TZU A;  5LMU L;  1QZG A;  1I94 Q;  3A8I E;  2EZV A;  4OEM B;  5LMN L;  1CM9 A;  3DXJ C;  5G3L D;  3NBI A;  4QIW B;  1Z7T A;  2R93 B;  1B4O A;  2HDM A;  4A3F B;  4L63 B;  3FPU B;  1NBW A;  4KV6 A;  1CKO A;  1X65 A;  5I2Y A;  1ASY A;  2JN4 A;  2A1A A;  2Z4I A;  2EYJ A;  2PCF B;  5EPK A;  1VQ5 A;  3T1H L;  1MI2 A;  3TDQ A;  1J9O A;  2N88 A;  1IBL Q;  2JA8 G;  3HOV H;  4Y7N B;  1MD2 D;  2Z6K A;  4JI5 L;  4I7Z C;  1BF4 A;  1XX8 A;  4RH6 A;  3V2T A;  4JPB W;  2Y0S G;  1OXV A;  3NEL A;  1FL0 A;  2O5I C;  1I50 B;  1N34 Q;  1IBM Q;  1HH2 P;  4DKA C;  2E2J B;  4GKK Q;  3TS0 A;  5JVG 3;  4KKT A;  1EZ6 A;  3MWY W;  4WJW A;  4A3I H;  2QW7 A;  5C3E G;  2CKZ B;  4J6H A;  5CV7 A;  1EYC A;  3I2Z A;  5HUR A;  1W6K A;  1KDB A;  4NPS A;  1JOK A;  3IKJ A;  1KDA A;  4LUZ A;  4X3U A;  1I4Q A;  1K83 B;  1J6Q A;  2DY8 A;  3ERS X;  4ULL A;  2QGQ A;  1E24 A;  2DNC A;  4JC0 A;  3A5U A;  5AJ3 L;  3K0X A;  2D2C C;  1Q46 A;  3FDT A;  3NXW A;  3G4S A;  4A3M B;  1SNQ A;  1EY0 A;  1VQB A;  4OGQ C;  4IPH A;  3TRE A;  1TY2 A;  3I4O A;  2HCI A;  3S16 H;  4B3M L;  4LF7 L;  5IGE A;  4RKL A;  2PNR C;  1IL8 A;  1KDC A;  2QCP X;  1VQJ A;  1WFQ A;  5BN4 A;  1UNS A;  1PDQ A;  2FMM A;  2VB2 X;  4EQ5 A;  2MO1 A;  3I4M H;  1Q12 A;  2F0T A;  3UDG A;  1FJG L;  1GXD C;  4C3J G;  2NZO A;  4RGN A;  2F52 A;  3A0J A;  1SRO A;  1V8Q A;  4QY7 A;  1QCB D;  1XMO L;  1EOV A;  4OWW B;  5C0X I;  3M4O B;  3IL8 A;  1SAP A;  5CV5 A;  4DAY A;  2GA4 B;  3H0G H;  3HZX A;  3E6Z X;  1WVL A;  1HRJ A;  1TWC H;  5CYU A;  1PH5 A;  1WI5 A;  3RZO H;  3STB C;  1OTC A;  1IL2 A;  4NXM Q;  1QWY A;  1TR5 A;  4QUC A;  2A69 C;  4DNI A;  1F2L A;  4IPC A;  4UHV A;  4A3F G;  1SND A;  1SN8 A;  1O80 A;  2F0Q A;  4P73 A;  5IE8 A;  4AQY Q;  2E2D C;  2OWO A;  4X6A H;  4A3J H;  3G7L A;  3K7A B;  1DXM A;  1HUM A;  2Z6K C;  3KJO A;  2FJ2 A;  5JOB A;  5IP7 H;  2AUJ D;  1JE5 A;  1JQY D;  2FFK B;  1H9M A;  3GTO B;  3F1Z A;  3MTS A;  4IO9 A;  3ZJY C;  4JYA L;  1UAP A;  3TP8 A;  4R8I A;  1B50 A;  1H9R A;  3MFG A;  1Q8K A;  1MHW C;  4FF4 A;  2MPM A;  3U9O A;  4DPG A;  1YNX A;  2DUD A;  2KCT A;  1L2F A;  1K73 C;  1A2T A;  4N8X 1;  4I65 A;  2LY7 A;  5M5W H;  2R92 G;  1Q1B A;  2F03 A;  3PUX A;  2K6A A;  2F3V A;  4DF7 A;  4POF A;  3ERO A;  3N52 A;  4A76 A;  3VR6 A;  2G9D A;  1UEA B;  2ZT9 C;  3DWA A;  4DR1 L;  1IKM A;  4IFD J;  2PI2 A;  3I4M B;  4YIJ A;  3NQI A;  4IUN A;  4LFB Q;  3NTH A;  2KA7 A;  1FD7 D;  1PRT B;  4A75 A;  3GTP H;  4ZKB B;  2Q8T A;  4C3H G;  5T1G A;  1J5E L;  4A3M G;  3CC4 A;  3D0F A;  3GTM B;  1PRT C;  3W3A A;  4AH6 A;  4A93 G;  1F77 A;  3E9H A;  1E2V A;  2UUB Q;  4OIJ A;  3Q6S A;  1Y8P B;  2F0H A;  2RCF A;  5I6W A;  1A3U A;  4LAA A;  4NB3 A;  5IOD A;  2L15 A;  4RMF A;  4LF9 L;  1K0S A;  2IPK D;  3L7Z C;  1NJI C;  1BKB A;  2OXP A;  5LL6 S;  4HN7 A;  4DAY B;  4B3T L;  4NP5 A;  4ZUJ A;  1ML0 D;  1KAB A;  3URY A;  3P7J A;  2H5X A;  2KBN A;  5IGF A;  3P75 A;  2EQS A;  2L12 A;  1SMY D;  5IYB H;  5IWA L;  2CW0 C;  2HHH Q;  4UP7 A;  4EX5 A;  2JA7 H;  2M00 A;  5JJZ A;  4CDD C;  3A7A B;  5IGG A;  2Q8I B;  5CGK A;  1KNE A;  5ELC A;  5IYD H;  1F2M A;  2L5T A;  2XRS D;  3K5O A;  5AJ3 Q;  1G29 1;  2ZTD A;  5C4J H;  1PMR A;  1HA5 A;  3C1E A;  1ESR A;  1OO9 B;  3NTI A;  1M8A A;  3J80 i;  1VQC A;  2JA6 H;  4NXN Q;  1ROD A;  3TP5 A;  4RAU C;  2K14 A;  5E7N A;  4LF7 Q;  2UXC L;  4A3I G;  1KHI A;  1S3O A;  1WTP A;  5M5W B;  3RLN A;  1PTO F;  1S5B D;  4MN3 A;  2ZTC A;  1PTO D;  1PV4 A;  4BWG B;  2C5C A;  5IGD A;  5FLX L;  4BXX H;  1RD9 D;  1ZXT A;  2A73 B;  4WRD A;  2HUG A;  2QF7 A;  5BN5 A;  4FDB A;  1VS0 A;  5EPL A;  2EXZ A;  3E3X A;  1XMO Q;  1S5D D;  1Z6H A;  1Y1W B;  4HID A;  1XXG A;  4JK1 C;  5TSS A;  4X64 Q;  5FKA C;  1EY9 A;  1YNN D;  4YCU A;  4PZ8 A;  3JAM E;  2WB1 G;  1HFN A;  2N49 A;  3S17 H;  1X6O A;  3S2D H;  4R9W A;  3W1G A;  3E0J A;  1PH2 A;  3PO3 B;  1U4M A;  2RDH A;  1DCZ A;  2PZT A;  4YCW A;  1DYQ A;  3JAM c;  3EJI A;  4LWC A;  4A3B H;  1SE2 A;  3OPO A;  2F0E A;  3ICE A;  4GNX A;  5GAD C;  1CTM A;  3I4M G;  1K28 A;  4JI7 Q;  2E8G A;  3F2D A;  5EAY A;  5DLQ E;  1TWG B;  1Q1E A;  4DAP A;  3J80 L;  1EIG A;  1K3B C;  1SE3 A;  2F0F A;  1Y1V H;  2R61 A;  5CV9 A;  3PGZ A;  1A15 A;  3H0G G;  1IW7 C;  3AU7 A;  3RLO A;  1X32 A;  4BBR B;  1QUQ A;  4A3E H;  1TXY A;  2KCN A;  3GTQ H;  4HSP A;  4IUQ A;  2LXK A;  3TN2 A;  1HJP A;  1U4L A;  4Y52 H;  2NVY B;  2XVS A;  2Q2H A;  1EQV A;  2JA6 B;  1LLR D;  2TSS A;  1MBY A;  2A68 D;  3GQB A;  4O2D A;  1XTD A;  1Y8N B;  2JEA I;  3M3Y B;  3S1R H;  4TKO B;  3L0O A;  2NUC A;  1E1O A;  4KMU C;  4A3J G;  1ENF A;  3AEV A;  3HOZ H;  4DV3 L;  5E1F A;  2WAQ B;  4DR1 Q;  2K4K A;  5IP7 G;  2F0N A;  2UXD L;  4K0K L;  1G8Z D;  4RA8 A;  4DK3 C;  2NVQ H;  1H9J A;  1ZKO A;  3RR5 A;  3IAY A;  1RIP A;  4CHT B;  4WJ3 M;  1J5E Q;  4HMJ A;  5KND A;  2BCO A;  1KRS A;  2WIN B;  3CHB D;  4HED A;  1RF2 D;  3OW2 A;  4LF5 Q;  3F2U A;  2A6H D;  2KHJ A;  3S17 B;  3PIO A;  4LF9 Q;  4DR4 Q;  4RG1 A; 
#chains in the Genus database with same CATH homology
 3STB D;  5C44 G;  3T1Y Q;  1W2B A;  4DUY Q;  1SR3 A;  1B7Y B;  3HKZ G;  1VQP A;  1T9H A;  1PVO A;  4P74 A;  3TEH B;  2NN6 I;  1C0A A;  3CCM A;  4DV2 Q;  4NXN L;  3VDY A;  4TVA B;  1VQ7 A;  4JV5 L;  2KEN A;  3F2C A;  4DV7 L;  1HR0 L;  4DUZ L;  2Y0S E;  3CCJ A;  4B3M Q;  1YBY A;  4KHP Q;  1P16 A;  4DAM A;  1B70 B;  1D8L A;  2MNA A;  3JAM i;  3DM3 A;  1YEZ A;  1EFW A;  1TWA H;  2F4V L;  1NY4 A;  5FJ8 G;  2RCN A;  3I4N G;  4YHH Q;  4B3S L;  4DV5 L;  5ELO A;  5GAE C;  3CP0 A;  2VQF Q;  3PV0 A;  1NE3 A;  2JE6 I;  2UUA L;  1PH8 A;  5GAG C;  1K8A C;  3HOX G;  3KDF A;  2JQO A;  5FLM H;  4HIM A;  2R92 H;  3TRZ A;  2I5M X;  3EBE A;  1FJG Q;  2KCM A;  2NVT H;  4QGU A;  1X3G A;  3CME A;  1HNX L;  2Q2I A;  4O0A A;  2ZM6 Q;  4GNX B;  2Q2T A;  4LFC Q;  2BH2 A;  3U58 A;  1L1O A;  4LFA Q;  3BZC A;  1AE3 A;  2VW9 A;  4LF8 L;  1YHQ A;  1V1Q A;  1WCM G;  4KLK A;  4X64 L;  4JI2 L;  3PO3 G;  1I6H H;  1NMG A;  1VQ6 A;  1HNZ L;  2HQL A;  2V1C C;  3GTM H;  1SE8 A;  1XNR Q;  3RN2 A;  4X62 Q;  3W5O A;  3CC2 A;  4GNX C;  4L5R C;  4IPD A;  4LF6 L;  3CCS A;  3KFU A;  2F3I A;  5GAH C;  4JBM A;  4LF9 Q;  2A19 A;  3HFZ B;  5M3F G;  1FGU A;  2Z0S A;  4YWL A;  4DR5 Q;  1YJW A;  4C3H H;  5JJI A;  3AFQ A;  3A74 A;  1QUQ B;  3KF6 B;  5IYB G;  2OTL A;  2R93 G;  3ULL A;  3PO2 H;  1NMF A;  4GLX A;  3CCR A;  1U5K A;  1SFO H;  1PH9 A;  1ASZ A;  1EYG A;  4A3G H;  1YHB A;  4JG2 A;  1VQF A;  2K52 A;  2YV5 A;  4A3K H;  3GD7 A;  4A93 H;  2PNH A;  5IYD G;  4UP8 A;  4DR3 Q;  5LMU L;  3F8T A;  1QZG A;  1I94 Q;  4GLA C;  4QJF A;  3GTK H;  1BVS A;  5LMN L;  4JI7 L;  2K5N A;  1SRU A;  2R7Z H;  1VQI A;  1JB7 A;  3MXN B;  4A3C H;  1JMC A;  3M85 A;  3K8A A;  2ATW A;  2B29 A;  1NBW A;  2JA6 G;  1CKO A;  1X65 A;  3I56 A;  1LYL A;  1OXX K;  5HY6 A;  3EIV A;  1ASY A;  2A1A A;  1VQ5 A;  3T1H L;  3S1Q H;  4JYA Q;  5JEA J;  1X9N A;  2VQE Q;  1YHA A;  1IBL Q;  3CD6 A;  3PCO B;  2JA8 G;  3KOJ A;  3HOV H;  2Z6K A;  4R4O A;  2Q2U A;  2N78 A;  4JI5 L;  4JI6 Q;  2UXB Q;  1G6P A;  3B6Y A;  3S14 H;  2WAQ G;  2PQA B;  4BXX G;  1N36 Q;  2RHQ B;  3UDF A;  4JI8 L;  1M1K C;  2Y0S G;  1XNQ Q;  1OXV A;  1Q86 C;  3NEL A;  4R4T A;  5GRO A;  1YJ9 A;  2AWO A;  1FL0 A;  2IX0 A;  3PUV A;  1N32 Q;  2YTX A;  4R4C A;  1N34 Q;  1IBM Q;  1HH2 P;  2CCZ A;  2NVX H;  4A3L H;  4DKA C;  4GOP A;  4GKK Q;  1AE2 A;  1VCI A;  3TS0 A;  2VUM G;  1A63 A;  4L5T A;  2IX1 A;  2JA9 A;  4A3I H;  1K3R A;  4JBJ A;  1LM0 A;  4JI4 L;  1Y1W H;  1HNW Q;  2K5H A;  1CSP A;  4BBS H;  4JI3 Q;  3I4N H;  5C3E G;  2CKZ B;  5JJL A;  4DR6 Q;  3I2Z A;  1I5F A;  1N33 Q;  3GTG H;  4NPS A;  3H15 A;  4HJ9 A;  4LUZ A;  2IY5 B;  2HIV A;  4JBK A;  4AYB E;  1J6Q A;  3NBH B;  3ERS X;  1O7I A;  3KDF B;  4APV A;  4A3B G;  2HT1 A;  2QGQ A;  3L2P A;  1E24 A;  4LF5 L;  4A3D H;  2BA1 A;  4B3R L;  1U0L A;  4JC0 A;  3A5U A;  4DV6 Q;  3HOU G;  3PO3 H;  5AJ3 L;  3K0X A;  1MKH A;  3RLF A;  4L5Q A;  3UE0 A;  1L1O B;  1C9O A;  1Q46 A;  2EIF A;  3F2B A;  4YCV A;  4DR4 L;  3HOW G;  2VY3 A;  3G4S A;  3CF5 A;  3M4Q A;  3T1Y L;  1VQ9 A;  3S24 A;  4DUY L;  5J3B A;  3BJU A;  3S15 H;  4B3T Q;  1VQB A;  4IPH A;  5M3F H;  3TRE A;  3ULP A;  3K81 C;  3I4O A;  4DV4 Q;  1A0I A;  3S16 H;  2LXJ A;  1JT8 A;  1L1O C;  1VQE A;  3KYH C;  1TWG H;  1UE1 A;  1L0W A;  4DV1 Q;  1Q82 C;  1IBK Q;  4B3M L;  5IWA Q;  4LF7 L;  4GKJ Q;  1PYS B;  1RL2 A;  4DR2 Q;  3CQZ H;  2E5L Q;  3M7N A;  2QEX A;  3Q8D A;  2GVA A;  2FXQ A;  3ULJ A;  4A3E G;  1YJN A;  4IPG A;  4A4I A;  1VQJ A;  1WFQ A;  4YHH L;  1H95 A;  2VQF L;  2NZH A;  4IOA A;  3CW2 C;  5FLX c;  4EQ5 A;  2MO1 A;  3I4M H;  5M3M H;  1Q12 A;  4BBR H;  1N8R C;  3UDG A;  2E2I H;  2OQ0 A;  1S40 A;  1FJG L;  3WWV A;  4LF4 Q;  2NZO A;  2ZM6 L;  2F52 A;  2B63 G;  4X65 Q;  4LFC L;  1HZC A;  3A0J A;  1YVC A;  2NVY H;  1SRO A;  2D0P A;  3HKS A;  4QY7 A;  2BA0 A;  4LFA L;  1HZA A;  1GD7 A;  2CWA A;  2JK8 A;  1EOV A;  4PMW A;  3CXC A;  1XMO L;  2JA5 G;  1XPU A;  3LGJ A;  4OWW B;  2B3G A;  4MZ9 A;  5C0X I;  3HOZ G;  1UE6 A;  1XMQ L;  1Q7Y C;  1KIX A;  1XNR L;  2UXC Q;  3M3Y H;  4X62 L;  3H0G H;  2ASB A;  1TWC H;  2F4V Q;  1PH5 A;  1WI5 A;  4HJ7 A;  2NN6 G;  3RZO H;  4HIO A;  1OXS C;  3STB C;  1OTC A;  2UUA Q;  4DR5 L;  1IL2 A;  3HOY H;  4NXM Q;  1EWI A;  5IYC H;  1QVG A;  2MFI A;  4DNI A;  4POG A;  4GN5 A;  3PUW A;  2D0O A;  4IPC A;  2WP8 J;  3MEF A;  4A3F G;  2OTJ A;  4LW1 A;  1SN8 A;  1DGS A;  5IE8 A;  4P73 A;  4AQY Q;  3AQQ A;  4DV0 L;  3M9B A;  2JA7 G;  4BY7 H;  2R6G A;  3PUY A;  1FVI A;  1UE5 A;  4PG3 A;  1VQM A;  2UUC L;  1OXU A;  2XGT A;  2OWO A;  3S1N H;  1X3E A;  4A3J H;  1TWH H;  4QQB X;  4X6A H;  1I94 L;  2OQK A;  3CCQ A;  1QVF A;  2Z6K C;  3RNU A;  3KJO A;  1GO3 E;  5IP7 H;  2I5H A;  4GOP B;  4ALP A;  4AYB G;  4JI0 Q;  1JE5 A;  3OTO L;  2ES2 A;  4UY8 C;  3J7A 5;  4TQU S;  2OCE A;  4YY3 Q;  4OX9 L;  3CPW A;  2IT1 A;  4XTC S;  5C0X J;  4X66 Q;  1GM5 A;  4DK6 C;  3J80 c;  5IP9 H;  2K75 A;  3F1Z A;  4IO9 A;  1A8V A;  2MO0 A;  3ZJY C;  1VQ4 A;  3BZK A;  3DLL A;  4PZ7 A;  1SMX A;  4JYA L;  1NTG A;  4LUO A;  2RF4 A;  3EN2 A;  5JEA G;  2VQE L;  1IBL L;  1PFS A;  1Q8K A;  3KLW A;  1XPR A;  1EIY B;  4JI6 L;  4XIG S;  5ELN A;  4ME3 A;  3JC6 6;  4DPG A;  1YNX A;  1VQH A;  2DUD A;  2KCT A;  1L2F A;  1N36 L;  1K73 C;  1K8G A;  3CCL A;  4JCV E;  2ZTE A;  5M5W H;  1XNQ L;  5BR8 Q;  3CCU A;  2R92 G;  3HOW H;  1Q1B A;  1X55 A;  2YU9 H;  2XTI A;  3PUX A;  5C44 H;  1GKH A;  1N34 L;  1IBM L;  3CC7 A;  3FKI G;  4PZ6 A;  3W1B A;  1BBU A;  4POF A;  3CCE A;  4A76 A;  5JJK A;  2KHI A;  4GKK L;  1HZB A;  4JI1 Q;  1KQS A;  3K7U C;  1GVP A;  4DR1 L;  4DR7 L;  4BY1 G;  4IFD J;  1E7Z A;  3PSI A;  2PI2 A;  4JOI C;  1EQR A;  3J81 i;  3UDX A;  4R4Q A;  3PIP A;  1HNW L;  1XPO A;  3KF6 A;  2PI2 E;  4JI3 L;  4LFB Q;  1IZ6 A;  1E3P A;  1P8L A;  2IHF A;  2K5V A;  5FJ8 H;  4C3I H;  1YIT A;  1IXR A;  4A75 A;  3GTP H;  3A5Z B;  1VQK A;  3TS2 A;  2HIX A;  4AIM A;  4GN3 B;  1R9T H;  2K50 A;  3HOX H;  1N33 L;  1J5E L;  1W3S A;  2ALY B;  4A3M G;  3CCV A;  3CC4 A;  2LSS A;  2B63 H;  3PO2 G;  1CKM A;  3D0F A;  4HJA A;  1PH7 A;  1PYB A;  2CWP A;  4IJL A;  2WB1 E;  4YWM A;  4AH6 A;  4A3K G;  2JA5 H;  4A93 G;  1WCM H;  3E9H A;  4GN4 B;  4DV6 L;  1MJE A;  2UUB Q;  1E22 A;  4DV3 Q;  1BBW A;  4NB3 A;  2L15 A;  4RMF A;  4JI4 Q;  3ER0 A;  1A62 A;  2UU9 Q;  4LF9 L;  2UXD Q;  4K0K Q;  3L7Z C;  1NJI C;  4OON A;  1BKB A;  2R7Z G;  5H1S E;  4A3C G;  4P72 A;  4DAY B;  2AMC B;  1YZ6 A;  1PA6 A;  4B3T L;  2VNU D;  2MQH A;  4DV4 L;  4DV2 L;  1Y1V G;  2H5X A;  3FP9 A;  2KBN A;  2EQS A;  5IYB H;  1WOC A;  3KF8 B;  2BH8 A;  5IWA L;  1IBK L;  3H3V H;  2R93 H;  3GO5 A;  4UP7 A;  4EX5 A;  2HHH Q;  4KHP L;  2JA7 H;  2DGY A;  3J81 c;  3PUZ A;  1QZH A;  3PF4 A;  1N9W A;  2VL6 A;  1KD1 C;  5IYD H;  5AJ3 Q;  2IHE A;  1G29 1;  2ZTD A;  5C4J H;  3FHW A;  2CFM A;  1G51 A;  3I7F A;  2VZA A;  4J15 A;  4OWX B;  1PHJ A;  1EQQ A;  4Y7N H;  4P75 A;  4LF4 L;  1AH9 A;  2D62 A;  4X65 L;  1Q81 C;  1VQO A;  1M90 C;  4A3L G;  2AKW B;  3BU2 A;  5HGQ A;  2WAQ E;  1JJC B;  3J80 i;  1VQC A;  2JA6 H;  4NXN Q;  4JV5 Q;  1S72 A;  2K14 A;  4DV7 Q;  5E7N A;  1HR0 Q;  1I50 H;  1WJJ A;  4DUZ Q;  4LF7 Q;  1UWV A;  3AFP A;  4A3I G;  2UXC L;  4QL5 A;  1KHI A;  1S3O A;  2EXD A;  4IOC A;  3RLN A;  4HJ8 A;  1Y1W G;  3U4Z A;  1HR0 W;  2E2J H;  5IT9 c;  3H3V I;  2ZTC A;  4BBS G;  4JBW A;  2JA8 H;  1YI2 A;  1PV4 A;  4B3S Q;  4DV5 Q;  1K9M C;  5C4X G;  4BXX H;  1VQD A;  4NXM L;  2AHO B;  1OXT A;  3NEN A;  2N3S A;  3G48 A;  4FDB A;  1CKN A;  1PH3 A;  2YTY A;  1YIJ A;  4HIK A;  1VS0 A;  1HNX Q;  3GTL H;  2ZJR A;  2CQO A;  3FKI H;  4AQY L;  2GN5 A;  3U4V A;  1XMO Q;  4A3D G;  4LF8 Q;  4HID A;  3S1M H;  4DR3 L;  4X64 Q;  2VUM H;  1HZ9 A;  4JI2 Q;  1XMQ Q;  1HNZ Q;  1KRT A;  4BY1 H;  1K83 H;  4GS3 A;  2GVB A;  4YCU A;  1EUJ A;  4JI0 L;  1WYD A;  3IRB A;  4PZ8 A;  4LF6 Q;  1VQN A;  4IFD I;  2WB1 G;  5IY0 A;  5C3E H;  3E9I A;  4YY3 L;  2A8V A;  3CPF A;  1K0R A;  2N49 A;  2E2H H;  1X3F A;  4X66 L;  5C0X G;  2I0Q A;  1PH1 A;  3S17 H;  1UE7 A;  1X6O A;  3S2D H;  1X54 A;  3W1G A;  4A3M H;  1PH2 A;  1Z9F A;  4GOP C;  3SGI A;  4YCW A;  4DV0 Q;  1VQ8 A;  4OWT B;  2N8N A;  1PH6 A;  3OYY A;  3JAM c;  2UUC Q;  3PF5 A;  1TWF H;  4LWC A;  4A3B H;  5M5X H;  3HKZ E;  1D7Q A;  2UXB L;  4L5S A;  5GQO A;  3HOU H;  3ICE A;  1XJV A;  4GNX A;  3D31 A;  5LMU Q;  2ZJQ A;  5GAD C;  2I5L X;  3I4M G;  5BR8 L;  5M3M G;  4BBR G;  5LMN Q;  2E8G A;  4JI7 Q;  3F2D A;  5FLM G;  4UP9 A;  3OTO Q;  5EAY A;  5DLQ E;  5LMN W;  1N32 L;  4KI0 A;  1EIF A;  1E1T A;  1Q1E A;  3GDE A;  4OX9 Q;  2QA4 A;  2PMZ E;  4LNQ A;  1Y1V H;  2YYZ A;  3M4P A;  4JI1 L;  3J81 j;  2YTV A;  3I55 A;  3PGZ A;  4BA1 I;  1V43 A;  5K36 G;  4IFD G;  3T1H Q;  1UEB A;  3H0G G;  4LUV A;  3RLO A;  2WFW A;  4GLV B;  4R1J A;  1KAW A;  1QUQ A;  3CMA A;  1TXY A;  4A3E H;  3GTQ H;  1JJ2 A;  3M4O H;  4JI5 Q;  4LFB L;  2LXK A;  2RHS B;  1HJP A;  3HOY G;  4Y52 H;  4DR6 L;  4IJH A;  5IYC G;  1JJG A;  4JI8 Q;  1Z47 A;  2Q2H A;  3TQY A;  3J7Z C;  1VQG A;  4YWK A;  3K80 C;  4C3J H;  1IYJ B;  4O2D A;  4BY7 G;  1XTD A;  4KHZ A;  4BA2 I;  4OO1 I;  2JEA I;  4A3G G;  1KXL A;  3S1R H;  3L0O A;  4MTN A;  1E1O A;  4A3J G;  5M5Y H;  2UUB L;  1KL9 A;  3AEV A;  3HOZ H;  4DV3 L;  4DR1 Q;  2VS1 A;  4C2M H;  2K4K A;  4DR7 Q;  4QIW E;  2R7D A;  5IP7 G;  4UPA A;  3G6E A;  4OXP A;  1LTL A;  1C7Y A;  2UU9 L;  1SLJ A;  4K0K L;  1B8A A;  2UXD L;  3GTJ H;  4MNO A;  4DK3 C;  2NVQ H;  3K7A H;  3RZD H;  1VQA A;  3RR5 A;  3NEM A;  2JEB I;  2JJQ A;  5C4X H;  3UDI A;  3S2H H;  1RIP A;  1X56 A;  1CSQ A;  4HJ5 A;  3U50 C;  4WJ3 M;  1J5E Q;  5IP9 G;  3G71 A;  1PH4 A;  1V9P A;  1CUK A;  3KJP A;  4R4I A;  3UE1 A;  2R7F A;  4DV1 L;  3E0E A;  2PQA A;  1KRS A;  2ID0 A;  4P71 A;  3RN5 A;  4A3F H;  4DR2 L;  2HHH L;  4GKJ L;  2E5L L;  3GTO H;  1VQL A;  1Y14 B;  3AYH B;  2ZJP A;  2C35 B;  3OW2 A;  1MJC A;  1CKN B;  4JOI A;  4LF5 Q;  3HOV G;  2KHJ A;  4B3R Q;  3CAM A;  4WJ4 A;  1LUZ A;  2AWN A;  1I3Q H;  1KC8 C;  1QVC A;  4H02 A;  3PIO A;  4DR4 Q;  1MIU A;  4RG1 A;  4OO1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...