4YY3Q

30s ribosomal subunit- higb complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 21
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4yy3Q00
2QGQA 2WP8J 1DGSA 3ERSX 4X64Q 1EQQA 2HQLA 5HY6A 4JI1L 4DK6C 1SFOH 2MQHA 4JI5Q 3S15H 1X55A 2NVQH 4DR6Q 1WJJA 2R92G 4L5SA 1FJGL 4Y7NH 3PSIA 2ZTCA 4DR3L 2A19A 5IYBH 2HHHQ 2K14A 1E1TA 4DV5L 1N36Q 4NB3A 1SRUA 4POFA 4HIKA 4A3JG 1VQFA 4JI1Q 4IFDG 4A3KH 1TXYA 4FDBA 2ZJPA 3S14H 2LSSA 3LGJA 2BA1A 3PCOB 4BY1G 2F52A 3G4SA 1Y14B 3I55A 1PA6A 4KI0A 1FJGQ 4LUVA 4DR3Q 1XMOL 1R9TH 3KDFA 1PFSA 4DV5Q 1JE5A 3KLWA 4A3LG 2N8NA 3UE0A 1EWIA 1VS0A 1U0LA 1A8VA 2WAQE 3CQZH 5FLMH 1W3SA 3S24A 5IYCH 2ES2A 3U50C 2OTLA 4GS3A 5M5YH 3S2DH 3H0GG 3UDXA 1Q8KA 1D7QA 1TWAH 4DKAC 3CC2A 4WJ3M 1I6HH 2JEBI 4AH6A 1L1OA 1XMOQ 1JJ2A 3RNUA 2JA6H 2HIVA 4UP7A 1L1OC 3CCMA 2CWAA 1NY4A 4XIGS 2H5XA 4HIDA 5M3MG 1K73C 2YV5A 3HOYG 2AMCB 3GTPH 1Q1BA 2IT1A 5BR8L 3J80c 1FVIA 3MEFA 1VQ5A 2L15A 4IJHA 1VQCA 2CKZB 3J81j 3G71A 2VY3A 1A63A 4DV7L 1C7YA 2KCTA 4JC0A 3TREA 3HKZG 3AQQA 1L0WA 2JE6I 2AKWB 1SE8A 2JA5G 3NBHB 4GNXB 1YBYA 3RLOA 3GDEA 4LF4L 4OWWB 3S1QH 4JI3L 1KRSA 4POGA 1K0RA 3E9HA 4QL5A 4OWTB 4DR2L 5GAHC 4BBRH 4DV7Q 2F4VQ 4P74A 5GROA 5AJ3Q 1NMFA 3K7AH 3KF8B 4DPGA 4LF6L 1Y1VG 4LF9L 4UY8C 5IT9c 3HOVH 4A3GG 1YHBA 3BJUA 3RN2A 1YEZA 3RLFA 3CCUA 4JI3Q 4LF4Q 3CCJA 3Q8DA 1PH3A 4IOAA 2R93G 2D62A 4P75A 4LFCL 3CPFA 3J81c 4L5QA 4LF6Q 4LF9Q 4A3MH 1Y1WH 4OONA 2BH2A 5M3FG 2Q2IA 2E2IH 3I4MG 2JA8H 1KXLA 1NE3A 4JI8L 1EIFA 1IBLL 3PUYA 3BZKA 4X62L 4LUZA 2A8VA 4AYBG 3F2CA 3F2BA 1VQ6A 2MNAA 2Z0SA 3J7ZC 4A3BG 4LFCQ 4OO1I 2ALYB 1EYGA 1NTGA 3CC7A 2AWNA 1YI2A 4YCWA 3S1MH 1N33L 2IY5B 4JI8Q 1IBLQ 1H95A 2LXKA 4O2DA 1UEBA 4MNOA 4X62Q 4GKKL 1A0IA 1X9NA 2JJQA 2ZJQA 1KQSA 1HR0W 2R92H 4A3DG 2PI2A 1YIJA 2JEAI 4DV2L 1PH2A 4GLVB 2HIXA 1N33Q 3PGZA 1IZ6A 4P73A 1YJWA 4PZ6A 4JI4L 1D8LA 4A3JH 2KHIA 1HNWL 3KFUA 1UE6A 2D0OA 3NELA 2RF4A 3CF5A 3KF6A 1K9MC 1TWHH 4BY1H 1JMCA 1YHAA 1VQKA 1PHJA 4DV2Q 2WB1E 5GAEC 4OO1G 2CFMA 4L5RC 4A3EG 1A62A 1E7ZA 1LM0A 3CCRA 1XJVA 1VQMA 1V9PA 1HZBA 3CAMA 3PUWA 3PO2G 2E2HH 3DLLA 2R7ZG 3H0GH 3U4VA 4AYBE 3CCQA 5ELNA 1G6PA 4JI0L 4IO9A 4X66Q 3M3YH 1I50H 1E22A 2ZTDA 1X3FA 3SGIA 1KAWA 2N49A 5M3MH 4GN5A 4GKJL 3K81C 4DAMA 4LF8Q 1YJNA 3L7ZC 2B63H 4JI0Q 2OQKA 3M4PA 4LFAQ 4AIMA 2UUCL 1XNQL 2OQ0A 4ME3A 1Q46A 3T1HL 3IRBA 4QGUA 3HOXG 2NVTH 1OXVA 3CW2C 1BKBA 3GTJH 2JA5H 5C0XI 2FXQA 2K52A 3UDFA 3T1YL 5GADC 3KJOA 4B3SL 3D31A 3NENA 4DUYQ 1VQIA 4R4TA 1K83H 4P71A 1VQ4A 4DK3C 1HR0L 4QQBX 1SN8A 3CCVA 4J15A 2K5HA 1KD1C 2EXDA 1M90C 1GM5A 2B3GA 2UUCQ 1XNQQ 1B7YB 3UDIA 5IYDG 3T1HQ 4BA2I 4YCUA 1N34L 3I4OA 1S3OA 2K75A 3KYHC 4LW1A 4GOPB 3F1ZA 1VQGA 1Y1VH 2JQOA 4BXXG 4A3GH 1GD7A 2K5VA 5GQOA 5IP9G 3A5ZB 5C4JH 3ICEA 4YCVA 2BH8A 1HR0Q 2UXDL 5JJLA 5C3EG 2B29A 2VW9A 2E8GA 3FP9A 4DV4L 1JB7A 2R93H 1AH9A 3RN5A 3K0XA 4QJFA 4JBKA 1N34Q 4DNIA 1UWVA 3STBC 4HJ9A 2E5LL 3VDYA 1EFWA 5M3FH 3I4MH 1K8GA 4GNXA 4LFBL 2RHQB 1XTDA 1MIUA 3BZCA 1I5FA 1KHIA 2UXDQ 1E1OA 2CQOA 3E9IA 4A75A 4DV4Q 1T9HA 4A3BH 4HJAA 2V1CC 2ZJRA 2EIFA 1PH1A 5FJ8H 2E5LQ 1X3GA 1I3QH 3AFPA 1XMQL 4PMWA 1X3EA 3HOUG 3PO3H 4LFBQ 1MJCA 1WYDA 1X56A 1Q86C 1NMGA 4JI2L 2C35B 1FL0A 4IPDA 4A3DH 1AE2A 2I5LX 3OTOL 2PNHA 5BR8Q 4DR7L 1XMQQ 3J80i 3S1RH 3D0FA 2ASBA 1PH7A 2CCZA 1CKMA 1XPUA 3GTGH 1CKNA 4RG1A 4A76A 1J6QA 1YHQA 2ATWA 1B8AA 4JI2Q 2UXCL 1L2FA 1OXXK 2NZHA 2AWOA 2XGTA 5J3BA 3GTQH 2BA0A 1X65A 3OTOQ 4DR7Q 3GTKH 1I94L 5H1SE 4A3EH 1N32L 4DR2Q 3UE1A 1S72A 5C44G 4A3CG 1QVCA 1VCIA 5K36G 4YWMA 1QVGA 3OYYA 3CCSA 2UXCQ 3TEHB 1JT8A 3PO2H 2WB1G 1SMXA 2Q2UA 5C0XJ 2R7ZH 3PIOA 1PH5A 1VQLA 3GD7A 1I94Q 1VQOA 3PUZA 4A3IH 2IX1A 3H3VI 1VQ8A 1PH9A 4JV5L 3CXCA 1PYSB 4BY7G 2K50A 1VQ9A 3WWVA 3HFZB 4DR1L 4KHZA 4A3KG 1WFQA 3J81i 3AFQA 3PIPA 5EAYA 1KRTA 4B3ML 1JJCB 4L5TA 1X54A 3CPWA 4NXML 3M7NA 1G291 4A93G 1VQDA 3HOXH 4IPCA 4DV1L 4JOIA 4EQ5A 4DR5L 2E2JH 4DR1Q 2R6GA 2GVAA 4KLKA 3TS0A 1XPOA 3ULLA 1HNZL 4B3MQ 1XNRL 4BBSG 1Z47A 3U58A 4NXMQ 5IYDH 4GN4B 1QUQB 5M5XH 5IP7G 2KHJA 1BBUA 4DV1Q 4BXXH 4GKKQ 2OCEA 4JG2A 3S16H 1Q12A 4X6AH 5IP9H 3STBD 3JAMc 4DV0L 5IE8A 2KBNA 2VUMG 4C3IH 3RR5A 1BBWA 1EQRA 4X65L 5C3EH 1HNZQ 1M1KC 3M85A 4WJ4A 4A4IA 2DUDA 3S17H 3L0OA 2ZM6L 1YJ9A 4A3LH 2MO0A 2NZOA 4PZ7A 4JI4Q 2F3IA 1HNWQ 2RCNA 1UE1A 3RZDH 4JBWA 4LUOA 4HJ8A 4DV6L 2KCMA 3EBEA 4QIWE 5E7NA 1NJIC 4X65Q 1Q81C 3TS2A 4APVA 2N3SA 3FHWA 2ZM6Q 3ULPA 1GVPA 2I0QA 3HOYH 1KL9A 4B3RL 1WOCA 2IHFA 3AEVA 1EIYB 1K3RA 3H15A 4GOPA 4R4CA 3A0JA 3HOUH 3HOZG 1E3PA 4OXPA 3I4NG 1BVSA 2Q2HA 1U5KA 2PQAB 3A74A 3J7A5 4IPHA 4LF7L 4OWXB 1SROA 4GKJQ 5IY0A 4JCVE 3EN2A 3KJPA 4B3RQ 4KHPL 2ID0A 1C9OA 1G51A 2QEXA 1HZ9A 2MFIA 4OX9L 3M9BA 1J5EL 3HOWG 5ELOA 4Y52H 2GN5A 4LF7Q 1CKOA 1VQEA 4B3SQ 3T1YQ 2JA7G 4KHPQ 1ASYA 4DR6L 1KC8C 4OX9Q 1S40A 4R1JA 2Q2TA 3G6EA 1SR3A 5C44H 3CCLA 1YNXA 3M4QA 4A3CH 1QZHA 5JJIA 1J5EQ 1O7IA 2DGYA 3W1GA 4TVAB 1N36L 2NN6I 1FGUA 3I7FA 3PV0A 5M5WH 4B3TL 4JI6L 1GKHA 1Q82C 1WCMG 5GAGC 1HNXL 4DR4L 3DM3A 2Y0SG 2NVYH 3RLNA 1TWCH 4UP9A 2UUAL 1VQPA 1EUJA 3ER0A 3E0EA 3K7UC 5C0XG 4GNXC 4MZ9A 4YWKA 1LTLA 3G48A 1UE7A 3I56A 4B3TQ 2IHEA 4DR4Q 4JI6Q 3FKIG 4HJ5A 4IOCA 1VQ7A 3M4OH 4BY7H 4JYAL 1HNXQ 1HZCA 3PUVA 1IYJB 2ZTEA 1IBKL 1RIPA 1Q7YC 3KOJA 2UUAQ 1PYBA 1C0AA 1E24A 3CC4A 1V43A 1GO3E 1LUZA 4A93H 1HZAA 1B70B 2YTYA 3JC66 3PUXA 1MKHA 4A3FG 1VQAA 5C4XG 4GN3B 4JYAQ 1NBWA 2K5NA 1IBKQ 2NN6G 3MXNB 1YZ6A 2JK8A 4BBSH 5HGQA 2MO1A 3OW2A 2HT1A 5IP7H 5JEAJ 4O0AA 1PH4A 4K0KL 2D0PA 2N78A 3H3VH 5FLXc 2VUMH 3EIVA 2B63G 1QZGA 2WFWA 2QA4A 3KDFB 2Y0SE 4DAYB 4MTNA 3L2PA 2F4VL 2UUBL 3W1BA 5LMUL 5LMNL 3TRZA 4K0KQ 5AJ3L 1PH8A 2YU9H 2VS1A 2Z6KA 1CSQA 1CSPA 3AYHB 2Z6KC 4NXNL 2UU9L 1L1OB 1ASZA 4JI7L 1P16A 1N32Q 5IYBG 4R4IA 2UUBQ 4IFDJ 2NVXH 4LWCA 5LMUQ 1HH2P 1OXSC 2R7FA 1YITA 5LMNQ 1PH6A 1LYLA 2I5MX 1QVFA 1QUQA 2CWPA 3CCEA 1JJGA 1PV4A 3F2DA 1UE5A 2RHSB 3HOZH 1IL2A 4LF5L 3PF5A 3I4NH 4NXNQ 3S2HH 2UU9Q 4HJ7A 1OXTA 3NEMA 3F8TA 4R4QA 4NPSA 4RMFA 4JI7Q 1KIXA 1PVOA 2VL6A 2VQEL 1SLJA 1W2BA 2OWOA 4JV5Q 1EOVA 1IBML 4JOIC 2XTIA 3B6YA 4UPAA 1CUKA 1X6OA 5FLMG 3CMEA 3GTMH 1YVCA 3CMAA 5IYCG 2EQSA 4LF5Q 3PF4A 1CKNB 3HOWH 3GTOH 3K80C 2JA6G 1AE3A 4TQUS 5DLQE 2VQEQ 3HKSA 4YWLA 1IBMQ 2JA7H 4DR5Q 3S1NH 3CD6A 5FJ8G 3HKZE 4LNQA 1TWFH 1N9WA 2PI2E 3CP0A 3W5OA 1XNRQ 5IWAL 4XTCS 3PO3G 4IJLA 4JBJA 2VQFL 1WCMH 4DV3L 2A1AA 2PQAA 3K8AA 3GTLH 4QY7A 1OTCA 4DV0Q 4GLXA 2I5HA 1Q1EA 1OXUA 3JAMi 2R7DA 1VQJA 2GVBA 4ALPA 1MJEA 4JBMA 4C3HH 4BBRG 1V1QA 5IWAQ 1P8LA 4HIMA 4DUZL 2YYZA 3FKIH 2VQFQ 4DV3Q 4H02A 2K4KA 1WI5A 4GLAC 5JJKA 3TQYA 3U4ZA 3HOVG 1VQBA 1RL2A 4X66L 4IPGA 4DV6Q 4HIOA 4GOPC 2VZAA 1N8RC 4P72A 2OTJA 4A3FH 4DUZQ 1IXRA 2PMZE 5C4XH 2UXBL 3BU2A 4LF8L 3I2ZA 4YY3L 1VQNA 3RZOH 4AQYL 3ZJYC 4A3MG 4UP8A 1Y1WG 4C3JH 4YHHL 4LFAL 2JA8G 2YTVA 2IX0A 2AHOB 2WAQG 4PZ8A 4BA1I 3ULJA 1VQHA 4A3IG 4IFDI 3KF6B 4X64L 4R4OA 2UXBQ 2KENA 3UDGA 2VNUD 5JEAG 4JI5L 4DUYL 1TWGH 2JA9A 2LXJA 3GO5A 4PG3A 4YY3Q 1Z9FA 3A5UA 1K8AC 4AQYQ 4EX5A 2YTXA 2HHHL 1HJPA 4YHHQ 4C2MH 5LMNW 1XPRA
chains in the Genus database with same CATH superfamily
2WP8J 1DGSA 5ELFA 5HY6A 1SFOH 4JI1L 2SNSA 1X55A 5M3FB 4DR6Q 3VR3A 3A8KE 4L5SA 4NP5A 1N36Q 1SRUA 2KJXA 4POFA 4A3BB 3E3XA 2K7VA 4JI1Q 1LTAD 2K5DA 5E4XA 3DEOA 3PCOB 2F52A 4LUVA 5KIXA 5JPNC 1B2TA 4DAYA 3KLWA 4A3LG 3TN2A 2N8NA 4IUPA 3UE0A 3WDNA 1EWIA 4PV1C 4A3DB 2SNMA 5KGUA 2EYOA 3S2DH 3UDXA 1Q8KA 1TWAH 4WJ3M 3QB3A 4RCOA 4AH6A 1L1OA 1CZGA 2YV5A 3NWTA 1Q1BA 5BR8L 3J80c 1FVIA 2XRQD 4TKOB 3FRPB 3K58A 2CKZB 3OIQA 2BDNA 2VY3A 5CC4A 1OO9B 2F0MA 3S9WA 2KCTA 4JC0A 3TREA 5EKLA 5KNCA 2JE6I 3GDEA 4OWWB 4JW0A 2R93B 5GAHC 1BUVT 4KKUA 1ENFA 4LF6L 3HOVH 3H91A 2NWGA 4IUQA 3U9OA 3I4NB 3RN2A 3CCUA 2Z4HA 2G9HD 3NWSA 5CORA 2RDGA 4IUVA 5JVH3 4LF6Q 5CR3A 1AEXA 1G2SA 1LT3D 1KXLA 4X62L 3BG3A 4G57A 4V190 1EYGA 4K2KA 5IODA 5ELEA 3K57A 4C3IB 1TWFB 5C3EB 4K6DA 2LXKA 1Y8PB 1UEBA 4O2DA 4X62Q 2F3VA 1X9NA 2JJQA 2ZJQA 1HR0W 3BVGA 5L37A 1PH2A 4GLVB 1YJWA 1HNWL 1A3VA 5FKAC 2D0OA 3CRLC 2RF4A 3KF6A 3V2TA 1QCBD 1YHAA 1SSOA 1PHJA 2WB1E 2Q8IB 4L5RC 3I73A 1DYQA 1E7ZA 1UEAB 2EOTA 2F0OA 4Q5VA 3H0GH 3GQBA 5C4HA 3NK9A 1ESRA 4X66Q 2Z4IA 3MHBA 1E22A 4HR7B 4CDDC 2ZTDA 4G4KA 4GN5A 4GKJL 1Y8NB 4ZCKA 1YJNA 1EZ8A 2MPMA 1JORA 4LFAQ 3TP8A 2FMMA 1Q46A 2F3WA 1OXVA 3CW2C 2FXQA 4DUYQ 1HPCA 1TIID 1K83H 3T56B 4QQBX 3CCVA 4H7BA 4FXGC 5JAVA 1Z7TA 3LX0A 1VQGA 1Y1VH 2JQOA 4A3GH 1GD7A 5GQOA 5IGCA 3ICEA 1AFPA 1D1IA 1O78A 2NTTA 2QCPX 3A7AB 4OGQC 1JB7A 4QJFA 4QUFA 1UWVA 1KDCA 3VDYA 3I4MH 1IHZA 1K8GA 4C56C 4BBSB 1MGSA 2RDHA 1JQYD 2I07B 4U673 3SR1A 2RCFA 2ZJRA 3GTPB 3EVQA 1GUNA 1X3GA 3AFPA 1F2LA 3I3CA 3ND8A 1MJCA 1I6VC 5K5PA 4U68A 3DMUA 2C35B 1PTOB 4Z9CB 1HRJA 2P5ZX 3S1QB 5CV8A 1L0YB 3D0FA 4E6IA 1E0BA 4XXEA 1QJOA 4RG1A 4KD3A 3T51B 1J6QA 1B8AA 2NZHA 2AWOA 2XGTA 3OIPA 3QIAA 1EY5A 3HOZB 5H1SE 4A3EH 3S2HB 1GXDC 4DR2Q 1N32L 5C44G 4OIKA 4DF7A 1IL8A 1STAA 4K6LA 4KKTA 3W2DA 3OWEB 4ZLTF 3CCSA 4K8IA 1PH5A 1VQLA 3GD7A 1VQOA 5J39A 4A3IH 1RTNA 3H3VI 1EU3A 1IKMA 1PH9A 3BYYB 3CXCA 3I90A 2K50A 1VQ9A 4A3KG 2A6EC 2MP1A 1WFQA 3AFQA 5IGDA 4B3ML 4OL7A 1JJCB 4L5TA 1X54A 1CI3M 1VQDA 4IPCA 1F77A 2Y0SB 4EQ5A 1AP0A 3E6ZX 2E2JH 3J81L 2R6GA 3ULLA 1HNZL 4B3MQ 1Z47A 2MGSA 2LMCB 1QUQB 5M5XH 1VF7A 5IP7G 1BBUA 3NPPA 4IFDH 4B9XA 3RR5A 1WTRA 1HNZQ 3L0OA 1GOZA 3NE5B 1IYUA 1J8IA 1HQRD 1D5ZC 5C4XB 1WTOA 2SDFA 2K5WA 4LUOA 4DV6L 5E7NA 3D4WA 1I50B 2D5DA 1Q81C 3Q23A 4APVA 3TS2A 3FHWA 1EWHA 3L9AX 3O13A 4B3RL 3AEVA 2OEOA 4OHJA 1DOMA 4R4CA 4J1MA 4OXPA 1BVSA 2Q2HA 3A74A 1T5EA 3K59A 2RA4A 3GTJB 1SROA 5IY0A 1SFOB 4B3RQ 4ZKBB 2ID0A 1CQVA 1HZ9A 1PYWD 2QEXA 3D6WA 4K5XA 4Y52H 2GN5A 2FFKB 2JA7G 4B3SQ 1ASYA 1EOTA 1Y69U 2QDLA 1GUWA 1QZHA 2A6HC 3I7FA 4DR4L 2JXMB 4F87A 1Q82C 1HNXL 2F0LA 1TS4A 4M1UB 4KK7A 2A6ED 5E3FA 5CBAE 1PTOC 1EUJA 3SK6A 1TWAB 1PFBA 2C9OA 5C0XG 3K5MA 4YWKA 4GNXC 2FHTA 1UE7A 1HUMA 1PFMA 2D9UA 2IHEA 2ZXOA 4DU9A 4DR4Q 1Q8IA 4JYAL 2NZ1D 5CV9A 1HNXQ 2PYKA 1HZCA 1LABA 3PUVA 1Q7YC 1I3QB 1EWCA 2PQEA 3PO3B 5EPJA 1LUZA 1HZAA 1B70B 2IJ0A 2YTYA 4A3FG 4JYAQ 5C5MA 2H4OA 3IFDA 5HGQA 2MO1A 1PH4A 1QB5D 3D6CA 3T53B 3HOVB 2VUMH 3MXUA 1ZYRD 2B63G 2EJFC 1EY7A 4FF4A 5T1GA 2EY6A 3KDFB 3VR4A 5IT9E 4RGTA 1BR9A 5AJ3L 2YU9H 3URYA 4CBVA 1VDZA 4JI7L 1ASZA 3FPPA 4R4IA 1O7LA 1HH2P 1YITA 1ENAA 3KLSA 1S5CD 1PH6A 3F2DA 4LF5L 3I4NH 2AUKA 1U4PA 3WOEA 4JI7Q 3F8TA 1ML0D 3SEBA 1TKWB 1D5MC 1SLJA 5DM73 3D4DA 1IBML 4JOIC 2PZUA 2XTIA 3B6YA 2E76C 3UI2A 1CUKA 1B50A 2CW0C 2QILA 4LF5Q 2A6HD 2K5QA 1AE3A 4TQUS 1SMYD 3HKSA 4YWLA 1IBMQ 4RHRA 4DR5Q 3C3LA 5FJ8G 1BDOA 1PTOD 1TWFH 2XN9C 4DN4M 1N9WA 2PI2E 2B2TA 5I6WA 2F0DA 2LY7A 1WCMH 1B44D 3A8IE 2MUYA 3K6OA 4QY7A 3MXGA 2H1EA 1F9QA 4GLXA 5NUCA 3H0GB 1NR2A 4LJZC 2GVBA 4C3HH 4G7ZC 4BBRG 4HIMA 2XNAC 3ERQA 1Y8OB 1KLUD 3CKIB 4GLAC 3D3RA 3U4ZA 1ZXTA 1NSNS 2M9VA 4KHVA 5BN3A 4GOPC 3QR8A 3HKZB 2OTJA 2PMZE 2N55A 1K0SA 3I2ZA 2B2WC 4YY3L 3RZOH 4A3MG 1K83B 1Y1WG 4MHEA 5T1IA 4FXDA 4PZ8A 1PTOF 2CHBD 1STHA 4RH6A 4L63B 3VYUA 2VNUD 2K01A 1Y1VB 1ZKOA 4A3GB 2JA9A 4YY3Q 3NTIA 1D7QA 1G8ZD 2F0UA 1YNND 4F7XA 4H0LC 2V4DA 4C2MH 4N9TA 2NVYB 2SOBA 2MQHA 1B9MA 2NVQH 3I4MB 1S5ED 2A19A 1V1OA 2K14A 1E1TA 2EPBA 4NB3A 1CHPD 1STBA 1TXYA 3LGJA 4BY1G 3G4SA 4ZK9B 1Y14B 1PA6A 1B3AA 3TDQA 1J9OA 1V1PB 3DWAA 4TSSA 4P2CB 4TRDA 1U0LA 1A8VA 4KJNA 3CQZH 5FLMH 1W3SA 2ES2A 3DXJC 4GS3A 1STEA 2A69D 2JA6H 1JJ2A 3RNUA 3CCMA 4HIDA 1K73C 3HOYG 5M3MG 1EEFD 3GTPH 3MEFA 1VQCA 3J81j 1SYFA 1C7YA 3ND9A 4ZUJA 1LTID 2JA5G 3NBHB 4HN7A 3Q6SA 4LF4L 3S1QH 1DOLA 1XXGA 4JI3L 4POGA 3E9HA 4QL5A 4WORA 2F4VQ 2IX3A 4P74A 5D3DA 2J0TD 5GROA 1NMFA 4DPGA 5C3WA 4LF9L 4UY8C 5FLXL 4LF4Q 1YEZA 4JI3Q 3ITPA 2KA7A 2D62A 1BOSA 4P75A 5I6YA 4MIUA 3J81c 4L5QA 4LF9Q 4OONA 2KUMA 2JA8H 3FMCA 1NE3A 3GTOB 5M5XB 2A8VA 4AYBG 1VQ6A 2N88A 1YI2A 4YCWA 1N33L 1HHVA 3JAME 1H95A 4GKKL 1A0IA 2B39A 3RUZA 1RCVD 1SE3A 1N33Q 4JI4L 2F0EA 2IWHA 1VQKA 4HMIA 3TP5A 1CM9A 2QEJC 3DHQA 1A62A 3CCRA 1XJVA 1VQMA 3CAMA 4ZUIA 2B2VC 3PUWA 3PO2G 2R7ZG 4AYBE 1AZPA 1I50H 3Q24A 2EVBA 4ZQ3A 4DA2A 1CT1D 2TSSA 4LF8Q 2EJMA 4DXGA 2KEEA 4HTHA 3BDCA 1VMCA 3EA6A 3M4PA 2UUCL 3MZ5A 1GHJA 2OQ0A 3T1HL 1ENCA 3HOXG 1BKBA 4J6HA 3GTJH 2K52A 3T1YL 5GADC 3KJOA 3D31A 1HR0L 1SN8A 4Y7NB 4J15A 5FOBB 2K5HA 2KVMA 3EROA 2EXDA 5F2DA 1ET6A 1M90C 2UUCQ 5IYDG 3T1HQ 5IP9G 2NBFA 4YCVA 1S5BD 2BH8A 1D5XC 1HR0Q 1SJHD 3Q0AA 2B29A 2VW9A 5FK9C 3FP9A 4NKLA 4HSPA 4HJ9A 3STBC 3QWNA 4GNXA 2B2YC 1MIUA 3BZCA 1SNQA 3A8JE 1I6HB 4A75A 1F9PA 5EQ0A 2EIFA 5CV5A 1PH1A 2RBMA 3I91A 2IW3A 3MWYW 4KD4A 1E2WA 2VUMB 1I3QH 3HZXA 1GHKA 3HOUG 2BCOA 3GV6A 3PO3H 1WTXA 1AW7A 1NMGA 4HEDA 4XQJA 4IUUA 2YU9B 2I5LX 5BR8Q 4H13C 4CKEA 3J80i 4DNTB 1PH7A 5C5LA 1CKMA 1Q90A 3SXHA 4XQQA 5LL6X 2UXCL 3QOJA 1RTOA 1OXXK 2ICEC 2JSOA 4RAUC 3GTQH 1X65A 2HDMA 2O2LD 4V0BA 1I94L 2KOLA 4A3CG 5E1FA 1VCIA 1LTRD 2UXCQ 1JT8A 3TEHB 1VMPA 2WB1G 2Q2UA 3PIOA 4A3MB 3IKJA 1Y1WB 1I94Q 5KYIA 4UAIA 5EBCA 5I9PA 4R8IA 4KY6A 3LWEA 5FO9B 1VQ8A 5EPLA 4BY7G 3WWVA 4DR1L 2DNEA 5IT9L 1KRTA 1EYCA 2K28A 3P20A 1G291 4A93G 1U4MA 1WCMB 2IL8A 3OSOA 4JOIA 4XYQA 2F0JA 3OPOA 1HA6A 4DR1Q 1XPOA 4KMUC 4ZAIA 2WINB 1Z6HA 4CJ0B 4C3HB 2OCEA 3S16H 4X6AH 2F0FA 3STBD 4DV0L 2KBNA 4BY1B 3H09A 1BBWA 1EQRA 2B8GA 4X65L 1R4QB 3M85A 4X3KA 2DUDA 4A4IA 1A2UA 2ZM6L 2Q8TA 2MO0A 1HNWQ 2F3IA 2OT2A 4N9PA 3RZOB 3A7LA 3EBEA 4QIWE 4XYOA 4X65Q 5EBDA 4LK1C 3SK8A 4EVOA 4EQPA 2ZM6Q 5D14A 2I0QA 3VR5A 5M3MB 1KL9A 4MN3A 1WOCA 2IHFA 5TSSA 2FINB 1K3RA 4GOPA 4ODGA 1TQOA 3TZUA 1U5KA 4C2MB 1RKNA 2PQAB 4OWXB 3LNNA 2B2WA 4GKJQ 3EN2A 5JPMC 4OX9L 2O5JC 2NVQB 3M9BA 1J5EL 3A54A 3HOWG 1WD1A 4B08A 1CKOA 1F2YA 4OX9Q 4R1JA 1D2BA 1DD2A 4DK1A 5C44H 3CCLA 3M4QA 5JJIA 2F0WA 1CK1A 1J5EQ 1O7IA 1S5DD 2DY7A 2NN6I 1FGUA 4NW2A 2PW7A 1EEID 1GKHA 1EY0A 2NVYH 1SEBD 1NCVA 1TWCH 3CQZB 2UUAL 1RODA 1VQPA 2RVLA 3K7UC 4MZ9A 1S5FD 3G48A 2JA6B 2X6LA 3FKIG 1I4HA 1CZWA 3A56A 5I4DA 1IBKL 1IYJB 1RIPA 3M4YA 2UUAQ 3KF8A 5KNBA 3CC4A 1V43A 5FLXE 1MKHA 1VQAA 3K5OA 2PCFB 3PIO3 1IBKQ 2NN6G 2BE5C 1A2TA 5IP7H 1RHPA 2F1MA 2G9DA 4K0KL 3DM1A 2N78A 3H3VH 5FLXc 1WTPA 2QDBA 1T5XD 3R8BA 2WFWA 1TS3A 1QZGA 4DAYB 1Q3LA 3L2PA 3W1BA 5LMUL 1QG7A 5LMNL 3TRZA 4K0KQ 1PH8A 5C4ZA 2VS1A 2Z6KA 4KJOA 3AYHB 1JE4A 2WV6D 1G6ZA 1L1OB 2JA8B 1P16A 5EGTA 1N32Q 2PW5A 5IYBG 2NVXH 5LMUQ 2M2LA 5LMNQ 2I5MX 3R2TA 1UE5A 5DEHA 4MTKA 2VL6A 3BDOA 2VQEL 3GP7A 1LT6D 1G91A 3CMEA 3GTMH 3CMAA 5IYCG 1DXMA 4XQNA 2KCNA 3GTOH 1C4QA 2VQEQ 4F8MA 1YNJD 1TU2B 2JA7H 2MJ8A 4XT1B 3HKZE 3U9SA 4LNQA 1B9NA 1HCZA 5KRUA 3CP0A 4XTCS 3C1FA 2VQFL 2A1AA 1MBYA 1OTCA 1ZYRC 1Q1EA 3KLRA 1OXUA 5C0XH 3F2UA 3RMHA 4ALPA 5D65A 1P8LA 4DUZL 1H9SA 2YYZA 2VQFQ 2LS01 1A15A 1WI5A 3JAML 1ICFB 2BE5D 5J22A 3HOUB 4X3SA 1RL2A 4DV6Q 2HCIA 3VR2A 4F88A 4A3FH 4C1NI 4DUZQ 2EJGC 1QILA 2Z9HA 2F03A 1VQNA 1QE6A 5J1ZA 4AQYL 1B1ZA 4ULLA 2EXZA 2EY2A 2IX0A 2AHOB 2WAQG 4IFDI 1VQHA 4A3IG 1PMRA 3KF6B 4H44C 2GA4B 2KENA 1H9MA 5JEAG 1PFNA 1TWGH 3NTKA 4AQYQ 1ET9A 2G5DA 4EX5A 2HHHL 1HJPA 1STNA 5LHY1 3CRKC 5K36H 3W3AA 1KDBA 5LMNW 1XPRA 2QGQA 3ERSX 1SMYC 2HQLA 4EQOA 3BYTB 4JK1C 1LO5D 4N8FA 1WJJA 2R92G 1CA6A 2DJGC 1FJGL 4Y7NH 2ZTCA 4DR3L 2HHHQ 4DV5L 3Q22A 4HIKA 5HGTA 4A3JG 3M4OB 4CDFC 3K0YA 4IFDG 2ZJPA 2LSSA 3PMFA 3I55A 4KI0A 1FJGQ 4DR3Q 1AZQA 2OF1A 1PFSA 4DV5Q 1JE5A 1I4PA 2WAQE 5IGGA 3S24A 3U50C 2OTLA 2B2YA 5M5YH 3HS0C 4DKAC 1ZEQX 2FMCA 1F9RA 1I6HH 2HIVA 1L1OC 1B4OA 2CWAA 2E74C 3TBIB 3WOFA 3GTQB 4ILWA 1VQ5A 1M4VA 5D3IB 5IGBA 2L15A 1A63A 5CBEE 2EZVA 1EY9A 2EY5A 3AQQA 3J7AV 2O5IC 5KYLA 1YBYA 3RLOA 4RKBA 2J7ZA 1K0RA 4OWTB 1YNNC 2K05A 4BBRH 1PXUA 1I4XA 1MI2A 5BN5A 5AJ3Q 1K8OA 1XWEA 3K7AH 3KF8B 1SYBA 2L55A 5IT9c 2F0VA 4JVZA 3NP8A 2XWJB 2L1BA 2F4IA 3Q8DA 1UNSA 2R93G 1SNMA 1H9RA 4LFCL 1ICWA 2MHVA 4A3MH 1Y1WH 2BH2A 5M3FG 4DXFA 4JI8L 1EIFA 1IBLL 1SAPA 3TP6A 4K5VA 2A5HA 2MNAA 2Z0SA 3F2BA 4A3BG 2WIIB 4LFCQ 3S16B 2ALYB 4OO1I 3S1NB 1IW7C 2AWNA 1CQFA 4JI8Q 1IBLQ 2A69C 2F0SA 2EYJA 3M7GA 1SXTA 5E4WC 1PLFA 2CVRA 3GTLB 4X3UA 4BS9A 1KQSA 4A3DG 2PI2A 1YIJA 3K5NA 2PO4A 4DV2L 3PGZA 3ONAB 1F9SA 3E5SA 4PZ6A 1D8LA 1RD9D 2KHIA 1UE6A 1MSGA 1TWHH 4BY1H 1JMCA 2AUJD 2OXPA 4DV2Q 5GAEC 4OO1G 2K1BA 1LM0A 1V9PA 1D1KA 2E2HH 1WTVA 3CCQA 1G6PA 4JI0L 4IO9A 3M3YH 3NHHA 1EY8A 5CV6A 1KAWA 5M3MH 4CHTB 4DNRB 4DAMA 1C48A 1NNXA 1G2TA 5C44B 4JI0Q 2OQKA 4AIMA 3MC0B 3NXWA 4ME3A 2JA5H 3OOCA 4CDCC 3N52A 3NUCA 1TWCB 3S15B 1JCKB 1VQIA 1VQ4A 2DJFC 4KTAA 1UAPA 3MXNA 3H6MA 1KD1C 1GM5A 1X32A 1KNEA 1B7YB 1HXYD 3UDIA 4BA2I 4YCUA 1N34L 3I4OA 3QO2A 1S3OA 2K75A 3KYHC 4LW1A 4BXXG 4A3KB 2K5VA 3S14B 1BNZA 2JYOA 4C3IG 3K5LA 5C3EG 3CU7A 2FJ2A 2E8GA 2HCCA 2K6AA 4DV4L 1AH9A 3RN5A 4KY5A 3K0XA 4N8X1 3LWUA 1N34Q 4DNIA 4JBKA 1DOKA 3OWFA 2E5LL 1EFWA 1IW7D 4DAVA 1JOQA 2AQ1B 4LFBL 2RHQB 1XTDA 1I5FA 1CFMA 1E1OA 2CQOA 4PQXA 5G3LD 4DV4Q 5DAUA 3AU7A 4FO2A 4FYDA 1R4PB 3SK4A 1SNPA 4HJAA 2E5LQ 3HG9A 1XMQL 1UUPA 1X3EA 4LFBQ 5ELBA 1BQQT 4RHSA 5FO8B 3QG1A 3BVZA 1BBXC 1XMQQ 3S1RH 4HCEA 4QB4A 2CCZA 1BCPB 3GTGH 4A76A 2NVXB 3VYSA 2XVSA 2ATWA 2L11A 1WTQA 3FDTA 1QNUA 3T13A 5J3BA 1FR3A 3X3MA 3GTKH 3P75A 3A55A 5CV7A 4RFBA 3T4AC 4CJ2C 1QVCA 2PZTA 1KTKA 3OYYA 3PO2H 1SMXA 5C0XJ 3NBIA 5G3LF 2R7ZH 3GTMB 4IUTA 3PUZA 4DK0A 4JV5L 2NYZD 1PYSB 1GUSA 2JA7B 1LT4D 3HFZB 3J81i 5EAYA 3S1MB 4NXML 1JC7A 4R8NA 3HOXH 1WD0A 1ESFA 3FPUB 1BF4A 1LTSD 2GVAA 2RKSA 4EGVA 4I7AA 2EY1A 1XNRL 4BBSG 3FEWX 3U58A 4NXMQ 5IYDH 2KHJA 1E2VA 2XWBB 4GKKQ 4JG2A 3VA7A 1VF5C 1Q12A 5IP9H 3JAMc 1SJED 1LLRD 4WJ4A 5JVG3 1JOKA 4DAPA 4A3LH 4A3FB 5CGKA 4JI4Q 2WKCA 3RZDH 3X3NA 4RGMA 3ULPA 1GVPA 4S3SA 4JPBW 3FVQA 1LTBD 1TWGB 2B63B 5ELDA 3HOUH 3A0JA 3HOZG 2X6GA 2NVTB 3DWPA 4IPHA 4LF7L 4OEMB 4JCVE 2DY8A 4KHPL 1C9OA 1G51A 1M8AA 1V8QA 3R3OA 1H9KA 5ELOA 3D4RA 4LF7Q 1F2MA 1XYIA 3T1YQ 4KHPQ 1EIGA 4DR6L 1KC8C 4IUNA 1L0XB 2Q2TA 2E75C 2SEBD 3G6EA 2QF7A 2A73B 3SK5A 4A3CH 2DGYA 3W1GA 4TVAB 1N36L 4B3TL 3PV0A 5M5WH 5GAGC 2WKDA 4KV6A 3DM3A 2Y0SG 1EFID 2PMZB 5M5YB 3ER0A 4B3TQ 1EY6A 4BY7H 4IOCA 1VQ7A 4I7ZC 3M4OH 1BCPC 1IYVA 1PYBA 3HGBA 2R3ZA 4A93H 3J80E 5CMDA 5C4XG 2A68C 2J4XA 4CGYB 5DM63 2K5NA 4HMJA 3MXNB 1YZ6A 2JK8A 4GZYC 2EDGA 4C3JG 4BBRB 3OW2A 2HT1A 1I4RA 1SBBB 2EYPA 2F0KA 2L12A 2D0PA 4HAEA 1JWMD 3K7AB 1A6XA 2Y0SE 4L6TB 1II3A 3TP7A 2F0TA 1ILPA 2DNCA 1CSQA 4ID6A 4NXNL 2UU9L 1GUTA 3EQLC 4Q0FA 1QOHA 1LTTD 4LWCA 1HTPA 1QVFA 1LYLA 1QWYA 3AMUA 1QUQA 4NDXA 3CCEA 2KHSA 3PF5A 4NXNQ 2B2UC 4HJ7A 1OXTA 2UU9Q 1PVOA 4R4QA 4NPSA 1W2BA 2OWOA 4IURA 1HUNA 2QW7A 3OMGA 4FNFA 2KEDA 3HOWH 3V05A 5CYUA 4RA8A 2Z1CA 1FNUA 1TWHB 4IZ8A 3S1NH 2A74C 1NAPA 1K3BC 3PO3G 3W5OA 3C2PA 4CJ1B 3S17B 2AQ3B 4IJLA 4JBJA 2B2TC 4NMZA 4DV3L 4YIJA 2F0QA 3K8AA 4CDEC 1BCPD 3GTLH 2E2HB 4DV0Q 2I5HA 4XT3B 4KY7A 3M3YB 2M00A 3MA2B 4RCNA 1PZJD 1K28A 3FKIH 3HOYB 4DV3Q 2R61A 2A68D 5LL6S 5EPKA 2K4KA 4FF2A 3TQYA 3HOVG 1O7YA 2AQ2B 4X66L 4O1NA 2VZAA 1N8RC 1IXRA 2O4XA 2JA5B 1A3UA 4RWSC 2NN6H 2JP1A 3OW7A 4CKBA 1JWUD 4UP8A 2HD3A 3R93A 4LFAL 3PQIA 1U4LA 2YTVA 4BA1I 3ULJA 4X64L 2EYMA 2HUGA 1H9JA 3UDGA 5JOBA 4JI5L 3BVMA 4PG3A 3A5UA 2LXJA 2VB2X 4DUYL 1SNCA 1SYDA 1Z9FA 3BDLA 4LMQD 1CHQD 1BCPF 1C8CA 3IFTA 4K14A 2EYFA 1EQQA 4X64Q 1YNJC 4DK6C 3DUZA 4JI5Q 1FD7D 3S15H 1SYCA 1JICA 3PSIA 1RF2D 2BOSA 3TSSA 5IYBH 3I8ZA 4K8JA 4AYBB 3E0JA 3OHXC 1VQFA 2XSCA 4A3KH 2K32A 3IL8A 4FDBA 3S14H 2BA1A 2E2DC 1XMOL 1R9TH 3KDFA 1IKLA 5EKIA 2BDOA 3DEPA 1VS0A 5IYCH 3V96A 3H0GG 3NQIA 3S1RB 5I2XA 3CC2A 1RJTA 2JEBI 3MFYA 3GTGB 1XMOQ 5EKKA 4UP7A 4HSVA 1NY4A 4XIGS 2H5XA 2AMCB 2Z6BA 2HDLA 2IT1A 3GTKB 4QUCA 3CHBD 2RDFA 4IJHA 1KDAA 3G71A 4DV7L 3HKZG 1L0WA 4G7OC 2AKWB 1SE8A 3MFGA 3PO2B 5ELCA 2R7ZB 4GNXB 1KRSA 4DR2L 4DV7Q 3KLSX 5EJWA 3TZDA 1O80A 1EL0A 1Y1VG 4A3GG 1YHBA 3BJUA 1NUCA 3RLFA 4XDXA 2ZXRA 5HURA 5A2QE 3CCJA 3VA5A 3HOXB 1PH3A 4IOAA 1HTLD 1S4ZA 3C1EA 5BN4A 3CPFA 1HFNA 4DGZA 2E2IH 2Q2IA 3I4MG 1QNKA 2ENBA 5IOCA 3HEJA 3PUYA 2K03A 1I4QA 2WACA 3BZKA 4LUZA 3F2CA 5JEAH 3J7ZC 3C46A 1NTGA 3CC7A 3QJYA 3IAYA 3J7YW 2LFNA 3S1MH 2X69A 2IY5B 1WTWA 4RKLA 3BS1A 3AB9A 1PRTB 2ZXPA 4MNOA 4DFAA 3RZDB 2R92H 2JEAI 3HP3A 1SNOA 2HIXA 1SNDA 1ILQA 1IZ6A 2KECA 4P73A 1NR4A 4A3JH 1EIHA 3KFUA 3NELA 1HQMC 3EFXD 3CF5A 1K9MC 4J8QA 1MHWC 1DZ1A 4PMBA 2CFMA 2C5CA 4A3EG 1FNWA 2B2VA 1HZBA 4X3TA 3SHLA 3DLLA 3DWQA 3U4VA 1WVLA 4C3JB 5ELNA 3J7AF 5C6AA 1ONLA 1TT2A 4M8AA 1X3FA 2VXWA 3SGIA 2N49A 3K81C 4WRDA 3L7ZC 2B63H 4B9WA 1MSHA 1XNQL 2NVTH 3IRBA 4QGUA 5M5WB 2NUCA 1V1PA 2WB1B 3SVMA 5C0XI 2PNRC 4B3SL 3UDFA 4R9WA 3NENA 2TMPA 4R4TA 5KEEA 4P71A 4DK3C 1FNVA 1GUOA 1XNQQ 2B3GA 3ZYYX 1KAAA 2RSOA 1JOOA 4BY7B 4QIWB 4GOPB 3F1ZA 2PPBC 1C0AA 5C4JH 3A5ZB 5COYA 1X3PA 4IALA 1SE4A 3VR6A 2UXDL 5JJLA 5DNFA 4A93B 3T16A 3NTHA 2R93H 3KUPA 5M3FH 3S2DB 3NBHA 1TR5A 2UXDQ 2JN4A 1KHIA 1RDPD 4LAAA 3E9IA 1GJXA 1T9HA 5I2YA 3MVVA 4A3BH 2V1CC 4IN3A 4WJWA 5FJ8H 2CH4W 4PMWA 1LV9A 3NSWA 1WYDA 1X56A 1Q86C 4JI2L 1FL0A 2Z8LA 4RGNA 4IPDA 1CA5A 4A3DH 1AE2A 2F0IA 1LTGD 2PNHA 3OTOL 4DR7L 1KLGD 2B8FA 2ASBA 1XPUA 1CKNA 3MEHA 1YHQA 4JI2Q 1L2FA 3OMCA 1XTCD 2BA0A 4O42A 3OTOQ 4DR7Q 3J80L 2DN8A 4OO1H 3HRZC 4L8JA 3UE1A 1S72A 3D8GA 1A3TA 2F0HA 5K36G 2KQ3A 4YWMA 1QVGA 1DM0B 2RSNA 1FYCA 1U4RA 1PZKD 1PRTC 3L3OC 3HOWB 1BXTA 3BZDB 2IX1A 4KN7C 3H94A 2LKVA 1CTMA 1LACA 4KHZA 1PDQA 3EJIA 2QKIC 2B2UA 1EYAA 3PIPA 3MXPA 1E2ZA 4KKSA 1JB3A 3M7NA 5AFWA 3CPWA 1EZ6A 5ISRA 2I46A 4DV1L 1STGA 4DR5L 3TS0A 4KLKA 3I4LA 1B53A 3MAQA 2PZWA 1EQTA 4GN4B 3FKIB 3KBXA 4DV1Q 4BXXH 1SYEA 1LT5D 5IE8A 2VUMG 4C3IH 4WFN3 4FP5D 3SDZA 2XIWA 5C3EH 1M1KC 3S17H 1YJ9A 3KK7A 2IPKD 2NZOA 4PZ7A 3GV3A 4UHVA 2RCNA 1UE1A 3NQTA 4QCLA 4JBWA 4HJ8A 1GUGA 1NJIC 2KCMA 4G7HC 4I65A 2N3SA 1W6KA 1PZID 1TY2A 3HOYH 5KNDA 1EIYB 2F0NA 3H15A 1EY4A 1E3PA 3I4NG 3TMEA 5A35A 2XRSD 3J7A5 1K8MA 2K33A 3KJPA 2MFIA 2EE1A 1H9SB 4K2LA 1FGBD 4ME5A 2L4NA 1VQEA 2VB3X 1PRTD 1S40A 1TS2A 3G6JB 1SR3A 1YNXA 1W6JA 5IGFA 3P1HA 3R2IA 1R9TB 4JI6L 4OELB 4FXKC 1WCMG 3RLNA 4UP9A 5JJZA 1TVXA 3E0EA 3MTSA 3P7JA 1LTLA 4C3HG 3I56A 4JI6Q 4HJ5A 3KBGA 1F2ZA 2ZTEA 2CW0D 3KOJA 4BWGB 4FF1A 1SDFA 1E24A 4ZRZA 5IIFA 1GO3E 1BO0A 1SYGA 3RD4A 3JC66 3PUXA 1DCZA 4GN3B 1KABA 1NBWA 2D2CC 1HFGA 1WTHA 5IGEA 4QF4A 4BBSH 4ZYSA 1PRTF 4IQZA 4O0AA 5JEAJ 1DJRD 1MD2D 4RGOS 1JR0D 5FO7B 3EIVA 3PIP3 2QA4A 4A3EB 1O7ZA 4MTNA 2F4VL 1KNAA 2UUBL 2K04A 1PTOH 2NB0A 4PNYA 3I72A 1DONA 1CSPA 4QMGA 2Z6KC 2E2IB 4HCSA 1EU4A 2WAQB 1EYDA 3J81E 4A3IB 2ICIA 2UUBQ 1TY0A 1XX8A 2CH4A 4IFDJ 2L9HA 1OXSC 2R7FA 3N6RA 1HA5A 2RQXA 2CWPA 4PMCA 1JJGA 1PV4A 2L5TA 2RHSB 3HOZH 1IL2A 1I4GA 3S2HH 1STYA 3NEMA 4RMFA 1KIXA 3I70A 2NTSA 1EQVA 4JV5Q 1EOVA 2E2JB 4UPAA 1X6OA 5FLMG 2R92B 1YVCA 1U9RA 2EQSA 3PF4A 4OIJA 1CKNB 3QOLA 3K80C 5C3XA 3G7LA 2JA6G 5DLQE 4ABNA 4A3JB 1D6EC 4K5WA 2KCCA 5A2QL 3CD6A 1XNRQ 3VYTA 5IWAL 2PQAA 2EYHA 2F0PA 4KN4C 3JAMi 4CKCA 2R7DA 1VQJA 1MJEA 4JBMA 1V1QA 5IWAQ 2Q8RE 2ZT9C 4H02A 4ZKCB 4FF3A 5JJKA 1TS5A 1VQBA 4FVMA 4HIOA 4IPGA 4C1NK 5M9OA 4P72A 1B3QA 5C4XH 2EYLA 2UXBL 3BU2A 4LF8L 2CQAA 3ZJYC 4C3JH 4YHHL 3VYRA 2JA8G 5I9OA 2L0CA 1JWSD 4EQNA 4R4OA 2UXBQ 5CV4A 3GO5A 1X3QA 5C4JB 1K8AC 1AN8A 2YTXA 4UDUC 3SE0A 3H3VC 4YHHQ 1SE2A 2HQEA 2F0GA
chains in the Genus database with same CATH topology
2QGQA 2WP8J 1DGSA 3ERSX 4X64Q 1EQQA 2HQLA 5HY6A 4JI1L 4DK6C 1SFOH 2MQHA 4JI5Q 3S15H 1X55A 2NVQH 4DR6Q 1WJJA 2R92G 4L5SA 1FJGL 4Y7NH 3PSIA 2ZTCA 4DR3L 2A19A 5IYBH 2HHHQ 2K14A 1E1TA 4DV5L 1N36Q 4NB3A 1SRUA 4POFA 4HIKA 4A3JG 1VQFA 4JI1Q 4IFDG 4A3KH 1TXYA 4FDBA 2ZJPA 3S14H 2LSSA 3LGJA 2BA1A 3PCOB 4BY1G 2F52A 3G4SA 1Y14B 3I55A 1PA6A 4KI0A 1FJGQ 4LUVA 4DR3Q 1XMOL 1R9TH 3KDFA 1PFSA 4DV5Q 1JE5A 3KLWA 4A3LG 2N8NA 3UE0A 1EWIA 1VS0A 1U0LA 1A8VA 2WAQE 3CQZH 5FLMH 1W3SA 3S24A 5IYCH 2ES2A 3U50C 2OTLA 4GS3A 5M5YH 3S2DH 3H0GG 3UDXA 1Q8KA 1D7QA 1TWAH 4DKAC 3CC2A 4WJ3M 1I6HH 2JEBI 4AH6A 1L1OA 1XMOQ 1JJ2A 3RNUA 2JA6H 2HIVA 4UP7A 1L1OC 3CCMA 2CWAA 1NY4A 4XIGS 2H5XA 4HIDA 5M3MG 1K73C 2YV5A 3HOYG 2AMCB 3GTPH 1Q1BA 2IT1A 5BR8L 3J80c 1FVIA 3MEFA 1VQ5A 2L15A 4IJHA 1VQCA 2CKZB 3J81j 3G71A 2VY3A 1A63A 4DV7L 1C7YA 2KCTA 4JC0A 3TREA 3HKZG 3AQQA 1L0WA 2JE6I 2AKWB 1SE8A 2JA5G 3NBHB 4GNXB 1YBYA 3RLOA 3GDEA 4LF4L 4OWWB 3S1QH 4JI3L 1KRSA 4POGA 1K0RA 3E9HA 4QL5A 4OWTB 4DR2L 5GAHC 4BBRH 4DV7Q 2F4VQ 4P74A 5GROA 5AJ3Q 1NMFA 3K7AH 3KF8B 4DPGA 4LF6L 1Y1VG 4LF9L 4UY8C 5IT9c 3HOVH 4A3GG 1YHBA 3BJUA 3RN2A 1YEZA 3RLFA 3CCUA 4JI3Q 4LF4Q 3CCJA 3Q8DA 1PH3A 4IOAA 2R93G 2D62A 4P75A 4LFCL 3CPFA 3J81c 4L5QA 4LF6Q 4LF9Q 4A3MH 1Y1WH 4OONA 2BH2A 5M3FG 2Q2IA 2E2IH 3I4MG 2JA8H 1KXLA 1NE3A 4JI8L 1EIFA 1IBLL 3PUYA 3BZKA 4X62L 4LUZA 2A8VA 4AYBG 3F2CA 3F2BA 1VQ6A 2MNAA 2Z0SA 3J7ZC 4A3BG 4LFCQ 4OO1I 2ALYB 1EYGA 1NTGA 3CC7A 2AWNA 1YI2A 4YCWA 3S1MH 1N33L 2IY5B 4JI8Q 1IBLQ 1H95A 2LXKA 4O2DA 1UEBA 4MNOA 4X62Q 4GKKL 1A0IA 1X9NA 2JJQA 2ZJQA 1KQSA 1HR0W 2R92H 4A3DG 2PI2A 1YIJA 2JEAI 4DV2L 1PH2A 4GLVB 2HIXA 1N33Q 3PGZA 1IZ6A 4P73A 1YJWA 4PZ6A 4JI4L 1D8LA 4A3JH 2KHIA 1HNWL 3KFUA 1UE6A 2D0OA 3NELA 2RF4A 3CF5A 3KF6A 1K9MC 1TWHH 4BY1H 1JMCA 1YHAA 1VQKA 1PHJA 4DV2Q 2WB1E 5GAEC 4OO1G 2CFMA 4L5RC 4A3EG 1A62A 1E7ZA 1LM0A 3CCRA 1XJVA 1VQMA 1V9PA 1HZBA 3CAMA 3PUWA 3PO2G 2E2HH 3DLLA 2R7ZG 3H0GH 3U4VA 4AYBE 3CCQA 5ELNA 1G6PA 4JI0L 4IO9A 4X66Q 3M3YH 1I50H 1E22A 2ZTDA 1X3FA 3SGIA 1KAWA 2N49A 5M3MH 4GN5A 4GKJL 3K81C 4DAMA 4LF8Q 1YJNA 3L7ZC 2B63H 4JI0Q 2OQKA 3M4PA 4LFAQ 4AIMA 2UUCL 1XNQL 2OQ0A 4ME3A 1Q46A 3T1HL 3IRBA 4QGUA 3HOXG 2NVTH 1OXVA 3CW2C 1BKBA 3GTJH 2JA5H 5C0XI 2FXQA 2K52A 3UDFA 3T1YL 5GADC 3KJOA 4B3SL 3D31A 3NENA 4DUYQ 1VQIA 4R4TA 1K83H 4P71A 1VQ4A 4DK3C 1HR0L 4QQBX 1SN8A 3CCVA 4J15A 2K5HA 1KD1C 2EXDA 1M90C 1GM5A 2B3GA 2UUCQ 1XNQQ 1B7YB 3UDIA 5IYDG 3T1HQ 4BA2I 4YCUA 1N34L 3I4OA 1S3OA 2K75A 3KYHC 4LW1A 4GOPB 3F1ZA 1VQGA 1Y1VH 2JQOA 4BXXG 4A3GH 1GD7A 2K5VA 5GQOA 5IP9G 3A5ZB 5C4JH 3ICEA 4YCVA 2BH8A 1HR0Q 2UXDL 5JJLA 5C3EG 2B29A 2VW9A 2E8GA 3FP9A 4DV4L 1JB7A 2R93H 1AH9A 3RN5A 3K0XA 4QJFA 4JBKA 1N34Q 4DNIA 1UWVA 3STBC 4HJ9A 2E5LL 3VDYA 1EFWA 5M3FH 3I4MH 1K8GA 4GNXA 4LFBL 2RHQB 1XTDA 1MIUA 3BZCA 1I5FA 1KHIA 2UXDQ 1E1OA 2CQOA 3E9IA 4A75A 4DV4Q 1T9HA 4A3BH 4HJAA 2V1CC 2ZJRA 2EIFA 1PH1A 5FJ8H 2E5LQ 1X3GA 1I3QH 3AFPA 1XMQL 4PMWA 1X3EA 3HOUG 3PO3H 4LFBQ 1MJCA 1WYDA 1X56A 1Q86C 1NMGA 4JI2L 2C35B 1FL0A 4IPDA 4A3DH 1AE2A 2I5LX 3OTOL 2PNHA 5BR8Q 4DR7L 1XMQQ 3J80i 3S1RH 3D0FA 2ASBA 1PH7A 2CCZA 1CKMA 1XPUA 3GTGH 1CKNA 4RG1A 4A76A 1J6QA 1YHQA 2ATWA 1B8AA 4JI2Q 2UXCL 1L2FA 1OXXK 2NZHA 2AWOA 2XGTA 5J3BA 3GTQH 2BA0A 1X65A 3OTOQ 4DR7Q 3GTKH 1I94L 5H1SE 4A3EH 1N32L 4DR2Q 3UE1A 1S72A 5C44G 4A3CG 1QVCA 1VCIA 5K36G 4YWMA 1QVGA 3OYYA 3CCSA 2UXCQ 3TEHB 1JT8A 3PO2H 2WB1G 1SMXA 2Q2UA 5C0XJ 2R7ZH 3PIOA 1PH5A 1VQLA 3GD7A 1I94Q 1VQOA 3PUZA 4A3IH 2IX1A 3H3VI 1VQ8A 1PH9A 4JV5L 3CXCA 1PYSB 4BY7G 2K50A 1VQ9A 3WWVA 3HFZB 4DR1L 4KHZA 4A3KG 1WFQA 3J81i 3AFQA 3PIPA 5EAYA 1KRTA 4B3ML 1JJCB 4L5TA 1X54A 3CPWA 4NXML 3M7NA 1G291 4A93G 1VQDA 3HOXH 4IPCA 4DV1L 4JOIA 4EQ5A 4DR5L 2E2JH 4DR1Q 2R6GA 2GVAA 4KLKA 3TS0A 1XPOA 3ULLA 1HNZL 4B3MQ 1XNRL 4BBSG 1Z47A 3U58A 4NXMQ 5IYDH 4GN4B 1QUQB 5M5XH 5IP7G 2KHJA 1BBUA 4DV1Q 4BXXH 4GKKQ 2OCEA 4JG2A 3S16H 1Q12A 4X6AH 5IP9H 3STBD 3JAMc 4DV0L 5IE8A 2KBNA 2VUMG 4C3IH 3RR5A 1BBWA 1EQRA 4X65L 5C3EH 1HNZQ 1M1KC 3M85A 4WJ4A 4A4IA 2DUDA 3S17H 3L0OA 2ZM6L 1YJ9A 4A3LH 2MO0A 2NZOA 4PZ7A 4JI4Q 2F3IA 1HNWQ 2RCNA 1UE1A 3RZDH 4JBWA 4LUOA 4HJ8A 4DV6L 2KCMA 3EBEA 4QIWE 5E7NA 1NJIC 4X65Q 1Q81C 3TS2A 4APVA 2N3SA 3FHWA 2ZM6Q 3ULPA 1GVPA 2I0QA 3HOYH 1KL9A 4B3RL 1WOCA 2IHFA 3AEVA 1EIYB 1K3RA 3H15A 4GOPA 4R4CA 3A0JA 3HOUH 3HOZG 1E3PA 4OXPA 3I4NG 1BVSA 2Q2HA 1U5KA 2PQAB 3A74A 3J7A5 4IPHA 4LF7L 4OWXB 1SROA 4GKJQ 5IY0A 4JCVE 3EN2A 3KJPA 4B3RQ 4KHPL 2ID0A 1C9OA 1G51A 2QEXA 1HZ9A 2MFIA 4OX9L 3M9BA 1J5EL 3HOWG 5ELOA 4Y52H 2GN5A 4LF7Q 1CKOA 1VQEA 4B3SQ 3T1YQ 2JA7G 4KHPQ 1ASYA 4DR6L 1KC8C 4OX9Q 1S40A 4R1JA 2Q2TA 3G6EA 1SR3A 5C44H 3CCLA 1YNXA 3M4QA 4A3CH 1QZHA 5JJIA 1J5EQ 1O7IA 2DGYA 3W1GA 4TVAB 1N36L 2NN6I 1FGUA 3I7FA 3PV0A 5M5WH 4B3TL 4JI6L 1GKHA 1Q82C 1WCMG 5GAGC 1HNXL 4DR4L 3DM3A 2Y0SG 2NVYH 3RLNA 1TWCH 4UP9A 2UUAL 1VQPA 1EUJA 3ER0A 3E0EA 3K7UC 5C0XG 4GNXC 4MZ9A 4YWKA 1LTLA 3G48A 1UE7A 3I56A 4B3TQ 2IHEA 4DR4Q 4JI6Q 3FKIG 4HJ5A 4IOCA 1VQ7A 3M4OH 4BY7H 4JYAL 1HNXQ 1HZCA 3PUVA 1IYJB 2ZTEA 1IBKL 1RIPA 1Q7YC 3KOJA 2UUAQ 1PYBA 1C0AA 1E24A 3CC4A 1V43A 1GO3E 1LUZA 4A93H 1HZAA 1B70B 2YTYA 3JC66 3PUXA 1MKHA 4A3FG 1VQAA 5C4XG 4GN3B 4JYAQ 1NBWA 2K5NA 1IBKQ 2NN6G 3MXNB 1YZ6A 2JK8A 4BBSH 5HGQA 2MO1A 3OW2A 2HT1A 5IP7H 5JEAJ 4O0AA 1PH4A 4K0KL 2D0PA 2N78A 3H3VH 5FLXc 2VUMH 3EIVA 2B63G 1QZGA 2WFWA 2QA4A 3KDFB 2Y0SE 4DAYB 4MTNA 3L2PA 2F4VL 2UUBL 3W1BA 5LMUL 5LMNL 3TRZA 4K0KQ 5AJ3L 1PH8A 2YU9H 2VS1A 2Z6KA 1CSQA 1CSPA 3AYHB 2Z6KC 4NXNL 2UU9L 1L1OB 1ASZA 4JI7L 1P16A 1N32Q 5IYBG 4R4IA 2UUBQ 4IFDJ 2NVXH 4LWCA 5LMUQ 1HH2P 1OXSC 2R7FA 1YITA 5LMNQ 1PH6A 1LYLA 2I5MX 1QVFA 1QUQA 2CWPA 3CCEA 1JJGA 1PV4A 3F2DA 1UE5A 2RHSB 3HOZH 1IL2A 4LF5L 3PF5A 3I4NH 4NXNQ 3S2HH 2UU9Q 4HJ7A 1OXTA 3NEMA 3F8TA 4R4QA 4NPSA 4RMFA 4JI7Q 1KIXA 1PVOA 2VL6A 2VQEL 1SLJA 1W2BA 2OWOA 4JV5Q 1EOVA 1IBML 4JOIC 2XTIA 3B6YA 4UPAA 1CUKA 1X6OA 5FLMG 3CMEA 3GTMH 1YVCA 3CMAA 5IYCG 2EQSA 4LF5Q 3PF4A 1CKNB 3HOWH 3GTOH 3K80C 2JA6G 1AE3A 4TQUS 5DLQE 2VQEQ 3HKSA 4YWLA 1IBMQ 2JA7H 4DR5Q 3S1NH 3CD6A 5FJ8G 3HKZE 4LNQA 1TWFH 1N9WA 2PI2E 3CP0A 3W5OA 1XNRQ 5IWAL 4XTCS 3PO3G 4IJLA 4JBJA 2VQFL 1WCMH 4DV3L 2A1AA 2PQAA 3K8AA 3GTLH 4QY7A 1OTCA 4DV0Q 4GLXA 2I5HA 1Q1EA 1OXUA 3JAMi 2R7DA 1VQJA 2GVBA 4ALPA 1MJEA 4JBMA 4C3HH 4BBRG 1V1QA 5IWAQ 1P8LA 4HIMA 4DUZL 2YYZA 3FKIH 2VQFQ 4DV3Q 4H02A 2K4KA 1WI5A 4GLAC 5JJKA 3TQYA 3U4ZA 3HOVG 1VQBA 1RL2A 4X66L 4IPGA 4DV6Q 4HIOA 4GOPC 2VZAA 1N8RC 4P72A 2OTJA 4A3FH 4DUZQ 1IXRA 2PMZE 5C4XH 2UXBL 3BU2A 4LF8L 3I2ZA 4YY3L 1VQNA 3RZOH 4AQYL 3ZJYC 4A3MG 4UP8A 1Y1WG 4C3JH 4YHHL 4LFAL 2JA8G 2YTVA 2IX0A 2AHOB 2WAQG 4PZ8A 4BA1I 3ULJA 1VQHA 4A3IG 4IFDI 3KF6B 4X64L 4R4OA 2UXBQ 2KENA 3UDGA 2VNUD 5JEAG 4JI5L 4DUYL 1TWGH 2JA9A 2LXJA 3GO5A 4PG3A 4YY3Q 1Z9FA 3A5UA 1K8AC 4AQYQ 4EX5A 2YTXA 2HHHL 1HJPA 4YHHQ 4C2MH 5LMNW 1XPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGQ A;  2WP8 J;  1DGS A;  3ERS X;  4X64 Q;  1EQQ A;  2HQL A;  5HY6 A;  4JI1 L;  4DK6 C;  1SFO H;  2MQH A;  4JI5 Q;  3S15 H;  1X55 A;  2NVQ H;  4DR6 Q;  1WJJ A;  2R92 G;  4L5S A;  1FJG L;  4Y7N H;  3PSI A;  2ZTC A;  4DR3 L;  2A19 A;  5IYB H;  2HHH Q;  2K14 A;  1E1T A;  4DV5 L;  1N36 Q;  4NB3 A;  1SRU A;  4POF A;  4HIK A;  4A3J G;  1VQF A;  4JI1 Q;  4IFD G;  4A3K H;  1TXY A;  4FDB A;  2ZJP A;  3S14 H;  2LSS A;  3LGJ A;  2BA1 A;  3PCO B;  4BY1 G;  2F52 A;  3G4S A;  1Y14 B;  3I55 A;  1PA6 A;  4KI0 A;  1FJG Q;  4LUV A;  4DR3 Q;  1XMO L;  1R9T H;  3KDF A;  1PFS A;  4DV5 Q;  1JE5 A;  3KLW A;  4A3L G;  2N8N A;  3UE0 A;  1EWI A;  1VS0 A;  1U0L A;  1A8V A;  2WAQ E;  3CQZ H;  5FLM H;  1W3S A;  3S24 A;  5IYC H;  2ES2 A;  3U50 C;  2OTL A;  4GS3 A;  5M5Y H;  3S2D H;  3H0G G;  3UDX A;  1Q8K A;  1D7Q A;  1TWA H;  4DKA C;  3CC2 A;  4WJ3 M;  1I6H H;  2JEB I;  4AH6 A;  1L1O A;  1XMO Q;  1JJ2 A;  3RNU A;  2JA6 H;  2HIV A;  4UP7 A;  1L1O C;  3CCM A;  2CWA A;  1NY4 A;  4XIG S;  2H5X A;  4HID A;  5M3M G;  1K73 C;  2YV5 A;  3HOY G;  2AMC B;  3GTP H;  1Q1B A;  2IT1 A;  5BR8 L;  3J80 c;  1FVI A;  3MEF A;  1VQ5 A;  2L15 A;  4IJH A;  1VQC A;  2CKZ B;  3J81 j;  3G71 A;  2VY3 A;  1A63 A;  4DV7 L;  1C7Y A;  2KCT A;  4JC0 A;  3TRE A;  3HKZ G;  3AQQ A;  1L0W A;  2JE6 I;  2AKW B;  1SE8 A;  2JA5 G;  3NBH B;  4GNX B;  1YBY A;  3RLO A;  3GDE A;  4LF4 L;  4OWW B;  3S1Q H;  4JI3 L;  1KRS A;  4POG A;  1K0R A;  3E9H A;  4QL5 A;  4OWT B;  4DR2 L;  5GAH C;  4BBR H;  4DV7 Q;  2F4V Q;  4P74 A;  5GRO A;  5AJ3 Q;  1NMF A;  3K7A H;  3KF8 B;  4DPG A;  4LF6 L;  1Y1V G;  4LF9 L;  4UY8 C;  5IT9 c;  3HOV H;  4A3G G;  1YHB A;  3BJU A;  3RN2 A;  1YEZ A;  3RLF A;  3CCU A;  4JI3 Q;  4LF4 Q;  3CCJ A;  3Q8D A;  1PH3 A;  4IOA A;  2R93 G;  2D62 A;  4P75 A;  4LFC L;  3CPF A;  3J81 c;  4L5Q A;  4LF6 Q;  4LF9 Q;  4A3M H;  1Y1W H;  4OON A;  2BH2 A;  5M3F G;  2Q2I A;  2E2I H;  3I4M G;  2JA8 H;  1KXL A;  1NE3 A;  4JI8 L;  1EIF A;  1IBL L;  3PUY A;  3BZK A;  4X62 L;  4LUZ A;  2A8V A;  4AYB G;  3F2C A;  3F2B A;  1VQ6 A;  2MNA A;  2Z0S A;  3J7Z C;  4A3B G;  4LFC Q;  4OO1 I;  2ALY B;  1EYG A;  1NTG A;  3CC7 A;  2AWN A;  1YI2 A;  4YCW A;  3S1M H;  1N33 L;  2IY5 B;  4JI8 Q;  1IBL Q;  1H95 A;  2LXK A;  4O2D A;  1UEB A;  4MNO A;  4X62 Q;  4GKK L;  1A0I A;  1X9N A;  2JJQ A;  2ZJQ A;  1KQS A;  1HR0 W;  2R92 H;  4A3D G;  2PI2 A;  1YIJ A;  2JEA I;  4DV2 L;  1PH2 A;  4GLV B;  2HIX A;  1N33 Q;  3PGZ A;  1IZ6 A;  4P73 A;  1YJW A;  4PZ6 A;  4JI4 L;  1D8L A;  4A3J H;  2KHI A;  1HNW L;  3KFU A;  1UE6 A;  2D0O A;  3NEL A;  2RF4 A;  3CF5 A;  3KF6 A;  1K9M C;  1TWH H;  4BY1 H;  1JMC A;  1YHA A;  1VQK A;  1PHJ A;  4DV2 Q;  2WB1 E;  5GAE C;  4OO1 G;  2CFM A;  4L5R C;  4A3E G;  1A62 A;  1E7Z A;  1LM0 A;  3CCR A;  1XJV A;  1VQM A;  1V9P A;  1HZB A;  3CAM A;  3PUW A;  3PO2 G;  2E2H H;  3DLL A;  2R7Z G;  3H0G H;  3U4V A;  4AYB E;  3CCQ A;  5ELN A;  1G6P A;  4JI0 L;  4IO9 A;  4X66 Q;  3M3Y H;  1I50 H;  1E22 A;  2ZTD A;  1X3F A;  3SGI A;  1KAW A;  2N49 A;  5M3M H;  4GN5 A;  4GKJ L;  3K81 C;  4DAM A;  4LF8 Q;  1YJN A;  3L7Z C;  2B63 H;  4JI0 Q;  2OQK A;  3M4P A;  4LFA Q;  4AIM A;  2UUC L;  1XNQ L;  2OQ0 A;  4ME3 A;  1Q46 A;  3T1H L;  3IRB A;  4QGU A;  3HOX G;  2NVT H;  1OXV A;  3CW2 C;  1BKB A;  3GTJ H;  2JA5 H;  5C0X I;  2FXQ A;  2K52 A;  3UDF A;  3T1Y L;  5GAD C;  3KJO A;  4B3S L;  3D31 A;  3NEN A;  4DUY Q;  1VQI A;  4R4T A;  1K83 H;  4P71 A;  1VQ4 A;  4DK3 C;  1HR0 L;  4QQB X;  1SN8 A;  3CCV A;  4J15 A;  2K5H A;  1KD1 C;  2EXD A;  1M90 C;  1GM5 A;  2B3G A;  2UUC Q;  1XNQ Q;  1B7Y B;  3UDI A;  5IYD G;  3T1H Q;  4BA2 I;  4YCU A;  1N34 L;  3I4O A;  1S3O A;  2K75 A;  3KYH C;  4LW1 A;  4GOP B;  3F1Z A;  1VQG A;  1Y1V H;  2JQO A;  4BXX G;  4A3G H;  1GD7 A;  2K5V A;  5GQO A;  5IP9 G;  3A5Z B;  5C4J H;  3ICE A;  4YCV A;  2BH8 A;  1HR0 Q;  2UXD L;  5JJL A;  5C3E G;  2B29 A;  2VW9 A;  2E8G A;  3FP9 A;  4DV4 L;  1JB7 A;  2R93 H;  1AH9 A;  3RN5 A;  3K0X A;  4QJF A;  4JBK A;  1N34 Q;  4DNI A;  1UWV A;  3STB C;  4HJ9 A;  2E5L L;  3VDY A;  1EFW A;  5M3F H;  3I4M H;  1K8G A;  4GNX A;  4LFB L;  2RHQ B;  1XTD A;  1MIU A;  3BZC A;  1I5F A;  1KHI A;  2UXD Q;  1E1O A;  2CQO A;  3E9I A;  4A75 A;  4DV4 Q;  1T9H A;  4A3B H;  4HJA A;  2V1C C;  2ZJR A;  2EIF A;  1PH1 A;  5FJ8 H;  2E5L Q;  1X3G A;  1I3Q H;  3AFP A;  1XMQ L;  4PMW A;  1X3E A;  3HOU G;  3PO3 H;  4LFB Q;  1MJC A;  1WYD A;  1X56 A;  1Q86 C;  1NMG A;  4JI2 L;  2C35 B;  1FL0 A;  4IPD A;  4A3D H;  1AE2 A;  2I5L X;  3OTO L;  2PNH A;  5BR8 Q;  4DR7 L;  1XMQ Q;  3J80 i;  3S1R H;  3D0F A;  2ASB A;  1PH7 A;  2CCZ A;  1CKM A;  1XPU A;  3GTG H;  1CKN A;  4RG1 A;  4A76 A;  1J6Q A;  1YHQ A;  2ATW A;  1B8A A;  4JI2 Q;  2UXC L;  1L2F A;  1OXX K;  2NZH A;  2AWO A;  2XGT A;  5J3B A;  3GTQ H;  2BA0 A;  1X65 A;  3OTO Q;  4DR7 Q;  3GTK H;  1I94 L;  5H1S E;  4A3E H;  1N32 L;  4DR2 Q;  3UE1 A;  1S72 A;  5C44 G;  4A3C G;  1QVC A;  1VCI A;  5K36 G;  4YWM A;  1QVG A;  3OYY A;  3CCS A;  2UXC Q;  3TEH B;  1JT8 A;  3PO2 H;  2WB1 G;  1SMX A;  2Q2U A;  5C0X J;  2R7Z H;  3PIO A;  1PH5 A;  1VQL A;  3GD7 A;  1I94 Q;  1VQO A;  3PUZ A;  4A3I H;  2IX1 A;  3H3V I;  1VQ8 A;  1PH9 A;  4JV5 L;  3CXC A;  1PYS B;  4BY7 G;  2K50 A;  1VQ9 A;  3WWV A;  3HFZ B;  4DR1 L;  4KHZ A;  4A3K G;  1WFQ A;  3J81 i;  3AFQ A;  3PIP A;  5EAY A;  1KRT A;  4B3M L;  1JJC B;  4L5T A;  1X54 A;  3CPW A;  4NXM L;  3M7N A;  1G29 1;  4A93 G;  1VQD A;  3HOX H;  4IPC A;  4DV1 L;  4JOI A;  4EQ5 A;  4DR5 L;  2E2J H;  4DR1 Q;  2R6G A;  2GVA A;  4KLK A;  3TS0 A;  1XPO A;  3ULL A;  1HNZ L;  4B3M Q;  1XNR L;  4BBS G;  1Z47 A;  3U58 A;  4NXM Q;  5IYD H;  4GN4 B;  1QUQ B;  5M5X H;  5IP7 G;  2KHJ A;  1BBU A;  4DV1 Q;  4BXX H;  4GKK Q;  2OCE A;  4JG2 A;  3S16 H;  1Q12 A;  4X6A H;  5IP9 H;  3STB D;  3JAM c;  4DV0 L;  5IE8 A;  2KBN A;  2VUM G;  4C3I H;  3RR5 A;  1BBW A;  1EQR A;  4X65 L;  5C3E H;  1HNZ Q;  1M1K C;  3M85 A;  4WJ4 A;  4A4I A;  2DUD A;  3S17 H;  3L0O A;  2ZM6 L;  1YJ9 A;  4A3L H;  2MO0 A;  2NZO A;  4PZ7 A;  4JI4 Q;  2F3I A;  1HNW Q;  2RCN A;  1UE1 A;  3RZD H;  4JBW A;  4LUO A;  4HJ8 A;  4DV6 L;  2KCM A;  3EBE A;  4QIW E;  5E7N A;  1NJI C;  4X65 Q;  1Q81 C;  3TS2 A;  4APV A;  2N3S A;  3FHW A;  2ZM6 Q;  3ULP A;  1GVP A;  2I0Q A;  3HOY H;  1KL9 A;  4B3R L;  1WOC A;  2IHF A;  3AEV A;  1EIY B;  1K3R A;  3H15 A;  4GOP A;  4R4C A;  3A0J A;  3HOU H;  3HOZ G;  1E3P A;  4OXP A;  3I4N G;  1BVS A;  2Q2H A;  1U5K A;  2PQA B;  3A74 A;  3J7A 5;  4IPH A;  4LF7 L;  4OWX B;  1SRO A;  4GKJ Q;  5IY0 A;  4JCV E;  3EN2 A;  3KJP A;  4B3R Q;  4KHP L;  2ID0 A;  1C9O A;  1G51 A;  2QEX A;  1HZ9 A;  2MFI A;  4OX9 L;  3M9B A;  1J5E L;  3HOW G;  5ELO A;  4Y52 H;  2GN5 A;  4LF7 Q;  1CKO A;  1VQE A;  4B3S Q;  3T1Y Q;  2JA7 G;  4KHP Q;  1ASY A;  4DR6 L;  1KC8 C;  4OX9 Q;  1S40 A;  4R1J A;  2Q2T A;  3G6E A;  1SR3 A;  5C44 H;  3CCL A;  1YNX A;  3M4Q A;  4A3C H;  1QZH A;  5JJI A;  1J5E Q;  1O7I A;  2DGY A;  3W1G A;  4TVA B;  1N36 L;  2NN6 I;  1FGU A;  3I7F A;  3PV0 A;  5M5W H;  4B3T L;  4JI6 L;  1GKH A;  1Q82 C;  1WCM G;  5GAG C;  1HNX L;  4DR4 L;  3DM3 A;  2Y0S G;  2NVY H;  3RLN A;  1TWC H;  4UP9 A;  2UUA L;  1VQP A;  1EUJ A;  3ER0 A;  3E0E A;  3K7U C;  5C0X G;  4GNX C;  4MZ9 A;  4YWK A;  1LTL A;  3G48 A;  1UE7 A;  3I56 A;  4B3T Q;  2IHE A;  4DR4 Q;  4JI6 Q;  3FKI G;  4HJ5 A;  4IOC A;  1VQ7 A;  3M4O H;  4BY7 H;  4JYA L;  1HNX Q;  1HZC A;  3PUV A;  1IYJ B;  2ZTE A;  1IBK L;  1RIP A;  1Q7Y C;  3KOJ A;  2UUA Q;  1PYB A;  1C0A A;  1E24 A;  3CC4 A;  1V43 A;  1GO3 E;  1LUZ A;  4A93 H;  1HZA A;  1B70 B;  2YTY A;  3JC6 6;  3PUX A;  1MKH A;  4A3F G;  1VQA A;  5C4X G;  4GN3 B;  4JYA Q;  1NBW A;  2K5N A;  1IBK Q;  2NN6 G;  3MXN B;  1YZ6 A;  2JK8 A;  4BBS H;  5HGQ A;  2MO1 A;  3OW2 A;  2HT1 A;  5IP7 H;  5JEA J;  4O0A A;  1PH4 A;  4K0K L;  2D0P A;  2N78 A;  3H3V H;  5FLX c;  2VUM H;  3EIV A;  2B63 G;  1QZG A;  2WFW A;  2QA4 A;  3KDF B;  2Y0S E;  4DAY B;  4MTN A;  3L2P A;  2F4V L;  2UUB L;  3W1B A;  5LMU L;  5LMN L;  3TRZ A;  4K0K Q;  5AJ3 L;  1PH8 A;  2YU9 H;  2VS1 A;  2Z6K A;  1CSQ A;  1CSP A;  3AYH B;  2Z6K C;  4NXN L;  2UU9 L;  1L1O B;  1ASZ A;  4JI7 L;  1P16 A;  1N32 Q;  5IYB G;  4R4I A;  2UUB Q;  4IFD J;  2NVX H;  4LWC A;  5LMU Q;  1HH2 P;  1OXS C;  2R7F A;  1YIT A;  5LMN Q;  1PH6 A;  1LYL A;  2I5M X;  1QVF A;  1QUQ A;  2CWP A;  3CCE A;  1JJG A;  1PV4 A;  3F2D A;  1UE5 A;  2RHS B;  3HOZ H;  1IL2 A;  4LF5 L;  3PF5 A;  3I4N H;  4NXN Q;  3S2H H;  2UU9 Q;  4HJ7 A;  1OXT A;  3NEM A;  3F8T A;  4R4Q A;  4NPS A;  4RMF A;  4JI7 Q;  1KIX A;  1PVO A;  2VL6 A;  2VQE L;  1SLJ A;  1W2B A;  2OWO A;  4JV5 Q;  1EOV A;  1IBM L;  4JOI C;  2XTI A;  3B6Y A;  4UPA A;  1CUK A;  1X6O A;  5FLM G;  3CME A;  3GTM H;  1YVC A;  3CMA A;  5IYC G;  2EQS A;  4LF5 Q;  3PF4 A;  1CKN B;  3HOW H;  3GTO H;  3K80 C;  2JA6 G;  1AE3 A;  4TQU S;  5DLQ E;  2VQE Q;  3HKS A;  4YWL A;  1IBM Q;  2JA7 H;  4DR5 Q;  3S1N H;  3CD6 A;  5FJ8 G;  3HKZ E;  4LNQ A;  1TWF H;  1N9W A;  2PI2 E;  3CP0 A;  3W5O A;  1XNR Q;  5IWA L;  4XTC S;  3PO3 G;  4IJL A;  4JBJ A;  2VQF L;  1WCM H;  4DV3 L;  2A1A A;  2PQA A;  3K8A A;  3GTL H;  4QY7 A;  1OTC A;  4DV0 Q;  4GLX A;  2I5H A;  1Q1E A;  1OXU A;  3JAM i;  2R7D A;  1VQJ A;  2GVB A;  4ALP A;  1MJE A;  4JBM A;  4C3H H;  4BBR G;  1V1Q A;  5IWA Q;  1P8L A;  4HIM A;  4DUZ L;  2YYZ A;  3FKI H;  2VQF Q;  4DV3 Q;  4H02 A;  2K4K A;  1WI5 A;  4GLA C;  5JJK A;  3TQY A;  3U4Z A;  3HOV G;  1VQB A;  1RL2 A;  4X66 L;  4IPG A;  4DV6 Q;  4HIO A;  4GOP C;  2VZA A;  1N8R C;  4P72 A;  2OTJ A;  4A3F H;  4DUZ Q;  1IXR A;  2PMZ E;  5C4X H;  2UXB L;  3BU2 A;  4LF8 L;  3I2Z A;  4YY3 L;  1VQN A;  3RZO H;  4AQY L;  3ZJY C;  4A3M G;  4UP8 A;  1Y1W G;  4C3J H;  4YHH L;  4LFA L;  2JA8 G;  2YTV A;  2IX0 A;  2AHO B;  2WAQ G;  4PZ8 A;  4BA1 I;  3ULJ A;  1VQH A;  4A3I G;  4IFD I;  3KF6 B;  4X64 L;  4R4O A;  2UXB Q;  2KEN A;  3UDG A;  2VNU D;  5JEA G;  4JI5 L;  4DUY L;  1TWG H;  2JA9 A;  2LXJ A;  3GO5 A;  4PG3 A;  4YY3 Q;  1Z9F A;  3A5U A;  1K8A C;  4AQY Q;  4EX5 A;  2YTX A;  2HHH L;  1HJP A;  4YHH Q;  4C2M H;  5LMN W;  1XPR A; 
#chains in the Genus database with same CATH topology
 2WP8 J;  1DGS A;  5ELF A;  5HY6 A;  1SFO H;  4JI1 L;  2SNS A;  1X55 A;  5M3F B;  4DR6 Q;  3VR3 A;  3A8K E;  4L5S A;  4NP5 A;  1N36 Q;  1SRU A;  2KJX A;  4POF A;  4A3B B;  3E3X A;  2K7V A;  4JI1 Q;  1LTA D;  2K5D A;  5E4X A;  3DEO A;  3PCO B;  2F52 A;  4LUV A;  5KIX A;  5JPN C;  1B2T A;  4DAY A;  3KLW A;  4A3L G;  3TN2 A;  2N8N A;  4IUP A;  3UE0 A;  3WDN A;  1EWI A;  4PV1 C;  4A3D B;  2SNM A;  5KGU A;  2EYO A;  3S2D H;  3UDX A;  1Q8K A;  1TWA H;  4WJ3 M;  3QB3 A;  4RCO A;  4AH6 A;  1L1O A;  1CZG A;  2YV5 A;  3NWT A;  1Q1B A;  5BR8 L;  3J80 c;  1FVI A;  2XRQ D;  4TKO B;  3FRP B;  3K58 A;  2CKZ B;  3OIQ A;  2BDN A;  2VY3 A;  5CC4 A;  1OO9 B;  2F0M A;  3S9W A;  2KCT A;  4JC0 A;  3TRE A;  5EKL A;  5KNC A;  2JE6 I;  3GDE A;  4OWW B;  4JW0 A;  2R93 B;  5GAH C;  1BUV T;  4KKU A;  1ENF A;  4LF6 L;  3HOV H;  3H91 A;  2NWG A;  4IUQ A;  3U9O A;  3I4N B;  3RN2 A;  3CCU A;  2Z4H A;  2G9H D;  3NWS A;  5COR A;  2RDG A;  4IUV A;  5JVH 3;  4LF6 Q;  5CR3 A;  1AEX A;  1G2S A;  1LT3 D;  1KXL A;  4X62 L;  3BG3 A;  4G57 A;  4V19 0;  1EYG A;  4K2K A;  5IOD A;  5ELE A;  3K57 A;  4C3I B;  1TWF B;  5C3E B;  4K6D A;  2LXK A;  1Y8P B;  1UEB A;  4O2D A;  4X62 Q;  2F3V A;  1X9N A;  2JJQ A;  2ZJQ A;  1HR0 W;  3BVG A;  5L37 A;  1PH2 A;  4GLV B;  1YJW A;  1HNW L;  1A3V A;  5FKA C;  2D0O A;  3CRL C;  2RF4 A;  3KF6 A;  3V2T A;  1QCB D;  1YHA A;  1SSO A;  1PHJ A;  2WB1 E;  2Q8I B;  4L5R C;  3I73 A;  1DYQ A;  1E7Z A;  1UEA B;  2EOT A;  2F0O A;  4Q5V A;  3H0G H;  3GQB A;  5C4H A;  3NK9 A;  1ESR A;  4X66 Q;  2Z4I A;  3MHB A;  1E22 A;  4HR7 B;  4CDD C;  2ZTD A;  4G4K A;  4GN5 A;  4GKJ L;  1Y8N B;  4ZCK A;  1YJN A;  1EZ8 A;  2MPM A;  1JOR A;  4LFA Q;  3TP8 A;  2FMM A;  1Q46 A;  2F3W A;  1OXV A;  3CW2 C;  2FXQ A;  4DUY Q;  1HPC A;  1TII D;  1K83 H;  3T56 B;  4QQB X;  3CCV A;  4H7B A;  4FXG C;  5JAV A;  1Z7T A;  3LX0 A;  1VQG A;  1Y1V H;  2JQO A;  4A3G H;  1GD7 A;  5GQO A;  5IGC A;  3ICE A;  1AFP A;  1D1I A;  1O78 A;  2NTT A;  2QCP X;  3A7A B;  4OGQ C;  1JB7 A;  4QJF A;  4QUF A;  1UWV A;  1KDC A;  3VDY A;  3I4M H;  1IHZ A;  1K8G A;  4C56 C;  4BBS B;  1MGS A;  2RDH A;  1JQY D;  2I07 B;  4U67 3;  3SR1 A;  2RCF A;  2ZJR A;  3GTP B;  3EVQ A;  1GUN A;  1X3G A;  3AFP A;  1F2L A;  3I3C A;  3ND8 A;  1MJC A;  1I6V C;  5K5P A;  4U68 A;  3DMU A;  2C35 B;  1PTO B;  4Z9C B;  1HRJ A;  2P5Z X;  3S1Q B;  5CV8 A;  1L0Y B;  3D0F A;  4E6I A;  1E0B A;  4XXE A;  1QJO A;  4RG1 A;  4KD3 A;  3T51 B;  1J6Q A;  1B8A A;  2NZH A;  2AWO A;  2XGT A;  3OIP A;  3QIA A;  1EY5 A;  3HOZ B;  5H1S E;  4A3E H;  3S2H B;  1GXD C;  4DR2 Q;  1N32 L;  5C44 G;  4OIK A;  4DF7 A;  1IL8 A;  1STA A;  4K6L A;  4KKT A;  3W2D A;  3OWE B;  4ZLT F;  3CCS A;  4K8I A;  1PH5 A;  1VQL A;  3GD7 A;  1VQO A;  5J39 A;  4A3I H;  1RTN A;  3H3V I;  1EU3 A;  1IKM A;  1PH9 A;  3BYY B;  3CXC A;  3I90 A;  2K50 A;  1VQ9 A;  4A3K G;  2A6E C;  2MP1 A;  1WFQ A;  3AFQ A;  5IGD A;  4B3M L;  4OL7 A;  1JJC B;  4L5T A;  1X54 A;  1CI3 M;  1VQD A;  4IPC A;  1F77 A;  2Y0S B;  4EQ5 A;  1AP0 A;  3E6Z X;  2E2J H;  3J81 L;  2R6G A;  3ULL A;  1HNZ L;  4B3M Q;  1Z47 A;  2MGS A;  2LMC B;  1QUQ B;  5M5X H;  1VF7 A;  5IP7 G;  1BBU A;  3NPP A;  4IFD H;  4B9X A;  3RR5 A;  1WTR A;  1HNZ Q;  3L0O A;  1GOZ A;  3NE5 B;  1IYU A;  1J8I A;  1HQR D;  1D5Z C;  5C4X B;  1WTO A;  2SDF A;  2K5W A;  4LUO A;  4DV6 L;  5E7N A;  3D4W A;  1I50 B;  2D5D A;  1Q81 C;  3Q23 A;  4APV A;  3TS2 A;  3FHW A;  1EWH A;  3L9A X;  3O13 A;  4B3R L;  3AEV A;  2OEO A;  4OHJ A;  1DOM A;  4R4C A;  4J1M A;  4OXP A;  1BVS A;  2Q2H A;  3A74 A;  1T5E A;  3K59 A;  2RA4 A;  3GTJ B;  1SRO A;  5IY0 A;  1SFO B;  4B3R Q;  4ZKB B;  2ID0 A;  1CQV A;  1HZ9 A;  1PYW D;  2QEX A;  3D6W A;  4K5X A;  4Y52 H;  2GN5 A;  2FFK B;  2JA7 G;  4B3S Q;  1ASY A;  1EOT A;  1Y69 U;  2QDL A;  1GUW A;  1QZH A;  2A6H C;  3I7F A;  4DR4 L;  2JXM B;  4F87 A;  1Q82 C;  1HNX L;  2F0L A;  1TS4 A;  4M1U B;  4KK7 A;  2A6E D;  5E3F A;  5CBA E;  1PTO C;  1EUJ A;  3SK6 A;  1TWA B;  1PFB A;  2C9O A;  5C0X G;  3K5M A;  4YWK A;  4GNX C;  2FHT A;  1UE7 A;  1HUM A;  1PFM A;  2D9U A;  2IHE A;  2ZXO A;  4DU9 A;  4DR4 Q;  1Q8I A;  4JYA L;  2NZ1 D;  5CV9 A;  1HNX Q;  2PYK A;  1HZC A;  1LAB A;  3PUV A;  1Q7Y C;  1I3Q B;  1EWC A;  2PQE A;  3PO3 B;  5EPJ A;  1LUZ A;  1HZA A;  1B70 B;  2IJ0 A;  2YTY A;  4A3F G;  4JYA Q;  5C5M A;  2H4O A;  3IFD A;  5HGQ A;  2MO1 A;  1PH4 A;  1QB5 D;  3D6C A;  3T53 B;  3HOV B;  2VUM H;  3MXU A;  1ZYR D;  2B63 G;  2EJF C;  1EY7 A;  4FF4 A;  5T1G A;  2EY6 A;  3KDF B;  3VR4 A;  5IT9 E;  4RGT A;  1BR9 A;  5AJ3 L;  2YU9 H;  3URY A;  4CBV A;  1VDZ A;  4JI7 L;  1ASZ A;  3FPP A;  4R4I A;  1O7L A;  1HH2 P;  1YIT A;  1ENA A;  3KLS A;  1S5C D;  1PH6 A;  3F2D A;  4LF5 L;  3I4N H;  2AUK A;  1U4P A;  3WOE A;  4JI7 Q;  3F8T A;  1ML0 D;  3SEB A;  1TKW B;  1D5M C;  1SLJ A;  5DM7 3;  3D4D A;  1IBM L;  4JOI C;  2PZU A;  2XTI A;  3B6Y A;  2E76 C;  3UI2 A;  1CUK A;  1B50 A;  2CW0 C;  2QIL A;  4LF5 Q;  2A6H D;  2K5Q A;  1AE3 A;  4TQU S;  1SMY D;  3HKS A;  4YWL A;  1IBM Q;  4RHR A;  4DR5 Q;  3C3L A;  5FJ8 G;  1BDO A;  1PTO D;  1TWF H;  2XN9 C;  4DN4 M;  1N9W A;  2PI2 E;  2B2T A;  5I6W A;  2F0D A;  2LY7 A;  1WCM H;  1B44 D;  3A8I E;  2MUY A;  3K6O A;  4QY7 A;  3MXG A;  2H1E A;  1F9Q A;  4GLX A;  5NUC A;  3H0G B;  1NR2 A;  4LJZ C;  2GVB A;  4C3H H;  4G7Z C;  4BBR G;  4HIM A;  2XNA C;  3ERQ A;  1Y8O B;  1KLU D;  3CKI B;  4GLA C;  3D3R A;  3U4Z A;  1ZXT A;  1NSN S;  2M9V A;  4KHV A;  5BN3 A;  4GOP C;  3QR8 A;  3HKZ B;  2OTJ A;  2PMZ E;  2N55 A;  1K0S A;  3I2Z A;  2B2W C;  4YY3 L;  3RZO H;  4A3M G;  1K83 B;  1Y1W G;  4MHE A;  5T1I A;  4FXD A;  4PZ8 A;  1PTO F;  2CHB D;  1STH A;  4RH6 A;  4L63 B;  3VYU A;  2VNU D;  2K01 A;  1Y1V B;  1ZKO A;  4A3G B;  2JA9 A;  4YY3 Q;  3NTI A;  1D7Q A;  1G8Z D;  2F0U A;  1YNN D;  4F7X A;  4H0L C;  2V4D A;  4C2M H;  4N9T A;  2NVY B;  2SOB A;  2MQH A;  1B9M A;  2NVQ H;  3I4M B;  1S5E D;  2A19 A;  1V1O A;  2K14 A;  1E1T A;  2EPB A;  4NB3 A;  1CHP D;  1STB A;  1TXY A;  3LGJ A;  4BY1 G;  3G4S A;  4ZK9 B;  1Y14 B;  1PA6 A;  1B3A A;  3TDQ A;  1J9O A;  1V1P B;  3DWA A;  4TSS A;  4P2C B;  4TRD A;  1U0L A;  1A8V A;  4KJN A;  3CQZ H;  5FLM H;  1W3S A;  2ES2 A;  3DXJ C;  4GS3 A;  1STE A;  2A69 D;  2JA6 H;  1JJ2 A;  3RNU A;  3CCM A;  4HID A;  1K73 C;  3HOY G;  5M3M G;  1EEF D;  3GTP H;  3MEF A;  1VQC A;  3J81 j;  1SYF A;  1C7Y A;  3ND9 A;  4ZUJ A;  1LTI D;  2JA5 G;  3NBH B;  4HN7 A;  3Q6S A;  4LF4 L;  3S1Q H;  1DOL A;  1XXG A;  4JI3 L;  4POG A;  3E9H A;  4QL5 A;  4WOR A;  2F4V Q;  2IX3 A;  4P74 A;  5D3D A;  2J0T D;  5GRO A;  1NMF A;  4DPG A;  5C3W A;  4LF9 L;  4UY8 C;  5FLX L;  4LF4 Q;  1YEZ A;  4JI3 Q;  3ITP A;  2KA7 A;  2D62 A;  1BOS A;  4P75 A;  5I6Y A;  4MIU A;  3J81 c;  4L5Q A;  4LF9 Q;  4OON A;  2KUM A;  2JA8 H;  3FMC A;  1NE3 A;  3GTO B;  5M5X B;  2A8V A;  4AYB G;  1VQ6 A;  2N88 A;  1YI2 A;  4YCW A;  1N33 L;  1HHV A;  3JAM E;  1H95 A;  4GKK L;  1A0I A;  2B39 A;  3RUZ A;  1RCV D;  1SE3 A;  1N33 Q;  4JI4 L;  2F0E A;  2IWH A;  1VQK A;  4HMI A;  3TP5 A;  1CM9 A;  2QEJ C;  3DHQ A;  1A62 A;  3CCR A;  1XJV A;  1VQM A;  3CAM A;  4ZUI A;  2B2V C;  3PUW A;  3PO2 G;  2R7Z G;  4AYB E;  1AZP A;  1I50 H;  3Q24 A;  2EVB A;  4ZQ3 A;  4DA2 A;  1CT1 D;  2TSS A;  4LF8 Q;  2EJM A;  4DXG A;  2KEE A;  4HTH A;  3BDC A;  1VMC A;  3EA6 A;  3M4P A;  2UUC L;  3MZ5 A;  1GHJ A;  2OQ0 A;  3T1H L;  1ENC A;  3HOX G;  1BKB A;  4J6H A;  3GTJ H;  2K52 A;  3T1Y L;  5GAD C;  3KJO A;  3D31 A;  1HR0 L;  1SN8 A;  4Y7N B;  4J15 A;  5FOB B;  2K5H A;  2KVM A;  3ERO A;  2EXD A;  5F2D A;  1ET6 A;  1M90 C;  2UUC Q;  5IYD G;  3T1H Q;  5IP9 G;  2NBF A;  4YCV A;  1S5B D;  2BH8 A;  1D5X C;  1HR0 Q;  1SJH D;  3Q0A A;  2B29 A;  2VW9 A;  5FK9 C;  3FP9 A;  4NKL A;  4HSP A;  4HJ9 A;  3STB C;  3QWN A;  4GNX A;  2B2Y C;  1MIU A;  3BZC A;  1SNQ A;  3A8J E;  1I6H B;  4A75 A;  1F9P A;  5EQ0 A;  2EIF A;  5CV5 A;  1PH1 A;  2RBM A;  3I91 A;  2IW3 A;  3MWY W;  4KD4 A;  1E2W A;  2VUM B;  1I3Q H;  3HZX A;  1GHK A;  3HOU G;  2BCO A;  3GV6 A;  3PO3 H;  1WTX A;  1AW7 A;  1NMG A;  4HED A;  4XQJ A;  4IUU A;  2YU9 B;  2I5L X;  5BR8 Q;  4H13 C;  4CKE A;  3J80 i;  4DNT B;  1PH7 A;  5C5L A;  1CKM A;  1Q90 A;  3SXH A;  4XQQ A;  5LL6 X;  2UXC L;  3QOJ A;  1RTO A;  1OXX K;  2ICE C;  2JSO A;  4RAU C;  3GTQ H;  1X65 A;  2HDM A;  2O2L D;  4V0B A;  1I94 L;  2KOL A;  4A3C G;  5E1F A;  1VCI A;  1LTR D;  2UXC Q;  1JT8 A;  3TEH B;  1VMP A;  2WB1 G;  2Q2U A;  3PIO A;  4A3M B;  3IKJ A;  1Y1W B;  1I94 Q;  5KYI A;  4UAI A;  5EBC A;  5I9P A;  4R8I A;  4KY6 A;  3LWE A;  5FO9 B;  1VQ8 A;  5EPL A;  4BY7 G;  3WWV A;  4DR1 L;  2DNE A;  5IT9 L;  1KRT A;  1EYC A;  2K28 A;  3P20 A;  1G29 1;  4A93 G;  1U4M A;  1WCM B;  2IL8 A;  3OSO A;  4JOI A;  4XYQ A;  2F0J A;  3OPO A;  1HA6 A;  4DR1 Q;  1XPO A;  4KMU C;  4ZAI A;  2WIN B;  1Z6H A;  4CJ0 B;  4C3H B;  2OCE A;  3S16 H;  4X6A H;  2F0F A;  3STB D;  4DV0 L;  2KBN A;  4BY1 B;  3H09 A;  1BBW A;  1EQR A;  2B8G A;  4X65 L;  1R4Q B;  3M85 A;  4X3K A;  2DUD A;  4A4I A;  1A2U A;  2ZM6 L;  2Q8T A;  2MO0 A;  1HNW Q;  2F3I A;  2OT2 A;  4N9P A;  3RZO B;  3A7L A;  3EBE A;  4QIW E;  4XYO A;  4X65 Q;  5EBD A;  4LK1 C;  3SK8 A;  4EVO A;  4EQP A;  2ZM6 Q;  5D14 A;  2I0Q A;  3VR5 A;  5M3M B;  1KL9 A;  4MN3 A;  1WOC A;  2IHF A;  5TSS A;  2FIN B;  1K3R A;  4GOP A;  4ODG A;  1TQO A;  3TZU A;  1U5K A;  4C2M B;  1RKN A;  2PQA B;  4OWX B;  3LNN A;  2B2W A;  4GKJ Q;  3EN2 A;  5JPM C;  4OX9 L;  2O5J C;  2NVQ B;  3M9B A;  1J5E L;  3A54 A;  3HOW G;  1WD1 A;  4B08 A;  1CKO A;  1F2Y A;  4OX9 Q;  4R1J A;  1D2B A;  1DD2 A;  4DK1 A;  5C44 H;  3CCL A;  3M4Q A;  5JJI A;  2F0W A;  1CK1 A;  1J5E Q;  1O7I A;  1S5D D;  2DY7 A;  2NN6 I;  1FGU A;  4NW2 A;  2PW7 A;  1EEI D;  1GKH A;  1EY0 A;  2NVY H;  1SEB D;  1NCV A;  1TWC H;  3CQZ B;  2UUA L;  1ROD A;  1VQP A;  2RVL A;  3K7U C;  4MZ9 A;  1S5F D;  3G48 A;  2JA6 B;  2X6L A;  3FKI G;  1I4H A;  1CZW A;  3A56 A;  5I4D A;  1IBK L;  1IYJ B;  1RIP A;  3M4Y A;  2UUA Q;  3KF8 A;  5KNB A;  3CC4 A;  1V43 A;  5FLX E;  1MKH A;  1VQA A;  3K5O A;  2PCF B;  3PIO 3;  1IBK Q;  2NN6 G;  2BE5 C;  1A2T A;  5IP7 H;  1RHP A;  2F1M A;  2G9D A;  4K0K L;  3DM1 A;  2N78 A;  3H3V H;  5FLX c;  1WTP A;  2QDB A;  1T5X D;  3R8B A;  2WFW A;  1TS3 A;  1QZG A;  4DAY B;  1Q3L A;  3L2P A;  3W1B A;  5LMU L;  1QG7 A;  5LMN L;  3TRZ A;  4K0K Q;  1PH8 A;  5C4Z A;  2VS1 A;  2Z6K A;  4KJO A;  3AYH B;  1JE4 A;  2WV6 D;  1G6Z A;  1L1O B;  2JA8 B;  1P16 A;  5EGT A;  1N32 Q;  2PW5 A;  5IYB G;  2NVX H;  5LMU Q;  2M2L A;  5LMN Q;  2I5M X;  3R2T A;  1UE5 A;  5DEH A;  4MTK A;  2VL6 A;  3BDO A;  2VQE L;  3GP7 A;  1LT6 D;  1G91 A;  3CME A;  3GTM H;  3CMA A;  5IYC G;  1DXM A;  4XQN A;  2KCN A;  3GTO H;  1C4Q A;  2VQE Q;  4F8M A;  1YNJ D;  1TU2 B;  2JA7 H;  2MJ8 A;  4XT1 B;  3HKZ E;  3U9S A;  4LNQ A;  1B9N A;  1HCZ A;  5KRU A;  3CP0 A;  4XTC S;  3C1F A;  2VQF L;  2A1A A;  1MBY A;  1OTC A;  1ZYR C;  1Q1E A;  3KLR A;  1OXU A;  5C0X H;  3F2U A;  3RMH A;  4ALP A;  5D65 A;  1P8L A;  4DUZ L;  1H9S A;  2YYZ A;  2VQF Q;  2LS0 1;  1A15 A;  1WI5 A;  3JAM L;  1ICF B;  2BE5 D;  5J22 A;  3HOU B;  4X3S A;  1RL2 A;  4DV6 Q;  2HCI A;  3VR2 A;  4F88 A;  4A3F H;  4C1N I;  4DUZ Q;  2EJG C;  1QIL A;  2Z9H A;  2F03 A;  1VQN A;  1QE6 A;  5J1Z A;  4AQY L;  1B1Z A;  4ULL A;  2EXZ A;  2EY2 A;  2IX0 A;  2AHO B;  2WAQ G;  4IFD I;  1VQH A;  4A3I G;  1PMR A;  3KF6 B;  4H44 C;  2GA4 B;  2KEN A;  1H9M A;  5JEA G;  1PFN A;  1TWG H;  3NTK A;  4AQY Q;  1ET9 A;  2G5D A;  4EX5 A;  2HHH L;  1HJP A;  1STN A;  5LHY 1;  3CRK C;  5K36 H;  3W3A A;  1KDB A;  5LMN W;  1XPR A;  2QGQ A;  3ERS X;  1SMY C;  2HQL A;  4EQO A;  3BYT B;  4JK1 C;  1LO5 D;  4N8F A;  1WJJ A;  2R92 G;  1CA6 A;  2DJG C;  1FJG L;  4Y7N H;  2ZTC A;  4DR3 L;  2HHH Q;  4DV5 L;  3Q22 A;  4HIK A;  5HGT A;  4A3J G;  3M4O B;  4CDF C;  3K0Y A;  4IFD G;  2ZJP A;  2LSS A;  3PMF A;  3I55 A;  4KI0 A;  1FJG Q;  4DR3 Q;  1AZQ A;  2OF1 A;  1PFS A;  4DV5 Q;  1JE5 A;  1I4P A;  2WAQ E;  5IGG A;  3S24 A;  3U50 C;  2OTL A;  2B2Y A;  5M5Y H;  3HS0 C;  4DKA C;  1ZEQ X;  2FMC A;  1F9R A;  1I6H H;  2HIV A;  1L1O C;  1B4O A;  2CWA A;  2E74 C;  3TBI B;  3WOF A;  3GTQ B;  4ILW A;  1VQ5 A;  1M4V A;  5D3I B;  5IGB A;  2L15 A;  1A63 A;  5CBE E;  2EZV A;  1EY9 A;  2EY5 A;  3AQQ A;  3J7A V;  2O5I C;  5KYL A;  1YBY A;  3RLO A;  4RKB A;  2J7Z A;  1K0R A;  4OWT B;  1YNN C;  2K05 A;  4BBR H;  1PXU A;  1I4X A;  1MI2 A;  5BN5 A;  5AJ3 Q;  1K8O A;  1XWE A;  3K7A H;  3KF8 B;  1SYB A;  2L55 A;  5IT9 c;  2F0V A;  4JVZ A;  3NP8 A;  2XWJ B;  2L1B A;  2F4I A;  3Q8D A;  1UNS A;  2R93 G;  1SNM A;  1H9R A;  4LFC L;  1ICW A;  2MHV A;  4A3M H;  1Y1W H;  2BH2 A;  5M3F G;  4DXF A;  4JI8 L;  1EIF A;  1IBL L;  1SAP A;  3TP6 A;  4K5V A;  2A5H A;  2MNA A;  2Z0S A;  3F2B A;  4A3B G;  2WII B;  4LFC Q;  3S16 B;  2ALY B;  4OO1 I;  3S1N B;  1IW7 C;  2AWN A;  1CQF A;  4JI8 Q;  1IBL Q;  2A69 C;  2F0S A;  2EYJ A;  3M7G A;  1SXT A;  5E4W C;  1PLF A;  2CVR A;  3GTL B;  4X3U A;  4BS9 A;  1KQS A;  4A3D G;  2PI2 A;  1YIJ A;  3K5N A;  2PO4 A;  4DV2 L;  3PGZ A;  3ONA B;  1F9S A;  3E5S A;  4PZ6 A;  1D8L A;  1RD9 D;  2KHI A;  1UE6 A;  1MSG A;  1TWH H;  4BY1 H;  1JMC A;  2AUJ D;  2OXP A;  4DV2 Q;  5GAE C;  4OO1 G;  2K1B A;  1LM0 A;  1V9P A;  1D1K A;  2E2H H;  1WTV A;  3CCQ A;  1G6P A;  4JI0 L;  4IO9 A;  3M3Y H;  3NHH A;  1EY8 A;  5CV6 A;  1KAW A;  5M3M H;  4CHT B;  4DNR B;  4DAM A;  1C48 A;  1NNX A;  1G2T A;  5C44 B;  4JI0 Q;  2OQK A;  4AIM A;  3MC0 B;  3NXW A;  4ME3 A;  2JA5 H;  3OOC A;  4CDC C;  3N52 A;  3NUC A;  1TWC B;  3S15 B;  1JCK B;  1VQI A;  1VQ4 A;  2DJF C;  4KTA A;  1UAP A;  3MXN A;  3H6M A;  1KD1 C;  1GM5 A;  1X32 A;  1KNE A;  1B7Y B;  1HXY D;  3UDI A;  4BA2 I;  4YCU A;  1N34 L;  3I4O A;  3QO2 A;  1S3O A;  2K75 A;  3KYH C;  4LW1 A;  4BXX G;  4A3K B;  2K5V A;  3S14 B;  1BNZ A;  2JYO A;  4C3I G;  3K5L A;  5C3E G;  3CU7 A;  2FJ2 A;  2E8G A;  2HCC A;  2K6A A;  4DV4 L;  1AH9 A;  3RN5 A;  4KY5 A;  3K0X A;  4N8X 1;  3LWU A;  1N34 Q;  4DNI A;  4JBK A;  1DOK A;  3OWF A;  2E5L L;  1EFW A;  1IW7 D;  4DAV A;  1JOQ A;  2AQ1 B;  4LFB L;  2RHQ B;  1XTD A;  1I5F A;  1CFM A;  1E1O A;  2CQO A;  4PQX A;  5G3L D;  4DV4 Q;  5DAU A;  3AU7 A;  4FO2 A;  4FYD A;  1R4P B;  3SK4 A;  1SNP A;  4HJA A;  2E5L Q;  3HG9 A;  1XMQ L;  1UUP A;  1X3E A;  4LFB Q;  5ELB A;  1BQQ T;  4RHS A;  5FO8 B;  3QG1 A;  3BVZ A;  1BBX C;  1XMQ Q;  3S1R H;  4HCE A;  4QB4 A;  2CCZ A;  1BCP B;  3GTG H;  4A76 A;  2NVX B;  3VYS A;  2XVS A;  2ATW A;  2L11 A;  1WTQ A;  3FDT A;  1QNU A;  3T13 A;  5J3B A;  1FR3 A;  3X3M A;  3GTK H;  3P75 A;  3A55 A;  5CV7 A;  4RFB A;  3T4A C;  4CJ2 C;  1QVC A;  2PZT A;  1KTK A;  3OYY A;  3PO2 H;  1SMX A;  5C0X J;  3NBI A;  5G3L F;  2R7Z H;  3GTM B;  4IUT A;  3PUZ A;  4DK0 A;  4JV5 L;  2NYZ D;  1PYS B;  1GUS A;  2JA7 B;  1LT4 D;  3HFZ B;  3J81 i;  5EAY A;  3S1M B;  4NXM L;  1JC7 A;  4R8N A;  3HOX H;  1WD0 A;  1ESF A;  3FPU B;  1BF4 A;  1LTS D;  2GVA A;  2RKS A;  4EGV A;  4I7A A;  2EY1 A;  1XNR L;  4BBS G;  3FEW X;  3U58 A;  4NXM Q;  5IYD H;  2KHJ A;  1E2V A;  2XWB B;  4GKK Q;  4JG2 A;  3VA7 A;  1VF5 C;  1Q12 A;  5IP9 H;  3JAM c;  1SJE D;  1LLR D;  4WJ4 A;  5JVG 3;  1JOK A;  4DAP A;  4A3L H;  4A3F B;  5CGK A;  4JI4 Q;  2WKC A;  3RZD H;  3X3N A;  4RGM A;  3ULP A;  1GVP A;  4S3S A;  4JPB W;  3FVQ A;  1LTB D;  1TWG B;  2B63 B;  5ELD A;  3HOU H;  3A0J A;  3HOZ G;  2X6G A;  2NVT B;  3DWP A;  4IPH A;  4LF7 L;  4OEM B;  4JCV E;  2DY8 A;  4KHP L;  1C9O A;  1G51 A;  1M8A A;  1V8Q A;  3R3O A;  1H9K A;  5ELO A;  3D4R A;  4LF7 Q;  1F2M A;  1XYI A;  3T1Y Q;  4KHP Q;  1EIG A;  4DR6 L;  1KC8 C;  4IUN A;  1L0X B;  2Q2T A;  2E75 C;  2SEB D;  3G6E A;  2QF7 A;  2A73 B;  3SK5 A;  4A3C H;  2DGY A;  3W1G A;  4TVA B;  1N36 L;  4B3T L;  3PV0 A;  5M5W H;  5GAG C;  2WKD A;  4KV6 A;  3DM3 A;  2Y0S G;  1EFI D;  2PMZ B;  5M5Y B;  3ER0 A;  4B3T Q;  1EY6 A;  4BY7 H;  4IOC A;  1VQ7 A;  4I7Z C;  3M4O H;  1BCP C;  1IYV A;  1PYB A;  3HGB A;  2R3Z A;  4A93 H;  3J80 E;  5CMD A;  5C4X G;  2A68 C;  2J4X A;  4CGY B;  5DM6 3;  2K5N A;  4HMJ A;  3MXN B;  1YZ6 A;  2JK8 A;  4GZY C;  2EDG A;  4C3J G;  4BBR B;  3OW2 A;  2HT1 A;  1I4R A;  1SBB B;  2EYP A;  2F0K A;  2L12 A;  2D0P A;  4HAE A;  1JWM D;  3K7A B;  1A6X A;  2Y0S E;  4L6T B;  1II3 A;  3TP7 A;  2F0T A;  1ILP A;  2DNC A;  1CSQ A;  4ID6 A;  4NXN L;  2UU9 L;  1GUT A;  3EQL C;  4Q0F A;  1QOH A;  1LTT D;  4LWC A;  1HTP A;  1QVF A;  1LYL A;  1QWY A;  3AMU A;  1QUQ A;  4NDX A;  3CCE A;  2KHS A;  3PF5 A;  4NXN Q;  2B2U C;  4HJ7 A;  1OXT A;  2UU9 Q;  1PVO A;  4R4Q A;  4NPS A;  1W2B A;  2OWO A;  4IUR A;  1HUN A;  2QW7 A;  3OMG A;  4FNF A;  2KED A;  3HOW H;  3V05 A;  5CYU A;  4RA8 A;  2Z1C A;  1FNU A;  1TWH B;  4IZ8 A;  3S1N H;  2A74 C;  1NAP A;  1K3B C;  3PO3 G;  3W5O A;  3C2P A;  4CJ1 B;  3S17 B;  2AQ3 B;  4IJL A;  4JBJ A;  2B2T C;  4NMZ A;  4DV3 L;  4YIJ A;  2F0Q A;  3K8A A;  4CDE C;  1BCP D;  3GTL H;  2E2H B;  4DV0 Q;  2I5H A;  4XT3 B;  4KY7 A;  3M3Y B;  2M00 A;  3MA2 B;  4RCN A;  1PZJ D;  1K28 A;  3FKI H;  3HOY B;  4DV3 Q;  2R61 A;  2A68 D;  5LL6 S;  5EPK A;  2K4K A;  4FF2 A;  3TQY A;  3HOV G;  1O7Y A;  2AQ2 B;  4X66 L;  4O1N A;  2VZA A;  1N8R C;  1IXR A;  2O4X A;  2JA5 B;  1A3U A;  4RWS C;  2NN6 H;  2JP1 A;  3OW7 A;  4CKB A;  1JWU D;  4UP8 A;  2HD3 A;  3R93 A;  4LFA L;  3PQI A;  1U4L A;  2YTV A;  4BA1 I;  3ULJ A;  4X64 L;  2EYM A;  2HUG A;  1H9J A;  3UDG A;  5JOB A;  4JI5 L;  3BVM A;  4PG3 A;  3A5U A;  2LXJ A;  2VB2 X;  4DUY L;  1SNC A;  1SYD A;  1Z9F A;  3BDL A;  4LMQ D;  1CHQ D;  1BCP F;  1C8C A;  3IFT A;  4K14 A;  2EYF A;  1EQQ A;  4X64 Q;  1YNJ C;  4DK6 C;  3DUZ A;  4JI5 Q;  1FD7 D;  3S15 H;  1SYC A;  1JIC A;  3PSI A;  1RF2 D;  2BOS A;  3TSS A;  5IYB H;  3I8Z A;  4K8J A;  4AYB B;  3E0J A;  3OHX C;  1VQF A;  2XSC A;  4A3K H;  2K32 A;  3IL8 A;  4FDB A;  3S14 H;  2BA1 A;  2E2D C;  1XMO L;  1R9T H;  3KDF A;  1IKL A;  5EKI A;  2BDO A;  3DEP A;  1VS0 A;  5IYC H;  3V96 A;  3H0G G;  3NQI A;  3S1R B;  5I2X A;  3CC2 A;  1RJT A;  2JEB I;  3MFY A;  3GTG B;  1XMO Q;  5EKK A;  4UP7 A;  4HSV A;  1NY4 A;  4XIG S;  2H5X A;  2AMC B;  2Z6B A;  2HDL A;  2IT1 A;  3GTK B;  4QUC A;  3CHB D;  2RDF A;  4IJH A;  1KDA A;  3G71 A;  4DV7 L;  3HKZ G;  1L0W A;  4G7O C;  2AKW B;  1SE8 A;  3MFG A;  3PO2 B;  5ELC A;  2R7Z B;  4GNX B;  1KRS A;  4DR2 L;  4DV7 Q;  3KLS X;  5EJW A;  3TZD A;  1O80 A;  1EL0 A;  1Y1V G;  4A3G G;  1YHB A;  3BJU A;  1NUC A;  3RLF A;  4XDX A;  2ZXR A;  5HUR A;  5A2Q E;  3CCJ A;  3VA5 A;  3HOX B;  1PH3 A;  4IOA A;  1HTL D;  1S4Z A;  3C1E A;  5BN4 A;  3CPF A;  1HFN A;  4DGZ A;  2E2I H;  2Q2I A;  3I4M G;  1QNK A;  2ENB A;  5IOC A;  3HEJ A;  3PUY A;  2K03 A;  1I4Q A;  2WAC A;  3BZK A;  4LUZ A;  3F2C A;  5JEA H;  3J7Z C;  3C46 A;  1NTG A;  3CC7 A;  3QJY A;  3IAY A;  3J7Y W;  2LFN A;  3S1M H;  2X69 A;  2IY5 B;  1WTW A;  4RKL A;  3BS1 A;  3AB9 A;  1PRT B;  2ZXP A;  4MNO A;  4DFA A;  3RZD B;  2R92 H;  2JEA I;  3HP3 A;  1SNO A;  2HIX A;  1SND A;  1ILQ A;  1IZ6 A;  2KEC A;  4P73 A;  1NR4 A;  4A3J H;  1EIH A;  3KFU A;  3NEL A;  1HQM C;  3EFX D;  3CF5 A;  1K9M C;  4J8Q A;  1MHW C;  1DZ1 A;  4PMB A;  2CFM A;  2C5C A;  4A3E G;  1FNW A;  2B2V A;  1HZB A;  4X3T A;  3SHL A;  3DLL A;  3DWQ A;  3U4V A;  1WVL A;  4C3J B;  5ELN A;  3J7A F;  5C6A A;  1ONL A;  1TT2 A;  4M8A A;  1X3F A;  2VXW A;  3SGI A;  2N49 A;  3K81 C;  4WRD A;  3L7Z C;  2B63 H;  4B9W A;  1MSH A;  1XNQ L;  2NVT H;  3IRB A;  4QGU A;  5M5W B;  2NUC A;  1V1P A;  2WB1 B;  3SVM A;  5C0X I;  2PNR C;  4B3S L;  3UDF A;  4R9W A;  3NEN A;  2TMP A;  4R4T A;  5KEE A;  4P71 A;  4DK3 C;  1FNV A;  1GUO A;  1XNQ Q;  2B3G A;  3ZYY X;  1KAA A;  2RSO A;  1JOO A;  4BY7 B;  4QIW B;  4GOP B;  3F1Z A;  2PPB C;  1C0A A;  5C4J H;  3A5Z B;  5COY A;  1X3P A;  4IAL A;  1SE4 A;  3VR6 A;  2UXD L;  5JJL A;  5DNF A;  4A93 B;  3T16 A;  3NTH A;  2R93 H;  3KUP A;  5M3F H;  3S2D B;  3NBH A;  1TR5 A;  2UXD Q;  2JN4 A;  1KHI A;  1RDP D;  4LAA A;  3E9I A;  1GJX A;  1T9H A;  5I2Y A;  3MVV A;  4A3B H;  2V1C C;  4IN3 A;  4WJW A;  5FJ8 H;  2CH4 W;  4PMW A;  1LV9 A;  3NSW A;  1WYD A;  1X56 A;  1Q86 C;  4JI2 L;  1FL0 A;  2Z8L A;  4RGN A;  4IPD A;  1CA5 A;  4A3D H;  1AE2 A;  2F0I A;  1LTG D;  2PNH A;  3OTO L;  4DR7 L;  1KLG D;  2B8F A;  2ASB A;  1XPU A;  1CKN A;  3MEH A;  1YHQ A;  4JI2 Q;  1L2F A;  3OMC A;  1XTC D;  2BA0 A;  4O42 A;  3OTO Q;  4DR7 Q;  3J80 L;  2DN8 A;  4OO1 H;  3HRZ C;  4L8J A;  3UE1 A;  1S72 A;  3D8G A;  1A3T A;  2F0H A;  5K36 G;  2KQ3 A;  4YWM A;  1QVG A;  1DM0 B;  2RSN A;  1FYC A;  1U4R A;  1PZK D;  1PRT C;  3L3O C;  3HOW B;  1BXT A;  3BZD B;  2IX1 A;  4KN7 C;  3H94 A;  2LKV A;  1CTM A;  1LAC A;  4KHZ A;  1PDQ A;  3EJI A;  2QKI C;  2B2U A;  1EYA A;  3PIP A;  3MXP A;  1E2Z A;  4KKS A;  1JB3 A;  3M7N A;  5AFW A;  3CPW A;  1EZ6 A;  5ISR A;  2I46 A;  4DV1 L;  1STG A;  4DR5 L;  3TS0 A;  4KLK A;  3I4L A;  1B53 A;  3MAQ A;  2PZW A;  1EQT A;  4GN4 B;  3FKI B;  3KBX A;  4DV1 Q;  4BXX H;  1SYE A;  1LT5 D;  5IE8 A;  2VUM G;  4C3I H;  4WFN 3;  4FP5 D;  3SDZ A;  2XIW A;  5C3E H;  1M1K C;  3S17 H;  1YJ9 A;  3KK7 A;  2IPK D;  2NZO A;  4PZ7 A;  3GV3 A;  4UHV A;  2RCN A;  1UE1 A;  3NQT A;  4QCL A;  4JBW A;  4HJ8 A;  1GUG A;  1NJI C;  2KCM A;  4G7H C;  4I65 A;  2N3S A;  1W6K A;  1PZI D;  1TY2 A;  3HOY H;  5KND A;  1EIY B;  2F0N A;  3H15 A;  1EY4 A;  1E3P A;  3I4N G;  3TME A;  5A35 A;  2XRS D;  3J7A 5;  1K8M A;  2K33 A;  3KJP A;  2MFI A;  2EE1 A;  1H9S B;  4K2L A;  1FGB D;  4ME5 A;  2L4N A;  1VQE A;  2VB3 X;  1PRT D;  1S40 A;  1TS2 A;  3G6J B;  1SR3 A;  1YNX A;  1W6J A;  5IGF A;  3P1H A;  3R2I A;  1R9T B;  4JI6 L;  4OEL B;  4FXK C;  1WCM G;  3RLN A;  4UP9 A;  5JJZ A;  1TVX A;  3E0E A;  3MTS A;  3P7J A;  1LTL A;  4C3H G;  3I56 A;  4JI6 Q;  4HJ5 A;  3KBG A;  1F2Z A;  2ZTE A;  2CW0 D;  3KOJ A;  4BWG B;  4FF1 A;  1SDF A;  1E24 A;  4ZRZ A;  5IIF A;  1GO3 E;  1BO0 A;  1SYG A;  3RD4 A;  3JC6 6;  3PUX A;  1DCZ A;  4GN3 B;  1KAB A;  1NBW A;  2D2C C;  1HFG A;  1WTH A;  5IGE A;  4QF4 A;  4BBS H;  4ZYS A;  1PRT F;  4IQZ A;  4O0A A;  5JEA J;  1DJR D;  1MD2 D;  4RGO S;  1JR0 D;  5FO7 B;  3EIV A;  3PIP 3;  2QA4 A;  4A3E B;  1O7Z A;  4MTN A;  2F4V L;  1KNA A;  2UUB L;  2K04 A;  1PTO H;  2NB0 A;  4PNY A;  3I72 A;  1DON A;  1CSP A;  4QMG A;  2Z6K C;  2E2I B;  4HCS A;  1EU4 A;  2WAQ B;  1EYD A;  3J81 E;  4A3I B;  2ICI A;  2UUB Q;  1TY0 A;  1XX8 A;  2CH4 A;  4IFD J;  2L9H A;  1OXS C;  2R7F A;  3N6R A;  1HA5 A;  2RQX A;  2CWP A;  4PMC A;  1JJG A;  1PV4 A;  2L5T A;  2RHS B;  3HOZ H;  1IL2 A;  1I4G A;  3S2H H;  1STY A;  3NEM A;  4RMF A;  1KIX A;  3I70 A;  2NTS A;  1EQV A;  4JV5 Q;  1EOV A;  2E2J B;  4UPA A;  1X6O A;  5FLM G;  2R92 B;  1YVC A;  1U9R A;  2EQS A;  3PF4 A;  4OIJ A;  1CKN B;  3QOL A;  3K80 C;  5C3X A;  3G7L A;  2JA6 G;  5DLQ E;  4ABN A;  4A3J B;  1D6E C;  4K5W A;  2KCC A;  5A2Q L;  3CD6 A;  1XNR Q;  3VYT A;  5IWA L;  2PQA A;  2EYH A;  2F0P A;  4KN4 C;  3JAM i;  4CKC A;  2R7D A;  1VQJ A;  1MJE A;  4JBM A;  1V1Q A;  5IWA Q;  2Q8R E;  2ZT9 C;  4H02 A;  4ZKC B;  4FF3 A;  5JJK A;  1TS5 A;  1VQB A;  4FVM A;  4HIO A;  4IPG A;  4C1N K;  5M9O A;  4P72 A;  1B3Q A;  5C4X H;  2EYL A;  2UXB L;  3BU2 A;  4LF8 L;  2CQA A;  3ZJY C;  4C3J H;  4YHH L;  3VYR A;  2JA8 G;  5I9O A;  2L0C A;  1JWS D;  4EQN A;  4R4O A;  2UXB Q;  5CV4 A;  3GO5 A;  1X3Q A;  5C4J B;  1K8A C;  1AN8 A;  2YTX A;  4UDU C;  3SE0 A;  3H3V C;  4YHH Q;  1SE2 A;  2HQE A;  2F0G A; 
#chains in the Genus database with same CATH homology
 2QGQ A;  2WP8 J;  1DGS A;  3ERS X;  4X64 Q;  1EQQ A;  2HQL A;  5HY6 A;  4JI1 L;  4DK6 C;  1SFO H;  2MQH A;  4JI5 Q;  3S15 H;  1X55 A;  2NVQ H;  4DR6 Q;  1WJJ A;  2R92 G;  4L5S A;  1FJG L;  4Y7N H;  3PSI A;  2ZTC A;  4DR3 L;  2A19 A;  5IYB H;  2HHH Q;  2K14 A;  1E1T A;  4DV5 L;  1N36 Q;  4NB3 A;  1SRU A;  4POF A;  4HIK A;  4A3J G;  1VQF A;  4JI1 Q;  4IFD G;  4A3K H;  1TXY A;  4FDB A;  2ZJP A;  3S14 H;  2LSS A;  3LGJ A;  2BA1 A;  3PCO B;  4BY1 G;  2F52 A;  3G4S A;  1Y14 B;  3I55 A;  1PA6 A;  4KI0 A;  1FJG Q;  4LUV A;  4DR3 Q;  1XMO L;  1R9T H;  3KDF A;  1PFS A;  4DV5 Q;  1JE5 A;  3KLW A;  4A3L G;  2N8N A;  3UE0 A;  1EWI A;  1VS0 A;  1U0L A;  1A8V A;  2WAQ E;  3CQZ H;  5FLM H;  1W3S A;  3S24 A;  5IYC H;  2ES2 A;  3U50 C;  2OTL A;  4GS3 A;  5M5Y H;  3S2D H;  3H0G G;  3UDX A;  1Q8K A;  1D7Q A;  1TWA H;  4DKA C;  3CC2 A;  4WJ3 M;  1I6H H;  2JEB I;  4AH6 A;  1L1O A;  1XMO Q;  1JJ2 A;  3RNU A;  2JA6 H;  2HIV A;  4UP7 A;  1L1O C;  3CCM A;  2CWA A;  1NY4 A;  4XIG S;  2H5X A;  4HID A;  5M3M G;  1K73 C;  2YV5 A;  3HOY G;  2AMC B;  3GTP H;  1Q1B A;  2IT1 A;  5BR8 L;  3J80 c;  1FVI A;  3MEF A;  1VQ5 A;  2L15 A;  4IJH A;  1VQC A;  2CKZ B;  3J81 j;  3G71 A;  2VY3 A;  1A63 A;  4DV7 L;  1C7Y A;  2KCT A;  4JC0 A;  3TRE A;  3HKZ G;  3AQQ A;  1L0W A;  2JE6 I;  2AKW B;  1SE8 A;  2JA5 G;  3NBH B;  4GNX B;  1YBY A;  3RLO A;  3GDE A;  4LF4 L;  4OWW B;  3S1Q H;  4JI3 L;  1KRS A;  4POG A;  1K0R A;  3E9H A;  4QL5 A;  4OWT B;  4DR2 L;  5GAH C;  4BBR H;  4DV7 Q;  2F4V Q;  4P74 A;  5GRO A;  5AJ3 Q;  1NMF A;  3K7A H;  3KF8 B;  4DPG A;  4LF6 L;  1Y1V G;  4LF9 L;  4UY8 C;  5IT9 c;  3HOV H;  4A3G G;  1YHB A;  3BJU A;  3RN2 A;  1YEZ A;  3RLF A;  3CCU A;  4JI3 Q;  4LF4 Q;  3CCJ A;  3Q8D A;  1PH3 A;  4IOA A;  2R93 G;  2D62 A;  4P75 A;  4LFC L;  3CPF A;  3J81 c;  4L5Q A;  4LF6 Q;  4LF9 Q;  4A3M H;  1Y1W H;  4OON A;  2BH2 A;  5M3F G;  2Q2I A;  2E2I H;  3I4M G;  2JA8 H;  1KXL A;  1NE3 A;  4JI8 L;  1EIF A;  1IBL L;  3PUY A;  3BZK A;  4X62 L;  4LUZ A;  2A8V A;  4AYB G;  3F2C A;  3F2B A;  1VQ6 A;  2MNA A;  2Z0S A;  3J7Z C;  4A3B G;  4LFC Q;  4OO1 I;  2ALY B;  1EYG A;  1NTG A;  3CC7 A;  2AWN A;  1YI2 A;  4YCW A;  3S1M H;  1N33 L;  2IY5 B;  4JI8 Q;  1IBL Q;  1H95 A;  2LXK A;  4O2D A;  1UEB A;  4MNO A;  4X62 Q;  4GKK L;  1A0I A;  1X9N A;  2JJQ A;  2ZJQ A;  1KQS A;  1HR0 W;  2R92 H;  4A3D G;  2PI2 A;  1YIJ A;  2JEA I;  4DV2 L;  1PH2 A;  4GLV B;  2HIX A;  1N33 Q;  3PGZ A;  1IZ6 A;  4P73 A;  1YJW A;  4PZ6 A;  4JI4 L;  1D8L A;  4A3J H;  2KHI A;  1HNW L;  3KFU A;  1UE6 A;  2D0O A;  3NEL A;  2RF4 A;  3CF5 A;  3KF6 A;  1K9M C;  1TWH H;  4BY1 H;  1JMC A;  1YHA A;  1VQK A;  1PHJ A;  4DV2 Q;  2WB1 E;  5GAE C;  4OO1 G;  2CFM A;  4L5R C;  4A3E G;  1A62 A;  1E7Z A;  1LM0 A;  3CCR A;  1XJV A;  1VQM A;  1V9P A;  1HZB A;  3CAM A;  3PUW A;  3PO2 G;  2E2H H;  3DLL A;  2R7Z G;  3H0G H;  3U4V A;  4AYB E;  3CCQ A;  5ELN A;  1G6P A;  4JI0 L;  4IO9 A;  4X66 Q;  3M3Y H;  1I50 H;  1E22 A;  2ZTD A;  1X3F A;  3SGI A;  1KAW A;  2N49 A;  5M3M H;  4GN5 A;  4GKJ L;  3K81 C;  4DAM A;  4LF8 Q;  1YJN A;  3L7Z C;  2B63 H;  4JI0 Q;  2OQK A;  3M4P A;  4LFA Q;  4AIM A;  2UUC L;  1XNQ L;  2OQ0 A;  4ME3 A;  1Q46 A;  3T1H L;  3IRB A;  4QGU A;  3HOX G;  2NVT H;  1OXV A;  3CW2 C;  1BKB A;  3GTJ H;  2JA5 H;  5C0X I;  2FXQ A;  2K52 A;  3UDF A;  3T1Y L;  5GAD C;  3KJO A;  4B3S L;  3D31 A;  3NEN A;  4DUY Q;  1VQI A;  4R4T A;  1K83 H;  4P71 A;  1VQ4 A;  4DK3 C;  1HR0 L;  4QQB X;  1SN8 A;  3CCV A;  4J15 A;  2K5H A;  1KD1 C;  2EXD A;  1M90 C;  1GM5 A;  2B3G A;  2UUC Q;  1XNQ Q;  1B7Y B;  3UDI A;  5IYD G;  3T1H Q;  4BA2 I;  4YCU A;  1N34 L;  3I4O A;  1S3O A;  2K75 A;  3KYH C;  4LW1 A;  4GOP B;  3F1Z A;  1VQG A;  1Y1V H;  2JQO A;  4BXX G;  4A3G H;  1GD7 A;  2K5V A;  5GQO A;  5IP9 G;  3A5Z B;  5C4J H;  3ICE A;  4YCV A;  2BH8 A;  1HR0 Q;  2UXD L;  5JJL A;  5C3E G;  2B29 A;  2VW9 A;  2E8G A;  3FP9 A;  4DV4 L;  1JB7 A;  2R93 H;  1AH9 A;  3RN5 A;  3K0X A;  4QJF A;  4JBK A;  1N34 Q;  4DNI A;  1UWV A;  3STB C;  4HJ9 A;  2E5L L;  3VDY A;  1EFW A;  5M3F H;  3I4M H;  1K8G A;  4GNX A;  4LFB L;  2RHQ B;  1XTD A;  1MIU A;  3BZC A;  1I5F A;  1KHI A;  2UXD Q;  1E1O A;  2CQO A;  3E9I A;  4A75 A;  4DV4 Q;  1T9H A;  4A3B H;  4HJA A;  2V1C C;  2ZJR A;  2EIF A;  1PH1 A;  5FJ8 H;  2E5L Q;  1X3G A;  1I3Q H;  3AFP A;  1XMQ L;  4PMW A;  1X3E A;  3HOU G;  3PO3 H;  4LFB Q;  1MJC A;  1WYD A;  1X56 A;  1Q86 C;  1NMG A;  4JI2 L;  2C35 B;  1FL0 A;  4IPD A;  4A3D H;  1AE2 A;  2I5L X;  3OTO L;  2PNH A;  5BR8 Q;  4DR7 L;  1XMQ Q;  3J80 i;  3S1R H;  3D0F A;  2ASB A;  1PH7 A;  2CCZ A;  1CKM A;  1XPU A;  3GTG H;  1CKN A;  4RG1 A;  4A76 A;  1J6Q A;  1YHQ A;  2ATW A;  1B8A A;  4JI2 Q;  2UXC L;  1L2F A;  1OXX K;  2NZH A;  2AWO A;  2XGT A;  5J3B A;  3GTQ H;  2BA0 A;  1X65 A;  3OTO Q;  4DR7 Q;  3GTK H;  1I94 L;  5H1S E;  4A3E H;  1N32 L;  4DR2 Q;  3UE1 A;  1S72 A;  5C44 G;  4A3C G;  1QVC A;  1VCI A;  5K36 G;  4YWM A;  1QVG A;  3OYY A;  3CCS A;  2UXC Q;  3TEH B;  1JT8 A;  3PO2 H;  2WB1 G;  1SMX A;  2Q2U A;  5C0X J;  2R7Z H;  3PIO A;  1PH5 A;  1VQL A;  3GD7 A;  1I94 Q;  1VQO A;  3PUZ A;  4A3I H;  2IX1 A;  3H3V I;  1VQ8 A;  1PH9 A;  4JV5 L;  3CXC A;  1PYS B;  4BY7 G;  2K50 A;  1VQ9 A;  3WWV A;  3HFZ B;  4DR1 L;  4KHZ A;  4A3K G;  1WFQ A;  3J81 i;  3AFQ A;  3PIP A;  5EAY A;  1KRT A;  4B3M L;  1JJC B;  4L5T A;  1X54 A;  3CPW A;  4NXM L;  3M7N A;  1G29 1;  4A93 G;  1VQD A;  3HOX H;  4IPC A;  4DV1 L;  4JOI A;  4EQ5 A;  4DR5 L;  2E2J H;  4DR1 Q;  2R6G A;  2GVA A;  4KLK A;  3TS0 A;  1XPO A;  3ULL A;  1HNZ L;  4B3M Q;  1XNR L;  4BBS G;  1Z47 A;  3U58 A;  4NXM Q;  5IYD H;  4GN4 B;  1QUQ B;  5M5X H;  5IP7 G;  2KHJ A;  1BBU A;  4DV1 Q;  4BXX H;  4GKK Q;  2OCE A;  4JG2 A;  3S16 H;  1Q12 A;  4X6A H;  5IP9 H;  3STB D;  3JAM c;  4DV0 L;  5IE8 A;  2KBN A;  2VUM G;  4C3I H;  3RR5 A;  1BBW A;  1EQR A;  4X65 L;  5C3E H;  1HNZ Q;  1M1K C;  3M85 A;  4WJ4 A;  4A4I A;  2DUD A;  3S17 H;  3L0O A;  2ZM6 L;  1YJ9 A;  4A3L H;  2MO0 A;  2NZO A;  4PZ7 A;  4JI4 Q;  2F3I A;  1HNW Q;  2RCN A;  1UE1 A;  3RZD H;  4JBW A;  4LUO A;  4HJ8 A;  4DV6 L;  2KCM A;  3EBE A;  4QIW E;  5E7N A;  1NJI C;  4X65 Q;  1Q81 C;  3TS2 A;  4APV A;  2N3S A;  3FHW A;  2ZM6 Q;  3ULP A;  1GVP A;  2I0Q A;  3HOY H;  1KL9 A;  4B3R L;  1WOC A;  2IHF A;  3AEV A;  1EIY B;  1K3R A;  3H15 A;  4GOP A;  4R4C A;  3A0J A;  3HOU H;  3HOZ G;  1E3P A;  4OXP A;  3I4N G;  1BVS A;  2Q2H A;  1U5K A;  2PQA B;  3A74 A;  3J7A 5;  4IPH A;  4LF7 L;  4OWX B;  1SRO A;  4GKJ Q;  5IY0 A;  4JCV E;  3EN2 A;  3KJP A;  4B3R Q;  4KHP L;  2ID0 A;  1C9O A;  1G51 A;  2QEX A;  1HZ9 A;  2MFI A;  4OX9 L;  3M9B A;  1J5E L;  3HOW G;  5ELO A;  4Y52 H;  2GN5 A;  4LF7 Q;  1CKO A;  1VQE A;  4B3S Q;  3T1Y Q;  2JA7 G;  4KHP Q;  1ASY A;  4DR6 L;  1KC8 C;  4OX9 Q;  1S40 A;  4R1J A;  2Q2T A;  3G6E A;  1SR3 A;  5C44 H;  3CCL A;  1YNX A;  3M4Q A;  4A3C H;  1QZH A;  5JJI A;  1J5E Q;  1O7I A;  2DGY A;  3W1G A;  4TVA B;  1N36 L;  2NN6 I;  1FGU A;  3I7F A;  3PV0 A;  5M5W H;  4B3T L;  4JI6 L;  1GKH A;  1Q82 C;  1WCM G;  5GAG C;  1HNX L;  4DR4 L;  3DM3 A;  2Y0S G;  2NVY H;  3RLN A;  1TWC H;  4UP9 A;  2UUA L;  1VQP A;  1EUJ A;  3ER0 A;  3E0E A;  3K7U C;  5C0X G;  4GNX C;  4MZ9 A;  4YWK A;  1LTL A;  3G48 A;  1UE7 A;  3I56 A;  4B3T Q;  2IHE A;  4DR4 Q;  4JI6 Q;  3FKI G;  4HJ5 A;  4IOC A;  1VQ7 A;  3M4O H;  4BY7 H;  4JYA L;  1HNX Q;  1HZC A;  3PUV A;  1IYJ B;  2ZTE A;  1IBK L;  1RIP A;  1Q7Y C;  3KOJ A;  2UUA Q;  1PYB A;  1C0A A;  1E24 A;  3CC4 A;  1V43 A;  1GO3 E;  1LUZ A;  4A93 H;  1HZA A;  1B70 B;  2YTY A;  3JC6 6;  3PUX A;  1MKH A;  4A3F G;  1VQA A;  5C4X G;  4GN3 B;  4JYA Q;  1NBW A;  2K5N A;  1IBK Q;  2NN6 G;  3MXN B;  1YZ6 A;  2JK8 A;  4BBS H;  5HGQ A;  2MO1 A;  3OW2 A;  2HT1 A;  5IP7 H;  5JEA J;  4O0A A;  1PH4 A;  4K0K L;  2D0P A;  2N78 A;  3H3V H;  5FLX c;  2VUM H;  3EIV A;  2B63 G;  1QZG A;  2WFW A;  2QA4 A;  3KDF B;  2Y0S E;  4DAY B;  4MTN A;  3L2P A;  2F4V L;  2UUB L;  3W1B A;  5LMU L;  5LMN L;  3TRZ A;  4K0K Q;  5AJ3 L;  1PH8 A;  2YU9 H;  2VS1 A;  2Z6K A;  1CSQ A;  1CSP A;  3AYH B;  2Z6K C;  4NXN L;  2UU9 L;  1L1O B;  1ASZ A;  4JI7 L;  1P16 A;  1N32 Q;  5IYB G;  4R4I A;  2UUB Q;  4IFD J;  2NVX H;  4LWC A;  5LMU Q;  1HH2 P;  1OXS C;  2R7F A;  1YIT A;  5LMN Q;  1PH6 A;  1LYL A;  2I5M X;  1QVF A;  1QUQ A;  2CWP A;  3CCE A;  1JJG A;  1PV4 A;  3F2D A;  1UE5 A;  2RHS B;  3HOZ H;  1IL2 A;  4LF5 L;  3PF5 A;  3I4N H;  4NXN Q;  3S2H H;  2UU9 Q;  4HJ7 A;  1OXT A;  3NEM A;  3F8T A;  4R4Q A;  4NPS A;  4RMF A;  4JI7 Q;  1KIX A;  1PVO A;  2VL6 A;  2VQE L;  1SLJ A;  1W2B A;  2OWO A;  4JV5 Q;  1EOV A;  1IBM L;  4JOI C;  2XTI A;  3B6Y A;  4UPA A;  1CUK A;  1X6O A;  5FLM G;  3CME A;  3GTM H;  1YVC A;  3CMA A;  5IYC G;  2EQS A;  4LF5 Q;  3PF4 A;  1CKN B;  3HOW H;  3GTO H;  3K80 C;  2JA6 G;  1AE3 A;  4TQU S;  5DLQ E;  2VQE Q;  3HKS A;  4YWL A;  1IBM Q;  2JA7 H;  4DR5 Q;  3S1N H;  3CD6 A;  5FJ8 G;  3HKZ E;  4LNQ A;  1TWF H;  1N9W A;  2PI2 E;  3CP0 A;  3W5O A;  1XNR Q;  5IWA L;  4XTC S;  3PO3 G;  4IJL A;  4JBJ A;  2VQF L;  1WCM H;  4DV3 L;  2A1A A;  2PQA A;  3K8A A;  3GTL H;  4QY7 A;  1OTC A;  4DV0 Q;  4GLX A;  2I5H A;  1Q1E A;  1OXU A;  3JAM i;  2R7D A;  1VQJ A;  2GVB A;  4ALP A;  1MJE A;  4JBM A;  4C3H H;  4BBR G;  1V1Q A;  5IWA Q;  1P8L A;  4HIM A;  4DUZ L;  2YYZ A;  3FKI H;  2VQF Q;  4DV3 Q;  4H02 A;  2K4K A;  1WI5 A;  4GLA C;  5JJK A;  3TQY A;  3U4Z A;  3HOV G;  1VQB A;  1RL2 A;  4X66 L;  4IPG A;  4DV6 Q;  4HIO A;  4GOP C;  2VZA A;  1N8R C;  4P72 A;  2OTJ A;  4A3F H;  4DUZ Q;  1IXR A;  2PMZ E;  5C4X H;  2UXB L;  3BU2 A;  4LF8 L;  3I2Z A;  4YY3 L;  1VQN A;  3RZO H;  4AQY L;  3ZJY C;  4A3M G;  4UP8 A;  1Y1W G;  4C3J H;  4YHH L;  4LFA L;  2JA8 G;  2YTV A;  2IX0 A;  2AHO B;  2WAQ G;  4PZ8 A;  4BA1 I;  3ULJ A;  1VQH A;  4A3I G;  4IFD I;  3KF6 B;  4X64 L;  4R4O A;  2UXB Q;  2KEN A;  3UDG A;  2VNU D;  5JEA G;  4JI5 L;  4DUY L;  1TWG H;  2JA9 A;  2LXJ A;  3GO5 A;  4PG3 A;  4YY3 Q;  1Z9F A;  3A5U A;  1K8A C;  4AQY Q;  4EX5 A;  2YTX A;  2HHH L;  1HJP A;  4YHH Q;  4C2M H;  5LMN W;  1XPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...