4YY3Q

30s ribosomal subunit- higb complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
total genus 21
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4yy3Q00
1JE5A 3M4QA 4AYBE 3CCMA 3T1HQ 2VUMG 4A3IG 1K8AC 2UUCQ 1NTGA 4UY8C 4OO1G 1PH1A 3NEMA 1PHJA 4LF4Q 2R93H 4UPAA 1Q81C 4A93G 1X54A 1M1KC 1X3EA 5C4XH 3UDFA 3CD6A 5C3EG 2E5LQ 2Y0SG 4KHZA 4JBWA 2K4KA 5FJ8H 2CWPA 5IYDG 3CC4A 1Y1VH 2JA7G 1G51A 4JG2A 2MNAA 3ICEA 1NMFA 1L0WA 3ULJA 4DR6Q 4OWWB 1SR3A 5GAGC 4GLXA 5GAEC 3CCQA 2ATWA 1HNXL 3S24A 3NBHB 3GTLH 4LF8Q 2UXCL 4GN4B 1KC8C 4DK3C 2JEAI 1YEZA 1K9MC 3LGJA 4KHPL 2ZTEA 1UE5A 3AFPA 1XMOL 1WJJA 3I56A 4DV0Q 5IYCG 1EYGA 2MO1A 1I3QH 3S1QH 1E24A 1TWGH 4X62L 5M3FH 2CCZA 2I0QA 1J5EQ 2WAQE 1PH4A 1JB7A 3TS2A 3RLNA 2JA5H 1LTLA 5FLMH 1VQ4A 3HOXH 1NJIC 1KL9A 1KRTA 4BY7H 5HGQA 4X66L 2NVXH 3I4MH 5ELOA 1VQEA 4C2MH 3GTKH 2JJQA 3OYYA 5AJ3L 3RLOA 5C44H 3PGZA 1K3RA 1I5FA 1CSPA 2UUAL 2CWAA 2HQLA 4HIOA 1HZCA 4UP9A 4DR3L 1YJWA 3G71A 1SE8A 1LYLA 1PYSB 3EIVA 4DV7L 4NXNL 3I7FA 1N36Q 2ZJQA 3I4NH 2PMZE 1NE3A 5IY0A 4KI0A 1HR0L 2UXBL 4AIMA 3H15A 3E9HA 2LXJA 4BY1G 1N33L 4GKJL 4LFBQ 1HNWQ 1GM5A 4DV2Q 3BJUA 4JI0L 2K5VA 3KF6A 4H02A 3PUXA 4QGUA 4B3SQ 3PO3G 4LFCL 2B63H 4JI2Q 4JV5L 2K5HA 4K0KQ 1VQFA 1N34Q 2N78A 4DV5Q 3OTOQ 2E2HH 1GO3E 4JI4L 1TWFH 1MJCA 1X9NA 4JI6Q 4BBRG 2IY5B 1HJPA 2EIFA 1IBKL 2OTJA 1JJGA 1A62A 3A5ZB 1BBWA 2IHFA 3KF6B 3BZKA 4TQUS 1VQAA 2A1AA 2F3IA 1PH9A 4IPCA 2XTIA 4LF9L 5C0XJ 4DUYQ 3OW2A 1D7QA 4P72A 3W5OA 4A75A 4JYAL 3K0XA 4MNOA 3HOVG 1BBUA 3HOWH 4PG3A 3S14H 2ZM6Q 1HR0W 1VQNA 4JBMA 2JA8H 3PO2G 4X64Q 3H0GG 1QUQA 3TREA 3HOYG 4LUOA 1NBWA 3M3YH 2F52A 3HOZG 1XMQL 3U50C 1VQOA 4A3LG 4PMWA 1TXYA 2E8GA 3CXCA 2ALYB 2KHIA 2WP8J 1EOVA 5IP9H 2VQFQ 3CC2A 3A74A 4A3DG 1FL0A 3AEVA 1MIUA 4A3JH 4DV6L 1L1OA 2JEBI 1LM0A 2OQKA 1QUQB 2Q2HA 5LMNL 2RHQB 2VY3A 4L5TA 3K8AA 4LFAQ 4OO1I 3T1YQ 3K7AH 1YZ6A 3WWVA 1J6QA 4R4TA 2A8VA 4IO9A 4P71A 4DR4L 1Y1WG 2UXDQ 1VS0A 4JI5L 2NN6G 5J3BA 3DLLA 2HHHQ 1L1OB 4LNQA 1VQ7A 1R9TH 3M7NA 4IJLA 3HOUG 4BXXG 1N32Q 4OWTB 2YU9H 1B7YB 4NXMQ 1MJEA 3S1NH 1DGSA 4JI7Q 3GD7A 3S16H 2Z0SA 4OONA 4DV3L 3HKSA 1I94Q 4HIDA 4DR2Q 4QL5A 5DLQE 2A19A 4OXPA 1A8VA 1XTDA 2BA1A 1VQDA 3M9BA 1X56A 3L2PA 1FVIA 3KOJA 5E7NA 4B3RQ 2H5XA 3HFZB 3PIPA 5LMNW 3S1RH 4B3TQ 2ID0A 1TWHH 2ZTCA 4A3CG 2B3GA 2DGYA 5GROA 3UDIA 1K8GA 4GN3B 1EFWA 3AYHB 2OTLA 4BBSH 1QZHA 2I5LX 2QGQA 1E22A 5C4XG 5K36G 4AQYQ 4LF7Q 1Z47A 2Y0SE 3PUWA 5FJ8G 1IBMQ 4IPGA 1Y1VG 1CKOA 1VQHA 1W3SA 4UP7A 2AKWB 1OXXK 5IWAQ 3F2BA 1S72A 2K75A 3T1HL 1KRSA 2UUCL 1VQMA 2AWOA 3M85A 3GTMH 1YJ9A 4UP8A 2R92H 4GLAC 5IYBH 2ZTDA 4OX9Q 3KFUA 3PV0A 2JA6H 1CKNA 4PZ8A 1HZ9A 1H95A 1C7YA 4LUVA 2ZJRA 3KJPA 3RZDH 4LWCA 3U58A 2E5LL 2JK8A 3A5UA 2UU9L 3GTPH 4GKKQ 5IP7H 1HNZQ 1VQCA 3DM3A 4C3JH 3NELA 2QA4A 5M3FG 4JI1Q 1P16A 4YCWA 1UEBA 2UUBQ 1CKNB 1X3FA 2NVTH 5M3MH 4EQ5A 4DV4Q 2JA5G 3I2ZA 4NXNQ 5FLMG 1XNQQ 2NVQH 1A63A 1X65A 1PA6A 5JEAJ 1O7IA 4JCVE 4BY7G 1RIPA 3CC7A 4AYBG 2CFMA 5EAYA 3U4VA 3I4MG 3MEFA 4HJ5A 2GVBA 5HY6A 4IOCA 5JJKA 5C4JH 5C44G 1OXVA 4J15A 4MZ9A 3EN2A 4JI8Q 4DKAC 4RMFA 4KLKA 2F4VL 3GTOH 1SROA 1HNXQ 4L5SA 1CUKA 2LSSA 2UXCQ 2VQEQ 3HKZG 1KD1C 4R4OA 2CQOA 2FXQA 2R6GA 1OTCA 3G4SA 1Q12A 5C3EH 4KHPQ 2BH2A 1E3PA 2RHSB 3I4NG 4YCVA 5IYDH 1G6PA 3FKIH 2QEXA 3CQZH 4R4IA 1T9HA 4JOIC 4IFDI 1GKHA 1WOCA 1YI2A 4DV1Q 3L0OA 4HJ7A 1HH2P 2IT1A 1TWCH 3UDXA 1AE3A 4C3IH 4R1JA 3L7ZC 4OWXB 2NZOA 1Q1EA 4LF4L 2D0PA 1N36L 1PH8A 3J81j 2VL6A 3KJOA 4DV7Q 1YHQA 3W1GA 2MQHA 2L15A 4EX5A 4LFBL 2WAQG 3S17H 1HNWL 4A3GG 4DV2L 4A4IA 2C35B 1FJGQ 4B3SL 3RR5A 4JI2L 3S15H 4IFDJ 1IBLQ 4K0KL 1N34L 3BU2A 3PUYA 4APVA 4DPGA 4BA1I 4DK6C 3OTOL 4DV5L 3J80i 1UE6A 4DUZL 4JI6L 1HR0Q 4R4QA 1LUZA 1WCMG 3GO5A 5H1SE 1YIJA 4NPSA 3I4OA 5LMUQ 4IPHA 4DUYL 1M90C 3NENA 1L2FA 5M5XH 3J80c 4JI4Q 1JMCA 4A3JG 4A3EH 4PZ6A 3GTGH 1FGUA 3D31A 1N8RC 4P75A 2ZM6L 4X65Q 4GS3A 1OXTA 4YWMA 3F2DA 3S2DH 1AH9A 1P8LA 1XPUA 2VS1A 4IPDA 4JBJA 1YJNA 4JYAQ 1VQPA 4LF5Q 2AWNA 5IE8A 2OQ0A 1K83H 4YY3L 3J7ZC 2VQFL 3G6EA 4HJ9A 1PVOA 1IXRA 2D62A 4GN5A 5M5YH 1EWIA 4LF6L 2DUDA 1SRUA 2IHEA 4DR1Q 5BR8Q 4LFAL 2WB1E 4DAMA 4DR7Q 3T1YL 2YTXA 3E9IA 3STBD 2I5HA 3FP9A 4DR5L 5JJIA 4MTNA 4A3MH 3H3VI 2UXDL 4XIGS 3M4OH 5C0XG 4ALPA 2HHHL 1YHAA 4WJ4A 3TQYA 4AH6A 1K0RA 1A0IA 3TS0A 3CP0A 3UE1A 4NXML 1XNRQ 2N49A 4YHHQ 1X3GA 4JI7L 3AQQA 2R7ZH 3HOYH 3W1BA 4GLVB 3PIOA 2JA9A 2PNHA 1I94L 4JI5Q 3CW2C 1ASYA 1EUJA 4A3LH 2Q2UA 4DR2L 3K7UC 1AE2A 1X55A 3PUZA 4NB3A 4Y52H 1U5KA 2RF4A 3TEHB 4B3MQ 2HT1A 2R93G 1BKBA 4B3RL 4QIWE 3J81i 2B29A 2R92G 2K52A 3PSIA 2PI2A 4DNIA 5IYBG 2K5NA 1ASZA 4JI3Q 3JAMi 4POFA 1SFOH 2JA6G 3ZJYC 1OXSC 1CSQA 1V1QA 1VQ9A 2IX1A 4AQYL 1PV4A 4LF7L 1C0AA 3EBEA 4JC0A 3S2HH 1VQ5A 4ME3A 3J81c 5IP7G 1VQ6A 3CPWA 2VNUD 2E2IH 1PFSA 5IWAL 3IRBA 3JAMc 3PF4A 1YBYA 3FHWA 3HOUH 4A3BH 2Q2IA 3ER0A 2JQOA 5M3MG 3RN5A 2KHJA 4L5QA 3GTQH 4A3KH 1MKHA 1VQGA 1EQQA 1I6HH 4OX9L 3AFQA 2ASBA 2PI2E 2BA0A 5GAHC 1Y14B 4JBKA 2V1CC 3KDFA 3UDGA 4A3FH 1I50H 2PQAA 4YWKA 3RNUA 2GVAA 3S1MH 2EXDA 2D0OA 3CCRA 3CCVA 2YYZA 4GKKL 4DR6L 2N3SA 4A3CH 2MO0A 4C3HH 1HNZL 2AHOB 3PCOB 4JI1L 4DAYB 1K73C 3HOXG 4HIMA 1VQ8A 5M5WH 2UUBL 4LF8L 3RZOH 1IYJB 4DV4L 3HKZE 3KDFB 2I5MX 2YTYA 1GVPA 1XNQL 2VUMH 2PQAB 4A3IH 4DV0L 1PH5A 2UU9Q 1PH2A 3G48A 2K50A 3FKIG 1WI5A 4HJ8A 4A93H 2JE6I 1TWAH 1J5EL 4BA2I 2E2JH 2RCNA 1C9OA 4JI8L 1UE1A 1D8LA 1V43A 1XMOQ 1UWVA 2KCMA 3RN2A 3H3VH 1KXLA 4GNXC 2VQEL 1PH6A 2JA7H 1L1OC 3KLWA 1CKMA 4HIKA 4X62Q 2R7FA 1VQBA 1QVCA 5IT9c 2B63G 3PF5A 2F4VQ 3CPFA 4R4CA 3CCLA 2R7DA 4DV1L 4IOAA 1HZAA 3B6YA 1Q46A 3JC66 4X66Q 1PH3A 5FLXc 3RLFA 3PUVA 5AJ3Q 1XJVA 4FDBA 5IYCH 4QQBX 1EQRA 5JEAG 2UUAQ 4YCUA 4GOPC 1WFQA 2N8NA 2Z6KC 1N9WA 4DR3Q 3HOWG 3STBC 3M4PA 4O2DA 2XGTA 2KENA 1V9PA 3CAMA 3CCUA 3CCJA 2NN6I 3ERSX 2NVYH 4P73A 1KAWA 1FJGL 1Q8KA 4A3EG 2JA8G 1IBLL 1N33Q 2UXBQ 2OWOA 4GKJQ 2AMCB 3F1ZA 4JI0Q 1SMXA 5C0XI 1XPRA 1YITA 4LFCQ 4JV5Q 1PYBA 1NY4A 1X6OA 1JJCB 5JJLA 5IP9G 1G291 3U4ZA 5LMUL 1E1TA 2YV5A 1IBKQ 1Q82C 4LF9Q 3KF8B 2KBNA 4X64L 4DUZQ 5ELNA 1YNXA 1Q7YC 1JJ2A 4BY1H 1OXUA 3MXNB 3KYHC 5GQOA 4X65L 3I55A 3PO3H 1B70B 4O0AA 2CKZB 3CCEA 1JT8A 2K14A 4LW1A 1U0LA 4A3GH 4A3MG 1VCIA 4WJ3M 4QJFA 3F2CA 4LF5L 4BBRH 3E0EA 1NMGA 1HZBA 1Q86C 4IJHA 3ULPA 4IFDG 3VDYA 2IX0A 1KQSA 1XMQQ 2KCTA 3J7A5 2BH8A 2ZJPA 2R7ZG 1WCMH 2EQSA 4DR1L 5BR8L 1S3OA 3CMEA 3SGIA 1VQKA 1EIFA 3Q8DA 4DR7L 4DV6Q 3HOVH 4X6AH 4A76A 4Y7NH 4TVAB 1PH7A 4YY3Q 5LMNQ 1QVGA 4BBSG 1GD7A 1VQJA 3CMAA 1N32L 4GNXA 3PO2H 4LF6Q 2GN5A 1UE7A 3H0GH 4L5RC 1SLJA 4XTCS 2HIVA 3ULLA 4JOIA 4QY7A 3CCSA 3HOZH 4DR4Q 2YTVA 1QZGA 1XNRL 2NZHA 1Q1BA 4YHHL 2VZAA 4DR5Q 1Z9FA 1IZ6A 2VW9A 1E1OA 4LUZA 3K81C 4A3DH 1S40A 2OCEA 4GNXB 4B3TL 3CF5A 3UE0A 2MFIA 4DV3Q 4P74A 1W2BA 4B3ML 3A0JA 3GDEA 4A3BG 1KIXA 2LXKA 1VQLA 3D0FA 1KHIA 3F8TA 4HJAA 4A3KG 1EIYB 4JI3L 3BZCA 4YWLA 2HIXA 2WB1G 4GOPA 1Y1WH 1IBML 3TRZA 4POGA 1YHBA 4A3FG 1YVCA 2Z6KA 1RL2A 1SN8A 1QVFA 4BXXH 4PZ7A 2Q2TA 2ES2A 5GADC 1BVSA 1XPOA 3GTJH 1WYDA 4RG1A 2WFWA 1B8AA 1VQIA 3K80C 4GOPB 1E7ZA 1IL2A
chains in the Genus database with same CATH superfamily
3DWQA 1NSNS 2F4IA 1K8AC 1NTGA 2F0KA 3HRZC 1LT5D 4CJ2C 1Q81C 4HEDA 2SEBD 5C4XH 1O7ZA 3UDFA 2N55A 1Y69U 2EVBA 4JBWA 4G4KA 2JA7G 2MUYA 4L63B 1JCKB 1G51A 1IKMA 2MNAA 3TP7A 5C3WA 4DR6Q 1SR3A 2ZXRA 4GLXA 5GAEC 2ATWA 3VA5A 3S24A 4GN4B 1KDBA 1RCVD 1K9MC 4EQPA 4CDFC 1HQRD 3I56A 5KIXA 5IYCG 1EYGA 1KTKA 1R4PB 3U9SA 5F2DA 3VYUA 1E24A 4F8MA 4KMUC 4C1NI 3I91A 5FO7B 3TBIB 3RLNA 1G2SA 2ZXOA 3HOXH 3I70A 1SE4A 2NVXH 5ELOA 4QCLA 2L0CA 1DOKA 3CKIB 1I5FA 1CSPA 3I72A 2PMZB 2HQLA 3FMCA 3E0JA 2EYFA 5HGTA 3G71A 1LYLA 4DV7L 5T1IA 3E9HA 2LXJA 1YNND 1GM5A 3PUXA 2B63H 4JV5L 3S16B 1K28A 1V1PB 2E75C 1EL0A 3OTOQ 1AFPA 3C2PA 1MJCA 3FRPB 5LHY1 2OTJA 4PQXA 1JJGA 1J8IA 3KF6B 3BZKA 3S9WA 2L55A 1PH9A 5I4DA 1ZYRC 5CMDA 2EY2A 1H9SB 4M8AA 3HOVG 1EZ8A 1VDZA 1X3QA 3BVGA 4C56C 4NKLA 3PO2G 4X64Q 1O7LA 2C5CA 1EYDA 1QUQA 1NBWA 4XQQA 1XMQL 2DY7A 4DK1A 1IHZA 2QDLA 2ALYB 3GQBA 3K5OA 1EOVA 5IP9H 4A3DG 2K6AA 3I8ZA 3D6CA 1CZWA 1MIUA 2JEBI 1LM0A 1G91A 1T5EA 2OEOA 4L5TA 3K8AA 4LFAQ 1ZKOA 1I4PA 4OO1I 2RSNA 4P71A 2NN6G 2AUKA 1L1OB 4PMCA 2NVQB 3QJYA 4CBVA 4KTAA 4NXMQ 1RDPD 5C4JB 3VYTA 4DV3L 3T56B 1PRTB 2PQEA 1PFBA 4OXPA 1A8VA 1XTDA 3BDOA 3L2PA 5C0XH 4B3RQ 1IW7D 2H5XA 3HFZB 2ID0A 1TWHH 2ZTCA 2B3GA 1K8GA 4BBSH 3FKIB 1QZHA 3CQZB 4N8X1 4AQYQ 1G2TA 2Y0SE 5FJ8G 1Y1VG 3ND8A 3DEPA 1ENAA 2AWOA 3M85A 2F0IA 3GTMH 4RGNA 1YJ9A 4UP8A 1PTOF 3V96A 2JA6H 4PZ8A 1HTLD 1A2TA 3DHQA 3OWFA 1HZ9A 1H95A 1WTHA 4LUVA 2E5LL 3KJPA 3RZDH 3S17B 3GTPH 3A5UA 3GV3A 1STNA 3SXHA 2UU9L 5IP7H 3S15B 4J1MA 2M9VA 2QA4A 2F0HA 1SYCA 4K8IA 4KJOA 1CKNB 2NVTH 5M3MH 2JA5G 1EEFD 1XNQQ 1X65A 4BY7G 1I4HA 3M7GA 5HY6A 1DD2A 2BCOA 5C44G 1OXVA 5D3DA 2KCCA 4A3EB 1HUNA 3GTGB 2D2CC 4XYOA 3GTOH 1A2UA 1KD1C 3MXPA 4HMIA 2CQOA 4R4OA 3I4NG 2QEXA 2KECA 3GP7A 3LNNA 4R4IA 4IFDI 1WOCA 4RAUC 3R8BA 5M5YB 1JOKA 2B2WC 2JSOA 4H0LC 2B39A 3P75A 3UDXA 1AE3A 3L7ZC 2NZOA 2DJGC 2EYJA 3MFGA 2VL6A 1YHQA 2MQHA 2L15A 2LFNA 4DV2L 3C46A 2C35B 1FJGQ 2N88A 3RR5A 4JI2L 4K0KL 1N34L 3IAYA 4RA8A 3T53B 4APVA 5EPLA 4DUZL 4R4QA 3NTIA 4CDCC 1WCMG 5H1SE 1MHWC 2B2VC 2F0MA 4NPSA 3I4OA 5JPNC 4IPHA 3ITPA 3NENA 4IUPA 5M5XH 3NHHA 4A3JG 1FGUA 4G7ZC 1N8RC 3S2HB 4KY5A 5FLXL 2E2IB 1OXTA 3F2DA 3HOUB 4JBJA 4A3KB 1K83H 2VQFL 4HJ9A 1IXRA 1UUPA 2D62A 4GN5A 2DUDA 4ABNA 4DAMA 2KUMA 2H4OA 4F87A 3RZOB 1SXTA 2PZWA 2UXDL 5M5WB 4Q5VA 1JC7A 1PZID 4IFDH 3I90A 2F3VA 3TQYA 4AH6A 2F0DA 1JE4A 1STGA 4J8QA 4V0BA 1EIGA 2CHBD 3AQQA 3HOYH 4IUNA 3K6OA 2IL8A 1I94L 1DJRD 1ASYA 1GUOA 4A3LH 3K7UC 1HTPA 3KK7A 3PUZA 4NB3A 1F77A 1U5KA 1TVXA 1LT6D 2F0QA 4QIWE 1ML0D 1SYBA 3J81i 2B29A 5CV8A 2R92G 5IYBG 3PSIA 4JI3Q 1DYQA 4F88A 1D1KA 1SFOH 3BDLA 4CJ0B 3ZJYC 1FD7D 2HQEA 1VQ5A 1JR0D 2QEJC 3J81c 5EQ0A 3CPWA 4FXKC 3TP5A 1WTPA 3IRBA 4A3BH 1I4GA 4OIKA 2K1BA 3R93A 1MKHA 3AFQA 3TMEA 2PI2E 2BA0A 2V1CC 3KDFA 1I50H 1OO9B 2PQAA 2PZTA 5EPJA 2GVAA 3S1MH 2JYOA 4DF7A 1GUGA 1HNZL 2WINB 3HOXG 2UUBL 4DV0L 2UU9Q 1HHVA 1PH2A 1DOLA 2FJ2A 2F0LA 2E2JH 1U9RA 2RCNA 1C9OA 4JI8L 1D8LA 1V43A 2KCMA 1KXLA 4KN7C 1SBBB 4GNXC 5J1ZA 1O80A 2PW5A 2JA7H 3KLWA 4C3IG 1HFNA 1CKMA 3NP8A 5JJZA 4A3GB 1QVCA 1SNOA 5IT9c 1SSOA 4BBRB 2B63G 1NAPA 2Q8RE 2BE5C 3CCLA 4DV1L 2F0FA 2QW7A 3ERQA 4CHTB 1F2YA 3CRLC 1RODA 1E2ZA 5IYCH 1EQRA 5EKLA 5ISRA 1WFQA 2K04A 3H0GB 1N9WA 4DR3Q 1WTVA 3CAMA 2NN6I 3ERSX 4P73A 1H9RA 1IBLL 4JK1C 4JI0Q 1YITA 1A15A 5JJLA 1JJCB 1LTGD 3Q6SA 3U9OA 4CGYB 5IP9G 3U4ZA 5LMUL 3Q0AA 1V1OA 3KF8B 4DUZQ 1NCVA 1F9RA 3I55A 3K5LA 3GTJB 1JT8A 4A3MG 1VCIA 2NUCA 4ODGA 1PDQA 3E0EA 1NMGA 3NTKA 1Q86C 1BUVT 5T1GA 3ULPA 1NNXA 2KCTA 2R7ZG 1SYDA 4RKBA 2F03A 1JWUD 1S3OA 4FF2A 3HOVH 4X6AH 4LAAA 4TVAB 4BBSG 1JQYD 3CMAA 1N32L 3QR8A 3PO2H 1UE7A 1XXGA 2HIVA 1GHJA 4DR4Q 1ILPA 2D9UA 1TS4A 1Q1BA 2Z9HA 2B2WA 2B2UA 3I4LA 2VW9A 4LUZA 4A3DH 2M2LA 2CW0D 5FO8B 3UE0A 3EQLC 4B3ML 2ZXPA 5I6YA 1ZYRD 1TWGB 5M3FB 3AMUA 1MGSA 1QNUA 2PCFB 1IBML 2NN6H 3NWSA 1BF4A 4DXFA 4A3FG 1SN8A 3O13A 1CQVA 1E2VA 2Z6BA 3I4MB 4L6TB 3GTKB 2A6ED 1KNAA 4S3SA 3DM1A 4GOPB 3Q24A 3WOEA 1JE5A 4AYBE 2VUMG 2UUCQ 3CRKC 2RKSA 1B3AA 4OO1G 2XWBB 1B50A 5LL6S 2TMPA 4UPAA 2PYKA 4X3UA 3OMCA 1A3VA 1M1KC 1X3EA 2DJFC 3NBHA 5FJ8H 1EOTA 1Y1VH 1PRTF 4JG2A 2X6LA 4NP5A 2E2HB 3ULJA 1TWFB 2SOBA 5GAGC 1LTAD 2UXCL 3OIPA 3GTLH 1SNPA 1W6JA 3LGJA 4KHPL 2ZTEA 3AFPA 2HCIA 4DV0Q 1Z7TA 1CK1A 1U4PA 4ZQ3A 1I3QH 3HOWB 3E5SA 3A8JE 4X62L 1JB7A 3ND9A 5DEHA 2JA8B 2JA5H 1LTLA 3J81L 2K05A 1NR4A 1CA6A 1KL9A 1KRTA 2PO4A 1S4ZA 4BY7H 4X3TA 4X66L 4K2KA 3RLOA 5C44H 4Z9CB 1SJED 2FINB 3SK5A 3MA2B 2WV6D 2K01A 1SJHD 1MI2A 2NZ1D 1HZCA 4DGZA 1SE8A 1K3BC 4NXNL 3I4NH 2PMZE 4KHVA 5IY0A 1HR0L 5I2YA 1QJOA 1N33L 4BY1G 4KD4A 4GKJL 2YU9B 5IODA 4H02A 4LFCL 2F0TA 5JPMC 2K5HA 5E4WC 4JI4L 5C6AA 1HCZA 4KN4C 1SAPA 2IY5B 1EQTA 2EIFA 5KEEA 2EE1A 1A6XA 3MWYW 4HTHA 2L12A 5C0XJ 4DUYQ 2A69D 3DUZA 1D7QA 4P72A 2EYLA 4MNOA 4PG3A 3S14H 1HR0W 1VQNA 1S5BD 3PIO3 3HOYG 3M3YH 2F52A 4A3LG 2BDNA 4PMWA 3IL8A 2E8GA 2KHIA 3OW7A 4K8JA 4HMJA 2L5TA 4A3JH 2OQKA 5LMNL 2SNMA 2CQAA 5CORA 3Q23A 3T1YQ 3K7AH 1BCPC 1MSGA 4R8NA 1VS0A 1L0XB 5C3XA 2HHHQ 3H6MA 3KLRA 1R9TH 1GUSA 1N32Q 2WIIB 3S1NH 1DGSA 4JI7Q 3FVQA 2Z0SA 4HIDA 1GOZA 4L8JA 4QL5A 4KD3A 3DWPA 5FLXE 4HSVA 4NW2A 1VQDA 3MVVA 4HCSA 1T5XD 2FMMA 1QNKA 3PIPA 5LMNW 3S1RH 5GROA 4GN3B 3AYHB 2F0UA 2KEEA 1PXUA 2XSCA 4G7HC 4LF7Q 2H1EA 1D2BA 1IBMQ 4F7XA 1W3SA 1OXXK 5IWAQ 3T1HL 3IKJA 5DAUA 2KVMA 2R92H 5IYBH 2MHVA 3H09A 5JAVA 2RDFA 3KFUA 3PV0A 4FP5D 4JVZA 1AP0A 1C7YA 2F0OA 4GKKQ 1F2LA 1FNUA 2LKVA 1HRJA 3TZUA 1KABA 4XT1B 1VQCA 2WKCA 3DM3A 4C3JH 1P16A 4YCWA 1X3FA 2XN9C 4XDXA 2E2DC 4LK1C 1PA6A 1RIPA 4AYBG 5JJKA 3MEFA 1GUNA 5EPKA 2CH4A 5KRUA 3EN2A 2LY7A 4RMFA 2RCFA 2P5ZX 4KLKA 2F4VL 1CUKA 2LSSA 2UXCQ 2VQEQ 3HKZG 2R6GA 4ZRZA 4KHPQ 5C3EH 1YNJC 5DM73 4YCVA 5IYDH 1G6PA 3J7YW 1B53A 4E6IA 2XRQD 1DONA 4JOIC 1GKHA 2PZUA 1YI2A 1D6EC 1LTTD 2EYMA 1XX8A 1KDAA 4WRDA 1W6KA 4HJ7A 1SYFA 1HH2P 1TWCH 2Z8LA 4C3IH 4R1JA 4OWXB 1XYIA 1SMYD 4LF4L 3I3CA 2X69A 2D0PA 5G3LD 1N36L 1PH8A 3BG3A 1VMPA 2NYZD 3KJOA 4LFBL 1CHPD 1HNWL 1EY8A 4B3SL 4N9PA 4IFDJ 2B8GA 4DN4M 2RQXA 2M00A 4BA1I 4DK6C 4DV5L 2Z4IA 4EQNA 4JI6L 1HR0Q 4ID6A 3GO5A 1F9QA 1ZEQX 5KNCA 3SK6A 1M90C 1PZJD 3MHBA 5IIFA 4JI4Q 4Q0FA 2XIWA 3G6JB 2ZM6L 2AQ2B 2A6HD 4X65Q 3OHXC 2VXWA 4YWMA 3TDQA 3QIAA 3S2DH 1AH9A 1XWEA 3Q22A 1QG7A 1PYWD 4YY3L 3G6EA 4HSPA 4LJZC 4OELB 4RGTA 3LWUA 4KKSA 1QOHA 4C3HB 2I07B 2I5HA 4DR5L 5JOBA 3G7LA 4A3MH 4XIGS 2ICEC 3BZDB 4ALPA 2O2LD 4A3IB 4WJ4A 4TRDA 3TS0A 1XNRQ 3CP0A 3UE1A 2N49A 4XT3B 5IGCA 4YHHQ 1X3GA 2R7ZH 1KLUD 4A93B 4GLVB 3VYRA 5LL6X 3CW2C 1EUJA 3J7AF 1EYAA 4DR2L 5E1FA 1BOSA 3R2TA 4Y52H 2EYPA 2RF4A 2HT1A 2K52A 1LLRD 2PI2A 3JAMi 1WTQA 4POFA 1V1QA 3T13A 3X3NA 2L9HA 1C0AA 1VQ6A 1ET6A 2VNUD 2A5HA 3JAMc 4IUTA 3PF4A 1IKLA 1YBYA 4P2CB 2Q2IA 2JQOA 3GTQH 3RN5A 1I6HH 3T4AC 1VQGA 2WACA 1EQQA 4DAYA 4OX9L 3SVMA 2ASBA 5FK9C 4ILWA 2NWGA 3UDGA 4A3FH 4CKBA 4CDEC 1UNSA 2N3SA 2NVYB 4DU9A 1I4QA 1Y8NB 4A3CH 4JI1L 3VR2A 4HIMA 4LF8L 1PTOH 1IYJB 2EY1A 4DV4L 2I5MX 2VUMH 3N52A 4EQOA 3G48A 3FKIG 4OO1H 1RTNA 2JE6I 1TWAH 1D5ZC 2FFKB 5EGTA 1UE1A 4MTKA 1UWVA 3RN2A 3PO3B 1PH6A 1L1OC 5ELEA 1B44D 5CV7A 5FKAC 2B2UC 1GJXA 5CV6A 2F4VQ 1AN8A 4R4CA 1Q46A 1RF2D 3PUVA 1WCMB 1ENFA 4FDBA 1STBA 4QQBX 3OMGA 5JEAG 3W2DA 4Y7NB 4YCUA 1WTRA 4KY7A 1B3QA 1QB5D 3STBC 3M4PA 1HUMA 4DV7Q 3HOZB 1V9PA 1G6ZA 1KAWA 1Q8KA 4K5WA 4A3EG 1SDFA 5CV4A 2AMCB 1TKWB 1XPRA 1EY9A 4JV5Q 3P1HA 1BR9A 5I6WA 4U673 3E3XA 1X6OA 1G291 2KHSA 4FNFA 3BS1A 1Y1WB 1AZQA 4RGOS 3J81E 5ELNA 4XQNA 4BY1H 1OXUA 3MXNB 2PNRC 1NUCA 1Z6HA 3KYHC 5GQOA 4O0AA 2QCPX 2AQ3B 2CKZB 2K14A 4LW1A 4X3SA 3K59A 1ENCA 3V05A 4WJ3M 5E4XA 1VMCA 1ICFB 4NDXA 4LF5L 3A54A 3VDYA 1XMQQ 3RMHA 3J7A5 3K5MA 1WD0A 2EQSA 3DMUA 5BR8L 2DN8A 4DR1L 4QF4A 4DR7L 5C4XB 4YY3Q 1QVGA 4QUCA 3L9AX 1SNQA 3QOJA 4JOIA 4QY7A 3BVMA 2F0JA 4DR5Q 1Z9FA 1IZ6A 1U4LA 3K81C 4GNXB 4B3TL 1LTID 3VA7A 2MFIA 3BYYB 4DV3Q 3D0FA 1KHIA 3SDZA 4C1NK 5IT9E 4A3KG 4IUQA 3BVZA 4PMBA 4POGA 1BNZA 4C3JG 1YVCA 2Z6KA 1RL2A 5BN4A 3HOXB 1QVFA 4PZ7A 4IN3A 2Q2TA 2NVXB 5GADC 1BVSA 2KEDA 1B8AA 1VQIA 5EBCA 2G9DA 3M4QA 3CCMA 1JORA 3NTHA 1XTCD 2CVRA 4UY8C 1SE2A 5COYA 3SEBA 1I4XA 3FEWX 2R93H 5A35A 4DAVA 1KDCA 3CD6A 5C3EG 3MFYA 2Y0SG 3QWNA 1EQVA 4KHZA 2E5LQ 3WDNA 2CWPA 5IYDG 1C4QA 4BWGB 3CC4A 2B63B 1TY0A 1D1IA 1NMFA 1L0WA 4TSSA 3KLSX 4OWWB 2KA7A 4RFBA 2OT2A 3CCQA 3D6WA 4LF8Q 5K5PA 1KC8C 2JEAI 2SNSA 1YEZA 3TP8A 2WAQB 1UE5A 1XMOL 3NXWA 4DAPA 1STHA 1HQMC 3S1QH 2I0QA 4FF3A 3TS2A 2EYOA 3QO2A 1EY4A 3JAML 1EY6A 4C2MH 3OPOA 3H3VC 5AJ3L 2Z1CA 3A7LA 1K3RA 3PGZA 4OHJA 4DK0A 2UUAL 3MAQA 3PQIA 2CWAA 1HA5A 4HIOA 1SNMA 1V1PA 1YJWA 1M8AA 2ZJQA 3C3LA 2UXBL 4AIMA 3H15A 4DV2Q 3KF6A 2O4XA 1QWYA 1D5MC 2D5DA 4JI2Q 4K0KQ 1VQFA 1N34Q 1E0BA 1VF5C 2N78A 1GO3E 1H9SA 2GA4B 4JPBW 1FR3A 4H13C 4BBRG 1HJPA 4XXEA 1IBKL 1B1ZA 3I73A 1A62A 1BBWA 4LF9L 2A1AA 2F3IA 1TWHB 4IPCA 3MXGA 5BN3A 4BBSB 3OW2A 5EBDA 2AQ1B 3AB9A 1YNJD 1BBUA 2KOLA 3SK4A 1K8OA 3H0GG 5EKIA 2FMCA 4LUOA 3GTMB 2F0NA 3U50C 1TXYA 2JP1A 2MJ8A 2JA6B 2VQFQ 1IYVA 3AEVA 1WTWA 4DV6L 1L1OA 3RZDB 1K0SA 3W3AA 3GTPB 1QUQB 2Q2HA 2HDMA 2RHQB 1CT1D 3WWVA 1YZ6A 5IGEA 1J6QA 4R4TA 4FO2A 4IO9A 2UXDQ 4JI5L 2NVTB 5J3BA 5M3MB 3MXUA 4HR7B 4LNQA 1VQ7A 3N6RA 1CA5A 4IJLA 4BXXG 3V2TA 1B7YB 2K03A 1MJEA 3GD7A 3S16H 4OONA 1I94Q 4HCEA 3HG9A 2A19A 3NK9A 3GTOB 2BA1A 3M9BA 1X56A 2OF1A 4KV6A 4A3CG 4B3TQ 1EFWA 2OTLA 3AU7A 3X3MA 3EJIA 2QGQA 1E22A 5K36G 1JWMD 2K5QA 1Z47A 3PUWA 4IUUA 4IPGA 1CKOA 3HZXA 1LTSD 2AKWB 2K75A 1KRSA 1ESRA 3DXJC 1CFMA 4GLAC 4EGVA 2J4XA 2ZTDA 1CKNA 4BS9A 4ZUIA 1CZGA 5J39A 2DNEA 3U58A 1UEAB 3KBXA 1HNZQ 2PPBC 4RH6A 1CM9A 1WVLA 3NELA 5M3FG 1UEBA 4H44C 2UUBQ 4EQ5A 3I2ZA 2NVQH 5FLMG 1PTOC 3OWEB 1O7IA 2DY8A 1IL8A 3CC7A 4J6HA 5JVG3 2CFMA 3U4VA 3I4MG 2K33A 4X3KA 1QE6A 2GVBA 4IOCA 5M5XB 5C4JH 4MZ9A 1TQOA 4JI8Q 4DKAC 2A74C 2SDFA 4ZAIA 4L5SA 3P7JA 1FGBD 1OTCA 3G4SA 1Q12A 2BH2A 3NWTA 2RHSB 2F0VA 3FKIH 3CQZH 1JOOA 3DWAA 1K83B 1T9HA 2KJXA 1X32A 4DV1Q 1Y8PB 5CR3A 2IT1A 1O7YA 3J81j 4FF4A 4RGMA 4EX5A 1FNWA 3S17H 3S15H 3HOYB 1A63A 1IBLQ 3OTOL 3J80i 5JEAH 1RD9D 3F2UA 1LUZA 3HS0C 1HXYD 3D4DA 1YIJA 5ELFA 5LMUQ 2EOTA 1L2FA 3J80c 5IT9L 1SFOB 3RUZA 4A3EH 1SNCA 3GTGH 3D31A 4P75A 4GS3A 2LMCB 4O1NA 2O5IC 1RKNA 3LX0A 4A3BB 1BBXC 1XPUA 5DNFA 2VS1A 1VQPA 3A7AB 2OQ0A 2WB1B 1H9MA 5J22A 5M5YH 1BO0A 1EWIA 1I50B 1SNDA 3S1MB 2IHEA 4QB4A 4LFAL 1I6VC 3STBD 3FP9A 5DM63 3H3VI 3M4OH 5IOCA 4XYQA 5E3FA 1YHAA 1CI3M 5D3IB 1K0RA 1A0IA 4NXML 3BYTB 3W1BA 4B08A 3PIOA 4JI5Q 1EU4A 2E2JB 2Q2UA 3OSOA 4B3MQ 2R93G 1S5FD 2JA7B 4B3RL 3T16A 2Q8IB 5CV5A 1PFMA 2K5NA 1ASZA 3NPPA 1OXSC 1CSQA 2F3WA 1VQ9A 4OEMB 4FXGC 4AQYL 3EBEA 5G3LF 3S2HH 4N8FA 2IX3A 2HDLA 2E2IH 3HOUH 2F0GA 4UHVA 3ER0A 4L5QA 4A3KH 2E74C 4CKEA 3IFTA 4JBKA 4YWKA 3RNUA 2D0OA 3HKZB 3EFXD 2MO0A 5CBEE 3PCOB 3NUCA 1K73C 3RZOH 4M1UB 4N9TA 5M5WH 1K8MA 3KDFB 2RBMA 4QMGA 4EVOA 3D4WA 1GVPA 1XNQL 2PQAB 2K50A 4I65A 5IGGA 4HJ8A 1L0YB 1LTBD 1J5EL 1GUWA 3VR5A 1TR5A 4K14A 2B2TC 3H3VH 3D4RA 4ULLA 4IALA 1U4MA 2NTTA 4X62Q 4I7ZC 3SHLA 4CKCA 4YIJA 3PF5A 1TU2B 3HGBA 3B6YA 4X66Q 1PH3A 5FLXc 1KLGD 4B9WA 5IGBA 4OIJA 1R4QB 4ZUJA 3HOVB 1I4RA 2L11A 2FHTA 1V8QA 3PO2B 2N8NA 2Z6KC 1S5CD 4UAIA 5CC4A 5KYLA 4NXNQ 1FJGL 3CCJA 1CHQD 1N33Q 1TS2A 2OWOA 4GKJQ 4A3DB 3F1ZA 5A2QL 5C0XI 3KF8A 4LFCQ 3K0YA 1PYBA 1ILQA 3PMFA 4IQZA 5C5LA 3R2IA 1Q82C 1D5XC 1EYCA 1SE3A 2KBNA 2CW0C 2BE5D 1STAA 4MN3A 3JAME 1B70B 1VF7A 4A3GH 2EYHA 4QJFA 3VYSA 4BBRH 3NSWA 2B2YC 3BDCA 2IX0A 2A73B 3NBIA 4R8IA 2ZJPA 1EY0A 2EY5A 4CDDC 1QCBD 4V190 2A6EC 3CMEA 4NMZA 1VQKA 5EKKA 1JB3A 1TIID 1PH7A 4OGQC 5LMNQ 1GD7A 1VQJA 1Y1VB 1DXMA 3H0GH 1SLJA 4XTCS 3ULLA 3CCSA 2YTVA 4IURA 2NZHA 2VZAA 5CYUA 5ELDA 1E1OA 3GTLB 2R3ZA 4RWSC 2OCEA 3CF5A 3MZ5A 1W2BA 3A0JA 3GDEA 1I3QB 3J80L 3TZDA 2B8FA 4JI3L 3BZCA 4YWLA 4GOPA 2K5DA 2JA5B 1B2TA 1YHBA 2EJMA 2AUJD 1SEBD 1LT3D 3K5NA 4BXXH 4BY7B 3EVQA 2K7VA 1DCZA 4C3HG 5L37A 1XPOA 4CJ1B 3GTJH 3SR1A 1DZ1A 2WFWA 5C44B 1E7ZA 1IL2A 4RHRA 3K57A 1BDOA 3T1HQ 4A3IG 4ZK9B 4U68A 2ENBA 2EJFC 1NR2A 1PH1A 3NEMA 1PHJA 3I4NB 2L1BA 4A93G 1X54A 3GV6A 5JVH3 5K36H 3T51B 2XWJB 1EZ6A 4I7AA 1UAPA 2K4KA 2K5WA 5KYIA 3ICEA 5TSSA 5KGUA 4KJNA 3A8KE 1HNXL 3NBHB 4DK3C 2IW3A 1WJJA 4IZ8A 4XQJA 2MO1A 1TWGH 5M3FH 2CCZA 3S14B 1PRTC 1J5EQ 1BXTA 2WAQE 1PH4A 3VR3A 2I46A 5CV9A 3A8IE 5BN5A 5FLMH 1VQ4A 1EFID 5D65A 1NJIC 3M3YB 5HGQA 2A69C 3I4MH 1VQEA 3GTKH 2JJQA 3OYYA 4A3JB 5C5MA 1Q8IA 1MD2D 1ET9A 1RJTA 2PW7A 3M4YA 3K7AB 4WFN3 4UP9A 4LF4Q 4DR3L 1G8ZD 1PYSB 3EIVA 2L4NA 3ZYYX 3I7FA 1N36Q 1EWHA 1NE3A 4KI0A 1R9TB 1EEID 4LFBQ 1HNWQ 3BJUA 4JI0L 3EROA 3M4OB 2K5VA 3PO3G 4B3SQ 4QGUA 2QKIC 3S1NB 1PTOD 2A68C 1KNEA 4QUFA 4KK7A 1MSHA 4DV5Q 2E2HH 1TWFH 1X9NA 2ICIA 4JI6Q 3TP6A 5ELCA 3A5ZB 2RA4A 2IHFA 3OOCA 3S1RB 4ZYSA 4TQUS 1VQAA 4R9WA 1LT4D 2XTIA 1ESFA 1SYGA 3D8GA 3W5OA 4A75A 4JYAL 3K0XA 2XNAC 1U4RA 3HOWH 2ZM6Q 4G7OC 3MC0B 4JBMA 2JA8H 1BCPF 3KUPA 3TREA 1LABA 1JICA 3HOZG 2EXZA 1VQOA 2R92B 2RSOA 3VR4A 3CXCA 2WP8J 3CC2A 2B2TA 3A74A 1FL0A 1CQFA 1F2ZA 2VY3A 4C3JB 4K6DA 2A8VA 4DR4L 1Y1WG 4UDUC 2O5JC 3WOFA 5I9PA 3DLLA 3TN2A 3IFDA 3M7NA 2RDHA 3SE0A 1ONLA 3HOUG 1BQQT 4LMQD 4OWTB 2YU9H 4RKLA 3MTSA 3HKSA 2KCNA 4DR2Q 2R61A 5DLQE 1F9PA 1FVIA 3KOJA 5E7NA 2NB0A 5C3EB 2Y0SB 1B9MA 2DGYA 3UDIA 2MGSA 1STEA 3A56A 2JXMB 2I5LX 2Z4HA 5C4XG 2QF7A 4DNRB 1RTOA 3F2BA 4UP7A 1VQHA 1S72A 1TWCB 1TY2A 2UUCL 1VQMA 4C3IB 1BCPD 4RHSA 4OX9Q 1E2WA 5IGFA 2QDBA 4HAEA 2ZJRA 3H94A 4LWCA 2JK8A 1EWCA 2G9HD 1PLFA 5C4ZA 4JI1Q 1LACA 1SMYC 1YNNC 2WKDA 1WTOA 2B2YA 2EZVA 3FPUB 4DV4Q 2RDGA 1Q90A 5JEAJ 4JCVE 1C48A 5EAYA 3CU7A 4TKOB 4HJ5A 3D3RA 4J15A 5I2XA 2XRSD 1H9JA 1LTRD 1SROA 1HNXQ 4FYDA 2C9OA 2FXQA 3SK8A 3S2DB 2MPMA 1E3PA 4KY6A 2EJGC 1RHPA 1F9SA 3QOLA 2A6HC 2J0TD 3L0OA 4H7BA 2K32A 3KLSA 4FVMA 2Q8TA 4K6LA 1Q1EA 4A3MB 2E76C 3W1GA 2WAQG 1S5ED 4A3GG 4A4IA 1Q3LA 2TSSA 3DEOA 1EY7A 3VR6A 3A55A 2R7ZB 1TS5A 3BU2A 3PUYA 4DPGA 5CGKA 4KKTA 2HD3A 4B9XA 1UE6A 4HN7A 1AEXA 3HEJA 2JN4A 1SYEA 4DUYL 2V4DA 3OIQA 3FDTA 3C1EA 1JMCA 4PZ6A 1IW7C 4DA2A 2F0WA 1P8LA 2VB2X 3K58A 4IPDA 1YJNA 3GTQB 4JYAQ 4LF5Q 2AWNA 1I6HB 4K2LA 5IE8A 2IJ0A 4FXDA 3J7ZC 1PVOA 3TSSA 4LF6L 5D14A 4A3FB 4FF1A 2G5DA 1SRUA 4DR1Q 5BR8Q 5CBAE 4O42A 2WB1E 4DR7Q 4MIUA 2YTXA 3T1YL 3E9IA 1A3UA 5JJIA 5A2QE 4MTNA 1PTOB 2MP1A 2EDGA 5C0XG 4ZKBB 2HHHL 3NQTA 2VUMB 5HURA 1DOMA 4JI7L 1EIHA 4K5VA 4QIWB 1TWAB 2JA9A 2PNHA 5NUCA 1AE2A 1HA6A 1X55A 2NTSA 3TEHB 1BKBA 2XVSA 4DNIA 4ME5A 5KNBA 1DM0B 2JA6G 4WORA 1O78A 2IX1A 2K28A 1PV4A 4LF7L 4JC0A 1ZXTA 4ME3A 5IP7G 1M4VA 1PFSA 5IWAL 1GXDC 3FHWA 4RCNA 3URYA 5ELBA 2RVLA 1PMRA 1F2MA 1TT2A 5M3MG 2KHJA 1STYA 5GAHC 1Y14B 2B2VA 4RCOA 3RD4A 4GKKL 2EXDA 3E6ZX 3CCRA 3CCVA 2YYZA 4DR6L 1B9NA 3C1FA 1LO5D 4C3HH 1HPCA 2AHOB 1VQ8A 1LV9A 4DAYB 3EA6A 3FPPA 3UI2A 4KKUA 3HKZE 2YTYA 2OXPA 4A3IH 3HP3A 3NE5B 1PH5A 3J80E 1WI5A 2IPKD 4A93H 4BA2I 1II3A 1AW7A 4BY1B 1JWSD 2DNCA 1HFGA 1AZPA 3NQIA 1XMOQ 2F0EA 3L3OC 4OL7A 2VQEL 2CH4W 5AFWA 4HIKA 4WJWA 1X3PA 2R7FA 1VQBA 1FNVA 3CPFA 3MEHA 1BCPB 2R7DA 3R3OA 4K5XA 4IOAA 1HZAA 1CTMA 3JC66 3RLFA 3CHBD 5AJ3Q 3J7AV 1XJVA 1GHKA 5M9OA 2BDOA 2UUAQ 4GOPC 1PFNA 1IYUA 1B4OA 3HOWG 2EPBA 1EU3A 4O2DA 2XGTA 1TS3A 2KENA 3CCUA 1H9KA 2NVYH 2JA8G 1KAAA 2UXBQ 5FOBB 3H91A 1ICWA 2KQ3A 2ZT9C 1SMXA 1WTXA 1J9OA 3MXNA 1QILA 1NY4A 4MHEA 5I9OA 4DFAA 2F1MA 1E1TA 2YV5A 4G57A 2LS01 1IBKQ 4GZYC 1S5DD 1GUTA 4LF9Q 4X64L 1PRTD 1YNXA 2F0SA 1Q7YC 1JJ2A 1EY5A 4X65L 3PO3H 1JOQA 4PNYA 3CCEA 4DNTB 1U0LA 1Y8OB 3LWEA 2HUGA 4JW0A 3F2CA 1MBYA 1HZBA 4IJHA 4IFDG 1KQSA 2BH8A 2VB3X 4IUVA 2R93B 1WCMH 3SGIA 4DXGA 3PIP3 1EIFA 3Q8DA 1FYCA 4DV6Q 2QILA 4A76A 3KBGA 4Y7NH 1A3TA 4GNXA 4LF6Q 2GN5A 4L5RC 1C8CA 5EJWA 1WD1A 2J7ZA 4ZCKA 3HOZH 1QZGA 1XNRL 2A68D 4YHHL 2NBFA 5KNDA 3QB3A 1S40A 1PZKD 4P74A 3ONAB 4A3BG 1KIXA 2LXKA 1VQLA 4PV1C 3S1QB 3F8TA 4HJAA 1EIYB 2HIXA 2WB1G 2F0PA 5C4HA 1Y1WH 2HCCA 3P20A 3TRZA 2IWHA 2X6GA 5FO9B 2BOSA 4ZLTF 5IGDA 4ZKCB 4AYBB 3QG1A 2ES2A 4C2MB 1WYDA 4RG1A 3K80C 2EY6A
chains in the Genus database with same CATH topology
1JE5A 3M4QA 4AYBE 3CCMA 3T1HQ 2VUMG 4A3IG 1K8AC 2UUCQ 1NTGA 4UY8C 4OO1G 1PH1A 3NEMA 1PHJA 4LF4Q 2R93H 4UPAA 1Q81C 4A93G 1X54A 1M1KC 1X3EA 5C4XH 3UDFA 3CD6A 5C3EG 2E5LQ 2Y0SG 4KHZA 4JBWA 2K4KA 5FJ8H 2CWPA 5IYDG 3CC4A 1Y1VH 2JA7G 1G51A 4JG2A 2MNAA 3ICEA 1NMFA 1L0WA 3ULJA 4DR6Q 4OWWB 1SR3A 5GAGC 4GLXA 5GAEC 3CCQA 2ATWA 1HNXL 3S24A 3NBHB 3GTLH 4LF8Q 2UXCL 4GN4B 1KC8C 4DK3C 2JEAI 1YEZA 1K9MC 3LGJA 4KHPL 2ZTEA 1UE5A 3AFPA 1XMOL 1WJJA 3I56A 4DV0Q 5IYCG 1EYGA 2MO1A 1I3QH 3S1QH 1E24A 1TWGH 4X62L 5M3FH 2CCZA 2I0QA 1J5EQ 2WAQE 1PH4A 1JB7A 3TS2A 3RLNA 2JA5H 1LTLA 5FLMH 1VQ4A 3HOXH 1NJIC 1KL9A 1KRTA 4BY7H 5HGQA 4X66L 2NVXH 3I4MH 5ELOA 1VQEA 4C2MH 3GTKH 2JJQA 3OYYA 5AJ3L 3RLOA 5C44H 3PGZA 1K3RA 1I5FA 1CSPA 2UUAL 2CWAA 2HQLA 4HIOA 1HZCA 4UP9A 4DR3L 1YJWA 3G71A 1SE8A 1LYLA 1PYSB 3EIVA 4DV7L 4NXNL 3I7FA 1N36Q 2ZJQA 3I4NH 2PMZE 1NE3A 5IY0A 4KI0A 1HR0L 2UXBL 4AIMA 3H15A 3E9HA 2LXJA 4BY1G 1N33L 4GKJL 4LFBQ 1HNWQ 1GM5A 4DV2Q 3BJUA 4JI0L 2K5VA 3KF6A 4H02A 3PUXA 4QGUA 4B3SQ 3PO3G 4LFCL 2B63H 4JI2Q 4JV5L 2K5HA 4K0KQ 1VQFA 1N34Q 2N78A 4DV5Q 3OTOQ 2E2HH 1GO3E 4JI4L 1TWFH 1MJCA 1X9NA 4JI6Q 4BBRG 2IY5B 1HJPA 2EIFA 1IBKL 2OTJA 1JJGA 1A62A 3A5ZB 1BBWA 2IHFA 3KF6B 3BZKA 4TQUS 1VQAA 2A1AA 2F3IA 1PH9A 4IPCA 2XTIA 4LF9L 5C0XJ 4DUYQ 3OW2A 1D7QA 4P72A 3W5OA 4A75A 4JYAL 3K0XA 4MNOA 3HOVG 1BBUA 3HOWH 4PG3A 3S14H 2ZM6Q 1HR0W 1VQNA 4JBMA 2JA8H 3PO2G 4X64Q 3H0GG 1QUQA 3TREA 3HOYG 4LUOA 1NBWA 3M3YH 2F52A 3HOZG 1XMQL 3U50C 1VQOA 4A3LG 4PMWA 1TXYA 2E8GA 3CXCA 2ALYB 2KHIA 2WP8J 1EOVA 5IP9H 2VQFQ 3CC2A 3A74A 4A3DG 1FL0A 3AEVA 1MIUA 4A3JH 4DV6L 1L1OA 2JEBI 1LM0A 2OQKA 1QUQB 2Q2HA 5LMNL 2RHQB 2VY3A 4L5TA 3K8AA 4LFAQ 4OO1I 3T1YQ 3K7AH 1YZ6A 3WWVA 1J6QA 4R4TA 2A8VA 4IO9A 4P71A 4DR4L 1Y1WG 2UXDQ 1VS0A 4JI5L 2NN6G 5J3BA 3DLLA 2HHHQ 1L1OB 4LNQA 1VQ7A 1R9TH 3M7NA 4IJLA 3HOUG 4BXXG 1N32Q 4OWTB 2YU9H 1B7YB 4NXMQ 1MJEA 3S1NH 1DGSA 4JI7Q 3GD7A 3S16H 2Z0SA 4OONA 4DV3L 3HKSA 1I94Q 4HIDA 4DR2Q 4QL5A 5DLQE 2A19A 4OXPA 1A8VA 1XTDA 2BA1A 1VQDA 3M9BA 1X56A 3L2PA 1FVIA 3KOJA 5E7NA 4B3RQ 2H5XA 3HFZB 3PIPA 5LMNW 3S1RH 4B3TQ 2ID0A 1TWHH 2ZTCA 4A3CG 2B3GA 2DGYA 5GROA 3UDIA 1K8GA 4GN3B 1EFWA 3AYHB 2OTLA 4BBSH 1QZHA 2I5LX 2QGQA 1E22A 5C4XG 5K36G 4AQYQ 4LF7Q 1Z47A 2Y0SE 3PUWA 5FJ8G 1IBMQ 4IPGA 1Y1VG 1CKOA 1VQHA 1W3SA 4UP7A 2AKWB 1OXXK 5IWAQ 3F2BA 1S72A 2K75A 3T1HL 1KRSA 2UUCL 1VQMA 2AWOA 3M85A 3GTMH 1YJ9A 4UP8A 2R92H 4GLAC 5IYBH 2ZTDA 4OX9Q 3KFUA 3PV0A 2JA6H 1CKNA 4PZ8A 1HZ9A 1H95A 1C7YA 4LUVA 2ZJRA 3KJPA 3RZDH 4LWCA 3U58A 2E5LL 2JK8A 3A5UA 2UU9L 3GTPH 4GKKQ 5IP7H 1HNZQ 1VQCA 3DM3A 4C3JH 3NELA 2QA4A 5M3FG 4JI1Q 1P16A 4YCWA 1UEBA 2UUBQ 1CKNB 1X3FA 2NVTH 5M3MH 4EQ5A 4DV4Q 2JA5G 3I2ZA 4NXNQ 5FLMG 1XNQQ 2NVQH 1A63A 1X65A 1PA6A 5JEAJ 1O7IA 4JCVE 4BY7G 1RIPA 3CC7A 4AYBG 2CFMA 5EAYA 3U4VA 3I4MG 3MEFA 4HJ5A 2GVBA 5HY6A 4IOCA 5JJKA 5C4JH 5C44G 1OXVA 4J15A 4MZ9A 3EN2A 4JI8Q 4DKAC 4RMFA 4KLKA 2F4VL 3GTOH 1SROA 1HNXQ 4L5SA 1CUKA 2LSSA 2UXCQ 2VQEQ 3HKZG 1KD1C 4R4OA 2CQOA 2FXQA 2R6GA 1OTCA 3G4SA 1Q12A 5C3EH 4KHPQ 2BH2A 1E3PA 2RHSB 3I4NG 4YCVA 5IYDH 1G6PA 3FKIH 2QEXA 3CQZH 4R4IA 1T9HA 4JOIC 4IFDI 1GKHA 1WOCA 1YI2A 4DV1Q 3L0OA 4HJ7A 1HH2P 2IT1A 1TWCH 3UDXA 1AE3A 4C3IH 4R1JA 3L7ZC 4OWXB 2NZOA 1Q1EA 4LF4L 2D0PA 1N36L 1PH8A 3J81j 2VL6A 3KJOA 4DV7Q 1YHQA 3W1GA 2MQHA 2L15A 4EX5A 4LFBL 2WAQG 3S17H 1HNWL 4A3GG 4DV2L 4A4IA 2C35B 1FJGQ 4B3SL 3RR5A 4JI2L 3S15H 4IFDJ 1IBLQ 4K0KL 1N34L 3BU2A 3PUYA 4APVA 4DPGA 4BA1I 4DK6C 3OTOL 4DV5L 3J80i 1UE6A 4DUZL 4JI6L 1HR0Q 4R4QA 1LUZA 1WCMG 3GO5A 5H1SE 1YIJA 4NPSA 3I4OA 5LMUQ 4IPHA 4DUYL 1M90C 3NENA 1L2FA 5M5XH 3J80c 4JI4Q 1JMCA 4A3JG 4A3EH 4PZ6A 3GTGH 1FGUA 3D31A 1N8RC 4P75A 2ZM6L 4X65Q 4GS3A 1OXTA 4YWMA 3F2DA 3S2DH 1AH9A 1P8LA 1XPUA 2VS1A 4IPDA 4JBJA 1YJNA 4JYAQ 1VQPA 4LF5Q 2AWNA 5IE8A 2OQ0A 1K83H 4YY3L 3J7ZC 2VQFL 3G6EA 4HJ9A 1PVOA 1IXRA 2D62A 4GN5A 5M5YH 1EWIA 4LF6L 2DUDA 1SRUA 2IHEA 4DR1Q 5BR8Q 4LFAL 2WB1E 4DAMA 4DR7Q 3T1YL 2YTXA 3E9IA 3STBD 2I5HA 3FP9A 4DR5L 5JJIA 4MTNA 4A3MH 3H3VI 2UXDL 4XIGS 3M4OH 5C0XG 4ALPA 2HHHL 1YHAA 4WJ4A 3TQYA 4AH6A 1K0RA 1A0IA 3TS0A 3CP0A 3UE1A 4NXML 1XNRQ 2N49A 4YHHQ 1X3GA 4JI7L 3AQQA 2R7ZH 3HOYH 3W1BA 4GLVB 3PIOA 2JA9A 2PNHA 1I94L 4JI5Q 3CW2C 1ASYA 1EUJA 4A3LH 2Q2UA 4DR2L 3K7UC 1AE2A 1X55A 3PUZA 4NB3A 4Y52H 1U5KA 2RF4A 3TEHB 4B3MQ 2HT1A 2R93G 1BKBA 4B3RL 4QIWE 3J81i 2B29A 2R92G 2K52A 3PSIA 2PI2A 4DNIA 5IYBG 2K5NA 1ASZA 4JI3Q 3JAMi 4POFA 1SFOH 2JA6G 3ZJYC 1OXSC 1CSQA 1V1QA 1VQ9A 2IX1A 4AQYL 1PV4A 4LF7L 1C0AA 3EBEA 4JC0A 3S2HH 1VQ5A 4ME3A 3J81c 5IP7G 1VQ6A 3CPWA 2VNUD 2E2IH 1PFSA 5IWAL 3IRBA 3JAMc 3PF4A 1YBYA 3FHWA 3HOUH 4A3BH 2Q2IA 3ER0A 2JQOA 5M3MG 3RN5A 2KHJA 4L5QA 3GTQH 4A3KH 1MKHA 1VQGA 1EQQA 1I6HH 4OX9L 3AFQA 2ASBA 2PI2E 2BA0A 5GAHC 1Y14B 4JBKA 2V1CC 3KDFA 3UDGA 4A3FH 1I50H 2PQAA 4YWKA 3RNUA 2GVAA 3S1MH 2EXDA 2D0OA 3CCRA 3CCVA 2YYZA 4GKKL 4DR6L 2N3SA 4A3CH 2MO0A 4C3HH 1HNZL 2AHOB 3PCOB 4JI1L 4DAYB 1K73C 3HOXG 4HIMA 1VQ8A 5M5WH 2UUBL 4LF8L 3RZOH 1IYJB 4DV4L 3HKZE 3KDFB 2I5MX 2YTYA 1GVPA 1XNQL 2VUMH 2PQAB 4A3IH 4DV0L 1PH5A 2UU9Q 1PH2A 3G48A 2K50A 3FKIG 1WI5A 4HJ8A 4A93H 2JE6I 1TWAH 1J5EL 4BA2I 2E2JH 2RCNA 1C9OA 4JI8L 1UE1A 1D8LA 1V43A 1XMOQ 1UWVA 2KCMA 3RN2A 3H3VH 1KXLA 4GNXC 2VQEL 1PH6A 2JA7H 1L1OC 3KLWA 1CKMA 4HIKA 4X62Q 2R7FA 1VQBA 1QVCA 5IT9c 2B63G 3PF5A 2F4VQ 3CPFA 4R4CA 3CCLA 2R7DA 4DV1L 4IOAA 1HZAA 3B6YA 1Q46A 3JC66 4X66Q 1PH3A 5FLXc 3RLFA 3PUVA 5AJ3Q 1XJVA 4FDBA 5IYCH 4QQBX 1EQRA 5JEAG 2UUAQ 4YCUA 4GOPC 1WFQA 2N8NA 2Z6KC 1N9WA 4DR3Q 3HOWG 3STBC 3M4PA 4O2DA 2XGTA 2KENA 1V9PA 3CAMA 3CCUA 3CCJA 2NN6I 3ERSX 2NVYH 4P73A 1KAWA 1FJGL 1Q8KA 4A3EG 2JA8G 1IBLL 1N33Q 2UXBQ 2OWOA 4GKJQ 2AMCB 3F1ZA 4JI0Q 1SMXA 5C0XI 1XPRA 1YITA 4LFCQ 4JV5Q 1PYBA 1NY4A 1X6OA 1JJCB 5JJLA 5IP9G 1G291 3U4ZA 5LMUL 1E1TA 2YV5A 1IBKQ 1Q82C 4LF9Q 3KF8B 2KBNA 4X64L 4DUZQ 5ELNA 1YNXA 1Q7YC 1JJ2A 4BY1H 1OXUA 3MXNB 3KYHC 5GQOA 4X65L 3I55A 3PO3H 1B70B 4O0AA 2CKZB 3CCEA 1JT8A 2K14A 4LW1A 1U0LA 4A3GH 4A3MG 1VCIA 4WJ3M 4QJFA 3F2CA 4LF5L 4BBRH 3E0EA 1NMGA 1HZBA 1Q86C 4IJHA 3ULPA 4IFDG 3VDYA 2IX0A 1KQSA 1XMQQ 2KCTA 3J7A5 2BH8A 2ZJPA 2R7ZG 1WCMH 2EQSA 4DR1L 5BR8L 1S3OA 3CMEA 3SGIA 1VQKA 1EIFA 3Q8DA 4DR7L 4DV6Q 3HOVH 4X6AH 4A76A 4Y7NH 4TVAB 1PH7A 4YY3Q 5LMNQ 1QVGA 4BBSG 1GD7A 1VQJA 3CMAA 1N32L 4GNXA 3PO2H 4LF6Q 2GN5A 1UE7A 3H0GH 4L5RC 1SLJA 4XTCS 2HIVA 3ULLA 4JOIA 4QY7A 3CCSA 3HOZH 4DR4Q 2YTVA 1QZGA 1XNRL 2NZHA 1Q1BA 4YHHL 2VZAA 4DR5Q 1Z9FA 1IZ6A 2VW9A 1E1OA 4LUZA 3K81C 4A3DH 1S40A 2OCEA 4GNXB 4B3TL 3CF5A 3UE0A 2MFIA 4DV3Q 4P74A 1W2BA 4B3ML 3A0JA 3GDEA 4A3BG 1KIXA 2LXKA 1VQLA 3D0FA 1KHIA 3F8TA 4HJAA 4A3KG 1EIYB 4JI3L 3BZCA 4YWLA 2HIXA 2WB1G 4GOPA 1Y1WH 1IBML 3TRZA 4POGA 1YHBA 4A3FG 1YVCA 2Z6KA 1RL2A 1SN8A 1QVFA 4BXXH 4PZ7A 2Q2TA 2ES2A 5GADC 1BVSA 1XPOA 3GTJH 1WYDA 4RG1A 2WFWA 1B8AA 1VQIA 3K80C 4GOPB 1E7ZA 1IL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JE5 A;  3M4Q A;  4AYB E;  3CCM A;  3T1H Q;  2VUM G;  4A3I G;  1K8A C;  2UUC Q;  1NTG A;  4UY8 C;  4OO1 G;  1PH1 A;  3NEM A;  1PHJ A;  4LF4 Q;  2R93 H;  4UPA A;  1Q81 C;  4A93 G;  1X54 A;  1M1K C;  1X3E A;  5C4X H;  3UDF A;  3CD6 A;  5C3E G;  2E5L Q;  2Y0S G;  4KHZ A;  4JBW A;  2K4K A;  5FJ8 H;  2CWP A;  5IYD G;  3CC4 A;  1Y1V H;  2JA7 G;  1G51 A;  4JG2 A;  2MNA A;  3ICE A;  1NMF A;  1L0W A;  3ULJ A;  4DR6 Q;  4OWW B;  1SR3 A;  5GAG C;  4GLX A;  5GAE C;  3CCQ A;  2ATW A;  1HNX L;  3S24 A;  3NBH B;  3GTL H;  4LF8 Q;  2UXC L;  4GN4 B;  1KC8 C;  4DK3 C;  2JEA I;  1YEZ A;  1K9M C;  3LGJ A;  4KHP L;  2ZTE A;  1UE5 A;  3AFP A;  1XMO L;  1WJJ A;  3I56 A;  4DV0 Q;  5IYC G;  1EYG A;  2MO1 A;  1I3Q H;  3S1Q H;  1E24 A;  1TWG H;  4X62 L;  5M3F H;  2CCZ A;  2I0Q A;  1J5E Q;  2WAQ E;  1PH4 A;  1JB7 A;  3TS2 A;  3RLN A;  2JA5 H;  1LTL A;  5FLM H;  1VQ4 A;  3HOX H;  1NJI C;  1KL9 A;  1KRT A;  4BY7 H;  5HGQ A;  4X66 L;  2NVX H;  3I4M H;  5ELO A;  1VQE A;  4C2M H;  3GTK H;  2JJQ A;  3OYY A;  5AJ3 L;  3RLO A;  5C44 H;  3PGZ A;  1K3R A;  1I5F A;  1CSP A;  2UUA L;  2CWA A;  2HQL A;  4HIO A;  1HZC A;  4UP9 A;  4DR3 L;  1YJW A;  3G71 A;  1SE8 A;  1LYL A;  1PYS B;  3EIV A;  4DV7 L;  4NXN L;  3I7F A;  1N36 Q;  2ZJQ A;  3I4N H;  2PMZ E;  1NE3 A;  5IY0 A;  4KI0 A;  1HR0 L;  2UXB L;  4AIM A;  3H15 A;  3E9H A;  2LXJ A;  4BY1 G;  1N33 L;  4GKJ L;  4LFB Q;  1HNW Q;  1GM5 A;  4DV2 Q;  3BJU A;  4JI0 L;  2K5V A;  3KF6 A;  4H02 A;  3PUX A;  4QGU A;  4B3S Q;  3PO3 G;  4LFC L;  2B63 H;  4JI2 Q;  4JV5 L;  2K5H A;  4K0K Q;  1VQF A;  1N34 Q;  2N78 A;  4DV5 Q;  3OTO Q;  2E2H H;  1GO3 E;  4JI4 L;  1TWF H;  1MJC A;  1X9N A;  4JI6 Q;  4BBR G;  2IY5 B;  1HJP A;  2EIF A;  1IBK L;  2OTJ A;  1JJG A;  1A62 A;  3A5Z B;  1BBW A;  2IHF A;  3KF6 B;  3BZK A;  4TQU S;  1VQA A;  2A1A A;  2F3I A;  1PH9 A;  4IPC A;  2XTI A;  4LF9 L;  5C0X J;  4DUY Q;  3OW2 A;  1D7Q A;  4P72 A;  3W5O A;  4A75 A;  4JYA L;  3K0X A;  4MNO A;  3HOV G;  1BBU A;  3HOW H;  4PG3 A;  3S14 H;  2ZM6 Q;  1HR0 W;  1VQN A;  4JBM A;  2JA8 H;  3PO2 G;  4X64 Q;  3H0G G;  1QUQ A;  3TRE A;  3HOY G;  4LUO A;  1NBW A;  3M3Y H;  2F52 A;  3HOZ G;  1XMQ L;  3U50 C;  1VQO A;  4A3L G;  4PMW A;  1TXY A;  2E8G A;  3CXC A;  2ALY B;  2KHI A;  2WP8 J;  1EOV A;  5IP9 H;  2VQF Q;  3CC2 A;  3A74 A;  4A3D G;  1FL0 A;  3AEV A;  1MIU A;  4A3J H;  4DV6 L;  1L1O A;  2JEB I;  1LM0 A;  2OQK A;  1QUQ B;  2Q2H A;  5LMN L;  2RHQ B;  2VY3 A;  4L5T A;  3K8A A;  4LFA Q;  4OO1 I;  3T1Y Q;  3K7A H;  1YZ6 A;  3WWV A;  1J6Q A;  4R4T A;  2A8V A;  4IO9 A;  4P71 A;  4DR4 L;  1Y1W G;  2UXD Q;  1VS0 A;  4JI5 L;  2NN6 G;  5J3B A;  3DLL A;  2HHH Q;  1L1O B;  4LNQ A;  1VQ7 A;  1R9T H;  3M7N A;  4IJL A;  3HOU G;  4BXX G;  1N32 Q;  4OWT B;  2YU9 H;  1B7Y B;  4NXM Q;  1MJE A;  3S1N H;  1DGS A;  4JI7 Q;  3GD7 A;  3S16 H;  2Z0S A;  4OON A;  4DV3 L;  3HKS A;  1I94 Q;  4HID A;  4DR2 Q;  4QL5 A;  5DLQ E;  2A19 A;  4OXP A;  1A8V A;  1XTD A;  2BA1 A;  1VQD A;  3M9B A;  1X56 A;  3L2P A;  1FVI A;  3KOJ A;  5E7N A;  4B3R Q;  2H5X A;  3HFZ B;  3PIP A;  5LMN W;  3S1R H;  4B3T Q;  2ID0 A;  1TWH H;  2ZTC A;  4A3C G;  2B3G A;  2DGY A;  5GRO A;  3UDI A;  1K8G A;  4GN3 B;  1EFW A;  3AYH B;  2OTL A;  4BBS H;  1QZH A;  2I5L X;  2QGQ A;  1E22 A;  5C4X G;  5K36 G;  4AQY Q;  4LF7 Q;  1Z47 A;  2Y0S E;  3PUW A;  5FJ8 G;  1IBM Q;  4IPG A;  1Y1V G;  1CKO A;  1VQH A;  1W3S A;  4UP7 A;  2AKW B;  1OXX K;  5IWA Q;  3F2B A;  1S72 A;  2K75 A;  3T1H L;  1KRS A;  2UUC L;  1VQM A;  2AWO A;  3M85 A;  3GTM H;  1YJ9 A;  4UP8 A;  2R92 H;  4GLA C;  5IYB H;  2ZTD A;  4OX9 Q;  3KFU A;  3PV0 A;  2JA6 H;  1CKN A;  4PZ8 A;  1HZ9 A;  1H95 A;  1C7Y A;  4LUV A;  2ZJR A;  3KJP A;  3RZD H;  4LWC A;  3U58 A;  2E5L L;  2JK8 A;  3A5U A;  2UU9 L;  3GTP H;  4GKK Q;  5IP7 H;  1HNZ Q;  1VQC A;  3DM3 A;  4C3J H;  3NEL A;  2QA4 A;  5M3F G;  4JI1 Q;  1P16 A;  4YCW A;  1UEB A;  2UUB Q;  1CKN B;  1X3F A;  2NVT H;  5M3M H;  4EQ5 A;  4DV4 Q;  2JA5 G;  3I2Z A;  4NXN Q;  5FLM G;  1XNQ Q;  2NVQ H;  1A63 A;  1X65 A;  1PA6 A;  5JEA J;  1O7I A;  4JCV E;  4BY7 G;  1RIP A;  3CC7 A;  4AYB G;  2CFM A;  5EAY A;  3U4V A;  3I4M G;  3MEF A;  4HJ5 A;  2GVB A;  5HY6 A;  4IOC A;  5JJK A;  5C4J H;  5C44 G;  1OXV A;  4J15 A;  4MZ9 A;  3EN2 A;  4JI8 Q;  4DKA C;  4RMF A;  4KLK A;  2F4V L;  3GTO H;  1SRO A;  1HNX Q;  4L5S A;  1CUK A;  2LSS A;  2UXC Q;  2VQE Q;  3HKZ G;  1KD1 C;  4R4O A;  2CQO A;  2FXQ A;  2R6G A;  1OTC A;  3G4S A;  1Q12 A;  5C3E H;  4KHP Q;  2BH2 A;  1E3P A;  2RHS B;  3I4N G;  4YCV A;  5IYD H;  1G6P A;  3FKI H;  2QEX A;  3CQZ H;  4R4I A;  1T9H A;  4JOI C;  4IFD I;  1GKH A;  1WOC A;  1YI2 A;  4DV1 Q;  3L0O A;  4HJ7 A;  1HH2 P;  2IT1 A;  1TWC H;  3UDX A;  1AE3 A;  4C3I H;  4R1J A;  3L7Z C;  4OWX B;  2NZO A;  1Q1E A;  4LF4 L;  2D0P A;  1N36 L;  1PH8 A;  3J81 j;  2VL6 A;  3KJO A;  4DV7 Q;  1YHQ A;  3W1G A;  2MQH A;  2L15 A;  4EX5 A;  4LFB L;  2WAQ G;  3S17 H;  1HNW L;  4A3G G;  4DV2 L;  4A4I A;  2C35 B;  1FJG Q;  4B3S L;  3RR5 A;  4JI2 L;  3S15 H;  4IFD J;  1IBL Q;  4K0K L;  1N34 L;  3BU2 A;  3PUY A;  4APV A;  4DPG A;  4BA1 I;  4DK6 C;  3OTO L;  4DV5 L;  3J80 i;  1UE6 A;  4DUZ L;  4JI6 L;  1HR0 Q;  4R4Q A;  1LUZ A;  1WCM G;  3GO5 A;  5H1S E;  1YIJ A;  4NPS A;  3I4O A;  5LMU Q;  4IPH A;  4DUY L;  1M90 C;  3NEN A;  1L2F A;  5M5X H;  3J80 c;  4JI4 Q;  1JMC A;  4A3J G;  4A3E H;  4PZ6 A;  3GTG H;  1FGU A;  3D31 A;  1N8R C;  4P75 A;  2ZM6 L;  4X65 Q;  4GS3 A;  1OXT A;  4YWM A;  3F2D A;  3S2D H;  1AH9 A;  1P8L A;  1XPU A;  2VS1 A;  4IPD A;  4JBJ A;  1YJN A;  4JYA Q;  1VQP A;  4LF5 Q;  2AWN A;  5IE8 A;  2OQ0 A;  1K83 H;  4YY3 L;  3J7Z C;  2VQF L;  3G6E A;  4HJ9 A;  1PVO A;  1IXR A;  2D62 A;  4GN5 A;  5M5Y H;  1EWI A;  4LF6 L;  2DUD A;  1SRU A;  2IHE A;  4DR1 Q;  5BR8 Q;  4LFA L;  2WB1 E;  4DAM A;  4DR7 Q;  3T1Y L;  2YTX A;  3E9I A;  3STB D;  2I5H A;  3FP9 A;  4DR5 L;  5JJI A;  4MTN A;  4A3M H;  3H3V I;  2UXD L;  4XIG S;  3M4O H;  5C0X G;  4ALP A;  2HHH L;  1YHA A;  4WJ4 A;  3TQY A;  4AH6 A;  1K0R A;  1A0I A;  3TS0 A;  3CP0 A;  3UE1 A;  4NXM L;  1XNR Q;  2N49 A;  4YHH Q;  1X3G A;  4JI7 L;  3AQQ A;  2R7Z H;  3HOY H;  3W1B A;  4GLV B;  3PIO A;  2JA9 A;  2PNH A;  1I94 L;  4JI5 Q;  3CW2 C;  1ASY A;  1EUJ A;  4A3L H;  2Q2U A;  4DR2 L;  3K7U C;  1AE2 A;  1X55 A;  3PUZ A;  4NB3 A;  4Y52 H;  1U5K A;  2RF4 A;  3TEH B;  4B3M Q;  2HT1 A;  2R93 G;  1BKB A;  4B3R L;  4QIW E;  3J81 i;  2B29 A;  2R92 G;  2K52 A;  3PSI A;  2PI2 A;  4DNI A;  5IYB G;  2K5N A;  1ASZ A;  4JI3 Q;  3JAM i;  4POF A;  1SFO H;  2JA6 G;  3ZJY C;  1OXS C;  1CSQ A;  1V1Q A;  1VQ9 A;  2IX1 A;  4AQY L;  1PV4 A;  4LF7 L;  1C0A A;  3EBE A;  4JC0 A;  3S2H H;  1VQ5 A;  4ME3 A;  3J81 c;  5IP7 G;  1VQ6 A;  3CPW A;  2VNU D;  2E2I H;  1PFS A;  5IWA L;  3IRB A;  3JAM c;  3PF4 A;  1YBY A;  3FHW A;  3HOU H;  4A3B H;  2Q2I A;  3ER0 A;  2JQO A;  5M3M G;  3RN5 A;  2KHJ A;  4L5Q A;  3GTQ H;  4A3K H;  1MKH A;  1VQG A;  1EQQ A;  1I6H H;  4OX9 L;  3AFQ A;  2ASB A;  2PI2 E;  2BA0 A;  5GAH C;  1Y14 B;  4JBK A;  2V1C C;  3KDF A;  3UDG A;  4A3F H;  1I50 H;  2PQA A;  4YWK A;  3RNU A;  2GVA A;  3S1M H;  2EXD A;  2D0O A;  3CCR A;  3CCV A;  2YYZ A;  4GKK L;  4DR6 L;  2N3S A;  4A3C H;  2MO0 A;  4C3H H;  1HNZ L;  2AHO B;  3PCO B;  4JI1 L;  4DAY B;  1K73 C;  3HOX G;  4HIM A;  1VQ8 A;  5M5W H;  2UUB L;  4LF8 L;  3RZO H;  1IYJ B;  4DV4 L;  3HKZ E;  3KDF B;  2I5M X;  2YTY A;  1GVP A;  1XNQ L;  2VUM H;  2PQA B;  4A3I H;  4DV0 L;  1PH5 A;  2UU9 Q;  1PH2 A;  3G48 A;  2K50 A;  3FKI G;  1WI5 A;  4HJ8 A;  4A93 H;  2JE6 I;  1TWA H;  1J5E L;  4BA2 I;  2E2J H;  2RCN A;  1C9O A;  4JI8 L;  1UE1 A;  1D8L A;  1V43 A;  1XMO Q;  1UWV A;  2KCM A;  3RN2 A;  3H3V H;  1KXL A;  4GNX C;  2VQE L;  1PH6 A;  2JA7 H;  1L1O C;  3KLW A;  1CKM A;  4HIK A;  4X62 Q;  2R7F A;  1VQB A;  1QVC A;  5IT9 c;  2B63 G;  3PF5 A;  2F4V Q;  3CPF A;  4R4C A;  3CCL A;  2R7D A;  4DV1 L;  4IOA A;  1HZA A;  3B6Y A;  1Q46 A;  3JC6 6;  4X66 Q;  1PH3 A;  5FLX c;  3RLF A;  3PUV A;  5AJ3 Q;  1XJV A;  4FDB A;  5IYC H;  4QQB X;  1EQR A;  5JEA G;  2UUA Q;  4YCU A;  4GOP C;  1WFQ A;  2N8N A;  2Z6K C;  1N9W A;  4DR3 Q;  3HOW G;  3STB C;  3M4P A;  4O2D A;  2XGT A;  2KEN A;  1V9P A;  3CAM A;  3CCU A;  3CCJ A;  2NN6 I;  3ERS X;  2NVY H;  4P73 A;  1KAW A;  1FJG L;  1Q8K A;  4A3E G;  2JA8 G;  1IBL L;  1N33 Q;  2UXB Q;  2OWO A;  4GKJ Q;  2AMC B;  3F1Z A;  4JI0 Q;  1SMX A;  5C0X I;  1XPR A;  1YIT A;  4LFC Q;  4JV5 Q;  1PYB A;  1NY4 A;  1X6O A;  1JJC B;  5JJL A;  5IP9 G;  1G29 1;  3U4Z A;  5LMU L;  1E1T A;  2YV5 A;  1IBK Q;  1Q82 C;  4LF9 Q;  3KF8 B;  2KBN A;  4X64 L;  4DUZ Q;  5ELN A;  1YNX A;  1Q7Y C;  1JJ2 A;  4BY1 H;  1OXU A;  3MXN B;  3KYH C;  5GQO A;  4X65 L;  3I55 A;  3PO3 H;  1B70 B;  4O0A A;  2CKZ B;  3CCE A;  1JT8 A;  2K14 A;  4LW1 A;  1U0L A;  4A3G H;  4A3M G;  1VCI A;  4WJ3 M;  4QJF A;  3F2C A;  4LF5 L;  4BBR H;  3E0E A;  1NMG A;  1HZB A;  1Q86 C;  4IJH A;  3ULP A;  4IFD G;  3VDY A;  2IX0 A;  1KQS A;  1XMQ Q;  2KCT A;  3J7A 5;  2BH8 A;  2ZJP A;  2R7Z G;  1WCM H;  2EQS A;  4DR1 L;  5BR8 L;  1S3O A;  3CME A;  3SGI A;  1VQK A;  1EIF A;  3Q8D A;  4DR7 L;  4DV6 Q;  3HOV H;  4X6A H;  4A76 A;  4Y7N H;  4TVA B;  1PH7 A;  4YY3 Q;  5LMN Q;  1QVG A;  4BBS G;  1GD7 A;  1VQJ A;  3CMA A;  1N32 L;  4GNX A;  3PO2 H;  4LF6 Q;  2GN5 A;  1UE7 A;  3H0G H;  4L5R C;  1SLJ A;  4XTC S;  2HIV A;  3ULL A;  4JOI A;  4QY7 A;  3CCS A;  3HOZ H;  4DR4 Q;  2YTV A;  1QZG A;  1XNR L;  2NZH A;  1Q1B A;  4YHH L;  2VZA A;  4DR5 Q;  1Z9F A;  1IZ6 A;  2VW9 A;  1E1O A;  4LUZ A;  3K81 C;  4A3D H;  1S40 A;  2OCE A;  4GNX B;  4B3T L;  3CF5 A;  3UE0 A;  2MFI A;  4DV3 Q;  4P74 A;  1W2B A;  4B3M L;  3A0J A;  3GDE A;  4A3B G;  1KIX A;  2LXK A;  1VQL A;  3D0F A;  1KHI A;  3F8T A;  4HJA A;  4A3K G;  1EIY B;  4JI3 L;  3BZC A;  4YWL A;  2HIX A;  2WB1 G;  4GOP A;  1Y1W H;  1IBM L;  3TRZ A;  4POG A;  1YHB A;  4A3F G;  1YVC A;  2Z6K A;  1RL2 A;  1SN8 A;  1QVF A;  4BXX H;  4PZ7 A;  2Q2T A;  2ES2 A;  5GAD C;  1BVS A;  1XPO A;  3GTJ H;  1WYD A;  4RG1 A;  2WFW A;  1B8A A;  1VQI A;  3K80 C;  4GOP B;  1E7Z A;  1IL2 A; 
#chains in the Genus database with same CATH topology
 3DWQ A;  1NSN S;  2F4I A;  1K8A C;  1NTG A;  2F0K A;  3HRZ C;  1LT5 D;  4CJ2 C;  1Q81 C;  4HED A;  2SEB D;  5C4X H;  1O7Z A;  3UDF A;  2N55 A;  1Y69 U;  2EVB A;  4JBW A;  4G4K A;  2JA7 G;  2MUY A;  4L63 B;  1JCK B;  1G51 A;  1IKM A;  2MNA A;  3TP7 A;  5C3W A;  4DR6 Q;  1SR3 A;  2ZXR A;  4GLX A;  5GAE C;  2ATW A;  3VA5 A;  3S24 A;  4GN4 B;  1KDB A;  1RCV D;  1K9M C;  4EQP A;  4CDF C;  1HQR D;  3I56 A;  5KIX A;  5IYC G;  1EYG A;  1KTK A;  1R4P B;  3U9S A;  5F2D A;  3VYU A;  1E24 A;  4F8M A;  4KMU C;  4C1N I;  3I91 A;  5FO7 B;  3TBI B;  3RLN A;  1G2S A;  2ZXO A;  3HOX H;  3I70 A;  1SE4 A;  2NVX H;  5ELO A;  4QCL A;  2L0C A;  1DOK A;  3CKI B;  1I5F A;  1CSP A;  3I72 A;  2PMZ B;  2HQL A;  3FMC A;  3E0J A;  2EYF A;  5HGT A;  3G71 A;  1LYL A;  4DV7 L;  5T1I A;  3E9H A;  2LXJ A;  1YNN D;  1GM5 A;  3PUX A;  2B63 H;  4JV5 L;  3S16 B;  1K28 A;  1V1P B;  2E75 C;  1EL0 A;  3OTO Q;  1AFP A;  3C2P A;  1MJC A;  3FRP B;  5LHY 1;  2OTJ A;  4PQX A;  1JJG A;  1J8I A;  3KF6 B;  3BZK A;  3S9W A;  2L55 A;  1PH9 A;  5I4D A;  1ZYR C;  5CMD A;  2EY2 A;  1H9S B;  4M8A A;  3HOV G;  1EZ8 A;  1VDZ A;  1X3Q A;  3BVG A;  4C56 C;  4NKL A;  3PO2 G;  4X64 Q;  1O7L A;  2C5C A;  1EYD A;  1QUQ A;  1NBW A;  4XQQ A;  1XMQ L;  2DY7 A;  4DK1 A;  1IHZ A;  2QDL A;  2ALY B;  3GQB A;  3K5O A;  1EOV A;  5IP9 H;  4A3D G;  2K6A A;  3I8Z A;  3D6C A;  1CZW A;  1MIU A;  2JEB I;  1LM0 A;  1G91 A;  1T5E A;  2OEO A;  4L5T A;  3K8A A;  4LFA Q;  1ZKO A;  1I4P A;  4OO1 I;  2RSN A;  4P71 A;  2NN6 G;  2AUK A;  1L1O B;  4PMC A;  2NVQ B;  3QJY A;  4CBV A;  4KTA A;  4NXM Q;  1RDP D;  5C4J B;  3VYT A;  4DV3 L;  3T56 B;  1PRT B;  2PQE A;  1PFB A;  4OXP A;  1A8V A;  1XTD A;  3BDO A;  3L2P A;  5C0X H;  4B3R Q;  1IW7 D;  2H5X A;  3HFZ B;  2ID0 A;  1TWH H;  2ZTC A;  2B3G A;  1K8G A;  4BBS H;  3FKI B;  1QZH A;  3CQZ B;  4N8X 1;  4AQY Q;  1G2T A;  2Y0S E;  5FJ8 G;  1Y1V G;  3ND8 A;  3DEP A;  1ENA A;  2AWO A;  3M85 A;  2F0I A;  3GTM H;  4RGN A;  1YJ9 A;  4UP8 A;  1PTO F;  3V96 A;  2JA6 H;  4PZ8 A;  1HTL D;  1A2T A;  3DHQ A;  3OWF A;  1HZ9 A;  1H95 A;  1WTH A;  4LUV A;  2E5L L;  3KJP A;  3RZD H;  3S17 B;  3GTP H;  3A5U A;  3GV3 A;  1STN A;  3SXH A;  2UU9 L;  5IP7 H;  3S15 B;  4J1M A;  2M9V A;  2QA4 A;  2F0H A;  1SYC A;  4K8I A;  4KJO A;  1CKN B;  2NVT H;  5M3M H;  2JA5 G;  1EEF D;  1XNQ Q;  1X65 A;  4BY7 G;  1I4H A;  3M7G A;  5HY6 A;  1DD2 A;  2BCO A;  5C44 G;  1OXV A;  5D3D A;  2KCC A;  4A3E B;  1HUN A;  3GTG B;  2D2C C;  4XYO A;  3GTO H;  1A2U A;  1KD1 C;  3MXP A;  4HMI A;  2CQO A;  4R4O A;  3I4N G;  2QEX A;  2KEC A;  3GP7 A;  3LNN A;  4R4I A;  4IFD I;  1WOC A;  4RAU C;  3R8B A;  5M5Y B;  1JOK A;  2B2W C;  2JSO A;  4H0L C;  2B39 A;  3P75 A;  3UDX A;  1AE3 A;  3L7Z C;  2NZO A;  2DJG C;  2EYJ A;  3MFG A;  2VL6 A;  1YHQ A;  2MQH A;  2L15 A;  2LFN A;  4DV2 L;  3C46 A;  2C35 B;  1FJG Q;  2N88 A;  3RR5 A;  4JI2 L;  4K0K L;  1N34 L;  3IAY A;  4RA8 A;  3T53 B;  4APV A;  5EPL A;  4DUZ L;  4R4Q A;  3NTI A;  4CDC C;  1WCM G;  5H1S E;  1MHW C;  2B2V C;  2F0M A;  4NPS A;  3I4O A;  5JPN C;  4IPH A;  3ITP A;  3NEN A;  4IUP A;  5M5X H;  3NHH A;  4A3J G;  1FGU A;  4G7Z C;  1N8R C;  3S2H B;  4KY5 A;  5FLX L;  2E2I B;  1OXT A;  3F2D A;  3HOU B;  4JBJ A;  4A3K B;  1K83 H;  2VQF L;  4HJ9 A;  1IXR A;  1UUP A;  2D62 A;  4GN5 A;  2DUD A;  4ABN A;  4DAM A;  2KUM A;  2H4O A;  4F87 A;  3RZO B;  1SXT A;  2PZW A;  2UXD L;  5M5W B;  4Q5V A;  1JC7 A;  1PZI D;  4IFD H;  3I90 A;  2F3V A;  3TQY A;  4AH6 A;  2F0D A;  1JE4 A;  1STG A;  4J8Q A;  4V0B A;  1EIG A;  2CHB D;  3AQQ A;  3HOY H;  4IUN A;  3K6O A;  2IL8 A;  1I94 L;  1DJR D;  1ASY A;  1GUO A;  4A3L H;  3K7U C;  1HTP A;  3KK7 A;  3PUZ A;  4NB3 A;  1F77 A;  1U5K A;  1TVX A;  1LT6 D;  2F0Q A;  4QIW E;  1ML0 D;  1SYB A;  3J81 i;  2B29 A;  5CV8 A;  2R92 G;  5IYB G;  3PSI A;  4JI3 Q;  1DYQ A;  4F88 A;  1D1K A;  1SFO H;  3BDL A;  4CJ0 B;  3ZJY C;  1FD7 D;  2HQE A;  1VQ5 A;  1JR0 D;  2QEJ C;  3J81 c;  5EQ0 A;  3CPW A;  4FXK C;  3TP5 A;  1WTP A;  3IRB A;  4A3B H;  1I4G A;  4OIK A;  2K1B A;  3R93 A;  1MKH A;  3AFQ A;  3TME A;  2PI2 E;  2BA0 A;  2V1C C;  3KDF A;  1I50 H;  1OO9 B;  2PQA A;  2PZT A;  5EPJ A;  2GVA A;  3S1M H;  2JYO A;  4DF7 A;  1GUG A;  1HNZ L;  2WIN B;  3HOX G;  2UUB L;  4DV0 L;  2UU9 Q;  1HHV A;  1PH2 A;  1DOL A;  2FJ2 A;  2F0L A;  2E2J H;  1U9R A;  2RCN A;  1C9O A;  4JI8 L;  1D8L A;  1V43 A;  2KCM A;  1KXL A;  4KN7 C;  1SBB B;  4GNX C;  5J1Z A;  1O80 A;  2PW5 A;  2JA7 H;  3KLW A;  4C3I G;  1HFN A;  1CKM A;  3NP8 A;  5JJZ A;  4A3G B;  1QVC A;  1SNO A;  5IT9 c;  1SSO A;  4BBR B;  2B63 G;  1NAP A;  2Q8R E;  2BE5 C;  3CCL A;  4DV1 L;  2F0F A;  2QW7 A;  3ERQ A;  4CHT B;  1F2Y A;  3CRL C;  1ROD A;  1E2Z A;  5IYC H;  1EQR A;  5EKL A;  5ISR A;  1WFQ A;  2K04 A;  3H0G B;  1N9W A;  4DR3 Q;  1WTV A;  3CAM A;  2NN6 I;  3ERS X;  4P73 A;  1H9R A;  1IBL L;  4JK1 C;  4JI0 Q;  1YIT A;  1A15 A;  5JJL A;  1JJC B;  1LTG D;  3Q6S A;  3U9O A;  4CGY B;  5IP9 G;  3U4Z A;  5LMU L;  3Q0A A;  1V1O A;  3KF8 B;  4DUZ Q;  1NCV A;  1F9R A;  3I55 A;  3K5L A;  3GTJ B;  1JT8 A;  4A3M G;  1VCI A;  2NUC A;  4ODG A;  1PDQ A;  3E0E A;  1NMG A;  3NTK A;  1Q86 C;  1BUV T;  5T1G A;  3ULP A;  1NNX A;  2KCT A;  2R7Z G;  1SYD A;  4RKB A;  2F03 A;  1JWU D;  1S3O A;  4FF2 A;  3HOV H;  4X6A H;  4LAA A;  4TVA B;  4BBS G;  1JQY D;  3CMA A;  1N32 L;  3QR8 A;  3PO2 H;  1UE7 A;  1XXG A;  2HIV A;  1GHJ A;  4DR4 Q;  1ILP A;  2D9U A;  1TS4 A;  1Q1B A;  2Z9H A;  2B2W A;  2B2U A;  3I4L A;  2VW9 A;  4LUZ A;  4A3D H;  2M2L A;  2CW0 D;  5FO8 B;  3UE0 A;  3EQL C;  4B3M L;  2ZXP A;  5I6Y A;  1ZYR D;  1TWG B;  5M3F B;  3AMU A;  1MGS A;  1QNU A;  2PCF B;  1IBM L;  2NN6 H;  3NWS A;  1BF4 A;  4DXF A;  4A3F G;  1SN8 A;  3O13 A;  1CQV A;  1E2V A;  2Z6B A;  3I4M B;  4L6T B;  3GTK B;  2A6E D;  1KNA A;  4S3S A;  3DM1 A;  4GOP B;  3Q24 A;  3WOE A;  1JE5 A;  4AYB E;  2VUM G;  2UUC Q;  3CRK C;  2RKS A;  1B3A A;  4OO1 G;  2XWB B;  1B50 A;  5LL6 S;  2TMP A;  4UPA A;  2PYK A;  4X3U A;  3OMC A;  1A3V A;  1M1K C;  1X3E A;  2DJF C;  3NBH A;  5FJ8 H;  1EOT A;  1Y1V H;  1PRT F;  4JG2 A;  2X6L A;  4NP5 A;  2E2H B;  3ULJ A;  1TWF B;  2SOB A;  5GAG C;  1LTA D;  2UXC L;  3OIP A;  3GTL H;  1SNP A;  1W6J A;  3LGJ A;  4KHP L;  2ZTE A;  3AFP A;  2HCI A;  4DV0 Q;  1Z7T A;  1CK1 A;  1U4P A;  4ZQ3 A;  1I3Q H;  3HOW B;  3E5S A;  3A8J E;  4X62 L;  1JB7 A;  3ND9 A;  5DEH A;  2JA8 B;  2JA5 H;  1LTL A;  3J81 L;  2K05 A;  1NR4 A;  1CA6 A;  1KL9 A;  1KRT A;  2PO4 A;  1S4Z A;  4BY7 H;  4X3T A;  4X66 L;  4K2K A;  3RLO A;  5C44 H;  4Z9C B;  1SJE D;  2FIN B;  3SK5 A;  3MA2 B;  2WV6 D;  2K01 A;  1SJH D;  1MI2 A;  2NZ1 D;  1HZC A;  4DGZ A;  1SE8 A;  1K3B C;  4NXN L;  3I4N H;  2PMZ E;  4KHV A;  5IY0 A;  1HR0 L;  5I2Y A;  1QJO A;  1N33 L;  4BY1 G;  4KD4 A;  4GKJ L;  2YU9 B;  5IOD A;  4H02 A;  4LFC L;  2F0T A;  5JPM C;  2K5H A;  5E4W C;  4JI4 L;  5C6A A;  1HCZ A;  4KN4 C;  1SAP A;  2IY5 B;  1EQT A;  2EIF A;  5KEE A;  2EE1 A;  1A6X A;  3MWY W;  4HTH A;  2L12 A;  5C0X J;  4DUY Q;  2A69 D;  3DUZ A;  1D7Q A;  4P72 A;  2EYL A;  4MNO A;  4PG3 A;  3S14 H;  1HR0 W;  1VQN A;  1S5B D;  3PIO 3;  3HOY G;  3M3Y H;  2F52 A;  4A3L G;  2BDN A;  4PMW A;  3IL8 A;  2E8G A;  2KHI A;  3OW7 A;  4K8J A;  4HMJ A;  2L5T A;  4A3J H;  2OQK A;  5LMN L;  2SNM A;  2CQA A;  5COR A;  3Q23 A;  3T1Y Q;  3K7A H;  1BCP C;  1MSG A;  4R8N A;  1VS0 A;  1L0X B;  5C3X A;  2HHH Q;  3H6M A;  3KLR A;  1R9T H;  1GUS A;  1N32 Q;  2WII B;  3S1N H;  1DGS A;  4JI7 Q;  3FVQ A;  2Z0S A;  4HID A;  1GOZ A;  4L8J A;  4QL5 A;  4KD3 A;  3DWP A;  5FLX E;  4HSV A;  4NW2 A;  1VQD A;  3MVV A;  4HCS A;  1T5X D;  2FMM A;  1QNK A;  3PIP A;  5LMN W;  3S1R H;  5GRO A;  4GN3 B;  3AYH B;  2F0U A;  2KEE A;  1PXU A;  2XSC A;  4G7H C;  4LF7 Q;  2H1E A;  1D2B A;  1IBM Q;  4F7X A;  1W3S A;  1OXX K;  5IWA Q;  3T1H L;  3IKJ A;  5DAU A;  2KVM A;  2R92 H;  5IYB H;  2MHV A;  3H09 A;  5JAV A;  2RDF A;  3KFU A;  3PV0 A;  4FP5 D;  4JVZ A;  1AP0 A;  1C7Y A;  2F0O A;  4GKK Q;  1F2L A;  1FNU A;  2LKV A;  1HRJ A;  3TZU A;  1KAB A;  4XT1 B;  1VQC A;  2WKC A;  3DM3 A;  4C3J H;  1P16 A;  4YCW A;  1X3F A;  2XN9 C;  4XDX A;  2E2D C;  4LK1 C;  1PA6 A;  1RIP A;  4AYB G;  5JJK A;  3MEF A;  1GUN A;  5EPK A;  2CH4 A;  5KRU A;  3EN2 A;  2LY7 A;  4RMF A;  2RCF A;  2P5Z X;  4KLK A;  2F4V L;  1CUK A;  2LSS A;  2UXC Q;  2VQE Q;  3HKZ G;  2R6G A;  4ZRZ A;  4KHP Q;  5C3E H;  1YNJ C;  5DM7 3;  4YCV A;  5IYD H;  1G6P A;  3J7Y W;  1B53 A;  4E6I A;  2XRQ D;  1DON A;  4JOI C;  1GKH A;  2PZU A;  1YI2 A;  1D6E C;  1LTT D;  2EYM A;  1XX8 A;  1KDA A;  4WRD A;  1W6K A;  4HJ7 A;  1SYF A;  1HH2 P;  1TWC H;  2Z8L A;  4C3I H;  4R1J A;  4OWX B;  1XYI A;  1SMY D;  4LF4 L;  3I3C A;  2X69 A;  2D0P A;  5G3L D;  1N36 L;  1PH8 A;  3BG3 A;  1VMP A;  2NYZ D;  3KJO A;  4LFB L;  1CHP D;  1HNW L;  1EY8 A;  4B3S L;  4N9P A;  4IFD J;  2B8G A;  4DN4 M;  2RQX A;  2M00 A;  4BA1 I;  4DK6 C;  4DV5 L;  2Z4I A;  4EQN A;  4JI6 L;  1HR0 Q;  4ID6 A;  3GO5 A;  1F9Q A;  1ZEQ X;  5KNC A;  3SK6 A;  1M90 C;  1PZJ D;  3MHB A;  5IIF A;  4JI4 Q;  4Q0F A;  2XIW A;  3G6J B;  2ZM6 L;  2AQ2 B;  2A6H D;  4X65 Q;  3OHX C;  2VXW A;  4YWM A;  3TDQ A;  3QIA A;  3S2D H;  1AH9 A;  1XWE A;  3Q22 A;  1QG7 A;  1PYW D;  4YY3 L;  3G6E A;  4HSP A;  4LJZ C;  4OEL B;  4RGT A;  3LWU A;  4KKS A;  1QOH A;  4C3H B;  2I07 B;  2I5H A;  4DR5 L;  5JOB A;  3G7L A;  4A3M H;  4XIG S;  2ICE C;  3BZD B;  4ALP A;  2O2L D;  4A3I B;  4WJ4 A;  4TRD A;  3TS0 A;  1XNR Q;  3CP0 A;  3UE1 A;  2N49 A;  4XT3 B;  5IGC A;  4YHH Q;  1X3G A;  2R7Z H;  1KLU D;  4A93 B;  4GLV B;  3VYR A;  5LL6 X;  3CW2 C;  1EUJ A;  3J7A F;  1EYA A;  4DR2 L;  5E1F A;  1BOS A;  3R2T A;  4Y52 H;  2EYP A;  2RF4 A;  2HT1 A;  2K52 A;  1LLR D;  2PI2 A;  3JAM i;  1WTQ A;  4POF A;  1V1Q A;  3T13 A;  3X3N A;  2L9H A;  1C0A A;  1VQ6 A;  1ET6 A;  2VNU D;  2A5H A;  3JAM c;  4IUT A;  3PF4 A;  1IKL A;  1YBY A;  4P2C B;  2Q2I A;  2JQO A;  3GTQ H;  3RN5 A;  1I6H H;  3T4A C;  1VQG A;  2WAC A;  1EQQ A;  4DAY A;  4OX9 L;  3SVM A;  2ASB A;  5FK9 C;  4ILW A;  2NWG A;  3UDG A;  4A3F H;  4CKB A;  4CDE C;  1UNS A;  2N3S A;  2NVY B;  4DU9 A;  1I4Q A;  1Y8N B;  4A3C H;  4JI1 L;  3VR2 A;  4HIM A;  4LF8 L;  1PTO H;  1IYJ B;  2EY1 A;  4DV4 L;  2I5M X;  2VUM H;  3N52 A;  4EQO A;  3G48 A;  3FKI G;  4OO1 H;  1RTN A;  2JE6 I;  1TWA H;  1D5Z C;  2FFK B;  5EGT A;  1UE1 A;  4MTK A;  1UWV A;  3RN2 A;  3PO3 B;  1PH6 A;  1L1O C;  5ELE A;  1B44 D;  5CV7 A;  5FKA C;  2B2U C;  1GJX A;  5CV6 A;  2F4V Q;  1AN8 A;  4R4C A;  1Q46 A;  1RF2 D;  3PUV A;  1WCM B;  1ENF A;  4FDB A;  1STB A;  4QQB X;  3OMG A;  5JEA G;  3W2D A;  4Y7N B;  4YCU A;  1WTR A;  4KY7 A;  1B3Q A;  1QB5 D;  3STB C;  3M4P A;  1HUM A;  4DV7 Q;  3HOZ B;  1V9P A;  1G6Z A;  1KAW A;  1Q8K A;  4K5W A;  4A3E G;  1SDF A;  5CV4 A;  2AMC B;  1TKW B;  1XPR A;  1EY9 A;  4JV5 Q;  3P1H A;  1BR9 A;  5I6W A;  4U67 3;  3E3X A;  1X6O A;  1G29 1;  2KHS A;  4FNF A;  3BS1 A;  1Y1W B;  1AZQ A;  4RGO S;  3J81 E;  5ELN A;  4XQN A;  4BY1 H;  1OXU A;  3MXN B;  2PNR C;  1NUC A;  1Z6H A;  3KYH C;  5GQO A;  4O0A A;  2QCP X;  2AQ3 B;  2CKZ B;  2K14 A;  4LW1 A;  4X3S A;  3K59 A;  1ENC A;  3V05 A;  4WJ3 M;  5E4X A;  1VMC A;  1ICF B;  4NDX A;  4LF5 L;  3A54 A;  3VDY A;  1XMQ Q;  3RMH A;  3J7A 5;  3K5M A;  1WD0 A;  2EQS A;  3DMU A;  5BR8 L;  2DN8 A;  4DR1 L;  4QF4 A;  4DR7 L;  5C4X B;  4YY3 Q;  1QVG A;  4QUC A;  3L9A X;  1SNQ A;  3QOJ A;  4JOI A;  4QY7 A;  3BVM A;  2F0J A;  4DR5 Q;  1Z9F A;  1IZ6 A;  1U4L A;  3K81 C;  4GNX B;  4B3T L;  1LTI D;  3VA7 A;  2MFI A;  3BYY B;  4DV3 Q;  3D0F A;  1KHI A;  3SDZ A;  4C1N K;  5IT9 E;  4A3K G;  4IUQ A;  3BVZ A;  4PMB A;  4POG A;  1BNZ A;  4C3J G;  1YVC A;  2Z6K A;  1RL2 A;  5BN4 A;  3HOX B;  1QVF A;  4PZ7 A;  4IN3 A;  2Q2T A;  2NVX B;  5GAD C;  1BVS A;  2KED A;  1B8A A;  1VQI A;  5EBC A;  2G9D A;  3M4Q A;  3CCM A;  1JOR A;  3NTH A;  1XTC D;  2CVR A;  4UY8 C;  1SE2 A;  5COY A;  3SEB A;  1I4X A;  3FEW X;  2R93 H;  5A35 A;  4DAV A;  1KDC A;  3CD6 A;  5C3E G;  3MFY A;  2Y0S G;  3QWN A;  1EQV A;  4KHZ A;  2E5L Q;  3WDN A;  2CWP A;  5IYD G;  1C4Q A;  4BWG B;  3CC4 A;  2B63 B;  1TY0 A;  1D1I A;  1NMF A;  1L0W A;  4TSS A;  3KLS X;  4OWW B;  2KA7 A;  4RFB A;  2OT2 A;  3CCQ A;  3D6W A;  4LF8 Q;  5K5P A;  1KC8 C;  2JEA I;  2SNS A;  1YEZ A;  3TP8 A;  2WAQ B;  1UE5 A;  1XMO L;  3NXW A;  4DAP A;  1STH A;  1HQM C;  3S1Q H;  2I0Q A;  4FF3 A;  3TS2 A;  2EYO A;  3QO2 A;  1EY4 A;  3JAM L;  1EY6 A;  4C2M H;  3OPO A;  3H3V C;  5AJ3 L;  2Z1C A;  3A7L A;  1K3R A;  3PGZ A;  4OHJ A;  4DK0 A;  2UUA L;  3MAQ A;  3PQI A;  2CWA A;  1HA5 A;  4HIO A;  1SNM A;  1V1P A;  1YJW A;  1M8A A;  2ZJQ A;  3C3L A;  2UXB L;  4AIM A;  3H15 A;  4DV2 Q;  3KF6 A;  2O4X A;  1QWY A;  1D5M C;  2D5D A;  4JI2 Q;  4K0K Q;  1VQF A;  1N34 Q;  1E0B A;  1VF5 C;  2N78 A;  1GO3 E;  1H9S A;  2GA4 B;  4JPB W;  1FR3 A;  4H13 C;  4BBR G;  1HJP A;  4XXE A;  1IBK L;  1B1Z A;  3I73 A;  1A62 A;  1BBW A;  4LF9 L;  2A1A A;  2F3I A;  1TWH B;  4IPC A;  3MXG A;  5BN3 A;  4BBS B;  3OW2 A;  5EBD A;  2AQ1 B;  3AB9 A;  1YNJ D;  1BBU A;  2KOL A;  3SK4 A;  1K8O A;  3H0G G;  5EKI A;  2FMC A;  4LUO A;  3GTM B;  2F0N A;  3U50 C;  1TXY A;  2JP1 A;  2MJ8 A;  2JA6 B;  2VQF Q;  1IYV A;  3AEV A;  1WTW A;  4DV6 L;  1L1O A;  3RZD B;  1K0S A;  3W3A A;  3GTP B;  1QUQ B;  2Q2H A;  2HDM A;  2RHQ B;  1CT1 D;  3WWV A;  1YZ6 A;  5IGE A;  1J6Q A;  4R4T A;  4FO2 A;  4IO9 A;  2UXD Q;  4JI5 L;  2NVT B;  5J3B A;  5M3M B;  3MXU A;  4HR7 B;  4LNQ A;  1VQ7 A;  3N6R A;  1CA5 A;  4IJL A;  4BXX G;  3V2T A;  1B7Y B;  2K03 A;  1MJE A;  3GD7 A;  3S16 H;  4OON A;  1I94 Q;  4HCE A;  3HG9 A;  2A19 A;  3NK9 A;  3GTO B;  2BA1 A;  3M9B A;  1X56 A;  2OF1 A;  4KV6 A;  4A3C G;  4B3T Q;  1EFW A;  2OTL A;  3AU7 A;  3X3M A;  3EJI A;  2QGQ A;  1E22 A;  5K36 G;  1JWM D;  2K5Q A;  1Z47 A;  3PUW A;  4IUU A;  4IPG A;  1CKO A;  3HZX A;  1LTS D;  2AKW B;  2K75 A;  1KRS A;  1ESR A;  3DXJ C;  1CFM A;  4GLA C;  4EGV A;  2J4X A;  2ZTD A;  1CKN A;  4BS9 A;  4ZUI A;  1CZG A;  5J39 A;  2DNE A;  3U58 A;  1UEA B;  3KBX A;  1HNZ Q;  2PPB C;  4RH6 A;  1CM9 A;  1WVL A;  3NEL A;  5M3F G;  1UEB A;  4H44 C;  2UUB Q;  4EQ5 A;  3I2Z A;  2NVQ H;  5FLM G;  1PTO C;  3OWE B;  1O7I A;  2DY8 A;  1IL8 A;  3CC7 A;  4J6H A;  5JVG 3;  2CFM A;  3U4V A;  3I4M G;  2K33 A;  4X3K A;  1QE6 A;  2GVB A;  4IOC A;  5M5X B;  5C4J H;  4MZ9 A;  1TQO A;  4JI8 Q;  4DKA C;  2A74 C;  2SDF A;  4ZAI A;  4L5S A;  3P7J A;  1FGB D;  1OTC A;  3G4S A;  1Q12 A;  2BH2 A;  3NWT A;  2RHS B;  2F0V A;  3FKI H;  3CQZ H;  1JOO A;  3DWA A;  1K83 B;  1T9H A;  2KJX A;  1X32 A;  4DV1 Q;  1Y8P B;  5CR3 A;  2IT1 A;  1O7Y A;  3J81 j;  4FF4 A;  4RGM A;  4EX5 A;  1FNW A;  3S17 H;  3S15 H;  3HOY B;  1A63 A;  1IBL Q;  3OTO L;  3J80 i;  5JEA H;  1RD9 D;  3F2U A;  1LUZ A;  3HS0 C;  1HXY D;  3D4D A;  1YIJ A;  5ELF A;  5LMU Q;  2EOT A;  1L2F A;  3J80 c;  5IT9 L;  1SFO B;  3RUZ A;  4A3E H;  1SNC A;  3GTG H;  3D31 A;  4P75 A;  4GS3 A;  2LMC B;  4O1N A;  2O5I C;  1RKN A;  3LX0 A;  4A3B B;  1BBX C;  1XPU A;  5DNF A;  2VS1 A;  1VQP A;  3A7A B;  2OQ0 A;  2WB1 B;  1H9M A;  5J22 A;  5M5Y H;  1BO0 A;  1EWI A;  1I50 B;  1SND A;  3S1M B;  2IHE A;  4QB4 A;  4LFA L;  1I6V C;  3STB D;  3FP9 A;  5DM6 3;  3H3V I;  3M4O H;  5IOC A;  4XYQ A;  5E3F A;  1YHA A;  1CI3 M;  5D3I B;  1K0R A;  1A0I A;  4NXM L;  3BYT B;  3W1B A;  4B08 A;  3PIO A;  4JI5 Q;  1EU4 A;  2E2J B;  2Q2U A;  3OSO A;  4B3M Q;  2R93 G;  1S5F D;  2JA7 B;  4B3R L;  3T16 A;  2Q8I B;  5CV5 A;  1PFM A;  2K5N A;  1ASZ A;  3NPP A;  1OXS C;  1CSQ A;  2F3W A;  1VQ9 A;  4OEM B;  4FXG C;  4AQY L;  3EBE A;  5G3L F;  3S2H H;  4N8F A;  2IX3 A;  2HDL A;  2E2I H;  3HOU H;  2F0G A;  4UHV A;  3ER0 A;  4L5Q A;  4A3K H;  2E74 C;  4CKE A;  3IFT A;  4JBK A;  4YWK A;  3RNU A;  2D0O A;  3HKZ B;  3EFX D;  2MO0 A;  5CBE E;  3PCO B;  3NUC A;  1K73 C;  3RZO H;  4M1U B;  4N9T A;  5M5W H;  1K8M A;  3KDF B;  2RBM A;  4QMG A;  4EVO A;  3D4W A;  1GVP A;  1XNQ L;  2PQA B;  2K50 A;  4I65 A;  5IGG A;  4HJ8 A;  1L0Y B;  1LTB D;  1J5E L;  1GUW A;  3VR5 A;  1TR5 A;  4K14 A;  2B2T C;  3H3V H;  3D4R A;  4ULL A;  4IAL A;  1U4M A;  2NTT A;  4X62 Q;  4I7Z C;  3SHL A;  4CKC A;  4YIJ A;  3PF5 A;  1TU2 B;  3HGB A;  3B6Y A;  4X66 Q;  1PH3 A;  5FLX c;  1KLG D;  4B9W A;  5IGB A;  4OIJ A;  1R4Q B;  4ZUJ A;  3HOV B;  1I4R A;  2L11 A;  2FHT A;  1V8Q A;  3PO2 B;  2N8N A;  2Z6K C;  1S5C D;  4UAI A;  5CC4 A;  5KYL A;  4NXN Q;  1FJG L;  3CCJ A;  1CHQ D;  1N33 Q;  1TS2 A;  2OWO A;  4GKJ Q;  4A3D B;  3F1Z A;  5A2Q L;  5C0X I;  3KF8 A;  4LFC Q;  3K0Y A;  1PYB A;  1ILQ A;  3PMF A;  4IQZ A;  5C5L A;  3R2I A;  1Q82 C;  1D5X C;  1EYC A;  1SE3 A;  2KBN A;  2CW0 C;  2BE5 D;  1STA A;  4MN3 A;  3JAM E;  1B70 B;  1VF7 A;  4A3G H;  2EYH A;  4QJF A;  3VYS A;  4BBR H;  3NSW A;  2B2Y C;  3BDC A;  2IX0 A;  2A73 B;  3NBI A;  4R8I A;  2ZJP A;  1EY0 A;  2EY5 A;  4CDD C;  1QCB D;  4V19 0;  2A6E C;  3CME A;  4NMZ A;  1VQK A;  5EKK A;  1JB3 A;  1TII D;  1PH7 A;  4OGQ C;  5LMN Q;  1GD7 A;  1VQJ A;  1Y1V B;  1DXM A;  3H0G H;  1SLJ A;  4XTC S;  3ULL A;  3CCS A;  2YTV A;  4IUR A;  2NZH A;  2VZA A;  5CYU A;  5ELD A;  1E1O A;  3GTL B;  2R3Z A;  4RWS C;  2OCE A;  3CF5 A;  3MZ5 A;  1W2B A;  3A0J A;  3GDE A;  1I3Q B;  3J80 L;  3TZD A;  2B8F A;  4JI3 L;  3BZC A;  4YWL A;  4GOP A;  2K5D A;  2JA5 B;  1B2T A;  1YHB A;  2EJM A;  2AUJ D;  1SEB D;  1LT3 D;  3K5N A;  4BXX H;  4BY7 B;  3EVQ A;  2K7V A;  1DCZ A;  4C3H G;  5L37 A;  1XPO A;  4CJ1 B;  3GTJ H;  3SR1 A;  1DZ1 A;  2WFW A;  5C44 B;  1E7Z A;  1IL2 A;  4RHR A;  3K57 A;  1BDO A;  3T1H Q;  4A3I G;  4ZK9 B;  4U68 A;  2ENB A;  2EJF C;  1NR2 A;  1PH1 A;  3NEM A;  1PHJ A;  3I4N B;  2L1B A;  4A93 G;  1X54 A;  3GV6 A;  5JVH 3;  5K36 H;  3T51 B;  2XWJ B;  1EZ6 A;  4I7A A;  1UAP A;  2K4K A;  2K5W A;  5KYI A;  3ICE A;  5TSS A;  5KGU A;  4KJN A;  3A8K E;  1HNX L;  3NBH B;  4DK3 C;  2IW3 A;  1WJJ A;  4IZ8 A;  4XQJ A;  2MO1 A;  1TWG H;  5M3F H;  2CCZ A;  3S14 B;  1PRT C;  1J5E Q;  1BXT A;  2WAQ E;  1PH4 A;  3VR3 A;  2I46 A;  5CV9 A;  3A8I E;  5BN5 A;  5FLM H;  1VQ4 A;  1EFI D;  5D65 A;  1NJI C;  3M3Y B;  5HGQ A;  2A69 C;  3I4M H;  1VQE A;  3GTK H;  2JJQ A;  3OYY A;  4A3J B;  5C5M A;  1Q8I A;  1MD2 D;  1ET9 A;  1RJT A;  2PW7 A;  3M4Y A;  3K7A B;  4WFN 3;  4UP9 A;  4LF4 Q;  4DR3 L;  1G8Z D;  1PYS B;  3EIV A;  2L4N A;  3ZYY X;  3I7F A;  1N36 Q;  1EWH A;  1NE3 A;  4KI0 A;  1R9T B;  1EEI D;  4LFB Q;  1HNW Q;  3BJU A;  4JI0 L;  3ERO A;  3M4O B;  2K5V A;  3PO3 G;  4B3S Q;  4QGU A;  2QKI C;  3S1N B;  1PTO D;  2A68 C;  1KNE A;  4QUF A;  4KK7 A;  1MSH A;  4DV5 Q;  2E2H H;  1TWF H;  1X9N A;  2ICI A;  4JI6 Q;  3TP6 A;  5ELC A;  3A5Z B;  2RA4 A;  2IHF A;  3OOC A;  3S1R B;  4ZYS A;  4TQU S;  1VQA A;  4R9W A;  1LT4 D;  2XTI A;  1ESF A;  1SYG A;  3D8G A;  3W5O A;  4A75 A;  4JYA L;  3K0X A;  2XNA C;  1U4R A;  3HOW H;  2ZM6 Q;  4G7O C;  3MC0 B;  4JBM A;  2JA8 H;  1BCP F;  3KUP A;  3TRE A;  1LAB A;  1JIC A;  3HOZ G;  2EXZ A;  1VQO A;  2R92 B;  2RSO A;  3VR4 A;  3CXC A;  2WP8 J;  3CC2 A;  2B2T A;  3A74 A;  1FL0 A;  1CQF A;  1F2Z A;  2VY3 A;  4C3J B;  4K6D A;  2A8V A;  4DR4 L;  1Y1W G;  4UDU C;  2O5J C;  3WOF A;  5I9P A;  3DLL A;  3TN2 A;  3IFD A;  3M7N A;  2RDH A;  3SE0 A;  1ONL A;  3HOU G;  1BQQ T;  4LMQ D;  4OWT B;  2YU9 H;  4RKL A;  3MTS A;  3HKS A;  2KCN A;  4DR2 Q;  2R61 A;  5DLQ E;  1F9P A;  1FVI A;  3KOJ A;  5E7N A;  2NB0 A;  5C3E B;  2Y0S B;  1B9M A;  2DGY A;  3UDI A;  2MGS A;  1STE A;  3A56 A;  2JXM B;  2I5L X;  2Z4H A;  5C4X G;  2QF7 A;  4DNR B;  1RTO A;  3F2B A;  4UP7 A;  1VQH A;  1S72 A;  1TWC B;  1TY2 A;  2UUC L;  1VQM A;  4C3I B;  1BCP D;  4RHS A;  4OX9 Q;  1E2W A;  5IGF A;  2QDB A;  4HAE A;  2ZJR A;  3H94 A;  4LWC A;  2JK8 A;  1EWC A;  2G9H D;  1PLF A;  5C4Z A;  4JI1 Q;  1LAC A;  1SMY C;  1YNN C;  2WKD A;  1WTO A;  2B2Y A;  2EZV A;  3FPU B;  4DV4 Q;  2RDG A;  1Q90 A;  5JEA J;  4JCV E;  1C48 A;  5EAY A;  3CU7 A;  4TKO B;  4HJ5 A;  3D3R A;  4J15 A;  5I2X A;  2XRS D;  1H9J A;  1LTR D;  1SRO A;  1HNX Q;  4FYD A;  2C9O A;  2FXQ A;  3SK8 A;  3S2D B;  2MPM A;  1E3P A;  4KY6 A;  2EJG C;  1RHP A;  1F9S A;  3QOL A;  2A6H C;  2J0T D;  3L0O A;  4H7B A;  2K32 A;  3KLS A;  4FVM A;  2Q8T A;  4K6L A;  1Q1E A;  4A3M B;  2E76 C;  3W1G A;  2WAQ G;  1S5E D;  4A3G G;  4A4I A;  1Q3L A;  2TSS A;  3DEO A;  1EY7 A;  3VR6 A;  3A55 A;  2R7Z B;  1TS5 A;  3BU2 A;  3PUY A;  4DPG A;  5CGK A;  4KKT A;  2HD3 A;  4B9X A;  1UE6 A;  4HN7 A;  1AEX A;  3HEJ A;  2JN4 A;  1SYE A;  4DUY L;  2V4D A;  3OIQ A;  3FDT A;  3C1E A;  1JMC A;  4PZ6 A;  1IW7 C;  4DA2 A;  2F0W A;  1P8L A;  2VB2 X;  3K58 A;  4IPD A;  1YJN A;  3GTQ B;  4JYA Q;  4LF5 Q;  2AWN A;  1I6H B;  4K2L A;  5IE8 A;  2IJ0 A;  4FXD A;  3J7Z C;  1PVO A;  3TSS A;  4LF6 L;  5D14 A;  4A3F B;  4FF1 A;  2G5D A;  1SRU A;  4DR1 Q;  5BR8 Q;  5CBA E;  4O42 A;  2WB1 E;  4DR7 Q;  4MIU A;  2YTX A;  3T1Y L;  3E9I A;  1A3U A;  5JJI A;  5A2Q E;  4MTN A;  1PTO B;  2MP1 A;  2EDG A;  5C0X G;  4ZKB B;  2HHH L;  3NQT A;  2VUM B;  5HUR A;  1DOM A;  4JI7 L;  1EIH A;  4K5V A;  4QIW B;  1TWA B;  2JA9 A;  2PNH A;  5NUC A;  1AE2 A;  1HA6 A;  1X55 A;  2NTS A;  3TEH B;  1BKB A;  2XVS A;  4DNI A;  4ME5 A;  5KNB A;  1DM0 B;  2JA6 G;  4WOR A;  1O78 A;  2IX1 A;  2K28 A;  1PV4 A;  4LF7 L;  4JC0 A;  1ZXT A;  4ME3 A;  5IP7 G;  1M4V A;  1PFS A;  5IWA L;  1GXD C;  3FHW A;  4RCN A;  3URY A;  5ELB A;  2RVL A;  1PMR A;  1F2M A;  1TT2 A;  5M3M G;  2KHJ A;  1STY A;  5GAH C;  1Y14 B;  2B2V A;  4RCO A;  3RD4 A;  4GKK L;  2EXD A;  3E6Z X;  3CCR A;  3CCV A;  2YYZ A;  4DR6 L;  1B9N A;  3C1F A;  1LO5 D;  4C3H H;  1HPC A;  2AHO B;  1VQ8 A;  1LV9 A;  4DAY B;  3EA6 A;  3FPP A;  3UI2 A;  4KKU A;  3HKZ E;  2YTY A;  2OXP A;  4A3I H;  3HP3 A;  3NE5 B;  1PH5 A;  3J80 E;  1WI5 A;  2IPK D;  4A93 H;  4BA2 I;  1II3 A;  1AW7 A;  4BY1 B;  1JWS D;  2DNC A;  1HFG A;  1AZP A;  3NQI A;  1XMO Q;  2F0E A;  3L3O C;  4OL7 A;  2VQE L;  2CH4 W;  5AFW A;  4HIK A;  4WJW A;  1X3P A;  2R7F A;  1VQB A;  1FNV A;  3CPF A;  3MEH A;  1BCP B;  2R7D A;  3R3O A;  4K5X A;  4IOA A;  1HZA A;  1CTM A;  3JC6 6;  3RLF A;  3CHB D;  5AJ3 Q;  3J7A V;  1XJV A;  1GHK A;  5M9O A;  2BDO A;  2UUA Q;  4GOP C;  1PFN A;  1IYU A;  1B4O A;  3HOW G;  2EPB A;  1EU3 A;  4O2D A;  2XGT A;  1TS3 A;  2KEN A;  3CCU A;  1H9K A;  2NVY H;  2JA8 G;  1KAA A;  2UXB Q;  5FOB B;  3H91 A;  1ICW A;  2KQ3 A;  2ZT9 C;  1SMX A;  1WTX A;  1J9O A;  3MXN A;  1QIL A;  1NY4 A;  4MHE A;  5I9O A;  4DFA A;  2F1M A;  1E1T A;  2YV5 A;  4G57 A;  2LS0 1;  1IBK Q;  4GZY C;  1S5D D;  1GUT A;  4LF9 Q;  4X64 L;  1PRT D;  1YNX A;  2F0S A;  1Q7Y C;  1JJ2 A;  1EY5 A;  4X65 L;  3PO3 H;  1JOQ A;  4PNY A;  3CCE A;  4DNT B;  1U0L A;  1Y8O B;  3LWE A;  2HUG A;  4JW0 A;  3F2C A;  1MBY A;  1HZB A;  4IJH A;  4IFD G;  1KQS A;  2BH8 A;  2VB3 X;  4IUV A;  2R93 B;  1WCM H;  3SGI A;  4DXG A;  3PIP 3;  1EIF A;  3Q8D A;  1FYC A;  4DV6 Q;  2QIL A;  4A76 A;  3KBG A;  4Y7N H;  1A3T A;  4GNX A;  4LF6 Q;  2GN5 A;  4L5R C;  1C8C A;  5EJW A;  1WD1 A;  2J7Z A;  4ZCK A;  3HOZ H;  1QZG A;  1XNR L;  2A68 D;  4YHH L;  2NBF A;  5KND A;  3QB3 A;  1S40 A;  1PZK D;  4P74 A;  3ONA B;  4A3B G;  1KIX A;  2LXK A;  1VQL A;  4PV1 C;  3S1Q B;  3F8T A;  4HJA A;  1EIY B;  2HIX A;  2WB1 G;  2F0P A;  5C4H A;  1Y1W H;  2HCC A;  3P20 A;  3TRZ A;  2IWH A;  2X6G A;  5FO9 B;  2BOS A;  4ZLT F;  5IGD A;  4ZKC B;  4AYB B;  3QG1 A;  2ES2 A;  4C2M B;  1WYD A;  4RG1 A;  3K80 C;  2EY6 A; 
#chains in the Genus database with same CATH homology
 1JE5 A;  3M4Q A;  4AYB E;  3CCM A;  3T1H Q;  2VUM G;  4A3I G;  1K8A C;  2UUC Q;  1NTG A;  4UY8 C;  4OO1 G;  1PH1 A;  3NEM A;  1PHJ A;  4LF4 Q;  2R93 H;  4UPA A;  1Q81 C;  4A93 G;  1X54 A;  1M1K C;  1X3E A;  5C4X H;  3UDF A;  3CD6 A;  5C3E G;  2E5L Q;  2Y0S G;  4KHZ A;  4JBW A;  2K4K A;  5FJ8 H;  2CWP A;  5IYD G;  3CC4 A;  1Y1V H;  2JA7 G;  1G51 A;  4JG2 A;  2MNA A;  3ICE A;  1NMF A;  1L0W A;  3ULJ A;  4DR6 Q;  4OWW B;  1SR3 A;  5GAG C;  4GLX A;  5GAE C;  3CCQ A;  2ATW A;  1HNX L;  3S24 A;  3NBH B;  3GTL H;  4LF8 Q;  2UXC L;  4GN4 B;  1KC8 C;  4DK3 C;  2JEA I;  1YEZ A;  1K9M C;  3LGJ A;  4KHP L;  2ZTE A;  1UE5 A;  3AFP A;  1XMO L;  1WJJ A;  3I56 A;  4DV0 Q;  5IYC G;  1EYG A;  2MO1 A;  1I3Q H;  3S1Q H;  1E24 A;  1TWG H;  4X62 L;  5M3F H;  2CCZ A;  2I0Q A;  1J5E Q;  2WAQ E;  1PH4 A;  1JB7 A;  3TS2 A;  3RLN A;  2JA5 H;  1LTL A;  5FLM H;  1VQ4 A;  3HOX H;  1NJI C;  1KL9 A;  1KRT A;  4BY7 H;  5HGQ A;  4X66 L;  2NVX H;  3I4M H;  5ELO A;  1VQE A;  4C2M H;  3GTK H;  2JJQ A;  3OYY A;  5AJ3 L;  3RLO A;  5C44 H;  3PGZ A;  1K3R A;  1I5F A;  1CSP A;  2UUA L;  2CWA A;  2HQL A;  4HIO A;  1HZC A;  4UP9 A;  4DR3 L;  1YJW A;  3G71 A;  1SE8 A;  1LYL A;  1PYS B;  3EIV A;  4DV7 L;  4NXN L;  3I7F A;  1N36 Q;  2ZJQ A;  3I4N H;  2PMZ E;  1NE3 A;  5IY0 A;  4KI0 A;  1HR0 L;  2UXB L;  4AIM A;  3H15 A;  3E9H A;  2LXJ A;  4BY1 G;  1N33 L;  4GKJ L;  4LFB Q;  1HNW Q;  1GM5 A;  4DV2 Q;  3BJU A;  4JI0 L;  2K5V A;  3KF6 A;  4H02 A;  3PUX A;  4QGU A;  4B3S Q;  3PO3 G;  4LFC L;  2B63 H;  4JI2 Q;  4JV5 L;  2K5H A;  4K0K Q;  1VQF A;  1N34 Q;  2N78 A;  4DV5 Q;  3OTO Q;  2E2H H;  1GO3 E;  4JI4 L;  1TWF H;  1MJC A;  1X9N A;  4JI6 Q;  4BBR G;  2IY5 B;  1HJP A;  2EIF A;  1IBK L;  2OTJ A;  1JJG A;  1A62 A;  3A5Z B;  1BBW A;  2IHF A;  3KF6 B;  3BZK A;  4TQU S;  1VQA A;  2A1A A;  2F3I A;  1PH9 A;  4IPC A;  2XTI A;  4LF9 L;  5C0X J;  4DUY Q;  3OW2 A;  1D7Q A;  4P72 A;  3W5O A;  4A75 A;  4JYA L;  3K0X A;  4MNO A;  3HOV G;  1BBU A;  3HOW H;  4PG3 A;  3S14 H;  2ZM6 Q;  1HR0 W;  1VQN A;  4JBM A;  2JA8 H;  3PO2 G;  4X64 Q;  3H0G G;  1QUQ A;  3TRE A;  3HOY G;  4LUO A;  1NBW A;  3M3Y H;  2F52 A;  3HOZ G;  1XMQ L;  3U50 C;  1VQO A;  4A3L G;  4PMW A;  1TXY A;  2E8G A;  3CXC A;  2ALY B;  2KHI A;  2WP8 J;  1EOV A;  5IP9 H;  2VQF Q;  3CC2 A;  3A74 A;  4A3D G;  1FL0 A;  3AEV A;  1MIU A;  4A3J H;  4DV6 L;  1L1O A;  2JEB I;  1LM0 A;  2OQK A;  1QUQ B;  2Q2H A;  5LMN L;  2RHQ B;  2VY3 A;  4L5T A;  3K8A A;  4LFA Q;  4OO1 I;  3T1Y Q;  3K7A H;  1YZ6 A;  3WWV A;  1J6Q A;  4R4T A;  2A8V A;  4IO9 A;  4P71 A;  4DR4 L;  1Y1W G;  2UXD Q;  1VS0 A;  4JI5 L;  2NN6 G;  5J3B A;  3DLL A;  2HHH Q;  1L1O B;  4LNQ A;  1VQ7 A;  1R9T H;  3M7N A;  4IJL A;  3HOU G;  4BXX G;  1N32 Q;  4OWT B;  2YU9 H;  1B7Y B;  4NXM Q;  1MJE A;  3S1N H;  1DGS A;  4JI7 Q;  3GD7 A;  3S16 H;  2Z0S A;  4OON A;  4DV3 L;  3HKS A;  1I94 Q;  4HID A;  4DR2 Q;  4QL5 A;  5DLQ E;  2A19 A;  4OXP A;  1A8V A;  1XTD A;  2BA1 A;  1VQD A;  3M9B A;  1X56 A;  3L2P A;  1FVI A;  3KOJ A;  5E7N A;  4B3R Q;  2H5X A;  3HFZ B;  3PIP A;  5LMN W;  3S1R H;  4B3T Q;  2ID0 A;  1TWH H;  2ZTC A;  4A3C G;  2B3G A;  2DGY A;  5GRO A;  3UDI A;  1K8G A;  4GN3 B;  1EFW A;  3AYH B;  2OTL A;  4BBS H;  1QZH A;  2I5L X;  2QGQ A;  1E22 A;  5C4X G;  5K36 G;  4AQY Q;  4LF7 Q;  1Z47 A;  2Y0S E;  3PUW A;  5FJ8 G;  1IBM Q;  4IPG A;  1Y1V G;  1CKO A;  1VQH A;  1W3S A;  4UP7 A;  2AKW B;  1OXX K;  5IWA Q;  3F2B A;  1S72 A;  2K75 A;  3T1H L;  1KRS A;  2UUC L;  1VQM A;  2AWO A;  3M85 A;  3GTM H;  1YJ9 A;  4UP8 A;  2R92 H;  4GLA C;  5IYB H;  2ZTD A;  4OX9 Q;  3KFU A;  3PV0 A;  2JA6 H;  1CKN A;  4PZ8 A;  1HZ9 A;  1H95 A;  1C7Y A;  4LUV A;  2ZJR A;  3KJP A;  3RZD H;  4LWC A;  3U58 A;  2E5L L;  2JK8 A;  3A5U A;  2UU9 L;  3GTP H;  4GKK Q;  5IP7 H;  1HNZ Q;  1VQC A;  3DM3 A;  4C3J H;  3NEL A;  2QA4 A;  5M3F G;  4JI1 Q;  1P16 A;  4YCW A;  1UEB A;  2UUB Q;  1CKN B;  1X3F A;  2NVT H;  5M3M H;  4EQ5 A;  4DV4 Q;  2JA5 G;  3I2Z A;  4NXN Q;  5FLM G;  1XNQ Q;  2NVQ H;  1A63 A;  1X65 A;  1PA6 A;  5JEA J;  1O7I A;  4JCV E;  4BY7 G;  1RIP A;  3CC7 A;  4AYB G;  2CFM A;  5EAY A;  3U4V A;  3I4M G;  3MEF A;  4HJ5 A;  2GVB A;  5HY6 A;  4IOC A;  5JJK A;  5C4J H;  5C44 G;  1OXV A;  4J15 A;  4MZ9 A;  3EN2 A;  4JI8 Q;  4DKA C;  4RMF A;  4KLK A;  2F4V L;  3GTO H;  1SRO A;  1HNX Q;  4L5S A;  1CUK A;  2LSS A;  2UXC Q;  2VQE Q;  3HKZ G;  1KD1 C;  4R4O A;  2CQO A;  2FXQ A;  2R6G A;  1OTC A;  3G4S A;  1Q12 A;  5C3E H;  4KHP Q;  2BH2 A;  1E3P A;  2RHS B;  3I4N G;  4YCV A;  5IYD H;  1G6P A;  3FKI H;  2QEX A;  3CQZ H;  4R4I A;  1T9H A;  4JOI C;  4IFD I;  1GKH A;  1WOC A;  1YI2 A;  4DV1 Q;  3L0O A;  4HJ7 A;  1HH2 P;  2IT1 A;  1TWC H;  3UDX A;  1AE3 A;  4C3I H;  4R1J A;  3L7Z C;  4OWX B;  2NZO A;  1Q1E A;  4LF4 L;  2D0P A;  1N36 L;  1PH8 A;  3J81 j;  2VL6 A;  3KJO A;  4DV7 Q;  1YHQ A;  3W1G A;  2MQH A;  2L15 A;  4EX5 A;  4LFB L;  2WAQ G;  3S17 H;  1HNW L;  4A3G G;  4DV2 L;  4A4I A;  2C35 B;  1FJG Q;  4B3S L;  3RR5 A;  4JI2 L;  3S15 H;  4IFD J;  1IBL Q;  4K0K L;  1N34 L;  3BU2 A;  3PUY A;  4APV A;  4DPG A;  4BA1 I;  4DK6 C;  3OTO L;  4DV5 L;  3J80 i;  1UE6 A;  4DUZ L;  4JI6 L;  1HR0 Q;  4R4Q A;  1LUZ A;  1WCM G;  3GO5 A;  5H1S E;  1YIJ A;  4NPS A;  3I4O A;  5LMU Q;  4IPH A;  4DUY L;  1M90 C;  3NEN A;  1L2F A;  5M5X H;  3J80 c;  4JI4 Q;  1JMC A;  4A3J G;  4A3E H;  4PZ6 A;  3GTG H;  1FGU A;  3D31 A;  1N8R C;  4P75 A;  2ZM6 L;  4X65 Q;  4GS3 A;  1OXT A;  4YWM A;  3F2D A;  3S2D H;  1AH9 A;  1P8L A;  1XPU A;  2VS1 A;  4IPD A;  4JBJ A;  1YJN A;  4JYA Q;  1VQP A;  4LF5 Q;  2AWN A;  5IE8 A;  2OQ0 A;  1K83 H;  4YY3 L;  3J7Z C;  2VQF L;  3G6E A;  4HJ9 A;  1PVO A;  1IXR A;  2D62 A;  4GN5 A;  5M5Y H;  1EWI A;  4LF6 L;  2DUD A;  1SRU A;  2IHE A;  4DR1 Q;  5BR8 Q;  4LFA L;  2WB1 E;  4DAM A;  4DR7 Q;  3T1Y L;  2YTX A;  3E9I A;  3STB D;  2I5H A;  3FP9 A;  4DR5 L;  5JJI A;  4MTN A;  4A3M H;  3H3V I;  2UXD L;  4XIG S;  3M4O H;  5C0X G;  4ALP A;  2HHH L;  1YHA A;  4WJ4 A;  3TQY A;  4AH6 A;  1K0R A;  1A0I A;  3TS0 A;  3CP0 A;  3UE1 A;  4NXM L;  1XNR Q;  2N49 A;  4YHH Q;  1X3G A;  4JI7 L;  3AQQ A;  2R7Z H;  3HOY H;  3W1B A;  4GLV B;  3PIO A;  2JA9 A;  2PNH A;  1I94 L;  4JI5 Q;  3CW2 C;  1ASY A;  1EUJ A;  4A3L H;  2Q2U A;  4DR2 L;  3K7U C;  1AE2 A;  1X55 A;  3PUZ A;  4NB3 A;  4Y52 H;  1U5K A;  2RF4 A;  3TEH B;  4B3M Q;  2HT1 A;  2R93 G;  1BKB A;  4B3R L;  4QIW E;  3J81 i;  2B29 A;  2R92 G;  2K52 A;  3PSI A;  2PI2 A;  4DNI A;  5IYB G;  2K5N A;  1ASZ A;  4JI3 Q;  3JAM i;  4POF A;  1SFO H;  2JA6 G;  3ZJY C;  1OXS C;  1CSQ A;  1V1Q A;  1VQ9 A;  2IX1 A;  4AQY L;  1PV4 A;  4LF7 L;  1C0A A;  3EBE A;  4JC0 A;  3S2H H;  1VQ5 A;  4ME3 A;  3J81 c;  5IP7 G;  1VQ6 A;  3CPW A;  2VNU D;  2E2I H;  1PFS A;  5IWA L;  3IRB A;  3JAM c;  3PF4 A;  1YBY A;  3FHW A;  3HOU H;  4A3B H;  2Q2I A;  3ER0 A;  2JQO A;  5M3M G;  3RN5 A;  2KHJ A;  4L5Q A;  3GTQ H;  4A3K H;  1MKH A;  1VQG A;  1EQQ A;  1I6H H;  4OX9 L;  3AFQ A;  2ASB A;  2PI2 E;  2BA0 A;  5GAH C;  1Y14 B;  4JBK A;  2V1C C;  3KDF A;  3UDG A;  4A3F H;  1I50 H;  2PQA A;  4YWK A;  3RNU A;  2GVA A;  3S1M H;  2EXD A;  2D0O A;  3CCR A;  3CCV A;  2YYZ A;  4GKK L;  4DR6 L;  2N3S A;  4A3C H;  2MO0 A;  4C3H H;  1HNZ L;  2AHO B;  3PCO B;  4JI1 L;  4DAY B;  1K73 C;  3HOX G;  4HIM A;  1VQ8 A;  5M5W H;  2UUB L;  4LF8 L;  3RZO H;  1IYJ B;  4DV4 L;  3HKZ E;  3KDF B;  2I5M X;  2YTY A;  1GVP A;  1XNQ L;  2VUM H;  2PQA B;  4A3I H;  4DV0 L;  1PH5 A;  2UU9 Q;  1PH2 A;  3G48 A;  2K50 A;  3FKI G;  1WI5 A;  4HJ8 A;  4A93 H;  2JE6 I;  1TWA H;  1J5E L;  4BA2 I;  2E2J H;  2RCN A;  1C9O A;  4JI8 L;  1UE1 A;  1D8L A;  1V43 A;  1XMO Q;  1UWV A;  2KCM A;  3RN2 A;  3H3V H;  1KXL A;  4GNX C;  2VQE L;  1PH6 A;  2JA7 H;  1L1O C;  3KLW A;  1CKM A;  4HIK A;  4X62 Q;  2R7F A;  1VQB A;  1QVC A;  5IT9 c;  2B63 G;  3PF5 A;  2F4V Q;  3CPF A;  4R4C A;  3CCL A;  2R7D A;  4DV1 L;  4IOA A;  1HZA A;  3B6Y A;  1Q46 A;  3JC6 6;  4X66 Q;  1PH3 A;  5FLX c;  3RLF A;  3PUV A;  5AJ3 Q;  1XJV A;  4FDB A;  5IYC H;  4QQB X;  1EQR A;  5JEA G;  2UUA Q;  4YCU A;  4GOP C;  1WFQ A;  2N8N A;  2Z6K C;  1N9W A;  4DR3 Q;  3HOW G;  3STB C;  3M4P A;  4O2D A;  2XGT A;  2KEN A;  1V9P A;  3CAM A;  3CCU A;  3CCJ A;  2NN6 I;  3ERS X;  2NVY H;  4P73 A;  1KAW A;  1FJG L;  1Q8K A;  4A3E G;  2JA8 G;  1IBL L;  1N33 Q;  2UXB Q;  2OWO A;  4GKJ Q;  2AMC B;  3F1Z A;  4JI0 Q;  1SMX A;  5C0X I;  1XPR A;  1YIT A;  4LFC Q;  4JV5 Q;  1PYB A;  1NY4 A;  1X6O A;  1JJC B;  5JJL A;  5IP9 G;  1G29 1;  3U4Z A;  5LMU L;  1E1T A;  2YV5 A;  1IBK Q;  1Q82 C;  4LF9 Q;  3KF8 B;  2KBN A;  4X64 L;  4DUZ Q;  5ELN A;  1YNX A;  1Q7Y C;  1JJ2 A;  4BY1 H;  1OXU A;  3MXN B;  3KYH C;  5GQO A;  4X65 L;  3I55 A;  3PO3 H;  1B70 B;  4O0A A;  2CKZ B;  3CCE A;  1JT8 A;  2K14 A;  4LW1 A;  1U0L A;  4A3G H;  4A3M G;  1VCI A;  4WJ3 M;  4QJF A;  3F2C A;  4LF5 L;  4BBR H;  3E0E A;  1NMG A;  1HZB A;  1Q86 C;  4IJH A;  3ULP A;  4IFD G;  3VDY A;  2IX0 A;  1KQS A;  1XMQ Q;  2KCT A;  3J7A 5;  2BH8 A;  2ZJP A;  2R7Z G;  1WCM H;  2EQS A;  4DR1 L;  5BR8 L;  1S3O A;  3CME A;  3SGI A;  1VQK A;  1EIF A;  3Q8D A;  4DR7 L;  4DV6 Q;  3HOV H;  4X6A H;  4A76 A;  4Y7N H;  4TVA B;  1PH7 A;  4YY3 Q;  5LMN Q;  1QVG A;  4BBS G;  1GD7 A;  1VQJ A;  3CMA A;  1N32 L;  4GNX A;  3PO2 H;  4LF6 Q;  2GN5 A;  1UE7 A;  3H0G H;  4L5R C;  1SLJ A;  4XTC S;  2HIV A;  3ULL A;  4JOI A;  4QY7 A;  3CCS A;  3HOZ H;  4DR4 Q;  2YTV A;  1QZG A;  1XNR L;  2NZH A;  1Q1B A;  4YHH L;  2VZA A;  4DR5 Q;  1Z9F A;  1IZ6 A;  2VW9 A;  1E1O A;  4LUZ A;  3K81 C;  4A3D H;  1S40 A;  2OCE A;  4GNX B;  4B3T L;  3CF5 A;  3UE0 A;  2MFI A;  4DV3 Q;  4P74 A;  1W2B A;  4B3M L;  3A0J A;  3GDE A;  4A3B G;  1KIX A;  2LXK A;  1VQL A;  3D0F A;  1KHI A;  3F8T A;  4HJA A;  4A3K G;  1EIY B;  4JI3 L;  3BZC A;  4YWL A;  2HIX A;  2WB1 G;  4GOP A;  1Y1W H;  1IBM L;  3TRZ A;  4POG A;  1YHB A;  4A3F G;  1YVC A;  2Z6K A;  1RL2 A;  1SN8 A;  1QVF A;  4BXX H;  4PZ7 A;  2Q2T A;  2ES2 A;  5GAD C;  1BVS A;  1XPO A;  3GTJ H;  1WYD A;  4RG1 A;  2WFW A;  1B8A A;  1VQI A;  3K80 C;  4GOP B;  1E7Z A;  1IL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...