4YY3Q

30s ribosomal subunit- higb complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 21
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4yy3Q00
1X3FA 2C35B 3BZCA 3M85A 4IPGA 4KHZA 2MFIA 3UE0A 1CSQA 2E5LL 4DR6Q 1X6OA 4BY1G 4A3FG 2VS1A 3U50C 4YY3L 2HHHQ 2I5LX 3FP9A 1HNZL 1VQ7A 1BBWA 4BA2I 3PUXA 3H3VI 2GN5A 3KF8B 5IP9H 3F2CA 3OYYA 1V43A 2ZM6Q 3CMEA 5M3FG 1KHIA 2CQOA 2K5HA 3AFQA 4DV1L 5GAHC 4IOCA 4XTCS 2HQLA 5EAYA 4JI3Q 2Q2UA 1H95A 1TWGH 3W5OA 2PNHA 5IYBG 4DR7L 1E3PA 2RHSB 2WB1E 5C0XG 4GKKQ 4YWLA 5IE8A 4UPAA 3I56A 5M5WH 1NMFA 2GVBA 1BVSA 4GN4B 4JI2L 1VQ9A 2CWPA 1V9PA 2UUBL 4MNOA 5GADC 2AWNA 1WCMH 2YTXA 2HIXA 5J3BA 3OW2A 3RN2A 2B63G 3J81i 4K0KQ 1N8RC 1G6PA 4BY7H 2QGQA 1Y1WG 4OX9L 4OWXB 3BZKA 3K7UC 3ULPA 4A3EH 1HNWQ 1KIXA 4DV0Q 4A4IA 3RZOH 2RHQB 1Q1EA 4R4QA 3E9IA 5AJ3Q 2KCMA 4NB3A 5IP7H 2A1AA 1KQSA 1N34Q 1YHQA 4JI5L 1IBKQ 1LYLA 3CC7A 4X64Q 2NN6G 2HHHL 5FJ8G 3GTKH 1VQGA 2VZAA 1PHJA 1HR0Q 3G4SA 1VQEA 1OXSC 2K4KA 3PCOB 4P75A 3TS0A 4OWWB 2UU9Q 4NXNL 1XNRQ 3GTQH 4H02A 4J15A 4Y7NH 1K8GA 4KHPL 2JQOA 1N9WA 3HOZH 4MZ9A 3HOYH 4OONA 3A5UA 1YVCA 3M4OH 4LUZA 1FJGL 3CPFA 4YWMA 3HKZG 2JJQA 1HNXQ 2Z0SA 2XGTA 4LF7L 2EXDA 1Q8KA 2IT1A 1J5EL 2E5LQ 3KOJA 5FLMG 4GLXA 1HZAA 4A3GH 5IYCH 1YJWA 4A3MH 1I5FA 2PQAB 4YY3Q 1IL2A 2AMCB 1WI5A 1HNZQ 1SLJA 2F52A 2ZJRA 2LSSA 4L5SA 2NZHA 2WAQE 3HKSA 1R9TH 1AH9A 1Y1VG 3PUZA 4PZ6A 1CKNA 2HIVA 2JA7G 3F1ZA 4B3RL 2BH8A 4R4OA 1L2FA 2JA9A 1M90C 4B3TL 3KYHC 4LFCL 4IFDI 2I5HA 3Q8DA 4DV1Q 5GQOA 1EFWA 1VQDA 1VQ5A 4O2DA 1KD1C 1A0IA 4BBRG 1OXUA 3RZDH 2R93G 2ZTEA 1JB7A 4JI7L 5IWAL 3PV0A 4L5QA 4APVA 3I4MG 2IX0A 3FHWA 4DR4Q 3CF5A 3GDEA 4LFAL 3HOUG 3M9BA 3NBHB 4JI2Q 1Q86C 2OCEA 1PH8A 3PO3G 2UUBQ 2F3IA 1YBYA 3GD7A 1IZ6A 1IXRA 1EWIA 5IT9c 1KC8C 4DV2L 1TWAH 1EYGA 4LF6L 3PIOA 1V1QA 1YZ6A 3CP0A 1GM5A 3CCLA 1PYSB 5C44G 1AE3A 4GN5A 1GO3E 4DUYL 2VQEL 4DR3L 4LF5L 3FKIG 2ZJPA 3KDFB 2Q2IA 4YCWA 4HJ8A 3T1HL 1ASZA 2GVAA 4AQYL 2ES2A 1X65A 5IYDH 5C0XI 1K8AC 4DV3L 4JI5Q 2UXBL 5C4JH 4L5RC 4YCVA 4LUOA 3J81j 2LXJA 3UDXA 2IY5B 1CKNB 3CC2A 3J7A5 4NXNQ 1W2BA 3CQZH 2CKZB 1E22A 4LW1A 2LXKA 5E7NA 4P71A 3S1QH 2CFMA 4R4IA 4KHPQ 1KXLA 4YHHL 3JC66 4JCVE 3CC4A 2UUAL 3I4NH 4GN3B 1QUQA 5C3EG 1K73C 2NVYH 1P8LA 4IJHA 5BR8Q 3PO2G 3G71A 1FJGQ 1BBUA 4JI0Q 1LM0A 4RG1A 1VQ8A 1VQBA 4A3FH 1FVIA 4LF7Q 4PG3A 1J5EQ 2JA8G 1XNQL 3J80i 2R92G 2D62A 5M3MG 5JEAG 1VQMA 1N33L 1L1OA 3S2HH 4UY8C 3S1NH 2NN6I 1PV4A 4A3LH 4OO1I 4PZ7A 4MTNA 2VUMH 2JE6I 4LNQA 1PH1A 1E7ZA 4B3RQ 4IPCA 1PA6A 3S14H 3UE1A 3KF6B 4B3TQ 1W3SA 2WFWA 4AYBG 1NTGA 2AWOA 3HOXH 5GROA 4QIWE 5C4XH 1JMCA 1SFOH 4A3CH 1NY4A 4P72A 4A3IG 3H0GG 4GNXA 3SGIA 3PGZA 2AKWB 4B3ML 4JI7Q 5IWAQ 2KENA 1TXYA 1YITA 1Q82C 3HOVH 2KHIA 4PZ8A 2N3SA 4LFAQ 4A93H 2V1CC 3CW2C 1AE2A 4P73A 3GTMH 4HIKA 4QJFA 3PF5A 3KFUA 4C3IH 1XPUA 4UP7A 4GOPA 4DV2Q 4A3KG 5DLQE 4A75A 1NMGA 2H5XA 2CCZA 4LF6Q 4PMWA 1QUQB 3I7FA 3CCSA 1NE3A 4HIOA 3S2DH 2R7DA 1BKBA 3L7ZC 4C3JH 4YWKA 1CUKA 4DUYQ 2OQ0A 3RR5A 1CKOA 2VQEQ 4DR3Q 4LF5Q 2KBNA 2WB1G 3PUYA 1KRTA 3T1HQ 1Z9FA 1XMQL 4AQYQ 4NXMQ 4X65Q 4DV3Q 2UXBQ 2MO0A 5H1SE 4R4TA 5IP9G 3CXCA 4BBSH 4LFBL 2JA5H 4JBMA 3KJPA 3RLOA 4OXPA 2B3GA 5HGQA 1YJ9A 3H3VH 4POGA 4OO1G 1TWHH 3GO5A 1D7QA 3I55A 1XPOA 4DR5L 1EQQA 4A3JH 1Q81C 1YEZA 1G291 3A74A 2UUAQ 2JEAI 1OXVA 1C7YA 1KAWA 1X55A 4JI6L 3K8AA 4DR2L 4B3SQ 2N8NA 4IPHA 4DPGA 1E1OA 3E0EA 2E8GA 1WCMG 4GS3A 5LMNW 2EQSA 1L1OC 3J81c 3U4ZA 4GOPB 1X54A 1N33Q 4AIMA 2VQFL 3DM3A 2VNUD 4DV7L 4JC0A 4BY7G 4Y52H 3M3YH 4O0AA 1X3EA 1I3QH 2A19A 4A3EG 1EUJA 1YNXA 4DV6L 1B7YB 3T1YL 5IP7G 3GTLH 1FGUA 2K5NA 3STBC 3S1RH 3HOWH 4BA1I 2ZJQA 2Q2HA 3TS2A 4JOIA 2UXDL 2R93H 2XTIA 3F2DA 4TQUS 3CPWA 5FLXc 1Q46A 1PH4A 1PH9A 4HJ5A 3PUVA 3CCEA 4B3MQ 1J6QA 1SE8A 1A8VA 2VY3A 4ALPA 3ICEA 3TREA 2JA6H 2BA1A 3GTOH 4DR7Q 4R1JA 1HH2P 1JE5A 2Y0SE 3ERSX 4GOPC 5JJIA 1C9OA 3CD6A 5LMUL 1X9NA 2RF4A 2E2JH 3HOYG 1QVGA 2VW9A 5GAGC 2WAQG 3I2ZA 4JBWA 4A3BH 3K7AH 4DNIA 3PUWA 1UE6A 3MXNB 4LF4L 4BXXH 1SROA 1K3RA 3MEFA 1HZ9A 1XPRA 1GVPA 1LUZA 1JJ2A 1WJJA 2JK8A 4DUZL 2BA0A 4JYAL 4A3GG 5M5YH 2FXQA 2R7FA 5IYCG 1PH2A 2K75A 1JJGA 4OX9Q 1YI2A 4A3MG 4DR1L 4QGUA 1XMQQ 1QZGA 1EIYB 2F4VL 4QY7A 3CCMA 4DAMA 4JI1L 1HZBA 3G48A 1CSPA 1UE5A 4LFBQ 2D0OA 4A3DH 3L0OA 1VQPA 4OWTB 3ER0A 1TWCH 4GKJL 1PFSA 3M4QA 2YU9H 2HT1A 2IX1A 4HJ7A 2Z6KA 3TQYA 1PH5A 4DR5Q 2L15A 3K81C 3JAMi 1JJCB 1Z47A 1N36L 3AQQA 1QZHA 4JI6Q 4C2MH 3GTJH 3RNUA 5JJLA 3CMAA 3RN5A 2R92H 4IOAA 4XIGS 1UWVA 1VQAA 4DK6C 1LTLA 1VQNA 4LUVA 4BY1H 4LF9L 2VQFQ 1PH6A 1HNWL 4AH6A 1PH3A 3M7NA 4DV4L 2N49A 1S40A 3BU2A 4RMFA 3K80C 4LWCA 3CCQA 1I94L 1N32L 2KHJA 1VCIA 2RCNA 4DV6Q 3T1YQ 3CAMA 4X62L 4JOIC 1XJVA 1VQ4A 3NENA 1G51A 1VQCA 4R4CA 2E2HH 5IYDG 5M3FH 1VQOA 2UXDQ 2R7ZH 2IHFA 3S24A 3ZJYC 1E1TA 3W1BA 1DGSA 4LFCQ 1JT8A 2UUCL 1SR3A 5IYBH 2R6GA 4IFDJ 3H15A 5LMNL 1HZCA 1K9MC 2WP8J 4IPDA 4L5TA 1MIUA 2E2IH 3LGJA 1MJEA 3B6YA 5LMUQ 2Q2TA 3I4NG 1I6HH 4HJ9A 3EIVA 4KLKA 1L0WA 3K0XA 2B63H 4LF4Q 3BJUA 1TWFH 2AHOB 1YHBA 3KJOA 1MJCA 1Y14B 3EBEA 1O7IA 1XMOL 3J80c 4DUZQ 1Y1WH 4JYAQ 1GKHA 3AFPA 3PSIA 4IJLA 2ALYB 3U4VA 4DR1Q 2OTLA 4A3LG 2F4VQ 4IO9A 1CKMA 3NEMA 3CCRA 4X6AH 2VUMG 4LF8L 2YTVA 4JI1Q 1EQRA 1RL2A 3L2PA 4WJ3M 1L1OB 5FJ8H 1P16A 1K0RA 3HOXG 1SN8A 5C0XJ 2R7ZG 3AEVA 4A3CG 1YHAA 5C4XG 2VL6A 2Z6KC 4GKJQ 1VQFA 1KL9A 4DR4L 1NBWA 1K83H 1A63A 1N36Q 4JG2A 4P74A 3HOVG 2MNAA 4A93G 1VQHA 2K50A 4JI8L 3CCUA 3AYHB 5GAEC 4YHHQ 4HIMA 1YIJA 4DV5L 1NJIC 4GNXB 2D0PA 3EN2A 2NZOA 1VQ6A 1A62A 1HR0W 2PQAA 1VQKA 4JV5L 3OTOL 1YJNA 1WOCA 1U0LA 2YYZA 2ID0A 1UE7A 3ULJA 5FLMH 3U58A 4LF9Q 4POFA 1E24A 1B70B 4KI0A 5HY6A 3PIPA 3PF4A 4DV4Q 1XNQQ 2PI2E 3RLNA 2UXCL 4NPSA 3WWVA 2MQHA 1IYJB 3STBD 3KLWA 1I94Q 1N32Q 1WYDA 3RLFA 4UP8A 1Y1VH 4HIDA 3GTPH 4X62Q 3J7ZC 2CWAA 4TVAB 2JA7H 3HKZE 3DLLA 1HJPA 2I5MX 1IBLL 3IRBA 2K5VA 4BBRH 2UUCQ 4BBSG 4X66L 2JA5G 3UDFA 4GNXC 1PVOA 5LMNQ 2EIFA 4JI4L 1B8AA 3I4MH 3HOUH 1M1KC 4FDBA 1IBML 5JJKA 3PO3H 5BR8L 4A3JG 2DGYA 3F8TA 4QQBX 3E9HA 4A76A 3S1MH 4JI0L 2OTJA 2I0QA 2KCTA 1PYBA 1GD7A 3HOZG 1Q12A 3KDFA 1XMOQ 1VQLA 3S15H 3CCJA 1QVFA 5C44H 3G6EA 1OTCA 4DR6L 2YTYA 4GLAC 4EQ5A 3FKIH 1VQJA 2N78A 1VQIA 1VS0A 1X3GA 1FL0A 1S3OA 2B29A 2PI2A 1UE1A 3NELA 4GLVB 4EX5A 4LF8Q 2NVQH 3S17H 2Y0SG 1Q1BA 1WFQA 4HJAA 2ZM6L 4C3HH 3HOWG 3TRZA 4JI3L 5ELNA 3S16H 1PH7A 1C0AA 3A0JA 4GKKL 2JA6G 1OXXK 3D0FA 4JI8Q 5C3EH 3CCVA 3ULLA 3PO2H 3F2BA 4DV5Q 4DKAC 3UDGA 2ZTCA 2K52A 4JV5Q 1D8LA 3OTOQ 2OWOA 4DR2Q 4A3BG 4ME3A 3A5ZB 1ASYA 2JA8H 2DUDA 1SMXA 1T9HA 1OXTA 2IHEA 5M3MH 4BXXG 2MO1A 4UP9A 3GTGH 4K0KL 2QA4A 1X56A 1MKHA 3KF6A 2UXCQ 2BH2A 4JBJA 2PMZE 4DV7Q 4NXML 4X65L 4DV0L 3D31A 5AJ3L 2QEXA 2A8VA 2NVXH 1IBLQ 1N34L 4JBKA 2OQKA 3I4OA 3TEHB 3HFZB 1IBKL 4A3IH 1QVCA 4X64L 3H0GH 4X66Q 3W1GA 2ATWA 4YCUA 1HR0L 4A3DG 4WJ4A 3VDYA 4JI4Q 1EOVA 1I50H 1XNRL 2ZTDA 2UU9L 2JEBI 1IBMQ 4DAYB 1U5KA 3UDIA 1UEBA 1S72A 1Q7YC 3JAMc 1KRSA 1XTDA 2ASBA 4IFDG 5ELOA 4B3SL 4AYBE 3M4PA 4A3KH 1RIPA 2YV5A 2K14A 4DK3C 5IY0A 5K36G 1SRUA 2NVTH 1EIFA 5JEAJ 4QL5A 1HNXL 5M5XH
chains in the Genus database with same CATH superfamily
1K28A 4CKCA 1TKWB 4IPGA 4KHZA 2MFIA 2E5LL 4DR6Q 2I5LX 1PTOD 3KF8B 1DYQA 1V43A 2F0TA 3CMEA 4TRDA 1K8MA 4XTCS 5EAYA 4JI3Q 2Q2UA 2B2WC 5IYBG 4DR7L 4YWLA 5M5WH 3NWSA 1B4OA 2GVBA 4A3BB 1GUWA 1V9PA 3NE5B 4XQJA 2EY5A 1LT3D 1G91A 3NPPA 3RN2A 3FKIB 4L8JA 3K0YA 5IODA 2NUCA 3NTIA 1JWMD 4S3SA 5A2QL 2R3ZA 5M9OA 5IT9L 4DV0Q 2BCOA 3I8ZA 1QOHA 2BDOA 4JI5L 3CC7A 4X64Q 2B2TA 4HTHA 1HR0Q 1VQEA 1OXSC 2K4KA 4P75A 3WDNA 2DJGC 4NXNL 4H02A 3TN2A 2F0LA 1K8GA 4KHPL 1N9WA 2BE5C 3J81E 4LUZA 2L55A 1FJGL 3HKZG 1HNXQ 1H9RA 2XGTA 2F0DA 2EXDA 1EY9A 1Q8KA 2RDGA 1J5EL 2CVRA 2E5LQ 5FLMG 1KNAA 2QDLA 2AMCB 1WI5A 4QUCA 1SLJA 3SXHA 1U4MA 1TU2B 2FJ2A 3HKSA 3PUZA 1CKNA 5KRUA 2CW0D 1L2FA 2I5HA 3Q8DA 4ZRZA 3TMEA 1A0IA 1JOKA 4BBRG 1OXUA 2E2IB 4H0LC 3CRLC 3UI2A 1HFGA 3CU7A 4JI7L 4DR4Q 1I6HB 4GZYC 2OCEA 3PO3G 1EZ6A 3A8KE 3GD7A 3T51B 4MTKA 4DV2L 3L3OC 1STEA 1GM5A 1SXTA 1SBBB 1PYSB 5C5MA 4GN5A 4DR3L 2ZJPA 1B2TA 4HJ8A 3T1HL 2ES2A 3HS0C 5C0XI 4JI5Q 1TWGB 2Q8IB 4FNFA 1ZXTA 3UDXA 2IY5B 1CKNB 3J7A5 1EU4A 3S9WA 1K83B 5EPLA 1PFNA 4NXNQ 5E7NA 1LO5D 1EZ8A 4KHPQ 3I3CA 2Z4IA 2A74C 1MD2D 1HUMA 5C3EG 1K73C 2NVYH 1P8LA 4IJHA 1FJGQ 1MHWC 4U68A 4BY7B 1QILA 4JI0Q 1LM0A 1VQBA 4A3FH 1KDAA 1J5EQ 2A6EC 2QEJC 3J80i 1N33L 2VXWA 1L1OA 4DNTB 3GTPB 3SK4A 2J4XA 2JA7B 4MTNA 5I4DA 2EZVA 1CA5A 2VUMH 3GTKB 1TY0A 2SNMA 1F9RA 1WTXA 1PA6A 2FMMA 3UE1A 3KF6B 4CJ1B 2WFWA 5GROA 1JMCA 1SFOH 3HZXA 3R8BA 3H0GG 4GNXA 3HOYB 4JI7Q 1ZKOA 3DHQA 1TXYA 2C9OA 1YITA 2B2YC 3WOEA 4HIKA 3KFUA 4BS9A 4DV2Q 2EJMA 3ONAB 5I6WA 4A3KG 1NMGA 2CCZA 2B2UC 4PMWA 3CCSA 5IGEA 1NE3A 2R7DA 1BKBA 1CUKA 4DR3Q 2NVQB 3T1HQ 3M4YA 1C8CA 4NXMQ 5I9PA 5HGTA 3Q0AA 4KKUA 3RZDB 2KHSA 3QWNA 4YIJA 4BBSH 4LFBL 3MA2B 4NKLA 2B3GA 1TWHH 2SEBD 3GO5A 2RDHA 4DR5L 4A3JH 1YEZA 1OXVA 1KAWA 1GUOA 2J7ZA 2JA8B 4B3SQ 3E0EA 4GS3A 2E8GA 5FO7B 1ENFA 2EQSA 3J81c 4PQXA 2B8FA 1N33Q 2KUMA 3MEHA 4H7BA 3T13A 4O0AA 5KEEA 1STNA 1I3QH 1X3EA 1YNXA 4AYBB 2PPBC 1EEID 3AB9A 3T1YL 4IZ8A 5IP7G 4A3IB 1FGUA 2XTIA 3F2DA 1F9PA 1E2VA 4TQUS 2XRSD 1PH9A 3CCEA 1A8VA 1DOMA 4ALPA 1I4PA 2JA6H 5JJIA 4OIKA 2RF4A 3ERQA 5KIXA 1QVGA 2VW9A 3RD4A 2ZXOA 4JBWA 4A3BH 4KKTA 1UE6A 2BDNA 3MXNB 4BXXH 1SROA 1AW7A 1XPRA 3VR6A 2JK8A 3NSWA 3EJIA 1V1PB 2K75A 1JICA 4QGUA 5C4XB 3N6RA 4QY7A 1HZBA 4DAYA 1CSPA 4LFBQ 3CHBD 4NDXA 4JK1C 1VMPA 1VQPA 5C6AA 4OWTB 3ER0A 3GTMB 2HT1A 1EQVA 3ND9A 4DR5Q 1H9SA 3C2PA 3JAMi 4IFDH 1JJCB 2AQ1B 4BWGB 4MN3A 2A6ED 3RNUA 3RN5A 2RSOA 5DNFA 1UWVA 4CDFC 4EVOA 1O80A 4K5XA 4A3EB 4N9TA 1PH6A 1PH3A 2B8GA 3IKJA 4RMFA 3CCQA 4R8IA 1LTSD 2RCNA 3T1YQ 4N8FA 4X62L 3F2UA 1B1ZA 1EYAA 2IHFA 1DGSA 1STGA 5K5PA 4LFCQ 3GTQB 4RGNA 1EY5A 1LV9A 3QO2A 3HOZB 1K9MC 4IPDA 1HFNA 2E2IH 1A3UA 2WAQB 1PTOB 2I07B 3B6YA 1Q3LA 4NP5A 4QF4A 2SOBA 1I6HH 2Z9HA 5ELDA 3EIVA 4KLKA 4ZLTF 3BJUA 2ZT9C 2AHOB 1ENCA 3KJOA 4A3MB 3H3VC 4L63B 2PW7A 1R9TB 2ALYB 2OTLA 1ESRA 1ILPA 1ML0D 2Q8TA 4FO2A 4WJ3M 3GTOB 5C0XJ 2K5DA 1MI2A 1JQYD 2QILA 2VL6A 2Z6KC 1NBWA 1O7ZA 1K83H 3OSOA 4P74A 3HOVG 1STAA 2MNAA 2A5HA 2K50A 3CCUA 3AYHB 4YHHQ 1NJIC 3EN2A 2NZOA 3TZUA 3T53B 4JV5L 1LT4D 2YYZA 3QB3A 4NW2A 3EFXD 1Z7TA 1BCPD 1B70B 1ILQA 2MQHA 3KLWA 4KN7C 3RUZA 3GTPH 2RKSA 4X62Q 2JA7H 3HKZE 4B9XA 4IALA 2NTTA 3DLLA 1QB5D 1PLFA 3TP7A 1K3BC 2K5VA 3NBHA 2QDBA 3I4LA 4X66L 2JA5G 4GNXC 2HCCA 2XNAC 2QCPX 3HOUH 1IBML 4IUTA 3F8TA 3E9HA 4IUVA 4A76A 2OTJA 1FNWA 1BQQT 3DXJC 4K14A 1PYBA 1GD7A 4HMJA 3S2HB 1WTPA 1HA5A 4LK1C 3G6EA 1IKLA 4X3TA 1SNOA 3A7LA 1WVLA 2N78A 1VQIA 5C3WA 2HHHL 1S3OA 1SEBD 2NVQH 2WV6D 2Y0SG 1Q1BA 4RA8A 3TRZA 1A6XA 5A2QE 1BXTA 4ID6A 3SEBA 1PH7A 1C0AA 4GKKL 2B2WA 2MJ8A 1KLUD 3PO2H 3OW7A 5EBDA 3T4AC 5I2YA 4JV5Q 4HN7A 3MFGA 2G5DA 2JA8H 4UP9A 3ND8A 5IGBA 3TP5A 4DV7Q 2OT2A 4X65L 4M1UB 4UAIA 2OQKA 4A3IH 4F7XA 4X66Q 2ATWA 4YCUA 1EOVA 1XNRL 3FMCA 1IBMQ 5KGUA 5ELOA 3M4PA 5K36G 2YV5A 5IY0A 4X3UA 4JVZA 2NB0A 1X3FA 2C35B 1SYCA 1BR9A 4ZUIA 1CSQA 1BDOA 2HHHQ 3FP9A 5J22A 3HOWB 4BBRB 1BBWA 3PUXA 2GN5A 5IP9H 2C5CA 3C3LA 2F0HA 1VDZA 2K5HA 3AFQA 2R7ZG 3QOJA 3PO3B 2HDLA 3E0JA 1PMRA 4GKKQ 5IE8A 4UPAA 3MXUA 5IGGA 1WTVA 2UUBL 2CWPA 2AWNA 1WCMH 5J1ZA 3W2DA 5J3BA 2B63G 3J81i 5M5YB 1ET9A 1QG7A 2HCIA 2QGQA 1Y1WG 1F2MA 4OWXB 3ULPA 4A3EH 1BBXC 1HNWQ 3RZOH 2RHQB 1Q1EA 2IX3A 2KCMA 2MPMA 4NB3A 2L9HA 3S16B 3DEPA 3MZ5A 4HSPA 4J6HA 3BDCA 2NN6G 5T1GA 4DXFA 1VQGA 2VZAA 2YU9B 1K0SA 1YNJC 5C3EB 3G4SA 1NR4A 1XNRQ 3GTQH 1STYA 5FK9C 2D5DA 2JQOA 3HOZH 4MZ9A 1V1OA 4OONA 3BG3A 1A2TA 3A5UA 3SE0A 3VR4A 4YWMA 4LF7L 4RAUC 1RTOA 4GLXA 2EYFA 4A3GH 4FXKC 5IYCH 2NVXB 3RMHA 2L11A 1LTGD 2P5ZX 4K6DA 4A3MH 2PQAB 4HEDA 4KY5A 1SMYD 4L5SA 1R9TH 1Y1VG 4PZ6A 2HIVA 4B3RL 4R4OA 1XYIA 3C46A 3SDZA 3MC0B 1JB7A 4A3KB 5IWAL 3PV0A 1XWEA 4L5QA 3H09A 4APVA 2K32A 3NK9A 3I4MG 3NTHA 3M9BA 2KOLA 2B2YA 2UUBQ 1Y8OB 2WACA 1YBYA 1IZ6A 1EWIA 5IT9c 3A56A 4I65A 1TWAH 4ZK9B 5CBAE 3PIOA 1W6KA 3M7GA 1X3QA 5C44G 5EGTA 1EIGA 4KV6A 4LF5L 5CGKA 4YCWA 1ASZA 2KA7A 4AQYL 1X65A 2EPBA 4LJZC 4DV3L 4KTAA 5C4JH 4L5RC 4OHJA 2LXJA 4C3HG 4WRDA 3NQTA 3CC2A 5D3IB 5A35A 4LW1A 2LXKA 1I4XA 2CFMA 4R4IA 4IUUA 1QE6A 4ZUJA 3D8GA 3VYTA 1IW7D 3CC4A 3I4NH 2IL8A 4KMUC 5BR8Q 3G71A 4WFN3 1JR0D 1J9OA 1VQ8A 4LF7Q 4IUQA 3DMUA 1XNQL 2QF7A 2R92G 5JEAG 3S2HH 2L12A 4OL7A 4UY8C 3GV6A 1PV4A 4A3LH 5C3XA 3A7AB 2JE6I 5EPKA 4LNQA 1GUSA 4G7ZC 1E2ZA 2XVSA 4B3RQ 1H9MA 3QOLA 1LACA 3E5SA 3NTKA 1FNVA 1NY4A 5JOBA 3A55A 1G6ZA 1A3VA 2AKWB 5IWAQ 2XIWA 4H13C 1IL8A 2V1CC 3CW2C 1AE2A 1HHVA 3R3OA 3R2TA 3PF5A 2NWGA 4C3IH 5E3FA 5FLXL 1CZWA 3BDOA 1SJHD 5DLQE 1L0XB 3VR5A 4HIOA 3L7ZC 5FKAC 4I7ZC 1CKOA 4LF5Q 3S17B 2WB1G 3PUYA 1NR2A 4AQYQ 2QKIC 1YNJD 4DV3Q 4R4TA 1TS2A 4JBMA 1STHA 4K5VA 1SDFA 3I55A 1EQQA 3A74A 1EFID 4IUNA 1DOKA 2VB3X 2DN8A 3K8AA 3J7YW 3PQIA 3NHHA 4LAAA 5M3MB 4DPGA 1E1OA 4EQPA 2F0MA 5LMNW 4HR7B 1DXMA 1LT5D 2EY1A 1EY4A 1GHKA 3J7AV 1B3QA 4ZYSA 1EUJA 5CV5A 2EY6A 4DV6L 1B7YB 4NMZA 2F0JA 3S1RH 3HOWH 1BOSA 1W6JA 2ZXRA 3R93A 2ZJQA 2F0UA 2D9UA 4TKOB 4HJ5A 3MHBA 1J6QA 2VY3A 1T5EA 2BA1A 1JORA 2PW5A 4DR7Q 2EVBA 4ZQ3A 4R1JA 2Y0SE 4GOPC 1HXYD 4C56C 3CD6A 4N9PA 5LMUL 5M5XB 4KJNA 3S1NB 3JAML 1K3RA 3H6MA 4KY7A 1LUZA 1S5BD 2BA0A 2LS01 3NXWA 5M5YH 1JJGA 5CORA 3AU7A 1YI2A 4DR1L 1EIYB 1ONLA 5I6YA 3OMCA 4JI1L 1UE5A 2E74C 3Q22A 3L0OA 2CH4A 5D3DA 1PFSA 3M4QA 2YU9H 2Z6KA 1KAAA 2D2CC 5LL6S 3K81C 1UEAB 4OELB 1EQTA 4DA2A 4C1NI 3MTSA 2QW7A 3GTJH 3CMAA 4DFAA 4O1NA 4XIGS 1UUPA 5EKKA 1VQNA 4LUVA 4BY1H 5CV7A 4AH6A 2F0KA 4I7AA 4LWCA 1I94L 3QG1A 2KHJA 1VCIA 4DV6Q 4CGYB 1ENAA 2Z8LA 2IW3A 1XJVA 1O7LA 4R4CA 5M3FH 1H9KA 1Q90A 3W1BA 1JT8A 1WD1A 1PRTB 2IJ0A 3T56B 2O5IC 2R6GA 5C0XH 2V4DA 5LMNL 1JWUD 3M4OB 1AEXA 5LMUQ 2Q2TA 3KUPA 2B2VA 2RBMA 2KEDA 3K0XA 3MVVA 1L0WA 3KK7A 2O2LD 3M3YB 3A8IE 2TMPA 4K2KA 3EBEA 1B50A 1O7IA 1EWHA 2FINB 1YNNC 2Y0SB 2F0FA 3FDTA 2FFKB 1MSHA 1JE4A 4IJLA 3K59A 4J8QA 4DR1Q 4IO9A 1SSOA 2KCCA 3CCRA 4X6AH 2VUMG 3FEWX 4JI1Q 2DY8A 1RL2A 1I4QA 1L1OB 5FJ8H 2KCNA 3X3MA 1VQFA 2E2JB 1KL9A 2NBFA 2DY7A 2PZTA 2K05A 4JG2A 4JI8L 4HIMA 3K5LA 1YIJA 4GNXB 1M4VA 1VQKA 1SYFA 1YJNA 1EOTA 1UE7A 4POFA 1E24A 1GUGA 4K6LA 5HY6A 2DNCA 3PF4A 1D1KA 4HCSA 3RLNA 4NPSA 1I94Q 1WYDA 4ZKCB 3RLFA 1H9JA 4FF1A 3J7ZC 3FVQA 1BCPC 5LHY1 1HJPA 2I5MX 1SNDA 3IRBA 2CH4W 4DK0A 4BBSG 1PVOA 1GJXA 5LMNQ 1PXUA 4A3JG 2DGYA 2FHTA 1I4GA 1JC7A 1D5MC 1JCKB 1OO9B 2KCTA 1DCZA 3P7JA 3KDFA 1SAPA 4RGMA 2YTYA 2KEEA 2E2HB 4GLAC 3URYA 3FKIH 2B29A 1FL0A 3HOXB 3S17H 2XRQD 2ICIA 4HJAA 2ZM6L 4CBVA 1I6VC 5ELNA 4A93B 3DUZA 3A0JA 2JA6G 4JI8Q 4KD3A 1QCBD 3CCVA 1WTOA 2ZTCA 4QB4A 1SJED 3IFTA 1Y1WB 1SNPA 4A3BG 4ME3A 1ASYA 2KECA 4C3JB 1BNZA 1T9HA 1OXTA 2IHEA 5M3MH 4BXXG 5C5LA 4K0KL 1X56A 1MKHA 2PMZE 3I91A 4K5WA 1QWYA 2VB2X 5KNDA 2LKVA 3D31A 4DN4M 2QEXA 2A8VA 1D2BA 3E3XA 5BN3A 1FGBD 4EGVA 1N34L 3TEHB 2EY2A 1QVCA 1PZJD 5EKLA 3PIO3 3VA5A 5JAVA 3VDYA 1QNKA 2JEBI 4DAYB 1U5KA 3UDIA 5ISRA 4MIUA 1HUNA 1KRSA 4IFDG 3FPPA 4HMIA 1YNND 1EIFA 2FMCA 5JVH3 5TSSA 1H9SB 5M5XH 3I56A 3M85A 2XN9C 3UE0A 4ME5A 1X6OA 2Z6BA 2RQXA 1BCPF 2LFNA 2VS1A 3U50C 4YY3L 1HNZL 2JN4A 1VQ7A 4CDDC 3H3VI 3F2CA 3SR1A 4FYDA 2ZM6Q 1B53A 1UNSA 3HG9A 1KDCA 3IFDA 1KHIA 2CQOA 4XT3B 5CMDA 2HQLA 2AQ3B 1TWGH 3W5OA 1RF2D 1E3PA 2WB1E 3J80E 1NMFA 2EYLA 3S15B 4GN4B 1JWSD 3K7AB 5DM73 4JI2L 4EQNA 3H91A 4MNOA 3W3AA 2YTXA 2HDMA 3I72A 4K0KQ 1G6PA 4BY7H 2M9VA 4OX9L 2OF1A 3BZKA 3BZDB 2A73B 4C3HB 4ZKBB 4PV1C 4R4QA 1KQSA 1N34Q 4A3DB 1LYLA 3GTKH 3R2IA 1PHJA 5FO8B 3KBGA 5D14A 3TS0A 1DJRD 1MSGA 4C2MB 1U9RA 3HOYH 2R92B 1YVCA 2K1BA 3M4OH 2B2VC 4TSSA 5F2DA 2IT1A 3KOJA 2A69D 2HQEA 1KLGD 1SE2A 5KNBA 1S4ZA 1YJWA 1I5FA 4YY3Q 5FLXE 1HNZQ 5CV6A 5CV9A 2F52A 2ZJRA 1J8IA 4K8IA 2JA7G 2K6AA 1PZKD 5FOBB 2JA9A 4B3TL 5GQOA 3PIP3 1M8AA 1VQDA 1SMYC 1PFMA 1KD1C 1TT2A 3MWYW 2R93G 3RZDH 3BDLA 4JPBW 5C4ZA 2MHVA 3CF5A 3GDEA 3HOUG 3GTLB 3NBHB 4JI2Q 1Q8IA 1PH8A 1GHJA 2RSNA 2F0IA 3GP7A 1DONA 1D6EC 3DWPA 3NP8A 4RWSC 1YZ6A 3CP0A 1U4RA 1CI3M 3CCLA 2K33A 5EPJA 1ET6A 2F0NA 1Y8PB 5IYDH 1K8AC 2UXBL 4LUOA 3TP8A 3DM1A 1HCZA 2Z4HA 1R4PB 2F0GA 2CKZB 3Q24A 4P71A 4JCVE 3HKZB 4L6TB 1S5CD 1RDPD 1S5FD 3PO2G 2WKDA 4M8AA 4PG3A 2F3VA 2JA8G 2EDGA 1IW7C 1CFMA 3D6CA 2D62A 1S5DD 1VQMA 1RTNA 5I9OA 2NN6I 4OO1I 4RCNA 1R4QB 4OGQC 1RJTA 3P75A 3JAME 1MBYA 4B3TQ 4ULLA 4AYBG 3HOXH 1KDBA 4QIWE 5G3LF 5C4XH 4A3CH 4A3IG 2JP1A 3T16A 4DNRB 3SGIA 3PGZA 4FF3A 3EROA 1S5ED 4RKBA 1Q82C 1EIHA 4A93H 4PZ8A 2N3SA 2E75C 5CV8A 3GTMH 1HTLD 2PQEA 4UP7A 4GOPA 3OWFA 2EJGC 3SHLA 3KBXA 4PMBA 2L0CA 3NBIA 4C3JH 2PNRC 3RR5A 4HCEA 4J1MA 1XX8A 2KBNA 1KRTA 1Z9FA 1XMQL 4X65Q 2UXBQ 4IN3A 3BVMA 4MHEA 2F0QA 4DU9A 1EWCA 5IP9G 5G3LD 4O42A 1YJ9A 2B39A 4OO1G 4POGA 3OIPA 3VYUA 2JEAI 1C7YA 4JI6L 1EYDA 3P1HA 4DR2L 1FR3A 1SYBA 4UDUC 4IPHA 1AZPA 1O78A 1PTOH 3GTGB 1WCMG 4IQZA 3U4ZA 4GOPB 2KVMA 4AIMA 2VNUD 4Y52H 2WIIB 2A19A 1RODA 3EA6A 4A3EG 1BF4A 4Q0FA 1ICFB 3GTLH 3LWEA 3H0GB 3TS2A 2Q2HA 2L4NA 1SE3A 3D4DA 1I4HA 2OEOA 5FLXc 1I50B 3CPWA 4V190 3PUVA 1SE8A 2NVYB 2A68C 4CHTB 3TREA 1D1IA 1ICWA 3GTOH 1NCVA 1HH2P 3ERSX 4QIWB 2NVTB 3S1MB 2WAQG 1EY6A 3I2ZA 3K7AH 1HQRD 1RD9D 4DNIA 4DXGA 3PUWA 4LF4L 3MEFA 1HZ9A 5L37A 2Z1CA 2VUMB 1GVPA 1WJJA 4A3GG 1A3TA 2FXQA 5IYCG 1PH2A 4A3MG 1XMQQ 1SYDA 2MGSA 2F4VL 4ZCKA 3CCMA 1STBA 3J80L 3K5NA 1TR5A 1QNUA 2D0OA 4A3DH 4GKJL 2IX1A 4HJ7A 3D4WA 3TQYA 1PH5A 3X3NA 1N36L 1Z47A 3CKIB 4HAEA 1QZHA 4JI6Q 4C2MH 4H44C 3ZYYX 4LMQD 2AUJD 2R92H 3TSSA 4IOAA 5ELCA 1HQMC 3KLSA 1LTLA 4DK6C 2PZUA 4LF9L 3OHXC 1CQVA 3M7NA 1DZ1A 4DV4L 2N49A 3BU2A 2JYOA 3K80C 4BBSB 4JOIC 1VQ4A 1G51A 1TWHB 1BO0A 3ZJYC 1RCVD 1E1TA 3K58A 4A3JB 4Y7NB 2KQ3A 5IYBH 3U9OA 3QR8A 3H15A 2SNSA 1HZCA 2G9DA 2WP8J 3LGJA 1CQFA 3D4RA 1MJEA 2X69A 2F0WA 3I4NG 2RVLA 3KLRA 4LF4Q 1I3QB 1MJCA 1B9MA 4FXGC 4A3LG 1ESFA 2F4VQ 3FPUB 1AP0A 1CKMA 4G7OC 1IHZA 4LF8L 1CHQD 5EKIA 3L2PA 5JPNC 1F2YA 2JA6B 2F0SA 1SN8A 1EYCA 1VMCA 3AEVA 4GKJQ 1GUTA 1BCPB 3TDQA 4DR4L 4EQOA 1A63A 1N36Q 1DOLA 2ICEC 2BOSA 2NTSA 5KYIA 5GAEC 4DV5L 4C3IG 4XYOA 5AFWA 1PYWD 2ID0A 3ULJA 2JSOA 5FLMH 3U58A 4LF9Q 3C1EA 3PIPA 4DV4Q 2AUKA 2PI2E 1XNQQ 3KLSX 4KKSA 4HIDA 5JVG3 2EYJA 2CWAA 4TVAB 4RKLA 2A68D 1WTWA 3CQZB 4BBRH 4QUFA 3S1QB 1SE4A 3K5OA 4JI4L 1B8AA 5JJKA 3PO3H 2J0TD 1F9QA 4WJWA 4QQBX 4JI0L 2K28A 1D5XC 1QJOA 4HSVA 3CRKC 4RGTA 2K01A 1Q12A 5IGCA 1HA6A 5BN4A 1QVFA 4KJOA 5IOCA 3K5MA 4EQ5A 1VQJA 3NELA 1X3GA 2PI2A 3U9SA 4GLVB 4XQNA 4LF8Q 1PDQA 4EX5A 3S14B 4N8X1 3HOWG 4XDXA 1CA6A 3HOVB 3S16H 1IYVA 3D3RA 4U673 1OXXK 3SK5A 5C3EH 4KD4A 3ULLA 1HTPA 4DV5Q 3BVGA 4DKAC 3UDGA 4RHSA 3I90A 2OWOA 3A5ZB 3S2DB 5EJWA 4F8MA 3QIAA 2PYKA 1CZGA 2MO1A 3GTGH 3SK8A 3KF6A 4DGZA 4JBJA 4NXML 3BYTB 3H94A 4FXDA 3VYRA 5AJ3L 3MAQA 1C4QA 3NUCA 2NVXH 3OPOA 1CTMA 4JBKA 2EYOA 2JA5B 1IBKL 2CQAA 2F3WA 4IUPA 1EY0A 3H0GH 4JI4Q 1I50H 2NYZD 2ZTDA 2UU9L 1S72A 2OXPA 2EYHA 3O13A 2ASBA 4V0BA 4B3SL 4AYBE 4A3KH 1RIPA 5DEHA 3NQIA 1SRUA 2NVTH 5JEAJ 4XXEA 3WOFA 4CDCC 3S1MH 3BZCA 2MUYA 5CBEE 4FVMA 4BY1G 4A3FG 1B44D 2K7VA 1HRJA 5EBCA 3K57A 2R93B 4BA2I 3OYYA 3TZDA 5CV4A 1NSNS 5M3FG 5D65A 3HOUB 4IOCA 1H95A 1I4RA 4DV1L 5GAHC 4DAVA 2Q8RE 2PNHA 2RHSB 5C0XG 2X6LA 3MFYA 1AN8A 2X6GA 3OIQA 3HP3A 1BVSA 1LTTD 3BYYB 1VQ9A 5GADC 2GA4B 4KHVA 2HIXA 3OW2A 1N8RC 4X3KA 1RHPA 3K7UC 2E2DC 1KIXA 4A4IA 3I73A 5AJ3Q 3E9IA 5IP7H 2A1AA 1VF5C 4Q5VA 1YHQA 1IBKQ 2BE5D 5FJ8G 1TWCB 2L5TA 1KABA 3FRPB 3PCOB 3V2TA 4OWWB 3PO2B 2UU9Q 4KK7A 4RHRA 1GXDC 3MXNA 4J15A 4Y7NH 2HD3A 2PCFB 4DK1A 4B08A 2EYMA 1V1PA 5DAUA 3I70A 2ENBA 5ELBA 1X3PA 3CPFA 2JJQA 5E1FA 3G6JB 3VR2A 2Z0SA 2H4OA 1E2WA 1HZAA 2XWBB 3ITPA 1F77A 2H1EA 3V96A 2AQ2B 1IL2A 1AH9A 2LSSA 2NZHA 2WAQE 5FO9B 2R7ZB 5CC4A 5CR3A 5HURA 3F1ZA 1ZYRC 3MXGA 3HEJA 2A69C 2BH8A 1M90C 4PNYA 3KYHC 4LFCL 1KNEA 4IFDI 4DV1Q 1EFWA 1VQ5A 4O2DA 1WTHA 2ZTEA 1FD7D 1SNQA 2F4IA 3HRZC 3E6ZX 2IX0A 3FHWA 1GOZA 4LFAL 5E4WC 1Q86C 4F88A 2LY7A 1F2ZA 2B63B 4KY6A 2F3IA 1TWFB 2F03A 1PFBA 1KC8C 1IXRA 1TVXA 1EYGA 4LF6L 2K5QA 1V1QA 3OWEB 3HGBA 1SYGA 1T5XD 1AE3A 3LX0A 1GO3E 4DUYL 2IWHA 2VQEL 2IPKD 4UHVA 1WTQA 3FKIG 3KDFB 2Q2IA 2PZWA 4RCOA 2GVAA 1TS4A 2B2TC 4YCVA 4R9WA 3J81j 1EEFD 5CYUA 1TQOA 1KTKA 2N55A 3EVQA 1B9NA 5COYA 2TSSA 1W2BA 3CQZH 1U4PA 1E22A 1G2TA 2EJFC 3S1QH 1KXLA 1WCMB 2F1MA 3IL8A 4YHHL 3JC66 2UUAL 1O7YA 4GN3B 1QUQA 1K8OA 2K04A 1BBUA 3V05A 1WD0A 3DEOA 4RG1A 2ZXPA 3TBIB 1FVIA 1II3A 3RZOB 2RCFA 4WORA 5M3MG 1JOOA 5BN5A 1PZID 3S1NH 1Y1VB 1EY8A 4PZ7A 1G2SA 1TS5A 2XSCA 1PH1A 1E7ZA 2M2LA 5ELFA 3J81L 4IPCA 3S14H 1W3SA 1WTRA 1NTGA 2AWOA 1CM9A 1IKMA 4P72A 3SVMA 3I4MB 1A15A 5LL6X 4B3ML 4QCLA 2KENA 3HOVH 1RKNA 2KHIA 2WKCA 4LFAQ 4P73A 4QJFA 2RA4A 1XPUA 4A3GB 4Z9CB 4LF6Q 4A75A 2H5XA 1MGSA 5C44B 1QUQB 3I7FA 4KN4C 3S2DH 4YWKA 4CKBA 4DUYQ 1PRTC 2OQ0A 2JXMB 2VQEQ 2CHBD 2MO0A 4FF4A 2RDFA 5H1SE 3CXCA 1EY7A 3NWTA 2JA5H 3KJPA 3RLOA 4OXPA 5HGQA 3H3VH 2NZ1D 2PMZB 1DM0B 1D7QA 3SK6A 1C48A 3N52A 1XPOA 1Q81C 1TWAB 1G291 2UUAQ 5E4XA 1X55A 1JOQA 4JW0A 2N8NA 4RGOS 3P20A 1TY2A 1GUNA 4ZAIA 1L1OC 1NNXA 1X54A 2MP1A 5JJZA 2VQFL 3DM3A 1TS3A 4DV7L 4JC0A 4BY7G 3M3YH 5C4JB 1ZYRD 1SYEA 4XQQA 1G8ZD 3VR3A 2EOTA 2K5NA 3STBC 4B9WA 4C1NK 4BA1I 2UXDL 2R93H 4JOIA 3A54A 4CKEA 1Q46A 1PH4A 3I4NB 4B3MQ 3ICEA 3DWAA 1JE5A 4QMGA 5I2XA 1C9OA 2O5JC 4ODGA 1X9NA 2E2JH 3HOYG 1AZQA 1L0YB 5GAGC 2SDFA 5DM63 2HUGA 2DNEA 2A6HC 1JJ2A 2WB1B 4DUZL 2F0EA 4JYAL 1XTCD 1A2UA 2R7FA 1NUCA 4OX9Q 1QZGA 4DAMA 4ABNA 4ILWA 3G48A 5IT9E 4G7HC 1TWCH 4C3IB 5IGFA 5M5WB 5JPMC 3PMFA 2L15A 4FF2A 1Z6HA 3AQQA 2KJXA 3BS1A 5K36H 1FYCA 4DAPA 2EXZA 5JJLA 2R61A 1VQAA 1JB3A 1PRTF 2F0PA 2VQFQ 1HNWL 1VF7A 3IAYA 1S40A 1N32L 3CAMA 3Q6SA 3NENA 1VQCA 2E76C 2E2HH 2UXDQ 5IYDG 4X3SA 1VQOA 2R7ZH 3S24A 5EQ0A 2DJFC 1LTBD 2UUCL 1EL0A 1SR3A 3VYSA 4IFDJ 4L5TA 1MIUA 1AFPA 4HJ9A 5J39A 2B63H 1SNMA 1TWFH 1YHBA 1PRTD 1Y14B 1XMOL 1BUVT 3J80c 4DUZQ 1Y1WH 3DWQA 1GKHA 4JYAQ 3AFPA 3S1RB 3PSIA 3U4VA 2I46A 4CJ2C 2M00A 3NEMA 2YTVA 1EQRA 1CK1A 2NN6H 1P16A 4OO1H 1PTOC 1K0RA 3HOXG 4A3CG 1YHAA 5C4XG 1EU3A 2K03A 1LTID 2K5WA 2O4XA 3VA7A 3A8JE 3L9AX 4A93G 1VQHA 5ELEA 4K8JA 2D0PA 1VQ6A 1A62A 1HR0W 2PQAA 3OTOL 4OEMB 1WOCA 1U0LA 1LLRD 4G4KA 3LNNA 1DD2A 4KI0A 4PMCA 2L1BA 2UXCL 3WWVA 4C3JG 1IYJB 3STBD 2WINB 1N32Q 4UP8A 1Y1VH 1B3AA 1Y8NB 1TIID 1IBLL 1CHPD 3C1FA 2UUCQ 3UDFA 4CDEC 5IGDA 2EIFA 4P2CB 3GTJB 4XYQA 3I4MH 3GV3A 1M1KC 1HPCA 4FDBA 3QJYA 5BR8L 3BVZA 4F87A 3J7AF 3K6OA 1E0BA 2A6HD 4BY1B 4A3FB 5KYLA 2I0QA 5IIFA 3HOZG 2F0VA 3LWUA 1XMOQ 1VQLA 3S15H 3CCJA 5C44H 1OTCA 4DR6L 4E6IA 5M3FB 1LT6D 2F0OA 1VS0A 3GQBA 1UE1A 2XWJB 4RFBA 2G9HD 1NAPA 1SFOB 1WFQA 1F2LA 4C3HH 1LTRD 1D5ZC 5C4HA 1CT1D 1LTAD 2CW0C 4CJ0B 4JI3L 1V8QA 1SNCA 3D0FA 3OMGA 1ZEQX 3F2BA 2K52A 3D6WA 1D8LA 5T1IA 3OTOQ 4DR2Q 2B2UA 2LMCB 2DUDA 1SMXA 5JEAH 2EYPA 2UXCQ 2QA4A 2BH2A 3KF8A 4IURA 1UAPA 4DV0L 1PTOF 2N88A 5KNCA 2PO4A 4FP5D 1IBLQ 1Y69U 3I4OA 1U4LA 1XXGA 3G7LA 3HFZB 4X64L 3MXPA 1X32A 2EE1A 4OIJA 3W1GA 1HR0L 4A3DG 4WJ4A 3AMUA 4G57A 4RH6A 1Q7YC 1UEBA 3Q23A 4DF7A 3JAMc 1FNUA 1LABA 1XTDA 1IYUA 3OOCA 4XT1B 4R8NA 2K14A 4K2LA 1F9SA 4DK3C 5NUCA 3TP6A 3EQLC 4QL5A 1HNXL
chains in the Genus database with same CATH topology
1X3FA 2C35B 3BZCA 3M85A 4IPGA 4KHZA 2MFIA 3UE0A 1CSQA 2E5LL 4DR6Q 1X6OA 4BY1G 4A3FG 2VS1A 3U50C 4YY3L 2HHHQ 2I5LX 3FP9A 1HNZL 1VQ7A 1BBWA 4BA2I 3PUXA 3H3VI 2GN5A 3KF8B 5IP9H 3F2CA 3OYYA 1V43A 2ZM6Q 3CMEA 5M3FG 1KHIA 2CQOA 2K5HA 3AFQA 4DV1L 5GAHC 4IOCA 4XTCS 2HQLA 5EAYA 4JI3Q 2Q2UA 1H95A 1TWGH 3W5OA 2PNHA 5IYBG 4DR7L 1E3PA 2RHSB 2WB1E 5C0XG 4GKKQ 4YWLA 5IE8A 4UPAA 3I56A 5M5WH 1NMFA 2GVBA 1BVSA 4GN4B 4JI2L 1VQ9A 2CWPA 1V9PA 2UUBL 4MNOA 5GADC 2AWNA 1WCMH 2YTXA 2HIXA 5J3BA 3OW2A 3RN2A 2B63G 3J81i 4K0KQ 1N8RC 1G6PA 4BY7H 2QGQA 1Y1WG 4OX9L 4OWXB 3BZKA 3K7UC 3ULPA 4A3EH 1HNWQ 1KIXA 4DV0Q 4A4IA 3RZOH 2RHQB 1Q1EA 4R4QA 3E9IA 5AJ3Q 2KCMA 4NB3A 5IP7H 2A1AA 1KQSA 1N34Q 1YHQA 4JI5L 1IBKQ 1LYLA 3CC7A 4X64Q 2NN6G 2HHHL 5FJ8G 3GTKH 1VQGA 2VZAA 1PHJA 1HR0Q 3G4SA 1VQEA 1OXSC 2K4KA 3PCOB 4P75A 3TS0A 4OWWB 2UU9Q 4NXNL 1XNRQ 3GTQH 4H02A 4J15A 4Y7NH 1K8GA 4KHPL 2JQOA 1N9WA 3HOZH 4MZ9A 3HOYH 4OONA 3A5UA 1YVCA 3M4OH 4LUZA 1FJGL 3CPFA 4YWMA 3HKZG 2JJQA 1HNXQ 2Z0SA 2XGTA 4LF7L 2EXDA 1Q8KA 2IT1A 1J5EL 2E5LQ 3KOJA 5FLMG 4GLXA 1HZAA 4A3GH 5IYCH 1YJWA 4A3MH 1I5FA 2PQAB 4YY3Q 1IL2A 2AMCB 1WI5A 1HNZQ 1SLJA 2F52A 2ZJRA 2LSSA 4L5SA 2NZHA 2WAQE 3HKSA 1R9TH 1AH9A 1Y1VG 3PUZA 4PZ6A 1CKNA 2HIVA 2JA7G 3F1ZA 4B3RL 2BH8A 4R4OA 1L2FA 2JA9A 1M90C 4B3TL 3KYHC 4LFCL 4IFDI 2I5HA 3Q8DA 4DV1Q 5GQOA 1EFWA 1VQDA 1VQ5A 4O2DA 1KD1C 1A0IA 4BBRG 1OXUA 3RZDH 2R93G 2ZTEA 1JB7A 4JI7L 5IWAL 3PV0A 4L5QA 4APVA 3I4MG 2IX0A 3FHWA 4DR4Q 3CF5A 3GDEA 4LFAL 3HOUG 3M9BA 3NBHB 4JI2Q 1Q86C 2OCEA 1PH8A 3PO3G 2UUBQ 2F3IA 1YBYA 3GD7A 1IZ6A 1IXRA 1EWIA 5IT9c 1KC8C 4DV2L 1TWAH 1EYGA 4LF6L 3PIOA 1V1QA 1YZ6A 3CP0A 1GM5A 3CCLA 1PYSB 5C44G 1AE3A 4GN5A 1GO3E 4DUYL 2VQEL 4DR3L 4LF5L 3FKIG 2ZJPA 3KDFB 2Q2IA 4YCWA 4HJ8A 3T1HL 1ASZA 2GVAA 4AQYL 2ES2A 1X65A 5IYDH 5C0XI 1K8AC 4DV3L 4JI5Q 2UXBL 5C4JH 4L5RC 4YCVA 4LUOA 3J81j 2LXJA 3UDXA 2IY5B 1CKNB 3CC2A 3J7A5 4NXNQ 1W2BA 3CQZH 2CKZB 1E22A 4LW1A 2LXKA 5E7NA 4P71A 3S1QH 2CFMA 4R4IA 4KHPQ 1KXLA 4YHHL 3JC66 4JCVE 3CC4A 2UUAL 3I4NH 4GN3B 1QUQA 5C3EG 1K73C 2NVYH 1P8LA 4IJHA 5BR8Q 3PO2G 3G71A 1FJGQ 1BBUA 4JI0Q 1LM0A 4RG1A 1VQ8A 1VQBA 4A3FH 1FVIA 4LF7Q 4PG3A 1J5EQ 2JA8G 1XNQL 3J80i 2R92G 2D62A 5M3MG 5JEAG 1VQMA 1N33L 1L1OA 3S2HH 4UY8C 3S1NH 2NN6I 1PV4A 4A3LH 4OO1I 4PZ7A 4MTNA 2VUMH 2JE6I 4LNQA 1PH1A 1E7ZA 4B3RQ 4IPCA 1PA6A 3S14H 3UE1A 3KF6B 4B3TQ 1W3SA 2WFWA 4AYBG 1NTGA 2AWOA 3HOXH 5GROA 4QIWE 5C4XH 1JMCA 1SFOH 4A3CH 1NY4A 4P72A 4A3IG 3H0GG 4GNXA 3SGIA 3PGZA 2AKWB 4B3ML 4JI7Q 5IWAQ 2KENA 1TXYA 1YITA 1Q82C 3HOVH 2KHIA 4PZ8A 2N3SA 4LFAQ 4A93H 2V1CC 3CW2C 1AE2A 4P73A 3GTMH 4HIKA 4QJFA 3PF5A 3KFUA 4C3IH 1XPUA 4UP7A 4GOPA 4DV2Q 4A3KG 5DLQE 4A75A 1NMGA 2H5XA 2CCZA 4LF6Q 4PMWA 1QUQB 3I7FA 3CCSA 1NE3A 4HIOA 3S2DH 2R7DA 1BKBA 3L7ZC 4C3JH 4YWKA 1CUKA 4DUYQ 2OQ0A 3RR5A 1CKOA 2VQEQ 4DR3Q 4LF5Q 2KBNA 2WB1G 3PUYA 1KRTA 3T1HQ 1Z9FA 1XMQL 4AQYQ 4NXMQ 4X65Q 4DV3Q 2UXBQ 2MO0A 5H1SE 4R4TA 5IP9G 3CXCA 4BBSH 4LFBL 2JA5H 4JBMA 3KJPA 3RLOA 4OXPA 2B3GA 5HGQA 1YJ9A 3H3VH 4POGA 4OO1G 1TWHH 3GO5A 1D7QA 3I55A 1XPOA 4DR5L 1EQQA 4A3JH 1Q81C 1YEZA 1G291 3A74A 2UUAQ 2JEAI 1OXVA 1C7YA 1KAWA 1X55A 4JI6L 3K8AA 4DR2L 4B3SQ 2N8NA 4IPHA 4DPGA 1E1OA 3E0EA 2E8GA 1WCMG 4GS3A 5LMNW 2EQSA 1L1OC 3J81c 3U4ZA 4GOPB 1X54A 1N33Q 4AIMA 2VQFL 3DM3A 2VNUD 4DV7L 4JC0A 4BY7G 4Y52H 3M3YH 4O0AA 1X3EA 1I3QH 2A19A 4A3EG 1EUJA 1YNXA 4DV6L 1B7YB 3T1YL 5IP7G 3GTLH 1FGUA 2K5NA 3STBC 3S1RH 3HOWH 4BA1I 2ZJQA 2Q2HA 3TS2A 4JOIA 2UXDL 2R93H 2XTIA 3F2DA 4TQUS 3CPWA 5FLXc 1Q46A 1PH4A 1PH9A 4HJ5A 3PUVA 3CCEA 4B3MQ 1J6QA 1SE8A 1A8VA 2VY3A 4ALPA 3ICEA 3TREA 2JA6H 2BA1A 3GTOH 4DR7Q 4R1JA 1HH2P 1JE5A 2Y0SE 3ERSX 4GOPC 5JJIA 1C9OA 3CD6A 5LMUL 1X9NA 2RF4A 2E2JH 3HOYG 1QVGA 2VW9A 5GAGC 2WAQG 3I2ZA 4JBWA 4A3BH 3K7AH 4DNIA 3PUWA 1UE6A 3MXNB 4LF4L 4BXXH 1SROA 1K3RA 3MEFA 1HZ9A 1XPRA 1GVPA 1LUZA 1JJ2A 1WJJA 2JK8A 4DUZL 2BA0A 4JYAL 4A3GG 5M5YH 2FXQA 2R7FA 5IYCG 1PH2A 2K75A 1JJGA 4OX9Q 1YI2A 4A3MG 4DR1L 4QGUA 1XMQQ 1QZGA 1EIYB 2F4VL 4QY7A 3CCMA 4DAMA 4JI1L 1HZBA 3G48A 1CSPA 1UE5A 4LFBQ 2D0OA 4A3DH 3L0OA 1VQPA 4OWTB 3ER0A 1TWCH 4GKJL 1PFSA 3M4QA 2YU9H 2HT1A 2IX1A 4HJ7A 2Z6KA 3TQYA 1PH5A 4DR5Q 2L15A 3K81C 3JAMi 1JJCB 1Z47A 1N36L 3AQQA 1QZHA 4JI6Q 4C2MH 3GTJH 3RNUA 5JJLA 3CMAA 3RN5A 2R92H 4IOAA 4XIGS 1UWVA 1VQAA 4DK6C 1LTLA 1VQNA 4LUVA 4BY1H 4LF9L 2VQFQ 1PH6A 1HNWL 4AH6A 1PH3A 3M7NA 4DV4L 2N49A 1S40A 3BU2A 4RMFA 3K80C 4LWCA 3CCQA 1I94L 1N32L 2KHJA 1VCIA 2RCNA 4DV6Q 3T1YQ 3CAMA 4X62L 4JOIC 1XJVA 1VQ4A 3NENA 1G51A 1VQCA 4R4CA 2E2HH 5IYDG 5M3FH 1VQOA 2UXDQ 2R7ZH 2IHFA 3S24A 3ZJYC 1E1TA 3W1BA 1DGSA 4LFCQ 1JT8A 2UUCL 1SR3A 5IYBH 2R6GA 4IFDJ 3H15A 5LMNL 1HZCA 1K9MC 2WP8J 4IPDA 4L5TA 1MIUA 2E2IH 3LGJA 1MJEA 3B6YA 5LMUQ 2Q2TA 3I4NG 1I6HH 4HJ9A 3EIVA 4KLKA 1L0WA 3K0XA 2B63H 4LF4Q 3BJUA 1TWFH 2AHOB 1YHBA 3KJOA 1MJCA 1Y14B 3EBEA 1O7IA 1XMOL 3J80c 4DUZQ 1Y1WH 4JYAQ 1GKHA 3AFPA 3PSIA 4IJLA 2ALYB 3U4VA 4DR1Q 2OTLA 4A3LG 2F4VQ 4IO9A 1CKMA 3NEMA 3CCRA 4X6AH 2VUMG 4LF8L 2YTVA 4JI1Q 1EQRA 1RL2A 3L2PA 4WJ3M 1L1OB 5FJ8H 1P16A 1K0RA 3HOXG 1SN8A 5C0XJ 2R7ZG 3AEVA 4A3CG 1YHAA 5C4XG 2VL6A 2Z6KC 4GKJQ 1VQFA 1KL9A 4DR4L 1NBWA 1K83H 1A63A 1N36Q 4JG2A 4P74A 3HOVG 2MNAA 4A93G 1VQHA 2K50A 4JI8L 3CCUA 3AYHB 5GAEC 4YHHQ 4HIMA 1YIJA 4DV5L 1NJIC 4GNXB 2D0PA 3EN2A 2NZOA 1VQ6A 1A62A 1HR0W 2PQAA 1VQKA 4JV5L 3OTOL 1YJNA 1WOCA 1U0LA 2YYZA 2ID0A 1UE7A 3ULJA 5FLMH 3U58A 4LF9Q 4POFA 1E24A 1B70B 4KI0A 5HY6A 3PIPA 3PF4A 4DV4Q 1XNQQ 2PI2E 3RLNA 2UXCL 4NPSA 3WWVA 2MQHA 1IYJB 3STBD 3KLWA 1I94Q 1N32Q 1WYDA 3RLFA 4UP8A 1Y1VH 4HIDA 3GTPH 4X62Q 3J7ZC 2CWAA 4TVAB 2JA7H 3HKZE 3DLLA 1HJPA 2I5MX 1IBLL 3IRBA 2K5VA 4BBRH 2UUCQ 4BBSG 4X66L 2JA5G 3UDFA 4GNXC 1PVOA 5LMNQ 2EIFA 4JI4L 1B8AA 3I4MH 3HOUH 1M1KC 4FDBA 1IBML 5JJKA 3PO3H 5BR8L 4A3JG 2DGYA 3F8TA 4QQBX 3E9HA 4A76A 3S1MH 4JI0L 2OTJA 2I0QA 2KCTA 1PYBA 1GD7A 3HOZG 1Q12A 3KDFA 1XMOQ 1VQLA 3S15H 3CCJA 1QVFA 5C44H 3G6EA 1OTCA 4DR6L 2YTYA 4GLAC 4EQ5A 3FKIH 1VQJA 2N78A 1VQIA 1VS0A 1X3GA 1FL0A 1S3OA 2B29A 2PI2A 1UE1A 3NELA 4GLVB 4EX5A 4LF8Q 2NVQH 3S17H 2Y0SG 1Q1BA 1WFQA 4HJAA 2ZM6L 4C3HH 3HOWG 3TRZA 4JI3L 5ELNA 3S16H 1PH7A 1C0AA 3A0JA 4GKKL 2JA6G 1OXXK 3D0FA 4JI8Q 5C3EH 3CCVA 3ULLA 3PO2H 3F2BA 4DV5Q 4DKAC 3UDGA 2ZTCA 2K52A 4JV5Q 1D8LA 3OTOQ 2OWOA 4DR2Q 4A3BG 4ME3A 3A5ZB 1ASYA 2JA8H 2DUDA 1SMXA 1T9HA 1OXTA 2IHEA 5M3MH 4BXXG 2MO1A 4UP9A 3GTGH 4K0KL 2QA4A 1X56A 1MKHA 3KF6A 2UXCQ 2BH2A 4JBJA 2PMZE 4DV7Q 4NXML 4X65L 4DV0L 3D31A 5AJ3L 2QEXA 2A8VA 2NVXH 1IBLQ 1N34L 4JBKA 2OQKA 3I4OA 3TEHB 3HFZB 1IBKL 4A3IH 1QVCA 4X64L 3H0GH 4X66Q 3W1GA 2ATWA 4YCUA 1HR0L 4A3DG 4WJ4A 3VDYA 4JI4Q 1EOVA 1I50H 1XNRL 2ZTDA 2UU9L 2JEBI 1IBMQ 4DAYB 1U5KA 3UDIA 1UEBA 1S72A 1Q7YC 3JAMc 1KRSA 1XTDA 2ASBA 4IFDG 5ELOA 4B3SL 4AYBE 3M4PA 4A3KH 1RIPA 2YV5A 2K14A 4DK3C 5IY0A 5K36G 1SRUA 2NVTH 1EIFA 5JEAJ 4QL5A 1HNXL 5M5XH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3F A;  2C35 B;  3BZC A;  3M85 A;  4IPG A;  4KHZ A;  2MFI A;  3UE0 A;  1CSQ A;  2E5L L;  4DR6 Q;  1X6O A;  4BY1 G;  4A3F G;  2VS1 A;  3U50 C;  4YY3 L;  2HHH Q;  2I5L X;  3FP9 A;  1HNZ L;  1VQ7 A;  1BBW A;  4BA2 I;  3PUX A;  3H3V I;  2GN5 A;  3KF8 B;  5IP9 H;  3F2C A;  3OYY A;  1V43 A;  2ZM6 Q;  3CME A;  5M3F G;  1KHI A;  2CQO A;  2K5H A;  3AFQ A;  4DV1 L;  5GAH C;  4IOC A;  4XTC S;  2HQL A;  5EAY A;  4JI3 Q;  2Q2U A;  1H95 A;  1TWG H;  3W5O A;  2PNH A;  5IYB G;  4DR7 L;  1E3P A;  2RHS B;  2WB1 E;  5C0X G;  4GKK Q;  4YWL A;  5IE8 A;  4UPA A;  3I56 A;  5M5W H;  1NMF A;  2GVB A;  1BVS A;  4GN4 B;  4JI2 L;  1VQ9 A;  2CWP A;  1V9P A;  2UUB L;  4MNO A;  5GAD C;  2AWN A;  1WCM H;  2YTX A;  2HIX A;  5J3B A;  3OW2 A;  3RN2 A;  2B63 G;  3J81 i;  4K0K Q;  1N8R C;  1G6P A;  4BY7 H;  2QGQ A;  1Y1W G;  4OX9 L;  4OWX B;  3BZK A;  3K7U C;  3ULP A;  4A3E H;  1HNW Q;  1KIX A;  4DV0 Q;  4A4I A;  3RZO H;  2RHQ B;  1Q1E A;  4R4Q A;  3E9I A;  5AJ3 Q;  2KCM A;  4NB3 A;  5IP7 H;  2A1A A;  1KQS A;  1N34 Q;  1YHQ A;  4JI5 L;  1IBK Q;  1LYL A;  3CC7 A;  4X64 Q;  2NN6 G;  2HHH L;  5FJ8 G;  3GTK H;  1VQG A;  2VZA A;  1PHJ A;  1HR0 Q;  3G4S A;  1VQE A;  1OXS C;  2K4K A;  3PCO B;  4P75 A;  3TS0 A;  4OWW B;  2UU9 Q;  4NXN L;  1XNR Q;  3GTQ H;  4H02 A;  4J15 A;  4Y7N H;  1K8G A;  4KHP L;  2JQO A;  1N9W A;  3HOZ H;  4MZ9 A;  3HOY H;  4OON A;  3A5U A;  1YVC A;  3M4O H;  4LUZ A;  1FJG L;  3CPF A;  4YWM A;  3HKZ G;  2JJQ A;  1HNX Q;  2Z0S A;  2XGT A;  4LF7 L;  2EXD A;  1Q8K A;  2IT1 A;  1J5E L;  2E5L Q;  3KOJ A;  5FLM G;  4GLX A;  1HZA A;  4A3G H;  5IYC H;  1YJW A;  4A3M H;  1I5F A;  2PQA B;  4YY3 Q;  1IL2 A;  2AMC B;  1WI5 A;  1HNZ Q;  1SLJ A;  2F52 A;  2ZJR A;  2LSS A;  4L5S A;  2NZH A;  2WAQ E;  3HKS A;  1R9T H;  1AH9 A;  1Y1V G;  3PUZ A;  4PZ6 A;  1CKN A;  2HIV A;  2JA7 G;  3F1Z A;  4B3R L;  2BH8 A;  4R4O A;  1L2F A;  2JA9 A;  1M90 C;  4B3T L;  3KYH C;  4LFC L;  4IFD I;  2I5H A;  3Q8D A;  4DV1 Q;  5GQO A;  1EFW A;  1VQD A;  1VQ5 A;  4O2D A;  1KD1 C;  1A0I A;  4BBR G;  1OXU A;  3RZD H;  2R93 G;  2ZTE A;  1JB7 A;  4JI7 L;  5IWA L;  3PV0 A;  4L5Q A;  4APV A;  3I4M G;  2IX0 A;  3FHW A;  4DR4 Q;  3CF5 A;  3GDE A;  4LFA L;  3HOU G;  3M9B A;  3NBH B;  4JI2 Q;  1Q86 C;  2OCE A;  1PH8 A;  3PO3 G;  2UUB Q;  2F3I A;  1YBY A;  3GD7 A;  1IZ6 A;  1IXR A;  1EWI A;  5IT9 c;  1KC8 C;  4DV2 L;  1TWA H;  1EYG A;  4LF6 L;  3PIO A;  1V1Q A;  1YZ6 A;  3CP0 A;  1GM5 A;  3CCL A;  1PYS B;  5C44 G;  1AE3 A;  4GN5 A;  1GO3 E;  4DUY L;  2VQE L;  4DR3 L;  4LF5 L;  3FKI G;  2ZJP A;  3KDF B;  2Q2I A;  4YCW A;  4HJ8 A;  3T1H L;  1ASZ A;  2GVA A;  4AQY L;  2ES2 A;  1X65 A;  5IYD H;  5C0X I;  1K8A C;  4DV3 L;  4JI5 Q;  2UXB L;  5C4J H;  4L5R C;  4YCV A;  4LUO A;  3J81 j;  2LXJ A;  3UDX A;  2IY5 B;  1CKN B;  3CC2 A;  3J7A 5;  4NXN Q;  1W2B A;  3CQZ H;  2CKZ B;  1E22 A;  4LW1 A;  2LXK A;  5E7N A;  4P71 A;  3S1Q H;  2CFM A;  4R4I A;  4KHP Q;  1KXL A;  4YHH L;  3JC6 6;  4JCV E;  3CC4 A;  2UUA L;  3I4N H;  4GN3 B;  1QUQ A;  5C3E G;  1K73 C;  2NVY H;  1P8L A;  4IJH A;  5BR8 Q;  3PO2 G;  3G71 A;  1FJG Q;  1BBU A;  4JI0 Q;  1LM0 A;  4RG1 A;  1VQ8 A;  1VQB A;  4A3F H;  1FVI A;  4LF7 Q;  4PG3 A;  1J5E Q;  2JA8 G;  1XNQ L;  3J80 i;  2R92 G;  2D62 A;  5M3M G;  5JEA G;  1VQM A;  1N33 L;  1L1O A;  3S2H H;  4UY8 C;  3S1N H;  2NN6 I;  1PV4 A;  4A3L H;  4OO1 I;  4PZ7 A;  4MTN A;  2VUM H;  2JE6 I;  4LNQ A;  1PH1 A;  1E7Z A;  4B3R Q;  4IPC A;  1PA6 A;  3S14 H;  3UE1 A;  3KF6 B;  4B3T Q;  1W3S A;  2WFW A;  4AYB G;  1NTG A;  2AWO A;  3HOX H;  5GRO A;  4QIW E;  5C4X H;  1JMC A;  1SFO H;  4A3C H;  1NY4 A;  4P72 A;  4A3I G;  3H0G G;  4GNX A;  3SGI A;  3PGZ A;  2AKW B;  4B3M L;  4JI7 Q;  5IWA Q;  2KEN A;  1TXY A;  1YIT A;  1Q82 C;  3HOV H;  2KHI A;  4PZ8 A;  2N3S A;  4LFA Q;  4A93 H;  2V1C C;  3CW2 C;  1AE2 A;  4P73 A;  3GTM H;  4HIK A;  4QJF A;  3PF5 A;  3KFU A;  4C3I H;  1XPU A;  4UP7 A;  4GOP A;  4DV2 Q;  4A3K G;  5DLQ E;  4A75 A;  1NMG A;  2H5X A;  2CCZ A;  4LF6 Q;  4PMW A;  1QUQ B;  3I7F A;  3CCS A;  1NE3 A;  4HIO A;  3S2D H;  2R7D A;  1BKB A;  3L7Z C;  4C3J H;  4YWK A;  1CUK A;  4DUY Q;  2OQ0 A;  3RR5 A;  1CKO A;  2VQE Q;  4DR3 Q;  4LF5 Q;  2KBN A;  2WB1 G;  3PUY A;  1KRT A;  3T1H Q;  1Z9F A;  1XMQ L;  4AQY Q;  4NXM Q;  4X65 Q;  4DV3 Q;  2UXB Q;  2MO0 A;  5H1S E;  4R4T A;  5IP9 G;  3CXC A;  4BBS H;  4LFB L;  2JA5 H;  4JBM A;  3KJP A;  3RLO A;  4OXP A;  2B3G A;  5HGQ A;  1YJ9 A;  3H3V H;  4POG A;  4OO1 G;  1TWH H;  3GO5 A;  1D7Q A;  3I55 A;  1XPO A;  4DR5 L;  1EQQ A;  4A3J H;  1Q81 C;  1YEZ A;  1G29 1;  3A74 A;  2UUA Q;  2JEA I;  1OXV A;  1C7Y A;  1KAW A;  1X55 A;  4JI6 L;  3K8A A;  4DR2 L;  4B3S Q;  2N8N A;  4IPH A;  4DPG A;  1E1O A;  3E0E A;  2E8G A;  1WCM G;  4GS3 A;  5LMN W;  2EQS A;  1L1O C;  3J81 c;  3U4Z A;  4GOP B;  1X54 A;  1N33 Q;  4AIM A;  2VQF L;  3DM3 A;  2VNU D;  4DV7 L;  4JC0 A;  4BY7 G;  4Y52 H;  3M3Y H;  4O0A A;  1X3E A;  1I3Q H;  2A19 A;  4A3E G;  1EUJ A;  1YNX A;  4DV6 L;  1B7Y B;  3T1Y L;  5IP7 G;  3GTL H;  1FGU A;  2K5N A;  3STB C;  3S1R H;  3HOW H;  4BA1 I;  2ZJQ A;  2Q2H A;  3TS2 A;  4JOI A;  2UXD L;  2R93 H;  2XTI A;  3F2D A;  4TQU S;  3CPW A;  5FLX c;  1Q46 A;  1PH4 A;  1PH9 A;  4HJ5 A;  3PUV A;  3CCE A;  4B3M Q;  1J6Q A;  1SE8 A;  1A8V A;  2VY3 A;  4ALP A;  3ICE A;  3TRE A;  2JA6 H;  2BA1 A;  3GTO H;  4DR7 Q;  4R1J A;  1HH2 P;  1JE5 A;  2Y0S E;  3ERS X;  4GOP C;  5JJI A;  1C9O A;  3CD6 A;  5LMU L;  1X9N A;  2RF4 A;  2E2J H;  3HOY G;  1QVG A;  2VW9 A;  5GAG C;  2WAQ G;  3I2Z A;  4JBW A;  4A3B H;  3K7A H;  4DNI A;  3PUW A;  1UE6 A;  3MXN B;  4LF4 L;  4BXX H;  1SRO A;  1K3R A;  3MEF A;  1HZ9 A;  1XPR A;  1GVP A;  1LUZ A;  1JJ2 A;  1WJJ A;  2JK8 A;  4DUZ L;  2BA0 A;  4JYA L;  4A3G G;  5M5Y H;  2FXQ A;  2R7F A;  5IYC G;  1PH2 A;  2K75 A;  1JJG A;  4OX9 Q;  1YI2 A;  4A3M G;  4DR1 L;  4QGU A;  1XMQ Q;  1QZG A;  1EIY B;  2F4V L;  4QY7 A;  3CCM A;  4DAM A;  4JI1 L;  1HZB A;  3G48 A;  1CSP A;  1UE5 A;  4LFB Q;  2D0O A;  4A3D H;  3L0O A;  1VQP A;  4OWT B;  3ER0 A;  1TWC H;  4GKJ L;  1PFS A;  3M4Q A;  2YU9 H;  2HT1 A;  2IX1 A;  4HJ7 A;  2Z6K A;  3TQY A;  1PH5 A;  4DR5 Q;  2L15 A;  3K81 C;  3JAM i;  1JJC B;  1Z47 A;  1N36 L;  3AQQ A;  1QZH A;  4JI6 Q;  4C2M H;  3GTJ H;  3RNU A;  5JJL A;  3CMA A;  3RN5 A;  2R92 H;  4IOA A;  4XIG S;  1UWV A;  1VQA A;  4DK6 C;  1LTL A;  1VQN A;  4LUV A;  4BY1 H;  4LF9 L;  2VQF Q;  1PH6 A;  1HNW L;  4AH6 A;  1PH3 A;  3M7N A;  4DV4 L;  2N49 A;  1S40 A;  3BU2 A;  4RMF A;  3K80 C;  4LWC A;  3CCQ A;  1I94 L;  1N32 L;  2KHJ A;  1VCI A;  2RCN A;  4DV6 Q;  3T1Y Q;  3CAM A;  4X62 L;  4JOI C;  1XJV A;  1VQ4 A;  3NEN A;  1G51 A;  1VQC A;  4R4C A;  2E2H H;  5IYD G;  5M3F H;  1VQO A;  2UXD Q;  2R7Z H;  2IHF A;  3S24 A;  3ZJY C;  1E1T A;  3W1B A;  1DGS A;  4LFC Q;  1JT8 A;  2UUC L;  1SR3 A;  5IYB H;  2R6G A;  4IFD J;  3H15 A;  5LMN L;  1HZC A;  1K9M C;  2WP8 J;  4IPD A;  4L5T A;  1MIU A;  2E2I H;  3LGJ A;  1MJE A;  3B6Y A;  5LMU Q;  2Q2T A;  3I4N G;  1I6H H;  4HJ9 A;  3EIV A;  4KLK A;  1L0W A;  3K0X A;  2B63 H;  4LF4 Q;  3BJU A;  1TWF H;  2AHO B;  1YHB A;  3KJO A;  1MJC A;  1Y14 B;  3EBE A;  1O7I A;  1XMO L;  3J80 c;  4DUZ Q;  1Y1W H;  4JYA Q;  1GKH A;  3AFP A;  3PSI A;  4IJL A;  2ALY B;  3U4V A;  4DR1 Q;  2OTL A;  4A3L G;  2F4V Q;  4IO9 A;  1CKM A;  3NEM A;  3CCR A;  4X6A H;  2VUM G;  4LF8 L;  2YTV A;  4JI1 Q;  1EQR A;  1RL2 A;  3L2P A;  4WJ3 M;  1L1O B;  5FJ8 H;  1P16 A;  1K0R A;  3HOX G;  1SN8 A;  5C0X J;  2R7Z G;  3AEV A;  4A3C G;  1YHA A;  5C4X G;  2VL6 A;  2Z6K C;  4GKJ Q;  1VQF A;  1KL9 A;  4DR4 L;  1NBW A;  1K83 H;  1A63 A;  1N36 Q;  4JG2 A;  4P74 A;  3HOV G;  2MNA A;  4A93 G;  1VQH A;  2K50 A;  4JI8 L;  3CCU A;  3AYH B;  5GAE C;  4YHH Q;  4HIM A;  1YIJ A;  4DV5 L;  1NJI C;  4GNX B;  2D0P A;  3EN2 A;  2NZO A;  1VQ6 A;  1A62 A;  1HR0 W;  2PQA A;  1VQK A;  4JV5 L;  3OTO L;  1YJN A;  1WOC A;  1U0L A;  2YYZ A;  2ID0 A;  1UE7 A;  3ULJ A;  5FLM H;  3U58 A;  4LF9 Q;  4POF A;  1E24 A;  1B70 B;  4KI0 A;  5HY6 A;  3PIP A;  3PF4 A;  4DV4 Q;  1XNQ Q;  2PI2 E;  3RLN A;  2UXC L;  4NPS A;  3WWV A;  2MQH A;  1IYJ B;  3STB D;  3KLW A;  1I94 Q;  1N32 Q;  1WYD A;  3RLF A;  4UP8 A;  1Y1V H;  4HID A;  3GTP H;  4X62 Q;  3J7Z C;  2CWA A;  4TVA B;  2JA7 H;  3HKZ E;  3DLL A;  1HJP A;  2I5M X;  1IBL L;  3IRB A;  2K5V A;  4BBR H;  2UUC Q;  4BBS G;  4X66 L;  2JA5 G;  3UDF A;  4GNX C;  1PVO A;  5LMN Q;  2EIF A;  4JI4 L;  1B8A A;  3I4M H;  3HOU H;  1M1K C;  4FDB A;  1IBM L;  5JJK A;  3PO3 H;  5BR8 L;  4A3J G;  2DGY A;  3F8T A;  4QQB X;  3E9H A;  4A76 A;  3S1M H;  4JI0 L;  2OTJ A;  2I0Q A;  2KCT A;  1PYB A;  1GD7 A;  3HOZ G;  1Q12 A;  3KDF A;  1XMO Q;  1VQL A;  3S15 H;  3CCJ A;  1QVF A;  5C44 H;  3G6E A;  1OTC A;  4DR6 L;  2YTY A;  4GLA C;  4EQ5 A;  3FKI H;  1VQJ A;  2N78 A;  1VQI A;  1VS0 A;  1X3G A;  1FL0 A;  1S3O A;  2B29 A;  2PI2 A;  1UE1 A;  3NEL A;  4GLV B;  4EX5 A;  4LF8 Q;  2NVQ H;  3S17 H;  2Y0S G;  1Q1B A;  1WFQ A;  4HJA A;  2ZM6 L;  4C3H H;  3HOW G;  3TRZ A;  4JI3 L;  5ELN A;  3S16 H;  1PH7 A;  1C0A A;  3A0J A;  4GKK L;  2JA6 G;  1OXX K;  3D0F A;  4JI8 Q;  5C3E H;  3CCV A;  3ULL A;  3PO2 H;  3F2B A;  4DV5 Q;  4DKA C;  3UDG A;  2ZTC A;  2K52 A;  4JV5 Q;  1D8L A;  3OTO Q;  2OWO A;  4DR2 Q;  4A3B G;  4ME3 A;  3A5Z B;  1ASY A;  2JA8 H;  2DUD A;  1SMX A;  1T9H A;  1OXT A;  2IHE A;  5M3M H;  4BXX G;  2MO1 A;  4UP9 A;  3GTG H;  4K0K L;  2QA4 A;  1X56 A;  1MKH A;  3KF6 A;  2UXC Q;  2BH2 A;  4JBJ A;  2PMZ E;  4DV7 Q;  4NXM L;  4X65 L;  4DV0 L;  3D31 A;  5AJ3 L;  2QEX A;  2A8V A;  2NVX H;  1IBL Q;  1N34 L;  4JBK A;  2OQK A;  3I4O A;  3TEH B;  3HFZ B;  1IBK L;  4A3I H;  1QVC A;  4X64 L;  3H0G H;  4X66 Q;  3W1G A;  2ATW A;  4YCU A;  1HR0 L;  4A3D G;  4WJ4 A;  3VDY A;  4JI4 Q;  1EOV A;  1I50 H;  1XNR L;  2ZTD A;  2UU9 L;  2JEB I;  1IBM Q;  4DAY B;  1U5K A;  3UDI A;  1UEB A;  1S72 A;  1Q7Y C;  3JAM c;  1KRS A;  1XTD A;  2ASB A;  4IFD G;  5ELO A;  4B3S L;  4AYB E;  3M4P A;  4A3K H;  1RIP A;  2YV5 A;  2K14 A;  4DK3 C;  5IY0 A;  5K36 G;  1SRU A;  2NVT H;  1EIF A;  5JEA J;  4QL5 A;  1HNX L;  5M5X H; 
#chains in the Genus database with same CATH topology
 1K28 A;  4CKC A;  1TKW B;  4IPG A;  4KHZ A;  2MFI A;  2E5L L;  4DR6 Q;  2I5L X;  1PTO D;  3KF8 B;  1DYQ A;  1V43 A;  2F0T A;  3CME A;  4TRD A;  1K8M A;  4XTC S;  5EAY A;  4JI3 Q;  2Q2U A;  2B2W C;  5IYB G;  4DR7 L;  4YWL A;  5M5W H;  3NWS A;  1B4O A;  2GVB A;  4A3B B;  1GUW A;  1V9P A;  3NE5 B;  4XQJ A;  2EY5 A;  1LT3 D;  1G91 A;  3NPP A;  3RN2 A;  3FKI B;  4L8J A;  3K0Y A;  5IOD A;  2NUC A;  3NTI A;  1JWM D;  4S3S A;  5A2Q L;  2R3Z A;  5M9O A;  5IT9 L;  4DV0 Q;  2BCO A;  3I8Z A;  1QOH A;  2BDO A;  4JI5 L;  3CC7 A;  4X64 Q;  2B2T A;  4HTH A;  1HR0 Q;  1VQE A;  1OXS C;  2K4K A;  4P75 A;  3WDN A;  2DJG C;  4NXN L;  4H02 A;  3TN2 A;  2F0L A;  1K8G A;  4KHP L;  1N9W A;  2BE5 C;  3J81 E;  4LUZ A;  2L55 A;  1FJG L;  3HKZ G;  1HNX Q;  1H9R A;  2XGT A;  2F0D A;  2EXD A;  1EY9 A;  1Q8K A;  2RDG A;  1J5E L;  2CVR A;  2E5L Q;  5FLM G;  1KNA A;  2QDL A;  2AMC B;  1WI5 A;  4QUC A;  1SLJ A;  3SXH A;  1U4M A;  1TU2 B;  2FJ2 A;  3HKS A;  3PUZ A;  1CKN A;  5KRU A;  2CW0 D;  1L2F A;  2I5H A;  3Q8D A;  4ZRZ A;  3TME A;  1A0I A;  1JOK A;  4BBR G;  1OXU A;  2E2I B;  4H0L C;  3CRL C;  3UI2 A;  1HFG A;  3CU7 A;  4JI7 L;  4DR4 Q;  1I6H B;  4GZY C;  2OCE A;  3PO3 G;  1EZ6 A;  3A8K E;  3GD7 A;  3T51 B;  4MTK A;  4DV2 L;  3L3O C;  1STE A;  1GM5 A;  1SXT A;  1SBB B;  1PYS B;  5C5M A;  4GN5 A;  4DR3 L;  2ZJP A;  1B2T A;  4HJ8 A;  3T1H L;  2ES2 A;  3HS0 C;  5C0X I;  4JI5 Q;  1TWG B;  2Q8I B;  4FNF A;  1ZXT A;  3UDX A;  2IY5 B;  1CKN B;  3J7A 5;  1EU4 A;  3S9W A;  1K83 B;  5EPL A;  1PFN A;  4NXN Q;  5E7N A;  1LO5 D;  1EZ8 A;  4KHP Q;  3I3C A;  2Z4I A;  2A74 C;  1MD2 D;  1HUM A;  5C3E G;  1K73 C;  2NVY H;  1P8L A;  4IJH A;  1FJG Q;  1MHW C;  4U68 A;  4BY7 B;  1QIL A;  4JI0 Q;  1LM0 A;  1VQB A;  4A3F H;  1KDA A;  1J5E Q;  2A6E C;  2QEJ C;  3J80 i;  1N33 L;  2VXW A;  1L1O A;  4DNT B;  3GTP B;  3SK4 A;  2J4X A;  2JA7 B;  4MTN A;  5I4D A;  2EZV A;  1CA5 A;  2VUM H;  3GTK B;  1TY0 A;  2SNM A;  1F9R A;  1WTX A;  1PA6 A;  2FMM A;  3UE1 A;  3KF6 B;  4CJ1 B;  2WFW A;  5GRO A;  1JMC A;  1SFO H;  3HZX A;  3R8B A;  3H0G G;  4GNX A;  3HOY B;  4JI7 Q;  1ZKO A;  3DHQ A;  1TXY A;  2C9O A;  1YIT A;  2B2Y C;  3WOE A;  4HIK A;  3KFU A;  4BS9 A;  4DV2 Q;  2EJM A;  3ONA B;  5I6W A;  4A3K G;  1NMG A;  2CCZ A;  2B2U C;  4PMW A;  3CCS A;  5IGE A;  1NE3 A;  2R7D A;  1BKB A;  1CUK A;  4DR3 Q;  2NVQ B;  3T1H Q;  3M4Y A;  1C8C A;  4NXM Q;  5I9P A;  5HGT A;  3Q0A A;  4KKU A;  3RZD B;  2KHS A;  3QWN A;  4YIJ A;  4BBS H;  4LFB L;  3MA2 B;  4NKL A;  2B3G A;  1TWH H;  2SEB D;  3GO5 A;  2RDH A;  4DR5 L;  4A3J H;  1YEZ A;  1OXV A;  1KAW A;  1GUO A;  2J7Z A;  2JA8 B;  4B3S Q;  3E0E A;  4GS3 A;  2E8G A;  5FO7 B;  1ENF A;  2EQS A;  3J81 c;  4PQX A;  2B8F A;  1N33 Q;  2KUM A;  3MEH A;  4H7B A;  3T13 A;  4O0A A;  5KEE A;  1STN A;  1I3Q H;  1X3E A;  1YNX A;  4AYB B;  2PPB C;  1EEI D;  3AB9 A;  3T1Y L;  4IZ8 A;  5IP7 G;  4A3I B;  1FGU A;  2XTI A;  3F2D A;  1F9P A;  1E2V A;  4TQU S;  2XRS D;  1PH9 A;  3CCE A;  1A8V A;  1DOM A;  4ALP A;  1I4P A;  2JA6 H;  5JJI A;  4OIK A;  2RF4 A;  3ERQ A;  5KIX A;  1QVG A;  2VW9 A;  3RD4 A;  2ZXO A;  4JBW A;  4A3B H;  4KKT A;  1UE6 A;  2BDN A;  3MXN B;  4BXX H;  1SRO A;  1AW7 A;  1XPR A;  3VR6 A;  2JK8 A;  3NSW A;  3EJI A;  1V1P B;  2K75 A;  1JIC A;  4QGU A;  5C4X B;  3N6R A;  4QY7 A;  1HZB A;  4DAY A;  1CSP A;  4LFB Q;  3CHB D;  4NDX A;  4JK1 C;  1VMP A;  1VQP A;  5C6A A;  4OWT B;  3ER0 A;  3GTM B;  2HT1 A;  1EQV A;  3ND9 A;  4DR5 Q;  1H9S A;  3C2P A;  3JAM i;  4IFD H;  1JJC B;  2AQ1 B;  4BWG B;  4MN3 A;  2A6E D;  3RNU A;  3RN5 A;  2RSO A;  5DNF A;  1UWV A;  4CDF C;  4EVO A;  1O80 A;  4K5X A;  4A3E B;  4N9T A;  1PH6 A;  1PH3 A;  2B8G A;  3IKJ A;  4RMF A;  3CCQ A;  4R8I A;  1LTS D;  2RCN A;  3T1Y Q;  4N8F A;  4X62 L;  3F2U A;  1B1Z A;  1EYA A;  2IHF A;  1DGS A;  1STG A;  5K5P A;  4LFC Q;  3GTQ B;  4RGN A;  1EY5 A;  1LV9 A;  3QO2 A;  3HOZ B;  1K9M C;  4IPD A;  1HFN A;  2E2I H;  1A3U A;  2WAQ B;  1PTO B;  2I07 B;  3B6Y A;  1Q3L A;  4NP5 A;  4QF4 A;  2SOB A;  1I6H H;  2Z9H A;  5ELD A;  3EIV A;  4KLK A;  4ZLT F;  3BJU A;  2ZT9 C;  2AHO B;  1ENC A;  3KJO A;  4A3M B;  3H3V C;  4L63 B;  2PW7 A;  1R9T B;  2ALY B;  2OTL A;  1ESR A;  1ILP A;  1ML0 D;  2Q8T A;  4FO2 A;  4WJ3 M;  3GTO B;  5C0X J;  2K5D A;  1MI2 A;  1JQY D;  2QIL A;  2VL6 A;  2Z6K C;  1NBW A;  1O7Z A;  1K83 H;  3OSO A;  4P74 A;  3HOV G;  1STA A;  2MNA A;  2A5H A;  2K50 A;  3CCU A;  3AYH B;  4YHH Q;  1NJI C;  3EN2 A;  2NZO A;  3TZU A;  3T53 B;  4JV5 L;  1LT4 D;  2YYZ A;  3QB3 A;  4NW2 A;  3EFX D;  1Z7T A;  1BCP D;  1B70 B;  1ILQ A;  2MQH A;  3KLW A;  4KN7 C;  3RUZ A;  3GTP H;  2RKS A;  4X62 Q;  2JA7 H;  3HKZ E;  4B9X A;  4IAL A;  2NTT A;  3DLL A;  1QB5 D;  1PLF A;  3TP7 A;  1K3B C;  2K5V A;  3NBH A;  2QDB A;  3I4L A;  4X66 L;  2JA5 G;  4GNX C;  2HCC A;  2XNA C;  2QCP X;  3HOU H;  1IBM L;  4IUT A;  3F8T A;  3E9H A;  4IUV A;  4A76 A;  2OTJ A;  1FNW A;  1BQQ T;  3DXJ C;  4K14 A;  1PYB A;  1GD7 A;  4HMJ A;  3S2H B;  1WTP A;  1HA5 A;  4LK1 C;  3G6E A;  1IKL A;  4X3T A;  1SNO A;  3A7L A;  1WVL A;  2N78 A;  1VQI A;  5C3W A;  2HHH L;  1S3O A;  1SEB D;  2NVQ H;  2WV6 D;  2Y0S G;  1Q1B A;  4RA8 A;  3TRZ A;  1A6X A;  5A2Q E;  1BXT A;  4ID6 A;  3SEB A;  1PH7 A;  1C0A A;  4GKK L;  2B2W A;  2MJ8 A;  1KLU D;  3PO2 H;  3OW7 A;  5EBD A;  3T4A C;  5I2Y A;  4JV5 Q;  4HN7 A;  3MFG A;  2G5D A;  2JA8 H;  4UP9 A;  3ND8 A;  5IGB A;  3TP5 A;  4DV7 Q;  2OT2 A;  4X65 L;  4M1U B;  4UAI A;  2OQK A;  4A3I H;  4F7X A;  4X66 Q;  2ATW A;  4YCU A;  1EOV A;  1XNR L;  3FMC A;  1IBM Q;  5KGU A;  5ELO A;  3M4P A;  5K36 G;  2YV5 A;  5IY0 A;  4X3U A;  4JVZ A;  2NB0 A;  1X3F A;  2C35 B;  1SYC A;  1BR9 A;  4ZUI A;  1CSQ A;  1BDO A;  2HHH Q;  3FP9 A;  5J22 A;  3HOW B;  4BBR B;  1BBW A;  3PUX A;  2GN5 A;  5IP9 H;  2C5C A;  3C3L A;  2F0H A;  1VDZ A;  2K5H A;  3AFQ A;  2R7Z G;  3QOJ A;  3PO3 B;  2HDL A;  3E0J A;  1PMR A;  4GKK Q;  5IE8 A;  4UPA A;  3MXU A;  5IGG A;  1WTV A;  2UUB L;  2CWP A;  2AWN A;  1WCM H;  5J1Z A;  3W2D A;  5J3B A;  2B63 G;  3J81 i;  5M5Y B;  1ET9 A;  1QG7 A;  2HCI A;  2QGQ A;  1Y1W G;  1F2M A;  4OWX B;  3ULP A;  4A3E H;  1BBX C;  1HNW Q;  3RZO H;  2RHQ B;  1Q1E A;  2IX3 A;  2KCM A;  2MPM A;  4NB3 A;  2L9H A;  3S16 B;  3DEP A;  3MZ5 A;  4HSP A;  4J6H A;  3BDC A;  2NN6 G;  5T1G A;  4DXF A;  1VQG A;  2VZA A;  2YU9 B;  1K0S A;  1YNJ C;  5C3E B;  3G4S A;  1NR4 A;  1XNR Q;  3GTQ H;  1STY A;  5FK9 C;  2D5D A;  2JQO A;  3HOZ H;  4MZ9 A;  1V1O A;  4OON A;  3BG3 A;  1A2T A;  3A5U A;  3SE0 A;  3VR4 A;  4YWM A;  4LF7 L;  4RAU C;  1RTO A;  4GLX A;  2EYF A;  4A3G H;  4FXK C;  5IYC H;  2NVX B;  3RMH A;  2L11 A;  1LTG D;  2P5Z X;  4K6D A;  4A3M H;  2PQA B;  4HED A;  4KY5 A;  1SMY D;  4L5S A;  1R9T H;  1Y1V G;  4PZ6 A;  2HIV A;  4B3R L;  4R4O A;  1XYI A;  3C46 A;  3SDZ A;  3MC0 B;  1JB7 A;  4A3K B;  5IWA L;  3PV0 A;  1XWE A;  4L5Q A;  3H09 A;  4APV A;  2K32 A;  3NK9 A;  3I4M G;  3NTH A;  3M9B A;  2KOL A;  2B2Y A;  2UUB Q;  1Y8O B;  2WAC A;  1YBY A;  1IZ6 A;  1EWI A;  5IT9 c;  3A56 A;  4I65 A;  1TWA H;  4ZK9 B;  5CBA E;  3PIO A;  1W6K A;  3M7G A;  1X3Q A;  5C44 G;  5EGT A;  1EIG A;  4KV6 A;  4LF5 L;  5CGK A;  4YCW A;  1ASZ A;  2KA7 A;  4AQY L;  1X65 A;  2EPB A;  4LJZ C;  4DV3 L;  4KTA A;  5C4J H;  4L5R C;  4OHJ A;  2LXJ A;  4C3H G;  4WRD A;  3NQT A;  3CC2 A;  5D3I B;  5A35 A;  4LW1 A;  2LXK A;  1I4X A;  2CFM A;  4R4I A;  4IUU A;  1QE6 A;  4ZUJ A;  3D8G A;  3VYT A;  1IW7 D;  3CC4 A;  3I4N H;  2IL8 A;  4KMU C;  5BR8 Q;  3G71 A;  4WFN 3;  1JR0 D;  1J9O A;  1VQ8 A;  4LF7 Q;  4IUQ A;  3DMU A;  1XNQ L;  2QF7 A;  2R92 G;  5JEA G;  3S2H H;  2L12 A;  4OL7 A;  4UY8 C;  3GV6 A;  1PV4 A;  4A3L H;  5C3X A;  3A7A B;  2JE6 I;  5EPK A;  4LNQ A;  1GUS A;  4G7Z C;  1E2Z A;  2XVS A;  4B3R Q;  1H9M A;  3QOL A;  1LAC A;  3E5S A;  3NTK A;  1FNV A;  1NY4 A;  5JOB A;  3A55 A;  1G6Z A;  1A3V A;  2AKW B;  5IWA Q;  2XIW A;  4H13 C;  1IL8 A;  2V1C C;  3CW2 C;  1AE2 A;  1HHV A;  3R3O A;  3R2T A;  3PF5 A;  2NWG A;  4C3I H;  5E3F A;  5FLX L;  1CZW A;  3BDO A;  1SJH D;  5DLQ E;  1L0X B;  3VR5 A;  4HIO A;  3L7Z C;  5FKA C;  4I7Z C;  1CKO A;  4LF5 Q;  3S17 B;  2WB1 G;  3PUY A;  1NR2 A;  4AQY Q;  2QKI C;  1YNJ D;  4DV3 Q;  4R4T A;  1TS2 A;  4JBM A;  1STH A;  4K5V A;  1SDF A;  3I55 A;  1EQQ A;  3A74 A;  1EFI D;  4IUN A;  1DOK A;  2VB3 X;  2DN8 A;  3K8A A;  3J7Y W;  3PQI A;  3NHH A;  4LAA A;  5M3M B;  4DPG A;  1E1O A;  4EQP A;  2F0M A;  5LMN W;  4HR7 B;  1DXM A;  1LT5 D;  2EY1 A;  1EY4 A;  1GHK A;  3J7A V;  1B3Q A;  4ZYS A;  1EUJ A;  5CV5 A;  2EY6 A;  4DV6 L;  1B7Y B;  4NMZ A;  2F0J A;  3S1R H;  3HOW H;  1BOS A;  1W6J A;  2ZXR A;  3R93 A;  2ZJQ A;  2F0U A;  2D9U A;  4TKO B;  4HJ5 A;  3MHB A;  1J6Q A;  2VY3 A;  1T5E A;  2BA1 A;  1JOR A;  2PW5 A;  4DR7 Q;  2EVB A;  4ZQ3 A;  4R1J A;  2Y0S E;  4GOP C;  1HXY D;  4C56 C;  3CD6 A;  4N9P A;  5LMU L;  5M5X B;  4KJN A;  3S1N B;  3JAM L;  1K3R A;  3H6M A;  4KY7 A;  1LUZ A;  1S5B D;  2BA0 A;  2LS0 1;  3NXW A;  5M5Y H;  1JJG A;  5COR A;  3AU7 A;  1YI2 A;  4DR1 L;  1EIY B;  1ONL A;  5I6Y A;  3OMC A;  4JI1 L;  1UE5 A;  2E74 C;  3Q22 A;  3L0O A;  2CH4 A;  5D3D A;  1PFS A;  3M4Q A;  2YU9 H;  2Z6K A;  1KAA A;  2D2C C;  5LL6 S;  3K81 C;  1UEA B;  4OEL B;  1EQT A;  4DA2 A;  4C1N I;  3MTS A;  2QW7 A;  3GTJ H;  3CMA A;  4DFA A;  4O1N A;  4XIG S;  1UUP A;  5EKK A;  1VQN A;  4LUV A;  4BY1 H;  5CV7 A;  4AH6 A;  2F0K A;  4I7A A;  4LWC A;  1I94 L;  3QG1 A;  2KHJ A;  1VCI A;  4DV6 Q;  4CGY B;  1ENA A;  2Z8L A;  2IW3 A;  1XJV A;  1O7L A;  4R4C A;  5M3F H;  1H9K A;  1Q90 A;  3W1B A;  1JT8 A;  1WD1 A;  1PRT B;  2IJ0 A;  3T56 B;  2O5I C;  2R6G A;  5C0X H;  2V4D A;  5LMN L;  1JWU D;  3M4O B;  1AEX A;  5LMU Q;  2Q2T A;  3KUP A;  2B2V A;  2RBM A;  2KED A;  3K0X A;  3MVV A;  1L0W A;  3KK7 A;  2O2L D;  3M3Y B;  3A8I E;  2TMP A;  4K2K A;  3EBE A;  1B50 A;  1O7I A;  1EWH A;  2FIN B;  1YNN C;  2Y0S B;  2F0F A;  3FDT A;  2FFK B;  1MSH A;  1JE4 A;  4IJL A;  3K59 A;  4J8Q A;  4DR1 Q;  4IO9 A;  1SSO A;  2KCC A;  3CCR A;  4X6A H;  2VUM G;  3FEW X;  4JI1 Q;  2DY8 A;  1RL2 A;  1I4Q A;  1L1O B;  5FJ8 H;  2KCN A;  3X3M A;  1VQF A;  2E2J B;  1KL9 A;  2NBF A;  2DY7 A;  2PZT A;  2K05 A;  4JG2 A;  4JI8 L;  4HIM A;  3K5L A;  1YIJ A;  4GNX B;  1M4V A;  1VQK A;  1SYF A;  1YJN A;  1EOT A;  1UE7 A;  4POF A;  1E24 A;  1GUG A;  4K6L A;  5HY6 A;  2DNC A;  3PF4 A;  1D1K A;  4HCS A;  3RLN A;  4NPS A;  1I94 Q;  1WYD A;  4ZKC B;  3RLF A;  1H9J A;  4FF1 A;  3J7Z C;  3FVQ A;  1BCP C;  5LHY 1;  1HJP A;  2I5M X;  1SND A;  3IRB A;  2CH4 W;  4DK0 A;  4BBS G;  1PVO A;  1GJX A;  5LMN Q;  1PXU A;  4A3J G;  2DGY A;  2FHT A;  1I4G A;  1JC7 A;  1D5M C;  1JCK B;  1OO9 B;  2KCT A;  1DCZ A;  3P7J A;  3KDF A;  1SAP A;  4RGM A;  2YTY A;  2KEE A;  2E2H B;  4GLA C;  3URY A;  3FKI H;  2B29 A;  1FL0 A;  3HOX B;  3S17 H;  2XRQ D;  2ICI A;  4HJA A;  2ZM6 L;  4CBV A;  1I6V C;  5ELN A;  4A93 B;  3DUZ A;  3A0J A;  2JA6 G;  4JI8 Q;  4KD3 A;  1QCB D;  3CCV A;  1WTO A;  2ZTC A;  4QB4 A;  1SJE D;  3IFT A;  1Y1W B;  1SNP A;  4A3B G;  4ME3 A;  1ASY A;  2KEC A;  4C3J B;  1BNZ A;  1T9H A;  1OXT A;  2IHE A;  5M3M H;  4BXX G;  5C5L A;  4K0K L;  1X56 A;  1MKH A;  2PMZ E;  3I91 A;  4K5W A;  1QWY A;  2VB2 X;  5KND A;  2LKV A;  3D31 A;  4DN4 M;  2QEX A;  2A8V A;  1D2B A;  3E3X A;  5BN3 A;  1FGB D;  4EGV A;  1N34 L;  3TEH B;  2EY2 A;  1QVC A;  1PZJ D;  5EKL A;  3PIO 3;  3VA5 A;  5JAV A;  3VDY A;  1QNK A;  2JEB I;  4DAY B;  1U5K A;  3UDI A;  5ISR A;  4MIU A;  1HUN A;  1KRS A;  4IFD G;  3FPP A;  4HMI A;  1YNN D;  1EIF A;  2FMC A;  5JVH 3;  5TSS A;  1H9S B;  5M5X H;  3I56 A;  3M85 A;  2XN9 C;  3UE0 A;  4ME5 A;  1X6O A;  2Z6B A;  2RQX A;  1BCP F;  2LFN A;  2VS1 A;  3U50 C;  4YY3 L;  1HNZ L;  2JN4 A;  1VQ7 A;  4CDD C;  3H3V I;  3F2C A;  3SR1 A;  4FYD A;  2ZM6 Q;  1B53 A;  1UNS A;  3HG9 A;  1KDC A;  3IFD A;  1KHI A;  2CQO A;  4XT3 B;  5CMD A;  2HQL A;  2AQ3 B;  1TWG H;  3W5O A;  1RF2 D;  1E3P A;  2WB1 E;  3J80 E;  1NMF A;  2EYL A;  3S15 B;  4GN4 B;  1JWS D;  3K7A B;  5DM7 3;  4JI2 L;  4EQN A;  3H91 A;  4MNO A;  3W3A A;  2YTX A;  2HDM A;  3I72 A;  4K0K Q;  1G6P A;  4BY7 H;  2M9V A;  4OX9 L;  2OF1 A;  3BZK A;  3BZD B;  2A73 B;  4C3H B;  4ZKB B;  4PV1 C;  4R4Q A;  1KQS A;  1N34 Q;  4A3D B;  1LYL A;  3GTK H;  3R2I A;  1PHJ A;  5FO8 B;  3KBG A;  5D14 A;  3TS0 A;  1DJR D;  1MSG A;  4C2M B;  1U9R A;  3HOY H;  2R92 B;  1YVC A;  2K1B A;  3M4O H;  2B2V C;  4TSS A;  5F2D A;  2IT1 A;  3KOJ A;  2A69 D;  2HQE A;  1KLG D;  1SE2 A;  5KNB A;  1S4Z A;  1YJW A;  1I5F A;  4YY3 Q;  5FLX E;  1HNZ Q;  5CV6 A;  5CV9 A;  2F52 A;  2ZJR A;  1J8I A;  4K8I A;  2JA7 G;  2K6A A;  1PZK D;  5FOB B;  2JA9 A;  4B3T L;  5GQO A;  3PIP 3;  1M8A A;  1VQD A;  1SMY C;  1PFM A;  1KD1 C;  1TT2 A;  3MWY W;  2R93 G;  3RZD H;  3BDL A;  4JPB W;  5C4Z A;  2MHV A;  3CF5 A;  3GDE A;  3HOU G;  3GTL B;  3NBH B;  4JI2 Q;  1Q8I A;  1PH8 A;  1GHJ A;  2RSN A;  2F0I A;  3GP7 A;  1DON A;  1D6E C;  3DWP A;  3NP8 A;  4RWS C;  1YZ6 A;  3CP0 A;  1U4R A;  1CI3 M;  3CCL A;  2K33 A;  5EPJ A;  1ET6 A;  2F0N A;  1Y8P B;  5IYD H;  1K8A C;  2UXB L;  4LUO A;  3TP8 A;  3DM1 A;  1HCZ A;  2Z4H A;  1R4P B;  2F0G A;  2CKZ B;  3Q24 A;  4P71 A;  4JCV E;  3HKZ B;  4L6T B;  1S5C D;  1RDP D;  1S5F D;  3PO2 G;  2WKD A;  4M8A A;  4PG3 A;  2F3V A;  2JA8 G;  2EDG A;  1IW7 C;  1CFM A;  3D6C A;  2D62 A;  1S5D D;  1VQM A;  1RTN A;  5I9O A;  2NN6 I;  4OO1 I;  4RCN A;  1R4Q B;  4OGQ C;  1RJT A;  3P75 A;  3JAM E;  1MBY A;  4B3T Q;  4ULL A;  4AYB G;  3HOX H;  1KDB A;  4QIW E;  5G3L F;  5C4X H;  4A3C H;  4A3I G;  2JP1 A;  3T16 A;  4DNR B;  3SGI A;  3PGZ A;  4FF3 A;  3ERO A;  1S5E D;  4RKB A;  1Q82 C;  1EIH A;  4A93 H;  4PZ8 A;  2N3S A;  2E75 C;  5CV8 A;  3GTM H;  1HTL D;  2PQE A;  4UP7 A;  4GOP A;  3OWF A;  2EJG C;  3SHL A;  3KBX A;  4PMB A;  2L0C A;  3NBI A;  4C3J H;  2PNR C;  3RR5 A;  4HCE A;  4J1M A;  1XX8 A;  2KBN A;  1KRT A;  1Z9F A;  1XMQ L;  4X65 Q;  2UXB Q;  4IN3 A;  3BVM A;  4MHE A;  2F0Q A;  4DU9 A;  1EWC A;  5IP9 G;  5G3L D;  4O42 A;  1YJ9 A;  2B39 A;  4OO1 G;  4POG A;  3OIP A;  3VYU A;  2JEA I;  1C7Y A;  4JI6 L;  1EYD A;  3P1H A;  4DR2 L;  1FR3 A;  1SYB A;  4UDU C;  4IPH A;  1AZP A;  1O78 A;  1PTO H;  3GTG B;  1WCM G;  4IQZ A;  3U4Z A;  4GOP B;  2KVM A;  4AIM A;  2VNU D;  4Y52 H;  2WII B;  2A19 A;  1ROD A;  3EA6 A;  4A3E G;  1BF4 A;  4Q0F A;  1ICF B;  3GTL H;  3LWE A;  3H0G B;  3TS2 A;  2Q2H A;  2L4N A;  1SE3 A;  3D4D A;  1I4H A;  2OEO A;  5FLX c;  1I50 B;  3CPW A;  4V19 0;  3PUV A;  1SE8 A;  2NVY B;  2A68 C;  4CHT B;  3TRE A;  1D1I A;  1ICW A;  3GTO H;  1NCV A;  1HH2 P;  3ERS X;  4QIW B;  2NVT B;  3S1M B;  2WAQ G;  1EY6 A;  3I2Z A;  3K7A H;  1HQR D;  1RD9 D;  4DNI A;  4DXG A;  3PUW A;  4LF4 L;  3MEF A;  1HZ9 A;  5L37 A;  2Z1C A;  2VUM B;  1GVP A;  1WJJ A;  4A3G G;  1A3T A;  2FXQ A;  5IYC G;  1PH2 A;  4A3M G;  1XMQ Q;  1SYD A;  2MGS A;  2F4V L;  4ZCK A;  3CCM A;  1STB A;  3J80 L;  3K5N A;  1TR5 A;  1QNU A;  2D0O A;  4A3D H;  4GKJ L;  2IX1 A;  4HJ7 A;  3D4W A;  3TQY A;  1PH5 A;  3X3N A;  1N36 L;  1Z47 A;  3CKI B;  4HAE A;  1QZH A;  4JI6 Q;  4C2M H;  4H44 C;  3ZYY X;  4LMQ D;  2AUJ D;  2R92 H;  3TSS A;  4IOA A;  5ELC A;  1HQM C;  3KLS A;  1LTL A;  4DK6 C;  2PZU A;  4LF9 L;  3OHX C;  1CQV A;  3M7N A;  1DZ1 A;  4DV4 L;  2N49 A;  3BU2 A;  2JYO A;  3K80 C;  4BBS B;  4JOI C;  1VQ4 A;  1G51 A;  1TWH B;  1BO0 A;  3ZJY C;  1RCV D;  1E1T A;  3K58 A;  4A3J B;  4Y7N B;  2KQ3 A;  5IYB H;  3U9O A;  3QR8 A;  3H15 A;  2SNS A;  1HZC A;  2G9D A;  2WP8 J;  3LGJ A;  1CQF A;  3D4R A;  1MJE A;  2X69 A;  2F0W A;  3I4N G;  2RVL A;  3KLR A;  4LF4 Q;  1I3Q B;  1MJC A;  1B9M A;  4FXG C;  4A3L G;  1ESF A;  2F4V Q;  3FPU B;  1AP0 A;  1CKM A;  4G7O C;  1IHZ A;  4LF8 L;  1CHQ D;  5EKI A;  3L2P A;  5JPN C;  1F2Y A;  2JA6 B;  2F0S A;  1SN8 A;  1EYC A;  1VMC A;  3AEV A;  4GKJ Q;  1GUT A;  1BCP B;  3TDQ A;  4DR4 L;  4EQO A;  1A63 A;  1N36 Q;  1DOL A;  2ICE C;  2BOS A;  2NTS A;  5KYI A;  5GAE C;  4DV5 L;  4C3I G;  4XYO A;  5AFW A;  1PYW D;  2ID0 A;  3ULJ A;  2JSO A;  5FLM H;  3U58 A;  4LF9 Q;  3C1E A;  3PIP A;  4DV4 Q;  2AUK A;  2PI2 E;  1XNQ Q;  3KLS X;  4KKS A;  4HID A;  5JVG 3;  2EYJ A;  2CWA A;  4TVA B;  4RKL A;  2A68 D;  1WTW A;  3CQZ B;  4BBR H;  4QUF A;  3S1Q B;  1SE4 A;  3K5O A;  4JI4 L;  1B8A A;  5JJK A;  3PO3 H;  2J0T D;  1F9Q A;  4WJW A;  4QQB X;  4JI0 L;  2K28 A;  1D5X C;  1QJO A;  4HSV A;  3CRK C;  4RGT A;  2K01 A;  1Q12 A;  5IGC A;  1HA6 A;  5BN4 A;  1QVF A;  4KJO A;  5IOC A;  3K5M A;  4EQ5 A;  1VQJ A;  3NEL A;  1X3G A;  2PI2 A;  3U9S A;  4GLV B;  4XQN A;  4LF8 Q;  1PDQ A;  4EX5 A;  3S14 B;  4N8X 1;  3HOW G;  4XDX A;  1CA6 A;  3HOV B;  3S16 H;  1IYV A;  3D3R A;  4U67 3;  1OXX K;  3SK5 A;  5C3E H;  4KD4 A;  3ULL A;  1HTP A;  4DV5 Q;  3BVG A;  4DKA C;  3UDG A;  4RHS A;  3I90 A;  2OWO A;  3A5Z B;  3S2D B;  5EJW A;  4F8M A;  3QIA A;  2PYK A;  1CZG A;  2MO1 A;  3GTG H;  3SK8 A;  3KF6 A;  4DGZ A;  4JBJ A;  4NXM L;  3BYT B;  3H94 A;  4FXD A;  3VYR A;  5AJ3 L;  3MAQ A;  1C4Q A;  3NUC A;  2NVX H;  3OPO A;  1CTM A;  4JBK A;  2EYO A;  2JA5 B;  1IBK L;  2CQA A;  2F3W A;  4IUP A;  1EY0 A;  3H0G H;  4JI4 Q;  1I50 H;  2NYZ D;  2ZTD A;  2UU9 L;  1S72 A;  2OXP A;  2EYH A;  3O13 A;  2ASB A;  4V0B A;  4B3S L;  4AYB E;  4A3K H;  1RIP A;  5DEH A;  3NQI A;  1SRU A;  2NVT H;  5JEA J;  4XXE A;  3WOF A;  4CDC C;  3S1M H;  3BZC A;  2MUY A;  5CBE E;  4FVM A;  4BY1 G;  4A3F G;  1B44 D;  2K7V A;  1HRJ A;  5EBC A;  3K57 A;  2R93 B;  4BA2 I;  3OYY A;  3TZD A;  5CV4 A;  1NSN S;  5M3F G;  5D65 A;  3HOU B;  4IOC A;  1H95 A;  1I4R A;  4DV1 L;  5GAH C;  4DAV A;  2Q8R E;  2PNH A;  2RHS B;  5C0X G;  2X6L A;  3MFY A;  1AN8 A;  2X6G A;  3OIQ A;  3HP3 A;  1BVS A;  1LTT D;  3BYY B;  1VQ9 A;  5GAD C;  2GA4 B;  4KHV A;  2HIX A;  3OW2 A;  1N8R C;  4X3K A;  1RHP A;  3K7U C;  2E2D C;  1KIX A;  4A4I A;  3I73 A;  5AJ3 Q;  3E9I A;  5IP7 H;  2A1A A;  1VF5 C;  4Q5V A;  1YHQ A;  1IBK Q;  2BE5 D;  5FJ8 G;  1TWC B;  2L5T A;  1KAB A;  3FRP B;  3PCO B;  3V2T A;  4OWW B;  3PO2 B;  2UU9 Q;  4KK7 A;  4RHR A;  1GXD C;  3MXN A;  4J15 A;  4Y7N H;  2HD3 A;  2PCF B;  4DK1 A;  4B08 A;  2EYM A;  1V1P A;  5DAU A;  3I70 A;  2ENB A;  5ELB A;  1X3P A;  3CPF A;  2JJQ A;  5E1F A;  3G6J B;  3VR2 A;  2Z0S A;  2H4O A;  1E2W A;  1HZA A;  2XWB B;  3ITP A;  1F77 A;  2H1E A;  3V96 A;  2AQ2 B;  1IL2 A;  1AH9 A;  2LSS A;  2NZH A;  2WAQ E;  5FO9 B;  2R7Z B;  5CC4 A;  5CR3 A;  5HUR A;  3F1Z A;  1ZYR C;  3MXG A;  3HEJ A;  2A69 C;  2BH8 A;  1M90 C;  4PNY A;  3KYH C;  4LFC L;  1KNE A;  4IFD I;  4DV1 Q;  1EFW A;  1VQ5 A;  4O2D A;  1WTH A;  2ZTE A;  1FD7 D;  1SNQ A;  2F4I A;  3HRZ C;  3E6Z X;  2IX0 A;  3FHW A;  1GOZ A;  4LFA L;  5E4W C;  1Q86 C;  4F88 A;  2LY7 A;  1F2Z A;  2B63 B;  4KY6 A;  2F3I A;  1TWF B;  2F03 A;  1PFB A;  1KC8 C;  1IXR A;  1TVX A;  1EYG A;  4LF6 L;  2K5Q A;  1V1Q A;  3OWE B;  3HGB A;  1SYG A;  1T5X D;  1AE3 A;  3LX0 A;  1GO3 E;  4DUY L;  2IWH A;  2VQE L;  2IPK D;  4UHV A;  1WTQ A;  3FKI G;  3KDF B;  2Q2I A;  2PZW A;  4RCO A;  2GVA A;  1TS4 A;  2B2T C;  4YCV A;  4R9W A;  3J81 j;  1EEF D;  5CYU A;  1TQO A;  1KTK A;  2N55 A;  3EVQ A;  1B9N A;  5COY A;  2TSS A;  1W2B A;  3CQZ H;  1U4P A;  1E22 A;  1G2T A;  2EJF C;  3S1Q H;  1KXL A;  1WCM B;  2F1M A;  3IL8 A;  4YHH L;  3JC6 6;  2UUA L;  1O7Y A;  4GN3 B;  1QUQ A;  1K8O A;  2K04 A;  1BBU A;  3V05 A;  1WD0 A;  3DEO A;  4RG1 A;  2ZXP A;  3TBI B;  1FVI A;  1II3 A;  3RZO B;  2RCF A;  4WOR A;  5M3M G;  1JOO A;  5BN5 A;  1PZI D;  3S1N H;  1Y1V B;  1EY8 A;  4PZ7 A;  1G2S A;  1TS5 A;  2XSC A;  1PH1 A;  1E7Z A;  2M2L A;  5ELF A;  3J81 L;  4IPC A;  3S14 H;  1W3S A;  1WTR A;  1NTG A;  2AWO A;  1CM9 A;  1IKM A;  4P72 A;  3SVM A;  3I4M B;  1A15 A;  5LL6 X;  4B3M L;  4QCL A;  2KEN A;  3HOV H;  1RKN A;  2KHI A;  2WKC A;  4LFA Q;  4P73 A;  4QJF A;  2RA4 A;  1XPU A;  4A3G B;  4Z9C B;  4LF6 Q;  4A75 A;  2H5X A;  1MGS A;  5C44 B;  1QUQ B;  3I7F A;  4KN4 C;  3S2D H;  4YWK A;  4CKB A;  4DUY Q;  1PRT C;  2OQ0 A;  2JXM B;  2VQE Q;  2CHB D;  2MO0 A;  4FF4 A;  2RDF A;  5H1S E;  3CXC A;  1EY7 A;  3NWT A;  2JA5 H;  3KJP A;  3RLO A;  4OXP A;  5HGQ A;  3H3V H;  2NZ1 D;  2PMZ B;  1DM0 B;  1D7Q A;  3SK6 A;  1C48 A;  3N52 A;  1XPO A;  1Q81 C;  1TWA B;  1G29 1;  2UUA Q;  5E4X A;  1X55 A;  1JOQ A;  4JW0 A;  2N8N A;  4RGO S;  3P20 A;  1TY2 A;  1GUN A;  4ZAI A;  1L1O C;  1NNX A;  1X54 A;  2MP1 A;  5JJZ A;  2VQF L;  3DM3 A;  1TS3 A;  4DV7 L;  4JC0 A;  4BY7 G;  3M3Y H;  5C4J B;  1ZYR D;  1SYE A;  4XQQ A;  1G8Z D;  3VR3 A;  2EOT A;  2K5N A;  3STB C;  4B9W A;  4C1N K;  4BA1 I;  2UXD L;  2R93 H;  4JOI A;  3A54 A;  4CKE A;  1Q46 A;  1PH4 A;  3I4N B;  4B3M Q;  3ICE A;  3DWA A;  1JE5 A;  4QMG A;  5I2X A;  1C9O A;  2O5J C;  4ODG A;  1X9N A;  2E2J H;  3HOY G;  1AZQ A;  1L0Y B;  5GAG C;  2SDF A;  5DM6 3;  2HUG A;  2DNE A;  2A6H C;  1JJ2 A;  2WB1 B;  4DUZ L;  2F0E A;  4JYA L;  1XTC D;  1A2U A;  2R7F A;  1NUC A;  4OX9 Q;  1QZG A;  4DAM A;  4ABN A;  4ILW A;  3G48 A;  5IT9 E;  4G7H C;  1TWC H;  4C3I B;  5IGF A;  5M5W B;  5JPM C;  3PMF A;  2L15 A;  4FF2 A;  1Z6H A;  3AQQ A;  2KJX A;  3BS1 A;  5K36 H;  1FYC A;  4DAP A;  2EXZ A;  5JJL A;  2R61 A;  1VQA A;  1JB3 A;  1PRT F;  2F0P A;  2VQF Q;  1HNW L;  1VF7 A;  3IAY A;  1S40 A;  1N32 L;  3CAM A;  3Q6S A;  3NEN A;  1VQC A;  2E76 C;  2E2H H;  2UXD Q;  5IYD G;  4X3S A;  1VQO A;  2R7Z H;  3S24 A;  5EQ0 A;  2DJF C;  1LTB D;  2UUC L;  1EL0 A;  1SR3 A;  3VYS A;  4IFD J;  4L5T A;  1MIU A;  1AFP A;  4HJ9 A;  5J39 A;  2B63 H;  1SNM A;  1TWF H;  1YHB A;  1PRT D;  1Y14 B;  1XMO L;  1BUV T;  3J80 c;  4DUZ Q;  1Y1W H;  3DWQ A;  1GKH A;  4JYA Q;  3AFP A;  3S1R B;  3PSI A;  3U4V A;  2I46 A;  4CJ2 C;  2M00 A;  3NEM A;  2YTV A;  1EQR A;  1CK1 A;  2NN6 H;  1P16 A;  4OO1 H;  1PTO C;  1K0R A;  3HOX G;  4A3C G;  1YHA A;  5C4X G;  1EU3 A;  2K03 A;  1LTI D;  2K5W A;  2O4X A;  3VA7 A;  3A8J E;  3L9A X;  4A93 G;  1VQH A;  5ELE A;  4K8J A;  2D0P A;  1VQ6 A;  1A62 A;  1HR0 W;  2PQA A;  3OTO L;  4OEM B;  1WOC A;  1U0L A;  1LLR D;  4G4K A;  3LNN A;  1DD2 A;  4KI0 A;  4PMC A;  2L1B A;  2UXC L;  3WWV A;  4C3J G;  1IYJ B;  3STB D;  2WIN B;  1N32 Q;  4UP8 A;  1Y1V H;  1B3A A;  1Y8N B;  1TII D;  1IBL L;  1CHP D;  3C1F A;  2UUC Q;  3UDF A;  4CDE C;  5IGD A;  2EIF A;  4P2C B;  3GTJ B;  4XYQ A;  3I4M H;  3GV3 A;  1M1K C;  1HPC A;  4FDB A;  3QJY A;  5BR8 L;  3BVZ A;  4F87 A;  3J7A F;  3K6O A;  1E0B A;  2A6H D;  4BY1 B;  4A3F B;  5KYL A;  2I0Q A;  5IIF A;  3HOZ G;  2F0V A;  3LWU A;  1XMO Q;  1VQL A;  3S15 H;  3CCJ A;  5C44 H;  1OTC A;  4DR6 L;  4E6I A;  5M3F B;  1LT6 D;  2F0O A;  1VS0 A;  3GQB A;  1UE1 A;  2XWJ B;  4RFB A;  2G9H D;  1NAP A;  1SFO B;  1WFQ A;  1F2L A;  4C3H H;  1LTR D;  1D5Z C;  5C4H A;  1CT1 D;  1LTA D;  2CW0 C;  4CJ0 B;  4JI3 L;  1V8Q A;  1SNC A;  3D0F A;  3OMG A;  1ZEQ X;  3F2B A;  2K52 A;  3D6W A;  1D8L A;  5T1I A;  3OTO Q;  4DR2 Q;  2B2U A;  2LMC B;  2DUD A;  1SMX A;  5JEA H;  2EYP A;  2UXC Q;  2QA4 A;  2BH2 A;  3KF8 A;  4IUR A;  1UAP A;  4DV0 L;  1PTO F;  2N88 A;  5KNC A;  2PO4 A;  4FP5 D;  1IBL Q;  1Y69 U;  3I4O A;  1U4L A;  1XXG A;  3G7L A;  3HFZ B;  4X64 L;  3MXP A;  1X32 A;  2EE1 A;  4OIJ A;  3W1G A;  1HR0 L;  4A3D G;  4WJ4 A;  3AMU A;  4G57 A;  4RH6 A;  1Q7Y C;  1UEB A;  3Q23 A;  4DF7 A;  3JAM c;  1FNU A;  1LAB A;  1XTD A;  1IYU A;  3OOC A;  4XT1 B;  4R8N A;  2K14 A;  4K2L A;  1F9S A;  4DK3 C;  5NUC A;  3TP6 A;  3EQL C;  4QL5 A;  1HNX L; 
#chains in the Genus database with same CATH homology
 1X3F A;  2C35 B;  3BZC A;  3M85 A;  4IPG A;  4KHZ A;  2MFI A;  3UE0 A;  1CSQ A;  2E5L L;  4DR6 Q;  1X6O A;  4BY1 G;  4A3F G;  2VS1 A;  3U50 C;  4YY3 L;  2HHH Q;  2I5L X;  3FP9 A;  1HNZ L;  1VQ7 A;  1BBW A;  4BA2 I;  3PUX A;  3H3V I;  2GN5 A;  3KF8 B;  5IP9 H;  3F2C A;  3OYY A;  1V43 A;  2ZM6 Q;  3CME A;  5M3F G;  1KHI A;  2CQO A;  2K5H A;  3AFQ A;  4DV1 L;  5GAH C;  4IOC A;  4XTC S;  2HQL A;  5EAY A;  4JI3 Q;  2Q2U A;  1H95 A;  1TWG H;  3W5O A;  2PNH A;  5IYB G;  4DR7 L;  1E3P A;  2RHS B;  2WB1 E;  5C0X G;  4GKK Q;  4YWL A;  5IE8 A;  4UPA A;  3I56 A;  5M5W H;  1NMF A;  2GVB A;  1BVS A;  4GN4 B;  4JI2 L;  1VQ9 A;  2CWP A;  1V9P A;  2UUB L;  4MNO A;  5GAD C;  2AWN A;  1WCM H;  2YTX A;  2HIX A;  5J3B A;  3OW2 A;  3RN2 A;  2B63 G;  3J81 i;  4K0K Q;  1N8R C;  1G6P A;  4BY7 H;  2QGQ A;  1Y1W G;  4OX9 L;  4OWX B;  3BZK A;  3K7U C;  3ULP A;  4A3E H;  1HNW Q;  1KIX A;  4DV0 Q;  4A4I A;  3RZO H;  2RHQ B;  1Q1E A;  4R4Q A;  3E9I A;  5AJ3 Q;  2KCM A;  4NB3 A;  5IP7 H;  2A1A A;  1KQS A;  1N34 Q;  1YHQ A;  4JI5 L;  1IBK Q;  1LYL A;  3CC7 A;  4X64 Q;  2NN6 G;  2HHH L;  5FJ8 G;  3GTK H;  1VQG A;  2VZA A;  1PHJ A;  1HR0 Q;  3G4S A;  1VQE A;  1OXS C;  2K4K A;  3PCO B;  4P75 A;  3TS0 A;  4OWW B;  2UU9 Q;  4NXN L;  1XNR Q;  3GTQ H;  4H02 A;  4J15 A;  4Y7N H;  1K8G A;  4KHP L;  2JQO A;  1N9W A;  3HOZ H;  4MZ9 A;  3HOY H;  4OON A;  3A5U A;  1YVC A;  3M4O H;  4LUZ A;  1FJG L;  3CPF A;  4YWM A;  3HKZ G;  2JJQ A;  1HNX Q;  2Z0S A;  2XGT A;  4LF7 L;  2EXD A;  1Q8K A;  2IT1 A;  1J5E L;  2E5L Q;  3KOJ A;  5FLM G;  4GLX A;  1HZA A;  4A3G H;  5IYC H;  1YJW A;  4A3M H;  1I5F A;  2PQA B;  4YY3 Q;  1IL2 A;  2AMC B;  1WI5 A;  1HNZ Q;  1SLJ A;  2F52 A;  2ZJR A;  2LSS A;  4L5S A;  2NZH A;  2WAQ E;  3HKS A;  1R9T H;  1AH9 A;  1Y1V G;  3PUZ A;  4PZ6 A;  1CKN A;  2HIV A;  2JA7 G;  3F1Z A;  4B3R L;  2BH8 A;  4R4O A;  1L2F A;  2JA9 A;  1M90 C;  4B3T L;  3KYH C;  4LFC L;  4IFD I;  2I5H A;  3Q8D A;  4DV1 Q;  5GQO A;  1EFW A;  1VQD A;  1VQ5 A;  4O2D A;  1KD1 C;  1A0I A;  4BBR G;  1OXU A;  3RZD H;  2R93 G;  2ZTE A;  1JB7 A;  4JI7 L;  5IWA L;  3PV0 A;  4L5Q A;  4APV A;  3I4M G;  2IX0 A;  3FHW A;  4DR4 Q;  3CF5 A;  3GDE A;  4LFA L;  3HOU G;  3M9B A;  3NBH B;  4JI2 Q;  1Q86 C;  2OCE A;  1PH8 A;  3PO3 G;  2UUB Q;  2F3I A;  1YBY A;  3GD7 A;  1IZ6 A;  1IXR A;  1EWI A;  5IT9 c;  1KC8 C;  4DV2 L;  1TWA H;  1EYG A;  4LF6 L;  3PIO A;  1V1Q A;  1YZ6 A;  3CP0 A;  1GM5 A;  3CCL A;  1PYS B;  5C44 G;  1AE3 A;  4GN5 A;  1GO3 E;  4DUY L;  2VQE L;  4DR3 L;  4LF5 L;  3FKI G;  2ZJP A;  3KDF B;  2Q2I A;  4YCW A;  4HJ8 A;  3T1H L;  1ASZ A;  2GVA A;  4AQY L;  2ES2 A;  1X65 A;  5IYD H;  5C0X I;  1K8A C;  4DV3 L;  4JI5 Q;  2UXB L;  5C4J H;  4L5R C;  4YCV A;  4LUO A;  3J81 j;  2LXJ A;  3UDX A;  2IY5 B;  1CKN B;  3CC2 A;  3J7A 5;  4NXN Q;  1W2B A;  3CQZ H;  2CKZ B;  1E22 A;  4LW1 A;  2LXK A;  5E7N A;  4P71 A;  3S1Q H;  2CFM A;  4R4I A;  4KHP Q;  1KXL A;  4YHH L;  3JC6 6;  4JCV E;  3CC4 A;  2UUA L;  3I4N H;  4GN3 B;  1QUQ A;  5C3E G;  1K73 C;  2NVY H;  1P8L A;  4IJH A;  5BR8 Q;  3PO2 G;  3G71 A;  1FJG Q;  1BBU A;  4JI0 Q;  1LM0 A;  4RG1 A;  1VQ8 A;  1VQB A;  4A3F H;  1FVI A;  4LF7 Q;  4PG3 A;  1J5E Q;  2JA8 G;  1XNQ L;  3J80 i;  2R92 G;  2D62 A;  5M3M G;  5JEA G;  1VQM A;  1N33 L;  1L1O A;  3S2H H;  4UY8 C;  3S1N H;  2NN6 I;  1PV4 A;  4A3L H;  4OO1 I;  4PZ7 A;  4MTN A;  2VUM H;  2JE6 I;  4LNQ A;  1PH1 A;  1E7Z A;  4B3R Q;  4IPC A;  1PA6 A;  3S14 H;  3UE1 A;  3KF6 B;  4B3T Q;  1W3S A;  2WFW A;  4AYB G;  1NTG A;  2AWO A;  3HOX H;  5GRO A;  4QIW E;  5C4X H;  1JMC A;  1SFO H;  4A3C H;  1NY4 A;  4P72 A;  4A3I G;  3H0G G;  4GNX A;  3SGI A;  3PGZ A;  2AKW B;  4B3M L;  4JI7 Q;  5IWA Q;  2KEN A;  1TXY A;  1YIT A;  1Q82 C;  3HOV H;  2KHI A;  4PZ8 A;  2N3S A;  4LFA Q;  4A93 H;  2V1C C;  3CW2 C;  1AE2 A;  4P73 A;  3GTM H;  4HIK A;  4QJF A;  3PF5 A;  3KFU A;  4C3I H;  1XPU A;  4UP7 A;  4GOP A;  4DV2 Q;  4A3K G;  5DLQ E;  4A75 A;  1NMG A;  2H5X A;  2CCZ A;  4LF6 Q;  4PMW A;  1QUQ B;  3I7F A;  3CCS A;  1NE3 A;  4HIO A;  3S2D H;  2R7D A;  1BKB A;  3L7Z C;  4C3J H;  4YWK A;  1CUK A;  4DUY Q;  2OQ0 A;  3RR5 A;  1CKO A;  2VQE Q;  4DR3 Q;  4LF5 Q;  2KBN A;  2WB1 G;  3PUY A;  1KRT A;  3T1H Q;  1Z9F A;  1XMQ L;  4AQY Q;  4NXM Q;  4X65 Q;  4DV3 Q;  2UXB Q;  2MO0 A;  5H1S E;  4R4T A;  5IP9 G;  3CXC A;  4BBS H;  4LFB L;  2JA5 H;  4JBM A;  3KJP A;  3RLO A;  4OXP A;  2B3G A;  5HGQ A;  1YJ9 A;  3H3V H;  4POG A;  4OO1 G;  1TWH H;  3GO5 A;  1D7Q A;  3I55 A;  1XPO A;  4DR5 L;  1EQQ A;  4A3J H;  1Q81 C;  1YEZ A;  1G29 1;  3A74 A;  2UUA Q;  2JEA I;  1OXV A;  1C7Y A;  1KAW A;  1X55 A;  4JI6 L;  3K8A A;  4DR2 L;  4B3S Q;  2N8N A;  4IPH A;  4DPG A;  1E1O A;  3E0E A;  2E8G A;  1WCM G;  4GS3 A;  5LMN W;  2EQS A;  1L1O C;  3J81 c;  3U4Z A;  4GOP B;  1X54 A;  1N33 Q;  4AIM A;  2VQF L;  3DM3 A;  2VNU D;  4DV7 L;  4JC0 A;  4BY7 G;  4Y52 H;  3M3Y H;  4O0A A;  1X3E A;  1I3Q H;  2A19 A;  4A3E G;  1EUJ A;  1YNX A;  4DV6 L;  1B7Y B;  3T1Y L;  5IP7 G;  3GTL H;  1FGU A;  2K5N A;  3STB C;  3S1R H;  3HOW H;  4BA1 I;  2ZJQ A;  2Q2H A;  3TS2 A;  4JOI A;  2UXD L;  2R93 H;  2XTI A;  3F2D A;  4TQU S;  3CPW A;  5FLX c;  1Q46 A;  1PH4 A;  1PH9 A;  4HJ5 A;  3PUV A;  3CCE A;  4B3M Q;  1J6Q A;  1SE8 A;  1A8V A;  2VY3 A;  4ALP A;  3ICE A;  3TRE A;  2JA6 H;  2BA1 A;  3GTO H;  4DR7 Q;  4R1J A;  1HH2 P;  1JE5 A;  2Y0S E;  3ERS X;  4GOP C;  5JJI A;  1C9O A;  3CD6 A;  5LMU L;  1X9N A;  2RF4 A;  2E2J H;  3HOY G;  1QVG A;  2VW9 A;  5GAG C;  2WAQ G;  3I2Z A;  4JBW A;  4A3B H;  3K7A H;  4DNI A;  3PUW A;  1UE6 A;  3MXN B;  4LF4 L;  4BXX H;  1SRO A;  1K3R A;  3MEF A;  1HZ9 A;  1XPR A;  1GVP A;  1LUZ A;  1JJ2 A;  1WJJ A;  2JK8 A;  4DUZ L;  2BA0 A;  4JYA L;  4A3G G;  5M5Y H;  2FXQ A;  2R7F A;  5IYC G;  1PH2 A;  2K75 A;  1JJG A;  4OX9 Q;  1YI2 A;  4A3M G;  4DR1 L;  4QGU A;  1XMQ Q;  1QZG A;  1EIY B;  2F4V L;  4QY7 A;  3CCM A;  4DAM A;  4JI1 L;  1HZB A;  3G48 A;  1CSP A;  1UE5 A;  4LFB Q;  2D0O A;  4A3D H;  3L0O A;  1VQP A;  4OWT B;  3ER0 A;  1TWC H;  4GKJ L;  1PFS A;  3M4Q A;  2YU9 H;  2HT1 A;  2IX1 A;  4HJ7 A;  2Z6K A;  3TQY A;  1PH5 A;  4DR5 Q;  2L15 A;  3K81 C;  3JAM i;  1JJC B;  1Z47 A;  1N36 L;  3AQQ A;  1QZH A;  4JI6 Q;  4C2M H;  3GTJ H;  3RNU A;  5JJL A;  3CMA A;  3RN5 A;  2R92 H;  4IOA A;  4XIG S;  1UWV A;  1VQA A;  4DK6 C;  1LTL A;  1VQN A;  4LUV A;  4BY1 H;  4LF9 L;  2VQF Q;  1PH6 A;  1HNW L;  4AH6 A;  1PH3 A;  3M7N A;  4DV4 L;  2N49 A;  1S40 A;  3BU2 A;  4RMF A;  3K80 C;  4LWC A;  3CCQ A;  1I94 L;  1N32 L;  2KHJ A;  1VCI A;  2RCN A;  4DV6 Q;  3T1Y Q;  3CAM A;  4X62 L;  4JOI C;  1XJV A;  1VQ4 A;  3NEN A;  1G51 A;  1VQC A;  4R4C A;  2E2H H;  5IYD G;  5M3F H;  1VQO A;  2UXD Q;  2R7Z H;  2IHF A;  3S24 A;  3ZJY C;  1E1T A;  3W1B A;  1DGS A;  4LFC Q;  1JT8 A;  2UUC L;  1SR3 A;  5IYB H;  2R6G A;  4IFD J;  3H15 A;  5LMN L;  1HZC A;  1K9M C;  2WP8 J;  4IPD A;  4L5T A;  1MIU A;  2E2I H;  3LGJ A;  1MJE A;  3B6Y A;  5LMU Q;  2Q2T A;  3I4N G;  1I6H H;  4HJ9 A;  3EIV A;  4KLK A;  1L0W A;  3K0X A;  2B63 H;  4LF4 Q;  3BJU A;  1TWF H;  2AHO B;  1YHB A;  3KJO A;  1MJC A;  1Y14 B;  3EBE A;  1O7I A;  1XMO L;  3J80 c;  4DUZ Q;  1Y1W H;  4JYA Q;  1GKH A;  3AFP A;  3PSI A;  4IJL A;  2ALY B;  3U4V A;  4DR1 Q;  2OTL A;  4A3L G;  2F4V Q;  4IO9 A;  1CKM A;  3NEM A;  3CCR A;  4X6A H;  2VUM G;  4LF8 L;  2YTV A;  4JI1 Q;  1EQR A;  1RL2 A;  3L2P A;  4WJ3 M;  1L1O B;  5FJ8 H;  1P16 A;  1K0R A;  3HOX G;  1SN8 A;  5C0X J;  2R7Z G;  3AEV A;  4A3C G;  1YHA A;  5C4X G;  2VL6 A;  2Z6K C;  4GKJ Q;  1VQF A;  1KL9 A;  4DR4 L;  1NBW A;  1K83 H;  1A63 A;  1N36 Q;  4JG2 A;  4P74 A;  3HOV G;  2MNA A;  4A93 G;  1VQH A;  2K50 A;  4JI8 L;  3CCU A;  3AYH B;  5GAE C;  4YHH Q;  4HIM A;  1YIJ A;  4DV5 L;  1NJI C;  4GNX B;  2D0P A;  3EN2 A;  2NZO A;  1VQ6 A;  1A62 A;  1HR0 W;  2PQA A;  1VQK A;  4JV5 L;  3OTO L;  1YJN A;  1WOC A;  1U0L A;  2YYZ A;  2ID0 A;  1UE7 A;  3ULJ A;  5FLM H;  3U58 A;  4LF9 Q;  4POF A;  1E24 A;  1B70 B;  4KI0 A;  5HY6 A;  3PIP A;  3PF4 A;  4DV4 Q;  1XNQ Q;  2PI2 E;  3RLN A;  2UXC L;  4NPS A;  3WWV A;  2MQH A;  1IYJ B;  3STB D;  3KLW A;  1I94 Q;  1N32 Q;  1WYD A;  3RLF A;  4UP8 A;  1Y1V H;  4HID A;  3GTP H;  4X62 Q;  3J7Z C;  2CWA A;  4TVA B;  2JA7 H;  3HKZ E;  3DLL A;  1HJP A;  2I5M X;  1IBL L;  3IRB A;  2K5V A;  4BBR H;  2UUC Q;  4BBS G;  4X66 L;  2JA5 G;  3UDF A;  4GNX C;  1PVO A;  5LMN Q;  2EIF A;  4JI4 L;  1B8A A;  3I4M H;  3HOU H;  1M1K C;  4FDB A;  1IBM L;  5JJK A;  3PO3 H;  5BR8 L;  4A3J G;  2DGY A;  3F8T A;  4QQB X;  3E9H A;  4A76 A;  3S1M H;  4JI0 L;  2OTJ A;  2I0Q A;  2KCT A;  1PYB A;  1GD7 A;  3HOZ G;  1Q12 A;  3KDF A;  1XMO Q;  1VQL A;  3S15 H;  3CCJ A;  1QVF A;  5C44 H;  3G6E A;  1OTC A;  4DR6 L;  2YTY A;  4GLA C;  4EQ5 A;  3FKI H;  1VQJ A;  2N78 A;  1VQI A;  1VS0 A;  1X3G A;  1FL0 A;  1S3O A;  2B29 A;  2PI2 A;  1UE1 A;  3NEL A;  4GLV B;  4EX5 A;  4LF8 Q;  2NVQ H;  3S17 H;  2Y0S G;  1Q1B A;  1WFQ A;  4HJA A;  2ZM6 L;  4C3H H;  3HOW G;  3TRZ A;  4JI3 L;  5ELN A;  3S16 H;  1PH7 A;  1C0A A;  3A0J A;  4GKK L;  2JA6 G;  1OXX K;  3D0F A;  4JI8 Q;  5C3E H;  3CCV A;  3ULL A;  3PO2 H;  3F2B A;  4DV5 Q;  4DKA C;  3UDG A;  2ZTC A;  2K52 A;  4JV5 Q;  1D8L A;  3OTO Q;  2OWO A;  4DR2 Q;  4A3B G;  4ME3 A;  3A5Z B;  1ASY A;  2JA8 H;  2DUD A;  1SMX A;  1T9H A;  1OXT A;  2IHE A;  5M3M H;  4BXX G;  2MO1 A;  4UP9 A;  3GTG H;  4K0K L;  2QA4 A;  1X56 A;  1MKH A;  3KF6 A;  2UXC Q;  2BH2 A;  4JBJ A;  2PMZ E;  4DV7 Q;  4NXM L;  4X65 L;  4DV0 L;  3D31 A;  5AJ3 L;  2QEX A;  2A8V A;  2NVX H;  1IBL Q;  1N34 L;  4JBK A;  2OQK A;  3I4O A;  3TEH B;  3HFZ B;  1IBK L;  4A3I H;  1QVC A;  4X64 L;  3H0G H;  4X66 Q;  3W1G A;  2ATW A;  4YCU A;  1HR0 L;  4A3D G;  4WJ4 A;  3VDY A;  4JI4 Q;  1EOV A;  1I50 H;  1XNR L;  2ZTD A;  2UU9 L;  2JEB I;  1IBM Q;  4DAY B;  1U5K A;  3UDI A;  1UEB A;  1S72 A;  1Q7Y C;  3JAM c;  1KRS A;  1XTD A;  2ASB A;  4IFD G;  5ELO A;  4B3S L;  4AYB E;  3M4P A;  4A3K H;  1RIP A;  2YV5 A;  2K14 A;  4DK3 C;  5IY0 A;  5K36 G;  1SRU A;  2NVT H;  1EIF A;  5JEA J;  4QL5 A;  1HNX L;  5M5X H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...