1B44D

Crystal structure of the b subunit of heat-labile enterotoxin from e. coli carrying a peptide with anti-hsv activity
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEKLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PROTEIN (B-POL SUBUNIT OF HEAT-LABILE ENTEROTOXIN)
publication title Crystal structure of the B subunit of Escherichia coli heat-labile enterotoxin carrying peptides with anti-herpes simplex virus type 1 activity.
pubmed rcsb
source organism Escherichia coli
total genus 26
structure length 106
sequence length 106
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1999-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b44D00
1S5BD 1LTID 1SE3A 1TS3A 1XTCD 2J4XA 1JR0D 1B44D 3R8BA 1HTLD 1S5FD 1LTTD 3MC0B 4BWGB 1BCPB 1ET6A 3BYTB 1MD2D 1S5CD 1PRTF 1V1OA 2NTTA 2RDHA 1PYWD 1LT5D 1D5XC 1V1PA 1HQRD 1LT4D 1PRTC 4Z9CB 1DJRD 1JCKB 1SBBB 1RDPD 2RDGA 1ESFA 1SE4A 1I4HA 1D5MC 2TSSA 4K6LA 3BVGA 1BCPF 3BVZA 2IJ0A 1EEID 1LT3D 3BZDB 1JWMD 5FKAC 1FD7D 1SJED 1KLUD 1EU4A 1BCPC 1UUPA 3V05A 1LTRD 1TS2A 1RCVD 1L0YB 2XNAC 3EA6A 1LT6D 4RGOS 1V1PB 2Z8LA 3O13A 4RH6A 1PTOH 2QEJC 4RGTA 2NTSA 1PRTD 1UNSA 1AN8A 1PTOB 1S5DD 4RGMA 1PZJD 4RGNA 1I4QA 1JWSD 1LTAD 1T5XD 1L0XB 4RFBA 1SXTA 4DXGA 1I4XA 1EFID 1RD9D 4RHSA 1SJHD 5D3DA 1HA5A 1STEA 1ET9A 2XRQD 2AQ2B 3URYA 3BYYB 2XRSD 1BCPD 3OWEB 1TS5A 5I4DA 2XN9C 1EWCA 3CHBD 1LTBD 2AQ1B 1FGBD 5ELCA 2SEBD 1KTKA 3SEBA 5D3IB 3DWAA 3R2IA 1FNUA 1S5ED 4RHRA 2IPKD 1D6EC 1TY0A 3MFGA 1EU3A 2QILA 1I4PA 3GP7A 4DXFA 1CT1D 1TS4A 4RCOA 1RF2D 4ZYSA 4C56C 1CQVA 1FNWA 3DWQA 3TSSA 1D5ZC 3DWPA 4OHJA 4TSSA 1FNVA 1JWUD 1M4VA 4UDUC 1CK1A 1XXGA 3R2TA 1LO5D 1KLGD 4L6TB 1CHPD 5FK9C 1TY2A 1PTOF 1ENFA 1F77A 1BXTA 3EFXD 1LLRD 2R61A 2G9HD 5ELFA 1QILA 1PTOD 2WV6D 1PZID 3BVMA 1LTSD 2O2LD 4O1NA 1LTGD 1PTOC 3KLSX 1I4GA 1B1ZA 5ELDA 3W2DA 5ELEA 1PRTB 1SE2A 5ELBA 5TSSA 2AQ3B 1CHQD 1G8ZD 1EEFD 1GOZA 1HXYD 2CHBD 4L63B 1I4RA 1SEBD 1PZKD 1JQYD 2ICIA 1AW7A 1DYQA
chains in the Genus database with same CATH superfamily
1SE3A 3MA2B 4LF9L 1X3FA 3SE0A 5J22A 3I7FA 1LTTD 2D0OA 2YTXA 3MC0B 3KOJA 1PLFA 1BUVT 1UE1A 3CMAA 3I4NH 1YNJD 4IQZA 3OMCA 4AQYQ 1G6ZA 2OQKA 2EXDA 1V1PA 4JI8L 2E2IH 3K80C 5M5WH 1OXUA 2LFNA 3K57A 4PMBA 3CP0A 3B6YA 1I6HH 5M5XB 2NYZD 2WINB 3T1YL 3QG1A 4J6HA 4DR6L 4H13C 3NWTA 1YNND 4IALA 4R4QA 3HOWB 3BVZA 3AFPA 1EEID 3CCEA 2NN6I 4C3IG 3ULLA 4GZYC 3GQBA 3GTKB 1KLUD 3UDFA 3F2BA 1EY7A 1BBUA 2LXKA 4X64Q 1LT6D 4DV4L 4RGOS 3M85A 3C3LA 3GTQB 1YIJA 3M3YB 1CM9A 5C5MA 2PCFB 4BY1H 2L9HA 2ZXPA 4DAVA 1MSGA 1KHIA 4XQQA 4C3IB 4A3LH 2I5LX 5JAVA 4JI0L 3K59A 2XRQD 2LS01 4V0BA 2AQ2B 1A2TA 2XVSA 5BR8Q 3WWVA 1XNRQ 4QQBX 1KDBA 1VQCA 1YI2A 2IHFA 4IOCA 3WOFA 2JA5G 5JEAG 4K6DA 2K75A 1QG7A 2K6AA 3HZXA 1P8LA 1X9NA 1CA5A 1E2WA 4N8X1 3QO2A 4DUZL 1Y1VB 5CGKA 3R93A 4IFDJ 1F2YA 1VMCA 3MFGA 1H9MA 3HOVH 2JA5B 5KNBA 2E2HH 1CT1D 4RCOA 1RF2D 4CHTB 3H3VH 1VF7A 3EJIA 4A3MG 4DKAC 1QVFA 1XXGA 1SNMA 4K5XA 1C48A 1PH4A 1SN8A 1F77A 3UI2A 1AZPA 1DGSA 2AWNA 3F2CA 2PW5A 4LF8L 4QCLA 4DUYQ 3K7AH 1CHQD 5IP7G 2A69C 4A3MB 2HIXA 1PMRA 1C0AA 4L63B 1YJWA 1U4RA 3H0GG 2Z4HA 2ZT9C 4DR7Q 2R7ZB 1S72A 1F9SA 5IT9c 1HTLD 1CKNA 2F0SA 1KRTA 2XIWA 1NY4A 2QF7A 1O7ZA 3OYYA 2ATWA 1PRTF 4OIKA 1UE6A 1YNJC 1G291 3A74A 3MEFA 2EY5A 3H0GB 3PIPA 4GN3B 1I50H 1JCKB 3PUZA 2C9OA 1XMQL 1I4HA 3BDLA 1L0WA 1BNZA 2E8GA 4KTAA 4LWCA 1YNNC 3MXPA 4JC0A 4JOIA 1PFBA 2AHOB 2NWGA 3SXHA 5K5PA 4A3DG 4GLAC 5JOBA 2H5XA 4BBSG 3A7LA 4NP5A 2PZTA 2QW7A 2OTJA 2LY7A 4HIKA 1AN8A 3QOLA 2O5JC 1S5DD 4DV0Q 2TMPA 3HS0C 4CKEA 4QB4A 3JAMi 1KQSA 4F7XA 1RD9D 2KUMA 1STEA 2ICEC 3HKZB 4A3GB 1N33L 2NZOA 5IWAL 3PGZA 1SYCA 2PYKA 3HFZB 4DV2Q 2WB1E 5BN3A 3OW7A 4DV7L 4X65L 1PYSB 3DMUA 1E0BA 4KMUC 1TWHB 3SEBA 1HR0L 4M8AA 4JI2L 4FP5D 4OWXB 3RZDB 3TP7A 1SNCA 2B2UA 5GAEC 4IFDG 2WACA 3MHBA 5LL6S 1SYGA 4KHZA 1IHZA 4LUOA 4RMFA 4LF6L 1TS4A 4X3SA 2HDMA 1DXMA 1GUSA 5I2XA 3RD4A 3I90A 3J7AF 4UDUC 4A3KH 1STAA 1Y1WG 1PFSA 1CHPD 1IYJB 2K5QA 1E22A 2WAQE 1UE7A 1SMYD 2NZ1D 1QILA 3BVMA 4LFBL 3PMFA 4DU9A 4ME5A 4GNXA 4NDXA 2FINB 2RF4A 5T1GA 4CJ0B 3HOUG 4X66L 4DV5Q 3PF5A 1I4RA 2JK8A 2D5DA 1Y1WB 2KECA 1C7YA 3CD6A 3Q8DA 2VY3A 4APVA 1JR0D 1JICA 3FPUB 3ND9A 5M3FG 1RJTA 1S5FD 4YHHL 3K0XA 4GN4B 5M5YB 3AB9A 1PDQA 3OOCA 3NP8A 3BYTB 2VQFQ 2G5DA 1MD2D 1S5CD 2PMZB 3H3VI 4A3BH 1ENAA 3V2TA 2XTIA 4DK3C 4YWKA 1VQGA 1TIID 4C2MB 5EBCA 2V4DA 3GTLB 1SBBB 2YTVA 1SE4A 2HHHQ 2FJ2A 4PNYA 1PH6A 5M3FB 1PH7A 4ZKCB 2TSSA 1DOLA 3FRPB 2B63G 2UXCL 1JWMD 2YU9B 1FD7D 3BZCA 3C2PA 2LXJA 1ZYRC 1BCPC 3IRBA 1ZXTA 1BR9A 5GAHC 1LTRD 2B2WA 2VQEL 4HCSA 2NVXB 3S1QB 4A3FG 1IBKL 2B2VA 4R9WA 4IUUA 2IW3A 2PQEA 1T9HA 1ENCA 3DLLA 4DV6L 1SXTA 2L15A 2KEDA 1I50B 4X64L 2Y0SE 1EY8A 3W3AA 4EQPA 4A3FB 3URYA 3A0JA 1Q86C 4XT1B 3TREA 3K5LA 1SROA 4B3ML 3CCVA 3NBIA 2ZJPA 3RMHA 1WTPA 3KDFA 3MZ5A 1EY6A 1BBWA 5E4XA 2DJFC 3PO2H 1KRSA 3KF8B 1NBWA 1RKNA 2I5MX 2A6EC 3QIAA 1II3A 2EJGC 5CV9A 4DR2L 3S9WA 1G51A 1A0IA 3FDTA 4MTKA 1HZ9A 5FLXL 4DR3Q 4DR1Q 1HNXQ 2A19A 2R92H 4L5QA 4YCUA 1A2UA 3H6MA 2MP1A 1VMPA 3NENA 4E6IA 1VQKA 3SK8A 2DN8A 1JOKA 4NPSA 1FYCA 3LWEA 4HAEA 5IGEA 1RIPA 1SMYC 5FO7B 1KAAA 1HHVA 1KXLA 4IPDA 1SE2A 4EX5A 2FMCA 1S4ZA 1HH2P 2F0WA 1XWEA 2K5DA 1C8CA 2BH2A 1XMOL 5L37A 4IPCA 1A8VA 3G6JB 4HMIA 2DY7A 2ZTDA 2CWAA 1Q8IA 2N55A 1GUGA 4DUYL 2LKVA 1N36Q 2VS1A 4A3JG 4JVZA 2RDFA 5IP9G 4BY7G 1QVGA 4A3KB 1CSPA 4JBMA 4ZAIA 1TVXA 4IPGA 2K7VA 4FXDA 3AYHB 2SOBA 4CKCA 3HOZH 4IUQA 1Y8NB 1FJGQ 4WJ3M 4A3JB 2PQAB 1QVCA 4C1NK 3FEWX 5C3XA 1VQ6A 1LV9A 2KCMA 3K5MA 1VQ7A 3X3NA 5I9OA 1FR3A 2HCCA 1W3SA 1SYDA 5NUCA 3GTOH 1EIHA 1PTOH 1ICFB 3TZUA 4HJ5A 3M4YA 2F0MA 1N9WA 4XTCS 4FXGC 3KFUA 2Q8IB 4OO1G 3S15B 3MTSA 5GQOA 4JI5L 1SJHD 2MPMA 5DLQE 1NMGA 1YITA 3ONAB 1W6JA 1TS5A 2GN5A 2KBNA 5AJ3L 4LF7L 1D1KA 3VR2A 2EIFA 2A68C 4KKSA 3NSWA 2M00A 4OX9L 3R3OA 3GTPB 4LFAL 4QY7A 3T1HQ 2ZJQA 1PYBA 2F0GA 4A3CH 1W6KA 1Q7YC 1D6EC 3SVMA 4Y7NB 1I4PA 4WFN3 2K1BA 1J5EQ 1ZKOA 1IYUA 5LMNQ 4F87A 2F0NA 3HOXG 2J0TD 3R2TA 1GUWA 1XX8A 4CKBA 5FLMH 3Q0AA 5FO8B 2WV6D 4X62L 1GO3E 3OWFA 5ELBA 2L55A 3NTKA 4CDCC 2BOSA 1AFPA 4QMGA 2Q2UA 3T4AC 2UXDQ 3N6RA 2SNSA 4DV1Q 3IAYA 3FKIG 1BOSA 2SDFA 1UE5A 5CORA 2R92B 3KJOA 4JW0A 1NE3A 5C3EG 5M5XH 1A3VA 2RHQB 1ILQA 1LT5D 2OTLA 4FNFA 1PRTC 3PO3G 1DJRD 2XWBB 2F0FA 2SNMA 3EN2A 2IL8A 1LM0A 1O7IA 1S3OA 2A6HC 2QCPX 3OHXC 1F9RA 4JBJA 3GTKH 2KEEA 3BVGA 4JI3L 4DGZA 1Q8KA 2F1MA 2P5ZX 2RCFA 5C3EB 1V8QA 1XNQQ 3CQZH 1TQOA 4O0AA 1EU4A 1M8AA 3KF6A 5CBAE 3GTQH 4A3IG 4LMQD 4IURA 4QGUA 2HHHL 1NTGA 5DM63 4B3SQ 1OXVA 3PQIA 3RLOA 4C3IH 5EJWA 4A3EG 3I4MG 4P2CB 1PV4A 1W2BA 1XYIA 3C46A 3I2ZA 1AE2A 4I65A 2B2TA 3PSIA 2BH8A 4RFBA 1K73C 5LMUQ 1DZ1A 5FJ8G 2VZAA 4PZ8A 2KHIA 1G91A 4NXML 1CQFA 1WOCA 1VQBA 4RG1A 3T51B 1JB3A 1VQIA 3TS0A 3NELA 3MXGA 4A3EB 3I4MB 3NBHA 3G7LA 4LF5Q 5DEHA 3K8AA 3P75A 3S2DH 1LTBD 1A6XA 3KBGA 2AQ1B 5IT9L 1SYFA 4LFCQ 4AYBB 1VQ9A 2R7FA 1EIFA 2E76C 2NVQH 2JA5H 5JEAH 5FOBB 1ONLA 4CJ1B 3TMEA 2PNHA 1F2MA 1CQVA 1FNVA 1MGSA 3CC4A 4CBVA 2HDLA 1PH2A 5KNDA 4GOPC 3DM3A 1EQQA 3CF5A 4LF4Q 5E7NA 3CCRA 5CV4A 4DR3L 5FLXE 4DR1L 3CMEA 1HNXL 2NUCA 4A3MH 4R8NA 3FP9A 2PI2E 1J8IA 1YHAA 2LMCB 1O7LA 3W1BA 3PF4A 3HOYG 1K3BC 2CFMA 1QWYA 3EVQA 2R7ZH 1VQAA 3KK7A 3J7A5 1JQYD 1FVIA 1E24A 1LTID 3N52A 4JI6L 1MHWC 2FMMA 3A8IE 3I4LA 4BWGB 5IP7H 3FVQA 1HNZL 4DAYB 3SGIA 3H0GH 2Z6KA 2NTTA 1JJCB 1WJJA 3A5UA 1E2VA 3GTGB 1NMFA 5JJZA 1CSQA 4JV5Q 2A69D 3UDIA 3S1RB 1V1QA 5D65A 2A1AA 5JJLA 4K6LA 4G7ZC 2JE6I 4OWTB 2DY8A 5K36G 3D4WA 3G48A 1ILPA 3HKZE 2K52A 3E9HA 1Z47A 2WIIB 1V43A 4P73A 4GOPB 1V9PA 4OXPA 1QUQA 4WJWA 1XJVA 1FJGL 1X55A 5KIXA 2MNAA 1K8AC 2VUMG 4A3DH 1WTXA 1MJEA 3S2HB 2RCNA 3I55A 4POFA 4RGNA 5KYLA 4BBSH 4A3GH 3P20A 4K8IA 5ISRA 4KI0A 4PG3A 1PH5A 3OWEB 2JEBI 3U9OA 1X6OA 2VUMB 3CRKC 4NB3A 4J15A 2N49A 5IYCG 1EWCA 4C3JG 1A62A 3CQZB 1U9RA 1TWHH 4KJOA 5C0XJ 1C4QA 2KQ3A 4TKOB 3RZDH 1SNDA 5T1IA 3VR3A 3F2DA 2X69A 2YV5A 2JN4A 1EZ6A 2F3VA 4JI7Q 1OXXK 1M90C 4C3JB 1HFGA 4ZCKA 2JP1A 2Z0SA 1EIGA 5EKLA 2EDGA 3NPPA 4IZ8A 3KLSA 3P1HA 3A54A 1H9RA 2ZJRA 3M4OH 4IFDH 5EPKA 2E5LQ 5FK9C 2EYHA 5BN5A 2BDNA 2NZHA 3L7ZC 3KYHC 1Q81C 5CC4A 1LTGD 4RAUC 3TBIB 3NTIA 1J5EL 3S2DB 1B1ZA 5LMNL 1Y1WH 1WTHA 3CCUA 2Q2HA 1B7YB 4HTHA 2UUCL 4OEMB 1PZKD 3JAME 1X3EA 2NVQB 2B8FA 5M5YH 4HIMA 2OF1A 3Q6SA 1JC7A 4YY3L 1X32A 1GHJA 1BDOA 5CV6A 3HOUH 3LX0A 5CV7A 4L8JA 4JI1Q 4C2MH 4CDDC 3GTLH 1QNUA 1YHBA 2UXDL 2FXQA 5M3FH 3GTMB 2CH4W 4FYDA 4KN7C 2YU9H 1PFMA 3VYTA 5C4JH 2IJ0A 3QR8A 1O80A 2OXPA 1JORA 4JI4Q 2NVXH 1TT2A 3S1QH 1VQDA 1PA6A 2MHVA 3F1ZA 2XNAC 4HR7B 5IYBH 2B63H 1SSOA 1TWAB 3NWSA 3MXNB 2QA4A 5F2DA 4B3TQ 1SNPA 2OEOA 1LTAD 1HRJA 1HR0W 1NCVA 1B3QA 3TP6A 4A3FH 1EFID 3M4PA 1SRUA 2CWPA 2F0EA 3CW2C 4JBKA 3OTOL 1SNQA 3RLFA 1EZ8A 2NVTB 2F3WA 2LSSA 3NQIA 1ZYRD 1BCPD 4IUVA 5IGDA 1EYGA 3GV6A 1Z7TA 3TS2A 1S40A 1A63A 3TEHB 5LMUL 5C0XG 5KYIA 3NTHA 4QL5A 1X65A 4YCVA 1JJGA 1F9QA 4A3DB 2B3GA 4FVMA 3NHHA 1STGA 2JA6G 5EQ0A 4BBRG 4R4CA 1X3PA 4B9XA 4BBSB 3D6WA 4ZYSA 2F4VL 1L1OA 2ZM6L 3TSSA 3U58A 1F2LA 3EROA 3C1EA 4DR4Q 4R4IA 4CJ2C 1HZBA 2UUBL 1STYA 3Q23A 1QJOA 4XXEA 4V190 2OT2A 3PIO3 3CCQA 4GN5A 4KHPQ 2B2TC 1LUZA 2K5WA 3ERSX 2O2LD 4P72A 4BBRB 4UY8C 2A6ED 2JA6B 1D2BA 1I4GA 3D4RA 5ELEA 3LNNA 5C4ZA 3NE5B 3F2UA 1QNKA 4KY7A 4EQOA 2R93G 1WFQA 4BY1G 1HNWL 3R8BA 1EOTA 3L0OA 4QUCA 2X6GA 3J80E 4OIJA 1JT8A 1ET6A 4YWMA 5LHY1 3SR1A 4ALPA 3E9IA 3I8ZA 2K5VA 4NXNL 4IFDI 3M4OB 1HZAA 3S1NB 2RDGA 2F0LA 3MEHA 4A93G 4S3SA 4A3JH 4CDFC 4H44C 2K32A 4BY7H 5J39A 2O4XA 2VW9A 2B2YA 1K0RA 4DFAA 3HKSA 1UUPA 2ZXOA 2B29A 3V05A 4JV5L 3EA6A 4NW2A 4J1MA 4A93B 4MNOA 1CKOA 4RGTA 4GKKL 3HOUB 3VR4A 3QJYA 5IGCA 2RA4A 2UUAL 3S15H 1IL2A 1PZJD 1JWSD 1PFNA 4A75A 1VQ8A 1VQLA 1WCMG 3CCLA 1Q1EA 1HA5A 1WTRA 2CH4A 3L2PA 2IHEA 4AQYL 1A15A 3DM1A 4O2DA 4CGYB 2NVYH 3VR5A 3G71A 3MXUA 4XYOA 3VYUA 5I4DA 2Z6KC 5C4JB 2A73B 1L2FA 4OO1H 3TDQA 1UEBA 1VDZA 3GTPH 3K81C 5KEEA 2F0OA 4GKJQ 1WCMB 2JA7G 1KTKA 2N8NA 4DR5Q 5D3IB 2B63B 4Y7NH 2F0HA 1UAPA 1S5ED 4ZUJA 1U4MA 2RHSB 3J81c 4POGA 2JJQA 1U4PA 4LUZA 2L5TA 5M3MG 4KJNA 4JYAQ 1EIYB 3TN2A 2OQ0A 3J80i 1WYDA 2JA7B 5FO9B 4IPHA 2A68D 2EYFA 5M3MB 4JI7L 1MSHA 4O1NA 3HOXH 4B3RQ 5BR8L 3PUVA 1XNRL 2CW0D 2AQ3B 1EEFD 2K5HA 1OO9B 2E5LL 4EGVA 4YIJA 1PXUA 4KY5A 2EPBA 2UU9Q 1BCPB 3DXJC 2UXBQ 1EQTA 4DK1A 1HJPA 1JJ2A 2ZXRA 3MWYW 1LT4D 2AWOA 1K8GA 3UE1A 2HIVA 4DPGA 2VNUD 1N8RC 2E75C 2JYOA 1VQ4A 5C3EH 1SFOB 4YCWA 1LT3D 5FKAC 3PO3H 2WB1G 1KDAA 1V1PB 2Z8LA 4ZUIA 1C9OA 2XGTA 3E0EA 2L12A 1EY4A 1PRTD 1D7QA 3P7JA 2N88A 4DR7L 2CVRA 5GADC 1QB5D 1GM5A 4JI4L 2MJ8A 4A3IH 2A6HD 1L0XB 1I4XA 4AYBE 1A3UA 1TWCH 4A3EH 3I4MH 1I5FA 2WB1B 1HZCA 2HD3A 2XRSD 4IUPA 5CR3A 1IZ6A 2EQSA 3TRZA 4BY7B 1Y14B 2A8VA 5C5LA 1WVLA 2D0PA 1CTMA 1SR3A 4PMWA 2BE5D 3E3XA 2WAQG 4LF9Q 5FJ8H 1EY5A 2YYZA 4K2KA 2EJFC 3H91A 4IN3A 2H4OA 2EYJA 1DCZA 4KD3A 3CCSA 3T13A 1R4PB 4JI8Q 5KRUA 3GV3A 1PHJA 1VCIA 3GP7A 3T1YQ 2WAQB 3NEMA 3L9AX 2WP8J 1STHA 1IL8A 1K3RA 3K6OA 2IT1A 2NVYB 1XTDA 4DV0L 1WI5A 1D8LA 5J1ZA 1ZEQX 4OO1I 5ELFA 3STBC 1WTOA 1VQJA 1PZID 2ZTCA 2PI2A 3W2DA 3S17B 5EAYA 4K14A 2UUAQ 2CW0C 4JOIC 2CHBD 5GAGC 4DV2L 3RLNA 2ICIA 4Q5VA 3L3OC 1EY0A 2M9VA 4PQXA 2RKSA 3S1MB 3X3MA 3IL8A 4BA1I 4JI0Q 3HOYH 3VR6A 3CC7A 1GVPA 3GTGH 1V1OA 2OCEA 1HQRD 4JCVE 3H15A 2R6GA 3S1RH 1YZ6A 3ER0A 3A55A 4DN4M 2PPBC 4ZKBB 3HOXB 4UAIA 1L1OC 1H95A 2Y0SG 1HA6A 3I4OA 3PO2G 3D0FA 3A8JE 4MTNA 1SJED 1CKNB 3CXCA 2E2JB 1B50A 2I0QA 4LNQA 1EUJA 1YNXA 1L0YB 2O5IC 2BCOA 1B8AA 1E3PA 1GXDC 2EYOA 3BDCA 3SHLA 3S2HH 4QIWB 2C35B 4DV5L 2B8GA 5K36H 2B2UC 1CZGA 3A8KE 2AKWB 3G6EA 2GA4B 2F0KA 1PH8A 1B4OA 2MQHA 1K83B 3VA5A 3FKIB 2DNCA 4LF8Q 2VQFL 5HY6A 2AMCB 1I6VC 2EXZA 2HUGA 2VUMH 3ICEA 2F0VA 1VS0A 1YVCA 4M1UB 3KLWA 1DOKA 3PO3B 5E1FA 4C3HG 3K5OA 4GNXC 2BE5C 5ELCA 2CQAA 4I7ZC 3I91A 4R4OA 5IYCH 5CBEE 4C3JH 1ICWA 2G9DA 1QCBD 1YJ9A 3FHWA 1L1OB 4OGQC 4A3IB 3CRLC 4NMZA 4GKJL 3NK9A 1U4LA 4C3HB 1EQRA 3U4VA 1XMQQ 3PIP3 4DR5L 1D5ZC 1TWCB 1N32Q 1LTLA 3E6ZX 1T5EA 4GS3A 3S14B 1EWHA 3HOZG 3A56A 4UHVA 2EY6A 4JYAL 4KLKA 5C4HA 4ZRZA 5FLXc 1AH9A 4FXKC 1PRTB 4BXXG 3M9BA 5IE8A 4TVAB 4RA8A 4EQNA 1GOZA 1RHPA 2KCTA 1STBA 2QKIC 4FF4A 5EGTA 1E2ZA 4DA2A 2HT1A 3CU7A 2B2WC 3DEOA 4R1JA 4TQUS 4B3RL 2B2VC 2ES2A 4HN7A 1TWGH 1CI3M 1PVOA 3GTMH 4QUFA 1FL0A 1D5XC 1DM0B 4GNXB 1IKMA 1TKWB 1UWVA 2K04A 1KC8C 3PUWA 4DV7Q 4X65Q 4KHVA 2JA8G 2M2LA 3C1FA 1HR0Q 1GUNA 3H09A 2HQLA 3K58A 1TWAH 4ME3A 3S24A 1AP0A 4ID6A 2FFKB 3AMUA 1DONA 2JA8B 2K05A 3HOYB 2NTSA 1UNSA 5AFWA 3KF8A 5H1SE 1I4QA 2VL6A 5FLMG 1K28A 4UP8A 1N36L 2NVTH 4KKUA 4LFBQ 5D3DA 2FHTA 3OIPA 5DM73 4GLVB 4X66Q 4X3KA 4LJZC 1SYEA 3WDNA 3CPFA 2HCIA 3BU2A 3AFQA 1EY9A 1FGUA 2SEBD 3T56B 3R2IA 4A4IA 2E2DC 2VB3X 4RHRA 4DK0A 2V1CC 2RSNA 1ESRA 1TY0A 4JG2A 1AZQA 5IOCA 3AQQA 3OW2A 1VQNA 5C0XH 4F88A 2F0DA 1B9MA 1QZGA 3DWQA 3FPPA 3DWPA 4OHJA 3CCJA 3KDFB 3HOWG 4WRDA 5JVG3 2NN6G 3EQLC 2UXCQ 2GVAA 4ODGA 1WTVA 5IGFA 3ZJYC 4BBRH 2JA6H 1R9TB 1F9PA 4K5VA 5I2YA 4G7OC 3OPOA 1SMXA 2VQEQ 2KCCA 1Q12A 2EE1A 1IYVA 1IBKQ 2F0PA 1NAPA 3JAMc 3WOEA 1JE4A 2Q2IA 1TS3A 1XTCD 5BN4A 4WJ4A 1B44D 4DV6Q 4HIOA 3AEVA 2PQAA 1YHQA 3T16A 4LAAA 3T1HL 3FMCA 3S1NH 4IUNA 5J3BA 2R93H 1O7YA 3D8GA 1SAPA 3UDXA 5C44G 4B3MQ 1K8MA 1K8OA 1HCZA 4G7HC 2PMZE 1QE6A 3RN2A 3HG9A 3QB3A 1UEAB 1D5MC 3SK6A 5LL6X 1BF4A 2EJMA 4XYQA 1BBXC 1Y1VG 5C4XG 1OXSC 4KK7A 3S16B 3J81L 5C44B 1IBLQ 4DR2Q 4A93H 4RCNA 2YTYA 2Q8TA 1KDCA 4DNRB 5M9OA 4HJ7A 4GLXA 1GUOA 2K33A 2Q8RE 3VYRA 4OELB 1KIXA 1J6QA 1TWGB 1I94Q 5C4XB 4R4TA 2F03A 2XSCA 3NXWA 4DV1L 4G4KA 3E5SA 2X6LA 3E0JA 5JJIA 2F4IA 3LGJA 4HJ8A 1IKLA 4PZ6A 3K0YA 1U0LA 3ND8A 1D1IA 1TWFH 3VA7A 2PZWA 1WCMH 3J7YW 1XMOQ 2R7ZG 5JPNC 2CKZB 3LWUA 3TZDA 1FGBD 3M7NA 3BG3A 1H9KA 5HGQA 4XQJA 1K9MC 1TU2B 1XNQL 3SDZA 1RL2A 3PV0A 1TR5A 2EVBA 5IYDG 1WTQA 1KAWA 4I7AA 2E74C 2JA7H 4B3SL 3PUYA 2RVLA 1M4VA 5HGTA 4L6TB 3CC2A 5M3MH 1TY2A 1OXTA 2K50A 1PTOF 3RUZA 4ZQ3A 3IFTA 1KNEA 3KLSX 4HSPA 2KCNA 4B9WA 4HCEA 4DV3Q 3UDGA 1G8ZD 1N32L 1VQMA 3I4NG 1GHKA 4XIGS 4LF5L 1AW7A 3AU7A 1S5BD 1LYLA 2MO1A 4DAMA 3J80c 5IT9E 4LFCL 2CQOA 4JI5Q 5C0XI 3HKZG 2BA1A 4A3GG 2PW7A 3RN5A 4KY6A 2MGSA 5IGGA 3I4NB 4HJAA 1G2TA 1Y8PB 5AJ3Q 2N3SA 2RSOA 4U673 2B39A 3M7GA 1SFOH 2E2IB 5M5WB 4LF7Q 3GDEA 1I6HB 1HUNA 4OX9Q 3GO5A 4LFAQ 3BZDB 1XPOA 1CZWA 4LF4L 3CCMA 4C1NI 2DGYA 3HP3A 4A3LG 2VB2X 3H3VC 4DF7A 1NNXA 1H9SA 2AUKA 2JXMB 2QDBA 2Z6BA 3U4ZA 1KL9A 5JJKA 4RH6A 1VQEA 5DNFA 3DEPA 3PCOB 2F0UA 4WORA 3BDOA 4HSVA 3VYSA 2MUYA 4IOAA 2R93B 2EYMA 4BY1B 1EYDA 3BZKA 4DXGA 1MI2A 4N9TA 1ASYA 1U5KA 5IP9H 1EFWA 4X62Q 3HEJA 1HTPA 1KABA 3KF6B 2IX3A 3BYYB 1NSNS 1E1TA 1IBMQ 3QWNA 3VDYA 3I3CA 3HOVG 2L11A 4Q0FA 4CDEC 2EYPA 4K2LA 2EZVA 5GROA 4LW1A 4XT3B 1YBYA 3MVVA 5JPMC 1ML0D 2IPKD 1RODA 4K0KQ 2QILA 2EOTA 5EBDA 2DUDA 4DXFA 3OSOA 1XPUA 5CMDA 4C56C 3NBHB 4LUVA 4O42A 3HOVB 3CPWA 2E2HB 4IJHA 3UE0A 1CK1A 3NUCA 1LO5D 4JI3Q 4EQ5A 4KV6A 2ASBA 1TWFB 5IODA 4DAYA 2Z4IA 3S17H 3RR5A 3ULJA 4UP7A 2L0CA 5I6WA 1WD0A 2K28A 3M4QA 4MHEA 1EYCA 2F52A 3D3RA 5TSSA 1VQHA 1I3QH 5IYBG 1SE8A 2N78A 3S1MH 3JC66 3PUXA 3K7AB 1HUMA 4H7BA 2EY2A 2QEJC 3TP5A 4HEDA 2KENA 3HGBA 2J4XA 3IKJA 4FF1A 5KNCA 1A3TA 1GD7A 4P74A 1Y8OB 2Q2TA 1WTWA 4NXMQ 3STBD 2RDHA 1PYWD 1MJCA 4GOPA 3RNUA 5EKIA 1JOQA 4Z9CB 1KD1C 1LABA 4QIWE 3DUZA 3G4SA 1BQQT 3J7ZC 2E2JH 1GJXA 1STNA 4J8QA 2KOLA 2F0JA 2IX0A 2H1EA 4JBWA 2EY1A 2D9UA 4MZ9A 1KNAA 4RWSC 1IXRA 2L1BA 1O78A 3EIVA 3J81j 3O13A 2JQOA 3GD7A 1F2ZA 1QOHA 5EPJA 3V96A 3BS1A 5IGBA 1K83H 1DOMA 1TXYA 1G2SA 1LACA 3FKIH 1PH1A 3J81E 1IBLL 1SNOA 4XDXA 4A76A 4FF2A 4JI1L 1N34Q 3U50C 1PH3A 1CUKA 2K14A 2XN9C 2DNEA 1I94L 1JE5A 1QUQB 5CV5A 1Q1BA 3CHBD 4EVOA 4FF3A 4JI6Q 4X3UA 1WD1A 1X54A 5JVH3 1XPRA 2K01A 3GTJH 2OWOA 1HNZQ 1EL0A 4A3KG 5CYUA 4HJ9A 5A2QL 2JSOA 4C3HH 1EU3A 2D62A 4L5TA 4ILWA 2Z9HA 1VQPA 1GKHA 4KKTA 4DNTB 2DJGC 1PH9A 1YJNA 3S14H 4TSSA 1CKMA 4B3TL 4PZ7A 3I56A 5COYA 2KVMA 1VQOA 1AE3A 3EFXD 3IFDA 2R61A 1PTOD 4YWLA 3Q24A 1X56A 3F8TA 5G3LF 1HPCA 4NKLA 3KUPA 2IY5B 1Y69U 3D31A 1MIUA 3OMGA 4BS9A 4A3BG 1B70B 5IY0A 4KD4A 4DNIA 1JB7A 3NQTA 1EWIA 4BXXH 4DR6Q 4N9PA 4PMCA 4AIMA 1J9OA 4UP9A 5EPLA 4DV3L 1M1KC 3ERQA 4F8MA 1B3AA 4A3BB 3QOJA 3MXNA 2VXWA 3J81i 4G57A 4DAPA 1RDPD 1ESFA 4DV4Q 1Z6HA 2I07B 4DR4L 3PIOA 2PZUA 2F0QA 4RKBA 4QF4A 1CA6A 1JOOA 4LK1C 1VQ5A 1I3QB 4KHPL 1E7ZA 2NB0A 4HIDA 4X6AH 2JA8H 4FDBA 1VF5C 1NR2A 1Z9FA 3RZOH 2NBFA 1BO0A 5EKKA 1MBYA 4B08A 4IO9A 1T5XD 1B2TA 3I70A 2RQXA 1SDFA 2D2CC 5E3FA 3TP8A 1ET9A 2A74C 1GUTA 1EQVA 2IWHA 3K5NA 4DUZQ 4HMJA 1NUCA 3JAML 1HQMC 2UUCQ 4L5SA 2I5HA 3A5ZB 3KBXA 3HRZC 4YY3Q 2IX1A 4RKLA 5E4WC 2R92G 2Y0SB 3DWAA 1FNUA 2MFIA 3PO2B 5KGUA 1Q46A 1IBML 2PO4A 2BA0A 2Z1CA 1IW7D 3CAMA 4K5WA 2A5HA 4IJLA 2JA9A 3W5OA 1FNWA 2QGQA 1Q82C 1JWUD 1R9TH 3Q22A 4JPBW 1KLGD 1VQFA 2BDOA 5I9PA 2ENBA 3A7AB 1K0SA 1ENFA 2KJXA 1BXTA 2ALYB 4X3TA 4ZLTF 4K0KL 1LTSD 5DAUA 1ASZA 1PTOC 5ELDA 3HOWH 1OTCA 1X3GA 1RTOA 2NN6H 1B53A 4H02A 2B2YC 2HQEA 4KN4C 5ELOA 3GTJB 2F3IA 3MFYA 4OL7A 1SEBD 4K8JA 1DYQA 2QDLA 1EOVA 3I72A 4ULLA 1YEZA 1X3QA 3TQYA 3H94A 2KHSA 4H0LC 3M3YH 3OTOQ 2J7ZA 4BA2I 3DHQA 1NJIC 2ZTEA 4L5RC 1DD2A 2ID0A 1G6PA 5I6YA 4AH6A 1RTNA 3W1GA 1QZHA 4AYBG 1BCPF 3CKIB 3S16H 5C44H 2WFWA 1MKHA 4OWWB 3I73A 3HOZB 1H9SB 2I46A 5A35A 1H9JA 1SYBA 1TS2A 3SK4A 1RCVD 5C6AA 4UPAA 3ITPA 2CCZA 2L4NA 2RBMA 3D4DA 2F4VQ 1Y1VH 5C4XH 1N33Q 5IWAQ 2JEAI 2ZM6Q 2QEXA 3GTOB 4XQNA 2UUBQ 1AEXA 1BKBA 1PTOB 2R7DA 2WKCA 4RGMA 4FO2A 2UU9L 2MO0A 4RHSA 3K7UC 2UXBL 1Q3LA 3ZYYX 5ELNA 3MAQA 4OONA 4U68A 4JI2Q 2PNRC 3D6CA 1JMCA 4QJFA 4A3CG 3J7AV 5JEAJ 4ABNA 1R4QB 2XWJB 4ZK9B 2K4KA 4TRDA 4LF6Q 1HNWQ 3EBEA 5HURA 4MN3A 1HFNA 3J80L 1N34L 1B9NA 4PV1C 3RZOB 1CFMA 5CV8A 1NR4A 4DK6C 1Q90A 4NXNQ 5IIFA 3KLRA 2K03A 1P16A 4JK1C 1IW7C 2F0IA 3OIQA 3SK5A 3KJPA 3ULPA 3U9SA 5IYDH 1BVSA 2AUJD 1SLJA 2WKDA 4IUTA 5A2QE 1LLRD 2KA7A 2G9HD 2EYLA 2C5CA 1EYAA 4Y52H 2F0TA 4N8FA 2KHJA 4P71A 4R8IA 4YHHQ 2GVBA 1E1OA 2K5NA 5D14A 4MIUA 5C3WA 3T53B 1HXYD 5G3LD 4GKKQ 5LMNW 2R3ZA 4P75A 3BJUA
chains in the Genus database with same CATH topology
1SE3A 3MA2B 3SE0A 5J22A 1LTTD 3MC0B 1PLFA 1BUVT 1YNJD 4IQZA 3OMCA 1G6ZA 1V1PA 1OXUA 2LFNA 3K57A 4PMBA 5M5XB 2NYZD 2WINB 3QG1A 4J6HA 4H13C 3NWTA 1YNND 4IALA 3HOWB 3BVZA 1EEID 2NN6I 4C3IG 4GZYC 3GQBA 3GTKB 1KLUD 1EY7A 1LT6D 4RGOS 3M85A 3C3LA 3GTQB 3M3YB 1CM9A 5C5MA 2PCFB 2L9HA 2ZXPA 4DAVA 1MSGA 4XQQA 4C3IB 5JAVA 3K59A 2XRQD 2LS01 4V0BA 2AQ2B 1A2TA 2XVSA 1KDBA 3WOFA 5JEAG 4K6DA 1QG7A 2K6AA 3HZXA 1CA5A 1E2WA 3QO2A 1Y1VB 5CGKA 3R93A 4IFDJ 1F2YA 1VMCA 3MFGA 1H9MA 2JA5B 5KNBA 1CT1D 4RCOA 1RF2D 4CHTB 1VF7A 3EJIA 1XXGA 1SNMA 4K5XA 1C48A 1F77A 3UI2A 1AZPA 2AWNA 2PW5A 4QCLA 1CHQD 2A69C 4A3MB 1PMRA 4L63B 1U4RA 2Z4HA 2ZT9C 2R7ZB 1F9SA 1HTLD 2F0SA 2XIWA 2QF7A 1O7ZA 1PRTF 4OIKA 1YNJC 1G291 2EY5A 3H0GB 1JCKB 3PUZA 2C9OA 1I4HA 3BDLA 1BNZA 4KTAA 1YNNC 3MXPA 1PFBA 5K5PA 2NWGA 3SXHA 5JOBA 3A7LA 4NP5A 2PZTA 2LY7A 1AN8A 3QOLA 2O5JC 1S5DD 2TMPA 3HS0C 4CKEA 4QB4A 4F7XA 1RD9D 2KUMA 1STEA 2ICEC 3HKZB 4A3GB 1SYCA 2PYKA 5BN3A 3OW7A 3DMUA 1E0BA 4KMUC 1TWHB 3SEBA 4M8AA 4FP5D 3RZDB 3TP7A 1SNCA 2B2UA 4IFDG 2WACA 3MHBA 5LL6S 1SYGA 4KHZA 1IHZA 1TS4A 4X3SA 2HDMA 1DXMA 1GUSA 5I2XA 3RD4A 3I90A 3J7AF 4UDUC 1STAA 1CHPD 2K5QA 1SMYD 2NZ1D 1QILA 3BVMA 3PMFA 4DU9A 4ME5A 4NDXA 2FINB 5T1GA 4CJ0B 1I4RA 2D5DA 1Y1WB 2KECA 1JR0D 1JICA 3FPUB 3ND9A 1RJTA 1S5FD 5M5YB 3AB9A 1PDQA 3OOCA 3NP8A 3BYTB 2PMZB 1MD2D 1S5CD 1ENAA 3V2TA 1TIID 4C2MB 5EBCA 2V4DA 3GTLB 1SBBB 1SE4A 2FJ2A 4PNYA 5M3FB 4ZKCB 2TSSA 1DOLA 3FRPB 1JWMD 2YU9B 1FD7D 3C2PA 1ZYRC 1BCPC 1ZXTA 1BR9A 1LTRD 2B2WA 4HCSA 2NVXB 3S1QB 2B2VA 4R9WA 4IUUA 2IW3A 2PQEA 1ENCA 1SXTA 2KEDA 1I50B 1EY8A 3W3AA 4EQPA 4A3FB 3URYA 4XT1B 3K5LA 3NBIA 3RMHA 1WTPA 3MZ5A 1EY6A 5E4XA 1RKNA 2A6EC 3QIAA 1II3A 2EJGC 5CV9A 3S9WA 3FDTA 5FLXL 1A2UA 3H6MA 2MP1A 1VMPA 4E6IA 3SK8A 2DN8A 1JOKA 1FYCA 3LWEA 4HAEA 5IGEA 1SMYC 5FO7B 1KAAA 1HHVA 1SE2A 2FMCA 1S4ZA 2F0WA 1XWEA 2K5DA 1C8CA 3G6JB 4HMIA 2DY7A 1Q8IA 2N55A 1GUGA 2LKVA 2RDFA 4A3KB 4ZAIA 1TVXA 2K7VA 4FXDA 2SOBA 4CKCA 4IUQA 1Y8NB 4A3JB 4C1NK 3FEWX 5C3XA 1LV9A 3K5MA 3X3NA 5I9OA 1FR3A 2HCCA 1SYDA 5NUCA 1EIHA 1PTOH 3TZUA 3M4YA 2F0MA 4XTCS 4FXGC 2Q8IB 4OO1G 3S15B 3MTSA 1SJHD 2MPMA 3ONAB 1W6JA 1TS5A 1D1KA 3VR2A 2A68C 4KKSA 3NSWA 2M00A 3R3OA 3GTPB 2F0GA 1W6KA 1D6EC 3SVMA 4Y7NB 1I4PA 4WFN3 2K1BA 1ZKOA 1IYUA 4F87A 2F0NA 2J0TD 3R2TA 1GUWA 1XX8A 4CKBA 3Q0AA 5FO8B 2WV6D 3OWFA 5ELBA 2L55A 3NTKA 2BOSA 1AFPA 4QMGA 3T4AC 3N6RA 2SNSA 3IAYA 1BOSA 2SDFA 5CORA 2R92B 1A3VA 1ILQA 1LT5D 4FNFA 1PRTC 1DJRD 2XWBB 2F0FA 2SNMA 2IL8A 2A6HC 2QCPX 3OHXC 1F9RA 2KEEA 3BVGA 4DGZA 2F1MA 5C3EB 1V8QA 1TQOA 1EU4A 1M8AA 5CBAE 4LMQD 4IURA 5DM63 1OXVA 5EJWA 4P2CB 1XYIA 3C46A 4I65A 2B2TA 4RFBA 1DZ1A 1G91A 1CQFA 3T51B 1JB3A 4A3EB 3I4MB 3MXGA 3NBHA 3G7LA 5DEHA 3P75A 1LTBD 1A6XA 3KBGA 2AQ1B 5IT9L 1SYFA 4AYBB 2E76C 5JEAH 5FOBB 1ONLA 4CJ1B 3TMEA 1F2MA 1CQVA 1FNVA 1MGSA 4CBVA 2HDLA 5KNDA 5CV4A 5FLXE 2NUCA 4R8NA 1J8IA 2LMCB 1O7LA 1QWYA 3EVQA 3KK7A 1JQYD 1LTID 3N52A 2FMMA 3A8IE 3I4LA 4BWGB 3FVQA 2NTTA 1E2VA 3GTGB 5JJZA 2A69D 3S1RB 5D65A 4K6LA 4G7ZC 2JE6I 2DY8A 5K36G 3D4WA 1ILPA 1Z47A 2WIIB 1V43A 4WJWA 5KIXA 1WTXA 3S2HB 4RGNA 5KYLA 3P20A 4K8IA 5ISRA 4KI0A 3OWEB 2JEBI 3U9OA 2VUMB 3CRKC 1EWCA 4C3JG 3CQZB 1U9RA 4KJOA 5C0XJ 1C4QA 2KQ3A 4TKOB 1SNDA 5T1IA 3VR3A 2X69A 1EZ6A 2F3VA 1OXXK 4C3JB 1HFGA 2JP1A 1EIGA 5EKLA 2EDGA 3NPPA 4IZ8A 3KLSA 3P1HA 3A54A 1H9RA 4IFDH 5EPKA 5FK9C 2EYHA 5BN5A 2BDNA 3L7ZC 5CC4A 1LTGD 4RAUC 3TBIB 3NTIA 3S2DB 1B1ZA 4HTHA 1PZKD 3JAME 2NVQB 2B8FA 2OF1A 3Q6SA 1JC7A 1X32A 1GHJA 1BDOA 5CV6A 3LX0A 5CV7A 4L8JA 1QNUA 3GTMB 4FYDA 4KN7C 1PFMA 3VYTA 2IJ0A 1O80A 2OXPA 1JORA 1TT2A 2MHVA 2XNAC 4HR7B 1SSOA 1TWAB 3NWSA 5F2DA 1SNPA 2OEOA 1LTAD 1HRJA 1NCVA 3TP6A 1EFID 2F0EA 1SNQA 3RLFA 1EZ8A 2NVTB 2F3WA 3NQIA 4IUVA 1ZYRD 1BCPD 5IGDA 3GV6A 1Z7TA 5C0XG 5KYIA 3NTHA 1F9QA 4A3DB 4FVMA 3NHHA 1STGA 5EQ0A 1X3PA 4B9XA 4BBSB 3D6WA 4ZYSA 3TSSA 1F2LA 3EROA 3C1EA 4CJ2C 1STYA 3Q23A 1QJOA 4XXEA 4V190 2OT2A 3PIO3 2B2TC 2K5WA 2JA6B 2O2LD 4BBRB 1D2BA 2A6ED 1I4GA 3D4RA 5ELEA 3LNNA 5C4ZA 3NE5B 3F2UA 1QNKA 4KY7A 4EQOA 3R8BA 4QUCA 1EOTA 3J80E 2X6GA 4OIJA 1ET6A 5LHY1 3SR1A 3I8ZA 4IFDI 3M4OB 3S1NB 2RDGA 2F0LA 3MEHA 4S3SA 4H44C 2K32A 5J39A 2O4XA 2B2YA 4DFAA 1UUPA 2ZXOA 3V05A 3EA6A 4NW2A 4J1MA 4A93B 4RGTA 3HOUB 3VR4A 3QJYA 5IGCA 2RA4A 1PZJD 1JWSD 1PFNA 1Q1EA 1HA5A 1WTRA 1A15A 3DM1A 4CGYB 3VR5A 3MXUA 4XYOA 3VYUA 5I4DA 5C4JB 2A73B 4OO1H 3TDQA 1VDZA 5KEEA 2F0OA 1WCMB 1KTKA 5D3IB 2B63B 2F0HA 1UAPA 1S5ED 4ZUJA 1U4MA 1U4PA 2L5TA 4KJNA 3TN2A 2JA7B 5FO9B 2A68D 2EYFA 5M3MB 1MSHA 4O1NA 3PUVA 2CW0D 2AQ3B 1EEFD 1OO9B 4EGVA 4YIJA 1PXUA 4KY5A 2EPBA 1BCPB 3DXJC 1EQTA 4DK1A 2ZXRA 3MWYW 1LT4D 2AWOA 2VNUD 2E75C 2JYOA 1SFOB 1LT3D 5FKAC 1KDAA 1V1PB 2Z8LA 4ZUIA 2L12A 1EY4A 1PRTD 3P7JA 2N88A 2CVRA 1QB5D 2MJ8A 2A6HD 1L0XB 1I4XA 1A3UA 2WB1B 2XRSD 4IUPA 5CR3A 4BY7B 5C5LA 1WVLA 1CTMA 4PMWA 2BE5D 1EY5A 2YYZA 4K2KA 2EJFC 3H91A 4IN3A 2H4OA 2EYJA 1DCZA 4KD3A 3T13A 1R4PB 5KRUA 3GV3A 1VCIA 3GP7A 2WAQB 3L9AX 2WP8J 1STHA 1IL8A 3K6OA 2IT1A 2NVYB 5J1ZA 1ZEQX 4OO1I 5ELFA 1WTOA 1PZID 3W2DA 3S17B 4K14A 2CW0C 2CHBD 2ICIA 4Q5VA 3L3OC 1EY0A 2M9VA 4PQXA 2RKSA 3S1MB 3X3MA 3IL8A 4BA1I 3VR6A 1V1OA 1HQRD 2R6GA 3A55A 4DN4M 2PPBC 4ZKBB 3HOXB 4UAIA 1HA6A 3A8JE 2E2JB 1SJED 1B50A 1L0YB 2O5IC 2BCOA 3SHLA 1GXDC 2EYOA 3BDCA 4QIWB 2B8GA 5K36H 2B2UC 1CZGA 3A8KE 2GA4B 2F0KA 1B4OA 1K83B 3VA5A 3FKIB 2DNCA 1I6VC 2EXZA 2HUGA 2F0VA 4M1UB 1DOKA 3PO3B 5E1FA 4C3HG 3K5OA 2BE5C 5ELCA 2CQAA 4I7ZC 3I91A 5CBEE 1ICWA 2G9DA 1QCBD 4OGQC 4A3IB 3CRLC 4NMZA 3NK9A 1U4LA 4C3HB 3PIP3 1D5ZC 1TWCB 3E6ZX 1T5EA 3S14B 1EWHA 3A56A 2EY6A 5C4HA 4ZRZA 4FXKC 1PRTB 4RA8A 4EQNA 1GOZA 1RHPA 1STBA 2QKIC 4FF4A 5EGTA 1E2ZA 4DA2A 3CU7A 2B2WC 3DEOA 4TQUS 2B2VC 4HN7A 1CI3M 4QUFA 1D5XC 1DM0B 1IKMA 1TKWB 2K04A 3PUWA 4KHVA 2M2LA 3C1FA 1GUNA 3H09A 3K58A 1AP0A 4ID6A 2FFKB 3AMUA 1DONA 2JA8B 2K05A 3HOYB 2NTSA 1UNSA 5AFWA 3KF8A 1I4QA 4KKUA 5D3DA 2FHTA 3OIPA 5DM73 4X3KA 4LJZC 1SYEA 3WDNA 2HCIA 1EY9A 2SEBD 3T56B 3R2IA 2E2DC 2VB3X 4RHRA 4DK0A 2RSNA 1ESRA 1TY0A 1AZQA 5IOCA 5C0XH 4F88A 2F0DA 1B9MA 3DWQA 3FPPA 3DWPA 4OHJA 4WRDA 5JVG3 2NN6G 3EQLC 4ODGA 1WTVA 5IGFA 1R9TB 1F9PA 4K5VA 5I2YA 4G7OC 3OPOA 2KCCA 1Q12A 2EE1A 1IYVA 2F0PA 1NAPA 3WOEA 1JE4A 1TS3A 1XTCD 5BN4A 1B44D 3T16A 4LAAA 3FMCA 4IUNA 1O7YA 3D8GA 1SAPA 1K8MA 1K8OA 1HCZA 4G7HC 1QE6A 3HG9A 3QB3A 1UEAB 1D5MC 3SK6A 5LL6X 1BF4A 2EJMA 4XYQA 1BBXC 1OXSC 4KK7A 3S16B 3J81L 5C44B 4RCNA 2Q8TA 1KDCA 4DNRB 5M9OA 1GUOA 2K33A 2Q8RE 3VYRA 1TWGB 5C4XB 2F03A 2XSCA 3NXWA 4G4KA 3E5SA 2X6LA 3E0JA 2F4IA 1IKLA 3K0YA 3ND8A 1D1IA 3VA7A 2PZWA 3J7YW 5JPNC 3LWUA 3TZDA 1FGBD 3M7NA 3BG3A 1H9KA 4XQJA 1TU2B 3SDZA 3PV0A 1TR5A 2EVBA 1WTQA 2E74C 3PUYA 2RVLA 1M4VA 5HGTA 4L6TB 1TY2A 1OXTA 1PTOF 3RUZA 4ZQ3A 3IFTA 1KNEA 3KLSX 4HSPA 2KCNA 4B9WA 4HCEA 1G8ZD 1GHKA 4XIGS 1AW7A 3AU7A 1S5BD 5IT9E 5C0XI 2BA1A 2PW7A 4KY6A 2MGSA 5IGGA 3I4NB 1G2TA 1Y8PB 2RSOA 4U673 2B39A 3M7GA 2E2IB 5M5WB 1I6HB 1HUNA 3GO5A 3BZDB 1CZWA 4C1NI 3HP3A 2VB2X 3H3VC 4DF7A 2JXMB 1H9SA 2AUKA 2QDBA 4RH6A 5DNFA 3DEPA 4WORA 2F0UA 3BDOA 4HSVA 3VYSA 2MUYA 2R93B 2EYMA 4BY1B 1EYDA 4DXGA 1MI2A 4N9TA 3HEJA 1HTPA 1KABA 2IX3A 3BYYB 1NSNS 3QWNA 3I3CA 2L11A 4Q0FA 2EYPA 4K2LA 2EZVA 4XT3B 3MVVA 5JPMC 1ML0D 2IPKD 1RODA 2QILA 2EOTA 5EBDA 4DXFA 3OSOA 5CMDA 4C56C 4O42A 3HOVB 2E2HB 1CK1A 3NUCA 1LO5D 4KV6A 1TWFB 5IODA 4DAYA 2Z4IA 2L0CA 5I6WA 1WD0A 2K28A 4MHEA 1EYCA 3D3RA 5TSSA 3PUXA 3K7AB 1HUMA 4H7BA 2EY2A 2QEJC 3TP5A 4HEDA 3HGBA 2J4XA 3IKJA 4FF1A 5KNCA 1A3TA 1Y8OB 1WTWA 2RDHA 1PYWD 5EKIA 1JOQA 4Z9CB 1LABA 3DUZA 1BQQT 1GJXA 1STNA 4J8QA 2KOLA 2F0JA 2IX0A 2H1EA 4JBWA 2EY1A 2D9UA 1KNAA 4RWSC 2L1BA 1O78A 3O13A 3GD7A 1F2ZA 1QOHA 5EPJA 3V96A 3BS1A 5IGBA 1DOMA 1G2SA 1LACA 3J81E 1SNOA 4XDXA 4FF2A 2XN9C 2DNEA 5CV5A 1Q1BA 3CHBD 4EVOA 4FF3A 4X3UA 1WD1A 5JVH3 2K01A 1EL0A 5CYUA 5A2QL 2JSOA 1EU3A 2D62A 4ILWA 4DNTB 4KKTA 4TSSA 5COYA 2KVMA 3EFXD 3IFDA 2R61A 1PTOD 3Q24A 5G3LF 1HPCA 4NKLA 3KUPA 1Y69U 3D31A 3OMGA 4BS9A 4KD4A 3NQTA 4N9PA 4PMCA 1J9OA 5EPLA 3ERQA 4F8MA 1B3AA 4A3BB 3QOJA 3MXNA 2VXWA 4G57A 4DAPA 1RDPD 1ESFA 1Z6HA 2I07B 2PZUA 2F0QA 4RKBA 4QF4A 1CA6A 1JOOA 4LK1C 1I3QB 2NB0A 1VF5C 1NR2A 2NBFA 1BO0A 5EKKA 1MBYA 4B08A 1T5XD 1B2TA 3I70A 2RQXA 1SDFA 2D2CC 5E3FA 3TP8A 1ET9A 2A74C 1GUTA 1EQVA 2IWHA 3K5NA 4HMJA 1NUCA 3JAML 1HQMC 3KBXA 3HRZC 2IX1A 4RKLA 5E4WC 2Y0SB 3DWAA 1FNUA 3PO2B 5KGUA 2PO4A 2BA0A 2Z1CA 1IW7D 4K5WA 2A5HA 1FNWA 1JWUD 3Q22A 1KLGD 2BDOA 5I9PA 2ENBA 3A7AB 1ENFA 2KJXA 1BXTA 4X3TA 4ZLTF 1LTSD 5DAUA 1PTOC 5ELDA 2NN6H 1RTOA 1B53A 2B2YC 2HQEA 4KN4C 3GTJB 3MFYA 4OL7A 1SEBD 4K8JA 1DYQA 3I72A 4ULLA 1X3QA 3H94A 2KHSA 4H0LC 2J7ZA 4BA2I 3DHQA 1DD2A 2ID0A 5I6YA 1RTNA 1BCPF 3CKIB 3I73A 3HOZB 1H9SB 2I46A 5A35A 1H9JA 1SYBA 1TS2A 3SK4A 1RCVD 5C6AA 3ITPA 2L4NA 2RBMA 3D4DA 2JEAI 3GTOB 4XQNA 1AEXA 1PTOB 2WKCA 4RGMA 4FO2A 4RHSA 1Q3LA 3ZYYX 3MAQA 4U68A 2PNRC 3D6CA 3J7AV 5JEAJ 4ABNA 1R4QB 2XWJB 4ZK9B 4TRDA 5HURA 4MN3A 1HFNA 3J80L 1B9NA 4PV1C 3RZOB 1CFMA 5CV8A 1NR4A 1Q90A 5IIFA 3KLRA 2K03A 4JK1C 1IW7C 2F0IA 3OIQA 3SK5A 3U9SA 2AUJD 2WKDA 4IUTA 5A2QE 1LLRD 2KA7A 2G9HD 2EYLA 2C5CA 1EYAA 2F0TA 4R8IA 5D14A 4MIUA 5C3WA 3T53B 1HXYD 5G3LD 2R3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5B D;  1LTI D;  1SE3 A;  1TS3 A;  1XTC D;  2J4X A;  1JR0 D;  1B44 D;  3R8B A;  1HTL D;  1S5F D;  1LTT D;  3MC0 B;  4BWG B;  1BCP B;  1ET6 A;  3BYT B;  1MD2 D;  1S5C D;  1PRT F;  1V1O A;  2NTT A;  2RDH A;  1PYW D;  1LT5 D;  1D5X C;  1V1P A;  1HQR D;  1LT4 D;  1PRT C;  4Z9C B;  1DJR D;  1JCK B;  1SBB B;  1RDP D;  2RDG A;  1ESF A;  1SE4 A;  1I4H A;  1D5M C;  2TSS A;  4K6L A;  3BVG A;  1BCP F;  3BVZ A;  2IJ0 A;  1EEI D;  1LT3 D;  3BZD B;  1JWM D;  5FKA C;  1FD7 D;  1SJE D;  1KLU D;  1EU4 A;  1BCP C;  1UUP A;  3V05 A;  1LTR D;  1TS2 A;  1RCV D;  1L0Y B;  2XNA C;  3EA6 A;  1LT6 D;  4RGO S;  1V1P B;  2Z8L A;  3O13 A;  4RH6 A;  1PTO H;  2QEJ C;  4RGT A;  2NTS A;  1PRT D;  1UNS A;  1AN8 A;  1PTO B;  1S5D D;  4RGM A;  1PZJ D;  4RGN A;  1I4Q A;  1JWS D;  1LTA D;  1T5X D;  1L0X B;  4RFB A;  1SXT A;  4DXG A;  1I4X A;  1EFI D;  1RD9 D;  4RHS A;  1SJH D;  5D3D A;  1HA5 A;  1STE A;  1ET9 A;  2XRQ D;  2AQ2 B;  3URY A;  3BYY B;  2XRS D;  1BCP D;  3OWE B;  1TS5 A;  5I4D A;  2XN9 C;  1EWC A;  3CHB D;  1LTB D;  2AQ1 B;  1FGB D;  5ELC A;  2SEB D;  1KTK A;  3SEB A;  5D3I B;  3DWA A;  3R2I A;  1FNU A;  1S5E D;  4RHR A;  2IPK D;  1D6E C;  1TY0 A;  3MFG A;  1EU3 A;  2QIL A;  1I4P A;  3GP7 A;  4DXF A;  1CT1 D;  1TS4 A;  4RCO A;  1RF2 D;  4ZYS A;  4C56 C;  1CQV A;  1FNW A;  3DWQ A;  3TSS A;  1D5Z C;  3DWP A;  4OHJ A;  4TSS A;  1FNV A;  1JWU D;  1M4V A;  4UDU C;  1CK1 A;  1XXG A;  3R2T A;  1LO5 D;  1KLG D;  4L6T B;  1CHP D;  5FK9 C;  1TY2 A;  1PTO F;  1ENF A;  1F77 A;  1BXT A;  3EFX D;  1LLR D;  2R61 A;  2G9H D;  5ELF A;  1QIL A;  1PTO D;  2WV6 D;  1PZI D;  3BVM A;  1LTS D;  2O2L D;  4O1N A;  1LTG D;  1PTO C;  3KLS X;  1I4G A;  1B1Z A;  5ELD A;  3W2D A;  5ELE A;  1PRT B;  1SE2 A;  5ELB A;  5TSS A;  2AQ3 B;  1CHQ D;  1G8Z D;  1EEF D;  1GOZ A;  1HXY D;  2CHB D;  4L63 B;  1I4R A;  1SEB D;  1PZK D;  1JQY D;  2ICI A;  1AW7 A;  1DYQ A; 
#chains in the Genus database with same CATH topology
 1SE3 A;  3MA2 B;  4LF9 L;  1X3F A;  3SE0 A;  5J22 A;  3I7F A;  1LTT D;  2D0O A;  2YTX A;  3MC0 B;  3KOJ A;  1PLF A;  1BUV T;  1UE1 A;  3CMA A;  3I4N H;  1YNJ D;  4IQZ A;  3OMC A;  4AQY Q;  1G6Z A;  2OQK A;  2EXD A;  1V1P A;  4JI8 L;  2E2I H;  3K80 C;  5M5W H;  1OXU A;  2LFN A;  3K57 A;  4PMB A;  3CP0 A;  3B6Y A;  1I6H H;  5M5X B;  2NYZ D;  2WIN B;  3T1Y L;  3QG1 A;  4J6H A;  4DR6 L;  4H13 C;  3NWT A;  1YNN D;  4IAL A;  4R4Q A;  3HOW B;  3BVZ A;  3AFP A;  1EEI D;  3CCE A;  2NN6 I;  4C3I G;  3ULL A;  4GZY C;  3GQB A;  3GTK B;  1KLU D;  3UDF A;  3F2B A;  1EY7 A;  1BBU A;  2LXK A;  4X64 Q;  1LT6 D;  4DV4 L;  4RGO S;  3M85 A;  3C3L A;  3GTQ B;  1YIJ A;  3M3Y B;  1CM9 A;  5C5M A;  2PCF B;  4BY1 H;  2L9H A;  2ZXP A;  4DAV A;  1MSG A;  1KHI A;  4XQQ A;  4C3I B;  4A3L H;  2I5L X;  5JAV A;  4JI0 L;  3K59 A;  2XRQ D;  2LS0 1;  4V0B A;  2AQ2 B;  1A2T A;  2XVS A;  5BR8 Q;  3WWV A;  1XNR Q;  4QQB X;  1KDB A;  1VQC A;  1YI2 A;  2IHF A;  4IOC A;  3WOF A;  2JA5 G;  5JEA G;  4K6D A;  2K75 A;  1QG7 A;  2K6A A;  3HZX A;  1P8L A;  1X9N A;  1CA5 A;  1E2W A;  4N8X 1;  3QO2 A;  4DUZ L;  1Y1V B;  5CGK A;  3R93 A;  4IFD J;  1F2Y A;  1VMC A;  3MFG A;  1H9M A;  3HOV H;  2JA5 B;  5KNB A;  2E2H H;  1CT1 D;  4RCO A;  1RF2 D;  4CHT B;  3H3V H;  1VF7 A;  3EJI A;  4A3M G;  4DKA C;  1QVF A;  1XXG A;  1SNM A;  4K5X A;  1C48 A;  1PH4 A;  1SN8 A;  1F77 A;  3UI2 A;  1AZP A;  1DGS A;  2AWN A;  3F2C A;  2PW5 A;  4LF8 L;  4QCL A;  4DUY Q;  3K7A H;  1CHQ D;  5IP7 G;  2A69 C;  4A3M B;  2HIX A;  1PMR A;  1C0A A;  4L63 B;  1YJW A;  1U4R A;  3H0G G;  2Z4H A;  2ZT9 C;  4DR7 Q;  2R7Z B;  1S72 A;  1F9S A;  5IT9 c;  1HTL D;  1CKN A;  2F0S A;  1KRT A;  2XIW A;  1NY4 A;  2QF7 A;  1O7Z A;  3OYY A;  2ATW A;  1PRT F;  4OIK A;  1UE6 A;  1YNJ C;  1G29 1;  3A74 A;  3MEF A;  2EY5 A;  3H0G B;  3PIP A;  4GN3 B;  1I50 H;  1JCK B;  3PUZ A;  2C9O A;  1XMQ L;  1I4H A;  3BDL A;  1L0W A;  1BNZ A;  2E8G A;  4KTA A;  4LWC A;  1YNN C;  3MXP A;  4JC0 A;  4JOI A;  1PFB A;  2AHO B;  2NWG A;  3SXH A;  5K5P A;  4A3D G;  4GLA C;  5JOB A;  2H5X A;  4BBS G;  3A7L A;  4NP5 A;  2PZT A;  2QW7 A;  2OTJ A;  2LY7 A;  4HIK A;  1AN8 A;  3QOL A;  2O5J C;  1S5D D;  4DV0 Q;  2TMP A;  3HS0 C;  4CKE A;  4QB4 A;  3JAM i;  1KQS A;  4F7X A;  1RD9 D;  2KUM A;  1STE A;  2ICE C;  3HKZ B;  4A3G B;  1N33 L;  2NZO A;  5IWA L;  3PGZ A;  1SYC A;  2PYK A;  3HFZ B;  4DV2 Q;  2WB1 E;  5BN3 A;  3OW7 A;  4DV7 L;  4X65 L;  1PYS B;  3DMU A;  1E0B A;  4KMU C;  1TWH B;  3SEB A;  1HR0 L;  4M8A A;  4JI2 L;  4FP5 D;  4OWX B;  3RZD B;  3TP7 A;  1SNC A;  2B2U A;  5GAE C;  4IFD G;  2WAC A;  3MHB A;  5LL6 S;  1SYG A;  4KHZ A;  1IHZ A;  4LUO A;  4RMF A;  4LF6 L;  1TS4 A;  4X3S A;  2HDM A;  1DXM A;  1GUS A;  5I2X A;  3RD4 A;  3I90 A;  3J7A F;  4UDU C;  4A3K H;  1STA A;  1Y1W G;  1PFS A;  1CHP D;  1IYJ B;  2K5Q A;  1E22 A;  2WAQ E;  1UE7 A;  1SMY D;  2NZ1 D;  1QIL A;  3BVM A;  4LFB L;  3PMF A;  4DU9 A;  4ME5 A;  4GNX A;  4NDX A;  2FIN B;  2RF4 A;  5T1G A;  4CJ0 B;  3HOU G;  4X66 L;  4DV5 Q;  3PF5 A;  1I4R A;  2JK8 A;  2D5D A;  1Y1W B;  2KEC A;  1C7Y A;  3CD6 A;  3Q8D A;  2VY3 A;  4APV A;  1JR0 D;  1JIC A;  3FPU B;  3ND9 A;  5M3F G;  1RJT A;  1S5F D;  4YHH L;  3K0X A;  4GN4 B;  5M5Y B;  3AB9 A;  1PDQ A;  3OOC A;  3NP8 A;  3BYT B;  2VQF Q;  2G5D A;  1MD2 D;  1S5C D;  2PMZ B;  3H3V I;  4A3B H;  1ENA A;  3V2T A;  2XTI A;  4DK3 C;  4YWK A;  1VQG A;  1TII D;  4C2M B;  5EBC A;  2V4D A;  3GTL B;  1SBB B;  2YTV A;  1SE4 A;  2HHH Q;  2FJ2 A;  4PNY A;  1PH6 A;  5M3F B;  1PH7 A;  4ZKC B;  2TSS A;  1DOL A;  3FRP B;  2B63 G;  2UXC L;  1JWM D;  2YU9 B;  1FD7 D;  3BZC A;  3C2P A;  2LXJ A;  1ZYR C;  1BCP C;  3IRB A;  1ZXT A;  1BR9 A;  5GAH C;  1LTR D;  2B2W A;  2VQE L;  4HCS A;  2NVX B;  3S1Q B;  4A3F G;  1IBK L;  2B2V A;  4R9W A;  4IUU A;  2IW3 A;  2PQE A;  1T9H A;  1ENC A;  3DLL A;  4DV6 L;  1SXT A;  2L15 A;  2KED A;  1I50 B;  4X64 L;  2Y0S E;  1EY8 A;  3W3A A;  4EQP A;  4A3F B;  3URY A;  3A0J A;  1Q86 C;  4XT1 B;  3TRE A;  3K5L A;  1SRO A;  4B3M L;  3CCV A;  3NBI A;  2ZJP A;  3RMH A;  1WTP A;  3KDF A;  3MZ5 A;  1EY6 A;  1BBW A;  5E4X A;  2DJF C;  3PO2 H;  1KRS A;  3KF8 B;  1NBW A;  1RKN A;  2I5M X;  2A6E C;  3QIA A;  1II3 A;  2EJG C;  5CV9 A;  4DR2 L;  3S9W A;  1G51 A;  1A0I A;  3FDT A;  4MTK A;  1HZ9 A;  5FLX L;  4DR3 Q;  4DR1 Q;  1HNX Q;  2A19 A;  2R92 H;  4L5Q A;  4YCU A;  1A2U A;  3H6M A;  2MP1 A;  1VMP A;  3NEN A;  4E6I A;  1VQK A;  3SK8 A;  2DN8 A;  1JOK A;  4NPS A;  1FYC A;  3LWE A;  4HAE A;  5IGE A;  1RIP A;  1SMY C;  5FO7 B;  1KAA A;  1HHV A;  1KXL A;  4IPD A;  1SE2 A;  4EX5 A;  2FMC A;  1S4Z A;  1HH2 P;  2F0W A;  1XWE A;  2K5D A;  1C8C A;  2BH2 A;  1XMO L;  5L37 A;  4IPC A;  1A8V A;  3G6J B;  4HMI A;  2DY7 A;  2ZTD A;  2CWA A;  1Q8I A;  2N55 A;  1GUG A;  4DUY L;  2LKV A;  1N36 Q;  2VS1 A;  4A3J G;  4JVZ A;  2RDF A;  5IP9 G;  4BY7 G;  1QVG A;  4A3K B;  1CSP A;  4JBM A;  4ZAI A;  1TVX A;  4IPG A;  2K7V A;  4FXD A;  3AYH B;  2SOB A;  4CKC A;  3HOZ H;  4IUQ A;  1Y8N B;  1FJG Q;  4WJ3 M;  4A3J B;  2PQA B;  1QVC A;  4C1N K;  3FEW X;  5C3X A;  1VQ6 A;  1LV9 A;  2KCM A;  3K5M A;  1VQ7 A;  3X3N A;  5I9O A;  1FR3 A;  2HCC A;  1W3S A;  1SYD A;  5NUC A;  3GTO H;  1EIH A;  1PTO H;  1ICF B;  3TZU A;  4HJ5 A;  3M4Y A;  2F0M A;  1N9W A;  4XTC S;  4FXG C;  3KFU A;  2Q8I B;  4OO1 G;  3S15 B;  3MTS A;  5GQO A;  4JI5 L;  1SJH D;  2MPM A;  5DLQ E;  1NMG A;  1YIT A;  3ONA B;  1W6J A;  1TS5 A;  2GN5 A;  2KBN A;  5AJ3 L;  4LF7 L;  1D1K A;  3VR2 A;  2EIF A;  2A68 C;  4KKS A;  3NSW A;  2M00 A;  4OX9 L;  3R3O A;  3GTP B;  4LFA L;  4QY7 A;  3T1H Q;  2ZJQ A;  1PYB A;  2F0G A;  4A3C H;  1W6K A;  1Q7Y C;  1D6E C;  3SVM A;  4Y7N B;  1I4P A;  4WFN 3;  2K1B A;  1J5E Q;  1ZKO A;  1IYU A;  5LMN Q;  4F87 A;  2F0N A;  3HOX G;  2J0T D;  3R2T A;  1GUW A;  1XX8 A;  4CKB A;  5FLM H;  3Q0A A;  5FO8 B;  2WV6 D;  4X62 L;  1GO3 E;  3OWF A;  5ELB A;  2L55 A;  3NTK A;  4CDC C;  2BOS A;  1AFP A;  4QMG A;  2Q2U A;  3T4A C;  2UXD Q;  3N6R A;  2SNS A;  4DV1 Q;  3IAY A;  3FKI G;  1BOS A;  2SDF A;  1UE5 A;  5COR A;  2R92 B;  3KJO A;  4JW0 A;  1NE3 A;  5C3E G;  5M5X H;  1A3V A;  2RHQ B;  1ILQ A;  1LT5 D;  2OTL A;  4FNF A;  1PRT C;  3PO3 G;  1DJR D;  2XWB B;  2F0F A;  2SNM A;  3EN2 A;  2IL8 A;  1LM0 A;  1O7I A;  1S3O A;  2A6H C;  2QCP X;  3OHX C;  1F9R A;  4JBJ A;  3GTK H;  2KEE A;  3BVG A;  4JI3 L;  4DGZ A;  1Q8K A;  2F1M A;  2P5Z X;  2RCF A;  5C3E B;  1V8Q A;  1XNQ Q;  3CQZ H;  1TQO A;  4O0A A;  1EU4 A;  1M8A A;  3KF6 A;  5CBA E;  3GTQ H;  4A3I G;  4LMQ D;  4IUR A;  4QGU A;  2HHH L;  1NTG A;  5DM6 3;  4B3S Q;  1OXV A;  3PQI A;  3RLO A;  4C3I H;  5EJW A;  4A3E G;  3I4M G;  4P2C B;  1PV4 A;  1W2B A;  1XYI A;  3C46 A;  3I2Z A;  1AE2 A;  4I65 A;  2B2T A;  3PSI A;  2BH8 A;  4RFB A;  1K73 C;  5LMU Q;  1DZ1 A;  5FJ8 G;  2VZA A;  4PZ8 A;  2KHI A;  1G91 A;  4NXM L;  1CQF A;  1WOC A;  1VQB A;  4RG1 A;  3T51 B;  1JB3 A;  1VQI A;  3TS0 A;  3NEL A;  3MXG A;  4A3E B;  3I4M B;  3NBH A;  3G7L A;  4LF5 Q;  5DEH A;  3K8A A;  3P75 A;  3S2D H;  1LTB D;  1A6X A;  3KBG A;  2AQ1 B;  5IT9 L;  1SYF A;  4LFC Q;  4AYB B;  1VQ9 A;  2R7F A;  1EIF A;  2E76 C;  2NVQ H;  2JA5 H;  5JEA H;  5FOB B;  1ONL A;  4CJ1 B;  3TME A;  2PNH A;  1F2M A;  1CQV A;  1FNV A;  1MGS A;  3CC4 A;  4CBV A;  2HDL A;  1PH2 A;  5KND A;  4GOP C;  3DM3 A;  1EQQ A;  3CF5 A;  4LF4 Q;  5E7N A;  3CCR A;  5CV4 A;  4DR3 L;  5FLX E;  4DR1 L;  3CME A;  1HNX L;  2NUC A;  4A3M H;  4R8N A;  3FP9 A;  2PI2 E;  1J8I A;  1YHA A;  2LMC B;  1O7L A;  3W1B A;  3PF4 A;  3HOY G;  1K3B C;  2CFM A;  1QWY A;  3EVQ A;  2R7Z H;  1VQA A;  3KK7 A;  3J7A 5;  1JQY D;  1FVI A;  1E24 A;  1LTI D;  3N52 A;  4JI6 L;  1MHW C;  2FMM A;  3A8I E;  3I4L A;  4BWG B;  5IP7 H;  3FVQ A;  1HNZ L;  4DAY B;  3SGI A;  3H0G H;  2Z6K A;  2NTT A;  1JJC B;  1WJJ A;  3A5U A;  1E2V A;  3GTG B;  1NMF A;  5JJZ A;  1CSQ A;  4JV5 Q;  2A69 D;  3UDI A;  3S1R B;  1V1Q A;  5D65 A;  2A1A A;  5JJL A;  4K6L A;  4G7Z C;  2JE6 I;  4OWT B;  2DY8 A;  5K36 G;  3D4W A;  3G48 A;  1ILP A;  3HKZ E;  2K52 A;  3E9H A;  1Z47 A;  2WII B;  1V43 A;  4P73 A;  4GOP B;  1V9P A;  4OXP A;  1QUQ A;  4WJW A;  1XJV A;  1FJG L;  1X55 A;  5KIX A;  2MNA A;  1K8A C;  2VUM G;  4A3D H;  1WTX A;  1MJE A;  3S2H B;  2RCN A;  3I55 A;  4POF A;  4RGN A;  5KYL A;  4BBS H;  4A3G H;  3P20 A;  4K8I A;  5ISR A;  4KI0 A;  4PG3 A;  1PH5 A;  3OWE B;  2JEB I;  3U9O A;  1X6O A;  2VUM B;  3CRK C;  4NB3 A;  4J15 A;  2N49 A;  5IYC G;  1EWC A;  4C3J G;  1A62 A;  3CQZ B;  1U9R A;  1TWH H;  4KJO A;  5C0X J;  1C4Q A;  2KQ3 A;  4TKO B;  3RZD H;  1SND A;  5T1I A;  3VR3 A;  3F2D A;  2X69 A;  2YV5 A;  2JN4 A;  1EZ6 A;  2F3V A;  4JI7 Q;  1OXX K;  1M90 C;  4C3J B;  1HFG A;  4ZCK A;  2JP1 A;  2Z0S A;  1EIG A;  5EKL A;  2EDG A;  3NPP A;  4IZ8 A;  3KLS A;  3P1H A;  3A54 A;  1H9R A;  2ZJR A;  3M4O H;  4IFD H;  5EPK A;  2E5L Q;  5FK9 C;  2EYH A;  5BN5 A;  2BDN A;  2NZH A;  3L7Z C;  3KYH C;  1Q81 C;  5CC4 A;  1LTG D;  4RAU C;  3TBI B;  3NTI A;  1J5E L;  3S2D B;  1B1Z A;  5LMN L;  1Y1W H;  1WTH A;  3CCU A;  2Q2H A;  1B7Y B;  4HTH A;  2UUC L;  4OEM B;  1PZK D;  3JAM E;  1X3E A;  2NVQ B;  2B8F A;  5M5Y H;  4HIM A;  2OF1 A;  3Q6S A;  1JC7 A;  4YY3 L;  1X32 A;  1GHJ A;  1BDO A;  5CV6 A;  3HOU H;  3LX0 A;  5CV7 A;  4L8J A;  4JI1 Q;  4C2M H;  4CDD C;  3GTL H;  1QNU A;  1YHB A;  2UXD L;  2FXQ A;  5M3F H;  3GTM B;  2CH4 W;  4FYD A;  4KN7 C;  2YU9 H;  1PFM A;  3VYT A;  5C4J H;  2IJ0 A;  3QR8 A;  1O80 A;  2OXP A;  1JOR A;  4JI4 Q;  2NVX H;  1TT2 A;  3S1Q H;  1VQD A;  1PA6 A;  2MHV A;  3F1Z A;  2XNA C;  4HR7 B;  5IYB H;  2B63 H;  1SSO A;  1TWA B;  3NWS A;  3MXN B;  2QA4 A;  5F2D A;  4B3T Q;  1SNP A;  2OEO A;  1LTA D;  1HRJ A;  1HR0 W;  1NCV A;  1B3Q A;  3TP6 A;  4A3F H;  1EFI D;  3M4P A;  1SRU A;  2CWP A;  2F0E A;  3CW2 C;  4JBK A;  3OTO L;  1SNQ A;  3RLF A;  1EZ8 A;  2NVT B;  2F3W A;  2LSS A;  3NQI A;  1ZYR D;  1BCP D;  4IUV A;  5IGD A;  1EYG A;  3GV6 A;  1Z7T A;  3TS2 A;  1S40 A;  1A63 A;  3TEH B;  5LMU L;  5C0X G;  5KYI A;  3NTH A;  4QL5 A;  1X65 A;  4YCV A;  1JJG A;  1F9Q A;  4A3D B;  2B3G A;  4FVM A;  3NHH A;  1STG A;  2JA6 G;  5EQ0 A;  4BBR G;  4R4C A;  1X3P A;  4B9X A;  4BBS B;  3D6W A;  4ZYS A;  2F4V L;  1L1O A;  2ZM6 L;  3TSS A;  3U58 A;  1F2L A;  3ERO A;  3C1E A;  4DR4 Q;  4R4I A;  4CJ2 C;  1HZB A;  2UUB L;  1STY A;  3Q23 A;  1QJO A;  4XXE A;  4V19 0;  2OT2 A;  3PIO 3;  3CCQ A;  4GN5 A;  4KHP Q;  2B2T C;  1LUZ A;  2K5W A;  3ERS X;  2O2L D;  4P72 A;  4BBR B;  4UY8 C;  2A6E D;  2JA6 B;  1D2B A;  1I4G A;  3D4R A;  5ELE A;  3LNN A;  5C4Z A;  3NE5 B;  3F2U A;  1QNK A;  4KY7 A;  4EQO A;  2R93 G;  1WFQ A;  4BY1 G;  1HNW L;  3R8B A;  1EOT A;  3L0O A;  4QUC A;  2X6G A;  3J80 E;  4OIJ A;  1JT8 A;  1ET6 A;  4YWM A;  5LHY 1;  3SR1 A;  4ALP A;  3E9I A;  3I8Z A;  2K5V A;  4NXN L;  4IFD I;  3M4O B;  1HZA A;  3S1N B;  2RDG A;  2F0L A;  3MEH A;  4A93 G;  4S3S A;  4A3J H;  4CDF C;  4H44 C;  2K32 A;  4BY7 H;  5J39 A;  2O4X A;  2VW9 A;  2B2Y A;  1K0R A;  4DFA A;  3HKS A;  1UUP A;  2ZXO A;  2B29 A;  3V05 A;  4JV5 L;  3EA6 A;  4NW2 A;  4J1M A;  4A93 B;  4MNO A;  1CKO A;  4RGT A;  4GKK L;  3HOU B;  3VR4 A;  3QJY A;  5IGC A;  2RA4 A;  2UUA L;  3S15 H;  1IL2 A;  1PZJ D;  1JWS D;  1PFN A;  4A75 A;  1VQ8 A;  1VQL A;  1WCM G;  3CCL A;  1Q1E A;  1HA5 A;  1WTR A;  2CH4 A;  3L2P A;  2IHE A;  4AQY L;  1A15 A;  3DM1 A;  4O2D A;  4CGY B;  2NVY H;  3VR5 A;  3G71 A;  3MXU A;  4XYO A;  3VYU A;  5I4D A;  2Z6K C;  5C4J B;  2A73 B;  1L2F A;  4OO1 H;  3TDQ A;  1UEB A;  1VDZ A;  3GTP H;  3K81 C;  5KEE A;  2F0O A;  4GKJ Q;  1WCM B;  2JA7 G;  1KTK A;  2N8N A;  4DR5 Q;  5D3I B;  2B63 B;  4Y7N H;  2F0H A;  1UAP A;  1S5E D;  4ZUJ A;  1U4M A;  2RHS B;  3J81 c;  4POG A;  2JJQ A;  1U4P A;  4LUZ A;  2L5T A;  5M3M G;  4KJN A;  4JYA Q;  1EIY B;  3TN2 A;  2OQ0 A;  3J80 i;  1WYD A;  2JA7 B;  5FO9 B;  4IPH A;  2A68 D;  2EYF A;  5M3M B;  4JI7 L;  1MSH A;  4O1N A;  3HOX H;  4B3R Q;  5BR8 L;  3PUV A;  1XNR L;  2CW0 D;  2AQ3 B;  1EEF D;  2K5H A;  1OO9 B;  2E5L L;  4EGV A;  4YIJ A;  1PXU A;  4KY5 A;  2EPB A;  2UU9 Q;  1BCP B;  3DXJ C;  2UXB Q;  1EQT A;  4DK1 A;  1HJP A;  1JJ2 A;  2ZXR A;  3MWY W;  1LT4 D;  2AWO A;  1K8G A;  3UE1 A;  2HIV A;  4DPG A;  2VNU D;  1N8R C;  2E75 C;  2JYO A;  1VQ4 A;  5C3E H;  1SFO B;  4YCW A;  1LT3 D;  5FKA C;  3PO3 H;  2WB1 G;  1KDA A;  1V1P B;  2Z8L A;  4ZUI A;  1C9O A;  2XGT A;  3E0E A;  2L12 A;  1EY4 A;  1PRT D;  1D7Q A;  3P7J A;  2N88 A;  4DR7 L;  2CVR A;  5GAD C;  1QB5 D;  1GM5 A;  4JI4 L;  2MJ8 A;  4A3I H;  2A6H D;  1L0X B;  1I4X A;  4AYB E;  1A3U A;  1TWC H;  4A3E H;  3I4M H;  1I5F A;  2WB1 B;  1HZC A;  2HD3 A;  2XRS D;  4IUP A;  5CR3 A;  1IZ6 A;  2EQS A;  3TRZ A;  4BY7 B;  1Y14 B;  2A8V A;  5C5L A;  1WVL A;  2D0P A;  1CTM A;  1SR3 A;  4PMW A;  2BE5 D;  3E3X A;  2WAQ G;  4LF9 Q;  5FJ8 H;  1EY5 A;  2YYZ A;  4K2K A;  2EJF C;  3H91 A;  4IN3 A;  2H4O A;  2EYJ A;  1DCZ A;  4KD3 A;  3CCS A;  3T13 A;  1R4P B;  4JI8 Q;  5KRU A;  3GV3 A;  1PHJ A;  1VCI A;  3GP7 A;  3T1Y Q;  2WAQ B;  3NEM A;  3L9A X;  2WP8 J;  1STH A;  1IL8 A;  1K3R A;  3K6O A;  2IT1 A;  2NVY B;  1XTD A;  4DV0 L;  1WI5 A;  1D8L A;  5J1Z A;  1ZEQ X;  4OO1 I;  5ELF A;  3STB C;  1WTO A;  1VQJ A;  1PZI D;  2ZTC A;  2PI2 A;  3W2D A;  3S17 B;  5EAY A;  4K14 A;  2UUA Q;  2CW0 C;  4JOI C;  2CHB D;  5GAG C;  4DV2 L;  3RLN A;  2ICI A;  4Q5V A;  3L3O C;  1EY0 A;  2M9V A;  4PQX A;  2RKS A;  3S1M B;  3X3M A;  3IL8 A;  4BA1 I;  4JI0 Q;  3HOY H;  3VR6 A;  3CC7 A;  1GVP A;  3GTG H;  1V1O A;  2OCE A;  1HQR D;  4JCV E;  3H15 A;  2R6G A;  3S1R H;  1YZ6 A;  3ER0 A;  3A55 A;  4DN4 M;  2PPB C;  4ZKB B;  3HOX B;  4UAI A;  1L1O C;  1H95 A;  2Y0S G;  1HA6 A;  3I4O A;  3PO2 G;  3D0F A;  3A8J E;  4MTN A;  1SJE D;  1CKN B;  3CXC A;  2E2J B;  1B50 A;  2I0Q A;  4LNQ A;  1EUJ A;  1YNX A;  1L0Y B;  2O5I C;  2BCO A;  1B8A A;  1E3P A;  1GXD C;  2EYO A;  3BDC A;  3SHL A;  3S2H H;  4QIW B;  2C35 B;  4DV5 L;  2B8G A;  5K36 H;  2B2U C;  1CZG A;  3A8K E;  2AKW B;  3G6E A;  2GA4 B;  2F0K A;  1PH8 A;  1B4O A;  2MQH A;  1K83 B;  3VA5 A;  3FKI B;  2DNC A;  4LF8 Q;  2VQF L;  5HY6 A;  2AMC B;  1I6V C;  2EXZ A;  2HUG A;  2VUM H;  3ICE A;  2F0V A;  1VS0 A;  1YVC A;  4M1U B;  3KLW A;  1DOK A;  3PO3 B;  5E1F A;  4C3H G;  3K5O A;  4GNX C;  2BE5 C;  5ELC A;  2CQA A;  4I7Z C;  3I91 A;  4R4O A;  5IYC H;  5CBE E;  4C3J H;  1ICW A;  2G9D A;  1QCB D;  1YJ9 A;  3FHW A;  1L1O B;  4OGQ C;  4A3I B;  3CRL C;  4NMZ A;  4GKJ L;  3NK9 A;  1U4L A;  4C3H B;  1EQR A;  3U4V A;  1XMQ Q;  3PIP 3;  4DR5 L;  1D5Z C;  1TWC B;  1N32 Q;  1LTL A;  3E6Z X;  1T5E A;  4GS3 A;  3S14 B;  1EWH A;  3HOZ G;  3A56 A;  4UHV A;  2EY6 A;  4JYA L;  4KLK A;  5C4H A;  4ZRZ A;  5FLX c;  1AH9 A;  4FXK C;  1PRT B;  4BXX G;  3M9B A;  5IE8 A;  4TVA B;  4RA8 A;  4EQN A;  1GOZ A;  1RHP A;  2KCT A;  1STB A;  2QKI C;  4FF4 A;  5EGT A;  1E2Z A;  4DA2 A;  2HT1 A;  3CU7 A;  2B2W C;  3DEO A;  4R1J A;  4TQU S;  4B3R L;  2B2V C;  2ES2 A;  4HN7 A;  1TWG H;  1CI3 M;  1PVO A;  3GTM H;  4QUF A;  1FL0 A;  1D5X C;  1DM0 B;  4GNX B;  1IKM A;  1TKW B;  1UWV A;  2K04 A;  1KC8 C;  3PUW A;  4DV7 Q;  4X65 Q;  4KHV A;  2JA8 G;  2M2L A;  3C1F A;  1HR0 Q;  1GUN A;  3H09 A;  2HQL A;  3K58 A;  1TWA H;  4ME3 A;  3S24 A;  1AP0 A;  4ID6 A;  2FFK B;  3AMU A;  1DON A;  2JA8 B;  2K05 A;  3HOY B;  2NTS A;  1UNS A;  5AFW A;  3KF8 A;  5H1S E;  1I4Q A;  2VL6 A;  5FLM G;  1K28 A;  4UP8 A;  1N36 L;  2NVT H;  4KKU A;  4LFB Q;  5D3D A;  2FHT A;  3OIP A;  5DM7 3;  4GLV B;  4X66 Q;  4X3K A;  4LJZ C;  1SYE A;  3WDN A;  3CPF A;  2HCI A;  3BU2 A;  3AFQ A;  1EY9 A;  1FGU A;  2SEB D;  3T56 B;  3R2I A;  4A4I A;  2E2D C;  2VB3 X;  4RHR A;  4DK0 A;  2V1C C;  2RSN A;  1ESR A;  1TY0 A;  4JG2 A;  1AZQ A;  5IOC A;  3AQQ A;  3OW2 A;  1VQN A;  5C0X H;  4F88 A;  2F0D A;  1B9M A;  1QZG A;  3DWQ A;  3FPP A;  3DWP A;  4OHJ A;  3CCJ A;  3KDF B;  3HOW G;  4WRD A;  5JVG 3;  2NN6 G;  3EQL C;  2UXC Q;  2GVA A;  4ODG A;  1WTV A;  5IGF A;  3ZJY C;  4BBR H;  2JA6 H;  1R9T B;  1F9P A;  4K5V A;  5I2Y A;  4G7O C;  3OPO A;  1SMX A;  2VQE Q;  2KCC A;  1Q12 A;  2EE1 A;  1IYV A;  1IBK Q;  2F0P A;  1NAP A;  3JAM c;  3WOE A;  1JE4 A;  2Q2I A;  1TS3 A;  1XTC D;  5BN4 A;  4WJ4 A;  1B44 D;  4DV6 Q;  4HIO A;  3AEV A;  2PQA A;  1YHQ A;  3T16 A;  4LAA A;  3T1H L;  3FMC A;  3S1N H;  4IUN A;  5J3B A;  2R93 H;  1O7Y A;  3D8G A;  1SAP A;  3UDX A;  5C44 G;  4B3M Q;  1K8M A;  1K8O A;  1HCZ A;  4G7H C;  2PMZ E;  1QE6 A;  3RN2 A;  3HG9 A;  3QB3 A;  1UEA B;  1D5M C;  3SK6 A;  5LL6 X;  1BF4 A;  2EJM A;  4XYQ A;  1BBX C;  1Y1V G;  5C4X G;  1OXS C;  4KK7 A;  3S16 B;  3J81 L;  5C44 B;  1IBL Q;  4DR2 Q;  4A93 H;  4RCN A;  2YTY A;  2Q8T A;  1KDC A;  4DNR B;  5M9O A;  4HJ7 A;  4GLX A;  1GUO A;  2K33 A;  2Q8R E;  3VYR A;  4OEL B;  1KIX A;  1J6Q A;  1TWG B;  1I94 Q;  5C4X B;  4R4T A;  2F03 A;  2XSC A;  3NXW A;  4DV1 L;  4G4K A;  3E5S A;  2X6L A;  3E0J A;  5JJI A;  2F4I A;  3LGJ A;  4HJ8 A;  1IKL A;  4PZ6 A;  3K0Y A;  1U0L A;  3ND8 A;  1D1I A;  1TWF H;  3VA7 A;  2PZW A;  1WCM H;  3J7Y W;  1XMO Q;  2R7Z G;  5JPN C;  2CKZ B;  3LWU A;  3TZD A;  1FGB D;  3M7N A;  3BG3 A;  1H9K A;  5HGQ A;  4XQJ A;  1K9M C;  1TU2 B;  1XNQ L;  3SDZ A;  1RL2 A;  3PV0 A;  1TR5 A;  2EVB A;  5IYD G;  1WTQ A;  1KAW A;  4I7A A;  2E74 C;  2JA7 H;  4B3S L;  3PUY A;  2RVL A;  1M4V A;  5HGT A;  4L6T B;  3CC2 A;  5M3M H;  1TY2 A;  1OXT A;  2K50 A;  1PTO F;  3RUZ A;  4ZQ3 A;  3IFT A;  1KNE A;  3KLS X;  4HSP A;  2KCN A;  4B9W A;  4HCE A;  4DV3 Q;  3UDG A;  1G8Z D;  1N32 L;  1VQM A;  3I4N G;  1GHK A;  4XIG S;  4LF5 L;  1AW7 A;  3AU7 A;  1S5B D;  1LYL A;  2MO1 A;  4DAM A;  3J80 c;  5IT9 E;  4LFC L;  2CQO A;  4JI5 Q;  5C0X I;  3HKZ G;  2BA1 A;  4A3G G;  2PW7 A;  3RN5 A;  4KY6 A;  2MGS A;  5IGG A;  3I4N B;  4HJA A;  1G2T A;  1Y8P B;  5AJ3 Q;  2N3S A;  2RSO A;  4U67 3;  2B39 A;  3M7G A;  1SFO H;  2E2I B;  5M5W B;  4LF7 Q;  3GDE A;  1I6H B;  1HUN A;  4OX9 Q;  3GO5 A;  4LFA Q;  3BZD B;  1XPO A;  1CZW A;  4LF4 L;  3CCM A;  4C1N I;  2DGY A;  3HP3 A;  4A3L G;  2VB2 X;  3H3V C;  4DF7 A;  1NNX A;  1H9S A;  2AUK A;  2JXM B;  2QDB A;  2Z6B A;  3U4Z A;  1KL9 A;  5JJK A;  4RH6 A;  1VQE A;  5DNF A;  3DEP A;  3PCO B;  2F0U A;  4WOR A;  3BDO A;  4HSV A;  3VYS A;  2MUY A;  4IOA A;  2R93 B;  2EYM A;  4BY1 B;  1EYD A;  3BZK A;  4DXG A;  1MI2 A;  4N9T A;  1ASY A;  1U5K A;  5IP9 H;  1EFW A;  4X62 Q;  3HEJ A;  1HTP A;  1KAB A;  3KF6 B;  2IX3 A;  3BYY B;  1NSN S;  1E1T A;  1IBM Q;  3QWN A;  3VDY A;  3I3C A;  3HOV G;  2L11 A;  4Q0F A;  4CDE C;  2EYP A;  4K2L A;  2EZV A;  5GRO A;  4LW1 A;  4XT3 B;  1YBY A;  3MVV A;  5JPM C;  1ML0 D;  2IPK D;  1ROD A;  4K0K Q;  2QIL A;  2EOT A;  5EBD A;  2DUD A;  4DXF A;  3OSO A;  1XPU A;  5CMD A;  4C56 C;  3NBH B;  4LUV A;  4O42 A;  3HOV B;  3CPW A;  2E2H B;  4IJH A;  3UE0 A;  1CK1 A;  3NUC A;  1LO5 D;  4JI3 Q;  4EQ5 A;  4KV6 A;  2ASB A;  1TWF B;  5IOD A;  4DAY A;  2Z4I A;  3S17 H;  3RR5 A;  3ULJ A;  4UP7 A;  2L0C A;  5I6W A;  1WD0 A;  2K28 A;  3M4Q A;  4MHE A;  1EYC A;  2F52 A;  3D3R A;  5TSS A;  1VQH A;  1I3Q H;  5IYB G;  1SE8 A;  2N78 A;  3S1M H;  3JC6 6;  3PUX A;  3K7A B;  1HUM A;  4H7B A;  2EY2 A;  2QEJ C;  3TP5 A;  4HED A;  2KEN A;  3HGB A;  2J4X A;  3IKJ A;  4FF1 A;  5KNC A;  1A3T A;  1GD7 A;  4P74 A;  1Y8O B;  2Q2T A;  1WTW A;  4NXM Q;  3STB D;  2RDH A;  1PYW D;  1MJC A;  4GOP A;  3RNU A;  5EKI A;  1JOQ A;  4Z9C B;  1KD1 C;  1LAB A;  4QIW E;  3DUZ A;  3G4S A;  1BQQ T;  3J7Z C;  2E2J H;  1GJX A;  1STN A;  4J8Q A;  2KOL A;  2F0J A;  2IX0 A;  2H1E A;  4JBW A;  2EY1 A;  2D9U A;  4MZ9 A;  1KNA A;  4RWS C;  1IXR A;  2L1B A;  1O78 A;  3EIV A;  3J81 j;  3O13 A;  2JQO A;  3GD7 A;  1F2Z A;  1QOH A;  5EPJ A;  3V96 A;  3BS1 A;  5IGB A;  1K83 H;  1DOM A;  1TXY A;  1G2S A;  1LAC A;  3FKI H;  1PH1 A;  3J81 E;  1IBL L;  1SNO A;  4XDX A;  4A76 A;  4FF2 A;  4JI1 L;  1N34 Q;  3U50 C;  1PH3 A;  1CUK A;  2K14 A;  2XN9 C;  2DNE A;  1I94 L;  1JE5 A;  1QUQ B;  5CV5 A;  1Q1B A;  3CHB D;  4EVO A;  4FF3 A;  4JI6 Q;  4X3U A;  1WD1 A;  1X54 A;  5JVH 3;  1XPR A;  2K01 A;  3GTJ H;  2OWO A;  1HNZ Q;  1EL0 A;  4A3K G;  5CYU A;  4HJ9 A;  5A2Q L;  2JSO A;  4C3H H;  1EU3 A;  2D62 A;  4L5T A;  4ILW A;  2Z9H A;  1VQP A;  1GKH A;  4KKT A;  4DNT B;  2DJG C;  1PH9 A;  1YJN A;  3S14 H;  4TSS A;  1CKM A;  4B3T L;  4PZ7 A;  3I56 A;  5COY A;  2KVM A;  1VQO A;  1AE3 A;  3EFX D;  3IFD A;  2R61 A;  1PTO D;  4YWL A;  3Q24 A;  1X56 A;  3F8T A;  5G3L F;  1HPC A;  4NKL A;  3KUP A;  2IY5 B;  1Y69 U;  3D31 A;  1MIU A;  3OMG A;  4BS9 A;  4A3B G;  1B70 B;  5IY0 A;  4KD4 A;  4DNI A;  1JB7 A;  3NQT A;  1EWI A;  4BXX H;  4DR6 Q;  4N9P A;  4PMC A;  4AIM A;  1J9O A;  4UP9 A;  5EPL A;  4DV3 L;  1M1K C;  3ERQ A;  4F8M A;  1B3A A;  4A3B B;  3QOJ A;  3MXN A;  2VXW A;  3J81 i;  4G57 A;  4DAP A;  1RDP D;  1ESF A;  4DV4 Q;  1Z6H A;  2I07 B;  4DR4 L;  3PIO A;  2PZU A;  2F0Q A;  4RKB A;  4QF4 A;  1CA6 A;  1JOO A;  4LK1 C;  1VQ5 A;  1I3Q B;  4KHP L;  1E7Z A;  2NB0 A;  4HID A;  4X6A H;  2JA8 H;  4FDB A;  1VF5 C;  1NR2 A;  1Z9F A;  3RZO H;  2NBF A;  1BO0 A;  5EKK A;  1MBY A;  4B08 A;  4IO9 A;  1T5X D;  1B2T A;  3I70 A;  2RQX A;  1SDF A;  2D2C C;  5E3F A;  3TP8 A;  1ET9 A;  2A74 C;  1GUT A;  1EQV A;  2IWH A;  3K5N A;  4DUZ Q;  4HMJ A;  1NUC A;  3JAM L;  1HQM C;  2UUC Q;  4L5S A;  2I5H A;  3A5Z B;  3KBX A;  3HRZ C;  4YY3 Q;  2IX1 A;  4RKL A;  5E4W C;  2R92 G;  2Y0S B;  3DWA A;  1FNU A;  2MFI A;  3PO2 B;  5KGU A;  1Q46 A;  1IBM L;  2PO4 A;  2BA0 A;  2Z1C A;  1IW7 D;  3CAM A;  4K5W A;  2A5H A;  4IJL A;  2JA9 A;  3W5O A;  1FNW A;  2QGQ A;  1Q82 C;  1JWU D;  1R9T H;  3Q22 A;  4JPB W;  1KLG D;  1VQF A;  2BDO A;  5I9P A;  2ENB A;  3A7A B;  1K0S A;  1ENF A;  2KJX A;  1BXT A;  2ALY B;  4X3T A;  4ZLT F;  4K0K L;  1LTS D;  5DAU A;  1ASZ A;  1PTO C;  5ELD A;  3HOW H;  1OTC A;  1X3G A;  1RTO A;  2NN6 H;  1B53 A;  4H02 A;  2B2Y C;  2HQE A;  4KN4 C;  5ELO A;  3GTJ B;  2F3I A;  3MFY A;  4OL7 A;  1SEB D;  4K8J A;  1DYQ A;  2QDL A;  1EOV A;  3I72 A;  4ULL A;  1YEZ A;  1X3Q A;  3TQY A;  3H94 A;  2KHS A;  4H0L C;  3M3Y H;  3OTO Q;  2J7Z A;  4BA2 I;  3DHQ A;  1NJI C;  2ZTE A;  4L5R C;  1DD2 A;  2ID0 A;  1G6P A;  5I6Y A;  4AH6 A;  1RTN A;  3W1G A;  1QZH A;  4AYB G;  1BCP F;  3CKI B;  3S16 H;  5C44 H;  2WFW A;  1MKH A;  4OWW B;  3I73 A;  3HOZ B;  1H9S B;  2I46 A;  5A35 A;  1H9J A;  1SYB A;  1TS2 A;  3SK4 A;  1RCV D;  5C6A A;  4UPA A;  3ITP A;  2CCZ A;  2L4N A;  2RBM A;  3D4D A;  2F4V Q;  1Y1V H;  5C4X H;  1N33 Q;  5IWA Q;  2JEA I;  2ZM6 Q;  2QEX A;  3GTO B;  4XQN A;  2UUB Q;  1AEX A;  1BKB A;  1PTO B;  2R7D A;  2WKC A;  4RGM A;  4FO2 A;  2UU9 L;  2MO0 A;  4RHS A;  3K7U C;  2UXB L;  1Q3L A;  3ZYY X;  5ELN A;  3MAQ A;  4OON A;  4U68 A;  4JI2 Q;  2PNR C;  3D6C A;  1JMC A;  4QJF A;  4A3C G;  3J7A V;  5JEA J;  4ABN A;  1R4Q B;  2XWJ B;  4ZK9 B;  2K4K A;  4TRD A;  4LF6 Q;  1HNW Q;  3EBE A;  5HUR A;  4MN3 A;  1HFN A;  3J80 L;  1N34 L;  1B9N A;  4PV1 C;  3RZO B;  1CFM A;  5CV8 A;  1NR4 A;  4DK6 C;  1Q90 A;  4NXN Q;  5IIF A;  3KLR A;  2K03 A;  1P16 A;  4JK1 C;  1IW7 C;  2F0I A;  3OIQ A;  3SK5 A;  3KJP A;  3ULP A;  3U9S A;  5IYD H;  1BVS A;  2AUJ D;  1SLJ A;  2WKD A;  4IUT A;  5A2Q E;  1LLR D;  2KA7 A;  2G9H D;  2EYL A;  2C5C A;  1EYA A;  4Y52 H;  2F0T A;  4N8F A;  2KHJ A;  4P71 A;  4R8I A;  4YHH Q;  2GVB A;  1E1O A;  2K5N A;  5D14 A;  4MIU A;  5C3W A;  3T53 B;  1HXY D;  5G3L D;  4GKK Q;  5LMN W;  2R3Z A;  4P75 A;  3BJU A; 
#chains in the Genus database with same CATH homology
 1SE3 A;  3MA2 B;  3SE0 A;  5J22 A;  1LTT D;  3MC0 B;  1PLF A;  1BUV T;  1YNJ D;  4IQZ A;  3OMC A;  1G6Z A;  1V1P A;  1OXU A;  2LFN A;  3K57 A;  4PMB A;  5M5X B;  2NYZ D;  2WIN B;  3QG1 A;  4J6H A;  4H13 C;  3NWT A;  1YNN D;  4IAL A;  3HOW B;  3BVZ A;  1EEI D;  2NN6 I;  4C3I G;  4GZY C;  3GQB A;  3GTK B;  1KLU D;  1EY7 A;  1LT6 D;  4RGO S;  3M85 A;  3C3L A;  3GTQ B;  3M3Y B;  1CM9 A;  5C5M A;  2PCF B;  2L9H A;  2ZXP A;  4DAV A;  1MSG A;  4XQQ A;  4C3I B;  5JAV A;  3K59 A;  2XRQ D;  2LS0 1;  4V0B A;  2AQ2 B;  1A2T A;  2XVS A;  1KDB A;  3WOF A;  5JEA G;  4K6D A;  1QG7 A;  2K6A A;  3HZX A;  1CA5 A;  1E2W A;  3QO2 A;  1Y1V B;  5CGK A;  3R93 A;  4IFD J;  1F2Y A;  1VMC A;  3MFG A;  1H9M A;  2JA5 B;  5KNB A;  1CT1 D;  4RCO A;  1RF2 D;  4CHT B;  1VF7 A;  3EJI A;  1XXG A;  1SNM A;  4K5X A;  1C48 A;  1F77 A;  3UI2 A;  1AZP A;  2AWN A;  2PW5 A;  4QCL A;  1CHQ D;  2A69 C;  4A3M B;  1PMR A;  4L63 B;  1U4R A;  2Z4H A;  2ZT9 C;  2R7Z B;  1F9S A;  1HTL D;  2F0S A;  2XIW A;  2QF7 A;  1O7Z A;  1PRT F;  4OIK A;  1YNJ C;  1G29 1;  2EY5 A;  3H0G B;  1JCK B;  3PUZ A;  2C9O A;  1I4H A;  3BDL A;  1BNZ A;  4KTA A;  1YNN C;  3MXP A;  1PFB A;  5K5P A;  2NWG A;  3SXH A;  5JOB A;  3A7L A;  4NP5 A;  2PZT A;  2LY7 A;  1AN8 A;  3QOL A;  2O5J C;  1S5D D;  2TMP A;  3HS0 C;  4CKE A;  4QB4 A;  4F7X A;  1RD9 D;  2KUM A;  1STE A;  2ICE C;  3HKZ B;  4A3G B;  1SYC A;  2PYK A;  5BN3 A;  3OW7 A;  3DMU A;  1E0B A;  4KMU C;  1TWH B;  3SEB A;  4M8A A;  4FP5 D;  3RZD B;  3TP7 A;  1SNC A;  2B2U A;  4IFD G;  2WAC A;  3MHB A;  5LL6 S;  1SYG A;  4KHZ A;  1IHZ A;  1TS4 A;  4X3S A;  2HDM A;  1DXM A;  1GUS A;  5I2X A;  3RD4 A;  3I90 A;  3J7A F;  4UDU C;  1STA A;  1CHP D;  2K5Q A;  1SMY D;  2NZ1 D;  1QIL A;  3BVM A;  3PMF A;  4DU9 A;  4ME5 A;  4NDX A;  2FIN B;  5T1G A;  4CJ0 B;  1I4R A;  2D5D A;  1Y1W B;  2KEC A;  1JR0 D;  1JIC A;  3FPU B;  3ND9 A;  1RJT A;  1S5F D;  5M5Y B;  3AB9 A;  1PDQ A;  3OOC A;  3NP8 A;  3BYT B;  2PMZ B;  1MD2 D;  1S5C D;  1ENA A;  3V2T A;  1TII D;  4C2M B;  5EBC A;  2V4D A;  3GTL B;  1SBB B;  1SE4 A;  2FJ2 A;  4PNY A;  5M3F B;  4ZKC B;  2TSS A;  1DOL A;  3FRP B;  1JWM D;  2YU9 B;  1FD7 D;  3C2P A;  1ZYR C;  1BCP C;  1ZXT A;  1BR9 A;  1LTR D;  2B2W A;  4HCS A;  2NVX B;  3S1Q B;  2B2V A;  4R9W A;  4IUU A;  2IW3 A;  2PQE A;  1ENC A;  1SXT A;  2KED A;  1I50 B;  1EY8 A;  3W3A A;  4EQP A;  4A3F B;  3URY A;  4XT1 B;  3K5L A;  3NBI A;  3RMH A;  1WTP A;  3MZ5 A;  1EY6 A;  5E4X A;  1RKN A;  2A6E C;  3QIA A;  1II3 A;  2EJG C;  5CV9 A;  3S9W A;  3FDT A;  5FLX L;  1A2U A;  3H6M A;  2MP1 A;  1VMP A;  4E6I A;  3SK8 A;  2DN8 A;  1JOK A;  1FYC A;  3LWE A;  4HAE A;  5IGE A;  1SMY C;  5FO7 B;  1KAA A;  1HHV A;  1SE2 A;  2FMC A;  1S4Z A;  2F0W A;  1XWE A;  2K5D A;  1C8C A;  3G6J B;  4HMI A;  2DY7 A;  1Q8I A;  2N55 A;  1GUG A;  2LKV A;  2RDF A;  4A3K B;  4ZAI A;  1TVX A;  2K7V A;  4FXD A;  2SOB A;  4CKC A;  4IUQ A;  1Y8N B;  4A3J B;  4C1N K;  3FEW X;  5C3X A;  1LV9 A;  3K5M A;  3X3N A;  5I9O A;  1FR3 A;  2HCC A;  1SYD A;  5NUC A;  1EIH A;  1PTO H;  3TZU A;  3M4Y A;  2F0M A;  4XTC S;  4FXG C;  2Q8I B;  4OO1 G;  3S15 B;  3MTS A;  1SJH D;  2MPM A;  3ONA B;  1W6J A;  1TS5 A;  1D1K A;  3VR2 A;  2A68 C;  4KKS A;  3NSW A;  2M00 A;  3R3O A;  3GTP B;  2F0G A;  1W6K A;  1D6E C;  3SVM A;  4Y7N B;  1I4P A;  4WFN 3;  2K1B A;  1ZKO A;  1IYU A;  4F87 A;  2F0N A;  2J0T D;  3R2T A;  1GUW A;  1XX8 A;  4CKB A;  3Q0A A;  5FO8 B;  2WV6 D;  3OWF A;  5ELB A;  2L55 A;  3NTK A;  2BOS A;  1AFP A;  4QMG A;  3T4A C;  3N6R A;  2SNS A;  3IAY A;  1BOS A;  2SDF A;  5COR A;  2R92 B;  1A3V A;  1ILQ A;  1LT5 D;  4FNF A;  1PRT C;  1DJR D;  2XWB B;  2F0F A;  2SNM A;  2IL8 A;  2A6H C;  2QCP X;  3OHX C;  1F9R A;  2KEE A;  3BVG A;  4DGZ A;  2F1M A;  5C3E B;  1V8Q A;  1TQO A;  1EU4 A;  1M8A A;  5CBA E;  4LMQ D;  4IUR A;  5DM6 3;  1OXV A;  5EJW A;  4P2C B;  1XYI A;  3C46 A;  4I65 A;  2B2T A;  4RFB A;  1DZ1 A;  1G91 A;  1CQF A;  3T51 B;  1JB3 A;  4A3E B;  3I4M B;  3MXG A;  3NBH A;  3G7L A;  5DEH A;  3P75 A;  1LTB D;  1A6X A;  3KBG A;  2AQ1 B;  5IT9 L;  1SYF A;  4AYB B;  2E76 C;  5JEA H;  5FOB B;  1ONL A;  4CJ1 B;  3TME A;  1F2M A;  1CQV A;  1FNV A;  1MGS A;  4CBV A;  2HDL A;  5KND A;  5CV4 A;  5FLX E;  2NUC A;  4R8N A;  1J8I A;  2LMC B;  1O7L A;  1QWY A;  3EVQ A;  3KK7 A;  1JQY D;  1LTI D;  3N52 A;  2FMM A;  3A8I E;  3I4L A;  4BWG B;  3FVQ A;  2NTT A;  1E2V A;  3GTG B;  5JJZ A;  2A69 D;  3S1R B;  5D65 A;  4K6L A;  4G7Z C;  2JE6 I;  2DY8 A;  5K36 G;  3D4W A;  1ILP A;  1Z47 A;  2WII B;  1V43 A;  4WJW A;  5KIX A;  1WTX A;  3S2H B;  4RGN A;  5KYL A;  3P20 A;  4K8I A;  5ISR A;  4KI0 A;  3OWE B;  2JEB I;  3U9O A;  2VUM B;  3CRK C;  1EWC A;  4C3J G;  3CQZ B;  1U9R A;  4KJO A;  5C0X J;  1C4Q A;  2KQ3 A;  4TKO B;  1SND A;  5T1I A;  3VR3 A;  2X69 A;  1EZ6 A;  2F3V A;  1OXX K;  4C3J B;  1HFG A;  2JP1 A;  1EIG A;  5EKL A;  2EDG A;  3NPP A;  4IZ8 A;  3KLS A;  3P1H A;  3A54 A;  1H9R A;  4IFD H;  5EPK A;  5FK9 C;  2EYH A;  5BN5 A;  2BDN A;  3L7Z C;  5CC4 A;  1LTG D;  4RAU C;  3TBI B;  3NTI A;  3S2D B;  1B1Z A;  4HTH A;  1PZK D;  3JAM E;  2NVQ B;  2B8F A;  2OF1 A;  3Q6S A;  1JC7 A;  1X32 A;  1GHJ A;  1BDO A;  5CV6 A;  3LX0 A;  5CV7 A;  4L8J A;  1QNU A;  3GTM B;  4FYD A;  4KN7 C;  1PFM A;  3VYT A;  2IJ0 A;  1O80 A;  2OXP A;  1JOR A;  1TT2 A;  2MHV A;  2XNA C;  4HR7 B;  1SSO A;  1TWA B;  3NWS A;  5F2D A;  1SNP A;  2OEO A;  1LTA D;  1HRJ A;  1NCV A;  3TP6 A;  1EFI D;  2F0E A;  1SNQ A;  3RLF A;  1EZ8 A;  2NVT B;  2F3W A;  3NQI A;  4IUV A;  1ZYR D;  1BCP D;  5IGD A;  3GV6 A;  1Z7T A;  5C0X G;  5KYI A;  3NTH A;  1F9Q A;  4A3D B;  4FVM A;  3NHH A;  1STG A;  5EQ0 A;  1X3P A;  4B9X A;  4BBS B;  3D6W A;  4ZYS A;  3TSS A;  1F2L A;  3ERO A;  3C1E A;  4CJ2 C;  1STY A;  3Q23 A;  1QJO A;  4XXE A;  4V19 0;  2OT2 A;  3PIO 3;  2B2T C;  2K5W A;  2JA6 B;  2O2L D;  4BBR B;  1D2B A;  2A6E D;  1I4G A;  3D4R A;  5ELE A;  3LNN A;  5C4Z A;  3NE5 B;  3F2U A;  1QNK A;  4KY7 A;  4EQO A;  3R8B A;  4QUC A;  1EOT A;  3J80 E;  2X6G A;  4OIJ A;  1ET6 A;  5LHY 1;  3SR1 A;  3I8Z A;  4IFD I;  3M4O B;  3S1N B;  2RDG A;  2F0L A;  3MEH A;  4S3S A;  4H44 C;  2K32 A;  5J39 A;  2O4X A;  2B2Y A;  4DFA A;  1UUP A;  2ZXO A;  3V05 A;  3EA6 A;  4NW2 A;  4J1M A;  4A93 B;  4RGT A;  3HOU B;  3VR4 A;  3QJY A;  5IGC A;  2RA4 A;  1PZJ D;  1JWS D;  1PFN A;  1Q1E A;  1HA5 A;  1WTR A;  1A15 A;  3DM1 A;  4CGY B;  3VR5 A;  3MXU A;  4XYO A;  3VYU A;  5I4D A;  5C4J B;  2A73 B;  4OO1 H;  3TDQ A;  1VDZ A;  5KEE A;  2F0O A;  1WCM B;  1KTK A;  5D3I B;  2B63 B;  2F0H A;  1UAP A;  1S5E D;  4ZUJ A;  1U4M A;  1U4P A;  2L5T A;  4KJN A;  3TN2 A;  2JA7 B;  5FO9 B;  2A68 D;  2EYF A;  5M3M B;  1MSH A;  4O1N A;  3PUV A;  2CW0 D;  2AQ3 B;  1EEF D;  1OO9 B;  4EGV A;  4YIJ A;  1PXU A;  4KY5 A;  2EPB A;  1BCP B;  3DXJ C;  1EQT A;  4DK1 A;  2ZXR A;  3MWY W;  1LT4 D;  2AWO A;  2VNU D;  2E75 C;  2JYO A;  1SFO B;  1LT3 D;  5FKA C;  1KDA A;  1V1P B;  2Z8L A;  4ZUI A;  2L12 A;  1EY4 A;  1PRT D;  3P7J A;  2N88 A;  2CVR A;  1QB5 D;  2MJ8 A;  2A6H D;  1L0X B;  1I4X A;  1A3U A;  2WB1 B;  2XRS D;  4IUP A;  5CR3 A;  4BY7 B;  5C5L A;  1WVL A;  1CTM A;  4PMW A;  2BE5 D;  1EY5 A;  2YYZ A;  4K2K A;  2EJF C;  3H91 A;  4IN3 A;  2H4O A;  2EYJ A;  1DCZ A;  4KD3 A;  3T13 A;  1R4P B;  5KRU A;  3GV3 A;  1VCI A;  3GP7 A;  2WAQ B;  3L9A X;  2WP8 J;  1STH A;  1IL8 A;  3K6O A;  2IT1 A;  2NVY B;  5J1Z A;  1ZEQ X;  4OO1 I;  5ELF A;  1WTO A;  1PZI D;  3W2D A;  3S17 B;  4K14 A;  2CW0 C;  2CHB D;  2ICI A;  4Q5V A;  3L3O C;  1EY0 A;  2M9V A;  4PQX A;  2RKS A;  3S1M B;  3X3M A;  3IL8 A;  4BA1 I;  3VR6 A;  1V1O A;  1HQR D;  2R6G A;  3A55 A;  4DN4 M;  2PPB C;  4ZKB B;  3HOX B;  4UAI A;  1HA6 A;  3A8J E;  2E2J B;  1SJE D;  1B50 A;  1L0Y B;  2O5I C;  2BCO A;  3SHL A;  1GXD C;  2EYO A;  3BDC A;  4QIW B;  2B8G A;  5K36 H;  2B2U C;  1CZG A;  3A8K E;  2GA4 B;  2F0K A;  1B4O A;  1K83 B;  3VA5 A;  3FKI B;  2DNC A;  1I6V C;  2EXZ A;  2HUG A;  2F0V A;  4M1U B;  1DOK A;  3PO3 B;  5E1F A;  4C3H G;  3K5O A;  2BE5 C;  5ELC A;  2CQA A;  4I7Z C;  3I91 A;  5CBE E;  1ICW A;  2G9D A;  1QCB D;  4OGQ C;  4A3I B;  3CRL C;  4NMZ A;  3NK9 A;  1U4L A;  4C3H B;  3PIP 3;  1D5Z C;  1TWC B;  3E6Z X;  1T5E A;  3S14 B;  1EWH A;  3A56 A;  2EY6 A;  5C4H A;  4ZRZ A;  4FXK C;  1PRT B;  4RA8 A;  4EQN A;  1GOZ A;  1RHP A;  1STB A;  2QKI C;  4FF4 A;  5EGT A;  1E2Z A;  4DA2 A;  3CU7 A;  2B2W C;  3DEO A;  4TQU S;  2B2V C;  4HN7 A;  1CI3 M;  4QUF A;  1D5X C;  1DM0 B;  1IKM A;  1TKW B;  2K04 A;  3PUW A;  4KHV A;  2M2L A;  3C1F A;  1GUN A;  3H09 A;  3K58 A;  1AP0 A;  4ID6 A;  2FFK B;  3AMU A;  1DON A;  2JA8 B;  2K05 A;  3HOY B;  2NTS A;  1UNS A;  5AFW A;  3KF8 A;  1I4Q A;  4KKU A;  5D3D A;  2FHT A;  3OIP A;  5DM7 3;  4X3K A;  4LJZ C;  1SYE A;  3WDN A;  2HCI A;  1EY9 A;  2SEB D;  3T56 B;  3R2I A;  2E2D C;  2VB3 X;  4RHR A;  4DK0 A;  2RSN A;  1ESR A;  1TY0 A;  1AZQ A;  5IOC A;  5C0X H;  4F88 A;  2F0D A;  1B9M A;  3DWQ A;  3FPP A;  3DWP A;  4OHJ A;  4WRD A;  5JVG 3;  2NN6 G;  3EQL C;  4ODG A;  1WTV A;  5IGF A;  1R9T B;  1F9P A;  4K5V A;  5I2Y A;  4G7O C;  3OPO A;  2KCC A;  1Q12 A;  2EE1 A;  1IYV A;  2F0P A;  1NAP A;  3WOE A;  1JE4 A;  1TS3 A;  1XTC D;  5BN4 A;  1B44 D;  3T16 A;  4LAA A;  3FMC A;  4IUN A;  1O7Y A;  3D8G A;  1SAP A;  1K8M A;  1K8O A;  1HCZ A;  4G7H C;  1QE6 A;  3HG9 A;  3QB3 A;  1UEA B;  1D5M C;  3SK6 A;  5LL6 X;  1BF4 A;  2EJM A;  4XYQ A;  1BBX C;  1OXS C;  4KK7 A;  3S16 B;  3J81 L;  5C44 B;  4RCN A;  2Q8T A;  1KDC A;  4DNR B;  5M9O A;  1GUO A;  2K33 A;  2Q8R E;  3VYR A;  1TWG B;  5C4X B;  2F03 A;  2XSC A;  3NXW A;  4G4K A;  3E5S A;  2X6L A;  3E0J A;  2F4I A;  1IKL A;  3K0Y A;  3ND8 A;  1D1I A;  3VA7 A;  2PZW A;  3J7Y W;  5JPN C;  3LWU A;  3TZD A;  1FGB D;  3M7N A;  3BG3 A;  1H9K A;  4XQJ A;  1TU2 B;  3SDZ A;  3PV0 A;  1TR5 A;  2EVB A;  1WTQ A;  2E74 C;  3PUY A;  2RVL A;  1M4V A;  5HGT A;  4L6T B;  1TY2 A;  1OXT A;  1PTO F;  3RUZ A;  4ZQ3 A;  3IFT A;  1KNE A;  3KLS X;  4HSP A;  2KCN A;  4B9W A;  4HCE A;  1G8Z D;  1GHK A;  4XIG S;  1AW7 A;  3AU7 A;  1S5B D;  5IT9 E;  5C0X I;  2BA1 A;  2PW7 A;  4KY6 A;  2MGS A;  5IGG A;  3I4N B;  1G2T A;  1Y8P B;  2RSO A;  4U67 3;  2B39 A;  3M7G A;  2E2I B;  5M5W B;  1I6H B;  1HUN A;  3GO5 A;  3BZD B;  1CZW A;  4C1N I;  3HP3 A;  2VB2 X;  3H3V C;  4DF7 A;  2JXM B;  1H9S A;  2AUK A;  2QDB A;  4RH6 A;  5DNF A;  3DEP A;  4WOR A;  2F0U A;  3BDO A;  4HSV A;  3VYS A;  2MUY A;  2R93 B;  2EYM A;  4BY1 B;  1EYD A;  4DXG A;  1MI2 A;  4N9T A;  3HEJ A;  1HTP A;  1KAB A;  2IX3 A;  3BYY B;  1NSN S;  3QWN A;  3I3C A;  2L11 A;  4Q0F A;  2EYP A;  4K2L A;  2EZV A;  4XT3 B;  3MVV A;  5JPM C;  1ML0 D;  2IPK D;  1ROD A;  2QIL A;  2EOT A;  5EBD A;  4DXF A;  3OSO A;  5CMD A;  4C56 C;  4O42 A;  3HOV B;  2E2H B;  1CK1 A;  3NUC A;  1LO5 D;  4KV6 A;  1TWF B;  5IOD A;  4DAY A;  2Z4I A;  2L0C A;  5I6W A;  1WD0 A;  2K28 A;  4MHE A;  1EYC A;  3D3R A;  5TSS A;  3PUX A;  3K7A B;  1HUM A;  4H7B A;  2EY2 A;  2QEJ C;  3TP5 A;  4HED A;  3HGB A;  2J4X A;  3IKJ A;  4FF1 A;  5KNC A;  1A3T A;  1Y8O B;  1WTW A;  2RDH A;  1PYW D;  5EKI A;  1JOQ A;  4Z9C B;  1LAB A;  3DUZ A;  1BQQ T;  1GJX A;  1STN A;  4J8Q A;  2KOL A;  2F0J A;  2IX0 A;  2H1E A;  4JBW A;  2EY1 A;  2D9U A;  1KNA A;  4RWS C;  2L1B A;  1O78 A;  3O13 A;  3GD7 A;  1F2Z A;  1QOH A;  5EPJ A;  3V96 A;  3BS1 A;  5IGB A;  1DOM A;  1G2S A;  1LAC A;  3J81 E;  1SNO A;  4XDX A;  4FF2 A;  2XN9 C;  2DNE A;  5CV5 A;  1Q1B A;  3CHB D;  4EVO A;  4FF3 A;  4X3U A;  1WD1 A;  5JVH 3;  2K01 A;  1EL0 A;  5CYU A;  5A2Q L;  2JSO A;  1EU3 A;  2D62 A;  4ILW A;  4DNT B;  4KKT A;  4TSS A;  5COY A;  2KVM A;  3EFX D;  3IFD A;  2R61 A;  1PTO D;  3Q24 A;  5G3L F;  1HPC A;  4NKL A;  3KUP A;  1Y69 U;  3D31 A;  3OMG A;  4BS9 A;  4KD4 A;  3NQT A;  4N9P A;  4PMC A;  1J9O A;  5EPL A;  3ERQ A;  4F8M A;  1B3A A;  4A3B B;  3QOJ A;  3MXN A;  2VXW A;  4G57 A;  4DAP A;  1RDP D;  1ESF A;  1Z6H A;  2I07 B;  2PZU A;  2F0Q A;  4RKB A;  4QF4 A;  1CA6 A;  1JOO A;  4LK1 C;  1I3Q B;  2NB0 A;  1VF5 C;  1NR2 A;  2NBF A;  1BO0 A;  5EKK A;  1MBY A;  4B08 A;  1T5X D;  1B2T A;  3I70 A;  2RQX A;  1SDF A;  2D2C C;  5E3F A;  3TP8 A;  1ET9 A;  2A74 C;  1GUT A;  1EQV A;  2IWH A;  3K5N A;  4HMJ A;  1NUC A;  3JAM L;  1HQM C;  3KBX A;  3HRZ C;  2IX1 A;  4RKL A;  5E4W C;  2Y0S B;  3DWA A;  1FNU A;  3PO2 B;  5KGU A;  2PO4 A;  2BA0 A;  2Z1C A;  1IW7 D;  4K5W A;  2A5H A;  1FNW A;  1JWU D;  3Q22 A;  1KLG D;  2BDO A;  5I9P A;  2ENB A;  3A7A B;  1ENF A;  2KJX A;  1BXT A;  4X3T A;  4ZLT F;  1LTS D;  5DAU A;  1PTO C;  5ELD A;  2NN6 H;  1RTO A;  1B53 A;  2B2Y C;  2HQE A;  4KN4 C;  3GTJ B;  3MFY A;  4OL7 A;  1SEB D;  4K8J A;  1DYQ A;  3I72 A;  4ULL A;  1X3Q A;  3H94 A;  2KHS A;  4H0L C;  2J7Z A;  4BA2 I;  3DHQ A;  1DD2 A;  2ID0 A;  5I6Y A;  1RTN A;  1BCP F;  3CKI B;  3I73 A;  3HOZ B;  1H9S B;  2I46 A;  5A35 A;  1H9J A;  1SYB A;  1TS2 A;  3SK4 A;  1RCV D;  5C6A A;  3ITP A;  2L4N A;  2RBM A;  3D4D A;  2JEA I;  3GTO B;  4XQN A;  1AEX A;  1PTO B;  2WKC A;  4RGM A;  4FO2 A;  4RHS A;  1Q3L A;  3ZYY X;  3MAQ A;  4U68 A;  2PNR C;  3D6C A;  3J7A V;  5JEA J;  4ABN A;  1R4Q B;  2XWJ B;  4ZK9 B;  4TRD A;  5HUR A;  4MN3 A;  1HFN A;  3J80 L;  1B9N A;  4PV1 C;  3RZO B;  1CFM A;  5CV8 A;  1NR4 A;  1Q90 A;  5IIF A;  3KLR A;  2K03 A;  4JK1 C;  1IW7 C;  2F0I A;  3OIQ A;  3SK5 A;  3U9S A;  2AUJ D;  2WKD A;  4IUT A;  5A2Q E;  1LLR D;  2KA7 A;  2G9H D;  2EYL A;  2C5C A;  1EYA A;  2F0T A;  4R8I A;  5D14 A;  4MIU A;  5C3W A;  3T53 B;  1HXY D;  5G3L D;  2R3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...