1B44D

Crystal structure of the b subunit of heat-labile enterotoxin from e. coli carrying a peptide with anti-hsv activity
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEKLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (B-POL SUBUNIT OF HEAT-LABILE ENTEROTOXIN)
publication title Crystal structure of the B subunit of Escherichia coli heat-labile enterotoxin carrying peptides with anti-herpes simplex virus type 1 activity.
pubmed rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 26
structure length 106
sequence length 106
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1999-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b44D00
4RH6A 3R8BA 1D5XC 1DYQA 5FKAC 1LT3D 1I4QA 5ELFA 1PTOF 2QILA 2XNAC 5TSSA 1JR0D 3TSSA 1PRTB 2AQ3B 1PRTC 1PTOB 1PTOC 3KLSX 1EWCA 1PRTD 1PTOD 3MFGA 2IPKD 4C56C 1EEID 1HTLD 3DWPA 1BXTA 4DXFA 1SE4A 1SJED 2QEJC 1I4GA 1ENFA 1PZJD 1LO5D 1FNUA 1HXYD 5ELEA 3DWQA 1LLRD 1XTCD 4L6TB 4RGMA 2AQ1B 4RCOA 2ICIA 1KLGD 4BWGB 3R2IA 1EU3A 1QILA 1FGBD 1LTTD 1LT5D 3SEBA 1UNSA 1EU4A 3O13A 3V05A 1DJRD 3BZDB 1V1OA 1S5DD 1EFID 2CHBD 1D5ZC 1M4VA 4ZYSA 1D5MC 1B44D 1LTRD 1JWSD 4UDUC 3CHBD 2G9HD 1FD7D 1STEA 1HA5A 2TSSA 4DXGA 1EEFD 3BYTB 3URYA 4O1NA 2RDHA 1XXGA 1SXTA 1T5XD 1LT6D 4OHJA 1V1PA 1SJHD 1S5FD 1TS3A 3R2TA 1KLUD 4Z9CB 1PZKD 1SEBD 1TS4A 4RGOS 1TS5A 2AQ2B 3OWEB 4RFBA 5I4DA 1D6EC 1LT4D 1PTOH 1SBBB 2J4XA 3BVGA 4RHSA 1S5BD 5FK9C 1LTAD 1LTBD 3W2DA 3DWAA 1ESFA 2O2LD 1S5ED 1L0YB 1JCKB 3EA6A 4RGNA 1ET6A 1TS2A 3BVZA 4RGTA 2IJ0A 1KTKA 4L63B 1PYWD 5ELBA 1I4PA 4TSSA 1CHPD 5D3IB 2NTSA 1LTID 1G8ZD 4RHRA 1F77A 1V1PB 3BVMA 1I4XA 1SE2A 1I4RA 3MC0B 1ET9A 1RF2D 1L0XB 2XN9C 1LTGD 2R61A 1PRTF 1RDPD 1LTSD 3GP7A 1FNVA 1MD2D 1TY0A 1CT1D 1AN8A 1JWUD 3BYYB 1BCPF 1HQRD 2XRQD 1RCVD 5ELCA 1BCPB 1I4HA 1BCPC 2RDGA 1JQYD 1B1ZA 1UUPA 1FNWA 1BCPD 1S5CD 1JWMD 1AW7A 2Z8LA 3EFXD 1RD9D 2WV6D 1CHQD 1CK1A 5ELDA 1PZID 2SEBD 5D3DA 1CQVA 2XRSD 4K6LA 1TY2A 1SE3A 1GOZA 2NTTA
chains in the Genus database with same CATH superfamily
1NTGA 4X3KA 2UXCL 4HN7A 1PTOF 3IRBA 4KJOA 3HOXB 1EY8A 3J7AF 4AH6A 4BA2I 2EOTA 4KN4C 1B3AA 5DM73 4DV6L 3MWYW 3G48A 1SNMA 2JA8H 1PZJD 1LO5D 1SNCA 4GLXA 1NMFA 5H1SE 1SYDA 3L9AX 3ERSX 1SMYC 4BA1I 4NB3A 4DF7A 4G7HC 2IW3A 5M5XH 3SEBA 2E75C 2R93H 4FF4A 5EJWA 3BS1A 4X3SA 4KHPL 1I50H 2F0HA 2ASBA 1TWAH 2PYKA 1C7YA 1Y14B 3D31A 1K3BC 1WD0A 2B63B 3GTOH 5IT9E 4UY8C 1VQDA 1DCZA 2JEAI 1KAAA 5KNBA 4UAIA 4BS9A 5M3FH 4A3IG 3L0OA 2B8GA 4O2DA 3DM3A 2NZOA 2JA6G 1D6EC 1LT4D 4J8QA 2AHOB 3K5MA 5CV8A 4JI1L 4C1NI 1OXSC 5FJ8G 2PCFB 3TREA 4B3SL 4NMZA 4K8IA 4YCUA 3ERQA 3GD7A 1STNA 2NZHA 4DAPA 1L0XB 4QMGA 1GM5A 3J81E 3I4OA 1EOTA 1PYBA 2NVTB 2LKVA 3NQTA 2K5DA 2PI2A 4LFCQ 4KHVA 5J22A 4JBWA 4A3DH 4WORA 1ZYRD 2EIFA 5C3WA 1ML0D 3OMCA 4IFDH 4K2KA 3S1QH 3M4OB 3EBEA 2F0UA 4HSPA 1K8OA 4NKLA 2A6EC 4H44C 1NY4A 3EQLC 1PFBA 2K5HA 3FKIH 5DLQE 3V2TA 3CC7A 2VUMB 1A63A 1N33L 3CXCA 2NTTA 3PO2G 3EIVA 4DV5Q 1B4OA 4A3GH 1S4ZA 5C3EB 2ES2A 2EVBA 2R7DA 1PH6A 3AU7A 1GKHA 3NTHA 1PRTC 2E8GA 3KLSX 3K5NA 1A62A 3CF5A 1I4GA 5BN3A 4A3BG 4B3MQ 1LLRD 3VYRA 3SK5A 1E3PA 5DEHA 2JA7H 2RCNA 1QILA 3AEVA 1HNXL 1XX8A 2K50A 2K75A 2ALYB 4IN3A 1ENCA 4JOIC 1XNRQ 2PW7A 1X3GA 5C4XG 4LFAQ 1DJRD 1WTRA 4JW0A 1YHAA 1IYVA 1CKNB 2K1BA 3A8KE 4BBRB 1YNND 4P75A 4DAMA 3VDYA 2F0GA 2DNCA 1T5XD 4DAYA 3BG3A 3A8JE 1V1PA 1J9OA 4LUVA 3Q23A 3UDIA 1SEBD 3BJUA 1MHWC 3N52A 4QUCA 5IGEA 1A2UA 3GTGB 2JK8A 2HT1A 4JC0A 1RTNA 2ZTCA 2DJFC 4OO1H 1TIID 2B63H 3PIOA 4POFA 3SGIA 2MNAA 3CCVA 5C0XG 1G8ZD 1HZBA 3W1GA 3ITPA 1KNEA 3I55A 1VCIA 1LABA 1X55A 3MC0B 4R9WA 2HUGA 2XN9C 2F0DA 1J5EL 3S9WA 1PRTF 4X62Q 1MKHA 3GTPH 1Q46A 1TWCH 1XYIA 3TEHB 1HQRD 3MEHA 3J7YW 2Q2UA 2FHTA 3C1FA 3UE1A 4LAAA 4X65Q 4P2CB 2Q2IA 3G4SA 1BOSA 1JJCB 1PHJA 3I3CA 1JWMD 2VB3X 4B3TQ 3T16A 4GNXB 2I5MX 2ZT9C 1YITA 1L1OA 4X66L 2A6ED 1GOZA 3R8BA 4HJ9A 4HCEA 1N34L 4DV7L 1KRTA 3E0JA 4QF4A 5T1IA 3SK8A 4Y7NH 2R92G 4ZCKA 3QB3A 1C48A 2D9UA 1KRSA 2PQAB 2Q8RE 5JOBA 3LX0A 1X32A 3H0GB 1EWCA 1PRTD 1B50A 2MO0A 5IGGA 1SE4A 3K0YA 2RBMA 1X56A 2Z6KA 1SE8A 4R1JA 2DUDA 2Y0SE 1STGA 4I65A 1GUWA 4JI8Q 5D65A 4FF2A 4AYBB 5ELNA 2CH4A 1BR9A 3S1NB 1XPUA 2F0JA 1A6XA 2EYMA 4YY3L 1LT5D 4MTKA 4A3FG 4JI3L 1T9HA 4NXNQ 3NSWA 3I8ZA 4QL5A 4K6DA 2JA5H 4K14A 2QEXA 3WWVA 5E7NA 1GD7A 3RZDB 1B44D 1LTRD 2KVMA 1CFMA 3QOJA 4LF8Q 4DXGA 2WKDA 4OX9Q 5I2YA 2JXMB 2VL6A 5IOCA 1JB3A 1YVCA 1D8LA 4B3RL 3I4MG 4A93G 2VZAA 2O5JC 3S24A 1EFWA 1PTOH 4IPGA 3NELA 1LTAD 4FVMA 4DUZL 4B9WA 2WAQE 2QDBA 4LF7L 3GDEA 4QB4A 5E1FA 4ZUJA 3I4NB 4YWMA 1TT2A 1UWVA 3P20A 3I91A 2X6LA 4DR2Q 4L63B 1RKNA 4L5TA 4HTHA 3F2BA 1EQQA 4DR5L 1LTID 2D0PA 3L3OC 2H5XA 3DEPA 2LFNA 1YJ9A 3HOVG 4DV3L 3D6CA 2IT1A 1RTOA 4IPDA 4C3JB 3CAMA 4IUUA 4N8FA 4TKOB 3LWUA 3A5ZB 5LL6X 1F9QA 3HKZG 4OWXB 5M3MH 1ICFB 5FLMG 1RD9D 3IKJA 3LNNA 3K7AH 2H1EA 4IUNA 2L12A 2XRSD 4JBMA 1VS0A 1STYA 4NW2A 4DK3C 1EQRA 1DYQA 3A55A 3K8AA 1RL2A 3TSSA 1PRTB 2XTIA 3KJOA 3PQIA 3QR8A 2EY1A 4A3IB 1OTCA 4A3JG 3H3VI 2IPKD 5J1ZA 1DOKA 3NPPA 1UEAB 2AWOA 1Q3LA 2L0CA 2KQ3A 3DHQA 1HXYD 1KDCA 1QWYA 1NMGA 4ZLTF 1PYSB 1VQIA 1EU3A 2K05A 2LXKA 1SAPA 2EYJA 2QA4A 1XMOL 3H0GH 4A3KG 4JYAQ 3V05A 4C2MB 5IP9H 1S5DD 3NHHA 1QVFA 4LF6L 2YYZA 3MXGA 1CSQA 1Y8OB 2CHBD 4CDCC 4DKAC 4CKEA 5GROA 1F2ZA 3GQBA 3S1NH 1IZ6A 1TU2B 1STEA 1HA5A 2OQ0A 4I7ZC 1P16A 2M00A 1N32Q 1STAA 1HNZL 3RN5A 5IGBA 5JPNC 1S5FD 3A7AB 4DUYQ 4XQJA 4ODGA 1JC7A 1EIYB 2F0VA 2E2HB 5FK9C 3BDLA 1CZWA 5JVG3 1FJGQ 1RJTA 2MGSA 5DAUA 3S17B 1O7YA 1TS2A 4HIOA 3PO2B 1PH1A 1CHPD 1EY9A 2DY7A 3PUYA 1QE6A 2NTSA 4FF3A 2KENA 1WI5A 2Z9HA 3QJYA 2K28A 3HOZH 4DV1L 1LV9A 4HSVA 4CKCA 3P75A 1HNWQ 4RMFA 5K5PA 4LF5L 1K9MC 1H9SB 1PV4A 3I4NH 1BCPF 2IX3A 2AKWB 4XYOA 2F0MA 3K7UC 5EPJA 4LWCA 1ILPA 1PFMA 2RDGA 3VR6A 3W5OA 5IGCA 1MIUA 5KEEA 3L7ZC 4IQZA 1K83H 3EFXD 4CKBA 2YTYA 1I5FA 1Q12A 2WV6D 1LYLA 5C4XB 4FNFA 3J81j 4C3JH 1GUNA 3I2ZA 2UUAQ 3HOYH 4EVOA 2L55A 3FPUB 1WCMH 3I90A 1O7IA 4IPCA 5IYCG 1Y1WH 4RH6A 1UEBA 3K58A 3OTOL 2PO4A 2F0FA 1Q82C 3HZXA 4NDXA 1U4LA 5EPLA 1BXTA 2Z1CA 1G2SA 1TVXA 5IT9L 5CV4A 2K52A 3PF5A 4YHHQ 5ELEA 1XTCD 2NUCA 1UAPA 5CYUA 2A19A 3D4RA 1H9KA 5J39A 5FO9B 3QO2A 1HUMA 1Z47A 4JI2Q 2JA9A 3CRKC 2RVLA 1ENAA 1Q90A 4WRDA 3U9SA 4N9PA 3TN2A 2MUYA 3KF6B 1YIJA 3GV6A 2F0EA 2SNSA 4PMBA 2FMCA 1Y8NB 4LUZA 1JT8A 1D7QA 4LFCL 1FR3A 4UDUC 2K5WA 5FOBB 4BY1B 2F3WA 2TSSA 4DR1L 5EKKA 1X54A 4F87A 1PMRA 3AFPA 4BXXG 1LT6D 5L37A 2L4NA 4AQYL 4OWWB 3J81L 1TXYA 4KHZA 4DNTB 1V9PA 4RHSA 3BVGA 4P73A 4CDFC 2MP1A 2WKCA 3ND8A 3T1YQ 2NN6G 3NBHB 4IURA 4DV5L 1X3PA 4GN4B 2AUJD 5I2XA 1VQBA 2VQFQ 1LACA 2F0NA 2ZJPA 1K73C 3NP8A 1PYWD 3AB9A 5EPKA 4C3IG 2SDFA 5IP7H 2ZJQA 1GHKA 1IHZA 1I4XA 1E0BA 2GVBA 4L5SA 4DN4M 3PIPA 2E2HH 1N36L 3KDFA 3STBD 3S17H 4RG1A 4R4OA 4M1UB 2MJ8A 5ELCA 4JV5L 1JOQA 3VR2A 4PQXA 1SMXA 3A7LA 1UUPA 1VF7A 4BY7B 1VQPA 1QVGA 2HQLA 4HEDA 4A3MH 1AP0A 4FO2A 3HP3A 1BDOA 1CQVA 5LMNW 1KAWA 4MHEA 4KKUA 3D3RA 3NTIA 1K8GA 4POGA 3FEWX 5BR8L 3AMUA 3WOFA 4XT1B 3S14H 1KNAA 1HR0L 4XIGS 1VQMA 1TWHB 2VW9A 1X3FA 3MFGA 2B29A 3M3YB 1SJED 2R7ZG 1S40A 1EY0A 4RKLA 4HR7B 4L6TB 4LF9L 4RGMA 1CQFA 2IX1A 2JN4A 4NXML 1OXVA 2I07B 3W1BA 1L1OC 2L15A 2RHQB 1QCBD 3OIPA 5CV6A 1VQOA 2ZXPA 1FYCA 2EY5A 4R8NA 1X6OA 3CD6A 2ENBA 3D4WA 1VDZA 1VQFA 5JEAJ 4GKKL 3HOVB 4K5WA 4X62L 4Y52H 4LJZC 2OCEA 1U9RA 2Z6KC 4KLKA 1GVPA 2OEOA 3T53B 4AYBE 3TQYA 1BF4A 2KCNA 4A76A 1OXUA 4B3TL 3J7ZC 4HJ7A 2B2UA 3RMHA 5IYDH 2UXBQ 1MGSA 4ZRZA 5C0XH 4PMCA 1PZKD 2MPMA 2UUBL 1TS4A 1I3QB 3MEFA 5LMNQ 1A2TA 3QOLA 1DOMA 1S5ED 5HGQA 1SYBA 1ET6A 1YNNC 2VQEL 4RGTA 1NCVA 4BY1H 3AFQA 2EY2A 2VXWA 4UHVA 2OT2A 1EZ6A 3X3NA 3SVMA 2XVSA 1QZHA 4EQ5A 4WFN3 4A3JB 1I4RA 2MO1A 3JAMi 4JI6L 5ELOA 5IIFA 5KGUA 1GXDC 3D0FA 2F03A 5LL6S 1B2TA 1F9PA 4IZ8A 5G3LD 3CQZH 1R4QB 1SFOB 1ZEQX 4NXNL 4DGZA 5C0XI 3HOWG 3CCQA 1BBWA 5EKIA 1CUKA 1VQCA 4A3KB 2A74C 1VMPA 1CKOA 4GN5A 1CTMA 1IBKQ 5ELDA 4GS3A 2ZTEA 3K6OA 3TRZA 4LF8L 4OONA 2R6GA 1VQHA 1O7ZA 2HCIA 4DV0L 3I4LA 3NBIA 3S2HB 5CGKA 1E22A 4OX9L 4EX5A 1SROA 3HG9A 4KN7C 5TSSA 3PO3B 3M4YA 1SNOA 2JJQA 2NB0A 4BY7H 3DWPA 2UUCL 2LY7A 1ASZA 4LNQA 1ESRA 1K28A 4IUPA 1A8VA 2ICIA 1IKLA 4DV4Q 2EJMA 1PH9A 4GLAC 1IBMQ 3OOCA 4N9TA 3T4AC 1XMQL 5EGTA 2E2IH 4K5XA 3J80L 4GOPA 2FFKB 2PNRC 2N78A 4KD4A 1NNXA 3FPPA 3PGZA 3M3YH 3K81C 3BZDB 1V1OA 2BCOA 4EQPA 1QUQA 3I70A 4DA2A 5CBEE 1JWSD 1E24A 3CHBD 2CVRA 1EY5A 4ID6A 2F0LA 1LM0A 1EIGA 3G7LA 2V1CC 2F0OA 2KA7A 3P7JA 4O1NA 2RDHA 2PZWA 5EBCA 2RCFA 4N8X1 1AE2A 2KHSA 4A3CG 4H13C 2ID0A 5CORA 4DR3Q 1Q86C 3HOXH 4RFBA 5IYBG 2OQKA 1XNQQ 3KLWA 2J7ZA 3EA6A 3S1RB 2Q8TA 1SLJA 5ELBA 4R4QA 5IWAQ 1M1KC 2D62A 1V1PB 1SYEA 4P71A 1I3QH 2R7FA 3T1HQ 4DK6C 4TVAB 2F0IA 2NWGA 1D1IA 1MBYA 2DJGC 2EYFA 4IALA 2EDGA 4OL7A 2QGQA 2NVXB 1B8AA 5C3XA 4A3LH 1G91A 4DR7L 4PNYA 5GADC 5C44G 3VYSA 1KQSA 2NVYB 4K0KQ 2XIWA 5KRUA 3K59A 2K4KA 4A3JH 4BBSB 1QZGA 1SNQA 1Q7YC 4C1NK 4QCLA 4HIMA 3V96A 2Q2HA 2MFIA 3PIO3 1KL9A 3H6MA 2XWBB 3VYUA 3P1HA 2VS1A 1FVIA 4HAEA 1I4QA 1YEZA 3BDCA 3VR5A 1SFOH 2JA8G 4CGYB 3CCLA 3HS0C 1T5EA 4F88A 4LFBQ 3TP8A 3G71A 3PF4A 2A68C 2IL8A 3CP0A 2EJGC 4LMQD 3SR1A 2Z4IA 1HFGA 2AQ1B 3T51B 2R93G 1JOKA 3S2HH 5LMUQ 1L1OB 2MHVA 3MXNB 2UXCQ 2EXZA 3ER0A 4X64L 1D1KA 4RCNA 3OW7A 2NVTH 3PO3H 5FO8B 2PMZB 5C0XJ 3F1ZA 2D2CC 3MHBA 4I7AA 4XQQA 3DMUA 2DN8A 4G7OC 2LMCB 1D5ZC 3M4OH 2B2VA 5M3FG 4K5VA 1TR5A 4QQBX 1EWIA 2VUMH 1BKBA 2FXQA 1A3VA 3TMEA 3D8GA 1ONLA 1GUGA 1Y1VB 1VQKA 3SHLA 1QG7A 4KHPQ 1YHBA 3OMGA 4H02A 5C3EH 4GLVB 2F1MA 5EKLA 3OWEB 4HIDA 2RQXA 3CCRA 1QNUA 1F2MA 3NXWA 4JBKA 2PPBC 3OWFA 1SSOA 2F4VL 1QB5D 1KTKA 2K7VA 1A3TA 2HHHL 1UE5A 2HDMA 2H4OA 4Q5VA 4ME3A 2NVQB 4QUFA 4YIJA 1AFPA 1JMCA 2FINB 1SE2A 2DGYA 1KXLA 3F2DA 4A3DG 2R7ZB 2R61A 3U9OA 4JI2L 2UU9L 4C3HB 1HRJA 4MIUA 2K6AA 4IFDG 4YWLA 3BYYB 1RHPA 5IYCH 3K57A 3S1RH 4ILWA 4BBRH 3G6EA 4ZAIA 4K8JA 1E2WA 5KIXA 1FNWA 2SOBA 1EYAA 2B2WA 4FDBA 2VNUD 2BH8A 1IXRA 4JI0L 4A3GG 3EROA 1PZID 4DV2L 1VQ7A 2KCMA 4XQNA 2K5QA 3H3VH 2NVXH 1Q81C 5A35A 1IKMA 1VF5C 4A3EG 3PSIA 5FKAC 3J80i 2F4IA 4MTNA 3M7NA 3GTGH 3W3AA 4LF4L 3LWEA 1W2BA 3ICEA 3S15B 2C9OA 3UDFA 2XGTA 3OYYA 3KFUA 4IOCA 4BBSH 2A68D 1M90C 4CHTB 2BE5D 3DWQA 2VQFL 4CJ0B 2CWAA 2E2DC 4IUQA 4R4IA 1WTVA 1C4QA 4KI0A 2PZTA 3FHWA 1V1QA 3NTKA 3S2DB 3IFTA 5AJ3L 1HHVA 3MXPA 1FL0A 3SK6A 2KHIA 2EZVA 3CCJA 2PQEA 4L5RC 1SYCA 1RIPA 4NPSA 4XDXA 3S16B 5BN5A 2JA6B 2L5TA 1EEFD 2PZUA 4DK0A 4CDDC 3T56B 4KY5A 3TP6A 4QJFA 4GZYC 1NUCA 3AQQA 3HOWB 4OO1G 1B53A 1N9WA 4CJ2C 3I56A 4U68A 2A8VA 2CWPA 1BQQT 2B63G 3KBXA 4HJAA 5GQOA 1IBLL 3X3MA 5K36H 1GUTA 3GTKB 2E5LL 2A73B 1CKMA 1F9RA 3UE0A 3TBIB 5DM63 4UP8A 1I4PA 1Y1VH 4JI5L 1I6HB 5GAGC 2B2UC 3HKZE 4H0LC 2WB1G 1OXTA 3TZUA 2C35B 3GTQB 1B7YB 2CFMA 3ONAB 4KMUC 1STBA 3JAMc 5JEAH 2NN6I 1LTSD 3N6RA 1TY0A 1AN8A 4B08A 1JWUD 4G57A 1UE7A 2OXPA 3RZDH 2IHFA 2JYOA 1Z6HA 3CRLC 1S5CD 2NVQH 1HZ9A 1AW7A 3A54A 4OELB 3KJPA 5IT9c 3QG1A 2E2JB 4R4CA 3CKIB 1DXMA 3DUZA 2R7ZH 4HCSA 4K6LA 4C3HH 2ZXRA 4A4IA 5IY0A 3M85A 1EIHA 4A3BB 1X9NA 3STBC 1AZQA 1E2VA 2A5HA 2XNAC 3D6WA 1KABA 4JVZA 3RR5A 2I5HA 3A0JA 3S1MB 1EEID 5HGTA 5C4JB 2G9DA 2KBNA 4KKTA 4X66Q 3L2PA 3CPWA 1PDQA 4LW1A 4QGUA 1NAPA 2ICEC 3E9HA 5JJLA 3F2UA 2R3ZA 4MN3A 4DR4Q 4YWKA 2JA5G 1LTTD 2PI2E 1B70B 1B3QA 4HIKA 4H7BA 3S15H 5FLXc 1JICA 1H95A 1H9SA 4PMWA 1M4VA 1D5MC 3UDXA 2SNMA 2YV5A 1TWGB 3KF8B 4M8AA 4X6AH 1LUZA 4YY3Q 1S3OA 3CU7A 3MXUA 1IL8A 3R3OA 1PH4A 2UXDQ 1U0LA 1KLUD 4Z9CB 5C44B 1IBKL 4GOPC 4QIWE 1MI2A 1QJOA 4OXPA 4A3IH 3CCMA 3U50C 5IODA 1F2LA 4CDEC 2JEBI 1UE1A 3BVZA 2A6HC 2JA6H 1E2ZA 1WTPA 3I7FA 4TSSA 2KEEA 2JA8B 1VQ6A 4B3RQ 1Q1EA 2LXJA 5FJ8H 2B39A 2EXDA 4DUZQ 4LF7Q 5JAVA 2CQAA 5M3MG 4C2MH 1KC8C 3M4PA 4ZUIA 1R4PB 1TWFB 4DR5Q 2K14A 2WACA 2HCCA 1I50B 5T1GA 1VQ5A 1VQLA 3ZYYX 1TWAB 2N55A 4DV3Q 5CR3A 3NQIA 2R92B 3A56A 1CHQD 3KOJA 4XT3B 3B6YA 3NWTA 1YNJD 2K04A 2V4DA 5M9OA 2DNEA 4B3ML 3KDFB 4JI4Q 2RKSA 4HMIA 4LK1C 2QILA 4YCVA 1Y69U 3PUWA 4DR3L 1PTOC 3PMFA 1MSGA 3PO2H 3BZKA 3NWSA 1OXXK 4C56C 2CW0C 1TQOA 4CBVA 1XNRL 2BA1A 2QEJC 4A3FB 3M4QA 4LFAL 4RAUC 5BN4A 5A2QE 4ALPA 4JG2A 4FXKC 2ZM6Q 2F0WA 1B9NA 1XPRA 1KLGD 2CH4W 4JK1C 2OTJA 4BWGB 2F0QA 5IP9G 4A3BH 4ABNA 1SDFA 3RLNA 3T1HL 3JC66 1KDBA 3EVQA 1JB7A 1GHJA 5NUCA 5C4JH 1X3QA 1EIFA 1CI3M 2KOLA 4XXEA 1VQNA 1QOHA 2RA4A 4A93B 1WD1A 3I4MB 4A3DB 2E74C 5C4XH 1AZPA 1DGSA 1KDAA 1L0WA 4IUVA 3HOUG 1K8MA 2B8FA 1EYGA 2F3VA 1XMOQ 4K0KL 3NUCA 4WJ4A 2PMZE 1IW7C 3NK9A 1TS5A 1K0SA 1A15A 4WJWA 4FF1A 4L5QA 4A3GB 3A8IE 3BZCA 3K5OA 5KNCA 3F8TA 3ULLA 1QNKA 1TWGH 2O2LD 4UP9A 2B2VC 2PNHA 1EQVA 4KK7A 4ZK9B 2G5DA 4LFBL 1DONA 4A3EB 3HOZG 2A6HD 1BBXC 4FXGC 4X65L 2OWOA 4RHRA 3VR3A 1F77A 3IFDA 5C44H 1W6KA 1JE4A 3GTJB 3I4NG 4DNIA 3HKZB 3OHXC 4EGVA 5LMUL 5G3LF 4OGQC 1HFNA 2EJFC 2DY8A 1WOCA 3GP7A 1GJXA 2L1BA 1PXUA 1SNDA 2N88A 2TMPA 1R9TB 1BO0A 3AYHB 4Q0FA 2E76C 4NP5A 3CCUA 5JJIA 4C3JG 5J3BA 3CPFA 3MTSA 2YTVA 3HOYG 1B1ZA 1J8IA 3DXJC 1WCMG 3LGJA 1Y1WG 4DV1Q 3MFYA 3H94A 2KJXA 3CMEA 3Q6SA 5I9PA 4LF5Q 1ZKOA 1SE3A 4JI8L 3JAME 1YJWA 3KUPA 1LT3D 2L11A 5ELFA 1TWFH 2AWNA 3FVQA 4GKJQ 3J80c 2AQ3B 4J15A 4PZ7A 5LHY1 1NR4A 1PTOD 1CA5A 1HTLD 4DXFA 2R92H 2B2WC 2A1AA 2D5DA 2CW0D 2X69A 2WIIB 3WOEA 2CQOA 2K03A 3RUZA 2K5VA 1FGUA 4ME5A 3OTOQ 2XSCA 3R2IA 4KJNA 1WTQA 1FGBD 5KNDA 4YCWA 5I6YA 1EU4A 1IYUA 1F2YA 4U673 3O13A 3SK4A 2D0OA 2EYOA 3NEMA 4DFAA 4P74A 1HZAA 2WB1B 2B3GA 4J6HA 1K0RA 3GTPB 1TWCB 4KY6A 1C0AA 4A3FH 3J7AV 2ZXOA 1AH9A 4ZYSA 1SNPA 1E7ZA 1KIXA 1FD7D 3CCEA 3KLSA 1YJNA 3M7GA 3VYTA 1VQ9A 3BYTB 1U5KA 3URYA 1PVOA 2JSOA 3EJIA 2EQSA 1WJJA 4DR2L 1SJHD 5JJZA 4V0BA 4GOPB 3J81i 2LS01 4DR6Q 1ASYA 1IW7D 2OTLA 1EYCA 1OO9B 4QIWB 1TWHH 1QUQB 5FLXE 4Y7NB 3DEOA 4A93H 3I4MH 4DR1Q 5IP7G 1JCKB 4FYDA 4AQYQ 1ICWA 1DD2A 1O78A 2I46A 1HR0W 5CV5A 2O4XA 4PZ6A 3D4DA 4PG3A 3U4VA 1V8QA 5C5MA 2F0TA 5IE8A 2EYHA 4CJ1B 1EQTA 1FNVA 3HOVH 2N49A 1JE5A 4IUTA 4A3MG 1I94Q 2N8NA 2IHEA 2KUMA 3GO5A 4A3EH 2Q2TA 2JA5B 2NBFA 2WP8J 1YI2A 1G6PA 1QVCA 3FMCA 3GTJH 1VQGA 4DAYB 1N36Q 2SEBD 3OW2A 3TP5A 3H15A 2WFWA 5E4XA 3F2CA 2IY5B 1LTLA 1SMYD 1TY2A 5FLMH 2GVAA 4IFDI 1Q8KA 2RF4A 1R9TH 2EYPA 4JV5Q 3CC2A 1EY6A 1JR0D 1Z7TA 5M5WB 1PTOB 1M8AA 4QY7A 2RHSB 4KV6A 4XTCS 3E0EA 3IL8A 1CKNA 4JYAL 5IGFA 1ENFA 1E1OA 5I9OA 3GTMB 2EPBA 3FRPB 4UP7A 3Q8DA 3UDGA 1IYJB 4R8IA 3H91A 5BR8Q 3PCOB 1WTWA 1HR0Q 2YU9B 1N32L 1L2FA 2Y0SG 3PUXA 5COYA 4DUYL 4JI7Q 1VMCA 2QW7A 1EFID 4LF9Q 1N8RC 5IYDG 4NXMQ 2BDOA 2BE5C 4A3KH 1NJIC 1FJGL 5M3MB 1CM9A 1JOOA 1KD1C 1BBUA 2JP1A 3TS2A 3WDNA 3K7AB 3ND9A 4P72A 3RZOB 3ULPA 4GKKQ 4PZ8A 4BY1G 1C8CA 1SN8A 5JJKA 2L9HA 1G51A 2X6GA 4DV6Q 3OSOA 4C3IB 2B2YA 1ESFA 1HNWL 3HGBA 3MVVA 1Q1BA 3G6JB 1CA6A 3BU2A 5DNFA 3Q0AA 4J1MA 1WYDA 1P8LA 5GAEC 4HJ5A 3HKSA 5D3IB 2UUBQ 2F0PA 2GN5A 4IJLA 3MXNA 4GNXA 2WAQG 4HJ8A 4OO1I 1JJ2A 2B2TA 1ET9A 1H9MA 4GN3B 1XPOA 2O5IC 1H9RA 2UUAL 4KD3A 1MD2D 3FDTA 2VQEQ 4DR4L 4MNOA 2XRQD 2PQAA 2BA0A 1RCVD 1JORA 2KECA 2Z0SA 3RNUA 1W3SA 3RN2A 3BDOA 3U58A 3CC4A 5F2DA 2QF7A 1XJVA 4JI6Q 1IL2A 3QIAA 1CK1A 1HH2P 4TQUS 1WVLA 1NSNS 3K0XA 4UPAA 4APVA 1DOLA 4YHHL 4IPHA 1PH8A 3Q24A 2UXDL 4FXDA 1D5XC 2Z6BA 3H09A 2N3SA 4BY7G 1EY4A 3HOUB 3KLRA 1K8AC 4OEMB 4O42A 1K3RA 4JI1Q 5JPMC 1SYFA 3M9BA 4B3SQ 3FKIG 2LSSA 2CCZA 4DV0Q 1SR3A 1FNUA 3MZ5A 4ULLA 2RSOA 2BOSA 2ZJRA 3HEJA 1V43A 2HIVA 3HRZC 3QWNA 3C46A 3CW2C 5M5WH 1UNSA 3HOZB 3SDZA 4EQNA 3J80E 3IAYA 2UUCQ 1EZ8A 4ZKCB 3GTMH 1XTDA 2NVYH 4DPGA 2NYZD 2JA7G 3T1YL 3K5LA 4IFDJ 5C4ZA 1XMQQ 4R4TA 4LUOA 1N33Q 1K83B 3HOXG 4S3SA 3R93A 2VB2X 2NZ1D 2YU9H 4KY7A 1TS3A 3HOYB 3U4ZA 1W6JA 4KKSA 1WCMB 1VQJA 4RGOS 1ILQA 5EBDA 1H9JA 5CV9A 1Y1WB 5I4DA 4BXXH 1S5BD 2RDFA 2QKIC 1GO3E 2EYLA 4JI4L 1II3A 1L0YB 4RGNA 2IJ0A 1UE6A 1YZ6A 3Q22A 1A0IA 2NN6H 3VA7A 1BUVT 1AEXA 1AE3A 1WTOA 1CZGA 5KYIA 1HNXQ 3RZOH 4IJHA 1G2TA 3BVMA 4A3LG 2QCPX 2ZM6L 3VA5A 1RF2D 4DU9A 3A5UA 1LTGD 4C3IH 1E1TA 1RDPD 5ISRA 3PUZA 4ZQ3A 1KHIA 4B9XA 2K01A 3EN2A 1BCPC 4V190 5A2QL 1Y8PB 3SE0A 4RKBA 3TS0A 1PH3A 5CMDA 3RLOA 2FJ2A 4O0AA 5E4WC 3TZDA 4PV1C 2KCCA 3KYHC 4TRDA 1VQ4A 4DR7Q 5CC4A 5M5YB 1X3EA 4JOIA 1WTXA 2I0QA 4FP5D 4OIKA 1VQEA 4JPBW 3CMAA 1WTHA 4DAVA 3GTLB 1DM0B 1HUNA 2VY3A 3PV0A 1YNJC 2YTXA 4RCOA 3PO3G 3NE5B 4K2LA 3UI2A 2GA4B 4AIMA 2HD3A 1J5EQ 1U4MA 3HOUH 1GUOA 2K33A 4HMJA 3OPOA 1PH5A 5EQ0A 1YNXA 3E9IA 2UXBL 2AUKA 3E3XA 2VUMG 2JQOA 2F52A 3RLFA 2ATWA 5LMNL 4MZ9A 5HY6A 4G4KA 4A75A 4X64Q 5C3EG 3CCSA 2JE6I 1ZXTA 1N34Q 4DV7Q 2HQEA 1EUJA 5C6AA 1SRUA 1O80A 1SYGA 4A3MB 2HIXA 1HQMC 4F8MA 1EY7A 2Z4HA 1PLFA 2AQ2B 3J81c 2J4XA 1G291 2WB1E 1MSHA 3W2DA 1BNZA 3S14B 1Z9FA 4GKJL 2ZTDA 1PFSA 4X3TA 2J0TD 1YHQA 1MJEA 1HJPA 4JI3Q 3I72A 5C4HA 1HCZA 3JAML 1I6VC 3MA2B 3C1EA 1VQAA 3S2DH 4BBRG 5I6WA 4RWSC 4G7ZC 2F4VQ 2M2LA 4IOAA 5AFWA 4OWTB 1U4RA 5CV7A 1Q8IA 2HHHQ 2EE1A 1I4HA 2F0KA 1JQYD 1PA6A 1TKWB 3S16H 1BCPD 1WFQA 3KF8A 2Z8LA 4WJ3M 1RODA 2Y0SB 1PH2A 1HPCA 1XWEA 1J6QA 2A69C 5FO7B 2UU9Q 1PH7A 1VQ8A 3HOWH 2OF1A 3KBGA 1NBWA 5D14A 2QDLA 4DV4L 1G6ZA 4XYQA 3PUVA 1IBML 1A3UA 4BBSG 5M5XB 3NENA 3KF6A 5KYLA 2R93B 2KEDA 4DR6L 3GTKH 1S72A 3ULJA 4JI0Q 1YBYA 2KHJA 4DV2Q 3C3LA 1F9SA 1I6HH 1PFNA 1DZ1A 3RD4A 3HFZB 4L8JA 4JBJA 5IGDA 3GTQH 2CKZB 3OIQA 5M5YH 3GTOB 5GAHC 3KK7A 4X3UA 3TDQA 4LF4Q 2HDLA 5FLXL 5M3FB 2XWJB 2KCTA 4RA8A 2IX0A 5CBAE 3K80C 3GTLH 3NBHA 2WAQB 3PIP3 1EL0A 2F3IA 3CQZB 1GUSA 2G9HD 3ZJYC 1C9OA 1XNQL 2BH2A 1I94L 4ZKBB 2K5NA 5E3FA 2E2JH 2BDNA 2IWHA 1JJGA 1XXGA 1SXTA 3I73A 2C5CA 4OHJA 1HA6A 1B9MA 3H0GG 5AJ3Q 3VR4A 4OIJA 5IWAL 3C2PA 3R2TA 2I5LX 4JCVE 5K36G 1CSPA 3H3VC 1SBBB 3E5SA 4AYBG 3E6ZX 1HZCA 1LTBD 3J7A5 2P5ZX 3DWAA 1Y1VG 3S1MH 1HTPA 4A3CH 2RSNA 1U4PA 3DLLA 2AMCB 5IYBH 4E6IA 1X65A 5JEAG 3S1QB 2FMMA 1BVSA 5HURA 2Q8IB 1MJCA 5C5LA 5JVH3 3MAQA 1EOVA 3FKIB 3TP7A 1IBLQ 2M9VA 4IO9A 2MQHA 3FP9A 1NE3A 2EY6A 3DM1A 2E5LQ 4LF6Q 2E2IB 1CT1D 2B2YC 3A74A 1ZYRC 1EWHA 2K32A 5EAYA 1BCPB 4JI5Q 4JI7L 3GV3A 2PW5A 4C3HG 4DK1A 4F7XA 1HNZQ 3T13A 2F0SA 4EQOA 4DNRB 3SXHA 1EYDA 4GNXC 5D3DA 1D2BA 2WINB 2A69D 1STHA 2B2TC 1O7LA 1NR2A 2JA7B 4KTAA
chains in the Genus database with same CATH topology
4X3KA 4HN7A 1PTOF 4KJOA 3HOXB 1EY8A 3J7AF 4BA2I 2EOTA 4KN4C 1B3AA 5DM73 3MWYW 1SNMA 1PZJD 1LO5D 1SNCA 1SYDA 3L9AX 1SMYC 4BA1I 4DF7A 4G7HC 2IW3A 3SEBA 2E75C 4FF4A 5EJWA 3BS1A 4X3SA 2F0HA 2PYKA 3D31A 1WD0A 2B63B 5IT9E 1DCZA 2JEAI 1KAAA 5KNBA 4UAIA 4BS9A 2B8GA 1D6EC 1LT4D 4J8QA 3K5MA 5CV8A 4C1NI 1OXSC 2PCFB 4NMZA 4K8IA 3ERQA 3GD7A 1STNA 4DAPA 1L0XB 4QMGA 3J81E 1EOTA 2NVTB 2LKVA 3NQTA 2K5DA 4KHVA 5J22A 4JBWA 4WORA 1ZYRD 5C3WA 1ML0D 3OMCA 4IFDH 4K2KA 3M4OB 2F0UA 4HSPA 1K8OA 4NKLA 2A6EC 4H44C 2VUMB 3EQLC 1PFBA 3V2TA 2NTTA 1B4OA 1S4ZA 5C3EB 2EVBA 3AU7A 3NTHA 1PRTC 3KLSX 3K5NA 1I4GA 5BN3A 1LLRD 3VYRA 3SK5A 5DEHA 1QILA 1XX8A 4IN3A 1ENCA 2PW7A 1DJRD 1WTRA 1IYVA 2K1BA 3A8KE 4BBRB 1YNND 2F0GA 2DNCA 1T5XD 4DAYA 3BG3A 3A8JE 1V1PA 1J9OA 3Q23A 1SEBD 3N52A 4QUCA 5IGEA 1A2UA 3GTGB 1RTNA 4OO1H 1TIID 5C0XG 1G8ZD 3ITPA 1KNEA 1VCIA 1LABA 3MC0B 4R9WA 2HUGA 2XN9C 2F0DA 3S9WA 1PRTF 1XYIA 1HQRD 3MEHA 3J7YW 2FHTA 3C1FA 4LAAA 4P2CB 1BOSA 3I3CA 1JWMD 2VB3X 3T16A 2ZT9C 2A6ED 1GOZA 3R8BA 4HCEA 3E0JA 4QF4A 5T1IA 3SK8A 3QB3A 1C48A 2D9UA 2Q8RE 5JOBA 3LX0A 1X32A 3H0GB 1EWCA 1PRTD 1B50A 5IGGA 1SE4A 3K0YA 2RBMA 1STGA 4I65A 1GUWA 4FF2A 5D65A 4AYBB 1BR9A 3S1NB 2F0JA 1A6XA 2EYMA 1LT5D 3NSWA 3I8ZA 4K6DA 4K14A 3RZDB 1B44D 1LTRD 2KVMA 1CFMA 3QOJA 4DXGA 2WKDA 5I2YA 2JXMB 5IOCA 1JB3A 2O5JC 1PTOH 1LTAD 4FVMA 4B9WA 2QDBA 4QB4A 5E1FA 4ZUJA 3I4NB 1TT2A 3P20A 3I91A 2X6LA 4L63B 1RKNA 4HTHA 1LTID 3L3OC 3DEPA 2LFNA 3D6CA 2IT1A 1RTOA 4C3JB 4IUUA 4TKOB 3LWUA 5LL6X 1F9QA 1RD9D 3IKJA 3LNNA 2H1EA 4IUNA 2L12A 2XRSD 4NW2A 1STYA 1DYQA 3A55A 3TSSA 1PRTB 2EY1A 4A3IB 2IPKD 5J1ZA 1DOKA 3NPPA 1UEAB 2AWOA 1Q3LA 2L0CA 2KQ3A 3DHQA 1HXYD 1KDCA 1QWYA 4ZLTF 1EU3A 2K05A 1SAPA 2EYJA 3V05A 4C2MB 1S5DD 3NHHA 2YYZA 3MXGA 1Y8OB 2CHBD 4CKEA 1F2ZA 3GQBA 1TU2B 1STEA 1HA5A 4I7ZC 2M00A 1STAA 5IGBA 5JPNC 1S5FD 3A7AB 4XQJA 4ODGA 1JC7A 2F0VA 2E2HB 5FK9C 3BDLA 1CZWA 5JVG3 1RJTA 2MGSA 5DAUA 3S17B 1O7YA 1TS2A 3PO2B 1CHPD 1EY9A 2DY7A 3PUYA 1QE6A 2NTSA 4FF3A 3QJYA 2K28A 1LV9A 4HSVA 4CKCA 3P75A 5K5PA 1H9SB 1BCPF 2IX3A 5EPJA 4XYOA 2F0MA 1ILPA 1PFMA 2RDGA 3VR6A 5IGCA 5KEEA 3L7ZC 4IQZA 3EFXD 4CKBA 1Q12A 2WV6D 5C4XB 4FNFA 1GUNA 4EVOA 2L55A 3FPUB 3I90A 4RH6A 3K58A 2PO4A 2F0FA 3HZXA 4NDXA 1U4LA 5EPLA 1BXTA 2Z1CA 1G2SA 1TVXA 5IT9L 5CV4A 5ELEA 1XTCD 2NUCA 1UAPA 5CYUA 3D4RA 1H9KA 5J39A 5FO9B 3QO2A 1HUMA 1Z47A 3CRKC 2RVLA 1ENAA 1Q90A 4WRDA 3U9SA 4N9PA 3TN2A 2MUYA 3GV6A 2F0EA 2SNSA 4PMBA 2FMCA 1Y8NB 1FR3A 4UDUC 2K5WA 5FOBB 4BY1B 2F3WA 2TSSA 5EKKA 4F87A 1PMRA 1LT6D 2L4NA 3J81L 4KHZA 4DNTB 4RHSA 3BVGA 2MP1A 2WKCA 3ND8A 2NN6G 4IURA 1X3PA 2AUJD 5I2XA 1LACA 2F0NA 3NP8A 1PYWD 3AB9A 5EPKA 4C3IG 2SDFA 1GHKA 1IHZA 1I4XA 1E0BA 4DN4M 4M1UB 2MJ8A 5ELCA 1JOQA 3VR2A 4PQXA 3A7LA 1UUPA 1VF7A 4BY7B 4HEDA 1AP0A 4FO2A 3HP3A 1BDOA 1CQVA 4MHEA 4KKUA 3D3RA 3NTIA 3FEWX 3AMUA 3WOFA 4XT1B 1KNAA 4XIGS 1TWHB 3MFGA 3M3YB 1SJED 1EY0A 4RKLA 4HR7B 4L6TB 4RGMA 1CQFA 2IX1A 1OXVA 2I07B 1QCBD 3OIPA 5CV6A 2ZXPA 1FYCA 2EY5A 4R8NA 2ENBA 3D4WA 1VDZA 5JEAJ 3HOVB 4K5WA 4LJZC 1U9RA 2OEOA 3T53B 1BF4A 2KCNA 1OXUA 2B2UA 3RMHA 4ZRZA 1MGSA 5C0XH 4PMCA 1PZKD 2MPMA 1TS4A 1I3QB 1A2TA 3QOLA 1DOMA 1S5ED 1SYBA 1ET6A 1YNNC 4RGTA 1NCVA 2EY2A 2VXWA 2OT2A 1EZ6A 3X3NA 3SVMA 2XVSA 4WFN3 4A3JB 1I4RA 5IIFA 5KGUA 1GXDC 2F03A 5LL6S 1B2TA 1F9PA 4IZ8A 5G3LD 1R4QB 1SFOB 1ZEQX 4DGZA 5C0XI 5EKIA 4A3KB 2A74C 1VMPA 1CTMA 5ELDA 3K6OA 2R6GA 1O7ZA 2HCIA 3I4LA 3NBIA 3S2HB 5CGKA 3HG9A 4KN7C 5TSSA 3PO3B 3M4YA 1SNOA 2NB0A 3DWPA 2LY7A 1ESRA 4IUPA 2ICIA 1IKLA 2EJMA 3OOCA 4N9TA 3T4AC 5EGTA 4K5XA 3J80L 2FFKB 2PNRC 4KD4A 3FPPA 3BZDB 1V1OA 2BCOA 4EQPA 3I70A 4DA2A 5CBEE 1JWSD 3CHBD 2CVRA 1EY5A 4ID6A 2F0LA 1EIGA 3G7LA 2F0OA 2KA7A 3P7JA 4O1NA 2RDHA 2PZWA 5EBCA 2KHSA 4H13C 2ID0A 5CORA 4RFBA 2J7ZA 3EA6A 3S1RB 2Q8TA 5ELBA 2D62A 1V1PB 1SYEA 2F0IA 2NWGA 1D1IA 1MBYA 2EYFA 4IALA 2EDGA 4OL7A 2NVXB 5C3XA 1G91A 4PNYA 3VYSA 2NVYB 2XIWA 5KRUA 3K59A 4BBSB 1SNQA 4C1NK 4QCLA 3V96A 3PIO3 3H6MA 2XWBB 3VYUA 3P1HA 4HAEA 1I4QA 3BDCA 3VR5A 4CGYB 3HS0C 1T5EA 4F88A 3TP8A 2A68C 2IL8A 2EJGC 4LMQD 3SR1A 2Z4IA 1HFGA 2AQ1B 3T51B 1JOKA 2MHVA 2EXZA 1D1KA 4RCNA 3OW7A 5FO8B 2PMZB 5C0XJ 2D2CC 3MHBA 4XQQA 2DN8A 3DMUA 4G7OC 2LMCB 1D5ZC 2B2VA 4K5VA 1TR5A 3TMEA 1A3VA 3D8GA 1ONLA 1GUGA 1Y1VB 3SHLA 1QG7A 3OMGA 2F1MA 5EKLA 3OWEB 2RQXA 1QNUA 1F2MA 3NXWA 2PPBC 3OWFA 1SSOA 1QB5D 1KTKA 2K7VA 1A3TA 2HDMA 2H4OA 4Q5VA 2NVQB 4QUFA 4YIJA 1AFPA 2FINB 1SE2A 2R7ZB 2R61A 3U9OA 4C3HB 1HRJA 4MIUA 2K6AA 4IFDG 3BYYB 1RHPA 3K57A 4ILWA 4ZAIA 4K8JA 1E2WA 5KIXA 1FNWA 2SOBA 1EYAA 2B2WA 2VNUD 3EROA 1PZID 4XQNA 2K5QA 5A35A 1IKMA 1VF5C 5FKAC 2F4IA 3M7NA 3W3AA 3LWEA 3S15B 2C9OA 2A68D 4CHTB 2BE5D 3DWQA 4CJ0B 2E2DC 4IUQA 1WTVA 1C4QA 4KI0A 2PZTA 3NTKA 3S2DB 3IFTA 1HHVA 3MXPA 3SK6A 2EZVA 2PQEA 1SYCA 4XDXA 3S16B 5BN5A 2JA6B 2L5TA 1EEFD 2PZUA 4DK0A 3T56B 4KY5A 3TP6A 4GZYC 1NUCA 3HOWB 4OO1G 1B53A 4CJ2C 4U68A 1BQQT 3KBXA 3X3MA 5K36H 1GUTA 3GTKB 2A73B 1F9RA 3TBIB 5DM63 1I4PA 1I6HB 2B2UC 4H0LC 1OXTA 3TZUA 3GTQB 3ONAB 4KMUC 1STBA 5JEAH 2NN6I 1LTSD 3N6RA 1TY0A 1AN8A 4B08A 1JWUD 4G57A 2OXPA 2JYOA 1Z6HA 3CRLC 1S5CD 1AW7A 3A54A 3QG1A 2E2JB 3CKIB 1DXMA 3DUZA 4HCSA 4K6LA 2ZXRA 3M85A 1EIHA 4A3BB 1AZQA 1E2VA 2A5HA 2XNAC 3D6WA 1KABA 3S1MB 1EEID 5HGTA 5C4JB 2G9DA 4KKTA 1PDQA 1NAPA 2ICEC 3F2UA 2R3ZA 4MN3A 1LTTD 4H7BA 1JICA 1H9SA 4PMWA 1M4VA 1D5MC 2SNMA 1TWGB 4M8AA 3CU7A 3MXUA 1IL8A 3R3OA 1KLUD 4Z9CB 5C44B 1MI2A 1QJOA 5IODA 1F2LA 2JEBI 3BVZA 2A6HC 1E2ZA 1WTPA 4TSSA 2KEEA 2JA8B 1Q1EA 2B39A 5JAVA 2CQAA 4ZUIA 1R4PB 1TWFB 2WACA 2HCCA 1I50B 5T1GA 3ZYYX 1TWAB 2N55A 5CR3A 3NQIA 2R92B 3A56A 1CHQD 4XT3B 3NWTA 1YNJD 2K04A 2V4DA 5M9OA 2DNEA 2RKSA 4HMIA 4LK1C 2QILA 1Y69U 3PUWA 1PTOC 3PMFA 1MSGA 3NWSA 4C56C 1OXXK 2CW0C 1TQOA 4CBVA 2BA1A 2QEJC 4A3FB 4RAUC 5BN4A 5A2QE 4FXKC 2F0WA 1B9NA 1KLGD 4JK1C 4BWGB 2F0QA 4ABNA 1SDFA 1KDBA 3EVQA 1GHJA 5NUCA 1X3QA 1CI3M 2KOLA 4XXEA 1QOHA 2RA4A 4A93B 1WD1A 3I4MB 4A3DB 2E74C 1AZPA 1KDAA 4IUVA 1K8MA 2B8FA 2F3VA 3NUCA 1IW7C 3NK9A 1TS5A 1A15A 4WJWA 4FF1A 4A3GB 3A8IE 3K5OA 5KNCA 1QNKA 2O2LD 2B2VC 4KK7A 1EQVA 4ZK9B 1DONA 4A3EB 2A6HD 1BBXC 4FXGC 4RHRA 3VR3A 1F77A 3IFDA 1W6KA 1JE4A 3GTJB 3HKZB 3OHXC 4EGVA 5G3LF 4OGQC 1HFNA 2EJFC 2DY8A 3GP7A 1GJXA 2L1BA 1PXUA 1SNDA 2N88A 2TMPA 1R9TB 1BO0A 4Q0FA 2E76C 4NP5A 4C3JG 3MTSA 1B1ZA 1J8IA 3DXJC 3MFYA 3H94A 2KJXA 3Q6SA 5I9PA 1ZKOA 1SE3A 3JAME 3KUPA 1LT3D 2L11A 5ELFA 2AWNA 3FVQA 2AQ3B 5LHY1 1NR4A 1PTOD 1CA5A 1HTLD 4DXFA 2B2WC 2D5DA 2CW0D 2X69A 2WIIB 3WOEA 2K03A 3RUZA 4ME5A 2XSCA 3R2IA 4KJNA 1WTQA 1FGBD 5KNDA 5I6YA 1EU4A 1IYUA 1F2YA 4U673 3O13A 3SK4A 2EYOA 4DFAA 2WB1B 4J6HA 3GTPB 1TWCB 4KY6A 3J7AV 2ZXOA 4ZYSA 1SNPA 1FD7D 3KLSA 3M7GA 3VYTA 3BYTB 3URYA 2JSOA 3EJIA 1SJHD 5JJZA 4V0BA 2LS01 1IW7D 1EYCA 1OO9B 4QIWB 5FLXE 4Y7NB 3DEOA 1JCKB 4FYDA 1ICWA 1DD2A 1O78A 2I46A 5CV5A 2O4XA 3D4DA 1V8QA 5C5MA 2F0TA 2EYHA 4CJ1B 1EQTA 1FNVA 4IUTA 2KUMA 3GO5A 2JA5B 2NBFA 2WP8J 3FMCA 2SEBD 3TP5A 5E4XA 1SMYD 1TY2A 4IFDI 2EYPA 1EY6A 1JR0D 1Z7TA 5M5WB 1PTOB 1M8AA 4KV6A 4XTCS 3IL8A 5IGFA 1ENFA 5I9OA 3GTMB 2EPBA 3FRPB 4R8IA 3H91A 1WTWA 2YU9B 3PUXA 5COYA 1VMCA 1EFID 2BDOA 2BE5C 5M3MB 1CM9A 1JOOA 2JP1A 3WDNA 3K7AB 3ND9A 3RZOB 1C8CA 2L9HA 2X6GA 3OSOA 4C3IB 2B2YA 1ESFA 3HGBA 3MVVA 1Q1BA 3G6JB 1CA6A 5DNFA 3Q0AA 4J1MA 5D3IB 2F0PA 3MXNA 4OO1I 2B2TA 1ET9A 1H9MA 2O5IC 1H9RA 4KD3A 1MD2D 3FDTA 2XRQD 2BA0A 1RCVD 1JORA 2KECA 3BDOA 5F2DA 2QF7A 3QIAA 1CK1A 4TQUS 1WVLA 1NSNS 1DOLA 3Q24A 4FXDA 1D5XC 3H09A 1EY4A 3HOUB 3KLRA 4O42A 5JPMC 1SYFA 1FNUA 3MZ5A 4ULLA 2RSOA 2BOSA 3HEJA 1V43A 3HRZC 3QWNA 3C46A 1UNSA 3HOZB 3SDZA 4EQNA 3J80E 3IAYA 1EZ8A 4ZKCB 2NYZD 3K5LA 4IFDJ 5C4ZA 1K83B 4S3SA 3R93A 2VB2X 2NZ1D 4KY7A 1TS3A 3HOYB 1W6JA 4KKSA 1WCMB 4RGOS 1ILQA 5EBDA 1H9JA 5CV9A 1Y1WB 5I4DA 1S5BD 2RDFA 2QKIC 2EYLA 1II3A 1L0YB 4RGNA 2IJ0A 3Q22A 2NN6H 3VA7A 1BUVT 1AEXA 1WTOA 1CZGA 5KYIA 1G2TA 3BVMA 2QCPX 3VA5A 1RF2D 4DU9A 1LTGD 1RDPD 5ISRA 3PUZA 4ZQ3A 4B9XA 2K01A 1BCPC 4V190 5A2QL 1Y8PB 3SE0A 4RKBA 5CMDA 2FJ2A 5E4WC 3TZDA 4PV1C 2KCCA 4TRDA 5CC4A 5M5YB 1WTXA 4FP5D 4OIKA 4DAVA 3GTLB 1DM0B 1HUNA 3PV0A 1YNJC 4RCOA 3NE5B 4K2LA 3UI2A 2GA4B 1U4MA 1GUOA 2K33A 4HMJA 3OPOA 5EQ0A 2AUKA 3RLFA 4G4KA 2JE6I 1ZXTA 2HQEA 4A3MB 5C6AA 1SYGA 1O80A 1HQMC 4F8MA 1EY7A 2Z4HA 1PLFA 2AQ2B 2J4XA 1G291 1MSHA 3W2DA 1BNZA 3S14B 4X3TA 2J0TD 5C4HA 3I72A 1HCZA 3JAML 1I6VC 3MA2B 3C1EA 5I6WA 4RWSC 4G7ZC 2M2LA 5AFWA 1U4RA 5CV7A 1Q8IA 2EE1A 1I4HA 2F0KA 1JQYD 1TKWB 1BCPD 3KF8A 2Z8LA 1RODA 2Y0SB 1HPCA 1XWEA 2A69C 5FO7B 2OF1A 3KBGA 5D14A 1G6ZA 4XYQA 3PUVA 1A3UA 5M5XB 2R93B 5KYLA 2KEDA 3C3LA 1F9SA 1PFNA 1DZ1A 3RD4A 4L8JA 5IGDA 3OIQA 3GTOB 3KK7A 4X3UA 3TDQA 2HDLA 5FLXL 5M3FB 2XWJB 4RA8A 2IX0A 5CBAE 3NBHA 2WAQB 3PIP3 1EL0A 3CQZB 1GUSA 2G9HD 4ZKBB 5E3FA 2BDNA 2IWHA 1XXGA 1SXTA 3I73A 2C5CA 4OHJA 1HA6A 1B9MA 3VR4A 4OIJA 3C2PA 3R2TA 5K36G 3H3VC 1SBBB 3E5SA 3E6ZX 1LTBD 3DWAA 1HTPA 2RSNA 1U4PA 4E6IA 5JEAG 3S1QB 2FMMA 5HURA 2Q8IB 5C5LA 5JVH3 3MAQA 3FKIB 3TP7A 2M9VA 2EY6A 3DM1A 2E2IB 1CT1D 2B2YC 1ZYRC 1EWHA 2K32A 1BCPB 3GV3A 2PW5A 4C3HG 4DK1A 4F7XA 3T13A 2F0SA 4EQOA 4DNRB 3SXHA 1EYDA 5D3DA 1D2BA 2WINB 2A69D 1STHA 2B2TC 1O7LA 1NR2A 2JA7B 4KTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RH6 A;  3R8B A;  1D5X C;  1DYQ A;  5FKA C;  1LT3 D;  1I4Q A;  5ELF A;  1PTO F;  2QIL A;  2XNA C;  5TSS A;  1JR0 D;  3TSS A;  1PRT B;  2AQ3 B;  1PRT C;  1PTO B;  1PTO C;  3KLS X;  1EWC A;  1PRT D;  1PTO D;  3MFG A;  2IPK D;  4C56 C;  1EEI D;  1HTL D;  3DWP A;  1BXT A;  4DXF A;  1SE4 A;  1SJE D;  2QEJ C;  1I4G A;  1ENF A;  1PZJ D;  1LO5 D;  1FNU A;  1HXY D;  5ELE A;  3DWQ A;  1LLR D;  1XTC D;  4L6T B;  4RGM A;  2AQ1 B;  4RCO A;  2ICI A;  1KLG D;  4BWG B;  3R2I A;  1EU3 A;  1QIL A;  1FGB D;  1LTT D;  1LT5 D;  3SEB A;  1UNS A;  1EU4 A;  3O13 A;  3V05 A;  1DJR D;  3BZD B;  1V1O A;  1S5D D;  1EFI D;  2CHB D;  1D5Z C;  1M4V A;  4ZYS A;  1D5M C;  1B44 D;  1LTR D;  1JWS D;  4UDU C;  3CHB D;  2G9H D;  1FD7 D;  1STE A;  1HA5 A;  2TSS A;  4DXG A;  1EEF D;  3BYT B;  3URY A;  4O1N A;  2RDH A;  1XXG A;  1SXT A;  1T5X D;  1LT6 D;  4OHJ A;  1V1P A;  1SJH D;  1S5F D;  1TS3 A;  3R2T A;  1KLU D;  4Z9C B;  1PZK D;  1SEB D;  1TS4 A;  4RGO S;  1TS5 A;  2AQ2 B;  3OWE B;  4RFB A;  5I4D A;  1D6E C;  1LT4 D;  1PTO H;  1SBB B;  2J4X A;  3BVG A;  4RHS A;  1S5B D;  5FK9 C;  1LTA D;  1LTB D;  3W2D A;  3DWA A;  1ESF A;  2O2L D;  1S5E D;  1L0Y B;  1JCK B;  3EA6 A;  4RGN A;  1ET6 A;  1TS2 A;  3BVZ A;  4RGT A;  2IJ0 A;  1KTK A;  4L63 B;  1PYW D;  5ELB A;  1I4P A;  4TSS A;  1CHP D;  5D3I B;  2NTS A;  1LTI D;  1G8Z D;  4RHR A;  1F77 A;  1V1P B;  3BVM A;  1I4X A;  1SE2 A;  1I4R A;  3MC0 B;  1ET9 A;  1RF2 D;  1L0X B;  2XN9 C;  1LTG D;  2R61 A;  1PRT F;  1RDP D;  1LTS D;  3GP7 A;  1FNV A;  1MD2 D;  1TY0 A;  1CT1 D;  1AN8 A;  1JWU D;  3BYY B;  1BCP F;  1HQR D;  2XRQ D;  1RCV D;  5ELC A;  1BCP B;  1I4H A;  1BCP C;  2RDG A;  1JQY D;  1B1Z A;  1UUP A;  1FNW A;  1BCP D;  1S5C D;  1JWM D;  1AW7 A;  2Z8L A;  3EFX D;  1RD9 D;  2WV6 D;  1CHQ D;  1CK1 A;  5ELD A;  1PZI D;  2SEB D;  5D3D A;  1CQV A;  2XRS D;  4K6L A;  1TY2 A;  1SE3 A;  1GOZ A;  2NTT A; 
#chains in the Genus database with same CATH topology
 1NTG A;  4X3K A;  2UXC L;  4HN7 A;  1PTO F;  3IRB A;  4KJO A;  3HOX B;  1EY8 A;  3J7A F;  4AH6 A;  4BA2 I;  2EOT A;  4KN4 C;  1B3A A;  5DM7 3;  4DV6 L;  3MWY W;  3G48 A;  1SNM A;  2JA8 H;  1PZJ D;  1LO5 D;  1SNC A;  4GLX A;  1NMF A;  5H1S E;  1SYD A;  3L9A X;  3ERS X;  1SMY C;  4BA1 I;  4NB3 A;  4DF7 A;  4G7H C;  2IW3 A;  5M5X H;  3SEB A;  2E75 C;  2R93 H;  4FF4 A;  5EJW A;  3BS1 A;  4X3S A;  4KHP L;  1I50 H;  2F0H A;  2ASB A;  1TWA H;  2PYK A;  1C7Y A;  1Y14 B;  3D31 A;  1K3B C;  1WD0 A;  2B63 B;  3GTO H;  5IT9 E;  4UY8 C;  1VQD A;  1DCZ A;  2JEA I;  1KAA A;  5KNB A;  4UAI A;  4BS9 A;  5M3F H;  4A3I G;  3L0O A;  2B8G A;  4O2D A;  3DM3 A;  2NZO A;  2JA6 G;  1D6E C;  1LT4 D;  4J8Q A;  2AHO B;  3K5M A;  5CV8 A;  4JI1 L;  4C1N I;  1OXS C;  5FJ8 G;  2PCF B;  3TRE A;  4B3S L;  4NMZ A;  4K8I A;  4YCU A;  3ERQ A;  3GD7 A;  1STN A;  2NZH A;  4DAP A;  1L0X B;  4QMG A;  1GM5 A;  3J81 E;  3I4O A;  1EOT A;  1PYB A;  2NVT B;  2LKV A;  3NQT A;  2K5D A;  2PI2 A;  4LFC Q;  4KHV A;  5J22 A;  4JBW A;  4A3D H;  4WOR A;  1ZYR D;  2EIF A;  5C3W A;  1ML0 D;  3OMC A;  4IFD H;  4K2K A;  3S1Q H;  3M4O B;  3EBE A;  2F0U A;  4HSP A;  1K8O A;  4NKL A;  2A6E C;  4H44 C;  1NY4 A;  3EQL C;  1PFB A;  2K5H A;  3FKI H;  5DLQ E;  3V2T A;  3CC7 A;  2VUM B;  1A63 A;  1N33 L;  3CXC A;  2NTT A;  3PO2 G;  3EIV A;  4DV5 Q;  1B4O A;  4A3G H;  1S4Z A;  5C3E B;  2ES2 A;  2EVB A;  2R7D A;  1PH6 A;  3AU7 A;  1GKH A;  3NTH A;  1PRT C;  2E8G A;  3KLS X;  3K5N A;  1A62 A;  3CF5 A;  1I4G A;  5BN3 A;  4A3B G;  4B3M Q;  1LLR D;  3VYR A;  3SK5 A;  1E3P A;  5DEH A;  2JA7 H;  2RCN A;  1QIL A;  3AEV A;  1HNX L;  1XX8 A;  2K50 A;  2K75 A;  2ALY B;  4IN3 A;  1ENC A;  4JOI C;  1XNR Q;  2PW7 A;  1X3G A;  5C4X G;  4LFA Q;  1DJR D;  1WTR A;  4JW0 A;  1YHA A;  1IYV A;  1CKN B;  2K1B A;  3A8K E;  4BBR B;  1YNN D;  4P75 A;  4DAM A;  3VDY A;  2F0G A;  2DNC A;  1T5X D;  4DAY A;  3BG3 A;  3A8J E;  1V1P A;  1J9O A;  4LUV A;  3Q23 A;  3UDI A;  1SEB D;  3BJU A;  1MHW C;  3N52 A;  4QUC A;  5IGE A;  1A2U A;  3GTG B;  2JK8 A;  2HT1 A;  4JC0 A;  1RTN A;  2ZTC A;  2DJF C;  4OO1 H;  1TII D;  2B63 H;  3PIO A;  4POF A;  3SGI A;  2MNA A;  3CCV A;  5C0X G;  1G8Z D;  1HZB A;  3W1G A;  3ITP A;  1KNE A;  3I55 A;  1VCI A;  1LAB A;  1X55 A;  3MC0 B;  4R9W A;  2HUG A;  2XN9 C;  2F0D A;  1J5E L;  3S9W A;  1PRT F;  4X62 Q;  1MKH A;  3GTP H;  1Q46 A;  1TWC H;  1XYI A;  3TEH B;  1HQR D;  3MEH A;  3J7Y W;  2Q2U A;  2FHT A;  3C1F A;  3UE1 A;  4LAA A;  4X65 Q;  4P2C B;  2Q2I A;  3G4S A;  1BOS A;  1JJC B;  1PHJ A;  3I3C A;  1JWM D;  2VB3 X;  4B3T Q;  3T16 A;  4GNX B;  2I5M X;  2ZT9 C;  1YIT A;  1L1O A;  4X66 L;  2A6E D;  1GOZ A;  3R8B A;  4HJ9 A;  4HCE A;  1N34 L;  4DV7 L;  1KRT A;  3E0J A;  4QF4 A;  5T1I A;  3SK8 A;  4Y7N H;  2R92 G;  4ZCK A;  3QB3 A;  1C48 A;  2D9U A;  1KRS A;  2PQA B;  2Q8R E;  5JOB A;  3LX0 A;  1X32 A;  3H0G B;  1EWC A;  1PRT D;  1B50 A;  2MO0 A;  5IGG A;  1SE4 A;  3K0Y A;  2RBM A;  1X56 A;  2Z6K A;  1SE8 A;  4R1J A;  2DUD A;  2Y0S E;  1STG A;  4I65 A;  1GUW A;  4JI8 Q;  5D65 A;  4FF2 A;  4AYB B;  5ELN A;  2CH4 A;  1BR9 A;  3S1N B;  1XPU A;  2F0J A;  1A6X A;  2EYM A;  4YY3 L;  1LT5 D;  4MTK A;  4A3F G;  4JI3 L;  1T9H A;  4NXN Q;  3NSW A;  3I8Z A;  4QL5 A;  4K6D A;  2JA5 H;  4K14 A;  2QEX A;  3WWV A;  5E7N A;  1GD7 A;  3RZD B;  1B44 D;  1LTR D;  2KVM A;  1CFM A;  3QOJ A;  4LF8 Q;  4DXG A;  2WKD A;  4OX9 Q;  5I2Y A;  2JXM B;  2VL6 A;  5IOC A;  1JB3 A;  1YVC A;  1D8L A;  4B3R L;  3I4M G;  4A93 G;  2VZA A;  2O5J C;  3S24 A;  1EFW A;  1PTO H;  4IPG A;  3NEL A;  1LTA D;  4FVM A;  4DUZ L;  4B9W A;  2WAQ E;  2QDB A;  4LF7 L;  3GDE A;  4QB4 A;  5E1F A;  4ZUJ A;  3I4N B;  4YWM A;  1TT2 A;  1UWV A;  3P20 A;  3I91 A;  2X6L A;  4DR2 Q;  4L63 B;  1RKN A;  4L5T A;  4HTH A;  3F2B A;  1EQQ A;  4DR5 L;  1LTI D;  2D0P A;  3L3O C;  2H5X A;  3DEP A;  2LFN A;  1YJ9 A;  3HOV G;  4DV3 L;  3D6C A;  2IT1 A;  1RTO A;  4IPD A;  4C3J B;  3CAM A;  4IUU A;  4N8F A;  4TKO B;  3LWU A;  3A5Z B;  5LL6 X;  1F9Q A;  3HKZ G;  4OWX B;  5M3M H;  1ICF B;  5FLM G;  1RD9 D;  3IKJ A;  3LNN A;  3K7A H;  2H1E A;  4IUN A;  2L12 A;  2XRS D;  4JBM A;  1VS0 A;  1STY A;  4NW2 A;  4DK3 C;  1EQR A;  1DYQ A;  3A55 A;  3K8A A;  1RL2 A;  3TSS A;  1PRT B;  2XTI A;  3KJO A;  3PQI A;  3QR8 A;  2EY1 A;  4A3I B;  1OTC A;  4A3J G;  3H3V I;  2IPK D;  5J1Z A;  1DOK A;  3NPP A;  1UEA B;  2AWO A;  1Q3L A;  2L0C A;  2KQ3 A;  3DHQ A;  1HXY D;  1KDC A;  1QWY A;  1NMG A;  4ZLT F;  1PYS B;  1VQI A;  1EU3 A;  2K05 A;  2LXK A;  1SAP A;  2EYJ A;  2QA4 A;  1XMO L;  3H0G H;  4A3K G;  4JYA Q;  3V05 A;  4C2M B;  5IP9 H;  1S5D D;  3NHH A;  1QVF A;  4LF6 L;  2YYZ A;  3MXG A;  1CSQ A;  1Y8O B;  2CHB D;  4CDC C;  4DKA C;  4CKE A;  5GRO A;  1F2Z A;  3GQB A;  3S1N H;  1IZ6 A;  1TU2 B;  1STE A;  1HA5 A;  2OQ0 A;  4I7Z C;  1P16 A;  2M00 A;  1N32 Q;  1STA A;  1HNZ L;  3RN5 A;  5IGB A;  5JPN C;  1S5F D;  3A7A B;  4DUY Q;  4XQJ A;  4ODG A;  1JC7 A;  1EIY B;  2F0V A;  2E2H B;  5FK9 C;  3BDL A;  1CZW A;  5JVG 3;  1FJG Q;  1RJT A;  2MGS A;  5DAU A;  3S17 B;  1O7Y A;  1TS2 A;  4HIO A;  3PO2 B;  1PH1 A;  1CHP D;  1EY9 A;  2DY7 A;  3PUY A;  1QE6 A;  2NTS A;  4FF3 A;  2KEN A;  1WI5 A;  2Z9H A;  3QJY A;  2K28 A;  3HOZ H;  4DV1 L;  1LV9 A;  4HSV A;  4CKC A;  3P75 A;  1HNW Q;  4RMF A;  5K5P A;  4LF5 L;  1K9M C;  1H9S B;  1PV4 A;  3I4N H;  1BCP F;  2IX3 A;  2AKW B;  4XYO A;  2F0M A;  3K7U C;  5EPJ A;  4LWC A;  1ILP A;  1PFM A;  2RDG A;  3VR6 A;  3W5O A;  5IGC A;  1MIU A;  5KEE A;  3L7Z C;  4IQZ A;  1K83 H;  3EFX D;  4CKB A;  2YTY A;  1I5F A;  1Q12 A;  2WV6 D;  1LYL A;  5C4X B;  4FNF A;  3J81 j;  4C3J H;  1GUN A;  3I2Z A;  2UUA Q;  3HOY H;  4EVO A;  2L55 A;  3FPU B;  1WCM H;  3I90 A;  1O7I A;  4IPC A;  5IYC G;  1Y1W H;  4RH6 A;  1UEB A;  3K58 A;  3OTO L;  2PO4 A;  2F0F A;  1Q82 C;  3HZX A;  4NDX A;  1U4L A;  5EPL A;  1BXT A;  2Z1C A;  1G2S A;  1TVX A;  5IT9 L;  5CV4 A;  2K52 A;  3PF5 A;  4YHH Q;  5ELE A;  1XTC D;  2NUC A;  1UAP A;  5CYU A;  2A19 A;  3D4R A;  1H9K A;  5J39 A;  5FO9 B;  3QO2 A;  1HUM A;  1Z47 A;  4JI2 Q;  2JA9 A;  3CRK C;  2RVL A;  1ENA A;  1Q90 A;  4WRD A;  3U9S A;  4N9P A;  3TN2 A;  2MUY A;  3KF6 B;  1YIJ A;  3GV6 A;  2F0E A;  2SNS A;  4PMB A;  2FMC A;  1Y8N B;  4LUZ A;  1JT8 A;  1D7Q A;  4LFC L;  1FR3 A;  4UDU C;  2K5W A;  5FOB B;  4BY1 B;  2F3W A;  2TSS A;  4DR1 L;  5EKK A;  1X54 A;  4F87 A;  1PMR A;  3AFP A;  4BXX G;  1LT6 D;  5L37 A;  2L4N A;  4AQY L;  4OWW B;  3J81 L;  1TXY A;  4KHZ A;  4DNT B;  1V9P A;  4RHS A;  3BVG A;  4P73 A;  4CDF C;  2MP1 A;  2WKC A;  3ND8 A;  3T1Y Q;  2NN6 G;  3NBH B;  4IUR A;  4DV5 L;  1X3P A;  4GN4 B;  2AUJ D;  5I2X A;  1VQB A;  2VQF Q;  1LAC A;  2F0N A;  2ZJP A;  1K73 C;  3NP8 A;  1PYW D;  3AB9 A;  5EPK A;  4C3I G;  2SDF A;  5IP7 H;  2ZJQ A;  1GHK A;  1IHZ A;  1I4X A;  1E0B A;  2GVB A;  4L5S A;  4DN4 M;  3PIP A;  2E2H H;  1N36 L;  3KDF A;  3STB D;  3S17 H;  4RG1 A;  4R4O A;  4M1U B;  2MJ8 A;  5ELC A;  4JV5 L;  1JOQ A;  3VR2 A;  4PQX A;  1SMX A;  3A7L A;  1UUP A;  1VF7 A;  4BY7 B;  1VQP A;  1QVG A;  2HQL A;  4HED A;  4A3M H;  1AP0 A;  4FO2 A;  3HP3 A;  1BDO A;  1CQV A;  5LMN W;  1KAW A;  4MHE A;  4KKU A;  3D3R A;  3NTI A;  1K8G A;  4POG A;  3FEW X;  5BR8 L;  3AMU A;  3WOF A;  4XT1 B;  3S14 H;  1KNA A;  1HR0 L;  4XIG S;  1VQM A;  1TWH B;  2VW9 A;  1X3F A;  3MFG A;  2B29 A;  3M3Y B;  1SJE D;  2R7Z G;  1S40 A;  1EY0 A;  4RKL A;  4HR7 B;  4L6T B;  4LF9 L;  4RGM A;  1CQF A;  2IX1 A;  2JN4 A;  4NXM L;  1OXV A;  2I07 B;  3W1B A;  1L1O C;  2L15 A;  2RHQ B;  1QCB D;  3OIP A;  5CV6 A;  1VQO A;  2ZXP A;  1FYC A;  2EY5 A;  4R8N A;  1X6O A;  3CD6 A;  2ENB A;  3D4W A;  1VDZ A;  1VQF A;  5JEA J;  4GKK L;  3HOV B;  4K5W A;  4X62 L;  4Y52 H;  4LJZ C;  2OCE A;  1U9R A;  2Z6K C;  4KLK A;  1GVP A;  2OEO A;  3T53 B;  4AYB E;  3TQY A;  1BF4 A;  2KCN A;  4A76 A;  1OXU A;  4B3T L;  3J7Z C;  4HJ7 A;  2B2U A;  3RMH A;  5IYD H;  2UXB Q;  1MGS A;  4ZRZ A;  5C0X H;  4PMC A;  1PZK D;  2MPM A;  2UUB L;  1TS4 A;  1I3Q B;  3MEF A;  5LMN Q;  1A2T A;  3QOL A;  1DOM A;  1S5E D;  5HGQ A;  1SYB A;  1ET6 A;  1YNN C;  2VQE L;  4RGT A;  1NCV A;  4BY1 H;  3AFQ A;  2EY2 A;  2VXW A;  4UHV A;  2OT2 A;  1EZ6 A;  3X3N A;  3SVM A;  2XVS A;  1QZH A;  4EQ5 A;  4WFN 3;  4A3J B;  1I4R A;  2MO1 A;  3JAM i;  4JI6 L;  5ELO A;  5IIF A;  5KGU A;  1GXD C;  3D0F A;  2F03 A;  5LL6 S;  1B2T A;  1F9P A;  4IZ8 A;  5G3L D;  3CQZ H;  1R4Q B;  1SFO B;  1ZEQ X;  4NXN L;  4DGZ A;  5C0X I;  3HOW G;  3CCQ A;  1BBW A;  5EKI A;  1CUK A;  1VQC A;  4A3K B;  2A74 C;  1VMP A;  1CKO A;  4GN5 A;  1CTM A;  1IBK Q;  5ELD A;  4GS3 A;  2ZTE A;  3K6O A;  3TRZ A;  4LF8 L;  4OON A;  2R6G A;  1VQH A;  1O7Z A;  2HCI A;  4DV0 L;  3I4L A;  3NBI A;  3S2H B;  5CGK A;  1E22 A;  4OX9 L;  4EX5 A;  1SRO A;  3HG9 A;  4KN7 C;  5TSS A;  3PO3 B;  3M4Y A;  1SNO A;  2JJQ A;  2NB0 A;  4BY7 H;  3DWP A;  2UUC L;  2LY7 A;  1ASZ A;  4LNQ A;  1ESR A;  1K28 A;  4IUP A;  1A8V A;  2ICI A;  1IKL A;  4DV4 Q;  2EJM A;  1PH9 A;  4GLA C;  1IBM Q;  3OOC A;  4N9T A;  3T4A C;  1XMQ L;  5EGT A;  2E2I H;  4K5X A;  3J80 L;  4GOP A;  2FFK B;  2PNR C;  2N78 A;  4KD4 A;  1NNX A;  3FPP A;  3PGZ A;  3M3Y H;  3K81 C;  3BZD B;  1V1O A;  2BCO A;  4EQP A;  1QUQ A;  3I70 A;  4DA2 A;  5CBE E;  1JWS D;  1E24 A;  3CHB D;  2CVR A;  1EY5 A;  4ID6 A;  2F0L A;  1LM0 A;  1EIG A;  3G7L A;  2V1C C;  2F0O A;  2KA7 A;  3P7J A;  4O1N A;  2RDH A;  2PZW A;  5EBC A;  2RCF A;  4N8X 1;  1AE2 A;  2KHS A;  4A3C G;  4H13 C;  2ID0 A;  5COR A;  4DR3 Q;  1Q86 C;  3HOX H;  4RFB A;  5IYB G;  2OQK A;  1XNQ Q;  3KLW A;  2J7Z A;  3EA6 A;  3S1R B;  2Q8T A;  1SLJ A;  5ELB A;  4R4Q A;  5IWA Q;  1M1K C;  2D62 A;  1V1P B;  1SYE A;  4P71 A;  1I3Q H;  2R7F A;  3T1H Q;  4DK6 C;  4TVA B;  2F0I A;  2NWG A;  1D1I A;  1MBY A;  2DJG C;  2EYF A;  4IAL A;  2EDG A;  4OL7 A;  2QGQ A;  2NVX B;  1B8A A;  5C3X A;  4A3L H;  1G91 A;  4DR7 L;  4PNY A;  5GAD C;  5C44 G;  3VYS A;  1KQS A;  2NVY B;  4K0K Q;  2XIW A;  5KRU A;  3K59 A;  2K4K A;  4A3J H;  4BBS B;  1QZG A;  1SNQ A;  1Q7Y C;  4C1N K;  4QCL A;  4HIM A;  3V96 A;  2Q2H A;  2MFI A;  3PIO 3;  1KL9 A;  3H6M A;  2XWB B;  3VYU A;  3P1H A;  2VS1 A;  1FVI A;  4HAE A;  1I4Q A;  1YEZ A;  3BDC A;  3VR5 A;  1SFO H;  2JA8 G;  4CGY B;  3CCL A;  3HS0 C;  1T5E A;  4F88 A;  4LFB Q;  3TP8 A;  3G71 A;  3PF4 A;  2A68 C;  2IL8 A;  3CP0 A;  2EJG C;  4LMQ D;  3SR1 A;  2Z4I A;  1HFG A;  2AQ1 B;  3T51 B;  2R93 G;  1JOK A;  3S2H H;  5LMU Q;  1L1O B;  2MHV A;  3MXN B;  2UXC Q;  2EXZ A;  3ER0 A;  4X64 L;  1D1K A;  4RCN A;  3OW7 A;  2NVT H;  3PO3 H;  5FO8 B;  2PMZ B;  5C0X J;  3F1Z A;  2D2C C;  3MHB A;  4I7A A;  4XQQ A;  3DMU A;  2DN8 A;  4G7O C;  2LMC B;  1D5Z C;  3M4O H;  2B2V A;  5M3F G;  4K5V A;  1TR5 A;  4QQB X;  1EWI A;  2VUM H;  1BKB A;  2FXQ A;  1A3V A;  3TME A;  3D8G A;  1ONL A;  1GUG A;  1Y1V B;  1VQK A;  3SHL A;  1QG7 A;  4KHP Q;  1YHB A;  3OMG A;  4H02 A;  5C3E H;  4GLV B;  2F1M A;  5EKL A;  3OWE B;  4HID A;  2RQX A;  3CCR A;  1QNU A;  1F2M A;  3NXW A;  4JBK A;  2PPB C;  3OWF A;  1SSO A;  2F4V L;  1QB5 D;  1KTK A;  2K7V A;  1A3T A;  2HHH L;  1UE5 A;  2HDM A;  2H4O A;  4Q5V A;  4ME3 A;  2NVQ B;  4QUF A;  4YIJ A;  1AFP A;  1JMC A;  2FIN B;  1SE2 A;  2DGY A;  1KXL A;  3F2D A;  4A3D G;  2R7Z B;  2R61 A;  3U9O A;  4JI2 L;  2UU9 L;  4C3H B;  1HRJ A;  4MIU A;  2K6A A;  4IFD G;  4YWL A;  3BYY B;  1RHP A;  5IYC H;  3K57 A;  3S1R H;  4ILW A;  4BBR H;  3G6E A;  4ZAI A;  4K8J A;  1E2W A;  5KIX A;  1FNW A;  2SOB A;  1EYA A;  2B2W A;  4FDB A;  2VNU D;  2BH8 A;  1IXR A;  4JI0 L;  4A3G G;  3ERO A;  1PZI D;  4DV2 L;  1VQ7 A;  2KCM A;  4XQN A;  2K5Q A;  3H3V H;  2NVX H;  1Q81 C;  5A35 A;  1IKM A;  1VF5 C;  4A3E G;  3PSI A;  5FKA C;  3J80 i;  2F4I A;  4MTN A;  3M7N A;  3GTG H;  3W3A A;  4LF4 L;  3LWE A;  1W2B A;  3ICE A;  3S15 B;  2C9O A;  3UDF A;  2XGT A;  3OYY A;  3KFU A;  4IOC A;  4BBS H;  2A68 D;  1M90 C;  4CHT B;  2BE5 D;  3DWQ A;  2VQF L;  4CJ0 B;  2CWA A;  2E2D C;  4IUQ A;  4R4I A;  1WTV A;  1C4Q A;  4KI0 A;  2PZT A;  3FHW A;  1V1Q A;  3NTK A;  3S2D B;  3IFT A;  5AJ3 L;  1HHV A;  3MXP A;  1FL0 A;  3SK6 A;  2KHI A;  2EZV A;  3CCJ A;  2PQE A;  4L5R C;  1SYC A;  1RIP A;  4NPS A;  4XDX A;  3S16 B;  5BN5 A;  2JA6 B;  2L5T A;  1EEF D;  2PZU A;  4DK0 A;  4CDD C;  3T56 B;  4KY5 A;  3TP6 A;  4QJF A;  4GZY C;  1NUC A;  3AQQ A;  3HOW B;  4OO1 G;  1B53 A;  1N9W A;  4CJ2 C;  3I56 A;  4U68 A;  2A8V A;  2CWP A;  1BQQ T;  2B63 G;  3KBX A;  4HJA A;  5GQO A;  1IBL L;  3X3M A;  5K36 H;  1GUT A;  3GTK B;  2E5L L;  2A73 B;  1CKM A;  1F9R A;  3UE0 A;  3TBI B;  5DM6 3;  4UP8 A;  1I4P A;  1Y1V H;  4JI5 L;  1I6H B;  5GAG C;  2B2U C;  3HKZ E;  4H0L C;  2WB1 G;  1OXT A;  3TZU A;  2C35 B;  3GTQ B;  1B7Y B;  2CFM A;  3ONA B;  4KMU C;  1STB A;  3JAM c;  5JEA H;  2NN6 I;  1LTS D;  3N6R A;  1TY0 A;  1AN8 A;  4B08 A;  1JWU D;  4G57 A;  1UE7 A;  2OXP A;  3RZD H;  2IHF A;  2JYO A;  1Z6H A;  3CRL C;  1S5C D;  2NVQ H;  1HZ9 A;  1AW7 A;  3A54 A;  4OEL B;  3KJP A;  5IT9 c;  3QG1 A;  2E2J B;  4R4C A;  3CKI B;  1DXM A;  3DUZ A;  2R7Z H;  4HCS A;  4K6L A;  4C3H H;  2ZXR A;  4A4I A;  5IY0 A;  3M85 A;  1EIH A;  4A3B B;  1X9N A;  3STB C;  1AZQ A;  1E2V A;  2A5H A;  2XNA C;  3D6W A;  1KAB A;  4JVZ A;  3RR5 A;  2I5H A;  3A0J A;  3S1M B;  1EEI D;  5HGT A;  5C4J B;  2G9D A;  2KBN A;  4KKT A;  4X66 Q;  3L2P A;  3CPW A;  1PDQ A;  4LW1 A;  4QGU A;  1NAP A;  2ICE C;  3E9H A;  5JJL A;  3F2U A;  2R3Z A;  4MN3 A;  4DR4 Q;  4YWK A;  2JA5 G;  1LTT D;  2PI2 E;  1B70 B;  1B3Q A;  4HIK A;  4H7B A;  3S15 H;  5FLX c;  1JIC A;  1H95 A;  1H9S A;  4PMW A;  1M4V A;  1D5M C;  3UDX A;  2SNM A;  2YV5 A;  1TWG B;  3KF8 B;  4M8A A;  4X6A H;  1LUZ A;  4YY3 Q;  1S3O A;  3CU7 A;  3MXU A;  1IL8 A;  3R3O A;  1PH4 A;  2UXD Q;  1U0L A;  1KLU D;  4Z9C B;  5C44 B;  1IBK L;  4GOP C;  4QIW E;  1MI2 A;  1QJO A;  4OXP A;  4A3I H;  3CCM A;  3U50 C;  5IOD A;  1F2L A;  4CDE C;  2JEB I;  1UE1 A;  3BVZ A;  2A6H C;  2JA6 H;  1E2Z A;  1WTP A;  3I7F A;  4TSS A;  2KEE A;  2JA8 B;  1VQ6 A;  4B3R Q;  1Q1E A;  2LXJ A;  5FJ8 H;  2B39 A;  2EXD A;  4DUZ Q;  4LF7 Q;  5JAV A;  2CQA A;  5M3M G;  4C2M H;  1KC8 C;  3M4P A;  4ZUI A;  1R4P B;  1TWF B;  4DR5 Q;  2K14 A;  2WAC A;  2HCC A;  1I50 B;  5T1G A;  1VQ5 A;  1VQL A;  3ZYY X;  1TWA B;  2N55 A;  4DV3 Q;  5CR3 A;  3NQI A;  2R92 B;  3A56 A;  1CHQ D;  3KOJ A;  4XT3 B;  3B6Y A;  3NWT A;  1YNJ D;  2K04 A;  2V4D A;  5M9O A;  2DNE A;  4B3M L;  3KDF B;  4JI4 Q;  2RKS A;  4HMI A;  4LK1 C;  2QIL A;  4YCV A;  1Y69 U;  3PUW A;  4DR3 L;  1PTO C;  3PMF A;  1MSG A;  3PO2 H;  3BZK A;  3NWS A;  1OXX K;  4C56 C;  2CW0 C;  1TQO A;  4CBV A;  1XNR L;  2BA1 A;  2QEJ C;  4A3F B;  3M4Q A;  4LFA L;  4RAU C;  5BN4 A;  5A2Q E;  4ALP A;  4JG2 A;  4FXK C;  2ZM6 Q;  2F0W A;  1B9N A;  1XPR A;  1KLG D;  2CH4 W;  4JK1 C;  2OTJ A;  4BWG B;  2F0Q A;  5IP9 G;  4A3B H;  4ABN A;  1SDF A;  3RLN A;  3T1H L;  3JC6 6;  1KDB A;  3EVQ A;  1JB7 A;  1GHJ A;  5NUC A;  5C4J H;  1X3Q A;  1EIF A;  1CI3 M;  2KOL A;  4XXE A;  1VQN A;  1QOH A;  2RA4 A;  4A93 B;  1WD1 A;  3I4M B;  4A3D B;  2E74 C;  5C4X H;  1AZP A;  1DGS A;  1KDA A;  1L0W A;  4IUV A;  3HOU G;  1K8M A;  2B8F A;  1EYG A;  2F3V A;  1XMO Q;  4K0K L;  3NUC A;  4WJ4 A;  2PMZ E;  1IW7 C;  3NK9 A;  1TS5 A;  1K0S A;  1A15 A;  4WJW A;  4FF1 A;  4L5Q A;  4A3G B;  3A8I E;  3BZC A;  3K5O A;  5KNC A;  3F8T A;  3ULL A;  1QNK A;  1TWG H;  2O2L D;  4UP9 A;  2B2V C;  2PNH A;  1EQV A;  4KK7 A;  4ZK9 B;  2G5D A;  4LFB L;  1DON A;  4A3E B;  3HOZ G;  2A6H D;  1BBX C;  4FXG C;  4X65 L;  2OWO A;  4RHR A;  3VR3 A;  1F77 A;  3IFD A;  5C44 H;  1W6K A;  1JE4 A;  3GTJ B;  3I4N G;  4DNI A;  3HKZ B;  3OHX C;  4EGV A;  5LMU L;  5G3L F;  4OGQ C;  1HFN A;  2EJF C;  2DY8 A;  1WOC A;  3GP7 A;  1GJX A;  2L1B A;  1PXU A;  1SND A;  2N88 A;  2TMP A;  1R9T B;  1BO0 A;  3AYH B;  4Q0F A;  2E76 C;  4NP5 A;  3CCU A;  5JJI A;  4C3J G;  5J3B A;  3CPF A;  3MTS A;  2YTV A;  3HOY G;  1B1Z A;  1J8I A;  3DXJ C;  1WCM G;  3LGJ A;  1Y1W G;  4DV1 Q;  3MFY A;  3H94 A;  2KJX A;  3CME A;  3Q6S A;  5I9P A;  4LF5 Q;  1ZKO A;  1SE3 A;  4JI8 L;  3JAM E;  1YJW A;  3KUP A;  1LT3 D;  2L11 A;  5ELF A;  1TWF H;  2AWN A;  3FVQ A;  4GKJ Q;  3J80 c;  2AQ3 B;  4J15 A;  4PZ7 A;  5LHY 1;  1NR4 A;  1PTO D;  1CA5 A;  1HTL D;  4DXF A;  2R92 H;  2B2W C;  2A1A A;  2D5D A;  2CW0 D;  2X69 A;  2WII B;  3WOE A;  2CQO A;  2K03 A;  3RUZ A;  2K5V A;  1FGU A;  4ME5 A;  3OTO Q;  2XSC A;  3R2I A;  4KJN A;  1WTQ A;  1FGB D;  5KND A;  4YCW A;  5I6Y A;  1EU4 A;  1IYU A;  1F2Y A;  4U67 3;  3O13 A;  3SK4 A;  2D0O A;  2EYO A;  3NEM A;  4DFA A;  4P74 A;  1HZA A;  2WB1 B;  2B3G A;  4J6H A;  1K0R A;  3GTP B;  1TWC B;  4KY6 A;  1C0A A;  4A3F H;  3J7A V;  2ZXO A;  1AH9 A;  4ZYS A;  1SNP A;  1E7Z A;  1KIX A;  1FD7 D;  3CCE A;  3KLS A;  1YJN A;  3M7G A;  3VYT A;  1VQ9 A;  3BYT B;  1U5K A;  3URY A;  1PVO A;  2JSO A;  3EJI A;  2EQS A;  1WJJ A;  4DR2 L;  1SJH D;  5JJZ A;  4V0B A;  4GOP B;  3J81 i;  2LS0 1;  4DR6 Q;  1ASY A;  1IW7 D;  2OTL A;  1EYC A;  1OO9 B;  4QIW B;  1TWH H;  1QUQ B;  5FLX E;  4Y7N B;  3DEO A;  4A93 H;  3I4M H;  4DR1 Q;  5IP7 G;  1JCK B;  4FYD A;  4AQY Q;  1ICW A;  1DD2 A;  1O78 A;  2I46 A;  1HR0 W;  5CV5 A;  2O4X A;  4PZ6 A;  3D4D A;  4PG3 A;  3U4V A;  1V8Q A;  5C5M A;  2F0T A;  5IE8 A;  2EYH A;  4CJ1 B;  1EQT A;  1FNV A;  3HOV H;  2N49 A;  1JE5 A;  4IUT A;  4A3M G;  1I94 Q;  2N8N A;  2IHE A;  2KUM A;  3GO5 A;  4A3E H;  2Q2T A;  2JA5 B;  2NBF A;  2WP8 J;  1YI2 A;  1G6P A;  1QVC A;  3FMC A;  3GTJ H;  1VQG A;  4DAY B;  1N36 Q;  2SEB D;  3OW2 A;  3TP5 A;  3H15 A;  2WFW A;  5E4X A;  3F2C A;  2IY5 B;  1LTL A;  1SMY D;  1TY2 A;  5FLM H;  2GVA A;  4IFD I;  1Q8K A;  2RF4 A;  1R9T H;  2EYP A;  4JV5 Q;  3CC2 A;  1EY6 A;  1JR0 D;  1Z7T A;  5M5W B;  1PTO B;  1M8A A;  4QY7 A;  2RHS B;  4KV6 A;  4XTC S;  3E0E A;  3IL8 A;  1CKN A;  4JYA L;  5IGF A;  1ENF A;  1E1O A;  5I9O A;  3GTM B;  2EPB A;  3FRP B;  4UP7 A;  3Q8D A;  3UDG A;  1IYJ B;  4R8I A;  3H91 A;  5BR8 Q;  3PCO B;  1WTW A;  1HR0 Q;  2YU9 B;  1N32 L;  1L2F A;  2Y0S G;  3PUX A;  5COY A;  4DUY L;  4JI7 Q;  1VMC A;  2QW7 A;  1EFI D;  4LF9 Q;  1N8R C;  5IYD G;  4NXM Q;  2BDO A;  2BE5 C;  4A3K H;  1NJI C;  1FJG L;  5M3M B;  1CM9 A;  1JOO A;  1KD1 C;  1BBU A;  2JP1 A;  3TS2 A;  3WDN A;  3K7A B;  3ND9 A;  4P72 A;  3RZO B;  3ULP A;  4GKK Q;  4PZ8 A;  4BY1 G;  1C8C A;  1SN8 A;  5JJK A;  2L9H A;  1G51 A;  2X6G A;  4DV6 Q;  3OSO A;  4C3I B;  2B2Y A;  1ESF A;  1HNW L;  3HGB A;  3MVV A;  1Q1B A;  3G6J B;  1CA6 A;  3BU2 A;  5DNF A;  3Q0A A;  4J1M A;  1WYD A;  1P8L A;  5GAE C;  4HJ5 A;  3HKS A;  5D3I B;  2UUB Q;  2F0P A;  2GN5 A;  4IJL A;  3MXN A;  4GNX A;  2WAQ G;  4HJ8 A;  4OO1 I;  1JJ2 A;  2B2T A;  1ET9 A;  1H9M A;  4GN3 B;  1XPO A;  2O5I C;  1H9R A;  2UUA L;  4KD3 A;  1MD2 D;  3FDT A;  2VQE Q;  4DR4 L;  4MNO A;  2XRQ D;  2PQA A;  2BA0 A;  1RCV D;  1JOR A;  2KEC A;  2Z0S A;  3RNU A;  1W3S A;  3RN2 A;  3BDO A;  3U58 A;  3CC4 A;  5F2D A;  2QF7 A;  1XJV A;  4JI6 Q;  1IL2 A;  3QIA A;  1CK1 A;  1HH2 P;  4TQU S;  1WVL A;  1NSN S;  3K0X A;  4UPA A;  4APV A;  1DOL A;  4YHH L;  4IPH A;  1PH8 A;  3Q24 A;  2UXD L;  4FXD A;  1D5X C;  2Z6B A;  3H09 A;  2N3S A;  4BY7 G;  1EY4 A;  3HOU B;  3KLR A;  1K8A C;  4OEM B;  4O42 A;  1K3R A;  4JI1 Q;  5JPM C;  1SYF A;  3M9B A;  4B3S Q;  3FKI G;  2LSS A;  2CCZ A;  4DV0 Q;  1SR3 A;  1FNU A;  3MZ5 A;  4ULL A;  2RSO A;  2BOS A;  2ZJR A;  3HEJ A;  1V43 A;  2HIV A;  3HRZ C;  3QWN A;  3C46 A;  3CW2 C;  5M5W H;  1UNS A;  3HOZ B;  3SDZ A;  4EQN A;  3J80 E;  3IAY A;  2UUC Q;  1EZ8 A;  4ZKC B;  3GTM H;  1XTD A;  2NVY H;  4DPG A;  2NYZ D;  2JA7 G;  3T1Y L;  3K5L A;  4IFD J;  5C4Z A;  1XMQ Q;  4R4T A;  4LUO A;  1N33 Q;  1K83 B;  3HOX G;  4S3S A;  3R93 A;  2VB2 X;  2NZ1 D;  2YU9 H;  4KY7 A;  1TS3 A;  3HOY B;  3U4Z A;  1W6J A;  4KKS A;  1WCM B;  1VQJ A;  4RGO S;  1ILQ A;  5EBD A;  1H9J A;  5CV9 A;  1Y1W B;  5I4D A;  4BXX H;  1S5B D;  2RDF A;  2QKI C;  1GO3 E;  2EYL A;  4JI4 L;  1II3 A;  1L0Y B;  4RGN A;  2IJ0 A;  1UE6 A;  1YZ6 A;  3Q22 A;  1A0I A;  2NN6 H;  3VA7 A;  1BUV T;  1AEX A;  1AE3 A;  1WTO A;  1CZG A;  5KYI A;  1HNX Q;  3RZO H;  4IJH A;  1G2T A;  3BVM A;  4A3L G;  2QCP X;  2ZM6 L;  3VA5 A;  1RF2 D;  4DU9 A;  3A5U A;  1LTG D;  4C3I H;  1E1T A;  1RDP D;  5ISR A;  3PUZ A;  4ZQ3 A;  1KHI A;  4B9X A;  2K01 A;  3EN2 A;  1BCP C;  4V19 0;  5A2Q L;  1Y8P B;  3SE0 A;  4RKB A;  3TS0 A;  1PH3 A;  5CMD A;  3RLO A;  2FJ2 A;  4O0A A;  5E4W C;  3TZD A;  4PV1 C;  2KCC A;  3KYH C;  4TRD A;  1VQ4 A;  4DR7 Q;  5CC4 A;  5M5Y B;  1X3E A;  4JOI A;  1WTX A;  2I0Q A;  4FP5 D;  4OIK A;  1VQE A;  4JPB W;  3CMA A;  1WTH A;  4DAV A;  3GTL B;  1DM0 B;  1HUN A;  2VY3 A;  3PV0 A;  1YNJ C;  2YTX A;  4RCO A;  3PO3 G;  3NE5 B;  4K2L A;  3UI2 A;  2GA4 B;  4AIM A;  2HD3 A;  1J5E Q;  1U4M A;  3HOU H;  1GUO A;  2K33 A;  4HMJ A;  3OPO A;  1PH5 A;  5EQ0 A;  1YNX A;  3E9I A;  2UXB L;  2AUK A;  3E3X A;  2VUM G;  2JQO A;  2F52 A;  3RLF A;  2ATW A;  5LMN L;  4MZ9 A;  5HY6 A;  4G4K A;  4A75 A;  4X64 Q;  5C3E G;  3CCS A;  2JE6 I;  1ZXT A;  1N34 Q;  4DV7 Q;  2HQE A;  1EUJ A;  5C6A A;  1SRU A;  1O80 A;  1SYG A;  4A3M B;  2HIX A;  1HQM C;  4F8M A;  1EY7 A;  2Z4H A;  1PLF A;  2AQ2 B;  3J81 c;  2J4X A;  1G29 1;  2WB1 E;  1MSH A;  3W2D A;  1BNZ A;  3S14 B;  1Z9F A;  4GKJ L;  2ZTD A;  1PFS A;  4X3T A;  2J0T D;  1YHQ A;  1MJE A;  1HJP A;  4JI3 Q;  3I72 A;  5C4H A;  1HCZ A;  3JAM L;  1I6V C;  3MA2 B;  3C1E A;  1VQA A;  3S2D H;  4BBR G;  5I6W A;  4RWS C;  4G7Z C;  2F4V Q;  2M2L A;  4IOA A;  5AFW A;  4OWT B;  1U4R A;  5CV7 A;  1Q8I A;  2HHH Q;  2EE1 A;  1I4H A;  2F0K A;  1JQY D;  1PA6 A;  1TKW B;  3S16 H;  1BCP D;  1WFQ A;  3KF8 A;  2Z8L A;  4WJ3 M;  1ROD A;  2Y0S B;  1PH2 A;  1HPC A;  1XWE A;  1J6Q A;  2A69 C;  5FO7 B;  2UU9 Q;  1PH7 A;  1VQ8 A;  3HOW H;  2OF1 A;  3KBG A;  1NBW A;  5D14 A;  2QDL A;  4DV4 L;  1G6Z A;  4XYQ A;  3PUV A;  1IBM L;  1A3U A;  4BBS G;  5M5X B;  3NEN A;  3KF6 A;  5KYL A;  2R93 B;  2KED A;  4DR6 L;  3GTK H;  1S72 A;  3ULJ A;  4JI0 Q;  1YBY A;  2KHJ A;  4DV2 Q;  3C3L A;  1F9S A;  1I6H H;  1PFN A;  1DZ1 A;  3RD4 A;  3HFZ B;  4L8J A;  4JBJ A;  5IGD A;  3GTQ H;  2CKZ B;  3OIQ A;  5M5Y H;  3GTO B;  5GAH C;  3KK7 A;  4X3U A;  3TDQ A;  4LF4 Q;  2HDL A;  5FLX L;  5M3F B;  2XWJ B;  2KCT A;  4RA8 A;  2IX0 A;  5CBA E;  3K80 C;  3GTL H;  3NBH A;  2WAQ B;  3PIP 3;  1EL0 A;  2F3I A;  3CQZ B;  1GUS A;  2G9H D;  3ZJY C;  1C9O A;  1XNQ L;  2BH2 A;  1I94 L;  4ZKB B;  2K5N A;  5E3F A;  2E2J H;  2BDN A;  2IWH A;  1JJG A;  1XXG A;  1SXT A;  3I73 A;  2C5C A;  4OHJ A;  1HA6 A;  1B9M A;  3H0G G;  5AJ3 Q;  3VR4 A;  4OIJ A;  5IWA L;  3C2P A;  3R2T A;  2I5L X;  4JCV E;  5K36 G;  1CSP A;  3H3V C;  1SBB B;  3E5S A;  4AYB G;  3E6Z X;  1HZC A;  1LTB D;  3J7A 5;  2P5Z X;  3DWA A;  1Y1V G;  3S1M H;  1HTP A;  4A3C H;  2RSN A;  1U4P A;  3DLL A;  2AMC B;  5IYB H;  4E6I A;  1X65 A;  5JEA G;  3S1Q B;  2FMM A;  1BVS A;  5HUR A;  2Q8I B;  1MJC A;  5C5L A;  5JVH 3;  3MAQ A;  1EOV A;  3FKI B;  3TP7 A;  1IBL Q;  2M9V A;  4IO9 A;  2MQH A;  3FP9 A;  1NE3 A;  2EY6 A;  3DM1 A;  2E5L Q;  4LF6 Q;  2E2I B;  1CT1 D;  2B2Y C;  3A74 A;  1ZYR C;  1EWH A;  2K32 A;  5EAY A;  1BCP B;  4JI5 Q;  4JI7 L;  3GV3 A;  2PW5 A;  4C3H G;  4DK1 A;  4F7X A;  1HNZ Q;  3T13 A;  2F0S A;  4EQO A;  4DNR B;  3SXH A;  1EYD A;  4GNX C;  5D3D A;  1D2B A;  2WIN B;  2A69 D;  1STH A;  2B2T C;  1O7L A;  1NR2 A;  2JA7 B;  4KTA A; 
#chains in the Genus database with same CATH homology
 4X3K A;  4HN7 A;  1PTO F;  4KJO A;  3HOX B;  1EY8 A;  3J7A F;  4BA2 I;  2EOT A;  4KN4 C;  1B3A A;  5DM7 3;  3MWY W;  1SNM A;  1PZJ D;  1LO5 D;  1SNC A;  1SYD A;  3L9A X;  1SMY C;  4BA1 I;  4DF7 A;  4G7H C;  2IW3 A;  3SEB A;  2E75 C;  4FF4 A;  5EJW A;  3BS1 A;  4X3S A;  2F0H A;  2PYK A;  3D31 A;  1WD0 A;  2B63 B;  5IT9 E;  1DCZ A;  2JEA I;  1KAA A;  5KNB A;  4UAI A;  4BS9 A;  2B8G A;  1D6E C;  1LT4 D;  4J8Q A;  3K5M A;  5CV8 A;  4C1N I;  1OXS C;  2PCF B;  4NMZ A;  4K8I A;  3ERQ A;  3GD7 A;  1STN A;  4DAP A;  1L0X B;  4QMG A;  3J81 E;  1EOT A;  2NVT B;  2LKV A;  3NQT A;  2K5D A;  4KHV A;  5J22 A;  4JBW A;  4WOR A;  1ZYR D;  5C3W A;  1ML0 D;  3OMC A;  4IFD H;  4K2K A;  3M4O B;  2F0U A;  4HSP A;  1K8O A;  4NKL A;  2A6E C;  4H44 C;  2VUM B;  3EQL C;  1PFB A;  3V2T A;  2NTT A;  1B4O A;  1S4Z A;  5C3E B;  2EVB A;  3AU7 A;  3NTH A;  1PRT C;  3KLS X;  3K5N A;  1I4G A;  5BN3 A;  1LLR D;  3VYR A;  3SK5 A;  5DEH A;  1QIL A;  1XX8 A;  4IN3 A;  1ENC A;  2PW7 A;  1DJR D;  1WTR A;  1IYV A;  2K1B A;  3A8K E;  4BBR B;  1YNN D;  2F0G A;  2DNC A;  1T5X D;  4DAY A;  3BG3 A;  3A8J E;  1V1P A;  1J9O A;  3Q23 A;  1SEB D;  3N52 A;  4QUC A;  5IGE A;  1A2U A;  3GTG B;  1RTN A;  4OO1 H;  1TII D;  5C0X G;  1G8Z D;  3ITP A;  1KNE A;  1VCI A;  1LAB A;  3MC0 B;  4R9W A;  2HUG A;  2XN9 C;  2F0D A;  3S9W A;  1PRT F;  1XYI A;  1HQR D;  3MEH A;  3J7Y W;  2FHT A;  3C1F A;  4LAA A;  4P2C B;  1BOS A;  3I3C A;  1JWM D;  2VB3 X;  3T16 A;  2ZT9 C;  2A6E D;  1GOZ A;  3R8B A;  4HCE A;  3E0J A;  4QF4 A;  5T1I A;  3SK8 A;  3QB3 A;  1C48 A;  2D9U A;  2Q8R E;  5JOB A;  3LX0 A;  1X32 A;  3H0G B;  1EWC A;  1PRT D;  1B50 A;  5IGG A;  1SE4 A;  3K0Y A;  2RBM A;  1STG A;  4I65 A;  1GUW A;  4FF2 A;  5D65 A;  4AYB B;  1BR9 A;  3S1N B;  2F0J A;  1A6X A;  2EYM A;  1LT5 D;  3NSW A;  3I8Z A;  4K6D A;  4K14 A;  3RZD B;  1B44 D;  1LTR D;  2KVM A;  1CFM A;  3QOJ A;  4DXG A;  2WKD A;  5I2Y A;  2JXM B;  5IOC A;  1JB3 A;  2O5J C;  1PTO H;  1LTA D;  4FVM A;  4B9W A;  2QDB A;  4QB4 A;  5E1F A;  4ZUJ A;  3I4N B;  1TT2 A;  3P20 A;  3I91 A;  2X6L A;  4L63 B;  1RKN A;  4HTH A;  1LTI D;  3L3O C;  3DEP A;  2LFN A;  3D6C A;  2IT1 A;  1RTO A;  4C3J B;  4IUU A;  4TKO B;  3LWU A;  5LL6 X;  1F9Q A;  1RD9 D;  3IKJ A;  3LNN A;  2H1E A;  4IUN A;  2L12 A;  2XRS D;  4NW2 A;  1STY A;  1DYQ A;  3A55 A;  3TSS A;  1PRT B;  2EY1 A;  4A3I B;  2IPK D;  5J1Z A;  1DOK A;  3NPP A;  1UEA B;  2AWO A;  1Q3L A;  2L0C A;  2KQ3 A;  3DHQ A;  1HXY D;  1KDC A;  1QWY A;  4ZLT F;  1EU3 A;  2K05 A;  1SAP A;  2EYJ A;  3V05 A;  4C2M B;  1S5D D;  3NHH A;  2YYZ A;  3MXG A;  1Y8O B;  2CHB D;  4CKE A;  1F2Z A;  3GQB A;  1TU2 B;  1STE A;  1HA5 A;  4I7Z C;  2M00 A;  1STA A;  5IGB A;  5JPN C;  1S5F D;  3A7A B;  4XQJ A;  4ODG A;  1JC7 A;  2F0V A;  2E2H B;  5FK9 C;  3BDL A;  1CZW A;  5JVG 3;  1RJT A;  2MGS A;  5DAU A;  3S17 B;  1O7Y A;  1TS2 A;  3PO2 B;  1CHP D;  1EY9 A;  2DY7 A;  3PUY A;  1QE6 A;  2NTS A;  4FF3 A;  3QJY A;  2K28 A;  1LV9 A;  4HSV A;  4CKC A;  3P75 A;  5K5P A;  1H9S B;  1BCP F;  2IX3 A;  5EPJ A;  4XYO A;  2F0M A;  1ILP A;  1PFM A;  2RDG A;  3VR6 A;  5IGC A;  5KEE A;  3L7Z C;  4IQZ A;  3EFX D;  4CKB A;  1Q12 A;  2WV6 D;  5C4X B;  4FNF A;  1GUN A;  4EVO A;  2L55 A;  3FPU B;  3I90 A;  4RH6 A;  3K58 A;  2PO4 A;  2F0F A;  3HZX A;  4NDX A;  1U4L A;  5EPL A;  1BXT A;  2Z1C A;  1G2S A;  1TVX A;  5IT9 L;  5CV4 A;  5ELE A;  1XTC D;  2NUC A;  1UAP A;  5CYU A;  3D4R A;  1H9K A;  5J39 A;  5FO9 B;  3QO2 A;  1HUM A;  1Z47 A;  3CRK C;  2RVL A;  1ENA A;  1Q90 A;  4WRD A;  3U9S A;  4N9P A;  3TN2 A;  2MUY A;  3GV6 A;  2F0E A;  2SNS A;  4PMB A;  2FMC A;  1Y8N B;  1FR3 A;  4UDU C;  2K5W A;  5FOB B;  4BY1 B;  2F3W A;  2TSS A;  5EKK A;  4F87 A;  1PMR A;  1LT6 D;  2L4N A;  3J81 L;  4KHZ A;  4DNT B;  4RHS A;  3BVG A;  2MP1 A;  2WKC A;  3ND8 A;  2NN6 G;  4IUR A;  1X3P A;  2AUJ D;  5I2X A;  1LAC A;  2F0N A;  3NP8 A;  1PYW D;  3AB9 A;  5EPK A;  4C3I G;  2SDF A;  1GHK A;  1IHZ A;  1I4X A;  1E0B A;  4DN4 M;  4M1U B;  2MJ8 A;  5ELC A;  1JOQ A;  3VR2 A;  4PQX A;  3A7L A;  1UUP A;  1VF7 A;  4BY7 B;  4HED A;  1AP0 A;  4FO2 A;  3HP3 A;  1BDO A;  1CQV A;  4MHE A;  4KKU A;  3D3R A;  3NTI A;  3FEW X;  3AMU A;  3WOF A;  4XT1 B;  1KNA A;  4XIG S;  1TWH B;  3MFG A;  3M3Y B;  1SJE D;  1EY0 A;  4RKL A;  4HR7 B;  4L6T B;  4RGM A;  1CQF A;  2IX1 A;  1OXV A;  2I07 B;  1QCB D;  3OIP A;  5CV6 A;  2ZXP A;  1FYC A;  2EY5 A;  4R8N A;  2ENB A;  3D4W A;  1VDZ A;  5JEA J;  3HOV B;  4K5W A;  4LJZ C;  1U9R A;  2OEO A;  3T53 B;  1BF4 A;  2KCN A;  1OXU A;  2B2U A;  3RMH A;  4ZRZ A;  1MGS A;  5C0X H;  4PMC A;  1PZK D;  2MPM A;  1TS4 A;  1I3Q B;  1A2T A;  3QOL A;  1DOM A;  1S5E D;  1SYB A;  1ET6 A;  1YNN C;  4RGT A;  1NCV A;  2EY2 A;  2VXW A;  2OT2 A;  1EZ6 A;  3X3N A;  3SVM A;  2XVS A;  4WFN 3;  4A3J B;  1I4R A;  5IIF A;  5KGU A;  1GXD C;  2F03 A;  5LL6 S;  1B2T A;  1F9P A;  4IZ8 A;  5G3L D;  1R4Q B;  1SFO B;  1ZEQ X;  4DGZ A;  5C0X I;  5EKI A;  4A3K B;  2A74 C;  1VMP A;  1CTM A;  5ELD A;  3K6O A;  2R6G A;  1O7Z A;  2HCI A;  3I4L A;  3NBI A;  3S2H B;  5CGK A;  3HG9 A;  4KN7 C;  5TSS A;  3PO3 B;  3M4Y A;  1SNO A;  2NB0 A;  3DWP A;  2LY7 A;  1ESR A;  4IUP A;  2ICI A;  1IKL A;  2EJM A;  3OOC A;  4N9T A;  3T4A C;  5EGT A;  4K5X A;  3J80 L;  2FFK B;  2PNR C;  4KD4 A;  3FPP A;  3BZD B;  1V1O A;  2BCO A;  4EQP A;  3I70 A;  4DA2 A;  5CBE E;  1JWS D;  3CHB D;  2CVR A;  1EY5 A;  4ID6 A;  2F0L A;  1EIG A;  3G7L A;  2F0O A;  2KA7 A;  3P7J A;  4O1N A;  2RDH A;  2PZW A;  5EBC A;  2KHS A;  4H13 C;  2ID0 A;  5COR A;  4RFB A;  2J7Z A;  3EA6 A;  3S1R B;  2Q8T A;  5ELB A;  2D62 A;  1V1P B;  1SYE A;  2F0I A;  2NWG A;  1D1I A;  1MBY A;  2EYF A;  4IAL A;  2EDG A;  4OL7 A;  2NVX B;  5C3X A;  1G91 A;  4PNY A;  3VYS A;  2NVY B;  2XIW A;  5KRU A;  3K59 A;  4BBS B;  1SNQ A;  4C1N K;  4QCL A;  3V96 A;  3PIO 3;  3H6M A;  2XWB B;  3VYU A;  3P1H A;  4HAE A;  1I4Q A;  3BDC A;  3VR5 A;  4CGY B;  3HS0 C;  1T5E A;  4F88 A;  3TP8 A;  2A68 C;  2IL8 A;  2EJG C;  4LMQ D;  3SR1 A;  2Z4I A;  1HFG A;  2AQ1 B;  3T51 B;  1JOK A;  2MHV A;  2EXZ A;  1D1K A;  4RCN A;  3OW7 A;  5FO8 B;  2PMZ B;  5C0X J;  2D2C C;  3MHB A;  4XQQ A;  2DN8 A;  3DMU A;  4G7O C;  2LMC B;  1D5Z C;  2B2V A;  4K5V A;  1TR5 A;  3TME A;  1A3V A;  3D8G A;  1ONL A;  1GUG A;  1Y1V B;  3SHL A;  1QG7 A;  3OMG A;  2F1M A;  5EKL A;  3OWE B;  2RQX A;  1QNU A;  1F2M A;  3NXW A;  2PPB C;  3OWF A;  1SSO A;  1QB5 D;  1KTK A;  2K7V A;  1A3T A;  2HDM A;  2H4O A;  4Q5V A;  2NVQ B;  4QUF A;  4YIJ A;  1AFP A;  2FIN B;  1SE2 A;  2R7Z B;  2R61 A;  3U9O A;  4C3H B;  1HRJ A;  4MIU A;  2K6A A;  4IFD G;  3BYY B;  1RHP A;  3K57 A;  4ILW A;  4ZAI A;  4K8J A;  1E2W A;  5KIX A;  1FNW A;  2SOB A;  1EYA A;  2B2W A;  2VNU D;  3ERO A;  1PZI D;  4XQN A;  2K5Q A;  5A35 A;  1IKM A;  1VF5 C;  5FKA C;  2F4I A;  3M7N A;  3W3A A;  3LWE A;  3S15 B;  2C9O A;  2A68 D;  4CHT B;  2BE5 D;  3DWQ A;  4CJ0 B;  2E2D C;  4IUQ A;  1WTV A;  1C4Q A;  4KI0 A;  2PZT A;  3NTK A;  3S2D B;  3IFT A;  1HHV A;  3MXP A;  3SK6 A;  2EZV A;  2PQE A;  1SYC A;  4XDX A;  3S16 B;  5BN5 A;  2JA6 B;  2L5T A;  1EEF D;  2PZU A;  4DK0 A;  3T56 B;  4KY5 A;  3TP6 A;  4GZY C;  1NUC A;  3HOW B;  4OO1 G;  1B53 A;  4CJ2 C;  4U68 A;  1BQQ T;  3KBX A;  3X3M A;  5K36 H;  1GUT A;  3GTK B;  2A73 B;  1F9R A;  3TBI B;  5DM6 3;  1I4P A;  1I6H B;  2B2U C;  4H0L C;  1OXT A;  3TZU A;  3GTQ B;  3ONA B;  4KMU C;  1STB A;  5JEA H;  2NN6 I;  1LTS D;  3N6R A;  1TY0 A;  1AN8 A;  4B08 A;  1JWU D;  4G57 A;  2OXP A;  2JYO A;  1Z6H A;  3CRL C;  1S5C D;  1AW7 A;  3A54 A;  3QG1 A;  2E2J B;  3CKI B;  1DXM A;  3DUZ A;  4HCS A;  4K6L A;  2ZXR A;  3M85 A;  1EIH A;  4A3B B;  1AZQ A;  1E2V A;  2A5H A;  2XNA C;  3D6W A;  1KAB A;  3S1M B;  1EEI D;  5HGT A;  5C4J B;  2G9D A;  4KKT A;  1PDQ A;  1NAP A;  2ICE C;  3F2U A;  2R3Z A;  4MN3 A;  1LTT D;  4H7B A;  1JIC A;  1H9S A;  4PMW A;  1M4V A;  1D5M C;  2SNM A;  1TWG B;  4M8A A;  3CU7 A;  3MXU A;  1IL8 A;  3R3O A;  1KLU D;  4Z9C B;  5C44 B;  1MI2 A;  1QJO A;  5IOD A;  1F2L A;  2JEB I;  3BVZ A;  2A6H C;  1E2Z A;  1WTP A;  4TSS A;  2KEE A;  2JA8 B;  1Q1E A;  2B39 A;  5JAV A;  2CQA A;  4ZUI A;  1R4P B;  1TWF B;  2WAC A;  2HCC A;  1I50 B;  5T1G A;  3ZYY X;  1TWA B;  2N55 A;  5CR3 A;  3NQI A;  2R92 B;  3A56 A;  1CHQ D;  4XT3 B;  3NWT A;  1YNJ D;  2K04 A;  2V4D A;  5M9O A;  2DNE A;  2RKS A;  4HMI A;  4LK1 C;  2QIL A;  1Y69 U;  3PUW A;  1PTO C;  3PMF A;  1MSG A;  3NWS A;  4C56 C;  1OXX K;  2CW0 C;  1TQO A;  4CBV A;  2BA1 A;  2QEJ C;  4A3F B;  4RAU C;  5BN4 A;  5A2Q E;  4FXK C;  2F0W A;  1B9N A;  1KLG D;  4JK1 C;  4BWG B;  2F0Q A;  4ABN A;  1SDF A;  1KDB A;  3EVQ A;  1GHJ A;  5NUC A;  1X3Q A;  1CI3 M;  2KOL A;  4XXE A;  1QOH A;  2RA4 A;  4A93 B;  1WD1 A;  3I4M B;  4A3D B;  2E74 C;  1AZP A;  1KDA A;  4IUV A;  1K8M A;  2B8F A;  2F3V A;  3NUC A;  1IW7 C;  3NK9 A;  1TS5 A;  1A15 A;  4WJW A;  4FF1 A;  4A3G B;  3A8I E;  3K5O A;  5KNC A;  1QNK A;  2O2L D;  2B2V C;  4KK7 A;  1EQV A;  4ZK9 B;  1DON A;  4A3E B;  2A6H D;  1BBX C;  4FXG C;  4RHR A;  3VR3 A;  1F77 A;  3IFD A;  1W6K A;  1JE4 A;  3GTJ B;  3HKZ B;  3OHX C;  4EGV A;  5G3L F;  4OGQ C;  1HFN A;  2EJF C;  2DY8 A;  3GP7 A;  1GJX A;  2L1B A;  1PXU A;  1SND A;  2N88 A;  2TMP A;  1R9T B;  1BO0 A;  4Q0F A;  2E76 C;  4NP5 A;  4C3J G;  3MTS A;  1B1Z A;  1J8I A;  3DXJ C;  3MFY A;  3H94 A;  2KJX A;  3Q6S A;  5I9P A;  1ZKO A;  1SE3 A;  3JAM E;  3KUP A;  1LT3 D;  2L11 A;  5ELF A;  2AWN A;  3FVQ A;  2AQ3 B;  5LHY 1;  1NR4 A;  1PTO D;  1CA5 A;  1HTL D;  4DXF A;  2B2W C;  2D5D A;  2CW0 D;  2X69 A;  2WII B;  3WOE A;  2K03 A;  3RUZ A;  4ME5 A;  2XSC A;  3R2I A;  4KJN A;  1WTQ A;  1FGB D;  5KND A;  5I6Y A;  1EU4 A;  1IYU A;  1F2Y A;  4U67 3;  3O13 A;  3SK4 A;  2EYO A;  4DFA A;  2WB1 B;  4J6H A;  3GTP B;  1TWC B;  4KY6 A;  3J7A V;  2ZXO A;  4ZYS A;  1SNP A;  1FD7 D;  3KLS A;  3M7G A;  3VYT A;  3BYT B;  3URY A;  2JSO A;  3EJI A;  1SJH D;  5JJZ A;  4V0B A;  2LS0 1;  1IW7 D;  1EYC A;  1OO9 B;  4QIW B;  5FLX E;  4Y7N B;  3DEO A;  1JCK B;  4FYD A;  1ICW A;  1DD2 A;  1O78 A;  2I46 A;  5CV5 A;  2O4X A;  3D4D A;  1V8Q A;  5C5M A;  2F0T A;  2EYH A;  4CJ1 B;  1EQT A;  1FNV A;  4IUT A;  2KUM A;  3GO5 A;  2JA5 B;  2NBF A;  2WP8 J;  3FMC A;  2SEB D;  3TP5 A;  5E4X A;  1SMY D;  1TY2 A;  4IFD I;  2EYP A;  1EY6 A;  1JR0 D;  1Z7T A;  5M5W B;  1PTO B;  1M8A A;  4KV6 A;  4XTC S;  3IL8 A;  5IGF A;  1ENF A;  5I9O A;  3GTM B;  2EPB A;  3FRP B;  4R8I A;  3H91 A;  1WTW A;  2YU9 B;  3PUX A;  5COY A;  1VMC A;  1EFI D;  2BDO A;  2BE5 C;  5M3M B;  1CM9 A;  1JOO A;  2JP1 A;  3WDN A;  3K7A B;  3ND9 A;  3RZO B;  1C8C A;  2L9H A;  2X6G A;  3OSO A;  4C3I B;  2B2Y A;  1ESF A;  3HGB A;  3MVV A;  1Q1B A;  3G6J B;  1CA6 A;  5DNF A;  3Q0A A;  4J1M A;  5D3I B;  2F0P A;  3MXN A;  4OO1 I;  2B2T A;  1ET9 A;  1H9M A;  2O5I C;  1H9R A;  4KD3 A;  1MD2 D;  3FDT A;  2XRQ D;  2BA0 A;  1RCV D;  1JOR A;  2KEC A;  3BDO A;  5F2D A;  2QF7 A;  3QIA A;  1CK1 A;  4TQU S;  1WVL A;  1NSN S;  1DOL A;  3Q24 A;  4FXD A;  1D5X C;  3H09 A;  1EY4 A;  3HOU B;  3KLR A;  4O42 A;  5JPM C;  1SYF A;  1FNU A;  3MZ5 A;  4ULL A;  2RSO A;  2BOS A;  3HEJ A;  1V43 A;  3HRZ C;  3QWN A;  3C46 A;  1UNS A;  3HOZ B;  3SDZ A;  4EQN A;  3J80 E;  3IAY A;  1EZ8 A;  4ZKC B;  2NYZ D;  3K5L A;  4IFD J;  5C4Z A;  1K83 B;  4S3S A;  3R93 A;  2VB2 X;  2NZ1 D;  4KY7 A;  1TS3 A;  3HOY B;  1W6J A;  4KKS A;  1WCM B;  4RGO S;  1ILQ A;  5EBD A;  1H9J A;  5CV9 A;  1Y1W B;  5I4D A;  1S5B D;  2RDF A;  2QKI C;  2EYL A;  1II3 A;  1L0Y B;  4RGN A;  2IJ0 A;  3Q22 A;  2NN6 H;  3VA7 A;  1BUV T;  1AEX A;  1WTO A;  1CZG A;  5KYI A;  1G2T A;  3BVM A;  2QCP X;  3VA5 A;  1RF2 D;  4DU9 A;  1LTG D;  1RDP D;  5ISR A;  3PUZ A;  4ZQ3 A;  4B9X A;  2K01 A;  1BCP C;  4V19 0;  5A2Q L;  1Y8P B;  3SE0 A;  4RKB A;  5CMD A;  2FJ2 A;  5E4W C;  3TZD A;  4PV1 C;  2KCC A;  4TRD A;  5CC4 A;  5M5Y B;  1WTX A;  4FP5 D;  4OIK A;  4DAV A;  3GTL B;  1DM0 B;  1HUN A;  3PV0 A;  1YNJ C;  4RCO A;  3NE5 B;  4K2L A;  3UI2 A;  2GA4 B;  1U4M A;  1GUO A;  2K33 A;  4HMJ A;  3OPO A;  5EQ0 A;  2AUK A;  3RLF A;  4G4K A;  2JE6 I;  1ZXT A;  2HQE A;  4A3M B;  5C6A A;  1SYG A;  1O80 A;  1HQM C;  4F8M A;  1EY7 A;  2Z4H A;  1PLF A;  2AQ2 B;  2J4X A;  1G29 1;  1MSH A;  3W2D A;  1BNZ A;  3S14 B;  4X3T A;  2J0T D;  5C4H A;  3I72 A;  1HCZ A;  3JAM L;  1I6V C;  3MA2 B;  3C1E A;  5I6W A;  4RWS C;  4G7Z C;  2M2L A;  5AFW A;  1U4R A;  5CV7 A;  1Q8I A;  2EE1 A;  1I4H A;  2F0K A;  1JQY D;  1TKW B;  1BCP D;  3KF8 A;  2Z8L A;  1ROD A;  2Y0S B;  1HPC A;  1XWE A;  2A69 C;  5FO7 B;  2OF1 A;  3KBG A;  5D14 A;  1G6Z A;  4XYQ A;  3PUV A;  1A3U A;  5M5X B;  2R93 B;  5KYL A;  2KED A;  3C3L A;  1F9S A;  1PFN A;  1DZ1 A;  3RD4 A;  4L8J A;  5IGD A;  3OIQ A;  3GTO B;  3KK7 A;  4X3U A;  3TDQ A;  2HDL A;  5FLX L;  5M3F B;  2XWJ B;  4RA8 A;  2IX0 A;  5CBA E;  3NBH A;  2WAQ B;  3PIP 3;  1EL0 A;  3CQZ B;  1GUS A;  2G9H D;  4ZKB B;  5E3F A;  2BDN A;  2IWH A;  1XXG A;  1SXT A;  3I73 A;  2C5C A;  4OHJ A;  1HA6 A;  1B9M A;  3VR4 A;  4OIJ A;  3C2P A;  3R2T A;  5K36 G;  3H3V C;  1SBB B;  3E5S A;  3E6Z X;  1LTB D;  3DWA A;  1HTP A;  2RSN A;  1U4P A;  4E6I A;  5JEA G;  3S1Q B;  2FMM A;  5HUR A;  2Q8I B;  5C5L A;  5JVH 3;  3MAQ A;  3FKI B;  3TP7 A;  2M9V A;  2EY6 A;  3DM1 A;  2E2I B;  1CT1 D;  2B2Y C;  1ZYR C;  1EWH A;  2K32 A;  1BCP B;  3GV3 A;  2PW5 A;  4C3H G;  4DK1 A;  4F7X A;  3T13 A;  2F0S A;  4EQO A;  4DNR B;  3SXH A;  1EYD A;  5D3D A;  1D2B A;  2WIN B;  2A69 D;  1STH A;  2B2T C;  1O7L A;  1NR2 A;  2JA7 B;  4KTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...