3ERSX

Crystal structure of e. coli trbp111
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
METVAYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGQKTLQTVTSLVPYYSEEELMGKTVVVLCNLQKAKMRGETSECMLLCAETDDGSESVLLTPERMMPAGVRVVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords tRNA-binding protein ygjH
publication title Crystal structure of Trbp111: a tructure specific tRNA binding protein
pubmed doi rcsb
source organism Escherichia coli
total genus 23
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ersX00
4PZ7A 3L7ZC 4IFDG 2PQAB 1N33Q 2ASBA 1A8VA 3HOUG 4UPAA 4GKJL 2ID0A 5JEAG 2D0PA 1VQJA 3HFZB 4DR5L 1AE2A 1HNXQ 2IHEA 4DV3L 4IPGA 3U4ZA 1L1OB 2IY5B 4DR1L 1NE3A 1SRUA 3PUZA 5FJ8H 4GOPC 1L0WA 3OTOL 4DR4L 3BZCA 3KF6A 1JMCA 3AYHB 3NBHB 3ULPA 2JA7G 3CMEA 2VS1A 4J15A 1VQEA 2LXJA 5E7NA 1Z9FA 2EIFA 4DR6L 1VQIA 3JAMi 4LF5L 1VQBA 1XPOA 4NXNL 4DV4Q 1NBWA 5IYCH 1JJGA 2AMCB 5GAEC 4LWCA 2JA5H 2AKWB 2VL6A 3H3VH 3AFPA 2I0QA 2WP8J 2UUBQ 3IRBA 1BBWA 2K52A 1PH1A 1VS0A 4IJHA 2Q2TA 3GTMH 4LF8Q 3UDIA 3GD7A 4YY3L 1SMXA 3HOXG 2Y0SE 4EQ5A 1J5EL 3KDFB 1YI2A 1X6OA 4JI4Q 3F2CA 4LF7Q 5LMNW 3D0FA 3G48A 4APVA 3I56A 2R7ZG 5LMNQ 1S72A 4AQYL 3T1YL 3HOVH 3K7AH 4X64L 3KFUA 1MJEA 5IP7G 4A3BH 2AHOB 3Q8DA 4A3GG 2ZM6L 4X6AH 5C44H 4C3IH 3CC4A 2NVYH 3U50C 4OWXB 3W1GA 1HH2P 3J7ZC 2OQKA 2JA9A 1XMQQ 2YYZA 3PIOA 4HIDA 1N8RC 2B3GA 1E7ZA 2JK8A 4UY8C 1K83H 3GTKH 3G71A 1WCMH 4DV0L 2ALYB 1VQLA 1K0RA 1G6PA 1WOCA 2A1AA 1N36L 4DK3C 3S1RH 4DR4Q 2B29A 4A3IG 3CCUA 1PH7A 2MO1A 5FLMH 2E2JH 2R93G 4YCUA 1OXTA 4L5RC 2JE6I 3BJUA 4MZ9A 4PZ6A 3KYHC 1N32L 4NXNQ 2IHFA 1XPUA 1X56A 1GM5A 4DUZL 4UP9A 1K9MC 3ICEA 1KRSA 3GTJH 1XMOL 1D8LA 1LYLA 4BA1I 1VQ4A 2CKZB 1J5EQ 1T9HA 2UU9L 5AJ3L 1PV4A 4GN3B 4A3MG 3J80c 3PV0A 3T1YQ 1Y1VG 4C2MH 2YU9H 4IPDA 2V1CC 3FKIG 3I4OA 3PCOB 3CD6A 3M3YH 4JV5Q 1C0AA 4BY1G 1EFWA 3TREA 5IWAL 2HHHL 4JI0L 4B3ML 4DV7L 1YVCA 2Y0SG 3E9HA 3PGZA 3KF6B 4DAMA 3GTPH 5JJLA 1Q86C 2E5LL 1PYSB 4YWMA 4DV0Q 3RLNA 1HZ9A 1N36Q 2KBNA 3HOUH 1V9PA 5C3EG 4IPCA 2F52A 4BBSG 4DR2Q 1CSPA 3S24A 3RZOH 1IXRA 3B6YA 4YHHL 4GNXB 4KI0A 1Q12A 1Z47A 2K14A 4JI5Q 3OYYA 2EQSA 2ZTEA 4O0AA 1EWIA 4JI2L 1YHAA 1TWCH 4GN4B 3CPWA 1K73C 2RCNA 2Z6KA 1C7YA 2Z0SA 4DUZQ 1VQ9A 4LF4L 2JA7H 3PO2G 4LFBL 1PH6A 1W2BA 4JI6Q 4BA2I 5HY6A 1KXLA 3STBD 1E22A 1ASZA 1OTCA 2OWOA 1WI5A 4YCVA 2R7DA 5AJ3Q 2UU9Q 3GDEA 1JE5A 1X3GA 3H3VI 3AFQA 3K80C 3NEMA 4BY7G 3JC66 4PZ8A 1UE6A 1Q81C 3AQQA 3TRZA 1B70B 2NN6G 4QL5A 4GNXC 2VQFL 1K8GA 2UXCQ 3HOXH 2JA6G 1NMGA 5IWAQ 1G291 1GD7A 4HJ5A 1XPRA 1CUKA 3GTQH 3PUVA 4H02A 1XNQL 2R7ZH 5IYDH 4JYAL 4A93G 5M5YH 4JBJA 3CC7A 2E5LQ 5IP7H 2ZJPA 1FGUA 3GTLH 4A3GH 3F8TA 2GVAA 3DM3A 4P71A 1Y1WH 4DR7Q 1IYJB 4A3EG 3TEHB 2XGTA 4R4CA 5M3FG 2D62A 1I5FA 4YHHQ 1JJCB 2NZHA 4BBRG 1WJJA 1O7IA 4JOIA 2VY3A 3BZKA 3ZJYC 4OO1G 1SR3A 4LF9Q 2YTXA 3SGIA 3I4MG 4A3DG 4X65L 1A0IA 4HIMA 4A3IH 4LF4Q 1XNRL 2MFIA 4DPGA 2R93H 1UE5A 4DR3L 4LFBQ 4B3SL 3KF8B 3TS2A 3CCRA 3ULJA 2JJQA 1PH3A 2ZJQA 5M5WH 5M3MG 1QUQA 4LUVA 4QQBX 3BU2A 2KCMA 2N49A 4A4IA 5C0XG 2ZTCA 2UUCQ 2PMZE 2CCZA 1BVSA 3PSIA 2BH2A 4OONA 4JI3L 2K75A 1VCIA 2PNHA 4AH6A 4A3MH 1YHBA 1VQPA 1CKNA 4GS3A 1Y1VH 5M5XH 1HNZL 1EQQA 4DV5L 1KHIA 1L1OC 3A5ZB 3FKIH 4YWLA 2UUAL 3PO3H 3J81j 4KHPL 4BY1H 2NVTH 4AIMA 4FDBA 1S3OA 2WAQE 1H95A 5EAYA 1FJGL 3CCSA 1KRTA 1SFOH 1A62A 1EQRA 1X55A 4IPHA 4ALPA 4IFDI 3WWVA 3CCEA 3RNUA 3UE0A 4GKJQ 2CWAA 3G4SA 5LMUL 2OQ0A 3RLOA 4DR5Q 1IBML 3I4NG 4BBSH 4DV3Q 4JCVE 1VQFA 3M4PA 3H0GG 1N34L 4B3TL 3ERSX 3CCVA 2JA8G 4DR1Q 3UDXA 2QEXA 3A0JA 2QA4A 1JJ2A 1QVCA 3CW2C 1HZBA 3J81c 1EOVA 2GN5A 4JI7L 4LFAL 1MIUA 3OTOQ 3PF4A 5K36G 1TWAH 2L15A 1PVOA 2MO0A 4R4OA 4DR6Q 1Q1BA 3KOJA 3PUXA 3PO2H 1M90C 3M4OH 3PUWA 1UEBA 4LUZA 3RN2A 1PH2A 4JBKA 4LF5Q 1E1TA 2VQEL 1OXSC 3HKZE 2KHIA 3GTOH 1Q8KA 3J7A5 5IYBG 3CCMA 4BY7H 1K3RA 4YY3Q 4DV5Q 1TXYA 3F2DA 5H1SE 2I5HA 2ES2A 4UP8A 2F3IA 1IBLL 4JG2A 2AWNA 4KHPQ 3NELA 1HJPA 2FXQA 2JA6H 1NY4A 1EYGA 2VUMG 4AQYQ 4X64Q 4GOPA 1RL2A 2ZM6Q 4A93H 3CCQA 1I50H 1VQHA 1Y14B 4DV1L 3CP0A 4GKKL 2JEAI 2YV5A 3OW2A 4A3KG 5LMUQ 2CFMA 2N8NA 1QUQB 4A3EH 1IBMQ 3MEFA 4PMWA 1UWVA 1KQSA 2E2HH 2E2IH 2ZJRA 5M3FH 4A3LG 2PQAA 1I3QH 4BBRH 4KHZA 2WAQG 4OWWB 2IT1A 1HR0L 2XTIA 2YTVA 3U4VA 3W1BA 1YJ9A 1VQ5A 2K5NA 1IBKL 4A3DH 4DKAC 2CQOA 5IP9G 4L5QA 1QZGA 2E8GA 4NXML 1QVGA 1N32Q 2VQEQ 1B7YB 3MXNB 3KLWA 4X62L 5GROA 3M9BA 1MKHA 4A3FG 1K8AC 1I94L 2VW9A 3H15A 4A3JG 3PF5A 1JB7A 2A8VA 2D0OA 4JI8L 2RHQB 4LW1A 3T1HL 1XMOQ 1HZAA 3CF5A 1CKOA 5FLXc 2C35B 4IO9A 1PA6A 4DV2L 2LXKA 2WB1E 1UE1A 5LMNL 1WYDA 2OCEA 3S1NH 1YIJA 3CC2A 3HKZG 1SROA 1FVIA 3PUYA 4QJFA 4NPSA 4POFA 1EIFA 3E0EA 3AEVA 4QIWE 4GKKQ 1VQNA 4IFDJ 1PH8A 5JJKA 2UXBQ 3J80i 2WFWA 3CXCA 2HHHQ 2I5LX 4B3MQ 3EN2A 4P72A 4DV7Q 1TWGH 4JI0Q 5JEAJ 1VQMA 1TWFH 3VDYA 1VQCA 2R6GA 1X65A 4RG1A 3M85A 1HR0W 1OXVA 3I55A 2YTYA 1Q46A 1X54A 3M7NA 1X3EA 1IL2A 3EBEA 3JAMc 1IBKQ 4OWTB 2JEBI 3I4NH 4GLVB 1EIYB 4IOAA 5C4XG 1D7QA 1PYBA 3H0GH 1HNWL 2JA8H 1S40A 1TWHH 3RZDH 1YJNA 1R9TH 3U58A 4L5SA 2BH8A 3CCJA 4JI2Q 2KHJA 2R7FA 4DUYL 1W3SA 2DGYA 1I94Q 5HGQA 1V1QA 4UP7A 4JI8Q 3K81C 4LFCL 1GO3E 3TQYA 3S2DH 1X3FA 4GLAC 4EX5A 3RR5A 4LF7L 2A19A 2N78A 4GN5A 2DUDA 1VQGA 3K7UC 5GADC 1BBUA 4MTNA 4ME3A 4LF6L 5IYBH 1SE8A 2VNUD 2VQFQ 2K4KA 1A63A 2Q2HA 2NN6I 1PHJA 4KLKA 3CAMA 1XNQQ 4A3CG 1XMQL 2VUMH 4JYAQ 2UXBL 4WJ3M 4P75A 2WB1G 1XTDA 4IOCA 3RN5A 3HOYG 3HOWG 3FHWA 3HOZG 1L2FA 1XJVA 1SN8A 4HJ8A 2KENA 2LSSA 2EXDA 1YHQA 1E24A 4A3KH 5IE8A 4WJ4A 1KAWA 1YBYA 3PIPA 4L5TA 1G51A 4A3LH 4DV6L 1HNWQ 1V43A 2HIXA 5IT9c 4BXXG 2BA0A 1NTGA 1QZHA 4OO1I 4X65Q 5C3EH 1YJWA 3EIVA 5DLQE 4DUYQ 1XNRQ 4C3HH 4HIKA 4GNXA 4DR3Q 1LUZA 4B3SQ 2B63G 5IP9H 4LFCQ 4JI1L 3G6EA 1VQDA 3A5UA 1OXUA 1UE7A 4AYBE 1GVPA 3CPFA 4HJ9A 2RF4A 5IYDG 1KIXA 4A3FH 3W5OA 4LNQA 3CQZH 2RHSB 4LF6Q 4A3JH 3RLFA 4JBMA 4LUOA 5C0XI 4C3JH 1KC8C 2KCTA 3D31A 4B3RL 2IX1A 3ER0A 2R92G 2Z6KC 4JV5L 2AWOA 2I5MX 3TS0A 1Y1WG 3CMAA 5J3BA 1Q1EA 4JBWA 1HZCA 2K5VA 4IJLA 4JI3Q 4OX9L 3F2BA 3FP9A 2UXDL 2N3SA 1PFSA 1BKBA 1N9WA 5ELNA 5BR8L 1KD1C 1HNZQ 1B8AA 2MQHA 2NZOA 2Q2IA 1VQ8A 3S17H 3CCLA 2UUAQ 4Y52H 1C9OA 1P8LA 4K0KL 2NVQH 3S16H 3S15H 1AH9A 1U5KA 1LM0A 1NMFA 1FJGQ 2HIVA 4DR2L 3UE1A 4DV6Q 4X66L 2OTLA 1LTLA 4JI5L 5FJ8G 1MJCA 2JQOA 5IY0A 2BA1A 5GAHC 4PG3A 2IX0A 4DK6C 4Y7NH 1N34Q 4B3TQ 3STBC 5C4XH 4A75A 1Q7YC 1YZ6A 5JJIA 4R4IA 4JI1Q 2F4VL 4JI6L 4JI7Q 4LFAQ 4QGUA 2PI2A 2CWPA 5IYCG 2JA5G 2K50A 1RIPA 4DAYB 3GO5A 5GAGC 3I4MH 4NB3A 4JOIC 1L1OA 4P73A 2MNAA 2ZTDA 1KL9A 3J81i 3GTGH 1CKNB 1NJIC 1P16A 4B3RQ 1Q82C 3PO3G 2VZAA 3LGJA 2PI2E 3L0OA 5GQOA 5M3MH 3KJPA 1ASYA 2UXCL 3K0XA 3M4QA 4OX9Q 1VQ6A 3HOVG 1VQOA 1IZ6A 1CKMA 2UXDQ 4RMFA 4HJ7A 5BR8Q 1M1KC 4TQUS 1VQ7A 4A3BG 3NENA 1SLJA 5C44G 1PH9A 3A74A 2K5HA 4AYBG 1PH4A 1YNXA 1IBLQ 4K0KQ 4DR7L 4QY7A 3ULLA 2ATWA 1CSQA 4P74A 4JC0A 4GLXA 4A3CH 4O2DA 1VQAA 1WCMG 3E9IA 4DNIA 4DV1Q 2QGQA 3KDFA 4TVAB 4X66Q 1EUJA 3HOYH 3HOWH 1N33L 3HOZH 4R4TA 2Q2UA 4HJAA 4LF9L 5FLMG 4MNOA 3K8AA 3DLLA 4OXPA 1HNXL 4XTCS 5C4JH 2F4VQ 1E3PA 2HQLA 1E1OA 1AE3A 1HR0Q 4XIGS 1I6HH 4POGA 1VQKA 4A76A 4BXXH 2H5XA 2OTJA 3HKSA 3F1ZA 1YITA 5ELOA 4YWKA 5C0XJ 3S14H 4NXMQ 3I2ZA 1GKHA 2UUCL 2B63H 4HIOA 3S2HH 4X62Q 1DGSA 3S1QH 3L2PA 4DV4L 2GVBA 4R4QA 1YEZA 3UDGA 2HT1A 1OXXK 3S1MH 2UUBL 3T1HQ 4LF8L 4GOPB 1U0LA 4R1JA 1WFQA 4DV2Q 1X9NA 1PH5A 3KJOA 3I7FA 4JI4L 2R92H 1JT8A 4YCWA 1J6QA 1QVFA 2NVXH 3UDFA 1FL0A
chains in the Genus database with same CATH superfamily
1QJOA 3L7ZC 4KKTA 5JPMC 2PQAB 1A8VA 4GKJL 5M3FB 5JEAG 3HFZB 2IY5B 3MHBA 1IW7C 1SRUA 1H9RA 5CMDA 2RBMA 1D6EC 2PO4A 3JAML 1MSHA 5I6WA 3NBHB 3ULPA 2A69C 3EQLC 1ZKOA 2EIFA 5EBDA 1TWCB 2B2YA 1VQBA 1XPOA 1JJGA 2B2VA 2ZXOA 5IYCH 1F9PA 5GAEC 2JA5H 3H3VH 3AFPA 2K52A 1LACA 1VS0A 3GTMH 4H44C 4LF8Q 4YY3L 3GD7A 1YI2A 4I7ZC 3G48A 1C0AA 1VF5C 1Z6HA 3KFUA 4AQYL 1CFMA 5IP7G 5E3FA 1HQRD 2ZM6L 4C3IH 1R4QB 1PLFA 4EVOA 2RSOA 3DEPA 4OWXB 2XNAC 3A7LA 1N8RC 1ICFB 2JA9A 4HIDA 2MP1A 1K83H 4R8IA 3GTKH 4IN3A 2ALYB 3VR2A 1N36L 3PMFA 1SE4A 4DR4Q 4A3IG 3H0GB 2E2JH 2R93G 2F0GA 4YCUA 1DD2A 4PZ6A 2K03A 4WRDA 2A68C 2LFNA 5KGUA 1WD0A 3ICEA 1SYCA 3GTJH 5I2YA 1XMOL 1J5EQ 3HZXA 1HUMA 1T9HA 5AJ3L 1D5XC 4A3MG 3KF8A 3PV0A 2YU9H 1BCPB 1BCPF 4CBVA 3NXWA 2HHHL 4JI0L 1JOKA 2BDOA 3E9HA 3PGZA 4DAMA 3GTPH 3OHXC 1IYUA 1EIHA 2KBNA 5C3EG 1CZGA 4IPCA 5JPNC 4KMUC 3S24A 1IXRA 4YHHL 4KI0A 5BN4A 3F2UA 4MN3A 4DK0A 3K0YA 4B9XA 1WTHA 1YHAA 3GQBA 1VQ9A 2Z6KA 2Z0SA 4DUZQ 3EA6A 2JA7H 5L37A 3W2DA 5FKAC 4JI6Q 2B39A 5IGBA 1ASZA 1WI5A 4CHTB 2UU9Q 1R4PB 3T13A 1JE5A 3H3VI 1SE3A 2B2YC 2A6ED 2F0SA 3JC66 4PZ8A 1UE6A 1B70B 2UXCQ 2KA7A 3HOXH 2A73B 1E2ZA 1GD7A 1EQVA 2RCFA 1HRJA 3GTQH 4H02A 1XNQL 1FYCA 5IYDH 3T4AC 4A93G 4JBJA 2ZJPA 4UDUC 4P71A 3TBIB 4DFAA 4DR7Q 1Y1WH 5J1ZA 5EKIA 4HSPA 2D62A 2KUMA 1M8AA 1O7IA 4JOIA 4OO1G 1RDPD 4A3DG 2NBFA 3SXHA 4LF4Q 3BG3A 1UE5A 5KNDA 1PH3A 1EY5A 2A74C 4ME5A 1EY7A 2N49A 3OWEB 3SEBA 2PMZE 4FYDA 5CV9A 2CCZA 1Q90A 4XQNA 1DJRD 2BH2A 5I2XA 1AN8A 1YHBA 1VQPA 1I6VC 1QG7A 1EQQA 1KHIA 2UUAL 1H9JA 4KHPL 4BY1H 2F0MA 4FDBA 1A15A 1S3OA 2L11A 5EAYA 2CH4A 3CCSA 3MEHA 1A62A 1X55A 2Z1CA 4KHVA 4OELB 1WVLA 1LTID 1VDZA 5EQ0A 5C4JB 2CWAA 1J9OA 2OQ0A 2OF1A 4BBSH 5LHY1 1SAPA 2QEXA 1AP0A 5TSSA 1QVCA 3MFGA 5K36G 4LFAL 1MIUA 1Q3LA 3OTOQ 3PF4A 1PMRA 1JOOA 3R3OA 5JJZA 1Q1BA 3PO2H 1ICWA 2F0WA 2R3ZA 4LF5Q 3K58A 1OXSC 2WINB 1EY8A 5I6YA 1SSOA 3CCMA 2EY2A 2RVLA 4BY7H 1ENAA 3F2DA 4O1NA 1HTPA 2NN6H 4FP5D 1IBLL 3QG1A 2FXQA 1NY4A 2JSOA 5EJWA 5E4WC 3VYSA 2VUMG 4X64Q 4KKSA 4GOPA 3KLSX 3CCQA 1VQHA 2JEAI 1VF7A 4B08A 4CDCC 2CFMA 1UWVA 2E2HH 2ZJRA 3FRPB 1I4XA 4A3LG 2XVSA 2PQAA 1I4RA 4BBRH 1NAPA 1HR0L 2YTVA 3W1BA 4K5XA 1ML0D 1MGSA 2CQOA 1QZGA 4L5QA 2NUCA 2MUYA 1BUVT 4NXML 1QVGA 1N32Q 2XIWA 1ILPA 3M9BA 5FOBB 3TMEA 3GTMB 4A3FG 1F77A 1W6KA 4JI8L 2RHQB 3DWPA 5FLXc 4DV2L 2LXKA 4A3JB 1T5XD 1ZYRC 1RKNA 2O2LD 3HKZG 1FVIA 1GUNA 1HFNA 1EIFA 4K5VA 3FDTA 4GKKQ 1AW7A 3CXCA 4B3MQ 2I5LX 1K83B 5JEAJ 2FMMA 1ILQA 2NVQB 1LTAD 1X65A 3I4LA 4QCLA 2QILA 1X54A 4UHVA 3BDLA 1QILA 1IBKQ 2DY7A 1TY2A 5DM63 2DJFC 2JEBI 4OWTB 4GLVB 1EIYB 4RGOS 5C4XG 1S40A 1BXTA 1CM9A 1V1QA 4UP7A 4LFCL 3TP5A 1IHZA 3BZDB 1E0BA 5T1IA 1V8QA 1KNEA 3TP8A 2MGSA 1M4VA 5E1FA 4MTNA 1JQYD 2SOBA 2VNUD 2VQFQ 2K4KA 3TZDA 2NN6I 1EU4A 1G91A 3GTPB 4WJ3M 1XTDA 3RN5A 3HOWG 1SN8A 4DAVA 4WJ4A 3PIPA 3IL8A 1EL0A 1V43A 2HIXA 5IT9c 4BXXG 4C3HH 4ID6A 4HIKA 5IP9H 4JI1L 1A2UA 3A5UA 1FNVA 4HN7A 4AYBE 1D5ZC 3GV3A 2D2CC 1KIXA 4LF6Q 3RLFA 4IUQA 3K5NA 1KC8C 3D31A 2EYPA 4B3RL 3ER0A 1PXUA 2QCPX 2I5MX 2LY7A 3GTQB 1GUOA 3FP9A 2UXDL 1KD1C 2KJXA 4FXDA 2R92B 1Y1WB 4RKBA 1UEAB 3V2TA 4Y52H 4RKLA 4WJWA 1BQQT 3S16H 1BDOA 4FXGC 2Q8TA 1RTNA 2JYOA 3UE1A 4DV6Q 5J39A 1LTLA 5FO7B 2JQOA 5IT9E 4CDEC 1V1OA 4Y7NH 1N34Q 2PNRC 3STBC 1ET9A 5JJIA 3I73A 4JI6L 2CWPA 4ZYSA 3FPPA 1DCZA 4ZAIA 1H9SB 1KNAA 1L1OA 2LMCB 2ZTDA 3J81i 3CU7A 3GTGH 1CKNB 1MSGA 1Q82C 3PO3G 3AB9A 3L0OA 5M3MH 2UXCL 1GHJA 3M4QA 4WORA 3HOVG 1IZ6A 1FNUA 4RMFA 5BR8Q 3ITPA 1DOLA 1M1KC 1JC7A 3NENA 5C44G 4BY1B 2HDMA 2K5HA 1PH4A 1J8IA 4DR7L 4HAEA 3Q23A 3DEOA 2Y0SB 3NSWA 4GLXA 4AYBB 2FFKB 3R2IA 1YNJC 2Q2UA 4MNOA 3BVZA 4XTCS 2F4VQ 2EYOA 3SVMA 1B9NA 1WTRA 4POGA 3QO2A 4KK7A 4A76A 2H5XA 2HCCA 3PO2B 3HKSA 3R2TA 2RQXA 5ELOA 4OIJA 2Z8LA 4N9TA 4LK1C 1DGSA 3S1QH 5LL6S 1ENFA 3RD4A 1IKLA 1U0LA 4R1JA 1FGBD 1PH5A 5FLXL 1JT8A 3Q6SA 4YCWA 3IAYA 3URYA 2V4DA 3G7LA 3SHLA 1GXDC 5C3XA 1N33Q 4UPAA 2WV6D 3DHQA 2A5HA 2ID0A 3KLRA 1HNXQ 3U9OA 2IHEA 1LTGD 3HOUB 3QB3A 1NE3A 2DJGC 1LO5D 3PUZA 5BN5A 2F0HA 1SXTA 3OTOL 2BE5C 1B9MA 3BZCA 3KF6A 4QUFA 2VS1A 2LXJA 1WTXA 2XWJB 4LF5L 5KNCA 4NDXA 4ZUJA 4NXNL 1NBWA 2AMCB 4LWCA 2SDFA 4QUCA 2UUBQ 3AMUA 1BBWA 1PH1A 2H1EA 1STNA 5JVG3 3UDIA 1SBBB 2NZ1D 2EVBA 3KDFB 4JI4Q 5LMNW 5LMNQ 3T1YL 3K7AH 3VYTA 4X64L 2B8GA 1LT6D 2AHOB 3Q8DA 4A3GG 4X6AH 1RTOA 2R7ZB 3OMGA 1SNDA 3TP7A 3W1GA 3CRKC 3J7ZC 2C5CA 1C4QA 1XMQQ 3PIOA 2B3GA 5IOCA 4F87A 1F9QA 1V1PA 1WCMH 3QWNA 4K2KA 4DV0L 1VQLA 5KIXA 1RF2D 1WOCA 4DK3C 2B29A 1KTKA 5A2QE 1K8MA 4KN7C 5FK9C 1OXTA 3OW7A 4FO2A 4MZ9A 2E2DC 2K28A 1VMCA 3NTIA 3KYHC 1N32L 4KV6A 1XPUA 1TS5A 3DM1A 2EY6A 1DOMA 1X56A 1GM5A 4IALA 1KRSA 4DK1A 3T53B 1VQ4A 2CKZB 5K5PA 4FF4A 4GN3B 3J80c 4C2MH 2V1CC 3PCOB 1EFWA 5IWAL 1Y1VB 2L55A 1WTWA 4B3ML 2EJMA 3FKIB 1YVCA 2TMPA 4YWMA 2E5LL 3MWYW 3RLNA 2A6HC 2ICEC 2X6GA 3J81E 1SFOB 4NW2A 4F7XA 5JEAH 1CSPA 3RZOH 3MA2B 4GNXB 2WAQB 3HS0C 3OYYA 2ZTEA 1EOTA 4GN4B 3CPWA 3NHHA 4LFBL 1W2BA 4I65A 3L3OC 1E22A 1OTCA 4YCVA 2ZT9C 2RSNA 1PZJD 3J80E 3NBIA 1PFBA 3TRZA 1Q81C 1SMYD 5D3DA 2VQFL 2CW0D 4RAUC 3FMCA 1PTOB 1CUKA 1PTOF 3X3NA 2JA6B 5IP7H 1GUSA 4EQPA 5E4XA 3GTLH 3DM3A 4ILWA 4KTAA 1DZ1A 1T5EA 1QCBD 4A3EB 3V05A 2VY3A 4Y7NB 4L63B 1SR3A 2YTXA 3SGIA 3OWFA 4DU9A 4A3IH 3EJIA 2R93H 1F2ZA 3TS2A 4ZRZA 3CCRA 3D4WA 2ZJQA 4H0LC 4QQBX 2EE1A 2PYKA 3GTGB 5C0XG 2ZTCA 1EWCA 1QOHA 5M3MB 3VR5A 3WOEA 1H9SA 1VCIA 2PNHA 4A3MH 5ELBA 1CKNA 4GS3A 5M5XH 4DV5L 5F2DA 1F9SA 4YWLA 3VR3A 2RDFA 1XXGA 2G5DA 1BBXC 1TWGB 3KBXA 4IPHA 3CCEA 4MIUA 3UE0A 4DR5Q 1IBML 4DV3Q 3M4PA 5ELFA 1N34L 3CCVA 1H9MA 3BVMA 4CJ1B 2QA4A 3I4NB 3Q0AA 5EKKA 1KLGD 3VA5A 1TWAH 1SYEA 2JA8B 2Z6BA 1PVOA 1TWHB 2MO0A 3RMHA 1M90C 3MVVA 1UEBA 3RN2A 4JBKA 2X6LA 1EZ8A 1E1TA 2VQEL 2F0VA 3GTOH 4IQZA 1JR0D 1RCVD 1EEFD 3BS1A 4CJ0B 5H1SE 3DWAA 2F3IA 2NYZD 3I72A 1RL2A 2QW7A 4ABNA 4A93H 1I50H 4S3SA 3CP0A 2PZTA 2YV5A 3OW2A 5FO8B 4QF4A 5LMUQ 1QUQB 5M9OA 1NR4A 3MEFA 1KQSA 2E2IH 1I3QH 4A3KB 2F0NA 2XTIA 1VQ5A 4A3DH 2F0QA 3CRLC 3P20A 1QB5D 1STBA 4K8JA 2L4NA 4Z9CB 3MTSA 3DXJC 1EWHA 1SYFA 3MXNB 3U9SA 4A3JG 5ISRA 2F0KA 2Z9HA 4C3JG 2A8VA 2D0OA 1TQOA 3CF5A 5CYUA 2C35B 2FJ2A 3K7AB 1UE1A 2KCCA 3PQIA 2K6AA 1PRTD 1D5MC 1NR2A 3J80L 3D4RA 4QJFA 2B2VC 4NPSA 1S4ZA 3AEVA 1GUWA 5JJKA 2EY1A 4PV1C 3EN2A 3S17B 3ONAB 4DA2A 1TWFH 3IFTA 1VQCA 1EY6A 1ZXTA 2L0CA 2R6GA 4RG1A 1BR9A 1OXVA 2C9OA 1Q46A 1IL2A 4LMQD 5D14A 2J4XA 3BYTB 4IOAA 1HNWL 1DYQA 3RZDH 1R9TH 3U58A 2BH8A 5K36H 1EY9A 4JI2Q 2BCOA 2R7FA 1I94Q 5HGQA 3K81C 1GO3E 3HEJA 3ERQA 1U4PA 2CHBD 5CV4A 2B2TA 1BBUA 1IYVA 3TZUA 1SE8A 3GP7A 4DAYA 1SNPA 3CAMA 1XTCD 4A3CG 1XMQL 2VUMH 4JYAQ 2UXBL 3HP3A 4IOCA 3FHWA 3HOZG 4KD3A 1E24A 3HOYB 1YBYA 1G51A 4A3LH 2MPMA 3C3LA 4OIKA 2M00A 2BA0A 4OO1I 4XXEA 1SYDA 4DUYQ 2HUGA 4GNXA 1I6HB 4OEMB 1G6ZA 1PTOD 3SK5A 3S2HB 4P2CB 4HJ9A 2B63B 2D9UA 5IYDG 4A3FH 3W5OA 3CQZH 4LUOA 1CT1D 2OEOA 3DWQA 2R92G 2Z6KC 1Y1WG 3SDZA 3CMAA 4JBWA 4OX9L 3F2BA 5ELNA 2MQHA 2NB0A 4MTKA 4U673 3CCLA 3SR1A 2LS01 1DOKA 1P8LA 2DNEA 4X3TA 3S15H 4K14A 1U5KA 4XT3B 5CV5A 1FJGQ 3IKJA 4OHJA 5A35A 2MJ8A 1EEID 2XWBB 3NTHA 3SK4A 4X66L 2OTLA 2KHSA 2L5TA 5FJ8G 5IY0A 4A3IB 5EPLA 4G7ZC 1BF4A 3I91A 4B3TQ 5C4XH 1Q7YC 4XT1B 4R4IA 2PI2A 2A6EC 1K8OA 3I4MH 4JOIC 5EBCA 2PPBC 2B2WA 1KL9A 1RODA 2JA5B 1P16A 3LGJA 5GQOA 3TP6A 3NBHA 4A3MB 1CKMA 4RGNA 1G8ZD 2K04A 2DNCA 4A3BG 4AYBG 2VB2X 1YNXA 4K0KQ 4QY7A 1CSQA 3H91A 4CKEA 2IWHA 4DAPA 4C3IB 3QJYA 1Y8OB 4XQJA 1VQAA 4RGMA 3E9IA 4DV1Q 1EYDA 1TS4A 1EUJA 3HOWH 2K05A 3GTKB 5FLMG 4EQNA 2NTTA 4L8JA 1D2BA 3AU7A 2F0UA 5DNFA 1E3PA 2HQLA 1E1OA 1TWAB 5FO9B 4XIGS 2E2JB 2WACA 1VQKA 3ND9A 4BXXH 1I4GA 4WFN3 5C0XJ 3S14H 2Q8IB 4IUUA 5DEHA 4C56C 1LABA 3I2ZA 1GKHA 1I4QA 3GTOB 2GVBA 2F3WA 1YEZA 2VB3X 3E5SA 3OPOA 3GTJB 3S1MH 1BCPD 4LF8L 1KLUD 4OL7A 4F8MA 1WFQA 1X9NA 3KJOA 3I7FA 2YU9B 1TR5A 1J6QA 2XSCA 1CA6A 1QVFA 2NVXH 2CQAA 2F0EA 4IFDG 4DXFA 3HOUG 1NCVA 4IURA 2D0PA 1VQJA 4DR5L 3SE0A 4DV3L 2QDLA 4IPGA 3U4ZA 3P1HA 4TSSA 1XX8A 4GOPC 4CJ2C 2I46A 4DR4L 4HSVA 2K1BA 4RCNA 1VMPA 4J15A 5E7NA 1VQEA 2D5DA 4RHSA 3JAMi 4DV4Q 2JA7B 1X32A 2VL6A 1UAPA 2WP8J 3IRBA 2Q2TA 5EPJA 4IJHA 3J7YW 1SMXA 2Y0SE 2EYMA 1J5EL 4LF7Q 5D3IB 3D0FA 4APVA 3I56A 2R7ZG 1S72A 3HOVH 3VYRA 5KYIA 3HOXB 5C44H 3CC4A 2NVYH 1TWFB 4XYOA 1HH2P 2N88A 2JK8A 3N52A 5COYA 1GUGA 1G6PA 2A1AA 4J1MA 3S1RH 3H6MA 3CCUA 1PH7A 4L5RC 4X3UA 4HCEA 1KDBA 2F3VA 1CK1A 2IHFA 2MHVA 2CH4W 4DUZL 1K9MC 3FPUB 2EZVA 4MHEA 4K6DA 1D8LA 1LYLA 5CORA 5ELEA 4BA1I 1KDCA 4IUNA 2UU9L 4G4KA 3QIAA 1Y1VG 1SDFA 4IPDA 3I70A 3OOCA 3FKIG 3I4OA 1STYA 2K7VA 1XYIA 3D3RA 1ESFA 1N36Q 1ET6A 1K0SA 2EPBA 1WTOA 1U4RA 2F52A 2KQ3A 3NE5B 1HA6A 2M2LA 2PQEA 1Q12A 2ICIA 1B2TA 2K14A 2EQSA 4BBSB 1EWIA 4JI2L 1TWCH 2RCNA 4LF4L 1LT3D 2HDLA 1BOSA 4ZQ3A 1CHQD 5DAUA 1PH6A 2RDGA 5HY6A 2WKDA 3A8KE 4A3FB 3H09A 4L6TB 3CQZB 5G3LF 5AJ3Q 3NUCA 3GDEA 1X3GA 1PZID 1NNXA 2BOSA 1LT4D 1EY4A 3J7AV 4QL5A 1K8GA 2H4OA 1MI2A 2JA6G 1NMGA 4BY7B 1G291 3A56A 1S5BD 1XPRA 4JYAL 4A3GH 3F8TA 2F0IA 5CV7A 1IYJB 4A3EG 3MZ5A 4DGZA 2X69A 4N8FA 3TEHB 4R4CA 5M3FG 1OO9B 4YHHQ 3VA7A 4EGVA 3QOLA 1FNWA 2E2HB 3WOFA 4LF9Q 4KN4C 1HFGA 5HGTA 4BBRB 4DPGA 1EQTA 1O78A 3KF8B 5C3WA 3I4MB 2SEBD 3FVQA 5M3MG 2ENBA 3ZYYX 4KD4A 2KCMA 1STGA 4RCOA 3M7GA 3I3CA 2QEJC 2F4IA 2K75A 4AH6A 5KNBA 2RA4A 2B2UA 4O42A 1L1OC 3A5ZB 2OXPA 5KRUA 2NVTH 1X3QA 1GOZA 1ONLA 2WAQE 1H95A 3JAME 1U4LA 1FJGL 4ZUIA 1KRTA 2WIIB 1EQRA 4ALPA 4K2LA 3RNUA 3I8ZA 3RLOA 3I4NG 1F9RA 4JCVE 1VQFA 3H0GG 4B3TL 1A6XA 4Q5VA 2JA8G 5CGKA 4OGQC 3UDXA 3P75A 4DR1Q 3A0JA 1JJ2A 2J0TD 5C6AA 3J81c 1EOVA 2GN5A 3C46A 1IW7D 4I7AA 4PQXA 1I4PA 4R4OA 5IODA 4DR6Q 1A3VA 3PUWA 4RH6A 1PH2A 4DF7A 5IT9L 3S9WA 2A69D 2KHIA 3VR4A 2DY8A 5BN3A 1F2MA 4RFBA 2XRQD 3H94A 1C8CA 5IYBG 1Q8IA 3T51B 1B4OA 1TXYA 2KCNA 3BVGA 2I5HA 2ES2A 4JG2A 4KHPQ 1O7ZA 1WD1A 1B50A 2AUJD 1NSNS 1TIID 4DV1L 1Y14B 3IFDA 4GKKL 1Y69U 4KKUA 4A3KG 1SYGA 4FXKC 4PMWA 3HGBA 4FF2A 3LX0A 3L9AX 4KJOA 2IT1A 3U4VA 1YJ9A 2K5NA 1RD9D 5CBEE 1IBKL 2IL8A 1B3QA 4DKAC 2K5DA 2IJ0A 4C3HB 3A8JE 1QE6A 1MKHA 4XQQA 1K8AC 2A68D 3H15A 3NWSA 1JB7A 1TKWB 5C0XH 2EXZA 4IUTA 1HZAA 3D8GA 1PA6A 3HOVB 2ZXRA 4ZLTF 2WB1E 1WYDA 3S1NH 1YIJA 3A7AB 3CC2A 3PUYA 1SROA 2PZWA 2QF7A 4IFDJ 2XN9C 1PH8A 3O13A 3V96A 2NWGA 2WFWA 1JWMD 4P72A 4DV7Q 1VQMA 2G9HD 3VDYA 3S16B 2F0DA 5KEEA 1HR0W 2HCIA 5NUCA 1PYWD 5IGGA 1JWSD 1D7QA 2NTSA 5D65A 1PYBA 4L5SA 2EYJA 3CCJA 1UUPA 2WKCA 2KHJA 1W3SA 1MBYA 4JI8Q 5JAVA 5EGTA 1FR3A 1STEA 3S2DH 1RHPA 4GLAC 3RR5A 4EX5A 2A19A 4LF7L 3K7UC 5GADC 4ZKBB 3TN2A 3VR6A 4ME3A 1SNQA 4DXGA 4LF6L 2Q2HA 4HR7B 3K5LA 3T16A 4RHRA 4N9PA 2F0LA 3SK6A 3HOYG 2IW3A 3BDCA 4HJ8A 2LSSA 2F0OA 1CHPD 1AFPA 1SEBD 1KAWA 2WB1B 1HQMC 1CTMA 4L5TA 4DV6L 5G3LD 4PMBA 5J22A 4X65Q 5C3EH 3EIVA 5DLQE 1XNRQ 4DR3Q 1LUZA 4B3SQ 3OMCA 1HPCA 4LFCQ 2B63G 1Z7TA 1KDAA 1UE7A 5A2QL 3CPFA 5IGEA 3S1QB 4A3JH 5C0XI 3D6CA 4C3JH 2AWOA 1Q1EA 2K5VA 4IJLA 2F0FA 1TY0A 4JI3Q 4CKBA 1TS3A 1PFSA 1BKBA 1N9WA 5BR8L 1HNZQ 1VQ8A 4J8QA 2Q2IA 1B8AA 4A3GB 1SJED 4J6HA 1YNND 2KECA 1C9OA 2NVQH 1LM0A 1NMFA 1DXMA 2HIVA 1S5DD 3W3AA 1HTLD 1PFNA 2BA1A 2E76C 1LTSD 4DK6C 2GA4B 3MXGA 4A75A 3WDNA 1YZ6A 1G2SA 2F4VL 4LJZC 4JI1Q 2DN8A 2M9VA 4JI7Q 3NQTA 5IYCG 3J81L 4X3KA 3K57A 2JA5G 3MXUA 5C4ZA 4OO1H 3GO5A 1SMYC 2CW0C 4RGTA 1JOQA 4B3RQ 3KJPA 2E75C 1ASYA 3PIP3 4FF1A 2UXDQ 4HJ7A 1NUCA 1SLJA 3Q22A 2NVTB 3A74A 3NTKA 4C3IG 1WTVA 3HG9A 3ULLA 2SNSA 4XDXA 4DNRB 4JC0A 4A3CH 1B53A 5C5MA 4O2DA 2QGQA 3KDFA 1N33L 3HOZH 3MXPA 3QR8A 4HJAA 4LF9L 3MC0B 3K8AA 4KJNA 3DLLA 1WCMB 4OXPA 1HNXL 1TVXA 4V190 4HMJA 3UI2A 2TSSA 3HRZC 3E3XA 3F1ZA 4H7BA 1YITA 1S5FD 1RJTA 5C4HA 4YWKA 3P7JA 2FMCA 1LTRD 4HIOA 4X62Q 3K5OA 1HA5A 3L2PA 2HT1A 3UDGA 1PZKD 2UUBL 4UAIA 3T1HQ 2EYFA 2R92H 4JI4L 4Q0FA 4C2MB 3UDFA 1FL0A 5LMNL 4PZ7A 1ZYRD 3TSSA 4V0BA 4N8X1 1F2YA 2ASBA 4IUPA 4NKLA 1AE2A 1JCKB 4EQOA 3LWEA 4FNFA 2VXWA 5KYLA 1O7YA 1L1OB 4DR1L 1SYBA 5FJ8H 5EKLA 1L0WA 3RZOB 2F03A 4JPBW 4PNYA 1JMCA 3AYHB 1D1KA 2J7ZA 1A3UA 3CMEA 2JA7G 2RKSA 4CDDC 4DR6L 1Z9FA 1VQIA 1ZEQX 2K32A 2AKWB 1YNNC 2AUKA 1CZWA 5ELCA 2I0QA 4HMIA 4FF3A 2CVRA 3HOXG 4EQ5A 1X6OA 3S1NB 3F2CA 1JB3A 3E0JA 1X3PA 3M4YA 3E6ZX 4KY7A 1MJEA 1SNOA 4KY5A 1HHVA 4A3BH 3ND8A 2JXMB 3BYYB 2EDGA 5I9PA 3NP8A 3U50C 2B8FA 3NPPA 2OQKA 5ELDA 5IGCA 2YYZA 4FVMA 1O80A 3GTLB 1E7ZA 4UY8C 1JWUD 3G71A 4ULLA 1K0RA 1LV9A 3K59A 2MO1A 5FLMH 2JE6I 3BJUA 4R9WA 5CV6A 4NXNQ 2Z4HA 2R93B 2AQ2B 4UP9A 1LLRD 3S2DB 2K5QA 1PRTC 4IZ8A 4U68A 1PV4A 1GHKA 2ZXPA 4G7HC 3T1YQ 2OT2A 4JV5Q 3CD6A 3M3YH 4BY1G 3TREA 5M5XB 2PMZB 4DV7L 4HTHA 3KBGA 2Y0SG 3KF6B 3EVQA 5JJLA 1Q86C 1PYSB 4IUVA 2HQEA 4DV0Q 1HZ9A 2B2TC 4IFDH 4RA8A 2BDNA 1MHWC 2L1BA 5AFWA 3NQIA 3HOUH 1IKMA 1V9PA 1KABA 4BBSG 2O5JC 4DR2Q 2G9DA 3B6YA 1Z47A 4JI5Q 5C3EB 4O0AA 5I4DA 4G57A 4JVZA 1K73C 1C7YA 4JW0A 3PO2G 4BA2I 1KXLA 3STBD 1AZQA 2OWOA 2R7DA 3PIO3 4C3JB 3AFQA 3K80C 3NEMA 4BY7G 2FHTA 5T1GA 3RUZA 3AQQA 2NN6G 2HD3A 1V1PB 3A54A 4GNXC 2AQ1B 5IWAQ 5I9OA 1H9KA 3NWTA 4HJ5A 3PUVA 2R7ZH 2F0JA 1U4MA 5M5YH 2E5LQ 3CC7A 1FGUA 2GVAA 3KLSA 3J7AF 1JICA 4CKCA 1I50B 2XGTA 4A93B 1I5FA 1CA5A 2XRSD 1JJCB 2NZHA 3D6WA 4C1NK 4BBRG 1WJJA 1UNSA 3BZKA 3ZJYC 2E2IB 2N55A 2FINB 1A3TA 3I4MG 4X65L 1A0IA 4HIMA 1I3QB 1XNRL 1YNJD 1A2TA 2MFIA 1PTOC 4DR3L 4LFBQ 4B3SL 2KVMA 3ULJA 2JJQA 3NK9A 4A3DB 5M5WH 1QUQA 2EJFC 4LUVA 5FLXE 3BU2A 3TDQA 4A4IA 1EFID 3K5MA 2UUCQ 5CC4A 4JK1C 4X3SA 1U9RA 1BVSA 3PSIA 4H13C 4OONA 1D1IA 4JI3L 1EU3A 1EY0A 3CKIB 4DNTB 2KEEA 2Z4IA 1Y1VH 1HNZL 3MXNA 3FKIH 5IGDA 3PO3H 1PDQA 1LTBD 3J81j 2B2WC 4AIMA 1B1ZA 1SFOH 3HOZB 3C1EA 1ESRA 4IFDI 1TU2B 3WWVA 4GKJQ 3G4SA 5LMUL 1E2WA 3N6RA 4F88A 3ERSX 3CW2C 1HZBA 4JI7L 1IL8A 1TS2A 2L15A 3DMUA 2EJGC 1CI3M 3RZDB 3KOJA 1R9TB 3PUXA 3M4OH 4LUZA 2BE5D 2PCFB 3HKZE 1Q8KA 1SNMA 4B9WA 2PW5A 1EYAA 2K5WA 3J7A5 3DUZA 1K3RA 3VYUA 4YY3Q 1PTOH 4DV5Q 1L0YB 4NP5A 4UP8A 1DM0B 2QKIC 2AWNA 3NELA 1HJPA 2Q8RE 2JA6H 1EYGA 4AQYQ 2K01A 1Y8PB 2ZM6Q 2F0PA 2VUMB 3I90A 4LAAA 2N8NA 4CDFC 4A3EH 1IBMQ 1G2TA 1JE4A 3T56B 5M3FH 4CGYB 3SK8A 4KHZA 2WAQG 4OWWB 4C3HG 1C48A 2RDHA 1BNZA 3LNNA 5IP9G 5CV8A 2E8GA 2VQEQ 1BCPC 1B7YB 1E2VA 1MD2D 3KLWA 5GROA 3GV6A 4X62L 4G7OC 4TRDA 3MAQA 1I94L 2VW9A 3PF5A 1L0XB 1WTPA 1XMOQ 4LW1A 3T1HL 4KY6A 1CKOA 4IO9A 2JP1A 4A3BB 2OCEA 4POFA 3E0EA 1PFMA 4QIWE 4ODGA 1VQNA 3J80i 2HHHQ 4JI0Q 3A8IE 1TWGH 2E74C 3HKZB 1F2LA 1QNKA 1HXYD 2I07B 3S15B 1EYCA 3M85A 3I55A 2YTYA 3M7NA 1X3EA 3EBEA 3JAMc 1JORA 2F0TA 2IPKD 5DM73 3I4NH 2A6HD 3H0GH 1K28A 5CR3A 3A55A 4XYQA 5LL6X 2JA8H 1EIGA 1TWHH 1YJNA 2KOLA 5C4XB 3R93A 2R61A 4DUYL 2DGYA 2K33A 5EPKA 4NMZA 4PMCA 1AEXA 3TQYA 1W6JA 1X3FA 2N78A 4GN5A 4K8IA 2DUDA 1VQGA 2P5ZX 3M3YB 5C5LA 5IYBH 3BDOA 4HEDA 1A63A 1S5CD 1PHJA 2L12A 3C1FA 4KLKA 1KAAA 1XNQQ 2JN4A 4P75A 2WB1G 1STAA 1L2FA 4M8AA 1XJVA 2KENA 2EXDA 1YHQA 4ZK9B 5IE8A 4A3KH 3HOWB 2O4XA 1LTTD 1HNWQ 1Y8NB 1NTGA 1QZHA 4QIWB 1EZ6A 1K3BC 1YJWA 1ENCA 1QNUA 3CHBD 3G6EA 4QB4A 1VQDA 1OXUA 1STHA 2PW7A 4TKOB 3S14B 1GVPA 2KEDA 4ZKCB 3Q24A 2RF4A 4LNQA 5HURA 1GJXA 3D4DA 2RHSB 1CQFA 4JBMA 1BO0A 2KCTA 2LKVA 2IX1A 4JV5L 3S1MB 3TS0A 5J3BA 1HZCA 3K6OA 5M5YB 2N3SA 2UXBQ 1PRTB 2NZOA 1AZPA 1PRTF 4R8NA 2EY5A 2EOTA 3S17H 2UUAQ 2NVXB 3OSOA 2O5IC 4K0KL 1AH9A 1B44D 4DR2L 1SE2A 3LWUA 3R8BA 4M1UB 4JI5L 3MFYA 1MJCA 1I4HA 5GAHC 2EYHA 4PG3A 2IX0A 2AQ3B 5M5WB 4BWGB 3OIPA 4LFAQ 4QGUA 2K50A 1FD7D 1RIPA 4DAYB 5GAGC 5JVH3 4NB3A 1SJHD 4P73A 2MNAA 1SNCA 1XWEA 1NJIC 1GUTA 4RWSC 2VZAA 2PI2E 4YIJA 3KUPA 3K0XA 4OX9Q 1VQ6A 1VQOA 4K5WA 4C1NI 1VQ7A 2F1MA 4TQUS 3PO3B 1TT2A 1WTQA 1PH9A 4QMGA 1IBLQ 2ATWA 1HCZA 4P74A 5C44B 3OIQA 1HUNA 5IIFA 3EFXD 4E6IA 1LT5D 2NVYB 1WCMG 3QOJA 4DNIA 4TVAB 4X66Q 3HOYH 1DONA 4R4TA 1S5ED 2B2UC 3H3VC 1CQVA 4BS9A 5C4JH 3S1RB 3EROA 1B3AA 1AE3A 1HR0Q 1I6HH 5IGFA 3C2PA 2EYLA 3M4OB 2OTJA 4ZCKA 5JOBA 2QDBA 3KK7A 1II3A 4NXMQ 4DN4M 4HCSA 3S2HH 2L9HA 2UUCL 2B63H 4DV4L 4GZYC 4R4QA 1QWYA 1O7LA 1OXXK 2PZUA 3G6JB 4K6LA 4GOPB 5CBAE 3X3MA 4DV2Q 2SNMA 2IX3A 3FEWX
chains in the Genus database with same CATH topology
4PZ7A 3L7ZC 4IFDG 2PQAB 1N33Q 2ASBA 1A8VA 3HOUG 4UPAA 4GKJL 2ID0A 5JEAG 2D0PA 1VQJA 3HFZB 4DR5L 1AE2A 1HNXQ 2IHEA 4DV3L 4IPGA 3U4ZA 1L1OB 2IY5B 4DR1L 1NE3A 1SRUA 3PUZA 5FJ8H 4GOPC 1L0WA 3OTOL 4DR4L 3BZCA 3KF6A 1JMCA 3AYHB 3NBHB 3ULPA 2JA7G 3CMEA 2VS1A 4J15A 1VQEA 2LXJA 5E7NA 1Z9FA 2EIFA 4DR6L 1VQIA 3JAMi 4LF5L 1VQBA 1XPOA 4NXNL 4DV4Q 1NBWA 5IYCH 1JJGA 2AMCB 5GAEC 4LWCA 2JA5H 2AKWB 2VL6A 3H3VH 3AFPA 2I0QA 2WP8J 2UUBQ 3IRBA 1BBWA 2K52A 1PH1A 1VS0A 4IJHA 2Q2TA 3GTMH 4LF8Q 3UDIA 3GD7A 4YY3L 1SMXA 3HOXG 2Y0SE 4EQ5A 1J5EL 3KDFB 1YI2A 1X6OA 4JI4Q 3F2CA 4LF7Q 5LMNW 3D0FA 3G48A 4APVA 3I56A 2R7ZG 5LMNQ 1S72A 4AQYL 3T1YL 3HOVH 3K7AH 4X64L 3KFUA 1MJEA 5IP7G 4A3BH 2AHOB 3Q8DA 4A3GG 2ZM6L 4X6AH 5C44H 4C3IH 3CC4A 2NVYH 3U50C 4OWXB 3W1GA 1HH2P 3J7ZC 2OQKA 2JA9A 1XMQQ 2YYZA 3PIOA 4HIDA 1N8RC 2B3GA 1E7ZA 2JK8A 4UY8C 1K83H 3GTKH 3G71A 1WCMH 4DV0L 2ALYB 1VQLA 1K0RA 1G6PA 1WOCA 2A1AA 1N36L 4DK3C 3S1RH 4DR4Q 2B29A 4A3IG 3CCUA 1PH7A 2MO1A 5FLMH 2E2JH 2R93G 4YCUA 1OXTA 4L5RC 2JE6I 3BJUA 4MZ9A 4PZ6A 3KYHC 1N32L 4NXNQ 2IHFA 1XPUA 1X56A 1GM5A 4DUZL 4UP9A 1K9MC 3ICEA 1KRSA 3GTJH 1XMOL 1D8LA 1LYLA 4BA1I 1VQ4A 2CKZB 1J5EQ 1T9HA 2UU9L 5AJ3L 1PV4A 4GN3B 4A3MG 3J80c 3PV0A 3T1YQ 1Y1VG 4C2MH 2YU9H 4IPDA 2V1CC 3FKIG 3I4OA 3PCOB 3CD6A 3M3YH 4JV5Q 1C0AA 4BY1G 1EFWA 3TREA 5IWAL 2HHHL 4JI0L 4B3ML 4DV7L 1YVCA 2Y0SG 3E9HA 3PGZA 3KF6B 4DAMA 3GTPH 5JJLA 1Q86C 2E5LL 1PYSB 4YWMA 4DV0Q 3RLNA 1HZ9A 1N36Q 2KBNA 3HOUH 1V9PA 5C3EG 4IPCA 2F52A 4BBSG 4DR2Q 1CSPA 3S24A 3RZOH 1IXRA 3B6YA 4YHHL 4GNXB 4KI0A 1Q12A 1Z47A 2K14A 4JI5Q 3OYYA 2EQSA 2ZTEA 4O0AA 1EWIA 4JI2L 1YHAA 1TWCH 4GN4B 3CPWA 1K73C 2RCNA 2Z6KA 1C7YA 2Z0SA 4DUZQ 1VQ9A 4LF4L 2JA7H 3PO2G 4LFBL 1PH6A 1W2BA 4JI6Q 4BA2I 5HY6A 1KXLA 3STBD 1E22A 1ASZA 1OTCA 2OWOA 1WI5A 4YCVA 2R7DA 5AJ3Q 2UU9Q 3GDEA 1JE5A 1X3GA 3H3VI 3AFQA 3K80C 3NEMA 4BY7G 3JC66 4PZ8A 1UE6A 1Q81C 3AQQA 3TRZA 1B70B 2NN6G 4QL5A 4GNXC 2VQFL 1K8GA 2UXCQ 3HOXH 2JA6G 1NMGA 5IWAQ 1G291 1GD7A 4HJ5A 1XPRA 1CUKA 3GTQH 3PUVA 4H02A 1XNQL 2R7ZH 5IYDH 4JYAL 4A93G 5M5YH 4JBJA 3CC7A 2E5LQ 5IP7H 2ZJPA 1FGUA 3GTLH 4A3GH 3F8TA 2GVAA 3DM3A 4P71A 1Y1WH 4DR7Q 1IYJB 4A3EG 3TEHB 2XGTA 4R4CA 5M3FG 2D62A 1I5FA 4YHHQ 1JJCB 2NZHA 4BBRG 1WJJA 1O7IA 4JOIA 2VY3A 3BZKA 3ZJYC 4OO1G 1SR3A 4LF9Q 2YTXA 3SGIA 3I4MG 4A3DG 4X65L 1A0IA 4HIMA 4A3IH 4LF4Q 1XNRL 2MFIA 4DPGA 2R93H 1UE5A 4DR3L 4LFBQ 4B3SL 3KF8B 3TS2A 3CCRA 3ULJA 2JJQA 1PH3A 2ZJQA 5M5WH 5M3MG 1QUQA 4LUVA 4QQBX 3BU2A 2KCMA 2N49A 4A4IA 5C0XG 2ZTCA 2UUCQ 2PMZE 2CCZA 1BVSA 3PSIA 2BH2A 4OONA 4JI3L 2K75A 1VCIA 2PNHA 4AH6A 4A3MH 1YHBA 1VQPA 1CKNA 4GS3A 1Y1VH 5M5XH 1HNZL 1EQQA 4DV5L 1KHIA 1L1OC 3A5ZB 3FKIH 4YWLA 2UUAL 3PO3H 3J81j 4KHPL 4BY1H 2NVTH 4AIMA 4FDBA 1S3OA 2WAQE 1H95A 5EAYA 1FJGL 3CCSA 1KRTA 1SFOH 1A62A 1EQRA 1X55A 4IPHA 4ALPA 4IFDI 3WWVA 3CCEA 3RNUA 3UE0A 4GKJQ 2CWAA 3G4SA 5LMUL 2OQ0A 3RLOA 4DR5Q 1IBML 3I4NG 4BBSH 4DV3Q 4JCVE 1VQFA 3M4PA 3H0GG 1N34L 4B3TL 3ERSX 3CCVA 2JA8G 4DR1Q 3UDXA 2QEXA 3A0JA 2QA4A 1JJ2A 1QVCA 3CW2C 1HZBA 3J81c 1EOVA 2GN5A 4JI7L 4LFAL 1MIUA 3OTOQ 3PF4A 5K36G 1TWAH 2L15A 1PVOA 2MO0A 4R4OA 4DR6Q 1Q1BA 3KOJA 3PUXA 3PO2H 1M90C 3M4OH 3PUWA 1UEBA 4LUZA 3RN2A 1PH2A 4JBKA 4LF5Q 1E1TA 2VQEL 1OXSC 3HKZE 2KHIA 3GTOH 1Q8KA 3J7A5 5IYBG 3CCMA 4BY7H 1K3RA 4YY3Q 4DV5Q 1TXYA 3F2DA 5H1SE 2I5HA 2ES2A 4UP8A 2F3IA 1IBLL 4JG2A 2AWNA 4KHPQ 3NELA 1HJPA 2FXQA 2JA6H 1NY4A 1EYGA 2VUMG 4AQYQ 4X64Q 4GOPA 1RL2A 2ZM6Q 4A93H 3CCQA 1I50H 1VQHA 1Y14B 4DV1L 3CP0A 4GKKL 2JEAI 2YV5A 3OW2A 4A3KG 5LMUQ 2CFMA 2N8NA 1QUQB 4A3EH 1IBMQ 3MEFA 4PMWA 1UWVA 1KQSA 2E2HH 2E2IH 2ZJRA 5M3FH 4A3LG 2PQAA 1I3QH 4BBRH 4KHZA 2WAQG 4OWWB 2IT1A 1HR0L 2XTIA 2YTVA 3U4VA 3W1BA 1YJ9A 1VQ5A 2K5NA 1IBKL 4A3DH 4DKAC 2CQOA 5IP9G 4L5QA 1QZGA 2E8GA 4NXML 1QVGA 1N32Q 2VQEQ 1B7YB 3MXNB 3KLWA 4X62L 5GROA 3M9BA 1MKHA 4A3FG 1K8AC 1I94L 2VW9A 3H15A 4A3JG 3PF5A 1JB7A 2A8VA 2D0OA 4JI8L 2RHQB 4LW1A 3T1HL 1XMOQ 1HZAA 3CF5A 1CKOA 5FLXc 2C35B 4IO9A 1PA6A 4DV2L 2LXKA 2WB1E 1UE1A 5LMNL 1WYDA 2OCEA 3S1NH 1YIJA 3CC2A 3HKZG 1SROA 1FVIA 3PUYA 4QJFA 4NPSA 4POFA 1EIFA 3E0EA 3AEVA 4QIWE 4GKKQ 1VQNA 4IFDJ 1PH8A 5JJKA 2UXBQ 3J80i 2WFWA 3CXCA 2HHHQ 2I5LX 4B3MQ 3EN2A 4P72A 4DV7Q 1TWGH 4JI0Q 5JEAJ 1VQMA 1TWFH 3VDYA 1VQCA 2R6GA 1X65A 4RG1A 3M85A 1HR0W 1OXVA 3I55A 2YTYA 1Q46A 1X54A 3M7NA 1X3EA 1IL2A 3EBEA 3JAMc 1IBKQ 4OWTB 2JEBI 3I4NH 4GLVB 1EIYB 4IOAA 5C4XG 1D7QA 1PYBA 3H0GH 1HNWL 2JA8H 1S40A 1TWHH 3RZDH 1YJNA 1R9TH 3U58A 4L5SA 2BH8A 3CCJA 4JI2Q 2KHJA 2R7FA 4DUYL 1W3SA 2DGYA 1I94Q 5HGQA 1V1QA 4UP7A 4JI8Q 3K81C 4LFCL 1GO3E 3TQYA 3S2DH 1X3FA 4GLAC 4EX5A 3RR5A 4LF7L 2A19A 2N78A 4GN5A 2DUDA 1VQGA 3K7UC 5GADC 1BBUA 4MTNA 4ME3A 4LF6L 5IYBH 1SE8A 2VNUD 2VQFQ 2K4KA 1A63A 2Q2HA 2NN6I 1PHJA 4KLKA 3CAMA 1XNQQ 4A3CG 1XMQL 2VUMH 4JYAQ 2UXBL 4WJ3M 4P75A 2WB1G 1XTDA 4IOCA 3RN5A 3HOYG 3HOWG 3FHWA 3HOZG 1L2FA 1XJVA 1SN8A 4HJ8A 2KENA 2LSSA 2EXDA 1YHQA 1E24A 4A3KH 5IE8A 4WJ4A 1KAWA 1YBYA 3PIPA 4L5TA 1G51A 4A3LH 4DV6L 1HNWQ 1V43A 2HIXA 5IT9c 4BXXG 2BA0A 1NTGA 1QZHA 4OO1I 4X65Q 5C3EH 1YJWA 3EIVA 5DLQE 4DUYQ 1XNRQ 4C3HH 4HIKA 4GNXA 4DR3Q 1LUZA 4B3SQ 2B63G 5IP9H 4LFCQ 4JI1L 3G6EA 1VQDA 3A5UA 1OXUA 1UE7A 4AYBE 1GVPA 3CPFA 4HJ9A 2RF4A 5IYDG 1KIXA 4A3FH 3W5OA 4LNQA 3CQZH 2RHSB 4LF6Q 4A3JH 3RLFA 4JBMA 4LUOA 5C0XI 4C3JH 1KC8C 2KCTA 3D31A 4B3RL 2IX1A 3ER0A 2R92G 2Z6KC 4JV5L 2AWOA 2I5MX 3TS0A 1Y1WG 3CMAA 5J3BA 1Q1EA 4JBWA 1HZCA 2K5VA 4IJLA 4JI3Q 4OX9L 3F2BA 3FP9A 2UXDL 2N3SA 1PFSA 1BKBA 1N9WA 5ELNA 5BR8L 1KD1C 1HNZQ 1B8AA 2MQHA 2NZOA 2Q2IA 1VQ8A 3S17H 3CCLA 2UUAQ 4Y52H 1C9OA 1P8LA 4K0KL 2NVQH 3S16H 3S15H 1AH9A 1U5KA 1LM0A 1NMFA 1FJGQ 2HIVA 4DR2L 3UE1A 4DV6Q 4X66L 2OTLA 1LTLA 4JI5L 5FJ8G 1MJCA 2JQOA 5IY0A 2BA1A 5GAHC 4PG3A 2IX0A 4DK6C 4Y7NH 1N34Q 4B3TQ 3STBC 5C4XH 4A75A 1Q7YC 1YZ6A 5JJIA 4R4IA 4JI1Q 2F4VL 4JI6L 4JI7Q 4LFAQ 4QGUA 2PI2A 2CWPA 5IYCG 2JA5G 2K50A 1RIPA 4DAYB 3GO5A 5GAGC 3I4MH 4NB3A 4JOIC 1L1OA 4P73A 2MNAA 2ZTDA 1KL9A 3J81i 3GTGH 1CKNB 1NJIC 1P16A 4B3RQ 1Q82C 3PO3G 2VZAA 3LGJA 2PI2E 3L0OA 5GQOA 5M3MH 3KJPA 1ASYA 2UXCL 3K0XA 3M4QA 4OX9Q 1VQ6A 3HOVG 1VQOA 1IZ6A 1CKMA 2UXDQ 4RMFA 4HJ7A 5BR8Q 1M1KC 4TQUS 1VQ7A 4A3BG 3NENA 1SLJA 5C44G 1PH9A 3A74A 2K5HA 4AYBG 1PH4A 1YNXA 1IBLQ 4K0KQ 4DR7L 4QY7A 3ULLA 2ATWA 1CSQA 4P74A 4JC0A 4GLXA 4A3CH 4O2DA 1VQAA 1WCMG 3E9IA 4DNIA 4DV1Q 2QGQA 3KDFA 4TVAB 4X66Q 1EUJA 3HOYH 3HOWH 1N33L 3HOZH 4R4TA 2Q2UA 4HJAA 4LF9L 5FLMG 4MNOA 3K8AA 3DLLA 4OXPA 1HNXL 4XTCS 5C4JH 2F4VQ 1E3PA 2HQLA 1E1OA 1AE3A 1HR0Q 4XIGS 1I6HH 4POGA 1VQKA 4A76A 4BXXH 2H5XA 2OTJA 3HKSA 3F1ZA 1YITA 5ELOA 4YWKA 5C0XJ 3S14H 4NXMQ 3I2ZA 1GKHA 2UUCL 2B63H 4HIOA 3S2HH 4X62Q 1DGSA 3S1QH 3L2PA 4DV4L 2GVBA 4R4QA 1YEZA 3UDGA 2HT1A 1OXXK 3S1MH 2UUBL 3T1HQ 4LF8L 4GOPB 1U0LA 4R1JA 1WFQA 4DV2Q 1X9NA 1PH5A 3KJOA 3I7FA 4JI4L 2R92H 1JT8A 4YCWA 1J6QA 1QVFA 2NVXH 3UDFA 1FL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ7 A;  3L7Z C;  4IFD G;  2PQA B;  1N33 Q;  2ASB A;  1A8V A;  3HOU G;  4UPA A;  4GKJ L;  2ID0 A;  5JEA G;  2D0P A;  1VQJ A;  3HFZ B;  4DR5 L;  1AE2 A;  1HNX Q;  2IHE A;  4DV3 L;  4IPG A;  3U4Z A;  1L1O B;  2IY5 B;  4DR1 L;  1NE3 A;  1SRU A;  3PUZ A;  5FJ8 H;  4GOP C;  1L0W A;  3OTO L;  4DR4 L;  3BZC A;  3KF6 A;  1JMC A;  3AYH B;  3NBH B;  3ULP A;  2JA7 G;  3CME A;  2VS1 A;  4J15 A;  1VQE A;  2LXJ A;  5E7N A;  1Z9F A;  2EIF A;  4DR6 L;  1VQI A;  3JAM i;  4LF5 L;  1VQB A;  1XPO A;  4NXN L;  4DV4 Q;  1NBW A;  5IYC H;  1JJG A;  2AMC B;  5GAE C;  4LWC A;  2JA5 H;  2AKW B;  2VL6 A;  3H3V H;  3AFP A;  2I0Q A;  2WP8 J;  2UUB Q;  3IRB A;  1BBW A;  2K52 A;  1PH1 A;  1VS0 A;  4IJH A;  2Q2T A;  3GTM H;  4LF8 Q;  3UDI A;  3GD7 A;  4YY3 L;  1SMX A;  3HOX G;  2Y0S E;  4EQ5 A;  1J5E L;  3KDF B;  1YI2 A;  1X6O A;  4JI4 Q;  3F2C A;  4LF7 Q;  5LMN W;  3D0F A;  3G48 A;  4APV A;  3I56 A;  2R7Z G;  5LMN Q;  1S72 A;  4AQY L;  3T1Y L;  3HOV H;  3K7A H;  4X64 L;  3KFU A;  1MJE A;  5IP7 G;  4A3B H;  2AHO B;  3Q8D A;  4A3G G;  2ZM6 L;  4X6A H;  5C44 H;  4C3I H;  3CC4 A;  2NVY H;  3U50 C;  4OWX B;  3W1G A;  1HH2 P;  3J7Z C;  2OQK A;  2JA9 A;  1XMQ Q;  2YYZ A;  3PIO A;  4HID A;  1N8R C;  2B3G A;  1E7Z A;  2JK8 A;  4UY8 C;  1K83 H;  3GTK H;  3G71 A;  1WCM H;  4DV0 L;  2ALY B;  1VQL A;  1K0R A;  1G6P A;  1WOC A;  2A1A A;  1N36 L;  4DK3 C;  3S1R H;  4DR4 Q;  2B29 A;  4A3I G;  3CCU A;  1PH7 A;  2MO1 A;  5FLM H;  2E2J H;  2R93 G;  4YCU A;  1OXT A;  4L5R C;  2JE6 I;  3BJU A;  4MZ9 A;  4PZ6 A;  3KYH C;  1N32 L;  4NXN Q;  2IHF A;  1XPU A;  1X56 A;  1GM5 A;  4DUZ L;  4UP9 A;  1K9M C;  3ICE A;  1KRS A;  3GTJ H;  1XMO L;  1D8L A;  1LYL A;  4BA1 I;  1VQ4 A;  2CKZ B;  1J5E Q;  1T9H A;  2UU9 L;  5AJ3 L;  1PV4 A;  4GN3 B;  4A3M G;  3J80 c;  3PV0 A;  3T1Y Q;  1Y1V G;  4C2M H;  2YU9 H;  4IPD A;  2V1C C;  3FKI G;  3I4O A;  3PCO B;  3CD6 A;  3M3Y H;  4JV5 Q;  1C0A A;  4BY1 G;  1EFW A;  3TRE A;  5IWA L;  2HHH L;  4JI0 L;  4B3M L;  4DV7 L;  1YVC A;  2Y0S G;  3E9H A;  3PGZ A;  3KF6 B;  4DAM A;  3GTP H;  5JJL A;  1Q86 C;  2E5L L;  1PYS B;  4YWM A;  4DV0 Q;  3RLN A;  1HZ9 A;  1N36 Q;  2KBN A;  3HOU H;  1V9P A;  5C3E G;  4IPC A;  2F52 A;  4BBS G;  4DR2 Q;  1CSP A;  3S24 A;  3RZO H;  1IXR A;  3B6Y A;  4YHH L;  4GNX B;  4KI0 A;  1Q12 A;  1Z47 A;  2K14 A;  4JI5 Q;  3OYY A;  2EQS A;  2ZTE A;  4O0A A;  1EWI A;  4JI2 L;  1YHA A;  1TWC H;  4GN4 B;  3CPW A;  1K73 C;  2RCN A;  2Z6K A;  1C7Y A;  2Z0S A;  4DUZ Q;  1VQ9 A;  4LF4 L;  2JA7 H;  3PO2 G;  4LFB L;  1PH6 A;  1W2B A;  4JI6 Q;  4BA2 I;  5HY6 A;  1KXL A;  3STB D;  1E22 A;  1ASZ A;  1OTC A;  2OWO A;  1WI5 A;  4YCV A;  2R7D A;  5AJ3 Q;  2UU9 Q;  3GDE A;  1JE5 A;  1X3G A;  3H3V I;  3AFQ A;  3K80 C;  3NEM A;  4BY7 G;  3JC6 6;  4PZ8 A;  1UE6 A;  1Q81 C;  3AQQ A;  3TRZ A;  1B70 B;  2NN6 G;  4QL5 A;  4GNX C;  2VQF L;  1K8G A;  2UXC Q;  3HOX H;  2JA6 G;  1NMG A;  5IWA Q;  1G29 1;  1GD7 A;  4HJ5 A;  1XPR A;  1CUK A;  3GTQ H;  3PUV A;  4H02 A;  1XNQ L;  2R7Z H;  5IYD H;  4JYA L;  4A93 G;  5M5Y H;  4JBJ A;  3CC7 A;  2E5L Q;  5IP7 H;  2ZJP A;  1FGU A;  3GTL H;  4A3G H;  3F8T A;  2GVA A;  3DM3 A;  4P71 A;  1Y1W H;  4DR7 Q;  1IYJ B;  4A3E G;  3TEH B;  2XGT A;  4R4C A;  5M3F G;  2D62 A;  1I5F A;  4YHH Q;  1JJC B;  2NZH A;  4BBR G;  1WJJ A;  1O7I A;  4JOI A;  2VY3 A;  3BZK A;  3ZJY C;  4OO1 G;  1SR3 A;  4LF9 Q;  2YTX A;  3SGI A;  3I4M G;  4A3D G;  4X65 L;  1A0I A;  4HIM A;  4A3I H;  4LF4 Q;  1XNR L;  2MFI A;  4DPG A;  2R93 H;  1UE5 A;  4DR3 L;  4LFB Q;  4B3S L;  3KF8 B;  3TS2 A;  3CCR A;  3ULJ A;  2JJQ A;  1PH3 A;  2ZJQ A;  5M5W H;  5M3M G;  1QUQ A;  4LUV A;  4QQB X;  3BU2 A;  2KCM A;  2N49 A;  4A4I A;  5C0X G;  2ZTC A;  2UUC Q;  2PMZ E;  2CCZ A;  1BVS A;  3PSI A;  2BH2 A;  4OON A;  4JI3 L;  2K75 A;  1VCI A;  2PNH A;  4AH6 A;  4A3M H;  1YHB A;  1VQP A;  1CKN A;  4GS3 A;  1Y1V H;  5M5X H;  1HNZ L;  1EQQ A;  4DV5 L;  1KHI A;  1L1O C;  3A5Z B;  3FKI H;  4YWL A;  2UUA L;  3PO3 H;  3J81 j;  4KHP L;  4BY1 H;  2NVT H;  4AIM A;  4FDB A;  1S3O A;  2WAQ E;  1H95 A;  5EAY A;  1FJG L;  3CCS A;  1KRT A;  1SFO H;  1A62 A;  1EQR A;  1X55 A;  4IPH A;  4ALP A;  4IFD I;  3WWV A;  3CCE A;  3RNU A;  3UE0 A;  4GKJ Q;  2CWA A;  3G4S A;  5LMU L;  2OQ0 A;  3RLO A;  4DR5 Q;  1IBM L;  3I4N G;  4BBS H;  4DV3 Q;  4JCV E;  1VQF A;  3M4P A;  3H0G G;  1N34 L;  4B3T L;  3ERS X;  3CCV A;  2JA8 G;  4DR1 Q;  3UDX A;  2QEX A;  3A0J A;  2QA4 A;  1JJ2 A;  1QVC A;  3CW2 C;  1HZB A;  3J81 c;  1EOV A;  2GN5 A;  4JI7 L;  4LFA L;  1MIU A;  3OTO Q;  3PF4 A;  5K36 G;  1TWA H;  2L15 A;  1PVO A;  2MO0 A;  4R4O A;  4DR6 Q;  1Q1B A;  3KOJ A;  3PUX A;  3PO2 H;  1M90 C;  3M4O H;  3PUW A;  1UEB A;  4LUZ A;  3RN2 A;  1PH2 A;  4JBK A;  4LF5 Q;  1E1T A;  2VQE L;  1OXS C;  3HKZ E;  2KHI A;  3GTO H;  1Q8K A;  3J7A 5;  5IYB G;  3CCM A;  4BY7 H;  1K3R A;  4YY3 Q;  4DV5 Q;  1TXY A;  3F2D A;  5H1S E;  2I5H A;  2ES2 A;  4UP8 A;  2F3I A;  1IBL L;  4JG2 A;  2AWN A;  4KHP Q;  3NEL A;  1HJP A;  2FXQ A;  2JA6 H;  1NY4 A;  1EYG A;  2VUM G;  4AQY Q;  4X64 Q;  4GOP A;  1RL2 A;  2ZM6 Q;  4A93 H;  3CCQ A;  1I50 H;  1VQH A;  1Y14 B;  4DV1 L;  3CP0 A;  4GKK L;  2JEA I;  2YV5 A;  3OW2 A;  4A3K G;  5LMU Q;  2CFM A;  2N8N A;  1QUQ B;  4A3E H;  1IBM Q;  3MEF A;  4PMW A;  1UWV A;  1KQS A;  2E2H H;  2E2I H;  2ZJR A;  5M3F H;  4A3L G;  2PQA A;  1I3Q H;  4BBR H;  4KHZ A;  2WAQ G;  4OWW B;  2IT1 A;  1HR0 L;  2XTI A;  2YTV A;  3U4V A;  3W1B A;  1YJ9 A;  1VQ5 A;  2K5N A;  1IBK L;  4A3D H;  4DKA C;  2CQO A;  5IP9 G;  4L5Q A;  1QZG A;  2E8G A;  4NXM L;  1QVG A;  1N32 Q;  2VQE Q;  1B7Y B;  3MXN B;  3KLW A;  4X62 L;  5GRO A;  3M9B A;  1MKH A;  4A3F G;  1K8A C;  1I94 L;  2VW9 A;  3H15 A;  4A3J G;  3PF5 A;  1JB7 A;  2A8V A;  2D0O A;  4JI8 L;  2RHQ B;  4LW1 A;  3T1H L;  1XMO Q;  1HZA A;  3CF5 A;  1CKO A;  5FLX c;  2C35 B;  4IO9 A;  1PA6 A;  4DV2 L;  2LXK A;  2WB1 E;  1UE1 A;  5LMN L;  1WYD A;  2OCE A;  3S1N H;  1YIJ A;  3CC2 A;  3HKZ G;  1SRO A;  1FVI A;  3PUY A;  4QJF A;  4NPS A;  4POF A;  1EIF A;  3E0E A;  3AEV A;  4QIW E;  4GKK Q;  1VQN A;  4IFD J;  1PH8 A;  5JJK A;  2UXB Q;  3J80 i;  2WFW A;  3CXC A;  2HHH Q;  2I5L X;  4B3M Q;  3EN2 A;  4P72 A;  4DV7 Q;  1TWG H;  4JI0 Q;  5JEA J;  1VQM A;  1TWF H;  3VDY A;  1VQC A;  2R6G A;  1X65 A;  4RG1 A;  3M85 A;  1HR0 W;  1OXV A;  3I55 A;  2YTY A;  1Q46 A;  1X54 A;  3M7N A;  1X3E A;  1IL2 A;  3EBE A;  3JAM c;  1IBK Q;  4OWT B;  2JEB I;  3I4N H;  4GLV B;  1EIY B;  4IOA A;  5C4X G;  1D7Q A;  1PYB A;  3H0G H;  1HNW L;  2JA8 H;  1S40 A;  1TWH H;  3RZD H;  1YJN A;  1R9T H;  3U58 A;  4L5S A;  2BH8 A;  3CCJ A;  4JI2 Q;  2KHJ A;  2R7F A;  4DUY L;  1W3S A;  2DGY A;  1I94 Q;  5HGQ A;  1V1Q A;  4UP7 A;  4JI8 Q;  3K81 C;  4LFC L;  1GO3 E;  3TQY A;  3S2D H;  1X3F A;  4GLA C;  4EX5 A;  3RR5 A;  4LF7 L;  2A19 A;  2N78 A;  4GN5 A;  2DUD A;  1VQG A;  3K7U C;  5GAD C;  1BBU A;  4MTN A;  4ME3 A;  4LF6 L;  5IYB H;  1SE8 A;  2VNU D;  2VQF Q;  2K4K A;  1A63 A;  2Q2H A;  2NN6 I;  1PHJ A;  4KLK A;  3CAM A;  1XNQ Q;  4A3C G;  1XMQ L;  2VUM H;  4JYA Q;  2UXB L;  4WJ3 M;  4P75 A;  2WB1 G;  1XTD A;  4IOC A;  3RN5 A;  3HOY G;  3HOW G;  3FHW A;  3HOZ G;  1L2F A;  1XJV A;  1SN8 A;  4HJ8 A;  2KEN A;  2LSS A;  2EXD A;  1YHQ A;  1E24 A;  4A3K H;  5IE8 A;  4WJ4 A;  1KAW A;  1YBY A;  3PIP A;  4L5T A;  1G51 A;  4A3L H;  4DV6 L;  1HNW Q;  1V43 A;  2HIX A;  5IT9 c;  4BXX G;  2BA0 A;  1NTG A;  1QZH A;  4OO1 I;  4X65 Q;  5C3E H;  1YJW A;  3EIV A;  5DLQ E;  4DUY Q;  1XNR Q;  4C3H H;  4HIK A;  4GNX A;  4DR3 Q;  1LUZ A;  4B3S Q;  2B63 G;  5IP9 H;  4LFC Q;  4JI1 L;  3G6E A;  1VQD A;  3A5U A;  1OXU A;  1UE7 A;  4AYB E;  1GVP A;  3CPF A;  4HJ9 A;  2RF4 A;  5IYD G;  1KIX A;  4A3F H;  3W5O A;  4LNQ A;  3CQZ H;  2RHS B;  4LF6 Q;  4A3J H;  3RLF A;  4JBM A;  4LUO A;  5C0X I;  4C3J H;  1KC8 C;  2KCT A;  3D31 A;  4B3R L;  2IX1 A;  3ER0 A;  2R92 G;  2Z6K C;  4JV5 L;  2AWO A;  2I5M X;  3TS0 A;  1Y1W G;  3CMA A;  5J3B A;  1Q1E A;  4JBW A;  1HZC A;  2K5V A;  4IJL A;  4JI3 Q;  4OX9 L;  3F2B A;  3FP9 A;  2UXD L;  2N3S A;  1PFS A;  1BKB A;  1N9W A;  5ELN A;  5BR8 L;  1KD1 C;  1HNZ Q;  1B8A A;  2MQH A;  2NZO A;  2Q2I A;  1VQ8 A;  3S17 H;  3CCL A;  2UUA Q;  4Y52 H;  1C9O A;  1P8L A;  4K0K L;  2NVQ H;  3S16 H;  3S15 H;  1AH9 A;  1U5K A;  1LM0 A;  1NMF A;  1FJG Q;  2HIV A;  4DR2 L;  3UE1 A;  4DV6 Q;  4X66 L;  2OTL A;  1LTL A;  4JI5 L;  5FJ8 G;  1MJC A;  2JQO A;  5IY0 A;  2BA1 A;  5GAH C;  4PG3 A;  2IX0 A;  4DK6 C;  4Y7N H;  1N34 Q;  4B3T Q;  3STB C;  5C4X H;  4A75 A;  1Q7Y C;  1YZ6 A;  5JJI A;  4R4I A;  4JI1 Q;  2F4V L;  4JI6 L;  4JI7 Q;  4LFA Q;  4QGU A;  2PI2 A;  2CWP A;  5IYC G;  2JA5 G;  2K50 A;  1RIP A;  4DAY B;  3GO5 A;  5GAG C;  3I4M H;  4NB3 A;  4JOI C;  1L1O A;  4P73 A;  2MNA A;  2ZTD A;  1KL9 A;  3J81 i;  3GTG H;  1CKN B;  1NJI C;  1P16 A;  4B3R Q;  1Q82 C;  3PO3 G;  2VZA A;  3LGJ A;  2PI2 E;  3L0O A;  5GQO A;  5M3M H;  3KJP A;  1ASY A;  2UXC L;  3K0X A;  3M4Q A;  4OX9 Q;  1VQ6 A;  3HOV G;  1VQO A;  1IZ6 A;  1CKM A;  2UXD Q;  4RMF A;  4HJ7 A;  5BR8 Q;  1M1K C;  4TQU S;  1VQ7 A;  4A3B G;  3NEN A;  1SLJ A;  5C44 G;  1PH9 A;  3A74 A;  2K5H A;  4AYB G;  1PH4 A;  1YNX A;  1IBL Q;  4K0K Q;  4DR7 L;  4QY7 A;  3ULL A;  2ATW A;  1CSQ A;  4P74 A;  4JC0 A;  4GLX A;  4A3C H;  4O2D A;  1VQA A;  1WCM G;  3E9I A;  4DNI A;  4DV1 Q;  2QGQ A;  3KDF A;  4TVA B;  4X66 Q;  1EUJ A;  3HOY H;  3HOW H;  1N33 L;  3HOZ H;  4R4T A;  2Q2U A;  4HJA A;  4LF9 L;  5FLM G;  4MNO A;  3K8A A;  3DLL A;  4OXP A;  1HNX L;  4XTC S;  5C4J H;  2F4V Q;  1E3P A;  2HQL A;  1E1O A;  1AE3 A;  1HR0 Q;  4XIG S;  1I6H H;  4POG A;  1VQK A;  4A76 A;  4BXX H;  2H5X A;  2OTJ A;  3HKS A;  3F1Z A;  1YIT A;  5ELO A;  4YWK A;  5C0X J;  3S14 H;  4NXM Q;  3I2Z A;  1GKH A;  2UUC L;  2B63 H;  4HIO A;  3S2H H;  4X62 Q;  1DGS A;  3S1Q H;  3L2P A;  4DV4 L;  2GVB A;  4R4Q A;  1YEZ A;  3UDG A;  2HT1 A;  1OXX K;  3S1M H;  2UUB L;  3T1H Q;  4LF8 L;  4GOP B;  1U0L A;  4R1J A;  1WFQ A;  4DV2 Q;  1X9N A;  1PH5 A;  3KJO A;  3I7F A;  4JI4 L;  2R92 H;  1JT8 A;  4YCW A;  1J6Q A;  1QVF A;  2NVX H;  3UDF A;  1FL0 A; 
#chains in the Genus database with same CATH topology
 1QJO A;  3L7Z C;  4KKT A;  5JPM C;  2PQA B;  1A8V A;  4GKJ L;  5M3F B;  5JEA G;  3HFZ B;  2IY5 B;  3MHB A;  1IW7 C;  1SRU A;  1H9R A;  5CMD A;  2RBM A;  1D6E C;  2PO4 A;  3JAM L;  1MSH A;  5I6W A;  3NBH B;  3ULP A;  2A69 C;  3EQL C;  1ZKO A;  2EIF A;  5EBD A;  1TWC B;  2B2Y A;  1VQB A;  1XPO A;  1JJG A;  2B2V A;  2ZXO A;  5IYC H;  1F9P A;  5GAE C;  2JA5 H;  3H3V H;  3AFP A;  2K52 A;  1LAC A;  1VS0 A;  3GTM H;  4H44 C;  4LF8 Q;  4YY3 L;  3GD7 A;  1YI2 A;  4I7Z C;  3G48 A;  1C0A A;  1VF5 C;  1Z6H A;  3KFU A;  4AQY L;  1CFM A;  5IP7 G;  5E3F A;  1HQR D;  2ZM6 L;  4C3I H;  1R4Q B;  1PLF A;  4EVO A;  2RSO A;  3DEP A;  4OWX B;  2XNA C;  3A7L A;  1N8R C;  1ICF B;  2JA9 A;  4HID A;  2MP1 A;  1K83 H;  4R8I A;  3GTK H;  4IN3 A;  2ALY B;  3VR2 A;  1N36 L;  3PMF A;  1SE4 A;  4DR4 Q;  4A3I G;  3H0G B;  2E2J H;  2R93 G;  2F0G A;  4YCU A;  1DD2 A;  4PZ6 A;  2K03 A;  4WRD A;  2A68 C;  2LFN A;  5KGU A;  1WD0 A;  3ICE A;  1SYC A;  3GTJ H;  5I2Y A;  1XMO L;  1J5E Q;  3HZX A;  1HUM A;  1T9H A;  5AJ3 L;  1D5X C;  4A3M G;  3KF8 A;  3PV0 A;  2YU9 H;  1BCP B;  1BCP F;  4CBV A;  3NXW A;  2HHH L;  4JI0 L;  1JOK A;  2BDO A;  3E9H A;  3PGZ A;  4DAM A;  3GTP H;  3OHX C;  1IYU A;  1EIH A;  2KBN A;  5C3E G;  1CZG A;  4IPC A;  5JPN C;  4KMU C;  3S24 A;  1IXR A;  4YHH L;  4KI0 A;  5BN4 A;  3F2U A;  4MN3 A;  4DK0 A;  3K0Y A;  4B9X A;  1WTH A;  1YHA A;  3GQB A;  1VQ9 A;  2Z6K A;  2Z0S A;  4DUZ Q;  3EA6 A;  2JA7 H;  5L37 A;  3W2D A;  5FKA C;  4JI6 Q;  2B39 A;  5IGB A;  1ASZ A;  1WI5 A;  4CHT B;  2UU9 Q;  1R4P B;  3T13 A;  1JE5 A;  3H3V I;  1SE3 A;  2B2Y C;  2A6E D;  2F0S A;  3JC6 6;  4PZ8 A;  1UE6 A;  1B70 B;  2UXC Q;  2KA7 A;  3HOX H;  2A73 B;  1E2Z A;  1GD7 A;  1EQV A;  2RCF A;  1HRJ A;  3GTQ H;  4H02 A;  1XNQ L;  1FYC A;  5IYD H;  3T4A C;  4A93 G;  4JBJ A;  2ZJP A;  4UDU C;  4P71 A;  3TBI B;  4DFA A;  4DR7 Q;  1Y1W H;  5J1Z A;  5EKI A;  4HSP A;  2D62 A;  2KUM A;  1M8A A;  1O7I A;  4JOI A;  4OO1 G;  1RDP D;  4A3D G;  2NBF A;  3SXH A;  4LF4 Q;  3BG3 A;  1UE5 A;  5KND A;  1PH3 A;  1EY5 A;  2A74 C;  4ME5 A;  1EY7 A;  2N49 A;  3OWE B;  3SEB A;  2PMZ E;  4FYD A;  5CV9 A;  2CCZ A;  1Q90 A;  4XQN A;  1DJR D;  2BH2 A;  5I2X A;  1AN8 A;  1YHB A;  1VQP A;  1I6V C;  1QG7 A;  1EQQ A;  1KHI A;  2UUA L;  1H9J A;  4KHP L;  4BY1 H;  2F0M A;  4FDB A;  1A15 A;  1S3O A;  2L11 A;  5EAY A;  2CH4 A;  3CCS A;  3MEH A;  1A62 A;  1X55 A;  2Z1C A;  4KHV A;  4OEL B;  1WVL A;  1LTI D;  1VDZ A;  5EQ0 A;  5C4J B;  2CWA A;  1J9O A;  2OQ0 A;  2OF1 A;  4BBS H;  5LHY 1;  1SAP A;  2QEX A;  1AP0 A;  5TSS A;  1QVC A;  3MFG A;  5K36 G;  4LFA L;  1MIU A;  1Q3L A;  3OTO Q;  3PF4 A;  1PMR A;  1JOO A;  3R3O A;  5JJZ A;  1Q1B A;  3PO2 H;  1ICW A;  2F0W A;  2R3Z A;  4LF5 Q;  3K58 A;  1OXS C;  2WIN B;  1EY8 A;  5I6Y A;  1SSO A;  3CCM A;  2EY2 A;  2RVL A;  4BY7 H;  1ENA A;  3F2D A;  4O1N A;  1HTP A;  2NN6 H;  4FP5 D;  1IBL L;  3QG1 A;  2FXQ A;  1NY4 A;  2JSO A;  5EJW A;  5E4W C;  3VYS A;  2VUM G;  4X64 Q;  4KKS A;  4GOP A;  3KLS X;  3CCQ A;  1VQH A;  2JEA I;  1VF7 A;  4B08 A;  4CDC C;  2CFM A;  1UWV A;  2E2H H;  2ZJR A;  3FRP B;  1I4X A;  4A3L G;  2XVS A;  2PQA A;  1I4R A;  4BBR H;  1NAP A;  1HR0 L;  2YTV A;  3W1B A;  4K5X A;  1ML0 D;  1MGS A;  2CQO A;  1QZG A;  4L5Q A;  2NUC A;  2MUY A;  1BUV T;  4NXM L;  1QVG A;  1N32 Q;  2XIW A;  1ILP A;  3M9B A;  5FOB B;  3TME A;  3GTM B;  4A3F G;  1F77 A;  1W6K A;  4JI8 L;  2RHQ B;  3DWP A;  5FLX c;  4DV2 L;  2LXK A;  4A3J B;  1T5X D;  1ZYR C;  1RKN A;  2O2L D;  3HKZ G;  1FVI A;  1GUN A;  1HFN A;  1EIF A;  4K5V A;  3FDT A;  4GKK Q;  1AW7 A;  3CXC A;  4B3M Q;  2I5L X;  1K83 B;  5JEA J;  2FMM A;  1ILQ A;  2NVQ B;  1LTA D;  1X65 A;  3I4L A;  4QCL A;  2QIL A;  1X54 A;  4UHV A;  3BDL A;  1QIL A;  1IBK Q;  2DY7 A;  1TY2 A;  5DM6 3;  2DJF C;  2JEB I;  4OWT B;  4GLV B;  1EIY B;  4RGO S;  5C4X G;  1S40 A;  1BXT A;  1CM9 A;  1V1Q A;  4UP7 A;  4LFC L;  3TP5 A;  1IHZ A;  3BZD B;  1E0B A;  5T1I A;  1V8Q A;  1KNE A;  3TP8 A;  2MGS A;  1M4V A;  5E1F A;  4MTN A;  1JQY D;  2SOB A;  2VNU D;  2VQF Q;  2K4K A;  3TZD A;  2NN6 I;  1EU4 A;  1G91 A;  3GTP B;  4WJ3 M;  1XTD A;  3RN5 A;  3HOW G;  1SN8 A;  4DAV A;  4WJ4 A;  3PIP A;  3IL8 A;  1EL0 A;  1V43 A;  2HIX A;  5IT9 c;  4BXX G;  4C3H H;  4ID6 A;  4HIK A;  5IP9 H;  4JI1 L;  1A2U A;  3A5U A;  1FNV A;  4HN7 A;  4AYB E;  1D5Z C;  3GV3 A;  2D2C C;  1KIX A;  4LF6 Q;  3RLF A;  4IUQ A;  3K5N A;  1KC8 C;  3D31 A;  2EYP A;  4B3R L;  3ER0 A;  1PXU A;  2QCP X;  2I5M X;  2LY7 A;  3GTQ B;  1GUO A;  3FP9 A;  2UXD L;  1KD1 C;  2KJX A;  4FXD A;  2R92 B;  1Y1W B;  4RKB A;  1UEA B;  3V2T A;  4Y52 H;  4RKL A;  4WJW A;  1BQQ T;  3S16 H;  1BDO A;  4FXG C;  2Q8T A;  1RTN A;  2JYO A;  3UE1 A;  4DV6 Q;  5J39 A;  1LTL A;  5FO7 B;  2JQO A;  5IT9 E;  4CDE C;  1V1O A;  4Y7N H;  1N34 Q;  2PNR C;  3STB C;  1ET9 A;  5JJI A;  3I73 A;  4JI6 L;  2CWP A;  4ZYS A;  3FPP A;  1DCZ A;  4ZAI A;  1H9S B;  1KNA A;  1L1O A;  2LMC B;  2ZTD A;  3J81 i;  3CU7 A;  3GTG H;  1CKN B;  1MSG A;  1Q82 C;  3PO3 G;  3AB9 A;  3L0O A;  5M3M H;  2UXC L;  1GHJ A;  3M4Q A;  4WOR A;  3HOV G;  1IZ6 A;  1FNU A;  4RMF A;  5BR8 Q;  3ITP A;  1DOL A;  1M1K C;  1JC7 A;  3NEN A;  5C44 G;  4BY1 B;  2HDM A;  2K5H A;  1PH4 A;  1J8I A;  4DR7 L;  4HAE A;  3Q23 A;  3DEO A;  2Y0S B;  3NSW A;  4GLX A;  4AYB B;  2FFK B;  3R2I A;  1YNJ C;  2Q2U A;  4MNO A;  3BVZ A;  4XTC S;  2F4V Q;  2EYO A;  3SVM A;  1B9N A;  1WTR A;  4POG A;  3QO2 A;  4KK7 A;  4A76 A;  2H5X A;  2HCC A;  3PO2 B;  3HKS A;  3R2T A;  2RQX A;  5ELO A;  4OIJ A;  2Z8L A;  4N9T A;  4LK1 C;  1DGS A;  3S1Q H;  5LL6 S;  1ENF A;  3RD4 A;  1IKL A;  1U0L A;  4R1J A;  1FGB D;  1PH5 A;  5FLX L;  1JT8 A;  3Q6S A;  4YCW A;  3IAY A;  3URY A;  2V4D A;  3G7L A;  3SHL A;  1GXD C;  5C3X A;  1N33 Q;  4UPA A;  2WV6 D;  3DHQ A;  2A5H A;  2ID0 A;  3KLR A;  1HNX Q;  3U9O A;  2IHE A;  1LTG D;  3HOU B;  3QB3 A;  1NE3 A;  2DJG C;  1LO5 D;  3PUZ A;  5BN5 A;  2F0H A;  1SXT A;  3OTO L;  2BE5 C;  1B9M A;  3BZC A;  3KF6 A;  4QUF A;  2VS1 A;  2LXJ A;  1WTX A;  2XWJ B;  4LF5 L;  5KNC A;  4NDX A;  4ZUJ A;  4NXN L;  1NBW A;  2AMC B;  4LWC A;  2SDF A;  4QUC A;  2UUB Q;  3AMU A;  1BBW A;  1PH1 A;  2H1E A;  1STN A;  5JVG 3;  3UDI A;  1SBB B;  2NZ1 D;  2EVB A;  3KDF B;  4JI4 Q;  5LMN W;  5LMN Q;  3T1Y L;  3K7A H;  3VYT A;  4X64 L;  2B8G A;  1LT6 D;  2AHO B;  3Q8D A;  4A3G G;  4X6A H;  1RTO A;  2R7Z B;  3OMG A;  1SND A;  3TP7 A;  3W1G A;  3CRK C;  3J7Z C;  2C5C A;  1C4Q A;  1XMQ Q;  3PIO A;  2B3G A;  5IOC A;  4F87 A;  1F9Q A;  1V1P A;  1WCM H;  3QWN A;  4K2K A;  4DV0 L;  1VQL A;  5KIX A;  1RF2 D;  1WOC A;  4DK3 C;  2B29 A;  1KTK A;  5A2Q E;  1K8M A;  4KN7 C;  5FK9 C;  1OXT A;  3OW7 A;  4FO2 A;  4MZ9 A;  2E2D C;  2K28 A;  1VMC A;  3NTI A;  3KYH C;  1N32 L;  4KV6 A;  1XPU A;  1TS5 A;  3DM1 A;  2EY6 A;  1DOM A;  1X56 A;  1GM5 A;  4IAL A;  1KRS A;  4DK1 A;  3T53 B;  1VQ4 A;  2CKZ B;  5K5P A;  4FF4 A;  4GN3 B;  3J80 c;  4C2M H;  2V1C C;  3PCO B;  1EFW A;  5IWA L;  1Y1V B;  2L55 A;  1WTW A;  4B3M L;  2EJM A;  3FKI B;  1YVC A;  2TMP A;  4YWM A;  2E5L L;  3MWY W;  3RLN A;  2A6H C;  2ICE C;  2X6G A;  3J81 E;  1SFO B;  4NW2 A;  4F7X A;  5JEA H;  1CSP A;  3RZO H;  3MA2 B;  4GNX B;  2WAQ B;  3HS0 C;  3OYY A;  2ZTE A;  1EOT A;  4GN4 B;  3CPW A;  3NHH A;  4LFB L;  1W2B A;  4I65 A;  3L3O C;  1E22 A;  1OTC A;  4YCV A;  2ZT9 C;  2RSN A;  1PZJ D;  3J80 E;  3NBI A;  1PFB A;  3TRZ A;  1Q81 C;  1SMY D;  5D3D A;  2VQF L;  2CW0 D;  4RAU C;  3FMC A;  1PTO B;  1CUK A;  1PTO F;  3X3N A;  2JA6 B;  5IP7 H;  1GUS A;  4EQP A;  5E4X A;  3GTL H;  3DM3 A;  4ILW A;  4KTA A;  1DZ1 A;  1T5E A;  1QCB D;  4A3E B;  3V05 A;  2VY3 A;  4Y7N B;  4L63 B;  1SR3 A;  2YTX A;  3SGI A;  3OWF A;  4DU9 A;  4A3I H;  3EJI A;  2R93 H;  1F2Z A;  3TS2 A;  4ZRZ A;  3CCR A;  3D4W A;  2ZJQ A;  4H0L C;  4QQB X;  2EE1 A;  2PYK A;  3GTG B;  5C0X G;  2ZTC A;  1EWC A;  1QOH A;  5M3M B;  3VR5 A;  3WOE A;  1H9S A;  1VCI A;  2PNH A;  4A3M H;  5ELB A;  1CKN A;  4GS3 A;  5M5X H;  4DV5 L;  5F2D A;  1F9S A;  4YWL A;  3VR3 A;  2RDF A;  1XXG A;  2G5D A;  1BBX C;  1TWG B;  3KBX A;  4IPH A;  3CCE A;  4MIU A;  3UE0 A;  4DR5 Q;  1IBM L;  4DV3 Q;  3M4P A;  5ELF A;  1N34 L;  3CCV A;  1H9M A;  3BVM A;  4CJ1 B;  2QA4 A;  3I4N B;  3Q0A A;  5EKK A;  1KLG D;  3VA5 A;  1TWA H;  1SYE A;  2JA8 B;  2Z6B A;  1PVO A;  1TWH B;  2MO0 A;  3RMH A;  1M90 C;  3MVV A;  1UEB A;  3RN2 A;  4JBK A;  2X6L A;  1EZ8 A;  1E1T A;  2VQE L;  2F0V A;  3GTO H;  4IQZ A;  1JR0 D;  1RCV D;  1EEF D;  3BS1 A;  4CJ0 B;  5H1S E;  3DWA A;  2F3I A;  2NYZ D;  3I72 A;  1RL2 A;  2QW7 A;  4ABN A;  4A93 H;  1I50 H;  4S3S A;  3CP0 A;  2PZT A;  2YV5 A;  3OW2 A;  5FO8 B;  4QF4 A;  5LMU Q;  1QUQ B;  5M9O A;  1NR4 A;  3MEF A;  1KQS A;  2E2I H;  1I3Q H;  4A3K B;  2F0N A;  2XTI A;  1VQ5 A;  4A3D H;  2F0Q A;  3CRL C;  3P20 A;  1QB5 D;  1STB A;  4K8J A;  2L4N A;  4Z9C B;  3MTS A;  3DXJ C;  1EWH A;  1SYF A;  3MXN B;  3U9S A;  4A3J G;  5ISR A;  2F0K A;  2Z9H A;  4C3J G;  2A8V A;  2D0O A;  1TQO A;  3CF5 A;  5CYU A;  2C35 B;  2FJ2 A;  3K7A B;  1UE1 A;  2KCC A;  3PQI A;  2K6A A;  1PRT D;  1D5M C;  1NR2 A;  3J80 L;  3D4R A;  4QJF A;  2B2V C;  4NPS A;  1S4Z A;  3AEV A;  1GUW A;  5JJK A;  2EY1 A;  4PV1 C;  3EN2 A;  3S17 B;  3ONA B;  4DA2 A;  1TWF H;  3IFT A;  1VQC A;  1EY6 A;  1ZXT A;  2L0C A;  2R6G A;  4RG1 A;  1BR9 A;  1OXV A;  2C9O A;  1Q46 A;  1IL2 A;  4LMQ D;  5D14 A;  2J4X A;  3BYT B;  4IOA A;  1HNW L;  1DYQ A;  3RZD H;  1R9T H;  3U58 A;  2BH8 A;  5K36 H;  1EY9 A;  4JI2 Q;  2BCO A;  2R7F A;  1I94 Q;  5HGQ A;  3K81 C;  1GO3 E;  3HEJ A;  3ERQ A;  1U4P A;  2CHB D;  5CV4 A;  2B2T A;  1BBU A;  1IYV A;  3TZU A;  1SE8 A;  3GP7 A;  4DAY A;  1SNP A;  3CAM A;  1XTC D;  4A3C G;  1XMQ L;  2VUM H;  4JYA Q;  2UXB L;  3HP3 A;  4IOC A;  3FHW A;  3HOZ G;  4KD3 A;  1E24 A;  3HOY B;  1YBY A;  1G51 A;  4A3L H;  2MPM A;  3C3L A;  4OIK A;  2M00 A;  2BA0 A;  4OO1 I;  4XXE A;  1SYD A;  4DUY Q;  2HUG A;  4GNX A;  1I6H B;  4OEM B;  1G6Z A;  1PTO D;  3SK5 A;  3S2H B;  4P2C B;  4HJ9 A;  2B63 B;  2D9U A;  5IYD G;  4A3F H;  3W5O A;  3CQZ H;  4LUO A;  1CT1 D;  2OEO A;  3DWQ A;  2R92 G;  2Z6K C;  1Y1W G;  3SDZ A;  3CMA A;  4JBW A;  4OX9 L;  3F2B A;  5ELN A;  2MQH A;  2NB0 A;  4MTK A;  4U67 3;  3CCL A;  3SR1 A;  2LS0 1;  1DOK A;  1P8L A;  2DNE A;  4X3T A;  3S15 H;  4K14 A;  1U5K A;  4XT3 B;  5CV5 A;  1FJG Q;  3IKJ A;  4OHJ A;  5A35 A;  2MJ8 A;  1EEI D;  2XWB B;  3NTH A;  3SK4 A;  4X66 L;  2OTL A;  2KHS A;  2L5T A;  5FJ8 G;  5IY0 A;  4A3I B;  5EPL A;  4G7Z C;  1BF4 A;  3I91 A;  4B3T Q;  5C4X H;  1Q7Y C;  4XT1 B;  4R4I A;  2PI2 A;  2A6E C;  1K8O A;  3I4M H;  4JOI C;  5EBC A;  2PPB C;  2B2W A;  1KL9 A;  1ROD A;  2JA5 B;  1P16 A;  3LGJ A;  5GQO A;  3TP6 A;  3NBH A;  4A3M B;  1CKM A;  4RGN A;  1G8Z D;  2K04 A;  2DNC A;  4A3B G;  4AYB G;  2VB2 X;  1YNX A;  4K0K Q;  4QY7 A;  1CSQ A;  3H91 A;  4CKE A;  2IWH A;  4DAP A;  4C3I B;  3QJY A;  1Y8O B;  4XQJ A;  1VQA A;  4RGM A;  3E9I A;  4DV1 Q;  1EYD A;  1TS4 A;  1EUJ A;  3HOW H;  2K05 A;  3GTK B;  5FLM G;  4EQN A;  2NTT A;  4L8J A;  1D2B A;  3AU7 A;  2F0U A;  5DNF A;  1E3P A;  2HQL A;  1E1O A;  1TWA B;  5FO9 B;  4XIG S;  2E2J B;  2WAC A;  1VQK A;  3ND9 A;  4BXX H;  1I4G A;  4WFN 3;  5C0X J;  3S14 H;  2Q8I B;  4IUU A;  5DEH A;  4C56 C;  1LAB A;  3I2Z A;  1GKH A;  1I4Q A;  3GTO B;  2GVB A;  2F3W A;  1YEZ A;  2VB3 X;  3E5S A;  3OPO A;  3GTJ B;  3S1M H;  1BCP D;  4LF8 L;  1KLU D;  4OL7 A;  4F8M A;  1WFQ A;  1X9N A;  3KJO A;  3I7F A;  2YU9 B;  1TR5 A;  1J6Q A;  2XSC A;  1CA6 A;  1QVF A;  2NVX H;  2CQA A;  2F0E A;  4IFD G;  4DXF A;  3HOU G;  1NCV A;  4IUR A;  2D0P A;  1VQJ A;  4DR5 L;  3SE0 A;  4DV3 L;  2QDL A;  4IPG A;  3U4Z A;  3P1H A;  4TSS A;  1XX8 A;  4GOP C;  4CJ2 C;  2I46 A;  4DR4 L;  4HSV A;  2K1B A;  4RCN A;  1VMP A;  4J15 A;  5E7N A;  1VQE A;  2D5D A;  4RHS A;  3JAM i;  4DV4 Q;  2JA7 B;  1X32 A;  2VL6 A;  1UAP A;  2WP8 J;  3IRB A;  2Q2T A;  5EPJ A;  4IJH A;  3J7Y W;  1SMX A;  2Y0S E;  2EYM A;  1J5E L;  4LF7 Q;  5D3I B;  3D0F A;  4APV A;  3I56 A;  2R7Z G;  1S72 A;  3HOV H;  3VYR A;  5KYI A;  3HOX B;  5C44 H;  3CC4 A;  2NVY H;  1TWF B;  4XYO A;  1HH2 P;  2N88 A;  2JK8 A;  3N52 A;  5COY A;  1GUG A;  1G6P A;  2A1A A;  4J1M A;  3S1R H;  3H6M A;  3CCU A;  1PH7 A;  4L5R C;  4X3U A;  4HCE A;  1KDB A;  2F3V A;  1CK1 A;  2IHF A;  2MHV A;  2CH4 W;  4DUZ L;  1K9M C;  3FPU B;  2EZV A;  4MHE A;  4K6D A;  1D8L A;  1LYL A;  5COR A;  5ELE A;  4BA1 I;  1KDC A;  4IUN A;  2UU9 L;  4G4K A;  3QIA A;  1Y1V G;  1SDF A;  4IPD A;  3I70 A;  3OOC A;  3FKI G;  3I4O A;  1STY A;  2K7V A;  1XYI A;  3D3R A;  1ESF A;  1N36 Q;  1ET6 A;  1K0S A;  2EPB A;  1WTO A;  1U4R A;  2F52 A;  2KQ3 A;  3NE5 B;  1HA6 A;  2M2L A;  2PQE A;  1Q12 A;  2ICI A;  1B2T A;  2K14 A;  2EQS A;  4BBS B;  1EWI A;  4JI2 L;  1TWC H;  2RCN A;  4LF4 L;  1LT3 D;  2HDL A;  1BOS A;  4ZQ3 A;  1CHQ D;  5DAU A;  1PH6 A;  2RDG A;  5HY6 A;  2WKD A;  3A8K E;  4A3F B;  3H09 A;  4L6T B;  3CQZ B;  5G3L F;  5AJ3 Q;  3NUC A;  3GDE A;  1X3G A;  1PZI D;  1NNX A;  2BOS A;  1LT4 D;  1EY4 A;  3J7A V;  4QL5 A;  1K8G A;  2H4O A;  1MI2 A;  2JA6 G;  1NMG A;  4BY7 B;  1G29 1;  3A56 A;  1S5B D;  1XPR A;  4JYA L;  4A3G H;  3F8T A;  2F0I A;  5CV7 A;  1IYJ B;  4A3E G;  3MZ5 A;  4DGZ A;  2X69 A;  4N8F A;  3TEH B;  4R4C A;  5M3F G;  1OO9 B;  4YHH Q;  3VA7 A;  4EGV A;  3QOL A;  1FNW A;  2E2H B;  3WOF A;  4LF9 Q;  4KN4 C;  1HFG A;  5HGT A;  4BBR B;  4DPG A;  1EQT A;  1O78 A;  3KF8 B;  5C3W A;  3I4M B;  2SEB D;  3FVQ A;  5M3M G;  2ENB A;  3ZYY X;  4KD4 A;  2KCM A;  1STG A;  4RCO A;  3M7G A;  3I3C A;  2QEJ C;  2F4I A;  2K75 A;  4AH6 A;  5KNB A;  2RA4 A;  2B2U A;  4O42 A;  1L1O C;  3A5Z B;  2OXP A;  5KRU A;  2NVT H;  1X3Q A;  1GOZ A;  1ONL A;  2WAQ E;  1H95 A;  3JAM E;  1U4L A;  1FJG L;  4ZUI A;  1KRT A;  2WII B;  1EQR A;  4ALP A;  4K2L A;  3RNU A;  3I8Z A;  3RLO A;  3I4N G;  1F9R A;  4JCV E;  1VQF A;  3H0G G;  4B3T L;  1A6X A;  4Q5V A;  2JA8 G;  5CGK A;  4OGQ C;  3UDX A;  3P75 A;  4DR1 Q;  3A0J A;  1JJ2 A;  2J0T D;  5C6A A;  3J81 c;  1EOV A;  2GN5 A;  3C46 A;  1IW7 D;  4I7A A;  4PQX A;  1I4P A;  4R4O A;  5IOD A;  4DR6 Q;  1A3V A;  3PUW A;  4RH6 A;  1PH2 A;  4DF7 A;  5IT9 L;  3S9W A;  2A69 D;  2KHI A;  3VR4 A;  2DY8 A;  5BN3 A;  1F2M A;  4RFB A;  2XRQ D;  3H94 A;  1C8C A;  5IYB G;  1Q8I A;  3T51 B;  1B4O A;  1TXY A;  2KCN A;  3BVG A;  2I5H A;  2ES2 A;  4JG2 A;  4KHP Q;  1O7Z A;  1WD1 A;  1B50 A;  2AUJ D;  1NSN S;  1TII D;  4DV1 L;  1Y14 B;  3IFD A;  4GKK L;  1Y69 U;  4KKU A;  4A3K G;  1SYG A;  4FXK C;  4PMW A;  3HGB A;  4FF2 A;  3LX0 A;  3L9A X;  4KJO A;  2IT1 A;  3U4V A;  1YJ9 A;  2K5N A;  1RD9 D;  5CBE E;  1IBK L;  2IL8 A;  1B3Q A;  4DKA C;  2K5D A;  2IJ0 A;  4C3H B;  3A8J E;  1QE6 A;  1MKH A;  4XQQ A;  1K8A C;  2A68 D;  3H15 A;  3NWS A;  1JB7 A;  1TKW B;  5C0X H;  2EXZ A;  4IUT A;  1HZA A;  3D8G A;  1PA6 A;  3HOV B;  2ZXR A;  4ZLT F;  2WB1 E;  1WYD A;  3S1N H;  1YIJ A;  3A7A B;  3CC2 A;  3PUY A;  1SRO A;  2PZW A;  2QF7 A;  4IFD J;  2XN9 C;  1PH8 A;  3O13 A;  3V96 A;  2NWG A;  2WFW A;  1JWM D;  4P72 A;  4DV7 Q;  1VQM A;  2G9H D;  3VDY A;  3S16 B;  2F0D A;  5KEE A;  1HR0 W;  2HCI A;  5NUC A;  1PYW D;  5IGG A;  1JWS D;  1D7Q A;  2NTS A;  5D65 A;  1PYB A;  4L5S A;  2EYJ A;  3CCJ A;  1UUP A;  2WKC A;  2KHJ A;  1W3S A;  1MBY A;  4JI8 Q;  5JAV A;  5EGT A;  1FR3 A;  1STE A;  3S2D H;  1RHP A;  4GLA C;  3RR5 A;  4EX5 A;  2A19 A;  4LF7 L;  3K7U C;  5GAD C;  4ZKB B;  3TN2 A;  3VR6 A;  4ME3 A;  1SNQ A;  4DXG A;  4LF6 L;  2Q2H A;  4HR7 B;  3K5L A;  3T16 A;  4RHR A;  4N9P A;  2F0L A;  3SK6 A;  3HOY G;  2IW3 A;  3BDC A;  4HJ8 A;  2LSS A;  2F0O A;  1CHP D;  1AFP A;  1SEB D;  1KAW A;  2WB1 B;  1HQM C;  1CTM A;  4L5T A;  4DV6 L;  5G3L D;  4PMB A;  5J22 A;  4X65 Q;  5C3E H;  3EIV A;  5DLQ E;  1XNR Q;  4DR3 Q;  1LUZ A;  4B3S Q;  3OMC A;  1HPC A;  4LFC Q;  2B63 G;  1Z7T A;  1KDA A;  1UE7 A;  5A2Q L;  3CPF A;  5IGE A;  3S1Q B;  4A3J H;  5C0X I;  3D6C A;  4C3J H;  2AWO A;  1Q1E A;  2K5V A;  4IJL A;  2F0F A;  1TY0 A;  4JI3 Q;  4CKB A;  1TS3 A;  1PFS A;  1BKB A;  1N9W A;  5BR8 L;  1HNZ Q;  1VQ8 A;  4J8Q A;  2Q2I A;  1B8A A;  4A3G B;  1SJE D;  4J6H A;  1YNN D;  2KEC A;  1C9O A;  2NVQ H;  1LM0 A;  1NMF A;  1DXM A;  2HIV A;  1S5D D;  3W3A A;  1HTL D;  1PFN A;  2BA1 A;  2E76 C;  1LTS D;  4DK6 C;  2GA4 B;  3MXG A;  4A75 A;  3WDN A;  1YZ6 A;  1G2S A;  2F4V L;  4LJZ C;  4JI1 Q;  2DN8 A;  2M9V A;  4JI7 Q;  3NQT A;  5IYC G;  3J81 L;  4X3K A;  3K57 A;  2JA5 G;  3MXU A;  5C4Z A;  4OO1 H;  3GO5 A;  1SMY C;  2CW0 C;  4RGT A;  1JOQ A;  4B3R Q;  3KJP A;  2E75 C;  1ASY A;  3PIP 3;  4FF1 A;  2UXD Q;  4HJ7 A;  1NUC A;  1SLJ A;  3Q22 A;  2NVT B;  3A74 A;  3NTK A;  4C3I G;  1WTV A;  3HG9 A;  3ULL A;  2SNS A;  4XDX A;  4DNR B;  4JC0 A;  4A3C H;  1B53 A;  5C5M A;  4O2D A;  2QGQ A;  3KDF A;  1N33 L;  3HOZ H;  3MXP A;  3QR8 A;  4HJA A;  4LF9 L;  3MC0 B;  3K8A A;  4KJN A;  3DLL A;  1WCM B;  4OXP A;  1HNX L;  1TVX A;  4V19 0;  4HMJ A;  3UI2 A;  2TSS A;  3HRZ C;  3E3X A;  3F1Z A;  4H7B A;  1YIT A;  1S5F D;  1RJT A;  5C4H A;  4YWK A;  3P7J A;  2FMC A;  1LTR D;  4HIO A;  4X62 Q;  3K5O A;  1HA5 A;  3L2P A;  2HT1 A;  3UDG A;  1PZK D;  2UUB L;  4UAI A;  3T1H Q;  2EYF A;  2R92 H;  4JI4 L;  4Q0F A;  4C2M B;  3UDF A;  1FL0 A;  5LMN L;  4PZ7 A;  1ZYR D;  3TSS A;  4V0B A;  4N8X 1;  1F2Y A;  2ASB A;  4IUP A;  4NKL A;  1AE2 A;  1JCK B;  4EQO A;  3LWE A;  4FNF A;  2VXW A;  5KYL A;  1O7Y A;  1L1O B;  4DR1 L;  1SYB A;  5FJ8 H;  5EKL A;  1L0W A;  3RZO B;  2F03 A;  4JPB W;  4PNY A;  1JMC A;  3AYH B;  1D1K A;  2J7Z A;  1A3U A;  3CME A;  2JA7 G;  2RKS A;  4CDD C;  4DR6 L;  1Z9F A;  1VQI A;  1ZEQ X;  2K32 A;  2AKW B;  1YNN C;  2AUK A;  1CZW A;  5ELC A;  2I0Q A;  4HMI A;  4FF3 A;  2CVR A;  3HOX G;  4EQ5 A;  1X6O A;  3S1N B;  3F2C A;  1JB3 A;  3E0J A;  1X3P A;  3M4Y A;  3E6Z X;  4KY7 A;  1MJE A;  1SNO A;  4KY5 A;  1HHV A;  4A3B H;  3ND8 A;  2JXM B;  3BYY B;  2EDG A;  5I9P A;  3NP8 A;  3U50 C;  2B8F A;  3NPP A;  2OQK A;  5ELD A;  5IGC A;  2YYZ A;  4FVM A;  1O80 A;  3GTL B;  1E7Z A;  4UY8 C;  1JWU D;  3G71 A;  4ULL A;  1K0R A;  1LV9 A;  3K59 A;  2MO1 A;  5FLM H;  2JE6 I;  3BJU A;  4R9W A;  5CV6 A;  4NXN Q;  2Z4H A;  2R93 B;  2AQ2 B;  4UP9 A;  1LLR D;  3S2D B;  2K5Q A;  1PRT C;  4IZ8 A;  4U68 A;  1PV4 A;  1GHK A;  2ZXP A;  4G7H C;  3T1Y Q;  2OT2 A;  4JV5 Q;  3CD6 A;  3M3Y H;  4BY1 G;  3TRE A;  5M5X B;  2PMZ B;  4DV7 L;  4HTH A;  3KBG A;  2Y0S G;  3KF6 B;  3EVQ A;  5JJL A;  1Q86 C;  1PYS B;  4IUV A;  2HQE A;  4DV0 Q;  1HZ9 A;  2B2T C;  4IFD H;  4RA8 A;  2BDN A;  1MHW C;  2L1B A;  5AFW A;  3NQI A;  3HOU H;  1IKM A;  1V9P A;  1KAB A;  4BBS G;  2O5J C;  4DR2 Q;  2G9D A;  3B6Y A;  1Z47 A;  4JI5 Q;  5C3E B;  4O0A A;  5I4D A;  4G57 A;  4JVZ A;  1K73 C;  1C7Y A;  4JW0 A;  3PO2 G;  4BA2 I;  1KXL A;  3STB D;  1AZQ A;  2OWO A;  2R7D A;  3PIO 3;  4C3J B;  3AFQ A;  3K80 C;  3NEM A;  4BY7 G;  2FHT A;  5T1G A;  3RUZ A;  3AQQ A;  2NN6 G;  2HD3 A;  1V1P B;  3A54 A;  4GNX C;  2AQ1 B;  5IWA Q;  5I9O A;  1H9K A;  3NWT A;  4HJ5 A;  3PUV A;  2R7Z H;  2F0J A;  1U4M A;  5M5Y H;  2E5L Q;  3CC7 A;  1FGU A;  2GVA A;  3KLS A;  3J7A F;  1JIC A;  4CKC A;  1I50 B;  2XGT A;  4A93 B;  1I5F A;  1CA5 A;  2XRS D;  1JJC B;  2NZH A;  3D6W A;  4C1N K;  4BBR G;  1WJJ A;  1UNS A;  3BZK A;  3ZJY C;  2E2I B;  2N55 A;  2FIN B;  1A3T A;  3I4M G;  4X65 L;  1A0I A;  4HIM A;  1I3Q B;  1XNR L;  1YNJ D;  1A2T A;  2MFI A;  1PTO C;  4DR3 L;  4LFB Q;  4B3S L;  2KVM A;  3ULJ A;  2JJQ A;  3NK9 A;  4A3D B;  5M5W H;  1QUQ A;  2EJF C;  4LUV A;  5FLX E;  3BU2 A;  3TDQ A;  4A4I A;  1EFI D;  3K5M A;  2UUC Q;  5CC4 A;  4JK1 C;  4X3S A;  1U9R A;  1BVS A;  3PSI A;  4H13 C;  4OON A;  1D1I A;  4JI3 L;  1EU3 A;  1EY0 A;  3CKI B;  4DNT B;  2KEE A;  2Z4I A;  1Y1V H;  1HNZ L;  3MXN A;  3FKI H;  5IGD A;  3PO3 H;  1PDQ A;  1LTB D;  3J81 j;  2B2W C;  4AIM A;  1B1Z A;  1SFO H;  3HOZ B;  3C1E A;  1ESR A;  4IFD I;  1TU2 B;  3WWV A;  4GKJ Q;  3G4S A;  5LMU L;  1E2W A;  3N6R A;  4F88 A;  3ERS X;  3CW2 C;  1HZB A;  4JI7 L;  1IL8 A;  1TS2 A;  2L15 A;  3DMU A;  2EJG C;  1CI3 M;  3RZD B;  3KOJ A;  1R9T B;  3PUX A;  3M4O H;  4LUZ A;  2BE5 D;  2PCF B;  3HKZ E;  1Q8K A;  1SNM A;  4B9W A;  2PW5 A;  1EYA A;  2K5W A;  3J7A 5;  3DUZ A;  1K3R A;  3VYU A;  4YY3 Q;  1PTO H;  4DV5 Q;  1L0Y B;  4NP5 A;  4UP8 A;  1DM0 B;  2QKI C;  2AWN A;  3NEL A;  1HJP A;  2Q8R E;  2JA6 H;  1EYG A;  4AQY Q;  2K01 A;  1Y8P B;  2ZM6 Q;  2F0P A;  2VUM B;  3I90 A;  4LAA A;  2N8N A;  4CDF C;  4A3E H;  1IBM Q;  1G2T A;  1JE4 A;  3T56 B;  5M3F H;  4CGY B;  3SK8 A;  4KHZ A;  2WAQ G;  4OWW B;  4C3H G;  1C48 A;  2RDH A;  1BNZ A;  3LNN A;  5IP9 G;  5CV8 A;  2E8G A;  2VQE Q;  1BCP C;  1B7Y B;  1E2V A;  1MD2 D;  3KLW A;  5GRO A;  3GV6 A;  4X62 L;  4G7O C;  4TRD A;  3MAQ A;  1I94 L;  2VW9 A;  3PF5 A;  1L0X B;  1WTP A;  1XMO Q;  4LW1 A;  3T1H L;  4KY6 A;  1CKO A;  4IO9 A;  2JP1 A;  4A3B B;  2OCE A;  4POF A;  3E0E A;  1PFM A;  4QIW E;  4ODG A;  1VQN A;  3J80 i;  2HHH Q;  4JI0 Q;  3A8I E;  1TWG H;  2E74 C;  3HKZ B;  1F2L A;  1QNK A;  1HXY D;  2I07 B;  3S15 B;  1EYC A;  3M85 A;  3I55 A;  2YTY A;  3M7N A;  1X3E A;  3EBE A;  3JAM c;  1JOR A;  2F0T A;  2IPK D;  5DM7 3;  3I4N H;  2A6H D;  3H0G H;  1K28 A;  5CR3 A;  3A55 A;  4XYQ A;  5LL6 X;  2JA8 H;  1EIG A;  1TWH H;  1YJN A;  2KOL A;  5C4X B;  3R93 A;  2R61 A;  4DUY L;  2DGY A;  2K33 A;  5EPK A;  4NMZ A;  4PMC A;  1AEX A;  3TQY A;  1W6J A;  1X3F A;  2N78 A;  4GN5 A;  4K8I A;  2DUD A;  1VQG A;  2P5Z X;  3M3Y B;  5C5L A;  5IYB H;  3BDO A;  4HED A;  1A63 A;  1S5C D;  1PHJ A;  2L12 A;  3C1F A;  4KLK A;  1KAA A;  1XNQ Q;  2JN4 A;  4P75 A;  2WB1 G;  1STA A;  1L2F A;  4M8A A;  1XJV A;  2KEN A;  2EXD A;  1YHQ A;  4ZK9 B;  5IE8 A;  4A3K H;  3HOW B;  2O4X A;  1LTT D;  1HNW Q;  1Y8N B;  1NTG A;  1QZH A;  4QIW B;  1EZ6 A;  1K3B C;  1YJW A;  1ENC A;  1QNU A;  3CHB D;  3G6E A;  4QB4 A;  1VQD A;  1OXU A;  1STH A;  2PW7 A;  4TKO B;  3S14 B;  1GVP A;  2KED A;  4ZKC B;  3Q24 A;  2RF4 A;  4LNQ A;  5HUR A;  1GJX A;  3D4D A;  2RHS B;  1CQF A;  4JBM A;  1BO0 A;  2KCT A;  2LKV A;  2IX1 A;  4JV5 L;  3S1M B;  3TS0 A;  5J3B A;  1HZC A;  3K6O A;  5M5Y B;  2N3S A;  2UXB Q;  1PRT B;  2NZO A;  1AZP A;  1PRT F;  4R8N A;  2EY5 A;  2EOT A;  3S17 H;  2UUA Q;  2NVX B;  3OSO A;  2O5I C;  4K0K L;  1AH9 A;  1B44 D;  4DR2 L;  1SE2 A;  3LWU A;  3R8B A;  4M1U B;  4JI5 L;  3MFY A;  1MJC A;  1I4H A;  5GAH C;  2EYH A;  4PG3 A;  2IX0 A;  2AQ3 B;  5M5W B;  4BWG B;  3OIP A;  4LFA Q;  4QGU A;  2K50 A;  1FD7 D;  1RIP A;  4DAY B;  5GAG C;  5JVH 3;  4NB3 A;  1SJH D;  4P73 A;  2MNA A;  1SNC A;  1XWE A;  1NJI C;  1GUT A;  4RWS C;  2VZA A;  2PI2 E;  4YIJ A;  3KUP A;  3K0X A;  4OX9 Q;  1VQ6 A;  1VQO A;  4K5W A;  4C1N I;  1VQ7 A;  2F1M A;  4TQU S;  3PO3 B;  1TT2 A;  1WTQ A;  1PH9 A;  4QMG A;  1IBL Q;  2ATW A;  1HCZ A;  4P74 A;  5C44 B;  3OIQ A;  1HUN A;  5IIF A;  3EFX D;  4E6I A;  1LT5 D;  2NVY B;  1WCM G;  3QOJ A;  4DNI A;  4TVA B;  4X66 Q;  3HOY H;  1DON A;  4R4T A;  1S5E D;  2B2U C;  3H3V C;  1CQV A;  4BS9 A;  5C4J H;  3S1R B;  3ERO A;  1B3A A;  1AE3 A;  1HR0 Q;  1I6H H;  5IGF A;  3C2P A;  2EYL A;  3M4O B;  2OTJ A;  4ZCK A;  5JOB A;  2QDB A;  3KK7 A;  1II3 A;  4NXM Q;  4DN4 M;  4HCS A;  3S2H H;  2L9H A;  2UUC L;  2B63 H;  4DV4 L;  4GZY C;  4R4Q A;  1QWY A;  1O7L A;  1OXX K;  2PZU A;  3G6J B;  4K6L A;  4GOP B;  5CBA E;  3X3M A;  4DV2 Q;  2SNM A;  2IX3 A;  3FEW X; 
#chains in the Genus database with same CATH homology
 4PZ7 A;  3L7Z C;  4IFD G;  2PQA B;  1N33 Q;  2ASB A;  1A8V A;  3HOU G;  4UPA A;  4GKJ L;  2ID0 A;  5JEA G;  2D0P A;  1VQJ A;  3HFZ B;  4DR5 L;  1AE2 A;  1HNX Q;  2IHE A;  4DV3 L;  4IPG A;  3U4Z A;  1L1O B;  2IY5 B;  4DR1 L;  1NE3 A;  1SRU A;  3PUZ A;  5FJ8 H;  4GOP C;  1L0W A;  3OTO L;  4DR4 L;  3BZC A;  3KF6 A;  1JMC A;  3AYH B;  3NBH B;  3ULP A;  2JA7 G;  3CME A;  2VS1 A;  4J15 A;  1VQE A;  2LXJ A;  5E7N A;  1Z9F A;  2EIF A;  4DR6 L;  1VQI A;  3JAM i;  4LF5 L;  1VQB A;  1XPO A;  4NXN L;  4DV4 Q;  1NBW A;  5IYC H;  1JJG A;  2AMC B;  5GAE C;  4LWC A;  2JA5 H;  2AKW B;  2VL6 A;  3H3V H;  3AFP A;  2I0Q A;  2WP8 J;  2UUB Q;  3IRB A;  1BBW A;  2K52 A;  1PH1 A;  1VS0 A;  4IJH A;  2Q2T A;  3GTM H;  4LF8 Q;  3UDI A;  3GD7 A;  4YY3 L;  1SMX A;  3HOX G;  2Y0S E;  4EQ5 A;  1J5E L;  3KDF B;  1YI2 A;  1X6O A;  4JI4 Q;  3F2C A;  4LF7 Q;  5LMN W;  3D0F A;  3G48 A;  4APV A;  3I56 A;  2R7Z G;  5LMN Q;  1S72 A;  4AQY L;  3T1Y L;  3HOV H;  3K7A H;  4X64 L;  3KFU A;  1MJE A;  5IP7 G;  4A3B H;  2AHO B;  3Q8D A;  4A3G G;  2ZM6 L;  4X6A H;  5C44 H;  4C3I H;  3CC4 A;  2NVY H;  3U50 C;  4OWX B;  3W1G A;  1HH2 P;  3J7Z C;  2OQK A;  2JA9 A;  1XMQ Q;  2YYZ A;  3PIO A;  4HID A;  1N8R C;  2B3G A;  1E7Z A;  2JK8 A;  4UY8 C;  1K83 H;  3GTK H;  3G71 A;  1WCM H;  4DV0 L;  2ALY B;  1VQL A;  1K0R A;  1G6P A;  1WOC A;  2A1A A;  1N36 L;  4DK3 C;  3S1R H;  4DR4 Q;  2B29 A;  4A3I G;  3CCU A;  1PH7 A;  2MO1 A;  5FLM H;  2E2J H;  2R93 G;  4YCU A;  1OXT A;  4L5R C;  2JE6 I;  3BJU A;  4MZ9 A;  4PZ6 A;  3KYH C;  1N32 L;  4NXN Q;  2IHF A;  1XPU A;  1X56 A;  1GM5 A;  4DUZ L;  4UP9 A;  1K9M C;  3ICE A;  1KRS A;  3GTJ H;  1XMO L;  1D8L A;  1LYL A;  4BA1 I;  1VQ4 A;  2CKZ B;  1J5E Q;  1T9H A;  2UU9 L;  5AJ3 L;  1PV4 A;  4GN3 B;  4A3M G;  3J80 c;  3PV0 A;  3T1Y Q;  1Y1V G;  4C2M H;  2YU9 H;  4IPD A;  2V1C C;  3FKI G;  3I4O A;  3PCO B;  3CD6 A;  3M3Y H;  4JV5 Q;  1C0A A;  4BY1 G;  1EFW A;  3TRE A;  5IWA L;  2HHH L;  4JI0 L;  4B3M L;  4DV7 L;  1YVC A;  2Y0S G;  3E9H A;  3PGZ A;  3KF6 B;  4DAM A;  3GTP H;  5JJL A;  1Q86 C;  2E5L L;  1PYS B;  4YWM A;  4DV0 Q;  3RLN A;  1HZ9 A;  1N36 Q;  2KBN A;  3HOU H;  1V9P A;  5C3E G;  4IPC A;  2F52 A;  4BBS G;  4DR2 Q;  1CSP A;  3S24 A;  3RZO H;  1IXR A;  3B6Y A;  4YHH L;  4GNX B;  4KI0 A;  1Q12 A;  1Z47 A;  2K14 A;  4JI5 Q;  3OYY A;  2EQS A;  2ZTE A;  4O0A A;  1EWI A;  4JI2 L;  1YHA A;  1TWC H;  4GN4 B;  3CPW A;  1K73 C;  2RCN A;  2Z6K A;  1C7Y A;  2Z0S A;  4DUZ Q;  1VQ9 A;  4LF4 L;  2JA7 H;  3PO2 G;  4LFB L;  1PH6 A;  1W2B A;  4JI6 Q;  4BA2 I;  5HY6 A;  1KXL A;  3STB D;  1E22 A;  1ASZ A;  1OTC A;  2OWO A;  1WI5 A;  4YCV A;  2R7D A;  5AJ3 Q;  2UU9 Q;  3GDE A;  1JE5 A;  1X3G A;  3H3V I;  3AFQ A;  3K80 C;  3NEM A;  4BY7 G;  3JC6 6;  4PZ8 A;  1UE6 A;  1Q81 C;  3AQQ A;  3TRZ A;  1B70 B;  2NN6 G;  4QL5 A;  4GNX C;  2VQF L;  1K8G A;  2UXC Q;  3HOX H;  2JA6 G;  1NMG A;  5IWA Q;  1G29 1;  1GD7 A;  4HJ5 A;  1XPR A;  1CUK A;  3GTQ H;  3PUV A;  4H02 A;  1XNQ L;  2R7Z H;  5IYD H;  4JYA L;  4A93 G;  5M5Y H;  4JBJ A;  3CC7 A;  2E5L Q;  5IP7 H;  2ZJP A;  1FGU A;  3GTL H;  4A3G H;  3F8T A;  2GVA A;  3DM3 A;  4P71 A;  1Y1W H;  4DR7 Q;  1IYJ B;  4A3E G;  3TEH B;  2XGT A;  4R4C A;  5M3F G;  2D62 A;  1I5F A;  4YHH Q;  1JJC B;  2NZH A;  4BBR G;  1WJJ A;  1O7I A;  4JOI A;  2VY3 A;  3BZK A;  3ZJY C;  4OO1 G;  1SR3 A;  4LF9 Q;  2YTX A;  3SGI A;  3I4M G;  4A3D G;  4X65 L;  1A0I A;  4HIM A;  4A3I H;  4LF4 Q;  1XNR L;  2MFI A;  4DPG A;  2R93 H;  1UE5 A;  4DR3 L;  4LFB Q;  4B3S L;  3KF8 B;  3TS2 A;  3CCR A;  3ULJ A;  2JJQ A;  1PH3 A;  2ZJQ A;  5M5W H;  5M3M G;  1QUQ A;  4LUV A;  4QQB X;  3BU2 A;  2KCM A;  2N49 A;  4A4I A;  5C0X G;  2ZTC A;  2UUC Q;  2PMZ E;  2CCZ A;  1BVS A;  3PSI A;  2BH2 A;  4OON A;  4JI3 L;  2K75 A;  1VCI A;  2PNH A;  4AH6 A;  4A3M H;  1YHB A;  1VQP A;  1CKN A;  4GS3 A;  1Y1V H;  5M5X H;  1HNZ L;  1EQQ A;  4DV5 L;  1KHI A;  1L1O C;  3A5Z B;  3FKI H;  4YWL A;  2UUA L;  3PO3 H;  3J81 j;  4KHP L;  4BY1 H;  2NVT H;  4AIM A;  4FDB A;  1S3O A;  2WAQ E;  1H95 A;  5EAY A;  1FJG L;  3CCS A;  1KRT A;  1SFO H;  1A62 A;  1EQR A;  1X55 A;  4IPH A;  4ALP A;  4IFD I;  3WWV A;  3CCE A;  3RNU A;  3UE0 A;  4GKJ Q;  2CWA A;  3G4S A;  5LMU L;  2OQ0 A;  3RLO A;  4DR5 Q;  1IBM L;  3I4N G;  4BBS H;  4DV3 Q;  4JCV E;  1VQF A;  3M4P A;  3H0G G;  1N34 L;  4B3T L;  3ERS X;  3CCV A;  2JA8 G;  4DR1 Q;  3UDX A;  2QEX A;  3A0J A;  2QA4 A;  1JJ2 A;  1QVC A;  3CW2 C;  1HZB A;  3J81 c;  1EOV A;  2GN5 A;  4JI7 L;  4LFA L;  1MIU A;  3OTO Q;  3PF4 A;  5K36 G;  1TWA H;  2L15 A;  1PVO A;  2MO0 A;  4R4O A;  4DR6 Q;  1Q1B A;  3KOJ A;  3PUX A;  3PO2 H;  1M90 C;  3M4O H;  3PUW A;  1UEB A;  4LUZ A;  3RN2 A;  1PH2 A;  4JBK A;  4LF5 Q;  1E1T A;  2VQE L;  1OXS C;  3HKZ E;  2KHI A;  3GTO H;  1Q8K A;  3J7A 5;  5IYB G;  3CCM A;  4BY7 H;  1K3R A;  4YY3 Q;  4DV5 Q;  1TXY A;  3F2D A;  5H1S E;  2I5H A;  2ES2 A;  4UP8 A;  2F3I A;  1IBL L;  4JG2 A;  2AWN A;  4KHP Q;  3NEL A;  1HJP A;  2FXQ A;  2JA6 H;  1NY4 A;  1EYG A;  2VUM G;  4AQY Q;  4X64 Q;  4GOP A;  1RL2 A;  2ZM6 Q;  4A93 H;  3CCQ A;  1I50 H;  1VQH A;  1Y14 B;  4DV1 L;  3CP0 A;  4GKK L;  2JEA I;  2YV5 A;  3OW2 A;  4A3K G;  5LMU Q;  2CFM A;  2N8N A;  1QUQ B;  4A3E H;  1IBM Q;  3MEF A;  4PMW A;  1UWV A;  1KQS A;  2E2H H;  2E2I H;  2ZJR A;  5M3F H;  4A3L G;  2PQA A;  1I3Q H;  4BBR H;  4KHZ A;  2WAQ G;  4OWW B;  2IT1 A;  1HR0 L;  2XTI A;  2YTV A;  3U4V A;  3W1B A;  1YJ9 A;  1VQ5 A;  2K5N A;  1IBK L;  4A3D H;  4DKA C;  2CQO A;  5IP9 G;  4L5Q A;  1QZG A;  2E8G A;  4NXM L;  1QVG A;  1N32 Q;  2VQE Q;  1B7Y B;  3MXN B;  3KLW A;  4X62 L;  5GRO A;  3M9B A;  1MKH A;  4A3F G;  1K8A C;  1I94 L;  2VW9 A;  3H15 A;  4A3J G;  3PF5 A;  1JB7 A;  2A8V A;  2D0O A;  4JI8 L;  2RHQ B;  4LW1 A;  3T1H L;  1XMO Q;  1HZA A;  3CF5 A;  1CKO A;  5FLX c;  2C35 B;  4IO9 A;  1PA6 A;  4DV2 L;  2LXK A;  2WB1 E;  1UE1 A;  5LMN L;  1WYD A;  2OCE A;  3S1N H;  1YIJ A;  3CC2 A;  3HKZ G;  1SRO A;  1FVI A;  3PUY A;  4QJF A;  4NPS A;  4POF A;  1EIF A;  3E0E A;  3AEV A;  4QIW E;  4GKK Q;  1VQN A;  4IFD J;  1PH8 A;  5JJK A;  2UXB Q;  3J80 i;  2WFW A;  3CXC A;  2HHH Q;  2I5L X;  4B3M Q;  3EN2 A;  4P72 A;  4DV7 Q;  1TWG H;  4JI0 Q;  5JEA J;  1VQM A;  1TWF H;  3VDY A;  1VQC A;  2R6G A;  1X65 A;  4RG1 A;  3M85 A;  1HR0 W;  1OXV A;  3I55 A;  2YTY A;  1Q46 A;  1X54 A;  3M7N A;  1X3E A;  1IL2 A;  3EBE A;  3JAM c;  1IBK Q;  4OWT B;  2JEB I;  3I4N H;  4GLV B;  1EIY B;  4IOA A;  5C4X G;  1D7Q A;  1PYB A;  3H0G H;  1HNW L;  2JA8 H;  1S40 A;  1TWH H;  3RZD H;  1YJN A;  1R9T H;  3U58 A;  4L5S A;  2BH8 A;  3CCJ A;  4JI2 Q;  2KHJ A;  2R7F A;  4DUY L;  1W3S A;  2DGY A;  1I94 Q;  5HGQ A;  1V1Q A;  4UP7 A;  4JI8 Q;  3K81 C;  4LFC L;  1GO3 E;  3TQY A;  3S2D H;  1X3F A;  4GLA C;  4EX5 A;  3RR5 A;  4LF7 L;  2A19 A;  2N78 A;  4GN5 A;  2DUD A;  1VQG A;  3K7U C;  5GAD C;  1BBU A;  4MTN A;  4ME3 A;  4LF6 L;  5IYB H;  1SE8 A;  2VNU D;  2VQF Q;  2K4K A;  1A63 A;  2Q2H A;  2NN6 I;  1PHJ A;  4KLK A;  3CAM A;  1XNQ Q;  4A3C G;  1XMQ L;  2VUM H;  4JYA Q;  2UXB L;  4WJ3 M;  4P75 A;  2WB1 G;  1XTD A;  4IOC A;  3RN5 A;  3HOY G;  3HOW G;  3FHW A;  3HOZ G;  1L2F A;  1XJV A;  1SN8 A;  4HJ8 A;  2KEN A;  2LSS A;  2EXD A;  1YHQ A;  1E24 A;  4A3K H;  5IE8 A;  4WJ4 A;  1KAW A;  1YBY A;  3PIP A;  4L5T A;  1G51 A;  4A3L H;  4DV6 L;  1HNW Q;  1V43 A;  2HIX A;  5IT9 c;  4BXX G;  2BA0 A;  1NTG A;  1QZH A;  4OO1 I;  4X65 Q;  5C3E H;  1YJW A;  3EIV A;  5DLQ E;  4DUY Q;  1XNR Q;  4C3H H;  4HIK A;  4GNX A;  4DR3 Q;  1LUZ A;  4B3S Q;  2B63 G;  5IP9 H;  4LFC Q;  4JI1 L;  3G6E A;  1VQD A;  3A5U A;  1OXU A;  1UE7 A;  4AYB E;  1GVP A;  3CPF A;  4HJ9 A;  2RF4 A;  5IYD G;  1KIX A;  4A3F H;  3W5O A;  4LNQ A;  3CQZ H;  2RHS B;  4LF6 Q;  4A3J H;  3RLF A;  4JBM A;  4LUO A;  5C0X I;  4C3J H;  1KC8 C;  2KCT A;  3D31 A;  4B3R L;  2IX1 A;  3ER0 A;  2R92 G;  2Z6K C;  4JV5 L;  2AWO A;  2I5M X;  3TS0 A;  1Y1W G;  3CMA A;  5J3B A;  1Q1E A;  4JBW A;  1HZC A;  2K5V A;  4IJL A;  4JI3 Q;  4OX9 L;  3F2B A;  3FP9 A;  2UXD L;  2N3S A;  1PFS A;  1BKB A;  1N9W A;  5ELN A;  5BR8 L;  1KD1 C;  1HNZ Q;  1B8A A;  2MQH A;  2NZO A;  2Q2I A;  1VQ8 A;  3S17 H;  3CCL A;  2UUA Q;  4Y52 H;  1C9O A;  1P8L A;  4K0K L;  2NVQ H;  3S16 H;  3S15 H;  1AH9 A;  1U5K A;  1LM0 A;  1NMF A;  1FJG Q;  2HIV A;  4DR2 L;  3UE1 A;  4DV6 Q;  4X66 L;  2OTL A;  1LTL A;  4JI5 L;  5FJ8 G;  1MJC A;  2JQO A;  5IY0 A;  2BA1 A;  5GAH C;  4PG3 A;  2IX0 A;  4DK6 C;  4Y7N H;  1N34 Q;  4B3T Q;  3STB C;  5C4X H;  4A75 A;  1Q7Y C;  1YZ6 A;  5JJI A;  4R4I A;  4JI1 Q;  2F4V L;  4JI6 L;  4JI7 Q;  4LFA Q;  4QGU A;  2PI2 A;  2CWP A;  5IYC G;  2JA5 G;  2K50 A;  1RIP A;  4DAY B;  3GO5 A;  5GAG C;  3I4M H;  4NB3 A;  4JOI C;  1L1O A;  4P73 A;  2MNA A;  2ZTD A;  1KL9 A;  3J81 i;  3GTG H;  1CKN B;  1NJI C;  1P16 A;  4B3R Q;  1Q82 C;  3PO3 G;  2VZA A;  3LGJ A;  2PI2 E;  3L0O A;  5GQO A;  5M3M H;  3KJP A;  1ASY A;  2UXC L;  3K0X A;  3M4Q A;  4OX9 Q;  1VQ6 A;  3HOV G;  1VQO A;  1IZ6 A;  1CKM A;  2UXD Q;  4RMF A;  4HJ7 A;  5BR8 Q;  1M1K C;  4TQU S;  1VQ7 A;  4A3B G;  3NEN A;  1SLJ A;  5C44 G;  1PH9 A;  3A74 A;  2K5H A;  4AYB G;  1PH4 A;  1YNX A;  1IBL Q;  4K0K Q;  4DR7 L;  4QY7 A;  3ULL A;  2ATW A;  1CSQ A;  4P74 A;  4JC0 A;  4GLX A;  4A3C H;  4O2D A;  1VQA A;  1WCM G;  3E9I A;  4DNI A;  4DV1 Q;  2QGQ A;  3KDF A;  4TVA B;  4X66 Q;  1EUJ A;  3HOY H;  3HOW H;  1N33 L;  3HOZ H;  4R4T A;  2Q2U A;  4HJA A;  4LF9 L;  5FLM G;  4MNO A;  3K8A A;  3DLL A;  4OXP A;  1HNX L;  4XTC S;  5C4J H;  2F4V Q;  1E3P A;  2HQL A;  1E1O A;  1AE3 A;  1HR0 Q;  4XIG S;  1I6H H;  4POG A;  1VQK A;  4A76 A;  4BXX H;  2H5X A;  2OTJ A;  3HKS A;  3F1Z A;  1YIT A;  5ELO A;  4YWK A;  5C0X J;  3S14 H;  4NXM Q;  3I2Z A;  1GKH A;  2UUC L;  2B63 H;  4HIO A;  3S2H H;  4X62 Q;  1DGS A;  3S1Q H;  3L2P A;  4DV4 L;  2GVB A;  4R4Q A;  1YEZ A;  3UDG A;  2HT1 A;  1OXX K;  3S1M H;  2UUB L;  3T1H Q;  4LF8 L;  4GOP B;  1U0L A;  4R1J A;  1WFQ A;  4DV2 Q;  1X9N A;  1PH5 A;  3KJO A;  3I7F A;  4JI4 L;  2R92 H;  1JT8 A;  4YCW A;  1J6Q A;  1QVF A;  2NVX H;  3UDF A;  1FL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...