3ERSX

Crystal structure of e. coli trbp111
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
METVAYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGQKTLQTVTSLVPYYSEEELMGKTVVVLCNLQKAKMRGETSECMLLCAETDDGSESVLLTPERMMPAGVRVVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA-binding protein ygjH
publication title Crystal structure of Trbp111: a tructure specific tRNA binding protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
total genus 23
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ersX00
5IYCH 1KAWA 3E9IA 4JV5Q 4A93G 4POFA 1A8VA 2PI2E 4HJAA 3VDYA 1G6PA 4JV5L 1HZBA 1X3EA 1GKHA 4HIMA 1XJVA 3SGIA 4JI4L 4KI0A 2WAQE 4IPGA 2ZJPA 3CCEA 4LNQA 2JK8A 2CWAA 4GNXB 3MXNB 1KRSA 4A3IG 4IFDJ 1A63A 3CQZH 4PMWA 4UP8A 1Z9FA 4JI2L 2I5LX 4R4OA 5GAEC 2Q2TA 1MKHA 3KLWA 4QIWE 4R4TA 4DUYQ 5DLQE 4XTCS 4L5SA 3G4SA 1E1TA 2YTYA 1LUZA 1WFQA 4BXXG 4X64Q 1Y1VG 4IPDA 3UDIA 4JI6Q 4L5RC 3TQYA 2VUMH 1K83H 3K8AA 4PZ7A 1UE6A 1VQKA 2QGQA 2F4VQ 4OO1I 4JI6L 1B7YB 4OX9L 2R6GA 1IL2A 1N33Q 2F4VL 4RG1A 4UP7A 3I4MH 3RNUA 1IBML 3S2HH 4QJFA 3G6EA 3MEFA 1N33L 3PO3G 4DR4Q 3K7AH 2UXBQ 2QEXA 5M5YH 5IYBG 4JI5Q 1S3OA 3BJUA 4DR4L 2AHOB 1X3GA 4YY3L 4LF9Q 1BVSA 4POGA 3A74A 2Q2UA 1HNXL 2R7DA 3CCLA 4Y52H 1MIUA 1NTGA 5C44H 1GO3E 1VCIA 2H5XA 2ID0A 3D31A 5GQOA 4DR2Q 4GKKQ 1XMQQ 4DR2L 3GDEA 4GKKL 1VQDA 2NVXH 3PUYA 2A1AA 3CP0A 4DR3Q 2RCNA 1XMQL 1PYSB 1R9TH 4A3JG 2NZOA 4B3MQ 1VQIA 4YCUA 4DR3L 3F2BA 4B3ML 4EQ5A 1P16A 1W2BA 1SRUA 4LF6Q 4DV0Q 1UE7A 1IYJB 1E24A 1V1QA 5C3EH 1VQ7A 4A3EG 3U4ZA 2N3SA 3FHWA 4DV0L 2ES2A 5K36G 3BU2A 4RMFA 4DNIA 1UE1A 3ULLA 1X65A 4JBWA 1PH8A 1XPUA 4LW1A 4P75A 1XPOA 4XIGS 3GTOH 1VQ8A 2N49A 4DAMA 4UP9A 2YU9H 3FP9A 3S24A 4DR1Q 3PIOA 4DV5Q 3I4NH 1JT8A 2UUAQ 1HNWL 2UUBQ 4JC0A 2XTIA 3J81i 2ZTCA 3KDFA 4R4QA 5AJ3Q 4IJLA 4DV5L 4DR1L 1JB7A 1A0IA 3K0XA 2UUAL 3OTOQ 2UUBL 1IZ6A 1KRTA 5AJ3L 3KF6B 4KHPL 3OTOL 4DR5L 3ULJA 2B63H 1E22A 4X62Q 1KL9A 1X56A 1YZ6A 1GVPA 2IT1A 3UDGA 1ASZA 4IFDG 4YWMA 3CXCA 5C3EG 5J3BA 2I5HA 1VQPA 5IP9G 1NE3A 4A3KH 3I4OA 3GTQH 4JCVE 4DV3Q 1BBWA 1FJGL 4C3IH 5IWAL 4B3RL 4IO9A 5H1SE 3I56A 1PA6A 4NXML 2JE6I 4QL5A 4DR7Q 1O7IA 2JA8G 4A3CH 3J80i 2JA7G 4B3TQ 5JJKA 2VNUD 2JJQA 1K8AC 4DR7L 1JE5A 1IBKQ 4B3TL 2CQOA 4A3GG 1N8RC 1Y14B 4AYBG 5C0XJ 3HKZG 3NBHB 3HOVG 2NZHA 1VQJA 1GD7A 2KCTA 4L5QA 2VQEQ 4HIDA 3HOYG 1QVCA 4IPHA 4NPSA 3S15H 4X6AH 2RF4A 4DV2L 4PG3A 4LF7Q 2LSSA 4BBRH 3S17H 5E7NA 4ALPA 4HJ9A 1K0RA 4GNXA 3CPFA 3TREA 1VQMA 2ASBA 3HFZB 2NVQH 3ZJYC 4A3MG 2E8GA 1XNRQ 1VQLA 2AWOA 1V43A 1UE5A 1E1OA 3STBC 3CPWA 1I94L 4LF5Q 4P72A 4GN5A 4A3BH 1Z47A 1YHAA 4IOAA 2JA5H 3GTGH 1HH2P 3H0GH 1SLJA 1M90C 1IXRA 2HQLA 2IHFA 4GLVB 1PVOA 3BZKA 1VQAA 5FJ8H 3RLNA 3KJPA 1L1OC 4OWWB 4JI4Q 1D7QA 3Q8DA 3CCVA 4DKAC 2E2JH 3PSIA 2N78A 1OXUA 4DV4L 2R92H 2OWOA 4QY7A 1HJPA 3W1BA 3T1YL 4UY8C 1C9OA 2CWPA 4X66L 4OONA 2ZM6L 1X6OA 1WCMG 4JI2Q 3HOUH 1P8LA 1SR3A 4P73A 2YTXA 2E5LQ 3DM3A 4YWLA 2HHHL 3H3VI 3PF4A 1JMCA 2AMCB 5IP7G 2E5LL 1J6QA 4R4IA 1PH3A 3UDFA 2E2HH 5IYDH 1TWAH 3PUZA 4YHHQ 2R7ZG 1VQHA 4YCWA 4C3HH 4DK3C 2RHQB 1C7YA 3ER0A 4YHHL 4A3BG 4OX9Q 4LFCQ 3CC4A 4OXPA 1S72A 3CCQA 4R1JA 1K3RA 1U0LA 2D0PA 1PH7A 1PH5A 3S16H 4LFCL 4QQBX 2OCEA 1IBMQ 5GROA 5IYCG 3J81j 5LMNW 1PV4A 4LUOA 3IRBA 2UUCQ 3F2DA 4P74A 1CUKA 2HT1A 4BA2I 5C4XH 1A62A 3UE1A 5GAHC 1YITA 4BY7H 2UUCL 3EBEA 4LUVA 4YY3Q 2Z0SA 4MNOA 4MZ9A 4PZ6A 3F8TA 3I55A 3HKZE 1HNXQ 3L0OA 5LMUQ 4WJ3M 1YJWA 3PUVA 4ME3A 2JA6H 1L1OB 5LMUL 3CC2A 1XTDA 3S1RH 2R7FA 1EFWA 2HIXA 2ATWA 4A3LH 2KCMA 2MQHA 2B3GA 4MTNA 4YWKA 2XGTA 3ERSX 1XMOL 1K9MC 2K4KA 3RLFA 1Y1WH 4TQUS 1N32L 2MO1A 1VQ6A 3GTLH 2VUMG 1N36Q 3K7UC 3KF6A 3PUWA 1N36L 3HOWH 4WJ4A 5IE8A 1Q8KA 1VQBA 4GOPC 1VQ9A 1TWGH 2I0QA 1K73C 3I4MG 1RL2A 1HZ9A 2K52A 1U5KA 3S1MH 4LF4Q 4BY1H 2OQKA 4DV1L 3E9HA 1FGUA 1SN8A 1B8AA 3M9BA 4DPGA 1SFOH 2PQAB 1X9NA 2AWNA 4LF4L 1SE8A 4DV7Q 4JI3Q 1NMFA 1SROA 3STBD 3CCJA 3HOZH 5C44G 1HNWQ 1L2FA 4DV7L 4JI3L 2VZAA 4GLAC 4DV6L 2JEBI 3M4OH 4A3LG 2LXJA 4GOPA 1C0AA 1CSPA 3PO2H 2VL6A 1E3PA 5M3FH 1CKNB 1OXXK 4BBSH 1YI2A 1Q1EA 4JYAL 4DR5Q 2K5NA 2I5MX 1NBWA 3GD7A 4AH6A 4HJ7A 4KHPQ 4HJ5A 3BZCA 1PYBA 4IFDI 5ELOA 3CCRA 5FLMH 1EIYB 3S1QH 4JI1L 3U4VA 1JJGA 1EUJA 4J15A 1HNZL 3GTKH 1VQNA 4GLXA 4NB3A 1ASYA 1FJGQ 3KFUA 1CKMA 5IWAQ 4B3RQ 1H95A 2UXCQ 1YIJA 1N9WA 1NMGA 3EIVA 4NXMQ 3PIPA 2PNHA 3ULPA 2GVBA 4BY1G 4JOIC 4P71A 2JQOA 5M3MH 2R93H 4H02A 1MJEA 1WYDA 4GOPB 1VQOA 3U58A 2K14A 5ELNA 2IX1A 2ZTDA 1UWVA 2BH8A 3I4NG 1YJ9A 3S2DH 4A3DH 1G291 3FKIH 2IHEA 3E0EA 2OTJA 2IX0A 2YV5A 3M7NA 3AQQA 1N34L 2MFIA 2QA4A 1DGSA 2Y0SG 4DV2Q 1D8LA 5JJLA 4YCVA 3AFQA 2B63G 4L5TA 3HOXH 4KHZA 1OXTA 4LUZA 3H15A 3CCUA 4K0KQ 1I3QH 2KHIA 1HZAA 4IJHA 4A3KG 4O0AA 4C2MH 3JC66 4A3FH 4K0KL 4AIMA 1I94Q 5LMNQ 3JAMc 3D0FA 4NXNQ 1I5FA 1KC8C 1KD1C 1YNXA 4A93H 4GN4B 5LMNL 3NELA 4A3CG 4NXNL 1PH2A 1NY4A 1TWHH 4HJ8A 1SMXA 3TEHB 2BA1A 3TS0A 3KOJA 1QUQB 4B3SL 3DLLA 2BH2A 5BR8Q 1B70B 3CF5A 1UEBA 4DV4Q 2DGYA 4A3IH 5BR8L 2LXKA 1TWFH 3S1NH 1XPRA 3NENA 2B29A 3KJOA 3T1YQ 5JEAJ 1RIPA 1MJCA 3W1GA 4X66Q 2ZM6Q 4LF8Q 1QVFA 5IY0A 1KQSA 2HHHQ 1EIFA 1M1KC 3K81C 5GADC 3H3VH 4LF8L 1XNQQ 3TS2A 2YYZA 1Q82C 4BXXH 3A5ZB 1T9HA 4BBRG 3T1HL 4DK6C 1XNQL 2JEAI 1Y1VH 3G48A 1L1OA 4TVAB 1X3FA 3M4QA 1X54A 3M85A 1FVIA 2NVYH 1Q12A 4KLKA 4DAYB 3RN5A 3PO3H 2Z6KC 2JA5G 1V9PA 4APVA 2Q2HA 1PFSA 1YBYA 3H0GG 5IYBH 3GO5A 1LTLA 1VQEA 4A4IA 3GTPH 5FJ8G 3UDXA 1YHBA 3OW2A 1CSQA 3CD6A 5JJIA 2OQ0A 4EX5A 1GM5A 4AYBE 2VW9A 2WB1G 3PGZA 3CMEA 2R92G 3M3YH 1HR0Q 4DR6Q 2VY3A 2L15A 1HR0L 4DR6L 1KIXA 3HOUG 2Y0SE 2Z6KA 1WJJA 4DUYL 2PQAA 4UPAA 2EQSA 3LGJA 3RR5A 5C0XI 4OWTB 5M5XH 4A3JH 1QZGA 1QZHA 1VQ4A 2KHJA 1BBUA 1XMOQ 1CKOA 1YVCA 2K75A 4X64L 5C0XG 5IYDG 1NJIC 1N32Q 3OYYA 1I50H 1KXLA 2IY5B 3HKSA 4OO1G 4O2DA 3K80C 1CKNA 4FDBA 4A3EH 2D62A 5GAGC 1VS0A 2KBNA 2PMZE 1PH9A 2C35B 2WFWA 4JBMA 1L0WA 2UXBL 2HIVA 4JI0Q 1KHIA 2GN5A 4JI5L 4Y7NH 5C4JH 4R4CA 4DV1Q 4BY7G 5C4XG 4LF9L 4A75A 4JI0L 2A19A 3S14H 4X65Q 1S40A 2EIFA 1PH6A 1BKBA 1OXSC 5HGQA 5M5WH 4X65L 3L7ZC 3PCOB 5IT9c 3F2CA 4DV6Q 4LFBQ 1JJ2A 4LWCA 2JA6G 4LFBL 3AYHB 1J5EQ 3ICEA 1YEZA 4JYAQ 1HZCA 2EXDA 1HR0W 3KF8B 1Q86C 1J5EL 1Q1BA 2ZJRA 1PH4A 2ZTEA 1Y1WG 1G51A 4JI1Q 5JEAG 1TXYA 5IP9H 4LF6L 4GN3B 4BA1I 2DUDA 1HNZQ 1VQGA 3PV0A 5EAYA 2MNAA 3F1ZA 3HOWG 1AE3A 3I7FA 3AFPA 2JA8H 3NEMA 5HY6A 2JA7H 2V1CC 4JBKA 2CKZB 1OXVA 1EQRA 1LYLA 1EYGA 1Q81C 4A3GH 1EWIA 3JAMi 4IOCA 2WB1E 2ALYB 3G71A 2WAQG 1VQCA 3GTMH 3HOVH 1WI5A 2YTVA 1Q46A 4DUZQ 1YJNA 1LM0A 4IPCA 2K50A 3HOYH 2K5HA 3HOZG 3CCMA 4A76A 3RLOA 1FL0A 1AE2A 4DUZL 2NVTH 2FXQA 1TWCH 3AEVA 3PO2G 5M3FG 1N34Q 1QUQA 1VQFA 3RZOH 1WOCA 2RHSB 4JBJA 1YHQA 4JI7Q 3TRZA 4X62L 4BBSG 2VS1A 1PH1A 4JI7L 4JOIA 1VQ5A 2AKWB 3KYHC 4AQYQ 5FLMG 1JJCB 3EN2A 4AQYL 4A3MH 2BA0A 4DV3L 4HIOA 1Q7YC 2GVAA 3J7ZC 3A5UA 2UXDQ 4HIKA 1X55A 2CCZA 2UXCL 2K5VA 3KDFB 2UXDL 3L2PA 3RN2A 3J81c 3UE0A 3U50C 4LFAQ 4GNXC 3PF5A 1IBKL 5M3MG 3I2ZA 4QGUA 2E2IH 4B3SQ 4GKJQ 3RZDH 2R93G 4LFAL 3J7A5 2CFMA 3M4PA 2ZJQA 2UU9Q 4GKJL 1AH9A 1EOVA 4JG2A 2F3IA 3CCSA 1IBLQ 4A3DG 5FLXc 2PI2A 2UU9L 2KENA 3CW2C 2VQEL 2Q2IA 3FKIG 1WCMH 3B6YA 1IBLL 2WP8J 3PUXA 4LF7L 2N8NA 3CAMA 4JI8Q 3WWVA 5IP7H 3GTJH 3CMAA 2F52A 1PHJA 4JI8L 2VQFQ 3T1HQ 4PZ8A 3HOXG 2JA9A 2D0OA 2R7ZH 1QVGA 2A8VA 2NN6I 3J80c 2VQFL 1I6HH 1EQQA 4OWXB 3CC7A 2MO0A 2OTLA 4C3JH 2NN6G 4GS3A 1K8GA 1XNRL 4A3FG 1E7ZA 4LF5L 3A0JA 1W3SA 3W5OA 1OTCA
chains in the Genus database with same CATH superfamily
1U4MA 4RHRA 3E9IA 4EGVA 2G5DA 2PI2E 1VMCA 3VDYA 2QW7A 4HIMA 1LTTD 1U4RA 1BUVT 4IPGA 2IL8A 2CWAA 1WD1A 1CA6A 1F9QA 2K5QA 4R4OA 4LMQD 1ZKOA 3UI2A 2Q2TA 1WTVA 4DK1A 4QIWE 4QIWB 2Z9HA 3G4SA 4JK1C 4IN3A 3K5NA 1Y1VG 2B63B 2L4NA 4L5RC 3TQYA 1K83H 3ND9A 2QGQA 1F9SA 3S9WA 4OX9L 2NTTA 3S2HH 4RCNA 1H9MA 2J7ZA 3CKIB 2QEXA 5A35A 5E4WC 3RMHA 3H94A 3TMEA 3BJUA 5M9OA 4JI5Q 4RGOS 4YY3L 1SAPA 1S5CD 1ENAA 2R7DA 3CCLA 1UEAB 2H5XA 3AB9A 3V2TA 2L55A 4RAUC 1MGSA 5FLXE 4DR3Q 5D3DA 4A3JG 4C1NK 2I46A 4DR3L 4PNYA 4EQ5A 2PCFB 5FKAC 1SRUA 1M4VA 1TVXA 1DD2A 2NVQB 5K36G 2NB0A 2N3SA 4IUNA 3BU2A 4KKSA 2M00A 4RMFA 1AP0A 1II3A 1X65A 1H9SB 4JBWA 1TWHB 1STNA 1XTCD 1MSGA 3GTGB 1G8ZD 2RSNA 3S24A 5IIFA 3PIOA 4P2CB 1JT8A 4HN7A 1VF5C 2XTIA 3J81i 5AJ3Q 2XN9C 2R92B 2F0UA 5AJ3L 2B2UC 1EOTA 3H91A 3A8JE 4LK1C 2IT1A 5AFWA 3UDGA 2FJ2A 4YWMA 1LT4D 2FMMA 1VQPA 2C9OA 2D9UA 1JORA 2RBMA 3D4RA 1TWAB 4DV3Q 1SE2A 4C3IH 5IWAL 4H13C 4IO9A 5H1SE 3C3LA 2UXCQ 3SR1A 1O7IA 4A3CH 3J80i 2JJQA 2KA7A 1IBKQ 3P7JA 4XT3B 1I4RA 1A3TA 1B50A 3D4WA 3VR2A 5EPJA 2KCTA 4HIDA 3S15H 4X3UA 2JA6B 5G3LD 2ZXPA 2LSSA 4TRDA 5FO9B 1SMYD 4GNXA 3CPFA 2F0FA 3TREA 5C4HA 2R61A 1JB3A 1I94L 3STBC 1Z47A 3VA7A 4WFN3 3H0GH 1M90C 4DU9A 1TWGB 3BZKA 1AZQA 4PQXA 1VQAA 3RLNA 4ZLTF 4L8JA 4JI4Q 1D7QA 2E2JH 3S1MB 1IYVA 1L0YB 1OXUA 2OWOA 1HJPA 4UY8C 1BF4A 4X66L 2JN4A 2K32A 1WCMG 4JI2Q 1SR3A 2YTXA 4YWLA 3H3VI 1I4HA 5IP7G 3NUCA 5J22A 1EY5A 4JPBW 4DK3C 3C2PA 1T5EA 1I4XA 1HPCA 4LFCQ 2A74C 4OXPA 5EQ0A 1S72A 2RDGA 1PH5A 4LFCL 2QDLA 4U68A 4B9XA 3IRBA 4P74A 1CUKA 2PNRC 2HT1A 1TT2A 1QOHA 2FFKB 1G2TA 2Z0SA 4MNOA 2F0VA 3F8TA 3HKZE 1HNXQ 5JVG3 2R93B 3HKZB 3L0OA 1CT1D 1ENFA 5LMUQ 3HEJA 1D6EC 1L1OB 4FXKC 5LMUL 3CC2A 4A3LH 4OEMB 2R7FA 1EFWA 2HIXA 3R93A 5IGFA 2MQHA 4LAAA 2Z6BA 2EY2A 2RA4A 3SK6A 3O13A 1Y1WH 3GTLH 2VUMG 1D2BA 3K7UC 2B8FA 3HOWH 5EPKA 4WJ4A 5C5LA 1VQ9A 1K73C 5IGEA 1HZ9A 2K52A 1LLRD 2KUMA 1KDCA 3EA6A 2EXZA 2KCNA 3E3XA 2QILA 4MN3A 3M9BA 3DXJC 1SFOH 1FD7D 4JI3Q 1HFNA 3CCJA 1L2FA 1TY2A 4DXGA 4JI3L 4C1NI 4A3LG 3PO2H 2VL6A 3BDCA 5M3FH 4A3IB 3U9OA 1TWFB 1OXXK 4BBSH 5KYLA 4HJ7A 1PZKD 1LTRD 3BZCA 4KK7A 1PYBA 4IFDI 5ELOA 1PYWD 3QG1A 4IUUA 1BNZA 1NR2A 4KD3A 3WOFA 1SYDA 1ASYA 3OPOA 4XDXA 3KFUA 1H95A 1N9WA 3NP8A 1NMGA 3PIPA 2PNHA 2LMCB 3PO3B 1WYDA 1VQOA 3U58A 4J6HA 3SK5A 2ZTDA 5I6WA 3GTPB 2BH8A 3GQBA 4DN4M 3M7NA 3AQQA 1DGSA 5IODA 1D8LA 1H9JA 2B63G 2QKIC 1OXTA 1ZYRD 4LUZA 3EFXD 4IJHA 1HZAA 4C2MH 1I6VC 3D3RA 4A3FH 1I50B 4O1NA 4WORA 3MXGA 1Q8IA 4A93H 2H4OA 2V4DA 3WOEA 1EY7A 1TWHH 4KJNA 1SMXA 5M5YB 2BA1A 3TS0A 4B3SL 4DAYA 2BH2A 1XXGA 3CF5A 3KBGA 3TSSA 2WKCA 2DGYA 3NTKA 3S14B 3A7AB 2B29A 3G7LA 5IY0A 1M1KC 1S5BD 4G7ZC 2MGSA 2YYZA 4BXXH 3T1HL 1KNAA 1DJRD 1B3AA 2K5WA 4Z9CB 1WTWA 2XNAC 1RF2D 4NMZA 2G9HD 1VMPA 1I4GA 1FVIA 5KNDA 2ICEC 2H1EA 2Q2HA 5CV5A 4KN4C 3UDXA 4F8MA 3OW2A 5HURA 1X3PA 5JJIA 2JYOA 3CMEA 2R92G 3TZDA 1TKWB 2BDNA 2VB2X 2KCCA 1KIXA 2Y0SE 2FHTA 3IL8A 2Z6KA 3FPUB 2EQSA 5C0XI 1QZGA 1SJED 2KHJA 5FK9C 1CKOA 4X64L 1IW7D 5C0XG 5IYDG 3OYYA 1CQFA 4OO1G 3D4DA 2PO4A 3A8KE 1IHZA 1VS0A 4A3MB 2HDLA 2KBNA 4FF3A 4HMJA 1FGBD 4OHJA 2C35B 1SE4A 5I9PA 2HIVA 4JI0Q 5C4JH 1J9OA 4ZCKA 4R4CA 2IX3A 1LTID 4JI0L 1SYFA 2A19A 4X65Q 1S40A 1PH6A 4K5XA 3RZDB 5CBAE 4X65L 1GHJA 3PCOB 5IT9c 3F2CA 4LFBQ 5A2QE 1C48A 2JA6G 4LFBL 1Y8OB 3AYHB 3K58A 5ISRA 4JYAQ 2CHBD 1HR0W 2EXDA 3MXUA 2KHSA 3PMFA 1Q86C 5E3FA 4BBRB 1D1KA 2X69A 1G51A 4JI1Q 5JEAG 1TXYA 4LF6L 3T13A 5EPLA 4RWSC 3I70A 1HNZQ 4HR7B 3PV0A 5EAYA 2MNAA 2HUGA 2RKSA 4A3BB 2E76C 4XYQA 4C3JB 2QF7A 3AFPA 2JA8H 2CW0C 4JBKA 1WD0A 1DXMA 4WJWA 2WV6D 3JAMi 3NHHA 3G71A 2ALYB 3GTMH 4CHTB 1GUTA 2YTVA 3HOYH 5EKKA 2K50A 3HOZG 1ICWA 3CCMA 1IW7C 2IWHA 3NBIA 3DEOA 3AEVA 1N34Q 1VQFA 3RZOH 5L37A 3VR4A 5CGKA 3KYHC 1M8AA 4OIKA 1A3UA 1I4PA 3V96A 4CDDC 4HIOA 1K83B 2EYJA 3A5UA 3D6WA 4WRDA 4YIJA 1K3BC 2EE1A 1JWMD 3PF5A 3I2ZA 2R93G 4GKJQ 2CFMA 4HCSA 4GKJL 1EOVA 2K5DA 1IBLQ 4IUVA 5FLXc 2KENA 3CW2C 3SHLA 2VQEL 3OMGA 1IBLL 3L3OC 2WP8J 3R8BA 3S1RB 3NWSA 1EQVA 1RJTA 2AUKA 3GTJH 2F52A 4PZ8A 4R8IA 3Q22A 4Q0FA 1EQQA 1A6XA 4K14A 2OTLA 1XNRL 5TSSA 1E7ZA 1KAWA 2EZVA 3FPPA 4JV5Q 4POFA 4KKTA 4BS9A 2B2VA 1A8VA 4IUPA 1CK1A 3KBXA 4JV5L 1HZBA 2Q8TA 4NW2A 4BY1B 1GKHA 4ID6A 2WAQE 2A69C 3CCEA 2JK8A 4GNXB 4A3IG 1A63A 2F3VA 3KLWA 2GA4B 4R4TA 5DLQE 4XTCS 1AEXA 1SXTA 2YTYA 1LUZA 1WFQA 4FNFA 1WTQA 4IPDA 3QR8A 2KECA 4G57A 2F0NA 3K8AA 1UE6A 1B7YB 3NQIA 2R6GA 4IALA 1N33Q 1ZXTA 4RG1A 3KF8A 3RNUA 3G6EA 1N33L 3PO3G 4C3IB 4DR4Q 3K7AH 2UXBQ 4KN7C 5M5YH 5IYBG 1S3OA 4DR4L 2O4XA 2BE5C 4Y52H 1EWCA 5C44H 1GO3E 2ID0A 4DR2Q 1B53A 3EQLC 1RDPD 4DR2L 1B9NA 5ELCA 1KLUD 2NVXH 4MIUA 3NPPA 2C5CA 1R9TH 2NZOA 1P16A 1U4LA 3QO2A 1EZ8A 4DV0Q 1UE7A 1V1QA 1PFMA 5IT9L 1TS2A 4DV0L 2ES2A 1PLFA 3OIQA 3K0YA 2B2WC 3QOLA 1Y69U 3MFGA 1VQ8A 2N49A 3H0GB 4HTHA 3NWTA 2YU9H 4DV5Q 1HA5A 3DM1A 2UUBQ 4JC0A 2E2JB 2ZTCA 2K7VA 4R4QA 4DV5L 1JB7A 2UUBL 3OTOQ 3OTOL 2PW7A 4DR5L 3ULJA 4CBVA 1GXDC 5J3BA 4DFAA 4JCVE 2BOSA 1FJGL 4K2LA 3GV6A 3I56A 4NXML 2JE6I 4QL5A 4QUCA 2JA7G 4B3TQ 1E2VA 4B3TL 1N8RC 1Y14B 2B2TA 3A7LA 4RKBA 2M2LA 2KJXA 1HXYD 1GD7A 5ELFA 5FO8B 1IYUA 4ULLA 1BQQT 4X6AH 3JAML 4LF7Q 4BBRH 4ALPA 1JQYD 4CJ1B 2ASBA 1DYQA 2OEOA 3BVMA 3ZJYC 5FLXL 1Y1WB 4A3MG 3GTLB 2AWOA 1VDZA 1V43A 4A3BH 3NXWA 3X3MA 1YHAA 3LX0A 2JA5H 3HOWB 3R2TA 1HH2P 3IKJA 1SLJA 1EEFD 1IXRA 2HQLA 2IHFA 1PVOA 3M7GA 1SNCA 5FJ8H 4TSSA 3CCVA 1V1OA 2E2DC 1PZID 4KTAA 1SFOB 3SK4A 3R2IA 4OONA 1LTGD 3HOUH 1P8LA 5LL6X 2E5LQ 5KEEA 3PF4A 3PO2B 2AMCB 5M3FB 2E5LL 4BBSB 2F3WA 2E2HH 2F0SA 3DMUA 2R7ZG 4C3HH 2RHQB 4CKBA 4ZK9B 4N9TA 4A3BG 4OX9Q 4C3JG 2F0HA 3CC4A 3S16H 4R1JA 1K3RA 4KY5A 1STYA 2OCEA 2IW3A 5GROA 3J81j 5LMNW 2UUCQ 3LWUA 1R4QB 5C4XH 1A62A 1YITA 1T5XD 2UUCL 4LUVA 4N8FA 4YY3Q 4A3GB 5I9OA 3I55A 1JE4A 3HOVB 2ICIA 4X3SA 1YJWA 3H3VC 2J0TD 3LNNA 1STEA 3S1RH 1CTMA 3PIO3 2PZTA 1XMOL 3HZXA 1GUNA 1STAA 4TQUS 1N32L 1VQ6A 3KF6A 3PUWA 1Q8KA 3URYA 4C2MB 4ZYSA 4A3FB 4CDCC 1FR3A 1WTHA 3MC0B 1U5KA 1BCPF 4A93B 4BY1H 2OQKA 1KLGD 2E2IB 4DNTB 1X9NA 1NMFA 3STBD 5C5MA 2JXMB 2LXJA 4GOPA 2ZXOA 1CZGA 5KGUA 2LFNA 5JPNC 4UDUC 2K5NA 2A6HC 1NBWA 4AH6A 4CJ0B 2B2WA 2K6AA 3S1QH 3CCRA 5FLMH 4KV6A 2AQ2B 4J15A 5IGCA 3GTKH 1VQNA 4NB3A 1EY8A 2A6ED 5IWAQ 2F0LA 3DWQA 3K59A 2IJ0A 1CA5A 2I07B 4ZAIA 4BY1G 1JOQA 4H0LC 4P71A 1K28A 2IX1A 1UWVA 2XRSD 1PMRA 1H9KA 5KYIA 3E0EA 3I72A 2YV5A 1GOZA 3I73A 3HG9A 1CHPD 4CJ2C 5JJLA 3FMCA 3HOXH 1HCZA 4I7ZC 1RKNA 4K2KA 3HP3A 3JC66 1I94Q 4C3IG 5LMNQ 1PTOF 3F2UA 4QCLA 1IKMA 1KC8C 1YNXA 5LMNL 5C3XA 4A3CG 2EVBA 5BN4A 1NY4A 3BZDB 2DY8A 1LT5D 3KOJA 3NQTA 3DLLA 2HD3A 1B70B 2EYMA 5C4JB 2RDHA 3S1NH 4ZKBB 4X66Q 1RIPA 4LF8Q 1QVFA 1KQSA 1IL8A 3H3VH 1B2TA 3TS2A 5GADC 4LF8L 2CVRA 2A6EC 2G9DA 3A5ZB 1T9HA 5BN5A 4DK6C 1X3QA 1H9RA 1Z6HA 3BVZA 4TVAB 4CKCA 1X3FA 3FEWX 3M4QA 1X54A 4K6LA 3QJYA 1EYCA 3RN5A 2EDGA 3DUZA 2Z6KC 3ND8A 1FYCA 3H0GG 2JA8B 1YNNC 1ET9A 1LTSD 1HHVA 2EJGC 3CD6A 4IUTA 1GM5A 4AYBE 3I4NB 4AYBB 4E6IA 1EU3A 3GTMB 5I6YA 2L15A 4QUFA 1HTLD 4PMBA 3HOYB 1BBXC 5CV4A 3BVGA 4DUYL 4UPAA 2QDBA 1VQ4A 3RZOB 1BBUA 4CKEA 1G2SA 3A55A 1NJIC 2Q8IB 1KXLA 2IY5B 3HKSA 1CKNA 3PQIA 4A3EH 2D62A 1O7YA 1JWUD 2PMZE 2PMZB 3KUPA 4KJOA 5CBEE 2PQEA 1KHIA 2N88A 4Y7NH 3I8ZA 4LF9L 3K5OA 1NNXA 3PIP3 1GJXA 5HGQA 3D6CA 3MXPA 1W6JA 4LWCA 3IFDA 1YEZA 2EOTA 5CV7A 3KF8B 1XWEA 4IFDH 3FRPB 1BOSA 1QILA 1Y1WG 3GTJB 4HMIA 1KTKA 1V8QA 5IP9H 1NR4A 2TMPA 3MHBA 2NTSA 2FMCA 3HOWG 5ELBA 3I7FA 3QWNA 2EY6A 5J39A 2PZUA 1TS3A 2CKZB 2A68C 1JR0D 2QCPX 4A3GH 3AU7A 1EWIA 2SDFA 4NP5A 4IOCA 2F0WA 2WB1E 2WB1B 3HOVH 4J8QA 5BN3A 1YJNA 3NSWA 1SNDA 4A76A 2NVTH 1TWCH 3PO2G 5M3FG 1WOCA 2RHSB 4BBSG 1TU2B 3TRZA 4X62L 1PRTF 1CFMA 2AKWB 1SJHD 4S3SA 3I3CA 3EN2A 4RFBA 2LY7A 1SBBB 2F03A 1JCKB 2M9VA 2GVAA 4HIKA 1X55A 2CCZA 2B8GA 5D65A 1B44D 3H09A 3ONAB 1XX8A 1F2LA 4BY7B 4QGUA 2E2IH 4B3SQ 3K7AB 4FF2A 3M4PA 4IURA 2ZJQA 2BCOA 4JG2A 2X6GA 3CCSA 2PI2A 1E2ZA 5C44B 1NSNS 3WWVA 3HGBA 5NUCA 2B2VC 3CMAA 1QG7A 1KABA 5K5PA 3T1HQ 3N6RA 2HCCA 5A2QL 2NVXB 5J1ZA 1PDQA 1QVGA 1R9TB 1JOKA 2F1MA 4GS3A 1K8GA 4A3FG 4LF5L 3W5OA 1OTCA 5IYCH 4A93G 4RGMA 1LTAD 1G6PA 1RCVD 1U4PA 3WDNA 5FOBB 1XJVA 3SGIA 4KI0A 3T51B 4LNQA 4IFDJ 3MXNB 2YU9B 4PMWA 2CW0D 2F0KA 2I5LX 1BO0A 1U9RA 1MKHA 1K0SA 4L5SA 1E1TA 2Y0SB 2L0CA 4BXXG 4X64Q 3UDIA 1AW7A 2FINB 4OO1I 1VQKA 4UP7A 3I4MH 1IBML 4QJFA 3MEFA 3J7YW 5I2YA 1X3GA 4POGA 1BVSA 4ZUJA 3QOJA 3A74A 4FP5D 3J81E 1NTGA 3D31A 5GQOA 1ESFA 1XMQQ 3GDEA 1VQDA 3PUYA 2A1AA 1XMQL 2RCNA 1PYSB 4F7XA 4YCUA 4XQNA 2K1BA 2XIWA 2Z4HA 1W2BA 4LF6Q 4RA8A 1E24A 2A73B 4V190 5C6AA 2EYOA 3SXHA 3J80E 2P5ZX 5DNFA 4DNIA 1EQTA 3ULLA 2NUCA 4P75A 4XIGS 2JA5B 5CMDA 4DAMA 3P20A 3FP9A 4DR1Q 3I4NH 2UUAQ 1HNWL 5JVH3 4DR1L 4EVOA 3DEPA 1D5ZC 2UUAL 1A0IA 3KLSX 3K6OA 4DNRB 1JOOA 1YNJC 1BCPC 3KF6B 4KHPL 3HOUB 1E22A 1KL9A 1X56A 3BDLA 1GVPA 2A69D 1ASZA 2IPKD 3Q0AA 5EKLA 5HGTA 1AN8A 1LT3D 2B2TC 1NE3A 2F0GA 3I4OA 4A3KH 3GTQH 2E2HB 2ENBA 1BBWA 4C3HB 3VYSA 4B3RL 3TBIB 1PA6A 3SK8A 2JA8G 3S16B 2VNUD 1F2MA 1JE5A 4AYBG 5C0XJ 5C4XB 3P75A 3HKZG 2A5HA 3M3YB 4FO2A 3HOYG 4L5QA 2VQEQ 4IPHA 4NPSA 1F77A 2F0TA 1S5DD 2RF4A 4DV2L 4PG3A 2BE5D 1L0XB 4A3JB 1SE3A 4HJ9A 3T4AC 1K0RA 1NUCA 1VQMA 4OELB 1XNRQ 1VQLA 3CPWA 4IUQA 1E1OA 2K03A 2PYKA 4P72A 4IOAA 3OW7A 4RKLA 3MWYW 1WVLA 1BXTA 4RGTA 4OWWB 3Q8DA 5E1FA 3VYUA 2N78A 4DV4L 2O2LD 1PTOC 3T1YL 2WAQB 1C9OA 3EROA 2ZM6L 1X6OA 2CH4A 2HHHL 2F0MA 1JMCA 1B9MA 1FNWA 1HQRD 1PH3A 3C46A 1AZPA 3PUZA 1VQHA 1EU4A 5G3LF 3S1QB 1C7YA 3ER0A 3SEBA 1I4QA 2WKDA 3CCQA 1PH7A 2D0PA 1SYEA 1EYAA 2B2YA 3GTKB 4LUOA 4BY7H 1TQOA 5GAHC 3EBEA 2MHVA 4B08A 4MZ9A 1IKLA 1RTNA 1PZJD 4G4KA 4WJ3M 1EIHA 4ME3A 1Y8NB 4KKUA 1GHKA 2ATWA 1EWHA 2WACA 3QB3A 4MTNA 5EBDA 4YWKA 1HRJA 1K9MC 2K4KA 3RLFA 3ITPA 3HOXB 3VR5A 1TIID 5ELEA 2L1BA 3MAQA 1WTXA 2AQ3B 5IE8A 4GOPC 1VQBA 4Q5VA 2I0QA 2HCIA 1RL2A 1QJOA 2F0EA 4M1UB 2DY7A 4DV1L 1PFBA 3IAYA 1FGUA 1SN8A 1B8AA 1GUGA 2MP1A 1SE8A 4DV7Q 1SROA 2RVLA 4KD4A 5C44G 1ONLA 4DV7L 2VZAA 4DV6L 2JEBI 3M4OH 3K57A 1E3PA 1MD2D 4KHVA 1EFID 1CKNB 1DOMA 3S1NB 2F0DA 1Q1EA 4DR5Q 2I5MX 3GD7A 4L63B 1OO9B 5I2XA 4HJ5A 1R4PB 3DWAA 3T56B 3NBHA 1EIYB 2K28A 4K8JA 3U4VA 4HAEA 1FNUA 1FNVA 1I6HB 1EUJA 3BDOA 1FJGQ 1CKMA 1K8OA 4NXMQ 1SNOA 3ULPA 5EKIA 2GVBA 1NCVA 1S5FD 4JOIC 4EQOA 5M3MH 1MJEA 1KAAA 2E74C 4A3DH 4XXEA 1YJ9A 1G291 3FKIH 2IHEA 2OTJA 1PTOH 2Y0SG 1DONA 4OL7A 4DGZA 5F2DA 4KHZA 4PV1C 3GP7A 3X3NA 2L11A 3CCUA 1I3QH 2KHIA 2NN6H 3CHBD 4O0AA 1LABA 4AIMA 3D0FA 3MA2B 1I5FA 4R9WA 4NXNQ 4A3EB 5COYA 4GN4B 4NXNL 5LL6S 1MI2A 1B1ZA 1LTBD 5BR8Q 3OOCA 4Y7NB 2DNEA 1SYCA 4ABNA 5BR8L 2LXKA 3NENA 1MJCA 3W1GA 1LV9A 4ZUIA 4RGNA 3NTIA 1XNQQ 5KNCA 2CH4W 1Q82C 1LO5D 4BBRG 1XNQL 1Y1VH 3G48A 4M8AA 1Z7TA 1J8IA 2F4IA 5C3EB 2NVYH 4KLKA 1HFGA 4DAYB 2A6HD 1NAPA 4DK0A 2JA5G 3NK9A 1V9PA 3ERQA 4APVA 2F0QA 1PFSA 3GO5A 1LTLA 1VQEA 3CRLC 4A4IA 2ZXRA 3GTOB 5FJ8G 1Y8PB 1YHBA 2OQ0A 4EX5A 3VR6A 3M3YH 2WIIB 1QCBD 3BYYB 4ZRZA 1HQMC 3HOUG 1SNMA 1O7ZA 1WJJA 5LHY1 2PQAA 2NVTB 3LGJA 4A3JH 1TWCB 4OWTB 5M5XH 1QZHA 2Z1CA 1XMOQ 1YVCA 2K75A 3RUZA 4XT1B 1N32Q 3KK7A 4C3HG 4O2DA 3K80C 5CORA 1HUNA 4FDBA 2K05A 4DXFA 5K36H 4KMUC 1PH9A 4ME5A 4CDEC 2WFWA 4EQNA 1L0WA 1F2ZA 4FF1A 2GN5A 4JI5L 3JAME 5C4XG 3OWEB 1BKBA 2JP1A 1OXSC 5CV9A 5M5WH 1JJ2A 5IGDA 1STHA 3DWPA 2EYHA 3C1FA 2XWJB 4BWGB 2LS01 1HZCA 1Q1BA 3S17B 2ZT9C 5IGBA 2KEDA 4RCOA 1SYBA 2DUDA 2PZWA 5DM73 1VQGA 4ZQ3A 2DJFC 1AE3A 1UUPA 5HY6A 1UNSA 3MEHA 1EQRA 3IFTA 2RQXA 1EYGA 3TN2A 4JW0A 2WAQG 3OSOA 1LM0A 4IPCA 1V1PA 2X6LA 3RLOA 1FL0A 2FXQA 3EJIA 1QUQA 4I65A 1YNND 3G6JB 1YHQA 4JI7Q 2VS1A 1PH1A 4JI7L 4JOIA 4H44C 4DF7A 4XQJA 5FLMG 1SYGA 1ILQA 1JJCB 1SDFA 3Q6SA 5CR3A 4L6TB 4DV3L 1Q7YC 2UXDQ 2UXCL 2K5VA 2UXDL 3L2PA 3J81c 3I4MB 3U50C 4LFAQ 2LKVA 1IBKL 2MJ8A 2O5JC 1EY0A 4LFAL 3J7AF 1AH9A 1SSOA 2HDMA 1HTPA 1WCMH 3MVVA 3PUXA 4QMGA 2N8NA 2EY1A 5IP7H 1HUMA 1PHJA 2VQFQ 3HOXG 3R3OA 2JA9A 5FO7B 3GV3A 2EYLA 3J80c 2VQFL 1I6HH 1MBYA 2MO0A 3TZUA 3EVQA 5EGTA 1E2WA 1EY4A 1QNUA 1CHQD 1UAPA 1W3SA 4HJAA 1X3EA 1ET6A 2SNMA 3T53B 4JI4L 5JJZA 4HEDA 4B9WA 2ZJPA 3A54A 3D8GA 2K04A 3HOZB 1KRSA 3CQZH 4UP8A 1Z9FA 4JI2L 5GAEC 1VF7A 4KY6A 2A68D 4DUYQ 2N55A 3ZYYX 4CDFC 1TS4A 2SEBD 4JI6Q 2VUMH 2F0PA 3LWEA 4FXGC 4PZ7A 5DEHA 2F4VQ 4JI6L 1CQVA 4X3TA 1IL2A 2F4VL 4A3KB 1K8MA 3GTQB 1D5MC 3BS1A 2MPMA 1BDOA 2AHOB 4LF9Q 3T16A 1HNXL 4K5VA 4R8NA 2Q2UA 1MIUA 1SMYC 1VCIA 5CV8A 3S2DB 4GKKQ 4GKKL 5T1IA 3CP0A 4B3MQ 1VQIA 4J1MA 3F2BA 4B3ML 1IYJB 5C3EH 1VQ7A 4A3EG 3U4ZA 3FHWA 2KOLA 1F9RA 1UE1A 5CYUA 1PH8A 1XPUA 1G6ZA 5C4ZA 4LW1A 1XPOA 3GTOH 4FXDA 3W2DA 3I4LA 1A15A 4XQQA 4UP9A 4X3KA 3BG3A 3NE5B 1S5ED 5IOCA 1WTOA 1ILPA 4OIJA 4NDXA 3KDFA 2HQEA 4IJLA 3K0XA 4QB4A 1IZ6A 2SNSA 1KRTA 1CI3M 2B63H 4X62Q 1YZ6A 3OIPA 5CC4A 4C56C 4IFDG 3J7AV 3CXCA 5C3EG 2I5HA 3M4YA 5IP9G 3AMUA 2RDFA 1EEID 2B2UA 4OGQC 4QF4A 4DR7Q 5JJKA 1K8AC 4DR7L 1MSHA 2KQ3A 2CQOA 4A3GG 1JC7A 1C4QA 1SNPA 4RHSA 3NBHB 1GUSA 2NZHA 4ZKCB 1VQJA 1D1IA 1PFNA 3HOVG 1QVCA 4K5WA 1WTRA 2NYZD 4XYOA 2L5TA 1RHPA 5IGGA 3Q23A 3J81L 4TKOB 2MUYA 3QIAA 3S17H 5E7NA 3CRKC 4IQZA 3HFZB 1BCPB 2NVQH 4UAIA 2E8GA 2B39A 5D14A 1X32A 1UE5A 4LF5Q 4GN5A 4CGYB 3GTGH 2EY5A 4GLVB 1AFPA 3KJPA 1L1OC 3J80L 3OWFA 4DKAC 3PSIA 3VYRA 2E75C 2R92H 2D5DA 2L12A 4QY7A 3TP6A 3W1BA 2CWPA 1SEBD 1GUWA 1QWYA 3A8IE 4P73A 2B2YC 3DM3A 1A2UA 3M4OB 1J6QA 4R4IA 1JICA 2XVSA 3UDFA 5C0XH 4PMCA 5IYDH 1TWAH 4YHHQ 4YCWA 5KNBA 4OO1H 4YHHL 1RODA 2DN8A 1YNJD 1BCPD 4QQBX 1U0LA 4DAVA 1IBMQ 1Q3LA 5IYCG 2JA7B 1PV4A 4BA2I 3F2DA 3SVMA 5KRUA 3UE1A 4PZ6A 5M3MB 1ZYRC 1EZ6A 5DM63 3PUVA 1CZWA 1H9SA 2JA6H 4A3DB 4MTKA 3DHQA 1XTDA 2PPBC 3V05A 3FKIB 4O42A 1Q90A 2KCMA 2B3GA 5E4XA 1O80A 1PTOB 2XGTA 3ERSX 2WINB 3VYTA 5T1GA 5JEAH 1EIGA 2MO1A 1N36Q 1B4OA 1N36L 3I91A 1ICFB 1I3QB 1TWGH 1TY0A 3I4MG 2NZ1D 3S1MH 4LF4Q 3E9HA 4DPGA 2PQAB 4LF4L 2AWNA 1RTOA 2BDOA 2OF1A 4DAPA 1PXUA 3HOZH 1HNWQ 3MTSA 4GLAC 2Z8LA 1C0AA 1CSPA 1S4ZA 4NKLA 5JAVA 1SNQA 1YI2A 4JYAL 4KHPQ 2RSOA 1O7LA 2OT2A 1QE6A 3HRZC 4JI1L 3H6MA 2R7ZB 3L9AX 3W3AA 1PTOD 1Y1VB 2KEEA 1JJGA 2NBFA 1HNZL 1MHWC 1WTPA 1DCZA 4GLXA 4B3RQ 1ML0D 3E6ZX 1YIJA 3EIVA 2NVYB 1ZEQX 3Q24A 2XSCA 1DM0B 1DOLA 1LACA 1A3VA 2JQOA 4ILWA 4H02A 4G7HC 2R93H 2F0OA 4GOPB 2K14A 5ELNA 4FYDA 3E0JA 4FVMA 3I4NG 3S2DH 1A2TA 2IX0A 2VB3X 1N34L 2MFIA 4LJZC 2QA4A 2AQ1B 4DV2Q 3BYTB 2D2CC 4YCVA 3AFQA 4V0BA 4L5TA 1QB5D 4G7OC 1EL0A 5M5XB 4FF4A 3H15A 3SDZA 4K0KQ 4A3KG 4IZ8A 4K0KL 5DAUA 3JAMc 4N8X1 3S2HB 1KD1C 2Q8RE 3NELA 1V1PB 1PH2A 2XWBB 3N52A 4HJ8A 3TEHB 1QUQB 1EY6A 1DOKA 5KIXA 4K8IA 1XYIA 3TDQA 1RD9D 1UEBA 4DV4Q 3K5MA 3HS0C 4HCEA 4A3IH 1TWFH 1XPRA 3T1YQ 3KJOA 1G91A 5JEAJ 2ZM6Q 5M5WB 4ODGA 2HHHQ 1EIFA 3K81C 3NTHA 4MHEA 2JEAI 1JWSD 4KY7A 3FVQA 1L1OA 2AUJD 2KVMA 1B3QA 4K6DA 3M85A 4H7BA 2VXWA 1Q12A 3PO3H 2OXPA 1YBYA 5IYBH 3P1HA 4U673 3GTPH 1CSQA 4F88A 1PRTB 4F87A 2VW9A 2WB1G 3PGZA 1ENCA 1HR0Q 4DR6Q 4HSVA 2VY3A 3KLSA 1HR0L 4DR6L 1GUOA 5EJWA 3RR5A 1HA6A 2EJMA 1I50H 1LT6D 4EQPA 2L9HA 5GAGC 2F0JA 3SE0A 2PW5A 4GZYC 2RCFA 2EYPA 4DA2A 4JBMA 3A56A 2UXBL 4N9PA 1D5XC 1F2YA 3MZ5A 5C3WA 4BY7G 4DV1Q 4UHVA 4A75A 3S14H 2EIFA 2O5IC 3L7ZC 3OMCA 3KLRA 2Z4IA 4DV6Q 1PRTD 3U9SA 1BR9A 3S15B 5CV6A 1J5EQ 3OHXC 3ICEA 1WCMB 1C8CA 2TSSA 1J5EL 2ZJRA 5EBCA 1PH4A 2ZTEA 2EPBA 1EY9A 2F0IA 4GN3B 3CU7A 4BA1I 1STBA 3F1ZA 1W6KA 1KDBA 5JOBA 2DNCA 2J4XA 2QEJC 3NEMA 5JPMC 2JA7H 2V1CC 1OXVA 1LYLA 2SOBA 1Q81C 3C1EA 1VQCA 4JVZA 1WI5A 1Q46A 4DUZQ 1KDAA 4I7AA 2K5HA 5D3IB 2K33A 3VR3A 1AE2A 4DUZL 1ESRA 3CQZB 4JBJA 1TS5A 1VQ5A 4AQYQ 1STGA 3K5LA 2NWGA 4AQYL 4A3MH 1F9PA 2BA0A 2VUMB 3J7ZC 2DJGC 5ELDA 3KDFB 2EYFA 3RN2A 1TR5A 4HSPA 2EJFC 3E5SA 3UE0A 4GNXC 1PRTC 5M3MG 3RZDH 1EYDA 3J7A5 1CM9A 2UU9Q 1QNKA 2F3IA 3FDTA 4A3DG 2UU9L 2Q2IA 3FKIG 3B6YA 4RH6A 2JSOA 2K01A 2XRQD 3TP5A 4LF7L 3CAMA 4JI8Q 3VA5A 5IT9E 2CQAA 3MXNA 1DZ1A 1E0BA 4JI8L 3I90A 3RD4A 2D0OA 2R7ZH 3TP8A 2A8VA 1KNEA 1O78A 2NN6I 4OWXB 3CC7A 2R3ZA 3TP7A 4C3JH 2NN6G 5I4DA 3MFYA 3A0JA
chains in the Genus database with same CATH topology
5IYCH 1KAWA 3E9IA 4JV5Q 4A93G 4POFA 1A8VA 2PI2E 4HJAA 3VDYA 1G6PA 4JV5L 1HZBA 1X3EA 1GKHA 4HIMA 1XJVA 3SGIA 4JI4L 4KI0A 2WAQE 4IPGA 2ZJPA 3CCEA 4LNQA 2JK8A 2CWAA 4GNXB 3MXNB 1KRSA 4A3IG 4IFDJ 1A63A 3CQZH 4PMWA 4UP8A 1Z9FA 4JI2L 2I5LX 4R4OA 5GAEC 2Q2TA 1MKHA 3KLWA 4QIWE 4R4TA 4DUYQ 5DLQE 4XTCS 4L5SA 3G4SA 1E1TA 2YTYA 1LUZA 1WFQA 4BXXG 4X64Q 1Y1VG 4IPDA 3UDIA 4JI6Q 4L5RC 3TQYA 2VUMH 1K83H 3K8AA 4PZ7A 1UE6A 1VQKA 2QGQA 2F4VQ 4OO1I 4JI6L 1B7YB 4OX9L 2R6GA 1IL2A 1N33Q 2F4VL 4RG1A 4UP7A 3I4MH 3RNUA 1IBML 3S2HH 4QJFA 3G6EA 3MEFA 1N33L 3PO3G 4DR4Q 3K7AH 2UXBQ 2QEXA 5M5YH 5IYBG 4JI5Q 1S3OA 3BJUA 4DR4L 2AHOB 1X3GA 4YY3L 4LF9Q 1BVSA 4POGA 3A74A 2Q2UA 1HNXL 2R7DA 3CCLA 4Y52H 1MIUA 1NTGA 5C44H 1GO3E 1VCIA 2H5XA 2ID0A 3D31A 5GQOA 4DR2Q 4GKKQ 1XMQQ 4DR2L 3GDEA 4GKKL 1VQDA 2NVXH 3PUYA 2A1AA 3CP0A 4DR3Q 2RCNA 1XMQL 1PYSB 1R9TH 4A3JG 2NZOA 4B3MQ 1VQIA 4YCUA 4DR3L 3F2BA 4B3ML 4EQ5A 1P16A 1W2BA 1SRUA 4LF6Q 4DV0Q 1UE7A 1IYJB 1E24A 1V1QA 5C3EH 1VQ7A 4A3EG 3U4ZA 2N3SA 3FHWA 4DV0L 2ES2A 5K36G 3BU2A 4RMFA 4DNIA 1UE1A 3ULLA 1X65A 4JBWA 1PH8A 1XPUA 4LW1A 4P75A 1XPOA 4XIGS 3GTOH 1VQ8A 2N49A 4DAMA 4UP9A 2YU9H 3FP9A 3S24A 4DR1Q 3PIOA 4DV5Q 3I4NH 1JT8A 2UUAQ 1HNWL 2UUBQ 4JC0A 2XTIA 3J81i 2ZTCA 3KDFA 4R4QA 5AJ3Q 4IJLA 4DV5L 4DR1L 1JB7A 1A0IA 3K0XA 2UUAL 3OTOQ 2UUBL 1IZ6A 1KRTA 5AJ3L 3KF6B 4KHPL 3OTOL 4DR5L 3ULJA 2B63H 1E22A 4X62Q 1KL9A 1X56A 1YZ6A 1GVPA 2IT1A 3UDGA 1ASZA 4IFDG 4YWMA 3CXCA 5C3EG 5J3BA 2I5HA 1VQPA 5IP9G 1NE3A 4A3KH 3I4OA 3GTQH 4JCVE 4DV3Q 1BBWA 1FJGL 4C3IH 5IWAL 4B3RL 4IO9A 5H1SE 3I56A 1PA6A 4NXML 2JE6I 4QL5A 4DR7Q 1O7IA 2JA8G 4A3CH 3J80i 2JA7G 4B3TQ 5JJKA 2VNUD 2JJQA 1K8AC 4DR7L 1JE5A 1IBKQ 4B3TL 2CQOA 4A3GG 1N8RC 1Y14B 4AYBG 5C0XJ 3HKZG 3NBHB 3HOVG 2NZHA 1VQJA 1GD7A 2KCTA 4L5QA 2VQEQ 4HIDA 3HOYG 1QVCA 4IPHA 4NPSA 3S15H 4X6AH 2RF4A 4DV2L 4PG3A 4LF7Q 2LSSA 4BBRH 3S17H 5E7NA 4ALPA 4HJ9A 1K0RA 4GNXA 3CPFA 3TREA 1VQMA 2ASBA 3HFZB 2NVQH 3ZJYC 4A3MG 2E8GA 1XNRQ 1VQLA 2AWOA 1V43A 1UE5A 1E1OA 3STBC 3CPWA 1I94L 4LF5Q 4P72A 4GN5A 4A3BH 1Z47A 1YHAA 4IOAA 2JA5H 3GTGH 1HH2P 3H0GH 1SLJA 1M90C 1IXRA 2HQLA 2IHFA 4GLVB 1PVOA 3BZKA 1VQAA 5FJ8H 3RLNA 3KJPA 1L1OC 4OWWB 4JI4Q 1D7QA 3Q8DA 3CCVA 4DKAC 2E2JH 3PSIA 2N78A 1OXUA 4DV4L 2R92H 2OWOA 4QY7A 1HJPA 3W1BA 3T1YL 4UY8C 1C9OA 2CWPA 4X66L 4OONA 2ZM6L 1X6OA 1WCMG 4JI2Q 3HOUH 1P8LA 1SR3A 4P73A 2YTXA 2E5LQ 3DM3A 4YWLA 2HHHL 3H3VI 3PF4A 1JMCA 2AMCB 5IP7G 2E5LL 1J6QA 4R4IA 1PH3A 3UDFA 2E2HH 5IYDH 1TWAH 3PUZA 4YHHQ 2R7ZG 1VQHA 4YCWA 4C3HH 4DK3C 2RHQB 1C7YA 3ER0A 4YHHL 4A3BG 4OX9Q 4LFCQ 3CC4A 4OXPA 1S72A 3CCQA 4R1JA 1K3RA 1U0LA 2D0PA 1PH7A 1PH5A 3S16H 4LFCL 4QQBX 2OCEA 1IBMQ 5GROA 5IYCG 3J81j 5LMNW 1PV4A 4LUOA 3IRBA 2UUCQ 3F2DA 4P74A 1CUKA 2HT1A 4BA2I 5C4XH 1A62A 3UE1A 5GAHC 1YITA 4BY7H 2UUCL 3EBEA 4LUVA 4YY3Q 2Z0SA 4MNOA 4MZ9A 4PZ6A 3F8TA 3I55A 3HKZE 1HNXQ 3L0OA 5LMUQ 4WJ3M 1YJWA 3PUVA 4ME3A 2JA6H 1L1OB 5LMUL 3CC2A 1XTDA 3S1RH 2R7FA 1EFWA 2HIXA 2ATWA 4A3LH 2KCMA 2MQHA 2B3GA 4MTNA 4YWKA 2XGTA 3ERSX 1XMOL 1K9MC 2K4KA 3RLFA 1Y1WH 4TQUS 1N32L 2MO1A 1VQ6A 3GTLH 2VUMG 1N36Q 3K7UC 3KF6A 3PUWA 1N36L 3HOWH 4WJ4A 5IE8A 1Q8KA 1VQBA 4GOPC 1VQ9A 1TWGH 2I0QA 1K73C 3I4MG 1RL2A 1HZ9A 2K52A 1U5KA 3S1MH 4LF4Q 4BY1H 2OQKA 4DV1L 3E9HA 1FGUA 1SN8A 1B8AA 3M9BA 4DPGA 1SFOH 2PQAB 1X9NA 2AWNA 4LF4L 1SE8A 4DV7Q 4JI3Q 1NMFA 1SROA 3STBD 3CCJA 3HOZH 5C44G 1HNWQ 1L2FA 4DV7L 4JI3L 2VZAA 4GLAC 4DV6L 2JEBI 3M4OH 4A3LG 2LXJA 4GOPA 1C0AA 1CSPA 3PO2H 2VL6A 1E3PA 5M3FH 1CKNB 1OXXK 4BBSH 1YI2A 1Q1EA 4JYAL 4DR5Q 2K5NA 2I5MX 1NBWA 3GD7A 4AH6A 4HJ7A 4KHPQ 4HJ5A 3BZCA 1PYBA 4IFDI 5ELOA 3CCRA 5FLMH 1EIYB 3S1QH 4JI1L 3U4VA 1JJGA 1EUJA 4J15A 1HNZL 3GTKH 1VQNA 4GLXA 4NB3A 1ASYA 1FJGQ 3KFUA 1CKMA 5IWAQ 4B3RQ 1H95A 2UXCQ 1YIJA 1N9WA 1NMGA 3EIVA 4NXMQ 3PIPA 2PNHA 3ULPA 2GVBA 4BY1G 4JOIC 4P71A 2JQOA 5M3MH 2R93H 4H02A 1MJEA 1WYDA 4GOPB 1VQOA 3U58A 2K14A 5ELNA 2IX1A 2ZTDA 1UWVA 2BH8A 3I4NG 1YJ9A 3S2DH 4A3DH 1G291 3FKIH 2IHEA 3E0EA 2OTJA 2IX0A 2YV5A 3M7NA 3AQQA 1N34L 2MFIA 2QA4A 1DGSA 2Y0SG 4DV2Q 1D8LA 5JJLA 4YCVA 3AFQA 2B63G 4L5TA 3HOXH 4KHZA 1OXTA 4LUZA 3H15A 3CCUA 4K0KQ 1I3QH 2KHIA 1HZAA 4IJHA 4A3KG 4O0AA 4C2MH 3JC66 4A3FH 4K0KL 4AIMA 1I94Q 5LMNQ 3JAMc 3D0FA 4NXNQ 1I5FA 1KC8C 1KD1C 1YNXA 4A93H 4GN4B 5LMNL 3NELA 4A3CG 4NXNL 1PH2A 1NY4A 1TWHH 4HJ8A 1SMXA 3TEHB 2BA1A 3TS0A 3KOJA 1QUQB 4B3SL 3DLLA 2BH2A 5BR8Q 1B70B 3CF5A 1UEBA 4DV4Q 2DGYA 4A3IH 5BR8L 2LXKA 1TWFH 3S1NH 1XPRA 3NENA 2B29A 3KJOA 3T1YQ 5JEAJ 1RIPA 1MJCA 3W1GA 4X66Q 2ZM6Q 4LF8Q 1QVFA 5IY0A 1KQSA 2HHHQ 1EIFA 1M1KC 3K81C 5GADC 3H3VH 4LF8L 1XNQQ 3TS2A 2YYZA 1Q82C 4BXXH 3A5ZB 1T9HA 4BBRG 3T1HL 4DK6C 1XNQL 2JEAI 1Y1VH 3G48A 1L1OA 4TVAB 1X3FA 3M4QA 1X54A 3M85A 1FVIA 2NVYH 1Q12A 4KLKA 4DAYB 3RN5A 3PO3H 2Z6KC 2JA5G 1V9PA 4APVA 2Q2HA 1PFSA 1YBYA 3H0GG 5IYBH 3GO5A 1LTLA 1VQEA 4A4IA 3GTPH 5FJ8G 3UDXA 1YHBA 3OW2A 1CSQA 3CD6A 5JJIA 2OQ0A 4EX5A 1GM5A 4AYBE 2VW9A 2WB1G 3PGZA 3CMEA 2R92G 3M3YH 1HR0Q 4DR6Q 2VY3A 2L15A 1HR0L 4DR6L 1KIXA 3HOUG 2Y0SE 2Z6KA 1WJJA 4DUYL 2PQAA 4UPAA 2EQSA 3LGJA 3RR5A 5C0XI 4OWTB 5M5XH 4A3JH 1QZGA 1QZHA 1VQ4A 2KHJA 1BBUA 1XMOQ 1CKOA 1YVCA 2K75A 4X64L 5C0XG 5IYDG 1NJIC 1N32Q 3OYYA 1I50H 1KXLA 2IY5B 3HKSA 4OO1G 4O2DA 3K80C 1CKNA 4FDBA 4A3EH 2D62A 5GAGC 1VS0A 2KBNA 2PMZE 1PH9A 2C35B 2WFWA 4JBMA 1L0WA 2UXBL 2HIVA 4JI0Q 1KHIA 2GN5A 4JI5L 4Y7NH 5C4JH 4R4CA 4DV1Q 4BY7G 5C4XG 4LF9L 4A75A 4JI0L 2A19A 3S14H 4X65Q 1S40A 2EIFA 1PH6A 1BKBA 1OXSC 5HGQA 5M5WH 4X65L 3L7ZC 3PCOB 5IT9c 3F2CA 4DV6Q 4LFBQ 1JJ2A 4LWCA 2JA6G 4LFBL 3AYHB 1J5EQ 3ICEA 1YEZA 4JYAQ 1HZCA 2EXDA 1HR0W 3KF8B 1Q86C 1J5EL 1Q1BA 2ZJRA 1PH4A 2ZTEA 1Y1WG 1G51A 4JI1Q 5JEAG 1TXYA 5IP9H 4LF6L 4GN3B 4BA1I 2DUDA 1HNZQ 1VQGA 3PV0A 5EAYA 2MNAA 3F1ZA 3HOWG 1AE3A 3I7FA 3AFPA 2JA8H 3NEMA 5HY6A 2JA7H 2V1CC 4JBKA 2CKZB 1OXVA 1EQRA 1LYLA 1EYGA 1Q81C 4A3GH 1EWIA 3JAMi 4IOCA 2WB1E 2ALYB 3G71A 2WAQG 1VQCA 3GTMH 3HOVH 1WI5A 2YTVA 1Q46A 4DUZQ 1YJNA 1LM0A 4IPCA 2K50A 3HOYH 2K5HA 3HOZG 3CCMA 4A76A 3RLOA 1FL0A 1AE2A 4DUZL 2NVTH 2FXQA 1TWCH 3AEVA 3PO2G 5M3FG 1N34Q 1QUQA 1VQFA 3RZOH 1WOCA 2RHSB 4JBJA 1YHQA 4JI7Q 3TRZA 4X62L 4BBSG 2VS1A 1PH1A 4JI7L 4JOIA 1VQ5A 2AKWB 3KYHC 4AQYQ 5FLMG 1JJCB 3EN2A 4AQYL 4A3MH 2BA0A 4DV3L 4HIOA 1Q7YC 2GVAA 3J7ZC 3A5UA 2UXDQ 4HIKA 1X55A 2CCZA 2UXCL 2K5VA 3KDFB 2UXDL 3L2PA 3RN2A 3J81c 3UE0A 3U50C 4LFAQ 4GNXC 3PF5A 1IBKL 5M3MG 3I2ZA 4QGUA 2E2IH 4B3SQ 4GKJQ 3RZDH 2R93G 4LFAL 3J7A5 2CFMA 3M4PA 2ZJQA 2UU9Q 4GKJL 1AH9A 1EOVA 4JG2A 2F3IA 3CCSA 1IBLQ 4A3DG 5FLXc 2PI2A 2UU9L 2KENA 3CW2C 2VQEL 2Q2IA 3FKIG 1WCMH 3B6YA 1IBLL 2WP8J 3PUXA 4LF7L 2N8NA 3CAMA 4JI8Q 3WWVA 5IP7H 3GTJH 3CMAA 2F52A 1PHJA 4JI8L 2VQFQ 3T1HQ 4PZ8A 3HOXG 2JA9A 2D0OA 2R7ZH 1QVGA 2A8VA 2NN6I 3J80c 2VQFL 1I6HH 1EQQA 4OWXB 3CC7A 2MO0A 2OTLA 4C3JH 2NN6G 4GS3A 1K8GA 1XNRL 4A3FG 1E7ZA 4LF5L 3A0JA 1W3SA 3W5OA 1OTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC H;  1KAW A;  3E9I A;  4JV5 Q;  4A93 G;  4POF A;  1A8V A;  2PI2 E;  4HJA A;  3VDY A;  1G6P A;  4JV5 L;  1HZB A;  1X3E A;  1GKH A;  4HIM A;  1XJV A;  3SGI A;  4JI4 L;  4KI0 A;  2WAQ E;  4IPG A;  2ZJP A;  3CCE A;  4LNQ A;  2JK8 A;  2CWA A;  4GNX B;  3MXN B;  1KRS A;  4A3I G;  4IFD J;  1A63 A;  3CQZ H;  4PMW A;  4UP8 A;  1Z9F A;  4JI2 L;  2I5L X;  4R4O A;  5GAE C;  2Q2T A;  1MKH A;  3KLW A;  4QIW E;  4R4T A;  4DUY Q;  5DLQ E;  4XTC S;  4L5S A;  3G4S A;  1E1T A;  2YTY A;  1LUZ A;  1WFQ A;  4BXX G;  4X64 Q;  1Y1V G;  4IPD A;  3UDI A;  4JI6 Q;  4L5R C;  3TQY A;  2VUM H;  1K83 H;  3K8A A;  4PZ7 A;  1UE6 A;  1VQK A;  2QGQ A;  2F4V Q;  4OO1 I;  4JI6 L;  1B7Y B;  4OX9 L;  2R6G A;  1IL2 A;  1N33 Q;  2F4V L;  4RG1 A;  4UP7 A;  3I4M H;  3RNU A;  1IBM L;  3S2H H;  4QJF A;  3G6E A;  3MEF A;  1N33 L;  3PO3 G;  4DR4 Q;  3K7A H;  2UXB Q;  2QEX A;  5M5Y H;  5IYB G;  4JI5 Q;  1S3O A;  3BJU A;  4DR4 L;  2AHO B;  1X3G A;  4YY3 L;  4LF9 Q;  1BVS A;  4POG A;  3A74 A;  2Q2U A;  1HNX L;  2R7D A;  3CCL A;  4Y52 H;  1MIU A;  1NTG A;  5C44 H;  1GO3 E;  1VCI A;  2H5X A;  2ID0 A;  3D31 A;  5GQO A;  4DR2 Q;  4GKK Q;  1XMQ Q;  4DR2 L;  3GDE A;  4GKK L;  1VQD A;  2NVX H;  3PUY A;  2A1A A;  3CP0 A;  4DR3 Q;  2RCN A;  1XMQ L;  1PYS B;  1R9T H;  4A3J G;  2NZO A;  4B3M Q;  1VQI A;  4YCU A;  4DR3 L;  3F2B A;  4B3M L;  4EQ5 A;  1P16 A;  1W2B A;  1SRU A;  4LF6 Q;  4DV0 Q;  1UE7 A;  1IYJ B;  1E24 A;  1V1Q A;  5C3E H;  1VQ7 A;  4A3E G;  3U4Z A;  2N3S A;  3FHW A;  4DV0 L;  2ES2 A;  5K36 G;  3BU2 A;  4RMF A;  4DNI A;  1UE1 A;  3ULL A;  1X65 A;  4JBW A;  1PH8 A;  1XPU A;  4LW1 A;  4P75 A;  1XPO A;  4XIG S;  3GTO H;  1VQ8 A;  2N49 A;  4DAM A;  4UP9 A;  2YU9 H;  3FP9 A;  3S24 A;  4DR1 Q;  3PIO A;  4DV5 Q;  3I4N H;  1JT8 A;  2UUA Q;  1HNW L;  2UUB Q;  4JC0 A;  2XTI A;  3J81 i;  2ZTC A;  3KDF A;  4R4Q A;  5AJ3 Q;  4IJL A;  4DV5 L;  4DR1 L;  1JB7 A;  1A0I A;  3K0X A;  2UUA L;  3OTO Q;  2UUB L;  1IZ6 A;  1KRT A;  5AJ3 L;  3KF6 B;  4KHP L;  3OTO L;  4DR5 L;  3ULJ A;  2B63 H;  1E22 A;  4X62 Q;  1KL9 A;  1X56 A;  1YZ6 A;  1GVP A;  2IT1 A;  3UDG A;  1ASZ A;  4IFD G;  4YWM A;  3CXC A;  5C3E G;  5J3B A;  2I5H A;  1VQP A;  5IP9 G;  1NE3 A;  4A3K H;  3I4O A;  3GTQ H;  4JCV E;  4DV3 Q;  1BBW A;  1FJG L;  4C3I H;  5IWA L;  4B3R L;  4IO9 A;  5H1S E;  3I56 A;  1PA6 A;  4NXM L;  2JE6 I;  4QL5 A;  4DR7 Q;  1O7I A;  2JA8 G;  4A3C H;  3J80 i;  2JA7 G;  4B3T Q;  5JJK A;  2VNU D;  2JJQ A;  1K8A C;  4DR7 L;  1JE5 A;  1IBK Q;  4B3T L;  2CQO A;  4A3G G;  1N8R C;  1Y14 B;  4AYB G;  5C0X J;  3HKZ G;  3NBH B;  3HOV G;  2NZH A;  1VQJ A;  1GD7 A;  2KCT A;  4L5Q A;  2VQE Q;  4HID A;  3HOY G;  1QVC A;  4IPH A;  4NPS A;  3S15 H;  4X6A H;  2RF4 A;  4DV2 L;  4PG3 A;  4LF7 Q;  2LSS A;  4BBR H;  3S17 H;  5E7N A;  4ALP A;  4HJ9 A;  1K0R A;  4GNX A;  3CPF A;  3TRE A;  1VQM A;  2ASB A;  3HFZ B;  2NVQ H;  3ZJY C;  4A3M G;  2E8G A;  1XNR Q;  1VQL A;  2AWO A;  1V43 A;  1UE5 A;  1E1O A;  3STB C;  3CPW A;  1I94 L;  4LF5 Q;  4P72 A;  4GN5 A;  4A3B H;  1Z47 A;  1YHA A;  4IOA A;  2JA5 H;  3GTG H;  1HH2 P;  3H0G H;  1SLJ A;  1M90 C;  1IXR A;  2HQL A;  2IHF A;  4GLV B;  1PVO A;  3BZK A;  1VQA A;  5FJ8 H;  3RLN A;  3KJP A;  1L1O C;  4OWW B;  4JI4 Q;  1D7Q A;  3Q8D A;  3CCV A;  4DKA C;  2E2J H;  3PSI A;  2N78 A;  1OXU A;  4DV4 L;  2R92 H;  2OWO A;  4QY7 A;  1HJP A;  3W1B A;  3T1Y L;  4UY8 C;  1C9O A;  2CWP A;  4X66 L;  4OON A;  2ZM6 L;  1X6O A;  1WCM G;  4JI2 Q;  3HOU H;  1P8L A;  1SR3 A;  4P73 A;  2YTX A;  2E5L Q;  3DM3 A;  4YWL A;  2HHH L;  3H3V I;  3PF4 A;  1JMC A;  2AMC B;  5IP7 G;  2E5L L;  1J6Q A;  4R4I A;  1PH3 A;  3UDF A;  2E2H H;  5IYD H;  1TWA H;  3PUZ A;  4YHH Q;  2R7Z G;  1VQH A;  4YCW A;  4C3H H;  4DK3 C;  2RHQ B;  1C7Y A;  3ER0 A;  4YHH L;  4A3B G;  4OX9 Q;  4LFC Q;  3CC4 A;  4OXP A;  1S72 A;  3CCQ A;  4R1J A;  1K3R A;  1U0L A;  2D0P A;  1PH7 A;  1PH5 A;  3S16 H;  4LFC L;  4QQB X;  2OCE A;  1IBM Q;  5GRO A;  5IYC G;  3J81 j;  5LMN W;  1PV4 A;  4LUO A;  3IRB A;  2UUC Q;  3F2D A;  4P74 A;  1CUK A;  2HT1 A;  4BA2 I;  5C4X H;  1A62 A;  3UE1 A;  5GAH C;  1YIT A;  4BY7 H;  2UUC L;  3EBE A;  4LUV A;  4YY3 Q;  2Z0S A;  4MNO A;  4MZ9 A;  4PZ6 A;  3F8T A;  3I55 A;  3HKZ E;  1HNX Q;  3L0O A;  5LMU Q;  4WJ3 M;  1YJW A;  3PUV A;  4ME3 A;  2JA6 H;  1L1O B;  5LMU L;  3CC2 A;  1XTD A;  3S1R H;  2R7F A;  1EFW A;  2HIX A;  2ATW A;  4A3L H;  2KCM A;  2MQH A;  2B3G A;  4MTN A;  4YWK A;  2XGT A;  3ERS X;  1XMO L;  1K9M C;  2K4K A;  3RLF A;  1Y1W H;  4TQU S;  1N32 L;  2MO1 A;  1VQ6 A;  3GTL H;  2VUM G;  1N36 Q;  3K7U C;  3KF6 A;  3PUW A;  1N36 L;  3HOW H;  4WJ4 A;  5IE8 A;  1Q8K A;  1VQB A;  4GOP C;  1VQ9 A;  1TWG H;  2I0Q A;  1K73 C;  3I4M G;  1RL2 A;  1HZ9 A;  2K52 A;  1U5K A;  3S1M H;  4LF4 Q;  4BY1 H;  2OQK A;  4DV1 L;  3E9H A;  1FGU A;  1SN8 A;  1B8A A;  3M9B A;  4DPG A;  1SFO H;  2PQA B;  1X9N A;  2AWN A;  4LF4 L;  1SE8 A;  4DV7 Q;  4JI3 Q;  1NMF A;  1SRO A;  3STB D;  3CCJ A;  3HOZ H;  5C44 G;  1HNW Q;  1L2F A;  4DV7 L;  4JI3 L;  2VZA A;  4GLA C;  4DV6 L;  2JEB I;  3M4O H;  4A3L G;  2LXJ A;  4GOP A;  1C0A A;  1CSP A;  3PO2 H;  2VL6 A;  1E3P A;  5M3F H;  1CKN B;  1OXX K;  4BBS H;  1YI2 A;  1Q1E A;  4JYA L;  4DR5 Q;  2K5N A;  2I5M X;  1NBW A;  3GD7 A;  4AH6 A;  4HJ7 A;  4KHP Q;  4HJ5 A;  3BZC A;  1PYB A;  4IFD I;  5ELO A;  3CCR A;  5FLM H;  1EIY B;  3S1Q H;  4JI1 L;  3U4V A;  1JJG A;  1EUJ A;  4J15 A;  1HNZ L;  3GTK H;  1VQN A;  4GLX A;  4NB3 A;  1ASY A;  1FJG Q;  3KFU A;  1CKM A;  5IWA Q;  4B3R Q;  1H95 A;  2UXC Q;  1YIJ A;  1N9W A;  1NMG A;  3EIV A;  4NXM Q;  3PIP A;  2PNH A;  3ULP A;  2GVB A;  4BY1 G;  4JOI C;  4P71 A;  2JQO A;  5M3M H;  2R93 H;  4H02 A;  1MJE A;  1WYD A;  4GOP B;  1VQO A;  3U58 A;  2K14 A;  5ELN A;  2IX1 A;  2ZTD A;  1UWV A;  2BH8 A;  3I4N G;  1YJ9 A;  3S2D H;  4A3D H;  1G29 1;  3FKI H;  2IHE A;  3E0E A;  2OTJ A;  2IX0 A;  2YV5 A;  3M7N A;  3AQQ A;  1N34 L;  2MFI A;  2QA4 A;  1DGS A;  2Y0S G;  4DV2 Q;  1D8L A;  5JJL A;  4YCV A;  3AFQ A;  2B63 G;  4L5T A;  3HOX H;  4KHZ A;  1OXT A;  4LUZ A;  3H15 A;  3CCU A;  4K0K Q;  1I3Q H;  2KHI A;  1HZA A;  4IJH A;  4A3K G;  4O0A A;  4C2M H;  3JC6 6;  4A3F H;  4K0K L;  4AIM A;  1I94 Q;  5LMN Q;  3JAM c;  3D0F A;  4NXN Q;  1I5F A;  1KC8 C;  1KD1 C;  1YNX A;  4A93 H;  4GN4 B;  5LMN L;  3NEL A;  4A3C G;  4NXN L;  1PH2 A;  1NY4 A;  1TWH H;  4HJ8 A;  1SMX A;  3TEH B;  2BA1 A;  3TS0 A;  3KOJ A;  1QUQ B;  4B3S L;  3DLL A;  2BH2 A;  5BR8 Q;  1B70 B;  3CF5 A;  1UEB A;  4DV4 Q;  2DGY A;  4A3I H;  5BR8 L;  2LXK A;  1TWF H;  3S1N H;  1XPR A;  3NEN A;  2B29 A;  3KJO A;  3T1Y Q;  5JEA J;  1RIP A;  1MJC A;  3W1G A;  4X66 Q;  2ZM6 Q;  4LF8 Q;  1QVF A;  5IY0 A;  1KQS A;  2HHH Q;  1EIF A;  1M1K C;  3K81 C;  5GAD C;  3H3V H;  4LF8 L;  1XNQ Q;  3TS2 A;  2YYZ A;  1Q82 C;  4BXX H;  3A5Z B;  1T9H A;  4BBR G;  3T1H L;  4DK6 C;  1XNQ L;  2JEA I;  1Y1V H;  3G48 A;  1L1O A;  4TVA B;  1X3F A;  3M4Q A;  1X54 A;  3M85 A;  1FVI A;  2NVY H;  1Q12 A;  4KLK A;  4DAY B;  3RN5 A;  3PO3 H;  2Z6K C;  2JA5 G;  1V9P A;  4APV A;  2Q2H A;  1PFS A;  1YBY A;  3H0G G;  5IYB H;  3GO5 A;  1LTL A;  1VQE A;  4A4I A;  3GTP H;  5FJ8 G;  3UDX A;  1YHB A;  3OW2 A;  1CSQ A;  3CD6 A;  5JJI A;  2OQ0 A;  4EX5 A;  1GM5 A;  4AYB E;  2VW9 A;  2WB1 G;  3PGZ A;  3CME A;  2R92 G;  3M3Y H;  1HR0 Q;  4DR6 Q;  2VY3 A;  2L15 A;  1HR0 L;  4DR6 L;  1KIX A;  3HOU G;  2Y0S E;  2Z6K A;  1WJJ A;  4DUY L;  2PQA A;  4UPA A;  2EQS A;  3LGJ A;  3RR5 A;  5C0X I;  4OWT B;  5M5X H;  4A3J H;  1QZG A;  1QZH A;  1VQ4 A;  2KHJ A;  1BBU A;  1XMO Q;  1CKO A;  1YVC A;  2K75 A;  4X64 L;  5C0X G;  5IYD G;  1NJI C;  1N32 Q;  3OYY A;  1I50 H;  1KXL A;  2IY5 B;  3HKS A;  4OO1 G;  4O2D A;  3K80 C;  1CKN A;  4FDB A;  4A3E H;  2D62 A;  5GAG C;  1VS0 A;  2KBN A;  2PMZ E;  1PH9 A;  2C35 B;  2WFW A;  4JBM A;  1L0W A;  2UXB L;  2HIV A;  4JI0 Q;  1KHI A;  2GN5 A;  4JI5 L;  4Y7N H;  5C4J H;  4R4C A;  4DV1 Q;  4BY7 G;  5C4X G;  4LF9 L;  4A75 A;  4JI0 L;  2A19 A;  3S14 H;  4X65 Q;  1S40 A;  2EIF A;  1PH6 A;  1BKB A;  1OXS C;  5HGQ A;  5M5W H;  4X65 L;  3L7Z C;  3PCO B;  5IT9 c;  3F2C A;  4DV6 Q;  4LFB Q;  1JJ2 A;  4LWC A;  2JA6 G;  4LFB L;  3AYH B;  1J5E Q;  3ICE A;  1YEZ A;  4JYA Q;  1HZC A;  2EXD A;  1HR0 W;  3KF8 B;  1Q86 C;  1J5E L;  1Q1B A;  2ZJR A;  1PH4 A;  2ZTE A;  1Y1W G;  1G51 A;  4JI1 Q;  5JEA G;  1TXY A;  5IP9 H;  4LF6 L;  4GN3 B;  4BA1 I;  2DUD A;  1HNZ Q;  1VQG A;  3PV0 A;  5EAY A;  2MNA A;  3F1Z A;  3HOW G;  1AE3 A;  3I7F A;  3AFP A;  2JA8 H;  3NEM A;  5HY6 A;  2JA7 H;  2V1C C;  4JBK A;  2CKZ B;  1OXV A;  1EQR A;  1LYL A;  1EYG A;  1Q81 C;  4A3G H;  1EWI A;  3JAM i;  4IOC A;  2WB1 E;  2ALY B;  3G71 A;  2WAQ G;  1VQC A;  3GTM H;  3HOV H;  1WI5 A;  2YTV A;  1Q46 A;  4DUZ Q;  1YJN A;  1LM0 A;  4IPC A;  2K50 A;  3HOY H;  2K5H A;  3HOZ G;  3CCM A;  4A76 A;  3RLO A;  1FL0 A;  1AE2 A;  4DUZ L;  2NVT H;  2FXQ A;  1TWC H;  3AEV A;  3PO2 G;  5M3F G;  1N34 Q;  1QUQ A;  1VQF A;  3RZO H;  1WOC A;  2RHS B;  4JBJ A;  1YHQ A;  4JI7 Q;  3TRZ A;  4X62 L;  4BBS G;  2VS1 A;  1PH1 A;  4JI7 L;  4JOI A;  1VQ5 A;  2AKW B;  3KYH C;  4AQY Q;  5FLM G;  1JJC B;  3EN2 A;  4AQY L;  4A3M H;  2BA0 A;  4DV3 L;  4HIO A;  1Q7Y C;  2GVA A;  3J7Z C;  3A5U A;  2UXD Q;  4HIK A;  1X55 A;  2CCZ A;  2UXC L;  2K5V A;  3KDF B;  2UXD L;  3L2P A;  3RN2 A;  3J81 c;  3UE0 A;  3U50 C;  4LFA Q;  4GNX C;  3PF5 A;  1IBK L;  5M3M G;  3I2Z A;  4QGU A;  2E2I H;  4B3S Q;  4GKJ Q;  3RZD H;  2R93 G;  4LFA L;  3J7A 5;  2CFM A;  3M4P A;  2ZJQ A;  2UU9 Q;  4GKJ L;  1AH9 A;  1EOV A;  4JG2 A;  2F3I A;  3CCS A;  1IBL Q;  4A3D G;  5FLX c;  2PI2 A;  2UU9 L;  2KEN A;  3CW2 C;  2VQE L;  2Q2I A;  3FKI G;  1WCM H;  3B6Y A;  1IBL L;  2WP8 J;  3PUX A;  4LF7 L;  2N8N A;  3CAM A;  4JI8 Q;  3WWV A;  5IP7 H;  3GTJ H;  3CMA A;  2F52 A;  1PHJ A;  4JI8 L;  2VQF Q;  3T1H Q;  4PZ8 A;  3HOX G;  2JA9 A;  2D0O A;  2R7Z H;  1QVG A;  2A8V A;  2NN6 I;  3J80 c;  2VQF L;  1I6H H;  1EQQ A;  4OWX B;  3CC7 A;  2MO0 A;  2OTL A;  4C3J H;  2NN6 G;  4GS3 A;  1K8G A;  1XNR L;  4A3F G;  1E7Z A;  4LF5 L;  3A0J A;  1W3S A;  3W5O A;  1OTC A; 
#chains in the Genus database with same CATH topology
 1U4M A;  4RHR A;  3E9I A;  4EGV A;  2G5D A;  2PI2 E;  1VMC A;  3VDY A;  2QW7 A;  4HIM A;  1LTT D;  1U4R A;  1BUV T;  4IPG A;  2IL8 A;  2CWA A;  1WD1 A;  1CA6 A;  1F9Q A;  2K5Q A;  4R4O A;  4LMQ D;  1ZKO A;  3UI2 A;  2Q2T A;  1WTV A;  4DK1 A;  4QIW E;  4QIW B;  2Z9H A;  3G4S A;  4JK1 C;  4IN3 A;  3K5N A;  1Y1V G;  2B63 B;  2L4N A;  4L5R C;  3TQY A;  1K83 H;  3ND9 A;  2QGQ A;  1F9S A;  3S9W A;  4OX9 L;  2NTT A;  3S2H H;  4RCN A;  1H9M A;  2J7Z A;  3CKI B;  2QEX A;  5A35 A;  5E4W C;  3RMH A;  3H94 A;  3TME A;  3BJU A;  5M9O A;  4JI5 Q;  4RGO S;  4YY3 L;  1SAP A;  1S5C D;  1ENA A;  2R7D A;  3CCL A;  1UEA B;  2H5X A;  3AB9 A;  3V2T A;  2L55 A;  4RAU C;  1MGS A;  5FLX E;  4DR3 Q;  5D3D A;  4A3J G;  4C1N K;  2I46 A;  4DR3 L;  4PNY A;  4EQ5 A;  2PCF B;  5FKA C;  1SRU A;  1M4V A;  1TVX A;  1DD2 A;  2NVQ B;  5K36 G;  2NB0 A;  2N3S A;  4IUN A;  3BU2 A;  4KKS A;  2M00 A;  4RMF A;  1AP0 A;  1II3 A;  1X65 A;  1H9S B;  4JBW A;  1TWH B;  1STN A;  1XTC D;  1MSG A;  3GTG B;  1G8Z D;  2RSN A;  3S24 A;  5IIF A;  3PIO A;  4P2C B;  1JT8 A;  4HN7 A;  1VF5 C;  2XTI A;  3J81 i;  5AJ3 Q;  2XN9 C;  2R92 B;  2F0U A;  5AJ3 L;  2B2U C;  1EOT A;  3H91 A;  3A8J E;  4LK1 C;  2IT1 A;  5AFW A;  3UDG A;  2FJ2 A;  4YWM A;  1LT4 D;  2FMM A;  1VQP A;  2C9O A;  2D9U A;  1JOR A;  2RBM A;  3D4R A;  1TWA B;  4DV3 Q;  1SE2 A;  4C3I H;  5IWA L;  4H13 C;  4IO9 A;  5H1S E;  3C3L A;  2UXC Q;  3SR1 A;  1O7I A;  4A3C H;  3J80 i;  2JJQ A;  2KA7 A;  1IBK Q;  3P7J A;  4XT3 B;  1I4R A;  1A3T A;  1B50 A;  3D4W A;  3VR2 A;  5EPJ A;  2KCT A;  4HID A;  3S15 H;  4X3U A;  2JA6 B;  5G3L D;  2ZXP A;  2LSS A;  4TRD A;  5FO9 B;  1SMY D;  4GNX A;  3CPF A;  2F0F A;  3TRE A;  5C4H A;  2R61 A;  1JB3 A;  1I94 L;  3STB C;  1Z47 A;  3VA7 A;  4WFN 3;  3H0G H;  1M90 C;  4DU9 A;  1TWG B;  3BZK A;  1AZQ A;  4PQX A;  1VQA A;  3RLN A;  4ZLT F;  4L8J A;  4JI4 Q;  1D7Q A;  2E2J H;  3S1M B;  1IYV A;  1L0Y B;  1OXU A;  2OWO A;  1HJP A;  4UY8 C;  1BF4 A;  4X66 L;  2JN4 A;  2K32 A;  1WCM G;  4JI2 Q;  1SR3 A;  2YTX A;  4YWL A;  3H3V I;  1I4H A;  5IP7 G;  3NUC A;  5J22 A;  1EY5 A;  4JPB W;  4DK3 C;  3C2P A;  1T5E A;  1I4X A;  1HPC A;  4LFC Q;  2A74 C;  4OXP A;  5EQ0 A;  1S72 A;  2RDG A;  1PH5 A;  4LFC L;  2QDL A;  4U68 A;  4B9X A;  3IRB A;  4P74 A;  1CUK A;  2PNR C;  2HT1 A;  1TT2 A;  1QOH A;  2FFK B;  1G2T A;  2Z0S A;  4MNO A;  2F0V A;  3F8T A;  3HKZ E;  1HNX Q;  5JVG 3;  2R93 B;  3HKZ B;  3L0O A;  1CT1 D;  1ENF A;  5LMU Q;  3HEJ A;  1D6E C;  1L1O B;  4FXK C;  5LMU L;  3CC2 A;  4A3L H;  4OEM B;  2R7F A;  1EFW A;  2HIX A;  3R93 A;  5IGF A;  2MQH A;  4LAA A;  2Z6B A;  2EY2 A;  2RA4 A;  3SK6 A;  3O13 A;  1Y1W H;  3GTL H;  2VUM G;  1D2B A;  3K7U C;  2B8F A;  3HOW H;  5EPK A;  4WJ4 A;  5C5L A;  1VQ9 A;  1K73 C;  5IGE A;  1HZ9 A;  2K52 A;  1LLR D;  2KUM A;  1KDC A;  3EA6 A;  2EXZ A;  2KCN A;  3E3X A;  2QIL A;  4MN3 A;  3M9B A;  3DXJ C;  1SFO H;  1FD7 D;  4JI3 Q;  1HFN A;  3CCJ A;  1L2F A;  1TY2 A;  4DXG A;  4JI3 L;  4C1N I;  4A3L G;  3PO2 H;  2VL6 A;  3BDC A;  5M3F H;  4A3I B;  3U9O A;  1TWF B;  1OXX K;  4BBS H;  5KYL A;  4HJ7 A;  1PZK D;  1LTR D;  3BZC A;  4KK7 A;  1PYB A;  4IFD I;  5ELO A;  1PYW D;  3QG1 A;  4IUU A;  1BNZ A;  1NR2 A;  4KD3 A;  3WOF A;  1SYD A;  1ASY A;  3OPO A;  4XDX A;  3KFU A;  1H95 A;  1N9W A;  3NP8 A;  1NMG A;  3PIP A;  2PNH A;  2LMC B;  3PO3 B;  1WYD A;  1VQO A;  3U58 A;  4J6H A;  3SK5 A;  2ZTD A;  5I6W A;  3GTP B;  2BH8 A;  3GQB A;  4DN4 M;  3M7N A;  3AQQ A;  1DGS A;  5IOD A;  1D8L A;  1H9J A;  2B63 G;  2QKI C;  1OXT A;  1ZYR D;  4LUZ A;  3EFX D;  4IJH A;  1HZA A;  4C2M H;  1I6V C;  3D3R A;  4A3F H;  1I50 B;  4O1N A;  4WOR A;  3MXG A;  1Q8I A;  4A93 H;  2H4O A;  2V4D A;  3WOE A;  1EY7 A;  1TWH H;  4KJN A;  1SMX A;  5M5Y B;  2BA1 A;  3TS0 A;  4B3S L;  4DAY A;  2BH2 A;  1XXG A;  3CF5 A;  3KBG A;  3TSS A;  2WKC A;  2DGY A;  3NTK A;  3S14 B;  3A7A B;  2B29 A;  3G7L A;  5IY0 A;  1M1K C;  1S5B D;  4G7Z C;  2MGS A;  2YYZ A;  4BXX H;  3T1H L;  1KNA A;  1DJR D;  1B3A A;  2K5W A;  4Z9C B;  1WTW A;  2XNA C;  1RF2 D;  4NMZ A;  2G9H D;  1VMP A;  1I4G A;  1FVI A;  5KND A;  2ICE C;  2H1E A;  2Q2H A;  5CV5 A;  4KN4 C;  3UDX A;  4F8M A;  3OW2 A;  5HUR A;  1X3P A;  5JJI A;  2JYO A;  3CME A;  2R92 G;  3TZD A;  1TKW B;  2BDN A;  2VB2 X;  2KCC A;  1KIX A;  2Y0S E;  2FHT A;  3IL8 A;  2Z6K A;  3FPU B;  2EQS A;  5C0X I;  1QZG A;  1SJE D;  2KHJ A;  5FK9 C;  1CKO A;  4X64 L;  1IW7 D;  5C0X G;  5IYD G;  3OYY A;  1CQF A;  4OO1 G;  3D4D A;  2PO4 A;  3A8K E;  1IHZ A;  1VS0 A;  4A3M B;  2HDL A;  2KBN A;  4FF3 A;  4HMJ A;  1FGB D;  4OHJ A;  2C35 B;  1SE4 A;  5I9P A;  2HIV A;  4JI0 Q;  5C4J H;  1J9O A;  4ZCK A;  4R4C A;  2IX3 A;  1LTI D;  4JI0 L;  1SYF A;  2A19 A;  4X65 Q;  1S40 A;  1PH6 A;  4K5X A;  3RZD B;  5CBA E;  4X65 L;  1GHJ A;  3PCO B;  5IT9 c;  3F2C A;  4LFB Q;  5A2Q E;  1C48 A;  2JA6 G;  4LFB L;  1Y8O B;  3AYH B;  3K58 A;  5ISR A;  4JYA Q;  2CHB D;  1HR0 W;  2EXD A;  3MXU A;  2KHS A;  3PMF A;  1Q86 C;  5E3F A;  4BBR B;  1D1K A;  2X69 A;  1G51 A;  4JI1 Q;  5JEA G;  1TXY A;  4LF6 L;  3T13 A;  5EPL A;  4RWS C;  3I70 A;  1HNZ Q;  4HR7 B;  3PV0 A;  5EAY A;  2MNA A;  2HUG A;  2RKS A;  4A3B B;  2E76 C;  4XYQ A;  4C3J B;  2QF7 A;  3AFP A;  2JA8 H;  2CW0 C;  4JBK A;  1WD0 A;  1DXM A;  4WJW A;  2WV6 D;  3JAM i;  3NHH A;  3G71 A;  2ALY B;  3GTM H;  4CHT B;  1GUT A;  2YTV A;  3HOY H;  5EKK A;  2K50 A;  3HOZ G;  1ICW A;  3CCM A;  1IW7 C;  2IWH A;  3NBI A;  3DEO A;  3AEV A;  1N34 Q;  1VQF A;  3RZO H;  5L37 A;  3VR4 A;  5CGK A;  3KYH C;  1M8A A;  4OIK A;  1A3U A;  1I4P A;  3V96 A;  4CDD C;  4HIO A;  1K83 B;  2EYJ A;  3A5U A;  3D6W A;  4WRD A;  4YIJ A;  1K3B C;  2EE1 A;  1JWM D;  3PF5 A;  3I2Z A;  2R93 G;  4GKJ Q;  2CFM A;  4HCS A;  4GKJ L;  1EOV A;  2K5D A;  1IBL Q;  4IUV A;  5FLX c;  2KEN A;  3CW2 C;  3SHL A;  2VQE L;  3OMG A;  1IBL L;  3L3O C;  2WP8 J;  3R8B A;  3S1R B;  3NWS A;  1EQV A;  1RJT A;  2AUK A;  3GTJ H;  2F52 A;  4PZ8 A;  4R8I A;  3Q22 A;  4Q0F A;  1EQQ A;  1A6X A;  4K14 A;  2OTL A;  1XNR L;  5TSS A;  1E7Z A;  1KAW A;  2EZV A;  3FPP A;  4JV5 Q;  4POF A;  4KKT A;  4BS9 A;  2B2V A;  1A8V A;  4IUP A;  1CK1 A;  3KBX A;  4JV5 L;  1HZB A;  2Q8T A;  4NW2 A;  4BY1 B;  1GKH A;  4ID6 A;  2WAQ E;  2A69 C;  3CCE A;  2JK8 A;  4GNX B;  4A3I G;  1A63 A;  2F3V A;  3KLW A;  2GA4 B;  4R4T A;  5DLQ E;  4XTC S;  1AEX A;  1SXT A;  2YTY A;  1LUZ A;  1WFQ A;  4FNF A;  1WTQ A;  4IPD A;  3QR8 A;  2KEC A;  4G57 A;  2F0N A;  3K8A A;  1UE6 A;  1B7Y B;  3NQI A;  2R6G A;  4IAL A;  1N33 Q;  1ZXT A;  4RG1 A;  3KF8 A;  3RNU A;  3G6E A;  1N33 L;  3PO3 G;  4C3I B;  4DR4 Q;  3K7A H;  2UXB Q;  4KN7 C;  5M5Y H;  5IYB G;  1S3O A;  4DR4 L;  2O4X A;  2BE5 C;  4Y52 H;  1EWC A;  5C44 H;  1GO3 E;  2ID0 A;  4DR2 Q;  1B53 A;  3EQL C;  1RDP D;  4DR2 L;  1B9N A;  5ELC A;  1KLU D;  2NVX H;  4MIU A;  3NPP A;  2C5C A;  1R9T H;  2NZO A;  1P16 A;  1U4L A;  3QO2 A;  1EZ8 A;  4DV0 Q;  1UE7 A;  1V1Q A;  1PFM A;  5IT9 L;  1TS2 A;  4DV0 L;  2ES2 A;  1PLF A;  3OIQ A;  3K0Y A;  2B2W C;  3QOL A;  1Y69 U;  3MFG A;  1VQ8 A;  2N49 A;  3H0G B;  4HTH A;  3NWT A;  2YU9 H;  4DV5 Q;  1HA5 A;  3DM1 A;  2UUB Q;  4JC0 A;  2E2J B;  2ZTC A;  2K7V A;  4R4Q A;  4DV5 L;  1JB7 A;  2UUB L;  3OTO Q;  3OTO L;  2PW7 A;  4DR5 L;  3ULJ A;  4CBV A;  1GXD C;  5J3B A;  4DFA A;  4JCV E;  2BOS A;  1FJG L;  4K2L A;  3GV6 A;  3I56 A;  4NXM L;  2JE6 I;  4QL5 A;  4QUC A;  2JA7 G;  4B3T Q;  1E2V A;  4B3T L;  1N8R C;  1Y14 B;  2B2T A;  3A7L A;  4RKB A;  2M2L A;  2KJX A;  1HXY D;  1GD7 A;  5ELF A;  5FO8 B;  1IYU A;  4ULL A;  1BQQ T;  4X6A H;  3JAM L;  4LF7 Q;  4BBR H;  4ALP A;  1JQY D;  4CJ1 B;  2ASB A;  1DYQ A;  2OEO A;  3BVM A;  3ZJY C;  5FLX L;  1Y1W B;  4A3M G;  3GTL B;  2AWO A;  1VDZ A;  1V43 A;  4A3B H;  3NXW A;  3X3M A;  1YHA A;  3LX0 A;  2JA5 H;  3HOW B;  3R2T A;  1HH2 P;  3IKJ A;  1SLJ A;  1EEF D;  1IXR A;  2HQL A;  2IHF A;  1PVO A;  3M7G A;  1SNC A;  5FJ8 H;  4TSS A;  3CCV A;  1V1O A;  2E2D C;  1PZI D;  4KTA A;  1SFO B;  3SK4 A;  3R2I A;  4OON A;  1LTG D;  3HOU H;  1P8L A;  5LL6 X;  2E5L Q;  5KEE A;  3PF4 A;  3PO2 B;  2AMC B;  5M3F B;  2E5L L;  4BBS B;  2F3W A;  2E2H H;  2F0S A;  3DMU A;  2R7Z G;  4C3H H;  2RHQ B;  4CKB A;  4ZK9 B;  4N9T A;  4A3B G;  4OX9 Q;  4C3J G;  2F0H A;  3CC4 A;  3S16 H;  4R1J A;  1K3R A;  4KY5 A;  1STY A;  2OCE A;  2IW3 A;  5GRO A;  3J81 j;  5LMN W;  2UUC Q;  3LWU A;  1R4Q B;  5C4X H;  1A62 A;  1YIT A;  1T5X D;  2UUC L;  4LUV A;  4N8F A;  4YY3 Q;  4A3G B;  5I9O A;  3I55 A;  1JE4 A;  3HOV B;  2ICI A;  4X3S A;  1YJW A;  3H3V C;  2J0T D;  3LNN A;  1STE A;  3S1R H;  1CTM A;  3PIO 3;  2PZT A;  1XMO L;  3HZX A;  1GUN A;  1STA A;  4TQU S;  1N32 L;  1VQ6 A;  3KF6 A;  3PUW A;  1Q8K A;  3URY A;  4C2M B;  4ZYS A;  4A3F B;  4CDC C;  1FR3 A;  1WTH A;  3MC0 B;  1U5K A;  1BCP F;  4A93 B;  4BY1 H;  2OQK A;  1KLG D;  2E2I B;  4DNT B;  1X9N A;  1NMF A;  3STB D;  5C5M A;  2JXM B;  2LXJ A;  4GOP A;  2ZXO A;  1CZG A;  5KGU A;  2LFN A;  5JPN C;  4UDU C;  2K5N A;  2A6H C;  1NBW A;  4AH6 A;  4CJ0 B;  2B2W A;  2K6A A;  3S1Q H;  3CCR A;  5FLM H;  4KV6 A;  2AQ2 B;  4J15 A;  5IGC A;  3GTK H;  1VQN A;  4NB3 A;  1EY8 A;  2A6E D;  5IWA Q;  2F0L A;  3DWQ A;  3K59 A;  2IJ0 A;  1CA5 A;  2I07 B;  4ZAI A;  4BY1 G;  1JOQ A;  4H0L C;  4P71 A;  1K28 A;  2IX1 A;  1UWV A;  2XRS D;  1PMR A;  1H9K A;  5KYI A;  3E0E A;  3I72 A;  2YV5 A;  1GOZ A;  3I73 A;  3HG9 A;  1CHP D;  4CJ2 C;  5JJL A;  3FMC A;  3HOX H;  1HCZ A;  4I7Z C;  1RKN A;  4K2K A;  3HP3 A;  3JC6 6;  1I94 Q;  4C3I G;  5LMN Q;  1PTO F;  3F2U A;  4QCL A;  1IKM A;  1KC8 C;  1YNX A;  5LMN L;  5C3X A;  4A3C G;  2EVB A;  5BN4 A;  1NY4 A;  3BZD B;  2DY8 A;  1LT5 D;  3KOJ A;  3NQT A;  3DLL A;  2HD3 A;  1B70 B;  2EYM A;  5C4J B;  2RDH A;  3S1N H;  4ZKB B;  4X66 Q;  1RIP A;  4LF8 Q;  1QVF A;  1KQS A;  1IL8 A;  3H3V H;  1B2T A;  3TS2 A;  5GAD C;  4LF8 L;  2CVR A;  2A6E C;  2G9D A;  3A5Z B;  1T9H A;  5BN5 A;  4DK6 C;  1X3Q A;  1H9R A;  1Z6H A;  3BVZ A;  4TVA B;  4CKC A;  1X3F A;  3FEW X;  3M4Q A;  1X54 A;  4K6L A;  3QJY A;  1EYC A;  3RN5 A;  2EDG A;  3DUZ A;  2Z6K C;  3ND8 A;  1FYC A;  3H0G G;  2JA8 B;  1YNN C;  1ET9 A;  1LTS D;  1HHV A;  2EJG C;  3CD6 A;  4IUT A;  1GM5 A;  4AYB E;  3I4N B;  4AYB B;  4E6I A;  1EU3 A;  3GTM B;  5I6Y A;  2L15 A;  4QUF A;  1HTL D;  4PMB A;  3HOY B;  1BBX C;  5CV4 A;  3BVG A;  4DUY L;  4UPA A;  2QDB A;  1VQ4 A;  3RZO B;  1BBU A;  4CKE A;  1G2S A;  3A55 A;  1NJI C;  2Q8I B;  1KXL A;  2IY5 B;  3HKS A;  1CKN A;  3PQI A;  4A3E H;  2D62 A;  1O7Y A;  1JWU D;  2PMZ E;  2PMZ B;  3KUP A;  4KJO A;  5CBE E;  2PQE A;  1KHI A;  2N88 A;  4Y7N H;  3I8Z A;  4LF9 L;  3K5O A;  1NNX A;  3PIP 3;  1GJX A;  5HGQ A;  3D6C A;  3MXP A;  1W6J A;  4LWC A;  3IFD A;  1YEZ A;  2EOT A;  5CV7 A;  3KF8 B;  1XWE A;  4IFD H;  3FRP B;  1BOS A;  1QIL A;  1Y1W G;  3GTJ B;  4HMI A;  1KTK A;  1V8Q A;  5IP9 H;  1NR4 A;  2TMP A;  3MHB A;  2NTS A;  2FMC A;  3HOW G;  5ELB A;  3I7F A;  3QWN A;  2EY6 A;  5J39 A;  2PZU A;  1TS3 A;  2CKZ B;  2A68 C;  1JR0 D;  2QCP X;  4A3G H;  3AU7 A;  1EWI A;  2SDF A;  4NP5 A;  4IOC A;  2F0W A;  2WB1 E;  2WB1 B;  3HOV H;  4J8Q A;  5BN3 A;  1YJN A;  3NSW A;  1SND A;  4A76 A;  2NVT H;  1TWC H;  3PO2 G;  5M3F G;  1WOC A;  2RHS B;  4BBS G;  1TU2 B;  3TRZ A;  4X62 L;  1PRT F;  1CFM A;  2AKW B;  1SJH D;  4S3S A;  3I3C A;  3EN2 A;  4RFB A;  2LY7 A;  1SBB B;  2F03 A;  1JCK B;  2M9V A;  2GVA A;  4HIK A;  1X55 A;  2CCZ A;  2B8G A;  5D65 A;  1B44 D;  3H09 A;  3ONA B;  1XX8 A;  1F2L A;  4BY7 B;  4QGU A;  2E2I H;  4B3S Q;  3K7A B;  4FF2 A;  3M4P A;  4IUR A;  2ZJQ A;  2BCO A;  4JG2 A;  2X6G A;  3CCS A;  2PI2 A;  1E2Z A;  5C44 B;  1NSN S;  3WWV A;  3HGB A;  5NUC A;  2B2V C;  3CMA A;  1QG7 A;  1KAB A;  5K5P A;  3T1H Q;  3N6R A;  2HCC A;  5A2Q L;  2NVX B;  5J1Z A;  1PDQ A;  1QVG A;  1R9T B;  1JOK A;  2F1M A;  4GS3 A;  1K8G A;  4A3F G;  4LF5 L;  3W5O A;  1OTC A;  5IYC H;  4A93 G;  4RGM A;  1LTA D;  1G6P A;  1RCV D;  1U4P A;  3WDN A;  5FOB B;  1XJV A;  3SGI A;  4KI0 A;  3T51 B;  4LNQ A;  4IFD J;  3MXN B;  2YU9 B;  4PMW A;  2CW0 D;  2F0K A;  2I5L X;  1BO0 A;  1U9R A;  1MKH A;  1K0S A;  4L5S A;  1E1T A;  2Y0S B;  2L0C A;  4BXX G;  4X64 Q;  3UDI A;  1AW7 A;  2FIN B;  4OO1 I;  1VQK A;  4UP7 A;  3I4M H;  1IBM L;  4QJF A;  3MEF A;  3J7Y W;  5I2Y A;  1X3G A;  4POG A;  1BVS A;  4ZUJ A;  3QOJ A;  3A74 A;  4FP5 D;  3J81 E;  1NTG A;  3D31 A;  5GQO A;  1ESF A;  1XMQ Q;  3GDE A;  1VQD A;  3PUY A;  2A1A A;  1XMQ L;  2RCN A;  1PYS B;  4F7X A;  4YCU A;  4XQN A;  2K1B A;  2XIW A;  2Z4H A;  1W2B A;  4LF6 Q;  4RA8 A;  1E24 A;  2A73 B;  4V19 0;  5C6A A;  2EYO A;  3SXH A;  3J80 E;  2P5Z X;  5DNF A;  4DNI A;  1EQT A;  3ULL A;  2NUC A;  4P75 A;  4XIG S;  2JA5 B;  5CMD A;  4DAM A;  3P20 A;  3FP9 A;  4DR1 Q;  3I4N H;  2UUA Q;  1HNW L;  5JVH 3;  4DR1 L;  4EVO A;  3DEP A;  1D5Z C;  2UUA L;  1A0I A;  3KLS X;  3K6O A;  4DNR B;  1JOO A;  1YNJ C;  1BCP C;  3KF6 B;  4KHP L;  3HOU B;  1E22 A;  1KL9 A;  1X56 A;  3BDL A;  1GVP A;  2A69 D;  1ASZ A;  2IPK D;  3Q0A A;  5EKL A;  5HGT A;  1AN8 A;  1LT3 D;  2B2T C;  1NE3 A;  2F0G A;  3I4O A;  4A3K H;  3GTQ H;  2E2H B;  2ENB A;  1BBW A;  4C3H B;  3VYS A;  4B3R L;  3TBI B;  1PA6 A;  3SK8 A;  2JA8 G;  3S16 B;  2VNU D;  1F2M A;  1JE5 A;  4AYB G;  5C0X J;  5C4X B;  3P75 A;  3HKZ G;  2A5H A;  3M3Y B;  4FO2 A;  3HOY G;  4L5Q A;  2VQE Q;  4IPH A;  4NPS A;  1F77 A;  2F0T A;  1S5D D;  2RF4 A;  4DV2 L;  4PG3 A;  2BE5 D;  1L0X B;  4A3J B;  1SE3 A;  4HJ9 A;  3T4A C;  1K0R A;  1NUC A;  1VQM A;  4OEL B;  1XNR Q;  1VQL A;  3CPW A;  4IUQ A;  1E1O A;  2K03 A;  2PYK A;  4P72 A;  4IOA A;  3OW7 A;  4RKL A;  3MWY W;  1WVL A;  1BXT A;  4RGT A;  4OWW B;  3Q8D A;  5E1F A;  3VYU A;  2N78 A;  4DV4 L;  2O2L D;  1PTO C;  3T1Y L;  2WAQ B;  1C9O A;  3ERO A;  2ZM6 L;  1X6O A;  2CH4 A;  2HHH L;  2F0M A;  1JMC A;  1B9M A;  1FNW A;  1HQR D;  1PH3 A;  3C46 A;  1AZP A;  3PUZ A;  1VQH A;  1EU4 A;  5G3L F;  3S1Q B;  1C7Y A;  3ER0 A;  3SEB A;  1I4Q A;  2WKD A;  3CCQ A;  1PH7 A;  2D0P A;  1SYE A;  1EYA A;  2B2Y A;  3GTK B;  4LUO A;  4BY7 H;  1TQO A;  5GAH C;  3EBE A;  2MHV A;  4B08 A;  4MZ9 A;  1IKL A;  1RTN A;  1PZJ D;  4G4K A;  4WJ3 M;  1EIH A;  4ME3 A;  1Y8N B;  4KKU A;  1GHK A;  2ATW A;  1EWH A;  2WAC A;  3QB3 A;  4MTN A;  5EBD A;  4YWK A;  1HRJ A;  1K9M C;  2K4K A;  3RLF A;  3ITP A;  3HOX B;  3VR5 A;  1TII D;  5ELE A;  2L1B A;  3MAQ A;  1WTX A;  2AQ3 B;  5IE8 A;  4GOP C;  1VQB A;  4Q5V A;  2I0Q A;  2HCI A;  1RL2 A;  1QJO A;  2F0E A;  4M1U B;  2DY7 A;  4DV1 L;  1PFB A;  3IAY A;  1FGU A;  1SN8 A;  1B8A A;  1GUG A;  2MP1 A;  1SE8 A;  4DV7 Q;  1SRO A;  2RVL A;  4KD4 A;  5C44 G;  1ONL A;  4DV7 L;  2VZA A;  4DV6 L;  2JEB I;  3M4O H;  3K57 A;  1E3P A;  1MD2 D;  4KHV A;  1EFI D;  1CKN B;  1DOM A;  3S1N B;  2F0D A;  1Q1E A;  4DR5 Q;  2I5M X;  3GD7 A;  4L63 B;  1OO9 B;  5I2X A;  4HJ5 A;  1R4P B;  3DWA A;  3T56 B;  3NBH A;  1EIY B;  2K28 A;  4K8J A;  3U4V A;  4HAE A;  1FNU A;  1FNV A;  1I6H B;  1EUJ A;  3BDO A;  1FJG Q;  1CKM A;  1K8O A;  4NXM Q;  1SNO A;  3ULP A;  5EKI A;  2GVB A;  1NCV A;  1S5F D;  4JOI C;  4EQO A;  5M3M H;  1MJE A;  1KAA A;  2E74 C;  4A3D H;  4XXE A;  1YJ9 A;  1G29 1;  3FKI H;  2IHE A;  2OTJ A;  1PTO H;  2Y0S G;  1DON A;  4OL7 A;  4DGZ A;  5F2D A;  4KHZ A;  4PV1 C;  3GP7 A;  3X3N A;  2L11 A;  3CCU A;  1I3Q H;  2KHI A;  2NN6 H;  3CHB D;  4O0A A;  1LAB A;  4AIM A;  3D0F A;  3MA2 B;  1I5F A;  4R9W A;  4NXN Q;  4A3E B;  5COY A;  4GN4 B;  4NXN L;  5LL6 S;  1MI2 A;  1B1Z A;  1LTB D;  5BR8 Q;  3OOC A;  4Y7N B;  2DNE A;  1SYC A;  4ABN A;  5BR8 L;  2LXK A;  3NEN A;  1MJC A;  3W1G A;  1LV9 A;  4ZUI A;  4RGN A;  3NTI A;  1XNQ Q;  5KNC A;  2CH4 W;  1Q82 C;  1LO5 D;  4BBR G;  1XNQ L;  1Y1V H;  3G48 A;  4M8A A;  1Z7T A;  1J8I A;  2F4I A;  5C3E B;  2NVY H;  4KLK A;  1HFG A;  4DAY B;  2A6H D;  1NAP A;  4DK0 A;  2JA5 G;  3NK9 A;  1V9P A;  3ERQ A;  4APV A;  2F0Q A;  1PFS A;  3GO5 A;  1LTL A;  1VQE A;  3CRL C;  4A4I A;  2ZXR A;  3GTO B;  5FJ8 G;  1Y8P B;  1YHB A;  2OQ0 A;  4EX5 A;  3VR6 A;  3M3Y H;  2WII B;  1QCB D;  3BYY B;  4ZRZ A;  1HQM C;  3HOU G;  1SNM A;  1O7Z A;  1WJJ A;  5LHY 1;  2PQA A;  2NVT B;  3LGJ A;  4A3J H;  1TWC B;  4OWT B;  5M5X H;  1QZH A;  2Z1C A;  1XMO Q;  1YVC A;  2K75 A;  3RUZ A;  4XT1 B;  1N32 Q;  3KK7 A;  4C3H G;  4O2D A;  3K80 C;  5COR A;  1HUN A;  4FDB A;  2K05 A;  4DXF A;  5K36 H;  4KMU C;  1PH9 A;  4ME5 A;  4CDE C;  2WFW A;  4EQN A;  1L0W A;  1F2Z A;  4FF1 A;  2GN5 A;  4JI5 L;  3JAM E;  5C4X G;  3OWE B;  1BKB A;  2JP1 A;  1OXS C;  5CV9 A;  5M5W H;  1JJ2 A;  5IGD A;  1STH A;  3DWP A;  2EYH A;  3C1F A;  2XWJ B;  4BWG B;  2LS0 1;  1HZC A;  1Q1B A;  3S17 B;  2ZT9 C;  5IGB A;  2KED A;  4RCO A;  1SYB A;  2DUD A;  2PZW A;  5DM7 3;  1VQG A;  4ZQ3 A;  2DJF C;  1AE3 A;  1UUP A;  5HY6 A;  1UNS A;  3MEH A;  1EQR A;  3IFT A;  2RQX A;  1EYG A;  3TN2 A;  4JW0 A;  2WAQ G;  3OSO A;  1LM0 A;  4IPC A;  1V1P A;  2X6L A;  3RLO A;  1FL0 A;  2FXQ A;  3EJI A;  1QUQ A;  4I65 A;  1YNN D;  3G6J B;  1YHQ A;  4JI7 Q;  2VS1 A;  1PH1 A;  4JI7 L;  4JOI A;  4H44 C;  4DF7 A;  4XQJ A;  5FLM G;  1SYG A;  1ILQ A;  1JJC B;  1SDF A;  3Q6S A;  5CR3 A;  4L6T B;  4DV3 L;  1Q7Y C;  2UXD Q;  2UXC L;  2K5V A;  2UXD L;  3L2P A;  3J81 c;  3I4M B;  3U50 C;  4LFA Q;  2LKV A;  1IBK L;  2MJ8 A;  2O5J C;  1EY0 A;  4LFA L;  3J7A F;  1AH9 A;  1SSO A;  2HDM A;  1HTP A;  1WCM H;  3MVV A;  3PUX A;  4QMG A;  2N8N A;  2EY1 A;  5IP7 H;  1HUM A;  1PHJ A;  2VQF Q;  3HOX G;  3R3O A;  2JA9 A;  5FO7 B;  3GV3 A;  2EYL A;  3J80 c;  2VQF L;  1I6H H;  1MBY A;  2MO0 A;  3TZU A;  3EVQ A;  5EGT A;  1E2W A;  1EY4 A;  1QNU A;  1CHQ D;  1UAP A;  1W3S A;  4HJA A;  1X3E A;  1ET6 A;  2SNM A;  3T53 B;  4JI4 L;  5JJZ A;  4HED A;  4B9W A;  2ZJP A;  3A54 A;  3D8G A;  2K04 A;  3HOZ B;  1KRS A;  3CQZ H;  4UP8 A;  1Z9F A;  4JI2 L;  5GAE C;  1VF7 A;  4KY6 A;  2A68 D;  4DUY Q;  2N55 A;  3ZYY X;  4CDF C;  1TS4 A;  2SEB D;  4JI6 Q;  2VUM H;  2F0P A;  3LWE A;  4FXG C;  4PZ7 A;  5DEH A;  2F4V Q;  4JI6 L;  1CQV A;  4X3T A;  1IL2 A;  2F4V L;  4A3K B;  1K8M A;  3GTQ B;  1D5M C;  3BS1 A;  2MPM A;  1BDO A;  2AHO B;  4LF9 Q;  3T16 A;  1HNX L;  4K5V A;  4R8N A;  2Q2U A;  1MIU A;  1SMY C;  1VCI A;  5CV8 A;  3S2D B;  4GKK Q;  4GKK L;  5T1I A;  3CP0 A;  4B3M Q;  1VQI A;  4J1M A;  3F2B A;  4B3M L;  1IYJ B;  5C3E H;  1VQ7 A;  4A3E G;  3U4Z A;  3FHW A;  2KOL A;  1F9R A;  1UE1 A;  5CYU A;  1PH8 A;  1XPU A;  1G6Z A;  5C4Z A;  4LW1 A;  1XPO A;  3GTO H;  4FXD A;  3W2D A;  3I4L A;  1A15 A;  4XQQ A;  4UP9 A;  4X3K A;  3BG3 A;  3NE5 B;  1S5E D;  5IOC A;  1WTO A;  1ILP A;  4OIJ A;  4NDX A;  3KDF A;  2HQE A;  4IJL A;  3K0X A;  4QB4 A;  1IZ6 A;  2SNS A;  1KRT A;  1CI3 M;  2B63 H;  4X62 Q;  1YZ6 A;  3OIP A;  5CC4 A;  4C56 C;  4IFD G;  3J7A V;  3CXC A;  5C3E G;  2I5H A;  3M4Y A;  5IP9 G;  3AMU A;  2RDF A;  1EEI D;  2B2U A;  4OGQ C;  4QF4 A;  4DR7 Q;  5JJK A;  1K8A C;  4DR7 L;  1MSH A;  2KQ3 A;  2CQO A;  4A3G G;  1JC7 A;  1C4Q A;  1SNP A;  4RHS A;  3NBH B;  1GUS A;  2NZH A;  4ZKC B;  1VQJ A;  1D1I A;  1PFN A;  3HOV G;  1QVC A;  4K5W A;  1WTR A;  2NYZ D;  4XYO A;  2L5T A;  1RHP A;  5IGG A;  3Q23 A;  3J81 L;  4TKO B;  2MUY A;  3QIA A;  3S17 H;  5E7N A;  3CRK C;  4IQZ A;  3HFZ B;  1BCP B;  2NVQ H;  4UAI A;  2E8G A;  2B39 A;  5D14 A;  1X32 A;  1UE5 A;  4LF5 Q;  4GN5 A;  4CGY B;  3GTG H;  2EY5 A;  4GLV B;  1AFP A;  3KJP A;  1L1O C;  3J80 L;  3OWF A;  4DKA C;  3PSI A;  3VYR A;  2E75 C;  2R92 H;  2D5D A;  2L12 A;  4QY7 A;  3TP6 A;  3W1B A;  2CWP A;  1SEB D;  1GUW A;  1QWY A;  3A8I E;  4P73 A;  2B2Y C;  3DM3 A;  1A2U A;  3M4O B;  1J6Q A;  4R4I A;  1JIC A;  2XVS A;  3UDF A;  5C0X H;  4PMC A;  5IYD H;  1TWA H;  4YHH Q;  4YCW A;  5KNB A;  4OO1 H;  4YHH L;  1ROD A;  2DN8 A;  1YNJ D;  1BCP D;  4QQB X;  1U0L A;  4DAV A;  1IBM Q;  1Q3L A;  5IYC G;  2JA7 B;  1PV4 A;  4BA2 I;  3F2D A;  3SVM A;  5KRU A;  3UE1 A;  4PZ6 A;  5M3M B;  1ZYR C;  1EZ6 A;  5DM6 3;  3PUV A;  1CZW A;  1H9S A;  2JA6 H;  4A3D B;  4MTK A;  3DHQ A;  1XTD A;  2PPB C;  3V05 A;  3FKI B;  4O42 A;  1Q90 A;  2KCM A;  2B3G A;  5E4X A;  1O80 A;  1PTO B;  2XGT A;  3ERS X;  2WIN B;  3VYT A;  5T1G A;  5JEA H;  1EIG A;  2MO1 A;  1N36 Q;  1B4O A;  1N36 L;  3I91 A;  1ICF B;  1I3Q B;  1TWG H;  1TY0 A;  3I4M G;  2NZ1 D;  3S1M H;  4LF4 Q;  3E9H A;  4DPG A;  2PQA B;  4LF4 L;  2AWN A;  1RTO A;  2BDO A;  2OF1 A;  4DAP A;  1PXU A;  3HOZ H;  1HNW Q;  3MTS A;  4GLA C;  2Z8L A;  1C0A A;  1CSP A;  1S4Z A;  4NKL A;  5JAV A;  1SNQ A;  1YI2 A;  4JYA L;  4KHP Q;  2RSO A;  1O7L A;  2OT2 A;  1QE6 A;  3HRZ C;  4JI1 L;  3H6M A;  2R7Z B;  3L9A X;  3W3A A;  1PTO D;  1Y1V B;  2KEE A;  1JJG A;  2NBF A;  1HNZ L;  1MHW C;  1WTP A;  1DCZ A;  4GLX A;  4B3R Q;  1ML0 D;  3E6Z X;  1YIJ A;  3EIV A;  2NVY B;  1ZEQ X;  3Q24 A;  2XSC A;  1DM0 B;  1DOL A;  1LAC A;  1A3V A;  2JQO A;  4ILW A;  4H02 A;  4G7H C;  2R93 H;  2F0O A;  4GOP B;  2K14 A;  5ELN A;  4FYD A;  3E0J A;  4FVM A;  3I4N G;  3S2D H;  1A2T A;  2IX0 A;  2VB3 X;  1N34 L;  2MFI A;  4LJZ C;  2QA4 A;  2AQ1 B;  4DV2 Q;  3BYT B;  2D2C C;  4YCV A;  3AFQ A;  4V0B A;  4L5T A;  1QB5 D;  4G7O C;  1EL0 A;  5M5X B;  4FF4 A;  3H15 A;  3SDZ A;  4K0K Q;  4A3K G;  4IZ8 A;  4K0K L;  5DAU A;  3JAM c;  4N8X 1;  3S2H B;  1KD1 C;  2Q8R E;  3NEL A;  1V1P B;  1PH2 A;  2XWB B;  3N52 A;  4HJ8 A;  3TEH B;  1QUQ B;  1EY6 A;  1DOK A;  5KIX A;  4K8I A;  1XYI A;  3TDQ A;  1RD9 D;  1UEB A;  4DV4 Q;  3K5M A;  3HS0 C;  4HCE A;  4A3I H;  1TWF H;  1XPR A;  3T1Y Q;  3KJO A;  1G91 A;  5JEA J;  2ZM6 Q;  5M5W B;  4ODG A;  2HHH Q;  1EIF A;  3K81 C;  3NTH A;  4MHE A;  2JEA I;  1JWS D;  4KY7 A;  3FVQ A;  1L1O A;  2AUJ D;  2KVM A;  1B3Q A;  4K6D A;  3M85 A;  4H7B A;  2VXW A;  1Q12 A;  3PO3 H;  2OXP A;  1YBY A;  5IYB H;  3P1H A;  4U67 3;  3GTP H;  1CSQ A;  4F88 A;  1PRT B;  4F87 A;  2VW9 A;  2WB1 G;  3PGZ A;  1ENC A;  1HR0 Q;  4DR6 Q;  4HSV A;  2VY3 A;  3KLS A;  1HR0 L;  4DR6 L;  1GUO A;  5EJW A;  3RR5 A;  1HA6 A;  2EJM A;  1I50 H;  1LT6 D;  4EQP A;  2L9H A;  5GAG C;  2F0J A;  3SE0 A;  2PW5 A;  4GZY C;  2RCF A;  2EYP A;  4DA2 A;  4JBM A;  3A56 A;  2UXB L;  4N9P A;  1D5X C;  1F2Y A;  3MZ5 A;  5C3W A;  4BY7 G;  4DV1 Q;  4UHV A;  4A75 A;  3S14 H;  2EIF A;  2O5I C;  3L7Z C;  3OMC A;  3KLR A;  2Z4I A;  4DV6 Q;  1PRT D;  3U9S A;  1BR9 A;  3S15 B;  5CV6 A;  1J5E Q;  3OHX C;  3ICE A;  1WCM B;  1C8C A;  2TSS A;  1J5E L;  2ZJR A;  5EBC A;  1PH4 A;  2ZTE A;  2EPB A;  1EY9 A;  2F0I A;  4GN3 B;  3CU7 A;  4BA1 I;  1STB A;  3F1Z A;  1W6K A;  1KDB A;  5JOB A;  2DNC A;  2J4X A;  2QEJ C;  3NEM A;  5JPM C;  2JA7 H;  2V1C C;  1OXV A;  1LYL A;  2SOB A;  1Q81 C;  3C1E A;  1VQC A;  4JVZ A;  1WI5 A;  1Q46 A;  4DUZ Q;  1KDA A;  4I7A A;  2K5H A;  5D3I B;  2K33 A;  3VR3 A;  1AE2 A;  4DUZ L;  1ESR A;  3CQZ B;  4JBJ A;  1TS5 A;  1VQ5 A;  4AQY Q;  1STG A;  3K5L A;  2NWG A;  4AQY L;  4A3M H;  1F9P A;  2BA0 A;  2VUM B;  3J7Z C;  2DJG C;  5ELD A;  3KDF B;  2EYF A;  3RN2 A;  1TR5 A;  4HSP A;  2EJF C;  3E5S A;  3UE0 A;  4GNX C;  1PRT C;  5M3M G;  3RZD H;  1EYD A;  3J7A 5;  1CM9 A;  2UU9 Q;  1QNK A;  2F3I A;  3FDT A;  4A3D G;  2UU9 L;  2Q2I A;  3FKI G;  3B6Y A;  4RH6 A;  2JSO A;  2K01 A;  2XRQ D;  3TP5 A;  4LF7 L;  3CAM A;  4JI8 Q;  3VA5 A;  5IT9 E;  2CQA A;  3MXN A;  1DZ1 A;  1E0B A;  4JI8 L;  3I90 A;  3RD4 A;  2D0O A;  2R7Z H;  3TP8 A;  2A8V A;  1KNE A;  1O78 A;  2NN6 I;  4OWX B;  3CC7 A;  2R3Z A;  3TP7 A;  4C3J H;  2NN6 G;  5I4D A;  3MFY A;  3A0J A; 
#chains in the Genus database with same CATH homology
 5IYC H;  1KAW A;  3E9I A;  4JV5 Q;  4A93 G;  4POF A;  1A8V A;  2PI2 E;  4HJA A;  3VDY A;  1G6P A;  4JV5 L;  1HZB A;  1X3E A;  1GKH A;  4HIM A;  1XJV A;  3SGI A;  4JI4 L;  4KI0 A;  2WAQ E;  4IPG A;  2ZJP A;  3CCE A;  4LNQ A;  2JK8 A;  2CWA A;  4GNX B;  3MXN B;  1KRS A;  4A3I G;  4IFD J;  1A63 A;  3CQZ H;  4PMW A;  4UP8 A;  1Z9F A;  4JI2 L;  2I5L X;  4R4O A;  5GAE C;  2Q2T A;  1MKH A;  3KLW A;  4QIW E;  4R4T A;  4DUY Q;  5DLQ E;  4XTC S;  4L5S A;  3G4S A;  1E1T A;  2YTY A;  1LUZ A;  1WFQ A;  4BXX G;  4X64 Q;  1Y1V G;  4IPD A;  3UDI A;  4JI6 Q;  4L5R C;  3TQY A;  2VUM H;  1K83 H;  3K8A A;  4PZ7 A;  1UE6 A;  1VQK A;  2QGQ A;  2F4V Q;  4OO1 I;  4JI6 L;  1B7Y B;  4OX9 L;  2R6G A;  1IL2 A;  1N33 Q;  2F4V L;  4RG1 A;  4UP7 A;  3I4M H;  3RNU A;  1IBM L;  3S2H H;  4QJF A;  3G6E A;  3MEF A;  1N33 L;  3PO3 G;  4DR4 Q;  3K7A H;  2UXB Q;  2QEX A;  5M5Y H;  5IYB G;  4JI5 Q;  1S3O A;  3BJU A;  4DR4 L;  2AHO B;  1X3G A;  4YY3 L;  4LF9 Q;  1BVS A;  4POG A;  3A74 A;  2Q2U A;  1HNX L;  2R7D A;  3CCL A;  4Y52 H;  1MIU A;  1NTG A;  5C44 H;  1GO3 E;  1VCI A;  2H5X A;  2ID0 A;  3D31 A;  5GQO A;  4DR2 Q;  4GKK Q;  1XMQ Q;  4DR2 L;  3GDE A;  4GKK L;  1VQD A;  2NVX H;  3PUY A;  2A1A A;  3CP0 A;  4DR3 Q;  2RCN A;  1XMQ L;  1PYS B;  1R9T H;  4A3J G;  2NZO A;  4B3M Q;  1VQI A;  4YCU A;  4DR3 L;  3F2B A;  4B3M L;  4EQ5 A;  1P16 A;  1W2B A;  1SRU A;  4LF6 Q;  4DV0 Q;  1UE7 A;  1IYJ B;  1E24 A;  1V1Q A;  5C3E H;  1VQ7 A;  4A3E G;  3U4Z A;  2N3S A;  3FHW A;  4DV0 L;  2ES2 A;  5K36 G;  3BU2 A;  4RMF A;  4DNI A;  1UE1 A;  3ULL A;  1X65 A;  4JBW A;  1PH8 A;  1XPU A;  4LW1 A;  4P75 A;  1XPO A;  4XIG S;  3GTO H;  1VQ8 A;  2N49 A;  4DAM A;  4UP9 A;  2YU9 H;  3FP9 A;  3S24 A;  4DR1 Q;  3PIO A;  4DV5 Q;  3I4N H;  1JT8 A;  2UUA Q;  1HNW L;  2UUB Q;  4JC0 A;  2XTI A;  3J81 i;  2ZTC A;  3KDF A;  4R4Q A;  5AJ3 Q;  4IJL A;  4DV5 L;  4DR1 L;  1JB7 A;  1A0I A;  3K0X A;  2UUA L;  3OTO Q;  2UUB L;  1IZ6 A;  1KRT A;  5AJ3 L;  3KF6 B;  4KHP L;  3OTO L;  4DR5 L;  3ULJ A;  2B63 H;  1E22 A;  4X62 Q;  1KL9 A;  1X56 A;  1YZ6 A;  1GVP A;  2IT1 A;  3UDG A;  1ASZ A;  4IFD G;  4YWM A;  3CXC A;  5C3E G;  5J3B A;  2I5H A;  1VQP A;  5IP9 G;  1NE3 A;  4A3K H;  3I4O A;  3GTQ H;  4JCV E;  4DV3 Q;  1BBW A;  1FJG L;  4C3I H;  5IWA L;  4B3R L;  4IO9 A;  5H1S E;  3I56 A;  1PA6 A;  4NXM L;  2JE6 I;  4QL5 A;  4DR7 Q;  1O7I A;  2JA8 G;  4A3C H;  3J80 i;  2JA7 G;  4B3T Q;  5JJK A;  2VNU D;  2JJQ A;  1K8A C;  4DR7 L;  1JE5 A;  1IBK Q;  4B3T L;  2CQO A;  4A3G G;  1N8R C;  1Y14 B;  4AYB G;  5C0X J;  3HKZ G;  3NBH B;  3HOV G;  2NZH A;  1VQJ A;  1GD7 A;  2KCT A;  4L5Q A;  2VQE Q;  4HID A;  3HOY G;  1QVC A;  4IPH A;  4NPS A;  3S15 H;  4X6A H;  2RF4 A;  4DV2 L;  4PG3 A;  4LF7 Q;  2LSS A;  4BBR H;  3S17 H;  5E7N A;  4ALP A;  4HJ9 A;  1K0R A;  4GNX A;  3CPF A;  3TRE A;  1VQM A;  2ASB A;  3HFZ B;  2NVQ H;  3ZJY C;  4A3M G;  2E8G A;  1XNR Q;  1VQL A;  2AWO A;  1V43 A;  1UE5 A;  1E1O A;  3STB C;  3CPW A;  1I94 L;  4LF5 Q;  4P72 A;  4GN5 A;  4A3B H;  1Z47 A;  1YHA A;  4IOA A;  2JA5 H;  3GTG H;  1HH2 P;  3H0G H;  1SLJ A;  1M90 C;  1IXR A;  2HQL A;  2IHF A;  4GLV B;  1PVO A;  3BZK A;  1VQA A;  5FJ8 H;  3RLN A;  3KJP A;  1L1O C;  4OWW B;  4JI4 Q;  1D7Q A;  3Q8D A;  3CCV A;  4DKA C;  2E2J H;  3PSI A;  2N78 A;  1OXU A;  4DV4 L;  2R92 H;  2OWO A;  4QY7 A;  1HJP A;  3W1B A;  3T1Y L;  4UY8 C;  1C9O A;  2CWP A;  4X66 L;  4OON A;  2ZM6 L;  1X6O A;  1WCM G;  4JI2 Q;  3HOU H;  1P8L A;  1SR3 A;  4P73 A;  2YTX A;  2E5L Q;  3DM3 A;  4YWL A;  2HHH L;  3H3V I;  3PF4 A;  1JMC A;  2AMC B;  5IP7 G;  2E5L L;  1J6Q A;  4R4I A;  1PH3 A;  3UDF A;  2E2H H;  5IYD H;  1TWA H;  3PUZ A;  4YHH Q;  2R7Z G;  1VQH A;  4YCW A;  4C3H H;  4DK3 C;  2RHQ B;  1C7Y A;  3ER0 A;  4YHH L;  4A3B G;  4OX9 Q;  4LFC Q;  3CC4 A;  4OXP A;  1S72 A;  3CCQ A;  4R1J A;  1K3R A;  1U0L A;  2D0P A;  1PH7 A;  1PH5 A;  3S16 H;  4LFC L;  4QQB X;  2OCE A;  1IBM Q;  5GRO A;  5IYC G;  3J81 j;  5LMN W;  1PV4 A;  4LUO A;  3IRB A;  2UUC Q;  3F2D A;  4P74 A;  1CUK A;  2HT1 A;  4BA2 I;  5C4X H;  1A62 A;  3UE1 A;  5GAH C;  1YIT A;  4BY7 H;  2UUC L;  3EBE A;  4LUV A;  4YY3 Q;  2Z0S A;  4MNO A;  4MZ9 A;  4PZ6 A;  3F8T A;  3I55 A;  3HKZ E;  1HNX Q;  3L0O A;  5LMU Q;  4WJ3 M;  1YJW A;  3PUV A;  4ME3 A;  2JA6 H;  1L1O B;  5LMU L;  3CC2 A;  1XTD A;  3S1R H;  2R7F A;  1EFW A;  2HIX A;  2ATW A;  4A3L H;  2KCM A;  2MQH A;  2B3G A;  4MTN A;  4YWK A;  2XGT A;  3ERS X;  1XMO L;  1K9M C;  2K4K A;  3RLF A;  1Y1W H;  4TQU S;  1N32 L;  2MO1 A;  1VQ6 A;  3GTL H;  2VUM G;  1N36 Q;  3K7U C;  3KF6 A;  3PUW A;  1N36 L;  3HOW H;  4WJ4 A;  5IE8 A;  1Q8K A;  1VQB A;  4GOP C;  1VQ9 A;  1TWG H;  2I0Q A;  1K73 C;  3I4M G;  1RL2 A;  1HZ9 A;  2K52 A;  1U5K A;  3S1M H;  4LF4 Q;  4BY1 H;  2OQK A;  4DV1 L;  3E9H A;  1FGU A;  1SN8 A;  1B8A A;  3M9B A;  4DPG A;  1SFO H;  2PQA B;  1X9N A;  2AWN A;  4LF4 L;  1SE8 A;  4DV7 Q;  4JI3 Q;  1NMF A;  1SRO A;  3STB D;  3CCJ A;  3HOZ H;  5C44 G;  1HNW Q;  1L2F A;  4DV7 L;  4JI3 L;  2VZA A;  4GLA C;  4DV6 L;  2JEB I;  3M4O H;  4A3L G;  2LXJ A;  4GOP A;  1C0A A;  1CSP A;  3PO2 H;  2VL6 A;  1E3P A;  5M3F H;  1CKN B;  1OXX K;  4BBS H;  1YI2 A;  1Q1E A;  4JYA L;  4DR5 Q;  2K5N A;  2I5M X;  1NBW A;  3GD7 A;  4AH6 A;  4HJ7 A;  4KHP Q;  4HJ5 A;  3BZC A;  1PYB A;  4IFD I;  5ELO A;  3CCR A;  5FLM H;  1EIY B;  3S1Q H;  4JI1 L;  3U4V A;  1JJG A;  1EUJ A;  4J15 A;  1HNZ L;  3GTK H;  1VQN A;  4GLX A;  4NB3 A;  1ASY A;  1FJG Q;  3KFU A;  1CKM A;  5IWA Q;  4B3R Q;  1H95 A;  2UXC Q;  1YIJ A;  1N9W A;  1NMG A;  3EIV A;  4NXM Q;  3PIP A;  2PNH A;  3ULP A;  2GVB A;  4BY1 G;  4JOI C;  4P71 A;  2JQO A;  5M3M H;  2R93 H;  4H02 A;  1MJE A;  1WYD A;  4GOP B;  1VQO A;  3U58 A;  2K14 A;  5ELN A;  2IX1 A;  2ZTD A;  1UWV A;  2BH8 A;  3I4N G;  1YJ9 A;  3S2D H;  4A3D H;  1G29 1;  3FKI H;  2IHE A;  3E0E A;  2OTJ A;  2IX0 A;  2YV5 A;  3M7N A;  3AQQ A;  1N34 L;  2MFI A;  2QA4 A;  1DGS A;  2Y0S G;  4DV2 Q;  1D8L A;  5JJL A;  4YCV A;  3AFQ A;  2B63 G;  4L5T A;  3HOX H;  4KHZ A;  1OXT A;  4LUZ A;  3H15 A;  3CCU A;  4K0K Q;  1I3Q H;  2KHI A;  1HZA A;  4IJH A;  4A3K G;  4O0A A;  4C2M H;  3JC6 6;  4A3F H;  4K0K L;  4AIM A;  1I94 Q;  5LMN Q;  3JAM c;  3D0F A;  4NXN Q;  1I5F A;  1KC8 C;  1KD1 C;  1YNX A;  4A93 H;  4GN4 B;  5LMN L;  3NEL A;  4A3C G;  4NXN L;  1PH2 A;  1NY4 A;  1TWH H;  4HJ8 A;  1SMX A;  3TEH B;  2BA1 A;  3TS0 A;  3KOJ A;  1QUQ B;  4B3S L;  3DLL A;  2BH2 A;  5BR8 Q;  1B70 B;  3CF5 A;  1UEB A;  4DV4 Q;  2DGY A;  4A3I H;  5BR8 L;  2LXK A;  1TWF H;  3S1N H;  1XPR A;  3NEN A;  2B29 A;  3KJO A;  3T1Y Q;  5JEA J;  1RIP A;  1MJC A;  3W1G A;  4X66 Q;  2ZM6 Q;  4LF8 Q;  1QVF A;  5IY0 A;  1KQS A;  2HHH Q;  1EIF A;  1M1K C;  3K81 C;  5GAD C;  3H3V H;  4LF8 L;  1XNQ Q;  3TS2 A;  2YYZ A;  1Q82 C;  4BXX H;  3A5Z B;  1T9H A;  4BBR G;  3T1H L;  4DK6 C;  1XNQ L;  2JEA I;  1Y1V H;  3G48 A;  1L1O A;  4TVA B;  1X3F A;  3M4Q A;  1X54 A;  3M85 A;  1FVI A;  2NVY H;  1Q12 A;  4KLK A;  4DAY B;  3RN5 A;  3PO3 H;  2Z6K C;  2JA5 G;  1V9P A;  4APV A;  2Q2H A;  1PFS A;  1YBY A;  3H0G G;  5IYB H;  3GO5 A;  1LTL A;  1VQE A;  4A4I A;  3GTP H;  5FJ8 G;  3UDX A;  1YHB A;  3OW2 A;  1CSQ A;  3CD6 A;  5JJI A;  2OQ0 A;  4EX5 A;  1GM5 A;  4AYB E;  2VW9 A;  2WB1 G;  3PGZ A;  3CME A;  2R92 G;  3M3Y H;  1HR0 Q;  4DR6 Q;  2VY3 A;  2L15 A;  1HR0 L;  4DR6 L;  1KIX A;  3HOU G;  2Y0S E;  2Z6K A;  1WJJ A;  4DUY L;  2PQA A;  4UPA A;  2EQS A;  3LGJ A;  3RR5 A;  5C0X I;  4OWT B;  5M5X H;  4A3J H;  1QZG A;  1QZH A;  1VQ4 A;  2KHJ A;  1BBU A;  1XMO Q;  1CKO A;  1YVC A;  2K75 A;  4X64 L;  5C0X G;  5IYD G;  1NJI C;  1N32 Q;  3OYY A;  1I50 H;  1KXL A;  2IY5 B;  3HKS A;  4OO1 G;  4O2D A;  3K80 C;  1CKN A;  4FDB A;  4A3E H;  2D62 A;  5GAG C;  1VS0 A;  2KBN A;  2PMZ E;  1PH9 A;  2C35 B;  2WFW A;  4JBM A;  1L0W A;  2UXB L;  2HIV A;  4JI0 Q;  1KHI A;  2GN5 A;  4JI5 L;  4Y7N H;  5C4J H;  4R4C A;  4DV1 Q;  4BY7 G;  5C4X G;  4LF9 L;  4A75 A;  4JI0 L;  2A19 A;  3S14 H;  4X65 Q;  1S40 A;  2EIF A;  1PH6 A;  1BKB A;  1OXS C;  5HGQ A;  5M5W H;  4X65 L;  3L7Z C;  3PCO B;  5IT9 c;  3F2C A;  4DV6 Q;  4LFB Q;  1JJ2 A;  4LWC A;  2JA6 G;  4LFB L;  3AYH B;  1J5E Q;  3ICE A;  1YEZ A;  4JYA Q;  1HZC A;  2EXD A;  1HR0 W;  3KF8 B;  1Q86 C;  1J5E L;  1Q1B A;  2ZJR A;  1PH4 A;  2ZTE A;  1Y1W G;  1G51 A;  4JI1 Q;  5JEA G;  1TXY A;  5IP9 H;  4LF6 L;  4GN3 B;  4BA1 I;  2DUD A;  1HNZ Q;  1VQG A;  3PV0 A;  5EAY A;  2MNA A;  3F1Z A;  3HOW G;  1AE3 A;  3I7F A;  3AFP A;  2JA8 H;  3NEM A;  5HY6 A;  2JA7 H;  2V1C C;  4JBK A;  2CKZ B;  1OXV A;  1EQR A;  1LYL A;  1EYG A;  1Q81 C;  4A3G H;  1EWI A;  3JAM i;  4IOC A;  2WB1 E;  2ALY B;  3G71 A;  2WAQ G;  1VQC A;  3GTM H;  3HOV H;  1WI5 A;  2YTV A;  1Q46 A;  4DUZ Q;  1YJN A;  1LM0 A;  4IPC A;  2K50 A;  3HOY H;  2K5H A;  3HOZ G;  3CCM A;  4A76 A;  3RLO A;  1FL0 A;  1AE2 A;  4DUZ L;  2NVT H;  2FXQ A;  1TWC H;  3AEV A;  3PO2 G;  5M3F G;  1N34 Q;  1QUQ A;  1VQF A;  3RZO H;  1WOC A;  2RHS B;  4JBJ A;  1YHQ A;  4JI7 Q;  3TRZ A;  4X62 L;  4BBS G;  2VS1 A;  1PH1 A;  4JI7 L;  4JOI A;  1VQ5 A;  2AKW B;  3KYH C;  4AQY Q;  5FLM G;  1JJC B;  3EN2 A;  4AQY L;  4A3M H;  2BA0 A;  4DV3 L;  4HIO A;  1Q7Y C;  2GVA A;  3J7Z C;  3A5U A;  2UXD Q;  4HIK A;  1X55 A;  2CCZ A;  2UXC L;  2K5V A;  3KDF B;  2UXD L;  3L2P A;  3RN2 A;  3J81 c;  3UE0 A;  3U50 C;  4LFA Q;  4GNX C;  3PF5 A;  1IBK L;  5M3M G;  3I2Z A;  4QGU A;  2E2I H;  4B3S Q;  4GKJ Q;  3RZD H;  2R93 G;  4LFA L;  3J7A 5;  2CFM A;  3M4P A;  2ZJQ A;  2UU9 Q;  4GKJ L;  1AH9 A;  1EOV A;  4JG2 A;  2F3I A;  3CCS A;  1IBL Q;  4A3D G;  5FLX c;  2PI2 A;  2UU9 L;  2KEN A;  3CW2 C;  2VQE L;  2Q2I A;  3FKI G;  1WCM H;  3B6Y A;  1IBL L;  2WP8 J;  3PUX A;  4LF7 L;  2N8N A;  3CAM A;  4JI8 Q;  3WWV A;  5IP7 H;  3GTJ H;  3CMA A;  2F52 A;  1PHJ A;  4JI8 L;  2VQF Q;  3T1H Q;  4PZ8 A;  3HOX G;  2JA9 A;  2D0O A;  2R7Z H;  1QVG A;  2A8V A;  2NN6 I;  3J80 c;  2VQF L;  1I6H H;  1EQQ A;  4OWX B;  3CC7 A;  2MO0 A;  2OTL A;  4C3J H;  2NN6 G;  4GS3 A;  1K8G A;  1XNR L;  4A3F G;  1E7Z A;  4LF5 L;  3A0J A;  1W3S A;  3W5O A;  1OTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...