3ERSX

Crystal structure of e. coli trbp111
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
112
Chain Sequence
METVAYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGQKTLQTVTSLVPYYSEEELMGKTVVVLCNLQKAKMRGETSECMLLCAETDDGSESVLLTPERMMPAGVRVVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Trbp111: a tructure specific tRNA binding protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
molecule keywords tRNA-binding protein ygjH
total genus 23
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2008-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3ersX00
1KIXA 3TRZA 2KHJA 5IYCG 5C0XI 4DV1Q 4AYBG 3H0GH 2PMZE 2QA4A 2EXDA 5JEAG 3GTJH 5M3FG 4APVA 2ZJPA 3T1YL 1YITA 1K73C 3KYHC 1I94Q 3KFUA 2IT1A 2VY3A 1Y1WH 3RNUA 3PUYA 2BA1A 3I4MH 4KHPL 2R93G 2RF4A 2JQOA 1NY4A 4AQYL 1N36Q 5C4XG 4KHZA 3J81i 4BBRG 2XTIA 5IE8A 4FDBA 5FJ8G 3CPWA 4A3JG 1YZ6A 1IBKL 1QVFA 1N8RC 3HOUH 2K14A 3PUXA 4X64L 2R7ZH 4GKJQ 1EFWA 3HOVH 2Z6KC 4L5TA 3PUVA 4GN3B 4LUOA 5M5WH 5C0XJ 1HNXL 4A3CH 4LF8L 2AKWB 5K36G 4JI0L 1SLJA 2MO0A 4JI8L 2R7FA 2BH2A 4A3EH 4P71A 2PQAB 4P73A 1HZBA 1B8AA 1VQEA 3DLLA 4DR1L 5HGQA 4P72A 4B3ML 4L5RC 3RLOA 3PIOA 1N33Q 2YTYA 1VQHA 3PUZA 3HOYG 1T9HA 5DLQE 4IO9A 3CCRA 3S16H 4NPSA 1VQ4A 3CC4A 4GKKL 4GOPA 3I4NH 2AHOB 1JMCA 1HZCA 1X65A 4QY7A 4JI5L 3S17H 4DR5Q 3CCLA 4LF5L 1LUZA 1E22A 1IYJB 2XGTA 2Z6KA 1QUQA 4PZ6A 4POFA 1U0LA 4YHHQ 3GTOH 1X54A 3HOVG 3CCVA 1NBWA 1VQOA 1DGSA 1N34L 4O2DA 1PH9A 5LMNW 4R4QA 3KJPA 3WWVA 2JA5H 4LW1A 4A4IA 4JI1L 3I7FA 1U5KA 4DUYQ 3HOUG 4LF6Q 4DV1L 3FKIG 3RLNA 5IYBH 4A3KH 1PH7A 1EYGA 1YEZA 1IBLL 4A76A 2DGYA 2E5LL 1GKHA 1VQMA 3CMEA 1XMQQ 3GTLH 4JV5L 5GAHC 4DV6L 1SFOH 3I4MG 4LUVA 2JEBI 1CKNA 2JEAI 1YHBA 3HKSA 2LXJA 1YHAA 4R4TA 4GN5A 4AQYQ 1XMOQ 1CUKA 3TREA 4LUZA 5M3FH 1WOCA 3A0JA 4DPGA 3H0GG 1SRUA 2OCEA 5E7NA 3S14H 2H5XA 2ZM6L 5FLMG 3GTGH 3CF5A 3UDXA 4GNXA 5JJKA 2VQEQ 2I5HA 4GLXA 1YJWA 3UE1A 4POGA 4DV0L 4QJFA 4PZ7A 1PA6A 2E2IH 4LFBL 1WFQA 1Q81C 4DV3L 2K52A 4DV7L 1O7IA 4XIGS 4B3SL 2ZTCA 4EQ5A 4PMWA 4R4CA 1BBUA 1L1OB 1WCMH 4KI0A 4IFDI 1FVIA 1HNZL 1VQGA 2MO1A 3KF8B 3STBC 3I56A 3J81j 1N33L 3HOZH 1JB7A 1GO3E 1WJJA 1MJCA 1QVGA 4DV2Q 3T1HL 4DV5L 3S15H 2ZM6Q 1VQBA 1HJPA 3JC66 1XMOL 4TQUS 1PH4A 1L2FA 1HR0Q 4JBMA 2QGQA 4JI2L 1NTGA 1LYLA 2KHIA 5ELNA 3CC7A 2Q2HA 4K0KL 1X3EA 1OXXK 4DV7Q 4OO1I 4QGUA 4OXPA 5FLMH 2UXCL 1VQ5A 1A63A 2CKZB 3TQYA 4DKAC 5C44H 3CCMA 2V1CC 2IX0A 4HJAA 4JI4Q 3HKZG 4JI1Q 2GN5A 3OTOQ 2PQAA 1L1OC 5C4JH 3CCJA 3HFZB 4DV5Q 2UU9L 1A62A 4DAYB 3G71A 3PIPA 1NMFA 3CCUA 1LM0A 2D62A 3D0FA 3I55A 4JYAL 2WAQE 2ZTEA 4BA2I 4IJHA 3J7ZC 4DR6Q 1YI2A 1KD1C 4B3RL 1XTDA 5ELOA 3S1RH 1KHIA 4A3LG 1SMXA 2JA5G 4RG1A 4DR5L 4A3EG 1A0IA 2EQSA 1MIUA 4UP8A 3ULJA 3ULLA 2ZJQA 4JI7Q 1J6QA 3W5OA 5IWAL 4IOCA 2CWPA 3AYHB 1IXRA 3OW2A 2IX1A 2JE6I 2VUMH 1VQ6A 3U58A 3J80i 3BJUA 2IY5B 1Z47A 2Y0SG 2A1AA 1PH5A 1VQLA 1D8LA 1TWFH 2Q2TA 1FL0A 4R1JA 5C3EH 3BZCA 3PCOB 3TS2A 2N49A 2OQ0A 2OTJA 3A74A 1TWHH 1G6PA 1SROA 2ID0A 3IRBA 3BZKA 4LF6L 4GLAC 2IHFA 2I5MX 4IPDA 1Q86C 2JA8H 2JJQA 4YWMA 5JJLA 3PO2G 4C3JH 5C44G 2GVAA 4LFBQ 4IOAA 5IYCH 1CKNB 2YYZA 2HHHQ 1VQCA 4DV0Q 1XPOA 1XNQQ 1VQPA 1K0RA 3DM3A 4A3MH 5C0XG 1GM5A 4A75A 1C0AA 4X62L 1X9NA 4JBJA 3KLWA 4WJ3M 5AJ3L 4BY7G 3W1BA 3H15A 5IP9G 2K50A 1HNZQ 2AWNA 1EQQA 2WP8J 3U4VA 4NXNQ 2UXCQ 2NN6G 4A3JH 3E9HA 1NMGA 2AWOA 3F2DA 1VQAA 1KXLA 1XPRA 4YCWA 3RZDH 2CCZA 4JI6Q 2ALYB 1L0WA 2CFMA 1EQRA 1IBLQ 4BXXH 1L1OA 1I6HH 1VQFA 5M3MH 2K5VA 1K8GA 4JYAQ 4X66Q 2UUCQ 4DR7Q 1Q8KA 1TWGH 4QIWE 3J81c 1XNRQ 4DR2L 2VZAA 1HNWL 3EIVA 1EIYB 1I3QH 3GDEA 4L5QA 1S40A 2I0QA 1KRTA 1HZ9A 1PV4A 5JJIA 1G51A 1YIJA 2JA6H 4A3BG 2KCTA 4R4OA 4YWLA 3VDYA 3KOJA 1E3PA 1M1KC 2UUBL 4B3SQ 4JI5Q 4BA1I 1FJGL 1EOVA 1E24A 3NENA 3CMAA 3ERSX 1QZGA 1V9PA 3M3YH 3UDFA 2PNHA 2Q2IA 1Q1EA 2C35B 1KAWA 3AFQA 2N3SA 3STBD 2Q2UA 1PYBA 1UE6A 1Y1VG 3K80C 3M9BA 1XPUA 2JA7G 3HOWG 2BA0A 3CPFA 5LMUQ 4A3IH 2A19A 4DV4L 5IYBG 4IFDJ 2F4VQ 2UUAQ 3MEFA 4GOPC 2JA6G 2PI2A 4LF9Q 3L2PA 1JJCB 5IYDG 4HJ5A 3UDGA 3PO3G 4A3DG 3FP9A 4ALPA 1BKBA 4PZ8A 3K7UC 1W2BA 4DR4L 4A3FG 1EWIA 4L5SA 5GADC 4QQBX 4GNXC 1KC8C 4XTCS 3S1NH 5IYDH 2ZTDA 2B63H 2VQFQ 4DR4Q 1W3SA 2VQEL 1PH1A 2CQOA 1VQ7A 3CAMA 2RHQB 1TXYA 3HOZG 1H95A 4JG2A 5AJ3Q 2F4VL 4B3TQ 2K5NA 3SGIA 1B70B 1RIPA 5IY0A 1PH6A 2UU9Q 2HHHL 3CD6A 3KDFA 2R6GA 2N8NA 3PGZA 2KENA 4JBWA 3PUWA 5IP7G 4JC0A 4MZ9A 1CKMA 4A3MG 4JOIA 1WYDA 1MJEA 1PHJA 2UXDQ 2NVQH 3RN5A 3D31A 1X3GA 5LMNQ 4C3HH 1V43A 2AMCB 3G48A 2QEXA 2JA8G 3L7ZC 1E1TA 2PI2E 2Z0SA 4P75A 4DAMA 4EX5A 3CP0A 3H3VH 4RMFA 1VQJA 4NXMQ 1KQSA 2NN6I 3GTMH 1XNQL 4YY3L 4KHPQ 1N9WA 2Y0SE 5FJ8H 1E7ZA 3U50C 3G6EA 1WI5A 4DK3C 2E8GA 5IP9H 1VQIA 5FLXc 1IZ6A 2VUMG 4AYBE 1GVPA 3RN2A 4NXNL 4A3GH 1HNXQ 1CSPA 3M7NA 1S72A 2R7DA 4X64Q 4UP7A 2F3IA 3PV0A 4C3IH 3AQQA 4IFDG 4HIOA 4GKJL 2ES2A 1P8LA 3KF6A 1IBML 4LWCA 3CCSA 3PSIA 3JAMi 2JA9A 2NVYH 4JCVE 4X66L 4DR1Q 1Y14B 4OWWB 4NXML 3E9IA 3ZJYC 1VQ9A 1IBMQ 1JT8A 3OTOL 1PFSA 4JI7L 5IP7H 5H1SE 1PH8A 3RLFA 4J15A 3I4NG 1KL9A 3CCEA 4DUZL 3H3VI 1SE8A 3HKZE 1PVOA 4AH6A 4DR6L 3K81C 1X3FA 3TS0A 1M90C 1UE7A 1UE5A 2VL6A 4JI3L 1YHQA 1EUJA 3NBHB 5HY6A 4HJ7A 4BY1H 1UWVA 1OXUA 1HH2P 3OYYA 2HQLA 3S24A 3CW2C 3M4OH 3HOWH 4A3FH 1K3RA 2GVBA 5LMUL 4DV4Q 1V1QA 4GN4B 3EBEA 5IWAQ 2NVXH 3J7A5 4A3DH 5J3BA 1J5EQ 3L0OA 2HT1A 2N78A 4NB3A 2WFWA 4TVAB 5JEAJ 3W1GA 1YJNA 1I5FA 2E2HH 5LMNL 1I50H 2YV5A 3S2DH 1OXTA 2K4KA 4A3IG 3RZOH 2UXBQ 2JA7H 3PF4A 1YBYA 2MNAA 4DUZQ 2UUBQ 1FJGQ 1HZAA 4OX9Q 4BY1G 3GTKH 3CC2A 4MNOA 2YTVA 3EN2A 4JI2Q 2K5HA 1Q46A 1HR0L 1Y1VH 4HJ9A 1VQKA 4HIDA 2UUAL 4OO1G 1E1OA 2NZOA 4DNIA 3MXNB 2RHSB 3KJOA 1OXSC 4O0AA 1MKHA 4JOIC 1BVSA 4JI8Q 1AE2A 5EAYA 2WAQG 3U4ZA 1Z9FA 1K83H 4YCUA 4HJ8A 4LF7Q 3K8AA 2UXBL 3TEHB 2RCNA 1Q1BA 4GLVB 1NE3A 3GTPH 5M3MG 3M4QA 2B29A 2ZJRA 2NZHA 1VQ8A 3CXCA 4ME3A 5M5YH 2LXKA 1AE3A 1NJIC 1Q12A 1Q82C 1G291 3A5UA 4A3GG 4IJLA 4LFAL 1S3OA 2D0OA 1XJVA 3S1MH 3AEVA 4BXXG 1XNRL 1HNWQ 4PG3A 1JJGA 1OTCA 2KCMA 1YVCA 3NEMA 1QVCA 4KLKA 4OWTB 4JI3Q 4C2MH 4A93H 1Q7YC 3E0EA 4LF8Q 4LFCQ 3HOXG 3CCQA 4MTNA 3ICEA 2MQHA 1XMQL 4BBSG 4JV5Q 4K0KQ 2VNUD 2A8VA 1X6OA 4LF4L 1EIFA 4LNQA 1K9MC 1J5EL 4X65L 4YWKA 2WB1G 3KF6B 2OWOA 3G4SA 2L15A 2OTLA 4X62Q 1N36L 1X55A 1TWAH 4YY3Q 3PO2H 4B3MQ 1FGUA 1OXVA 2CWAA 4OWXB 5GQOA 1PYSB 3KDFB 3FKIH 5GAGC 4Y7NH 4HIKA 4A3KG 4WJ4A 1I94L 1ASZA 1CKOA 2VW9A 4UPAA 4LF5Q 5C3EG 1UE1A 4OX9L 3JAMc 1LTLA 2MFIA 1A8VA 1AH9A 4AIMA 4A3LH 3ULPA 1BBWA 4OONA 5GROA 4IPGA 2B63G 3ER0A 4UY8C 3UE0A 1N34Q 3F8TA 3GD7A 2DUDA 2VS1A 4HIMA 4B3TL 4IPHA 2E2JH 1KRSA 1CSQA 4GOPB 4R4IA 5C4XH 3GO5A 3T1YQ 3B6YA 2IHEA 1SN8A 4JI0Q 4JI6L 2E5LQ 2ASBA 3GTQH 2R93H 3RR5A 3M4PA 2ATWA 3K7AH 4IPCA 4QL5A 3HOYH 3CQZH 1VQNA 1GD7A 3AFPA 4H02A 1C7YA 1HR0W 2UXDL 2B3GA 1VQDA 1IBKQ 1QUQB 1SR3A 1IL2A 1RL2A 2OQKA 4GKKQ 3M85A 2FXQA 4UP9A 3LGJA 2NVTH 2R92H 2YTXA 4DR3L 4Y52H 2D0PA 3S1QH 3K0XA 4LF9L 1D7QA 3F2BA 4A3CG 4BBSH 2HIXA 4DR7L 4JI4L 3HOXH 5M5XH 1PH2A 2R7ZG 4A93G 2K75A 4YHHL 1P16A 3J80c 1N32L 4X6AH 2VQFL 4BBRH 4B3RQ 4DK6C 4DV6Q 5GAEC 1JE5A 3PO3H 1JJ2A 4DV3Q 3NELA 1VCIA 4LF7L 1K8AC 1Y1WG 1WCMG 1N32Q 3F1ZA 1TWCH 2BH8A 5BR8Q 2JK8A 4DUYL 1X56A 3PF5A 1B7YB 1YJ9A 2F52A 2EIFA 3Q8DA 2YU9H 3FHWA 3BU2A 3I4OA 1R9TH 3UDIA 4DV2L 2KBNA 3T1HQ 4DR2Q 4LFAQ 1YNXA 2HIVA 3F2CA 4DR3Q 5IT9c 4X65Q 4GNXB 1QZHA 1PH3A 4JBKA 2I5LX 5BR8L 2UUCL 4LF4Q 4BY7H 4YCVA 1VS0A 4A3BH 4GS3A 1ASYA 1UEBA 1C9OA 2LSSA 4P74A 3A5ZB 3S2HH 2WB1E 2R92G 4LFCL 3I2ZA
chains in the Genus database with same CATH superfamily
3TRZA 5C0XI 4DV1Q 2CH4W 2QA4A 2EY1A 4CDDC 5M3FG 3T1YL 3KYHC 3PO3B 5C4JB 3KFUA 4ABNA 1SJHD 5A2QL 3RNUA 3S2DB 2E2HB 3KBGA 1RDPD 1N36Q 2FMCA 3BZDB 2F0JA 1IYUA 2UXDQ 1QILA 4L5TA 3PUVA 5C0XJ 4LUOA 4A3CH 3RUZA 5K36G 1A6XA 4OELB 4OIKA 1SLJA 4CDEC 3FVQA 3BYYB 1ML0D 1B8AA 1CZWA 1O7ZA 2M00A 4B3ML 4P72A 1PZJD 3RLOA 3HOYG 4P2CB 2CH4A 4IO9A 2FMMA 1EYDA 4NPSA 3DM1A 4RHSA 1EL0A 2YU9B 1HZCA 1IHZA 4JI5L 1TS5A 4ILWA 1STYA 5CV5A 2AQ2B 4C3JB 1IYJB 4DAPA 2XGTA 5K5PA 4LK1C 4PZ6A 4YHHQ 1U0LA 3GTOH 2IPKD 2QF7A 3BDOA 4R4QA 1A3UA 3WWVA 1ZYRD 5KNDA 2FINB 5DNFA 3FPUB 1STGA 4A76A 3GTLH 4JV5L 5GAHC 4DV6L 4V0BA 1TS3A 1F9QA 2K5QA 2LXJA 2EE1A 4RCNA 2B2YA 4LUZA 2OCEA 1EY0A 4DAVA 5FLMG 2HDLA 3UDXA 3VR5A 4GNXA 1YJWA 3UE1A 3OW7A 4FXKC 2F0TA 4PZ7A 2E2IH 2BDNA 1KDBA 4DV3L 1O7IA 4B3SL 4DNRB 4R4CA 1BBUA 1H9RA 4IFDI 4FF1A 1JB7A 2LS01 3U9SA 4HSPA 3S15H 1FNWA 2R93B 3MA2B 4TQUS 4JI2L 4JBMA 1OO9B 1NTGA 1GUGA 2JP1A 2KHIA 4JW0A 4A3DB 1XTCD 2Q2HA 4B08A 3BS1A 1SJED 4K0KL 3LNNA 2LY7A 3NHHA 4QGUA 3OOCA 4OXPA 2PO4A 3MAQA 4DKAC 2WV6D 1HFNA 2G5DA 2PZUA 5BN5A 2VB2X 4JI1Q 3OTOQ 2A69C 1L1OC 1F9PA 5C4JH 3CCJA 1A62A 1LTRD 1NMFA 3CCUA 1LM0A 3QR8A 5EJWA 1XXGA 1JQYD 2WAQE 4BA2I 3TP8A 2QILA 3H0GB 5ELOA 1TQOA 3S1RH 2JA5G 1B2TA 4A3EG 2ZJQA 1MIUA 1QJOA 2XVSA 3W5OA 3CU7A 4C3IB 3K57A 1JWMD 3AYHB 2IX1A 2JE6I 5ELDA 2VUMH 2E2DC 5D3IB 1VQ6A 1S5BD 2IY5B 1Z47A 3TSSA 1PH5A 1SAPA 1D8LA 1TWFH 3IFTA 1FL0A 2Q2TA 4R1JA 1CT1D 1D1IA 1M4VA 2OQ0A 2K7VA 3J7AF 3NTHA 4GLAC 1IKLA 3BVZA 4YWMA 1BCPC 4C3JH 2GVAA 4LFBQ 5CV9A 4IUUA 1PFNA 1CKNB 3J80E 1Y8NB 2HQEA 2A6HC 4A75A 2G9HD 1SYBA 4JBJA 3C1FA 1KABA 3EA6A 1K3BC 1Z6HA 5EKKA 4NXNQ 3V05A 3F2DA 1VQAA 3NQIA 4JI6Q 5KNBA 2HCCA 1I6HH 1L0XB 3CRLC 1TWGH 1M8AA 1HNWL 3A54A 5EBCA 1EIYB 2HCIA 3O13A 1KRTA 1GJXA 5JJIA 1YIJA 2JA6H 4YWLA 1M1KC 3VDYA 1E3PA 4N9TA 4JI5Q 4BA1I 1EOVA 5ISRA 3E3XA 1CK1A 2F4IA 3ERSX 4C1NK 2A68C 1Q1EA 2C35B 2Q2IA 3AFQA 2Q8TA 2Q2UA 1PYBA 1B50A 5E3FA 2BA0A 3CPFA 3ND9A 5LMUQ 2F4VQ 3MEFA 4GOPC 3FEWX 1TT2A 5JAVA 4HJ5A 2B2VA 4K5WA 2Z9HA 3UDGA 1BKBA 4QF4A 1HCZA 4DR4L 4A3FG 2F1MA 4L5SA 3R3OA 5GADC 4QIWB 4HTHA 1KC8C 1DCZA 3S1NH 1SNCA 4G4KA 2EYOA 1IW7C 1W3SA 2P5ZX 1PH1A 3HOZG 5C44B 1VQ7A 2RHQB 4UHVA 1D5MC 1LLRD 1PH6A 3EQLC 2EJFC 1I3QB 2F0NA 1W6JA 1IW7D 3PGZA 3G7LA 4C2MB 4JBWA 5BN4A 3FMCA 4A93B 3WOFA 4TSSA 5FLXL 3PUWA 4A3MG 4JC0A 4MZ9A 2NVQH 1B1ZA 1TS4A 1SNMA 2M9VA 3G48A 2QEXA 1E1TA 4DAMA 4P75A 1HHVA 1I4HA 1VQJA 3E6ZX 4WFN3 1Z7TA 3GTMH 1UUPA 3H09A 1N9WA 4KHPQ 1F2LA 2E2JB 1EYAA 3A7AB 2OEOA 1VQIA 3ND8A 4DK0A 4XT1B 3A56A 1GVPA 4H44C 2F3VA 3M7NA 3TN2A 3TP6A 1PMRA 3AQQA 2ES2A 4DGZA 3PSIA 3JAMi 2HUGA 4OWWB 1QG7A 1RCVD 2IW3A 4HEDA 4G7OC 2ZXPA 1SNOA 1EQTA 2KUMA 2E2IB 1PH8A 3RLFA 4NP5A 4IUVA 4ODGA 1M90C 2EY2A 1C48A 1UE5A 1EUJA 3NBHB 4U673 1HH2P 1JOKA 3S24A 3VYUA 1VMCA 5CV8A 1K3RA 2GVBA 2NVXH 1V1QA 1H9MA 3HOXB 5J3BA 1YNJD 3QJYA 4TVAB 5JEAJ 3V2TA 1I5FA 5C5MA 2E76C 3RZOH 5CR3A 3MHBA 3PF4A 1CQVA 2MNAA 2IWHA 4DUZQ 2PNRC 2UUBQ 5T1IA 1HR0L 1PFMA 4OO1G 2NZOA 2XIWA 5I6YA 3BDCA 4MTKA 4QCLA 2CW0C 5EAYA 5KIXA 3J7YW 4HJ8A 3TEHB 2RCNA 2EYJA 3M4QA 1PZKD 2KEEA 4FF3A 1O80A 1Q82C 1G291 3QIAA 4A3GG 2MJ8A 4IJLA 4LFAL 1S5DD 5E1FA 1LO5D 2DN8A 2JA6B 1XNRL 4BXXG 2TMPA 2XRSD 2CVRA 1OTCA 1YVCA 3NEMA 2RCFA 4ZRZA 4KLKA 3I90A 4JI3Q 2BE5C 2SEBD 4C2MH 2DNCA 1CM9A 1QNUA 1Q7YC 4LFCQ 3CCQA 3ICEA 1B3AA 2OF1A 3K59A 1KNAA 2WB1B 4X65L 4XYOA 2OWOA 1FYCA 2OTLA 4OHJA 4X62Q 3E5SA 2R3ZA 4YY3Q 3VYRA 4B3MQ 1TWHB 1FGUA 1O7YA 2CWAA 4OWXB 4F87A 4HIKA 4WJ4A 1JOOA 3LWEA 1I4PA 2KEDA 2V4DA 4LF5Q 5C3EG 3JAMc 2Z4IA 1D1KA 1FNVA 4Q0FA 2A6ED 1J9OA 3T53B 2K1BA 3ULPA 1LT5D 3MEHA 3F8TA 3GD7A 4QUFA 4HIMA 2F0GA 1VDZA 4IPHA 5DM73 5DEHA 5C4XH 3T1YQ 3SE0A 1J8IA 3M4PA 1SE4A 3DXJC 3HOYH 1SYEA 5LL6S 1GD7A 4H02A 2UXDL 2B3GA 3JAME 1SR3A 2KQ3A 1WCMB 2AUJD 1LV9A 4BY1B 2FXQA 2NVTH 3LGJA 3QG1A 1CHQD 4LAAA 3S1QH 3SK8A 3F2BA 4A3CG 4BBSH 4L8JA 1Y8OB 3HOXH 2ZXOA 5A35A 4X3SA 5I6WA 4YHHL 1P16A 2F0SA 2R7ZG 2R7ZB 2VQFL 1WTXA 5FO9B 3NELA 1G91A 1GUTA 3L9AX 2BOSA 3NBHA 1W6KA 1WCMG 1TWCH 5BR8Q 4IZ8A 4OL7A 1YJ9A 2F52A 3AB9A 1ENFA 1II3A 3BU2A 3UDIA 4DV2L 1U9RA 3HGBA 1EZ6A 2HIVA 2JEAI 2DY8A 1PH3A 5FO8B 1SYFA 2I5LX 1GXDC 4WJWA 3I8ZA 4FP5D 1SSOA 2A73B 4P74A 3J81E 1NNXA 1H9JA 1KIXA 2KHJA 3DMUA 5IYCG 1RTNA 2EXDA 5JEAG 4U68A 2X6GA 4R9WA 1I94Q 2VY3A 3A8JE 1SNQA 2Q8IB 2BA1A 4HAEA 4KHPL 1Q8IA 1V1OA 3NSWA 2JQOA 5C4XG 4KHZA 4PQXA 5FJ8G 1IBKL 2EOTA 1QVFA 4PV1C 4GKJQ 3SHLA 1EFWA 2Z6KC 1DOKA 1DOLA 5M5WH 3J80L 2FHTA 4JI0L 2MO0A 1PTOF 4JI8L 3MVVA 1Y69U 2PQAB 4DXGA 1HZBA 4ZCKA 3DLLA 3PIOA 1VQHA 2DY7A 1D6EC 1T9HA 5FOBB 2F0IA 2AHOB 3I4MB 1H9SB 1X65A 3S17H 1VMPA 4DR5Q 3I72A 4G7ZC 1PRTD 1SNPA 3NE5B 4QMGA 4RGOS 4LF5L 3IAYA 1E22A 4CJ0B 3L3OC 2Z6KA 4GZYC 2EPBA 4HCEA 3CCVA 1N34L 1ENAA 1VF5C 1PH9A 4CKCA 4R8IA 2JA5H 1ET6A 2ZT9C 4LW1A 4I7ZC 4JI1L 1U4LA 1U5KA 4DUYQ 2MP1A 2Z6BA 5IYBH 3EFXD 1IBLL 1YEZA 1VQMA 3CMEA 2EYLA 5CV7A 3I4MG 4LUVA 1PFBA 3ERQA 1F2ZA 1ILPA 4CBVA 1I4GA 3TREA 2K5WA 2EYPA 5E7NA 5CMDA 3CF5A 1K83B 5JJKA 2VQEQ 4GLXA 3GTQB 4POGA 2B2VC 3HZXA 4RGNA 1Q81C 4XIGS 1DONA 4KI0A 4M1UB 5KNCA 1JWUD 1QB5D 3NUCA 2F0KA 3I56A 3J81j 3HOZH 4DV5L 2ZM6Q 1EWHA 1XMOL 1PH4A 2PZTA 1LYLA 1LTSD 1DZ1A 1WTQA 2EYMA 2KVMA 2NB0A 1A2UA 3GTGB 4OO1I 1CZGA 5CV6A 5FLMH 5D14A 3S1QB 1A63A 2NVQB 2CKZB 2SNSA 1PLFA 2B2TC 2DNEA 2NZ1D 3G71A 4F88A 3I55A 2L55A 4JYAL 4M8AA 1XTDA 1SMXA 4HCSA 3HG9A 3J81L 2QW7A 3Q24A 1IKMA 3R2TA 1L0YB 4N9PA 3MWYW 2L4NA 3BJUA 3GV3A 1EY7A 1PTOC 5JVG3 3PCOB 4MHEA 3TS2A 2OTJA 4ZAIA 1KLGD 4XQQA 5C44G 2RVLA 5IYCH 1VQCA 4A3MH 2XWJB 4ME5A 1C0AA 2FJ2A 5AJ3L 1E2WA 4A3FB 3DUZA 1EU3A 5IP9G 2L9HA 4O1NA 2AWNA 2WP8J 3M4YA 2AWOA 1KXLA 4YCWA 1TWCB 2CFMA 1DJRD 2KHSA 3OIQA 1IBLQ 1K8GA 4XT3B 2QDBA 1LTBD 2H1EA 2UUCQ 4DR7Q 1Q8KA 4QIWE 3J81c 4KN7C 3URYA 2B2WA 4C1NI 1I3QH 3GDEA 2D2CC 4L5QA 2RDGA 4XDXA 1PV4A 2F0UA 3BG3A 1SYCA 1G51A 4KK7A 2KCTA 1PYWD 4R4OA 3KOJA 4B3SQ 2Q8RE 1E24A 3NENA 3GTJB 1R9TB 1UAPA 1V9PA 1STNA 3UDFA 5EPKA 2B2UA 1KAWA 2N3SA 3CQZB 1Y1VG 5EPJA 3DEPA 3PQIA 5C3WA 3S9WA 2A19A 4DV4L 2JA6G 2RDHA 2PI2A 3L2PA 5IYDG 2PW5A 3PO3G 4TRDA 4PZ8A 1EWIA 1EIGA 4QQBX 4K8JA 2Z4HA 2B63H 3MFGA 3AMUA 3K6OA 1V8QA 2NYZD 3S14B 4QUCA 2E74C 1U4MA 2CQOA 1HRJA 4IUNA 2K05A 5AJ3Q 2Y0SB 2K5NA 1B70B 2F0WA 1WTWA 2UU9Q 3CD6A 2N8NA 2K32A 1JICA 5E4WC 1MJEA 4FNFA 1CKMA 4C3HH 3HS0C 1T5XD 4C3IG 4ZKCB 2JA8G 3H3VH 2Z0SA 3H3VC 1BXTA 2JSOA 5K36H 1KQSA 2TSSA 3SR1A 2NN6I 1XNQL 1E7ZA 3IL8A 3G6EA 1IZ6A 4S3SA 2VUMG 3RN2A 4A3GH 2J7ZA 1HNXQ 2RSNA 1P8LA 3KF6A 1K8MA 2N88A 3CCSA 4ID6A 4JCVE 4DR1Q 3J7AV 1IBMQ 5JJZA 1FD7D 4JI7L 5IP7H 1TIID 3I4NG 3A55A 1LTTD 1NR4A 4DUZL 3HKZE 1PVOA 4AH6A 1X3FA 4KN4C 3C3LA 1STAA 1UE7A 1HTPA 2VL6A 4JI3L 3OHXC 2KA7A 3HEJA 3BVMA 1PRTB 2EJMA 3M4OH 1QOHA 2A6HD 5F2DA 1SFOB 4C3HB 2B2TA 3SDZA 4GN4B 4DV4Q 2A5HA 1J5EQ 5CYUA 3W1GA 5IGEA 1I50H 1NUCA 4A3IG 2UXBQ 1XX8A 2JA7H 3PIP3 1S5FD 1HZAA 4BY1G 2NUCA 3EN2A 2K5HA 1Q46A 4HJ9A 1VQKA 3QWNA 1E1OA 4DNIA 5KRUA 1RD9D 5LL6X 4RKBA 1SNDA 3U4ZA 1DD2A 4KJOA 1Z9FA 4WORA 4KJNA 2NVYB 4LF7Q 3K8AA 5AFWA 1Q1BA 2B29A 4FO2A 5M5YH 3Q23A 1NJIC 4C56C 4K5VA 4KY6A 3FPPA 4FF4A 3S1MH 1JJGA 4IUTA 2KCMA 1QVCA 1I4QA 2F0HA 4LF8Q 4MTNA 2MQHA 4JV5Q 1LTID 4K0KQ 1A3TA 1LACA 2VNUD 4JPBW 1X6OA 1KNEA 2XRQD 1CQFA 4LNQA 2F0DA 3SK4A 4YWKA 2WB1G 2EY5A 1SYDA 3T4AC 1N36L 2RDFA 3PO2H 4NW2A 5GQOA 3K7AB 3N6RA 5C4HA 5JPNC 3I4NB 2WINB 4RAUC 1ASZA 3TP5A 3K5NA 3K5OA 5J39A 2JN4A 2MFIA 1JOQA 1AH9A 2CQAA 2Z1CA 1G2SA 4A3LH 3GTOB 5GROA 1YNJC 3ER0A 4UY8C 1N34Q 1STHA 3NWSA 2BCOA 1KRSA 4GOPB 2RKSA 4R4IA 1VF7A 4ZKBB 3B6YA 2IHEA 3K7AH 5JPMC 1AP0A 3KUPA 3CQZH 2K5DA 3AFPA 4HN7A 1HR0W 1IBKQ 1QUQB 1IL2A 1RL2A 3NQTA 2OQKA 2JA8B 1JC7A 4G7HC 4UP9A 1TY0A 1XYIA 4LF9L 1SMYD 3S2HB 3EJIA 4MN3A 4DR7L 1RHPA 4XYQA 4DK6C 1C8CA 3PO3H 1JJ2A 1VCIA 4LF7L 1B53A 1K8AC 1MBYA 1Y1WG 1O78A 4DUYL 2JK8A 3BYTB 1B7YB 1NR2A 4E6IA 4O42A 3DHQA 5C4ZA 2B8GA 4DR3Q 5IT9c 4JBKA 3P20A 1D5ZC 5IT9E 3VA7A 4N8X1 2IJ0A 1ASYA 3S2HH 4LF8L 4KD3A 2PMZE 1IL8A 1Y1VB 4RH6A 1WTHA 4APVA 1YITA 1K73C 4DNTB 5JOBA 2R93G 1NY4A 4J6HA 2JA7B 4H13C 3J81i 1BOSA 2XTIA 4FF2A 1YZ6A 2K14A 3PUXA 4X64L 2R7ZH 3NTKA 2JXMB 3HOVH 1R4PB 1HNXL 3MZ5A 4CDCC 2BH2A 3GQBA 4DFAA 4A3EH 1U4PA 1AN8A 1SXTA 4P71A 4P73A 3NP8A 4DR1L 4L5RC 1N33Q 5HGTA 5DLQE 3CCRA 1VQ4A 2LMCB 5COYA 3I4NH 3VR2A 1JMCA 4QY7A 4K5XA 5NUCA 2RBMA 2F0FA 1LUZA 3SEBA 3HOZB 4JVZA 1EY6A 4POFA 3TZDA 1X54A 1DGSA 4O2DA 3T16A 3KJPA 1U4RA 2BDOA 3TBIB 5IGBA 4A4IA 4LF6Q 4DV1L 3FKIG 4A3KH 1PH7A 1EYGA 3KK7A 2E5LL 1WD0A 1LABA 2JEBI 3DWPA 1XMOQ 5M3FH 4DPGA 4C3HG 1EU4A 2H5XA 1A2TA 2I5HA 4Q5VA 3R2IA 1NSNS 3SVMA 4QJFA 1PA6A 2J4XA 3A8KE 4LFBL 1BDOA 3I91A 5CV4A 4DV7L 2ZTCA 4PMWA 4XXEA 1WCMH 1L1OB 3JAML 5TSSA 3GV6A 1FVIA 2MO1A 3KF8B 1AFPA 1FGBD 1CTMA 3HP3A 3STBC 1N33L 1GO3E 1WJJA 1MJCA 5DAUA 4DV2Q 1QVGA 3T1HL 1NCVA 1PRTF 5E4XA 1VQBA 2AQ1B 5EBDA 3MXPA 2B39A 4ZYSA 2L0CA 5ELNA 3CC7A 4I7AA 1X3EA 3BVGA 3VR6A 4DV7Q 2CW0D 2UXCL 2VUMB 4CDFC 4NMZA 3TQYA 5C44H 4JI4Q 3VR3A 1LT3D 4KTAA 2GN5A 3C46A 2I07B 2PQAA 3GTLB 2WIIB 3HFZB 1ZEQX 2AQ3B 4BS9A 4DAYB 1O7LA 1E2ZA 3PIPA 2D62A 3D0FA 5BN3A 3UI2A 4B9WA 2ZTEA 4IJHA 2O2LD 4B3RL 1MGSA 4K2KA 3HOWG 1A0IA 2EQSA 4UP8A 4K14A 3ULJA 1Q3LA 3VA5A 2MHVA 5IWAL 1G2TA 1HUMA 2CWPA 1RJTA 4A3EB 1JR0D 3U58A 2Y0SG 4KKUA 2A1AA 4FVMA 1D5XC 1CI3M 3BZCA 4KHVA 1QWYA 2XWBB 1Y8PB 1SROA 3BZKA 2K04A 4LF6L 2IHFA 3I70A 1Q86C 2JA8H 2JJQA 3PO2G 3D6CA 1F77A 2I46A 2HHHQ 4DV0Q 3D4RA 3D4WA 1VQPA 5C0XG 3C2PA 3R93A 4X62L 2A6EC 3HOVB 3H15A 2VXWA 2K50A 3S17B 4K6LA 1SDFA 1HNZQ 1PTOH 3A8IE 1ICFB 2UXCQ 2NN6G 4A3JH 3CKIB 1XPRA 1MHWC 3RZDH 4CJ1B 2ALYB 1L0WA 3DWAA 1R4QB 1VQFA 4JYAQ 2RQXA 4X66Q 1XNRQ 3EIVA 1CA6A 2D5DA 1S40A 2PW7A 5EGTA 1ZKOA 3KLSA 1UNSA 2F0VA 1G8ZD 2IX3A 5C4XB 5I2YA 2UUBL 2CHBD 3M3YH 5ELEA 5I2XA 4X3UA 4KMUC 3STBD 1XPUA 1UE6A 3K80C 3M9BA 3CHBD 2MGSA 1B4OA 4RGMA 5FO7B 2M2LA 3KBXA 1RKNA 5IYBG 2UUAQ 4UDUC 4F8MA 4A3DG 3FP9A 1W2BA 1STBA 3K7UC 4G57A 5CBEE 1GUOA 4OIJA 1BR9A 4XTCS 2F0EA 3RD4A 4DR4Q 5KYLA 1HPCA 1X3QA 3TDQA 3V96A 4B9XA 4PMBA 3QO2A 2F4VL 4B3TQ 1E2VA 2N55A 1RIPA 1SE3A 2HHHL 2R6GA 2KENA 1TWGB 5IP7G 1WYDA 1PHJA 1KLUD 3D31A 5LMNQ 4IUPA 4DU9A 3QB3A 3L7ZC 3FDTA 2PI2E 4EX5A 2O5JC 1SMYC 2EJGC 3CP0A 4DAYA 4IFDH 3RZOB 3VR4A 3ONAB 4RCOA 4NKLA 2Y0SE 5FJ8H 4KKSA 2F0PA 4DK3C 2E8GA 3KLSX 3T13A 4IALA 2X6LA 1SYGA 1S5CD 4NXNL 4KY7A 1CSPA 1JE4A 2R7DA 4X64Q 3QOJA 3HKZB 5IGCA 4HIOA 2QKIC 1HQRD 1BUVT 2EXZA 3NTIA 4C3JG 2X69A 5IT9L 3DEOA 1FR3A 4X66L 5C3EB 2PZWA 4NXML 1VQ9A 1PFSA 3W3AA 4J15A 4CKEA 2QCPX 3CCEA 1PTOB 3H3VI 1SE8A 3M7GA 1H9KA 1YHQA 4HJ7A 3OWEB 4BY1H 3G6JB 1OXUA 5HURA 3EROA 3OYYA 4CKBA 3HOWH 1GUNA 2XN9C 4IUQA 3K58A 4A3FH 1IYVA 4YIJA 5LMUL 3EBEA 4A3DH 1BQQT 2D9UA 2HT1A 2N78A 4Z9CB 5LMNL 2L12A 2YV5A 1OXTA 1V1PB 3GTMB 4EVOA 5T1GA 3GTKH 1EZ8A 4A3GB 4OX9Q 1YNNC 4OO1H 2YTVA 3NK9A 3OMCA 5EPLA 1Y1VH 3MXNB 3T56B 1MKHA 2SOBA 4JOIC 4JI8Q 1AE2A 4PMCA 1EIHA 1K83H 2H4OA 1NE3A 1F9SA 2ZJRA 2NZHA 4ME3A 2LXKA 1AE3A 3MXGA 3R8BA 1Q12A 4H7BA 2K28A 2D0OA 2EYHA 5G3LF 1XJVA 1HNWQ 4PG3A 1B9NA 5IGFA 1PXUA 4A93H 3E0EA 2KCCA 3HOXG 5FKAC 2NVTB 4ZQ3A 2JA5B 1XMQL 4BBSG 2NTTA 1GUWA 1EIFA 3CRKC 2B8FA 1J5EL 3KF6B 1WTOA 2L15A 4EQPA 1X55A 4K6DA 1HTLD 1OXVA 5ELFA 1B3QA 1PYSB 3FKIH 5GAGC 4A3KG 5J22A 4A3JB 1CKOA 3D4DA 4OX9L 3WOEA 5C3XA 4IQZA 3D3RA 1ESRA 1EY5A 1BBWA 4AYBB 4IPGA 2B63G 2QEJC 2LKVA 3UE0A 1SEBD 1AEXA 2DUDA 2VS1A 4B3TL 1AZPA 4KD4A 1EY8A 4BWGB 4JI0Q 5A2QE 2ASBA 3RR5A 2Z8LA 1PZID 2ATWA 4QL5A 3PMFA 4KY5A 5JEAH 4ZUJA 1C7YA 4GKKQ 5I9OA 2YTXA 4DR3L 4Y52H 2D0PA 1I4XA 3K0YA 4CGYB 1KTKA 2HIXA 3D6WA 5M5XH 5IIFA 4A93G 2K75A 4CJ2C 4Y7NB 3J80c 2RA4A 5M9OA 5I4DA 4DV3Q 1ET9A 1KDAA 2L11A 1X3PA 4FXGC 3F1ZA 2C9OA 1ONLA 1X56A 1EQVA 2EIFA 3Q8DA 3I4OA 5M3MB 1HA6A 2KBNA 3T1HQ 4DR2Q 4LFAQ 1YNXA 4X65Q 4GNXB 2LFNA 3TMEA 5BR8L 4LF4Q 4BY7H 4GS3A 3N52A 2WB1E 4LFCL 3I2ZA 1EYCA 4AYBG 1I6VC 3H0GH 3S1RB 3GTJH 5EKIA 2ZJPA 2F0OA 2IT1A 3S1NB 1Y1WH 3I4LA 3SK6A 2K33A 3PUYA 3HOYB 3I3CA 3MXNA 3I4MH 1EEFD 2PYKA 1YNND 2RF4A 4AQYL 1JORA 5IGDA 4BBRG 5IE8A 2NN6H 4FDBA 3CPWA 4A3JG 1N8RC 3HOUH 3AU7A 1T5EA 4GN3B 3SK5A 5M5YB 3E0JA 2AKWB 1B44D 1F9RA 3P7JA 1SE2A 2R7FA 1JWSD 1VQEA 3IKJA 5HGQA 2ICIA 4JK1C 1DM0B 2YTYA 3PUZA 3S16H 1LT4D 4GKKL 3CC4A 3K5MA 2SNMA 4GOPA 3Q22A 4XQNA 2EVBA 3CCLA 4HMJA 4J8QA 4F7XA 1KAAA 4KV6A 1QUQA 3OIPA 1CHPD 1RODA 2K01A 4FXDA 3HOVG 1NBWA 1VQOA 5D3DA 4HR7B 4I65A 1K0SA 5LMNW 1HQMC 5J1ZA 1QCBD 3I7FA 3NXWA 3NWTA 1ENCA 3HOUG 1HXYD 2R61A 3RLNA 2DGYA 1GKHA 1XMQQ 2A68D 1DXMA 1SFOH 2WACA 3MTSA 1CKNA 3M3YB 1YHBA 3H6MA 3HKSA 4R4TA 1YHAA 4GN5A 4R8NA 4AQYQ 1CUKA 4IOCA 1MI2A 1WOCA 3A0JA 5ELCA 3H0GG 1SRUA 3S14H 3C1EA 1K28A 1RTOA 2ZM6L 3GTGH 3HRZC 4ZUIA 4DV0L 4L6TB 3HOWB 1WD1A 4V190 2BE5D 1WFQA 2KJXA 1BCPB 4RGTA 2K52A 4EQ5A 1BF4A 2MUYA 3VYTA 1A3VA 1HNZL 1VQGA 1TU2B 5CORA 1GOZA 1D2BA 4X3TA 1TWFB 4L63B 1HJPA 5IGGA 3JC66 1HR0Q 1L2FA 2QGQA 2K6AA 4BY7B 4DN4M 1HFGA 1OXXK 3P1HA 5G3LD 1WTRA 1VQ5A 1BCPF 3OWFA 5CBAE 3CCMA 2V1CC 2IX0A 4HJAA 3HKZG 3X3NA 4DV5Q 2UU9L 2O5IC 4CHTB 2NWGA 3OSOA 4A3BB 1MD2D 4RFBA 1MSGA 1G6ZA 5C5LA 3J7ZC 4DR6Q 1YI2A 1KD1C 1ILQA 1KHIA 4A3LG 4A3MB 4RG1A 4DR5L 1SBBB 4RHRA 3ULLA 4JI7Q 3MC0B 1J6QA 4FYDA 4ULLA 1IXRA 3OW2A 3LWUA 3J80i 1TVXA 1VQLA 2L1BA 1JCKB 5EKLA 3ZYYX 5C3EH 2N49A 1ZXTA 3A74A 4NDXA 1TWHH 1G6PA 2ID0A 3IRBA 1B9MA 2I5MX 4IPDA 4PNYA 5JJLA 2PPBC 4IOAA 2WAQB 2YYZA 1STEA 1XPOA 1XNQQ 1K0RA 3DM3A 1GM5A 1X9NA 1TR5A 3KLWA 4WJ3M 1BCPD 2B63B 4BY7G 3W1BA 3MXUA 1EQQA 3U4VA 5IODA 2HDMA 3E9HA 1NMGA 4HSVA 2CCZA 1EEID 1EQRA 4IURA 2A69D 4BXXH 1L1OA 3GTKB 5M3MH 2K5VA 3KF8A 1UEAB 1BBXC 3GTPB 1F2MA 4DR2L 2VZAA 3P75A 4N8FA 5LHY1 1S4ZA 2XNAC 2F0QA 2I0QA 1HZ9A 1I50B 3S1MB 4A3BG 1XWEA 2KCNA 2WKDA 5KEEA 1FJGL 1QZGA 4BBSB 3CMAA 1PDQA 2PNHA 1DYQA 4QB4A 4DXFA 2K03A 2KECA 2GA4B 2EZVA 5M3FB 1PTOD 2JA7G 4A3IH 4IFDJ 3OPOA 4LF9Q 1JJCB 4EQNA 3HOUB 4ALPA 3MFYA 4GNXC 5C6AA 1TS2A 5IYDH 2ZTDA 2B2UC 5IOCA 2VQFQ 1PRTC 2B2YC 1CA5A 2VQEL 4DK1A 1H95A 3CAMA 1TXYA 1I6HB 4JG2A 1NAPA 3SGIA 2ZXRA 4DA2A 5IY0A 3BDLA 1BO0A 1KDCA 3KDFA 2B2WC 3NBIA 1Y1WB 4J1MA 3K5LA 5C0XH 5L37A 1ZYRC 5FK9C 4JOIA 3RN5A 2OT2A 2WKCA 1X3GA 1LTAD 1WVLA 3KLRA 1V43A 2AMCB 2F0LA 1HUNA 1EFID 2EDGA 4RA8A 4RMFA 1LT6D 4NXMQ 5M5WB 1TKWB 4YY3L 1A15A 3H91A 3U50C 1WI5A 5IP9H 5FLXc 5ELBA 4AYBE 1AZQA 4ZK9B 1EOTA 1S72A 4IFDG 3LX0A 2F3IA 3PV0A 4UP7A 4C3IH 4GKJL 1IBML 4MIUA 3QOLA 1MSHA 2EYFA 4LWCA 1S5ED 3SXHA 1WTPA 1BNZA 2JA9A 2NVYH 1Y14B 5JVH3 3E9IA 3ZJYC 1ESFA 3OTOL 1JT8A 3I73A 4EQOA 5H1SE 2JYOA 5M5XB 3Q0AA 1KL9A 1AW7A 1I4RA 3D8GA 3ITPA 3PIO3 2ICEC 4DR6L 3K81C 1E0BA 3IFDA 3TS0A 1DOMA 5HY6A 5KGUA 1Q90A 1UWVA 4OGQC 1TY2A 4X3KA 2HQLA 2F0MA 3CW2C 2J0TD 5CC4A 4LMQD 3WDNA 2PCFB 5EQ0A 5IWAQ 3J7A5 2AUKA 2E75C 2O4XA 3L0OA 4NB3A 1QE6A 2WFWA 4BBRB 1YJNA 2E2HH 3S2DH 4K2LA 3F2UA 2K4KA 3RMHA 5KYIA 1C4QA 4EGVA 1JB3A 1YBYA 4H0LC 1FJGQ 2DJGC 1HA5A 3CC2A 4MNOA 3A7LA 4JI2Q 4HIDA 2PMZB 2UUAL 4OEMB 3VYSA 3FKIB 2RHSB 3KJOA 4O0AA 1OXSC 1BVSA 4KKTA 2WAQG 2RSOA 4YCUA 1F2YA 2IL8A 2UXBL 2QDLA 1EY9A 4GLVB 4K8IA 3GTPH 5M3MG 2F3WA 1VQ8A 3CXCA 5I9PA 2HD3A 1GHKA 1X32A 2MPMA 4TKOB 3A5UA 3Q6SA 1CFMA 1S3OA 2G9DA 3AEVA 2C5CA 2ENBA 2VB3X 4LJZC 2NVXB 4OWTB 3TP7A 1GHJA 4ZLTF 2PQEA 3S16B 3M4OB 5CGKA 2FFKB 2DJFC 4A3IB 2A8VA 1RF2D 4LF4L 5D65A 1K9MC 4UAIA 1FNUA 3G4SA 3NPPA 1TWAH 5DM63 2F03A 4XQJA 1QNKA 3U9OA 3KDFB 4Y7NH 1I94L 2OXPA 2VW9A 4UPAA 1UE1A 4RWSC 1LTLA 2R92B 1ICWA 1A8VA 4RKLA 4AIMA 3X3MA 4OONA 2KOLA 3DWQA 2E2JH 3GP7A 1CSQA 3GO5A 2NTSA 4JI6L 1H9SA 1SN8A 1TWAB 3PO2B 2E5LQ 4A3KB 3GTQH 2SDFA 3S15B 2R93H 1V1PA 4IPCA 1VQNA 1VQDA 3EVQA 3OMGA 3M85A 2R92H 3W2DA 3K0XA 3TZUA 3T51B 1D7QA 2A74C 4JI4L 4DF7A 1PH2A 2EY6A 4WRDA 1K8OA 1N32L 4X6AH 4BBRH 2XSCA 4B3RQ 4DV6Q 5GAEC 1JE5A 3H94A 1WTVA 3FRPB 4IN3A 1EWCA 2NBFA 2BH8A 3PF5A 3RZDB 1N32Q 2YU9H 3FHWA 1GUSA 1R9TH 1QZHA 3F2CA 2UUCL 4YCVA 1VS0A 1EY4A 4A3BH 2L5TA 1UEBA 1C9OA 2LSSA 3A5ZB 5FLXE 2R92G 4HMIA 1LTGD
chains in the Genus database with same CATH topology
1KIXA 3TRZA 2KHJA 5IYCG 5C0XI 4DV1Q 4AYBG 3H0GH 2PMZE 2QA4A 2EXDA 5JEAG 3GTJH 5M3FG 4APVA 2ZJPA 3T1YL 1YITA 1K73C 3KYHC 1I94Q 3KFUA 2IT1A 2VY3A 1Y1WH 3RNUA 3PUYA 2BA1A 3I4MH 4KHPL 2R93G 2RF4A 2JQOA 1NY4A 4AQYL 1N36Q 5C4XG 4KHZA 3J81i 4BBRG 2XTIA 5IE8A 4FDBA 5FJ8G 3CPWA 4A3JG 1YZ6A 1IBKL 1QVFA 1N8RC 3HOUH 2K14A 3PUXA 4X64L 2R7ZH 4GKJQ 1EFWA 3HOVH 2Z6KC 4L5TA 3PUVA 4GN3B 4LUOA 5M5WH 5C0XJ 1HNXL 4A3CH 4LF8L 2AKWB 5K36G 4JI0L 1SLJA 2MO0A 4JI8L 2R7FA 2BH2A 4A3EH 4P71A 2PQAB 4P73A 1HZBA 1B8AA 1VQEA 3DLLA 4DR1L 5HGQA 4P72A 4B3ML 4L5RC 3RLOA 3PIOA 1N33Q 2YTYA 1VQHA 3PUZA 3HOYG 1T9HA 5DLQE 4IO9A 3CCRA 3S16H 4NPSA 1VQ4A 3CC4A 4GKKL 4GOPA 3I4NH 2AHOB 1JMCA 1HZCA 1X65A 4QY7A 4JI5L 3S17H 4DR5Q 3CCLA 4LF5L 1LUZA 1E22A 1IYJB 2XGTA 2Z6KA 1QUQA 4PZ6A 4POFA 1U0LA 4YHHQ 3GTOH 1X54A 3HOVG 3CCVA 1NBWA 1VQOA 1DGSA 1N34L 4O2DA 1PH9A 5LMNW 4R4QA 3KJPA 3WWVA 2JA5H 4LW1A 4A4IA 4JI1L 3I7FA 1U5KA 4DUYQ 3HOUG 4LF6Q 4DV1L 3FKIG 3RLNA 5IYBH 4A3KH 1PH7A 1EYGA 1YEZA 1IBLL 4A76A 2DGYA 2E5LL 1GKHA 1VQMA 3CMEA 1XMQQ 3GTLH 4JV5L 5GAHC 4DV6L 1SFOH 3I4MG 4LUVA 2JEBI 1CKNA 2JEAI 1YHBA 3HKSA 2LXJA 1YHAA 4R4TA 4GN5A 4AQYQ 1XMOQ 1CUKA 3TREA 4LUZA 5M3FH 1WOCA 3A0JA 4DPGA 3H0GG 1SRUA 2OCEA 5E7NA 3S14H 2H5XA 2ZM6L 5FLMG 3GTGH 3CF5A 3UDXA 4GNXA 5JJKA 2VQEQ 2I5HA 4GLXA 1YJWA 3UE1A 4POGA 4DV0L 4QJFA 4PZ7A 1PA6A 2E2IH 4LFBL 1WFQA 1Q81C 4DV3L 2K52A 4DV7L 1O7IA 4XIGS 4B3SL 2ZTCA 4EQ5A 4PMWA 4R4CA 1BBUA 1L1OB 1WCMH 4KI0A 4IFDI 1FVIA 1HNZL 1VQGA 2MO1A 3KF8B 3STBC 3I56A 3J81j 1N33L 3HOZH 1JB7A 1GO3E 1WJJA 1MJCA 1QVGA 4DV2Q 3T1HL 4DV5L 3S15H 2ZM6Q 1VQBA 1HJPA 3JC66 1XMOL 4TQUS 1PH4A 1L2FA 1HR0Q 4JBMA 2QGQA 4JI2L 1NTGA 1LYLA 2KHIA 5ELNA 3CC7A 2Q2HA 4K0KL 1X3EA 1OXXK 4DV7Q 4OO1I 4QGUA 4OXPA 5FLMH 2UXCL 1VQ5A 1A63A 2CKZB 3TQYA 4DKAC 5C44H 3CCMA 2V1CC 2IX0A 4HJAA 4JI4Q 3HKZG 4JI1Q 2GN5A 3OTOQ 2PQAA 1L1OC 5C4JH 3CCJA 3HFZB 4DV5Q 2UU9L 1A62A 4DAYB 3G71A 3PIPA 1NMFA 3CCUA 1LM0A 2D62A 3D0FA 3I55A 4JYAL 2WAQE 2ZTEA 4BA2I 4IJHA 3J7ZC 4DR6Q 1YI2A 1KD1C 4B3RL 1XTDA 5ELOA 3S1RH 1KHIA 4A3LG 1SMXA 2JA5G 4RG1A 4DR5L 4A3EG 1A0IA 2EQSA 1MIUA 4UP8A 3ULJA 3ULLA 2ZJQA 4JI7Q 1J6QA 3W5OA 5IWAL 4IOCA 2CWPA 3AYHB 1IXRA 3OW2A 2IX1A 2JE6I 2VUMH 1VQ6A 3U58A 3J80i 3BJUA 2IY5B 1Z47A 2Y0SG 2A1AA 1PH5A 1VQLA 1D8LA 1TWFH 2Q2TA 1FL0A 4R1JA 5C3EH 3BZCA 3PCOB 3TS2A 2N49A 2OQ0A 2OTJA 3A74A 1TWHH 1G6PA 1SROA 2ID0A 3IRBA 3BZKA 4LF6L 4GLAC 2IHFA 2I5MX 4IPDA 1Q86C 2JA8H 2JJQA 4YWMA 5JJLA 3PO2G 4C3JH 5C44G 2GVAA 4LFBQ 4IOAA 5IYCH 1CKNB 2YYZA 2HHHQ 1VQCA 4DV0Q 1XPOA 1XNQQ 1VQPA 1K0RA 3DM3A 4A3MH 5C0XG 1GM5A 4A75A 1C0AA 4X62L 1X9NA 4JBJA 3KLWA 4WJ3M 5AJ3L 4BY7G 3W1BA 3H15A 5IP9G 2K50A 1HNZQ 2AWNA 1EQQA 2WP8J 3U4VA 4NXNQ 2UXCQ 2NN6G 4A3JH 3E9HA 1NMGA 2AWOA 3F2DA 1VQAA 1KXLA 1XPRA 4YCWA 3RZDH 2CCZA 4JI6Q 2ALYB 1L0WA 2CFMA 1EQRA 1IBLQ 4BXXH 1L1OA 1I6HH 1VQFA 5M3MH 2K5VA 1K8GA 4JYAQ 4X66Q 2UUCQ 4DR7Q 1Q8KA 1TWGH 4QIWE 3J81c 1XNRQ 4DR2L 2VZAA 1HNWL 3EIVA 1EIYB 1I3QH 3GDEA 4L5QA 1S40A 2I0QA 1KRTA 1HZ9A 1PV4A 5JJIA 1G51A 1YIJA 2JA6H 4A3BG 2KCTA 4R4OA 4YWLA 3VDYA 3KOJA 1E3PA 1M1KC 2UUBL 4B3SQ 4JI5Q 4BA1I 1FJGL 1EOVA 1E24A 3NENA 3CMAA 3ERSX 1QZGA 1V9PA 3M3YH 3UDFA 2PNHA 2Q2IA 1Q1EA 2C35B 1KAWA 3AFQA 2N3SA 3STBD 2Q2UA 1PYBA 1UE6A 1Y1VG 3K80C 3M9BA 1XPUA 2JA7G 3HOWG 2BA0A 3CPFA 5LMUQ 4A3IH 2A19A 4DV4L 5IYBG 4IFDJ 2F4VQ 2UUAQ 3MEFA 4GOPC 2JA6G 2PI2A 4LF9Q 3L2PA 1JJCB 5IYDG 4HJ5A 3UDGA 3PO3G 4A3DG 3FP9A 4ALPA 1BKBA 4PZ8A 3K7UC 1W2BA 4DR4L 4A3FG 1EWIA 4L5SA 5GADC 4QQBX 4GNXC 1KC8C 4XTCS 3S1NH 5IYDH 2ZTDA 2B63H 2VQFQ 4DR4Q 1W3SA 2VQEL 1PH1A 2CQOA 1VQ7A 3CAMA 2RHQB 1TXYA 3HOZG 1H95A 4JG2A 5AJ3Q 2F4VL 4B3TQ 2K5NA 3SGIA 1B70B 1RIPA 5IY0A 1PH6A 2UU9Q 2HHHL 3CD6A 3KDFA 2R6GA 2N8NA 3PGZA 2KENA 4JBWA 3PUWA 5IP7G 4JC0A 4MZ9A 1CKMA 4A3MG 4JOIA 1WYDA 1MJEA 1PHJA 2UXDQ 2NVQH 3RN5A 3D31A 1X3GA 5LMNQ 4C3HH 1V43A 2AMCB 3G48A 2QEXA 2JA8G 3L7ZC 1E1TA 2PI2E 2Z0SA 4P75A 4DAMA 4EX5A 3CP0A 3H3VH 4RMFA 1VQJA 4NXMQ 1KQSA 2NN6I 3GTMH 1XNQL 4YY3L 4KHPQ 1N9WA 2Y0SE 5FJ8H 1E7ZA 3U50C 3G6EA 1WI5A 4DK3C 2E8GA 5IP9H 1VQIA 5FLXc 1IZ6A 2VUMG 4AYBE 1GVPA 3RN2A 4NXNL 4A3GH 1HNXQ 1CSPA 3M7NA 1S72A 2R7DA 4X64Q 4UP7A 2F3IA 3PV0A 4C3IH 3AQQA 4IFDG 4HIOA 4GKJL 2ES2A 1P8LA 3KF6A 1IBML 4LWCA 3CCSA 3PSIA 3JAMi 2JA9A 2NVYH 4JCVE 4X66L 4DR1Q 1Y14B 4OWWB 4NXML 3E9IA 3ZJYC 1VQ9A 1IBMQ 1JT8A 3OTOL 1PFSA 4JI7L 5IP7H 5H1SE 1PH8A 3RLFA 4J15A 3I4NG 1KL9A 3CCEA 4DUZL 3H3VI 1SE8A 3HKZE 1PVOA 4AH6A 4DR6L 3K81C 1X3FA 3TS0A 1M90C 1UE7A 1UE5A 2VL6A 4JI3L 1YHQA 1EUJA 3NBHB 5HY6A 4HJ7A 4BY1H 1UWVA 1OXUA 1HH2P 3OYYA 2HQLA 3S24A 3CW2C 3M4OH 3HOWH 4A3FH 1K3RA 2GVBA 5LMUL 4DV4Q 1V1QA 4GN4B 3EBEA 5IWAQ 2NVXH 3J7A5 4A3DH 5J3BA 1J5EQ 3L0OA 2HT1A 2N78A 4NB3A 2WFWA 4TVAB 5JEAJ 3W1GA 1YJNA 1I5FA 2E2HH 5LMNL 1I50H 2YV5A 3S2DH 1OXTA 2K4KA 4A3IG 3RZOH 2UXBQ 2JA7H 3PF4A 1YBYA 2MNAA 4DUZQ 2UUBQ 1FJGQ 1HZAA 4OX9Q 4BY1G 3GTKH 3CC2A 4MNOA 2YTVA 3EN2A 4JI2Q 2K5HA 1Q46A 1HR0L 1Y1VH 4HJ9A 1VQKA 4HIDA 2UUAL 4OO1G 1E1OA 2NZOA 4DNIA 3MXNB 2RHSB 3KJOA 1OXSC 4O0AA 1MKHA 4JOIC 1BVSA 4JI8Q 1AE2A 5EAYA 2WAQG 3U4ZA 1Z9FA 1K83H 4YCUA 4HJ8A 4LF7Q 3K8AA 2UXBL 3TEHB 2RCNA 1Q1BA 4GLVB 1NE3A 3GTPH 5M3MG 3M4QA 2B29A 2ZJRA 2NZHA 1VQ8A 3CXCA 4ME3A 5M5YH 2LXKA 1AE3A 1NJIC 1Q12A 1Q82C 1G291 3A5UA 4A3GG 4IJLA 4LFAL 1S3OA 2D0OA 1XJVA 3S1MH 3AEVA 4BXXG 1XNRL 1HNWQ 4PG3A 1JJGA 1OTCA 2KCMA 1YVCA 3NEMA 1QVCA 4KLKA 4OWTB 4JI3Q 4C2MH 4A93H 1Q7YC 3E0EA 4LF8Q 4LFCQ 3HOXG 3CCQA 4MTNA 3ICEA 2MQHA 1XMQL 4BBSG 4JV5Q 4K0KQ 2VNUD 2A8VA 1X6OA 4LF4L 1EIFA 4LNQA 1K9MC 1J5EL 4X65L 4YWKA 2WB1G 3KF6B 2OWOA 3G4SA 2L15A 2OTLA 4X62Q 1N36L 1X55A 1TWAH 4YY3Q 3PO2H 4B3MQ 1FGUA 1OXVA 2CWAA 4OWXB 5GQOA 1PYSB 3KDFB 3FKIH 5GAGC 4Y7NH 4HIKA 4A3KG 4WJ4A 1I94L 1ASZA 1CKOA 2VW9A 4UPAA 4LF5Q 5C3EG 1UE1A 4OX9L 3JAMc 1LTLA 2MFIA 1A8VA 1AH9A 4AIMA 4A3LH 3ULPA 1BBWA 4OONA 5GROA 4IPGA 2B63G 3ER0A 4UY8C 3UE0A 1N34Q 3F8TA 3GD7A 2DUDA 2VS1A 4HIMA 4B3TL 4IPHA 2E2JH 1KRSA 1CSQA 4GOPB 4R4IA 5C4XH 3GO5A 3T1YQ 3B6YA 2IHEA 1SN8A 4JI0Q 4JI6L 2E5LQ 2ASBA 3GTQH 2R93H 3RR5A 3M4PA 2ATWA 3K7AH 4IPCA 4QL5A 3HOYH 3CQZH 1VQNA 1GD7A 3AFPA 4H02A 1C7YA 1HR0W 2UXDL 2B3GA 1VQDA 1IBKQ 1QUQB 1SR3A 1IL2A 1RL2A 2OQKA 4GKKQ 3M85A 2FXQA 4UP9A 3LGJA 2NVTH 2R92H 2YTXA 4DR3L 4Y52H 2D0PA 3S1QH 3K0XA 4LF9L 1D7QA 3F2BA 4A3CG 4BBSH 2HIXA 4DR7L 4JI4L 3HOXH 5M5XH 1PH2A 2R7ZG 4A93G 2K75A 4YHHL 1P16A 3J80c 1N32L 4X6AH 2VQFL 4BBRH 4B3RQ 4DK6C 4DV6Q 5GAEC 1JE5A 3PO3H 1JJ2A 4DV3Q 3NELA 1VCIA 4LF7L 1K8AC 1Y1WG 1WCMG 1N32Q 3F1ZA 1TWCH 2BH8A 5BR8Q 2JK8A 4DUYL 1X56A 3PF5A 1B7YB 1YJ9A 2F52A 2EIFA 3Q8DA 2YU9H 3FHWA 3BU2A 3I4OA 1R9TH 3UDIA 4DV2L 2KBNA 3T1HQ 4DR2Q 4LFAQ 1YNXA 2HIVA 3F2CA 4DR3Q 5IT9c 4X65Q 4GNXB 1QZHA 1PH3A 4JBKA 2I5LX 5BR8L 2UUCL 4LF4Q 4BY7H 4YCVA 1VS0A 4A3BH 4GS3A 1ASYA 1UEBA 1C9OA 2LSSA 4P74A 3A5ZB 3S2HH 2WB1E 2R92G 4LFCL 3I2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIX A;  3TRZ A;  2KHJ A;  5IYC G;  5C0X I;  4DV1 Q;  4AYB G;  3H0G H;  2PMZ E;  2QA4 A;  2EXD A;  5JEA G;  3GTJ H;  5M3F G;  4APV A;  2ZJP A;  3T1Y L;  1YIT A;  1K73 C;  3KYH C;  1I94 Q;  3KFU A;  2IT1 A;  2VY3 A;  1Y1W H;  3RNU A;  3PUY A;  2BA1 A;  3I4M H;  4KHP L;  2R93 G;  2RF4 A;  2JQO A;  1NY4 A;  4AQY L;  1N36 Q;  5C4X G;  4KHZ A;  3J81 i;  4BBR G;  2XTI A;  5IE8 A;  4FDB A;  5FJ8 G;  3CPW A;  4A3J G;  1YZ6 A;  1IBK L;  1QVF A;  1N8R C;  3HOU H;  2K14 A;  3PUX A;  4X64 L;  2R7Z H;  4GKJ Q;  1EFW A;  3HOV H;  2Z6K C;  4L5T A;  3PUV A;  4GN3 B;  4LUO A;  5M5W H;  5C0X J;  1HNX L;  4A3C H;  4LF8 L;  2AKW B;  5K36 G;  4JI0 L;  1SLJ A;  2MO0 A;  4JI8 L;  2R7F A;  2BH2 A;  4A3E H;  4P71 A;  2PQA B;  4P73 A;  1HZB A;  1B8A A;  1VQE A;  3DLL A;  4DR1 L;  5HGQ A;  4P72 A;  4B3M L;  4L5R C;  3RLO A;  3PIO A;  1N33 Q;  2YTY A;  1VQH A;  3PUZ A;  3HOY G;  1T9H A;  5DLQ E;  4IO9 A;  3CCR A;  3S16 H;  4NPS A;  1VQ4 A;  3CC4 A;  4GKK L;  4GOP A;  3I4N H;  2AHO B;  1JMC A;  1HZC A;  1X65 A;  4QY7 A;  4JI5 L;  3S17 H;  4DR5 Q;  3CCL A;  4LF5 L;  1LUZ A;  1E22 A;  1IYJ B;  2XGT A;  2Z6K A;  1QUQ A;  4PZ6 A;  4POF A;  1U0L A;  4YHH Q;  3GTO H;  1X54 A;  3HOV G;  3CCV A;  1NBW A;  1VQO A;  1DGS A;  1N34 L;  4O2D A;  1PH9 A;  5LMN W;  4R4Q A;  3KJP A;  3WWV A;  2JA5 H;  4LW1 A;  4A4I A;  4JI1 L;  3I7F A;  1U5K A;  4DUY Q;  3HOU G;  4LF6 Q;  4DV1 L;  3FKI G;  3RLN A;  5IYB H;  4A3K H;  1PH7 A;  1EYG A;  1YEZ A;  1IBL L;  4A76 A;  2DGY A;  2E5L L;  1GKH A;  1VQM A;  3CME A;  1XMQ Q;  3GTL H;  4JV5 L;  5GAH C;  4DV6 L;  1SFO H;  3I4M G;  4LUV A;  2JEB I;  1CKN A;  2JEA I;  1YHB A;  3HKS A;  2LXJ A;  1YHA A;  4R4T A;  4GN5 A;  4AQY Q;  1XMO Q;  1CUK A;  3TRE A;  4LUZ A;  5M3F H;  1WOC A;  3A0J A;  4DPG A;  3H0G G;  1SRU A;  2OCE A;  5E7N A;  3S14 H;  2H5X A;  2ZM6 L;  5FLM G;  3GTG H;  3CF5 A;  3UDX A;  4GNX A;  5JJK A;  2VQE Q;  2I5H A;  4GLX A;  1YJW A;  3UE1 A;  4POG A;  4DV0 L;  4QJF A;  4PZ7 A;  1PA6 A;  2E2I H;  4LFB L;  1WFQ A;  1Q81 C;  4DV3 L;  2K52 A;  4DV7 L;  1O7I A;  4XIG S;  4B3S L;  2ZTC A;  4EQ5 A;  4PMW A;  4R4C A;  1BBU A;  1L1O B;  1WCM H;  4KI0 A;  4IFD I;  1FVI A;  1HNZ L;  1VQG A;  2MO1 A;  3KF8 B;  3STB C;  3I56 A;  3J81 j;  1N33 L;  3HOZ H;  1JB7 A;  1GO3 E;  1WJJ A;  1MJC A;  1QVG A;  4DV2 Q;  3T1H L;  4DV5 L;  3S15 H;  2ZM6 Q;  1VQB A;  1HJP A;  3JC6 6;  1XMO L;  4TQU S;  1PH4 A;  1L2F A;  1HR0 Q;  4JBM A;  2QGQ A;  4JI2 L;  1NTG A;  1LYL A;  2KHI A;  5ELN A;  3CC7 A;  2Q2H A;  4K0K L;  1X3E A;  1OXX K;  4DV7 Q;  4OO1 I;  4QGU A;  4OXP A;  5FLM H;  2UXC L;  1VQ5 A;  1A63 A;  2CKZ B;  3TQY A;  4DKA C;  5C44 H;  3CCM A;  2V1C C;  2IX0 A;  4HJA A;  4JI4 Q;  3HKZ G;  4JI1 Q;  2GN5 A;  3OTO Q;  2PQA A;  1L1O C;  5C4J H;  3CCJ A;  3HFZ B;  4DV5 Q;  2UU9 L;  1A62 A;  4DAY B;  3G71 A;  3PIP A;  1NMF A;  3CCU A;  1LM0 A;  2D62 A;  3D0F A;  3I55 A;  4JYA L;  2WAQ E;  2ZTE A;  4BA2 I;  4IJH A;  3J7Z C;  4DR6 Q;  1YI2 A;  1KD1 C;  4B3R L;  1XTD A;  5ELO A;  3S1R H;  1KHI A;  4A3L G;  1SMX A;  2JA5 G;  4RG1 A;  4DR5 L;  4A3E G;  1A0I A;  2EQS A;  1MIU A;  4UP8 A;  3ULJ A;  3ULL A;  2ZJQ A;  4JI7 Q;  1J6Q A;  3W5O A;  5IWA L;  4IOC A;  2CWP A;  3AYH B;  1IXR A;  3OW2 A;  2IX1 A;  2JE6 I;  2VUM H;  1VQ6 A;  3U58 A;  3J80 i;  3BJU A;  2IY5 B;  1Z47 A;  2Y0S G;  2A1A A;  1PH5 A;  1VQL A;  1D8L A;  1TWF H;  2Q2T A;  1FL0 A;  4R1J A;  5C3E H;  3BZC A;  3PCO B;  3TS2 A;  2N49 A;  2OQ0 A;  2OTJ A;  3A74 A;  1TWH H;  1G6P A;  1SRO A;  2ID0 A;  3IRB A;  3BZK A;  4LF6 L;  4GLA C;  2IHF A;  2I5M X;  4IPD A;  1Q86 C;  2JA8 H;  2JJQ A;  4YWM A;  5JJL A;  3PO2 G;  4C3J H;  5C44 G;  2GVA A;  4LFB Q;  4IOA A;  5IYC H;  1CKN B;  2YYZ A;  2HHH Q;  1VQC A;  4DV0 Q;  1XPO A;  1XNQ Q;  1VQP A;  1K0R A;  3DM3 A;  4A3M H;  5C0X G;  1GM5 A;  4A75 A;  1C0A A;  4X62 L;  1X9N A;  4JBJ A;  3KLW A;  4WJ3 M;  5AJ3 L;  4BY7 G;  3W1B A;  3H15 A;  5IP9 G;  2K50 A;  1HNZ Q;  2AWN A;  1EQQ A;  2WP8 J;  3U4V A;  4NXN Q;  2UXC Q;  2NN6 G;  4A3J H;  3E9H A;  1NMG A;  2AWO A;  3F2D A;  1VQA A;  1KXL A;  1XPR A;  4YCW A;  3RZD H;  2CCZ A;  4JI6 Q;  2ALY B;  1L0W A;  2CFM A;  1EQR A;  1IBL Q;  4BXX H;  1L1O A;  1I6H H;  1VQF A;  5M3M H;  2K5V A;  1K8G A;  4JYA Q;  4X66 Q;  2UUC Q;  4DR7 Q;  1Q8K A;  1TWG H;  4QIW E;  3J81 c;  1XNR Q;  4DR2 L;  2VZA A;  1HNW L;  3EIV A;  1EIY B;  1I3Q H;  3GDE A;  4L5Q A;  1S40 A;  2I0Q A;  1KRT A;  1HZ9 A;  1PV4 A;  5JJI A;  1G51 A;  1YIJ A;  2JA6 H;  4A3B G;  2KCT A;  4R4O A;  4YWL A;  3VDY A;  3KOJ A;  1E3P A;  1M1K C;  2UUB L;  4B3S Q;  4JI5 Q;  4BA1 I;  1FJG L;  1EOV A;  1E24 A;  3NEN A;  3CMA A;  3ERS X;  1QZG A;  1V9P A;  3M3Y H;  3UDF A;  2PNH A;  2Q2I A;  1Q1E A;  2C35 B;  1KAW A;  3AFQ A;  2N3S A;  3STB D;  2Q2U A;  1PYB A;  1UE6 A;  1Y1V G;  3K80 C;  3M9B A;  1XPU A;  2JA7 G;  3HOW G;  2BA0 A;  3CPF A;  5LMU Q;  4A3I H;  2A19 A;  4DV4 L;  5IYB G;  4IFD J;  2F4V Q;  2UUA Q;  3MEF A;  4GOP C;  2JA6 G;  2PI2 A;  4LF9 Q;  3L2P A;  1JJC B;  5IYD G;  4HJ5 A;  3UDG A;  3PO3 G;  4A3D G;  3FP9 A;  4ALP A;  1BKB A;  4PZ8 A;  3K7U C;  1W2B A;  4DR4 L;  4A3F G;  1EWI A;  4L5S A;  5GAD C;  4QQB X;  4GNX C;  1KC8 C;  4XTC S;  3S1N H;  5IYD H;  2ZTD A;  2B63 H;  2VQF Q;  4DR4 Q;  1W3S A;  2VQE L;  1PH1 A;  2CQO A;  1VQ7 A;  3CAM A;  2RHQ B;  1TXY A;  3HOZ G;  1H95 A;  4JG2 A;  5AJ3 Q;  2F4V L;  4B3T Q;  2K5N A;  3SGI A;  1B70 B;  1RIP A;  5IY0 A;  1PH6 A;  2UU9 Q;  2HHH L;  3CD6 A;  3KDF A;  2R6G A;  2N8N A;  3PGZ A;  2KEN A;  4JBW A;  3PUW A;  5IP7 G;  4JC0 A;  4MZ9 A;  1CKM A;  4A3M G;  4JOI A;  1WYD A;  1MJE A;  1PHJ A;  2UXD Q;  2NVQ H;  3RN5 A;  3D31 A;  1X3G A;  5LMN Q;  4C3H H;  1V43 A;  2AMC B;  3G48 A;  2QEX A;  2JA8 G;  3L7Z C;  1E1T A;  2PI2 E;  2Z0S A;  4P75 A;  4DAM A;  4EX5 A;  3CP0 A;  3H3V H;  4RMF A;  1VQJ A;  4NXM Q;  1KQS A;  2NN6 I;  3GTM H;  1XNQ L;  4YY3 L;  4KHP Q;  1N9W A;  2Y0S E;  5FJ8 H;  1E7Z A;  3U50 C;  3G6E A;  1WI5 A;  4DK3 C;  2E8G A;  5IP9 H;  1VQI A;  5FLX c;  1IZ6 A;  2VUM G;  4AYB E;  1GVP A;  3RN2 A;  4NXN L;  4A3G H;  1HNX Q;  1CSP A;  3M7N A;  1S72 A;  2R7D A;  4X64 Q;  4UP7 A;  2F3I A;  3PV0 A;  4C3I H;  3AQQ A;  4IFD G;  4HIO A;  4GKJ L;  2ES2 A;  1P8L A;  3KF6 A;  1IBM L;  4LWC A;  3CCS A;  3PSI A;  3JAM i;  2JA9 A;  2NVY H;  4JCV E;  4X66 L;  4DR1 Q;  1Y14 B;  4OWW B;  4NXM L;  3E9I A;  3ZJY C;  1VQ9 A;  1IBM Q;  1JT8 A;  3OTO L;  1PFS A;  4JI7 L;  5IP7 H;  5H1S E;  1PH8 A;  3RLF A;  4J15 A;  3I4N G;  1KL9 A;  3CCE A;  4DUZ L;  3H3V I;  1SE8 A;  3HKZ E;  1PVO A;  4AH6 A;  4DR6 L;  3K81 C;  1X3F A;  3TS0 A;  1M90 C;  1UE7 A;  1UE5 A;  2VL6 A;  4JI3 L;  1YHQ A;  1EUJ A;  3NBH B;  5HY6 A;  4HJ7 A;  4BY1 H;  1UWV A;  1OXU A;  1HH2 P;  3OYY A;  2HQL A;  3S24 A;  3CW2 C;  3M4O H;  3HOW H;  4A3F H;  1K3R A;  2GVB A;  5LMU L;  4DV4 Q;  1V1Q A;  4GN4 B;  3EBE A;  5IWA Q;  2NVX H;  3J7A 5;  4A3D H;  5J3B A;  1J5E Q;  3L0O A;  2HT1 A;  2N78 A;  4NB3 A;  2WFW A;  4TVA B;  5JEA J;  3W1G A;  1YJN A;  1I5F A;  2E2H H;  5LMN L;  1I50 H;  2YV5 A;  3S2D H;  1OXT A;  2K4K A;  4A3I G;  3RZO H;  2UXB Q;  2JA7 H;  3PF4 A;  1YBY A;  2MNA A;  4DUZ Q;  2UUB Q;  1FJG Q;  1HZA A;  4OX9 Q;  4BY1 G;  3GTK H;  3CC2 A;  4MNO A;  2YTV A;  3EN2 A;  4JI2 Q;  2K5H A;  1Q46 A;  1HR0 L;  1Y1V H;  4HJ9 A;  1VQK A;  4HID A;  2UUA L;  4OO1 G;  1E1O A;  2NZO A;  4DNI A;  3MXN B;  2RHS B;  3KJO A;  1OXS C;  4O0A A;  1MKH A;  4JOI C;  1BVS A;  4JI8 Q;  1AE2 A;  5EAY A;  2WAQ G;  3U4Z A;  1Z9F A;  1K83 H;  4YCU A;  4HJ8 A;  4LF7 Q;  3K8A A;  2UXB L;  3TEH B;  2RCN A;  1Q1B A;  4GLV B;  1NE3 A;  3GTP H;  5M3M G;  3M4Q A;  2B29 A;  2ZJR A;  2NZH A;  1VQ8 A;  3CXC A;  4ME3 A;  5M5Y H;  2LXK A;  1AE3 A;  1NJI C;  1Q12 A;  1Q82 C;  1G29 1;  3A5U A;  4A3G G;  4IJL A;  4LFA L;  1S3O A;  2D0O A;  1XJV A;  3S1M H;  3AEV A;  4BXX G;  1XNR L;  1HNW Q;  4PG3 A;  1JJG A;  1OTC A;  2KCM A;  1YVC A;  3NEM A;  1QVC A;  4KLK A;  4OWT B;  4JI3 Q;  4C2M H;  4A93 H;  1Q7Y C;  3E0E A;  4LF8 Q;  4LFC Q;  3HOX G;  3CCQ A;  4MTN A;  3ICE A;  2MQH A;  1XMQ L;  4BBS G;  4JV5 Q;  4K0K Q;  2VNU D;  2A8V A;  1X6O A;  4LF4 L;  1EIF A;  4LNQ A;  1K9M C;  1J5E L;  4X65 L;  4YWK A;  2WB1 G;  3KF6 B;  2OWO A;  3G4S A;  2L15 A;  2OTL A;  4X62 Q;  1N36 L;  1X55 A;  1TWA H;  4YY3 Q;  3PO2 H;  4B3M Q;  1FGU A;  1OXV A;  2CWA A;  4OWX B;  5GQO A;  1PYS B;  3KDF B;  3FKI H;  5GAG C;  4Y7N H;  4HIK A;  4A3K G;  4WJ4 A;  1I94 L;  1ASZ A;  1CKO A;  2VW9 A;  4UPA A;  4LF5 Q;  5C3E G;  1UE1 A;  4OX9 L;  3JAM c;  1LTL A;  2MFI A;  1A8V A;  1AH9 A;  4AIM A;  4A3L H;  3ULP A;  1BBW A;  4OON A;  5GRO A;  4IPG A;  2B63 G;  3ER0 A;  4UY8 C;  3UE0 A;  1N34 Q;  3F8T A;  3GD7 A;  2DUD A;  2VS1 A;  4HIM A;  4B3T L;  4IPH A;  2E2J H;  1KRS A;  1CSQ A;  4GOP B;  4R4I A;  5C4X H;  3GO5 A;  3T1Y Q;  3B6Y A;  2IHE A;  1SN8 A;  4JI0 Q;  4JI6 L;  2E5L Q;  2ASB A;  3GTQ H;  2R93 H;  3RR5 A;  3M4P A;  2ATW A;  3K7A H;  4IPC A;  4QL5 A;  3HOY H;  3CQZ H;  1VQN A;  1GD7 A;  3AFP A;  4H02 A;  1C7Y A;  1HR0 W;  2UXD L;  2B3G A;  1VQD A;  1IBK Q;  1QUQ B;  1SR3 A;  1IL2 A;  1RL2 A;  2OQK A;  4GKK Q;  3M85 A;  2FXQ A;  4UP9 A;  3LGJ A;  2NVT H;  2R92 H;  2YTX A;  4DR3 L;  4Y52 H;  2D0P A;  3S1Q H;  3K0X A;  4LF9 L;  1D7Q A;  3F2B A;  4A3C G;  4BBS H;  2HIX A;  4DR7 L;  4JI4 L;  3HOX H;  5M5X H;  1PH2 A;  2R7Z G;  4A93 G;  2K75 A;  4YHH L;  1P16 A;  3J80 c;  1N32 L;  4X6A H;  2VQF L;  4BBR H;  4B3R Q;  4DK6 C;  4DV6 Q;  5GAE C;  1JE5 A;  3PO3 H;  1JJ2 A;  4DV3 Q;  3NEL A;  1VCI A;  4LF7 L;  1K8A C;  1Y1W G;  1WCM G;  1N32 Q;  3F1Z A;  1TWC H;  2BH8 A;  5BR8 Q;  2JK8 A;  4DUY L;  1X56 A;  3PF5 A;  1B7Y B;  1YJ9 A;  2F52 A;  2EIF A;  3Q8D A;  2YU9 H;  3FHW A;  3BU2 A;  3I4O A;  1R9T H;  3UDI A;  4DV2 L;  2KBN A;  3T1H Q;  4DR2 Q;  4LFA Q;  1YNX A;  2HIV A;  3F2C A;  4DR3 Q;  5IT9 c;  4X65 Q;  4GNX B;  1QZH A;  1PH3 A;  4JBK A;  2I5L X;  5BR8 L;  2UUC L;  4LF4 Q;  4BY7 H;  4YCV A;  1VS0 A;  4A3B H;  4GS3 A;  1ASY A;  1UEB A;  1C9O A;  2LSS A;  4P74 A;  3A5Z B;  3S2H H;  2WB1 E;  2R92 G;  4LFC L;  3I2Z A; 
#chains in the Genus database with same CATH topology
 3TRZ A;  5C0X I;  4DV1 Q;  2CH4 W;  2QA4 A;  2EY1 A;  4CDD C;  5M3F G;  3T1Y L;  3KYH C;  3PO3 B;  5C4J B;  3KFU A;  4ABN A;  1SJH D;  5A2Q L;  3RNU A;  3S2D B;  2E2H B;  3KBG A;  1RDP D;  1N36 Q;  2FMC A;  3BZD B;  2F0J A;  1IYU A;  2UXD Q;  1QIL A;  4L5T A;  3PUV A;  5C0X J;  4LUO A;  4A3C H;  3RUZ A;  5K36 G;  1A6X A;  4OEL B;  4OIK A;  1SLJ A;  4CDE C;  3FVQ A;  3BYY B;  1ML0 D;  1B8A A;  1CZW A;  1O7Z A;  2M00 A;  4B3M L;  4P72 A;  1PZJ D;  3RLO A;  3HOY G;  4P2C B;  2CH4 A;  4IO9 A;  2FMM A;  1EYD A;  4NPS A;  3DM1 A;  4RHS A;  1EL0 A;  2YU9 B;  1HZC A;  1IHZ A;  4JI5 L;  1TS5 A;  4ILW A;  1STY A;  5CV5 A;  2AQ2 B;  4C3J B;  1IYJ B;  4DAP A;  2XGT A;  5K5P A;  4LK1 C;  4PZ6 A;  4YHH Q;  1U0L A;  3GTO H;  2IPK D;  2QF7 A;  3BDO A;  4R4Q A;  1A3U A;  3WWV A;  1ZYR D;  5KND A;  2FIN B;  5DNF A;  3FPU B;  1STG A;  4A76 A;  3GTL H;  4JV5 L;  5GAH C;  4DV6 L;  4V0B A;  1TS3 A;  1F9Q A;  2K5Q A;  2LXJ A;  2EE1 A;  4RCN A;  2B2Y A;  4LUZ A;  2OCE A;  1EY0 A;  4DAV A;  5FLM G;  2HDL A;  3UDX A;  3VR5 A;  4GNX A;  1YJW A;  3UE1 A;  3OW7 A;  4FXK C;  2F0T A;  4PZ7 A;  2E2I H;  2BDN A;  1KDB A;  4DV3 L;  1O7I A;  4B3S L;  4DNR B;  4R4C A;  1BBU A;  1H9R A;  4IFD I;  4FF1 A;  1JB7 A;  2LS0 1;  3U9S A;  4HSP A;  3S15 H;  1FNW A;  2R93 B;  3MA2 B;  4TQU S;  4JI2 L;  4JBM A;  1OO9 B;  1NTG A;  1GUG A;  2JP1 A;  2KHI A;  4JW0 A;  4A3D B;  1XTC D;  2Q2H A;  4B08 A;  3BS1 A;  1SJE D;  4K0K L;  3LNN A;  2LY7 A;  3NHH A;  4QGU A;  3OOC A;  4OXP A;  2PO4 A;  3MAQ A;  4DKA C;  2WV6 D;  1HFN A;  2G5D A;  2PZU A;  5BN5 A;  2VB2 X;  4JI1 Q;  3OTO Q;  2A69 C;  1L1O C;  1F9P A;  5C4J H;  3CCJ A;  1A62 A;  1LTR D;  1NMF A;  3CCU A;  1LM0 A;  3QR8 A;  5EJW A;  1XXG A;  1JQY D;  2WAQ E;  4BA2 I;  3TP8 A;  2QIL A;  3H0G B;  5ELO A;  1TQO A;  3S1R H;  2JA5 G;  1B2T A;  4A3E G;  2ZJQ A;  1MIU A;  1QJO A;  2XVS A;  3W5O A;  3CU7 A;  4C3I B;  3K57 A;  1JWM D;  3AYH B;  2IX1 A;  2JE6 I;  5ELD A;  2VUM H;  2E2D C;  5D3I B;  1VQ6 A;  1S5B D;  2IY5 B;  1Z47 A;  3TSS A;  1PH5 A;  1SAP A;  1D8L A;  1TWF H;  3IFT A;  1FL0 A;  2Q2T A;  4R1J A;  1CT1 D;  1D1I A;  1M4V A;  2OQ0 A;  2K7V A;  3J7A F;  3NTH A;  4GLA C;  1IKL A;  3BVZ A;  4YWM A;  1BCP C;  4C3J H;  2GVA A;  4LFB Q;  5CV9 A;  4IUU A;  1PFN A;  1CKN B;  3J80 E;  1Y8N B;  2HQE A;  2A6H C;  4A75 A;  2G9H D;  1SYB A;  4JBJ A;  3C1F A;  1KAB A;  3EA6 A;  1K3B C;  1Z6H A;  5EKK A;  4NXN Q;  3V05 A;  3F2D A;  1VQA A;  3NQI A;  4JI6 Q;  5KNB A;  2HCC A;  1I6H H;  1L0X B;  3CRL C;  1TWG H;  1M8A A;  1HNW L;  3A54 A;  5EBC A;  1EIY B;  2HCI A;  3O13 A;  1KRT A;  1GJX A;  5JJI A;  1YIJ A;  2JA6 H;  4YWL A;  1M1K C;  3VDY A;  1E3P A;  4N9T A;  4JI5 Q;  4BA1 I;  1EOV A;  5ISR A;  3E3X A;  1CK1 A;  2F4I A;  3ERS X;  4C1N K;  2A68 C;  1Q1E A;  2C35 B;  2Q2I A;  3AFQ A;  2Q8T A;  2Q2U A;  1PYB A;  1B50 A;  5E3F A;  2BA0 A;  3CPF A;  3ND9 A;  5LMU Q;  2F4V Q;  3MEF A;  4GOP C;  3FEW X;  1TT2 A;  5JAV A;  4HJ5 A;  2B2V A;  4K5W A;  2Z9H A;  3UDG A;  1BKB A;  4QF4 A;  1HCZ A;  4DR4 L;  4A3F G;  2F1M A;  4L5S A;  3R3O A;  5GAD C;  4QIW B;  4HTH A;  1KC8 C;  1DCZ A;  3S1N H;  1SNC A;  4G4K A;  2EYO A;  1IW7 C;  1W3S A;  2P5Z X;  1PH1 A;  3HOZ G;  5C44 B;  1VQ7 A;  2RHQ B;  4UHV A;  1D5M C;  1LLR D;  1PH6 A;  3EQL C;  2EJF C;  1I3Q B;  2F0N A;  1W6J A;  1IW7 D;  3PGZ A;  3G7L A;  4C2M B;  4JBW A;  5BN4 A;  3FMC A;  4A93 B;  3WOF A;  4TSS A;  5FLX L;  3PUW A;  4A3M G;  4JC0 A;  4MZ9 A;  2NVQ H;  1B1Z A;  1TS4 A;  1SNM A;  2M9V A;  3G48 A;  2QEX A;  1E1T A;  4DAM A;  4P75 A;  1HHV A;  1I4H A;  1VQJ A;  3E6Z X;  4WFN 3;  1Z7T A;  3GTM H;  1UUP A;  3H09 A;  1N9W A;  4KHP Q;  1F2L A;  2E2J B;  1EYA A;  3A7A B;  2OEO A;  1VQI A;  3ND8 A;  4DK0 A;  4XT1 B;  3A56 A;  1GVP A;  4H44 C;  2F3V A;  3M7N A;  3TN2 A;  3TP6 A;  1PMR A;  3AQQ A;  2ES2 A;  4DGZ A;  3PSI A;  3JAM i;  2HUG A;  4OWW B;  1QG7 A;  1RCV D;  2IW3 A;  4HED A;  4G7O C;  2ZXP A;  1SNO A;  1EQT A;  2KUM A;  2E2I B;  1PH8 A;  3RLF A;  4NP5 A;  4IUV A;  4ODG A;  1M90 C;  2EY2 A;  1C48 A;  1UE5 A;  1EUJ A;  3NBH B;  4U67 3;  1HH2 P;  1JOK A;  3S24 A;  3VYU A;  1VMC A;  5CV8 A;  1K3R A;  2GVB A;  2NVX H;  1V1Q A;  1H9M A;  3HOX B;  5J3B A;  1YNJ D;  3QJY A;  4TVA B;  5JEA J;  3V2T A;  1I5F A;  5C5M A;  2E76 C;  3RZO H;  5CR3 A;  3MHB A;  3PF4 A;  1CQV A;  2MNA A;  2IWH A;  4DUZ Q;  2PNR C;  2UUB Q;  5T1I A;  1HR0 L;  1PFM A;  4OO1 G;  2NZO A;  2XIW A;  5I6Y A;  3BDC A;  4MTK A;  4QCL A;  2CW0 C;  5EAY A;  5KIX A;  3J7Y W;  4HJ8 A;  3TEH B;  2RCN A;  2EYJ A;  3M4Q A;  1PZK D;  2KEE A;  4FF3 A;  1O80 A;  1Q82 C;  1G29 1;  3QIA A;  4A3G G;  2MJ8 A;  4IJL A;  4LFA L;  1S5D D;  5E1F A;  1LO5 D;  2DN8 A;  2JA6 B;  1XNR L;  4BXX G;  2TMP A;  2XRS D;  2CVR A;  1OTC A;  1YVC A;  3NEM A;  2RCF A;  4ZRZ A;  4KLK A;  3I90 A;  4JI3 Q;  2BE5 C;  2SEB D;  4C2M H;  2DNC A;  1CM9 A;  1QNU A;  1Q7Y C;  4LFC Q;  3CCQ A;  3ICE A;  1B3A A;  2OF1 A;  3K59 A;  1KNA A;  2WB1 B;  4X65 L;  4XYO A;  2OWO A;  1FYC A;  2OTL A;  4OHJ A;  4X62 Q;  3E5S A;  2R3Z A;  4YY3 Q;  3VYR A;  4B3M Q;  1TWH B;  1FGU A;  1O7Y A;  2CWA A;  4OWX B;  4F87 A;  4HIK A;  4WJ4 A;  1JOO A;  3LWE A;  1I4P A;  2KED A;  2V4D A;  4LF5 Q;  5C3E G;  3JAM c;  2Z4I A;  1D1K A;  1FNV A;  4Q0F A;  2A6E D;  1J9O A;  3T53 B;  2K1B A;  3ULP A;  1LT5 D;  3MEH A;  3F8T A;  3GD7 A;  4QUF A;  4HIM A;  2F0G A;  1VDZ A;  4IPH A;  5DM7 3;  5DEH A;  5C4X H;  3T1Y Q;  3SE0 A;  1J8I A;  3M4P A;  1SE4 A;  3DXJ C;  3HOY H;  1SYE A;  5LL6 S;  1GD7 A;  4H02 A;  2UXD L;  2B3G A;  3JAM E;  1SR3 A;  2KQ3 A;  1WCM B;  2AUJ D;  1LV9 A;  4BY1 B;  2FXQ A;  2NVT H;  3LGJ A;  3QG1 A;  1CHQ D;  4LAA A;  3S1Q H;  3SK8 A;  3F2B A;  4A3C G;  4BBS H;  4L8J A;  1Y8O B;  3HOX H;  2ZXO A;  5A35 A;  4X3S A;  5I6W A;  4YHH L;  1P16 A;  2F0S A;  2R7Z G;  2R7Z B;  2VQF L;  1WTX A;  5FO9 B;  3NEL A;  1G91 A;  1GUT A;  3L9A X;  2BOS A;  3NBH A;  1W6K A;  1WCM G;  1TWC H;  5BR8 Q;  4IZ8 A;  4OL7 A;  1YJ9 A;  2F52 A;  3AB9 A;  1ENF A;  1II3 A;  3BU2 A;  3UDI A;  4DV2 L;  1U9R A;  3HGB A;  1EZ6 A;  2HIV A;  2JEA I;  2DY8 A;  1PH3 A;  5FO8 B;  1SYF A;  2I5L X;  1GXD C;  4WJW A;  3I8Z A;  4FP5 D;  1SSO A;  2A73 B;  4P74 A;  3J81 E;  1NNX A;  1H9J A;  1KIX A;  2KHJ A;  3DMU A;  5IYC G;  1RTN A;  2EXD A;  5JEA G;  4U68 A;  2X6G A;  4R9W A;  1I94 Q;  2VY3 A;  3A8J E;  1SNQ A;  2Q8I B;  2BA1 A;  4HAE A;  4KHP L;  1Q8I A;  1V1O A;  3NSW A;  2JQO A;  5C4X G;  4KHZ A;  4PQX A;  5FJ8 G;  1IBK L;  2EOT A;  1QVF A;  4PV1 C;  4GKJ Q;  3SHL A;  1EFW A;  2Z6K C;  1DOK A;  1DOL A;  5M5W H;  3J80 L;  2FHT A;  4JI0 L;  2MO0 A;  1PTO F;  4JI8 L;  3MVV A;  1Y69 U;  2PQA B;  4DXG A;  1HZB A;  4ZCK A;  3DLL A;  3PIO A;  1VQH A;  2DY7 A;  1D6E C;  1T9H A;  5FOB B;  2F0I A;  2AHO B;  3I4M B;  1H9S B;  1X65 A;  3S17 H;  1VMP A;  4DR5 Q;  3I72 A;  4G7Z C;  1PRT D;  1SNP A;  3NE5 B;  4QMG A;  4RGO S;  4LF5 L;  3IAY A;  1E22 A;  4CJ0 B;  3L3O C;  2Z6K A;  4GZY C;  2EPB A;  4HCE A;  3CCV A;  1N34 L;  1ENA A;  1VF5 C;  1PH9 A;  4CKC A;  4R8I A;  2JA5 H;  1ET6 A;  2ZT9 C;  4LW1 A;  4I7Z C;  4JI1 L;  1U4L A;  1U5K A;  4DUY Q;  2MP1 A;  2Z6B A;  5IYB H;  3EFX D;  1IBL L;  1YEZ A;  1VQM A;  3CME A;  2EYL A;  5CV7 A;  3I4M G;  4LUV A;  1PFB A;  3ERQ A;  1F2Z A;  1ILP A;  4CBV A;  1I4G A;  3TRE A;  2K5W A;  2EYP A;  5E7N A;  5CMD A;  3CF5 A;  1K83 B;  5JJK A;  2VQE Q;  4GLX A;  3GTQ B;  4POG A;  2B2V C;  3HZX A;  4RGN A;  1Q81 C;  4XIG S;  1DON A;  4KI0 A;  4M1U B;  5KNC A;  1JWU D;  1QB5 D;  3NUC A;  2F0K A;  3I56 A;  3J81 j;  3HOZ H;  4DV5 L;  2ZM6 Q;  1EWH A;  1XMO L;  1PH4 A;  2PZT A;  1LYL A;  1LTS D;  1DZ1 A;  1WTQ A;  2EYM A;  2KVM A;  2NB0 A;  1A2U A;  3GTG B;  4OO1 I;  1CZG A;  5CV6 A;  5FLM H;  5D14 A;  3S1Q B;  1A63 A;  2NVQ B;  2CKZ B;  2SNS A;  1PLF A;  2B2T C;  2DNE A;  2NZ1 D;  3G71 A;  4F88 A;  3I55 A;  2L55 A;  4JYA L;  4M8A A;  1XTD A;  1SMX A;  4HCS A;  3HG9 A;  3J81 L;  2QW7 A;  3Q24 A;  1IKM A;  3R2T A;  1L0Y B;  4N9P A;  3MWY W;  2L4N A;  3BJU A;  3GV3 A;  1EY7 A;  1PTO C;  5JVG 3;  3PCO B;  4MHE A;  3TS2 A;  2OTJ A;  4ZAI A;  1KLG D;  4XQQ A;  5C44 G;  2RVL A;  5IYC H;  1VQC A;  4A3M H;  2XWJ B;  4ME5 A;  1C0A A;  2FJ2 A;  5AJ3 L;  1E2W A;  4A3F B;  3DUZ A;  1EU3 A;  5IP9 G;  2L9H A;  4O1N A;  2AWN A;  2WP8 J;  3M4Y A;  2AWO A;  1KXL A;  4YCW A;  1TWC B;  2CFM A;  1DJR D;  2KHS A;  3OIQ A;  1IBL Q;  1K8G A;  4XT3 B;  2QDB A;  1LTB D;  2H1E A;  2UUC Q;  4DR7 Q;  1Q8K A;  4QIW E;  3J81 c;  4KN7 C;  3URY A;  2B2W A;  4C1N I;  1I3Q H;  3GDE A;  2D2C C;  4L5Q A;  2RDG A;  4XDX A;  1PV4 A;  2F0U A;  3BG3 A;  1SYC A;  1G51 A;  4KK7 A;  2KCT A;  1PYW D;  4R4O A;  3KOJ A;  4B3S Q;  2Q8R E;  1E24 A;  3NEN A;  3GTJ B;  1R9T B;  1UAP A;  1V9P A;  1STN A;  3UDF A;  5EPK A;  2B2U A;  1KAW A;  2N3S A;  3CQZ B;  1Y1V G;  5EPJ A;  3DEP A;  3PQI A;  5C3W A;  3S9W A;  2A19 A;  4DV4 L;  2JA6 G;  2RDH A;  2PI2 A;  3L2P A;  5IYD G;  2PW5 A;  3PO3 G;  4TRD A;  4PZ8 A;  1EWI A;  1EIG A;  4QQB X;  4K8J A;  2Z4H A;  2B63 H;  3MFG A;  3AMU A;  3K6O A;  1V8Q A;  2NYZ D;  3S14 B;  4QUC A;  2E74 C;  1U4M A;  2CQO A;  1HRJ A;  4IUN A;  2K05 A;  5AJ3 Q;  2Y0S B;  2K5N A;  1B70 B;  2F0W A;  1WTW A;  2UU9 Q;  3CD6 A;  2N8N A;  2K32 A;  1JIC A;  5E4W C;  1MJE A;  4FNF A;  1CKM A;  4C3H H;  3HS0 C;  1T5X D;  4C3I G;  4ZKC B;  2JA8 G;  3H3V H;  2Z0S A;  3H3V C;  1BXT A;  2JSO A;  5K36 H;  1KQS A;  2TSS A;  3SR1 A;  2NN6 I;  1XNQ L;  1E7Z A;  3IL8 A;  3G6E A;  1IZ6 A;  4S3S A;  2VUM G;  3RN2 A;  4A3G H;  2J7Z A;  1HNX Q;  2RSN A;  1P8L A;  3KF6 A;  1K8M A;  2N88 A;  3CCS A;  4ID6 A;  4JCV E;  4DR1 Q;  3J7A V;  1IBM Q;  5JJZ A;  1FD7 D;  4JI7 L;  5IP7 H;  1TII D;  3I4N G;  3A55 A;  1LTT D;  1NR4 A;  4DUZ L;  3HKZ E;  1PVO A;  4AH6 A;  1X3F A;  4KN4 C;  3C3L A;  1STA A;  1UE7 A;  1HTP A;  2VL6 A;  4JI3 L;  3OHX C;  2KA7 A;  3HEJ A;  3BVM A;  1PRT B;  2EJM A;  3M4O H;  1QOH A;  2A6H D;  5F2D A;  1SFO B;  4C3H B;  2B2T A;  3SDZ A;  4GN4 B;  4DV4 Q;  2A5H A;  1J5E Q;  5CYU A;  3W1G A;  5IGE A;  1I50 H;  1NUC A;  4A3I G;  2UXB Q;  1XX8 A;  2JA7 H;  3PIP 3;  1S5F D;  1HZA A;  4BY1 G;  2NUC A;  3EN2 A;  2K5H A;  1Q46 A;  4HJ9 A;  1VQK A;  3QWN A;  1E1O A;  4DNI A;  5KRU A;  1RD9 D;  5LL6 X;  4RKB A;  1SND A;  3U4Z A;  1DD2 A;  4KJO A;  1Z9F A;  4WOR A;  4KJN A;  2NVY B;  4LF7 Q;  3K8A A;  5AFW A;  1Q1B A;  2B29 A;  4FO2 A;  5M5Y H;  3Q23 A;  1NJI C;  4C56 C;  4K5V A;  4KY6 A;  3FPP A;  4FF4 A;  3S1M H;  1JJG A;  4IUT A;  2KCM A;  1QVC A;  1I4Q A;  2F0H A;  4LF8 Q;  4MTN A;  2MQH A;  4JV5 Q;  1LTI D;  4K0K Q;  1A3T A;  1LAC A;  2VNU D;  4JPB W;  1X6O A;  1KNE A;  2XRQ D;  1CQF A;  4LNQ A;  2F0D A;  3SK4 A;  4YWK A;  2WB1 G;  2EY5 A;  1SYD A;  3T4A C;  1N36 L;  2RDF A;  3PO2 H;  4NW2 A;  5GQO A;  3K7A B;  3N6R A;  5C4H A;  5JPN C;  3I4N B;  2WIN B;  4RAU C;  1ASZ A;  3TP5 A;  3K5N A;  3K5O A;  5J39 A;  2JN4 A;  2MFI A;  1JOQ A;  1AH9 A;  2CQA A;  2Z1C A;  1G2S A;  4A3L H;  3GTO B;  5GRO A;  1YNJ C;  3ER0 A;  4UY8 C;  1N34 Q;  1STH A;  3NWS A;  2BCO A;  1KRS A;  4GOP B;  2RKS A;  4R4I A;  1VF7 A;  4ZKB B;  3B6Y A;  2IHE A;  3K7A H;  5JPM C;  1AP0 A;  3KUP A;  3CQZ H;  2K5D A;  3AFP A;  4HN7 A;  1HR0 W;  1IBK Q;  1QUQ B;  1IL2 A;  1RL2 A;  3NQT A;  2OQK A;  2JA8 B;  1JC7 A;  4G7H C;  4UP9 A;  1TY0 A;  1XYI A;  4LF9 L;  1SMY D;  3S2H B;  3EJI A;  4MN3 A;  4DR7 L;  1RHP A;  4XYQ A;  4DK6 C;  1C8C A;  3PO3 H;  1JJ2 A;  1VCI A;  4LF7 L;  1B53 A;  1K8A C;  1MBY A;  1Y1W G;  1O78 A;  4DUY L;  2JK8 A;  3BYT B;  1B7Y B;  1NR2 A;  4E6I A;  4O42 A;  3DHQ A;  5C4Z A;  2B8G A;  4DR3 Q;  5IT9 c;  4JBK A;  3P20 A;  1D5Z C;  5IT9 E;  3VA7 A;  4N8X 1;  2IJ0 A;  1ASY A;  3S2H H;  4LF8 L;  4KD3 A;  2PMZ E;  1IL8 A;  1Y1V B;  4RH6 A;  1WTH A;  4APV A;  1YIT A;  1K73 C;  4DNT B;  5JOB A;  2R93 G;  1NY4 A;  4J6H A;  2JA7 B;  4H13 C;  3J81 i;  1BOS A;  2XTI A;  4FF2 A;  1YZ6 A;  2K14 A;  3PUX A;  4X64 L;  2R7Z H;  3NTK A;  2JXM B;  3HOV H;  1R4P B;  1HNX L;  3MZ5 A;  4CDC C;  2BH2 A;  3GQB A;  4DFA A;  4A3E H;  1U4P A;  1AN8 A;  1SXT A;  4P71 A;  4P73 A;  3NP8 A;  4DR1 L;  4L5R C;  1N33 Q;  5HGT A;  5DLQ E;  3CCR A;  1VQ4 A;  2LMC B;  5COY A;  3I4N H;  3VR2 A;  1JMC A;  4QY7 A;  4K5X A;  5NUC A;  2RBM A;  2F0F A;  1LUZ A;  3SEB A;  3HOZ B;  4JVZ A;  1EY6 A;  4POF A;  3TZD A;  1X54 A;  1DGS A;  4O2D A;  3T16 A;  3KJP A;  1U4R A;  2BDO A;  3TBI B;  5IGB A;  4A4I A;  4LF6 Q;  4DV1 L;  3FKI G;  4A3K H;  1PH7 A;  1EYG A;  3KK7 A;  2E5L L;  1WD0 A;  1LAB A;  2JEB I;  3DWP A;  1XMO Q;  5M3F H;  4DPG A;  4C3H G;  1EU4 A;  2H5X A;  1A2T A;  2I5H A;  4Q5V A;  3R2I A;  1NSN S;  3SVM A;  4QJF A;  1PA6 A;  2J4X A;  3A8K E;  4LFB L;  1BDO A;  3I91 A;  5CV4 A;  4DV7 L;  2ZTC A;  4PMW A;  4XXE A;  1WCM H;  1L1O B;  3JAM L;  5TSS A;  3GV6 A;  1FVI A;  2MO1 A;  3KF8 B;  1AFP A;  1FGB D;  1CTM A;  3HP3 A;  3STB C;  1N33 L;  1GO3 E;  1WJJ A;  1MJC A;  5DAU A;  4DV2 Q;  1QVG A;  3T1H L;  1NCV A;  1PRT F;  5E4X A;  1VQB A;  2AQ1 B;  5EBD A;  3MXP A;  2B39 A;  4ZYS A;  2L0C A;  5ELN A;  3CC7 A;  4I7A A;  1X3E A;  3BVG A;  3VR6 A;  4DV7 Q;  2CW0 D;  2UXC L;  2VUM B;  4CDF C;  4NMZ A;  3TQY A;  5C44 H;  4JI4 Q;  3VR3 A;  1LT3 D;  4KTA A;  2GN5 A;  3C46 A;  2I07 B;  2PQA A;  3GTL B;  2WII B;  3HFZ B;  1ZEQ X;  2AQ3 B;  4BS9 A;  4DAY B;  1O7L A;  1E2Z A;  3PIP A;  2D62 A;  3D0F A;  5BN3 A;  3UI2 A;  4B9W A;  2ZTE A;  4IJH A;  2O2L D;  4B3R L;  1MGS A;  4K2K A;  3HOW G;  1A0I A;  2EQS A;  4UP8 A;  4K14 A;  3ULJ A;  1Q3L A;  3VA5 A;  2MHV A;  5IWA L;  1G2T A;  1HUM A;  2CWP A;  1RJT A;  4A3E B;  1JR0 D;  3U58 A;  2Y0S G;  4KKU A;  2A1A A;  4FVM A;  1D5X C;  1CI3 M;  3BZC A;  4KHV A;  1QWY A;  2XWB B;  1Y8P B;  1SRO A;  3BZK A;  2K04 A;  4LF6 L;  2IHF A;  3I70 A;  1Q86 C;  2JA8 H;  2JJQ A;  3PO2 G;  3D6C A;  1F77 A;  2I46 A;  2HHH Q;  4DV0 Q;  3D4R A;  3D4W A;  1VQP A;  5C0X G;  3C2P A;  3R93 A;  4X62 L;  2A6E C;  3HOV B;  3H15 A;  2VXW A;  2K50 A;  3S17 B;  4K6L A;  1SDF A;  1HNZ Q;  1PTO H;  3A8I E;  1ICF B;  2UXC Q;  2NN6 G;  4A3J H;  3CKI B;  1XPR A;  1MHW C;  3RZD H;  4CJ1 B;  2ALY B;  1L0W A;  3DWA A;  1R4Q B;  1VQF A;  4JYA Q;  2RQX A;  4X66 Q;  1XNR Q;  3EIV A;  1CA6 A;  2D5D A;  1S40 A;  2PW7 A;  5EGT A;  1ZKO A;  3KLS A;  1UNS A;  2F0V A;  1G8Z D;  2IX3 A;  5C4X B;  5I2Y A;  2UUB L;  2CHB D;  3M3Y H;  5ELE A;  5I2X A;  4X3U A;  4KMU C;  3STB D;  1XPU A;  1UE6 A;  3K80 C;  3M9B A;  3CHB D;  2MGS A;  1B4O A;  4RGM A;  5FO7 B;  2M2L A;  3KBX A;  1RKN A;  5IYB G;  2UUA Q;  4UDU C;  4F8M A;  4A3D G;  3FP9 A;  1W2B A;  1STB A;  3K7U C;  4G57 A;  5CBE E;  1GUO A;  4OIJ A;  1BR9 A;  4XTC S;  2F0E A;  3RD4 A;  4DR4 Q;  5KYL A;  1HPC A;  1X3Q A;  3TDQ A;  3V96 A;  4B9X A;  4PMB A;  3QO2 A;  2F4V L;  4B3T Q;  1E2V A;  2N55 A;  1RIP A;  1SE3 A;  2HHH L;  2R6G A;  2KEN A;  1TWG B;  5IP7 G;  1WYD A;  1PHJ A;  1KLU D;  3D31 A;  5LMN Q;  4IUP A;  4DU9 A;  3QB3 A;  3L7Z C;  3FDT A;  2PI2 E;  4EX5 A;  2O5J C;  1SMY C;  2EJG C;  3CP0 A;  4DAY A;  4IFD H;  3RZO B;  3VR4 A;  3ONA B;  4RCO A;  4NKL A;  2Y0S E;  5FJ8 H;  4KKS A;  2F0P A;  4DK3 C;  2E8G A;  3KLS X;  3T13 A;  4IAL A;  2X6L A;  1SYG A;  1S5C D;  4NXN L;  4KY7 A;  1CSP A;  1JE4 A;  2R7D A;  4X64 Q;  3QOJ A;  3HKZ B;  5IGC A;  4HIO A;  2QKI C;  1HQR D;  1BUV T;  2EXZ A;  3NTI A;  4C3J G;  2X69 A;  5IT9 L;  3DEO A;  1FR3 A;  4X66 L;  5C3E B;  2PZW A;  4NXM L;  1VQ9 A;  1PFS A;  3W3A A;  4J15 A;  4CKE A;  2QCP X;  3CCE A;  1PTO B;  3H3V I;  1SE8 A;  3M7G A;  1H9K A;  1YHQ A;  4HJ7 A;  3OWE B;  4BY1 H;  3G6J B;  1OXU A;  5HUR A;  3ERO A;  3OYY A;  4CKB A;  3HOW H;  1GUN A;  2XN9 C;  4IUQ A;  3K58 A;  4A3F H;  1IYV A;  4YIJ A;  5LMU L;  3EBE A;  4A3D H;  1BQQ T;  2D9U A;  2HT1 A;  2N78 A;  4Z9C B;  5LMN L;  2L12 A;  2YV5 A;  1OXT A;  1V1P B;  3GTM B;  4EVO A;  5T1G A;  3GTK H;  1EZ8 A;  4A3G B;  4OX9 Q;  1YNN C;  4OO1 H;  2YTV A;  3NK9 A;  3OMC A;  5EPL A;  1Y1V H;  3MXN B;  3T56 B;  1MKH A;  2SOB A;  4JOI C;  4JI8 Q;  1AE2 A;  4PMC A;  1EIH A;  1K83 H;  2H4O A;  1NE3 A;  1F9S A;  2ZJR A;  2NZH A;  4ME3 A;  2LXK A;  1AE3 A;  3MXG A;  3R8B A;  1Q12 A;  4H7B A;  2K28 A;  2D0O A;  2EYH A;  5G3L F;  1XJV A;  1HNW Q;  4PG3 A;  1B9N A;  5IGF A;  1PXU A;  4A93 H;  3E0E A;  2KCC A;  3HOX G;  5FKA C;  2NVT B;  4ZQ3 A;  2JA5 B;  1XMQ L;  4BBS G;  2NTT A;  1GUW A;  1EIF A;  3CRK C;  2B8F A;  1J5E L;  3KF6 B;  1WTO A;  2L15 A;  4EQP A;  1X55 A;  4K6D A;  1HTL D;  1OXV A;  5ELF A;  1B3Q A;  1PYS B;  3FKI H;  5GAG C;  4A3K G;  5J22 A;  4A3J B;  1CKO A;  3D4D A;  4OX9 L;  3WOE A;  5C3X A;  4IQZ A;  3D3R A;  1ESR A;  1EY5 A;  1BBW A;  4AYB B;  4IPG A;  2B63 G;  2QEJ C;  2LKV A;  3UE0 A;  1SEB D;  1AEX A;  2DUD A;  2VS1 A;  4B3T L;  1AZP A;  4KD4 A;  1EY8 A;  4BWG B;  4JI0 Q;  5A2Q E;  2ASB A;  3RR5 A;  2Z8L A;  1PZI D;  2ATW A;  4QL5 A;  3PMF A;  4KY5 A;  5JEA H;  4ZUJ A;  1C7Y A;  4GKK Q;  5I9O A;  2YTX A;  4DR3 L;  4Y52 H;  2D0P A;  1I4X A;  3K0Y A;  4CGY B;  1KTK A;  2HIX A;  3D6W A;  5M5X H;  5IIF A;  4A93 G;  2K75 A;  4CJ2 C;  4Y7N B;  3J80 c;  2RA4 A;  5M9O A;  5I4D A;  4DV3 Q;  1ET9 A;  1KDA A;  2L11 A;  1X3P A;  4FXG C;  3F1Z A;  2C9O A;  1ONL A;  1X56 A;  1EQV A;  2EIF A;  3Q8D A;  3I4O A;  5M3M B;  1HA6 A;  2KBN A;  3T1H Q;  4DR2 Q;  4LFA Q;  1YNX A;  4X65 Q;  4GNX B;  2LFN A;  3TME A;  5BR8 L;  4LF4 Q;  4BY7 H;  4GS3 A;  3N52 A;  2WB1 E;  4LFC L;  3I2Z A;  1EYC A;  4AYB G;  1I6V C;  3H0G H;  3S1R B;  3GTJ H;  5EKI A;  2ZJP A;  2F0O A;  2IT1 A;  3S1N B;  1Y1W H;  3I4L A;  3SK6 A;  2K33 A;  3PUY A;  3HOY B;  3I3C A;  3MXN A;  3I4M H;  1EEF D;  2PYK A;  1YNN D;  2RF4 A;  4AQY L;  1JOR A;  5IGD A;  4BBR G;  5IE8 A;  2NN6 H;  4FDB A;  3CPW A;  4A3J G;  1N8R C;  3HOU H;  3AU7 A;  1T5E A;  4GN3 B;  3SK5 A;  5M5Y B;  3E0J A;  2AKW B;  1B44 D;  1F9R A;  3P7J A;  1SE2 A;  2R7F A;  1JWS D;  1VQE A;  3IKJ A;  5HGQ A;  2ICI A;  4JK1 C;  1DM0 B;  2YTY A;  3PUZ A;  3S16 H;  1LT4 D;  4GKK L;  3CC4 A;  3K5M A;  2SNM A;  4GOP A;  3Q22 A;  4XQN A;  2EVB A;  3CCL A;  4HMJ A;  4J8Q A;  4F7X A;  1KAA A;  4KV6 A;  1QUQ A;  3OIP A;  1CHP D;  1ROD A;  2K01 A;  4FXD A;  3HOV G;  1NBW A;  1VQO A;  5D3D A;  4HR7 B;  4I65 A;  1K0S A;  5LMN W;  1HQM C;  5J1Z A;  1QCB D;  3I7F A;  3NXW A;  3NWT A;  1ENC A;  3HOU G;  1HXY D;  2R61 A;  3RLN A;  2DGY A;  1GKH A;  1XMQ Q;  2A68 D;  1DXM A;  1SFO H;  2WAC A;  3MTS A;  1CKN A;  3M3Y B;  1YHB A;  3H6M A;  3HKS A;  4R4T A;  1YHA A;  4GN5 A;  4R8N A;  4AQY Q;  1CUK A;  4IOC A;  1MI2 A;  1WOC A;  3A0J A;  5ELC A;  3H0G G;  1SRU A;  3S14 H;  3C1E A;  1K28 A;  1RTO A;  2ZM6 L;  3GTG H;  3HRZ C;  4ZUI A;  4DV0 L;  4L6T B;  3HOW B;  1WD1 A;  4V19 0;  2BE5 D;  1WFQ A;  2KJX A;  1BCP B;  4RGT A;  2K52 A;  4EQ5 A;  1BF4 A;  2MUY A;  3VYT A;  1A3V A;  1HNZ L;  1VQG A;  1TU2 B;  5COR A;  1GOZ A;  1D2B A;  4X3T A;  1TWF B;  4L63 B;  1HJP A;  5IGG A;  3JC6 6;  1HR0 Q;  1L2F A;  2QGQ A;  2K6A A;  4BY7 B;  4DN4 M;  1HFG A;  1OXX K;  3P1H A;  5G3L D;  1WTR A;  1VQ5 A;  1BCP F;  3OWF A;  5CBA E;  3CCM A;  2V1C C;  2IX0 A;  4HJA A;  3HKZ G;  3X3N A;  4DV5 Q;  2UU9 L;  2O5I C;  4CHT B;  2NWG A;  3OSO A;  4A3B B;  1MD2 D;  4RFB A;  1MSG A;  1G6Z A;  5C5L A;  3J7Z C;  4DR6 Q;  1YI2 A;  1KD1 C;  1ILQ A;  1KHI A;  4A3L G;  4A3M B;  4RG1 A;  4DR5 L;  1SBB B;  4RHR A;  3ULL A;  4JI7 Q;  3MC0 B;  1J6Q A;  4FYD A;  4ULL A;  1IXR A;  3OW2 A;  3LWU A;  3J80 i;  1TVX A;  1VQL A;  2L1B A;  1JCK B;  5EKL A;  3ZYY X;  5C3E H;  2N49 A;  1ZXT A;  3A74 A;  4NDX A;  1TWH H;  1G6P A;  2ID0 A;  3IRB A;  1B9M A;  2I5M X;  4IPD A;  4PNY A;  5JJL A;  2PPB C;  4IOA A;  2WAQ B;  2YYZ A;  1STE A;  1XPO A;  1XNQ Q;  1K0R A;  3DM3 A;  1GM5 A;  1X9N A;  1TR5 A;  3KLW A;  4WJ3 M;  1BCP D;  2B63 B;  4BY7 G;  3W1B A;  3MXU A;  1EQQ A;  3U4V A;  5IOD A;  2HDM A;  3E9H A;  1NMG A;  4HSV A;  2CCZ A;  1EEI D;  1EQR A;  4IUR A;  2A69 D;  4BXX H;  1L1O A;  3GTK B;  5M3M H;  2K5V A;  3KF8 A;  1UEA B;  1BBX C;  3GTP B;  1F2M A;  4DR2 L;  2VZA A;  3P75 A;  4N8F A;  5LHY 1;  1S4Z A;  2XNA C;  2F0Q A;  2I0Q A;  1HZ9 A;  1I50 B;  3S1M B;  4A3B G;  1XWE A;  2KCN A;  2WKD A;  5KEE A;  1FJG L;  1QZG A;  4BBS B;  3CMA A;  1PDQ A;  2PNH A;  1DYQ A;  4QB4 A;  4DXF A;  2K03 A;  2KEC A;  2GA4 B;  2EZV A;  5M3F B;  1PTO D;  2JA7 G;  4A3I H;  4IFD J;  3OPO A;  4LF9 Q;  1JJC B;  4EQN A;  3HOU B;  4ALP A;  3MFY A;  4GNX C;  5C6A A;  1TS2 A;  5IYD H;  2ZTD A;  2B2U C;  5IOC A;  2VQF Q;  1PRT C;  2B2Y C;  1CA5 A;  2VQE L;  4DK1 A;  1H95 A;  3CAM A;  1TXY A;  1I6H B;  4JG2 A;  1NAP A;  3SGI A;  2ZXR A;  4DA2 A;  5IY0 A;  3BDL A;  1BO0 A;  1KDC A;  3KDF A;  2B2W C;  3NBI A;  1Y1W B;  4J1M A;  3K5L A;  5C0X H;  5L37 A;  1ZYR C;  5FK9 C;  4JOI A;  3RN5 A;  2OT2 A;  2WKC A;  1X3G A;  1LTA D;  1WVL A;  3KLR A;  1V43 A;  2AMC B;  2F0L A;  1HUN A;  1EFI D;  2EDG A;  4RA8 A;  4RMF A;  1LT6 D;  4NXM Q;  5M5W B;  1TKW B;  4YY3 L;  1A15 A;  3H91 A;  3U50 C;  1WI5 A;  5IP9 H;  5FLX c;  5ELB A;  4AYB E;  1AZQ A;  4ZK9 B;  1EOT A;  1S72 A;  4IFD G;  3LX0 A;  2F3I A;  3PV0 A;  4UP7 A;  4C3I H;  4GKJ L;  1IBM L;  4MIU A;  3QOL A;  1MSH A;  2EYF A;  4LWC A;  1S5E D;  3SXH A;  1WTP A;  1BNZ A;  2JA9 A;  2NVY H;  1Y14 B;  5JVH 3;  3E9I A;  3ZJY C;  1ESF A;  3OTO L;  1JT8 A;  3I73 A;  4EQO A;  5H1S E;  2JYO A;  5M5X B;  3Q0A A;  1KL9 A;  1AW7 A;  1I4R A;  3D8G A;  3ITP A;  3PIO 3;  2ICE C;  4DR6 L;  3K81 C;  1E0B A;  3IFD A;  3TS0 A;  1DOM A;  5HY6 A;  5KGU A;  1Q90 A;  1UWV A;  4OGQ C;  1TY2 A;  4X3K A;  2HQL A;  2F0M A;  3CW2 C;  2J0T D;  5CC4 A;  4LMQ D;  3WDN A;  2PCF B;  5EQ0 A;  5IWA Q;  3J7A 5;  2AUK A;  2E75 C;  2O4X A;  3L0O A;  4NB3 A;  1QE6 A;  2WFW A;  4BBR B;  1YJN A;  2E2H H;  3S2D H;  4K2L A;  3F2U A;  2K4K A;  3RMH A;  5KYI A;  1C4Q A;  4EGV A;  1JB3 A;  1YBY A;  4H0L C;  1FJG Q;  2DJG C;  1HA5 A;  3CC2 A;  4MNO A;  3A7L A;  4JI2 Q;  4HID A;  2PMZ B;  2UUA L;  4OEM B;  3VYS A;  3FKI B;  2RHS B;  3KJO A;  4O0A A;  1OXS C;  1BVS A;  4KKT A;  2WAQ G;  2RSO A;  4YCU A;  1F2Y A;  2IL8 A;  2UXB L;  2QDL A;  1EY9 A;  4GLV B;  4K8I A;  3GTP H;  5M3M G;  2F3W A;  1VQ8 A;  3CXC A;  5I9P A;  2HD3 A;  1GHK A;  1X32 A;  2MPM A;  4TKO B;  3A5U A;  3Q6S A;  1CFM A;  1S3O A;  2G9D A;  3AEV A;  2C5C A;  2ENB A;  2VB3 X;  4LJZ C;  2NVX B;  4OWT B;  3TP7 A;  1GHJ A;  4ZLT F;  2PQE A;  3S16 B;  3M4O B;  5CGK A;  2FFK B;  2DJF C;  4A3I B;  2A8V A;  1RF2 D;  4LF4 L;  5D65 A;  1K9M C;  4UAI A;  1FNU A;  3G4S A;  3NPP A;  1TWA H;  5DM6 3;  2F03 A;  4XQJ A;  1QNK A;  3U9O A;  3KDF B;  4Y7N H;  1I94 L;  2OXP A;  2VW9 A;  4UPA A;  1UE1 A;  4RWS C;  1LTL A;  2R92 B;  1ICW A;  1A8V A;  4RKL A;  4AIM A;  3X3M A;  4OON A;  2KOL A;  3DWQ A;  2E2J H;  3GP7 A;  1CSQ A;  3GO5 A;  2NTS A;  4JI6 L;  1H9S A;  1SN8 A;  1TWA B;  3PO2 B;  2E5L Q;  4A3K B;  3GTQ H;  2SDF A;  3S15 B;  2R93 H;  1V1P A;  4IPC A;  1VQN A;  1VQD A;  3EVQ A;  3OMG A;  3M85 A;  2R92 H;  3W2D A;  3K0X A;  3TZU A;  3T51 B;  1D7Q A;  2A74 C;  4JI4 L;  4DF7 A;  1PH2 A;  2EY6 A;  4WRD A;  1K8O A;  1N32 L;  4X6A H;  4BBR H;  2XSC A;  4B3R Q;  4DV6 Q;  5GAE C;  1JE5 A;  3H94 A;  1WTV A;  3FRP B;  4IN3 A;  1EWC A;  2NBF A;  2BH8 A;  3PF5 A;  3RZD B;  1N32 Q;  2YU9 H;  3FHW A;  1GUS A;  1R9T H;  1QZH A;  3F2C A;  2UUC L;  4YCV A;  1VS0 A;  1EY4 A;  4A3B H;  2L5T A;  1UEB A;  1C9O A;  2LSS A;  3A5Z B;  5FLX E;  2R92 G;  4HMI A;  1LTG D; 
#chains in the Genus database with same CATH homology
 1KIX A;  3TRZ A;  2KHJ A;  5IYC G;  5C0X I;  4DV1 Q;  4AYB G;  3H0G H;  2PMZ E;  2QA4 A;  2EXD A;  5JEA G;  3GTJ H;  5M3F G;  4APV A;  2ZJP A;  3T1Y L;  1YIT A;  1K73 C;  3KYH C;  1I94 Q;  3KFU A;  2IT1 A;  2VY3 A;  1Y1W H;  3RNU A;  3PUY A;  2BA1 A;  3I4M H;  4KHP L;  2R93 G;  2RF4 A;  2JQO A;  1NY4 A;  4AQY L;  1N36 Q;  5C4X G;  4KHZ A;  3J81 i;  4BBR G;  2XTI A;  5IE8 A;  4FDB A;  5FJ8 G;  3CPW A;  4A3J G;  1YZ6 A;  1IBK L;  1QVF A;  1N8R C;  3HOU H;  2K14 A;  3PUX A;  4X64 L;  2R7Z H;  4GKJ Q;  1EFW A;  3HOV H;  2Z6K C;  4L5T A;  3PUV A;  4GN3 B;  4LUO A;  5M5W H;  5C0X J;  1HNX L;  4A3C H;  4LF8 L;  2AKW B;  5K36 G;  4JI0 L;  1SLJ A;  2MO0 A;  4JI8 L;  2R7F A;  2BH2 A;  4A3E H;  4P71 A;  2PQA B;  4P73 A;  1HZB A;  1B8A A;  1VQE A;  3DLL A;  4DR1 L;  5HGQ A;  4P72 A;  4B3M L;  4L5R C;  3RLO A;  3PIO A;  1N33 Q;  2YTY A;  1VQH A;  3PUZ A;  3HOY G;  1T9H A;  5DLQ E;  4IO9 A;  3CCR A;  3S16 H;  4NPS A;  1VQ4 A;  3CC4 A;  4GKK L;  4GOP A;  3I4N H;  2AHO B;  1JMC A;  1HZC A;  1X65 A;  4QY7 A;  4JI5 L;  3S17 H;  4DR5 Q;  3CCL A;  4LF5 L;  1LUZ A;  1E22 A;  1IYJ B;  2XGT A;  2Z6K A;  1QUQ A;  4PZ6 A;  4POF A;  1U0L A;  4YHH Q;  3GTO H;  1X54 A;  3HOV G;  3CCV A;  1NBW A;  1VQO A;  1DGS A;  1N34 L;  4O2D A;  1PH9 A;  5LMN W;  4R4Q A;  3KJP A;  3WWV A;  2JA5 H;  4LW1 A;  4A4I A;  4JI1 L;  3I7F A;  1U5K A;  4DUY Q;  3HOU G;  4LF6 Q;  4DV1 L;  3FKI G;  3RLN A;  5IYB H;  4A3K H;  1PH7 A;  1EYG A;  1YEZ A;  1IBL L;  4A76 A;  2DGY A;  2E5L L;  1GKH A;  1VQM A;  3CME A;  1XMQ Q;  3GTL H;  4JV5 L;  5GAH C;  4DV6 L;  1SFO H;  3I4M G;  4LUV A;  2JEB I;  1CKN A;  2JEA I;  1YHB A;  3HKS A;  2LXJ A;  1YHA A;  4R4T A;  4GN5 A;  4AQY Q;  1XMO Q;  1CUK A;  3TRE A;  4LUZ A;  5M3F H;  1WOC A;  3A0J A;  4DPG A;  3H0G G;  1SRU A;  2OCE A;  5E7N A;  3S14 H;  2H5X A;  2ZM6 L;  5FLM G;  3GTG H;  3CF5 A;  3UDX A;  4GNX A;  5JJK A;  2VQE Q;  2I5H A;  4GLX A;  1YJW A;  3UE1 A;  4POG A;  4DV0 L;  4QJF A;  4PZ7 A;  1PA6 A;  2E2I H;  4LFB L;  1WFQ A;  1Q81 C;  4DV3 L;  2K52 A;  4DV7 L;  1O7I A;  4XIG S;  4B3S L;  2ZTC A;  4EQ5 A;  4PMW A;  4R4C A;  1BBU A;  1L1O B;  1WCM H;  4KI0 A;  4IFD I;  1FVI A;  1HNZ L;  1VQG A;  2MO1 A;  3KF8 B;  3STB C;  3I56 A;  3J81 j;  1N33 L;  3HOZ H;  1JB7 A;  1GO3 E;  1WJJ A;  1MJC A;  1QVG A;  4DV2 Q;  3T1H L;  4DV5 L;  3S15 H;  2ZM6 Q;  1VQB A;  1HJP A;  3JC6 6;  1XMO L;  4TQU S;  1PH4 A;  1L2F A;  1HR0 Q;  4JBM A;  2QGQ A;  4JI2 L;  1NTG A;  1LYL A;  2KHI A;  5ELN A;  3CC7 A;  2Q2H A;  4K0K L;  1X3E A;  1OXX K;  4DV7 Q;  4OO1 I;  4QGU A;  4OXP A;  5FLM H;  2UXC L;  1VQ5 A;  1A63 A;  2CKZ B;  3TQY A;  4DKA C;  5C44 H;  3CCM A;  2V1C C;  2IX0 A;  4HJA A;  4JI4 Q;  3HKZ G;  4JI1 Q;  2GN5 A;  3OTO Q;  2PQA A;  1L1O C;  5C4J H;  3CCJ A;  3HFZ B;  4DV5 Q;  2UU9 L;  1A62 A;  4DAY B;  3G71 A;  3PIP A;  1NMF A;  3CCU A;  1LM0 A;  2D62 A;  3D0F A;  3I55 A;  4JYA L;  2WAQ E;  2ZTE A;  4BA2 I;  4IJH A;  3J7Z C;  4DR6 Q;  1YI2 A;  1KD1 C;  4B3R L;  1XTD A;  5ELO A;  3S1R H;  1KHI A;  4A3L G;  1SMX A;  2JA5 G;  4RG1 A;  4DR5 L;  4A3E G;  1A0I A;  2EQS A;  1MIU A;  4UP8 A;  3ULJ A;  3ULL A;  2ZJQ A;  4JI7 Q;  1J6Q A;  3W5O A;  5IWA L;  4IOC A;  2CWP A;  3AYH B;  1IXR A;  3OW2 A;  2IX1 A;  2JE6 I;  2VUM H;  1VQ6 A;  3U58 A;  3J80 i;  3BJU A;  2IY5 B;  1Z47 A;  2Y0S G;  2A1A A;  1PH5 A;  1VQL A;  1D8L A;  1TWF H;  2Q2T A;  1FL0 A;  4R1J A;  5C3E H;  3BZC A;  3PCO B;  3TS2 A;  2N49 A;  2OQ0 A;  2OTJ A;  3A74 A;  1TWH H;  1G6P A;  1SRO A;  2ID0 A;  3IRB A;  3BZK A;  4LF6 L;  4GLA C;  2IHF A;  2I5M X;  4IPD A;  1Q86 C;  2JA8 H;  2JJQ A;  4YWM A;  5JJL A;  3PO2 G;  4C3J H;  5C44 G;  2GVA A;  4LFB Q;  4IOA A;  5IYC H;  1CKN B;  2YYZ A;  2HHH Q;  1VQC A;  4DV0 Q;  1XPO A;  1XNQ Q;  1VQP A;  1K0R A;  3DM3 A;  4A3M H;  5C0X G;  1GM5 A;  4A75 A;  1C0A A;  4X62 L;  1X9N A;  4JBJ A;  3KLW A;  4WJ3 M;  5AJ3 L;  4BY7 G;  3W1B A;  3H15 A;  5IP9 G;  2K50 A;  1HNZ Q;  2AWN A;  1EQQ A;  2WP8 J;  3U4V A;  4NXN Q;  2UXC Q;  2NN6 G;  4A3J H;  3E9H A;  1NMG A;  2AWO A;  3F2D A;  1VQA A;  1KXL A;  1XPR A;  4YCW A;  3RZD H;  2CCZ A;  4JI6 Q;  2ALY B;  1L0W A;  2CFM A;  1EQR A;  1IBL Q;  4BXX H;  1L1O A;  1I6H H;  1VQF A;  5M3M H;  2K5V A;  1K8G A;  4JYA Q;  4X66 Q;  2UUC Q;  4DR7 Q;  1Q8K A;  1TWG H;  4QIW E;  3J81 c;  1XNR Q;  4DR2 L;  2VZA A;  1HNW L;  3EIV A;  1EIY B;  1I3Q H;  3GDE A;  4L5Q A;  1S40 A;  2I0Q A;  1KRT A;  1HZ9 A;  1PV4 A;  5JJI A;  1G51 A;  1YIJ A;  2JA6 H;  4A3B G;  2KCT A;  4R4O A;  4YWL A;  3VDY A;  3KOJ A;  1E3P A;  1M1K C;  2UUB L;  4B3S Q;  4JI5 Q;  4BA1 I;  1FJG L;  1EOV A;  1E24 A;  3NEN A;  3CMA A;  3ERS X;  1QZG A;  1V9P A;  3M3Y H;  3UDF A;  2PNH A;  2Q2I A;  1Q1E A;  2C35 B;  1KAW A;  3AFQ A;  2N3S A;  3STB D;  2Q2U A;  1PYB A;  1UE6 A;  1Y1V G;  3K80 C;  3M9B A;  1XPU A;  2JA7 G;  3HOW G;  2BA0 A;  3CPF A;  5LMU Q;  4A3I H;  2A19 A;  4DV4 L;  5IYB G;  4IFD J;  2F4V Q;  2UUA Q;  3MEF A;  4GOP C;  2JA6 G;  2PI2 A;  4LF9 Q;  3L2P A;  1JJC B;  5IYD G;  4HJ5 A;  3UDG A;  3PO3 G;  4A3D G;  3FP9 A;  4ALP A;  1BKB A;  4PZ8 A;  3K7U C;  1W2B A;  4DR4 L;  4A3F G;  1EWI A;  4L5S A;  5GAD C;  4QQB X;  4GNX C;  1KC8 C;  4XTC S;  3S1N H;  5IYD H;  2ZTD A;  2B63 H;  2VQF Q;  4DR4 Q;  1W3S A;  2VQE L;  1PH1 A;  2CQO A;  1VQ7 A;  3CAM A;  2RHQ B;  1TXY A;  3HOZ G;  1H95 A;  4JG2 A;  5AJ3 Q;  2F4V L;  4B3T Q;  2K5N A;  3SGI A;  1B70 B;  1RIP A;  5IY0 A;  1PH6 A;  2UU9 Q;  2HHH L;  3CD6 A;  3KDF A;  2R6G A;  2N8N A;  3PGZ A;  2KEN A;  4JBW A;  3PUW A;  5IP7 G;  4JC0 A;  4MZ9 A;  1CKM A;  4A3M G;  4JOI A;  1WYD A;  1MJE A;  1PHJ A;  2UXD Q;  2NVQ H;  3RN5 A;  3D31 A;  1X3G A;  5LMN Q;  4C3H H;  1V43 A;  2AMC B;  3G48 A;  2QEX A;  2JA8 G;  3L7Z C;  1E1T A;  2PI2 E;  2Z0S A;  4P75 A;  4DAM A;  4EX5 A;  3CP0 A;  3H3V H;  4RMF A;  1VQJ A;  4NXM Q;  1KQS A;  2NN6 I;  3GTM H;  1XNQ L;  4YY3 L;  4KHP Q;  1N9W A;  2Y0S E;  5FJ8 H;  1E7Z A;  3U50 C;  3G6E A;  1WI5 A;  4DK3 C;  2E8G A;  5IP9 H;  1VQI A;  5FLX c;  1IZ6 A;  2VUM G;  4AYB E;  1GVP A;  3RN2 A;  4NXN L;  4A3G H;  1HNX Q;  1CSP A;  3M7N A;  1S72 A;  2R7D A;  4X64 Q;  4UP7 A;  2F3I A;  3PV0 A;  4C3I H;  3AQQ A;  4IFD G;  4HIO A;  4GKJ L;  2ES2 A;  1P8L A;  3KF6 A;  1IBM L;  4LWC A;  3CCS A;  3PSI A;  3JAM i;  2JA9 A;  2NVY H;  4JCV E;  4X66 L;  4DR1 Q;  1Y14 B;  4OWW B;  4NXM L;  3E9I A;  3ZJY C;  1VQ9 A;  1IBM Q;  1JT8 A;  3OTO L;  1PFS A;  4JI7 L;  5IP7 H;  5H1S E;  1PH8 A;  3RLF A;  4J15 A;  3I4N G;  1KL9 A;  3CCE A;  4DUZ L;  3H3V I;  1SE8 A;  3HKZ E;  1PVO A;  4AH6 A;  4DR6 L;  3K81 C;  1X3F A;  3TS0 A;  1M90 C;  1UE7 A;  1UE5 A;  2VL6 A;  4JI3 L;  1YHQ A;  1EUJ A;  3NBH B;  5HY6 A;  4HJ7 A;  4BY1 H;  1UWV A;  1OXU A;  1HH2 P;  3OYY A;  2HQL A;  3S24 A;  3CW2 C;  3M4O H;  3HOW H;  4A3F H;  1K3R A;  2GVB A;  5LMU L;  4DV4 Q;  1V1Q A;  4GN4 B;  3EBE A;  5IWA Q;  2NVX H;  3J7A 5;  4A3D H;  5J3B A;  1J5E Q;  3L0O A;  2HT1 A;  2N78 A;  4NB3 A;  2WFW A;  4TVA B;  5JEA J;  3W1G A;  1YJN A;  1I5F A;  2E2H H;  5LMN L;  1I50 H;  2YV5 A;  3S2D H;  1OXT A;  2K4K A;  4A3I G;  3RZO H;  2UXB Q;  2JA7 H;  3PF4 A;  1YBY A;  2MNA A;  4DUZ Q;  2UUB Q;  1FJG Q;  1HZA A;  4OX9 Q;  4BY1 G;  3GTK H;  3CC2 A;  4MNO A;  2YTV A;  3EN2 A;  4JI2 Q;  2K5H A;  1Q46 A;  1HR0 L;  1Y1V H;  4HJ9 A;  1VQK A;  4HID A;  2UUA L;  4OO1 G;  1E1O A;  2NZO A;  4DNI A;  3MXN B;  2RHS B;  3KJO A;  1OXS C;  4O0A A;  1MKH A;  4JOI C;  1BVS A;  4JI8 Q;  1AE2 A;  5EAY A;  2WAQ G;  3U4Z A;  1Z9F A;  1K83 H;  4YCU A;  4HJ8 A;  4LF7 Q;  3K8A A;  2UXB L;  3TEH B;  2RCN A;  1Q1B A;  4GLV B;  1NE3 A;  3GTP H;  5M3M G;  3M4Q A;  2B29 A;  2ZJR A;  2NZH A;  1VQ8 A;  3CXC A;  4ME3 A;  5M5Y H;  2LXK A;  1AE3 A;  1NJI C;  1Q12 A;  1Q82 C;  1G29 1;  3A5U A;  4A3G G;  4IJL A;  4LFA L;  1S3O A;  2D0O A;  1XJV A;  3S1M H;  3AEV A;  4BXX G;  1XNR L;  1HNW Q;  4PG3 A;  1JJG A;  1OTC A;  2KCM A;  1YVC A;  3NEM A;  1QVC A;  4KLK A;  4OWT B;  4JI3 Q;  4C2M H;  4A93 H;  1Q7Y C;  3E0E A;  4LF8 Q;  4LFC Q;  3HOX G;  3CCQ A;  4MTN A;  3ICE A;  2MQH A;  1XMQ L;  4BBS G;  4JV5 Q;  4K0K Q;  2VNU D;  2A8V A;  1X6O A;  4LF4 L;  1EIF A;  4LNQ A;  1K9M C;  1J5E L;  4X65 L;  4YWK A;  2WB1 G;  3KF6 B;  2OWO A;  3G4S A;  2L15 A;  2OTL A;  4X62 Q;  1N36 L;  1X55 A;  1TWA H;  4YY3 Q;  3PO2 H;  4B3M Q;  1FGU A;  1OXV A;  2CWA A;  4OWX B;  5GQO A;  1PYS B;  3KDF B;  3FKI H;  5GAG C;  4Y7N H;  4HIK A;  4A3K G;  4WJ4 A;  1I94 L;  1ASZ A;  1CKO A;  2VW9 A;  4UPA A;  4LF5 Q;  5C3E G;  1UE1 A;  4OX9 L;  3JAM c;  1LTL A;  2MFI A;  1A8V A;  1AH9 A;  4AIM A;  4A3L H;  3ULP A;  1BBW A;  4OON A;  5GRO A;  4IPG A;  2B63 G;  3ER0 A;  4UY8 C;  3UE0 A;  1N34 Q;  3F8T A;  3GD7 A;  2DUD A;  2VS1 A;  4HIM A;  4B3T L;  4IPH A;  2E2J H;  1KRS A;  1CSQ A;  4GOP B;  4R4I A;  5C4X H;  3GO5 A;  3T1Y Q;  3B6Y A;  2IHE A;  1SN8 A;  4JI0 Q;  4JI6 L;  2E5L Q;  2ASB A;  3GTQ H;  2R93 H;  3RR5 A;  3M4P A;  2ATW A;  3K7A H;  4IPC A;  4QL5 A;  3HOY H;  3CQZ H;  1VQN A;  1GD7 A;  3AFP A;  4H02 A;  1C7Y A;  1HR0 W;  2UXD L;  2B3G A;  1VQD A;  1IBK Q;  1QUQ B;  1SR3 A;  1IL2 A;  1RL2 A;  2OQK A;  4GKK Q;  3M85 A;  2FXQ A;  4UP9 A;  3LGJ A;  2NVT H;  2R92 H;  2YTX A;  4DR3 L;  4Y52 H;  2D0P A;  3S1Q H;  3K0X A;  4LF9 L;  1D7Q A;  3F2B A;  4A3C G;  4BBS H;  2HIX A;  4DR7 L;  4JI4 L;  3HOX H;  5M5X H;  1PH2 A;  2R7Z G;  4A93 G;  2K75 A;  4YHH L;  1P16 A;  3J80 c;  1N32 L;  4X6A H;  2VQF L;  4BBR H;  4B3R Q;  4DK6 C;  4DV6 Q;  5GAE C;  1JE5 A;  3PO3 H;  1JJ2 A;  4DV3 Q;  3NEL A;  1VCI A;  4LF7 L;  1K8A C;  1Y1W G;  1WCM G;  1N32 Q;  3F1Z A;  1TWC H;  2BH8 A;  5BR8 Q;  2JK8 A;  4DUY L;  1X56 A;  3PF5 A;  1B7Y B;  1YJ9 A;  2F52 A;  2EIF A;  3Q8D A;  2YU9 H;  3FHW A;  3BU2 A;  3I4O A;  1R9T H;  3UDI A;  4DV2 L;  2KBN A;  3T1H Q;  4DR2 Q;  4LFA Q;  1YNX A;  2HIV A;  3F2C A;  4DR3 Q;  5IT9 c;  4X65 Q;  4GNX B;  1QZH A;  1PH3 A;  4JBK A;  2I5L X;  5BR8 L;  2UUC L;  4LF4 Q;  4BY7 H;  4YCV A;  1VS0 A;  4A3B H;  4GS3 A;  1ASY A;  1UEB A;  1C9O A;  2LSS A;  4P74 A;  3A5Z B;  3S2H H;  2WB1 E;  2R92 G;  4LFC L;  3I2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...