4ZLTF

Crystal structure of viral chemokine binding protein r17 in complex with ccl3
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
TPTACCFSYSRKIPRQFIVAYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors.
pubmed doi rcsb
source organism Cricetid herpesvirus 2
molecule tags Chemokine binding protein/chemokine
total genus 14
structure length 62
sequence length 62
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zltF00
1MSGA 1B3AA 2KOLA 1CA6A 1X32A 1AP0A 1O80A 1WTQA 4MN3A 2FFKB 1QG7A 2MJ8A 1U4PA 1LV9A 1PDQA 2B2YC 5D65A 1BF4A 4R8IA 3MWYW 2K01A 5CORA 2B2UA 2KEDA 3GV3A 2HDMA 4ZLTF 1WD1A 1G2SA 2B2TA 3TN2A 4HEDA 4LMQD 1DONA 2L11A 3TZDA 5DNFA 2X69A 2DY8A 5CBEE 2EE1A 1J8IA 1MSHA 1X3QA 1XYIA 4XDXA 1VMPA 2HCIA 2HCCA 2JP1A 3LWEA 3I91A 4IURA 4MHEA 2B2TC 2HDLA 3FDTA 1G6ZA 2MGSA 3KUPA 1SAPA 1WTXA 1HUMA 2DY7A 2RSOA 2J7ZA 2FHTA 1B4OA 3I8ZA 4CJ0B 4HAEA 2L12A 4IUQA 2K04A 3FPUB 2KECA 2VXWA 2K28A 1DOMA 4NW2A 1WTRA 5T1GA 4IUTA 1HRJA 5AFWA 1F2LA 2MP1A 4ZK9B 1ILQA 2B2VC 2K03A 1PFNA 2Q8RE 1WTWA 5T1IA 4O42A 5JJZA 1BO0A 4UAIA 1G2TA 1IKMA 1KNEA 2L9HA 4RAUC 4HCSA 1ESRA 1B53A 5COYA 1JICA 5E4WC 3I3CA 3N52A 1Q3LA 2L4NA 3GV6A 3QO2A 1GUWA 1U4LA 1EIHA 3P7JA 3IL8A 1DOLA 3H91A 1TVXA 2N55A 2X6GA 1SSOA 1M8AA 2K1BA 3ONAB 1KNAA 4RWSC 4XT1B 4X3TA 1U4MA 1RHPA 2B2VA 1PLFA 1NR2A 1RODA 2JYOA 2RA4A 1IL8A 4R9WA 4X3SA 1X3PA 3SVMA 1BBXC 3IFDA 5CMDA 1F9SA 1CM9A 1NAPA 1WTPA 1A15A 2FJ2A 1WD0A 3KBXA 2KUMA 4XT3B 2FMMA 2EOTA 1CA5A 1HHVA 3D6WA 3Q6SA 2L1BA 1NR4A 3MTSA 1J9OA 1EIGA 3HP3A 1PFBA 5E4XA 1F9QA 4ZKCB 1AZQA 2R3ZA 1MGSA 1RTNA 4QUCA 1F9RA 5EPJA 1JE4A 3DEPA 2CVRA 1EQTA 1VMCA 2MPMA 1ICWA 4X3KA 1ILPA 2Q8TA 1B50A 3F2UA 5EJWA 2H1EA 2SDFA 2X6LA 1HFGA 2B2WA 3DM1A 1HA6A 2RVLA 4X3UA 4CJ2C 1O7YA 2KEEA 1C8CA 2D9UA 2KVMA 4RA8A 1AZPA 4CJ1B 1RTOA 5D14A 3R93A 2BDNA 4OIKA 2FINB 1WTVA 1DOKA 2B2WC 1BNZA 1XX8A 2M2LA 5EQ0A 4ZAIA 5EPLA 3UI2A 4U68A 1G91A 1MI2A 2RSNA 4ZKBB 2IL8A 1EL0A 1QE6A 1RJTA 2NZ1D 4IUVA 1WTOA 2XIWA 2EPBA 1ZXTA 4IUPA 1EOTA 1NCVA 1PFMA 1O7ZA 1S4ZA 5EPKA 1WVLA 3I90A 1QNKA 2N88A 2NWGA 4IUUA 2B2UC 1DZ1A 4OIJA 5EKIA 1ML0D 4QUFA 1F9PA 5CBAE 2NYZD 4HSVA 1IKLA 2K05A 3G7LA 1U4RA 2B2YA 4DN4M 3DEOA 1B2TA 2HUGA 1HUNA 1SDFA 1E0BA 1HFNA
chains in the Genus database with same CATH superfamily
3BS1A 1UNSA 4C56C 1O80A 4X65L 1LV9A 2D0PA 3J80c 2B2UA 2EDGA 2NVTB 3GP7A 2Z8LA 3RZDH 1XNQQ 1EY7A 2RQXA 5CV9A 2Z4HA 3BDLA 1HZ9A 4UY8C 1C4QA 1QB5D 1H9SA 4DV6Q 4DKAC 2UUCL 1Q1EA 1BBUA 2HCCA 3HOYG 2B29A 5CV4A 1L0XB 5EGTA 2CKZB 3FDTA 2PQAA 1A3UA 1UWVA 4H0LC 3E0EA 3EQLC 1PRTC 1EQVA 3AU7A 3KDFA 5K5PA 2K28A 1BBWA 1K3RA 5G3LF 1D1IA 1WFQA 1S5CD 4PG3A 1E2WA 1B53A 2EXZA 1RD9D 1SNDA 3D4RA 5C0XJ 4Y7NH 3I7FA 2A6HD 5IODA 4DPGA 3H3VH 4BXXG 4A93G 3NPPA 2KA7A 2K1BA 1GKHA 2VB3X 1IL8A 3F2DA 3CKIB 3U50C 3GTQH 3K80C 3J7A5 3FKIB 4LW1A 1F9SA 2AMCB 4DA2A 1JOQA 1HQRD 1H9SB 2F4VQ 2R93G 4N9TA 3FP9A 2RHSB 5BN5A 1GOZA 2PQAB 5FO9B 3IFTA 1XNQL 4C1NK 1IW7D 3GTMB 2CW0D 4QY7A 1F9RA 3KLRA 2ATWA 1EY0A 4DV6L 2CVRA 3KDFB 1A6XA 1YJNA 5EJWA 1J6QA 1X3FA 5BR8Q 1EY9A 1IBMQ 4LUOA 2RDFA 4R1JA 1D8LA 3I72A 3J81c 2E2JB 1HA5A 4BS9A 1XX8A 1WI5A 2F52A 1PRTB 3BJUA 1EQRA 1KAAA 4MTKA 5M5XB 1N34Q 1N32Q 1EY6A 1EL0A 5JJLA 1SMYD 2BA1A 4K5VA 4POFA 3A8KE 3NELA 1NCVA 1LTTD 4L5QA 5EBCA 2PNRC 4JI3Q 4ZRZA 4LF5L 1GUNA 4KTAA 4QB4A 3LNNA 1YITA 1DZ1A 3T53B 2IX1A 1I4GA 1W6JA 2HHHQ 1B2TA 1GUTA 2PQEA 5GAEC 3S1QB 3A56A 3T16A 3K81C 3R3OA 3HKZG 3MC0B 5HY6A 1F2ZA 1K8OA 2F4VL 3MHBA 3GV3A 1ET6A 1Z47A 2A74C 4OO1I 2NVXB 2G9HD 4ABNA 5CR3A 3VR5A 5KYLA 3KF8A 2ZJPA 2E75C 2JP1A 3GTOH 1X6OA 4QF4A 5BR8L 4DR2Q 3HOXB 2CH4W 1KHIA 3D8GA 1IBML 2QW7A 4IUQA 2KCCA 4E6IA 2V1CC 1Y8PB 1WTRA 3D3RA 5I6WA 2F4IA 1YJWA 4LFAQ 2XNAC 3NBHA 1N34L 2I5LX 1D5XC 5JEAH 4HJAA 2P5ZX 1ESRA 4JOIA 1YHQA 1PA6A 5IYDG 3BG3A 3OMGA 3PIO3 4QL5A 4JI3L 4PNYA 4DR3Q 3LX0A 1GD7A 3ERSX 2EJFC 4A3EG 2JE6I 2HHHL 2EYMA 2IT1A 3M4OH 1GO3E 4RCNA 1ASZA 2DJGC 2EZVA 3BZKA 3ULLA 1BBXC 1PTOD 4IFDI 3JAMi 1LACA 3CPFA 1DM0B 4XT3B 3I4NB 4A3JH 3E0JA 1CA5A 2EYPA 1PH7A 2VL6A 1DXMA 2LKVA 4O2DA 4X3KA 2YYZA 5LL6X 1VQCA 3AYHB 3CC2A 3SDZA 3H09A 3NBHB 1PH1A 1Y14B 5E7NA 1ASYA 5NUCA 4C3IG 4PZ6A 1SYBA 3J7YW 3WWVA 1TWFH 4MNOA 4A3GG 4BWGB 4LFAL 4IPGA 3DM3A 4ZAIA 1Z9FA 4HJ9A 5KNBA 3J80i 1JJGA 4JG2A 3R2IA 3K5NA 1PFMA 2K5QA 3S2DH 2ZXPA 4DR3L 3HOYH 4TQUS 3M3YB 2MUYA 4XIGS 4IPDA 1SDFA 3HS0C 3GTPH 3HOUH 1I5FA 1NR2A 4JV5Q 1HZAA 1CSQA 4LFCQ 1GM5A 1VQ7A 2PPBC 1U5KA 2NUCA 1K0RA 1PDQA 3CC4A 4P74A 1O78A 2WP8J 3PIP3 1FNUA 4C1NI 3TN2A 3U9OA 2JA7G 1B9NA 2L11A 3D6CA 5DM63 5M3MG 3E9HA 4R4CA 1XYIA 3BU2A 1KIXA 1SXTA 2HCIA 4MHEA 4DK6C 4BXXH 5GQOA 4A93H 3CF5A 1SNCA 5ELEA 5GROA 1SNOA 3HOVG 3PV0A 1LO5D 2KECA 1DOMA 5F2DA 1PZID 3S14B 2KBNA 2F0MA 4QQBX 2R93H 3S16B 3H0GB 1IKMA 2MNAA 2GVBA 4RGTA 3AFQA 2EXDA 3I3CA 1Y8OB 2A6EC 3GQBA 1GHJA 1TT2A 2WIIB 4GN5A 5EBDA 1FL0A 4DV1Q 4XT1B 1TKWB 3MEHA 2VUMG 4JV5L 4R9WA 4YWMA 2RA4A 5KNDA 1S3OA 2JK8A 4YHHQ 4A3DG 2F0FA 4LFCL 4AH6A 1LT6D 2JEBI 1CM9A 2F0VA 1EZ6A 2Q8IB 2ICIA 1HHVA 1I6HH 1P16A 5M5YB 4UP7A 1EFWA 4JYAQ 2DNCA 2R7ZG 1FYCA 1XMQQ 1ICWA 2F3WA 1T9HA 3W2DA 1CQFA 2X6LA 5FJ8G 2B2WA 3S1RB 3EA6A 2QKIC 1Y1VB 2JA5G 2WFWA 1C8CA 1PTOH 3ULPA 2LSSA 4YCWA 3HFZB 2UUAQ 1FNVA 3NUCA 3GTKH 1H9JA 1G91A 1FD7D 4DK3C 4HSPA 2KHSA 2ZJRA 2EPBA 2IJ0A 4FF2A 1EOTA 3I90A 1ML0D 5JJKA 4DV1L 4DV7L 1FGBD 2CWPA 1Q1BA 4YHHL 1AP0A 4C3JB 3DLLA 2Z6KA 1QG7A 2OT2A 3KFUA 4C3HB 3VR2A 2Y0SB 4RMFA 2O5JC 3TREA 2DN8A 4JYAL 5IYDH 3M7GA 1XMQL 3CCUA 4K14A 1A3VA 3MFYA 4PZ8A 2H4OA 4CKBA 4JI1Q 3T56B 3HOZG 4A3EH 3EN2A 1T5XD 4GNXA 3UDGA 1ZYRC 1LM0A 5C3EB 3LGJA 4APVA 1IYJB 5ELBA 5ELFA 3CCJA 2UUAL 1OXSC 4YWKA 2E2IH 4WJ4A 5FLXL 4P71A 1SYDA 4K8IA 1PH8A 3S1MH 2JA6G 1IBLQ 1KAWA 1GUWA 4J1MA 3IL8A 5K36G 4AIMA 5IP9G 3W1GA 2Q2HA 1VQFA 3RLOA 1QILA 2UXDL 4JBWA 4DV3Q 5CMDA 1WTHA 4BBSG 4C3IH 1X65A 2FMMA 4S3SA 4A3GH 1RF2D 2YU9H 4IJLA 4TRDA 5D3IB 1JE4A 2LXKA 2DUDA 3C46A 2C9OA 1ILPA 3D4DA 2FXQA 2YTVA 2BDOA 4GN3B 3OYYA 4JI1L 2ZXOA 5H1SE 2KEEA 3NSWA 1TIID 4P75A 2EY1A 4XQNA 5KGUA 3B6YA 3GTQB 2JA7H 1JC7A 2A6ED 1V9PA 2ZTDA 1X9NA 5M3MH 1S40A 2JSOA 1YVCA 1IBLL 4OIJA 1E1OA 2Z6BA 1OXUA 2EY5A 3S2HH 1YI2A 1Q81C 4KY5A 1Q8IA 3KK7A 1E0BA 1IYUA 4HJ8A 3HOVH 4ULLA 5C3XA 4DV3L 4Q0FA 1U4PA 3HOWG 1BF4A 2A69C 1LTSD 1EIYB 4KJOA 4LFBQ 1LT3D 3VR3A 1LTID 4M8AA 2IPKD 2SOBA 4JI7Q 3TSSA 2F0KA 2O5IC 1NBWA 2HDLA 3PUXA 4PZ7A 2RSOA 4IALA 4BA1I 2VUMH 1F2MA 5CV8A 1S5ED 4CJ0B 3VR4A 4Q5VA 1D5ZC 3SR1A 1YNJC 4A3DH 2N49A 4BY1G 3L9AX 1AW7A 1HZBA 5AJ3Q 3C3LA 2BA0A 2Y0SE 4WORA 4FYDA 3PUZA 1JJCB 1G6PA 3IRBA 4G4KA 2WINB 4I7AA 1EIHA 5JPNC 2R7ZH 4KY6A 5M3FG 5FJ8H 4DAVA 4GOPC 4IFDJ 4HIMA 1PLFA 2ZJQA 1RIPA 4J15A 3U4VA 2JA5H 3GTOB 2R6GA 4WRDA 5M9OA 4G7ZC 4DXFA 1BDOA 1NAPA 2PCFB 4C2MH 2D2CC 5FLXE 1D7QA 4LFBL 4KHVA 3IAYA 5KYIA 1F9QA 4JI7L 2YTYA 4GOPA 3DEPA 1BUVT 3J81j 2WAQE 3FRPB 1I6VC 2SDFA 3HKSA 2NZOA 1PZKD 2C5CA 3NQTA 3VYUA 1HNWQ 2E2DC 4GKJQ 3W5OA 1FJGQ 1ZYRD 1TWCB 3H6MA 1AZPA 2HD3A 1ZEQX 3CCVA 3NP8A 1CHQD 5C44G 1W2BA 3M4OB 1E7ZA 5AJ3L 1VQ9A 3NTIA 1S5FD 2CFMA 4PMBA 4DNRB 1BCPF 1CT1D 4IJHA 2F0JA 4OGQC 1ICFB 4A3JB 1VQ4A 1YNXA 3I4LA 4JI4Q 4DU9A 4CKCA 1SE8A 1U4RA 2B2YA 1HR0W 1S72A 4OWTB 3T51B 3D6WA 5JAVA 3HOZH 1BQQT 5IYCG 1MJEA 2OTJA 2MJ8A 1MBYA 2XVSA 4GOPB 3ER0A 2NTTA 2K01A 2KEDA 1STBA 1WD1A 4KD4A 5JPMC 1N8RC 1H95A 3D0FA 3MAQA 3H3VI 2UXCQ 1EY4A 2LXJA 5KNCA 2R92G 2QEXA 1TWFB 3ZYYX 2ZTEA 2D62A 2PW7A 2JA6H 2TSSA 2WKDA 1R9TH 5A35A 5K36H 1BXTA 5D3DA 1HNWL 2NBFA 1I4RA 5IP9H 1FJGL 3PO3G 4GKJL 5C6AA 3S2DB 4A3FG 2K04A 3FPUB 3HOYB 3ND9A 4G7OC 4NW2A 4DR7Q 3PUWA 4DAMA 4NPSA 3HOUB 2N78A 2B63G 1STEA 1K28A 3K7UC 4BBSH 1A2UA 2MHVA 4O42A 4YIJA 3A55A 1YBYA 1VQNA 2Z1CA 3BDOA 4HCSA 5FLXc 3FEWX 5E4WC 1PH2A 1XPUA 4RKBA 2MQHA 4OO1G 3M4YA 2CCZA 4JI4L 2RCNA 1M8AA 3I4MB 1Q8KA 2VW9A 2GA4B 3PO2G 4BA2I 4X3SA 1PMRA 2QF7A 4OL7A 3S15H 1Q90A 5HURA 5FOBB 4WFN3 4A93B 1WTPA 1A15A 4DUYQ 5J22A 2UXCL 5DM73 2O4XA 4A3CG 2CH4A 4GN4B 5M5WH 5EPJA 2R93B 1VMCA 1B50A 2Q8TA 1YEZA 2A73B 4CJ2C 4JC0A 1YNJD 2IW3A 3KYHC 4A4IA 3P1HA 5LMNQ 4DNTB 1M1KC 4LWCA 4CJ1B 3CC7A 4TKOB 4DR7L 3HOWH 4CDFC 4ZYSA 3AB9A 1XTCD 4KHZA 1HPCA 1KRSA 1VQLA 1KC8C 1I4PA 1I6HB 4NKLA 1IKLA 2K05A 3G7LA 2WB1E 4OHJA 3CCSA 3CW2C 4IZ8A 5I4DA 1EFID 2SNSA 2ZTCA 4BY1H 3J7AV 1CFMA 4DUYL 4OONA 1EYCA 4F87A 3HKZB 4K6LA 4XTCS 3ULJA 5A2QL 1AE3A 3CRKC 1JB7A 3GTKB 1N9WA 2K5DA 2F0HA 1EUJA 3EBEA 3TP7A 5M3FH 1YHAA 1XTDA 1KDCA 1V1OA 5LMNL 4IN3A 3TEHB 1LTAD 1NE3A 4IUTA 3N6RA 1D6EC 5HGQA 3QIAA 5CV5A 4ME3A 2C35B 1PH9A 1WYDA 3CQZH 3N52A 4HIKA 1MKHA 3GV6A 4O1NA 1HNXQ 1DOLA 1UAPA 4YWLA 4B3SQ 4JOIC 4X3TA 1PZJD 1TU2B 4ILWA 5CBEE 4FF1A 3OPOA 3GD7A 3CD6A 2B8FA 5IGEA 2AWNA 1GJXA 1TS4A 1E1TA 1PTOF 4A3EB 3TS2A 3TP8A 5C44H 3OHXC 4GLAC 3Q6SA 1N32L 5LMUQ 1X56A 2ASBA 1JOOA 4RG1A 4XQQA 3C1EA 3HP3A 2ES2A 1S5BD 2EYJA 3G71A 4CKEA 1DD2A 1SYCA 3SE0A 1LABA 1QUQA 1VF5C 3AFPA 4B3TQ 1UE6A 3S1MB 2AQ3B 1V43A 4FDBA 5IYCH 1JJ2A 4FXKC 2JQOA 1O7LA 2OQ0A 5IGGA 1ENFA 3KF8B 1UEAB 2HT1A 2XN9C 2AWOA 2QDLA 5I6YA 1QE6A 3D31A 3HOXG 1XPOA 1PH3A 3BZDB 1SE2A 2EYLA 2R92H 3Q24A 1DGSA 3MXUA 3ND8A 3U58A 4POGA 2YU9B 5CBAE 1X55A 3A8JE 1PRTD 2HUGA 4B3SL 1I50H 4DR2L 3NWSA 3PO3H 3S1NB 5C0XG 3S17H 2CHBD 4A3FH 5GADC 3I56A 2UXBQ 4DV2Q 4H13C 1CTMA 1S5DD 2CQOA 4LAAA 4ZLTF 2B63H 3GTGH 2B2TA 3GO5A 5LMUL 3CRLC 2XWJB 2X69A 2F03A 3GDEA 2L5TA 2R61A 1IXRA 4Z9CB 5IIFA 4OO1H 4BY7G 4K0KQ 1SAPA 4L63B 3I4NG 5M3MB 4B3TL 2ALYB 1VQEA 4NXMQ 3PO2H 2E74C 4X64Q 2I46A 1LT4D 4CBVA 3M4QA 2E2HH 1KLGD 2Q8RE 2F0TA 1V8QA 5A2QE 3HOVB 1KDAA 1HXYD 3P20A 4A3BB 3HKZE 4A3CH 2IX0A 4N8X1 1FVIA 3CPWA 2KJXA 2L4NA 1EOVA 1U4LA 4LJZC 1IHZA 2K7VA 1TVXA 1Y1WG 2N55A 2NVQH 1A3TA 1IL2A 1RODA 3TQYA 3PF5A 1F2YA 4OEMB 1CKMA 4FNFA 2WV6D 2UXBL 3NWTA 4DV2L 4L6TB 2K32A 2VB2X 3RLNA 5JVH3 1AH9A 4HIDA 2GVAA 1STHA 4DV4Q 2TMPA 3PGZA 2Q2UA 2NN6G 3K0YA 1N33Q 3D4WA 5IWAQ 3GTJB 3TBIB 4NP5A 5IGDA 3R2TA 4ZCKA 1HJPA 4LF6Q 4K0KL 1TXYA 1SROA 3U4ZA 2EJGC 4NXML 4X64L 4DV0Q 4OIKA 4LF8Q 2B2WC 4FF4A 3A74A 2G9DA 2ZM6Q 3KF6A 4U68A 1QJOA 2JA5B 1L2FA 2RSNA 3MXNA 5FK9C 2AHOB 1VQPA 4GLVB 2KCNA 5HGTA 5GAHC 3RR5A 4IUUA 4JW0A 1JWMD 2MFIA 4EX5A 4DNIA 1VQIA 2NYZD 2AQ1B 5LL6S 1SBBB 4KKUA 3DEOA 1I4HA 1II3A 1JR0D 4UDUC 4HTHA 2BCOA 2XGTA 4MN3A 5IT9L 1VQ5A 1JCKB 2EYOA 2K5NA 1FGUA 3G6EA 5CORA 4AQYQ 4KI0A 2OXPA 4XYOA 3L3OC 2A68C 4DV4L 1WCMG 3K0XA 3W1BA 1Y8NB 4R8NA 2Z6KC 1N33L 4GZYC 1CUKA 5IWAL 1VQKA 3I55A 4XDXA 4IURA 2J4XA 3Q23A 4K2LA 5TSSA 3R8BA 4KN4C 4B3RQ 3VYSA 4LF6L 3KF6B 4OWWB 2K6AA 1I3QB 4DR4Q 3MA2B 4LF9Q 3MXNB 3P75A 4FVMA 2JXMB 3HZXA 4XQJA 4DV0L 2EYHA 4LF8L 1HRJA 2I5HA 3JC66 4L5TA 4MZ9A 4ZK9B 1TY0A 2ZM6L 5DAUA 2OQKA 3TRZA 2NB0A 3CHBD 4A3KB 1Y1VG 4GNXC 4RAUC 1SYFA 2YV5A 2K33A 1TWHB 3H91A 2N3SA 3H3VC 1LTBD 4WJ3M 1XMOQ 1VQOA 2NVYH 4EQ5A 2JA6B 1R9TB 4AYBG 1Y69U 3BVGA 4ID6A 2YTXA 4AQYL 5FO8B 3MTSA 3HOXH 1UE5A 4ZKCB 1M90C 5I2YA 1QVCA 4C3JG 1LTGD 1E2VA 2WAQB 3RZDB 4B3RL 1HA6A 1FR3A 2NTSA 2BE5C 4X3UA 4ALPA 1CKOA 4DR4L 2D9UA 1QOHA 2F0DA 3EIVA 4LF9L 3R93A 5C0XH 1AN8A 2K75A 4P73A 2JA8G 1BNZA 1Q12A 1Q86C 3S15B 2IHEA 3F8TA 4FO2A 4JI0Q 1LTRD 4JBJA 1BOSA 4UPAA 5C4JH 4HN7A 3BVZA 1KQSA 3QOJA 4MTNA 4GNXB 1R4QB 1QZHA 1KXLA 4G57A 3AQQA 1V1PA 4DN4M 4BY7H 4U673 5M5WB 1QZGA 3I4NH 3CCRA 1JB3A 5JEAJ 1XMOL 1HFNA 1QWYA 4Y7NB 2K50A 1VS0A 1H9RA 2FFKB 2B3GA 1KLUD 4R8IA 2F0UA 4QCLA 4JI2Q 1BCPC 3KLWA 1M4VA 1TWAH 3HOWB 4CDDC 3FVQA 3I91A 3L2PA 1TQOA 1HUMA 1Y1WH 1QVGA 3CCMA 5IT9E 1SE4A 1SLJA 5JOBA 3SK4A 5ELNA 1K8AC 1HR0Q 5EKLA 2HQLA 1JMCA 2DGYA 3S9WA 4DF7A 1V1PB 4JVZA 3M3YH 2OWOA 4JI0L 2NN6H 4BY1B 5COYA 4KK7A 3QOLA 1XPRA 4LK1C 4F7XA 3PMFA 4HMIA 4OWXB 4KLKA 4KKSA 3TP5A 3TZUA 4KMUC 3KJOA 1RHPA 3K5MA 2JYOA 4DUZQ 3SVMA 1EWHA 1NUCA 5M3FB 2A68D 1WD0A 3KBXA 2F0IA 2DNEA 2E8GA 4V190 5IYBG 1GUGA 1R4PB 4RGNA 4JI2L 1K83H 2XSCA 4DK0A 3E6ZX 4QUCA 2A1AA 1SNQA 1EQTA 3UDFA 3BYYB 1B7YB 1BCPB 3KJPA 3E3XA 3Q0AA 3S14H 3CQZB 3S16H 1SEBD 5IOCA 2BDNA 4YCVA 2EVBA 1HR0L 3ICEA 5EQ0A 5EPLA 1UEBA 4ZKBB 5CV6A 5CYUA 4IUVA 1WCMH 4IUPA 1CZGA 5FLMG 3EFXD 4DGZA 1IW7C 5C44B 4IOAA 2LS01 3QWNA 4L5SA 1ENCA 2QA4A 2WB1B 1HQMC 4DUZL 4HMJA 2M9VA 1B3AA 3NHHA 4JI5Q 3V96A 2PMZE 3ITPA 2B2YC 4EQNA 2IY5B 1EEID 1VQBA 2BH2A 1A63A 4A3MG 1B1ZA 1X54A 2ZT9C 4ZUJA 1Y1VH 1MIUA 3K7AH 1PFSA 1KRTA 4HIOA 3OIQA 3A0JA 4MIUA 4ZUIA 1JORA 3BYTB 2BE5D 5LHY1 4A3IG 2R92B 1SJHD 2CQAA 4K8JA 2FHTA 4UP9A 3CCEA 4HAEA 1C9OA 4LUVA 2FMCA 4PV1C 1EU4A 1F2LA 3OW2A 3TP6A 1I50B 3VR6A 1CKNA 3PO3B 5T1IA 1G2TA 2K4KA 3S17B 1GUOA 4B3MQ 1DJRD 2K52A 3CMAA 1LYLA 1E2ZA 1Q3LA 2D0OA 2F3IA 3GTGB 4JBMA 4JPBW 4C3JH 3PIOA 5C3WA 4KV6A 4YY3Q 2F0OA 4K5WA 1B8AA 3CMEA 5JJIA 1XXGA 3SGIA 4G7HC 1NMGA 4PMCA 1NNXA 4QIWE 2QGQA 4PQXA 2A5HA 2JA8H 3GTPB 2OF1A 3PO2B 1SRUA 1NR4A 3X3MA 2K5HA 2E76C 5ISRA 3NEMA 3F2UA 4JI8Q 4P2CB 1CKNB 1YHBA 1TWGH 1O7YA 4BBRG 2EYFA 1B44D 4F8MA 2F0QA 4O0AA 2A69D 2FINB 5C4XG 2NVQB 1TS5A 1PTOC 1E3PA 1X3GA 3K5OA 2ICEC 1JT8A 2XWBB 3F2BA 4B3ML 1IYVA 2M00A 1B9MA 1V1QA 1HZCA 2N88A 5BN3A 1PHJA 3DWPA 1F9PA 3URYA 4HSVA 4XYQA 3V05A 4GS3A 3HOUG 4KJNA 1VQ8A 4LF4Q 5ELDA 4YY3L 3AMUA 1MSGA 1CA6A 3FPPA 4KY7A 1K0SA 2F0WA 2CWAA 3FMCA 4IFDG 3PCOB 3I4MG 4LF5Q 4DR6Q 3STBC 1X3QA 3PIPA 1YNNC 4M1UB 4JI8L 1UE7A 3HRZC 3SK8A 2KCTA 2K14A 1SFOH 4DAYA 4UHVA 2VQEQ 1I94Q 1JQYD 2L12A 4RH6A 2A19A 2IWHA 1WOCA 4A3LG 5G3LD 5T1GA 1EQQA 3VYRA 1VQAA 5DEHA 2I5MX 4H44C 4LUZA 3L7ZC 1BO0A 4FXGC 1KNEA 3K57A 5IYBH 1Z7TA 1PTOB 5C4HA 1JICA 2H5XA 3FKIG 4RGMA 2KQ3A 2EJMA 4LF4L 1BR9A 4NB3A 5J3BA 3NXWA 4K5XA 1P8LA 3K6OA 3OIPA 2FJ2A 3A7LA 2EOTA 2AKWB 4F88A 2JEAI 3A7AB 1EIGA 1PVOA 1PFBA 5E4XA 1KDBA 4DAYB 1AZQA 4DR6L 5FLMH 4GKKQ 2EY6A 1OTCA 4R4QA 2NZHA 3G6JB 1HFGA 3DM1A 1VQGA 3MZ5A 2VQEL 1I94L 2VNUD 1OXXK 3GTLH 1PH6A 3OWFA 1K3BC 3DUZA 2PZWA 3MXPA 1D2BA 3RN5A 2XRQD 3G48A 1FNWA 2NVYB 1GUSA 4A3MH 1RJTA 1VCIA 5KIXA 3M7NA 5E3FA 1JOKA 3EVQA 2EIFA 1BVSA 3DHQA 1K8MA 1EYAA 2HQEA 5I9OA 2E2IB 3K5LA 2O2LD 1CSPA 4DR1Q 5E1FA 4A3IH 2F0LA 3BVMA 2I0QA 1PRTF 4DV5Q 1KL9A 2EQSA 2B39A 3NENA 3S24A 1I4XA 3MXGA 1ENAA 3EJIA 1NMFA 3H15A 3T1YQ 2F3VA 4RCOA 3U9SA 2LMCB 3LWUA 4JI6Q 5LMNW 3WOFA 2SEBD 1VQMA 4C3IB 1TWCH 2PNHA 4GKKL 4A3GB 1CQVA 3KBGA 2B2TC 1HNXL 4KHPQ 1H9KA 5C4JB 1VQDA 2ID0A 1RCVD 1SNPA 4QJFA 2QILA 4NXNQ 1D5MC 3PF4A 4FXDA 4BY7B 5AFWA 2OCEA 1W3SA 3ZJYC 2Z0SA 5JJZA 3IKJA 4K6DA 2IX3A 5C4ZA 1QNUA 1A2TA 4DK1A 1TR5A 1QUQB 2RCFA 3CAMA 3F2CA 2R7FA 5JVG3 1BKBA 4HCEA 4CGYB 3C2PA 4R4TA 1SMXA 2XTIA 1TWAB 3ONAB 2JA7B 1KNAA 2GN5A 4DR1L 1WJJA 2KENA 3RLFA 1KTKA 1U4MA 3UI2A 4JBKA 1X3PA 3RZOH 4RHSA 2RDHA 4BBRH 4DV5L 5I9PA 3S2HB 2DJFC 1Y1WB 5C4XH 4LNQA 1CZWA 3KOJA 1LT5D 2QCPX 3SHLA 2L1BA 4HJ7A 3T1YL 1LTLA 3STBD 1J9OA 4OXPA 1YNND 1RTNA 4JI6L 1Z6HA 1Q82C 2MPMA 3CXCA 5CC4A 3X3NA 5FO7B 3E5SA 4KHPL 3HEJA 1NTGA 3SK5A 1PV4A 2V4DA 3TDQA 2RBMA 5ELCA 5KEEA 1EWCA 2NVTH 4QGUA 1YJ9A 4NXNL 1EWIA 3VYTA 1EEFD 1HTLD 2VUMB 1MI2A 4K2KA 1RL2A 4L5RC 4IFDH 1WTOA 2XIWA 1NJIC 3I4MH 1L0WA 2VY3A 3MVVA 3RN2A 4A3DB 3E9IA 1EY8A 3UDXA 1B70B 4QUFA 1PYWD 2K5VA 2BOSA 4B08A 1K83B 2BH8A 4IOCA 4OX9Q 1HCZA 3EROA 2B8GA 4A3BG 4DR5Q 3A8IE 1X32A 1Q7YC 2R7ZB 4JCVE 3RUZA 4V0BA 1A62A 4A3LH 2PO4A 2Z4IA 3V2TA 3NTHA 4KD3A 1G2SA 1HH2P 3TZDA 1J5EQ 5DNFA 5GAGC 2DY8A 4C2MB 2EE1A 2Z9HA 1MSHA 3M85A 1IBKQ 1GHKA 3TMEA 4J6HA 2LFNA 4J8QA 4DV7Q 3FKIH 1WCMB 2I07B 2PI2A 3UDIA 1RKNA 3Q22A 1B4OA 4RKLA 3H0GG 3PQIA 1QCBD 1EIFA 3BDCA 3GTMH 1E24A 1W6KA 4FF3A 2F0EA 3L0OA 3J81i 4UAIA 2RHQB 1GXDC 1U9RA 1STYA 4ODGA 5IGBA 4EQPA 1JWSD 2PW5A 1EZ8A 3QO2A 5IY0A 3P7JA 4YCUA 2KHJA 3OWEB 4CDCC 1Q46A 4NMZA 1NSNS 5C0XI 4RWSC 3K7AB 4QMGA 2E2JH 3WDNA 2F1MA 2HIXA 4DFAA 4OX9L 1EYDA 1DYQA 1OXTA 5M5XH 4H02A 4DR5L 4ME5A 3J7AF 3DXJC 1EYGA 1SNMA 3HOZB 1EU3A 4IUNA 3W3AA 4AYBB 1J5EL 1MGSA 1IBKL 4GLXA 5DLQE 3S1QH 1UUPA 4A76A 1PYBA 3JAML 1VQ6A 3PSIA 4KN7C 3CU7A 2UXDQ 4DXGA 3RNUA 3VA5A 4NDXA 1XJVA 5C5LA 2NVXH 4RFBA 4IPHA 5IP7G 4R4OA 2MO0A 1ZXTA 5EPKA 3T4AC 1TY2A 3OMCA 1WVLA 2JA8B 2NWGA 4LF7Q 4BBSB 1PH5A 1XNRQ 3Q8DA 1E22A 1GVPA 3F1ZA 4C3HG 2VQFQ 4A3KG 1G51A 2KOLA 2Y0SG 1WTQA 5CGKA 2VS1A 1U0LA 2EY2A 3J80L 2F0SA 1ESFA 2NN6I 4HR7B 5KRUA 1TWGB 2PZUA 2PMZB 1IZ6A 4H7BA 4X62Q 1UE1A 4LMQD 3A5ZB 4DAPA 1PXUA 1KD1C 2LY7A 3LWEA 1RDPD 4P72A 2ZXRA 1SYGA 4IPCA 4N8FA 3HG9A 5C3EG 2MGSA 3KUPA 1WTXA 1K8GA 3OTOQ 3I2ZA 2RF4A 3H94A 2L0CA 1MHWC 1T5EA 1AE2A 4PMWA 2RKSA 3J7ZC 1O7IA 3OW7A 1A0IA 1ILQA 1DCZA 3K59A 1WTWA 3SXHA 2Q2TA 2OEOA 1MJCA 2WAQG 3UE1A 2MO1A 1ONLA 4N9PA 3I4OA 1G291 5IGFA 5IE8A 3S1NH 4L8JA 4LF7L 1TS2A 1XNRL 1SSOA 2AUKA 2AUJD 3CCLA 1X3EA 1SYEA 2VQFL 2WACA 2JA9A 3A54A 1C7YA 4JK1C 2XRSD 4B9WA 3PUYA 3K58A 3NQIA 1STGA 4EVOA 4QIWB 1SFOB 2KUMA 5EKKA 3FHWA 3I70A 4X62L 3OSOA 3T13A 2IHFA 3NTKA 2R3ZA 3DWAA 2H1EA 3QJYA 3OTOL 2HIVA 1KABA 2KVMA 4A3BH 3J81L 1JE5A 5D14A 2J0TD 1LLRD 3NK9A 3I73A 1DOKA 1L0YB 5J1ZA 1WTVA 3G4SA 4X66Q 2QEJC 1ZKOA 2IL8A 2PI2E 1HNZQ 1C0AA 2NZ1D 4AYBE 1QVFA 3KLSA 1STNA 4IQZA 1YIJA 1LUZA 2E5LQ 1QNKA 3VA7A 1ET9A 3JAME 1SN8A 1MD2D 1VQHA 4UP8A 2UU9Q 5C5MA 2A6HC 3K8AA 3A5UA 2KCMA 4X6AH 4R4IA 3H0GH 3ERQA 3RD4A 3MEFA 2L15A 3CCQA 4ZQ3A 4KKTA 1TS3A 5D65A 3GTJH 3MWYW 1B3QA 2HDMA 4B9XA 3GTLB 2N8NA 1AEXA 4HEDA 1XWEA 4I7ZC 4RGOS 1DONA 3BZCA 3AEVA 1G8ZD 2F0GA 1N36Q 1PYSB 4XXEA 1YZ6A 2Q2IA 1J8IA 3NBIA 2F0PA 4I65A 1VMPA 4TSSA 2CW0C 4A3MB 3QR8A 1G6ZA 2KHIA 1A8VA 1JWUD 2DY7A 3SEBA 5BN4A 2J7ZA 2OTLA 3I8ZA 3VDYA 3OOCA 3J80E 2L55A 3DWQA 3SK6A 1STAA 4FP5D 2VXWA 4EGVA 5IGCA 3TS0A 1VF7A 4TVAB 5M5YH 3T1HQ 4OELB 4A3IB 2MP1A 3QB3A 1SJED 5IT9c 2B2VC 2K03A 1PFNA 5FKAC 4X66L 3C1FA 4Y52H 2L9HA 1HNZL 5L37A 4CDEC 3S1RH 3O13A 1K9MC 2A8VA 1HTPA 2JN4A 5EAYA 1SMYC 2E5LL 3NE5B 1L1OC 3WOEA 4IO9A 1C48A 4WJWA 2UU9L 4A75A 2X6GA 1SR3A 2UUBQ 1CI3M 2B2VA 3PUVA 1EY5A 3CP0A 4X65Q 3IFDA 2AQ2B 1CK1A 2PYKA 3MFGA 2D5DA 1L1OA 2PZTA 1I4QA 1K73C 5JEAG 1H9MA 4A3FB 2F0NA 2WB1G 3RMHA 5IP7H 1N36L 2UUCQ 1D1KA 2VZAA 2G5DA 1I3QH 1VQJA 4EQOA 2QDBA 1OO9B 3DMUA 4RHRA 2B63B 2K5WA 3JAMc 2RVLA 2ENBA 3M4PA 1NY4A 3QG1A 5ELOA 4RA8A 4C3HH 4A3KH 1F77A 1RTOA 1VDZA 4JI5L 3T1HL 4A3JG 2M2LA 2R7DA 1TWHH 2JJQA 3RZOB 1BCPD 4BBRB 3HGBA 2RDGA 2WKCA 1CHPD 5C4XB 1S4ZA 5I2XA 1PH4A 1O7ZA 2E2HB 4HJ5A 1SE3A 2B2UC 5CV7A 5EKIA 1AFPA 2SNMA 3UE0A 4CHTB 5C3EH 1OXVA 1HUNA 5J39A 3J81E 2UUBL 1L1OB 3M9BA 3KLSX
chains in the Genus database with same CATH topology
3BS1A 1UNSA 4C56C 1O80A 1LV9A 2B2UA 2EDGA 2NVTB 3GP7A 2Z8LA 1EY7A 2RQXA 5CV9A 2Z4HA 3BDLA 1C4QA 1QB5D 1H9SA 1Q1EA 2HCCA 5CV4A 1L0XB 5EGTA 3FDTA 1A3UA 4H0LC 3EQLC 1PRTC 1EQVA 3AU7A 5K5PA 2K28A 5G3LF 1D1IA 1S5CD 1E2WA 1B53A 2EXZA 1RD9D 1SNDA 3D4RA 5C0XJ 2A6HD 5IODA 3NPPA 2KA7A 2K1BA 2VB3X 1IL8A 3CKIB 3FKIB 1F9SA 4DA2A 1JOQA 1HQRD 1H9SB 4N9TA 5BN5A 1GOZA 5FO9B 3IFTA 4C1NK 1IW7D 3GTMB 2CW0D 1F9RA 3KLRA 1EY0A 2CVRA 1A6XA 5EJWA 1EY9A 2RDFA 3I72A 2E2JB 1HA5A 4BS9A 1XX8A 1PRTB 5M5XB 1KAAA 1EY6A 1EL0A 1SMYD 2BA1A 4K5VA 3A8KE 1LTTD 1NCVA 5EBCA 2PNRC 4ZRZA 1GUNA 4KTAA 4QB4A 3LNNA 1DZ1A 3T53B 2IX1A 1I4GA 1W6JA 1B2TA 1GUTA 2PQEA 3S1QB 3A56A 3T16A 3R3OA 3MC0B 1F2ZA 1K8OA 3MHBA 3GV3A 1ET6A 1Z47A 2A74C 4OO1I 2NVXB 2G9HD 4ABNA 5CR3A 3VR5A 5KYLA 3KF8A 2E75C 2JP1A 4QF4A 3HOXB 3D8GA 4IUQA 2KCCA 4E6IA 1Y8PB 1WTRA 3D3RA 5I6WA 2F4IA 2XNAC 3NBHA 1D5XC 5JEAH 1ESRA 3BG3A 3OMGA 3PIO3 4PNYA 3LX0A 2EJFC 2JE6I 2EYMA 2IT1A 4RCNA 2EZVA 1BBXC 1PTOD 4IFDI 1LACA 1DM0B 4XT3B 3I4NB 1CA5A 3E0JA 2EYPA 1DXMA 2LKVA 4X3KA 2YYZA 5LL6X 3SDZA 3H09A 5NUCA 4C3IG 1SYBA 3J7YW 4BWGB 4ZAIA 5KNBA 3R2IA 3K5NA 1PFMA 2K5QA 2ZXPA 4TQUS 3M3YB 2MUYA 4XIGS 1SDFA 3HS0C 1NR2A 2PPBC 2NUCA 1PDQA 1O78A 2WP8J 3PIP3 1FNUA 4C1NI 3TN2A 3U9OA 1B9NA 2L11A 3D6CA 5DM63 1XYIA 1SXTA 2HCIA 4MHEA 1SNCA 5ELEA 1SNOA 3PV0A 1LO5D 2KECA 1DOMA 5F2DA 1PZID 3S14B 2F0MA 3S16B 3H0GB 1IKMA 4RGTA 3I3CA 1Y8OB 2A6EC 3GQBA 1GHJA 1TT2A 2WIIB 5EBDA 4XT1B 1TKWB 3MEHA 4R9WA 2RA4A 5KNDA 2F0FA 1LT6D 2JEBI 1CM9A 2F0VA 1EZ6A 2Q8IB 2ICIA 1HHVA 5M5YB 2DNCA 1FYCA 1ICWA 2F3WA 3W2DA 1CQFA 2X6LA 2B2WA 3S1RB 3EA6A 2QKIC 1Y1VB 1C8CA 1PTOH 1FNVA 3NUCA 1G91A 1H9JA 1FD7D 4HSPA 2KHSA 2EPBA 2IJ0A 4FF2A 1EOTA 3I90A 1ML0D 1FGBD 1Q1BA 1AP0A 4C3JB 1QG7A 2OT2A 4C3HB 3VR2A 2Y0SB 2O5JC 2DN8A 3M7GA 4K14A 1A3VA 3MFYA 2H4OA 4CKBA 3T56B 1T5XD 1ZYRC 5C3EB 5ELBA 5ELFA 1OXSC 5FLXL 1SYDA 4K8IA 1GUWA 4J1MA 3IL8A 5K36G 1QILA 4JBWA 5CMDA 2FMMA 4S3SA 1RF2D 4TRDA 5D3IB 1JE4A 3C46A 2C9OA 1ILPA 3D4DA 2BDOA 2ZXOA 2KEEA 3NSWA 1TIID 2EY1A 4XQNA 5KGUA 3GTQB 1JC7A 2A6ED 2JSOA 4OIJA 1OXUA 2EY5A 4KY5A 1Q8IA 3KK7A 1E0BA 1IYUA 4ULLA 5C3XA 4Q0FA 1U4PA 1BF4A 2A69C 1LTSD 4KJOA 1LT3D 3VR3A 1LTID 4M8AA 2IPKD 2SOBA 3TSSA 2F0KA 2O5IC 2HDLA 3PUXA 2RSOA 4IALA 4BA1I 1F2MA 5CV8A 1S5ED 4CJ0B 3VR4A 4Q5VA 1D5ZC 3SR1A 1YNJC 3L9AX 1AW7A 3C3LA 2BA0A 4WORA 4FYDA 3PUZA 4G4KA 2WINB 1EIHA 5JPNC 4KY6A 4DAVA 4IFDJ 1PLFA 3GTOB 2R6GA 4WRDA 5M9OA 4G7ZC 4DXFA 1BDOA 1NAPA 2PCFB 2D2CC 5FLXE 4KHVA 3IAYA 5KYIA 1F9QA 3DEPA 1BUVT 3FRPB 1I6VC 2SDFA 1PZKD 2C5CA 3NQTA 3VYUA 2E2DC 1ZYRD 1TWCB 3H6MA 1AZPA 1ZEQX 3NP8A 1CHQD 3M4OB 3NTIA 1S5FD 4PMBA 4DNRB 1BCPF 1CT1D 2F0JA 4OGQC 4A3JB 3I4LA 4DU9A 4CKCA 1U4RA 2B2YA 3T51B 5JAVA 3D6WA 1BQQT 2MJ8A 1MBYA 2XVSA 2NTTA 2K01A 2KEDA 1STBA 1WD1A 4KD4A 5JPMC 3MAQA 1EY4A 5KNCA 1TWFB 3ZYYX 2D62A 2PW7A 2TSSA 2WKDA 5A35A 5K36H 1BXTA 5D3DA 2NBFA 1I4RA 3S2DB 5C6AA 2K04A 3FPUB 3HOYB 3ND9A 4G7OC 4NW2A 3PUWA 3HOUB 1STEA 1A2UA 2MHVA 4O42A 4YIJA 3A55A 2Z1CA 3BDOA 4HCSA 3FEWX 5E4WC 4RKBA 4OO1G 3M4YA 1M8AA 3I4MB 2GA4B 4BA2I 4X3SA 1PMRA 2QF7A 4OL7A 1Q90A 5HURA 5FOBB 4WFN3 4A93B 1WTPA 1A15A 5J22A 5DM73 2O4XA 5EPJA 2R93B 1VMCA 1B50A 2Q8TA 2A73B 4CJ2C 1YNJD 2IW3A 3P1HA 4DNTB 4CJ1B 4TKOB 4ZYSA 3AB9A 1XTCD 4KHZA 1HPCA 1I4PA 1I6HB 4NKLA 1IKLA 2K05A 3G7LA 4OHJA 4IZ8A 5I4DA 1EFID 2SNSA 3J7AV 1CFMA 1EYCA 4F87A 3HKZB 4K6LA 4XTCS 5A2QL 3CRKC 3GTKB 2K5DA 2F0HA 3TP7A 1KDCA 1V1OA 4IN3A 1LTAD 4IUTA 3N6RA 1D6EC 3QIAA 5CV5A 3N52A 3GV6A 4O1NA 1DOLA 1UAPA 4X3TA 1PZJD 1TU2B 4ILWA 5CBEE 4FF1A 3OPOA 3GD7A 2B8FA 5IGEA 2AWNA 1GJXA 1TS4A 1PTOF 4A3EB 3TP8A 3OHXC 3Q6SA 1JOOA 4XQQA 3C1EA 3HP3A 1S5BD 2EYJA 4CKEA 1DD2A 1SYCA 3SE0A 1LABA 1VF5C 3S1MB 2AQ3B 1V43A 4FXKC 1O7LA 5IGGA 1ENFA 1UEAB 2XN9C 2AWOA 5I6YA 1QE6A 3D31A 3BZDB 1SE2A 2EYLA 3Q24A 3MXUA 3ND8A 2YU9B 5CBAE 3A8JE 1PRTD 2HUGA 3NWSA 3S1NB 5C0XG 2CHBD 4H13C 1CTMA 1S5DD 4LAAA 4ZLTF 2B2TA 3GO5A 3CRLC 2XWJB 2X69A 2F03A 2L5TA 2R61A 4Z9CB 5IIFA 4OO1H 1SAPA 4L63B 5M3MB 2E74C 2I46A 1LT4D 4CBVA 1KLGD 2Q8RE 2F0TA 1V8QA 5A2QE 3HOVB 1KDAA 1HXYD 3P20A 4A3BB 2IX0A 2KJXA 2L4NA 1U4LA 4LJZC 1IHZA 2K7VA 1TVXA 2N55A 1A3TA 3KLSX 1RODA 1F2YA 4FNFA 2WV6D 3NWTA 4L6TB 2K32A 2VB2X 5JVH3 1STHA 2TMPA 2NN6G 3K0YA 3D4WA 3GTJB 3TBIB 4NP5A 5IGDA 3R2TA 2EJGC 4OIKA 2B2WC 4FF4A 2G9DA 4U68A 1QJOA 2JA5B 2RSNA 3MXNA 5FK9C 5HGTA 2KCNA 4IUUA 1JWMD 2NYZD 2AQ1B 5LL6S 1SBBB 4KKUA 3DEOA 1I4HA 1II3A 1JR0D 4UDUC 4HTHA 2BCOA 4MN3A 5IT9L 1JCKB 2EYOA 5CORA 4KI0A 2OXPA 4XYOA 3L3OC 2A68C 1Y8NB 4R8NA 4GZYC 4XDXA 4IURA 2J4XA 3Q23A 4K2LA 5TSSA 3R8BA 4KN4C 3VYSA 2K6AA 1I3QB 3MA2B 3P75A 4FVMA 2JXMB 3HZXA 4XQJA 2EYHA 1HRJA 4ZK9B 1TY0A 5DAUA 2NB0A 3CHBD 4A3KB 4RAUC 1SYFA 2K33A 1TWHB 3H91A 3H3VC 1LTBD 2JA6B 1R9TB 1Y69U 3BVGA 4ID6A 5FO8B 3MTSA 4ZKCB 5I2YA 4C3JG 1LTGD 1E2VA 2WAQB 3RZDB 1HA6A 1FR3A 2NTSA 2BE5C 4X3UA 2D9UA 1QOHA 2F0DA 3R93A 5C0XH 1AN8A 1BNZA 1Q12A 3S15B 4FO2A 1LTRD 1BOSA 4HN7A 3BVZA 3QOJA 1R4QB 4G57A 1V1PA 4DN4M 4U673 5M5WB 1JB3A 5JEAJ 1HFNA 1QWYA 4Y7NB 2FFKB 1H9RA 1KLUD 4R8IA 2F0UA 4QCLA 1BCPC 1M4VA 3HOWB 3FVQA 3I91A 1TQOA 1HUMA 5IT9E 1SE4A 5JOBA 3SK4A 5EKLA 3S9WA 4DF7A 1V1PB 2NN6H 4BY1B 5COYA 4KK7A 3QOLA 4LK1C 4F7XA 3PMFA 4HMIA 4KKSA 3TP5A 3TZUA 4KMUC 1RHPA 3K5MA 2JYOA 3SVMA 1EWHA 1NUCA 5M3FB 2A68D 1WD0A 3KBXA 2F0IA 2DNEA 4V190 1GUGA 1R4PB 4RGNA 2XSCA 4DK0A 3E6ZX 4QUCA 1SNQA 1EQTA 3BYYB 1BCPB 3Q0AA 3CQZB 1SEBD 5IOCA 2BDNA 2EVBA 5EQ0A 5EPLA 4ZKBB 5CV6A 5CYUA 4IUVA 4IUPA 1CZGA 3EFXD 4DGZA 1IW7C 5C44B 2LS01 3QWNA 1ENCA 2WB1B 1HQMC 4HMJA 2M9VA 1B3AA 3NHHA 3V96A 4EQNA 3ITPA 2B2YC 1EEID 1B1ZA 2ZT9C 4ZUJA 3OIQA 4MIUA 4ZUIA 1JORA 3BYTB 2BE5D 5LHY1 2R92B 1SJHD 2CQAA 4K8JA 2FHTA 4HAEA 2FMCA 4PV1C 1EU4A 1F2LA 3TP6A 1I50B 3VR6A 3PO3B 5T1IA 1G2TA 3S17B 1GUOA 1DJRD 1E2ZA 1Q3LA 3GTGB 5C3WA 4KV6A 2F0OA 4K5WA 1XXGA 4G7HC 4PMCA 4PQXA 2A5HA 3GTPB 2OF1A 3PO2B 1NR4A 3X3MA 2E76C 5ISRA 3F2UA 4P2CB 1O7YA 2EYFA 1B44D 4F8MA 2F0QA 2A69D 2FINB 2NVQB 1TS5A 1PTOC 3K5OA 2ICEC 2XWBB 1IYVA 2M00A 1B9MA 5BN3A 2N88A 3DWPA 1F9PA 3URYA 4HSVA 4XYQA 3V05A 4KJNA 5ELDA 3AMUA 1MSGA 1CA6A 3FPPA 4KY7A 2F0WA 3FMCA 4IFDG 1X3QA 1YNNC 4M1UB 3HRZC 3SK8A 4DAYA 1JQYD 2L12A 4RH6A 2IWHA 5G3LD 5T1GA 3VYRA 5DEHA 4H44C 3L7ZC 1BO0A 4FXGC 1KNEA 3K57A 1Z7TA 1PTOB 5C4HA 1JICA 4RGMA 2KQ3A 2EJMA 1BR9A 3NXWA 4K5XA 3K6OA 3OIPA 2FJ2A 3A7LA 2EOTA 4F88A 2JEAI 3A7AB 1EIGA 1PFBA 5E4XA 1KDBA 1AZQA 2EY6A 3G6JB 1HFGA 3DM1A 3MZ5A 2VNUD 1OXXK 3OWFA 3DUZA 2PZWA 3MXPA 1D2BA 2XRQD 1FNWA 2NVYB 1GUSA 1RJTA 1VCIA 5KIXA 3M7NA 5E3FA 1JOKA 3EVQA 3DHQA 1K8MA 1EYAA 2HQEA 5I9OA 2E2IB 3K5LA 2O2LD 5E1FA 2F0LA 3BVMA 1PRTF 2B39A 1I4XA 3MXGA 1ENAA 3EJIA 2F3VA 3U9SA 4RCOA 2LMCB 3LWUA 3WOFA 2SEBD 4C3IB 4A3GB 1CQVA 3KBGA 2B2TC 1H9KA 5C4JB 2ID0A 1RCVD 1SNPA 2QILA 1D5MC 4FXDA 4BY7B 5AFWA 5JJZA 3IKJA 4K6DA 2IX3A 5C4ZA 1QNUA 1A2TA 4DK1A 1TR5A 5JVG3 4HCEA 4CGYB 3C2PA 1TWAB 3ONAB 2JA7B 1KNAA 1KTKA 1U4MA 3UI2A 1X3PA 4RHSA 2RDHA 5I9PA 3S2HB 1Y1WB 1CZWA 1LT5D 2QCPX 3SHLA 2L1BA 1J9OA 1YNND 1RTNA 1Z6HA 2MPMA 5CC4A 3X3NA 5FO7B 3E5SA 3HEJA 3SK5A 2V4DA 3TDQA 2RBMA 5ELCA 5KEEA 1EWCA 3VYTA 1EEFD 1HTLD 2VUMB 1MI2A 4K2KA 4IFDH 1WTOA 2XIWA 4A3DB 3MVVA 1EY8A 4QUFA 1PYWD 2BOSA 4B08A 1K83B 1HCZA 3EROA 2B8GA 3A8IE 1X32A 2R7ZB 3RUZA 4V0BA 2PO4A 2Z4IA 3V2TA 3NTHA 4KD3A 1G2SA 3TZDA 5DNFA 2DY8A 4C2MB 2EE1A 1GHKA 1MSHA 3M85A 3TMEA 4J6HA 2LFNA 4J8QA 1WCMB 2I07B 1RKNA 3Q22A 1B4OA 4RKLA 1QCBD 3BDCA 1W6KA 4FF3A 2F0EA 4UAIA 1GXDC 1U9RA 1STYA 4ODGA 5IGBA 4EQPA 1JWSD 2PW5A 1EZ8A 3QO2A 3P7JA 3OWEB 4NMZA 5C0XI 1NSNS 4RWSC 3K7AB 4QMGA 3WDNA 2F1MA 4DFAA 1EYDA 1DYQA 1OXTA 4ME5A 3J7AF 3DXJC 1SNMA 3HOZB 1EU3A 4IUNA 3W3AA 4AYBB 1MGSA 1UUPA 3JAML 4KN7C 3CU7A 4DXGA 3VA5A 4NDXA 5C5LA 4RFBA 1ZXTA 5EPKA 3T4AC 1TY2A 3OMCA 1WVLA 2JA8B 2NWGA 4BBSB 4C3HG 2KOLA 1WTQA 5CGKA 2EY2A 3J80L 2F0SA 1ESFA 2NN6I 4HR7B 5KRUA 1TWGB 2PZUA 2PMZB 4H7BA 4LMQD 4DAPA 1PXUA 2LY7A 3LWEA 1RDPD 2ZXRA 1SYGA 3HG9A 2MGSA 3KUPA 1WTXA 3H94A 2L0CA 1T5EA 4PMWA 2RKSA 3OW7A 1ILQA 1DCZA 3K59A 1WTWA 3SXHA 2OEOA 1ONLA 4N9PA 1G291 5IGFA 4L8JA 1TS2A 1SSOA 2AUKA 2AUJD 1SYEA 2WACA 3A54A 4JK1C 2XRSD 4B9WA 3PUYA 3K58A 3NQIA 1STGA 4EVOA 4QIWB 1SFOB 2KUMA 5EKKA 3I70A 3OSOA 3T13A 3NTKA 2R3ZA 3DWAA 2H1EA 3QJYA 1KABA 2KVMA 3J81L 5D14A 2J0TD 1LLRD 3NK9A 3I73A 1DOKA 1L0YB 5J1ZA 1WTVA 2QEJC 1ZKOA 2IL8A 2NZ1D 3KLSA 1STNA 4IQZA 1QNKA 3VA7A 1ET9A 3JAME 1MD2D 5C5MA 2A6HC 3ERQA 3RD4A 4ZQ3A 4KKTA 1TS3A 5D65A 3MWYW 2HDMA 4B9XA 3GTLB 1AEXA 4HEDA 1XWEA 4I7ZC 4RGOS 1DONA 1G8ZD 2F0GA 4XXEA 1J8IA 3NBIA 2F0PA 4I65A 1VMPA 4TSSA 2CW0C 4A3MB 1G6ZA 1JWUD 2DY7A 3SEBA 5BN4A 2J7ZA 3I8ZA 3OOCA 3J80E 2L55A 3DWQA 3SK6A 1STAA 4FP5D 2VXWA 4EGVA 5IGCA 1VF7A 4A3IB 2MP1A 3QB3A 1SJED 2B2VC 2K03A 1PFNA 5FKAC 3C1FA 2L9HA 3O13A 1HTPA 1SMYC 3NE5B 3WOEA 1C48A 4WJWA 2X6GA 1CI3M 2B2VA 3PUVA 1EY5A 3IFDA 2AQ2B 1CK1A 2PYKA 2D5DA 2PZTA 3MFGA 1I4QA 5JEAG 1H9MA 4A3FB 2F0NA 3RMHA 1D1KA 4EQOA 2QDBA 1OO9B 3DMUA 4RHRA 2B63B 2K5WA 2RVLA 2ENBA 3QG1A 4RA8A 1F77A 1RTOA 1VDZA 2M2LA 3RZOB 1BCPD 4BBRB 3HGBA 2RDGA 2WKCA 1CHPD 5C4XB 1S4ZA 5I2XA 1O7ZA 2E2HB 1SE3A 2B2UC 5CV7A 5EKIA 1AFPA 2SNMA 4CHTB 1OXVA 1HUNA 5J39A 3J81E 3RLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSG A;  1B3A A;  2KOL A;  1CA6 A;  1X32 A;  1AP0 A;  1O80 A;  1WTQ A;  4MN3 A;  2FFK B;  1QG7 A;  2MJ8 A;  1U4P A;  1LV9 A;  1PDQ A;  2B2Y C;  5D65 A;  1BF4 A;  4R8I A;  3MWY W;  2K01 A;  5COR A;  2B2U A;  2KED A;  3GV3 A;  2HDM A;  4ZLT F;  1WD1 A;  1G2S A;  2B2T A;  3TN2 A;  4HED A;  4LMQ D;  1DON A;  2L11 A;  3TZD A;  5DNF A;  2X69 A;  2DY8 A;  5CBE E;  2EE1 A;  1J8I A;  1MSH A;  1X3Q A;  1XYI A;  4XDX A;  1VMP A;  2HCI A;  2HCC A;  2JP1 A;  3LWE A;  3I91 A;  4IUR A;  4MHE A;  2B2T C;  2HDL A;  3FDT A;  1G6Z A;  2MGS A;  3KUP A;  1SAP A;  1WTX A;  1HUM A;  2DY7 A;  2RSO A;  2J7Z A;  2FHT A;  1B4O A;  3I8Z A;  4CJ0 B;  4HAE A;  2L12 A;  4IUQ A;  2K04 A;  3FPU B;  2KEC A;  2VXW A;  2K28 A;  1DOM A;  4NW2 A;  1WTR A;  5T1G A;  4IUT A;  1HRJ A;  5AFW A;  1F2L A;  2MP1 A;  4ZK9 B;  1ILQ A;  2B2V C;  2K03 A;  1PFN A;  2Q8R E;  1WTW A;  5T1I A;  4O42 A;  5JJZ A;  1BO0 A;  4UAI A;  1G2T A;  1IKM A;  1KNE A;  2L9H A;  4RAU C;  4HCS A;  1ESR A;  1B53 A;  5COY A;  1JIC A;  5E4W C;  3I3C A;  3N52 A;  1Q3L A;  2L4N A;  3GV6 A;  3QO2 A;  1GUW A;  1U4L A;  1EIH A;  3P7J A;  3IL8 A;  1DOL A;  3H91 A;  1TVX A;  2N55 A;  2X6G A;  1SSO A;  1M8A A;  2K1B A;  3ONA B;  1KNA A;  4RWS C;  4XT1 B;  4X3T A;  1U4M A;  1RHP A;  2B2V A;  1PLF A;  1NR2 A;  1ROD A;  2JYO A;  2RA4 A;  1IL8 A;  4R9W A;  4X3S A;  1X3P A;  3SVM A;  1BBX C;  3IFD A;  5CMD A;  1F9S A;  1CM9 A;  1NAP A;  1WTP A;  1A15 A;  2FJ2 A;  1WD0 A;  3KBX A;  2KUM A;  4XT3 B;  2FMM A;  2EOT A;  1CA5 A;  1HHV A;  3D6W A;  3Q6S A;  2L1B A;  1NR4 A;  3MTS A;  1J9O A;  1EIG A;  3HP3 A;  1PFB A;  5E4X A;  1F9Q A;  4ZKC B;  1AZQ A;  2R3Z A;  1MGS A;  1RTN A;  4QUC A;  1F9R A;  5EPJ A;  1JE4 A;  3DEP A;  2CVR A;  1EQT A;  1VMC A;  2MPM A;  1ICW A;  4X3K A;  1ILP A;  2Q8T A;  1B50 A;  3F2U A;  5EJW A;  2H1E A;  2SDF A;  2X6L A;  1HFG A;  2B2W A;  3DM1 A;  1HA6 A;  2RVL A;  4X3U A;  4CJ2 C;  1O7Y A;  2KEE A;  1C8C A;  2D9U A;  2KVM A;  4RA8 A;  1AZP A;  4CJ1 B;  1RTO A;  5D14 A;  3R93 A;  2BDN A;  4OIK A;  2FIN B;  1WTV A;  1DOK A;  2B2W C;  1BNZ A;  1XX8 A;  2M2L A;  5EQ0 A;  4ZAI A;  5EPL A;  3UI2 A;  4U68 A;  1G91 A;  1MI2 A;  2RSN A;  4ZKB B;  2IL8 A;  1EL0 A;  1QE6 A;  1RJT A;  2NZ1 D;  4IUV A;  1WTO A;  2XIW A;  2EPB A;  1ZXT A;  4IUP A;  1EOT A;  1NCV A;  1PFM A;  1O7Z A;  1S4Z A;  5EPK A;  1WVL A;  3I90 A;  1QNK A;  2N88 A;  2NWG A;  4IUU A;  2B2U C;  1DZ1 A;  4OIJ A;  5EKI A;  1ML0 D;  4QUF A;  1F9P A;  5CBA E;  2NYZ D;  4HSV A;  1IKL A;  2K05 A;  3G7L A;  1U4R A;  2B2Y A;  4DN4 M;  3DEO A;  1B2T A;  2HUG A;  1HUN A;  1SDF A;  1E0B A;  1HFN A; 
#chains in the Genus database with same CATH topology
 3BS1 A;  1UNS A;  4C56 C;  1O80 A;  4X65 L;  1LV9 A;  2D0P A;  3J80 c;  2B2U A;  2EDG A;  2NVT B;  3GP7 A;  2Z8L A;  3RZD H;  1XNQ Q;  1EY7 A;  2RQX A;  5CV9 A;  2Z4H A;  3BDL A;  1HZ9 A;  4UY8 C;  1C4Q A;  1QB5 D;  1H9S A;  4DV6 Q;  4DKA C;  2UUC L;  1Q1E A;  1BBU A;  2HCC A;  3HOY G;  2B29 A;  5CV4 A;  1L0X B;  5EGT A;  2CKZ B;  3FDT A;  2PQA A;  1A3U A;  1UWV A;  4H0L C;  3E0E A;  3EQL C;  1PRT C;  1EQV A;  3AU7 A;  3KDF A;  5K5P A;  2K28 A;  1BBW A;  1K3R A;  5G3L F;  1D1I A;  1WFQ A;  1S5C D;  4PG3 A;  1E2W A;  1B53 A;  2EXZ A;  1RD9 D;  1SND A;  3D4R A;  5C0X J;  4Y7N H;  3I7F A;  2A6H D;  5IOD A;  4DPG A;  3H3V H;  4BXX G;  4A93 G;  3NPP A;  2KA7 A;  2K1B A;  1GKH A;  2VB3 X;  1IL8 A;  3F2D A;  3CKI B;  3U50 C;  3GTQ H;  3K80 C;  3J7A 5;  3FKI B;  4LW1 A;  1F9S A;  2AMC B;  4DA2 A;  1JOQ A;  1HQR D;  1H9S B;  2F4V Q;  2R93 G;  4N9T A;  3FP9 A;  2RHS B;  5BN5 A;  1GOZ A;  2PQA B;  5FO9 B;  3IFT A;  1XNQ L;  4C1N K;  1IW7 D;  3GTM B;  2CW0 D;  4QY7 A;  1F9R A;  3KLR A;  2ATW A;  1EY0 A;  4DV6 L;  2CVR A;  3KDF B;  1A6X A;  1YJN A;  5EJW A;  1J6Q A;  1X3F A;  5BR8 Q;  1EY9 A;  1IBM Q;  4LUO A;  2RDF A;  4R1J A;  1D8L A;  3I72 A;  3J81 c;  2E2J B;  1HA5 A;  4BS9 A;  1XX8 A;  1WI5 A;  2F52 A;  1PRT B;  3BJU A;  1EQR A;  1KAA A;  4MTK A;  5M5X B;  1N34 Q;  1N32 Q;  1EY6 A;  1EL0 A;  5JJL A;  1SMY D;  2BA1 A;  4K5V A;  4POF A;  3A8K E;  3NEL A;  1NCV A;  1LTT D;  4L5Q A;  5EBC A;  2PNR C;  4JI3 Q;  4ZRZ A;  4LF5 L;  1GUN A;  4KTA A;  4QB4 A;  3LNN A;  1YIT A;  1DZ1 A;  3T53 B;  2IX1 A;  1I4G A;  1W6J A;  2HHH Q;  1B2T A;  1GUT A;  2PQE A;  5GAE C;  3S1Q B;  3A56 A;  3T16 A;  3K81 C;  3R3O A;  3HKZ G;  3MC0 B;  5HY6 A;  1F2Z A;  1K8O A;  2F4V L;  3MHB A;  3GV3 A;  1ET6 A;  1Z47 A;  2A74 C;  4OO1 I;  2NVX B;  2G9H D;  4ABN A;  5CR3 A;  3VR5 A;  5KYL A;  3KF8 A;  2ZJP A;  2E75 C;  2JP1 A;  3GTO H;  1X6O A;  4QF4 A;  5BR8 L;  4DR2 Q;  3HOX B;  2CH4 W;  1KHI A;  3D8G A;  1IBM L;  2QW7 A;  4IUQ A;  2KCC A;  4E6I A;  2V1C C;  1Y8P B;  1WTR A;  3D3R A;  5I6W A;  2F4I A;  1YJW A;  4LFA Q;  2XNA C;  3NBH A;  1N34 L;  2I5L X;  1D5X C;  5JEA H;  4HJA A;  2P5Z X;  1ESR A;  4JOI A;  1YHQ A;  1PA6 A;  5IYD G;  3BG3 A;  3OMG A;  3PIO 3;  4QL5 A;  4JI3 L;  4PNY A;  4DR3 Q;  3LX0 A;  1GD7 A;  3ERS X;  2EJF C;  4A3E G;  2JE6 I;  2HHH L;  2EYM A;  2IT1 A;  3M4O H;  1GO3 E;  4RCN A;  1ASZ A;  2DJG C;  2EZV A;  3BZK A;  3ULL A;  1BBX C;  1PTO D;  4IFD I;  3JAM i;  1LAC A;  3CPF A;  1DM0 B;  4XT3 B;  3I4N B;  4A3J H;  3E0J A;  1CA5 A;  2EYP A;  1PH7 A;  2VL6 A;  1DXM A;  2LKV A;  4O2D A;  4X3K A;  2YYZ A;  5LL6 X;  1VQC A;  3AYH B;  3CC2 A;  3SDZ A;  3H09 A;  3NBH B;  1PH1 A;  1Y14 B;  5E7N A;  1ASY A;  5NUC A;  4C3I G;  4PZ6 A;  1SYB A;  3J7Y W;  3WWV A;  1TWF H;  4MNO A;  4A3G G;  4BWG B;  4LFA L;  4IPG A;  3DM3 A;  4ZAI A;  1Z9F A;  4HJ9 A;  5KNB A;  3J80 i;  1JJG A;  4JG2 A;  3R2I A;  3K5N A;  1PFM A;  2K5Q A;  3S2D H;  2ZXP A;  4DR3 L;  3HOY H;  4TQU S;  3M3Y B;  2MUY A;  4XIG S;  4IPD A;  1SDF A;  3HS0 C;  3GTP H;  3HOU H;  1I5F A;  1NR2 A;  4JV5 Q;  1HZA A;  1CSQ A;  4LFC Q;  1GM5 A;  1VQ7 A;  2PPB C;  1U5K A;  2NUC A;  1K0R A;  1PDQ A;  3CC4 A;  4P74 A;  1O78 A;  2WP8 J;  3PIP 3;  1FNU A;  4C1N I;  3TN2 A;  3U9O A;  2JA7 G;  1B9N A;  2L11 A;  3D6C A;  5DM6 3;  5M3M G;  3E9H A;  4R4C A;  1XYI A;  3BU2 A;  1KIX A;  1SXT A;  2HCI A;  4MHE A;  4DK6 C;  4BXX H;  5GQO A;  4A93 H;  3CF5 A;  1SNC A;  5ELE A;  5GRO A;  1SNO A;  3HOV G;  3PV0 A;  1LO5 D;  2KEC A;  1DOM A;  5F2D A;  1PZI D;  3S14 B;  2KBN A;  2F0M A;  4QQB X;  2R93 H;  3S16 B;  3H0G B;  1IKM A;  2MNA A;  2GVB A;  4RGT A;  3AFQ A;  2EXD A;  3I3C A;  1Y8O B;  2A6E C;  3GQB A;  1GHJ A;  1TT2 A;  2WII B;  4GN5 A;  5EBD A;  1FL0 A;  4DV1 Q;  4XT1 B;  1TKW B;  3MEH A;  2VUM G;  4JV5 L;  4R9W A;  4YWM A;  2RA4 A;  5KND A;  1S3O A;  2JK8 A;  4YHH Q;  4A3D G;  2F0F A;  4LFC L;  4AH6 A;  1LT6 D;  2JEB I;  1CM9 A;  2F0V A;  1EZ6 A;  2Q8I B;  2ICI A;  1HHV A;  1I6H H;  1P16 A;  5M5Y B;  4UP7 A;  1EFW A;  4JYA Q;  2DNC A;  2R7Z G;  1FYC A;  1XMQ Q;  1ICW A;  2F3W A;  1T9H A;  3W2D A;  1CQF A;  2X6L A;  5FJ8 G;  2B2W A;  3S1R B;  3EA6 A;  2QKI C;  1Y1V B;  2JA5 G;  2WFW A;  1C8C A;  1PTO H;  3ULP A;  2LSS A;  4YCW A;  3HFZ B;  2UUA Q;  1FNV A;  3NUC A;  3GTK H;  1H9J A;  1G91 A;  1FD7 D;  4DK3 C;  4HSP A;  2KHS A;  2ZJR A;  2EPB A;  2IJ0 A;  4FF2 A;  1EOT A;  3I90 A;  1ML0 D;  5JJK A;  4DV1 L;  4DV7 L;  1FGB D;  2CWP A;  1Q1B A;  4YHH L;  1AP0 A;  4C3J B;  3DLL A;  2Z6K A;  1QG7 A;  2OT2 A;  3KFU A;  4C3H B;  3VR2 A;  2Y0S B;  4RMF A;  2O5J C;  3TRE A;  2DN8 A;  4JYA L;  5IYD H;  3M7G A;  1XMQ L;  3CCU A;  4K14 A;  1A3V A;  3MFY A;  4PZ8 A;  2H4O A;  4CKB A;  4JI1 Q;  3T56 B;  3HOZ G;  4A3E H;  3EN2 A;  1T5X D;  4GNX A;  3UDG A;  1ZYR C;  1LM0 A;  5C3E B;  3LGJ A;  4APV A;  1IYJ B;  5ELB A;  5ELF A;  3CCJ A;  2UUA L;  1OXS C;  4YWK A;  2E2I H;  4WJ4 A;  5FLX L;  4P71 A;  1SYD A;  4K8I A;  1PH8 A;  3S1M H;  2JA6 G;  1IBL Q;  1KAW A;  1GUW A;  4J1M A;  3IL8 A;  5K36 G;  4AIM A;  5IP9 G;  3W1G A;  2Q2H A;  1VQF A;  3RLO A;  1QIL A;  2UXD L;  4JBW A;  4DV3 Q;  5CMD A;  1WTH A;  4BBS G;  4C3I H;  1X65 A;  2FMM A;  4S3S A;  4A3G H;  1RF2 D;  2YU9 H;  4IJL A;  4TRD A;  5D3I B;  1JE4 A;  2LXK A;  2DUD A;  3C46 A;  2C9O A;  1ILP A;  3D4D A;  2FXQ A;  2YTV A;  2BDO A;  4GN3 B;  3OYY A;  4JI1 L;  2ZXO A;  5H1S E;  2KEE A;  3NSW A;  1TII D;  4P75 A;  2EY1 A;  4XQN A;  5KGU A;  3B6Y A;  3GTQ B;  2JA7 H;  1JC7 A;  2A6E D;  1V9P A;  2ZTD A;  1X9N A;  5M3M H;  1S40 A;  2JSO A;  1YVC A;  1IBL L;  4OIJ A;  1E1O A;  2Z6B A;  1OXU A;  2EY5 A;  3S2H H;  1YI2 A;  1Q81 C;  4KY5 A;  1Q8I A;  3KK7 A;  1E0B A;  1IYU A;  4HJ8 A;  3HOV H;  4ULL A;  5C3X A;  4DV3 L;  4Q0F A;  1U4P A;  3HOW G;  1BF4 A;  2A69 C;  1LTS D;  1EIY B;  4KJO A;  4LFB Q;  1LT3 D;  3VR3 A;  1LTI D;  4M8A A;  2IPK D;  2SOB A;  4JI7 Q;  3TSS A;  2F0K A;  2O5I C;  1NBW A;  2HDL A;  3PUX A;  4PZ7 A;  2RSO A;  4IAL A;  4BA1 I;  2VUM H;  1F2M A;  5CV8 A;  1S5E D;  4CJ0 B;  3VR4 A;  4Q5V A;  1D5Z C;  3SR1 A;  1YNJ C;  4A3D H;  2N49 A;  4BY1 G;  3L9A X;  1AW7 A;  1HZB A;  5AJ3 Q;  3C3L A;  2BA0 A;  2Y0S E;  4WOR A;  4FYD A;  3PUZ A;  1JJC B;  1G6P A;  3IRB A;  4G4K A;  2WIN B;  4I7A A;  1EIH A;  5JPN C;  2R7Z H;  4KY6 A;  5M3F G;  5FJ8 H;  4DAV A;  4GOP C;  4IFD J;  4HIM A;  1PLF A;  2ZJQ A;  1RIP A;  4J15 A;  3U4V A;  2JA5 H;  3GTO B;  2R6G A;  4WRD A;  5M9O A;  4G7Z C;  4DXF A;  1BDO A;  1NAP A;  2PCF B;  4C2M H;  2D2C C;  5FLX E;  1D7Q A;  4LFB L;  4KHV A;  3IAY A;  5KYI A;  1F9Q A;  4JI7 L;  2YTY A;  4GOP A;  3DEP A;  1BUV T;  3J81 j;  2WAQ E;  3FRP B;  1I6V C;  2SDF A;  3HKS A;  2NZO A;  1PZK D;  2C5C A;  3NQT A;  3VYU A;  1HNW Q;  2E2D C;  4GKJ Q;  3W5O A;  1FJG Q;  1ZYR D;  1TWC B;  3H6M A;  1AZP A;  2HD3 A;  1ZEQ X;  3CCV A;  3NP8 A;  1CHQ D;  5C44 G;  1W2B A;  3M4O B;  1E7Z A;  5AJ3 L;  1VQ9 A;  3NTI A;  1S5F D;  2CFM A;  4PMB A;  4DNR B;  1BCP F;  1CT1 D;  4IJH A;  2F0J A;  4OGQ C;  1ICF B;  4A3J B;  1VQ4 A;  1YNX A;  3I4L A;  4JI4 Q;  4DU9 A;  4CKC A;  1SE8 A;  1U4R A;  2B2Y A;  1HR0 W;  1S72 A;  4OWT B;  3T51 B;  3D6W A;  5JAV A;  3HOZ H;  1BQQ T;  5IYC G;  1MJE A;  2OTJ A;  2MJ8 A;  1MBY A;  2XVS A;  4GOP B;  3ER0 A;  2NTT A;  2K01 A;  2KED A;  1STB A;  1WD1 A;  4KD4 A;  5JPM C;  1N8R C;  1H95 A;  3D0F A;  3MAQ A;  3H3V I;  2UXC Q;  1EY4 A;  2LXJ A;  5KNC A;  2R92 G;  2QEX A;  1TWF B;  3ZYY X;  2ZTE A;  2D62 A;  2PW7 A;  2JA6 H;  2TSS A;  2WKD A;  1R9T H;  5A35 A;  5K36 H;  1BXT A;  5D3D A;  1HNW L;  2NBF A;  1I4R A;  5IP9 H;  1FJG L;  3PO3 G;  4GKJ L;  5C6A A;  3S2D B;  4A3F G;  2K04 A;  3FPU B;  3HOY B;  3ND9 A;  4G7O C;  4NW2 A;  4DR7 Q;  3PUW A;  4DAM A;  4NPS A;  3HOU B;  2N78 A;  2B63 G;  1STE A;  1K28 A;  3K7U C;  4BBS H;  1A2U A;  2MHV A;  4O42 A;  4YIJ A;  3A55 A;  1YBY A;  1VQN A;  2Z1C A;  3BDO A;  4HCS A;  5FLX c;  3FEW X;  5E4W C;  1PH2 A;  1XPU A;  4RKB A;  2MQH A;  4OO1 G;  3M4Y A;  2CCZ A;  4JI4 L;  2RCN A;  1M8A A;  3I4M B;  1Q8K A;  2VW9 A;  2GA4 B;  3PO2 G;  4BA2 I;  4X3S A;  1PMR A;  2QF7 A;  4OL7 A;  3S15 H;  1Q90 A;  5HUR A;  5FOB B;  4WFN 3;  4A93 B;  1WTP A;  1A15 A;  4DUY Q;  5J22 A;  2UXC L;  5DM7 3;  2O4X A;  4A3C G;  2CH4 A;  4GN4 B;  5M5W H;  5EPJ A;  2R93 B;  1VMC A;  1B50 A;  2Q8T A;  1YEZ A;  2A73 B;  4CJ2 C;  4JC0 A;  1YNJ D;  2IW3 A;  3KYH C;  4A4I A;  3P1H A;  5LMN Q;  4DNT B;  1M1K C;  4LWC A;  4CJ1 B;  3CC7 A;  4TKO B;  4DR7 L;  3HOW H;  4CDF C;  4ZYS A;  3AB9 A;  1XTC D;  4KHZ A;  1HPC A;  1KRS A;  1VQL A;  1KC8 C;  1I4P A;  1I6H B;  4NKL A;  1IKL A;  2K05 A;  3G7L A;  2WB1 E;  4OHJ A;  3CCS A;  3CW2 C;  4IZ8 A;  5I4D A;  1EFI D;  2SNS A;  2ZTC A;  4BY1 H;  3J7A V;  1CFM A;  4DUY L;  4OON A;  1EYC A;  4F87 A;  3HKZ B;  4K6L A;  4XTC S;  3ULJ A;  5A2Q L;  1AE3 A;  3CRK C;  1JB7 A;  3GTK B;  1N9W A;  2K5D A;  2F0H A;  1EUJ A;  3EBE A;  3TP7 A;  5M3F H;  1YHA A;  1XTD A;  1KDC A;  1V1O A;  5LMN L;  4IN3 A;  3TEH B;  1LTA D;  1NE3 A;  4IUT A;  3N6R A;  1D6E C;  5HGQ A;  3QIA A;  5CV5 A;  4ME3 A;  2C35 B;  1PH9 A;  1WYD A;  3CQZ H;  3N52 A;  4HIK A;  1MKH A;  3GV6 A;  4O1N A;  1HNX Q;  1DOL A;  1UAP A;  4YWL A;  4B3S Q;  4JOI C;  4X3T A;  1PZJ D;  1TU2 B;  4ILW A;  5CBE E;  4FF1 A;  3OPO A;  3GD7 A;  3CD6 A;  2B8F A;  5IGE A;  2AWN A;  1GJX A;  1TS4 A;  1E1T A;  1PTO F;  4A3E B;  3TS2 A;  3TP8 A;  5C44 H;  3OHX C;  4GLA C;  3Q6S A;  1N32 L;  5LMU Q;  1X56 A;  2ASB A;  1JOO A;  4RG1 A;  4XQQ A;  3C1E A;  3HP3 A;  2ES2 A;  1S5B D;  2EYJ A;  3G71 A;  4CKE A;  1DD2 A;  1SYC A;  3SE0 A;  1LAB A;  1QUQ A;  1VF5 C;  3AFP A;  4B3T Q;  1UE6 A;  3S1M B;  2AQ3 B;  1V43 A;  4FDB A;  5IYC H;  1JJ2 A;  4FXK C;  2JQO A;  1O7L A;  2OQ0 A;  5IGG A;  1ENF A;  3KF8 B;  1UEA B;  2HT1 A;  2XN9 C;  2AWO A;  2QDL A;  5I6Y A;  1QE6 A;  3D31 A;  3HOX G;  1XPO A;  1PH3 A;  3BZD B;  1SE2 A;  2EYL A;  2R92 H;  3Q24 A;  1DGS A;  3MXU A;  3ND8 A;  3U58 A;  4POG A;  2YU9 B;  5CBA E;  1X55 A;  3A8J E;  1PRT D;  2HUG A;  4B3S L;  1I50 H;  4DR2 L;  3NWS A;  3PO3 H;  3S1N B;  5C0X G;  3S17 H;  2CHB D;  4A3F H;  5GAD C;  3I56 A;  2UXB Q;  4DV2 Q;  4H13 C;  1CTM A;  1S5D D;  2CQO A;  4LAA A;  4ZLT F;  2B63 H;  3GTG H;  2B2T A;  3GO5 A;  5LMU L;  3CRL C;  2XWJ B;  2X69 A;  2F03 A;  3GDE A;  2L5T A;  2R61 A;  1IXR A;  4Z9C B;  5IIF A;  4OO1 H;  4BY7 G;  4K0K Q;  1SAP A;  4L63 B;  3I4N G;  5M3M B;  4B3T L;  2ALY B;  1VQE A;  4NXM Q;  3PO2 H;  2E74 C;  4X64 Q;  2I46 A;  1LT4 D;  4CBV A;  3M4Q A;  2E2H H;  1KLG D;  2Q8R E;  2F0T A;  1V8Q A;  5A2Q E;  3HOV B;  1KDA A;  1HXY D;  3P20 A;  4A3B B;  3HKZ E;  4A3C H;  2IX0 A;  4N8X 1;  1FVI A;  3CPW A;  2KJX A;  2L4N A;  1EOV A;  1U4L A;  4LJZ C;  1IHZ A;  2K7V A;  1TVX A;  1Y1W G;  2N55 A;  2NVQ H;  1A3T A;  1IL2 A;  1ROD A;  3TQY A;  3PF5 A;  1F2Y A;  4OEM B;  1CKM A;  4FNF A;  2WV6 D;  2UXB L;  3NWT A;  4DV2 L;  4L6T B;  2K32 A;  2VB2 X;  3RLN A;  5JVH 3;  1AH9 A;  4HID A;  2GVA A;  1STH A;  4DV4 Q;  2TMP A;  3PGZ A;  2Q2U A;  2NN6 G;  3K0Y A;  1N33 Q;  3D4W A;  5IWA Q;  3GTJ B;  3TBI B;  4NP5 A;  5IGD A;  3R2T A;  4ZCK A;  1HJP A;  4LF6 Q;  4K0K L;  1TXY A;  1SRO A;  3U4Z A;  2EJG C;  4NXM L;  4X64 L;  4DV0 Q;  4OIK A;  4LF8 Q;  2B2W C;  4FF4 A;  3A74 A;  2G9D A;  2ZM6 Q;  3KF6 A;  4U68 A;  1QJO A;  2JA5 B;  1L2F A;  2RSN A;  3MXN A;  5FK9 C;  2AHO B;  1VQP A;  4GLV B;  2KCN A;  5HGT A;  5GAH C;  3RR5 A;  4IUU A;  4JW0 A;  1JWM D;  2MFI A;  4EX5 A;  4DNI A;  1VQI A;  2NYZ D;  2AQ1 B;  5LL6 S;  1SBB B;  4KKU A;  3DEO A;  1I4H A;  1II3 A;  1JR0 D;  4UDU C;  4HTH A;  2BCO A;  2XGT A;  4MN3 A;  5IT9 L;  1VQ5 A;  1JCK B;  2EYO A;  2K5N A;  1FGU A;  3G6E A;  5COR A;  4AQY Q;  4KI0 A;  2OXP A;  4XYO A;  3L3O C;  2A68 C;  4DV4 L;  1WCM G;  3K0X A;  3W1B A;  1Y8N B;  4R8N A;  2Z6K C;  1N33 L;  4GZY C;  1CUK A;  5IWA L;  1VQK A;  3I55 A;  4XDX A;  4IUR A;  2J4X A;  3Q23 A;  4K2L A;  5TSS A;  3R8B A;  4KN4 C;  4B3R Q;  3VYS A;  4LF6 L;  3KF6 B;  4OWW B;  2K6A A;  1I3Q B;  4DR4 Q;  3MA2 B;  4LF9 Q;  3MXN B;  3P75 A;  4FVM A;  2JXM B;  3HZX A;  4XQJ A;  4DV0 L;  2EYH A;  4LF8 L;  1HRJ A;  2I5H A;  3JC6 6;  4L5T A;  4MZ9 A;  4ZK9 B;  1TY0 A;  2ZM6 L;  5DAU A;  2OQK A;  3TRZ A;  2NB0 A;  3CHB D;  4A3K B;  1Y1V G;  4GNX C;  4RAU C;  1SYF A;  2YV5 A;  2K33 A;  1TWH B;  3H91 A;  2N3S A;  3H3V C;  1LTB D;  4WJ3 M;  1XMO Q;  1VQO A;  2NVY H;  4EQ5 A;  2JA6 B;  1R9T B;  4AYB G;  1Y69 U;  3BVG A;  4ID6 A;  2YTX A;  4AQY L;  5FO8 B;  3MTS A;  3HOX H;  1UE5 A;  4ZKC B;  1M90 C;  5I2Y A;  1QVC A;  4C3J G;  1LTG D;  1E2V A;  2WAQ B;  3RZD B;  4B3R L;  1HA6 A;  1FR3 A;  2NTS A;  2BE5 C;  4X3U A;  4ALP A;  1CKO A;  4DR4 L;  2D9U A;  1QOH A;  2F0D A;  3EIV A;  4LF9 L;  3R93 A;  5C0X H;  1AN8 A;  2K75 A;  4P73 A;  2JA8 G;  1BNZ A;  1Q12 A;  1Q86 C;  3S15 B;  2IHE A;  3F8T A;  4FO2 A;  4JI0 Q;  1LTR D;  4JBJ A;  1BOS A;  4UPA A;  5C4J H;  4HN7 A;  3BVZ A;  1KQS A;  3QOJ A;  4MTN A;  4GNX B;  1R4Q B;  1QZH A;  1KXL A;  4G57 A;  3AQQ A;  1V1P A;  4DN4 M;  4BY7 H;  4U67 3;  5M5W B;  1QZG A;  3I4N H;  3CCR A;  1JB3 A;  5JEA J;  1XMO L;  1HFN A;  1QWY A;  4Y7N B;  2K50 A;  1VS0 A;  1H9R A;  2FFK B;  2B3G A;  1KLU D;  4R8I A;  2F0U A;  4QCL A;  4JI2 Q;  1BCP C;  3KLW A;  1M4V A;  1TWA H;  3HOW B;  4CDD C;  3FVQ A;  3I91 A;  3L2P A;  1TQO A;  1HUM A;  1Y1W H;  1QVG A;  3CCM A;  5IT9 E;  1SE4 A;  1SLJ A;  5JOB A;  3SK4 A;  5ELN A;  1K8A C;  1HR0 Q;  5EKL A;  2HQL A;  1JMC A;  2DGY A;  3S9W A;  4DF7 A;  1V1P B;  4JVZ A;  3M3Y H;  2OWO A;  4JI0 L;  2NN6 H;  4BY1 B;  5COY A;  4KK7 A;  3QOL A;  1XPR A;  4LK1 C;  4F7X A;  3PMF A;  4HMI A;  4OWX B;  4KLK A;  4KKS A;  3TP5 A;  3TZU A;  4KMU C;  3KJO A;  1RHP A;  3K5M A;  2JYO A;  4DUZ Q;  3SVM A;  1EWH A;  1NUC A;  5M3F B;  2A68 D;  1WD0 A;  3KBX A;  2F0I A;  2DNE A;  2E8G A;  4V19 0;  5IYB G;  1GUG A;  1R4P B;  4RGN A;  4JI2 L;  1K83 H;  2XSC A;  4DK0 A;  3E6Z X;  4QUC A;  2A1A A;  1SNQ A;  1EQT A;  3UDF A;  3BYY B;  1B7Y B;  1BCP B;  3KJP A;  3E3X A;  3Q0A A;  3S14 H;  3CQZ B;  3S16 H;  1SEB D;  5IOC A;  2BDN A;  4YCV A;  2EVB A;  1HR0 L;  3ICE A;  5EQ0 A;  5EPL A;  1UEB A;  4ZKB B;  5CV6 A;  5CYU A;  4IUV A;  1WCM H;  4IUP A;  1CZG A;  5FLM G;  3EFX D;  4DGZ A;  1IW7 C;  5C44 B;  4IOA A;  2LS0 1;  3QWN A;  4L5S A;  1ENC A;  2QA4 A;  2WB1 B;  1HQM C;  4DUZ L;  4HMJ A;  2M9V A;  1B3A A;  3NHH A;  4JI5 Q;  3V96 A;  2PMZ E;  3ITP A;  2B2Y C;  4EQN A;  2IY5 B;  1EEI D;  1VQB A;  2BH2 A;  1A63 A;  4A3M G;  1B1Z A;  1X54 A;  2ZT9 C;  4ZUJ A;  1Y1V H;  1MIU A;  3K7A H;  1PFS A;  1KRT A;  4HIO A;  3OIQ A;  3A0J A;  4MIU A;  4ZUI A;  1JOR A;  3BYT B;  2BE5 D;  5LHY 1;  4A3I G;  2R92 B;  1SJH D;  2CQA A;  4K8J A;  2FHT A;  4UP9 A;  3CCE A;  4HAE A;  1C9O A;  4LUV A;  2FMC A;  4PV1 C;  1EU4 A;  1F2L A;  3OW2 A;  3TP6 A;  1I50 B;  3VR6 A;  1CKN A;  3PO3 B;  5T1I A;  1G2T A;  2K4K A;  3S17 B;  1GUO A;  4B3M Q;  1DJR D;  2K52 A;  3CMA A;  1LYL A;  1E2Z A;  1Q3L A;  2D0O A;  2F3I A;  3GTG B;  4JBM A;  4JPB W;  4C3J H;  3PIO A;  5C3W A;  4KV6 A;  4YY3 Q;  2F0O A;  4K5W A;  1B8A A;  3CME A;  5JJI A;  1XXG A;  3SGI A;  4G7H C;  1NMG A;  4PMC A;  1NNX A;  4QIW E;  2QGQ A;  4PQX A;  2A5H A;  2JA8 H;  3GTP B;  2OF1 A;  3PO2 B;  1SRU A;  1NR4 A;  3X3M A;  2K5H A;  2E76 C;  5ISR A;  3NEM A;  3F2U A;  4JI8 Q;  4P2C B;  1CKN B;  1YHB A;  1TWG H;  1O7Y A;  4BBR G;  2EYF A;  1B44 D;  4F8M A;  2F0Q A;  4O0A A;  2A69 D;  2FIN B;  5C4X G;  2NVQ B;  1TS5 A;  1PTO C;  1E3P A;  1X3G A;  3K5O A;  2ICE C;  1JT8 A;  2XWB B;  3F2B A;  4B3M L;  1IYV A;  2M00 A;  1B9M A;  1V1Q A;  1HZC A;  2N88 A;  5BN3 A;  1PHJ A;  3DWP A;  1F9P A;  3URY A;  4HSV A;  4XYQ A;  3V05 A;  4GS3 A;  3HOU G;  4KJN A;  1VQ8 A;  4LF4 Q;  5ELD A;  4YY3 L;  3AMU A;  1MSG A;  1CA6 A;  3FPP A;  4KY7 A;  1K0S A;  2F0W A;  2CWA A;  3FMC A;  4IFD G;  3PCO B;  3I4M G;  4LF5 Q;  4DR6 Q;  3STB C;  1X3Q A;  3PIP A;  1YNN C;  4M1U B;  4JI8 L;  1UE7 A;  3HRZ C;  3SK8 A;  2KCT A;  2K14 A;  1SFO H;  4DAY A;  4UHV A;  2VQE Q;  1I94 Q;  1JQY D;  2L12 A;  4RH6 A;  2A19 A;  2IWH A;  1WOC A;  4A3L G;  5G3L D;  5T1G A;  1EQQ A;  3VYR A;  1VQA A;  5DEH A;  2I5M X;  4H44 C;  4LUZ A;  3L7Z C;  1BO0 A;  4FXG C;  1KNE A;  3K57 A;  5IYB H;  1Z7T A;  1PTO B;  5C4H A;  1JIC A;  2H5X A;  3FKI G;  4RGM A;  2KQ3 A;  2EJM A;  4LF4 L;  1BR9 A;  4NB3 A;  5J3B A;  3NXW A;  4K5X A;  1P8L A;  3K6O A;  3OIP A;  2FJ2 A;  3A7L A;  2EOT A;  2AKW B;  4F88 A;  2JEA I;  3A7A B;  1EIG A;  1PVO A;  1PFB A;  5E4X A;  1KDB A;  4DAY B;  1AZQ A;  4DR6 L;  5FLM H;  4GKK Q;  2EY6 A;  1OTC A;  4R4Q A;  2NZH A;  3G6J B;  1HFG A;  3DM1 A;  1VQG A;  3MZ5 A;  2VQE L;  1I94 L;  2VNU D;  1OXX K;  3GTL H;  1PH6 A;  3OWF A;  1K3B C;  3DUZ A;  2PZW A;  3MXP A;  1D2B A;  3RN5 A;  2XRQ D;  3G48 A;  1FNW A;  2NVY B;  1GUS A;  4A3M H;  1RJT A;  1VCI A;  5KIX A;  3M7N A;  5E3F A;  1JOK A;  3EVQ A;  2EIF A;  1BVS A;  3DHQ A;  1K8M A;  1EYA A;  2HQE A;  5I9O A;  2E2I B;  3K5L A;  2O2L D;  1CSP A;  4DR1 Q;  5E1F A;  4A3I H;  2F0L A;  3BVM A;  2I0Q A;  1PRT F;  4DV5 Q;  1KL9 A;  2EQS A;  2B39 A;  3NEN A;  3S24 A;  1I4X A;  3MXG A;  1ENA A;  3EJI A;  1NMF A;  3H15 A;  3T1Y Q;  2F3V A;  4RCO A;  3U9S A;  2LMC B;  3LWU A;  4JI6 Q;  5LMN W;  3WOF A;  2SEB D;  1VQM A;  4C3I B;  1TWC H;  2PNH A;  4GKK L;  4A3G B;  1CQV A;  3KBG A;  2B2T C;  1HNX L;  4KHP Q;  1H9K A;  5C4J B;  1VQD A;  2ID0 A;  1RCV D;  1SNP A;  4QJF A;  2QIL A;  4NXN Q;  1D5M C;  3PF4 A;  4FXD A;  4BY7 B;  5AFW A;  2OCE A;  1W3S A;  3ZJY C;  2Z0S A;  5JJZ A;  3IKJ A;  4K6D A;  2IX3 A;  5C4Z A;  1QNU A;  1A2T A;  4DK1 A;  1TR5 A;  1QUQ B;  2RCF A;  3CAM A;  3F2C A;  2R7F A;  5JVG 3;  1BKB A;  4HCE A;  4CGY B;  3C2P A;  4R4T A;  1SMX A;  2XTI A;  1TWA B;  3ONA B;  2JA7 B;  1KNA A;  2GN5 A;  4DR1 L;  1WJJ A;  2KEN A;  3RLF A;  1KTK A;  1U4M A;  3UI2 A;  4JBK A;  1X3P A;  3RZO H;  4RHS A;  2RDH A;  4BBR H;  4DV5 L;  5I9P A;  3S2H B;  2DJF C;  1Y1W B;  5C4X H;  4LNQ A;  1CZW A;  3KOJ A;  1LT5 D;  2QCP X;  3SHL A;  2L1B A;  4HJ7 A;  3T1Y L;  1LTL A;  3STB D;  1J9O A;  4OXP A;  1YNN D;  1RTN A;  4JI6 L;  1Z6H A;  1Q82 C;  2MPM A;  3CXC A;  5CC4 A;  3X3N A;  5FO7 B;  3E5S A;  4KHP L;  3HEJ A;  1NTG A;  3SK5 A;  1PV4 A;  2V4D A;  3TDQ A;  2RBM A;  5ELC A;  5KEE A;  1EWC A;  2NVT H;  4QGU A;  1YJ9 A;  4NXN L;  1EWI A;  3VYT A;  1EEF D;  1HTL D;  2VUM B;  1MI2 A;  4K2K A;  1RL2 A;  4L5R C;  4IFD H;  1WTO A;  2XIW A;  1NJI C;  3I4M H;  1L0W A;  2VY3 A;  3MVV A;  3RN2 A;  4A3D B;  3E9I A;  1EY8 A;  3UDX A;  1B70 B;  4QUF A;  1PYW D;  2K5V A;  2BOS A;  4B08 A;  1K83 B;  2BH8 A;  4IOC A;  4OX9 Q;  1HCZ A;  3ERO A;  2B8G A;  4A3B G;  4DR5 Q;  3A8I E;  1X32 A;  1Q7Y C;  2R7Z B;  4JCV E;  3RUZ A;  4V0B A;  1A62 A;  4A3L H;  2PO4 A;  2Z4I A;  3V2T A;  3NTH A;  4KD3 A;  1G2S A;  1HH2 P;  3TZD A;  1J5E Q;  5DNF A;  5GAG C;  2DY8 A;  4C2M B;  2EE1 A;  2Z9H A;  1MSH A;  3M85 A;  1IBK Q;  1GHK A;  3TME A;  4J6H A;  2LFN A;  4J8Q A;  4DV7 Q;  3FKI H;  1WCM B;  2I07 B;  2PI2 A;  3UDI A;  1RKN A;  3Q22 A;  1B4O A;  4RKL A;  3H0G G;  3PQI A;  1QCB D;  1EIF A;  3BDC A;  3GTM H;  1E24 A;  1W6K A;  4FF3 A;  2F0E A;  3L0O A;  3J81 i;  4UAI A;  2RHQ B;  1GXD C;  1U9R A;  1STY A;  4ODG A;  5IGB A;  4EQP A;  1JWS D;  2PW5 A;  1EZ8 A;  3QO2 A;  5IY0 A;  3P7J A;  4YCU A;  2KHJ A;  3OWE B;  4CDC C;  1Q46 A;  4NMZ A;  1NSN S;  5C0X I;  4RWS C;  3K7A B;  4QMG A;  2E2J H;  3WDN A;  2F1M A;  2HIX A;  4DFA A;  4OX9 L;  1EYD A;  1DYQ A;  1OXT A;  5M5X H;  4H02 A;  4DR5 L;  4ME5 A;  3J7A F;  3DXJ C;  1EYG A;  1SNM A;  3HOZ B;  1EU3 A;  4IUN A;  3W3A A;  4AYB B;  1J5E L;  1MGS A;  1IBK L;  4GLX A;  5DLQ E;  3S1Q H;  1UUP A;  4A76 A;  1PYB A;  3JAM L;  1VQ6 A;  3PSI A;  4KN7 C;  3CU7 A;  2UXD Q;  4DXG A;  3RNU A;  3VA5 A;  4NDX A;  1XJV A;  5C5L A;  2NVX H;  4RFB A;  4IPH A;  5IP7 G;  4R4O A;  2MO0 A;  1ZXT A;  5EPK A;  3T4A C;  1TY2 A;  3OMC A;  1WVL A;  2JA8 B;  2NWG A;  4LF7 Q;  4BBS B;  1PH5 A;  1XNR Q;  3Q8D A;  1E22 A;  1GVP A;  3F1Z A;  4C3H G;  2VQF Q;  4A3K G;  1G51 A;  2KOL A;  2Y0S G;  1WTQ A;  5CGK A;  2VS1 A;  1U0L A;  2EY2 A;  3J80 L;  2F0S A;  1ESF A;  2NN6 I;  4HR7 B;  5KRU A;  1TWG B;  2PZU A;  2PMZ B;  1IZ6 A;  4H7B A;  4X62 Q;  1UE1 A;  4LMQ D;  3A5Z B;  4DAP A;  1PXU A;  1KD1 C;  2LY7 A;  3LWE A;  1RDP D;  4P72 A;  2ZXR A;  1SYG A;  4IPC A;  4N8F A;  3HG9 A;  5C3E G;  2MGS A;  3KUP A;  1WTX A;  1K8G A;  3OTO Q;  3I2Z A;  2RF4 A;  3H94 A;  2L0C A;  1MHW C;  1T5E A;  1AE2 A;  4PMW A;  2RKS A;  3J7Z C;  1O7I A;  3OW7 A;  1A0I A;  1ILQ A;  1DCZ A;  3K59 A;  1WTW A;  3SXH A;  2Q2T A;  2OEO A;  1MJC A;  2WAQ G;  3UE1 A;  2MO1 A;  1ONL A;  4N9P A;  3I4O A;  1G29 1;  5IGF A;  5IE8 A;  3S1N H;  4L8J A;  4LF7 L;  1TS2 A;  1XNR L;  1SSO A;  2AUK A;  2AUJ D;  3CCL A;  1X3E A;  1SYE A;  2VQF L;  2WAC A;  2JA9 A;  3A54 A;  1C7Y A;  4JK1 C;  2XRS D;  4B9W A;  3PUY A;  3K58 A;  3NQI A;  1STG A;  4EVO A;  4QIW B;  1SFO B;  2KUM A;  5EKK A;  3FHW A;  3I70 A;  4X62 L;  3OSO A;  3T13 A;  2IHF A;  3NTK A;  2R3Z A;  3DWA A;  2H1E A;  3QJY A;  3OTO L;  2HIV A;  1KAB A;  2KVM A;  4A3B H;  3J81 L;  1JE5 A;  5D14 A;  2J0T D;  1LLR D;  3NK9 A;  3I73 A;  1DOK A;  1L0Y B;  5J1Z A;  1WTV A;  3G4S A;  4X66 Q;  2QEJ C;  1ZKO A;  2IL8 A;  2PI2 E;  1HNZ Q;  1C0A A;  2NZ1 D;  4AYB E;  1QVF A;  3KLS A;  1STN A;  4IQZ A;  1YIJ A;  1LUZ A;  2E5L Q;  1QNK A;  3VA7 A;  1ET9 A;  3JAM E;  1SN8 A;  1MD2 D;  1VQH A;  4UP8 A;  2UU9 Q;  5C5M A;  2A6H C;  3K8A A;  3A5U A;  2KCM A;  4X6A H;  4R4I A;  3H0G H;  3ERQ A;  3RD4 A;  3MEF A;  2L15 A;  3CCQ A;  4ZQ3 A;  4KKT A;  1TS3 A;  5D65 A;  3GTJ H;  3MWY W;  1B3Q A;  2HDM A;  4B9X A;  3GTL B;  2N8N A;  1AEX A;  4HED A;  1XWE A;  4I7Z C;  4RGO S;  1DON A;  3BZC A;  3AEV A;  1G8Z D;  2F0G A;  1N36 Q;  1PYS B;  4XXE A;  1YZ6 A;  2Q2I A;  1J8I A;  3NBI A;  2F0P A;  4I65 A;  1VMP A;  4TSS A;  2CW0 C;  4A3M B;  3QR8 A;  1G6Z A;  2KHI A;  1A8V A;  1JWU D;  2DY7 A;  3SEB A;  5BN4 A;  2J7Z A;  2OTL A;  3I8Z A;  3VDY A;  3OOC A;  3J80 E;  2L55 A;  3DWQ A;  3SK6 A;  1STA A;  4FP5 D;  2VXW A;  4EGV A;  5IGC A;  3TS0 A;  1VF7 A;  4TVA B;  5M5Y H;  3T1H Q;  4OEL B;  4A3I B;  2MP1 A;  3QB3 A;  1SJE D;  5IT9 c;  2B2V C;  2K03 A;  1PFN A;  5FKA C;  4X66 L;  3C1F A;  4Y52 H;  2L9H A;  1HNZ L;  5L37 A;  4CDE C;  3S1R H;  3O13 A;  1K9M C;  2A8V A;  1HTP A;  2JN4 A;  5EAY A;  1SMY C;  2E5L L;  3NE5 B;  1L1O C;  3WOE A;  4IO9 A;  1C48 A;  4WJW A;  2UU9 L;  4A75 A;  2X6G A;  1SR3 A;  2UUB Q;  1CI3 M;  2B2V A;  3PUV A;  1EY5 A;  3CP0 A;  4X65 Q;  3IFD A;  2AQ2 B;  1CK1 A;  2PYK A;  3MFG A;  2D5D A;  1L1O A;  2PZT A;  1I4Q A;  1K73 C;  5JEA G;  1H9M A;  4A3F B;  2F0N A;  2WB1 G;  3RMH A;  5IP7 H;  1N36 L;  2UUC Q;  1D1K A;  2VZA A;  2G5D A;  1I3Q H;  1VQJ A;  4EQO A;  2QDB A;  1OO9 B;  3DMU A;  4RHR A;  2B63 B;  2K5W A;  3JAM c;  2RVL A;  2ENB A;  3M4P A;  1NY4 A;  3QG1 A;  5ELO A;  4RA8 A;  4C3H H;  4A3K H;  1F77 A;  1RTO A;  1VDZ A;  4JI5 L;  3T1H L;  4A3J G;  2M2L A;  2R7D A;  1TWH H;  2JJQ A;  3RZO B;  1BCP D;  4BBR B;  3HGB A;  2RDG A;  2WKC A;  1CHP D;  5C4X B;  1S4Z A;  5I2X A;  1PH4 A;  1O7Z A;  2E2H B;  4HJ5 A;  1SE3 A;  2B2U C;  5CV7 A;  5EKI A;  1AFP A;  2SNM A;  3UE0 A;  4CHT B;  5C3E H;  1OXV A;  1HUN A;  5J39 A;  3J81 E;  2UUB L;  1L1O B;  3M9B A;  3KLS X; 
#chains in the Genus database with same CATH homology
 3BS1 A;  1UNS A;  4C56 C;  1O80 A;  1LV9 A;  2B2U A;  2EDG A;  2NVT B;  3GP7 A;  2Z8L A;  1EY7 A;  2RQX A;  5CV9 A;  2Z4H A;  3BDL A;  1C4Q A;  1QB5 D;  1H9S A;  1Q1E A;  2HCC A;  5CV4 A;  1L0X B;  5EGT A;  3FDT A;  1A3U A;  4H0L C;  3EQL C;  1PRT C;  1EQV A;  3AU7 A;  5K5P A;  2K28 A;  5G3L F;  1D1I A;  1S5C D;  1E2W A;  1B53 A;  2EXZ A;  1RD9 D;  1SND A;  3D4R A;  5C0X J;  2A6H D;  5IOD A;  3NPP A;  2KA7 A;  2K1B A;  2VB3 X;  1IL8 A;  3CKI B;  3FKI B;  1F9S A;  4DA2 A;  1JOQ A;  1HQR D;  1H9S B;  4N9T A;  5BN5 A;  1GOZ A;  5FO9 B;  3IFT A;  4C1N K;  1IW7 D;  3GTM B;  2CW0 D;  1F9R A;  3KLR A;  1EY0 A;  2CVR A;  1A6X A;  5EJW A;  1EY9 A;  2RDF A;  3I72 A;  2E2J B;  1HA5 A;  4BS9 A;  1XX8 A;  1PRT B;  5M5X B;  1KAA A;  1EY6 A;  1EL0 A;  1SMY D;  2BA1 A;  4K5V A;  3A8K E;  1LTT D;  1NCV A;  5EBC A;  2PNR C;  4ZRZ A;  1GUN A;  4KTA A;  4QB4 A;  3LNN A;  1DZ1 A;  3T53 B;  2IX1 A;  1I4G A;  1W6J A;  1B2T A;  1GUT A;  2PQE A;  3S1Q B;  3A56 A;  3T16 A;  3R3O A;  3MC0 B;  1F2Z A;  1K8O A;  3MHB A;  3GV3 A;  1ET6 A;  1Z47 A;  2A74 C;  4OO1 I;  2NVX B;  2G9H D;  4ABN A;  5CR3 A;  3VR5 A;  5KYL A;  3KF8 A;  2E75 C;  2JP1 A;  4QF4 A;  3HOX B;  3D8G A;  4IUQ A;  2KCC A;  4E6I A;  1Y8P B;  1WTR A;  3D3R A;  5I6W A;  2F4I A;  2XNA C;  3NBH A;  1D5X C;  5JEA H;  1ESR A;  3BG3 A;  3OMG A;  3PIO 3;  4PNY A;  3LX0 A;  2EJF C;  2JE6 I;  2EYM A;  2IT1 A;  4RCN A;  2EZV A;  1BBX C;  1PTO D;  4IFD I;  1LAC A;  1DM0 B;  4XT3 B;  3I4N B;  1CA5 A;  3E0J A;  2EYP A;  1DXM A;  2LKV A;  4X3K A;  2YYZ A;  5LL6 X;  3SDZ A;  3H09 A;  5NUC A;  4C3I G;  1SYB A;  3J7Y W;  4BWG B;  4ZAI A;  5KNB A;  3R2I A;  3K5N A;  1PFM A;  2K5Q A;  2ZXP A;  4TQU S;  3M3Y B;  2MUY A;  4XIG S;  1SDF A;  3HS0 C;  1NR2 A;  2PPB C;  2NUC A;  1PDQ A;  1O78 A;  2WP8 J;  3PIP 3;  1FNU A;  4C1N I;  3TN2 A;  3U9O A;  1B9N A;  2L11 A;  3D6C A;  5DM6 3;  1XYI A;  1SXT A;  2HCI A;  4MHE A;  1SNC A;  5ELE A;  1SNO A;  3PV0 A;  1LO5 D;  2KEC A;  1DOM A;  5F2D A;  1PZI D;  3S14 B;  2F0M A;  3S16 B;  3H0G B;  1IKM A;  4RGT A;  3I3C A;  1Y8O B;  2A6E C;  3GQB A;  1GHJ A;  1TT2 A;  2WII B;  5EBD A;  4XT1 B;  1TKW B;  3MEH A;  4R9W A;  2RA4 A;  5KND A;  2F0F A;  1LT6 D;  2JEB I;  1CM9 A;  2F0V A;  1EZ6 A;  2Q8I B;  2ICI A;  1HHV A;  5M5Y B;  2DNC A;  1FYC A;  1ICW A;  2F3W A;  3W2D A;  1CQF A;  2X6L A;  2B2W A;  3S1R B;  3EA6 A;  2QKI C;  1Y1V B;  1C8C A;  1PTO H;  1FNV A;  3NUC A;  1G91 A;  1H9J A;  1FD7 D;  4HSP A;  2KHS A;  2EPB A;  2IJ0 A;  4FF2 A;  1EOT A;  3I90 A;  1ML0 D;  1FGB D;  1Q1B A;  1AP0 A;  4C3J B;  1QG7 A;  2OT2 A;  4C3H B;  3VR2 A;  2Y0S B;  2O5J C;  2DN8 A;  3M7G A;  4K14 A;  1A3V A;  3MFY A;  2H4O A;  4CKB A;  3T56 B;  1T5X D;  1ZYR C;  5C3E B;  5ELB A;  5ELF A;  1OXS C;  5FLX L;  1SYD A;  4K8I A;  1GUW A;  4J1M A;  3IL8 A;  5K36 G;  1QIL A;  4JBW A;  5CMD A;  2FMM A;  4S3S A;  1RF2 D;  4TRD A;  5D3I B;  1JE4 A;  3C46 A;  2C9O A;  1ILP A;  3D4D A;  2BDO A;  2ZXO A;  2KEE A;  3NSW A;  1TII D;  2EY1 A;  4XQN A;  5KGU A;  3GTQ B;  1JC7 A;  2A6E D;  2JSO A;  4OIJ A;  1OXU A;  2EY5 A;  4KY5 A;  1Q8I A;  3KK7 A;  1E0B A;  1IYU A;  4ULL A;  5C3X A;  4Q0F A;  1U4P A;  1BF4 A;  2A69 C;  1LTS D;  4KJO A;  1LT3 D;  3VR3 A;  1LTI D;  4M8A A;  2IPK D;  2SOB A;  3TSS A;  2F0K A;  2O5I C;  2HDL A;  3PUX A;  2RSO A;  4IAL A;  4BA1 I;  1F2M A;  5CV8 A;  1S5E D;  4CJ0 B;  3VR4 A;  4Q5V A;  1D5Z C;  3SR1 A;  1YNJ C;  3L9A X;  1AW7 A;  3C3L A;  2BA0 A;  4WOR A;  4FYD A;  3PUZ A;  4G4K A;  2WIN B;  1EIH A;  5JPN C;  4KY6 A;  4DAV A;  4IFD J;  1PLF A;  3GTO B;  2R6G A;  4WRD A;  5M9O A;  4G7Z C;  4DXF A;  1BDO A;  1NAP A;  2PCF B;  2D2C C;  5FLX E;  4KHV A;  3IAY A;  5KYI A;  1F9Q A;  3DEP A;  1BUV T;  3FRP B;  1I6V C;  2SDF A;  1PZK D;  2C5C A;  3NQT A;  3VYU A;  2E2D C;  1ZYR D;  1TWC B;  3H6M A;  1AZP A;  1ZEQ X;  3NP8 A;  1CHQ D;  3M4O B;  3NTI A;  1S5F D;  4PMB A;  4DNR B;  1BCP F;  1CT1 D;  2F0J A;  4OGQ C;  4A3J B;  3I4L A;  4DU9 A;  4CKC A;  1U4R A;  2B2Y A;  3T51 B;  5JAV A;  3D6W A;  1BQQ T;  2MJ8 A;  1MBY A;  2XVS A;  2NTT A;  2K01 A;  2KED A;  1STB A;  1WD1 A;  4KD4 A;  5JPM C;  3MAQ A;  1EY4 A;  5KNC A;  1TWF B;  3ZYY X;  2D62 A;  2PW7 A;  2TSS A;  2WKD A;  5A35 A;  5K36 H;  1BXT A;  5D3D A;  2NBF A;  1I4R A;  3S2D B;  5C6A A;  2K04 A;  3FPU B;  3HOY B;  3ND9 A;  4G7O C;  4NW2 A;  3PUW A;  3HOU B;  1STE A;  1A2U A;  2MHV A;  4O42 A;  4YIJ A;  3A55 A;  2Z1C A;  3BDO A;  4HCS A;  3FEW X;  5E4W C;  4RKB A;  4OO1 G;  3M4Y A;  1M8A A;  3I4M B;  2GA4 B;  4BA2 I;  4X3S A;  1PMR A;  2QF7 A;  4OL7 A;  1Q90 A;  5HUR A;  5FOB B;  4WFN 3;  4A93 B;  1WTP A;  1A15 A;  5J22 A;  5DM7 3;  2O4X A;  5EPJ A;  2R93 B;  1VMC A;  1B50 A;  2Q8T A;  2A73 B;  4CJ2 C;  1YNJ D;  2IW3 A;  3P1H A;  4DNT B;  4CJ1 B;  4TKO B;  4ZYS A;  3AB9 A;  1XTC D;  4KHZ A;  1HPC A;  1I4P A;  1I6H B;  4NKL A;  1IKL A;  2K05 A;  3G7L A;  4OHJ A;  4IZ8 A;  5I4D A;  1EFI D;  2SNS A;  3J7A V;  1CFM A;  1EYC A;  4F87 A;  3HKZ B;  4K6L A;  4XTC S;  5A2Q L;  3CRK C;  3GTK B;  2K5D A;  2F0H A;  3TP7 A;  1KDC A;  1V1O A;  4IN3 A;  1LTA D;  4IUT A;  3N6R A;  1D6E C;  3QIA A;  5CV5 A;  3N52 A;  3GV6 A;  4O1N A;  1DOL A;  1UAP A;  4X3T A;  1PZJ D;  1TU2 B;  4ILW A;  5CBE E;  4FF1 A;  3OPO A;  3GD7 A;  2B8F A;  5IGE A;  2AWN A;  1GJX A;  1TS4 A;  1PTO F;  4A3E B;  3TP8 A;  3OHX C;  3Q6S A;  1JOO A;  4XQQ A;  3C1E A;  3HP3 A;  1S5B D;  2EYJ A;  4CKE A;  1DD2 A;  1SYC A;  3SE0 A;  1LAB A;  1VF5 C;  3S1M B;  2AQ3 B;  1V43 A;  4FXK C;  1O7L A;  5IGG A;  1ENF A;  1UEA B;  2XN9 C;  2AWO A;  5I6Y A;  1QE6 A;  3D31 A;  3BZD B;  1SE2 A;  2EYL A;  3Q24 A;  3MXU A;  3ND8 A;  2YU9 B;  5CBA E;  3A8J E;  1PRT D;  2HUG A;  3NWS A;  3S1N B;  5C0X G;  2CHB D;  4H13 C;  1CTM A;  1S5D D;  4LAA A;  4ZLT F;  2B2T A;  3GO5 A;  3CRL C;  2XWJ B;  2X69 A;  2F03 A;  2L5T A;  2R61 A;  4Z9C B;  5IIF A;  4OO1 H;  1SAP A;  4L63 B;  5M3M B;  2E74 C;  2I46 A;  1LT4 D;  4CBV A;  1KLG D;  2Q8R E;  2F0T A;  1V8Q A;  5A2Q E;  3HOV B;  1KDA A;  1HXY D;  3P20 A;  4A3B B;  2IX0 A;  2KJX A;  2L4N A;  1U4L A;  4LJZ C;  1IHZ A;  2K7V A;  1TVX A;  2N55 A;  1A3T A;  3KLS X;  1ROD A;  1F2Y A;  4FNF A;  2WV6 D;  3NWT A;  4L6T B;  2K32 A;  2VB2 X;  5JVH 3;  1STH A;  2TMP A;  2NN6 G;  3K0Y A;  3D4W A;  3GTJ B;  3TBI B;  4NP5 A;  5IGD A;  3R2T A;  2EJG C;  4OIK A;  2B2W C;  4FF4 A;  2G9D A;  4U68 A;  1QJO A;  2JA5 B;  2RSN A;  3MXN A;  5FK9 C;  5HGT A;  2KCN A;  4IUU A;  1JWM D;  2NYZ D;  2AQ1 B;  5LL6 S;  1SBB B;  4KKU A;  3DEO A;  1I4H A;  1II3 A;  1JR0 D;  4UDU C;  4HTH A;  2BCO A;  4MN3 A;  5IT9 L;  1JCK B;  2EYO A;  5COR A;  4KI0 A;  2OXP A;  4XYO A;  3L3O C;  2A68 C;  1Y8N B;  4R8N A;  4GZY C;  4XDX A;  4IUR A;  2J4X A;  3Q23 A;  4K2L A;  5TSS A;  3R8B A;  4KN4 C;  3VYS A;  2K6A A;  1I3Q B;  3MA2 B;  3P75 A;  4FVM A;  2JXM B;  3HZX A;  4XQJ A;  2EYH A;  1HRJ A;  4ZK9 B;  1TY0 A;  5DAU A;  2NB0 A;  3CHB D;  4A3K B;  4RAU C;  1SYF A;  2K33 A;  1TWH B;  3H91 A;  3H3V C;  1LTB D;  2JA6 B;  1R9T B;  1Y69 U;  3BVG A;  4ID6 A;  5FO8 B;  3MTS A;  4ZKC B;  5I2Y A;  4C3J G;  1LTG D;  1E2V A;  2WAQ B;  3RZD B;  1HA6 A;  1FR3 A;  2NTS A;  2BE5 C;  4X3U A;  2D9U A;  1QOH A;  2F0D A;  3R93 A;  5C0X H;  1AN8 A;  1BNZ A;  1Q12 A;  3S15 B;  4FO2 A;  1LTR D;  1BOS A;  4HN7 A;  3BVZ A;  3QOJ A;  1R4Q B;  4G57 A;  1V1P A;  4DN4 M;  4U67 3;  5M5W B;  1JB3 A;  5JEA J;  1HFN A;  1QWY A;  4Y7N B;  2FFK B;  1H9R A;  1KLU D;  4R8I A;  2F0U A;  4QCL A;  1BCP C;  1M4V A;  3HOW B;  3FVQ A;  3I91 A;  1TQO A;  1HUM A;  5IT9 E;  1SE4 A;  5JOB A;  3SK4 A;  5EKL A;  3S9W A;  4DF7 A;  1V1P B;  2NN6 H;  4BY1 B;  5COY A;  4KK7 A;  3QOL A;  4LK1 C;  4F7X A;  3PMF A;  4HMI A;  4KKS A;  3TP5 A;  3TZU A;  4KMU C;  1RHP A;  3K5M A;  2JYO A;  3SVM A;  1EWH A;  1NUC A;  5M3F B;  2A68 D;  1WD0 A;  3KBX A;  2F0I A;  2DNE A;  4V19 0;  1GUG A;  1R4P B;  4RGN A;  2XSC A;  4DK0 A;  3E6Z X;  4QUC A;  1SNQ A;  1EQT A;  3BYY B;  1BCP B;  3Q0A A;  3CQZ B;  1SEB D;  5IOC A;  2BDN A;  2EVB A;  5EQ0 A;  5EPL A;  4ZKB B;  5CV6 A;  5CYU A;  4IUV A;  4IUP A;  1CZG A;  3EFX D;  4DGZ A;  1IW7 C;  5C44 B;  2LS0 1;  3QWN A;  1ENC A;  2WB1 B;  1HQM C;  4HMJ A;  2M9V A;  1B3A A;  3NHH A;  3V96 A;  4EQN A;  3ITP A;  2B2Y C;  1EEI D;  1B1Z A;  2ZT9 C;  4ZUJ A;  3OIQ A;  4MIU A;  4ZUI A;  1JOR A;  3BYT B;  2BE5 D;  5LHY 1;  2R92 B;  1SJH D;  2CQA A;  4K8J A;  2FHT A;  4HAE A;  2FMC A;  4PV1 C;  1EU4 A;  1F2L A;  3TP6 A;  1I50 B;  3VR6 A;  3PO3 B;  5T1I A;  1G2T A;  3S17 B;  1GUO A;  1DJR D;  1E2Z A;  1Q3L A;  3GTG B;  5C3W A;  4KV6 A;  2F0O A;  4K5W A;  1XXG A;  4G7H C;  4PMC A;  4PQX A;  2A5H A;  3GTP B;  2OF1 A;  3PO2 B;  1NR4 A;  3X3M A;  2E76 C;  5ISR A;  3F2U A;  4P2C B;  1O7Y A;  2EYF A;  1B44 D;  4F8M A;  2F0Q A;  2A69 D;  2FIN B;  2NVQ B;  1TS5 A;  1PTO C;  3K5O A;  2ICE C;  2XWB B;  1IYV A;  2M00 A;  1B9M A;  5BN3 A;  2N88 A;  3DWP A;  1F9P A;  3URY A;  4HSV A;  4XYQ A;  3V05 A;  4KJN A;  5ELD A;  3AMU A;  1MSG A;  1CA6 A;  3FPP A;  4KY7 A;  2F0W A;  3FMC A;  4IFD G;  1X3Q A;  1YNN C;  4M1U B;  3HRZ C;  3SK8 A;  4DAY A;  1JQY D;  2L12 A;  4RH6 A;  2IWH A;  5G3L D;  5T1G A;  3VYR A;  5DEH A;  4H44 C;  3L7Z C;  1BO0 A;  4FXG C;  1KNE A;  3K57 A;  1Z7T A;  1PTO B;  5C4H A;  1JIC A;  4RGM A;  2KQ3 A;  2EJM A;  1BR9 A;  3NXW A;  4K5X A;  3K6O A;  3OIP A;  2FJ2 A;  3A7L A;  2EOT A;  4F88 A;  2JEA I;  3A7A B;  1EIG A;  1PFB A;  5E4X A;  1KDB A;  1AZQ A;  2EY6 A;  3G6J B;  1HFG A;  3DM1 A;  3MZ5 A;  2VNU D;  1OXX K;  3OWF A;  3DUZ A;  2PZW A;  3MXP A;  1D2B A;  2XRQ D;  1FNW A;  2NVY B;  1GUS A;  1RJT A;  1VCI A;  5KIX A;  3M7N A;  5E3F A;  1JOK A;  3EVQ A;  3DHQ A;  1K8M A;  1EYA A;  2HQE A;  5I9O A;  2E2I B;  3K5L A;  2O2L D;  5E1F A;  2F0L A;  3BVM A;  1PRT F;  2B39 A;  1I4X A;  3MXG A;  1ENA A;  3EJI A;  2F3V A;  3U9S A;  4RCO A;  2LMC B;  3LWU A;  3WOF A;  2SEB D;  4C3I B;  4A3G B;  1CQV A;  3KBG A;  2B2T C;  1H9K A;  5C4J B;  2ID0 A;  1RCV D;  1SNP A;  2QIL A;  1D5M C;  4FXD A;  4BY7 B;  5AFW A;  5JJZ A;  3IKJ A;  4K6D A;  2IX3 A;  5C4Z A;  1QNU A;  1A2T A;  4DK1 A;  1TR5 A;  5JVG 3;  4HCE A;  4CGY B;  3C2P A;  1TWA B;  3ONA B;  2JA7 B;  1KNA A;  1KTK A;  1U4M A;  3UI2 A;  1X3P A;  4RHS A;  2RDH A;  5I9P A;  3S2H B;  1Y1W B;  1CZW A;  1LT5 D;  2QCP X;  3SHL A;  2L1B A;  1J9O A;  1YNN D;  1RTN A;  1Z6H A;  2MPM A;  5CC4 A;  3X3N A;  5FO7 B;  3E5S A;  3HEJ A;  3SK5 A;  2V4D A;  3TDQ A;  2RBM A;  5ELC A;  5KEE A;  1EWC A;  3VYT A;  1EEF D;  1HTL D;  2VUM B;  1MI2 A;  4K2K A;  4IFD H;  1WTO A;  2XIW A;  4A3D B;  3MVV A;  1EY8 A;  4QUF A;  1PYW D;  2BOS A;  4B08 A;  1K83 B;  1HCZ A;  3ERO A;  2B8G A;  3A8I E;  1X32 A;  2R7Z B;  3RUZ A;  4V0B A;  2PO4 A;  2Z4I A;  3V2T A;  3NTH A;  4KD3 A;  1G2S A;  3TZD A;  5DNF A;  2DY8 A;  4C2M B;  2EE1 A;  1GHK A;  1MSH A;  3M85 A;  3TME A;  4J6H A;  2LFN A;  4J8Q A;  1WCM B;  2I07 B;  1RKN A;  3Q22 A;  1B4O A;  4RKL A;  1QCB D;  3BDC A;  1W6K A;  4FF3 A;  2F0E A;  4UAI A;  1GXD C;  1U9R A;  1STY A;  4ODG A;  5IGB A;  4EQP A;  1JWS D;  2PW5 A;  1EZ8 A;  3QO2 A;  3P7J A;  3OWE B;  4NMZ A;  5C0X I;  1NSN S;  4RWS C;  3K7A B;  4QMG A;  3WDN A;  2F1M A;  4DFA A;  1EYD A;  1DYQ A;  1OXT A;  4ME5 A;  3J7A F;  3DXJ C;  1SNM A;  3HOZ B;  1EU3 A;  4IUN A;  3W3A A;  4AYB B;  1MGS A;  1UUP A;  3JAM L;  4KN7 C;  3CU7 A;  4DXG A;  3VA5 A;  4NDX A;  5C5L A;  4RFB A;  1ZXT A;  5EPK A;  3T4A C;  1TY2 A;  3OMC A;  1WVL A;  2JA8 B;  2NWG A;  4BBS B;  4C3H G;  2KOL A;  1WTQ A;  5CGK A;  2EY2 A;  3J80 L;  2F0S A;  1ESF A;  2NN6 I;  4HR7 B;  5KRU A;  1TWG B;  2PZU A;  2PMZ B;  4H7B A;  4LMQ D;  4DAP A;  1PXU A;  2LY7 A;  3LWE A;  1RDP D;  2ZXR A;  1SYG A;  3HG9 A;  2MGS A;  3KUP A;  1WTX A;  3H94 A;  2L0C A;  1T5E A;  4PMW A;  2RKS A;  3OW7 A;  1ILQ A;  1DCZ A;  3K59 A;  1WTW A;  3SXH A;  2OEO A;  1ONL A;  4N9P A;  1G29 1;  5IGF A;  4L8J A;  1TS2 A;  1SSO A;  2AUK A;  2AUJ D;  1SYE A;  2WAC A;  3A54 A;  4JK1 C;  2XRS D;  4B9W A;  3PUY A;  3K58 A;  3NQI A;  1STG A;  4EVO A;  4QIW B;  1SFO B;  2KUM A;  5EKK A;  3I70 A;  3OSO A;  3T13 A;  3NTK A;  2R3Z A;  3DWA A;  2H1E A;  3QJY A;  1KAB A;  2KVM A;  3J81 L;  5D14 A;  2J0T D;  1LLR D;  3NK9 A;  3I73 A;  1DOK A;  1L0Y B;  5J1Z A;  1WTV A;  2QEJ C;  1ZKO A;  2IL8 A;  2NZ1 D;  3KLS A;  1STN A;  4IQZ A;  1QNK A;  3VA7 A;  1ET9 A;  3JAM E;  1MD2 D;  5C5M A;  2A6H C;  3ERQ A;  3RD4 A;  4ZQ3 A;  4KKT A;  1TS3 A;  5D65 A;  3MWY W;  2HDM A;  4B9X A;  3GTL B;  1AEX A;  4HED A;  1XWE A;  4I7Z C;  4RGO S;  1DON A;  1G8Z D;  2F0G A;  4XXE A;  1J8I A;  3NBI A;  2F0P A;  4I65 A;  1VMP A;  4TSS A;  2CW0 C;  4A3M B;  1G6Z A;  1JWU D;  2DY7 A;  3SEB A;  5BN4 A;  2J7Z A;  3I8Z A;  3OOC A;  3J80 E;  2L55 A;  3DWQ A;  3SK6 A;  1STA A;  4FP5 D;  2VXW A;  4EGV A;  5IGC A;  1VF7 A;  4A3I B;  2MP1 A;  3QB3 A;  1SJE D;  2B2V C;  2K03 A;  1PFN A;  5FKA C;  3C1F A;  2L9H A;  3O13 A;  1HTP A;  1SMY C;  3NE5 B;  3WOE A;  1C48 A;  4WJW A;  2X6G A;  1CI3 M;  2B2V A;  3PUV A;  1EY5 A;  3IFD A;  2AQ2 B;  1CK1 A;  2PYK A;  2D5D A;  2PZT A;  3MFG A;  1I4Q A;  5JEA G;  1H9M A;  4A3F B;  2F0N A;  3RMH A;  1D1K A;  4EQO A;  2QDB A;  1OO9 B;  3DMU A;  4RHR A;  2B63 B;  2K5W A;  2RVL A;  2ENB A;  3QG1 A;  4RA8 A;  1F77 A;  1RTO A;  1VDZ A;  2M2L A;  3RZO B;  1BCP D;  4BBR B;  3HGB A;  2RDG A;  2WKC A;  1CHP D;  5C4X B;  1S4Z A;  5I2X A;  1O7Z A;  2E2H B;  1SE3 A;  2B2U C;  5CV7 A;  5EKI A;  1AFP A;  2SNM A;  4CHT B;  1OXV A;  1HUN A;  5J39 A;  3J81 E;  3RLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...