4ZLTF

Crystal structure of viral chemokine binding protein r17 in complex with ccl3
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
TPTACCFSYSRKIPRQFIVAYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemokine binding protein/chemokine
molecule keywords Putative uncharacterized protein
publication title Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors.
pubmed doi rcsb
source organism Cricetid herpesvirus 2
total genus 14
structure length 62
sequence length 62
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zltF00
1SDFA 2B2UC 4U68A 1J9OA 3MWYW 1WVLA 4HSVA 2KEDA 2NYZD 1IL8A 1VMCA 4X3KA 5CMDA 1DONA 1DZ1A 2VXWA 2FMMA 2IL8A 4ZAIA 1ICWA 1O7ZA 4IUQA 2R3ZA 1C8CA 1NR4A 1HUNA 1DOKA 2L9HA 4CJ2C 1S4ZA 1TVXA 4R9WA 1G6ZA 1VMPA 1AP0A 1QNKA 1XYIA 4XT1B 2B2WA 1B2TA 1X32A 1BO0A 1KNAA 1MSHA 2DY7A 2EOTA 5EPKA 5D65A 3I91A 1CA6A 1RODA 1EIHA 1F9PA 4CJ1B 3I3CA 1HFNA 3R93A 3GV6A 1WTXA 1O7YA 3MTSA 1HUMA 4CJ0B 3HP3A 4IURA 1JE4A 4ZLTF 1G91A 4OIJA 3QO2A 1Q3LA 4ZKBB 5CBEE 1AZQA 1EIGA 1X3PA 1B50A 1PDQA 2L1BA 3DEPA 3I8ZA 2L4NA 1RJTA 4O42A 4IUTA 1ILQA 1HA6A 1U4PA 1RTOA 2X6LA 1RHPA 3D6WA 4IUVA 2SDFA 2M2LA 2MPMA 4MN3A 5DNFA 1WD0A 2K05A 3KBXA 1AZPA 1U4RA 5D14A 4X3TA 1PLFA 1ZXTA 4X3UA 5CORA 1A15A 5EJWA 2B2YC 1JICA 4DN4M 3TN2A 2B2UA 2KECA 2N88A 4UAIA 4QUFA 2N55A 1NR2A 2FHTA 2X69A 1MSGA 3H91A 2Q8RE 2MP1A 2KOLA 1QG7A 4HAEA 4OIKA 3FDTA 1ESRA 1MI2A 2MGSA 1F9QA 4IUUA 2EPBA 4R8IA 3Q6SA 5E4XA 5JJZA 1HHVA 3FPUB 1WTQA 2B2VC 1ML0D 3ONAB 4RWSC 2B2YA 1J8IA 2DY8A 3IL8A 2RSOA 2B2TC 2FFKB 1SSOA 1F9RA 1PFBA 1WTRA 2K1BA 1NAPA 4X3SA 3SVMA 1EQTA 3KUPA 1O80A 3UI2A 2D9UA 1QE6A 1SAPA 5AFWA 2KVMA 5COYA 1WTWA 3LWEA 2JP1A 2H1EA 4ZK9B 1E0BA 2HCIA 2RSNA 4MHEA 1LV9A 2FINB 5EPJA 1BNZA 5EKIA 2MJ8A 1KNEA 2FJ2A 2Q8TA 2NZ1D 2HDMA 4XT3B 2HCCA 2RA4A 1GUWA 4HEDA 1NCVA 4NW2A 1G2SA 2HDLA 2EE1A 2B2WC 2K01A 2L12A 2HUGA 2NWGA 3DM1A 4RA8A 2XIWA 5T1GA 1IKMA 1B3AA 1CM9A 2CVRA 3DEOA 5T1IA 2K04A 1EOTA 3I90A 5E4WC 2KUMA 3IFDA 2K03A 1DOLA 3G7LA 1RTNA 5EPLA 5EQ0A 4LMQD 4XDXA 3N52A 1BF4A 1B53A 1CA5A 3GV3A 1PFMA 2K28A 2L11A 1MGSA 2KEEA 2X6GA 4IUPA 1ILPA 1U4MA 1X3QA 1U4LA 2B2VA 4RAUC 1WTOA 3P7JA 1HRJA 1HFGA 1IKLA 2BDNA 2J7ZA 1BBXC 2RVLA 4ZKCB 1XX8A 2B2TA 5CBAE 3F2UA 1WTPA 1F2LA 4QUCA 1EL0A 1M8AA 1WD1A 1F9SA 1B4OA 1DOMA 4HCSA 1PFNA 2JYOA 3TZDA 1WTVA 1G2TA
chains in the Genus database with same CATH superfamily
1X55A 3CRKC 2BE5C 4IPHA 3AQQA 4RHSA 4TSSA 2EXDA 1JWSD 4C3HG 2PO4A 2OXPA 5HGQA 1QNKA 1WYDA 1CKOA 1B2TA 1CZWA 2R7FA 3I3CA 3ERQA 2RCNA 4C3JG 1F2MA 1KDAA 1TWFB 1XMOQ 2F0PA 5JEAG 1I4PA 3QO2A 4HN7A 5CV7A 3GTLB 4BBSH 4KI0A 3TEHB 4YCUA 1G8ZD 2L4NA 1H9SA 2NTSA 1GVPA 2QDBA 1KRTA 4B3SL 2SDFA 2MPMA 1R9TH 4YCWA 2NBFA 4OL7A 3OW2A 4X3TA 1MD2D 1SR3A 2CWPA 4H13C 3ZJYC 3NEMA 4HIDA 4A3JG 1S5DD 5KEEA 2L15A 4QIWB 1JB3A 2IX1A 2D62A 3D4WA 4GKJQ 5FJ8G 2JEBI 5IGDA 2MGSA 4B3TL 1GOZA 1HHVA 4J8QA 4LF8Q 2VB3X 2B2YA 2IHEA 4GN3B 2MHVA 2EY5A 1F9RA 1PFBA 2A19A 2GN5A 4C2MH 3SVMA 5K36G 1VQBA 3KDFA 1QOHA 3MXNB 1KRSA 2D9UA 4ZQ3A 1IW7C 1SJHD 4RHRA 4FF4A 4JI0L 4HJ9A 3S2DH 2RSNA 2E2HH 1SJED 5EKIA 1I4GA 2NN6I 3ZYYX 1TY2A 1CKNB 1NCVA 3A55A 2PCFB 4A3BB 2PI2E 4AYBG 4N9TA 4DR2Q 2K04A 5E4WC 1FNUA 4PZ6A 3K6OA 5GQOA 2EVBA 3IFDA 1WCMB 5E7NA 1I50H 1LLRD 3L9AX 2XSCA 5M5XB 3RMHA 3E0EA 4KTAA 2LSSA 4UDUC 4WJ3M 3PF5A 1I4QA 2XNAC 4BS9A 3H3VC 4FF2A 2DN8A 3A5UA 2B2TA 5KNCA 1F2LA 2NZOA 4JOIA 3OWEB 1J5EL 2WIIB 1G2TA 1L0XB 1M1KC 3RN2A 2JJQA 3T16A 2AUJD 1XNQL 5BR8L 3S16H 2JA5B 3C1EA 3CC2A 4LF5L 2F4VL 2EY1A 1ICWA 3PF4A 1JC7A 5M3MH 1O7IA 4XQJA 1XWEA 4R9WA 1CK1A 1TWHB 2F0NA 2UXBQ 1MSHA 2AHOB 5C4ZA 5D65A 2AWOA 4BBRB 4JI2Q 4G7HC 1TWAH 4DAMA 1EIGA 2NTTA 3G6EA 1GJXA 1KXLA 2WP8J 3AEVA 4ID6A 4L5SA 4GN5A 1RTOA 1C4QA 2Y0SE 4KY5A 3TREA 3D6CA 1HNXL 2K4KA 2F1MA 4LUOA 4B3MQ 1B1ZA 4N8FA 3R2TA 4LFAQ 3HGBA 4YHHL 2F0VA 1JQYD 2XRSD 5FKAC 4LUVA 3SGIA 1IBML 1HTPA 4PG3A 1I5FA 1D2BA 4RWSC 2R92H 1J8IA 4O1NA 4QCLA 4EQOA 2ZJQA 3UE1A 2ALYB 4DV7Q 4JW0A 1HJPA 3PO2G 2I5MX 1QCBD 1H9JA 5COYA 2PQEA 4ZK9B 1UEAB 2YTYA 1N33L 1GXDC 3GTPB 1D6EC 1JJCB 2E74C 4YWMA 2D0PA 4OO1H 4FXGC 3M4OB 4NW2A 1VQ7A 3DWAA 1SLJA 5IGCA 1E3PA 3TP8A 3NP8A 5EBCA 3OTOL 4X62Q 2YU9B 4JI5L 4OELB 2XTIA 1L1OB 4GOPC 3GTJB 1EY7A 3GQBA 4R8NA 4QIWE 4LFBQ 2C9OA 1K3RA 1PMRA 1XMQL 1UE1A 4QUCA 1F9SA 4A3IH 4DU9A 3U4ZA 4HSVA 1VMCA 5ELBA 4RH6A 2UUAQ 1SMXA 1PH1A 3KFUA 2FMMA 1GUOA 3I7FA 3JAME 2VUMB 1DOKA 2RQXA 1HQMC 3A8IE 3P75A 3WOFA 1KC8C 4J1MA 3KK7A 4JI1L 3I91A 1TWCH 1VQJA 1O7YA 1CQFA 2IW3A 4RGOS 5I2XA 5CV4A 2QEXA 3HOUG 5CBEE 4ZKBB 5DM73 4DR6L 2O4XA 2UU9Q 3T13A 4DK3C 2DGYA 5KGUA 1AE3A 1GUNA 1STYA 2EZVA 1IBKQ 3RR5A 2QW7A 1ZXTA 2K5QA 2WB1G 1TS2A 4EVOA 5I9OA 3H15A 2H4OA 5FLMH 3IKJA 4R4CA 4R4IA 2IHFA 1CT1D 3NWTA 4KKSA 4HIOA 5C4XB 3Q6SA 4DR4L 2PZTA 4K6DA 3ONAB 4PMWA 2Y0SG 1HNZQ 4X66L 2WACA 3F8TA 2IX3A 1WI5A 2FFKB 1JORA 2AWNA 1GHJA 1YHBA 5AJ3L 3GTOH 1WTWA 1QE6A 1UNSA 5AFWA 3CCRA 3S2HB 3K0YA 1NUCA 5J22A 3CF5A 2FINB 1G51A 1V8QA 2EYLA 1LT3D 4C3HB 4F87A 3RN5A 4K0KQ 1BCPF 4GZYC 3HOWG 2A68D 4GNXB 3I4OA 4RFBA 4HSPA 3U50C 1IKMA 4UHVA 3HG9A 1CM9A 1JWUD 4POGA 3H0GG 4EX5A 4LF7L 1E1OA 2N49A 2KJXA 1OXSC 4JI4L 3FRPB 1Y1WH 2R93H 2KCCA 1TKWB 4X6AH 1MGSA 2KEEA 2A69C 3CCJA 5EGTA 1U4LA 1HRJA 3L3OC 4ULLA 5IT9E 1IKLA 1VQ4A 1LT5D 3ND8A 5KYIA 3NTHA 3HOZG 1M8AA 4DR5L 4QF4A 4PZ7A 1X9NA 4OXPA 4A3JB 3HOVG 3K5LA 2NYZD 5CMDA 5C44H 5JJLA 4X64Q 1DONA 1T5XD 5C4JB 2IL8A 2JE6I 1N32Q 4IUQA 1HUNA 1EWCA 3U9SA 2CWAA 2CQOA 3NUCA 1N36L 1AP0A 1XYIA 1S5FD 3GTKH 2RBMA 4IPCA 3J81c 1LTTD 4IOCA 4GS3A 4RGTA 4BY7H 1SE2A 4C56C 1HUMA 4ZYSA 1QUQB 4C1NK 3AFPA 3J7ZC 3D3RA 2E2IH 1EOVA 4UY8C 1PDQA 2EY6A 5IY0A 2JA6H 4JI7L 2VY3A 3W3AA 4DR7Q 1H9RA 4AYBB 4IFDG 3K57A 5C3XA 4KLKA 4ME3A 4V0BA 1XNRL 4A3BG 2QA4A 3S17H 4DUYL 1SYFA 3OHXC 2KCTA 5M5YB 2KECA 1H9KA 4DAPA 3H91A 4KJNA 4DXFA 3TP7A 4RGNA 3S14B 4EQNA 2RDFA 1A6XA 3I4NH 3ULLA 5C0XH 3AFQA 5GAEC 2VS1A 4LF6L 4A3EB 4OO1I 2RSOA 2UXCQ 4LAAA 2L55A 3I4MG 3BJUA 1LTBD 2A6HD 3J81L 4CDDC 1I4HA 1KNEA 1JOQA 2VZAA 2G9HD 4B3RQ 5FO9B 3KLRA 2PW5A 5T1GA 5FO7B 1HZCA 3EROA 3PUXA 4BBSB 3BYYB 1Y1WG 1HA5A 3GTMH 3GD7A 1N8RC 4JI3Q 3C46A 1CA5A 3J7AF 2QKIC 1ILPA 4AQYQ 1BCPC 4A3GG 1ZYRC 3CQZB 2I5HA 4H44C 5IP9H 2KHSA 1C48A 3J81j 5M3FG 2F0DA 2JSOA 4KY6A 3HS0C 3X3NA 1K28A 5DAUA 2GVAA 3BS1A 1R4QB 2KCMA 2VL6A 2JEAI 4MTNA 1BDOA 3E0JA 2ZTCA 2I5LX 4H0LC 3HOYH 5I4DA 3MFYA 1QJOA 5GAHC 2ZJPA 4DR3Q 2B2WA 2D0OA 1BO0A 1YNJC 2EOTA 2EYHA 2NVYH 1VF5C 2CW0C 4WRDA 3CCLA 3PO2B 2K32A 1IBLQ 3PMFA 4Y7NH 3JC66 1X3PA 3AU7A 3PUWA 1FNVA 1ILQA 3BVZA 1F2YA 2ENBA 3FP9A 4ZCKA 5JEAJ 4IUVA 2I46A 4MN3A 1E22A 2G5DA 1FYCA 3R3OA 1U4RA 3E9HA 1I50B 4NXML 1SYGA 3D0FA 5M5WH 5IYDG 2N88A 1NR2A 5BN5A 1EY4A 1CTMA 1V1QA 1P8LA 3FDTA 3GTGH 2G9DA 5CV8A 2WFWA 1EY9A 5JJZA 3MA2B 2QGQA 3DXJC 3HKSA 3TMEA 2JA7H 3QR8A 5E1FA 1N34Q 2B2TC 3FKIH 1SEBD 1TWGH 1Q90A 4N8X1 4FF3A 1ENCA 3IFTA 4JOIC 1KAWA 3G48A 2F3WA 1SAPA 3E3XA 4LWCA 1RL2A 2F0TA 2IT1A 4DV3Q 2JP1A 2ICEC 2JQOA 3UDGA 4OX9Q 4DV5L 1I4RA 5M3MB 2KQ3A 2NB0A 3A7LA 2Q8TA 5C3EH 1LACA 1GUWA 5ELFA 1QVCA 2EE1A 2D2CC 3M4YA 5FOBB 1SFOH 3T1HL 3A7AB 2Q2IA 1E2ZA 1E7ZA 1XTCD 4GKKQ 4FXKC 1KAAA 2K03A 4OGQC 1HNWQ 4AYBE 3HOUB 1KLGD 3S9WA 3NSWA 2PNHA 5EPLA 1VS0A 4XDXA 1HR0Q 2AUKA 4KD3A 3A0JA 1WTOA 1SYCA 3OIPA 2BDNA 5CYUA 3S1MH 4IOAA 1SNMA 3NBHB 3G4SA 3VYSA 1G291 1KABA 4XQNA 1QWYA 2HIXA 2WB1B 1WTVA 2F3VA 3J80E 4HJ8A 1QVGA 1TQOA 1EFWA 1VQDA 1EYAA 2VXWA 1EU3A 2DUDA 3M9BA 3R2IA 2R3ZA 4DAYB 2Y0SB 1T9HA 1UWVA 3C1FA 5FK9C 3RZDH 1PH3A 1ET6A 5C4XG 2WKCA 4DUZL 3K5NA 3AB9A 4A3KG 3C3LA 3TZUA 1EQRA 2PPBC 3PUZA 2L1BA 1Y69U 4ALPA 4RKBA 1IYVA 1DXMA 2OT2A 1RJTA 2RF4A 3OTOQ 1W6JA 3K7AH 3HOXG 3I56A 3HOWB 1ZKOA 5C0XI 5IIFA 2NVQB 3TS0A 2M9VA 1YEZA 2OWOA 3H0GB 4NXNL 1VQIA 4Q5VA 3KLSA 5IP7H 2HHHL 4KY7A 1U9RA 4WJWA 2K5HA 1DM0B 1UE5A 3CPWA 4YWLA 1UUPA 1C9OA 2XWJB 1FJGL 2JA7G 1PVOA 1VQCA 1PRTB 3EN2A 3NXWA 1STGA 2K75A 4KK7A 4ABNA 3ULPA 2RKSA 1VQLA 1PZID 4A3IB 1I6HB 4P72A 2DY8A 1NE3A 3FPPA 1MJCA 3DLLA 3HOZB 1PRTF 3NE5B 2F03A 3AYHB 3S1RB 2CFMA 1OXVA 3RNUA 2VQEQ 4DV2Q 3KUPA 4JC0A 3HOVB 3M3YH 1VQ8A 3U58A 4EQPA 1D1IA 2HD3A 2HCIA 1TT2A 5EPJA 2K6AA 4A3CH 1BNZA 2EDGA 4LFCL 3RD4A 2F0EA 4DK1A 1PTOH 1QILA 1SYEA 5LL6X 1TWCB 2EYFA 3BDCA 2B63G 1Q8IA 1Q86C 1NMGA 2UXDL 2XIWA 1VQMA 1G6PA 3VA7A 1ZEQX 1O7LA 4M1UB 1X54A 3CC7A 3RLNA 4DR1L 1L2FA 1M90C 2R7ZH 5J3BA 2F0UA 1D1KA 2KCNA 4LMQD 2L0CA 4YY3L 3A8KE 4GOPB 4P71A 2CHBD 2I0QA 4Q0FA 4LF9L 2YYZA 4BWGB 1VQEA 2J7ZA 3CCUA 4A3MH 1CZGA 4ZKCB 1A8VA 4R4TA 3B6YA 1SNPA 3D4RA 1FL0A 1J9OA 3CMAA 2LMCB 1N9WA 4P2CB 3A56A 3S1QB 3KF6B 4BY1H 1O7ZA 5G3LD 1Q82C 1YI2A 4WFN3 4A3FH 1VQKA 3RZOB 3I72A 1I94L 4U673 1EIHA 1RODA 1SYBA 1K8MA 2F0WA 3QG1A 3J7A5 2A5HA 2RDHA 2CKZB 4A3EG 4QMGA 1EWHA 2R7DA 3PGZA 3I4MB 4XYOA 3CCEA 5CV5A 2F52A 1HXYD 3TP5A 4JYAL 1LTRD 1AFPA 2CQAA 2F0LA 2PNRC 3BG3A 2D5DA 1STEA 1K0RA 1MJEA 2M2LA 4JI4Q 3GTQB 1SMYC 2K52A 4DV0Q 3NK9A 3X3MA 2VB2X 4F7XA 3U9OA 4KD4A 3K80C 1EEFD 2HIVA 4PMBA 1Y1WB 3UE0A 1NNXA 1PA6A 4RMFA 2Q8RE 1QG7A 4BBSG 3VA5A 2KBNA 3G71A 2E5LL 2Z6KC 2WB1E 2LFNA 4A3GB 1EWIA 1LT4D 5IGEA 1YIJA 4KHPL 5IWAL 2ZXOA 1RCVD 3VR4A 5M3FB 3OYYA 2EYOA 1E2WA 4X3SA 2WINB 4HMIA 1VQAA 4JV5Q 1GHKA 2E2JH 2A8VA 2H1EA 1E0BA 4B9WA 2XGTA 1BQQT 3CKIB 4OWTB 4BY7B 2K01A 5EAYA 1PRTC 4NB3A 1Z9FA 4JI7Q 1SN8A 2RCFA 4JCVE 5I6WA 1YJ9A 1F77A 3VR3A 1C7YA 2E2IB 2F0KA 2R61A 5EQ0A 1RF2D 2K5WA 1EY5A 1I3QB 3GV3A 5LMNQ 3A74A 1PYSB 3VR2A 3PUYA 4JI6Q 2RVLA 4DNIA 1XX8A 4GLAC 3ULJA 4EQ5A 5K5PA 1KDBA 4HCSA 3BYTB 1BVSA 4IJLA 2QEJC 1GM5A 2MNAA 1CHPD 4UP7A 2PQAA 4NDXA 1PFSA 2KEDA 1X3GA 1Y1VH 1EYGA 2NVTH 1CUKA 1DCZA 1BR9A 2JXMB 2BA1A 1X6OA 4PQXA 3E9IA 1YNXA 3MC0B 1VF7A 3R93A 3N6RA 2SNSA 4IJHA 4X65L 4GLVB 4P73A 3PV0A 4CJ0B 3HFZB 3TQYA 2CH4W 2N78A 1B8AA 1JOKA 4C3IH 1PYWD 3K5OA 4IN3A 4C1NI 1CSQA 3QOJA 4BXXH 4YWKA 1HA6A 5DNFA 5M3MG 3KYHC 2N8NA 1EZ8A 2ES2A 1HQRD 2VQFQ 5DM63 1OO9B 4X3UA 4H02A 4G7ZC 1LTAD 1AH9A 1JICA 3GTLH 2ZXPA 2SEBD 4Z9CB 1XMOL 1OXXK 3SHLA 4HAEA 4KHZA 4IUUA 2E75C 2BCOA 4E6IA 3CHBD 4LW1A 3NHHA 1V1PB 5L37A 3T1YQ 5JJIA 2NUCA 3DWQA 4K8JA 3PO3H 3URYA 1Q7YC 3J81i 2TSSA 3HOYB 2BH2A 2RDGA 4RKLA 1F2ZA 4GKJL 2NZ1D 3M7GA 2NVYB 2B2WC 2HUGA 1FNWA 3QWNA 1B3AA 2R92G 3FHWA 4XQQA 4LF8L 3HZXA 1EZ6A 5T1IA 4A3KB 2LXKA 4DV6Q 1LUZA 4XXEA 4O2DA 4KV6A 5C5MA 1SNCA 2HQEA 1CQVA 1ICFB 1X56A 4IUPA 3HOXB 5JPNC 1K83B 1H9SB 4OEMB 2UUCQ 1BCPB 1HFGA 4DFAA 1ASYA 3VR5A 4JVZA 4OO1G 5IYBH 2BE5D 4QY7A 4MNOA 2QILA 4DV1L 1Y8PB 1WTPA 5M5WB 4LF4Q 1I4XA 3PIPA 1WCMH 4DR2L 4JI8Q 3TP6A 3UDFA 5M5XH 1YNNC 3MWYW 4AIMA 5JAVA 4CDEC 1SNOA 4X3KA 3STBC 1S3OA 2UUBQ 2JA7B 5GADC 1HZ9A 1KNAA 1VQFA 2FMCA 1DD2A 1W2BA 3DMUA 4APVA 4A3IG 3O13A 4A3LH 1AEXA 3KDFB 4C3IG 1AZQA 2JA5H 3W1BA 1XPRA 1EEID 1FD7D 3SK8A 5ISRA 3DEPA 1BKBA 4CKCA 3KF8A 3T1HQ 2ZJRA 4CDFC 1CHQD 1SFOB 3NTKA 2B63B 2BOSA 2PW7A 1YBYA 3Q23A 3R8BA 1VQGA 1LM0A 5D14A 5FLXc 1EFID 2UXBL 1KTKA 2JN4A 3HRZC 1PLFA 4OHJA 2F0QA 3TS2A 4UAIA 4A93H 1IYJB 4JI2L 1JE5A 3RLFA 2EYJA 1MI2A 1F9QA 1EIYB 4N9PA 4TVAB 3MHBA 4YCVA 2HT1A 3OWFA 2F0OA 5M9OA 1IW7D 1YJWA 4HJ7A 1T5EA 1K3BC 3K59A 4TQUS 4KHVA 3KBGA 5IYCH 1D5MC 3MXGA 3LWEA 4B3ML 2GA4B 4LFAL 1LV9A 5FLMG 1Q8KA 3RZDB 3D8GA 5BN4A 2MQHA 1E2VA 1UAPA 2HDLA 3VYUA 4DV4Q 1B44D 1WJJA 5A2QL 1TR5A 4OONA 1UE7A 1NTGA 4HTHA 4DV7L 4CBVA 5IT9c 2K50A 5FLXL 1PFMA 4RCNA 5D3DA 2X6GA 3ND9A 4XIGS 1STNA 1Q81C 2B2VA 2K33A 2LXJA 5BN3A 5ELOA 1V43A 2AMCB 1D7QA 1FVIA 1PFNA 2QF7A 4DK0A 2IX0A 3PIOA 2EJFC 1D8LA 1S40A 3L2PA 1AN8A 1QVFA 1S5BD 2PYKA 3SK6A 4B3SQ 2R93G 4HIKA 2Q2HA 4CJ2C 1TVXA 1GUTA 4BA1I 1VQ6A 4LFBL 5EPKA 3FEWX 2EYPA 1A2TA 1LYLA 1R9TB 2AKWB 1PH6A 1CSPA 2GVBA 1BXTA 4KJOA 1G91A 5CGKA 1IXRA 1UEBA 2UXDQ 1ASZA 4B3TQ 1PTOB 1L0YB 4UP8A 5C44G 2F0FA 3PSIA 4O42A 4IUTA 5LMUL 2UUAL 4M8AA 4HR7B 4DR1Q 1PTOF 1RHPA 4I7AA 3V05A 2K05A 4ILWA 1NY4A 5IT9L 5IGGA 4A3DH 1R4PB 1KIXA 4PNYA 2R7ZB 4C2MB 4A75A 3SK5A 1PRTD 4BY7G 3K5MA 2B2YC 1JJ2A 3VYRA 4JI0Q 4DN4M 3SXHA 3TN2A 1LT6D 2B2UA 3J7YW 4GLXA 4J6HA 3S2DB 1ESRA 2E2HB 4B08A 2JA6G 4A3MB 2F0GA 1C0AA 5JVG3 1ML0D 1HZAA 3F2DA 4RGMA 1FGUA 3KJOA 2CH4A 3LWUA 5ELCA 1VQ5A 1IBKL 5GROA 3EFXD 3K58A 1E24A 4UP9A 5H1SE 4DPGA 1TS3A 3I4NG 1G2SA 4G4KA 1K8AC 4G7OC 5C0XG 4G57A 3E5SA 5D3IB 1VDZA 3BU2A 1J5EQ 1JB7A 4K2LA 1HNZL 3PQIA 4WORA 3VR6A 5EKKA 1DOLA 4K14A 1K9MC 1XNQQ 4KKUA 5BR8Q 3OSOA 3NPPA 4LF5Q 2F4VQ 3HKZB 3MEFA 3WOEA 4ME5A 4C3HH 1VQPA 3S16B 3W5OA 3MVVA 3GDEA 4R4OA 2KENA 1SXTA 3SK4A 4K0KL 4C3JH 4FF1A 2Z4HA 3I70A 5JEAH 4L5RC 2JYOA 5TSSA 5C3WA 4I65A 1K0SA 1TWAB 1DGSA 3A5ZB 2XWBB 1JMCA 3UDIA 1X65A 2OF1A 1KL9A 4L6TB 5A35A 4XT1B 3KLSX 1HNXQ 1HFNA 3J80i 4CJ1B 5IP9G 2ASBA 3W1GA 1LTLA 4YHHQ 2KA7A 2OQKA 4KN4C 5KNBA 3S15H 1HR0W 1TIID 5FJ8H 3DHQA 5JPMC 1L1OA 2IPKD 1IBMQ 1GD7A 3CCSA 3I8ZA 1AW7A 5IOCA 4X64L 3HOYG 1YHQA 2V4DA 2ZXRA 3D6WA 1N32L 4K8IA 1WD0A 3ERSX 2R92B 4TKOB 5K36H 5HURA 2VNUD 3H6MA 1V9PA 1A15A 1N33Q 4QL5A 1PXUA 2N55A 2EQSA 3NENA 2IWHA 2EPBA 5IODA 5E4XA 1JT8A 1PTOC 3FPUB 4KKTA 3Q22A 1PH7A 5JJKA 2Z1CA 4DR7L 4LNQA 4PZ8A 1O80A 3MXPA 4JI5Q 2JA8H 2KVMA 1Z7TA 1BBUA 2J0TD 4FO2A 5ELEA 3MAQA 3S14H 1D5ZC 1RIPA 2MJ8A 2DNCA 2FJ2A 1XMQQ 2CCZA 2R6GA 2OTJA 3STBD 1UE6A 1S72A 4QB4A 3FKIG 2A69D 2UXCL 3WWVA 5FO8B 1K73C 2A68C 4C3IB 3EJIA 4ZUIA 3LX0A 3MEHA 5F2DA 1BOSA 3OIQA 4JI1Q 3K0XA 5C3EG 1KLUD 1MHWC 4DK6C 1O78A 3J80c 1MKHA 3EBEA 5CR3A 4B3RL 4DKAC 3SEBA 5LHY1 4DR6Q 1SDFA 4IPDA 3L7ZC 4XTCS 3GO5A 1Q12A 3G6JB 4ZAIA 3CQZH 4JI3L 4V190 4GNXA 1CFMA 2J4XA 4MIUA 4AQYL 2ID0A 4OWWB 3PO3B 3OPOA 4DGZA 3I55A 2F0IA 3TSSA 3QOLA 3MXUA 1EYCA 1B50A 4DNTB 4DR4Q 2NVXH 4OWXB 3RLOA 1PYBA 1TXYA 4X66Q 4DA2A 2WAQB 1X3FA 3HKZE 1IL2A 3CP0A 2C35B 1K8OA 4DR3L 5AJ3Q 3OMCA 4RG1A 3PO2H 2SOBA 2K5DA 3HEJA 5I9PA 3GTOB 5IGFA 2X69A 1YHAA 1MSGA 3CW2C 2OQ0A 3J80L 4DV1Q 1IBLL 1ENFA 2LS01 1SNDA 1WTQA 3I2ZA 4FP5D 2IJ0A 4LF7Q 2JA8G 1LO5D 3NELA 1QUQA 2A74C 3BZDB 2OCEA 5IP7G 5KIXA 2PMZE 2XN9C 1VQHA 2R93B 1PH2A 4L5TA 3C2PA 1GUGA 1OXTA 4PV1C 2B8FA 5DLQE 2A6HC 2Q2TA 1IHZA 4RA8A 4DR5Q 5HY6A 4JBJA 1SNQA 4IPGA 3DEOA 4K5XA 1N34L 5ELNA 1Z6HA 3TRZA 1BCPD 3ER0A 1WFQA 1ZYRD 3Q24A 1Q1EA 1GUSA 3CCMA 1HH2P 1STAA 4CHTB 5C44B 4DV3L 2Z4IA 2VW9A 1SBBB 4OX9L 5KYLA 1N36Q 4A3CG 1U4MA 1YITA 2OTLA 3CU7A 1VQ9A 1PZKD 3GTKB 3T51B 2JK8A 4L8JA 4A93B 3HOUH 3Q8DA 2A73B 3CCVA 2BA0A 4GKKL 3L0OA 2A6EC 1HNWL 1IL8A 1YNJD 4NPSA 2R7ZG 2RHQB 2ZM6L 1DZ1A 4DAVA 3BDOA 2JA6B 1W6KA 4A76A 2CW0D 3SE0A 4HJAA 1G6ZA 1HR0L 3CPFA 3H3VH 4KMUC 1B70B 1XNRQ 4P75A 4POFA 4A3MG 4DUYQ 1WTXA 4FDBA 2F3IA 4JBKA 3HP3A 4IURA 1JE4A 5EKLA 3BVMA 4FYDA 1IYUA 3S17B 1EY0A 1MIUA 1Q3LA 5LMNW 3V96A 2AQ3B 4CGYB 2RHSB 3S1NH 2LKVA 1TY0A 4LF6Q 4UPAA 1LTID 1GKHA 4BY1G 3I4NB 4A3FG 3KBXA 1A3TA 1EY6A 4MZ9A 2P5ZX 3TDQA 2FXQA 1KDCA 5EJWA 4QUFA 3M4QA 1A63A 3JAMi 2MFIA 3VDYA 2B8GA 1WTHA 3HOWH 2AQ1B 1U5KA 2B2VC 3HKZG 2E2DC 2NVQH 1A3UA 1TU2B 3LGJA 1ESFA 2F0HA 1STBA 5JOBA 3H0GH 4S3SA 1JWMD 1NAPA 1VCIA 1STHA 1SE4A 2M00A 2A1AA 1TWFH 3GTMB 2L5TA 2F0SA 4A4IA 2BH8A 2HDMA 2MUYA 1BBWA 4IFDJ 1I6HH 2B3GA 2L12A 3HOZH 2F0MA 2ATWA 3S1RH 4K2KA 2CVRA 1KD1C 1XTDA 1XXGA 3HOVH 2WAQE 5GAGC 5LMUQ 1TS4A 4JBMA 3NWSA 1RDPD 2VQEL 4DV2L 1B9NA 2EIFA 1BF4A 3MFGA 2K28A 2L11A 3K8AA 4JK1C 3KJPA 2PI2A 1Q46A 4LK1C 3U4VA 4A3DB 2HQLA 3EIVA 2TMPA 1QB5D 1V1OA 1DOMA 2ZTEA 5G3LF 2F4IA 3K81C 1DJRD 5C5LA 1LTSD 2B2UC 4U68A 4XYQA 4Y7NB 3W2DA 1HZBA 5A2QE 4IZ8A 1NR4A 2JA9A 3ICEA 4IFDH 1JCKB 1FR3A 1CA6A 4NP5A 1PTOD 4NXMQ 1S5ED 1F9PA 4R4QA 1PV4A 3M7NA 3GV6A 5FLXE 4A3BH 4EGVA 4JPBW 3FMCA 4ZLTF 5C6AA 4OIJA 3J81E 1B7YB 2Q2UA 4LUZA 3RUZA 5J1ZA 1YZ6A 4PMCA 2KHIA 3S1QH 5DEHA 4CKEA 3JAMc 1ET9A 1Y1VG 3GTGB 5IGBA 1E1TA 1U4PA 1DYQA 3RZOH 4B9XA 3NBHA 2N3SA 4K5VA 3IAYA 2EY2A 3OOCA 2YV5A 3FKIB 1TWGB 5NUCA 2QDLA 3I4MH 1EYDA 4DV5Q 1WOCA 2K5NA 4MTKA 2C5CA 2FHTA 3SDZA 1XPOA 2KOLA 1PHJA 2O5IC 4R8IA 4DAYA 5C3EB 3CXCA 4JBWA 3GTQH 2OEOA 4QQBX 4C3JB 5LL6S 4BXXG 3IRBA 1AE2A 3NQTA 4F8MA 1SSOA 1TWHH 4DV0L 2K1BA 3CCQA 1EQTA 3UI2A 2Z6KA 1M4VA 3DWPA 4L5QA 2E76C 3E6ZX 4GN4B 1NJIC 4MHEA 2YTVA 4BBRH 1H9MA 4A3GH 2DJFC 1A0IA 1OXUA 2E8GA 3NQIA 4FVMA 4HEDA 1D5XC 4YIJA 4AH6A 5M3FH 2NWGA 3S1MB 3S15B 1JR0D 3JAML 1QNUA 2DNEA 1LABA 1SE8A 3I4LA 2KHJA 1QZGA 3G7LA 3PO3G 4LJZC 5C0XJ 4JV5L 1L1OC 5CC4A 3LNNA 2PZUA 4O0AA 1X3QA 3BZCA 1OTCA 3BVGA 1B9MA 2LY7A 1IZ6A 4DUZQ 1SYDA 1ONLA 1RD9D 5CBAE 3BDLA 3H3VI 1KHIA 4I7ZC 2IY5B 2WAQG 4F88A 4FNFA 1I3QH 1SE3A 3FVQA 1GO3E 1HTLD 1HPCA 1C8CA 1SROA 5ELDA 3P1HA 3GTPH 1S4ZA 3K7AB 1VMPA 3EA6A 3TBIB 4QGUA 5LMNL 2SNMA 4P74A 4NMZA 2JA8B 4IO9A 4NXNQ 3M4OH 5IYBG 4TRDA 3MTSA 4JI6L 3H09A 2HHHQ 1L0WA 5IYDH 5KRUA 1H95A 2O5JC 3CC4A 4HJ5A 1WCMG 2WV6D 5JVH3 1FJGQ 1SMYD 3PIP3 1A3VA 2ZT9C 3MXNA 1EIFA 1PH9A 4GOPA 2YU9H 1PZJD 5I6YA 1Z47A 2K7VA 1EU4A 3GTJH 2XRQD 4X62L 1AZPA 1CKNA 2Z0SA 1EUJA 3F2CA 1Y8NB 2Q8IB 2F0JA 3M3YB 1YVCA 4JG2A 4A3LG 4LFCQ 2AQ2B 3KF6A 2JA5G 1I6VC 3DUZA 4DF7A 1CKMA 1SRUA 2Z9HA 2VUMH 2Z6BA 4NKLA 1YJNA 1II3A 1ENAA 1WTRA 2MO1A 1NSNS 3D31A 3SR1A 3T4AC 5IE8A 2VQFL 1Q1BA 4BBRG 1U0LA 1EQQA 4YY3Q 2PQAB 3I73A 5C4HA 4A93G 1BUVT 1PH5A 3CD6A 4LF9Q 2A6ED 3ITPA 1JOOA 2BDOA 4XT3B 2RA4A 3UDXA 4GNXC 3V2TA 1TS5A 3DM1A 2XVSA 1EQVA 3I90A 1EOTA 2UU9L 2ICIA 3T1YL 2DJGC 1J6QA 2NVXB 1RTNA 3OW7A 3T53B 5IYCG 3WDNA 2O2LD 1B53A 1PH8A 4CKBA 2NN6H 4Y52H 1K8GA 1XJVA 4BY1B 1I94Q 4HIMA 2K5VA 2PZWA 4A3FB 5C4XH 4IFDI 1MBYA 3F2UA 4A3KH 3D4DA 4J15A 1B4OA 3QJYA 5KNDA 4JYAQ 4HMJA 4KN7C 3F1ZA 4DV6L 4DNRB 1WVLA 2EJMA 3BZKA 4K5WA 3S2HH 3P20A 3HOXH 5I2YA 1K83H 4RCOA 4K6LA 4ODGA 5J39A 2L9HA 2Z8LA 1RKNA 1W3SA 1X32A 1PH4A 1A62A 2DY7A 2UUCL 3AMUA 1A2UA 4LF4L 4IQZA 3EVQA 1QZHA 1S5CD 3KLWA 4JI8L 3A54A 2E5LQ 1JJGA 5CV9A 1HCZA 3Q0AA 1Y14B 3K7UC 3PIO3 4KHPQ 5IWAQ 3H94A 4H7BA 2UUBL 2X6LA 3A8JE 3PUVA 3KOJA 4CDCC 1X3EA 2EJGC 1Y8OB 2MO0A 2QCPX 5CORA 3NBIA 1NMFA 3F2BA 4ZRZA 2E2JB 1KQSA 2PMZB 4A3JH 3DM3A 2V1CC 5CV6A 2MP1A 4OIKA 3GP7A 2EXZA 3T56B 2VUMG 3CMEA 3QB3A 2B63H 2EYMA 5C4JH 2B29A 2I07B 4HCEA 3J7AV 3QIAA 3IL8A 2ZM6Q 1VQOA 1P16A 1NBWA 4A3DG 3M4PA 4QJFA 3OMGA 4ZUJA 3NTIA 4FXDA 2B39A 2WKDA 1LTGD 2H5XA 2HCCA 3M85A 2NZHA 1CI3M 3CRLC 4WJ4A 1B3QA 2KUMA 3MZ5A 3VYTA 2YTXA 2K14A 3S1NB 1XPUA 2NN6G 3S24A 3N52A 5M5YH 1Y1VB 3CAMA 4IUNA 4L63B 3KF8B 5E3FA 2NVTB 4R1JA 4RAUC 2ZTDA 3P7JA 4BA2I 5HGTA 1BBXC 3PCOB 4X65Q 1V1PA 1YNND 3EQLC 1EL0A 5EBDA 4DV4L 1WD1A 4A3EH 1EY8A 4DXGA 1FGBD 1VQNA 3TZDA 4IALA
chains in the Genus database with same CATH topology
3CRKC 2BE5C 4RHSA 4TSSA 1JWSD 4C3HG 2PO4A 2OXPA 1QNKA 1B2TA 1CZWA 3I3CA 3ERQA 4C3JG 1F2MA 1KDAA 1TWFB 2F0PA 5JEAG 1I4PA 3QO2A 4HN7A 5CV7A 3GTLB 4KI0A 1G8ZD 2L4NA 1H9SA 2NTSA 2QDBA 2SDFA 2MPMA 2NBFA 4OL7A 4X3TA 1MD2D 4H13C 1S5DD 5KEEA 4QIWB 1JB3A 2IX1A 2D62A 3D4WA 2JEBI 5IGDA 2MGSA 1GOZA 1HHVA 4J8QA 2VB3X 2B2YA 2MHVA 2EY5A 1F9RA 1PFBA 3SVMA 5K36G 1QOHA 4ZQ3A 2D9UA 1IW7C 1SJHD 4RHRA 4FF4A 2RSNA 1SJED 5EKIA 1I4GA 2NN6I 3ZYYX 1TY2A 1NCVA 3A55A 2PCFB 4A3BB 4N9TA 2K04A 5E4WC 1FNUA 3K6OA 2EVBA 3IFDA 1WCMB 1LLRD 3L9AX 2XSCA 5M5XB 3RMHA 4KTAA 4UDUC 1I4QA 2XNAC 4BS9A 3H3VC 4FF2A 2DN8A 2B2TA 5KNCA 1F2LA 3OWEB 2WIIB 1G2TA 1L0XB 3T16A 2AUJD 2JA5B 3C1EA 2EY1A 1ICWA 1JC7A 4XQJA 1XWEA 4R9WA 1CK1A 1TWHB 2F0NA 1MSHA 5C4ZA 5D65A 2AWOA 4BBRB 4G7HC 1EIGA 2NTTA 1GJXA 2WP8J 4ID6A 1RTOA 1C4QA 4KY5A 3D6CA 2F1MA 1B1ZA 3R2TA 3HGBA 2F0VA 1JQYD 2XRSD 5FKAC 1HTPA 1D2BA 4RWSC 1J8IA 4O1NA 4QCLA 4EQOA 1QCBD 1H9JA 5COYA 2PQEA 4ZK9B 1UEAB 1GXDC 3GTPB 1D6EC 2E74C 4OO1H 4FXGC 3M4OB 4NW2A 3DWAA 5IGCA 3TP8A 3NP8A 5EBCA 2YU9B 3GTJB 1EY7A 3GQBA 4R8NA 2C9OA 1PMRA 4QUCA 1F9SA 4DU9A 4HSVA 1VMCA 5ELBA 4RH6A 2FMMA 1GUOA 3JAME 2VUMB 1DOKA 2RQXA 1HQMC 3A8IE 3P75A 3WOFA 4J1MA 3KK7A 3I91A 1O7YA 1CQFA 2IW3A 4RGOS 5I2XA 5CV4A 5CBEE 4ZKBB 5DM73 2O4XA 3T13A 5KGUA 1GUNA 1STYA 2EZVA 1ZXTA 2K5QA 1TS2A 4EVOA 5I9OA 2H4OA 3IKJA 1CT1D 3NWTA 4KKSA 5C4XB 3Q6SA 2PZTA 4K6DA 3ONAB 4PMWA 2WACA 2IX3A 2FFKB 1JORA 2AWNA 1GHJA 1WTWA 1QE6A 1UNSA 5AFWA 3S2HB 3K0YA 1NUCA 5J22A 2FINB 1V8QA 2EYLA 1LT3D 4C3HB 4F87A 1BCPF 4GZYC 2A68D 4RFBA 4HSPA 1IKMA 3HG9A 1CM9A 1JWUD 2KJXA 1OXSC 3FRPB 2KCCA 1TKWB 1MGSA 2KEEA 2A69C 5EGTA 1U4LA 1HRJA 3L3OC 4ULLA 5IT9E 1IKLA 1LT5D 3ND8A 5KYIA 3NTHA 1M8AA 4QF4A 4A3JB 3K5LA 2NYZD 5CMDA 1DONA 1T5XD 5C4JB 2IL8A 2JE6I 4IUQA 1HUNA 1EWCA 3U9SA 3NUCA 1AP0A 1XYIA 1S5FD 2RBMA 1LTTD 4RGTA 1SE2A 4C56C 1HUMA 4ZYSA 4C1NK 3D3RA 1PDQA 2EY6A 3W3AA 1H9RA 4AYBB 4IFDG 3K57A 5C3XA 4V0BA 1SYFA 3OHXC 5M5YB 2KECA 1H9KA 4DAPA 3H91A 4KJNA 4DXFA 3TP7A 4RGNA 3S14B 4EQNA 2RDFA 1A6XA 5C0XH 4A3EB 4OO1I 2RSOA 4LAAA 2L55A 1LTBD 2A6HD 3J81L 1I4HA 1KNEA 1JOQA 2G9HD 5FO9B 3KLRA 2PW5A 5T1GA 5FO7B 3EROA 3PUXA 4BBSB 3BYYB 1HA5A 3GD7A 3C46A 1CA5A 3J7AF 2QKIC 1ILPA 1BCPC 1ZYRC 3CQZB 4H44C 2KHSA 1C48A 2F0DA 2JSOA 4KY6A 3HS0C 3X3NA 5DAUA 3BS1A 1R4QB 2JEAI 1BDOA 3E0JA 4H0LC 5I4DA 3MFYA 1QJOA 2B2WA 1BO0A 1YNJC 2EOTA 2EYHA 1VF5C 2CW0C 4WRDA 3PO2B 2K32A 3PMFA 1X3PA 3AU7A 3PUWA 1FNVA 1ILQA 3BVZA 1F2YA 2ENBA 5JEAJ 4IUVA 2I46A 4MN3A 1FYCA 3R3OA 1U4RA 1I50B 1SYGA 2N88A 1NR2A 5BN5A 1EY4A 1CTMA 3FDTA 2G9DA 5CV8A 1EY9A 5JJZA 3MA2B 3DXJC 3TMEA 5E1FA 2B2TC 1SEBD 1Q90A 4FF3A 1ENCA 3IFTA 2F3WA 1SAPA 2F0TA 2IT1A 2JP1A 2ICEC 1I4RA 5M3MB 2KQ3A 2NB0A 3A7LA 2Q8TA 1LACA 1GUWA 5ELFA 2EE1A 2D2CC 3M4YA 5FOBB 3A7AB 1E2ZA 1XTCD 4FXKC 1KAAA 2K03A 4OGQC 3HOUB 1KLGD 3S9WA 3NSWA 5EPLA 4XDXA 2AUKA 4KD3A 1WTOA 1SYCA 3OIPA 2BDNA 5CYUA 1SNMA 3VYSA 1G291 1KABA 4XQNA 1QWYA 2WB1B 1WTVA 2F3VA 3J80E 1TQOA 1EYAA 2VXWA 1EU3A 3R2IA 2R3ZA 2Y0SB 3C1FA 5FK9C 1ET6A 2WKCA 3K5NA 3AB9A 3C3LA 3TZUA 2PPBC 3PUZA 2L1BA 1Y69U 1IYVA 4RKBA 1DXMA 2OT2A 1RJTA 1W6JA 3HOWB 1ZKOA 5C0XI 5IIFA 2NVQB 2M9VA 3H0GB 4Q5VA 3KLSA 4KY7A 1U9RA 4WJWA 1DM0B 1UUPA 2XWJB 3NXWA 1PRTB 4KK7A 1STGA 4ABNA 2RKSA 1PZID 4A3IB 1I6HB 2DY8A 3FPPA 3HOZB 1PRTF 3NE5B 2F03A 3S1RB 1OXVA 3KUPA 3HOVB 4EQPA 1D1IA 2HCIA 1TT2A 5EPJA 2K6AA 1BNZA 2EDGA 3RD4A 2F0EA 4DK1A 1PTOH 1QILA 1SYEA 5LL6X 1TWCB 2EYFA 3BDCA 1Q8IA 2XIWA 3VA7A 1ZEQX 1O7LA 4M1UB 2F0UA 1D1KA 2KCNA 4LMQD 2L0CA 3A8KE 2CHBD 4Q0FA 2YYZA 4BWGB 2J7ZA 1CZGA 4ZKCB 1SNPA 3D4RA 1J9OA 2LMCB 4P2CB 3A56A 3S1QB 1O7ZA 5G3LD 4WFN3 3RZOB 3I72A 4U673 1EIHA 1RODA 1SYBA 1K8MA 2F0WA 3QG1A 2A5HA 2RDHA 4QMGA 1EWHA 3I4MB 4XYOA 5CV5A 3TP5A 1HXYD 1LTRD 1AFPA 2CQAA 2F0LA 2PNRC 3BG3A 2D5DA 1STEA 2M2LA 3GTQB 1SMYC 3NK9A 3X3MA 2VB2X 4F7XA 3U9OA 4KD4A 1EEFD 4PMBA 1Y1WB 2Q8RE 1QG7A 3VA5A 2LFNA 4A3GB 1LT4D 5IGEA 2ZXOA 1RCVD 3VR4A 5M3FB 2EYOA 1E2WA 4X3SA 2WINB 4HMIA 1GHKA 2H1EA 1E0BA 4B9WA 1BQQT 3CKIB 4BY7B 2K01A 1PRTC 5I6WA 2E2IB 1F77A 3VR3A 2F0KA 2R61A 5EQ0A 1RF2D 2K5WA 1EY5A 1I3QB 3GV3A 3VR2A 3PUYA 2RVLA 1XX8A 5K5PA 1KDBA 4HCSA 3BYTB 2QEJC 1CHPD 4NDXA 2KEDA 1DCZA 1BR9A 2JXMB 2BA1A 4PQXA 3MC0B 1VF7A 3R93A 3N6RA 2SNSA 3PV0A 4CJ0B 1JOKA 1PYWD 3K5OA 4IN3A 4C1NI 3QOJA 1HA6A 5DNFA 1EZ8A 1HQRD 5DM63 1OO9B 4X3UA 4G7ZC 1LTAD 1JICA 2ZXPA 2SEBD 4Z9CB 1OXXK 3SHLA 4HAEA 4KHZA 4IUUA 2E75C 2BCOA 4E6IA 3CHBD 3NHHA 1V1PB 2NUCA 3DWQA 4K8JA 3URYA 2TSSA 3HOYB 2RDGA 4RKLA 1F2ZA 2NZ1D 3M7GA 2NVYB 2B2WC 2HUGA 1FNWA 3QWNA 1B3AA 4XQQA 3HZXA 1EZ6A 5T1IA 4A3KB 4XXEA 4KV6A 5C5MA 1SNCA 2HQEA 1CQVA 4IUPA 3HOXB 5JPNC 1K83B 1H9SB 1BCPB 1HFGA 4DFAA 3VR5A 4OO1G 2BE5D 2QILA 1WTPA 1Y8PB 5M5WB 1I4XA 3TP6A 1YNNC 3MWYW 5JAVA 1SNOA 4X3KA 2JA7B 1KNAA 2FMCA 1DD2A 3DMUA 3O13A 1AEXA 4C3IG 1AZQA 1EEID 1FD7D 3SK8A 5ISRA 3DEPA 4CKCA 3KF8A 1CHQD 1SFOB 3NTKA 2B63B 2BOSA 2PW7A 3Q23A 3R8BA 5D14A 1EFID 1KTKA 3HRZC 1PLFA 4OHJA 2F0QA 4UAIA 3RLFA 2EYJA 1MI2A 1F9QA 4N9PA 3MHBA 3OWFA 2F0OA 5M9OA 1IW7D 1T5EA 3K59A 4TQUS 4KHVA 3KBGA 1D5MC 3MXGA 3LWEA 2GA4B 1LV9A 3RZDB 3D8GA 5BN4A 1E2VA 1UAPA 2HDLA 3VYUA 1B44D 5A2QL 1TR5A 4HTHA 4CBVA 5FLXL 1PFMA 4RCNA 5D3DA 2X6GA 3ND9A 4XIGS 1STNA 2B2VA 2K33A 5BN3A 1V43A 1PFNA 2QF7A 4DK0A 2IX0A 2EJFC 1AN8A 1S5BD 2PYKA 3SK6A 4CJ2C 1TVXA 1GUTA 4BA1I 5EPKA 3FEWX 2EYPA 1A2TA 1R9TB 1BXTA 4KJOA 1G91A 5CGKA 1PTOB 1L0YB 2F0FA 4O42A 4IUTA 4M8AA 4HR7B 1PTOF 1RHPA 3V05A 2K05A 4ILWA 5IT9L 5IGGA 1R4PB 4PNYA 2R7ZB 4C2MB 3SK5A 1PRTD 3K5MA 2B2YC 3VYRA 4DN4M 3SXHA 3TN2A 1LT6D 2B2UA 3J7YW 4J6HA 3S2DB 1ESRA 2E2HB 4B08A 4A3MB 2F0GA 5JVG3 1ML0D 4RGMA 3LWUA 5ELCA 3EFXD 3K58A 1TS3A 1G2SA 4G4KA 4G7OC 5C0XG 4G57A 3E5SA 5D3IB 1VDZA 4K2LA 4WORA 3VR6A 5EKKA 1DOLA 4K14A 4KKUA 3OSOA 3NPPA 3HKZB 3WOEA 4ME5A 3S16B 3MVVA 1SXTA 3SK4A 4FF1A 2Z4HA 3I70A 5JEAH 2JYOA 5TSSA 5C3WA 4I65A 1TWAB 2XWBB 2OF1A 4L6TB 5A35A 4XT1B 3KLSX 1HFNA 4CJ1B 2KA7A 4KN4C 5KNBA 1TIID 3DHQA 5JPMC 2IPKD 3I8ZA 1AW7A 5IOCA 2V4DA 2ZXRA 3D6WA 4K8IA 1WD0A 2R92B 4TKOB 5K36H 5HURA 2VNUD 3H6MA 1A15A 1PXUA 2N55A 2IWHA 2EPBA 5IODA 5E4XA 1PTOC 3FPUB 4KKTA 3Q22A 2Z1CA 1O80A 3MXPA 2KVMA 1Z7TA 2J0TD 4FO2A 5ELEA 3MAQA 1D5ZC 2MJ8A 2DNCA 2FJ2A 2R6GA 4QB4A 2A69D 5FO8B 2A68C 4C3IB 3EJIA 4ZUIA 3LX0A 3MEHA 5F2DA 1BOSA 3OIQA 1KLUD 1O78A 5CR3A 3SEBA 5LHY1 1SDFA 3L7ZC 4XTCS 3GO5A 1Q12A 3G6JB 4ZAIA 4V190 1CFMA 2J4XA 4MIUA 2ID0A 3PO3B 3OPOA 4DGZA 2F0IA 3TSSA 3QOLA 3MXUA 1EYCA 1B50A 4DNTB 4DA2A 2WAQB 1K8OA 3OMCA 2SOBA 2K5DA 3HEJA 5I9PA 3GTOB 5IGFA 2X69A 1MSGA 3J80L 1ENFA 2LS01 1SNDA 1WTQA 4FP5D 2IJ0A 1LO5D 2A74C 3BZDB 5KIXA 2XN9C 2R93B 3C2PA 1GUGA 1OXTA 4PV1C 2B8FA 2A6HC 1IHZA 4RA8A 1SNQA 3DEOA 4K5XA 1Z6HA 1BCPD 1ZYRD 3Q24A 1Q1EA 1GUSA 1STAA 4CHTB 5C44B 2Z4IA 1SBBB 5KYLA 1U4MA 3CU7A 1PZKD 3GTKB 3T51B 4L8JA 4A93B 2A73B 2BA0A 2A6EC 1IL8A 1YNJD 1DZ1A 4DAVA 3BDOA 2JA6B 1W6KA 2CW0D 3SE0A 1G6ZA 4KMUC 1WTXA 3HP3A 4IURA 1JE4A 5EKLA 3BVMA 4FYDA 1IYUA 3S17B 1EY0A 1Q3LA 3V96A 2AQ3B 4CGYB 2LKVA 1TY0A 1LTID 3I4NB 3KBXA 1A3TA 1EY6A 3TDQA 1KDCA 5EJWA 4QUFA 2B8GA 2AQ1B 2B2VC 2E2DC 1A3UA 1TU2B 1ESFA 2F0HA 1STBA 5JOBA 4S3SA 1JWMD 1NAPA 1VCIA 1STHA 1SE4A 2M00A 3GTMB 2L5TA 2F0SA 2HDMA 2MUYA 4IFDJ 2L12A 2F0MA 4K2KA 2CVRA 1XXGA 1TS4A 3NWSA 1RDPD 1B9NA 1BF4A 3MFGA 2K28A 2L11A 4JK1C 4LK1C 4A3DB 2TMPA 1QB5D 1V1OA 1DOMA 5G3LF 2F4IA 1DJRD 5C5LA 1LTSD 2B2UC 4U68A 4XYQA 4Y7NB 3W2DA 5A2QE 4IZ8A 1NR4A 4IFDH 1JCKB 1FR3A 1CA6A 4NP5A 1PTOD 1S5ED 1F9PA 3M7NA 3GV6A 5FLXE 4EGVA 3FMCA 4ZLTF 5C6AA 4OIJA 3J81E 3RUZA 5J1ZA 4PMCA 5DEHA 4CKEA 1ET9A 3GTGB 5IGBA 1U4PA 1DYQA 4B9XA 3NBHA 4K5VA 3IAYA 2EY2A 3OOCA 3FKIB 1TWGB 5NUCA 1EYDA 2C5CA 2FHTA 3SDZA 2KOLA 2O5IC 4R8IA 4DAYA 5C3EB 4JBWA 2OEOA 4C3JB 5LL6S 3NQTA 4F8MA 1SSOA 2K1BA 1EQTA 3UI2A 1M4VA 3DWPA 2E76C 3E6ZX 4MHEA 1H9MA 1OXUA 3NQIA 4FVMA 4HEDA 1D5XC 4YIJA 2NWGA 3S1MB 3S15B 1JR0D 3JAML 1QNUA 2DNEA 1LABA 3I4LA 3G7LA 4LJZC 5C0XJ 5CC4A 3LNNA 2PZUA 1X3QA 3BVGA 1B9MA 2LY7A 1SYDA 1ONLA 1RD9D 5CBAE 3BDLA 4I7ZC 4F88A 4FNFA 1SE3A 3FVQA 1HTLD 1HPCA 1C8CA 5ELDA 3P1HA 1S4ZA 3K7AB 1VMPA 3EA6A 3TBIB 2SNMA 4NMZA 2JA8B 4TRDA 3MTSA 3H09A 5KRUA 2O5JC 2WV6D 5JVH3 1SMYD 3PIP3 1A3VA 2ZT9C 3MXNA 1PZJD 5I6YA 1Z47A 2K7VA 1EU4A 2XRQD 1AZPA 1Y8NB 2Q8IB 2F0JA 3M3YB 2AQ2B 1I6VC 3DUZA 4DF7A 4NKLA 1II3A 1ENAA 1WTRA 1NSNS 3D31A 3SR1A 3T4AC 1Q1BA 5C4HA 3I73A 1BUVT 2A6ED 3ITPA 1JOOA 2BDOA 4XT3B 2RA4A 3V2TA 1TS5A 3DM1A 2XVSA 1EQVA 3I90A 1EOTA 2ICIA 2NVXB 1RTNA 3OW7A 3T53B 3WDNA 2O2LD 1B53A 4CKBA 2NN6H 4BY1B 2PZWA 4A3FB 4IFDI 1MBYA 3F2UA 3D4DA 1B4OA 3QJYA 5KNDA 4HMJA 4KN7C 4DNRB 1WVLA 2EJMA 4K5WA 3P20A 5I2YA 4RCOA 4K6LA 4ODGA 5J39A 2L9HA 2Z8LA 1RKNA 1X32A 2DY7A 3AMUA 1A2UA 4IQZA 3EVQA 1S5CD 3A54A 5CV9A 1HCZA 3Q0AA 3PIO3 3H94A 4H7BA 2X6LA 3A8JE 3PUVA 2EJGC 1Y8OB 2QCPX 5CORA 3NBIA 4ZRZA 2E2JB 2PMZB 5CV6A 2MP1A 4OIKA 3GP7A 2EXZA 3T56B 3QB3A 2EYMA 2I07B 4HCEA 3J7AV 3QIAA 3IL8A 3OMGA 4ZUJA 3NTIA 4FXDA 2B39A 2WKDA 1LTGD 2HCCA 3M85A 1CI3M 3CRLC 2KUMA 3MZ5A 3VYTA 3S1NB 2NN6G 3N52A 1Y1VB 4IUNA 4L63B 5E3FA 2NVTB 4RAUC 3P7JA 4BA2I 5HGTA 1BBXC 1V1PA 1YNND 3EQLC 1EL0A 5EBDA 1WD1A 1EY8A 4DXGA 1FGBD 3TZDA 4IALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SDF A;  2B2U C;  4U68 A;  1J9O A;  3MWY W;  1WVL A;  4HSV A;  2KED A;  2NYZ D;  1IL8 A;  1VMC A;  4X3K A;  5CMD A;  1DON A;  1DZ1 A;  2VXW A;  2FMM A;  2IL8 A;  4ZAI A;  1ICW A;  1O7Z A;  4IUQ A;  2R3Z A;  1C8C A;  1NR4 A;  1HUN A;  1DOK A;  2L9H A;  4CJ2 C;  1S4Z A;  1TVX A;  4R9W A;  1G6Z A;  1VMP A;  1AP0 A;  1QNK A;  1XYI A;  4XT1 B;  2B2W A;  1B2T A;  1X32 A;  1BO0 A;  1KNA A;  1MSH A;  2DY7 A;  2EOT A;  5EPK A;  5D65 A;  3I91 A;  1CA6 A;  1ROD A;  1EIH A;  1F9P A;  4CJ1 B;  3I3C A;  1HFN A;  3R93 A;  3GV6 A;  1WTX A;  1O7Y A;  3MTS A;  1HUM A;  4CJ0 B;  3HP3 A;  4IUR A;  1JE4 A;  4ZLT F;  1G91 A;  4OIJ A;  3QO2 A;  1Q3L A;  4ZKB B;  5CBE E;  1AZQ A;  1EIG A;  1X3P A;  1B50 A;  1PDQ A;  2L1B A;  3DEP A;  3I8Z A;  2L4N A;  1RJT A;  4O42 A;  4IUT A;  1ILQ A;  1HA6 A;  1U4P A;  1RTO A;  2X6L A;  1RHP A;  3D6W A;  4IUV A;  2SDF A;  2M2L A;  2MPM A;  4MN3 A;  5DNF A;  1WD0 A;  2K05 A;  3KBX A;  1AZP A;  1U4R A;  5D14 A;  4X3T A;  1PLF A;  1ZXT A;  4X3U A;  5COR A;  1A15 A;  5EJW A;  2B2Y C;  1JIC A;  4DN4 M;  3TN2 A;  2B2U A;  2KEC A;  2N88 A;  4UAI A;  4QUF A;  2N55 A;  1NR2 A;  2FHT A;  2X69 A;  1MSG A;  3H91 A;  2Q8R E;  2MP1 A;  2KOL A;  1QG7 A;  4HAE A;  4OIK A;  3FDT A;  1ESR A;  1MI2 A;  2MGS A;  1F9Q A;  4IUU A;  2EPB A;  4R8I A;  3Q6S A;  5E4X A;  5JJZ A;  1HHV A;  3FPU B;  1WTQ A;  2B2V C;  1ML0 D;  3ONA B;  4RWS C;  2B2Y A;  1J8I A;  2DY8 A;  3IL8 A;  2RSO A;  2B2T C;  2FFK B;  1SSO A;  1F9R A;  1PFB A;  1WTR A;  2K1B A;  1NAP A;  4X3S A;  3SVM A;  1EQT A;  3KUP A;  1O80 A;  3UI2 A;  2D9U A;  1QE6 A;  1SAP A;  5AFW A;  2KVM A;  5COY A;  1WTW A;  3LWE A;  2JP1 A;  2H1E A;  4ZK9 B;  1E0B A;  2HCI A;  2RSN A;  4MHE A;  1LV9 A;  2FIN B;  5EPJ A;  1BNZ A;  5EKI A;  2MJ8 A;  1KNE A;  2FJ2 A;  2Q8T A;  2NZ1 D;  2HDM A;  4XT3 B;  2HCC A;  2RA4 A;  1GUW A;  4HED A;  1NCV A;  4NW2 A;  1G2S A;  2HDL A;  2EE1 A;  2B2W C;  2K01 A;  2L12 A;  2HUG A;  2NWG A;  3DM1 A;  4RA8 A;  2XIW A;  5T1G A;  1IKM A;  1B3A A;  1CM9 A;  2CVR A;  3DEO A;  5T1I A;  2K04 A;  1EOT A;  3I90 A;  5E4W C;  2KUM A;  3IFD A;  2K03 A;  1DOL A;  3G7L A;  1RTN A;  5EPL A;  5EQ0 A;  4LMQ D;  4XDX A;  3N52 A;  1BF4 A;  1B53 A;  1CA5 A;  3GV3 A;  1PFM A;  2K28 A;  2L11 A;  1MGS A;  2KEE A;  2X6G A;  4IUP A;  1ILP A;  1U4M A;  1X3Q A;  1U4L A;  2B2V A;  4RAU C;  1WTO A;  3P7J A;  1HRJ A;  1HFG A;  1IKL A;  2BDN A;  2J7Z A;  1BBX C;  2RVL A;  4ZKC B;  1XX8 A;  2B2T A;  5CBA E;  3F2U A;  1WTP A;  1F2L A;  4QUC A;  1EL0 A;  1M8A A;  1WD1 A;  1F9S A;  1B4O A;  1DOM A;  4HCS A;  1PFN A;  2JYO A;  3TZD A;  1WTV A;  1G2T A; 
#chains in the Genus database with same CATH topology
 1X55 A;  3CRK C;  2BE5 C;  4IPH A;  3AQQ A;  4RHS A;  4TSS A;  2EXD A;  1JWS D;  4C3H G;  2PO4 A;  2OXP A;  5HGQ A;  1QNK A;  1WYD A;  1CKO A;  1B2T A;  1CZW A;  2R7F A;  3I3C A;  3ERQ A;  2RCN A;  4C3J G;  1F2M A;  1KDA A;  1TWF B;  1XMO Q;  2F0P A;  5JEA G;  1I4P A;  3QO2 A;  4HN7 A;  5CV7 A;  3GTL B;  4BBS H;  4KI0 A;  3TEH B;  4YCU A;  1G8Z D;  2L4N A;  1H9S A;  2NTS A;  1GVP A;  2QDB A;  1KRT A;  4B3S L;  2SDF A;  2MPM A;  1R9T H;  4YCW A;  2NBF A;  4OL7 A;  3OW2 A;  4X3T A;  1MD2 D;  1SR3 A;  2CWP A;  4H13 C;  3ZJY C;  3NEM A;  4HID A;  4A3J G;  1S5D D;  5KEE A;  2L15 A;  4QIW B;  1JB3 A;  2IX1 A;  2D62 A;  3D4W A;  4GKJ Q;  5FJ8 G;  2JEB I;  5IGD A;  2MGS A;  4B3T L;  1GOZ A;  1HHV A;  4J8Q A;  4LF8 Q;  2VB3 X;  2B2Y A;  2IHE A;  4GN3 B;  2MHV A;  2EY5 A;  1F9R A;  1PFB A;  2A19 A;  2GN5 A;  4C2M H;  3SVM A;  5K36 G;  1VQB A;  3KDF A;  1QOH A;  3MXN B;  1KRS A;  2D9U A;  4ZQ3 A;  1IW7 C;  1SJH D;  4RHR A;  4FF4 A;  4JI0 L;  4HJ9 A;  3S2D H;  2RSN A;  2E2H H;  1SJE D;  5EKI A;  1I4G A;  2NN6 I;  3ZYY X;  1TY2 A;  1CKN B;  1NCV A;  3A55 A;  2PCF B;  4A3B B;  2PI2 E;  4AYB G;  4N9T A;  4DR2 Q;  2K04 A;  5E4W C;  1FNU A;  4PZ6 A;  3K6O A;  5GQO A;  2EVB A;  3IFD A;  1WCM B;  5E7N A;  1I50 H;  1LLR D;  3L9A X;  2XSC A;  5M5X B;  3RMH A;  3E0E A;  4KTA A;  2LSS A;  4UDU C;  4WJ3 M;  3PF5 A;  1I4Q A;  2XNA C;  4BS9 A;  3H3V C;  4FF2 A;  2DN8 A;  3A5U A;  2B2T A;  5KNC A;  1F2L A;  2NZO A;  4JOI A;  3OWE B;  1J5E L;  2WII B;  1G2T A;  1L0X B;  1M1K C;  3RN2 A;  2JJQ A;  3T16 A;  2AUJ D;  1XNQ L;  5BR8 L;  3S16 H;  2JA5 B;  3C1E A;  3CC2 A;  4LF5 L;  2F4V L;  2EY1 A;  1ICW A;  3PF4 A;  1JC7 A;  5M3M H;  1O7I A;  4XQJ A;  1XWE A;  4R9W A;  1CK1 A;  1TWH B;  2F0N A;  2UXB Q;  1MSH A;  2AHO B;  5C4Z A;  5D65 A;  2AWO A;  4BBR B;  4JI2 Q;  4G7H C;  1TWA H;  4DAM A;  1EIG A;  2NTT A;  3G6E A;  1GJX A;  1KXL A;  2WP8 J;  3AEV A;  4ID6 A;  4L5S A;  4GN5 A;  1RTO A;  1C4Q A;  2Y0S E;  4KY5 A;  3TRE A;  3D6C A;  1HNX L;  2K4K A;  2F1M A;  4LUO A;  4B3M Q;  1B1Z A;  4N8F A;  3R2T A;  4LFA Q;  3HGB A;  4YHH L;  2F0V A;  1JQY D;  2XRS D;  5FKA C;  4LUV A;  3SGI A;  1IBM L;  1HTP A;  4PG3 A;  1I5F A;  1D2B A;  4RWS C;  2R92 H;  1J8I A;  4O1N A;  4QCL A;  4EQO A;  2ZJQ A;  3UE1 A;  2ALY B;  4DV7 Q;  4JW0 A;  1HJP A;  3PO2 G;  2I5M X;  1QCB D;  1H9J A;  5COY A;  2PQE A;  4ZK9 B;  1UEA B;  2YTY A;  1N33 L;  1GXD C;  3GTP B;  1D6E C;  1JJC B;  2E74 C;  4YWM A;  2D0P A;  4OO1 H;  4FXG C;  3M4O B;  4NW2 A;  1VQ7 A;  3DWA A;  1SLJ A;  5IGC A;  1E3P A;  3TP8 A;  3NP8 A;  5EBC A;  3OTO L;  4X62 Q;  2YU9 B;  4JI5 L;  4OEL B;  2XTI A;  1L1O B;  4GOP C;  3GTJ B;  1EY7 A;  3GQB A;  4R8N A;  4QIW E;  4LFB Q;  2C9O A;  1K3R A;  1PMR A;  1XMQ L;  1UE1 A;  4QUC A;  1F9S A;  4A3I H;  4DU9 A;  3U4Z A;  4HSV A;  1VMC A;  5ELB A;  4RH6 A;  2UUA Q;  1SMX A;  1PH1 A;  3KFU A;  2FMM A;  1GUO A;  3I7F A;  3JAM E;  2VUM B;  1DOK A;  2RQX A;  1HQM C;  3A8I E;  3P75 A;  3WOF A;  1KC8 C;  4J1M A;  3KK7 A;  4JI1 L;  3I91 A;  1TWC H;  1VQJ A;  1O7Y A;  1CQF A;  2IW3 A;  4RGO S;  5I2X A;  5CV4 A;  2QEX A;  3HOU G;  5CBE E;  4ZKB B;  5DM7 3;  4DR6 L;  2O4X A;  2UU9 Q;  3T13 A;  4DK3 C;  2DGY A;  5KGU A;  1AE3 A;  1GUN A;  1STY A;  2EZV A;  1IBK Q;  3RR5 A;  2QW7 A;  1ZXT A;  2K5Q A;  2WB1 G;  1TS2 A;  4EVO A;  5I9O A;  3H15 A;  2H4O A;  5FLM H;  3IKJ A;  4R4C A;  4R4I A;  2IHF A;  1CT1 D;  3NWT A;  4KKS A;  4HIO A;  5C4X B;  3Q6S A;  4DR4 L;  2PZT A;  4K6D A;  3ONA B;  4PMW A;  2Y0S G;  1HNZ Q;  4X66 L;  2WAC A;  3F8T A;  2IX3 A;  1WI5 A;  2FFK B;  1JOR A;  2AWN A;  1GHJ A;  1YHB A;  5AJ3 L;  3GTO H;  1WTW A;  1QE6 A;  1UNS A;  5AFW A;  3CCR A;  3S2H B;  3K0Y A;  1NUC A;  5J22 A;  3CF5 A;  2FIN B;  1G51 A;  1V8Q A;  2EYL A;  1LT3 D;  4C3H B;  4F87 A;  3RN5 A;  4K0K Q;  1BCP F;  4GZY C;  3HOW G;  2A68 D;  4GNX B;  3I4O A;  4RFB A;  4HSP A;  3U50 C;  1IKM A;  4UHV A;  3HG9 A;  1CM9 A;  1JWU D;  4POG A;  3H0G G;  4EX5 A;  4LF7 L;  1E1O A;  2N49 A;  2KJX A;  1OXS C;  4JI4 L;  3FRP B;  1Y1W H;  2R93 H;  2KCC A;  1TKW B;  4X6A H;  1MGS A;  2KEE A;  2A69 C;  3CCJ A;  5EGT A;  1U4L A;  1HRJ A;  3L3O C;  4ULL A;  5IT9 E;  1IKL A;  1VQ4 A;  1LT5 D;  3ND8 A;  5KYI A;  3NTH A;  3HOZ G;  1M8A A;  4DR5 L;  4QF4 A;  4PZ7 A;  1X9N A;  4OXP A;  4A3J B;  3HOV G;  3K5L A;  2NYZ D;  5CMD A;  5C44 H;  5JJL A;  4X64 Q;  1DON A;  1T5X D;  5C4J B;  2IL8 A;  2JE6 I;  1N32 Q;  4IUQ A;  1HUN A;  1EWC A;  3U9S A;  2CWA A;  2CQO A;  3NUC A;  1N36 L;  1AP0 A;  1XYI A;  1S5F D;  3GTK H;  2RBM A;  4IPC A;  3J81 c;  1LTT D;  4IOC A;  4GS3 A;  4RGT A;  4BY7 H;  1SE2 A;  4C56 C;  1HUM A;  4ZYS A;  1QUQ B;  4C1N K;  3AFP A;  3J7Z C;  3D3R A;  2E2I H;  1EOV A;  4UY8 C;  1PDQ A;  2EY6 A;  5IY0 A;  2JA6 H;  4JI7 L;  2VY3 A;  3W3A A;  4DR7 Q;  1H9R A;  4AYB B;  4IFD G;  3K57 A;  5C3X A;  4KLK A;  4ME3 A;  4V0B A;  1XNR L;  4A3B G;  2QA4 A;  3S17 H;  4DUY L;  1SYF A;  3OHX C;  2KCT A;  5M5Y B;  2KEC A;  1H9K A;  4DAP A;  3H91 A;  4KJN A;  4DXF A;  3TP7 A;  4RGN A;  3S14 B;  4EQN A;  2RDF A;  1A6X A;  3I4N H;  3ULL A;  5C0X H;  3AFQ A;  5GAE C;  2VS1 A;  4LF6 L;  4A3E B;  4OO1 I;  2RSO A;  2UXC Q;  4LAA A;  2L55 A;  3I4M G;  3BJU A;  1LTB D;  2A6H D;  3J81 L;  4CDD C;  1I4H A;  1KNE A;  1JOQ A;  2VZA A;  2G9H D;  4B3R Q;  5FO9 B;  3KLR A;  2PW5 A;  5T1G A;  5FO7 B;  1HZC A;  3ERO A;  3PUX A;  4BBS B;  3BYY B;  1Y1W G;  1HA5 A;  3GTM H;  3GD7 A;  1N8R C;  4JI3 Q;  3C46 A;  1CA5 A;  3J7A F;  2QKI C;  1ILP A;  4AQY Q;  1BCP C;  4A3G G;  1ZYR C;  3CQZ B;  2I5H A;  4H44 C;  5IP9 H;  2KHS A;  1C48 A;  3J81 j;  5M3F G;  2F0D A;  2JSO A;  4KY6 A;  3HS0 C;  3X3N A;  1K28 A;  5DAU A;  2GVA A;  3BS1 A;  1R4Q B;  2KCM A;  2VL6 A;  2JEA I;  4MTN A;  1BDO A;  3E0J A;  2ZTC A;  2I5L X;  4H0L C;  3HOY H;  5I4D A;  3MFY A;  1QJO A;  5GAH C;  2ZJP A;  4DR3 Q;  2B2W A;  2D0O A;  1BO0 A;  1YNJ C;  2EOT A;  2EYH A;  2NVY H;  1VF5 C;  2CW0 C;  4WRD A;  3CCL A;  3PO2 B;  2K32 A;  1IBL Q;  3PMF A;  4Y7N H;  3JC6 6;  1X3P A;  3AU7 A;  3PUW A;  1FNV A;  1ILQ A;  3BVZ A;  1F2Y A;  2ENB A;  3FP9 A;  4ZCK A;  5JEA J;  4IUV A;  2I46 A;  4MN3 A;  1E22 A;  2G5D A;  1FYC A;  3R3O A;  1U4R A;  3E9H A;  1I50 B;  4NXM L;  1SYG A;  3D0F A;  5M5W H;  5IYD G;  2N88 A;  1NR2 A;  5BN5 A;  1EY4 A;  1CTM A;  1V1Q A;  1P8L A;  3FDT A;  3GTG H;  2G9D A;  5CV8 A;  2WFW A;  1EY9 A;  5JJZ A;  3MA2 B;  2QGQ A;  3DXJ C;  3HKS A;  3TME A;  2JA7 H;  3QR8 A;  5E1F A;  1N34 Q;  2B2T C;  3FKI H;  1SEB D;  1TWG H;  1Q90 A;  4N8X 1;  4FF3 A;  1ENC A;  3IFT A;  4JOI C;  1KAW A;  3G48 A;  2F3W A;  1SAP A;  3E3X A;  4LWC A;  1RL2 A;  2F0T A;  2IT1 A;  4DV3 Q;  2JP1 A;  2ICE C;  2JQO A;  3UDG A;  4OX9 Q;  4DV5 L;  1I4R A;  5M3M B;  2KQ3 A;  2NB0 A;  3A7L A;  2Q8T A;  5C3E H;  1LAC A;  1GUW A;  5ELF A;  1QVC A;  2EE1 A;  2D2C C;  3M4Y A;  5FOB B;  1SFO H;  3T1H L;  3A7A B;  2Q2I A;  1E2Z A;  1E7Z A;  1XTC D;  4GKK Q;  4FXK C;  1KAA A;  2K03 A;  4OGQ C;  1HNW Q;  4AYB E;  3HOU B;  1KLG D;  3S9W A;  3NSW A;  2PNH A;  5EPL A;  1VS0 A;  4XDX A;  1HR0 Q;  2AUK A;  4KD3 A;  3A0J A;  1WTO A;  1SYC A;  3OIP A;  2BDN A;  5CYU A;  3S1M H;  4IOA A;  1SNM A;  3NBH B;  3G4S A;  3VYS A;  1G29 1;  1KAB A;  4XQN A;  1QWY A;  2HIX A;  2WB1 B;  1WTV A;  2F3V A;  3J80 E;  4HJ8 A;  1QVG A;  1TQO A;  1EFW A;  1VQD A;  1EYA A;  2VXW A;  1EU3 A;  2DUD A;  3M9B A;  3R2I A;  2R3Z A;  4DAY B;  2Y0S B;  1T9H A;  1UWV A;  3C1F A;  5FK9 C;  3RZD H;  1PH3 A;  1ET6 A;  5C4X G;  2WKC A;  4DUZ L;  3K5N A;  3AB9 A;  4A3K G;  3C3L A;  3TZU A;  1EQR A;  2PPB C;  3PUZ A;  2L1B A;  1Y69 U;  4ALP A;  4RKB A;  1IYV A;  1DXM A;  2OT2 A;  1RJT A;  2RF4 A;  3OTO Q;  1W6J A;  3K7A H;  3HOX G;  3I56 A;  3HOW B;  1ZKO A;  5C0X I;  5IIF A;  2NVQ B;  3TS0 A;  2M9V A;  1YEZ A;  2OWO A;  3H0G B;  4NXN L;  1VQI A;  4Q5V A;  3KLS A;  5IP7 H;  2HHH L;  4KY7 A;  1U9R A;  4WJW A;  2K5H A;  1DM0 B;  1UE5 A;  3CPW A;  4YWL A;  1UUP A;  1C9O A;  2XWJ B;  1FJG L;  2JA7 G;  1PVO A;  1VQC A;  1PRT B;  3EN2 A;  3NXW A;  1STG A;  2K75 A;  4KK7 A;  4ABN A;  3ULP A;  2RKS A;  1VQL A;  1PZI D;  4A3I B;  1I6H B;  4P72 A;  2DY8 A;  1NE3 A;  3FPP A;  1MJC A;  3DLL A;  3HOZ B;  1PRT F;  3NE5 B;  2F03 A;  3AYH B;  3S1R B;  2CFM A;  1OXV A;  3RNU A;  2VQE Q;  4DV2 Q;  3KUP A;  4JC0 A;  3HOV B;  3M3Y H;  1VQ8 A;  3U58 A;  4EQP A;  1D1I A;  2HD3 A;  2HCI A;  1TT2 A;  5EPJ A;  2K6A A;  4A3C H;  1BNZ A;  2EDG A;  4LFC L;  3RD4 A;  2F0E A;  4DK1 A;  1PTO H;  1QIL A;  1SYE A;  5LL6 X;  1TWC B;  2EYF A;  3BDC A;  2B63 G;  1Q8I A;  1Q86 C;  1NMG A;  2UXD L;  2XIW A;  1VQM A;  1G6P A;  3VA7 A;  1ZEQ X;  1O7L A;  4M1U B;  1X54 A;  3CC7 A;  3RLN A;  4DR1 L;  1L2F A;  1M90 C;  2R7Z H;  5J3B A;  2F0U A;  1D1K A;  2KCN A;  4LMQ D;  2L0C A;  4YY3 L;  3A8K E;  4GOP B;  4P71 A;  2CHB D;  2I0Q A;  4Q0F A;  4LF9 L;  2YYZ A;  4BWG B;  1VQE A;  2J7Z A;  3CCU A;  4A3M H;  1CZG A;  4ZKC B;  1A8V A;  4R4T A;  3B6Y A;  1SNP A;  3D4R A;  1FL0 A;  1J9O A;  3CMA A;  2LMC B;  1N9W A;  4P2C B;  3A56 A;  3S1Q B;  3KF6 B;  4BY1 H;  1O7Z A;  5G3L D;  1Q82 C;  1YI2 A;  4WFN 3;  4A3F H;  1VQK A;  3RZO B;  3I72 A;  1I94 L;  4U67 3;  1EIH A;  1ROD A;  1SYB A;  1K8M A;  2F0W A;  3QG1 A;  3J7A 5;  2A5H A;  2RDH A;  2CKZ B;  4A3E G;  4QMG A;  1EWH A;  2R7D A;  3PGZ A;  3I4M B;  4XYO A;  3CCE A;  5CV5 A;  2F52 A;  1HXY D;  3TP5 A;  4JYA L;  1LTR D;  1AFP A;  2CQA A;  2F0L A;  2PNR C;  3BG3 A;  2D5D A;  1STE A;  1K0R A;  1MJE A;  2M2L A;  4JI4 Q;  3GTQ B;  1SMY C;  2K52 A;  4DV0 Q;  3NK9 A;  3X3M A;  2VB2 X;  4F7X A;  3U9O A;  4KD4 A;  3K80 C;  1EEF D;  2HIV A;  4PMB A;  1Y1W B;  3UE0 A;  1NNX A;  1PA6 A;  4RMF A;  2Q8R E;  1QG7 A;  4BBS G;  3VA5 A;  2KBN A;  3G71 A;  2E5L L;  2Z6K C;  2WB1 E;  2LFN A;  4A3G B;  1EWI A;  1LT4 D;  5IGE A;  1YIJ A;  4KHP L;  5IWA L;  2ZXO A;  1RCV D;  3VR4 A;  5M3F B;  3OYY A;  2EYO A;  1E2W A;  4X3S A;  2WIN B;  4HMI A;  1VQA A;  4JV5 Q;  1GHK A;  2E2J H;  2A8V A;  2H1E A;  1E0B A;  4B9W A;  2XGT A;  1BQQ T;  3CKI B;  4OWT B;  4BY7 B;  2K01 A;  5EAY A;  1PRT C;  4NB3 A;  1Z9F A;  4JI7 Q;  1SN8 A;  2RCF A;  4JCV E;  5I6W A;  1YJ9 A;  1F77 A;  3VR3 A;  1C7Y A;  2E2I B;  2F0K A;  2R61 A;  5EQ0 A;  1RF2 D;  2K5W A;  1EY5 A;  1I3Q B;  3GV3 A;  5LMN Q;  3A74 A;  1PYS B;  3VR2 A;  3PUY A;  4JI6 Q;  2RVL A;  4DNI A;  1XX8 A;  4GLA C;  3ULJ A;  4EQ5 A;  5K5P A;  1KDB A;  4HCS A;  3BYT B;  1BVS A;  4IJL A;  2QEJ C;  1GM5 A;  2MNA A;  1CHP D;  4UP7 A;  2PQA A;  4NDX A;  1PFS A;  2KED A;  1X3G A;  1Y1V H;  1EYG A;  2NVT H;  1CUK A;  1DCZ A;  1BR9 A;  2JXM B;  2BA1 A;  1X6O A;  4PQX A;  3E9I A;  1YNX A;  3MC0 B;  1VF7 A;  3R93 A;  3N6R A;  2SNS A;  4IJH A;  4X65 L;  4GLV B;  4P73 A;  3PV0 A;  4CJ0 B;  3HFZ B;  3TQY A;  2CH4 W;  2N78 A;  1B8A A;  1JOK A;  4C3I H;  1PYW D;  3K5O A;  4IN3 A;  4C1N I;  1CSQ A;  3QOJ A;  4BXX H;  4YWK A;  1HA6 A;  5DNF A;  5M3M G;  3KYH C;  2N8N A;  1EZ8 A;  2ES2 A;  1HQR D;  2VQF Q;  5DM6 3;  1OO9 B;  4X3U A;  4H02 A;  4G7Z C;  1LTA D;  1AH9 A;  1JIC A;  3GTL H;  2ZXP A;  2SEB D;  4Z9C B;  1XMO L;  1OXX K;  3SHL A;  4HAE A;  4KHZ A;  4IUU A;  2E75 C;  2BCO A;  4E6I A;  3CHB D;  4LW1 A;  3NHH A;  1V1P B;  5L37 A;  3T1Y Q;  5JJI A;  2NUC A;  3DWQ A;  4K8J A;  3PO3 H;  3URY A;  1Q7Y C;  3J81 i;  2TSS A;  3HOY B;  2BH2 A;  2RDG A;  4RKL A;  1F2Z A;  4GKJ L;  2NZ1 D;  3M7G A;  2NVY B;  2B2W C;  2HUG A;  1FNW A;  3QWN A;  1B3A A;  2R92 G;  3FHW A;  4XQQ A;  4LF8 L;  3HZX A;  1EZ6 A;  5T1I A;  4A3K B;  2LXK A;  4DV6 Q;  1LUZ A;  4XXE A;  4O2D A;  4KV6 A;  5C5M A;  1SNC A;  2HQE A;  1CQV A;  1ICF B;  1X56 A;  4IUP A;  3HOX B;  5JPN C;  1K83 B;  1H9S B;  4OEM B;  2UUC Q;  1BCP B;  1HFG A;  4DFA A;  1ASY A;  3VR5 A;  4JVZ A;  4OO1 G;  5IYB H;  2BE5 D;  4QY7 A;  4MNO A;  2QIL A;  4DV1 L;  1Y8P B;  1WTP A;  5M5W B;  4LF4 Q;  1I4X A;  3PIP A;  1WCM H;  4DR2 L;  4JI8 Q;  3TP6 A;  3UDF A;  5M5X H;  1YNN C;  3MWY W;  4AIM A;  5JAV A;  4CDE C;  1SNO A;  4X3K A;  3STB C;  1S3O A;  2UUB Q;  2JA7 B;  5GAD C;  1HZ9 A;  1KNA A;  1VQF A;  2FMC A;  1DD2 A;  1W2B A;  3DMU A;  4APV A;  4A3I G;  3O13 A;  4A3L H;  1AEX A;  3KDF B;  4C3I G;  1AZQ A;  2JA5 H;  3W1B A;  1XPR A;  1EEI D;  1FD7 D;  3SK8 A;  5ISR A;  3DEP A;  1BKB A;  4CKC A;  3KF8 A;  3T1H Q;  2ZJR A;  4CDF C;  1CHQ D;  1SFO B;  3NTK A;  2B63 B;  2BOS A;  2PW7 A;  1YBY A;  3Q23 A;  3R8B A;  1VQG A;  1LM0 A;  5D14 A;  5FLX c;  1EFI D;  2UXB L;  1KTK A;  2JN4 A;  3HRZ C;  1PLF A;  4OHJ A;  2F0Q A;  3TS2 A;  4UAI A;  4A93 H;  1IYJ B;  4JI2 L;  1JE5 A;  3RLF A;  2EYJ A;  1MI2 A;  1F9Q A;  1EIY B;  4N9P A;  4TVA B;  3MHB A;  4YCV A;  2HT1 A;  3OWF A;  2F0O A;  5M9O A;  1IW7 D;  1YJW A;  4HJ7 A;  1T5E A;  1K3B C;  3K59 A;  4TQU S;  4KHV A;  3KBG A;  5IYC H;  1D5M C;  3MXG A;  3LWE A;  4B3M L;  2GA4 B;  4LFA L;  1LV9 A;  5FLM G;  1Q8K A;  3RZD B;  3D8G A;  5BN4 A;  2MQH A;  1E2V A;  1UAP A;  2HDL A;  3VYU A;  4DV4 Q;  1B44 D;  1WJJ A;  5A2Q L;  1TR5 A;  4OON A;  1UE7 A;  1NTG A;  4HTH A;  4DV7 L;  4CBV A;  5IT9 c;  2K50 A;  5FLX L;  1PFM A;  4RCN A;  5D3D A;  2X6G A;  3ND9 A;  4XIG S;  1STN A;  1Q81 C;  2B2V A;  2K33 A;  2LXJ A;  5BN3 A;  5ELO A;  1V43 A;  2AMC B;  1D7Q A;  1FVI A;  1PFN A;  2QF7 A;  4DK0 A;  2IX0 A;  3PIO A;  2EJF C;  1D8L A;  1S40 A;  3L2P A;  1AN8 A;  1QVF A;  1S5B D;  2PYK A;  3SK6 A;  4B3S Q;  2R93 G;  4HIK A;  2Q2H A;  4CJ2 C;  1TVX A;  1GUT A;  4BA1 I;  1VQ6 A;  4LFB L;  5EPK A;  3FEW X;  2EYP A;  1A2T A;  1LYL A;  1R9T B;  2AKW B;  1PH6 A;  1CSP A;  2GVB A;  1BXT A;  4KJO A;  1G91 A;  5CGK A;  1IXR A;  1UEB A;  2UXD Q;  1ASZ A;  4B3T Q;  1PTO B;  1L0Y B;  4UP8 A;  5C44 G;  2F0F A;  3PSI A;  4O42 A;  4IUT A;  5LMU L;  2UUA L;  4M8A A;  4HR7 B;  4DR1 Q;  1PTO F;  1RHP A;  4I7A A;  3V05 A;  2K05 A;  4ILW A;  1NY4 A;  5IT9 L;  5IGG A;  4A3D H;  1R4P B;  1KIX A;  4PNY A;  2R7Z B;  4C2M B;  4A75 A;  3SK5 A;  1PRT D;  4BY7 G;  3K5M A;  2B2Y C;  1JJ2 A;  3VYR A;  4JI0 Q;  4DN4 M;  3SXH A;  3TN2 A;  1LT6 D;  2B2U A;  3J7Y W;  4GLX A;  4J6H A;  3S2D B;  1ESR A;  2E2H B;  4B08 A;  2JA6 G;  4A3M B;  2F0G A;  1C0A A;  5JVG 3;  1ML0 D;  1HZA A;  3F2D A;  4RGM A;  1FGU A;  3KJO A;  2CH4 A;  3LWU A;  5ELC A;  1VQ5 A;  1IBK L;  5GRO A;  3EFX D;  3K58 A;  1E24 A;  4UP9 A;  5H1S E;  4DPG A;  1TS3 A;  3I4N G;  1G2S A;  4G4K A;  1K8A C;  4G7O C;  5C0X G;  4G57 A;  3E5S A;  5D3I B;  1VDZ A;  3BU2 A;  1J5E Q;  1JB7 A;  4K2L A;  1HNZ L;  3PQI A;  4WOR A;  3VR6 A;  5EKK A;  1DOL A;  4K14 A;  1K9M C;  1XNQ Q;  4KKU A;  5BR8 Q;  3OSO A;  3NPP A;  4LF5 Q;  2F4V Q;  3HKZ B;  3MEF A;  3WOE A;  4ME5 A;  4C3H H;  1VQP A;  3S16 B;  3W5O A;  3MVV A;  3GDE A;  4R4O A;  2KEN A;  1SXT A;  3SK4 A;  4K0K L;  4C3J H;  4FF1 A;  2Z4H A;  3I70 A;  5JEA H;  4L5R C;  2JYO A;  5TSS A;  5C3W A;  4I65 A;  1K0S A;  1TWA B;  1DGS A;  3A5Z B;  2XWB B;  1JMC A;  3UDI A;  1X65 A;  2OF1 A;  1KL9 A;  4L6T B;  5A35 A;  4XT1 B;  3KLS X;  1HNX Q;  1HFN A;  3J80 i;  4CJ1 B;  5IP9 G;  2ASB A;  3W1G A;  1LTL A;  4YHH Q;  2KA7 A;  2OQK A;  4KN4 C;  5KNB A;  3S15 H;  1HR0 W;  1TII D;  5FJ8 H;  3DHQ A;  5JPM C;  1L1O A;  2IPK D;  1IBM Q;  1GD7 A;  3CCS A;  3I8Z A;  1AW7 A;  5IOC A;  4X64 L;  3HOY G;  1YHQ A;  2V4D A;  2ZXR A;  3D6W A;  1N32 L;  4K8I A;  1WD0 A;  3ERS X;  2R92 B;  4TKO B;  5K36 H;  5HUR A;  2VNU D;  3H6M A;  1V9P A;  1A15 A;  1N33 Q;  4QL5 A;  1PXU A;  2N55 A;  2EQS A;  3NEN A;  2IWH A;  2EPB A;  5IOD A;  5E4X A;  1JT8 A;  1PTO C;  3FPU B;  4KKT A;  3Q22 A;  1PH7 A;  5JJK A;  2Z1C A;  4DR7 L;  4LNQ A;  4PZ8 A;  1O80 A;  3MXP A;  4JI5 Q;  2JA8 H;  2KVM A;  1Z7T A;  1BBU A;  2J0T D;  4FO2 A;  5ELE A;  3MAQ A;  3S14 H;  1D5Z C;  1RIP A;  2MJ8 A;  2DNC A;  2FJ2 A;  1XMQ Q;  2CCZ A;  2R6G A;  2OTJ A;  3STB D;  1UE6 A;  1S72 A;  4QB4 A;  3FKI G;  2A69 D;  2UXC L;  3WWV A;  5FO8 B;  1K73 C;  2A68 C;  4C3I B;  3EJI A;  4ZUI A;  3LX0 A;  3MEH A;  5F2D A;  1BOS A;  3OIQ A;  4JI1 Q;  3K0X A;  5C3E G;  1KLU D;  1MHW C;  4DK6 C;  1O78 A;  3J80 c;  1MKH A;  3EBE A;  5CR3 A;  4B3R L;  4DKA C;  3SEB A;  5LHY 1;  4DR6 Q;  1SDF A;  4IPD A;  3L7Z C;  4XTC S;  3GO5 A;  1Q12 A;  3G6J B;  4ZAI A;  3CQZ H;  4JI3 L;  4V19 0;  4GNX A;  1CFM A;  2J4X A;  4MIU A;  4AQY L;  2ID0 A;  4OWW B;  3PO3 B;  3OPO A;  4DGZ A;  3I55 A;  2F0I A;  3TSS A;  3QOL A;  3MXU A;  1EYC A;  1B50 A;  4DNT B;  4DR4 Q;  2NVX H;  4OWX B;  3RLO A;  1PYB A;  1TXY A;  4X66 Q;  4DA2 A;  2WAQ B;  1X3F A;  3HKZ E;  1IL2 A;  3CP0 A;  2C35 B;  1K8O A;  4DR3 L;  5AJ3 Q;  3OMC A;  4RG1 A;  3PO2 H;  2SOB A;  2K5D A;  3HEJ A;  5I9P A;  3GTO B;  5IGF A;  2X69 A;  1YHA A;  1MSG A;  3CW2 C;  2OQ0 A;  3J80 L;  4DV1 Q;  1IBL L;  1ENF A;  2LS0 1;  1SND A;  1WTQ A;  3I2Z A;  4FP5 D;  2IJ0 A;  4LF7 Q;  2JA8 G;  1LO5 D;  3NEL A;  1QUQ A;  2A74 C;  3BZD B;  2OCE A;  5IP7 G;  5KIX A;  2PMZ E;  2XN9 C;  1VQH A;  2R93 B;  1PH2 A;  4L5T A;  3C2P A;  1GUG A;  1OXT A;  4PV1 C;  2B8F A;  5DLQ E;  2A6H C;  2Q2T A;  1IHZ A;  4RA8 A;  4DR5 Q;  5HY6 A;  4JBJ A;  1SNQ A;  4IPG A;  3DEO A;  4K5X A;  1N34 L;  5ELN A;  1Z6H A;  3TRZ A;  1BCP D;  3ER0 A;  1WFQ A;  1ZYR D;  3Q24 A;  1Q1E A;  1GUS A;  3CCM A;  1HH2 P;  1STA A;  4CHT B;  5C44 B;  4DV3 L;  2Z4I A;  2VW9 A;  1SBB B;  4OX9 L;  5KYL A;  1N36 Q;  4A3C G;  1U4M A;  1YIT A;  2OTL A;  3CU7 A;  1VQ9 A;  1PZK D;  3GTK B;  3T51 B;  2JK8 A;  4L8J A;  4A93 B;  3HOU H;  3Q8D A;  2A73 B;  3CCV A;  2BA0 A;  4GKK L;  3L0O A;  2A6E C;  1HNW L;  1IL8 A;  1YNJ D;  4NPS A;  2R7Z G;  2RHQ B;  2ZM6 L;  1DZ1 A;  4DAV A;  3BDO A;  2JA6 B;  1W6K A;  4A76 A;  2CW0 D;  3SE0 A;  4HJA A;  1G6Z A;  1HR0 L;  3CPF A;  3H3V H;  4KMU C;  1B70 B;  1XNR Q;  4P75 A;  4POF A;  4A3M G;  4DUY Q;  1WTX A;  4FDB A;  2F3I A;  4JBK A;  3HP3 A;  4IUR A;  1JE4 A;  5EKL A;  3BVM A;  4FYD A;  1IYU A;  3S17 B;  1EY0 A;  1MIU A;  1Q3L A;  5LMN W;  3V96 A;  2AQ3 B;  4CGY B;  2RHS B;  3S1N H;  2LKV A;  1TY0 A;  4LF6 Q;  4UPA A;  1LTI D;  1GKH A;  4BY1 G;  3I4N B;  4A3F G;  3KBX A;  1A3T A;  1EY6 A;  4MZ9 A;  2P5Z X;  3TDQ A;  2FXQ A;  1KDC A;  5EJW A;  4QUF A;  3M4Q A;  1A63 A;  3JAM i;  2MFI A;  3VDY A;  2B8G A;  1WTH A;  3HOW H;  2AQ1 B;  1U5K A;  2B2V C;  3HKZ G;  2E2D C;  2NVQ H;  1A3U A;  1TU2 B;  3LGJ A;  1ESF A;  2F0H A;  1STB A;  5JOB A;  3H0G H;  4S3S A;  1JWM D;  1NAP A;  1VCI A;  1STH A;  1SE4 A;  2M00 A;  2A1A A;  1TWF H;  3GTM B;  2L5T A;  2F0S A;  4A4I A;  2BH8 A;  2HDM A;  2MUY A;  1BBW A;  4IFD J;  1I6H H;  2B3G A;  2L12 A;  3HOZ H;  2F0M A;  2ATW A;  3S1R H;  4K2K A;  2CVR A;  1KD1 C;  1XTD A;  1XXG A;  3HOV H;  2WAQ E;  5GAG C;  5LMU Q;  1TS4 A;  4JBM A;  3NWS A;  1RDP D;  2VQE L;  4DV2 L;  1B9N A;  2EIF A;  1BF4 A;  3MFG A;  2K28 A;  2L11 A;  3K8A A;  4JK1 C;  3KJP A;  2PI2 A;  1Q46 A;  4LK1 C;  3U4V A;  4A3D B;  2HQL A;  3EIV A;  2TMP A;  1QB5 D;  1V1O A;  1DOM A;  2ZTE A;  5G3L F;  2F4I A;  3K81 C;  1DJR D;  5C5L A;  1LTS D;  2B2U C;  4U68 A;  4XYQ A;  4Y7N B;  3W2D A;  1HZB A;  5A2Q E;  4IZ8 A;  1NR4 A;  2JA9 A;  3ICE A;  4IFD H;  1JCK B;  1FR3 A;  1CA6 A;  4NP5 A;  1PTO D;  4NXM Q;  1S5E D;  1F9P A;  4R4Q A;  1PV4 A;  3M7N A;  3GV6 A;  5FLX E;  4A3B H;  4EGV A;  4JPB W;  3FMC A;  4ZLT F;  5C6A A;  4OIJ A;  3J81 E;  1B7Y B;  2Q2U A;  4LUZ A;  3RUZ A;  5J1Z A;  1YZ6 A;  4PMC A;  2KHI A;  3S1Q H;  5DEH A;  4CKE A;  3JAM c;  1ET9 A;  1Y1V G;  3GTG B;  5IGB A;  1E1T A;  1U4P A;  1DYQ A;  3RZO H;  4B9X A;  3NBH A;  2N3S A;  4K5V A;  3IAY A;  2EY2 A;  3OOC A;  2YV5 A;  3FKI B;  1TWG B;  5NUC A;  2QDL A;  3I4M H;  1EYD A;  4DV5 Q;  1WOC A;  2K5N A;  4MTK A;  2C5C A;  2FHT A;  3SDZ A;  1XPO A;  2KOL A;  1PHJ A;  2O5I C;  4R8I A;  4DAY A;  5C3E B;  3CXC A;  4JBW A;  3GTQ H;  2OEO A;  4QQB X;  4C3J B;  5LL6 S;  4BXX G;  3IRB A;  1AE2 A;  3NQT A;  4F8M A;  1SSO A;  1TWH H;  4DV0 L;  2K1B A;  3CCQ A;  1EQT A;  3UI2 A;  2Z6K A;  1M4V A;  3DWP A;  4L5Q A;  2E76 C;  3E6Z X;  4GN4 B;  1NJI C;  4MHE A;  2YTV A;  4BBR H;  1H9M A;  4A3G H;  2DJF C;  1A0I A;  1OXU A;  2E8G A;  3NQI A;  4FVM A;  4HED A;  1D5X C;  4YIJ A;  4AH6 A;  5M3F H;  2NWG A;  3S1M B;  3S15 B;  1JR0 D;  3JAM L;  1QNU A;  2DNE A;  1LAB A;  1SE8 A;  3I4L A;  2KHJ A;  1QZG A;  3G7L A;  3PO3 G;  4LJZ C;  5C0X J;  4JV5 L;  1L1O C;  5CC4 A;  3LNN A;  2PZU A;  4O0A A;  1X3Q A;  3BZC A;  1OTC A;  3BVG A;  1B9M A;  2LY7 A;  1IZ6 A;  4DUZ Q;  1SYD A;  1ONL A;  1RD9 D;  5CBA E;  3BDL A;  3H3V I;  1KHI A;  4I7Z C;  2IY5 B;  2WAQ G;  4F88 A;  4FNF A;  1I3Q H;  1SE3 A;  3FVQ A;  1GO3 E;  1HTL D;  1HPC A;  1C8C A;  1SRO A;  5ELD A;  3P1H A;  3GTP H;  1S4Z A;  3K7A B;  1VMP A;  3EA6 A;  3TBI B;  4QGU A;  5LMN L;  2SNM A;  4P74 A;  4NMZ A;  2JA8 B;  4IO9 A;  4NXN Q;  3M4O H;  5IYB G;  4TRD A;  3MTS A;  4JI6 L;  3H09 A;  2HHH Q;  1L0W A;  5IYD H;  5KRU A;  1H95 A;  2O5J C;  3CC4 A;  4HJ5 A;  1WCM G;  2WV6 D;  5JVH 3;  1FJG Q;  1SMY D;  3PIP 3;  1A3V A;  2ZT9 C;  3MXN A;  1EIF A;  1PH9 A;  4GOP A;  2YU9 H;  1PZJ D;  5I6Y A;  1Z47 A;  2K7V A;  1EU4 A;  3GTJ H;  2XRQ D;  4X62 L;  1AZP A;  1CKN A;  2Z0S A;  1EUJ A;  3F2C A;  1Y8N B;  2Q8I B;  2F0J A;  3M3Y B;  1YVC A;  4JG2 A;  4A3L G;  4LFC Q;  2AQ2 B;  3KF6 A;  2JA5 G;  1I6V C;  3DUZ A;  4DF7 A;  1CKM A;  1SRU A;  2Z9H A;  2VUM H;  2Z6B A;  4NKL A;  1YJN A;  1II3 A;  1ENA A;  1WTR A;  2MO1 A;  1NSN S;  3D31 A;  3SR1 A;  3T4A C;  5IE8 A;  2VQF L;  1Q1B A;  4BBR G;  1U0L A;  1EQQ A;  4YY3 Q;  2PQA B;  3I73 A;  5C4H A;  4A93 G;  1BUV T;  1PH5 A;  3CD6 A;  4LF9 Q;  2A6E D;  3ITP A;  1JOO A;  2BDO A;  4XT3 B;  2RA4 A;  3UDX A;  4GNX C;  3V2T A;  1TS5 A;  3DM1 A;  2XVS A;  1EQV A;  3I90 A;  1EOT A;  2UU9 L;  2ICI A;  3T1Y L;  2DJG C;  1J6Q A;  2NVX B;  1RTN A;  3OW7 A;  3T53 B;  5IYC G;  3WDN A;  2O2L D;  1B53 A;  1PH8 A;  4CKB A;  2NN6 H;  4Y52 H;  1K8G A;  1XJV A;  4BY1 B;  1I94 Q;  4HIM A;  2K5V A;  2PZW A;  4A3F B;  5C4X H;  4IFD I;  1MBY A;  3F2U A;  4A3K H;  3D4D A;  4J15 A;  1B4O A;  3QJY A;  5KND A;  4JYA Q;  4HMJ A;  4KN7 C;  3F1Z A;  4DV6 L;  4DNR B;  1WVL A;  2EJM A;  3BZK A;  4K5W A;  3S2H H;  3P20 A;  3HOX H;  5I2Y A;  1K83 H;  4RCO A;  4K6L A;  4ODG A;  5J39 A;  2L9H A;  2Z8L A;  1RKN A;  1W3S A;  1X32 A;  1PH4 A;  1A62 A;  2DY7 A;  2UUC L;  3AMU A;  1A2U A;  4LF4 L;  4IQZ A;  3EVQ A;  1QZH A;  1S5C D;  3KLW A;  4JI8 L;  3A54 A;  2E5L Q;  1JJG A;  5CV9 A;  1HCZ A;  3Q0A A;  1Y14 B;  3K7U C;  3PIO 3;  4KHP Q;  5IWA Q;  3H94 A;  4H7B A;  2UUB L;  2X6L A;  3A8J E;  3PUV A;  3KOJ A;  4CDC C;  1X3E A;  2EJG C;  1Y8O B;  2MO0 A;  2QCP X;  5COR A;  3NBI A;  1NMF A;  3F2B A;  4ZRZ A;  2E2J B;  1KQS A;  2PMZ B;  4A3J H;  3DM3 A;  2V1C C;  5CV6 A;  2MP1 A;  4OIK A;  3GP7 A;  2EXZ A;  3T56 B;  2VUM G;  3CME A;  3QB3 A;  2B63 H;  2EYM A;  5C4J H;  2B29 A;  2I07 B;  4HCE A;  3J7A V;  3QIA A;  3IL8 A;  2ZM6 Q;  1VQO A;  1P16 A;  1NBW A;  4A3D G;  3M4P A;  4QJF A;  3OMG A;  4ZUJ A;  3NTI A;  4FXD A;  2B39 A;  2WKD A;  1LTG D;  2H5X A;  2HCC A;  3M85 A;  2NZH A;  1CI3 M;  3CRL C;  4WJ4 A;  1B3Q A;  2KUM A;  3MZ5 A;  3VYT A;  2YTX A;  2K14 A;  3S1N B;  1XPU A;  2NN6 G;  3S24 A;  3N52 A;  5M5Y H;  1Y1V B;  3CAM A;  4IUN A;  4L63 B;  3KF8 B;  5E3F A;  2NVT B;  4R1J A;  4RAU C;  2ZTD A;  3P7J A;  4BA2 I;  5HGT A;  1BBX C;  3PCO B;  4X65 Q;  1V1P A;  1YNN D;  3EQL C;  1EL0 A;  5EBD A;  4DV4 L;  1WD1 A;  4A3E H;  1EY8 A;  4DXG A;  1FGB D;  1VQN A;  3TZD A;  4IAL A; 
#chains in the Genus database with same CATH homology
 3CRK C;  2BE5 C;  4RHS A;  4TSS A;  1JWS D;  4C3H G;  2PO4 A;  2OXP A;  1QNK A;  1B2T A;  1CZW A;  3I3C A;  3ERQ A;  4C3J G;  1F2M A;  1KDA A;  1TWF B;  2F0P A;  5JEA G;  1I4P A;  3QO2 A;  4HN7 A;  5CV7 A;  3GTL B;  4KI0 A;  1G8Z D;  2L4N A;  1H9S A;  2NTS A;  2QDB A;  2SDF A;  2MPM A;  2NBF A;  4OL7 A;  4X3T A;  1MD2 D;  4H13 C;  1S5D D;  5KEE A;  4QIW B;  1JB3 A;  2IX1 A;  2D62 A;  3D4W A;  2JEB I;  5IGD A;  2MGS A;  1GOZ A;  1HHV A;  4J8Q A;  2VB3 X;  2B2Y A;  2MHV A;  2EY5 A;  1F9R A;  1PFB A;  3SVM A;  5K36 G;  1QOH A;  4ZQ3 A;  2D9U A;  1IW7 C;  1SJH D;  4RHR A;  4FF4 A;  2RSN A;  1SJE D;  5EKI A;  1I4G A;  2NN6 I;  3ZYY X;  1TY2 A;  1NCV A;  3A55 A;  2PCF B;  4A3B B;  4N9T A;  2K04 A;  5E4W C;  1FNU A;  3K6O A;  2EVB A;  3IFD A;  1WCM B;  1LLR D;  3L9A X;  2XSC A;  5M5X B;  3RMH A;  4KTA A;  4UDU C;  1I4Q A;  2XNA C;  4BS9 A;  3H3V C;  4FF2 A;  2DN8 A;  2B2T A;  5KNC A;  1F2L A;  3OWE B;  2WII B;  1G2T A;  1L0X B;  3T16 A;  2AUJ D;  2JA5 B;  3C1E A;  2EY1 A;  1ICW A;  1JC7 A;  4XQJ A;  1XWE A;  4R9W A;  1CK1 A;  1TWH B;  2F0N A;  1MSH A;  5C4Z A;  5D65 A;  2AWO A;  4BBR B;  4G7H C;  1EIG A;  2NTT A;  1GJX A;  2WP8 J;  4ID6 A;  1RTO A;  1C4Q A;  4KY5 A;  3D6C A;  2F1M A;  1B1Z A;  3R2T A;  3HGB A;  2F0V A;  1JQY D;  2XRS D;  5FKA C;  1HTP A;  1D2B A;  4RWS C;  1J8I A;  4O1N A;  4QCL A;  4EQO A;  1QCB D;  1H9J A;  5COY A;  2PQE A;  4ZK9 B;  1UEA B;  1GXD C;  3GTP B;  1D6E C;  2E74 C;  4OO1 H;  4FXG C;  3M4O B;  4NW2 A;  3DWA A;  5IGC A;  3TP8 A;  3NP8 A;  5EBC A;  2YU9 B;  3GTJ B;  1EY7 A;  3GQB A;  4R8N A;  2C9O A;  1PMR A;  4QUC A;  1F9S A;  4DU9 A;  4HSV A;  1VMC A;  5ELB A;  4RH6 A;  2FMM A;  1GUO A;  3JAM E;  2VUM B;  1DOK A;  2RQX A;  1HQM C;  3A8I E;  3P75 A;  3WOF A;  4J1M A;  3KK7 A;  3I91 A;  1O7Y A;  1CQF A;  2IW3 A;  4RGO S;  5I2X A;  5CV4 A;  5CBE E;  4ZKB B;  5DM7 3;  2O4X A;  3T13 A;  5KGU A;  1GUN A;  1STY A;  2EZV A;  1ZXT A;  2K5Q A;  1TS2 A;  4EVO A;  5I9O A;  2H4O A;  3IKJ A;  1CT1 D;  3NWT A;  4KKS A;  5C4X B;  3Q6S A;  2PZT A;  4K6D A;  3ONA B;  4PMW A;  2WAC A;  2IX3 A;  2FFK B;  1JOR A;  2AWN A;  1GHJ A;  1WTW A;  1QE6 A;  1UNS A;  5AFW A;  3S2H B;  3K0Y A;  1NUC A;  5J22 A;  2FIN B;  1V8Q A;  2EYL A;  1LT3 D;  4C3H B;  4F87 A;  1BCP F;  4GZY C;  2A68 D;  4RFB A;  4HSP A;  1IKM A;  3HG9 A;  1CM9 A;  1JWU D;  2KJX A;  1OXS C;  3FRP B;  2KCC A;  1TKW B;  1MGS A;  2KEE A;  2A69 C;  5EGT A;  1U4L A;  1HRJ A;  3L3O C;  4ULL A;  5IT9 E;  1IKL A;  1LT5 D;  3ND8 A;  5KYI A;  3NTH A;  1M8A A;  4QF4 A;  4A3J B;  3K5L A;  2NYZ D;  5CMD A;  1DON A;  1T5X D;  5C4J B;  2IL8 A;  2JE6 I;  4IUQ A;  1HUN A;  1EWC A;  3U9S A;  3NUC A;  1AP0 A;  1XYI A;  1S5F D;  2RBM A;  1LTT D;  4RGT A;  1SE2 A;  4C56 C;  1HUM A;  4ZYS A;  4C1N K;  3D3R A;  1PDQ A;  2EY6 A;  3W3A A;  1H9R A;  4AYB B;  4IFD G;  3K57 A;  5C3X A;  4V0B A;  1SYF A;  3OHX C;  5M5Y B;  2KEC A;  1H9K A;  4DAP A;  3H91 A;  4KJN A;  4DXF A;  3TP7 A;  4RGN A;  3S14 B;  4EQN A;  2RDF A;  1A6X A;  5C0X H;  4A3E B;  4OO1 I;  2RSO A;  4LAA A;  2L55 A;  1LTB D;  2A6H D;  3J81 L;  1I4H A;  1KNE A;  1JOQ A;  2G9H D;  5FO9 B;  3KLR A;  2PW5 A;  5T1G A;  5FO7 B;  3ERO A;  3PUX A;  4BBS B;  3BYY B;  1HA5 A;  3GD7 A;  3C46 A;  1CA5 A;  3J7A F;  2QKI C;  1ILP A;  1BCP C;  1ZYR C;  3CQZ B;  4H44 C;  2KHS A;  1C48 A;  2F0D A;  2JSO A;  4KY6 A;  3HS0 C;  3X3N A;  5DAU A;  3BS1 A;  1R4Q B;  2JEA I;  1BDO A;  3E0J A;  4H0L C;  5I4D A;  3MFY A;  1QJO A;  2B2W A;  1BO0 A;  1YNJ C;  2EOT A;  2EYH A;  1VF5 C;  2CW0 C;  4WRD A;  3PO2 B;  2K32 A;  3PMF A;  1X3P A;  3AU7 A;  3PUW A;  1FNV A;  1ILQ A;  3BVZ A;  1F2Y A;  2ENB A;  5JEA J;  4IUV A;  2I46 A;  4MN3 A;  1FYC A;  3R3O A;  1U4R A;  1I50 B;  1SYG A;  2N88 A;  1NR2 A;  5BN5 A;  1EY4 A;  1CTM A;  3FDT A;  2G9D A;  5CV8 A;  1EY9 A;  5JJZ A;  3MA2 B;  3DXJ C;  3TME A;  5E1F A;  2B2T C;  1SEB D;  1Q90 A;  4FF3 A;  1ENC A;  3IFT A;  2F3W A;  1SAP A;  2F0T A;  2IT1 A;  2JP1 A;  2ICE C;  1I4R A;  5M3M B;  2KQ3 A;  2NB0 A;  3A7L A;  2Q8T A;  1LAC A;  1GUW A;  5ELF A;  2EE1 A;  2D2C C;  3M4Y A;  5FOB B;  3A7A B;  1E2Z A;  1XTC D;  4FXK C;  1KAA A;  2K03 A;  4OGQ C;  3HOU B;  1KLG D;  3S9W A;  3NSW A;  5EPL A;  4XDX A;  2AUK A;  4KD3 A;  1WTO A;  1SYC A;  3OIP A;  2BDN A;  5CYU A;  1SNM A;  3VYS A;  1G29 1;  1KAB A;  4XQN A;  1QWY A;  2WB1 B;  1WTV A;  2F3V A;  3J80 E;  1TQO A;  1EYA A;  2VXW A;  1EU3 A;  3R2I A;  2R3Z A;  2Y0S B;  3C1F A;  5FK9 C;  1ET6 A;  2WKC A;  3K5N A;  3AB9 A;  3C3L A;  3TZU A;  2PPB C;  3PUZ A;  2L1B A;  1Y69 U;  1IYV A;  4RKB A;  1DXM A;  2OT2 A;  1RJT A;  1W6J A;  3HOW B;  1ZKO A;  5C0X I;  5IIF A;  2NVQ B;  2M9V A;  3H0G B;  4Q5V A;  3KLS A;  4KY7 A;  1U9R A;  4WJW A;  1DM0 B;  1UUP A;  2XWJ B;  3NXW A;  1PRT B;  4KK7 A;  1STG A;  4ABN A;  2RKS A;  1PZI D;  4A3I B;  1I6H B;  2DY8 A;  3FPP A;  3HOZ B;  1PRT F;  3NE5 B;  2F03 A;  3S1R B;  1OXV A;  3KUP A;  3HOV B;  4EQP A;  1D1I A;  2HCI A;  1TT2 A;  5EPJ A;  2K6A A;  1BNZ A;  2EDG A;  3RD4 A;  2F0E A;  4DK1 A;  1PTO H;  1QIL A;  1SYE A;  5LL6 X;  1TWC B;  2EYF A;  3BDC A;  1Q8I A;  2XIW A;  3VA7 A;  1ZEQ X;  1O7L A;  4M1U B;  2F0U A;  1D1K A;  2KCN A;  4LMQ D;  2L0C A;  3A8K E;  2CHB D;  4Q0F A;  2YYZ A;  4BWG B;  2J7Z A;  1CZG A;  4ZKC B;  1SNP A;  3D4R A;  1J9O A;  2LMC B;  4P2C B;  3A56 A;  3S1Q B;  1O7Z A;  5G3L D;  4WFN 3;  3RZO B;  3I72 A;  4U67 3;  1EIH A;  1ROD A;  1SYB A;  1K8M A;  2F0W A;  3QG1 A;  2A5H A;  2RDH A;  4QMG A;  1EWH A;  3I4M B;  4XYO A;  5CV5 A;  3TP5 A;  1HXY D;  1LTR D;  1AFP A;  2CQA A;  2F0L A;  2PNR C;  3BG3 A;  2D5D A;  1STE A;  2M2L A;  3GTQ B;  1SMY C;  3NK9 A;  3X3M A;  2VB2 X;  4F7X A;  3U9O A;  4KD4 A;  1EEF D;  4PMB A;  1Y1W B;  2Q8R E;  1QG7 A;  3VA5 A;  2LFN A;  4A3G B;  1LT4 D;  5IGE A;  2ZXO A;  1RCV D;  3VR4 A;  5M3F B;  2EYO A;  1E2W A;  4X3S A;  2WIN B;  4HMI A;  1GHK A;  2H1E A;  1E0B A;  4B9W A;  1BQQ T;  3CKI B;  4BY7 B;  2K01 A;  1PRT C;  5I6W A;  2E2I B;  1F77 A;  3VR3 A;  2F0K A;  2R61 A;  5EQ0 A;  1RF2 D;  2K5W A;  1EY5 A;  1I3Q B;  3GV3 A;  3VR2 A;  3PUY A;  2RVL A;  1XX8 A;  5K5P A;  1KDB A;  4HCS A;  3BYT B;  2QEJ C;  1CHP D;  4NDX A;  2KED A;  1DCZ A;  1BR9 A;  2JXM B;  2BA1 A;  4PQX A;  3MC0 B;  1VF7 A;  3R93 A;  3N6R A;  2SNS A;  3PV0 A;  4CJ0 B;  1JOK A;  1PYW D;  3K5O A;  4IN3 A;  4C1N I;  3QOJ A;  1HA6 A;  5DNF A;  1EZ8 A;  1HQR D;  5DM6 3;  1OO9 B;  4X3U A;  4G7Z C;  1LTA D;  1JIC A;  2ZXP A;  2SEB D;  4Z9C B;  1OXX K;  3SHL A;  4HAE A;  4KHZ A;  4IUU A;  2E75 C;  2BCO A;  4E6I A;  3CHB D;  3NHH A;  1V1P B;  2NUC A;  3DWQ A;  4K8J A;  3URY A;  2TSS A;  3HOY B;  2RDG A;  4RKL A;  1F2Z A;  2NZ1 D;  3M7G A;  2NVY B;  2B2W C;  2HUG A;  1FNW A;  3QWN A;  1B3A A;  4XQQ A;  3HZX A;  1EZ6 A;  5T1I A;  4A3K B;  4XXE A;  4KV6 A;  5C5M A;  1SNC A;  2HQE A;  1CQV A;  4IUP A;  3HOX B;  5JPN C;  1K83 B;  1H9S B;  1BCP B;  1HFG A;  4DFA A;  3VR5 A;  4OO1 G;  2BE5 D;  2QIL A;  1WTP A;  1Y8P B;  5M5W B;  1I4X A;  3TP6 A;  1YNN C;  3MWY W;  5JAV A;  1SNO A;  4X3K A;  2JA7 B;  1KNA A;  2FMC A;  1DD2 A;  3DMU A;  3O13 A;  1AEX A;  4C3I G;  1AZQ A;  1EEI D;  1FD7 D;  3SK8 A;  5ISR A;  3DEP A;  4CKC A;  3KF8 A;  1CHQ D;  1SFO B;  3NTK A;  2B63 B;  2BOS A;  2PW7 A;  3Q23 A;  3R8B A;  5D14 A;  1EFI D;  1KTK A;  3HRZ C;  1PLF A;  4OHJ A;  2F0Q A;  4UAI A;  3RLF A;  2EYJ A;  1MI2 A;  1F9Q A;  4N9P A;  3MHB A;  3OWF A;  2F0O A;  5M9O A;  1IW7 D;  1T5E A;  3K59 A;  4TQU S;  4KHV A;  3KBG A;  1D5M C;  3MXG A;  3LWE A;  2GA4 B;  1LV9 A;  3RZD B;  3D8G A;  5BN4 A;  1E2V A;  1UAP A;  2HDL A;  3VYU A;  1B44 D;  5A2Q L;  1TR5 A;  4HTH A;  4CBV A;  5FLX L;  1PFM A;  4RCN A;  5D3D A;  2X6G A;  3ND9 A;  4XIG S;  1STN A;  2B2V A;  2K33 A;  5BN3 A;  1V43 A;  1PFN A;  2QF7 A;  4DK0 A;  2IX0 A;  2EJF C;  1AN8 A;  1S5B D;  2PYK A;  3SK6 A;  4CJ2 C;  1TVX A;  1GUT A;  4BA1 I;  5EPK A;  3FEW X;  2EYP A;  1A2T A;  1R9T B;  1BXT A;  4KJO A;  1G91 A;  5CGK A;  1PTO B;  1L0Y B;  2F0F A;  4O42 A;  4IUT A;  4M8A A;  4HR7 B;  1PTO F;  1RHP A;  3V05 A;  2K05 A;  4ILW A;  5IT9 L;  5IGG A;  1R4P B;  4PNY A;  2R7Z B;  4C2M B;  3SK5 A;  1PRT D;  3K5M A;  2B2Y C;  3VYR A;  4DN4 M;  3SXH A;  3TN2 A;  1LT6 D;  2B2U A;  3J7Y W;  4J6H A;  3S2D B;  1ESR A;  2E2H B;  4B08 A;  4A3M B;  2F0G A;  5JVG 3;  1ML0 D;  4RGM A;  3LWU A;  5ELC A;  3EFX D;  3K58 A;  1TS3 A;  1G2S A;  4G4K A;  4G7O C;  5C0X G;  4G57 A;  3E5S A;  5D3I B;  1VDZ A;  4K2L A;  4WOR A;  3VR6 A;  5EKK A;  1DOL A;  4K14 A;  4KKU A;  3OSO A;  3NPP A;  3HKZ B;  3WOE A;  4ME5 A;  3S16 B;  3MVV A;  1SXT A;  3SK4 A;  4FF1 A;  2Z4H A;  3I70 A;  5JEA H;  2JYO A;  5TSS A;  5C3W A;  4I65 A;  1TWA B;  2XWB B;  2OF1 A;  4L6T B;  5A35 A;  4XT1 B;  3KLS X;  1HFN A;  4CJ1 B;  2KA7 A;  4KN4 C;  5KNB A;  1TII D;  3DHQ A;  5JPM C;  2IPK D;  3I8Z A;  1AW7 A;  5IOC A;  2V4D A;  2ZXR A;  3D6W A;  4K8I A;  1WD0 A;  2R92 B;  4TKO B;  5K36 H;  5HUR A;  2VNU D;  3H6M A;  1A15 A;  1PXU A;  2N55 A;  2IWH A;  2EPB A;  5IOD A;  5E4X A;  1PTO C;  3FPU B;  4KKT A;  3Q22 A;  2Z1C A;  1O80 A;  3MXP A;  2KVM A;  1Z7T A;  2J0T D;  4FO2 A;  5ELE A;  3MAQ A;  1D5Z C;  2MJ8 A;  2DNC A;  2FJ2 A;  2R6G A;  4QB4 A;  2A69 D;  5FO8 B;  2A68 C;  4C3I B;  3EJI A;  4ZUI A;  3LX0 A;  3MEH A;  5F2D A;  1BOS A;  3OIQ A;  1KLU D;  1O78 A;  5CR3 A;  3SEB A;  5LHY 1;  1SDF A;  3L7Z C;  4XTC S;  3GO5 A;  1Q12 A;  3G6J B;  4ZAI A;  4V19 0;  1CFM A;  2J4X A;  4MIU A;  2ID0 A;  3PO3 B;  3OPO A;  4DGZ A;  2F0I A;  3TSS A;  3QOL A;  3MXU A;  1EYC A;  1B50 A;  4DNT B;  4DA2 A;  2WAQ B;  1K8O A;  3OMC A;  2SOB A;  2K5D A;  3HEJ A;  5I9P A;  3GTO B;  5IGF A;  2X69 A;  1MSG A;  3J80 L;  1ENF A;  2LS0 1;  1SND A;  1WTQ A;  4FP5 D;  2IJ0 A;  1LO5 D;  2A74 C;  3BZD B;  5KIX A;  2XN9 C;  2R93 B;  3C2P A;  1GUG A;  1OXT A;  4PV1 C;  2B8F A;  2A6H C;  1IHZ A;  4RA8 A;  1SNQ A;  3DEO A;  4K5X A;  1Z6H A;  1BCP D;  1ZYR D;  3Q24 A;  1Q1E A;  1GUS A;  1STA A;  4CHT B;  5C44 B;  2Z4I A;  1SBB B;  5KYL A;  1U4M A;  3CU7 A;  1PZK D;  3GTK B;  3T51 B;  4L8J A;  4A93 B;  2A73 B;  2BA0 A;  2A6E C;  1IL8 A;  1YNJ D;  1DZ1 A;  4DAV A;  3BDO A;  2JA6 B;  1W6K A;  2CW0 D;  3SE0 A;  1G6Z A;  4KMU C;  1WTX A;  3HP3 A;  4IUR A;  1JE4 A;  5EKL A;  3BVM A;  4FYD A;  1IYU A;  3S17 B;  1EY0 A;  1Q3L A;  3V96 A;  2AQ3 B;  4CGY B;  2LKV A;  1TY0 A;  1LTI D;  3I4N B;  3KBX A;  1A3T A;  1EY6 A;  3TDQ A;  1KDC A;  5EJW A;  4QUF A;  2B8G A;  2AQ1 B;  2B2V C;  2E2D C;  1A3U A;  1TU2 B;  1ESF A;  2F0H A;  1STB A;  5JOB A;  4S3S A;  1JWM D;  1NAP A;  1VCI A;  1STH A;  1SE4 A;  2M00 A;  3GTM B;  2L5T A;  2F0S A;  2HDM A;  2MUY A;  4IFD J;  2L12 A;  2F0M A;  4K2K A;  2CVR A;  1XXG A;  1TS4 A;  3NWS A;  1RDP D;  1B9N A;  1BF4 A;  3MFG A;  2K28 A;  2L11 A;  4JK1 C;  4LK1 C;  4A3D B;  2TMP A;  1QB5 D;  1V1O A;  1DOM A;  5G3L F;  2F4I A;  1DJR D;  5C5L A;  1LTS D;  2B2U C;  4U68 A;  4XYQ A;  4Y7N B;  3W2D A;  5A2Q E;  4IZ8 A;  1NR4 A;  4IFD H;  1JCK B;  1FR3 A;  1CA6 A;  4NP5 A;  1PTO D;  1S5E D;  1F9P A;  3M7N A;  3GV6 A;  5FLX E;  4EGV A;  3FMC A;  4ZLT F;  5C6A A;  4OIJ A;  3J81 E;  3RUZ A;  5J1Z A;  4PMC A;  5DEH A;  4CKE A;  1ET9 A;  3GTG B;  5IGB A;  1U4P A;  1DYQ A;  4B9X A;  3NBH A;  4K5V A;  3IAY A;  2EY2 A;  3OOC A;  3FKI B;  1TWG B;  5NUC A;  1EYD A;  2C5C A;  2FHT A;  3SDZ A;  2KOL A;  2O5I C;  4R8I A;  4DAY A;  5C3E B;  4JBW A;  2OEO A;  4C3J B;  5LL6 S;  3NQT A;  4F8M A;  1SSO A;  2K1B A;  1EQT A;  3UI2 A;  1M4V A;  3DWP A;  2E76 C;  3E6Z X;  4MHE A;  1H9M A;  1OXU A;  3NQI A;  4FVM A;  4HED A;  1D5X C;  4YIJ A;  2NWG A;  3S1M B;  3S15 B;  1JR0 D;  3JAM L;  1QNU A;  2DNE A;  1LAB A;  3I4L A;  3G7L A;  4LJZ C;  5C0X J;  5CC4 A;  3LNN A;  2PZU A;  1X3Q A;  3BVG A;  1B9M A;  2LY7 A;  1SYD A;  1ONL A;  1RD9 D;  5CBA E;  3BDL A;  4I7Z C;  4F88 A;  4FNF A;  1SE3 A;  3FVQ A;  1HTL D;  1HPC A;  1C8C A;  5ELD A;  3P1H A;  1S4Z A;  3K7A B;  1VMP A;  3EA6 A;  3TBI B;  2SNM A;  4NMZ A;  2JA8 B;  4TRD A;  3MTS A;  3H09 A;  5KRU A;  2O5J C;  2WV6 D;  5JVH 3;  1SMY D;  3PIP 3;  1A3V A;  2ZT9 C;  3MXN A;  1PZJ D;  5I6Y A;  1Z47 A;  2K7V A;  1EU4 A;  2XRQ D;  1AZP A;  1Y8N B;  2Q8I B;  2F0J A;  3M3Y B;  2AQ2 B;  1I6V C;  3DUZ A;  4DF7 A;  4NKL A;  1II3 A;  1ENA A;  1WTR A;  1NSN S;  3D31 A;  3SR1 A;  3T4A C;  1Q1B A;  5C4H A;  3I73 A;  1BUV T;  2A6E D;  3ITP A;  1JOO A;  2BDO A;  4XT3 B;  2RA4 A;  3V2T A;  1TS5 A;  3DM1 A;  2XVS A;  1EQV A;  3I90 A;  1EOT A;  2ICI A;  2NVX B;  1RTN A;  3OW7 A;  3T53 B;  3WDN A;  2O2L D;  1B53 A;  4CKB A;  2NN6 H;  4BY1 B;  2PZW A;  4A3F B;  4IFD I;  1MBY A;  3F2U A;  3D4D A;  1B4O A;  3QJY A;  5KND A;  4HMJ A;  4KN7 C;  4DNR B;  1WVL A;  2EJM A;  4K5W A;  3P20 A;  5I2Y A;  4RCO A;  4K6L A;  4ODG A;  5J39 A;  2L9H A;  2Z8L A;  1RKN A;  1X32 A;  2DY7 A;  3AMU A;  1A2U A;  4IQZ A;  3EVQ A;  1S5C D;  3A54 A;  5CV9 A;  1HCZ A;  3Q0A A;  3PIO 3;  3H94 A;  4H7B A;  2X6L A;  3A8J E;  3PUV A;  2EJG C;  1Y8O B;  2QCP X;  5COR A;  3NBI A;  4ZRZ A;  2E2J B;  2PMZ B;  5CV6 A;  2MP1 A;  4OIK A;  3GP7 A;  2EXZ A;  3T56 B;  3QB3 A;  2EYM A;  2I07 B;  4HCE A;  3J7A V;  3QIA A;  3IL8 A;  3OMG A;  4ZUJ A;  3NTI A;  4FXD A;  2B39 A;  2WKD A;  1LTG D;  2HCC A;  3M85 A;  1CI3 M;  3CRL C;  2KUM A;  3MZ5 A;  3VYT A;  3S1N B;  2NN6 G;  3N52 A;  1Y1V B;  4IUN A;  4L63 B;  5E3F A;  2NVT B;  4RAU C;  3P7J A;  4BA2 I;  5HGT A;  1BBX C;  1V1P A;  1YNN D;  3EQL C;  1EL0 A;  5EBD A;  1WD1 A;  1EY8 A;  4DXG A;  1FGB D;  3TZD A;  4IAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...