4ZLTF

Crystal structure of viral chemokine binding protein r17 in complex with ccl3
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
TPTACCFSYSRKIPRQFIVAYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Parallel Evolution of Chemokine Binding by Structurally Related Herpesvirus Decoy Receptors.
pubmed doi rcsb
source organism Cricetid herpesvirus 2
molecule tags Chemokine binding protein/chemokine
total genus 14
structure length 62
sequence length 62
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zltF00
1ML0D 2L12A 2D9UA 1CA6A 4ZLTF 2EOTA 4HEDA 5E4WC 1S4ZA 2Q8RE 1F9QA 5DNFA 1G91A 1HA6A 3I90A 1HFGA 3P7JA 1NR4A 5T1IA 2L4NA 1WTVA 1G6ZA 1NCVA 1AP0A 3GV6A 1B53A 1F9PA 3MWYW 4LMQD 1WTXA 4IUQA 2RSOA 2KUMA 1EL0A 1KNAA 2KEDA 4X3SA 4O42A 3HP3A 1KNEA 2N55A 1G2TA 1EIGA 4UAIA 2SDFA 2FJ2A 1RJTA 1B4OA 2JP1A 2N88A 1WTRA 1U4RA 2H1EA 3MTSA 5CORA 3H91A 2B2TC 2FFKB 3DEPA 3ONAB 2K05A 2KVMA 1DOKA 2L11A 1IL8A 2X69A 3FDTA 4QUCA 5D65A 5EQ0A 1XYIA 1PFNA 1Q3LA 4OIJA 1IKLA 2MJ8A 1CM9A 2L9HA 4R8IA 1AZQA 2HDMA 2MGSA 1PLFA 1RODA 1LV9A 2HCCA 2CVRA 2HUGA 4CJ1B 1DOLA 1EQTA 1PDQA 4CJ2C 1AZPA 2EE1A 3I3CA 2NWGA 5T1GA 1WTOA 4R9WA 1BNZA 1RHPA 3QO2A 1WD0A 1MSHA 3UI2A 1QG7A 1MSGA 2DY8A 1NAPA 3DEOA 4RWSC 4ZKCB 1G2SA 1X3QA 2FHTA 2B2VA 1MI2A 3R93A 4HSVA 1MGSA 5EPJA 1WTQA 1ILPA 3IFDA 2EPBA 1O80A 4OIKA 2X6LA 4IUTA 1VMCA 2B2UA 1XX8A 2VXWA 4ZKBB 1WVLA 2Q8TA 5JJZA 1ICWA 1BF4A 4HAEA 2B2YA 5CBEE 2HDLA 1A15A 2RA4A 4RA8A 2X6GA 2B2UC 2K03A 2K01A 4QUFA 1GUWA 1E0BA 3GV3A 1VMPA 1BO0A 2NZ1D 4DN4M 1IKMA 1CA5A 2R3ZA 2L1BA 1EIHA 1QNKA 2B2WA 2K28A 1X32A 3I91A 1HFNA 1RTOA 3I8ZA 1F9SA 3LWEA 3Q6SA 4XT1B 1U4PA 4ZAIA 2B2WC 1JE4A 1SAPA 2NYZD 1QE6A 1TVXA 1J9OA 5COYA 1O7YA 2XIWA 1HUMA 3DM1A 4IUUA 2HCIA 4XDXA 5CBAE 2MP1A 1HRJA 3FPUB 5EPLA 1U4LA 2BDNA 3D6WA 2MPMA 1ILQA 1PFMA 3N52A 2B2VC 3IL8A 4CJ0B 1SDFA 4RAUC 3SVMA 5EJWA 5CMDA 1X3PA 4MN3A 2FMMA 4X3TA 4X3UA 1O7ZA 1WD1A 1J8IA 2B2YC 1PFBA 1F9RA 2IL8A 2KECA 1B50A 1DONA 1NR2A 5EKIA 4ZK9B 5D14A 1M8AA 1JICA 4MHEA 1HUNA 2KOLA 2K1BA 4NW2A 1SSOA 3TZDA 4HCSA 2K04A 1C8CA 4X3KA 2RSNA 4IURA 5AFWA 2J7ZA 2M2LA 4U68A 3KUPA 2B2TA 1F2LA 2RVLA 2FINB 1DOMA 1EOTA 2DY7A 3G7LA 4IUPA 1B2TA 3TN2A 1ESRA 1RTNA 5EPKA 1B3AA 3KBXA 4XT3B 1DZ1A 1HHVA 2KEEA 4IUVA 1WTPA 5E4XA 1BBXC 1WTWA 3F2UA 2JYOA 1U4MA 1ZXTA
chains in the Genus database with same CATH superfamily
3ERSX 1SNQA 3M7GA 4DV2Q 1CSPA 1VQPA 1G291 2QKIC 3JAML 5C3EH 1PTOD 2Q8RE 4CKBA 1G91A 3G71A 4H02A 2K5DA 4I7AA 4KD3A 2XRQD 3OWFA 3H6MA 4HIDA 2XTIA 5ELFA 1L0YB 3S2HB 3GTJH 1JB7A 3NWTA 2RQXA 4ABNA 2N55A 1SMYD 5IYBH 1K73C 1SNCA 1QCBD 2FJ2A 2R6GA 4WJWA 4OHJA 4OELB 4K5XA 2A5HA 3IFTA 1DOKA 1PH3A 3TBIB 3TQYA 1PFNA 3S16B 3V05A 3NBHA 1CM9A 3ER0A 1XMOL 3I4NB 3KF6A 1PLFA 3T1HQ 4X65L 2I5LX 4JBKA 3M4YA 3GTQB 1U9RA 3S15B 2K5QA 2ZXPA 1QG7A 2NVYH 1BCPB 4LJZC 1X3QA 4A3IB 1K8MA 1KQSA 3AU7A 4XQNA 1IL2A 5C0XI 3P20A 4HMJA 4DR7L 2K03A 4YWKA 3B6YA 1VQBA 1LACA 2A69C 2R3ZA 3S1RH 2QDBA 1Z9FA 3U9OA 4JI8Q 4UP9A 1RTOA 3I4MG 3TEHB 5LMNW 3SK5A 4HJ5A 3BDCA 4LWCA 1PA6A 1AFPA 1KDAA 1TVXA 3QG1A 2IHFA 2XIWA 2UU9Q 3TDQA 2I5MX 4RKBA 3K80C 4OX9L 3NBHB 1PTOF 4BBRB 5M3FG 4DV4Q 3A55A 3KF6B 2Z6BA 4I7ZC 4X3TA 4X3UA 3VR4A 3OIPA 1PFBA 1F9RA 3ZJYC 4BY7B 2QCPX 4MIUA 2KBNA 4MHEA 5FLMH 3HKZB 5I4DA 5ELBA 2JA9A 4IURA 5FK9C 4FVMA 2K32A 3VA7A 3J80c 3NQTA 2A19A 1S3OA 1STAA 2AUKA 2CH4A 1UEBA 2MHVA 3H0GB 3G48A 4A3KG 2PMZE 3A7LA 4F8MA 1XMQL 1ML0D 1LO5D 4QL5A 2F4VQ 4X66L 1Y69U 3PUZA 2K4KA 3HOUG 5FKAC 3VR6A 3F1ZA 1JORA 1G6ZA 3ZYYX 3MWYW 2NVQB 1WTXA 3CRLC 2NVXB 1BBWA 4IUQA 1VQOA 2UXDL 1NBWA 4X64Q 4L8JA 5M5YH 1A2TA 5C44H 2ZTEA 4QMGA 2XGTA 1WI5A 4IPGA 1GOZA 4LFCL 2EY6A 2B63G 5IGEA 1WFQA 4FP5D 2CH4W 2EJGC 3A5ZB 2JA5G 4A3EG 5IP7G 3ULLA 3RNUA 1K8AC 2NN6H 3QOJA 3DWPA 1EQTA 3MVVA 4CJ2C 4JI2L 5FO9B 3K5LA 3K0XA 4ID6A 1A6XA 3S16H 3SE0A 4ULLA 1DCZA 4HSVA 1MGSA 3I4NH 2R7ZG 3L9AX 1X3FA 1KIXA 2B2UA 1EWCA 4JC0A 3GTQH 3S15H 2Q8TA 4YCVA 1Y1VG 3C3LA 1OXXK 2BDOA 5I2XA 1EYCA 2WP8J 4BY1B 2X6GA 3CW2C 4A3IH 4KKSA 1VMPA 4LFAQ 3Q23A 2KHSA 4LF6L 5DM73 2K5VA 2EVBA 3W5OA 2JA8G 2HHHQ 1I5FA 4XDXA 1Y1WB 2E2HB 2BA1A 1MHWC 4BBSB 3RD4A 2NN6I 4A93G 3U9SA 4DU9A 4AQYL 3HOWB 2IW3A 3A56A 5JJKA 1TWCH 5JEAJ 4DF7A 5CMDA 1N9WA 4DR2Q 1LTSD 4NXNL 1O7ZA 5IWAQ 1E1TA 2EYMA 4BA1I 5CV5A 4JYAQ 1SLJA 3OWEB 4BBRH 4WRDA 2K1BA 3DWQA 1LT5D 3MHBA 4DR3L 1PV4A 4K2LA 2RBMA 4KY7A 1SYEA 4DR4Q 4U68A 4K14A 4LUVA 2YU9B 3T1YL 2F0SA 2AQ1B 5JEAH 1B1ZA 1ESRA 3IKJA 4TQUS 4XYOA 5LMUQ 4FXDA 4DGZA 4U673 2A8VA 1R4PB 5C3XA 3R2IA 3PMFA 4Q0FA 4O2DA 1N32L 4XQQA 4HIMA 1JJCB 1K0RA 4YHHL 1JJ2A 2JSOA 1AP0A 5C3EG 3H0GH 3VYRA 2A68C 1KNAA 2BH2A 2RCNA 5CC4A 3VYSA 1V1PA 1I4XA 4FF4A 3I70A 2PQAA 2H1EA 4A3GG 4X6AH 2NVQH 2DJGC 5C5MA 4J8QA 1IBML 2NVXH 1BOSA 2QEXA 3HOYG 1AZQA 1YNXA 4PMWA 3AMUA 4GLVB 1RODA 3T13A 5I6YA 3RR5A 2KHJA 2SOBA 3CQZB 4R4QA 1MI2A 3HOZB 3K6OA 1FYCA 1LABA 4IPDA 3RN2A 1KD1C 2IX1A 4GKJQ 5CV4A 5JVH3 2EYLA 3ULJA 5IGGA 3EJIA 2XWBB 1HNXL 4LF9L 1IKMA 3J80L 3PUVA 3GTKB 4OONA 4DK1A 1VQLA 3NENA 3S24A 3K5OA 2E2DC 4BY1H 1VF5C 5IE8A 5M5WB 1V1PB 3S2DB 5CV7A 2PQAB 4C3HB 4DR5Q 1C7YA 3C1FA 5COYA 1BDOA 4R8NA 3OYYA 4B08A 1ILQA 5KNCA 4DNTB 1K8OA 1E22A 1G8ZD 2LFNA 2R7DA 2UUCL 1JQYD 2F0KA 4KI0A 5IT9c 1CKNA 1Y1WH 2E2HH 1MBYA 4BBSH 4XYQA 2WAQB 1YNJD 1C48A 4XIGS 2DGYA 4B3TL 1A63A 2IX0A 3KLSA 4N9TA 5AFWA 1IYUA 3T51B 5FLMG 1HNZQ 1NUCA 1EFID 2G5DA 1JWUD 1HTPA 3JC66 4DNRB 4A3CG 3WOEA 1FJGQ 5ELCA 1U4MA 1J5EL 1BVSA 4JI7L 3U50C 4LW1A 2EOTA 5LL6X 1LT3D 3NK9A 3P7JA 1SE8A 1TR5A 4WORA 1F9PA 1SMXA 4KJOA 3A7AB 4EVOA 1CSQA 4X3SA 3U4VA 2SDFA 3W2DA 1SRUA 2E5LL 2UXBQ 2B2TC 4Z9CB 1IL8A 1CKNB 1JE5A 1H9MA 1VQIA 2F0QA 2SNSA 3NPPA 3HGBA 2HCCA 4IFDI 1ENAA 4L5QA 2KCNA 2HIXA 1Q1EA 2RDGA 2PZTA 2GN5A 3OTOL 4DUZQ 3HG9A 3G6JB 1HR0Q 4GZYC 4KHZA 1STGA 3GD7A 1I4RA 2VL6A 2Y0SB 4OXPA 4JV5Q 2F0OA 1BBUA 1J6QA 3VR5A 3CQZH 1E2ZA 2EZVA 1E0BA 3GV3A 4EQOA 1BO0A 4LAAA 1EWIA 3E6ZX 4BWGB 4A3IG 4GOPA 2VY3A 2B3GA 4O1NA 5IYCG 2DNCA 2K50A 4CDEC 1TU2B 1TWGH 1FVIA 4XT1B 5EBCA 2PZUA 3GTKH 1XWEA 2HCIA 4PV1C 2NZHA 2F4VL 1LTID 1K0SA 2YTXA 5EJWA 1X65A 2JA7B 1HQRD 4RGOS 4PQXA 4JBMA 3HOXB 4HCEA 3CU7A 2K14A 4NP5A 3QWNA 5J1ZA 2Q2TA 2Y0SE 3EBEA 1GUTA 2ZXRA 5JVG3 2AMCB 2B2TA 2PI2A 4BBRG 5BN5A 3TN2A 1VQFA 2VB3X 2KEEA 1U5KA 2IX3A 4NDXA 4BY7G 2OQKA 3AB9A 1PRTD 3F2CA 2AWNA 2M9VA 1KLGD 3HKZG 2RF4A 4GOPB 1JT8A 3K59A 3I55A 2MFIA 3WWVA 3PGZA 1ASYA 2E2JB 2IJ0A 2F03A 2YTVA 2KENA 3SK6A 2QW7A 1UUPA 4RG1A 1EWHA 4L5SA 1FGBD 5GAGC 1LT4D 3H0GG 1EIGA 2FMCA 1P16A 2ENBA 1VF7A 4MTNA 1IXRA 2F0EA 1IBLQ 3DEPA 1OXVA 2WKCA 1N34Q 2MO0A 2OWOA 4LFAL 2F3VA 3C2PA 1FD7D 3K58A 4APVA 2LS01 3GTJB 2HDMA 3BVGA 3CCUA 2HUGA 3KJPA 3CCEA 3C1EA 4R9WA 3Q8DA 3UI2A 3STBD 1IHZA 2KCMA 1G2SA 3G6EA 5J3BA 2WACA 5CV6A 4A3MG 4JI6L 2AQ2B 5IT9L 4LF5L 2M00A 1YJ9A 1CTMA 3OSOA 1RL2A 5IYDH 1TWFH 3JAME 4J1MA 1I4PA 5IWAL 2VS1A 5KGUA 4FDBA 1DGSA 1CA5A 3NTKA 3GTMB 4A3BH 4B3SL 3CHBD 1GXDC 5AJ3Q 2B2WA 2WFWA 3MFGA 5C6AA 1CT1D 5LMUL 1SAPA 4C3JB 1PYSB 4BY1G 4JG2A 3TREA 4OO1G 2OCEA 1PRTF 4GKKL 4GN3B 3S1RB 4X62Q 5LMNQ 2F0GA 4CJ0B 4DV7Q 5NUCA 3S1MH 4CKCA 4RAUC 4E6IA 2UUBQ 1JMCA 3HOVB 5C4ZA 2OXPA 3M85A 3KOJA 1AEXA 1EY5A 4N8FA 4CDFC 2IL8A 1Y14B 2D0OA 2F0UA 1IW7D 4NW2A 1Y1WG 5M3MB 3W1GA 2IHEA 2EY1A 2JA7H 3KUPA 4BBSG 2WV6D 2ZM6Q 2DY7A 4ZRZA 3G4SA 4C2MH 3HOWG 3HOXH 1VQGA 4DXGA 1EUJA 1SE2A 1CQVA 1SN8A 4A3DB 4NXML 2K5WA 3KLRA 3J81j 4V190 1B70B 3A74A 5E4WC 1N36Q 2A74C 2K75A 1UWVA 1SFOH 3SDZA 2KCCA 1O78A 5JJLA 1E24A 3ULPA 2JA6B 1JOQA 4HTHA 4KTAA 5C4JB 2E2JH 5C0XJ 1B4OA 1M90C 4AIMA 2F0MA 2Z1CA 3H91A 4ZYSA 2FFKB 2K05A 2KVMA 3KYHC 4QUCA 4TRDA 5BN3A 3KK7A 2F1MA 3J81E 4GNXC 2G9DA 1PYWD 2K7VA 2F0LA 4KY5A 4KN4C 4R8IA 1AH9A 1RCVD 1BKBA 2CVRA 1AZPA 3OHXC 3RLNA 5M5YB 5C0XH 2EE1A 3UE0A 1AE3A 1RHPA 4IOAA 1MSHA 5C44B 1SJHD 1MSGA 3I2ZA 1NAPA 4PMCA 1E1OA 2PQEA 1O7LA 3SEBA 4DK6C 3GP7A 3WDNA 1H95A 1D8LA 4LF4Q 1X56A 4ZKBB 4N8X1 5JJZA 5HY6A 1HTLD 2PZWA 1KAWA 2NBFA 1HZCA 5CBEE 2UXCQ 2I46A 2NTSA 3BYYB 4HJ9A 1DM0B 1YEZA 2R61A 3EIVA 4LF7L 3HOZG 1PH9A 1K83B 3I91A 1F9SA 1HNZL 2VUMG 1NMFA 3CC2A 2LMCB 3FRPB 4DV5Q 4LFBL 2F0DA 3GTMH 3PCOB 1FJGL 4TKOB 4C56C 3D6WA 1EOVA 3N52A 4P2CB 3HS0C 1H9RA 4RCNA 5HGTA 5IGDA 2V1CC 4C3JH 3JAMi 1GKHA 4LUZA 3EVQA 4JI1L 1LTBD 1RDPD 1I94Q 5EKIA 4JBWA 4C3HG 4DV6Q 3CXCA 1C8CA 3HOVH 1H9KA 2M2LA 2C9OA 4HIKA 2ZXOA 1HH2P 1LLRD 3VDYA 4OWTB 1TWCB 3RN5A 4A75A 3I73A 4ME5A 3X3NA 2HQLA 4JI5Q 4GNXA 1YHAA 2QDLA 1LYLA 4BXXH 5M3MH 3R2TA 4JPBW 2Q2UA 2WAQG 2L12A 1KRSA 4G7HC 5EAYA 3UDIA 1PH4A 1HZAA 1HFGA 1YNJC 3I90A 2NUCA 1WTVA 4A3DH 1HZBA 1ASZA 2R92B 3GDEA 2TSSA 4YCWA 5C4XH 5E1FA 1CZGA 2EYFA 1EL0A 1HPCA 4PZ7A 1JCKB 2CW0C 1GHKA 1Q86C 1PH8A 4UAIA 5CORA 5CV8A 3CP0A 1XNQL 3D31A 1VQ6A 4LF8Q 3QOLA 2JA6H 5I2YA 4OIJA 2NZOA 4M1UB 3EA6A 3E9HA 3EFXD 1TWHB 3AYHB 5C4JH 2ATWA 5ELDA 4DV0L 5CV9A 1B9MA 1F77A 5FJ8H 1OXUA 4J15A 3NP8A 4JI4Q 1FNWA 5A2QE 2PO4A 1IYJB 2FHTA 1CUKA 4GNXB 2A6HC 1O80A 3VYTA 3HEJA 1I4QA 2VXWA 5FO7B 3URYA 1E2VA 1D5XC 2UUAL 3K7UC 2RA4A 3QB3A 3HKZE 1YZ6A 5IYDG 3VR3A 2PNHA 2NZ1D 2WB1B 3OIQA 3J81i 1X32A 2Y0SG 1P8LA 1H9JA 4H44C 4IJHA 4AH6A 3NBIA 2NYZD 3S17H 3MZ5A 1K83H 5I9PA 3TSSA 3S1NH 3BZDB 2BCOA 2D0PA 1GUSA 2Z4IA 3PIPA 2G9HD 2NB0A 1BCPD 3A0JA 1XTDA 3K81C 4MN3A 3PIOA 2D62A 2EDGA 1WD1A 4AYBB 1QWYA 3RZDB 1DONA 3BJUA 3D4RA 4GS3A 5D14A 1SROA 2LXJA 4EGVA 1SSOA 4YY3Q 4HCSA 4DV3Q 1IBKQ 4QIWB 4DAMA 1DOMA 3U58A 1IBLL 1STYA 4J6HA 3I4LA 5EPKA 1B3AA 1YIJA 1V1OA 4UP8A 1HNWQ 3CCJA 4A3JH 2JA7G 3I4OA 1BBXC 1VQHA 1RIPA 1FL0A 3HRZC 2ALYB 3HOXG 3J80E 4OL7A 4DUYL 2VZAA 1ESFA 1I4GA 4JI3Q 4PZ8A 2ZTCA 4K5WA 1EZ8A 4G7ZC 3GQBA 4EQ5A 3RZOB 1WCMB 4K5VA 4O42A 3HP3A 4V0BA 3PO2B 1RJTA 2JP1A 4AYBE 2VB2X 1U4RA 4DR1Q 4RFBA 2R92H 3ONAB 5K36G 3FHWA 4HN7A 3EQLC 2VQFL 5E3FA 1AE2A 5HURA 2MJ8A 3I7FA 2IWHA 4P73A 1I6HB 2MGSA 1NJIC 2BE5D 1EFWA 4A76A 1BNZA 4K0KQ 4KV6A 1WOCA 3NWSA 1KDCA 2P5ZX 4KKUA 3NSWA 1ILPA 1TWHH 5C0XG 3KJOA 1WJJA 4B9XA 4B3RL 2UUBL 1SXTA 1BCPF 3OOCA 4OGQC 5EKLA 5IODA 1EU3A 5IYBG 4RA8A 2DN8A 1CQFA 5I6WA 2NTTA 4R4TA 2L15A 2HQEA 4IPHA 4PZ6A 4F88A 5JOBA 1GUNA 5BR8Q 2XNAC 1JWSD 2KCTA 4PMBA 3UE1A 4DV1Q 1U4PA 1I50B 5IGCA 5CR3A 1ENFA 2BDNA 4JI0L 4IPCA 3IRBA 1W2BA 1A8VA 3SGIA 3CCVA 1QZGA 1A0IA 3ICEA 4DR6L 1X3PA 3H15A 1VQ4A 2FMMA 2Q2HA 1TWGB 2AKWB 1XNRQ 3KBGA 4C3JG 1M8AA 4KHPL 3J7AF 4UDUC 3UDGA 5EBDA 4JVZA 2AUJD 3FPPA 3RZDH 3KBXA 4F7XA 4B3ML 3M9BA 3HOVG 1E2WA 1YBYA 2XSCA 5E4XA 4LUOA 1ZEQX 3GO5A 4C1NK 4DV2L 4DAPA 1RKNA 4RHSA 1ENCA 2E76C 1OTCA 4HEDA 1S5BD 2PCFB 1F9QA 5D3IB 5M3MG 4IFDJ 1G51A 1D1IA 1II3A 1W6KA 1YVCA 3J7AV 1NR4A 3M3YH 1IW7C 4NMZA 3S14B 4FF1A 4QQBX 2AWOA 2LY7A 2RSOA 2EXZA 4A3DG 1DD2A 1EQQA 3BDLA 1G2TA 4YIJA 4IFDH 1RF2D 1B7YB 4GN4B 3RZOH 1QNUA 5J39A 1M4VA 1WCMH 3T1HL 3PO2H 3J80i 2JA6G 5C5LA 3R8BA 3H3VC 3NTHA 1XMOQ 4CJ1B 1YJWA 1N8RC 1MJEA 1WTOA 4X65Q 1UE6A 4UP7A 2H5XA 2LKVA 1WTQA 1I6HH 5FJ8G 2EYPA 1XX8A 4NB3A 2Z8LA 1Y8PB 1QZHA 4OO1I 5KRUA 2WAQE 1F2MA 4QGUA 4DR7Q 1CKOA 1GO3E 1PTOC 4JI8L 4DN4M 5C44G 3EN2A 1T5XD 1VQAA 4XXEA 4FXKC 3LWEA 4K2KA 1TWFB 4RHRA 1JC7A 1HCZA 2NN6G 2UU9L 1SMYC 4CBVA 4DPGA 5J22A 4Y7NB 1FR3A 2GA4B 2MP1A 4RGNA 2MPMA 4A3BB 1ZYRD 2B2VC 4DV4L 3AFQA 1ET6A 3I4NG 3PF5A 3A8IE 4OWXB 3SVMA 1VQMA 1I50H 1JOKA 4OX9Q 1V43A 3BU2A 3GTPB 5IP9H 2B2YC 1SYCA 2F0FA 1G6PA 2N3SA 1RD9D 3TZUA 2B63B 1A62A 1HUNA 3TZDA 1A3TA 5EGTA 5IT9E 1YHBA 2ICIA 2JJQA 2A73B 3PQIA 4ZUIA 3S1MB 3W1BA 3K8AA 4K8JA 1Q1BA 2RHSB 2KHIA 4XT3B 2F0IA 3SR1A 1U0LA 2F0TA 2IY5B 1WTWA 3F2UA 1WTHA 4H7BA 1I4HA 1XMQQ 4FXGC 2EXDA 4C2MB 5T1IA 1NCVA 3GV6A 1B53A 1MIUA 3N6RA 4OEMB 3FMCA 3TP8A 2KUMA 2RKSA 4X64L 4RKLA 1NNXA 1HQMC 2UXDQ 4OWWB 3CC4A 3MTSA 3S14H 4S3SA 4DAYA 1SFOB 4ODGA 3D0FA 3MEHA 4QJFA 5JEAG 3PIP3 2WINB 3I4MH 2R92G 2E8GA 4LFCQ 3PIO3 4NKLA 5I9OA 4FYDA 4Q5VA 4IZ8A 3DUZA 1D5MC 4LK1C 3V96A 3L2PA 1Q7YC 1JB3A 1TS2A 3KLSX 1D5ZC 2PNRC 1L1OC 1DJRD 1YI2A 2DNEA 4JBJA 1X54A 2B2VA 3R93A 4A3LH 4CKEA 5HGQA 4UPAA 5FLXc 3K57A 2Q2IA 2B2YA 1A15A 4QUFA 5JPNC 2F0HA 5TSSA 2XWJB 3QJYA 2YV5A 3Q0AA 3OMGA 2PW7A 4LF6Q 3E9IA 4KLKA 3KLWA 4EQNA 2HHHL 3RMHA 2MO1A 1EY8A 3Q6SA 4DA2A 2A68D 2F52A 1PTOB 4DAYB 3MA2B 5CBAE 4L5TA 1Q46A 1HXYD 2EIFA 1KTKA 3KF8A 2F0VA 1R9TB 3DXJC 1Q82C 5IIFA 1VS0A 4A3FB 4DR2L 3QIAA 3M4PA 4AQYQ 4WFN3 1IYVA 3AFPA 4Y7NH 1QOHA 3HKSA 2ZTDA 3PO3B 4JYAL 4NXNQ 2F4IA 4POGA 3HOYB 4DR4L 4K8IA 1VQKA 2J7ZA 3U4ZA 4ILWA 4DR3Q 2I0QA 3GTPH 3D3RA 5KNDA 3T1YQ 2QGQA 2B63H 1Y8OB 4IUVA 3SK8A 4AYBG 5IP7H 2XVSA 1PXUA 1W6JA 2F0JA 1HR0W 3P75A 1SNPA 4QB4A 3E0JA 1B50A 2PI2E 2ES2A 4DK0A 1LT6D 4LNQA 1L1OA 5G3LD 3PUWA 2NVTB 1N32Q 4LMQD 1PH2A 4YHHQ 1LTRD 1Y1VH 1PZKD 2IT1A 3KF8B 1EEID 4K6DA 5KIXA 2GVAA 5DLQE 4H0LC 4UHVA 2JN4A 3A8KE 3MXPA 3MAQA 1VQEA 2MQHA 3P1HA 1XPRA 1PH7A 1ET9A 3E3XA 4O0AA 5EQ0A 3Q22A 3IAYA 1IBMQ 1IKLA 3CRKC 3AEVA 5C4XB 1FNUA 2EYJA 2KQ3A 4DKAC 1UE5A 1WCMG 4GLAC 3T53B 3ND9A 4IJLA 3PO2G 5LL6S 1STEA 4RWSC 4MNOA 1W3SA 2EQSA 1VDZA 4DAVA 2L5TA 1OXTA 2X6LA 4GKJL 1D2BA 1WVLA 1CI3M 5KEEA 2I07B 1C9OA 4A4IA 3DMUA 1XNRL 1L1OB 1XXGA 2O5JC 1SNDA 2D2CC 2K52A 1X55A 1VQ5A 4L6TB 3H3VH 1TS5A 1B3QA 2B29A 2RDHA 1HNXQ 1OO9B 4LF9Q 1BQQT 3MFYA 4K6LA 5DM63 1K3BC 4DR5L 1HZ9A 3NEMA 3F2DA 4UY8C 2F0WA 4N9PA 1O7YA 1QUQA 2KJXA 5CYUA 1U4LA 3IL8A 2DUDA 2JEAI 4IOCA 2QILA 5G3LF 1ONLA 4BA2I 4QCLA 1PTOH 3NXWA 3BDOA 2EYHA 1UE1A 2C5CA 2ZJPA 2PW5A 4DK3C 1SYDA 4HSPA 3R3OA 3S17B 2UUCQ 1NE3A 4ZK9B 4ME3A 1R9TH 4R4IA 1CHQD 4MTKA 2L55A 4A3FH 3CCRA 1MJCA 2K33A 5IP9G 3S1NB 4B3TQ 4A3GH 2RHQB 1F2LA 1TT2A 2FINB 1EOTA 4I65A 4DNIA 1EZ6A 1SR3A 1YNND 4IUPA 5GQOA 3PO3H 3H3VI 3HOYH 1X3EA 2OTLA 4KHVA 3LX0A 2O2LD 1NMGA 1PMRA 1VQ7A 4ZUJA 1S4ZA 1J5EQ 4JI7Q 2OQ0A 5LHY1 5FLXL 3K5MA 4IQZA 4A3JB 5M9OA 1EY7A 2E74C 2L0CA 1SBBB 1QUQB 3BZKA 2UXBL 1PFSA 2NVTH 3SHLA 1WTRA 1TQOA 4FO2A 3TP6A 1STNA 5KYLA 2E5LQ 1TS3A 2VW9A 4M8AA 1C0AA 1C4QA 2EYOA 5H1SE 2CWAA 2JXMB 4DUZL 2PMZB 1HR0L 4RCOA 1XPUA 1VQDA 1I3QB 1SYGA 1UNSA 1E7ZA 1WD0A 2BH8A 2YTYA 4XTCS 3OTOQ 1L0WA 1LM0A 1D7QA 1PZID 5ISRA 4JV5L 3OMCA 2B8GA 4A3LG 1GUOA 1BF4A 4POFA 4JOIC 4CDCC 3M4QA 2B2UC 4DXFA 1V1QA 1EY0A 1LTTD 3C46A 1JWMD 3NHHA 3J81L 2L1BA 2RCFA 4IN3A 2K28A 2CQAA 1HFNA 5M5XH 3FKIB 4L63B 3F2BA 1QVFA 1LTLA 1BR9A 1Y8NB 4C3IB 4A3CH 2Z6KC 1Q81C 3E0EA 1S72A 2FXQA 4F87A 5EPLA 3CCQA 1QVGA 5GADC 1DXMA 4IO9A 3CMAA 1VQNA 3MC0B 3SK4A 1BXTA 1Q8IA 1EYGA 1JICA 1SE4A 1JOOA 2PYKA 5GROA 2PPBC 3WOFA 3CCSA 4A3BG 2BA0A 3HZXA 1HHVA 2J0TD 1N33Q 1ZYRC 1R4QB 2JK8A 4A3MB 1PYBA 1QILA 2JYOA 3S2HH 1H9SA 2WKDA 1QB5D 4QY7A 1ZXTA 2SNMA 2D9UA 4KD4A 3HFZB 2L4NA 4G7OC 2LXKA 3TS0A 4NPSA 4FF2A 4JOIA 5JAVA 1K28A 3DLLA 4ZCKA 4DFAA 1YJNA 1N34L 2YYZA 4QF4A 2WB1E 2XRSD 3M3YB 3MXUA 1X9NA 1STHA 2GVBA 1WYDA 2Z9HA 1NSNS 5IYCH 3VR2A 2K5NA 1GVPA 4CHTB 2Z6KA 4Y52H 2NWGA 1TWAB 3H94A 2HD3A 3QO2A 5KYIA 2I5HA 2SEBD 1GHJA 4YWLA 3LGJA 3IFDA 2EPBA 4OIKA 3CF5A 1VMCA 4JI6Q 1H9SB 4LF5Q 1HA5A 1I3QH 1ICWA 1KAAA 3CC7A 1PRTC 3CKIB 2BOSA 4GLXA 5IGBA 1PHJA 5AJ3L 5FO8B 4QIWE 2O4XA 2F3WA 3LNNA 1Q90A 4P74A 2QA4A 4B3SQ 3I8ZA 1D6EC 3CMEA 1MD2D 4PG3A 2A6ED 2EJMA 2Q8IB 4BY7H 1S5DD 5A2QL 1EY4A 1HUMA 1XJVA 1HRJA 4X62L 5LMNL 4DV7L 3M4OB 3FKIH 1PFMA 1EYDA 1K3RA 2R93B 4GKKQ 2B8FA 1F2ZA 1A3VA 4FNFA 4C3IH 3RUZA 4MZ9A 2J4XA 3ERQA 1E3PA 2KECA 3KFUA 2K5HA 1NR2A 1X6OA 4XQJA 5CGKA 2ICEC 1B44D 3STBC 2RSNA 2ZM6L 1T5EA 1STBA 3DM3A 3J7ZC 4A3FG 1L0XB 1EQRA 1WTPA 1CK1A 3PO3G 4RGMA 2CFMA 1KABA 2OF1A 1N36L 4NXMQ 1CA6A 1F2YA 1FNVA 3A5UA 1TXYA 3H09A 1TY0A 4A3MH 1YHQA 5C4HA 1I6VC 1Z6HA 1EY9A 5A35A 1PZJD 1LTGD 1UEAB 3T56B 4CGYB 1V9PA 1LUZA 3PUXA 1KNEA 1GUGA 2F0NA 2OT2A 2F3IA 3M7NA 2VUMB 3MXGA 2VQEQ 3CPFA 3FP9A 3S1QB 3LWUA 1EIYB 2E2IB 4JK1C 1Q3LA 3D4WA 1TKWB 5ELNA 2F0PA 3RLOA 4BXXG 1Q8KA 4C1NI 1DYQA 3BZCA 4G4KA 2A69D 1LV9A 4EX5A 1EQVA 2TMPA 4OO1H 4WJ3M 4IUNA 3DEOA 2Z4HA 5DEHA 2EY2A 3AQQA 3E5SA 4LF4L 2VNUD 2QF7A 4FF3A 3I4MB 1A3UA 3GTLB 1CZWA 5C4XG 1TWAH 3D4DA 4YWMA 3K5NA 2UXCL 3Q24A 2EJFC 3NUCA 1EIFA 3D6CA 3BVMA 1SNMA 1SYBA 3VA5A 1EIHA 5M3FB 3HOWH 1UE7A 1XTCD 1PH5A 4GN5A 4DV5L 1K8GA 3S9WA 4LF7Q 1PRTB 1TIID 4ZAIA 4GOPC 3NQIA 3BVZA 2N78A 4R4CA 2CW0D 1KC8C 4LFBQ 2ZJQA 1KXLA 3DM1A 3SXHA 2N49A 1GM5A 1JR0D 4KK7A 1T9HA 2RDFA 2YU9H 1VCIA 3CCMA 5KNBA 2CCZA 4KJNA 1CFMA 1I94L 4JCVE 1X3GA 3TP7A 4DV6L 4A3KB 3M4OH 4CDDC 2JQOA 4JI1Q 2R93H 5D3DA 1EYAA 3EROA 3PUYA 4L5RC 3HOUB 2RVLA 2H4OA 3G7LA 4JI5L 2A6HD 4B9WA 5FOBB 2O5IC 3CPWA 5E7NA 1SYFA 5IOCA 4EQPA 1KRTA 4JW0A 4KN7C 4HIOA 1B9NA 3PF4A 1HA6A 2HIVA 3T16A 2JEBI 4WJ4A 1PVOA 1VQCA 4YCUA 2JA5B 4A3EB 1YNNC 2KEDA 3V2TA 2Z0SA 4P75A 3GTOB 2KA7A 2CQOA 3FVQA 2N88A 4LF8L 4RMFA 2X69A 1MKHA 2R7ZB 1XNQQ 4PNYA 5L37A 3HOZH 4BS9A 3NE5B 3A54A 3BYTB 4A3JG 2B39A 1Y1VB 2VUMH 3L3OC 2L9HA 3CAMA 2IPKD 1LTAD 1OXSC 3S1QH 1DOLA 4X66Q 4JI4L 5T1GA 4DV0Q 2E2IH 2N8NA 1TS4A 1KL9A 2WIIB 2DY8A 4ZKCB 3JAMc 3K7AB 2EY5A 1EU4A 2JA8B 3DHQA 2AQ3B 1B8AA 3ND8A 4HAEA 5F2DA 5M5WH 2D5DA 3S2DH 3DWAA 5JJIA 4C3HH 3TS2A 3PV0A 2K01A 1SNOA 2UUAQ 3MEFA 3OW2A 3FEWX 4A93B 5K5PA 1QVCA 2DJFC 3RLFA 3GTLH 1QNKA 4HJ8A 1VQ9A 2C35B 1NY4A 4ALPA 4JI2Q 5IGFA 2B2WC 1N33L 1JE4A 1J9OA 1CKMA 3O13A 1QJOA 4KKTA 4IUUA 3BG3A 5DAUA 5M3FH 4RGTA 1SDFA 1TY2A 3X3MA 5IY0A 4HJ7A 3FKIG 1KLUD 3L0OA 3OW7A 1KHIA 3K0YA 4C3IG 3GTGB 5ELEA 2V4DA 4YY3L 2MNAA 4DV3L 1IBKL 1JJGA 2KOLA 3L7ZC 1ICFB 1XPOA 4P71A 2QEJC 2AHOB 3NTIA 1HNWL 1YITA 4KY6A 3KDFA 1ZKOA 5C3EB 4A3KH 5JPMC 1EY6A 2XN9C 3QR8A 1UAPA 1L2FA 1FGUA 3MXNA 3I56A 1K9MC 2WB1G 3CD6A 1S5ED 3HOUH 1Z7TA 3F8TA 3W3AA 4ZLTF 4JI3L 4A3GB 4DUYQ 5DNFA 4TSSA 2ZT9C 1O7IA 2ZJRA 1BUVT 4HJAA 1SJED 1GJXA 1SE3A 4P72A 3TMEA 4DR1L 1PH1A 1D1KA 3J7A5 2R7FA 4R4OA 3J81c 3TRZA 2JA5H 2L11A 3FDTA 4A3EH 5D65A 1XYIA 2CWPA 4IALA 1BCPC 2NVYB 3GTOH 1S5CD 1SEBD 4KMUC 2VQFQ 5GAHC 4K0KL 1IZ6A 5C3WA 1PDQA 2ID0A 3I3CA 2R7ZH 3I72A 1AN8A 3KDFB 3T4AC 3ITPA 5BN4A 3PSIA 2ASBA 1S40A 5EPJA 5ELOA 1V8QA 3MXNB 4IUTA 2CHBD 3UDFA 4B3RQ 2CKZB 2HDLA 4TVAB 5GAEC 3UDXA 5FLXE 2A1AA 4IFDG 1M1KC 3K7AH 2JA8H 1GD7A 5EKKA 5BR8L 1VQJA 1VQ8A 4DV1L 3A8JE 4HMIA 1Z47A 4H13C 4ZQ3A 1PH6A 4A93H 3VYUA 1QE6A 3BS1A 1HJPA 1A2UA 2JE6I 1KDBA 3FPUB 4JI0Q 2OEOA 1EEFD 3D8GA 5M5XB 2MUYA 4DR6Q 2K6AA 1Q12A 3CCLA 2BE5C 3J7YW 1J8IA 1GUWA 1CHPD 1NTGA 4HR7B 2LSSA 2OTJA 3TP5A 2K04A 4KHPQ 2A6EC 4X3KA 4G57A 2VQEL 5K36H 1B2TA 2E75C 3OPOA 2R93G 3NELA 3GTGH 1RTNA 1AW7A 1DZ1A 4RH6A 4B3MQ 2HT1A 1S5FD 4R1JA
chains in the Genus database with same CATH topology
1SNQA 3M7GA 1G291 2QKIC 3JAML 1PTOD 2Q8RE 4CKBA 1G91A 2K5DA 4KD3A 2XRQD 3OWFA 3H6MA 5ELFA 1L0YB 3S2HB 3NWTA 2RQXA 4ABNA 2N55A 1SMYD 1SNCA 1QCBD 2FJ2A 2R6GA 4WJWA 4OHJA 4K5XA 2A5HA 3IFTA 1DOKA 3TBIB 1PFNA 3S16B 3V05A 3NBHA 1CM9A 3I4NB 1PLFA 3GTQB 3M4YA 3S15B 1U9RA 2K5QA 2ZXPA 1QG7A 1BCPB 4LJZC 1X3QA 4A3IB 1K8MA 3AU7A 4XQNA 5C0XI 3P20A 4HMJA 2K03A 1LACA 2A69C 2R3ZA 2QDBA 3U9OA 1RTOA 3SK5A 3BDCA 1AFPA 1KDAA 1TVXA 3QG1A 2XIWA 3TDQA 4RKBA 1PTOF 4BBRB 3A55A 4I7ZC 4X3TA 4X3UA 3VR4A 3OIPA 1PFBA 1F9RA 4BY7B 2QCPX 4MIUA 4MHEA 3HKZB 5I4DA 5ELBA 4IURA 5FK9C 4FVMA 2K32A 3VA7A 3NQTA 1STAA 2AUKA 2MHVA 3H0GB 3A7LA 4F8MA 1ML0D 1LO5D 1Y69U 3PUZA 5FKAC 3VR6A 1JORA 1G6ZA 3ZYYX 3MWYW 2NVQB 1WTXA 3CRLC 2NVXB 4IUQA 4L8JA 1A2TA 4QMGA 1GOZA 2EY6A 5IGEA 4FP5D 2EJGC 2NN6H 3QOJA 3DWPA 1EQTA 3MVVA 4CJ2C 5FO9B 3K5LA 4ID6A 1A6XA 3SE0A 4ULLA 1DCZA 4HSVA 1MGSA 3L9AX 2B2UA 1EWCA 2Q8TA 3C3LA 1OXXK 2BDOA 5I2XA 1EYCA 2WP8J 4BY1B 2X6GA 4KKSA 1VMPA 3Q23A 2KHSA 5DM73 2EVBA 4XDXA 1Y1WB 2E2HB 2BA1A 4BBSB 3RD4A 2NN6I 3U9SA 4DU9A 3HOWB 2IW3A 3A56A 5JEAJ 4DF7A 5CMDA 1LTSD 1O7ZA 2EYMA 4BA1I 5CV5A 3OWEB 4WRDA 2K1BA 3DWQA 1LT5D 3MHBA 4K2LA 2RBMA 4KY7A 1SYEA 4U68A 4K14A 2YU9B 2F0SA 2AQ1B 5JEAH 1B1ZA 1ESRA 3IKJA 4TQUS 4XYOA 4FXDA 4DGZA 4U673 1R4PB 5C3XA 3R2IA 3PMFA 4Q0FA 4XQQA 2JSOA 1AP0A 3VYRA 2A68C 1KNAA 5CC4A 3VYSA 1V1PA 1I4XA 4FF4A 3I70A 2H1EA 5C5MA 4J8QA 1BOSA 1AZQA 4PMWA 3AMUA 1RODA 3T13A 5I6YA 2SOBA 3CQZB 1MI2A 3HOZB 3K6OA 1FYCA 1LABA 2IX1A 5CV4A 5JVH3 2EYLA 5IGGA 3EJIA 2XWBB 1IKMA 3J80L 3PUVA 3GTKB 4DK1A 3K5OA 2E2DC 1VF5C 5M5WB 1V1PB 3S2DB 5CV7A 4C3HB 3C1FA 5COYA 1BDOA 4R8NA 4B08A 1ILQA 5KNCA 4DNTB 1K8OA 1G8ZD 2LFNA 1JQYD 2F0KA 4KI0A 1MBYA 4XYQA 2WAQB 1YNJD 1C48A 4XIGS 2IX0A 3KLSA 4N9TA 5AFWA 1IYUA 3T51B 1NUCA 1EFID 1JWUD 1HTPA 4DNRB 3WOEA 5ELCA 1U4MA 2EOTA 5LL6X 1LT3D 3NK9A 3P7JA 1TR5A 4WORA 1F9PA 4KJOA 3A7AB 4EVOA 4X3SA 2SDFA 3W2DA 2B2TC 4Z9CB 1IL8A 1H9MA 2F0QA 2SNSA 3NPPA 3HGBA 2HCCA 4IFDI 1ENAA 2KCNA 1Q1EA 2RDGA 2PZTA 3HG9A 3G6JB 4GZYC 4KHZA 1STGA 3GD7A 1I4RA 2Y0SB 2F0OA 3VR5A 1E2ZA 2EZVA 1E0BA 3GV3A 4EQOA 1BO0A 4LAAA 3E6ZX 4BWGB 4O1NA 2DNCA 1TU2B 4XT1B 5EBCA 2PZUA 1XWEA 2HCIA 4PV1C 1LTID 5EJWA 2JA7B 1HQRD 4RGOS 4PQXA 3HOXB 4HCEA 3CU7A 4NP5A 3QWNA 5J1ZA 1GUTA 2ZXRA 5JVG3 2B2TA 5BN5A 3TN2A 2VB3X 2KEEA 2IX3A 4NDXA 3AB9A 1PRTD 2AWNA 2M9VA 1KLGD 3K59A 2E2JB 2IJ0A 2F03A 3SK6A 1UUPA 1EWHA 1FGBD 1LT4D 1EIGA 2FMCA 2ENBA 1VF7A 2F0EA 3DEPA 1OXVA 2WKCA 2F3VA 3C2PA 1FD7D 3K58A 2LS01 3GTJB 2HDMA 3BVGA 2HUGA 3C1EA 4R9WA 3UI2A 1IHZA 1G2SA 2WACA 5CV6A 2AQ2B 5IT9L 2M00A 1CTMA 3OSOA 3JAME 4J1MA 1I4PA 5KGUA 1CA5A 3NTKA 3GTMB 3CHBD 1GXDC 2B2WA 3MFGA 5C6AA 1CT1D 1SAPA 4C3JB 4OO1G 1PRTF 3S1RB 2F0GA 4CJ0B 5NUCA 4CKCA 4RAUC 4E6IA 3HOVB 5C4ZA 2OXPA 3M85A 1AEXA 1EY5A 2IL8A 2F0UA 1IW7D 4NW2A 5M3MB 2EY1A 3KUPA 2WV6D 2DY7A 4ZRZA 4DXGA 1SE2A 1CQVA 4A3DB 2K5WA 3KLRA 4V190 5E4WC 2A74C 3SDZA 2KCCA 1O78A 2JA6B 1JOQA 4HTHA 4KTAA 5C4JB 5C0XJ 1B4OA 2F0MA 2Z1CA 3H91A 4ZYSA 2FFKB 2K05A 2KVMA 4QUCA 4TRDA 5BN3A 3KK7A 2F1MA 3J81E 2G9DA 1PYWD 2K7VA 2F0LA 4KY5A 4KN4C 4R8IA 1RCVD 2CVRA 1AZPA 3OHXC 5M5YB 5C0XH 2EE1A 1RHPA 1MSHA 5C44B 1SJHD 1MSGA 1NAPA 4PMCA 2PQEA 1O7LA 3SEBA 3GP7A 3WDNA 4ZKBB 5JJZA 1HTLD 2PZWA 2NBFA 5CBEE 2I46A 2NTSA 3BYYB 1DM0B 2R61A 1K83B 3I91A 1F9SA 2LMCB 3FRPB 2F0DA 4TKOB 4C56C 3D6WA 3N52A 4P2CB 3HS0C 1H9RA 4RCNA 5HGTA 5IGDA 3EVQA 1LTBD 1RDPD 5EKIA 4JBWA 4C3HG 1C8CA 1H9KA 2M2LA 2C9OA 2ZXOA 1LLRD 1TWCB 3I73A 4ME5A 3X3NA 3R2TA 2L12A 4G7HC 3I90A 1HFGA 1YNJC 2NUCA 1WTVA 2R92B 2TSSA 5E1FA 1CZGA 2EYFA 1EL0A 1HPCA 1JCKB 2CW0C 1GHKA 4UAIA 5CORA 5CV8A 3D31A 3QOLA 5I2YA 4OIJA 4M1UB 3EA6A 3EFXD 1TWHB 5ELDA 5CV9A 1B9MA 1F77A 1OXUA 3NP8A 1FNWA 5A2QE 2PO4A 2FHTA 2A6HC 1O80A 3VYTA 3HEJA 1I4QA 2VXWA 5FO7B 3URYA 1E2VA 1D5XC 2RA4A 3QB3A 3VR3A 2NZ1D 2WB1B 3OIQA 1X32A 1H9JA 4H44C 3NBIA 2NYZD 3MZ5A 5I9PA 3TSSA 3BZDB 2BCOA 1GUSA 2Z4IA 2G9HD 2NB0A 1BCPD 4MN3A 2D62A 2EDGA 1WD1A 4AYBB 1QWYA 3RZDB 1DONA 3D4RA 5D14A 4EGVA 1SSOA 4HCSA 4QIWB 1DOMA 1STYA 4J6HA 3I4LA 5EPKA 1B3AA 1V1OA 1BBXC 3HRZC 3J80E 4OL7A 1ESFA 1I4GA 4G7ZC 4K5WA 1EZ8A 3GQBA 3RZOB 1WCMB 4K5VA 4O42A 3HP3A 4V0BA 3PO2B 1RJTA 2JP1A 2VB2X 1U4RA 4RFBA 3ONAB 5K36G 4HN7A 3EQLC 5E3FA 5HURA 2MJ8A 2IWHA 1I6HB 2MGSA 2BE5D 1BNZA 4KV6A 3NWSA 1KDCA 4KKUA 3NSWA 1ILPA 5C0XG 4B9XA 1SXTA 1BCPF 3OOCA 4OGQC 5EKLA 5IODA 1EU3A 4RA8A 2DN8A 1CQFA 5I6WA 2NTTA 2HQEA 4F88A 5JOBA 1GUNA 2XNAC 1JWSD 4PMBA 1U4PA 1I50B 5IGCA 5CR3A 1ENFA 2BDNA 1X3PA 2FMMA 1TWGB 3KBGA 4C3JG 1M8AA 3J7AF 4UDUC 5EBDA 2AUJD 3FPPA 3KBXA 4F7XA 1E2WA 2XSCA 5E4XA 1ZEQX 3GO5A 4C1NK 4DAPA 1RKNA 4RHSA 1ENCA 2E76C 4HEDA 1S5BD 2PCFB 1F9QA 5D3IB 4IFDJ 1D1IA 1II3A 1W6KA 3J7AV 1NR4A 1IW7C 4NMZA 3S14B 4FF1A 2AWOA 2LY7A 2RSOA 2EXZA 1DD2A 3BDLA 1G2TA 4YIJA 4IFDH 1RF2D 1QNUA 5J39A 1M4VA 5C5LA 3R8BA 3H3VC 3NTHA 4CJ1B 1WTOA 2LKVA 1WTQA 2EYPA 1XX8A 2Z8LA 1Y8PB 4OO1I 5KRUA 1F2MA 1PTOC 4DN4M 1T5XD 4XXEA 4FXKC 3LWEA 4K2KA 1TWFB 4RHRA 1JC7A 1HCZA 2NN6G 1SMYC 4CBVA 5J22A 4Y7NB 1FR3A 2GA4B 2MP1A 4RGNA 2MPMA 4A3BB 1ZYRD 2B2VC 1ET6A 3A8IE 3SVMA 1JOKA 1V43A 3GTPB 2B2YC 1SYCA 2F0FA 1RD9D 3TZUA 2B63B 1HUNA 3TZDA 1A3TA 5EGTA 5IT9E 2ICIA 4ZUIA 2A73B 3S1MB 4K8JA 1Q1BA 4XT3B 2F0IA 3SR1A 2F0TA 1WTWA 3F2UA 4H7BA 1I4HA 4FXGC 4C2MB 5T1IA 1NCVA 3GV6A 1B53A 3N6RA 3FMCA 3TP8A 2KUMA 2RKSA 4RKLA 1HQMC 3MTSA 4S3SA 4DAYA 1SFOB 4ODGA 3MEHA 5JEAG 3PIP3 2WINB 3PIO3 4NKLA 5I9OA 4FYDA 4Q5VA 4IZ8A 3DUZA 1D5MC 4LK1C 3V96A 1JB3A 1TS2A 3KLSX 1D5ZC 2PNRC 1DJRD 2DNEA 2B2VA 3R93A 4CKEA 3K57A 2B2YA 1A15A 4QUFA 5JPNC 2F0HA 5TSSA 2XWJB 3QJYA 3Q0AA 3OMGA 2PW7A 4EQNA 3RMHA 1EY8A 3Q6SA 4DA2A 2A68D 1PTOB 3MA2B 5CBAE 1HXYD 1KTKA 3KF8A 2F0VA 1R9TB 3DXJC 5IIFA 4A3FB 3QIAA 4WFN3 1IYVA 1QOHA 3PO3B 2F4IA 3HOYB 4K8IA 2J7ZA 4ILWA 3D3RA 5KNDA 1Y8OB 4IUVA 3SK8A 2XVSA 1PXUA 1W6JA 2F0JA 3P75A 1SNPA 4QB4A 3E0JA 1B50A 4DK0A 1LT6D 5G3LD 3PUWA 2NVTB 4LMQD 1LTRD 1PZKD 2IT1A 1EEID 4K6DA 5KIXA 4H0LC 3A8KE 3MXPA 3MAQA 3P1HA 1ET9A 5EQ0A 3Q22A 3IAYA 1IKLA 3CRKC 5C4XB 1FNUA 2EYJA 2KQ3A 3T53B 3ND9A 5LL6S 1STEA 4RWSC 1VDZA 4DAVA 2L5TA 1OXTA 2X6LA 1D2BA 1WVLA 1CI3M 5KEEA 2I07B 3DMUA 1XXGA 2O5JC 1SNDA 2D2CC 4L6TB 1TS5A 2RDHA 1OO9B 1BQQT 3MFYA 4K6LA 5DM63 2F0WA 4N9PA 1O7YA 5CYUA 2KJXA 1U4LA 3IL8A 2JEAI 2QILA 5G3LF 1ONLA 4BA2I 4QCLA 1PTOH 3BDOA 3NXWA 2EYHA 2C5CA 2PW5A 1SYDA 4HSPA 3R3OA 3S17B 4ZK9B 1CHQD 2L55A 2K33A 3S1NB 1F2LA 1TT2A 2FINB 1EOTA 4I65A 1EZ6A 4IUPA 1YNND 4KHVA 3LX0A 2O2LD 1PMRA 4ZUJA 1S4ZA 5LHY1 5FLXL 3K5MA 4IQZA 4A3JB 5M9OA 1EY7A 2E74C 2L0CA 1SBBB 3SHLA 1WTRA 1TQOA 4FO2A 3TP6A 1STNA 5KYLA 1TS3A 4M8AA 1C4QA 2EYOA 2JXMB 2PMZB 4RCOA 1I3QB 1SYGA 1UNSA 1WD0A 4XTCS 1PZID 5ISRA 3OMCA 2B8GA 1GUOA 1BF4A 2B2UC 4DXFA 1EY0A 1LTTD 3C46A 1JWMD 3NHHA 3J81L 2L1BA 4IN3A 2K28A 2CQAA 1HFNA 3FKIB 4L63B 1BR9A 1Y8NB 4C3IB 4F87A 5EPLA 1DXMA 3MC0B 3SK4A 1BXTA 1Q8IA 1JICA 1SE4A 1JOOA 2PYKA 2PPBC 3WOFA 2BA0A 3HZXA 1HHVA 2J0TD 1ZYRC 1R4QB 4A3MB 1QILA 2JYOA 1H9SA 2WKDA 1QB5D 1ZXTA 2SNMA 2D9UA 4KD4A 2L4NA 4G7OC 4FF2A 5JAVA 4DFAA 2YYZA 4QF4A 2XRSD 3M3YB 3MXUA 1STHA 1NSNS 3VR2A 4CHTB 2NWGA 1TWAB 3H94A 3QO2A 5KYIA 2SEBD 1GHJA 3IFDA 2EPBA 4OIKA 1VMCA 1H9SB 1HA5A 1ICWA 1KAAA 1PRTC 3CKIB 2BOSA 5IGBA 5FO8B 2O4XA 2F3WA 3LNNA 1Q90A 3I8ZA 1D6EC 1MD2D 2A6ED 2EJMA 2Q8IB 1S5DD 5A2QL 1EY4A 1HUMA 1HRJA 3M4OB 1PFMA 1EYDA 2R93B 2B8FA 1F2ZA 1A3VA 4FNFA 3RUZA 2J4XA 3ERQA 2KECA 1NR2A 4XQJA 5CGKA 2ICEC 1B44D 2RSNA 1T5EA 1STBA 1L0XB 1WTPA 1CK1A 4RGMA 1KABA 2OF1A 1CA6A 1F2YA 1FNVA 3H09A 1TY0A 5C4HA 1I6VC 1Z6HA 1EY9A 5A35A 1PZJD 1LTGD 1UEAB 3T56B 4CGYB 3PUXA 1KNEA 1GUGA 2F0NA 2OT2A 3M7NA 2VUMB 3MXGA 3S1QB 3LWUA 2E2IB 4JK1C 1Q3LA 3D4WA 1TKWB 2F0PA 4C1NI 1DYQA 4G4KA 2A69D 1LV9A 1EQVA 2TMPA 4OO1H 4IUNA 3DEOA 2Z4HA 5DEHA 2EY2A 3E5SA 2VNUD 2QF7A 4FF3A 3I4MB 1A3UA 3GTLB 1CZWA 3D4DA 3K5NA 3Q24A 2EJFC 3NUCA 3D6CA 3BVMA 1SNMA 1SYBA 3VA5A 1EIHA 5M3FB 1XTCD 3S9WA 1PRTB 1TIID 4ZAIA 3NQIA 3BVZA 2CW0D 3DM1A 3SXHA 1JR0D 4KK7A 2RDFA 1VCIA 5KNBA 4KJNA 1CFMA 3TP7A 4A3KB 5D3DA 1EYAA 3EROA 3PUYA 3HOUB 2RVLA 2H4OA 3G7LA 2A6HD 4B9WA 5FOBB 2O5IC 1SYFA 5IOCA 4EQPA 4KN7C 1B9NA 1HA6A 3T16A 2JEBI 2JA5B 4A3EB 1YNNC 2KEDA 3V2TA 3GTOB 2KA7A 3FVQA 2N88A 2X69A 2R7ZB 4PNYA 4BS9A 3NE5B 3A54A 3BYTB 2B39A 1Y1VB 3L3OC 2L9HA 2IPKD 1LTAD 1OXSC 1DOLA 5T1GA 1TS4A 2WIIB 2DY8A 4ZKCB 3K7AB 2EY5A 1EU4A 2JA8B 3DHQA 2AQ3B 5F2DA 3ND8A 4HAEA 2D5DA 3DWAA 3PV0A 2K01A 1SNOA 3FEWX 4A93B 5K5PA 3RLFA 1QNKA 5IGFA 2B2WC 1JE4A 1J9OA 3O13A 1QJOA 4KKTA 4IUUA 3BG3A 5DAUA 4RGTA 1SDFA 1TY2A 3X3MA 1KLUD 3OW7A 3K0YA 4C3IG 3GTGB 5ELEA 2V4DA 2KOLA 3L7ZC 2QEJC 3NTIA 4KY6A 1ZKOA 5C3EB 5JPMC 1EY6A 2XN9C 1UAPA 3MXNA 1S5ED 1Z7TA 3W3AA 4ZLTF 4A3GB 5DNFA 4TSSA 2ZT9C 1BUVT 1SJED 1GJXA 1SE3A 3TMEA 1D1KA 2L11A 3FDTA 1XYIA 5D65A 4IALA 1BCPC 2NVYB 1S5CD 1SEBD 4KMUC 5C3WA 1PDQA 2ID0A 3I3CA 3I72A 1AN8A 3T4AC 3ITPA 5BN4A 5EPJA 1V8QA 4IUTA 2CHBD 2HDLA 5FLXE 4IFDG 5EKKA 3A8JE 4HMIA 1Z47A 4H13C 4ZQ3A 3VYUA 1QE6A 3BS1A 1A2UA 2JE6I 1KDBA 3FPUB 2OEOA 1EEFD 3D8GA 5M5XB 2MUYA 2K6AA 1Q12A 2BE5C 3J7YW 1J8IA 1GUWA 1CHPD 4HR7B 3TP5A 2K04A 2A6EC 4X3KA 4G57A 5K36H 1B2TA 2E75C 3OPOA 1RTNA 1AW7A 1DZ1A 4RH6A 1S5FD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML0 D;  2L12 A;  2D9U A;  1CA6 A;  4ZLT F;  2EOT A;  4HED A;  5E4W C;  1S4Z A;  2Q8R E;  1F9Q A;  5DNF A;  1G91 A;  1HA6 A;  3I90 A;  1HFG A;  3P7J A;  1NR4 A;  5T1I A;  2L4N A;  1WTV A;  1G6Z A;  1NCV A;  1AP0 A;  3GV6 A;  1B53 A;  1F9P A;  3MWY W;  4LMQ D;  1WTX A;  4IUQ A;  2RSO A;  2KUM A;  1EL0 A;  1KNA A;  2KED A;  4X3S A;  4O42 A;  3HP3 A;  1KNE A;  2N55 A;  1G2T A;  1EIG A;  4UAI A;  2SDF A;  2FJ2 A;  1RJT A;  1B4O A;  2JP1 A;  2N88 A;  1WTR A;  1U4R A;  2H1E A;  3MTS A;  5COR A;  3H91 A;  2B2T C;  2FFK B;  3DEP A;  3ONA B;  2K05 A;  2KVM A;  1DOK A;  2L11 A;  1IL8 A;  2X69 A;  3FDT A;  4QUC A;  5D65 A;  5EQ0 A;  1XYI A;  1PFN A;  1Q3L A;  4OIJ A;  1IKL A;  2MJ8 A;  1CM9 A;  2L9H A;  4R8I A;  1AZQ A;  2HDM A;  2MGS A;  1PLF A;  1ROD A;  1LV9 A;  2HCC A;  2CVR A;  2HUG A;  4CJ1 B;  1DOL A;  1EQT A;  1PDQ A;  4CJ2 C;  1AZP A;  2EE1 A;  3I3C A;  2NWG A;  5T1G A;  1WTO A;  4R9W A;  1BNZ A;  1RHP A;  3QO2 A;  1WD0 A;  1MSH A;  3UI2 A;  1QG7 A;  1MSG A;  2DY8 A;  1NAP A;  3DEO A;  4RWS C;  4ZKC B;  1G2S A;  1X3Q A;  2FHT A;  2B2V A;  1MI2 A;  3R93 A;  4HSV A;  1MGS A;  5EPJ A;  1WTQ A;  1ILP A;  3IFD A;  2EPB A;  1O80 A;  4OIK A;  2X6L A;  4IUT A;  1VMC A;  2B2U A;  1XX8 A;  2VXW A;  4ZKB B;  1WVL A;  2Q8T A;  5JJZ A;  1ICW A;  1BF4 A;  4HAE A;  2B2Y A;  5CBE E;  2HDL A;  1A15 A;  2RA4 A;  4RA8 A;  2X6G A;  2B2U C;  2K03 A;  2K01 A;  4QUF A;  1GUW A;  1E0B A;  3GV3 A;  1VMP A;  1BO0 A;  2NZ1 D;  4DN4 M;  1IKM A;  1CA5 A;  2R3Z A;  2L1B A;  1EIH A;  1QNK A;  2B2W A;  2K28 A;  1X32 A;  3I91 A;  1HFN A;  1RTO A;  3I8Z A;  1F9S A;  3LWE A;  3Q6S A;  4XT1 B;  1U4P A;  4ZAI A;  2B2W C;  1JE4 A;  1SAP A;  2NYZ D;  1QE6 A;  1TVX A;  1J9O A;  5COY A;  1O7Y A;  2XIW A;  1HUM A;  3DM1 A;  4IUU A;  2HCI A;  4XDX A;  5CBA E;  2MP1 A;  1HRJ A;  3FPU B;  5EPL A;  1U4L A;  2BDN A;  3D6W A;  2MPM A;  1ILQ A;  1PFM A;  3N52 A;  2B2V C;  3IL8 A;  4CJ0 B;  1SDF A;  4RAU C;  3SVM A;  5EJW A;  5CMD A;  1X3P A;  4MN3 A;  2FMM A;  4X3T A;  4X3U A;  1O7Z A;  1WD1 A;  1J8I A;  2B2Y C;  1PFB A;  1F9R A;  2IL8 A;  2KEC A;  1B50 A;  1DON A;  1NR2 A;  5EKI A;  4ZK9 B;  5D14 A;  1M8A A;  1JIC A;  4MHE A;  1HUN A;  2KOL A;  2K1B A;  4NW2 A;  1SSO A;  3TZD A;  4HCS A;  2K04 A;  1C8C A;  4X3K A;  2RSN A;  4IUR A;  5AFW A;  2J7Z A;  2M2L A;  4U68 A;  3KUP A;  2B2T A;  1F2L A;  2RVL A;  2FIN B;  1DOM A;  1EOT A;  2DY7 A;  3G7L A;  4IUP A;  1B2T A;  3TN2 A;  1ESR A;  1RTN A;  5EPK A;  1B3A A;  3KBX A;  4XT3 B;  1DZ1 A;  1HHV A;  2KEE A;  4IUV A;  1WTP A;  5E4X A;  1BBX C;  1WTW A;  3F2U A;  2JYO A;  1U4M A;  1ZXT A; 
#chains in the Genus database with same CATH topology
 3ERS X;  1SNQ A;  3M7G A;  4DV2 Q;  1CSP A;  1VQP A;  1G29 1;  2QKI C;  3JAM L;  5C3E H;  1PTO D;  2Q8R E;  4CKB A;  1G91 A;  3G71 A;  4H02 A;  2K5D A;  4I7A A;  4KD3 A;  2XRQ D;  3OWF A;  3H6M A;  4HID A;  2XTI A;  5ELF A;  1L0Y B;  3S2H B;  3GTJ H;  1JB7 A;  3NWT A;  2RQX A;  4ABN A;  2N55 A;  1SMY D;  5IYB H;  1K73 C;  1SNC A;  1QCB D;  2FJ2 A;  2R6G A;  4WJW A;  4OHJ A;  4OEL B;  4K5X A;  2A5H A;  3IFT A;  1DOK A;  1PH3 A;  3TBI B;  3TQY A;  1PFN A;  3S16 B;  3V05 A;  3NBH A;  1CM9 A;  3ER0 A;  1XMO L;  3I4N B;  3KF6 A;  1PLF A;  3T1H Q;  4X65 L;  2I5L X;  4JBK A;  3M4Y A;  3GTQ B;  1U9R A;  3S15 B;  2K5Q A;  2ZXP A;  1QG7 A;  2NVY H;  1BCP B;  4LJZ C;  1X3Q A;  4A3I B;  1K8M A;  1KQS A;  3AU7 A;  4XQN A;  1IL2 A;  5C0X I;  3P20 A;  4HMJ A;  4DR7 L;  2K03 A;  4YWK A;  3B6Y A;  1VQB A;  1LAC A;  2A69 C;  2R3Z A;  3S1R H;  2QDB A;  1Z9F A;  3U9O A;  4JI8 Q;  4UP9 A;  1RTO A;  3I4M G;  3TEH B;  5LMN W;  3SK5 A;  4HJ5 A;  3BDC A;  4LWC A;  1PA6 A;  1AFP A;  1KDA A;  1TVX A;  3QG1 A;  2IHF A;  2XIW A;  2UU9 Q;  3TDQ A;  2I5M X;  4RKB A;  3K80 C;  4OX9 L;  3NBH B;  1PTO F;  4BBR B;  5M3F G;  4DV4 Q;  3A55 A;  3KF6 B;  2Z6B A;  4I7Z C;  4X3T A;  4X3U A;  3VR4 A;  3OIP A;  1PFB A;  1F9R A;  3ZJY C;  4BY7 B;  2QCP X;  4MIU A;  2KBN A;  4MHE A;  5FLM H;  3HKZ B;  5I4D A;  5ELB A;  2JA9 A;  4IUR A;  5FK9 C;  4FVM A;  2K32 A;  3VA7 A;  3J80 c;  3NQT A;  2A19 A;  1S3O A;  1STA A;  2AUK A;  2CH4 A;  1UEB A;  2MHV A;  3H0G B;  3G48 A;  4A3K G;  2PMZ E;  3A7L A;  4F8M A;  1XMQ L;  1ML0 D;  1LO5 D;  4QL5 A;  2F4V Q;  4X66 L;  1Y69 U;  3PUZ A;  2K4K A;  3HOU G;  5FKA C;  3VR6 A;  3F1Z A;  1JOR A;  1G6Z A;  3ZYY X;  3MWY W;  2NVQ B;  1WTX A;  3CRL C;  2NVX B;  1BBW A;  4IUQ A;  1VQO A;  2UXD L;  1NBW A;  4X64 Q;  4L8J A;  5M5Y H;  1A2T A;  5C44 H;  2ZTE A;  4QMG A;  2XGT A;  1WI5 A;  4IPG A;  1GOZ A;  4LFC L;  2EY6 A;  2B63 G;  5IGE A;  1WFQ A;  4FP5 D;  2CH4 W;  2EJG C;  3A5Z B;  2JA5 G;  4A3E G;  5IP7 G;  3ULL A;  3RNU A;  1K8A C;  2NN6 H;  3QOJ A;  3DWP A;  1EQT A;  3MVV A;  4CJ2 C;  4JI2 L;  5FO9 B;  3K5L A;  3K0X A;  4ID6 A;  1A6X A;  3S16 H;  3SE0 A;  4ULL A;  1DCZ A;  4HSV A;  1MGS A;  3I4N H;  2R7Z G;  3L9A X;  1X3F A;  1KIX A;  2B2U A;  1EWC A;  4JC0 A;  3GTQ H;  3S15 H;  2Q8T A;  4YCV A;  1Y1V G;  3C3L A;  1OXX K;  2BDO A;  5I2X A;  1EYC A;  2WP8 J;  4BY1 B;  2X6G A;  3CW2 C;  4A3I H;  4KKS A;  1VMP A;  4LFA Q;  3Q23 A;  2KHS A;  4LF6 L;  5DM7 3;  2K5V A;  2EVB A;  3W5O A;  2JA8 G;  2HHH Q;  1I5F A;  4XDX A;  1Y1W B;  2E2H B;  2BA1 A;  1MHW C;  4BBS B;  3RD4 A;  2NN6 I;  4A93 G;  3U9S A;  4DU9 A;  4AQY L;  3HOW B;  2IW3 A;  3A56 A;  5JJK A;  1TWC H;  5JEA J;  4DF7 A;  5CMD A;  1N9W A;  4DR2 Q;  1LTS D;  4NXN L;  1O7Z A;  5IWA Q;  1E1T A;  2EYM A;  4BA1 I;  5CV5 A;  4JYA Q;  1SLJ A;  3OWE B;  4BBR H;  4WRD A;  2K1B A;  3DWQ A;  1LT5 D;  3MHB A;  4DR3 L;  1PV4 A;  4K2L A;  2RBM A;  4KY7 A;  1SYE A;  4DR4 Q;  4U68 A;  4K14 A;  4LUV A;  2YU9 B;  3T1Y L;  2F0S A;  2AQ1 B;  5JEA H;  1B1Z A;  1ESR A;  3IKJ A;  4TQU S;  4XYO A;  5LMU Q;  4FXD A;  4DGZ A;  4U67 3;  2A8V A;  1R4P B;  5C3X A;  3R2I A;  3PMF A;  4Q0F A;  4O2D A;  1N32 L;  4XQQ A;  4HIM A;  1JJC B;  1K0R A;  4YHH L;  1JJ2 A;  2JSO A;  1AP0 A;  5C3E G;  3H0G H;  3VYR A;  2A68 C;  1KNA A;  2BH2 A;  2RCN A;  5CC4 A;  3VYS A;  1V1P A;  1I4X A;  4FF4 A;  3I70 A;  2PQA A;  2H1E A;  4A3G G;  4X6A H;  2NVQ H;  2DJG C;  5C5M A;  4J8Q A;  1IBM L;  2NVX H;  1BOS A;  2QEX A;  3HOY G;  1AZQ A;  1YNX A;  4PMW A;  3AMU A;  4GLV B;  1ROD A;  3T13 A;  5I6Y A;  3RR5 A;  2KHJ A;  2SOB A;  3CQZ B;  4R4Q A;  1MI2 A;  3HOZ B;  3K6O A;  1FYC A;  1LAB A;  4IPD A;  3RN2 A;  1KD1 C;  2IX1 A;  4GKJ Q;  5CV4 A;  5JVH 3;  2EYL A;  3ULJ A;  5IGG A;  3EJI A;  2XWB B;  1HNX L;  4LF9 L;  1IKM A;  3J80 L;  3PUV A;  3GTK B;  4OON A;  4DK1 A;  1VQL A;  3NEN A;  3S24 A;  3K5O A;  2E2D C;  4BY1 H;  1VF5 C;  5IE8 A;  5M5W B;  1V1P B;  3S2D B;  5CV7 A;  2PQA B;  4C3H B;  4DR5 Q;  1C7Y A;  3C1F A;  5COY A;  1BDO A;  4R8N A;  3OYY A;  4B08 A;  1ILQ A;  5KNC A;  4DNT B;  1K8O A;  1E22 A;  1G8Z D;  2LFN A;  2R7D A;  2UUC L;  1JQY D;  2F0K A;  4KI0 A;  5IT9 c;  1CKN A;  1Y1W H;  2E2H H;  1MBY A;  4BBS H;  4XYQ A;  2WAQ B;  1YNJ D;  1C48 A;  4XIG S;  2DGY A;  4B3T L;  1A63 A;  2IX0 A;  3KLS A;  4N9T A;  5AFW A;  1IYU A;  3T51 B;  5FLM G;  1HNZ Q;  1NUC A;  1EFI D;  2G5D A;  1JWU D;  1HTP A;  3JC6 6;  4DNR B;  4A3C G;  3WOE A;  1FJG Q;  5ELC A;  1U4M A;  1J5E L;  1BVS A;  4JI7 L;  3U50 C;  4LW1 A;  2EOT A;  5LL6 X;  1LT3 D;  3NK9 A;  3P7J A;  1SE8 A;  1TR5 A;  4WOR A;  1F9P A;  1SMX A;  4KJO A;  3A7A B;  4EVO A;  1CSQ A;  4X3S A;  3U4V A;  2SDF A;  3W2D A;  1SRU A;  2E5L L;  2UXB Q;  2B2T C;  4Z9C B;  1IL8 A;  1CKN B;  1JE5 A;  1H9M A;  1VQI A;  2F0Q A;  2SNS A;  3NPP A;  3HGB A;  2HCC A;  4IFD I;  1ENA A;  4L5Q A;  2KCN A;  2HIX A;  1Q1E A;  2RDG A;  2PZT A;  2GN5 A;  3OTO L;  4DUZ Q;  3HG9 A;  3G6J B;  1HR0 Q;  4GZY C;  4KHZ A;  1STG A;  3GD7 A;  1I4R A;  2VL6 A;  2Y0S B;  4OXP A;  4JV5 Q;  2F0O A;  1BBU A;  1J6Q A;  3VR5 A;  3CQZ H;  1E2Z A;  2EZV A;  1E0B A;  3GV3 A;  4EQO A;  1BO0 A;  4LAA A;  1EWI A;  3E6Z X;  4BWG B;  4A3I G;  4GOP A;  2VY3 A;  2B3G A;  4O1N A;  5IYC G;  2DNC A;  2K50 A;  4CDE C;  1TU2 B;  1TWG H;  1FVI A;  4XT1 B;  5EBC A;  2PZU A;  3GTK H;  1XWE A;  2HCI A;  4PV1 C;  2NZH A;  2F4V L;  1LTI D;  1K0S A;  2YTX A;  5EJW A;  1X65 A;  2JA7 B;  1HQR D;  4RGO S;  4PQX A;  4JBM A;  3HOX B;  4HCE A;  3CU7 A;  2K14 A;  4NP5 A;  3QWN A;  5J1Z A;  2Q2T A;  2Y0S E;  3EBE A;  1GUT A;  2ZXR A;  5JVG 3;  2AMC B;  2B2T A;  2PI2 A;  4BBR G;  5BN5 A;  3TN2 A;  1VQF A;  2VB3 X;  2KEE A;  1U5K A;  2IX3 A;  4NDX A;  4BY7 G;  2OQK A;  3AB9 A;  1PRT D;  3F2C A;  2AWN A;  2M9V A;  1KLG D;  3HKZ G;  2RF4 A;  4GOP B;  1JT8 A;  3K59 A;  3I55 A;  2MFI A;  3WWV A;  3PGZ A;  1ASY A;  2E2J B;  2IJ0 A;  2F03 A;  2YTV A;  2KEN A;  3SK6 A;  2QW7 A;  1UUP A;  4RG1 A;  1EWH A;  4L5S A;  1FGB D;  5GAG C;  1LT4 D;  3H0G G;  1EIG A;  2FMC A;  1P16 A;  2ENB A;  1VF7 A;  4MTN A;  1IXR A;  2F0E A;  1IBL Q;  3DEP A;  1OXV A;  2WKC A;  1N34 Q;  2MO0 A;  2OWO A;  4LFA L;  2F3V A;  3C2P A;  1FD7 D;  3K58 A;  4APV A;  2LS0 1;  3GTJ B;  2HDM A;  3BVG A;  3CCU A;  2HUG A;  3KJP A;  3CCE A;  3C1E A;  4R9W A;  3Q8D A;  3UI2 A;  3STB D;  1IHZ A;  2KCM A;  1G2S A;  3G6E A;  5J3B A;  2WAC A;  5CV6 A;  4A3M G;  4JI6 L;  2AQ2 B;  5IT9 L;  4LF5 L;  2M00 A;  1YJ9 A;  1CTM A;  3OSO A;  1RL2 A;  5IYD H;  1TWF H;  3JAM E;  4J1M A;  1I4P A;  5IWA L;  2VS1 A;  5KGU A;  4FDB A;  1DGS A;  1CA5 A;  3NTK A;  3GTM B;  4A3B H;  4B3S L;  3CHB D;  1GXD C;  5AJ3 Q;  2B2W A;  2WFW A;  3MFG A;  5C6A A;  1CT1 D;  5LMU L;  1SAP A;  4C3J B;  1PYS B;  4BY1 G;  4JG2 A;  3TRE A;  4OO1 G;  2OCE A;  1PRT F;  4GKK L;  4GN3 B;  3S1R B;  4X62 Q;  5LMN Q;  2F0G A;  4CJ0 B;  4DV7 Q;  5NUC A;  3S1M H;  4CKC A;  4RAU C;  4E6I A;  2UUB Q;  1JMC A;  3HOV B;  5C4Z A;  2OXP A;  3M85 A;  3KOJ A;  1AEX A;  1EY5 A;  4N8F A;  4CDF C;  2IL8 A;  1Y14 B;  2D0O A;  2F0U A;  1IW7 D;  4NW2 A;  1Y1W G;  5M3M B;  3W1G A;  2IHE A;  2EY1 A;  2JA7 H;  3KUP A;  4BBS G;  2WV6 D;  2ZM6 Q;  2DY7 A;  4ZRZ A;  3G4S A;  4C2M H;  3HOW G;  3HOX H;  1VQG A;  4DXG A;  1EUJ A;  1SE2 A;  1CQV A;  1SN8 A;  4A3D B;  4NXM L;  2K5W A;  3KLR A;  3J81 j;  4V19 0;  1B70 B;  3A74 A;  5E4W C;  1N36 Q;  2A74 C;  2K75 A;  1UWV A;  1SFO H;  3SDZ A;  2KCC A;  1O78 A;  5JJL A;  1E24 A;  3ULP A;  2JA6 B;  1JOQ A;  4HTH A;  4KTA A;  5C4J B;  2E2J H;  5C0X J;  1B4O A;  1M90 C;  4AIM A;  2F0M A;  2Z1C A;  3H91 A;  4ZYS A;  2FFK B;  2K05 A;  2KVM A;  3KYH C;  4QUC A;  4TRD A;  5BN3 A;  3KK7 A;  2F1M A;  3J81 E;  4GNX C;  2G9D A;  1PYW D;  2K7V A;  2F0L A;  4KY5 A;  4KN4 C;  4R8I A;  1AH9 A;  1RCV D;  1BKB A;  2CVR A;  1AZP A;  3OHX C;  3RLN A;  5M5Y B;  5C0X H;  2EE1 A;  3UE0 A;  1AE3 A;  1RHP A;  4IOA A;  1MSH A;  5C44 B;  1SJH D;  1MSG A;  3I2Z A;  1NAP A;  4PMC A;  1E1O A;  2PQE A;  1O7L A;  3SEB A;  4DK6 C;  3GP7 A;  3WDN A;  1H95 A;  1D8L A;  4LF4 Q;  1X56 A;  4ZKB B;  4N8X 1;  5JJZ A;  5HY6 A;  1HTL D;  2PZW A;  1KAW A;  2NBF A;  1HZC A;  5CBE E;  2UXC Q;  2I46 A;  2NTS A;  3BYY B;  4HJ9 A;  1DM0 B;  1YEZ A;  2R61 A;  3EIV A;  4LF7 L;  3HOZ G;  1PH9 A;  1K83 B;  3I91 A;  1F9S A;  1HNZ L;  2VUM G;  1NMF A;  3CC2 A;  2LMC B;  3FRP B;  4DV5 Q;  4LFB L;  2F0D A;  3GTM H;  3PCO B;  1FJG L;  4TKO B;  4C56 C;  3D6W A;  1EOV A;  3N52 A;  4P2C B;  3HS0 C;  1H9R A;  4RCN A;  5HGT A;  5IGD A;  2V1C C;  4C3J H;  3JAM i;  1GKH A;  4LUZ A;  3EVQ A;  4JI1 L;  1LTB D;  1RDP D;  1I94 Q;  5EKI A;  4JBW A;  4C3H G;  4DV6 Q;  3CXC A;  1C8C A;  3HOV H;  1H9K A;  2M2L A;  2C9O A;  4HIK A;  2ZXO A;  1HH2 P;  1LLR D;  3VDY A;  4OWT B;  1TWC B;  3RN5 A;  4A75 A;  3I73 A;  4ME5 A;  3X3N A;  2HQL A;  4JI5 Q;  4GNX A;  1YHA A;  2QDL A;  1LYL A;  4BXX H;  5M3M H;  3R2T A;  4JPB W;  2Q2U A;  2WAQ G;  2L12 A;  1KRS A;  4G7H C;  5EAY A;  3UDI A;  1PH4 A;  1HZA A;  1HFG A;  1YNJ C;  3I90 A;  2NUC A;  1WTV A;  4A3D H;  1HZB A;  1ASZ A;  2R92 B;  3GDE A;  2TSS A;  4YCW A;  5C4X H;  5E1F A;  1CZG A;  2EYF A;  1EL0 A;  1HPC A;  4PZ7 A;  1JCK B;  2CW0 C;  1GHK A;  1Q86 C;  1PH8 A;  4UAI A;  5COR A;  5CV8 A;  3CP0 A;  1XNQ L;  3D31 A;  1VQ6 A;  4LF8 Q;  3QOL A;  2JA6 H;  5I2Y A;  4OIJ A;  2NZO A;  4M1U B;  3EA6 A;  3E9H A;  3EFX D;  1TWH B;  3AYH B;  5C4J H;  2ATW A;  5ELD A;  4DV0 L;  5CV9 A;  1B9M A;  1F77 A;  5FJ8 H;  1OXU A;  4J15 A;  3NP8 A;  4JI4 Q;  1FNW A;  5A2Q E;  2PO4 A;  1IYJ B;  2FHT A;  1CUK A;  4GNX B;  2A6H C;  1O80 A;  3VYT A;  3HEJ A;  1I4Q A;  2VXW A;  5FO7 B;  3URY A;  1E2V A;  1D5X C;  2UUA L;  3K7U C;  2RA4 A;  3QB3 A;  3HKZ E;  1YZ6 A;  5IYD G;  3VR3 A;  2PNH A;  2NZ1 D;  2WB1 B;  3OIQ A;  3J81 i;  1X32 A;  2Y0S G;  1P8L A;  1H9J A;  4H44 C;  4IJH A;  4AH6 A;  3NBI A;  2NYZ D;  3S17 H;  3MZ5 A;  1K83 H;  5I9P A;  3TSS A;  3S1N H;  3BZD B;  2BCO A;  2D0P A;  1GUS A;  2Z4I A;  3PIP A;  2G9H D;  2NB0 A;  1BCP D;  3A0J A;  1XTD A;  3K81 C;  4MN3 A;  3PIO A;  2D62 A;  2EDG A;  1WD1 A;  4AYB B;  1QWY A;  3RZD B;  1DON A;  3BJU A;  3D4R A;  4GS3 A;  5D14 A;  1SRO A;  2LXJ A;  4EGV A;  1SSO A;  4YY3 Q;  4HCS A;  4DV3 Q;  1IBK Q;  4QIW B;  4DAM A;  1DOM A;  3U58 A;  1IBL L;  1STY A;  4J6H A;  3I4L A;  5EPK A;  1B3A A;  1YIJ A;  1V1O A;  4UP8 A;  1HNW Q;  3CCJ A;  4A3J H;  2JA7 G;  3I4O A;  1BBX C;  1VQH A;  1RIP A;  1FL0 A;  3HRZ C;  2ALY B;  3HOX G;  3J80 E;  4OL7 A;  4DUY L;  2VZA A;  1ESF A;  1I4G A;  4JI3 Q;  4PZ8 A;  2ZTC A;  4K5W A;  1EZ8 A;  4G7Z C;  3GQB A;  4EQ5 A;  3RZO B;  1WCM B;  4K5V A;  4O42 A;  3HP3 A;  4V0B A;  3PO2 B;  1RJT A;  2JP1 A;  4AYB E;  2VB2 X;  1U4R A;  4DR1 Q;  4RFB A;  2R92 H;  3ONA B;  5K36 G;  3FHW A;  4HN7 A;  3EQL C;  2VQF L;  5E3F A;  1AE2 A;  5HUR A;  2MJ8 A;  3I7F A;  2IWH A;  4P73 A;  1I6H B;  2MGS A;  1NJI C;  2BE5 D;  1EFW A;  4A76 A;  1BNZ A;  4K0K Q;  4KV6 A;  1WOC A;  3NWS A;  1KDC A;  2P5Z X;  4KKU A;  3NSW A;  1ILP A;  1TWH H;  5C0X G;  3KJO A;  1WJJ A;  4B9X A;  4B3R L;  2UUB L;  1SXT A;  1BCP F;  3OOC A;  4OGQ C;  5EKL A;  5IOD A;  1EU3 A;  5IYB G;  4RA8 A;  2DN8 A;  1CQF A;  5I6W A;  2NTT A;  4R4T A;  2L15 A;  2HQE A;  4IPH A;  4PZ6 A;  4F88 A;  5JOB A;  1GUN A;  5BR8 Q;  2XNA C;  1JWS D;  2KCT A;  4PMB A;  3UE1 A;  4DV1 Q;  1U4P A;  1I50 B;  5IGC A;  5CR3 A;  1ENF A;  2BDN A;  4JI0 L;  4IPC A;  3IRB A;  1W2B A;  1A8V A;  3SGI A;  3CCV A;  1QZG A;  1A0I A;  3ICE A;  4DR6 L;  1X3P A;  3H15 A;  1VQ4 A;  2FMM A;  2Q2H A;  1TWG B;  2AKW B;  1XNR Q;  3KBG A;  4C3J G;  1M8A A;  4KHP L;  3J7A F;  4UDU C;  3UDG A;  5EBD A;  4JVZ A;  2AUJ D;  3FPP A;  3RZD H;  3KBX A;  4F7X A;  4B3M L;  3M9B A;  3HOV G;  1E2W A;  1YBY A;  2XSC A;  5E4X A;  4LUO A;  1ZEQ X;  3GO5 A;  4C1N K;  4DV2 L;  4DAP A;  1RKN A;  4RHS A;  1ENC A;  2E76 C;  1OTC A;  4HED A;  1S5B D;  2PCF B;  1F9Q A;  5D3I B;  5M3M G;  4IFD J;  1G51 A;  1D1I A;  1II3 A;  1W6K A;  1YVC A;  3J7A V;  1NR4 A;  3M3Y H;  1IW7 C;  4NMZ A;  3S14 B;  4FF1 A;  4QQB X;  2AWO A;  2LY7 A;  2RSO A;  2EXZ A;  4A3D G;  1DD2 A;  1EQQ A;  3BDL A;  1G2T A;  4YIJ A;  4IFD H;  1RF2 D;  1B7Y B;  4GN4 B;  3RZO H;  1QNU A;  5J39 A;  1M4V A;  1WCM H;  3T1H L;  3PO2 H;  3J80 i;  2JA6 G;  5C5L A;  3R8B A;  3H3V C;  3NTH A;  1XMO Q;  4CJ1 B;  1YJW A;  1N8R C;  1MJE A;  1WTO A;  4X65 Q;  1UE6 A;  4UP7 A;  2H5X A;  2LKV A;  1WTQ A;  1I6H H;  5FJ8 G;  2EYP A;  1XX8 A;  4NB3 A;  2Z8L A;  1Y8P B;  1QZH A;  4OO1 I;  5KRU A;  2WAQ E;  1F2M A;  4QGU A;  4DR7 Q;  1CKO A;  1GO3 E;  1PTO C;  4JI8 L;  4DN4 M;  5C44 G;  3EN2 A;  1T5X D;  1VQA A;  4XXE A;  4FXK C;  3LWE A;  4K2K A;  1TWF B;  4RHR A;  1JC7 A;  1HCZ A;  2NN6 G;  2UU9 L;  1SMY C;  4CBV A;  4DPG A;  5J22 A;  4Y7N B;  1FR3 A;  2GA4 B;  2MP1 A;  4RGN A;  2MPM A;  4A3B B;  1ZYR D;  2B2V C;  4DV4 L;  3AFQ A;  1ET6 A;  3I4N G;  3PF5 A;  3A8I E;  4OWX B;  3SVM A;  1VQM A;  1I50 H;  1JOK A;  4OX9 Q;  1V43 A;  3BU2 A;  3GTP B;  5IP9 H;  2B2Y C;  1SYC A;  2F0F A;  1G6P A;  2N3S A;  1RD9 D;  3TZU A;  2B63 B;  1A62 A;  1HUN A;  3TZD A;  1A3T A;  5EGT A;  5IT9 E;  1YHB A;  2ICI A;  2JJQ A;  2A73 B;  3PQI A;  4ZUI A;  3S1M B;  3W1B A;  3K8A A;  4K8J A;  1Q1B A;  2RHS B;  2KHI A;  4XT3 B;  2F0I A;  3SR1 A;  1U0L A;  2F0T A;  2IY5 B;  1WTW A;  3F2U A;  1WTH A;  4H7B A;  1I4H A;  1XMQ Q;  4FXG C;  2EXD A;  4C2M B;  5T1I A;  1NCV A;  3GV6 A;  1B53 A;  1MIU A;  3N6R A;  4OEM B;  3FMC A;  3TP8 A;  2KUM A;  2RKS A;  4X64 L;  4RKL A;  1NNX A;  1HQM C;  2UXD Q;  4OWW B;  3CC4 A;  3MTS A;  3S14 H;  4S3S A;  4DAY A;  1SFO B;  4ODG A;  3D0F A;  3MEH A;  4QJF A;  5JEA G;  3PIP 3;  2WIN B;  3I4M H;  2R92 G;  2E8G A;  4LFC Q;  3PIO 3;  4NKL A;  5I9O A;  4FYD A;  4Q5V A;  4IZ8 A;  3DUZ A;  1D5M C;  4LK1 C;  3V96 A;  3L2P A;  1Q7Y C;  1JB3 A;  1TS2 A;  3KLS X;  1D5Z C;  2PNR C;  1L1O C;  1DJR D;  1YI2 A;  2DNE A;  4JBJ A;  1X54 A;  2B2V A;  3R93 A;  4A3L H;  4CKE A;  5HGQ A;  4UPA A;  5FLX c;  3K57 A;  2Q2I A;  2B2Y A;  1A15 A;  4QUF A;  5JPN C;  2F0H A;  5TSS A;  2XWJ B;  3QJY A;  2YV5 A;  3Q0A A;  3OMG A;  2PW7 A;  4LF6 Q;  3E9I A;  4KLK A;  3KLW A;  4EQN A;  2HHH L;  3RMH A;  2MO1 A;  1EY8 A;  3Q6S A;  4DA2 A;  2A68 D;  2F52 A;  1PTO B;  4DAY B;  3MA2 B;  5CBA E;  4L5T A;  1Q46 A;  1HXY D;  2EIF A;  1KTK A;  3KF8 A;  2F0V A;  1R9T B;  3DXJ C;  1Q82 C;  5IIF A;  1VS0 A;  4A3F B;  4DR2 L;  3QIA A;  3M4P A;  4AQY Q;  4WFN 3;  1IYV A;  3AFP A;  4Y7N H;  1QOH A;  3HKS A;  2ZTD A;  3PO3 B;  4JYA L;  4NXN Q;  2F4I A;  4POG A;  3HOY B;  4DR4 L;  4K8I A;  1VQK A;  2J7Z A;  3U4Z A;  4ILW A;  4DR3 Q;  2I0Q A;  3GTP H;  3D3R A;  5KND A;  3T1Y Q;  2QGQ A;  2B63 H;  1Y8O B;  4IUV A;  3SK8 A;  4AYB G;  5IP7 H;  2XVS A;  1PXU A;  1W6J A;  2F0J A;  1HR0 W;  3P75 A;  1SNP A;  4QB4 A;  3E0J A;  1B50 A;  2PI2 E;  2ES2 A;  4DK0 A;  1LT6 D;  4LNQ A;  1L1O A;  5G3L D;  3PUW A;  2NVT B;  1N32 Q;  4LMQ D;  1PH2 A;  4YHH Q;  1LTR D;  1Y1V H;  1PZK D;  2IT1 A;  3KF8 B;  1EEI D;  4K6D A;  5KIX A;  2GVA A;  5DLQ E;  4H0L C;  4UHV A;  2JN4 A;  3A8K E;  3MXP A;  3MAQ A;  1VQE A;  2MQH A;  3P1H A;  1XPR A;  1PH7 A;  1ET9 A;  3E3X A;  4O0A A;  5EQ0 A;  3Q22 A;  3IAY A;  1IBM Q;  1IKL A;  3CRK C;  3AEV A;  5C4X B;  1FNU A;  2EYJ A;  2KQ3 A;  4DKA C;  1UE5 A;  1WCM G;  4GLA C;  3T53 B;  3ND9 A;  4IJL A;  3PO2 G;  5LL6 S;  1STE A;  4RWS C;  4MNO A;  1W3S A;  2EQS A;  1VDZ A;  4DAV A;  2L5T A;  1OXT A;  2X6L A;  4GKJ L;  1D2B A;  1WVL A;  1CI3 M;  5KEE A;  2I07 B;  1C9O A;  4A4I A;  3DMU A;  1XNR L;  1L1O B;  1XXG A;  2O5J C;  1SND A;  2D2C C;  2K52 A;  1X55 A;  1VQ5 A;  4L6T B;  3H3V H;  1TS5 A;  1B3Q A;  2B29 A;  2RDH A;  1HNX Q;  1OO9 B;  4LF9 Q;  1BQQ T;  3MFY A;  4K6L A;  5DM6 3;  1K3B C;  4DR5 L;  1HZ9 A;  3NEM A;  3F2D A;  4UY8 C;  2F0W A;  4N9P A;  1O7Y A;  1QUQ A;  2KJX A;  5CYU A;  1U4L A;  3IL8 A;  2DUD A;  2JEA I;  4IOC A;  2QIL A;  5G3L F;  1ONL A;  4BA2 I;  4QCL A;  1PTO H;  3NXW A;  3BDO A;  2EYH A;  1UE1 A;  2C5C A;  2ZJP A;  2PW5 A;  4DK3 C;  1SYD A;  4HSP A;  3R3O A;  3S17 B;  2UUC Q;  1NE3 A;  4ZK9 B;  4ME3 A;  1R9T H;  4R4I A;  1CHQ D;  4MTK A;  2L55 A;  4A3F H;  3CCR A;  1MJC A;  2K33 A;  5IP9 G;  3S1N B;  4B3T Q;  4A3G H;  2RHQ B;  1F2L A;  1TT2 A;  2FIN B;  1EOT A;  4I65 A;  4DNI A;  1EZ6 A;  1SR3 A;  1YNN D;  4IUP A;  5GQO A;  3PO3 H;  3H3V I;  3HOY H;  1X3E A;  2OTL A;  4KHV A;  3LX0 A;  2O2L D;  1NMG A;  1PMR A;  1VQ7 A;  4ZUJ A;  1S4Z A;  1J5E Q;  4JI7 Q;  2OQ0 A;  5LHY 1;  5FLX L;  3K5M A;  4IQZ A;  4A3J B;  5M9O A;  1EY7 A;  2E74 C;  2L0C A;  1SBB B;  1QUQ B;  3BZK A;  2UXB L;  1PFS A;  2NVT H;  3SHL A;  1WTR A;  1TQO A;  4FO2 A;  3TP6 A;  1STN A;  5KYL A;  2E5L Q;  1TS3 A;  2VW9 A;  4M8A A;  1C0A A;  1C4Q A;  2EYO A;  5H1S E;  2CWA A;  2JXM B;  4DUZ L;  2PMZ B;  1HR0 L;  4RCO A;  1XPU A;  1VQD A;  1I3Q B;  1SYG A;  1UNS A;  1E7Z A;  1WD0 A;  2BH8 A;  2YTY A;  4XTC S;  3OTO Q;  1L0W A;  1LM0 A;  1D7Q A;  1PZI D;  5ISR A;  4JV5 L;  3OMC A;  2B8G A;  4A3L G;  1GUO A;  1BF4 A;  4POF A;  4JOI C;  4CDC C;  3M4Q A;  2B2U C;  4DXF A;  1V1Q A;  1EY0 A;  1LTT D;  3C46 A;  1JWM D;  3NHH A;  3J81 L;  2L1B A;  2RCF A;  4IN3 A;  2K28 A;  2CQA A;  1HFN A;  5M5X H;  3FKI B;  4L63 B;  3F2B A;  1QVF A;  1LTL A;  1BR9 A;  1Y8N B;  4C3I B;  4A3C H;  2Z6K C;  1Q81 C;  3E0E A;  1S72 A;  2FXQ A;  4F87 A;  5EPL A;  3CCQ A;  1QVG A;  5GAD C;  1DXM A;  4IO9 A;  3CMA A;  1VQN A;  3MC0 B;  3SK4 A;  1BXT A;  1Q8I A;  1EYG A;  1JIC A;  1SE4 A;  1JOO A;  2PYK A;  5GRO A;  2PPB C;  3WOF A;  3CCS A;  4A3B G;  2BA0 A;  3HZX A;  1HHV A;  2J0T D;  1N33 Q;  1ZYR C;  1R4Q B;  2JK8 A;  4A3M B;  1PYB A;  1QIL A;  2JYO A;  3S2H H;  1H9S A;  2WKD A;  1QB5 D;  4QY7 A;  1ZXT A;  2SNM A;  2D9U A;  4KD4 A;  3HFZ B;  2L4N A;  4G7O C;  2LXK A;  3TS0 A;  4NPS A;  4FF2 A;  4JOI A;  5JAV A;  1K28 A;  3DLL A;  4ZCK A;  4DFA A;  1YJN A;  1N34 L;  2YYZ A;  4QF4 A;  2WB1 E;  2XRS D;  3M3Y B;  3MXU A;  1X9N A;  1STH A;  2GVB A;  1WYD A;  2Z9H A;  1NSN S;  5IYC H;  3VR2 A;  2K5N A;  1GVP A;  4CHT B;  2Z6K A;  4Y52 H;  2NWG A;  1TWA B;  3H94 A;  2HD3 A;  3QO2 A;  5KYI A;  2I5H A;  2SEB D;  1GHJ A;  4YWL A;  3LGJ A;  3IFD A;  2EPB A;  4OIK A;  3CF5 A;  1VMC A;  4JI6 Q;  1H9S B;  4LF5 Q;  1HA5 A;  1I3Q H;  1ICW A;  1KAA A;  3CC7 A;  1PRT C;  3CKI B;  2BOS A;  4GLX A;  5IGB A;  1PHJ A;  5AJ3 L;  5FO8 B;  4QIW E;  2O4X A;  2F3W A;  3LNN A;  1Q90 A;  4P74 A;  2QA4 A;  4B3S Q;  3I8Z A;  1D6E C;  3CME A;  1MD2 D;  4PG3 A;  2A6E D;  2EJM A;  2Q8I B;  4BY7 H;  1S5D D;  5A2Q L;  1EY4 A;  1HUM A;  1XJV A;  1HRJ A;  4X62 L;  5LMN L;  4DV7 L;  3M4O B;  3FKI H;  1PFM A;  1EYD A;  1K3R A;  2R93 B;  4GKK Q;  2B8F A;  1F2Z A;  1A3V A;  4FNF A;  4C3I H;  3RUZ A;  4MZ9 A;  2J4X A;  3ERQ A;  1E3P A;  2KEC A;  3KFU A;  2K5H A;  1NR2 A;  1X6O A;  4XQJ A;  5CGK A;  2ICE C;  1B44 D;  3STB C;  2RSN A;  2ZM6 L;  1T5E A;  1STB A;  3DM3 A;  3J7Z C;  4A3F G;  1L0X B;  1EQR A;  1WTP A;  1CK1 A;  3PO3 G;  4RGM A;  2CFM A;  1KAB A;  2OF1 A;  1N36 L;  4NXM Q;  1CA6 A;  1F2Y A;  1FNV A;  3A5U A;  1TXY A;  3H09 A;  1TY0 A;  4A3M H;  1YHQ A;  5C4H A;  1I6V C;  1Z6H A;  1EY9 A;  5A35 A;  1PZJ D;  1LTG D;  1UEA B;  3T56 B;  4CGY B;  1V9P A;  1LUZ A;  3PUX A;  1KNE A;  1GUG A;  2F0N A;  2OT2 A;  2F3I A;  3M7N A;  2VUM B;  3MXG A;  2VQE Q;  3CPF A;  3FP9 A;  3S1Q B;  3LWU A;  1EIY B;  2E2I B;  4JK1 C;  1Q3L A;  3D4W A;  1TKW B;  5ELN A;  2F0P A;  3RLO A;  4BXX G;  1Q8K A;  4C1N I;  1DYQ A;  3BZC A;  4G4K A;  2A69 D;  1LV9 A;  4EX5 A;  1EQV A;  2TMP A;  4OO1 H;  4WJ3 M;  4IUN A;  3DEO A;  2Z4H A;  5DEH A;  2EY2 A;  3AQQ A;  3E5S A;  4LF4 L;  2VNU D;  2QF7 A;  4FF3 A;  3I4M B;  1A3U A;  3GTL B;  1CZW A;  5C4X G;  1TWA H;  3D4D A;  4YWM A;  3K5N A;  2UXC L;  3Q24 A;  2EJF C;  3NUC A;  1EIF A;  3D6C A;  3BVM A;  1SNM A;  1SYB A;  3VA5 A;  1EIH A;  5M3F B;  3HOW H;  1UE7 A;  1XTC D;  1PH5 A;  4GN5 A;  4DV5 L;  1K8G A;  3S9W A;  4LF7 Q;  1PRT B;  1TII D;  4ZAI A;  4GOP C;  3NQI A;  3BVZ A;  2N78 A;  4R4C A;  2CW0 D;  1KC8 C;  4LFB Q;  2ZJQ A;  1KXL A;  3DM1 A;  3SXH A;  2N49 A;  1GM5 A;  1JR0 D;  4KK7 A;  1T9H A;  2RDF A;  2YU9 H;  1VCI A;  3CCM A;  5KNB A;  2CCZ A;  4KJN A;  1CFM A;  1I94 L;  4JCV E;  1X3G A;  3TP7 A;  4DV6 L;  4A3K B;  3M4O H;  4CDD C;  2JQO A;  4JI1 Q;  2R93 H;  5D3D A;  1EYA A;  3ERO A;  3PUY A;  4L5R C;  3HOU B;  2RVL A;  2H4O A;  3G7L A;  4JI5 L;  2A6H D;  4B9W A;  5FOB B;  2O5I C;  3CPW A;  5E7N A;  1SYF A;  5IOC A;  4EQP A;  1KRT A;  4JW0 A;  4KN7 C;  4HIO A;  1B9N A;  3PF4 A;  1HA6 A;  2HIV A;  3T16 A;  2JEB I;  4WJ4 A;  1PVO A;  1VQC A;  4YCU A;  2JA5 B;  4A3E B;  1YNN C;  2KED A;  3V2T A;  2Z0S A;  4P75 A;  3GTO B;  2KA7 A;  2CQO A;  3FVQ A;  2N88 A;  4LF8 L;  4RMF A;  2X69 A;  1MKH A;  2R7Z B;  1XNQ Q;  4PNY A;  5L37 A;  3HOZ H;  4BS9 A;  3NE5 B;  3A54 A;  3BYT B;  4A3J G;  2B39 A;  1Y1V B;  2VUM H;  3L3O C;  2L9H A;  3CAM A;  2IPK D;  1LTA D;  1OXS C;  3S1Q H;  1DOL A;  4X66 Q;  4JI4 L;  5T1G A;  4DV0 Q;  2E2I H;  2N8N A;  1TS4 A;  1KL9 A;  2WII B;  2DY8 A;  4ZKC B;  3JAM c;  3K7A B;  2EY5 A;  1EU4 A;  2JA8 B;  3DHQ A;  2AQ3 B;  1B8A A;  3ND8 A;  4HAE A;  5F2D A;  5M5W H;  2D5D A;  3S2D H;  3DWA A;  5JJI A;  4C3H H;  3TS2 A;  3PV0 A;  2K01 A;  1SNO A;  2UUA Q;  3MEF A;  3OW2 A;  3FEW X;  4A93 B;  5K5P A;  1QVC A;  2DJF C;  3RLF A;  3GTL H;  1QNK A;  4HJ8 A;  1VQ9 A;  2C35 B;  1NY4 A;  4ALP A;  4JI2 Q;  5IGF A;  2B2W C;  1N33 L;  1JE4 A;  1J9O A;  1CKM A;  3O13 A;  1QJO A;  4KKT A;  4IUU A;  3BG3 A;  5DAU A;  5M3F H;  4RGT A;  1SDF A;  1TY2 A;  3X3M A;  5IY0 A;  4HJ7 A;  3FKI G;  1KLU D;  3L0O A;  3OW7 A;  1KHI A;  3K0Y A;  4C3I G;  3GTG B;  5ELE A;  2V4D A;  4YY3 L;  2MNA A;  4DV3 L;  1IBK L;  1JJG A;  2KOL A;  3L7Z C;  1ICF B;  1XPO A;  4P71 A;  2QEJ C;  2AHO B;  3NTI A;  1HNW L;  1YIT A;  4KY6 A;  3KDF A;  1ZKO A;  5C3E B;  4A3K H;  5JPM C;  1EY6 A;  2XN9 C;  3QR8 A;  1UAP A;  1L2F A;  1FGU A;  3MXN A;  3I56 A;  1K9M C;  2WB1 G;  3CD6 A;  1S5E D;  3HOU H;  1Z7T A;  3F8T A;  3W3A A;  4ZLT F;  4JI3 L;  4A3G B;  4DUY Q;  5DNF A;  4TSS A;  2ZT9 C;  1O7I A;  2ZJR A;  1BUV T;  4HJA A;  1SJE D;  1GJX A;  1SE3 A;  4P72 A;  3TME A;  4DR1 L;  1PH1 A;  1D1K A;  3J7A 5;  2R7F A;  4R4O A;  3J81 c;  3TRZ A;  2JA5 H;  2L11 A;  3FDT A;  4A3E H;  5D65 A;  1XYI A;  2CWP A;  4IAL A;  1BCP C;  2NVY B;  3GTO H;  1S5C D;  1SEB D;  4KMU C;  2VQF Q;  5GAH C;  4K0K L;  1IZ6 A;  5C3W A;  1PDQ A;  2ID0 A;  3I3C A;  2R7Z H;  3I72 A;  1AN8 A;  3KDF B;  3T4A C;  3ITP A;  5BN4 A;  3PSI A;  2ASB A;  1S40 A;  5EPJ A;  5ELO A;  1V8Q A;  3MXN B;  4IUT A;  2CHB D;  3UDF A;  4B3R Q;  2CKZ B;  2HDL A;  4TVA B;  5GAE C;  3UDX A;  5FLX E;  2A1A A;  4IFD G;  1M1K C;  3K7A H;  2JA8 H;  1GD7 A;  5EKK A;  5BR8 L;  1VQJ A;  1VQ8 A;  4DV1 L;  3A8J E;  4HMI A;  1Z47 A;  4H13 C;  4ZQ3 A;  1PH6 A;  4A93 H;  3VYU A;  1QE6 A;  3BS1 A;  1HJP A;  1A2U A;  2JE6 I;  1KDB A;  3FPU B;  4JI0 Q;  2OEO A;  1EEF D;  3D8G A;  5M5X B;  2MUY A;  4DR6 Q;  2K6A A;  1Q12 A;  3CCL A;  2BE5 C;  3J7Y W;  1J8I A;  1GUW A;  1CHP D;  1NTG A;  4HR7 B;  2LSS A;  2OTJ A;  3TP5 A;  2K04 A;  4KHP Q;  2A6E C;  4X3K A;  4G57 A;  2VQE L;  5K36 H;  1B2T A;  2E75 C;  3OPO A;  2R93 G;  3NEL A;  3GTG H;  1RTN A;  1AW7 A;  1DZ1 A;  4RH6 A;  4B3M Q;  2HT1 A;  1S5F D;  4R1J A; 
#chains in the Genus database with same CATH homology
 1SNQ A;  3M7G A;  1G29 1;  2QKI C;  3JAM L;  1PTO D;  2Q8R E;  4CKB A;  1G91 A;  2K5D A;  4KD3 A;  2XRQ D;  3OWF A;  3H6M A;  5ELF A;  1L0Y B;  3S2H B;  3NWT A;  2RQX A;  4ABN A;  2N55 A;  1SMY D;  1SNC A;  1QCB D;  2FJ2 A;  2R6G A;  4WJW A;  4OHJ A;  4K5X A;  2A5H A;  3IFT A;  1DOK A;  3TBI B;  1PFN A;  3S16 B;  3V05 A;  3NBH A;  1CM9 A;  3I4N B;  1PLF A;  3GTQ B;  3M4Y A;  3S15 B;  1U9R A;  2K5Q A;  2ZXP A;  1QG7 A;  1BCP B;  4LJZ C;  1X3Q A;  4A3I B;  1K8M A;  3AU7 A;  4XQN A;  5C0X I;  3P20 A;  4HMJ A;  2K03 A;  1LAC A;  2A69 C;  2R3Z A;  2QDB A;  3U9O A;  1RTO A;  3SK5 A;  3BDC A;  1AFP A;  1KDA A;  1TVX A;  3QG1 A;  2XIW A;  3TDQ A;  4RKB A;  1PTO F;  4BBR B;  3A55 A;  4I7Z C;  4X3T A;  4X3U A;  3VR4 A;  3OIP A;  1PFB A;  1F9R A;  4BY7 B;  2QCP X;  4MIU A;  4MHE A;  3HKZ B;  5I4D A;  5ELB A;  4IUR A;  5FK9 C;  4FVM A;  2K32 A;  3VA7 A;  3NQT A;  1STA A;  2AUK A;  2MHV A;  3H0G B;  3A7L A;  4F8M A;  1ML0 D;  1LO5 D;  1Y69 U;  3PUZ A;  5FKA C;  3VR6 A;  1JOR A;  1G6Z A;  3ZYY X;  3MWY W;  2NVQ B;  1WTX A;  3CRL C;  2NVX B;  4IUQ A;  4L8J A;  1A2T A;  4QMG A;  1GOZ A;  2EY6 A;  5IGE A;  4FP5 D;  2EJG C;  2NN6 H;  3QOJ A;  3DWP A;  1EQT A;  3MVV A;  4CJ2 C;  5FO9 B;  3K5L A;  4ID6 A;  1A6X A;  3SE0 A;  4ULL A;  1DCZ A;  4HSV A;  1MGS A;  3L9A X;  2B2U A;  1EWC A;  2Q8T A;  3C3L A;  1OXX K;  2BDO A;  5I2X A;  1EYC A;  2WP8 J;  4BY1 B;  2X6G A;  4KKS A;  1VMP A;  3Q23 A;  2KHS A;  5DM7 3;  2EVB A;  4XDX A;  1Y1W B;  2E2H B;  2BA1 A;  4BBS B;  3RD4 A;  2NN6 I;  3U9S A;  4DU9 A;  3HOW B;  2IW3 A;  3A56 A;  5JEA J;  4DF7 A;  5CMD A;  1LTS D;  1O7Z A;  2EYM A;  4BA1 I;  5CV5 A;  3OWE B;  4WRD A;  2K1B A;  3DWQ A;  1LT5 D;  3MHB A;  4K2L A;  2RBM A;  4KY7 A;  1SYE A;  4U68 A;  4K14 A;  2YU9 B;  2F0S A;  2AQ1 B;  5JEA H;  1B1Z A;  1ESR A;  3IKJ A;  4TQU S;  4XYO A;  4FXD A;  4DGZ A;  4U67 3;  1R4P B;  5C3X A;  3R2I A;  3PMF A;  4Q0F A;  4XQQ A;  2JSO A;  1AP0 A;  3VYR A;  2A68 C;  1KNA A;  5CC4 A;  3VYS A;  1V1P A;  1I4X A;  4FF4 A;  3I70 A;  2H1E A;  5C5M A;  4J8Q A;  1BOS A;  1AZQ A;  4PMW A;  3AMU A;  1ROD A;  3T13 A;  5I6Y A;  2SOB A;  3CQZ B;  1MI2 A;  3HOZ B;  3K6O A;  1FYC A;  1LAB A;  2IX1 A;  5CV4 A;  5JVH 3;  2EYL A;  5IGG A;  3EJI A;  2XWB B;  1IKM A;  3J80 L;  3PUV A;  3GTK B;  4DK1 A;  3K5O A;  2E2D C;  1VF5 C;  5M5W B;  1V1P B;  3S2D B;  5CV7 A;  4C3H B;  3C1F A;  5COY A;  1BDO A;  4R8N A;  4B08 A;  1ILQ A;  5KNC A;  4DNT B;  1K8O A;  1G8Z D;  2LFN A;  1JQY D;  2F0K A;  4KI0 A;  1MBY A;  4XYQ A;  2WAQ B;  1YNJ D;  1C48 A;  4XIG S;  2IX0 A;  3KLS A;  4N9T A;  5AFW A;  1IYU A;  3T51 B;  1NUC A;  1EFI D;  1JWU D;  1HTP A;  4DNR B;  3WOE A;  5ELC A;  1U4M A;  2EOT A;  5LL6 X;  1LT3 D;  3NK9 A;  3P7J A;  1TR5 A;  4WOR A;  1F9P A;  4KJO A;  3A7A B;  4EVO A;  4X3S A;  2SDF A;  3W2D A;  2B2T C;  4Z9C B;  1IL8 A;  1H9M A;  2F0Q A;  2SNS A;  3NPP A;  3HGB A;  2HCC A;  4IFD I;  1ENA A;  2KCN A;  1Q1E A;  2RDG A;  2PZT A;  3HG9 A;  3G6J B;  4GZY C;  4KHZ A;  1STG A;  3GD7 A;  1I4R A;  2Y0S B;  2F0O A;  3VR5 A;  1E2Z A;  2EZV A;  1E0B A;  3GV3 A;  4EQO A;  1BO0 A;  4LAA A;  3E6Z X;  4BWG B;  4O1N A;  2DNC A;  1TU2 B;  4XT1 B;  5EBC A;  2PZU A;  1XWE A;  2HCI A;  4PV1 C;  1LTI D;  5EJW A;  2JA7 B;  1HQR D;  4RGO S;  4PQX A;  3HOX B;  4HCE A;  3CU7 A;  4NP5 A;  3QWN A;  5J1Z A;  1GUT A;  2ZXR A;  5JVG 3;  2B2T A;  5BN5 A;  3TN2 A;  2VB3 X;  2KEE A;  2IX3 A;  4NDX A;  3AB9 A;  1PRT D;  2AWN A;  2M9V A;  1KLG D;  3K59 A;  2E2J B;  2IJ0 A;  2F03 A;  3SK6 A;  1UUP A;  1EWH A;  1FGB D;  1LT4 D;  1EIG A;  2FMC A;  2ENB A;  1VF7 A;  2F0E A;  3DEP A;  1OXV A;  2WKC A;  2F3V A;  3C2P A;  1FD7 D;  3K58 A;  2LS0 1;  3GTJ B;  2HDM A;  3BVG A;  2HUG A;  3C1E A;  4R9W A;  3UI2 A;  1IHZ A;  1G2S A;  2WAC A;  5CV6 A;  2AQ2 B;  5IT9 L;  2M00 A;  1CTM A;  3OSO A;  3JAM E;  4J1M A;  1I4P A;  5KGU A;  1CA5 A;  3NTK A;  3GTM B;  3CHB D;  1GXD C;  2B2W A;  3MFG A;  5C6A A;  1CT1 D;  1SAP A;  4C3J B;  4OO1 G;  1PRT F;  3S1R B;  2F0G A;  4CJ0 B;  5NUC A;  4CKC A;  4RAU C;  4E6I A;  3HOV B;  5C4Z A;  2OXP A;  3M85 A;  1AEX A;  1EY5 A;  2IL8 A;  2F0U A;  1IW7 D;  4NW2 A;  5M3M B;  2EY1 A;  3KUP A;  2WV6 D;  2DY7 A;  4ZRZ A;  4DXG A;  1SE2 A;  1CQV A;  4A3D B;  2K5W A;  3KLR A;  4V19 0;  5E4W C;  2A74 C;  3SDZ A;  2KCC A;  1O78 A;  2JA6 B;  1JOQ A;  4HTH A;  4KTA A;  5C4J B;  5C0X J;  1B4O A;  2F0M A;  2Z1C A;  3H91 A;  4ZYS A;  2FFK B;  2K05 A;  2KVM A;  4QUC A;  4TRD A;  5BN3 A;  3KK7 A;  2F1M A;  3J81 E;  2G9D A;  1PYW D;  2K7V A;  2F0L A;  4KY5 A;  4KN4 C;  4R8I A;  1RCV D;  2CVR A;  1AZP A;  3OHX C;  5M5Y B;  5C0X H;  2EE1 A;  1RHP A;  1MSH A;  5C44 B;  1SJH D;  1MSG A;  1NAP A;  4PMC A;  2PQE A;  1O7L A;  3SEB A;  3GP7 A;  3WDN A;  4ZKB B;  5JJZ A;  1HTL D;  2PZW A;  2NBF A;  5CBE E;  2I46 A;  2NTS A;  3BYY B;  1DM0 B;  2R61 A;  1K83 B;  3I91 A;  1F9S A;  2LMC B;  3FRP B;  2F0D A;  4TKO B;  4C56 C;  3D6W A;  3N52 A;  4P2C B;  3HS0 C;  1H9R A;  4RCN A;  5HGT A;  5IGD A;  3EVQ A;  1LTB D;  1RDP D;  5EKI A;  4JBW A;  4C3H G;  1C8C A;  1H9K A;  2M2L A;  2C9O A;  2ZXO A;  1LLR D;  1TWC B;  3I73 A;  4ME5 A;  3X3N A;  3R2T A;  2L12 A;  4G7H C;  3I90 A;  1HFG A;  1YNJ C;  2NUC A;  1WTV A;  2R92 B;  2TSS A;  5E1F A;  1CZG A;  2EYF A;  1EL0 A;  1HPC A;  1JCK B;  2CW0 C;  1GHK A;  4UAI A;  5COR A;  5CV8 A;  3D31 A;  3QOL A;  5I2Y A;  4OIJ A;  4M1U B;  3EA6 A;  3EFX D;  1TWH B;  5ELD A;  5CV9 A;  1B9M A;  1F77 A;  1OXU A;  3NP8 A;  1FNW A;  5A2Q E;  2PO4 A;  2FHT A;  2A6H C;  1O80 A;  3VYT A;  3HEJ A;  1I4Q A;  2VXW A;  5FO7 B;  3URY A;  1E2V A;  1D5X C;  2RA4 A;  3QB3 A;  3VR3 A;  2NZ1 D;  2WB1 B;  3OIQ A;  1X32 A;  1H9J A;  4H44 C;  3NBI A;  2NYZ D;  3MZ5 A;  5I9P A;  3TSS A;  3BZD B;  2BCO A;  1GUS A;  2Z4I A;  2G9H D;  2NB0 A;  1BCP D;  4MN3 A;  2D62 A;  2EDG A;  1WD1 A;  4AYB B;  1QWY A;  3RZD B;  1DON A;  3D4R A;  5D14 A;  4EGV A;  1SSO A;  4HCS A;  4QIW B;  1DOM A;  1STY A;  4J6H A;  3I4L A;  5EPK A;  1B3A A;  1V1O A;  1BBX C;  3HRZ C;  3J80 E;  4OL7 A;  1ESF A;  1I4G A;  4G7Z C;  4K5W A;  1EZ8 A;  3GQB A;  3RZO B;  1WCM B;  4K5V A;  4O42 A;  3HP3 A;  4V0B A;  3PO2 B;  1RJT A;  2JP1 A;  2VB2 X;  1U4R A;  4RFB A;  3ONA B;  5K36 G;  4HN7 A;  3EQL C;  5E3F A;  5HUR A;  2MJ8 A;  2IWH A;  1I6H B;  2MGS A;  2BE5 D;  1BNZ A;  4KV6 A;  3NWS A;  1KDC A;  4KKU A;  3NSW A;  1ILP A;  5C0X G;  4B9X A;  1SXT A;  1BCP F;  3OOC A;  4OGQ C;  5EKL A;  5IOD A;  1EU3 A;  4RA8 A;  2DN8 A;  1CQF A;  5I6W A;  2NTT A;  2HQE A;  4F88 A;  5JOB A;  1GUN A;  2XNA C;  1JWS D;  4PMB A;  1U4P A;  1I50 B;  5IGC A;  5CR3 A;  1ENF A;  2BDN A;  1X3P A;  2FMM A;  1TWG B;  3KBG A;  4C3J G;  1M8A A;  3J7A F;  4UDU C;  5EBD A;  2AUJ D;  3FPP A;  3KBX A;  4F7X A;  1E2W A;  2XSC A;  5E4X A;  1ZEQ X;  3GO5 A;  4C1N K;  4DAP A;  1RKN A;  4RHS A;  1ENC A;  2E76 C;  4HED A;  1S5B D;  2PCF B;  1F9Q A;  5D3I B;  4IFD J;  1D1I A;  1II3 A;  1W6K A;  3J7A V;  1NR4 A;  1IW7 C;  4NMZ A;  3S14 B;  4FF1 A;  2AWO A;  2LY7 A;  2RSO A;  2EXZ A;  1DD2 A;  3BDL A;  1G2T A;  4YIJ A;  4IFD H;  1RF2 D;  1QNU A;  5J39 A;  1M4V A;  5C5L A;  3R8B A;  3H3V C;  3NTH A;  4CJ1 B;  1WTO A;  2LKV A;  1WTQ A;  2EYP A;  1XX8 A;  2Z8L A;  1Y8P B;  4OO1 I;  5KRU A;  1F2M A;  1PTO C;  4DN4 M;  1T5X D;  4XXE A;  4FXK C;  3LWE A;  4K2K A;  1TWF B;  4RHR A;  1JC7 A;  1HCZ A;  2NN6 G;  1SMY C;  4CBV A;  5J22 A;  4Y7N B;  1FR3 A;  2GA4 B;  2MP1 A;  4RGN A;  2MPM A;  4A3B B;  1ZYR D;  2B2V C;  1ET6 A;  3A8I E;  3SVM A;  1JOK A;  1V43 A;  3GTP B;  2B2Y C;  1SYC A;  2F0F A;  1RD9 D;  3TZU A;  2B63 B;  1HUN A;  3TZD A;  1A3T A;  5EGT A;  5IT9 E;  2ICI A;  4ZUI A;  2A73 B;  3S1M B;  4K8J A;  1Q1B A;  4XT3 B;  2F0I A;  3SR1 A;  2F0T A;  1WTW A;  3F2U A;  4H7B A;  1I4H A;  4FXG C;  4C2M B;  5T1I A;  1NCV A;  3GV6 A;  1B53 A;  3N6R A;  3FMC A;  3TP8 A;  2KUM A;  2RKS A;  4RKL A;  1HQM C;  3MTS A;  4S3S A;  4DAY A;  1SFO B;  4ODG A;  3MEH A;  5JEA G;  3PIP 3;  2WIN B;  3PIO 3;  4NKL A;  5I9O A;  4FYD A;  4Q5V A;  4IZ8 A;  3DUZ A;  1D5M C;  4LK1 C;  3V96 A;  1JB3 A;  1TS2 A;  3KLS X;  1D5Z C;  2PNR C;  1DJR D;  2DNE A;  2B2V A;  3R93 A;  4CKE A;  3K57 A;  2B2Y A;  1A15 A;  4QUF A;  5JPN C;  2F0H A;  5TSS A;  2XWJ B;  3QJY A;  3Q0A A;  3OMG A;  2PW7 A;  4EQN A;  3RMH A;  1EY8 A;  3Q6S A;  4DA2 A;  2A68 D;  1PTO B;  3MA2 B;  5CBA E;  1HXY D;  1KTK A;  3KF8 A;  2F0V A;  1R9T B;  3DXJ C;  5IIF A;  4A3F B;  3QIA A;  4WFN 3;  1IYV A;  1QOH A;  3PO3 B;  2F4I A;  3HOY B;  4K8I A;  2J7Z A;  4ILW A;  3D3R A;  5KND A;  1Y8O B;  4IUV A;  3SK8 A;  2XVS A;  1PXU A;  1W6J A;  2F0J A;  3P75 A;  1SNP A;  4QB4 A;  3E0J A;  1B50 A;  4DK0 A;  1LT6 D;  5G3L D;  3PUW A;  2NVT B;  4LMQ D;  1LTR D;  1PZK D;  2IT1 A;  1EEI D;  4K6D A;  5KIX A;  4H0L C;  3A8K E;  3MXP A;  3MAQ A;  3P1H A;  1ET9 A;  5EQ0 A;  3Q22 A;  3IAY A;  1IKL A;  3CRK C;  5C4X B;  1FNU A;  2EYJ A;  2KQ3 A;  3T53 B;  3ND9 A;  5LL6 S;  1STE A;  4RWS C;  1VDZ A;  4DAV A;  2L5T A;  1OXT A;  2X6L A;  1D2B A;  1WVL A;  1CI3 M;  5KEE A;  2I07 B;  3DMU A;  1XXG A;  2O5J C;  1SND A;  2D2C C;  4L6T B;  1TS5 A;  2RDH A;  1OO9 B;  1BQQ T;  3MFY A;  4K6L A;  5DM6 3;  2F0W A;  4N9P A;  1O7Y A;  5CYU A;  2KJX A;  1U4L A;  3IL8 A;  2JEA I;  2QIL A;  5G3L F;  1ONL A;  4BA2 I;  4QCL A;  1PTO H;  3BDO A;  3NXW A;  2EYH A;  2C5C A;  2PW5 A;  1SYD A;  4HSP A;  3R3O A;  3S17 B;  4ZK9 B;  1CHQ D;  2L55 A;  2K33 A;  3S1N B;  1F2L A;  1TT2 A;  2FIN B;  1EOT A;  4I65 A;  1EZ6 A;  4IUP A;  1YNN D;  4KHV A;  3LX0 A;  2O2L D;  1PMR A;  4ZUJ A;  1S4Z A;  5LHY 1;  5FLX L;  3K5M A;  4IQZ A;  4A3J B;  5M9O A;  1EY7 A;  2E74 C;  2L0C A;  1SBB B;  3SHL A;  1WTR A;  1TQO A;  4FO2 A;  3TP6 A;  1STN A;  5KYL A;  1TS3 A;  4M8A A;  1C4Q A;  2EYO A;  2JXM B;  2PMZ B;  4RCO A;  1I3Q B;  1SYG A;  1UNS A;  1WD0 A;  4XTC S;  1PZI D;  5ISR A;  3OMC A;  2B8G A;  1GUO A;  1BF4 A;  2B2U C;  4DXF A;  1EY0 A;  1LTT D;  3C46 A;  1JWM D;  3NHH A;  3J81 L;  2L1B A;  4IN3 A;  2K28 A;  2CQA A;  1HFN A;  3FKI B;  4L63 B;  1BR9 A;  1Y8N B;  4C3I B;  4F87 A;  5EPL A;  1DXM A;  3MC0 B;  3SK4 A;  1BXT A;  1Q8I A;  1JIC A;  1SE4 A;  1JOO A;  2PYK A;  2PPB C;  3WOF A;  2BA0 A;  3HZX A;  1HHV A;  2J0T D;  1ZYR C;  1R4Q B;  4A3M B;  1QIL A;  2JYO A;  1H9S A;  2WKD A;  1QB5 D;  1ZXT A;  2SNM A;  2D9U A;  4KD4 A;  2L4N A;  4G7O C;  4FF2 A;  5JAV A;  4DFA A;  2YYZ A;  4QF4 A;  2XRS D;  3M3Y B;  3MXU A;  1STH A;  1NSN S;  3VR2 A;  4CHT B;  2NWG A;  1TWA B;  3H94 A;  3QO2 A;  5KYI A;  2SEB D;  1GHJ A;  3IFD A;  2EPB A;  4OIK A;  1VMC A;  1H9S B;  1HA5 A;  1ICW A;  1KAA A;  1PRT C;  3CKI B;  2BOS A;  5IGB A;  5FO8 B;  2O4X A;  2F3W A;  3LNN A;  1Q90 A;  3I8Z A;  1D6E C;  1MD2 D;  2A6E D;  2EJM A;  2Q8I B;  1S5D D;  5A2Q L;  1EY4 A;  1HUM A;  1HRJ A;  3M4O B;  1PFM A;  1EYD A;  2R93 B;  2B8F A;  1F2Z A;  1A3V A;  4FNF A;  3RUZ A;  2J4X A;  3ERQ A;  2KEC A;  1NR2 A;  4XQJ A;  5CGK A;  2ICE C;  1B44 D;  2RSN A;  1T5E A;  1STB A;  1L0X B;  1WTP A;  1CK1 A;  4RGM A;  1KAB A;  2OF1 A;  1CA6 A;  1F2Y A;  1FNV A;  3H09 A;  1TY0 A;  5C4H A;  1I6V C;  1Z6H A;  1EY9 A;  5A35 A;  1PZJ D;  1LTG D;  1UEA B;  3T56 B;  4CGY B;  3PUX A;  1KNE A;  1GUG A;  2F0N A;  2OT2 A;  3M7N A;  2VUM B;  3MXG A;  3S1Q B;  3LWU A;  2E2I B;  4JK1 C;  1Q3L A;  3D4W A;  1TKW B;  2F0P A;  4C1N I;  1DYQ A;  4G4K A;  2A69 D;  1LV9 A;  1EQV A;  2TMP A;  4OO1 H;  4IUN A;  3DEO A;  2Z4H A;  5DEH A;  2EY2 A;  3E5S A;  2VNU D;  2QF7 A;  4FF3 A;  3I4M B;  1A3U A;  3GTL B;  1CZW A;  3D4D A;  3K5N A;  3Q24 A;  2EJF C;  3NUC A;  3D6C A;  3BVM A;  1SNM A;  1SYB A;  3VA5 A;  1EIH A;  5M3F B;  1XTC D;  3S9W A;  1PRT B;  1TII D;  4ZAI A;  3NQI A;  3BVZ A;  2CW0 D;  3DM1 A;  3SXH A;  1JR0 D;  4KK7 A;  2RDF A;  1VCI A;  5KNB A;  4KJN A;  1CFM A;  3TP7 A;  4A3K B;  5D3D A;  1EYA A;  3ERO A;  3PUY A;  3HOU B;  2RVL A;  2H4O A;  3G7L A;  2A6H D;  4B9W A;  5FOB B;  2O5I C;  1SYF A;  5IOC A;  4EQP A;  4KN7 C;  1B9N A;  1HA6 A;  3T16 A;  2JEB I;  2JA5 B;  4A3E B;  1YNN C;  2KED A;  3V2T A;  3GTO B;  2KA7 A;  3FVQ A;  2N88 A;  2X69 A;  2R7Z B;  4PNY A;  4BS9 A;  3NE5 B;  3A54 A;  3BYT B;  2B39 A;  1Y1V B;  3L3O C;  2L9H A;  2IPK D;  1LTA D;  1OXS C;  1DOL A;  5T1G A;  1TS4 A;  2WII B;  2DY8 A;  4ZKC B;  3K7A B;  2EY5 A;  1EU4 A;  2JA8 B;  3DHQ A;  2AQ3 B;  5F2D A;  3ND8 A;  4HAE A;  2D5D A;  3DWA A;  3PV0 A;  2K01 A;  1SNO A;  3FEW X;  4A93 B;  5K5P A;  3RLF A;  1QNK A;  5IGF A;  2B2W C;  1JE4 A;  1J9O A;  3O13 A;  1QJO A;  4KKT A;  4IUU A;  3BG3 A;  5DAU A;  4RGT A;  1SDF A;  1TY2 A;  3X3M A;  1KLU D;  3OW7 A;  3K0Y A;  4C3I G;  3GTG B;  5ELE A;  2V4D A;  2KOL A;  3L7Z C;  2QEJ C;  3NTI A;  4KY6 A;  1ZKO A;  5C3E B;  5JPM C;  1EY6 A;  2XN9 C;  1UAP A;  3MXN A;  1S5E D;  1Z7T A;  3W3A A;  4ZLT F;  4A3G B;  5DNF A;  4TSS A;  2ZT9 C;  1BUV T;  1SJE D;  1GJX A;  1SE3 A;  3TME A;  1D1K A;  2L11 A;  3FDT A;  1XYI A;  5D65 A;  4IAL A;  1BCP C;  2NVY B;  1S5C D;  1SEB D;  4KMU C;  5C3W A;  1PDQ A;  2ID0 A;  3I3C A;  3I72 A;  1AN8 A;  3T4A C;  3ITP A;  5BN4 A;  5EPJ A;  1V8Q A;  4IUT A;  2CHB D;  2HDL A;  5FLX E;  4IFD G;  5EKK A;  3A8J E;  4HMI A;  1Z47 A;  4H13 C;  4ZQ3 A;  3VYU A;  1QE6 A;  3BS1 A;  1A2U A;  2JE6 I;  1KDB A;  3FPU B;  2OEO A;  1EEF D;  3D8G A;  5M5X B;  2MUY A;  2K6A A;  1Q12 A;  2BE5 C;  3J7Y W;  1J8I A;  1GUW A;  1CHP D;  4HR7 B;  3TP5 A;  2K04 A;  2A6E C;  4X3K A;  4G57 A;  5K36 H;  1B2T A;  2E75 C;  3OPO A;  1RTN A;  1AW7 A;  1DZ1 A;  4RH6 A;  1S5F D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...