4X62Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x62Q00
2Q2HA 2VNUD 4YWMA 1VQ7A 3BZKA 3K81C 4P72A 1N34L 1G51A 4LNQA 4WJ3M 1K83H 1AH9A 4A3MH 2JE6I 1W3SA 4OWWB 1WOCA 4A3BG 4GLXA 4ALPA 4A75A 3KDFA 1EWIA 4IJLA 3ER0A 3NEMA 3GTOH 2MFIA 5AJ3Q 4DR1Q 2MQHA 1YJWA 1IBKQ 4LFBQ 4A93G 2BH2A 1X6OA 1D8LA 1HZBA 2K4KA 1YHAA 1YHBA 3U50C 3JAMi 4HJ7A 3PF5A 2NVTH 1NJIC 2Z6KA 2NVQH 1LYLA 1YITA 1VQ5A 3IRBA 5J3BA 4DV5L 1YI2A 2HHHL 4JI7Q 2ZM6Q 1YJNA 3S1QH 4TVAB 4DR7Q 5C44H 4DR2L 4LF9Q 4HJ9A 1TWFH 1HNZQ 2CCZA 5IP9H 3G4SA 3CCMA 3PIOA 5GQOA 3J80i 2E2JH 4DR4Q 1QVGA 1VQGA 1A63A 4A3EH 2YV5A 4DR6Q 1E22A 1PH1A 4GKKL 3CF5A 1B8AA 4X62L 2ZTCA 2XGTA 3S2HH 4LFAL 4OWTB 4IPHA 2JJQA 4UP7A 4BBSH 3SGIA 1I3QH 1GM5A 1UEBA 2PMZE 3RZDH 3CPFA 3FP9A 3AYHB 1K73C 1VQPA 1Y1VH 1XMQL 3W1BA 1VQJA 1Q12A 4B3ML 4LFCQ 2UXDL 1AE2A 5GROA 1J6QA 4YHHL 5IWAL 3J81j 2ATWA 2WB1E 4A3BH 4B3RL 3CCQA 3AFQA 4YWLA 5GADC 3J80c 2VQEQ 3OTOL 1JJCB 5IE8A 2UUCL 3NBHB 4GNXB 2YTXA 1KXLA 3BU2A 3CCLA 3CMAA 1N34Q 1PH4A 1VQLA 5JJKA 1X65A 1QZHA 4A93H 1XPOA 4B3SQ 2JA6G 5JJLA 2B63G 1XTDA 1OXTA 3EN2A 3HOYG 4LUOA 3CXCA 2WAQE 1PH2A 1XNRL 4JBJA 3U4VA 5BR8Q 5FJ8G 3KJOA 2D0PA 3H0GG 3CD6A 1IL2A 4YCVA 1I94Q 2WAQG 3OYYA 4OXPA 4A3KH 3S2DH 2N49A 1RL2A 3CCEA 3T1HL 1E7ZA 2GVBA 2HQLA 2YTVA 2LSSA 1K0RA 2OCEA 4JI3L 4HIDA 1PH9A 2HHHQ 4BXXH 4JOIC 1K8GA 4JI2Q 1WFQA 2F52A 3PV0A 3T1YL 4DR2Q 1YIJA 4LWCA 4BA2I 4BA1I 1NY4A 4OX9Q 3HOUG 3I7FA 3GTKH 4DUYL 4X65Q 2H5XA 1R9TH 2K50A 3I56A 4GNXC 2AWOA 2K52A 3A74A 3KF6B 3AQQA 1YJ9A 1I50H 2JQOA 4TQUS 5M3MG 3A5ZB 1FGUA 1SLJA 5IYDG 3CCJA 1FL0A 3UDGA 2OTJA 2UUAL 1H95A 3CC2A 4YWKA 1MKHA 4A3FG 1VCIA 1WJJA 3NELA 4GLAC 4P74A 1PYSB 1E1OA 5C44G 1XMQQ 3BJUA 1OXXK 4JOIA 4B3TQ 4JV5Q 2UXCL 2VZAA 2UXDQ 1JJ2A 3TS2A 1IBML 1HJPA 4QY7A 1UE6A 3MXNB 3CCRA 3UDXA 3G48A 1VQNA 1HNXQ 2JA6H 1TXYA 2LXKA 4GN4B 4LUZA 2MNAA 4DV4Q 4GNXA 4LF5Q 2B63H 1BKBA 4IFDG 1XMOQ 3GTQH 3RLFA 1CKNA 5LMUL 4JI0L 1TWAH 1KRSA 4XIGS 1KC8C 3H0GH 5C4XH 4HJ5A 2DGYA 3F2DA 2IHEA 1N33L 4DPGA 1N9WA 1XNRQ 1EFWA 1PH6A 4LF4Q 4L5RC 3J7ZC 2ES2A 2F4VL 4IFDI 2WFWA 2IX1A 3DLLA 4LF8Q 4DV3Q 4LF7Q 1UE5A 3F1ZA 2ASBA 4P75A 4A4IA 2B29A 3HOUH 3AEVA 1WYDA 1YBYA 3T1HQ 1EYGA 2ID0A 3CW2C 3HKSA 4QL5A 4JI3Q 3J7A5 1XJVA 3DM3A 3W5OA 2Z0SA 1IZ6A 4RMFA 2FXQA 1T9HA 4DV0Q 5M3MH 1X55A 1IBLL 4A3LG 2E2HH 4X66L 1ASZA 5IYDH 1VQAA 2YU9H 1N8RC 3KF6A 5GAEC 1Q1EA 1PYBA 1EQRA 1SE8A 4L5SA 3CP0A 4A3DH 4A3FH 3VDYA 4JI6L 3PO2G 4DKAC 4C3HH 4DUZL 1NMGA 4KLKA 2UUAQ 4A3KG 1G6PA 3FKIG 4IOCA 4WJ4A 3EBEA 3I2ZA 4BXXG 2N78A 3CC7A 4JI8L 1VQMA 1MIUA 1YHQA 4JI5L 1ASYA 3S1MH 5HY6A 3A5UA 4OWXB 2VS1A 1U5KA 4AQYL 4JI1Q 2Q2UA 2UXBQ 3M9BA 1K9MC 2C35B 3RNUA 2NZHA 4JI4L 4A76A 2QA4A 4GKJQ 4IFDJ 1PFSA 4A3IG 2UU9Q 2HIVA 5E7NA 2K5HA 4LF6Q 4DR5Q 3U4ZA 1PHJA 3JAMc 2QGQA 4PG3A 5LMUQ 4JI0Q 1QVFA 5JEAG 4GLVB 1Q8KA 5M3FH 3PIPA 4GOPB 1QZGA 4DV2L 3HOXG 3RR5A 2BA0A 1L1OB 4YY3Q 1CSQA 1X3GA 4DK6C 1VQFA 3S1RH 5M5WH 3UDIA 1C7YA 2F4VQ 1N32L 1HR0L 1JT8A 1HR0W 1KRTA 3KLWA 3I4NG 5EAYA 1VQDA 3HOZH 2E5LL 4JYAL 4HIKA 1NMFA 1AE3A 2JA7G 4A3LH 2OQ0A 1VS0A 3I4MH 5C0XG 2I5MX 3PUZA 3S17H 2PI2A 2UUBL 1XNQL 2A19A 4QGUA 1K3RA 2AHOB 2EQSA 5HGQA 3CQZH 3E9IA 3PO2H 2JK8A 2IHFA 4IJHA 2GN5A 2GVAA 3CCSA 1PH8A 4O2DA 4X66Q 5C4XG 4DAMA 1JMCA 1FJGL 4DV7L 2DUDA 3FKIH 3CCVA 4UP9A 3CCUA 4YCWA 5C0XI 3HOVG 3J81i 1CSPA 4BBRG 4NB3A 4DV5Q 4JI6Q 2KENA 4DV6L 2R92G 1BBWA 4KI0A 3S1NH 2JEBI 2WP8J 1W2BA 1P8LA 1Q1BA 3S24A 3KJPA 1Q82C 3RN5A 1HNWL 2KCMA 2QEXA 1XPRA 1CKMA 3L2PA 5IYCG 4ME3A 2PQAB 4X64L 1UE1A 2E8GA 4GS3A 4MNOA 4X6AH 2E2IH 1D7QA 1EUJA 4OONA 4A3IH 4KHPL 1V9PA 1X9NA 2NVYH 4HIOA 1OXUA 4YCUA 2K14A 2JEAI 4GKKQ 4X62Q 2I0QA 4JCVE 4LFAQ 4MZ9A 3GO5A 2ZJPA 1X3EA 3HOXH 1DGSA 1U0LA 3PUXA 4A3DG 1VQIA 4HJAA 1PV4A 3PSIA 3FHWA 5FLXc 1YNXA 5AJ3L 4DR1L 2JA5G 4B3MQ 3I4NH 1YEZA 4LFBL 1NBWA 4YHHQ 5IWAQ 2LXJA 1V43A 3CPWA 3RZOH 2JA7H 4JBWA 1MJEA 3G6EA 4B3RQ 1I6HH 3ICEA 2UUCQ 3OTOQ 1S40A 2OWOA 2ALYB 4BY7G 4JI7L 2ZM6L 4NXNL 2AKWB 2VL6A 4GN3B 2E5LQ 2CFMA 1TWGH 1TWCH 4GN5A 1JB7A 4LF9L 1B7YB 2CKZB 3UDFA 2NZOA 4P71A 4EX5A 3RLOA 1SR3A 2HT1A 2BA1A 4IPGA 5ELOA 1SN8A 1UE7A 4DR4L 1XNQQ 5K36G 1EIFA 3HOVH 1VQ4A 4PZ6A 4BBRH 5M3FG 2R92H 3GD7A 3JC66 3B6YA 4AIMA 1V1QA 1TWHH 1WCMG 2ZJQA 3M7NA 3L7ZC 4NPSA 1LUZA 2CQOA 4DV7Q 4A3JG 1Y1WG 2KCTA 1VQOA 1E24A 3M4OH 1Q81C 5IYCH 1PH3A 2RHSB 2HIXA 3L0OA 2ZJRA 1GD7A 3CAMA 2B3GA 4HIMA 2KBNA 1HZCA 3HKZE 3Q8DA 3T1YQ 4PZ7A 1N36L 3HOZG 2VQFL 1S3OA 1YVCA 5GAGC 4LFCL 1GO3E 2EXDA 4KHPQ 4DUYQ 3PO3H 1L2FA 1QUQB 4X64Q 4R1JA 3I4MG 1Q46A 3HKZG 2Y0SE 4DNIA 5IP7G 4C2MH 2XTIA 4OO1G 1JJGA 1E3PA 4RG1A 1E1TA 3K8AA 1VQ9A 2PI2E 1M90C 1GKHA 2Y0SG 3BZCA 4IPCA 4L5QA 2JA5H 1IYJB 5ELNA 2JA8G 1VQCA 3A0JA 4B3SL 1VQBA 3TEHB 4A3CG 2N3SA 3GTMH 3ULLA 3LGJA 4OO1I 3WWVA 1KHIA 2CWAA 3K7UC 5BR8L 2UXCQ 2VUMH 4BY7H 1IBMQ 4HJ8A 1I94L 2EIFA 1EIYB 3M3YH 5FLMH 2IY5B 5H1SE 3KF8B 2VQEL 4IPDA 3S16H 4APVA 2R7ZG 1PVOA 4JC0A 3D0FA 3STBD 5M5XH 1G291 4JI2L 4NXNQ 2D0OA 2IT1A 4LW1A 4R4IA 2VW9A 4DV1L 3OW2A 4POGA 4K0KL 4QQBX 4OX9L 1WCMH 1VQ6A 3G71A 4X65L 3K7AH 4C3IH 4A3JH 1Y1WH 1P16A 1N33Q 1BBUA 1Q7YC 4UPAA 3KFUA 1A62A 1WI5A 2MO1A 4DR3L 1Z9FA 3M4QA 2KHIA 2RCNA 3RN2A 3PO3G 1BVSA 3ERSX 1HZ9A 1A8VA 1Q86C 1VQEA 1K8AC 3HFZB 1PH7A 2BH8A 5LMNL 1KQSA 5LMNW 4POFA 1J5EL 4PZ8A 5C3EG 4JBMA 4NXML 1VQHA 4R4TA 2K75A 5IP7H 3F2CA 1FVIA 3MEFA 1CKOA 3PGZA 1N36Q 3HOWG 2NN6G 2VQFQ 2OTLA 1QUQA 4B3TL 4JV5L 2Q2TA 1VQ8A 3GTPH 3GTJH 1IBLQ 2CWPA 1LTLA 1C9OA 4H02A 4Y52H 3H3VI 2JA8H 5IY0A 5GAHC 1OXVA 3U58A 4UY8C 4A3CH 1C0AA 1HNXL 1MJCA 4DV4L 4J15A 4GOPC 3PUVA 3UE1A 4LF5L 1LM0A 1O7IA 1L1OC 1XMOL 4AYBE 2NN6I 1KL9A 4R4CA 1NE3A 3E9HA 3AFPA 4A3GG 3D31A 4DUZQ 1I5FA 2WB1G 4FDBA 3M4PA 1PH5A 4QJFA 4XTCS 1CKNB 3K80C 2R7FA 1GVPA 3STBC 3S15H 1JE5A 1X56A 4AYBG 1HZAA 5IYBG 3PUYA 2R93G 4JBKA 3CMEA 4JI8Q 1X3FA 4BY1G 3M85A 4JI5Q 2JA9A 4LF4L 1Y14B 2R7ZH 1EQQA 4LF8L 4IO9A 4P73A 4DV3L 4AQYQ 1KD1C 4LF7L 4DAYB 4KHZA 2N8NA 3UE0A 4JI4Q 4AH6A 2I5HA 1Z47A 4QIWE 2ZTEA 1X54A 4C3JH 4IOAA 2YTYA 5JEAJ 1SFOH 1HH2P 4K0KQ 4GOPA 3TRZA 4DV1Q 3J81c 2A1AA 4UP8A 1L1OA 4MTNA 3F2BA 2PNHA 2R6GA 3I4OA 4DV2Q 3TS0A 4DV0L 3KDFB 3PUWA 4A3MG 1IBKL 3GTGH 2VY3A 3F8TA 3H3VH 5C3EH 1UWVA 1L0WA 4DR3Q 3ULPA 1N32Q 2Q2IA 2VUMG 1HR0Q 1SROA 3GDEA 3NENA 3HOWH 4DR7L 4JYAQ 1VQKA 3E0EA 2A8VA 5JJIA 2KHJA 1SMXA 3CC4A 5LMNQ 2RHQB 5FLMG 1M1KC 1J5EQ 2K5VA 2OQKA 5C0XJ 1HNZL 4Y7NH 3W1GA 2NVXH 4NXMQ 4EQ5A 1OTCA 2RF4A 1NTGA 3K0XA 3I55A 2L15A 3RLNA 4PMWA 2AWNA 1KIXA 2UUBQ 3TREA 1QVCA 1RIPA 3EIVA 4DR6L 3TQYA 3S14H 3GTLH 1CUKA 1KAWA 4JI1L 4A3GH 2UXBL 5IP9G 1B70B 1FJGQ 4LUVA 1SRUA 4A3EG 4L5TA 4GKJL 2IX0A 2ZTDA 2UU9L 1XPUA 5M5YH 1EOVA 5IYBH 3HOYH 2YYZA 4LF6L 4DR5L 4DV6Q 2R93H 1OXSC 4BY1H 2AMCB 3PCOB 5DLQE 5FJ8H 3ULJA 5C4JH 2PQAA 1HNWQ 4BBSG 2K5NA 2I5LX 1A0IA 2F3IA 2V1CC 4R4QA 1S72A 1YZ6A 1PA6A 2R7DA 4YY3L 5IT9c 2Z6KC 4DK3C 3KOJA 3KYHC 1IXRA 4R4OA 1Y1VG 4JG2A 3PF4A 2D62A 4O0AA 2MO0A 3ZJYC 3H15A
chains in the Genus database with same CATH superfamily
2Q2HA 4YWMA 1VQ7A 3BZKA 1U9RA 3K81C 4KJOA 3CQZB 2BE5D 1K83H 2EZVA 1W3SA 4OWWB 4UAIA 4A75A 1LO5D 2B2UA 4RGNA 1EWIA 4IJLA 3MC0B 5AJ3Q 1IBKQ 2AQ1B 2BH2A 1D8LA 1HZBA 1YHBA 3U50C 2NVTH 1LYLA 1VQ5A 3IRBA 2ZM6Q 1YJNA 4CJ0B 4DR7Q 4Q0FA 5DEHA 2AQ2B 2E2IB 3GV3A 1K3BC 1BCPC 1Q90A 4L63B 1KTKA 5GQOA 4CBVA 2RSNA 1M4VA 3QB3A 2RQXA 4C3JB 4NKLA 3CF5A 3S2HH 2PCFB 2ZTCA 1CQVA 2JJQA 3SK5A 3SGIA 4FNFA 1E0BA 1GM5A 3I4NB 3J7AV 1PTOF 4XT1B 3FP9A 1K73C 1H9JA 1DOKA 3RZOB 2DNEA 4I7AA 2K5QA 3W1BA 1I6HB 2PZTA 2FMMA 5KEEA 5IWAL 5KNDA 3N6RA 5C5LA 3OMCA 2VQEQ 3OTOL 1ILQA 3BU2A 3HOVB 1WTHA 2F3VA 1SNMA 4KKSA 1PH4A 1EY5A 1QZHA 4A93H 2KQ3A 2Z4HA 3PQIA 2B63G 1PH2A 1D5ZC 2EVBA 5J22A 3CRLC 3KJOA 5M5YB 5EQ0A 3CD6A 4OEMB 4KY7A 3K0YA 2WAQG 5EKIA 3OPOA 4CJ1B 1E7ZA 2HQLA 2YTVA 2OCEA 4JI2Q 1WFQA 4RFBA 3PV0A 3KLRA 1YIJA 1BDOA 1AZPA 1UNSA 3GTKH 2P5ZX 4X65Q 1R9TH 2AWOA 2JA5B 4DXGA 4A3MB 1WVLA 2JQOA 4TSSA 5IT9E 4KD4A 3ND9A 4YWKA 1ET9A 1Y8PB 4C3HG 1PYSB 1E1OA 2F03A 2EOTA 4JV5Q 3H94A 1IBML 5I4DA 1NCVA 4JK1C 1ZYRD 3MXNB 2ICEC 5T1GA 3NBHA 4DV4Q 4GNXA 4LF5Q 2MPMA 4G7HC 2QKIC 3GTQH 3DXJC 3VYUA 5IGFA 2F0UA 1TWAH 2EYPA 5LMUL 5D3IB 3WDNA 4HJ5A 3EVQA 3MFYA 1PXUA 5FO9B 1EY9A 3C1EA 2Q8RE 2Z4IA 2EYJA 1N9WA 3LWEA 1S5BD 1RF2D 4HMIA 1PH6A 3J7ZC 4BS9A 2XSCA 2XWJB 3DLLA 4FF3A 3BYYB 1SNQA 1TQOA 3WOEA 4DU9A 4P75A 4A4IA 2B29A 4RKLA 3HOUH 3AEVA 1YBYA 5JVG3 3GTPB 4FVMA 2Y0SB 1WD1A 1IZ6A 2B8GA 3NPPA 4A3LG 3KBGA 1N8RC 1PYBA 1EQRA 2M9VA 5LL6S 2H4OA 2IWHA 1QOHA 1Z7TA 2G5DA 1PRTB 1AW7A 4DKAC 3SEBA 4PQXA 3T16A 4KLKA 1ICWA 4IOCA 3I2ZA 1HA6A 2A6HC 1STYA 4JI8L 1YHQA 3S1MH 4FXKC 4IFDH 2O4XA 1U5KA 2VS1A 2Q2UA 4CJ2C 1K9MC 1PTOD 4A3IG 2UU9Q 1STNA 1O7LA 2QW7A 1PHJA 3RD4A 4RKBA 5LMUQ 4GLVB 1DOMA 3G7LA 1FYCA 1NUCA 1L1OB 4ZAIA 1TIID 2JP1A 2Z9HA 4X3SA 4KY5A 1LT3D 1NMFA 3FDTA 1AE3A 3S14B 3GTLB 2F0SA 2JA7G 2OQ0A 4R8IA 5C0XG 2I5MX 3PUZA 1B4OA 2WB1B 1SYDA 3OWEB 5IIFA 3BDCA 4QGUA 2JA6B 2EQSA 3PO2H 1EY8A 2GVAA 4ZK9B 4RGOS 4DV7L 1ILPA 3K5MA 3CCVA 5C0XI 2PZUA 3J81i 4DV5Q 2QCPX 1ET6A 2EYLA 1P8LA 4R9WA 4PNYA 1Q82C 1HNWL 3RN5A 1LTRD 5E4XA 1KLGD 3OSOA 1EUJA 1K83B 4KHPL 2NVYH 3HEJA 2JEAI 3FPPA 4GKKQ 1B44D 1Q8IA 4X62Q 5JEAH 4LFAQ 1X3EA 1DGSA 1IHZA 3PUXA 4X3TA 4A3DG 1VQIA 1PV4A 1TVXA 2QILA 4DR1L 4LFBL 3U9SA 3NSWA 4B3RQ 2BDNA 1S40A 2OWOA 4HCEA 3BG3A 1YNND 1TWGH 4GN5A 1JB7A 1EU3A 3BYTB 1SJED 2CVRA 1B3QA 2HT1A 2BA1A 5ELOA 3S2HB 1UE7A 4DR4L 1RDPD 2VB3X 5M3FG 2R92H 4AIMA 1SYCA 1WCMG 2ZJQA 1LACA 4B9WA 1Y1WG 2F0JA 4DV7Q 2SNMA 3OIQA 2O2LD 1Q81C 5IYCH 1SE4A 5JJZA 1GD7A 1PRTD 3CAMA 1N36L 1EYAA 5GAGC 1GO3E 2EXDA 3NTHA 2KCNA 4DUYQ 5K5PA 1EY4A 1L2FA 1Y8OB 4NW2A 4DA2A 1Z6HA 4PMCA 4DNIA 4TKOB 4OO1G 4A93B 2DJFC 1VQ9A 3QO2A 1SNDA 4C1NI 4IPCA 4L5QA 4A3CG 4B3SL 1B1ZA 5E1FA 2N3SA 3MAQA 4DN4M 3GTMH 1YNNC 3LGJA 4OO1I 3WWVA 1KHIA 2A68C 1ENAA 3K5OA 4BY7H 1I4PA 2A74C 1I94L 1X32A 2X69A 2FHTA 3M3YH 2IL8A 2F0PA 2VQEL 3GTKB 1GUGA 1R9TB 2NWGA 2R7ZG 4JC0A 3STBD 5K36H 1G291 4K0KL 3O13A 1JQYD 4R4IA 3OW2A 4QQBX 4OX9L 3K5NA 4G7ZC 1PRTC 3FMCA 4C3IH 2F0GA 1P16A 4UPAA 1MD2D 5JOBA 3KFUA 2B2YC 1A62A 4I7ZC 3HOXB 1DXMA 2KHIA 3PO3G 1BVSA 1K8AC 1HZ9A 1Q86C 2L5TA 1VQEA 3IAYA 1F9RA 3HFZB 5C4HA 1HFNA 5LMNL 5LMNW 4POFA 1J5EL 2K75A 4ME5A 3F2CA 5EGTA 1N36Q 2NN6G 1QUQA 2N55A 4K5WA 2F0EA 4LJZC 2PO4A 4V0BA 3GTJH 3GTQB 2CWPA 1KNAA 1TWAB 3R8BA 3H3VI 2JA8H 2N88A 5FLXE 5C5MA 2SOBA 3WOFA 1MJCA 2HQEA 4DK0A 1AZQA 1LM0A 1JICA 1L1OC 4ABNA 2NN6I 1NE3A 3E9HA 4DUZQ 1PH5A 1BF4A 5IGGA 5IGEA 4K8IA 3STBC 5CC4A 4AYBG 1SYEA 1X56A 5IYBG 2R93G 2SNSA 3HOUB 2MHVA 4LF4L 5IOCA 3P1HA 4H44C 3DM1A 4LF8L 1TKWB 4DV3L 4AQYQ 3MFGA 4LF7L 4DAYB 4P2CB 1QILA 3X3NA 4RCNA 3UE0A 1A15A 2NZ1D 1S5ED 1Z47A 3VR3A 5IODA 4C3JH 5JEAJ 3D4WA 1LTSD 4K0KQ 1TR5A 1QCBD 1FGBD 4EQNA 3K58A 2DY7A 4MTNA 3TS0A 3KDFB 4DNTB 2F1MA 3F8TA 3ULPA 1L0WA 3P7JA 2VUMG 1HR0Q 4FXGC 5BN3A 3NENA 3HOWH 4JYAQ 3S1MB 1SMXA 5LMNQ 1J5EQ 1HNZL 2NVXH 4EQ5A 2Z1CA 2D9UA 1NNXA 2AWNA 2UUBQ 3TREA 1D5XC 5JPMC 3EIVA 4QMGA 2KCCA 2L12A 2Q8TA 2UXBL 5IP9G 2K5DA 5M9OA 2ZXOA 4KTAA 2WIIB 1X3QA 2IX0A 4GKJL 1U4MA 3MTSA 1EOVA 3K7AB 5M5YH 4DR5L 2FMCA 4DV6Q 2KJXA 1OXSC 2B2VA 4ZKCB 1WTWA 2CQAA 5CMDA 5I6WA 5DLQE 2PQAA 4BBSG 1L0XB 3KOJA 4R4OA 5HGTA 1Y1VG 4KD3A 3GTGH 5ISRA 3ZJYC 3H15A 2KECA 1RJTA 4RHSA 1RTNA 3PO2B 4A3MH 3PMFA 3FVQA 3KLSX 3V96A 1STEA 3GTOH 3ER0A 1CI3M 1YJWA 2MQHA 2XRQD 2NTSA 1Y69U 1FNWA 4HJ7A 1YHAA 1D5MC 2XVSA 3EJIA 3IL8A 3VR4A 1NJIC 2HHHL 1HA5A 4LF9Q 2F0IA 1SYFA 2NVYB 1HNZQ 3QWNA 5A35A 2J4XA 3PIOA 3I70A 1VQGA 4FF1A 1RTOA 2AQ3B 2JSOA 1U4RA 1H9SB 3OW7A 2XGTA 4G4KA 1ZKOA 2B2TC 5I9OA 4PV1C 2CHBD 2AUKA 4RAUC 5DM73 4B3ML 1CFMA 1IKLA 1AE2A 1QNUA 3QG1A 1J6QA 1TWGB 5ELCA 2WB1E 4A3BH 3J80c 5GADC 2VB2X 1GHJA 2UUCL 1NAPA 1QJOA 1IW7C 1HPCA 3QR8A 4OL7A 2YTXA 4E6IA 3GV6A 1VQLA 1X65A 5JJLA 4CDDC 1XTDA 3HOYG 4LUOA 4FXDA 3U4VA 4WRDA 5FJ8G 1ZXTA 1FNVA 1IL2A 4YCVA 4C56C 4ZCKA 1PZID 2M2LA 2KA7A 2HCCA 2GVBA 2LSSA 2NB0A 2HHHQ 4HIDA 1F2YA 1EEFD 1BUVT 2F52A 3T1YL 4BA1I 2D5DA 3CHBD 1LT4D 4DAPA 3I56A 4GNXC 3RUZA 3MHBA 3DMUA 1B3AA 3KF6B 3AQQA 1FNUA 1I50H 3GTMB 4DFAA 3EROA 3A5ZB 1SLJA 5IYDG 2R3ZA 3CCJA 2OTJA 1BXTA 4BY7B 2XNAC 4A3FG 3M3YB 1LTID 1VCIA 1WJJA 3NELA 4P74A 4KJNA 2UXCL 2KEDA 3BJUA 4JOIA 2SDFA 4B3TQ 2VZAA 1OO9B 3J81L 4MIUA 2XIWA 3AU7A 3UDXA 1HNXQ 1D1IA 4GN4B 1TXYA 2JA6H 2V4DA 1EY6A 1BKBA 4C3IB 1XMOQ 4G57A 3RLFA 4JI0L 1O7ZA 1D6EC 3Q23A 3H0GH 3QOLA 2DGYA 3F2DA 1N33L 1U4LA 3DWPA 1EFWA 5A2QL 4L5RC 2ES2A 1H9KA 2L11A 2EYOA 3FPUB 4IALA 1EYGA 1LTTD 3GTJB 3J7A5 1O7YA 2PYKA 3DM3A 2JA8B 2MGSA 4RMFA 1C48A 3DEOA 4DV0Q 5M3MH 3JAME 2E2HH 1ASZA 5GAEC 3VYRA 4F88A 3BZDB 3ITPA 1JC7A 3A7LA 1BOSA 4ULLA 4A3DH 4N8X1 1V1PB 4CDCC 3SHLA 2RCFA 4A3KG 3FKIG 1G91A 3I8ZA 3EBEA 4BXXG 3L3OC 1B53A 2DY8A 3X3MA 1EIHA 2ZXPA 1ASYA 4JI5L 2X6GA 1BBXC 3A5UA 1W6KA 1ESRA 4XT3B 2ICIA 2NZHA 4N8FA 4JI4L 5FO7B 4A76A 5E7NA 2K5HA 1A3VA 3JAMc 4JI0Q 1EY7A 2DNCA 1FR3A 1Q8KA 5M3FH 2HD3A 1QZGA 2QF7A 4FP5D 3RR5A 2BA0A 3HOWB 1PYWD 3A8IE 2PMZB 1KLUD 2NVXB 1N32L 5JVH3 3I4NG 1GHKA 1BNZA 2LKVA 1ENFA 1VS0A 3S17H 2KHSA 2PI2A 4DAVA 2AHOB 1ICFB 2GN5A 3CCSA 3I4LA 5C4XG 1FJGL 4UDUC 3HOVG 1JOQA 4BBRG 4IUUA 3SXHA 3KJPA 3GTGB 1CKMA 4ME3A 2PQAB 1LT5D 2E8GA 5CV5A 5J39A 1D7QA 4OONA 1OXUA 3TBIB 2K03A 5KNBA 4CKBA 1ENCA 3GTOB 3GO5A 2F0QA 3HOXH 2VXWA 2CW0D 4FO2A 4ZUJA 3H09A 5ELBA 2JA5G 1YNXA 5IWAQ 2LXJA 1V43A 1U4PA 1PLFA 3G6EA 3ICEA 3OTOQ 2I46A 3BVMA 4JI7L 3Q6SA 2AKWB 2CFMA 3ND8A 1TWCH 2A6HD 1B7YB 2NZOA 1SYGA 4P71A 4EX5A 2EYFA 1S5DD 4IPGA 1SN8A 4IQZA 1VQ4A 4R8NA 3K59A 1V1QA 5I2YA 1VF7A 3NBIA 1LUZA 2KOLA 2WV6D 4IN3A 1UAPA 3M4OH 2J0TD 2CH4W 3L0OA 2B3GA 4HIMA 2KBNA 3HKZE 3Q8DA 3TMEA 4A3BB 1PRTF 4M8AA 1YVCA 4LFCL 2CW0C 5KIXA 5BN4A 4WORA 4M1UB 3I4MG 1KDAA 1Q46A 5IP7G 3OHXC 1JJGA 5IT9L 4XYQA 5KRUA 1RD9D 1MHWC 2Y0SG 3BZCA 3D8GA 3OWFA 1IYJB 5ELNA 2XWBB 3ULLA 1I4HA 1EZ8A 3TZDA 5BR8L 2VUMH 1IBMQ 1H9MA 3NTIA 5H1SE 3R93A 1E2WA 4APVA 1STGA 1PVOA 2B8FA 4LW1A 4DV1L 2E76C 4POGA 4K2KA 5EPJA 1I50B 1IL8A 3K7AH 4A3JH 1BBUA 1DZ1A 5LHY1 1AN8A 1Z9FA 3M4QA 3SK6A 3ERSX 1AP0A 1A2TA 3MWYW 4O1NA 1I6VC 3N52A 4JBMA 2R61A 2TSSA 3PGZA 2FJ2A 4F7XA 2JA7B 1UEAB 1DD2A 4KKTA 3A56A 1T5EA 5IY0A 4CDFC 2JXMB 5E4WC 3H0GB 1C0AA 3PUVA 1O7IA 2NTTA 1VF5C 1MSGA 3D31A 3T4AC 2WB1G 3M4PA 4QJFA 3S15H 1B9NA 4JI8Q 4QB4A 1I4RA 4RGMA 4ZYSA 1KABA 4CGYB 3KF8A 2F0LA 2N8NA 3DEPA 2F0KA 2F4IA 5M3MB 2E2HB 2ZTEA 1QWYA 4DV1Q 2KEEA 4A3DB 4DXFA 2VY3A 5C3EH 1UWVA 4QUCA 2B2VC 5EKKA 3W3AA 5FK9C 1VQKA 2KHJA 3HS0C 3IKJA 4XQQA 2A68D 2OQKA 4Y7NH 2ASBA 1PDQA 3I55A 2PQEA 3EFXD 3SDZA 3MEHA 2MP1A 1RIPA 5C4ZA 3CKIB 1D2BA 1E2VA 1S5CD 1CUKA 4JI1L 4A3GH 2OXPA 1B70B 5CGKA 2NBFA 3QOJA 4LUVA 5G3LF 4IURA 5M3FB 1WTPA 3GQBA 4L5TA 4KY6A 3HOYH 1H9RA 2YYZA 4LF6L 2K01A 4BY1H 2AMCB 1JR0D 1QNKA 3NP8A 5FJ8H 5C4JH 1HNWQ 1S5FD 2K5NA 4LK1C 3E5SA 1A0IA 2F3IA 2V1CC 1S72A 4FF2A 1YZ6A 2FFKB 1JE4A 2R7DA 4YY3L 1KDCA 4DK3C 4JVZA 1RHPA 1CT1D 4KHPQ 2KUMA 5TSSA 4IZ8A 3S17B 1Q3LA 1SJHD 4P72A 1G51A 1DONA 4WJ3M 1AH9A 2L0CA 1WOCA 4GLXA 1I4GA 4ALPA 1II3A 5DAUA 2C9OA 4LAAA 1DYQA 1SYBA 4DR1Q 4A93G 3R2TA 4LFBQ 1CTMA 4Q5VA 5KYIA 2K4KA 3JAMi 1JWUD 2Z6KA 1YITA 5J3BA 1YI2A 1EYCA 4TVAB 2F0DA 4HJ9A 1E2ZA 2CCZA 2RBMA 3G4SA 4XQNA 2E2JH 4DR4Q 2IW3A 1PZJD 4A3EH 1JWMD 2YV5A 2PW7A 1E22A 3TN2A 3L9AX 3VA5A 1A6XA 1B8AA 4OWTB 1DJRD 4UP7A 2X6LA 1LTAD 5D65A 2PMZE 3RZDH 3NQIA 1VQPA 1XMQL 1VQJA 3D3RA 1Q12A 2F0MA 5GROA 3GP7A 4YHHL 1TWCB 3I90A 2ATWA 4YWLA 1JJCB 4HSPA 3NBHB 1CQFA 4GNXB 1KXLA 3CCLA 3VYSA 3CMAA 1WTVA 5JJKA 3VR5A 1XPOA 4B3SQ 3QIAA 3EQLC 1HCZA 3CXCA 2WAQE 3M4OB 4JBJA 2BDOA 4N9PA 1F9PA 3I73A 2A5HA 4XYOA 1I94Q 4A3KH 3S2DH 2K1BA 2N49A 3CCEA 5CORA 4ZQ3A 1SNPA 4JI3L 4BXXH 1PH9A 4JOIC 2EY1A 2K6AA 5ELFA 3KUPA 1HHVA 4LWCA 4BA2I 4OX9Q 3TP5A 3HOUG 3I7FA 5D3DA 5FKAC 3UI2A 2H5XA 4QIWB 1SE2A 1EQTA 2L1BA 1KDBA 4TQUS 1BO0A 1FGUA 1HTPA 1EU4A 1FL0A 3UDGA 3BVGA 2VUMB 1LT6D 3CC2A 1SAPA 1MKHA 2PW5A 4F87A 3MVVA 1XMQQ 5C44G 1TS4A 1OXXK 1VMCA 3S1QB 3TS2A 1HJPA 5G3LD 4O42A 5FLXL 5ELDA 2LXKA 3MA2B 3S9WA 2B63H 2MNAA 2B2UC 4A3JB 4IFDG 4U673 1CKNA 1PTOH 4XIGS 3K57A 1KC8C 4WFN3 5C4XH 1NR4A 1Y8NB 2BOSA 3LX0A 4X3KA 2K28A 4OELB 4EVOA 4LF4Q 2RDGA 2F4VL 4IFDI 2WFWA 4LF8Q 1ESFA 4J8QA 3HKZB 4DV3Q 4LF7Q 2TMPA 4QCLA 5IGDA 3F1ZA 1WYDA 3HKSA 1QG7A 4QL5A 4JI3Q 2IPKD 1XJVA 3W5OA 2Z0SA 2FXQA 5C6AA 1LTGD 1IBLL 3KK7A 1VQAA 2YU9H 1IW7D 1Q1EA 1EY0A 1SE8A 1HUNA 3CP0A 3BS1A 3PO2G 4JI6L 2ZXRA 3TZUA 3S15B 5CV6A 4C3HH 1I4QA 3J80E 1G6PA 1MSHA 1SE3A 2F0VA 1MIUA 5HY6A 4OWXB 1TS3A 2UXBQ 1CA6A 2G9HD 2M00A 2C35B 3RNUA 4GKJQ 1PFSA 2HIVA 4RA8A 4KMUC 4DR5Q 3U4ZA 2QGQA 5EPLA 1QVFA 5JEAG 5C3EB 4HTHA 4DV2L 5ELEA 4OIKA 4CKCA 1HQMC 5KYLA 3S1RH 5M5WH 5E3FA 1TS2A 1C7YA 2F4VQ 3NHHA 4Y7NB 2PPBC 1JT8A 3KLWA 2LMCB 3LNNA 1VQDA 2E5LL 4HIKA 3HZXA 4A3LH 4B9XA 3DHQA 3I4MH 4A3GB 2Z6BA 4F8MA 3OMGA 1V1OA 2JK8A 3HOYB 4IJHA 1PH8A 2A69C 4O2DA 4BY1B 4DAMA 2DUDA 3H3VC 5C4JB 3CCUA 4YCWA 3VYTA 3TSSA 4B08A 2NYZD 4JI6Q 4NB3A 2R92G 1BBWA 4KI0A 2WP8J 1CZWA 3VR6A 2KCMA 3DWQA 1XPRA 4CDEC 3L2PA 5IYCG 5CR3A 4X64L 2ENBA 3TDQA 1SMYD 4MNOA 4X6AH 4IUPA 4A3IH 1XWEA 5I2XA 1G2SA 1V9PA 4HIOA 4YCUA 2RDFA 4JCVE 2QDLA 3A55A 1EL0A 2ZJPA 1F2MA 1DCZA 3M4YA 5FOBB 4HAEA 4HJAA 4CHTB 2F0WA 2MJ8A 3FHWA 5AJ3L 4B3MQ 1YEZA 2B39A 2JA7H 4JBWA 1MJEA 5C0XH 2UUCQ 4BY7G 2E2JB 2ZM6L 2E5LQ 4GN3B 4A3EB 4QF4A 3UDFA 4IUTA 3RLOA 1SR3A 1MI2A 1A3UA 3SR1A 5K36G 1EIFA 5CV7A 3DWAA 2HDMA 3RZDB 2F0TA 3JC66 5EJWA 3B6YA 2K04A 1TWHH 4NMZA 4IOAA 2VNUD 3L7ZC 1SMYC 2CQOA 4C3IG 2KCTA 1VQOA 1E24A 1JOKA 1YNJC 4DNRB 4IUVA 1UUPA 2RHSB 2HIXA 1PH3A 2ZJRA 2RDHA 2G9DA 3HOZG 3T1YQ 4PZ7A 2VQFL 1S3OA 2GA4B 4ODGA 1LTBD 1QUQB 2DN8A 3BVZA 4R1JA 4X64Q 4H7BA 3OIPA 2RSOA 4C2MH 4XXEA 3D6WA 3AMUA 1E3PA 3Q0AA 2PI2E 1TU2B 1GKHA 4K8JA 4XDXA 5JPNC 1M90C 1PMRA 3F2UA 2JA8G 3A0JA 1VQBA 4DF7A 1CM9A 1I4XA 2OT2A 3ERQA 4A3KB 3S2DB 3FKIB 1A3TA 2UXCQ 1F9QA 4S3SA 1XTCD 2H1EA 4HJ8A 2EIFA 3S1NB 3C46A 1BQQT 2BCOA 3VR2A 1SBBB 3S16H 5M5XH 4JI2L 2IT1A 2VW9A 5CV8A 4JW0A 1WCMH 4X65L 1Y1WH 1N33Q 1TT2A 1Q7YC 4C3JG 1RCVD 1GUNA 1MBYA 4DR3L 2RCNA 4GZYC 4L8JA 5AFWA 5EBDA 3ZYYX 1PH7A 2BH8A 2FINB 4H13C 4NXML 1ML0D 1V8QA 1JORA 4R4TA 1TS5A 2F3WA 1FVIA 3MXGA 2C5CA 3AB9A 1CKOA 1A2UA 2BE5C 3HOWG 4OO1H 2VQFQ 1BR9A 2B63B 3JAML 2Q2TA 1VQ8A 4JV5L 3MZ5A 4Y52H 1PTOB 5GAHC 4UY8C 4A3CH 4JPBW 4DV4L 4LF5L 5C4XB 4I65A 2WAQB 1VDZA 4AYBE 4K6LA 3AFPA 1I5FA 4FDBA 4BBRB 1CKNB 3K80C 1O78A 1GVPA 3IFTA 1JE5A 2B2TA 1GJXA 3M85A 4JI5Q 2JA9A 2R7ZH 1KAAA 1X3PA 4XQJA 1KD1C 2KVMA 4KHZA 2EXZA 1JB3A 2WINB 3HP3A 4JI4Q 4QIWE 2HUGA 2YU9B 2YTYA 1SFOH 4GOPA 3D4RA 4KKUA 1B50A 2A1AA 3F2BA 3PO3H 2R6GA 3I4OA 4A3MG 3K5LA 4C3HB 3NUCA 4YIJA 5EPKA 4IUNA 3H3VH 4DR3Q 2EJGC 3URYA 2Q2IA 2L9HA 1N32Q 2NN6H 1EWHA 1HFGA 3E0EA 3NWSA 4MN3A 3CC4A 2RHQB 5FLMG 1M1KC 2K5VA 5C0XJ 4NXMQ 4TRDA 2RF4A 1NTGA 2L15A 3RLNA 4PMWA 1SNOA 1J9OA 4DR6L 1IKMA 1EZ6A 3HG9A 2EYHA 1KAWA 2PZWA 4OHJA 1FJGQ 1XPUA 2ZTDA 2UU9L 5IYBH 2R93H 1GOZA 3PCOB 5COYA 3S1RB 5M5WB 4ZLTF 5JAVA 3Q22A 1B2TA 2CH4A 5IT9c 2Z6KC 3KYHC 1CA5A 4JG2A 5KNCA 4DAYA 3PF4A 3I4MB 4RH6A 4KN4C 2IJ0A 3P20A 1N34L 4LNQA 2JE6I 4A3BG 3BDOA 2B2WA 3KDFA 3NEMA 2MFIA 5CYUA 1IYVA 4KK7A 1W6JA 4HN7A 1X6OA 1HQRD 3H6MA 5NUCA 1F77A 3PF5A 2NVQH 3S1QH 4DV5L 1G8ZD 1ZYRC 4RHRA 4JI7Q 3K6OA 5C44H 4DR2L 4A3IB 1TWFH 4EQOA 5IP9H 3CCMA 3J80i 1A63A 1QVGA 3U9OA 1C4QA 4DR6Q 5DM63 4EQPA 1PH1A 4GKKL 4X62L 2F0HA 4G7OC 4LFAL 4IPHA 4BBSH 1I3QH 1UEBA 3CPFA 3AYHB 1Y1VH 2OEOA 3QJYA 4X3UA 2I07B 1CZGA 4J1MA 2O5JC 4LFCQ 2UXDL 2K5WA 2RA4A 4ZRZA 1HUMA 3J81j 4B3RL 3CCQA 3AFQA 5IE8A 1XX8A 1HXYD 3A7AB 1N34Q 5CBAE 2JA6G 1DOLA 1NR2A 1TWHB 1OXTA 3EN2A 4J6HA 5T1IA 2K05A 1XNRL 5BR8Q 4HR7B 2D0PA 3H0GG 3PIP3 1EIGA 3I72A 1QB5D 3EA6A 5C3XA 1TY2A 3OYYA 1EFID 4OXPA 1RL2A 3T1HL 1K0RA 4NP5A 2NUCA 1IYUA 1K8GA 1PTOC 4C2MB 2IX3A 1WTRA 4DR2Q 1DM0B 1NY4A 4DUYL 2K50A 2K52A 3A74A 3T13A 1H9SA 4UHVA 1YJ9A 5M3MG 2E75C 2UUAL 1H95A 5DNFA 1LABA 2EJMA 3SVMA 4KV6A 2K32A 4GLAC 2NVTB 3S16B 2UXDQ 1JJ2A 3MXPA 4QY7A 3R2IA 5M5XB 4QUFA 1UE6A 1STAA 3CCRA 3G48A 1VQNA 4LUZA 1CK1A 1WCMB 2QDBA 4EGVA 1Y1WB 1F2LA 1B9MA 1KRSA 3J7AF 1F2ZA 4DK1A 1QE6A 2IHEA 4DPGA 2SEBD 1XNRQ 2EY2A 5D14A 2IX1A 5EKLA 5IGBA 1WTXA 1UE5A 1G6ZA 4V190 3T1HQ 1S4ZA 2ID0A 3CW2C 2J7ZA 1RKNA 4HEDA 4HMJA 3SE0A 2Q8IB 1RODA 1D1KA 1T9HA 1X55A 4X66L 5IYDH 3KF6A 3V2TA 2EDGA 3KLSA 5EBCA 4L5SA 4A3FH 1ZEQX 1STHA 2AUJD 3VDYA 4DUZL 1NMGA 2UUAQ 4L6TB 2R7ZB 3BDLA 1WD0A 4WJ4A 1EYDA 2N78A 3CC7A 1VQMA 5IGCA 4ILWA 4AQYL 4JI1Q 1SFOB 3M9BA 2OF1A 1AFPA 1PFBA 2EY5A 3P75A 3PO3B 2QA4A 4IFDJ 1EWCA 4RGTA 4LF6Q 1VMPA 4PG3A 3Q24A 1SDFA 3PIPA 2EE1A 3G6JB 4GOPB 3HOXG 2EY6A 5CV4A 4YY3Q 1CSQA 1X3GA 3A8KE 4DK6C 1VQFA 4ID6A 2JYOA 3UDIA 2O5IC 1HR0L 1HR0W 1KRTA 5EAYA 3HOZH 3CRKC 4JYAL 1SSOA 1KNEA 3R3OA 1R4QB 3LWUA 2F0OA 1PZKD 3E0JA 1JCKB 2UUBL 1XNQL 2A19A 1K3RA 5HGQA 1K0SA 3CQZH 3E9IA 1FD7D 4AYBB 1O80A 2IHFA 4K6DA 2R93B 4X66Q 1JMCA 3PIO3 3DUZA 4OGQC 3FKIH 5I9PA 1EOTA 1V1PA 3FEWX 4UP9A 1CSPA 5I6YA 2KENA 3NWTA 4DV6L 2F0NA 3S1NH 2JEBI 1W2BA 1Q1BA 1XYIA 3S24A 2A6ED 2QEXA 1WTQA 2HCIA 4HCSA 1UE1A 4GS3A 2PNRC 2E2IH 1K8OA 1NSNS 1SNCA 3OOCA 1X9NA 1STBA 2K14A 1PFMA 2I0QA 4K2LA 4MZ9A 5FO8B 2RKSA 1HTLD 1U0LA 3SK4A 3PSIA 5FLXc 2NVQB 2QEJC 3I4NH 1NBWA 3T53B 4FF4A 4YHHQ 5C44B 3CPWA 2E74C 3RZOH 1TWFB 1J8IA 1I6HH 2ALYB 3C1FA 3E3XA 4NXNL 4LMQD 2VL6A 5KGUA 5J1ZA 3D6CA 4LF9L 1F9SA 2CKZB 3MXUA 1XNQQ 4BBSB 3HOVH 1I3QB 2A6EC 4KN7C 4PZ6A 4BBRH 3GD7A 1GUTA 3M7NA 1Y1VB 4NPSA 4WJWA 4A3JG 1LV9A 2D2CC 1CHQD 5LL6X 3T56B 3IFDA 1HZCA 1BCPF 1K28A 3TP7A 3NQTA 1AEXA 4CKEA 1HRJA 1GUSA 4RWSC 3HKZG 3I3CA 2XN9C 2Y0SE 2XTIA 3C3LA 2WACA 4MHEA 4RG1A 4K14A 1E1TA 1BCPB 3K8AA 1CHPD 4N9TA 1G2TA 5L37A 3VA7A 2JA5H 3D4DA 4DGZA 1VQCA 1L0YB 3TEHB 3M7GA 2LFNA 4IUQA 2A69D 3HGBA 3I91A 2CWAA 3K7UC 2LS01 1EQVA 3MXNA 4KHVA 1EIYB 5FLMH 2IY5B 1GUOA 3KF8B 3NTKA 4IPDA 1TY0A 3D0FA 1SXTA 4NXNQ 2D0OA 5F2DA 4NDXA 1K8MA 1VQ6A 2RVLA 3G71A 1GXDC 2E2DC 3FRPB 1WI5A 2MO1A 3SK8A 3V05A 1PFNA 3RN2A 1A8VA 2XRSD 1GUWA 4U68A 1KQSA 4C1NK 4PZ8A 3W2DA 4Z9CB 5HURA 2F0FA 5C3EG 1WTOA 1SEBD 1VQHA 5IP7H 5BN5A 3MEFA 4PMBA 4BWGB 2OTLA 4B3TL 4MTKA 4HSVA 3GTPH 1IBLQ 4ZUIA 1LTLA 1C9OA 4H02A 4ZKBB 3J81E 3U58A 1OXVA 3E6ZX 1HNXL 4H0LC 4J15A 4GOPC 3UE1A 2B2YA 2Z8LA 3KBXA 1XMOL 4R4CA 1KL9A 1R4PB 4K5XA 3J80L 4A3GG 4FYDA 3T51B 4XTCS 1EEID 2R92B 3NK9A 2R7FA 5CV9A 1HZAA 3PUYA 4JBKA 1T5XD 3CMEA 1LLRD 1X3FA 4BY1G 3NE5B 2WKDA 1Y14B 2WKCA 3TP6A 5A2QE 1EQQA 1YNJD 4P73A 4IO9A 3TP8A 4AH6A 2I5HA 1X54A 1HH2P 3HRZC 3TRZA 3J81c 4UP8A 1L1OA 2L55A 2MUYA 2PNHA 3C2PA 4DV2Q 4A3FB 4DV0L 3PUWA 4K5VA 1IBKL 2JN4A 1JWSD 1ONLA 2EPBA 2EJFC 1SROA 3ONAB 3GDEA 4OIJA 4DR7L 5JJIA 3NXWA 2A8VA 3J7YW 1C8CA 3A8JE 2K7VA 3W1GA 1OTCA 3K0XA 1XXGA 1KIXA 1QVCA 3CU7A 2L4NA 3TQYA 3S14H 3GTLH 5C3WA 2A73B 3RMHA 1MGSA 2EYMA 3A54A 2ZT9C 1SRUA 2K33A 4A3EG 2B2WC 4RCOA 1BCPD 5CBEE 3ULJA 1JOOA 2I5LX 1PA6A 1M8AA 4R4QA 3H91A 3HOZB 1IXRA 2DJGC 2LY7A 2D62A 4O0AA 2HDLA 2MO0A
chains in the Genus database with same CATH topology
2Q2HA 2VNUD 4YWMA 1VQ7A 3BZKA 3K81C 4P72A 1N34L 1G51A 4LNQA 4WJ3M 1K83H 1AH9A 4A3MH 2JE6I 1W3SA 4OWWB 1WOCA 4A3BG 4GLXA 4ALPA 4A75A 3KDFA 1EWIA 4IJLA 3ER0A 3NEMA 3GTOH 2MFIA 5AJ3Q 4DR1Q 2MQHA 1YJWA 1IBKQ 4LFBQ 4A93G 2BH2A 1X6OA 1D8LA 1HZBA 2K4KA 1YHAA 1YHBA 3U50C 3JAMi 4HJ7A 3PF5A 2NVTH 1NJIC 2Z6KA 2NVQH 1LYLA 1YITA 1VQ5A 3IRBA 5J3BA 4DV5L 1YI2A 2HHHL 4JI7Q 2ZM6Q 1YJNA 3S1QH 4TVAB 4DR7Q 5C44H 4DR2L 4LF9Q 4HJ9A 1TWFH 1HNZQ 2CCZA 5IP9H 3G4SA 3CCMA 3PIOA 5GQOA 3J80i 2E2JH 4DR4Q 1QVGA 1VQGA 1A63A 4A3EH 2YV5A 4DR6Q 1E22A 1PH1A 4GKKL 3CF5A 1B8AA 4X62L 2ZTCA 2XGTA 3S2HH 4LFAL 4OWTB 4IPHA 2JJQA 4UP7A 4BBSH 3SGIA 1I3QH 1GM5A 1UEBA 2PMZE 3RZDH 3CPFA 3FP9A 3AYHB 1K73C 1VQPA 1Y1VH 1XMQL 3W1BA 1VQJA 1Q12A 4B3ML 4LFCQ 2UXDL 1AE2A 5GROA 1J6QA 4YHHL 5IWAL 3J81j 2ATWA 2WB1E 4A3BH 4B3RL 3CCQA 3AFQA 4YWLA 5GADC 3J80c 2VQEQ 3OTOL 1JJCB 5IE8A 2UUCL 3NBHB 4GNXB 2YTXA 1KXLA 3BU2A 3CCLA 3CMAA 1N34Q 1PH4A 1VQLA 5JJKA 1X65A 1QZHA 4A93H 1XPOA 4B3SQ 2JA6G 5JJLA 2B63G 1XTDA 1OXTA 3EN2A 3HOYG 4LUOA 3CXCA 2WAQE 1PH2A 1XNRL 4JBJA 3U4VA 5BR8Q 5FJ8G 3KJOA 2D0PA 3H0GG 3CD6A 1IL2A 4YCVA 1I94Q 2WAQG 3OYYA 4OXPA 4A3KH 3S2DH 2N49A 1RL2A 3CCEA 3T1HL 1E7ZA 2GVBA 2HQLA 2YTVA 2LSSA 1K0RA 2OCEA 4JI3L 4HIDA 1PH9A 2HHHQ 4BXXH 4JOIC 1K8GA 4JI2Q 1WFQA 2F52A 3PV0A 3T1YL 4DR2Q 1YIJA 4LWCA 4BA2I 4BA1I 1NY4A 4OX9Q 3HOUG 3I7FA 3GTKH 4DUYL 4X65Q 2H5XA 1R9TH 2K50A 3I56A 4GNXC 2AWOA 2K52A 3A74A 3KF6B 3AQQA 1YJ9A 1I50H 2JQOA 4TQUS 5M3MG 3A5ZB 1FGUA 1SLJA 5IYDG 3CCJA 1FL0A 3UDGA 2OTJA 2UUAL 1H95A 3CC2A 4YWKA 1MKHA 4A3FG 1VCIA 1WJJA 3NELA 4GLAC 4P74A 1PYSB 1E1OA 5C44G 1XMQQ 3BJUA 1OXXK 4JOIA 4B3TQ 4JV5Q 2UXCL 2VZAA 2UXDQ 1JJ2A 3TS2A 1IBML 1HJPA 4QY7A 1UE6A 3MXNB 3CCRA 3UDXA 3G48A 1VQNA 1HNXQ 2JA6H 1TXYA 2LXKA 4GN4B 4LUZA 2MNAA 4DV4Q 4GNXA 4LF5Q 2B63H 1BKBA 4IFDG 1XMOQ 3GTQH 3RLFA 1CKNA 5LMUL 4JI0L 1TWAH 1KRSA 4XIGS 1KC8C 3H0GH 5C4XH 4HJ5A 2DGYA 3F2DA 2IHEA 1N33L 4DPGA 1N9WA 1XNRQ 1EFWA 1PH6A 4LF4Q 4L5RC 3J7ZC 2ES2A 2F4VL 4IFDI 2WFWA 2IX1A 3DLLA 4LF8Q 4DV3Q 4LF7Q 1UE5A 3F1ZA 2ASBA 4P75A 4A4IA 2B29A 3HOUH 3AEVA 1WYDA 1YBYA 3T1HQ 1EYGA 2ID0A 3CW2C 3HKSA 4QL5A 4JI3Q 3J7A5 1XJVA 3DM3A 3W5OA 2Z0SA 1IZ6A 4RMFA 2FXQA 1T9HA 4DV0Q 5M3MH 1X55A 1IBLL 4A3LG 2E2HH 4X66L 1ASZA 5IYDH 1VQAA 2YU9H 1N8RC 3KF6A 5GAEC 1Q1EA 1PYBA 1EQRA 1SE8A 4L5SA 3CP0A 4A3DH 4A3FH 3VDYA 4JI6L 3PO2G 4DKAC 4C3HH 4DUZL 1NMGA 4KLKA 2UUAQ 4A3KG 1G6PA 3FKIG 4IOCA 4WJ4A 3EBEA 3I2ZA 4BXXG 2N78A 3CC7A 4JI8L 1VQMA 1MIUA 1YHQA 4JI5L 1ASYA 3S1MH 5HY6A 3A5UA 4OWXB 2VS1A 1U5KA 4AQYL 4JI1Q 2Q2UA 2UXBQ 3M9BA 1K9MC 2C35B 3RNUA 2NZHA 4JI4L 4A76A 2QA4A 4GKJQ 4IFDJ 1PFSA 4A3IG 2UU9Q 2HIVA 5E7NA 2K5HA 4LF6Q 4DR5Q 3U4ZA 1PHJA 3JAMc 2QGQA 4PG3A 5LMUQ 4JI0Q 1QVFA 5JEAG 4GLVB 1Q8KA 5M3FH 3PIPA 4GOPB 1QZGA 4DV2L 3HOXG 3RR5A 2BA0A 1L1OB 4YY3Q 1CSQA 1X3GA 4DK6C 1VQFA 3S1RH 5M5WH 3UDIA 1C7YA 2F4VQ 1N32L 1HR0L 1JT8A 1HR0W 1KRTA 3KLWA 3I4NG 5EAYA 1VQDA 3HOZH 2E5LL 4JYAL 4HIKA 1NMFA 1AE3A 2JA7G 4A3LH 2OQ0A 1VS0A 3I4MH 5C0XG 2I5MX 3PUZA 3S17H 2PI2A 2UUBL 1XNQL 2A19A 4QGUA 1K3RA 2AHOB 2EQSA 5HGQA 3CQZH 3E9IA 3PO2H 2JK8A 2IHFA 4IJHA 2GN5A 2GVAA 3CCSA 1PH8A 4O2DA 4X66Q 5C4XG 4DAMA 1JMCA 1FJGL 4DV7L 2DUDA 3FKIH 3CCVA 4UP9A 3CCUA 4YCWA 5C0XI 3HOVG 3J81i 1CSPA 4BBRG 4NB3A 4DV5Q 4JI6Q 2KENA 4DV6L 2R92G 1BBWA 4KI0A 3S1NH 2JEBI 2WP8J 1W2BA 1P8LA 1Q1BA 3S24A 3KJPA 1Q82C 3RN5A 1HNWL 2KCMA 2QEXA 1XPRA 1CKMA 3L2PA 5IYCG 4ME3A 2PQAB 4X64L 1UE1A 2E8GA 4GS3A 4MNOA 4X6AH 2E2IH 1D7QA 1EUJA 4OONA 4A3IH 4KHPL 1V9PA 1X9NA 2NVYH 4HIOA 1OXUA 4YCUA 2K14A 2JEAI 4GKKQ 4X62Q 2I0QA 4JCVE 4LFAQ 4MZ9A 3GO5A 2ZJPA 1X3EA 3HOXH 1DGSA 1U0LA 3PUXA 4A3DG 1VQIA 4HJAA 1PV4A 3PSIA 3FHWA 5FLXc 1YNXA 5AJ3L 4DR1L 2JA5G 4B3MQ 3I4NH 1YEZA 4LFBL 1NBWA 4YHHQ 5IWAQ 2LXJA 1V43A 3CPWA 3RZOH 2JA7H 4JBWA 1MJEA 3G6EA 4B3RQ 1I6HH 3ICEA 2UUCQ 3OTOQ 1S40A 2OWOA 2ALYB 4BY7G 4JI7L 2ZM6L 4NXNL 2AKWB 2VL6A 4GN3B 2E5LQ 2CFMA 1TWGH 1TWCH 4GN5A 1JB7A 4LF9L 1B7YB 2CKZB 3UDFA 2NZOA 4P71A 4EX5A 3RLOA 1SR3A 2HT1A 2BA1A 4IPGA 5ELOA 1SN8A 1UE7A 4DR4L 1XNQQ 5K36G 1EIFA 3HOVH 1VQ4A 4PZ6A 4BBRH 5M3FG 2R92H 3GD7A 3JC66 3B6YA 4AIMA 1V1QA 1TWHH 1WCMG 2ZJQA 3M7NA 3L7ZC 4NPSA 1LUZA 2CQOA 4DV7Q 4A3JG 1Y1WG 2KCTA 1VQOA 1E24A 3M4OH 1Q81C 5IYCH 1PH3A 2RHSB 2HIXA 3L0OA 2ZJRA 1GD7A 3CAMA 2B3GA 4HIMA 2KBNA 1HZCA 3HKZE 3Q8DA 3T1YQ 4PZ7A 1N36L 3HOZG 2VQFL 1S3OA 1YVCA 5GAGC 4LFCL 1GO3E 2EXDA 4KHPQ 4DUYQ 3PO3H 1L2FA 1QUQB 4X64Q 4R1JA 3I4MG 1Q46A 3HKZG 2Y0SE 4DNIA 5IP7G 4C2MH 2XTIA 4OO1G 1JJGA 1E3PA 4RG1A 1E1TA 3K8AA 1VQ9A 2PI2E 1M90C 1GKHA 2Y0SG 3BZCA 4IPCA 4L5QA 2JA5H 1IYJB 5ELNA 2JA8G 1VQCA 3A0JA 4B3SL 1VQBA 3TEHB 4A3CG 2N3SA 3GTMH 3ULLA 3LGJA 4OO1I 3WWVA 1KHIA 2CWAA 3K7UC 5BR8L 2UXCQ 2VUMH 4BY7H 1IBMQ 4HJ8A 1I94L 2EIFA 1EIYB 3M3YH 5FLMH 2IY5B 5H1SE 3KF8B 2VQEL 4IPDA 3S16H 4APVA 2R7ZG 1PVOA 4JC0A 3D0FA 3STBD 5M5XH 1G291 4JI2L 4NXNQ 2D0OA 2IT1A 4LW1A 4R4IA 2VW9A 4DV1L 3OW2A 4POGA 4K0KL 4QQBX 4OX9L 1WCMH 1VQ6A 3G71A 4X65L 3K7AH 4C3IH 4A3JH 1Y1WH 1P16A 1N33Q 1BBUA 1Q7YC 4UPAA 3KFUA 1A62A 1WI5A 2MO1A 4DR3L 1Z9FA 3M4QA 2KHIA 2RCNA 3RN2A 3PO3G 1BVSA 3ERSX 1HZ9A 1A8VA 1Q86C 1VQEA 1K8AC 3HFZB 1PH7A 2BH8A 5LMNL 1KQSA 5LMNW 4POFA 1J5EL 4PZ8A 5C3EG 4JBMA 4NXML 1VQHA 4R4TA 2K75A 5IP7H 3F2CA 1FVIA 3MEFA 1CKOA 3PGZA 1N36Q 3HOWG 2NN6G 2VQFQ 2OTLA 1QUQA 4B3TL 4JV5L 2Q2TA 1VQ8A 3GTPH 3GTJH 1IBLQ 2CWPA 1LTLA 1C9OA 4H02A 4Y52H 3H3VI 2JA8H 5IY0A 5GAHC 1OXVA 3U58A 4UY8C 4A3CH 1C0AA 1HNXL 1MJCA 4DV4L 4J15A 4GOPC 3PUVA 3UE1A 4LF5L 1LM0A 1O7IA 1L1OC 1XMOL 4AYBE 2NN6I 1KL9A 4R4CA 1NE3A 3E9HA 3AFPA 4A3GG 3D31A 4DUZQ 1I5FA 2WB1G 4FDBA 3M4PA 1PH5A 4QJFA 4XTCS 1CKNB 3K80C 2R7FA 1GVPA 3STBC 3S15H 1JE5A 1X56A 4AYBG 1HZAA 5IYBG 3PUYA 2R93G 4JBKA 3CMEA 4JI8Q 1X3FA 4BY1G 3M85A 4JI5Q 2JA9A 4LF4L 1Y14B 2R7ZH 1EQQA 4LF8L 4IO9A 4P73A 4DV3L 4AQYQ 1KD1C 4LF7L 4DAYB 4KHZA 2N8NA 3UE0A 4JI4Q 4AH6A 2I5HA 1Z47A 4QIWE 2ZTEA 1X54A 4C3JH 4IOAA 2YTYA 5JEAJ 1SFOH 1HH2P 4K0KQ 4GOPA 3TRZA 4DV1Q 3J81c 2A1AA 4UP8A 1L1OA 4MTNA 3F2BA 2PNHA 2R6GA 3I4OA 4DV2Q 3TS0A 4DV0L 3KDFB 3PUWA 4A3MG 1IBKL 3GTGH 2VY3A 3F8TA 3H3VH 5C3EH 1UWVA 1L0WA 4DR3Q 3ULPA 1N32Q 2Q2IA 2VUMG 1HR0Q 1SROA 3GDEA 3NENA 3HOWH 4DR7L 4JYAQ 1VQKA 3E0EA 2A8VA 5JJIA 2KHJA 1SMXA 3CC4A 5LMNQ 2RHQB 5FLMG 1M1KC 1J5EQ 2K5VA 2OQKA 5C0XJ 1HNZL 4Y7NH 3W1GA 2NVXH 4NXMQ 4EQ5A 1OTCA 2RF4A 1NTGA 3K0XA 3I55A 2L15A 3RLNA 4PMWA 2AWNA 1KIXA 2UUBQ 3TREA 1QVCA 1RIPA 3EIVA 4DR6L 3TQYA 3S14H 3GTLH 1CUKA 1KAWA 4JI1L 4A3GH 2UXBL 5IP9G 1B70B 1FJGQ 4LUVA 1SRUA 4A3EG 4L5TA 4GKJL 2IX0A 2ZTDA 2UU9L 1XPUA 5M5YH 1EOVA 5IYBH 3HOYH 2YYZA 4LF6L 4DR5L 4DV6Q 2R93H 1OXSC 4BY1H 2AMCB 3PCOB 5DLQE 5FJ8H 3ULJA 5C4JH 2PQAA 1HNWQ 4BBSG 2K5NA 2I5LX 1A0IA 2F3IA 2V1CC 4R4QA 1S72A 1YZ6A 1PA6A 2R7DA 4YY3L 5IT9c 2Z6KC 4DK3C 3KOJA 3KYHC 1IXRA 4R4OA 1Y1VG 4JG2A 3PF4A 2D62A 4O0AA 2MO0A 3ZJYC 3H15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2H A;  2VNU D;  4YWM A;  1VQ7 A;  3BZK A;  3K81 C;  4P72 A;  1N34 L;  1G51 A;  4LNQ A;  4WJ3 M;  1K83 H;  1AH9 A;  4A3M H;  2JE6 I;  1W3S A;  4OWW B;  1WOC A;  4A3B G;  4GLX A;  4ALP A;  4A75 A;  3KDF A;  1EWI A;  4IJL A;  3ER0 A;  3NEM A;  3GTO H;  2MFI A;  5AJ3 Q;  4DR1 Q;  2MQH A;  1YJW A;  1IBK Q;  4LFB Q;  4A93 G;  2BH2 A;  1X6O A;  1D8L A;  1HZB A;  2K4K A;  1YHA A;  1YHB A;  3U50 C;  3JAM i;  4HJ7 A;  3PF5 A;  2NVT H;  1NJI C;  2Z6K A;  2NVQ H;  1LYL A;  1YIT A;  1VQ5 A;  3IRB A;  5J3B A;  4DV5 L;  1YI2 A;  2HHH L;  4JI7 Q;  2ZM6 Q;  1YJN A;  3S1Q H;  4TVA B;  4DR7 Q;  5C44 H;  4DR2 L;  4LF9 Q;  4HJ9 A;  1TWF H;  1HNZ Q;  2CCZ A;  5IP9 H;  3G4S A;  3CCM A;  3PIO A;  5GQO A;  3J80 i;  2E2J H;  4DR4 Q;  1QVG A;  1VQG A;  1A63 A;  4A3E H;  2YV5 A;  4DR6 Q;  1E22 A;  1PH1 A;  4GKK L;  3CF5 A;  1B8A A;  4X62 L;  2ZTC A;  2XGT A;  3S2H H;  4LFA L;  4OWT B;  4IPH A;  2JJQ A;  4UP7 A;  4BBS H;  3SGI A;  1I3Q H;  1GM5 A;  1UEB A;  2PMZ E;  3RZD H;  3CPF A;  3FP9 A;  3AYH B;  1K73 C;  1VQP A;  1Y1V H;  1XMQ L;  3W1B A;  1VQJ A;  1Q12 A;  4B3M L;  4LFC Q;  2UXD L;  1AE2 A;  5GRO A;  1J6Q A;  4YHH L;  5IWA L;  3J81 j;  2ATW A;  2WB1 E;  4A3B H;  4B3R L;  3CCQ A;  3AFQ A;  4YWL A;  5GAD C;  3J80 c;  2VQE Q;  3OTO L;  1JJC B;  5IE8 A;  2UUC L;  3NBH B;  4GNX B;  2YTX A;  1KXL A;  3BU2 A;  3CCL A;  3CMA A;  1N34 Q;  1PH4 A;  1VQL A;  5JJK A;  1X65 A;  1QZH A;  4A93 H;  1XPO A;  4B3S Q;  2JA6 G;  5JJL A;  2B63 G;  1XTD A;  1OXT A;  3EN2 A;  3HOY G;  4LUO A;  3CXC A;  2WAQ E;  1PH2 A;  1XNR L;  4JBJ A;  3U4V A;  5BR8 Q;  5FJ8 G;  3KJO A;  2D0P A;  3H0G G;  3CD6 A;  1IL2 A;  4YCV A;  1I94 Q;  2WAQ G;  3OYY A;  4OXP A;  4A3K H;  3S2D H;  2N49 A;  1RL2 A;  3CCE A;  3T1H L;  1E7Z A;  2GVB A;  2HQL A;  2YTV A;  2LSS A;  1K0R A;  2OCE A;  4JI3 L;  4HID A;  1PH9 A;  2HHH Q;  4BXX H;  4JOI C;  1K8G A;  4JI2 Q;  1WFQ A;  2F52 A;  3PV0 A;  3T1Y L;  4DR2 Q;  1YIJ A;  4LWC A;  4BA2 I;  4BA1 I;  1NY4 A;  4OX9 Q;  3HOU G;  3I7F A;  3GTK H;  4DUY L;  4X65 Q;  2H5X A;  1R9T H;  2K50 A;  3I56 A;  4GNX C;  2AWO A;  2K52 A;  3A74 A;  3KF6 B;  3AQQ A;  1YJ9 A;  1I50 H;  2JQO A;  4TQU S;  5M3M G;  3A5Z B;  1FGU A;  1SLJ A;  5IYD G;  3CCJ A;  1FL0 A;  3UDG A;  2OTJ A;  2UUA L;  1H95 A;  3CC2 A;  4YWK A;  1MKH A;  4A3F G;  1VCI A;  1WJJ A;  3NEL A;  4GLA C;  4P74 A;  1PYS B;  1E1O A;  5C44 G;  1XMQ Q;  3BJU A;  1OXX K;  4JOI A;  4B3T Q;  4JV5 Q;  2UXC L;  2VZA A;  2UXD Q;  1JJ2 A;  3TS2 A;  1IBM L;  1HJP A;  4QY7 A;  1UE6 A;  3MXN B;  3CCR A;  3UDX A;  3G48 A;  1VQN A;  1HNX Q;  2JA6 H;  1TXY A;  2LXK A;  4GN4 B;  4LUZ A;  2MNA A;  4DV4 Q;  4GNX A;  4LF5 Q;  2B63 H;  1BKB A;  4IFD G;  1XMO Q;  3GTQ H;  3RLF A;  1CKN A;  5LMU L;  4JI0 L;  1TWA H;  1KRS A;  4XIG S;  1KC8 C;  3H0G H;  5C4X H;  4HJ5 A;  2DGY A;  3F2D A;  2IHE A;  1N33 L;  4DPG A;  1N9W A;  1XNR Q;  1EFW A;  1PH6 A;  4LF4 Q;  4L5R C;  3J7Z C;  2ES2 A;  2F4V L;  4IFD I;  2WFW A;  2IX1 A;  3DLL A;  4LF8 Q;  4DV3 Q;  4LF7 Q;  1UE5 A;  3F1Z A;  2ASB A;  4P75 A;  4A4I A;  2B29 A;  3HOU H;  3AEV A;  1WYD A;  1YBY A;  3T1H Q;  1EYG A;  2ID0 A;  3CW2 C;  3HKS A;  4QL5 A;  4JI3 Q;  3J7A 5;  1XJV A;  3DM3 A;  3W5O A;  2Z0S A;  1IZ6 A;  4RMF A;  2FXQ A;  1T9H A;  4DV0 Q;  5M3M H;  1X55 A;  1IBL L;  4A3L G;  2E2H H;  4X66 L;  1ASZ A;  5IYD H;  1VQA A;  2YU9 H;  1N8R C;  3KF6 A;  5GAE C;  1Q1E A;  1PYB A;  1EQR A;  1SE8 A;  4L5S A;  3CP0 A;  4A3D H;  4A3F H;  3VDY A;  4JI6 L;  3PO2 G;  4DKA C;  4C3H H;  4DUZ L;  1NMG A;  4KLK A;  2UUA Q;  4A3K G;  1G6P A;  3FKI G;  4IOC A;  4WJ4 A;  3EBE A;  3I2Z A;  4BXX G;  2N78 A;  3CC7 A;  4JI8 L;  1VQM A;  1MIU A;  1YHQ A;  4JI5 L;  1ASY A;  3S1M H;  5HY6 A;  3A5U A;  4OWX B;  2VS1 A;  1U5K A;  4AQY L;  4JI1 Q;  2Q2U A;  2UXB Q;  3M9B A;  1K9M C;  2C35 B;  3RNU A;  2NZH A;  4JI4 L;  4A76 A;  2QA4 A;  4GKJ Q;  4IFD J;  1PFS A;  4A3I G;  2UU9 Q;  2HIV A;  5E7N A;  2K5H A;  4LF6 Q;  4DR5 Q;  3U4Z A;  1PHJ A;  3JAM c;  2QGQ A;  4PG3 A;  5LMU Q;  4JI0 Q;  1QVF A;  5JEA G;  4GLV B;  1Q8K A;  5M3F H;  3PIP A;  4GOP B;  1QZG A;  4DV2 L;  3HOX G;  3RR5 A;  2BA0 A;  1L1O B;  4YY3 Q;  1CSQ A;  1X3G A;  4DK6 C;  1VQF A;  3S1R H;  5M5W H;  3UDI A;  1C7Y A;  2F4V Q;  1N32 L;  1HR0 L;  1JT8 A;  1HR0 W;  1KRT A;  3KLW A;  3I4N G;  5EAY A;  1VQD A;  3HOZ H;  2E5L L;  4JYA L;  4HIK A;  1NMF A;  1AE3 A;  2JA7 G;  4A3L H;  2OQ0 A;  1VS0 A;  3I4M H;  5C0X G;  2I5M X;  3PUZ A;  3S17 H;  2PI2 A;  2UUB L;  1XNQ L;  2A19 A;  4QGU A;  1K3R A;  2AHO B;  2EQS A;  5HGQ A;  3CQZ H;  3E9I A;  3PO2 H;  2JK8 A;  2IHF A;  4IJH A;  2GN5 A;  2GVA A;  3CCS A;  1PH8 A;  4O2D A;  4X66 Q;  5C4X G;  4DAM A;  1JMC A;  1FJG L;  4DV7 L;  2DUD A;  3FKI H;  3CCV A;  4UP9 A;  3CCU A;  4YCW A;  5C0X I;  3HOV G;  3J81 i;  1CSP A;  4BBR G;  4NB3 A;  4DV5 Q;  4JI6 Q;  2KEN A;  4DV6 L;  2R92 G;  1BBW A;  4KI0 A;  3S1N H;  2JEB I;  2WP8 J;  1W2B A;  1P8L A;  1Q1B A;  3S24 A;  3KJP A;  1Q82 C;  3RN5 A;  1HNW L;  2KCM A;  2QEX A;  1XPR A;  1CKM A;  3L2P A;  5IYC G;  4ME3 A;  2PQA B;  4X64 L;  1UE1 A;  2E8G A;  4GS3 A;  4MNO A;  4X6A H;  2E2I H;  1D7Q A;  1EUJ A;  4OON A;  4A3I H;  4KHP L;  1V9P A;  1X9N A;  2NVY H;  4HIO A;  1OXU A;  4YCU A;  2K14 A;  2JEA I;  4GKK Q;  4X62 Q;  2I0Q A;  4JCV E;  4LFA Q;  4MZ9 A;  3GO5 A;  2ZJP A;  1X3E A;  3HOX H;  1DGS A;  1U0L A;  3PUX A;  4A3D G;  1VQI A;  4HJA A;  1PV4 A;  3PSI A;  3FHW A;  5FLX c;  1YNX A;  5AJ3 L;  4DR1 L;  2JA5 G;  4B3M Q;  3I4N H;  1YEZ A;  4LFB L;  1NBW A;  4YHH Q;  5IWA Q;  2LXJ A;  1V43 A;  3CPW A;  3RZO H;  2JA7 H;  4JBW A;  1MJE A;  3G6E A;  4B3R Q;  1I6H H;  3ICE A;  2UUC Q;  3OTO Q;  1S40 A;  2OWO A;  2ALY B;  4BY7 G;  4JI7 L;  2ZM6 L;  4NXN L;  2AKW B;  2VL6 A;  4GN3 B;  2E5L Q;  2CFM A;  1TWG H;  1TWC H;  4GN5 A;  1JB7 A;  4LF9 L;  1B7Y B;  2CKZ B;  3UDF A;  2NZO A;  4P71 A;  4EX5 A;  3RLO A;  1SR3 A;  2HT1 A;  2BA1 A;  4IPG A;  5ELO A;  1SN8 A;  1UE7 A;  4DR4 L;  1XNQ Q;  5K36 G;  1EIF A;  3HOV H;  1VQ4 A;  4PZ6 A;  4BBR H;  5M3F G;  2R92 H;  3GD7 A;  3JC6 6;  3B6Y A;  4AIM A;  1V1Q A;  1TWH H;  1WCM G;  2ZJQ A;  3M7N A;  3L7Z C;  4NPS A;  1LUZ A;  2CQO A;  4DV7 Q;  4A3J G;  1Y1W G;  2KCT A;  1VQO A;  1E24 A;  3M4O H;  1Q81 C;  5IYC H;  1PH3 A;  2RHS B;  2HIX A;  3L0O A;  2ZJR A;  1GD7 A;  3CAM A;  2B3G A;  4HIM A;  2KBN A;  1HZC A;  3HKZ E;  3Q8D A;  3T1Y Q;  4PZ7 A;  1N36 L;  3HOZ G;  2VQF L;  1S3O A;  1YVC A;  5GAG C;  4LFC L;  1GO3 E;  2EXD A;  4KHP Q;  4DUY Q;  3PO3 H;  1L2F A;  1QUQ B;  4X64 Q;  4R1J A;  3I4M G;  1Q46 A;  3HKZ G;  2Y0S E;  4DNI A;  5IP7 G;  4C2M H;  2XTI A;  4OO1 G;  1JJG A;  1E3P A;  4RG1 A;  1E1T A;  3K8A A;  1VQ9 A;  2PI2 E;  1M90 C;  1GKH A;  2Y0S G;  3BZC A;  4IPC A;  4L5Q A;  2JA5 H;  1IYJ B;  5ELN A;  2JA8 G;  1VQC A;  3A0J A;  4B3S L;  1VQB A;  3TEH B;  4A3C G;  2N3S A;  3GTM H;  3ULL A;  3LGJ A;  4OO1 I;  3WWV A;  1KHI A;  2CWA A;  3K7U C;  5BR8 L;  2UXC Q;  2VUM H;  4BY7 H;  1IBM Q;  4HJ8 A;  1I94 L;  2EIF A;  1EIY B;  3M3Y H;  5FLM H;  2IY5 B;  5H1S E;  3KF8 B;  2VQE L;  4IPD A;  3S16 H;  4APV A;  2R7Z G;  1PVO A;  4JC0 A;  3D0F A;  3STB D;  5M5X H;  1G29 1;  4JI2 L;  4NXN Q;  2D0O A;  2IT1 A;  4LW1 A;  4R4I A;  2VW9 A;  4DV1 L;  3OW2 A;  4POG A;  4K0K L;  4QQB X;  4OX9 L;  1WCM H;  1VQ6 A;  3G71 A;  4X65 L;  3K7A H;  4C3I H;  4A3J H;  1Y1W H;  1P16 A;  1N33 Q;  1BBU A;  1Q7Y C;  4UPA A;  3KFU A;  1A62 A;  1WI5 A;  2MO1 A;  4DR3 L;  1Z9F A;  3M4Q A;  2KHI A;  2RCN A;  3RN2 A;  3PO3 G;  1BVS A;  3ERS X;  1HZ9 A;  1A8V A;  1Q86 C;  1VQE A;  1K8A C;  3HFZ B;  1PH7 A;  2BH8 A;  5LMN L;  1KQS A;  5LMN W;  4POF A;  1J5E L;  4PZ8 A;  5C3E G;  4JBM A;  4NXM L;  1VQH A;  4R4T A;  2K75 A;  5IP7 H;  3F2C A;  1FVI A;  3MEF A;  1CKO A;  3PGZ A;  1N36 Q;  3HOW G;  2NN6 G;  2VQF Q;  2OTL A;  1QUQ A;  4B3T L;  4JV5 L;  2Q2T A;  1VQ8 A;  3GTP H;  3GTJ H;  1IBL Q;  2CWP A;  1LTL A;  1C9O A;  4H02 A;  4Y52 H;  3H3V I;  2JA8 H;  5IY0 A;  5GAH C;  1OXV A;  3U58 A;  4UY8 C;  4A3C H;  1C0A A;  1HNX L;  1MJC A;  4DV4 L;  4J15 A;  4GOP C;  3PUV A;  3UE1 A;  4LF5 L;  1LM0 A;  1O7I A;  1L1O C;  1XMO L;  4AYB E;  2NN6 I;  1KL9 A;  4R4C A;  1NE3 A;  3E9H A;  3AFP A;  4A3G G;  3D31 A;  4DUZ Q;  1I5F A;  2WB1 G;  4FDB A;  3M4P A;  1PH5 A;  4QJF A;  4XTC S;  1CKN B;  3K80 C;  2R7F A;  1GVP A;  3STB C;  3S15 H;  1JE5 A;  1X56 A;  4AYB G;  1HZA A;  5IYB G;  3PUY A;  2R93 G;  4JBK A;  3CME A;  4JI8 Q;  1X3F A;  4BY1 G;  3M85 A;  4JI5 Q;  2JA9 A;  4LF4 L;  1Y14 B;  2R7Z H;  1EQQ A;  4LF8 L;  4IO9 A;  4P73 A;  4DV3 L;  4AQY Q;  1KD1 C;  4LF7 L;  4DAY B;  4KHZ A;  2N8N A;  3UE0 A;  4JI4 Q;  4AH6 A;  2I5H A;  1Z47 A;  4QIW E;  2ZTE A;  1X54 A;  4C3J H;  4IOA A;  2YTY A;  5JEA J;  1SFO H;  1HH2 P;  4K0K Q;  4GOP A;  3TRZ A;  4DV1 Q;  3J81 c;  2A1A A;  4UP8 A;  1L1O A;  4MTN A;  3F2B A;  2PNH A;  2R6G A;  3I4O A;  4DV2 Q;  3TS0 A;  4DV0 L;  3KDF B;  3PUW A;  4A3M G;  1IBK L;  3GTG H;  2VY3 A;  3F8T A;  3H3V H;  5C3E H;  1UWV A;  1L0W A;  4DR3 Q;  3ULP A;  1N32 Q;  2Q2I A;  2VUM G;  1HR0 Q;  1SRO A;  3GDE A;  3NEN A;  3HOW H;  4DR7 L;  4JYA Q;  1VQK A;  3E0E A;  2A8V A;  5JJI A;  2KHJ A;  1SMX A;  3CC4 A;  5LMN Q;  2RHQ B;  5FLM G;  1M1K C;  1J5E Q;  2K5V A;  2OQK A;  5C0X J;  1HNZ L;  4Y7N H;  3W1G A;  2NVX H;  4NXM Q;  4EQ5 A;  1OTC A;  2RF4 A;  1NTG A;  3K0X A;  3I55 A;  2L15 A;  3RLN A;  4PMW A;  2AWN A;  1KIX A;  2UUB Q;  3TRE A;  1QVC A;  1RIP A;  3EIV A;  4DR6 L;  3TQY A;  3S14 H;  3GTL H;  1CUK A;  1KAW A;  4JI1 L;  4A3G H;  2UXB L;  5IP9 G;  1B70 B;  1FJG Q;  4LUV A;  1SRU A;  4A3E G;  4L5T A;  4GKJ L;  2IX0 A;  2ZTD A;  2UU9 L;  1XPU A;  5M5Y H;  1EOV A;  5IYB H;  3HOY H;  2YYZ A;  4LF6 L;  4DR5 L;  4DV6 Q;  2R93 H;  1OXS C;  4BY1 H;  2AMC B;  3PCO B;  5DLQ E;  5FJ8 H;  3ULJ A;  5C4J H;  2PQA A;  1HNW Q;  4BBS G;  2K5N A;  2I5L X;  1A0I A;  2F3I A;  2V1C C;  4R4Q A;  1S72 A;  1YZ6 A;  1PA6 A;  2R7D A;  4YY3 L;  5IT9 c;  2Z6K C;  4DK3 C;  3KOJ A;  3KYH C;  1IXR A;  4R4O A;  1Y1V G;  4JG2 A;  3PF4 A;  2D62 A;  4O0A A;  2MO0 A;  3ZJY C;  3H15 A; 
#chains in the Genus database with same CATH topology
 2Q2H A;  4YWM A;  1VQ7 A;  3BZK A;  1U9R A;  3K81 C;  4KJO A;  3CQZ B;  2BE5 D;  1K83 H;  2EZV A;  1W3S A;  4OWW B;  4UAI A;  4A75 A;  1LO5 D;  2B2U A;  4RGN A;  1EWI A;  4IJL A;  3MC0 B;  5AJ3 Q;  1IBK Q;  2AQ1 B;  2BH2 A;  1D8L A;  1HZB A;  1YHB A;  3U50 C;  2NVT H;  1LYL A;  1VQ5 A;  3IRB A;  2ZM6 Q;  1YJN A;  4CJ0 B;  4DR7 Q;  4Q0F A;  5DEH A;  2AQ2 B;  2E2I B;  3GV3 A;  1K3B C;  1BCP C;  1Q90 A;  4L63 B;  1KTK A;  5GQO A;  4CBV A;  2RSN A;  1M4V A;  3QB3 A;  2RQX A;  4C3J B;  4NKL A;  3CF5 A;  3S2H H;  2PCF B;  2ZTC A;  1CQV A;  2JJQ A;  3SK5 A;  3SGI A;  4FNF A;  1E0B A;  1GM5 A;  3I4N B;  3J7A V;  1PTO F;  4XT1 B;  3FP9 A;  1K73 C;  1H9J A;  1DOK A;  3RZO B;  2DNE A;  4I7A A;  2K5Q A;  3W1B A;  1I6H B;  2PZT A;  2FMM A;  5KEE A;  5IWA L;  5KND A;  3N6R A;  5C5L A;  3OMC A;  2VQE Q;  3OTO L;  1ILQ A;  3BU2 A;  3HOV B;  1WTH A;  2F3V A;  1SNM A;  4KKS A;  1PH4 A;  1EY5 A;  1QZH A;  4A93 H;  2KQ3 A;  2Z4H A;  3PQI A;  2B63 G;  1PH2 A;  1D5Z C;  2EVB A;  5J22 A;  3CRL C;  3KJO A;  5M5Y B;  5EQ0 A;  3CD6 A;  4OEM B;  4KY7 A;  3K0Y A;  2WAQ G;  5EKI A;  3OPO A;  4CJ1 B;  1E7Z A;  2HQL A;  2YTV A;  2OCE A;  4JI2 Q;  1WFQ A;  4RFB A;  3PV0 A;  3KLR A;  1YIJ A;  1BDO A;  1AZP A;  1UNS A;  3GTK H;  2P5Z X;  4X65 Q;  1R9T H;  2AWO A;  2JA5 B;  4DXG A;  4A3M B;  1WVL A;  2JQO A;  4TSS A;  5IT9 E;  4KD4 A;  3ND9 A;  4YWK A;  1ET9 A;  1Y8P B;  4C3H G;  1PYS B;  1E1O A;  2F03 A;  2EOT A;  4JV5 Q;  3H94 A;  1IBM L;  5I4D A;  1NCV A;  4JK1 C;  1ZYR D;  3MXN B;  2ICE C;  5T1G A;  3NBH A;  4DV4 Q;  4GNX A;  4LF5 Q;  2MPM A;  4G7H C;  2QKI C;  3GTQ H;  3DXJ C;  3VYU A;  5IGF A;  2F0U A;  1TWA H;  2EYP A;  5LMU L;  5D3I B;  3WDN A;  4HJ5 A;  3EVQ A;  3MFY A;  1PXU A;  5FO9 B;  1EY9 A;  3C1E A;  2Q8R E;  2Z4I A;  2EYJ A;  1N9W A;  3LWE A;  1S5B D;  1RF2 D;  4HMI A;  1PH6 A;  3J7Z C;  4BS9 A;  2XSC A;  2XWJ B;  3DLL A;  4FF3 A;  3BYY B;  1SNQ A;  1TQO A;  3WOE A;  4DU9 A;  4P75 A;  4A4I A;  2B29 A;  4RKL A;  3HOU H;  3AEV A;  1YBY A;  5JVG 3;  3GTP B;  4FVM A;  2Y0S B;  1WD1 A;  1IZ6 A;  2B8G A;  3NPP A;  4A3L G;  3KBG A;  1N8R C;  1PYB A;  1EQR A;  2M9V A;  5LL6 S;  2H4O A;  2IWH A;  1QOH A;  1Z7T A;  2G5D A;  1PRT B;  1AW7 A;  4DKA C;  3SEB A;  4PQX A;  3T16 A;  4KLK A;  1ICW A;  4IOC A;  3I2Z A;  1HA6 A;  2A6H C;  1STY A;  4JI8 L;  1YHQ A;  3S1M H;  4FXK C;  4IFD H;  2O4X A;  1U5K A;  2VS1 A;  2Q2U A;  4CJ2 C;  1K9M C;  1PTO D;  4A3I G;  2UU9 Q;  1STN A;  1O7L A;  2QW7 A;  1PHJ A;  3RD4 A;  4RKB A;  5LMU Q;  4GLV B;  1DOM A;  3G7L A;  1FYC A;  1NUC A;  1L1O B;  4ZAI A;  1TII D;  2JP1 A;  2Z9H A;  4X3S A;  4KY5 A;  1LT3 D;  1NMF A;  3FDT A;  1AE3 A;  3S14 B;  3GTL B;  2F0S A;  2JA7 G;  2OQ0 A;  4R8I A;  5C0X G;  2I5M X;  3PUZ A;  1B4O A;  2WB1 B;  1SYD A;  3OWE B;  5IIF A;  3BDC A;  4QGU A;  2JA6 B;  2EQS A;  3PO2 H;  1EY8 A;  2GVA A;  4ZK9 B;  4RGO S;  4DV7 L;  1ILP A;  3K5M A;  3CCV A;  5C0X I;  2PZU A;  3J81 i;  4DV5 Q;  2QCP X;  1ET6 A;  2EYL A;  1P8L A;  4R9W A;  4PNY A;  1Q82 C;  1HNW L;  3RN5 A;  1LTR D;  5E4X A;  1KLG D;  3OSO A;  1EUJ A;  1K83 B;  4KHP L;  2NVY H;  3HEJ A;  2JEA I;  3FPP A;  4GKK Q;  1B44 D;  1Q8I A;  4X62 Q;  5JEA H;  4LFA Q;  1X3E A;  1DGS A;  1IHZ A;  3PUX A;  4X3T A;  4A3D G;  1VQI A;  1PV4 A;  1TVX A;  2QIL A;  4DR1 L;  4LFB L;  3U9S A;  3NSW A;  4B3R Q;  2BDN A;  1S40 A;  2OWO A;  4HCE A;  3BG3 A;  1YNN D;  1TWG H;  4GN5 A;  1JB7 A;  1EU3 A;  3BYT B;  1SJE D;  2CVR A;  1B3Q A;  2HT1 A;  2BA1 A;  5ELO A;  3S2H B;  1UE7 A;  4DR4 L;  1RDP D;  2VB3 X;  5M3F G;  2R92 H;  4AIM A;  1SYC A;  1WCM G;  2ZJQ A;  1LAC A;  4B9W A;  1Y1W G;  2F0J A;  4DV7 Q;  2SNM A;  3OIQ A;  2O2L D;  1Q81 C;  5IYC H;  1SE4 A;  5JJZ A;  1GD7 A;  1PRT D;  3CAM A;  1N36 L;  1EYA A;  5GAG C;  1GO3 E;  2EXD A;  3NTH A;  2KCN A;  4DUY Q;  5K5P A;  1EY4 A;  1L2F A;  1Y8O B;  4NW2 A;  4DA2 A;  1Z6H A;  4PMC A;  4DNI A;  4TKO B;  4OO1 G;  4A93 B;  2DJF C;  1VQ9 A;  3QO2 A;  1SND A;  4C1N I;  4IPC A;  4L5Q A;  4A3C G;  4B3S L;  1B1Z A;  5E1F A;  2N3S A;  3MAQ A;  4DN4 M;  3GTM H;  1YNN C;  3LGJ A;  4OO1 I;  3WWV A;  1KHI A;  2A68 C;  1ENA A;  3K5O A;  4BY7 H;  1I4P A;  2A74 C;  1I94 L;  1X32 A;  2X69 A;  2FHT A;  3M3Y H;  2IL8 A;  2F0P A;  2VQE L;  3GTK B;  1GUG A;  1R9T B;  2NWG A;  2R7Z G;  4JC0 A;  3STB D;  5K36 H;  1G29 1;  4K0K L;  3O13 A;  1JQY D;  4R4I A;  3OW2 A;  4QQB X;  4OX9 L;  3K5N A;  4G7Z C;  1PRT C;  3FMC A;  4C3I H;  2F0G A;  1P16 A;  4UPA A;  1MD2 D;  5JOB A;  3KFU A;  2B2Y C;  1A62 A;  4I7Z C;  3HOX B;  1DXM A;  2KHI A;  3PO3 G;  1BVS A;  1K8A C;  1HZ9 A;  1Q86 C;  2L5T A;  1VQE A;  3IAY A;  1F9R A;  3HFZ B;  5C4H A;  1HFN A;  5LMN L;  5LMN W;  4POF A;  1J5E L;  2K75 A;  4ME5 A;  3F2C A;  5EGT A;  1N36 Q;  2NN6 G;  1QUQ A;  2N55 A;  4K5W A;  2F0E A;  4LJZ C;  2PO4 A;  4V0B A;  3GTJ H;  3GTQ B;  2CWP A;  1KNA A;  1TWA B;  3R8B A;  3H3V I;  2JA8 H;  2N88 A;  5FLX E;  5C5M A;  2SOB A;  3WOF A;  1MJC A;  2HQE A;  4DK0 A;  1AZQ A;  1LM0 A;  1JIC A;  1L1O C;  4ABN A;  2NN6 I;  1NE3 A;  3E9H A;  4DUZ Q;  1PH5 A;  1BF4 A;  5IGG A;  5IGE A;  4K8I A;  3STB C;  5CC4 A;  4AYB G;  1SYE A;  1X56 A;  5IYB G;  2R93 G;  2SNS A;  3HOU B;  2MHV A;  4LF4 L;  5IOC A;  3P1H A;  4H44 C;  3DM1 A;  4LF8 L;  1TKW B;  4DV3 L;  4AQY Q;  3MFG A;  4LF7 L;  4DAY B;  4P2C B;  1QIL A;  3X3N A;  4RCN A;  3UE0 A;  1A15 A;  2NZ1 D;  1S5E D;  1Z47 A;  3VR3 A;  5IOD A;  4C3J H;  5JEA J;  3D4W A;  1LTS D;  4K0K Q;  1TR5 A;  1QCB D;  1FGB D;  4EQN A;  3K58 A;  2DY7 A;  4MTN A;  3TS0 A;  3KDF B;  4DNT B;  2F1M A;  3F8T A;  3ULP A;  1L0W A;  3P7J A;  2VUM G;  1HR0 Q;  4FXG C;  5BN3 A;  3NEN A;  3HOW H;  4JYA Q;  3S1M B;  1SMX A;  5LMN Q;  1J5E Q;  1HNZ L;  2NVX H;  4EQ5 A;  2Z1C A;  2D9U A;  1NNX A;  2AWN A;  2UUB Q;  3TRE A;  1D5X C;  5JPM C;  3EIV A;  4QMG A;  2KCC A;  2L12 A;  2Q8T A;  2UXB L;  5IP9 G;  2K5D A;  5M9O A;  2ZXO A;  4KTA A;  2WII B;  1X3Q A;  2IX0 A;  4GKJ L;  1U4M A;  3MTS A;  1EOV A;  3K7A B;  5M5Y H;  4DR5 L;  2FMC A;  4DV6 Q;  2KJX A;  1OXS C;  2B2V A;  4ZKC B;  1WTW A;  2CQA A;  5CMD A;  5I6W A;  5DLQ E;  2PQA A;  4BBS G;  1L0X B;  3KOJ A;  4R4O A;  5HGT A;  1Y1V G;  4KD3 A;  3GTG H;  5ISR A;  3ZJY C;  3H15 A;  2KEC A;  1RJT A;  4RHS A;  1RTN A;  3PO2 B;  4A3M H;  3PMF A;  3FVQ A;  3KLS X;  3V96 A;  1STE A;  3GTO H;  3ER0 A;  1CI3 M;  1YJW A;  2MQH A;  2XRQ D;  2NTS A;  1Y69 U;  1FNW A;  4HJ7 A;  1YHA A;  1D5M C;  2XVS A;  3EJI A;  3IL8 A;  3VR4 A;  1NJI C;  2HHH L;  1HA5 A;  4LF9 Q;  2F0I A;  1SYF A;  2NVY B;  1HNZ Q;  3QWN A;  5A35 A;  2J4X A;  3PIO A;  3I70 A;  1VQG A;  4FF1 A;  1RTO A;  2AQ3 B;  2JSO A;  1U4R A;  1H9S B;  3OW7 A;  2XGT A;  4G4K A;  1ZKO A;  2B2T C;  5I9O A;  4PV1 C;  2CHB D;  2AUK A;  4RAU C;  5DM7 3;  4B3M L;  1CFM A;  1IKL A;  1AE2 A;  1QNU A;  3QG1 A;  1J6Q A;  1TWG B;  5ELC A;  2WB1 E;  4A3B H;  3J80 c;  5GAD C;  2VB2 X;  1GHJ A;  2UUC L;  1NAP A;  1QJO A;  1IW7 C;  1HPC A;  3QR8 A;  4OL7 A;  2YTX A;  4E6I A;  3GV6 A;  1VQL A;  1X65 A;  5JJL A;  4CDD C;  1XTD A;  3HOY G;  4LUO A;  4FXD A;  3U4V A;  4WRD A;  5FJ8 G;  1ZXT A;  1FNV A;  1IL2 A;  4YCV A;  4C56 C;  4ZCK A;  1PZI D;  2M2L A;  2KA7 A;  2HCC A;  2GVB A;  2LSS A;  2NB0 A;  2HHH Q;  4HID A;  1F2Y A;  1EEF D;  1BUV T;  2F52 A;  3T1Y L;  4BA1 I;  2D5D A;  3CHB D;  1LT4 D;  4DAP A;  3I56 A;  4GNX C;  3RUZ A;  3MHB A;  3DMU A;  1B3A A;  3KF6 B;  3AQQ A;  1FNU A;  1I50 H;  3GTM B;  4DFA A;  3ERO A;  3A5Z B;  1SLJ A;  5IYD G;  2R3Z A;  3CCJ A;  2OTJ A;  1BXT A;  4BY7 B;  2XNA C;  4A3F G;  3M3Y B;  1LTI D;  1VCI A;  1WJJ A;  3NEL A;  4P74 A;  4KJN A;  2UXC L;  2KED A;  3BJU A;  4JOI A;  2SDF A;  4B3T Q;  2VZA A;  1OO9 B;  3J81 L;  4MIU A;  2XIW A;  3AU7 A;  3UDX A;  1HNX Q;  1D1I A;  4GN4 B;  1TXY A;  2JA6 H;  2V4D A;  1EY6 A;  1BKB A;  4C3I B;  1XMO Q;  4G57 A;  3RLF A;  4JI0 L;  1O7Z A;  1D6E C;  3Q23 A;  3H0G H;  3QOL A;  2DGY A;  3F2D A;  1N33 L;  1U4L A;  3DWP A;  1EFW A;  5A2Q L;  4L5R C;  2ES2 A;  1H9K A;  2L11 A;  2EYO A;  3FPU B;  4IAL A;  1EYG A;  1LTT D;  3GTJ B;  3J7A 5;  1O7Y A;  2PYK A;  3DM3 A;  2JA8 B;  2MGS A;  4RMF A;  1C48 A;  3DEO A;  4DV0 Q;  5M3M H;  3JAM E;  2E2H H;  1ASZ A;  5GAE C;  3VYR A;  4F88 A;  3BZD B;  3ITP A;  1JC7 A;  3A7L A;  1BOS A;  4ULL A;  4A3D H;  4N8X 1;  1V1P B;  4CDC C;  3SHL A;  2RCF A;  4A3K G;  3FKI G;  1G91 A;  3I8Z A;  3EBE A;  4BXX G;  3L3O C;  1B53 A;  2DY8 A;  3X3M A;  1EIH A;  2ZXP A;  1ASY A;  4JI5 L;  2X6G A;  1BBX C;  3A5U A;  1W6K A;  1ESR A;  4XT3 B;  2ICI A;  2NZH A;  4N8F A;  4JI4 L;  5FO7 B;  4A76 A;  5E7N A;  2K5H A;  1A3V A;  3JAM c;  4JI0 Q;  1EY7 A;  2DNC A;  1FR3 A;  1Q8K A;  5M3F H;  2HD3 A;  1QZG A;  2QF7 A;  4FP5 D;  3RR5 A;  2BA0 A;  3HOW B;  1PYW D;  3A8I E;  2PMZ B;  1KLU D;  2NVX B;  1N32 L;  5JVH 3;  3I4N G;  1GHK A;  1BNZ A;  2LKV A;  1ENF A;  1VS0 A;  3S17 H;  2KHS A;  2PI2 A;  4DAV A;  2AHO B;  1ICF B;  2GN5 A;  3CCS A;  3I4L A;  5C4X G;  1FJG L;  4UDU C;  3HOV G;  1JOQ A;  4BBR G;  4IUU A;  3SXH A;  3KJP A;  3GTG B;  1CKM A;  4ME3 A;  2PQA B;  1LT5 D;  2E8G A;  5CV5 A;  5J39 A;  1D7Q A;  4OON A;  1OXU A;  3TBI B;  2K03 A;  5KNB A;  4CKB A;  1ENC A;  3GTO B;  3GO5 A;  2F0Q A;  3HOX H;  2VXW A;  2CW0 D;  4FO2 A;  4ZUJ A;  3H09 A;  5ELB A;  2JA5 G;  1YNX A;  5IWA Q;  2LXJ A;  1V43 A;  1U4P A;  1PLF A;  3G6E A;  3ICE A;  3OTO Q;  2I46 A;  3BVM A;  4JI7 L;  3Q6S A;  2AKW B;  2CFM A;  3ND8 A;  1TWC H;  2A6H D;  1B7Y B;  2NZO A;  1SYG A;  4P71 A;  4EX5 A;  2EYF A;  1S5D D;  4IPG A;  1SN8 A;  4IQZ A;  1VQ4 A;  4R8N A;  3K59 A;  1V1Q A;  5I2Y A;  1VF7 A;  3NBI A;  1LUZ A;  2KOL A;  2WV6 D;  4IN3 A;  1UAP A;  3M4O H;  2J0T D;  2CH4 W;  3L0O A;  2B3G A;  4HIM A;  2KBN A;  3HKZ E;  3Q8D A;  3TME A;  4A3B B;  1PRT F;  4M8A A;  1YVC A;  4LFC L;  2CW0 C;  5KIX A;  5BN4 A;  4WOR A;  4M1U B;  3I4M G;  1KDA A;  1Q46 A;  5IP7 G;  3OHX C;  1JJG A;  5IT9 L;  4XYQ A;  5KRU A;  1RD9 D;  1MHW C;  2Y0S G;  3BZC A;  3D8G A;  3OWF A;  1IYJ B;  5ELN A;  2XWB B;  3ULL A;  1I4H A;  1EZ8 A;  3TZD A;  5BR8 L;  2VUM H;  1IBM Q;  1H9M A;  3NTI A;  5H1S E;  3R93 A;  1E2W A;  4APV A;  1STG A;  1PVO A;  2B8F A;  4LW1 A;  4DV1 L;  2E76 C;  4POG A;  4K2K A;  5EPJ A;  1I50 B;  1IL8 A;  3K7A H;  4A3J H;  1BBU A;  1DZ1 A;  5LHY 1;  1AN8 A;  1Z9F A;  3M4Q A;  3SK6 A;  3ERS X;  1AP0 A;  1A2T A;  3MWY W;  4O1N A;  1I6V C;  3N52 A;  4JBM A;  2R61 A;  2TSS A;  3PGZ A;  2FJ2 A;  4F7X A;  2JA7 B;  1UEA B;  1DD2 A;  4KKT A;  3A56 A;  1T5E A;  5IY0 A;  4CDF C;  2JXM B;  5E4W C;  3H0G B;  1C0A A;  3PUV A;  1O7I A;  2NTT A;  1VF5 C;  1MSG A;  3D31 A;  3T4A C;  2WB1 G;  3M4P A;  4QJF A;  3S15 H;  1B9N A;  4JI8 Q;  4QB4 A;  1I4R A;  4RGM A;  4ZYS A;  1KAB A;  4CGY B;  3KF8 A;  2F0L A;  2N8N A;  3DEP A;  2F0K A;  2F4I A;  5M3M B;  2E2H B;  2ZTE A;  1QWY A;  4DV1 Q;  2KEE A;  4A3D B;  4DXF A;  2VY3 A;  5C3E H;  1UWV A;  4QUC A;  2B2V C;  5EKK A;  3W3A A;  5FK9 C;  1VQK A;  2KHJ A;  3HS0 C;  3IKJ A;  4XQQ A;  2A68 D;  2OQK A;  4Y7N H;  2ASB A;  1PDQ A;  3I55 A;  2PQE A;  3EFX D;  3SDZ A;  3MEH A;  2MP1 A;  1RIP A;  5C4Z A;  3CKI B;  1D2B A;  1E2V A;  1S5C D;  1CUK A;  4JI1 L;  4A3G H;  2OXP A;  1B70 B;  5CGK A;  2NBF A;  3QOJ A;  4LUV A;  5G3L F;  4IUR A;  5M3F B;  1WTP A;  3GQB A;  4L5T A;  4KY6 A;  3HOY H;  1H9R A;  2YYZ A;  4LF6 L;  2K01 A;  4BY1 H;  2AMC B;  1JR0 D;  1QNK A;  3NP8 A;  5FJ8 H;  5C4J H;  1HNW Q;  1S5F D;  2K5N A;  4LK1 C;  3E5S A;  1A0I A;  2F3I A;  2V1C C;  1S72 A;  4FF2 A;  1YZ6 A;  2FFK B;  1JE4 A;  2R7D A;  4YY3 L;  1KDC A;  4DK3 C;  4JVZ A;  1RHP A;  1CT1 D;  4KHP Q;  2KUM A;  5TSS A;  4IZ8 A;  3S17 B;  1Q3L A;  1SJH D;  4P72 A;  1G51 A;  1DON A;  4WJ3 M;  1AH9 A;  2L0C A;  1WOC A;  4GLX A;  1I4G A;  4ALP A;  1II3 A;  5DAU A;  2C9O A;  4LAA A;  1DYQ A;  1SYB A;  4DR1 Q;  4A93 G;  3R2T A;  4LFB Q;  1CTM A;  4Q5V A;  5KYI A;  2K4K A;  3JAM i;  1JWU D;  2Z6K A;  1YIT A;  5J3B A;  1YI2 A;  1EYC A;  4TVA B;  2F0D A;  4HJ9 A;  1E2Z A;  2CCZ A;  2RBM A;  3G4S A;  4XQN A;  2E2J H;  4DR4 Q;  2IW3 A;  1PZJ D;  4A3E H;  1JWM D;  2YV5 A;  2PW7 A;  1E22 A;  3TN2 A;  3L9A X;  3VA5 A;  1A6X A;  1B8A A;  4OWT B;  1DJR D;  4UP7 A;  2X6L A;  1LTA D;  5D65 A;  2PMZ E;  3RZD H;  3NQI A;  1VQP A;  1XMQ L;  1VQJ A;  3D3R A;  1Q12 A;  2F0M A;  5GRO A;  3GP7 A;  4YHH L;  1TWC B;  3I90 A;  2ATW A;  4YWL A;  1JJC B;  4HSP A;  3NBH B;  1CQF A;  4GNX B;  1KXL A;  3CCL A;  3VYS A;  3CMA A;  1WTV A;  5JJK A;  3VR5 A;  1XPO A;  4B3S Q;  3QIA A;  3EQL C;  1HCZ A;  3CXC A;  2WAQ E;  3M4O B;  4JBJ A;  2BDO A;  4N9P A;  1F9P A;  3I73 A;  2A5H A;  4XYO A;  1I94 Q;  4A3K H;  3S2D H;  2K1B A;  2N49 A;  3CCE A;  5COR A;  4ZQ3 A;  1SNP A;  4JI3 L;  4BXX H;  1PH9 A;  4JOI C;  2EY1 A;  2K6A A;  5ELF A;  3KUP A;  1HHV A;  4LWC A;  4BA2 I;  4OX9 Q;  3TP5 A;  3HOU G;  3I7F A;  5D3D A;  5FKA C;  3UI2 A;  2H5X A;  4QIW B;  1SE2 A;  1EQT A;  2L1B A;  1KDB A;  4TQU S;  1BO0 A;  1FGU A;  1HTP A;  1EU4 A;  1FL0 A;  3UDG A;  3BVG A;  2VUM B;  1LT6 D;  3CC2 A;  1SAP A;  1MKH A;  2PW5 A;  4F87 A;  3MVV A;  1XMQ Q;  5C44 G;  1TS4 A;  1OXX K;  1VMC A;  3S1Q B;  3TS2 A;  1HJP A;  5G3L D;  4O42 A;  5FLX L;  5ELD A;  2LXK A;  3MA2 B;  3S9W A;  2B63 H;  2MNA A;  2B2U C;  4A3J B;  4IFD G;  4U67 3;  1CKN A;  1PTO H;  4XIG S;  3K57 A;  1KC8 C;  4WFN 3;  5C4X H;  1NR4 A;  1Y8N B;  2BOS A;  3LX0 A;  4X3K A;  2K28 A;  4OEL B;  4EVO A;  4LF4 Q;  2RDG A;  2F4V L;  4IFD I;  2WFW A;  4LF8 Q;  1ESF A;  4J8Q A;  3HKZ B;  4DV3 Q;  4LF7 Q;  2TMP A;  4QCL A;  5IGD A;  3F1Z A;  1WYD A;  3HKS A;  1QG7 A;  4QL5 A;  4JI3 Q;  2IPK D;  1XJV A;  3W5O A;  2Z0S A;  2FXQ A;  5C6A A;  1LTG D;  1IBL L;  3KK7 A;  1VQA A;  2YU9 H;  1IW7 D;  1Q1E A;  1EY0 A;  1SE8 A;  1HUN A;  3CP0 A;  3BS1 A;  3PO2 G;  4JI6 L;  2ZXR A;  3TZU A;  3S15 B;  5CV6 A;  4C3H H;  1I4Q A;  3J80 E;  1G6P A;  1MSH A;  1SE3 A;  2F0V A;  1MIU A;  5HY6 A;  4OWX B;  1TS3 A;  2UXB Q;  1CA6 A;  2G9H D;  2M00 A;  2C35 B;  3RNU A;  4GKJ Q;  1PFS A;  2HIV A;  4RA8 A;  4KMU C;  4DR5 Q;  3U4Z A;  2QGQ A;  5EPL A;  1QVF A;  5JEA G;  5C3E B;  4HTH A;  4DV2 L;  5ELE A;  4OIK A;  4CKC A;  1HQM C;  5KYL A;  3S1R H;  5M5W H;  5E3F A;  1TS2 A;  1C7Y A;  2F4V Q;  3NHH A;  4Y7N B;  2PPB C;  1JT8 A;  3KLW A;  2LMC B;  3LNN A;  1VQD A;  2E5L L;  4HIK A;  3HZX A;  4A3L H;  4B9X A;  3DHQ A;  3I4M H;  4A3G B;  2Z6B A;  4F8M A;  3OMG A;  1V1O A;  2JK8 A;  3HOY B;  4IJH A;  1PH8 A;  2A69 C;  4O2D A;  4BY1 B;  4DAM A;  2DUD A;  3H3V C;  5C4J B;  3CCU A;  4YCW A;  3VYT A;  3TSS A;  4B08 A;  2NYZ D;  4JI6 Q;  4NB3 A;  2R92 G;  1BBW A;  4KI0 A;  2WP8 J;  1CZW A;  3VR6 A;  2KCM A;  3DWQ A;  1XPR A;  4CDE C;  3L2P A;  5IYC G;  5CR3 A;  4X64 L;  2ENB A;  3TDQ A;  1SMY D;  4MNO A;  4X6A H;  4IUP A;  4A3I H;  1XWE A;  5I2X A;  1G2S A;  1V9P A;  4HIO A;  4YCU A;  2RDF A;  4JCV E;  2QDL A;  3A55 A;  1EL0 A;  2ZJP A;  1F2M A;  1DCZ A;  3M4Y A;  5FOB B;  4HAE A;  4HJA A;  4CHT B;  2F0W A;  2MJ8 A;  3FHW A;  5AJ3 L;  4B3M Q;  1YEZ A;  2B39 A;  2JA7 H;  4JBW A;  1MJE A;  5C0X H;  2UUC Q;  4BY7 G;  2E2J B;  2ZM6 L;  2E5L Q;  4GN3 B;  4A3E B;  4QF4 A;  3UDF A;  4IUT A;  3RLO A;  1SR3 A;  1MI2 A;  1A3U A;  3SR1 A;  5K36 G;  1EIF A;  5CV7 A;  3DWA A;  2HDM A;  3RZD B;  2F0T A;  3JC6 6;  5EJW A;  3B6Y A;  2K04 A;  1TWH H;  4NMZ A;  4IOA A;  2VNU D;  3L7Z C;  1SMY C;  2CQO A;  4C3I G;  2KCT A;  1VQO A;  1E24 A;  1JOK A;  1YNJ C;  4DNR B;  4IUV A;  1UUP A;  2RHS B;  2HIX A;  1PH3 A;  2ZJR A;  2RDH A;  2G9D A;  3HOZ G;  3T1Y Q;  4PZ7 A;  2VQF L;  1S3O A;  2GA4 B;  4ODG A;  1LTB D;  1QUQ B;  2DN8 A;  3BVZ A;  4R1J A;  4X64 Q;  4H7B A;  3OIP A;  2RSO A;  4C2M H;  4XXE A;  3D6W A;  3AMU A;  1E3P A;  3Q0A A;  2PI2 E;  1TU2 B;  1GKH A;  4K8J A;  4XDX A;  5JPN C;  1M90 C;  1PMR A;  3F2U A;  2JA8 G;  3A0J A;  1VQB A;  4DF7 A;  1CM9 A;  1I4X A;  2OT2 A;  3ERQ A;  4A3K B;  3S2D B;  3FKI B;  1A3T A;  2UXC Q;  1F9Q A;  4S3S A;  1XTC D;  2H1E A;  4HJ8 A;  2EIF A;  3S1N B;  3C46 A;  1BQQ T;  2BCO A;  3VR2 A;  1SBB B;  3S16 H;  5M5X H;  4JI2 L;  2IT1 A;  2VW9 A;  5CV8 A;  4JW0 A;  1WCM H;  4X65 L;  1Y1W H;  1N33 Q;  1TT2 A;  1Q7Y C;  4C3J G;  1RCV D;  1GUN A;  1MBY A;  4DR3 L;  2RCN A;  4GZY C;  4L8J A;  5AFW A;  5EBD A;  3ZYY X;  1PH7 A;  2BH8 A;  2FIN B;  4H13 C;  4NXM L;  1ML0 D;  1V8Q A;  1JOR A;  4R4T A;  1TS5 A;  2F3W A;  1FVI A;  3MXG A;  2C5C A;  3AB9 A;  1CKO A;  1A2U A;  2BE5 C;  3HOW G;  4OO1 H;  2VQF Q;  1BR9 A;  2B63 B;  3JAM L;  2Q2T A;  1VQ8 A;  4JV5 L;  3MZ5 A;  4Y52 H;  1PTO B;  5GAH C;  4UY8 C;  4A3C H;  4JPB W;  4DV4 L;  4LF5 L;  5C4X B;  4I65 A;  2WAQ B;  1VDZ A;  4AYB E;  4K6L A;  3AFP A;  1I5F A;  4FDB A;  4BBR B;  1CKN B;  3K80 C;  1O78 A;  1GVP A;  3IFT A;  1JE5 A;  2B2T A;  1GJX A;  3M85 A;  4JI5 Q;  2JA9 A;  2R7Z H;  1KAA A;  1X3P A;  4XQJ A;  1KD1 C;  2KVM A;  4KHZ A;  2EXZ A;  1JB3 A;  2WIN B;  3HP3 A;  4JI4 Q;  4QIW E;  2HUG A;  2YU9 B;  2YTY A;  1SFO H;  4GOP A;  3D4R A;  4KKU A;  1B50 A;  2A1A A;  3F2B A;  3PO3 H;  2R6G A;  3I4O A;  4A3M G;  3K5L A;  4C3H B;  3NUC A;  4YIJ A;  5EPK A;  4IUN A;  3H3V H;  4DR3 Q;  2EJG C;  3URY A;  2Q2I A;  2L9H A;  1N32 Q;  2NN6 H;  1EWH A;  1HFG A;  3E0E A;  3NWS A;  4MN3 A;  3CC4 A;  2RHQ B;  5FLM G;  1M1K C;  2K5V A;  5C0X J;  4NXM Q;  4TRD A;  2RF4 A;  1NTG A;  2L15 A;  3RLN A;  4PMW A;  1SNO A;  1J9O A;  4DR6 L;  1IKM A;  1EZ6 A;  3HG9 A;  2EYH A;  1KAW A;  2PZW A;  4OHJ A;  1FJG Q;  1XPU A;  2ZTD A;  2UU9 L;  5IYB H;  2R93 H;  1GOZ A;  3PCO B;  5COY A;  3S1R B;  5M5W B;  4ZLT F;  5JAV A;  3Q22 A;  1B2T A;  2CH4 A;  5IT9 c;  2Z6K C;  3KYH C;  1CA5 A;  4JG2 A;  5KNC A;  4DAY A;  3PF4 A;  3I4M B;  4RH6 A;  4KN4 C;  2IJ0 A;  3P20 A;  1N34 L;  4LNQ A;  2JE6 I;  4A3B G;  3BDO A;  2B2W A;  3KDF A;  3NEM A;  2MFI A;  5CYU A;  1IYV A;  4KK7 A;  1W6J A;  4HN7 A;  1X6O A;  1HQR D;  3H6M A;  5NUC A;  1F77 A;  3PF5 A;  2NVQ H;  3S1Q H;  4DV5 L;  1G8Z D;  1ZYR C;  4RHR A;  4JI7 Q;  3K6O A;  5C44 H;  4DR2 L;  4A3I B;  1TWF H;  4EQO A;  5IP9 H;  3CCM A;  3J80 i;  1A63 A;  1QVG A;  3U9O A;  1C4Q A;  4DR6 Q;  5DM6 3;  4EQP A;  1PH1 A;  4GKK L;  4X62 L;  2F0H A;  4G7O C;  4LFA L;  4IPH A;  4BBS H;  1I3Q H;  1UEB A;  3CPF A;  3AYH B;  1Y1V H;  2OEO A;  3QJY A;  4X3U A;  2I07 B;  1CZG A;  4J1M A;  2O5J C;  4LFC Q;  2UXD L;  2K5W A;  2RA4 A;  4ZRZ A;  1HUM A;  3J81 j;  4B3R L;  3CCQ A;  3AFQ A;  5IE8 A;  1XX8 A;  1HXY D;  3A7A B;  1N34 Q;  5CBA E;  2JA6 G;  1DOL A;  1NR2 A;  1TWH B;  1OXT A;  3EN2 A;  4J6H A;  5T1I A;  2K05 A;  1XNR L;  5BR8 Q;  4HR7 B;  2D0P A;  3H0G G;  3PIP 3;  1EIG A;  3I72 A;  1QB5 D;  3EA6 A;  5C3X A;  1TY2 A;  3OYY A;  1EFI D;  4OXP A;  1RL2 A;  3T1H L;  1K0R A;  4NP5 A;  2NUC A;  1IYU A;  1K8G A;  1PTO C;  4C2M B;  2IX3 A;  1WTR A;  4DR2 Q;  1DM0 B;  1NY4 A;  4DUY L;  2K50 A;  2K52 A;  3A74 A;  3T13 A;  1H9S A;  4UHV A;  1YJ9 A;  5M3M G;  2E75 C;  2UUA L;  1H95 A;  5DNF A;  1LAB A;  2EJM A;  3SVM A;  4KV6 A;  2K32 A;  4GLA C;  2NVT B;  3S16 B;  2UXD Q;  1JJ2 A;  3MXP A;  4QY7 A;  3R2I A;  5M5X B;  4QUF A;  1UE6 A;  1STA A;  3CCR A;  3G48 A;  1VQN A;  4LUZ A;  1CK1 A;  1WCM B;  2QDB A;  4EGV A;  1Y1W B;  1F2L A;  1B9M A;  1KRS A;  3J7A F;  1F2Z A;  4DK1 A;  1QE6 A;  2IHE A;  4DPG A;  2SEB D;  1XNR Q;  2EY2 A;  5D14 A;  2IX1 A;  5EKL A;  5IGB A;  1WTX A;  1UE5 A;  1G6Z A;  4V19 0;  3T1H Q;  1S4Z A;  2ID0 A;  3CW2 C;  2J7Z A;  1RKN A;  4HED A;  4HMJ A;  3SE0 A;  2Q8I B;  1ROD A;  1D1K A;  1T9H A;  1X55 A;  4X66 L;  5IYD H;  3KF6 A;  3V2T A;  2EDG A;  3KLS A;  5EBC A;  4L5S A;  4A3F H;  1ZEQ X;  1STH A;  2AUJ D;  3VDY A;  4DUZ L;  1NMG A;  2UUA Q;  4L6T B;  2R7Z B;  3BDL A;  1WD0 A;  4WJ4 A;  1EYD A;  2N78 A;  3CC7 A;  1VQM A;  5IGC A;  4ILW A;  4AQY L;  4JI1 Q;  1SFO B;  3M9B A;  2OF1 A;  1AFP A;  1PFB A;  2EY5 A;  3P75 A;  3PO3 B;  2QA4 A;  4IFD J;  1EWC A;  4RGT A;  4LF6 Q;  1VMP A;  4PG3 A;  3Q24 A;  1SDF A;  3PIP A;  2EE1 A;  3G6J B;  4GOP B;  3HOX G;  2EY6 A;  5CV4 A;  4YY3 Q;  1CSQ A;  1X3G A;  3A8K E;  4DK6 C;  1VQF A;  4ID6 A;  2JYO A;  3UDI A;  2O5I C;  1HR0 L;  1HR0 W;  1KRT A;  5EAY A;  3HOZ H;  3CRK C;  4JYA L;  1SSO A;  1KNE A;  3R3O A;  1R4Q B;  3LWU A;  2F0O A;  1PZK D;  3E0J A;  1JCK B;  2UUB L;  1XNQ L;  2A19 A;  1K3R A;  5HGQ A;  1K0S A;  3CQZ H;  3E9I A;  1FD7 D;  4AYB B;  1O80 A;  2IHF A;  4K6D A;  2R93 B;  4X66 Q;  1JMC A;  3PIO 3;  3DUZ A;  4OGQ C;  3FKI H;  5I9P A;  1EOT A;  1V1P A;  3FEW X;  4UP9 A;  1CSP A;  5I6Y A;  2KEN A;  3NWT A;  4DV6 L;  2F0N A;  3S1N H;  2JEB I;  1W2B A;  1Q1B A;  1XYI A;  3S24 A;  2A6E D;  2QEX A;  1WTQ A;  2HCI A;  4HCS A;  1UE1 A;  4GS3 A;  2PNR C;  2E2I H;  1K8O A;  1NSN S;  1SNC A;  3OOC A;  1X9N A;  1STB A;  2K14 A;  1PFM A;  2I0Q A;  4K2L A;  4MZ9 A;  5FO8 B;  2RKS A;  1HTL D;  1U0L A;  3SK4 A;  3PSI A;  5FLX c;  2NVQ B;  2QEJ C;  3I4N H;  1NBW A;  3T53 B;  4FF4 A;  4YHH Q;  5C44 B;  3CPW A;  2E74 C;  3RZO H;  1TWF B;  1J8I A;  1I6H H;  2ALY B;  3C1F A;  3E3X A;  4NXN L;  4LMQ D;  2VL6 A;  5KGU A;  5J1Z A;  3D6C A;  4LF9 L;  1F9S A;  2CKZ B;  3MXU A;  1XNQ Q;  4BBS B;  3HOV H;  1I3Q B;  2A6E C;  4KN7 C;  4PZ6 A;  4BBR H;  3GD7 A;  1GUT A;  3M7N A;  1Y1V B;  4NPS A;  4WJW A;  4A3J G;  1LV9 A;  2D2C C;  1CHQ D;  5LL6 X;  3T56 B;  3IFD A;  1HZC A;  1BCP F;  1K28 A;  3TP7 A;  3NQT A;  1AEX A;  4CKE A;  1HRJ A;  1GUS A;  4RWS C;  3HKZ G;  3I3C A;  2XN9 C;  2Y0S E;  2XTI A;  3C3L A;  2WAC A;  4MHE A;  4RG1 A;  4K14 A;  1E1T A;  1BCP B;  3K8A A;  1CHP D;  4N9T A;  1G2T A;  5L37 A;  3VA7 A;  2JA5 H;  3D4D A;  4DGZ A;  1VQC A;  1L0Y B;  3TEH B;  3M7G A;  2LFN A;  4IUQ A;  2A69 D;  3HGB A;  3I91 A;  2CWA A;  3K7U C;  2LS0 1;  1EQV A;  3MXN A;  4KHV A;  1EIY B;  5FLM H;  2IY5 B;  1GUO A;  3KF8 B;  3NTK A;  4IPD A;  1TY0 A;  3D0F A;  1SXT A;  4NXN Q;  2D0O A;  5F2D A;  4NDX A;  1K8M A;  1VQ6 A;  2RVL A;  3G71 A;  1GXD C;  2E2D C;  3FRP B;  1WI5 A;  2MO1 A;  3SK8 A;  3V05 A;  1PFN A;  3RN2 A;  1A8V A;  2XRS D;  1GUW A;  4U68 A;  1KQS A;  4C1N K;  4PZ8 A;  3W2D A;  4Z9C B;  5HUR A;  2F0F A;  5C3E G;  1WTO A;  1SEB D;  1VQH A;  5IP7 H;  5BN5 A;  3MEF A;  4PMB A;  4BWG B;  2OTL A;  4B3T L;  4MTK A;  4HSV A;  3GTP H;  1IBL Q;  4ZUI A;  1LTL A;  1C9O A;  4H02 A;  4ZKB B;  3J81 E;  3U58 A;  1OXV A;  3E6Z X;  1HNX L;  4H0L C;  4J15 A;  4GOP C;  3UE1 A;  2B2Y A;  2Z8L A;  3KBX A;  1XMO L;  4R4C A;  1KL9 A;  1R4P B;  4K5X A;  3J80 L;  4A3G G;  4FYD A;  3T51 B;  4XTC S;  1EEI D;  2R92 B;  3NK9 A;  2R7F A;  5CV9 A;  1HZA A;  3PUY A;  4JBK A;  1T5X D;  3CME A;  1LLR D;  1X3F A;  4BY1 G;  3NE5 B;  2WKD A;  1Y14 B;  2WKC A;  3TP6 A;  5A2Q E;  1EQQ A;  1YNJ D;  4P73 A;  4IO9 A;  3TP8 A;  4AH6 A;  2I5H A;  1X54 A;  1HH2 P;  3HRZ C;  3TRZ A;  3J81 c;  4UP8 A;  1L1O A;  2L55 A;  2MUY A;  2PNH A;  3C2P A;  4DV2 Q;  4A3F B;  4DV0 L;  3PUW A;  4K5V A;  1IBK L;  2JN4 A;  1JWS D;  1ONL A;  2EPB A;  2EJF C;  1SRO A;  3ONA B;  3GDE A;  4OIJ A;  4DR7 L;  5JJI A;  3NXW A;  2A8V A;  3J7Y W;  1C8C A;  3A8J E;  2K7V A;  3W1G A;  1OTC A;  3K0X A;  1XXG A;  1KIX A;  1QVC A;  3CU7 A;  2L4N A;  3TQY A;  3S14 H;  3GTL H;  5C3W A;  2A73 B;  3RMH A;  1MGS A;  2EYM A;  3A54 A;  2ZT9 C;  1SRU A;  2K33 A;  4A3E G;  2B2W C;  4RCO A;  1BCP D;  5CBE E;  3ULJ A;  1JOO A;  2I5L X;  1PA6 A;  1M8A A;  4R4Q A;  3H91 A;  3HOZ B;  1IXR A;  2DJG C;  2LY7 A;  2D62 A;  4O0A A;  2HDL A;  2MO0 A; 
#chains in the Genus database with same CATH homology
 2Q2H A;  2VNU D;  4YWM A;  1VQ7 A;  3BZK A;  3K81 C;  4P72 A;  1N34 L;  1G51 A;  4LNQ A;  4WJ3 M;  1K83 H;  1AH9 A;  4A3M H;  2JE6 I;  1W3S A;  4OWW B;  1WOC A;  4A3B G;  4GLX A;  4ALP A;  4A75 A;  3KDF A;  1EWI A;  4IJL A;  3ER0 A;  3NEM A;  3GTO H;  2MFI A;  5AJ3 Q;  4DR1 Q;  2MQH A;  1YJW A;  1IBK Q;  4LFB Q;  4A93 G;  2BH2 A;  1X6O A;  1D8L A;  1HZB A;  2K4K A;  1YHA A;  1YHB A;  3U50 C;  3JAM i;  4HJ7 A;  3PF5 A;  2NVT H;  1NJI C;  2Z6K A;  2NVQ H;  1LYL A;  1YIT A;  1VQ5 A;  3IRB A;  5J3B A;  4DV5 L;  1YI2 A;  2HHH L;  4JI7 Q;  2ZM6 Q;  1YJN A;  3S1Q H;  4TVA B;  4DR7 Q;  5C44 H;  4DR2 L;  4LF9 Q;  4HJ9 A;  1TWF H;  1HNZ Q;  2CCZ A;  5IP9 H;  3G4S A;  3CCM A;  3PIO A;  5GQO A;  3J80 i;  2E2J H;  4DR4 Q;  1QVG A;  1VQG A;  1A63 A;  4A3E H;  2YV5 A;  4DR6 Q;  1E22 A;  1PH1 A;  4GKK L;  3CF5 A;  1B8A A;  4X62 L;  2ZTC A;  2XGT A;  3S2H H;  4LFA L;  4OWT B;  4IPH A;  2JJQ A;  4UP7 A;  4BBS H;  3SGI A;  1I3Q H;  1GM5 A;  1UEB A;  2PMZ E;  3RZD H;  3CPF A;  3FP9 A;  3AYH B;  1K73 C;  1VQP A;  1Y1V H;  1XMQ L;  3W1B A;  1VQJ A;  1Q12 A;  4B3M L;  4LFC Q;  2UXD L;  1AE2 A;  5GRO A;  1J6Q A;  4YHH L;  5IWA L;  3J81 j;  2ATW A;  2WB1 E;  4A3B H;  4B3R L;  3CCQ A;  3AFQ A;  4YWL A;  5GAD C;  3J80 c;  2VQE Q;  3OTO L;  1JJC B;  5IE8 A;  2UUC L;  3NBH B;  4GNX B;  2YTX A;  1KXL A;  3BU2 A;  3CCL A;  3CMA A;  1N34 Q;  1PH4 A;  1VQL A;  5JJK A;  1X65 A;  1QZH A;  4A93 H;  1XPO A;  4B3S Q;  2JA6 G;  5JJL A;  2B63 G;  1XTD A;  1OXT A;  3EN2 A;  3HOY G;  4LUO A;  3CXC A;  2WAQ E;  1PH2 A;  1XNR L;  4JBJ A;  3U4V A;  5BR8 Q;  5FJ8 G;  3KJO A;  2D0P A;  3H0G G;  3CD6 A;  1IL2 A;  4YCV A;  1I94 Q;  2WAQ G;  3OYY A;  4OXP A;  4A3K H;  3S2D H;  2N49 A;  1RL2 A;  3CCE A;  3T1H L;  1E7Z A;  2GVB A;  2HQL A;  2YTV A;  2LSS A;  1K0R A;  2OCE A;  4JI3 L;  4HID A;  1PH9 A;  2HHH Q;  4BXX H;  4JOI C;  1K8G A;  4JI2 Q;  1WFQ A;  2F52 A;  3PV0 A;  3T1Y L;  4DR2 Q;  1YIJ A;  4LWC A;  4BA2 I;  4BA1 I;  1NY4 A;  4OX9 Q;  3HOU G;  3I7F A;  3GTK H;  4DUY L;  4X65 Q;  2H5X A;  1R9T H;  2K50 A;  3I56 A;  4GNX C;  2AWO A;  2K52 A;  3A74 A;  3KF6 B;  3AQQ A;  1YJ9 A;  1I50 H;  2JQO A;  4TQU S;  5M3M G;  3A5Z B;  1FGU A;  1SLJ A;  5IYD G;  3CCJ A;  1FL0 A;  3UDG A;  2OTJ A;  2UUA L;  1H95 A;  3CC2 A;  4YWK A;  1MKH A;  4A3F G;  1VCI A;  1WJJ A;  3NEL A;  4GLA C;  4P74 A;  1PYS B;  1E1O A;  5C44 G;  1XMQ Q;  3BJU A;  1OXX K;  4JOI A;  4B3T Q;  4JV5 Q;  2UXC L;  2VZA A;  2UXD Q;  1JJ2 A;  3TS2 A;  1IBM L;  1HJP A;  4QY7 A;  1UE6 A;  3MXN B;  3CCR A;  3UDX A;  3G48 A;  1VQN A;  1HNX Q;  2JA6 H;  1TXY A;  2LXK A;  4GN4 B;  4LUZ A;  2MNA A;  4DV4 Q;  4GNX A;  4LF5 Q;  2B63 H;  1BKB A;  4IFD G;  1XMO Q;  3GTQ H;  3RLF A;  1CKN A;  5LMU L;  4JI0 L;  1TWA H;  1KRS A;  4XIG S;  1KC8 C;  3H0G H;  5C4X H;  4HJ5 A;  2DGY A;  3F2D A;  2IHE A;  1N33 L;  4DPG A;  1N9W A;  1XNR Q;  1EFW A;  1PH6 A;  4LF4 Q;  4L5R C;  3J7Z C;  2ES2 A;  2F4V L;  4IFD I;  2WFW A;  2IX1 A;  3DLL A;  4LF8 Q;  4DV3 Q;  4LF7 Q;  1UE5 A;  3F1Z A;  2ASB A;  4P75 A;  4A4I A;  2B29 A;  3HOU H;  3AEV A;  1WYD A;  1YBY A;  3T1H Q;  1EYG A;  2ID0 A;  3CW2 C;  3HKS A;  4QL5 A;  4JI3 Q;  3J7A 5;  1XJV A;  3DM3 A;  3W5O A;  2Z0S A;  1IZ6 A;  4RMF A;  2FXQ A;  1T9H A;  4DV0 Q;  5M3M H;  1X55 A;  1IBL L;  4A3L G;  2E2H H;  4X66 L;  1ASZ A;  5IYD H;  1VQA A;  2YU9 H;  1N8R C;  3KF6 A;  5GAE C;  1Q1E A;  1PYB A;  1EQR A;  1SE8 A;  4L5S A;  3CP0 A;  4A3D H;  4A3F H;  3VDY A;  4JI6 L;  3PO2 G;  4DKA C;  4C3H H;  4DUZ L;  1NMG A;  4KLK A;  2UUA Q;  4A3K G;  1G6P A;  3FKI G;  4IOC A;  4WJ4 A;  3EBE A;  3I2Z A;  4BXX G;  2N78 A;  3CC7 A;  4JI8 L;  1VQM A;  1MIU A;  1YHQ A;  4JI5 L;  1ASY A;  3S1M H;  5HY6 A;  3A5U A;  4OWX B;  2VS1 A;  1U5K A;  4AQY L;  4JI1 Q;  2Q2U A;  2UXB Q;  3M9B A;  1K9M C;  2C35 B;  3RNU A;  2NZH A;  4JI4 L;  4A76 A;  2QA4 A;  4GKJ Q;  4IFD J;  1PFS A;  4A3I G;  2UU9 Q;  2HIV A;  5E7N A;  2K5H A;  4LF6 Q;  4DR5 Q;  3U4Z A;  1PHJ A;  3JAM c;  2QGQ A;  4PG3 A;  5LMU Q;  4JI0 Q;  1QVF A;  5JEA G;  4GLV B;  1Q8K A;  5M3F H;  3PIP A;  4GOP B;  1QZG A;  4DV2 L;  3HOX G;  3RR5 A;  2BA0 A;  1L1O B;  4YY3 Q;  1CSQ A;  1X3G A;  4DK6 C;  1VQF A;  3S1R H;  5M5W H;  3UDI A;  1C7Y A;  2F4V Q;  1N32 L;  1HR0 L;  1JT8 A;  1HR0 W;  1KRT A;  3KLW A;  3I4N G;  5EAY A;  1VQD A;  3HOZ H;  2E5L L;  4JYA L;  4HIK A;  1NMF A;  1AE3 A;  2JA7 G;  4A3L H;  2OQ0 A;  1VS0 A;  3I4M H;  5C0X G;  2I5M X;  3PUZ A;  3S17 H;  2PI2 A;  2UUB L;  1XNQ L;  2A19 A;  4QGU A;  1K3R A;  2AHO B;  2EQS A;  5HGQ A;  3CQZ H;  3E9I A;  3PO2 H;  2JK8 A;  2IHF A;  4IJH A;  2GN5 A;  2GVA A;  3CCS A;  1PH8 A;  4O2D A;  4X66 Q;  5C4X G;  4DAM A;  1JMC A;  1FJG L;  4DV7 L;  2DUD A;  3FKI H;  3CCV A;  4UP9 A;  3CCU A;  4YCW A;  5C0X I;  3HOV G;  3J81 i;  1CSP A;  4BBR G;  4NB3 A;  4DV5 Q;  4JI6 Q;  2KEN A;  4DV6 L;  2R92 G;  1BBW A;  4KI0 A;  3S1N H;  2JEB I;  2WP8 J;  1W2B A;  1P8L A;  1Q1B A;  3S24 A;  3KJP A;  1Q82 C;  3RN5 A;  1HNW L;  2KCM A;  2QEX A;  1XPR A;  1CKM A;  3L2P A;  5IYC G;  4ME3 A;  2PQA B;  4X64 L;  1UE1 A;  2E8G A;  4GS3 A;  4MNO A;  4X6A H;  2E2I H;  1D7Q A;  1EUJ A;  4OON A;  4A3I H;  4KHP L;  1V9P A;  1X9N A;  2NVY H;  4HIO A;  1OXU A;  4YCU A;  2K14 A;  2JEA I;  4GKK Q;  4X62 Q;  2I0Q A;  4JCV E;  4LFA Q;  4MZ9 A;  3GO5 A;  2ZJP A;  1X3E A;  3HOX H;  1DGS A;  1U0L A;  3PUX A;  4A3D G;  1VQI A;  4HJA A;  1PV4 A;  3PSI A;  3FHW A;  5FLX c;  1YNX A;  5AJ3 L;  4DR1 L;  2JA5 G;  4B3M Q;  3I4N H;  1YEZ A;  4LFB L;  1NBW A;  4YHH Q;  5IWA Q;  2LXJ A;  1V43 A;  3CPW A;  3RZO H;  2JA7 H;  4JBW A;  1MJE A;  3G6E A;  4B3R Q;  1I6H H;  3ICE A;  2UUC Q;  3OTO Q;  1S40 A;  2OWO A;  2ALY B;  4BY7 G;  4JI7 L;  2ZM6 L;  4NXN L;  2AKW B;  2VL6 A;  4GN3 B;  2E5L Q;  2CFM A;  1TWG H;  1TWC H;  4GN5 A;  1JB7 A;  4LF9 L;  1B7Y B;  2CKZ B;  3UDF A;  2NZO A;  4P71 A;  4EX5 A;  3RLO A;  1SR3 A;  2HT1 A;  2BA1 A;  4IPG A;  5ELO A;  1SN8 A;  1UE7 A;  4DR4 L;  1XNQ Q;  5K36 G;  1EIF A;  3HOV H;  1VQ4 A;  4PZ6 A;  4BBR H;  5M3F G;  2R92 H;  3GD7 A;  3JC6 6;  3B6Y A;  4AIM A;  1V1Q A;  1TWH H;  1WCM G;  2ZJQ A;  3M7N A;  3L7Z C;  4NPS A;  1LUZ A;  2CQO A;  4DV7 Q;  4A3J G;  1Y1W G;  2KCT A;  1VQO A;  1E24 A;  3M4O H;  1Q81 C;  5IYC H;  1PH3 A;  2RHS B;  2HIX A;  3L0O A;  2ZJR A;  1GD7 A;  3CAM A;  2B3G A;  4HIM A;  2KBN A;  1HZC A;  3HKZ E;  3Q8D A;  3T1Y Q;  4PZ7 A;  1N36 L;  3HOZ G;  2VQF L;  1S3O A;  1YVC A;  5GAG C;  4LFC L;  1GO3 E;  2EXD A;  4KHP Q;  4DUY Q;  3PO3 H;  1L2F A;  1QUQ B;  4X64 Q;  4R1J A;  3I4M G;  1Q46 A;  3HKZ G;  2Y0S E;  4DNI A;  5IP7 G;  4C2M H;  2XTI A;  4OO1 G;  1JJG A;  1E3P A;  4RG1 A;  1E1T A;  3K8A A;  1VQ9 A;  2PI2 E;  1M90 C;  1GKH A;  2Y0S G;  3BZC A;  4IPC A;  4L5Q A;  2JA5 H;  1IYJ B;  5ELN A;  2JA8 G;  1VQC A;  3A0J A;  4B3S L;  1VQB A;  3TEH B;  4A3C G;  2N3S A;  3GTM H;  3ULL A;  3LGJ A;  4OO1 I;  3WWV A;  1KHI A;  2CWA A;  3K7U C;  5BR8 L;  2UXC Q;  2VUM H;  4BY7 H;  1IBM Q;  4HJ8 A;  1I94 L;  2EIF A;  1EIY B;  3M3Y H;  5FLM H;  2IY5 B;  5H1S E;  3KF8 B;  2VQE L;  4IPD A;  3S16 H;  4APV A;  2R7Z G;  1PVO A;  4JC0 A;  3D0F A;  3STB D;  5M5X H;  1G29 1;  4JI2 L;  4NXN Q;  2D0O A;  2IT1 A;  4LW1 A;  4R4I A;  2VW9 A;  4DV1 L;  3OW2 A;  4POG A;  4K0K L;  4QQB X;  4OX9 L;  1WCM H;  1VQ6 A;  3G71 A;  4X65 L;  3K7A H;  4C3I H;  4A3J H;  1Y1W H;  1P16 A;  1N33 Q;  1BBU A;  1Q7Y C;  4UPA A;  3KFU A;  1A62 A;  1WI5 A;  2MO1 A;  4DR3 L;  1Z9F A;  3M4Q A;  2KHI A;  2RCN A;  3RN2 A;  3PO3 G;  1BVS A;  3ERS X;  1HZ9 A;  1A8V A;  1Q86 C;  1VQE A;  1K8A C;  3HFZ B;  1PH7 A;  2BH8 A;  5LMN L;  1KQS A;  5LMN W;  4POF A;  1J5E L;  4PZ8 A;  5C3E G;  4JBM A;  4NXM L;  1VQH A;  4R4T A;  2K75 A;  5IP7 H;  3F2C A;  1FVI A;  3MEF A;  1CKO A;  3PGZ A;  1N36 Q;  3HOW G;  2NN6 G;  2VQF Q;  2OTL A;  1QUQ A;  4B3T L;  4JV5 L;  2Q2T A;  1VQ8 A;  3GTP H;  3GTJ H;  1IBL Q;  2CWP A;  1LTL A;  1C9O A;  4H02 A;  4Y52 H;  3H3V I;  2JA8 H;  5IY0 A;  5GAH C;  1OXV A;  3U58 A;  4UY8 C;  4A3C H;  1C0A A;  1HNX L;  1MJC A;  4DV4 L;  4J15 A;  4GOP C;  3PUV A;  3UE1 A;  4LF5 L;  1LM0 A;  1O7I A;  1L1O C;  1XMO L;  4AYB E;  2NN6 I;  1KL9 A;  4R4C A;  1NE3 A;  3E9H A;  3AFP A;  4A3G G;  3D31 A;  4DUZ Q;  1I5F A;  2WB1 G;  4FDB A;  3M4P A;  1PH5 A;  4QJF A;  4XTC S;  1CKN B;  3K80 C;  2R7F A;  1GVP A;  3STB C;  3S15 H;  1JE5 A;  1X56 A;  4AYB G;  1HZA A;  5IYB G;  3PUY A;  2R93 G;  4JBK A;  3CME A;  4JI8 Q;  1X3F A;  4BY1 G;  3M85 A;  4JI5 Q;  2JA9 A;  4LF4 L;  1Y14 B;  2R7Z H;  1EQQ A;  4LF8 L;  4IO9 A;  4P73 A;  4DV3 L;  4AQY Q;  1KD1 C;  4LF7 L;  4DAY B;  4KHZ A;  2N8N A;  3UE0 A;  4JI4 Q;  4AH6 A;  2I5H A;  1Z47 A;  4QIW E;  2ZTE A;  1X54 A;  4C3J H;  4IOA A;  2YTY A;  5JEA J;  1SFO H;  1HH2 P;  4K0K Q;  4GOP A;  3TRZ A;  4DV1 Q;  3J81 c;  2A1A A;  4UP8 A;  1L1O A;  4MTN A;  3F2B A;  2PNH A;  2R6G A;  3I4O A;  4DV2 Q;  3TS0 A;  4DV0 L;  3KDF B;  3PUW A;  4A3M G;  1IBK L;  3GTG H;  2VY3 A;  3F8T A;  3H3V H;  5C3E H;  1UWV A;  1L0W A;  4DR3 Q;  3ULP A;  1N32 Q;  2Q2I A;  2VUM G;  1HR0 Q;  1SRO A;  3GDE A;  3NEN A;  3HOW H;  4DR7 L;  4JYA Q;  1VQK A;  3E0E A;  2A8V A;  5JJI A;  2KHJ A;  1SMX A;  3CC4 A;  5LMN Q;  2RHQ B;  5FLM G;  1M1K C;  1J5E Q;  2K5V A;  2OQK A;  5C0X J;  1HNZ L;  4Y7N H;  3W1G A;  2NVX H;  4NXM Q;  4EQ5 A;  1OTC A;  2RF4 A;  1NTG A;  3K0X A;  3I55 A;  2L15 A;  3RLN A;  4PMW A;  2AWN A;  1KIX A;  2UUB Q;  3TRE A;  1QVC A;  1RIP A;  3EIV A;  4DR6 L;  3TQY A;  3S14 H;  3GTL H;  1CUK A;  1KAW A;  4JI1 L;  4A3G H;  2UXB L;  5IP9 G;  1B70 B;  1FJG Q;  4LUV A;  1SRU A;  4A3E G;  4L5T A;  4GKJ L;  2IX0 A;  2ZTD A;  2UU9 L;  1XPU A;  5M5Y H;  1EOV A;  5IYB H;  3HOY H;  2YYZ A;  4LF6 L;  4DR5 L;  4DV6 Q;  2R93 H;  1OXS C;  4BY1 H;  2AMC B;  3PCO B;  5DLQ E;  5FJ8 H;  3ULJ A;  5C4J H;  2PQA A;  1HNW Q;  4BBS G;  2K5N A;  2I5L X;  1A0I A;  2F3I A;  2V1C C;  4R4Q A;  1S72 A;  1YZ6 A;  1PA6 A;  2R7D A;  4YY3 L;  5IT9 c;  2Z6K C;  4DK3 C;  3KOJ A;  3KYH C;  1IXR A;  4R4O A;  1Y1V G;  4JG2 A;  3PF4 A;  2D62 A;  4O0A A;  2MO0 A;  3ZJY C;  3H15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...