2UUBQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
total genus 22
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uubQ00
2UUBL 1Y1WG 3TEHB 1YHBA 5JEAG 2IHEA 4J15A 1KRTA 1GM5A 3AFPA 4K0KL 3OW2A 4A3FH 3HOUG 1L1OB 3ER0A 5M5XH 1PH9A 4LF9Q 2E2HH 2KHJA 1ASYA 4IOCA 2NVYH 4BY1H 1BKBA 3CCLA 1N8RC 5ELNA 1I6HH 2Z6KC 4YY3L 3K81C 4DR1L 4DR4Q 4C2MH 2K75A 4NXNL 2Q2UA 3HOZG 1HNZQ 1FGUA 1WCMG 1A62A 2UUCL 4B3TQ 4A93H 4A3GH 1WI5A 4DV4Q 1YJNA 3I4NG 4EQ5A 1FJGQ 5IT9c 2K4KA 5IYDG 3JAMc 2KENA 3PV0A 4GOPA 4JG2A 4X65L 4LF6L 4DUZL 2H5XA 2VUMH 3UDXA 1VCIA 2NZOA 1VQFA 3FP9A 3L7ZC 5IWAQ 1A0IA 4QGUA 1YJWA 1NJIC 4LF5L 1N32Q 2L15A 3PUZA 3CCEA 3I4OA 1YZ6A 4A3IG 1BBWA 1RL2A 2Y0SG 1X9NA 4WJ3M 3D31A 1EUJA 3LGJA 4DPGA 3H15A 4JI6L 3S1MH 1KHIA 1N33Q 1AH9A 2I5HA 2BA1A 5C4XG 1U5KA 3GTLH 4YCVA 2VQEL 1LUZA 4BA1I 1LM0A 5C44G 2GVBA 1QZHA 4JI2L 4A3EG 2B63G 1Z9FA 4QY7A 1PH7A 4JI4L 3CQZH 5M5YH 4A3MG 2YV5A 4R4TA 1OXVA 2UUBQ 2MO0A 2N8NA 3AYHB 3KF6B 4DV2L 1VQAA 1R9TH 4OX9L 1EQRA 2F52A 1VQ6A 2R93H 3I56A 3E9HA 1Y1WH 3S15H 3HOYG 2WB1E 1XMQL 3HOUH 3K7AH 3U4VA 1HZCA 3NELA 4XIGS 3S2HH 1VQ7A 4YY3Q 5M3MG 4GNXA 4TQUS 3MXNB 4DR1Q 1IBKL 1VQ9A 1YNXA 2K5NA 3J80c 3TREA 2UU9L 2MNAA 4GLAC 2UUCQ 3HKSA 1JT8A 4BXXG 2YTXA 3RR5A 1FL0A 2NZHA 1K8GA 1D8LA 4IJLA 1VQJA 1ASZA 1WCMH 4KHZA 1JJ2A 4LF8L 1OXTA 1J6QA 3STBD 1LYLA 4X65Q 4LF6Q 4DUZQ 3I4NH 1EIYB 3CCMA 1NTGA 1X55A 4PZ7A 5IYDH 4FDBA 4LF5Q 4LUVA 2HQLA 3CW2C 2VW9A 1XPOA 4POGA 2VZAA 4JI6Q 2N3SA 1OXUA 3WWVA 2VQEQ 1SR3A 1J5EL 3GTQH 2PI2E 4JI2Q 2IHFA 1PH3A 1Y1VH 4LNQA 3UE0A 1X3EA 4JI4Q 1E1TA 2MFIA 3W1BA 1JE5A 5C4XH 3OTOL 1DGSA 4UP9A 4LFAQ 1K9MC 2LXJA 4A3EH 3HKZG 4UY8C 2B63H 3AEVA 3GTPH 4C3JH 3I4MG 4DV2Q 4OX9Q 4JCVE 1BVSA 2KCTA 4A75A 1A63A 4HIDA 2WAQE 3S24A 3CMAA 1K3RA 1L2FA 3CCUA 2JA8G 3RZDH 4RMFA 4GNXC 1XMQQ 4A3BG 4C3IH 1K83H 1XNQL 3PCOB 2RCNA 3S17H 1E24A 1I3QH 4AIMA 3HOYH 3PGZA 2DUDA 1AE3A 3MEFA 1VQ4A 2UU9Q 2IX0A 1SN8A 2MQHA 1TWAH 5M3MH 3J80i 3CD6A 3NBHB 1VQKA 4JYAL 4Y7NH 2UXDQ 4DV7L 2R92G 1TWHH 4LF8Q 4BXXH 4L5SA 4B3SQ 2LSSA 4LFCL 5GAGC 2CQOA 4HJAA 1V9PA 2AWOA 3KOJA 4DAYB 1Q12A 2YU9H 2JK8A 2QGQA 1GD7A 3CF5A 3NENA 1YJ9A 3M3YH 2WB1G 2PMZE 3IRBA 1CKNB 3B6YA 1YEZA 1GO3E 3PO2G 3ERSX 3KJOA 5IP9G 1K73C 1PHJA 1J5EQ 4QJFA 1SE8A 3ULJA 1IL2A 3AQQA 1EYGA 3A5ZB 4TVAB 4AYBE 4GLXA 2VL6A 4JV5L 5C0XG 2B3GA 3PF5A 1QVFA 2YTYA 3OTOQ 2K50A 3KLWA 1HZBA 4JI5L 2ZM6L 3G6EA 2PNHA 3G71A 4BA2I 3UE1A 5H1SE 1EQQA 2UXBL 5C0XI 5IYCG 4NPSA 1L1OC 4LUZA 3J81c 3J7A5 3KDFB 4JOIA 1XNQQ 2AWNA 3KF6A 2ZTCA 3KYHC 4YHHL 4B3MQ 1XPUA 4IJHA 3T1HL 2JA8H 4A3BH 2V1CC 2YTVA 1EOVA 5C0XJ 3HFZB 5DLQE 4PZ6A 2MO1A 4JI7L 1PYBA 2JA7G 4JYAQ 1X3FA 4GLVB 4DV7Q 1OXXK 2JEBI 4DK3C 2RHSB 4H02A 1IBML 3E0EA 3M4PA 4P75A 4LFCQ 3M4OH 4PMWA 5HGQA 1BBUA 3CPWA 4DR5L 1L0WA 1C9OA 4P72A 3FKIG 4LUOA 2R92H 2ZTDA 3GTMH 1WJJA 3TQYA 3PF4A 1N36L 3FHWA 5IE8A 4BY7G 4A3LG 1VQIA 4A3DG 3UDGA 4O0AA 4OWTB 1CUKA 1PH1A 4BBSG 4HIOA 4NXML 4OO1I 5LMUL 4DV6L 4BBRG 1YIJA 3J81j 4A3JG 4NB3A 3PO2H 3CCSA 4JV5Q 5C3EG 2YYZA 5IP9H 4LFAL 2CFMA 4R4OA 2K52A 4P73A 3BJUA 3K8AA 4MNOA 3CPFA 2ZM6Q 4JI5Q 3KFUA 1UE5A 2A1AA 1QUQB 2OQ0A 3ZJYC 2UXBQ 4JOIC 4Y52H 3RNUA 4HJ7A 1PH8A 5M5WH 5BR8L 4DAMA 4KLKA 1VQDA 4IO9A 1VQNA 1NBWA 4YHHQ 4A3KG 1XJVA 5JJKA 3S1NH 3J81i 1PYSB 1W2BA 3T1HQ 4JI1L 2BH2A 3CCVA 1AE2A 2K14A 4A4IA 1PH4A 1HJPA 1P16A 1YVCA 2JJQA 3A0JA 4HJ5A 3VDYA 4JI7Q 2PQAB 3HOZH 2UXDL 2QA4A 2NVQH 4B3SL 2IY5B 1IBMQ 1CSPA 1VQMA 4DK6C 3ULPA 2JA7H 3CXCA 2E2JH 2RF4A 3JC66 1A8VA 4YCUA 4DR5Q 1XMOL 1KIXA 2F4VL 4C3HH 1HNXL 1IXRA 1XTDA 3Q8DA 4JI0L 4A3CG 1LTLA 1N36Q 3FKIH 4IPDA 3CAMA 4GOPB 3PO3G 2CKZB 2KCMA 4A3IH 1UE6A 2VQFL 2OQKA 5JJLA 4GN5A 2Q2TA 3L0OA 4NXMQ 5LMUQ 4DV6Q 3RN5A 1Q86C 4BY7H 4A3LH 4A3DH 2BH8A 4JI8L 3CMEA 5M3FG 4DV3L 4BBSH 5C44H 2N78A 4UP7A 5LMNL 1S40A 1HNWL 1YITA 3A74A 4BBRH 1Q1BA 2R7DA 3I55A 4A3JH 1CKOA 4A3MH 3H3VI 3UDFA 1UWVA 1E22A 1OTCA 4LF4L 3K7UC 4XTCS 1X3GA 5BR8Q 1KXLA 1OXSC 1VQGA 1L1OA 4B3ML 4YWLA 2QEXA 4OWXB 4IFDI 4IPGA 5FLXc 1T9HA 1O7IA 4POFA 2R7FA 4JI1Q 3PIOA 3W1GA 4AH6A 1G6PA 2JA9A 3BZCA 1KRSA 4A3KH 1YHAA 2IX1A 3H0GG 3D0FA 2K5VA 1Q82C 2ZJQA 1UE7A 3ICEA 3S14H 3CC4A 4DR2L 4PG3A 1VQPA 2VY3A 2WFWA 1N9WA 1PH6A 2E5LQ 3S1RH 3F2CA 2NVXH 3BZKA 2E5LL 1HZ9A 1YI2A 4DV5L 4OONA 1N34L 4OWWB 1XMOQ 1MKHA 2Y0SE 1IBLL 4A3GG 2F4VQ 1HNXQ 2PI2A 4IPHA 4HIKA 1XPRA 3K80C 4JI0Q 3M4QA 2ZJRA 2ZJPA 1TWCH 3DLLA 1IYJB 2VQFQ 3M7NA 1S72A 2ID0A 2WP8J 1SRUA 1SROA 3S1QH 2ZTEA 3T1YL 1X6OA 2JA5G 2JA6G 3PO3H 4JI8Q 4DV3Q 4RG1A 2Z0SA 5LMNQ 4A76A 1HNWQ 4OXPA 4EX5A 1JJGA 1NMGA 4AQYL 4ALPA 1I5FA 3F2DA 5M3FH 1QVCA 2HT1A 1RIPA 5AJ3L 4LF4Q 5LMNW 3AFQA 3EIVA 4YWMA 3I4MH 2DGYA 1VQHA 1GKHA 2ATWA 1QUQA 2LXKA 3J7ZC 1KD1C 1D7QA 4DV1L 4DNIA 2JE6I 4R4QA 2R6GA 3GTJH 4UP8A 1Q1EA 4DV0L 1YBYA 1C7YA 2EXDA 5GAHC 1NY4A 3DM3A 4DR2Q 1JMCA 4KHPL 1PH5A 1MJEA 1KAWA 1G51A 5GQOA 3H0GH 1SMXA 2Q2IA 4GS3A 2XTIA 1EIFA 3I2ZA 1Q46A 4X64L 5GADC 2PQAA 2AKWB 5FLMG 4DV5Q 2WAQG 1QZGA 1N34Q 3GTKH 1IBLQ 4LWCA 1V43A 1HR0L 2I5MX 2UUAL 4OO1G 3PUYA 3PIPA 3NEMA 1JB7A 2KHIA 2NVTH 3K0XA 3RLOA 4HJ9A 2OTJA 3RZOH 1VQBA 2E8GA 4P74A 1S3OA 1P8LA 5JEAJ 5IY0A 3HOWG 2RHQB 4DUYL 4DR7L 3F2BA 2K5HA 3T1YQ 1WOCA 4JBWA 3S2DH 3HKZE 5GAEC 2OTLA 2IT1A 4L5TA 3STBC 1I94L 2CCZA 2JA5H 4DR6L 2GN5A 2JA6H 4P71A 2F3IA 4AQYQ 1QVGA 4JI3L 4HIMA 3GDEA 1TXYA 5AJ3Q 2AMCB 1NMFA 1FVIA 1KQSA 1Y1VG 2FXQA 1V1QA 3GO5A 5IYCH 3CC2A 2UXCL 2HIXA 3RLFA 4X66L 5K36G 4LFBL 3GTGH 2AHOB 3HOXG 1SFOH 3PUXA 4APVA 1MIUA 4DV1Q 2KBNA 1HH2P 2OCEA 4AYBG 4X62L 3E9IA 3PUVA 4MTNA 5FJ8G 4DV0Q 1YHQA 3OYYA 4KHPQ 4K0KQ 3TRZA 4KI0A 3CC7A 1PV4A 3EN2A 5IYBG 4UPAA 4B3RL 4X64Q 4GN4B 3CCQA 1TWGH 3U58A 3TS2A 2I0QA 1KC8C 1UE1A 1U0LA 3M85A 3PSIA 1HR0Q 1X56A 1PA6A 2UUAQ 1EFWA 1VQCA 1VQLA 1UEBA 1E1OA 5FLMH 4L5RC 1Q8KA 5C4JH 2ASBA 1H95A 3UDIA 4O2DA 2D0PA 4ME3A 3RLNA 1HR0W 4GOPC 1E7ZA 2VNUD 1CKNA 4DUYQ 1VQEA 3HOVG 4JBJA 4DR7Q 2EIFA 1XNRL 4PZ8A 3A5UA 3L2PA 1B70B 2ES2A 3HOWH 4GKJL 2XGTA 3G4SA 2CWAA 5IP7G 3JAMi 1I94Q 3GTOH 4IFDG 5C3EH 4DR6Q 1Q7YC 1VS0A 2OWOA 4LF7L 4QL5A 2A8VA 4GKKL 4HJ8A 1M1KC 4JI3Q 2HHHL 1KL9A 1PVOA 1K0RA 3F8TA 4DKAC 1TWFH 3CCJA 2E2IH 4DR3L 4JBMA 2UXCQ 2R7ZG 1GVPA 1VQ5A 4X66Q 3F1ZA 4LFBQ 2BA0A 1HZAA 1CKMA 3W5OA 3SGIA 3KDFA 1M90C 4A3FG 2NN6G 3CP0A 5HY6A 3BU2A 2GVAA 1I50H 2I5LX 4BY1G 4X62Q 3HOXH 4IFDJ 3U50C 4R4IA 4JBKA 5GROA 2NN6I 1VQOA 4GNXB 5J3BA 2C35B 2JEAI 3U4ZA 1EWIA 1X54A 4LF9L 5FJ8H 1PH2A 4B3RQ 2D0OA 4GN3B 3PUWA 1VQ8A 4A93G 1WFQA 1C0AA 3KJPA 5IYBH 4NXNQ 4DR4L 4YCWA 1WYDA 1Z47A 2JQOA 1IBKQ 1HNZL 4QIWE 4B3TL 2Z6KA 2EQSA 4JC0A 4DV4L 1CSQA 1E3PA 3I7FA 3RN2A 4A3CH 1PFSA 1W3SA 2B29A 1FJGL 2VUMG 4LW1A 5JJIA 4YWKA 1B7YB 2Q2HA 1K8AC 1XNRQ 4QQBX 2ALYB 4MZ9A 1Y14B 2A19A 5IWAL 1JJCB 3EBEA 4GKJQ 1N32L 1X65A 4IPCA 3H3VH 3M9BA 3HOVH 4WJ4A 2HIVA 3TS0A 5E7NA 5EAYA 1G291 2CWPA 4LF7Q 4GKKQ 1SLJA 5IP7H 2HHHQ 4IOAA 5ELOA 1NE3A 2VS1A 1Q81C 3ULLA 1N33L 4R4CA 3CCRA 4R1JA 3GD7A 1B8AA 4DR3Q 1MJCA 3G48A 3KF8B 1IZ6A 4L5QA 3S16H 2D62A 2N49A 2R93G 4X6AH 2R7ZH
chains in the Genus database with same CATH superfamily
5JEAG 1YHBA 1KRTA 4K0KL 4A3FH 1D5XC 3Q24A 2JA5B 5FK9C 1VF7A 4RH6A 1GUOA 5E4XA 3VYUA 2XRQD 1I6HH 4R9WA 1B9MA 1QNKA 2Z6KC 4YY3L 4DR4Q 3HOZG 2Q2UA 4NXNL 1WCMG 1YJNA 3I4LA 2KENA 3PV0A 2F0WA 1EY8A 5CV8A 2H5XA 4K6LA 1XYIA 3D4WA 3TP6A 1NJIC 1VQFA 5CV9A 4KKTA 1A0IA 3PUZA 5EBDA 2BCOA 3TDQA 2ZXOA 1VMCA 1WTPA 3FKIB 1KHIA 1AH9A 2BA1A 1BNZA 3GTLH 4YCVA 2VQEL 2GVBA 3PMFA 4JI2L 2B2WC 4A3EG 4QY7A 5I2YA 3BZDB 3Q22A 3ZYYX 5CC4A 2N8NA 1VQAA 3FPUB 4OX9L 1NNXA 2F52A 1WTOA 5C3EB 3I56A 3E9HA 1Y1WH 1F2LA 1HZCA 2ENBA 3D3RA 1IBKL 4IALA 1QJOA 4DR1Q 4GZYC 1YNXA 2K5NA 2KUMA 1PRTB 3WDNA 3RR5A 1FL0A 1B1ZA 2NZHA 1XWEA 1D8LA 1JJ2A 3S14B 1I50B 1J6QA 3STBD 3MWYW 4X65Q 4LF6Q 4G7HC 5J1ZA 2CHBD 4IN3A 3I4NH 3H09A 2X6GA 1X55A 4FDBA 5I6WA 4P2CB 1X32A 3IFDA 3J80E 3T4AC 2A68D 1BF4A 3P20A 2B8FA 1J5EL 1DYQA 2PI2E 3A8KE 2IHFA 1PH3A 1Y1VH 1I4RA 2BE5C 2L9HA 5C4XH 1IW7D 1DCZA 3OTOL 1DGSA 3DWPA 4UP9A 2Z1CA 1HTLD 2B2VA 4LFAQ 5A2QE 4FP5D 2QF7A 3I4MG 4DV2Q 1JORA 4CJ2C 4JCVE 1RJTA 2WAQE 4KHVA 1L2FA 1L0XB 1XMQQ 1XNQL 5JJZA 1EFID 1JC7A 4WRDA 1QB5D 2DUDA 3MEFA 1VQ4A 2MQHA 4I65A 2J0TD 2PZUA 4HMIA 4NKLA 4BXXH 1SMYD 4KN7C 4LFCL 5GAGC 1TS2A 1V9PA 2F0UA 3N6RA 4EQNA 1Q12A 2JK8A 4KKSA 1GD7A 3NENA 3M3YH 2PMZE 1TS5A 5KYIA 1DXMA 3EVQA 3PO2G 1H9MA 2XWJB 4CGYB 3P7JA 3ULJA 1EYGA 4JV5L 3PF5A 3V96A 2K50A 3KLWA 1D6EC 1II3A 5FO8B 3KUPA 1NR2A 3D6WA 5C0XI 2M00A 3R2IA 2N88A 2EJMA 4NPSA 3KDFB 5EKIA 2AWNA 5DAUA 1XPUA 1B53A 4KK7A 3T1HL 3GTGB 3HEJA 2DJFC 1SFOB 3SK4A 1CT1D 3HFZB 1A3VA 1EIHA 2MO1A 4JI7L 2F0NA 2JA7G 1X3FA 2E76C 4DV7Q 1OXXK 2K1BA 4P75A 3J7AF 5CGKA 3J81E 1BBUA 1EEFD 2G9DA 4P72A 1STNA 4K5XA 1DOMA 1WJJA 1SJED 1PTOH 3TQYA 1N36L 2K6AA 5IE8A 4A3LG 4A3DG 4NP5A 3UDGA 4HIOA 4OO1I 3I91A 1YIJA 5CV7A 1ESFA 1I4HA 3L3OC 2KEEA 1SNQA 3HOWB 3KFUA 4MNOA 3A7LA 1JB3A 2ZM6Q 1GHKA 1UE5A 2QKIC 4CDCC 2UXBQ 4H0LC 5JAVA 2BOSA 2DNEA 2CVRA 5M5WH 2PO4A 2PPBC 1W6KA 4IO9A 1NBWA 1XJVA 3VR6A 4XQJA 4JI1L 2BH2A 1Y1VB 2HDMA 1PH4A 2JJQA 3HOZH 1YVCA 1BCPB 2UXDL 2RBMA 2QA4A 1HTPA 3HOXB 4M1UB 1VQMA 5C3XA 2HD3A 2F4VL 3NK9A 1IXRA 1LT3D 1KDCA 3MXUA 2A6HC 4IPDA 3PO3G 2CKZB 4BWGB 2K5DA 2EY2A 5LMUQ 2Q8IB 5EQ0A 5C4ZA 5M3FG 4BBSH 2A6EC 3P1HA 5LMNL 1HNWL 4A3JH 1PMRA 3I55A 1HA6A 4OGQC 3HOVB 1UWVA 1SNDA 3M3YB 3H3VC 5BR8Q 1KXLA 2ICIA 3OW7A 3NQIA 4YWLA 4OWXB 1GUGA 1T9HA 1F2ZA 5BN5A 4POFA 4HSVA 2JA9A 4A3KH 1YHAA 2B2YA 2C5CA 2VY3A 1MGSA 5I9OA 1ENCA 3S1RH 2CW0D 1HZ9A 4OWWB 1XMOQ 2Y0SE 4H7BA 4A3GG 2PI2A 3M4QA 2ZJPA 3GP7A 1TWCH 3AMUA 1Q90A 1DZ1A 1S72A 1PZKD 4PMCA 1Y8PB 2JA5G 1X6OA 3R3OA 5I4DA 4HAEA 4DV3Q 2Z0SA 4A76A 2EYLA 3MFGA 4EX5A 1JJGA 3CU7A 1A15A 3EIVA 1JQYD 5IGDA 3I4MH 2ATWA 3WOEA 2RVLA 3WOFA 2LXKA 1PDQA 1KD1C 1D7QA 4DV1L 4R4QA 4CDEC 1QILA 4X3SA 1Q1EA 4DV0L 1NY4A 3KLRA 4IUPA 1ET9A 5FO7B 1MJEA 5GQOA 3H0GH 2R93B 3RN5A 1EIFA 4PQXA 1Q46A 2PQAA 3GTKH 2WAQG 3I70A 4ZKBB 3EJIA 1QZGA 1IBLQ 1SYEA 4LWCA 2E74C 2O5IC 3BS1A 1PTOD 3TP5A 1QNUA 1EOTA 1PFNA 4KY6A 5JEAJ 2RHQB 3HOZB 4DUYL 1WCMB 2N55A 1T5XD 1GOZA 1WOCA 2FJ2A 4JBWA 2OTLA 2IT1A 4KV6A 4KJNA 3STBC 4DR6L 1TXYA 5AJ3Q 3KBGA 2L4NA 5E4WC 2F03A 1V1QA 3CRKC 4PV1C 3TZUA 4X66L 2A68C 3BDOA 1LT4D 3GTQB 1S5ED 4C3JG 4OIJA 2QCPX 3SE0A 4MTNA 4X62L 5FJ8G 4A3EB 1YHQA 4KHPQ 2KCNA 3L9AX 4KI0A 1PV4A 2NUCA 1S4ZA 2DY7A 4GN4B 4NMZA 5DM63 1KC8C 3PSIA 1Y8OB 5D14A 1EFWA 1VQLA 1E1OA 3TBIB 3D8GA 3MFYA 2H1EA 1A3TA 2NTSA 4ME3A 2KHSA 2MUYA 5J39A 1Z6HA 2IWHA 2ES2A 1EEID 1QCBD 3C3LA 2FMCA 3S1RB 1SMYC 5KIXA 4IUTA 1I94Q 3GTOH 1RF2D 4ZKCB 3GV6A 2OWOA 1PFBA 2A8VA 4QL5A 1ZXTA 1M1KC 4JI3Q 1KL9A 4JBMA 2UXCQ 1Z7TA 2FMMA 2RCFA 4LFBQ 1CKMA 3QJYA 3KDFA 1I4PA 1JOOA 4A3FG 3V2TA 2WACA 1CK1A 1JWSD 3FPPA 3T51B 3K58A 1SEBD 1FGBD 3U50C 2RDGA 3NQTA 4JW0A 5J3BA 2RDFA 1PH2A 1EYDA 4JK1C 4B3RQ 2D0OA 3MA2B 1FR3A 1WFQA 3I4MB 4L6TB 3KJPA 3T13A 4DR4L 1Z47A 2I07B 2AQ1B 4ZYSA 1RHPA 1YNJD 4JC0A 2H4OA 3OOCA 4S3SA 1HHVA 4YWKA 1K8AC 2JP1A 2NB0A 4XYQA 3M4OB 1JJCB 3EBEA 3H0GB 3H3VH 1AZPA 4RWSC 4WJ4A 3GTKB 4ULLA 2EYJA 4LF7Q 2XWBB 5IP7H 2HHHQ 4IOAA 4FYDA 4ZQ3A 3CHBD 3ULLA 3CCRA 1MJCA 3G7LA 3G48A 1IZ6A 3DMUA 2MPMA 3TSSA 3PO2B 4HJAA 2R7ZH 1Y1WG 2IHEA 4J15A 3AFPA 1B50A 3OW2A 3MXGA 4X3KA 4EVOA 4LF9Q 2E2HH 2KHJA 4IOCA 2NVYH 4BY1H 1BKBA 3CCLA 4DR1L 2K75A 1FGUA 4A93H 4HN7A 4A3GH 1WI5A 3I4NG 1FJGQ 1CA5A 4JG2A 4X65L 2P5ZX 4LF6L 2KEDA 2VUMH 3UDXA 4RHSA 2JA7B 1VCIA 5IWAQ 3L7ZC 1STGA 2DJGC 3CCEA 4A3IG 2Y0SG 1LO5D 3H15A 3LGJA 4DPGA 3S1MH 3M4YA 1N33Q 1HRJA 5C4XG 1U5KA 1LUZA 4BA1I 1QZHA 1Q3LA 3QB3A 3CQZH 2Z4HA 4RFBA 4R4TA 1SYCA 1ML0D 3AYHB 2PW7A 2KVMA 4DV2L 1EQRA 1BXTA 4B9WA 3GTOB 4QF4A 1H9JA 1LT5D 2SOBA 4HEDA 1XMQL 2SEBD 4XIGS 1XXGA 3MXNB 2F0EA 3J7YW 3TREA 1RTNA 2EYOA 2UUCQ 3HKSA 4BXXG 3A7AB 5T1IA 4KHZA 1OXTA 1J8IA 1LYLA 4DUZQ 2RSOA 2NVXB 5IYDH 1ENFA 1SYBA 3MXPA 2MHVA 2EOTA 1XPOA 1D2BA 2CW0C 2VZAA 1TVXA 4G57A 3WWVA 1RODA 1KNAA 5JVG3 1SR3A 4IURA 4LNQA 2EYFA 1X3EA 3PO3B 2MFIA 2MJ8A 1R4PB 2OF1A 1I4XA 2LXJA 3TZDA 4C3JH 1D5MC 2Q8TA 1TY0A 4HIDA 2F0JA 4RMFA 4C3IH 3PCOB 3S17H 1E24A 1I3QH 5FOBB 3HOYH 1WTVA 3I90A 3PGZA 1AE3A 2UU9Q 1SN8A 3T53B 1TWAH 1AW7A 3GTJB 1NR4A 3NBHB 4N9TA 1FYCA 4DV7L 1IYVA 2LS01 3E5SA 4LF8Q 1C8CA 3S2DB 1E2VA 2A5HA 2QGQA 2O2LD 1GO3E 2HDLA 3ONAB 3KJOA 4A3GB 1PTOC 1FNVA 1K73C 4U673 2JYOA 2EVBA 3AQQA 2VXWA 3BVGA 3FVQA 4TVAB 4AYBE 2VL6A 2B2WA 5C0XG 2F0LA 1AP0A 4DNRB 3D4DA 2RQXA 2ZM6L 3G6EA 3G71A 1KTKA 5H1SE 2UXBL 1IL8A 1BQQT 1L1OC 4LUZA 2Q8RE 2D5DA 4KY7A 5KNCA 4B3MQ 1ILPA 2JA8H 1I6VC 2YTVA 4K2LA 3I72A 3I73A 4MTKA 4JYAQ 4GLVB 3VR5A 2JEBI 4DK3C 4H02A 2J7ZA 3M4PA 3K57A 4I7ZC 1ONLA 1EY9A 3H94A 1C9OA 4K8IA 4DN4M 1F2MA 1RD9D 3K6OA 1CHPD 1B9NA 2WAQB 1PH1A 4BBSG 2WINB 5LMUL 3J81j 4A3JG 3MEHA 5IP9H 1H9KA 2K52A 4P73A 3C2PA 3K8AA 4JI5Q 3CPFA 4Y52H 3SVMA 1D5ZC 1EZ8A 1O7YA 3H91A 5BR8L 1PH8A 4DAMA 4KLKA 1VQDA 2E2IB 4A3KG 2K03A 5JJKA 1W2BA 4F7XA 2PMZB 3CCVA 4A4IA 1JCKB 1HJPA 3A0JA 2PQAB 2NVQH 1ESRA 4B3SL 3IL8A 3MTSA 1IBMQ 1CSPA 4C3JB 4DK6C 2E2JH 3JC66 1PLFA 3E3XA 1XMOL 2F0HA 2IL8A 4C3IB 2G9HD 2PCFB 3Q8DA 4IQZA 3CAMA 4A3IH 1F9RA 2OQKA 4GN5A 1TWAB 3L0OA 2Q2TA 1NCVA 1YNJC 4DV6Q 1Q86C 4NXMQ 2DNCA 4BY7H 4DV3L 1LTBD 3TMEA 2N78A 3NBIA 4UP7A 4BBRH 1CKOA 4HCEA 1GUSA 2BDNA 3F2UA 4RKBA 1X3GA 3OSOA 1OXSC 4IFDI 1MSGA 1O7IA 1MBYA 5C6AA 1D1IA 3PIOA 1KDBA 3BZCA 3SEBA 3H0GG 1EWHA 2K5VA 1FD7D 1SSOA 3UI2A 5G3LF 4Z9CB 5EPLA 4A3FB 1EY5A 1C4QA 3F2CA 1BBXC 4KD3A 4FXKC 2TSSA 1KAAA 4M8AA 1BCPF 1IBLL 2SDFA 2L12A 1HNXQ 4IPHA 1I6HB 1XPRA 4CKEA 4Q5VA 4JI0Q 2FINB 1RKNA 1DOLA 2JA8B 1KLGD 1IYJB 4DXFA 4WORA 4FF4A 3M7NA 2ID0A 1SRUA 3S1QH 5CBEE 3A8IE 3VR3A 3K5LA 4JI8Q 4RG1A 1K3BC 1BO0A 1NMGA 4ALPA 3NXWA 1TKWB 2HT1A 3C1FA 5AJ3L 1WD0A 3QOJA 2L1BA 4IUUA 2R61A 1VQHA 1R4QB 2F0DA 1QUQA 3GTLB 5IGCA 4DNIA 4ZAIA 2R6GA 1B2TA 4UP8A 1JWUD 1HPCA 1C7YA 1YBYA 3MXNA 5GAHC 4CDFC 1WTXA 4DR2Q 1JMCA 4KHPL 1PH5A 2F0SA 4ZRZA 1AZQA 3I2ZA 1Y1WB 4ZLTF 1N34Q 5E1FA 2I5MX 1G2SA 1GHJA 3PIPA 1JB7A 1SBBB 2NVTH 3RLOA 2OTJA 1LTGD 4CHTB 4J1MA 5IY0A 1H9SA 5COYA 3T1YQ 1SNOA 3I4NB 1O7LA 4L5TA 1I94L 2E2JB 2NZ1D 5C0XH 4P71A 5LHY1 4TRDA 4AQYQ 1QVGA 4JI3L 4PNYA 2AMCB 1NMFA 1RDPD 4CJ1B 1KQSA 5IGGA 1QE6A 4ILWA 1G8ZD 5FKAC 3RLFA 4A3IB 2UXCL 3X3MA 4LFBL 2Y0SB 1A2TA 2CH4A 5ELBA 2KECA 3PUXA 4APVA 1MIUA 4XQQA 2KBNA 4BY7B 1DD2A 5C4XB 4AYBG 1LTSD 4K0KQ 3TRZA 4UPAA 3NBHA 2EJGC 4B3RL 1UNSA 1TWGH 4DK0A 3C46A 1UE1A 5AFWA 4U68A 5FLMH 1YNND 1O7ZA 5C4JH 2NTTA 1H9RA 3UDIA 1VF5C 4OO1H 4GOPC 1E7ZA 2E75C 4DR7Q 3EA6A 3S9WA 4QB4A 5IP7G 1EL0A 1Q7YC 4LF7L 2NWGA 2HHHL 1K28A 2EYMA 3F8TA 1TWFH 1JR0D 3CCJA 4XT1B 2R7ZG 5G3LD 2VB2X 4RGTA 5ELFA 3W5OA 4RHRA 3SGIA 3U9OA 5K36H 1BCPD 5I9PA 4BY1G 4IFDJ 1A2UA 1PZJD 2NN6I 4UDUC 3LNNA 5GROA 1VQOA 4LF9L 1K0SA 4OELB 2OT2A 1VQ8A 4A93G 4RCOA 1EY6A 5IYBH 1BOSA 1IBKQ 1K8MA 4LMQD 4FF2A 3I7FA 2XNAC 2VUMG 1FJGL 4HTHA 1X3QA 4QQBX 2ALYB 2EZVA 4RGOS 3SK8A 2A19A 1LT6D 5IWAL 4GKJQ 4FXDA 2RKSA 5KEEA 5F2DA 3TS0A 2M2LA 5E7NA 3U9SA 1TY2A 1G291 2Z6BA 4GKKQ 2LY7A 1PTOB 1SNCA 5ELOA 3NPPA 3E0JA 1KNEA 1N33L 4R4CA 4EQOA 4FXGC 1AN8A 3GD7A 1B8AA 4MN3A 4K5WA 2B39A 3S16H 1S5BD 3TEHB 1BUVT 3K59A 4TKOB 1GM5A 2PZWA 4OHJA 2NN6H 1L1OB 1QWYA 3ER0A 1TIID 2Z4IA 2AUKA 1FNUA 1ASYA 1HUNA 5M5WB 1N8RC 1TS3A 3K81C 1CTMA 1HQRD 2PZTA 1HNZQ 1A62A 2UUCL 2L55A 4EQ5A 2K5QA 2K4KA 3OWFA 5IYDG 2XVSA 3SXHA 1STBA 4DUZL 4C3HG 3DHQA 3FP9A 3K5NA 1YJWA 1MD2D 2L15A 4KN4C 1PYWD 3I4OA 1YZ6A 1S5DD 1BBWA 1RL2A 2LFNA 4WJ3M 3D31A 2I5HA 2X69A 1I4GA 4UHVA 5C4JB 4FVMA 5C44G 1RTOA 2LKVA 1Z9FA 4EGVA 1VDZA 2ICEC 5M5YH 4A3MG 4BBSB 1OXVA 2UUBQ 3TP7A 1EY4A 3NTKA 3NE5B 4G7OC 1XTCD 1IW7C 4A3JB 4C3IG 1R9TH 3DEPA 1VQ6A 5E3FA 3S15H 3HOYG 1F9PA 3HOUH 4K2KA 1TWFB 4GNXA 4L8JA 3S2HH 3J80c 2UU9L 2MNAA 1EU4A 5BN3A 2YTXA 1K8GA 4IJLA 4A3KB 4NDXA 2F0PA 1ASZA 4LF8L 4KTAA 4FO2A 1EIYB 1F2YA 2AQ2B 3OIQA 4B08A 1NTGA 4PZ7A 4LF5Q 3KK7A 4LK1C 2VW9A 4R8NA 4POGA 4ME5A 4JI6Q 3SHLA 1TWCB 4X3UA 3ITPA 4QUFA 1WD1A 3RMHA 4K8JA 4JPBW 3IAYA 4JI4Q 1JE5A 3V05A 2VB3X 1O80A 3VA7A 2B63H 3AEVA 1LABA 3GTPH 4N9PA 1A63A 1K3RA 2JA8G 3RZDH 4GNXC 3VYSA 3RUZA 4AIMA 5IODA 2F3WA 3BDLA 3Q6SA 5M3MH 3CD6A 4JYAL 2UXDQ 1TWHH 1IHZA 2A69D 5EPKA 2AWOA 3KOJA 1CZWA 1FNWA 1NUCA 3CF5A 3GV3A 2WB1G 3NUCA 1SJHD 1CKNB 3B6YA 2B8GA 5IP9G 2PQEA 5IOCA 3ND9A 1TT2A 2BE5D 1IL2A 4GLXA 5JOBA 1QVFA 1JOKA 4KD4A 4JI5L 5IGFA 1PXUA 4IZ8A 1ZKOA 1HCZA 5C5LA 3UE1A 1EQQA 5IYCG 3VYRA 2A73B 3J81c 3J7A5 4JOIA 1STHA 3ND8A 3KF6A 2ZTCA 3KYHC 2F0QA 1SNMA 4A3BH 2V1CC 1XX8A 5DLQE 1Q8IA 4PZ6A 5KNDA 1PYBA 2XSCA 2HUGA 4ZUJA 1IBML 2OXPA 3E0EA 2F0GA 4PMWA 1L0WA 2R92H 2JN4A 2B2TC 5LL6X 3HOUB 1E2WA 3PF4A 3R2TA 3FHWA 4N8X1 3S2HB 4BY7G 1VQIA 5HURA 2TMPA 2EDGA 4O0AA 1CUKA 3T16A 2F0OA 4NXML 3TN2A 4DV6L 4BBRG 3NWTA 3SK5A 4NB3A 1STYA 3QIAA 5CV6A 2YYZA 4LFAL 2CFMA 3ERQA 1DONA 4FF1A 3BJUA 5J22A 1QUQB 3ZJYC 2MGSA 1F9SA 1UUPA 4JOIC 4K14A 3HG9A 1EYAA 3BDCA 3IKJA 4XXEA 4YHHQ 1G91A 1PYSB 3LWUA 3A54A 1AE2A 2K14A 3HS0C 3J7AV 1B3QA 5EKKA 5JPMC 5CYUA 2B63B 3GTPB 1BCPC 1SDFA 2KJXA 3ULPA 4AYBB 2RF4A 1A8VA 4YCUA 4QCLA 4DR5Q 1KLUD 4O42A 1SE4A 4C3HH 1HNXL 3OIPA 1H9SB 1XTDA 4JI0L 4A3CG 1LTTD 2PYKA 2HCIA 3FDTA 3FKIH 4GOPB 3MAQA 3OMCA 2JSOA 3MVVA 1GUNA 5JJLA 2L0CA 1TWHB 4JI8L 3CMEA 5C44H 5I6YA 1Q1BA 2KOLA 2R7DA 4A3MH 4O1NA 3UDFA 1OTCA 3AU7A 5ISRA 4HR7B 3K7UC 4XTCS 4F8MA 1G2TA 1L1OA 2RSNA 1B44D 2QEXA 5FLXc 4E6IA 5FLXL 1U4MA 4X3TA 3W1GA 4BA2I 2IX1A 1KRSA 2Z8LA 3ICEA 1NAPA 3D0FA 1DJRD 1Q82C 2R7ZB 1UE7A 3S14H 4DR2L 4PG3A 1VQPA 2AUJD 1PRTF 1PH6A 4XDXA 3BZKA 2E2HB 1N34L 4BY1B 2NVYB 1HUMA 1EZ6A 4ABNA 4OL7A 1ILQA 3PIO3 4HIKA 2O4XA 1RCVD 3G6JB 2ZJRA 2XN9C 1GJXA 4LJZC 2ZXPA 3HZXA 2F3VA 3DLLA 4A93B 3NWSA 2VQFQ 4HMJA 5BN4A 2FFKB 4R8IA 1GUTA 3T1YL 3FMCA 1S5FD 2VUMB 1C48A 1PZID 3O13A 1IKMA 3BYTB 4AQYL 1I5FA 3F2DA 1QVCA 1RIPA 3LX0A 4LF4Q 3LWEA 2IPKD 4V0BA 3S1MB 4YWMA 2X6LA 1JICA 3PQIA 4WJWA 5JVH3 3J7ZC 1MSHA 2JE6I 3CQZB 4WFN3 2WV6D 4QUCA 2EXDA 4FF3A 3DEOA 2F1MA 1KAWA 1KDAA 3S1NH 4I7AA 2E5LQ 5FLMG 2AKWB 4DV5Q 2EYPA 4XT3B 2MP1A 4H13C 4KY5A 4B9XA 4OO1G 3NEMA 2KHIA 4DK1A 3K0XA 1UEAB 1ZYRD 4DXGA 3A55A 3RZOH 1VQBA 4P74A 5IIFA 3Q23A 1P8LA 2K05A 4DR7L 3NSWA 3HKZE 5GAEC 4Q0FA 1U4LA 3PIP3 1KABA 2GN5A 2JA6H 5CBAE 4C3HB 3GDEA 1T5EA 1QOHA 1QG7A 3GO5A 5IYCH 3CC2A 5K36G 2HIXA 1CQFA 3GTGH 2AHOB 4YIJA 1SFOH 1W6JA 1HH2P 2OCEA 4QIWB 5C44B 1WVLA 4C1NK 3OYYA 4A3MB 3EN2A 2KA7A 5IYBG 2G5DA 5D3DA 4X64Q 3CCQA 3OPOA 1U0LA 4CJ0B 3S17B 1HR0Q 1X56A 1Y8NB 1I3QB 2UUAQ 1DOKA 1SYFA 3QR8A 3SR1A 3HOYB 4L5RC 1H95A 1JOQA 2ZT9C 1EQTA 2D0PA 1B4OA 4O2DA 3MHBA 3KLSA 1HR0W 2VNUD 5A35A 2F0TA 1CKNA 4N8FA 1VQEA 5T1GA 4JBJA 2EIFA 1B70B 3HOWH 4GKJL 1E0BA 2XGTA 4K5VA 2CWAA 3JAMi 2A69C 2QDBA 3N52A 3R8BA 5DM73 4GKKL 2F0FA 1PVOA 1K0RA 3QOLA 3OWEB 3R93A 3EROA 1PFMA 3F1ZA 2BA0A 1PRTD 1M4VA 3KLSX 2NN6G 3CP0A 4J8QA 5KNBA 4HCSA 4DGZA 4UAIA 2WKCA 5C3WA 2I5LX 3HOXH 1SYDA 4JBKA 1SE2A 4GNXB 1NSNS 2C35B 2JEAI 1BDOA 4KKUA 4GN3B 1C0AA 3A56A 1WYDA 1HNZL 2NBFA 4QIWE 2EQSA 4FNFA 1CFMA 1CSQA 1E3PA 4A3CH 2B29A 2EYHA 2F0IA 4DNTB 2Q2HA 5KGUA 1MI2A 3CRLC 2HCCA 1XNRQ 2EY6A 1X65A 3S1NB 3M9BA 3HOVH 4JVZA 2HIVA 3NTHA 4ZUIA 2CWPA 1SLJA 4EQPA 1NE3A 1Q81C 4IFDH 1WTHA 4IUVA 2K5WA 4R1JA 4DR3Q 1LV9A 3RZOB 2WB1B 3KF8B 3M7GA 2N49A 1V43A 2B2VC 4X6AH 2UUBL 2C9OA 3HOUG 5LL6S 5M5XH 2JA6B 1PH9A 2K28A 5D65A 5ELNA 3BVZA 4XYOA 4C2MH 2D9UA 1HXYD 4B3TQ 4DV4Q 2I46A 5IT9c 1UAPA 5IT9L 2NVQB 3JAMc 4NW2A 3TP8A 3JAML 4GOPA 4BS9A 1GUWA 2NZOA 1N32Q 4QGUA 4LF5L 1AEXA 1X9NA 1WTQA 1EUJA 4JI6L 5EPJA 1LM0A 2B63G 4DAPA 1PH7A 4JI4L 1VMPA 1PTOF 2YV5A 4V190 2MO0A 1BR9A 5CORA 4BBRB 3KF6B 2R93H 5JEAH 3QG1A 2HQEA 2WB1E 2DN8A 3VR2A 2QEJC 3K7AH 3U4VA 3NELA 4CBVA 1VQ7A 4YY3Q 5M3MG 4TQUS 1VQ9A 1SE3A 4NXNQ 4OIKA 1JT8A 1GXDC 4GLAC 4LAAA 3C1EA 2EPBA 3DWQA 2F4IA 1VQJA 1WCMH 1HQMC 1WTWA 5ELEA 3CCMA 3D6CA 2AQ3B 2HQLA 3CW2C 4LUVA 1K8OA 2O5JC 2EE1A 2N3SA 1OXUA 5D3IB 3VA5A 2VQEQ 3GTQH 3OMGA 2SNSA 4XQNA 4JI2Q 3DM1A 1MHWC 3S1QB 3UE0A 1E1TA 3NP8A 3W1BA 5CMDA 1A3UA 1K9MC 1EQVA 2RDHA 4UY8C 4A3EH 3HKZG 3E6ZX 4OX9Q 1BVSA 2KCTA 1F9QA 3S24A 1LTAD 2F0MA 3CMAA 4A3BG 2B2UA 3CCUA 4L63B 1K83H 2RCNA 2EY1A 1V1PB 1M8AA 1DM0B 2A74C 1CHQD 2IX0A 2QW7A 3J80i 3D4RA 1VQKA 4Y7NH 2V4DA 2R92G 1LACA 4L5SA 3I8ZA 2LSSA 1HFGA 4B3SQ 2CQOA 5HGTA 4DAYB 5M5XB 2YU9H 1YJ9A 2PW5A 5FLXE 2WIIB 3IRBA 1TU2B 2LMCB 4C2MB 1YEZA 2NVTB 3ERSX 1A6XA 1PHJA 5FO9B 1J5EQ 4QJFA 1SE8A 1ZYRC 5KRUA 3A5ZB 1STEA 2B3GA 2YTYA 3OTOQ 2L5TA 3BG3A 1HZBA 2PNHA 2B2UC 4IUNA 3QWNA 1EIGA 1XNQQ 4YHHL 3VYTA 1O78A 4IJHA 4K6DA 4DAVA 2K32A 1EOVA 4CDDC 1EY0A 5C0XJ 2WKDA 2B2YC 5ELDA 2IJ0A 1SAPA 1U4RA 2RHSB 4LFCQ 3M4OH 5CV5A 5HGQA 1SXTA 3CPWA 4DR5L 4HSPA 4DFAA 3FKIG 4LUOA 2ZTDA 1TWGB 3GTMH 3K7AB 4CKCA 5NUCA 5JPNC 4KJOA 2K7VA 4OWTB 3URYA 2IW3A 3PO2H 3CCSA 4JV5Q 5C3EG 1ENAA 1ICFB 1L0YB 4R4OA 4RKLA 5C4HA 3FEWX 2A1AA 1EWCA 2OQ0A 5I2XA 3RNUA 4HJ7A 1WTRA 4ID6A 1E2ZA 3DWAA 2XIWA 3A8JE 1VQNA 3J81i 3J80L 3T1HQ 1J9OA 1F77A 1HA5A 4DU9A 1P16A 1PRTC 3VDYA 4HJ5A 4JI7Q 4RGNA 3T56B 2IY5B 4F87A 5L37A 3MC0B 2KQ3A 4KMUC 2JA7H 3CXCA 2E2DC 2RA4A 5A2QL 1KIXA 5ELCA 1K83B 1LTRD 1JWMD 1S5CD 2D2CC 1LTLA 1N36Q 3X3NA 2KCMA 1UE6A 2VQFL 4Y7NB 4A3LH 4A3DH 2BH8A 3BVMA 4F88A 1TQOA 2DY8A 1S40A 1YITA 3KF8A 3A74A 3W3AA 3H3VI 1X3PA 2YU9B 5M9OA 1E22A 1V8QA 1CI3M 3NHHA 4LF4L 2QILA 2EJFC 2FHTA 1VQGA 4B3ML 1CZGA 3K5MA 4IPGA 4G4KA 2R7FA 3S16B 4JI1Q 3I3CA 1G6PA 4J6HA 5DEHA 4AH6A 4PMBA 2ZJQA 3CC4A 3H6MA 2WFWA 1N9WA 1D1KA 2NVXH 3P75A 2E5LL 1YI2A 4DV5L 3AB9A 4OONA 1MKHA 2ZXRA 2J4XA 2F4VQ 4RGMA 3K80C 2B2TA 4MIUA 1EY7A 2WP8J 1SROA 2ZTEA 3KBXA 3PO3H 2JA6G 3IFTA 1U9RA 5LMNQ 1U4PA 1HNWQ 1AFPA 4OXPA 4TSSA 4ODGA 1JE4A 5CV4A 5K5PA 4G7ZC 5M3FH 2QDLA 3GTMB 5EKLA 3J81L 5LMNW 3AFQA 1Y69U 2R3ZA 1ICWA 2DGYA 5TSSA 1GKHA 3MZ5A 2K04A 5M5YB 1TS4A 3GTJH 2K33A 3DM3A 4RAUC 1R9TB 2OEOA 5CR3A 1G51A 4A75A 1SMXA 2Q2IA 4GS3A 2XTIA 3F2BA 3S2DH 4X64L 5GADC 3S15B 4DF7A 2NYZD 2PNRC 1HR0L 2UUAL 3CKIB 3PUYA 2F0VA 5DNFA 1G6ZA 4HJ9A 2E8GA 1S3OA 5EGTA 1YNNC 5IGBA 3HOWG 2K5HA 1OO9B 3BYYB 3NTIA 2CCZA 2JA5H 2CQAA 2F3IA 3SK6A 1ZEQX 4HIMA 3EQLC 1FVIA 1Y1VG 2FXQA 2CH4W 2XRSD 5IT9E 3EFXD 4ZK9B 3JAME 3HOXG 1I4QA 1CQVA 4DV1Q 3HRZC 4A3DB 4DV0Q 3E9IA 3PUVA 1V1PA 4MHEA 2IX3A 3CC7A 1V1OA 3FRPB 3TS2A 3U58A 3RZDB 2I0QA 2JXMB 3M85A 4OEMB 4IUQA 1PA6A 1VQCA 4DAYA 1B3AA 1SNPA 1UEBA 5C5MA 1Q8KA 2ASBA 1HFNA 5KYLA 3RLNA 5M3MB 4DUYQ 3HOVG 1XNRL 4PZ8A 3VR4A 3A5UA 3L2PA 1SYGA 3K5OA 3G4SA 2EY5A 4IFDG 5C3EH 4DR6Q 1VS0A 3DUZA 4C56C 4HJ8A 4DKAC 2E2IH 4DR3L 1TR5A 1GVPA 1VQ5A 1EU3A 4X66Q 1HZAA 3OHXC 1M90C 5IGEA 5HY6A 4RA8A 3BU2A 2GVAA 1I50H 3HGBA 1IYUA 3RD4A 4C1NI 4X62Q 3Q0AA 4R4IA 4CKBA 2M9VA 3U4ZA 1EWIA 1X54A 2GA4B 1LTID 5FJ8H 5M3FB 3SDZA 2Z9HA 3W2DA 3HKZB 3PUWA 2A6HD 1CA6A 4YCWA 2JQOA 4H44C 4A3BB 4B3TL 2Z6KA 5EJWA 4DV4L 3RN2A 1PFSA 1W3SA 2K01A 5JJIA 4LW1A 3DXJC 1B7YB 2KCCA 2A6ED 4ZCKA 2SNMA 4DA2A 1STAA 4MZ9A 2BDOA 1Y14B 2F0KA 1N32L 4RCNA 4IPCA 2R92B 2EXZA 1LLRD 3GQBA 5EAYA 3QO2A 2L11A 5EBCA 2VS1A 1ET6A 1CM9A 3HP3A 3K0YA 4QMGA 4L5QA 1IKLA 2D62A 1EYCA 2R93G
chains in the Genus database with same CATH topology
2UUBL 1Y1WG 3TEHB 1YHBA 5JEAG 2IHEA 4J15A 1KRTA 1GM5A 3AFPA 4K0KL 3OW2A 4A3FH 3HOUG 1L1OB 3ER0A 5M5XH 1PH9A 4LF9Q 2E2HH 2KHJA 1ASYA 4IOCA 2NVYH 4BY1H 1BKBA 3CCLA 1N8RC 5ELNA 1I6HH 2Z6KC 4YY3L 3K81C 4DR1L 4DR4Q 4C2MH 2K75A 4NXNL 2Q2UA 3HOZG 1HNZQ 1FGUA 1WCMG 1A62A 2UUCL 4B3TQ 4A93H 4A3GH 1WI5A 4DV4Q 1YJNA 3I4NG 4EQ5A 1FJGQ 5IT9c 2K4KA 5IYDG 3JAMc 2KENA 3PV0A 4GOPA 4JG2A 4X65L 4LF6L 4DUZL 2H5XA 2VUMH 3UDXA 1VCIA 2NZOA 1VQFA 3FP9A 3L7ZC 5IWAQ 1A0IA 4QGUA 1YJWA 1NJIC 4LF5L 1N32Q 2L15A 3PUZA 3CCEA 3I4OA 1YZ6A 4A3IG 1BBWA 1RL2A 2Y0SG 1X9NA 4WJ3M 3D31A 1EUJA 3LGJA 4DPGA 3H15A 4JI6L 3S1MH 1KHIA 1N33Q 1AH9A 2I5HA 2BA1A 5C4XG 1U5KA 3GTLH 4YCVA 2VQEL 1LUZA 4BA1I 1LM0A 5C44G 2GVBA 1QZHA 4JI2L 4A3EG 2B63G 1Z9FA 4QY7A 1PH7A 4JI4L 3CQZH 5M5YH 4A3MG 2YV5A 4R4TA 1OXVA 2UUBQ 2MO0A 2N8NA 3AYHB 3KF6B 4DV2L 1VQAA 1R9TH 4OX9L 1EQRA 2F52A 1VQ6A 2R93H 3I56A 3E9HA 1Y1WH 3S15H 3HOYG 2WB1E 1XMQL 3HOUH 3K7AH 3U4VA 1HZCA 3NELA 4XIGS 3S2HH 1VQ7A 4YY3Q 5M3MG 4GNXA 4TQUS 3MXNB 4DR1Q 1IBKL 1VQ9A 1YNXA 2K5NA 3J80c 3TREA 2UU9L 2MNAA 4GLAC 2UUCQ 3HKSA 1JT8A 4BXXG 2YTXA 3RR5A 1FL0A 2NZHA 1K8GA 1D8LA 4IJLA 1VQJA 1ASZA 1WCMH 4KHZA 1JJ2A 4LF8L 1OXTA 1J6QA 3STBD 1LYLA 4X65Q 4LF6Q 4DUZQ 3I4NH 1EIYB 3CCMA 1NTGA 1X55A 4PZ7A 5IYDH 4FDBA 4LF5Q 4LUVA 2HQLA 3CW2C 2VW9A 1XPOA 4POGA 2VZAA 4JI6Q 2N3SA 1OXUA 3WWVA 2VQEQ 1SR3A 1J5EL 3GTQH 2PI2E 4JI2Q 2IHFA 1PH3A 1Y1VH 4LNQA 3UE0A 1X3EA 4JI4Q 1E1TA 2MFIA 3W1BA 1JE5A 5C4XH 3OTOL 1DGSA 4UP9A 4LFAQ 1K9MC 2LXJA 4A3EH 3HKZG 4UY8C 2B63H 3AEVA 3GTPH 4C3JH 3I4MG 4DV2Q 4OX9Q 4JCVE 1BVSA 2KCTA 4A75A 1A63A 4HIDA 2WAQE 3S24A 3CMAA 1K3RA 1L2FA 3CCUA 2JA8G 3RZDH 4RMFA 4GNXC 1XMQQ 4A3BG 4C3IH 1K83H 1XNQL 3PCOB 2RCNA 3S17H 1E24A 1I3QH 4AIMA 3HOYH 3PGZA 2DUDA 1AE3A 3MEFA 1VQ4A 2UU9Q 2IX0A 1SN8A 2MQHA 1TWAH 5M3MH 3J80i 3CD6A 3NBHB 1VQKA 4JYAL 4Y7NH 2UXDQ 4DV7L 2R92G 1TWHH 4LF8Q 4BXXH 4L5SA 4B3SQ 2LSSA 4LFCL 5GAGC 2CQOA 4HJAA 1V9PA 2AWOA 3KOJA 4DAYB 1Q12A 2YU9H 2JK8A 2QGQA 1GD7A 3CF5A 3NENA 1YJ9A 3M3YH 2WB1G 2PMZE 3IRBA 1CKNB 3B6YA 1YEZA 1GO3E 3PO2G 3ERSX 3KJOA 5IP9G 1K73C 1PHJA 1J5EQ 4QJFA 1SE8A 3ULJA 1IL2A 3AQQA 1EYGA 3A5ZB 4TVAB 4AYBE 4GLXA 2VL6A 4JV5L 5C0XG 2B3GA 3PF5A 1QVFA 2YTYA 3OTOQ 2K50A 3KLWA 1HZBA 4JI5L 2ZM6L 3G6EA 2PNHA 3G71A 4BA2I 3UE1A 5H1SE 1EQQA 2UXBL 5C0XI 5IYCG 4NPSA 1L1OC 4LUZA 3J81c 3J7A5 3KDFB 4JOIA 1XNQQ 2AWNA 3KF6A 2ZTCA 3KYHC 4YHHL 4B3MQ 1XPUA 4IJHA 3T1HL 2JA8H 4A3BH 2V1CC 2YTVA 1EOVA 5C0XJ 3HFZB 5DLQE 4PZ6A 2MO1A 4JI7L 1PYBA 2JA7G 4JYAQ 1X3FA 4GLVB 4DV7Q 1OXXK 2JEBI 4DK3C 2RHSB 4H02A 1IBML 3E0EA 3M4PA 4P75A 4LFCQ 3M4OH 4PMWA 5HGQA 1BBUA 3CPWA 4DR5L 1L0WA 1C9OA 4P72A 3FKIG 4LUOA 2R92H 2ZTDA 3GTMH 1WJJA 3TQYA 3PF4A 1N36L 3FHWA 5IE8A 4BY7G 4A3LG 1VQIA 4A3DG 3UDGA 4O0AA 4OWTB 1CUKA 1PH1A 4BBSG 4HIOA 4NXML 4OO1I 5LMUL 4DV6L 4BBRG 1YIJA 3J81j 4A3JG 4NB3A 3PO2H 3CCSA 4JV5Q 5C3EG 2YYZA 5IP9H 4LFAL 2CFMA 4R4OA 2K52A 4P73A 3BJUA 3K8AA 4MNOA 3CPFA 2ZM6Q 4JI5Q 3KFUA 1UE5A 2A1AA 1QUQB 2OQ0A 3ZJYC 2UXBQ 4JOIC 4Y52H 3RNUA 4HJ7A 1PH8A 5M5WH 5BR8L 4DAMA 4KLKA 1VQDA 4IO9A 1VQNA 1NBWA 4YHHQ 4A3KG 1XJVA 5JJKA 3S1NH 3J81i 1PYSB 1W2BA 3T1HQ 4JI1L 2BH2A 3CCVA 1AE2A 2K14A 4A4IA 1PH4A 1HJPA 1P16A 1YVCA 2JJQA 3A0JA 4HJ5A 3VDYA 4JI7Q 2PQAB 3HOZH 2UXDL 2QA4A 2NVQH 4B3SL 2IY5B 1IBMQ 1CSPA 1VQMA 4DK6C 3ULPA 2JA7H 3CXCA 2E2JH 2RF4A 3JC66 1A8VA 4YCUA 4DR5Q 1XMOL 1KIXA 2F4VL 4C3HH 1HNXL 1IXRA 1XTDA 3Q8DA 4JI0L 4A3CG 1LTLA 1N36Q 3FKIH 4IPDA 3CAMA 4GOPB 3PO3G 2CKZB 2KCMA 4A3IH 1UE6A 2VQFL 2OQKA 5JJLA 4GN5A 2Q2TA 3L0OA 4NXMQ 5LMUQ 4DV6Q 3RN5A 1Q86C 4BY7H 4A3LH 4A3DH 2BH8A 4JI8L 3CMEA 5M3FG 4DV3L 4BBSH 5C44H 2N78A 4UP7A 5LMNL 1S40A 1HNWL 1YITA 3A74A 4BBRH 1Q1BA 2R7DA 3I55A 4A3JH 1CKOA 4A3MH 3H3VI 3UDFA 1UWVA 1E22A 1OTCA 4LF4L 3K7UC 4XTCS 1X3GA 5BR8Q 1KXLA 1OXSC 1VQGA 1L1OA 4B3ML 4YWLA 2QEXA 4OWXB 4IFDI 4IPGA 5FLXc 1T9HA 1O7IA 4POFA 2R7FA 4JI1Q 3PIOA 3W1GA 4AH6A 1G6PA 2JA9A 3BZCA 1KRSA 4A3KH 1YHAA 2IX1A 3H0GG 3D0FA 2K5VA 1Q82C 2ZJQA 1UE7A 3ICEA 3S14H 3CC4A 4DR2L 4PG3A 1VQPA 2VY3A 2WFWA 1N9WA 1PH6A 2E5LQ 3S1RH 3F2CA 2NVXH 3BZKA 2E5LL 1HZ9A 1YI2A 4DV5L 4OONA 1N34L 4OWWB 1XMOQ 1MKHA 2Y0SE 1IBLL 4A3GG 2F4VQ 1HNXQ 2PI2A 4IPHA 4HIKA 1XPRA 3K80C 4JI0Q 3M4QA 2ZJRA 2ZJPA 1TWCH 3DLLA 1IYJB 2VQFQ 3M7NA 1S72A 2ID0A 2WP8J 1SRUA 1SROA 3S1QH 2ZTEA 3T1YL 1X6OA 2JA5G 2JA6G 3PO3H 4JI8Q 4DV3Q 4RG1A 2Z0SA 5LMNQ 4A76A 1HNWQ 4OXPA 4EX5A 1JJGA 1NMGA 4AQYL 4ALPA 1I5FA 3F2DA 5M3FH 1QVCA 2HT1A 1RIPA 5AJ3L 4LF4Q 5LMNW 3AFQA 3EIVA 4YWMA 3I4MH 2DGYA 1VQHA 1GKHA 2ATWA 1QUQA 2LXKA 3J7ZC 1KD1C 1D7QA 4DV1L 4DNIA 2JE6I 4R4QA 2R6GA 3GTJH 4UP8A 1Q1EA 4DV0L 1YBYA 1C7YA 2EXDA 5GAHC 1NY4A 3DM3A 4DR2Q 1JMCA 4KHPL 1PH5A 1MJEA 1KAWA 1G51A 5GQOA 3H0GH 1SMXA 2Q2IA 4GS3A 2XTIA 1EIFA 3I2ZA 1Q46A 4X64L 5GADC 2PQAA 2AKWB 5FLMG 4DV5Q 2WAQG 1QZGA 1N34Q 3GTKH 1IBLQ 4LWCA 1V43A 1HR0L 2I5MX 2UUAL 4OO1G 3PUYA 3PIPA 3NEMA 1JB7A 2KHIA 2NVTH 3K0XA 3RLOA 4HJ9A 2OTJA 3RZOH 1VQBA 2E8GA 4P74A 1S3OA 1P8LA 5JEAJ 5IY0A 3HOWG 2RHQB 4DUYL 4DR7L 3F2BA 2K5HA 3T1YQ 1WOCA 4JBWA 3S2DH 3HKZE 5GAEC 2OTLA 2IT1A 4L5TA 3STBC 1I94L 2CCZA 2JA5H 4DR6L 2GN5A 2JA6H 4P71A 2F3IA 4AQYQ 1QVGA 4JI3L 4HIMA 3GDEA 1TXYA 5AJ3Q 2AMCB 1NMFA 1FVIA 1KQSA 1Y1VG 2FXQA 1V1QA 3GO5A 5IYCH 3CC2A 2UXCL 2HIXA 3RLFA 4X66L 5K36G 4LFBL 3GTGH 2AHOB 3HOXG 1SFOH 3PUXA 4APVA 1MIUA 4DV1Q 2KBNA 1HH2P 2OCEA 4AYBG 4X62L 3E9IA 3PUVA 4MTNA 5FJ8G 4DV0Q 1YHQA 3OYYA 4KHPQ 4K0KQ 3TRZA 4KI0A 3CC7A 1PV4A 3EN2A 5IYBG 4UPAA 4B3RL 4X64Q 4GN4B 3CCQA 1TWGH 3U58A 3TS2A 2I0QA 1KC8C 1UE1A 1U0LA 3M85A 3PSIA 1HR0Q 1X56A 1PA6A 2UUAQ 1EFWA 1VQCA 1VQLA 1UEBA 1E1OA 5FLMH 4L5RC 1Q8KA 5C4JH 2ASBA 1H95A 3UDIA 4O2DA 2D0PA 4ME3A 3RLNA 1HR0W 4GOPC 1E7ZA 2VNUD 1CKNA 4DUYQ 1VQEA 3HOVG 4JBJA 4DR7Q 2EIFA 1XNRL 4PZ8A 3A5UA 3L2PA 1B70B 2ES2A 3HOWH 4GKJL 2XGTA 3G4SA 2CWAA 5IP7G 3JAMi 1I94Q 3GTOH 4IFDG 5C3EH 4DR6Q 1Q7YC 1VS0A 2OWOA 4LF7L 4QL5A 2A8VA 4GKKL 4HJ8A 1M1KC 4JI3Q 2HHHL 1KL9A 1PVOA 1K0RA 3F8TA 4DKAC 1TWFH 3CCJA 2E2IH 4DR3L 4JBMA 2UXCQ 2R7ZG 1GVPA 1VQ5A 4X66Q 3F1ZA 4LFBQ 2BA0A 1HZAA 1CKMA 3W5OA 3SGIA 3KDFA 1M90C 4A3FG 2NN6G 3CP0A 5HY6A 3BU2A 2GVAA 1I50H 2I5LX 4BY1G 4X62Q 3HOXH 4IFDJ 3U50C 4R4IA 4JBKA 5GROA 2NN6I 1VQOA 4GNXB 5J3BA 2C35B 2JEAI 3U4ZA 1EWIA 1X54A 4LF9L 5FJ8H 1PH2A 4B3RQ 2D0OA 4GN3B 3PUWA 1VQ8A 4A93G 1WFQA 1C0AA 3KJPA 5IYBH 4NXNQ 4DR4L 4YCWA 1WYDA 1Z47A 2JQOA 1IBKQ 1HNZL 4QIWE 4B3TL 2Z6KA 2EQSA 4JC0A 4DV4L 1CSQA 1E3PA 3I7FA 3RN2A 4A3CH 1PFSA 1W3SA 2B29A 1FJGL 2VUMG 4LW1A 5JJIA 4YWKA 1B7YB 2Q2HA 1K8AC 1XNRQ 4QQBX 2ALYB 4MZ9A 1Y14B 2A19A 5IWAL 1JJCB 3EBEA 4GKJQ 1N32L 1X65A 4IPCA 3H3VH 3M9BA 3HOVH 4WJ4A 2HIVA 3TS0A 5E7NA 5EAYA 1G291 2CWPA 4LF7Q 4GKKQ 1SLJA 5IP7H 2HHHQ 4IOAA 5ELOA 1NE3A 2VS1A 1Q81C 3ULLA 1N33L 4R4CA 3CCRA 4R1JA 3GD7A 1B8AA 4DR3Q 1MJCA 3G48A 3KF8B 1IZ6A 4L5QA 3S16H 2D62A 2N49A 2R93G 4X6AH 2R7ZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB L;  1Y1W G;  3TEH B;  1YHB A;  5JEA G;  2IHE A;  4J15 A;  1KRT A;  1GM5 A;  3AFP A;  4K0K L;  3OW2 A;  4A3F H;  3HOU G;  1L1O B;  3ER0 A;  5M5X H;  1PH9 A;  4LF9 Q;  2E2H H;  2KHJ A;  1ASY A;  4IOC A;  2NVY H;  4BY1 H;  1BKB A;  3CCL A;  1N8R C;  5ELN A;  1I6H H;  2Z6K C;  4YY3 L;  3K81 C;  4DR1 L;  4DR4 Q;  4C2M H;  2K75 A;  4NXN L;  2Q2U A;  3HOZ G;  1HNZ Q;  1FGU A;  1WCM G;  1A62 A;  2UUC L;  4B3T Q;  4A93 H;  4A3G H;  1WI5 A;  4DV4 Q;  1YJN A;  3I4N G;  4EQ5 A;  1FJG Q;  5IT9 c;  2K4K A;  5IYD G;  3JAM c;  2KEN A;  3PV0 A;  4GOP A;  4JG2 A;  4X65 L;  4LF6 L;  4DUZ L;  2H5X A;  2VUM H;  3UDX A;  1VCI A;  2NZO A;  1VQF A;  3FP9 A;  3L7Z C;  5IWA Q;  1A0I A;  4QGU A;  1YJW A;  1NJI C;  4LF5 L;  1N32 Q;  2L15 A;  3PUZ A;  3CCE A;  3I4O A;  1YZ6 A;  4A3I G;  1BBW A;  1RL2 A;  2Y0S G;  1X9N A;  4WJ3 M;  3D31 A;  1EUJ A;  3LGJ A;  4DPG A;  3H15 A;  4JI6 L;  3S1M H;  1KHI A;  1N33 Q;  1AH9 A;  2I5H A;  2BA1 A;  5C4X G;  1U5K A;  3GTL H;  4YCV A;  2VQE L;  1LUZ A;  4BA1 I;  1LM0 A;  5C44 G;  2GVB A;  1QZH A;  4JI2 L;  4A3E G;  2B63 G;  1Z9F A;  4QY7 A;  1PH7 A;  4JI4 L;  3CQZ H;  5M5Y H;  4A3M G;  2YV5 A;  4R4T A;  1OXV A;  2UUB Q;  2MO0 A;  2N8N A;  3AYH B;  3KF6 B;  4DV2 L;  1VQA A;  1R9T H;  4OX9 L;  1EQR A;  2F52 A;  1VQ6 A;  2R93 H;  3I56 A;  3E9H A;  1Y1W H;  3S15 H;  3HOY G;  2WB1 E;  1XMQ L;  3HOU H;  3K7A H;  3U4V A;  1HZC A;  3NEL A;  4XIG S;  3S2H H;  1VQ7 A;  4YY3 Q;  5M3M G;  4GNX A;  4TQU S;  3MXN B;  4DR1 Q;  1IBK L;  1VQ9 A;  1YNX A;  2K5N A;  3J80 c;  3TRE A;  2UU9 L;  2MNA A;  4GLA C;  2UUC Q;  3HKS A;  1JT8 A;  4BXX G;  2YTX A;  3RR5 A;  1FL0 A;  2NZH A;  1K8G A;  1D8L A;  4IJL A;  1VQJ A;  1ASZ A;  1WCM H;  4KHZ A;  1JJ2 A;  4LF8 L;  1OXT A;  1J6Q A;  3STB D;  1LYL A;  4X65 Q;  4LF6 Q;  4DUZ Q;  3I4N H;  1EIY B;  3CCM A;  1NTG A;  1X55 A;  4PZ7 A;  5IYD H;  4FDB A;  4LF5 Q;  4LUV A;  2HQL A;  3CW2 C;  2VW9 A;  1XPO A;  4POG A;  2VZA A;  4JI6 Q;  2N3S A;  1OXU A;  3WWV A;  2VQE Q;  1SR3 A;  1J5E L;  3GTQ H;  2PI2 E;  4JI2 Q;  2IHF A;  1PH3 A;  1Y1V H;  4LNQ A;  3UE0 A;  1X3E A;  4JI4 Q;  1E1T A;  2MFI A;  3W1B A;  1JE5 A;  5C4X H;  3OTO L;  1DGS A;  4UP9 A;  4LFA Q;  1K9M C;  2LXJ A;  4A3E H;  3HKZ G;  4UY8 C;  2B63 H;  3AEV A;  3GTP H;  4C3J H;  3I4M G;  4DV2 Q;  4OX9 Q;  4JCV E;  1BVS A;  2KCT A;  4A75 A;  1A63 A;  4HID A;  2WAQ E;  3S24 A;  3CMA A;  1K3R A;  1L2F A;  3CCU A;  2JA8 G;  3RZD H;  4RMF A;  4GNX C;  1XMQ Q;  4A3B G;  4C3I H;  1K83 H;  1XNQ L;  3PCO B;  2RCN A;  3S17 H;  1E24 A;  1I3Q H;  4AIM A;  3HOY H;  3PGZ A;  2DUD A;  1AE3 A;  3MEF A;  1VQ4 A;  2UU9 Q;  2IX0 A;  1SN8 A;  2MQH A;  1TWA H;  5M3M H;  3J80 i;  3CD6 A;  3NBH B;  1VQK A;  4JYA L;  4Y7N H;  2UXD Q;  4DV7 L;  2R92 G;  1TWH H;  4LF8 Q;  4BXX H;  4L5S A;  4B3S Q;  2LSS A;  4LFC L;  5GAG C;  2CQO A;  4HJA A;  1V9P A;  2AWO A;  3KOJ A;  4DAY B;  1Q12 A;  2YU9 H;  2JK8 A;  2QGQ A;  1GD7 A;  3CF5 A;  3NEN A;  1YJ9 A;  3M3Y H;  2WB1 G;  2PMZ E;  3IRB A;  1CKN B;  3B6Y A;  1YEZ A;  1GO3 E;  3PO2 G;  3ERS X;  3KJO A;  5IP9 G;  1K73 C;  1PHJ A;  1J5E Q;  4QJF A;  1SE8 A;  3ULJ A;  1IL2 A;  3AQQ A;  1EYG A;  3A5Z B;  4TVA B;  4AYB E;  4GLX A;  2VL6 A;  4JV5 L;  5C0X G;  2B3G A;  3PF5 A;  1QVF A;  2YTY A;  3OTO Q;  2K50 A;  3KLW A;  1HZB A;  4JI5 L;  2ZM6 L;  3G6E A;  2PNH A;  3G71 A;  4BA2 I;  3UE1 A;  5H1S E;  1EQQ A;  2UXB L;  5C0X I;  5IYC G;  4NPS A;  1L1O C;  4LUZ A;  3J81 c;  3J7A 5;  3KDF B;  4JOI A;  1XNQ Q;  2AWN A;  3KF6 A;  2ZTC A;  3KYH C;  4YHH L;  4B3M Q;  1XPU A;  4IJH A;  3T1H L;  2JA8 H;  4A3B H;  2V1C C;  2YTV A;  1EOV A;  5C0X J;  3HFZ B;  5DLQ E;  4PZ6 A;  2MO1 A;  4JI7 L;  1PYB A;  2JA7 G;  4JYA Q;  1X3F A;  4GLV B;  4DV7 Q;  1OXX K;  2JEB I;  4DK3 C;  2RHS B;  4H02 A;  1IBM L;  3E0E A;  3M4P A;  4P75 A;  4LFC Q;  3M4O H;  4PMW A;  5HGQ A;  1BBU A;  3CPW A;  4DR5 L;  1L0W A;  1C9O A;  4P72 A;  3FKI G;  4LUO A;  2R92 H;  2ZTD A;  3GTM H;  1WJJ A;  3TQY A;  3PF4 A;  1N36 L;  3FHW A;  5IE8 A;  4BY7 G;  4A3L G;  1VQI A;  4A3D G;  3UDG A;  4O0A A;  4OWT B;  1CUK A;  1PH1 A;  4BBS G;  4HIO A;  4NXM L;  4OO1 I;  5LMU L;  4DV6 L;  4BBR G;  1YIJ A;  3J81 j;  4A3J G;  4NB3 A;  3PO2 H;  3CCS A;  4JV5 Q;  5C3E G;  2YYZ A;  5IP9 H;  4LFA L;  2CFM A;  4R4O A;  2K52 A;  4P73 A;  3BJU A;  3K8A A;  4MNO A;  3CPF A;  2ZM6 Q;  4JI5 Q;  3KFU A;  1UE5 A;  2A1A A;  1QUQ B;  2OQ0 A;  3ZJY C;  2UXB Q;  4JOI C;  4Y52 H;  3RNU A;  4HJ7 A;  1PH8 A;  5M5W H;  5BR8 L;  4DAM A;  4KLK A;  1VQD A;  4IO9 A;  1VQN A;  1NBW A;  4YHH Q;  4A3K G;  1XJV A;  5JJK A;  3S1N H;  3J81 i;  1PYS B;  1W2B A;  3T1H Q;  4JI1 L;  2BH2 A;  3CCV A;  1AE2 A;  2K14 A;  4A4I A;  1PH4 A;  1HJP A;  1P16 A;  1YVC A;  2JJQ A;  3A0J A;  4HJ5 A;  3VDY A;  4JI7 Q;  2PQA B;  3HOZ H;  2UXD L;  2QA4 A;  2NVQ H;  4B3S L;  2IY5 B;  1IBM Q;  1CSP A;  1VQM A;  4DK6 C;  3ULP A;  2JA7 H;  3CXC A;  2E2J H;  2RF4 A;  3JC6 6;  1A8V A;  4YCU A;  4DR5 Q;  1XMO L;  1KIX A;  2F4V L;  4C3H H;  1HNX L;  1IXR A;  1XTD A;  3Q8D A;  4JI0 L;  4A3C G;  1LTL A;  1N36 Q;  3FKI H;  4IPD A;  3CAM A;  4GOP B;  3PO3 G;  2CKZ B;  2KCM A;  4A3I H;  1UE6 A;  2VQF L;  2OQK A;  5JJL A;  4GN5 A;  2Q2T A;  3L0O A;  4NXM Q;  5LMU Q;  4DV6 Q;  3RN5 A;  1Q86 C;  4BY7 H;  4A3L H;  4A3D H;  2BH8 A;  4JI8 L;  3CME A;  5M3F G;  4DV3 L;  4BBS H;  5C44 H;  2N78 A;  4UP7 A;  5LMN L;  1S40 A;  1HNW L;  1YIT A;  3A74 A;  4BBR H;  1Q1B A;  2R7D A;  3I55 A;  4A3J H;  1CKO A;  4A3M H;  3H3V I;  3UDF A;  1UWV A;  1E22 A;  1OTC A;  4LF4 L;  3K7U C;  4XTC S;  1X3G A;  5BR8 Q;  1KXL A;  1OXS C;  1VQG A;  1L1O A;  4B3M L;  4YWL A;  2QEX A;  4OWX B;  4IFD I;  4IPG A;  5FLX c;  1T9H A;  1O7I A;  4POF A;  2R7F A;  4JI1 Q;  3PIO A;  3W1G A;  4AH6 A;  1G6P A;  2JA9 A;  3BZC A;  1KRS A;  4A3K H;  1YHA A;  2IX1 A;  3H0G G;  3D0F A;  2K5V A;  1Q82 C;  2ZJQ A;  1UE7 A;  3ICE A;  3S14 H;  3CC4 A;  4DR2 L;  4PG3 A;  1VQP A;  2VY3 A;  2WFW A;  1N9W A;  1PH6 A;  2E5L Q;  3S1R H;  3F2C A;  2NVX H;  3BZK A;  2E5L L;  1HZ9 A;  1YI2 A;  4DV5 L;  4OON A;  1N34 L;  4OWW B;  1XMO Q;  1MKH A;  2Y0S E;  1IBL L;  4A3G G;  2F4V Q;  1HNX Q;  2PI2 A;  4IPH A;  4HIK A;  1XPR A;  3K80 C;  4JI0 Q;  3M4Q A;  2ZJR A;  2ZJP A;  1TWC H;  3DLL A;  1IYJ B;  2VQF Q;  3M7N A;  1S72 A;  2ID0 A;  2WP8 J;  1SRU A;  1SRO A;  3S1Q H;  2ZTE A;  3T1Y L;  1X6O A;  2JA5 G;  2JA6 G;  3PO3 H;  4JI8 Q;  4DV3 Q;  4RG1 A;  2Z0S A;  5LMN Q;  4A76 A;  1HNW Q;  4OXP A;  4EX5 A;  1JJG A;  1NMG A;  4AQY L;  4ALP A;  1I5F A;  3F2D A;  5M3F H;  1QVC A;  2HT1 A;  1RIP A;  5AJ3 L;  4LF4 Q;  5LMN W;  3AFQ A;  3EIV A;  4YWM A;  3I4M H;  2DGY A;  1VQH A;  1GKH A;  2ATW A;  1QUQ A;  2LXK A;  3J7Z C;  1KD1 C;  1D7Q A;  4DV1 L;  4DNI A;  2JE6 I;  4R4Q A;  2R6G A;  3GTJ H;  4UP8 A;  1Q1E A;  4DV0 L;  1YBY A;  1C7Y A;  2EXD A;  5GAH C;  1NY4 A;  3DM3 A;  4DR2 Q;  1JMC A;  4KHP L;  1PH5 A;  1MJE A;  1KAW A;  1G51 A;  5GQO A;  3H0G H;  1SMX A;  2Q2I A;  4GS3 A;  2XTI A;  1EIF A;  3I2Z A;  1Q46 A;  4X64 L;  5GAD C;  2PQA A;  2AKW B;  5FLM G;  4DV5 Q;  2WAQ G;  1QZG A;  1N34 Q;  3GTK H;  1IBL Q;  4LWC A;  1V43 A;  1HR0 L;  2I5M X;  2UUA L;  4OO1 G;  3PUY A;  3PIP A;  3NEM A;  1JB7 A;  2KHI A;  2NVT H;  3K0X A;  3RLO A;  4HJ9 A;  2OTJ A;  3RZO H;  1VQB A;  2E8G A;  4P74 A;  1S3O A;  1P8L A;  5JEA J;  5IY0 A;  3HOW G;  2RHQ B;  4DUY L;  4DR7 L;  3F2B A;  2K5H A;  3T1Y Q;  1WOC A;  4JBW A;  3S2D H;  3HKZ E;  5GAE C;  2OTL A;  2IT1 A;  4L5T A;  3STB C;  1I94 L;  2CCZ A;  2JA5 H;  4DR6 L;  2GN5 A;  2JA6 H;  4P71 A;  2F3I A;  4AQY Q;  1QVG A;  4JI3 L;  4HIM A;  3GDE A;  1TXY A;  5AJ3 Q;  2AMC B;  1NMF A;  1FVI A;  1KQS A;  1Y1V G;  2FXQ A;  1V1Q A;  3GO5 A;  5IYC H;  3CC2 A;  2UXC L;  2HIX A;  3RLF A;  4X66 L;  5K36 G;  4LFB L;  3GTG H;  2AHO B;  3HOX G;  1SFO H;  3PUX A;  4APV A;  1MIU A;  4DV1 Q;  2KBN A;  1HH2 P;  2OCE A;  4AYB G;  4X62 L;  3E9I A;  3PUV A;  4MTN A;  5FJ8 G;  4DV0 Q;  1YHQ A;  3OYY A;  4KHP Q;  4K0K Q;  3TRZ A;  4KI0 A;  3CC7 A;  1PV4 A;  3EN2 A;  5IYB G;  4UPA A;  4B3R L;  4X64 Q;  4GN4 B;  3CCQ A;  1TWG H;  3U58 A;  3TS2 A;  2I0Q A;  1KC8 C;  1UE1 A;  1U0L A;  3M85 A;  3PSI A;  1HR0 Q;  1X56 A;  1PA6 A;  2UUA Q;  1EFW A;  1VQC A;  1VQL A;  1UEB A;  1E1O A;  5FLM H;  4L5R C;  1Q8K A;  5C4J H;  2ASB A;  1H95 A;  3UDI A;  4O2D A;  2D0P A;  4ME3 A;  3RLN A;  1HR0 W;  4GOP C;  1E7Z A;  2VNU D;  1CKN A;  4DUY Q;  1VQE A;  3HOV G;  4JBJ A;  4DR7 Q;  2EIF A;  1XNR L;  4PZ8 A;  3A5U A;  3L2P A;  1B70 B;  2ES2 A;  3HOW H;  4GKJ L;  2XGT A;  3G4S A;  2CWA A;  5IP7 G;  3JAM i;  1I94 Q;  3GTO H;  4IFD G;  5C3E H;  4DR6 Q;  1Q7Y C;  1VS0 A;  2OWO A;  4LF7 L;  4QL5 A;  2A8V A;  4GKK L;  4HJ8 A;  1M1K C;  4JI3 Q;  2HHH L;  1KL9 A;  1PVO A;  1K0R A;  3F8T A;  4DKA C;  1TWF H;  3CCJ A;  2E2I H;  4DR3 L;  4JBM A;  2UXC Q;  2R7Z G;  1GVP A;  1VQ5 A;  4X66 Q;  3F1Z A;  4LFB Q;  2BA0 A;  1HZA A;  1CKM A;  3W5O A;  3SGI A;  3KDF A;  1M90 C;  4A3F G;  2NN6 G;  3CP0 A;  5HY6 A;  3BU2 A;  2GVA A;  1I50 H;  2I5L X;  4BY1 G;  4X62 Q;  3HOX H;  4IFD J;  3U50 C;  4R4I A;  4JBK A;  5GRO A;  2NN6 I;  1VQO A;  4GNX B;  5J3B A;  2C35 B;  2JEA I;  3U4Z A;  1EWI A;  1X54 A;  4LF9 L;  5FJ8 H;  1PH2 A;  4B3R Q;  2D0O A;  4GN3 B;  3PUW A;  1VQ8 A;  4A93 G;  1WFQ A;  1C0A A;  3KJP A;  5IYB H;  4NXN Q;  4DR4 L;  4YCW A;  1WYD A;  1Z47 A;  2JQO A;  1IBK Q;  1HNZ L;  4QIW E;  4B3T L;  2Z6K A;  2EQS A;  4JC0 A;  4DV4 L;  1CSQ A;  1E3P A;  3I7F A;  3RN2 A;  4A3C H;  1PFS A;  1W3S A;  2B29 A;  1FJG L;  2VUM G;  4LW1 A;  5JJI A;  4YWK A;  1B7Y B;  2Q2H A;  1K8A C;  1XNR Q;  4QQB X;  2ALY B;  4MZ9 A;  1Y14 B;  2A19 A;  5IWA L;  1JJC B;  3EBE A;  4GKJ Q;  1N32 L;  1X65 A;  4IPC A;  3H3V H;  3M9B A;  3HOV H;  4WJ4 A;  2HIV A;  3TS0 A;  5E7N A;  5EAY A;  1G29 1;  2CWP A;  4LF7 Q;  4GKK Q;  1SLJ A;  5IP7 H;  2HHH Q;  4IOA A;  5ELO A;  1NE3 A;  2VS1 A;  1Q81 C;  3ULL A;  1N33 L;  4R4C A;  3CCR A;  4R1J A;  3GD7 A;  1B8A A;  4DR3 Q;  1MJC A;  3G48 A;  3KF8 B;  1IZ6 A;  4L5Q A;  3S16 H;  2D62 A;  2N49 A;  2R93 G;  4X6A H;  2R7Z H; 
#chains in the Genus database with same CATH topology
 5JEA G;  1YHB A;  1KRT A;  4K0K L;  4A3F H;  1D5X C;  3Q24 A;  2JA5 B;  5FK9 C;  1VF7 A;  4RH6 A;  1GUO A;  5E4X A;  3VYU A;  2XRQ D;  1I6H H;  4R9W A;  1B9M A;  1QNK A;  2Z6K C;  4YY3 L;  4DR4 Q;  3HOZ G;  2Q2U A;  4NXN L;  1WCM G;  1YJN A;  3I4L A;  2KEN A;  3PV0 A;  2F0W A;  1EY8 A;  5CV8 A;  2H5X A;  4K6L A;  1XYI A;  3D4W A;  3TP6 A;  1NJI C;  1VQF A;  5CV9 A;  4KKT A;  1A0I A;  3PUZ A;  5EBD A;  2BCO A;  3TDQ A;  2ZXO A;  1VMC A;  1WTP A;  3FKI B;  1KHI A;  1AH9 A;  2BA1 A;  1BNZ A;  3GTL H;  4YCV A;  2VQE L;  2GVB A;  3PMF A;  4JI2 L;  2B2W C;  4A3E G;  4QY7 A;  5I2Y A;  3BZD B;  3Q22 A;  3ZYY X;  5CC4 A;  2N8N A;  1VQA A;  3FPU B;  4OX9 L;  1NNX A;  2F52 A;  1WTO A;  5C3E B;  3I56 A;  3E9H A;  1Y1W H;  1F2L A;  1HZC A;  2ENB A;  3D3R A;  1IBK L;  4IAL A;  1QJO A;  4DR1 Q;  4GZY C;  1YNX A;  2K5N A;  2KUM A;  1PRT B;  3WDN A;  3RR5 A;  1FL0 A;  1B1Z A;  2NZH A;  1XWE A;  1D8L A;  1JJ2 A;  3S14 B;  1I50 B;  1J6Q A;  3STB D;  3MWY W;  4X65 Q;  4LF6 Q;  4G7H C;  5J1Z A;  2CHB D;  4IN3 A;  3I4N H;  3H09 A;  2X6G A;  1X55 A;  4FDB A;  5I6W A;  4P2C B;  1X32 A;  3IFD A;  3J80 E;  3T4A C;  2A68 D;  1BF4 A;  3P20 A;  2B8F A;  1J5E L;  1DYQ A;  2PI2 E;  3A8K E;  2IHF A;  1PH3 A;  1Y1V H;  1I4R A;  2BE5 C;  2L9H A;  5C4X H;  1IW7 D;  1DCZ A;  3OTO L;  1DGS A;  3DWP A;  4UP9 A;  2Z1C A;  1HTL D;  2B2V A;  4LFA Q;  5A2Q E;  4FP5 D;  2QF7 A;  3I4M G;  4DV2 Q;  1JOR A;  4CJ2 C;  4JCV E;  1RJT A;  2WAQ E;  4KHV A;  1L2F A;  1L0X B;  1XMQ Q;  1XNQ L;  5JJZ A;  1EFI D;  1JC7 A;  4WRD A;  1QB5 D;  2DUD A;  3MEF A;  1VQ4 A;  2MQH A;  4I65 A;  2J0T D;  2PZU A;  4HMI A;  4NKL A;  4BXX H;  1SMY D;  4KN7 C;  4LFC L;  5GAG C;  1TS2 A;  1V9P A;  2F0U A;  3N6R A;  4EQN A;  1Q12 A;  2JK8 A;  4KKS A;  1GD7 A;  3NEN A;  3M3Y H;  2PMZ E;  1TS5 A;  5KYI A;  1DXM A;  3EVQ A;  3PO2 G;  1H9M A;  2XWJ B;  4CGY B;  3P7J A;  3ULJ A;  1EYG A;  4JV5 L;  3PF5 A;  3V96 A;  2K50 A;  3KLW A;  1D6E C;  1II3 A;  5FO8 B;  3KUP A;  1NR2 A;  3D6W A;  5C0X I;  2M00 A;  3R2I A;  2N88 A;  2EJM A;  4NPS A;  3KDF B;  5EKI A;  2AWN A;  5DAU A;  1XPU A;  1B53 A;  4KK7 A;  3T1H L;  3GTG B;  3HEJ A;  2DJF C;  1SFO B;  3SK4 A;  1CT1 D;  3HFZ B;  1A3V A;  1EIH A;  2MO1 A;  4JI7 L;  2F0N A;  2JA7 G;  1X3F A;  2E76 C;  4DV7 Q;  1OXX K;  2K1B A;  4P75 A;  3J7A F;  5CGK A;  3J81 E;  1BBU A;  1EEF D;  2G9D A;  4P72 A;  1STN A;  4K5X A;  1DOM A;  1WJJ A;  1SJE D;  1PTO H;  3TQY A;  1N36 L;  2K6A A;  5IE8 A;  4A3L G;  4A3D G;  4NP5 A;  3UDG A;  4HIO A;  4OO1 I;  3I91 A;  1YIJ A;  5CV7 A;  1ESF A;  1I4H A;  3L3O C;  2KEE A;  1SNQ A;  3HOW B;  3KFU A;  4MNO A;  3A7L A;  1JB3 A;  2ZM6 Q;  1GHK A;  1UE5 A;  2QKI C;  4CDC C;  2UXB Q;  4H0L C;  5JAV A;  2BOS A;  2DNE A;  2CVR A;  5M5W H;  2PO4 A;  2PPB C;  1W6K A;  4IO9 A;  1NBW A;  1XJV A;  3VR6 A;  4XQJ A;  4JI1 L;  2BH2 A;  1Y1V B;  2HDM A;  1PH4 A;  2JJQ A;  3HOZ H;  1YVC A;  1BCP B;  2UXD L;  2RBM A;  2QA4 A;  1HTP A;  3HOX B;  4M1U B;  1VQM A;  5C3X A;  2HD3 A;  2F4V L;  3NK9 A;  1IXR A;  1LT3 D;  1KDC A;  3MXU A;  2A6H C;  4IPD A;  3PO3 G;  2CKZ B;  4BWG B;  2K5D A;  2EY2 A;  5LMU Q;  2Q8I B;  5EQ0 A;  5C4Z A;  5M3F G;  4BBS H;  2A6E C;  3P1H A;  5LMN L;  1HNW L;  4A3J H;  1PMR A;  3I55 A;  1HA6 A;  4OGQ C;  3HOV B;  1UWV A;  1SND A;  3M3Y B;  3H3V C;  5BR8 Q;  1KXL A;  2ICI A;  3OW7 A;  3NQI A;  4YWL A;  4OWX B;  1GUG A;  1T9H A;  1F2Z A;  5BN5 A;  4POF A;  4HSV A;  2JA9 A;  4A3K H;  1YHA A;  2B2Y A;  2C5C A;  2VY3 A;  1MGS A;  5I9O A;  1ENC A;  3S1R H;  2CW0 D;  1HZ9 A;  4OWW B;  1XMO Q;  2Y0S E;  4H7B A;  4A3G G;  2PI2 A;  3M4Q A;  2ZJP A;  3GP7 A;  1TWC H;  3AMU A;  1Q90 A;  1DZ1 A;  1S72 A;  1PZK D;  4PMC A;  1Y8P B;  2JA5 G;  1X6O A;  3R3O A;  5I4D A;  4HAE A;  4DV3 Q;  2Z0S A;  4A76 A;  2EYL A;  3MFG A;  4EX5 A;  1JJG A;  3CU7 A;  1A15 A;  3EIV A;  1JQY D;  5IGD A;  3I4M H;  2ATW A;  3WOE A;  2RVL A;  3WOF A;  2LXK A;  1PDQ A;  1KD1 C;  1D7Q A;  4DV1 L;  4R4Q A;  4CDE C;  1QIL A;  4X3S A;  1Q1E A;  4DV0 L;  1NY4 A;  3KLR A;  4IUP A;  1ET9 A;  5FO7 B;  1MJE A;  5GQO A;  3H0G H;  2R93 B;  3RN5 A;  1EIF A;  4PQX A;  1Q46 A;  2PQA A;  3GTK H;  2WAQ G;  3I70 A;  4ZKB B;  3EJI A;  1QZG A;  1IBL Q;  1SYE A;  4LWC A;  2E74 C;  2O5I C;  3BS1 A;  1PTO D;  3TP5 A;  1QNU A;  1EOT A;  1PFN A;  4KY6 A;  5JEA J;  2RHQ B;  3HOZ B;  4DUY L;  1WCM B;  2N55 A;  1T5X D;  1GOZ A;  1WOC A;  2FJ2 A;  4JBW A;  2OTL A;  2IT1 A;  4KV6 A;  4KJN A;  3STB C;  4DR6 L;  1TXY A;  5AJ3 Q;  3KBG A;  2L4N A;  5E4W C;  2F03 A;  1V1Q A;  3CRK C;  4PV1 C;  3TZU A;  4X66 L;  2A68 C;  3BDO A;  1LT4 D;  3GTQ B;  1S5E D;  4C3J G;  4OIJ A;  2QCP X;  3SE0 A;  4MTN A;  4X62 L;  5FJ8 G;  4A3E B;  1YHQ A;  4KHP Q;  2KCN A;  3L9A X;  4KI0 A;  1PV4 A;  2NUC A;  1S4Z A;  2DY7 A;  4GN4 B;  4NMZ A;  5DM6 3;  1KC8 C;  3PSI A;  1Y8O B;  5D14 A;  1EFW A;  1VQL A;  1E1O A;  3TBI B;  3D8G A;  3MFY A;  2H1E A;  1A3T A;  2NTS A;  4ME3 A;  2KHS A;  2MUY A;  5J39 A;  1Z6H A;  2IWH A;  2ES2 A;  1EEI D;  1QCB D;  3C3L A;  2FMC A;  3S1R B;  1SMY C;  5KIX A;  4IUT A;  1I94 Q;  3GTO H;  1RF2 D;  4ZKC B;  3GV6 A;  2OWO A;  1PFB A;  2A8V A;  4QL5 A;  1ZXT A;  1M1K C;  4JI3 Q;  1KL9 A;  4JBM A;  2UXC Q;  1Z7T A;  2FMM A;  2RCF A;  4LFB Q;  1CKM A;  3QJY A;  3KDF A;  1I4P A;  1JOO A;  4A3F G;  3V2T A;  2WAC A;  1CK1 A;  1JWS D;  3FPP A;  3T51 B;  3K58 A;  1SEB D;  1FGB D;  3U50 C;  2RDG A;  3NQT A;  4JW0 A;  5J3B A;  2RDF A;  1PH2 A;  1EYD A;  4JK1 C;  4B3R Q;  2D0O A;  3MA2 B;  1FR3 A;  1WFQ A;  3I4M B;  4L6T B;  3KJP A;  3T13 A;  4DR4 L;  1Z47 A;  2I07 B;  2AQ1 B;  4ZYS A;  1RHP A;  1YNJ D;  4JC0 A;  2H4O A;  3OOC A;  4S3S A;  1HHV A;  4YWK A;  1K8A C;  2JP1 A;  2NB0 A;  4XYQ A;  3M4O B;  1JJC B;  3EBE A;  3H0G B;  3H3V H;  1AZP A;  4RWS C;  4WJ4 A;  3GTK B;  4ULL A;  2EYJ A;  4LF7 Q;  2XWB B;  5IP7 H;  2HHH Q;  4IOA A;  4FYD A;  4ZQ3 A;  3CHB D;  3ULL A;  3CCR A;  1MJC A;  3G7L A;  3G48 A;  1IZ6 A;  3DMU A;  2MPM A;  3TSS A;  3PO2 B;  4HJA A;  2R7Z H;  1Y1W G;  2IHE A;  4J15 A;  3AFP A;  1B50 A;  3OW2 A;  3MXG A;  4X3K A;  4EVO A;  4LF9 Q;  2E2H H;  2KHJ A;  4IOC A;  2NVY H;  4BY1 H;  1BKB A;  3CCL A;  4DR1 L;  2K75 A;  1FGU A;  4A93 H;  4HN7 A;  4A3G H;  1WI5 A;  3I4N G;  1FJG Q;  1CA5 A;  4JG2 A;  4X65 L;  2P5Z X;  4LF6 L;  2KED A;  2VUM H;  3UDX A;  4RHS A;  2JA7 B;  1VCI A;  5IWA Q;  3L7Z C;  1STG A;  2DJG C;  3CCE A;  4A3I G;  2Y0S G;  1LO5 D;  3H15 A;  3LGJ A;  4DPG A;  3S1M H;  3M4Y A;  1N33 Q;  1HRJ A;  5C4X G;  1U5K A;  1LUZ A;  4BA1 I;  1QZH A;  1Q3L A;  3QB3 A;  3CQZ H;  2Z4H A;  4RFB A;  4R4T A;  1SYC A;  1ML0 D;  3AYH B;  2PW7 A;  2KVM A;  4DV2 L;  1EQR A;  1BXT A;  4B9W A;  3GTO B;  4QF4 A;  1H9J A;  1LT5 D;  2SOB A;  4HED A;  1XMQ L;  2SEB D;  4XIG S;  1XXG A;  3MXN B;  2F0E A;  3J7Y W;  3TRE A;  1RTN A;  2EYO A;  2UUC Q;  3HKS A;  4BXX G;  3A7A B;  5T1I A;  4KHZ A;  1OXT A;  1J8I A;  1LYL A;  4DUZ Q;  2RSO A;  2NVX B;  5IYD H;  1ENF A;  1SYB A;  3MXP A;  2MHV A;  2EOT A;  1XPO A;  1D2B A;  2CW0 C;  2VZA A;  1TVX A;  4G57 A;  3WWV A;  1ROD A;  1KNA A;  5JVG 3;  1SR3 A;  4IUR A;  4LNQ A;  2EYF A;  1X3E A;  3PO3 B;  2MFI A;  2MJ8 A;  1R4P B;  2OF1 A;  1I4X A;  2LXJ A;  3TZD A;  4C3J H;  1D5M C;  2Q8T A;  1TY0 A;  4HID A;  2F0J A;  4RMF A;  4C3I H;  3PCO B;  3S17 H;  1E24 A;  1I3Q H;  5FOB B;  3HOY H;  1WTV A;  3I90 A;  3PGZ A;  1AE3 A;  2UU9 Q;  1SN8 A;  3T53 B;  1TWA H;  1AW7 A;  3GTJ B;  1NR4 A;  3NBH B;  4N9T A;  1FYC A;  4DV7 L;  1IYV A;  2LS0 1;  3E5S A;  4LF8 Q;  1C8C A;  3S2D B;  1E2V A;  2A5H A;  2QGQ A;  2O2L D;  1GO3 E;  2HDL A;  3ONA B;  3KJO A;  4A3G B;  1PTO C;  1FNV A;  1K73 C;  4U67 3;  2JYO A;  2EVB A;  3AQQ A;  2VXW A;  3BVG A;  3FVQ A;  4TVA B;  4AYB E;  2VL6 A;  2B2W A;  5C0X G;  2F0L A;  1AP0 A;  4DNR B;  3D4D A;  2RQX A;  2ZM6 L;  3G6E A;  3G71 A;  1KTK A;  5H1S E;  2UXB L;  1IL8 A;  1BQQ T;  1L1O C;  4LUZ A;  2Q8R E;  2D5D A;  4KY7 A;  5KNC A;  4B3M Q;  1ILP A;  2JA8 H;  1I6V C;  2YTV A;  4K2L A;  3I72 A;  3I73 A;  4MTK A;  4JYA Q;  4GLV B;  3VR5 A;  2JEB I;  4DK3 C;  4H02 A;  2J7Z A;  3M4P A;  3K57 A;  4I7Z C;  1ONL A;  1EY9 A;  3H94 A;  1C9O A;  4K8I A;  4DN4 M;  1F2M A;  1RD9 D;  3K6O A;  1CHP D;  1B9N A;  2WAQ B;  1PH1 A;  4BBS G;  2WIN B;  5LMU L;  3J81 j;  4A3J G;  3MEH A;  5IP9 H;  1H9K A;  2K52 A;  4P73 A;  3C2P A;  3K8A A;  4JI5 Q;  3CPF A;  4Y52 H;  3SVM A;  1D5Z C;  1EZ8 A;  1O7Y A;  3H91 A;  5BR8 L;  1PH8 A;  4DAM A;  4KLK A;  1VQD A;  2E2I B;  4A3K G;  2K03 A;  5JJK A;  1W2B A;  4F7X A;  2PMZ B;  3CCV A;  4A4I A;  1JCK B;  1HJP A;  3A0J A;  2PQA B;  2NVQ H;  1ESR A;  4B3S L;  3IL8 A;  3MTS A;  1IBM Q;  1CSP A;  4C3J B;  4DK6 C;  2E2J H;  3JC6 6;  1PLF A;  3E3X A;  1XMO L;  2F0H A;  2IL8 A;  4C3I B;  2G9H D;  2PCF B;  3Q8D A;  4IQZ A;  3CAM A;  4A3I H;  1F9R A;  2OQK A;  4GN5 A;  1TWA B;  3L0O A;  2Q2T A;  1NCV A;  1YNJ C;  4DV6 Q;  1Q86 C;  4NXM Q;  2DNC A;  4BY7 H;  4DV3 L;  1LTB D;  3TME A;  2N78 A;  3NBI A;  4UP7 A;  4BBR H;  1CKO A;  4HCE A;  1GUS A;  2BDN A;  3F2U A;  4RKB A;  1X3G A;  3OSO A;  1OXS C;  4IFD I;  1MSG A;  1O7I A;  1MBY A;  5C6A A;  1D1I A;  3PIO A;  1KDB A;  3BZC A;  3SEB A;  3H0G G;  1EWH A;  2K5V A;  1FD7 D;  1SSO A;  3UI2 A;  5G3L F;  4Z9C B;  5EPL A;  4A3F B;  1EY5 A;  1C4Q A;  3F2C A;  1BBX C;  4KD3 A;  4FXK C;  2TSS A;  1KAA A;  4M8A A;  1BCP F;  1IBL L;  2SDF A;  2L12 A;  1HNX Q;  4IPH A;  1I6H B;  1XPR A;  4CKE A;  4Q5V A;  4JI0 Q;  2FIN B;  1RKN A;  1DOL A;  2JA8 B;  1KLG D;  1IYJ B;  4DXF A;  4WOR A;  4FF4 A;  3M7N A;  2ID0 A;  1SRU A;  3S1Q H;  5CBE E;  3A8I E;  3VR3 A;  3K5L A;  4JI8 Q;  4RG1 A;  1K3B C;  1BO0 A;  1NMG A;  4ALP A;  3NXW A;  1TKW B;  2HT1 A;  3C1F A;  5AJ3 L;  1WD0 A;  3QOJ A;  2L1B A;  4IUU A;  2R61 A;  1VQH A;  1R4Q B;  2F0D A;  1QUQ A;  3GTL B;  5IGC A;  4DNI A;  4ZAI A;  2R6G A;  1B2T A;  4UP8 A;  1JWU D;  1HPC A;  1C7Y A;  1YBY A;  3MXN A;  5GAH C;  4CDF C;  1WTX A;  4DR2 Q;  1JMC A;  4KHP L;  1PH5 A;  2F0S A;  4ZRZ A;  1AZQ A;  3I2Z A;  1Y1W B;  4ZLT F;  1N34 Q;  5E1F A;  2I5M X;  1G2S A;  1GHJ A;  3PIP A;  1JB7 A;  1SBB B;  2NVT H;  3RLO A;  2OTJ A;  1LTG D;  4CHT B;  4J1M A;  5IY0 A;  1H9S A;  5COY A;  3T1Y Q;  1SNO A;  3I4N B;  1O7L A;  4L5T A;  1I94 L;  2E2J B;  2NZ1 D;  5C0X H;  4P71 A;  5LHY 1;  4TRD A;  4AQY Q;  1QVG A;  4JI3 L;  4PNY A;  2AMC B;  1NMF A;  1RDP D;  4CJ1 B;  1KQS A;  5IGG A;  1QE6 A;  4ILW A;  1G8Z D;  5FKA C;  3RLF A;  4A3I B;  2UXC L;  3X3M A;  4LFB L;  2Y0S B;  1A2T A;  2CH4 A;  5ELB A;  2KEC A;  3PUX A;  4APV A;  1MIU A;  4XQQ A;  2KBN A;  4BY7 B;  1DD2 A;  5C4X B;  4AYB G;  1LTS D;  4K0K Q;  3TRZ A;  4UPA A;  3NBH A;  2EJG C;  4B3R L;  1UNS A;  1TWG H;  4DK0 A;  3C46 A;  1UE1 A;  5AFW A;  4U68 A;  5FLM H;  1YNN D;  1O7Z A;  5C4J H;  2NTT A;  1H9R A;  3UDI A;  1VF5 C;  4OO1 H;  4GOP C;  1E7Z A;  2E75 C;  4DR7 Q;  3EA6 A;  3S9W A;  4QB4 A;  5IP7 G;  1EL0 A;  1Q7Y C;  4LF7 L;  2NWG A;  2HHH L;  1K28 A;  2EYM A;  3F8T A;  1TWF H;  1JR0 D;  3CCJ A;  4XT1 B;  2R7Z G;  5G3L D;  2VB2 X;  4RGT A;  5ELF A;  3W5O A;  4RHR A;  3SGI A;  3U9O A;  5K36 H;  1BCP D;  5I9P A;  4BY1 G;  4IFD J;  1A2U A;  1PZJ D;  2NN6 I;  4UDU C;  3LNN A;  5GRO A;  1VQO A;  4LF9 L;  1K0S A;  4OEL B;  2OT2 A;  1VQ8 A;  4A93 G;  4RCO A;  1EY6 A;  5IYB H;  1BOS A;  1IBK Q;  1K8M A;  4LMQ D;  4FF2 A;  3I7F A;  2XNA C;  2VUM G;  1FJG L;  4HTH A;  1X3Q A;  4QQB X;  2ALY B;  2EZV A;  4RGO S;  3SK8 A;  2A19 A;  1LT6 D;  5IWA L;  4GKJ Q;  4FXD A;  2RKS A;  5KEE A;  5F2D A;  3TS0 A;  2M2L A;  5E7N A;  3U9S A;  1TY2 A;  1G29 1;  2Z6B A;  4GKK Q;  2LY7 A;  1PTO B;  1SNC A;  5ELO A;  3NPP A;  3E0J A;  1KNE A;  1N33 L;  4R4C A;  4EQO A;  4FXG C;  1AN8 A;  3GD7 A;  1B8A A;  4MN3 A;  4K5W A;  2B39 A;  3S16 H;  1S5B D;  3TEH B;  1BUV T;  3K59 A;  4TKO B;  1GM5 A;  2PZW A;  4OHJ A;  2NN6 H;  1L1O B;  1QWY A;  3ER0 A;  1TII D;  2Z4I A;  2AUK A;  1FNU A;  1ASY A;  1HUN A;  5M5W B;  1N8R C;  1TS3 A;  3K81 C;  1CTM A;  1HQR D;  2PZT A;  1HNZ Q;  1A62 A;  2UUC L;  2L55 A;  4EQ5 A;  2K5Q A;  2K4K A;  3OWF A;  5IYD G;  2XVS A;  3SXH A;  1STB A;  4DUZ L;  4C3H G;  3DHQ A;  3FP9 A;  3K5N A;  1YJW A;  1MD2 D;  2L15 A;  4KN4 C;  1PYW D;  3I4O A;  1YZ6 A;  1S5D D;  1BBW A;  1RL2 A;  2LFN A;  4WJ3 M;  3D31 A;  2I5H A;  2X69 A;  1I4G A;  4UHV A;  5C4J B;  4FVM A;  5C44 G;  1RTO A;  2LKV A;  1Z9F A;  4EGV A;  1VDZ A;  2ICE C;  5M5Y H;  4A3M G;  4BBS B;  1OXV A;  2UUB Q;  3TP7 A;  1EY4 A;  3NTK A;  3NE5 B;  4G7O C;  1XTC D;  1IW7 C;  4A3J B;  4C3I G;  1R9T H;  3DEP A;  1VQ6 A;  5E3F A;  3S15 H;  3HOY G;  1F9P A;  3HOU H;  4K2K A;  1TWF B;  4GNX A;  4L8J A;  3S2H H;  3J80 c;  2UU9 L;  2MNA A;  1EU4 A;  5BN3 A;  2YTX A;  1K8G A;  4IJL A;  4A3K B;  4NDX A;  2F0P A;  1ASZ A;  4LF8 L;  4KTA A;  4FO2 A;  1EIY B;  1F2Y A;  2AQ2 B;  3OIQ A;  4B08 A;  1NTG A;  4PZ7 A;  4LF5 Q;  3KK7 A;  4LK1 C;  2VW9 A;  4R8N A;  4POG A;  4ME5 A;  4JI6 Q;  3SHL A;  1TWC B;  4X3U A;  3ITP A;  4QUF A;  1WD1 A;  3RMH A;  4K8J A;  4JPB W;  3IAY A;  4JI4 Q;  1JE5 A;  3V05 A;  2VB3 X;  1O80 A;  3VA7 A;  2B63 H;  3AEV A;  1LAB A;  3GTP H;  4N9P A;  1A63 A;  1K3R A;  2JA8 G;  3RZD H;  4GNX C;  3VYS A;  3RUZ A;  4AIM A;  5IOD A;  2F3W A;  3BDL A;  3Q6S A;  5M3M H;  3CD6 A;  4JYA L;  2UXD Q;  1TWH H;  1IHZ A;  2A69 D;  5EPK A;  2AWO A;  3KOJ A;  1CZW A;  1FNW A;  1NUC A;  3CF5 A;  3GV3 A;  2WB1 G;  3NUC A;  1SJH D;  1CKN B;  3B6Y A;  2B8G A;  5IP9 G;  2PQE A;  5IOC A;  3ND9 A;  1TT2 A;  2BE5 D;  1IL2 A;  4GLX A;  5JOB A;  1QVF A;  1JOK A;  4KD4 A;  4JI5 L;  5IGF A;  1PXU A;  4IZ8 A;  1ZKO A;  1HCZ A;  5C5L A;  3UE1 A;  1EQQ A;  5IYC G;  3VYR A;  2A73 B;  3J81 c;  3J7A 5;  4JOI A;  1STH A;  3ND8 A;  3KF6 A;  2ZTC A;  3KYH C;  2F0Q A;  1SNM A;  4A3B H;  2V1C C;  1XX8 A;  5DLQ E;  1Q8I A;  4PZ6 A;  5KND A;  1PYB A;  2XSC A;  2HUG A;  4ZUJ A;  1IBM L;  2OXP A;  3E0E A;  2F0G A;  4PMW A;  1L0W A;  2R92 H;  2JN4 A;  2B2T C;  5LL6 X;  3HOU B;  1E2W A;  3PF4 A;  3R2T A;  3FHW A;  4N8X 1;  3S2H B;  4BY7 G;  1VQI A;  5HUR A;  2TMP A;  2EDG A;  4O0A A;  1CUK A;  3T16 A;  2F0O A;  4NXM L;  3TN2 A;  4DV6 L;  4BBR G;  3NWT A;  3SK5 A;  4NB3 A;  1STY A;  3QIA A;  5CV6 A;  2YYZ A;  4LFA L;  2CFM A;  3ERQ A;  1DON A;  4FF1 A;  3BJU A;  5J22 A;  1QUQ B;  3ZJY C;  2MGS A;  1F9S A;  1UUP A;  4JOI C;  4K14 A;  3HG9 A;  1EYA A;  3BDC A;  3IKJ A;  4XXE A;  4YHH Q;  1G91 A;  1PYS B;  3LWU A;  3A54 A;  1AE2 A;  2K14 A;  3HS0 C;  3J7A V;  1B3Q A;  5EKK A;  5JPM C;  5CYU A;  2B63 B;  3GTP B;  1BCP C;  1SDF A;  2KJX A;  3ULP A;  4AYB B;  2RF4 A;  1A8V A;  4YCU A;  4QCL A;  4DR5 Q;  1KLU D;  4O42 A;  1SE4 A;  4C3H H;  1HNX L;  3OIP A;  1H9S B;  1XTD A;  4JI0 L;  4A3C G;  1LTT D;  2PYK A;  2HCI A;  3FDT A;  3FKI H;  4GOP B;  3MAQ A;  3OMC A;  2JSO A;  3MVV A;  1GUN A;  5JJL A;  2L0C A;  1TWH B;  4JI8 L;  3CME A;  5C44 H;  5I6Y A;  1Q1B A;  2KOL A;  2R7D A;  4A3M H;  4O1N A;  3UDF A;  1OTC A;  3AU7 A;  5ISR A;  4HR7 B;  3K7U C;  4XTC S;  4F8M A;  1G2T A;  1L1O A;  2RSN A;  1B44 D;  2QEX A;  5FLX c;  4E6I A;  5FLX L;  1U4M A;  4X3T A;  3W1G A;  4BA2 I;  2IX1 A;  1KRS A;  2Z8L A;  3ICE A;  1NAP A;  3D0F A;  1DJR D;  1Q82 C;  2R7Z B;  1UE7 A;  3S14 H;  4DR2 L;  4PG3 A;  1VQP A;  2AUJ D;  1PRT F;  1PH6 A;  4XDX A;  3BZK A;  2E2H B;  1N34 L;  4BY1 B;  2NVY B;  1HUM A;  1EZ6 A;  4ABN A;  4OL7 A;  1ILQ A;  3PIO 3;  4HIK A;  2O4X A;  1RCV D;  3G6J B;  2ZJR A;  2XN9 C;  1GJX A;  4LJZ C;  2ZXP A;  3HZX A;  2F3V A;  3DLL A;  4A93 B;  3NWS A;  2VQF Q;  4HMJ A;  5BN4 A;  2FFK B;  4R8I A;  1GUT A;  3T1Y L;  3FMC A;  1S5F D;  2VUM B;  1C48 A;  1PZI D;  3O13 A;  1IKM A;  3BYT B;  4AQY L;  1I5F A;  3F2D A;  1QVC A;  1RIP A;  3LX0 A;  4LF4 Q;  3LWE A;  2IPK D;  4V0B A;  3S1M B;  4YWM A;  2X6L A;  1JIC A;  3PQI A;  4WJW A;  5JVH 3;  3J7Z C;  1MSH A;  2JE6 I;  3CQZ B;  4WFN 3;  2WV6 D;  4QUC A;  2EXD A;  4FF3 A;  3DEO A;  2F1M A;  1KAW A;  1KDA A;  3S1N H;  4I7A A;  2E5L Q;  5FLM G;  2AKW B;  4DV5 Q;  2EYP A;  4XT3 B;  2MP1 A;  4H13 C;  4KY5 A;  4B9X A;  4OO1 G;  3NEM A;  2KHI A;  4DK1 A;  3K0X A;  1UEA B;  1ZYR D;  4DXG A;  3A55 A;  3RZO H;  1VQB A;  4P74 A;  5IIF A;  3Q23 A;  1P8L A;  2K05 A;  4DR7 L;  3NSW A;  3HKZ E;  5GAE C;  4Q0F A;  1U4L A;  3PIP 3;  1KAB A;  2GN5 A;  2JA6 H;  5CBA E;  4C3H B;  3GDE A;  1T5E A;  1QOH A;  1QG7 A;  3GO5 A;  5IYC H;  3CC2 A;  5K36 G;  2HIX A;  1CQF A;  3GTG H;  2AHO B;  4YIJ A;  1SFO H;  1W6J A;  1HH2 P;  2OCE A;  4QIW B;  5C44 B;  1WVL A;  4C1N K;  3OYY A;  4A3M B;  3EN2 A;  2KA7 A;  5IYB G;  2G5D A;  5D3D A;  4X64 Q;  3CCQ A;  3OPO A;  1U0L A;  4CJ0 B;  3S17 B;  1HR0 Q;  1X56 A;  1Y8N B;  1I3Q B;  2UUA Q;  1DOK A;  1SYF A;  3QR8 A;  3SR1 A;  3HOY B;  4L5R C;  1H95 A;  1JOQ A;  2ZT9 C;  1EQT A;  2D0P A;  1B4O A;  4O2D A;  3MHB A;  3KLS A;  1HR0 W;  2VNU D;  5A35 A;  2F0T A;  1CKN A;  4N8F A;  1VQE A;  5T1G A;  4JBJ A;  2EIF A;  1B70 B;  3HOW H;  4GKJ L;  1E0B A;  2XGT A;  4K5V A;  2CWA A;  3JAM i;  2A69 C;  2QDB A;  3N52 A;  3R8B A;  5DM7 3;  4GKK L;  2F0F A;  1PVO A;  1K0R A;  3QOL A;  3OWE B;  3R93 A;  3ERO A;  1PFM A;  3F1Z A;  2BA0 A;  1PRT D;  1M4V A;  3KLS X;  2NN6 G;  3CP0 A;  4J8Q A;  5KNB A;  4HCS A;  4DGZ A;  4UAI A;  2WKC A;  5C3W A;  2I5L X;  3HOX H;  1SYD A;  4JBK A;  1SE2 A;  4GNX B;  1NSN S;  2C35 B;  2JEA I;  1BDO A;  4KKU A;  4GN3 B;  1C0A A;  3A56 A;  1WYD A;  1HNZ L;  2NBF A;  4QIW E;  2EQS A;  4FNF A;  1CFM A;  1CSQ A;  1E3P A;  4A3C H;  2B29 A;  2EYH A;  2F0I A;  4DNT B;  2Q2H A;  5KGU A;  1MI2 A;  3CRL C;  2HCC A;  1XNR Q;  2EY6 A;  1X65 A;  3S1N B;  3M9B A;  3HOV H;  4JVZ A;  2HIV A;  3NTH A;  4ZUI A;  2CWP A;  1SLJ A;  4EQP A;  1NE3 A;  1Q81 C;  4IFD H;  1WTH A;  4IUV A;  2K5W A;  4R1J A;  4DR3 Q;  1LV9 A;  3RZO B;  2WB1 B;  3KF8 B;  3M7G A;  2N49 A;  1V43 A;  2B2V C;  4X6A H;  2UUB L;  2C9O A;  3HOU G;  5LL6 S;  5M5X H;  2JA6 B;  1PH9 A;  2K28 A;  5D65 A;  5ELN A;  3BVZ A;  4XYO A;  4C2M H;  2D9U A;  1HXY D;  4B3T Q;  4DV4 Q;  2I46 A;  5IT9 c;  1UAP A;  5IT9 L;  2NVQ B;  3JAM c;  4NW2 A;  3TP8 A;  3JAM L;  4GOP A;  4BS9 A;  1GUW A;  2NZO A;  1N32 Q;  4QGU A;  4LF5 L;  1AEX A;  1X9N A;  1WTQ A;  1EUJ A;  4JI6 L;  5EPJ A;  1LM0 A;  2B63 G;  4DAP A;  1PH7 A;  4JI4 L;  1VMP A;  1PTO F;  2YV5 A;  4V19 0;  2MO0 A;  1BR9 A;  5COR A;  4BBR B;  3KF6 B;  2R93 H;  5JEA H;  3QG1 A;  2HQE A;  2WB1 E;  2DN8 A;  3VR2 A;  2QEJ C;  3K7A H;  3U4V A;  3NEL A;  4CBV A;  1VQ7 A;  4YY3 Q;  5M3M G;  4TQU S;  1VQ9 A;  1SE3 A;  4NXN Q;  4OIK A;  1JT8 A;  1GXD C;  4GLA C;  4LAA A;  3C1E A;  2EPB A;  3DWQ A;  2F4I A;  1VQJ A;  1WCM H;  1HQM C;  1WTW A;  5ELE A;  3CCM A;  3D6C A;  2AQ3 B;  2HQL A;  3CW2 C;  4LUV A;  1K8O A;  2O5J C;  2EE1 A;  2N3S A;  1OXU A;  5D3I B;  3VA5 A;  2VQE Q;  3GTQ H;  3OMG A;  2SNS A;  4XQN A;  4JI2 Q;  3DM1 A;  1MHW C;  3S1Q B;  3UE0 A;  1E1T A;  3NP8 A;  3W1B A;  5CMD A;  1A3U A;  1K9M C;  1EQV A;  2RDH A;  4UY8 C;  4A3E H;  3HKZ G;  3E6Z X;  4OX9 Q;  1BVS A;  2KCT A;  1F9Q A;  3S24 A;  1LTA D;  2F0M A;  3CMA A;  4A3B G;  2B2U A;  3CCU A;  4L63 B;  1K83 H;  2RCN A;  2EY1 A;  1V1P B;  1M8A A;  1DM0 B;  2A74 C;  1CHQ D;  2IX0 A;  2QW7 A;  3J80 i;  3D4R A;  1VQK A;  4Y7N H;  2V4D A;  2R92 G;  1LAC A;  4L5S A;  3I8Z A;  2LSS A;  1HFG A;  4B3S Q;  2CQO A;  5HGT A;  4DAY B;  5M5X B;  2YU9 H;  1YJ9 A;  2PW5 A;  5FLX E;  2WII B;  3IRB A;  1TU2 B;  2LMC B;  4C2M B;  1YEZ A;  2NVT B;  3ERS X;  1A6X A;  1PHJ A;  5FO9 B;  1J5E Q;  4QJF A;  1SE8 A;  1ZYR C;  5KRU A;  3A5Z B;  1STE A;  2B3G A;  2YTY A;  3OTO Q;  2L5T A;  3BG3 A;  1HZB A;  2PNH A;  2B2U C;  4IUN A;  3QWN A;  1EIG A;  1XNQ Q;  4YHH L;  3VYT A;  1O78 A;  4IJH A;  4K6D A;  4DAV A;  2K32 A;  1EOV A;  4CDD C;  1EY0 A;  5C0X J;  2WKD A;  2B2Y C;  5ELD A;  2IJ0 A;  1SAP A;  1U4R A;  2RHS B;  4LFC Q;  3M4O H;  5CV5 A;  5HGQ A;  1SXT A;  3CPW A;  4DR5 L;  4HSP A;  4DFA A;  3FKI G;  4LUO A;  2ZTD A;  1TWG B;  3GTM H;  3K7A B;  4CKC A;  5NUC A;  5JPN C;  4KJO A;  2K7V A;  4OWT B;  3URY A;  2IW3 A;  3PO2 H;  3CCS A;  4JV5 Q;  5C3E G;  1ENA A;  1ICF B;  1L0Y B;  4R4O A;  4RKL A;  5C4H A;  3FEW X;  2A1A A;  1EWC A;  2OQ0 A;  5I2X A;  3RNU A;  4HJ7 A;  1WTR A;  4ID6 A;  1E2Z A;  3DWA A;  2XIW A;  3A8J E;  1VQN A;  3J81 i;  3J80 L;  3T1H Q;  1J9O A;  1F77 A;  1HA5 A;  4DU9 A;  1P16 A;  1PRT C;  3VDY A;  4HJ5 A;  4JI7 Q;  4RGN A;  3T56 B;  2IY5 B;  4F87 A;  5L37 A;  3MC0 B;  2KQ3 A;  4KMU C;  2JA7 H;  3CXC A;  2E2D C;  2RA4 A;  5A2Q L;  1KIX A;  5ELC A;  1K83 B;  1LTR D;  1JWM D;  1S5C D;  2D2C C;  1LTL A;  1N36 Q;  3X3N A;  2KCM A;  1UE6 A;  2VQF L;  4Y7N B;  4A3L H;  4A3D H;  2BH8 A;  3BVM A;  4F88 A;  1TQO A;  2DY8 A;  1S40 A;  1YIT A;  3KF8 A;  3A74 A;  3W3A A;  3H3V I;  1X3P A;  2YU9 B;  5M9O A;  1E22 A;  1V8Q A;  1CI3 M;  3NHH A;  4LF4 L;  2QIL A;  2EJF C;  2FHT A;  1VQG A;  4B3M L;  1CZG A;  3K5M A;  4IPG A;  4G4K A;  2R7F A;  3S16 B;  4JI1 Q;  3I3C A;  1G6P A;  4J6H A;  5DEH A;  4AH6 A;  4PMB A;  2ZJQ A;  3CC4 A;  3H6M A;  2WFW A;  1N9W A;  1D1K A;  2NVX H;  3P75 A;  2E5L L;  1YI2 A;  4DV5 L;  3AB9 A;  4OON A;  1MKH A;  2ZXR A;  2J4X A;  2F4V Q;  4RGM A;  3K80 C;  2B2T A;  4MIU A;  1EY7 A;  2WP8 J;  1SRO A;  2ZTE A;  3KBX A;  3PO3 H;  2JA6 G;  3IFT A;  1U9R A;  5LMN Q;  1U4P A;  1HNW Q;  1AFP A;  4OXP A;  4TSS A;  4ODG A;  1JE4 A;  5CV4 A;  5K5P A;  4G7Z C;  5M3F H;  2QDL A;  3GTM B;  5EKL A;  3J81 L;  5LMN W;  3AFQ A;  1Y69 U;  2R3Z A;  1ICW A;  2DGY A;  5TSS A;  1GKH A;  3MZ5 A;  2K04 A;  5M5Y B;  1TS4 A;  3GTJ H;  2K33 A;  3DM3 A;  4RAU C;  1R9T B;  2OEO A;  5CR3 A;  1G51 A;  4A75 A;  1SMX A;  2Q2I A;  4GS3 A;  2XTI A;  3F2B A;  3S2D H;  4X64 L;  5GAD C;  3S15 B;  4DF7 A;  2NYZ D;  2PNR C;  1HR0 L;  2UUA L;  3CKI B;  3PUY A;  2F0V A;  5DNF A;  1G6Z A;  4HJ9 A;  2E8G A;  1S3O A;  5EGT A;  1YNN C;  5IGB A;  3HOW G;  2K5H A;  1OO9 B;  3BYY B;  3NTI A;  2CCZ A;  2JA5 H;  2CQA A;  2F3I A;  3SK6 A;  1ZEQ X;  4HIM A;  3EQL C;  1FVI A;  1Y1V G;  2FXQ A;  2CH4 W;  2XRS D;  5IT9 E;  3EFX D;  4ZK9 B;  3JAM E;  3HOX G;  1I4Q A;  1CQV A;  4DV1 Q;  3HRZ C;  4A3D B;  4DV0 Q;  3E9I A;  3PUV A;  1V1P A;  4MHE A;  2IX3 A;  3CC7 A;  1V1O A;  3FRP B;  3TS2 A;  3U58 A;  3RZD B;  2I0Q A;  2JXM B;  3M85 A;  4OEM B;  4IUQ A;  1PA6 A;  1VQC A;  4DAY A;  1B3A A;  1SNP A;  1UEB A;  5C5M A;  1Q8K A;  2ASB A;  1HFN A;  5KYL A;  3RLN A;  5M3M B;  4DUY Q;  3HOV G;  1XNR L;  4PZ8 A;  3VR4 A;  3A5U A;  3L2P A;  1SYG A;  3K5O A;  3G4S A;  2EY5 A;  4IFD G;  5C3E H;  4DR6 Q;  1VS0 A;  3DUZ A;  4C56 C;  4HJ8 A;  4DKA C;  2E2I H;  4DR3 L;  1TR5 A;  1GVP A;  1VQ5 A;  1EU3 A;  4X66 Q;  1HZA A;  3OHX C;  1M90 C;  5IGE A;  5HY6 A;  4RA8 A;  3BU2 A;  2GVA A;  1I50 H;  3HGB A;  1IYU A;  3RD4 A;  4C1N I;  4X62 Q;  3Q0A A;  4R4I A;  4CKB A;  2M9V A;  3U4Z A;  1EWI A;  1X54 A;  2GA4 B;  1LTI D;  5FJ8 H;  5M3F B;  3SDZ A;  2Z9H A;  3W2D A;  3HKZ B;  3PUW A;  2A6H D;  1CA6 A;  4YCW A;  2JQO A;  4H44 C;  4A3B B;  4B3T L;  2Z6K A;  5EJW A;  4DV4 L;  3RN2 A;  1PFS A;  1W3S A;  2K01 A;  5JJI A;  4LW1 A;  3DXJ C;  1B7Y B;  2KCC A;  2A6E D;  4ZCK A;  2SNM A;  4DA2 A;  1STA A;  4MZ9 A;  2BDO A;  1Y14 B;  2F0K A;  1N32 L;  4RCN A;  4IPC A;  2R92 B;  2EXZ A;  1LLR D;  3GQB A;  5EAY A;  3QO2 A;  2L11 A;  5EBC A;  2VS1 A;  1ET6 A;  1CM9 A;  3HP3 A;  3K0Y A;  4QMG A;  4L5Q A;  1IKL A;  2D62 A;  1EYC A;  2R93 G; 
#chains in the Genus database with same CATH homology
 2UUB L;  1Y1W G;  3TEH B;  1YHB A;  5JEA G;  2IHE A;  4J15 A;  1KRT A;  1GM5 A;  3AFP A;  4K0K L;  3OW2 A;  4A3F H;  3HOU G;  1L1O B;  3ER0 A;  5M5X H;  1PH9 A;  4LF9 Q;  2E2H H;  2KHJ A;  1ASY A;  4IOC A;  2NVY H;  4BY1 H;  1BKB A;  3CCL A;  1N8R C;  5ELN A;  1I6H H;  2Z6K C;  4YY3 L;  3K81 C;  4DR1 L;  4DR4 Q;  4C2M H;  2K75 A;  4NXN L;  2Q2U A;  3HOZ G;  1HNZ Q;  1FGU A;  1WCM G;  1A62 A;  2UUC L;  4B3T Q;  4A93 H;  4A3G H;  1WI5 A;  4DV4 Q;  1YJN A;  3I4N G;  4EQ5 A;  1FJG Q;  5IT9 c;  2K4K A;  5IYD G;  3JAM c;  2KEN A;  3PV0 A;  4GOP A;  4JG2 A;  4X65 L;  4LF6 L;  4DUZ L;  2H5X A;  2VUM H;  3UDX A;  1VCI A;  2NZO A;  1VQF A;  3FP9 A;  3L7Z C;  5IWA Q;  1A0I A;  4QGU A;  1YJW A;  1NJI C;  4LF5 L;  1N32 Q;  2L15 A;  3PUZ A;  3CCE A;  3I4O A;  1YZ6 A;  4A3I G;  1BBW A;  1RL2 A;  2Y0S G;  1X9N A;  4WJ3 M;  3D31 A;  1EUJ A;  3LGJ A;  4DPG A;  3H15 A;  4JI6 L;  3S1M H;  1KHI A;  1N33 Q;  1AH9 A;  2I5H A;  2BA1 A;  5C4X G;  1U5K A;  3GTL H;  4YCV A;  2VQE L;  1LUZ A;  4BA1 I;  1LM0 A;  5C44 G;  2GVB A;  1QZH A;  4JI2 L;  4A3E G;  2B63 G;  1Z9F A;  4QY7 A;  1PH7 A;  4JI4 L;  3CQZ H;  5M5Y H;  4A3M G;  2YV5 A;  4R4T A;  1OXV A;  2UUB Q;  2MO0 A;  2N8N A;  3AYH B;  3KF6 B;  4DV2 L;  1VQA A;  1R9T H;  4OX9 L;  1EQR A;  2F52 A;  1VQ6 A;  2R93 H;  3I56 A;  3E9H A;  1Y1W H;  3S15 H;  3HOY G;  2WB1 E;  1XMQ L;  3HOU H;  3K7A H;  3U4V A;  1HZC A;  3NEL A;  4XIG S;  3S2H H;  1VQ7 A;  4YY3 Q;  5M3M G;  4GNX A;  4TQU S;  3MXN B;  4DR1 Q;  1IBK L;  1VQ9 A;  1YNX A;  2K5N A;  3J80 c;  3TRE A;  2UU9 L;  2MNA A;  4GLA C;  2UUC Q;  3HKS A;  1JT8 A;  4BXX G;  2YTX A;  3RR5 A;  1FL0 A;  2NZH A;  1K8G A;  1D8L A;  4IJL A;  1VQJ A;  1ASZ A;  1WCM H;  4KHZ A;  1JJ2 A;  4LF8 L;  1OXT A;  1J6Q A;  3STB D;  1LYL A;  4X65 Q;  4LF6 Q;  4DUZ Q;  3I4N H;  1EIY B;  3CCM A;  1NTG A;  1X55 A;  4PZ7 A;  5IYD H;  4FDB A;  4LF5 Q;  4LUV A;  2HQL A;  3CW2 C;  2VW9 A;  1XPO A;  4POG A;  2VZA A;  4JI6 Q;  2N3S A;  1OXU A;  3WWV A;  2VQE Q;  1SR3 A;  1J5E L;  3GTQ H;  2PI2 E;  4JI2 Q;  2IHF A;  1PH3 A;  1Y1V H;  4LNQ A;  3UE0 A;  1X3E A;  4JI4 Q;  1E1T A;  2MFI A;  3W1B A;  1JE5 A;  5C4X H;  3OTO L;  1DGS A;  4UP9 A;  4LFA Q;  1K9M C;  2LXJ A;  4A3E H;  3HKZ G;  4UY8 C;  2B63 H;  3AEV A;  3GTP H;  4C3J H;  3I4M G;  4DV2 Q;  4OX9 Q;  4JCV E;  1BVS A;  2KCT A;  4A75 A;  1A63 A;  4HID A;  2WAQ E;  3S24 A;  3CMA A;  1K3R A;  1L2F A;  3CCU A;  2JA8 G;  3RZD H;  4RMF A;  4GNX C;  1XMQ Q;  4A3B G;  4C3I H;  1K83 H;  1XNQ L;  3PCO B;  2RCN A;  3S17 H;  1E24 A;  1I3Q H;  4AIM A;  3HOY H;  3PGZ A;  2DUD A;  1AE3 A;  3MEF A;  1VQ4 A;  2UU9 Q;  2IX0 A;  1SN8 A;  2MQH A;  1TWA H;  5M3M H;  3J80 i;  3CD6 A;  3NBH B;  1VQK A;  4JYA L;  4Y7N H;  2UXD Q;  4DV7 L;  2R92 G;  1TWH H;  4LF8 Q;  4BXX H;  4L5S A;  4B3S Q;  2LSS A;  4LFC L;  5GAG C;  2CQO A;  4HJA A;  1V9P A;  2AWO A;  3KOJ A;  4DAY B;  1Q12 A;  2YU9 H;  2JK8 A;  2QGQ A;  1GD7 A;  3CF5 A;  3NEN A;  1YJ9 A;  3M3Y H;  2WB1 G;  2PMZ E;  3IRB A;  1CKN B;  3B6Y A;  1YEZ A;  1GO3 E;  3PO2 G;  3ERS X;  3KJO A;  5IP9 G;  1K73 C;  1PHJ A;  1J5E Q;  4QJF A;  1SE8 A;  3ULJ A;  1IL2 A;  3AQQ A;  1EYG A;  3A5Z B;  4TVA B;  4AYB E;  4GLX A;  2VL6 A;  4JV5 L;  5C0X G;  2B3G A;  3PF5 A;  1QVF A;  2YTY A;  3OTO Q;  2K50 A;  3KLW A;  1HZB A;  4JI5 L;  2ZM6 L;  3G6E A;  2PNH A;  3G71 A;  4BA2 I;  3UE1 A;  5H1S E;  1EQQ A;  2UXB L;  5C0X I;  5IYC G;  4NPS A;  1L1O C;  4LUZ A;  3J81 c;  3J7A 5;  3KDF B;  4JOI A;  1XNQ Q;  2AWN A;  3KF6 A;  2ZTC A;  3KYH C;  4YHH L;  4B3M Q;  1XPU A;  4IJH A;  3T1H L;  2JA8 H;  4A3B H;  2V1C C;  2YTV A;  1EOV A;  5C0X J;  3HFZ B;  5DLQ E;  4PZ6 A;  2MO1 A;  4JI7 L;  1PYB A;  2JA7 G;  4JYA Q;  1X3F A;  4GLV B;  4DV7 Q;  1OXX K;  2JEB I;  4DK3 C;  2RHS B;  4H02 A;  1IBM L;  3E0E A;  3M4P A;  4P75 A;  4LFC Q;  3M4O H;  4PMW A;  5HGQ A;  1BBU A;  3CPW A;  4DR5 L;  1L0W A;  1C9O A;  4P72 A;  3FKI G;  4LUO A;  2R92 H;  2ZTD A;  3GTM H;  1WJJ A;  3TQY A;  3PF4 A;  1N36 L;  3FHW A;  5IE8 A;  4BY7 G;  4A3L G;  1VQI A;  4A3D G;  3UDG A;  4O0A A;  4OWT B;  1CUK A;  1PH1 A;  4BBS G;  4HIO A;  4NXM L;  4OO1 I;  5LMU L;  4DV6 L;  4BBR G;  1YIJ A;  3J81 j;  4A3J G;  4NB3 A;  3PO2 H;  3CCS A;  4JV5 Q;  5C3E G;  2YYZ A;  5IP9 H;  4LFA L;  2CFM A;  4R4O A;  2K52 A;  4P73 A;  3BJU A;  3K8A A;  4MNO A;  3CPF A;  2ZM6 Q;  4JI5 Q;  3KFU A;  1UE5 A;  2A1A A;  1QUQ B;  2OQ0 A;  3ZJY C;  2UXB Q;  4JOI C;  4Y52 H;  3RNU A;  4HJ7 A;  1PH8 A;  5M5W H;  5BR8 L;  4DAM A;  4KLK A;  1VQD A;  4IO9 A;  1VQN A;  1NBW A;  4YHH Q;  4A3K G;  1XJV A;  5JJK A;  3S1N H;  3J81 i;  1PYS B;  1W2B A;  3T1H Q;  4JI1 L;  2BH2 A;  3CCV A;  1AE2 A;  2K14 A;  4A4I A;  1PH4 A;  1HJP A;  1P16 A;  1YVC A;  2JJQ A;  3A0J A;  4HJ5 A;  3VDY A;  4JI7 Q;  2PQA B;  3HOZ H;  2UXD L;  2QA4 A;  2NVQ H;  4B3S L;  2IY5 B;  1IBM Q;  1CSP A;  1VQM A;  4DK6 C;  3ULP A;  2JA7 H;  3CXC A;  2E2J H;  2RF4 A;  3JC6 6;  1A8V A;  4YCU A;  4DR5 Q;  1XMO L;  1KIX A;  2F4V L;  4C3H H;  1HNX L;  1IXR A;  1XTD A;  3Q8D A;  4JI0 L;  4A3C G;  1LTL A;  1N36 Q;  3FKI H;  4IPD A;  3CAM A;  4GOP B;  3PO3 G;  2CKZ B;  2KCM A;  4A3I H;  1UE6 A;  2VQF L;  2OQK A;  5JJL A;  4GN5 A;  2Q2T A;  3L0O A;  4NXM Q;  5LMU Q;  4DV6 Q;  3RN5 A;  1Q86 C;  4BY7 H;  4A3L H;  4A3D H;  2BH8 A;  4JI8 L;  3CME A;  5M3F G;  4DV3 L;  4BBS H;  5C44 H;  2N78 A;  4UP7 A;  5LMN L;  1S40 A;  1HNW L;  1YIT A;  3A74 A;  4BBR H;  1Q1B A;  2R7D A;  3I55 A;  4A3J H;  1CKO A;  4A3M H;  3H3V I;  3UDF A;  1UWV A;  1E22 A;  1OTC A;  4LF4 L;  3K7U C;  4XTC S;  1X3G A;  5BR8 Q;  1KXL A;  1OXS C;  1VQG A;  1L1O A;  4B3M L;  4YWL A;  2QEX A;  4OWX B;  4IFD I;  4IPG A;  5FLX c;  1T9H A;  1O7I A;  4POF A;  2R7F A;  4JI1 Q;  3PIO A;  3W1G A;  4AH6 A;  1G6P A;  2JA9 A;  3BZC A;  1KRS A;  4A3K H;  1YHA A;  2IX1 A;  3H0G G;  3D0F A;  2K5V A;  1Q82 C;  2ZJQ A;  1UE7 A;  3ICE A;  3S14 H;  3CC4 A;  4DR2 L;  4PG3 A;  1VQP A;  2VY3 A;  2WFW A;  1N9W A;  1PH6 A;  2E5L Q;  3S1R H;  3F2C A;  2NVX H;  3BZK A;  2E5L L;  1HZ9 A;  1YI2 A;  4DV5 L;  4OON A;  1N34 L;  4OWW B;  1XMO Q;  1MKH A;  2Y0S E;  1IBL L;  4A3G G;  2F4V Q;  1HNX Q;  2PI2 A;  4IPH A;  4HIK A;  1XPR A;  3K80 C;  4JI0 Q;  3M4Q A;  2ZJR A;  2ZJP A;  1TWC H;  3DLL A;  1IYJ B;  2VQF Q;  3M7N A;  1S72 A;  2ID0 A;  2WP8 J;  1SRU A;  1SRO A;  3S1Q H;  2ZTE A;  3T1Y L;  1X6O A;  2JA5 G;  2JA6 G;  3PO3 H;  4JI8 Q;  4DV3 Q;  4RG1 A;  2Z0S A;  5LMN Q;  4A76 A;  1HNW Q;  4OXP A;  4EX5 A;  1JJG A;  1NMG A;  4AQY L;  4ALP A;  1I5F A;  3F2D A;  5M3F H;  1QVC A;  2HT1 A;  1RIP A;  5AJ3 L;  4LF4 Q;  5LMN W;  3AFQ A;  3EIV A;  4YWM A;  3I4M H;  2DGY A;  1VQH A;  1GKH A;  2ATW A;  1QUQ A;  2LXK A;  3J7Z C;  1KD1 C;  1D7Q A;  4DV1 L;  4DNI A;  2JE6 I;  4R4Q A;  2R6G A;  3GTJ H;  4UP8 A;  1Q1E A;  4DV0 L;  1YBY A;  1C7Y A;  2EXD A;  5GAH C;  1NY4 A;  3DM3 A;  4DR2 Q;  1JMC A;  4KHP L;  1PH5 A;  1MJE A;  1KAW A;  1G51 A;  5GQO A;  3H0G H;  1SMX A;  2Q2I A;  4GS3 A;  2XTI A;  1EIF A;  3I2Z A;  1Q46 A;  4X64 L;  5GAD C;  2PQA A;  2AKW B;  5FLM G;  4DV5 Q;  2WAQ G;  1QZG A;  1N34 Q;  3GTK H;  1IBL Q;  4LWC A;  1V43 A;  1HR0 L;  2I5M X;  2UUA L;  4OO1 G;  3PUY A;  3PIP A;  3NEM A;  1JB7 A;  2KHI A;  2NVT H;  3K0X A;  3RLO A;  4HJ9 A;  2OTJ A;  3RZO H;  1VQB A;  2E8G A;  4P74 A;  1S3O A;  1P8L A;  5JEA J;  5IY0 A;  3HOW G;  2RHQ B;  4DUY L;  4DR7 L;  3F2B A;  2K5H A;  3T1Y Q;  1WOC A;  4JBW A;  3S2D H;  3HKZ E;  5GAE C;  2OTL A;  2IT1 A;  4L5T A;  3STB C;  1I94 L;  2CCZ A;  2JA5 H;  4DR6 L;  2GN5 A;  2JA6 H;  4P71 A;  2F3I A;  4AQY Q;  1QVG A;  4JI3 L;  4HIM A;  3GDE A;  1TXY A;  5AJ3 Q;  2AMC B;  1NMF A;  1FVI A;  1KQS A;  1Y1V G;  2FXQ A;  1V1Q A;  3GO5 A;  5IYC H;  3CC2 A;  2UXC L;  2HIX A;  3RLF A;  4X66 L;  5K36 G;  4LFB L;  3GTG H;  2AHO B;  3HOX G;  1SFO H;  3PUX A;  4APV A;  1MIU A;  4DV1 Q;  2KBN A;  1HH2 P;  2OCE A;  4AYB G;  4X62 L;  3E9I A;  3PUV A;  4MTN A;  5FJ8 G;  4DV0 Q;  1YHQ A;  3OYY A;  4KHP Q;  4K0K Q;  3TRZ A;  4KI0 A;  3CC7 A;  1PV4 A;  3EN2 A;  5IYB G;  4UPA A;  4B3R L;  4X64 Q;  4GN4 B;  3CCQ A;  1TWG H;  3U58 A;  3TS2 A;  2I0Q A;  1KC8 C;  1UE1 A;  1U0L A;  3M85 A;  3PSI A;  1HR0 Q;  1X56 A;  1PA6 A;  2UUA Q;  1EFW A;  1VQC A;  1VQL A;  1UEB A;  1E1O A;  5FLM H;  4L5R C;  1Q8K A;  5C4J H;  2ASB A;  1H95 A;  3UDI A;  4O2D A;  2D0P A;  4ME3 A;  3RLN A;  1HR0 W;  4GOP C;  1E7Z A;  2VNU D;  1CKN A;  4DUY Q;  1VQE A;  3HOV G;  4JBJ A;  4DR7 Q;  2EIF A;  1XNR L;  4PZ8 A;  3A5U A;  3L2P A;  1B70 B;  2ES2 A;  3HOW H;  4GKJ L;  2XGT A;  3G4S A;  2CWA A;  5IP7 G;  3JAM i;  1I94 Q;  3GTO H;  4IFD G;  5C3E H;  4DR6 Q;  1Q7Y C;  1VS0 A;  2OWO A;  4LF7 L;  4QL5 A;  2A8V A;  4GKK L;  4HJ8 A;  1M1K C;  4JI3 Q;  2HHH L;  1KL9 A;  1PVO A;  1K0R A;  3F8T A;  4DKA C;  1TWF H;  3CCJ A;  2E2I H;  4DR3 L;  4JBM A;  2UXC Q;  2R7Z G;  1GVP A;  1VQ5 A;  4X66 Q;  3F1Z A;  4LFB Q;  2BA0 A;  1HZA A;  1CKM A;  3W5O A;  3SGI A;  3KDF A;  1M90 C;  4A3F G;  2NN6 G;  3CP0 A;  5HY6 A;  3BU2 A;  2GVA A;  1I50 H;  2I5L X;  4BY1 G;  4X62 Q;  3HOX H;  4IFD J;  3U50 C;  4R4I A;  4JBK A;  5GRO A;  2NN6 I;  1VQO A;  4GNX B;  5J3B A;  2C35 B;  2JEA I;  3U4Z A;  1EWI A;  1X54 A;  4LF9 L;  5FJ8 H;  1PH2 A;  4B3R Q;  2D0O A;  4GN3 B;  3PUW A;  1VQ8 A;  4A93 G;  1WFQ A;  1C0A A;  3KJP A;  5IYB H;  4NXN Q;  4DR4 L;  4YCW A;  1WYD A;  1Z47 A;  2JQO A;  1IBK Q;  1HNZ L;  4QIW E;  4B3T L;  2Z6K A;  2EQS A;  4JC0 A;  4DV4 L;  1CSQ A;  1E3P A;  3I7F A;  3RN2 A;  4A3C H;  1PFS A;  1W3S A;  2B29 A;  1FJG L;  2VUM G;  4LW1 A;  5JJI A;  4YWK A;  1B7Y B;  2Q2H A;  1K8A C;  1XNR Q;  4QQB X;  2ALY B;  4MZ9 A;  1Y14 B;  2A19 A;  5IWA L;  1JJC B;  3EBE A;  4GKJ Q;  1N32 L;  1X65 A;  4IPC A;  3H3V H;  3M9B A;  3HOV H;  4WJ4 A;  2HIV A;  3TS0 A;  5E7N A;  5EAY A;  1G29 1;  2CWP A;  4LF7 Q;  4GKK Q;  1SLJ A;  5IP7 H;  2HHH Q;  4IOA A;  5ELO A;  1NE3 A;  2VS1 A;  1Q81 C;  3ULL A;  1N33 L;  4R4C A;  3CCR A;  4R1J A;  3GD7 A;  1B8A A;  4DR3 Q;  1MJC A;  3G48 A;  3KF8 B;  1IZ6 A;  4L5Q A;  3S16 H;  2D62 A;  2N49 A;  2R93 G;  4X6A H;  2R7Z H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...