2K5DA

Solution nmr structure of sag0934 from streptococcus agalactiae. northeast structural genomics target sar32[1-108].
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
110
structure length
110
Chain Sequence
MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKADDIVLTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein SAG0934
publication title SOLUTION NMR STRUCTURE OF SAG0934 from Streptococcus agalactiae. NORTHEAST STRUCTURAL GENOMICS TARGET SaR32[1-108].
rcsb
source organism Streptococcus agalactiae serogroup v
total genus 18
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06125 DUF961 Bacterial protein of unknown function (DUF961)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.390 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k5dA01
2K5DA
chains in the Genus database with same CATH superfamily
4KV6A 5JVG3 1XPOA 2JA8H 1BUVT 1W6JA 1KRTA 2DN8A 3DMUA 4A93H 5K5PA 1K0RA 1HNWQ 5JVH3 1EOTA 4JI5L 3ICEA 3DWQA 3GTLB 4G7HC 1K3BC 1E2ZA 1CZGA 2GA4B 3ND9A 4GNXB 1TY2A 1G91A 1W6KA 4HJ5A 3G71A 4B3MQ 1FNUA 1I4PA 4POFA 2XWBB 1MJCA 4BBRB 5IWAQ 2EYOA 5LL6S 4HCEA 4B08A 4WJ3M 1WD1A 2NVTH 3D6WA 3DLLA 2K05A 3DWPA 4LF9Q 4MHEA 2MO1A 4OHJA 3MEFA 1TKWB 2R93G 1R9TH 5FOBB 4A3GH 3FHWA 3MC0B 1TWAB 1D1IA 2WKDA 3H94A 3UE1A 4TVAB 2UUAQ 3FKIH 4GKKQ 1A2UA 4IALA 1X65A 5A2QL 1KNEA 1LTGD 4OXPA 2K5QA 1NSNS 3HGBA 1QWYA 1TS5A 3CXCA 2Y0SE 2E74C 5JJKA 3MEHA 2CFMA 3T1HQ 2IX1A 1HNZQ 3A55A 3Q23A 2B8FA 3NP8A 3MFYA 4RMFA 4EQPA 5FLXL 1BKBA 3K58A 3CCSA 5IP7H 4DR3L 1UWVA 3M7NA 5D3DA 3OIQA 1TWFB 2F0QA 4K5WA 2C35B 2PZWA 2FFKB 2EOTA 4DR2Q 2QDLA 1E2WA 3FPUB 3O13A 4DN4M 2OTJA 2I5HA 4XQQA 1TS4A 1A0IA 1UAPA 4JI4Q 1ESRA 1QUQB 5JPMC 1N32Q 4JBWA 4I7ZC 3I4MG 2E76C 5C4JH 3RZOH 4BY1G 3SVMA 1HXYD 1L0XB 1SJED 3SXHA 2VNUD 1FGUA 2K50A 4XIGS 1B8AA 4O42A 1VQ4A 4KHVA 4LF8Q 3GTMB 2A6HC 4DV0L 1K83B 2KCNA 4GN3B 4EVOA 1HRJA 1X3FA 4YWMA 3KF6B 3NEMA 3S1RB 4P72A 1B7YB 4B3SQ 1X6OA 3HKZE 1G8ZD 4X3TA 4A3IH 1FYCA 1YITA 4HJAA 1W3SA 2LY7A 1T5EA 4N9PA 3IKJA 1VQ8A 2NN6H 2V1CC 3A8IE 4RFBA 3T53B 4QJFA 4ZLTF 1TXYA 4YCWA 1VQEA 3B6YA 2MO0A 1M4VA 4GOPA 1ESFA 4GLVB 4ZYSA 5C4ZA 2VS1A 2Q2TA 2HDLA 3J7AV 1CHQD 2Z6BA 5FO8B 4QL5A 1Y8PB 3GTQB 1WTWA 3CCVA 1PRTF 2O2LD 2BDOA 3J80i 1Q82C 3G6JB 1QOHA 2IWHA 4B3RQ 2K5VA 1KD1C 3GTLH 2R7DA 3R93A 5AFWA 3NTIA 3PUXA 1J6QA 1S5CD 4LF7Q 1FL0A 5C3WA 1Q86C 2BDNA 2K14A 5M5WH 2QW7A 5A2QE 3KLWA 1CQFA 5IYBH 5IYDH 4IFDH 1WTOA 2EVBA 1VDZA 4MTKA 2Z4HA 2PQAB 4AYBB 3KDFA 3JAMi 4C3JB 5T1GA 4TQUS 4RGNA 1SMXA 2AWOA 4DUYL 4OO1H 5FLXE 1YJ9A 4OX9L 4K2LA 4CJ0B 2JEAI 1O7YA 1PDQA 1QG7A 4R4TA 1TWAH 5ELEA 1D5XC 4LFAQ 1Y1WB 2PPBC 2K5HA 1QILA 2WAQE 1C4QA 2RF4A 5IE8A 4BXXH 3CMAA 2FMCA 1PH6A 2BE5D 5CV6A 1KRSA 1JC7A 2MP1A 3T4AC 4OL7A 1PH9A 1RTOA 1BCPC 4V0BA 2MJ8A 5EBCA 3D0FA 3K7UC 5IGBA 2MGSA 1BQQT 4XQNA 3CCEA 1PH1A 1Z9FA 4LF5L 4OIKA 2XVSA 3LX0A 3CQZB 1TWFH 4KJNA 4HMIA 4QMGA 2CCZA 3CD6A 4LFBQ 4IUQA 5M9OA 1S3OA 2KHIA 2PMZE 1PTOD 4DAMA 2CHBD 1SXTA 1XWEA 5JJLA 3A8KE 2IY5B 4C56C 1ENCA 4RGMA 4BY7G 1HNWL 3DXJC 1SMYC 2ZXOA 3C1EA 5HURA 2RHQB 1B4OA 2I46A 5EPJA 4JI1Q 1A2TA 2JA7B 1PLFA 1V43A 2RDFA 1X54A 4HJ7A 2OXPA 4RGOS 2XWJB 4C3HH 4C1NI 2A68D 1VF7A 4B3ML 3OOCA 3GD7A 1AZQA 5E4WC 5ELDA 1VQKA 1LLRD 5IWAL 1WCMB 4FF3A 2F4IA 1RD9D 3HP3A 1HFNA 1F9SA 3TZUA 3NUCA 5D14A 3GTMH 2Z9HA 1K83H 3GTKB 5A35A 1BNZA 1EEID 3TMEA 3S1RH 2IT1A 4LF9L 2B2WA 4Z9CB 4KN4C 3KBGA 1EY4A 3R3OA 5BN5A 1QVFA 4DFAA 4ALPA 2RCFA 2QEXA 2AKWB 1VQOA 3H3VH 1M8AA 5CV5A 1Z47A 4RH6A 5CMDA 3KYHC 3VR4A 2UUAL 1STHA 4GKKL 4CDEC 1JICA 4JI3Q 1NTGA 2E2JB 3AEVA 2HQEA 4PZ7A 1YNJC 1CK1A 4KTAA 1IBKQ 1NCVA 3QIAA 2G9HD 2WIIB 3H09A 4MTNA 3T1HL 2Q2HA 1HNZL 3M85A 3S1MB 1S5DD 3TP7A 1D2BA 5I9PA 1GO3E 3OTOQ 2ZJQA 2SNMA 2UXBQ 2WP8J 5IOCA 1UUPA 5EPKA 1ML0D 1KLGD 2EJFC 1VF5C 2Z8LA 1YBYA 3EBEA 4KHZA 1GUSA 3HOVB 1CI3M 3DWAA 3EIVA 5IYCH 2BA0A 2D5DA 3ZJYC 4DR2L 1E0BA 1H9MA 1YI2A 1K0SA 4ABNA 1S40A 3BG3A 5KNCA 3A56A 1CSQA 1VQLA 3RLOA 1A62A 4N8FA 1KNAA 4C3JH 4JI4L 2I5LX 1GUOA 1SE2A 5C3EB 1JT8A 3A54A 1KHIA 2JP1A 4ODGA 4F87A 2L15A 3BZCA 3J81j 3RLFA 4R4CA 3BZDB 2OCEA 2A8VA 5IGDA 4GNXC 4CJ2C 3HOYG 2KVMA 4KD4A 1IW7C 1AFPA 1Y1WH 4LF8L 4C3IB 5FK9C 5KNBA 1Y14B 2ZTCA 1QVGA 5EQ0A 2YTXA 4B3SL 3K0XA 1IYJB 1DXMA 1ENFA 5BN3A 3DM1A 1CM9A 3MWYW 2E2DC 3J81L 1WTHA 1N33Q 5ELBA 2ALYB 2FMMA 4A3JG 2RQXA 4OONA 3CCQA 4HCSA 1PH3A 3KBXA 3A7AB 1VQFA 3QO2A 3R2TA 3CQZH 2ASBA 3S14B 1OXVA 3PCOB 1R4QB 4LF6Q 1RHPA 2EDGA 2X6GA 3HRZC 5FJ8G 2F0JA 2YV5A 4N9TA 4IOAA 4IURA 4FF1A 1SNQA 4DUZQ 3NBIA 1G6ZA 3HS0C 2R61A 4B3RL 1GJXA 3EVQA 2B2VC 1NR4A 2CQOA 4XQJA 1BXTA 3K6OA 2JA7H 1UEBA 3HG9A 4YWLA 2V4DA 5IODA 2UU9Q 4EQNA 1HZBA 1Y8NB 4Q5VA 4LF7L 2EYMA 3SHLA 1U4LA 4ULLA 1WJJA 2ZXPA 4ZUJA 4BBSG 5K36H 1H9JA 1X3QA 5BN4A 2VUMG 2EXDA 3CF5A 5F2DA 3BU2A 2WB1B 1WCMH 1G51A 1EFID 3HFZB 3MXNA 4MN3A 1A3UA 1U5KA 1STGA 2Q2UA 4HAEA 3BZKA 3QR8A 2O4XA 1JOKA 3VR2A 1SLJA 4A93G 2QA4A 1JOQA 2NZOA 5JJZA 1O7ZA 2JA6B 2Q2IA 5KIXA 4G7ZC 1YJWA 3V05A 4U68A 2PCFB 3GV6A 4HN7A 2QF7A 4NPSA 1KXLA 4LFAL 1UNSA 5C0XG 3KK7A 2AQ1B 1YHBA 2E2JH 4IPDA 5JPNC 5NUCA 1BDOA 3BVMA 1EYGA 3OMGA 4HR7B 4KKTA 3NTHA 1Q8KA 3NHHA 4HTHA 3S1QH 1HH2P 2A74C 2HCCA 3G7LA 4A4IA 3RR5A 1Q81C 1SE8A 3FMCA 3CP0A 3TS0A 2QDBA 1FJGQ 1CFMA 3J81c 1STYA 1Q1EA 3K7AB 5I2YA 2WAQG 3X3NA 3OHXC 3UDFA 2BCOA 4LFBL 2LXJA 4IUTA 3HOVH 5LMNQ 4JI6Q 1LUZA 1HUMA 3QB3A 1I4GA 1EY6A 2RKSA 1SYDA 2KQ3A 4KY6A 2NVQB 1H9SB 2NBFA 1SE4A 3FKIG 1YHAA 4JOIC 4DK1A 5JEAH 1BR9A 1LT3D 2IPKD 4JI1L 1I4XA 3WDNA 2OQ0A 4JI8Q 4DXFA 1LTAD 3PO2B 2A6HD 5C3EH 3PIO3 4IZ8A 3J81E 1F9RA 1V1PA 3SK6A 1QE6A 3BDOA 4XTCS 1SFOH 2R92G 3G48A 2HUGA 3QWNA 1PFBA 5GAGC 2JK8A 1CUKA 2N88A 4BWGB 4C3IH 1VQPA 3PO3G 3ULLA 4IJLA 1PFNA 4ZK9B 1E7ZA 1H9KA 2PYKA 5I2XA 2XNAC 4DV3Q 3TZDA 2PO4A 3DHQA 2B2TA 3P7JA 4DV2Q 1EY9A 3URYA 1E2VA 1T5XD 1I4QA 3U4VA 1Z6HA 3HOUB 3MVVA 5C44H 5LMUQ 2F3VA 4JI3L 2SNSA 2KHJA 3S14H 4TSSA 1STAA 3V2TA 1HUNA 4X3SA 4LNQA 4DV1Q 4QB4A 2AHOB 5C0XJ 4RCOA 1I4RA 5IGCA 4A3IB 1XJVA 1UE7A 3I56A 1JJ2A 4UP8A 4JYAQ 3S9WA 3AB9A 3OTOL 2VXWA 1HQMC 3FPPA 2DY8A 4L5SA 2GVAA 4L63B 3L0OA 3MXGA 2RCNA 4AIMA 3GTOH 2JA5B 1G6PA 1AN8A 3BDCA 2KOLA 1YVCA 4RHSA 1B50A 2NN6G 1PYWD 1T9HA 1A63A 1LTLA 1K9MC 1DOLA 1SJHD 1FD7D 1F2YA 1DOKA 1QNUA 4RWSC 1CKNB 4A3CH 2R7ZB 3OW7A 3CRKC 3W1GA 4A3BB 4A3FB 1UE1A 2B29A 4L8JA 2JE6I 4G57A 2F0VA 1QZHA 2JA6H 5I6YA 2K5WA 2EJGC 4DR1Q 1WTVA 5M5WB 1BCPD 1OXSC 2I5MX 4FDBA 2F0PA 1ET9A 2K5DA 2JN4A 3G6EA 4P75A 1LM0A 3GDEA 3ONAB 3EN2A 2QCPX 2N8NA 4YIJA 2RHSB 3DEPA 1HQRD 2F0UA 2F1MA 4J1MA 2EIFA 3WOEA 3NTKA 4BBRG 1L1OA 1SN8A 2P5ZX 4OGQC 5IYBG 4A3EH 5IYDG 1XNRQ 4IFDG 2F0GA 1SYGA 2UXDQ 1WYDA 1W2BA 1XNQQ 1L2FA 3PIOA 4NXNQ 1N33L 1JB3A 4M1UB 1SMYD 4LF4Q 4OO1G 1DOMA 4ZAIA 3K7AH 4PZ6A 1N8RC 1PH7A 2F0WA 4R8IA 5JJIA 4LF6L 2K52A 2X6LA 1NJIC 3ZYYX 1Y8OB 1WFQA 2F0DA 5AJ3Q 1VQDA 1RL2A 4DUZL 1Y1VH 2NVQH 3NWSA 1PRTC 4PMWA 3NSWA 3G4SA 2KECA 1RF2D 2I07B 5M3MH 1A8VA 3CCJA 1O80A 4IPGA 3ERSX 2HHHQ 1KQSA 4OWWB 4XXEA 3PO2H 4GNXA 2UU9L 4JV5Q 1RKNA 1P16A 2D9UA 4KKUA 3FEWX 5C4XG 1EY8A 3PUZA 4KY7A 2NVXB 2F03A 1I50B 4K8IA 3J80L 3P75A 2EJMA 1ZYRC 3MFGA 3HZXA 1NUCA 1CA6A 1V9PA 4CJ1B 5J3BA 1K73C 4JVZA 1CA5A 1LT4D 3E6ZX 1J5EQ 2F0NA 4L5QA 3HOWB 3STBC 3QJYA 2JEBI 3CKIB 1YNJD 4U673 4C3HB 3Q24A 3Q8DA 2HQLA 4A3KH 2KEEA 1K8AC 1PA6A 3HOUH 4KJOA 4A3LG 3CCMA 1E3PA 2HIXA 1O7IA 3JAML 5IP9H 3D31A 3VR6A 1IYVA 2WKCA 4P73A 1IL2A 4EQ5A 2VZAA 1HTPA 1Q3LA 2Z6KC 1SYEA 2RVLA 2J0TD 1VQCA 5M3FG 1HFGA 5CV8A 1XYIA 2A69C 1JMCA 3Q6SA 5EGTA 1FJGL 1R4PB 2JA5H 3BYYB 5I6WA 5LMNL 2VY3A 3NXWA 4DU9A 3GQBA 4JI6L 1YEZA 5GQOA 4LWCA 4KHPQ 2OT2A 1PFMA 4PZ8A 3K0YA 1C7YA 2R7ZH 4A3BH 2F0HA 1QUQA 1SR3A 5FLXc 1IW7D 5EPLA 4JI8L 4X64Q 4R1JA 4A3FH 4CDDC 1CTMA 3PF4A 1B3AA 2E8GA 4K14A 4LJZC 3K5NA 4JPBW 3VYTA 3F2UA 1SEBD 2AUJD 1F2MA 5C5MA 3Q0AA 4DK0A 3F2CA 1LYLA 4WORA 3KF8B 1E1OA 1IL8A 3ND8A 1GUTA 4FP5D 1DCZA 3CPFA 4KY5A 1L0WA 3KF6A 3J7ZC 1LO5D 4F8MA 3OMCA 4PG3A 4DV3L 5KNDA 5C6AA 3JC66 5JAVA 3M3YB 1GVPA 1EY0A 5ISRA 4ZCKA 4DAYB 4IQZA 2L55A 4JBMA 4AH6A 4UP9A 3E0EA 4QIWE 4DV2L 5CYUA 3MAQA 4AYBG 4UY8C 4C3JG 5LMUL 1STNA 1HTLD 4A3DB 2B8GA 2R93H 5G3LD 5J1ZA 1KTKA 1OXTA 2NWGA 4JOIA 1JJCB 5DLQE 3J80E 4DV1L 1VQJA 4O0AA 5EBDA 1XPUA 3I4LA 1DYQA 5FO7B 1JB7A 2YU9H 1XMQQ 4WJWA 4JYAL 3K57A 1Q46A 4HJ9A 1SNDA 2H5XA 4A3MB 1FNWA 2L9HA 2NVYB 4RGTA 4IPHA 2B39A 1Q90A 1BBWA 3EA6A 3LWUA 4IOCA 1MKHA 1U9RA 4ZRZA 3UE0A 1L0YB 3RUZA 1HA5A 3AYHB 4FVMA 1KL9A 1GUGA 2NVXH 3JAME 1HCZA 3SGIA 2ZXRA 1I50H 1UEAB 2C5CA 2PQAA 1Z7TA 3PMFA 1JCKB 1TT2A 4DV5Q 1H9RA 2B2YA 2E75C 1IBLQ 2UUBQ 5C0XI 2WFWA 3HOWH 1IKMA 4ZQ3A 2KENA 2RSOA 3MTSA 1NMGA 3CCRA 3PSIA 1D8LA 1HJPA 2HCIA 5DEHA 1SSOA 3VYSA 4X66Q 4DR1L 4DR6Q 1Q7YC 2JA7G 4L6TB 4BY1H 2IHEA 2BA1A 2EY6A 4LFCQ 2B2UA 3NPPA 3RZDB 2K7VA 5K36G 4FYDA 4DNRB 1WCMG 4IUVA 5GADC 1LTBD 2DNEA 1XNRL 1VQAA 2UXDL 1PMRA 1SDFA 1XNQL 4NXNL 4UP7A 1NMFA 4GLXA 2K33A 5CV9A 2NTTA 4LF4L 2XN9C 4X3UA 3CAMA 4BA1I 4EGVA 1EZ6A 4YY3Q 5EKLA 1P8LA 2AQ2B 1V1OA 1AW7A 1HR0Q 3FRPB 1PRTB 4FXKC 3HOXG 5FLMH 3MXPA 5AJ3L 4KI0A 3NBHB 1Y69U 1MSGA 2RBMA 1GD7A 5CV4A 4DK6C 2J4XA 4V190 3S1QB 4RKLA 3SK8A 3GTJB 2F4VQ 2HHHL 3D4RA 1A15A 2R6GA 4Y52H 1X3EA 3I3CA 4APVA 5CBEE 5CGKA 3L9AX 2L4NA 4JV5L 3TSSA 2L0CA 2ATWA 1UE6A 1TWGB 2K1BA 3TN2A 1AEXA 3U50C 1PH4A 2A6EC 1JE5A 4LUOA 3KLSA 3VA5A 3A8JE 3RMHA 4OWXB 1TR5A 5EJWA 1EUJA 3M4QA 4HMJA 3H0GB 1BBXC 1J5EL 3C3LA 2Y0SB 1SRUA 2QILA 2NTSA 4RHRA 3M3YH 3KJOA 1NR2A 3U9OA 1G2SA 2E2HH 3GO5A 2ZJPA 5M5XB 1HHVA 1SFOB 4BS9A 2UXCQ 3W1BA 1EL0A 1I6VC 4GKJL 4A3DH 3S2HB 3BYTB 4K0KQ 1IXRA 1EQTA 1CQVA 5D65A 1QZGA 2B63G 4ME3A 1CKMA 2EE1A 4HSVA 3ER0A 2NN6I 4A3MH 2NVYH 5C44B 3EJIA 2FJ2A 4Y7NB 3I72A 1LACA 4K8JA 1EIGA 3Q22A 1YJNA 3MZ5A 5IGGA 2CQAA 2ZT9C 4KHPL 5BR8Q 1X3GA 1AH9A 1RODA 2K75A 4ID6A 3H6MA 4XYOA 2PNRC 1NBWA 3HKZB 4CDFC 3BJUA 2AQ3B 4X64L 1VMPA 4LK1C 1KDBA 2DJGC 1IZ6A 3GTOB 3PF5A 2MPMA 2RSNA 4IUNA 4DR5Q 2CKZB 1VS0A 2DGYA 1TU2B 2G9DA 4O2DA 3NK9A 2DJFC 3HOZG 2XSCA 4IFDI 1NE3A 4X6AH 2PZUA 2AWNA 3M4OB 3RZDH 4OO1I 2JYOA 2JA8G 1IYUA 5KGUA 2WB1G 1SYBA 3N6RA 4ILWA 4JK1C 3MHBA 5GAHC 3KUPA 4B3TQ 1A3VA 3CHBD 1QJOA 3GTGB 1D5MC 3A74A 1K8OA 1PRTD 1HZAA 3I55A 4GOPC 2VQEQ 1M90C 1DONA 2EY1A 2JA6G 1ILPA 4M8AA 1TQOA 4JI2Q 1S5BD 4HIOA 4X62Q 2K4KA 4A3EB 1XMQL 2F52A 4UPAA 2FINB 1S72A 4R8NA 1TWCH 4XDXA 3I91A 3GTJH 5E7NA 4YCVA 4XYQA 1ZYRD 2Z4IA 5E3FA 1EU3A 3J81i 1TVXA 2A19A 2LMCB 4MIUA 4YCUA 1TWGH 1IBMQ 3STBD 5ELOA 4A3GG 2KCCA 3UDXA 2CVRA 2WAQB 2PI2A 2F0FA 2ZM6Q 1VQBA 1Y1VB 3KLSX 3OSOA 5FKAC 1HPCA 3H0GH 2F0SA 2YYZA 1KC8C 2PW7A 4DV5L 5M3MB 1IBLL 4QY7A 4FNFA 1WTPA 1I94Q 2UUBL 2XRSD 1V1QA 4JBJA 2QKIC 3VA7A 4NXMQ 3L3OC 2Z0SA 1A3TA 4GLAC 5DM73 1YNNC 4CGYB 5M5XH 5E4XA 4X66L 4DR6L 3I4NB 4IO9A 1SAPA 5IP7G 4AYBE 5HGTA 5KRUA 2VL6A 1XPRA 1I5FA 3K81C 3PO2G 1EFWA 3GP7A 3U9SA 3RLNA 2EYPA 1I6HB 2A69D 2PMZB 3S2HH 4KLKA 4LFCL 3SK4A 2R92B 1WOCA 2CH4A 3S2DH 3LNNA 2JJQA 3NWTA 3E0JA 3I8ZA 2UUCQ 2NB0A 3PO3B 3H3VI 3FP9A 4L5TA 1II3A 4A3KB 2EY2A 1KAAA 1XX8A 4YY3L 3PUVA 4Y7NH 1MHWC 1HR0L 1DM0B 2EXZA 5LL6X 3DM3A 4A3JH 2C9OA 2E5LQ 5GAEC 4K5XA 1H9SA 1G291 3QOJA 1TY0A 5J22A 2RA4A 3AFQA 1EOVA 1PTOF 4DV4Q 3EQLC 1NNXA 1MGSA 5FJ8H 1H95A 2F4VL 3VYRA 2ID0A 4DAPA 4DV7Q 3W2DA 1TS2A 2D2CC 2YTYA 2O5JC 4FO2A 4DR4Q 1D5ZC 1I3QH 4PMBA 4A3IG 5IGFA 4ME5A 4FF2A 3W3AA 1G2TA 4DNIA 2CH4W 2K01A 2KEDA 4FXDA 4KK7A 4B9WA 2LSSA 1VQIA 1MIUA 1SYFA 4UAIA 4NDXA 1LTRD 2FXQA 2ICEC 1WTRA 2RDHA 4FXGC 3SEBA 3M4OH 1JQYD 3WOFA 4TKOB 1E22A 1Q12A 1PYBA 1OTCA 2B2WC 5FO9B 1MJEA 1SNOA 3D6CA 5DNFA 3TS2A 5CORA 2N3SA 1IKLA 3CRLC 3TBIB 4CHTB 4X65L 1PHJA 1LT5D 1JE4A 4HIMA 1GM5A 2SEBD 1MSHA 2UXCL 4IPCA 3IAYA 4ZKBB 4A3BG 1PH8A 3GTGH 4A3FG 5EAYA 3KJPA 4DKAC 2VB3X 2L1BA 3PGZA 4WJ4A 2TSSA 2DY7A 4K0KL 4EX5A 1GUNA 5M5YB 5C0XH 2E2IH 1JWMD 2EYHA 1KLUD 3T56B 3H91A 4PQXA 2KUMA 3IFTA 4IJHA 4TRDA 3GTPH 2R93B 3K5LA 2NUCA 1XXGA 3QG1A 4K5VA 2EYJA 3N52A 5LMNW 1RJTA 3IFDA 5BR8L 4DV6Q 2ZTDA 2YU9B 1IHZA 4F7XA 3IL8A 1CKNA 1N9WA 4QQBX 1LABA 4BXXG 4OWTB 1JOOA 3E3XA 1F77A 1BBUA 4NKLA 1ICWA 4DR5L 3U4ZA 1VQMA 3CPWA 2KJXA 2KBNA 3LWEA 3I90A 3I4NH 2ENBA 2NZHA 4GS3A 5I4DA 4I7AA 4UHVA 5C4XB 3DUZA 1QB5D 4CKBA 1I6HH 1AZPA 2H4OA 2NZ1D 4QCLA 1LV9A 2R92H 2EQSA 2B3GA 4LAAA 3P20A 1ZKOA 3VR5A 3K5MA 4BA2I 3C46A 1GHJA 1QCBD 3E9HA 4C2MB 4QUFA 3D8GA 1SE3A 3S24A 1LT6D 3VDYA 1B53A 3F2DA 1PV4A 3AMUA 1K8MA 3PO3H 4B3TL 4GOPB 3F2BA 4JI7Q 4GN5A 5ELNA 3I4MB 5IGEA 3HOWG 1N34Q 2GN5A 3CC4A 2IJ0A 1EZ8A 1ONLA 1PTOB 2VQEL 1KDAA 4BY1B 4GKJQ 2VW9A 4C3HG 3CCLA 1EWIA 2MFIA 4JI2L 2CWAA 2EY5A 1CZWA 2B2VA 2EYLA 4QF4A 3BVZA 1FR3A 1Q1BA 4X62L 2A6ED 5IIFA 1LTID 3TP6A 4PV1C 4JI0Q 3VYUA 3AFPA 1EQQA 1NY4A 4IUPA 4IFDJ 2CW0C 3ITPA 5M3FB 4A76A 1IBML 3A5UA 1ZEQX 2Z1CA 4LUZA 3KDFB 2MQHA 1ASZA 4RKBA 2ZJRA 4DR7Q 2ZM6L 1WD0A 2K04A 4F88A 3T1YQ 5JOBA 2IL8A 2CWPA 3X3MA 4A75A 1FGBD 1I94L 2ICIA 5FLMG 2LKVA 3AQQA 2VQFQ 4NXML 2WB1E 1B3QA 2PI2E 3I70A 4O1NA 3S16B 3RN2A 1XTCD 5LHY1 3HKSA 4G4KA 3V96A 1FNVA 1VCIA 4ZKCB 1JJGA 3J80c 3C2PA 1BVSA 4J8QA 4NMZA 1EEFD 1ILQA 4NW2A 5IYCG 2UUCL 1GHKA 5M5YH 1SYCA 4POGA 2LS01 1AP0A 2MNAA 2E2HB 4P71A 4GN4B 4HSPA 2PQEA 1WVLA 1C8CA 4BBRH 2M2LA 3GV3A 2KA7A 5HY6A 2GVBA 2HDMA 1D7QA 4NB3A 1OO9B 1S4ZA 1BF4A 2E5LL 5GROA 4E6IA 1U4RA 1B44D 3JAMc 2QEJC 3QOLA 3TRZA 1SBBB 1VQ7A 2ZTEA 2A5HA 2HT1A 1M1KC 4H13C 4DV4L 4K6LA 4A3DG 1ZXTA 1Y1WG 5D3IB 4DV7L 2R7FA 3EROA 4DR4L 1ICFB 4RA8A 2MUYA 4QGUA 5EKIA 3KLRA 2PW5A 1MBYA 1F9PA 2XIWA 1KAWA 4A3MG 2H1EA 4JG2A 4QUCA 1VQ9A 3KF8A 3R2IA 3W5OA 1LTTD 4OIJA 3KOJA 5C4XH 3ULJA 2F0EA 1HNXQ 3M4PA 2SDFA 4RG1A 1KABA 3PV0A 3D4DA 3RD4A 1EIYB 3SK5A 5T1IA 1GOZA 4BY7B 4DAYA 4C2MH 3H15A 4R9WA 2B2TC 4JCVE 4KKSA 4DAVA 2D0PA 2EPBA 4P2CB 1DZ1A 1E1TA 2N78A 4DF7A 1GUWA 3AU7A 3ULPA 3I4MH 1K28A 2DNCA 1PFSA 3C1FA 1MI2A 4K2KA 4WRDA 2J7ZA 1CKOA 3OYYA 1PTOH 3PUYA 2OEOA 1XMOQ 1FVIA 2JSOA 2I0QA 1GXDC 4YHHQ 3F1ZA 1VQ5A 5KYIA 4A3LH 3I2ZA 3TP5A 3DEOA 1RDPD 3PQIA 1U0LA 1SROA 4OELB 1ET6A 3K80C 2IW3A 3TREA 2LFNA 4P74A 2VB2X 3ERQA 3UDIA 2TMPA 3I73A 1AE3A 1X56A 2WV6D 5M3FH 3NQTA 3PIP3 2KHSA 2HD3A 4B9XA 3TEHB 1CSPA 1U4MA 2XRQD 2PNHA 3TP8A 3OWFA 2M9VA 4DV6L 1YNND 3I4OA 4C1NK 4CBVA 3HOXB 2D0OA 4PNYA 1PZID 1TWCB 1YZ6A 2AMCB 1LTSD 1EU4A 5DM63 1TWHB 2OTLA 2Q8RE 1DGSA 3TDQA 1EYCA 1VMCA 1QVCA 1HZCA 3S16H 1RIPA 1CT1D 2Q8IB 3S17B 4EQOA 1XTDA 2EZVA 1U4PA 2DUDA 1JR0D 3A0JA 3GTQH 5J39A 3CC2A 2L11A 3CMEA 3S1NB 1DJRD 5EKKA 3T51B 4AQYQ 1C48A 2K03A 1BCPF 3RN5A 1EQRA 3HOVG 4KD3A 1L1OC 1EY7A 3MXUA 1MD2D 1C9OA 4X65Q 1EYDA 3H0GG 4JI7L 5JEAG 1N36Q 3M9BA 2Y0SG 3OWEB 1NAPA 2F0LA 1OXXK 2JXMB 1N34L 3T13A 4J15A 1KDCA 5C3EG 2R3ZA 4JI5Q 3SDZA 3CW2C 3S2DB 4IN3A 3T16A 1N32L 1EWCA 3HOYB 3FVQA 3NBHA 4DK3C 3OPOA 2F3IA 1B70B 3HEJA 1TIID 4C3IG 4JI0L 1ENAA 4RCNA 3PUWA 2B63B 4LUVA 1EYAA 2G5DA 1O7LA 4DA2A 4DGZA 2F0OA 3UI2A 5TSSA 1BOSA 3MXNB 1AE2A 3VR3A 2NYZD 3WWVA 4A3JB 4XT3B 2KCMA 1STBA 4CKCA 2HIVA 4J6HA 3L2PA 4DR7L 1PH2A 4Q0FA 5CR3A 5C44G 1WTQA 1PZJD 4R4IA 5I9OA 3T1YL 4H0LC 1Q8IA 5ELFA 1DD2A 2JA9A 4HIKA 4OEMB 1E24A 1S5FD 4BY7H 1B9MA 1VQGA 2VQFL 1I3QB 1HZ9A 3K5OA 3NENA 3EFXD 5C5LA 4CDCC 4XT1B 5CC4A 1O78A 2IX3A 2AUKA 1PZKD 2ES2A 3HKZG 3PIPA 4L5RC 2X69A 1SNMA 3E9IA 3S15B 1ASYA 4JW0A 3FDTA 2Z6KA 1STEA 5IT9L 1WI5A 1EWHA 2OQKA 2XGTA 4BBSB 4HIDA 3HOZB 2VUMB 2R7ZG 3J7YW 4DR3Q 4S3SA 1SNPA 4FF4A 1VQNA 1X9NA 4K6DA 2BE5C 5ELCA 1EIHA 2D62A 5E1FA 5C4HA 1OXUA 2RDGA 3F8TA 1F2ZA 1S5ED 5CBAE 4A3CG 1D1KA 2JA8B 5HGQA 3A5ZB 4I65A 2M00A 2N55A 4A93B 2K5NA 1B9NA 3CC7A 3M4YA 1JWSD 1J8IA 1QNKA 4LMQD 4R4OA 5JEAJ 5L37A 1D6EC 1F2LA 3L7ZC 1EQVA 1HR0W 3D3RA 3GTKH 4CKEA 4N8X1 4JBKA 1VQ6A 1RTNA 3LGJA 1PTOC 2IX0A 1WTXA 2E2IB 1X3PA 1PH5A 4YWKA 2SOBA 4GZYC 2EYFA 3HOXH 4IUUA 1V1PB 3TQYA 3E5SA 4JC0A 1PVOA 4QIWB 4PMCA 3SE0A 3GTPB 3NQIA 1TWHH 2NVTB 2PZTA 4NP5A 1EY5A 3OW2A 4A3EG 3U58A 4DV0Q 3J7A5 2YTVA 1BCPB 1SNCA 2A68C 2O5IC 2WINB 4MNOA 3S17H 2BOSA 3S1MH 2K32A 1B2TA 1HNXL 2A1AA 1R9TB 1A6XA 3OIPA 4A3GB 1X32A 3S1NH 2L5TA 1YIJA 2MHVA 4H44C 5KYLA 4WFN3 5KEEA 3J7AF 2K6AA 1K8GA 3FKIB 3MA2B 3H3VC 1Y1VG 4UDUC 3CU7A 1BO0A 2XTIA 1VQHA 4DXGA 2K28A 3R8BA 5M3MG 2L12A 3KFUA 1EIFA 2BH8A 4MZ9A 1XMOL 4G7OC 1YNXA 5IT9c 4YHHL 3RNUA 2JQOA 2CW0D 5G3LF 2FHTA 1PXUA 3BS1A 4HJ8A 3HOYH 3I4NG 2Q8TA 2QGQA 3D4WA 2WACA 3K59A 3M7GA 2N49A 2BH2A 4DPGA 2B63H 1GKHA 1F9QA 4ZUIA 1YHQA 2F3WA 3IRBA 1JORA 1HA6A 4R4QA 3UDGA 4A3KG 5IT9E 4DUYQ 2A73B 3BDLA 5C3XA 3HOUG 4OX9Q 5C4JB 3RZOB 1I4HA 2F0MA 3I7FA 2F0TA 2F0IA 1CHPD 5IP9G 3CCUA 3NE5B 5IY0A 3SR1A 5COYA 2B2YC 1UE5A 4LW1A 4RAUC 4DNTB 5H1SE 3A7LA 2F0KA 4HEDA 5DAUA 2OWOA 1X55A 2LXKA 1IBKL 3NELA 4H7BA 2OF1A 1JWUD 4KN7C 1K3RA 3S15H 1L1OB 4X3KA 3P1HA 1TS3A 1C0AA 2B2UC 4AQYL 2JA5G 1J9OA 4BBSH 2UXBL 3HOZH 2VUMH 1PYSB 3BVGA 2IHFA 1KIXA 4LF5Q 5CV7A 4H02A 2KCTA 1B1ZA 4KMUC 1RCVD 3K8AA 1V8QA 1N36L
chains in the Genus database with same CATH topology
4KV6A 5JVG3 1BUVT 1W6JA 2DN8A 3DMUA 5K5PA 5JVH3 1EOTA 3DWQA 3GTLB 4G7HC 1E2ZA 1CZGA 2GA4B 3ND9A 1TY2A 1G91A 1W6KA 1FNUA 1I4PA 2XWBB 4BBRB 2EYOA 5LL6S 4HCEA 4B08A 1WD1A 3D6WA 2K05A 3DWPA 4MHEA 4OHJA 1TKWB 5FOBB 3MC0B 1TWAB 1D1IA 2WKDA 3H94A 1A2UA 4IALA 5A2QL 1KNEA 1LTGD 2K5QA 1NSNS 3HGBA 1QWYA 1TS5A 2E74C 3MEHA 2IX1A 3A55A 3Q23A 2B8FA 3NP8A 3MFYA 4EQPA 5FLXL 3K58A 3M7NA 5D3DA 3OIQA 1TWFB 2F0QA 4K5WA 2PZWA 2FFKB 2EOTA 1E2WA 3FPUB 3O13A 4DN4M 4XQQA 1TS4A 1UAPA 1ESRA 5JPMC 4JBWA 4I7ZC 2E76C 3SVMA 1HXYD 1L0XB 1SJED 3SXHA 2VNUD 4XIGS 4O42A 4KHVA 3GTMB 2A6HC 1HRJA 1K83B 2KCNA 4EVOA 3S1RB 1G8ZD 4X3TA 1FYCA 2LY7A 1T5EA 4N9PA 3IKJA 2NN6H 3A8IE 4RFBA 3T53B 4ZLTF 1M4VA 1ESFA 4ZYSA 5C4ZA 2HDLA 3J7AV 1CHQD 5FO8B 1Y8PB 3GTQB 1WTWA 1PRTF 2O2LD 2BDOA 3G6JB 1QOHA 2IWHA 3R93A 5AFWA 3NTIA 3PUXA 1S5CD 5C3WA 2BDNA 5A2QE 1CQFA 4IFDH 1WTOA 2EVBA 1VDZA 2Z4HA 4AYBB 4C3JB 5T1GA 4TQUS 4RGNA 2AWOA 4OO1H 5FLXE 4K2LA 4CJ0B 2JEAI 1O7YA 1PDQA 1QG7A 5ELEA 1D5XC 1Y1WB 2PPBC 1QILA 1C4QA 2FMCA 2BE5D 5CV6A 1JC7A 2MP1A 3T4AC 4OL7A 1RTOA 1BCPC 4V0BA 2MJ8A 5EBCA 5IGBA 2MGSA 1BQQT 4XQNA 4OIKA 2XVSA 3LX0A 3CQZB 4KJNA 4HMIA 4QMGA 4IUQA 5M9OA 1PTOD 2CHBD 1SXTA 1XWEA 3A8KE 4C56C 1ENCA 4RGMA 3DXJC 1SMYC 2ZXOA 3C1EA 5HURA 1B4OA 2I46A 5EPJA 1A2TA 2JA7B 1PLFA 1V43A 2RDFA 2OXPA 4RGOS 2XWJB 4C1NI 2A68D 1VF7A 3OOCA 3GD7A 1AZQA 5E4WC 5ELDA 1LLRD 1WCMB 4FF3A 2F4IA 1RD9D 3HP3A 1HFNA 1F9SA 3TZUA 3NUCA 5D14A 3GTKB 5A35A 1BNZA 1EEID 3TMEA 2IT1A 2B2WA 4Z9CB 4KN4C 3KBGA 1EY4A 3R3OA 5BN5A 4DFAA 1M8AA 5CV5A 1Z47A 4RH6A 5CMDA 3VR4A 1STHA 1JICA 2E2JB 2HQEA 1YNJC 1CK1A 4KTAA 1NCVA 3QIAA 2G9HD 2WIIB 3H09A 3S1MB 3M85A 1S5DD 3TP7A 1D2BA 5I9PA 2SNMA 2WP8J 5IOCA 1UUPA 5EPKA 1ML0D 1KLGD 2EJFC 1VF5C 2Z8LA 4KHZA 1GUSA 3HOVB 1CI3M 3DWAA 2BA0A 2D5DA 1E0BA 1H9MA 4ABNA 3BG3A 5KNCA 3A56A 1KNAA 1GUOA 1SE2A 5C3EB 3A54A 4ODGA 2JP1A 4F87A 3RLFA 3BZDB 5IGDA 4CJ2C 2KVMA 4KD4A 1IW7C 1AFPA 4C3IB 5FK9C 5KNBA 5EQ0A 1DXMA 1ENFA 5BN3A 3DM1A 1CM9A 3MWYW 2E2DC 3J81L 5ELBA 2FMMA 2RQXA 4HCSA 3KBXA 3A7AB 3QO2A 3R2TA 3S14B 1OXVA 1R4QB 1RHPA 2EDGA 2X6GA 3HRZC 2F0JA 4N9TA 4IURA 4FF1A 1SNQA 3NBIA 1G6ZA 3HS0C 2R61A 1GJXA 3EVQA 2B2VC 1NR4A 4XQJA 1BXTA 3K6OA 3HG9A 2V4DA 5IODA 4EQNA 1Y8NB 4Q5VA 2EYMA 3SHLA 1U4LA 4ULLA 2ZXPA 4ZUJA 5K36H 1H9JA 1X3QA 5BN4A 5F2DA 2WB1B 1EFID 3MXNA 4MN3A 1A3UA 1STGA 4HAEA 2O4XA 1JOKA 3VR2A 1JOQA 5JJZA 1O7ZA 2JA6B 5KIXA 4G7ZC 3V05A 4U68A 2PCFB 3GV6A 4HN7A 2QF7A 1UNSA 5C0XG 3KK7A 2AQ1B 5JPNC 5NUCA 1BDOA 3BVMA 3OMGA 4HR7B 4KKTA 3NTHA 3NHHA 4HTHA 3G7LA 2A74C 2HCCA 3FMCA 2QDBA 1CFMA 1STYA 1Q1EA 3K7AB 5I2YA 3X3NA 3OHXC 2BCOA 4IUTA 1HUMA 3QB3A 1I4GA 1EY6A 2RKSA 1SYDA 2KQ3A 4KY6A 2NVQB 1H9SB 2NBFA 1SE4A 4DK1A 5JEAH 1BR9A 1LT3D 2IPKD 1I4XA 3WDNA 4DXFA 1LTAD 3PO2B 2A6HD 3PIO3 4IZ8A 3J81E 1F9RA 1V1PA 3SK6A 1QE6A 3BDOA 4XTCS 2HUGA 3QWNA 1PFBA 2N88A 4BWGB 1PFNA 4ZK9B 1H9KA 2PYKA 5I2XA 2XNAC 3TZDA 2PO4A 3DHQA 2B2TA 3P7JA 1EY9A 3URYA 1E2VA 1T5XD 1I4QA 1Z6HA 3HOUB 3MVVA 2F3VA 2SNSA 4TSSA 1STAA 3V2TA 1HUNA 4X3SA 4QB4A 5C0XJ 4RCOA 1I4RA 5IGCA 4A3IB 3S9WA 3AB9A 2VXWA 1HQMC 3FPPA 2DY8A 4L63B 3MXGA 2JA5B 1AN8A 3BDCA 2KOLA 4RHSA 1B50A 2NN6G 1PYWD 1DOLA 1SJHD 1FD7D 1F2YA 1DOKA 1QNUA 4RWSC 2R7ZB 3OW7A 3CRKC 4A3BB 4A3FB 4L8JA 2JE6I 4G57A 2F0VA 5I6YA 2K5WA 2EJGC 1WTVA 5M5WB 1BCPD 1OXSC 2F0PA 1ET9A 2K5DA 3ONAB 2QCPX 4YIJA 3DEPA 1HQRD 2F0UA 2F1MA 4J1MA 3WOEA 3NTKA 4OGQC 4IFDG 2F0GA 1SYGA 1JB3A 4M1UB 1SMYD 4OO1G 1DOMA 4ZAIA 2F0WA 4R8IA 2X6LA 3ZYYX 1Y8OB 2F0DA 3NWSA 1PRTC 4PMWA 3NSWA 2KECA 1RF2D 2I07B 1O80A 4XXEA 1RKNA 2D9UA 4KKUA 3FEWX 1EY8A 3PUZA 4KY7A 2NVXB 2F03A 1I50B 4K8IA 3J80L 3P75A 2EJMA 1ZYRC 3MFGA 3HZXA 1NUCA 1CA6A 4CJ1B 1CA5A 1LT4D 3E6ZX 2F0NA 3HOWB 3QJYA 2JEBI 3CKIB 1YNJD 4U673 4C3HB 3Q24A 2KEEA 4KJOA 3JAML 3D31A 3VR6A 1IYVA 2WKCA 1HTPA 1Q3LA 1SYEA 2RVLA 2J0TD 1HFGA 5CV8A 1XYIA 2A69C 3Q6SA 5EGTA 1R4PB 3BYYB 5I6WA 3NXWA 4DU9A 3GQBA 2OT2A 1PFMA 3K0YA 2F0HA 1IW7D 5EPLA 1CTMA 1B3AA 4K14A 4LJZC 3K5NA 3VYTA 3F2UA 1SEBD 2AUJD 1F2MA 5C5MA 3Q0AA 4DK0A 4WORA 1IL8A 3ND8A 1GUTA 4FP5D 1DCZA 4KY5A 1LO5D 4F8MA 3OMCA 3M3YB 5KNDA 5C6AA 5JAVA 1EY0A 5ISRA 4IQZA 2L55A 5CYUA 3MAQA 4C3JG 1STNA 1HTLD 4A3DB 2B8GA 5G3LD 5J1ZA 1KTKA 1OXTA 2NWGA 3J80E 5EBDA 3I4LA 1DYQA 5FO7B 4WJWA 3K57A 1SNDA 4A3MB 1FNWA 2L9HA 2NVYB 4RGTA 2B39A 1Q90A 3EA6A 3LWUA 1U9RA 4ZRZA 1L0YB 3RUZA 1HA5A 4FVMA 1GUGA 3JAME 1HCZA 2ZXRA 1UEAB 2C5CA 1Z7TA 3PMFA 1JCKB 1TT2A 1H9RA 2B2YA 2E75C 1IKMA 5C0XI 4ZQ3A 2RSOA 3MTSA 2HCIA 5DEHA 1SSOA 3VYSA 4L6TB 2BA1A 2EY6A 2B2UA 3NPPA 3RZDB 2K7VA 5K36G 4FYDA 4DNRB 4IUVA 1LTBD 2DNEA 1PMRA 1SDFA 2K33A 5CV9A 2NTTA 4BA1I 2XN9C 4X3UA 4EGVA 1EZ6A 5EKLA 2AQ2B 1V1OA 1AW7A 3FRPB 1PRTB 4FXKC 3MXPA 4KI0A 1Y69U 1MSGA 2RBMA 5CV4A 2J4XA 4V190 3S1QB 4RKLA 3SK8A 3GTJB 3D4RA 1A15A 2R6GA 3I3CA 5CBEE 5CGKA 3L9AX 2L4NA 3TSSA 2L0CA 1TWGB 2K1BA 3TN2A 1AEXA 2A6EC 3KLSA 3VA5A 3A8JE 3RMHA 1TR5A 5EJWA 4HMJA 3H0GB 1BBXC 3C3LA 2Y0SB 2QILA 2NTSA 4RHRA 1V8QA 1NR2A 3U9OA 1G2SA 3GO5A 5M5XB 1HHVA 1SFOB 4BS9A 1EL0A 1I6VC 3S2HB 3BYTB 1EQTA 1CQVA 5D65A 2EE1A 4HSVA 2NN6I 5C44B 3EJIA 2FJ2A 4Y7NB 3I72A 1LACA 4K8JA 1EIGA 3Q22A 3MZ5A 5IGGA 2CQAA 2ZT9C 1RODA 4ID6A 3H6MA 4XYOA 2PNRC 3HKZB 2AQ3B 1VMPA 4LK1C 1KDBA 3GTOB 2MPMA 2RSNA 4IUNA 1TU2B 2G9DA 3NK9A 2XSCA 4IFDI 2PZUA 2AWNA 3M4OB 4OO1I 2JYOA 1IYUA 5KGUA 1SYBA 3N6RA 4ILWA 4JK1C 3MHBA 3KUPA 1A3VA 3CHBD 1QJOA 3GTGB 1D5MC 1K8OA 1PRTD 1DONA 2EY1A 1ILPA 4M8AA 1TQOA 1S5BD 4A3EB 2FINB 4R8NA 4XDXA 3I91A 4XYQA 1ZYRD 2Z4IA 5E3FA 1EU3A 1TVXA 2LMCB 4MIUA 2KCCA 2CVRA 2WAQB 2F0FA 1Y1VB 3KLSX 3OSOA 5FKAC 1HPCA 2F0SA 2YYZA 2PW7A 5M3MB 4FNFA 1WTPA 2XRSD 2QKIC 3VA7A 3L3OC 1A3TA 5DM73 1YNNC 4CGYB 5E4XA 3I4NB 1SAPA 5HGTA 5KRUA 3GP7A 3U9SA 2EYPA 1I6HB 2A69D 2PMZB 3SK4A 2R92B 3LNNA 3NWTA 3E0JA 3I8ZA 2NB0A 3PO3B 1II3A 4A3KB 2EY2A 1KAAA 1XX8A 3PUVA 1DM0B 2EXZA 5LL6X 2C9OA 4K5XA 1H9SA 1G291 3QOJA 1TY0A 5J22A 2RA4A 1PTOF 3EQLC 1MGSA 3VYRA 2ID0A 4DAPA 3W2DA 1TS2A 2D2CC 2O5JC 4FO2A 1D5ZC 4PMBA 5IGFA 4ME5A 4FF2A 3W3AA 1G2TA 2K01A 2KEDA 4FXDA 4KK7A 4B9WA 1SYFA 4UAIA 4NDXA 1LTRD 2ICEC 1WTRA 2RDHA 4FXGC 3SEBA 1JQYD 3WOFA 4TKOB 1Q12A 2B2WC 5FO9B 1SNOA 3D6CA 5DNFA 5CORA 3TBIB 1IKLA 3CRLC 4CHTB 1LT5D 1JE4A 2SEBD 1MSHA 3IAYA 4ZKBB 2VB3X 2L1BA 2TSSA 2DY7A 1GUNA 5M5YB 5C0XH 1JWMD 2EYHA 1KLUD 3T56B 3H91A 4PQXA 2KUMA 3IFTA 4TRDA 2R93B 3K5LA 2NUCA 1XXGA 3QG1A 4K5VA 2EYJA 3N52A 1RJTA 3IFDA 2YU9B 1IHZA 4F7XA 3IL8A 1LABA 1JOOA 1F77A 4NKLA 1ICWA 2KJXA 3LWEA 3I90A 2ENBA 5I4DA 5C4XB 3DUZA 1QB5D 4CKBA 1AZPA 2H4OA 2NZ1D 4QCLA 1LV9A 3VR5A 3P20A 1ZKOA 4BA2I 3K5MA 3C46A 1GHJA 1QCBD 4C2MB 4QUFA 3D8GA 1SE3A 1LT6D 1B53A 3AMUA 1K8MA 3I4MB 5IGEA 2IJ0A 1EZ8A 1ONLA 1PTOB 4BY1B 1KDAA 4C3HG 2EY5A 1CZWA 2B2VA 2EYLA 4QF4A 3BVZA 1FR3A 1Q1BA 2A6ED 5IIFA 1LTID 3TP6A 4PV1C 3VYUA 4IUPA 4IFDJ 2CW0C 3ITPA 5M3FB 1ZEQX 2Z1CA 4RKBA 1WD0A 2K04A 4F88A 5JOBA 2IL8A 3X3MA 1FGBD 2ICIA 2LKVA 3I70A 4O1NA 3S16B 1XTCD 5LHY1 4G4KA 3V96A 1FNVA 1VCIA 4ZKCB 3C2PA 4J8QA 4NMZA 1EEFD 1ILQA 4NW2A 1GHKA 1SYCA 2LS01 1AP0A 2E2HB 4HSPA 2PQEA 1WVLA 1C8CA 2M2LA 3GV3A 2KA7A 2HDMA 1OO9B 1S4ZA 1BF4A 4E6IA 1U4RA 1B44D 2QEJC 3QOLA 1SBBB 2A5HA 4H13C 4K6LA 1ZXTA 5D3IB 3EROA 4RA8A 2MUYA 5EKIA 3KLRA 2PW5A 1MBYA 1F9PA 2XIWA 2H1EA 4QUCA 3KF8A 3R2IA 1LTTD 4OIJA 2F0EA 2SDFA 1KABA 3PV0A 3D4DA 3RD4A 3SK5A 5T1IA 1GOZA 4BY7B 4DAYA 4R9WA 2B2TC 4KKSA 4DAVA 2EPBA 4P2CB 1DZ1A 4DF7A 1GUWA 3AU7A 2DNCA 3C1FA 1MI2A 4K2KA 4WRDA 2J7ZA 1PTOH 3PUYA 2OEOA 2JSOA 1GXDC 5KYIA 3TP5A 3DEOA 1RDPD 1ET6A 2IW3A 2LFNA 2VB2X 3ERQA 2TMPA 3I73A 2WV6D 3NQTA 3PIP3 2KHSA 4B9XA 1U4MA 2XRQD 3TP8A 3OWFA 2M9VA 1YNND 4C1NK 4CBVA 3HOXB 4PNYA 1PZID 1TWCB 1LTSD 1EU4A 5DM63 1TWHB 2Q8RE 3TDQA 1EYCA 1VMCA 1CT1D 2Q8IB 3S17B 4EQOA 2EZVA 1U4PA 1JR0D 3S1NB 5J39A 2L11A 1DJRD 5EKKA 3T51B 1C48A 2K03A 1BCPF 4KD3A 1EY7A 3MXUA 1MD2D 1EYDA 5JEAG 1NAPA 3OWEB 2F0LA 1OXXK 2JXMB 3T13A 1KDCA 2R3ZA 3SDZA 3S2DB 4IN3A 3T16A 1EWCA 3HOYB 3FVQA 3NBHA 3OPOA 3HEJA 1TIID 4C3IG 1ENAA 4RCNA 3PUWA 2B63B 1EYAA 1O7LA 4DA2A 4DGZA 2F0OA 3UI2A 5TSSA 1BOSA 3VR3A 2NYZD 4A3JB 4XT3B 1STBA 4CKCA 4J6HA 4Q0FA 5CR3A 1WTQA 1PZJD 5I9OA 4H0LC 1Q8IA 5ELFA 1DD2A 1S5FD 1B9MA 1I3QB 3K5OA 3EFXD 5C5LA 4XT1B 5CC4A 1O78A 2IX3A 2AUKA 1PZKD 2X69A 1SNMA 3S15B 3FDTA 1STEA 5IT9L 1EWHA 4BBSB 3HOZB 2VUMB 3J7YW 4S3SA 1SNPA 4FF4A 4K6DA 2BE5C 5ELCA 1EIHA 2D62A 5E1FA 5C4HA 1OXUA 2RDGA 5CBAE 1F2ZA 1S5ED 1D1KA 2JA8B 4I65A 2M00A 2N55A 4A93B 1B9NA 1J8IA 3M4YA 1JWSD 1QNKA 4LMQD 5JEAJ 1D6EC 1F2LA 3L7ZC 1EQVA 3D3RA 4CKEA 1RTNA 1PTOC 2IX0A 1WTXA 2E2IB 1X3PA 2SOBA 4GZYC 2EYFA 4IUUA 1V1PB 3E5SA 4QIWB 4PMCA 3SE0A 3GTPB 3NQIA 2NVTB 2PZTA 4NP5A 1EY5A 1BCPB 1SNCA 2A68C 2O5IC 2WINB 2BOSA 2K32A 1B2TA 1R9TB 1A6XA 3OIPA 4A3GB 1X32A 2L5TA 2MHVA 4H44C 5KYLA 4WFN3 5KEEA 3J7AF 2K6AA 3FKIB 3MA2B 3H3VC 4UDUC 3CU7A 1BO0A 4DXGA 2K28A 3R8BA 2L12A 4G7OC 2CW0D 5G3LF 2FHTA 1PXUA 3BS1A 2Q8TA 3D4WA 2WACA 3K59A 3M7GA 1F9QA 4ZUIA 2F3WA 1JORA 1HA6A 5IT9E 2A73B 3BDLA 5C3XA 5C4JB 3RZOB 1I4HA 2F0MA 2F0TA 2F0IA 1CHPD 3NE5B 3SR1A 5COYA 2B2YC 4RAUC 4DNTB 3A7LA 2F0KA 4HEDA 5DAUA 4H7BA 2OF1A 1JWUD 4KN7C 4X3KA 3P1HA 1TS3A 2B2UC 1J9OA 3BVGA 5CV7A 1B1ZA 4KMUC 1RCVD 4LAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5D A; 
#chains in the Genus database with same CATH topology
 4KV6 A;  5JVG 3;  1XPO A;  2JA8 H;  1BUV T;  1W6J A;  1KRT A;  2DN8 A;  3DMU A;  4A93 H;  5K5P A;  1K0R A;  1HNW Q;  5JVH 3;  1EOT A;  4JI5 L;  3ICE A;  3DWQ A;  3GTL B;  4G7H C;  1K3B C;  1E2Z A;  1CZG A;  2GA4 B;  3ND9 A;  4GNX B;  1TY2 A;  1G91 A;  1W6K A;  4HJ5 A;  3G71 A;  4B3M Q;  1FNU A;  1I4P A;  4POF A;  2XWB B;  1MJC A;  4BBR B;  5IWA Q;  2EYO A;  5LL6 S;  4HCE A;  4B08 A;  4WJ3 M;  1WD1 A;  2NVT H;  3D6W A;  3DLL A;  2K05 A;  3DWP A;  4LF9 Q;  4MHE A;  2MO1 A;  4OHJ A;  3MEF A;  1TKW B;  2R93 G;  1R9T H;  5FOB B;  4A3G H;  3FHW A;  3MC0 B;  1TWA B;  1D1I A;  2WKD A;  3H94 A;  3UE1 A;  4TVA B;  2UUA Q;  3FKI H;  4GKK Q;  1A2U A;  4IAL A;  1X65 A;  5A2Q L;  1KNE A;  1LTG D;  4OXP A;  2K5Q A;  1NSN S;  3HGB A;  1QWY A;  1TS5 A;  3CXC A;  2Y0S E;  2E74 C;  5JJK A;  3MEH A;  2CFM A;  3T1H Q;  2IX1 A;  1HNZ Q;  3A55 A;  3Q23 A;  2B8F A;  3NP8 A;  3MFY A;  4RMF A;  4EQP A;  5FLX L;  1BKB A;  3K58 A;  3CCS A;  5IP7 H;  4DR3 L;  1UWV A;  3M7N A;  5D3D A;  3OIQ A;  1TWF B;  2F0Q A;  4K5W A;  2C35 B;  2PZW A;  2FFK B;  2EOT A;  4DR2 Q;  2QDL A;  1E2W A;  3FPU B;  3O13 A;  4DN4 M;  2OTJ A;  2I5H A;  4XQQ A;  1TS4 A;  1A0I A;  1UAP A;  4JI4 Q;  1ESR A;  1QUQ B;  5JPM C;  1N32 Q;  4JBW A;  4I7Z C;  3I4M G;  2E76 C;  5C4J H;  3RZO H;  4BY1 G;  3SVM A;  1HXY D;  1L0X B;  1SJE D;  3SXH A;  2VNU D;  1FGU A;  2K50 A;  4XIG S;  1B8A A;  4O42 A;  1VQ4 A;  4KHV A;  4LF8 Q;  3GTM B;  2A6H C;  4DV0 L;  1K83 B;  2KCN A;  4GN3 B;  4EVO A;  1HRJ A;  1X3F A;  4YWM A;  3KF6 B;  3NEM A;  3S1R B;  4P72 A;  1B7Y B;  4B3S Q;  1X6O A;  3HKZ E;  1G8Z D;  4X3T A;  4A3I H;  1FYC A;  1YIT A;  4HJA A;  1W3S A;  2LY7 A;  1T5E A;  4N9P A;  3IKJ A;  1VQ8 A;  2NN6 H;  2V1C C;  3A8I E;  4RFB A;  3T53 B;  4QJF A;  4ZLT F;  1TXY A;  4YCW A;  1VQE A;  3B6Y A;  2MO0 A;  1M4V A;  4GOP A;  1ESF A;  4GLV B;  4ZYS A;  5C4Z A;  2VS1 A;  2Q2T A;  2HDL A;  3J7A V;  1CHQ D;  2Z6B A;  5FO8 B;  4QL5 A;  1Y8P B;  3GTQ B;  1WTW A;  3CCV A;  1PRT F;  2O2L D;  2BDO A;  3J80 i;  1Q82 C;  3G6J B;  1QOH A;  2IWH A;  4B3R Q;  2K5V A;  1KD1 C;  3GTL H;  2R7D A;  3R93 A;  5AFW A;  3NTI A;  3PUX A;  1J6Q A;  1S5C D;  4LF7 Q;  1FL0 A;  5C3W A;  1Q86 C;  2BDN A;  2K14 A;  5M5W H;  2QW7 A;  5A2Q E;  3KLW A;  1CQF A;  5IYB H;  5IYD H;  4IFD H;  1WTO A;  2EVB A;  1VDZ A;  4MTK A;  2Z4H A;  2PQA B;  4AYB B;  3KDF A;  3JAM i;  4C3J B;  5T1G A;  4TQU S;  4RGN A;  1SMX A;  2AWO A;  4DUY L;  4OO1 H;  5FLX E;  1YJ9 A;  4OX9 L;  4K2L A;  4CJ0 B;  2JEA I;  1O7Y A;  1PDQ A;  1QG7 A;  4R4T A;  1TWA H;  5ELE A;  1D5X C;  4LFA Q;  1Y1W B;  2PPB C;  2K5H A;  1QIL A;  2WAQ E;  1C4Q A;  2RF4 A;  5IE8 A;  4BXX H;  3CMA A;  2FMC A;  1PH6 A;  2BE5 D;  5CV6 A;  1KRS A;  1JC7 A;  2MP1 A;  3T4A C;  4OL7 A;  1PH9 A;  1RTO A;  1BCP C;  4V0B A;  2MJ8 A;  5EBC A;  3D0F A;  3K7U C;  5IGB A;  2MGS A;  1BQQ T;  4XQN A;  3CCE A;  1PH1 A;  1Z9F A;  4LF5 L;  4OIK A;  2XVS A;  3LX0 A;  3CQZ B;  1TWF H;  4KJN A;  4HMI A;  4QMG A;  2CCZ A;  3CD6 A;  4LFB Q;  4IUQ A;  5M9O A;  1S3O A;  2KHI A;  2PMZ E;  1PTO D;  4DAM A;  2CHB D;  1SXT A;  1XWE A;  5JJL A;  3A8K E;  2IY5 B;  4C56 C;  1ENC A;  4RGM A;  4BY7 G;  1HNW L;  3DXJ C;  1SMY C;  2ZXO A;  3C1E A;  5HUR A;  2RHQ B;  1B4O A;  2I46 A;  5EPJ A;  4JI1 Q;  1A2T A;  2JA7 B;  1PLF A;  1V43 A;  2RDF A;  1X54 A;  4HJ7 A;  2OXP A;  4RGO S;  2XWJ B;  4C3H H;  4C1N I;  2A68 D;  1VF7 A;  4B3M L;  3OOC A;  3GD7 A;  1AZQ A;  5E4W C;  5ELD A;  1VQK A;  1LLR D;  5IWA L;  1WCM B;  4FF3 A;  2F4I A;  1RD9 D;  3HP3 A;  1HFN A;  1F9S A;  3TZU A;  3NUC A;  5D14 A;  3GTM H;  2Z9H A;  1K83 H;  3GTK B;  5A35 A;  1BNZ A;  1EEI D;  3TME A;  3S1R H;  2IT1 A;  4LF9 L;  2B2W A;  4Z9C B;  4KN4 C;  3KBG A;  1EY4 A;  3R3O A;  5BN5 A;  1QVF A;  4DFA A;  4ALP A;  2RCF A;  2QEX A;  2AKW B;  1VQO A;  3H3V H;  1M8A A;  5CV5 A;  1Z47 A;  4RH6 A;  5CMD A;  3KYH C;  3VR4 A;  2UUA L;  1STH A;  4GKK L;  4CDE C;  1JIC A;  4JI3 Q;  1NTG A;  2E2J B;  3AEV A;  2HQE A;  4PZ7 A;  1YNJ C;  1CK1 A;  4KTA A;  1IBK Q;  1NCV A;  3QIA A;  2G9H D;  2WII B;  3H09 A;  4MTN A;  3T1H L;  2Q2H A;  1HNZ L;  3M85 A;  3S1M B;  1S5D D;  3TP7 A;  1D2B A;  5I9P A;  1GO3 E;  3OTO Q;  2ZJQ A;  2SNM A;  2UXB Q;  2WP8 J;  5IOC A;  1UUP A;  5EPK A;  1ML0 D;  1KLG D;  2EJF C;  1VF5 C;  2Z8L A;  1YBY A;  3EBE A;  4KHZ A;  1GUS A;  3HOV B;  1CI3 M;  3DWA A;  3EIV A;  5IYC H;  2BA0 A;  2D5D A;  3ZJY C;  4DR2 L;  1E0B A;  1H9M A;  1YI2 A;  1K0S A;  4ABN A;  1S40 A;  3BG3 A;  5KNC A;  3A56 A;  1CSQ A;  1VQL A;  3RLO A;  1A62 A;  4N8F A;  1KNA A;  4C3J H;  4JI4 L;  2I5L X;  1GUO A;  1SE2 A;  5C3E B;  1JT8 A;  3A54 A;  1KHI A;  2JP1 A;  4ODG A;  4F87 A;  2L15 A;  3BZC A;  3J81 j;  3RLF A;  4R4C A;  3BZD B;  2OCE A;  2A8V A;  5IGD A;  4GNX C;  4CJ2 C;  3HOY G;  2KVM A;  4KD4 A;  1IW7 C;  1AFP A;  1Y1W H;  4LF8 L;  4C3I B;  5FK9 C;  5KNB A;  1Y14 B;  2ZTC A;  1QVG A;  5EQ0 A;  2YTX A;  4B3S L;  3K0X A;  1IYJ B;  1DXM A;  1ENF A;  5BN3 A;  3DM1 A;  1CM9 A;  3MWY W;  2E2D C;  3J81 L;  1WTH A;  1N33 Q;  5ELB A;  2ALY B;  2FMM A;  4A3J G;  2RQX A;  4OON A;  3CCQ A;  4HCS A;  1PH3 A;  3KBX A;  3A7A B;  1VQF A;  3QO2 A;  3R2T A;  3CQZ H;  2ASB A;  3S14 B;  1OXV A;  3PCO B;  1R4Q B;  4LF6 Q;  1RHP A;  2EDG A;  2X6G A;  3HRZ C;  5FJ8 G;  2F0J A;  2YV5 A;  4N9T A;  4IOA A;  4IUR A;  4FF1 A;  1SNQ A;  4DUZ Q;  3NBI A;  1G6Z A;  3HS0 C;  2R61 A;  4B3R L;  1GJX A;  3EVQ A;  2B2V C;  1NR4 A;  2CQO A;  4XQJ A;  1BXT A;  3K6O A;  2JA7 H;  1UEB A;  3HG9 A;  4YWL A;  2V4D A;  5IOD A;  2UU9 Q;  4EQN A;  1HZB A;  1Y8N B;  4Q5V A;  4LF7 L;  2EYM A;  3SHL A;  1U4L A;  4ULL A;  1WJJ A;  2ZXP A;  4ZUJ A;  4BBS G;  5K36 H;  1H9J A;  1X3Q A;  5BN4 A;  2VUM G;  2EXD A;  3CF5 A;  5F2D A;  3BU2 A;  2WB1 B;  1WCM H;  1G51 A;  1EFI D;  3HFZ B;  3MXN A;  4MN3 A;  1A3U A;  1U5K A;  1STG A;  2Q2U A;  4HAE A;  3BZK A;  3QR8 A;  2O4X A;  1JOK A;  3VR2 A;  1SLJ A;  4A93 G;  2QA4 A;  1JOQ A;  2NZO A;  5JJZ A;  1O7Z A;  2JA6 B;  2Q2I A;  5KIX A;  4G7Z C;  1YJW A;  3V05 A;  4U68 A;  2PCF B;  3GV6 A;  4HN7 A;  2QF7 A;  4NPS A;  1KXL A;  4LFA L;  1UNS A;  5C0X G;  3KK7 A;  2AQ1 B;  1YHB A;  2E2J H;  4IPD A;  5JPN C;  5NUC A;  1BDO A;  3BVM A;  1EYG A;  3OMG A;  4HR7 B;  4KKT A;  3NTH A;  1Q8K A;  3NHH A;  4HTH A;  3S1Q H;  1HH2 P;  2A74 C;  2HCC A;  3G7L A;  4A4I A;  3RR5 A;  1Q81 C;  1SE8 A;  3FMC A;  3CP0 A;  3TS0 A;  2QDB A;  1FJG Q;  1CFM A;  3J81 c;  1STY A;  1Q1E A;  3K7A B;  5I2Y A;  2WAQ G;  3X3N A;  3OHX C;  3UDF A;  2BCO A;  4LFB L;  2LXJ A;  4IUT A;  3HOV H;  5LMN Q;  4JI6 Q;  1LUZ A;  1HUM A;  3QB3 A;  1I4G A;  1EY6 A;  2RKS A;  1SYD A;  2KQ3 A;  4KY6 A;  2NVQ B;  1H9S B;  2NBF A;  1SE4 A;  3FKI G;  1YHA A;  4JOI C;  4DK1 A;  5JEA H;  1BR9 A;  1LT3 D;  2IPK D;  4JI1 L;  1I4X A;  3WDN A;  2OQ0 A;  4JI8 Q;  4DXF A;  1LTA D;  3PO2 B;  2A6H D;  5C3E H;  3PIO 3;  4IZ8 A;  3J81 E;  1F9R A;  1V1P A;  3SK6 A;  1QE6 A;  3BDO A;  4XTC S;  1SFO H;  2R92 G;  3G48 A;  2HUG A;  3QWN A;  1PFB A;  5GAG C;  2JK8 A;  1CUK A;  2N88 A;  4BWG B;  4C3I H;  1VQP A;  3PO3 G;  3ULL A;  4IJL A;  1PFN A;  4ZK9 B;  1E7Z A;  1H9K A;  2PYK A;  5I2X A;  2XNA C;  4DV3 Q;  3TZD A;  2PO4 A;  3DHQ A;  2B2T A;  3P7J A;  4DV2 Q;  1EY9 A;  3URY A;  1E2V A;  1T5X D;  1I4Q A;  3U4V A;  1Z6H A;  3HOU B;  3MVV A;  5C44 H;  5LMU Q;  2F3V A;  4JI3 L;  2SNS A;  2KHJ A;  3S14 H;  4TSS A;  1STA A;  3V2T A;  1HUN A;  4X3S A;  4LNQ A;  4DV1 Q;  4QB4 A;  2AHO B;  5C0X J;  4RCO A;  1I4R A;  5IGC A;  4A3I B;  1XJV A;  1UE7 A;  3I56 A;  1JJ2 A;  4UP8 A;  4JYA Q;  3S9W A;  3AB9 A;  3OTO L;  2VXW A;  1HQM C;  3FPP A;  2DY8 A;  4L5S A;  2GVA A;  4L63 B;  3L0O A;  3MXG A;  2RCN A;  4AIM A;  3GTO H;  2JA5 B;  1G6P A;  1AN8 A;  3BDC A;  2KOL A;  1YVC A;  4RHS A;  1B50 A;  2NN6 G;  1PYW D;  1T9H A;  1A63 A;  1LTL A;  1K9M C;  1DOL A;  1SJH D;  1FD7 D;  1F2Y A;  1DOK A;  1QNU A;  4RWS C;  1CKN B;  4A3C H;  2R7Z B;  3OW7 A;  3CRK C;  3W1G A;  4A3B B;  4A3F B;  1UE1 A;  2B29 A;  4L8J A;  2JE6 I;  4G57 A;  2F0V A;  1QZH A;  2JA6 H;  5I6Y A;  2K5W A;  2EJG C;  4DR1 Q;  1WTV A;  5M5W B;  1BCP D;  1OXS C;  2I5M X;  4FDB A;  2F0P A;  1ET9 A;  2K5D A;  2JN4 A;  3G6E A;  4P75 A;  1LM0 A;  3GDE A;  3ONA B;  3EN2 A;  2QCP X;  2N8N A;  4YIJ A;  2RHS B;  3DEP A;  1HQR D;  2F0U A;  2F1M A;  4J1M A;  2EIF A;  3WOE A;  3NTK A;  4BBR G;  1L1O A;  1SN8 A;  2P5Z X;  4OGQ C;  5IYB G;  4A3E H;  5IYD G;  1XNR Q;  4IFD G;  2F0G A;  1SYG A;  2UXD Q;  1WYD A;  1W2B A;  1XNQ Q;  1L2F A;  3PIO A;  4NXN Q;  1N33 L;  1JB3 A;  4M1U B;  1SMY D;  4LF4 Q;  4OO1 G;  1DOM A;  4ZAI A;  3K7A H;  4PZ6 A;  1N8R C;  1PH7 A;  2F0W A;  4R8I A;  5JJI A;  4LF6 L;  2K52 A;  2X6L A;  1NJI C;  3ZYY X;  1Y8O B;  1WFQ A;  2F0D A;  5AJ3 Q;  1VQD A;  1RL2 A;  4DUZ L;  1Y1V H;  2NVQ H;  3NWS A;  1PRT C;  4PMW A;  3NSW A;  3G4S A;  2KEC A;  1RF2 D;  2I07 B;  5M3M H;  1A8V A;  3CCJ A;  1O80 A;  4IPG A;  3ERS X;  2HHH Q;  1KQS A;  4OWW B;  4XXE A;  3PO2 H;  4GNX A;  2UU9 L;  4JV5 Q;  1RKN A;  1P16 A;  2D9U A;  4KKU A;  3FEW X;  5C4X G;  1EY8 A;  3PUZ A;  4KY7 A;  2NVX B;  2F03 A;  1I50 B;  4K8I A;  3J80 L;  3P75 A;  2EJM A;  1ZYR C;  3MFG A;  3HZX A;  1NUC A;  1CA6 A;  1V9P A;  4CJ1 B;  5J3B A;  1K73 C;  4JVZ A;  1CA5 A;  1LT4 D;  3E6Z X;  1J5E Q;  2F0N A;  4L5Q A;  3HOW B;  3STB C;  3QJY A;  2JEB I;  3CKI B;  1YNJ D;  4U67 3;  4C3H B;  3Q24 A;  3Q8D A;  2HQL A;  4A3K H;  2KEE A;  1K8A C;  1PA6 A;  3HOU H;  4KJO A;  4A3L G;  3CCM A;  1E3P A;  2HIX A;  1O7I A;  3JAM L;  5IP9 H;  3D31 A;  3VR6 A;  1IYV A;  2WKC A;  4P73 A;  1IL2 A;  4EQ5 A;  2VZA A;  1HTP A;  1Q3L A;  2Z6K C;  1SYE A;  2RVL A;  2J0T D;  1VQC A;  5M3F G;  1HFG A;  5CV8 A;  1XYI A;  2A69 C;  1JMC A;  3Q6S A;  5EGT A;  1FJG L;  1R4P B;  2JA5 H;  3BYY B;  5I6W A;  5LMN L;  2VY3 A;  3NXW A;  4DU9 A;  3GQB A;  4JI6 L;  1YEZ A;  5GQO A;  4LWC A;  4KHP Q;  2OT2 A;  1PFM A;  4PZ8 A;  3K0Y A;  1C7Y A;  2R7Z H;  4A3B H;  2F0H A;  1QUQ A;  1SR3 A;  5FLX c;  1IW7 D;  5EPL A;  4JI8 L;  4X64 Q;  4R1J A;  4A3F H;  4CDD C;  1CTM A;  3PF4 A;  1B3A A;  2E8G A;  4K14 A;  4LJZ C;  3K5N A;  4JPB W;  3VYT A;  3F2U A;  1SEB D;  2AUJ D;  1F2M A;  5C5M A;  3Q0A A;  4DK0 A;  3F2C A;  1LYL A;  4WOR A;  3KF8 B;  1E1O A;  1IL8 A;  3ND8 A;  1GUT A;  4FP5 D;  1DCZ A;  3CPF A;  4KY5 A;  1L0W A;  3KF6 A;  3J7Z C;  1LO5 D;  4F8M A;  3OMC A;  4PG3 A;  4DV3 L;  5KND A;  5C6A A;  3JC6 6;  5JAV A;  3M3Y B;  1GVP A;  1EY0 A;  5ISR A;  4ZCK A;  4DAY B;  4IQZ A;  2L55 A;  4JBM A;  4AH6 A;  4UP9 A;  3E0E A;  4QIW E;  4DV2 L;  5CYU A;  3MAQ A;  4AYB G;  4UY8 C;  4C3J G;  5LMU L;  1STN A;  1HTL D;  4A3D B;  2B8G A;  2R93 H;  5G3L D;  5J1Z A;  1KTK A;  1OXT A;  2NWG A;  4JOI A;  1JJC B;  5DLQ E;  3J80 E;  4DV1 L;  1VQJ A;  4O0A A;  5EBD A;  1XPU A;  3I4L A;  1DYQ A;  5FO7 B;  1JB7 A;  2YU9 H;  1XMQ Q;  4WJW A;  4JYA L;  3K57 A;  1Q46 A;  4HJ9 A;  1SND A;  2H5X A;  4A3M B;  1FNW A;  2L9H A;  2NVY B;  4RGT A;  4IPH A;  2B39 A;  1Q90 A;  1BBW A;  3EA6 A;  3LWU A;  4IOC A;  1MKH A;  1U9R A;  4ZRZ A;  3UE0 A;  1L0Y B;  3RUZ A;  1HA5 A;  3AYH B;  4FVM A;  1KL9 A;  1GUG A;  2NVX H;  3JAM E;  1HCZ A;  3SGI A;  2ZXR A;  1I50 H;  1UEA B;  2C5C A;  2PQA A;  1Z7T A;  3PMF A;  1JCK B;  1TT2 A;  4DV5 Q;  1H9R A;  2B2Y A;  2E75 C;  1IBL Q;  2UUB Q;  5C0X I;  2WFW A;  3HOW H;  1IKM A;  4ZQ3 A;  2KEN A;  2RSO A;  3MTS A;  1NMG A;  3CCR A;  3PSI A;  1D8L A;  1HJP A;  2HCI A;  5DEH A;  1SSO A;  3VYS A;  4X66 Q;  4DR1 L;  4DR6 Q;  1Q7Y C;  2JA7 G;  4L6T B;  4BY1 H;  2IHE A;  2BA1 A;  2EY6 A;  4LFC Q;  2B2U A;  3NPP A;  3RZD B;  2K7V A;  5K36 G;  4FYD A;  4DNR B;  1WCM G;  4IUV A;  5GAD C;  1LTB D;  2DNE A;  1XNR L;  1VQA A;  2UXD L;  1PMR A;  1SDF A;  1XNQ L;  4NXN L;  4UP7 A;  1NMF A;  4GLX A;  2K33 A;  5CV9 A;  2NTT A;  4LF4 L;  2XN9 C;  4X3U A;  3CAM A;  4BA1 I;  4EGV A;  1EZ6 A;  4YY3 Q;  5EKL A;  1P8L A;  2AQ2 B;  1V1O A;  1AW7 A;  1HR0 Q;  3FRP B;  1PRT B;  4FXK C;  3HOX G;  5FLM H;  3MXP A;  5AJ3 L;  4KI0 A;  3NBH B;  1Y69 U;  1MSG A;  2RBM A;  1GD7 A;  5CV4 A;  4DK6 C;  2J4X A;  4V19 0;  3S1Q B;  4RKL A;  3SK8 A;  3GTJ B;  2F4V Q;  2HHH L;  3D4R A;  1A15 A;  2R6G A;  4Y52 H;  1X3E A;  3I3C A;  4APV A;  5CBE E;  5CGK A;  3L9A X;  2L4N A;  4JV5 L;  3TSS A;  2L0C A;  2ATW A;  1UE6 A;  1TWG B;  2K1B A;  3TN2 A;  1AEX A;  3U50 C;  1PH4 A;  2A6E C;  1JE5 A;  4LUO A;  3KLS A;  3VA5 A;  3A8J E;  3RMH A;  4OWX B;  1TR5 A;  5EJW A;  1EUJ A;  3M4Q A;  4HMJ A;  3H0G B;  1BBX C;  1J5E L;  3C3L A;  2Y0S B;  1SRU A;  2QIL A;  2NTS A;  4RHR A;  3M3Y H;  3KJO A;  1NR2 A;  3U9O A;  1G2S A;  2E2H H;  3GO5 A;  2ZJP A;  5M5X B;  1HHV A;  1SFO B;  4BS9 A;  2UXC Q;  3W1B A;  1EL0 A;  1I6V C;  4GKJ L;  4A3D H;  3S2H B;  3BYT B;  4K0K Q;  1IXR A;  1EQT A;  1CQV A;  5D65 A;  1QZG A;  2B63 G;  4ME3 A;  1CKM A;  2EE1 A;  4HSV A;  3ER0 A;  2NN6 I;  4A3M H;  2NVY H;  5C44 B;  3EJI A;  2FJ2 A;  4Y7N B;  3I72 A;  1LAC A;  4K8J A;  1EIG A;  3Q22 A;  1YJN A;  3MZ5 A;  5IGG A;  2CQA A;  2ZT9 C;  4KHP L;  5BR8 Q;  1X3G A;  1AH9 A;  1ROD A;  2K75 A;  4ID6 A;  3H6M A;  4XYO A;  2PNR C;  1NBW A;  3HKZ B;  4CDF C;  3BJU A;  2AQ3 B;  4X64 L;  1VMP A;  4LK1 C;  1KDB A;  2DJG C;  1IZ6 A;  3GTO B;  3PF5 A;  2MPM A;  2RSN A;  4IUN A;  4DR5 Q;  2CKZ B;  1VS0 A;  2DGY A;  1TU2 B;  2G9D A;  4O2D A;  3NK9 A;  2DJF C;  3HOZ G;  2XSC A;  4IFD I;  1NE3 A;  4X6A H;  2PZU A;  2AWN A;  3M4O B;  3RZD H;  4OO1 I;  2JYO A;  2JA8 G;  1IYU A;  5KGU A;  2WB1 G;  1SYB A;  3N6R A;  4ILW A;  4JK1 C;  3MHB A;  5GAH C;  3KUP A;  4B3T Q;  1A3V A;  3CHB D;  1QJO A;  3GTG B;  1D5M C;  3A74 A;  1K8O A;  1PRT D;  1HZA A;  3I55 A;  4GOP C;  2VQE Q;  1M90 C;  1DON A;  2EY1 A;  2JA6 G;  1ILP A;  4M8A A;  1TQO A;  4JI2 Q;  1S5B D;  4HIO A;  4X62 Q;  2K4K A;  4A3E B;  1XMQ L;  2F52 A;  4UPA A;  2FIN B;  1S72 A;  4R8N A;  1TWC H;  4XDX A;  3I91 A;  3GTJ H;  5E7N A;  4YCV A;  4XYQ A;  1ZYR D;  2Z4I A;  5E3F A;  1EU3 A;  3J81 i;  1TVX A;  2A19 A;  2LMC B;  4MIU A;  4YCU A;  1TWG H;  1IBM Q;  3STB D;  5ELO A;  4A3G G;  2KCC A;  3UDX A;  2CVR A;  2WAQ B;  2PI2 A;  2F0F A;  2ZM6 Q;  1VQB A;  1Y1V B;  3KLS X;  3OSO A;  5FKA C;  1HPC A;  3H0G H;  2F0S A;  2YYZ A;  1KC8 C;  2PW7 A;  4DV5 L;  5M3M B;  1IBL L;  4QY7 A;  4FNF A;  1WTP A;  1I94 Q;  2UUB L;  2XRS D;  1V1Q A;  4JBJ A;  2QKI C;  3VA7 A;  4NXM Q;  3L3O C;  2Z0S A;  1A3T A;  4GLA C;  5DM7 3;  1YNN C;  4CGY B;  5M5X H;  5E4X A;  4X66 L;  4DR6 L;  3I4N B;  4IO9 A;  1SAP A;  5IP7 G;  4AYB E;  5HGT A;  5KRU A;  2VL6 A;  1XPR A;  1I5F A;  3K81 C;  3PO2 G;  1EFW A;  3GP7 A;  3U9S A;  3RLN A;  2EYP A;  1I6H B;  2A69 D;  2PMZ B;  3S2H H;  4KLK A;  4LFC L;  3SK4 A;  2R92 B;  1WOC A;  2CH4 A;  3S2D H;  3LNN A;  2JJQ A;  3NWT A;  3E0J A;  3I8Z A;  2UUC Q;  2NB0 A;  3PO3 B;  3H3V I;  3FP9 A;  4L5T A;  1II3 A;  4A3K B;  2EY2 A;  1KAA A;  1XX8 A;  4YY3 L;  3PUV A;  4Y7N H;  1MHW C;  1HR0 L;  1DM0 B;  2EXZ A;  5LL6 X;  3DM3 A;  4A3J H;  2C9O A;  2E5L Q;  5GAE C;  4K5X A;  1H9S A;  1G29 1;  3QOJ A;  1TY0 A;  5J22 A;  2RA4 A;  3AFQ A;  1EOV A;  1PTO F;  4DV4 Q;  3EQL C;  1NNX A;  1MGS A;  5FJ8 H;  1H95 A;  2F4V L;  3VYR A;  2ID0 A;  4DAP A;  4DV7 Q;  3W2D A;  1TS2 A;  2D2C C;  2YTY A;  2O5J C;  4FO2 A;  4DR4 Q;  1D5Z C;  1I3Q H;  4PMB A;  4A3I G;  5IGF A;  4ME5 A;  4FF2 A;  3W3A A;  1G2T A;  4DNI A;  2CH4 W;  2K01 A;  2KED A;  4FXD A;  4KK7 A;  4B9W A;  2LSS A;  1VQI A;  1MIU A;  1SYF A;  4UAI A;  4NDX A;  1LTR D;  2FXQ A;  2ICE C;  1WTR A;  2RDH A;  4FXG C;  3SEB A;  3M4O H;  1JQY D;  3WOF A;  4TKO B;  1E22 A;  1Q12 A;  1PYB A;  1OTC A;  2B2W C;  5FO9 B;  1MJE A;  1SNO A;  3D6C A;  5DNF A;  3TS2 A;  5COR A;  2N3S A;  1IKL A;  3CRL C;  3TBI B;  4CHT B;  4X65 L;  1PHJ A;  1LT5 D;  1JE4 A;  4HIM A;  1GM5 A;  2SEB D;  1MSH A;  2UXC L;  4IPC A;  3IAY A;  4ZKB B;  4A3B G;  1PH8 A;  3GTG H;  4A3F G;  5EAY A;  3KJP A;  4DKA C;  2VB3 X;  2L1B A;  3PGZ A;  4WJ4 A;  2TSS A;  2DY7 A;  4K0K L;  4EX5 A;  1GUN A;  5M5Y B;  5C0X H;  2E2I H;  1JWM D;  2EYH A;  1KLU D;  3T56 B;  3H91 A;  4PQX A;  2KUM A;  3IFT A;  4IJH A;  4TRD A;  3GTP H;  2R93 B;  3K5L A;  2NUC A;  1XXG A;  3QG1 A;  4K5V A;  2EYJ A;  3N52 A;  5LMN W;  1RJT A;  3IFD A;  5BR8 L;  4DV6 Q;  2ZTD A;  2YU9 B;  1IHZ A;  4F7X A;  3IL8 A;  1CKN A;  1N9W A;  4QQB X;  1LAB A;  4BXX G;  4OWT B;  1JOO A;  3E3X A;  1F77 A;  1BBU A;  4NKL A;  1ICW A;  4DR5 L;  3U4Z A;  1VQM A;  3CPW A;  2KJX A;  2KBN A;  3LWE A;  3I90 A;  3I4N H;  2ENB A;  2NZH A;  4GS3 A;  5I4D A;  4I7A A;  4UHV A;  5C4X B;  3DUZ A;  1QB5 D;  4CKB A;  1I6H H;  1AZP A;  2H4O A;  2NZ1 D;  4QCL A;  1LV9 A;  2R92 H;  2EQS A;  2B3G A;  4LAA A;  3P20 A;  1ZKO A;  3VR5 A;  3K5M A;  4BA2 I;  3C46 A;  1GHJ A;  1QCB D;  3E9H A;  4C2M B;  4QUF A;  3D8G A;  1SE3 A;  3S24 A;  1LT6 D;  3VDY A;  1B53 A;  3F2D A;  1PV4 A;  3AMU A;  1K8M A;  3PO3 H;  4B3T L;  4GOP B;  3F2B A;  4JI7 Q;  4GN5 A;  5ELN A;  3I4M B;  5IGE A;  3HOW G;  1N34 Q;  2GN5 A;  3CC4 A;  2IJ0 A;  1EZ8 A;  1ONL A;  1PTO B;  2VQE L;  1KDA A;  4BY1 B;  4GKJ Q;  2VW9 A;  4C3H G;  3CCL A;  1EWI A;  2MFI A;  4JI2 L;  2CWA A;  2EY5 A;  1CZW A;  2B2V A;  2EYL A;  4QF4 A;  3BVZ A;  1FR3 A;  1Q1B A;  4X62 L;  2A6E D;  5IIF A;  1LTI D;  3TP6 A;  4PV1 C;  4JI0 Q;  3VYU A;  3AFP A;  1EQQ A;  1NY4 A;  4IUP A;  4IFD J;  2CW0 C;  3ITP A;  5M3F B;  4A76 A;  1IBM L;  3A5U A;  1ZEQ X;  2Z1C A;  4LUZ A;  3KDF B;  2MQH A;  1ASZ A;  4RKB A;  2ZJR A;  4DR7 Q;  2ZM6 L;  1WD0 A;  2K04 A;  4F88 A;  3T1Y Q;  5JOB A;  2IL8 A;  2CWP A;  3X3M A;  4A75 A;  1FGB D;  1I94 L;  2ICI A;  5FLM G;  2LKV A;  3AQQ A;  2VQF Q;  4NXM L;  2WB1 E;  1B3Q A;  2PI2 E;  3I70 A;  4O1N A;  3S16 B;  3RN2 A;  1XTC D;  5LHY 1;  3HKS A;  4G4K A;  3V96 A;  1FNV A;  1VCI A;  4ZKC B;  1JJG A;  3J80 c;  3C2P A;  1BVS A;  4J8Q A;  4NMZ A;  1EEF D;  1ILQ A;  4NW2 A;  5IYC G;  2UUC L;  1GHK A;  5M5Y H;  1SYC A;  4POG A;  2LS0 1;  1AP0 A;  2MNA A;  2E2H B;  4P71 A;  4GN4 B;  4HSP A;  2PQE A;  1WVL A;  1C8C A;  4BBR H;  2M2L A;  3GV3 A;  2KA7 A;  5HY6 A;  2GVB A;  2HDM A;  1D7Q A;  4NB3 A;  1OO9 B;  1S4Z A;  1BF4 A;  2E5L L;  5GRO A;  4E6I A;  1U4R A;  1B44 D;  3JAM c;  2QEJ C;  3QOL A;  3TRZ A;  1SBB B;  1VQ7 A;  2ZTE A;  2A5H A;  2HT1 A;  1M1K C;  4H13 C;  4DV4 L;  4K6L A;  4A3D G;  1ZXT A;  1Y1W G;  5D3I B;  4DV7 L;  2R7F A;  3ERO A;  4DR4 L;  1ICF B;  4RA8 A;  2MUY A;  4QGU A;  5EKI A;  3KLR A;  2PW5 A;  1MBY A;  1F9P A;  2XIW A;  1KAW A;  4A3M G;  2H1E A;  4JG2 A;  4QUC A;  1VQ9 A;  3KF8 A;  3R2I A;  3W5O A;  1LTT D;  4OIJ A;  3KOJ A;  5C4X H;  3ULJ A;  2F0E A;  1HNX Q;  3M4P A;  2SDF A;  4RG1 A;  1KAB A;  3PV0 A;  3D4D A;  3RD4 A;  1EIY B;  3SK5 A;  5T1I A;  1GOZ A;  4BY7 B;  4DAY A;  4C2M H;  3H15 A;  4R9W A;  2B2T C;  4JCV E;  4KKS A;  4DAV A;  2D0P A;  2EPB A;  4P2C B;  1DZ1 A;  1E1T A;  2N78 A;  4DF7 A;  1GUW A;  3AU7 A;  3ULP A;  3I4M H;  1K28 A;  2DNC A;  1PFS A;  3C1F A;  1MI2 A;  4K2K A;  4WRD A;  2J7Z A;  1CKO A;  3OYY A;  1PTO H;  3PUY A;  2OEO A;  1XMO Q;  1FVI A;  2JSO A;  2I0Q A;  1GXD C;  4YHH Q;  3F1Z A;  1VQ5 A;  5KYI A;  4A3L H;  3I2Z A;  3TP5 A;  3DEO A;  1RDP D;  3PQI A;  1U0L A;  1SRO A;  4OEL B;  1ET6 A;  3K80 C;  2IW3 A;  3TRE A;  2LFN A;  4P74 A;  2VB2 X;  3ERQ A;  3UDI A;  2TMP A;  3I73 A;  1AE3 A;  1X56 A;  2WV6 D;  5M3F H;  3NQT A;  3PIP 3;  2KHS A;  2HD3 A;  4B9X A;  3TEH B;  1CSP A;  1U4M A;  2XRQ D;  2PNH A;  3TP8 A;  3OWF A;  2M9V A;  4DV6 L;  1YNN D;  3I4O A;  4C1N K;  4CBV A;  3HOX B;  2D0O A;  4PNY A;  1PZI D;  1TWC B;  1YZ6 A;  2AMC B;  1LTS D;  1EU4 A;  5DM6 3;  1TWH B;  2OTL A;  2Q8R E;  1DGS A;  3TDQ A;  1EYC A;  1VMC A;  1QVC A;  1HZC A;  3S16 H;  1RIP A;  1CT1 D;  2Q8I B;  3S17 B;  4EQO A;  1XTD A;  2EZV A;  1U4P A;  2DUD A;  1JR0 D;  3A0J A;  3GTQ H;  5J39 A;  3CC2 A;  2L11 A;  3CME A;  3S1N B;  1DJR D;  5EKK A;  3T51 B;  4AQY Q;  1C48 A;  2K03 A;  1BCP F;  3RN5 A;  1EQR A;  3HOV G;  4KD3 A;  1L1O C;  1EY7 A;  3MXU A;  1MD2 D;  1C9O A;  4X65 Q;  1EYD A;  3H0G G;  4JI7 L;  5JEA G;  1N36 Q;  3M9B A;  2Y0S G;  3OWE B;  1NAP A;  2F0L A;  1OXX K;  2JXM B;  1N34 L;  3T13 A;  4J15 A;  1KDC A;  5C3E G;  2R3Z A;  4JI5 Q;  3SDZ A;  3CW2 C;  3S2D B;  4IN3 A;  3T16 A;  1N32 L;  1EWC A;  3HOY B;  3FVQ A;  3NBH A;  4DK3 C;  3OPO A;  2F3I A;  1B70 B;  3HEJ A;  1TII D;  4C3I G;  4JI0 L;  1ENA A;  4RCN A;  3PUW A;  2B63 B;  4LUV A;  1EYA A;  2G5D A;  1O7L A;  4DA2 A;  4DGZ A;  2F0O A;  3UI2 A;  5TSS A;  1BOS A;  3MXN B;  1AE2 A;  3VR3 A;  2NYZ D;  3WWV A;  4A3J B;  4XT3 B;  2KCM A;  1STB A;  4CKC A;  2HIV A;  4J6H A;  3L2P A;  4DR7 L;  1PH2 A;  4Q0F A;  5CR3 A;  5C44 G;  1WTQ A;  1PZJ D;  4R4I A;  5I9O A;  3T1Y L;  4H0L C;  1Q8I A;  5ELF A;  1DD2 A;  2JA9 A;  4HIK A;  4OEM B;  1E24 A;  1S5F D;  4BY7 H;  1B9M A;  1VQG A;  2VQF L;  1I3Q B;  1HZ9 A;  3K5O A;  3NEN A;  3EFX D;  5C5L A;  4CDC C;  4XT1 B;  5CC4 A;  1O78 A;  2IX3 A;  2AUK A;  1PZK D;  2ES2 A;  3HKZ G;  3PIP A;  4L5R C;  2X69 A;  1SNM A;  3E9I A;  3S15 B;  1ASY A;  4JW0 A;  3FDT A;  2Z6K A;  1STE A;  5IT9 L;  1WI5 A;  1EWH A;  2OQK A;  2XGT A;  4BBS B;  4HID A;  3HOZ B;  2VUM B;  2R7Z G;  3J7Y W;  4DR3 Q;  4S3S A;  1SNP A;  4FF4 A;  1VQN A;  1X9N A;  4K6D A;  2BE5 C;  5ELC A;  1EIH A;  2D62 A;  5E1F A;  5C4H A;  1OXU A;  2RDG A;  3F8T A;  1F2Z A;  1S5E D;  5CBA E;  4A3C G;  1D1K A;  2JA8 B;  5HGQ A;  3A5Z B;  4I65 A;  2M00 A;  2N55 A;  4A93 B;  2K5N A;  1B9N A;  3CC7 A;  3M4Y A;  1JWS D;  1J8I A;  1QNK A;  4LMQ D;  4R4O A;  5JEA J;  5L37 A;  1D6E C;  1F2L A;  3L7Z C;  1EQV A;  1HR0 W;  3D3R A;  3GTK H;  4CKE A;  4N8X 1;  4JBK A;  1VQ6 A;  1RTN A;  3LGJ A;  1PTO C;  2IX0 A;  1WTX A;  2E2I B;  1X3P A;  1PH5 A;  4YWK A;  2SOB A;  4GZY C;  2EYF A;  3HOX H;  4IUU A;  1V1P B;  3TQY A;  3E5S A;  4JC0 A;  1PVO A;  4QIW B;  4PMC A;  3SE0 A;  3GTP B;  3NQI A;  1TWH H;  2NVT B;  2PZT A;  4NP5 A;  1EY5 A;  3OW2 A;  4A3E G;  3U58 A;  4DV0 Q;  3J7A 5;  2YTV A;  1BCP B;  1SNC A;  2A68 C;  2O5I C;  2WIN B;  4MNO A;  3S17 H;  2BOS A;  3S1M H;  2K32 A;  1B2T A;  1HNX L;  2A1A A;  1R9T B;  1A6X A;  3OIP A;  4A3G B;  1X32 A;  3S1N H;  2L5T A;  1YIJ A;  2MHV A;  4H44 C;  5KYL A;  4WFN 3;  5KEE A;  3J7A F;  2K6A A;  1K8G A;  3FKI B;  3MA2 B;  3H3V C;  1Y1V G;  4UDU C;  3CU7 A;  1BO0 A;  2XTI A;  1VQH A;  4DXG A;  2K28 A;  3R8B A;  5M3M G;  2L12 A;  3KFU A;  1EIF A;  2BH8 A;  4MZ9 A;  1XMO L;  4G7O C;  1YNX A;  5IT9 c;  4YHH L;  3RNU A;  2JQO A;  2CW0 D;  5G3L F;  2FHT A;  1PXU A;  3BS1 A;  4HJ8 A;  3HOY H;  3I4N G;  2Q8T A;  2QGQ A;  3D4W A;  2WAC A;  3K59 A;  3M7G A;  2N49 A;  2BH2 A;  4DPG A;  2B63 H;  1GKH A;  1F9Q A;  4ZUI A;  1YHQ A;  2F3W A;  3IRB A;  1JOR A;  1HA6 A;  4R4Q A;  3UDG A;  4A3K G;  5IT9 E;  4DUY Q;  2A73 B;  3BDL A;  5C3X A;  3HOU G;  4OX9 Q;  5C4J B;  3RZO B;  1I4H A;  2F0M A;  3I7F A;  2F0T A;  2F0I A;  1CHP D;  5IP9 G;  3CCU A;  3NE5 B;  5IY0 A;  3SR1 A;  5COY A;  2B2Y C;  1UE5 A;  4LW1 A;  4RAU C;  4DNT B;  5H1S E;  3A7L A;  2F0K A;  4HED A;  5DAU A;  2OWO A;  1X55 A;  2LXK A;  1IBK L;  3NEL A;  4H7B A;  2OF1 A;  1JWU D;  4KN7 C;  1K3R A;  3S15 H;  1L1O B;  4X3K A;  3P1H A;  1TS3 A;  1C0A A;  2B2U C;  4AQY L;  2JA5 G;  1J9O A;  4BBS H;  2UXB L;  3HOZ H;  2VUM H;  1PYS B;  3BVG A;  2IHF A;  1KIX A;  4LF5 Q;  5CV7 A;  4H02 A;  2KCT A;  1B1Z A;  4KMU C;  1RCV D;  3K8A A;  1V8Q A;  1N36 L; 
#chains in the Genus database with same CATH homology
 4KV6 A;  5JVG 3;  1BUV T;  1W6J A;  2DN8 A;  3DMU A;  5K5P A;  5JVH 3;  1EOT A;  3DWQ A;  3GTL B;  4G7H C;  1E2Z A;  1CZG A;  2GA4 B;  3ND9 A;  1TY2 A;  1G91 A;  1W6K A;  1FNU A;  1I4P A;  2XWB B;  4BBR B;  2EYO A;  5LL6 S;  4HCE A;  4B08 A;  1WD1 A;  3D6W A;  2K05 A;  3DWP A;  4MHE A;  4OHJ A;  1TKW B;  5FOB B;  3MC0 B;  1TWA B;  1D1I A;  2WKD A;  3H94 A;  1A2U A;  4IAL A;  5A2Q L;  1KNE A;  1LTG D;  2K5Q A;  1NSN S;  3HGB A;  1QWY A;  1TS5 A;  2E74 C;  3MEH A;  2IX1 A;  3A55 A;  3Q23 A;  2B8F A;  3NP8 A;  3MFY A;  4EQP A;  5FLX L;  3K58 A;  3M7N A;  5D3D A;  3OIQ A;  1TWF B;  2F0Q A;  4K5W A;  2PZW A;  2FFK B;  2EOT A;  1E2W A;  3FPU B;  3O13 A;  4DN4 M;  4XQQ A;  1TS4 A;  1UAP A;  1ESR A;  5JPM C;  4JBW A;  4I7Z C;  2E76 C;  3SVM A;  1HXY D;  1L0X B;  1SJE D;  3SXH A;  2VNU D;  4XIG S;  4O42 A;  4KHV A;  3GTM B;  2A6H C;  1HRJ A;  1K83 B;  2KCN A;  4EVO A;  3S1R B;  1G8Z D;  4X3T A;  1FYC A;  2LY7 A;  1T5E A;  4N9P A;  3IKJ A;  2NN6 H;  3A8I E;  4RFB A;  3T53 B;  4ZLT F;  1M4V A;  1ESF A;  4ZYS A;  5C4Z A;  2HDL A;  3J7A V;  1CHQ D;  5FO8 B;  1Y8P B;  3GTQ B;  1WTW A;  1PRT F;  2O2L D;  2BDO A;  3G6J B;  1QOH A;  2IWH A;  3R93 A;  5AFW A;  3NTI A;  3PUX A;  1S5C D;  5C3W A;  2BDN A;  5A2Q E;  1CQF A;  4IFD H;  1WTO A;  2EVB A;  1VDZ A;  2Z4H A;  4AYB B;  4C3J B;  5T1G A;  4TQU S;  4RGN A;  2AWO A;  4OO1 H;  5FLX E;  4K2L A;  4CJ0 B;  2JEA I;  1O7Y A;  1PDQ A;  1QG7 A;  5ELE A;  1D5X C;  1Y1W B;  2PPB C;  1QIL A;  1C4Q A;  2FMC A;  2BE5 D;  5CV6 A;  1JC7 A;  2MP1 A;  3T4A C;  4OL7 A;  1RTO A;  1BCP C;  4V0B A;  2MJ8 A;  5EBC A;  5IGB A;  2MGS A;  1BQQ T;  4XQN A;  4OIK A;  2XVS A;  3LX0 A;  3CQZ B;  4KJN A;  4HMI A;  4QMG A;  4IUQ A;  5M9O A;  1PTO D;  2CHB D;  1SXT A;  1XWE A;  3A8K E;  4C56 C;  1ENC A;  4RGM A;  3DXJ C;  1SMY C;  2ZXO A;  3C1E A;  5HUR A;  1B4O A;  2I46 A;  5EPJ A;  1A2T A;  2JA7 B;  1PLF A;  1V43 A;  2RDF A;  2OXP A;  4RGO S;  2XWJ B;  4C1N I;  2A68 D;  1VF7 A;  3OOC A;  3GD7 A;  1AZQ A;  5E4W C;  5ELD A;  1LLR D;  1WCM B;  4FF3 A;  2F4I A;  1RD9 D;  3HP3 A;  1HFN A;  1F9S A;  3TZU A;  3NUC A;  5D14 A;  3GTK B;  5A35 A;  1BNZ A;  1EEI D;  3TME A;  2IT1 A;  2B2W A;  4Z9C B;  4KN4 C;  3KBG A;  1EY4 A;  3R3O A;  5BN5 A;  4DFA A;  1M8A A;  5CV5 A;  1Z47 A;  4RH6 A;  5CMD A;  3VR4 A;  1STH A;  1JIC A;  2E2J B;  2HQE A;  1YNJ C;  1CK1 A;  4KTA A;  1NCV A;  3QIA A;  2G9H D;  2WII B;  3H09 A;  3S1M B;  3M85 A;  1S5D D;  3TP7 A;  1D2B A;  5I9P A;  2SNM A;  2WP8 J;  5IOC A;  1UUP A;  5EPK A;  1ML0 D;  1KLG D;  2EJF C;  1VF5 C;  2Z8L A;  4KHZ A;  1GUS A;  3HOV B;  1CI3 M;  3DWA A;  2BA0 A;  2D5D A;  1E0B A;  1H9M A;  4ABN A;  3BG3 A;  5KNC A;  3A56 A;  1KNA A;  1GUO A;  1SE2 A;  5C3E B;  3A54 A;  4ODG A;  2JP1 A;  4F87 A;  3RLF A;  3BZD B;  5IGD A;  4CJ2 C;  2KVM A;  4KD4 A;  1IW7 C;  1AFP A;  4C3I B;  5FK9 C;  5KNB A;  5EQ0 A;  1DXM A;  1ENF A;  5BN3 A;  3DM1 A;  1CM9 A;  3MWY W;  2E2D C;  3J81 L;  5ELB A;  2FMM A;  2RQX A;  4HCS A;  3KBX A;  3A7A B;  3QO2 A;  3R2T A;  3S14 B;  1OXV A;  1R4Q B;  1RHP A;  2EDG A;  2X6G A;  3HRZ C;  2F0J A;  4N9T A;  4IUR A;  4FF1 A;  1SNQ A;  3NBI A;  1G6Z A;  3HS0 C;  2R61 A;  1GJX A;  3EVQ A;  2B2V C;  1NR4 A;  4XQJ A;  1BXT A;  3K6O A;  3HG9 A;  2V4D A;  5IOD A;  4EQN A;  1Y8N B;  4Q5V A;  2EYM A;  3SHL A;  1U4L A;  4ULL A;  2ZXP A;  4ZUJ A;  5K36 H;  1H9J A;  1X3Q A;  5BN4 A;  5F2D A;  2WB1 B;  1EFI D;  3MXN A;  4MN3 A;  1A3U A;  1STG A;  4HAE A;  2O4X A;  1JOK A;  3VR2 A;  1JOQ A;  5JJZ A;  1O7Z A;  2JA6 B;  5KIX A;  4G7Z C;  3V05 A;  4U68 A;  2PCF B;  3GV6 A;  4HN7 A;  2QF7 A;  1UNS A;  5C0X G;  3KK7 A;  2AQ1 B;  5JPN C;  5NUC A;  1BDO A;  3BVM A;  3OMG A;  4HR7 B;  4KKT A;  3NTH A;  3NHH A;  4HTH A;  3G7L A;  2A74 C;  2HCC A;  3FMC A;  2QDB A;  1CFM A;  1STY A;  1Q1E A;  3K7A B;  5I2Y A;  3X3N A;  3OHX C;  2BCO A;  4IUT A;  1HUM A;  3QB3 A;  1I4G A;  1EY6 A;  2RKS A;  1SYD A;  2KQ3 A;  4KY6 A;  2NVQ B;  1H9S B;  2NBF A;  1SE4 A;  4DK1 A;  5JEA H;  1BR9 A;  1LT3 D;  2IPK D;  1I4X A;  3WDN A;  4DXF A;  1LTA D;  3PO2 B;  2A6H D;  3PIO 3;  4IZ8 A;  3J81 E;  1F9R A;  1V1P A;  3SK6 A;  1QE6 A;  3BDO A;  4XTC S;  2HUG A;  3QWN A;  1PFB A;  2N88 A;  4BWG B;  1PFN A;  4ZK9 B;  1H9K A;  2PYK A;  5I2X A;  2XNA C;  3TZD A;  2PO4 A;  3DHQ A;  2B2T A;  3P7J A;  1EY9 A;  3URY A;  1E2V A;  1T5X D;  1I4Q A;  1Z6H A;  3HOU B;  3MVV A;  2F3V A;  2SNS A;  4TSS A;  1STA A;  3V2T A;  1HUN A;  4X3S A;  4QB4 A;  5C0X J;  4RCO A;  1I4R A;  5IGC A;  4A3I B;  3S9W A;  3AB9 A;  2VXW A;  1HQM C;  3FPP A;  2DY8 A;  4L63 B;  3MXG A;  2JA5 B;  1AN8 A;  3BDC A;  2KOL A;  4RHS A;  1B50 A;  2NN6 G;  1PYW D;  1DOL A;  1SJH D;  1FD7 D;  1F2Y A;  1DOK A;  1QNU A;  4RWS C;  2R7Z B;  3OW7 A;  3CRK C;  4A3B B;  4A3F B;  4L8J A;  2JE6 I;  4G57 A;  2F0V A;  5I6Y A;  2K5W A;  2EJG C;  1WTV A;  5M5W B;  1BCP D;  1OXS C;  2F0P A;  1ET9 A;  2K5D A;  3ONA B;  2QCP X;  4YIJ A;  3DEP A;  1HQR D;  2F0U A;  2F1M A;  4J1M A;  3WOE A;  3NTK A;  4OGQ C;  4IFD G;  2F0G A;  1SYG A;  1JB3 A;  4M1U B;  1SMY D;  4OO1 G;  1DOM A;  4ZAI A;  2F0W A;  4R8I A;  2X6L A;  3ZYY X;  1Y8O B;  2F0D A;  3NWS A;  1PRT C;  4PMW A;  3NSW A;  2KEC A;  1RF2 D;  2I07 B;  1O80 A;  4XXE A;  1RKN A;  2D9U A;  4KKU A;  3FEW X;  1EY8 A;  3PUZ A;  4KY7 A;  2NVX B;  2F03 A;  1I50 B;  4K8I A;  3J80 L;  3P75 A;  2EJM A;  1ZYR C;  3MFG A;  3HZX A;  1NUC A;  1CA6 A;  4CJ1 B;  1CA5 A;  1LT4 D;  3E6Z X;  2F0N A;  3HOW B;  3QJY A;  2JEB I;  3CKI B;  1YNJ D;  4U67 3;  4C3H B;  3Q24 A;  2KEE A;  4KJO A;  3JAM L;  3D31 A;  3VR6 A;  1IYV A;  2WKC A;  1HTP A;  1Q3L A;  1SYE A;  2RVL A;  2J0T D;  1HFG A;  5CV8 A;  1XYI A;  2A69 C;  3Q6S A;  5EGT A;  1R4P B;  3BYY B;  5I6W A;  3NXW A;  4DU9 A;  3GQB A;  2OT2 A;  1PFM A;  3K0Y A;  2F0H A;  1IW7 D;  5EPL A;  1CTM A;  1B3A A;  4K14 A;  4LJZ C;  3K5N A;  3VYT A;  3F2U A;  1SEB D;  2AUJ D;  1F2M A;  5C5M A;  3Q0A A;  4DK0 A;  4WOR A;  1IL8 A;  3ND8 A;  1GUT A;  4FP5 D;  1DCZ A;  4KY5 A;  1LO5 D;  4F8M A;  3OMC A;  3M3Y B;  5KND A;  5C6A A;  5JAV A;  1EY0 A;  5ISR A;  4IQZ A;  2L55 A;  5CYU A;  3MAQ A;  4C3J G;  1STN A;  1HTL D;  4A3D B;  2B8G A;  5G3L D;  5J1Z A;  1KTK A;  1OXT A;  2NWG A;  3J80 E;  5EBD A;  3I4L A;  1DYQ A;  5FO7 B;  4WJW A;  3K57 A;  1SND A;  4A3M B;  1FNW A;  2L9H A;  2NVY B;  4RGT A;  2B39 A;  1Q90 A;  3EA6 A;  3LWU A;  1U9R A;  4ZRZ A;  1L0Y B;  3RUZ A;  1HA5 A;  4FVM A;  1GUG A;  3JAM E;  1HCZ A;  2ZXR A;  1UEA B;  2C5C A;  1Z7T A;  3PMF A;  1JCK B;  1TT2 A;  1H9R A;  2B2Y A;  2E75 C;  1IKM A;  5C0X I;  4ZQ3 A;  2RSO A;  3MTS A;  2HCI A;  5DEH A;  1SSO A;  3VYS A;  4L6T B;  2BA1 A;  2EY6 A;  2B2U A;  3NPP A;  3RZD B;  2K7V A;  5K36 G;  4FYD A;  4DNR B;  4IUV A;  1LTB D;  2DNE A;  1PMR A;  1SDF A;  2K33 A;  5CV9 A;  2NTT A;  4BA1 I;  2XN9 C;  4X3U A;  4EGV A;  1EZ6 A;  5EKL A;  2AQ2 B;  1V1O A;  1AW7 A;  3FRP B;  1PRT B;  4FXK C;  3MXP A;  4KI0 A;  1Y69 U;  1MSG A;  2RBM A;  5CV4 A;  2J4X A;  4V19 0;  3S1Q B;  4RKL A;  3SK8 A;  3GTJ B;  3D4R A;  1A15 A;  2R6G A;  3I3C A;  5CBE E;  5CGK A;  3L9A X;  2L4N A;  3TSS A;  2L0C A;  1TWG B;  2K1B A;  3TN2 A;  1AEX A;  2A6E C;  3KLS A;  3VA5 A;  3A8J E;  3RMH A;  1TR5 A;  5EJW A;  4HMJ A;  3H0G B;  1BBX C;  3C3L A;  2Y0S B;  2QIL A;  2NTS A;  4RHR A;  1V8Q A;  1NR2 A;  3U9O A;  1G2S A;  3GO5 A;  5M5X B;  1HHV A;  1SFO B;  4BS9 A;  1EL0 A;  1I6V C;  3S2H B;  3BYT B;  1EQT A;  1CQV A;  5D65 A;  2EE1 A;  4HSV A;  2NN6 I;  5C44 B;  3EJI A;  2FJ2 A;  4Y7N B;  3I72 A;  1LAC A;  4K8J A;  1EIG A;  3Q22 A;  3MZ5 A;  5IGG A;  2CQA A;  2ZT9 C;  1ROD A;  4ID6 A;  3H6M A;  4XYO A;  2PNR C;  3HKZ B;  2AQ3 B;  1VMP A;  4LK1 C;  1KDB A;  3GTO B;  2MPM A;  2RSN A;  4IUN A;  1TU2 B;  2G9D A;  3NK9 A;  2XSC A;  4IFD I;  2PZU A;  2AWN A;  3M4O B;  4OO1 I;  2JYO A;  1IYU A;  5KGU A;  1SYB A;  3N6R A;  4ILW A;  4JK1 C;  3MHB A;  3KUP A;  1A3V A;  3CHB D;  1QJO A;  3GTG B;  1D5M C;  1K8O A;  1PRT D;  1DON A;  2EY1 A;  1ILP A;  4M8A A;  1TQO A;  1S5B D;  4A3E B;  2FIN B;  4R8N A;  4XDX A;  3I91 A;  4XYQ A;  1ZYR D;  2Z4I A;  5E3F A;  1EU3 A;  1TVX A;  2LMC B;  4MIU A;  2KCC A;  2CVR A;  2WAQ B;  2F0F A;  1Y1V B;  3KLS X;  3OSO A;  5FKA C;  1HPC A;  2F0S A;  2YYZ A;  2PW7 A;  5M3M B;  4FNF A;  1WTP A;  2XRS D;  2QKI C;  3VA7 A;  3L3O C;  1A3T A;  5DM7 3;  1YNN C;  4CGY B;  5E4X A;  3I4N B;  1SAP A;  5HGT A;  5KRU A;  3GP7 A;  3U9S A;  2EYP A;  1I6H B;  2A69 D;  2PMZ B;  3SK4 A;  2R92 B;  3LNN A;  3NWT A;  3E0J A;  3I8Z A;  2NB0 A;  3PO3 B;  1II3 A;  4A3K B;  2EY2 A;  1KAA A;  1XX8 A;  3PUV A;  1DM0 B;  2EXZ A;  5LL6 X;  2C9O A;  4K5X A;  1H9S A;  1G29 1;  3QOJ A;  1TY0 A;  5J22 A;  2RA4 A;  1PTO F;  3EQL C;  1MGS A;  3VYR A;  2ID0 A;  4DAP A;  3W2D A;  1TS2 A;  2D2C C;  2O5J C;  4FO2 A;  1D5Z C;  4PMB A;  5IGF A;  4ME5 A;  4FF2 A;  3W3A A;  1G2T A;  2K01 A;  2KED A;  4FXD A;  4KK7 A;  4B9W A;  1SYF A;  4UAI A;  4NDX A;  1LTR D;  2ICE C;  1WTR A;  2RDH A;  4FXG C;  3SEB A;  1JQY D;  3WOF A;  4TKO B;  1Q12 A;  2B2W C;  5FO9 B;  1SNO A;  3D6C A;  5DNF A;  5COR A;  3TBI B;  1IKL A;  3CRL C;  4CHT B;  1LT5 D;  1JE4 A;  2SEB D;  1MSH A;  3IAY A;  4ZKB B;  2VB3 X;  2L1B A;  2TSS A;  2DY7 A;  1GUN A;  5M5Y B;  5C0X H;  1JWM D;  2EYH A;  1KLU D;  3T56 B;  3H91 A;  4PQX A;  2KUM A;  3IFT A;  4TRD A;  2R93 B;  3K5L A;  2NUC A;  1XXG A;  3QG1 A;  4K5V A;  2EYJ A;  3N52 A;  1RJT A;  3IFD A;  2YU9 B;  1IHZ A;  4F7X A;  3IL8 A;  1LAB A;  1JOO A;  1F77 A;  4NKL A;  1ICW A;  2KJX A;  3LWE A;  3I90 A;  2ENB A;  5I4D A;  5C4X B;  3DUZ A;  1QB5 D;  4CKB A;  1AZP A;  2H4O A;  2NZ1 D;  4QCL A;  1LV9 A;  3VR5 A;  3P20 A;  1ZKO A;  4BA2 I;  3K5M A;  3C46 A;  1GHJ A;  1QCB D;  4C2M B;  4QUF A;  3D8G A;  1SE3 A;  1LT6 D;  1B53 A;  3AMU A;  1K8M A;  3I4M B;  5IGE A;  2IJ0 A;  1EZ8 A;  1ONL A;  1PTO B;  4BY1 B;  1KDA A;  4C3H G;  2EY5 A;  1CZW A;  2B2V A;  2EYL A;  4QF4 A;  3BVZ A;  1FR3 A;  1Q1B A;  2A6E D;  5IIF A;  1LTI D;  3TP6 A;  4PV1 C;  3VYU A;  4IUP A;  4IFD J;  2CW0 C;  3ITP A;  5M3F B;  1ZEQ X;  2Z1C A;  4RKB A;  1WD0 A;  2K04 A;  4F88 A;  5JOB A;  2IL8 A;  3X3M A;  1FGB D;  2ICI A;  2LKV A;  3I70 A;  4O1N A;  3S16 B;  1XTC D;  5LHY 1;  4G4K A;  3V96 A;  1FNV A;  1VCI A;  4ZKC B;  3C2P A;  4J8Q A;  4NMZ A;  1EEF D;  1ILQ A;  4NW2 A;  1GHK A;  1SYC A;  2LS0 1;  1AP0 A;  2E2H B;  4HSP A;  2PQE A;  1WVL A;  1C8C A;  2M2L A;  3GV3 A;  2KA7 A;  2HDM A;  1OO9 B;  1S4Z A;  1BF4 A;  4E6I A;  1U4R A;  1B44 D;  2QEJ C;  3QOL A;  1SBB B;  2A5H A;  4H13 C;  4K6L A;  1ZXT A;  5D3I B;  3ERO A;  4RA8 A;  2MUY A;  5EKI A;  3KLR A;  2PW5 A;  1MBY A;  1F9P A;  2XIW A;  2H1E A;  4QUC A;  3KF8 A;  3R2I A;  1LTT D;  4OIJ A;  2F0E A;  2SDF A;  1KAB A;  3PV0 A;  3D4D A;  3RD4 A;  3SK5 A;  5T1I A;  1GOZ A;  4BY7 B;  4DAY A;  4R9W A;  2B2T C;  4KKS A;  4DAV A;  2EPB A;  4P2C B;  1DZ1 A;  4DF7 A;  1GUW A;  3AU7 A;  2DNC A;  3C1F A;  1MI2 A;  4K2K A;  4WRD A;  2J7Z A;  1PTO H;  3PUY A;  2OEO A;  2JSO A;  1GXD C;  5KYI A;  3TP5 A;  3DEO A;  1RDP D;  1ET6 A;  2IW3 A;  2LFN A;  2VB2 X;  3ERQ A;  2TMP A;  3I73 A;  2WV6 D;  3NQT A;  3PIP 3;  2KHS A;  4B9X A;  1U4M A;  2XRQ D;  3TP8 A;  3OWF A;  2M9V A;  1YNN D;  4C1N K;  4CBV A;  3HOX B;  4PNY A;  1PZI D;  1TWC B;  1LTS D;  1EU4 A;  5DM6 3;  1TWH B;  2Q8R E;  3TDQ A;  1EYC A;  1VMC A;  1CT1 D;  2Q8I B;  3S17 B;  4EQO A;  2EZV A;  1U4P A;  1JR0 D;  3S1N B;  5J39 A;  2L11 A;  1DJR D;  5EKK A;  3T51 B;  1C48 A;  2K03 A;  1BCP F;  4KD3 A;  1EY7 A;  3MXU A;  1MD2 D;  1EYD A;  5JEA G;  1NAP A;  3OWE B;  2F0L A;  1OXX K;  2JXM B;  3T13 A;  1KDC A;  2R3Z A;  3SDZ A;  3S2D B;  4IN3 A;  3T16 A;  1EWC A;  3HOY B;  3FVQ A;  3NBH A;  3OPO A;  3HEJ A;  1TII D;  4C3I G;  1ENA A;  4RCN A;  3PUW A;  2B63 B;  1EYA A;  1O7L A;  4DA2 A;  4DGZ A;  2F0O A;  3UI2 A;  5TSS A;  1BOS A;  3VR3 A;  2NYZ D;  4A3J B;  4XT3 B;  1STB A;  4CKC A;  4J6H A;  4Q0F A;  5CR3 A;  1WTQ A;  1PZJ D;  5I9O A;  4H0L C;  1Q8I A;  5ELF A;  1DD2 A;  1S5F D;  1B9M A;  1I3Q B;  3K5O A;  3EFX D;  5C5L A;  4XT1 B;  5CC4 A;  1O78 A;  2IX3 A;  2AUK A;  1PZK D;  2X69 A;  1SNM A;  3S15 B;  3FDT A;  1STE A;  5IT9 L;  1EWH A;  4BBS B;  3HOZ B;  2VUM B;  3J7Y W;  4S3S A;  1SNP A;  4FF4 A;  4K6D A;  2BE5 C;  5ELC A;  1EIH A;  2D62 A;  5E1F A;  5C4H A;  1OXU A;  2RDG A;  5CBA E;  1F2Z A;  1S5E D;  1D1K A;  2JA8 B;  4I65 A;  2M00 A;  2N55 A;  4A93 B;  1B9N A;  1J8I A;  3M4Y A;  1JWS D;  1QNK A;  4LMQ D;  5JEA J;  1D6E C;  1F2L A;  3L7Z C;  1EQV A;  3D3R A;  4CKE A;  1RTN A;  1PTO C;  2IX0 A;  1WTX A;  2E2I B;  1X3P A;  2SOB A;  4GZY C;  2EYF A;  4IUU A;  1V1P B;  3E5S A;  4QIW B;  4PMC A;  3SE0 A;  3GTP B;  3NQI A;  2NVT B;  2PZT A;  4NP5 A;  1EY5 A;  1BCP B;  1SNC A;  2A68 C;  2O5I C;  2WIN B;  2BOS A;  2K32 A;  1B2T A;  1R9T B;  1A6X A;  3OIP A;  4A3G B;  1X32 A;  2L5T A;  2MHV A;  4H44 C;  5KYL A;  4WFN 3;  5KEE A;  3J7A F;  2K6A A;  3FKI B;  3MA2 B;  3H3V C;  4UDU C;  3CU7 A;  1BO0 A;  4DXG A;  2K28 A;  3R8B A;  2L12 A;  4G7O C;  2CW0 D;  5G3L F;  2FHT A;  1PXU A;  3BS1 A;  2Q8T A;  3D4W A;  2WAC A;  3K59 A;  3M7G A;  1F9Q A;  4ZUI A;  2F3W A;  1JOR A;  1HA6 A;  5IT9 E;  2A73 B;  3BDL A;  5C3X A;  5C4J B;  3RZO B;  1I4H A;  2F0M A;  2F0T A;  2F0I A;  1CHP D;  3NE5 B;  3SR1 A;  5COY A;  2B2Y C;  4RAU C;  4DNT B;  3A7L A;  2F0K A;  4HED A;  5DAU A;  4H7B A;  2OF1 A;  1JWU D;  4KN7 C;  4X3K A;  3P1H A;  1TS3 A;  2B2U C;  1J9O A;  3BVG A;  5CV7 A;  1B1Z A;  4KMU C;  1RCV D;  4LAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...