3U4VA

Crystal structure of the tetrahymena telomerase processivity factor teb1 ob-a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
NFNIGSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSSTFQNQQDSKYFFITAQDANNQEINMSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELKFKFGDYQIIPKETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase-associated protein 82
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Dna binding protein
total genus 24
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u4vA00
4R4TA 1GKHA 2YYZA 3J81i 1JE5A 3TREA 1A62A 3K0XA 2B63H 1NTGA 1AE3A 1UEBA 1YHAA 2K52A 2N49A 1K8AC 4JI8L 4HIOA 2UUBQ 3HOUG 4JI3Q 4O2DA 2NN6G 2A1AA 1P8LA 5IT9c 4DR2Q 4GLAC 2UXDQ 2K50A 4B3SQ 2FXQA 3H0GH 3VDYA 2HQLA 1R9TH 4GLXA 4YCWA 1VS0A 2JEBI 5IWAQ 3S1MH 3M4OH 2JA8G 1I3QH 1XNQQ 4DR5L 3I55A 2WFWA 1PH8A 2RHSB 4GN4B 4DAYB 4C2MH 3CCEA 4QJFA 1EIFA 4YCUA 4IO9A 3MXNB 1K9MC 4DV0Q 2F4VL 1BKBA 4B3RL 4B3TL 4GLVB 4AYBG 3D31A 2UU9Q 3A5UA 3PO2G 3K81C 3HOYG 1K0RA 3CC2A 5GAGC 3RR5A 1EIYB 1HR0L 3S16H 2R93H 2IX0A 4JI2Q 4DV6L 4A76A 1L2FA 4P71A 4LWCA 1AE2A 4A3FG 3HOWH 4A3GG 5K36G 2E2IH 3CP0A 1XNRL 1N36L 1KIXA 1XPUA 4GNXA 2VQFL 5IYBG 1XTDA 3KYHC 1A0IA 2CWAA 1PH3A 1C7YA 2ID0A 2NZOA 2OQ0A 4BY7H 1LUZA 1X3FA 2QGQA 1O7IA 4DUZQ 1OXXK 1CSQA 3J80c 1HNZQ 1IBMQ 1BVSA 2AWNA 3EBEA 1G291 5JEAJ 4LF5Q 1TXYA 4P74A 1YBYA 1J6QA 4DAMA 3F2BA 1IBLL 2Q2HA 2I5MX 4HJAA 3U58A 4A3MG 2JA5H 3S2HH 1NY4A 2PNHA 2BH8A 4P73A 3RN5A 2E5LL 5M5WH 3DM3A 2UUCQ 1VQBA 2MO1A 4X66L 1IBKL 1YJ9A 4GKKQ 2IX1A 3T1YL 4DNIA 4B3MQ 2V1CC 4H02A 5IP7G 5LMNL 5M3FH 1I50H 2GVBA 4DV7L 1N8RC 4DR7Q 4LF7L 4IPGA 3ERSX 3RLOA 4AQYL 4RG1A 1GO3E 4YWKA 3CQZH 4JCVE 2AMCB 1A63A 1VQKA 1MJEA 3JAMc 1VQ4A 5IYCH 5IY0A 1SRUA 1JMCA 4JYAL 1E7ZA 4LFCQ 4LF4L 1MIUA 4IPCA 3G48A 4APVA 2GN5A 1VCIA 2L15A 3F8TA 3CXCA 1DGSA 1TWHH 4ME3A 1K8GA 3CCQA 3EIVA 4GKJQ 4KI0A 3E9IA 2UUBL 4JI3L 1X3EA 4DR2L 1PHJA 4QQBX 3S24A 2UXDL 1W2BA 4B3SL 1Y14B 4QIWE 2VQEL 1Q81C 4LF6Q 2AHOB 5GQOA 1V43A 2N8NA 2WP8J 5IWAL 5M5YH 4HJ8A 3HOZG 3B6YA 4JC0A 4PZ8A 3CPFA 4P75A 2JA6G 3KFUA 1XNQL 2DUDA 1QUQB 3I4NH 4KHPQ 1HZBA 3CW2C 2WAQE 1HNXQ 1K3RA 2ZJRA 1TWCH 5IYBH 2JQOA 3HOVG 1AH9A 3CCVA 4DV0L 1D8LA 1Q1EA 3FKIH 4GN3B 4LNQA 4LUZA 3I4MG 1EUJA 1XJVA 2WB1E 2CFMA 2IT1A 3D0FA 3HKZG 3SGIA 1XPOA 2I0QA 4A75A 2UU9L 3PIPA 5C0XG 4NXMQ 1N32Q 1PH9A 3CCUA 1L1OC 3KF8B 4JI2L 3PGZA 4DR1Q 1L1OB 1I5FA 4DR3Q 4A3EH 1JB7A 1C0AA 3K8AA 4GN5A 4IJHA 2QA4A 2VNUD 2BA0A 3KOJA 4DV7Q 1B70B 1EQRA 4K0KQ 3RLFA 3PV0A 2ATWA 1HZ9A 1VQ8A 1JJCB 1PH5A 1Q82C 3AFQA 4DUZL 4A3IH 3NBHB 4UPAA 1HZCA 1X55A 1QZHA 1HNZL 2YV5A 1IBML 3Q8DA 4LFAQ 4LF5L 1LYLA 1VQLA 3DLLA 1SMXA 4A3KG 3U50C 1XMOQ 3M7NA 3HKSA 4A3LH 3UDFA 1YI2A 4R4CA 1SLJA 2ZTDA 4OWTB 5M3MG 2Z6KC 1P16A 3J81j 2UUCL 2KHJA 3S14H 4JOIC 2Q2TA 4GKKL 1I94Q 4B3ML 1QUQA 1XMQQ 4YY3L 2C35B 2KENA 4IPDA 4NB3A 3U4ZA 4HJ7A 1UWVA 4DR7L 1TWFH 3BU2A 4MTNA 4L5SA 2VQEQ 4X64Q 4UY8C 3J7ZC 2ZM6Q 3H15A 4BBSH 5E7NA 2RHQB 4LFBQ 3K7AH 3CCLA 4X65Q 2JA9A 1N9WA 4DK6C 4LFCL 1X54A 3J81c 2PI2E 5FLXc 1UE6A 1Y1WH 4JBWA 1Y1VG 1L1OA 4ALPA 2JA6H 4R1JA 1KRTA 3OTOQ 4BXXH 1EOVA 1J5EQ 4R4QA 1N34Q 4BBRH 4YHHQ 1CKMA 3GTGH 3TRZA 3TS2A 4GKJL 2R7ZH 4EX5A 4NXNQ 1U0LA 4MNOA 5GAEC 3HOXH 3NEMA 1GM5A 3KJPA 4DR6Q 5C4XG 3F2CA 3GTPH 4LF6L 1PH7A 5C3EG 3PSIA 4DR4Q 1PH6A 1SROA 1Q8KA 3F2DA 4A3DG 1LTLA 1X56A 4C3HH 2YTVA 5GROA 1WJJA 1V1QA 3RLNA 4L5TA 1EFWA 4JI6Q 4KHPL 1HNXL 4OONA 2VUMG 3ULLA 2Z6KA 3STBD 2R7DA 4DV5Q 5FJ8G 4JOIA 5IP9G 1VQCA 3I2ZA 1L0WA 4DPGA 3ZJYC 5ELOA 2VW9A 1VQ7A 1VQNA 4NXML 5IYDH 2NVQH 2JA7G 2IY5B 3GTKH 1N32L 4JI4Q 3PO3G 4BY1H 2H5XA 4POGA 1NMFA 4DR1L 1Q46A 4DR3L 4YY3Q 2N3SA 5M3MH 2ASBA 1G51A 4IPHA 2MO0A 4K0KL 1Z9FA 3EN2A 3GD7A 4TQUS 5BR8Q 3S1RH 4JV5Q 1VQIA 4A93G 2NZHA 3AYHB 1WCMG 3ULPA 1QVCA 5FLMG 4IOCA 2K14A 1UE1A 1SN8A 3L0OA 3UE0A 4R4IA 3HOUH 2UXCQ 2LXKA 4OO1I 3GTQH 4LFAL 1PV4A 2A8VA 4TVAB 2KBNA 1B7YB 3I4OA 4IFDJ 3UE1A 1XMOL 2UUAQ 1NBWA 3E9HA 3CMAA 3CMEA 2CCZA 4A3BG 2JA8H 2LXJA 3GTLH 1CSPA 1VQ9A 3M4PA 4JG2A 3UDGA 1Q1BA 4A3JG 1I94L 4A3CG 5M5XH 4DV4Q 1XMQL 1RL2A 1VQGA 4WJ3M 1E1TA 5C44G 3TEHB 2ALYB 3W1GA 3CCSA 3T1HL 1KC8C 3PUXA 1JT8A 4JI7Q 2EXDA 1GVPA 4XTCS 3BZCA 2BA1A 2PQAB 4X64L 2ZM6L 4JBMA 2IHEA 3ER0A 3HOYH 3PO2H 3S15H 1X6OA 5LMNW 1QZGA 2KHIA 4LFBL 1JJGA 2MQHA 4X65L 1VQPA 4A3GH 4A3FH 2HHHQ 1HNWQ 1UE5A 3WWVA 1VQMA 5C3EH 1Q86C 2K75A 4LW1A 1K83H 1MKHA 3G71A 4WJ4A 2F3IA 5H1SE 3OTOL 2R6GA 2GVAA 1J5EL 1N34L 1S3OA 3KDFB 1VQ5A 4YHHL 3TS0A 2RF4A 4PG3A 1V9PA 1VQFA 3PUZA 3M4QA 4NXNL 4MZ9A 5FJ8H 1VQ6A 2HT1A 4YCVA 1ASZA 4DR6L 4DV1Q 1Q7YC 4PZ6A 4X6AH 4LF8Q 2PI2A 3KF6B 4OWXB 1FVIA 4A3MH 3CC4A 4L5RC 1U5KA 2VS1A 4DR4L 2VL6A 1D7QA 1M90C 1KXLA 1HJPA 2N78A 3PO3H 4JI0Q 4JI6L 4AIMA 2B29A 1XPRA 5IP7H 3E0EA 5J3BA 2R93G 5C4JH 4DV5L 2I5HA 3H3VH 1HH2P 1B8AA 1KAWA 3CCMA 4DKAC 3GTOH 3AQQA 2BH2A 1GD7A 3CD6A 1CUKA 4LF9Q 2YU9H 1VQEA 2QEXA 2ES2A 2PQAA 4YWLA 3K7UC 4XIGS 4JI4L 3AEVA 3GTMH 1I6HH 3RNUA 1N33Q 4BY7G 2Y0SE 2OTLA 4X62Q 4GOPB 2HIVA 4QL5A 1Q12A 5BR8L 1BBWA 4JV5L 4Y52H 3T1HQ 4OX9Q 1LM0A 4A3JH 4Y7NH 2JE6I 3A74A 3KDFA 5JEAG 2JA5G 3A0JA 4OXPA 2UXCL 1VQDA 1NJIC 1OXSC 3JC66 2RCNA 2KCMA 3M9BA 1FJGQ 1E1OA 2A19A 1X3GA 4KLKA 1PYBA 1KL9A 2UUAL 3S2DH 4HIDA 2DGYA 3HOZH 2K5VA 5AJ3L 5M3FG 3KF6A 3OYYA 2E2HH 3LGJA 4HJ5A 2AWOA 4KHZA 4JI5Q 1YEZA 5LMUQ 4DUYQ 2JK8A 3L2PA 3NELA 4DV3Q 4DV4L 3HOVH 3ULJA 4OWWB 4GS3A 1KQSA 2OTJA 1H95A 2LSSA 5IYCG 3I4MH 5C0XJ 1TWGH 4JBKA 1YNXA 4PZ7A 4JI7L 1QVGA 3AFPA 1OXVA 4IFDG 1CKNB 4DK3C 2NN6I 2D0PA 3GDEA 2WAQG 2MNAA 2HHHL 1VQHA 1HNWL 1E24A 3BZKA 5HY6A 1EQQA 3FHWA 2Q2UA 1NMGA 2IHFA 4GOPA 2WB1G 1X65A 2CKZB 4IFDI 3S1NH 1T9HA 4JBJA 2OCEA 4YWMA 4JI1Q 1E3PA 1ASYA 4BA2I 4UP9A 3J80i 1IYJB 3KJOA 1EYGA 2D62A 3HKZE 4R4OA 1YZ6A 2ZJPA 1X9NA 1C9OA 1OXTA 3HFZB 3I4NG 2ZTEA 4DV1L 2XGTA 1MJCA 2E2JH 4A3KH 4LF8L 3CC7A 4OO1G 2UXBQ 1PYSB 1BBUA 3FKIG 3K80C 1YJNA 1HR0W 2Q2IA 2R92G 1K73C 4JI0L 3GTJH 1KHIA 1UE7A 2I5LX 4LUVA 4UP8A 3STBC 2AKWB 4C3IH 3OW2A 4FDBA 4L5QA 1PFSA 3UDIA 1IL2A 4QGUA 1YHQA 1WYDA 1WFQA 1PA6A 3J7A5 5JJLA 3JAMi 4A3EG 3MEFA 3W5OA 4DV2Q 4LF9L 2YTYA 4LUOA 3G6EA 5AJ3Q 2Y0SG 5GADC 1NE3A 2F52A 3I56A 1CKNA 3KLWA 1N33L 3W1BA 4P72A 5EAYA 4X62L 2K5NA 3A5ZB 4JI8Q 2EQSA 4A3IG 1Y1VH 3GO5A 1FL0A 2E8GA 1G6PA 1IZ6A 1OXUA 1KD1C 4OX9L 4HIMA 2YTXA 4C3JH 3RN2A 1PH4A 5ELNA 3NENA 4A3LG 3I7FA 4DR5Q 1Z47A 5C4XH 3PF4A 3FP9A 3UDXA 4POFA 1FJGL 2B63G 3H3VI 3CCJA 4A3DH 2R7FA 2F4VQ 2ZJQA 3PIOA 4B3RQ 4B3TQ 2OQKA 1EWIA 3H0GG 4NPSA 4JI5L 1VQJA 3CAMA 4BA1I 5LMUL 2EIFA 4DUYL 4IOAA 3PUVA 1PH2A 4DV3L 2VUMH 3CF5A 4BBSG 1HR0Q 4AYBE 1YJWA 4DV6Q 4J15A 3RZDH 5IP9H 1VQOA 1HZAA 1SE8A 1S40A 4AH6A 2PMZE 1XNRQ 1N36Q 1S72A 2NVTH 2JA7H 5JJKA 1E22A 5HGQA 2VQFQ 1Y1WG 2VY3A 1WOCA 4BXXG 4QY7A 1YITA 2OWOA 4BBRG 5GAHC 3BJUA 2K5HA 2MFIA 3U4VA 2R7ZG 1JJ2A 3M3YH 1PVOA 4HJ9A 3PUWA 3PCOB 5IE8A 3HOXG 4PMWA 2NVXH 2R92H 4A93H 4JI1L 2Z0SA 1IBLQ 1TWAH 3L7ZC 1WCMH 1OTCA 3HOWG 1FGUA 5FLMH 3F1ZA 4IJLA 2K4KA 4RMFA 4O0AA 1M1KC 5DLQE 3CPWA 3PUYA 1QVFA 2E5LQ 4HIKA 4GOPC 4X66Q 4A4IA 1CKOA 1PH1A 1IBKQ 3CCRA 3PF5A 3T1YQ 1SFOH 3TQYA 5LMNQ 1A8VA 2XTIA 2JJQA 3S17H 2HIXA 4A3BH 5C0XI 5JJIA 2NVYH 2ZTCA 2UXBL 4LF7Q 2JEAI 3RZOH 3IRBA 1KRSA 4AQYQ 1SR3A 5IYDG 3ICEA 4A3CH 4UP7A 3S1QH 2KCTA 5C44H 4GNXC 1IXRA 1W3SA 2B3GA 2D0OA 4EQ5A 1YVCA 4BY1G 4JYAQ 4GNXB 4LF4Q 2VZAA 2CQOA 1WI5A 1RIPA 1YHBA 3G4SA 2CWPA 1VQAA 4DV2L 1YIJA 3M85A
chains in the Genus database with same CATH superfamily
4DFAA 2YYZA 1B53A 1I4GA 3TREA 5EKKA 3K0XA 4ILWA 1UEBA 2N49A 4HIOA 3HOUG 1P8LA 1K3BC 4GLAC 2UXDQ 4B3SQ 4FF4A 3H0GH 4A3GB 3DEOA 1R9TH 4YCWA 1WVLA 4XDXA 3X3NA 5C3EB 4ZLTF 1GUWA 1JWMD 3C46A 4J6HA 4DR5L 2ICIA 4HTHA 3LNNA 1PH8A 4GN4B 5I9OA 4IO9A 3G6JB 1QOHA 1BKBA 2QW7A 3RUZA 1IYVA 3A5UA 1BCPD 3HOYG 3D8GA 2IX0A 1R4PB 1PFMA 2SEBD 1PZKD 5C5MA 4N8FA 3H3VC 1XTDA 5CV6A 3GP7A 2NZOA 2OQ0A 4BY7H 1LUZA 1X3FA 1O7IA 1OXXK 2A6ED 2YU9B 3J80c 1HNZQ 1IBMQ 2FJ2A 4LF5Q 2LMCB 1ML0D 4IQZA 2F0EA 2PNHA 4P73A 3RN5A 2E5LL 5M5WH 1IBKL 1YJ9A 1BF4A 1S4ZA 4RAUC 1K0SA 4H02A 5M3FH 1STHA 4DV7L 4AQYL 4RG1A 1GO3E 1A2UA 3CQZH 4HR7B 4L6TB 1MJEA 1A3TA 5C3WA 3WOFA 1D5MC 1VMPA 1Z6HA 4OEMB 5IYCH 1F9RA 4JK1C 1MIUA 2K5DA 4APVA 2Z4HA 2K04A 1DGSA 3CXCA 3SK5A 2KJXA 4GKJQ 2NTTA 2IL8A 3EVQA 3E9IA 3MEHA 1X3EA 4K5WA 1JORA 3C1FA 1FYCA 1Y14B 2EVBA 2AHOB 5IWAL 4HJ8A 4PZ8A 4P75A 1F2MA 4KY7A 1XNQL 2DUDA 3MXPA 4KJNA 4KHPQ 1SYDA 3CW2C 1HNXQ 1ENCA 1TWCH 2R93B 1E2ZA 1F9PA 3FKIH 4LNQA 4LUZA 4EQNA 2CFMA 1T5XD 4A3KB 2A68D 3PIPA 1IKLA 1JOOA 3CCUA 1NNXA 4K6LA 1WTWA 1L1OB 3W3AA 1CFMA 1Q3LA 1E0BA 2QA4A 2BA0A 1PYWD 3KOJA 1B70B 2ATWA 1HZ9A 4RWSC 1WTHA 3AFQA 2JA5B 1B3AA 2IX3A 1JOKA 1SYEA 3Q8DA 1LYLA 2A6HC 2QDBA 3DLLA 2XNAC 1SMXA 1XMOQ 1DYQA 3IL8A 4A3LH 1TKWB 3UDFA 1SLJA 3J81j 2KHJA 2G9HD 3SK8A 2Q2TA 4LJZC 5FK9C 2RBMA 4HJ7A 4L5SA 3BDCA 3D3RA 4X64Q 3H15A 3D4WA 2KCCA 1YNJD 5CV8A 4DNRB 1TWHB 5L37A 4X65Q 2QILA 2JA9A 4K2KA 3KF8A 5FLXc 2F3WA 1S5FD 4ALPA 1KRTA 1EOVA 3RZDB 2R3ZA 1N34Q 1J5EQ 1R4QB 4YHHQ 1CKMA 1D2BA 1EFID 3VA5A 3J80E 2JP1A 5EKIA 2XN9C 4LF6L 3GTPH 1EU3A 4DR4Q 1PH6A 1ZKOA 1I4QA 1WJJA 2BOSA 3VYTA 1EFWA 4JI6Q 2C5CA 4ZUJA 4C1NK 3K6OA 4KN4C 1I4XA 5FJ8G 4RGOS 1X3QA 1GUTA 1VQCA 3I2ZA 4DPGA 2VW9A 1B50A 1VQNA 2C9OA 4NXML 3FMCA 1N32L 3S17B 1DJRD 1JR0D 2H5XA 1NMFA 4ABNA 4YY3Q 1U4MA 2N3SA 1D5XC 1G51A 1TU2B 1GUOA 4K0KL 4TQUS 4A93G 2EJMA 1VF7A 2R61A 3ULPA 2K14A 3A55A 3L0OA 1MI2A 2A8VA 4XT3B 1STGA 2A73B 2B39A 1NBWA 1QJOA 3E9HA 3C3LA 2CCZA 5J22A 2JA8H 1CSPA 1VQ9A 2F0QA 5D3IB 3UDGA 4K5XA 1I94L 1H9MA 4DV4Q 1RL2A 1XMQL 3TEHB 1V1PB 2Z8LA 1I3QB 3PUXA 2L0CA 4XTCS 3S15H 1SE4A 2ZM6L 1Y1WB 4LFBL 1JJGA 1CQVA 3Q0AA 4A3GH 4A3FH 5K36H 4BBRB 1UE5A 5C3EH 3EROA 3CRKC 2D5DA 2R6GA 1CQFA 1VQ5A 1SE3A 1VQFA 2RDGA 3PUZA 3M4QA 1CZGA 4J8QA 3P1HA 1VQ6A 3BDOA 2XWBB 4DR6L 4DV1Q 1Q7YC 4V190 4X6AH 1H9JA 4IUTA 1F9QA 4CDFC 1F77A 3L9AX 1HJPA 2N78A 2F1MA 4ZRZA 3V96A 4NKLA 1EY7A 3CKIB 5J3BA 3GTKB 5C4JH 4DV5L 2A68C 1CUKA 2E2DC 2YU9H 1VQEA 3HG9A 2PQAA 3V05A 3U9SA 4JI4L 3RNUA 1N33Q 5CGKA 4BY7G 5HURA 5FLXE 4RKLA 2MPMA 4QL5A 2F0WA 5DEHA 3EJIA 4PV1C 1BBWA 5BR8L 4JV5L 4Y52H 4OX9Q 1LM0A 4ID6A 3A0JA 4JW0A 2UXCL 1OXSC 3JC66 1L0YB 1ONLA 3H91A 3BDLA 1PYBA 2UUAL 3HOZH 5M3FG 2FMCA 1B9NA 3LGJA 2AWOA 4NW2A 4KKTA 2K05A 2JK8A 3NQTA 5M5YB 1KQSA 2K5QA 2LSSA 2PMZB 3IKJA 5IYCG 3PIP3 4JBKA 1YNXA 1W6KA 5CR3A 3AFPA 3MFYA 5I2XA 3LWEA 3GDEA 3S9WA 2HHHL 2B2TC 5J39A 2WB1G 2XWJB 2OCEA 4JI1Q 4BA2I 4UP9A 4K8IA 1J8IA 4A3EB 3IAYA 1IYJB 3KJOA 2D62A 2BE5C 3WDNA 1FNVA 4RHSA 4L63B 3NWSA 2E2JH 4A3KH 5ELCA 2UXBQ 3K5LA 1CTMA 1PYSB 3FKIG 3K80C 3M7GA 2Q2IA 1K73C 4LUVA 4PQXA 4FDBA 1IL2A 1PTOD 1YHQA 1WYDA 1WFQA 1I6HB 3J7A5 4CDCC 2YTYA 2Y0SG 5EGTA 1NE3A 2F52A 4P72A 5FO9B 4Y7NB 2X6GA 2CH4W 1G6PA 1KD1C 4X3UA 4HIMA 3A56A 4OELB 4C3JH 5JVH3 3RN2A 3NENA 4A3LG 2K7VA 1ICFB 3DM1A 5EPLA 4N8X1 2JA6B 1PTOB 3T56B 2E2HB 2J7ZA 5C4XH 5I6YA 2PZTA 1LTAD 1FJGL 2B63G 3H3VI 3GTGB 2K33A 2BDNA 1JICA 3HOVB 4DU9A 2ZJQA 3PIOA 1BQQT 3I4MB 4M8AA 4NPSA 5I9PA 2NYZD 4JI5L 3NHHA 1U4PA 2EIFA 2MUYA 5LMUL 3PUVA 2VUMH 1GHJA 4J15A 4XXEA 5G3LF 4DV6Q 3RZDH 1ILPA 1SE8A 2PMZE 1XNRQ 1N36Q 1F2ZA 4KJOA 2JA7H 2J4XA 1F2LA 1A3UA 4QY7A 5T1IA 3K0YA 3U4VA 1EZ6A 1TS4A 3EQLC 3PUWA 2WKCA 5IE8A 2NVXH 4B9WA 1RF2D 1OTCA 3HOWG 1ICWA 1WCMH 1EYDA 4LAAA 1PLFA 1RTOA 4IJLA 4O0AA 5DLQE 1A2TA 1JOQA 4HIKA 3R2TA 2RVLA 1LT4D 1EY4A 3K59A 2JJQA 1JB3A 3S17H 3BYTB 1UAPA 2JEAI 3RZOH 3IRBA 4U673 1SR3A 1JE4A 1GXDC 2L1BA 3KBGA 5KRUA 4A3CH 4I65A 1G6ZA 2KCTA 1IXRA 1Y69U 2HDMA 3GTLB 4DV2L 2VZAA 3KK7A 2CWPA 3G4SA 2PPBC 1YIJA 3M85A 1GKHA 1Y1VB 3MXUA 1M8AA 5DAUA 2MGSA 5EBDA 2MJ8A 1NTGA 2K52A 1YHAA 1K8AC 3NBIA 4JI3Q 1DOMA 2A1AA 5IT9c 2RDHA 2K50A 2FXQA 3KLSX 4HAEA 1VS0A 1Y8PB 3K57A 4B9XA 1LT5D 2K01A 4F8MA 2JA8G 1I3QH 1CT1D 5C5LA 2PW5A 1STEA 1MGSA 2WFWA 2RHSB 1EEID 2FMMA 5C4HA 5IOCA 4YCUA 2RSOA 3VA7A 3QR8A 2RQXA 4ZKBB 2UU9Q 4H0LC 3K81C 2DY8A 3S16H 5GAGC 4FXKC 3RR5A 2AQ3B 3H09A 1HR0L 1EIYB 4JI2Q 1IW7C 3MA2B 1L2FA 2A5HA 4LWCA 1AE2A 4A3FG 4A3GG 5K36G 1EYCA 3OWEB 1KIXA 1XPUA 3SHLA 3MHBA 2VQFL 2B2UA 2JN4A 3KYHC 1A0IA 2XSCA 1SNQA 5DNFA 1TWAB 1TVXA 5FO7B 2EY1A 1BVSA 3EBEA 3I70A 1G291 5JEAJ 4P74A 1IHZA 2Q2HA 1W6JA 3U58A 1WD0A 1AZPA 1NY4A 4IZ8A 3S2HH 4A3BB 3DM3A 2MO1A 1CHPD 2OT2A 3T1YL 2F0TA 1STBA 3QJYA 4DNIA 5JVG3 1RTNA 4FO2A 2GVBA 3NK9A 4MIUA 1N8RC 4DR7Q 4IPGA 1XX8A 3MXNA 2F0HA 1A63A 4JCVE 3DWQA 1PTOC 3HP3A 2NN6H 3JAMc 1LTSD 2P5ZX 2RKSA 1SRUA 5IY0A 2H4OA 4Q0FA 4BWGB 3OHXC 4IFDH 1IYUA 2DJGC 3F8TA 1O7LA 2RA4A 2V4DA 1XWEA 3CCQA 1DZ1A 2SNSA 2UUBL 4DR2L 4QQBX 1U4LA 2B2WA 1Q81C 1GUNA 4LMQD 5GQOA 2N8NA 4IALA 5M5YH 3HOZG 1HUNA 3S1NB 1HZBA 1SNDA 3IFDA 1B9MA 4HMIA 5IYBH 2ZXOA 3CCVA 4DV0L 1EUJA 1S5DD 2EJGC 2WB1E 2EXZA 2WIIB 3D0FA 3BG3A 4FYDA 1HTLD 4C3HG 1D1KA 3KF8B 1TS2A 5KYIA 4DR1Q 4A3EH 4DR3Q 1JB7A 3K8AA 2VNUD 4C3IB 2F0VA 1EQRA 3PV0A 1VQ8A 3MXGA 1Q82C 4DUZL 5IT9E 1TQOA 1EZ8A 4A3KG 1B44D 3U50C 2B8FA 3HKSA 1RHPA 1YI2A 5M3MG 2ZTDA 3VR4A 1PMRA 2Z6KC 5E4XA 2UUCL 3S14H 2HD3A 4JOIC 4GKKL 1LT3D 2OXPA 5FOBB 1QUQA 3PIO3 4YY3L 4B3ML 2C35B 3BU2A 4MTNA 4R8IA 2TSSA 4BBSH 2RHQB 3N52A 3J81c 4LFCL 2PI2E 4KKUA 1SMYC 4JBWA 3BVMA 5JPMC 2JA6H 3OTOQ 3J80L 1NUCA 1ESRA 3GTGH 3TRZA 4X3SA 4C3JG 4EX5A 4NXNQ 3BS1A 5GAEC 3I4NB 5C4XG 1PH7A 1Q8KA 3F2DA 1NCVA 4FXDA 3QOLA 2R92B 3OPOA 2L5TA 1ZEQX 2VUMG 3ULLA 2Z6KA 4ZUIA 4JOIA 1L0WA 5IYDH 3ZJYC 5ELOA 4HEDA 3VR6A 2JA7G 3JAME 3E6ZX 1AFPA 1HTPA 3PO3G 3NSWA 4POGA 5IGEA 3I4LA 1EIHA 5C44B 2QCPX 4RH6A 3GD7A 4CDEC 1VQIA 1WCMG 3R3OA 3T4AC 4KY6A 3EA6A 4IOCA 1SN8A 2LXKA 3K5OA 1EQVA 3NTKA 3URYA 4LFAL 2PZWA 4IFDJ 5CMDA 5A2QE 3UE1A 1JWUD 2X6LA 3A8IE 3CMEA 4RGTA 4P2CB 3GTLH 1TWFB 2Z9HA 4XT1B 1Q1BA 3KLSA 4IUNA 4A3JG 4PMBA 3VR3A 4A3CG 3M4OB 3K7AB 2F0MA 2ALYB 3AU7A 3QB3A 1EYAA 2EYHA 4DF7A 2CVRA 1DCZA 3H94A 2PQAB 3PO2H 4C2MB 5LMNW 2MQHA 1VQPA 1BBXC 3BYYB 1HNWQ 1VQMA 2XVSA 1MKHA 1KLUD 2F3IA 5H1SE 2GVAA 2L4NA 2RF4A 2E2IB 4RCNA 4YIJA 3MFGA 4MZ9A 2SNMA 1PRTF 3A7AB 2PI2A 3CC4A 1FVIA 5IGDA 4A3MH 4L5RC 1D7QA 2VS1A 3J7YW 4JI0Q 1EQTA 1C8CA 1SJED 1EY0A 2GA4B 1TS3A 1M4VA 4U68A 5IP7H 2E75C 4V0BA 3H3VH 4BY1B 1HH2P 1KAWA 5JAVA 2BH2A 5FLXL 4LF9Q 1E2WA 2ES2A 3K7UC 4XIGS 3GTMH 2EE1A 3J81E 2M2LA 3K5NA 2HIVA 3TZDA 1JQYD 1Q12A 1EWCA 3T1HQ 3A74A 1SE2A 2J0TD 3N6RA 4OXPA 4OHJA 2E74C 1B2TA 1E1OA 1U9RA 1X3GA 4KLKA 1BCPF 3S2DH 2DJFC 3HRZC 3KF6A 3IFTA 3NTHA 3L2PA 3I8ZA 4DV3Q 1MBYA 3HOYB 3ULJA 1A3VA 4ME5A 2BE5D 5C0XJ 3MTSA 4JI7L 1KDBA 2CQAA 4E6IA 1OXVA 4IFDG 4DK3C 2NN6I 2D0PA 2WAQG 4DK0A 1E24A 3K58A 5HY6A 4KD3A 1EQQA 3TP5A 4MN3A 2XRSD 3VR2A 4K14A 2CKZB 4IFDI 2BDOA 3S1NH 4JBJA 3J80i 1HRJA 4HCEA 1EYGA 5D3DA 2ZJPA 1Y8OB 4K2LA 1X9NA 1LO5D 3Q24A 3OIPA 1OXTA 2XGTA 4LF8L 4KY5A 4ZCKA 1SNMA 1BBUA 1HR0W 5JJZA 3GTJH 1KHIA 3FEWX 4ZYSA 4C3IH 1ESFA 3UDIA 4EVOA 1ET9A 3BZDB 2L55A 5JJLA 4A3EG 2NTSA 4DV2Q 3G6EA 5AJ3Q 3I56A 1CKNA 1CM9A 4KKSA 4X62L 3A5ZB 4X3TA 2IW3A 5C4ZA 3GO5A 4UAIA 2ICEC 1K28A 4QF4A 1IZ6A 3VYUA 2Q8RE 1Y8NB 3FRPB 1DOLA 3I7FA 4NP5A 5J1ZA 4DR5Q 2PNRC 3PF4A 1KDAA 5KNCA 2B8GA 1H9RA 3CCJA 2OQKA 3H0GG 3CAMA 4IOAA 4DUYL 3I90A 1PH2A 2NBFA 3CF5A 4BBSG 1YJWA 3QG1A 1VQOA 2D9UA 4FP5D 5JJKA 5HGQA 2VY3A 1DM0B 2OWOA 2K03A 3BJUA 1S5CD 1JJ2A 4KMUC 4OO1H 4HJ9A 3PCOB 2R92H 2Z0SA 2L12A 3SK6A 3L7ZC 3F1ZA 1D1IA 4RMFA 1QNUA 1QVFA 2E5LQ 3Q6SA 4A4IA 1IBKQ 4GZYC 2O5IC 5JJIA 5C0XI 3HGBA 4UDUC 1LTTD 4AQYQ 3GTQB 2IWHA 5IYDG 5C44H 4GNXC 3A7LA 1W3SA 1WTOA 2D0OA 3X3MA 4EGVA 2CQOA 5LL6S 1WI5A 1YHBA 1ZXTA 1RD9D 5M5XB 1JMCA 4R4TA 4CKBA 1JE5A 1A62A 3A8JE 5CV9A 4LK1C 1B3QA 1AE3A 1WTQA 4DA2A 4JI8L 1BO0A 1Z7TA 4O2DA 5KNBA 4OIJA 4FF1A 2Z1CA 2FINB 3VDYA 1E2VA 4IUPA 2HQLA 2WACA 1IW7D 5KYLA 4WFN3 5IWAQ 3M4OH 1K83B 1PZJD 2EYOA 1WTXA 1XNQQ 5CYUA 1DXMA 4C2MH 2KQ3A 3MXNB 2QDLA 1K9MC 4EQOA 2F0FA 2F4VL 1FNUA 2CHBD 2VXWA 4B3RL 1RCVD 4B3TL 1CA5A 2K32A 4AYBG 4KK7A 3PO2G 2NVTB 1K0RA 3T16A 2R93H 2AUJD 2PYKA 4A76A 2AQ2B 3BVGA 4P71A 2KA7A 2E2IH 1BOSA 3CP0A 1V1OA 3P7JA 4GNXA 4G7HC 3UI2A 2CWAA 3LX0A 1PH3A 3TP7A 3PMFA 1C7YA 2ID0A 4CKEA 3A54A 2EY2A 2QGQA 1MSHA 3GTOB 2JSOA 1CSQA 3CHBD 1QB5D 2AWNA 1TXYA 1IBLL 1J6QA 4DAMA 1EY5A 4FXGC 1AP0A 1ZYRC 4HJAA 5JEAH 1SFOB 4CKCA 4A3MG 2JA5H 4RCOA 1HFGA 4I7AA 2NVYB 2KEDA 1VQBA 1SBBB 4X66L 4WORA 3TP6A 4BS9A 2IX1A 5LMNL 5IP7G 3S1QB 1LACA 3VR5A 4LF7L 1UEAB 3ERSX 3RLOA 5ISRA 4IUQA 2CW0D 4YWKA 1XTCD 1SNCA 1CZWA 2Z6BA 2B2VA 3AMUA 4QUCA 1VQ4A 4JYAL 1H9KA 4LF4L 1I4PA 1OO9B 3V2TA 4IPCA 3G48A 4F7XA 2GN5A 1VCIA 5C6AA 2L15A 3ONAB 1TWHH 3DWAA 1IL8A 1K8GA 1TWGB 3EIVA 1R9TB 4KI0A 1DD2A 5LHY1 2M9VA 5CBAE 2UXDL 4B3SL 4LF6Q 2WP8J 2L9HA 4ZAIA 3B6YA 4JC0A 2EY6A 1STYA 3KFUA 5BN5A 1QUQB 2WAQE 1K3RA 1PFBA 3FPPA 2JQOA 1AH9A 5AFWA 1D8LA 4GN3B 3DHQA 1XJVA 2DY7A 3HKZG 5COYA 1XPOA 3SGIA 1SYFA 4NXMQ 3FVQA 4A75A 2I46A 5EPJA 1N32Q 4FNFA 3QIAA 4BY7B 1C0AA 4G7ZC 4K0KQ 5IT9L 1GUGA 5JPNC 4M1UB 1JJCB 1C48A 5NUCA 4UPAA 1HZCA 1X55A 1IBML 1HNZL 2B2UC 5M5WB 3BVZA 4LF5L 5E4WC 1VQLA 1SYGA 1B4OA 1AW7A 3M7NA 3H6MA 3DEPA 4R4CA 5M3FB 1SMYD 5A35A 1I94Q 1JCKB 4QMGA 3T53B 1XMQQ 2EOTA 4C3IG 1Q90A 1QNKA 3MWYW 3U4ZA 1UWVA 2VQEQ 3D6WA 4UY8C 3J7ZC 2ZM6Q 2F0KA 3E3XA 4LFBQ 4A3DB 3CCLA 1DONA 3ERQA 1N9WA 4DK6C 3TDQA 3AB9A 1QILA 1UE6A 5IGBA 1Y1WH 3J7AV 3I3CA 2WB1B 4BBRH 4DAPA 3TS2A 4GKJL 3NQIA 4ZKCB 1U0LA 4MNOA 4C56C 1NR4A 4CDDC 3NEMA 1GM5A 4DR6Q 1LV9A 3NBHA 3Q22A 5C3EG 5KEEA 2YTVA 2LKVA 5GROA 3FKIB 1V1QA 3RLNA 2F0NA 3SDZA 2FFKB 2B2WC 3T51B 4KHPL 1HNXL 4OONA 3SVMA 3RD4A 4DV5Q 3JAML 3OOCA 5EJWA 1VQ7A 3TSSA 2EY5A 2EYFA 2IY5B 3GTKH 1LTGD 4JI4Q 4XQNA 2SDFA 3QOJA 1MD2D 3ND8A 2F03A 2ASBA 2MO0A 1STNA 4MHEA 1Z9FA 2F0OA 5EKLA 3VYRA 5BR8Q 4JV5Q 2NZHA 3AYHB 1ENAA 1QVCA 1HQMC 3ZYYX 5A2QL 3UE0A 4R4IA 2UXCQ 4OO1I 4F87A 3SE0A 3GTQH 4NDXA 1PV4A 1LTRD 2KBNA 4QCLA 2B63B 1XMOL 4K8JA 2UUAQ 1B1ZA 4JG2A 1HPCA 5M5XH 4RA8A 5C44G 3S1MB 5KNDA 2CW0C 3T1HL 1KC8C 1GVPA 4F88A 4X64L 2IPKD 3I73A 1X6OA 1QZGA 1X3PA 2AQ1B 1VF5C 3GV3A 5CC4A 4X65L 4OGQC 2HHHQ 4K6DA 1Q86C 2K75A 4LW1A 2K5WA 1K83H 3TP8A 4WJWA 1J5EL 1N34L 3HOWB 4YHHL 1AEXA 3GTPB 1O7YA 1HA6A 4S3SA 5FJ8H 1KAAA 1FGBD 2HT1A 3TBIB 3G7LA 1BXTA 3KF6B 4OWXB 4DR4L 5ELDA 2DNEA 2VL6A 1X32A 5I4DA 1KXLA 3R8BA 2G5DA 4JI6L 4AIMA 2B29A 1XPRA 3F2UA 4KN7C 2R93G 3DWPA 3E0JA 2L11A 5EQ0A 1B8AA 4DKAC 3GTOH 3J81L 5K5PA 1GD7A 4HCSA 3CD6A 4X3KA 2JXMB 2QEXA 1I50B 1CI3M 1I6HH 2Y0SE 3C1EA 1HFNA 2LS01 2N88A 1KTKA 3MZ5A 4IUUA 1EEFD 1PRTD 3HZXA 3NTIA 4Y7NH 1TS5A 2JE6I 5JEAG 3KDFA 2JA5G 4UHVA 1LLRD 2JA8B 1VQDA 2KEEA 2LY7A 1ENFA 2F0DA 3MVVA 2KCMA 1FJGQ 2A19A 1RKNA 2DGYA 2MHVA 2K5VA 5AJ3L 3OYYA 1PTOH 2E2HH 3I91A 4KHZA 4JI5Q 1ET6A 1YEZA 5LMUQ 1BNZA 3NELA 4DN4M 1LT6D 3OW7A 4DV4L 3HOVH 4OWWB 3S15B 1S5ED 4GS3A 2OTJA 3I4MH 4A3FB 1TWGH 1PRTB 4PZ7A 2PZUA 2XRQD 5C0XH 1CKNB 5TSSA 3O13A 2EYJA 2Q2UA 4GOPA 1X65A 1T9HA 3ITPA 4YWMA 1EL0A 5FKAC 4CHTB 1G91A 3U9OA 3HKZE 4R4OA 1JWSD 1C9OA 3D6CA 4DV1L 1SDFA 4A3IB 3A8KE 3HS0C 1SJHD 2O2LD 2HCCA 5C4JB 5ELFA 2A69C 2I5LX 4UP8A 4L5QA 1PFSA 1HUMA 4QGUA 4PNYA 2Q8IB 1PA6A 3Q23A 3QWNA 3JAMi 3MEFA 1BCPB 5CV4A 5GADC 1QCBD 2IJ0A 1N33L 3W1BA 5EAYA 2K5NA 2EQSA 1Y1VH 3DUZA 2D2CC 4OX9L 2YTXA 2Z4IA 4C1NI 2F0PA 3MAQA 3HOZB 3FP9A 3UDXA 5FO8B 1GJXA 1YNNC 4A3DH 1TT2A 2R7ZB 3HOXB 2FHTA 4BA1I 1U4RA 1HR0Q 4C3HB 5IP9H 1HZAA 2KVMA 1UNSA 2HUGA 2NZ1D 1IKMA 4MTKA 4CBVA 5I2YA 2EDGA 2VQFQ 1Y1WG 1O78A 1XXGA 1WOCA 4IUVA 3TMEA 1YITA 1NSNS 4BBRG 2PQEA 3NP8A 2MFIA 2KOLA 2NUCA 2NVQB 4JI1L 1TWAH 5FLMH 3NE5B 2E2JB 1KNEA 2K4KA 5D65A 3CPWA 5CORA 5M3MB 1TIID 3RMHA 3S1RB 4J1MA 3PF5A 3T1YQ 1A8VA 2XTIA 4A3BH 2HIXA 3HOUB 1HQRD 3PQIA 2ZTCA 2UXBL 3J7AF 1FNWA 2K6AA 3ICEA 4UP7A 3CU7A 2B3GA 3KBXA 4GNXB 1DOKA 4RFBA 1VQAA 3J81i 5BN4A 4L8JA 2VB3X 2B63H 3FDTA 4C3JB 2O4XA 2UUBQ 3ND9A 2NN6G 4DR2Q 3NXWA 3R93A 1PRTC 4QIWB 2OEOA 1CA6A 4FF3A 5C4XB 4GLXA 3OIQA 2JEBI 3NWTA 3DMUA 3S1MH 3R2IA 3I55A 3NUCA 4XQQA 1WTRA 4DAYB 3CCEA 4N9PA 2HDLA 1EIFA 4QJFA 2VUMB 1UUPA 4DV0Q 1K8MA 1JC7A 4GLVB 4HSVA 1KLGD 3D31A 3D4DA 3OMCA 3SEBA 1H9SB 4B08A 4TRDA 2JA7B 3CC2A 1ZYRD 4DV6L 3HOWH 3PO3B 3L3OC 2EZVA 2EYPA 1XNRL 1N36L 5IYBG 4OL7A 4CJ1B 2EYLA 2NVXB 1RJTA 1WCMB 4DUZQ 1EWHA 1XYIA 1YBYA 1NAPA 1BCPC 1STAA 3F2BA 5EBCA 2I5MX 3I72A 5M9OA 3C2PA 2BH8A 2UUCQ 3RZOB 4GKKQ 4A3JB 3OSOA 4B3MQ 2V1CC 1AN8A 1T5EA 1I50H 1EOTA 1HCZA 4O42A 5E1FA 4I7ZC 2A6EC 2AMCB 1VQKA 2PCFB 3TN2A 1E7ZA 4LFCQ 1HXYD 1CK1A 3GQBA 1I6VC 4RKBA 4ME3A 2A74C 4R8NA 2EJFC 4KV6A 4JI3L 1PHJA 4FVMA 2QF7A 3S24A 1W2BA 1SXTA 4QIWE 2VQEL 1V43A 1CHQD 2JA6G 3CPFA 3I4NH 1L0XB 3GV6A 2ZJRA 2G9DA 2KCNA 3HOVG 3S16B 1O7ZA 1Q1EA 4G57A 3I4MG 2N55A 2OF1A 1TR5A 2IT1A 1FR3A 2I0QA 2UU9L 1SSOA 5C0XG 1PH9A 1L1OC 4JI2L 3LWUA 3PGZA 2KHSA 1I5FA 4GN5A 4IJHA 1SYBA 5KGUA 4DV7Q 1C4QA 5G3LD 3RLFA 5ELEA 3KUPA 1PH5A 3K5MA 4A3IH 4G7OC 1HA5A 3S2HB 3NBHB 1QZHA 2YV5A 4H7BA 4LFAQ 1G8ZD 1A6XA 1RDPD 1BR9A 4OWTB 3SR1A 3P20A 1P16A 2TMPA 1MSGA 1S5BD 5CV7A 2KENA 1Q8IA 4IPDA 4NB3A 1PFNA 4DR7L 1TWFH 4CGYB 5IGGA 2MP1A 3WOEA 1LTID 5E7NA 2PO4A 2KUMA 3K7AH 1PXUA 2WAQB 1X54A 5D14A 4RGNA 2CH4A 1Y1VG 1L1OA 4R1JA 4DK1A 4BXXH 2B2VC 4R4QA 1AZQA 5IGCA 1SYCA 2R7ZH 1I4RA 2DNCA 2QKIC 2B2YC 3HOXH 3KJPA 3F2CA 3PSIA 1YNJC 4A3DG 1SROA 3M3YB 5T1GA 4TSSA 1LTLA 1X56A 4C3HH 1QE6A 5I6WA 4A93B 4L5TA 1G2TA 4KTAA 2F4IA 3STBD 2R7DA 5IP9G 2F0UA 4CJ0B 5LL6X 2NVQH 2RSNA 2NB0A 1HHVA 4XYOA 4BY1H 1EY8A 1RODA 1Q46A 2PW7A 4WRDA 4DR1L 4DR3L 5M3MH 4IPHA 5E3FA 4K5VA 3EN2A 4DAYA 3S1RH 5FLMG 1UE1A 3HOUH 2KECA 1H9SA 2WKDA 4TVAB 1TY0A 3S14B 1B7YB 3I4OA 5F2DA 2B2YA 3CMAA 4A3BG 2H1EA 2LXJA 5DM63 3M4PA 1KABA 2F0GA 3H0GB 1VQGA 4WJ3M 1E1TA 4BBSB 4Q5VA 1D5ZC 2I07B 4DXFA 3W1GA 3CCSA 4HMJA 2RDFA 1JT8A 2B2TA 2EXDA 4JI7Q 3BZCA 2BA1A 4JBMA 3HOYH 2IHEA 3ER0A 2KHIA 1BDOA 1EU4A 3T13A 1WTVA 3WWVA 1KDCA 3SK4A 3G71A 4WJ4A 1EIGA 1FD7D 3OTOL 1S3OA 3KDFB 3TS0A 4PG3A 1V9PA 5BN3A 1QWYA 2BCOA 4NXNL 1SNOA 3FPUB 2WINB 4YCVA 1ASZA 4PZ6A 4LF8Q 2F3VA 4PMCA 1U5KA 1M90C 3PO3H 2F0SA 3NPPA 3E0EA 3W2DA 2I5HA 1LABA 3CCMA 1V1PA 3E5SA 4IN3A 1EY6A 3AQQA 3EFXD 2AUKA 4DAVA 4TKOB 4YWLA 3AEVA 5C3XA 2OTLA 4X62Q 4GOPB 3CQZB 2VB2X 2F0IA 1GOZA 4DGZA 4A3JH 1J9OA 2Q8TA 4R9WA 4ZQ3A 1NJIC 3VYSA 2RCNA 3M9BA 4FF2A 1KL9A 5CBEE 4HIDA 3SXHA 4JVZA 4HJ5A 2EPBA 4DNTB 2NWGA 4DUYQ 4AYBB 2F0JA 2HQEA 1KNAA 3PO2B 2HCIA 4XYQA 1H95A 1PDQA 4Z9CB 1A15A 2JYOA 5ELBA 1QVGA 3TZUA 1TWCB 3QO2A 4ULLA 5IODA 2O5JC 1PTOF 3P75A 2MNAA 1VQHA 1HNWL 2QEJC 2EYMA 3BZKA 5IIFA 3FHWA 2A69D 1NMGA 2IHFA 2SOBA 1GUSA 5EPKA 1ASYA 1E3PA 1D6EC 1TY2A 4A3MB 1YZ6A 2Y0SB 4QB4A 3I4NG 3HFZB 2ZTEA 3MC0B 2F0LA 1MJCA 4QUFA 3CC7A 4HN7A 2DN8A 4OO1G 5DM73 1YJNA 2R92G 3OMGA 4JI0L 2X69A 1SAPA 1UE7A 3STBC 2AKWB 3DXJC 3OW2A 4JPBW 1WTPA 3GTMB 4DXGA 1NR2A 3W5OA 1MHWC 4LF9L 4LUOA 4NMZA 1YNND 4EQPA 3KLWA 4JI8Q 4A3IG 1EY9A 1FL0A 2E8GA 5KIXA 1OXUA 2WV6D 1WD1A 1PH4A 1SNPA 5ELNA 3M4YA 4XQJA 3S2DB 3D4RA 4G4KA 1Z47A 5HGTA 4POFA 4HSPA 2R7FA 1I4HA 2F4VQ 4B3RQ 4B3TQ 1K8OA 1EWIA 4RHRA 1VQJA 1BUVT 3HKZB 1VMCA 4DV3L 2XIWA 4AYBE 1QG7A 1S40A 2K28A 4AH6A 4OIKA 1S72A 2NVTH 4H44C 5IGFA 1E22A 1G2SA 3CRLC 4BXXG 1GHKA 2ZXPA 5GAHC 2K5HA 2ZXRA 2LFNA 2R7ZG 3M3YH 1PVOA 3HOXG 4PMWA 4A93H 1IBLQ 3KLRA 1V8QA 4ODGA 1FGUA 1O80A 4IURA 2A6HD 4CJ2C 1F9SA 1SEBD 4KD4A 3HEJA 5JOBA 3PUYA 1M1KC 4KHVA 2ENBA 4GOPC 4X66Q 1CKOA 1PH1A 3CCRA 1F2YA 1SFOH 3GTJB 3TQYA 5LMNQ 4O1NA 2NVYH 4LF7Q 1PZID 4ZK9B 1KRSA 4H13C 1LTBD 3S1QH 2ZT9C 2E76C 4N9TA 4RGMA 1II3A 4EQ5A 2K1BA 1VDZA 1YVCA 2M00A 4BY1G 4JYAQ 4LF4Q 1RIPA 1ILQA 2RCFA 5CV5A 3OWFA
chains in the Genus database with same CATH topology
4R4TA 1GKHA 2YYZA 3J81i 1JE5A 3TREA 1A62A 3K0XA 2B63H 1NTGA 1AE3A 1UEBA 1YHAA 2K52A 2N49A 1K8AC 4JI8L 4HIOA 2UUBQ 3HOUG 4JI3Q 4O2DA 2NN6G 2A1AA 1P8LA 5IT9c 4DR2Q 4GLAC 2UXDQ 2K50A 4B3SQ 2FXQA 3H0GH 3VDYA 2HQLA 1R9TH 4GLXA 4YCWA 1VS0A 2JEBI 5IWAQ 3S1MH 3M4OH 2JA8G 1I3QH 1XNQQ 4DR5L 3I55A 2WFWA 1PH8A 2RHSB 4GN4B 4DAYB 4C2MH 3CCEA 4QJFA 1EIFA 4YCUA 4IO9A 3MXNB 1K9MC 4DV0Q 2F4VL 1BKBA 4B3RL 4B3TL 4GLVB 4AYBG 3D31A 2UU9Q 3A5UA 3PO2G 3K81C 3HOYG 1K0RA 3CC2A 5GAGC 3RR5A 1EIYB 1HR0L 3S16H 2R93H 2IX0A 4JI2Q 4DV6L 4A76A 1L2FA 4P71A 4LWCA 1AE2A 4A3FG 3HOWH 4A3GG 5K36G 2E2IH 3CP0A 1XNRL 1N36L 1KIXA 1XPUA 4GNXA 2VQFL 5IYBG 1XTDA 3KYHC 1A0IA 2CWAA 1PH3A 1C7YA 2ID0A 2NZOA 2OQ0A 4BY7H 1LUZA 1X3FA 2QGQA 1O7IA 4DUZQ 1OXXK 1CSQA 3J80c 1HNZQ 1IBMQ 1BVSA 2AWNA 3EBEA 1G291 5JEAJ 4LF5Q 1TXYA 4P74A 1YBYA 1J6QA 4DAMA 3F2BA 1IBLL 2Q2HA 2I5MX 4HJAA 3U58A 4A3MG 2JA5H 3S2HH 1NY4A 2PNHA 2BH8A 4P73A 3RN5A 2E5LL 5M5WH 3DM3A 2UUCQ 1VQBA 2MO1A 4X66L 1IBKL 1YJ9A 4GKKQ 2IX1A 3T1YL 4DNIA 4B3MQ 2V1CC 4H02A 5IP7G 5LMNL 5M3FH 1I50H 2GVBA 4DV7L 1N8RC 4DR7Q 4LF7L 4IPGA 3ERSX 3RLOA 4AQYL 4RG1A 1GO3E 4YWKA 3CQZH 4JCVE 2AMCB 1A63A 1VQKA 1MJEA 3JAMc 1VQ4A 5IYCH 5IY0A 1SRUA 1JMCA 4JYAL 1E7ZA 4LFCQ 4LF4L 1MIUA 4IPCA 3G48A 4APVA 2GN5A 1VCIA 2L15A 3F8TA 3CXCA 1DGSA 1TWHH 4ME3A 1K8GA 3CCQA 3EIVA 4GKJQ 4KI0A 3E9IA 2UUBL 4JI3L 1X3EA 4DR2L 1PHJA 4QQBX 3S24A 2UXDL 1W2BA 4B3SL 1Y14B 4QIWE 2VQEL 1Q81C 4LF6Q 2AHOB 5GQOA 1V43A 2N8NA 2WP8J 5IWAL 5M5YH 4HJ8A 3HOZG 3B6YA 4JC0A 4PZ8A 3CPFA 4P75A 2JA6G 3KFUA 1XNQL 2DUDA 1QUQB 3I4NH 4KHPQ 1HZBA 3CW2C 2WAQE 1HNXQ 1K3RA 2ZJRA 1TWCH 5IYBH 2JQOA 3HOVG 1AH9A 3CCVA 4DV0L 1D8LA 1Q1EA 3FKIH 4GN3B 4LNQA 4LUZA 3I4MG 1EUJA 1XJVA 2WB1E 2CFMA 2IT1A 3D0FA 3HKZG 3SGIA 1XPOA 2I0QA 4A75A 2UU9L 3PIPA 5C0XG 4NXMQ 1N32Q 1PH9A 3CCUA 1L1OC 3KF8B 4JI2L 3PGZA 4DR1Q 1L1OB 1I5FA 4DR3Q 4A3EH 1JB7A 1C0AA 3K8AA 4GN5A 4IJHA 2QA4A 2VNUD 2BA0A 3KOJA 4DV7Q 1B70B 1EQRA 4K0KQ 3RLFA 3PV0A 2ATWA 1HZ9A 1VQ8A 1JJCB 1PH5A 1Q82C 3AFQA 4DUZL 4A3IH 3NBHB 4UPAA 1HZCA 1X55A 1QZHA 1HNZL 2YV5A 1IBML 3Q8DA 4LFAQ 4LF5L 1LYLA 1VQLA 3DLLA 1SMXA 4A3KG 3U50C 1XMOQ 3M7NA 3HKSA 4A3LH 3UDFA 1YI2A 4R4CA 1SLJA 2ZTDA 4OWTB 5M3MG 2Z6KC 1P16A 3J81j 2UUCL 2KHJA 3S14H 4JOIC 2Q2TA 4GKKL 1I94Q 4B3ML 1QUQA 1XMQQ 4YY3L 2C35B 2KENA 4IPDA 4NB3A 3U4ZA 4HJ7A 1UWVA 4DR7L 1TWFH 3BU2A 4MTNA 4L5SA 2VQEQ 4X64Q 4UY8C 3J7ZC 2ZM6Q 3H15A 4BBSH 5E7NA 2RHQB 4LFBQ 3K7AH 3CCLA 4X65Q 2JA9A 1N9WA 4DK6C 4LFCL 1X54A 3J81c 2PI2E 5FLXc 1UE6A 1Y1WH 4JBWA 1Y1VG 1L1OA 4ALPA 2JA6H 4R1JA 1KRTA 3OTOQ 4BXXH 1EOVA 1J5EQ 4R4QA 1N34Q 4BBRH 4YHHQ 1CKMA 3GTGH 3TRZA 3TS2A 4GKJL 2R7ZH 4EX5A 4NXNQ 1U0LA 4MNOA 5GAEC 3HOXH 3NEMA 1GM5A 3KJPA 4DR6Q 5C4XG 3F2CA 3GTPH 4LF6L 1PH7A 5C3EG 3PSIA 4DR4Q 1PH6A 1SROA 1Q8KA 3F2DA 4A3DG 1LTLA 1X56A 4C3HH 2YTVA 5GROA 1WJJA 1V1QA 3RLNA 4L5TA 1EFWA 4JI6Q 4KHPL 1HNXL 4OONA 2VUMG 3ULLA 2Z6KA 3STBD 2R7DA 4DV5Q 5FJ8G 4JOIA 5IP9G 1VQCA 3I2ZA 1L0WA 4DPGA 3ZJYC 5ELOA 2VW9A 1VQ7A 1VQNA 4NXML 5IYDH 2NVQH 2JA7G 2IY5B 3GTKH 1N32L 4JI4Q 3PO3G 4BY1H 2H5XA 4POGA 1NMFA 4DR1L 1Q46A 4DR3L 4YY3Q 2N3SA 5M3MH 2ASBA 1G51A 4IPHA 2MO0A 4K0KL 1Z9FA 3EN2A 3GD7A 4TQUS 5BR8Q 3S1RH 4JV5Q 1VQIA 4A93G 2NZHA 3AYHB 1WCMG 3ULPA 1QVCA 5FLMG 4IOCA 2K14A 1UE1A 1SN8A 3L0OA 3UE0A 4R4IA 3HOUH 2UXCQ 2LXKA 4OO1I 3GTQH 4LFAL 1PV4A 2A8VA 4TVAB 2KBNA 1B7YB 3I4OA 4IFDJ 3UE1A 1XMOL 2UUAQ 1NBWA 3E9HA 3CMAA 3CMEA 2CCZA 4A3BG 2JA8H 2LXJA 3GTLH 1CSPA 1VQ9A 3M4PA 4JG2A 3UDGA 1Q1BA 4A3JG 1I94L 4A3CG 5M5XH 4DV4Q 1XMQL 1RL2A 1VQGA 4WJ3M 1E1TA 5C44G 3TEHB 2ALYB 3W1GA 3CCSA 3T1HL 1KC8C 3PUXA 1JT8A 4JI7Q 2EXDA 1GVPA 4XTCS 3BZCA 2BA1A 2PQAB 4X64L 2ZM6L 4JBMA 2IHEA 3ER0A 3HOYH 3PO2H 3S15H 1X6OA 5LMNW 1QZGA 2KHIA 4LFBL 1JJGA 2MQHA 4X65L 1VQPA 4A3GH 4A3FH 2HHHQ 1HNWQ 1UE5A 3WWVA 1VQMA 5C3EH 1Q86C 2K75A 4LW1A 1K83H 1MKHA 3G71A 4WJ4A 2F3IA 5H1SE 3OTOL 2R6GA 2GVAA 1J5EL 1N34L 1S3OA 3KDFB 1VQ5A 4YHHL 3TS0A 2RF4A 4PG3A 1V9PA 1VQFA 3PUZA 3M4QA 4NXNL 4MZ9A 5FJ8H 1VQ6A 2HT1A 4YCVA 1ASZA 4DR6L 4DV1Q 1Q7YC 4PZ6A 4X6AH 4LF8Q 2PI2A 3KF6B 4OWXB 1FVIA 4A3MH 3CC4A 4L5RC 1U5KA 2VS1A 4DR4L 2VL6A 1D7QA 1M90C 1KXLA 1HJPA 2N78A 3PO3H 4JI0Q 4JI6L 4AIMA 2B29A 1XPRA 5IP7H 3E0EA 5J3BA 2R93G 5C4JH 4DV5L 2I5HA 3H3VH 1HH2P 1B8AA 1KAWA 3CCMA 4DKAC 3GTOH 3AQQA 2BH2A 1GD7A 3CD6A 1CUKA 4LF9Q 2YU9H 1VQEA 2QEXA 2ES2A 2PQAA 4YWLA 3K7UC 4XIGS 4JI4L 3AEVA 3GTMH 1I6HH 3RNUA 1N33Q 4BY7G 2Y0SE 2OTLA 4X62Q 4GOPB 2HIVA 4QL5A 1Q12A 5BR8L 1BBWA 4JV5L 4Y52H 3T1HQ 4OX9Q 1LM0A 4A3JH 4Y7NH 2JE6I 3A74A 3KDFA 5JEAG 2JA5G 3A0JA 4OXPA 2UXCL 1VQDA 1NJIC 1OXSC 3JC66 2RCNA 2KCMA 3M9BA 1FJGQ 1E1OA 2A19A 1X3GA 4KLKA 1PYBA 1KL9A 2UUAL 3S2DH 4HIDA 2DGYA 3HOZH 2K5VA 5AJ3L 5M3FG 3KF6A 3OYYA 2E2HH 3LGJA 4HJ5A 2AWOA 4KHZA 4JI5Q 1YEZA 5LMUQ 4DUYQ 2JK8A 3L2PA 3NELA 4DV3Q 4DV4L 3HOVH 3ULJA 4OWWB 4GS3A 1KQSA 2OTJA 1H95A 2LSSA 5IYCG 3I4MH 5C0XJ 1TWGH 4JBKA 1YNXA 4PZ7A 4JI7L 1QVGA 3AFPA 1OXVA 4IFDG 1CKNB 4DK3C 2NN6I 2D0PA 3GDEA 2WAQG 2MNAA 2HHHL 1VQHA 1HNWL 1E24A 3BZKA 5HY6A 1EQQA 3FHWA 2Q2UA 1NMGA 2IHFA 4GOPA 2WB1G 1X65A 2CKZB 4IFDI 3S1NH 1T9HA 4JBJA 2OCEA 4YWMA 4JI1Q 1E3PA 1ASYA 4BA2I 4UP9A 3J80i 1IYJB 3KJOA 1EYGA 2D62A 3HKZE 4R4OA 1YZ6A 2ZJPA 1X9NA 1C9OA 1OXTA 3HFZB 3I4NG 2ZTEA 4DV1L 2XGTA 1MJCA 2E2JH 4A3KH 4LF8L 3CC7A 4OO1G 2UXBQ 1PYSB 1BBUA 3FKIG 3K80C 1YJNA 1HR0W 2Q2IA 2R92G 1K73C 4JI0L 3GTJH 1KHIA 1UE7A 2I5LX 4LUVA 4UP8A 3STBC 2AKWB 4C3IH 3OW2A 4FDBA 4L5QA 1PFSA 3UDIA 1IL2A 4QGUA 1YHQA 1WYDA 1WFQA 1PA6A 3J7A5 5JJLA 3JAMi 4A3EG 3MEFA 3W5OA 4DV2Q 4LF9L 2YTYA 4LUOA 3G6EA 5AJ3Q 2Y0SG 5GADC 1NE3A 2F52A 3I56A 1CKNA 3KLWA 1N33L 3W1BA 4P72A 5EAYA 4X62L 2K5NA 3A5ZB 4JI8Q 2EQSA 4A3IG 1Y1VH 3GO5A 1FL0A 2E8GA 1G6PA 1IZ6A 1OXUA 1KD1C 4OX9L 4HIMA 2YTXA 4C3JH 3RN2A 1PH4A 5ELNA 3NENA 4A3LG 3I7FA 4DR5Q 1Z47A 5C4XH 3PF4A 3FP9A 3UDXA 4POFA 1FJGL 2B63G 3H3VI 3CCJA 4A3DH 2R7FA 2F4VQ 2ZJQA 3PIOA 4B3RQ 4B3TQ 2OQKA 1EWIA 3H0GG 4NPSA 4JI5L 1VQJA 3CAMA 4BA1I 5LMUL 2EIFA 4DUYL 4IOAA 3PUVA 1PH2A 4DV3L 2VUMH 3CF5A 4BBSG 1HR0Q 4AYBE 1YJWA 4DV6Q 4J15A 3RZDH 5IP9H 1VQOA 1HZAA 1SE8A 1S40A 4AH6A 2PMZE 1XNRQ 1N36Q 1S72A 2NVTH 2JA7H 5JJKA 1E22A 5HGQA 2VQFQ 1Y1WG 2VY3A 1WOCA 4BXXG 4QY7A 1YITA 2OWOA 4BBRG 5GAHC 3BJUA 2K5HA 2MFIA 3U4VA 2R7ZG 1JJ2A 3M3YH 1PVOA 4HJ9A 3PUWA 3PCOB 5IE8A 3HOXG 4PMWA 2NVXH 2R92H 4A93H 4JI1L 2Z0SA 1IBLQ 1TWAH 3L7ZC 1WCMH 1OTCA 3HOWG 1FGUA 5FLMH 3F1ZA 4IJLA 2K4KA 4RMFA 4O0AA 1M1KC 5DLQE 3CPWA 3PUYA 1QVFA 2E5LQ 4HIKA 4GOPC 4X66Q 4A4IA 1CKOA 1PH1A 1IBKQ 3CCRA 3PF5A 3T1YQ 1SFOH 3TQYA 5LMNQ 1A8VA 2XTIA 2JJQA 3S17H 2HIXA 4A3BH 5C0XI 5JJIA 2NVYH 2ZTCA 2UXBL 4LF7Q 2JEAI 3RZOH 3IRBA 1KRSA 4AQYQ 1SR3A 5IYDG 3ICEA 4A3CH 4UP7A 3S1QH 2KCTA 5C44H 4GNXC 1IXRA 1W3SA 2B3GA 2D0OA 4EQ5A 1YVCA 4BY1G 4JYAQ 4GNXB 4LF4Q 2VZAA 2CQOA 1WI5A 1RIPA 1YHBA 3G4SA 2CWPA 1VQAA 4DV2L 1YIJA 3M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4T A;  1GKH A;  2YYZ A;  3J81 i;  1JE5 A;  3TRE A;  1A62 A;  3K0X A;  2B63 H;  1NTG A;  1AE3 A;  1UEB A;  1YHA A;  2K52 A;  2N49 A;  1K8A C;  4JI8 L;  4HIO A;  2UUB Q;  3HOU G;  4JI3 Q;  4O2D A;  2NN6 G;  2A1A A;  1P8L A;  5IT9 c;  4DR2 Q;  4GLA C;  2UXD Q;  2K50 A;  4B3S Q;  2FXQ A;  3H0G H;  3VDY A;  2HQL A;  1R9T H;  4GLX A;  4YCW A;  1VS0 A;  2JEB I;  5IWA Q;  3S1M H;  3M4O H;  2JA8 G;  1I3Q H;  1XNQ Q;  4DR5 L;  3I55 A;  2WFW A;  1PH8 A;  2RHS B;  4GN4 B;  4DAY B;  4C2M H;  3CCE A;  4QJF A;  1EIF A;  4YCU A;  4IO9 A;  3MXN B;  1K9M C;  4DV0 Q;  2F4V L;  1BKB A;  4B3R L;  4B3T L;  4GLV B;  4AYB G;  3D31 A;  2UU9 Q;  3A5U A;  3PO2 G;  3K81 C;  3HOY G;  1K0R A;  3CC2 A;  5GAG C;  3RR5 A;  1EIY B;  1HR0 L;  3S16 H;  2R93 H;  2IX0 A;  4JI2 Q;  4DV6 L;  4A76 A;  1L2F A;  4P71 A;  4LWC A;  1AE2 A;  4A3F G;  3HOW H;  4A3G G;  5K36 G;  2E2I H;  3CP0 A;  1XNR L;  1N36 L;  1KIX A;  1XPU A;  4GNX A;  2VQF L;  5IYB G;  1XTD A;  3KYH C;  1A0I A;  2CWA A;  1PH3 A;  1C7Y A;  2ID0 A;  2NZO A;  2OQ0 A;  4BY7 H;  1LUZ A;  1X3F A;  2QGQ A;  1O7I A;  4DUZ Q;  1OXX K;  1CSQ A;  3J80 c;  1HNZ Q;  1IBM Q;  1BVS A;  2AWN A;  3EBE A;  1G29 1;  5JEA J;  4LF5 Q;  1TXY A;  4P74 A;  1YBY A;  1J6Q A;  4DAM A;  3F2B A;  1IBL L;  2Q2H A;  2I5M X;  4HJA A;  3U58 A;  4A3M G;  2JA5 H;  3S2H H;  1NY4 A;  2PNH A;  2BH8 A;  4P73 A;  3RN5 A;  2E5L L;  5M5W H;  3DM3 A;  2UUC Q;  1VQB A;  2MO1 A;  4X66 L;  1IBK L;  1YJ9 A;  4GKK Q;  2IX1 A;  3T1Y L;  4DNI A;  4B3M Q;  2V1C C;  4H02 A;  5IP7 G;  5LMN L;  5M3F H;  1I50 H;  2GVB A;  4DV7 L;  1N8R C;  4DR7 Q;  4LF7 L;  4IPG A;  3ERS X;  3RLO A;  4AQY L;  4RG1 A;  1GO3 E;  4YWK A;  3CQZ H;  4JCV E;  2AMC B;  1A63 A;  1VQK A;  1MJE A;  3JAM c;  1VQ4 A;  5IYC H;  5IY0 A;  1SRU A;  1JMC A;  4JYA L;  1E7Z A;  4LFC Q;  4LF4 L;  1MIU A;  4IPC A;  3G48 A;  4APV A;  2GN5 A;  1VCI A;  2L15 A;  3F8T A;  3CXC A;  1DGS A;  1TWH H;  4ME3 A;  1K8G A;  3CCQ A;  3EIV A;  4GKJ Q;  4KI0 A;  3E9I A;  2UUB L;  4JI3 L;  1X3E A;  4DR2 L;  1PHJ A;  4QQB X;  3S24 A;  2UXD L;  1W2B A;  4B3S L;  1Y14 B;  4QIW E;  2VQE L;  1Q81 C;  4LF6 Q;  2AHO B;  5GQO A;  1V43 A;  2N8N A;  2WP8 J;  5IWA L;  5M5Y H;  4HJ8 A;  3HOZ G;  3B6Y A;  4JC0 A;  4PZ8 A;  3CPF A;  4P75 A;  2JA6 G;  3KFU A;  1XNQ L;  2DUD A;  1QUQ B;  3I4N H;  4KHP Q;  1HZB A;  3CW2 C;  2WAQ E;  1HNX Q;  1K3R A;  2ZJR A;  1TWC H;  5IYB H;  2JQO A;  3HOV G;  1AH9 A;  3CCV A;  4DV0 L;  1D8L A;  1Q1E A;  3FKI H;  4GN3 B;  4LNQ A;  4LUZ A;  3I4M G;  1EUJ A;  1XJV A;  2WB1 E;  2CFM A;  2IT1 A;  3D0F A;  3HKZ G;  3SGI A;  1XPO A;  2I0Q A;  4A75 A;  2UU9 L;  3PIP A;  5C0X G;  4NXM Q;  1N32 Q;  1PH9 A;  3CCU A;  1L1O C;  3KF8 B;  4JI2 L;  3PGZ A;  4DR1 Q;  1L1O B;  1I5F A;  4DR3 Q;  4A3E H;  1JB7 A;  1C0A A;  3K8A A;  4GN5 A;  4IJH A;  2QA4 A;  2VNU D;  2BA0 A;  3KOJ A;  4DV7 Q;  1B70 B;  1EQR A;  4K0K Q;  3RLF A;  3PV0 A;  2ATW A;  1HZ9 A;  1VQ8 A;  1JJC B;  1PH5 A;  1Q82 C;  3AFQ A;  4DUZ L;  4A3I H;  3NBH B;  4UPA A;  1HZC A;  1X55 A;  1QZH A;  1HNZ L;  2YV5 A;  1IBM L;  3Q8D A;  4LFA Q;  4LF5 L;  1LYL A;  1VQL A;  3DLL A;  1SMX A;  4A3K G;  3U50 C;  1XMO Q;  3M7N A;  3HKS A;  4A3L H;  3UDF A;  1YI2 A;  4R4C A;  1SLJ A;  2ZTD A;  4OWT B;  5M3M G;  2Z6K C;  1P16 A;  3J81 j;  2UUC L;  2KHJ A;  3S14 H;  4JOI C;  2Q2T A;  4GKK L;  1I94 Q;  4B3M L;  1QUQ A;  1XMQ Q;  4YY3 L;  2C35 B;  2KEN A;  4IPD A;  4NB3 A;  3U4Z A;  4HJ7 A;  1UWV A;  4DR7 L;  1TWF H;  3BU2 A;  4MTN A;  4L5S A;  2VQE Q;  4X64 Q;  4UY8 C;  3J7Z C;  2ZM6 Q;  3H15 A;  4BBS H;  5E7N A;  2RHQ B;  4LFB Q;  3K7A H;  3CCL A;  4X65 Q;  2JA9 A;  1N9W A;  4DK6 C;  4LFC L;  1X54 A;  3J81 c;  2PI2 E;  5FLX c;  1UE6 A;  1Y1W H;  4JBW A;  1Y1V G;  1L1O A;  4ALP A;  2JA6 H;  4R1J A;  1KRT A;  3OTO Q;  4BXX H;  1EOV A;  1J5E Q;  4R4Q A;  1N34 Q;  4BBR H;  4YHH Q;  1CKM A;  3GTG H;  3TRZ A;  3TS2 A;  4GKJ L;  2R7Z H;  4EX5 A;  4NXN Q;  1U0L A;  4MNO A;  5GAE C;  3HOX H;  3NEM A;  1GM5 A;  3KJP A;  4DR6 Q;  5C4X G;  3F2C A;  3GTP H;  4LF6 L;  1PH7 A;  5C3E G;  3PSI A;  4DR4 Q;  1PH6 A;  1SRO A;  1Q8K A;  3F2D A;  4A3D G;  1LTL A;  1X56 A;  4C3H H;  2YTV A;  5GRO A;  1WJJ A;  1V1Q A;  3RLN A;  4L5T A;  1EFW A;  4JI6 Q;  4KHP L;  1HNX L;  4OON A;  2VUM G;  3ULL A;  2Z6K A;  3STB D;  2R7D A;  4DV5 Q;  5FJ8 G;  4JOI A;  5IP9 G;  1VQC A;  3I2Z A;  1L0W A;  4DPG A;  3ZJY C;  5ELO A;  2VW9 A;  1VQ7 A;  1VQN A;  4NXM L;  5IYD H;  2NVQ H;  2JA7 G;  2IY5 B;  3GTK H;  1N32 L;  4JI4 Q;  3PO3 G;  4BY1 H;  2H5X A;  4POG A;  1NMF A;  4DR1 L;  1Q46 A;  4DR3 L;  4YY3 Q;  2N3S A;  5M3M H;  2ASB A;  1G51 A;  4IPH A;  2MO0 A;  4K0K L;  1Z9F A;  3EN2 A;  3GD7 A;  4TQU S;  5BR8 Q;  3S1R H;  4JV5 Q;  1VQI A;  4A93 G;  2NZH A;  3AYH B;  1WCM G;  3ULP A;  1QVC A;  5FLM G;  4IOC A;  2K14 A;  1UE1 A;  1SN8 A;  3L0O A;  3UE0 A;  4R4I A;  3HOU H;  2UXC Q;  2LXK A;  4OO1 I;  3GTQ H;  4LFA L;  1PV4 A;  2A8V A;  4TVA B;  2KBN A;  1B7Y B;  3I4O A;  4IFD J;  3UE1 A;  1XMO L;  2UUA Q;  1NBW A;  3E9H A;  3CMA A;  3CME A;  2CCZ A;  4A3B G;  2JA8 H;  2LXJ A;  3GTL H;  1CSP A;  1VQ9 A;  3M4P A;  4JG2 A;  3UDG A;  1Q1B A;  4A3J G;  1I94 L;  4A3C G;  5M5X H;  4DV4 Q;  1XMQ L;  1RL2 A;  1VQG A;  4WJ3 M;  1E1T A;  5C44 G;  3TEH B;  2ALY B;  3W1G A;  3CCS A;  3T1H L;  1KC8 C;  3PUX A;  1JT8 A;  4JI7 Q;  2EXD A;  1GVP A;  4XTC S;  3BZC A;  2BA1 A;  2PQA B;  4X64 L;  2ZM6 L;  4JBM A;  2IHE A;  3ER0 A;  3HOY H;  3PO2 H;  3S15 H;  1X6O A;  5LMN W;  1QZG A;  2KHI A;  4LFB L;  1JJG A;  2MQH A;  4X65 L;  1VQP A;  4A3G H;  4A3F H;  2HHH Q;  1HNW Q;  1UE5 A;  3WWV A;  1VQM A;  5C3E H;  1Q86 C;  2K75 A;  4LW1 A;  1K83 H;  1MKH A;  3G71 A;  4WJ4 A;  2F3I A;  5H1S E;  3OTO L;  2R6G A;  2GVA A;  1J5E L;  1N34 L;  1S3O A;  3KDF B;  1VQ5 A;  4YHH L;  3TS0 A;  2RF4 A;  4PG3 A;  1V9P A;  1VQF A;  3PUZ A;  3M4Q A;  4NXN L;  4MZ9 A;  5FJ8 H;  1VQ6 A;  2HT1 A;  4YCV A;  1ASZ A;  4DR6 L;  4DV1 Q;  1Q7Y C;  4PZ6 A;  4X6A H;  4LF8 Q;  2PI2 A;  3KF6 B;  4OWX B;  1FVI A;  4A3M H;  3CC4 A;  4L5R C;  1U5K A;  2VS1 A;  4DR4 L;  2VL6 A;  1D7Q A;  1M90 C;  1KXL A;  1HJP A;  2N78 A;  3PO3 H;  4JI0 Q;  4JI6 L;  4AIM A;  2B29 A;  1XPR A;  5IP7 H;  3E0E A;  5J3B A;  2R93 G;  5C4J H;  4DV5 L;  2I5H A;  3H3V H;  1HH2 P;  1B8A A;  1KAW A;  3CCM A;  4DKA C;  3GTO H;  3AQQ A;  2BH2 A;  1GD7 A;  3CD6 A;  1CUK A;  4LF9 Q;  2YU9 H;  1VQE A;  2QEX A;  2ES2 A;  2PQA A;  4YWL A;  3K7U C;  4XIG S;  4JI4 L;  3AEV A;  3GTM H;  1I6H H;  3RNU A;  1N33 Q;  4BY7 G;  2Y0S E;  2OTL A;  4X62 Q;  4GOP B;  2HIV A;  4QL5 A;  1Q12 A;  5BR8 L;  1BBW A;  4JV5 L;  4Y52 H;  3T1H Q;  4OX9 Q;  1LM0 A;  4A3J H;  4Y7N H;  2JE6 I;  3A74 A;  3KDF A;  5JEA G;  2JA5 G;  3A0J A;  4OXP A;  2UXC L;  1VQD A;  1NJI C;  1OXS C;  3JC6 6;  2RCN A;  2KCM A;  3M9B A;  1FJG Q;  1E1O A;  2A19 A;  1X3G A;  4KLK A;  1PYB A;  1KL9 A;  2UUA L;  3S2D H;  4HID A;  2DGY A;  3HOZ H;  2K5V A;  5AJ3 L;  5M3F G;  3KF6 A;  3OYY A;  2E2H H;  3LGJ A;  4HJ5 A;  2AWO A;  4KHZ A;  4JI5 Q;  1YEZ A;  5LMU Q;  4DUY Q;  2JK8 A;  3L2P A;  3NEL A;  4DV3 Q;  4DV4 L;  3HOV H;  3ULJ A;  4OWW B;  4GS3 A;  1KQS A;  2OTJ A;  1H95 A;  2LSS A;  5IYC G;  3I4M H;  5C0X J;  1TWG H;  4JBK A;  1YNX A;  4PZ7 A;  4JI7 L;  1QVG A;  3AFP A;  1OXV A;  4IFD G;  1CKN B;  4DK3 C;  2NN6 I;  2D0P A;  3GDE A;  2WAQ G;  2MNA A;  2HHH L;  1VQH A;  1HNW L;  1E24 A;  3BZK A;  5HY6 A;  1EQQ A;  3FHW A;  2Q2U A;  1NMG A;  2IHF A;  4GOP A;  2WB1 G;  1X65 A;  2CKZ B;  4IFD I;  3S1N H;  1T9H A;  4JBJ A;  2OCE A;  4YWM A;  4JI1 Q;  1E3P A;  1ASY A;  4BA2 I;  4UP9 A;  3J80 i;  1IYJ B;  3KJO A;  1EYG A;  2D62 A;  3HKZ E;  4R4O A;  1YZ6 A;  2ZJP A;  1X9N A;  1C9O A;  1OXT A;  3HFZ B;  3I4N G;  2ZTE A;  4DV1 L;  2XGT A;  1MJC A;  2E2J H;  4A3K H;  4LF8 L;  3CC7 A;  4OO1 G;  2UXB Q;  1PYS B;  1BBU A;  3FKI G;  3K80 C;  1YJN A;  1HR0 W;  2Q2I A;  2R92 G;  1K73 C;  4JI0 L;  3GTJ H;  1KHI A;  1UE7 A;  2I5L X;  4LUV A;  4UP8 A;  3STB C;  2AKW B;  4C3I H;  3OW2 A;  4FDB A;  4L5Q A;  1PFS A;  3UDI A;  1IL2 A;  4QGU A;  1YHQ A;  1WYD A;  1WFQ A;  1PA6 A;  3J7A 5;  5JJL A;  3JAM i;  4A3E G;  3MEF A;  3W5O A;  4DV2 Q;  4LF9 L;  2YTY A;  4LUO A;  3G6E A;  5AJ3 Q;  2Y0S G;  5GAD C;  1NE3 A;  2F52 A;  3I56 A;  1CKN A;  3KLW A;  1N33 L;  3W1B A;  4P72 A;  5EAY A;  4X62 L;  2K5N A;  3A5Z B;  4JI8 Q;  2EQS A;  4A3I G;  1Y1V H;  3GO5 A;  1FL0 A;  2E8G A;  1G6P A;  1IZ6 A;  1OXU A;  1KD1 C;  4OX9 L;  4HIM A;  2YTX A;  4C3J H;  3RN2 A;  1PH4 A;  5ELN A;  3NEN A;  4A3L G;  3I7F A;  4DR5 Q;  1Z47 A;  5C4X H;  3PF4 A;  3FP9 A;  3UDX A;  4POF A;  1FJG L;  2B63 G;  3H3V I;  3CCJ A;  4A3D H;  2R7F A;  2F4V Q;  2ZJQ A;  3PIO A;  4B3R Q;  4B3T Q;  2OQK A;  1EWI A;  3H0G G;  4NPS A;  4JI5 L;  1VQJ A;  3CAM A;  4BA1 I;  5LMU L;  2EIF A;  4DUY L;  4IOA A;  3PUV A;  1PH2 A;  4DV3 L;  2VUM H;  3CF5 A;  4BBS G;  1HR0 Q;  4AYB E;  1YJW A;  4DV6 Q;  4J15 A;  3RZD H;  5IP9 H;  1VQO A;  1HZA A;  1SE8 A;  1S40 A;  4AH6 A;  2PMZ E;  1XNR Q;  1N36 Q;  1S72 A;  2NVT H;  2JA7 H;  5JJK A;  1E22 A;  5HGQ A;  2VQF Q;  1Y1W G;  2VY3 A;  1WOC A;  4BXX G;  4QY7 A;  1YIT A;  2OWO A;  4BBR G;  5GAH C;  3BJU A;  2K5H A;  2MFI A;  3U4V A;  2R7Z G;  1JJ2 A;  3M3Y H;  1PVO A;  4HJ9 A;  3PUW A;  3PCO B;  5IE8 A;  3HOX G;  4PMW A;  2NVX H;  2R92 H;  4A93 H;  4JI1 L;  2Z0S A;  1IBL Q;  1TWA H;  3L7Z C;  1WCM H;  1OTC A;  3HOW G;  1FGU A;  5FLM H;  3F1Z A;  4IJL A;  2K4K A;  4RMF A;  4O0A A;  1M1K C;  5DLQ E;  3CPW A;  3PUY A;  1QVF A;  2E5L Q;  4HIK A;  4GOP C;  4X66 Q;  4A4I A;  1CKO A;  1PH1 A;  1IBK Q;  3CCR A;  3PF5 A;  3T1Y Q;  1SFO H;  3TQY A;  5LMN Q;  1A8V A;  2XTI A;  2JJQ A;  3S17 H;  2HIX A;  4A3B H;  5C0X I;  5JJI A;  2NVY H;  2ZTC A;  2UXB L;  4LF7 Q;  2JEA I;  3RZO H;  3IRB A;  1KRS A;  4AQY Q;  1SR3 A;  5IYD G;  3ICE A;  4A3C H;  4UP7 A;  3S1Q H;  2KCT A;  5C44 H;  4GNX C;  1IXR A;  1W3S A;  2B3G A;  2D0O A;  4EQ5 A;  1YVC A;  4BY1 G;  4JYA Q;  4GNX B;  4LF4 Q;  2VZA A;  2CQO A;  1WI5 A;  1RIP A;  1YHB A;  3G4S A;  2CWP A;  1VQA A;  4DV2 L;  1YIJ A;  3M85 A; 
#chains in the Genus database with same CATH topology
 4DFA A;  2YYZ A;  1B53 A;  1I4G A;  3TRE A;  5EKK A;  3K0X A;  4ILW A;  1UEB A;  2N49 A;  4HIO A;  3HOU G;  1P8L A;  1K3B C;  4GLA C;  2UXD Q;  4B3S Q;  4FF4 A;  3H0G H;  4A3G B;  3DEO A;  1R9T H;  4YCW A;  1WVL A;  4XDX A;  3X3N A;  5C3E B;  4ZLT F;  1GUW A;  1JWM D;  3C46 A;  4J6H A;  4DR5 L;  2ICI A;  4HTH A;  3LNN A;  1PH8 A;  4GN4 B;  5I9O A;  4IO9 A;  3G6J B;  1QOH A;  1BKB A;  2QW7 A;  3RUZ A;  1IYV A;  3A5U A;  1BCP D;  3HOY G;  3D8G A;  2IX0 A;  1R4P B;  1PFM A;  2SEB D;  1PZK D;  5C5M A;  4N8F A;  3H3V C;  1XTD A;  5CV6 A;  3GP7 A;  2NZO A;  2OQ0 A;  4BY7 H;  1LUZ A;  1X3F A;  1O7I A;  1OXX K;  2A6E D;  2YU9 B;  3J80 c;  1HNZ Q;  1IBM Q;  2FJ2 A;  4LF5 Q;  2LMC B;  1ML0 D;  4IQZ A;  2F0E A;  2PNH A;  4P73 A;  3RN5 A;  2E5L L;  5M5W H;  1IBK L;  1YJ9 A;  1BF4 A;  1S4Z A;  4RAU C;  1K0S A;  4H02 A;  5M3F H;  1STH A;  4DV7 L;  4AQY L;  4RG1 A;  1GO3 E;  1A2U A;  3CQZ H;  4HR7 B;  4L6T B;  1MJE A;  1A3T A;  5C3W A;  3WOF A;  1D5M C;  1VMP A;  1Z6H A;  4OEM B;  5IYC H;  1F9R A;  4JK1 C;  1MIU A;  2K5D A;  4APV A;  2Z4H A;  2K04 A;  1DGS A;  3CXC A;  3SK5 A;  2KJX A;  4GKJ Q;  2NTT A;  2IL8 A;  3EVQ A;  3E9I A;  3MEH A;  1X3E A;  4K5W A;  1JOR A;  3C1F A;  1FYC A;  1Y14 B;  2EVB A;  2AHO B;  5IWA L;  4HJ8 A;  4PZ8 A;  4P75 A;  1F2M A;  4KY7 A;  1XNQ L;  2DUD A;  3MXP A;  4KJN A;  4KHP Q;  1SYD A;  3CW2 C;  1HNX Q;  1ENC A;  1TWC H;  2R93 B;  1E2Z A;  1F9P A;  3FKI H;  4LNQ A;  4LUZ A;  4EQN A;  2CFM A;  1T5X D;  4A3K B;  2A68 D;  3PIP A;  1IKL A;  1JOO A;  3CCU A;  1NNX A;  4K6L A;  1WTW A;  1L1O B;  3W3A A;  1CFM A;  1Q3L A;  1E0B A;  2QA4 A;  2BA0 A;  1PYW D;  3KOJ A;  1B70 B;  2ATW A;  1HZ9 A;  4RWS C;  1WTH A;  3AFQ A;  2JA5 B;  1B3A A;  2IX3 A;  1JOK A;  1SYE A;  3Q8D A;  1LYL A;  2A6H C;  2QDB A;  3DLL A;  2XNA C;  1SMX A;  1XMO Q;  1DYQ A;  3IL8 A;  4A3L H;  1TKW B;  3UDF A;  1SLJ A;  3J81 j;  2KHJ A;  2G9H D;  3SK8 A;  2Q2T A;  4LJZ C;  5FK9 C;  2RBM A;  4HJ7 A;  4L5S A;  3BDC A;  3D3R A;  4X64 Q;  3H15 A;  3D4W A;  2KCC A;  1YNJ D;  5CV8 A;  4DNR B;  1TWH B;  5L37 A;  4X65 Q;  2QIL A;  2JA9 A;  4K2K A;  3KF8 A;  5FLX c;  2F3W A;  1S5F D;  4ALP A;  1KRT A;  1EOV A;  3RZD B;  2R3Z A;  1N34 Q;  1J5E Q;  1R4Q B;  4YHH Q;  1CKM A;  1D2B A;  1EFI D;  3VA5 A;  3J80 E;  2JP1 A;  5EKI A;  2XN9 C;  4LF6 L;  3GTP H;  1EU3 A;  4DR4 Q;  1PH6 A;  1ZKO A;  1I4Q A;  1WJJ A;  2BOS A;  3VYT A;  1EFW A;  4JI6 Q;  2C5C A;  4ZUJ A;  4C1N K;  3K6O A;  4KN4 C;  1I4X A;  5FJ8 G;  4RGO S;  1X3Q A;  1GUT A;  1VQC A;  3I2Z A;  4DPG A;  2VW9 A;  1B50 A;  1VQN A;  2C9O A;  4NXM L;  3FMC A;  1N32 L;  3S17 B;  1DJR D;  1JR0 D;  2H5X A;  1NMF A;  4ABN A;  4YY3 Q;  1U4M A;  2N3S A;  1D5X C;  1G51 A;  1TU2 B;  1GUO A;  4K0K L;  4TQU S;  4A93 G;  2EJM A;  1VF7 A;  2R61 A;  3ULP A;  2K14 A;  3A55 A;  3L0O A;  1MI2 A;  2A8V A;  4XT3 B;  1STG A;  2A73 B;  2B39 A;  1NBW A;  1QJO A;  3E9H A;  3C3L A;  2CCZ A;  5J22 A;  2JA8 H;  1CSP A;  1VQ9 A;  2F0Q A;  5D3I B;  3UDG A;  4K5X A;  1I94 L;  1H9M A;  4DV4 Q;  1RL2 A;  1XMQ L;  3TEH B;  1V1P B;  2Z8L A;  1I3Q B;  3PUX A;  2L0C A;  4XTC S;  3S15 H;  1SE4 A;  2ZM6 L;  1Y1W B;  4LFB L;  1JJG A;  1CQV A;  3Q0A A;  4A3G H;  4A3F H;  5K36 H;  4BBR B;  1UE5 A;  5C3E H;  3ERO A;  3CRK C;  2D5D A;  2R6G A;  1CQF A;  1VQ5 A;  1SE3 A;  1VQF A;  2RDG A;  3PUZ A;  3M4Q A;  1CZG A;  4J8Q A;  3P1H A;  1VQ6 A;  3BDO A;  2XWB B;  4DR6 L;  4DV1 Q;  1Q7Y C;  4V19 0;  4X6A H;  1H9J A;  4IUT A;  1F9Q A;  4CDF C;  1F77 A;  3L9A X;  1HJP A;  2N78 A;  2F1M A;  4ZRZ A;  3V96 A;  4NKL A;  1EY7 A;  3CKI B;  5J3B A;  3GTK B;  5C4J H;  4DV5 L;  2A68 C;  1CUK A;  2E2D C;  2YU9 H;  1VQE A;  3HG9 A;  2PQA A;  3V05 A;  3U9S A;  4JI4 L;  3RNU A;  1N33 Q;  5CGK A;  4BY7 G;  5HUR A;  5FLX E;  4RKL A;  2MPM A;  4QL5 A;  2F0W A;  5DEH A;  3EJI A;  4PV1 C;  1BBW A;  5BR8 L;  4JV5 L;  4Y52 H;  4OX9 Q;  1LM0 A;  4ID6 A;  3A0J A;  4JW0 A;  2UXC L;  1OXS C;  3JC6 6;  1L0Y B;  1ONL A;  3H91 A;  3BDL A;  1PYB A;  2UUA L;  3HOZ H;  5M3F G;  2FMC A;  1B9N A;  3LGJ A;  2AWO A;  4NW2 A;  4KKT A;  2K05 A;  2JK8 A;  3NQT A;  5M5Y B;  1KQS A;  2K5Q A;  2LSS A;  2PMZ B;  3IKJ A;  5IYC G;  3PIP 3;  4JBK A;  1YNX A;  1W6K A;  5CR3 A;  3AFP A;  3MFY A;  5I2X A;  3LWE A;  3GDE A;  3S9W A;  2HHH L;  2B2T C;  5J39 A;  2WB1 G;  2XWJ B;  2OCE A;  4JI1 Q;  4BA2 I;  4UP9 A;  4K8I A;  1J8I A;  4A3E B;  3IAY A;  1IYJ B;  3KJO A;  2D62 A;  2BE5 C;  3WDN A;  1FNV A;  4RHS A;  4L63 B;  3NWS A;  2E2J H;  4A3K H;  5ELC A;  2UXB Q;  3K5L A;  1CTM A;  1PYS B;  3FKI G;  3K80 C;  3M7G A;  2Q2I A;  1K73 C;  4LUV A;  4PQX A;  4FDB A;  1IL2 A;  1PTO D;  1YHQ A;  1WYD A;  1WFQ A;  1I6H B;  3J7A 5;  4CDC C;  2YTY A;  2Y0S G;  5EGT A;  1NE3 A;  2F52 A;  4P72 A;  5FO9 B;  4Y7N B;  2X6G A;  2CH4 W;  1G6P A;  1KD1 C;  4X3U A;  4HIM A;  3A56 A;  4OEL B;  4C3J H;  5JVH 3;  3RN2 A;  3NEN A;  4A3L G;  2K7V A;  1ICF B;  3DM1 A;  5EPL A;  4N8X 1;  2JA6 B;  1PTO B;  3T56 B;  2E2H B;  2J7Z A;  5C4X H;  5I6Y A;  2PZT A;  1LTA D;  1FJG L;  2B63 G;  3H3V I;  3GTG B;  2K33 A;  2BDN A;  1JIC A;  3HOV B;  4DU9 A;  2ZJQ A;  3PIO A;  1BQQ T;  3I4M B;  4M8A A;  4NPS A;  5I9P A;  2NYZ D;  4JI5 L;  3NHH A;  1U4P A;  2EIF A;  2MUY A;  5LMU L;  3PUV A;  2VUM H;  1GHJ A;  4J15 A;  4XXE A;  5G3L F;  4DV6 Q;  3RZD H;  1ILP A;  1SE8 A;  2PMZ E;  1XNR Q;  1N36 Q;  1F2Z A;  4KJO A;  2JA7 H;  2J4X A;  1F2L A;  1A3U A;  4QY7 A;  5T1I A;  3K0Y A;  3U4V A;  1EZ6 A;  1TS4 A;  3EQL C;  3PUW A;  2WKC A;  5IE8 A;  2NVX H;  4B9W A;  1RF2 D;  1OTC A;  3HOW G;  1ICW A;  1WCM H;  1EYD A;  4LAA A;  1PLF A;  1RTO A;  4IJL A;  4O0A A;  5DLQ E;  1A2T A;  1JOQ A;  4HIK A;  3R2T A;  2RVL A;  1LT4 D;  1EY4 A;  3K59 A;  2JJQ A;  1JB3 A;  3S17 H;  3BYT B;  1UAP A;  2JEA I;  3RZO H;  3IRB A;  4U67 3;  1SR3 A;  1JE4 A;  1GXD C;  2L1B A;  3KBG A;  5KRU A;  4A3C H;  4I65 A;  1G6Z A;  2KCT A;  1IXR A;  1Y69 U;  2HDM A;  3GTL B;  4DV2 L;  2VZA A;  3KK7 A;  2CWP A;  3G4S A;  2PPB C;  1YIJ A;  3M85 A;  1GKH A;  1Y1V B;  3MXU A;  1M8A A;  5DAU A;  2MGS A;  5EBD A;  2MJ8 A;  1NTG A;  2K52 A;  1YHA A;  1K8A C;  3NBI A;  4JI3 Q;  1DOM A;  2A1A A;  5IT9 c;  2RDH A;  2K50 A;  2FXQ A;  3KLS X;  4HAE A;  1VS0 A;  1Y8P B;  3K57 A;  4B9X A;  1LT5 D;  2K01 A;  4F8M A;  2JA8 G;  1I3Q H;  1CT1 D;  5C5L A;  2PW5 A;  1STE A;  1MGS A;  2WFW A;  2RHS B;  1EEI D;  2FMM A;  5C4H A;  5IOC A;  4YCU A;  2RSO A;  3VA7 A;  3QR8 A;  2RQX A;  4ZKB B;  2UU9 Q;  4H0L C;  3K81 C;  2DY8 A;  3S16 H;  5GAG C;  4FXK C;  3RR5 A;  2AQ3 B;  3H09 A;  1HR0 L;  1EIY B;  4JI2 Q;  1IW7 C;  3MA2 B;  1L2F A;  2A5H A;  4LWC A;  1AE2 A;  4A3F G;  4A3G G;  5K36 G;  1EYC A;  3OWE B;  1KIX A;  1XPU A;  3SHL A;  3MHB A;  2VQF L;  2B2U A;  2JN4 A;  3KYH C;  1A0I A;  2XSC A;  1SNQ A;  5DNF A;  1TWA B;  1TVX A;  5FO7 B;  2EY1 A;  1BVS A;  3EBE A;  3I70 A;  1G29 1;  5JEA J;  4P74 A;  1IHZ A;  2Q2H A;  1W6J A;  3U58 A;  1WD0 A;  1AZP A;  1NY4 A;  4IZ8 A;  3S2H H;  4A3B B;  3DM3 A;  2MO1 A;  1CHP D;  2OT2 A;  3T1Y L;  2F0T A;  1STB A;  3QJY A;  4DNI A;  5JVG 3;  1RTN A;  4FO2 A;  2GVB A;  3NK9 A;  4MIU A;  1N8R C;  4DR7 Q;  4IPG A;  1XX8 A;  3MXN A;  2F0H A;  1A63 A;  4JCV E;  3DWQ A;  1PTO C;  3HP3 A;  2NN6 H;  3JAM c;  1LTS D;  2P5Z X;  2RKS A;  1SRU A;  5IY0 A;  2H4O A;  4Q0F A;  4BWG B;  3OHX C;  4IFD H;  1IYU A;  2DJG C;  3F8T A;  1O7L A;  2RA4 A;  2V4D A;  1XWE A;  3CCQ A;  1DZ1 A;  2SNS A;  2UUB L;  4DR2 L;  4QQB X;  1U4L A;  2B2W A;  1Q81 C;  1GUN A;  4LMQ D;  5GQO A;  2N8N A;  4IAL A;  5M5Y H;  3HOZ G;  1HUN A;  3S1N B;  1HZB A;  1SND A;  3IFD A;  1B9M A;  4HMI A;  5IYB H;  2ZXO A;  3CCV A;  4DV0 L;  1EUJ A;  1S5D D;  2EJG C;  2WB1 E;  2EXZ A;  2WII B;  3D0F A;  3BG3 A;  4FYD A;  1HTL D;  4C3H G;  1D1K A;  3KF8 B;  1TS2 A;  5KYI A;  4DR1 Q;  4A3E H;  4DR3 Q;  1JB7 A;  3K8A A;  2VNU D;  4C3I B;  2F0V A;  1EQR A;  3PV0 A;  1VQ8 A;  3MXG A;  1Q82 C;  4DUZ L;  5IT9 E;  1TQO A;  1EZ8 A;  4A3K G;  1B44 D;  3U50 C;  2B8F A;  3HKS A;  1RHP A;  1YI2 A;  5M3M G;  2ZTD A;  3VR4 A;  1PMR A;  2Z6K C;  5E4X A;  2UUC L;  3S14 H;  2HD3 A;  4JOI C;  4GKK L;  1LT3 D;  2OXP A;  5FOB B;  1QUQ A;  3PIO 3;  4YY3 L;  4B3M L;  2C35 B;  3BU2 A;  4MTN A;  4R8I A;  2TSS A;  4BBS H;  2RHQ B;  3N52 A;  3J81 c;  4LFC L;  2PI2 E;  4KKU A;  1SMY C;  4JBW A;  3BVM A;  5JPM C;  2JA6 H;  3OTO Q;  3J80 L;  1NUC A;  1ESR A;  3GTG H;  3TRZ A;  4X3S A;  4C3J G;  4EX5 A;  4NXN Q;  3BS1 A;  5GAE C;  3I4N B;  5C4X G;  1PH7 A;  1Q8K A;  3F2D A;  1NCV A;  4FXD A;  3QOL A;  2R92 B;  3OPO A;  2L5T A;  1ZEQ X;  2VUM G;  3ULL A;  2Z6K A;  4ZUI A;  4JOI A;  1L0W A;  5IYD H;  3ZJY C;  5ELO A;  4HED A;  3VR6 A;  2JA7 G;  3JAM E;  3E6Z X;  1AFP A;  1HTP A;  3PO3 G;  3NSW A;  4POG A;  5IGE A;  3I4L A;  1EIH A;  5C44 B;  2QCP X;  4RH6 A;  3GD7 A;  4CDE C;  1VQI A;  1WCM G;  3R3O A;  3T4A C;  4KY6 A;  3EA6 A;  4IOC A;  1SN8 A;  2LXK A;  3K5O A;  1EQV A;  3NTK A;  3URY A;  4LFA L;  2PZW A;  4IFD J;  5CMD A;  5A2Q E;  3UE1 A;  1JWU D;  2X6L A;  3A8I E;  3CME A;  4RGT A;  4P2C B;  3GTL H;  1TWF B;  2Z9H A;  4XT1 B;  1Q1B A;  3KLS A;  4IUN A;  4A3J G;  4PMB A;  3VR3 A;  4A3C G;  3M4O B;  3K7A B;  2F0M A;  2ALY B;  3AU7 A;  3QB3 A;  1EYA A;  2EYH A;  4DF7 A;  2CVR A;  1DCZ A;  3H94 A;  2PQA B;  3PO2 H;  4C2M B;  5LMN W;  2MQH A;  1VQP A;  1BBX C;  3BYY B;  1HNW Q;  1VQM A;  2XVS A;  1MKH A;  1KLU D;  2F3I A;  5H1S E;  2GVA A;  2L4N A;  2RF4 A;  2E2I B;  4RCN A;  4YIJ A;  3MFG A;  4MZ9 A;  2SNM A;  1PRT F;  3A7A B;  2PI2 A;  3CC4 A;  1FVI A;  5IGD A;  4A3M H;  4L5R C;  1D7Q A;  2VS1 A;  3J7Y W;  4JI0 Q;  1EQT A;  1C8C A;  1SJE D;  1EY0 A;  2GA4 B;  1TS3 A;  1M4V A;  4U68 A;  5IP7 H;  2E75 C;  4V0B A;  3H3V H;  4BY1 B;  1HH2 P;  1KAW A;  5JAV A;  2BH2 A;  5FLX L;  4LF9 Q;  1E2W A;  2ES2 A;  3K7U C;  4XIG S;  3GTM H;  2EE1 A;  3J81 E;  2M2L A;  3K5N A;  2HIV A;  3TZD A;  1JQY D;  1Q12 A;  1EWC A;  3T1H Q;  3A74 A;  1SE2 A;  2J0T D;  3N6R A;  4OXP A;  4OHJ A;  2E74 C;  1B2T A;  1E1O A;  1U9R A;  1X3G A;  4KLK A;  1BCP F;  3S2D H;  2DJF C;  3HRZ C;  3KF6 A;  3IFT A;  3NTH A;  3L2P A;  3I8Z A;  4DV3 Q;  1MBY A;  3HOY B;  3ULJ A;  1A3V A;  4ME5 A;  2BE5 D;  5C0X J;  3MTS A;  4JI7 L;  1KDB A;  2CQA A;  4E6I A;  1OXV A;  4IFD G;  4DK3 C;  2NN6 I;  2D0P A;  2WAQ G;  4DK0 A;  1E24 A;  3K58 A;  5HY6 A;  4KD3 A;  1EQQ A;  3TP5 A;  4MN3 A;  2XRS D;  3VR2 A;  4K14 A;  2CKZ B;  4IFD I;  2BDO A;  3S1N H;  4JBJ A;  3J80 i;  1HRJ A;  4HCE A;  1EYG A;  5D3D A;  2ZJP A;  1Y8O B;  4K2L A;  1X9N A;  1LO5 D;  3Q24 A;  3OIP A;  1OXT A;  2XGT A;  4LF8 L;  4KY5 A;  4ZCK A;  1SNM A;  1BBU A;  1HR0 W;  5JJZ A;  3GTJ H;  1KHI A;  3FEW X;  4ZYS A;  4C3I H;  1ESF A;  3UDI A;  4EVO A;  1ET9 A;  3BZD B;  2L55 A;  5JJL A;  4A3E G;  2NTS A;  4DV2 Q;  3G6E A;  5AJ3 Q;  3I56 A;  1CKN A;  1CM9 A;  4KKS A;  4X62 L;  3A5Z B;  4X3T A;  2IW3 A;  5C4Z A;  3GO5 A;  4UAI A;  2ICE C;  1K28 A;  4QF4 A;  1IZ6 A;  3VYU A;  2Q8R E;  1Y8N B;  3FRP B;  1DOL A;  3I7F A;  4NP5 A;  5J1Z A;  4DR5 Q;  2PNR C;  3PF4 A;  1KDA A;  5KNC A;  2B8G A;  1H9R A;  3CCJ A;  2OQK A;  3H0G G;  3CAM A;  4IOA A;  4DUY L;  3I90 A;  1PH2 A;  2NBF A;  3CF5 A;  4BBS G;  1YJW A;  3QG1 A;  1VQO A;  2D9U A;  4FP5 D;  5JJK A;  5HGQ A;  2VY3 A;  1DM0 B;  2OWO A;  2K03 A;  3BJU A;  1S5C D;  1JJ2 A;  4KMU C;  4OO1 H;  4HJ9 A;  3PCO B;  2R92 H;  2Z0S A;  2L12 A;  3SK6 A;  3L7Z C;  3F1Z A;  1D1I A;  4RMF A;  1QNU A;  1QVF A;  2E5L Q;  3Q6S A;  4A4I A;  1IBK Q;  4GZY C;  2O5I C;  5JJI A;  5C0X I;  3HGB A;  4UDU C;  1LTT D;  4AQY Q;  3GTQ B;  2IWH A;  5IYD G;  5C44 H;  4GNX C;  3A7L A;  1W3S A;  1WTO A;  2D0O A;  3X3M A;  4EGV A;  2CQO A;  5LL6 S;  1WI5 A;  1YHB A;  1ZXT A;  1RD9 D;  5M5X B;  1JMC A;  4R4T A;  4CKB A;  1JE5 A;  1A62 A;  3A8J E;  5CV9 A;  4LK1 C;  1B3Q A;  1AE3 A;  1WTQ A;  4DA2 A;  4JI8 L;  1BO0 A;  1Z7T A;  4O2D A;  5KNB A;  4OIJ A;  4FF1 A;  2Z1C A;  2FIN B;  3VDY A;  1E2V A;  4IUP A;  2HQL A;  2WAC A;  1IW7 D;  5KYL A;  4WFN 3;  5IWA Q;  3M4O H;  1K83 B;  1PZJ D;  2EYO A;  1WTX A;  1XNQ Q;  5CYU A;  1DXM A;  4C2M H;  2KQ3 A;  3MXN B;  2QDL A;  1K9M C;  4EQO A;  2F0F A;  2F4V L;  1FNU A;  2CHB D;  2VXW A;  4B3R L;  1RCV D;  4B3T L;  1CA5 A;  2K32 A;  4AYB G;  4KK7 A;  3PO2 G;  2NVT B;  1K0R A;  3T16 A;  2R93 H;  2AUJ D;  2PYK A;  4A76 A;  2AQ2 B;  3BVG A;  4P71 A;  2KA7 A;  2E2I H;  1BOS A;  3CP0 A;  1V1O A;  3P7J A;  4GNX A;  4G7H C;  3UI2 A;  2CWA A;  3LX0 A;  1PH3 A;  3TP7 A;  3PMF A;  1C7Y A;  2ID0 A;  4CKE A;  3A54 A;  2EY2 A;  2QGQ A;  1MSH A;  3GTO B;  2JSO A;  1CSQ A;  3CHB D;  1QB5 D;  2AWN A;  1TXY A;  1IBL L;  1J6Q A;  4DAM A;  1EY5 A;  4FXG C;  1AP0 A;  1ZYR C;  4HJA A;  5JEA H;  1SFO B;  4CKC A;  4A3M G;  2JA5 H;  4RCO A;  1HFG A;  4I7A A;  2NVY B;  2KED A;  1VQB A;  1SBB B;  4X66 L;  4WOR A;  3TP6 A;  4BS9 A;  2IX1 A;  5LMN L;  5IP7 G;  3S1Q B;  1LAC A;  3VR5 A;  4LF7 L;  1UEA B;  3ERS X;  3RLO A;  5ISR A;  4IUQ A;  2CW0 D;  4YWK A;  1XTC D;  1SNC A;  1CZW A;  2Z6B A;  2B2V A;  3AMU A;  4QUC A;  1VQ4 A;  4JYA L;  1H9K A;  4LF4 L;  1I4P A;  1OO9 B;  3V2T A;  4IPC A;  3G48 A;  4F7X A;  2GN5 A;  1VCI A;  5C6A A;  2L15 A;  3ONA B;  1TWH H;  3DWA A;  1IL8 A;  1K8G A;  1TWG B;  3EIV A;  1R9T B;  4KI0 A;  1DD2 A;  5LHY 1;  2M9V A;  5CBA E;  2UXD L;  4B3S L;  4LF6 Q;  2WP8 J;  2L9H A;  4ZAI A;  3B6Y A;  4JC0 A;  2EY6 A;  1STY A;  3KFU A;  5BN5 A;  1QUQ B;  2WAQ E;  1K3R A;  1PFB A;  3FPP A;  2JQO A;  1AH9 A;  5AFW A;  1D8L A;  4GN3 B;  3DHQ A;  1XJV A;  2DY7 A;  3HKZ G;  5COY A;  1XPO A;  3SGI A;  1SYF A;  4NXM Q;  3FVQ A;  4A75 A;  2I46 A;  5EPJ A;  1N32 Q;  4FNF A;  3QIA A;  4BY7 B;  1C0A A;  4G7Z C;  4K0K Q;  5IT9 L;  1GUG A;  5JPN C;  4M1U B;  1JJC B;  1C48 A;  5NUC A;  4UPA A;  1HZC A;  1X55 A;  1IBM L;  1HNZ L;  2B2U C;  5M5W B;  3BVZ A;  4LF5 L;  5E4W C;  1VQL A;  1SYG A;  1B4O A;  1AW7 A;  3M7N A;  3H6M A;  3DEP A;  4R4C A;  5M3F B;  1SMY D;  5A35 A;  1I94 Q;  1JCK B;  4QMG A;  3T53 B;  1XMQ Q;  2EOT A;  4C3I G;  1Q90 A;  1QNK A;  3MWY W;  3U4Z A;  1UWV A;  2VQE Q;  3D6W A;  4UY8 C;  3J7Z C;  2ZM6 Q;  2F0K A;  3E3X A;  4LFB Q;  4A3D B;  3CCL A;  1DON A;  3ERQ A;  1N9W A;  4DK6 C;  3TDQ A;  3AB9 A;  1QIL A;  1UE6 A;  5IGB A;  1Y1W H;  3J7A V;  3I3C A;  2WB1 B;  4BBR H;  4DAP A;  3TS2 A;  4GKJ L;  3NQI A;  4ZKC B;  1U0L A;  4MNO A;  4C56 C;  1NR4 A;  4CDD C;  3NEM A;  1GM5 A;  4DR6 Q;  1LV9 A;  3NBH A;  3Q22 A;  5C3E G;  5KEE A;  2YTV A;  2LKV A;  5GRO A;  3FKI B;  1V1Q A;  3RLN A;  2F0N A;  3SDZ A;  2FFK B;  2B2W C;  3T51 B;  4KHP L;  1HNX L;  4OON A;  3SVM A;  3RD4 A;  4DV5 Q;  3JAM L;  3OOC A;  5EJW A;  1VQ7 A;  3TSS A;  2EY5 A;  2EYF A;  2IY5 B;  3GTK H;  1LTG D;  4JI4 Q;  4XQN A;  2SDF A;  3QOJ A;  1MD2 D;  3ND8 A;  2F03 A;  2ASB A;  2MO0 A;  1STN A;  4MHE A;  1Z9F A;  2F0O A;  5EKL A;  3VYR A;  5BR8 Q;  4JV5 Q;  2NZH A;  3AYH B;  1ENA A;  1QVC A;  1HQM C;  3ZYY X;  5A2Q L;  3UE0 A;  4R4I A;  2UXC Q;  4OO1 I;  4F87 A;  3SE0 A;  3GTQ H;  4NDX A;  1PV4 A;  1LTR D;  2KBN A;  4QCL A;  2B63 B;  1XMO L;  4K8J A;  2UUA Q;  1B1Z A;  4JG2 A;  1HPC A;  5M5X H;  4RA8 A;  5C44 G;  3S1M B;  5KND A;  2CW0 C;  3T1H L;  1KC8 C;  1GVP A;  4F88 A;  4X64 L;  2IPK D;  3I73 A;  1X6O A;  1QZG A;  1X3P A;  2AQ1 B;  1VF5 C;  3GV3 A;  5CC4 A;  4X65 L;  4OGQ C;  2HHH Q;  4K6D A;  1Q86 C;  2K75 A;  4LW1 A;  2K5W A;  1K83 H;  3TP8 A;  4WJW A;  1J5E L;  1N34 L;  3HOW B;  4YHH L;  1AEX A;  3GTP B;  1O7Y A;  1HA6 A;  4S3S A;  5FJ8 H;  1KAA A;  1FGB D;  2HT1 A;  3TBI B;  3G7L A;  1BXT A;  3KF6 B;  4OWX B;  4DR4 L;  5ELD A;  2DNE A;  2VL6 A;  1X32 A;  5I4D A;  1KXL A;  3R8B A;  2G5D A;  4JI6 L;  4AIM A;  2B29 A;  1XPR A;  3F2U A;  4KN7 C;  2R93 G;  3DWP A;  3E0J A;  2L11 A;  5EQ0 A;  1B8A A;  4DKA C;  3GTO H;  3J81 L;  5K5P A;  1GD7 A;  4HCS A;  3CD6 A;  4X3K A;  2JXM B;  2QEX A;  1I50 B;  1CI3 M;  1I6H H;  2Y0S E;  3C1E A;  1HFN A;  2LS0 1;  2N88 A;  1KTK A;  3MZ5 A;  4IUU A;  1EEF D;  1PRT D;  3HZX A;  3NTI A;  4Y7N H;  1TS5 A;  2JE6 I;  5JEA G;  3KDF A;  2JA5 G;  4UHV A;  1LLR D;  2JA8 B;  1VQD A;  2KEE A;  2LY7 A;  1ENF A;  2F0D A;  3MVV A;  2KCM A;  1FJG Q;  2A19 A;  1RKN A;  2DGY A;  2MHV A;  2K5V A;  5AJ3 L;  3OYY A;  1PTO H;  2E2H H;  3I91 A;  4KHZ A;  4JI5 Q;  1ET6 A;  1YEZ A;  5LMU Q;  1BNZ A;  3NEL A;  4DN4 M;  1LT6 D;  3OW7 A;  4DV4 L;  3HOV H;  4OWW B;  3S15 B;  1S5E D;  4GS3 A;  2OTJ A;  3I4M H;  4A3F B;  1TWG H;  1PRT B;  4PZ7 A;  2PZU A;  2XRQ D;  5C0X H;  1CKN B;  5TSS A;  3O13 A;  2EYJ A;  2Q2U A;  4GOP A;  1X65 A;  1T9H A;  3ITP A;  4YWM A;  1EL0 A;  5FKA C;  4CHT B;  1G91 A;  3U9O A;  3HKZ E;  4R4O A;  1JWS D;  1C9O A;  3D6C A;  4DV1 L;  1SDF A;  4A3I B;  3A8K E;  3HS0 C;  1SJH D;  2O2L D;  2HCC A;  5C4J B;  5ELF A;  2A69 C;  2I5L X;  4UP8 A;  4L5Q A;  1PFS A;  1HUM A;  4QGU A;  4PNY A;  2Q8I B;  1PA6 A;  3Q23 A;  3QWN A;  3JAM i;  3MEF A;  1BCP B;  5CV4 A;  5GAD C;  1QCB D;  2IJ0 A;  1N33 L;  3W1B A;  5EAY A;  2K5N A;  2EQS A;  1Y1V H;  3DUZ A;  2D2C C;  4OX9 L;  2YTX A;  2Z4I A;  4C1N I;  2F0P A;  3MAQ A;  3HOZ B;  3FP9 A;  3UDX A;  5FO8 B;  1GJX A;  1YNN C;  4A3D H;  1TT2 A;  2R7Z B;  3HOX B;  2FHT A;  4BA1 I;  1U4R A;  1HR0 Q;  4C3H B;  5IP9 H;  1HZA A;  2KVM A;  1UNS A;  2HUG A;  2NZ1 D;  1IKM A;  4MTK A;  4CBV A;  5I2Y A;  2EDG A;  2VQF Q;  1Y1W G;  1O78 A;  1XXG A;  1WOC A;  4IUV A;  3TME A;  1YIT A;  1NSN S;  4BBR G;  2PQE A;  3NP8 A;  2MFI A;  2KOL A;  2NUC A;  2NVQ B;  4JI1 L;  1TWA H;  5FLM H;  3NE5 B;  2E2J B;  1KNE A;  2K4K A;  5D65 A;  3CPW A;  5COR A;  5M3M B;  1TII D;  3RMH A;  3S1R B;  4J1M A;  3PF5 A;  3T1Y Q;  1A8V A;  2XTI A;  4A3B H;  2HIX A;  3HOU B;  1HQR D;  3PQI A;  2ZTC A;  2UXB L;  3J7A F;  1FNW A;  2K6A A;  3ICE A;  4UP7 A;  3CU7 A;  2B3G A;  3KBX A;  4GNX B;  1DOK A;  4RFB A;  1VQA A;  3J81 i;  5BN4 A;  4L8J A;  2VB3 X;  2B63 H;  3FDT A;  4C3J B;  2O4X A;  2UUB Q;  3ND9 A;  2NN6 G;  4DR2 Q;  3NXW A;  3R93 A;  1PRT C;  4QIW B;  2OEO A;  1CA6 A;  4FF3 A;  5C4X B;  4GLX A;  3OIQ A;  2JEB I;  3NWT A;  3DMU A;  3S1M H;  3R2I A;  3I55 A;  3NUC A;  4XQQ A;  1WTR A;  4DAY B;  3CCE A;  4N9P A;  2HDL A;  1EIF A;  4QJF A;  2VUM B;  1UUP A;  4DV0 Q;  1K8M A;  1JC7 A;  4GLV B;  4HSV A;  1KLG D;  3D31 A;  3D4D A;  3OMC A;  3SEB A;  1H9S B;  4B08 A;  4TRD A;  2JA7 B;  3CC2 A;  1ZYR D;  4DV6 L;  3HOW H;  3PO3 B;  3L3O C;  2EZV A;  2EYP A;  1XNR L;  1N36 L;  5IYB G;  4OL7 A;  4CJ1 B;  2EYL A;  2NVX B;  1RJT A;  1WCM B;  4DUZ Q;  1EWH A;  1XYI A;  1YBY A;  1NAP A;  1BCP C;  1STA A;  3F2B A;  5EBC A;  2I5M X;  3I72 A;  5M9O A;  3C2P A;  2BH8 A;  2UUC Q;  3RZO B;  4GKK Q;  4A3J B;  3OSO A;  4B3M Q;  2V1C C;  1AN8 A;  1T5E A;  1I50 H;  1EOT A;  1HCZ A;  4O42 A;  5E1F A;  4I7Z C;  2A6E C;  2AMC B;  1VQK A;  2PCF B;  3TN2 A;  1E7Z A;  4LFC Q;  1HXY D;  1CK1 A;  3GQB A;  1I6V C;  4RKB A;  4ME3 A;  2A74 C;  4R8N A;  2EJF C;  4KV6 A;  4JI3 L;  1PHJ A;  4FVM A;  2QF7 A;  3S24 A;  1W2B A;  1SXT A;  4QIW E;  2VQE L;  1V43 A;  1CHQ D;  2JA6 G;  3CPF A;  3I4N H;  1L0X B;  3GV6 A;  2ZJR A;  2G9D A;  2KCN A;  3HOV G;  3S16 B;  1O7Z A;  1Q1E A;  4G57 A;  3I4M G;  2N55 A;  2OF1 A;  1TR5 A;  2IT1 A;  1FR3 A;  2I0Q A;  2UU9 L;  1SSO A;  5C0X G;  1PH9 A;  1L1O C;  4JI2 L;  3LWU A;  3PGZ A;  2KHS A;  1I5F A;  4GN5 A;  4IJH A;  1SYB A;  5KGU A;  4DV7 Q;  1C4Q A;  5G3L D;  3RLF A;  5ELE A;  3KUP A;  1PH5 A;  3K5M A;  4A3I H;  4G7O C;  1HA5 A;  3S2H B;  3NBH B;  1QZH A;  2YV5 A;  4H7B A;  4LFA Q;  1G8Z D;  1A6X A;  1RDP D;  1BR9 A;  4OWT B;  3SR1 A;  3P20 A;  1P16 A;  2TMP A;  1MSG A;  1S5B D;  5CV7 A;  2KEN A;  1Q8I A;  4IPD A;  4NB3 A;  1PFN A;  4DR7 L;  1TWF H;  4CGY B;  5IGG A;  2MP1 A;  3WOE A;  1LTI D;  5E7N A;  2PO4 A;  2KUM A;  3K7A H;  1PXU A;  2WAQ B;  1X54 A;  5D14 A;  4RGN A;  2CH4 A;  1Y1V G;  1L1O A;  4R1J A;  4DK1 A;  4BXX H;  2B2V C;  4R4Q A;  1AZQ A;  5IGC A;  1SYC A;  2R7Z H;  1I4R A;  2DNC A;  2QKI C;  2B2Y C;  3HOX H;  3KJP A;  3F2C A;  3PSI A;  1YNJ C;  4A3D G;  1SRO A;  3M3Y B;  5T1G A;  4TSS A;  1LTL A;  1X56 A;  4C3H H;  1QE6 A;  5I6W A;  4A93 B;  4L5T A;  1G2T A;  4KTA A;  2F4I A;  3STB D;  2R7D A;  5IP9 G;  2F0U A;  4CJ0 B;  5LL6 X;  2NVQ H;  2RSN A;  2NB0 A;  1HHV A;  4XYO A;  4BY1 H;  1EY8 A;  1ROD A;  1Q46 A;  2PW7 A;  4WRD A;  4DR1 L;  4DR3 L;  5M3M H;  4IPH A;  5E3F A;  4K5V A;  3EN2 A;  4DAY A;  3S1R H;  5FLM G;  1UE1 A;  3HOU H;  2KEC A;  1H9S A;  2WKD A;  4TVA B;  1TY0 A;  3S14 B;  1B7Y B;  3I4O A;  5F2D A;  2B2Y A;  3CMA A;  4A3B G;  2H1E A;  2LXJ A;  5DM6 3;  3M4P A;  1KAB A;  2F0G A;  3H0G B;  1VQG A;  4WJ3 M;  1E1T A;  4BBS B;  4Q5V A;  1D5Z C;  2I07 B;  4DXF A;  3W1G A;  3CCS A;  4HMJ A;  2RDF A;  1JT8 A;  2B2T A;  2EXD A;  4JI7 Q;  3BZC A;  2BA1 A;  4JBM A;  3HOY H;  2IHE A;  3ER0 A;  2KHI A;  1BDO A;  1EU4 A;  3T13 A;  1WTV A;  3WWV A;  1KDC A;  3SK4 A;  3G71 A;  4WJ4 A;  1EIG A;  1FD7 D;  3OTO L;  1S3O A;  3KDF B;  3TS0 A;  4PG3 A;  1V9P A;  5BN3 A;  1QWY A;  2BCO A;  4NXN L;  1SNO A;  3FPU B;  2WIN B;  4YCV A;  1ASZ A;  4PZ6 A;  4LF8 Q;  2F3V A;  4PMC A;  1U5K A;  1M90 C;  3PO3 H;  2F0S A;  3NPP A;  3E0E A;  3W2D A;  2I5H A;  1LAB A;  3CCM A;  1V1P A;  3E5S A;  4IN3 A;  1EY6 A;  3AQQ A;  3EFX D;  2AUK A;  4DAV A;  4TKO B;  4YWL A;  3AEV A;  5C3X A;  2OTL A;  4X62 Q;  4GOP B;  3CQZ B;  2VB2 X;  2F0I A;  1GOZ A;  4DGZ A;  4A3J H;  1J9O A;  2Q8T A;  4R9W A;  4ZQ3 A;  1NJI C;  3VYS A;  2RCN A;  3M9B A;  4FF2 A;  1KL9 A;  5CBE E;  4HID A;  3SXH A;  4JVZ A;  4HJ5 A;  2EPB A;  4DNT B;  2NWG A;  4DUY Q;  4AYB B;  2F0J A;  2HQE A;  1KNA A;  3PO2 B;  2HCI A;  4XYQ A;  1H95 A;  1PDQ A;  4Z9C B;  1A15 A;  2JYO A;  5ELB A;  1QVG A;  3TZU A;  1TWC B;  3QO2 A;  4ULL A;  5IOD A;  2O5J C;  1PTO F;  3P75 A;  2MNA A;  1VQH A;  1HNW L;  2QEJ C;  2EYM A;  3BZK A;  5IIF A;  3FHW A;  2A69 D;  1NMG A;  2IHF A;  2SOB A;  1GUS A;  5EPK A;  1ASY A;  1E3P A;  1D6E C;  1TY2 A;  4A3M B;  1YZ6 A;  2Y0S B;  4QB4 A;  3I4N G;  3HFZ B;  2ZTE A;  3MC0 B;  2F0L A;  1MJC A;  4QUF A;  3CC7 A;  4HN7 A;  2DN8 A;  4OO1 G;  5DM7 3;  1YJN A;  2R92 G;  3OMG A;  4JI0 L;  2X69 A;  1SAP A;  1UE7 A;  3STB C;  2AKW B;  3DXJ C;  3OW2 A;  4JPB W;  1WTP A;  3GTM B;  4DXG A;  1NR2 A;  3W5O A;  1MHW C;  4LF9 L;  4LUO A;  4NMZ A;  1YNN D;  4EQP A;  3KLW A;  4JI8 Q;  4A3I G;  1EY9 A;  1FL0 A;  2E8G A;  5KIX A;  1OXU A;  2WV6 D;  1WD1 A;  1PH4 A;  1SNP A;  5ELN A;  3M4Y A;  4XQJ A;  3S2D B;  3D4R A;  4G4K A;  1Z47 A;  5HGT A;  4POF A;  4HSP A;  2R7F A;  1I4H A;  2F4V Q;  4B3R Q;  4B3T Q;  1K8O A;  1EWI A;  4RHR A;  1VQJ A;  1BUV T;  3HKZ B;  1VMC A;  4DV3 L;  2XIW A;  4AYB E;  1QG7 A;  1S40 A;  2K28 A;  4AH6 A;  4OIK A;  1S72 A;  2NVT H;  4H44 C;  5IGF A;  1E22 A;  1G2S A;  3CRL C;  4BXX G;  1GHK A;  2ZXP A;  5GAH C;  2K5H A;  2ZXR A;  2LFN A;  2R7Z G;  3M3Y H;  1PVO A;  3HOX G;  4PMW A;  4A93 H;  1IBL Q;  3KLR A;  1V8Q A;  4ODG A;  1FGU A;  1O80 A;  4IUR A;  2A6H D;  4CJ2 C;  1F9S A;  1SEB D;  4KD4 A;  3HEJ A;  5JOB A;  3PUY A;  1M1K C;  4KHV A;  2ENB A;  4GOP C;  4X66 Q;  1CKO A;  1PH1 A;  3CCR A;  1F2Y A;  1SFO H;  3GTJ B;  3TQY A;  5LMN Q;  4O1N A;  2NVY H;  4LF7 Q;  1PZI D;  4ZK9 B;  1KRS A;  4H13 C;  1LTB D;  3S1Q H;  2ZT9 C;  2E76 C;  4N9T A;  4RGM A;  1II3 A;  4EQ5 A;  2K1B A;  1VDZ A;  1YVC A;  2M00 A;  4BY1 G;  4JYA Q;  4LF4 Q;  1RIP A;  1ILQ A;  2RCF A;  5CV5 A;  3OWF A; 
#chains in the Genus database with same CATH homology
 4R4T A;  1GKH A;  2YYZ A;  3J81 i;  1JE5 A;  3TRE A;  1A62 A;  3K0X A;  2B63 H;  1NTG A;  1AE3 A;  1UEB A;  1YHA A;  2K52 A;  2N49 A;  1K8A C;  4JI8 L;  4HIO A;  2UUB Q;  3HOU G;  4JI3 Q;  4O2D A;  2NN6 G;  2A1A A;  1P8L A;  5IT9 c;  4DR2 Q;  4GLA C;  2UXD Q;  2K50 A;  4B3S Q;  2FXQ A;  3H0G H;  3VDY A;  2HQL A;  1R9T H;  4GLX A;  4YCW A;  1VS0 A;  2JEB I;  5IWA Q;  3S1M H;  3M4O H;  2JA8 G;  1I3Q H;  1XNQ Q;  4DR5 L;  3I55 A;  2WFW A;  1PH8 A;  2RHS B;  4GN4 B;  4DAY B;  4C2M H;  3CCE A;  4QJF A;  1EIF A;  4YCU A;  4IO9 A;  3MXN B;  1K9M C;  4DV0 Q;  2F4V L;  1BKB A;  4B3R L;  4B3T L;  4GLV B;  4AYB G;  3D31 A;  2UU9 Q;  3A5U A;  3PO2 G;  3K81 C;  3HOY G;  1K0R A;  3CC2 A;  5GAG C;  3RR5 A;  1EIY B;  1HR0 L;  3S16 H;  2R93 H;  2IX0 A;  4JI2 Q;  4DV6 L;  4A76 A;  1L2F A;  4P71 A;  4LWC A;  1AE2 A;  4A3F G;  3HOW H;  4A3G G;  5K36 G;  2E2I H;  3CP0 A;  1XNR L;  1N36 L;  1KIX A;  1XPU A;  4GNX A;  2VQF L;  5IYB G;  1XTD A;  3KYH C;  1A0I A;  2CWA A;  1PH3 A;  1C7Y A;  2ID0 A;  2NZO A;  2OQ0 A;  4BY7 H;  1LUZ A;  1X3F A;  2QGQ A;  1O7I A;  4DUZ Q;  1OXX K;  1CSQ A;  3J80 c;  1HNZ Q;  1IBM Q;  1BVS A;  2AWN A;  3EBE A;  1G29 1;  5JEA J;  4LF5 Q;  1TXY A;  4P74 A;  1YBY A;  1J6Q A;  4DAM A;  3F2B A;  1IBL L;  2Q2H A;  2I5M X;  4HJA A;  3U58 A;  4A3M G;  2JA5 H;  3S2H H;  1NY4 A;  2PNH A;  2BH8 A;  4P73 A;  3RN5 A;  2E5L L;  5M5W H;  3DM3 A;  2UUC Q;  1VQB A;  2MO1 A;  4X66 L;  1IBK L;  1YJ9 A;  4GKK Q;  2IX1 A;  3T1Y L;  4DNI A;  4B3M Q;  2V1C C;  4H02 A;  5IP7 G;  5LMN L;  5M3F H;  1I50 H;  2GVB A;  4DV7 L;  1N8R C;  4DR7 Q;  4LF7 L;  4IPG A;  3ERS X;  3RLO A;  4AQY L;  4RG1 A;  1GO3 E;  4YWK A;  3CQZ H;  4JCV E;  2AMC B;  1A63 A;  1VQK A;  1MJE A;  3JAM c;  1VQ4 A;  5IYC H;  5IY0 A;  1SRU A;  1JMC A;  4JYA L;  1E7Z A;  4LFC Q;  4LF4 L;  1MIU A;  4IPC A;  3G48 A;  4APV A;  2GN5 A;  1VCI A;  2L15 A;  3F8T A;  3CXC A;  1DGS A;  1TWH H;  4ME3 A;  1K8G A;  3CCQ A;  3EIV A;  4GKJ Q;  4KI0 A;  3E9I A;  2UUB L;  4JI3 L;  1X3E A;  4DR2 L;  1PHJ A;  4QQB X;  3S24 A;  2UXD L;  1W2B A;  4B3S L;  1Y14 B;  4QIW E;  2VQE L;  1Q81 C;  4LF6 Q;  2AHO B;  5GQO A;  1V43 A;  2N8N A;  2WP8 J;  5IWA L;  5M5Y H;  4HJ8 A;  3HOZ G;  3B6Y A;  4JC0 A;  4PZ8 A;  3CPF A;  4P75 A;  2JA6 G;  3KFU A;  1XNQ L;  2DUD A;  1QUQ B;  3I4N H;  4KHP Q;  1HZB A;  3CW2 C;  2WAQ E;  1HNX Q;  1K3R A;  2ZJR A;  1TWC H;  5IYB H;  2JQO A;  3HOV G;  1AH9 A;  3CCV A;  4DV0 L;  1D8L A;  1Q1E A;  3FKI H;  4GN3 B;  4LNQ A;  4LUZ A;  3I4M G;  1EUJ A;  1XJV A;  2WB1 E;  2CFM A;  2IT1 A;  3D0F A;  3HKZ G;  3SGI A;  1XPO A;  2I0Q A;  4A75 A;  2UU9 L;  3PIP A;  5C0X G;  4NXM Q;  1N32 Q;  1PH9 A;  3CCU A;  1L1O C;  3KF8 B;  4JI2 L;  3PGZ A;  4DR1 Q;  1L1O B;  1I5F A;  4DR3 Q;  4A3E H;  1JB7 A;  1C0A A;  3K8A A;  4GN5 A;  4IJH A;  2QA4 A;  2VNU D;  2BA0 A;  3KOJ A;  4DV7 Q;  1B70 B;  1EQR A;  4K0K Q;  3RLF A;  3PV0 A;  2ATW A;  1HZ9 A;  1VQ8 A;  1JJC B;  1PH5 A;  1Q82 C;  3AFQ A;  4DUZ L;  4A3I H;  3NBH B;  4UPA A;  1HZC A;  1X55 A;  1QZH A;  1HNZ L;  2YV5 A;  1IBM L;  3Q8D A;  4LFA Q;  4LF5 L;  1LYL A;  1VQL A;  3DLL A;  1SMX A;  4A3K G;  3U50 C;  1XMO Q;  3M7N A;  3HKS A;  4A3L H;  3UDF A;  1YI2 A;  4R4C A;  1SLJ A;  2ZTD A;  4OWT B;  5M3M G;  2Z6K C;  1P16 A;  3J81 j;  2UUC L;  2KHJ A;  3S14 H;  4JOI C;  2Q2T A;  4GKK L;  1I94 Q;  4B3M L;  1QUQ A;  1XMQ Q;  4YY3 L;  2C35 B;  2KEN A;  4IPD A;  4NB3 A;  3U4Z A;  4HJ7 A;  1UWV A;  4DR7 L;  1TWF H;  3BU2 A;  4MTN A;  4L5S A;  2VQE Q;  4X64 Q;  4UY8 C;  3J7Z C;  2ZM6 Q;  3H15 A;  4BBS H;  5E7N A;  2RHQ B;  4LFB Q;  3K7A H;  3CCL A;  4X65 Q;  2JA9 A;  1N9W A;  4DK6 C;  4LFC L;  1X54 A;  3J81 c;  2PI2 E;  5FLX c;  1UE6 A;  1Y1W H;  4JBW A;  1Y1V G;  1L1O A;  4ALP A;  2JA6 H;  4R1J A;  1KRT A;  3OTO Q;  4BXX H;  1EOV A;  1J5E Q;  4R4Q A;  1N34 Q;  4BBR H;  4YHH Q;  1CKM A;  3GTG H;  3TRZ A;  3TS2 A;  4GKJ L;  2R7Z H;  4EX5 A;  4NXN Q;  1U0L A;  4MNO A;  5GAE C;  3HOX H;  3NEM A;  1GM5 A;  3KJP A;  4DR6 Q;  5C4X G;  3F2C A;  3GTP H;  4LF6 L;  1PH7 A;  5C3E G;  3PSI A;  4DR4 Q;  1PH6 A;  1SRO A;  1Q8K A;  3F2D A;  4A3D G;  1LTL A;  1X56 A;  4C3H H;  2YTV A;  5GRO A;  1WJJ A;  1V1Q A;  3RLN A;  4L5T A;  1EFW A;  4JI6 Q;  4KHP L;  1HNX L;  4OON A;  2VUM G;  3ULL A;  2Z6K A;  3STB D;  2R7D A;  4DV5 Q;  5FJ8 G;  4JOI A;  5IP9 G;  1VQC A;  3I2Z A;  1L0W A;  4DPG A;  3ZJY C;  5ELO A;  2VW9 A;  1VQ7 A;  1VQN A;  4NXM L;  5IYD H;  2NVQ H;  2JA7 G;  2IY5 B;  3GTK H;  1N32 L;  4JI4 Q;  3PO3 G;  4BY1 H;  2H5X A;  4POG A;  1NMF A;  4DR1 L;  1Q46 A;  4DR3 L;  4YY3 Q;  2N3S A;  5M3M H;  2ASB A;  1G51 A;  4IPH A;  2MO0 A;  4K0K L;  1Z9F A;  3EN2 A;  3GD7 A;  4TQU S;  5BR8 Q;  3S1R H;  4JV5 Q;  1VQI A;  4A93 G;  2NZH A;  3AYH B;  1WCM G;  3ULP A;  1QVC A;  5FLM G;  4IOC A;  2K14 A;  1UE1 A;  1SN8 A;  3L0O A;  3UE0 A;  4R4I A;  3HOU H;  2UXC Q;  2LXK A;  4OO1 I;  3GTQ H;  4LFA L;  1PV4 A;  2A8V A;  4TVA B;  2KBN A;  1B7Y B;  3I4O A;  4IFD J;  3UE1 A;  1XMO L;  2UUA Q;  1NBW A;  3E9H A;  3CMA A;  3CME A;  2CCZ A;  4A3B G;  2JA8 H;  2LXJ A;  3GTL H;  1CSP A;  1VQ9 A;  3M4P A;  4JG2 A;  3UDG A;  1Q1B A;  4A3J G;  1I94 L;  4A3C G;  5M5X H;  4DV4 Q;  1XMQ L;  1RL2 A;  1VQG A;  4WJ3 M;  1E1T A;  5C44 G;  3TEH B;  2ALY B;  3W1G A;  3CCS A;  3T1H L;  1KC8 C;  3PUX A;  1JT8 A;  4JI7 Q;  2EXD A;  1GVP A;  4XTC S;  3BZC A;  2BA1 A;  2PQA B;  4X64 L;  2ZM6 L;  4JBM A;  2IHE A;  3ER0 A;  3HOY H;  3PO2 H;  3S15 H;  1X6O A;  5LMN W;  1QZG A;  2KHI A;  4LFB L;  1JJG A;  2MQH A;  4X65 L;  1VQP A;  4A3G H;  4A3F H;  2HHH Q;  1HNW Q;  1UE5 A;  3WWV A;  1VQM A;  5C3E H;  1Q86 C;  2K75 A;  4LW1 A;  1K83 H;  1MKH A;  3G71 A;  4WJ4 A;  2F3I A;  5H1S E;  3OTO L;  2R6G A;  2GVA A;  1J5E L;  1N34 L;  1S3O A;  3KDF B;  1VQ5 A;  4YHH L;  3TS0 A;  2RF4 A;  4PG3 A;  1V9P A;  1VQF A;  3PUZ A;  3M4Q A;  4NXN L;  4MZ9 A;  5FJ8 H;  1VQ6 A;  2HT1 A;  4YCV A;  1ASZ A;  4DR6 L;  4DV1 Q;  1Q7Y C;  4PZ6 A;  4X6A H;  4LF8 Q;  2PI2 A;  3KF6 B;  4OWX B;  1FVI A;  4A3M H;  3CC4 A;  4L5R C;  1U5K A;  2VS1 A;  4DR4 L;  2VL6 A;  1D7Q A;  1M90 C;  1KXL A;  1HJP A;  2N78 A;  3PO3 H;  4JI0 Q;  4JI6 L;  4AIM A;  2B29 A;  1XPR A;  5IP7 H;  3E0E A;  5J3B A;  2R93 G;  5C4J H;  4DV5 L;  2I5H A;  3H3V H;  1HH2 P;  1B8A A;  1KAW A;  3CCM A;  4DKA C;  3GTO H;  3AQQ A;  2BH2 A;  1GD7 A;  3CD6 A;  1CUK A;  4LF9 Q;  2YU9 H;  1VQE A;  2QEX A;  2ES2 A;  2PQA A;  4YWL A;  3K7U C;  4XIG S;  4JI4 L;  3AEV A;  3GTM H;  1I6H H;  3RNU A;  1N33 Q;  4BY7 G;  2Y0S E;  2OTL A;  4X62 Q;  4GOP B;  2HIV A;  4QL5 A;  1Q12 A;  5BR8 L;  1BBW A;  4JV5 L;  4Y52 H;  3T1H Q;  4OX9 Q;  1LM0 A;  4A3J H;  4Y7N H;  2JE6 I;  3A74 A;  3KDF A;  5JEA G;  2JA5 G;  3A0J A;  4OXP A;  2UXC L;  1VQD A;  1NJI C;  1OXS C;  3JC6 6;  2RCN A;  2KCM A;  3M9B A;  1FJG Q;  1E1O A;  2A19 A;  1X3G A;  4KLK A;  1PYB A;  1KL9 A;  2UUA L;  3S2D H;  4HID A;  2DGY A;  3HOZ H;  2K5V A;  5AJ3 L;  5M3F G;  3KF6 A;  3OYY A;  2E2H H;  3LGJ A;  4HJ5 A;  2AWO A;  4KHZ A;  4JI5 Q;  1YEZ A;  5LMU Q;  4DUY Q;  2JK8 A;  3L2P A;  3NEL A;  4DV3 Q;  4DV4 L;  3HOV H;  3ULJ A;  4OWW B;  4GS3 A;  1KQS A;  2OTJ A;  1H95 A;  2LSS A;  5IYC G;  3I4M H;  5C0X J;  1TWG H;  4JBK A;  1YNX A;  4PZ7 A;  4JI7 L;  1QVG A;  3AFP A;  1OXV A;  4IFD G;  1CKN B;  4DK3 C;  2NN6 I;  2D0P A;  3GDE A;  2WAQ G;  2MNA A;  2HHH L;  1VQH A;  1HNW L;  1E24 A;  3BZK A;  5HY6 A;  1EQQ A;  3FHW A;  2Q2U A;  1NMG A;  2IHF A;  4GOP A;  2WB1 G;  1X65 A;  2CKZ B;  4IFD I;  3S1N H;  1T9H A;  4JBJ A;  2OCE A;  4YWM A;  4JI1 Q;  1E3P A;  1ASY A;  4BA2 I;  4UP9 A;  3J80 i;  1IYJ B;  3KJO A;  1EYG A;  2D62 A;  3HKZ E;  4R4O A;  1YZ6 A;  2ZJP A;  1X9N A;  1C9O A;  1OXT A;  3HFZ B;  3I4N G;  2ZTE A;  4DV1 L;  2XGT A;  1MJC A;  2E2J H;  4A3K H;  4LF8 L;  3CC7 A;  4OO1 G;  2UXB Q;  1PYS B;  1BBU A;  3FKI G;  3K80 C;  1YJN A;  1HR0 W;  2Q2I A;  2R92 G;  1K73 C;  4JI0 L;  3GTJ H;  1KHI A;  1UE7 A;  2I5L X;  4LUV A;  4UP8 A;  3STB C;  2AKW B;  4C3I H;  3OW2 A;  4FDB A;  4L5Q A;  1PFS A;  3UDI A;  1IL2 A;  4QGU A;  1YHQ A;  1WYD A;  1WFQ A;  1PA6 A;  3J7A 5;  5JJL A;  3JAM i;  4A3E G;  3MEF A;  3W5O A;  4DV2 Q;  4LF9 L;  2YTY A;  4LUO A;  3G6E A;  5AJ3 Q;  2Y0S G;  5GAD C;  1NE3 A;  2F52 A;  3I56 A;  1CKN A;  3KLW A;  1N33 L;  3W1B A;  4P72 A;  5EAY A;  4X62 L;  2K5N A;  3A5Z B;  4JI8 Q;  2EQS A;  4A3I G;  1Y1V H;  3GO5 A;  1FL0 A;  2E8G A;  1G6P A;  1IZ6 A;  1OXU A;  1KD1 C;  4OX9 L;  4HIM A;  2YTX A;  4C3J H;  3RN2 A;  1PH4 A;  5ELN A;  3NEN A;  4A3L G;  3I7F A;  4DR5 Q;  1Z47 A;  5C4X H;  3PF4 A;  3FP9 A;  3UDX A;  4POF A;  1FJG L;  2B63 G;  3H3V I;  3CCJ A;  4A3D H;  2R7F A;  2F4V Q;  2ZJQ A;  3PIO A;  4B3R Q;  4B3T Q;  2OQK A;  1EWI A;  3H0G G;  4NPS A;  4JI5 L;  1VQJ A;  3CAM A;  4BA1 I;  5LMU L;  2EIF A;  4DUY L;  4IOA A;  3PUV A;  1PH2 A;  4DV3 L;  2VUM H;  3CF5 A;  4BBS G;  1HR0 Q;  4AYB E;  1YJW A;  4DV6 Q;  4J15 A;  3RZD H;  5IP9 H;  1VQO A;  1HZA A;  1SE8 A;  1S40 A;  4AH6 A;  2PMZ E;  1XNR Q;  1N36 Q;  1S72 A;  2NVT H;  2JA7 H;  5JJK A;  1E22 A;  5HGQ A;  2VQF Q;  1Y1W G;  2VY3 A;  1WOC A;  4BXX G;  4QY7 A;  1YIT A;  2OWO A;  4BBR G;  5GAH C;  3BJU A;  2K5H A;  2MFI A;  3U4V A;  2R7Z G;  1JJ2 A;  3M3Y H;  1PVO A;  4HJ9 A;  3PUW A;  3PCO B;  5IE8 A;  3HOX G;  4PMW A;  2NVX H;  2R92 H;  4A93 H;  4JI1 L;  2Z0S A;  1IBL Q;  1TWA H;  3L7Z C;  1WCM H;  1OTC A;  3HOW G;  1FGU A;  5FLM H;  3F1Z A;  4IJL A;  2K4K A;  4RMF A;  4O0A A;  1M1K C;  5DLQ E;  3CPW A;  3PUY A;  1QVF A;  2E5L Q;  4HIK A;  4GOP C;  4X66 Q;  4A4I A;  1CKO A;  1PH1 A;  1IBK Q;  3CCR A;  3PF5 A;  3T1Y Q;  1SFO H;  3TQY A;  5LMN Q;  1A8V A;  2XTI A;  2JJQ A;  3S17 H;  2HIX A;  4A3B H;  5C0X I;  5JJI A;  2NVY H;  2ZTC A;  2UXB L;  4LF7 Q;  2JEA I;  3RZO H;  3IRB A;  1KRS A;  4AQY Q;  1SR3 A;  5IYD G;  3ICE A;  4A3C H;  4UP7 A;  3S1Q H;  2KCT A;  5C44 H;  4GNX C;  1IXR A;  1W3S A;  2B3G A;  2D0O A;  4EQ5 A;  1YVC A;  4BY1 G;  4JYA Q;  4GNX B;  4LF4 Q;  2VZA A;  2CQO A;  1WI5 A;  1RIP A;  1YHB A;  3G4S A;  2CWP A;  1VQA A;  4DV2 L;  1YIJ A;  3M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...