3U4VA

Crystal structure of the tetrahymena telomerase processivity factor teb1 ob-a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
NFNIGSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSSTFQNQQDSKYFFITAQDANNQEINMSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELKFKFGDYQIIPKETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Telomerase-associated protein 82
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 24
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u4vA00
2XTIA 3HOYG 3F2BA 3CCEA 2Q2HA 4LUZA 3CXCA 1Q86C 4B3TL 4A3GH 4OONA 5JEAG 2YV5A 4GLVB 1WCMH 3JAMi 2WB1E 1UE7A 2K14A 2VQFL 5IP9H 4BA1I 1XMOL 3T1YL 1HNZL 1E1TA 4LF5L 2K75A 4BXXG 1Q7YC 4DR6Q 2I5LX 2Z0SA 3L7ZC 1X54A 4LUOA 2HHHQ 2UUCQ 3CCLA 1HNWQ 2KENA 4IJLA 4HJ9A 4JI5Q 1HZ9A 1I3QH 1PFSA 3U50C 4DR6L 3K7UC 1W2BA 3CAMA 4JBJA 2ZJRA 2K52A 2UUCL 2HHHL 4JI6Q 4JI8Q 3U4ZA 4BY1G 1HNWL 2VUMG 4MTNA 4JI5L 1BBUA 1IYJB 1SLJA 3M4QA 1PHJA 3HOVH 2IT1A 3OYYA 4Y7NH 4DUZQ 3CMEA 4DV5Q 4JI8L 1VQLA 4JI6L 3JC66 1X9NA 1J5EQ 2ID0A 3HOXH 3NEMA 2CQOA 1PH6A 3GTQH 1Z9FA 4A3LH 2KCTA 4AH6A 3GTOH 4RMFA 1P16A 3L0OA 2H5XA 3K81C 2YTYA 5EAYA 4DUZL 2NN6I 4DV5L 4GOPA 3RLNA 4A3JG 4B3MQ 2IX1A 2VY3A 1YNXA 4GNXB 1J5EL 1LYLA 3NENA 3HOZG 4A3BG 2UU9Q 3I7FA 4C3HH 4A3FG 1NJIC 1VQHA 4L5RC 4B3ML 3CC4A 1VS0A 1WYDA 2CFMA 4DV2Q 1AE2A 3F1ZA 2D62A 4B3RQ 5C4JH 2UU9L 2JA5G 1WJJA 1MJEA 4YHHL 1Y14B 4A4IA 3PUXA 3MEFA 3TS2A 1X65A 2R93G 4YCVA 2AWOA 5C4XG 1JJGA 4DV2L 4XTCS 2CCZA 3HOWG 2VS1A 2IHFA 1VCIA 4AIMA 2WAQE 1M90C 1CKNA 2NZHA 3I4NH 1K8AC 2IY5B 3KDFA 4IFDJ 4O0AA 1VQIA 3G4SA 3F2CA 3PIOA 1XNQQ 3TS0A 1KD1C 3PUYA 5H1SE 1XJVA 3K7AH 2YTVA 3TQYA 1XPUA 3H3VI 1VQDA 1VQNA 1E24A 2OQ0A 3CW2C 1XTDA 2GVBA 3AFQA 5IP7H 1XNQL 3KLWA 2RF4A 5C3EG 3OTOQ 1K8GA 2AWNA 1JJ2A 3GD7A 2Y0SE 1CKMA 3K0XA 3M3YH 1I5FA 5JEAJ 4JBMA 4HJ5A 2AHOB 4BBRH 3OTOL 1NBWA 5JJLA 4OO1G 5E7NA 4IFDI 4HIMA 4HJ8A 4JI1Q 4PZ8A 2Q2UA 4R4TA 2JA9A 2VQEQ 1G6PA 5GAHC 4GNXC 4UY8C 1Y1WG 3GTGH 5GADC 3AEVA 1JJCB 1UE6A 1WFQA 4DV3Q 4GN5A 3STBD 4LFAQ 4JI1L 4AQYQ 1VQ7A 2VQEL 4QQBX 2HQLA 1QVFA 5IYDG 1Z47A 3RLFA 4A3KG 2MNAA 4DAMA 1IL2A 2CWAA 4KLKA 3NBHB 3HFZB 4DV3L 3GO5A 5FLMG 4GNXA 4AQYL 1C7YA 4LFAL 1VQ4A 2JA6G 3RN2A 4P72A 5IYBG 2JE6I 2ZM6Q 2CKZB 1SRUA 4R4OA 3UDXA 3L2PA 5C44G 2ASBA 3ZJYC 2C35B 2BA0A 1HZAA 3PIPA 4A76A 4EQ5A 5ELNA 3BU2A 2ZM6L 2A1AA 3H3VH 4BA2I 4R4QA 3HKSA 1KRTA 4GOPB 4P74A 1X6OA 3UDGA 3CCSA 1QZHA 5FLXc 3FHWA 2UUBQ 3FKIG 2B63H 3CPFA 4LFCQ 3HKZG 4R4CA 5IT9c 1A0IA 1EIFA 1TWAH 2JA7H 1EQRA 4PZ6A 2DUDA 1HR0Q 2UUBL 1RIPA 3D0FA 4LFCL 1I50H 3S1MH 2VW9A 2JK8A 4H02A 1Q46A 3A5ZB 1VQMA 3TRZA 2HIVA 1I94Q 1HR0L 2NVYH 4OX9Q 3M9BA 4GN4B 3RLOA 5M3MH 1PH1A 1I94L 3EN2A 5ELOA 5GAEC 4NXMQ 4BY7G 4JG2A 4YY3Q 3CCQA 4HJAA 4OX9L 1HR0W 2E2JH 4JYAQ 4L5TA 1B70B 3GTLH 4LF7Q 4TVAB 3KJOA 1H95A 4NXML 4YY3L 4AYBG 1GVPA 3S16H 3PUVA 4BXXH 1PVOA 3CCJA 1K83H 4JYAL 1XMQQ 3W1BA 3M4OH 4P75A 4LF7L 4DKAC 2JEBI 5LMNQ 4HIDA 1HH2P 2ZTDA 5LMUQ 1Q81C 3A0JA 3I4OA 4NXNQ 3KJPA 1OXUA 1XMQL 1HJPA 2EQSA 1VQ6A 1VQJA 3SGIA 1TWFH 1QVGA 4BY1H 2JEAI 5LMNL 4GOPC 2VUMH 3S2HH 3NELA 2MFIA 5LMUL 2WP8J 3PUZA 3S1RH 2QA4A 3F8TA 2KCMA 4GKJQ 4NXNL 4QY7A 2K5NA 4DAYB 3IRBA 1IBMQ 2MO1A 3E9HA 1U0LA 4QJFA 4YWKA 3I4MH 3S14H 4KHZA 5M5XH 3J80c 5LMNW 1N9WA 4GKJL 1CKOA 3A5UA 1IBKQ 1K9MC 5IY0A 4Y52H 4RG1A 3PUWA 3G6EA 3UDFA 1PYBA 4A3BH 2UXDQ 3MXNB 2E2IH 4GLXA 4HJ7A 4A93G 4EX5A 1SE8A 3HOVG 4GKKQ 3TEHB 4HIOA 2KHIA 1Y1VH 1AH9A 3J7ZC 3RZDH 3RR5A 2UXDL 2JA5H 1XPOA 4LF8L 4A3EG 4A3CH 5JJIA 1EIYB 4APVA 4ALPA 1PH8A 1UE5A 3RNUA 2FXQA 4LW1A 1YHQA 4GKKL 4B3RL 4QL5A 1EOVA 1L1OB 3I56A 2QGQA 3HOWH 1EWIA 1LM0A 3HOUG 1RL2A 1IBLQ 4OXPA 5M3FH 4DR3Q 5M5YH 1SMXA 3I55A 2ZJPA 1G51A 3CC7A 1EYGA 1IBLL 5IYCG 4C3JH 3DM3A 4DR3L 1K73C 2E2HH 3EIVA 3PO3G 4UP8A 4DK6C 2L15A 4X62Q 1KC8C 1SN8A 3OW2A 3CMAA 3GTPH 4DPGA 2YYZA 3KFUA 1GO3E 2MQHA 1B7YB 3I4NG 4PZ7A 3VDYA 4A3IG 4QIWE 1P8LA 3U4VA 1N8RC 2OTLA 3PO2G 1IXRA 4P73A 4BBSH 3J80i 3GTKH 4A3DH 3H0GH 4LFBQ 2WB1G 1D8LA 2D0PA 2R7ZH 1N32Q 4OO1I 4IPGA 4AYBE 4B3SQ 2R92H 4KI0A 1K3RA 4LFBL 5HY6A 1NE3A 2A19A 4UP7A 1VQKA 1N32L 4X64Q 1ASYA 4B3SL 2NZOA 4IPDA 2K4KA 3KF8B 1TXYA 2R6GA 3J81c 1ASZA 4LF9Q 1L1OC 5IYBH 4GS3A 2UXCQ 1PYSB 2EXDA 4X64L 1TWGH 1E3PA 5C44H 3RN5A 2ES2A 2E8GA 4C3IH 4DV0Q 2JA8H 5M5WH 4LF9L 2UXCL 4JC0A 4DR2Q 4JI4Q 1FJGQ 3G48A 1L1OA 2ZTCA 2EIFA 3M7NA 1Q12A 2HT1A 1V43A 4DV0L 1JMCA 1PH3A 4XIGS 2IHEA 3GTJH 1VQGA 2ZTEA 2K5VA 4DR2L 2HIXA 1YJ9A 1QUQB 2CWPA 1CSPA 3PCOB 1KQSA 1HNXQ 4JI4L 1FJGL 3A74A 3BJUA 4JBKA 4J15A 4PG3A 2F52A 2JJQA 2B29A 4LNQA 1E22A 3I2ZA 2VL6A 1K0RA 5FJ8G 4WJ4A 4JCVE 1HNXL 2OTJA 1U5KA 2K50A 3J7A5 1R9TH 3KOJA 1VQ9A 5IWAQ 1QZGA 1VQPA 4DR1Q 3E0EA 2R7FA 1PV4A 1N34Q 2NVTH 2WAQG 1QVCA 1MJCA 1B8AA 2B3GA 2JQOA 2NVQH 5IWAL 4KHPQ 3AYHB 2N8NA 1BVSA 2E5LQ 4DR1L 1W3SA 1Q8KA 3HOYH 4BY7H 1KRSA 3PGZA 3CCUA 4L5QA 4NB3A 4KHPL 1MKHA 1NY4A 4A3MG 2E5LL 1YEZA 2AKWB 3STBC 2UXBQ 4DV1Q 1YITA 4GLAC 3S1NH 5K36G 1O7IA 3J81i 2Y0SG 1XNRQ 5AJ3Q 1T9HA 1YHAA 2MO0A 3M4PA 3G71A 1XPRA 1KXLA 4TQUS 4DV1L 3B6YA 1UEBA 1PH9A 2N78A 5M3MG 3CF5A 2F3IA 4JI3Q 1KAWA 5AJ3L 1XNRL 4P71A 4JI2Q 4PMWA 4A3GG 1I6HH 1WCMG 5GAGC 2Q2IA 2ATWA 5IP9G 4IOCA 3S2DH 4JI0Q 4IOAA 2RCNA 4LWCA 4JI3L 1MIUA 1YBYA 1E1OA 1C9OA 4JI2L 1X56A 4HIKA 1OXSC 1UWVA 1A63A 3W1GA 2ALYB 1X3FA 4JI0L 4A3JH 4OWTB 2N49A 4UPAA 3H15A 1IBML 1V9PA 2XGTA 1NMFA 1VQEA 1GM5A 3HOZH 4DNIA 3CPWA 2LSSA 4A3FH 1QUQA 1IBKL 4A93H 3BZKA 3WWVA 4MZ9A 4POFA 3ULJA 2QEXA 2PMZE 4JBWA 3HOXG 3PSIA 4A3LG 1C0AA 2KHJA 3I4MG 1HZBA 1TWCH 3ER0A 3ICEA 4QGUA 3PV0A 1YI2A 4A3EH 5C4XH 1M1KC 2BH2A 2R93H 1OTCA 5C0XG 1YVCA 1S40A 1GKHA 3CCVA 1VQ8A 2A8VA 3HOUH 1E7ZA 1KL9A 1VQOA 1PH2A 1VQAA 1LUZA 3HKZE 1Q82C 2UUAQ 1L2FA 2OQKA 4YHHQ 5IE8A 3T1HQ 4ME3A 2RHSB 1VQCA 2WFWA 2Z6KC 1Y1VG 5IYCH 2PQAB 3PO3H 2UUAL 5HGQA 4A3CG 2D0OA 3FP9A 3T1HL 4L5SA 3E9IA 5C3EH 4DV6Q 4JOIC 3S17H 2I5MX 1N33Q 3KF6A 4X62L 3U58A 2Z6KA 1PH4A 3ERSX 5M3FG 2RHQB 1VQFA 4A3IH 4JI7Q 4UP9A 4DV6L 3D31A 3S1QH 1N33L 3PO2H 1D7QA 1FL0A 4JOIA 1G291 4YCWA 2LXJA 3EBEA 3K8AA 3Q8DA 4JI7L 1FVIA 1Q1EA 1WOCA 4GN3B 3TREA 1CSQA 4MNOA 5IP7G 3M85A 1Y1WH 2BH8A 4LUVA 1GD7A 4C2MH 1EQQA 2F4VQ 4DUYQ 4OWWB 1OXXK 5GQOA 3S15H 1WI5A 3KYHC 1KIXA 3GDEA 1DGSA 1LTLA 1PH7A 2Q2TA 5IYDH 2LXKA 4A3KH 2NN6G 2DGYA 4BBRG 4DR4Q 2F4VL 3ULLA 1SFOH 4DUYL 5FLMH 1IZ6A 3F2DA 2JA6H 4BBSG 2N3SA 4K0KQ 4NPSA 4WJ3M 4R1JA 2PI2E 4A3DG 1A8VA 1NMGA 1UE1A 3H0GG 2ZJQA 2V1CC 5DLQE 4DR4L 1JE5A 2R7ZG 1X55A 3AQQA 2NVXH 3CQZH 4K0KL 1FGUA 1HZCA 1L0WA 2YU9H 2R92G 1AE3A 1J6QA 1JB7A 4DR5Q 3BZCA 3JAMc 1V1QA 4R4IA 4YWLA 1PA6A 3FKIH 3CCRA 4DV4Q 1EUJA 1NTGA 2OCEA 5J3BA 4DR5L 4O2DA 3CCMA 4X66Q 2AMCB 3S24A 2I0QA 4LF6Q 3CD6A 5GROA 1YJNA 3CP0A 5C0XJ 1JT8A 1VQBA 1A62A 2PQAA 2KBNA 3AFPA 5FJ8H 4DV4L 4A75A 3UDIA 2JA8G 4JV5Q 2YTXA 4IO9A 3RZOH 2GN5A 4X6AH 4X66L 4IPCA 4LF6L 2I5HA 3UE0A 4X65Q 4FDBA 1X3EA 2K5HA 3UE1A 1N36Q 1X3GA 1BBWA 5JJKA 4JV5L 2IX0A 3K80C 1YZ6A 2B63G 1KHIA 2R7DA 4IPHA 1OXVA 1SR3A 1N34L 4X65L 1EFWA 3GTMH 3ULPA 4DR7Q 2JA7G 2GVAA 1N36L 1S72A 2PI2A 4IJHA 4LF8Q 5BR8Q 4YCUA 1YJWA 4LF4Q 4IFDG 1BKBA 2VZAA 4OWXB 3W5OA 3J81j 1CUKA 4DV7Q 2OWOA 1PH5A 3PF4A 4DR7L 2PNHA 4A3MH 3PF5A 5C0XI 5BR8L 1OXTA 4DK3C 1YIJA 3KF6B 4LF4L 1SROA 1Q1BA 4DV7L 1YHBA 3LGJA 3CC2A 2VNUD 1CKNB 4YWMA 1VQ5A 2UXBL 4B3TQ 3KDFB 2VQFQ 3DLLA 1TWHH 1S3OA 1XMOQ 4LF5Q 1HNZQ 4POGA 3T1YQ 2BA1A
chains in the Genus database with same CATH superfamily
4BBSB 3F2BA 3CXCA 1Q86C 5JEAG 1WCMH 2F0HA 3KUPA 4LF5L 3T1YL 2K75A 3L7ZC 1X54A 4LUOA 2EXZA 1FNWA 1HUNA 1HZ9A 2F0OA 1W2BA 3CAMA 2K52A 3NBHA 3U4ZA 2O5IC 1BBUA 2XRQD 1H9SA 3VYRA 1LACA 3M4QA 4B08A 1X9NA 4DGZA 1J5EQ 1PH6A 3NEMA 1Z9FA 2KCTA 1P16A 2H5XA 3K81C 4P2CB 1Y8OB 1C8CA 4FF1A 2VY3A 2HDMA 4RA8A 1J5EL 3A8KE 4GNXB 2DJFC 3V05A 4A3BG 2FHTA 4C3HH 4L5RC 2EY1A 1LT4D 3NWSA 1WJJA 3S1MB 4NKLA 1SNQA 1Y14B 2R93G 1ENAA 4JK1C 5C4XG 1JJGA 2FJ2A 2ZXPA 1WTOA 1CKNA 2Z6BA 1K8AC 1JWMD 4O0AA 1ML0D 4CDEC 2RDGA 4ILWA 3SDZA 1KD1C 1CHPD 3PUYA 4HMIA 5I6WA 1XJVA 2CW0D 3K7AH 2YTVA 3TQYA 1XPUA 2AUKA 3H3VI 2EOTA 2F0WA 4OIKA 3MWYW 5IT9E 1PRTF 1J8IA 1JJ2A 3GD7A 1CKMA 1TS4A 1TS5A 2B2YC 3EJIA 5JEAJ 2KOLA 2L0CA 5CV7A 2VUMB 3S2HB 4IFDI 3S1RB 4PZ8A 3VA5A 4V0BA 4XYOA 3SHLA 5GAHC 5K5PA 4UY8C 1STEA 4XDXA 5GADC 3T4AC 3AEVA 3I4MB 1UE6A 1MI2A 4ZKBB 3RLFA 1IL2A 2CWAA 4KLKA 4WJWA 4K8IA 3RN2A 1S4ZA 1WTPA 4XQQA 5I9OA 3U9OA 3L2PA 2CH4W 3ZJYC 2C35B 4N9TA 4C3IG 4OIJA 4CJ2C 3H3VH 4BA2I 1ILQA 1KRTA 4GOPB 3HOWB 1HRJA 1GUSA 2N55A 1HCZA 2Q8TA 2K03A 1QZHA 2UUBQ 1BUVT 1MD2D 3CPFA 3I3CA 4R4CA 5LL6X 3IL8A 1A0IA 2L1BA 2E2HB 1S5BD 2DUDA 1A2TA 4EGVA 2UUBL 3BDLA 3OOCA 5G3LD 2EY6A 4IFDH 3QWNA 1M8AA 3S1MH 3C2PA 2IWHA 1PZID 3I90A 1I94Q 2Z8LA 4NMZA 1SE4A 1GOZA 4UHVA 3D4RA 2A6EC 1I94L 5ELOA 2PYKA 5GAEC 3CCQA 2EJMA 2N88A 2Z4HA 4DK0A 3P75A 3H0GB 4JYAQ 3KJOA 1H95A 2NZ1D 4BXXH 2KHSA 4JYAL 4DKAC 3H91A 5KRUA 2ZTDA 1NR2A 2XSCA 3I4OA 2RDFA 1HJPA 2EQSA 2O4XA 1VQ6A 2EYOA 2VUMH 2Z1CA 3S2HH 1EEFD 1K8OA 3S1RH 5DEHA 1HTLD 1TWGB 2QA4A 3A8JE 3PIO3 2JA8B 1IBMQ 2MO1A 3E9HA 1U0LA 3I4MH 1WD0A 1XTCD 4C1NI 5LMNW 1CKOA 4KTAA 4XT3B 2F0PA 2LKVA 2UXDQ 2R61A 3TEHB 3UI2A 3MHBA 4HIOA 3EFXD 2UXDL 4U673 4A3EG 3RNUA 3I4LA 2FINB 2G9HD 1OO9B 2CVRA 3HOWH 1EWIA 2A73B 4HCEA 5BN4A 4OXPA 3SK8A 4QIWB 4QMGA 4C3HG 3I73A 2EE1A 1A3VA 1AZQA 2E2HH 1K73C 1S5ED 3EIVA 4DK6C 2EYHA 1KC8C 1SN8A 1SNDA 1B7YB 1SMYD 2ZT9C 2M2LA 4PZ7A 3VDYA 5C4ZA 4P73A 1LT5D 3H0GH 2JXMB 3NP8A 5D65A 4LFBQ 1ZYRC 4OO1I 3QOJA 4DAPA 1PDQA 4KI0A 4NDXA 4LFBL 1NR4A 4UP7A 4BWGB 1VQKA 5FO7B 1ONLA 3MXNA 3J81c 5IYBH 5ELDA 2UXCQ 2KCNA 5L37A 1TWGH 1E3PA 3PQIA 4ODGA 5J39A 1JCKB 2JA8H 2UXCL 1G6ZA 1DZ1A 5EBDA 1FJGQ 3A7LA 2EIFA 1Q12A 4ZK9B 5IGGA 1V43A 1G2TA 1Z7TA 3FVQA 1VQGA 4DAVA 1FJGL 4JW0A 1KQSA 2D2CC 3BJUA 1A15A 2B29A 4O1NA 1JR0D 2NUCA 2VL6A 5FJ8G 2K5WA 4JCVE 3RD4A 3S17B 4OO1H 3C1FA 1VQPA 4DR1Q 1SMYC 2O2LD 4K6LA 2ZXOA 1B8AA 1TS2A 4KD4A 4LAAA 3NBIA 4DR1L 1Q8KA 5KNBA 5IGBA 3S1QB 4L5QA 4A3MG 2UXBQ 3L3OC 4GLAC 1ENCA 5CV8A 3HGBA 3VA7A 2A5HA 2EY5A 1XNRQ 4K5VA 1SFOB 2N78A 3CF5A 2F3IA 1XNRL 4P71A 4PMWA 2ATWA 2AUJD 1HQRD 2NVXB 4LWCA 1YBYA 3A54A 5CORA 1PLFA 5C5MA 1F9SA 1I4HA 3D4WA 4HTHA 3K58A 1Y8PB 2N49A 4UPAA 3VYSA 4H7BA 1K0SA 1VQEA 2ENBA 3CPWA 2LSSA 1CI3M 1KLGD 3KLRA 1PTOF 1BR9A 2K7VA 4MZ9A 4POFA 2PMZE 3HOXG 1EQVA 3I4MG 2NTTA 5KEEA 1KL9A 1VQOA 1VQAA 1LUZA 1Q82C 2VB2X 2UUAQ 1EIHA 1I4QA 1O7ZA 2Z6KC 2K33A 5KYIA 1UAPA 1CQFA 2UUAL 5HGQA 2K1BA 2XRSD 4E6IA 4L5SA 2EDGA 4DV6Q 3S17H 1N33Q 3AU7A 3EA6A 2F0LA 1TWHB 4JI7Q 4DV6L 3OSOA 3D31A 1N33L 1D7QA 4FP5D 4A3GB 3BDCA 3K8AA 5EGTA 3Q8DA 4JI7L 5DM63 3T16A 3S1QH 1WOCA 5IP7G 3OW7A 4MNOA 2F0IA 1LTID 4XXEA 2RVLA 1EQQA 4DUYQ 1OXXK 1K28A 1BXTA 2NB0A 2E74C 2LXKA 1LT6D 2DGYA 5CV4A 1SFOH 4DUYL 1EYAA 4NPSA 2F0QA 5KGUA 2XWJB 2ZJQA 3H0GG 2SNSA 3HOVB 2SDFA 3BDOA 1ZKOA 3R2TA 2NVXH 1D2BA 1EWHA 1FGUA 1HUMA 4DR5Q 1SNMA 4YIJA 4IUUA 3DHQA 3FKIH 1EUJA 4DR5L 3OWFA 1EY4A 3CCMA 3S24A 5JVG3 5GROA 1YJNA 3CP0A 4Z9CB 1VQBA 2PQAA 4HN7A 5KNDA 2JA8G 2YTXA 4J8QA 4IPCA 3UE0A 1RTOA 1N36Q 5D3IB 5IGEA 5T1GA 2IX0A 4IUPA 5M5YB 2PPBC 1E0BA 1F9RA 1KLUD 4K2KA 3K57A 3ULPA 2PNRC 2JA7G 3HS0C 1N36L 1V1PB 5BR8Q 1YJWA 4LF4Q 4LF8Q 2WB1B 1SYBA 2MHVA 3R93A 2PNHA 1YIJA 2IPKD 5BR8L 5C0XI 4LF4L 4LF8L 3KF6B 4OO1G 1EYCA 1W6KA 3M3YB 4YWMA 1VQ5A 4B3TQ 3KDFB 1TWHH 1JE4A 3KBGA 2BA1A 4N8FA 3CCEA 4LUZA 4A3DB 4B3TL 4A3GH 1I4XA 2YV5A 3JAMi 1UE7A 3C1EA 1W6JA 1E1TA 2R7ZB 1KNEA 2F0VA 4DR6Q 2Z0SA 5I2XA 2UUCQ 2R92B 1DOMA 5FLXL 2KENA 4KMUC 4X3KA 5IT9L 4DR6L 1II3A 1AN8A 2UUCL 4JI6Q 4MTNA 1IYJB 3HOVH 1UEAB 4DUZQ 4DV5Q 4JI6L 3EQLC 1HPCA 4CBVA 1VQLA 1SBBB 4OHJA 4A3LH 4AH6A 4RMFA 3L0OA 4DUZL 4DV5L 3EROA 2NN6I 2SEBD 4GOPA 3RLNA 2WAQB 5C0XH 5IGCA 3FRPB 2GA4B 1YNXA 2B63B 5C4HA 2UU9Q 3I7FA 1CA6A 4IUVA 1TWAB 2AQ2B 2QILA 4F87A 3CC4A 1VS0A 1WYDA 4DV2Q 3F1ZA 4B3RQ 3DWQA 2UU9L 2JA5G 1MJEA 4A4IA 3TS2A 1X65A 1A6XA 2CH4A 4KY6A 2JP1A 4YCVA 4J6HA 4DV2L 5IGDA 3J81E 2VS1A 1D1IA 1M90C 2IY5B 3U9SA 5M3MB 3PIOA 3TS0A 3NQTA 2E2JB 4HR7B 3SK5A 1VQNA 1E24A 3AFQA 1Y8NB 4FVMA 4EQOA 3OTOQ 3S1NB 2LMCB 3M4OB 1GUNA 3K0XA 3M3YH 1I5FA 4JBMA 3MXUA 1QE6A 3OTOL 3H3VC 4BY1B 2A69D 2K04A 1S5FD 3Q22A 1MGSA 2VQEQ 5CBAE 1G6PA 3BVZA 4GNXC 1RJTA 2B2YA 3T53B 2F1MA 1JJCB 4DV3Q 3STBD 4LFAQ 4QQBX 5M5XB 2VQEL 1PRTD 2MNAA 4KHVA 1L0YB 4DV3L 4LFAL 3HOZB 1HHVA 2E2IB 2JE6I 2CKZB 1SRUA 4R4OA 3TP7A 2ASBA 3G6JB 1PFNA 1HZAA 4EQ5A 1SE3A 1HXYD 1HA5A 1X3PA 3QOLA 4R4QA 4G7OC 3Q6SA 2F0KA 4KKTA 1CA5A 4QCLA 3J7YW 3FKIG 2B63H 4FYDA 2RKSA 1FNUA 1TWAH 3J80E 4ME5A 3PMFA 3MEHA 4C3JB 4PZ6A 3LWEA 3SVMA 4QUFA 1HR0Q 2PW7A 2CQAA 2H4OA 2VW9A 4H02A 1Q46A 1JQYD 3A5ZB 3BG3A 3BYTB 1VQMA 3GTPB 3NQIA 1HR0L 3TRZA 1ET9A 1D5MC 3M9BA 3FEWX 3RLOA 2NYZD 5M3MH 4BY7G 1LTBD 4JG2A 1F9PA 4YY3Q 1F2LA 2E2JH 4L5TA 1B70B 1H9MA 1L0XB 4LF7Q 1SSOA 1KTKA 2VB3X 4YY3L 2D9UA 3KLSA 3M4OH 4P75A 4LF7L 2JEBI 1LABA 4HIDA 3A0JA 2PW5A 3KJPA 3LNNA 3SGIA 4BY1H 4GOPC 2MFIA 3K0YA 5C44B 3TP6A 1CQVA 1XWEA 3MC0B 2IX3A 2K5NA 4DAYB 5M5WB 4QJFA 4YWKA 5M5XH 1Q3LA 3A5UA 3BVGA 3ITPA 1K9MC 5IGFA 3GTJB 3G6EA 1PYBA 1TY2A 2E2IH 2LY7A 4HJ7A 4A93G 1BBXC 3HOVG 1RF2D 2KHIA 5FOBB 1S5DD 4V190 4JPBW 1PH8A 1PVOA 4LW1A 4RAUC 4QL5A 1EOVA 1L1OB 3I56A 1LM0A 2F3VA 3HOUG 1IBLQ 4TSSA 2RBMA 1SMXA 3I55A 3NPPA 1G51A 3CC7A 1IBLL 4C3JH 2RQXA 3DM3A 1MSGA 4IUNA 3PO3G 4UP8A 1Q8IA 1BCPF 2G9DA 3AMUA 4AYBB 5A2QE 5I6YA 3GTPH 4XYQA 2MQHA 3PIP3 2WKCA 5KNCA 4QIWE 1P8LA 3U4VA 1C4QA 2OTLA 1X3QA 1IXRA 3FPUB 3PO2G 4BBSH 3J80i 2EYMA 1BF4A 3S2DB 1NSNS 2WB1G 3SXHA 4CDDC 2A68D 1N32Q 2A6HD 3WOFA 2RDHA 1WVLA 4A3JB 1TT2A 1G2SA 2B2VC 3IFTA 1EFID 1SNPA 2A19A 3P20A 1N32L 5EKKA 3SE0A 4IPDA 2K4KA 3OIPA 4A3FB 1SYDA 1PRTB 2R6GA 4ID6A 1PMRA 5C44H 2E8GA 1KNAA 2OEOA 5E4WC 5M5WH 1EZ6A 1CFMA 2ZTCA 2AQ3B 2HT1A 2HDLA 4X3UA 5E1FA 1AFPA 4XIGS 3SK6A 3T13A 2HQEA 2ZTEA 3GTJH 4M8AA 3AB9A 3PCOB 1LTSD 1ENFA 2CW0C 4J15A 5C4JB 3URYA 2BE5D 4X3TA 1EU3A 2F0EA 5NUCA 5C3EB 2B8FA 3KOJA 4FNFA 3H09A 1N34Q 2X69A 2R7FA 3E0EA 4CJ1B 1PV4A 2WAQG 5A35A 4A3IB 1SAPA 1X32A 2N8NA 2E5LQ 1W3SA 1STGA 1KRSA 3CHBD 2P5ZX 2PCFB 5F2DA 2BDOA 3CCUA 2E5LL 4BS9A 4C2MB 1YEZA 2AKWB 3JAML 1YITA 2Y0SG 3QO2A 4JVZA 1T9HA 4A3KB 1WTWA 3G71A 1XPRA 1KXLA 4TQUS 3B6YA 5M3MG 1A2UA 4GZYC 3KF8A 1WCMG 5GAGC 2Q2IA 5TSSA 4LMQD 4IOCA 4RFBA 5C3XA 3M4YA 3S2DH 4JI0Q 2RCNA 1E1OA 1C9OA 2YU9B 4MN3A 1X56A 3DM1A 1OXSC 3DWPA 2ALYB 4B9WA 1X3FA 4JI0L 4A3JH 4U68A 1IBML 2EJGC 2E76C 3N52A 2L55A 1NMFA 1GM5A 1TY0A 4DNIA 1O80A 2JYOA 3HKZB 3K6OA 4A3FH 1QUQA 1T5XD 1TKWB 3BZKA 3WWVA 1QJOA 2QEXA 1GUGA 2KHJA 3RZOB 3ER0A 1M1KC 1BO0A 4FXKC 3Q24A 1YVCA 4G7HC 1GKHA 5FK9C 3CCVA 2A8VA 2KVMA 3KK7A 5JOBA 2KUMA 1SNOA 1XX8A 4YHHQ 3T1HQ 1CTMA 1PZKD 3VR6A 1VQCA 1LLRD 1PTOD 1WD1A 2EJFC 5IYCH 1ET6A 1GUTA 5D14A 2D0OA 3DEPA 3T1HL 1QNKA 3E9IA 5HURA 1GUOA 5C3EH 4RGNA 1B3AA 4DFAA 3KF6A 4ZAIA 1VDZA 2Z6KA 1Q90A 4LJZC 4I7AA 1GXDC 2F0MA 2RHQB 1WTQA 1VQFA 1DOKA 4A3IH 3EVQA 3L9AX 2J4XA 3NTKA 1FL0A 1G291 4C3JG 3EBEA 4KKSA 4MTKA 4RKLA 1I6VC 1Q1EA 2M00A 3M85A 1CSQA 1STNA 2BH8A 4LUVA 1GD7A 4C2MH 4OWWB 3MTSA 3OIQA 1KIXA 3KYHC 3GDEA 1LTLA 1PH7A 2Q2TA 2B2WA 2ICEC 4A3KH 3MFGA 3QJYA 1SXTA 4S3SA 3F2DA 4BBSG 1PFBA 1TWFB 2PI2E 4NW2A 1NMGA 2Z4IA 2V1CC 1KDBA 1SE2A 4QUCA 1ICWA 3GTOB 2YU9H 1AE3A 3G7LA 3BZCA 1V1QA 3VYUA 4R4IA 1PA6A 3GP7A 4CKEA 1SYGA 4HCSA 4O2DA 3E3XA 2AMCB 3LX0A 4K5XA 4X66Q 2I0QA 1G8ZD 5DM73 1EY5A 1WTVA 1A62A 4A75A 3UDIA 4DK1A 2XNAC 4H13C 2EPBA 3CKIB 3RZOH 4X6AH 1IKLA 4X66L 2I5HA 4X65Q 2K5HA 3UE1A 1X3GA 1YZ6A 1KHIA 1OXVA 4X65L 2GVAA 2QKIC 4IFDG 4KY7A 1CUKA 4IUTA 1D1KA 2I46A 1JOQA 1Q1BA 3CC2A 1CKNB 2IJ0A 2UXBL 1I4GA 4BBRB 2VXWA 1JOKA 3J81L 2TMPA 1BQQT 4F88A 1JB3A 1AW7A 4ZRZA 4OONA 2WB1E 2K14A 5IP9H 4BA1I 2KEEA 4BXXG 2I5LX 2B2UC 1B44D 2HHHQ 5C6AA 1HNWQ 4HJ9A 3TZUA 4MIUA 2ZJRA 2HHHL 1HNWL 1DOLA 2VUMG 1SLJA 2EYFA 3K5NA 4ZQ3A 3GV3A 4KD3A 2IT1A 3OYYA 1PHJA 3CMEA 2F0TA 3JC66 2ID0A 3GTOH 1B9NA 5EAYA 4A3JG 3FDTA 2O5JC 1YNND 2QF7A 4A3FG 1NJIC 1NNXA 3T51B 1ESRA 3MA2B 1I50B 4DNTB 4RGMA 3PUXA 3MEFA 2AWOA 4K8JA 4XTCS 2CCZA 3HOWG 1PTOB 2IHFA 1JWSD 4AIMA 2WAQE 3VR2A 3KBXA 4IFDJ 3VYTA 1LTAD 1TVXA 3G4SA 3F2CA 1XNQQ 5H1SE 2B2WC 3MVVA 3GTLB 1EYDA 4DF7A 3J80L 2OQ0A 3CW2C 1XNQL 1XTDA 3S16B 5C3EG 2Y0SE 2Q8IB 1MHWC 1LT3D 3BYYB 2EYPA 4L8JA 4BBRH 4HJ5A 1NBWA 5EPJA 4HIMA 2Q2UA 2XWBB 2NWGA 2BDNA 4RGOS 3S14B 4GN5A 3BVMA 3Q0AA 2HQLA 4A3KG 4DAMA 3NXWA 4GNXA 3GO5A 4A3BB 5IYBG 3UDXA 2DY8A 1UUPA 3NK9A 3RZDB 5ELBA 3PIPA 4A76A 3MXPA 2DNCA 2R93B 3D4DA 3HKSA 4TKOB 4P74A 5M3FB 4N8X1 5FLXc 3FHWA 2L4NA 1IYUA 3HKZG 5IT9c 1EIFA 2KQ3A 2B2TC 1QCBD 3OMCA 5DAUA 3D0FA 1I50H 3R8BA 1IW7D 2F0JA 1SJHD 4ZUJA 5K36H 1PTOH 1EU4A 3I70A 1D5ZC 3X3MA 3EN2A 4HJAA 3DEOA 4ULLA 3GTLH 5JEAH 4TVAB 4NP5A 1EOTA 3S16H 2B8GA 1XMQQ 3W1BA 5M9OA 5LMNQ 1HH2P 5A2QL 1HA6A 1Q81C 4CJ0B 3NE5B 1LO5D 1OXUA 1XMQL 4RCOA 3A56A 1QVGA 5LMNL 4ZUIA 2WP8J 3PUZA 1D5XC 3F8TA 2CHBD 4QY7A 4C3IB 5C3WA 3TP5A 2JSOA 5EKIA 3S14H 3TMEA 4UDUC 1IBKQ 2F0NA 5IY0A 1QOHA 4RG1A 3UDFA 4A3BH 1G91A 3MXNB 4GLXA 2C5CA 4EX5A 1SE8A 2QEJC 1AH9A 1DXMA 1I4PA 3F2UA 3RZDH 3RR5A 4KJOA 4KV6A 1XPOA 1EIYB 4B3RL 1UE5A 1YHQA 2FXQA 3HZXA 4IURA 4K6DA 2MUYA 5M3FH 4DR3Q 5M5YH 2KEDA 4DN4M 1D6EC 3HOYB 2ZJPA 4M1UB 4WFN3 4DR3L 4X62Q 3M7GA 5DNFA 3CMAA 4DPGA 2YYZA 3KFUA 1SEBD 3D3RA 2NN6H 1Z6HA 4KJNA 5KIXA 1KDCA 1I6HB 5CV5A 3OHXC 4A3DH 5BN5A 4Q5VA 2D0PA 2R7ZH 1BCPD 4AYBE 2R92H 3TP8A 1K3RA 2KJXA 4C1NK 5HY6A 2D5DA 1NE3A 4X64Q 5ELEA 2NZOA 2DN8A 2F0GA 1TXYA 3T56B 1I4RA 1T5EA 1L1OC 4LF9Q 4GS3A 1PYSB 2EXDA 2B2VA 2Q8RE 4X64L 3RN5A 3P1HA 2ES2A 4C3IH 1TWCB 4WRDA 5E3FA 4LF9L 4A3EB 4JI4Q 3G48A 3FPPA 1JMCA 1PH3A 3R2IA 2IHEA 5J1ZA 2OF1A 2L9HA 5CMDA 2CWPA 4JI4L 1CSPA 4ZCKA 3CRLC 4JBKA 4PG3A 4LNQA 3N6RA 1FNVA 4K2LA 5IOCA 3DWAA 4WJ4A 2DNEA 3HRZC 2K50A 2WIIB 5IWAQ 3VR4A 1QZGA 1QVCA 1MSHA 3OMGA 1U9RA 1SJED 2K32A 5IWAL 1BVSA 2A69C 3HOYH 1QWYA 2V4DA 4I7ZC 1MKHA 4G4KA 4Q0FA 1Y1WB 4C56C 4PMCA 3ERQA 3STBC 2MPMA 1PRTC 2PQEA 3S9WA 3S1NH 3S15B 5K36G 3J81i 2QDLA 5AJ3Q 4CDCC 3HEJA 2MO0A 3M4PA 1PH9A 2JA6B 2WINB 2PZTA 5LL6S 1LTTD 5EJWA 5AJ3L 4A3GG 1I6HH 1FYCA 4IOAA 3CQZB 2K6AA 2WKDA 1C48A 1HFGA 1UWVA 3W1GA 2HD3A 1RD9D 1IL8A 4OWTB 3H15A 2K01A 2XGTA 4FF3A 2AQ1B 3HOZH 1MBYA 1NUCA 3NHHA 4KK7A 1KDAA 1IKMA 4EQNA 1IYVA 4JBWA 2K5DA 4A3LG 1C0AA 1HZBA 1TWCH 2BOSA 3PV0A 1YI2A 4A3EH 1OTCA 5C0XG 4OL7A 3TSSA 2K28A 1B4OA 4R8NA 1PH2A 2R3ZA 4QB4A 3TZDA 3HKZE 3SK4A 2OQKA 4CDFC 5IE8A 4ME3A 2RHSB 1AZPA 2KECA 2PQAB 4H0LC 2FMMA 4XT1B 4A3MB 3FP9A 1EIGA 3O13A 4JOIC 4FO2A 3ERSX 5M3FG 1KABA 1DCZA 1FR3A 1S5CD 3ND9A 3X3NA 5J22A 2I07B 1VF5C 4YCWA 1R4QB 2LXJA 4HSVA 5CBEE 4I65A 5FLXE 3J7AF 1Y1WH 2FMCA 2F0SA 4FXDA 5GQOA 4IZ8A 3S15H 1I3QB 1TR5A 5IYDH 2NN6G 1BCPB 5FLMH 1IZ6A 2JA6H 2A6ED 4WORA 4K0KQ 4R1JA 3A8IE 4A3DG 1A8VA 1TIID 5DLQE 4Y7NB 1JE5A 2R7ZG 2TSSA 3CQZH 4K0KL 3GTQB 1HZCA 1L0WA 4OGQC 5E4XA 3HOXB 3QB3A 2R92G 1J6QA 1EY6A 3I8ZA 1JB7A 2KA7A 5FO8B 3JAMc 4YWLA 1QNUA 3CCRA 4IUQA 1LTGD 4DV4Q 1NTGA 5J3BA 2IW3A 4LF6Q 2HCCA 5C0XJ 1JT8A 3AFPA 4DV4L 2KBNA 5FJ8H 1PZJD 3CU7A 3J7AV 1SNCA 1EY7A 2GN5A 4LF6L 1ESFA 3I4NB 1BBWA 5JJKA 1B9MA 2B63G 4IPHA 2R7DA 1N34L 1HQMC 2SOBA 4DXGA 2PI2A 4IJHA 1BKBA 2VZAA 4OWXB 3W5OA 2A68C 2QCPX 2A6HC 2OWOA 3W3AA 5EKLA 4TRDA 3MAQA 1JWUD 4A3MH 4KN7C 1STAA 3PF5A 1OXTA 4FXGC 1E2WA 1AEXA 3NWTA 5EPLA 2FFKB 2XN9C 2VNUD 1GJXA 2VQFQ 3DLLA 4RCNA 1S3OA 1XMOQ 1HNZQ 2MGSA 1EZ8A 3OPOA 4IN3A 4POGA 1HFNA 2XTIA 3HOYG 1B3QA 2HCIA 1STBA 2Q2HA 2VQFL 4GLVB 3H94A 1XMOL 1HNZL 5ISRA 2QW7A 4XQNA 3GTGB 1B1ZA 1Q7YC 3VR5A 1GUWA 3CCLA 4IJLA 4IALA 4JI5Q 2QDBA 2Z9HA 4O42A 1I3QH 1PFSA 5JPNC 3U50C 1BOSA 3K7UC 4H44C 1V8QA 4JBJA 1J9OA 1VMPA 4JI8Q 4BY1G 2B2UA 4JI5L 1BNZA 3C46A 4F8MA 3Q23A 3MXGA 4Y7NH 2BE5C 4JI8L 3RUZA 4CGYB 1F2ZA 1U4LA 1ZYRD 3GTQH 3HOXH 2CQOA 1IHZA 2F0UA 2YTYA 2IX1A 4B3MQ 3OWEB 1K3BC 2C9OA 1LYLA 3NENA 3HOZG 2OT2A 1UNSA 1XYIA 1VQHA 4B3ML 2E75C 4RKBA 2JA7B 2CFMA 1AE2A 1V1PA 2D62A 4RWSC 5C4JH 4RH6A 3HG9A 1EL0A 4YHHL 3E6ZX 2ICIA 2XVSA 2NVYB 5IIFA 1VCIA 3I4NH 2NZHA 1RDPD 3KDFA 1VQIA 4MHEA 5EPKA 2KCCA 3QG1A 5LHY1 3QIAA 1VQDA 2GVBA 5IP7H 1O7LA 1K83B 3KLWA 2RF4A 4DU9A 1SYEA 1K8GA 2AWNA 4DXFA 3GQBA 5I4DA 1O78A 2AHOB 5JJLA 3H6MA 2XIWA 1ILPA 5E7NA 1K8MA 3IKJA 2MJ8A 4HJ8A 4JI1Q 1TS3A 1DD2A 4R4TA 2JA9A 3D8GA 1U4MA 5EQ0A 1Y1WG 3GTGH 3A55A 1KAAA 1WFQA 3K5LA 5I2YA 2X6GA 4JI1L 4HSPA 4AQYQ 1VQ7A 1QVFA 5IYDG 1Z47A 4EQPA 4G7ZC 2L11A 4CHTB 1E2VA 5JPMC 3NBHB 3HFZB 1C7YA 5FLMG 1CHQD 4AQYL 2JA6G 1VQ4A 4P72A 1H9SB 2ZM6Q 1PTOC 5C44G 5G3LF 1Y1VB 2BA0A 2JA5B 4K14A 5ELNA 4DNRB 3BU2A 2ZM6L 1EQTA 1RKNA 2A1AA 2A74C 1X6OA 3E0JA 1CM9A 1VMCA 3UDGA 3CCSA 4HMJA 4EVOA 4RGTA 5CGKA 2RSOA 4OEMB 4R8IA 3P7JA 4LFCQ 2JA7H 5AFWA 1EQRA 3SR1A 1B53A 1RIPA 3ZYYX 4LFCL 3MZ5A 2JK8A 3FMCA 4N9PA 5IODA 2HIVA 4X3SA 5JAVA 5EBCA 2NVYH 4OX9Q 2B2TA 4GN4B 2K5QA 4PV1C 1RTNA 4FF2A 1PH1A 4NXMQ 4OX9L 5ELFA 3GTKB 1HR0W 3HP3A 1TQOA 5C5LA 3C3LA 2WACA 4NXML 4AYBG 1GVPA 1ZEQX 3PUVA 3CCJA 1K83H 1NCVA 2JN4A 5LMUQ 1WTXA 1JORA 4NXNQ 4R9WA 2EVBA 1VQJA 1TWFH 2JEAI 1O7YA 3NELA 5LMUL 2B39A 2KCMA 4GKJQ 4NXNL 3D6WA 4DA2A 1CZWA 3IRBA 3TN2A 1BDOA 4KHZA 3J80c 2EYLA 1N9WA 2HUGA 4XQJA 4GKJL 4QF4A 1ZXTA 2WV6D 4Y52H 2MP1A 3PUWA 3FKIB 1JC7A 1V1OA 4HEDA 2F4IA 5ELCA 5JJZA 2F0DA 4GKKQ 5CV6A 1Y1VH 1EY8A 3J7ZC 4UAIA 2LS01 2JA5H 5JJIA 1R9TB 4A3CH 4APVA 4ALPA 2NVTB 3NTHA 4GKKL 3IFDA 2QGQA 4OELB 2DJGC 3D6CA 2EYJA 1EEID 1CT1D 1RL2A 5CC4A 2E2DC 2RA4A 1SDFA 1DM0B 2NVQB 1PFMA 3VR3A 3K5OA 4BY7B 1U4RA 5D3DA 1EYGA 5IYCG 4KY5A 3JAME 2L15A 5CR3A 2K05A 3OW2A 3K59A 1GO3E 3I4NG 1A3TA 3I72A 4A3IG 3IAYA 3MFYA 1N8RC 1QILA 4F7XA 1H9JA 3GTKH 2OXPA 1A3UA 1D8LA 4RHRA 4IPGA 4DAYA 3KLSX 4B3SQ 1ICFB 1SYFA 2L12A 1YNNC 4HAEA 1ASYA 4B3SL 3CRKC 3KF8B 1Y69U 4CKBA 1ASZA 4A93B 4CKCA 5I9PA 1PYWD 1F77A 1CK1A 4DV0Q 5C4XB 2PO4A 4JC0A 5FO9B 4DR2Q 1GHKA 1L1OA 3M7NA 3HOUB 4DV0L 3TBIB 4DR2L 2EZVA 2K5VA 4ZYSA 3RMHA 2HIXA 1YJ9A 1QUQB 1HNXQ 2NTSA 5CYUA 3V96A 1LTRD 2BCOA 3A74A 3WOEA 2F52A 2JJQA 2PZUA 1RCVD 3I2ZA 1E22A 2ZXRA 1K0RA 3PO3B 2RCFA 1HTPA 1STHA 3SEBA 1HNXL 2OTJA 3NSWA 1U5KA 3J7A5 1R9TH 1VQ9A 2LFNA 4PNYA 2NVTH 1MJCA 1DYQA 5HGTA 3BS1A 2B3GA 2JQOA 2NVQH 4KHPQ 3AYHB 1DJRD 3DUZA 3PO2B 4BY7H 3PGZA 2G5DA 4NB3A 5CV9A 1F2MA 4KHPL 1NY4A 1RHPA 2L5TA 4DV1Q 5KYLA 5JVH3 1O7IA 3NTIA 1YHAA 5COYA 4DV1L 1UEBA 4JI3Q 1U4PA 1KAWA 1LV9A 4JI2Q 1F2YA 2X6LA 5IP9G 4L63B 2PMZB 2RSNA 4JI3L 1MIUA 1PXUA 1YNJD 2DY7A 4JI2L 3W2DA 1JICA 4HIKA 1A63A 4FF4A 4L6TB 1DONA 1V9PA 3I91A 1B2TA 1WTRA 1EWCA 1IBKL 4A93H 4ABNA 3ULJA 1IW7C 3PSIA 2F03A 3ICEA 4QGUA 2BH2A 2R93H 5C4XH 3BZDB 1S40A 1VQ8A 3HOUH 1E7ZA 1QB5D 3GTMB 1H9RA 4IQZA 4KN4C 1L2FA 1STYA 4K5WA 1QG7A 2WFWA 1NAPA 1Y1VG 3PO3H 1H9KA 1JOOA 4A3CG 2I5MX 2Y0SB 5BN3A 4X62L 4J1MA 3U58A 1PH4A 2SNMA 4UP9A 5FKAC 3GV6A 3PO2H 4JOIA 1WCMB 4ZKCB 1RODA 3WDNA 1FVIA 4GN3B 1YNJC 3TREA 3V2TA 1F9QA 2M9VA 2F4VQ 3ND8A 4B9XA 1B50A 1WI5A 1DGSA 1EY0A 4PQXA 3ONAB 3TDQA 4BBRG 4DR4Q 2F4VL 3ULLA 1R4PB 2N3SA 2J0TD 4WJ3M 4G57A 1UE1A 3DMUA 2NBFA 3DXJC 4DR4L 1FGBD 4PMBA 1X55A 3AQQA 1E2ZA 1VF7A 4RHSA 1TU2B 3LWUA 5T1IA 3E5SA 4C3HB 3QR8A 2OCEA 3K5MA 2PZWA 3CD6A 1AP0A 3NUCA 2J7ZA 4KKUA 1FD7D 2IL8A 1WTHA 4JV5Q 4IO9A 1EY9A 2F3WA 4LK1C 4FDBA 1X3EA 1M4VA 3A7AB 3R3OA 4JV5L 3K80C 1SR3A 3GTMH 1GHJA 1SYCA 1EFWA 4DR7Q 2EY2A 1S72A 3K7AB 4YCUA 4DV7Q 3J81j 3PF4A 1PH5A 1BCPC 4DR7L 1XXGA 4ZLTF 1CZGA 2H1EA 4DK3C 1SROA 4DV7L 1YHBA 3LGJA 4LF5Q 3T1YQ 2F0FA
chains in the Genus database with same CATH topology
2XTIA 3HOYG 3F2BA 3CCEA 2Q2HA 4LUZA 3CXCA 1Q86C 4B3TL 4A3GH 4OONA 5JEAG 2YV5A 4GLVB 1WCMH 3JAMi 2WB1E 1UE7A 2K14A 2VQFL 5IP9H 4BA1I 1XMOL 3T1YL 1HNZL 1E1TA 4LF5L 2K75A 4BXXG 1Q7YC 4DR6Q 2I5LX 2Z0SA 3L7ZC 1X54A 4LUOA 2HHHQ 2UUCQ 3CCLA 1HNWQ 2KENA 4IJLA 4HJ9A 4JI5Q 1HZ9A 1I3QH 1PFSA 3U50C 4DR6L 3K7UC 1W2BA 3CAMA 4JBJA 2ZJRA 2K52A 2UUCL 2HHHL 4JI6Q 4JI8Q 3U4ZA 4BY1G 1HNWL 2VUMG 4MTNA 4JI5L 1BBUA 1IYJB 1SLJA 3M4QA 1PHJA 3HOVH 2IT1A 3OYYA 4Y7NH 4DUZQ 3CMEA 4DV5Q 4JI8L 1VQLA 4JI6L 3JC66 1X9NA 1J5EQ 2ID0A 3HOXH 3NEMA 2CQOA 1PH6A 3GTQH 1Z9FA 4A3LH 2KCTA 4AH6A 3GTOH 4RMFA 1P16A 3L0OA 2H5XA 3K81C 2YTYA 5EAYA 4DUZL 2NN6I 4DV5L 4GOPA 3RLNA 4A3JG 4B3MQ 2IX1A 2VY3A 1YNXA 4GNXB 1J5EL 1LYLA 3NENA 3HOZG 4A3BG 2UU9Q 3I7FA 4C3HH 4A3FG 1NJIC 1VQHA 4L5RC 4B3ML 3CC4A 1VS0A 1WYDA 2CFMA 4DV2Q 1AE2A 3F1ZA 2D62A 4B3RQ 5C4JH 2UU9L 2JA5G 1WJJA 1MJEA 4YHHL 1Y14B 4A4IA 3PUXA 3MEFA 3TS2A 1X65A 2R93G 4YCVA 2AWOA 5C4XG 1JJGA 4DV2L 4XTCS 2CCZA 3HOWG 2VS1A 2IHFA 1VCIA 4AIMA 2WAQE 1M90C 1CKNA 2NZHA 3I4NH 1K8AC 2IY5B 3KDFA 4IFDJ 4O0AA 1VQIA 3G4SA 3F2CA 3PIOA 1XNQQ 3TS0A 1KD1C 3PUYA 5H1SE 1XJVA 3K7AH 2YTVA 3TQYA 1XPUA 3H3VI 1VQDA 1VQNA 1E24A 2OQ0A 3CW2C 1XTDA 2GVBA 3AFQA 5IP7H 1XNQL 3KLWA 2RF4A 5C3EG 3OTOQ 1K8GA 2AWNA 1JJ2A 3GD7A 2Y0SE 1CKMA 3K0XA 3M3YH 1I5FA 5JEAJ 4JBMA 4HJ5A 2AHOB 4BBRH 3OTOL 1NBWA 5JJLA 4OO1G 5E7NA 4IFDI 4HIMA 4HJ8A 4JI1Q 4PZ8A 2Q2UA 4R4TA 2JA9A 2VQEQ 1G6PA 5GAHC 4GNXC 4UY8C 1Y1WG 3GTGH 5GADC 3AEVA 1JJCB 1UE6A 1WFQA 4DV3Q 4GN5A 3STBD 4LFAQ 4JI1L 4AQYQ 1VQ7A 2VQEL 4QQBX 2HQLA 1QVFA 5IYDG 1Z47A 3RLFA 4A3KG 2MNAA 4DAMA 1IL2A 2CWAA 4KLKA 3NBHB 3HFZB 4DV3L 3GO5A 5FLMG 4GNXA 4AQYL 1C7YA 4LFAL 1VQ4A 2JA6G 3RN2A 4P72A 5IYBG 2JE6I 2ZM6Q 2CKZB 1SRUA 4R4OA 3UDXA 3L2PA 5C44G 2ASBA 3ZJYC 2C35B 2BA0A 1HZAA 3PIPA 4A76A 4EQ5A 5ELNA 3BU2A 2ZM6L 2A1AA 3H3VH 4BA2I 4R4QA 3HKSA 1KRTA 4GOPB 4P74A 1X6OA 3UDGA 3CCSA 1QZHA 5FLXc 3FHWA 2UUBQ 3FKIG 2B63H 3CPFA 4LFCQ 3HKZG 4R4CA 5IT9c 1A0IA 1EIFA 1TWAH 2JA7H 1EQRA 4PZ6A 2DUDA 1HR0Q 2UUBL 1RIPA 3D0FA 4LFCL 1I50H 3S1MH 2VW9A 2JK8A 4H02A 1Q46A 3A5ZB 1VQMA 3TRZA 2HIVA 1I94Q 1HR0L 2NVYH 4OX9Q 3M9BA 4GN4B 3RLOA 5M3MH 1PH1A 1I94L 3EN2A 5ELOA 5GAEC 4NXMQ 4BY7G 4JG2A 4YY3Q 3CCQA 4HJAA 4OX9L 1HR0W 2E2JH 4JYAQ 4L5TA 1B70B 3GTLH 4LF7Q 4TVAB 3KJOA 1H95A 4NXML 4YY3L 4AYBG 1GVPA 3S16H 3PUVA 4BXXH 1PVOA 3CCJA 1K83H 4JYAL 1XMQQ 3W1BA 3M4OH 4P75A 4LF7L 4DKAC 2JEBI 5LMNQ 4HIDA 1HH2P 2ZTDA 5LMUQ 1Q81C 3A0JA 3I4OA 4NXNQ 3KJPA 1OXUA 1XMQL 1HJPA 2EQSA 1VQ6A 1VQJA 3SGIA 1TWFH 1QVGA 4BY1H 2JEAI 5LMNL 4GOPC 2VUMH 3S2HH 3NELA 2MFIA 5LMUL 2WP8J 3PUZA 3S1RH 2QA4A 3F8TA 2KCMA 4GKJQ 4NXNL 4QY7A 2K5NA 4DAYB 3IRBA 1IBMQ 2MO1A 3E9HA 1U0LA 4QJFA 4YWKA 3I4MH 3S14H 4KHZA 5M5XH 3J80c 5LMNW 1N9WA 4GKJL 1CKOA 3A5UA 1IBKQ 1K9MC 5IY0A 4Y52H 4RG1A 3PUWA 3G6EA 3UDFA 1PYBA 4A3BH 2UXDQ 3MXNB 2E2IH 4GLXA 4HJ7A 4A93G 4EX5A 1SE8A 3HOVG 4GKKQ 3TEHB 4HIOA 2KHIA 1Y1VH 1AH9A 3J7ZC 3RZDH 3RR5A 2UXDL 2JA5H 1XPOA 4LF8L 4A3EG 4A3CH 5JJIA 1EIYB 4APVA 4ALPA 1PH8A 1UE5A 3RNUA 2FXQA 4LW1A 1YHQA 4GKKL 4B3RL 4QL5A 1EOVA 1L1OB 3I56A 2QGQA 3HOWH 1EWIA 1LM0A 3HOUG 1RL2A 1IBLQ 4OXPA 5M3FH 4DR3Q 5M5YH 1SMXA 3I55A 2ZJPA 1G51A 3CC7A 1EYGA 1IBLL 5IYCG 4C3JH 3DM3A 4DR3L 1K73C 2E2HH 3EIVA 3PO3G 4UP8A 4DK6C 2L15A 4X62Q 1KC8C 1SN8A 3OW2A 3CMAA 3GTPH 4DPGA 2YYZA 3KFUA 1GO3E 2MQHA 1B7YB 3I4NG 4PZ7A 3VDYA 4A3IG 4QIWE 1P8LA 3U4VA 1N8RC 2OTLA 3PO2G 1IXRA 4P73A 4BBSH 3J80i 3GTKH 4A3DH 3H0GH 4LFBQ 2WB1G 1D8LA 2D0PA 2R7ZH 1N32Q 4OO1I 4IPGA 4AYBE 4B3SQ 2R92H 4KI0A 1K3RA 4LFBL 5HY6A 1NE3A 2A19A 4UP7A 1VQKA 1N32L 4X64Q 1ASYA 4B3SL 2NZOA 4IPDA 2K4KA 3KF8B 1TXYA 2R6GA 3J81c 1ASZA 4LF9Q 1L1OC 5IYBH 4GS3A 2UXCQ 1PYSB 2EXDA 4X64L 1TWGH 1E3PA 5C44H 3RN5A 2ES2A 2E8GA 4C3IH 4DV0Q 2JA8H 5M5WH 4LF9L 2UXCL 4JC0A 4DR2Q 4JI4Q 1FJGQ 3G48A 1L1OA 2ZTCA 2EIFA 3M7NA 1Q12A 2HT1A 1V43A 4DV0L 1JMCA 1PH3A 4XIGS 2IHEA 3GTJH 1VQGA 2ZTEA 2K5VA 4DR2L 2HIXA 1YJ9A 1QUQB 2CWPA 1CSPA 3PCOB 1KQSA 1HNXQ 4JI4L 1FJGL 3A74A 3BJUA 4JBKA 4J15A 4PG3A 2F52A 2JJQA 2B29A 4LNQA 1E22A 3I2ZA 2VL6A 1K0RA 5FJ8G 4WJ4A 4JCVE 1HNXL 2OTJA 1U5KA 2K50A 3J7A5 1R9TH 3KOJA 1VQ9A 5IWAQ 1QZGA 1VQPA 4DR1Q 3E0EA 2R7FA 1PV4A 1N34Q 2NVTH 2WAQG 1QVCA 1MJCA 1B8AA 2B3GA 2JQOA 2NVQH 5IWAL 4KHPQ 3AYHB 2N8NA 1BVSA 2E5LQ 4DR1L 1W3SA 1Q8KA 3HOYH 4BY7H 1KRSA 3PGZA 3CCUA 4L5QA 4NB3A 4KHPL 1MKHA 1NY4A 4A3MG 2E5LL 1YEZA 2AKWB 3STBC 2UXBQ 4DV1Q 1YITA 4GLAC 3S1NH 5K36G 1O7IA 3J81i 2Y0SG 1XNRQ 5AJ3Q 1T9HA 1YHAA 2MO0A 3M4PA 3G71A 1XPRA 1KXLA 4TQUS 4DV1L 3B6YA 1UEBA 1PH9A 2N78A 5M3MG 3CF5A 2F3IA 4JI3Q 1KAWA 5AJ3L 1XNRL 4P71A 4JI2Q 4PMWA 4A3GG 1I6HH 1WCMG 5GAGC 2Q2IA 2ATWA 5IP9G 4IOCA 3S2DH 4JI0Q 4IOAA 2RCNA 4LWCA 4JI3L 1MIUA 1YBYA 1E1OA 1C9OA 4JI2L 1X56A 4HIKA 1OXSC 1UWVA 1A63A 3W1GA 2ALYB 1X3FA 4JI0L 4A3JH 4OWTB 2N49A 4UPAA 3H15A 1IBML 1V9PA 2XGTA 1NMFA 1VQEA 1GM5A 3HOZH 4DNIA 3CPWA 2LSSA 4A3FH 1QUQA 1IBKL 4A93H 3BZKA 3WWVA 4MZ9A 4POFA 3ULJA 2QEXA 2PMZE 4JBWA 3HOXG 3PSIA 4A3LG 1C0AA 2KHJA 3I4MG 1HZBA 1TWCH 3ER0A 3ICEA 4QGUA 3PV0A 1YI2A 4A3EH 5C4XH 1M1KC 2BH2A 2R93H 1OTCA 5C0XG 1YVCA 1S40A 1GKHA 3CCVA 1VQ8A 2A8VA 3HOUH 1E7ZA 1KL9A 1VQOA 1PH2A 1VQAA 1LUZA 3HKZE 1Q82C 2UUAQ 1L2FA 2OQKA 4YHHQ 5IE8A 3T1HQ 4ME3A 2RHSB 1VQCA 2WFWA 2Z6KC 1Y1VG 5IYCH 2PQAB 3PO3H 2UUAL 5HGQA 4A3CG 2D0OA 3FP9A 3T1HL 4L5SA 3E9IA 5C3EH 4DV6Q 4JOIC 3S17H 2I5MX 1N33Q 3KF6A 4X62L 3U58A 2Z6KA 1PH4A 3ERSX 5M3FG 2RHQB 1VQFA 4A3IH 4JI7Q 4UP9A 4DV6L 3D31A 3S1QH 1N33L 3PO2H 1D7QA 1FL0A 4JOIA 1G291 4YCWA 2LXJA 3EBEA 3K8AA 3Q8DA 4JI7L 1FVIA 1Q1EA 1WOCA 4GN3B 3TREA 1CSQA 4MNOA 5IP7G 3M85A 1Y1WH 2BH8A 4LUVA 1GD7A 4C2MH 1EQQA 2F4VQ 4DUYQ 4OWWB 1OXXK 5GQOA 3S15H 1WI5A 3KYHC 1KIXA 3GDEA 1DGSA 1LTLA 1PH7A 2Q2TA 5IYDH 2LXKA 4A3KH 2NN6G 2DGYA 4BBRG 4DR4Q 2F4VL 3ULLA 1SFOH 4DUYL 5FLMH 1IZ6A 3F2DA 2JA6H 4BBSG 2N3SA 4K0KQ 4NPSA 4WJ3M 4R1JA 2PI2E 4A3DG 1A8VA 1NMGA 1UE1A 3H0GG 2ZJQA 2V1CC 5DLQE 4DR4L 1JE5A 2R7ZG 1X55A 3AQQA 2NVXH 3CQZH 4K0KL 1FGUA 1HZCA 1L0WA 2YU9H 2R92G 1AE3A 1J6QA 1JB7A 4DR5Q 3BZCA 3JAMc 1V1QA 4R4IA 4YWLA 1PA6A 3FKIH 3CCRA 4DV4Q 1EUJA 1NTGA 2OCEA 5J3BA 4DR5L 4O2DA 3CCMA 4X66Q 2AMCB 3S24A 2I0QA 4LF6Q 3CD6A 5GROA 1YJNA 3CP0A 5C0XJ 1JT8A 1VQBA 1A62A 2PQAA 2KBNA 3AFPA 5FJ8H 4DV4L 4A75A 3UDIA 2JA8G 4JV5Q 2YTXA 4IO9A 3RZOH 2GN5A 4X6AH 4X66L 4IPCA 4LF6L 2I5HA 3UE0A 4X65Q 4FDBA 1X3EA 2K5HA 3UE1A 1N36Q 1X3GA 1BBWA 5JJKA 4JV5L 2IX0A 3K80C 1YZ6A 2B63G 1KHIA 2R7DA 4IPHA 1OXVA 1SR3A 1N34L 4X65L 1EFWA 3GTMH 3ULPA 4DR7Q 2JA7G 2GVAA 1N36L 1S72A 2PI2A 4IJHA 4LF8Q 5BR8Q 4YCUA 1YJWA 4LF4Q 4IFDG 1BKBA 2VZAA 4OWXB 3W5OA 3J81j 1CUKA 4DV7Q 2OWOA 1PH5A 3PF4A 4DR7L 2PNHA 4A3MH 3PF5A 5C0XI 5BR8L 1OXTA 4DK3C 1YIJA 3KF6B 4LF4L 1SROA 1Q1BA 4DV7L 1YHBA 3LGJA 3CC2A 2VNUD 1CKNB 4YWMA 1VQ5A 2UXBL 4B3TQ 3KDFB 2VQFQ 3DLLA 1TWHH 1S3OA 1XMOQ 4LF5Q 1HNZQ 4POGA 3T1YQ 2BA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTI A;  3HOY G;  3F2B A;  3CCE A;  2Q2H A;  4LUZ A;  3CXC A;  1Q86 C;  4B3T L;  4A3G H;  4OON A;  5JEA G;  2YV5 A;  4GLV B;  1WCM H;  3JAM i;  2WB1 E;  1UE7 A;  2K14 A;  2VQF L;  5IP9 H;  4BA1 I;  1XMO L;  3T1Y L;  1HNZ L;  1E1T A;  4LF5 L;  2K75 A;  4BXX G;  1Q7Y C;  4DR6 Q;  2I5L X;  2Z0S A;  3L7Z C;  1X54 A;  4LUO A;  2HHH Q;  2UUC Q;  3CCL A;  1HNW Q;  2KEN A;  4IJL A;  4HJ9 A;  4JI5 Q;  1HZ9 A;  1I3Q H;  1PFS A;  3U50 C;  4DR6 L;  3K7U C;  1W2B A;  3CAM A;  4JBJ A;  2ZJR A;  2K52 A;  2UUC L;  2HHH L;  4JI6 Q;  4JI8 Q;  3U4Z A;  4BY1 G;  1HNW L;  2VUM G;  4MTN A;  4JI5 L;  1BBU A;  1IYJ B;  1SLJ A;  3M4Q A;  1PHJ A;  3HOV H;  2IT1 A;  3OYY A;  4Y7N H;  4DUZ Q;  3CME A;  4DV5 Q;  4JI8 L;  1VQL A;  4JI6 L;  3JC6 6;  1X9N A;  1J5E Q;  2ID0 A;  3HOX H;  3NEM A;  2CQO A;  1PH6 A;  3GTQ H;  1Z9F A;  4A3L H;  2KCT A;  4AH6 A;  3GTO H;  4RMF A;  1P16 A;  3L0O A;  2H5X A;  3K81 C;  2YTY A;  5EAY A;  4DUZ L;  2NN6 I;  4DV5 L;  4GOP A;  3RLN A;  4A3J G;  4B3M Q;  2IX1 A;  2VY3 A;  1YNX A;  4GNX B;  1J5E L;  1LYL A;  3NEN A;  3HOZ G;  4A3B G;  2UU9 Q;  3I7F A;  4C3H H;  4A3F G;  1NJI C;  1VQH A;  4L5R C;  4B3M L;  3CC4 A;  1VS0 A;  1WYD A;  2CFM A;  4DV2 Q;  1AE2 A;  3F1Z A;  2D62 A;  4B3R Q;  5C4J H;  2UU9 L;  2JA5 G;  1WJJ A;  1MJE A;  4YHH L;  1Y14 B;  4A4I A;  3PUX A;  3MEF A;  3TS2 A;  1X65 A;  2R93 G;  4YCV A;  2AWO A;  5C4X G;  1JJG A;  4DV2 L;  4XTC S;  2CCZ A;  3HOW G;  2VS1 A;  2IHF A;  1VCI A;  4AIM A;  2WAQ E;  1M90 C;  1CKN A;  2NZH A;  3I4N H;  1K8A C;  2IY5 B;  3KDF A;  4IFD J;  4O0A A;  1VQI A;  3G4S A;  3F2C A;  3PIO A;  1XNQ Q;  3TS0 A;  1KD1 C;  3PUY A;  5H1S E;  1XJV A;  3K7A H;  2YTV A;  3TQY A;  1XPU A;  3H3V I;  1VQD A;  1VQN A;  1E24 A;  2OQ0 A;  3CW2 C;  1XTD A;  2GVB A;  3AFQ A;  5IP7 H;  1XNQ L;  3KLW A;  2RF4 A;  5C3E G;  3OTO Q;  1K8G A;  2AWN A;  1JJ2 A;  3GD7 A;  2Y0S E;  1CKM A;  3K0X A;  3M3Y H;  1I5F A;  5JEA J;  4JBM A;  4HJ5 A;  2AHO B;  4BBR H;  3OTO L;  1NBW A;  5JJL A;  4OO1 G;  5E7N A;  4IFD I;  4HIM A;  4HJ8 A;  4JI1 Q;  4PZ8 A;  2Q2U A;  4R4T A;  2JA9 A;  2VQE Q;  1G6P A;  5GAH C;  4GNX C;  4UY8 C;  1Y1W G;  3GTG H;  5GAD C;  3AEV A;  1JJC B;  1UE6 A;  1WFQ A;  4DV3 Q;  4GN5 A;  3STB D;  4LFA Q;  4JI1 L;  4AQY Q;  1VQ7 A;  2VQE L;  4QQB X;  2HQL A;  1QVF A;  5IYD G;  1Z47 A;  3RLF A;  4A3K G;  2MNA A;  4DAM A;  1IL2 A;  2CWA A;  4KLK A;  3NBH B;  3HFZ B;  4DV3 L;  3GO5 A;  5FLM G;  4GNX A;  4AQY L;  1C7Y A;  4LFA L;  1VQ4 A;  2JA6 G;  3RN2 A;  4P72 A;  5IYB G;  2JE6 I;  2ZM6 Q;  2CKZ B;  1SRU A;  4R4O A;  3UDX A;  3L2P A;  5C44 G;  2ASB A;  3ZJY C;  2C35 B;  2BA0 A;  1HZA A;  3PIP A;  4A76 A;  4EQ5 A;  5ELN A;  3BU2 A;  2ZM6 L;  2A1A A;  3H3V H;  4BA2 I;  4R4Q A;  3HKS A;  1KRT A;  4GOP B;  4P74 A;  1X6O A;  3UDG A;  3CCS A;  1QZH A;  5FLX c;  3FHW A;  2UUB Q;  3FKI G;  2B63 H;  3CPF A;  4LFC Q;  3HKZ G;  4R4C A;  5IT9 c;  1A0I A;  1EIF A;  1TWA H;  2JA7 H;  1EQR A;  4PZ6 A;  2DUD A;  1HR0 Q;  2UUB L;  1RIP A;  3D0F A;  4LFC L;  1I50 H;  3S1M H;  2VW9 A;  2JK8 A;  4H02 A;  1Q46 A;  3A5Z B;  1VQM A;  3TRZ A;  2HIV A;  1I94 Q;  1HR0 L;  2NVY H;  4OX9 Q;  3M9B A;  4GN4 B;  3RLO A;  5M3M H;  1PH1 A;  1I94 L;  3EN2 A;  5ELO A;  5GAE C;  4NXM Q;  4BY7 G;  4JG2 A;  4YY3 Q;  3CCQ A;  4HJA A;  4OX9 L;  1HR0 W;  2E2J H;  4JYA Q;  4L5T A;  1B70 B;  3GTL H;  4LF7 Q;  4TVA B;  3KJO A;  1H95 A;  4NXM L;  4YY3 L;  4AYB G;  1GVP A;  3S16 H;  3PUV A;  4BXX H;  1PVO A;  3CCJ A;  1K83 H;  4JYA L;  1XMQ Q;  3W1B A;  3M4O H;  4P75 A;  4LF7 L;  4DKA C;  2JEB I;  5LMN Q;  4HID A;  1HH2 P;  2ZTD A;  5LMU Q;  1Q81 C;  3A0J A;  3I4O A;  4NXN Q;  3KJP A;  1OXU A;  1XMQ L;  1HJP A;  2EQS A;  1VQ6 A;  1VQJ A;  3SGI A;  1TWF H;  1QVG A;  4BY1 H;  2JEA I;  5LMN L;  4GOP C;  2VUM H;  3S2H H;  3NEL A;  2MFI A;  5LMU L;  2WP8 J;  3PUZ A;  3S1R H;  2QA4 A;  3F8T A;  2KCM A;  4GKJ Q;  4NXN L;  4QY7 A;  2K5N A;  4DAY B;  3IRB A;  1IBM Q;  2MO1 A;  3E9H A;  1U0L A;  4QJF A;  4YWK A;  3I4M H;  3S14 H;  4KHZ A;  5M5X H;  3J80 c;  5LMN W;  1N9W A;  4GKJ L;  1CKO A;  3A5U A;  1IBK Q;  1K9M C;  5IY0 A;  4Y52 H;  4RG1 A;  3PUW A;  3G6E A;  3UDF A;  1PYB A;  4A3B H;  2UXD Q;  3MXN B;  2E2I H;  4GLX A;  4HJ7 A;  4A93 G;  4EX5 A;  1SE8 A;  3HOV G;  4GKK Q;  3TEH B;  4HIO A;  2KHI A;  1Y1V H;  1AH9 A;  3J7Z C;  3RZD H;  3RR5 A;  2UXD L;  2JA5 H;  1XPO A;  4LF8 L;  4A3E G;  4A3C H;  5JJI A;  1EIY B;  4APV A;  4ALP A;  1PH8 A;  1UE5 A;  3RNU A;  2FXQ A;  4LW1 A;  1YHQ A;  4GKK L;  4B3R L;  4QL5 A;  1EOV A;  1L1O B;  3I56 A;  2QGQ A;  3HOW H;  1EWI A;  1LM0 A;  3HOU G;  1RL2 A;  1IBL Q;  4OXP A;  5M3F H;  4DR3 Q;  5M5Y H;  1SMX A;  3I55 A;  2ZJP A;  1G51 A;  3CC7 A;  1EYG A;  1IBL L;  5IYC G;  4C3J H;  3DM3 A;  4DR3 L;  1K73 C;  2E2H H;  3EIV A;  3PO3 G;  4UP8 A;  4DK6 C;  2L15 A;  4X62 Q;  1KC8 C;  1SN8 A;  3OW2 A;  3CMA A;  3GTP H;  4DPG A;  2YYZ A;  3KFU A;  1GO3 E;  2MQH A;  1B7Y B;  3I4N G;  4PZ7 A;  3VDY A;  4A3I G;  4QIW E;  1P8L A;  3U4V A;  1N8R C;  2OTL A;  3PO2 G;  1IXR A;  4P73 A;  4BBS H;  3J80 i;  3GTK H;  4A3D H;  3H0G H;  4LFB Q;  2WB1 G;  1D8L A;  2D0P A;  2R7Z H;  1N32 Q;  4OO1 I;  4IPG A;  4AYB E;  4B3S Q;  2R92 H;  4KI0 A;  1K3R A;  4LFB L;  5HY6 A;  1NE3 A;  2A19 A;  4UP7 A;  1VQK A;  1N32 L;  4X64 Q;  1ASY A;  4B3S L;  2NZO A;  4IPD A;  2K4K A;  3KF8 B;  1TXY A;  2R6G A;  3J81 c;  1ASZ A;  4LF9 Q;  1L1O C;  5IYB H;  4GS3 A;  2UXC Q;  1PYS B;  2EXD A;  4X64 L;  1TWG H;  1E3P A;  5C44 H;  3RN5 A;  2ES2 A;  2E8G A;  4C3I H;  4DV0 Q;  2JA8 H;  5M5W H;  4LF9 L;  2UXC L;  4JC0 A;  4DR2 Q;  4JI4 Q;  1FJG Q;  3G48 A;  1L1O A;  2ZTC A;  2EIF A;  3M7N A;  1Q12 A;  2HT1 A;  1V43 A;  4DV0 L;  1JMC A;  1PH3 A;  4XIG S;  2IHE A;  3GTJ H;  1VQG A;  2ZTE A;  2K5V A;  4DR2 L;  2HIX A;  1YJ9 A;  1QUQ B;  2CWP A;  1CSP A;  3PCO B;  1KQS A;  1HNX Q;  4JI4 L;  1FJG L;  3A74 A;  3BJU A;  4JBK A;  4J15 A;  4PG3 A;  2F52 A;  2JJQ A;  2B29 A;  4LNQ A;  1E22 A;  3I2Z A;  2VL6 A;  1K0R A;  5FJ8 G;  4WJ4 A;  4JCV E;  1HNX L;  2OTJ A;  1U5K A;  2K50 A;  3J7A 5;  1R9T H;  3KOJ A;  1VQ9 A;  5IWA Q;  1QZG A;  1VQP A;  4DR1 Q;  3E0E A;  2R7F A;  1PV4 A;  1N34 Q;  2NVT H;  2WAQ G;  1QVC A;  1MJC A;  1B8A A;  2B3G A;  2JQO A;  2NVQ H;  5IWA L;  4KHP Q;  3AYH B;  2N8N A;  1BVS A;  2E5L Q;  4DR1 L;  1W3S A;  1Q8K A;  3HOY H;  4BY7 H;  1KRS A;  3PGZ A;  3CCU A;  4L5Q A;  4NB3 A;  4KHP L;  1MKH A;  1NY4 A;  4A3M G;  2E5L L;  1YEZ A;  2AKW B;  3STB C;  2UXB Q;  4DV1 Q;  1YIT A;  4GLA C;  3S1N H;  5K36 G;  1O7I A;  3J81 i;  2Y0S G;  1XNR Q;  5AJ3 Q;  1T9H A;  1YHA A;  2MO0 A;  3M4P A;  3G71 A;  1XPR A;  1KXL A;  4TQU S;  4DV1 L;  3B6Y A;  1UEB A;  1PH9 A;  2N78 A;  5M3M G;  3CF5 A;  2F3I A;  4JI3 Q;  1KAW A;  5AJ3 L;  1XNR L;  4P71 A;  4JI2 Q;  4PMW A;  4A3G G;  1I6H H;  1WCM G;  5GAG C;  2Q2I A;  2ATW A;  5IP9 G;  4IOC A;  3S2D H;  4JI0 Q;  4IOA A;  2RCN A;  4LWC A;  4JI3 L;  1MIU A;  1YBY A;  1E1O A;  1C9O A;  4JI2 L;  1X56 A;  4HIK A;  1OXS C;  1UWV A;  1A63 A;  3W1G A;  2ALY B;  1X3F A;  4JI0 L;  4A3J H;  4OWT B;  2N49 A;  4UPA A;  3H15 A;  1IBM L;  1V9P A;  2XGT A;  1NMF A;  1VQE A;  1GM5 A;  3HOZ H;  4DNI A;  3CPW A;  2LSS A;  4A3F H;  1QUQ A;  1IBK L;  4A93 H;  3BZK A;  3WWV A;  4MZ9 A;  4POF A;  3ULJ A;  2QEX A;  2PMZ E;  4JBW A;  3HOX G;  3PSI A;  4A3L G;  1C0A A;  2KHJ A;  3I4M G;  1HZB A;  1TWC H;  3ER0 A;  3ICE A;  4QGU A;  3PV0 A;  1YI2 A;  4A3E H;  5C4X H;  1M1K C;  2BH2 A;  2R93 H;  1OTC A;  5C0X G;  1YVC A;  1S40 A;  1GKH A;  3CCV A;  1VQ8 A;  2A8V A;  3HOU H;  1E7Z A;  1KL9 A;  1VQO A;  1PH2 A;  1VQA A;  1LUZ A;  3HKZ E;  1Q82 C;  2UUA Q;  1L2F A;  2OQK A;  4YHH Q;  5IE8 A;  3T1H Q;  4ME3 A;  2RHS B;  1VQC A;  2WFW A;  2Z6K C;  1Y1V G;  5IYC H;  2PQA B;  3PO3 H;  2UUA L;  5HGQ A;  4A3C G;  2D0O A;  3FP9 A;  3T1H L;  4L5S A;  3E9I A;  5C3E H;  4DV6 Q;  4JOI C;  3S17 H;  2I5M X;  1N33 Q;  3KF6 A;  4X62 L;  3U58 A;  2Z6K A;  1PH4 A;  3ERS X;  5M3F G;  2RHQ B;  1VQF A;  4A3I H;  4JI7 Q;  4UP9 A;  4DV6 L;  3D31 A;  3S1Q H;  1N33 L;  3PO2 H;  1D7Q A;  1FL0 A;  4JOI A;  1G29 1;  4YCW A;  2LXJ A;  3EBE A;  3K8A A;  3Q8D A;  4JI7 L;  1FVI A;  1Q1E A;  1WOC A;  4GN3 B;  3TRE A;  1CSQ A;  4MNO A;  5IP7 G;  3M85 A;  1Y1W H;  2BH8 A;  4LUV A;  1GD7 A;  4C2M H;  1EQQ A;  2F4V Q;  4DUY Q;  4OWW B;  1OXX K;  5GQO A;  3S15 H;  1WI5 A;  3KYH C;  1KIX A;  3GDE A;  1DGS A;  1LTL A;  1PH7 A;  2Q2T A;  5IYD H;  2LXK A;  4A3K H;  2NN6 G;  2DGY A;  4BBR G;  4DR4 Q;  2F4V L;  3ULL A;  1SFO H;  4DUY L;  5FLM H;  1IZ6 A;  3F2D A;  2JA6 H;  4BBS G;  2N3S A;  4K0K Q;  4NPS A;  4WJ3 M;  4R1J A;  2PI2 E;  4A3D G;  1A8V A;  1NMG A;  1UE1 A;  3H0G G;  2ZJQ A;  2V1C C;  5DLQ E;  4DR4 L;  1JE5 A;  2R7Z G;  1X55 A;  3AQQ A;  2NVX H;  3CQZ H;  4K0K L;  1FGU A;  1HZC A;  1L0W A;  2YU9 H;  2R92 G;  1AE3 A;  1J6Q A;  1JB7 A;  4DR5 Q;  3BZC A;  3JAM c;  1V1Q A;  4R4I A;  4YWL A;  1PA6 A;  3FKI H;  3CCR A;  4DV4 Q;  1EUJ A;  1NTG A;  2OCE A;  5J3B A;  4DR5 L;  4O2D A;  3CCM A;  4X66 Q;  2AMC B;  3S24 A;  2I0Q A;  4LF6 Q;  3CD6 A;  5GRO A;  1YJN A;  3CP0 A;  5C0X J;  1JT8 A;  1VQB A;  1A62 A;  2PQA A;  2KBN A;  3AFP A;  5FJ8 H;  4DV4 L;  4A75 A;  3UDI A;  2JA8 G;  4JV5 Q;  2YTX A;  4IO9 A;  3RZO H;  2GN5 A;  4X6A H;  4X66 L;  4IPC A;  4LF6 L;  2I5H A;  3UE0 A;  4X65 Q;  4FDB A;  1X3E A;  2K5H A;  3UE1 A;  1N36 Q;  1X3G A;  1BBW A;  5JJK A;  4JV5 L;  2IX0 A;  3K80 C;  1YZ6 A;  2B63 G;  1KHI A;  2R7D A;  4IPH A;  1OXV A;  1SR3 A;  1N34 L;  4X65 L;  1EFW A;  3GTM H;  3ULP A;  4DR7 Q;  2JA7 G;  2GVA A;  1N36 L;  1S72 A;  2PI2 A;  4IJH A;  4LF8 Q;  5BR8 Q;  4YCU A;  1YJW A;  4LF4 Q;  4IFD G;  1BKB A;  2VZA A;  4OWX B;  3W5O A;  3J81 j;  1CUK A;  4DV7 Q;  2OWO A;  1PH5 A;  3PF4 A;  4DR7 L;  2PNH A;  4A3M H;  3PF5 A;  5C0X I;  5BR8 L;  1OXT A;  4DK3 C;  1YIJ A;  3KF6 B;  4LF4 L;  1SRO A;  1Q1B A;  4DV7 L;  1YHB A;  3LGJ A;  3CC2 A;  2VNU D;  1CKN B;  4YWM A;  1VQ5 A;  2UXB L;  4B3T Q;  3KDF B;  2VQF Q;  3DLL A;  1TWH H;  1S3O A;  1XMO Q;  4LF5 Q;  1HNZ Q;  4POG A;  3T1Y Q;  2BA1 A; 
#chains in the Genus database with same CATH topology
 4BBS B;  3F2B A;  3CXC A;  1Q86 C;  5JEA G;  1WCM H;  2F0H A;  3KUP A;  4LF5 L;  3T1Y L;  2K75 A;  3L7Z C;  1X54 A;  4LUO A;  2EXZ A;  1FNW A;  1HUN A;  1HZ9 A;  2F0O A;  1W2B A;  3CAM A;  2K52 A;  3NBH A;  3U4Z A;  2O5I C;  1BBU A;  2XRQ D;  1H9S A;  3VYR A;  1LAC A;  3M4Q A;  4B08 A;  1X9N A;  4DGZ A;  1J5E Q;  1PH6 A;  3NEM A;  1Z9F A;  2KCT A;  1P16 A;  2H5X A;  3K81 C;  4P2C B;  1Y8O B;  1C8C A;  4FF1 A;  2VY3 A;  2HDM A;  4RA8 A;  1J5E L;  3A8K E;  4GNX B;  2DJF C;  3V05 A;  4A3B G;  2FHT A;  4C3H H;  4L5R C;  2EY1 A;  1LT4 D;  3NWS A;  1WJJ A;  3S1M B;  4NKL A;  1SNQ A;  1Y14 B;  2R93 G;  1ENA A;  4JK1 C;  5C4X G;  1JJG A;  2FJ2 A;  2ZXP A;  1WTO A;  1CKN A;  2Z6B A;  1K8A C;  1JWM D;  4O0A A;  1ML0 D;  4CDE C;  2RDG A;  4ILW A;  3SDZ A;  1KD1 C;  1CHP D;  3PUY A;  4HMI A;  5I6W A;  1XJV A;  2CW0 D;  3K7A H;  2YTV A;  3TQY A;  1XPU A;  2AUK A;  3H3V I;  2EOT A;  2F0W A;  4OIK A;  3MWY W;  5IT9 E;  1PRT F;  1J8I A;  1JJ2 A;  3GD7 A;  1CKM A;  1TS4 A;  1TS5 A;  2B2Y C;  3EJI A;  5JEA J;  2KOL A;  2L0C A;  5CV7 A;  2VUM B;  3S2H B;  4IFD I;  3S1R B;  4PZ8 A;  3VA5 A;  4V0B A;  4XYO A;  3SHL A;  5GAH C;  5K5P A;  4UY8 C;  1STE A;  4XDX A;  5GAD C;  3T4A C;  3AEV A;  3I4M B;  1UE6 A;  1MI2 A;  4ZKB B;  3RLF A;  1IL2 A;  2CWA A;  4KLK A;  4WJW A;  4K8I A;  3RN2 A;  1S4Z A;  1WTP A;  4XQQ A;  5I9O A;  3U9O A;  3L2P A;  2CH4 W;  3ZJY C;  2C35 B;  4N9T A;  4C3I G;  4OIJ A;  4CJ2 C;  3H3V H;  4BA2 I;  1ILQ A;  1KRT A;  4GOP B;  3HOW B;  1HRJ A;  1GUS A;  2N55 A;  1HCZ A;  2Q8T A;  2K03 A;  1QZH A;  2UUB Q;  1BUV T;  1MD2 D;  3CPF A;  3I3C A;  4R4C A;  5LL6 X;  3IL8 A;  1A0I A;  2L1B A;  2E2H B;  1S5B D;  2DUD A;  1A2T A;  4EGV A;  2UUB L;  3BDL A;  3OOC A;  5G3L D;  2EY6 A;  4IFD H;  3QWN A;  1M8A A;  3S1M H;  3C2P A;  2IWH A;  1PZI D;  3I90 A;  1I94 Q;  2Z8L A;  4NMZ A;  1SE4 A;  1GOZ A;  4UHV A;  3D4R A;  2A6E C;  1I94 L;  5ELO A;  2PYK A;  5GAE C;  3CCQ A;  2EJM A;  2N88 A;  2Z4H A;  4DK0 A;  3P75 A;  3H0G B;  4JYA Q;  3KJO A;  1H95 A;  2NZ1 D;  4BXX H;  2KHS A;  4JYA L;  4DKA C;  3H91 A;  5KRU A;  2ZTD A;  1NR2 A;  2XSC A;  3I4O A;  2RDF A;  1HJP A;  2EQS A;  2O4X A;  1VQ6 A;  2EYO A;  2VUM H;  2Z1C A;  3S2H H;  1EEF D;  1K8O A;  3S1R H;  5DEH A;  1HTL D;  1TWG B;  2QA4 A;  3A8J E;  3PIO 3;  2JA8 B;  1IBM Q;  2MO1 A;  3E9H A;  1U0L A;  3I4M H;  1WD0 A;  1XTC D;  4C1N I;  5LMN W;  1CKO A;  4KTA A;  4XT3 B;  2F0P A;  2LKV A;  2UXD Q;  2R61 A;  3TEH B;  3UI2 A;  3MHB A;  4HIO A;  3EFX D;  2UXD L;  4U67 3;  4A3E G;  3RNU A;  3I4L A;  2FIN B;  2G9H D;  1OO9 B;  2CVR A;  3HOW H;  1EWI A;  2A73 B;  4HCE A;  5BN4 A;  4OXP A;  3SK8 A;  4QIW B;  4QMG A;  4C3H G;  3I73 A;  2EE1 A;  1A3V A;  1AZQ A;  2E2H H;  1K73 C;  1S5E D;  3EIV A;  4DK6 C;  2EYH A;  1KC8 C;  1SN8 A;  1SND A;  1B7Y B;  1SMY D;  2ZT9 C;  2M2L A;  4PZ7 A;  3VDY A;  5C4Z A;  4P73 A;  1LT5 D;  3H0G H;  2JXM B;  3NP8 A;  5D65 A;  4LFB Q;  1ZYR C;  4OO1 I;  3QOJ A;  4DAP A;  1PDQ A;  4KI0 A;  4NDX A;  4LFB L;  1NR4 A;  4UP7 A;  4BWG B;  1VQK A;  5FO7 B;  1ONL A;  3MXN A;  3J81 c;  5IYB H;  5ELD A;  2UXC Q;  2KCN A;  5L37 A;  1TWG H;  1E3P A;  3PQI A;  4ODG A;  5J39 A;  1JCK B;  2JA8 H;  2UXC L;  1G6Z A;  1DZ1 A;  5EBD A;  1FJG Q;  3A7L A;  2EIF A;  1Q12 A;  4ZK9 B;  5IGG A;  1V43 A;  1G2T A;  1Z7T A;  3FVQ A;  1VQG A;  4DAV A;  1FJG L;  4JW0 A;  1KQS A;  2D2C C;  3BJU A;  1A15 A;  2B29 A;  4O1N A;  1JR0 D;  2NUC A;  2VL6 A;  5FJ8 G;  2K5W A;  4JCV E;  3RD4 A;  3S17 B;  4OO1 H;  3C1F A;  1VQP A;  4DR1 Q;  1SMY C;  2O2L D;  4K6L A;  2ZXO A;  1B8A A;  1TS2 A;  4KD4 A;  4LAA A;  3NBI A;  4DR1 L;  1Q8K A;  5KNB A;  5IGB A;  3S1Q B;  4L5Q A;  4A3M G;  2UXB Q;  3L3O C;  4GLA C;  1ENC A;  5CV8 A;  3HGB A;  3VA7 A;  2A5H A;  2EY5 A;  1XNR Q;  4K5V A;  1SFO B;  2N78 A;  3CF5 A;  2F3I A;  1XNR L;  4P71 A;  4PMW A;  2ATW A;  2AUJ D;  1HQR D;  2NVX B;  4LWC A;  1YBY A;  3A54 A;  5COR A;  1PLF A;  5C5M A;  1F9S A;  1I4H A;  3D4W A;  4HTH A;  3K58 A;  1Y8P B;  2N49 A;  4UPA A;  3VYS A;  4H7B A;  1K0S A;  1VQE A;  2ENB A;  3CPW A;  2LSS A;  1CI3 M;  1KLG D;  3KLR A;  1PTO F;  1BR9 A;  2K7V A;  4MZ9 A;  4POF A;  2PMZ E;  3HOX G;  1EQV A;  3I4M G;  2NTT A;  5KEE A;  1KL9 A;  1VQO A;  1VQA A;  1LUZ A;  1Q82 C;  2VB2 X;  2UUA Q;  1EIH A;  1I4Q A;  1O7Z A;  2Z6K C;  2K33 A;  5KYI A;  1UAP A;  1CQF A;  2UUA L;  5HGQ A;  2K1B A;  2XRS D;  4E6I A;  4L5S A;  2EDG A;  4DV6 Q;  3S17 H;  1N33 Q;  3AU7 A;  3EA6 A;  2F0L A;  1TWH B;  4JI7 Q;  4DV6 L;  3OSO A;  3D31 A;  1N33 L;  1D7Q A;  4FP5 D;  4A3G B;  3BDC A;  3K8A A;  5EGT A;  3Q8D A;  4JI7 L;  5DM6 3;  3T16 A;  3S1Q H;  1WOC A;  5IP7 G;  3OW7 A;  4MNO A;  2F0I A;  1LTI D;  4XXE A;  2RVL A;  1EQQ A;  4DUY Q;  1OXX K;  1K28 A;  1BXT A;  2NB0 A;  2E74 C;  2LXK A;  1LT6 D;  2DGY A;  5CV4 A;  1SFO H;  4DUY L;  1EYA A;  4NPS A;  2F0Q A;  5KGU A;  2XWJ B;  2ZJQ A;  3H0G G;  2SNS A;  3HOV B;  2SDF A;  3BDO A;  1ZKO A;  3R2T A;  2NVX H;  1D2B A;  1EWH A;  1FGU A;  1HUM A;  4DR5 Q;  1SNM A;  4YIJ A;  4IUU A;  3DHQ A;  3FKI H;  1EUJ A;  4DR5 L;  3OWF A;  1EY4 A;  3CCM A;  3S24 A;  5JVG 3;  5GRO A;  1YJN A;  3CP0 A;  4Z9C B;  1VQB A;  2PQA A;  4HN7 A;  5KND A;  2JA8 G;  2YTX A;  4J8Q A;  4IPC A;  3UE0 A;  1RTO A;  1N36 Q;  5D3I B;  5IGE A;  5T1G A;  2IX0 A;  4IUP A;  5M5Y B;  2PPB C;  1E0B A;  1F9R A;  1KLU D;  4K2K A;  3K57 A;  3ULP A;  2PNR C;  2JA7 G;  3HS0 C;  1N36 L;  1V1P B;  5BR8 Q;  1YJW A;  4LF4 Q;  4LF8 Q;  2WB1 B;  1SYB A;  2MHV A;  3R93 A;  2PNH A;  1YIJ A;  2IPK D;  5BR8 L;  5C0X I;  4LF4 L;  4LF8 L;  3KF6 B;  4OO1 G;  1EYC A;  1W6K A;  3M3Y B;  4YWM A;  1VQ5 A;  4B3T Q;  3KDF B;  1TWH H;  1JE4 A;  3KBG A;  2BA1 A;  4N8F A;  3CCE A;  4LUZ A;  4A3D B;  4B3T L;  4A3G H;  1I4X A;  2YV5 A;  3JAM i;  1UE7 A;  3C1E A;  1W6J A;  1E1T A;  2R7Z B;  1KNE A;  2F0V A;  4DR6 Q;  2Z0S A;  5I2X A;  2UUC Q;  2R92 B;  1DOM A;  5FLX L;  2KEN A;  4KMU C;  4X3K A;  5IT9 L;  4DR6 L;  1II3 A;  1AN8 A;  2UUC L;  4JI6 Q;  4MTN A;  1IYJ B;  3HOV H;  1UEA B;  4DUZ Q;  4DV5 Q;  4JI6 L;  3EQL C;  1HPC A;  4CBV A;  1VQL A;  1SBB B;  4OHJ A;  4A3L H;  4AH6 A;  4RMF A;  3L0O A;  4DUZ L;  4DV5 L;  3ERO A;  2NN6 I;  2SEB D;  4GOP A;  3RLN A;  2WAQ B;  5C0X H;  5IGC A;  3FRP B;  2GA4 B;  1YNX A;  2B63 B;  5C4H A;  2UU9 Q;  3I7F A;  1CA6 A;  4IUV A;  1TWA B;  2AQ2 B;  2QIL A;  4F87 A;  3CC4 A;  1VS0 A;  1WYD A;  4DV2 Q;  3F1Z A;  4B3R Q;  3DWQ A;  2UU9 L;  2JA5 G;  1MJE A;  4A4I A;  3TS2 A;  1X65 A;  1A6X A;  2CH4 A;  4KY6 A;  2JP1 A;  4YCV A;  4J6H A;  4DV2 L;  5IGD A;  3J81 E;  2VS1 A;  1D1I A;  1M90 C;  2IY5 B;  3U9S A;  5M3M B;  3PIO A;  3TS0 A;  3NQT A;  2E2J B;  4HR7 B;  3SK5 A;  1VQN A;  1E24 A;  3AFQ A;  1Y8N B;  4FVM A;  4EQO A;  3OTO Q;  3S1N B;  2LMC B;  3M4O B;  1GUN A;  3K0X A;  3M3Y H;  1I5F A;  4JBM A;  3MXU A;  1QE6 A;  3OTO L;  3H3V C;  4BY1 B;  2A69 D;  2K04 A;  1S5F D;  3Q22 A;  1MGS A;  2VQE Q;  5CBA E;  1G6P A;  3BVZ A;  4GNX C;  1RJT A;  2B2Y A;  3T53 B;  2F1M A;  1JJC B;  4DV3 Q;  3STB D;  4LFA Q;  4QQB X;  5M5X B;  2VQE L;  1PRT D;  2MNA A;  4KHV A;  1L0Y B;  4DV3 L;  4LFA L;  3HOZ B;  1HHV A;  2E2I B;  2JE6 I;  2CKZ B;  1SRU A;  4R4O A;  3TP7 A;  2ASB A;  3G6J B;  1PFN A;  1HZA A;  4EQ5 A;  1SE3 A;  1HXY D;  1HA5 A;  1X3P A;  3QOL A;  4R4Q A;  4G7O C;  3Q6S A;  2F0K A;  4KKT A;  1CA5 A;  4QCL A;  3J7Y W;  3FKI G;  2B63 H;  4FYD A;  2RKS A;  1FNU A;  1TWA H;  3J80 E;  4ME5 A;  3PMF A;  3MEH A;  4C3J B;  4PZ6 A;  3LWE A;  3SVM A;  4QUF A;  1HR0 Q;  2PW7 A;  2CQA A;  2H4O A;  2VW9 A;  4H02 A;  1Q46 A;  1JQY D;  3A5Z B;  3BG3 A;  3BYT B;  1VQM A;  3GTP B;  3NQI A;  1HR0 L;  3TRZ A;  1ET9 A;  1D5M C;  3M9B A;  3FEW X;  3RLO A;  2NYZ D;  5M3M H;  4BY7 G;  1LTB D;  4JG2 A;  1F9P A;  4YY3 Q;  1F2L A;  2E2J H;  4L5T A;  1B70 B;  1H9M A;  1L0X B;  4LF7 Q;  1SSO A;  1KTK A;  2VB3 X;  4YY3 L;  2D9U A;  3KLS A;  3M4O H;  4P75 A;  4LF7 L;  2JEB I;  1LAB A;  4HID A;  3A0J A;  2PW5 A;  3KJP A;  3LNN A;  3SGI A;  4BY1 H;  4GOP C;  2MFI A;  3K0Y A;  5C44 B;  3TP6 A;  1CQV A;  1XWE A;  3MC0 B;  2IX3 A;  2K5N A;  4DAY B;  5M5W B;  4QJF A;  4YWK A;  5M5X H;  1Q3L A;  3A5U A;  3BVG A;  3ITP A;  1K9M C;  5IGF A;  3GTJ B;  3G6E A;  1PYB A;  1TY2 A;  2E2I H;  2LY7 A;  4HJ7 A;  4A93 G;  1BBX C;  3HOV G;  1RF2 D;  2KHI A;  5FOB B;  1S5D D;  4V19 0;  4JPB W;  1PH8 A;  1PVO A;  4LW1 A;  4RAU C;  4QL5 A;  1EOV A;  1L1O B;  3I56 A;  1LM0 A;  2F3V A;  3HOU G;  1IBL Q;  4TSS A;  2RBM A;  1SMX A;  3I55 A;  3NPP A;  1G51 A;  3CC7 A;  1IBL L;  4C3J H;  2RQX A;  3DM3 A;  1MSG A;  4IUN A;  3PO3 G;  4UP8 A;  1Q8I A;  1BCP F;  2G9D A;  3AMU A;  4AYB B;  5A2Q E;  5I6Y A;  3GTP H;  4XYQ A;  2MQH A;  3PIP 3;  2WKC A;  5KNC A;  4QIW E;  1P8L A;  3U4V A;  1C4Q A;  2OTL A;  1X3Q A;  1IXR A;  3FPU B;  3PO2 G;  4BBS H;  3J80 i;  2EYM A;  1BF4 A;  3S2D B;  1NSN S;  2WB1 G;  3SXH A;  4CDD C;  2A68 D;  1N32 Q;  2A6H D;  3WOF A;  2RDH A;  1WVL A;  4A3J B;  1TT2 A;  1G2S A;  2B2V C;  3IFT A;  1EFI D;  1SNP A;  2A19 A;  3P20 A;  1N32 L;  5EKK A;  3SE0 A;  4IPD A;  2K4K A;  3OIP A;  4A3F B;  1SYD A;  1PRT B;  2R6G A;  4ID6 A;  1PMR A;  5C44 H;  2E8G A;  1KNA A;  2OEO A;  5E4W C;  5M5W H;  1EZ6 A;  1CFM A;  2ZTC A;  2AQ3 B;  2HT1 A;  2HDL A;  4X3U A;  5E1F A;  1AFP A;  4XIG S;  3SK6 A;  3T13 A;  2HQE A;  2ZTE A;  3GTJ H;  4M8A A;  3AB9 A;  3PCO B;  1LTS D;  1ENF A;  2CW0 C;  4J15 A;  5C4J B;  3URY A;  2BE5 D;  4X3T A;  1EU3 A;  2F0E A;  5NUC A;  5C3E B;  2B8F A;  3KOJ A;  4FNF A;  3H09 A;  1N34 Q;  2X69 A;  2R7F A;  3E0E A;  4CJ1 B;  1PV4 A;  2WAQ G;  5A35 A;  4A3I B;  1SAP A;  1X32 A;  2N8N A;  2E5L Q;  1W3S A;  1STG A;  1KRS A;  3CHB D;  2P5Z X;  2PCF B;  5F2D A;  2BDO A;  3CCU A;  2E5L L;  4BS9 A;  4C2M B;  1YEZ A;  2AKW B;  3JAM L;  1YIT A;  2Y0S G;  3QO2 A;  4JVZ A;  1T9H A;  4A3K B;  1WTW A;  3G71 A;  1XPR A;  1KXL A;  4TQU S;  3B6Y A;  5M3M G;  1A2U A;  4GZY C;  3KF8 A;  1WCM G;  5GAG C;  2Q2I A;  5TSS A;  4LMQ D;  4IOC A;  4RFB A;  5C3X A;  3M4Y A;  3S2D H;  4JI0 Q;  2RCN A;  1E1O A;  1C9O A;  2YU9 B;  4MN3 A;  1X56 A;  3DM1 A;  1OXS C;  3DWP A;  2ALY B;  4B9W A;  1X3F A;  4JI0 L;  4A3J H;  4U68 A;  1IBM L;  2EJG C;  2E76 C;  3N52 A;  2L55 A;  1NMF A;  1GM5 A;  1TY0 A;  4DNI A;  1O80 A;  2JYO A;  3HKZ B;  3K6O A;  4A3F H;  1QUQ A;  1T5X D;  1TKW B;  3BZK A;  3WWV A;  1QJO A;  2QEX A;  1GUG A;  2KHJ A;  3RZO B;  3ER0 A;  1M1K C;  1BO0 A;  4FXK C;  3Q24 A;  1YVC A;  4G7H C;  1GKH A;  5FK9 C;  3CCV A;  2A8V A;  2KVM A;  3KK7 A;  5JOB A;  2KUM A;  1SNO A;  1XX8 A;  4YHH Q;  3T1H Q;  1CTM A;  1PZK D;  3VR6 A;  1VQC A;  1LLR D;  1PTO D;  1WD1 A;  2EJF C;  5IYC H;  1ET6 A;  1GUT A;  5D14 A;  2D0O A;  3DEP A;  3T1H L;  1QNK A;  3E9I A;  5HUR A;  1GUO A;  5C3E H;  4RGN A;  1B3A A;  4DFA A;  3KF6 A;  4ZAI A;  1VDZ A;  2Z6K A;  1Q90 A;  4LJZ C;  4I7A A;  1GXD C;  2F0M A;  2RHQ B;  1WTQ A;  1VQF A;  1DOK A;  4A3I H;  3EVQ A;  3L9A X;  2J4X A;  3NTK A;  1FL0 A;  1G29 1;  4C3J G;  3EBE A;  4KKS A;  4MTK A;  4RKL A;  1I6V C;  1Q1E A;  2M00 A;  3M85 A;  1CSQ A;  1STN A;  2BH8 A;  4LUV A;  1GD7 A;  4C2M H;  4OWW B;  3MTS A;  3OIQ A;  1KIX A;  3KYH C;  3GDE A;  1LTL A;  1PH7 A;  2Q2T A;  2B2W A;  2ICE C;  4A3K H;  3MFG A;  3QJY A;  1SXT A;  4S3S A;  3F2D A;  4BBS G;  1PFB A;  1TWF B;  2PI2 E;  4NW2 A;  1NMG A;  2Z4I A;  2V1C C;  1KDB A;  1SE2 A;  4QUC A;  1ICW A;  3GTO B;  2YU9 H;  1AE3 A;  3G7L A;  3BZC A;  1V1Q A;  3VYU A;  4R4I A;  1PA6 A;  3GP7 A;  4CKE A;  1SYG A;  4HCS A;  4O2D A;  3E3X A;  2AMC B;  3LX0 A;  4K5X A;  4X66 Q;  2I0Q A;  1G8Z D;  5DM7 3;  1EY5 A;  1WTV A;  1A62 A;  4A75 A;  3UDI A;  4DK1 A;  2XNA C;  4H13 C;  2EPB A;  3CKI B;  3RZO H;  4X6A H;  1IKL A;  4X66 L;  2I5H A;  4X65 Q;  2K5H A;  3UE1 A;  1X3G A;  1YZ6 A;  1KHI A;  1OXV A;  4X65 L;  2GVA A;  2QKI C;  4IFD G;  4KY7 A;  1CUK A;  4IUT A;  1D1K A;  2I46 A;  1JOQ A;  1Q1B A;  3CC2 A;  1CKN B;  2IJ0 A;  2UXB L;  1I4G A;  4BBR B;  2VXW A;  1JOK A;  3J81 L;  2TMP A;  1BQQ T;  4F88 A;  1JB3 A;  1AW7 A;  4ZRZ A;  4OON A;  2WB1 E;  2K14 A;  5IP9 H;  4BA1 I;  2KEE A;  4BXX G;  2I5L X;  2B2U C;  1B44 D;  2HHH Q;  5C6A A;  1HNW Q;  4HJ9 A;  3TZU A;  4MIU A;  2ZJR A;  2HHH L;  1HNW L;  1DOL A;  2VUM G;  1SLJ A;  2EYF A;  3K5N A;  4ZQ3 A;  3GV3 A;  4KD3 A;  2IT1 A;  3OYY A;  1PHJ A;  3CME A;  2F0T A;  3JC6 6;  2ID0 A;  3GTO H;  1B9N A;  5EAY A;  4A3J G;  3FDT A;  2O5J C;  1YNN D;  2QF7 A;  4A3F G;  1NJI C;  1NNX A;  3T51 B;  1ESR A;  3MA2 B;  1I50 B;  4DNT B;  4RGM A;  3PUX A;  3MEF A;  2AWO A;  4K8J A;  4XTC S;  2CCZ A;  3HOW G;  1PTO B;  2IHF A;  1JWS D;  4AIM A;  2WAQ E;  3VR2 A;  3KBX A;  4IFD J;  3VYT A;  1LTA D;  1TVX A;  3G4S A;  3F2C A;  1XNQ Q;  5H1S E;  2B2W C;  3MVV A;  3GTL B;  1EYD A;  4DF7 A;  3J80 L;  2OQ0 A;  3CW2 C;  1XNQ L;  1XTD A;  3S16 B;  5C3E G;  2Y0S E;  2Q8I B;  1MHW C;  1LT3 D;  3BYY B;  2EYP A;  4L8J A;  4BBR H;  4HJ5 A;  1NBW A;  5EPJ A;  4HIM A;  2Q2U A;  2XWB B;  2NWG A;  2BDN A;  4RGO S;  3S14 B;  4GN5 A;  3BVM A;  3Q0A A;  2HQL A;  4A3K G;  4DAM A;  3NXW A;  4GNX A;  3GO5 A;  4A3B B;  5IYB G;  3UDX A;  2DY8 A;  1UUP A;  3NK9 A;  3RZD B;  5ELB A;  3PIP A;  4A76 A;  3MXP A;  2DNC A;  2R93 B;  3D4D A;  3HKS A;  4TKO B;  4P74 A;  5M3F B;  4N8X 1;  5FLX c;  3FHW A;  2L4N A;  1IYU A;  3HKZ G;  5IT9 c;  1EIF A;  2KQ3 A;  2B2T C;  1QCB D;  3OMC A;  5DAU A;  3D0F A;  1I50 H;  3R8B A;  1IW7 D;  2F0J A;  1SJH D;  4ZUJ A;  5K36 H;  1PTO H;  1EU4 A;  3I70 A;  1D5Z C;  3X3M A;  3EN2 A;  4HJA A;  3DEO A;  4ULL A;  3GTL H;  5JEA H;  4TVA B;  4NP5 A;  1EOT A;  3S16 H;  2B8G A;  1XMQ Q;  3W1B A;  5M9O A;  5LMN Q;  1HH2 P;  5A2Q L;  1HA6 A;  1Q81 C;  4CJ0 B;  3NE5 B;  1LO5 D;  1OXU A;  1XMQ L;  4RCO A;  3A56 A;  1QVG A;  5LMN L;  4ZUI A;  2WP8 J;  3PUZ A;  1D5X C;  3F8T A;  2CHB D;  4QY7 A;  4C3I B;  5C3W A;  3TP5 A;  2JSO A;  5EKI A;  3S14 H;  3TME A;  4UDU C;  1IBK Q;  2F0N A;  5IY0 A;  1QOH A;  4RG1 A;  3UDF A;  4A3B H;  1G91 A;  3MXN B;  4GLX A;  2C5C A;  4EX5 A;  1SE8 A;  2QEJ C;  1AH9 A;  1DXM A;  1I4P A;  3F2U A;  3RZD H;  3RR5 A;  4KJO A;  4KV6 A;  1XPO A;  1EIY B;  4B3R L;  1UE5 A;  1YHQ A;  2FXQ A;  3HZX A;  4IUR A;  4K6D A;  2MUY A;  5M3F H;  4DR3 Q;  5M5Y H;  2KED A;  4DN4 M;  1D6E C;  3HOY B;  2ZJP A;  4M1U B;  4WFN 3;  4DR3 L;  4X62 Q;  3M7G A;  5DNF A;  3CMA A;  4DPG A;  2YYZ A;  3KFU A;  1SEB D;  3D3R A;  2NN6 H;  1Z6H A;  4KJN A;  5KIX A;  1KDC A;  1I6H B;  5CV5 A;  3OHX C;  4A3D H;  5BN5 A;  4Q5V A;  2D0P A;  2R7Z H;  1BCP D;  4AYB E;  2R92 H;  3TP8 A;  1K3R A;  2KJX A;  4C1N K;  5HY6 A;  2D5D A;  1NE3 A;  4X64 Q;  5ELE A;  2NZO A;  2DN8 A;  2F0G A;  1TXY A;  3T56 B;  1I4R A;  1T5E A;  1L1O C;  4LF9 Q;  4GS3 A;  1PYS B;  2EXD A;  2B2V A;  2Q8R E;  4X64 L;  3RN5 A;  3P1H A;  2ES2 A;  4C3I H;  1TWC B;  4WRD A;  5E3F A;  4LF9 L;  4A3E B;  4JI4 Q;  3G48 A;  3FPP A;  1JMC A;  1PH3 A;  3R2I A;  2IHE A;  5J1Z A;  2OF1 A;  2L9H A;  5CMD A;  2CWP A;  4JI4 L;  1CSP A;  4ZCK A;  3CRL C;  4JBK A;  4PG3 A;  4LNQ A;  3N6R A;  1FNV A;  4K2L A;  5IOC A;  3DWA A;  4WJ4 A;  2DNE A;  3HRZ C;  2K50 A;  2WII B;  5IWA Q;  3VR4 A;  1QZG A;  1QVC A;  1MSH A;  3OMG A;  1U9R A;  1SJE D;  2K32 A;  5IWA L;  1BVS A;  2A69 C;  3HOY H;  1QWY A;  2V4D A;  4I7Z C;  1MKH A;  4G4K A;  4Q0F A;  1Y1W B;  4C56 C;  4PMC A;  3ERQ A;  3STB C;  2MPM A;  1PRT C;  2PQE A;  3S9W A;  3S1N H;  3S15 B;  5K36 G;  3J81 i;  2QDL A;  5AJ3 Q;  4CDC C;  3HEJ A;  2MO0 A;  3M4P A;  1PH9 A;  2JA6 B;  2WIN B;  2PZT A;  5LL6 S;  1LTT D;  5EJW A;  5AJ3 L;  4A3G G;  1I6H H;  1FYC A;  4IOA A;  3CQZ B;  2K6A A;  2WKD A;  1C48 A;  1HFG A;  1UWV A;  3W1G A;  2HD3 A;  1RD9 D;  1IL8 A;  4OWT B;  3H15 A;  2K01 A;  2XGT A;  4FF3 A;  2AQ1 B;  3HOZ H;  1MBY A;  1NUC A;  3NHH A;  4KK7 A;  1KDA A;  1IKM A;  4EQN A;  1IYV A;  4JBW A;  2K5D A;  4A3L G;  1C0A A;  1HZB A;  1TWC H;  2BOS A;  3PV0 A;  1YI2 A;  4A3E H;  1OTC A;  5C0X G;  4OL7 A;  3TSS A;  2K28 A;  1B4O A;  4R8N A;  1PH2 A;  2R3Z A;  4QB4 A;  3TZD A;  3HKZ E;  3SK4 A;  2OQK A;  4CDF C;  5IE8 A;  4ME3 A;  2RHS B;  1AZP A;  2KEC A;  2PQA B;  4H0L C;  2FMM A;  4XT1 B;  4A3M B;  3FP9 A;  1EIG A;  3O13 A;  4JOI C;  4FO2 A;  3ERS X;  5M3F G;  1KAB A;  1DCZ A;  1FR3 A;  1S5C D;  3ND9 A;  3X3N A;  5J22 A;  2I07 B;  1VF5 C;  4YCW A;  1R4Q B;  2LXJ A;  4HSV A;  5CBE E;  4I65 A;  5FLX E;  3J7A F;  1Y1W H;  2FMC A;  2F0S A;  4FXD A;  5GQO A;  4IZ8 A;  3S15 H;  1I3Q B;  1TR5 A;  5IYD H;  2NN6 G;  1BCP B;  5FLM H;  1IZ6 A;  2JA6 H;  2A6E D;  4WOR A;  4K0K Q;  4R1J A;  3A8I E;  4A3D G;  1A8V A;  1TII D;  5DLQ E;  4Y7N B;  1JE5 A;  2R7Z G;  2TSS A;  3CQZ H;  4K0K L;  3GTQ B;  1HZC A;  1L0W A;  4OGQ C;  5E4X A;  3HOX B;  3QB3 A;  2R92 G;  1J6Q A;  1EY6 A;  3I8Z A;  1JB7 A;  2KA7 A;  5FO8 B;  3JAM c;  4YWL A;  1QNU A;  3CCR A;  4IUQ A;  1LTG D;  4DV4 Q;  1NTG A;  5J3B A;  2IW3 A;  4LF6 Q;  2HCC A;  5C0X J;  1JT8 A;  3AFP A;  4DV4 L;  2KBN A;  5FJ8 H;  1PZJ D;  3CU7 A;  3J7A V;  1SNC A;  1EY7 A;  2GN5 A;  4LF6 L;  1ESF A;  3I4N B;  1BBW A;  5JJK A;  1B9M A;  2B63 G;  4IPH A;  2R7D A;  1N34 L;  1HQM C;  2SOB A;  4DXG A;  2PI2 A;  4IJH A;  1BKB A;  2VZA A;  4OWX B;  3W5O A;  2A68 C;  2QCP X;  2A6H C;  2OWO A;  3W3A A;  5EKL A;  4TRD A;  3MAQ A;  1JWU D;  4A3M H;  4KN7 C;  1STA A;  3PF5 A;  1OXT A;  4FXG C;  1E2W A;  1AEX A;  3NWT A;  5EPL A;  2FFK B;  2XN9 C;  2VNU D;  1GJX A;  2VQF Q;  3DLL A;  4RCN A;  1S3O A;  1XMO Q;  1HNZ Q;  2MGS A;  1EZ8 A;  3OPO A;  4IN3 A;  4POG A;  1HFN A;  2XTI A;  3HOY G;  1B3Q A;  2HCI A;  1STB A;  2Q2H A;  2VQF L;  4GLV B;  3H94 A;  1XMO L;  1HNZ L;  5ISR A;  2QW7 A;  4XQN A;  3GTG B;  1B1Z A;  1Q7Y C;  3VR5 A;  1GUW A;  3CCL A;  4IJL A;  4IAL A;  4JI5 Q;  2QDB A;  2Z9H A;  4O42 A;  1I3Q H;  1PFS A;  5JPN C;  3U50 C;  1BOS A;  3K7U C;  4H44 C;  1V8Q A;  4JBJ A;  1J9O A;  1VMP A;  4JI8 Q;  4BY1 G;  2B2U A;  4JI5 L;  1BNZ A;  3C46 A;  4F8M A;  3Q23 A;  3MXG A;  4Y7N H;  2BE5 C;  4JI8 L;  3RUZ A;  4CGY B;  1F2Z A;  1U4L A;  1ZYR D;  3GTQ H;  3HOX H;  2CQO A;  1IHZ A;  2F0U A;  2YTY A;  2IX1 A;  4B3M Q;  3OWE B;  1K3B C;  2C9O A;  1LYL A;  3NEN A;  3HOZ G;  2OT2 A;  1UNS A;  1XYI A;  1VQH A;  4B3M L;  2E75 C;  4RKB A;  2JA7 B;  2CFM A;  1AE2 A;  1V1P A;  2D62 A;  4RWS C;  5C4J H;  4RH6 A;  3HG9 A;  1EL0 A;  4YHH L;  3E6Z X;  2ICI A;  2XVS A;  2NVY B;  5IIF A;  1VCI A;  3I4N H;  2NZH A;  1RDP D;  3KDF A;  1VQI A;  4MHE A;  5EPK A;  2KCC A;  3QG1 A;  5LHY 1;  3QIA A;  1VQD A;  2GVB A;  5IP7 H;  1O7L A;  1K83 B;  3KLW A;  2RF4 A;  4DU9 A;  1SYE A;  1K8G A;  2AWN A;  4DXF A;  3GQB A;  5I4D A;  1O78 A;  2AHO B;  5JJL A;  3H6M A;  2XIW A;  1ILP A;  5E7N A;  1K8M A;  3IKJ A;  2MJ8 A;  4HJ8 A;  4JI1 Q;  1TS3 A;  1DD2 A;  4R4T A;  2JA9 A;  3D8G A;  1U4M A;  5EQ0 A;  1Y1W G;  3GTG H;  3A55 A;  1KAA A;  1WFQ A;  3K5L A;  5I2Y A;  2X6G A;  4JI1 L;  4HSP A;  4AQY Q;  1VQ7 A;  1QVF A;  5IYD G;  1Z47 A;  4EQP A;  4G7Z C;  2L11 A;  4CHT B;  1E2V A;  5JPM C;  3NBH B;  3HFZ B;  1C7Y A;  5FLM G;  1CHQ D;  4AQY L;  2JA6 G;  1VQ4 A;  4P72 A;  1H9S B;  2ZM6 Q;  1PTO C;  5C44 G;  5G3L F;  1Y1V B;  2BA0 A;  2JA5 B;  4K14 A;  5ELN A;  4DNR B;  3BU2 A;  2ZM6 L;  1EQT A;  1RKN A;  2A1A A;  2A74 C;  1X6O A;  3E0J A;  1CM9 A;  1VMC A;  3UDG A;  3CCS A;  4HMJ A;  4EVO A;  4RGT A;  5CGK A;  2RSO A;  4OEM B;  4R8I A;  3P7J A;  4LFC Q;  2JA7 H;  5AFW A;  1EQR A;  3SR1 A;  1B53 A;  1RIP A;  3ZYY X;  4LFC L;  3MZ5 A;  2JK8 A;  3FMC A;  4N9P A;  5IOD A;  2HIV A;  4X3S A;  5JAV A;  5EBC A;  2NVY H;  4OX9 Q;  2B2T A;  4GN4 B;  2K5Q A;  4PV1 C;  1RTN A;  4FF2 A;  1PH1 A;  4NXM Q;  4OX9 L;  5ELF A;  3GTK B;  1HR0 W;  3HP3 A;  1TQO A;  5C5L A;  3C3L A;  2WAC A;  4NXM L;  4AYB G;  1GVP A;  1ZEQ X;  3PUV A;  3CCJ A;  1K83 H;  1NCV A;  2JN4 A;  5LMU Q;  1WTX A;  1JOR A;  4NXN Q;  4R9W A;  2EVB A;  1VQJ A;  1TWF H;  2JEA I;  1O7Y A;  3NEL A;  5LMU L;  2B39 A;  2KCM A;  4GKJ Q;  4NXN L;  3D6W A;  4DA2 A;  1CZW A;  3IRB A;  3TN2 A;  1BDO A;  4KHZ A;  3J80 c;  2EYL A;  1N9W A;  2HUG A;  4XQJ A;  4GKJ L;  4QF4 A;  1ZXT A;  2WV6 D;  4Y52 H;  2MP1 A;  3PUW A;  3FKI B;  1JC7 A;  1V1O A;  4HED A;  2F4I A;  5ELC A;  5JJZ A;  2F0D A;  4GKK Q;  5CV6 A;  1Y1V H;  1EY8 A;  3J7Z C;  4UAI A;  2LS0 1;  2JA5 H;  5JJI A;  1R9T B;  4A3C H;  4APV A;  4ALP A;  2NVT B;  3NTH A;  4GKK L;  3IFD A;  2QGQ A;  4OEL B;  2DJG C;  3D6C A;  2EYJ A;  1EEI D;  1CT1 D;  1RL2 A;  5CC4 A;  2E2D C;  2RA4 A;  1SDF A;  1DM0 B;  2NVQ B;  1PFM A;  3VR3 A;  3K5O A;  4BY7 B;  1U4R A;  5D3D A;  1EYG A;  5IYC G;  4KY5 A;  3JAM E;  2L15 A;  5CR3 A;  2K05 A;  3OW2 A;  3K59 A;  1GO3 E;  3I4N G;  1A3T A;  3I72 A;  4A3I G;  3IAY A;  3MFY A;  1N8R C;  1QIL A;  4F7X A;  1H9J A;  3GTK H;  2OXP A;  1A3U A;  1D8L A;  4RHR A;  4IPG A;  4DAY A;  3KLS X;  4B3S Q;  1ICF B;  1SYF A;  2L12 A;  1YNN C;  4HAE A;  1ASY A;  4B3S L;  3CRK C;  3KF8 B;  1Y69 U;  4CKB A;  1ASZ A;  4A93 B;  4CKC A;  5I9P A;  1PYW D;  1F77 A;  1CK1 A;  4DV0 Q;  5C4X B;  2PO4 A;  4JC0 A;  5FO9 B;  4DR2 Q;  1GHK A;  1L1O A;  3M7N A;  3HOU B;  4DV0 L;  3TBI B;  4DR2 L;  2EZV A;  2K5V A;  4ZYS A;  3RMH A;  2HIX A;  1YJ9 A;  1QUQ B;  1HNX Q;  2NTS A;  5CYU A;  3V96 A;  1LTR D;  2BCO A;  3A74 A;  3WOE A;  2F52 A;  2JJQ A;  2PZU A;  1RCV D;  3I2Z A;  1E22 A;  2ZXR A;  1K0R A;  3PO3 B;  2RCF A;  1HTP A;  1STH A;  3SEB A;  1HNX L;  2OTJ A;  3NSW A;  1U5K A;  3J7A 5;  1R9T H;  1VQ9 A;  2LFN A;  4PNY A;  2NVT H;  1MJC A;  1DYQ A;  5HGT A;  3BS1 A;  2B3G A;  2JQO A;  2NVQ H;  4KHP Q;  3AYH B;  1DJR D;  3DUZ A;  3PO2 B;  4BY7 H;  3PGZ A;  2G5D A;  4NB3 A;  5CV9 A;  1F2M A;  4KHP L;  1NY4 A;  1RHP A;  2L5T A;  4DV1 Q;  5KYL A;  5JVH 3;  1O7I A;  3NTI A;  1YHA A;  5COY A;  4DV1 L;  1UEB A;  4JI3 Q;  1U4P A;  1KAW A;  1LV9 A;  4JI2 Q;  1F2Y A;  2X6L A;  5IP9 G;  4L63 B;  2PMZ B;  2RSN A;  4JI3 L;  1MIU A;  1PXU A;  1YNJ D;  2DY7 A;  4JI2 L;  3W2D A;  1JIC A;  4HIK A;  1A63 A;  4FF4 A;  4L6T B;  1DON A;  1V9P A;  3I91 A;  1B2T A;  1WTR A;  1EWC A;  1IBK L;  4A93 H;  4ABN A;  3ULJ A;  1IW7 C;  3PSI A;  2F03 A;  3ICE A;  4QGU A;  2BH2 A;  2R93 H;  5C4X H;  3BZD B;  1S40 A;  1VQ8 A;  3HOU H;  1E7Z A;  1QB5 D;  3GTM B;  1H9R A;  4IQZ A;  4KN4 C;  1L2F A;  1STY A;  4K5W A;  1QG7 A;  2WFW A;  1NAP A;  1Y1V G;  3PO3 H;  1H9K A;  1JOO A;  4A3C G;  2I5M X;  2Y0S B;  5BN3 A;  4X62 L;  4J1M A;  3U58 A;  1PH4 A;  2SNM A;  4UP9 A;  5FKA C;  3GV6 A;  3PO2 H;  4JOI A;  1WCM B;  4ZKC B;  1ROD A;  3WDN A;  1FVI A;  4GN3 B;  1YNJ C;  3TRE A;  3V2T A;  1F9Q A;  2M9V A;  2F4V Q;  3ND8 A;  4B9X A;  1B50 A;  1WI5 A;  1DGS A;  1EY0 A;  4PQX A;  3ONA B;  3TDQ A;  4BBR G;  4DR4 Q;  2F4V L;  3ULL A;  1R4P B;  2N3S A;  2J0T D;  4WJ3 M;  4G57 A;  1UE1 A;  3DMU A;  2NBF A;  3DXJ C;  4DR4 L;  1FGB D;  4PMB A;  1X55 A;  3AQQ A;  1E2Z A;  1VF7 A;  4RHS A;  1TU2 B;  3LWU A;  5T1I A;  3E5S A;  4C3H B;  3QR8 A;  2OCE A;  3K5M A;  2PZW A;  3CD6 A;  1AP0 A;  3NUC A;  2J7Z A;  4KKU A;  1FD7 D;  2IL8 A;  1WTH A;  4JV5 Q;  4IO9 A;  1EY9 A;  2F3W A;  4LK1 C;  4FDB A;  1X3E A;  1M4V A;  3A7A B;  3R3O A;  4JV5 L;  3K80 C;  1SR3 A;  3GTM H;  1GHJ A;  1SYC A;  1EFW A;  4DR7 Q;  2EY2 A;  1S72 A;  3K7A B;  4YCU A;  4DV7 Q;  3J81 j;  3PF4 A;  1PH5 A;  1BCP C;  4DR7 L;  1XXG A;  4ZLT F;  1CZG A;  2H1E A;  4DK3 C;  1SRO A;  4DV7 L;  1YHB A;  3LGJ A;  4LF5 Q;  3T1Y Q;  2F0F A; 
#chains in the Genus database with same CATH homology
 2XTI A;  3HOY G;  3F2B A;  3CCE A;  2Q2H A;  4LUZ A;  3CXC A;  1Q86 C;  4B3T L;  4A3G H;  4OON A;  5JEA G;  2YV5 A;  4GLV B;  1WCM H;  3JAM i;  2WB1 E;  1UE7 A;  2K14 A;  2VQF L;  5IP9 H;  4BA1 I;  1XMO L;  3T1Y L;  1HNZ L;  1E1T A;  4LF5 L;  2K75 A;  4BXX G;  1Q7Y C;  4DR6 Q;  2I5L X;  2Z0S A;  3L7Z C;  1X54 A;  4LUO A;  2HHH Q;  2UUC Q;  3CCL A;  1HNW Q;  2KEN A;  4IJL A;  4HJ9 A;  4JI5 Q;  1HZ9 A;  1I3Q H;  1PFS A;  3U50 C;  4DR6 L;  3K7U C;  1W2B A;  3CAM A;  4JBJ A;  2ZJR A;  2K52 A;  2UUC L;  2HHH L;  4JI6 Q;  4JI8 Q;  3U4Z A;  4BY1 G;  1HNW L;  2VUM G;  4MTN A;  4JI5 L;  1BBU A;  1IYJ B;  1SLJ A;  3M4Q A;  1PHJ A;  3HOV H;  2IT1 A;  3OYY A;  4Y7N H;  4DUZ Q;  3CME A;  4DV5 Q;  4JI8 L;  1VQL A;  4JI6 L;  3JC6 6;  1X9N A;  1J5E Q;  2ID0 A;  3HOX H;  3NEM A;  2CQO A;  1PH6 A;  3GTQ H;  1Z9F A;  4A3L H;  2KCT A;  4AH6 A;  3GTO H;  4RMF A;  1P16 A;  3L0O A;  2H5X A;  3K81 C;  2YTY A;  5EAY A;  4DUZ L;  2NN6 I;  4DV5 L;  4GOP A;  3RLN A;  4A3J G;  4B3M Q;  2IX1 A;  2VY3 A;  1YNX A;  4GNX B;  1J5E L;  1LYL A;  3NEN A;  3HOZ G;  4A3B G;  2UU9 Q;  3I7F A;  4C3H H;  4A3F G;  1NJI C;  1VQH A;  4L5R C;  4B3M L;  3CC4 A;  1VS0 A;  1WYD A;  2CFM A;  4DV2 Q;  1AE2 A;  3F1Z A;  2D62 A;  4B3R Q;  5C4J H;  2UU9 L;  2JA5 G;  1WJJ A;  1MJE A;  4YHH L;  1Y14 B;  4A4I A;  3PUX A;  3MEF A;  3TS2 A;  1X65 A;  2R93 G;  4YCV A;  2AWO A;  5C4X G;  1JJG A;  4DV2 L;  4XTC S;  2CCZ A;  3HOW G;  2VS1 A;  2IHF A;  1VCI A;  4AIM A;  2WAQ E;  1M90 C;  1CKN A;  2NZH A;  3I4N H;  1K8A C;  2IY5 B;  3KDF A;  4IFD J;  4O0A A;  1VQI A;  3G4S A;  3F2C A;  3PIO A;  1XNQ Q;  3TS0 A;  1KD1 C;  3PUY A;  5H1S E;  1XJV A;  3K7A H;  2YTV A;  3TQY A;  1XPU A;  3H3V I;  1VQD A;  1VQN A;  1E24 A;  2OQ0 A;  3CW2 C;  1XTD A;  2GVB A;  3AFQ A;  5IP7 H;  1XNQ L;  3KLW A;  2RF4 A;  5C3E G;  3OTO Q;  1K8G A;  2AWN A;  1JJ2 A;  3GD7 A;  2Y0S E;  1CKM A;  3K0X A;  3M3Y H;  1I5F A;  5JEA J;  4JBM A;  4HJ5 A;  2AHO B;  4BBR H;  3OTO L;  1NBW A;  5JJL A;  4OO1 G;  5E7N A;  4IFD I;  4HIM A;  4HJ8 A;  4JI1 Q;  4PZ8 A;  2Q2U A;  4R4T A;  2JA9 A;  2VQE Q;  1G6P A;  5GAH C;  4GNX C;  4UY8 C;  1Y1W G;  3GTG H;  5GAD C;  3AEV A;  1JJC B;  1UE6 A;  1WFQ A;  4DV3 Q;  4GN5 A;  3STB D;  4LFA Q;  4JI1 L;  4AQY Q;  1VQ7 A;  2VQE L;  4QQB X;  2HQL A;  1QVF A;  5IYD G;  1Z47 A;  3RLF A;  4A3K G;  2MNA A;  4DAM A;  1IL2 A;  2CWA A;  4KLK A;  3NBH B;  3HFZ B;  4DV3 L;  3GO5 A;  5FLM G;  4GNX A;  4AQY L;  1C7Y A;  4LFA L;  1VQ4 A;  2JA6 G;  3RN2 A;  4P72 A;  5IYB G;  2JE6 I;  2ZM6 Q;  2CKZ B;  1SRU A;  4R4O A;  3UDX A;  3L2P A;  5C44 G;  2ASB A;  3ZJY C;  2C35 B;  2BA0 A;  1HZA A;  3PIP A;  4A76 A;  4EQ5 A;  5ELN A;  3BU2 A;  2ZM6 L;  2A1A A;  3H3V H;  4BA2 I;  4R4Q A;  3HKS A;  1KRT A;  4GOP B;  4P74 A;  1X6O A;  3UDG A;  3CCS A;  1QZH A;  5FLX c;  3FHW A;  2UUB Q;  3FKI G;  2B63 H;  3CPF A;  4LFC Q;  3HKZ G;  4R4C A;  5IT9 c;  1A0I A;  1EIF A;  1TWA H;  2JA7 H;  1EQR A;  4PZ6 A;  2DUD A;  1HR0 Q;  2UUB L;  1RIP A;  3D0F A;  4LFC L;  1I50 H;  3S1M H;  2VW9 A;  2JK8 A;  4H02 A;  1Q46 A;  3A5Z B;  1VQM A;  3TRZ A;  2HIV A;  1I94 Q;  1HR0 L;  2NVY H;  4OX9 Q;  3M9B A;  4GN4 B;  3RLO A;  5M3M H;  1PH1 A;  1I94 L;  3EN2 A;  5ELO A;  5GAE C;  4NXM Q;  4BY7 G;  4JG2 A;  4YY3 Q;  3CCQ A;  4HJA A;  4OX9 L;  1HR0 W;  2E2J H;  4JYA Q;  4L5T A;  1B70 B;  3GTL H;  4LF7 Q;  4TVA B;  3KJO A;  1H95 A;  4NXM L;  4YY3 L;  4AYB G;  1GVP A;  3S16 H;  3PUV A;  4BXX H;  1PVO A;  3CCJ A;  1K83 H;  4JYA L;  1XMQ Q;  3W1B A;  3M4O H;  4P75 A;  4LF7 L;  4DKA C;  2JEB I;  5LMN Q;  4HID A;  1HH2 P;  2ZTD A;  5LMU Q;  1Q81 C;  3A0J A;  3I4O A;  4NXN Q;  3KJP A;  1OXU A;  1XMQ L;  1HJP A;  2EQS A;  1VQ6 A;  1VQJ A;  3SGI A;  1TWF H;  1QVG A;  4BY1 H;  2JEA I;  5LMN L;  4GOP C;  2VUM H;  3S2H H;  3NEL A;  2MFI A;  5LMU L;  2WP8 J;  3PUZ A;  3S1R H;  2QA4 A;  3F8T A;  2KCM A;  4GKJ Q;  4NXN L;  4QY7 A;  2K5N A;  4DAY B;  3IRB A;  1IBM Q;  2MO1 A;  3E9H A;  1U0L A;  4QJF A;  4YWK A;  3I4M H;  3S14 H;  4KHZ A;  5M5X H;  3J80 c;  5LMN W;  1N9W A;  4GKJ L;  1CKO A;  3A5U A;  1IBK Q;  1K9M C;  5IY0 A;  4Y52 H;  4RG1 A;  3PUW A;  3G6E A;  3UDF A;  1PYB A;  4A3B H;  2UXD Q;  3MXN B;  2E2I H;  4GLX A;  4HJ7 A;  4A93 G;  4EX5 A;  1SE8 A;  3HOV G;  4GKK Q;  3TEH B;  4HIO A;  2KHI A;  1Y1V H;  1AH9 A;  3J7Z C;  3RZD H;  3RR5 A;  2UXD L;  2JA5 H;  1XPO A;  4LF8 L;  4A3E G;  4A3C H;  5JJI A;  1EIY B;  4APV A;  4ALP A;  1PH8 A;  1UE5 A;  3RNU A;  2FXQ A;  4LW1 A;  1YHQ A;  4GKK L;  4B3R L;  4QL5 A;  1EOV A;  1L1O B;  3I56 A;  2QGQ A;  3HOW H;  1EWI A;  1LM0 A;  3HOU G;  1RL2 A;  1IBL Q;  4OXP A;  5M3F H;  4DR3 Q;  5M5Y H;  1SMX A;  3I55 A;  2ZJP A;  1G51 A;  3CC7 A;  1EYG A;  1IBL L;  5IYC G;  4C3J H;  3DM3 A;  4DR3 L;  1K73 C;  2E2H H;  3EIV A;  3PO3 G;  4UP8 A;  4DK6 C;  2L15 A;  4X62 Q;  1KC8 C;  1SN8 A;  3OW2 A;  3CMA A;  3GTP H;  4DPG A;  2YYZ A;  3KFU A;  1GO3 E;  2MQH A;  1B7Y B;  3I4N G;  4PZ7 A;  3VDY A;  4A3I G;  4QIW E;  1P8L A;  3U4V A;  1N8R C;  2OTL A;  3PO2 G;  1IXR A;  4P73 A;  4BBS H;  3J80 i;  3GTK H;  4A3D H;  3H0G H;  4LFB Q;  2WB1 G;  1D8L A;  2D0P A;  2R7Z H;  1N32 Q;  4OO1 I;  4IPG A;  4AYB E;  4B3S Q;  2R92 H;  4KI0 A;  1K3R A;  4LFB L;  5HY6 A;  1NE3 A;  2A19 A;  4UP7 A;  1VQK A;  1N32 L;  4X64 Q;  1ASY A;  4B3S L;  2NZO A;  4IPD A;  2K4K A;  3KF8 B;  1TXY A;  2R6G A;  3J81 c;  1ASZ A;  4LF9 Q;  1L1O C;  5IYB H;  4GS3 A;  2UXC Q;  1PYS B;  2EXD A;  4X64 L;  1TWG H;  1E3P A;  5C44 H;  3RN5 A;  2ES2 A;  2E8G A;  4C3I H;  4DV0 Q;  2JA8 H;  5M5W H;  4LF9 L;  2UXC L;  4JC0 A;  4DR2 Q;  4JI4 Q;  1FJG Q;  3G48 A;  1L1O A;  2ZTC A;  2EIF A;  3M7N A;  1Q12 A;  2HT1 A;  1V43 A;  4DV0 L;  1JMC A;  1PH3 A;  4XIG S;  2IHE A;  3GTJ H;  1VQG A;  2ZTE A;  2K5V A;  4DR2 L;  2HIX A;  1YJ9 A;  1QUQ B;  2CWP A;  1CSP A;  3PCO B;  1KQS A;  1HNX Q;  4JI4 L;  1FJG L;  3A74 A;  3BJU A;  4JBK A;  4J15 A;  4PG3 A;  2F52 A;  2JJQ A;  2B29 A;  4LNQ A;  1E22 A;  3I2Z A;  2VL6 A;  1K0R A;  5FJ8 G;  4WJ4 A;  4JCV E;  1HNX L;  2OTJ A;  1U5K A;  2K50 A;  3J7A 5;  1R9T H;  3KOJ A;  1VQ9 A;  5IWA Q;  1QZG A;  1VQP A;  4DR1 Q;  3E0E A;  2R7F A;  1PV4 A;  1N34 Q;  2NVT H;  2WAQ G;  1QVC A;  1MJC A;  1B8A A;  2B3G A;  2JQO A;  2NVQ H;  5IWA L;  4KHP Q;  3AYH B;  2N8N A;  1BVS A;  2E5L Q;  4DR1 L;  1W3S A;  1Q8K A;  3HOY H;  4BY7 H;  1KRS A;  3PGZ A;  3CCU A;  4L5Q A;  4NB3 A;  4KHP L;  1MKH A;  1NY4 A;  4A3M G;  2E5L L;  1YEZ A;  2AKW B;  3STB C;  2UXB Q;  4DV1 Q;  1YIT A;  4GLA C;  3S1N H;  5K36 G;  1O7I A;  3J81 i;  2Y0S G;  1XNR Q;  5AJ3 Q;  1T9H A;  1YHA A;  2MO0 A;  3M4P A;  3G71 A;  1XPR A;  1KXL A;  4TQU S;  4DV1 L;  3B6Y A;  1UEB A;  1PH9 A;  2N78 A;  5M3M G;  3CF5 A;  2F3I A;  4JI3 Q;  1KAW A;  5AJ3 L;  1XNR L;  4P71 A;  4JI2 Q;  4PMW A;  4A3G G;  1I6H H;  1WCM G;  5GAG C;  2Q2I A;  2ATW A;  5IP9 G;  4IOC A;  3S2D H;  4JI0 Q;  4IOA A;  2RCN A;  4LWC A;  4JI3 L;  1MIU A;  1YBY A;  1E1O A;  1C9O A;  4JI2 L;  1X56 A;  4HIK A;  1OXS C;  1UWV A;  1A63 A;  3W1G A;  2ALY B;  1X3F A;  4JI0 L;  4A3J H;  4OWT B;  2N49 A;  4UPA A;  3H15 A;  1IBM L;  1V9P A;  2XGT A;  1NMF A;  1VQE A;  1GM5 A;  3HOZ H;  4DNI A;  3CPW A;  2LSS A;  4A3F H;  1QUQ A;  1IBK L;  4A93 H;  3BZK A;  3WWV A;  4MZ9 A;  4POF A;  3ULJ A;  2QEX A;  2PMZ E;  4JBW A;  3HOX G;  3PSI A;  4A3L G;  1C0A A;  2KHJ A;  3I4M G;  1HZB A;  1TWC H;  3ER0 A;  3ICE A;  4QGU A;  3PV0 A;  1YI2 A;  4A3E H;  5C4X H;  1M1K C;  2BH2 A;  2R93 H;  1OTC A;  5C0X G;  1YVC A;  1S40 A;  1GKH A;  3CCV A;  1VQ8 A;  2A8V A;  3HOU H;  1E7Z A;  1KL9 A;  1VQO A;  1PH2 A;  1VQA A;  1LUZ A;  3HKZ E;  1Q82 C;  2UUA Q;  1L2F A;  2OQK A;  4YHH Q;  5IE8 A;  3T1H Q;  4ME3 A;  2RHS B;  1VQC A;  2WFW A;  2Z6K C;  1Y1V G;  5IYC H;  2PQA B;  3PO3 H;  2UUA L;  5HGQ A;  4A3C G;  2D0O A;  3FP9 A;  3T1H L;  4L5S A;  3E9I A;  5C3E H;  4DV6 Q;  4JOI C;  3S17 H;  2I5M X;  1N33 Q;  3KF6 A;  4X62 L;  3U58 A;  2Z6K A;  1PH4 A;  3ERS X;  5M3F G;  2RHQ B;  1VQF A;  4A3I H;  4JI7 Q;  4UP9 A;  4DV6 L;  3D31 A;  3S1Q H;  1N33 L;  3PO2 H;  1D7Q A;  1FL0 A;  4JOI A;  1G29 1;  4YCW A;  2LXJ A;  3EBE A;  3K8A A;  3Q8D A;  4JI7 L;  1FVI A;  1Q1E A;  1WOC A;  4GN3 B;  3TRE A;  1CSQ A;  4MNO A;  5IP7 G;  3M85 A;  1Y1W H;  2BH8 A;  4LUV A;  1GD7 A;  4C2M H;  1EQQ A;  2F4V Q;  4DUY Q;  4OWW B;  1OXX K;  5GQO A;  3S15 H;  1WI5 A;  3KYH C;  1KIX A;  3GDE A;  1DGS A;  1LTL A;  1PH7 A;  2Q2T A;  5IYD H;  2LXK A;  4A3K H;  2NN6 G;  2DGY A;  4BBR G;  4DR4 Q;  2F4V L;  3ULL A;  1SFO H;  4DUY L;  5FLM H;  1IZ6 A;  3F2D A;  2JA6 H;  4BBS G;  2N3S A;  4K0K Q;  4NPS A;  4WJ3 M;  4R1J A;  2PI2 E;  4A3D G;  1A8V A;  1NMG A;  1UE1 A;  3H0G G;  2ZJQ A;  2V1C C;  5DLQ E;  4DR4 L;  1JE5 A;  2R7Z G;  1X55 A;  3AQQ A;  2NVX H;  3CQZ H;  4K0K L;  1FGU A;  1HZC A;  1L0W A;  2YU9 H;  2R92 G;  1AE3 A;  1J6Q A;  1JB7 A;  4DR5 Q;  3BZC A;  3JAM c;  1V1Q A;  4R4I A;  4YWL A;  1PA6 A;  3FKI H;  3CCR A;  4DV4 Q;  1EUJ A;  1NTG A;  2OCE A;  5J3B A;  4DR5 L;  4O2D A;  3CCM A;  4X66 Q;  2AMC B;  3S24 A;  2I0Q A;  4LF6 Q;  3CD6 A;  5GRO A;  1YJN A;  3CP0 A;  5C0X J;  1JT8 A;  1VQB A;  1A62 A;  2PQA A;  2KBN A;  3AFP A;  5FJ8 H;  4DV4 L;  4A75 A;  3UDI A;  2JA8 G;  4JV5 Q;  2YTX A;  4IO9 A;  3RZO H;  2GN5 A;  4X6A H;  4X66 L;  4IPC A;  4LF6 L;  2I5H A;  3UE0 A;  4X65 Q;  4FDB A;  1X3E A;  2K5H A;  3UE1 A;  1N36 Q;  1X3G A;  1BBW A;  5JJK A;  4JV5 L;  2IX0 A;  3K80 C;  1YZ6 A;  2B63 G;  1KHI A;  2R7D A;  4IPH A;  1OXV A;  1SR3 A;  1N34 L;  4X65 L;  1EFW A;  3GTM H;  3ULP A;  4DR7 Q;  2JA7 G;  2GVA A;  1N36 L;  1S72 A;  2PI2 A;  4IJH A;  4LF8 Q;  5BR8 Q;  4YCU A;  1YJW A;  4LF4 Q;  4IFD G;  1BKB A;  2VZA A;  4OWX B;  3W5O A;  3J81 j;  1CUK A;  4DV7 Q;  2OWO A;  1PH5 A;  3PF4 A;  4DR7 L;  2PNH A;  4A3M H;  3PF5 A;  5C0X I;  5BR8 L;  1OXT A;  4DK3 C;  1YIJ A;  3KF6 B;  4LF4 L;  1SRO A;  1Q1B A;  4DV7 L;  1YHB A;  3LGJ A;  3CC2 A;  2VNU D;  1CKN B;  4YWM A;  1VQ5 A;  2UXB L;  4B3T Q;  3KDF B;  2VQF Q;  3DLL A;  1TWH H;  1S3O A;  1XMO Q;  4LF5 Q;  1HNZ Q;  4POG A;  3T1Y Q;  2BA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...