1MBYA

Murine sak polo domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
75
structure length
75
Chain Sequence
SVFVKNVGWATQLTSGAVWVQFNDGSQLVMQAGVSSISYTSPDGQTTRYGENEKLPEYIKQKLQLLSSILLMFSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords serine/threonine kinase
publication title The Sak polo-box comprises a structural domain sufficient for mitotic subcellular localization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 11
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2002-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.930 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1mbyA00
1MBYA 5LHY1
chains in the Genus database with same CATH superfamily
1TY0A 4NW2A 3K5OA 3TZDA 2WV6D 2JN4A 4HCEA 3KF6B 2F0DA 2PQAB 3J7ZC 5I9OA 3RUZA 4JI2Q 1WVLA 1DD2A 3STBC 2UUBQ 3S2DB 2G9HD 4K2KA 2EYMA 1BR9A 3NBHB 2DN8A 1B44D 3EJIA 4QCLA 3T51B 4CBVA 1AZPA 1Z7TA 2MO0A 4DV1Q 4KN7C 4O1NA 4MHEA 5D65A 3DLLA 3CRLC 1PZJD 4C3JG 1VQ4A 1ENCA 2AWOA 3RLFA 1SMXA 1A62A 1F9RA 3I4NG 3QJYA 2G5DA 3NTKA 4YHHQ 1V1QA 1S72A 1HPCA 2OF1A 1F77A 4DR5L 5F2DA 1X3QA 4KJNA 1A63A 3I55A 4B3RQ 3HOUG 2NTTA 1KLUD 3CCVA 5KEEA 2GVBA 1T5EA 4A3GH 3BDOA 4DNIA 4F87A 3PF5A 2B3GA 1JWMD 1PXUA 1P16A 3T1HL 1O80A 2EXDA 3EBEA 1BO0A 4ODGA 4GKKQ 5JJZA 5CV9A 5KNDA 1XWEA 2RQXA 2K5QA 2F0LA 4LFBL 3A5UA 4F8MA 2JJQA 3A7LA 3OMGA 3SK4A 2Q8TA 4TQUS 1ICWA 2K1BA 1I4XA 4A3JB 2HT1A 4DR4Q 4QMGA 1EQRA 3M3YB 3DWAA 4DUZL 1LV9A 2G9DA 4JI4Q 1SYDA 2VQFQ 2XNAC 4A3GB 4DV3Q 1X32A 5AJ3Q 1Q1EA 1FJGQ 1H9JA 2VW9A 1ET9A 3EFXD 4JI2L 5C6AA 2UUBL 4ZCKA 3TBIB 4QB4A 4LAAA 2HHHQ 2VS1A 4ME5A 2YTYA 1XPOA 1S5DD 4R8IA 4ME3A 4DV1L 1BBWA 3M9BA 4K5WA 3X3NA 2A8VA 3HOYG 2OQ0A 2Y0SE 1PH2A 1B4OA 4IJLA 3D4WA 4NXNL 3VYUA 1B70B 5NUCA 2K04A 4C3IH 1I50H 4XQJA 2MO1A 1I4GA 1BXTA 1IW7C 4DFAA 4YHHL 5M5YH 2B2VC 4WFN3 2WIIB 3OIQA 3AEVA 1SMYD 5GADC 3TP5A 2KUMA 4B3RL 5IYBH 4DGZA 4P73A 4R9WA 3I4OA 4DR7Q 3ND8A 4DV2Q 2MP1A 1A0IA 3I4MH 4NXMQ 4I7ZC 5M3MB 5ELEA 3D8GA 1TIID 1SJHD 5LMNQ 2DGYA 4HTHA 2K5WA 3QG1A 3HKZB 1PFBA 3DM3A 4C1NI 1CZWA 3NTIA 4DNTB 2A68D 1V8QA 5DM63 1CHPD 4C3IB 4KKSA 1SNQA 2GA4B 3VR6A 3H6MA 4BA1I 1GUSA 3K7UC 3UE0A 2EIFA 5EPKA 4GKJQ 4DR4L 2M2LA 2PMZB 3U9OA 2E75C 3I56A 1TS5A 3U58A 4PMBA 1MJCA 2F4IA 3GP7A 4BBRG 4CKBA 4JI4L 4IALA 4CKCA 2L11A 4JI0L 4HEDA 3I4MB 2NVYH 5IE8A 1L0YB 2Z6KC 4CKEA 1ESRA 2D2CC 5AJ3L 3S16H 2V1CC 4G4KA 5JEAG 4HIKA 2ZT9C 1STEA 1VQAA 5IT9L 2HCCA 2K52A 2HHHL 3DWQA 1GUGA 1QVCA 5I6WA 2B2YA 5FJ8H 2L12A 5LMUQ 1YJNA 4LF9Q 1Y1WG 4IJHA 3HOWB 3CHBD 4LUOA 5KNCA 3E0EA 5GAHC 3I73A 5LHY1 1OXSC 3MEHA 3BU2A 2YU9B 5H1SE 3CCMA 4X62Q 2VZAA 3T16A 4CDFC 1HTLD 1TS4A 2IT1A 2UUCL 3V96A 4IUUA 4BY1H 1EYAA 3S16B 1G6PA 2R7ZB 4HJ8A 2K5DA 4A3FG 1I6VC 2DY8A 1UE1A 4DR7L 3D4DA 3JC66 4DV2L 1JORA 3MEFA 4ZKCB 3A74A 3J7A5 1O78A 1EQQA 1SYGA 4K8JA 4NXML 5IP7H 4FF3A 4N8X1 3AB9A 3IFDA 4H13C 4BY7G 4B3SQ 5LMNL 3BS1A 4QGUA 2EY2A 3CW2C 3KK7A 1EQTA 4XT3B 2MGSA 2R7DA 4DV0L 1PTOB 3Q0AA 4H02A 4OELB 2SDFA 3QOLA 1EY0A 1SYCA 2RVLA 3C46A 4GKJL 1NTGA 1OXVA 4RH6A 1AN8A 2EZVA 5CORA 3EROA 4JCVE 2K14A 3QO2A 3URYA 2E2IB 3ZJYC 3D6CA 2VQEQ 2HIVA 1CK1A 1RIPA 4YCVA 3ONAB 1JT8A 4G7ZC 3LWUA 3RN2A 3PO2H 2Z9HA 2EYPA 3EVQA 3TS0A 4HJAA 4CGYB 1SN8A 4DUYQ 4P2CB 5C0XI 4LWCA 1RDPD 1YIJA 4OXPA 1Q3LA 2IWHA 3A55A 5LMUL 3CPWA 4C3HG 4LF9L 2BCOA 5ELOA 2OTJA 2J4XA 5FLXL 2FFKB 2PCFB 4LK1C 2IY5B 1HNWQ 3TRZA 4X62L 2CQOA 3TMEA 5HGTA 2Z4IA 3D6WA 2A68C 3CCRA 4HIMA 4UY8C 4PG3A 5DLQE 3PO2B 3NBIA 4DV4Q 1HCZA 3MFYA 4LFCQ 4A3BH 2EYLA 2PO4A 3GV3A 1VQ5A 1ZKOA 3OWEB 1QZHA 4GLVB 3SGIA 3LWEA 4K8IA 3H15A 1G2SA 1Y8OB 4B3SL 1NUCA 1O7LA 2LFNA 1BNZA 3W1GA 4YWKA 3TREA 2JA6H 3GTQH 4IUTA 3G4SA 3ERSX 3DM1A 4FP5D 1KDCA 1G8ZD 1N34Q 3KLRA 3S1QH 4N8FA 3AMUA 2Z8LA 1XPUA 3F1ZA 3PF4A 2AMCB 2B2WC 4IFDI 5FO7B 1KABA 4UP9A 3HOXH 5C44B 1ENAA 5FK9C 1PH8A 4A3BB 2VUMG 1E1OA 2F0NA 1J8IA 1JB3A 1B7YB 4RA8A 4OIKA 3W3AA 2D9UA 2VQEL 4JYAQ 3K5MA 3VYSA 1YHQA 5HGQA 4L5QA 2N3SA 3VYTA 3GTQB 4YWLA 2HCIA 4XTCS 4WORA 1PH3A 5E3FA 1X56A 3S1QB 4DA2A 1XTCD 1NBWA 1K83H 2KECA 4LF6Q 4G7HC 1CZGA 3UI2A 1RTOA 1HNWL 3ULPA 3HOXB 4JG2A 4RGNA 2AQ1B 3JAML 2CH4W 1A3VA 2WB1B 3P20A 3CQZH 4R4TA 2RBMA 2PZTA 1KC8C 1F2ZA 5CV4A 2YV5A 3FKIG 2RSNA 3K0YA 4DV4L 2K6AA 2B63G 4LFCL 1MBYA 3NE5B 2JQOA 3K6OA 2OCEA 1K28A 4MTNA 2PQEA 1GUNA 3P1HA 4QIWB 3WWVA 1QUQA 4UHVA 1DOKA 1QJOA 2I5LX 2AQ2B 2O4XA 1GM5A 1HZBA 1N34L 1I6HH 3CQZB 2Y0SG 1RL2A 2F0UA 5BN4A 3PUWA 2QW7A 4GN4B 3KFUA 4DR3Q 3R3OA 2JA5G 2R92G 2B2TA 1A3UA 3Q8DA 1K3RA 4JI5Q 4A3IG 3BYTB 2AHOB 1PRTF 5HURA 1BDOA 4CHTB 4K6LA 4JYAL 1Q82C 4H7BA 2MUYA 1ESFA 1YNNC 2Q2IA 4B9XA 1PH4A 2XWJB 3P7JA 2F0IA 2FMCA 5C4XG 3SHLA 1Y1VH 1ILQA 2VB3X 5C4JH 3HOZG 1CI3M 3EN2A 1CQVA 4NPSA 1PH1A 1AP0A 1FNWA 4LF6L 2OTLA 1M4VA 3MZ5A 3OW7A 1WD0A 1RKNA 2N49A 1EY6A 3PO3H 4APVA 1X9NA 1FGBD 1XMQQ 1YI2A 1WCMH 2ZJRA 4PNYA 3CC2A 3C3LA 5JJLA 3NTHA 4IQZA 3I7FA 1BVSA 3BYYB 1U9RA 5ELFA 5IOCA 4L5RC 1SYFA 4DAMA 1QNUA 3E5SA 5C4JB 4KHPQ 5M5WH 5KYLA 2JA8G 3CP0A 1H9SA 4P71A 3QR8A 4A93H 1D6EC 3STBD 1B9NA 3SDZA 2DNCA 3PO3B 1KTKA 1YZ6A 3L2PA 1HTPA 1KL9A 1WCMB 2X6GA 5D3IB 1CFMA 4DR3L 1SE8A 2NBFA 1KAWA 4HCSA 4X3SA 3G71A 3K8AA 4JI5L 3Q22A 2YTVA 3QOJA 2CH4A 4GOPA 1KNAA 1CKMA 5M5WB 4HJ7A 1K8OA 5IYCG 4X65Q 4L5SA 4A93B 4Q0FA 4IFDH 3RZOB 1JR0D 3FMCA 4YCUA 4A3DB 2E2HH 3ERQA 2TMPA 1UE6A 3KDFA 3UE1A 1HA5A 2B8GA 2WFWA 3CCJA 2A5HA 1UAPA 3RR5A 4P74A 1PH6A 1TXYA 4OHJA 2DNEA 1EY9A 1XMQL 1NE3A 4XIGS 1RD9D 3K58A 3CMAA 4O0AA 3S17H 1U4LA 1VQKA 2N55A 1PTOD 3H0GH 2F0TA 4LFAQ 2CWPA 2ES2A 2F0FA 2CW0C 4XDXA 5JJKA 2AUJD 2OQKA 2F0JA 3I70A 1EY8A 4RCNA 4DAYB 2PZUA 2SNMA 3V05A 3J80E 2D0PA 4KHPL 1JE4A 3TZUA 2E8GA 1SE3A 2O2LD 1TS3A 1EY4A 1TY2A 5IGDA 1EEID 1KXLA 1M90C 1TWFH 3TN2A 4IPCA 3MAQA 4A3MH 2HD3A 4H44C 1KNEA 3S17B 4QY7A 1XNQQ 1VQMA 3CF5A 2EXZA 1SLJA 3DHQA 4KN4C 4FXKC 3RN5A 3RLNA 1TVXA 3S2DH 3UDIA 2F0EA 2A6HC 2F0OA 2B39A 1XXGA 4J15A 4LW1A 1SROA 1E1TA 1R9TH 3ND9A 1QILA 2WAQE 2K75A 1Q46A 3R2IA 4KTAA 1R4QB 2B2UC 1HFGA 3OTOQ 1TWFB 3I91A 2EY6A 1L1OA 4BXXH 1KD1C 1PA6A 2R3ZA 4A3MB 3NQIA 3LNNA 1IL8A 2IJ0A 3CD6A 1G51A 3LGJA 3PUZA 3T13A 5I4DA 4WJ3M 4B3MQ 4HR7B 3NP8A 2IW3A 2VXWA 3KJPA 2UUAQ 1FNVA 3FP9A 1VQ6A 4JBMA 4POGA 4BS9A 4QF4A 1S5BD 3D0FA 4YY3Q 1WFQA 1R9TB 1KQSA 2JA7G 2QF7A 1PZKD 3S24A 4LFAL 2JXMB 2NZHA 2EYFA 1BOSA 4Y7NH 4ZYSA 4CDEC 1V1PB 3BJUA 1YVCA 3P75A 3NHHA 3NWTA 1DJRD 1VQEA 3GTPH 1X6OA 1TWCH 1AE2A 2KQ3A 4GLAC 4IUNA 3HOVH 3F2UA 1NNXA 4A3JH 3CKIB 3M3YH 2F4VQ 4E6IA 3GTOB 4JBJA 1HZCA 3VA5A 3J81c 2H4OA 1X65A 1JJGA 1D1IA 4K5VA 5M3FB 1XNQL 2PNRC 3A0JA 4Y7NB 1CKNA 2IHFA 4GN5A 4M1UB 3FEWX 2O5IC 3GTPB 1AE3A 5KIXA 1TWCB 2SNSA 1EY5A 2F0QA 4QL5A 3HOVB 1EU3A 1OO9B 2Q2TA 3OTOL 4OWTB 1AW7A 1C4QA 3CC7A 2Z0SA 1L2FA 1PTOC 1GUTA 1HH2P 1B53A 1K73C 1G2TA 4ILWA 2R61A 3I4NH 3ULJA 3IFTA 2EY1A 3TP8A 3GTGH 3CAMA 1Q1BA 2K50A 4B3ML 2EVBA 2UUAL 3H3VI 4K14A 4PQXA 4RGMA 4JI3Q 2F52A 2Z6BA 1C8CA 3J81i 5FLMH 4YY3L 1N33Q 1QUQB 1PH7A 1VF5C 4UP8A 1DONA 5M3MH 4F88A 1B3QA 1H95A 4RGTA 1WTWA 4DK0A 4IOAA 3RZDB 4FF1A 1PV4A 4MN3A 1KRSA 4FVMA 3PQIA 2IX3A 2KHJA 2XN9C 4C3JB 2LS01 4HN7A 3K80C 1ICFB 4N9TA 3I4NB 5I6YA 2VL6A 4DK6C 4RGOS 2NVQH 4EQ5A 3GTGB 4GLXA 2IPKD 1SE2A 5D3DA 1IYJB 2C5CA 2BH2A 5CV7A 5DEHA 3LX0A 1OXTA 2F4VL 5EBCA 1WTVA 1EEFD 1VQLA 3HOUB 1Y8NB 5A35A 3ICEA 1ZXTA 2D0OA 2PI2E 3AQQA 1BQQT 2XVSA 3PGZA 2MPMA 5IYDH 1T5XD 1TU2B 5IGFA 3VA7A 2F1MA 1IBMQ 5J1ZA 1LTID 1VMCA 4AYBE 4GKKL 1TWAH 3G48A 4P72A 2NVQB 4IUPA 1IKLA 3H3VC 3HOYH 3HOWH 1OXUA 3WOFA 2ID0A 1VQFA 3VR3A 2YU9H 3IL8A 2NVTH 4R4CA 4FYDA 4AQYQ 1IBKQ 3CC4A 2VQFL 2RHQB 4DV3L 1S3OA 2WP8J 2R7ZH 1FJGL 3CU7A 3QWNA 4LF5Q 3HS0C 4BY1G 5GQOA 4JI3L 3M85A 5K36G 5A2QE 1A15A 2JE6I 1EWIA 4OO1G 3M4OH 3CCLA 1N33L 1KLGD 1TWAB 1Z6HA 3BZKA 2DJFC 2K5HA 5CV8A 4JOIA 5IP7G 3HZXA 3IRBA 3HOYB 2CVRA 4UPAA 1XMOQ 4GNXA 4RG1A 2PI2A 5ELCA 2XWBB 4A3KG 1CT1D 2D5DA 2NVTB 2E76C 1PTOH 2F0MA 2ENBA 3NQTA 1CSQA 1SNOA 3Q24A 3HEJA 1U5KA 2WACA 2EOTA 1JICA 1TWHB 5T1IA 3MXNA 4NB3A 1RCVD 2E2IH 4BBRH 3M4OB 4A3CH 1HR0Q 5C3EG 2CQAA 3GDEA 4K2LA 1DOLA 4DAPA 1SDFA 3QB3A 3I8ZA 4OONA 3KF8B 2KENA 1EIYB 4OEMB 1DZ1A 1LTGD 4RHRA 1IBML 1EY7A 1SNMA 2X69A 2BDNA 4BWGB 1DCZA 3KYHC 1U4RA 4DF7A 4OWWB 5IT9c 2QDLA 1Q12A 1GHKA 1SAPA 4KKTA 2BA0A 2EDGA 1F2YA 4AQYL 1IBKL 4BBRB 2L4NA 1BUVT 2FHTA 1UE7A 1BBUA 4POFA 1NCVA 2E2DC 4KHVA 4LF5L 1Q8KA 4A3FH 3K81C 2Q2UA 2KJXA 3WDNA 5I2XA 1VDZA 4ID6A 1J5EQ 3FVQA 4DR1Q 1CKOA 1S4ZA 3A7AB 1TQOA 1HJPA 3I2ZA 2QEXA 1HQMC 1J6QA 1QVFA 1W2BA 1Y1WB 5E4XA 2WKCA 1XMOL 1RHPA 3H3VH 2WAQG 2ALYB 3TQYA 1A8VA 1YNND 2JA6G 4K5XA 1Z9FA 1CSPA 1FD7D 1E0BA 1S5CD 2RKSA 4AH6A 2L9HA 2FINB 3VYRA 3W5OA 3PMFA 3G7LA 2K5NA 1QOHA 1BCPC 5JAVA 2OT2A 5C0XJ 3L0OA 5LL6S 4A4IA 5C44H 4YCWA 4A3FB 4EGVA 3EQLC 2JP1A 1GKHA 3D31A 2QILA 1BF4A 1LT3D 2NZ1D 1HR0L 1STAA 1X55A 1O7YA 3M7NA 4BY7B 1E2WA 2CHBD 4EQOA 2ATWA 5LL6X 3PCOB 1L1OB 5EJWA 5BN3A 1EWCA 1HNXQ 4DNRB 4KKUA 4CDDC 2PQAA 1X3GA 4HMIA 2A19A 2SOBA 4LUZA 2EYOA 4ABNA 4GS3A 4B9WA 5C4HA 2CKZB 4C3HH 4XQQA 3NBHA 4R4QA 2ZM6Q 2A1AA 4C1NK 4ZK9B 2LMCB 3EIVA 1QG7A 1EFID 2TSSA 4HIOA 5FLXc 2JEAI 1I4RA 1ASYA 1SBBB 4NP5A 4X64Q 4QQBX 1J5EL 4DUYL 4NKLA 2B2YC 2IL8A 3W2DA 3V2TA 3HP3A 1SNDA 4OWXB 2Q8RE 4IFDJ 3I90A 1VQCA 4C3HB 4FF4A 3E6ZX 4JI1Q 5IY0A 1PHJA 3SR1A 4FXDA 4UAIA 4JBKA 2KEEA 3MVVA 2H1EA 1C48A 2JK8A 2O5JC 2EJGC 3PUXA 5IGBA 1AEXA 1EOVA 2ZTCA 1QCBD 5D14A 3SK6A 3J80L 1SYEA 2A6ED 1BKBA 1VQJA 1CKNB 1L0XB 5IT9E 4CJ2C 1LM0A 4DPGA 1OTCA 1G6ZA 1ML0D 4JK1C 1GUOA 4V190 3S14B 2EYJA 3HKZE 1Y69U 4IN3A 1XNRQ 3T53B 2NWGA 1GOZA 2LKVA 1HNXL 3K0XA 1SNCA 1VQNA 3CRKC 3I4LA 4WRDA 2B8FA 1KRTA 1BBXC 1P8LA 1H9RA 2FXQA 2CW0D 1HR0W 1FYCA 1Y1VG 1MI2A 2I46A 1HA6A 1MD2D 1S5ED 1HZ9A 4MTKA 2PMZE 2ZM6L 4PZ6A 4A3EG 2VUMB 5GROA 2K33A 2QCPX 3FKIH 4IPDA 4X64L 4DV5Q 1LTTD 4ALPA 1VQGA 3JAMc 2ICIA 2PYKA 2B63H 4BBSG 4JI7Q 3CCQA 3MC0B 3PUYA 2IX0A 3MXGA 1ONLA 4R4IA 4X3UA 2I07B 3OMCA 4AYBG 3BVMA 5EBDA 3F2CA 2A6HD 2QEJC 5IP9G 1BCPB 5C0XH 2A74C 2K32A 4X6AH 2NN6G 4KMUC 1YBYA 1F2LA 1Y8PB 1B3AA 3FKIB 1JOKA 4TKOB 4DV6Q 5IGCA 2JA5H 5JVH3 5BR8Q 2R92H 2UXBQ 2B63B 1D8LA 2J7ZA 4A3IH 3OIPA 1SJED 4BA2I 2F0PA 2NVXB 1T9HA 2I5HA 3DEOA 4L63B 1K8GA 1JOOA 2KBNA 4HAEA 1ZYRC 3KLSA 5CV5A 1E22A 4R4OA 4DN4M 5CGKA 4YIJA 3RZOH 3K5LA 1XNRL 1HUNA 3TP7A 2CWAA 4A3DH 1OXXK 2FJ2A 4I7AA 1H9MA 2L1BA 3J7AF 1UNSA 4DXGA 4A3LH 3T1YQ 1ASZA 2Y0SB 4KV6A 1EIHA 2VNUD 4KY6A 2IX1A 1JOQA 2Q8IB 5E1FA 2K7VA 4B3TQ 2JA5B 1I4PA 4L8JA 4IURA 2R92B 3GTJB 2UU9Q 4A3IB 2R93G 2C9OA 3KLWA 4J8QA 1HUMA 4DV5L 2ZTDA 4DV7Q 1Z47A 4DAVA 3MFGA 2NTSA 3H0GG 3U4VA 4K0KQ 4JI7L 2DY7A 2A6EC 1B9MA 5C4XB 1GHJA 3MXPA 4HIDA 3HOZB 1I4HA 2BE5C 2JA8H 4CJ0B 2CFMA 4TRDA 2XRSD 1PMRA 4PZ8A 4EQNA 1CHQD 1PYSB 3K57A 1LACA 3BDCA 4S3SA 1WTOA 1GJXA 4U673 1XPRA 2DUDA 2LY7A 4DV6L 2F0SA 5BR8L 1PVOA 2UXBL 2NZOA 5C4ZA 4DXFA 1VQ9A 1L0WA 5M9OA 3PUVA 4H0LC 2EQSA 1U4PA 1N8RC 1B50A 3BVZA 3MWYW 1NR4A 3R8BA 4DKAC 1IHZA 2BDOA 2JA8B 3DXJC 5EPJA 1WTHA 1XX8A 1I5FA 1VCIA 1A3TA 3RMHA 1X3PA 1LUZA 3A8IE 3A8JE 2B2TC 1UEAB 1NJIC 3F2DA 5CBAE 1X3FA 4B3TL 4G57A 1JCKB 1FGUA 5G3LD 3KUPA 1KAAA 3KLSX 2UU9L 1LT4D 4UP7A 1QE6A 2B2VA 5L37A 3S1MH 3S9WA 4X65L 1G91A 3NUCA 4PV1C 1SFOB 4IUQA 3RNUA 2LXKA 5IODA 4KHZA 2R6GA 3T4AC 4P75A 4ZKBB 1LTAD 5ELDA 4PMCA 1M8AA 3C2PA 2Z1CA 1DOMA 1O7ZA 1JB7A 3M4YA 3SK5A 2WB1E 1LT5D 3GTOH 4A3JG 4LUVA 4ZRZA 3R93A 5EPLA 3GD7A 1F9PA 2RDHA 2BOSA 1SXTA 2E5LQ 2PW5A 3S1MB 1UUPA 2BH8A 1X3EA 5M3FH 4JBWA 3K59A 2R7FA 2M00A 4RMFA 4A3GG 3BZCA 2CCZA 5ISRA 4Q5VA 5IGEA 5IIFA 1B1ZA 1EUJA 5AFWA 1K0RA 4Z9CB 1HFNA 2Z6KA 1STGA 2KOLA 3CPFA 1YHAA 4GN3B 4QIWE 5GAGC 1Y14B 1IZ6A 2JSOA 2V4DA 2F0HA 5CYUA 2KEDA 4IUVA 1C7YA 4OO1I 3HGBA 1M1KC 4NXNQ 1B8AA 4EQPA 4RCOA 2F3WA 1D7QA 2XRQD 4GOPC 1KIXA 2P5ZX 1WTPA 3C1FA 1H9KA 3N6RA 1ZEQX 1VQIA 5KRUA 2JEBI 2NYZD 2RDFA 3DWPA 1U0LA 4ZAIA 5JEAJ 3PV0A 5FLMG 4GZYC 4C2MH 4KK7A 2JA7H 2BA1A 3RZDH 5M3MG 1D1KA 5K5PA 1K8AC 3SVMA 2F3VA 3HKZG 1FVIA 3DEPA 4C3JH 2ASBA 4YWMA 2WINB 4EVOA 3DUZA 2AQ3B 3CMEA 1VQ8A 2F03A 1QWYA 3M4PA 4C3IG 5JVG3 2FMMA 2NB0A 2KA7A 3HOUH 2F0GA 4V0BA 2WKDA 5IYBG 5IGGA 2E5LL 2ZXOA 5EQ0A 3I4MG 5DNFA 1NY4A 4C2MB 2JA7B 2F3IA 3NEMA 4JI0Q 1LT6D 1D2BA 2EY5A 2LSSA 1LLRD 5IYDG 2K03A 1A6XA 3UDXA 2XTIA 3I72A 3O13A 4LNQA 1YNJC 1SR3A 1EYCA 3NPPA 1VQPA 4I65A 4JW0A 3NXWA 4N9PA 1N9WA 1NSNS 5JJIA 1QNKA 4O42A 1DM0B 3HOWG 3UDGA 1XTDA 2L5TA 1QZGA 3F2BA 1A2TA 2RCFA 2QA4A 2NUCA 4G7OC 1GO3E 4RAUC 3MXUA 1NMGA 2UUCQ 1MKHA 2R7ZG 4JC0A 4DU9A 3M4QA 3MTSA 4RFBA 1EWHA 1EOTA 1BCPD 1CA6A 4HSVA 1MGSA 2HDLA 3ZYYX 1PRTC 1PYBA 1TWGH 1IYVA 1J9OA 1L1OC 5FJ8G 5ELBA 3GTMH 3K5NA 1LTBD 2KCMA 2RCNA 5GAEC 1PDQA 1UWVA 2E74C 4L5TA 1YITA 1TKWB 2HIXA 1D5MC 4TSSA 4DV0Q 1JQYD 1I50B 3MA2B 4X3TA 4DR6Q 1FNUA 3RLOA 1TWHH 1Q86C 5M5YB 1IKMA 1B2TA 1LTSD 2MNAA 3MHBA 1KDAA 4HJ5A 2EYHA 2B2WA 1H9SB 1TR5A 4R1JA 5KYIA 2KCTA 5CMDA 1TWGB 4X3KA 3J81E 3L7ZC 3CCSA 4A3CG 1CTMA 2RF4A 3GTMB 2F0VA 4OGQC 3X3MA 1IYUA 1I3QH 4XYOA 3L9AX 1EL0A 2KHIA 1VQOA 1XJVA 3NENA 4LJZC 3D4RA 4GOPB 1VF7A 1MIUA 2PW7A 2YTXA 3A54A 3TSSA 1HRJA 3BVGA 3IAYA 4CDCC 2L15A 2QDBA 2OWOA 2NVYB 5JEAH 5CV6A 1VQ7A 3KDFB 4KJOA 1YJWA 3PO2G 1NMFA 1STHA 3TP6A 1VQBA 4KD3A 5J22A 3CCEA 5K36H 1EYDA 5J39A 1I3QB 3H91A 4OO1H 5JOBA 2C35B 1VQDA 1Y1WH 2UXCQ 2D62A 2XIWA 5C3WA 2F0KA 3D3RA 4ULLA 2EJMA 4DR2Q 1VMPA 5I9PA 2EJFC 4A3KH 3A56A 1R4PB 3KOJA 1EU4A 1PLFA 4IPGA 3J81j 3PIO3 1NR2A 3B6YA 2EPBA 4KI0A 4XT1B 2OXPA 1I94Q 4DR6L 4DAYA 4CJ1B 1HHVA 1RTNA 4BY1B 5M5XH 1CUKA 5C44G 1E7ZA 4A3BG 1JWSD 1VS0A 4JI8Q 2QKIC 2SEBD 4LF4Q 3SEBA 5C3EH 4BY7H 1Q81C 3FRPB 3E3XA 3EA6A 3S1NH 1UE5A 4JI6Q 4A3KB 5EKIA 2YYZA 1E24A 2Z4HA 1SMYC 5C3XA 3G6EA 1HNZQ 1Q7YC 1EQVA 3SXHA 1TT2A 4OL7A 5DAUA 4XYQA 5E4WC 3S1RH 2N78A 1E3PA 5M5XB 1SEBD 3HOXG 4KLKA 3Q23A 4PZ7A 2WB1G 1PFNA 1PH9A 3R2TA 5DM73 1U4MA 5C3EB 1DGSA 1PRTB 1KDBA 3KJOA 1JWUD 1PH5A 1K0SA 1D5XC 1WTRA 3FPPA 2RHSB 4MZ9A 3S15H 1C9OA 2HUGA 3KF6A 3UDFA 1WTQA 3S1NB 3HKSA 2F0WA 1G291 4KY5A 2ZJQA 1WD1A 2NN6I 1E2ZA 1STBA 2UXCL 1Q90A 2K01A 1DYQA 2XGTA 1STNA 3VDYA 4WJWA 4JVZA 4DR2L 3S1RB 1LABA 1ZYRD 1X54A 4RKBA 2E2JH 3CCUA 2AWNA 3GQBA 1EIFA 4O2DA 2KHSA 1V1PA 1I94L 4UDUC 4ZUJA 3HFZB 3ITPA 5EKKA 3K7AH 3GTLH 3F8TA 4DK1A 5LMNW 3S15B 4DR1L 5EAYA 4QUCA 2VY3A 1FL0A 1GD7A 3OPOA 4JOIC 4JI8L 4LF4L 4GNXC 3W1BA 1O7IA 3NK9A 3S14H 5FO8B 4IO9A 4HSPA 5C5LA 2K05A 4KY7A 2WAQB 1PTOF 4JI6L 1EYGA 1N32Q 4RHSA 1MSHA 4L6TB 4LF7Q 4A76A 2JA6B 1ET6A 2E2JB 5JPNC 1CQFA 3AYHB 3VR4A 1WOCA 1PZID 3TS2A 1HNZL 5IWAQ 4C56C 3G6JB 2K4KA 4K6DA 3KBXA 3E9HA 3K7AB 2I5MX 5EKLA 3GTLB 2ICEC 4MNOA 2K5VA 2VUMH 1WTXA 3I3CA 2BE5D 3PIP3 3C1EA 1DXMA 5CBEE 2AUKA 1EIGA 2KCCA 1W6JA 3TEHB 1VQHA 2X6LA 3SE0A 4IOCA 4X66Q 5G3LF 3BG3A 1UEBA 1E2VA 4DK3C 2KVMA 3OWFA 1LTLA 4NDXA 5TSSA 1K83B 1LYLA 2QGQA 1SSOA 2LXJA 5EGTA 1YNXA 3PO3G 5C0XG 2OEOA 1GVPA 1K8MA 1WCMG 2GVAA 1HQRD 2GN5A 2Q2HA 4EX5A 3H94A 3HG9A 3NELA 1YJ9A 5CC4A 4FNFA 3TDQA 2RDGA 1WJJA 2NVXH 1STYA 3J80c 2KCNA 2MHVA 1F9QA 3U4ZA 4U68A 2L55A 4JI1L 1JJ2A 2UXDQ 3SK8A 4A93G 3AFPA 4J1MA 1N32L 1SE4A 1WYDA 4LF7L 2A69D 4A3DG 1IL2A 1S40A 1ILPA 4J6HA 4MIUA 4A3LG 1W6KA 1I6HB 5IWAL 3J7YW 1AZQA 2B2UA 1V9PA 4ZQ3A 2ZJPA 3GTJH 1A2UA 1Q8IA 1TS2A 4A3EH 1N36Q 1V43A 2MFIA 2DJGC 1EFWA 4FF2A 4XXEA 1F9SA 3RD4A 3JAMi 5FLXE 1FR3A 4LMQD 3U50C 3PIOA 5FO9B 3N52A 4X66L 4IFDG 2JYOA 4BBSH 3VR5A 4FO2A 1LO5D 5C4XH 4JV5Q 3J80i 3NWSA 5HY6A 3HOZH 1MSGA 1D5ZC 3OW2A 1IXRA 1Y1VB 3S2HH 3U9SA 1CA5A 4HMJA 4QUFA 1GUWA 5IP9H 2VB2X 1JJCB 3FPUB 4LF8Q 1II3A 2I0QA 5BN5A 4A3EB 4KD4A 4IPHA 1QB5D 5J3BA 2HQLA 2NN6H 1EZ8A 3AU7A 2ZXPA 1WI5A 5C5MA 4GNXB 5KGUA 1HZAA 5FOBB 3BDLA 1JE5A 1SNPA 4OX9Q 1YHBA 2M9VA 1V1OA 3GO5A 4QJFA 5COYA 5I2YA 1IBLQ 1PYWD 4B08A 4BBSB 4JPBW 4HJ9A 2MQHA 4PMWA 2L0CA 1NAPA 1GXDC 1YEZA 4FDBA 1AH9A 5E7NA 3CXCA 2UXDL 2A73B 3S2HB 4AYBB 2HDMA 1RJTA 1RODA 3FHWA 3MXNB 3IKJA 4WJ4A 5CR3A 2JA9A 3AFQA 3A5ZB 5JPMC 3KF8A 3GV6A 4A75A 4A3MG 5KNBA 4F7XA 3E9IA 3L3OC 4FXGC 2ZTEA 5ELNA 3WOEA 4ZLTF 4XQNA 4OIJA 2XSCA 2R93H 1N36L 2ZXRA 3A8KE 1SRUA 3NSWA 1I4QA 2N88A 3OHXC 1K3BC 5FKAC 2H5XA 4Y52H 5IYCH 1SFOH 1JC7A 1RF2D 3BZDB 4R8NA 1QVGA 1PFSA 1AFPA 3KBGA 3JAME 1XYIA 3OSOA 1CM9A 3T1YL 4JV5L 2K28A 1JMCA 2E2HB 1S5FD 4BXXG 2PZWA 3M7GA 2PNHA 1BCPF 3ER0A 3QIAA 4TVAB 3GTKH 1ENFA 1PFMA 4LF8L 1YNJD 2R93B 5T1GA 1K9MC 2PPBC 4DR5Q 2MJ8A 1KHIA 3FDTA 3OYYA 2A69C 2EE1A 4RKLA 4RWSC 4DV7L 2J0TD 4AIMA 3H09A 3Q6SA 1W3SA 2N8NA 4OX9L 3DMUA 4K0KL 2HQEA 1LTRD 2AKWB 1EZ6A 4M8AA 4NMZA 3PSIA 3VR2A 5M3FG 1IBLL 3H0GB 2B29A 4ZUIA 3OOCA 1MHWC 5A2QL 1IW7D 1HXYD 3T1HQ 3PIPA 3ULLA 3J7AV 1F2MA 3GTKB 3E0JA 2RA4A 3J81L 3HRZC 4LFBQ 1MJEA 3HOVG 1PRTD 1SYBA 2IHEA 4IZ8A 3T56B 1C0AA 2RSOA 4DUZQ
chains in the Genus database with same CATH topology
1TY0A 4NW2A 3K5OA 3TZDA 2WV6D 4HCEA 2F0DA 5I9OA 3RUZA 1DD2A 1WVLA 3S2DB 2G9HD 4K2KA 2EYMA 1BR9A 2DN8A 1B44D 3EJIA 4QCLA 3T51B 4CBVA 1AZPA 1Z7TA 4KN7C 4O1NA 4MHEA 5D65A 3CRLC 1PZJD 4C3JG 1ENCA 2AWOA 3RLFA 1F9RA 3QJYA 3NTKA 1HPCA 2OF1A 1F77A 5F2DA 1X3QA 4KJNA 2NTTA 1KLUD 5KEEA 1T5EA 3BDOA 4F87A 1JWMD 1PXUA 1O80A 1BO0A 4ODGA 5JJZA 5CV9A 5KNDA 1XWEA 2RQXA 2K5QA 2F0LA 4F8MA 3A7LA 3SK4A 3OMGA 2Q8TA 4TQUS 1ICWA 2K1BA 1I4XA 4A3JB 4QMGA 3M3YB 3DWAA 1LV9A 2G9DA 1SYDA 2XNAC 4A3GB 1X32A 1Q1EA 1H9JA 1ET9A 3EFXD 5C6AA 3TBIB 4QB4A 4LAAA 4ME5A 1S5DD 4R8IA 4K5WA 3X3NA 1B4OA 3D4WA 3VYUA 5NUCA 2K04A 4XQJA 1I4GA 1BXTA 1IW7C 4DFAA 2B2VC 4WFN3 2WIIB 3OIQA 1SMYD 3TP5A 2KUMA 4DGZA 4R9WA 3ND8A 2MP1A 4I7ZC 5M3MB 5ELEA 3D8GA 1TIID 1SJHD 4HTHA 2K5WA 3HKZB 3QG1A 1PFBA 4C1NI 1CZWA 3NTIA 4DNTB 2A68D 1V8QA 5DM63 1CHPD 4C3IB 4KKSA 1SNQA 2GA4B 3VR6A 3H6MA 4BA1I 1GUSA 5EPKA 2M2LA 2PMZB 3U9OA 2E75C 1TS5A 4PMBA 2F4IA 3GP7A 4CKBA 4IALA 4CKCA 2L11A 4HEDA 3I4MB 1L0YB 4CKEA 1ESRA 2D2CC 4G4KA 5JEAG 2ZT9C 1STEA 5IT9L 2HCCA 3DWQA 1GUGA 5I6WA 2B2YA 2L12A 3HOWB 3CHBD 5KNCA 3I73A 5LHY1 1OXSC 3MEHA 2YU9B 3T16A 1HTLD 1TS4A 2IT1A 3V96A 4IUUA 1EYAA 3S16B 2R7ZB 2K5DA 1I6VC 2DY8A 3D4DA 1JORA 4ZKCB 1O78A 1SYGA 4K8JA 4FF3A 3AB9A 3IFDA 4H13C 3BS1A 2EY2A 3KK7A 1EQTA 4XT3B 2MGSA 1PTOB 3Q0AA 2SDFA 3QOLA 1EY0A 1SYCA 2RVLA 3C46A 1OXVA 4RH6A 1AN8A 2EZVA 5CORA 3EROA 3QO2A 3URYA 2E2IB 3D6CA 1CK1A 3ONAB 4G7ZC 3LWUA 2EYPA 3EVQA 4CGYB 4P2CB 5C0XI 1RDPD 1Q3LA 2IWHA 3A55A 4C3HG 2BCOA 2J4XA 5FLXL 2FFKB 2PCFB 4LK1C 3TMEA 5HGTA 2Z4IA 3D6WA 2A68C 3PO2B 3NBIA 1HCZA 3MFYA 2EYLA 2PO4A 3GV3A 1ZKOA 3OWEB 3LWEA 4K8IA 1G2SA 1Y8OB 1NUCA 1O7LA 2LFNA 1BNZA 4IUTA 3DM1A 4FP5D 1KDCA 1G8ZD 3KLRA 3AMUA 2Z8LA 2B2WC 4IFDI 5FO7B 1KABA 5C44B 1ENAA 5FK9C 4A3BB 1J8IA 2F0NA 1JB3A 4RA8A 4OIKA 3W3AA 2D9UA 3K5MA 3VYSA 3VYTA 3GTQB 2HCIA 4XTCS 4WORA 5E3FA 3S1QB 4DA2A 1XTCD 2KECA 4G7HC 1CZGA 3UI2A 1RTOA 3HOXB 4RGNA 2AQ1B 3JAML 1A3VA 2WB1B 3P20A 2RBMA 2PZTA 1F2ZA 5CV4A 2RSNA 3K0YA 2K6AA 1MBYA 3NE5B 3K6OA 2PQEA 1GUNA 3P1HA 4QIWB 1DOKA 1QJOA 2AQ2B 2O4XA 3CQZB 2F0UA 5BN4A 3PUWA 3R3OA 2B2TA 1A3UA 3BYTB 1PRTF 5HURA 1BDOA 4CHTB 4K6LA 4H7BA 2MUYA 1ESFA 1YNNC 4B9XA 2XWJB 2F0IA 3P7JA 2FMCA 3SHLA 1ILQA 2VB3X 1CI3M 1CQVA 1AP0A 1FNWA 1M4VA 3MZ5A 3OW7A 1WD0A 1RKNA 1EY6A 1FGBD 4PNYA 3C3LA 3NTHA 4IQZA 3BYYB 1U9RA 5ELFA 5IOCA 1SYFA 1QNUA 3E5SA 5C4JB 5KYLA 1H9SA 1D6EC 1B9NA 3SDZA 2DNCA 3PO3B 1KTKA 1HTPA 1WCMB 2X6GA 5D3IB 1CFMA 2NBFA 4HCSA 4X3SA 3Q22A 3QOJA 1KNAA 5M5WB 1K8OA 4A93B 4Q0FA 4IFDH 3RZOB 1JR0D 3FMCA 4A3DB 3ERQA 2TMPA 1HA5A 2B8GA 2A5HA 1UAPA 4OHJA 2DNEA 1EY9A 4XIGS 1RD9D 3K58A 1U4LA 2N55A 1PTOD 2F0TA 2F0FA 2CW0C 4XDXA 2AUJD 2F0JA 3I70A 1EY8A 4RCNA 2PZUA 2SNMA 3V05A 3J80E 1JE4A 3TZUA 1SE3A 2O2LD 1TS3A 1EY4A 1TY2A 5IGDA 1EEID 3TN2A 3MAQA 4H44C 1KNEA 3S17B 2EXZA 3DHQA 4KN4C 4FXKC 1TVXA 2F0EA 2A6HC 2F0OA 2B39A 1XXGA 3ND9A 1QILA 3R2IA 4KTAA 1R4QB 2B2UC 1HFGA 1TWFB 3I91A 2EY6A 2R3ZA 4A3MB 3NQIA 3LNNA 1IL8A 2IJ0A 3PUZA 3T13A 5I4DA 4HR7B 3NP8A 2IW3A 2VXWA 1FNVA 4BS9A 4QF4A 1S5BD 1R9TB 2QF7A 1PZKD 2JXMB 2EYFA 1BOSA 4ZYSA 1V1PB 3P75A 3NHHA 3NWTA 1DJRD 2KQ3A 4IUNA 3F2UA 3CKIB 4E6IA 3GTOB 3VA5A 2H4OA 1D1IA 4K5VA 5M3FB 2PNRC 4Y7NB 4M1UB 3FEWX 2O5IC 3GTPB 5KIXA 1TWCB 2SNSA 1EY5A 2F0QA 3HOVB 1EU3A 1OO9B 1AW7A 1C4QA 1PTOC 1GUTA 1B53A 1G2TA 4ILWA 2R61A 3IFTA 2EY1A 3TP8A 1Q1BA 2EVBA 4K14A 4PQXA 4RGMA 1C8CA 1VF5C 1DONA 4F88A 4RGTA 1WTWA 4DK0A 3RZDB 4FF1A 4MN3A 4FVMA 2IX3A 2XN9C 4C3JB 2LS01 4HN7A 4N9TA 3I4NB 5I6YA 4RGOS 3GTGB 2IPKD 1SE2A 5D3DA 2C5CA 5CV7A 5DEHA 3LX0A 1OXTA 5EBCA 1WTVA 1EEFD 3HOUB 1Y8NB 5A35A 1ZXTA 1BQQT 2XVSA 2MPMA 1T5XD 1TU2B 5IGFA 3VA7A 2F1MA 5J1ZA 1LTID 1VMCA 2NVQB 4IUPA 1IKLA 3H3VC 1OXUA 3WOFA 2ID0A 3VR3A 3IL8A 4FYDA 2WP8J 3CU7A 3QWNA 3HS0C 3M85A 5K36G 5A2QE 1A15A 2JE6I 4OO1G 1KLGD 1TWAB 1Z6HA 5CV8A 3HZXA 3HOYB 2CVRA 5ELCA 2XWBB 1CT1D 2D5DA 2NVTB 2E76C 1PTOH 2F0MA 2ENBA 3NQTA 1SNOA 3Q24A 3HEJA 2WACA 2EOTA 1JICA 1TWHB 5T1IA 3MXNA 1RCVD 3M4OB 2CQAA 4K2LA 1DOLA 4DAPA 1SDFA 3QB3A 3I8ZA 1DZ1A 1LTGD 4RHRA 1EY7A 1SNMA 2X69A 2BDNA 4BWGB 1DCZA 4DF7A 1U4RA 1Q12A 1GHKA 1SAPA 4KKTA 2BA0A 2EDGA 1F2YA 4BBRB 2L4NA 1BUVT 2FHTA 1NCVA 2E2DC 4KHVA 2KJXA 3WDNA 5I2XA 1VDZA 4ID6A 3FVQA 1S4ZA 3A7AB 1TQOA 1HQMC 1Y1WB 5E4XA 2WKCA 1RHPA 1YNND 4K5XA 1FD7D 1E0BA 1S5CD 2RKSA 2L9HA 2FINB 3VYRA 3PMFA 3G7LA 1QOHA 1BCPC 5JAVA 2OT2A 5C0XJ 5LL6S 4A3FB 4EGVA 3EQLC 2JP1A 3D31A 2QILA 1BF4A 1LT3D 2NZ1D 1STAA 1O7YA 3M7NA 4BY7B 1E2WA 2CHBD 4EQOA 5LL6X 5EJWA 5BN3A 1EWCA 4DNRB 4KKUA 4HMIA 2SOBA 2EYOA 4ABNA 4B9WA 5C4HA 4XQQA 3NBHA 4C1NK 4ZK9B 2LMCB 1QG7A 1EFID 2TSSA 2JEAI 1I4RA 1SBBB 4NP5A 4NKLA 2B2YC 2IL8A 3W2DA 3V2TA 3HP3A 1SNDA 4IFDJ 2Q8RE 3I90A 4C3HB 4FF4A 3E6ZX 3SR1A 4FXDA 4UAIA 2KEEA 3MVVA 2H1EA 1C48A 2O5JC 2EJGC 3PUXA 5IGBA 1AEXA 5D14A 3J80L 1QCBD 3SK6A 1SYEA 2A6ED 1L0XB 5IT9E 4CJ2C 1G6ZA 1ML0D 4JK1C 1GUOA 4V190 3S14B 2EYJA 1Y69U 4IN3A 3T53B 2NWGA 1GOZA 2LKVA 1SNCA 3CRKC 3I4LA 4WRDA 2B8FA 1BBXC 1H9RA 2CW0D 1FYCA 2I46A 1MI2A 1HA6A 1MD2D 1S5ED 2VUMB 2K33A 2QCPX 1LTTD 2ICIA 2PYKA 3MC0B 3PUYA 2IX0A 3MXGA 1ONLA 4X3UA 2I07B 3OMCA 3BVMA 5EBDA 2A6HD 2QEJC 1BCPB 5C0XH 2A74C 2K32A 4KMUC 2NN6G 1F2LA 1Y8PB 1B3AA 3FKIB 1JOKA 4TKOB 5IGCA 5JVH3 2B63B 2J7ZA 3OIPA 1SJED 4BA2I 2F0PA 2NVXB 3DEOA 4L63B 1JOOA 4HAEA 1ZYRC 3KLSA 5CV5A 4DN4M 5CGKA 4YIJA 1HUNA 3K5LA 3TP7A 1OXXK 2FJ2A 1H9MA 2L1BA 3J7AF 1UNSA 4DXGA 2Y0SB 4KV6A 1EIHA 2VNUD 4KY6A 2IX1A 1JOQA 2Q8IB 5E1FA 2K7VA 2JA5B 1I4PA 4L8JA 4IURA 2R92B 3GTJB 4A3IB 2C9OA 4J8QA 1HUMA 1Z47A 4DAVA 3MFGA 2NTSA 2DY7A 2A6EC 1B9MA 5C4XB 1GHJA 3MXPA 3HOZB 1I4HA 2BE5C 4CJ0B 4TRDA 2XRSD 1PMRA 4EQNA 1CHQD 3K57A 1LACA 3BDCA 4S3SA 1WTOA 1GJXA 4U673 2LY7A 2F0SA 5C4ZA 4DXFA 5M9OA 3PUVA 4H0LC 1U4PA 1B50A 3BVZA 3MWYW 1NR4A 3R8BA 1IHZA 2BDOA 2JA8B 3DXJC 5EPJA 1XX8A 1VCIA 1A3TA 3RMHA 1X3PA 3A8IE 3A8JE 2B2TC 1UEAB 5CBAE 4G57A 1JCKB 5G3LD 3KUPA 1KAAA 3KLSX 1LT4D 1QE6A 2B2VA 3S9WA 1G91A 3NUCA 4PV1C 1SFOB 4IUQA 5IODA 4KHZA 2R6GA 3T4AC 4ZKBB 1LTAD 5ELDA 4PMCA 1M8AA 3C2PA 2Z1CA 1DOMA 1O7ZA 3M4YA 3SK5A 1LT5D 4ZRZA 3R93A 5EPLA 3GD7A 1F9PA 2RDHA 2BOSA 1SXTA 2PW5A 3S1MB 1UUPA 4JBWA 3K59A 2M00A 5ISRA 4Q5VA 5IGEA 5IIFA 1B1ZA 1HFNA 5AFWA 4Z9CB 1STGA 2KOLA 2JSOA 2V4DA 2F0HA 5CYUA 2KEDA 4IUVA 4OO1I 3HGBA 4EQPA 4RCOA 2F3WA 2XRQD 1WTPA 3C1FA 1H9KA 3N6RA 1ZEQX 5KRUA 2JEBI 2NYZD 2RDFA 3DWPA 4ZAIA 5JEAJ 3PV0A 4GZYC 4KK7A 2BA1A 1D1KA 5K5PA 3SVMA 2F3VA 3DEPA 2WINB 4EVOA 3DUZA 2AQ3B 2F03A 1QWYA 4C3IG 5JVG3 2FMMA 2NB0A 2KA7A 2F0GA 4V0BA 2WKDA 5IGGA 2ZXOA 5EQ0A 5DNFA 4C2MB 2JA7B 1LT6D 1D2BA 2EY5A 1LLRD 2K03A 1A6XA 3I72A 3O13A 1YNJC 1EYCA 3NPPA 4I65A 3NXWA 4N9PA 1NSNS 1QNKA 4O42A 1DM0B 2L5TA 1A2TA 2NUCA 4G7OC 4RAUC 3MXUA 4DU9A 3MTSA 4RFBA 1EWHA 1EOTA 1BCPD 1CA6A 4HSVA 1MGSA 2HDLA 3ZYYX 1PRTC 1IYVA 1J9OA 5ELBA 3K5NA 1LTBD 1PDQA 2E74C 1TKWB 1D5MC 4TSSA 1JQYD 1I50B 3MA2B 4X3TA 1FNUA 5M5YB 1IKMA 1B2TA 1LTSD 3MHBA 1KDAA 2EYHA 2B2WA 1H9SB 1TR5A 5KYIA 5CMDA 1TWGB 4X3KA 3J81E 3L7ZC 1CTMA 3GTMB 2F0VA 4OGQC 3X3MA 1IYUA 4XYOA 3L9AX 1EL0A 4LJZC 3D4RA 1VF7A 2PW7A 3A54A 3TSSA 1HRJA 3BVGA 3IAYA 2QDBA 2NVYB 5JEAH 5CV6A 4KJOA 1STHA 3TP6A 5J22A 4KD3A 5K36H 1EYDA 5J39A 1I3QB 3H91A 4OO1H 5JOBA 2D62A 2XIWA 5C3WA 2F0KA 3D3RA 4ULLA 2EJMA 1VMPA 5I9PA 2EJFC 3A56A 1R4PB 1EU4A 1PLFA 3PIO3 1NR2A 2EPBA 4KI0A 4XT1B 2OXPA 4DAYA 4CJ1B 1HHVA 1RTNA 4BY1B 1JWSD 2QKIC 2SEBD 3SEBA 3FRPB 3EA6A 4A3KB 5EKIA 2YYZA 2Z4HA 1SMYC 5C3XA 1EQVA 3SXHA 1TT2A 4OL7A 5DAUA 4XYQA 5E4WC 5M5XB 1SEBD 3Q23A 1PFNA 3R2TA 5DM73 1U4MA 5C3EB 1PRTB 1KDBA 1JWUD 1D5XC 1WTRA 3FPPA 2HUGA 3S1NB 1WTQA 2F0WA 1G291 4KY5A 1WD1A 2NN6I 1E2ZA 1STBA 1Q90A 2K01A 1DYQA 1STNA 4WJWA 3S1RB 1LABA 1ZYRD 4RKBA 2AWNA 3GQBA 2KHSA 1V1PA 4UDUC 4ZUJA 5EKKA 3ITPA 4DK1A 3S15B 4QUCA 3OPOA 3NK9A 5FO8B 4HSPA 5C5LA 2K05A 4KY7A 2WAQB 1PTOF 4RHSA 1MSHA 4L6TB 2JA6B 1ET6A 2E2JB 5JPNC 1CQFA 3VR4A 1PZID 4C56C 3G6JB 4K6DA 3KBXA 3K7AB 5EKLA 3GTLB 2ICEC 1WTXA 3I3CA 2BE5D 3PIP3 3C1EA 1DXMA 5CBEE 2AUKA 1EIGA 2KCCA 1W6JA 2X6LA 3SE0A 5G3LF 3BG3A 1E2VA 2KVMA 3OWFA 4NDXA 5TSSA 1K83B 1SSOA 5EGTA 5C0XG 2OEOA 1K8MA 1HQRD 3H94A 3HG9A 5CC4A 4FNFA 3TDQA 2RDGA 1STYA 2KCNA 2MHVA 1F9QA 4U68A 2L55A 3SK8A 4J1MA 1SE4A 2A69D 1ILPA 4J6HA 4MIUA 1W6KA 1I6HB 3J7YW 1AZQA 2B2UA 4ZQ3A 1A2UA 1Q8IA 1TS2A 1V43A 4FF2A 4XXEA 1F9SA 3RD4A 5FLXE 1FR3A 4LMQD 5FO9B 3N52A 4IFDG 2JYOA 3VR5A 4FO2A 1LO5D 3NWSA 1MSGA 1D5ZC 1Y1VB 3U9SA 1CA5A 4HMJA 4QUFA 1GUWA 2VB2X 3FPUB 1II3A 5BN5A 4A3EB 4KD4A 1QB5D 2NN6H 1EZ8A 3AU7A 2ZXPA 5C5MA 5KGUA 5FOBB 3BDLA 1SNPA 2M9VA 5COYA 1V1OA 3GO5A 5I2YA 1PYWD 4B08A 4BBSB 4PMWA 2L0CA 1NAPA 1GXDC 2A73B 3S2HB 4AYBB 2HDMA 1RJTA 1RODA 3IKJA 5CR3A 5JPMC 3KF8A 3GV6A 5KNBA 4F7XA 3L3OC 4XQNA 4FXGC 3WOEA 4ZLTF 4OIJA 2XSCA 2ZXRA 3A8KE 3NSWA 1I4QA 2N88A 3OHXC 5FKAC 1JC7A 1RF2D 3BZDB 4R8NA 1AFPA 3KBGA 3JAME 1XYIA 3OSOA 1CM9A 2K28A 2E2HB 1S5FD 2PZWA 3M7GA 1BCPF 3QIAA 1ENFA 1PFMA 1YNJD 2R93B 5T1GA 2PPBC 2MJ8A 3FDTA 2A69C 2EE1A 4RKLA 4RWSC 2J0TD 3H09A 3Q6SA 3DMUA 2HQEA 1LTRD 4M8AA 1EZ6A 4NMZA 3VR2A 3H0GB 4ZUIA 3OOCA 5A2QL 1IW7D 1HXYD 3J7AV 1F2MA 3GTKB 3E0JA 2RA4A 3J81L 3HRZC 1PRTD 1SYBA 4IZ8A 3T56B 2RSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBY A;  5LHY 1; 
#chains in the Genus database with same CATH topology
 1TY0 A;  4NW2 A;  3K5O A;  3TZD A;  2WV6 D;  2JN4 A;  4HCE A;  3KF6 B;  2F0D A;  2PQA B;  3J7Z C;  5I9O A;  3RUZ A;  4JI2 Q;  1WVL A;  1DD2 A;  3STB C;  2UUB Q;  3S2D B;  2G9H D;  4K2K A;  2EYM A;  1BR9 A;  3NBH B;  2DN8 A;  1B44 D;  3EJI A;  4QCL A;  3T51 B;  4CBV A;  1AZP A;  1Z7T A;  2MO0 A;  4DV1 Q;  4KN7 C;  4O1N A;  4MHE A;  5D65 A;  3DLL A;  3CRL C;  1PZJ D;  4C3J G;  1VQ4 A;  1ENC A;  2AWO A;  3RLF A;  1SMX A;  1A62 A;  1F9R A;  3I4N G;  3QJY A;  2G5D A;  3NTK A;  4YHH Q;  1V1Q A;  1S72 A;  1HPC A;  2OF1 A;  1F77 A;  4DR5 L;  5F2D A;  1X3Q A;  4KJN A;  1A63 A;  3I55 A;  4B3R Q;  3HOU G;  2NTT A;  1KLU D;  3CCV A;  5KEE A;  2GVB A;  1T5E A;  4A3G H;  3BDO A;  4DNI A;  4F87 A;  3PF5 A;  2B3G A;  1JWM D;  1PXU A;  1P16 A;  3T1H L;  1O80 A;  2EXD A;  3EBE A;  1BO0 A;  4ODG A;  4GKK Q;  5JJZ A;  5CV9 A;  5KND A;  1XWE A;  2RQX A;  2K5Q A;  2F0L A;  4LFB L;  3A5U A;  4F8M A;  2JJQ A;  3A7L A;  3OMG A;  3SK4 A;  2Q8T A;  4TQU S;  1ICW A;  2K1B A;  1I4X A;  4A3J B;  2HT1 A;  4DR4 Q;  4QMG A;  1EQR A;  3M3Y B;  3DWA A;  4DUZ L;  1LV9 A;  2G9D A;  4JI4 Q;  1SYD A;  2VQF Q;  2XNA C;  4A3G B;  4DV3 Q;  1X32 A;  5AJ3 Q;  1Q1E A;  1FJG Q;  1H9J A;  2VW9 A;  1ET9 A;  3EFX D;  4JI2 L;  5C6A A;  2UUB L;  4ZCK A;  3TBI B;  4QB4 A;  4LAA A;  2HHH Q;  2VS1 A;  4ME5 A;  2YTY A;  1XPO A;  1S5D D;  4R8I A;  4ME3 A;  4DV1 L;  1BBW A;  3M9B A;  4K5W A;  3X3N A;  2A8V A;  3HOY G;  2OQ0 A;  2Y0S E;  1PH2 A;  1B4O A;  4IJL A;  3D4W A;  4NXN L;  3VYU A;  1B70 B;  5NUC A;  2K04 A;  4C3I H;  1I50 H;  4XQJ A;  2MO1 A;  1I4G A;  1BXT A;  1IW7 C;  4DFA A;  4YHH L;  5M5Y H;  2B2V C;  4WFN 3;  2WII B;  3OIQ A;  3AEV A;  1SMY D;  5GAD C;  3TP5 A;  2KUM A;  4B3R L;  5IYB H;  4DGZ A;  4P73 A;  4R9W A;  3I4O A;  4DR7 Q;  3ND8 A;  4DV2 Q;  2MP1 A;  1A0I A;  3I4M H;  4NXM Q;  4I7Z C;  5M3M B;  5ELE A;  3D8G A;  1TII D;  1SJH D;  5LMN Q;  2DGY A;  4HTH A;  2K5W A;  3QG1 A;  3HKZ B;  1PFB A;  3DM3 A;  4C1N I;  1CZW A;  3NTI A;  4DNT B;  2A68 D;  1V8Q A;  5DM6 3;  1CHP D;  4C3I B;  4KKS A;  1SNQ A;  2GA4 B;  3VR6 A;  3H6M A;  4BA1 I;  1GUS A;  3K7U C;  3UE0 A;  2EIF A;  5EPK A;  4GKJ Q;  4DR4 L;  2M2L A;  2PMZ B;  3U9O A;  2E75 C;  3I56 A;  1TS5 A;  3U58 A;  4PMB A;  1MJC A;  2F4I A;  3GP7 A;  4BBR G;  4CKB A;  4JI4 L;  4IAL A;  4CKC A;  2L11 A;  4JI0 L;  4HED A;  3I4M B;  2NVY H;  5IE8 A;  1L0Y B;  2Z6K C;  4CKE A;  1ESR A;  2D2C C;  5AJ3 L;  3S16 H;  2V1C C;  4G4K A;  5JEA G;  4HIK A;  2ZT9 C;  1STE A;  1VQA A;  5IT9 L;  2HCC A;  2K52 A;  2HHH L;  3DWQ A;  1GUG A;  1QVC A;  5I6W A;  2B2Y A;  5FJ8 H;  2L12 A;  5LMU Q;  1YJN A;  4LF9 Q;  1Y1W G;  4IJH A;  3HOW B;  3CHB D;  4LUO A;  5KNC A;  3E0E A;  5GAH C;  3I73 A;  5LHY 1;  1OXS C;  3MEH A;  3BU2 A;  2YU9 B;  5H1S E;  3CCM A;  4X62 Q;  2VZA A;  3T16 A;  4CDF C;  1HTL D;  1TS4 A;  2IT1 A;  2UUC L;  3V96 A;  4IUU A;  4BY1 H;  1EYA A;  3S16 B;  1G6P A;  2R7Z B;  4HJ8 A;  2K5D A;  4A3F G;  1I6V C;  2DY8 A;  1UE1 A;  4DR7 L;  3D4D A;  3JC6 6;  4DV2 L;  1JOR A;  3MEF A;  4ZKC B;  3A74 A;  3J7A 5;  1O78 A;  1EQQ A;  1SYG A;  4K8J A;  4NXM L;  5IP7 H;  4FF3 A;  4N8X 1;  3AB9 A;  3IFD A;  4H13 C;  4BY7 G;  4B3S Q;  5LMN L;  3BS1 A;  4QGU A;  2EY2 A;  3CW2 C;  3KK7 A;  1EQT A;  4XT3 B;  2MGS A;  2R7D A;  4DV0 L;  1PTO B;  3Q0A A;  4H02 A;  4OEL B;  2SDF A;  3QOL A;  1EY0 A;  1SYC A;  2RVL A;  3C46 A;  4GKJ L;  1NTG A;  1OXV A;  4RH6 A;  1AN8 A;  2EZV A;  5COR A;  3ERO A;  4JCV E;  2K14 A;  3QO2 A;  3URY A;  2E2I B;  3ZJY C;  3D6C A;  2VQE Q;  2HIV A;  1CK1 A;  1RIP A;  4YCV A;  3ONA B;  1JT8 A;  4G7Z C;  3LWU A;  3RN2 A;  3PO2 H;  2Z9H A;  2EYP A;  3EVQ A;  3TS0 A;  4HJA A;  4CGY B;  1SN8 A;  4DUY Q;  4P2C B;  5C0X I;  4LWC A;  1RDP D;  1YIJ A;  4OXP A;  1Q3L A;  2IWH A;  3A55 A;  5LMU L;  3CPW A;  4C3H G;  4LF9 L;  2BCO A;  5ELO A;  2OTJ A;  2J4X A;  5FLX L;  2FFK B;  2PCF B;  4LK1 C;  2IY5 B;  1HNW Q;  3TRZ A;  4X62 L;  2CQO A;  3TME A;  5HGT A;  2Z4I A;  3D6W A;  2A68 C;  3CCR A;  4HIM A;  4UY8 C;  4PG3 A;  5DLQ E;  3PO2 B;  3NBI A;  4DV4 Q;  1HCZ A;  3MFY A;  4LFC Q;  4A3B H;  2EYL A;  2PO4 A;  3GV3 A;  1VQ5 A;  1ZKO A;  3OWE B;  1QZH A;  4GLV B;  3SGI A;  3LWE A;  4K8I A;  3H15 A;  1G2S A;  1Y8O B;  4B3S L;  1NUC A;  1O7L A;  2LFN A;  1BNZ A;  3W1G A;  4YWK A;  3TRE A;  2JA6 H;  3GTQ H;  4IUT A;  3G4S A;  3ERS X;  3DM1 A;  4FP5 D;  1KDC A;  1G8Z D;  1N34 Q;  3KLR A;  3S1Q H;  4N8F A;  3AMU A;  2Z8L A;  1XPU A;  3F1Z A;  3PF4 A;  2AMC B;  2B2W C;  4IFD I;  5FO7 B;  1KAB A;  4UP9 A;  3HOX H;  5C44 B;  1ENA A;  5FK9 C;  1PH8 A;  4A3B B;  2VUM G;  1E1O A;  2F0N A;  1J8I A;  1JB3 A;  1B7Y B;  4RA8 A;  4OIK A;  3W3A A;  2D9U A;  2VQE L;  4JYA Q;  3K5M A;  3VYS A;  1YHQ A;  5HGQ A;  4L5Q A;  2N3S A;  3VYT A;  3GTQ B;  4YWL A;  2HCI A;  4XTC S;  4WOR A;  1PH3 A;  5E3F A;  1X56 A;  3S1Q B;  4DA2 A;  1XTC D;  1NBW A;  1K83 H;  2KEC A;  4LF6 Q;  4G7H C;  1CZG A;  3UI2 A;  1RTO A;  1HNW L;  3ULP A;  3HOX B;  4JG2 A;  4RGN A;  2AQ1 B;  3JAM L;  2CH4 W;  1A3V A;  2WB1 B;  3P20 A;  3CQZ H;  4R4T A;  2RBM A;  2PZT A;  1KC8 C;  1F2Z A;  5CV4 A;  2YV5 A;  3FKI G;  2RSN A;  3K0Y A;  4DV4 L;  2K6A A;  2B63 G;  4LFC L;  1MBY A;  3NE5 B;  2JQO A;  3K6O A;  2OCE A;  1K28 A;  4MTN A;  2PQE A;  1GUN A;  3P1H A;  4QIW B;  3WWV A;  1QUQ A;  4UHV A;  1DOK A;  1QJO A;  2I5L X;  2AQ2 B;  2O4X A;  1GM5 A;  1HZB A;  1N34 L;  1I6H H;  3CQZ B;  2Y0S G;  1RL2 A;  2F0U A;  5BN4 A;  3PUW A;  2QW7 A;  4GN4 B;  3KFU A;  4DR3 Q;  3R3O A;  2JA5 G;  2R92 G;  2B2T A;  1A3U A;  3Q8D A;  1K3R A;  4JI5 Q;  4A3I G;  3BYT B;  2AHO B;  1PRT F;  5HUR A;  1BDO A;  4CHT B;  4K6L A;  4JYA L;  1Q82 C;  4H7B A;  2MUY A;  1ESF A;  1YNN C;  2Q2I A;  4B9X A;  1PH4 A;  2XWJ B;  3P7J A;  2F0I A;  2FMC A;  5C4X G;  3SHL A;  1Y1V H;  1ILQ A;  2VB3 X;  5C4J H;  3HOZ G;  1CI3 M;  3EN2 A;  1CQV A;  4NPS A;  1PH1 A;  1AP0 A;  1FNW A;  4LF6 L;  2OTL A;  1M4V A;  3MZ5 A;  3OW7 A;  1WD0 A;  1RKN A;  2N49 A;  1EY6 A;  3PO3 H;  4APV A;  1X9N A;  1FGB D;  1XMQ Q;  1YI2 A;  1WCM H;  2ZJR A;  4PNY A;  3CC2 A;  3C3L A;  5JJL A;  3NTH A;  4IQZ A;  3I7F A;  1BVS A;  3BYY B;  1U9R A;  5ELF A;  5IOC A;  4L5R C;  1SYF A;  4DAM A;  1QNU A;  3E5S A;  5C4J B;  4KHP Q;  5M5W H;  5KYL A;  2JA8 G;  3CP0 A;  1H9S A;  4P71 A;  3QR8 A;  4A93 H;  1D6E C;  3STB D;  1B9N A;  3SDZ A;  2DNC A;  3PO3 B;  1KTK A;  1YZ6 A;  3L2P A;  1HTP A;  1KL9 A;  1WCM B;  2X6G A;  5D3I B;  1CFM A;  4DR3 L;  1SE8 A;  2NBF A;  1KAW A;  4HCS A;  4X3S A;  3G71 A;  3K8A A;  4JI5 L;  3Q22 A;  2YTV A;  3QOJ A;  2CH4 A;  4GOP A;  1KNA A;  1CKM A;  5M5W B;  4HJ7 A;  1K8O A;  5IYC G;  4X65 Q;  4L5S A;  4A93 B;  4Q0F A;  4IFD H;  3RZO B;  1JR0 D;  3FMC A;  4YCU A;  4A3D B;  2E2H H;  3ERQ A;  2TMP A;  1UE6 A;  3KDF A;  3UE1 A;  1HA5 A;  2B8G A;  2WFW A;  3CCJ A;  2A5H A;  1UAP A;  3RR5 A;  4P74 A;  1PH6 A;  1TXY A;  4OHJ A;  2DNE A;  1EY9 A;  1XMQ L;  1NE3 A;  4XIG S;  1RD9 D;  3K58 A;  3CMA A;  4O0A A;  3S17 H;  1U4L A;  1VQK A;  2N55 A;  1PTO D;  3H0G H;  2F0T A;  4LFA Q;  2CWP A;  2ES2 A;  2F0F A;  2CW0 C;  4XDX A;  5JJK A;  2AUJ D;  2OQK A;  2F0J A;  3I70 A;  1EY8 A;  4RCN A;  4DAY B;  2PZU A;  2SNM A;  3V05 A;  3J80 E;  2D0P A;  4KHP L;  1JE4 A;  3TZU A;  2E8G A;  1SE3 A;  2O2L D;  1TS3 A;  1EY4 A;  1TY2 A;  5IGD A;  1EEI D;  1KXL A;  1M90 C;  1TWF H;  3TN2 A;  4IPC A;  3MAQ A;  4A3M H;  2HD3 A;  4H44 C;  1KNE A;  3S17 B;  4QY7 A;  1XNQ Q;  1VQM A;  3CF5 A;  2EXZ A;  1SLJ A;  3DHQ A;  4KN4 C;  4FXK C;  3RN5 A;  3RLN A;  1TVX A;  3S2D H;  3UDI A;  2F0E A;  2A6H C;  2F0O A;  2B39 A;  1XXG A;  4J15 A;  4LW1 A;  1SRO A;  1E1T A;  1R9T H;  3ND9 A;  1QIL A;  2WAQ E;  2K75 A;  1Q46 A;  3R2I A;  4KTA A;  1R4Q B;  2B2U C;  1HFG A;  3OTO Q;  1TWF B;  3I91 A;  2EY6 A;  1L1O A;  4BXX H;  1KD1 C;  1PA6 A;  2R3Z A;  4A3M B;  3NQI A;  3LNN A;  1IL8 A;  2IJ0 A;  3CD6 A;  1G51 A;  3LGJ A;  3PUZ A;  3T13 A;  5I4D A;  4WJ3 M;  4B3M Q;  4HR7 B;  3NP8 A;  2IW3 A;  2VXW A;  3KJP A;  2UUA Q;  1FNV A;  3FP9 A;  1VQ6 A;  4JBM A;  4POG A;  4BS9 A;  4QF4 A;  1S5B D;  3D0F A;  4YY3 Q;  1WFQ A;  1R9T B;  1KQS A;  2JA7 G;  2QF7 A;  1PZK D;  3S24 A;  4LFA L;  2JXM B;  2NZH A;  2EYF A;  1BOS A;  4Y7N H;  4ZYS A;  4CDE C;  1V1P B;  3BJU A;  1YVC A;  3P75 A;  3NHH A;  3NWT A;  1DJR D;  1VQE A;  3GTP H;  1X6O A;  1TWC H;  1AE2 A;  2KQ3 A;  4GLA C;  4IUN A;  3HOV H;  3F2U A;  1NNX A;  4A3J H;  3CKI B;  3M3Y H;  2F4V Q;  4E6I A;  3GTO B;  4JBJ A;  1HZC A;  3VA5 A;  3J81 c;  2H4O A;  1X65 A;  1JJG A;  1D1I A;  4K5V A;  5M3F B;  1XNQ L;  2PNR C;  3A0J A;  4Y7N B;  1CKN A;  2IHF A;  4GN5 A;  4M1U B;  3FEW X;  2O5I C;  3GTP B;  1AE3 A;  5KIX A;  1TWC B;  2SNS A;  1EY5 A;  2F0Q A;  4QL5 A;  3HOV B;  1EU3 A;  1OO9 B;  2Q2T A;  3OTO L;  4OWT B;  1AW7 A;  1C4Q A;  3CC7 A;  2Z0S A;  1L2F A;  1PTO C;  1GUT A;  1HH2 P;  1B53 A;  1K73 C;  1G2T A;  4ILW A;  2R61 A;  3I4N H;  3ULJ A;  3IFT A;  2EY1 A;  3TP8 A;  3GTG H;  3CAM A;  1Q1B A;  2K50 A;  4B3M L;  2EVB A;  2UUA L;  3H3V I;  4K14 A;  4PQX A;  4RGM A;  4JI3 Q;  2F52 A;  2Z6B A;  1C8C A;  3J81 i;  5FLM H;  4YY3 L;  1N33 Q;  1QUQ B;  1PH7 A;  1VF5 C;  4UP8 A;  1DON A;  5M3M H;  4F88 A;  1B3Q A;  1H95 A;  4RGT A;  1WTW A;  4DK0 A;  4IOA A;  3RZD B;  4FF1 A;  1PV4 A;  4MN3 A;  1KRS A;  4FVM A;  3PQI A;  2IX3 A;  2KHJ A;  2XN9 C;  4C3J B;  2LS0 1;  4HN7 A;  3K80 C;  1ICF B;  4N9T A;  3I4N B;  5I6Y A;  2VL6 A;  4DK6 C;  4RGO S;  2NVQ H;  4EQ5 A;  3GTG B;  4GLX A;  2IPK D;  1SE2 A;  5D3D A;  1IYJ B;  2C5C A;  2BH2 A;  5CV7 A;  5DEH A;  3LX0 A;  1OXT A;  2F4V L;  5EBC A;  1WTV A;  1EEF D;  1VQL A;  3HOU B;  1Y8N B;  5A35 A;  3ICE A;  1ZXT A;  2D0O A;  2PI2 E;  3AQQ A;  1BQQ T;  2XVS A;  3PGZ A;  2MPM A;  5IYD H;  1T5X D;  1TU2 B;  5IGF A;  3VA7 A;  2F1M A;  1IBM Q;  5J1Z A;  1LTI D;  1VMC A;  4AYB E;  4GKK L;  1TWA H;  3G48 A;  4P72 A;  2NVQ B;  4IUP A;  1IKL A;  3H3V C;  3HOY H;  3HOW H;  1OXU A;  3WOF A;  2ID0 A;  1VQF A;  3VR3 A;  2YU9 H;  3IL8 A;  2NVT H;  4R4C A;  4FYD A;  4AQY Q;  1IBK Q;  3CC4 A;  2VQF L;  2RHQ B;  4DV3 L;  1S3O A;  2WP8 J;  2R7Z H;  1FJG L;  3CU7 A;  3QWN A;  4LF5 Q;  3HS0 C;  4BY1 G;  5GQO A;  4JI3 L;  3M85 A;  5K36 G;  5A2Q E;  1A15 A;  2JE6 I;  1EWI A;  4OO1 G;  3M4O H;  3CCL A;  1N33 L;  1KLG D;  1TWA B;  1Z6H A;  3BZK A;  2DJF C;  2K5H A;  5CV8 A;  4JOI A;  5IP7 G;  3HZX A;  3IRB A;  3HOY B;  2CVR A;  4UPA A;  1XMO Q;  4GNX A;  4RG1 A;  2PI2 A;  5ELC A;  2XWB B;  4A3K G;  1CT1 D;  2D5D A;  2NVT B;  2E76 C;  1PTO H;  2F0M A;  2ENB A;  3NQT A;  1CSQ A;  1SNO A;  3Q24 A;  3HEJ A;  1U5K A;  2WAC A;  2EOT A;  1JIC A;  1TWH B;  5T1I A;  3MXN A;  4NB3 A;  1RCV D;  2E2I H;  4BBR H;  3M4O B;  4A3C H;  1HR0 Q;  5C3E G;  2CQA A;  3GDE A;  4K2L A;  1DOL A;  4DAP A;  1SDF A;  3QB3 A;  3I8Z A;  4OON A;  3KF8 B;  2KEN A;  1EIY B;  4OEM B;  1DZ1 A;  1LTG D;  4RHR A;  1IBM L;  1EY7 A;  1SNM A;  2X69 A;  2BDN A;  4BWG B;  1DCZ A;  3KYH C;  1U4R A;  4DF7 A;  4OWW B;  5IT9 c;  2QDL A;  1Q12 A;  1GHK A;  1SAP A;  4KKT A;  2BA0 A;  2EDG A;  1F2Y A;  4AQY L;  1IBK L;  4BBR B;  2L4N A;  1BUV T;  2FHT A;  1UE7 A;  1BBU A;  4POF A;  1NCV A;  2E2D C;  4KHV A;  4LF5 L;  1Q8K A;  4A3F H;  3K81 C;  2Q2U A;  2KJX A;  3WDN A;  5I2X A;  1VDZ A;  4ID6 A;  1J5E Q;  3FVQ A;  4DR1 Q;  1CKO A;  1S4Z A;  3A7A B;  1TQO A;  1HJP A;  3I2Z A;  2QEX A;  1HQM C;  1J6Q A;  1QVF A;  1W2B A;  1Y1W B;  5E4X A;  2WKC A;  1XMO L;  1RHP A;  3H3V H;  2WAQ G;  2ALY B;  3TQY A;  1A8V A;  1YNN D;  2JA6 G;  4K5X A;  1Z9F A;  1CSP A;  1FD7 D;  1E0B A;  1S5C D;  2RKS A;  4AH6 A;  2L9H A;  2FIN B;  3VYR A;  3W5O A;  3PMF A;  3G7L A;  2K5N A;  1QOH A;  1BCP C;  5JAV A;  2OT2 A;  5C0X J;  3L0O A;  5LL6 S;  4A4I A;  5C44 H;  4YCW A;  4A3F B;  4EGV A;  3EQL C;  2JP1 A;  1GKH A;  3D31 A;  2QIL A;  1BF4 A;  1LT3 D;  2NZ1 D;  1HR0 L;  1STA A;  1X55 A;  1O7Y A;  3M7N A;  4BY7 B;  1E2W A;  2CHB D;  4EQO A;  2ATW A;  5LL6 X;  3PCO B;  1L1O B;  5EJW A;  5BN3 A;  1EWC A;  1HNX Q;  4DNR B;  4KKU A;  4CDD C;  2PQA A;  1X3G A;  4HMI A;  2A19 A;  2SOB A;  4LUZ A;  2EYO A;  4ABN A;  4GS3 A;  4B9W A;  5C4H A;  2CKZ B;  4C3H H;  4XQQ A;  3NBH A;  4R4Q A;  2ZM6 Q;  2A1A A;  4C1N K;  4ZK9 B;  2LMC B;  3EIV A;  1QG7 A;  1EFI D;  2TSS A;  4HIO A;  5FLX c;  2JEA I;  1I4R A;  1ASY A;  1SBB B;  4NP5 A;  4X64 Q;  4QQB X;  1J5E L;  4DUY L;  4NKL A;  2B2Y C;  2IL8 A;  3W2D A;  3V2T A;  3HP3 A;  1SND A;  4OWX B;  2Q8R E;  4IFD J;  3I90 A;  1VQC A;  4C3H B;  4FF4 A;  3E6Z X;  4JI1 Q;  5IY0 A;  1PHJ A;  3SR1 A;  4FXD A;  4UAI A;  4JBK A;  2KEE A;  3MVV A;  2H1E A;  1C48 A;  2JK8 A;  2O5J C;  2EJG C;  3PUX A;  5IGB A;  1AEX A;  1EOV A;  2ZTC A;  1QCB D;  5D14 A;  3SK6 A;  3J80 L;  1SYE A;  2A6E D;  1BKB A;  1VQJ A;  1CKN B;  1L0X B;  5IT9 E;  4CJ2 C;  1LM0 A;  4DPG A;  1OTC A;  1G6Z A;  1ML0 D;  4JK1 C;  1GUO A;  4V19 0;  3S14 B;  2EYJ A;  3HKZ E;  1Y69 U;  4IN3 A;  1XNR Q;  3T53 B;  2NWG A;  1GOZ A;  2LKV A;  1HNX L;  3K0X A;  1SNC A;  1VQN A;  3CRK C;  3I4L A;  4WRD A;  2B8F A;  1KRT A;  1BBX C;  1P8L A;  1H9R A;  2FXQ A;  2CW0 D;  1HR0 W;  1FYC A;  1Y1V G;  1MI2 A;  2I46 A;  1HA6 A;  1MD2 D;  1S5E D;  1HZ9 A;  4MTK A;  2PMZ E;  2ZM6 L;  4PZ6 A;  4A3E G;  2VUM B;  5GRO A;  2K33 A;  2QCP X;  3FKI H;  4IPD A;  4X64 L;  4DV5 Q;  1LTT D;  4ALP A;  1VQG A;  3JAM c;  2ICI A;  2PYK A;  2B63 H;  4BBS G;  4JI7 Q;  3CCQ A;  3MC0 B;  3PUY A;  2IX0 A;  3MXG A;  1ONL A;  4R4I A;  4X3U A;  2I07 B;  3OMC A;  4AYB G;  3BVM A;  5EBD A;  3F2C A;  2A6H D;  2QEJ C;  5IP9 G;  1BCP B;  5C0X H;  2A74 C;  2K32 A;  4X6A H;  2NN6 G;  4KMU C;  1YBY A;  1F2L A;  1Y8P B;  1B3A A;  3FKI B;  1JOK A;  4TKO B;  4DV6 Q;  5IGC A;  2JA5 H;  5JVH 3;  5BR8 Q;  2R92 H;  2UXB Q;  2B63 B;  1D8L A;  2J7Z A;  4A3I H;  3OIP A;  1SJE D;  4BA2 I;  2F0P A;  2NVX B;  1T9H A;  2I5H A;  3DEO A;  4L63 B;  1K8G A;  1JOO A;  2KBN A;  4HAE A;  1ZYR C;  3KLS A;  5CV5 A;  1E22 A;  4R4O A;  4DN4 M;  5CGK A;  4YIJ A;  3RZO H;  3K5L A;  1XNR L;  1HUN A;  3TP7 A;  2CWA A;  4A3D H;  1OXX K;  2FJ2 A;  4I7A A;  1H9M A;  2L1B A;  3J7A F;  1UNS A;  4DXG A;  4A3L H;  3T1Y Q;  1ASZ A;  2Y0S B;  4KV6 A;  1EIH A;  2VNU D;  4KY6 A;  2IX1 A;  1JOQ A;  2Q8I B;  5E1F A;  2K7V A;  4B3T Q;  2JA5 B;  1I4P A;  4L8J A;  4IUR A;  2R92 B;  3GTJ B;  2UU9 Q;  4A3I B;  2R93 G;  2C9O A;  3KLW A;  4J8Q A;  1HUM A;  4DV5 L;  2ZTD A;  4DV7 Q;  1Z47 A;  4DAV A;  3MFG A;  2NTS A;  3H0G G;  3U4V A;  4K0K Q;  4JI7 L;  2DY7 A;  2A6E C;  1B9M A;  5C4X B;  1GHJ A;  3MXP A;  4HID A;  3HOZ B;  1I4H A;  2BE5 C;  2JA8 H;  4CJ0 B;  2CFM A;  4TRD A;  2XRS D;  1PMR A;  4PZ8 A;  4EQN A;  1CHQ D;  1PYS B;  3K57 A;  1LAC A;  3BDC A;  4S3S A;  1WTO A;  1GJX A;  4U67 3;  1XPR A;  2DUD A;  2LY7 A;  4DV6 L;  2F0S A;  5BR8 L;  1PVO A;  2UXB L;  2NZO A;  5C4Z A;  4DXF A;  1VQ9 A;  1L0W A;  5M9O A;  3PUV A;  4H0L C;  2EQS A;  1U4P A;  1N8R C;  1B50 A;  3BVZ A;  3MWY W;  1NR4 A;  3R8B A;  4DKA C;  1IHZ A;  2BDO A;  2JA8 B;  3DXJ C;  5EPJ A;  1WTH A;  1XX8 A;  1I5F A;  1VCI A;  1A3T A;  3RMH A;  1X3P A;  1LUZ A;  3A8I E;  3A8J E;  2B2T C;  1UEA B;  1NJI C;  3F2D A;  5CBA E;  1X3F A;  4B3T L;  4G57 A;  1JCK B;  1FGU A;  5G3L D;  3KUP A;  1KAA A;  3KLS X;  2UU9 L;  1LT4 D;  4UP7 A;  1QE6 A;  2B2V A;  5L37 A;  3S1M H;  3S9W A;  4X65 L;  1G91 A;  3NUC A;  4PV1 C;  1SFO B;  4IUQ A;  3RNU A;  2LXK A;  5IOD A;  4KHZ A;  2R6G A;  3T4A C;  4P75 A;  4ZKB B;  1LTA D;  5ELD A;  4PMC A;  1M8A A;  3C2P A;  2Z1C A;  1DOM A;  1O7Z A;  1JB7 A;  3M4Y A;  3SK5 A;  2WB1 E;  1LT5 D;  3GTO H;  4A3J G;  4LUV A;  4ZRZ A;  3R93 A;  5EPL A;  3GD7 A;  1F9P A;  2RDH A;  2BOS A;  1SXT A;  2E5L Q;  2PW5 A;  3S1M B;  1UUP A;  2BH8 A;  1X3E A;  5M3F H;  4JBW A;  3K59 A;  2R7F A;  2M00 A;  4RMF A;  4A3G G;  3BZC A;  2CCZ A;  5ISR A;  4Q5V A;  5IGE A;  5IIF A;  1B1Z A;  1EUJ A;  5AFW A;  1K0R A;  4Z9C B;  1HFN A;  2Z6K A;  1STG A;  2KOL A;  3CPF A;  1YHA A;  4GN3 B;  4QIW E;  5GAG C;  1Y14 B;  1IZ6 A;  2JSO A;  2V4D A;  2F0H A;  5CYU A;  2KED A;  4IUV A;  1C7Y A;  4OO1 I;  3HGB A;  1M1K C;  4NXN Q;  1B8A A;  4EQP A;  4RCO A;  2F3W A;  1D7Q A;  2XRQ D;  4GOP C;  1KIX A;  2P5Z X;  1WTP A;  3C1F A;  1H9K A;  3N6R A;  1ZEQ X;  1VQI A;  5KRU A;  2JEB I;  2NYZ D;  2RDF A;  3DWP A;  1U0L A;  4ZAI A;  5JEA J;  3PV0 A;  5FLM G;  4GZY C;  4C2M H;  4KK7 A;  2JA7 H;  2BA1 A;  3RZD H;  5M3M G;  1D1K A;  5K5P A;  1K8A C;  3SVM A;  2F3V A;  3HKZ G;  1FVI A;  3DEP A;  4C3J H;  2ASB A;  4YWM A;  2WIN B;  4EVO A;  3DUZ A;  2AQ3 B;  3CME A;  1VQ8 A;  2F03 A;  1QWY A;  3M4P A;  4C3I G;  5JVG 3;  2FMM A;  2NB0 A;  2KA7 A;  3HOU H;  2F0G A;  4V0B A;  2WKD A;  5IYB G;  5IGG A;  2E5L L;  2ZXO A;  5EQ0 A;  3I4M G;  5DNF A;  1NY4 A;  4C2M B;  2JA7 B;  2F3I A;  3NEM A;  4JI0 Q;  1LT6 D;  1D2B A;  2EY5 A;  2LSS A;  1LLR D;  5IYD G;  2K03 A;  1A6X A;  3UDX A;  2XTI A;  3I72 A;  3O13 A;  4LNQ A;  1YNJ C;  1SR3 A;  1EYC A;  3NPP A;  1VQP A;  4I65 A;  4JW0 A;  3NXW A;  4N9P A;  1N9W A;  1NSN S;  5JJI A;  1QNK A;  4O42 A;  1DM0 B;  3HOW G;  3UDG A;  1XTD A;  2L5T A;  1QZG A;  3F2B A;  1A2T A;  2RCF A;  2QA4 A;  2NUC A;  4G7O C;  1GO3 E;  4RAU C;  3MXU A;  1NMG A;  2UUC Q;  1MKH A;  2R7Z G;  4JC0 A;  4DU9 A;  3M4Q A;  3MTS A;  4RFB A;  1EWH A;  1EOT A;  1BCP D;  1CA6 A;  4HSV A;  1MGS A;  2HDL A;  3ZYY X;  1PRT C;  1PYB A;  1TWG H;  1IYV A;  1J9O A;  1L1O C;  5FJ8 G;  5ELB A;  3GTM H;  3K5N A;  1LTB D;  2KCM A;  2RCN A;  5GAE C;  1PDQ A;  1UWV A;  2E74 C;  4L5T A;  1YIT A;  1TKW B;  2HIX A;  1D5M C;  4TSS A;  4DV0 Q;  1JQY D;  1I50 B;  3MA2 B;  4X3T A;  4DR6 Q;  1FNU A;  3RLO A;  1TWH H;  1Q86 C;  5M5Y B;  1IKM A;  1B2T A;  1LTS D;  2MNA A;  3MHB A;  1KDA A;  4HJ5 A;  2EYH A;  2B2W A;  1H9S B;  1TR5 A;  4R1J A;  5KYI A;  2KCT A;  5CMD A;  1TWG B;  4X3K A;  3J81 E;  3L7Z C;  3CCS A;  4A3C G;  1CTM A;  2RF4 A;  3GTM B;  2F0V A;  4OGQ C;  3X3M A;  1IYU A;  1I3Q H;  4XYO A;  3L9A X;  1EL0 A;  2KHI A;  1VQO A;  1XJV A;  3NEN A;  4LJZ C;  3D4R A;  4GOP B;  1VF7 A;  1MIU A;  2PW7 A;  2YTX A;  3A54 A;  3TSS A;  1HRJ A;  3BVG A;  3IAY A;  4CDC C;  2L15 A;  2QDB A;  2OWO A;  2NVY B;  5JEA H;  5CV6 A;  1VQ7 A;  3KDF B;  4KJO A;  1YJW A;  3PO2 G;  1NMF A;  1STH A;  3TP6 A;  1VQB A;  4KD3 A;  5J22 A;  3CCE A;  5K36 H;  1EYD A;  5J39 A;  1I3Q B;  3H91 A;  4OO1 H;  5JOB A;  2C35 B;  1VQD A;  1Y1W H;  2UXC Q;  2D62 A;  2XIW A;  5C3W A;  2F0K A;  3D3R A;  4ULL A;  2EJM A;  4DR2 Q;  1VMP A;  5I9P A;  2EJF C;  4A3K H;  3A56 A;  1R4P B;  3KOJ A;  1EU4 A;  1PLF A;  4IPG A;  3J81 j;  3PIO 3;  1NR2 A;  3B6Y A;  2EPB A;  4KI0 A;  4XT1 B;  2OXP A;  1I94 Q;  4DR6 L;  4DAY A;  4CJ1 B;  1HHV A;  1RTN A;  4BY1 B;  5M5X H;  1CUK A;  5C44 G;  1E7Z A;  4A3B G;  1JWS D;  1VS0 A;  4JI8 Q;  2QKI C;  2SEB D;  4LF4 Q;  3SEB A;  5C3E H;  4BY7 H;  1Q81 C;  3FRP B;  3E3X A;  3EA6 A;  3S1N H;  1UE5 A;  4JI6 Q;  4A3K B;  5EKI A;  2YYZ A;  1E24 A;  2Z4H A;  1SMY C;  5C3X A;  3G6E A;  1HNZ Q;  1Q7Y C;  1EQV A;  3SXH A;  1TT2 A;  4OL7 A;  5DAU A;  4XYQ A;  5E4W C;  3S1R H;  2N78 A;  1E3P A;  5M5X B;  1SEB D;  3HOX G;  4KLK A;  3Q23 A;  4PZ7 A;  2WB1 G;  1PFN A;  1PH9 A;  3R2T A;  5DM7 3;  1U4M A;  5C3E B;  1DGS A;  1PRT B;  1KDB A;  3KJO A;  1JWU D;  1PH5 A;  1K0S A;  1D5X C;  1WTR A;  3FPP A;  2RHS B;  4MZ9 A;  3S15 H;  1C9O A;  2HUG A;  3KF6 A;  3UDF A;  1WTQ A;  3S1N B;  3HKS A;  2F0W A;  1G29 1;  4KY5 A;  2ZJQ A;  1WD1 A;  2NN6 I;  1E2Z A;  1STB A;  2UXC L;  1Q90 A;  2K01 A;  1DYQ A;  2XGT A;  1STN A;  3VDY A;  4WJW A;  4JVZ A;  4DR2 L;  3S1R B;  1LAB A;  1ZYR D;  1X54 A;  4RKB A;  2E2J H;  3CCU A;  2AWN A;  3GQB A;  1EIF A;  4O2D A;  2KHS A;  1V1P A;  1I94 L;  4UDU C;  4ZUJ A;  3HFZ B;  3ITP A;  5EKK A;  3K7A H;  3GTL H;  3F8T A;  4DK1 A;  5LMN W;  3S15 B;  4DR1 L;  5EAY A;  4QUC A;  2VY3 A;  1FL0 A;  1GD7 A;  3OPO A;  4JOI C;  4JI8 L;  4LF4 L;  4GNX C;  3W1B A;  1O7I A;  3NK9 A;  3S14 H;  5FO8 B;  4IO9 A;  4HSP A;  5C5L A;  2K05 A;  4KY7 A;  2WAQ B;  1PTO F;  4JI6 L;  1EYG A;  1N32 Q;  4RHS A;  1MSH A;  4L6T B;  4LF7 Q;  4A76 A;  2JA6 B;  1ET6 A;  2E2J B;  5JPN C;  1CQF A;  3AYH B;  3VR4 A;  1WOC A;  1PZI D;  3TS2 A;  1HNZ L;  5IWA Q;  4C56 C;  3G6J B;  2K4K A;  4K6D A;  3KBX A;  3E9H A;  3K7A B;  2I5M X;  5EKL A;  3GTL B;  2ICE C;  4MNO A;  2K5V A;  2VUM H;  1WTX A;  3I3C A;  2BE5 D;  3PIP 3;  3C1E A;  1DXM A;  5CBE E;  2AUK A;  1EIG A;  2KCC A;  1W6J A;  3TEH B;  1VQH A;  2X6L A;  3SE0 A;  4IOC A;  4X66 Q;  5G3L F;  3BG3 A;  1UEB A;  1E2V A;  4DK3 C;  2KVM A;  3OWF A;  1LTL A;  4NDX A;  5TSS A;  1K83 B;  1LYL A;  2QGQ A;  1SSO A;  2LXJ A;  5EGT A;  1YNX A;  3PO3 G;  5C0X G;  2OEO A;  1GVP A;  1K8M A;  1WCM G;  2GVA A;  1HQR D;  2GN5 A;  2Q2H A;  4EX5 A;  3H94 A;  3HG9 A;  3NEL A;  1YJ9 A;  5CC4 A;  4FNF A;  3TDQ A;  2RDG A;  1WJJ A;  2NVX H;  1STY A;  3J80 c;  2KCN A;  2MHV A;  1F9Q A;  3U4Z A;  4U68 A;  2L55 A;  4JI1 L;  1JJ2 A;  2UXD Q;  3SK8 A;  4A93 G;  3AFP A;  4J1M A;  1N32 L;  1SE4 A;  1WYD A;  4LF7 L;  2A69 D;  4A3D G;  1IL2 A;  1S40 A;  1ILP A;  4J6H A;  4MIU A;  4A3L G;  1W6K A;  1I6H B;  5IWA L;  3J7Y W;  1AZQ A;  2B2U A;  1V9P A;  4ZQ3 A;  2ZJP A;  3GTJ H;  1A2U A;  1Q8I A;  1TS2 A;  4A3E H;  1N36 Q;  1V43 A;  2MFI A;  2DJG C;  1EFW A;  4FF2 A;  4XXE A;  1F9S A;  3RD4 A;  3JAM i;  5FLX E;  1FR3 A;  4LMQ D;  3U50 C;  3PIO A;  5FO9 B;  3N52 A;  4X66 L;  4IFD G;  2JYO A;  4BBS H;  3VR5 A;  4FO2 A;  1LO5 D;  5C4X H;  4JV5 Q;  3J80 i;  3NWS A;  5HY6 A;  3HOZ H;  1MSG A;  1D5Z C;  3OW2 A;  1IXR A;  1Y1V B;  3S2H H;  3U9S A;  1CA5 A;  4HMJ A;  4QUF A;  1GUW A;  5IP9 H;  2VB2 X;  1JJC B;  3FPU B;  4LF8 Q;  1II3 A;  2I0Q A;  5BN5 A;  4A3E B;  4KD4 A;  4IPH A;  1QB5 D;  5J3B A;  2HQL A;  2NN6 H;  1EZ8 A;  3AU7 A;  2ZXP A;  1WI5 A;  5C5M A;  4GNX B;  5KGU A;  1HZA A;  5FOB B;  3BDL A;  1JE5 A;  1SNP A;  4OX9 Q;  1YHB A;  2M9V A;  1V1O A;  3GO5 A;  4QJF A;  5COY A;  5I2Y A;  1IBL Q;  1PYW D;  4B08 A;  4BBS B;  4JPB W;  4HJ9 A;  2MQH A;  4PMW A;  2L0C A;  1NAP A;  1GXD C;  1YEZ A;  4FDB A;  1AH9 A;  5E7N A;  3CXC A;  2UXD L;  2A73 B;  3S2H B;  4AYB B;  2HDM A;  1RJT A;  1ROD A;  3FHW A;  3MXN B;  3IKJ A;  4WJ4 A;  5CR3 A;  2JA9 A;  3AFQ A;  3A5Z B;  5JPM C;  3KF8 A;  3GV6 A;  4A75 A;  4A3M G;  5KNB A;  4F7X A;  3E9I A;  3L3O C;  4FXG C;  2ZTE A;  5ELN A;  3WOE A;  4ZLT F;  4XQN A;  4OIJ A;  2XSC A;  2R93 H;  1N36 L;  2ZXR A;  3A8K E;  1SRU A;  3NSW A;  1I4Q A;  2N88 A;  3OHX C;  1K3B C;  5FKA C;  2H5X A;  4Y52 H;  5IYC H;  1SFO H;  1JC7 A;  1RF2 D;  3BZD B;  4R8N A;  1QVG A;  1PFS A;  1AFP A;  3KBG A;  3JAM E;  1XYI A;  3OSO A;  1CM9 A;  3T1Y L;  4JV5 L;  2K28 A;  1JMC A;  2E2H B;  1S5F D;  4BXX G;  2PZW A;  3M7G A;  2PNH A;  1BCP F;  3ER0 A;  3QIA A;  4TVA B;  3GTK H;  1ENF A;  1PFM A;  4LF8 L;  1YNJ D;  2R93 B;  5T1G A;  1K9M C;  2PPB C;  4DR5 Q;  2MJ8 A;  1KHI A;  3FDT A;  3OYY A;  2A69 C;  2EE1 A;  4RKL A;  4RWS C;  4DV7 L;  2J0T D;  4AIM A;  3H09 A;  3Q6S A;  1W3S A;  2N8N A;  4OX9 L;  3DMU A;  4K0K L;  2HQE A;  1LTR D;  2AKW B;  1EZ6 A;  4M8A A;  4NMZ A;  3PSI A;  3VR2 A;  5M3F G;  1IBL L;  3H0G B;  2B29 A;  4ZUI A;  3OOC A;  1MHW C;  5A2Q L;  1IW7 D;  1HXY D;  3T1H Q;  3PIP A;  3ULL A;  3J7A V;  1F2M A;  3GTK B;  3E0J A;  2RA4 A;  3J81 L;  3HRZ C;  4LFB Q;  1MJE A;  3HOV G;  1PRT D;  1SYB A;  2IHE A;  4IZ8 A;  3T56 B;  1C0A A;  2RSO A;  4DUZ Q; 
#chains in the Genus database with same CATH homology
 1TY0 A;  4NW2 A;  3K5O A;  3TZD A;  2WV6 D;  4HCE A;  2F0D A;  5I9O A;  3RUZ A;  1DD2 A;  1WVL A;  3S2D B;  2G9H D;  4K2K A;  2EYM A;  1BR9 A;  2DN8 A;  1B44 D;  3EJI A;  4QCL A;  3T51 B;  4CBV A;  1AZP A;  1Z7T A;  4KN7 C;  4O1N A;  4MHE A;  5D65 A;  3CRL C;  1PZJ D;  4C3J G;  1ENC A;  2AWO A;  3RLF A;  1F9R A;  3QJY A;  3NTK A;  1HPC A;  2OF1 A;  1F77 A;  5F2D A;  1X3Q A;  4KJN A;  2NTT A;  1KLU D;  5KEE A;  1T5E A;  3BDO A;  4F87 A;  1JWM D;  1PXU A;  1O80 A;  1BO0 A;  4ODG A;  5JJZ A;  5CV9 A;  5KND A;  1XWE A;  2RQX A;  2K5Q A;  2F0L A;  4F8M A;  3A7L A;  3SK4 A;  3OMG A;  2Q8T A;  4TQU S;  1ICW A;  2K1B A;  1I4X A;  4A3J B;  4QMG A;  3M3Y B;  3DWA A;  1LV9 A;  2G9D A;  1SYD A;  2XNA C;  4A3G B;  1X32 A;  1Q1E A;  1H9J A;  1ET9 A;  3EFX D;  5C6A A;  3TBI B;  4QB4 A;  4LAA A;  4ME5 A;  1S5D D;  4R8I A;  4K5W A;  3X3N A;  1B4O A;  3D4W A;  3VYU A;  5NUC A;  2K04 A;  4XQJ A;  1I4G A;  1BXT A;  1IW7 C;  4DFA A;  2B2V C;  4WFN 3;  2WII B;  3OIQ A;  1SMY D;  3TP5 A;  2KUM A;  4DGZ A;  4R9W A;  3ND8 A;  2MP1 A;  4I7Z C;  5M3M B;  5ELE A;  3D8G A;  1TII D;  1SJH D;  4HTH A;  2K5W A;  3HKZ B;  3QG1 A;  1PFB A;  4C1N I;  1CZW A;  3NTI A;  4DNT B;  2A68 D;  1V8Q A;  5DM6 3;  1CHP D;  4C3I B;  4KKS A;  1SNQ A;  2GA4 B;  3VR6 A;  3H6M A;  4BA1 I;  1GUS A;  5EPK A;  2M2L A;  2PMZ B;  3U9O A;  2E75 C;  1TS5 A;  4PMB A;  2F4I A;  3GP7 A;  4CKB A;  4IAL A;  4CKC A;  2L11 A;  4HED A;  3I4M B;  1L0Y B;  4CKE A;  1ESR A;  2D2C C;  4G4K A;  5JEA G;  2ZT9 C;  1STE A;  5IT9 L;  2HCC A;  3DWQ A;  1GUG A;  5I6W A;  2B2Y A;  2L12 A;  3HOW B;  3CHB D;  5KNC A;  3I73 A;  5LHY 1;  1OXS C;  3MEH A;  2YU9 B;  3T16 A;  1HTL D;  1TS4 A;  2IT1 A;  3V96 A;  4IUU A;  1EYA A;  3S16 B;  2R7Z B;  2K5D A;  1I6V C;  2DY8 A;  3D4D A;  1JOR A;  4ZKC B;  1O78 A;  1SYG A;  4K8J A;  4FF3 A;  3AB9 A;  3IFD A;  4H13 C;  3BS1 A;  2EY2 A;  3KK7 A;  1EQT A;  4XT3 B;  2MGS A;  1PTO B;  3Q0A A;  2SDF A;  3QOL A;  1EY0 A;  1SYC A;  2RVL A;  3C46 A;  1OXV A;  4RH6 A;  1AN8 A;  2EZV A;  5COR A;  3ERO A;  3QO2 A;  3URY A;  2E2I B;  3D6C A;  1CK1 A;  3ONA B;  4G7Z C;  3LWU A;  2EYP A;  3EVQ A;  4CGY B;  4P2C B;  5C0X I;  1RDP D;  1Q3L A;  2IWH A;  3A55 A;  4C3H G;  2BCO A;  2J4X A;  5FLX L;  2FFK B;  2PCF B;  4LK1 C;  3TME A;  5HGT A;  2Z4I A;  3D6W A;  2A68 C;  3PO2 B;  3NBI A;  1HCZ A;  3MFY A;  2EYL A;  2PO4 A;  3GV3 A;  1ZKO A;  3OWE B;  3LWE A;  4K8I A;  1G2S A;  1Y8O B;  1NUC A;  1O7L A;  2LFN A;  1BNZ A;  4IUT A;  3DM1 A;  4FP5 D;  1KDC A;  1G8Z D;  3KLR A;  3AMU A;  2Z8L A;  2B2W C;  4IFD I;  5FO7 B;  1KAB A;  5C44 B;  1ENA A;  5FK9 C;  4A3B B;  1J8I A;  2F0N A;  1JB3 A;  4RA8 A;  4OIK A;  3W3A A;  2D9U A;  3K5M A;  3VYS A;  3VYT A;  3GTQ B;  2HCI A;  4XTC S;  4WOR A;  5E3F A;  3S1Q B;  4DA2 A;  1XTC D;  2KEC A;  4G7H C;  1CZG A;  3UI2 A;  1RTO A;  3HOX B;  4RGN A;  2AQ1 B;  3JAM L;  1A3V A;  2WB1 B;  3P20 A;  2RBM A;  2PZT A;  1F2Z A;  5CV4 A;  2RSN A;  3K0Y A;  2K6A A;  1MBY A;  3NE5 B;  3K6O A;  2PQE A;  1GUN A;  3P1H A;  4QIW B;  1DOK A;  1QJO A;  2AQ2 B;  2O4X A;  3CQZ B;  2F0U A;  5BN4 A;  3PUW A;  3R3O A;  2B2T A;  1A3U A;  3BYT B;  1PRT F;  5HUR A;  1BDO A;  4CHT B;  4K6L A;  4H7B A;  2MUY A;  1ESF A;  1YNN C;  4B9X A;  2XWJ B;  2F0I A;  3P7J A;  2FMC A;  3SHL A;  1ILQ A;  2VB3 X;  1CI3 M;  1CQV A;  1AP0 A;  1FNW A;  1M4V A;  3MZ5 A;  3OW7 A;  1WD0 A;  1RKN A;  1EY6 A;  1FGB D;  4PNY A;  3C3L A;  3NTH A;  4IQZ A;  3BYY B;  1U9R A;  5ELF A;  5IOC A;  1SYF A;  1QNU A;  3E5S A;  5C4J B;  5KYL A;  1H9S A;  1D6E C;  1B9N A;  3SDZ A;  2DNC A;  3PO3 B;  1KTK A;  1HTP A;  1WCM B;  2X6G A;  5D3I B;  1CFM A;  2NBF A;  4HCS A;  4X3S A;  3Q22 A;  3QOJ A;  1KNA A;  5M5W B;  1K8O A;  4A93 B;  4Q0F A;  4IFD H;  3RZO B;  1JR0 D;  3FMC A;  4A3D B;  3ERQ A;  2TMP A;  1HA5 A;  2B8G A;  2A5H A;  1UAP A;  4OHJ A;  2DNE A;  1EY9 A;  4XIG S;  1RD9 D;  3K58 A;  1U4L A;  2N55 A;  1PTO D;  2F0T A;  2F0F A;  2CW0 C;  4XDX A;  2AUJ D;  2F0J A;  3I70 A;  1EY8 A;  4RCN A;  2PZU A;  2SNM A;  3V05 A;  3J80 E;  1JE4 A;  3TZU A;  1SE3 A;  2O2L D;  1TS3 A;  1EY4 A;  1TY2 A;  5IGD A;  1EEI D;  3TN2 A;  3MAQ A;  4H44 C;  1KNE A;  3S17 B;  2EXZ A;  3DHQ A;  4KN4 C;  4FXK C;  1TVX A;  2F0E A;  2A6H C;  2F0O A;  2B39 A;  1XXG A;  3ND9 A;  1QIL A;  3R2I A;  4KTA A;  1R4Q B;  2B2U C;  1HFG A;  1TWF B;  3I91 A;  2EY6 A;  2R3Z A;  4A3M B;  3NQI A;  3LNN A;  1IL8 A;  2IJ0 A;  3PUZ A;  3T13 A;  5I4D A;  4HR7 B;  3NP8 A;  2IW3 A;  2VXW A;  1FNV A;  4BS9 A;  4QF4 A;  1S5B D;  1R9T B;  2QF7 A;  1PZK D;  2JXM B;  2EYF A;  1BOS A;  4ZYS A;  1V1P B;  3P75 A;  3NHH A;  3NWT A;  1DJR D;  2KQ3 A;  4IUN A;  3F2U A;  3CKI B;  4E6I A;  3GTO B;  3VA5 A;  2H4O A;  1D1I A;  4K5V A;  5M3F B;  2PNR C;  4Y7N B;  4M1U B;  3FEW X;  2O5I C;  3GTP B;  5KIX A;  1TWC B;  2SNS A;  1EY5 A;  2F0Q A;  3HOV B;  1EU3 A;  1OO9 B;  1AW7 A;  1C4Q A;  1PTO C;  1GUT A;  1B53 A;  1G2T A;  4ILW A;  2R61 A;  3IFT A;  2EY1 A;  3TP8 A;  1Q1B A;  2EVB A;  4K14 A;  4PQX A;  4RGM A;  1C8C A;  1VF5 C;  1DON A;  4F88 A;  4RGT A;  1WTW A;  4DK0 A;  3RZD B;  4FF1 A;  4MN3 A;  4FVM A;  2IX3 A;  2XN9 C;  4C3J B;  2LS0 1;  4HN7 A;  4N9T A;  3I4N B;  5I6Y A;  4RGO S;  3GTG B;  2IPK D;  1SE2 A;  5D3D A;  2C5C A;  5CV7 A;  5DEH A;  3LX0 A;  1OXT A;  5EBC A;  1WTV A;  1EEF D;  3HOU B;  1Y8N B;  5A35 A;  1ZXT A;  1BQQ T;  2XVS A;  2MPM A;  1T5X D;  1TU2 B;  5IGF A;  3VA7 A;  2F1M A;  5J1Z A;  1LTI D;  1VMC A;  2NVQ B;  4IUP A;  1IKL A;  3H3V C;  1OXU A;  3WOF A;  2ID0 A;  3VR3 A;  3IL8 A;  4FYD A;  2WP8 J;  3CU7 A;  3QWN A;  3HS0 C;  3M85 A;  5K36 G;  5A2Q E;  1A15 A;  2JE6 I;  4OO1 G;  1KLG D;  1TWA B;  1Z6H A;  5CV8 A;  3HZX A;  3HOY B;  2CVR A;  5ELC A;  2XWB B;  1CT1 D;  2D5D A;  2NVT B;  2E76 C;  1PTO H;  2F0M A;  2ENB A;  3NQT A;  1SNO A;  3Q24 A;  3HEJ A;  2WAC A;  2EOT A;  1JIC A;  1TWH B;  5T1I A;  3MXN A;  1RCV D;  3M4O B;  2CQA A;  4K2L A;  1DOL A;  4DAP A;  1SDF A;  3QB3 A;  3I8Z A;  1DZ1 A;  1LTG D;  4RHR A;  1EY7 A;  1SNM A;  2X69 A;  2BDN A;  4BWG B;  1DCZ A;  4DF7 A;  1U4R A;  1Q12 A;  1GHK A;  1SAP A;  4KKT A;  2BA0 A;  2EDG A;  1F2Y A;  4BBR B;  2L4N A;  1BUV T;  2FHT A;  1NCV A;  2E2D C;  4KHV A;  2KJX A;  3WDN A;  5I2X A;  1VDZ A;  4ID6 A;  3FVQ A;  1S4Z A;  3A7A B;  1TQO A;  1HQM C;  1Y1W B;  5E4X A;  2WKC A;  1RHP A;  1YNN D;  4K5X A;  1FD7 D;  1E0B A;  1S5C D;  2RKS A;  2L9H A;  2FIN B;  3VYR A;  3PMF A;  3G7L A;  1QOH A;  1BCP C;  5JAV A;  2OT2 A;  5C0X J;  5LL6 S;  4A3F B;  4EGV A;  3EQL C;  2JP1 A;  3D31 A;  2QIL A;  1BF4 A;  1LT3 D;  2NZ1 D;  1STA A;  1O7Y A;  3M7N A;  4BY7 B;  1E2W A;  2CHB D;  4EQO A;  5LL6 X;  5EJW A;  5BN3 A;  1EWC A;  4DNR B;  4KKU A;  4HMI A;  2SOB A;  2EYO A;  4ABN A;  4B9W A;  5C4H A;  4XQQ A;  3NBH A;  4C1N K;  4ZK9 B;  2LMC B;  1QG7 A;  1EFI D;  2TSS A;  2JEA I;  1I4R A;  1SBB B;  4NP5 A;  4NKL A;  2B2Y C;  2IL8 A;  3W2D A;  3V2T A;  3HP3 A;  1SND A;  4IFD J;  2Q8R E;  3I90 A;  4C3H B;  4FF4 A;  3E6Z X;  3SR1 A;  4FXD A;  4UAI A;  2KEE A;  3MVV A;  2H1E A;  1C48 A;  2O5J C;  2EJG C;  3PUX A;  5IGB A;  1AEX A;  5D14 A;  3J80 L;  1QCB D;  3SK6 A;  1SYE A;  2A6E D;  1L0X B;  5IT9 E;  4CJ2 C;  1G6Z A;  1ML0 D;  4JK1 C;  1GUO A;  4V19 0;  3S14 B;  2EYJ A;  1Y69 U;  4IN3 A;  3T53 B;  2NWG A;  1GOZ A;  2LKV A;  1SNC A;  3CRK C;  3I4L A;  4WRD A;  2B8F A;  1BBX C;  1H9R A;  2CW0 D;  1FYC A;  2I46 A;  1MI2 A;  1HA6 A;  1MD2 D;  1S5E D;  2VUM B;  2K33 A;  2QCP X;  1LTT D;  2ICI A;  2PYK A;  3MC0 B;  3PUY A;  2IX0 A;  3MXG A;  1ONL A;  4X3U A;  2I07 B;  3OMC A;  3BVM A;  5EBD A;  2A6H D;  2QEJ C;  1BCP B;  5C0X H;  2A74 C;  2K32 A;  4KMU C;  2NN6 G;  1F2L A;  1Y8P B;  1B3A A;  3FKI B;  1JOK A;  4TKO B;  5IGC A;  5JVH 3;  2B63 B;  2J7Z A;  3OIP A;  1SJE D;  4BA2 I;  2F0P A;  2NVX B;  3DEO A;  4L63 B;  1JOO A;  4HAE A;  1ZYR C;  3KLS A;  5CV5 A;  4DN4 M;  5CGK A;  4YIJ A;  1HUN A;  3K5L A;  3TP7 A;  1OXX K;  2FJ2 A;  1H9M A;  2L1B A;  3J7A F;  1UNS A;  4DXG A;  2Y0S B;  4KV6 A;  1EIH A;  2VNU D;  4KY6 A;  2IX1 A;  1JOQ A;  2Q8I B;  5E1F A;  2K7V A;  2JA5 B;  1I4P A;  4L8J A;  4IUR A;  2R92 B;  3GTJ B;  4A3I B;  2C9O A;  4J8Q A;  1HUM A;  1Z47 A;  4DAV A;  3MFG A;  2NTS A;  2DY7 A;  2A6E C;  1B9M A;  5C4X B;  1GHJ A;  3MXP A;  3HOZ B;  1I4H A;  2BE5 C;  4CJ0 B;  4TRD A;  2XRS D;  1PMR A;  4EQN A;  1CHQ D;  3K57 A;  1LAC A;  3BDC A;  4S3S A;  1WTO A;  1GJX A;  4U67 3;  2LY7 A;  2F0S A;  5C4Z A;  4DXF A;  5M9O A;  3PUV A;  4H0L C;  1U4P A;  1B50 A;  3BVZ A;  3MWY W;  1NR4 A;  3R8B A;  1IHZ A;  2BDO A;  2JA8 B;  3DXJ C;  5EPJ A;  1XX8 A;  1VCI A;  1A3T A;  3RMH A;  1X3P A;  3A8I E;  3A8J E;  2B2T C;  1UEA B;  5CBA E;  4G57 A;  1JCK B;  5G3L D;  3KUP A;  1KAA A;  3KLS X;  1LT4 D;  1QE6 A;  2B2V A;  3S9W A;  1G91 A;  3NUC A;  4PV1 C;  1SFO B;  4IUQ A;  5IOD A;  4KHZ A;  2R6G A;  3T4A C;  4ZKB B;  1LTA D;  5ELD A;  4PMC A;  1M8A A;  3C2P A;  2Z1C A;  1DOM A;  1O7Z A;  3M4Y A;  3SK5 A;  1LT5 D;  4ZRZ A;  3R93 A;  5EPL A;  3GD7 A;  1F9P A;  2RDH A;  2BOS A;  1SXT A;  2PW5 A;  3S1M B;  1UUP A;  4JBW A;  3K59 A;  2M00 A;  5ISR A;  4Q5V A;  5IGE A;  5IIF A;  1B1Z A;  1HFN A;  5AFW A;  4Z9C B;  1STG A;  2KOL A;  2JSO A;  2V4D A;  2F0H A;  5CYU A;  2KED A;  4IUV A;  4OO1 I;  3HGB A;  4EQP A;  4RCO A;  2F3W A;  2XRQ D;  1WTP A;  3C1F A;  1H9K A;  3N6R A;  1ZEQ X;  5KRU A;  2JEB I;  2NYZ D;  2RDF A;  3DWP A;  4ZAI A;  5JEA J;  3PV0 A;  4GZY C;  4KK7 A;  2BA1 A;  1D1K A;  5K5P A;  3SVM A;  2F3V A;  3DEP A;  2WIN B;  4EVO A;  3DUZ A;  2AQ3 B;  2F03 A;  1QWY A;  4C3I G;  5JVG 3;  2FMM A;  2NB0 A;  2KA7 A;  2F0G A;  4V0B A;  2WKD A;  5IGG A;  2ZXO A;  5EQ0 A;  5DNF A;  4C2M B;  2JA7 B;  1LT6 D;  1D2B A;  2EY5 A;  1LLR D;  2K03 A;  1A6X A;  3I72 A;  3O13 A;  1YNJ C;  1EYC A;  3NPP A;  4I65 A;  3NXW A;  4N9P A;  1NSN S;  1QNK A;  4O42 A;  1DM0 B;  2L5T A;  1A2T A;  2NUC A;  4G7O C;  4RAU C;  3MXU A;  4DU9 A;  3MTS A;  4RFB A;  1EWH A;  1EOT A;  1BCP D;  1CA6 A;  4HSV A;  1MGS A;  2HDL A;  3ZYY X;  1PRT C;  1IYV A;  1J9O A;  5ELB A;  3K5N A;  1LTB D;  1PDQ A;  2E74 C;  1TKW B;  1D5M C;  4TSS A;  1JQY D;  1I50 B;  3MA2 B;  4X3T A;  1FNU A;  5M5Y B;  1IKM A;  1B2T A;  1LTS D;  3MHB A;  1KDA A;  2EYH A;  2B2W A;  1H9S B;  1TR5 A;  5KYI A;  5CMD A;  1TWG B;  4X3K A;  3J81 E;  3L7Z C;  1CTM A;  3GTM B;  2F0V A;  4OGQ C;  3X3M A;  1IYU A;  4XYO A;  3L9A X;  1EL0 A;  4LJZ C;  3D4R A;  1VF7 A;  2PW7 A;  3A54 A;  3TSS A;  1HRJ A;  3BVG A;  3IAY A;  2QDB A;  2NVY B;  5JEA H;  5CV6 A;  4KJO A;  1STH A;  3TP6 A;  5J22 A;  4KD3 A;  5K36 H;  1EYD A;  5J39 A;  1I3Q B;  3H91 A;  4OO1 H;  5JOB A;  2D62 A;  2XIW A;  5C3W A;  2F0K A;  3D3R A;  4ULL A;  2EJM A;  1VMP A;  5I9P A;  2EJF C;  3A56 A;  1R4P B;  1EU4 A;  1PLF A;  3PIO 3;  1NR2 A;  2EPB A;  4KI0 A;  4XT1 B;  2OXP A;  4DAY A;  4CJ1 B;  1HHV A;  1RTN A;  4BY1 B;  1JWS D;  2QKI C;  2SEB D;  3SEB A;  3FRP B;  3EA6 A;  4A3K B;  5EKI A;  2YYZ A;  2Z4H A;  1SMY C;  5C3X A;  1EQV A;  3SXH A;  1TT2 A;  4OL7 A;  5DAU A;  4XYQ A;  5E4W C;  5M5X B;  1SEB D;  3Q23 A;  1PFN A;  3R2T A;  5DM7 3;  1U4M A;  5C3E B;  1PRT B;  1KDB A;  1JWU D;  1D5X C;  1WTR A;  3FPP A;  2HUG A;  3S1N B;  1WTQ A;  2F0W A;  1G29 1;  4KY5 A;  1WD1 A;  2NN6 I;  1E2Z A;  1STB A;  1Q90 A;  2K01 A;  1DYQ A;  1STN A;  4WJW A;  3S1R B;  1LAB A;  1ZYR D;  4RKB A;  2AWN A;  3GQB A;  2KHS A;  1V1P A;  4UDU C;  4ZUJ A;  5EKK A;  3ITP A;  4DK1 A;  3S15 B;  4QUC A;  3OPO A;  3NK9 A;  5FO8 B;  4HSP A;  5C5L A;  2K05 A;  4KY7 A;  2WAQ B;  1PTO F;  4RHS A;  1MSH A;  4L6T B;  2JA6 B;  1ET6 A;  2E2J B;  5JPN C;  1CQF A;  3VR4 A;  1PZI D;  4C56 C;  3G6J B;  4K6D A;  3KBX A;  3K7A B;  5EKL A;  3GTL B;  2ICE C;  1WTX A;  3I3C A;  2BE5 D;  3PIP 3;  3C1E A;  1DXM A;  5CBE E;  2AUK A;  1EIG A;  2KCC A;  1W6J A;  2X6L A;  3SE0 A;  5G3L F;  3BG3 A;  1E2V A;  2KVM A;  3OWF A;  4NDX A;  5TSS A;  1K83 B;  1SSO A;  5EGT A;  5C0X G;  2OEO A;  1K8M A;  1HQR D;  3H94 A;  3HG9 A;  5CC4 A;  4FNF A;  3TDQ A;  2RDG A;  1STY A;  2KCN A;  2MHV A;  1F9Q A;  4U68 A;  2L55 A;  3SK8 A;  4J1M A;  1SE4 A;  2A69 D;  1ILP A;  4J6H A;  4MIU A;  1W6K A;  1I6H B;  3J7Y W;  1AZQ A;  2B2U A;  4ZQ3 A;  1A2U A;  1Q8I A;  1TS2 A;  1V43 A;  4FF2 A;  4XXE A;  1F9S A;  3RD4 A;  5FLX E;  1FR3 A;  4LMQ D;  5FO9 B;  3N52 A;  4IFD G;  2JYO A;  3VR5 A;  4FO2 A;  1LO5 D;  3NWS A;  1MSG A;  1D5Z C;  1Y1V B;  3U9S A;  1CA5 A;  4HMJ A;  4QUF A;  1GUW A;  2VB2 X;  3FPU B;  1II3 A;  5BN5 A;  4A3E B;  4KD4 A;  1QB5 D;  2NN6 H;  1EZ8 A;  3AU7 A;  2ZXP A;  5C5M A;  5KGU A;  5FOB B;  3BDL A;  1SNP A;  2M9V A;  5COY A;  1V1O A;  3GO5 A;  5I2Y A;  1PYW D;  4B08 A;  4BBS B;  4PMW A;  2L0C A;  1NAP A;  1GXD C;  2A73 B;  3S2H B;  4AYB B;  2HDM A;  1RJT A;  1ROD A;  3IKJ A;  5CR3 A;  5JPM C;  3KF8 A;  3GV6 A;  5KNB A;  4F7X A;  3L3O C;  4XQN A;  4FXG C;  3WOE A;  4ZLT F;  4OIJ A;  2XSC A;  2ZXR A;  3A8K E;  3NSW A;  1I4Q A;  2N88 A;  3OHX C;  5FKA C;  1JC7 A;  1RF2 D;  3BZD B;  4R8N A;  1AFP A;  3KBG A;  3JAM E;  1XYI A;  3OSO A;  1CM9 A;  2K28 A;  2E2H B;  1S5F D;  2PZW A;  3M7G A;  1BCP F;  3QIA A;  1ENF A;  1PFM A;  1YNJ D;  2R93 B;  5T1G A;  2PPB C;  2MJ8 A;  3FDT A;  2A69 C;  2EE1 A;  4RKL A;  4RWS C;  2J0T D;  3H09 A;  3Q6S A;  3DMU A;  2HQE A;  1LTR D;  4M8A A;  1EZ6 A;  4NMZ A;  3VR2 A;  3H0G B;  4ZUI A;  3OOC A;  5A2Q L;  1IW7 D;  1HXY D;  3J7A V;  1F2M A;  3GTK B;  3E0J A;  2RA4 A;  3J81 L;  3HRZ C;  1PRT D;  1SYB A;  4IZ8 A;  3T56 B;  2RSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...