1MBYA

Murine sak polo domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
75
structure length
75
Chain Sequence
SVFVKNVGWATQLTSGAVWVQFNDGSQLVMQAGVSSISYTSPDGQTTRYGENEKLPEYIKQKLQLLSSILLMFSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords serine/threonine kinase
publication title The Sak polo-box comprises a structural domain sufficient for mitotic subcellular localization.
pubmed doi rcsb
source organism Mus musculus
total genus 11
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2002-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.930 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1mbyA00
5LHY1 1MBYA
chains in the Genus database with same CATH superfamily
1AZQA 1PH9A 1PV4A 4RAUC 3M4OB 3J80L 3CCMA 2K50A 1YNJC 4QQBX 3HKZB 1R9TH 4LF5Q 1TS4A 2JA8B 2VUMG 3BZCA 3I4NH 3TP5A 1HFGA 4PZ7A 2HQLA 4IPHA 4P2CB 4C3HH 5C0XJ 1HZCA 1IBKQ 4OO1H 4FDBA 3UDXA 1B1ZA 4KHVA 3DXJC 2F0QA 3ZJYC 2Q8TA 1IHZA 2JA6B 1UE6A 1B7YB 2Q8IB 1IBML 1JR0D 2Q8RE 4DNIA 4X3SA 4LMQD 1IYUA 1CKNA 1TWAB 2NN6G 1XNQQ 3L7ZC 3SE0A 1TWGH 2F0FA 2KEEA 5JJZA 4DR6Q 2ZTCA 1QJOA 3AFPA 3NENA 5G3LF 2UU9L 5A2QE 1BCPB 5C4XG 5M3FG 4IQZA 1VQMA 3NTIA 2PQAB 3OTOQ 2A5HA 3M9BA 4FXKC 1KHIA 3K5LA 3CC4A 1QUQB 4OWWB 2B3GA 4IFDG 5M5WB 3VA7A 2KEDA 1X3FA 2E2HH 2B2WC 3AFQA 1AZPA 3TP6A 2LY7A 4JBWA 1SMXA 4OWTB 3Q23A 1OXTA 4XQNA 4A3KG 3G7LA 2Z4IA 3K0YA 2A69D 2E2JH 1AP0A 2B63H 2AQ1B 4G4KA 5IY0A 3NPPA 4LFAL 3PGZA 3OWEB 3KDFA 1JJGA 2CHBD 4BXXG 2F52A 3SK5A 2NUCA 4HSVA 1SRUA 1WD0A 5ELCA 2N55A 3FKIH 1XX8A 2L11A 3QIAA 4KD4A 4CGYB 3CPWA 1I6HH 3FVQA 1PZID 4QF4A 4GLXA 1TWFH 1Q81C 2MPMA 1WCMH 3H6MA 3S9WA 1UUPA 5IODA 1F2YA 2X69A 2F0IA 1HZAA 2KHIA 1STGA 1LTLA 2KHJA 3NBHA 4XT1B 1PTOD 4DNTB 1X3EA 3K7AH 5CV6A 1SDFA 4XT3B 1YI2A 2R92G 4FF4A 1SJHD 2EXZA 1A62A 3DHQA 4A3IH 4X62Q 3R8BA 2HD3A 3E9IA 2EJFC 4ZKBB 1HJPA 1RJTA 1G2SA 1Y14B 4HMJA 2DUDA 4H13C 4QIWB 4A3EG 1SNCA 2EVBA 1XTCD 3X3NA 5TSSA 2J0TD 1E2VA 2QGQA 3ONAB 3E9HA 1DONA 3NELA 2NVYB 2Q2HA 4QUFA 1PH7A 2L4NA 2FFKB 2L0CA 5COYA 2F03A 1Y1VH 1PH2A 4WJWA 4LW1A 3SDZA 4CJ2C 3CCQA 3PO3G 3S1MB 2O2LD 3KF6B 1A15A 4YHHQ 1AN8A 2D2CC 1C9OA 1E2ZA 3PF4A 2TMPA 2F3WA 2EQSA 5EKIA 3STBC 2CW0D 5C0XH 2H5XA 5IP9H 1L1OB 3F8TA 5ELBA 1WYDA 4C2MH 1ASYA 4A3BG 1WTHA 2Z9HA 4GLVB 3RLFA 1NUCA 1P16A 2LFNA 3NE5B 2BE5D 4UAIA 1DZ1A 4G7ZC 5DM63 1GXDC 2SOBA 3PUYA 4DR3Q 1Y1WB 2R7ZB 1JC7A 4MZ9A 4WJ4A 3HFZB 5EPJA 4KI0A 2BH2A 2K5NA 3T4AC 3AB9A 4FO2A 1G91A 4C1NK 4JI8L 4QMGA 4QCLA 2E8GA 4X66L 4JI2Q 4KKSA 1HNWL 1A6XA 4DU9A 4QGUA 2QEXA 1CTMA 1PYBA 5LMNQ 1K8GA 3VYUA 1TWCH 4RKLA 3CW2C 1BVSA 5FKAC 3I7FA 4RGTA 2HUGA 3MAQA 5NUCA 4IUTA 4CHTB 5IGFA 2ASBA 3RN2A 5C44G 4DV0Q 2F0OA 1VQKA 4QB4A 2HIXA 3IFTA 4DUYQ 4FF3A 3MHBA 1RKNA 4KKUA 5I9OA 3CCVA 4LF5L 5GADC 2PI2E 1WTOA 4XQJA 4ZCKA 5DEHA 2K14A 4IPGA 5K5PA 3VR4A 3S16B 1LYLA 3QO2A 4DAPA 2VUMB 5EKLA 3U4ZA 1X32A 3SK8A 4L5QA 2QCPX 3ULLA 3ULPA 1NTGA 4P75A 1JOKA 4YWLA 4RMFA 4DXGA 3S2HH 2EYLA 4CKCA 2OT2A 2I5LX 2Y0SG 5FO7B 3S1QB 3GTKH 4ME3A 1ICWA 2XWJB 4L63B 1XNQL 4A3LG 3NHHA 3I4OA 3PO2H 4C3JH 5EPKA 5FJ8G 4CJ1B 1B70B 2MP1A 4A3MH 1XMQL 3TEHB 1U9RA 1NE3A 3IAYA 5D14A 2PNHA 3OTOL 3DUZA 2WB1B 2VW9A 5IYDH 4WRDA 3AMUA 5IYCH 3HOUG 1WTXA 2F0HA 1GUTA 1LTAD 4POGA 1TVXA 1Z9FA 1ZEQX 1KXLA 3KBXA 1PH5A 3KF8B 1XPRA 1I3QB 1Q8KA 2B2UC 2C9OA 3CRKC 1BCPF 1QNKA 3JAME 4XXEA 3ZYYX 1K83B 3E0JA 1D5ZC 4P71A 2NTSA 4XDXA 3D8GA 3TZDA 1VQGA 1PRTD 2JA8H 3F2UA 2VQEQ 5E1FA 1G6PA 3D4DA 1XWEA 5JPNC 4KHZA 2JP1A 4DV7Q 1QUQA 3SK4A 1VDZA 3M7NA 4MIUA 1IBLQ 1UAPA 2K28A 2JA6H 3SVMA 1ENFA 1HNZQ 1BXTA 1DGSA 2CCZA 3I3CA 4PQXA 3K57A 1TWAH 3H94A 3X3MA 1H9MA 2CKZB 1S5ED 1HCZA 3PCOB 3HOVB 2F0SA 2RHSB 2HCIA 2EYMA 5IGGA 2BA1A 3IKJA 1T5EA 2R93G 1JOQA 4H44C 1GO3E 3KLRA 4LUZA 2E2IB 3KLWA 1B3AA 4V0BA 1JICA 1BCPC 1TKWB 4BY7G 2K5VA 2F0MA 1JE4A 4X62L 4KY6A 1A3VA 4R1JA 4ZLTF 2R92B 1BBWA 1T5XD 2LKVA 1D6EC 3K5MA 1LUZA 5GROA 4KN7C 1JWSD 2ZJRA 1S4ZA 1Q8IA 3E5SA 3VDYA 1U4MA 2BE5C 1XYIA 2ZM6Q 5C6AA 1N32Q 4EQ5A 3GTJB 3A8JE 4JI7L 1TY2A 4TRDA 3BU2A 1MIUA 4Q5VA 4YHHL 1LT3D 1QVFA 5CGKA 2LMCB 1XMOQ 4DF7A 3PO3B 4QUCA 1ESRA 3DWAA 2R3ZA 4LWCA 3MVVA 5M5XB 1CKNB 1ENCA 4IO9A 3GQBA 1CK1A 3UE1A 4DR3L 1NCVA 4JBMA 1CKMA 3HOZB 3EQLC 2R6GA 4FF2A 4TQUS 3R93A 1Z7TA 3CHBD 4RHRA 4UP8A 3F2DA 5C5MA 2WINB 2QKIC 4JI2L 3CAMA 1RODA 1IBMQ 3DM3A 5BR8Q 3TBIB 1PRTF 3MEHA 4A3DH 2KCTA 1DCZA 1H9SA 2PYKA 4JI3L 1SR3A 2NVYH 3MC0B 2NBFA 3UDFA 3URYA 3IL8A 1U0LA 4DV0L 3RD4A 3S1MH 4XYOA 4X65L 2RVLA 5M9OA 4RCOA 1VQ7A 3PUXA 1HTPA 4XQQA 5FOBB 3H15A 3TP7A 4L5TA 3BS1A 1VQEA 1V43A 1FNWA 1KC8C 4DAYA 1W3SA 3J81i 2K01A 5L37A 4OL7A 1SE2A 1PH4A 2J7ZA 4RA8A 3C2PA 2L12A 4K2LA 4JI0L 1Y1WH 2R7ZH 2IT1A 1L0XB 4UP7A 1SAPA 2EY6A 1V8QA 4JW0A 4YY3Q 1VQIA 3NBHB 1PRTC 1A3TA 4ULLA 4E6IA 2ZJQA 2E75C 2NN6I 1JOOA 2K5WA 4PZ8A 4IOCA 4IJHA 4FNFA 2VZAA 1SMYD 4DKAC 2K05A 1HA5A 1YJWA 5I2YA 2RSOA 1QB5D 5EPLA 1B9MA 3KUPA 3WOEA 2JEAI 3BVZA 5IIFA 1I4GA 1F2ZA 3FPUB 1SBBB 2K5DA 1XTDA 1VQ9A 1DYQA 2H1EA 1GUOA 3AEVA 3P1HA 4GZYC 1XNRL 2IHEA 5JVH3 4K6LA 1NR2A 5J1ZA 2C5CA 1CSPA 1Q1BA 4I7ZC 4R9WA 1ICFB 3DM1A 2VL6A 1PFBA 1Y8PB 2PCFB 4ZUJA 4HTHA 5GAHC 3GD7A 2VQEL 1AE3A 4H0LC 3W2DA 2AQ3B 2E2DC 2RDFA 3K59A 1FL0A 4HJ5A 3S16H 3F1ZA 1NY4A 4ODGA 2VUMH 1IBLL 2UUCQ 5GAEC 4J8QA 1PFMA 5EAYA 3HOWB 5DNFA 2BH8A 3KF8A 1HNZL 1SFOB 5H1SE 1K0SA 4ABNA 4G7OC 3EROA 2QEJC 1B50A 2F0PA 4ILWA 3KFUA 4X3TA 2Z6BA 1O7YA 4YIJA 5CORA 1BUVT 3VR5A 2NVQB 4IUNA 3L3OC 3PIPA 1K9MC 1X9NA 3NQTA 2KCCA 1IXRA 4DR2L 3VR2A 1WTWA 1DM0B 1C4QA 4A3FH 2PW5A 2R7FA 2PMZE 4IURA 3NWSA 4Q0FA 5ELOA 3H0GG 1S5DD 1VQLA 1E1TA 1I3QH 1SYCA 5IYBG 4IFDH 3FHWA 1K83H 1D1KA 2O4XA 1AE2A 3FMCA 1JWUD 2PW7A 2E74C 2ZM6L 2WAQE 1VQ5A 5LMUQ 1N32L 4EGVA 5K36G 4IOAA 5C4HA 4OX9Q 1JT8A 4O1NA 4X66Q 1OXSC 1HNWQ 2PNRC 3KJOA 1R4PB 4B9XA 1VQFA 4LNQA 4BA2I 3ND9A 1N36Q 3ITPA 1XMOL 1X3PA 1XJVA 3DMUA 2FXQA 5IT9E 1PTOB 1C48A 2NWGA 3MEFA 1ESFA 1PFNA 4CKBA 3CRLC 3ER0A 3HOVH 3J81L 2RCFA 5C4ZA 1K28A 5IOCA 4LF6Q 5CBEE 1MJCA 4HMIA 4KJNA 2VS1A 2E2IH 3PIO3 4A93G 1SEBD 1D7QA 1E7ZA 1DD2A 1J8IA 3S14B 1KQSA 1LLRD 2K5QA 1S40A 3HKSA 3W1BA 3T1HL 1OO9B 1XPOA 2AQ2B 3GTQB 1XXGA 2RDHA 2I46A 5BR8L 3C3LA 4L5RC 1I50B 5CYUA 2K5HA 4EX5A 4IZ8A 4DGZA 2B2VC 3SGIA 1VQNA 1RF2D 3VR3A 1YHBA 4GKKQ 4BY1G 2LXJA 3PUWA 1B44D 3GTJH 1GJXA 3GTMB 1XMQQ 3HOYH 2NZHA 3QOLA 2RBMA 3PQIA 1EQTA 4J1MA 2A68D 2OWOA 2CH4A 2JEBI 1VF5C 2F0GA 3BVMA 4DR5Q 3PO3H 4HAEA 1LM0A 4V190 1B4OA 4K6DA 5FO9B 1IW7D 2BOSA 4LK1C 4B3RL 1X54A 2ZXPA 2ZXOA 5FLXE 2HDMA 5CV8A 3I4MH 1S5CD 5M5XH 1EWCA 4HR7B 5ELDA 4FVMA 1U4LA 4KK7A 1EWHA 3I56A 1FYCA 3HOZH 4YY3L 1KABA 5M3MB 5T1GA 3TREA 4GNXA 3ND8A 2ZT9C 1LTSD 4R8IA 1CUKA 3K6OA 3CMEA 2BCOA 2IX3A 2CQAA 2HIVA 4YWMA 4TSSA 4ZKCB 5FLMH 3P75A 4UHVA 4MN3A 2A6EC 1LTGD 2XWBB 4NMZA 4BBSG 1IYJB 3JAMc 3H3VI 4O0AA 1MBYA 4JI1Q 4BBRG 4F7XA 1EFID 4N8FA 4LF4Q 1G6ZA 4IPDA 3MTSA 1GD7A 1H9KA 2D62A 3KK7A 1WOCA 4XYQA 1PH8A 2XNAC 3K81C 1AW7A 4RHSA 1H9RA 1YZ6A 3DWQA 4QJFA 4R4CA 4S3SA 3G6EA 2AUJD 2IWHA 5JEAJ 5EBCA 3S2DB 4HIOA 2MJ8A 3M4PA 1R4QB 2UUCL 1CI3M 3I4NG 1I4RA 3NXWA 4N8X1 4C3IG 4GNXC 4C3HG 1TWHH 2JA7H 1D5XC 2OF1A 4OO1G 2Z4HA 3SR1A 4DAMA 3L9AX 5GAGC 1ZKOA 4OXPA 1Q12A 2EYPA 3GTGB 1Q7YC 1KNEA 2DNEA 1I4HA 1SNPA 2DJFC 3HKZE 1PZKD 4JI7Q 1PXUA 1O7IA 2XN9C 2V1CC 5FJ8H 1GVPA 2L9HA 1RHPA 2CQOA 2F4IA 2AWOA 2BDNA 3NEMA 3I8ZA 1ML0D 3BG3A 1I4QA 2OCEA 1E22A 5AFWA 2Q2IA 4DA2A 1JMCA 3A0JA 3NWTA 1MD2D 2QILA 3PIP3 2Z6KA 1QCBD 1H9SB 1PRTB 5FO8B 1BO0A 1EWIA 2AHOB 4DV2Q 3DEPA 1G8ZD 1SYEA 5IGBA 3FEWX 4U673 4LUVA 2MUYA 4JV5Q 5KGUA 5LMUL 1UEBA 4MHEA 4OX9L 4A3GB 1EIFA 3HOWH 4LFBQ 3GTPB 1SFOH 2B63G 2EPBA 1HR0W 4JI3Q 3W3AA 1N36L 4DAYB 3I4LA 2KENA 3SEBA 4GOPA 3HOXH 2UUAQ 5LL6X 1PLFA 3U58A 1EEID 1LV9A 4N9PA 1B9NA 4HIMA 4YCWA 1KAAA 4AYBB 2NVQH 3OIQA 1FNVA 3D0FA 3IFDA 4K14A 1Q90A 2XVSA 4OGQC 4X65Q 4U68A 1Q86C 2PO4A 4IPCA 4LF6L 2Z6KC 3U9SA 1CFMA 4MTKA 2JE6I 1G291 4ZK9B 3J81j 3J7YW 4DV1Q 2FHTA 1EY9A 1K3BC 5KEEA 4PMCA 2CFMA 1PTOF 4Y7NB 5C3XA 1RTNA 3N52A 2OQKA 5GQOA 2AWNA 4A3IG 1WD1A 4JYAQ 4JI0Q 1VQ4A 3LGJA 2JA5G 2EOTA 4GS3A 3GTLB 1KAWA 1EY7A 4TKOB 4GKKL 4MNOA 3HZXA 2A69C 3MXUA 3I72A 4GOPC 3T56B 4DK1A 4Y52H 1Z47A 4R4IA 5C4XB 1SXTA 4KD3A 5M3FB 1Y1VG 4RH6A 4DR5L 3EIVA 5EQ0A 1FVIA 5IGCA 4PZ6A 3MWYW 5JEAH 2OEOA 1TT2A 1PTOH 4QIWE 2UUBQ 3M4OH 1QG7A 1KDCA 2K7VA 1XNRQ 5HGQA 5C0XG 5IP9G 2WIIB 3K5NA 2ALYB 1PTOC 1CZWA 1Q1EA 3J7A5 1OXVA 3CD6A 5I4DA 1MKHA 1I4XA 1TQOA 1EYCA 2FMCA 2A74C 4A3KB 1JORA 2O5IC 4EVOA 3UDIA 1Q82C 1LTBD 3GP7A 2O5JC 1DOLA 3GTQH 3M7GA 3PMFA 4HCSA 1I50H 2A6HD 3LWUA 1PHJA 2KECA 4JI1L 1F9RA 4LF4L 3A8IE 1EFWA 2UXBQ 1EYAA 3GTMH 4A3JG 1QVGA 4NXMQ 3QWNA 2BDOA 4DR2Q 3G71A 3S1RB 3Q22A 1VQOA 1V1OA 4ALPA 1YNND 4DV3L 3OSOA 5LHY1 3TQYA 2VQFL 2CW0C 5EGTA 5M5WH 2VY3A 1RL2A 2F0KA 4HJ9A 1K8AC 2F3VA 2MNAA 1SLJA 2PPBC 3W1GA 3QOJA 1UNSA 1EEFD 1KRSA 1R9TB 4K5XA 1YJNA 5IWAQ 1EU4A 1SROA 1ZYRD 4C3IB 5ISRA 3O13A 4AYBE 4A3EB 1UWVA 1VQHA 1CA5A 5M3MH 4CKEA 4G7HC 4UDUC 1UE5A 4A3CG 4IUUA 3TS2A 1SNMA 1ONLA 3HS0C 4ID6A 4A76A 4C3JG 1AFPA 1JQYD 4NXNL 3U9OA 2EE1A 3D4WA 1HNXL 2FJ2A 3KBGA 4GN4B 2WV6D 2NB0A 4HCEA 2DJGC 5IYDG 3H09A 1NMGA 3QB3A 3RMHA 3MXNA 4JPBW 4HJ7A 1Y8NB 1JJCB 1SYFA 1M4VA 1JB7A 4A3BB 1A8VA 2IHFA 4DV2L 3AYHB 4IUVA 5FK9C 4B9WA 2RF4A 3J7ZC 2NVTB 5KNCA 2LS01 1FD7D 2RSNA 4JV5L 1S72A 3S2DH 1GM5A 1F9PA 2WB1E 2XIWA 3T1HQ 1GUSA 2WP8J 1PH3A 1LABA 1YHQA 5D3IB 3CF5A 4LFBL 4IFDJ 3G48A 4RGNA 3BYTB 4FYDA 2E2JB 4Z9CB 2UUAL 5C4JB 4X3UA 2B63B 1EY4A 4R4OA 1EYDA 4CJ0B 3M3YB 1TXYA 2I0QA 3KOJA 2WKDA 2NZ1D 1I94Q 4L8JA 5C44B 4GNXB 2ID0A 2UXCQ 3VR6A 2HHHQ 5CMDA 2EIFA 4DV1L 1V9PA 3A7AB 1K0RA 4EQNA 3T51B 2B8GA 1VF7A 4K8IA 1EU3A 2HDLA 4BWGB 1HUMA 1IKLA 1YNJD 4B3RQ 1YHAA 4RWSC 4DNRB 4DV4Q 3AU7A 1HR0Q 1HFNA 2ZTDA 5CC4A 1G2TA 3D3RA 3MA2B 5JPMC 4JYAL 3EFXD 4PV1C 2L15A 5IP7G 1EOTA 3TDQA 2MO1A 1EYGA 1G51A 2Y0SB 2AMCB 3UE0A 4WJ3M 2J4XA 2ZJPA 3EVQA 1VQ6A 2JA5B 1HRJA 3ERSX 3M4YA 4DPGA 4L6TB 4L5SA 4A3GH 1CQFA 3E6ZX 4O42A 3T1YQ 3PUZA 3NK9A 3WWVA 3A55A 1L0YB 3QG1A 2OXPA 3BZDB 5FLXc 1JWMD 2K75A 2QF7A 4OHJA 2SNSA 2NVXB 3PSIA 3HGBA 4RKBA 1EY5A 1TIID 2UUBL 4X3KA 4K2KA 3HOUB 3FPPA 3NTHA 3F2BA 5HURA 2EXDA 2N78A 4RFBA 1K3RA 4RGMA 1EZ6A 1NMFA 4LF8L 3TSSA 3KYHC 5KNDA 4B08A 2M2LA 2KUMA 4C2MB 2EJMA 5I6YA 1X65A 5HGTA 4LJZC 2YV5A 4LF7Q 1WJJA 3E3XA 5J39A 1C8CA 3S1QH 1F2LA 4K0KQ 3CMAA 2YTVA 2X6LA 4JI4Q 1W6JA 5C5LA 1MGSA 2LXKA 1HZ9A 2ICIA 3CQZB 4A3DG 2CWAA 1KNAA 2R61A 1SE3A 2PZUA 3NUCA 1KRTA 4X64Q 1B53A 1Y8OB 2UXBL 2NN6H 1RD9D 5G3LD 1E0BA 4DK3C 4NXML 2EDGA 4B3ML 1QILA 3LNNA 2C35B 1DJRD 3S1NB 1PFSA 5C4XH 5M3FH 1I6VC 1CKOA 1EY0A 4A3JB 3PUVA 1FGUA 1EY8A 2R93B 3V05A 3KLSA 5A2QL 1HA6A 4AH6A 1LTTD 4FXDA 2F0JA 1J9OA 1P8LA 4R4TA 2RDGA 1F2MA 3MXGA 4BY7B 3A7LA 4QY7A 1O80A 4GOPB 1IL2A 3QJYA 5IWAL 2Z0SA 1VMCA 2WKCA 1YIJA 2FINB 4OO1I 1IKMA 2F4VQ 3FP9A 3SHLA 1NR4A 4YCUA 2DN8A 2F0DA 1RCVD 4A3KH 1Y1WG 2R7ZG 1GUNA 3S15B 3I90A 4JOIA 5JJKA 3BZKA 1FR3A 4DR7Q 2WFWA 2ICEC 3MFGA 1MJEA 1YBYA 1VMPA 4KJOA 2F0EA 1STAA 2BA0A 1STHA 4BXXH 1WI5A 1FNUA 5CBAE 3NTKA 2MQHA 1RTOA 2F0VA 4P73A 1N34L 2PQEA 2OTLA 2EY5A 3TZUA 2Y0SE 1HH2P 5AJ3Q 1SSOA 2R7DA 4MTNA 3STBD 1Y69U 1J5EQ 2KA7A 2IX1A 3I73A 1C7YA 1JE5A 1ASZA 1KL9A 1V1PA 3ERQA 1SE8A 4KV6A 2EYJA 3M85A 3TP8A 2R92H 1I4PA 2YTXA 1SN8A 2DY7A 3GV3A 1MHWC 3K80C 2SEBD 2ES2A 4JOIC 3RZDB 2RQXA 3GO5A 4DV6L 3V2TA 4C3IH 4KN4C 5CR3A 4A3EH 2B2WA 2KCMA 4LFCL 1NSNS 1X3QA 5J3BA 1BF4A 3JAMi 2G9HD 2QDLA 1PZJD 1CHPD 1I94L 3NSWA 1SMYC 4K5WA 3IRBA 1S3OA 1EQVA 2UXCL 2HHHL 3D6CA 3M4QA 4ME5A 4A4IA 3S17B 1YNXA 1S5FD 2JYOA 2WB1G 2IW3A 3BJUA 4DV4L 4A3FG 1KIXA 1CM9A 4BS9A 1HR0L 4PG3A 1N33L 1HQMC 4A3BH 2OTJA 2DY8A 1MSGA 1KLGD 2NVTH 1ET9A 1NJIC 1E2WA 2K1BA 4JI5L 3F2CA 1NNXA 4HN7A 3FDTA 2HQEA 2FMMA 1TS5A 1H95A 2X6GA 1DOMA 2A19A 4ZUIA 3T1YL 4EQOA 3PV0A 1W6KA 3GTOB 1II3A 4DN4M 5IGEA 1D1IA 1Q46A 3RZOB 2IY5B 4JK1C 3Q6SA 2KHSA 5C3EG 2YTYA 2Q2UA 1B8AA 5C4JH 3BVGA 2QDBA 4FP5D 3A54A 4GKJQ 3PF5A 1GOZA 4YWKA 3J80E 3M3YH 2MFIA 1UE7A 3J81E 2E5LQ 1BBXC 1PDQA 2K4KA 4J15A 5C44H 5C0XI 5JJLA 3HOVG 4DR1Q 4DV3Q 2B2TA 5EKKA 2VQFQ 3VYTA 1STBA 2OQ0A 4CDCC 3JC66 4JBJA 2E76C 3D4RA 3SK6A 1HQRD 2M9VA 3CU7A 1IYVA 1ET6A 3MFYA 4LF7L 1B2TA 1M1KC 4XIGS 4LF9L 4N9TA 1CHQD 4K0KL 1LT6D 3RLNA 3CP0A 4JI4L 2ENBA 3OWFA 4WFN3 1SE4A 4ZQ3A 2Q2TA 4HJ8A 3J7AV 3MXNB 1HUNA 4X64L 2JA5H 3U4VA 4A3LH 4NB3A 1KLUD 4JVZA 2VB2X 1U4RA 4A3DB 4NXNQ 3Q24A 4XTCS 4JI6Q 1SNOA 2B29A 2K33A 1HNXQ 3H3VH 4IN3A 3HOYG 3TS0A 1EY6A 1TY0A 2NVXH 2L1BA 2NYZD 1CQVA 2QW7A 2B2TC 2M00A 3HOUH 4RCNA 2UXDQ 3DEOA 2K6AA 1CT1D 3A5ZB 3H3VC 2K04A 4AIMA 1H9JA 1VQCA 1BCPD 1SYDA 5EBDA 3H0GB 1FGBD 5E7NA 2D5DA 3DLLA 4B3SL 3I4MG 2F4VL 3HEJA 1BKBA 1SYBA 3I55A 3H91A 4AQYL 1TR5A 2KQ3A 2JA9A 2Z8LA 3W5OA 3JAML 4TVAB 3A56A 3HOZG 3N6RA 2QA4A 2CWPA 3ULJA 4DR7L 2V4DA 1HXYD 3FRPB 2A73B 1JCKB 2VNUD 4DUZQ 2F0WA 4KHPQ 5J22A 2I5HA 2SNMA 2RA4A 5FLMG 1X6OA 4GN3B 3CQZH 3FKIG 4OIKA 1QNUA 1HZBA 3T13A 3OIPA 5DM73 4KMUC 4DFAA 1STYA 4A75A 1WCMG 2D9UA 1D8LA 3CCUA 5AJ3L 5F2DA 3S1NH 1J5EL 3KLSX 1GHJA 1QZGA 1PH6A 2A68C 3AQQA 2EYHA 4A3JH 2XGTA 2WAQG 5CV9A 1FJGQ 2TSSA 4F87A 2R93H 2LSSA 4A93B 5IGDA 1YEZA 4UP9A 3HG9A 1IW7C 5LL6S 2KVMA 4DV5Q 5CV5A 4BY7H 3VYRA 4IJLA 1QZHA 3CKIB 2JXMB 4IUPA 3VA5A 1U5KA 1YVCA 3LX0A 2JK8A 1STEA 3ICEA 1TS3A 2JA7G 1KD1C 2B2UA 1IBKL 1EOVA 1CA6A 4CDEC 3OOCA 5C3WA 4OONA 4DR4Q 2NTTA 3CCLA 4OELB 2YU9B 2Z1CA 1BBUA 3S15H 2RHQB 1M90C 4H02A 5M5YB 4BY1B 1UEAB 2B39A 2MO0A 3K5OA 3WOFA 1QWYA 4A3CH 4KKTA 2SDFA 1QVCA 3UDGA 4K8JA 4DR6L 3RN5A 1VQ8A 2P5ZX 1ILPA 1BNZA 5ELEA 3P7JA 3K7UC 4ZYSA 3CC2A 1EIGA 1A0IA 4OEMB 4CBVA 3BDOA 2ZTEA 5DLQE 3S24A 1ILQA 2KBNA 1N9WA 3TRZA 4A3FB 4LF8Q 3S14H 1Q3LA 2JSOA 1EIHA 5KYLA 1C0AA 2JJQA 3HP3A 4KY7A 2EYFA 5ELNA 4OWXB 5JJIA 4M1UB 2EY1A 1ZXTA 3I70A 4G57A 3RZDH 2PQAA 5JAVA 3HOWG 4FF1A 2RKSA 5BN3A 4DK6C 3Q0AA 4GKJL 4BBSB 2K52A 1T9HA 2I07B 2XRQD 3L0OA 4BBRB 2HCCA 3OMGA 1EQRA 1LACA 4B3MQ 5C3EB 3HOXG 1VQPA 2E5LL 2B2YA 2KCNA 1HHVA 4JC0A 4DR1L 4NDXA 3V96A 4BA1I 4F88A 1NBWA 3C46A 3S17H 2GA4B 4P72A 1X55A 1LTID 2VXWA 3GDEA 1SNDA 2IL8A 3G6JB 1PVOA 1X3GA 1EZ8A 4I7AA 2PI2A 2NZOA 2VB3X 1S5BD 5KNBA 4KY5A 3D31A 4HIDA 4ZRZA 3I4NB 3NQIA 2EJGC 1D2BA 4C3HB 1HPCA 5CV4A 2B8FA 1STNA 3BDLA 2MGSA 1F77A 4P74A 5BN4A 4H7BA 1LT4D 1EUJA 3DWPA 1VCIA 4HSPA 5IP7H 2HT1A 4WORA 2F0NA 2F3IA 2IX0A 2GVBA 2RCNA 1JJ2A 3PO2G 3BDCA 4NP5A 3GTOH 1V1PB 4GN5A 4O2DA 4EQPA 4JI6L 1L2FA 5KIXA 3WDNA 1TWGB 3GV6A 4RGOS 4A3MG 4B3TQ 3RZOH 2H4OA 1QOHA 1B3QA 4IUQA 4I65A 2B2YC 3T16A 1ENAA 4UPAA 4KTAA 5IYCG 1N34Q 3HOYB 2UXDL 5JEAG 5I9PA 1LTRD 1AH9A 3VYSA 4FXGC 2D0OA 1PH1A 3CPFA 3PIOA 3HKZG 1IZ6A 1UE1A 4RG1A 3Q8DA 1BOSA 1X56A 5IT9c 3J7AF 2DGYA 3K0XA 2F0UA 2JA8G 2E2HB 3K58A 1M8AA 3I4MB 1EQQA 2AKWB 4C1NI 3I91A 3NBIA 5A35A 1GUWA 4DV6Q 3GTGH 1V1QA 1VQBA 4DUZL 5T1IA 2JA6G 3B6YA 4KHPL 3KF6A 2IPKD 1TS2A 4LFCQ 3R2TA 4C56C 2N3SA 2N8NA 1L1OA 3OW7A 4R8NA 1EL0A 2PMZB 3EA6A 1DXMA 4NKLA 1OXUA 5ELFA 4JCVE 1PA6A 3OMCA 3FKIB 5KRUA 5LMNL 1XPUA 3BYYB 3G4SA 1I6HB 4X6AH 4NPSA 1DOKA 1TWFB 2K03A 1QE6A 3TN2A 4UY8C 1FJGL 1WCMB 4APVA 4F8MA 3C1EA 1KTKA 2UU9Q 3I2ZA 2EZVA 2EY2A 5JOBA 1WVLA 1GKHA 5E4WC 2WAQB 4DV5L 3K7AB 2G9DA 4OIJA 3D6WA 1N33Q 1VQJA 4DUYL 3CC7A 2I5MX 3LWEA 4KLKA 3U50C 3H0GH 3P20A 1Z6HA 3CCRA 1TU2B 1KDAA 2K32A 4JI5Q 4A3IB 3OHXC 5DAUA 3KDFB 2EYOA 2KOLA 4DAVA 4QL5A 5IYBH 5HY6A 5I2XA 1KDBA 3J80i 4DR4L 3A74A 1O7LA 1A2UA 4LAAA 1RDPD 1O7ZA 1TWHB 2JA7B 5K36H 3GTPH 1K8MA 1WTQA 1AEXA 1L1OC 5M3MG 3T53B 1VQDA 4PNYA 4PMBA 1F9SA 2N49A 1CSQA 1BR9A 4LUOA 1L0WA 2A6HC 3UI2A 1PYWD 3CXCA 4LFAQ 1Y1VB 4R4QA 4HIKA 4JBKA 4PMWA 2L55A 1PYSB 4J6HA 3OYYA 1W2BA 5IT9L 3L2PA 3C1FA 2A1AA 4YCVA 5E3FA 3MXPA 5JVG3 3E0EA 1YNNC 3OPOA 3EJIA 5BN5A 4CDFC 4A93H 1LT5D 1YJ9A 3QR8A 4Y7NH 3SXHA 3KJPA 1N8RC 3RLOA 3HRZC 2KJXA 4IFDI 1YITA 1OTCA 4LF9Q 3J80c 2JQOA 3EN2A 1U4PA 3A5UA 4M8AA 3J81c 3CCSA 1NAPA 3CCJA 1E24A 3GTLH 2DNCA 2N88A 1SYGA 5EJWA 3OW2A 1GHKA 1WTPA 2A8VA 1ZYRC 4DV7L 3NP8A 2D0PA 1IL8A 2XSCA 1J6QA 1O78A 2YU9H 3EBEA 2A6ED 5M5YH 4CDDC 4HJAA 1CZGA 4BY1H 2F0TA 5E4XA 1E3PA 1SNQA 2YYZA 5CV7A 3A8KE 1TWCB 1WFQA 1EIYB 1A63A 1BDOA 3RR5A 1WTRA 1BQQT 2GN5A 1MI2A 2IJ0A 3HOXB 2ATWA 1OXXK 5D65A 2PZWA 2JN4A 5KYIA 4ZAIA 2MHVA 3R3OA 4DK0A 3RNUA 4GLAC 1A3UA 1WTVA 3MZ5A 5IE8A 4NW2A 2WACA 2ZXRA 2XTIA 1F9QA 4DXFA 4B3SQ 5LMNW 2PZTA 4AQYQ 1JB3A 3R2IA 3K8AA 3TMEA 5FLXL 2GVAA 4POFA 3S2HB 2CVRA 3GTKB 1MSHA 1K8OA 1HTLD 1VS0A 1LO5D 1GUGA 1VQAA 2F0LA 4A3GG 4K5VA 5D3DA 1K73C 4B3TL 5I6WA 3PO2B 2CH4W 3RUZA 4C3JB 2AUKA 4IALA 1SJED 4JI8Q 1A2TA 3CCEA 4BBSH 2L5TA 2XRSD 4JG2A 4BBRH 4A3MB 2B2VA 1D5MC 4HEDA 5C3EH 2G5DA 1E1OA 3S1RH 1RIPA 2F1MA 1PMRA 4AYBG 1I5FA
chains in the Genus database with same CATH topology
1AZQA 4RAUC 3M4OB 3J80L 1YNJC 3HKZB 1TS4A 2JA8B 3TP5A 1HFGA 4P2CB 5C0XJ 4OO1H 1B1ZA 4KHVA 3DXJC 2F0QA 2Q8TA 1IHZA 2JA6B 2Q8IB 1JR0D 2Q8RE 4X3SA 4LMQD 1IYUA 1TWAB 2NN6G 3L7ZC 3SE0A 2F0FA 2KEEA 5JJZA 1QJOA 5G3LF 5A2QE 1BCPB 4IQZA 3NTIA 2A5HA 4FXKC 3K5LA 4IFDG 5M5WB 3VA7A 2KEDA 2B2WC 1AZPA 3TP6A 2LY7A 4JBWA 3Q23A 1OXTA 4XQNA 3G7LA 2Z4IA 3K0YA 2A69D 1AP0A 2AQ1B 4G4KA 3NPPA 3OWEB 2CHBD 3SK5A 2NUCA 4HSVA 1WD0A 5ELCA 2N55A 1XX8A 2L11A 3QIAA 4KD4A 4CGYB 3FVQA 1PZID 4QF4A 2MPMA 3H6MA 3S9WA 1UUPA 5IODA 1F2YA 2X69A 2F0IA 3NBHA 1STGA 4XT1B 1PTOD 4DNTB 5CV6A 1SDFA 4XT3B 4FF4A 1SJHD 2EXZA 3DHQA 3R8BA 2EJFC 4ZKBB 1RJTA 1G2SA 4HMJA 4H13C 4QIWB 1SNCA 2EVBA 3X3NA 1XTCD 5TSSA 2J0TD 1E2VA 3ONAB 1DONA 2NVYB 4QUFA 2L4NA 2FFKB 2L0CA 5COYA 2F03A 4WJWA 3SDZA 4CJ2C 3S1MB 2O2LD 1A15A 1AN8A 2D2CC 1E2ZA 2TMPA 2F3WA 5EKIA 2CW0D 5C0XH 5ELBA 3RLFA 1NUCA 2LFNA 3NE5B 2BE5D 4UAIA 1DZ1A 4G7ZC 5DM63 1GXDC 2SOBA 3PUYA 1Y1WB 2R7ZB 1JC7A 5EPJA 4KI0A 3T4AC 3AB9A 4FO2A 1G91A 4C1NK 4QMGA 4QCLA 4KKSA 1A6XA 4DU9A 1CTMA 3VYUA 4RKLA 5FKAC 3MAQA 4RGTA 2HUGA 5NUCA 4IUTA 4CHTB 5IGFA 2F0OA 4QB4A 3IFTA 4FF3A 3MHBA 1RKNA 4KKUA 5I9OA 1WTOA 4XQJA 5K5PA 5DEHA 3VR4A 3S16B 3QO2A 4DAPA 2VUMB 5EKLA 1X32A 3SK8A 2QCPX 1JOKA 4DXGA 2EYLA 4CKCA 2OT2A 5FO7B 3S1QB 1ICWA 2XWJB 4L63B 3NHHA 5EPKA 4CJ1B 2MP1A 1U9RA 3IAYA 5D14A 3DUZA 2WB1B 4WRDA 3AMUA 1WTXA 2F0HA 1GUTA 1LTAD 1TVXA 1ZEQX 3KBXA 1I3QB 2B2UC 2C9OA 3CRKC 1BCPF 1QNKA 3JAME 4XXEA 3ZYYX 1K83B 3E0JA 1D5ZC 4XDXA 3TZDA 2NTSA 3D8GA 1PRTD 3F2UA 5E1FA 3D4DA 1XWEA 5JPNC 4KHZA 2JP1A 3SK4A 1VDZA 3M7NA 4MIUA 1UAPA 2K28A 3SVMA 1ENFA 1BXTA 3I3CA 4PQXA 3K57A 3H94A 3X3MA 1H9MA 1S5ED 1HCZA 3HOVB 2F0SA 2HCIA 2EYMA 5IGGA 2BA1A 3IKJA 1T5EA 1JOQA 4H44C 2E2IB 3KLRA 1B3AA 4V0BA 1JICA 1BCPC 1TKWB 2F0MA 1JE4A 4KY6A 1A3VA 4ZLTF 2R92B 1T5XD 2LKVA 1D6EC 3K5MA 4KN7C 1JWSD 1S4ZA 1Q8IA 3E5SA 1U4MA 2BE5C 1XYIA 5C6AA 3GTJB 3A8JE 1TY2A 4TRDA 4Q5VA 1LT3D 5CGKA 2LMCB 4DF7A 3PO3B 4QUCA 1ESRA 3DWAA 2R3ZA 3MVVA 5M5XB 1ENCA 3GQBA 1CK1A 1NCVA 3HOZB 3EQLC 2R6GA 4FF2A 4TQUS 3R93A 1Z7TA 3CHBD 4RHRA 5C5MA 2WINB 2QKIC 1RODA 3TBIB 1PRTF 3MEHA 1DCZA 1H9SA 2PYKA 3MC0B 2NBFA 3URYA 3IL8A 3RD4A 4XYOA 2RVLA 5M9OA 4RCOA 3PUXA 1HTPA 4XQQA 5FOBB 3TP7A 3BS1A 1V43A 1FNWA 4DAYA 2K01A 4OL7A 1SE2A 2J7ZA 4RA8A 3C2PA 2L12A 4K2LA 2IT1A 1L0XB 1SAPA 2EY6A 1V8QA 1PRTC 1A3TA 4ULLA 4E6IA 2E75C 2NN6I 1JOOA 2K5WA 4FNFA 1SMYD 2K05A 1HA5A 5I2YA 2RSOA 1QB5D 5EPLA 1B9MA 3KUPA 3WOEA 2JEAI 3BVZA 5IIFA 1I4GA 1F2ZA 3FPUB 1SBBB 2K5DA 1DYQA 2H1EA 1GUOA 3P1HA 4GZYC 5JVH3 4K6LA 1NR2A 5J1ZA 2C5CA 1Q1BA 4I7ZC 4R9WA 3DM1A 1PFBA 1Y8PB 2PCFB 4ZUJA 4HTHA 3GD7A 4H0LC 3W2DA 2AQ3B 2E2DC 2RDFA 3K59A 4ODGA 4J8QA 1PFMA 3HOWB 5DNFA 3KF8A 1SFOB 4ABNA 4G7OC 3EROA 2QEJC 1B50A 2F0PA 4ILWA 4X3TA 1O7YA 4YIJA 5CORA 1BUVT 3VR5A 2NVQB 4IUNA 3L3OC 3NQTA 2KCCA 3VR2A 1WTWA 1DM0B 1C4QA 2PW5A 4IURA 3NWSA 4Q0FA 1S5DD 1SYCA 4IFDH 1D1KA 2O4XA 3FMCA 1JWUD 2PW7A 2E74C 4EGVA 5K36G 5C4HA 4O1NA 1OXSC 2PNRC 1R4PB 4B9XA 4BA2I 3ND9A 3ITPA 1X3PA 3DMUA 5IT9E 1PTOB 1C48A 2NWGA 1ESFA 1PFNA 4CKBA 3CRLC 3J81L 5C4ZA 5IOCA 5CBEE 4HMIA 4KJNA 3PIO3 1SEBD 1DD2A 1J8IA 3S14B 1LLRD 2K5QA 3GTQB 1OO9B 2AQ2B 1XXGA 2RDHA 2I46A 3C3LA 1I50B 5CYUA 4IZ8A 4DGZA 2B2VC 1RF2D 3VR3A 3PUWA 1B44D 1GJXA 3GTMB 3QOLA 2RBMA 1EQTA 4J1MA 2A68D 2JEBI 1VF5C 2F0GA 3BVMA 4HAEA 4V190 1B4OA 4K6DA 5FO9B 1IW7D 2BOSA 4LK1C 2ZXPA 2ZXOA 5FLXE 2HDMA 5CV8A 1S5CD 1EWCA 4HR7B 5ELDA 4FVMA 1U4LA 4KK7A 1EWHA 1FYCA 1KABA 5M3MB 5T1GA 3ND8A 2ZT9C 1LTSD 4R8IA 3K6OA 2BCOA 2IX3A 2CQAA 4TSSA 4ZKCB 3P75A 4MN3A 2A6EC 1LTGD 2XWBB 4NMZA 1MBYA 4F7XA 1EFID 1G6ZA 3MTSA 1H9KA 2D62A 3KK7A 4XYQA 2XNAC 1AW7A 4RHSA 1H9RA 3DWQA 4S3SA 2AUJD 2IWHA 5JEAJ 5EBCA 3S2DB 2MJ8A 1R4QB 1CI3M 1I4RA 3NXWA 4C3IG 4C3HG 1D5XC 2OF1A 4OO1G 2Z4HA 3SR1A 3L9AX 1ZKOA 1Q12A 2EYPA 3GTGB 1KNEA 2DNEA 1I4HA 1SNPA 1PZKD 1PXUA 2XN9C 2L9HA 1RHPA 2F4IA 2AWOA 2BDNA 3I8ZA 1ML0D 3BG3A 1I4QA 5AFWA 4DA2A 1MD2D 3NWTA 2QILA 3PIP3 1QCBD 1H9SB 1PRTB 5FO8B 1BO0A 3DEPA 1G8ZD 1SYEA 5IGBA 3FEWX 4U673 2MUYA 5KGUA 4MHEA 4A3GB 3GTPB 2EPBA 3W3AA 3I4LA 3SEBA 5LL6X 1PLFA 1EEID 1LV9A 4N9PA 1B9NA 1KAAA 4AYBB 3OIQA 1FNVA 3IFDA 4K14A 1Q90A 2XVSA 4OGQC 4U68A 2PO4A 3U9SA 1CFMA 2JE6I 1G291 4ZK9B 3J7YW 2FHTA 1EY9A 5KEEA 4PMCA 1PTOF 4Y7NB 5C3XA 1RTNA 3N52A 2AWNA 1WD1A 2EOTA 3GTLB 1EY7A 4TKOB 3HZXA 2A69C 3MXUA 3I72A 3T56B 4DK1A 1Z47A 5C4XB 1SXTA 4KD3A 5M3FB 4RH6A 5EQ0A 5IGCA 3MWYW 5JEAH 2OEOA 1TT2A 1PTOH 1QG7A 1KDCA 2K7VA 5C0XG 2WIIB 3K5NA 1PTOC 1CZWA 1Q1EA 1OXVA 5I4DA 1I4XA 1TQOA 1EYCA 2FMCA 2A74C 4A3KB 1JORA 2O5IC 4EVOA 1LTBD 3GP7A 2O5JC 1DOLA 3M7GA 3PMFA 4HCSA 2A6HD 3LWUA 2KECA 1F9RA 3A8IE 1EYAA 3QWNA 2BDOA 3S1RB 3Q22A 1V1OA 1YNND 3OSOA 5LHY1 2CW0C 5EGTA 2F0KA 2F3VA 2PPBC 3QOJA 1UNSA 1EEFD 1R9TB 4K5XA 1EU4A 1ZYRD 4C3IB 5ISRA 3O13A 4A3EB 1CA5A 4CKEA 4G7HC 4UDUC 4IUUA 1SNMA 1ONLA 3HS0C 4ID6A 4C3JG 1AFPA 1JQYD 3U9OA 2EE1A 3D4WA 2FJ2A 3KBGA 2WV6D 2NB0A 4HCEA 3H09A 3QB3A 3RMHA 3MXNA 1Y8NB 1SYFA 1M4VA 4A3BB 4B9WA 4IUVA 5FK9C 2NVTB 5KNCA 2LS01 1FD7D 2RSNA 1F9PA 2XIWA 1GUSA 2WP8J 1LABA 5D3IB 4IFDJ 4RGNA 3BYTB 4FYDA 2E2JB 4Z9CB 5C4JB 4X3UA 2B63B 1EY4A 1EYDA 4CJ0B 3M3YB 2WKDA 2NZ1D 4L8JA 5C44B 2ID0A 3VR6A 5CMDA 3A7AB 4EQNA 3T51B 2B8GA 1VF7A 4K8IA 1EU3A 4BWGB 2HDLA 1HUMA 1IKLA 1YNJD 4RWSC 4DNRB 3AU7A 1HFNA 5CC4A 1G2TA 3D3RA 3MA2B 5JPMC 3EFXD 4PV1C 1EOTA 3TDQA 2Y0SB 2J4XA 3EVQA 2JA5B 1HRJA 3M4YA 4L6TB 1CQFA 3E6ZX 4O42A 3PUZA 3NK9A 3A55A 1L0YB 3QG1A 2OXPA 3BZDB 1JWMD 2QF7A 4OHJA 2SNSA 2NVXB 3HGBA 4RKBA 1EY5A 1TIID 4X3KA 4K2KA 3HOUB 3FPPA 3NTHA 5HURA 4RFBA 4RGMA 1EZ6A 3TSSA 5KNDA 4B08A 2M2LA 2KUMA 4C2MB 2EJMA 5I6YA 5HGTA 4LJZC 5J39A 1C8CA 1F2LA 2X6LA 1W6JA 5C5LA 1MGSA 2ICIA 3CQZB 1KNAA 2R61A 1SE3A 2PZUA 3NUCA 1B53A 1Y8OB 2NN6H 1RD9D 5G3LD 1E0BA 2EDGA 1QILA 3LNNA 1DJRD 3S1NB 1I6VC 1EY0A 4A3JB 3PUVA 1EY8A 2R93B 3V05A 3KLSA 5A2QL 1HA6A 4FXDA 1LTTD 2F0JA 1J9OA 2RDGA 1F2MA 3MXGA 4BY7B 3A7LA 1O80A 3QJYA 1VMCA 2WKCA 2FINB 4OO1I 1IKMA 3SHLA 1NR4A 2DN8A 2F0DA 1RCVD 1GUNA 3S15B 3I90A 1FR3A 2ICEC 3MFGA 1VMPA 4KJOA 2F0EA 1STAA 2BA0A 1STHA 1FNUA 5CBAE 3NTKA 1RTOA 2F0VA 2PQEA 2EY5A 3TZUA 1SSOA 1Y69U 2IX1A 2KA7A 3I73A 1V1PA 3ERQA 4KV6A 2EYJA 3M85A 3TP8A 1I4PA 2DY7A 3GV3A 2SEBD 3RZDB 2RQXA 3GO5A 3V2TA 4KN4C 5CR3A 2B2WA 1NSNS 1X3QA 1BF4A 2G9HD 1PZJD 1CHPD 3NSWA 1SMYC 4K5WA 1EQVA 3D6CA 4ME5A 3S17B 1S5FD 2JYOA 2IW3A 1CM9A 4BS9A 1HQMC 2DY8A 1MSGA 1KLGD 1ET9A 1E2WA 2K1BA 4HN7A 3FDTA 2HQEA 2FMMA 1TS5A 2X6GA 1DOMA 4ZUIA 4EQOA 3PV0A 1W6KA 3GTOB 1II3A 4DN4M 5IGEA 1D1IA 3RZOB 4JK1C 3Q6SA 2KHSA 3BVGA 2QDBA 4FP5D 3A54A 1GOZA 3J80E 3J81E 1BBXC 1PDQA 5C0XI 2B2TA 5EKKA 3VYTA 1STBA 2E76C 3D4RA 3SK6A 1HQRD 2M9VA 3CU7A 1IYVA 1ET6A 3MFYA 1B2TA 4XIGS 4N9TA 1CHQD 1LT6D 2ENBA 3OWFA 4WFN3 1SE4A 4ZQ3A 3J7AV 1HUNA 1KLUD 2VB2X 1U4RA 4A3DB 3Q24A 4XTCS 1SNOA 2K33A 4IN3A 1EY6A 1TY0A 2L1BA 2NYZD 1CQVA 2B2TC 2M00A 4RCNA 3DEOA 2K6AA 1CT1D 3H3VC 2K04A 1H9JA 1BCPD 1SYDA 5EBDA 3H0GB 1FGBD 2D5DA 3HEJA 1SYBA 3H91A 1TR5A 2KQ3A 2Z8LA 3JAML 3A56A 3N6RA 2V4DA 1HXYD 3FRPB 2A73B 1JCKB 2VNUD 2F0WA 5J22A 2SNMA 2RA4A 4OIKA 1QNUA 3T13A 3OIPA 5DM73 4KMUC 4DFAA 1STYA 2D9UA 5F2DA 3KLSX 1GHJA 2A68C 2EYHA 5CV9A 2TSSA 4F87A 4A93B 5IGDA 3HG9A 1IW7C 5LL6S 2KVMA 5CV5A 3VYRA 3CKIB 2JXMB 4IUPA 3VA5A 3LX0A 1STEA 1TS3A 2B2UA 1CA6A 3OOCA 5C3WA 2NTTA 2YU9B 2Z1CA 5M5YB 4BY1B 1UEAB 2B39A 3K5OA 3WOFA 1QWYA 4KKTA 2SDFA 4K8JA 1ILPA 1BNZA 5ELEA 3P7JA 4ZYSA 1EIGA 4CBVA 3BDOA 1ILQA 4A3FB 1Q3LA 2JSOA 1EIHA 5KYLA 3HP3A 4KY7A 2EYFA 4M1UB 2EY1A 1ZXTA 3I70A 4G57A 5JAVA 4FF1A 2RKSA 5BN3A 3Q0AA 4BBSB 2I07B 2XRQD 4BBRB 2HCCA 3OMGA 1LACA 5C3EB 2B2YA 2KCNA 1HHVA 4NDXA 3V96A 4BA1I 4F88A 3C46A 2GA4B 1LTID 2VXWA 1SNDA 2IL8A 3G6JB 1EZ8A 2VB3X 1S5BD 5KNBA 4KY5A 3D31A 4ZRZA 3I4NB 3NQIA 2EJGC 1D2BA 4C3HB 1HPCA 5CV4A 2B8FA 1STNA 3BDLA 2MGSA 1F77A 5BN4A 4H7BA 1LT4D 3DWPA 1VCIA 4HSPA 4WORA 2F0NA 2IX0A 3BDCA 4NP5A 1V1PB 4EQPA 5KIXA 3WDNA 1TWGB 3GV6A 4RGOS 2H4OA 1QOHA 4IUQA 4I65A 2B2YC 3T16A 1ENAA 4KTAA 3HOYB 5JEAG 5I9PA 1LTRD 3VYSA 4FXGC 1BOSA 3J7AF 2F0UA 2E2HB 3K58A 1M8AA 3I4MB 4C1NI 3I91A 3NBIA 5A35A 1GUWA 5T1IA 2IPKD 1TS2A 3R2TA 4C56C 3OW7A 4R8NA 1EL0A 2PMZB 3EA6A 1DXMA 4NKLA 1OXUA 5ELFA 3OMCA 3FKIB 5KRUA 3BYYB 1I6HB 1DOKA 1TWFB 2K03A 1QE6A 3TN2A 4F8MA 1WCMB 3C1EA 1KTKA 2EZVA 2EY2A 5JOBA 1WVLA 5E4WC 2WAQB 3K7AB 2G9DA 4OIJA 3D6WA 3LWEA 3P20A 1Z6HA 1TU2B 1KDAA 2K32A 4A3IB 3OHXC 5DAUA 2EYOA 2KOLA 4DAVA 5I2XA 1KDBA 1O7LA 1A2UA 4LAAA 1RDPD 1O7ZA 1TWHB 2JA7B 5K36H 1K8MA 1WTQA 1AEXA 3T53B 4PNYA 4PMBA 1F9SA 1BR9A 2A6HC 3UI2A 1PYWD 1Y1VB 4PMWA 2L55A 4J6HA 5IT9L 3C1FA 5E3FA 3MXPA 5JVG3 1YNNC 3OPOA 3EJIA 5BN5A 1LT5D 3SXHA 3HRZC 2KJXA 4IFDI 1U4PA 4M8AA 1NAPA 2DNCA 2N88A 1SYGA 5EJWA 1GHKA 1WTPA 1ZYRC 3NP8A 1IL8A 2XSCA 1O78A 2A6ED 1CZGA 2F0TA 5E4XA 1SNQA 2YYZA 5CV7A 3A8KE 1TWCB 1BDOA 1WTRA 1BQQT 1MI2A 2IJ0A 3HOXB 1OXXK 5D65A 2PZWA 5KYIA 4ZAIA 2MHVA 3R3OA 4DK0A 1A3UA 1WTVA 3MZ5A 4NW2A 2WACA 2ZXRA 4DXFA 1F9QA 2PZTA 1JB3A 3R2IA 3TMEA 5FLXL 3S2HB 2CVRA 3GTKB 1MSHA 1K8OA 1HTLD 1LO5D 1GUGA 2F0LA 4K5VA 5D3DA 5I6WA 3PO2B 3RUZA 4C3JB 2AUKA 4IALA 1SJED 1A2TA 2L5TA 2XRSD 4A3MB 2B2VA 1D5MC 4HEDA 2F1MA 1PMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LHY 1;  1MBY A; 
#chains in the Genus database with same CATH topology
 1AZQ A;  1PH9 A;  1PV4 A;  4RAU C;  3M4O B;  3J80 L;  3CCM A;  2K50 A;  1YNJ C;  4QQB X;  3HKZ B;  1R9T H;  4LF5 Q;  1TS4 A;  2JA8 B;  2VUM G;  3BZC A;  3I4N H;  3TP5 A;  1HFG A;  4PZ7 A;  2HQL A;  4IPH A;  4P2C B;  4C3H H;  5C0X J;  1HZC A;  1IBK Q;  4OO1 H;  4FDB A;  3UDX A;  1B1Z A;  4KHV A;  3DXJ C;  2F0Q A;  3ZJY C;  2Q8T A;  1IHZ A;  2JA6 B;  1UE6 A;  1B7Y B;  2Q8I B;  1IBM L;  1JR0 D;  2Q8R E;  4DNI A;  4X3S A;  4LMQ D;  1IYU A;  1CKN A;  1TWA B;  2NN6 G;  1XNQ Q;  3L7Z C;  3SE0 A;  1TWG H;  2F0F A;  2KEE A;  5JJZ A;  4DR6 Q;  2ZTC A;  1QJO A;  3AFP A;  3NEN A;  5G3L F;  2UU9 L;  5A2Q E;  1BCP B;  5C4X G;  5M3F G;  4IQZ A;  1VQM A;  3NTI A;  2PQA B;  3OTO Q;  2A5H A;  3M9B A;  4FXK C;  1KHI A;  3K5L A;  3CC4 A;  1QUQ B;  4OWW B;  2B3G A;  4IFD G;  5M5W B;  3VA7 A;  2KED A;  1X3F A;  2E2H H;  2B2W C;  3AFQ A;  1AZP A;  3TP6 A;  2LY7 A;  4JBW A;  1SMX A;  4OWT B;  3Q23 A;  1OXT A;  4XQN A;  4A3K G;  3G7L A;  2Z4I A;  3K0Y A;  2A69 D;  2E2J H;  1AP0 A;  2B63 H;  2AQ1 B;  4G4K A;  5IY0 A;  3NPP A;  4LFA L;  3PGZ A;  3OWE B;  3KDF A;  1JJG A;  2CHB D;  4BXX G;  2F52 A;  3SK5 A;  2NUC A;  4HSV A;  1SRU A;  1WD0 A;  5ELC A;  2N55 A;  3FKI H;  1XX8 A;  2L11 A;  3QIA A;  4KD4 A;  4CGY B;  3CPW A;  1I6H H;  3FVQ A;  1PZI D;  4QF4 A;  4GLX A;  1TWF H;  1Q81 C;  2MPM A;  1WCM H;  3H6M A;  3S9W A;  1UUP A;  5IOD A;  1F2Y A;  2X69 A;  2F0I A;  1HZA A;  2KHI A;  1STG A;  1LTL A;  2KHJ A;  3NBH A;  4XT1 B;  1PTO D;  4DNT B;  1X3E A;  3K7A H;  5CV6 A;  1SDF A;  4XT3 B;  1YI2 A;  2R92 G;  4FF4 A;  1SJH D;  2EXZ A;  1A62 A;  3DHQ A;  4A3I H;  4X62 Q;  3R8B A;  2HD3 A;  3E9I A;  2EJF C;  4ZKB B;  1HJP A;  1RJT A;  1G2S A;  1Y14 B;  4HMJ A;  2DUD A;  4H13 C;  4QIW B;  4A3E G;  1SNC A;  2EVB A;  1XTC D;  3X3N A;  5TSS A;  2J0T D;  1E2V A;  2QGQ A;  3ONA B;  3E9H A;  1DON A;  3NEL A;  2NVY B;  2Q2H A;  4QUF A;  1PH7 A;  2L4N A;  2FFK B;  2L0C A;  5COY A;  2F03 A;  1Y1V H;  1PH2 A;  4WJW A;  4LW1 A;  3SDZ A;  4CJ2 C;  3CCQ A;  3PO3 G;  3S1M B;  2O2L D;  3KF6 B;  1A15 A;  4YHH Q;  1AN8 A;  2D2C C;  1C9O A;  1E2Z A;  3PF4 A;  2TMP A;  2F3W A;  2EQS A;  5EKI A;  3STB C;  2CW0 D;  5C0X H;  2H5X A;  5IP9 H;  1L1O B;  3F8T A;  5ELB A;  1WYD A;  4C2M H;  1ASY A;  4A3B G;  1WTH A;  2Z9H A;  4GLV B;  3RLF A;  1NUC A;  1P16 A;  2LFN A;  3NE5 B;  2BE5 D;  4UAI A;  1DZ1 A;  4G7Z C;  5DM6 3;  1GXD C;  2SOB A;  3PUY A;  4DR3 Q;  1Y1W B;  2R7Z B;  1JC7 A;  4MZ9 A;  4WJ4 A;  3HFZ B;  5EPJ A;  4KI0 A;  2BH2 A;  2K5N A;  3T4A C;  3AB9 A;  4FO2 A;  1G91 A;  4C1N K;  4JI8 L;  4QMG A;  4QCL A;  2E8G A;  4X66 L;  4JI2 Q;  4KKS A;  1HNW L;  1A6X A;  4DU9 A;  4QGU A;  2QEX A;  1CTM A;  1PYB A;  5LMN Q;  1K8G A;  3VYU A;  1TWC H;  4RKL A;  3CW2 C;  1BVS A;  5FKA C;  3I7F A;  4RGT A;  2HUG A;  3MAQ A;  5NUC A;  4IUT A;  4CHT B;  5IGF A;  2ASB A;  3RN2 A;  5C44 G;  4DV0 Q;  2F0O A;  1VQK A;  4QB4 A;  2HIX A;  3IFT A;  4DUY Q;  4FF3 A;  3MHB A;  1RKN A;  4KKU A;  5I9O A;  3CCV A;  4LF5 L;  5GAD C;  2PI2 E;  1WTO A;  4XQJ A;  4ZCK A;  5DEH A;  2K14 A;  4IPG A;  5K5P A;  3VR4 A;  3S16 B;  1LYL A;  3QO2 A;  4DAP A;  2VUM B;  5EKL A;  3U4Z A;  1X32 A;  3SK8 A;  4L5Q A;  2QCP X;  3ULL A;  3ULP A;  1NTG A;  4P75 A;  1JOK A;  4YWL A;  4RMF A;  4DXG A;  3S2H H;  2EYL A;  4CKC A;  2OT2 A;  2I5L X;  2Y0S G;  5FO7 B;  3S1Q B;  3GTK H;  4ME3 A;  1ICW A;  2XWJ B;  4L63 B;  1XNQ L;  4A3L G;  3NHH A;  3I4O A;  3PO2 H;  4C3J H;  5EPK A;  5FJ8 G;  4CJ1 B;  1B70 B;  2MP1 A;  4A3M H;  1XMQ L;  3TEH B;  1U9R A;  1NE3 A;  3IAY A;  5D14 A;  2PNH A;  3OTO L;  3DUZ A;  2WB1 B;  2VW9 A;  5IYD H;  4WRD A;  3AMU A;  5IYC H;  3HOU G;  1WTX A;  2F0H A;  1GUT A;  1LTA D;  4POG A;  1TVX A;  1Z9F A;  1ZEQ X;  1KXL A;  3KBX A;  1PH5 A;  3KF8 B;  1XPR A;  1I3Q B;  1Q8K A;  2B2U C;  2C9O A;  3CRK C;  1BCP F;  1QNK A;  3JAM E;  4XXE A;  3ZYY X;  1K83 B;  3E0J A;  1D5Z C;  4P71 A;  2NTS A;  4XDX A;  3D8G A;  3TZD A;  1VQG A;  1PRT D;  2JA8 H;  3F2U A;  2VQE Q;  5E1F A;  1G6P A;  3D4D A;  1XWE A;  5JPN C;  4KHZ A;  2JP1 A;  4DV7 Q;  1QUQ A;  3SK4 A;  1VDZ A;  3M7N A;  4MIU A;  1IBL Q;  1UAP A;  2K28 A;  2JA6 H;  3SVM A;  1ENF A;  1HNZ Q;  1BXT A;  1DGS A;  2CCZ A;  3I3C A;  4PQX A;  3K57 A;  1TWA H;  3H94 A;  3X3M A;  1H9M A;  2CKZ B;  1S5E D;  1HCZ A;  3PCO B;  3HOV B;  2F0S A;  2RHS B;  2HCI A;  2EYM A;  5IGG A;  2BA1 A;  3IKJ A;  1T5E A;  2R93 G;  1JOQ A;  4H44 C;  1GO3 E;  3KLR A;  4LUZ A;  2E2I B;  3KLW A;  1B3A A;  4V0B A;  1JIC A;  1BCP C;  1TKW B;  4BY7 G;  2K5V A;  2F0M A;  1JE4 A;  4X62 L;  4KY6 A;  1A3V A;  4R1J A;  4ZLT F;  2R92 B;  1BBW A;  1T5X D;  2LKV A;  1D6E C;  3K5M A;  1LUZ A;  5GRO A;  4KN7 C;  1JWS D;  2ZJR A;  1S4Z A;  1Q8I A;  3E5S A;  3VDY A;  1U4M A;  2BE5 C;  1XYI A;  2ZM6 Q;  5C6A A;  1N32 Q;  4EQ5 A;  3GTJ B;  3A8J E;  4JI7 L;  1TY2 A;  4TRD A;  3BU2 A;  1MIU A;  4Q5V A;  4YHH L;  1LT3 D;  1QVF A;  5CGK A;  2LMC B;  1XMO Q;  4DF7 A;  3PO3 B;  4QUC A;  1ESR A;  3DWA A;  2R3Z A;  4LWC A;  3MVV A;  5M5X B;  1CKN B;  1ENC A;  4IO9 A;  3GQB A;  1CK1 A;  3UE1 A;  4DR3 L;  1NCV A;  4JBM A;  1CKM A;  3HOZ B;  3EQL C;  2R6G A;  4FF2 A;  4TQU S;  3R93 A;  1Z7T A;  3CHB D;  4RHR A;  4UP8 A;  3F2D A;  5C5M A;  2WIN B;  2QKI C;  4JI2 L;  3CAM A;  1ROD A;  1IBM Q;  3DM3 A;  5BR8 Q;  3TBI B;  1PRT F;  3MEH A;  4A3D H;  2KCT A;  1DCZ A;  1H9S A;  2PYK A;  4JI3 L;  1SR3 A;  2NVY H;  3MC0 B;  2NBF A;  3UDF A;  3URY A;  3IL8 A;  1U0L A;  4DV0 L;  3RD4 A;  3S1M H;  4XYO A;  4X65 L;  2RVL A;  5M9O A;  4RCO A;  1VQ7 A;  3PUX A;  1HTP A;  4XQQ A;  5FOB B;  3H15 A;  3TP7 A;  4L5T A;  3BS1 A;  1VQE A;  1V43 A;  1FNW A;  1KC8 C;  4DAY A;  1W3S A;  3J81 i;  2K01 A;  5L37 A;  4OL7 A;  1SE2 A;  1PH4 A;  2J7Z A;  4RA8 A;  3C2P A;  2L12 A;  4K2L A;  4JI0 L;  1Y1W H;  2R7Z H;  2IT1 A;  1L0X B;  4UP7 A;  1SAP A;  2EY6 A;  1V8Q A;  4JW0 A;  4YY3 Q;  1VQI A;  3NBH B;  1PRT C;  1A3T A;  4ULL A;  4E6I A;  2ZJQ A;  2E75 C;  2NN6 I;  1JOO A;  2K5W A;  4PZ8 A;  4IOC A;  4IJH A;  4FNF A;  2VZA A;  1SMY D;  4DKA C;  2K05 A;  1HA5 A;  1YJW A;  5I2Y A;  2RSO A;  1QB5 D;  5EPL A;  1B9M A;  3KUP A;  3WOE A;  2JEA I;  3BVZ A;  5IIF A;  1I4G A;  1F2Z A;  3FPU B;  1SBB B;  2K5D A;  1XTD A;  1VQ9 A;  1DYQ A;  2H1E A;  1GUO A;  3AEV A;  3P1H A;  4GZY C;  1XNR L;  2IHE A;  5JVH 3;  4K6L A;  1NR2 A;  5J1Z A;  2C5C A;  1CSP A;  1Q1B A;  4I7Z C;  4R9W A;  1ICF B;  3DM1 A;  2VL6 A;  1PFB A;  1Y8P B;  2PCF B;  4ZUJ A;  4HTH A;  5GAH C;  3GD7 A;  2VQE L;  1AE3 A;  4H0L C;  3W2D A;  2AQ3 B;  2E2D C;  2RDF A;  3K59 A;  1FL0 A;  4HJ5 A;  3S16 H;  3F1Z A;  1NY4 A;  4ODG A;  2VUM H;  1IBL L;  2UUC Q;  5GAE C;  4J8Q A;  1PFM A;  5EAY A;  3HOW B;  5DNF A;  2BH8 A;  3KF8 A;  1HNZ L;  1SFO B;  5H1S E;  1K0S A;  4ABN A;  4G7O C;  3ERO A;  2QEJ C;  1B50 A;  2F0P A;  4ILW A;  3KFU A;  4X3T A;  2Z6B A;  1O7Y A;  4YIJ A;  5COR A;  1BUV T;  3VR5 A;  2NVQ B;  4IUN A;  3L3O C;  3PIP A;  1K9M C;  1X9N A;  3NQT A;  2KCC A;  1IXR A;  4DR2 L;  3VR2 A;  1WTW A;  1DM0 B;  1C4Q A;  4A3F H;  2PW5 A;  2R7F A;  2PMZ E;  4IUR A;  3NWS A;  4Q0F A;  5ELO A;  3H0G G;  1S5D D;  1VQL A;  1E1T A;  1I3Q H;  1SYC A;  5IYB G;  4IFD H;  3FHW A;  1K83 H;  1D1K A;  2O4X A;  1AE2 A;  3FMC A;  1JWU D;  2PW7 A;  2E74 C;  2ZM6 L;  2WAQ E;  1VQ5 A;  5LMU Q;  1N32 L;  4EGV A;  5K36 G;  4IOA A;  5C4H A;  4OX9 Q;  1JT8 A;  4O1N A;  4X66 Q;  1OXS C;  1HNW Q;  2PNR C;  3KJO A;  1R4P B;  4B9X A;  1VQF A;  4LNQ A;  4BA2 I;  3ND9 A;  1N36 Q;  3ITP A;  1XMO L;  1X3P A;  1XJV A;  3DMU A;  2FXQ A;  5IT9 E;  1PTO B;  1C48 A;  2NWG A;  3MEF A;  1ESF A;  1PFN A;  4CKB A;  3CRL C;  3ER0 A;  3HOV H;  3J81 L;  2RCF A;  5C4Z A;  1K28 A;  5IOC A;  4LF6 Q;  5CBE E;  1MJC A;  4HMI A;  4KJN A;  2VS1 A;  2E2I H;  3PIO 3;  4A93 G;  1SEB D;  1D7Q A;  1E7Z A;  1DD2 A;  1J8I A;  3S14 B;  1KQS A;  1LLR D;  2K5Q A;  1S40 A;  3HKS A;  3W1B A;  3T1H L;  1OO9 B;  1XPO A;  2AQ2 B;  3GTQ B;  1XXG A;  2RDH A;  2I46 A;  5BR8 L;  3C3L A;  4L5R C;  1I50 B;  5CYU A;  2K5H A;  4EX5 A;  4IZ8 A;  4DGZ A;  2B2V C;  3SGI A;  1VQN A;  1RF2 D;  3VR3 A;  1YHB A;  4GKK Q;  4BY1 G;  2LXJ A;  3PUW A;  1B44 D;  3GTJ H;  1GJX A;  3GTM B;  1XMQ Q;  3HOY H;  2NZH A;  3QOL A;  2RBM A;  3PQI A;  1EQT A;  4J1M A;  2A68 D;  2OWO A;  2CH4 A;  2JEB I;  1VF5 C;  2F0G A;  3BVM A;  4DR5 Q;  3PO3 H;  4HAE A;  1LM0 A;  4V19 0;  1B4O A;  4K6D A;  5FO9 B;  1IW7 D;  2BOS A;  4LK1 C;  4B3R L;  1X54 A;  2ZXP A;  2ZXO A;  5FLX E;  2HDM A;  5CV8 A;  3I4M H;  1S5C D;  5M5X H;  1EWC A;  4HR7 B;  5ELD A;  4FVM A;  1U4L A;  4KK7 A;  1EWH A;  3I56 A;  1FYC A;  3HOZ H;  4YY3 L;  1KAB A;  5M3M B;  5T1G A;  3TRE A;  4GNX A;  3ND8 A;  2ZT9 C;  1LTS D;  4R8I A;  1CUK A;  3K6O A;  3CME A;  2BCO A;  2IX3 A;  2CQA A;  2HIV A;  4YWM A;  4TSS A;  4ZKC B;  5FLM H;  3P75 A;  4UHV A;  4MN3 A;  2A6E C;  1LTG D;  2XWB B;  4NMZ A;  4BBS G;  1IYJ B;  3JAM c;  3H3V I;  4O0A A;  1MBY A;  4JI1 Q;  4BBR G;  4F7X A;  1EFI D;  4N8F A;  4LF4 Q;  1G6Z A;  4IPD A;  3MTS A;  1GD7 A;  1H9K A;  2D62 A;  3KK7 A;  1WOC A;  4XYQ A;  1PH8 A;  2XNA C;  3K81 C;  1AW7 A;  4RHS A;  1H9R A;  1YZ6 A;  3DWQ A;  4QJF A;  4R4C A;  4S3S A;  3G6E A;  2AUJ D;  2IWH A;  5JEA J;  5EBC A;  3S2D B;  4HIO A;  2MJ8 A;  3M4P A;  1R4Q B;  2UUC L;  1CI3 M;  3I4N G;  1I4R A;  3NXW A;  4N8X 1;  4C3I G;  4GNX C;  4C3H G;  1TWH H;  2JA7 H;  1D5X C;  2OF1 A;  4OO1 G;  2Z4H A;  3SR1 A;  4DAM A;  3L9A X;  5GAG C;  1ZKO A;  4OXP A;  1Q12 A;  2EYP A;  3GTG B;  1Q7Y C;  1KNE A;  2DNE A;  1I4H A;  1SNP A;  2DJF C;  3HKZ E;  1PZK D;  4JI7 Q;  1PXU A;  1O7I A;  2XN9 C;  2V1C C;  5FJ8 H;  1GVP A;  2L9H A;  1RHP A;  2CQO A;  2F4I A;  2AWO A;  2BDN A;  3NEM A;  3I8Z A;  1ML0 D;  3BG3 A;  1I4Q A;  2OCE A;  1E22 A;  5AFW A;  2Q2I A;  4DA2 A;  1JMC A;  3A0J A;  3NWT A;  1MD2 D;  2QIL A;  3PIP 3;  2Z6K A;  1QCB D;  1H9S B;  1PRT B;  5FO8 B;  1BO0 A;  1EWI A;  2AHO B;  4DV2 Q;  3DEP A;  1G8Z D;  1SYE A;  5IGB A;  3FEW X;  4U67 3;  4LUV A;  2MUY A;  4JV5 Q;  5KGU A;  5LMU L;  1UEB A;  4MHE A;  4OX9 L;  4A3G B;  1EIF A;  3HOW H;  4LFB Q;  3GTP B;  1SFO H;  2B63 G;  2EPB A;  1HR0 W;  4JI3 Q;  3W3A A;  1N36 L;  4DAY B;  3I4L A;  2KEN A;  3SEB A;  4GOP A;  3HOX H;  2UUA Q;  5LL6 X;  1PLF A;  3U58 A;  1EEI D;  1LV9 A;  4N9P A;  1B9N A;  4HIM A;  4YCW A;  1KAA A;  4AYB B;  2NVQ H;  3OIQ A;  1FNV A;  3D0F A;  3IFD A;  4K14 A;  1Q90 A;  2XVS A;  4OGQ C;  4X65 Q;  4U68 A;  1Q86 C;  2PO4 A;  4IPC A;  4LF6 L;  2Z6K C;  3U9S A;  1CFM A;  4MTK A;  2JE6 I;  1G29 1;  4ZK9 B;  3J81 j;  3J7Y W;  4DV1 Q;  2FHT A;  1EY9 A;  1K3B C;  5KEE A;  4PMC A;  2CFM A;  1PTO F;  4Y7N B;  5C3X A;  1RTN A;  3N52 A;  2OQK A;  5GQO A;  2AWN A;  4A3I G;  1WD1 A;  4JYA Q;  4JI0 Q;  1VQ4 A;  3LGJ A;  2JA5 G;  2EOT A;  4GS3 A;  3GTL B;  1KAW A;  1EY7 A;  4TKO B;  4GKK L;  4MNO A;  3HZX A;  2A69 C;  3MXU A;  3I72 A;  4GOP C;  3T56 B;  4DK1 A;  4Y52 H;  1Z47 A;  4R4I A;  5C4X B;  1SXT A;  4KD3 A;  5M3F B;  1Y1V G;  4RH6 A;  4DR5 L;  3EIV A;  5EQ0 A;  1FVI A;  5IGC A;  4PZ6 A;  3MWY W;  5JEA H;  2OEO A;  1TT2 A;  1PTO H;  4QIW E;  2UUB Q;  3M4O H;  1QG7 A;  1KDC A;  2K7V A;  1XNR Q;  5HGQ A;  5C0X G;  5IP9 G;  2WII B;  3K5N A;  2ALY B;  1PTO C;  1CZW A;  1Q1E A;  3J7A 5;  1OXV A;  3CD6 A;  5I4D A;  1MKH A;  1I4X A;  1TQO A;  1EYC A;  2FMC A;  2A74 C;  4A3K B;  1JOR A;  2O5I C;  4EVO A;  3UDI A;  1Q82 C;  1LTB D;  3GP7 A;  2O5J C;  1DOL A;  3GTQ H;  3M7G A;  3PMF A;  4HCS A;  1I50 H;  2A6H D;  3LWU A;  1PHJ A;  2KEC A;  4JI1 L;  1F9R A;  4LF4 L;  3A8I E;  1EFW A;  2UXB Q;  1EYA A;  3GTM H;  4A3J G;  1QVG A;  4NXM Q;  3QWN A;  2BDO A;  4DR2 Q;  3G71 A;  3S1R B;  3Q22 A;  1VQO A;  1V1O A;  4ALP A;  1YNN D;  4DV3 L;  3OSO A;  5LHY 1;  3TQY A;  2VQF L;  2CW0 C;  5EGT A;  5M5W H;  2VY3 A;  1RL2 A;  2F0K A;  4HJ9 A;  1K8A C;  2F3V A;  2MNA A;  1SLJ A;  2PPB C;  3W1G A;  3QOJ A;  1UNS A;  1EEF D;  1KRS A;  1R9T B;  4K5X A;  1YJN A;  5IWA Q;  1EU4 A;  1SRO A;  1ZYR D;  4C3I B;  5ISR A;  3O13 A;  4AYB E;  4A3E B;  1UWV A;  1VQH A;  1CA5 A;  5M3M H;  4CKE A;  4G7H C;  4UDU C;  1UE5 A;  4A3C G;  4IUU A;  3TS2 A;  1SNM A;  1ONL A;  3HS0 C;  4ID6 A;  4A76 A;  4C3J G;  1AFP A;  1JQY D;  4NXN L;  3U9O A;  2EE1 A;  3D4W A;  1HNX L;  2FJ2 A;  3KBG A;  4GN4 B;  2WV6 D;  2NB0 A;  4HCE A;  2DJG C;  5IYD G;  3H09 A;  1NMG A;  3QB3 A;  3RMH A;  3MXN A;  4JPB W;  4HJ7 A;  1Y8N B;  1JJC B;  1SYF A;  1M4V A;  1JB7 A;  4A3B B;  1A8V A;  2IHF A;  4DV2 L;  3AYH B;  4IUV A;  5FK9 C;  4B9W A;  2RF4 A;  3J7Z C;  2NVT B;  5KNC A;  2LS0 1;  1FD7 D;  2RSN A;  4JV5 L;  1S72 A;  3S2D H;  1GM5 A;  1F9P A;  2WB1 E;  2XIW A;  3T1H Q;  1GUS A;  2WP8 J;  1PH3 A;  1LAB A;  1YHQ A;  5D3I B;  3CF5 A;  4LFB L;  4IFD J;  3G48 A;  4RGN A;  3BYT B;  4FYD A;  2E2J B;  4Z9C B;  2UUA L;  5C4J B;  4X3U A;  2B63 B;  1EY4 A;  4R4O A;  1EYD A;  4CJ0 B;  3M3Y B;  1TXY A;  2I0Q A;  3KOJ A;  2WKD A;  2NZ1 D;  1I94 Q;  4L8J A;  5C44 B;  4GNX B;  2ID0 A;  2UXC Q;  3VR6 A;  2HHH Q;  5CMD A;  2EIF A;  4DV1 L;  1V9P A;  3A7A B;  1K0R A;  4EQN A;  3T51 B;  2B8G A;  1VF7 A;  4K8I A;  1EU3 A;  2HDL A;  4BWG B;  1HUM A;  1IKL A;  1YNJ D;  4B3R Q;  1YHA A;  4RWS C;  4DNR B;  4DV4 Q;  3AU7 A;  1HR0 Q;  1HFN A;  2ZTD A;  5CC4 A;  1G2T A;  3D3R A;  3MA2 B;  5JPM C;  4JYA L;  3EFX D;  4PV1 C;  2L15 A;  5IP7 G;  1EOT A;  3TDQ A;  2MO1 A;  1EYG A;  1G51 A;  2Y0S B;  2AMC B;  3UE0 A;  4WJ3 M;  2J4X A;  2ZJP A;  3EVQ A;  1VQ6 A;  2JA5 B;  1HRJ A;  3ERS X;  3M4Y A;  4DPG A;  4L6T B;  4L5S A;  4A3G H;  1CQF A;  3E6Z X;  4O42 A;  3T1Y Q;  3PUZ A;  3NK9 A;  3WWV A;  3A55 A;  1L0Y B;  3QG1 A;  2OXP A;  3BZD B;  5FLX c;  1JWM D;  2K75 A;  2QF7 A;  4OHJ A;  2SNS A;  2NVX B;  3PSI A;  3HGB A;  4RKB A;  1EY5 A;  1TII D;  2UUB L;  4X3K A;  4K2K A;  3HOU B;  3FPP A;  3NTH A;  3F2B A;  5HUR A;  2EXD A;  2N78 A;  4RFB A;  1K3R A;  4RGM A;  1EZ6 A;  1NMF A;  4LF8 L;  3TSS A;  3KYH C;  5KND A;  4B08 A;  2M2L A;  2KUM A;  4C2M B;  2EJM A;  5I6Y A;  1X65 A;  5HGT A;  4LJZ C;  2YV5 A;  4LF7 Q;  1WJJ A;  3E3X A;  5J39 A;  1C8C A;  3S1Q H;  1F2L A;  4K0K Q;  3CMA A;  2YTV A;  2X6L A;  4JI4 Q;  1W6J A;  5C5L A;  1MGS A;  2LXK A;  1HZ9 A;  2ICI A;  3CQZ B;  4A3D G;  2CWA A;  1KNA A;  2R61 A;  1SE3 A;  2PZU A;  3NUC A;  1KRT A;  4X64 Q;  1B53 A;  1Y8O B;  2UXB L;  2NN6 H;  1RD9 D;  5G3L D;  1E0B A;  4DK3 C;  4NXM L;  2EDG A;  4B3M L;  1QIL A;  3LNN A;  2C35 B;  1DJR D;  3S1N B;  1PFS A;  5C4X H;  5M3F H;  1I6V C;  1CKO A;  1EY0 A;  4A3J B;  3PUV A;  1FGU A;  1EY8 A;  2R93 B;  3V05 A;  3KLS A;  5A2Q L;  1HA6 A;  4AH6 A;  1LTT D;  4FXD A;  2F0J A;  1J9O A;  1P8L A;  4R4T A;  2RDG A;  1F2M A;  3MXG A;  4BY7 B;  3A7L A;  4QY7 A;  1O80 A;  4GOP B;  1IL2 A;  3QJY A;  5IWA L;  2Z0S A;  1VMC A;  2WKC A;  1YIJ A;  2FIN B;  4OO1 I;  1IKM A;  2F4V Q;  3FP9 A;  3SHL A;  1NR4 A;  4YCU A;  2DN8 A;  2F0D A;  1RCV D;  4A3K H;  1Y1W G;  2R7Z G;  1GUN A;  3S15 B;  3I90 A;  4JOI A;  5JJK A;  3BZK A;  1FR3 A;  4DR7 Q;  2WFW A;  2ICE C;  3MFG A;  1MJE A;  1YBY A;  1VMP A;  4KJO A;  2F0E A;  1STA A;  2BA0 A;  1STH A;  4BXX H;  1WI5 A;  1FNU A;  5CBA E;  3NTK A;  2MQH A;  1RTO A;  2F0V A;  4P73 A;  1N34 L;  2PQE A;  2OTL A;  2EY5 A;  3TZU A;  2Y0S E;  1HH2 P;  5AJ3 Q;  1SSO A;  2R7D A;  4MTN A;  3STB D;  1Y69 U;  1J5E Q;  2KA7 A;  2IX1 A;  3I73 A;  1C7Y A;  1JE5 A;  1ASZ A;  1KL9 A;  1V1P A;  3ERQ A;  1SE8 A;  4KV6 A;  2EYJ A;  3M85 A;  3TP8 A;  2R92 H;  1I4P A;  2YTX A;  1SN8 A;  2DY7 A;  3GV3 A;  1MHW C;  3K80 C;  2SEB D;  2ES2 A;  4JOI C;  3RZD B;  2RQX A;  3GO5 A;  4DV6 L;  3V2T A;  4C3I H;  4KN4 C;  5CR3 A;  4A3E H;  2B2W A;  2KCM A;  4LFC L;  1NSN S;  1X3Q A;  5J3B A;  1BF4 A;  3JAM i;  2G9H D;  2QDL A;  1PZJ D;  1CHP D;  1I94 L;  3NSW A;  1SMY C;  4K5W A;  3IRB A;  1S3O A;  1EQV A;  2UXC L;  2HHH L;  3D6C A;  3M4Q A;  4ME5 A;  4A4I A;  3S17 B;  1YNX A;  1S5F D;  2JYO A;  2WB1 G;  2IW3 A;  3BJU A;  4DV4 L;  4A3F G;  1KIX A;  1CM9 A;  4BS9 A;  1HR0 L;  4PG3 A;  1N33 L;  1HQM C;  4A3B H;  2OTJ A;  2DY8 A;  1MSG A;  1KLG D;  2NVT H;  1ET9 A;  1NJI C;  1E2W A;  2K1B A;  4JI5 L;  3F2C A;  1NNX A;  4HN7 A;  3FDT A;  2HQE A;  2FMM A;  1TS5 A;  1H95 A;  2X6G A;  1DOM A;  2A19 A;  4ZUI A;  3T1Y L;  4EQO A;  3PV0 A;  1W6K A;  3GTO B;  1II3 A;  4DN4 M;  5IGE A;  1D1I A;  1Q46 A;  3RZO B;  2IY5 B;  4JK1 C;  3Q6S A;  2KHS A;  5C3E G;  2YTY A;  2Q2U A;  1B8A A;  5C4J H;  3BVG A;  2QDB A;  4FP5 D;  3A54 A;  4GKJ Q;  3PF5 A;  1GOZ A;  4YWK A;  3J80 E;  3M3Y H;  2MFI A;  1UE7 A;  3J81 E;  2E5L Q;  1BBX C;  1PDQ A;  2K4K A;  4J15 A;  5C44 H;  5C0X I;  5JJL A;  3HOV G;  4DR1 Q;  4DV3 Q;  2B2T A;  5EKK A;  2VQF Q;  3VYT A;  1STB A;  2OQ0 A;  4CDC C;  3JC6 6;  4JBJ A;  2E76 C;  3D4R A;  3SK6 A;  1HQR D;  2M9V A;  3CU7 A;  1IYV A;  1ET6 A;  3MFY A;  4LF7 L;  1B2T A;  1M1K C;  4XIG S;  4LF9 L;  4N9T A;  1CHQ D;  4K0K L;  1LT6 D;  3RLN A;  3CP0 A;  4JI4 L;  2ENB A;  3OWF A;  4WFN 3;  1SE4 A;  4ZQ3 A;  2Q2T A;  4HJ8 A;  3J7A V;  3MXN B;  1HUN A;  4X64 L;  2JA5 H;  3U4V A;  4A3L H;  4NB3 A;  1KLU D;  4JVZ A;  2VB2 X;  1U4R A;  4A3D B;  4NXN Q;  3Q24 A;  4XTC S;  4JI6 Q;  1SNO A;  2B29 A;  2K33 A;  1HNX Q;  3H3V H;  4IN3 A;  3HOY G;  3TS0 A;  1EY6 A;  1TY0 A;  2NVX H;  2L1B A;  2NYZ D;  1CQV A;  2QW7 A;  2B2T C;  2M00 A;  3HOU H;  4RCN A;  2UXD Q;  3DEO A;  2K6A A;  1CT1 D;  3A5Z B;  3H3V C;  2K04 A;  4AIM A;  1H9J A;  1VQC A;  1BCP D;  1SYD A;  5EBD A;  3H0G B;  1FGB D;  5E7N A;  2D5D A;  3DLL A;  4B3S L;  3I4M G;  2F4V L;  3HEJ A;  1BKB A;  1SYB A;  3I55 A;  3H91 A;  4AQY L;  1TR5 A;  2KQ3 A;  2JA9 A;  2Z8L A;  3W5O A;  3JAM L;  4TVA B;  3A56 A;  3HOZ G;  3N6R A;  2QA4 A;  2CWP A;  3ULJ A;  4DR7 L;  2V4D A;  1HXY D;  3FRP B;  2A73 B;  1JCK B;  2VNU D;  4DUZ Q;  2F0W A;  4KHP Q;  5J22 A;  2I5H A;  2SNM A;  2RA4 A;  5FLM G;  1X6O A;  4GN3 B;  3CQZ H;  3FKI G;  4OIK A;  1QNU A;  1HZB A;  3T13 A;  3OIP A;  5DM7 3;  4KMU C;  4DFA A;  1STY A;  4A75 A;  1WCM G;  2D9U A;  1D8L A;  3CCU A;  5AJ3 L;  5F2D A;  3S1N H;  1J5E L;  3KLS X;  1GHJ A;  1QZG A;  1PH6 A;  2A68 C;  3AQQ A;  2EYH A;  4A3J H;  2XGT A;  2WAQ G;  5CV9 A;  1FJG Q;  2TSS A;  4F87 A;  2R93 H;  2LSS A;  4A93 B;  5IGD A;  1YEZ A;  4UP9 A;  3HG9 A;  1IW7 C;  5LL6 S;  2KVM A;  4DV5 Q;  5CV5 A;  4BY7 H;  3VYR A;  4IJL A;  1QZH A;  3CKI B;  2JXM B;  4IUP A;  3VA5 A;  1U5K A;  1YVC A;  3LX0 A;  2JK8 A;  1STE A;  3ICE A;  1TS3 A;  2JA7 G;  1KD1 C;  2B2U A;  1IBK L;  1EOV A;  1CA6 A;  4CDE C;  3OOC A;  5C3W A;  4OON A;  4DR4 Q;  2NTT A;  3CCL A;  4OEL B;  2YU9 B;  2Z1C A;  1BBU A;  3S15 H;  2RHQ B;  1M90 C;  4H02 A;  5M5Y B;  4BY1 B;  1UEA B;  2B39 A;  2MO0 A;  3K5O A;  3WOF A;  1QWY A;  4A3C H;  4KKT A;  2SDF A;  1QVC A;  3UDG A;  4K8J A;  4DR6 L;  3RN5 A;  1VQ8 A;  2P5Z X;  1ILP A;  1BNZ A;  5ELE A;  3P7J A;  3K7U C;  4ZYS A;  3CC2 A;  1EIG A;  1A0I A;  4OEM B;  4CBV A;  3BDO A;  2ZTE A;  5DLQ E;  3S24 A;  1ILQ A;  2KBN A;  1N9W A;  3TRZ A;  4A3F B;  4LF8 Q;  3S14 H;  1Q3L A;  2JSO A;  1EIH A;  5KYL A;  1C0A A;  2JJQ A;  3HP3 A;  4KY7 A;  2EYF A;  5ELN A;  4OWX B;  5JJI A;  4M1U B;  2EY1 A;  1ZXT A;  3I70 A;  4G57 A;  3RZD H;  2PQA A;  5JAV A;  3HOW G;  4FF1 A;  2RKS A;  5BN3 A;  4DK6 C;  3Q0A A;  4GKJ L;  4BBS B;  2K52 A;  1T9H A;  2I07 B;  2XRQ D;  3L0O A;  4BBR B;  2HCC A;  3OMG A;  1EQR A;  1LAC A;  4B3M Q;  5C3E B;  3HOX G;  1VQP A;  2E5L L;  2B2Y A;  2KCN A;  1HHV A;  4JC0 A;  4DR1 L;  4NDX A;  3V96 A;  4BA1 I;  4F88 A;  1NBW A;  3C46 A;  3S17 H;  2GA4 B;  4P72 A;  1X55 A;  1LTI D;  2VXW A;  3GDE A;  1SND A;  2IL8 A;  3G6J B;  1PVO A;  1X3G A;  1EZ8 A;  4I7A A;  2PI2 A;  2NZO A;  2VB3 X;  1S5B D;  5KNB A;  4KY5 A;  3D31 A;  4HID A;  4ZRZ A;  3I4N B;  3NQI A;  2EJG C;  1D2B A;  4C3H B;  1HPC A;  5CV4 A;  2B8F A;  1STN A;  3BDL A;  2MGS A;  1F77 A;  4P74 A;  5BN4 A;  4H7B A;  1LT4 D;  1EUJ A;  3DWP A;  1VCI A;  4HSP A;  5IP7 H;  2HT1 A;  4WOR A;  2F0N A;  2F3I A;  2IX0 A;  2GVB A;  2RCN A;  1JJ2 A;  3PO2 G;  3BDC A;  4NP5 A;  3GTO H;  1V1P B;  4GN5 A;  4O2D A;  4EQP A;  4JI6 L;  1L2F A;  5KIX A;  3WDN A;  1TWG B;  3GV6 A;  4RGO S;  4A3M G;  4B3T Q;  3RZO H;  2H4O A;  1QOH A;  1B3Q A;  4IUQ A;  4I65 A;  2B2Y C;  3T16 A;  1ENA A;  4UPA A;  4KTA A;  5IYC G;  1N34 Q;  3HOY B;  2UXD L;  5JEA G;  5I9P A;  1LTR D;  1AH9 A;  3VYS A;  4FXG C;  2D0O A;  1PH1 A;  3CPF A;  3PIO A;  3HKZ G;  1IZ6 A;  1UE1 A;  4RG1 A;  3Q8D A;  1BOS A;  1X56 A;  5IT9 c;  3J7A F;  2DGY A;  3K0X A;  2F0U A;  2JA8 G;  2E2H B;  3K58 A;  1M8A A;  3I4M B;  1EQQ A;  2AKW B;  4C1N I;  3I91 A;  3NBI A;  5A35 A;  1GUW A;  4DV6 Q;  3GTG H;  1V1Q A;  1VQB A;  4DUZ L;  5T1I A;  2JA6 G;  3B6Y A;  4KHP L;  3KF6 A;  2IPK D;  1TS2 A;  4LFC Q;  3R2T A;  4C56 C;  2N3S A;  2N8N A;  1L1O A;  3OW7 A;  4R8N A;  1EL0 A;  2PMZ B;  3EA6 A;  1DXM A;  4NKL A;  1OXU A;  5ELF A;  4JCV E;  1PA6 A;  3OMC A;  3FKI B;  5KRU A;  5LMN L;  1XPU A;  3BYY B;  3G4S A;  1I6H B;  4X6A H;  4NPS A;  1DOK A;  1TWF B;  2K03 A;  1QE6 A;  3TN2 A;  4UY8 C;  1FJG L;  1WCM B;  4APV A;  4F8M A;  3C1E A;  1KTK A;  2UU9 Q;  3I2Z A;  2EZV A;  2EY2 A;  5JOB A;  1WVL A;  1GKH A;  5E4W C;  2WAQ B;  4DV5 L;  3K7A B;  2G9D A;  4OIJ A;  3D6W A;  1N33 Q;  1VQJ A;  4DUY L;  3CC7 A;  2I5M X;  3LWE A;  4KLK A;  3U50 C;  3H0G H;  3P20 A;  1Z6H A;  3CCR A;  1TU2 B;  1KDA A;  2K32 A;  4JI5 Q;  4A3I B;  3OHX C;  5DAU A;  3KDF B;  2EYO A;  2KOL A;  4DAV A;  4QL5 A;  5IYB H;  5HY6 A;  5I2X A;  1KDB A;  3J80 i;  4DR4 L;  3A74 A;  1O7L A;  1A2U A;  4LAA A;  1RDP D;  1O7Z A;  1TWH B;  2JA7 B;  5K36 H;  3GTP H;  1K8M A;  1WTQ A;  1AEX A;  1L1O C;  5M3M G;  3T53 B;  1VQD A;  4PNY A;  4PMB A;  1F9S A;  2N49 A;  1CSQ A;  1BR9 A;  4LUO A;  1L0W A;  2A6H C;  3UI2 A;  1PYW D;  3CXC A;  4LFA Q;  1Y1V B;  4R4Q A;  4HIK A;  4JBK A;  4PMW A;  2L55 A;  1PYS B;  4J6H A;  3OYY A;  1W2B A;  5IT9 L;  3L2P A;  3C1F A;  2A1A A;  4YCV A;  5E3F A;  3MXP A;  5JVG 3;  3E0E A;  1YNN C;  3OPO A;  3EJI A;  5BN5 A;  4CDF C;  4A93 H;  1LT5 D;  1YJ9 A;  3QR8 A;  4Y7N H;  3SXH A;  3KJP A;  1N8R C;  3RLO A;  3HRZ C;  2KJX A;  4IFD I;  1YIT A;  1OTC A;  4LF9 Q;  3J80 c;  2JQO A;  3EN2 A;  1U4P A;  3A5U A;  4M8A A;  3J81 c;  3CCS A;  1NAP A;  3CCJ A;  1E24 A;  3GTL H;  2DNC A;  2N88 A;  1SYG A;  5EJW A;  3OW2 A;  1GHK A;  1WTP A;  2A8V A;  1ZYR C;  4DV7 L;  3NP8 A;  2D0P A;  1IL8 A;  2XSC A;  1J6Q A;  1O78 A;  2YU9 H;  3EBE A;  2A6E D;  5M5Y H;  4CDD C;  4HJA A;  1CZG A;  4BY1 H;  2F0T A;  5E4X A;  1E3P A;  1SNQ A;  2YYZ A;  5CV7 A;  3A8K E;  1TWC B;  1WFQ A;  1EIY B;  1A63 A;  1BDO A;  3RR5 A;  1WTR A;  1BQQ T;  2GN5 A;  1MI2 A;  2IJ0 A;  3HOX B;  2ATW A;  1OXX K;  5D65 A;  2PZW A;  2JN4 A;  5KYI A;  4ZAI A;  2MHV A;  3R3O A;  4DK0 A;  3RNU A;  4GLA C;  1A3U A;  1WTV A;  3MZ5 A;  5IE8 A;  4NW2 A;  2WAC A;  2ZXR A;  2XTI A;  1F9Q A;  4DXF A;  4B3S Q;  5LMN W;  2PZT A;  4AQY Q;  1JB3 A;  3R2I A;  3K8A A;  3TME A;  5FLX L;  2GVA A;  4POF A;  3S2H B;  2CVR A;  3GTK B;  1MSH A;  1K8O A;  1HTL D;  1VS0 A;  1LO5 D;  1GUG A;  1VQA A;  2F0L A;  4A3G G;  4K5V A;  5D3D A;  1K73 C;  4B3T L;  5I6W A;  3PO2 B;  2CH4 W;  3RUZ A;  4C3J B;  2AUK A;  4IAL A;  1SJE D;  4JI8 Q;  1A2T A;  3CCE A;  4BBS H;  2L5T A;  2XRS D;  4JG2 A;  4BBR H;  4A3M B;  2B2V A;  1D5M C;  4HED A;  5C3E H;  2G5D A;  1E1O A;  3S1R H;  1RIP A;  2F1M A;  1PMR A;  4AYB G;  1I5F A; 
#chains in the Genus database with same CATH homology
 1AZQ A;  4RAU C;  3M4O B;  3J80 L;  1YNJ C;  3HKZ B;  1TS4 A;  2JA8 B;  3TP5 A;  1HFG A;  4P2C B;  5C0X J;  4OO1 H;  1B1Z A;  4KHV A;  3DXJ C;  2F0Q A;  2Q8T A;  1IHZ A;  2JA6 B;  2Q8I B;  1JR0 D;  2Q8R E;  4X3S A;  4LMQ D;  1IYU A;  1TWA B;  2NN6 G;  3L7Z C;  3SE0 A;  2F0F A;  2KEE A;  5JJZ A;  1QJO A;  5G3L F;  5A2Q E;  1BCP B;  4IQZ A;  3NTI A;  2A5H A;  4FXK C;  3K5L A;  4IFD G;  5M5W B;  3VA7 A;  2KED A;  2B2W C;  1AZP A;  3TP6 A;  2LY7 A;  4JBW A;  3Q23 A;  1OXT A;  4XQN A;  3G7L A;  2Z4I A;  3K0Y A;  2A69 D;  1AP0 A;  2AQ1 B;  4G4K A;  3NPP A;  3OWE B;  2CHB D;  3SK5 A;  2NUC A;  4HSV A;  1WD0 A;  5ELC A;  2N55 A;  1XX8 A;  2L11 A;  3QIA A;  4KD4 A;  4CGY B;  3FVQ A;  1PZI D;  4QF4 A;  2MPM A;  3H6M A;  3S9W A;  1UUP A;  5IOD A;  1F2Y A;  2X69 A;  2F0I A;  3NBH A;  1STG A;  4XT1 B;  1PTO D;  4DNT B;  5CV6 A;  1SDF A;  4XT3 B;  4FF4 A;  1SJH D;  2EXZ A;  3DHQ A;  3R8B A;  2EJF C;  4ZKB B;  1RJT A;  1G2S A;  4HMJ A;  4H13 C;  4QIW B;  1SNC A;  2EVB A;  3X3N A;  1XTC D;  5TSS A;  2J0T D;  1E2V A;  3ONA B;  1DON A;  2NVY B;  4QUF A;  2L4N A;  2FFK B;  2L0C A;  5COY A;  2F03 A;  4WJW A;  3SDZ A;  4CJ2 C;  3S1M B;  2O2L D;  1A15 A;  1AN8 A;  2D2C C;  1E2Z A;  2TMP A;  2F3W A;  5EKI A;  2CW0 D;  5C0X H;  5ELB A;  3RLF A;  1NUC A;  2LFN A;  3NE5 B;  2BE5 D;  4UAI A;  1DZ1 A;  4G7Z C;  5DM6 3;  1GXD C;  2SOB A;  3PUY A;  1Y1W B;  2R7Z B;  1JC7 A;  5EPJ A;  4KI0 A;  3T4A C;  3AB9 A;  4FO2 A;  1G91 A;  4C1N K;  4QMG A;  4QCL A;  4KKS A;  1A6X A;  4DU9 A;  1CTM A;  3VYU A;  4RKL A;  5FKA C;  3MAQ A;  4RGT A;  2HUG A;  5NUC A;  4IUT A;  4CHT B;  5IGF A;  2F0O A;  4QB4 A;  3IFT A;  4FF3 A;  3MHB A;  1RKN A;  4KKU A;  5I9O A;  1WTO A;  4XQJ A;  5K5P A;  5DEH A;  3VR4 A;  3S16 B;  3QO2 A;  4DAP A;  2VUM B;  5EKL A;  1X32 A;  3SK8 A;  2QCP X;  1JOK A;  4DXG A;  2EYL A;  4CKC A;  2OT2 A;  5FO7 B;  3S1Q B;  1ICW A;  2XWJ B;  4L63 B;  3NHH A;  5EPK A;  4CJ1 B;  2MP1 A;  1U9R A;  3IAY A;  5D14 A;  3DUZ A;  2WB1 B;  4WRD A;  3AMU A;  1WTX A;  2F0H A;  1GUT A;  1LTA D;  1TVX A;  1ZEQ X;  3KBX A;  1I3Q B;  2B2U C;  2C9O A;  3CRK C;  1BCP F;  1QNK A;  3JAM E;  4XXE A;  3ZYY X;  1K83 B;  3E0J A;  1D5Z C;  4XDX A;  3TZD A;  2NTS A;  3D8G A;  1PRT D;  3F2U A;  5E1F A;  3D4D A;  1XWE A;  5JPN C;  4KHZ A;  2JP1 A;  3SK4 A;  1VDZ A;  3M7N A;  4MIU A;  1UAP A;  2K28 A;  3SVM A;  1ENF A;  1BXT A;  3I3C A;  4PQX A;  3K57 A;  3H94 A;  3X3M A;  1H9M A;  1S5E D;  1HCZ A;  3HOV B;  2F0S A;  2HCI A;  2EYM A;  5IGG A;  2BA1 A;  3IKJ A;  1T5E A;  1JOQ A;  4H44 C;  2E2I B;  3KLR A;  1B3A A;  4V0B A;  1JIC A;  1BCP C;  1TKW B;  2F0M A;  1JE4 A;  4KY6 A;  1A3V A;  4ZLT F;  2R92 B;  1T5X D;  2LKV A;  1D6E C;  3K5M A;  4KN7 C;  1JWS D;  1S4Z A;  1Q8I A;  3E5S A;  1U4M A;  2BE5 C;  1XYI A;  5C6A A;  3GTJ B;  3A8J E;  1TY2 A;  4TRD A;  4Q5V A;  1LT3 D;  5CGK A;  2LMC B;  4DF7 A;  3PO3 B;  4QUC A;  1ESR A;  3DWA A;  2R3Z A;  3MVV A;  5M5X B;  1ENC A;  3GQB A;  1CK1 A;  1NCV A;  3HOZ B;  3EQL C;  2R6G A;  4FF2 A;  4TQU S;  3R93 A;  1Z7T A;  3CHB D;  4RHR A;  5C5M A;  2WIN B;  2QKI C;  1ROD A;  3TBI B;  1PRT F;  3MEH A;  1DCZ A;  1H9S A;  2PYK A;  3MC0 B;  2NBF A;  3URY A;  3IL8 A;  3RD4 A;  4XYO A;  2RVL A;  5M9O A;  4RCO A;  3PUX A;  1HTP A;  4XQQ A;  5FOB B;  3TP7 A;  3BS1 A;  1V43 A;  1FNW A;  4DAY A;  2K01 A;  4OL7 A;  1SE2 A;  2J7Z A;  4RA8 A;  3C2P A;  2L12 A;  4K2L A;  2IT1 A;  1L0X B;  1SAP A;  2EY6 A;  1V8Q A;  1PRT C;  1A3T A;  4ULL A;  4E6I A;  2E75 C;  2NN6 I;  1JOO A;  2K5W A;  4FNF A;  1SMY D;  2K05 A;  1HA5 A;  5I2Y A;  2RSO A;  1QB5 D;  5EPL A;  1B9M A;  3KUP A;  3WOE A;  2JEA I;  3BVZ A;  5IIF A;  1I4G A;  1F2Z A;  3FPU B;  1SBB B;  2K5D A;  1DYQ A;  2H1E A;  1GUO A;  3P1H A;  4GZY C;  5JVH 3;  4K6L A;  1NR2 A;  5J1Z A;  2C5C A;  1Q1B A;  4I7Z C;  4R9W A;  3DM1 A;  1PFB A;  1Y8P B;  2PCF B;  4ZUJ A;  4HTH A;  3GD7 A;  4H0L C;  3W2D A;  2AQ3 B;  2E2D C;  2RDF A;  3K59 A;  4ODG A;  4J8Q A;  1PFM A;  3HOW B;  5DNF A;  3KF8 A;  1SFO B;  4ABN A;  4G7O C;  3ERO A;  2QEJ C;  1B50 A;  2F0P A;  4ILW A;  4X3T A;  1O7Y A;  4YIJ A;  5COR A;  1BUV T;  3VR5 A;  2NVQ B;  4IUN A;  3L3O C;  3NQT A;  2KCC A;  3VR2 A;  1WTW A;  1DM0 B;  1C4Q A;  2PW5 A;  4IUR A;  3NWS A;  4Q0F A;  1S5D D;  1SYC A;  4IFD H;  1D1K A;  2O4X A;  3FMC A;  1JWU D;  2PW7 A;  2E74 C;  4EGV A;  5K36 G;  5C4H A;  4O1N A;  1OXS C;  2PNR C;  1R4P B;  4B9X A;  4BA2 I;  3ND9 A;  3ITP A;  1X3P A;  3DMU A;  5IT9 E;  1PTO B;  1C48 A;  2NWG A;  1ESF A;  1PFN A;  4CKB A;  3CRL C;  3J81 L;  5C4Z A;  5IOC A;  5CBE E;  4HMI A;  4KJN A;  3PIO 3;  1SEB D;  1DD2 A;  1J8I A;  3S14 B;  1LLR D;  2K5Q A;  3GTQ B;  1OO9 B;  2AQ2 B;  1XXG A;  2RDH A;  2I46 A;  3C3L A;  1I50 B;  5CYU A;  4IZ8 A;  4DGZ A;  2B2V C;  1RF2 D;  3VR3 A;  3PUW A;  1B44 D;  1GJX A;  3GTM B;  3QOL A;  2RBM A;  1EQT A;  4J1M A;  2A68 D;  2JEB I;  1VF5 C;  2F0G A;  3BVM A;  4HAE A;  4V19 0;  1B4O A;  4K6D A;  5FO9 B;  1IW7 D;  2BOS A;  4LK1 C;  2ZXP A;  2ZXO A;  5FLX E;  2HDM A;  5CV8 A;  1S5C D;  1EWC A;  4HR7 B;  5ELD A;  4FVM A;  1U4L A;  4KK7 A;  1EWH A;  1FYC A;  1KAB A;  5M3M B;  5T1G A;  3ND8 A;  2ZT9 C;  1LTS D;  4R8I A;  3K6O A;  2BCO A;  2IX3 A;  2CQA A;  4TSS A;  4ZKC B;  3P75 A;  4MN3 A;  2A6E C;  1LTG D;  2XWB B;  4NMZ A;  1MBY A;  4F7X A;  1EFI D;  1G6Z A;  3MTS A;  1H9K A;  2D62 A;  3KK7 A;  4XYQ A;  2XNA C;  1AW7 A;  4RHS A;  1H9R A;  3DWQ A;  4S3S A;  2AUJ D;  2IWH A;  5JEA J;  5EBC A;  3S2D B;  2MJ8 A;  1R4Q B;  1CI3 M;  1I4R A;  3NXW A;  4C3I G;  4C3H G;  1D5X C;  2OF1 A;  4OO1 G;  2Z4H A;  3SR1 A;  3L9A X;  1ZKO A;  1Q12 A;  2EYP A;  3GTG B;  1KNE A;  2DNE A;  1I4H A;  1SNP A;  1PZK D;  1PXU A;  2XN9 C;  2L9H A;  1RHP A;  2F4I A;  2AWO A;  2BDN A;  3I8Z A;  1ML0 D;  3BG3 A;  1I4Q A;  5AFW A;  4DA2 A;  1MD2 D;  3NWT A;  2QIL A;  3PIP 3;  1QCB D;  1H9S B;  1PRT B;  5FO8 B;  1BO0 A;  3DEP A;  1G8Z D;  1SYE A;  5IGB A;  3FEW X;  4U67 3;  2MUY A;  5KGU A;  4MHE A;  4A3G B;  3GTP B;  2EPB A;  3W3A A;  3I4L A;  3SEB A;  5LL6 X;  1PLF A;  1EEI D;  1LV9 A;  4N9P A;  1B9N A;  1KAA A;  4AYB B;  3OIQ A;  1FNV A;  3IFD A;  4K14 A;  1Q90 A;  2XVS A;  4OGQ C;  4U68 A;  2PO4 A;  3U9S A;  1CFM A;  2JE6 I;  1G29 1;  4ZK9 B;  3J7Y W;  2FHT A;  1EY9 A;  5KEE A;  4PMC A;  1PTO F;  4Y7N B;  5C3X A;  1RTN A;  3N52 A;  2AWN A;  1WD1 A;  2EOT A;  3GTL B;  1EY7 A;  4TKO B;  3HZX A;  2A69 C;  3MXU A;  3I72 A;  3T56 B;  4DK1 A;  1Z47 A;  5C4X B;  1SXT A;  4KD3 A;  5M3F B;  4RH6 A;  5EQ0 A;  5IGC A;  3MWY W;  5JEA H;  2OEO A;  1TT2 A;  1PTO H;  1QG7 A;  1KDC A;  2K7V A;  5C0X G;  2WII B;  3K5N A;  1PTO C;  1CZW A;  1Q1E A;  1OXV A;  5I4D A;  1I4X A;  1TQO A;  1EYC A;  2FMC A;  2A74 C;  4A3K B;  1JOR A;  2O5I C;  4EVO A;  1LTB D;  3GP7 A;  2O5J C;  1DOL A;  3M7G A;  3PMF A;  4HCS A;  2A6H D;  3LWU A;  2KEC A;  1F9R A;  3A8I E;  1EYA A;  3QWN A;  2BDO A;  3S1R B;  3Q22 A;  1V1O A;  1YNN D;  3OSO A;  5LHY 1;  2CW0 C;  5EGT A;  2F0K A;  2F3V A;  2PPB C;  3QOJ A;  1UNS A;  1EEF D;  1R9T B;  4K5X A;  1EU4 A;  1ZYR D;  4C3I B;  5ISR A;  3O13 A;  4A3E B;  1CA5 A;  4CKE A;  4G7H C;  4UDU C;  4IUU A;  1SNM A;  1ONL A;  3HS0 C;  4ID6 A;  4C3J G;  1AFP A;  1JQY D;  3U9O A;  2EE1 A;  3D4W A;  2FJ2 A;  3KBG A;  2WV6 D;  2NB0 A;  4HCE A;  3H09 A;  3QB3 A;  3RMH A;  3MXN A;  1Y8N B;  1SYF A;  1M4V A;  4A3B B;  4B9W A;  4IUV A;  5FK9 C;  2NVT B;  5KNC A;  2LS0 1;  1FD7 D;  2RSN A;  1F9P A;  2XIW A;  1GUS A;  2WP8 J;  1LAB A;  5D3I B;  4IFD J;  4RGN A;  3BYT B;  4FYD A;  2E2J B;  4Z9C B;  5C4J B;  4X3U A;  2B63 B;  1EY4 A;  1EYD A;  4CJ0 B;  3M3Y B;  2WKD A;  2NZ1 D;  4L8J A;  5C44 B;  2ID0 A;  3VR6 A;  5CMD A;  3A7A B;  4EQN A;  3T51 B;  2B8G A;  1VF7 A;  4K8I A;  1EU3 A;  4BWG B;  2HDL A;  1HUM A;  1IKL A;  1YNJ D;  4RWS C;  4DNR B;  3AU7 A;  1HFN A;  5CC4 A;  1G2T A;  3D3R A;  3MA2 B;  5JPM C;  3EFX D;  4PV1 C;  1EOT A;  3TDQ A;  2Y0S B;  2J4X A;  3EVQ A;  2JA5 B;  1HRJ A;  3M4Y A;  4L6T B;  1CQF A;  3E6Z X;  4O42 A;  3PUZ A;  3NK9 A;  3A55 A;  1L0Y B;  3QG1 A;  2OXP A;  3BZD B;  1JWM D;  2QF7 A;  4OHJ A;  2SNS A;  2NVX B;  3HGB A;  4RKB A;  1EY5 A;  1TII D;  4X3K A;  4K2K A;  3HOU B;  3FPP A;  3NTH A;  5HUR A;  4RFB A;  4RGM A;  1EZ6 A;  3TSS A;  5KND A;  4B08 A;  2M2L A;  2KUM A;  4C2M B;  2EJM A;  5I6Y A;  5HGT A;  4LJZ C;  5J39 A;  1C8C A;  1F2L A;  2X6L A;  1W6J A;  5C5L A;  1MGS A;  2ICI A;  3CQZ B;  1KNA A;  2R61 A;  1SE3 A;  2PZU A;  3NUC A;  1B53 A;  1Y8O B;  2NN6 H;  1RD9 D;  5G3L D;  1E0B A;  2EDG A;  1QIL A;  3LNN A;  1DJR D;  3S1N B;  1I6V C;  1EY0 A;  4A3J B;  3PUV A;  1EY8 A;  2R93 B;  3V05 A;  3KLS A;  5A2Q L;  1HA6 A;  4FXD A;  1LTT D;  2F0J A;  1J9O A;  2RDG A;  1F2M A;  3MXG A;  4BY7 B;  3A7L A;  1O80 A;  3QJY A;  1VMC A;  2WKC A;  2FIN B;  4OO1 I;  1IKM A;  3SHL A;  1NR4 A;  2DN8 A;  2F0D A;  1RCV D;  1GUN A;  3S15 B;  3I90 A;  1FR3 A;  2ICE C;  3MFG A;  1VMP A;  4KJO A;  2F0E A;  1STA A;  2BA0 A;  1STH A;  1FNU A;  5CBA E;  3NTK A;  1RTO A;  2F0V A;  2PQE A;  2EY5 A;  3TZU A;  1SSO A;  1Y69 U;  2IX1 A;  2KA7 A;  3I73 A;  1V1P A;  3ERQ A;  4KV6 A;  2EYJ A;  3M85 A;  3TP8 A;  1I4P A;  2DY7 A;  3GV3 A;  2SEB D;  3RZD B;  2RQX A;  3GO5 A;  3V2T A;  4KN4 C;  5CR3 A;  2B2W A;  1NSN S;  1X3Q A;  1BF4 A;  2G9H D;  1PZJ D;  1CHP D;  3NSW A;  1SMY C;  4K5W A;  1EQV A;  3D6C A;  4ME5 A;  3S17 B;  1S5F D;  2JYO A;  2IW3 A;  1CM9 A;  4BS9 A;  1HQM C;  2DY8 A;  1MSG A;  1KLG D;  1ET9 A;  1E2W A;  2K1B A;  4HN7 A;  3FDT A;  2HQE A;  2FMM A;  1TS5 A;  2X6G A;  1DOM A;  4ZUI A;  4EQO A;  3PV0 A;  1W6K A;  3GTO B;  1II3 A;  4DN4 M;  5IGE A;  1D1I A;  3RZO B;  4JK1 C;  3Q6S A;  2KHS A;  3BVG A;  2QDB A;  4FP5 D;  3A54 A;  1GOZ A;  3J80 E;  3J81 E;  1BBX C;  1PDQ A;  5C0X I;  2B2T A;  5EKK A;  3VYT A;  1STB A;  2E76 C;  3D4R A;  3SK6 A;  1HQR D;  2M9V A;  3CU7 A;  1IYV A;  1ET6 A;  3MFY A;  1B2T A;  4XIG S;  4N9T A;  1CHQ D;  1LT6 D;  2ENB A;  3OWF A;  4WFN 3;  1SE4 A;  4ZQ3 A;  3J7A V;  1HUN A;  1KLU D;  2VB2 X;  1U4R A;  4A3D B;  3Q24 A;  4XTC S;  1SNO A;  2K33 A;  4IN3 A;  1EY6 A;  1TY0 A;  2L1B A;  2NYZ D;  1CQV A;  2B2T C;  2M00 A;  4RCN A;  3DEO A;  2K6A A;  1CT1 D;  3H3V C;  2K04 A;  1H9J A;  1BCP D;  1SYD A;  5EBD A;  3H0G B;  1FGB D;  2D5D A;  3HEJ A;  1SYB A;  3H91 A;  1TR5 A;  2KQ3 A;  2Z8L A;  3JAM L;  3A56 A;  3N6R A;  2V4D A;  1HXY D;  3FRP B;  2A73 B;  1JCK B;  2VNU D;  2F0W A;  5J22 A;  2SNM A;  2RA4 A;  4OIK A;  1QNU A;  3T13 A;  3OIP A;  5DM7 3;  4KMU C;  4DFA A;  1STY A;  2D9U A;  5F2D A;  3KLS X;  1GHJ A;  2A68 C;  2EYH A;  5CV9 A;  2TSS A;  4F87 A;  4A93 B;  5IGD A;  3HG9 A;  1IW7 C;  5LL6 S;  2KVM A;  5CV5 A;  3VYR A;  3CKI B;  2JXM B;  4IUP A;  3VA5 A;  3LX0 A;  1STE A;  1TS3 A;  2B2U A;  1CA6 A;  3OOC A;  5C3W A;  2NTT A;  2YU9 B;  2Z1C A;  5M5Y B;  4BY1 B;  1UEA B;  2B39 A;  3K5O A;  3WOF A;  1QWY A;  4KKT A;  2SDF A;  4K8J A;  1ILP A;  1BNZ A;  5ELE A;  3P7J A;  4ZYS A;  1EIG A;  4CBV A;  3BDO A;  1ILQ A;  4A3F B;  1Q3L A;  2JSO A;  1EIH A;  5KYL A;  3HP3 A;  4KY7 A;  2EYF A;  4M1U B;  2EY1 A;  1ZXT A;  3I70 A;  4G57 A;  5JAV A;  4FF1 A;  2RKS A;  5BN3 A;  3Q0A A;  4BBS B;  2I07 B;  2XRQ D;  4BBR B;  2HCC A;  3OMG A;  1LAC A;  5C3E B;  2B2Y A;  2KCN A;  1HHV A;  4NDX A;  3V96 A;  4BA1 I;  4F88 A;  3C46 A;  2GA4 B;  1LTI D;  2VXW A;  1SND A;  2IL8 A;  3G6J B;  1EZ8 A;  2VB3 X;  1S5B D;  5KNB A;  4KY5 A;  3D31 A;  4ZRZ A;  3I4N B;  3NQI A;  2EJG C;  1D2B A;  4C3H B;  1HPC A;  5CV4 A;  2B8F A;  1STN A;  3BDL A;  2MGS A;  1F77 A;  5BN4 A;  4H7B A;  1LT4 D;  3DWP A;  1VCI A;  4HSP A;  4WOR A;  2F0N A;  2IX0 A;  3BDC A;  4NP5 A;  1V1P B;  4EQP A;  5KIX A;  3WDN A;  1TWG B;  3GV6 A;  4RGO S;  2H4O A;  1QOH A;  4IUQ A;  4I65 A;  2B2Y C;  3T16 A;  1ENA A;  4KTA A;  3HOY B;  5JEA G;  5I9P A;  1LTR D;  3VYS A;  4FXG C;  1BOS A;  3J7A F;  2F0U A;  2E2H B;  3K58 A;  1M8A A;  3I4M B;  4C1N I;  3I91 A;  3NBI A;  5A35 A;  1GUW A;  5T1I A;  2IPK D;  1TS2 A;  3R2T A;  4C56 C;  3OW7 A;  4R8N A;  1EL0 A;  2PMZ B;  3EA6 A;  1DXM A;  4NKL A;  1OXU A;  5ELF A;  3OMC A;  3FKI B;  5KRU A;  3BYY B;  1I6H B;  1DOK A;  1TWF B;  2K03 A;  1QE6 A;  3TN2 A;  4F8M A;  1WCM B;  3C1E A;  1KTK A;  2EZV A;  2EY2 A;  5JOB A;  1WVL A;  5E4W C;  2WAQ B;  3K7A B;  2G9D A;  4OIJ A;  3D6W A;  3LWE A;  3P20 A;  1Z6H A;  1TU2 B;  1KDA A;  2K32 A;  4A3I B;  3OHX C;  5DAU A;  2EYO A;  2KOL A;  4DAV A;  5I2X A;  1KDB A;  1O7L A;  1A2U A;  4LAA A;  1RDP D;  1O7Z A;  1TWH B;  2JA7 B;  5K36 H;  1K8M A;  1WTQ A;  1AEX A;  3T53 B;  4PNY A;  4PMB A;  1F9S A;  1BR9 A;  2A6H C;  3UI2 A;  1PYW D;  1Y1V B;  4PMW A;  2L55 A;  4J6H A;  5IT9 L;  3C1F A;  5E3F A;  3MXP A;  5JVG 3;  1YNN C;  3OPO A;  3EJI A;  5BN5 A;  1LT5 D;  3SXH A;  3HRZ C;  2KJX A;  4IFD I;  1U4P A;  4M8A A;  1NAP A;  2DNC A;  2N88 A;  1SYG A;  5EJW A;  1GHK A;  1WTP A;  1ZYR C;  3NP8 A;  1IL8 A;  2XSC A;  1O78 A;  2A6E D;  1CZG A;  2F0T A;  5E4X A;  1SNQ A;  2YYZ A;  5CV7 A;  3A8K E;  1TWC B;  1BDO A;  1WTR A;  1BQQ T;  1MI2 A;  2IJ0 A;  3HOX B;  1OXX K;  5D65 A;  2PZW A;  5KYI A;  4ZAI A;  2MHV A;  3R3O A;  4DK0 A;  1A3U A;  1WTV A;  3MZ5 A;  4NW2 A;  2WAC A;  2ZXR A;  4DXF A;  1F9Q A;  2PZT A;  1JB3 A;  3R2I A;  3TME A;  5FLX L;  3S2H B;  2CVR A;  3GTK B;  1MSH A;  1K8O A;  1HTL D;  1LO5 D;  1GUG A;  2F0L A;  4K5V A;  5D3D A;  5I6W A;  3PO2 B;  3RUZ A;  4C3J B;  2AUK A;  4IAL A;  1SJE D;  1A2T A;  2L5T A;  2XRS D;  4A3M B;  2B2V A;  1D5M C;  4HED A;  2F1M A;  1PMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...