1MBYA

Murine sak polo domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
75
structure length
75
Chain Sequence
SVFVKNVGWATQLTSGAVWVQFNDGSQLVMQAGVSSISYTSPDGQTTRYGENEKLPEYIKQKLQLLSSILLMFSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Sak polo-box comprises a structural domain sufficient for mitotic subcellular localization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords serine/threonine kinase
total genus 11
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2002-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.930 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1mbyA00
5LHY1 1MBYA
chains in the Genus database with same CATH superfamily
4LF7L 5BN5A 1AP0A 1HCZA 1Q8IA 5HY6A 1GUSA 4JI8Q 4LNQA 4GKJL 4ZCKA 3H3VC 2VQEL 2OTJA 2L12A 2V1CC 1SJHD 1XPUA 1H9KA 2PMZB 1PHJA 4A3MB 1F2YA 2V4DA 1J5EQ 4BBSH 2X6GA 4RHRA 2EYMA 5EAYA 5C3WA 1E3PA 3D4WA 4B9XA 4EQNA 1ESRA 3NQIA 1EQQA 5IIFA 1VDZA 4JI0L 2VQEQ 1LTSD 2A69C 3R2IA 5DEHA 2R93B 4L6TB 2NZ1D 2JA7H 1KD1C 3J81c 2F1MA 1TIID 3JAMi 2EZVA 1WD0A 2VQFL 1OTCA 2VUMH 3IKJA 1C8CA 2CFMA 4JI5L 1RODA 1KNEA 5JPNC 2E2IH 2DGYA 4J15A 5E7NA 5M5YH 3HS0C 1S3OA 2PQAA 1CSPA 2H5XA 2XN9C 1MKHA 4OO1G 5DM73 1LTRD 2ZJPA 2JEAI 2GVAA 1PZKD 1VF7A 5KGUA 4UHVA 3HGBA 1NSNS 2QILA 2NN6G 1IYUA 3R3OA 4APVA 3VA7A 1R9TB 3FP9A 2Z9HA 4BY1B 2GVBA 4H0LC 1I50B 2K4KA 1WVLA 2R61A 2XNAC 3S1RH 1RTOA 4PMCA 1KAWA 1Y14B 4A93B 5EJWA 1Q7YC 2DJFC 4POGA 1XTCD 3K5MA 1IBKL 3NWTA 2KCMA 3S1MH 3HOVG 1LT6D 2JK8A 4EX5A 3OIPA 2IJ0A 3L9AX 5IP9H 1QUQA 4DF7A 4A3JB 4BBSG 1JE4A 4IUPA 1G291 4CKEA 1K28A 1YNJD 4IUVA 2E2JH 3A7AB 2B2UC 1I4RA 3OPOA 3S2HB 2R7FA 2Q8TA 2BCOA 4JI1L 2E5LL 2ZJRA 2O4XA 2NWGA 4V190 4LJZC 4LK1C 4Z9CB 1KRSA 3FDTA 3JAML 5CV8A 1V8QA 2E74C 4OO1I 1Q12A 3D4DA 2K01A 1SYCA 4A3LH 3H3VH 3MC0B 2D2CC 2Q8IB 3K8AA 1VQDA 4HIMA 1OXUA 4GOPB 1LT3D 3VYUA 1GHJA 1ET6A 1B70B 3S16H 2IL8A 4IN3A 4U673 2WAQE 1U9RA 3J80c 3CKIB 1QVFA 3K0YA 1SE3A 5LL6X 4DV3Q 2VS1A 1WTWA 3HOVB 2K5WA 3BVZA 3K7UC 4KK7A 4TRDA 4DV4Q 4FYDA 1V1OA 3AFQA 5KIXA 4Y7NH 2EDGA 4CJ1B 3N6RA 1T5XD 2UUBL 2ALYB 4GOPC 3ONAB 4A3EG 1K0RA 3I4MG 1HNWQ 4OIKA 2RA4A 3HOYG 1GHKA 5AFWA 1SEBD 2G9DA 3S1NH 5JJIA 5M5XH 5CGKA 1I4HA 2KEDA 5EGTA 1ENCA 3Q0AA 4FF1A 1BXTA 5I9PA 4A3IB 1Q82C 1SFOH 2K28A 4PMWA 1EY7A 1PH1A 1UE7A 1BVSA 1JCKB 4DAMA 3A7LA 1IXRA 4JV5L 3OWEB 3NP8A 4K8IA 3MXNA 3HOZB 1KABA 1HH2P 1PLFA 2B2YA 5E1FA 2L4NA 4DV7L 5ELFA 4JI0Q 2MJ8A 1N36L 2ENBA 1CFMA 1VQLA 1JB7A 2ICEC 4NB3A 4DR4Q 1GVPA 1H9MA 4A3DH 2I07B 3GD7A 1PTOB 4JI6Q 2BE5C 4YIJA 2F3VA 3H94A 3UI2A 2VUMG 1YHAA 3M4PA 3PUZA 4AQYL 3F8TA 1WJJA 2XWBB 2PW7A 3I7FA 2Q2UA 2K14A 4KKUA 4GNXC 2KHSA 2LMCB 1KQSA 3QB3A 4ALPA 1LT5D 2KA7A 4FVMA 5G3LD 2A5HA 3CMEA 1KAAA 1PRTF 4IPGA 1O7IA 1GUWA 1CHQD 3PV0A 3E3XA 2F03A 4C3JH 2QW7A 1A3TA 2UUAQ 4KHZA 3QG1A 4AYBB 4HTHA 4C3IH 2WV6D 3A54A 1EWCA 3PO3B 1IBLL 1Q1BA 1EU4A 1TWHH 4PV1C 4R8IA 1EZ6A 2F3IA 2O5JC 1HPCA 2B2UA 2F0JA 4RGNA 1BO0A 4Y52H 1YBYA 1CI3M 1K83H 2A73B 4R4OA 4R4CA 5CC4A 3J81L 2UXBQ 1O80A 2VB2X 2N55A 3GTQH 3O13A 4C3HG 1L0YB 3I4NG 1MIUA 4KKSA 4X62L 1HNXQ 2WFWA 1FGUA 2IT1A 1M90C 1MI2A 5IP7H 1BOSA 3IFTA 1MD2D 4DR2Q 2JSOA 1TS4A 1WYDA 2KENA 4JC0A 3FPPA 5KNDA 4JYAL 2DUDA 1C7YA 2UXDQ 4QY7A 2I46A 3NE5B 2F0FA 3TS2A 3PIO3 4HJ5A 4A3KG 4CJ2C 4OX9Q 4XT3B 1HR0L 1LV9A 4CBVA 1C0AA 1KXLA 3PO3G 1P8LA 1VF5C 1CK1A 4A3DB 3PUXA 1HR0W 1NJIC 4DR2L 4A3DG 1CKMA 2YTYA 5C4JB 2F0GA 4YCWA 2NB0A 4DUYQ 1ILPA 4FDBA 1I3QH 1W6JA 3HZXA 3CCSA 3P7JA 1F77A 5EKKA 1RDPD 4PZ8A 4K0KL 4NXMQ 3C3LA 2BH2A 5FO7B 2F0HA 2OWOA 2CH4W 2N3SA 3TP7A 3K5LA 3NENA 1YNNC 1DCZA 1HR0Q 1PH6A 2B2YC 1PA6A 1D5MC 1K8MA 2VB3X 3NUCA 4FXKC 2H4OA 1EYCA 2F0WA 1SSOA 3BVGA 3RNUA 1TR5A 1D1IA 5CV7A 5M3FG 3EN2A 1QZHA 2ES2A 3ER0A 4ZRZA 3VR5A 1SMYD 5I6YA 3A5ZB 1BKBA 1CKNB 1KHIA 3F2UA 3FPUB 1S5ED 3S9WA 2F0PA 4K5WA 1PH3A 1VQAA 1XTDA 4POFA 3CCRA 3BDCA 1N36Q 1AZQA 1STHA 4A3GH 4NKLA 2B29A 3I8ZA 3I56A 1PH8A 3D6WA 1BQQT 2RHSB 2C9OA 3M4OH 1IBLQ 2VZAA 1GO3E 1M1KC 3TN2A 2KQ3A 3OIQA 3NBIA 5C3EB 3CC7A 1I6HB 2HHHL 3S24A 1KDBA 2HDLA 2B2VA 3DXJC 4A3FH 3S17B 1BNZA 2F0KA 1N34L 2M9VA 1PVOA 3A8IE 2F0TA 4KJOA 4MNOA 5L37A 1TS5A 3GTGB 4B08A 4DR5L 3I4NB 2JE6I 3LGJA 2WINB 3B6YA 4LFBQ 4HSVA 2A6HC 4XYOA 1YJ9A 3BJUA 1MGSA 2ICIA 3Q23A 4LMQD 1SYDA 4A4IA 1Y1WH 1VQEA 4YCUA 3KBGA 4DV7Q 1K9MC 2MNAA 4BA2I 2EYLA 3S1RB 5M3MG 4C3HH 3M4OB 5ISRA 4BY1H 4ME3A 2LXJA 2OXPA 2X69A 4JBMA 3K7AH 2WB1E 4A3FB 2F3WA 3P20A 1G2TA 1PTOD 2J7ZA 5C3EH 1I6HH 1PZID 5FLXE 4AIMA 4GLAC 2R3ZA 5LHY1 1L0XB 4CDEC 1E2VA 3KF6B 2ZXPA 3I91A 4OXPA 5M5YB 4LF5Q 3NBHA 4A3GB 2IHEA 1CZGA 1DXMA 4IFDJ 2E2IB 1A63A 5IYCG 3CRLC 5KNBA 2E5LQ 1VQHA 1EWHA 4L5QA 1EOVA 1LACA 1RJTA 2K5VA 3WWVA 3MAQA 4DR7Q 1A8VA 2QF7A 1TWCH 2HIVA 1CKNA 2B63B 1SDFA 1ENFA 1K0SA 2B8GA 2RDFA 2PYKA 4DKAC 1JICA 3AB9A 2SNSA 3MHBA 3VDYA 3TQYA 3H15A 4NDXA 1E2ZA 2PQEA 2UU9L 1ILQA 4KTAA 3HKSA 4QUFA 2OCEA 1JB3A 1HTLD 4PQXA 4DAYB 3SHLA 3S15B 1U4PA 2N78A 2DNCA 3M9BA 1SMXA 4N8FA 1SMYC 3PO2H 5D3DA 4X66Q 1O7LA 1UAPA 4JCVE 1H9RA 5C4XG 3HKZE 1EL0A 5D3IB 5IP9G 1LT4D 1ENAA 5ELCA 3R93A 3D8GA 4X65Q 3IL8A 3HOWB 1I3QB 1S5FD 4E6IA 2A69D 2N88A 4QCLA 5JPMC 3RR5A 5G3LF 1EY6A 5HURA 4DR3Q 3QOJA 4U68A 5LMUQ 1S40A 1D1KA 1XNQQ 2NVTB 1KLUD 4R9WA 4A3EH 1DYQA 3A8JE 4ILWA 1YEZA 3FKIH 4QB4A 1IBKQ 2B2VC 4ZAIA 1NCVA 3L7ZC 1UE1A 2XGTA 5FO9B 1Y1WB 5EKIA 5EPKA 1BDOA 1TWFH 3BVMA 3D0FA 1UEAB 4XTCS 4JW0A 3KFUA 3R2TA 5C44B 3GTGH 3HFZB 1X9NA 4HIKA 1TWHB 1MHWC 4PZ7A 4RG1A 1PRTB 4ABNA 4XQNA 1LYLA 3Q22A 2AQ3B 1W2BA 3KYHC 3NELA 2HT1A 1G91A 1H95A 2I0QA 4OELB 2A8VA 3MXPA 4UPAA 1J5EL 3H91A 2K50A 4WJ3M 1A3VA 4JG2A 1EQVA 3E9IA 4C3JB 4A3FG 5BR8L 4IUNA 3T51B 2ZTCA 3SR1A 1N9WA 3S1QH 1TWAB 5JEAH 1G6PA 5E4WC 4C3IB 1VS0A 4DR6Q 3OTOQ 2A6EC 1JJCB 2ZXRA 1OXSC 4BY1G 4JI6L 1Y1VG 1KIXA 4O42A 3GTLH 5FK9C 3RLFA 1SYBA 1LTTD 5JVH3 5C3XA 3ERSX 4I7AA 4R4QA 4EQPA 1PH9A 4GZYC 1E0BA 3C2PA 1CA6A 4JPBW 2QDBA 3LWEA 5IT9L 4QIWE 2AHOB 4RFBA 2A6ED 2F52A 1PTOH 2G9HD 4HIOA 1STNA 1K8AC 2RCFA 2NVYH 3GV3A 4DUZL 1FL0A 5C4ZA 1F9RA 3RLOA 4KN7C 2LFNA 1E1TA 3Q24A 1UUPA 2JA9A 3EQLC 2BE5D 1I4GA 2FMCA 2B8FA 2YU9H 4MTNA 1DOLA 4LF9Q 1KDCA 3CCEA 1YJNA 2E2HB 3K59A 4KY7A 2KHIA 5K36H 1JC7A 3KJPA 3RMHA 1TS3A 4X62Q 3K80C 4ODGA 1LUZA 2CVRA 4V0BA 2QCPX 4DV3L 2FHTA 1T5EA 3HOVH 3NPPA 4C3JG 3OMGA 2IX0A 4FXDA 3V05A 3CHBD 1SRUA 5LL6S 4A3BG 4YWKA 4JK1C 5A35A 4OX9L 2LY7A 4A76A 4KLKA 1W3SA 3RLNA 2I5HA 2F0OA 4GN5A 4HMIA 4J1MA 2AMCB 4RGTA 1XPRA 3CPWA 2RQXA 3E0JA 5C4XH 4KY5A 3BZCA 1EYDA 4MIUA 1WOCA 1SN8A 3M4QA 3S2HH 4R8NA 4IJHA 1PYSB 3PO3H 3HOUH 4JBWA 4OEMB 2PMZE 4YWLA 3U9OA 3S1MB 3BZKA 1CA5A 1CQVA 4K5VA 4DK3C 5IOCA 3SK6A 3PQIA 5ELNA 2KCCA 2O5IC 1A0IA 2Y0SG 1P16A 4LUZA 3I70A 5M3FH 3KF8B 3MFYA 5M9OA 2KCTA 2VW9A 1QILA 1O7ZA 2XIWA 3UDIA 1HFGA 3W2DA 4OWWB 4A3JH 4DR6L 1WCMG 3CW2C 3RZOB 1JWSD 4GLVB 1K3BC 5KYIA 1CT1D 1I4QA 3MWYW 1H9SB 1VQNA 3J7YW 1FNWA 5IWAL 2RDHA 1GJXA 4F7XA 1IBML 5GAEC 2MO1A 3DWPA 1D7QA 2JA8B 1PFMA 1RL2A 4IUTA 1PTOC 4QGUA 1SROA 1SYGA 2F0VA 4B3RQ 2E2DC 4BWGB 4A3IH 2CCZA 1EOTA 1LTLA 2R93H 1L0WA 2QGQA 2FMMA 2IHFA 1I6VC 3H3VI 4K2KA 1MJCA 3D3RA 4OO1H 1A62A 2MP1A 3K5OA 3GDEA 4CJ0B 5M5XB 4IFDH 5AJ3L 1X3PA 2IX3A 4EQ5A 1AE2A 5CBAE 1G51A 1B3AA 1LLRD 1JWUD 3A5UA 5D65A 1S5BD 4BBSB 3CCLA 1CM9A 4CDDC 4F8MA 5CBEE 5JJZA 3BDOA 2JA7G 2EY5A 1TWGH 5M3MH 2A6HD 1NBWA 3PMFA 2B39A 3KLRA 4GS3A 2F0DA 4LF7Q 4DV0Q 1I94Q 2MUYA 1IYJB 4LUOA 2MHVA 4N9PA 5JJKA 1F2ZA 1PFBA 3HG9A 4BBRH 5IGFA 5C3EG 4A3MH 1GD7A 2BA1A 1VQIA 3IFDA 1X3QA 1XNRQ 1VQKA 4LFAQ 1V1QA 4B3TL 3KOJA 2B2WA 1A15A 1XMQL 2C5CA 3DM3A 2J4XA 2BDOA 5IYDG 3A55A 4G7ZC 4AH6A 5FLMH 1WTRA 2O2LD 5IODA 4FNFA 1STAA 1Q3LA 1D8LA 3MVVA 4LF6L 2ATWA 4IFDI 4DR7L 4A3JG 3HOYB 5I6WA 5M3MB 1TWGB 3GV6A 4L5TA 1RIPA 2QEXA 1SXTA 4OONA 1MJEA 1WTHA 4PG3A 5H1SE 2PZWA 1G2SA 3OHXC 4BY7B 1LTAD 1PDQA 1PYBA 1BBUA 4KHVA 2RBMA 1YNND 3F2DA 1SE8A 3OYYA 1VQ8A 4O2DA 1EY9A 2DNEA 4K2LA 3M3YH 2Q2IA 2L1BA 1TY2A 2NVXB 3F2CA 1CSQA 1R4QB 1ZEQX 2BH8A 1EY5A 4JI4L 3T4AC 2K05A 3JC66 2HUGA 4M1UB 1PRTC 3PIP3 3WOFA 1Y8PB 2D62A 1B4OA 2CWAA 2EJMA 5T1GA 4G7HC 2JA8H 4H02A 2QDLA 2VY3A 2SDFA 1ET9A 2PCFB 1D6EC 2LXKA 2EYFA 4ZK9B 1DOKA 1D5ZC 3MA2B 1VCIA 2NVYB 1NE3A 5CR3A 4UAIA 1BCPC 3UDGA 4HR7B 1KRTA 3VR6A 3KDFB 1HZAA 5FJ8G 4N9TA 5C0XJ 2C35B 5IGBA 2AKWB 4LW1A 3RZOH 2JN4A 3DUZA 1X54A 3AFPA 3J80i 2B2TA 2MFIA 4YCVA 1SJED 3S2DH 3DWQA 2WIIB 4A93G 1TXYA 5GQOA 4P75A 4P74A 4QUCA 3VR4A 5IGCA 5IYCH 3AEVA 5FKAC 2IWHA 3OW7A 3DHQA 2RF4A 3OWFA 3I3CA 4KHPL 2F0UA 5J1ZA 4AYBE 4ZKBB 1D5XC 4EVOA 1XYIA 4BXXG 3U58A 3EROA 4C1NI 2Z4HA 3NK9A 3VR3A 5M3FB 5IT9E 2Q2HA 3VR2A 1QE6A 3D4RA 5FLMG 3BS1A 1RD9D 1F9PA 5GAGC 2L55A 4NP5A 5C4XB 4I65A 1S5CD 3I90A 4DK6C 4HMJA 4G57A 1EEID 3RZDH 4KHPQ 5KYLA 1HZ9A 2JA5B 1DJRD 2B2WC 5KRUA 2ID0A 2J0TD 1NY4A 5C44H 3E6ZX 3Q8DA 1J8IA 5JAVA 1C4QA 3MFGA 1UE6A 1EQTA 1XXGA 1LTGD 3ULPA 1XNQL 4H7BA 2JA8G 4QMGA 1Y69U 4XXEA 4JI3Q 1V1PA 5IT9c 5LMNL 1ML0D 2CQOA 1A3UA 3CRKC 4GLXA 1JOQA 4C3IG 4K0KQ 3MXGA 4TQUS 4DV4L 1NUCA 2FJ2A 3GTMH 1EIFA 1EIHA 1SNQA 1UE5A 4PNYA 4XQJA 1YITA 2UUBQ 1X56A 1EFWA 5DLQE 5J3BA 2NBFA 4ZYSA 2XSCA 4L8JA 5IY0A 5HGTA 4YHHQ 1V43A 4KI0A 3GQBA 1K3RA 2PQAB 3I55A 4DV6Q 4JI7L 4P71A 5CYUA 3TMEA 2EVBA 4DV1L 2SEBD 5LMUL 3G7LA 3JAMc 3BU2A 3ZYYX 2D5DA 3W1BA 3FEWX 3N52A 3EA6A 2DN8A 2YU9B 1BUVT 5C6AA 1RTNA 3J81E 4IJLA 1PYWD 4GOPA 2UXDL 1JOOA 5ELEA 3Q6SA 2MO0A 2UXCL 3CC4A 4FXGC 4A3CG 3MEFA 1IW7C 4C1NK 2WKDA 2K04A 5ELOA 4X66L 1BBWA 3MXUA 2JA6B 2KHJA 1HA5A 2RCNA 2FXQA 1C9OA 1VQMA 1Z9FA 5K36G 4LF6Q 5CMDA 2CW0D 4WJ4A 5DAUA 2MGSA 2UU9Q 2HIXA 3CPFA 2EE1A 3IRBA 5AJ3Q 4AQYQ 2K7VA 3UDFA 4FF2A 3P1HA 2LKVA 1TWAH 1Q90A 3AMUA 1R4PB 1CZWA 3GTLB 2MPMA 3EBEA 2N49A 4RHSA 4L63B 3X3MA 3HOXH 4LF4Q 3KJOA 2OQKA 1VQOA 1F2MA 4UP8A 1Q8KA 4B3TQ 2IY5B 2YV5A 1DOMA 1QNKA 4HAEA 4HIDA 2SNMA 4JI1Q 2UUAL 4LF9L 3H0GH 3KK7A 5CV4A 4DPGA 1TS2A 1F2LA 1Q81C 2KVMA 3M3YB 4XT1B 1CHPD 4O1NA 2R7ZG 1I94L 1YNJC 4C3HB 5DNFA 4X64Q 3L2PA 4R1JA 2PNHA 2MQHA 1X55A 4BY7H 2NVQH 1PRTD 2HQLA 3KLWA 4RKBA 1RCVD 2F0MA 4MN3A 1QJOA 5EPLA 3I2ZA 1SNMA 5KEEA 1CTMA 5EPJA 4OIJA 4FO2A 1HRJA 1FNVA 1OXTA 3CU7A 3PSIA 1KL9A 2RKSA 3NWSA 1B44D 1EZ8A 1TWFB 1K8GA 1KTKA 4A3BB 4DNTB 3T16A 3K0XA 3RUZA 2ZT9C 2NUCA 3I4MB 1HQRD 3H6MA 3EJIA 2A19A 4DK1A 4XYQA 1B8AA 4A3KH 2CH4A 2EYPA 3E5SA 1IBMQ 1PFNA 2K75A 5JEAG 5I9OA 5T1IA 1SAPA 3L3OC 4GN4B 3PO2B 1N8RC 4JI8L 3D6CA 4BBRB 2I5MX 4YWMA 1F9SA 5EBCA 3PIPA 4X3TA 4PZ6A 3K58A 4ZKCB 4DV2L 1TT2A 1ICFB 4B3ML 3OOCA 5C0XH 2L11A 4MZ9A 1LTID 1T9HA 2KECA 2JQOA 2PNRC 5IYBG 2B63H 1PH2A 3TZDA 2KEEA 2Y0SB 2YYZA 5A2QE 3S15H 1LO5D 4X6AH 1OXVA 3U4ZA 1ESFA 1QVGA 4A3MG 5IGDA 1BR9A 3H0GG 1VQPA 5I2XA 3T1YL 1TKWB 1UWVA 4IFDG 1IYVA 1BCPF 4R4TA 3QWNA 1B3QA 4LFCL 3EVQA 3KDFA 3HKZB 1U4LA 4GNXA 2UXCQ 1SE2A 2AQ2B 3LNNA 1G6ZA 2X6LA 3K7AB 1EYAA 1DGSA 4DV5Q 4KN4C 1XMOL 4HEDA 1HA6A 3SE0A 3DMUA 2EY6A 4J6HA 2ZTEA 5CV9A 4RAUC 3T56B 1VQ6A 4K6DA 2F4IA 1YIJA 4RWSC 4QQBX 1NR2A 2D0OA 4HCSA 4JI5Q 5EBDA 4HJ9A 4TKOB 2JA6G 2XVSA 3AQQA 4WRDA 5I4DA 4LFCQ 3DEPA 3GTJB 4LAAA 1XX8A 1SNPA 4IPHA 3PCOB 4DAPA 2G5DA 1Y1VB 3PUWA 2XTIA 1DD2A 4DXGA 4HJ7A 1QWYA 2PPBC 4ZUIA 1QNUA 3CP0A 3VYTA 4BBRG 1HNZQ 4IUQA 4HJAA 1EY4A 1B53A 5JJLA 3FKIG 1XMQQ 1UNSA 1X65A 5IGEA 4CDCC 2ZM6Q 3S17H 1YHQA 1SYFA 4RCNA 1RHPA 5E4XA 2NVQB 4DV5L 1SLJA 2HCCA 3I4OA 3HOXG 4LFAL 5LMNW 2VXWA 3OTOL 2R7ZH 4KJNA 3M7GA 2KBNA 3TP6A 1Q86C 4RGOS 3GTOB 5F2DA 4IURA 1K83B 1G8ZD 3I4NH 3J7A5 2F0QA 3E0EA 1XNRL 1X32A 5HGQA 1SNCA 4DR5Q 4UY8C 1PMRA 4P2CB 4DAYA 5IYBH 1HFNA 1S5DD 2BA0A 3HOUG 1U4RA 3OW2A 1L1OB 1B9NA 3H0GB 2EQSA 3W5OA 1Q46A 2Z1CA 1JMCA 2CW0C 4DU9A 3BZDB 1STBA 3BG3A 3T1HL 1B1ZA 4BY7G 3TSSA 1GUGA 4RH6A 1ONLA 3TDQA 1HZCA 1NNXA 1TQOA 1J9OA 3F1ZA 4P73A 2UXBL 1NR4A 3CAMA 2AWNA 3I73A 1IW7D 3ERQA 2Q8RE 3J7AV 4GKJQ 2AWOA 2WAQG 1VMCA 1FJGQ 4DR4L 3CCVA 3NTIA 2KOLA 4ID6A 3T1HQ 4JBJA 2OF1A 3TEHB 3MZ5A 4GN3B 2JA6H 4MHEA 1ZYRC 3NQTA 1JOKA 2E2HH 2OTLA 3CCMA 4OHJA 3ZJYC 3BYTB 3E9HA 3VYSA 1PV4A 1Y1WG 4IPDA 3STBC 3TBIB 2I5LX 5ELDA 1W6KA 3ULLA 4A3IG 5A2QL 5JOBA 5C4JH 1SFOB 2HD3A 4OWTB 4FP5D 4H44C 2M2LA 4CDFC 2JXMB 1A2UA 2F0IA 3C1EA 4ULLA 3W1GA 4LUVA 4DUYL 4MTKA 1VQJA 4EQOA 4NXNL 3PIOA 1YNXA 2NTSA 3PF4A 3OMCA 2YTVA 4K5XA 2EXDA 1QCBD 5J22A 4P72A 3J81i 1HQMC 1WTOA 2AUJD 1L1OC 4JI4Q 2PW5A 3L0OA 3NXWA 5C5MA 1M4VA 4A3GG 2K5HA 3UE0A 3K5NA 2TSSA 1KLGD 1SE4A 2UUCL 4I7ZC 1HNWL 2YTXA 1UEBA 2DY7A 3ITPA 4DGZA 2CHBD 4JYAQ 2R92H 3TP5A 1II3A 3ICEA 4JI2L 2HQEA 1MSGA 3V2TA 1XWEA 1IKMA 2PI2E 4R4IA 4DN4M 2L5TA 2HDMA 3HEJA 3K6OA 1IHZA 3URYA 2Y0SE 4G7OC 5BN3A 4DV6L 4JI7Q 2R92B 1VQ7A 2OQ0A 3M4YA 3TS0A 3PUYA 5K5PA 3GTOH 1Y8NB 3DWAA 2AQ1B 1LM0A 1JJ2A 4JI2Q 3HKZG 2R7ZB 2EY2A 1GUTA 2NYZD 1O78A 2R6GA 2EYOA 4C56C 4ZLTF 1TY0A 2EY1A 1X6OA 3A8KE 3BDLA 1WTPA 2XWJB 3FKIB 4KKTA 1VQGA 4DV0L 1Y8OB 3RN5A 2DY8A 1M8AA 4TVAB 4L5RC 3NTKA 5I2YA 2EIFA 3DEOA 3S2DB 5C44G 1QVCA 5LMNQ 1Y1VH 1C48A 1HXYD 1WFQA 4L5SA 4UDUC 4UP7A 1ICWA 1EU3A 3RN2A 2KJXA 5GADC 4LFBL 4F88A 3W3AA 5EKLA 3ND9A 3HOWH 2XRQD 4BS9A 4PMBA 3HOZH 3K57A 3I72A 3G48A 1VQFA 1B7YB 4NXNQ 1AW7A 1IKLA 2F0EA 4RA8A 4DA2A 4YHHL 5CV6A 2NTTA 2Z6KC 4ME5A 2CKZB 4WJWA 1FVIA 2QKIC 4CKBA 3CCJA 1JJGA 4NMZA 5NUCA 2AUKA 3A0JA 3TZUA 3C46A 3KLSX 5D14A 1VQ9A 2ZXOA 4S3SA 2Z0SA 1WD1A 4J8QA 3QOLA 2K5QA 4X3SA 2JA7B 4XQQA 3U50C 3HP3A 3QIAA 5FLXc 3G71A 4X3UA 2QEJC 5FO8B 1EFID 1Q1EA 3VA5A 3PUVA 1U4MA 1JWMD 1H9JA 4N8X1 4KD4A 3CMAA 2R92G 3SK4A 4JI3L 4RGMA 1TWCB 3EFXD 3IAYA 3DLLA 4IOCA 4YY3Q 3A56A 5J39A 3S1NB 4JOIA 4NW2A 2B2TC 2VQFQ 4A3LG 1DONA 5BR8Q 3CD6A 3TP8A 1FYCA 1A2TA 1GXDC 2NZHA 3U9SA 4KD3A 2ZM6L 1YJWA 1D2BA 1CKOA 2R93G 3X3NA 1L2FA 1SYEA 2BDNA 4RCOA 1TU2B 4K6LA 5CORA 3NBHB 2BOSA 4HJ8A 3SGIA 3FMCA 1X3GA 1Z6HA 3NTHA 1HNZL 1WTXA 3BYYB 4XIGS 3PF5A 1E7ZA 2ZJQA 4FF3A 4IO9A 4A3KB 3TREA 1FNUA 3DM1A 3I4MH 1ZXTA 1GUNA 2RSNA 5IYDH 4JBKA 3NEMA 5BN4A 1U0LA 1AN8A 4ZUJA 1BF4A 2K33A 2E2JB 5E3FA 1DZ1A 1S4ZA 1JR0D 1HJPA 3U4VA 1H9SA 2LSSA 1I50H 3FHWA 4DR3L 5FJ8H 4CGYB 2HCIA 3J80L 1IL2A 3CCUA 3C1FA 3GTKH 3GTJH 2VL6A 3HOWG 1SR3A 4G4KA 1STEA 1AE3A 3G6JB 1NTGA 4A93H 2JJQA 3F2BA 3CC2A 1STGA 4LF4L 1RF2D 3SXHA 2A1AA 3HOXB 1EY8A 5C0XI 2F0NA 1HZBA 2FINB 1R9TH 1JORA 2FFKB 3KBXA 3ND8A 4GKKQ 3S14H 3NSWA 2RVLA 4OL7A 1HUMA 2WB1B 1GM5A 1IZ6A 2VUMB 1EYGA 4BXXH 2PZTA 1EY0A 1QZGA 2F0LA 1KNAA 1AH9A 1VQCA 2K1BA 1ASZA 1KC8C 4A3CH 2Z6KA 1FD7D 3A74A 3SK8A 3WDNA 4JVZA 4DR1L 1NMGA 2R7DA 4WFN3 4X65L 1VQBA 2WKCA 1F9QA 3CCQA 2F4VL 1IL8A 4CKCA 3SEBA 2TMPA 2L0CA 4QF4A 3KF8A 3HOZG 1K73C 4B3MQ 2LS01 1QOHA 2B63G 1HNXL 1YI2A 4IPCA 2EYJA 3KLSA 5JVG3 3QR8A 3CF5A 1S72A 1E2WA 2NN6I 2PO4A 1QG7A 2UUCQ 4LF5L 3TRZA 3ULJA 4B9WA 1FGBD 5C4HA 4HSPA 1L1OA 2E76C 1U5KA 4O0AA 1WCMH 2E75C 1O7YA 1JQYD 1B2TA 3K81C 3QJYA 1DM0B 3AU7A 1HHVA 1Z7TA 3GP7A 1WTQA 4IOAA 4K8JA 2OEOA 5COYA 1NAPA 3CQZB 2JA5G 4UP9A 4OGQC 4DXFA 3HOUB 3QO2A 5IP7G 4DV2Q 2A68D 1NMFA 3J81j 4JV5Q 4FF4A 4LF8Q 3J7ZC 4IALA 4DNRB 4YY3L 1QUQB 3RD4A 1X3FA 1ZKOA 2OT2A 4ZQ3A 4EGVA 1N32L 2PZUA 4KMUC 3AYHB 3V96A 2VNUD 2DJGC 5JEAJ 4A3BH 2EXZA 1XPOA 4IZ8A 1N33L 1E24A 2RHQB 3WOEA 2K03A 3MXNB 1PH7A 4AYBG 2RDGA 1MBYA 1N34Q 4X3KA 3SDZA 5EQ0A 3M85A 3PGZA 2SOBA 2ASBA 1LTBD 1TVXA 5M5WH 1N32Q 3PO2G 1V1PB 5CV5A 4BA1I 4A75A 1YZ6A 4DFAA 1HUNA 4IUUA 1FJGL 1ASYA 3GO5A 2RSOA 1BCPB 3FRPB 3GTQB 5FLXL 1V9PA 4B3RL 2A74C 1WTVA 1EIGA 3M7NA 4CHTB 1K8OA 2D9UA 1YHBA 2Z6BA 1B9MA 1SNDA 4QL5A 1YVCA 4C2MB 1Z47A 2IPKD 4NPSA 2CQAA 4X64L 4KV6A 1RKNA 1VQ4A 3CXCA 3UDXA 1CQFA 4KY6A 4M8AA 5FOBB 3LX0A 4HCEA 3J80E 3STBD 1WI5A 4Q0FA 3R8BA 1EUJA 5C0XG 1E22A 1I4PA 2EJFC 1WCMB 2K5DA 2EOTA 5GROA 2HHHQ 4LF8L 1AZPA 1X3EA 2L15A 4HN7A 2B3GA 2K52A 2KCNA 1XJVA 3GTPH 2E8GA 2Z4IA 3H09A 3KUPA 1PFSA 1STYA 3LWUA 4DR1Q 1SNOA 2IW3A 5ELBA 1GKHA 3GTPB 1OXXK 1QB5D 1OO9B 3MTSA 2WACA 1SBBB 2NZOA 1VMPA 2NN6H 5IGGA 2WAQB 2GA4B 4WORA 1E1OA 4DV1Q 2H1EA 5C5LA 3KF6A 2KUMA 1AEXA 5KNCA 2IX1A 1JT8A 2EJGC 4QIWB 2EYHA 4B3SL 3JAME 2P5ZX 2WB1G 2K5NA 4Q5VA 1PZJD 2Q2TA 2K32A 2PI2A 1PH5A 1EWIA 1I5FA 2L9HA 4IQZA 2F4VQ 3I4LA 5IE8A 3T13A 3S14B 2GN5A 3S1QB 4DNIA 2K6AA 2NVXH 3G6EA 4C2MH 1FR3A 3MEHA 1GOZA 1EQRA 2F0SA 4JOIC 4F87A 2XRSD 3HRZC 1A6XA 4NXML 3SVMA 4H13C 1B50A 2QA4A 1BCPD 1XMOQ 5GAHC 4QJFA 1GUOA 3GTMB 3GTKB 1EIYB 2ZTDA 1HTPA 1ZYRD 4DUZQ 2CWPA 4TSSA 4K14A 3G4SA 4B3SQ 3D31A 4Y7NB 1EEFD 1I4XA 4RMFA 1CUKA 4GKKL 4LWCA 2M00A 2JEBI 1LABA 3P75A 5TSSA 3T1YQ 2JP1A 2A68C 2N8NA 3OSOA 1BBXC 1PTOF 3UE1A 3T53B 3VYRA 2WP8J 1PH4A 1PXUA 5M5WB 3S16B 3HOYH 4A3EB 3NHHA 1J6QA 2EPBA 4XDXA 4DAVA 2NVTH 2JA5H 3RZDB 1VQ5A 1N33Q 3EIVA 3SK5A 3CQZH 3J7AF 4DK0A 1JE5A 1MSHA 5IWAQ 5DM63 2JYOA 2D0PA 4GNXB 4OWXB 1KDAA 4RKLA 1AFPA 2Z8LA 3FVQA
chains in the Genus database with same CATH topology
5BN5A 1AP0A 1HCZA 1Q8IA 1GUSA 3H3VC 2L12A 1SJHD 1H9KA 2PMZB 4A3MB 1F2YA 2V4DA 2X6GA 4RHRA 2EYMA 5C3WA 3D4WA 4B9XA 4EQNA 1ESRA 3NQIA 5IIFA 1VDZA 1LTSD 2A69C 3R2IA 5DEHA 2R93B 4L6TB 2NZ1D 2F1MA 1TIID 2EZVA 1WD0A 3IKJA 1C8CA 1RODA 1KNEA 5JPNC 3HS0C 4OO1G 2XN9C 5DM73 1LTRD 2JEAI 1PZKD 1VF7A 5KGUA 3HGBA 1NSNS 2QILA 2NN6G 1IYUA 3R3OA 3VA7A 1R9TB 4BY1B 4H0LC 1I50B 1WVLA 2R61A 2XNAC 1RTOA 4PMCA 4A93B 5EJWA 1XTCD 3K5MA 3NWTA 1LT6D 3OIPA 2IJ0A 3L9AX 4DF7A 4A3JB 1JE4A 4IUPA 1G291 4CKEA 1YNJD 4IUVA 3A7AB 2B2UC 1I4RA 3OPOA 3S2HB 2Q8TA 2BCOA 2O4XA 2NWGA 4V190 4LJZC 4LK1C 4Z9CB 3FDTA 3JAML 5CV8A 1V8QA 2E74C 4OO1I 1Q12A 3D4DA 2K01A 1SYCA 3MC0B 2D2CC 2Q8IB 1OXUA 1LT3D 3VYUA 1GHJA 1ET6A 2IL8A 4IN3A 4U673 1U9RA 3CKIB 3K0YA 1SE3A 5LL6X 1WTWA 3HOVB 2K5WA 3BVZA 4KK7A 4TRDA 4FYDA 1V1OA 5KIXA 2EDGA 4CJ1B 3N6RA 1T5XD 3ONAB 4OIKA 2RA4A 1GHKA 5AFWA 1SEBD 2G9DA 5CGKA 1I4HA 2KEDA 5EGTA 1ENCA 3Q0AA 4FF1A 1BXTA 5I9PA 4A3IB 2K28A 4PMWA 1EY7A 1JCKB 3A7LA 3OWEB 3NP8A 4K8IA 3MXNA 3HOZB 1KABA 1PLFA 2B2YA 5E1FA 2L4NA 5ELFA 2MJ8A 2ENBA 1CFMA 2ICEC 1H9MA 2I07B 3GD7A 1PTOB 4YIJA 2BE5C 2F3VA 3H94A 3UI2A 3PUZA 2XWBB 2PW7A 4KKUA 2KHSA 2LMCB 3QB3A 1LT5D 2KA7A 4FVMA 5G3LD 2A5HA 1KAAA 1PRTF 1GUWA 1CHQD 3PV0A 2F03A 1A3TA 4KHZA 3QG1A 4AYBB 4HTHA 2WV6D 3A54A 1EWCA 3PO3B 1Q1BA 1EU4A 4PV1C 4R8IA 1EZ6A 2O5JC 1HPCA 2B2UA 2F0JA 4RGNA 1BO0A 1CI3M 2A73B 5CC4A 3J81L 1O80A 2VB2X 2N55A 3O13A 4C3HG 1L0YB 4KKSA 2IT1A 1MI2A 1BOSA 3IFTA 1MD2D 2JSOA 1TS4A 5KNDA 3FPPA 2I46A 3NE5B 2F0FA 3PIO3 4CJ2C 4XT3B 1LV9A 4CBVA 1VF5C 1CK1A 4A3DB 3PUXA 5C4JB 2F0GA 2NB0A 1ILPA 1W6JA 3HZXA 3P7JA 1F77A 5EKKA 1RDPD 3C3LA 5FO7B 2F0HA 3TP7A 3K5LA 1YNNC 1DCZA 2B2YC 1D5MC 1K8MA 2VB3X 3NUCA 4FXKC 2H4OA 1EYCA 2F0WA 1SSOA 3BVGA 1TR5A 1D1IA 5CV7A 4ZRZA 3VR5A 1SMYD 5I6YA 3F2UA 3FPUB 1S5ED 3S9WA 2F0PA 4K5WA 3BDCA 1AZQA 1STHA 4NKLA 3I8ZA 3D6WA 1BQQT 2C9OA 3TN2A 2KQ3A 3OIQA 3NBIA 5C3EB 1I6HB 1KDBA 2HDLA 2B2VA 3DXJC 3S17B 1BNZA 2F0KA 2M9VA 3A8IE 2F0TA 4KJOA 1TS5A 3GTGB 4B08A 3I4NB 2JE6I 2WINB 4HSVA 2A6HC 4XYOA 1MGSA 2ICIA 3Q23A 4LMQD 1SYDA 3KBGA 4BA2I 2EYLA 3S1RB 3M4OB 5ISRA 2OXPA 2X69A 4A3FB 2F3WA 3P20A 1G2TA 1PTOD 2J7ZA 1PZID 5FLXE 2R3ZA 5LHY1 1L0XB 1E2VA 2ZXPA 3I91A 5M5YB 3NBHA 4A3GB 1CZGA 1DXMA 4IFDJ 2E2IB 3CRLC 5KNBA 1EWHA 3MAQA 1LACA 1RJTA 2QF7A 2B63B 1SDFA 1ENFA 2B8GA 2RDFA 2PYKA 1JICA 3AB9A 2SNSA 3MHBA 4NDXA 1E2ZA 2PQEA 1ILQA 4KTAA 4QUFA 1JB3A 1HTLD 4PQXA 3SHLA 3S15B 1U4PA 2DNCA 1SMYC 5D3DA 1O7LA 1UAPA 1H9RA 1EL0A 5D3IB 1LT4D 1ENAA 5ELCA 3R93A 3D8GA 3HOWB 3IL8A 1I3QB 1S5FD 4E6IA 2A69D 2N88A 4QCLA 5JPMC 5G3LF 1EY6A 5HURA 3QOJA 4U68A 1D1KA 2NVTB 1KLUD 4R9WA 1DYQA 3A8JE 4ILWA 4QB4A 2B2VC 4ZAIA 1NCVA 3L7ZC 5FO9B 1Y1WB 5EKIA 5EPKA 1BDOA 3BVMA 1UEAB 4XTCS 3R2TA 5C44B 1TWHB 4ABNA 4XQNA 1PRTB 3Q22A 2AQ3B 1G91A 3MXPA 3H91A 1A3VA 1EQVA 4C3JB 4IUNA 3T51B 3SR1A 1TWAB 5JEAH 5E4WC 4C3IB 2A6EC 2ZXRA 1OXSC 4O42A 5FK9C 3RLFA 1SYBA 1LTTD 5JVH3 5C3XA 4EQPA 4GZYC 1E0BA 3C2PA 1CA6A 2QDBA 3LWEA 5IT9L 4RFBA 2A6ED 1PTOH 2G9HD 1STNA 3GV3A 5C4ZA 1F9RA 4KN7C 2LFNA 3Q24A 1UUPA 3EQLC 2BE5D 1I4GA 2FMCA 2B8FA 1DOLA 1KDCA 2E2HB 3K59A 4KY7A 5K36H 1JC7A 3RMHA 1TS3A 4ODGA 2CVRA 4V0BA 2QCPX 2FHTA 1T5EA 3NPPA 4C3JG 3OMGA 2IX0A 4FXDA 3V05A 3CHBD 5LL6S 4JK1C 5A35A 2LY7A 2F0OA 4HMIA 4J1MA 4RGTA 2RQXA 3E0JA 4KY5A 1EYDA 4MIUA 4R8NA 4JBWA 3U9OA 3S1MB 1CA5A 1CQVA 4K5VA 5IOCA 3SK6A 2KCCA 2O5IC 3I70A 3MFYA 5M9OA 1QILA 1O7ZA 2XIWA 1HFGA 3W2DA 3RZOB 1JWSD 5KYIA 1CT1D 1I4QA 3MWYW 1H9SB 3J7YW 1FNWA 2RDHA 1GJXA 4F7XA 3DWPA 2JA8B 1PFMA 4IUTA 1PTOC 1SYGA 2F0VA 2E2DC 4BWGB 1EOTA 2FMMA 1I6VC 4K2KA 3D3RA 4OO1H 2MP1A 3K5OA 4CJ0B 5M5XB 4IFDH 1X3PA 2IX3A 5CBAE 1LLRD 1B3AA 1JWUD 5D65A 1S5BD 4BBSB 1CM9A 4F8MA 5CBEE 5JJZA 3BDOA 2EY5A 2A6HD 3PMFA 2B39A 3KLRA 2F0DA 2MUYA 4N9PA 2MHVA 1F2ZA 1PFBA 3HG9A 5IGFA 2BA1A 3IFDA 1X3QA 2B2WA 1A15A 2C5CA 2J4XA 2BDOA 3A55A 4G7ZC 1WTRA 2O2LD 5IODA 4FNFA 1STAA 1Q3LA 3MVVA 4IFDI 3HOYB 5I6WA 5M3MB 1TWGB 3GV6A 1SXTA 2PZWA 1G2SA 3OHXC 4BY7B 1LTAD 1PDQA 4KHVA 2RBMA 1YNND 1EY9A 2DNEA 4K2LA 2L1BA 1TY2A 2NVXB 1R4QB 1ZEQX 1EY5A 3T4AC 2K05A 2HUGA 4M1UB 1PRTC 3PIP3 3WOFA 1Y8PB 2D62A 1B4OA 2EJMA 5T1GA 4G7HC 2SDFA 1ET9A 2PCFB 1D6EC 2EYFA 4ZK9B 1DOKA 1D5ZC 3MA2B 1VCIA 2NVYB 5CR3A 4UAIA 1BCPC 4HR7B 3VR6A 4N9TA 5C0XJ 5IGBA 3DUZA 2B2TA 1SJED 3DWQA 2WIIB 5IGCA 4QUCA 3VR4A 5FKAC 2IWHA 3OW7A 3DHQA 3OWFA 3I3CA 2F0UA 5J1ZA 4ZKBB 1D5XC 4EVOA 1XYIA 3EROA 4C1NI 2Z4HA 3NK9A 3VR3A 5M3FB 5IT9E 3VR2A 1QE6A 3D4RA 3BS1A 1RD9D 1F9PA 2L55A 4NP5A 5C4XB 4I65A 1S5CD 3I90A 4HMJA 4G57A 1EEID 5KYLA 2JA5B 1DJRD 2B2WC 5KRUA 2ID0A 2J0TD 3E6ZX 1J8IA 5JAVA 1C4QA 3MFGA 1EQTA 1XXGA 1LTGD 4H7BA 4QMGA 1Y69U 4XXEA 1V1PA 1ML0D 1A3UA 3CRKC 1JOQA 4C3IG 3MXGA 4TQUS 1NUCA 2FJ2A 1EIHA 1SNQA 4XQJA 4PNYA 2NBFA 4ZYSA 2XSCA 4L8JA 5HGTA 1V43A 4KI0A 3GQBA 5CYUA 3TMEA 2EVBA 2SEBD 3G7LA 3ZYYX 2D5DA 3FEWX 3N52A 3EA6A 2DN8A 2YU9B 1BUVT 5C6AA 1RTNA 3J81E 1PYWD 1JOOA 5ELEA 3Q6SA 4FXGC 1IW7C 4C1NK 2WKDA 2K04A 3MXUA 2JA6B 1HA5A 5K36G 5CMDA 2CW0D 5DAUA 2MGSA 2EE1A 4FF2A 2K7VA 3P1HA 2LKVA 1Q90A 3AMUA 1R4PB 1CZWA 3GTLB 2MPMA 4RHSA 3X3MA 4L63B 1F2MA 1DOMA 1QNKA 4HAEA 2SNMA 3KK7A 5CV4A 1TS2A 1F2LA 2KVMA 3M3YB 4XT1B 1CHPD 4O1NA 1YNJC 4C3HB 5DNFA 1PRTD 4RKBA 1RCVD 2F0MA 4MN3A 1QJOA 5EPLA 1SNMA 5KEEA 1CTMA 5EPJA 4FO2A 4OIJA 1HRJA 1FNVA 1OXTA 3CU7A 2RKSA 3NWSA 1B44D 1EZ8A 1TWFB 1KTKA 4A3BB 4DNTB 3T16A 3RUZA 2ZT9C 2NUCA 3I4MB 1HQRD 3H6MA 3EJIA 4DK1A 4XYQA 2EYPA 3E5SA 1PFNA 5JEAG 5I9OA 5T1IA 1SAPA 3L3OC 3PO2B 3D6CA 4BBRB 1F9SA 5EBCA 4X3TA 3K58A 4ZKCB 1TT2A 3OOCA 5C0XH 2L11A 1LTID 2KECA 2PNRC 3TZDA 2KEEA 2Y0SB 2YYZA 5A2QE 1LO5D 1OXVA 1ESFA 5IGDA 1BR9A 5I2XA 1TKWB 4IFDG 1IYVA 1BCPF 3QWNA 3EVQA 3HKZB 1U4LA 1SE2A 2AQ2B 3LNNA 1G6ZA 2X6LA 3K7AB 1EYAA 4KN4C 4HEDA 1HA6A 3SE0A 3DMUA 2EY6A 4J6HA 5CV9A 4RAUC 3T56B 4K6DA 2F4IA 4RWSC 1NR2A 4HCSA 5EBDA 4TKOB 2XVSA 4WRDA 5I4DA 3DEPA 3GTJB 4LAAA 1XX8A 1SNPA 4DAPA 1Y1VB 3PUWA 1DD2A 2PPBC 4DXGA 1QWYA 4ZUIA 1QNUA 3VYTA 4IUQA 1EY4A 1B53A 1UNSA 5IGEA 1SYFA 4RCNA 1RHPA 5E4XA 2NVQB 2HCCA 2VXWA 4KJNA 3M7GA 3TP6A 4RGOS 3GTOB 5F2DA 4IURA 1K83B 1G8ZD 2F0QA 1X32A 1SNCA 1HFNA 1PMRA 4P2CB 4DAYA 1S5DD 2BA0A 1U4RA 1B9NA 3H0GB 2Z1CA 2CW0C 4DU9A 3BZDB 1STBA 3BG3A 1B1ZA 3TSSA 1GUGA 4RH6A 1ONLA 3TDQA 1TQOA 1J9OA 1NR4A 2AWNA 3I73A 1IW7D 3ERQA 2Q8RE 3J7AV 2AWOA 1VMCA 3NTIA 2KOLA 4ID6A 2OF1A 3MZ5A 4MHEA 1ZYRC 3NQTA 1JOKA 4OHJA 3BYTB 3VYSA 3TBIB 5ELDA 1W6KA 5A2QL 5JOBA 1SFOB 4FP5D 4H44C 2M2LA 2JXMB 1A2UA 2F0IA 3C1EA 4ULLA 4EQOA 2NTSA 3OMCA 4K5XA 1QCBD 5J22A 1HQMC 1WTOA 2AUJD 2PW5A 3NXWA 5C5MA 1M4VA 3K5NA 2TSSA 1KLGD 1SE4A 4I7ZC 2DY7A 3ITPA 4DGZA 2CHBD 3TP5A 1II3A 2HQEA 1MSGA 3V2TA 1XWEA 1IKMA 4DN4M 2L5TA 2HDMA 3HEJA 3K6OA 1IHZA 3URYA 4G7OC 5BN3A 2R92B 3M4YA 3PUYA 5K5PA 1Y8NB 3DWAA 2AQ1B 2R7ZB 2EY2A 1GUTA 2NYZD 1O78A 2R6GA 2EYOA 4C56C 4ZLTF 1TY0A 2EY1A 3A8KE 3BDLA 1WTPA 2XWJB 3FKIB 4KKTA 1Y8OB 2DY8A 1M8AA 3NTKA 5I2YA 3DEOA 3S2DB 1C48A 1HXYD 4UDUC 1ICWA 1EU3A 2KJXA 4F88A 3W3AA 5EKLA 3ND9A 2XRQD 4BS9A 4PMBA 3K57A 3I72A 1AW7A 1IKLA 2F0EA 4RA8A 4DA2A 5CV6A 2NTTA 4ME5A 4WJWA 2QKIC 4CKBA 4NMZA 5NUCA 2AUKA 3TZUA 3C46A 3KLSX 5D14A 2ZXOA 4S3SA 1WD1A 4J8QA 3QOLA 2K5QA 4X3SA 2JA7B 4XQQA 3HP3A 3QIAA 4X3UA 2QEJC 5FO8B 1EFID 1Q1EA 3VA5A 3PUVA 1U4MA 1JWMD 1H9JA 4KD4A 3SK4A 4RGMA 1TWCB 3EFXD 3IAYA 3A56A 5J39A 3S1NB 4NW2A 2B2TC 1DONA 3TP8A 1FYCA 1A2TA 1GXDC 3U9SA 4KD3A 1D2BA 3X3NA 1SYEA 2BDNA 4RCOA 1TU2B 4K6LA 5CORA 2BOSA 3FMCA 1Z6HA 3NTHA 1WTXA 3BYYB 4XIGS 4FF3A 4A3KB 1FNUA 3DM1A 1ZXTA 1GUNA 2RSNA 5BN4A 1AN8A 4ZUJA 1BF4A 2K33A 2E2JB 5E3FA 1DZ1A 1S4ZA 1JR0D 1H9SA 4CGYB 2HCIA 3J80L 3C1FA 4G4KA 1STEA 3G6JB 1STGA 1RF2D 3SXHA 3HOXB 1EY8A 5C0XI 2F0NA 2FINB 1JORA 2FFKB 3KBXA 3ND8A 3NSWA 2RVLA 4OL7A 1HUMA 2WB1B 2VUMB 2PZTA 1EY0A 2F0LA 1KNAA 2K1BA 1FD7D 3SK8A 3WDNA 4WFN3 2WKCA 1F9QA 1IL8A 4CKCA 3SEBA 2TMPA 2L0CA 4QF4A 3KF8A 2LS01 1QOHA 2EYJA 3KLSA 5JVG3 1E2WA 2NN6I 2PO4A 1QG7A 4B9WA 1FGBD 5C4HA 4HSPA 2E76C 2E75C 1O7YA 1JQYD 1B2TA 1DM0B 3QJYA 3AU7A 1HHVA 1Z7TA 3GP7A 1WTQA 4K8JA 2OEOA 5COYA 1NAPA 3CQZB 4OGQC 4DXFA 3HOUB 3QO2A 2A68D 4FF4A 4IALA 4DNRB 3RD4A 4EGVA 1ZKOA 2OT2A 4ZQ3A 2PZUA 4KMUC 3V96A 2VNUD 5JEAJ 2EXZA 4IZ8A 3WOEA 2K03A 2RDGA 1MBYA 4X3KA 3SDZA 5EQ0A 3M85A 2SOBA 1LTBD 1TVXA 1V1PB 5CV5A 4BA1I 4DFAA 1HUNA 4IUUA 3GO5A 2RSOA 1BCPB 3FRPB 3GTQB 5FLXL 2A74C 1WTVA 1EIGA 3M7NA 4CHTB 1K8OA 2D9UA 1B9MA 1SNDA 4C2MB 1Z47A 2IPKD 2CQAA 4KV6A 1RKNA 1CQFA 4KY6A 4M8AA 5FOBB 3LX0A 4HCEA 3J80E 4Q0FA 3R8BA 5C0XG 1I4PA 2EJFC 1WCMB 2K5DA 2EOTA 1AZPA 4HN7A 2KCNA 2Z4IA 3H09A 3KUPA 1STYA 3LWUA 1SNOA 2IW3A 5ELBA 3GTPB 1OXXK 1QB5D 1OO9B 3MTSA 1SBBB 2WACA 1VMPA 2NN6H 5IGGA 2WAQB 2GA4B 4WORA 2H1EA 5C5LA 5KNCA 2KUMA 1AEXA 2IX1A 2EJGC 4QIWB 2EYHA 3JAME 4Q5VA 1PZJD 2K32A 2L9HA 4IQZA 3I4LA 3T13A 3S14B 3S1QB 2K6AA 1FR3A 3MEHA 1GOZA 2F0SA 4F87A 2XRSD 3HRZC 1A6XA 3SVMA 4H13C 1B50A 1BCPD 1GUOA 3GTMB 3GTKB 1HTPA 1ZYRD 4TSSA 4K14A 3D31A 4Y7NB 1EEFD 1I4XA 2M00A 2JEBI 1LABA 3P75A 5TSSA 2JP1A 2A68C 3OSOA 1BBXC 1PTOF 3T53B 3VYRA 2WP8J 1PXUA 5M5WB 3S16B 4A3EB 3NHHA 2EPBA 4XDXA 4DAVA 3RZDB 3SK5A 3J7AF 4DK0A 1MSHA 5DM63 2JYOA 1KDAA 4RKLA 1AFPA 2Z8LA 3FVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LHY 1;  1MBY A; 
#chains in the Genus database with same CATH topology
 4LF7 L;  5BN5 A;  1AP0 A;  1HCZ A;  1Q8I A;  5HY6 A;  1GUS A;  4JI8 Q;  4LNQ A;  4GKJ L;  4ZCK A;  3H3V C;  2VQE L;  2OTJ A;  2L12 A;  2V1C C;  1SJH D;  1XPU A;  1H9K A;  2PMZ B;  1PHJ A;  4A3M B;  1F2Y A;  2V4D A;  1J5E Q;  4BBS H;  2X6G A;  4RHR A;  2EYM A;  5EAY A;  5C3W A;  1E3P A;  3D4W A;  4B9X A;  4EQN A;  1ESR A;  3NQI A;  1EQQ A;  5IIF A;  1VDZ A;  4JI0 L;  2VQE Q;  1LTS D;  2A69 C;  3R2I A;  5DEH A;  2R93 B;  4L6T B;  2NZ1 D;  2JA7 H;  1KD1 C;  3J81 c;  2F1M A;  1TII D;  3JAM i;  2EZV A;  1WD0 A;  2VQF L;  1OTC A;  2VUM H;  3IKJ A;  1C8C A;  2CFM A;  4JI5 L;  1ROD A;  1KNE A;  5JPN C;  2E2I H;  2DGY A;  4J15 A;  5E7N A;  5M5Y H;  3HS0 C;  1S3O A;  2PQA A;  1CSP A;  2H5X A;  2XN9 C;  1MKH A;  4OO1 G;  5DM7 3;  1LTR D;  2ZJP A;  2JEA I;  2GVA A;  1PZK D;  1VF7 A;  5KGU A;  4UHV A;  3HGB A;  1NSN S;  2QIL A;  2NN6 G;  1IYU A;  3R3O A;  4APV A;  3VA7 A;  1R9T B;  3FP9 A;  2Z9H A;  4BY1 B;  2GVB A;  4H0L C;  1I50 B;  2K4K A;  1WVL A;  2R61 A;  2XNA C;  3S1R H;  1RTO A;  4PMC A;  1KAW A;  1Y14 B;  4A93 B;  5EJW A;  1Q7Y C;  2DJF C;  4POG A;  1XTC D;  3K5M A;  1IBK L;  3NWT A;  2KCM A;  3S1M H;  3HOV G;  1LT6 D;  2JK8 A;  4EX5 A;  3OIP A;  2IJ0 A;  3L9A X;  5IP9 H;  1QUQ A;  4DF7 A;  4A3J B;  4BBS G;  1JE4 A;  4IUP A;  1G29 1;  4CKE A;  1K28 A;  1YNJ D;  4IUV A;  2E2J H;  3A7A B;  2B2U C;  1I4R A;  3OPO A;  3S2H B;  2R7F A;  2Q8T A;  2BCO A;  4JI1 L;  2E5L L;  2ZJR A;  2O4X A;  2NWG A;  4V19 0;  4LJZ C;  4LK1 C;  4Z9C B;  1KRS A;  3FDT A;  3JAM L;  5CV8 A;  1V8Q A;  2E74 C;  4OO1 I;  1Q12 A;  3D4D A;  2K01 A;  1SYC A;  4A3L H;  3H3V H;  3MC0 B;  2D2C C;  2Q8I B;  3K8A A;  1VQD A;  4HIM A;  1OXU A;  4GOP B;  1LT3 D;  3VYU A;  1GHJ A;  1ET6 A;  1B70 B;  3S16 H;  2IL8 A;  4IN3 A;  4U67 3;  2WAQ E;  1U9R A;  3J80 c;  3CKI B;  1QVF A;  3K0Y A;  1SE3 A;  5LL6 X;  4DV3 Q;  2VS1 A;  1WTW A;  3HOV B;  2K5W A;  3BVZ A;  3K7U C;  4KK7 A;  4TRD A;  4DV4 Q;  4FYD A;  1V1O A;  3AFQ A;  5KIX A;  4Y7N H;  2EDG A;  4CJ1 B;  3N6R A;  1T5X D;  2UUB L;  2ALY B;  4GOP C;  3ONA B;  4A3E G;  1K0R A;  3I4M G;  1HNW Q;  4OIK A;  2RA4 A;  3HOY G;  1GHK A;  5AFW A;  1SEB D;  2G9D A;  3S1N H;  5JJI A;  5M5X H;  5CGK A;  1I4H A;  2KED A;  5EGT A;  1ENC A;  3Q0A A;  4FF1 A;  1BXT A;  5I9P A;  4A3I B;  1Q82 C;  1SFO H;  2K28 A;  4PMW A;  1EY7 A;  1PH1 A;  1UE7 A;  1BVS A;  1JCK B;  4DAM A;  3A7L A;  1IXR A;  4JV5 L;  3OWE B;  3NP8 A;  4K8I A;  3MXN A;  3HOZ B;  1KAB A;  1HH2 P;  1PLF A;  2B2Y A;  5E1F A;  2L4N A;  4DV7 L;  5ELF A;  4JI0 Q;  2MJ8 A;  1N36 L;  2ENB A;  1CFM A;  1VQL A;  1JB7 A;  2ICE C;  4NB3 A;  4DR4 Q;  1GVP A;  1H9M A;  4A3D H;  2I07 B;  3GD7 A;  1PTO B;  4JI6 Q;  2BE5 C;  4YIJ A;  2F3V A;  3H94 A;  3UI2 A;  2VUM G;  1YHA A;  3M4P A;  3PUZ A;  4AQY L;  3F8T A;  1WJJ A;  2XWB B;  2PW7 A;  3I7F A;  2Q2U A;  2K14 A;  4KKU A;  4GNX C;  2KHS A;  2LMC B;  1KQS A;  3QB3 A;  4ALP A;  1LT5 D;  2KA7 A;  4FVM A;  5G3L D;  2A5H A;  3CME A;  1KAA A;  1PRT F;  4IPG A;  1O7I A;  1GUW A;  1CHQ D;  3PV0 A;  3E3X A;  2F03 A;  4C3J H;  2QW7 A;  1A3T A;  2UUA Q;  4KHZ A;  3QG1 A;  4AYB B;  4HTH A;  4C3I H;  2WV6 D;  3A54 A;  1EWC A;  3PO3 B;  1IBL L;  1Q1B A;  1EU4 A;  1TWH H;  4PV1 C;  4R8I A;  1EZ6 A;  2F3I A;  2O5J C;  1HPC A;  2B2U A;  2F0J A;  4RGN A;  1BO0 A;  4Y52 H;  1YBY A;  1CI3 M;  1K83 H;  2A73 B;  4R4O A;  4R4C A;  5CC4 A;  3J81 L;  2UXB Q;  1O80 A;  2VB2 X;  2N55 A;  3GTQ H;  3O13 A;  4C3H G;  1L0Y B;  3I4N G;  1MIU A;  4KKS A;  4X62 L;  1HNX Q;  2WFW A;  1FGU A;  2IT1 A;  1M90 C;  1MI2 A;  5IP7 H;  1BOS A;  3IFT A;  1MD2 D;  4DR2 Q;  2JSO A;  1TS4 A;  1WYD A;  2KEN A;  4JC0 A;  3FPP A;  5KND A;  4JYA L;  2DUD A;  1C7Y A;  2UXD Q;  4QY7 A;  2I46 A;  3NE5 B;  2F0F A;  3TS2 A;  3PIO 3;  4HJ5 A;  4A3K G;  4CJ2 C;  4OX9 Q;  4XT3 B;  1HR0 L;  1LV9 A;  4CBV A;  1C0A A;  1KXL A;  3PO3 G;  1P8L A;  1VF5 C;  1CK1 A;  4A3D B;  3PUX A;  1HR0 W;  1NJI C;  4DR2 L;  4A3D G;  1CKM A;  2YTY A;  5C4J B;  2F0G A;  4YCW A;  2NB0 A;  4DUY Q;  1ILP A;  4FDB A;  1I3Q H;  1W6J A;  3HZX A;  3CCS A;  3P7J A;  1F77 A;  5EKK A;  1RDP D;  4PZ8 A;  4K0K L;  4NXM Q;  3C3L A;  2BH2 A;  5FO7 B;  2F0H A;  2OWO A;  2CH4 W;  2N3S A;  3TP7 A;  3K5L A;  3NEN A;  1YNN C;  1DCZ A;  1HR0 Q;  1PH6 A;  2B2Y C;  1PA6 A;  1D5M C;  1K8M A;  2VB3 X;  3NUC A;  4FXK C;  2H4O A;  1EYC A;  2F0W A;  1SSO A;  3BVG A;  3RNU A;  1TR5 A;  1D1I A;  5CV7 A;  5M3F G;  3EN2 A;  1QZH A;  2ES2 A;  3ER0 A;  4ZRZ A;  3VR5 A;  1SMY D;  5I6Y A;  3A5Z B;  1BKB A;  1CKN B;  1KHI A;  3F2U A;  3FPU B;  1S5E D;  3S9W A;  2F0P A;  4K5W A;  1PH3 A;  1VQA A;  1XTD A;  4POF A;  3CCR A;  3BDC A;  1N36 Q;  1AZQ A;  1STH A;  4A3G H;  4NKL A;  2B29 A;  3I8Z A;  3I56 A;  1PH8 A;  3D6W A;  1BQQ T;  2RHS B;  2C9O A;  3M4O H;  1IBL Q;  2VZA A;  1GO3 E;  1M1K C;  3TN2 A;  2KQ3 A;  3OIQ A;  3NBI A;  5C3E B;  3CC7 A;  1I6H B;  2HHH L;  3S24 A;  1KDB A;  2HDL A;  2B2V A;  3DXJ C;  4A3F H;  3S17 B;  1BNZ A;  2F0K A;  1N34 L;  2M9V A;  1PVO A;  3A8I E;  2F0T A;  4KJO A;  4MNO A;  5L37 A;  1TS5 A;  3GTG B;  4B08 A;  4DR5 L;  3I4N B;  2JE6 I;  3LGJ A;  2WIN B;  3B6Y A;  4LFB Q;  4HSV A;  2A6H C;  4XYO A;  1YJ9 A;  3BJU A;  1MGS A;  2ICI A;  3Q23 A;  4LMQ D;  1SYD A;  4A4I A;  1Y1W H;  1VQE A;  4YCU A;  3KBG A;  4DV7 Q;  1K9M C;  2MNA A;  4BA2 I;  2EYL A;  3S1R B;  5M3M G;  4C3H H;  3M4O B;  5ISR A;  4BY1 H;  4ME3 A;  2LXJ A;  2OXP A;  2X69 A;  4JBM A;  3K7A H;  2WB1 E;  4A3F B;  2F3W A;  3P20 A;  1G2T A;  1PTO D;  2J7Z A;  5C3E H;  1I6H H;  1PZI D;  5FLX E;  4AIM A;  4GLA C;  2R3Z A;  5LHY 1;  1L0X B;  4CDE C;  1E2V A;  3KF6 B;  2ZXP A;  3I91 A;  4OXP A;  5M5Y B;  4LF5 Q;  3NBH A;  4A3G B;  2IHE A;  1CZG A;  1DXM A;  4IFD J;  2E2I B;  1A63 A;  5IYC G;  3CRL C;  5KNB A;  2E5L Q;  1VQH A;  1EWH A;  4L5Q A;  1EOV A;  1LAC A;  1RJT A;  2K5V A;  3WWV A;  3MAQ A;  4DR7 Q;  1A8V A;  2QF7 A;  1TWC H;  2HIV A;  1CKN A;  2B63 B;  1SDF A;  1ENF A;  1K0S A;  2B8G A;  2RDF A;  2PYK A;  4DKA C;  1JIC A;  3AB9 A;  2SNS A;  3MHB A;  3VDY A;  3TQY A;  3H15 A;  4NDX A;  1E2Z A;  2PQE A;  2UU9 L;  1ILQ A;  4KTA A;  3HKS A;  4QUF A;  2OCE A;  1JB3 A;  1HTL D;  4PQX A;  4DAY B;  3SHL A;  3S15 B;  1U4P A;  2N78 A;  2DNC A;  3M9B A;  1SMX A;  4N8F A;  1SMY C;  3PO2 H;  5D3D A;  4X66 Q;  1O7L A;  1UAP A;  4JCV E;  1H9R A;  5C4X G;  3HKZ E;  1EL0 A;  5D3I B;  5IP9 G;  1LT4 D;  1ENA A;  5ELC A;  3R93 A;  3D8G A;  4X65 Q;  3IL8 A;  3HOW B;  1I3Q B;  1S5F D;  4E6I A;  2A69 D;  2N88 A;  4QCL A;  5JPM C;  3RR5 A;  5G3L F;  1EY6 A;  5HUR A;  4DR3 Q;  3QOJ A;  4U68 A;  5LMU Q;  1S40 A;  1D1K A;  1XNQ Q;  2NVT B;  1KLU D;  4R9W A;  4A3E H;  1DYQ A;  3A8J E;  4ILW A;  1YEZ A;  3FKI H;  4QB4 A;  1IBK Q;  2B2V C;  4ZAI A;  1NCV A;  3L7Z C;  1UE1 A;  2XGT A;  5FO9 B;  1Y1W B;  5EKI A;  5EPK A;  1BDO A;  1TWF H;  3BVM A;  3D0F A;  1UEA B;  4XTC S;  4JW0 A;  3KFU A;  3R2T A;  5C44 B;  3GTG H;  3HFZ B;  1X9N A;  4HIK A;  1TWH B;  1MHW C;  4PZ7 A;  4RG1 A;  1PRT B;  4ABN A;  4XQN A;  1LYL A;  3Q22 A;  2AQ3 B;  1W2B A;  3KYH C;  3NEL A;  2HT1 A;  1G91 A;  1H95 A;  2I0Q A;  4OEL B;  2A8V A;  3MXP A;  4UPA A;  1J5E L;  3H91 A;  2K50 A;  4WJ3 M;  1A3V A;  4JG2 A;  1EQV A;  3E9I A;  4C3J B;  4A3F G;  5BR8 L;  4IUN A;  3T51 B;  2ZTC A;  3SR1 A;  1N9W A;  3S1Q H;  1TWA B;  5JEA H;  1G6P A;  5E4W C;  4C3I B;  1VS0 A;  4DR6 Q;  3OTO Q;  2A6E C;  1JJC B;  2ZXR A;  1OXS C;  4BY1 G;  4JI6 L;  1Y1V G;  1KIX A;  4O42 A;  3GTL H;  5FK9 C;  3RLF A;  1SYB A;  1LTT D;  5JVH 3;  5C3X A;  3ERS X;  4I7A A;  4R4Q A;  4EQP A;  1PH9 A;  4GZY C;  1E0B A;  3C2P A;  1CA6 A;  4JPB W;  2QDB A;  3LWE A;  5IT9 L;  4QIW E;  2AHO B;  4RFB A;  2A6E D;  2F52 A;  1PTO H;  2G9H D;  4HIO A;  1STN A;  1K8A C;  2RCF A;  2NVY H;  3GV3 A;  4DUZ L;  1FL0 A;  5C4Z A;  1F9R A;  3RLO A;  4KN7 C;  2LFN A;  1E1T A;  3Q24 A;  1UUP A;  2JA9 A;  3EQL C;  2BE5 D;  1I4G A;  2FMC A;  2B8F A;  2YU9 H;  4MTN A;  1DOL A;  4LF9 Q;  1KDC A;  3CCE A;  1YJN A;  2E2H B;  3K59 A;  4KY7 A;  2KHI A;  5K36 H;  1JC7 A;  3KJP A;  3RMH A;  1TS3 A;  4X62 Q;  3K80 C;  4ODG A;  1LUZ A;  2CVR A;  4V0B A;  2QCP X;  4DV3 L;  2FHT A;  1T5E A;  3HOV H;  3NPP A;  4C3J G;  3OMG A;  2IX0 A;  4FXD A;  3V05 A;  3CHB D;  1SRU A;  5LL6 S;  4A3B G;  4YWK A;  4JK1 C;  5A35 A;  4OX9 L;  2LY7 A;  4A76 A;  4KLK A;  1W3S A;  3RLN A;  2I5H A;  2F0O A;  4GN5 A;  4HMI A;  4J1M A;  2AMC B;  4RGT A;  1XPR A;  3CPW A;  2RQX A;  3E0J A;  5C4X H;  4KY5 A;  3BZC A;  1EYD A;  4MIU A;  1WOC A;  1SN8 A;  3M4Q A;  3S2H H;  4R8N A;  4IJH A;  1PYS B;  3PO3 H;  3HOU H;  4JBW A;  4OEM B;  2PMZ E;  4YWL A;  3U9O A;  3S1M B;  3BZK A;  1CA5 A;  1CQV A;  4K5V A;  4DK3 C;  5IOC A;  3SK6 A;  3PQI A;  5ELN A;  2KCC A;  2O5I C;  1A0I A;  2Y0S G;  1P16 A;  4LUZ A;  3I70 A;  5M3F H;  3KF8 B;  3MFY A;  5M9O A;  2KCT A;  2VW9 A;  1QIL A;  1O7Z A;  2XIW A;  3UDI A;  1HFG A;  3W2D A;  4OWW B;  4A3J H;  4DR6 L;  1WCM G;  3CW2 C;  3RZO B;  1JWS D;  4GLV B;  1K3B C;  5KYI A;  1CT1 D;  1I4Q A;  3MWY W;  1H9S B;  1VQN A;  3J7Y W;  1FNW A;  5IWA L;  2RDH A;  1GJX A;  4F7X A;  1IBM L;  5GAE C;  2MO1 A;  3DWP A;  1D7Q A;  2JA8 B;  1PFM A;  1RL2 A;  4IUT A;  1PTO C;  4QGU A;  1SRO A;  1SYG A;  2F0V A;  4B3R Q;  2E2D C;  4BWG B;  4A3I H;  2CCZ A;  1EOT A;  1LTL A;  2R93 H;  1L0W A;  2QGQ A;  2FMM A;  2IHF A;  1I6V C;  3H3V I;  4K2K A;  1MJC A;  3D3R A;  4OO1 H;  1A62 A;  2MP1 A;  3K5O A;  3GDE A;  4CJ0 B;  5M5X B;  4IFD H;  5AJ3 L;  1X3P A;  2IX3 A;  4EQ5 A;  1AE2 A;  5CBA E;  1G51 A;  1B3A A;  1LLR D;  1JWU D;  3A5U A;  5D65 A;  1S5B D;  4BBS B;  3CCL A;  1CM9 A;  4CDD C;  4F8M A;  5CBE E;  5JJZ A;  3BDO A;  2JA7 G;  2EY5 A;  1TWG H;  5M3M H;  2A6H D;  1NBW A;  3PMF A;  2B39 A;  3KLR A;  4GS3 A;  2F0D A;  4LF7 Q;  4DV0 Q;  1I94 Q;  2MUY A;  1IYJ B;  4LUO A;  2MHV A;  4N9P A;  5JJK A;  1F2Z A;  1PFB A;  3HG9 A;  4BBR H;  5IGF A;  5C3E G;  4A3M H;  1GD7 A;  2BA1 A;  1VQI A;  3IFD A;  1X3Q A;  1XNR Q;  1VQK A;  4LFA Q;  1V1Q A;  4B3T L;  3KOJ A;  2B2W A;  1A15 A;  1XMQ L;  2C5C A;  3DM3 A;  2J4X A;  2BDO A;  5IYD G;  3A55 A;  4G7Z C;  4AH6 A;  5FLM H;  1WTR A;  2O2L D;  5IOD A;  4FNF A;  1STA A;  1Q3L A;  1D8L A;  3MVV A;  4LF6 L;  2ATW A;  4IFD I;  4DR7 L;  4A3J G;  3HOY B;  5I6W A;  5M3M B;  1TWG B;  3GV6 A;  4L5T A;  1RIP A;  2QEX A;  1SXT A;  4OON A;  1MJE A;  1WTH A;  4PG3 A;  5H1S E;  2PZW A;  1G2S A;  3OHX C;  4BY7 B;  1LTA D;  1PDQ A;  1PYB A;  1BBU A;  4KHV A;  2RBM A;  1YNN D;  3F2D A;  1SE8 A;  3OYY A;  1VQ8 A;  4O2D A;  1EY9 A;  2DNE A;  4K2L A;  3M3Y H;  2Q2I A;  2L1B A;  1TY2 A;  2NVX B;  3F2C A;  1CSQ A;  1R4Q B;  1ZEQ X;  2BH8 A;  1EY5 A;  4JI4 L;  3T4A C;  2K05 A;  3JC6 6;  2HUG A;  4M1U B;  1PRT C;  3PIP 3;  3WOF A;  1Y8P B;  2D62 A;  1B4O A;  2CWA A;  2EJM A;  5T1G A;  4G7H C;  2JA8 H;  4H02 A;  2QDL A;  2VY3 A;  2SDF A;  1ET9 A;  2PCF B;  1D6E C;  2LXK A;  2EYF A;  4ZK9 B;  1DOK A;  1D5Z C;  3MA2 B;  1VCI A;  2NVY B;  1NE3 A;  5CR3 A;  4UAI A;  1BCP C;  3UDG A;  4HR7 B;  1KRT A;  3VR6 A;  3KDF B;  1HZA A;  5FJ8 G;  4N9T A;  5C0X J;  2C35 B;  5IGB A;  2AKW B;  4LW1 A;  3RZO H;  2JN4 A;  3DUZ A;  1X54 A;  3AFP A;  3J80 i;  2B2T A;  2MFI A;  4YCV A;  1SJE D;  3S2D H;  3DWQ A;  2WII B;  4A93 G;  1TXY A;  5GQO A;  4P75 A;  4P74 A;  4QUC A;  3VR4 A;  5IGC A;  5IYC H;  3AEV A;  5FKA C;  2IWH A;  3OW7 A;  3DHQ A;  2RF4 A;  3OWF A;  3I3C A;  4KHP L;  2F0U A;  5J1Z A;  4AYB E;  4ZKB B;  1D5X C;  4EVO A;  1XYI A;  4BXX G;  3U58 A;  3ERO A;  4C1N I;  2Z4H A;  3NK9 A;  3VR3 A;  5M3F B;  5IT9 E;  2Q2H A;  3VR2 A;  1QE6 A;  3D4R A;  5FLM G;  3BS1 A;  1RD9 D;  1F9P A;  5GAG C;  2L55 A;  4NP5 A;  5C4X B;  4I65 A;  1S5C D;  3I90 A;  4DK6 C;  4HMJ A;  4G57 A;  1EEI D;  3RZD H;  4KHP Q;  5KYL A;  1HZ9 A;  2JA5 B;  1DJR D;  2B2W C;  5KRU A;  2ID0 A;  2J0T D;  1NY4 A;  5C44 H;  3E6Z X;  3Q8D A;  1J8I A;  5JAV A;  1C4Q A;  3MFG A;  1UE6 A;  1EQT A;  1XXG A;  1LTG D;  3ULP A;  1XNQ L;  4H7B A;  2JA8 G;  4QMG A;  1Y69 U;  4XXE A;  4JI3 Q;  1V1P A;  5IT9 c;  5LMN L;  1ML0 D;  2CQO A;  1A3U A;  3CRK C;  4GLX A;  1JOQ A;  4C3I G;  4K0K Q;  3MXG A;  4TQU S;  4DV4 L;  1NUC A;  2FJ2 A;  3GTM H;  1EIF A;  1EIH A;  1SNQ A;  1UE5 A;  4PNY A;  4XQJ A;  1YIT A;  2UUB Q;  1X56 A;  1EFW A;  5DLQ E;  5J3B A;  2NBF A;  4ZYS A;  2XSC A;  4L8J A;  5IY0 A;  5HGT A;  4YHH Q;  1V43 A;  4KI0 A;  3GQB A;  1K3R A;  2PQA B;  3I55 A;  4DV6 Q;  4JI7 L;  4P71 A;  5CYU A;  3TME A;  2EVB A;  4DV1 L;  2SEB D;  5LMU L;  3G7L A;  3JAM c;  3BU2 A;  3ZYY X;  2D5D A;  3W1B A;  3FEW X;  3N52 A;  3EA6 A;  2DN8 A;  2YU9 B;  1BUV T;  5C6A A;  1RTN A;  3J81 E;  4IJL A;  1PYW D;  4GOP A;  2UXD L;  1JOO A;  5ELE A;  3Q6S A;  2MO0 A;  2UXC L;  3CC4 A;  4FXG C;  4A3C G;  3MEF A;  1IW7 C;  4C1N K;  2WKD A;  2K04 A;  5ELO A;  4X66 L;  1BBW A;  3MXU A;  2JA6 B;  2KHJ A;  1HA5 A;  2RCN A;  2FXQ A;  1C9O A;  1VQM A;  1Z9F A;  5K36 G;  4LF6 Q;  5CMD A;  2CW0 D;  4WJ4 A;  5DAU A;  2MGS A;  2UU9 Q;  2HIX A;  3CPF A;  2EE1 A;  3IRB A;  5AJ3 Q;  4AQY Q;  2K7V A;  3UDF A;  4FF2 A;  3P1H A;  2LKV A;  1TWA H;  1Q90 A;  3AMU A;  1R4P B;  1CZW A;  3GTL B;  2MPM A;  3EBE A;  2N49 A;  4RHS A;  4L63 B;  3X3M A;  3HOX H;  4LF4 Q;  3KJO A;  2OQK A;  1VQO A;  1F2M A;  4UP8 A;  1Q8K A;  4B3T Q;  2IY5 B;  2YV5 A;  1DOM A;  1QNK A;  4HAE A;  4HID A;  2SNM A;  4JI1 Q;  2UUA L;  4LF9 L;  3H0G H;  3KK7 A;  5CV4 A;  4DPG A;  1TS2 A;  1F2L A;  1Q81 C;  2KVM A;  3M3Y B;  4XT1 B;  1CHP D;  4O1N A;  2R7Z G;  1I94 L;  1YNJ C;  4C3H B;  5DNF A;  4X64 Q;  3L2P A;  4R1J A;  2PNH A;  2MQH A;  1X55 A;  4BY7 H;  2NVQ H;  1PRT D;  2HQL A;  3KLW A;  4RKB A;  1RCV D;  2F0M A;  4MN3 A;  1QJO A;  5EPL A;  3I2Z A;  1SNM A;  5KEE A;  1CTM A;  5EPJ A;  4OIJ A;  4FO2 A;  1HRJ A;  1FNV A;  1OXT A;  3CU7 A;  3PSI A;  1KL9 A;  2RKS A;  3NWS A;  1B44 D;  1EZ8 A;  1TWF B;  1K8G A;  1KTK A;  4A3B B;  4DNT B;  3T16 A;  3K0X A;  3RUZ A;  2ZT9 C;  2NUC A;  3I4M B;  1HQR D;  3H6M A;  3EJI A;  2A19 A;  4DK1 A;  4XYQ A;  1B8A A;  4A3K H;  2CH4 A;  2EYP A;  3E5S A;  1IBM Q;  1PFN A;  2K75 A;  5JEA G;  5I9O A;  5T1I A;  1SAP A;  3L3O C;  4GN4 B;  3PO2 B;  1N8R C;  4JI8 L;  3D6C A;  4BBR B;  2I5M X;  4YWM A;  1F9S A;  5EBC A;  3PIP A;  4X3T A;  4PZ6 A;  3K58 A;  4ZKC B;  4DV2 L;  1TT2 A;  1ICF B;  4B3M L;  3OOC A;  5C0X H;  2L11 A;  4MZ9 A;  1LTI D;  1T9H A;  2KEC A;  2JQO A;  2PNR C;  5IYB G;  2B63 H;  1PH2 A;  3TZD A;  2KEE A;  2Y0S B;  2YYZ A;  5A2Q E;  3S15 H;  1LO5 D;  4X6A H;  1OXV A;  3U4Z A;  1ESF A;  1QVG A;  4A3M G;  5IGD A;  1BR9 A;  3H0G G;  1VQP A;  5I2X A;  3T1Y L;  1TKW B;  1UWV A;  4IFD G;  1IYV A;  1BCP F;  4R4T A;  3QWN A;  1B3Q A;  4LFC L;  3EVQ A;  3KDF A;  3HKZ B;  1U4L A;  4GNX A;  2UXC Q;  1SE2 A;  2AQ2 B;  3LNN A;  1G6Z A;  2X6L A;  3K7A B;  1EYA A;  1DGS A;  4DV5 Q;  4KN4 C;  1XMO L;  4HED A;  1HA6 A;  3SE0 A;  3DMU A;  2EY6 A;  4J6H A;  2ZTE A;  5CV9 A;  4RAU C;  3T56 B;  1VQ6 A;  4K6D A;  2F4I A;  1YIJ A;  4RWS C;  4QQB X;  1NR2 A;  2D0O A;  4HCS A;  4JI5 Q;  5EBD A;  4HJ9 A;  4TKO B;  2JA6 G;  2XVS A;  3AQQ A;  4WRD A;  5I4D A;  4LFC Q;  3DEP A;  3GTJ B;  4LAA A;  1XX8 A;  1SNP A;  4IPH A;  3PCO B;  4DAP A;  2G5D A;  1Y1V B;  3PUW A;  2XTI A;  1DD2 A;  4DXG A;  4HJ7 A;  1QWY A;  2PPB C;  4ZUI A;  1QNU A;  3CP0 A;  3VYT A;  4BBR G;  1HNZ Q;  4IUQ A;  4HJA A;  1EY4 A;  1B53 A;  5JJL A;  3FKI G;  1XMQ Q;  1UNS A;  1X65 A;  5IGE A;  4CDC C;  2ZM6 Q;  3S17 H;  1YHQ A;  1SYF A;  4RCN A;  1RHP A;  5E4X A;  2NVQ B;  4DV5 L;  1SLJ A;  2HCC A;  3I4O A;  3HOX G;  4LFA L;  5LMN W;  2VXW A;  3OTO L;  2R7Z H;  4KJN A;  3M7G A;  2KBN A;  3TP6 A;  1Q86 C;  4RGO S;  3GTO B;  5F2D A;  4IUR A;  1K83 B;  1G8Z D;  3I4N H;  3J7A 5;  2F0Q A;  3E0E A;  1XNR L;  1X32 A;  5HGQ A;  1SNC A;  4DR5 Q;  4UY8 C;  1PMR A;  4P2C B;  4DAY A;  5IYB H;  1HFN A;  1S5D D;  2BA0 A;  3HOU G;  1U4R A;  3OW2 A;  1L1O B;  1B9N A;  3H0G B;  2EQS A;  3W5O A;  1Q46 A;  2Z1C A;  1JMC A;  2CW0 C;  4DU9 A;  3BZD B;  1STB A;  3BG3 A;  3T1H L;  1B1Z A;  4BY7 G;  3TSS A;  1GUG A;  4RH6 A;  1ONL A;  3TDQ A;  1HZC A;  1NNX A;  1TQO A;  1J9O A;  3F1Z A;  4P73 A;  2UXB L;  1NR4 A;  3CAM A;  2AWN A;  3I73 A;  1IW7 D;  3ERQ A;  2Q8R E;  3J7A V;  4GKJ Q;  2AWO A;  2WAQ G;  1VMC A;  1FJG Q;  4DR4 L;  3CCV A;  3NTI A;  2KOL A;  4ID6 A;  3T1H Q;  4JBJ A;  2OF1 A;  3TEH B;  3MZ5 A;  4GN3 B;  2JA6 H;  4MHE A;  1ZYR C;  3NQT A;  1JOK A;  2E2H H;  2OTL A;  3CCM A;  4OHJ A;  3ZJY C;  3BYT B;  3E9H A;  3VYS A;  1PV4 A;  1Y1W G;  4IPD A;  3STB C;  3TBI B;  2I5L X;  5ELD A;  1W6K A;  3ULL A;  4A3I G;  5A2Q L;  5JOB A;  5C4J H;  1SFO B;  2HD3 A;  4OWT B;  4FP5 D;  4H44 C;  2M2L A;  4CDF C;  2JXM B;  1A2U A;  2F0I A;  3C1E A;  4ULL A;  3W1G A;  4LUV A;  4DUY L;  4MTK A;  1VQJ A;  4EQO A;  4NXN L;  3PIO A;  1YNX A;  2NTS A;  3PF4 A;  3OMC A;  2YTV A;  4K5X A;  2EXD A;  1QCB D;  5J22 A;  4P72 A;  3J81 i;  1HQM C;  1WTO A;  2AUJ D;  1L1O C;  4JI4 Q;  2PW5 A;  3L0O A;  3NXW A;  5C5M A;  1M4V A;  4A3G G;  2K5H A;  3UE0 A;  3K5N A;  2TSS A;  1KLG D;  1SE4 A;  2UUC L;  4I7Z C;  1HNW L;  2YTX A;  1UEB A;  2DY7 A;  3ITP A;  4DGZ A;  2CHB D;  4JYA Q;  2R92 H;  3TP5 A;  1II3 A;  3ICE A;  4JI2 L;  2HQE A;  1MSG A;  3V2T A;  1XWE A;  1IKM A;  2PI2 E;  4R4I A;  4DN4 M;  2L5T A;  2HDM A;  3HEJ A;  3K6O A;  1IHZ A;  3URY A;  2Y0S E;  4G7O C;  5BN3 A;  4DV6 L;  4JI7 Q;  2R92 B;  1VQ7 A;  2OQ0 A;  3M4Y A;  3TS0 A;  3PUY A;  5K5P A;  3GTO H;  1Y8N B;  3DWA A;  2AQ1 B;  1LM0 A;  1JJ2 A;  4JI2 Q;  3HKZ G;  2R7Z B;  2EY2 A;  1GUT A;  2NYZ D;  1O78 A;  2R6G A;  2EYO A;  4C56 C;  4ZLT F;  1TY0 A;  2EY1 A;  1X6O A;  3A8K E;  3BDL A;  1WTP A;  2XWJ B;  3FKI B;  4KKT A;  1VQG A;  4DV0 L;  1Y8O B;  3RN5 A;  2DY8 A;  1M8A A;  4TVA B;  4L5R C;  3NTK A;  5I2Y A;  2EIF A;  3DEO A;  3S2D B;  5C44 G;  1QVC A;  5LMN Q;  1Y1V H;  1C48 A;  1HXY D;  1WFQ A;  4L5S A;  4UDU C;  4UP7 A;  1ICW A;  1EU3 A;  3RN2 A;  2KJX A;  5GAD C;  4LFB L;  4F88 A;  3W3A A;  5EKL A;  3ND9 A;  3HOW H;  2XRQ D;  4BS9 A;  4PMB A;  3HOZ H;  3K57 A;  3I72 A;  3G48 A;  1VQF A;  1B7Y B;  4NXN Q;  1AW7 A;  1IKL A;  2F0E A;  4RA8 A;  4DA2 A;  4YHH L;  5CV6 A;  2NTT A;  2Z6K C;  4ME5 A;  2CKZ B;  4WJW A;  1FVI A;  2QKI C;  4CKB A;  3CCJ A;  1JJG A;  4NMZ A;  5NUC A;  2AUK A;  3A0J A;  3TZU A;  3C46 A;  3KLS X;  5D14 A;  1VQ9 A;  2ZXO A;  4S3S A;  2Z0S A;  1WD1 A;  4J8Q A;  3QOL A;  2K5Q A;  4X3S A;  2JA7 B;  4XQQ A;  3U50 C;  3HP3 A;  3QIA A;  5FLX c;  3G71 A;  4X3U A;  2QEJ C;  5FO8 B;  1EFI D;  1Q1E A;  3VA5 A;  3PUV A;  1U4M A;  1JWM D;  1H9J A;  4N8X 1;  4KD4 A;  3CMA A;  2R92 G;  3SK4 A;  4JI3 L;  4RGM A;  1TWC B;  3EFX D;  3IAY A;  3DLL A;  4IOC A;  4YY3 Q;  3A56 A;  5J39 A;  3S1N B;  4JOI A;  4NW2 A;  2B2T C;  2VQF Q;  4A3L G;  1DON A;  5BR8 Q;  3CD6 A;  3TP8 A;  1FYC A;  1A2T A;  1GXD C;  2NZH A;  3U9S A;  4KD3 A;  2ZM6 L;  1YJW A;  1D2B A;  1CKO A;  2R93 G;  3X3N A;  1L2F A;  1SYE A;  2BDN A;  4RCO A;  1TU2 B;  4K6L A;  5COR A;  3NBH B;  2BOS A;  4HJ8 A;  3SGI A;  3FMC A;  1X3G A;  1Z6H A;  3NTH A;  1HNZ L;  1WTX A;  3BYY B;  4XIG S;  3PF5 A;  1E7Z A;  2ZJQ A;  4FF3 A;  4IO9 A;  4A3K B;  3TRE A;  1FNU A;  3DM1 A;  3I4M H;  1ZXT A;  1GUN A;  2RSN A;  5IYD H;  4JBK A;  3NEM A;  5BN4 A;  1U0L A;  1AN8 A;  4ZUJ A;  1BF4 A;  2K33 A;  2E2J B;  5E3F A;  1DZ1 A;  1S4Z A;  1JR0 D;  1HJP A;  3U4V A;  1H9S A;  2LSS A;  1I50 H;  3FHW A;  4DR3 L;  5FJ8 H;  4CGY B;  2HCI A;  3J80 L;  1IL2 A;  3CCU A;  3C1F A;  3GTK H;  3GTJ H;  2VL6 A;  3HOW G;  1SR3 A;  4G4K A;  1STE A;  1AE3 A;  3G6J B;  1NTG A;  4A93 H;  2JJQ A;  3F2B A;  3CC2 A;  1STG A;  4LF4 L;  1RF2 D;  3SXH A;  2A1A A;  3HOX B;  1EY8 A;  5C0X I;  2F0N A;  1HZB A;  2FIN B;  1R9T H;  1JOR A;  2FFK B;  3KBX A;  3ND8 A;  4GKK Q;  3S14 H;  3NSW A;  2RVL A;  4OL7 A;  1HUM A;  2WB1 B;  1GM5 A;  1IZ6 A;  2VUM B;  1EYG A;  4BXX H;  2PZT A;  1EY0 A;  1QZG A;  2F0L A;  1KNA A;  1AH9 A;  1VQC A;  2K1B A;  1ASZ A;  1KC8 C;  4A3C H;  2Z6K A;  1FD7 D;  3A74 A;  3SK8 A;  3WDN A;  4JVZ A;  4DR1 L;  1NMG A;  2R7D A;  4WFN 3;  4X65 L;  1VQB A;  2WKC A;  1F9Q A;  3CCQ A;  2F4V L;  1IL8 A;  4CKC A;  3SEB A;  2TMP A;  2L0C A;  4QF4 A;  3KF8 A;  3HOZ G;  1K73 C;  4B3M Q;  2LS0 1;  1QOH A;  2B63 G;  1HNX L;  1YI2 A;  4IPC A;  2EYJ A;  3KLS A;  5JVG 3;  3QR8 A;  3CF5 A;  1S72 A;  1E2W A;  2NN6 I;  2PO4 A;  1QG7 A;  2UUC Q;  4LF5 L;  3TRZ A;  3ULJ A;  4B9W A;  1FGB D;  5C4H A;  4HSP A;  1L1O A;  2E76 C;  1U5K A;  4O0A A;  1WCM H;  2E75 C;  1O7Y A;  1JQY D;  1B2T A;  3K81 C;  3QJY A;  1DM0 B;  3AU7 A;  1HHV A;  1Z7T A;  3GP7 A;  1WTQ A;  4IOA A;  4K8J A;  2OEO A;  5COY A;  1NAP A;  3CQZ B;  2JA5 G;  4UP9 A;  4OGQ C;  4DXF A;  3HOU B;  3QO2 A;  5IP7 G;  4DV2 Q;  2A68 D;  1NMF A;  3J81 j;  4JV5 Q;  4FF4 A;  4LF8 Q;  3J7Z C;  4IAL A;  4DNR B;  4YY3 L;  1QUQ B;  3RD4 A;  1X3F A;  1ZKO A;  2OT2 A;  4ZQ3 A;  4EGV A;  1N32 L;  2PZU A;  4KMU C;  3AYH B;  3V96 A;  2VNU D;  2DJG C;  5JEA J;  4A3B H;  2EXZ A;  1XPO A;  4IZ8 A;  1N33 L;  1E24 A;  2RHQ B;  3WOE A;  2K03 A;  3MXN B;  1PH7 A;  4AYB G;  2RDG A;  1MBY A;  1N34 Q;  4X3K A;  3SDZ A;  5EQ0 A;  3M85 A;  3PGZ A;  2SOB A;  2ASB A;  1LTB D;  1TVX A;  5M5W H;  1N32 Q;  3PO2 G;  1V1P B;  5CV5 A;  4BA1 I;  4A75 A;  1YZ6 A;  4DFA A;  1HUN A;  4IUU A;  1FJG L;  1ASY A;  3GO5 A;  2RSO A;  1BCP B;  3FRP B;  3GTQ B;  5FLX L;  1V9P A;  4B3R L;  2A74 C;  1WTV A;  1EIG A;  3M7N A;  4CHT B;  1K8O A;  2D9U A;  1YHB A;  2Z6B A;  1B9M A;  1SND A;  4QL5 A;  1YVC A;  4C2M B;  1Z47 A;  2IPK D;  4NPS A;  2CQA A;  4X64 L;  4KV6 A;  1RKN A;  1VQ4 A;  3CXC A;  3UDX A;  1CQF A;  4KY6 A;  4M8A A;  5FOB B;  3LX0 A;  4HCE A;  3J80 E;  3STB D;  1WI5 A;  4Q0F A;  3R8B A;  1EUJ A;  5C0X G;  1E22 A;  1I4P A;  2EJF C;  1WCM B;  2K5D A;  2EOT A;  5GRO A;  2HHH Q;  4LF8 L;  1AZP A;  1X3E A;  2L15 A;  4HN7 A;  2B3G A;  2K52 A;  2KCN A;  1XJV A;  3GTP H;  2E8G A;  2Z4I A;  3H09 A;  3KUP A;  1PFS A;  1STY A;  3LWU A;  4DR1 Q;  1SNO A;  2IW3 A;  5ELB A;  1GKH A;  3GTP B;  1OXX K;  1QB5 D;  1OO9 B;  3MTS A;  2WAC A;  1SBB B;  2NZO A;  1VMP A;  2NN6 H;  5IGG A;  2WAQ B;  2GA4 B;  4WOR A;  1E1O A;  4DV1 Q;  2H1E A;  5C5L A;  3KF6 A;  2KUM A;  1AEX A;  5KNC A;  2IX1 A;  1JT8 A;  2EJG C;  4QIW B;  2EYH A;  4B3S L;  3JAM E;  2P5Z X;  2WB1 G;  2K5N A;  4Q5V A;  1PZJ D;  2Q2T A;  2K32 A;  2PI2 A;  1PH5 A;  1EWI A;  1I5F A;  2L9H A;  4IQZ A;  2F4V Q;  3I4L A;  5IE8 A;  3T13 A;  3S14 B;  2GN5 A;  3S1Q B;  4DNI A;  2K6A A;  2NVX H;  3G6E A;  4C2M H;  1FR3 A;  3MEH A;  1GOZ A;  1EQR A;  2F0S A;  4JOI C;  4F87 A;  2XRS D;  3HRZ C;  1A6X A;  4NXM L;  3SVM A;  4H13 C;  1B50 A;  2QA4 A;  1BCP D;  1XMO Q;  5GAH C;  4QJF A;  1GUO A;  3GTM B;  3GTK B;  1EIY B;  2ZTD A;  1HTP A;  1ZYR D;  4DUZ Q;  2CWP A;  4TSS A;  4K14 A;  3G4S A;  4B3S Q;  3D31 A;  4Y7N B;  1EEF D;  1I4X A;  4RMF A;  1CUK A;  4GKK L;  4LWC A;  2M00 A;  2JEB I;  1LAB A;  3P75 A;  5TSS A;  3T1Y Q;  2JP1 A;  2A68 C;  2N8N A;  3OSO A;  1BBX C;  1PTO F;  3UE1 A;  3T53 B;  3VYR A;  2WP8 J;  1PH4 A;  1PXU A;  5M5W B;  3S16 B;  3HOY H;  4A3E B;  3NHH A;  1J6Q A;  2EPB A;  4XDX A;  4DAV A;  2NVT H;  2JA5 H;  3RZD B;  1VQ5 A;  1N33 Q;  3EIV A;  3SK5 A;  3CQZ H;  3J7A F;  4DK0 A;  1JE5 A;  1MSH A;  5IWA Q;  5DM6 3;  2JYO A;  2D0P A;  4GNX B;  4OWX B;  1KDA A;  4RKL A;  1AFP A;  2Z8L A;  3FVQ A; 
#chains in the Genus database with same CATH homology
 5BN5 A;  1AP0 A;  1HCZ A;  1Q8I A;  1GUS A;  3H3V C;  2L12 A;  1SJH D;  1H9K A;  2PMZ B;  4A3M B;  1F2Y A;  2V4D A;  2X6G A;  4RHR A;  2EYM A;  5C3W A;  3D4W A;  4B9X A;  4EQN A;  1ESR A;  3NQI A;  5IIF A;  1VDZ A;  1LTS D;  2A69 C;  3R2I A;  5DEH A;  2R93 B;  4L6T B;  2NZ1 D;  2F1M A;  1TII D;  2EZV A;  1WD0 A;  3IKJ A;  1C8C A;  1ROD A;  1KNE A;  5JPN C;  3HS0 C;  4OO1 G;  2XN9 C;  5DM7 3;  1LTR D;  2JEA I;  1PZK D;  1VF7 A;  5KGU A;  3HGB A;  1NSN S;  2QIL A;  2NN6 G;  1IYU A;  3R3O A;  3VA7 A;  1R9T B;  4BY1 B;  4H0L C;  1I50 B;  1WVL A;  2R61 A;  2XNA C;  1RTO A;  4PMC A;  4A93 B;  5EJW A;  1XTC D;  3K5M A;  3NWT A;  1LT6 D;  3OIP A;  2IJ0 A;  3L9A X;  4DF7 A;  4A3J B;  1JE4 A;  4IUP A;  1G29 1;  4CKE A;  1YNJ D;  4IUV A;  3A7A B;  2B2U C;  1I4R A;  3OPO A;  3S2H B;  2Q8T A;  2BCO A;  2O4X A;  2NWG A;  4V19 0;  4LJZ C;  4LK1 C;  4Z9C B;  3FDT A;  3JAM L;  5CV8 A;  1V8Q A;  2E74 C;  4OO1 I;  1Q12 A;  3D4D A;  2K01 A;  1SYC A;  3MC0 B;  2D2C C;  2Q8I B;  1OXU A;  1LT3 D;  3VYU A;  1GHJ A;  1ET6 A;  2IL8 A;  4IN3 A;  4U67 3;  1U9R A;  3CKI B;  3K0Y A;  1SE3 A;  5LL6 X;  1WTW A;  3HOV B;  2K5W A;  3BVZ A;  4KK7 A;  4TRD A;  4FYD A;  1V1O A;  5KIX A;  2EDG A;  4CJ1 B;  3N6R A;  1T5X D;  3ONA B;  4OIK A;  2RA4 A;  1GHK A;  5AFW A;  1SEB D;  2G9D A;  5CGK A;  1I4H A;  2KED A;  5EGT A;  1ENC A;  3Q0A A;  4FF1 A;  1BXT A;  5I9P A;  4A3I B;  2K28 A;  4PMW A;  1EY7 A;  1JCK B;  3A7L A;  3OWE B;  3NP8 A;  4K8I A;  3MXN A;  3HOZ B;  1KAB A;  1PLF A;  2B2Y A;  5E1F A;  2L4N A;  5ELF A;  2MJ8 A;  2ENB A;  1CFM A;  2ICE C;  1H9M A;  2I07 B;  3GD7 A;  1PTO B;  4YIJ A;  2BE5 C;  2F3V A;  3H94 A;  3UI2 A;  3PUZ A;  2XWB B;  2PW7 A;  4KKU A;  2KHS A;  2LMC B;  3QB3 A;  1LT5 D;  2KA7 A;  4FVM A;  5G3L D;  2A5H A;  1KAA A;  1PRT F;  1GUW A;  1CHQ D;  3PV0 A;  2F03 A;  1A3T A;  4KHZ A;  3QG1 A;  4AYB B;  4HTH A;  2WV6 D;  3A54 A;  1EWC A;  3PO3 B;  1Q1B A;  1EU4 A;  4PV1 C;  4R8I A;  1EZ6 A;  2O5J C;  1HPC A;  2B2U A;  2F0J A;  4RGN A;  1BO0 A;  1CI3 M;  2A73 B;  5CC4 A;  3J81 L;  1O80 A;  2VB2 X;  2N55 A;  3O13 A;  4C3H G;  1L0Y B;  4KKS A;  2IT1 A;  1MI2 A;  1BOS A;  3IFT A;  1MD2 D;  2JSO A;  1TS4 A;  5KND A;  3FPP A;  2I46 A;  3NE5 B;  2F0F A;  3PIO 3;  4CJ2 C;  4XT3 B;  1LV9 A;  4CBV A;  1VF5 C;  1CK1 A;  4A3D B;  3PUX A;  5C4J B;  2F0G A;  2NB0 A;  1ILP A;  1W6J A;  3HZX A;  3P7J A;  1F77 A;  5EKK A;  1RDP D;  3C3L A;  5FO7 B;  2F0H A;  3TP7 A;  3K5L A;  1YNN C;  1DCZ A;  2B2Y C;  1D5M C;  1K8M A;  2VB3 X;  3NUC A;  4FXK C;  2H4O A;  1EYC A;  2F0W A;  1SSO A;  3BVG A;  1TR5 A;  1D1I A;  5CV7 A;  4ZRZ A;  3VR5 A;  1SMY D;  5I6Y A;  3F2U A;  3FPU B;  1S5E D;  3S9W A;  2F0P A;  4K5W A;  3BDC A;  1AZQ A;  1STH A;  4NKL A;  3I8Z A;  3D6W A;  1BQQ T;  2C9O A;  3TN2 A;  2KQ3 A;  3OIQ A;  3NBI A;  5C3E B;  1I6H B;  1KDB A;  2HDL A;  2B2V A;  3DXJ C;  3S17 B;  1BNZ A;  2F0K A;  2M9V A;  3A8I E;  2F0T A;  4KJO A;  1TS5 A;  3GTG B;  4B08 A;  3I4N B;  2JE6 I;  2WIN B;  4HSV A;  2A6H C;  4XYO A;  1MGS A;  2ICI A;  3Q23 A;  4LMQ D;  1SYD A;  3KBG A;  4BA2 I;  2EYL A;  3S1R B;  3M4O B;  5ISR A;  2OXP A;  2X69 A;  4A3F B;  2F3W A;  3P20 A;  1G2T A;  1PTO D;  2J7Z A;  1PZI D;  5FLX E;  2R3Z A;  5LHY 1;  1L0X B;  1E2V A;  2ZXP A;  3I91 A;  5M5Y B;  3NBH A;  4A3G B;  1CZG A;  1DXM A;  4IFD J;  2E2I B;  3CRL C;  5KNB A;  1EWH A;  3MAQ A;  1LAC A;  1RJT A;  2QF7 A;  2B63 B;  1SDF A;  1ENF A;  2B8G A;  2RDF A;  2PYK A;  1JIC A;  3AB9 A;  2SNS A;  3MHB A;  4NDX A;  1E2Z A;  2PQE A;  1ILQ A;  4KTA A;  4QUF A;  1JB3 A;  1HTL D;  4PQX A;  3SHL A;  3S15 B;  1U4P A;  2DNC A;  1SMY C;  5D3D A;  1O7L A;  1UAP A;  1H9R A;  1EL0 A;  5D3I B;  1LT4 D;  1ENA A;  5ELC A;  3R93 A;  3D8G A;  3HOW B;  3IL8 A;  1I3Q B;  1S5F D;  4E6I A;  2A69 D;  2N88 A;  4QCL A;  5JPM C;  5G3L F;  1EY6 A;  5HUR A;  3QOJ A;  4U68 A;  1D1K A;  2NVT B;  1KLU D;  4R9W A;  1DYQ A;  3A8J E;  4ILW A;  4QB4 A;  2B2V C;  4ZAI A;  1NCV A;  3L7Z C;  5FO9 B;  1Y1W B;  5EKI A;  5EPK A;  1BDO A;  3BVM A;  1UEA B;  4XTC S;  3R2T A;  5C44 B;  1TWH B;  4ABN A;  4XQN A;  1PRT B;  3Q22 A;  2AQ3 B;  1G91 A;  3MXP A;  3H91 A;  1A3V A;  1EQV A;  4C3J B;  4IUN A;  3T51 B;  3SR1 A;  1TWA B;  5JEA H;  5E4W C;  4C3I B;  2A6E C;  2ZXR A;  1OXS C;  4O42 A;  5FK9 C;  3RLF A;  1SYB A;  1LTT D;  5JVH 3;  5C3X A;  4EQP A;  4GZY C;  1E0B A;  3C2P A;  1CA6 A;  2QDB A;  3LWE A;  5IT9 L;  4RFB A;  2A6E D;  1PTO H;  2G9H D;  1STN A;  3GV3 A;  5C4Z A;  1F9R A;  4KN7 C;  2LFN A;  3Q24 A;  1UUP A;  3EQL C;  2BE5 D;  1I4G A;  2FMC A;  2B8F A;  1DOL A;  1KDC A;  2E2H B;  3K59 A;  4KY7 A;  5K36 H;  1JC7 A;  3RMH A;  1TS3 A;  4ODG A;  2CVR A;  4V0B A;  2QCP X;  2FHT A;  1T5E A;  3NPP A;  4C3J G;  3OMG A;  2IX0 A;  4FXD A;  3V05 A;  3CHB D;  5LL6 S;  4JK1 C;  5A35 A;  2LY7 A;  2F0O A;  4HMI A;  4J1M A;  4RGT A;  2RQX A;  3E0J A;  4KY5 A;  1EYD A;  4MIU A;  4R8N A;  4JBW A;  3U9O A;  3S1M B;  1CA5 A;  1CQV A;  4K5V A;  5IOC A;  3SK6 A;  2KCC A;  2O5I C;  3I70 A;  3MFY A;  5M9O A;  1QIL A;  1O7Z A;  2XIW A;  1HFG A;  3W2D A;  3RZO B;  1JWS D;  5KYI A;  1CT1 D;  1I4Q A;  3MWY W;  1H9S B;  3J7Y W;  1FNW A;  2RDH A;  1GJX A;  4F7X A;  3DWP A;  2JA8 B;  1PFM A;  4IUT A;  1PTO C;  1SYG A;  2F0V A;  2E2D C;  4BWG B;  1EOT A;  2FMM A;  1I6V C;  4K2K A;  3D3R A;  4OO1 H;  2MP1 A;  3K5O A;  4CJ0 B;  5M5X B;  4IFD H;  1X3P A;  2IX3 A;  5CBA E;  1LLR D;  1B3A A;  1JWU D;  5D65 A;  1S5B D;  4BBS B;  1CM9 A;  4F8M A;  5CBE E;  5JJZ A;  3BDO A;  2EY5 A;  2A6H D;  3PMF A;  2B39 A;  3KLR A;  2F0D A;  2MUY A;  4N9P A;  2MHV A;  1F2Z A;  1PFB A;  3HG9 A;  5IGF A;  2BA1 A;  3IFD A;  1X3Q A;  2B2W A;  1A15 A;  2C5C A;  2J4X A;  2BDO A;  3A55 A;  4G7Z C;  1WTR A;  2O2L D;  5IOD A;  4FNF A;  1STA A;  1Q3L A;  3MVV A;  4IFD I;  3HOY B;  5I6W A;  5M3M B;  1TWG B;  3GV6 A;  1SXT A;  2PZW A;  1G2S A;  3OHX C;  4BY7 B;  1LTA D;  1PDQ A;  4KHV A;  2RBM A;  1YNN D;  1EY9 A;  2DNE A;  4K2L A;  2L1B A;  1TY2 A;  2NVX B;  1R4Q B;  1ZEQ X;  1EY5 A;  3T4A C;  2K05 A;  2HUG A;  4M1U B;  1PRT C;  3PIP 3;  3WOF A;  1Y8P B;  2D62 A;  1B4O A;  2EJM A;  5T1G A;  4G7H C;  2SDF A;  1ET9 A;  2PCF B;  1D6E C;  2EYF A;  4ZK9 B;  1DOK A;  1D5Z C;  3MA2 B;  1VCI A;  2NVY B;  5CR3 A;  4UAI A;  1BCP C;  4HR7 B;  3VR6 A;  4N9T A;  5C0X J;  5IGB A;  3DUZ A;  2B2T A;  1SJE D;  3DWQ A;  2WII B;  5IGC A;  4QUC A;  3VR4 A;  5FKA C;  2IWH A;  3OW7 A;  3DHQ A;  3OWF A;  3I3C A;  2F0U A;  5J1Z A;  4ZKB B;  1D5X C;  4EVO A;  1XYI A;  3ERO A;  4C1N I;  2Z4H A;  3NK9 A;  3VR3 A;  5M3F B;  5IT9 E;  3VR2 A;  1QE6 A;  3D4R A;  3BS1 A;  1RD9 D;  1F9P A;  2L55 A;  4NP5 A;  5C4X B;  4I65 A;  1S5C D;  3I90 A;  4HMJ A;  4G57 A;  1EEI D;  5KYL A;  2JA5 B;  1DJR D;  2B2W C;  5KRU A;  2ID0 A;  2J0T D;  3E6Z X;  1J8I A;  5JAV A;  1C4Q A;  3MFG A;  1EQT A;  1XXG A;  1LTG D;  4H7B A;  4QMG A;  1Y69 U;  4XXE A;  1V1P A;  1ML0 D;  1A3U A;  3CRK C;  1JOQ A;  4C3I G;  3MXG A;  4TQU S;  1NUC A;  2FJ2 A;  1EIH A;  1SNQ A;  4XQJ A;  4PNY A;  2NBF A;  4ZYS A;  2XSC A;  4L8J A;  5HGT A;  1V43 A;  4KI0 A;  3GQB A;  5CYU A;  3TME A;  2EVB A;  2SEB D;  3G7L A;  3ZYY X;  2D5D A;  3FEW X;  3N52 A;  3EA6 A;  2DN8 A;  2YU9 B;  1BUV T;  5C6A A;  1RTN A;  3J81 E;  1PYW D;  1JOO A;  5ELE A;  3Q6S A;  4FXG C;  1IW7 C;  4C1N K;  2WKD A;  2K04 A;  3MXU A;  2JA6 B;  1HA5 A;  5K36 G;  5CMD A;  2CW0 D;  5DAU A;  2MGS A;  2EE1 A;  4FF2 A;  2K7V A;  3P1H A;  2LKV A;  1Q90 A;  3AMU A;  1R4P B;  1CZW A;  3GTL B;  2MPM A;  4RHS A;  3X3M A;  4L63 B;  1F2M A;  1DOM A;  1QNK A;  4HAE A;  2SNM A;  3KK7 A;  5CV4 A;  1TS2 A;  1F2L A;  2KVM A;  3M3Y B;  4XT1 B;  1CHP D;  4O1N A;  1YNJ C;  4C3H B;  5DNF A;  1PRT D;  4RKB A;  1RCV D;  2F0M A;  4MN3 A;  1QJO A;  5EPL A;  1SNM A;  5KEE A;  1CTM A;  5EPJ A;  4FO2 A;  4OIJ A;  1HRJ A;  1FNV A;  1OXT A;  3CU7 A;  2RKS A;  3NWS A;  1B44 D;  1EZ8 A;  1TWF B;  1KTK A;  4A3B B;  4DNT B;  3T16 A;  3RUZ A;  2ZT9 C;  2NUC A;  3I4M B;  1HQR D;  3H6M A;  3EJI A;  4DK1 A;  4XYQ A;  2EYP A;  3E5S A;  1PFN A;  5JEA G;  5I9O A;  5T1I A;  1SAP A;  3L3O C;  3PO2 B;  3D6C A;  4BBR B;  1F9S A;  5EBC A;  4X3T A;  3K58 A;  4ZKC B;  1TT2 A;  3OOC A;  5C0X H;  2L11 A;  1LTI D;  2KEC A;  2PNR C;  3TZD A;  2KEE A;  2Y0S B;  2YYZ A;  5A2Q E;  1LO5 D;  1OXV A;  1ESF A;  5IGD A;  1BR9 A;  5I2X A;  1TKW B;  4IFD G;  1IYV A;  1BCP F;  3QWN A;  3EVQ A;  3HKZ B;  1U4L A;  1SE2 A;  2AQ2 B;  3LNN A;  1G6Z A;  2X6L A;  3K7A B;  1EYA A;  4KN4 C;  4HED A;  1HA6 A;  3SE0 A;  3DMU A;  2EY6 A;  4J6H A;  5CV9 A;  4RAU C;  3T56 B;  4K6D A;  2F4I A;  4RWS C;  1NR2 A;  4HCS A;  5EBD A;  4TKO B;  2XVS A;  4WRD A;  5I4D A;  3DEP A;  3GTJ B;  4LAA A;  1XX8 A;  1SNP A;  4DAP A;  1Y1V B;  3PUW A;  1DD2 A;  2PPB C;  4DXG A;  1QWY A;  4ZUI A;  1QNU A;  3VYT A;  4IUQ A;  1EY4 A;  1B53 A;  1UNS A;  5IGE A;  1SYF A;  4RCN A;  1RHP A;  5E4X A;  2NVQ B;  2HCC A;  2VXW A;  4KJN A;  3M7G A;  3TP6 A;  4RGO S;  3GTO B;  5F2D A;  4IUR A;  1K83 B;  1G8Z D;  2F0Q A;  1X32 A;  1SNC A;  1HFN A;  1PMR A;  4P2C B;  4DAY A;  1S5D D;  2BA0 A;  1U4R A;  1B9N A;  3H0G B;  2Z1C A;  2CW0 C;  4DU9 A;  3BZD B;  1STB A;  3BG3 A;  1B1Z A;  3TSS A;  1GUG A;  4RH6 A;  1ONL A;  3TDQ A;  1TQO A;  1J9O A;  1NR4 A;  2AWN A;  3I73 A;  1IW7 D;  3ERQ A;  2Q8R E;  3J7A V;  2AWO A;  1VMC A;  3NTI A;  2KOL A;  4ID6 A;  2OF1 A;  3MZ5 A;  4MHE A;  1ZYR C;  3NQT A;  1JOK A;  4OHJ A;  3BYT B;  3VYS A;  3TBI B;  5ELD A;  1W6K A;  5A2Q L;  5JOB A;  1SFO B;  4FP5 D;  4H44 C;  2M2L A;  2JXM B;  1A2U A;  2F0I A;  3C1E A;  4ULL A;  4EQO A;  2NTS A;  3OMC A;  4K5X A;  1QCB D;  5J22 A;  1HQM C;  1WTO A;  2AUJ D;  2PW5 A;  3NXW A;  5C5M A;  1M4V A;  3K5N A;  2TSS A;  1KLG D;  1SE4 A;  4I7Z C;  2DY7 A;  3ITP A;  4DGZ A;  2CHB D;  3TP5 A;  1II3 A;  2HQE A;  1MSG A;  3V2T A;  1XWE A;  1IKM A;  4DN4 M;  2L5T A;  2HDM A;  3HEJ A;  3K6O A;  1IHZ A;  3URY A;  4G7O C;  5BN3 A;  2R92 B;  3M4Y A;  3PUY A;  5K5P A;  1Y8N B;  3DWA A;  2AQ1 B;  2R7Z B;  2EY2 A;  1GUT A;  2NYZ D;  1O78 A;  2R6G A;  2EYO A;  4C56 C;  4ZLT F;  1TY0 A;  2EY1 A;  3A8K E;  3BDL A;  1WTP A;  2XWJ B;  3FKI B;  4KKT A;  1Y8O B;  2DY8 A;  1M8A A;  3NTK A;  5I2Y A;  3DEO A;  3S2D B;  1C48 A;  1HXY D;  4UDU C;  1ICW A;  1EU3 A;  2KJX A;  4F88 A;  3W3A A;  5EKL A;  3ND9 A;  2XRQ D;  4BS9 A;  4PMB A;  3K57 A;  3I72 A;  1AW7 A;  1IKL A;  2F0E A;  4RA8 A;  4DA2 A;  5CV6 A;  2NTT A;  4ME5 A;  4WJW A;  2QKI C;  4CKB A;  4NMZ A;  5NUC A;  2AUK A;  3TZU A;  3C46 A;  3KLS X;  5D14 A;  2ZXO A;  4S3S A;  1WD1 A;  4J8Q A;  3QOL A;  2K5Q A;  4X3S A;  2JA7 B;  4XQQ A;  3HP3 A;  3QIA A;  4X3U A;  2QEJ C;  5FO8 B;  1EFI D;  1Q1E A;  3VA5 A;  3PUV A;  1U4M A;  1JWM D;  1H9J A;  4KD4 A;  3SK4 A;  4RGM A;  1TWC B;  3EFX D;  3IAY A;  3A56 A;  5J39 A;  3S1N B;  4NW2 A;  2B2T C;  1DON A;  3TP8 A;  1FYC A;  1A2T A;  1GXD C;  3U9S A;  4KD3 A;  1D2B A;  3X3N A;  1SYE A;  2BDN A;  4RCO A;  1TU2 B;  4K6L A;  5COR A;  2BOS A;  3FMC A;  1Z6H A;  3NTH A;  1WTX A;  3BYY B;  4XIG S;  4FF3 A;  4A3K B;  1FNU A;  3DM1 A;  1ZXT A;  1GUN A;  2RSN A;  5BN4 A;  1AN8 A;  4ZUJ A;  1BF4 A;  2K33 A;  2E2J B;  5E3F A;  1DZ1 A;  1S4Z A;  1JR0 D;  1H9S A;  4CGY B;  2HCI A;  3J80 L;  3C1F A;  4G4K A;  1STE A;  3G6J B;  1STG A;  1RF2 D;  3SXH A;  3HOX B;  1EY8 A;  5C0X I;  2F0N A;  2FIN B;  1JOR A;  2FFK B;  3KBX A;  3ND8 A;  3NSW A;  2RVL A;  4OL7 A;  1HUM A;  2WB1 B;  2VUM B;  2PZT A;  1EY0 A;  2F0L A;  1KNA A;  2K1B A;  1FD7 D;  3SK8 A;  3WDN A;  4WFN 3;  2WKC A;  1F9Q A;  1IL8 A;  4CKC A;  3SEB A;  2TMP A;  2L0C A;  4QF4 A;  3KF8 A;  2LS0 1;  1QOH A;  2EYJ A;  3KLS A;  5JVG 3;  1E2W A;  2NN6 I;  2PO4 A;  1QG7 A;  4B9W A;  1FGB D;  5C4H A;  4HSP A;  2E76 C;  2E75 C;  1O7Y A;  1JQY D;  1B2T A;  1DM0 B;  3QJY A;  3AU7 A;  1HHV A;  1Z7T A;  3GP7 A;  1WTQ A;  4K8J A;  2OEO A;  5COY A;  1NAP A;  3CQZ B;  4OGQ C;  4DXF A;  3HOU B;  3QO2 A;  2A68 D;  4FF4 A;  4IAL A;  4DNR B;  3RD4 A;  4EGV A;  1ZKO A;  2OT2 A;  4ZQ3 A;  2PZU A;  4KMU C;  3V96 A;  2VNU D;  5JEA J;  2EXZ A;  4IZ8 A;  3WOE A;  2K03 A;  2RDG A;  1MBY A;  4X3K A;  3SDZ A;  5EQ0 A;  3M85 A;  2SOB A;  1LTB D;  1TVX A;  1V1P B;  5CV5 A;  4BA1 I;  4DFA A;  1HUN A;  4IUU A;  3GO5 A;  2RSO A;  1BCP B;  3FRP B;  3GTQ B;  5FLX L;  2A74 C;  1WTV A;  1EIG A;  3M7N A;  4CHT B;  1K8O A;  2D9U A;  1B9M A;  1SND A;  4C2M B;  1Z47 A;  2IPK D;  2CQA A;  4KV6 A;  1RKN A;  1CQF A;  4KY6 A;  4M8A A;  5FOB B;  3LX0 A;  4HCE A;  3J80 E;  4Q0F A;  3R8B A;  5C0X G;  1I4P A;  2EJF C;  1WCM B;  2K5D A;  2EOT A;  1AZP A;  4HN7 A;  2KCN A;  2Z4I A;  3H09 A;  3KUP A;  1STY A;  3LWU A;  1SNO A;  2IW3 A;  5ELB A;  3GTP B;  1OXX K;  1QB5 D;  1OO9 B;  3MTS A;  1SBB B;  2WAC A;  1VMP A;  2NN6 H;  5IGG A;  2WAQ B;  2GA4 B;  4WOR A;  2H1E A;  5C5L A;  5KNC A;  2KUM A;  1AEX A;  2IX1 A;  2EJG C;  4QIW B;  2EYH A;  3JAM E;  4Q5V A;  1PZJ D;  2K32 A;  2L9H A;  4IQZ A;  3I4L A;  3T13 A;  3S14 B;  3S1Q B;  2K6A A;  1FR3 A;  3MEH A;  1GOZ A;  2F0S A;  4F87 A;  2XRS D;  3HRZ C;  1A6X A;  3SVM A;  4H13 C;  1B50 A;  1BCP D;  1GUO A;  3GTM B;  3GTK B;  1HTP A;  1ZYR D;  4TSS A;  4K14 A;  3D31 A;  4Y7N B;  1EEF D;  1I4X A;  2M00 A;  2JEB I;  1LAB A;  3P75 A;  5TSS A;  2JP1 A;  2A68 C;  3OSO A;  1BBX C;  1PTO F;  3T53 B;  3VYR A;  2WP8 J;  1PXU A;  5M5W B;  3S16 B;  4A3E B;  3NHH A;  2EPB A;  4XDX A;  4DAV A;  3RZD B;  3SK5 A;  3J7A F;  4DK0 A;  1MSH A;  5DM6 3;  2JYO A;  1KDA A;  4RKL A;  1AFP A;  2Z8L A;  3FVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...