1MBYA

Murine sak polo domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
75
structure length
75
Chain Sequence
SVFVKNVGWATQLTSGAVWVQFNDGSQLVMQAGVSSISYTSPDGQTTRYGENEKLPEYIKQKLQLLSSILLMFSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Sak polo-box comprises a structural domain sufficient for mitotic subcellular localization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords serine/threonine kinase
total genus 11
structure length 75
sequence length 75
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2002-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.930 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1mbyA00
5LHY1 1MBYA
chains in the Genus database with same CATH superfamily
1KIXA 1OXVA 3HS0C 4A3LH 4A3JH 3H3VC 2PCFB 4GN4B 2GA4B 1E2ZA 2QKIC 3X3MA 1IBMQ 3HKSA 4JI3Q 5M3MG 4CBVA 3DWAA 2RHSB 2YV5A 5C6AA 1JWUD 4QL5A 1LTTD 2OCEA 3BDCA 1XPOA 4HEDA 2PMZE 1BBUA 3AU7A 4OGQC 2UXDL 1EFWA 4ZQ3A 1LTAD 4DAYB 1M1KC 4JOIC 2HUGA 3GTOB 2ZJQA 1IW7D 5CORA 4FF1A 5I6YA 2NTTA 4XIGS 2UUAL 1WCMB 4YWKA 1YNND 3AEVA 4F8MA 1TY2A 2KUMA 3J81i 4DV4L 1EZ6A 3BVZA 5CV9A 1CA5A 4DXFA 4JI7Q 1MD2D 2CWAA 3A56A 1HNWQ 1SE2A 2F0OA 4WFN3 2FXQA 4NB3A 1F2ZA 3ULPA 5I9OA 1L0YB 3RD4A 2AHOB 2L55A 3QO2A 3K7AH 1FNWA 4F87A 4RCNA 1I6VC 1HCZA 3A55A 1K8GA 2RKSA 1U4RA 1Y69U 1G6PA 3TZDA 2JA6H 5LMNQ 2X6LA 3NELA 1XTCD 3CXCA 4HAEA 1LO5D 1N36Q 3TBIB 3J80L 1O7YA 5FLMG 1GUWA 2EIFA 1E0BA 2QCPX 3H91A 4ZUIA 2IX3A 4OXPA 4N8FA 1VMCA 1CHPD 4KV6A 1H9RA 4IPHA 4XT1B 1UEAB 4ILWA 5C44G 5ISRA 3V2TA 2EY1A 2CFMA 3KBXA 4FXKC 4K5VA 4KD3A 1UE1A 3HOUH 2SDFA 3IAYA 5C4JH 1KDCA 1VCIA 2B29A 3BVMA 3M3YB 2Q2UA 2HCIA 1HQMC 2XNAC 3NP8A 4OELB 4A3IH 2B2TC 3OMGA 1MSHA 3OHXC 3VYUA 2C5CA 3S2DH 1PMRA 4YIJA 3I70A 1KLGD 4KKTA 1EQRA 1RJTA 1SAPA 1EY8A 4X64Q 4GOPA 4S3SA 3MHBA 2RA4A 3D6CA 2ZTDA 3EN2A 3ND9A 5J39A 4DK3C 2B3GA 3L7ZC 1W6KA 1SJHD 2D2CC 2BH2A 2WIIB 4IURA 5M9OA 3RZOB 3MEHA 3HOVH 1OO9B 3E6ZX 3BS1A 1K0SA 3RUZA 2ES2A 5M3FB 1H9SB 1VQ9A 1I50H 3PUYA 1GOZA 1J9OA 1LYLA 4C3JH 1WCMG 2Z9HA 1JORA 5GAEC 5DNFA 2KQ3A 4YCWA 3D4RA 1PZKD 1NCVA 4ZKBB 4A3GH 1BVSA 4C3IG 3G6JB 4JV5L 2F4VQ 3A5UA 4DNRB 4IALA 3VA5A 1TWCH 2EY6A 1HNZL 3G7LA 1JWMD 4LFAQ 1BNZA 5IYDH 4GLXA 4IUNA 3KFUA 4KN4C 1C8CA 3E5SA 4HIOA 2JA7H 1PTOH 1SYCA 3H94A 1Z47A 2PW7A 3MZ5A 5KNBA 4JBKA 4TVAB 2R93B 1QG7A 1FL0A 4LW1A 1V1QA 1Q3LA 4ZLTF 4U673 4QY7A 1VQHA 2AMCB 2CW0C 3RMHA 1MIUA 2QW7A 1SMXA 2OF1A 3HOZH 3SE0A 2D9UA 1STBA 2YTXA 3KK7A 5E3FA 3FP9A 2K5WA 3T4AC 1EIYB 3K58A 3EFXD 1SR3A 2WACA 4IPGA 2F0TA 3MXNA 3MXPA 1Q46A 1ESRA 3VDYA 4X3KA 1FGUA 1CT1D 5I6WA 3PF5A 1E1TA 1KTKA 4LF6L 2XGTA 1RKNA 3ZYYX 4A3EB 1F2LA 1KABA 3G4SA 1K8AC 2YTVA 3TN2A 1D5MC 4HJAA 4DV3Q 3OIQA 2EY2A 3HOXB 5LL6X 4FP5D 4LF8L 2C9OA 5IWAQ 1I3QB 4BA1I 1ONLA 2BCOA 1PFSA 3Q0AA 1IHZA 2EQSA 2A6ED 4DXGA 5A2QL 4EQNA 3ZJYC 2MUYA 4A3CG 4IOAA 4DUZQ 1PV4A 3I4NB 3K7AB 4JBJA 2K04A 1H95A 1EIFA 4U68A 5BR8L 4FDBA 1PRTC 2X6GA 2PO4A 1EEID 3FMCA 4HIDA 5CR3A 1I6HB 2VQEQ 4MN3A 1S3OA 1SE3A 3GD7A 1NY4A 4KI0A 2G9HD 2X69A 2Y0SG 1HZCA 4R4IA 4V190 2QILA 1HRJA 3KLSA 3IL8A 1IXRA 4N9PA 2R7ZG 3IFDA 2L5TA 1YHBA 3NHHA 3BZDB 5FO9B 3HOYH 2OWOA 4QQBX 1PZJD 5C4HA 4HJ9A 4B08A 1HNXQ 4QJFA 1UUPA 4RHRA 3TSSA 2I5MX 5C3EB 1Y1WG 3QG1A 2UU9Q 2B63H 3FPUB 4A3BH 1U9RA 4HJ7A 5LMUL 3S2DB 1Y8NB 1TR5A 1BCPD 2F0EA 4CHTB 1Y1VB 1PH5A 2K6AA 4ZCKA 2ZXRA 2I0QA 4GKJQ 2EYPA 3J80c 3S15H 1EIHA 2EYFA 2PNRC 2XTIA 2IJ0A 1UAPA 1EOVA 2K14A 3NWSA 3NBHB 3TQYA 3GTKB 2Z6KC 4IO9A 4XYQA 2WKDA 3HOVB 5FLMH 3NUCA 3P1HA 2OEOA 1M90C 1G91A 1CI3M 3KYHC 2K5HA 4DFAA 2A6EC 1PYSB 4ULLA 3KF6A 4K8IA 2K05A 1ICWA 2CH4A 3HKZE 3HOUG 1SSOA 4JI7L 3Q22A 3GTJH 5JJZA 1CZWA 1KDAA 5EPLA 1YNXA 4DV1Q 3HOZB 1HR0L 4KMUC 1I5FA 3X3NA 5CYUA 3TS0A 1TWGH 2NVXH 2EVBA 1EY0A 1EYAA 1NBWA 5HGTA 3KDFA 4C3IB 3MAQA 1SNPA 1SYEA 4HMIA 4B3MQ 1HFNA 2JA6G 4JCVE 4GZYC 1Z7TA 4A4IA 3HOWG 3J7YW 1HUNA 4GOPC 4J6HA 4YWLA 2VQEL 4P71A 2K7VA 5J1ZA 1TT2A 4H44C 3S16H 1N36L 1DJRD 2H1EA 1ILPA 2KCMA 3I4OA 4K6LA 3TS2A 1LTGD 2QGQA 2KEEA 4C56C 2Q8TA 2A69D 3S9WA 2YU9H 1RTNA 3VR6A 2PQAA 1VQ4A 3J7A5 4DA2A 2M00A 4C2MB 5C44B 1VMPA 3NEMA 3ULLA 1Y1WB 1DGSA 1Q7YC 3S17H 3PO3H 2WB1B 1UE5A 3I4MG 4NPSA 2ZTEA 3I7FA 1G8ZD 2A68D 4HCEA 2ZM6L 5I2XA 4R8IA 1I4HA 3PO3G 1STGA 1NAPA 4X3SA 1WTVA 5C3XA 4UPAA 3CF5A 4KKUA 4R4CA 5DAUA 5M5YH 4LF4Q 5E4XA 5C0XH 4QMGA 1ENCA 1A8VA 1YBYA 3I72A 4CKBA 4JI6Q 1W3SA 1BCPF 3L0OA 4JBMA 4JI4Q 3Q8DA 4BBRH 3CCSA 4OWXB 3S1RH 2N55A 2PW5A 4JPBW 2VL6A 1ASZA 4G7OC 1TWHB 1R9TB 4A3KG 2EZVA 2ICEC 5C3EH 2EDGA 4KK7A 5DM63 2L4NA 1C48A 2G5DA 1PH4A 4F88A 3AMUA 5JVH3 4K6DA 1B7YB 3PQIA 2HQEA 3I90A 4A3JG 2KHIA 1D8LA 4LF5Q 3UDXA 4MIUA 5D3DA 1Y1VH 1HR0Q 2H5XA 3VYRA 2R7ZH 3QIAA 2DJFC 1QZGA 1K3BC 1SNMA 2PZTA 1EYGA 2Z8LA 1LT3D 3Q24A 1UNSA 1VQDA 3VR5A 2QA4A 1DCZA 1QUQB 2NN6G 1SROA 4OONA 5ELBA 1GXDC 1HH2P 3GTGH 3SVMA 3D4WA 4QIWB 3VR3A 1LABA 2GN5A 1Q82C 1QNUA 4RGTA 2O5IC 3C1FA 2IT1A 3NBIA 2F0VA 3A8JE 4GN3B 1NJIC 1V1PA 3GTJB 4MTNA 3T1HL 1T9HA 5FLXL 3R2IA 3M4QA 3PGZA 5FOBB 2MPMA 1KC8C 3ND8A 4RFBA 3KF8B 2F4IA 1XYIA 4DAMA 4KY5A 2IX1A 4QUCA 1SYFA 1VQIA 5GQOA 4GNXB 1QVGA 4IOCA 2BE5D 2HCCA 2UUCL 2BH8A 2MP1A 5CC4A 2XWJB 4XDXA 1WTHA 1S5DD 5C4XH 2CCZA 4JVZA 4BBSH 4BXXH 2KENA 2WV6D 3D3RA 4JC0A 4XXEA 1WI5A 5E7NA 3SK4A 1EWHA 2XWBB 1JC7A 4BXXG 5IOCA 2K1BA 4A93G 1PFBA 2K50A 5C4XG 5EGTA 3UDGA 1T5XD 2E74C 3BU2A 4A3BG 1WD1A 5ELEA 1P16A 5IYBG 2NZOA 5EPJA 1XTDA 1JWSD 4WJ3M 5IY0A 3DHQA 1PH3A 2WAQB 3N6RA 2NVQB 4A3GG 2H4OA 4UDUC 4Q0FA 1S5BD 1BCPC 3T51B 1S5FD 1FNVA 1WTQA 1NUCA 3EJIA 3W3AA 2N8NA 1D1KA 5BN3A 1EQVA 1BR9A 1HUMA 4PNYA 4DV0Q 4NXNQ 4C3JB 3U4VA 4DKAC 1B9NA 3DLLA 4JI2L 3H3VI 3S1RB 2CQOA 3MC0B 5C44H 1GM5A 1GHKA 5IT9c 2Q8RE 1DZ1A 2SOBA 4RAUC 4RH6A 1S5ED 1XPUA 4L8JA 2I5HA 3GTQB 5IP7G 4OWWB 5JJIA 1WVLA 2OT2A 3R2TA 5GROA 4BBSG 1PH8A 4G7ZC 2J7ZA 2F0MA 2LY7A 5DEHA 2EYMA 2JQOA 1A3VA 2KA7A 3DM1A 1ZKOA 4KD4A 4DV4Q 4LMQD 4IQZA 4A3FH 5M5YB 3S1QB 4YCVA 1HPCA 3CW2C 2K5DA 2F0PA 1OTCA 3OSOA 2MQHA 2D5DA 3OMCA 4IZ8A 4KY6A 1VQMA 1GD7A 1B44D 2WP8J 1J8IA 4K2KA 4JYAL 3J81E 5JPNC 4J8QA 2A6HD 1K83H 3KOJA 1NE3A 1IKLA 1F77A 1SBBB 3CAMA 5M5XH 1TXYA 1NSNS 4DAVA 4K8JA 4QCLA 3NE5B 2ASBA 3CCEA 1ZYRD 4N9TA 3PV0A 4LFCL 3RR5A 3NTIA 1W2BA 4B3ML 4A93B 1U4LA 1E24A 4IFDH 1E7ZA 4DU9A 1KHIA 2YYZA 1XMQL 5GAGC 4Y52H 4DR1Q 1JB7A 3PCOB 1MJEA 2JEBI 2R7ZB 3CCVA 3GTMB 1EFID 1YJ9A 2LXJA 2B2UA 1CHQD 2I46A 2NTSA 3WOEA 4NXMQ 1MI2A 2JYOA 5JPMC 4GS3A 4DAYA 1SNOA 2KEDA 3CCQA 2MO1A 3GP7A 4I7AA 2JA6B 1FJGL 3PUWA 3CQZH 5C4XB 1HR0W 4WORA 2F3VA 1IW7C 2CVRA 2KOLA 3W2DA 4DGZA 1BDOA 3OW7A 1PTOB 3E3XA 5C0XJ 2KJXA 3F2UA 2D0OA 1HTLD 1SFOB 2MNAA 1JE4A 3PUZA 4HMJA 4HR7B 3EVQA 4JI2Q 4HIKA 3UE0A 1I4RA 1KAWA 4XQQA 3K8AA 3SDZA 1GKHA 2K28A 1JE5A 1VS0A 4B9XA 2Z6KA 2HD3A 3GTPB 4GKJL 3R8BA 3G71A 4LF9L 4C1NK 4A3CH 3HFZB 1WTPA 3GO5A 1S72A 1EY4A 1XWEA 1ET6A 1N34Q 2V4DA 5HGQA 2F3WA 4IFDG 3I56A 3AYHB 1Z9FA 4A3EH 1RIPA 4JI5Q 4HIMA 4F7XA 4OWTB 3E9IA 3D0FA 4FNFA 1STAA 3QWNA 4X66L 3CCMA 3T1YQ 3KDFB 3K0YA 3PUVA 2UXCQ 1HNZQ 1YEZA 4DPGA 3LX0A 4DV2Q 1PFMA 2AQ1B 2Q8IB 5C4ZA 5LMNW 1I4PA 4IUQA 3GTQH 4KKSA 3GTLH 1AP0A 1K9MC 3NTKA 4TRDA 2B39A 2BOSA 1VF7A 4OIKA 5IT9E 1BOSA 1SMYD 4DR1L 5JEAH 1DYQA 2F0GA 4KJOA 2WAQG 1WTRA 3FHWA 2MO0A 3C3LA 1UE6A 4GOPB 4RHSA 2RHQB 4NW2A 4IUUA 1DD2A 4FXDA 2P5ZX 4DK0A 1H9SA 3J80E 1B3QA 2A74C 2BA1A 4IUVA 5AFWA 1XNQL 3M4PA 3Q6SA 3HOYG 4PV1C 1B2TA 2XN9C 4WRDA 1VQPA 4LFBQ 2HDLA 2ZT9C 4C1NI 2Y0SE 2AWNA 4LF6Q 2R92G 2UXBL 1EWIA 4G4KA 1N32L 4DR4L 4XT3B 1D1IA 4LJZC 3T53B 5KRUA 1ZXTA 1PRTF 1VQ7A 1Q8IA 5DM73 4KLKA 5IWAL 1HFGA 5E4WC 2R61A 2CH4W 4R8NA 1LT4D 1YNJC 4L5RC 3CD6A 4J15A 2F0FA 1ICFB 4Q5VA 3DWPA 2VY3A 2QEJC 1NR2A 2Z4HA 1JOKA 4ME5A 1S4ZA 4K14A 4ZYSA 4OX9L 1HZBA 4DUYL 1ET9A 2DNEA 3RLNA 1DONA 1PHJA 3K6OA 3GTKH 4OIJA 2F0LA 1GHJA 1RCVD 1JJCB 2L12A 2VB2X 5CMDA 1V1PB 5C5LA 3UDFA 2ZJPA 2UXBQ 3K5OA 4R1JA 1HA6A 3QOLA 4JI5L 2OTJA 3RLFA 1EU4A 1OXTA 1X54A 4X3UA 4OO1I 1TY0A 4NP5A 1VQLA 5C5MA 4JI3L 1SMYC 4IN3A 4IUPA 1N34L 4JI1Q 3KJOA 2F0JA 2B2TA 5ELCA 1BO0A 3MXGA 2N88A 2L9HA 4M8AA 5KIXA 4A3MB 4IPCA 2NVTB 3MWYW 4OHJA 2L11A 3U9OA 1I94Q 3K57A 1TS3A 4FF2A 3I4NG 3HOZG 3L2PA 2HT1A 1D5ZC 2JEAI 1SE4A 3C2PA 1EYCA 1MBYA 1JMCA 4CDCC 3LGJA 4HCSA 3WWVA 5FO7B 4BBRB 3EIVA 4BY1B 3IKJA 1CKOA 1JOOA 3KLSX 1R9TH 5LMNL 1I4XA 2RSNA 1VQFA 5CV5A 4IFDI 2NVYB 3M7GA 5M5WB 1ML0D 1ILQA 3HOYB 1XXGA 3RZDB 2R3ZA 2M9VA 1SNQA 4Y7NH 4BY7B 3G48A 1IKMA 4ZAIA 3CRLC 2NB0A 3GTLB 3K59A 3PF4A 1N32Q 1HTPA 1KNEA 4IJHA 3TP6A 4L6TB 3IFTA 5FO8B 4JYAQ 3U4ZA 5K36G 1G51A 4H02A 2TMPA 3PIO3 2EPBA 2HHHQ 1XJVA 4RKLA 3STBC 1G2SA 3GTMH 5ELNA 5JJLA 2KECA 1B3AA 3QB3A 1F9QA 2WB1G 3I4MB 4QUFA 3GTGB 1PTOC 2FINB 3K80C 1HQRD 1RHPA 3U50C 1PVOA 2AQ2B 3DXJC 3FDTA 3LWUA 1XMQQ 4XYOA 3OTOL 4PZ6A 2JA8B 1WOCA 1A63A 5KEEA 1F9SA 4POGA 1GVPA 1GUGA 4LK1C 1TWAB 2MFIA 1UWVA 2NN6I 1LTLA 1H9MA 4O2DA 4B3RL 3J7AV 4JBWA 4E6IA 2Z4IA 2F3IA 3OOCA 1WCMH 1Z6HA 1VQNA 5IYDG 4DUYQ 3CRKC 1PA6A 2G9DA 1VQAA 2K5QA 1NMFA 3HKZG 5CBEE 1IBKQ 2PZUA 2SNMA 2PI2A 2FHTA 5EQ0A 4C3IH 5JAVA 5FJ8G 2HIVA 3Q23A 4A3JB 1R4PB 3KF6B 1X32A 3NPPA 4UP9A 1K0RA 3H09A 2VUMB 4DV0L 3E0EA 3R93A 1Q86C 2ZM6Q 4X65Q 4LFAL 2UUBL 3EA6A 1KXLA 1B8AA 4HJ8A 4DR7Q 4KHPL 1LTID 2Q2IA 4HSPA 3DEOA 5CV4A 3J81c 1RL2A 2AKWB 5IYCG 1C4QA 3GQBA 4EGVA 1WFQA 1X3PA 3B6YA 4ODGA 2XIWA 3CPWA 1I94L 3CC4A 4DNTB 2F4VL 3I2ZA 4JI6L 1A62A 4A3IB 1DOMA 1VQOA 2E2HB 4P2CB 5T1IA 1HZ9A 2ZTCA 3RN5A 1AE3A 3S1MB 5C0XI 2PPBC 4A3GB 2A8VA 4RKBA 4XQNA 3J7AF 2IPKD 4Z9CB 4YHHL 1VQ5A 2CW0D 2JP1A 4TQUS 1MSGA 3J7ZC 3CMAA 4B9WA 2VQFQ 2UXCL 1G6ZA 1L1OC 4DV2L 1BXTA 4TSSA 1X65A 4RGOS 1ZEQX 2F0QA 1HJPA 3I3CA 3V96A 1LTSD 1K8MA 1KQSA 4AYBB 1PZID 3PIPA 1YNNC 1QCBD 4DV3L 1L1OB 4X3TA 1QVFA 2R7FA 1V1OA 4PZ8A 2XVSA 3ERQA 3PMFA 3CCJA 1TS2A 3EQLC 2NZ1D 4A3DB 2WAQE 2EYJA 4A3FB 4R4QA 3VR4A 4CJ2C 3H0GG 3RNUA 2HDMA 1TU2B 2QDBA 2F0IA 3OW2A 1GJXA 5T1GA 3QOJA 1KLUD 1B4OA 2L0CA 4AIMA 4DNIA 1N33Q 2PMZB 3NXWA 5D65A 2RVLA 5K36H 2JXMB 3L9AX 3PUXA 1NMGA 4YWMA 3KLRA 3V05A 4DR6L 4UY8C 3F2DA 1CZGA 3TZUA 3T56B 3I4MH 4UP8A 3OWEB 1EZ8A 4LUZA 5ELOA 1YI2A 4B3RQ 3RN2A 3BVGA 3VYSA 3A5ZB 2WINB 5J3BA 1A3UA 1N9WA 3KUPA 3RZDH 3GDEA 1M4VA 2VZAA 1X55A 1I3QH 4FF4A 3GV6A 3CU7A 2KCTA 3EROA 2F0WA 3HZXA 5KNDA 5KNCA 5EKIA 2DN8A 3URYA 1I50B 1DOKA 1V9PA 3QR8A 1U4MA 1G2TA 1IYUA 1XX8A 1JQYD 1O7LA 3VR2A 2ALYB 1MGSA 4L63B 3L3OC 3SHLA 3TDQA 1BKBA 1JICA 3KLWA 1F2YA 3MEFA 4G57A 2F0HA 1B1ZA 3FKIH 2C35B 1Y14B 1PH1A 1LLRD 1X9NA 4MNOA 3P20A 3M4OH 2AQ3B 1ESFA 3HOXH 4HTHA 4FYDA 3ICEA 1Q1BA 1KRTA 3JC66 4RCOA 3BYYB 2B8GA 3KF8A 2JA8H 2CQAA 4EVOA 3MXNB 4MTKA 1L1OA 4JI1L 3CCUA 5LMUQ 1PYWD 3I8ZA 3CKIB 4B3SQ 2BDNA 2VQFL 3GV3A 1TS4A 1VQEA 3J80i 3LWEA 3K5LA 4CKEA 2GVBA 2TSSA 1A15A 4DK1A 5K5PA 1Q12A 4A93H 2JA5H 4G7HC 4JI8Q 3PO2B 4AQYL 4IPDA 1V43A 2BE5C 1CQFA 4AYBG 4ALPA 3BZCA 5C0XG 5JEAJ 3CMEA 3I4NH 5I2YA 4BWGB 3TMEA 1QVCA 4APVA 4PZ7A 3NK9A 2B2VA 3CCLA 5ELFA 1EY7A 2Q2TA 1FD7D 4CJ1B 1T5EA 4OL7A 1YITA 1N33L 2E2HH 4KHVA 1YVCA 3S1MH 4DR6Q 4DK6C 2AWOA 4YY3L 2WB1E 2F0KA 4GN5A 3NQTA 3S1NB 3CC7A 5CV8A 1QWYA 3R3OA 3K5NA 1RD9D 3SK8A 2HIXA 3ERSX 2HHHL 2A73B 4I7ZC 4GKKQ 4V0BA 3S1QH 4K0KL 3GTPH 1E3PA 2N3SA 4R4OA 5CV7A 2E8GA 1I6HH 2OTLA 4H0LC 2F0SA 4CDEC 1W6JA 1PLFA 2D62A 4NXML 1RF2D 4P72A 2R92B 2LMCB 1Q81C 1K83B 3NBHA 2K03A 1Y8OB 3P75A 3F1ZA 2VUMH 2E5LQ 4RWSC 3A74A 1FJGQ 1H9JA 5EBDA 4A3EG 3M7NA 4FF3A 2NYZD 3AQQA 1WD0A 3FPPA 1BF4A 4LF4L 1TKWB 1ENAA 1LV9A 4P73A 4B3SL 1GO3E 4JI0L 2IX0A 3AB9A 4A3BB 3MFGA 1Y1VG 4CDDC 4JI4L 3PIOA 3HKZB 1J6QA 1VQ6A 1AFPA 1IZ6A 4DV6L 2E2IB 3FKIG 4UP7A 1Q1EA 2UU9L 2A6HC 3T16A 1YJNA 4OO1H 5GADC 5BN5A 3M4YA 2DY7A 2VNUD 4DR7L 4KN7C 1H9KA 1IL8A 3DWQA 2BA0A 3OIPA 1ZYRC 4K5WA 4K5XA 3U9SA 3HGBA 2Q2HA 1Y1WH 3S16B 1CTMA 4NDXA 3HP3A 1DOLA 4A3KB 1HHVA 4A3LG 1X6OA 1LTRD 2RDGA 1TWFH 3SXHA 4BA2I 3SK5A 2JA5B 1IYVA 3FKIB 3ONAB 1VQ8A 5C4JB 4A3DH 1Y8PB 2N49A 2KCCA 2LFNA 5EBCA 1F2MA 5IGCA 2A1AA 2SEBD 1A2TA 1TWGB 5L37A 4BY1H 3D4DA 2VS1A 3K5MA 1E1OA 5EAYA 3F2BA 3UDIA 2IW3A 4BBRG 4HN7A 1WYDA 4A76A 4GKKL 2DNCA 1JOQA 4ZUJA 1K28A 4JK1C 2ENBA 2EYOA 1IBLQ 2ID0A 4CGYB 3NENA 3BDOA 4R9WA 2B8FA 4AYBE 4Y7NB 5I4DA 1CFMA 2IHFA 3RZOH 3W5OA 1X56A 2Z1CA 2JA5G 1X3QA 1E22A 1J5EQ 4O42A 4YCUA 1BUVT 3RLOA 1JT8A 2VW9A 1HA5A 2UUCQ 1NNXA 4MHEA 2OQKA 3OYYA 5ELDA 1SNCA 4DV1L 4A3DG 5CGKA 2FMMA 2LS01 2VB3X 1YJWA 2B2YC 1CUKA 1WTXA 1PH7A 4X64L 2DY8A 4ZK9B 2L1BA 4EQOA 4DR4Q 4CJ0B 1L0XB 2N78A 3CC2A 3LNNA 2OQ0A 3H3VH 1KAAA 2NVTH 5CBAE 3BG3A 4C3HH 1P8LA 1F9PA 3JAMi 1PRTB 5JOBA 1SE8A 2R93G 1KRSA 2PYKA 2RQXA 2KHJA 1CA6A 2MJ8A 3NTHA 1VDZA 4LNQA 5E1FA 2ATWA 5D3IB 2A69C 3F2CA 1EIGA 1VQCA 2EYLA 1JR0D 1OXUA 5CV6A 5TSSA 2NVYH 4DN4M 1AN8A 2R93H 4OX9Q 1SRUA 1QUQA 1O7ZA 2IWHA 1PH6A 2AUKA 3A8IE 4P75A 2SNSA 4RGNA 3OWFA 3C1EA 3HOWB 3S1NH 1D7QA 5M3FG 2K01A 4QIWE 1EY5A 2F1MA 5IP7H 2OXPA 1YZ6A 1SN8A 2A68C 3DUZA 2E76C 4DF7A 4GNXA 4DV7L 2NVQH 2EXZA 2JA7G 4NKLA 2Z6BA 4TKOB 2B2WC 5EJWA 4POFA 3W1BA 1FVIA 4QB4A 3K0XA 2BDOA 3O13A 1YIJA 2VUMG 1IYJB 2B2VC 1AEXA 1TQOA 1Q90A 4GNXC 2WFWA 2PI2E 4ABNA 2KHSA 4JI8L 2ICIA 1OXXK 1STYA 2EJFC 1IBLL 1AW7A 1SXTA 1SDFA 4X62Q 1XNRQ 2RCFA 3AFQA 3P7JA 2VXWA 2K33A 2IHEA 4HSVA 5I9PA 2PQEA 3NSWA 3C46A 4DR5Q 2EJMA 3D31A 1TWAH 2IY5B 1JCKB 5JEAG 2F0UA 1U0LA 4LF5L 1KNAA 1EWCA 1VQGA 4AQYQ 1BCPB 1A3TA 1OXSC 2CWPA 1YHQA 1TS5A 1GUTA 2PNHA 1B53A 2KCNA 1EL0A 1X3FA 3ITPA 1QJOA 1LTBD 3HOUB 1XMOL 3VA7A 3S14H 5FLXE 1CK1A 1PDQA 5IODA 1LACA 4A3MG 1J5EL 3UI2A 1XPRA 3ER0A 2A5HA 4XQJA 1YHAA 4K2LA 1Q8KA 4LUOA 5COYA 1EYDA 4RMFA 1A2UA 1CSPA 3SEBA 4YY3Q 1EQQA 3G6EA 1X3GA 4BBSB 5C3WA 1AE2A 5M5WH 5IGEA 1RTOA 1AH9A 1K3RA 1VF5C 1KL9A 4LF7L 2K32A 5F2DA 3T1HQ 3BJUA 4BY7H 3CHBD 4IUTA 2O5JC 4LWCA 1L0WA 1KDBA 4B3TQ 2B63B 5M3FH 5IYCH 3FRPB 4C3JG 2F0DA 3MVVA 3H15A 3E0JA 4N8X1 1PH2A 4BY7G 4L5QA 2K4KA 1SYGA 2FJ2A 4DR2L 1D2BA 1LUZA 2RSOA 1C0AA 5AJ3L 3MTSA 3S15B 1GUSA 1I4GA 1DXMA 5J22A 4DV7Q 1FR3A 1I4QA 1B50A 3WOFA 4DV5Q 4CDFC 2B2WA 4HJ5A 1HNXL 3M85A 4QF4A 1GUOA 4C3HG 2EE1A 3S2HH 2F03A 4EQ5A 2UXDQ 4J1MA 3BZKA 2E5LL 4NMZA 1U5KA 4FXGC 2EJGC 4DAPA 2RBMA 3CCRA 2E75C 3I4LA 1NTGA 5HURA 2L15A 4JG2A 2K5NA 2JA7B 1L2FA 1IBML 2RF4A 4AH6A 5FK9C 5FLXc 4X65L 2V1CC 5IYBH 1SNDA 3FEWX 2NBFA 2PQAB 4XTCS 5BN4A 5M3MB 4KHPQ 2D0PA 1F9RA 1QB5D 1B70B 4A3KH 3M4OB 2MGSA 4JI0Q 1AZPA 3M9BA 1QNKA 3STBD 4X66Q 2ZXOA 3OPOA 2UUAQ 3QJYA 1C9OA 2FMCA 4C3HB 3T1YL 4PG3A 2RCNA 2DUDA 2J0TD 1E2WA 3A54A 5IP9G 3H0GH 1VQJA 3MFYA 2E2JB 4JV5Q 3HRZC 3A8KE 5EKLA 4YHHQ 2XSCA 3GTOH 4DR5L 4NXNL 2QF7A 5KYLA 1TVXA 4DR3L 3NQIA 5C3EG 5IGBA 4GLAC 3HOVG 1EY9A 5A35A 1VQKA 2DGYA 2IL8A 2A19A 3I73A 3D8GA 3I91A 2F52A 3K7UC 1C7YA 2HQLA 5EKKA 3WDNA 4R4TA 1JB3A 3TP7A 5M5XB 2NZHA 1K73C 1KD1C 4OO1G 1CKNA 4L5SA 4CKCA 2EOTA 3K81C 4OEMB 1LT6D 1SEBD 1HXYD 3IRBA 1SFOH 3S17B 3PO3B 5IP9H 2Z0SA 3F8TA 1TIID 2B2YA 3TP5A 4ID6A 1QE6A 2XRSD 4A3IG 4LFBL 4K0KQ 3SR1A 1QZHA 3PSIA 1S5CD 1STHA 3CPFA 1CQVA 2DJGC 2LXKA 1DM0B 2K5VA 2NUCA 4A75A 3EBEA 4LFCQ 2JJQA 3MA2B 5KYIA 2RDHA 3PIP3 2F0NA 1ENFA 4JW0A 3DM3A 3HG9A 1EU3A 3AFPA 2KBNA 5D14A 4DV5L 4B3TL 1IL2A 3CQZB 3H6MA 1GUNA 1FNUA 1U4PA 1LT5D 1STNA 2O2LD 5IGGA 2J4XA 4GLVB 3J81j 2QEXA 1LM0A 1TWHH 3KBGA 1O80A 3CP0A 2JA8G 1N8RC 1MKHA 4LUVA 1CM9A 3A0JA 2EYHA 3U58A 1WTWA 3T13A 4WJWA 5G3LF 3M3YH 5JJKA 3A7LA 4H7BA 5FJ8H 1WTOA 3HOWH 1BBWA 1JJGA 3SK6A 4DUZL 1M8AA 3S14B 1A6XA 1O7IA 5FKAC 4A3FG 1PXUA 4PQXA 1FYCA 4DV6Q 3BDLA 3W1GA 4IFDJ 4RGMA 1SJED 2JN4A 4UHVA 5IGDA 4MZ9A 5KGUA 3MXUA 5NUCA 5IIFA 2PZWA 1K8OA 1EY6A 2KVMA 2JA9A 1V8QA 4PMWA 4LF9Q 4QGUA 2YU9B 1BBXC 1CKNB 5IGFA 4KTAA 2M2LA 2QDLA 5IE8A 4RG1A 2JE6I 4C2MH 4UAIA 4KY7A 2O4XA 1MHWC 5M3MH 1STEA 1R4QB 2AUJD 2K52A 1O78A 4A3MH 1X3EA 1EUJA 2EXDA 1WJJA 2Y0SB 1D6EC 1PTOF 2K75A 1UEBA 4PMBA 4X6AH 2R7DA 1AZQA 4RA8A 4DR3Q 3N52A 3BYTB 1TWCB 2FFKB 1II3A 3E9HA 1EQTA 1RODA 1CKMA 4KHZA 4X62L 1XNRL 1PYBA 3JAMc 1HNWL 2NVXB 3S2HB 2RDFA 4JOIA 5IT9L 3KJPA 3A7AB 4BY1G 3JAML 2MHVA 1VQBA 2CHBD 3SGIA 1EEFD 2XRQD 2R6GA 1D5XC 2E2DC 4EX5A 1PTOD 4M1UB 3TEHB 2R92H 4LF8Q 4O0AA 1TWFB 4BS9A 4ZRZA 5JVG3 3VYTA 2ZXPA 1CSQA 1A0IA 5EPKA 4FVMA 1QOHA 3TRZA 1SYDA 1BQQT 5GAHC 1XNQQ 3HOXG 3PO2H 1EOTA 3OTOQ 3TREA 4LAAA 2LSSA 3H0GB 5BR8Q 2JK8A 4KJNA 1XMOQ 2E2JH 2YTYA 1RDPD 1UE7A 3J81L 2NN6H 5DLQE 1PH9A 2GVAA 5LHY1 3PO2G 1HZAA 3UE1A 4LF7Q 1IBKL 2EY5A 2E2IH 1B9MA 4H13C 1SYBA 3DMUA 4IJLA 1QILA 2I07B 1FGBD 3I55A 3ULJA 1JJ2A 1MJCA 1PFNA 4FO2A 4O1NA 2JSOA 2UUBQ 5LL6S 4DR2Q 1SLJA 4I65A 5AJ3Q 1E2VA 3HEJA 2WKCA 2CKZB 5G3LD 3S24A 4EQPA 5HY6A 1NR4A 1ASYA 4L5TA 2I5LX 1YNJD 3JAME 2NWGA 4ZKCB 3FVQA 2B2UC 3TP8A 2LKVA 3D6WA 4WJ4A 4PMCA 2B63G 4P74A 1PRTD 3NWTA 1G291 5A2QE 1S40A 2ZJRA 5H1SE 4ME3A 3DEPA
chains in the Genus database with same CATH topology
1OXVA 3HS0C 3H3VC 2PCFB 2GA4B 1E2ZA 2QKIC 3X3MA 4CBVA 3DWAA 5C6AA 1JWUD 1LTTD 3BDCA 4HEDA 3AU7A 4OGQC 4ZQ3A 1LTAD 3GTOB 2HUGA 1IW7D 5CORA 4FF1A 5I6YA 2NTTA 4XIGS 1WCMB 1YNND 4F8MA 1TY2A 2KUMA 1EZ6A 3BVZA 5CV9A 1CA5A 4DXFA 1MD2D 3A56A 1SE2A 2F0OA 4WFN3 1F2ZA 5I9OA 1L0YB 3RD4A 2L55A 3QO2A 4F87A 1FNWA 4RCNA 1I6VC 1HCZA 3A55A 2RKSA 1U4RA 1Y69U 3TZDA 2X6LA 1XTCD 4HAEA 1LO5D 3TBIB 3J80L 1O7YA 1GUWA 1E0BA 2QCPX 3H91A 4ZUIA 2IX3A 1VMCA 1CHPD 4KV6A 1H9RA 4XT1B 1UEAB 4ILWA 5ISRA 3V2TA 2EY1A 3KBXA 4FXKC 4K5VA 4KD3A 2SDFA 3IAYA 1KDCA 1VCIA 3BVMA 3M3YB 2HCIA 1HQMC 2XNAC 3NP8A 2B2TC 3OMGA 1MSHA 3OHXC 3VYUA 2C5CA 1PMRA 4YIJA 3I70A 1KLGD 4KKTA 1RJTA 1SAPA 1EY8A 4S3SA 3MHBA 2RA4A 3D6CA 3ND9A 5J39A 3L7ZC 1W6KA 1SJHD 2D2CC 2WIIB 4IURA 5M9OA 3RZOB 3MEHA 1OO9B 3E6ZX 3BS1A 3RUZA 5M3FB 1H9SB 3PUYA 1GOZA 1J9OA 1JORA 5DNFA 2KQ3A 3D4RA 1PZKD 1NCVA 4ZKBB 4C3IG 3G6JB 4DNRB 4IALA 3VA5A 2EY6A 3G7LA 1JWMD 1BNZA 4IUNA 4KN4C 1C8CA 3E5SA 1PTOH 1SYCA 3H94A 1Z47A 2PW7A 3MZ5A 5KNBA 2R93B 1QG7A 1Q3LA 4ZLTF 4U673 2CW0C 3RMHA 2OF1A 3SE0A 2D9UA 1STBA 3KK7A 5E3FA 2K5WA 3T4AC 3K58A 3EFXD 2WACA 2F0TA 3MXNA 3MXPA 1ESRA 4X3KA 5I6WA 1CT1D 1KTKA 1RKNA 3ZYYX 4A3EB 1F2LA 1KABA 3TN2A 1D5MC 3OIQA 2EY2A 3HOXB 5LL6X 4FP5D 2C9OA 1I3QB 4BA1I 1ONLA 2BCOA 3Q0AA 1IHZA 2A6ED 4DXGA 5A2QL 4EQNA 2MUYA 3I4NB 3K7AB 2K04A 4U68A 1PRTC 2X6GA 2PO4A 1EEID 3FMCA 5CR3A 1I6HB 4MN3A 1SE3A 3GD7A 4KI0A 2G9HD 2X69A 4V190 2QILA 1HRJA 3KLSA 3IL8A 4N9PA 3IFDA 2L5TA 3NHHA 3BZDB 5FO9B 1PZJD 5C4HA 4B08A 1UUPA 4RHRA 3TSSA 5C3EB 3QG1A 3FPUB 1U9RA 3S2DB 1Y8NB 1TR5A 1BCPD 2F0EA 4CHTB 1Y1VB 2K6AA 2ZXRA 2EYPA 1EIHA 2EYFA 2PNRC 2IJ0A 1UAPA 3NWSA 3GTKB 4XYQA 2WKDA 3HOVB 3NUCA 3P1HA 2OEOA 1G91A 1CI3M 4DFAA 2A6EC 4ULLA 4K8IA 2K05A 1ICWA 1SSOA 3Q22A 5JJZA 1CZWA 1KDAA 5EPLA 3HOZB 4KMUC 3X3NA 5CYUA 2EVBA 1EY0A 1EYAA 5HGTA 4C3IB 3MAQA 1SNPA 1SYEA 4HMIA 1HFNA 4GZYC 1Z7TA 1HUNA 3J7YW 4J6HA 5J1ZA 2K7VA 1TT2A 4H44C 1DJRD 2H1EA 1ILPA 4K6LA 1LTGD 2KEEA 4C56C 2Q8TA 2A69D 3S9WA 1RTNA 3VR6A 4DA2A 2M00A 4C2MB 5C44B 1VMPA 1Y1WB 2WB1B 1G8ZD 2A68D 4HCEA 5I2XA 4R8IA 1I4HA 1STGA 1NAPA 4X3SA 1WTVA 5C3XA 4KKUA 5DAUA 5E4XA 5C0XH 4QMGA 1ENCA 3I72A 4CKBA 1BCPF 2N55A 2PW5A 4G7OC 1TWHB 1R9TB 2EZVA 2ICEC 2EDGA 4KK7A 5DM63 2L4NA 1C48A 4F88A 3AMUA 5JVH3 4K6DA 2HQEA 3I90A 4MIUA 5D3DA 3VYRA 3QIAA 1SNMA 2PZTA 2Z8LA 1LT3D 3Q24A 1UNSA 3VR5A 1DCZA 2NN6G 5ELBA 1GXDC 3SVMA 3D4WA 4QIWB 3VR3A 1LABA 1QNUA 4RGTA 2O5IC 3C1FA 2IT1A 3NBIA 2F0VA 3A8JE 1V1PA 3GTJB 5FLXL 3R2IA 5FOBB 2MPMA 3ND8A 4RFBA 2F4IA 1XYIA 4KY5A 2IX1A 4QUCA 1SYFA 2BE5D 2HCCA 2MP1A 5CC4A 2XWJB 4XDXA 1S5DD 2WV6D 3D3RA 4XXEA 3SK4A 1EWHA 2XWBB 1JC7A 5IOCA 2K1BA 1PFBA 5EGTA 1T5XD 2E74C 1WD1A 5ELEA 5EPJA 1JWSD 3DHQA 2WAQB 3N6RA 2NVQB 2H4OA 4UDUC 4Q0FA 1S5BD 1BCPC 3T51B 1S5FD 1FNVA 1WTQA 1NUCA 3EJIA 3W3AA 1D1KA 5BN3A 1EQVA 1BR9A 1HUMA 4PNYA 4C3JB 1B9NA 3S1RB 3MC0B 1GHKA 2Q8RE 1DZ1A 2SOBA 4RAUC 4RH6A 1S5ED 3GTQB 4L8JA 1WVLA 2OT2A 3R2TA 4G7ZC 2J7ZA 2F0MA 2LY7A 5DEHA 2EYMA 1A3VA 2KA7A 3DM1A 1ZKOA 4KD4A 4LMQD 4IQZA 5M5YB 3S1QB 1HPCA 2K5DA 2F0PA 3OSOA 2D5DA 3OMCA 4IZ8A 4KY6A 1B44D 2WP8J 1J8IA 4K2KA 3J81E 5JPNC 4J8QA 2A6HD 1IKLA 1F77A 1SBBB 4DAVA 1NSNS 4K8JA 4QCLA 3NE5B 1ZYRD 4N9TA 3PV0A 3NTIA 4A93B 1U4LA 4IFDH 4DU9A 2YYZA 2JEBI 2R7ZB 3GTMB 1EFID 2B2UA 1CHQD 2I46A 2NTSA 3WOEA 1MI2A 2JYOA 5JPMC 4DAYA 1SNOA 2KEDA 3GP7A 2JA6B 3PUWA 5C4XB 4WORA 2F3VA 1IW7C 2CVRA 2KOLA 3W2DA 4DGZA 1BDOA 3OW7A 1PTOB 5C0XJ 2KJXA 3F2UA 1HTLD 1SFOB 1JE4A 3PUZA 4HMJA 4HR7B 3EVQA 1I4RA 4XQQA 3SDZA 2K28A 4B9XA 3GTPB 3R8BA 4C1NK 1WTPA 3GO5A 1EY4A 1XWEA 1ET6A 2V4DA 2F3WA 4IFDG 4F7XA 4FNFA 1STAA 3QWNA 3K0YA 3PUVA 3LX0A 1PFMA 2AQ1B 2Q8IB 5C4ZA 1I4PA 4IUQA 4KKSA 1AP0A 3NTKA 4TRDA 2B39A 2BOSA 1VF7A 4OIKA 5IT9E 1BOSA 1SMYD 5JEAH 1DYQA 2F0GA 4KJOA 1WTRA 3C3LA 4RHSA 4NW2A 4IUUA 1DD2A 4FXDA 4DK0A 1H9SA 3J80E 2A74C 2BA1A 4IUVA 5AFWA 3Q6SA 4PV1C 1B2TA 2XN9C 4WRDA 2HDLA 2ZT9C 4C1NI 2AWNA 4G4KA 4XT3B 1D1IA 4LJZC 3T53B 5KRUA 1ZXTA 1PRTF 1Q8IA 5DM73 1HFGA 5E4WC 2R61A 4R8NA 1LT4D 1YNJC 2F0FA 4Q5VA 3DWPA 2QEJC 1NR2A 2Z4HA 1JOKA 4ME5A 1S4ZA 4K14A 4ZYSA 1ET9A 2DNEA 1DONA 3K6OA 4OIJA 2F0LA 1GHJA 1RCVD 5CMDA 2L12A 2VB2X 1V1PB 5C5LA 3K5OA 1HA6A 3QOLA 3RLFA 1EU4A 1OXTA 4X3UA 4OO1I 1TY0A 4NP5A 5C5MA 1SMYC 4IN3A 4IUPA 2F0JA 2B2TA 5ELCA 1BO0A 3MXGA 2N88A 2L9HA 4M8AA 5KIXA 4A3MB 2NVTB 3MWYW 4OHJA 2L11A 3U9OA 3K57A 1TS3A 4FF2A 1D5ZC 2JEAI 1SE4A 3C2PA 1EYCA 1MBYA 4HCSA 5FO7B 4BBRB 4BY1B 3IKJA 1JOOA 3KLSX 1I4XA 2RSNA 5CV5A 4IFDI 2NVYB 3M7GA 5M5WB 1ML0D 1ILQA 3HOYB 1XXGA 3RZDB 2R3ZA 2M9VA 1SNQA 4BY7B 1IKMA 4ZAIA 3CRLC 2NB0A 3GTLB 3K59A 1HTPA 1KNEA 3TP6A 4L6TB 3IFTA 5FO8B 5K36G 2TMPA 3PIO3 2EPBA 4RKLA 1G2SA 2KECA 1B3AA 3QB3A 1F9QA 3I4MB 4QUFA 3GTGB 1PTOC 2FINB 1HQRD 1RHPA 2AQ2B 3DXJC 3FDTA 3LWUA 4XYOA 2JA8B 5KEEA 1F9SA 1GUGA 4LK1C 1TWAB 2NN6I 1H9MA 3J7AV 4JBWA 4E6IA 2Z4IA 3OOCA 1Z6HA 3CRKC 2G9DA 2K5QA 5CBEE 2PZUA 2SNMA 2FHTA 5EQ0A 5JAVA 3Q23A 4A3JB 1R4PB 1X32A 3NPPA 3H09A 2VUMB 3R93A 3EA6A 1LTID 4HSPA 3DEOA 5CV4A 1C4QA 3GQBA 4EGVA 1X3PA 4ODGA 2XIWA 4DNTB 4A3IB 1DOMA 2E2HB 4P2CB 5T1IA 3S1MB 5C0XI 2PPBC 4A3GB 4RKBA 4XQNA 3J7AF 2IPKD 4Z9CB 2CW0D 2JP1A 4TQUS 1MSGA 1G6ZA 4B9WA 1BXTA 4TSSA 4RGOS 1ZEQX 2F0QA 3I3CA 3V96A 1LTSD 1K8MA 4AYBB 1PZID 1YNNC 1QCBD 4X3TA 1V1OA 2XVSA 3ERQA 3PMFA 1TS2A 3EQLC 2NZ1D 4A3DB 2EYJA 4A3FB 3VR4A 4CJ2C 2HDMA 1TU2B 2QDBA 2F0IA 1GJXA 5T1GA 3QOJA 1KLUD 1B4OA 2L0CA 2PMZB 3NXWA 5D65A 2RVLA 5K36H 2JXMB 3L9AX 3PUXA 3KLRA 3V05A 1CZGA 3TZUA 3T56B 3OWEB 1EZ8A 3BVGA 3VYSA 2WINB 1A3UA 3KUPA 1M4VA 4FF4A 3GV6A 3CU7A 3EROA 2F0WA 3HZXA 5KNDA 5KNCA 5EKIA 2DN8A 3URYA 1I50B 1DOKA 1U4MA 1G2TA 1IYUA 1XX8A 1JQYD 1O7LA 3VR2A 1MGSA 4L63B 3L3OC 3SHLA 3TDQA 1JICA 1F2YA 4G57A 2F0HA 1B1ZA 1LLRD 3P20A 2AQ3B 1ESFA 4FYDA 4HTHA 1Q1BA 4RCOA 3BYYB 2B8GA 3KF8A 2CQAA 4EVOA 1PYWD 3I8ZA 3CKIB 2BDNA 3GV3A 1TS4A 3LWEA 3K5LA 4CKEA 2TSSA 1A15A 4DK1A 5K5PA 1Q12A 4G7HC 3PO2B 1V43A 2BE5C 1CQFA 5C0XG 5JEAJ 5I2YA 4BWGB 3TMEA 3NK9A 2B2VA 5ELFA 1EY7A 1FD7D 4CJ1B 1T5EA 4OL7A 4KHVA 2AWOA 2F0KA 3NQTA 3S1NB 5CV8A 1QWYA 3R3OA 3K5NA 1RD9D 3SK8A 2A73B 4I7ZC 4V0BA 5CV7A 4H0LC 2F0SA 1W6JA 1PLFA 2D62A 1RF2D 2R92B 2LMCB 1K83B 3NBHA 2K03A 1Y8OB 3P75A 4RWSC 1H9JA 5EBDA 3M7NA 4FF3A 2NYZD 1WD0A 3FPPA 1BF4A 1TKWB 1ENAA 1LV9A 2IX0A 3AB9A 4A3BB 3MFGA 3HKZB 1AFPA 2E2IB 1Q1EA 2A6HC 3T16A 4OO1H 5BN5A 3M4YA 2DY7A 2VNUD 4KN7C 1H9KA 1IL8A 3DWQA 2BA0A 3OIPA 1ZYRC 4K5WA 4K5XA 3U9SA 3HGBA 3S16B 1CTMA 4NDXA 3HP3A 1DOLA 4A3KB 1HHVA 1LTRD 2RDGA 4BA2I 3SXHA 3SK5A 2JA5B 1IYVA 3FKIB 3ONAB 5C4JB 1Y8PB 2KCCA 2LFNA 5EBCA 1F2MA 5IGCA 2SEBD 1A2TA 1TWGB 3D4DA 3K5MA 2IW3A 4HN7A 2DNCA 1JOQA 4ZUJA 4JK1C 2ENBA 2EYOA 2ID0A 4CGYB 3BDOA 4R9WA 2B8FA 4Y7NB 5I4DA 1CFMA 2Z1CA 1X3QA 4O42A 1BUVT 1HA5A 4MHEA 5ELDA 1SNCA 5CGKA 2FMMA 2LS01 2VB3X 2B2YC 1WTXA 2DY8A 4ZK9B 2L1BA 4EQOA 4CJ0B 1L0XB 3LNNA 1KAAA 5CBAE 3BG3A 1F9PA 1PRTB 5JOBA 2PYKA 2RQXA 1CA6A 2MJ8A 3NTHA 1VDZA 5E1FA 5D3IB 2A69C 1EIGA 2EYLA 1JR0D 1OXUA 5CV6A 5TSSA 4DN4M 1AN8A 2IWHA 1O7ZA 2AUKA 3A8IE 2SNSA 4RGNA 3OWFA 3C1EA 3HOWB 2K01A 1EY5A 2F1MA 2OXPA 2A68C 3DUZA 2E76C 4DF7A 2EXZA 4NKLA 4TKOB 2B2WC 5EJWA 4QB4A 2BDOA 3O13A 2B2VC 1AEXA 1TQOA 1Q90A 4ABNA 2KHSA 2ICIA 1OXXK 1STYA 2EJFC 1AW7A 1SXTA 1SDFA 3P7JA 2VXWA 2K33A 4HSVA 5I9PA 2PQEA 3NSWA 3C46A 2EJMA 3D31A 1JCKB 5JEAG 2F0UA 1KNAA 1EWCA 1BCPB 1A3TA 1OXSC 1TS5A 1GUTA 1B53A 2KCNA 1EL0A 3ITPA 1QJOA 1LTBD 3HOUB 3VA7A 5FLXE 1CK1A 1PDQA 5IODA 1LACA 3UI2A 2A5HA 4XQJA 4K2LA 5COYA 1EYDA 1A2UA 3SEBA 4BBSB 5C3WA 5IGEA 1RTOA 1VF5C 2K32A 5F2DA 3CHBD 4IUTA 2O5JC 1KDBA 2B63B 3FRPB 4C3JG 2F0DA 3MVVA 3E0JA 1SYGA 2FJ2A 1D2BA 2RSOA 3MTSA 3S15B 1GUSA 1I4GA 1DXMA 5J22A 1FR3A 1I4QA 1B50A 3WOFA 2B2WA 3M85A 4QF4A 1GUOA 4C3HG 2EE1A 2F03A 4J1MA 4NMZA 4FXGC 2EJGC 4DAPA 2RBMA 2E75C 3I4LA 5HURA 2JA7B 5FK9C 1SNDA 3FEWX 2NBFA 4XTCS 5BN4A 5M3MB 1F9RA 1QB5D 3M4OB 2MGSA 1AZPA 1QNKA 2ZXOA 3OPOA 3QJYA 2FMCA 4C3HB 2J0TD 1E2WA 3A54A 3MFYA 2E2JB 3HRZC 3A8KE 5EKLA 2XSCA 2QF7A 5KYLA 1TVXA 3NQIA 5IGBA 1EY9A 5A35A 2IL8A 3I73A 3D8GA 3I91A 5EKKA 3WDNA 1JB3A 3TP7A 5M5XB 4OO1G 4CKCA 2EOTA 1LT6D 1SEBD 1HXYD 3S17B 3PO3B 1TIID 2B2YA 3TP5A 4ID6A 1QE6A 2XRSD 3SR1A 1S5CD 1STHA 1CQVA 1DM0B 2NUCA 3MA2B 5KYIA 2RDHA 3PIP3 2F0NA 1ENFA 3HG9A 1EU3A 5D14A 3CQZB 3H6MA 1GUNA 1FNUA 1U4PA 1LT5D 1STNA 2O2LD 5IGGA 2J4XA 3KBGA 1O80A 1CM9A 2EYHA 1WTWA 3T13A 4WJWA 5G3LF 3A7LA 4H7BA 1WTOA 3SK6A 1M8AA 3S14B 1A6XA 5FKAC 1PXUA 4PQXA 1FYCA 3BDLA 4IFDJ 4RGMA 1SJED 5IGDA 5KGUA 5NUCA 3MXUA 5IIFA 2PZWA 1K8OA 1EY6A 2KVMA 1V8QA 4PMWA 2YU9B 1BBXC 5IGFA 4KTAA 2M2LA 2JE6I 4UAIA 4KY7A 2O4XA 1STEA 1R4QB 2AUJD 1O78A 2Y0SB 1D6EC 1PTOF 4PMBA 1AZQA 4RA8A 3N52A 3BYTB 1TWCB 2FFKB 1II3A 1EQTA 1RODA 4KHZA 2NVXB 3S2HB 2RDFA 5IT9L 3A7AB 3JAML 2MHVA 2CHBD 1EEFD 2XRQD 2R6GA 1D5XC 2E2DC 1PTOD 4M1UB 1TWFB 4BS9A 4ZRZA 5JVG3 3VYTA 2ZXPA 5EPKA 4FVMA 1QOHA 1SYDA 1BQQT 1EOTA 4LAAA 3H0GB 4KJNA 1RDPD 3J81L 2NN6H 5LHY1 2EY5A 1B9MA 4H13C 1SYBA 3DMUA 1QILA 2I07B 1FGBD 1PFNA 4FO2A 4O1NA 2JSOA 5LL6S 4I65A 1E2VA 3HEJA 2WKCA 5G3LD 4EQPA 1NR4A 1YNJD 3JAME 2NWGA 4ZKCB 3FVQA 2B2UC 3TP8A 2LKVA 3D6WA 4PMCA 1PRTD 3NWTA 1G291 5A2QE 3DEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LHY 1;  1MBY A; 
#chains in the Genus database with same CATH topology
 1KIX A;  1OXV A;  3HS0 C;  4A3L H;  4A3J H;  3H3V C;  2PCF B;  4GN4 B;  2GA4 B;  1E2Z A;  2QKI C;  3X3M A;  1IBM Q;  3HKS A;  4JI3 Q;  5M3M G;  4CBV A;  3DWA A;  2RHS B;  2YV5 A;  5C6A A;  1JWU D;  4QL5 A;  1LTT D;  2OCE A;  3BDC A;  1XPO A;  4HED A;  2PMZ E;  1BBU A;  3AU7 A;  4OGQ C;  2UXD L;  1EFW A;  4ZQ3 A;  1LTA D;  4DAY B;  1M1K C;  4JOI C;  2HUG A;  3GTO B;  2ZJQ A;  1IW7 D;  5COR A;  4FF1 A;  5I6Y A;  2NTT A;  4XIG S;  2UUA L;  1WCM B;  4YWK A;  1YNN D;  3AEV A;  4F8M A;  1TY2 A;  2KUM A;  3J81 i;  4DV4 L;  1EZ6 A;  3BVZ A;  5CV9 A;  1CA5 A;  4DXF A;  4JI7 Q;  1MD2 D;  2CWA A;  3A56 A;  1HNW Q;  1SE2 A;  2F0O A;  4WFN 3;  2FXQ A;  4NB3 A;  1F2Z A;  3ULP A;  5I9O A;  1L0Y B;  3RD4 A;  2AHO B;  2L55 A;  3QO2 A;  3K7A H;  1FNW A;  4F87 A;  4RCN A;  1I6V C;  1HCZ A;  3A55 A;  1K8G A;  2RKS A;  1U4R A;  1Y69 U;  1G6P A;  3TZD A;  2JA6 H;  5LMN Q;  2X6L A;  3NEL A;  1XTC D;  3CXC A;  4HAE A;  1LO5 D;  1N36 Q;  3TBI B;  3J80 L;  1O7Y A;  5FLM G;  1GUW A;  2EIF A;  1E0B A;  2QCP X;  3H91 A;  4ZUI A;  2IX3 A;  4OXP A;  4N8F A;  1VMC A;  1CHP D;  4KV6 A;  1H9R A;  4IPH A;  4XT1 B;  1UEA B;  4ILW A;  5C44 G;  5ISR A;  3V2T A;  2EY1 A;  2CFM A;  3KBX A;  4FXK C;  4K5V A;  4KD3 A;  1UE1 A;  3HOU H;  2SDF A;  3IAY A;  5C4J H;  1KDC A;  1VCI A;  2B29 A;  3BVM A;  3M3Y B;  2Q2U A;  2HCI A;  1HQM C;  2XNA C;  3NP8 A;  4OEL B;  4A3I H;  2B2T C;  3OMG A;  1MSH A;  3OHX C;  3VYU A;  2C5C A;  3S2D H;  1PMR A;  4YIJ A;  3I70 A;  1KLG D;  4KKT A;  1EQR A;  1RJT A;  1SAP A;  1EY8 A;  4X64 Q;  4GOP A;  4S3S A;  3MHB A;  2RA4 A;  3D6C A;  2ZTD A;  3EN2 A;  3ND9 A;  5J39 A;  4DK3 C;  2B3G A;  3L7Z C;  1W6K A;  1SJH D;  2D2C C;  2BH2 A;  2WII B;  4IUR A;  5M9O A;  3RZO B;  3MEH A;  3HOV H;  1OO9 B;  3E6Z X;  3BS1 A;  1K0S A;  3RUZ A;  2ES2 A;  5M3F B;  1H9S B;  1VQ9 A;  1I50 H;  3PUY A;  1GOZ A;  1J9O A;  1LYL A;  4C3J H;  1WCM G;  2Z9H A;  1JOR A;  5GAE C;  5DNF A;  2KQ3 A;  4YCW A;  3D4R A;  1PZK D;  1NCV A;  4ZKB B;  4A3G H;  1BVS A;  4C3I G;  3G6J B;  4JV5 L;  2F4V Q;  3A5U A;  4DNR B;  4IAL A;  3VA5 A;  1TWC H;  2EY6 A;  1HNZ L;  3G7L A;  1JWM D;  4LFA Q;  1BNZ A;  5IYD H;  4GLX A;  4IUN A;  3KFU A;  4KN4 C;  1C8C A;  3E5S A;  4HIO A;  2JA7 H;  1PTO H;  1SYC A;  3H94 A;  1Z47 A;  2PW7 A;  3MZ5 A;  5KNB A;  4JBK A;  4TVA B;  2R93 B;  1QG7 A;  1FL0 A;  4LW1 A;  1V1Q A;  1Q3L A;  4ZLT F;  4U67 3;  4QY7 A;  1VQH A;  2AMC B;  2CW0 C;  3RMH A;  1MIU A;  2QW7 A;  1SMX A;  2OF1 A;  3HOZ H;  3SE0 A;  2D9U A;  1STB A;  2YTX A;  3KK7 A;  5E3F A;  3FP9 A;  2K5W A;  3T4A C;  1EIY B;  3K58 A;  3EFX D;  1SR3 A;  2WAC A;  4IPG A;  2F0T A;  3MXN A;  3MXP A;  1Q46 A;  1ESR A;  3VDY A;  4X3K A;  1FGU A;  1CT1 D;  5I6W A;  3PF5 A;  1E1T A;  1KTK A;  4LF6 L;  2XGT A;  1RKN A;  3ZYY X;  4A3E B;  1F2L A;  1KAB A;  3G4S A;  1K8A C;  2YTV A;  3TN2 A;  1D5M C;  4HJA A;  4DV3 Q;  3OIQ A;  2EY2 A;  3HOX B;  5LL6 X;  4FP5 D;  4LF8 L;  2C9O A;  5IWA Q;  1I3Q B;  4BA1 I;  1ONL A;  2BCO A;  1PFS A;  3Q0A A;  1IHZ A;  2EQS A;  2A6E D;  4DXG A;  5A2Q L;  4EQN A;  3ZJY C;  2MUY A;  4A3C G;  4IOA A;  4DUZ Q;  1PV4 A;  3I4N B;  3K7A B;  4JBJ A;  2K04 A;  1H95 A;  1EIF A;  4U68 A;  5BR8 L;  4FDB A;  1PRT C;  2X6G A;  2PO4 A;  1EEI D;  3FMC A;  4HID A;  5CR3 A;  1I6H B;  2VQE Q;  4MN3 A;  1S3O A;  1SE3 A;  3GD7 A;  1NY4 A;  4KI0 A;  2G9H D;  2X69 A;  2Y0S G;  1HZC A;  4R4I A;  4V19 0;  2QIL A;  1HRJ A;  3KLS A;  3IL8 A;  1IXR A;  4N9P A;  2R7Z G;  3IFD A;  2L5T A;  1YHB A;  3NHH A;  3BZD B;  5FO9 B;  3HOY H;  2OWO A;  4QQB X;  1PZJ D;  5C4H A;  4HJ9 A;  4B08 A;  1HNX Q;  4QJF A;  1UUP A;  4RHR A;  3TSS A;  2I5M X;  5C3E B;  1Y1W G;  3QG1 A;  2UU9 Q;  2B63 H;  3FPU B;  4A3B H;  1U9R A;  4HJ7 A;  5LMU L;  3S2D B;  1Y8N B;  1TR5 A;  1BCP D;  2F0E A;  4CHT B;  1Y1V B;  1PH5 A;  2K6A A;  4ZCK A;  2ZXR A;  2I0Q A;  4GKJ Q;  2EYP A;  3J80 c;  3S15 H;  1EIH A;  2EYF A;  2PNR C;  2XTI A;  2IJ0 A;  1UAP A;  1EOV A;  2K14 A;  3NWS A;  3NBH B;  3TQY A;  3GTK B;  2Z6K C;  4IO9 A;  4XYQ A;  2WKD A;  3HOV B;  5FLM H;  3NUC A;  3P1H A;  2OEO A;  1M90 C;  1G91 A;  1CI3 M;  3KYH C;  2K5H A;  4DFA A;  2A6E C;  1PYS B;  4ULL A;  3KF6 A;  4K8I A;  2K05 A;  1ICW A;  2CH4 A;  3HKZ E;  3HOU G;  1SSO A;  4JI7 L;  3Q22 A;  3GTJ H;  5JJZ A;  1CZW A;  1KDA A;  5EPL A;  1YNX A;  4DV1 Q;  3HOZ B;  1HR0 L;  4KMU C;  1I5F A;  3X3N A;  5CYU A;  3TS0 A;  1TWG H;  2NVX H;  2EVB A;  1EY0 A;  1EYA A;  1NBW A;  5HGT A;  3KDF A;  4C3I B;  3MAQ A;  1SNP A;  1SYE A;  4HMI A;  4B3M Q;  1HFN A;  2JA6 G;  4JCV E;  4GZY C;  1Z7T A;  4A4I A;  3HOW G;  3J7Y W;  1HUN A;  4GOP C;  4J6H A;  4YWL A;  2VQE L;  4P71 A;  2K7V A;  5J1Z A;  1TT2 A;  4H44 C;  3S16 H;  1N36 L;  1DJR D;  2H1E A;  1ILP A;  2KCM A;  3I4O A;  4K6L A;  3TS2 A;  1LTG D;  2QGQ A;  2KEE A;  4C56 C;  2Q8T A;  2A69 D;  3S9W A;  2YU9 H;  1RTN A;  3VR6 A;  2PQA A;  1VQ4 A;  3J7A 5;  4DA2 A;  2M00 A;  4C2M B;  5C44 B;  1VMP A;  3NEM A;  3ULL A;  1Y1W B;  1DGS A;  1Q7Y C;  3S17 H;  3PO3 H;  2WB1 B;  1UE5 A;  3I4M G;  4NPS A;  2ZTE A;  3I7F A;  1G8Z D;  2A68 D;  4HCE A;  2ZM6 L;  5I2X A;  4R8I A;  1I4H A;  3PO3 G;  1STG A;  1NAP A;  4X3S A;  1WTV A;  5C3X A;  4UPA A;  3CF5 A;  4KKU A;  4R4C A;  5DAU A;  5M5Y H;  4LF4 Q;  5E4X A;  5C0X H;  4QMG A;  1ENC A;  1A8V A;  1YBY A;  3I72 A;  4CKB A;  4JI6 Q;  1W3S A;  1BCP F;  3L0O A;  4JBM A;  4JI4 Q;  3Q8D A;  4BBR H;  3CCS A;  4OWX B;  3S1R H;  2N55 A;  2PW5 A;  4JPB W;  2VL6 A;  1ASZ A;  4G7O C;  1TWH B;  1R9T B;  4A3K G;  2EZV A;  2ICE C;  5C3E H;  2EDG A;  4KK7 A;  5DM6 3;  2L4N A;  1C48 A;  2G5D A;  1PH4 A;  4F88 A;  3AMU A;  5JVH 3;  4K6D A;  1B7Y B;  3PQI A;  2HQE A;  3I90 A;  4A3J G;  2KHI A;  1D8L A;  4LF5 Q;  3UDX A;  4MIU A;  5D3D A;  1Y1V H;  1HR0 Q;  2H5X A;  3VYR A;  2R7Z H;  3QIA A;  2DJF C;  1QZG A;  1K3B C;  1SNM A;  2PZT A;  1EYG A;  2Z8L A;  1LT3 D;  3Q24 A;  1UNS A;  1VQD A;  3VR5 A;  2QA4 A;  1DCZ A;  1QUQ B;  2NN6 G;  1SRO A;  4OON A;  5ELB A;  1GXD C;  1HH2 P;  3GTG H;  3SVM A;  3D4W A;  4QIW B;  3VR3 A;  1LAB A;  2GN5 A;  1Q82 C;  1QNU A;  4RGT A;  2O5I C;  3C1F A;  2IT1 A;  3NBI A;  2F0V A;  3A8J E;  4GN3 B;  1NJI C;  1V1P A;  3GTJ B;  4MTN A;  3T1H L;  1T9H A;  5FLX L;  3R2I A;  3M4Q A;  3PGZ A;  5FOB B;  2MPM A;  1KC8 C;  3ND8 A;  4RFB A;  3KF8 B;  2F4I A;  1XYI A;  4DAM A;  4KY5 A;  2IX1 A;  4QUC A;  1SYF A;  1VQI A;  5GQO A;  4GNX B;  1QVG A;  4IOC A;  2BE5 D;  2HCC A;  2UUC L;  2BH8 A;  2MP1 A;  5CC4 A;  2XWJ B;  4XDX A;  1WTH A;  1S5D D;  5C4X H;  2CCZ A;  4JVZ A;  4BBS H;  4BXX H;  2KEN A;  2WV6 D;  3D3R A;  4JC0 A;  4XXE A;  1WI5 A;  5E7N A;  3SK4 A;  1EWH A;  2XWB B;  1JC7 A;  4BXX G;  5IOC A;  2K1B A;  4A93 G;  1PFB A;  2K50 A;  5C4X G;  5EGT A;  3UDG A;  1T5X D;  2E74 C;  3BU2 A;  4A3B G;  1WD1 A;  5ELE A;  1P16 A;  5IYB G;  2NZO A;  5EPJ A;  1XTD A;  1JWS D;  4WJ3 M;  5IY0 A;  3DHQ A;  1PH3 A;  2WAQ B;  3N6R A;  2NVQ B;  4A3G G;  2H4O A;  4UDU C;  4Q0F A;  1S5B D;  1BCP C;  3T51 B;  1S5F D;  1FNV A;  1WTQ A;  1NUC A;  3EJI A;  3W3A A;  2N8N A;  1D1K A;  5BN3 A;  1EQV A;  1BR9 A;  1HUM A;  4PNY A;  4DV0 Q;  4NXN Q;  4C3J B;  3U4V A;  4DKA C;  1B9N A;  3DLL A;  4JI2 L;  3H3V I;  3S1R B;  2CQO A;  3MC0 B;  5C44 H;  1GM5 A;  1GHK A;  5IT9 c;  2Q8R E;  1DZ1 A;  2SOB A;  4RAU C;  4RH6 A;  1S5E D;  1XPU A;  4L8J A;  2I5H A;  3GTQ B;  5IP7 G;  4OWW B;  5JJI A;  1WVL A;  2OT2 A;  3R2T A;  5GRO A;  4BBS G;  1PH8 A;  4G7Z C;  2J7Z A;  2F0M A;  2LY7 A;  5DEH A;  2EYM A;  2JQO A;  1A3V A;  2KA7 A;  3DM1 A;  1ZKO A;  4KD4 A;  4DV4 Q;  4LMQ D;  4IQZ A;  4A3F H;  5M5Y B;  3S1Q B;  4YCV A;  1HPC A;  3CW2 C;  2K5D A;  2F0P A;  1OTC A;  3OSO A;  2MQH A;  2D5D A;  3OMC A;  4IZ8 A;  4KY6 A;  1VQM A;  1GD7 A;  1B44 D;  2WP8 J;  1J8I A;  4K2K A;  4JYA L;  3J81 E;  5JPN C;  4J8Q A;  2A6H D;  1K83 H;  3KOJ A;  1NE3 A;  1IKL A;  1F77 A;  1SBB B;  3CAM A;  5M5X H;  1TXY A;  1NSN S;  4DAV A;  4K8J A;  4QCL A;  3NE5 B;  2ASB A;  3CCE A;  1ZYR D;  4N9T A;  3PV0 A;  4LFC L;  3RR5 A;  3NTI A;  1W2B A;  4B3M L;  4A93 B;  1U4L A;  1E24 A;  4IFD H;  1E7Z A;  4DU9 A;  1KHI A;  2YYZ A;  1XMQ L;  5GAG C;  4Y52 H;  4DR1 Q;  1JB7 A;  3PCO B;  1MJE A;  2JEB I;  2R7Z B;  3CCV A;  3GTM B;  1EFI D;  1YJ9 A;  2LXJ A;  2B2U A;  1CHQ D;  2I46 A;  2NTS A;  3WOE A;  4NXM Q;  1MI2 A;  2JYO A;  5JPM C;  4GS3 A;  4DAY A;  1SNO A;  2KED A;  3CCQ A;  2MO1 A;  3GP7 A;  4I7A A;  2JA6 B;  1FJG L;  3PUW A;  3CQZ H;  5C4X B;  1HR0 W;  4WOR A;  2F3V A;  1IW7 C;  2CVR A;  2KOL A;  3W2D A;  4DGZ A;  1BDO A;  3OW7 A;  1PTO B;  3E3X A;  5C0X J;  2KJX A;  3F2U A;  2D0O A;  1HTL D;  1SFO B;  2MNA A;  1JE4 A;  3PUZ A;  4HMJ A;  4HR7 B;  3EVQ A;  4JI2 Q;  4HIK A;  3UE0 A;  1I4R A;  1KAW A;  4XQQ A;  3K8A A;  3SDZ A;  1GKH A;  2K28 A;  1JE5 A;  1VS0 A;  4B9X A;  2Z6K A;  2HD3 A;  3GTP B;  4GKJ L;  3R8B A;  3G71 A;  4LF9 L;  4C1N K;  4A3C H;  3HFZ B;  1WTP A;  3GO5 A;  1S72 A;  1EY4 A;  1XWE A;  1ET6 A;  1N34 Q;  2V4D A;  5HGQ A;  2F3W A;  4IFD G;  3I56 A;  3AYH B;  1Z9F A;  4A3E H;  1RIP A;  4JI5 Q;  4HIM A;  4F7X A;  4OWT B;  3E9I A;  3D0F A;  4FNF A;  1STA A;  3QWN A;  4X66 L;  3CCM A;  3T1Y Q;  3KDF B;  3K0Y A;  3PUV A;  2UXC Q;  1HNZ Q;  1YEZ A;  4DPG A;  3LX0 A;  4DV2 Q;  1PFM A;  2AQ1 B;  2Q8I B;  5C4Z A;  5LMN W;  1I4P A;  4IUQ A;  3GTQ H;  4KKS A;  3GTL H;  1AP0 A;  1K9M C;  3NTK A;  4TRD A;  2B39 A;  2BOS A;  1VF7 A;  4OIK A;  5IT9 E;  1BOS A;  1SMY D;  4DR1 L;  5JEA H;  1DYQ A;  2F0G A;  4KJO A;  2WAQ G;  1WTR A;  3FHW A;  2MO0 A;  3C3L A;  1UE6 A;  4GOP B;  4RHS A;  2RHQ B;  4NW2 A;  4IUU A;  1DD2 A;  4FXD A;  2P5Z X;  4DK0 A;  1H9S A;  3J80 E;  1B3Q A;  2A74 C;  2BA1 A;  4IUV A;  5AFW A;  1XNQ L;  3M4P A;  3Q6S A;  3HOY G;  4PV1 C;  1B2T A;  2XN9 C;  4WRD A;  1VQP A;  4LFB Q;  2HDL A;  2ZT9 C;  4C1N I;  2Y0S E;  2AWN A;  4LF6 Q;  2R92 G;  2UXB L;  1EWI A;  4G4K A;  1N32 L;  4DR4 L;  4XT3 B;  1D1I A;  4LJZ C;  3T53 B;  5KRU A;  1ZXT A;  1PRT F;  1VQ7 A;  1Q8I A;  5DM7 3;  4KLK A;  5IWA L;  1HFG A;  5E4W C;  2R61 A;  2CH4 W;  4R8N A;  1LT4 D;  1YNJ C;  4L5R C;  3CD6 A;  4J15 A;  2F0F A;  1ICF B;  4Q5V A;  3DWP A;  2VY3 A;  2QEJ C;  1NR2 A;  2Z4H A;  1JOK A;  4ME5 A;  1S4Z A;  4K14 A;  4ZYS A;  4OX9 L;  1HZB A;  4DUY L;  1ET9 A;  2DNE A;  3RLN A;  1DON A;  1PHJ A;  3K6O A;  3GTK H;  4OIJ A;  2F0L A;  1GHJ A;  1RCV D;  1JJC B;  2L12 A;  2VB2 X;  5CMD A;  1V1P B;  5C5L A;  3UDF A;  2ZJP A;  2UXB Q;  3K5O A;  4R1J A;  1HA6 A;  3QOL A;  4JI5 L;  2OTJ A;  3RLF A;  1EU4 A;  1OXT A;  1X54 A;  4X3U A;  4OO1 I;  1TY0 A;  4NP5 A;  1VQL A;  5C5M A;  4JI3 L;  1SMY C;  4IN3 A;  4IUP A;  1N34 L;  4JI1 Q;  3KJO A;  2F0J A;  2B2T A;  5ELC A;  1BO0 A;  3MXG A;  2N88 A;  2L9H A;  4M8A A;  5KIX A;  4A3M B;  4IPC A;  2NVT B;  3MWY W;  4OHJ A;  2L11 A;  3U9O A;  1I94 Q;  3K57 A;  1TS3 A;  4FF2 A;  3I4N G;  3HOZ G;  3L2P A;  2HT1 A;  1D5Z C;  2JEA I;  1SE4 A;  3C2P A;  1EYC A;  1MBY A;  1JMC A;  4CDC C;  3LGJ A;  4HCS A;  3WWV A;  5FO7 B;  4BBR B;  3EIV A;  4BY1 B;  3IKJ A;  1CKO A;  1JOO A;  3KLS X;  1R9T H;  5LMN L;  1I4X A;  2RSN A;  1VQF A;  5CV5 A;  4IFD I;  2NVY B;  3M7G A;  5M5W B;  1ML0 D;  1ILQ A;  3HOY B;  1XXG A;  3RZD B;  2R3Z A;  2M9V A;  1SNQ A;  4Y7N H;  4BY7 B;  3G48 A;  1IKM A;  4ZAI A;  3CRL C;  2NB0 A;  3GTL B;  3K59 A;  3PF4 A;  1N32 Q;  1HTP A;  1KNE A;  4IJH A;  3TP6 A;  4L6T B;  3IFT A;  5FO8 B;  4JYA Q;  3U4Z A;  5K36 G;  1G51 A;  4H02 A;  2TMP A;  3PIO 3;  2EPB A;  2HHH Q;  1XJV A;  4RKL A;  3STB C;  1G2S A;  3GTM H;  5ELN A;  5JJL A;  2KEC A;  1B3A A;  3QB3 A;  1F9Q A;  2WB1 G;  3I4M B;  4QUF A;  3GTG B;  1PTO C;  2FIN B;  3K80 C;  1HQR D;  1RHP A;  3U50 C;  1PVO A;  2AQ2 B;  3DXJ C;  3FDT A;  3LWU A;  1XMQ Q;  4XYO A;  3OTO L;  4PZ6 A;  2JA8 B;  1WOC A;  1A63 A;  5KEE A;  1F9S A;  4POG A;  1GVP A;  1GUG A;  4LK1 C;  1TWA B;  2MFI A;  1UWV A;  2NN6 I;  1LTL A;  1H9M A;  4O2D A;  4B3R L;  3J7A V;  4JBW A;  4E6I A;  2Z4I A;  2F3I A;  3OOC A;  1WCM H;  1Z6H A;  1VQN A;  5IYD G;  4DUY Q;  3CRK C;  1PA6 A;  2G9D A;  1VQA A;  2K5Q A;  1NMF A;  3HKZ G;  5CBE E;  1IBK Q;  2PZU A;  2SNM A;  2PI2 A;  2FHT A;  5EQ0 A;  4C3I H;  5JAV A;  5FJ8 G;  2HIV A;  3Q23 A;  4A3J B;  1R4P B;  3KF6 B;  1X32 A;  3NPP A;  4UP9 A;  1K0R A;  3H09 A;  2VUM B;  4DV0 L;  3E0E A;  3R93 A;  1Q86 C;  2ZM6 Q;  4X65 Q;  4LFA L;  2UUB L;  3EA6 A;  1KXL A;  1B8A A;  4HJ8 A;  4DR7 Q;  4KHP L;  1LTI D;  2Q2I A;  4HSP A;  3DEO A;  5CV4 A;  3J81 c;  1RL2 A;  2AKW B;  5IYC G;  1C4Q A;  3GQB A;  4EGV A;  1WFQ A;  1X3P A;  3B6Y A;  4ODG A;  2XIW A;  3CPW A;  1I94 L;  3CC4 A;  4DNT B;  2F4V L;  3I2Z A;  4JI6 L;  1A62 A;  4A3I B;  1DOM A;  1VQO A;  2E2H B;  4P2C B;  5T1I A;  1HZ9 A;  2ZTC A;  3RN5 A;  1AE3 A;  3S1M B;  5C0X I;  2PPB C;  4A3G B;  2A8V A;  4RKB A;  4XQN A;  3J7A F;  2IPK D;  4Z9C B;  4YHH L;  1VQ5 A;  2CW0 D;  2JP1 A;  4TQU S;  1MSG A;  3J7Z C;  3CMA A;  4B9W A;  2VQF Q;  2UXC L;  1G6Z A;  1L1O C;  4DV2 L;  1BXT A;  4TSS A;  1X65 A;  4RGO S;  1ZEQ X;  2F0Q A;  1HJP A;  3I3C A;  3V96 A;  1LTS D;  1K8M A;  1KQS A;  4AYB B;  1PZI D;  3PIP A;  1YNN C;  1QCB D;  4DV3 L;  1L1O B;  4X3T A;  1QVF A;  2R7F A;  1V1O A;  4PZ8 A;  2XVS A;  3ERQ A;  3PMF A;  3CCJ A;  1TS2 A;  3EQL C;  2NZ1 D;  4A3D B;  2WAQ E;  2EYJ A;  4A3F B;  4R4Q A;  3VR4 A;  4CJ2 C;  3H0G G;  3RNU A;  2HDM A;  1TU2 B;  2QDB A;  2F0I A;  3OW2 A;  1GJX A;  5T1G A;  3QOJ A;  1KLU D;  1B4O A;  2L0C A;  4AIM A;  4DNI A;  1N33 Q;  2PMZ B;  3NXW A;  5D65 A;  2RVL A;  5K36 H;  2JXM B;  3L9A X;  3PUX A;  1NMG A;  4YWM A;  3KLR A;  3V05 A;  4DR6 L;  4UY8 C;  3F2D A;  1CZG A;  3TZU A;  3T56 B;  3I4M H;  4UP8 A;  3OWE B;  1EZ8 A;  4LUZ A;  5ELO A;  1YI2 A;  4B3R Q;  3RN2 A;  3BVG A;  3VYS A;  3A5Z B;  2WIN B;  5J3B A;  1A3U A;  1N9W A;  3KUP A;  3RZD H;  3GDE A;  1M4V A;  2VZA A;  1X55 A;  1I3Q H;  4FF4 A;  3GV6 A;  3CU7 A;  2KCT A;  3ERO A;  2F0W A;  3HZX A;  5KND A;  5KNC A;  5EKI A;  2DN8 A;  3URY A;  1I50 B;  1DOK A;  1V9P A;  3QR8 A;  1U4M A;  1G2T A;  1IYU A;  1XX8 A;  1JQY D;  1O7L A;  3VR2 A;  2ALY B;  1MGS A;  4L63 B;  3L3O C;  3SHL A;  3TDQ A;  1BKB A;  1JIC A;  3KLW A;  1F2Y A;  3MEF A;  4G57 A;  2F0H A;  1B1Z A;  3FKI H;  2C35 B;  1Y14 B;  1PH1 A;  1LLR D;  1X9N A;  4MNO A;  3P20 A;  3M4O H;  2AQ3 B;  1ESF A;  3HOX H;  4HTH A;  4FYD A;  3ICE A;  1Q1B A;  1KRT A;  3JC6 6;  4RCO A;  3BYY B;  2B8G A;  3KF8 A;  2JA8 H;  2CQA A;  4EVO A;  3MXN B;  4MTK A;  1L1O A;  4JI1 L;  3CCU A;  5LMU Q;  1PYW D;  3I8Z A;  3CKI B;  4B3S Q;  2BDN A;  2VQF L;  3GV3 A;  1TS4 A;  1VQE A;  3J80 i;  3LWE A;  3K5L A;  4CKE A;  2GVB A;  2TSS A;  1A15 A;  4DK1 A;  5K5P A;  1Q12 A;  4A93 H;  2JA5 H;  4G7H C;  4JI8 Q;  3PO2 B;  4AQY L;  4IPD A;  1V43 A;  2BE5 C;  1CQF A;  4AYB G;  4ALP A;  3BZC A;  5C0X G;  5JEA J;  3CME A;  3I4N H;  5I2Y A;  4BWG B;  3TME A;  1QVC A;  4APV A;  4PZ7 A;  3NK9 A;  2B2V A;  3CCL A;  5ELF A;  1EY7 A;  2Q2T A;  1FD7 D;  4CJ1 B;  1T5E A;  4OL7 A;  1YIT A;  1N33 L;  2E2H H;  4KHV A;  1YVC A;  3S1M H;  4DR6 Q;  4DK6 C;  2AWO A;  4YY3 L;  2WB1 E;  2F0K A;  4GN5 A;  3NQT A;  3S1N B;  3CC7 A;  5CV8 A;  1QWY A;  3R3O A;  3K5N A;  1RD9 D;  3SK8 A;  2HIX A;  3ERS X;  2HHH L;  2A73 B;  4I7Z C;  4GKK Q;  4V0B A;  3S1Q H;  4K0K L;  3GTP H;  1E3P A;  2N3S A;  4R4O A;  5CV7 A;  2E8G A;  1I6H H;  2OTL A;  4H0L C;  2F0S A;  4CDE C;  1W6J A;  1PLF A;  2D62 A;  4NXM L;  1RF2 D;  4P72 A;  2R92 B;  2LMC B;  1Q81 C;  1K83 B;  3NBH A;  2K03 A;  1Y8O B;  3P75 A;  3F1Z A;  2VUM H;  2E5L Q;  4RWS C;  3A74 A;  1FJG Q;  1H9J A;  5EBD A;  4A3E G;  3M7N A;  4FF3 A;  2NYZ D;  3AQQ A;  1WD0 A;  3FPP A;  1BF4 A;  4LF4 L;  1TKW B;  1ENA A;  1LV9 A;  4P73 A;  4B3S L;  1GO3 E;  4JI0 L;  2IX0 A;  3AB9 A;  4A3B B;  3MFG A;  1Y1V G;  4CDD C;  4JI4 L;  3PIO A;  3HKZ B;  1J6Q A;  1VQ6 A;  1AFP A;  1IZ6 A;  4DV6 L;  2E2I B;  3FKI G;  4UP7 A;  1Q1E A;  2UU9 L;  2A6H C;  3T16 A;  1YJN A;  4OO1 H;  5GAD C;  5BN5 A;  3M4Y A;  2DY7 A;  2VNU D;  4DR7 L;  4KN7 C;  1H9K A;  1IL8 A;  3DWQ A;  2BA0 A;  3OIP A;  1ZYR C;  4K5W A;  4K5X A;  3U9S A;  3HGB A;  2Q2H A;  1Y1W H;  3S16 B;  1CTM A;  4NDX A;  3HP3 A;  1DOL A;  4A3K B;  1HHV A;  4A3L G;  1X6O A;  1LTR D;  2RDG A;  1TWF H;  3SXH A;  4BA2 I;  3SK5 A;  2JA5 B;  1IYV A;  3FKI B;  3ONA B;  1VQ8 A;  5C4J B;  4A3D H;  1Y8P B;  2N49 A;  2KCC A;  2LFN A;  5EBC A;  1F2M A;  5IGC A;  2A1A A;  2SEB D;  1A2T A;  1TWG B;  5L37 A;  4BY1 H;  3D4D A;  2VS1 A;  3K5M A;  1E1O A;  5EAY A;  3F2B A;  3UDI A;  2IW3 A;  4BBR G;  4HN7 A;  1WYD A;  4A76 A;  4GKK L;  2DNC A;  1JOQ A;  4ZUJ A;  1K28 A;  4JK1 C;  2ENB A;  2EYO A;  1IBL Q;  2ID0 A;  4CGY B;  3NEN A;  3BDO A;  4R9W A;  2B8F A;  4AYB E;  4Y7N B;  5I4D A;  1CFM A;  2IHF A;  3RZO H;  3W5O A;  1X56 A;  2Z1C A;  2JA5 G;  1X3Q A;  1E22 A;  1J5E Q;  4O42 A;  4YCU A;  1BUV T;  3RLO A;  1JT8 A;  2VW9 A;  1HA5 A;  2UUC Q;  1NNX A;  4MHE A;  2OQK A;  3OYY A;  5ELD A;  1SNC A;  4DV1 L;  4A3D G;  5CGK A;  2FMM A;  2LS0 1;  2VB3 X;  1YJW A;  2B2Y C;  1CUK A;  1WTX A;  1PH7 A;  4X64 L;  2DY8 A;  4ZK9 B;  2L1B A;  4EQO A;  4DR4 Q;  4CJ0 B;  1L0X B;  2N78 A;  3CC2 A;  3LNN A;  2OQ0 A;  3H3V H;  1KAA A;  2NVT H;  5CBA E;  3BG3 A;  4C3H H;  1P8L A;  1F9P A;  3JAM i;  1PRT B;  5JOB A;  1SE8 A;  2R93 G;  1KRS A;  2PYK A;  2RQX A;  2KHJ A;  1CA6 A;  2MJ8 A;  3NTH A;  1VDZ A;  4LNQ A;  5E1F A;  2ATW A;  5D3I B;  2A69 C;  3F2C A;  1EIG A;  1VQC A;  2EYL A;  1JR0 D;  1OXU A;  5CV6 A;  5TSS A;  2NVY H;  4DN4 M;  1AN8 A;  2R93 H;  4OX9 Q;  1SRU A;  1QUQ A;  1O7Z A;  2IWH A;  1PH6 A;  2AUK A;  3A8I E;  4P75 A;  2SNS A;  4RGN A;  3OWF A;  3C1E A;  3HOW B;  3S1N H;  1D7Q A;  5M3F G;  2K01 A;  4QIW E;  1EY5 A;  2F1M A;  5IP7 H;  2OXP A;  1YZ6 A;  1SN8 A;  2A68 C;  3DUZ A;  2E76 C;  4DF7 A;  4GNX A;  4DV7 L;  2NVQ H;  2EXZ A;  2JA7 G;  4NKL A;  2Z6B A;  4TKO B;  2B2W C;  5EJW A;  4POF A;  3W1B A;  1FVI A;  4QB4 A;  3K0X A;  2BDO A;  3O13 A;  1YIJ A;  2VUM G;  1IYJ B;  2B2V C;  1AEX A;  1TQO A;  1Q90 A;  4GNX C;  2WFW A;  2PI2 E;  4ABN A;  2KHS A;  4JI8 L;  2ICI A;  1OXX K;  1STY A;  2EJF C;  1IBL L;  1AW7 A;  1SXT A;  1SDF A;  4X62 Q;  1XNR Q;  2RCF A;  3AFQ A;  3P7J A;  2VXW A;  2K33 A;  2IHE A;  4HSV A;  5I9P A;  2PQE A;  3NSW A;  3C46 A;  4DR5 Q;  2EJM A;  3D31 A;  1TWA H;  2IY5 B;  1JCK B;  5JEA G;  2F0U A;  1U0L A;  4LF5 L;  1KNA A;  1EWC A;  1VQG A;  4AQY Q;  1BCP B;  1A3T A;  1OXS C;  2CWP A;  1YHQ A;  1TS5 A;  1GUT A;  2PNH A;  1B53 A;  2KCN A;  1EL0 A;  1X3F A;  3ITP A;  1QJO A;  1LTB D;  3HOU B;  1XMO L;  3VA7 A;  3S14 H;  5FLX E;  1CK1 A;  1PDQ A;  5IOD A;  1LAC A;  4A3M G;  1J5E L;  3UI2 A;  1XPR A;  3ER0 A;  2A5H A;  4XQJ A;  1YHA A;  4K2L A;  1Q8K A;  4LUO A;  5COY A;  1EYD A;  4RMF A;  1A2U A;  1CSP A;  3SEB A;  4YY3 Q;  1EQQ A;  3G6E A;  1X3G A;  4BBS B;  5C3W A;  1AE2 A;  5M5W H;  5IGE A;  1RTO A;  1AH9 A;  1K3R A;  1VF5 C;  1KL9 A;  4LF7 L;  2K32 A;  5F2D A;  3T1H Q;  3BJU A;  4BY7 H;  3CHB D;  4IUT A;  2O5J C;  4LWC A;  1L0W A;  1KDB A;  4B3T Q;  2B63 B;  5M3F H;  5IYC H;  3FRP B;  4C3J G;  2F0D A;  3MVV A;  3H15 A;  3E0J A;  4N8X 1;  1PH2 A;  4BY7 G;  4L5Q A;  2K4K A;  1SYG A;  2FJ2 A;  4DR2 L;  1D2B A;  1LUZ A;  2RSO A;  1C0A A;  5AJ3 L;  3MTS A;  3S15 B;  1GUS A;  1I4G A;  1DXM A;  5J22 A;  4DV7 Q;  1FR3 A;  1I4Q A;  1B50 A;  3WOF A;  4DV5 Q;  4CDF C;  2B2W A;  4HJ5 A;  1HNX L;  3M85 A;  4QF4 A;  1GUO A;  4C3H G;  2EE1 A;  3S2H H;  2F03 A;  4EQ5 A;  2UXD Q;  4J1M A;  3BZK A;  2E5L L;  4NMZ A;  1U5K A;  4FXG C;  2EJG C;  4DAP A;  2RBM A;  3CCR A;  2E75 C;  3I4L A;  1NTG A;  5HUR A;  2L15 A;  4JG2 A;  2K5N A;  2JA7 B;  1L2F A;  1IBM L;  2RF4 A;  4AH6 A;  5FK9 C;  5FLX c;  4X65 L;  2V1C C;  5IYB H;  1SND A;  3FEW X;  2NBF A;  2PQA B;  4XTC S;  5BN4 A;  5M3M B;  4KHP Q;  2D0P A;  1F9R A;  1QB5 D;  1B70 B;  4A3K H;  3M4O B;  2MGS A;  4JI0 Q;  1AZP A;  3M9B A;  1QNK A;  3STB D;  4X66 Q;  2ZXO A;  3OPO A;  2UUA Q;  3QJY A;  1C9O A;  2FMC A;  4C3H B;  3T1Y L;  4PG3 A;  2RCN A;  2DUD A;  2J0T D;  1E2W A;  3A54 A;  5IP9 G;  3H0G H;  1VQJ A;  3MFY A;  2E2J B;  4JV5 Q;  3HRZ C;  3A8K E;  5EKL A;  4YHH Q;  2XSC A;  3GTO H;  4DR5 L;  4NXN L;  2QF7 A;  5KYL A;  1TVX A;  4DR3 L;  3NQI A;  5C3E G;  5IGB A;  4GLA C;  3HOV G;  1EY9 A;  5A35 A;  1VQK A;  2DGY A;  2IL8 A;  2A19 A;  3I73 A;  3D8G A;  3I91 A;  2F52 A;  3K7U C;  1C7Y A;  2HQL A;  5EKK A;  3WDN A;  4R4T A;  1JB3 A;  3TP7 A;  5M5X B;  2NZH A;  1K73 C;  1KD1 C;  4OO1 G;  1CKN A;  4L5S A;  4CKC A;  2EOT A;  3K81 C;  4OEM B;  1LT6 D;  1SEB D;  1HXY D;  3IRB A;  1SFO H;  3S17 B;  3PO3 B;  5IP9 H;  2Z0S A;  3F8T A;  1TII D;  2B2Y A;  3TP5 A;  4ID6 A;  1QE6 A;  2XRS D;  4A3I G;  4LFB L;  4K0K Q;  3SR1 A;  1QZH A;  3PSI A;  1S5C D;  1STH A;  3CPF A;  1CQV A;  2DJG C;  2LXK A;  1DM0 B;  2K5V A;  2NUC A;  4A75 A;  3EBE A;  4LFC Q;  2JJQ A;  3MA2 B;  5KYI A;  2RDH A;  3PIP 3;  2F0N A;  1ENF A;  4JW0 A;  3DM3 A;  3HG9 A;  1EU3 A;  3AFP A;  2KBN A;  5D14 A;  4DV5 L;  4B3T L;  1IL2 A;  3CQZ B;  3H6M A;  1GUN A;  1FNU A;  1U4P A;  1LT5 D;  1STN A;  2O2L D;  5IGG A;  2J4X A;  4GLV B;  3J81 j;  2QEX A;  1LM0 A;  1TWH H;  3KBG A;  1O80 A;  3CP0 A;  2JA8 G;  1N8R C;  1MKH A;  4LUV A;  1CM9 A;  3A0J A;  2EYH A;  3U58 A;  1WTW A;  3T13 A;  4WJW A;  5G3L F;  3M3Y H;  5JJK A;  3A7L A;  4H7B A;  5FJ8 H;  1WTO A;  3HOW H;  1BBW A;  1JJG A;  3SK6 A;  4DUZ L;  1M8A A;  3S14 B;  1A6X A;  1O7I A;  5FKA C;  4A3F G;  1PXU A;  4PQX A;  1FYC A;  4DV6 Q;  3BDL A;  3W1G A;  4IFD J;  4RGM A;  1SJE D;  2JN4 A;  4UHV A;  5IGD A;  4MZ9 A;  5KGU A;  3MXU A;  5NUC A;  5IIF A;  2PZW A;  1K8O A;  1EY6 A;  2KVM A;  2JA9 A;  1V8Q A;  4PMW A;  4LF9 Q;  4QGU A;  2YU9 B;  1BBX C;  1CKN B;  5IGF A;  4KTA A;  2M2L A;  2QDL A;  5IE8 A;  4RG1 A;  2JE6 I;  4C2M H;  4UAI A;  4KY7 A;  2O4X A;  1MHW C;  5M3M H;  1STE A;  1R4Q B;  2AUJ D;  2K52 A;  1O78 A;  4A3M H;  1X3E A;  1EUJ A;  2EXD A;  1WJJ A;  2Y0S B;  1D6E C;  1PTO F;  2K75 A;  1UEB A;  4PMB A;  4X6A H;  2R7D A;  1AZQ A;  4RA8 A;  4DR3 Q;  3N52 A;  3BYT B;  1TWC B;  2FFK B;  1II3 A;  3E9H A;  1EQT A;  1ROD A;  1CKM A;  4KHZ A;  4X62 L;  1XNR L;  1PYB A;  3JAM c;  1HNW L;  2NVX B;  3S2H B;  2RDF A;  4JOI A;  5IT9 L;  3KJP A;  3A7A B;  4BY1 G;  3JAM L;  2MHV A;  1VQB A;  2CHB D;  3SGI A;  1EEF D;  2XRQ D;  2R6G A;  1D5X C;  2E2D C;  4EX5 A;  1PTO D;  4M1U B;  3TEH B;  2R92 H;  4LF8 Q;  4O0A A;  1TWF B;  4BS9 A;  4ZRZ A;  5JVG 3;  3VYT A;  2ZXP A;  1CSQ A;  1A0I A;  5EPK A;  4FVM A;  1QOH A;  3TRZ A;  1SYD A;  1BQQ T;  5GAH C;  1XNQ Q;  3HOX G;  3PO2 H;  1EOT A;  3OTO Q;  3TRE A;  4LAA A;  2LSS A;  3H0G B;  5BR8 Q;  2JK8 A;  4KJN A;  1XMO Q;  2E2J H;  2YTY A;  1RDP D;  1UE7 A;  3J81 L;  2NN6 H;  5DLQ E;  1PH9 A;  2GVA A;  5LHY 1;  3PO2 G;  1HZA A;  3UE1 A;  4LF7 Q;  1IBK L;  2EY5 A;  2E2I H;  1B9M A;  4H13 C;  1SYB A;  3DMU A;  4IJL A;  1QIL A;  2I07 B;  1FGB D;  3I55 A;  3ULJ A;  1JJ2 A;  1MJC A;  1PFN A;  4FO2 A;  4O1N A;  2JSO A;  2UUB Q;  5LL6 S;  4DR2 Q;  1SLJ A;  4I65 A;  5AJ3 Q;  1E2V A;  3HEJ A;  2WKC A;  2CKZ B;  5G3L D;  3S24 A;  4EQP A;  5HY6 A;  1NR4 A;  1ASY A;  4L5T A;  2I5L X;  1YNJ D;  3JAM E;  2NWG A;  4ZKC B;  3FVQ A;  2B2U C;  3TP8 A;  2LKV A;  3D6W A;  4WJ4 A;  4PMC A;  2B63 G;  4P74 A;  1PRT D;  3NWT A;  1G29 1;  5A2Q E;  1S40 A;  2ZJR A;  5H1S E;  4ME3 A;  3DEP A; 
#chains in the Genus database with same CATH homology
 1OXV A;  3HS0 C;  3H3V C;  2PCF B;  2GA4 B;  1E2Z A;  2QKI C;  3X3M A;  4CBV A;  3DWA A;  5C6A A;  1JWU D;  1LTT D;  3BDC A;  4HED A;  3AU7 A;  4OGQ C;  4ZQ3 A;  1LTA D;  3GTO B;  2HUG A;  1IW7 D;  5COR A;  4FF1 A;  5I6Y A;  2NTT A;  4XIG S;  1WCM B;  1YNN D;  4F8M A;  1TY2 A;  2KUM A;  1EZ6 A;  3BVZ A;  5CV9 A;  1CA5 A;  4DXF A;  1MD2 D;  3A56 A;  1SE2 A;  2F0O A;  4WFN 3;  1F2Z A;  5I9O A;  1L0Y B;  3RD4 A;  2L55 A;  3QO2 A;  4F87 A;  1FNW A;  4RCN A;  1I6V C;  1HCZ A;  3A55 A;  2RKS A;  1U4R A;  1Y69 U;  3TZD A;  2X6L A;  1XTC D;  4HAE A;  1LO5 D;  3TBI B;  3J80 L;  1O7Y A;  1GUW A;  1E0B A;  2QCP X;  3H91 A;  4ZUI A;  2IX3 A;  1VMC A;  1CHP D;  4KV6 A;  1H9R A;  4XT1 B;  1UEA B;  4ILW A;  5ISR A;  3V2T A;  2EY1 A;  3KBX A;  4FXK C;  4K5V A;  4KD3 A;  2SDF A;  3IAY A;  1KDC A;  1VCI A;  3BVM A;  3M3Y B;  2HCI A;  1HQM C;  2XNA C;  3NP8 A;  2B2T C;  3OMG A;  1MSH A;  3OHX C;  3VYU A;  2C5C A;  1PMR A;  4YIJ A;  3I70 A;  1KLG D;  4KKT A;  1RJT A;  1SAP A;  1EY8 A;  4S3S A;  3MHB A;  2RA4 A;  3D6C A;  3ND9 A;  5J39 A;  3L7Z C;  1W6K A;  1SJH D;  2D2C C;  2WII B;  4IUR A;  5M9O A;  3RZO B;  3MEH A;  1OO9 B;  3E6Z X;  3BS1 A;  3RUZ A;  5M3F B;  1H9S B;  3PUY A;  1GOZ A;  1J9O A;  1JOR A;  5DNF A;  2KQ3 A;  3D4R A;  1PZK D;  1NCV A;  4ZKB B;  4C3I G;  3G6J B;  4DNR B;  4IAL A;  3VA5 A;  2EY6 A;  3G7L A;  1JWM D;  1BNZ A;  4IUN A;  4KN4 C;  1C8C A;  3E5S A;  1PTO H;  1SYC A;  3H94 A;  1Z47 A;  2PW7 A;  3MZ5 A;  5KNB A;  2R93 B;  1QG7 A;  1Q3L A;  4ZLT F;  4U67 3;  2CW0 C;  3RMH A;  2OF1 A;  3SE0 A;  2D9U A;  1STB A;  3KK7 A;  5E3F A;  2K5W A;  3T4A C;  3K58 A;  3EFX D;  2WAC A;  2F0T A;  3MXN A;  3MXP A;  1ESR A;  4X3K A;  5I6W A;  1CT1 D;  1KTK A;  1RKN A;  3ZYY X;  4A3E B;  1F2L A;  1KAB A;  3TN2 A;  1D5M C;  3OIQ A;  2EY2 A;  3HOX B;  5LL6 X;  4FP5 D;  2C9O A;  1I3Q B;  4BA1 I;  1ONL A;  2BCO A;  3Q0A A;  1IHZ A;  2A6E D;  4DXG A;  5A2Q L;  4EQN A;  2MUY A;  3I4N B;  3K7A B;  2K04 A;  4U68 A;  1PRT C;  2X6G A;  2PO4 A;  1EEI D;  3FMC A;  5CR3 A;  1I6H B;  4MN3 A;  1SE3 A;  3GD7 A;  4KI0 A;  2G9H D;  2X69 A;  4V19 0;  2QIL A;  1HRJ A;  3KLS A;  3IL8 A;  4N9P A;  3IFD A;  2L5T A;  3NHH A;  3BZD B;  5FO9 B;  1PZJ D;  5C4H A;  4B08 A;  1UUP A;  4RHR A;  3TSS A;  5C3E B;  3QG1 A;  3FPU B;  1U9R A;  3S2D B;  1Y8N B;  1TR5 A;  1BCP D;  2F0E A;  4CHT B;  1Y1V B;  2K6A A;  2ZXR A;  2EYP A;  1EIH A;  2EYF A;  2PNR C;  2IJ0 A;  1UAP A;  3NWS A;  3GTK B;  4XYQ A;  2WKD A;  3HOV B;  3NUC A;  3P1H A;  2OEO A;  1G91 A;  1CI3 M;  4DFA A;  2A6E C;  4ULL A;  4K8I A;  2K05 A;  1ICW A;  1SSO A;  3Q22 A;  5JJZ A;  1CZW A;  1KDA A;  5EPL A;  3HOZ B;  4KMU C;  3X3N A;  5CYU A;  2EVB A;  1EY0 A;  1EYA A;  5HGT A;  4C3I B;  3MAQ A;  1SNP A;  1SYE A;  4HMI A;  1HFN A;  4GZY C;  1Z7T A;  1HUN A;  3J7Y W;  4J6H A;  5J1Z A;  2K7V A;  1TT2 A;  4H44 C;  1DJR D;  2H1E A;  1ILP A;  4K6L A;  1LTG D;  2KEE A;  4C56 C;  2Q8T A;  2A69 D;  3S9W A;  1RTN A;  3VR6 A;  4DA2 A;  2M00 A;  4C2M B;  5C44 B;  1VMP A;  1Y1W B;  2WB1 B;  1G8Z D;  2A68 D;  4HCE A;  5I2X A;  4R8I A;  1I4H A;  1STG A;  1NAP A;  4X3S A;  1WTV A;  5C3X A;  4KKU A;  5DAU A;  5E4X A;  5C0X H;  4QMG A;  1ENC A;  3I72 A;  4CKB A;  1BCP F;  2N55 A;  2PW5 A;  4G7O C;  1TWH B;  1R9T B;  2EZV A;  2ICE C;  2EDG A;  4KK7 A;  5DM6 3;  2L4N A;  1C48 A;  4F88 A;  3AMU A;  5JVH 3;  4K6D A;  2HQE A;  3I90 A;  4MIU A;  5D3D A;  3VYR A;  3QIA A;  1SNM A;  2PZT A;  2Z8L A;  1LT3 D;  3Q24 A;  1UNS A;  3VR5 A;  1DCZ A;  2NN6 G;  5ELB A;  1GXD C;  3SVM A;  3D4W A;  4QIW B;  3VR3 A;  1LAB A;  1QNU A;  4RGT A;  2O5I C;  3C1F A;  2IT1 A;  3NBI A;  2F0V A;  3A8J E;  1V1P A;  3GTJ B;  5FLX L;  3R2I A;  5FOB B;  2MPM A;  3ND8 A;  4RFB A;  2F4I A;  1XYI A;  4KY5 A;  2IX1 A;  4QUC A;  1SYF A;  2BE5 D;  2HCC A;  2MP1 A;  5CC4 A;  2XWJ B;  4XDX A;  1S5D D;  2WV6 D;  3D3R A;  4XXE A;  3SK4 A;  1EWH A;  2XWB B;  1JC7 A;  5IOC A;  2K1B A;  1PFB A;  5EGT A;  1T5X D;  2E74 C;  1WD1 A;  5ELE A;  5EPJ A;  1JWS D;  3DHQ A;  2WAQ B;  3N6R A;  2NVQ B;  2H4O A;  4UDU C;  4Q0F A;  1S5B D;  1BCP C;  3T51 B;  1S5F D;  1FNV A;  1WTQ A;  1NUC A;  3EJI A;  3W3A A;  1D1K A;  5BN3 A;  1EQV A;  1BR9 A;  1HUM A;  4PNY A;  4C3J B;  1B9N A;  3S1R B;  3MC0 B;  1GHK A;  2Q8R E;  1DZ1 A;  2SOB A;  4RAU C;  4RH6 A;  1S5E D;  3GTQ B;  4L8J A;  1WVL A;  2OT2 A;  3R2T A;  4G7Z C;  2J7Z A;  2F0M A;  2LY7 A;  5DEH A;  2EYM A;  1A3V A;  2KA7 A;  3DM1 A;  1ZKO A;  4KD4 A;  4LMQ D;  4IQZ A;  5M5Y B;  3S1Q B;  1HPC A;  2K5D A;  2F0P A;  3OSO A;  2D5D A;  3OMC A;  4IZ8 A;  4KY6 A;  1B44 D;  2WP8 J;  1J8I A;  4K2K A;  3J81 E;  5JPN C;  4J8Q A;  2A6H D;  1IKL A;  1F77 A;  1SBB B;  4DAV A;  1NSN S;  4K8J A;  4QCL A;  3NE5 B;  1ZYR D;  4N9T A;  3PV0 A;  3NTI A;  4A93 B;  1U4L A;  4IFD H;  4DU9 A;  2YYZ A;  2JEB I;  2R7Z B;  3GTM B;  1EFI D;  2B2U A;  1CHQ D;  2I46 A;  2NTS A;  3WOE A;  1MI2 A;  2JYO A;  5JPM C;  4DAY A;  1SNO A;  2KED A;  3GP7 A;  2JA6 B;  3PUW A;  5C4X B;  4WOR A;  2F3V A;  1IW7 C;  2CVR A;  2KOL A;  3W2D A;  4DGZ A;  1BDO A;  3OW7 A;  1PTO B;  5C0X J;  2KJX A;  3F2U A;  1HTL D;  1SFO B;  1JE4 A;  3PUZ A;  4HMJ A;  4HR7 B;  3EVQ A;  1I4R A;  4XQQ A;  3SDZ A;  2K28 A;  4B9X A;  3GTP B;  3R8B A;  4C1N K;  1WTP A;  3GO5 A;  1EY4 A;  1XWE A;  1ET6 A;  2V4D A;  2F3W A;  4IFD G;  4F7X A;  4FNF A;  1STA A;  3QWN A;  3K0Y A;  3PUV A;  3LX0 A;  1PFM A;  2AQ1 B;  2Q8I B;  5C4Z A;  1I4P A;  4IUQ A;  4KKS A;  1AP0 A;  3NTK A;  4TRD A;  2B39 A;  2BOS A;  1VF7 A;  4OIK A;  5IT9 E;  1BOS A;  1SMY D;  5JEA H;  1DYQ A;  2F0G A;  4KJO A;  1WTR A;  3C3L A;  4RHS A;  4NW2 A;  4IUU A;  1DD2 A;  4FXD A;  4DK0 A;  1H9S A;  3J80 E;  2A74 C;  2BA1 A;  4IUV A;  5AFW A;  3Q6S A;  4PV1 C;  1B2T A;  2XN9 C;  4WRD A;  2HDL A;  2ZT9 C;  4C1N I;  2AWN A;  4G4K A;  4XT3 B;  1D1I A;  4LJZ C;  3T53 B;  5KRU A;  1ZXT A;  1PRT F;  1Q8I A;  5DM7 3;  1HFG A;  5E4W C;  2R61 A;  4R8N A;  1LT4 D;  1YNJ C;  2F0F A;  4Q5V A;  3DWP A;  2QEJ C;  1NR2 A;  2Z4H A;  1JOK A;  4ME5 A;  1S4Z A;  4K14 A;  4ZYS A;  1ET9 A;  2DNE A;  1DON A;  3K6O A;  4OIJ A;  2F0L A;  1GHJ A;  1RCV D;  5CMD A;  2L12 A;  2VB2 X;  1V1P B;  5C5L A;  3K5O A;  1HA6 A;  3QOL A;  3RLF A;  1EU4 A;  1OXT A;  4X3U A;  4OO1 I;  1TY0 A;  4NP5 A;  5C5M A;  1SMY C;  4IN3 A;  4IUP A;  2F0J A;  2B2T A;  5ELC A;  1BO0 A;  3MXG A;  2N88 A;  2L9H A;  4M8A A;  5KIX A;  4A3M B;  2NVT B;  3MWY W;  4OHJ A;  2L11 A;  3U9O A;  3K57 A;  1TS3 A;  4FF2 A;  1D5Z C;  2JEA I;  1SE4 A;  3C2P A;  1EYC A;  1MBY A;  4HCS A;  5FO7 B;  4BBR B;  4BY1 B;  3IKJ A;  1JOO A;  3KLS X;  1I4X A;  2RSN A;  5CV5 A;  4IFD I;  2NVY B;  3M7G A;  5M5W B;  1ML0 D;  1ILQ A;  3HOY B;  1XXG A;  3RZD B;  2R3Z A;  2M9V A;  1SNQ A;  4BY7 B;  1IKM A;  4ZAI A;  3CRL C;  2NB0 A;  3GTL B;  3K59 A;  1HTP A;  1KNE A;  3TP6 A;  4L6T B;  3IFT A;  5FO8 B;  5K36 G;  2TMP A;  3PIO 3;  2EPB A;  4RKL A;  1G2S A;  2KEC A;  1B3A A;  3QB3 A;  1F9Q A;  3I4M B;  4QUF A;  3GTG B;  1PTO C;  2FIN B;  1HQR D;  1RHP A;  2AQ2 B;  3DXJ C;  3FDT A;  3LWU A;  4XYO A;  2JA8 B;  5KEE A;  1F9S A;  1GUG A;  4LK1 C;  1TWA B;  2NN6 I;  1H9M A;  3J7A V;  4JBW A;  4E6I A;  2Z4I A;  3OOC A;  1Z6H A;  3CRK C;  2G9D A;  2K5Q A;  5CBE E;  2PZU A;  2SNM A;  2FHT A;  5EQ0 A;  5JAV A;  3Q23 A;  4A3J B;  1R4P B;  1X32 A;  3NPP A;  3H09 A;  2VUM B;  3R93 A;  3EA6 A;  1LTI D;  4HSP A;  3DEO A;  5CV4 A;  1C4Q A;  3GQB A;  4EGV A;  1X3P A;  4ODG A;  2XIW A;  4DNT B;  4A3I B;  1DOM A;  2E2H B;  4P2C B;  5T1I A;  3S1M B;  5C0X I;  2PPB C;  4A3G B;  4RKB A;  4XQN A;  3J7A F;  2IPK D;  4Z9C B;  2CW0 D;  2JP1 A;  4TQU S;  1MSG A;  1G6Z A;  4B9W A;  1BXT A;  4TSS A;  4RGO S;  1ZEQ X;  2F0Q A;  3I3C A;  3V96 A;  1LTS D;  1K8M A;  4AYB B;  1PZI D;  1YNN C;  1QCB D;  4X3T A;  1V1O A;  2XVS A;  3ERQ A;  3PMF A;  1TS2 A;  3EQL C;  2NZ1 D;  4A3D B;  2EYJ A;  4A3F B;  3VR4 A;  4CJ2 C;  2HDM A;  1TU2 B;  2QDB A;  2F0I A;  1GJX A;  5T1G A;  3QOJ A;  1KLU D;  1B4O A;  2L0C A;  2PMZ B;  3NXW A;  5D65 A;  2RVL A;  5K36 H;  2JXM B;  3L9A X;  3PUX A;  3KLR A;  3V05 A;  1CZG A;  3TZU A;  3T56 B;  3OWE B;  1EZ8 A;  3BVG A;  3VYS A;  2WIN B;  1A3U A;  3KUP A;  1M4V A;  4FF4 A;  3GV6 A;  3CU7 A;  3ERO A;  2F0W A;  3HZX A;  5KND A;  5KNC A;  5EKI A;  2DN8 A;  3URY A;  1I50 B;  1DOK A;  1U4M A;  1G2T A;  1IYU A;  1XX8 A;  1JQY D;  1O7L A;  3VR2 A;  1MGS A;  4L63 B;  3L3O C;  3SHL A;  3TDQ A;  1JIC A;  1F2Y A;  4G57 A;  2F0H A;  1B1Z A;  1LLR D;  3P20 A;  2AQ3 B;  1ESF A;  4FYD A;  4HTH A;  1Q1B A;  4RCO A;  3BYY B;  2B8G A;  3KF8 A;  2CQA A;  4EVO A;  1PYW D;  3I8Z A;  3CKI B;  2BDN A;  3GV3 A;  1TS4 A;  3LWE A;  3K5L A;  4CKE A;  2TSS A;  1A15 A;  4DK1 A;  5K5P A;  1Q12 A;  4G7H C;  3PO2 B;  1V43 A;  2BE5 C;  1CQF A;  5C0X G;  5JEA J;  5I2Y A;  4BWG B;  3TME A;  3NK9 A;  2B2V A;  5ELF A;  1EY7 A;  1FD7 D;  4CJ1 B;  1T5E A;  4OL7 A;  4KHV A;  2AWO A;  2F0K A;  3NQT A;  3S1N B;  5CV8 A;  1QWY A;  3R3O A;  3K5N A;  1RD9 D;  3SK8 A;  2A73 B;  4I7Z C;  4V0B A;  5CV7 A;  4H0L C;  2F0S A;  1W6J A;  1PLF A;  2D62 A;  1RF2 D;  2R92 B;  2LMC B;  1K83 B;  3NBH A;  2K03 A;  1Y8O B;  3P75 A;  4RWS C;  1H9J A;  5EBD A;  3M7N A;  4FF3 A;  2NYZ D;  1WD0 A;  3FPP A;  1BF4 A;  1TKW B;  1ENA A;  1LV9 A;  2IX0 A;  3AB9 A;  4A3B B;  3MFG A;  3HKZ B;  1AFP A;  2E2I B;  1Q1E A;  2A6H C;  3T16 A;  4OO1 H;  5BN5 A;  3M4Y A;  2DY7 A;  2VNU D;  4KN7 C;  1H9K A;  1IL8 A;  3DWQ A;  2BA0 A;  3OIP A;  1ZYR C;  4K5W A;  4K5X A;  3U9S A;  3HGB A;  3S16 B;  1CTM A;  4NDX A;  3HP3 A;  1DOL A;  4A3K B;  1HHV A;  1LTR D;  2RDG A;  4BA2 I;  3SXH A;  3SK5 A;  2JA5 B;  1IYV A;  3FKI B;  3ONA B;  5C4J B;  1Y8P B;  2KCC A;  2LFN A;  5EBC A;  1F2M A;  5IGC A;  2SEB D;  1A2T A;  1TWG B;  3D4D A;  3K5M A;  2IW3 A;  4HN7 A;  2DNC A;  1JOQ A;  4ZUJ A;  4JK1 C;  2ENB A;  2EYO A;  2ID0 A;  4CGY B;  3BDO A;  4R9W A;  2B8F A;  4Y7N B;  5I4D A;  1CFM A;  2Z1C A;  1X3Q A;  4O42 A;  1BUV T;  1HA5 A;  4MHE A;  5ELD A;  1SNC A;  5CGK A;  2FMM A;  2LS0 1;  2VB3 X;  2B2Y C;  1WTX A;  2DY8 A;  4ZK9 B;  2L1B A;  4EQO A;  4CJ0 B;  1L0X B;  3LNN A;  1KAA A;  5CBA E;  3BG3 A;  1F9P A;  1PRT B;  5JOB A;  2PYK A;  2RQX A;  1CA6 A;  2MJ8 A;  3NTH A;  1VDZ A;  5E1F A;  5D3I B;  2A69 C;  1EIG A;  2EYL A;  1JR0 D;  1OXU A;  5CV6 A;  5TSS A;  4DN4 M;  1AN8 A;  2IWH A;  1O7Z A;  2AUK A;  3A8I E;  2SNS A;  4RGN A;  3OWF A;  3C1E A;  3HOW B;  2K01 A;  1EY5 A;  2F1M A;  2OXP A;  2A68 C;  3DUZ A;  2E76 C;  4DF7 A;  2EXZ A;  4NKL A;  4TKO B;  2B2W C;  5EJW A;  4QB4 A;  2BDO A;  3O13 A;  2B2V C;  1AEX A;  1TQO A;  1Q90 A;  4ABN A;  2KHS A;  2ICI A;  1OXX K;  1STY A;  2EJF C;  1AW7 A;  1SXT A;  1SDF A;  3P7J A;  2VXW A;  2K33 A;  4HSV A;  5I9P A;  2PQE A;  3NSW A;  3C46 A;  2EJM A;  3D31 A;  1JCK B;  5JEA G;  2F0U A;  1KNA A;  1EWC A;  1BCP B;  1A3T A;  1OXS C;  1TS5 A;  1GUT A;  1B53 A;  2KCN A;  1EL0 A;  3ITP A;  1QJO A;  1LTB D;  3HOU B;  3VA7 A;  5FLX E;  1CK1 A;  1PDQ A;  5IOD A;  1LAC A;  3UI2 A;  2A5H A;  4XQJ A;  4K2L A;  5COY A;  1EYD A;  1A2U A;  3SEB A;  4BBS B;  5C3W A;  5IGE A;  1RTO A;  1VF5 C;  2K32 A;  5F2D A;  3CHB D;  4IUT A;  2O5J C;  1KDB A;  2B63 B;  3FRP B;  4C3J G;  2F0D A;  3MVV A;  3E0J A;  1SYG A;  2FJ2 A;  1D2B A;  2RSO A;  3MTS A;  3S15 B;  1GUS A;  1I4G A;  1DXM A;  5J22 A;  1FR3 A;  1I4Q A;  1B50 A;  3WOF A;  2B2W A;  3M85 A;  4QF4 A;  1GUO A;  4C3H G;  2EE1 A;  2F03 A;  4J1M A;  4NMZ A;  4FXG C;  2EJG C;  4DAP A;  2RBM A;  2E75 C;  3I4L A;  5HUR A;  2JA7 B;  5FK9 C;  1SND A;  3FEW X;  2NBF A;  4XTC S;  5BN4 A;  5M3M B;  1F9R A;  1QB5 D;  3M4O B;  2MGS A;  1AZP A;  1QNK A;  2ZXO A;  3OPO A;  3QJY A;  2FMC A;  4C3H B;  2J0T D;  1E2W A;  3A54 A;  3MFY A;  2E2J B;  3HRZ C;  3A8K E;  5EKL A;  2XSC A;  2QF7 A;  5KYL A;  1TVX A;  3NQI A;  5IGB A;  1EY9 A;  5A35 A;  2IL8 A;  3I73 A;  3D8G A;  3I91 A;  5EKK A;  3WDN A;  1JB3 A;  3TP7 A;  5M5X B;  4OO1 G;  4CKC A;  2EOT A;  1LT6 D;  1SEB D;  1HXY D;  3S17 B;  3PO3 B;  1TII D;  2B2Y A;  3TP5 A;  4ID6 A;  1QE6 A;  2XRS D;  3SR1 A;  1S5C D;  1STH A;  1CQV A;  1DM0 B;  2NUC A;  3MA2 B;  5KYI A;  2RDH A;  3PIP 3;  2F0N A;  1ENF A;  3HG9 A;  1EU3 A;  5D14 A;  3CQZ B;  3H6M A;  1GUN A;  1FNU A;  1U4P A;  1LT5 D;  1STN A;  2O2L D;  5IGG A;  2J4X A;  3KBG A;  1O80 A;  1CM9 A;  2EYH A;  1WTW A;  3T13 A;  4WJW A;  5G3L F;  3A7L A;  4H7B A;  1WTO A;  3SK6 A;  1M8A A;  3S14 B;  1A6X A;  5FKA C;  1PXU A;  4PQX A;  1FYC A;  3BDL A;  4IFD J;  4RGM A;  1SJE D;  5IGD A;  5KGU A;  5NUC A;  3MXU A;  5IIF A;  2PZW A;  1K8O A;  1EY6 A;  2KVM A;  1V8Q A;  4PMW A;  2YU9 B;  1BBX C;  5IGF A;  4KTA A;  2M2L A;  2JE6 I;  4UAI A;  4KY7 A;  2O4X A;  1STE A;  1R4Q B;  2AUJ D;  1O78 A;  2Y0S B;  1D6E C;  1PTO F;  4PMB A;  1AZQ A;  4RA8 A;  3N52 A;  3BYT B;  1TWC B;  2FFK B;  1II3 A;  1EQT A;  1ROD A;  4KHZ A;  2NVX B;  3S2H B;  2RDF A;  5IT9 L;  3A7A B;  3JAM L;  2MHV A;  2CHB D;  1EEF D;  2XRQ D;  2R6G A;  1D5X C;  2E2D C;  1PTO D;  4M1U B;  1TWF B;  4BS9 A;  4ZRZ A;  5JVG 3;  3VYT A;  2ZXP A;  5EPK A;  4FVM A;  1QOH A;  1SYD A;  1BQQ T;  1EOT A;  4LAA A;  3H0G B;  4KJN A;  1RDP D;  3J81 L;  2NN6 H;  5LHY 1;  2EY5 A;  1B9M A;  4H13 C;  1SYB A;  3DMU A;  1QIL A;  2I07 B;  1FGB D;  1PFN A;  4FO2 A;  4O1N A;  2JSO A;  5LL6 S;  4I65 A;  1E2V A;  3HEJ A;  2WKC A;  5G3L D;  4EQP A;  1NR4 A;  1YNJ D;  3JAM E;  2NWG A;  4ZKC B;  3FVQ A;  2B2U C;  3TP8 A;  2LKV A;  3D6W A;  4PMC A;  1PRT D;  3NWT A;  1G29 1;  5A2Q E;  3DEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...