5F2DA

Crystal structure of staphylococcal nuclease variant delta+phs i92n/v99t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYNYADGKMTNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92N/V99T at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5f2dA00
2EYLA 3MZ5A 2O4XA 3P1HA 4K6DA 4DF7A 5I6WA 1EQVA 2OEOA 4PMBA 1KDBA 5IGDA 2F0WA 2F0SA 2EYHA 4KY7A 5KYLA 2EYFA 1SNPA 2F3WA 2KHSA 3OMGA 4KY6A 3EJIA 5EKKA 4ZUIA 4PNYA 3NK9A 4ZQ3A 1A2TA 4HMJA 5IGFA 4NDXA 1A3VA 2ENBA 3SK4A 5J39A 5ISRA 5IGGA 1EY6A 4K8JA 3P75A 4EQNA 2F0LA 1STBA 2F0MA 5C6AA 1SNDA 4DU9A 2PQEA 2F0NA 3S9WA 1AEXA 1EY0A 5J22A 1EYCA 2F0PA 5JAVA 2RDFA 4IZ8A 5KRUA 5M9OA 2SNMA 4I65A 1SYCA 1TT2A 1KAAA 2EY1A 4IALA 3SK8A 3NP8A 3VA5A 5KGUA 4TRDA 2EY5A 5CGKA 4K8IA 1JOQA 1EY8A 4KJOA 1STNA 1SYGA 1KDAA 5J1ZA 5C5LA 1A3TA 3D8GA 1IHZA 2PZWA 1KABA 3H6MA 3RUZA 2RBMA 4K14A 2PW5A 4R8NA 2F0FA 4HMIA 1EYAA 3TP7A 2F0HA 4IUNA 3QOLA 3SXHA 4QMGA 4N9TA 5I6YA 2M00A 2QDBA 2F0QA 4ODGA 1SNMA 1A2UA 5KYIA 3OMCA 4ME5A 2PZTA 1STHA 3MHBA 5CV5A 4ZUJA 4EQOA 3LX0A 2OF1A 2WACA 2SOBA 5F2DA 1STGA 3U9OA 3HEJA 3DMUA 3R3OA 5K5PA 4DGZA 3BDLA 2KQ3A 4F8MA 5EGTA 5IIFA 5C4HA 1F2YA 2EYPA 2F3VA 3HZXA 4J6HA 4KJNA 5IGEA 4K2LA 5IGCA 5IODA 1JOOA 2EY2A 5HURA 4S3SA 4EVOA 3NQTA 4WORA 4HTHA 1KDCA 2PZUA 2EYOA 2SNSA 4MIUA 5I9PA 4KV6A 5C4ZA 5HGTA 5C5MA 4WRDA 3QOJA 4DFAA 5JOBA 1TR5A 1U9RA 3DHQA 3ITPA 1JOKA 3T16A 3TP8A 5IOCA 2F0OA 3TP6A 4EQPA 1SYEA 5IGBA 3NHHA 3OSOA 4N9PA 3MXPA 4K5WA 4OL7A 5CV7A 1EY7A 1F2ZA 4YIJA 4B9XA 3D4WA 4RKLA 4B9WA 5EKLA 3V2TA 3NXWA 3OWFA 5CV6A 1EY5A 2F0DA 1EYDA 5E1FA 4F7XA 1SNQA 2NUCA 2EY6A 4LAAA 3EROA 5CR3A 1EZ8A 1SYFA 4H7BA 4ID6A 1ENCA 2F0VA 3PMFA 5CV8A 3SK5A 5KIXA 3D6CA 4K2KA 5DEHA 4NKLA 1EZ6A 4KTAA 3TP5A 2RKSA 4NP5A 5C3XA 2F0JA 3QB3A 2PW7A 4KD3A 5CC4A 5DAUA 1SYDA 3SK6A 2EYMA 4E6IA 3TMEA 3NUCA 2F0GA 2EYJA 1JORA 5I9OA 1NSNS 1STYA 3MEHA 2HQEA 4J1MA 4KY5A 3C1EA 4PMCA 5E3FA 4QF4A 3E5SA 3D4DA 2PYKA 3C1FA 5KEEA 1RKNA 3T13A 1TQOA 1EY4A 2LKVA 4KD4A 3BDCA 4QB4A 1ENAA 1SNOA 2OXPA 5CV9A 1A3UA 3EVQA 1EY9A 4G57A 4KHVA 1II3A 1STAA 3SR1A 3SHLA 5C3WA 2F0EA 2F0IA 5NUCA 1F2MA 1NUCA 4NMZA 4K5VA 2EXZA 5CV4A 1SYBA 2F0UA 1SNCA 3ERQA 4K5XA 4RKBA 3MVVA 2F0KA 2F0TA
chains in the Genus database with same CATH superfamily
2EYLA 1PZID 5FK9C 3NE5B 4PQXA 2N88A 2F0SA 5K36H 4A3BB 4C1NI 1JCKB 5IYCH 2JA9A 3HOYB 3S14H 1LTSD 2ZXPA 4BY1H 1Q46A 2DN8A 1CUKA 1JQYD 4L5SA 1O78A 2ATWA 1FVIA 2NN6G 3P75A 3VYSA 3X3NA 2UUAL 1E3PA 1C48A 4A3BH 2NBFA 1SNDA 4JI3L 3S14B 3L3OC 4QJFA 1SYCA 1XPOA 1HNWQ 1D1KA 3I56A 3J7YW 1TIID 4CDEC 3WWVA 5C5LA 3RR5A 3I90A 4DK0A 3MC0B 1TS5A 4RGOS 4U68A 3ULLA 4DV1Q 1Z7TA 3KDFA 2C35B 3AMUA 4GKKQ 1WI5A 1JE5A 4ME5A 4I7ZC 1XMOL 4DR4Q 4APVA 3R3OA 3K0XA 2KQ3A 4A3FB 1PH5A 3U9SA 4B3SL 5EGTA 3K58A 2Z4IA 1G91A 4OIJA 1PH7A 2QF7A 2D0OA 2VB2X 3NQTA 3H3VH 4HN7A 4NXNQ 1CHPD 3MTSA 1G2TA 4MZ9A 2JYOA 4DUYQ 1C7YA 3VYUA 1V1OA 4DAYB 2K5WA 4XQNA 3CW2C 1AZQA 3TP6A 3OSOA 1RIPA 4K5WA 1EQTA 2QA4A 3CMEA 2B2WC 2PI2A 4QY7A 5DEHA 1LYLA 3E3XA 5C44H 1UWVA 3A8IE 2EJMA 3KYHC 5M3FG 1H9JA 5HY6A 4R8IA 1HZBA 1VQ6A 3KF6B 5I9OA 2A6EC 3MEHA 5BN3A 4JK1C 5C44B 1PYWD 5E3FA 5LMNQ 2K03A 3OTOQ 4HSVA 2LMCB 2LKVA 1P16A 3R2IA 4JI8L 5IWAL 2ZJRA 3EVQA 4PZ7A 1STAA 1U4LA 1JE4A 2L5TA 4GN3B 1EWIA 1L0XB 2A68D 3HOWG 1XNQL 3MZ5A 3PO2B 4DV7L 2E5LQ 4RHRA 2N49A 1HQMC 4GNXB 1CM9A 2F3WA 3EJIA 2QW7A 4PNYA 1O7YA 4C3IH 1WTWA 4JI4Q 3DM3A 4EQNA 3WOFA 4A93H 3TZUA 3ND8A 2PQAA 3U50C 3I72A 1K83H 4X66Q 1SE4A 1TT2A 3SK8A 3U4ZA 4X65Q 4V190 1EY8A 3D6WA 1KRSA 1DYQA 3D8GA 4BA2I 3NBHA 4UP7A 3J81c 4LF6L 1H95A 2L4NA 3TP7A 3VR6A 1BKBA 2N78A 2XIWA 5EPLA 3RZDB 4IOCA 1HQRD 1ASZA 5C4JH 5IP9H 1FJGQ 3TDQA 4RHSA 1RTNA 2L15A 3RZDH 2Z6BA 1ICWA 1HNXQ 4A3GG 3PIOA 4DV5L 3CRLC 4NXNL 4B3RL 1A63A 1F9SA 3BDOA 1WD0A 1P8LA 2D0PA 3RLOA 5HURA 1CKMA 3J81j 2SNSA 5C3EB 3KJPA 1BR9A 4KV6A 3TEHB 1VQ9A 5AJ3L 2AWOA 3VR4A 3ITPA 2K75A 4A76A 1N34L 1GM5A 2K33A 3S16B 1G2SA 5I4DA 4JI7L 3UE1A 4N9PA 2B2VA 1LLRD 5C3EH 1F2ZA 3IL8A 3PO3B 4B9WA 1HZAA 1EIYB 1ILQA 3M4PA 5E1FA 1H9KA 1X3QA 4IFDJ 5GADC 2JA8H 1X6OA 1MGSA 4KHZA 3RN5A 1BCPC 3HKSA 2RKSA 5K36G 1I4HA 2F0JA 1IBKL 2NN6H 3DEOA 4LFCL 1B7YB 1QWYA 1SXTA 2QCPX 1L1OB 3S2DH 1JORA 3J80i 3J7AV 1B9NA 3A55A 4LFBQ 1Y8NB 4A3GB 1X3FA 3K80C 1A3UA 2KCCA 2MHVA 5HGQA 1YNJC 1JT8A 3KK7A 1J9OA 1B8AA 5LMUQ 2Z4HA 3CAMA 4QL5A 1K8OA 2KUMA 2R92G 4K6DA 4K6LA 1MHWC 2SEBD 3MXUA 1HFNA 2NVTH 5EKKA 4GLAC 1XX8A 1A2TA 5T1GA 2ZJPA 2B2WA 2F0LA 2K5NA 3H15A 3FDTA 5FJ8H 1EY0A 2JP1A 1QVCA 4HJ9A 3NP8A 5D3DA 3PGZA 3S1QB 4H02A 1X3GA 4LF6Q 1Y1WG 2XTIA 3U4VA 1YEZA 4CKEA 2XNAC 5CBAE 4BY7H 1WTHA 5IYDG 1IHZA 3GTQH 1XMOQ 1QNKA 2KEEA 4JI0Q 4G7ZC 2E76C 1YHAA 2A5HA 4DAVA 3T1HL 3S15B 4HMIA 1M1KC 1CZGA 3EBEA 1FJGL 5KNDA 2E2HH 2R7DA 1KLUD 4YCWA 3MFGA 4X64Q 2PZTA 1FNVA 4UPAA 1I6HB 2UUCQ 4X6AH 3HS0C 1ONLA 2CFMA 1D5MC 5K5PA 1FR3A 1N9WA 4DR6L 2E2JB 2VUMG 1Q12A 3W3AA 3OHXC 3GV6A 5COYA 3BVZA 1N32Q 1YBYA 1JOOA 2YTXA 2WFWA 4HJ8A 2YU9B 3GTJH 1JWSD 1TWAB 3W2DA 4OO1G 1FD7D 1LM0A 1OXXK 2Q2HA 3TP8A 1K28A 2HUGA 2ZTEA 1HR0Q 4NXML 1NMFA 3CC4A 3D4WA 3HKZG 2WAQB 1NJIC 1TWHH 1Q90A 1GUOA 4AYBG 4DR2Q 2UU9Q 4LAAA 3GDEA 3NEMA 3PMFA 4GNXA 2MQHA 4JPBW 2J7ZA 3G4SA 1YITA 1WOCA 4BBSG 1VQMA 1PRTC 4IOAA 1XMQQ 1R4PB 2B2UC 4QIWB 5CC4A 1TWHB 3OW2A 1J8IA 4DR7L 2LY7A 2PCFB 1FGBD 4A3EH 3T51B 3K7AB 3N6RA 5LMUL 4ULLA 2HIXA 3T1HQ 1AP0A 5BR8Q 1S3OA 3P20A 4QB4A 4ZRZA 3LWUA 4AQYQ 1UE1A 1N36L 2KCNA 4DAYA 2F0UA 3ERQA 2RHSB 4A75A 3MVVA 2F0KA 3HOZG 5I6WA 1Q81C 2RCNA 4LFCQ 2AUKA 5FLMG 2AHOB 1LUZA 1OXVA 2AKWB 1EWHA 2WINB 2NYZD 2VQFL 1A62A 1NR2A 2ENBA 3L7ZC 3SK4A 2JA6B 4BXXG 1EY6A 3KJOA 1AE3A 2NZHA 5C6AA 3RD4A 1DZ1A 2RDFA 4R4QA 1D5XC 2EXDA 1S5FD 2L9HA 4B3SQ 4EQ5A 3IAYA 2RA4A 3OWEB 3FKIB 1GO3E 5GAGC 4JC0A 1D5ZC 1EQRA 1LTGD 1PH8A 2CW0D 4MTNA 1HR0W 1GOZA 5I6YA 1HNXL 4A3KG 1KQSA 2A8VA 1D2BA 1Q1BA 4CKCA 4P75A 1AH9A 3W5OA 1XTCD 2GA4B 4QGUA 2EPBA 2Z8LA 3E0JA 4Q0FA 5FKAC 4DV2L 2B63H 1JMCA 1I6VC 1PXUA 2TSSA 5BN5A 1MJCA 2EYPA 2N8NA 1VQNA 2PQAB 1KHIA 1SMYD 4JI0L 1PZJD 2B63B 4A3JH 3ICEA 3B6YA 3DLLA 2NVQB 2H5XA 3HOXH 1BDOA 3AB9A 5C5MA 4LW1A 3E0EA 1BUVT 3CHBD 3P7JA 4BXXH 1S4ZA 4FF1A 2PI2E 4JI8Q 1KLGD 2NVQH 1W6JA 4YIJA 1IBKQ 1DGSA 3L9AX 2N55A 1N36Q 3V2TA 3SE0A 2HCCA 1GUWA 2NUCA 2I5LX 1JOQA 2V1CC 4DN4M 3D6CA 1K3RA 2QKIC 5LL6X 3TSSA 1JC7A 1CHQD 1ENFA 4Y7NH 1KTKA 1TWGH 4DR5L 2R92B 3GTKH 4X3SA 1NSNS 3ONAB 2K28A 3CPFA 4DKAC 4A3IH 3FEWX 3RMHA 3C1FA 4NXMQ 4HIOA 3T13A 4FO2A 2UUBL 4UHVA 3GTKB 1AN8A 1OXUA 2F0IA 3QWNA 1IKLA 4NMZA 5C4XB 1YJ9A 2F0TA 1VQFA 3P1HA 1H9SB 3TQYA 1EQVA 2O5IC 2TMPA 1G6ZA 5KNBA 3CC2A 5A2QE 3S1NH 2BA0A 2BDOA 5C4XH 5JJKA 2B2YA 1RD9D 1V1PB 1Q8IA 3BYYB 1STBA 1SJED 1I50H 2B3GA 2FINB 1EYCA 4JI1L 5C4XG 4C3HH 2B2UA 1BOSA 4O1NA 2ASBA 3HOZB 1V1QA 3CCQA 2FFKB 2UXBQ 3PO3G 1WD1A 4ALPA 2QEJC 1I4QA 2RDGA 5LL6S 3G71A 1TVXA 2WKDA 4DR6Q 2ZM6Q 2Q8IB 4IUNA 4BBSB 2CQOA 2QEXA 3HKZE 2BCOA 4OGQC 4UDUC 2VW9A 1G291 4ZUJA 3K59A 4DV7Q 2E5LL 3H3VI 3HGBA 4P72A 2VY3A 3CRKC 2RDHA 3TREA 1VQBA 3SVMA 5IGEA 2NTSA 2K5VA 2EY2A 3PIPA 2E75C 3BZDB 2JQOA 1WTPA 1LT6D 2UU9L 1MD2D 4O0AA 4R4OA 4DV0Q 3PO2G 4KI0A 4X65L 1CK1A 5IWAQ 2F0OA 5C0XJ 2MO0A 2BE5C 3F8TA 3OPOA 1Y8PB 2R7FA 1TU2B 1WTXA 2L55A 4LF8Q 1J5EQ 2CW0C 1CTMA 5CV6A 3QJYA 1WTOA 4DXGA 4RCNA 4K2KA 1K3BC 3QB3A 3D3RA 1ESRA 4ZYSA 4KD3A 4JI2L 4JI4L 1B44D 4P74A 1JB3A 2DY7A 3A7LA 4OIKA 1R9TB 3DEPA 3CCLA 3NWTA 3A7AB 3AEVA 3FRPB 5D3IB 1QB5D 3K6OA 1B3QA 3KBXA 1R9TH 5IE8A 3TS0A 4JW0A 2IW3A 1EU3A 1JR0D 4IO9A 3JAMc 5LMNW 4BWGB 2SDFA 1SNCA 3KLWA 4TSSA 2IT1A 4A4IA 4C3IB 1WCMH 5M3FB 1JJGA 2EJFC 4DR4L 3CQZB 1SR3A 2EYHA 4KY7A 2EYFA 1K83B 2F52A 4C3JB 1UUPA 1C0AA 3GO5A 3VR2A 3JAML 2F0MA 2UUBQ 3HFZB 3I8ZA 1EEFD 1GUNA 2I0QA 4JI5Q 4B08A 5JAVA 4B3RQ 2LS01 4A3IG 3PQIA 3GV3A 2JA8G 3RLFA 1J5EL 2QDLA 4BBRG 2I07B 2RBMA 4JBWA 4QCLA 4HCSA 1XNRQ 2HHHL 4FXDA 1QZHA 2IX3A 3QO2A 1PH6A 1MIUA 1SNMA 4XQQA 2UUAQ 1JJCB 4LFAL 3CF5A 2LXJA 3S2HH 4DV3Q 4RAUC 1FNUA 1I4XA 1X3EA 3J81E 5IIFA 2XWBB 5FLXL 3HZXA 5IT9E 3BVMA 4C3JG 1SJHD 3S2HB 3CP0A 1PTOF 5C4ZA 1QZGA 3PO3H 4N8X1 1GD7A 1DOLA 1QILA 2NZ1D 5M5XH 1VQ7A 2RHQB 2JA8B 4DR7Q 1ZKOA 1IBLQ 4YWKA 4JG2A 5CORA 5BN4A 3J80E 3I70A 1TS2A 4OONA 1UE6A 1Y1VG 3GTPB 2Q2IA 1ENCA 5M3MB 3SK5A 4FF2A 3MXNA 4DR3L 3IFTA 2PW7A 5JPNC 4DUZQ 3K7UC 1PHJA 1C8CA 1GVPA 3GTPH 3I4NH 3PUYA 4E6IA 3TMEA 2YTVA 1SE3A 2F0GA 4OX9Q 4DV0L 4A3LG 1STYA 1S5DD 1B3AA 1DJRD 3I4NB 3BDCA 3MA2B 1N32L 1XPRA 5IT9L 2K5DA 1TWFH 4KHVA 1VQDA 4OHJA 4PMWA 5JEAJ 1SYBA 2EIFA 4WFN3 5L37A 4IUQA 4K5XA 4BY1B 3TRZA 2HD3A 4YY3Q 4NB3A 5EAYA 2PPBC 2NWGA 1SMXA 5ELEA 1ET9A 3L0OA 5E4WC 4ZLTF 3QG1A 3BYTB 3WOEA 1PH9A 3TBIB 2NVYB 2WKCA 4DK1A 3PUVA 1BXTA 4F88A 4BS9A 5M9OA 4FVMA 3SGIA 4OWXB 4UY8C 3VA5A 1HHVA 2EY5A 2D2CC 1RDPD 2HHHQ 1KDAA 1WTQA 5IT9c 2PW5A 1W3SA 4FP5D 1U4PA 3TS2A 1EFWA 1Q8KA 4QMGA 1AFPA 3TN2A 4DV3L 5C3EG 4A3FH 1S5BD 3MHBA 2WB1G 3T56B 3WDNA 1L1OC 1STGA 2B2VC 3U9OA 4XIGS 1VQKA 3DMUA 2GVAA 5JJZA 2UXDL 2F03A 4JI6L 1BNZA 5CBEE 1F2YA 4KHPQ 2LFNA 1Z6HA 4K2LA 2A74C 5FO7B 3V05A 4J15A 2I46A 1HNZQ 4UP8A 1S5CD 3MXNB 1U4MA 2L12A 3I4MG 2KVMA 1EU4A 2CQAA 1EY7A 2K4KA 2R93B 1GUTA 1YVCA 3IRBA 1EY5A 2Y0SE 3L2PA 4XT1B 5KIXA 3J81i 1EZ6A 3TP5A 5G3LF 3A8JE 3MEFA 1PZKD 4J8QA 3PUWA 1BQQT 2X6LA 3GTMB 2FXQA 4DAPA 3PIO3 5H1SE 4L8JA 1RJTA 5EBCA 2VUMB 4B9XA 5CV9A 4PZ6A 2OWOA 2BH8A 1BBWA 2K50A 1SDFA 3ND9A 2VUMH 2RSNA 1MBYA 1LACA 1O7ZA 4DF7A 4JCVE 4X3UA 2OEOA 3U58A 2XN9C 3HOUH 4JI5L 4OWWB 5KYLA 4F87A 3R8BA 1M4VA 2Z6KA 4ZUIA 1PTOH 1CT1D 4OX9L 5IGFA 2A69D 2F4VL 1CKNA 1QNUA 1LTTD 4GNXC 2XRSD 1KNEA 4ILWA 1DOKA 2SNMA 1EOVA 4IALA 1UEBA 3K57A 1AW7A 1L1OA 1PLFA 3D31A 3FMCA 1RTOA 5EKIA 5JVG3 1VQLA 1KABA 2IPKD 3M4OH 2IX0A 4X66L 4LF4L 1E0BA 1EEID 1STEA 4OXPA 1BCPB 3K5LA 3DXJC 4NPSA 3E9IA 1W2BA 3M4OB 5ELOA 4OO1I 1YZ6A 4EQOA 1STHA 1RL2A 5C44G 1Y1WB 2JA5H 2JXMB 4A3JB 3BDLA 2DJFC 4P71A 5FLXE 4F8MA 4DXFA 3M9BA 2K14A 5C4JB 4J6HA 1IBLL 2A69C 3S16H 1CA6A 3AYHB 1RODA 1X3PA 2G5DA 4EVOA 2OTLA 2JN4A 2H4OA 3UDIA 5HGTA 1HXYD 4DFAA 4H0LC 2DJGC 4A3MG 1KIXA 3K0YA 1JOKA 2M2LA 2RVLA 1RF2D 4DPGA 1WJJA 4A3DB 1U0LA 4MNOA 4Q5VA 2K32A 5CYUA 4U673 3HOWH 4IFDG 2F0DA 1E2VA 3KBGA 4ZKCB 2JA7G 4RH6A 2RQXA 4A3IB 3OIQA 2KHJA 1SYDA 1AE2A 1I5FA 1HUMA 1R4QB 3ULPA 3C3LA 4JV5L 3CCEA 4X62Q 1RKNA 3ZYYX 3J7A5 1I3QH 3D4RA 4RG1A 1IYJB 4FDBA 1B70B 1SRUA 3ULJA 2H1EA 1NUCA 3S1NB 1KNAA 3LNNA 4PV1C 4N8FA 1I3QB 1K8GA 3GQBA 1EQQA 2R61A 4A3MB 1H9MA 3Q22A 4KY6A 3NTHA 1T5XD 3GTOH 1CSPA 3PF5A 5ISRA 4AQYL 3S1QH 4FYDA 2JA7B 1Q82C 3R93A 1VQEA 2PQEA 2F0NA 4LFAQ 3T53B 5BR8L 1ZYRC 1X54A 2CVRA 4ZAIA 5CGKA 4K8IA 1KD1C 5T1IA 2EVBA 2E2HB 1A3TA 1L2FA 4YHHQ 3FVQA 3RUZA 3S1RH 3A56A 1ZYRD 4R8NA 2F4IA 4KLKA 3ER0A 2M9VA 3M4YA 4CDDC 4RCOA 3W1GA 3GTQB 4RGNA 4R4CA 5CV5A 1KAWA 4O42A 4IJLA 4KKSA 1IBMQ 4GKJQ 2WACA 4C2MH 1VQCA 1SN8A 4IURA 4CGYB 3I73A 1OXSC 4X3KA 4A3KH 3GTJB 1VQ4A 4R9WA 1KC8C 4BA1I 1TWAH 1PDQA 3GTLB 1ZXTA 3A74A 2CWAA 4RMFA 1HCZA 1V1PA 4LUZA 4A3KB 4HIKA 5I9PA 1SROA 5JJIA 4BY1G 3MAQA 1G8ZD 2I5MX 2MUYA 1IZ6A 3C2PA 2WB1E 1I4GA 1BBXC 3IKJA 4JBKA 3MXPA 5E4XA 1J6QA 1VF7A 5EPJA 3VR5A 3EQLC 3LGJA 1JICA 5CR3A 4ID6A 2EZVA 1GKHA 1HJPA 4B3TQ 5C3XA 1I4PA 1F2LA 4BBRH 1AZPA 3NELA 3H3VC 3BZKA 3BS1A 2PMZB 2HDMA 4DV4Q 3SEBA 4L5QA 3STBC 3H91A 4BBRB 2R93G 3O13A 5M5WH 5KEEA 3CCSA 1Y1VB 2K04A 1HTLD 4LUVA 2A6HD 4UAIA 2IY5B 2OXPA 1VQGA 1E1TA 3GD7A 1EY9A 4A3EB 3SR1A 3CQZH 3SHLA 2Q2TA 1QE6A 5LHY1 1Y1VH 5C0XI 3KLRA 2KECA 2O4XA 5IGDA 3F2BA 4IFDH 4HR7B 3I4MB 3OMGA 2F3IA 2B39A 3JAMi 2C9OA 3FPUB 1BCPD 2G9DA 3K5MA 1SAPA 1XYIA 5KRUA 5EBDA 1B9MA 4L6TB 3RZOB 1C9OA 2UXDQ 2AQ3B 2WB1B 1YNXA 2DY8A 3HOYG 2XRQD 4FF3A 4C3HG 2Z6KC 4K14A 3URYA 2HT1A 3SDZA 3AU7A 4B3TL 2ICIA 5DM63 4EGVA 3FKIH 3N52A 4JI1Q 1VMPA 2KCMA 2YV5A 4LF5Q 5KYIA 3I2ZA 1OO9B 4AYBE 2MFIA 2X69A 3HEJA 2ES2A 1G6PA 5G3LD 2K7VA 1CKOA 1EFID 1K8AC 1VF5C 2BA1A 4GN4B 2XGTA 4MIUA 3S1MH 1XNQQ 2E2IH 2JSOA 1Z9FA 3VYTA 2X6GA 1EL0A 3H94A 4IUUA 1B4OA 1HZCA 2LSSA 4QUCA 3OIPA 3CD6A 3HOXB 1JB7A 3K5NA 1PYBA 2VL6A 4G4KA 1U4RA 4JOIC 3EROA 1SYFA 3UI2A 2IWHA 1QOHA 3HP3A 4POGA 1CZWA 4LUOA 4NP5A 2IHFA 5ELNA 1GJXA 5A35A 1NTGA 2Y0SB 3H0GH 1SMYC 1W6KA 2Q8RE 3FKIG 1UAPA 1ASYA 2VQFQ 3Q8DA 4PMCA 3C1EA 5JVH3 2JE6I 2R92H 2HIVA 1QUQB 3UDFA 3CCVA 1SE8A 1D1IA 4K0KQ 1F2MA 2FJ2A 4CKBA 3KF8A 1ESFA 5GAHC 1F9RA 5AFWA 3VR3A 2MNAA 3KLSX 1KDBA 2F0WA 5FOBB 2NVYH 5FJ8G 3AFPA 3I3CA 2B8GA 2D5DA 1DXMA 1SSOA 3RLNA 1V8QA 4C3HB 2JEBI 1PVOA 4GZYC 3Q23A 3T1YL 4XYOA 1AEXA 2MPMA 5J22A 1ET6A 1X55A 2IHEA 4QIWE 3CCUA 2EY1A 1HUNA 4O2DA 2VZAA 1UE5A 2B29A 1D8LA 3FHWA 5DM73 1PFBA 4TQUS 1K73C 3NBHB 1O7IA 1HA6A 1L0YB 1NNXA 1ML0D 1OXTA 4HSPA 3SXHA 1FNWA 4M8AA 3EIVA 3DWQA 5EJWA 1LO5D 1U5KA 1LV9A 5GAEC 2FMCA 2HCIA 2NB0A 4B3ML 4C3IG 4NW2A 2V4DA 1OTCA 4A93G 1XJVA 3BJUA 4IPCA 3HKZB 4OO1H 1EOTA 5I2XA 3F2CA 4JYAL 5IGCA 1GUSA 4LWCA 4CJ1B 2MGSA 4S3SA 2RCFA 4DR1L 4WORA 2PZUA 4JI7Q 3S17H 2R93H 2KOLA 4JBMA 1U9RA 2BDNA 5JJLA 4QQBX 2KHIA 1IXRA 4KN7C 4DA2A 4EQPA 1H9SA 3NHHA 2OTJA 4LF9Q 1DD2A 4JVZA 3CCMA 3S17B 1PRTF 2MJ8A 2PMZE 2Z0SA 2OQKA 1PTOD 2R7ZG 1SNQA 1LABA 2ICEC 1EZ8A 2KBNA 2MO1A 1QUQA 3GTMH 5IYDH 4KTAA 1EYGA 4OELB 4DNTB 5EPKA 2F4VQ 1V43A 1M8AA 2WV6D 2R7ZH 1MSHA 3NUCA 4WJWA 2EYJA 1MI2A 2FMMA 4J1MA 1N34Q 1TS3A 2IX1A 3DM1A 4ME3A 3ZJYC 3D4DA 2PYKA 4KKUA 4LK1C 1TQOA 4JI3Q 4KD4A 2R7ZB 3G6JB 3PO2H 4RGMA 5ELCA 1LT5D 3OW7A 2EXZA 1IW7C 3EN2A 4LF7Q 4RKBA 2PNRC 1Q7YC 3M85A 1PTOC 1K0RA 4DR3Q 3QR8A 4A93B 5M5YH 1NAPA 2KHSA 2EDGA 3NK9A 3F2DA 3HOXG 1A3VA 1E1OA 1CSQA 2OQ0A 2KA7A 4C56C 4CDCC 1KRTA 4DR1Q 5M5YB 1DONA 3HOVH 5IP7H 4IUVA 1TXYA 2XWJB 4XTCS 1KAAA 5KGUA 4CDFC 1VQIA 2A1AA 2PNHA 2ALYB 4DR5Q 3HOVB 4KJOA 2PZWA 2EE1A 5IYBH 1PH3A 2F0FA 2A6HC 3CU7A 3NPPA 4YCUA 3QOLA 3GTGB 4IFDI 5ELBA 3MXGA 2AQ2B 3LX0A 3NSWA 4L5TA 3KF8B 1DM0B 5F2DA 1IYUA 2EJGC 1XNRL 1D7QA 1HRJA 2IL8A 1PFSA 2F3VA 2ID0A 2K5QA 5M5XB 3UE0A 2HDLA 3E6ZX 4HTHA 1HR0L 2RSOA 4MHEA 4HIMA 3A0JA 1B2TA 1IW7D 1TR5A 4IN3A 1HTPA 2N3SA 5IOCA 4FXGC 5IGBA 5M3MH 1IKMA 1B50A 2UUCL 1VQ8A 1A6XA 2UXBL 4ZKBB 5LMNL 1Z47A 4PZ8A 3DWPA 4KHPL 2UXCL 1WTRA 1KL9A 2AQ1B 2JJQA 4H7BA 4EX5A 1CFMA 1Q86C 3MWYW 1CQVA 3NENA 1DCZA 3F2UA 3KF6A 4CHTB 1PMRA 1O80A 4KY5A 3E5SA 3PSIA 1LT4D 2B8FA 2WAQG 2Z9HA 1EY4A 1VQHA 1A0IA 5GROA 3S2DB 4BY7G 4GOPB 4GS3A 3GTOB 3NTIA 1GHKA 1E7ZA 1LTLA 3OYYA 2K52A 4DV2Q 4GLVB 1EWCA 5TSSA 1XPUA 1HH2P 2ZT9C 4A3CG 1FGUA 2NVXH 4NDXA 2E74C 3I4NG 4IPHA 3JC66 5IGGA 4TVAB 4K8JA 4A3LH 4KK7A 4CJ0B 3RNUA 1D6EC 1ZEQX 2NVTB 1IYVA 3HOYH 2A19A 2NVXB 1F9QA 4I65A 5ELDA 3J80c 3TZDA 4JBJA 1XWEA 1ICFB 1MKHA 1STNA 1SYGA 1T9HA 4FF4A 4OEMB 5KNCA 4DV5Q 3BVGA 2RF4A 3FPPA 2JA6G 1I6HH 2NTTA 4AIMA 1EIFA 2F0HA 2DNEA 4BY7B 2CWPA 1NMGA 2ZJQA 3VDYA 5FLMH 3J80L 1A2UA 1PYSB 3I55A 4LMQD 3ERSX 5C0XG 3S15H 1K0SA 2SOBA 4PG3A 2VB3X 1VMCA 5DLQE 1LTBD 1B1ZA 1WTVA 2YU9H 2AMCB 1PFMA 4LF4Q 1XXGA 5C4HA 3G6EA 2R3ZA 4KJNA 4XXEA 1K8MA 1WYDA 4G7OC 2EOTA 4GN5A 3CC7A 4XDXA 3I91A 4POFA 2WP8J 1PH1A 2VQEQ 1BO0A 2K5HA 3DHQA 1E2WA 3T16A 1SFOH 1SYEA 2YTYA 5JPMC 2IJ0A 5DNFA 1JWMD 1PRTB 1YIJA 5EKLA 1PV4A 4F7XA 1YNJD 4LFBL 4YCVA 5CV8A 3UDGA 1SFOB 3CKIB 1IL2A 3M3YH 2CCZA 1MJEA 1QCBD 3K7AH 2E8GA 2VNUD 5DAUA 2L11A 3HOVG 3FP9A 3M3YB 1VQAA 4AH6A 4RWSC 1T5EA 3MFYA 4QF4A 3HG9A 5E7NA 1UNSA 5CMDA 3BU2A 5FLXc 4A3JG 1Y69U 3HRZC 1SNOA 1WCMG 1SLJA 1QJOA 2ZXRA 3JAME 2K6AA 3C46A 3I4MH 3NWSA 1S40A 1NR4A 4KN4C 5AJ3Q 1YNND 5EQ0A 4KKTA 4PMBA 4CJ2C 2R6GA 1F9PA 1CI3M 1IBML 1Q3LA 4GKJL 4IUPA 4LF5L 3S24A 2A73B 3A5ZB 4IQZA 4L5RC 1S5ED 4YY3L 1VCIA 1H9RA 5GQOA 3HOUB 3R2TA 3H09A 4B3MQ 2VS1A 3D0FA 3KFUA 4IUTA 4DU9A 4FNFA 3S9WA 5JEAH 3PIP3 1PTOB 2F0PA 3OTOL 4HJAA 4DV6Q 2Z1CA 2GN5A 1NCVA 1QVGA 3K8AA 2K05A 4A3BG 1K9MC 2ZTDA 3BZCA 5JEAG 1NE3A 2B2TA 1BVSA 3H6MA 3J7ZC 3Q0AA 2ZXOA 4WJ3M 4HCEA 1V9PA 1EYAA 2L0CA 2MP1A 2JA5B 4XYQA 2M00A 2F0QA 2AWNA 4LJZC 1X9NA 3M7GA 3KLSA 4DR2L 1PFNA 4DV4L 2A68C 2E2IB 1YHQA 4GLXA 2CKZB 4KMUC 1I94L 1E24A 1Y1WH 1TKWB 3A8KE 1QG7A 4A3DH 1HZ9A 2ZM6L 3HOWB 3AFQA 4WRDA 2BOSA 4DV1L 3V96A 4Z9CB 1GUGA 2A6ED 1YHBA 4R1JA 4RFBA 1N33L 2CH4W 3DUZA 4OL7A 3K5OA 1E2ZA 3J81L 3OWFA 2Q8TA 4YWLA 1A15A 2C5CA 4Y7NB 2F0VA 2I5HA 4DK3C 4RA8A 2OCEA 5FO9B 2E2DC 3IFDA 4Y52H 4HAEA 3M7NA 3I4OA 2HQEA 4DNIA 3VYRA 2KJXA 1HPCA 2LXKA 4A3FG 1TWGB 1KXLA 2P5ZX 5I2YA 1RHPA 3OOCA 4A3MH 1NY4A 4DNRB 5A2QL 1VQOA 5CV4A 1PH4A 4A3GH 1XTDA 2G9HD 4IJHA 2O5JC 1TY0A 1SEBD 2XSCA 4LF9L 1EIHA 2JA7H 2B2TC 1SNPA 2VXWA 4ZCKA 1I50B 4ZK9B 2KCTA 4GOPC 4L63B 4HMJA 3A54A 5J39A 2WAQE 4CBVA 1Y14B 3BG3A 5IP9G 1S72A 1XMQL 5IYBG 1QVFA 1O7LA 3NQIA 1VQPA 3I7FA 2D62A 1CA5A 1VS0A 3RN2A 4BBSH 2F1MA 1PH2A 3EA6A 1A8VA 1BF4A 3M4QA 4QUFA 1UEAB 3CMAA 2ZTCA 3VA7A 3PUXA 1YJNA 3HOZH 3KUPA 1G51A 2BE5D 4C2MB 2K1BA 1YI2A 3GP7A 4DK6C 4N9TA 5IYCG 4DUZL 1YJWA 2QDBA 1BBUA 2Y0SG 4ODGA 2OT2A 1VDZA 3S1RB 4YHHL 4HEDA 2WIIB 2OF1A 4P73A 3STBD 5ELFA 2UXCQ 4DGZA 3Q6SA 1BCPF 1X65A 1B53A 4GKKL 1UE7A 3PV0A 4M1UB 3AQQA 1E22A 2QGQA 2J4XA 1IL8A 1SBBB 3H0GG 3CPWA 1WVLA 4IPDA 1VQJA 2E2JH 3HOUG 1KDCA 1N33Q 2EYOA 4R4TA 1GHJA 2AUJD 3GTLH 1JJ2A 1HFGA 3G7LA 4X62L 1YNNC 2KEDA 4JI2Q 4HIDA 3NBIA 2D9UA 4RKLA 1N8RC 4LF7L 2GVBA 3NXWA 5D65A 1EYDA 4P2CB 1GXDC 4RGTA 1NBWA 1Q1EA 1LT3D 5M5WB 2JK8A 3KOJA 4HJ7A 1Y8OB 3SK6A 2PO4A 1TS4A 4V0BA 4OWTB 3W1BA 5M3MG 1MSGA 4G57A 4H44C 2K01A 5C3WA 1ILPA 2F0EA 1I4RA 2DNCA 3E9HA 5NUCA 2QILA 1X56A 1LTID 4JI6Q 2XVSA 4H13C 4ABNA 3EFXD 1VQ5A 1FL0A 1WCMB 5M3FH 1CQFA 4JOIA 3Q24A 1HNZL 2NZOA 1F77A 3NTKA 2Q2UA 3J7AF 3F1ZA 4MN3A 4IZ8A 4G7HC 1LTAD 1M90C 4C3JH 4I7AA 3DWAA 2JA6H 4K0KL 4TRDA 5D14A 4A3DG 3GTGH 5J1ZA 2KENA 3CCJA 4AYBB 2JEAI 4JV5Q 1DOMA 3RZOH 2J0TD 1C4QA 3T1YQ 1TWCH 4DUYL 4A3EG 2HQLA 5IY0A 1X32A 3OMCA 1I94Q 3T4AC 4X3TA 1TWCB 3X3MA 3PF4A 1TY2A 2O2LD 3UDXA 4IPGA 2NN6I 2CHBD 4HJ5A 4LF8L 3S1MB 1L0WA 1EIGA 5FO8B 5IODA 3I4LA 4A3CH 1CKNB 3A5UA 3CCRA 1PA6A 3G48A 3LWEA 3QOJA 4UP9A 2DUDA 3KDFB 5JOBA 4XQJA 1HNWL 1EUJA 4LNQA 4X64L 4FXKC 5CV7A 4WJ4A 2B2YC 2EQSA 1SE2A 2FHTA 4YWMA 2EY6A 3K81C 4ZQ3A 3H0GB 5J3BA 4NKLA 1LTRD 1FYCA 4JYAQ 2YYZA 4MTKA 1PRTD 2EYMA 3PUZA 1TWFB 4DAMA 4GOPA 5IP7G 1JWUD 1HA5A 5C0XH 2L1BA 1ENAA 2DGYA 2CH4A 1RCVD 4XT3B 4R4IA 2JA5G 1II3A 4DV6L 3PCOB 2VQEL 2B63G 4C1NK 2BH2A 4TKOB 1WFQA 3CXCA 4K5VA 3QIAA
chains in the Genus database with same CATH topology
2EYLA 1PZID 5FK9C 3NE5B 4PQXA 2N88A 2F0SA 5K36H 4A3BB 4C1NI 1JCKB 3HOYB 1LTSD 2ZXPA 2DN8A 1JQYD 1O78A 2NN6G 3P75A 3VYSA 3X3NA 1C48A 2NBFA 1SNDA 3S14B 3L3OC 1SYCA 1D1KA 3J7YW 1TIID 5C5LA 3I90A 4DK0A 3MC0B 1TS5A 4RGOS 4U68A 1Z7TA 3AMUA 4ME5A 4I7ZC 3R3OA 2KQ3A 4A3FB 3U9SA 5EGTA 3K58A 2Z4IA 1G91A 4OIJA 2QF7A 2VB2X 3NQTA 4HN7A 1CHPD 3MTSA 1G2TA 2JYOA 3VYUA 1V1OA 2K5WA 4XQNA 1AZQA 3TP6A 3OSOA 4K5WA 1EQTA 2B2WC 5DEHA 3A8IE 2EJMA 1H9JA 4R8IA 5I9OA 2A6EC 3MEHA 5BN3A 4JK1C 5C44B 1PYWD 5E3FA 2K03A 4HSVA 2LMCB 2LKVA 3R2IA 3EVQA 1STAA 1U4LA 1JE4A 2L5TA 1L0XB 2A68D 3MZ5A 3PO2B 4RHRA 1HQMC 1CM9A 2F3WA 3EJIA 4PNYA 1O7YA 1WTWA 4EQNA 3WOFA 3TZUA 3ND8A 3I72A 1SE4A 1TT2A 3SK8A 4V190 1EY8A 3D6WA 1DYQA 3D8GA 4BA2I 3NBHA 2L4NA 3TP7A 3VR6A 2XIWA 5EPLA 3RZDB 1HQRD 3TDQA 4RHSA 1RTNA 1ICWA 3CRLC 1F9SA 3BDOA 1WD0A 5HURA 2SNSA 5C3EB 1BR9A 4KV6A 2AWOA 3VR4A 3ITPA 2K33A 3S16B 1G2SA 5I4DA 4N9PA 2B2VA 1LLRD 1F2ZA 3IL8A 3PO3B 4B9WA 1ILQA 5E1FA 1H9KA 1X3QA 4IFDJ 1MGSA 4KHZA 1BCPC 2RKSA 5K36G 1I4HA 2F0JA 2NN6H 3DEOA 1QWYA 1SXTA 2QCPX 1JORA 3J7AV 1B9NA 3A55A 1Y8NB 4A3GB 1A3UA 2KCCA 2MHVA 1YNJC 3KK7A 1J9OA 2Z4HA 1K8OA 2KUMA 4K6DA 4K6LA 2SEBD 3MXUA 1HFNA 5EKKA 1XX8A 1A2TA 5T1GA 2B2WA 2F0LA 3FDTA 1EY0A 2JP1A 3NP8A 5D3DA 3S1QB 4CKEA 2XNAC 5CBAE 1IHZA 1QNKA 2KEEA 4G7ZC 2E76C 2A5HA 4DAVA 3S15B 4HMIA 1CZGA 5KNDA 1KLUD 3MFGA 2PZTA 1FNVA 1I6HB 3HS0C 1ONLA 1D5MC 5K5PA 1FR3A 2E2JB 1Q12A 3W3AA 3OHXC 3GV6A 5COYA 3BVZA 1JOOA 2YU9B 1JWSD 1TWAB 3W2DA 4OO1G 1FD7D 1OXXK 3TP8A 2HUGA 3D4WA 2WAQB 1GUOA 1Q90A 4LAAA 3PMFA 2J7ZA 1PRTC 1R4PB 2B2UC 4QIWB 5CC4A 1TWHB 1J8IA 2LY7A 2PCFB 1FGBD 3T51B 3K7AB 3N6RA 4ULLA 1AP0A 3P20A 4QB4A 4ZRZA 3LWUA 2KCNA 4DAYA 2F0UA 3ERQA 3MVVA 2F0KA 5I6WA 2AUKA 1OXVA 1EWHA 2WINB 2NYZD 1NR2A 2ENBA 3L7ZC 3SK4A 2JA6B 1EY6A 5C6AA 3RD4A 1DZ1A 2RDFA 1D5XC 1S5FD 2L9HA 3IAYA 2RA4A 3OWEB 3FKIB 1D5ZC 1LTGD 2CW0D 1GOZA 5I6YA 1D2BA 1Q1BA 4CKCA 1XTCD 2GA4B 2EPBA 2Z8LA 3E0JA 4Q0FA 5FKAC 1I6VC 1PXUA 2TSSA 5BN5A 2EYPA 1SMYD 2B63B 1PZJD 2NVQB 1BDOA 3AB9A 5C5MA 1BUVT 3CHBD 3P7JA 1S4ZA 4FF1A 1KLGD 1W6JA 4YIJA 3L9AX 2N55A 3V2TA 3SE0A 2HCCA 1GUWA 2NUCA 1JOQA 4DN4M 3D6CA 2QKIC 5LL6X 3TSSA 1JC7A 1CHQD 1ENFA 1KTKA 2R92B 4X3SA 1NSNS 3ONAB 2K28A 3FEWX 3RMHA 3C1FA 3T13A 4FO2A 3GTKB 1AN8A 1OXUA 2F0IA 3QWNA 1IKLA 4NMZA 5C4XB 2F0TA 3P1HA 1H9SB 1EQVA 2O5IC 2TMPA 1G6ZA 5KNBA 5A2QE 2BA0A 2BDOA 2B2YA 1RD9D 1V1PB 1Q8IA 3BYYB 1STBA 1SJED 2FINB 1EYCA 2B2UA 1BOSA 4O1NA 3HOZB 2FFKB 1WD1A 2QEJC 1I4QA 2RDGA 5LL6S 1TVXA 2WKDA 2Q8IB 4IUNA 4BBSB 2BCOA 4OGQC 4UDUC 1G291 4ZUJA 3K59A 3HGBA 3CRKC 2RDHA 3SVMA 5IGEA 2NTSA 2EY2A 2E75C 3BZDB 1WTPA 1LT6D 1MD2D 4KI0A 1CK1A 2F0OA 5C0XJ 2BE5C 3OPOA 1Y8PB 1TU2B 1WTXA 2L55A 2CW0C 1CTMA 5CV6A 3QJYA 1WTOA 4DXGA 4RCNA 4K2KA 3QB3A 3D3RA 1ESRA 4ZYSA 4KD3A 1B44D 1R9TB 1JB3A 2DY7A 3A7LA 4OIKA 3DEPA 3NWTA 3A7AB 3FRPB 5D3IB 1QB5D 3K6OA 3KBXA 2IW3A 1EU3A 1JR0D 4BWGB 2SDFA 1SNCA 4TSSA 2IT1A 4C3IB 5M3FB 2EJFC 3CQZB 2EYHA 4KY7A 2EYFA 1K83B 4C3JB 1UUPA 3GO5A 3VR2A 3JAML 2F0MA 3I8ZA 1EEFD 1GUNA 4B08A 5JAVA 2LS01 3GV3A 3RLFA 2I07B 2RBMA 4JBWA 4QCLA 4HCSA 4FXDA 2IX3A 3QO2A 1SNMA 4XQQA 4RAUC 1FNUA 1I4XA 3J81E 5IIFA 2XWBB 5FLXL 3HZXA 5IT9E 3BVMA 4C3JG 1SJHD 3S2HB 1PTOF 5C4ZA 1DOLA 1QILA 2NZ1D 2JA8B 1ZKOA 5CORA 5BN4A 3J80E 3I70A 1TS2A 3GTPB 1ENCA 5M3MB 3SK5A 4FF2A 3MXNA 3IFTA 2PW7A 5JPNC 1C8CA 3PUYA 4E6IA 3TMEA 1SE3A 2F0GA 1STYA 1S5DD 1B3AA 1DJRD 3I4NB 3BDCA 3MA2B 5IT9L 2K5DA 4KHVA 4OHJA 4PMWA 5JEAJ 1SYBA 4WFN3 4IUQA 4K5XA 4BY1B 2PPBC 2NWGA 5ELEA 1ET9A 5E4WC 4ZLTF 3QG1A 3BYTB 3WOEA 3TBIB 2NVYB 2WKCA 4DK1A 3PUVA 1BXTA 4F88A 4BS9A 5M9OA 4FVMA 3VA5A 1HHVA 2EY5A 2D2CC 1RDPD 1KDAA 1WTQA 2PW5A 4FP5D 1U4PA 4QMGA 1AFPA 3TN2A 1S5BD 3MHBA 3T56B 3WDNA 1STGA 2B2VC 3U9OA 4XIGS 3DMUA 5JJZA 2F03A 1BNZA 5CBEE 1F2YA 2LFNA 1Z6HA 4K2LA 2A74C 5FO7B 3V05A 2I46A 1S5CD 1U4MA 2L12A 2KVMA 1EU4A 2CQAA 1EY7A 2R93B 1GUTA 1EY5A 4XT1B 5KIXA 1EZ6A 3TP5A 5G3LF 3A8JE 1PZKD 4J8QA 3PUWA 1BQQT 2X6LA 3GTMB 4DAPA 3PIO3 4L8JA 1RJTA 5EBCA 2VUMB 4B9XA 5CV9A 1SDFA 3ND9A 2RSNA 1MBYA 1LACA 1O7ZA 4DF7A 4X3UA 2OEOA 2XN9C 5KYLA 4F87A 3R8BA 1M4VA 4ZUIA 1PTOH 1CT1D 5IGFA 2A69D 1QNUA 1LTTD 2XRSD 1KNEA 4ILWA 1DOKA 2SNMA 3K57A 4IALA 1AW7A 1PLFA 3D31A 3FMCA 1RTOA 5EKIA 5JVG3 1KABA 2IPKD 2IX0A 1E0BA 1EEID 1STEA 1BCPB 3K5LA 3DXJC 3M4OB 4OO1I 4EQOA 1STHA 1Y1WB 2JXMB 4A3JB 3BDLA 5FLXE 4F8MA 4DXFA 5C4JB 4J6HA 2A69C 1CA6A 1RODA 1X3PA 4EVOA 2H4OA 5HGTA 1HXYD 4DFAA 4H0LC 3K0YA 1JOKA 2M2LA 2RVLA 1RF2D 4A3DB 4Q5VA 2K32A 5CYUA 4U673 4IFDG 2F0DA 1E2VA 3KBGA 4ZKCB 4RH6A 2RQXA 4A3IB 3OIQA 1SYDA 1HUMA 1R4QB 3C3LA 1RKNA 3ZYYX 3D4RA 3S1NB 2H1EA 1NUCA 1KNAA 3LNNA 4PV1C 1I3QB 3GQBA 2R61A 4A3MB 1H9MA 3Q22A 4KY6A 3NTHA 1T5XD 5ISRA 4FYDA 2JA7B 3R93A 2PQEA 2F0NA 3T53B 1ZYRC 2CVRA 4ZAIA 5CGKA 4K8IA 5T1IA 2EVBA 2E2HB 1A3TA 3FVQA 3RUZA 3A56A 1ZYRD 4R8NA 2F4IA 2M9VA 3M4YA 4RCOA 3GTQB 4RGNA 5CV5A 4O42A 4KKSA 2WACA 4IURA 4CGYB 3I73A 1OXSC 4X3KA 3GTJB 4R9WA 4BA1I 1PDQA 3GTLB 1ZXTA 1HCZA 1V1PA 4A3KB 5I9PA 3MAQA 1G8ZD 2MUYA 3C2PA 1I4GA 1BBXC 3IKJA 3MXPA 5E4XA 1VF7A 5EPJA 3VR5A 3EQLC 1JICA 5CR3A 4ID6A 2EZVA 5C3XA 1I4PA 1F2LA 1AZPA 3H3VC 3BS1A 2PMZB 2HDMA 3SEBA 3H91A 4BBRB 3O13A 5KEEA 1Y1VB 2K04A 1HTLD 2A6HD 4UAIA 2OXPA 3GD7A 1EY9A 4A3EB 3SR1A 3SHLA 1QE6A 5LHY1 5C0XI 3KLRA 2KECA 2O4XA 5IGDA 4IFDH 3I4MB 4HR7B 3OMGA 2B39A 2C9OA 3FPUB 1BCPD 2G9DA 3K5MA 1SAPA 1XYIA 5KRUA 5EBDA 1B9MA 4L6TB 3RZOB 2AQ3B 2WB1B 2DY8A 2XRQD 4FF3A 4C3HG 4K14A 3URYA 3SDZA 3AU7A 2ICIA 5DM63 4EGVA 3N52A 1VMPA 5KYIA 1OO9B 2X69A 3HEJA 5G3LD 2K7VA 1EFID 1VF5C 2BA1A 4MIUA 2JSOA 3VYTA 2X6GA 1EL0A 3H94A 4IUUA 1B4OA 4QUCA 3OIPA 3HOXB 3K5NA 4G4KA 1U4RA 3EROA 1SYFA 3UI2A 2IWHA 1QOHA 3HP3A 1CZWA 4NP5A 1GJXA 5A35A 2Y0SB 1SMYC 1W6KA 2Q8RE 1UAPA 4PMCA 3C1EA 5JVH3 2JE6I 1D1IA 1F2MA 2FJ2A 4CKBA 3KF8A 1ESFA 1F9RA 5AFWA 3VR3A 3KLSX 1KDBA 2F0WA 5FOBB 3I3CA 2B8GA 2D5DA 1DXMA 1SSOA 4C3HB 1V8QA 2JEBI 4GZYC 3Q23A 4XYOA 1AEXA 2MPMA 5J22A 1ET6A 2EY1A 1HUNA 5DM73 1PFBA 4TQUS 1HA6A 1L0YB 1ML0D 1OXTA 4HSPA 3SXHA 1FNWA 4M8AA 5EJWA 3DWQA 1LO5D 1LV9A 2FMCA 2HCIA 2NB0A 4C3IG 4NW2A 2V4DA 3HKZB 4OO1H 1EOTA 5I2XA 5IGCA 1GUSA 4CJ1B 2MGSA 4S3SA 4WORA 2PZUA 2KOLA 1U9RA 2BDNA 4EQPA 1DD2A 4KN7C 4DA2A 1H9SA 3NHHA 3S17B 1PRTF 2MJ8A 1PTOD 1SNQA 1LABA 2ICEC 1EZ8A 4KTAA 4DNTB 5EPKA 1V43A 1M8AA 2WV6D 1MSHA 3NUCA 4WJWA 2EYJA 1MI2A 2FMMA 4J1MA 1TS3A 2IX1A 3DM1A 3D4DA 2PYKA 4KKUA 4LK1C 1TQOA 4KD4A 2R7ZB 3G6JB 4RGMA 5ELCA 1LT5D 3OW7A 2EXZA 1IW7C 4RKBA 2PNRC 3M85A 1PTOC 4A93B 1NAPA 2KHSA 2EDGA 3NK9A 1A3VA 2KA7A 4C56C 5M5YB 1DONA 4IUVA 2XWJB 4XTCS 1KAAA 5KGUA 3HOVB 4KJOA 2PZWA 2EE1A 2F0FA 2A6HC 3CU7A 3NPPA 3QOLA 3GTGB 4IFDI 5ELBA 3MXGA 2AQ2B 3LX0A 3NSWA 1DM0B 5F2DA 1IYUA 2EJGC 1HRJA 2IL8A 2F3VA 2ID0A 2K5QA 5M5XB 2HDLA 3E6ZX 4HTHA 2RSOA 4MHEA 1B2TA 1IW7D 1TR5A 4IN3A 1HTPA 5IOCA 4FXGC 5IGBA 1IKMA 1B50A 1A6XA 4ZKBB 1Z47A 3DWPA 1WTRA 2AQ1B 4H7BA 1CFMA 3MWYW 1CQVA 1DCZA 3F2UA 4CHTB 1PMRA 1O80A 4KY5A 3E5SA 1LT4D 2B8FA 1EY4A 3S2DB 3GTOB 3NTIA 1GHKA 1EWCA 5TSSA 2ZT9C 4NDXA 2E74C 5IGGA 4K8JA 4KK7A 4CJ0B 1D6EC 1ZEQX 2NVTB 1IYVA 2NVXB 1F9QA 4I65A 5ELDA 3TZDA 1XWEA 1STNA 1SYGA 4FF4A 5KNCA 3BVGA 3FPPA 2NTTA 2F0HA 2DNEA 4BY7B 3J80L 1A2UA 4LMQD 5C0XG 2SOBA 2VB3X 1VMCA 1LTBD 1B1ZA 1WTVA 1PFMA 1XXGA 5C4HA 2R3ZA 4KJNA 4XXEA 1K8MA 4G7OC 2EOTA 4XDXA 3I91A 2WP8J 1BO0A 3DHQA 1E2WA 3T16A 1SYEA 5JPMC 2IJ0A 5DNFA 1JWMD 1PRTB 5EKLA 4F7XA 1YNJD 5CV8A 1SFOB 3CKIB 1QCBD 2VNUD 5DAUA 2L11A 3M3YB 4RWSC 1T5EA 3MFYA 4QF4A 3HG9A 5CMDA 1UNSA 1Y69U 3HRZC 1SNOA 1QJOA 2ZXRA 3JAME 2K6AA 3C46A 3NWSA 1NR4A 4KN4C 1YNND 5EQ0A 4KKTA 4PMBA 4CJ2C 2R6GA 1F9PA 1CI3M 1Q3LA 4IUPA 2A73B 4IQZA 1S5ED 1VCIA 1H9RA 3HOUB 3R2TA 3H09A 4IUTA 4DU9A 4FNFA 3S9WA 5JEAH 3PIP3 1PTOB 2F0PA 2Z1CA 1NCVA 2K05A 5JEAG 2B2TA 3H6MA 3Q0AA 2ZXOA 4HCEA 1EYAA 2L0CA 2MP1A 2JA5B 4XYQA 2M00A 2F0QA 2AWNA 4LJZC 3M7GA 3KLSA 1PFNA 2A68C 2E2IB 4KMUC 1TKWB 3A8KE 1QG7A 3HOWB 4WRDA 2BOSA 3V96A 4Z9CB 1GUGA 2A6ED 4RFBA 3DUZA 4OL7A 3K5OA 1E2ZA 3J81L 3OWFA 2Q8TA 1A15A 2C5CA 4Y7NB 2F0VA 4RA8A 5FO9B 2E2DC 3IFDA 4HAEA 3M7NA 2HQEA 3VYRA 2KJXA 1HPCA 1TWGB 5I2YA 1RHPA 3OOCA 4DNRB 5A2QL 5CV4A 2G9HD 2O5JC 1TY0A 1SEBD 2XSCA 1EIHA 2B2TC 1SNPA 2VXWA 1I50B 4ZK9B 4HMJA 4L63B 3A54A 5J39A 4CBVA 3BG3A 1O7LA 3NQIA 2D62A 1CA5A 2F1MA 3EA6A 1BF4A 4QUFA 1UEAB 3VA7A 3PUXA 3KUPA 2BE5D 4C2MB 2K1BA 3GP7A 4N9TA 2QDBA 4ODGA 2OT2A 1VDZA 3S1RB 4HEDA 2WIIB 2OF1A 5ELFA 4DGZA 3Q6SA 1BCPF 1B53A 3PV0A 4M1UB 2J4XA 1IL8A 1SBBB 1WVLA 1KDCA 2EYOA 1GHJA 2AUJD 1HFGA 3G7LA 1YNNC 2KEDA 3NBIA 2D9UA 4RKLA 5D65A 3NXWA 1EYDA 4P2CB 1GXDC 4RGTA 1Q1EA 1LT3D 5M5WB 1Y8OB 3SK6A 2PO4A 1TS4A 4V0BA 1MSGA 4G57A 4H44C 2K01A 5C3WA 1ILPA 2F0EA 1I4RA 2DNCA 5NUCA 2QILA 1LTID 2XVSA 4H13C 4ABNA 3EFXD 1WCMB 1CQFA 3Q24A 1F77A 3NTKA 3J7AF 4MN3A 4IZ8A 4G7HC 1LTAD 3DWAA 4TRDA 5D14A 5J1ZA 4AYBB 2JEAI 1DOMA 2J0TD 1C4QA 1X32A 3OMCA 3T4AC 4X3TA 1TWCB 3X3MA 1TY2A 2O2LD 2NN6I 2CHBD 3S1MB 1EIGA 5FO8B 5IODA 3I4LA 3LWEA 3QOJA 5JOBA 4XQJA 4FXKC 5CV7A 2B2YC 1SE2A 2FHTA 2EY6A 4ZQ3A 3H0GB 4NKLA 1LTRD 1FYCA 2YYZA 1PRTD 2EYMA 3PUZA 1TWFB 1JWUD 1HA5A 5C0XH 2L1BA 1ENAA 1RCVD 4XT3B 1II3A 4C1NK 4TKOB 4K5VA 3QIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYL A;  3MZ5 A;  2O4X A;  3P1H A;  4K6D A;  4DF7 A;  5I6W A;  1EQV A;  2OEO A;  4PMB A;  1KDB A;  5IGD A;  2F0W A;  2F0S A;  2EYH A;  4KY7 A;  5KYL A;  2EYF A;  1SNP A;  2F3W A;  2KHS A;  3OMG A;  4KY6 A;  3EJI A;  5EKK A;  4ZUI A;  4PNY A;  3NK9 A;  4ZQ3 A;  1A2T A;  4HMJ A;  5IGF A;  4NDX A;  1A3V A;  2ENB A;  3SK4 A;  5J39 A;  5ISR A;  5IGG A;  1EY6 A;  4K8J A;  3P75 A;  4EQN A;  2F0L A;  1STB A;  2F0M A;  5C6A A;  1SND A;  4DU9 A;  2PQE A;  2F0N A;  3S9W A;  1AEX A;  1EY0 A;  5J22 A;  1EYC A;  2F0P A;  5JAV A;  2RDF A;  4IZ8 A;  5KRU A;  5M9O A;  2SNM A;  4I65 A;  1SYC A;  1TT2 A;  1KAA A;  2EY1 A;  4IAL A;  3SK8 A;  3NP8 A;  3VA5 A;  5KGU A;  4TRD A;  2EY5 A;  5CGK A;  4K8I A;  1JOQ A;  1EY8 A;  4KJO A;  1STN A;  1SYG A;  1KDA A;  5J1Z A;  5C5L A;  1A3T A;  3D8G A;  1IHZ A;  2PZW A;  1KAB A;  3H6M A;  3RUZ A;  2RBM A;  4K14 A;  2PW5 A;  4R8N A;  2F0F A;  4HMI A;  1EYA A;  3TP7 A;  2F0H A;  4IUN A;  3QOL A;  3SXH A;  4QMG A;  4N9T A;  5I6Y A;  2M00 A;  2QDB A;  2F0Q A;  4ODG A;  1SNM A;  1A2U A;  5KYI A;  3OMC A;  4ME5 A;  2PZT A;  1STH A;  3MHB A;  5CV5 A;  4ZUJ A;  4EQO A;  3LX0 A;  2OF1 A;  2WAC A;  2SOB A;  5F2D A;  1STG A;  3U9O A;  3HEJ A;  3DMU A;  3R3O A;  5K5P A;  4DGZ A;  3BDL A;  2KQ3 A;  4F8M A;  5EGT A;  5IIF A;  5C4H A;  1F2Y A;  2EYP A;  2F3V A;  3HZX A;  4J6H A;  4KJN A;  5IGE A;  4K2L A;  5IGC A;  5IOD A;  1JOO A;  2EY2 A;  5HUR A;  4S3S A;  4EVO A;  3NQT A;  4WOR A;  4HTH A;  1KDC A;  2PZU A;  2EYO A;  2SNS A;  4MIU A;  5I9P A;  4KV6 A;  5C4Z A;  5HGT A;  5C5M A;  4WRD A;  3QOJ A;  4DFA A;  5JOB A;  1TR5 A;  1U9R A;  3DHQ A;  3ITP A;  1JOK A;  3T16 A;  3TP8 A;  5IOC A;  2F0O A;  3TP6 A;  4EQP A;  1SYE A;  5IGB A;  3NHH A;  3OSO A;  4N9P A;  3MXP A;  4K5W A;  4OL7 A;  5CV7 A;  1EY7 A;  1F2Z A;  4YIJ A;  4B9X A;  3D4W A;  4RKL A;  4B9W A;  5EKL A;  3V2T A;  3NXW A;  3OWF A;  5CV6 A;  1EY5 A;  2F0D A;  1EYD A;  5E1F A;  4F7X A;  1SNQ A;  2NUC A;  2EY6 A;  4LAA A;  3ERO A;  5CR3 A;  1EZ8 A;  1SYF A;  4H7B A;  4ID6 A;  1ENC A;  2F0V A;  3PMF A;  5CV8 A;  3SK5 A;  5KIX A;  3D6C A;  4K2K A;  5DEH A;  4NKL A;  1EZ6 A;  4KTA A;  3TP5 A;  2RKS A;  4NP5 A;  5C3X A;  2F0J A;  3QB3 A;  2PW7 A;  4KD3 A;  5CC4 A;  5DAU A;  1SYD A;  3SK6 A;  2EYM A;  4E6I A;  3TME A;  3NUC A;  2F0G A;  2EYJ A;  1JOR A;  5I9O A;  1NSN S;  1STY A;  3MEH A;  2HQE A;  4J1M A;  4KY5 A;  3C1E A;  4PMC A;  5E3F A;  4QF4 A;  3E5S A;  3D4D A;  2PYK A;  3C1F A;  5KEE A;  1RKN A;  3T13 A;  1TQO A;  1EY4 A;  2LKV A;  4KD4 A;  3BDC A;  4QB4 A;  1ENA A;  1SNO A;  2OXP A;  5CV9 A;  1A3U A;  3EVQ A;  1EY9 A;  4G57 A;  4KHV A;  1II3 A;  1STA A;  3SR1 A;  3SHL A;  5C3W A;  2F0E A;  2F0I A;  5NUC A;  1F2M A;  1NUC A;  4NMZ A;  4K5V A;  2EXZ A;  5CV4 A;  1SYB A;  2F0U A;  1SNC A;  3ERQ A;  4K5X A;  4RKB A;  3MVV A;  2F0K A;  2F0T A; 
#chains in the Genus database with same CATH topology
 2EYL A;  1PZI D;  5FK9 C;  3NE5 B;  4PQX A;  2N88 A;  2F0S A;  5K36 H;  4A3B B;  4C1N I;  1JCK B;  5IYC H;  2JA9 A;  3HOY B;  3S14 H;  1LTS D;  2ZXP A;  4BY1 H;  1Q46 A;  2DN8 A;  1CUK A;  1JQY D;  4L5S A;  1O78 A;  2ATW A;  1FVI A;  2NN6 G;  3P75 A;  3VYS A;  3X3N A;  2UUA L;  1E3P A;  1C48 A;  4A3B H;  2NBF A;  1SND A;  4JI3 L;  3S14 B;  3L3O C;  4QJF A;  1SYC A;  1XPO A;  1HNW Q;  1D1K A;  3I56 A;  3J7Y W;  1TII D;  4CDE C;  3WWV A;  5C5L A;  3RR5 A;  3I90 A;  4DK0 A;  3MC0 B;  1TS5 A;  4RGO S;  4U68 A;  3ULL A;  4DV1 Q;  1Z7T A;  3KDF A;  2C35 B;  3AMU A;  4GKK Q;  1WI5 A;  1JE5 A;  4ME5 A;  4I7Z C;  1XMO L;  4DR4 Q;  4APV A;  3R3O A;  3K0X A;  2KQ3 A;  4A3F B;  1PH5 A;  3U9S A;  4B3S L;  5EGT A;  3K58 A;  2Z4I A;  1G91 A;  4OIJ A;  1PH7 A;  2QF7 A;  2D0O A;  2VB2 X;  3NQT A;  3H3V H;  4HN7 A;  4NXN Q;  1CHP D;  3MTS A;  1G2T A;  4MZ9 A;  2JYO A;  4DUY Q;  1C7Y A;  3VYU A;  1V1O A;  4DAY B;  2K5W A;  4XQN A;  3CW2 C;  1AZQ A;  3TP6 A;  3OSO A;  1RIP A;  4K5W A;  1EQT A;  2QA4 A;  3CME A;  2B2W C;  2PI2 A;  4QY7 A;  5DEH A;  1LYL A;  3E3X A;  5C44 H;  1UWV A;  3A8I E;  2EJM A;  3KYH C;  5M3F G;  1H9J A;  5HY6 A;  4R8I A;  1HZB A;  1VQ6 A;  3KF6 B;  5I9O A;  2A6E C;  3MEH A;  5BN3 A;  4JK1 C;  5C44 B;  1PYW D;  5E3F A;  5LMN Q;  2K03 A;  3OTO Q;  4HSV A;  2LMC B;  2LKV A;  1P16 A;  3R2I A;  4JI8 L;  5IWA L;  2ZJR A;  3EVQ A;  4PZ7 A;  1STA A;  1U4L A;  1JE4 A;  2L5T A;  4GN3 B;  1EWI A;  1L0X B;  2A68 D;  3HOW G;  1XNQ L;  3MZ5 A;  3PO2 B;  4DV7 L;  2E5L Q;  4RHR A;  2N49 A;  1HQM C;  4GNX B;  1CM9 A;  2F3W A;  3EJI A;  2QW7 A;  4PNY A;  1O7Y A;  4C3I H;  1WTW A;  4JI4 Q;  3DM3 A;  4EQN A;  3WOF A;  4A93 H;  3TZU A;  3ND8 A;  2PQA A;  3U50 C;  3I72 A;  1K83 H;  4X66 Q;  1SE4 A;  1TT2 A;  3SK8 A;  3U4Z A;  4X65 Q;  4V19 0;  1EY8 A;  3D6W A;  1KRS A;  1DYQ A;  3D8G A;  4BA2 I;  3NBH A;  4UP7 A;  3J81 c;  4LF6 L;  1H95 A;  2L4N A;  3TP7 A;  3VR6 A;  1BKB A;  2N78 A;  2XIW A;  5EPL A;  3RZD B;  4IOC A;  1HQR D;  1ASZ A;  5C4J H;  5IP9 H;  1FJG Q;  3TDQ A;  4RHS A;  1RTN A;  2L15 A;  3RZD H;  2Z6B A;  1ICW A;  1HNX Q;  4A3G G;  3PIO A;  4DV5 L;  3CRL C;  4NXN L;  4B3R L;  1A63 A;  1F9S A;  3BDO A;  1WD0 A;  1P8L A;  2D0P A;  3RLO A;  5HUR A;  1CKM A;  3J81 j;  2SNS A;  5C3E B;  3KJP A;  1BR9 A;  4KV6 A;  3TEH B;  1VQ9 A;  5AJ3 L;  2AWO A;  3VR4 A;  3ITP A;  2K75 A;  4A76 A;  1N34 L;  1GM5 A;  2K33 A;  3S16 B;  1G2S A;  5I4D A;  4JI7 L;  3UE1 A;  4N9P A;  2B2V A;  1LLR D;  5C3E H;  1F2Z A;  3IL8 A;  3PO3 B;  4B9W A;  1HZA A;  1EIY B;  1ILQ A;  3M4P A;  5E1F A;  1H9K A;  1X3Q A;  4IFD J;  5GAD C;  2JA8 H;  1X6O A;  1MGS A;  4KHZ A;  3RN5 A;  1BCP C;  3HKS A;  2RKS A;  5K36 G;  1I4H A;  2F0J A;  1IBK L;  2NN6 H;  3DEO A;  4LFC L;  1B7Y B;  1QWY A;  1SXT A;  2QCP X;  1L1O B;  3S2D H;  1JOR A;  3J80 i;  3J7A V;  1B9N A;  3A55 A;  4LFB Q;  1Y8N B;  4A3G B;  1X3F A;  3K80 C;  1A3U A;  2KCC A;  2MHV A;  5HGQ A;  1YNJ C;  1JT8 A;  3KK7 A;  1J9O A;  1B8A A;  5LMU Q;  2Z4H A;  3CAM A;  4QL5 A;  1K8O A;  2KUM A;  2R92 G;  4K6D A;  4K6L A;  1MHW C;  2SEB D;  3MXU A;  1HFN A;  2NVT H;  5EKK A;  4GLA C;  1XX8 A;  1A2T A;  5T1G A;  2ZJP A;  2B2W A;  2F0L A;  2K5N A;  3H15 A;  3FDT A;  5FJ8 H;  1EY0 A;  2JP1 A;  1QVC A;  4HJ9 A;  3NP8 A;  5D3D A;  3PGZ A;  3S1Q B;  4H02 A;  1X3G A;  4LF6 Q;  1Y1W G;  2XTI A;  3U4V A;  1YEZ A;  4CKE A;  2XNA C;  5CBA E;  4BY7 H;  1WTH A;  5IYD G;  1IHZ A;  3GTQ H;  1XMO Q;  1QNK A;  2KEE A;  4JI0 Q;  4G7Z C;  2E76 C;  1YHA A;  2A5H A;  4DAV A;  3T1H L;  3S15 B;  4HMI A;  1M1K C;  1CZG A;  3EBE A;  1FJG L;  5KND A;  2E2H H;  2R7D A;  1KLU D;  4YCW A;  3MFG A;  4X64 Q;  2PZT A;  1FNV A;  4UPA A;  1I6H B;  2UUC Q;  4X6A H;  3HS0 C;  1ONL A;  2CFM A;  1D5M C;  5K5P A;  1FR3 A;  1N9W A;  4DR6 L;  2E2J B;  2VUM G;  1Q12 A;  3W3A A;  3OHX C;  3GV6 A;  5COY A;  3BVZ A;  1N32 Q;  1YBY A;  1JOO A;  2YTX A;  2WFW A;  4HJ8 A;  2YU9 B;  3GTJ H;  1JWS D;  1TWA B;  3W2D A;  4OO1 G;  1FD7 D;  1LM0 A;  1OXX K;  2Q2H A;  3TP8 A;  1K28 A;  2HUG A;  2ZTE A;  1HR0 Q;  4NXM L;  1NMF A;  3CC4 A;  3D4W A;  3HKZ G;  2WAQ B;  1NJI C;  1TWH H;  1Q90 A;  1GUO A;  4AYB G;  4DR2 Q;  2UU9 Q;  4LAA A;  3GDE A;  3NEM A;  3PMF A;  4GNX A;  2MQH A;  4JPB W;  2J7Z A;  3G4S A;  1YIT A;  1WOC A;  4BBS G;  1VQM A;  1PRT C;  4IOA A;  1XMQ Q;  1R4P B;  2B2U C;  4QIW B;  5CC4 A;  1TWH B;  3OW2 A;  1J8I A;  4DR7 L;  2LY7 A;  2PCF B;  1FGB D;  4A3E H;  3T51 B;  3K7A B;  3N6R A;  5LMU L;  4ULL A;  2HIX A;  3T1H Q;  1AP0 A;  5BR8 Q;  1S3O A;  3P20 A;  4QB4 A;  4ZRZ A;  3LWU A;  4AQY Q;  1UE1 A;  1N36 L;  2KCN A;  4DAY A;  2F0U A;  3ERQ A;  2RHS B;  4A75 A;  3MVV A;  2F0K A;  3HOZ G;  5I6W A;  1Q81 C;  2RCN A;  4LFC Q;  2AUK A;  5FLM G;  2AHO B;  1LUZ A;  1OXV A;  2AKW B;  1EWH A;  2WIN B;  2NYZ D;  2VQF L;  1A62 A;  1NR2 A;  2ENB A;  3L7Z C;  3SK4 A;  2JA6 B;  4BXX G;  1EY6 A;  3KJO A;  1AE3 A;  2NZH A;  5C6A A;  3RD4 A;  1DZ1 A;  2RDF A;  4R4Q A;  1D5X C;  2EXD A;  1S5F D;  2L9H A;  4B3S Q;  4EQ5 A;  3IAY A;  2RA4 A;  3OWE B;  3FKI B;  1GO3 E;  5GAG C;  4JC0 A;  1D5Z C;  1EQR A;  1LTG D;  1PH8 A;  2CW0 D;  4MTN A;  1HR0 W;  1GOZ A;  5I6Y A;  1HNX L;  4A3K G;  1KQS A;  2A8V A;  1D2B A;  1Q1B A;  4CKC A;  4P75 A;  1AH9 A;  3W5O A;  1XTC D;  2GA4 B;  4QGU A;  2EPB A;  2Z8L A;  3E0J A;  4Q0F A;  5FKA C;  4DV2 L;  2B63 H;  1JMC A;  1I6V C;  1PXU A;  2TSS A;  5BN5 A;  1MJC A;  2EYP A;  2N8N A;  1VQN A;  2PQA B;  1KHI A;  1SMY D;  4JI0 L;  1PZJ D;  2B63 B;  4A3J H;  3ICE A;  3B6Y A;  3DLL A;  2NVQ B;  2H5X A;  3HOX H;  1BDO A;  3AB9 A;  5C5M A;  4LW1 A;  3E0E A;  1BUV T;  3CHB D;  3P7J A;  4BXX H;  1S4Z A;  4FF1 A;  2PI2 E;  4JI8 Q;  1KLG D;  2NVQ H;  1W6J A;  4YIJ A;  1IBK Q;  1DGS A;  3L9A X;  2N55 A;  1N36 Q;  3V2T A;  3SE0 A;  2HCC A;  1GUW A;  2NUC A;  2I5L X;  1JOQ A;  2V1C C;  4DN4 M;  3D6C A;  1K3R A;  2QKI C;  5LL6 X;  3TSS A;  1JC7 A;  1CHQ D;  1ENF A;  4Y7N H;  1KTK A;  1TWG H;  4DR5 L;  2R92 B;  3GTK H;  4X3S A;  1NSN S;  3ONA B;  2K28 A;  3CPF A;  4DKA C;  4A3I H;  3FEW X;  3RMH A;  3C1F A;  4NXM Q;  4HIO A;  3T13 A;  4FO2 A;  2UUB L;  4UHV A;  3GTK B;  1AN8 A;  1OXU A;  2F0I A;  3QWN A;  1IKL A;  4NMZ A;  5C4X B;  1YJ9 A;  2F0T A;  1VQF A;  3P1H A;  1H9S B;  3TQY A;  1EQV A;  2O5I C;  2TMP A;  1G6Z A;  5KNB A;  3CC2 A;  5A2Q E;  3S1N H;  2BA0 A;  2BDO A;  5C4X H;  5JJK A;  2B2Y A;  1RD9 D;  1V1P B;  1Q8I A;  3BYY B;  1STB A;  1SJE D;  1I50 H;  2B3G A;  2FIN B;  1EYC A;  4JI1 L;  5C4X G;  4C3H H;  2B2U A;  1BOS A;  4O1N A;  2ASB A;  3HOZ B;  1V1Q A;  3CCQ A;  2FFK B;  2UXB Q;  3PO3 G;  1WD1 A;  4ALP A;  2QEJ C;  1I4Q A;  2RDG A;  5LL6 S;  3G71 A;  1TVX A;  2WKD A;  4DR6 Q;  2ZM6 Q;  2Q8I B;  4IUN A;  4BBS B;  2CQO A;  2QEX A;  3HKZ E;  2BCO A;  4OGQ C;  4UDU C;  2VW9 A;  1G29 1;  4ZUJ A;  3K59 A;  4DV7 Q;  2E5L L;  3H3V I;  3HGB A;  4P72 A;  2VY3 A;  3CRK C;  2RDH A;  3TRE A;  1VQB A;  3SVM A;  5IGE A;  2NTS A;  2K5V A;  2EY2 A;  3PIP A;  2E75 C;  3BZD B;  2JQO A;  1WTP A;  1LT6 D;  2UU9 L;  1MD2 D;  4O0A A;  4R4O A;  4DV0 Q;  3PO2 G;  4KI0 A;  4X65 L;  1CK1 A;  5IWA Q;  2F0O A;  5C0X J;  2MO0 A;  2BE5 C;  3F8T A;  3OPO A;  1Y8P B;  2R7F A;  1TU2 B;  1WTX A;  2L55 A;  4LF8 Q;  1J5E Q;  2CW0 C;  1CTM A;  5CV6 A;  3QJY A;  1WTO A;  4DXG A;  4RCN A;  4K2K A;  1K3B C;  3QB3 A;  3D3R A;  1ESR A;  4ZYS A;  4KD3 A;  4JI2 L;  4JI4 L;  1B44 D;  4P74 A;  1JB3 A;  2DY7 A;  3A7L A;  4OIK A;  1R9T B;  3DEP A;  3CCL A;  3NWT A;  3A7A B;  3AEV A;  3FRP B;  5D3I B;  1QB5 D;  3K6O A;  1B3Q A;  3KBX A;  1R9T H;  5IE8 A;  3TS0 A;  4JW0 A;  2IW3 A;  1EU3 A;  1JR0 D;  4IO9 A;  3JAM c;  5LMN W;  4BWG B;  2SDF A;  1SNC A;  3KLW A;  4TSS A;  2IT1 A;  4A4I A;  4C3I B;  1WCM H;  5M3F B;  1JJG A;  2EJF C;  4DR4 L;  3CQZ B;  1SR3 A;  2EYH A;  4KY7 A;  2EYF A;  1K83 B;  2F52 A;  4C3J B;  1UUP A;  1C0A A;  3GO5 A;  3VR2 A;  3JAM L;  2F0M A;  2UUB Q;  3HFZ B;  3I8Z A;  1EEF D;  1GUN A;  2I0Q A;  4JI5 Q;  4B08 A;  5JAV A;  4B3R Q;  2LS0 1;  4A3I G;  3PQI A;  3GV3 A;  2JA8 G;  3RLF A;  1J5E L;  2QDL A;  4BBR G;  2I07 B;  2RBM A;  4JBW A;  4QCL A;  4HCS A;  1XNR Q;  2HHH L;  4FXD A;  1QZH A;  2IX3 A;  3QO2 A;  1PH6 A;  1MIU A;  1SNM A;  4XQQ A;  2UUA Q;  1JJC B;  4LFA L;  3CF5 A;  2LXJ A;  3S2H H;  4DV3 Q;  4RAU C;  1FNU A;  1I4X A;  1X3E A;  3J81 E;  5IIF A;  2XWB B;  5FLX L;  3HZX A;  5IT9 E;  3BVM A;  4C3J G;  1SJH D;  3S2H B;  3CP0 A;  1PTO F;  5C4Z A;  1QZG A;  3PO3 H;  4N8X 1;  1GD7 A;  1DOL A;  1QIL A;  2NZ1 D;  5M5X H;  1VQ7 A;  2RHQ B;  2JA8 B;  4DR7 Q;  1ZKO A;  1IBL Q;  4YWK A;  4JG2 A;  5COR A;  5BN4 A;  3J80 E;  3I70 A;  1TS2 A;  4OON A;  1UE6 A;  1Y1V G;  3GTP B;  2Q2I A;  1ENC A;  5M3M B;  3SK5 A;  4FF2 A;  3MXN A;  4DR3 L;  3IFT A;  2PW7 A;  5JPN C;  4DUZ Q;  3K7U C;  1PHJ A;  1C8C A;  1GVP A;  3GTP H;  3I4N H;  3PUY A;  4E6I A;  3TME A;  2YTV A;  1SE3 A;  2F0G A;  4OX9 Q;  4DV0 L;  4A3L G;  1STY A;  1S5D D;  1B3A A;  1DJR D;  3I4N B;  3BDC A;  3MA2 B;  1N32 L;  1XPR A;  5IT9 L;  2K5D A;  1TWF H;  4KHV A;  1VQD A;  4OHJ A;  4PMW A;  5JEA J;  1SYB A;  2EIF A;  4WFN 3;  5L37 A;  4IUQ A;  4K5X A;  4BY1 B;  3TRZ A;  2HD3 A;  4YY3 Q;  4NB3 A;  5EAY A;  2PPB C;  2NWG A;  1SMX A;  5ELE A;  1ET9 A;  3L0O A;  5E4W C;  4ZLT F;  3QG1 A;  3BYT B;  3WOE A;  1PH9 A;  3TBI B;  2NVY B;  2WKC A;  4DK1 A;  3PUV A;  1BXT A;  4F88 A;  4BS9 A;  5M9O A;  4FVM A;  3SGI A;  4OWX B;  4UY8 C;  3VA5 A;  1HHV A;  2EY5 A;  2D2C C;  1RDP D;  2HHH Q;  1KDA A;  1WTQ A;  5IT9 c;  2PW5 A;  1W3S A;  4FP5 D;  1U4P A;  3TS2 A;  1EFW A;  1Q8K A;  4QMG A;  1AFP A;  3TN2 A;  4DV3 L;  5C3E G;  4A3F H;  1S5B D;  3MHB A;  2WB1 G;  3T56 B;  3WDN A;  1L1O C;  1STG A;  2B2V C;  3U9O A;  4XIG S;  1VQK A;  3DMU A;  2GVA A;  5JJZ A;  2UXD L;  2F03 A;  4JI6 L;  1BNZ A;  5CBE E;  1F2Y A;  4KHP Q;  2LFN A;  1Z6H A;  4K2L A;  2A74 C;  5FO7 B;  3V05 A;  4J15 A;  2I46 A;  1HNZ Q;  4UP8 A;  1S5C D;  3MXN B;  1U4M A;  2L12 A;  3I4M G;  2KVM A;  1EU4 A;  2CQA A;  1EY7 A;  2K4K A;  2R93 B;  1GUT A;  1YVC A;  3IRB A;  1EY5 A;  2Y0S E;  3L2P A;  4XT1 B;  5KIX A;  3J81 i;  1EZ6 A;  3TP5 A;  5G3L F;  3A8J E;  3MEF A;  1PZK D;  4J8Q A;  3PUW A;  1BQQ T;  2X6L A;  3GTM B;  2FXQ A;  4DAP A;  3PIO 3;  5H1S E;  4L8J A;  1RJT A;  5EBC A;  2VUM B;  4B9X A;  5CV9 A;  4PZ6 A;  2OWO A;  2BH8 A;  1BBW A;  2K50 A;  1SDF A;  3ND9 A;  2VUM H;  2RSN A;  1MBY A;  1LAC A;  1O7Z A;  4DF7 A;  4JCV E;  4X3U A;  2OEO A;  3U58 A;  2XN9 C;  3HOU H;  4JI5 L;  4OWW B;  5KYL A;  4F87 A;  3R8B A;  1M4V A;  2Z6K A;  4ZUI A;  1PTO H;  1CT1 D;  4OX9 L;  5IGF A;  2A69 D;  2F4V L;  1CKN A;  1QNU A;  1LTT D;  4GNX C;  2XRS D;  1KNE A;  4ILW A;  1DOK A;  2SNM A;  1EOV A;  4IAL A;  1UEB A;  3K57 A;  1AW7 A;  1L1O A;  1PLF A;  3D31 A;  3FMC A;  1RTO A;  5EKI A;  5JVG 3;  1VQL A;  1KAB A;  2IPK D;  3M4O H;  2IX0 A;  4X66 L;  4LF4 L;  1E0B A;  1EEI D;  1STE A;  4OXP A;  1BCP B;  3K5L A;  3DXJ C;  4NPS A;  3E9I A;  1W2B A;  3M4O B;  5ELO A;  4OO1 I;  1YZ6 A;  4EQO A;  1STH A;  1RL2 A;  5C44 G;  1Y1W B;  2JA5 H;  2JXM B;  4A3J B;  3BDL A;  2DJF C;  4P71 A;  5FLX E;  4F8M A;  4DXF A;  3M9B A;  2K14 A;  5C4J B;  4J6H A;  1IBL L;  2A69 C;  3S16 H;  1CA6 A;  3AYH B;  1ROD A;  1X3P A;  2G5D A;  4EVO A;  2OTL A;  2JN4 A;  2H4O A;  3UDI A;  5HGT A;  1HXY D;  4DFA A;  4H0L C;  2DJG C;  4A3M G;  1KIX A;  3K0Y A;  1JOK A;  2M2L A;  2RVL A;  1RF2 D;  4DPG A;  1WJJ A;  4A3D B;  1U0L A;  4MNO A;  4Q5V A;  2K32 A;  5CYU A;  4U67 3;  3HOW H;  4IFD G;  2F0D A;  1E2V A;  3KBG A;  4ZKC B;  2JA7 G;  4RH6 A;  2RQX A;  4A3I B;  3OIQ A;  2KHJ A;  1SYD A;  1AE2 A;  1I5F A;  1HUM A;  1R4Q B;  3ULP A;  3C3L A;  4JV5 L;  3CCE A;  4X62 Q;  1RKN A;  3ZYY X;  3J7A 5;  1I3Q H;  3D4R A;  4RG1 A;  1IYJ B;  4FDB A;  1B70 B;  1SRU A;  3ULJ A;  2H1E A;  1NUC A;  3S1N B;  1KNA A;  3LNN A;  4PV1 C;  4N8F A;  1I3Q B;  1K8G A;  3GQB A;  1EQQ A;  2R61 A;  4A3M B;  1H9M A;  3Q22 A;  4KY6 A;  3NTH A;  1T5X D;  3GTO H;  1CSP A;  3PF5 A;  5ISR A;  4AQY L;  3S1Q H;  4FYD A;  2JA7 B;  1Q82 C;  3R93 A;  1VQE A;  2PQE A;  2F0N A;  4LFA Q;  3T53 B;  5BR8 L;  1ZYR C;  1X54 A;  2CVR A;  4ZAI A;  5CGK A;  4K8I A;  1KD1 C;  5T1I A;  2EVB A;  2E2H B;  1A3T A;  1L2F A;  4YHH Q;  3FVQ A;  3RUZ A;  3S1R H;  3A56 A;  1ZYR D;  4R8N A;  2F4I A;  4KLK A;  3ER0 A;  2M9V A;  3M4Y A;  4CDD C;  4RCO A;  3W1G A;  3GTQ B;  4RGN A;  4R4C A;  5CV5 A;  1KAW A;  4O42 A;  4IJL A;  4KKS A;  1IBM Q;  4GKJ Q;  2WAC A;  4C2M H;  1VQC A;  1SN8 A;  4IUR A;  4CGY B;  3I73 A;  1OXS C;  4X3K A;  4A3K H;  3GTJ B;  1VQ4 A;  4R9W A;  1KC8 C;  4BA1 I;  1TWA H;  1PDQ A;  3GTL B;  1ZXT A;  3A74 A;  2CWA A;  4RMF A;  1HCZ A;  1V1P A;  4LUZ A;  4A3K B;  4HIK A;  5I9P A;  1SRO A;  5JJI A;  4BY1 G;  3MAQ A;  1G8Z D;  2I5M X;  2MUY A;  1IZ6 A;  3C2P A;  2WB1 E;  1I4G A;  1BBX C;  3IKJ A;  4JBK A;  3MXP A;  5E4X A;  1J6Q A;  1VF7 A;  5EPJ A;  3VR5 A;  3EQL C;  3LGJ A;  1JIC A;  5CR3 A;  4ID6 A;  2EZV A;  1GKH A;  1HJP A;  4B3T Q;  5C3X A;  1I4P A;  1F2L A;  4BBR H;  1AZP A;  3NEL A;  3H3V C;  3BZK A;  3BS1 A;  2PMZ B;  2HDM A;  4DV4 Q;  3SEB A;  4L5Q A;  3STB C;  3H91 A;  4BBR B;  2R93 G;  3O13 A;  5M5W H;  5KEE A;  3CCS A;  1Y1V B;  2K04 A;  1HTL D;  4LUV A;  2A6H D;  4UAI A;  2IY5 B;  2OXP A;  1VQG A;  1E1T A;  3GD7 A;  1EY9 A;  4A3E B;  3SR1 A;  3CQZ H;  3SHL A;  2Q2T A;  1QE6 A;  5LHY 1;  1Y1V H;  5C0X I;  3KLR A;  2KEC A;  2O4X A;  5IGD A;  3F2B A;  4IFD H;  4HR7 B;  3I4M B;  3OMG A;  2F3I A;  2B39 A;  3JAM i;  2C9O A;  3FPU B;  1BCP D;  2G9D A;  3K5M A;  1SAP A;  1XYI A;  5KRU A;  5EBD A;  1B9M A;  4L6T B;  3RZO B;  1C9O A;  2UXD Q;  2AQ3 B;  2WB1 B;  1YNX A;  2DY8 A;  3HOY G;  2XRQ D;  4FF3 A;  4C3H G;  2Z6K C;  4K14 A;  3URY A;  2HT1 A;  3SDZ A;  3AU7 A;  4B3T L;  2ICI A;  5DM6 3;  4EGV A;  3FKI H;  3N52 A;  4JI1 Q;  1VMP A;  2KCM A;  2YV5 A;  4LF5 Q;  5KYI A;  3I2Z A;  1OO9 B;  4AYB E;  2MFI A;  2X69 A;  3HEJ A;  2ES2 A;  1G6P A;  5G3L D;  2K7V A;  1CKO A;  1EFI D;  1K8A C;  1VF5 C;  2BA1 A;  4GN4 B;  2XGT A;  4MIU A;  3S1M H;  1XNQ Q;  2E2I H;  2JSO A;  1Z9F A;  3VYT A;  2X6G A;  1EL0 A;  3H94 A;  4IUU A;  1B4O A;  1HZC A;  2LSS A;  4QUC A;  3OIP A;  3CD6 A;  3HOX B;  1JB7 A;  3K5N A;  1PYB A;  2VL6 A;  4G4K A;  1U4R A;  4JOI C;  3ERO A;  1SYF A;  3UI2 A;  2IWH A;  1QOH A;  3HP3 A;  4POG A;  1CZW A;  4LUO A;  4NP5 A;  2IHF A;  5ELN A;  1GJX A;  5A35 A;  1NTG A;  2Y0S B;  3H0G H;  1SMY C;  1W6K A;  2Q8R E;  3FKI G;  1UAP A;  1ASY A;  2VQF Q;  3Q8D A;  4PMC A;  3C1E A;  5JVH 3;  2JE6 I;  2R92 H;  2HIV A;  1QUQ B;  3UDF A;  3CCV A;  1SE8 A;  1D1I A;  4K0K Q;  1F2M A;  2FJ2 A;  4CKB A;  3KF8 A;  1ESF A;  5GAH C;  1F9R A;  5AFW A;  3VR3 A;  2MNA A;  3KLS X;  1KDB A;  2F0W A;  5FOB B;  2NVY H;  5FJ8 G;  3AFP A;  3I3C A;  2B8G A;  2D5D A;  1DXM A;  1SSO A;  3RLN A;  1V8Q A;  4C3H B;  2JEB I;  1PVO A;  4GZY C;  3Q23 A;  3T1Y L;  4XYO A;  1AEX A;  2MPM A;  5J22 A;  1ET6 A;  1X55 A;  2IHE A;  4QIW E;  3CCU A;  2EY1 A;  1HUN A;  4O2D A;  2VZA A;  1UE5 A;  2B29 A;  1D8L A;  3FHW A;  5DM7 3;  1PFB A;  4TQU S;  1K73 C;  3NBH B;  1O7I A;  1HA6 A;  1L0Y B;  1NNX A;  1ML0 D;  1OXT A;  4HSP A;  3SXH A;  1FNW A;  4M8A A;  3EIV A;  3DWQ A;  5EJW A;  1LO5 D;  1U5K A;  1LV9 A;  5GAE C;  2FMC A;  2HCI A;  2NB0 A;  4B3M L;  4C3I G;  4NW2 A;  2V4D A;  1OTC A;  4A93 G;  1XJV A;  3BJU A;  4IPC A;  3HKZ B;  4OO1 H;  1EOT A;  5I2X A;  3F2C A;  4JYA L;  5IGC A;  1GUS A;  4LWC A;  4CJ1 B;  2MGS A;  4S3S A;  2RCF A;  4DR1 L;  4WOR A;  2PZU A;  4JI7 Q;  3S17 H;  2R93 H;  2KOL A;  4JBM A;  1U9R A;  2BDN A;  5JJL A;  4QQB X;  2KHI A;  1IXR A;  4KN7 C;  4DA2 A;  4EQP A;  1H9S A;  3NHH A;  2OTJ A;  4LF9 Q;  1DD2 A;  4JVZ A;  3CCM A;  3S17 B;  1PRT F;  2MJ8 A;  2PMZ E;  2Z0S A;  2OQK A;  1PTO D;  2R7Z G;  1SNQ A;  1LAB A;  2ICE C;  1EZ8 A;  2KBN A;  2MO1 A;  1QUQ A;  3GTM H;  5IYD H;  4KTA A;  1EYG A;  4OEL B;  4DNT B;  5EPK A;  2F4V Q;  1V43 A;  1M8A A;  2WV6 D;  2R7Z H;  1MSH A;  3NUC A;  4WJW A;  2EYJ A;  1MI2 A;  2FMM A;  4J1M A;  1N34 Q;  1TS3 A;  2IX1 A;  3DM1 A;  4ME3 A;  3ZJY C;  3D4D A;  2PYK A;  4KKU A;  4LK1 C;  1TQO A;  4JI3 Q;  4KD4 A;  2R7Z B;  3G6J B;  3PO2 H;  4RGM A;  5ELC A;  1LT5 D;  3OW7 A;  2EXZ A;  1IW7 C;  3EN2 A;  4LF7 Q;  4RKB A;  2PNR C;  1Q7Y C;  3M85 A;  1PTO C;  1K0R A;  4DR3 Q;  3QR8 A;  4A93 B;  5M5Y H;  1NAP A;  2KHS A;  2EDG A;  3NK9 A;  3F2D A;  3HOX G;  1A3V A;  1E1O A;  1CSQ A;  2OQ0 A;  2KA7 A;  4C56 C;  4CDC C;  1KRT A;  4DR1 Q;  5M5Y B;  1DON A;  3HOV H;  5IP7 H;  4IUV A;  1TXY A;  2XWJ B;  4XTC S;  1KAA A;  5KGU A;  4CDF C;  1VQI A;  2A1A A;  2PNH A;  2ALY B;  4DR5 Q;  3HOV B;  4KJO A;  2PZW A;  2EE1 A;  5IYB H;  1PH3 A;  2F0F A;  2A6H C;  3CU7 A;  3NPP A;  4YCU A;  3QOL A;  3GTG B;  4IFD I;  5ELB A;  3MXG A;  2AQ2 B;  3LX0 A;  3NSW A;  4L5T A;  3KF8 B;  1DM0 B;  5F2D A;  1IYU A;  2EJG C;  1XNR L;  1D7Q A;  1HRJ A;  2IL8 A;  1PFS A;  2F3V A;  2ID0 A;  2K5Q A;  5M5X B;  3UE0 A;  2HDL A;  3E6Z X;  4HTH A;  1HR0 L;  2RSO A;  4MHE A;  4HIM A;  3A0J A;  1B2T A;  1IW7 D;  1TR5 A;  4IN3 A;  1HTP A;  2N3S A;  5IOC A;  4FXG C;  5IGB A;  5M3M H;  1IKM A;  1B50 A;  2UUC L;  1VQ8 A;  1A6X A;  2UXB L;  4ZKB B;  5LMN L;  1Z47 A;  4PZ8 A;  3DWP A;  4KHP L;  2UXC L;  1WTR A;  1KL9 A;  2AQ1 B;  2JJQ A;  4H7B A;  4EX5 A;  1CFM A;  1Q86 C;  3MWY W;  1CQV A;  3NEN A;  1DCZ A;  3F2U A;  3KF6 A;  4CHT B;  1PMR A;  1O80 A;  4KY5 A;  3E5S A;  3PSI A;  1LT4 D;  2B8F A;  2WAQ G;  2Z9H A;  1EY4 A;  1VQH A;  1A0I A;  5GRO A;  3S2D B;  4BY7 G;  4GOP B;  4GS3 A;  3GTO B;  3NTI A;  1GHK A;  1E7Z A;  1LTL A;  3OYY A;  2K52 A;  4DV2 Q;  4GLV B;  1EWC A;  5TSS A;  1XPU A;  1HH2 P;  2ZT9 C;  4A3C G;  1FGU A;  2NVX H;  4NDX A;  2E74 C;  3I4N G;  4IPH A;  3JC6 6;  5IGG A;  4TVA B;  4K8J A;  4A3L H;  4KK7 A;  4CJ0 B;  3RNU A;  1D6E C;  1ZEQ X;  2NVT B;  1IYV A;  3HOY H;  2A19 A;  2NVX B;  1F9Q A;  4I65 A;  5ELD A;  3J80 c;  3TZD A;  4JBJ A;  1XWE A;  1ICF B;  1MKH A;  1STN A;  1SYG A;  1T9H A;  4FF4 A;  4OEM B;  5KNC A;  4DV5 Q;  3BVG A;  2RF4 A;  3FPP A;  2JA6 G;  1I6H H;  2NTT A;  4AIM A;  1EIF A;  2F0H A;  2DNE A;  4BY7 B;  2CWP A;  1NMG A;  2ZJQ A;  3VDY A;  5FLM H;  3J80 L;  1A2U A;  1PYS B;  3I55 A;  4LMQ D;  3ERS X;  5C0X G;  3S15 H;  1K0S A;  2SOB A;  4PG3 A;  2VB3 X;  1VMC A;  5DLQ E;  1LTB D;  1B1Z A;  1WTV A;  2YU9 H;  2AMC B;  1PFM A;  4LF4 Q;  1XXG A;  5C4H A;  3G6E A;  2R3Z A;  4KJN A;  4XXE A;  1K8M A;  1WYD A;  4G7O C;  2EOT A;  4GN5 A;  3CC7 A;  4XDX A;  3I91 A;  4POF A;  2WP8 J;  1PH1 A;  2VQE Q;  1BO0 A;  2K5H A;  3DHQ A;  1E2W A;  3T16 A;  1SFO H;  1SYE A;  2YTY A;  5JPM C;  2IJ0 A;  5DNF A;  1JWM D;  1PRT B;  1YIJ A;  5EKL A;  1PV4 A;  4F7X A;  1YNJ D;  4LFB L;  4YCV A;  5CV8 A;  3UDG A;  1SFO B;  3CKI B;  1IL2 A;  3M3Y H;  2CCZ A;  1MJE A;  1QCB D;  3K7A H;  2E8G A;  2VNU D;  5DAU A;  2L11 A;  3HOV G;  3FP9 A;  3M3Y B;  1VQA A;  4AH6 A;  4RWS C;  1T5E A;  3MFY A;  4QF4 A;  3HG9 A;  5E7N A;  1UNS A;  5CMD A;  3BU2 A;  5FLX c;  4A3J G;  1Y69 U;  3HRZ C;  1SNO A;  1WCM G;  1SLJ A;  1QJO A;  2ZXR A;  3JAM E;  2K6A A;  3C46 A;  3I4M H;  3NWS A;  1S40 A;  1NR4 A;  4KN4 C;  5AJ3 Q;  1YNN D;  5EQ0 A;  4KKT A;  4PMB A;  4CJ2 C;  2R6G A;  1F9P A;  1CI3 M;  1IBM L;  1Q3L A;  4GKJ L;  4IUP A;  4LF5 L;  3S24 A;  2A73 B;  3A5Z B;  4IQZ A;  4L5R C;  1S5E D;  4YY3 L;  1VCI A;  1H9R A;  5GQO A;  3HOU B;  3R2T A;  3H09 A;  4B3M Q;  2VS1 A;  3D0F A;  3KFU A;  4IUT A;  4DU9 A;  4FNF A;  3S9W A;  5JEA H;  3PIP 3;  1PTO B;  2F0P A;  3OTO L;  4HJA A;  4DV6 Q;  2Z1C A;  2GN5 A;  1NCV A;  1QVG A;  3K8A A;  2K05 A;  4A3B G;  1K9M C;  2ZTD A;  3BZC A;  5JEA G;  1NE3 A;  2B2T A;  1BVS A;  3H6M A;  3J7Z C;  3Q0A A;  2ZXO A;  4WJ3 M;  4HCE A;  1V9P A;  1EYA A;  2L0C A;  2MP1 A;  2JA5 B;  4XYQ A;  2M00 A;  2F0Q A;  2AWN A;  4LJZ C;  1X9N A;  3M7G A;  3KLS A;  4DR2 L;  1PFN A;  4DV4 L;  2A68 C;  2E2I B;  1YHQ A;  4GLX A;  2CKZ B;  4KMU C;  1I94 L;  1E24 A;  1Y1W H;  1TKW B;  3A8K E;  1QG7 A;  4A3D H;  1HZ9 A;  2ZM6 L;  3HOW B;  3AFQ A;  4WRD A;  2BOS A;  4DV1 L;  3V96 A;  4Z9C B;  1GUG A;  2A6E D;  1YHB A;  4R1J A;  4RFB A;  1N33 L;  2CH4 W;  3DUZ A;  4OL7 A;  3K5O A;  1E2Z A;  3J81 L;  3OWF A;  2Q8T A;  4YWL A;  1A15 A;  2C5C A;  4Y7N B;  2F0V A;  2I5H A;  4DK3 C;  4RA8 A;  2OCE A;  5FO9 B;  2E2D C;  3IFD A;  4Y52 H;  4HAE A;  3M7N A;  3I4O A;  2HQE A;  4DNI A;  3VYR A;  2KJX A;  1HPC A;  2LXK A;  4A3F G;  1TWG B;  1KXL A;  2P5Z X;  5I2Y A;  1RHP A;  3OOC A;  4A3M H;  1NY4 A;  4DNR B;  5A2Q L;  1VQO A;  5CV4 A;  1PH4 A;  4A3G H;  1XTD A;  2G9H D;  4IJH A;  2O5J C;  1TY0 A;  1SEB D;  2XSC A;  4LF9 L;  1EIH A;  2JA7 H;  2B2T C;  1SNP A;  2VXW A;  4ZCK A;  1I50 B;  4ZK9 B;  2KCT A;  4GOP C;  4L63 B;  4HMJ A;  3A54 A;  5J39 A;  2WAQ E;  4CBV A;  1Y14 B;  3BG3 A;  5IP9 G;  1S72 A;  1XMQ L;  5IYB G;  1QVF A;  1O7L A;  3NQI A;  1VQP A;  3I7F A;  2D62 A;  1CA5 A;  1VS0 A;  3RN2 A;  4BBS H;  2F1M A;  1PH2 A;  3EA6 A;  1A8V A;  1BF4 A;  3M4Q A;  4QUF A;  1UEA B;  3CMA A;  2ZTC A;  3VA7 A;  3PUX A;  1YJN A;  3HOZ H;  3KUP A;  1G51 A;  2BE5 D;  4C2M B;  2K1B A;  1YI2 A;  3GP7 A;  4DK6 C;  4N9T A;  5IYC G;  4DUZ L;  1YJW A;  2QDB A;  1BBU A;  2Y0S G;  4ODG A;  2OT2 A;  1VDZ A;  3S1R B;  4YHH L;  4HED A;  2WII B;  2OF1 A;  4P73 A;  3STB D;  5ELF A;  2UXC Q;  4DGZ A;  3Q6S A;  1BCP F;  1X65 A;  1B53 A;  4GKK L;  1UE7 A;  3PV0 A;  4M1U B;  3AQQ A;  1E22 A;  2QGQ A;  2J4X A;  1IL8 A;  1SBB B;  3H0G G;  3CPW A;  1WVL A;  4IPD A;  1VQJ A;  2E2J H;  3HOU G;  1KDC A;  1N33 Q;  2EYO A;  4R4T A;  1GHJ A;  2AUJ D;  3GTL H;  1JJ2 A;  1HFG A;  3G7L A;  4X62 L;  1YNN C;  2KED A;  4JI2 Q;  4HID A;  3NBI A;  2D9U A;  4RKL A;  1N8R C;  4LF7 L;  2GVB A;  3NXW A;  5D65 A;  1EYD A;  4P2C B;  1GXD C;  4RGT A;  1NBW A;  1Q1E A;  1LT3 D;  5M5W B;  2JK8 A;  3KOJ A;  4HJ7 A;  1Y8O B;  3SK6 A;  2PO4 A;  1TS4 A;  4V0B A;  4OWT B;  3W1B A;  5M3M G;  1MSG A;  4G57 A;  4H44 C;  2K01 A;  5C3W A;  1ILP A;  2F0E A;  1I4R A;  2DNC A;  3E9H A;  5NUC A;  2QIL A;  1X56 A;  1LTI D;  4JI6 Q;  2XVS A;  4H13 C;  4ABN A;  3EFX D;  1VQ5 A;  1FL0 A;  1WCM B;  5M3F H;  1CQF A;  4JOI A;  3Q24 A;  1HNZ L;  2NZO A;  1F77 A;  3NTK A;  2Q2U A;  3J7A F;  3F1Z A;  4MN3 A;  4IZ8 A;  4G7H C;  1LTA D;  1M90 C;  4C3J H;  4I7A A;  3DWA A;  2JA6 H;  4K0K L;  4TRD A;  5D14 A;  4A3D G;  3GTG H;  5J1Z A;  2KEN A;  3CCJ A;  4AYB B;  2JEA I;  4JV5 Q;  1DOM A;  3RZO H;  2J0T D;  1C4Q A;  3T1Y Q;  1TWC H;  4DUY L;  4A3E G;  2HQL A;  5IY0 A;  1X32 A;  3OMC A;  1I94 Q;  3T4A C;  4X3T A;  1TWC B;  3X3M A;  3PF4 A;  1TY2 A;  2O2L D;  3UDX A;  4IPG A;  2NN6 I;  2CHB D;  4HJ5 A;  4LF8 L;  3S1M B;  1L0W A;  1EIG A;  5FO8 B;  5IOD A;  3I4L A;  4A3C H;  1CKN B;  3A5U A;  3CCR A;  1PA6 A;  3G48 A;  3LWE A;  3QOJ A;  4UP9 A;  2DUD A;  3KDF B;  5JOB A;  4XQJ A;  1HNW L;  1EUJ A;  4LNQ A;  4X64 L;  4FXK C;  5CV7 A;  4WJ4 A;  2B2Y C;  2EQS A;  1SE2 A;  2FHT A;  4YWM A;  2EY6 A;  3K81 C;  4ZQ3 A;  3H0G B;  5J3B A;  4NKL A;  1LTR D;  1FYC A;  4JYA Q;  2YYZ A;  4MTK A;  1PRT D;  2EYM A;  3PUZ A;  1TWF B;  4DAM A;  4GOP A;  5IP7 G;  1JWU D;  1HA5 A;  5C0X H;  2L1B A;  1ENA A;  2DGY A;  2CH4 A;  1RCV D;  4XT3 B;  4R4I A;  2JA5 G;  1II3 A;  4DV6 L;  3PCO B;  2VQE L;  2B63 G;  4C1N K;  2BH2 A;  4TKO B;  1WFQ A;  3CXC A;  4K5V A;  3QIA A; 
#chains in the Genus database with same CATH homology
 2EYL A;  1PZI D;  5FK9 C;  3NE5 B;  4PQX A;  2N88 A;  2F0S A;  5K36 H;  4A3B B;  4C1N I;  1JCK B;  3HOY B;  1LTS D;  2ZXP A;  2DN8 A;  1JQY D;  1O78 A;  2NN6 G;  3P75 A;  3VYS A;  3X3N A;  1C48 A;  2NBF A;  1SND A;  3S14 B;  3L3O C;  1SYC A;  1D1K A;  3J7Y W;  1TII D;  5C5L A;  3I90 A;  4DK0 A;  3MC0 B;  1TS5 A;  4RGO S;  4U68 A;  1Z7T A;  3AMU A;  4ME5 A;  4I7Z C;  3R3O A;  2KQ3 A;  4A3F B;  3U9S A;  5EGT A;  3K58 A;  2Z4I A;  1G91 A;  4OIJ A;  2QF7 A;  2VB2 X;  3NQT A;  4HN7 A;  1CHP D;  3MTS A;  1G2T A;  2JYO A;  3VYU A;  1V1O A;  2K5W A;  4XQN A;  1AZQ A;  3TP6 A;  3OSO A;  4K5W A;  1EQT A;  2B2W C;  5DEH A;  3A8I E;  2EJM A;  1H9J A;  4R8I A;  5I9O A;  2A6E C;  3MEH A;  5BN3 A;  4JK1 C;  5C44 B;  1PYW D;  5E3F A;  2K03 A;  4HSV A;  2LMC B;  2LKV A;  3R2I A;  3EVQ A;  1STA A;  1U4L A;  1JE4 A;  2L5T A;  1L0X B;  2A68 D;  3MZ5 A;  3PO2 B;  4RHR A;  1HQM C;  1CM9 A;  2F3W A;  3EJI A;  4PNY A;  1O7Y A;  1WTW A;  4EQN A;  3WOF A;  3TZU A;  3ND8 A;  3I72 A;  1SE4 A;  1TT2 A;  3SK8 A;  4V19 0;  1EY8 A;  3D6W A;  1DYQ A;  3D8G A;  4BA2 I;  3NBH A;  2L4N A;  3TP7 A;  3VR6 A;  2XIW A;  5EPL A;  3RZD B;  1HQR D;  3TDQ A;  4RHS A;  1RTN A;  1ICW A;  3CRL C;  1F9S A;  3BDO A;  1WD0 A;  5HUR A;  2SNS A;  5C3E B;  1BR9 A;  4KV6 A;  2AWO A;  3VR4 A;  3ITP A;  2K33 A;  3S16 B;  1G2S A;  5I4D A;  4N9P A;  2B2V A;  1LLR D;  1F2Z A;  3IL8 A;  3PO3 B;  4B9W A;  1ILQ A;  5E1F A;  1H9K A;  1X3Q A;  4IFD J;  1MGS A;  4KHZ A;  1BCP C;  2RKS A;  5K36 G;  1I4H A;  2F0J A;  2NN6 H;  3DEO A;  1QWY A;  1SXT A;  2QCP X;  1JOR A;  3J7A V;  1B9N A;  3A55 A;  1Y8N B;  4A3G B;  1A3U A;  2KCC A;  2MHV A;  1YNJ C;  3KK7 A;  1J9O A;  2Z4H A;  1K8O A;  2KUM A;  4K6D A;  4K6L A;  2SEB D;  3MXU A;  1HFN A;  5EKK A;  1XX8 A;  1A2T A;  5T1G A;  2B2W A;  2F0L A;  3FDT A;  1EY0 A;  2JP1 A;  3NP8 A;  5D3D A;  3S1Q B;  4CKE A;  2XNA C;  5CBA E;  1IHZ A;  1QNK A;  2KEE A;  4G7Z C;  2E76 C;  2A5H A;  4DAV A;  3S15 B;  4HMI A;  1CZG A;  5KND A;  1KLU D;  3MFG A;  2PZT A;  1FNV A;  1I6H B;  3HS0 C;  1ONL A;  1D5M C;  5K5P A;  1FR3 A;  2E2J B;  1Q12 A;  3W3A A;  3OHX C;  3GV6 A;  5COY A;  3BVZ A;  1JOO A;  2YU9 B;  1JWS D;  1TWA B;  3W2D A;  4OO1 G;  1FD7 D;  1OXX K;  3TP8 A;  2HUG A;  3D4W A;  2WAQ B;  1GUO A;  1Q90 A;  4LAA A;  3PMF A;  2J7Z A;  1PRT C;  1R4P B;  2B2U C;  4QIW B;  5CC4 A;  1TWH B;  1J8I A;  2LY7 A;  2PCF B;  1FGB D;  3T51 B;  3K7A B;  3N6R A;  4ULL A;  1AP0 A;  3P20 A;  4QB4 A;  4ZRZ A;  3LWU A;  2KCN A;  4DAY A;  2F0U A;  3ERQ A;  3MVV A;  2F0K A;  5I6W A;  2AUK A;  1OXV A;  1EWH A;  2WIN B;  2NYZ D;  1NR2 A;  2ENB A;  3L7Z C;  3SK4 A;  2JA6 B;  1EY6 A;  5C6A A;  3RD4 A;  1DZ1 A;  2RDF A;  1D5X C;  1S5F D;  2L9H A;  3IAY A;  2RA4 A;  3OWE B;  3FKI B;  1D5Z C;  1LTG D;  2CW0 D;  1GOZ A;  5I6Y A;  1D2B A;  1Q1B A;  4CKC A;  1XTC D;  2GA4 B;  2EPB A;  2Z8L A;  3E0J A;  4Q0F A;  5FKA C;  1I6V C;  1PXU A;  2TSS A;  5BN5 A;  2EYP A;  1SMY D;  2B63 B;  1PZJ D;  2NVQ B;  1BDO A;  3AB9 A;  5C5M A;  1BUV T;  3CHB D;  3P7J A;  1S4Z A;  4FF1 A;  1KLG D;  1W6J A;  4YIJ A;  3L9A X;  2N55 A;  3V2T A;  3SE0 A;  2HCC A;  1GUW A;  2NUC A;  1JOQ A;  4DN4 M;  3D6C A;  2QKI C;  5LL6 X;  3TSS A;  1JC7 A;  1CHQ D;  1ENF A;  1KTK A;  2R92 B;  4X3S A;  1NSN S;  3ONA B;  2K28 A;  3FEW X;  3RMH A;  3C1F A;  3T13 A;  4FO2 A;  3GTK B;  1AN8 A;  1OXU A;  2F0I A;  3QWN A;  1IKL A;  4NMZ A;  5C4X B;  2F0T A;  3P1H A;  1H9S B;  1EQV A;  2O5I C;  2TMP A;  1G6Z A;  5KNB A;  5A2Q E;  2BA0 A;  2BDO A;  2B2Y A;  1RD9 D;  1V1P B;  1Q8I A;  3BYY B;  1STB A;  1SJE D;  2FIN B;  1EYC A;  2B2U A;  1BOS A;  4O1N A;  3HOZ B;  2FFK B;  1WD1 A;  2QEJ C;  1I4Q A;  2RDG A;  5LL6 S;  1TVX A;  2WKD A;  2Q8I B;  4IUN A;  4BBS B;  2BCO A;  4OGQ C;  4UDU C;  1G29 1;  4ZUJ A;  3K59 A;  3HGB A;  3CRK C;  2RDH A;  3SVM A;  5IGE A;  2NTS A;  2EY2 A;  2E75 C;  3BZD B;  1WTP A;  1LT6 D;  1MD2 D;  4KI0 A;  1CK1 A;  2F0O A;  5C0X J;  2BE5 C;  3OPO A;  1Y8P B;  1TU2 B;  1WTX A;  2L55 A;  2CW0 C;  1CTM A;  5CV6 A;  3QJY A;  1WTO A;  4DXG A;  4RCN A;  4K2K A;  3QB3 A;  3D3R A;  1ESR A;  4ZYS A;  4KD3 A;  1B44 D;  1R9T B;  1JB3 A;  2DY7 A;  3A7L A;  4OIK A;  3DEP A;  3NWT A;  3A7A B;  3FRP B;  5D3I B;  1QB5 D;  3K6O A;  3KBX A;  2IW3 A;  1EU3 A;  1JR0 D;  4BWG B;  2SDF A;  1SNC A;  4TSS A;  2IT1 A;  4C3I B;  5M3F B;  2EJF C;  3CQZ B;  2EYH A;  4KY7 A;  2EYF A;  1K83 B;  4C3J B;  1UUP A;  3GO5 A;  3VR2 A;  3JAM L;  2F0M A;  3I8Z A;  1EEF D;  1GUN A;  4B08 A;  5JAV A;  2LS0 1;  3GV3 A;  3RLF A;  2I07 B;  2RBM A;  4JBW A;  4QCL A;  4HCS A;  4FXD A;  2IX3 A;  3QO2 A;  1SNM A;  4XQQ A;  4RAU C;  1FNU A;  1I4X A;  3J81 E;  5IIF A;  2XWB B;  5FLX L;  3HZX A;  5IT9 E;  3BVM A;  4C3J G;  1SJH D;  3S2H B;  1PTO F;  5C4Z A;  1DOL A;  1QIL A;  2NZ1 D;  2JA8 B;  1ZKO A;  5COR A;  5BN4 A;  3J80 E;  3I70 A;  1TS2 A;  3GTP B;  1ENC A;  5M3M B;  3SK5 A;  4FF2 A;  3MXN A;  3IFT A;  2PW7 A;  5JPN C;  1C8C A;  3PUY A;  4E6I A;  3TME A;  1SE3 A;  2F0G A;  1STY A;  1S5D D;  1B3A A;  1DJR D;  3I4N B;  3BDC A;  3MA2 B;  5IT9 L;  2K5D A;  4KHV A;  4OHJ A;  4PMW A;  5JEA J;  1SYB A;  4WFN 3;  4IUQ A;  4K5X A;  4BY1 B;  2PPB C;  2NWG A;  5ELE A;  1ET9 A;  5E4W C;  4ZLT F;  3QG1 A;  3BYT B;  3WOE A;  3TBI B;  2NVY B;  2WKC A;  4DK1 A;  3PUV A;  1BXT A;  4F88 A;  4BS9 A;  5M9O A;  4FVM A;  3VA5 A;  1HHV A;  2EY5 A;  2D2C C;  1RDP D;  1KDA A;  1WTQ A;  2PW5 A;  4FP5 D;  1U4P A;  4QMG A;  1AFP A;  3TN2 A;  1S5B D;  3MHB A;  3T56 B;  3WDN A;  1STG A;  2B2V C;  3U9O A;  4XIG S;  3DMU A;  5JJZ A;  2F03 A;  1BNZ A;  5CBE E;  1F2Y A;  2LFN A;  1Z6H A;  4K2L A;  2A74 C;  5FO7 B;  3V05 A;  2I46 A;  1S5C D;  1U4M A;  2L12 A;  2KVM A;  1EU4 A;  2CQA A;  1EY7 A;  2R93 B;  1GUT A;  1EY5 A;  4XT1 B;  5KIX A;  1EZ6 A;  3TP5 A;  5G3L F;  3A8J E;  1PZK D;  4J8Q A;  3PUW A;  1BQQ T;  2X6L A;  3GTM B;  4DAP A;  3PIO 3;  4L8J A;  1RJT A;  5EBC A;  2VUM B;  4B9X A;  5CV9 A;  1SDF A;  3ND9 A;  2RSN A;  1MBY A;  1LAC A;  1O7Z A;  4DF7 A;  4X3U A;  2OEO A;  2XN9 C;  5KYL A;  4F87 A;  3R8B A;  1M4V A;  4ZUI A;  1PTO H;  1CT1 D;  5IGF A;  2A69 D;  1QNU A;  1LTT D;  2XRS D;  1KNE A;  4ILW A;  1DOK A;  2SNM A;  3K57 A;  4IAL A;  1AW7 A;  1PLF A;  3D31 A;  3FMC A;  1RTO A;  5EKI A;  5JVG 3;  1KAB A;  2IPK D;  2IX0 A;  1E0B A;  1EEI D;  1STE A;  1BCP B;  3K5L A;  3DXJ C;  3M4O B;  4OO1 I;  4EQO A;  1STH A;  1Y1W B;  2JXM B;  4A3J B;  3BDL A;  5FLX E;  4F8M A;  4DXF A;  5C4J B;  4J6H A;  2A69 C;  1CA6 A;  1ROD A;  1X3P A;  4EVO A;  2H4O A;  5HGT A;  1HXY D;  4DFA A;  4H0L C;  3K0Y A;  1JOK A;  2M2L A;  2RVL A;  1RF2 D;  4A3D B;  4Q5V A;  2K32 A;  5CYU A;  4U67 3;  4IFD G;  2F0D A;  1E2V A;  3KBG A;  4ZKC B;  4RH6 A;  2RQX A;  4A3I B;  3OIQ A;  1SYD A;  1HUM A;  1R4Q B;  3C3L A;  1RKN A;  3ZYY X;  3D4R A;  3S1N B;  2H1E A;  1NUC A;  1KNA A;  3LNN A;  4PV1 C;  1I3Q B;  3GQB A;  2R61 A;  4A3M B;  1H9M A;  3Q22 A;  4KY6 A;  3NTH A;  1T5X D;  5ISR A;  4FYD A;  2JA7 B;  3R93 A;  2PQE A;  2F0N A;  3T53 B;  1ZYR C;  2CVR A;  4ZAI A;  5CGK A;  4K8I A;  5T1I A;  2EVB A;  2E2H B;  1A3T A;  3FVQ A;  3RUZ A;  3A56 A;  1ZYR D;  4R8N A;  2F4I A;  2M9V A;  3M4Y A;  4RCO A;  3GTQ B;  4RGN A;  5CV5 A;  4O42 A;  4KKS A;  2WAC A;  4IUR A;  4CGY B;  3I73 A;  1OXS C;  4X3K A;  3GTJ B;  4R9W A;  4BA1 I;  1PDQ A;  3GTL B;  1ZXT A;  1HCZ A;  1V1P A;  4A3K B;  5I9P A;  3MAQ A;  1G8Z D;  2MUY A;  3C2P A;  1I4G A;  1BBX C;  3IKJ A;  3MXP A;  5E4X A;  1VF7 A;  5EPJ A;  3VR5 A;  3EQL C;  1JIC A;  5CR3 A;  4ID6 A;  2EZV A;  5C3X A;  1I4P A;  1F2L A;  1AZP A;  3H3V C;  3BS1 A;  2PMZ B;  2HDM A;  3SEB A;  3H91 A;  4BBR B;  3O13 A;  5KEE A;  1Y1V B;  2K04 A;  1HTL D;  2A6H D;  4UAI A;  2OXP A;  3GD7 A;  1EY9 A;  4A3E B;  3SR1 A;  3SHL A;  1QE6 A;  5LHY 1;  5C0X I;  3KLR A;  2KEC A;  2O4X A;  5IGD A;  4IFD H;  3I4M B;  4HR7 B;  3OMG A;  2B39 A;  2C9O A;  3FPU B;  1BCP D;  2G9D A;  3K5M A;  1SAP A;  1XYI A;  5KRU A;  5EBD A;  1B9M A;  4L6T B;  3RZO B;  2AQ3 B;  2WB1 B;  2DY8 A;  2XRQ D;  4FF3 A;  4C3H G;  4K14 A;  3URY A;  3SDZ A;  3AU7 A;  2ICI A;  5DM6 3;  4EGV A;  3N52 A;  1VMP A;  5KYI A;  1OO9 B;  2X69 A;  3HEJ A;  5G3L D;  2K7V A;  1EFI D;  1VF5 C;  2BA1 A;  4MIU A;  2JSO A;  3VYT A;  2X6G A;  1EL0 A;  3H94 A;  4IUU A;  1B4O A;  4QUC A;  3OIP A;  3HOX B;  3K5N A;  4G4K A;  1U4R A;  3ERO A;  1SYF A;  3UI2 A;  2IWH A;  1QOH A;  3HP3 A;  1CZW A;  4NP5 A;  1GJX A;  5A35 A;  2Y0S B;  1SMY C;  1W6K A;  2Q8R E;  1UAP A;  4PMC A;  3C1E A;  5JVH 3;  2JE6 I;  1D1I A;  1F2M A;  2FJ2 A;  4CKB A;  3KF8 A;  1ESF A;  1F9R A;  5AFW A;  3VR3 A;  3KLS X;  1KDB A;  2F0W A;  5FOB B;  3I3C A;  2B8G A;  2D5D A;  1DXM A;  1SSO A;  4C3H B;  1V8Q A;  2JEB I;  4GZY C;  3Q23 A;  4XYO A;  1AEX A;  2MPM A;  5J22 A;  1ET6 A;  2EY1 A;  1HUN A;  5DM7 3;  1PFB A;  4TQU S;  1HA6 A;  1L0Y B;  1ML0 D;  1OXT A;  4HSP A;  3SXH A;  1FNW A;  4M8A A;  5EJW A;  3DWQ A;  1LO5 D;  1LV9 A;  2FMC A;  2HCI A;  2NB0 A;  4C3I G;  4NW2 A;  2V4D A;  3HKZ B;  4OO1 H;  1EOT A;  5I2X A;  5IGC A;  1GUS A;  4CJ1 B;  2MGS A;  4S3S A;  4WOR A;  2PZU A;  2KOL A;  1U9R A;  2BDN A;  4EQP A;  1DD2 A;  4KN7 C;  4DA2 A;  1H9S A;  3NHH A;  3S17 B;  1PRT F;  2MJ8 A;  1PTO D;  1SNQ A;  1LAB A;  2ICE C;  1EZ8 A;  4KTA A;  4DNT B;  5EPK A;  1V43 A;  1M8A A;  2WV6 D;  1MSH A;  3NUC A;  4WJW A;  2EYJ A;  1MI2 A;  2FMM A;  4J1M A;  1TS3 A;  2IX1 A;  3DM1 A;  3D4D A;  2PYK A;  4KKU A;  4LK1 C;  1TQO A;  4KD4 A;  2R7Z B;  3G6J B;  4RGM A;  5ELC A;  1LT5 D;  3OW7 A;  2EXZ A;  1IW7 C;  4RKB A;  2PNR C;  3M85 A;  1PTO C;  4A93 B;  1NAP A;  2KHS A;  2EDG A;  3NK9 A;  1A3V A;  2KA7 A;  4C56 C;  5M5Y B;  1DON A;  4IUV A;  2XWJ B;  4XTC S;  1KAA A;  5KGU A;  3HOV B;  4KJO A;  2PZW A;  2EE1 A;  2F0F A;  2A6H C;  3CU7 A;  3NPP A;  3QOL A;  3GTG B;  4IFD I;  5ELB A;  3MXG A;  2AQ2 B;  3LX0 A;  3NSW A;  1DM0 B;  5F2D A;  1IYU A;  2EJG C;  1HRJ A;  2IL8 A;  2F3V A;  2ID0 A;  2K5Q A;  5M5X B;  2HDL A;  3E6Z X;  4HTH A;  2RSO A;  4MHE A;  1B2T A;  1IW7 D;  1TR5 A;  4IN3 A;  1HTP A;  5IOC A;  4FXG C;  5IGB A;  1IKM A;  1B50 A;  1A6X A;  4ZKB B;  1Z47 A;  3DWP A;  1WTR A;  2AQ1 B;  4H7B A;  1CFM A;  3MWY W;  1CQV A;  1DCZ A;  3F2U A;  4CHT B;  1PMR A;  1O80 A;  4KY5 A;  3E5S A;  1LT4 D;  2B8F A;  1EY4 A;  3S2D B;  3GTO B;  3NTI A;  1GHK A;  1EWC A;  5TSS A;  2ZT9 C;  4NDX A;  2E74 C;  5IGG A;  4K8J A;  4KK7 A;  4CJ0 B;  1D6E C;  1ZEQ X;  2NVT B;  1IYV A;  2NVX B;  1F9Q A;  4I65 A;  5ELD A;  3TZD A;  1XWE A;  1STN A;  1SYG A;  4FF4 A;  5KNC A;  3BVG A;  3FPP A;  2NTT A;  2F0H A;  2DNE A;  4BY7 B;  3J80 L;  1A2U A;  4LMQ D;  5C0X G;  2SOB A;  2VB3 X;  1VMC A;  1LTB D;  1B1Z A;  1WTV A;  1PFM A;  1XXG A;  5C4H A;  2R3Z A;  4KJN A;  4XXE A;  1K8M A;  4G7O C;  2EOT A;  4XDX A;  3I91 A;  2WP8 J;  1BO0 A;  3DHQ A;  1E2W A;  3T16 A;  1SYE A;  5JPM C;  2IJ0 A;  5DNF A;  1JWM D;  1PRT B;  5EKL A;  4F7X A;  1YNJ D;  5CV8 A;  1SFO B;  3CKI B;  1QCB D;  2VNU D;  5DAU A;  2L11 A;  3M3Y B;  4RWS C;  1T5E A;  3MFY A;  4QF4 A;  3HG9 A;  5CMD A;  1UNS A;  1Y69 U;  3HRZ C;  1SNO A;  1QJO A;  2ZXR A;  3JAM E;  2K6A A;  3C46 A;  3NWS A;  1NR4 A;  4KN4 C;  1YNN D;  5EQ0 A;  4KKT A;  4PMB A;  4CJ2 C;  2R6G A;  1F9P A;  1CI3 M;  1Q3L A;  4IUP A;  2A73 B;  4IQZ A;  1S5E D;  1VCI A;  1H9R A;  3HOU B;  3R2T A;  3H09 A;  4IUT A;  4DU9 A;  4FNF A;  3S9W A;  5JEA H;  3PIP 3;  1PTO B;  2F0P A;  2Z1C A;  1NCV A;  2K05 A;  5JEA G;  2B2T A;  3H6M A;  3Q0A A;  2ZXO A;  4HCE A;  1EYA A;  2L0C A;  2MP1 A;  2JA5 B;  4XYQ A;  2M00 A;  2F0Q A;  2AWN A;  4LJZ C;  3M7G A;  3KLS A;  1PFN A;  2A68 C;  2E2I B;  4KMU C;  1TKW B;  3A8K E;  1QG7 A;  3HOW B;  4WRD A;  2BOS A;  3V96 A;  4Z9C B;  1GUG A;  2A6E D;  4RFB A;  3DUZ A;  4OL7 A;  3K5O A;  1E2Z A;  3J81 L;  3OWF A;  2Q8T A;  1A15 A;  2C5C A;  4Y7N B;  2F0V A;  4RA8 A;  5FO9 B;  2E2D C;  3IFD A;  4HAE A;  3M7N A;  2HQE A;  3VYR A;  2KJX A;  1HPC A;  1TWG B;  5I2Y A;  1RHP A;  3OOC A;  4DNR B;  5A2Q L;  5CV4 A;  2G9H D;  2O5J C;  1TY0 A;  1SEB D;  2XSC A;  1EIH A;  2B2T C;  1SNP A;  2VXW A;  1I50 B;  4ZK9 B;  4HMJ A;  4L63 B;  3A54 A;  5J39 A;  4CBV A;  3BG3 A;  1O7L A;  3NQI A;  2D62 A;  1CA5 A;  2F1M A;  3EA6 A;  1BF4 A;  4QUF A;  1UEA B;  3VA7 A;  3PUX A;  3KUP A;  2BE5 D;  4C2M B;  2K1B A;  3GP7 A;  4N9T A;  2QDB A;  4ODG A;  2OT2 A;  1VDZ A;  3S1R B;  4HED A;  2WII B;  2OF1 A;  5ELF A;  4DGZ A;  3Q6S A;  1BCP F;  1B53 A;  3PV0 A;  4M1U B;  2J4X A;  1IL8 A;  1SBB B;  1WVL A;  1KDC A;  2EYO A;  1GHJ A;  2AUJ D;  1HFG A;  3G7L A;  1YNN C;  2KED A;  3NBI A;  2D9U A;  4RKL A;  5D65 A;  3NXW A;  1EYD A;  4P2C B;  1GXD C;  4RGT A;  1Q1E A;  1LT3 D;  5M5W B;  1Y8O B;  3SK6 A;  2PO4 A;  1TS4 A;  4V0B A;  1MSG A;  4G57 A;  4H44 C;  2K01 A;  5C3W A;  1ILP A;  2F0E A;  1I4R A;  2DNC A;  5NUC A;  2QIL A;  1LTI D;  2XVS A;  4H13 C;  4ABN A;  3EFX D;  1WCM B;  1CQF A;  3Q24 A;  1F77 A;  3NTK A;  3J7A F;  4MN3 A;  4IZ8 A;  4G7H C;  1LTA D;  3DWA A;  4TRD A;  5D14 A;  5J1Z A;  4AYB B;  2JEA I;  1DOM A;  2J0T D;  1C4Q A;  1X32 A;  3OMC A;  3T4A C;  4X3T A;  1TWC B;  3X3M A;  1TY2 A;  2O2L D;  2NN6 I;  2CHB D;  3S1M B;  1EIG A;  5FO8 B;  5IOD A;  3I4L A;  3LWE A;  3QOJ A;  5JOB A;  4XQJ A;  4FXK C;  5CV7 A;  2B2Y C;  1SE2 A;  2FHT A;  2EY6 A;  4ZQ3 A;  3H0G B;  4NKL A;  1LTR D;  1FYC A;  2YYZ A;  1PRT D;  2EYM A;  3PUZ A;  1TWF B;  1JWU D;  1HA5 A;  5C0X H;  2L1B A;  1ENA A;  1RCV D;  4XT3 B;  1II3 A;  4C1N K;  4TKO B;  4K5V A;  3QIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...