5F2DA

Crystal structure of staphylococcal nuclease variant delta+phs i92n/v99t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYNYADGKMTNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92N/V99T at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5f2dA00
1SNCA 2F0MA 3MVVA 5I9PA 2EXZA 1IHZA 2KHSA 4KJOA 3SR1A 3S9WA 1TQOA 5IGDA 1II3A 2F0UA 5DAUA 4F8MA 3EVQA 1JOOA 5IGGA 1EY7A 3NUCA 4IALA 2WACA 4K2KA 5JAVA 2HQEA 5F2DA 3T16A 2QDBA 1F2ZA 2F0HA 2F0SA 2F3WA 2PZTA 3SK6A 4KY7A 5C5LA 5KEEA 4LAAA 5EKKA 5J22A 1SYBA 5EKLA 4DFAA 5C4HA 1SNDA 3E5SA 4KV6A 4B9XA 4K8JA 4E6IA 4IZ8A 5CV4A 5E1FA 5IGBA 4EVOA 1JOKA 4J6HA 4QMGA 2EY1A 1EYCA 4KD4A 4J1MA 2PW7A 5C5MA 3VA5A 1AEXA 5C3XA 1RKNA 3T13A 2NUCA 5CV5A 3P75A 2EY6A 4S3SA 4K8IA 3DHQA 3RUZA 3TMEA 1EY4A 2F0VA 2EY2A 2RDFA 3V2TA 2KQ3A 4K5WA 4OL7A 3D6CA 2F0GA 1NSNS 2ENBA 4HMIA 4HTHA 1A3TA 1EY5A 5DEHA 3SXHA 2OF1A 4K6DA 1JOQA 3OWFA 1EQVA 5M9OA 4WORA 1SNQA 1F2YA 1KDCA 3MXPA 2F0WA 5CV6A 4K2LA 1TT2A 3BDCA 5I6YA 2F0DA 4WRDA 1F2MA 4NP5A 1ENAA 1U9RA 5HURA 1TR5A 4N9TA 4RKLA 3NXWA 3R3OA 3NHHA 2PZUA 1EZ8A 1EY8A 1SYEA 3MEHA 2F0FA 3TP5A 3SK5A 2EYPA 3C1EA 4ODGA 5C3WA 1SNPA 5C6AA 5ISRA 2F0PA 1SYDA 3TP6A 5IGFA 3SHLA 1ENCA 1STAA 4QB4A 3DMUA 5HGTA 1JORA 4IUNA 4EQPA 4ZUJA 4DGZA 2F0JA 1STGA 5J1ZA 1SYFA 3D8GA 2PW5A 3MHBA 5CC4A 1EZ6A 5CGKA 2F0IA 1KDBA 2RBMA 4HMJA 3NP8A 3PMFA 4TRDA 1EY0A 4ZUIA 4DU9A 3ERQA 5C4ZA 4PNYA 1KAAA 1KABA 3EROA 1EY9A 3QOJA 3LX0A 3QOLA 1A2TA 4ME5A 4NMZA 1KDAA 4KJNA 5IGEA 2F3VA 4R8NA 1A3VA 1EYAA 2PQEA 2F0EA 1EY6A 2F0NA 1A3UA 2RKSA 4KY6A 5EGTA 5CR3A 3TP8A 2LKVA 4B9WA 4DF7A 5J39A 3BDLA 4RKBA 1SYCA 1SNMA 2EYHA 2O4XA 3SK4A 5I9OA 5IOCA 5KYIA 3HEJA 2EYJA 3NQTA 5CV9A 4MIUA 5IODA 4F7XA 4KY5A 2EY5A 2SNMA 5E3FA 5I6WA 4K14A 4K5VA 1EYDA 5CV8A 3U9OA 4K5XA 4QF4A 4PMBA 3D4DA 1SNOA 2PYKA 4I65A 5NUCA 3TP7A 5KYLA 2F0LA 1STYA 2OXPA 3D4WA 4NDXA 5KGUA 2F0KA 3H6MA 4ID6A 4KHVA 5CV7A 3MZ5A 4EQOA 2EYMA 2SNSA 5KIXA 1NUCA 2F0TA 5KRUA 4KD3A 3ITPA 2EYLA 1STBA 1SYGA 2SOBA 2EYFA 2F0OA 3NK9A 3OMGA 2F0QA 3OSOA 3HZXA 2PZWA 1STHA 2EYOA 5IGCA 4N9PA 4PMCA 4NKLA 3QB3A 4G57A 4H7BA 4EQNA 1A2UA 1STNA 3C1FA 2M00A 2OEOA 3OMCA 3P1HA 4YIJA 4KTAA 5K5PA 3SK8A 5IIFA 3EJIA 4ZQ3A 5JOBA
chains in the Genus database with same CATH superfamily
2NTSA 2L1BA 5I9PA 4DK6C 1IHZA 2GVBA 1EEFD 3KF6B 3HOXH 3MXNB 1PA6A 4GS3A 3RLFA 2F0SA 4OO1H 4X66Q 1VQFA 1I4PA 4DFAA 1PH9A 1VQMA 3P20A 4DV5L 4J6HA 1YNJC 3T13A 4JI7L 3K0YA 3PO3B 2VUMB 2TMPA 1MBYA 4JI4L 4IOCA 1BR9A 3T56B 4K5WA 4A3FG 1TWAH 4UP8A 5ELNA 3IRBA 4MTKA 4LK1C 4EX5A 1NR4A 3S1QB 3K6OA 4HSVA 1I4HA 1FR3A 1S72A 1SBBB 1SJED 1SYEA 5C3WA 1L0YB 1I4XA 3SHLA 4XXEA 1YJWA 2G9DA 3S16H 1X6OA 2NVYB 4IUNA 4C2MB 2K6AA 1JC7A 1GXDC 2A73B 5IYCG 3HOVB 4RGTA 4OX9Q 5CGKA 2RBMA 2K50A 1E3PA 1I50B 2B2YA 1LYLA 3QOJA 2LXKA 1ICWA 3IL8A 4P75A 2OTLA 3M4OB 1SFOH 1PRTB 4C3HH 5C3EB 2BA0A 1CK1A 1GUGA 2QDLA 4ZAIA 3GTOB 4CKCA 3BDLA 2K52A 2X6GA 2RHQB 4P71A 4DV6L 3H3VC 3KOJA 4MIUA 4JOIC 4A3JB 3D31A 3U9OA 5LL6S 1IKMA 3CAMA 3AEVA 3M3YH 3K57A 1YI2A 1F9QA 4YHHL 1SE8A 2KVMA 2MP1A 4EQOA 4DV7Q 2CWAA 2DUDA 2JA5G 1LT4D 3BG3A 3NEMA 4DV1L 3J7AF 1PXUA 1IZ6A 2K28A 2K5VA 2OEOA 1WTXA 2NZ1D 1IBKQ 2AHOB 2E5LL 4NXNQ 3IKJA 5JOBA 3CKIB 3M4QA 3UDXA 3MXGA 4JI5Q 4A3GG 4QJFA 4L8JA 1XNRQ 4B3TL 2R7ZG 1NE3A 1TWCB 2F0HA 5KNCA 2ZTDA 3W1BA 5H1SE 4DR4L 1EQTA 5C4JB 4DR3L 4E6IA 1OXTA 1TS3A 1MGSA 2B2TC 4CDEC 2NVXH 1TKWB 2HCCA 1T5XD 2UUCL 4GNXC 4HCSA 2FFKB 4K8IA 1HA6A 5LMNQ 2J0TD 2B63G 4FXGC 5C44G 3SGIA 3RZOH 5M3MB 3TEHB 2JK8A 4HMIA 4AIMA 4R1JA 2OF1A 3OWFA 3D3RA 1SE4A 3ULLA 1KXLA 1F2YA 1JWUD 1L1OC 2F0WA 3HKSA 1TT2A 4ZYSA 1V1PB 1V8QA 4DAVA 1Q86C 2F0DA 2BE5D 4A3DH 4LFAL 3NXWA 3OTOQ 1F9RA 2JEBI 3FVQA 3I4NB 2EYPA 1SNPA 2JA6G 5IGFA 2ZXRA 4X3TA 2C35B 2IX0A 2E75C 4K6LA 3S17H 1SYFA 1LTTD 3CCEA 1Y1VG 1BCPC 2EXDA 3I4MG 4JV5Q 2VUMH 1NAPA 1QVCA 4ULLA 5K36H 4DNRB 4G7ZC 1PRTD 1EUJA 1X3EA 2ATWA 1PH5A 5IYDG 1XMQL 1GJXA 1XPRA 4Z9CB 1DJRD 1X3QA 1C48A 1VQ4A 1ICFB 4IO9A 2EY5A 3OHXC 1IL8A 3AYHB 3J81E 1VF7A 2IX1A 3PUVA 3N52A 3FKIB 3JC66 2BH2A 2NVYH 1PH6A 1LM0A 4YWKA 3RD4A 2R6GA 1UWVA 1C0AA 4EQ5A 1I94Q 1W6JA 4B3SQ 1G6ZA 5IT9E 5CORA 4HIMA 5AJ3Q 2RCNA 3M4OH 2M00A 3MAQA 5C3EH 2CKZB 3GTOH 2RA4A 3HOYG 2PNHA 3S9WA 1QZHA 5GROA 3EVQA 3CQZH 3QR8A 3A56A 1SEBD 4R4QA 4QCLA 2E2IH 5KNBA 1ML0D 3J81c 3NQIA 5KEEA 3NBHB 5EKLA 4A3IB 1YHBA 1H9RA 2CW0D 2VB3X 3A5ZB 1UNSA 3MA2B 5E1FA 5FLXE 5IGBA 2EJFC 2QF7A 3R93A 1YNND 1YIJA 3QJYA 4XDXA 3TMEA 4BA2I 1D1KA 5FK9C 2CQOA 4KK7A 4IFDH 4IJHA 5M5WB 1QOHA 5IT9c 1EY5A 2MHVA 4K6DA 4QY7A 1CT1D 5I2XA 5M9OA 2N88A 5CV6A 1SE3A 4HIOA 1PLFA 1IXRA 3BDCA 3F1ZA 1JWMD 4N9TA 4X64L 2XRSD 4A3MB 3K8AA 1NTGA 4A4IA 4ALPA 3Q23A 3TQYA 3GD7A 5EPJA 3J80L 1G6PA 3TP6A 4BS9A 5C4JH 5IYBG 4QB4A 1DGSA 1JE4A 1FNVA 1EU4A 2L4NA 3M7NA 1LABA 2IW3A 5EPLA 4KMUC 2IHFA 1RCVD 3O13A 5FLXc 5EPKA 3I73A 4JBKA 2NVQH 1U0LA 2QA4A 3KLSX 1CZGA 4JI3L 4MNOA 5JPMC 1EY9A 5M3MH 2XN9C 2AQ3B 1Q8KA 5IWAQ 1BXTA 3HOWH 4LF9L 4AH6A 2R92G 3NSWA 1TVXA 3KBGA 2YTVA 2CWPA 4OEMB 3CCJA 4O2DA 2A6HD 3OW2A 2K04A 4F88A 3KYHC 3I4NH 1U4PA 1A63A 1PFMA 2XIWA 1HH2P 4LMQD 3S24A 1STYA 1J9OA 1PFBA 3K7AB 4CBVA 5KIXA 1VCIA 4LF6Q 4HN7A 2EYLA 1KNEA 3HZXA 1XMOL 1LTBD 3T4AC 3HG9A 1STNA 3AU7A 4UAIA 1HZAA 2VW9A 2Y0SG 2MQHA 2VXWA 4LJZC 4XYOA 2HHHQ 3GTQH 1DOKA 4M1UB 2B2WC 1RJTA 4PZ6A 5IP9H 1QNKA 2L15A 1MJCA 2MPMA 1II3A 3E3XA 2Q8IB 4LFCL 3IAYA 1F2ZA 1B9MA 3HOZG 2JYOA 1C4QA 4KY7A 5EQ0A 5D3DA 3F2CA 1OXUA 1Q7YC 2EY1A 5C3XA 4L63B 2KCCA 2R7DA 4RGMA 4S3SA 2EDGA 4CGYB 1PTOB 1YJ9A 1Q12A 3UDGA 2MFIA 1HQRD 4JW0A 1JOQA 2DY7A 5BN5A 1YNJD 5GAGC 1XXGA 3NTKA 1X32A 1WTPA 2ZM6L 4DUYQ 3M4YA 2A19A 3TZUA 3R3OA 4V190 1E24A 3TP5A 3KJOA 1PH3A 4ODGA 5ISRA 4A3BB 3BVMA 2NVTB 1LTGD 4LF8Q 1RODA 3ER0A 2CQAA 1EFWA 2ES2A 5BN3A 1VQNA 1CKMA 3PGZA 1Y14B 4KKSA 4ZUJA 2F0JA 3JAMi 3PUXA 3PUZA 3GV6A 1I4GA 4NXML 2UUAL 1EZ6A 1BVSA 2CCZA 4DU9A 3CD6A 1E1TA 4HSPA 1B4OA 1KABA 3BDOA 2NN6G 3DUZA 3UI2A 4CKBA 3QIAA 2JA7G 1SSOA 3TP8A 3K5MA 3NBIA 1GKHA 3BS1A 1BCPB 2C9OA 3NQTA 1E22A 4DV0L 4IUTA 5FJ8G 3NENA 1IBLL 4R4TA 3U58A 1SXTA 3TREA 2M2LA 3IFDA 1B44D 3LGJA 1HNZL 4MTNA 4C3IG 4AYBB 1K73C 1GUOA 1S3OA 2D62A 2KA7A 5CV7A 4Y7NH 1K83B 2F3IA 2SNSA 4DN4M 3UDIA 3RZDB 3D0FA 2AMCB 3CP0A 3PV0A 4OWWB 1G2TA 2L55A 3V05A 3ZJYC 3ND8A 2VQFQ 1A2UA 5K5PA 2Q2TA 1S5ED 2JA8G 2YV5A 2UUBL 4Y52H 2ALYB 1O78A 1VF5C 2E2JB 3CCVA 2D0OA 4FDBA 2JQOA 4X3SA 1M4VA 5EAYA 4RMFA 4NW2A 4LNQA 2D5DA 4O0AA 1OO9B 3Q8DA 2R93G 1SYBA 5FO9B 1Y1WG 1YHQA 1AFPA 1EL0A 3H3VH 1CKNB 3K7AH 2EE1A 4QMGA 4LF5L 4GKJQ 3VA5A 1MD2D 3S1MB 1PTOD 1VS0A 3TBIB 3T51B 2DJGC 4B3RQ 4KKTA 2EY2A 3A54A 3GTJB 4DV3L 1VQKA 5BN4A 2CW0C 4IURA 2UXCQ 1PV4A 4BXXH 4UHVA 3L2PA 1NCVA 1YNNC 2HDMA 3D6WA 4WRDA 2BA1A 4A3FB 2PQAB 5IY0A 4JI6L 5ELCA 2EOTA 4GLVB 5LMUL 2DNEA 2EJGC 2WAQE 3D8GA 1R4PB 2ZTEA 3MHBA 1TXYA 1ILQA 3DM3A 4PNYA 1EOVA 1N36L 4PZ8A 1YITA 2BDNA 1S4ZA 4DK0A 2ICEC 1IYUA 4A93H 4DXFA 5JJZA 1SNMA 2WB1G 1MSHA 2SNMA 4B3SL 4JI0L 1GHJA 1EYDA 1O7YA 2Z4HA 3PIOA 2VQEQ 3TP7A 1LT6D 1BQQT 4XQQA 1PH4A 1JJCB 1T5EA 1WTQA 3RNUA 2Z6KA 4X66L 2A6HC 4ZCKA 3NK9A 1CHQD 4UY8C 4GN3B 3K59A 1JICA 3F2UA 4PMCA 5IP7G 4POGA 4RGNA 4IPHA 3PUWA 4JBMA 4DR6Q 1EQQA 2JA5B 3I70A 4KHPQ 2XWBB 3CCSA 2RQXA 4A3LG 2PMZB 2A8VA 4IALA 2WACA 4DUZQ 2UXBL 1TWHB 1VQLA 1STEA 5FKAC 1ZKOA 1N32Q 4A3GB 4LAAA 2RHSB 1XWEA 4YCUA 5G3LD 4ZLTF 1HNWQ 1PYSB 1K83H 1JOKA 1FYCA 2R7ZB 3PF4A 2QGQA 5C5MA 3RZDH 3P75A 2G5DA 1HZBA 1PHJA 4A3CG 4POFA 1DM0B 3BYYB 4OX9L 1B1ZA 3HOUG 3W3AA 3T1HQ 2HCIA 2B63B 4OELB 5C44B 1FGUA 2KOLA 1PH7A 1VMCA 5JJKA 1LTSD 1RTNA 4K0KQ 1PVOA 5T1IA 3SK5A 4JCVE 4GOPA 4M8AA 3KJPA 2NN6I 4EQPA 3DWAA 3S1MH 1U5KA 4UDUC 2B8FA 3A5UA 1IKLA 2JA6B 2VZAA 2F52A 1I6VC 1I6HB 3VR4A 4ME5A 2LSSA 4NMZA 3KDFB 4DV7L 2KHIA 3SE0A 4DR5Q 2F0NA 1A3UA 3CRKC 1CSPA 2Z6BA 5M3FG 2LKVA 1HTLD 1Y1VB 1LLRD 3SK4A 3I4MB 1HZCA 1VQPA 4LWCA 2ZTCA 1IBKL 4F7XA 1B7YB 3H94A 1HR0L 4NXNL 4A3FH 2K1BA 5ELFA 4O42A 1U4MA 3CXCA 3ULPA 4LUZA 4JI5L 5A2QE 3DLLA 2BH8A 1IYJB 1XNRL 3X3MA 1I5FA 4NDXA 3MZ5A 3OWEB 1ESFA 5CYUA 2NB0A 3CCLA 1BCPF 2R7FA 1VQEA 4C1NK 4A75A 5I4DA 2PMZE 3GO5A 5IGCA 1B3QA 5KNDA 3H0GB 1WTHA 4N8X1 3T1YQ 5IE8A 4DAPA 4JBWA 3TS2A 1TWGB 2F1MA 4B3MQ 5LMNL 4CJ0B 3C3LA 2KECA 3SR1A 2WKDA 1S5FD 4FXDA 5DAUA 2AQ2B 1WCMG 1JB7A 2I07B 1R4QB 5AFWA 1QVFA 5J22A 3HOYB 1RL2A 4DR1Q 4IZ8A 4EVOA 4IUPA 3TSSA 1EYCA 1PDQA 3I91A 4J1MA 3K5OA 3OOCA 4XQNA 4JK1C 3GTMB 4EGVA 1EU3A 4JI4Q 3KF8B 3PUYA 1EY4A 3CC2A 1EFID 2DJFC 2KQ3A 3HKZG 3D6CA 2F0GA 5DEHA 1H9SB 5C4XG 4DAYA 3CW2C 2JA5H 4RA8A 1JJGA 4RHRA 5GAEC 1SRUA 4LW1A 5CBAE 1PTOC 4IUVA 1CSQA 2UXDQ 2K05A 4Q0FA 2PZUA 2F4VQ 1TWHH 3MEHA 1Y8NB 4LF4Q 4CJ2C 1XNQL 4JI2Q 1D2BA 4A3GH 2L11A 1ENCA 1STAA 3J80E 1JORA 4I7AA 4JBJA 1FGBD 3G7LA 2Z9HA 3E0EA 1K28A 3R8BA 1GOZA 5CC4A 5E4WC 4DR7Q 1NR2A 1NY4A 1A2TA 2PO4A 2QCPX 2F4IA 2B2UC 2PQEA 1CQVA 2RKSA 2R61A 4DF7A 1I94L 4PV1C 3I4OA 4A3DG 4RKBA 2CFMA 1O7ZA 2EYHA 1A0IA 3AQQA 1SE2A 3SEBA 3VYUA 5AJ3L 1IYVA 5E3FA 5CV8A 2FXQA 1J6QA 1PZID 2R92B 4G4KA 5M5XB 3JAML 1G2SA 3VYRA 1LTRD 3EFXD 3PO3H 3S15B 3J80c 3H6MA 3RLNA 1K9MC 3Q24A 3MXNA 2I5LX 1A6XA 4LFBQ 4V0BA 3UE1A 4DPGA 2HIVA 2JA6H 4LUOA 1I6HH 1VQJA 3Q6SA 4NKLA 2IX3A 4MN3A 3BZDB 1KLUD 4WFN3 3OMCA 2RCFA 3BZKA 3S1QH 1F9SA 3OYYA 4BY1G 1U4RA 2HT1A 2NWGA 3GTKB 5COYA 1WJJA 4RH6A 1Q46A 4H02A 3T16A 1XPUA 5IYDH 1CA5A 4C2MH 1QNUA 2XWJB 4X62L 2D0PA 3HOVH 4AQYL 2CHBD 1LO5D 2CVRA 5CV4A 4CKEA 1I50H 2IL8A 1CI3M 1WFQA 3HOZB 4UP9A 1SROA 2K5WA 2IT1A 2EQSA 1BNZA 1AZQA 2L0CA 1L0WA 3H0GH 1N9WA 1X56A 4H0LC 1X55A 2KHJA 2K5HA 3HGBA 4GLXA 4QQBX 4A3JH 1TWGH 4YY3Q 3CPFA 1SNQA 1HUMA 4KN4C 2H1EA 1ENAA 1H9MA 5IWAL 1WYDA 2GVAA 1BKBA 4DNTB 1LT3D 2KEDA 3TN2A 4C1NI 1RDPD 3GTGB 1G91A 4IPGA 4JI1Q 3HOYH 1Q1BA 3L3OC 3DM1A 3S1RB 1SJHD 1AE3A 1RD9D 2KEEA 3L7ZC 4FYDA 3GTMH 4IFDG 3S2HB 2R3ZA 3PMFA 4JPBW 2HDLA 2IHEA 5C4ZA 2DGYA 4BA1I 1H95A 1KDAA 1QZGA 3Q22A 1A3VA 1KC8C 4LF6L 3GV3A 3G4SA 1WTVA 1AZPA 4B9WA 2IJ0A 2B2YC 4KLKA 1TWCH 2JP1A 4XYQA 2O4XA 3ERSX 4BBRG 1HR0W 2AQ1B 5TSSA 1DCZA 2HHHL 3TZDA 2RDHA 4K5XA 4RFBA 4DAMA 2YYZA 4PZ7A 2JA7B 1D5MC 1IW7C 2F0LA 4C3JB 2ZT9C 3LWUA 2F0KA 1VMPA 1NUCA 4GLAC 3FHWA 4RWSC 1SYGA 3W5OA 4BBSB 1KTKA 4C3IB 2AWNA 3HOWG 1SLJA 4EQNA 4YWLA 1GUNA 1SN8A 2Q8RE 3VR2A 3SK8A 1CZWA 2E2HB 1SNCA 2F0MA 1NNXA 3RR5A 1EOTA 3AMUA 5ELEA 4P2CB 3LNNA 5IGGA 4F8MA 1I3QB 1JOOA 4JI8Q 1SAPA 3A8KE 1PRTF 4YCVA 3W1GA 1TY2A 2JA8B 5M5XH 2Z0SA 2CH4W 5T1GA 4DUYL 1V1PA 5C4HA 4LF7Q 1PYWD 3S15H 5ELDA 1VQ7A 3OIPA 1RKNA 3Q0AA 2KCMA 4DR2Q 3PIO3 4LF8L 2R93B 1FNWA 3FPPA 4DKAC 1WI5A 3PQIA 4OWTB 3TS0A 2BCOA 1CUKA 2AWOA 2MGSA 3MXPA 3GTKH 4X64Q 1UEAB 1K0RA 4O1NA 3FKIH 4RKLA 1IBMQ 3EA6A 1D8LA 3I2ZA 3NHHA 1EZ8A 3URYA 5I2YA 1QUQB 1J5EQ 5C0XH 1HFNA 5DNFA 5FOBB 3DMUA 2A68D 3RN2A 4GKKQ 1PZJD 1YBYA 3HOZH 1MIUA 5FO7B 2RSOA 4HMJA 4R4CA 2XRQD 2NTTA 4FNFA 2KUMA 2F0EA 5EGTA 1JMCA 5J39A 1M90C 5CR3A 1QB5D 3C46A 2OQ0A 3FEWX 5C0XJ 2HIXA 3H91A 3RN5A 1FD7D 2EYJA 3HRZC 2VB2X 3K81C 4K5VA 2PPBC 4A3IH 5FLMG 4ZKBB 2B2VA 2KENA 4ZKCB 5JVH3 4HJAA 3TDQA 3GTGH 3KLSA 4XT3B 1J8IA 4WJWA 1B53A 3CC7A 2WB1B 1HXYD 5JEAG 2WINB 1A62A 4ID6A 4A3EG 3NPPA 2F0TA 5M5WH 4HR7B 2K33A 5FLXL 1WTOA 2A6ED 3NTIA 3OMGA 1YHAA 1XJVA 3I90A 1M8AA 4GKJL 2Q2IA 2YTXA 4A3MH 1MJEA 3WOEA 3B6YA 3MVVA 1EEID 1ESRA 2EXZA 3I56A 4B3RL 2GN5A 1XTDA 2KHSA 1B2TA 1BF4A 3CCMA 2J7ZA 2UXCL 2JN4A 2PNRC 2JA7H 1I4QA 2LY7A 2FMMA 4DV4L 5HGQA 5C5LA 5EKKA 4C3JH 3EQLC 4CHTB 3MFYA 3MXUA 1HQMC 2K5DA 1EIYB 3PO2B 1AEXA 1QVGA 3H09A 1HCZA 4BBSH 4TKOB 3PIPA 4HEDA 4C3IH 2PI2E 2ID0A 2RDFA 3V2TA 1W3SA 1WTWA 4NB3A 3T53B 4DK3C 1BO0A 2RSNA 4A3KG 2E2HH 4WJ4A 2O5IC 2ZM6Q 3M4PA 1KL9A 5I6YA 1BBXC 5BR8Q 1I3QH 4FP5D 2ZJRA 3U4ZA 2OT2A 4XIGS 3CHBD 2F0FA 4WJ3M 3HOUB 1S40A 2JA8H 4IFDI 2ZXPA 3ICEA 4DXGA 4UP7A 2F03A 3KBXA 3ND9A 2ZXOA 3FDTA 1K8OA 1STGA 1D6EC 3BJUA 3VR5A 4DK1A 4U673 2VQEL 3U50C 5A35A 2F0IA 4TRDA 1EY0A 4ZUIA 3ERQA 2C5CA 1D7QA 1KAAA 1Q90A 3CMAA 2J4XA 3QOLA 1GM5A 3AFPA 3DWPA 1BBWA 4BXXG 1EQRA 2ZJQA 4JOIA 4KY6A 4QIWB 3NWTA 2I0QA 2WB1E 5KYIA 1X65A 3VA7A 4N8FA 3HEJA 4H13C 1Y69U 1E1OA 2E8GA 1E2VA 3U4VA 4IUQA 3ULJA 4DR6L 1HNXQ 1JCKB 4F87A 1DONA 4PMBA 5M3FB 4KHPL 3NWSA 1CKOA 1VQCA 2QKIC 2N3SA 3NTHA 2OTJA 2GA4B 1QILA 1T9HA 2QEJC 1N34L 4I7ZC 1LUZA 1PTOH 4DUZL 1EIFA 2HQLA 1KHIA 1K0SA 1GVPA 1UUPA 3S16B 2PZWA 1FJGL 1H9KA 4AYBE 2UU9L 3HP3A 1HNWL 4G57A 4H7BA 4A93G 1X9NA 2VY3A 4GZYC 2HUGA 3OTOL 1TWFB 4DV2Q 4BY7G 1HHVA 2FMCA 4A3BH 2SEBD 2NVTH 2JE6I 3EBEA 4APVA 2TSSA 4L5QA 4CDCC 2DN8A 1ET9A 3UDFA 2F3WA 2PZTA 3T1HL 3E6ZX 2AUJD 2B2TA 4GNXA 5D65A 1KRTA 3PSIA 1Q1EA 1GO3E 1WCMB 4K0KL 1W6KA 1EIHA 4JYAQ 2EY6A 2O2LD 3S2DB 1D5ZC 2JJQA 4OXPA 1AN8A 4DAYB 2WAQG 1L1OA 2WFWA 4P73A 3CU7A 2ENBA 5J3BA 1F9PA 1JE5A 1F2MA 4X65Q 5IP7H 2YTYA 4DR5L 3HKZB 4JVZA 3SDZA 1XX8A 2AUKA 5C4XB 3DXJC 3J81i 3GQBA 5EKIA 1E2WA 2F0PA 5LMUQ 3KUPA 1G8ZD 1V1OA 4R8IA 2L5TA 1VDZA 4DGZA 3PO2H 3MEFA 2A5HA 1KLGD 1YJNA 1YEZA 3TRZA 1X3PA 1JWSD 3EROA 3LX0A 3HOXG 1VQIA 1ET6A 5IGEA 1E2ZA 2E2JH 4OO1G 2A68C 3STBD 4HCEA 2ASBA 1PTOF 5CV9A 3T1YL 1B50A 4KY5A 5I6WA 1FL0A 3X3NA 2KJXA 4TQUS 4B3ML 3HOUH 3F8TA 1MHWC 5JPNC 4A3DB 5NUCA 1QG7A 1ZYRD 1S5BD 1JJ2A 4BWGB 3JAME 4L5RC 1UE5A 1UE1A 3D4WA 2EZVA 1LACA 1AW7A 4ILWA 4KKUA 4OIJA 2B29A 1HPCA 5FO8B 1E0BA 2CH4A 4KD3A 4RCNA 3GTJH 3E9IA 3G6JB 1VQ9A 2MO1A 2NZHA 1STHA 1IW7D 5E4XA 4DR1L 2DNCA 3S17B 1QE6A 1JQYD 3KLRA 1CKNA 4YIJA 2YU9B 1V1QA 3A74A 2E76C 4CDDC 4ZRZA 3I4LA 2A6EC 3HFZB 5IGDA 2A1AA 4RGOS 2E2DC 2OQKA 2UXBQ 4K2KA 5F2DA 5M3FH 3VDYA 1C9OA 5ELBA 3SK6A 4BY1B 2UXDL 4B9XA 4C3HG 3JAMc 2F4VL 4LF4L 1L0XB 1N33Q 4JI2L 2PQAA 1O80A 1BOSA 2NYZD 3DHQA 1Z6HA 5IYCH 3MFGA 2F0VA 2G9HD 2EPBA 3HKZE 3MTSA 4PG3A 2SDFA 1V9PA 1RIPA 1PFNA 1HFGA 1EQVA 2Z8LA 1TWFH 4MHEA 4R4OA 1VQOA 3QG1A 1DYQA 3H3VI 4DR7L 3I3CA 4CDFC 2V4DA 5HURA 2K5NA 3EN2A 4LUVA 2V1CC 4DV5Q 3J7ZC 3GTPB 4FVMA 2MNAA 1SMXA 1VQAA 5DM73 4JI7Q 1KIXA 1X3FA 1B9NA 2WIIB 3CQZB 1SMYD 5HGTA 1K3BC 3K0XA 2E2IB 2D2CC 1WCMH 1ENFA 1E7ZA 1ASYA 1HTPA 1UE6A 3S2DH 3NP8A 3OPOA 4JV5L 5D14A 1HA5A 3GTLB 3M7GA 5G3LF 4LFBL 5M5YB 4QUFA 3W2DA 1WD1A 2ZJPA 2D9UA 1HR0Q 3SVMA 4GN5A 4MZ9A 3U9SA 1Q81C 5C4XH 1OXSC 2PYKA 2R7ZH 2OCEA 2E74C 4BBRB 3M85A 1LTID 2EYMA 1SDFA 1NJIC 3ITPA 1EIGA 3GP7A 2F0OA 1LTAD 2B2WA 4DV6Q 3J7AV 2Z6KC 2RVLA 5D3IB 3P1HA 3A8JE 2NVQB 2B63H 2Z4IA 5C44H 3EJIA 3SXHA 2P5ZX 4IUUA 2WV6D 1PH2A 3HOWB 1TS2A 1PMRA 4J8QA 4YHHQ 4G7HC 1KRSA 1U4LA 3KF6A 1X54A 2QDBA 3CF5A 4FF4A 4YY3L 1BBUA 3RLOA 1DOMA 1TY0A 2VUMG 3PO3G 3BVZA 3S14B 4DV1Q 5K36G 1A8VA 3CCQA 3DWQA 1SR3A 1OXXK 4K8JA 2K4KA 1YNXA 2IWHA 4KD4A 2E5LQ 1XYIA 1GUWA 5CV5A 5JVG3 4JI1L 3RUZA 3QO2A 3OIQA 3G6EA 2JEAI 1Y1VH 4XTCS 3I4MH 1L2FA 4HIDA 2YU9H 4HTHA 4ME3A 1VQ8A 4B3TQ 1CM9A 1DZ1A 1DD2A 4RHSA 3VR6A 4YWMA 4KN7C 4WORA 5CMDA 2Y0SB 4DR4Q 1MKHA 3GTQB 2K32A 4DR3Q 3KDFA 5GAHC 3A7LA 2QILA 1XNQQ 3HOVG 3A8IE 2K01A 4BY1H 1KNAA 1LV9A 2UUCQ 1C8CA 3DEPA 5A2QL 2FINB 2L12A 3BYTB 5C3EG 1W2BA 4GOPC 1DOLA 4HJ8A 4Q5VA 4XT1B 4OO1I 5LHY1 3H0GG 3ZYYX 1D5XC 1D1IA 3AB9A 4A3JG 5E7NA 1ASZA 1K8AC 1QCBD 1PFSA 1AH9A 4LFAQ 2F3VA 1MSGA 1EYAA 1TS5A 2N55A 1GHKA 4L6TB 2PCFB 3J7A5 5I9OA 3PIP3 3MWYW 2XGTA 1PH1A 1WD0A 4K14A 5EBDA 4PQXA 4IN3A 4C56C 3GTPH 1XTCD 4QF4A 1HUNA 2OWOA 3STBC 5GADC 4JI8L 4DA2A 4CJ1B 1G51A 5KRUA 1V43A 3I72A 2AKWB 2M9VA 1XMQQ 2SOBA 3CPWA 4LF7L 4N9PA 1HZ9A 3GTLH 3QB3A 2XVSA 1ZYRC 3OW7A 3BU2A 4KTAA 4DNIA 5M5YH 4A3EB 4FF1A 2Q2UA 4DR2L 5EJWA 3HS0C 2K75A 3KF8A 4IQZA 1IL2A 1TQOA 1EWHA 3NUCA 2H5XA 1Q8IA 4XQJA 5JAVA 4KHZA 2HQEA 3A55A 3K5NA 2XTIA 3K5LA 1H9SA 1JT8A 1B70B 4X62Q 4HJ7A 4AQYQ 4OHJA 3CC4A 4BBRH 1FNUA 5M3MG 5ELOA 3G71A 4RAUC 2KCTA 1IBML 5IYBH 2PW7A 4IFDJ 2Y0SE 1J5EL 2I5MX 4A76A 3RMHA 2N8NA 5LMNW 1RF2D 1JB3A 4Y7NB 1WOCA 2EIFA 4GKKL 3K58A 3I4NG 2QEXA 1ZEQX 3A0JA 1Z7TA 3EIVA 3CMEA 2JXMB 4K2LA 2I5HA 4TSSA 2Z1CA 2R92H 4NP5A 1U9RA 1TS4A 3UE0A 2MO0A 1OTCA 1RHPA 2L9HA 3C1EA 5C6AA 4A3KB 1SYDA 3S14H 1PYBA 1ONLA 3FMCA 4B08A 4HIKA 3D4RA 3ONAB 1M1KC 1Y1WB 4QUCA 1F77A 2B3GA 5IP9G 3J81j 2K5QA 1VQ6A 1UEBA 1SMYC 5CBEE 5HY6A 3WOFA 3R2IA 1LTLA 1WTRA 3I8ZA 4IJLA 3FKIG 3A7AB 1XPOA 4UPAA 1C7YA 5IODA 1RTOA 2A69D 3J81L 1EWCA 5C0XG 2LXJA 4TVAB 1Y8PB 5LL6X 3D4DA 1NMFA 1DXMA 5KYLA 4JI3Q 4FO2A 5KGUA 2RDGA 4KHVA 1GD7A 3K7UC 1N8RC 4YCWA 1VQGA 1TIID 2LMCB 4LF9Q 2LS01 3OSOA 4HAEA 5IT9L 3BZCA 5L37A 4KI0A 4FXKC 2VQFL 3H15A 5IIFA 4ZQ3A 3NELA 1HJPA 3QWNA 4A3IG 2X6LA 4KJOA 2FHTA 4A93B 3F2DA 4OONA 1TU2B 3S1RH 4GNXB 3VR3A 1G291 4OGQC 1PZKD 2KCNA 3C2PA 4X6AH 2XNAC 3FP9A 5BR8L 4BY7B 1XMOQ 3P7JA 4KV6A 3S2HH 2VL6A 1P8LA 3AFQA 3PF5A 3FRPB 3NBHA 1O7IA 5FLMH 4QL5A 1VQDA 1R9TB 2NUCA 2B8GA 1L1OB 5DM63 1Q3LA 2K14A 2BE5C 1EWIA 2NBFA 5JEAH 4A3MG 3IFTA 4OL7A 1NSNS 2DY8A 4A3EH 4LFCQ 1GUSA 2JSOA 2NN6H 1VQ5A 4JG2A 1KDCA 3BVGA 2Q8TA 2WAQB 3MC0B 3I7FA 4C3JG 3VYSA 3CCRA 1KQSA 5FJ8H 2VNUD 1BUVT 5JJIA 1QWYA 5JEAJ 1F2LA 1PRTC 2HD3A 1HNXL 4BBSG 3L9AX 4L5TA 3L0OA 1HRJA 5J1ZA 3FPUB 4FF2A 4OWXB 3LWEA 1KDBA 3S1NB 1Y8OB 1NMGA 1B8AA 4KJNA 3CRLC 4OIKA 2A74C 4GOPB 4R4IA 5IOCA 2MJ8A 3HOXB 1ILPA 3KLWA 4FF3A 4DV2L 4H44C 1JR0D 1SNOA 1P16A 4I65A 4A3KH 2UUAQ 4NXMQ 1MI2A 1S5DD 1K3RA 3E0JA 3GDEA 2R93H 1Y1WH 1PH8A 1KD1C 1STBA 2N49A 2VS1A 2EYFA 2F0QA 4X3UA 2KBNA 3KFUA 1EYGA 4P74A 3C1FA 4DV0Q 1CHPD 1Z9FA 1TWAB 1IBLQ 1VQHA 4JYAL 2O5JC 1HNZQ 4QGUA 1BDOA 1WVLA 1B3AA 2F0UA 4G7OC 2K03A 1EY7A 4DV4Q 2I46A 1YVCA 4X65L 1N32L 1SNDA 3E5SA 4L5SA 3G48A 3J80i 3N6RA 1O7LA 2PI2A 5GQOA 1AP0A 2N78A 4NPSA 4ZK9B 1LT5D 1QUQA 1CFMA 1CA6A 1YZ6A 3V96A 2H4OA 1OXVA 2UUBQ 3KK7A 4P72A 4RCOA 1A15A 1SFOB 1A3TA 4C3HB 4A3BG 4HJ9A 1S5CD 1H9JA 1Z47A 3WDNA 2BDOA 4R9WA 1TR5A 4J15A 4RG1A 1BCPD 4GN4B 2QW7A 3DEOA 1EY8A 2LFNA 4LF5Q 1CTMA 3M3YB 2JA9A 1KAWA 5DLQE 3F2BA 4BY7H 4X3KA 4HJ5A 4PMWA 1I4RA 1Q82C 2Q2HA 4DV3Q 2BOSA 2EJMA 2PW5A 3J7YW 1R9TH 2B2UA 2IPKD 1AE2A 4ABNA 3R2TA 1CQFA 1NBWA 2RF4A 5EBCA 3CCUA 4IPDA 4R8NA 2MUYA 1EY6A 3K80C 5C0XI 2B39A 3WWVA 4AYBG 1SYCA 4JI6Q 1K8MA 1UE7A 2K7VA 1K8GA 1QJOA 3M9BA 4JC0A 4A3LH 3NE5B 1UAPA 4QIWE 4IPCA 2ICIA 1VQBA 3I55A 1N34Q 2WP8J 4IOAA 3PO2G 2X69A 2OXPA 3E9HA 2B2VC 1N36Q 1ZXTA 2A69C 3PCOB 4U68A 3VYTA 5JJLA 2NVXB 2FJ2A 1FJGQ 2UU9Q 3S1NH 2EVBA 1X3GA 1GUTA 2EYOA 2NZOA 3RZOB 1FVIA 2IY5B 2WKCA 1N33L 2XSCA 4JI0Q 4A3CH
chains in the Genus database with same CATH topology
2NTSA 2L1BA 5I9PA 1IHZA 1EEFD 3RLFA 2F0SA 4OO1H 1I4PA 4DFAA 3P20A 4J6HA 1YNJC 3T13A 3K0YA 3PO3B 2VUMB 2TMPA 1MBYA 1BR9A 3T56B 4K5WA 4LK1C 1NR4A 3S1QB 3K6OA 4HSVA 1I4HA 1FR3A 1SBBB 1SJED 1SYEA 5C3WA 1L0YB 1I4XA 3SHLA 4XXEA 2G9DA 2NVYB 4IUNA 4C2MB 2K6AA 1JC7A 1GXDC 2A73B 3HOVB 4RGTA 5CGKA 2RBMA 1I50B 2B2YA 3QOJA 1ICWA 3IL8A 3M4OB 1PRTB 5C3EB 2BA0A 1CK1A 1GUGA 4ZAIA 3GTOB 4CKCA 3BDLA 2X6GA 3H3VC 4MIUA 4A3JB 3D31A 3U9OA 5LL6S 1IKMA 3K57A 1F9QA 2KVMA 2MP1A 4EQOA 1LT4D 3BG3A 3J7AF 1PXUA 2K28A 2OEOA 1WTXA 2NZ1D 3IKJA 5JOBA 3CKIB 3MXGA 4L8JA 1TWCB 2F0HA 5KNCA 1EQTA 5C4JB 4E6IA 1OXTA 1TS3A 1MGSA 2B2TC 1TKWB 2HCCA 1T5XD 4HCSA 2FFKB 4K8IA 1HA6A 2J0TD 4FXGC 5M3MB 4HMIA 2OF1A 3OWFA 3D3RA 1SE4A 1F2YA 1JWUD 2F0WA 4ZYSA 4DAVA 1TT2A 1V1PB 1V8QA 2F0DA 2BE5D 3NXWA 1F9RA 2JEBI 3FVQA 3I4NB 2EYPA 1SNPA 5IGFA 2ZXRA 4X3TA 2IX0A 2E75C 4K6LA 1SYFA 1LTTD 1BCPC 1NAPA 4ULLA 5K36H 4DNRB 4G7ZC 1PRTD 1GJXA 4Z9CB 1DJRD 1X3QA 1C48A 2EY5A 3OHXC 1IL8A 3J81E 1VF7A 2IX1A 3PUVA 3N52A 3FKIB 3RD4A 2R6GA 1W6JA 1G6ZA 5IT9E 5CORA 2M00A 3MAQA 2RA4A 3S9WA 3EVQA 3A56A 1SEBD 4QCLA 5KNBA 1ML0D 3NQIA 5KEEA 5EKLA 4A3IB 1H9RA 2CW0D 2VB3X 1UNSA 3MA2B 5E1FA 5FLXE 5IGBA 2EJFC 2QF7A 3R93A 1YNND 3QJYA 4XDXA 3TMEA 4BA2I 1D1KA 5FK9C 4KK7A 4IFDH 5M5WB 1QOHA 1EY5A 2MHVA 4K6DA 1CT1D 5I2XA 5M9OA 2N88A 5CV6A 1SE3A 1PLFA 3BDCA 1JWMD 4N9TA 2XRSD 4A3MB 3Q23A 3GD7A 5EPJA 3J80L 3TP6A 4BS9A 4QB4A 1JE4A 1FNVA 1EU4A 2L4NA 3M7NA 1LABA 2IW3A 5EPLA 4KMUC 1RCVD 3O13A 5EPKA 3I73A 3KLSX 1CZGA 5JPMC 1EY9A 2XN9C 2AQ3B 1BXTA 3NSWA 1TVXA 3KBGA 2A6HD 2K04A 4F88A 1U4PA 1PFMA 2XIWA 4LMQD 1STYA 1J9OA 1PFBA 3K7AB 4CBVA 5KIXA 1VCIA 4HN7A 2EYLA 1KNEA 3HZXA 1LTBD 3T4AC 3HG9A 1STNA 3AU7A 4UAIA 4LJZC 2VXWA 4XYOA 1DOKA 4M1UB 2B2WC 1RJTA 1QNKA 2MPMA 1II3A 2Q8IB 3IAYA 1F2ZA 1B9MA 2JYOA 1C4QA 4KY7A 5EQ0A 5D3DA 1OXUA 2EY1A 5C3XA 4L63B 2KCCA 4RGMA 4S3SA 2EDGA 4CGYB 1PTOB 1Q12A 1HQRD 1JOQA 2DY7A 5BN5A 1YNJD 1XXGA 3NTKA 1X32A 1WTPA 3M4YA 3TZUA 3R3OA 4V190 3TP5A 4ODGA 5ISRA 4A3BB 3BVMA 2NVTB 1LTGD 1RODA 2CQAA 5BN3A 4KKSA 4ZUJA 2F0JA 3PUXA 3PUZA 3GV6A 1I4GA 1EZ6A 4DU9A 4HSPA 1B4OA 1KABA 3BDOA 2NN6G 3DUZA 3UI2A 4CKBA 3QIAA 1SSOA 3TP8A 3K5MA 3NBIA 3BS1A 1BCPB 2C9OA 3NQTA 4IUTA 1SXTA 2M2LA 3IFDA 1B44D 4C3IG 4AYBB 1GUOA 2D62A 2KA7A 5CV7A 1K83B 2SNSA 4DN4M 3RZDB 3PV0A 1G2TA 2L55A 3V05A 3ND8A 1A2UA 5K5PA 1S5ED 1O78A 1VF5C 2E2JB 4X3SA 1M4VA 4NW2A 2D5DA 1OO9B 1SYBA 5FO9B 1EL0A 1AFPA 2EE1A 4QMGA 3VA5A 1MD2D 3S1MB 1PTOD 3TBIB 3T51B 4KKTA 2EY2A 3A54A 3GTJB 5BN4A 2CW0C 4IURA 1NCVA 1YNNC 2HDMA 3D6WA 4WRDA 2BA1A 4A3FB 5ELCA 2EOTA 2DNEA 2EJGC 3D8GA 1R4PB 3MHBA 1ILQA 4PNYA 2BDNA 1S4ZA 4DK0A 2ICEC 1IYUA 4DXFA 5JJZA 1SNMA 1MSHA 2SNMA 1GHJA 1EYDA 1O7YA 2Z4HA 3TP7A 1LT6D 1BQQT 4XQQA 1T5EA 1WTQA 2A6HC 3NK9A 1CHQD 3K59A 1JICA 3F2UA 4PMCA 4RGNA 3PUWA 2JA5B 3I70A 2XWBB 2RQXA 2PMZB 4IALA 2WACA 1TWHB 1STEA 5FKAC 1ZKOA 4A3GB 4LAAA 1XWEA 5G3LD 4ZLTF 1JOKA 1FYCA 2R7ZB 5C5MA 3P75A 1DM0B 3BYYB 1B1ZA 3W3AA 2HCIA 2B63B 5C44B 2KOLA 1VMCA 1LTSD 1RTNA 5T1IA 3SK5A 4M8AA 2NN6I 4EQPA 3DWAA 4UDUC 2B8FA 1IKLA 2JA6B 1I6VC 1I6HB 3VR4A 4ME5A 4NMZA 3SE0A 2F0NA 1A3UA 3CRKC 2LKVA 1HTLD 1Y1VB 1LLRD 3SK4A 3I4MB 4F7XA 3H94A 2K1BA 5ELFA 4O42A 1U4MA 5A2QE 3X3MA 4NDXA 3MZ5A 3OWEB 1ESFA 5CYUA 2NB0A 1BCPF 4C1NK 5I4DA 3GO5A 5IGCA 5KNDA 3H0GB 4DAPA 4JBWA 1TWGB 2F1MA 4CJ0B 3C3LA 2KECA 3SR1A 2WKDA 1S5FD 4FXDA 5DAUA 2AQ2B 2I07B 1R4QB 5AFWA 5J22A 3HOYB 4IZ8A 4EVOA 4IUPA 3TSSA 1EYCA 1PDQA 3I91A 4J1MA 3K5OA 3OOCA 4XQNA 4JK1C 3GTMB 4EGVA 1EU3A 3PUYA 1EY4A 1EFID 2KQ3A 3D6CA 2F0GA 5DEHA 1H9SB 4DAYA 4RA8A 4RHRA 5CBAE 1PTOC 4IUVA 2K05A 4Q0FA 2PZUA 3MEHA 1Y8NB 4CJ2C 1D2BA 2L11A 1ENCA 1STAA 3J80E 1JORA 1FGBD 3G7LA 3R8BA 1GOZA 5CC4A 5E4WC 1NR2A 1A2TA 2PO4A 2QCPX 2F4IA 2B2UC 2PQEA 1CQVA 2RKSA 2R61A 4DF7A 4PV1C 4RKBA 1O7ZA 2EYHA 1SE2A 3SEBA 3VYUA 1IYVA 5E3FA 5CV8A 1PZID 2R92B 4G4KA 5M5XB 3JAML 1G2SA 3VYRA 1LTRD 3EFXD 3S15B 3H6MA 3Q24A 3MXNA 1A6XA 4V0BA 3Q6SA 4NKLA 2IX3A 4MN3A 3BZDB 1KLUD 4WFN3 3OMCA 1F9SA 1U4RA 2NWGA 3GTKB 5COYA 4RH6A 3T16A 1CA5A 1QNUA 2XWJB 2CHBD 1LO5D 2CVRA 5CV4A 4CKEA 2IL8A 1CI3M 3HOZB 2K5WA 2IT1A 1BNZA 1AZQA 2L0CA 4H0LC 3HGBA 1SNQA 1HUMA 4KN4C 2H1EA 1ENAA 1H9MA 4DNTB 1LT3D 2KEDA 3TN2A 4C1NI 1RDPD 3GTGB 1G91A 1Q1BA 3L3OC 3DM1A 3S1RB 1SJHD 1RD9D 2KEEA 3L7ZC 4FYDA 4IFDG 3S2HB 2R3ZA 3PMFA 2HDLA 5C4ZA 4BA1I 1KDAA 3Q22A 1A3VA 3GV3A 1WTVA 1AZPA 4B9WA 2IJ0A 2B2YC 2JP1A 4XYQA 2O4XA 2AQ1B 5TSSA 1DCZA 3TZDA 2RDHA 4K5XA 4RFBA 2YYZA 2JA7B 1D5MC 1IW7C 2F0LA 4C3JB 2ZT9C 3LWUA 2F0KA 1VMPA 1NUCA 4RWSC 1SYGA 4BBSB 1KTKA 4C3IB 2AWNA 4EQNA 1GUNA 2Q8RE 3VR2A 3SK8A 1CZWA 2E2HB 1SNCA 2F0MA 1EOTA 3AMUA 5ELEA 4P2CB 3LNNA 5IGGA 4F8MA 1I3QB 1JOOA 1SAPA 3A8KE 1PRTF 1TY2A 2JA8B 5T1GA 1V1PA 5C4HA 1PYWD 5ELDA 3OIPA 1RKNA 3Q0AA 3PIO3 2R93B 1FNWA 3FPPA 2BCOA 2AWOA 2MGSA 3MXPA 1UEAB 4O1NA 4RKLA 3EA6A 3NHHA 1EZ8A 3URYA 5I2YA 5C0XH 1HFNA 5DNFA 5FOBB 3DMUA 2A68D 1PZJD 5FO7B 2RSOA 4HMJA 2XRQD 2NTTA 4FNFA 2KUMA 2F0EA 5EGTA 5J39A 5CR3A 1QB5D 3C46A 5C0XJ 3FEWX 3H91A 1FD7D 2EYJA 3HRZC 2VB2X 4K5VA 2PPBC 4ZKBB 2B2VA 4ZKCB 5JVH3 3TDQA 3KLSA 4XT3B 1J8IA 4WJWA 1B53A 2WB1B 1HXYD 5JEAG 2WINB 4ID6A 3NPPA 2F0TA 4HR7B 2K33A 5FLXL 1WTOA 2A6ED 3NTIA 3OMGA 3I90A 1M8AA 3WOEA 3MVVA 1EEID 1ESRA 2EXZA 2KHSA 1B2TA 1BF4A 2J7ZA 2PNRC 1I4QA 2LY7A 2FMMA 5C5LA 5EKKA 3EQLC 4CHTB 3MFYA 3MXUA 1HQMC 2K5DA 3PO2B 1AEXA 3H09A 1HCZA 4TKOB 4HEDA 2ID0A 2RDFA 3V2TA 1WTWA 3T53B 1BO0A 2RSNA 2O5IC 5I6YA 1BBXC 4FP5D 2OT2A 4XIGS 3CHBD 2F0FA 3HOUB 4IFDI 2ZXPA 4DXGA 2F03A 3KBXA 3ND9A 2ZXOA 3FDTA 1K8OA 1STGA 1D6EC 3VR5A 4DK1A 4U673 5A35A 2F0IA 4TRDA 1EY0A 4ZUIA 3ERQA 2C5CA 1Q90A 1KAAA 2J4XA 3QOLA 3DWPA 4KY6A 4QIWB 3NWTA 5KYIA 3VA7A 3HEJA 4H13C 1Y69U 1E2VA 4IUQA 1JCKB 4F87A 1DONA 4PMBA 5M3FB 3NWSA 2QKIC 3NTHA 2GA4B 1QILA 2QEJC 4I7ZC 1PTOH 1UUPA 3S16B 2PZWA 1H9KA 3HP3A 4G57A 4H7BA 4GZYC 2HUGA 1TWFB 1HHVA 2FMCA 2SEBD 2JE6I 2TSSA 2DN8A 1ET9A 2F3WA 2PZTA 3E6ZX 2AUJD 2B2TA 5D65A 1Q1EA 1WCMB 1W6KA 1EIHA 2EY6A 2O2LD 3S2DB 1D5ZC 1AN8A 3CU7A 2ENBA 1F9PA 1F2MA 3HKZB 3SDZA 1XX8A 2AUKA 5C4XB 3DXJC 3GQBA 5EKIA 1E2WA 2F0PA 3KUPA 1G8ZD 1V1OA 4R8IA 2L5TA 1VDZA 4DGZA 2A5HA 1KLGD 1X3PA 1JWSD 3EROA 3LX0A 1ET6A 5IGEA 1E2ZA 4OO1G 2A68C 4HCEA 1PTOF 5CV9A 1B50A 4KY5A 5I6WA 3X3NA 2KJXA 4TQUS 5JPNC 4A3DB 5NUCA 1QG7A 1ZYRD 1S5BD 4BWGB 3JAME 2EZVA 3D4WA 1LACA 1AW7A 4ILWA 4KKUA 4OIJA 1HPCA 5FO8B 1E0BA 4KD3A 4RCNA 3G6JB 1STHA 1IW7D 5E4XA 2DNCA 3S17B 1QE6A 1JQYD 3KLRA 4YIJA 2YU9B 2E76C 4ZRZA 3I4LA 2A6EC 5IGDA 4RGOS 2E2DC 4K2KA 5F2DA 5ELBA 3SK6A 4BY1B 4B9XA 4C3HG 1L0XB 1O80A 1BOSA 2NYZD 3DHQA 1Z6HA 3MFGA 2F0VA 2G9HD 2EPBA 3MTSA 2SDFA 1PFNA 1HFGA 1EQVA 2Z8LA 4MHEA 3QG1A 1DYQA 3I3CA 2V4DA 5HURA 3GTPB 4FVMA 5DM73 1B9NA 2WIIB 3CQZB 1SMYD 5HGTA 2E2IB 2D2CC 1ENFA 1HTPA 3NP8A 3OPOA 5D14A 1HA5A 3GTLB 3M7GA 5G3LF 5M5YB 4QUFA 3W2DA 1WD1A 2D9UA 3SVMA 3U9SA 1OXSC 2PYKA 2E74C 4BBRB 3M85A 1LTID 2EYMA 1SDFA 3ITPA 1EIGA 3GP7A 2F0OA 1LTAD 2B2WA 3J7AV 2RVLA 5D3IB 3P1HA 3A8JE 2NVQB 2Z4IA 3SXHA 3EJIA 4IUUA 2WV6D 3HOWB 1TS2A 1PMRA 4J8QA 4G7HC 1U4LA 2QDBA 4FF4A 1DOMA 1TY0A 3BVZA 3S14B 5K36G 3DWQA 1OXXK 4K8JA 2IWHA 4KD4A 1XYIA 1GUWA 5CV5A 5JVG3 3RUZA 3QO2A 3OIQA 2JEAI 4XTCS 4HTHA 1CM9A 1DZ1A 1DD2A 4RHSA 3VR6A 4KN7C 4WORA 5CMDA 2Y0SB 3GTQB 2K32A 3A7LA 2QILA 3A8IE 2K01A 1KNAA 1LV9A 1C8CA 3DEPA 5A2QL 2FINB 2L12A 3BYTB 1DOLA 4Q5VA 4XT1B 4OO1I 5LHY1 3ZYYX 1D5XC 1D1IA 3AB9A 1QCBD 2F3VA 1MSGA 1EYAA 1TS5A 2N55A 1GHKA 4L6TB 2PCFB 5I9OA 3PIP3 3MWYW 1WD0A 4K14A 5EBDA 4PQXA 4IN3A 4C56C 1XTCD 4QF4A 1HUNA 4DA2A 4CJ1B 5KRUA 1V43A 3I72A 2M9VA 2SOBA 4N9PA 3QB3A 2XVSA 1ZYRC 3OW7A 4KTAA 4A3EB 4FF1A 5EJWA 3HS0C 3KF8A 4IQZA 1TQOA 1EWHA 3NUCA 1Q8IA 4XQJA 5JAVA 4KHZA 2HQEA 3A55A 3K5NA 3K5LA 1H9SA 4OHJA 1FNUA 4RAUC 2PW7A 4IFDJ 3RMHA 1RF2D 1JB3A 4Y7NB 3K58A 1ZEQX 1Z7TA 2JXMB 4K2LA 4TSSA 2Z1CA 4NP5A 1U9RA 1TS4A 1RHPA 2L9HA 3C1EA 5C6AA 4A3KB 1SYDA 1ONLA 3FMCA 4B08A 3D4RA 3ONAB 1Y1WB 4QUCA 1F77A 2K5QA 1SMYC 5CBEE 3WOFA 3R2IA 1WTRA 3I8ZA 3A7AB 5IODA 1RTOA 2A69D 3J81L 1EWCA 5C0XG 1Y8PB 5LL6X 3D4DA 1DXMA 5KYLA 4FO2A 5KGUA 2RDGA 4KHVA 2LMCB 1TIID 2LS01 3OSOA 4HAEA 5IT9L 4KI0A 4FXKC 5IIFA 4ZQ3A 3QWNA 2X6LA 4KJOA 2FHTA 4A93B 1TU2B 3VR3A 1G291 4OGQC 1PZKD 2KCNA 3C2PA 2XNAC 4BY7B 3P7JA 4KV6A 3FRPB 3NBHA 1R9TB 2NUCA 2B8GA 5DM63 1Q3LA 2BE5C 2NBFA 5JEAH 3IFTA 4OL7A 1NSNS 2DY8A 1GUSA 2JSOA 2NN6H 1KDCA 3BVGA 2Q8TA 2WAQB 3MC0B 4C3JG 3VYSA 2VNUD 1BUVT 1QWYA 5JEAJ 1F2LA 1PRTC 3L9AX 1HRJA 5J1ZA 3FPUB 4FF2A 3LWEA 1KDBA 3S1NB 1Y8OB 4KJNA 3CRLC 4OIKA 2A74C 5IOCA 2MJ8A 3HOXB 1ILPA 4FF3A 4H44C 1JR0D 1SNOA 4I65A 1MI2A 1S5DD 3E0JA 1STBA 2EYFA 2F0QA 4X3UA 3C1FA 1CHPD 1TWAB 2O5JC 1BDOA 1WVLA 1B3AA 2F0UA 4G7OC 2K03A 1EY7A 2I46A 1SNDA 3E5SA 3N6RA 1O7LA 1AP0A 4ZK9B 1LT5D 1CFMA 1CA6A 3V96A 2H4OA 1OXVA 3KK7A 4RCOA 1A15A 1SFOB 1A3TA 4C3HB 1S5CD 1H9JA 1Z47A 3WDNA 2BDOA 4R9WA 1TR5A 1BCPD 3DEOA 1EY8A 2LFNA 1CTMA 3M3YB 4X3KA 4PMWA 1I4RA 2BOSA 2EJMA 2PW5A 3J7YW 2B2UA 2IPKD 4ABNA 3R2TA 1CQFA 5EBCA 4R8NA 2MUYA 1EY6A 5C0XI 2B39A 1SYCA 1K8MA 2K7VA 1QJOA 3NE5B 1UAPA 2ICIA 2WP8J 2X69A 2OXPA 2B2VC 1ZXTA 2A69C 4U68A 3VYTA 2NVXB 2FJ2A 2EVBA 1GUTA 2EYOA 3RZOB 2WKCA 2XSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNC A;  2F0M A;  3MVV A;  5I9P A;  2EXZ A;  1IHZ A;  2KHS A;  4KJO A;  3SR1 A;  3S9W A;  1TQO A;  5IGD A;  1II3 A;  2F0U A;  5DAU A;  4F8M A;  3EVQ A;  1JOO A;  5IGG A;  1EY7 A;  3NUC A;  4IAL A;  2WAC A;  4K2K A;  5JAV A;  2HQE A;  5F2D A;  3T16 A;  2QDB A;  1F2Z A;  2F0H A;  2F0S A;  2F3W A;  2PZT A;  3SK6 A;  4KY7 A;  5C5L A;  5KEE A;  4LAA A;  5EKK A;  5J22 A;  1SYB A;  5EKL A;  4DFA A;  5C4H A;  1SND A;  3E5S A;  4KV6 A;  4B9X A;  4K8J A;  4E6I A;  4IZ8 A;  5CV4 A;  5E1F A;  5IGB A;  4EVO A;  1JOK A;  4J6H A;  4QMG A;  2EY1 A;  1EYC A;  4KD4 A;  4J1M A;  2PW7 A;  5C5M A;  3VA5 A;  1AEX A;  5C3X A;  1RKN A;  3T13 A;  2NUC A;  5CV5 A;  3P75 A;  2EY6 A;  4S3S A;  4K8I A;  3DHQ A;  3RUZ A;  3TME A;  1EY4 A;  2F0V A;  2EY2 A;  2RDF A;  3V2T A;  2KQ3 A;  4K5W A;  4OL7 A;  3D6C A;  2F0G A;  1NSN S;  2ENB A;  4HMI A;  4HTH A;  1A3T A;  1EY5 A;  5DEH A;  3SXH A;  2OF1 A;  4K6D A;  1JOQ A;  3OWF A;  1EQV A;  5M9O A;  4WOR A;  1SNQ A;  1F2Y A;  1KDC A;  3MXP A;  2F0W A;  5CV6 A;  4K2L A;  1TT2 A;  3BDC A;  5I6Y A;  2F0D A;  4WRD A;  1F2M A;  4NP5 A;  1ENA A;  1U9R A;  5HUR A;  1TR5 A;  4N9T A;  4RKL A;  3NXW A;  3R3O A;  3NHH A;  2PZU A;  1EZ8 A;  1EY8 A;  1SYE A;  3MEH A;  2F0F A;  3TP5 A;  3SK5 A;  2EYP A;  3C1E A;  4ODG A;  5C3W A;  1SNP A;  5C6A A;  5ISR A;  2F0P A;  1SYD A;  3TP6 A;  5IGF A;  3SHL A;  1ENC A;  1STA A;  4QB4 A;  3DMU A;  5HGT A;  1JOR A;  4IUN A;  4EQP A;  4ZUJ A;  4DGZ A;  2F0J A;  1STG A;  5J1Z A;  1SYF A;  3D8G A;  2PW5 A;  3MHB A;  5CC4 A;  1EZ6 A;  5CGK A;  2F0I A;  1KDB A;  2RBM A;  4HMJ A;  3NP8 A;  3PMF A;  4TRD A;  1EY0 A;  4ZUI A;  4DU9 A;  3ERQ A;  5C4Z A;  4PNY A;  1KAA A;  1KAB A;  3ERO A;  1EY9 A;  3QOJ A;  3LX0 A;  3QOL A;  1A2T A;  4ME5 A;  4NMZ A;  1KDA A;  4KJN A;  5IGE A;  2F3V A;  4R8N A;  1A3V A;  1EYA A;  2PQE A;  2F0E A;  1EY6 A;  2F0N A;  1A3U A;  2RKS A;  4KY6 A;  5EGT A;  5CR3 A;  3TP8 A;  2LKV A;  4B9W A;  4DF7 A;  5J39 A;  3BDL A;  4RKB A;  1SYC A;  1SNM A;  2EYH A;  2O4X A;  3SK4 A;  5I9O A;  5IOC A;  5KYI A;  3HEJ A;  2EYJ A;  3NQT A;  5CV9 A;  4MIU A;  5IOD A;  4F7X A;  4KY5 A;  2EY5 A;  2SNM A;  5E3F A;  5I6W A;  4K14 A;  4K5V A;  1EYD A;  5CV8 A;  3U9O A;  4K5X A;  4QF4 A;  4PMB A;  3D4D A;  1SNO A;  2PYK A;  4I65 A;  5NUC A;  3TP7 A;  5KYL A;  2F0L A;  1STY A;  2OXP A;  3D4W A;  4NDX A;  5KGU A;  2F0K A;  3H6M A;  4ID6 A;  4KHV A;  5CV7 A;  3MZ5 A;  4EQO A;  2EYM A;  2SNS A;  5KIX A;  1NUC A;  2F0T A;  5KRU A;  4KD3 A;  3ITP A;  2EYL A;  1STB A;  1SYG A;  2SOB A;  2EYF A;  2F0O A;  3NK9 A;  3OMG A;  2F0Q A;  3OSO A;  3HZX A;  2PZW A;  1STH A;  2EYO A;  5IGC A;  4N9P A;  4PMC A;  4NKL A;  3QB3 A;  4G57 A;  4H7B A;  4EQN A;  1A2U A;  1STN A;  3C1F A;  2M00 A;  2OEO A;  3OMC A;  3P1H A;  4YIJ A;  4KTA A;  5K5P A;  3SK8 A;  5IIF A;  3EJI A;  4ZQ3 A;  5JOB A; 
#chains in the Genus database with same CATH topology
 2NTS A;  2L1B A;  5I9P A;  4DK6 C;  1IHZ A;  2GVB A;  1EEF D;  3KF6 B;  3HOX H;  3MXN B;  1PA6 A;  4GS3 A;  3RLF A;  2F0S A;  4OO1 H;  4X66 Q;  1VQF A;  1I4P A;  4DFA A;  1PH9 A;  1VQM A;  3P20 A;  4DV5 L;  4J6H A;  1YNJ C;  3T13 A;  4JI7 L;  3K0Y A;  3PO3 B;  2VUM B;  2TMP A;  1MBY A;  4JI4 L;  4IOC A;  1BR9 A;  3T56 B;  4K5W A;  4A3F G;  1TWA H;  4UP8 A;  5ELN A;  3IRB A;  4MTK A;  4LK1 C;  4EX5 A;  1NR4 A;  3S1Q B;  3K6O A;  4HSV A;  1I4H A;  1FR3 A;  1S72 A;  1SBB B;  1SJE D;  1SYE A;  5C3W A;  1L0Y B;  1I4X A;  3SHL A;  4XXE A;  1YJW A;  2G9D A;  3S16 H;  1X6O A;  2NVY B;  4IUN A;  4C2M B;  2K6A A;  1JC7 A;  1GXD C;  2A73 B;  5IYC G;  3HOV B;  4RGT A;  4OX9 Q;  5CGK A;  2RBM A;  2K50 A;  1E3P A;  1I50 B;  2B2Y A;  1LYL A;  3QOJ A;  2LXK A;  1ICW A;  3IL8 A;  4P75 A;  2OTL A;  3M4O B;  1SFO H;  1PRT B;  4C3H H;  5C3E B;  2BA0 A;  1CK1 A;  1GUG A;  2QDL A;  4ZAI A;  3GTO B;  4CKC A;  3BDL A;  2K52 A;  2X6G A;  2RHQ B;  4P71 A;  4DV6 L;  3H3V C;  3KOJ A;  4MIU A;  4JOI C;  4A3J B;  3D31 A;  3U9O A;  5LL6 S;  1IKM A;  3CAM A;  3AEV A;  3M3Y H;  3K57 A;  1YI2 A;  1F9Q A;  4YHH L;  1SE8 A;  2KVM A;  2MP1 A;  4EQO A;  4DV7 Q;  2CWA A;  2DUD A;  2JA5 G;  1LT4 D;  3BG3 A;  3NEM A;  4DV1 L;  3J7A F;  1PXU A;  1IZ6 A;  2K28 A;  2K5V A;  2OEO A;  1WTX A;  2NZ1 D;  1IBK Q;  2AHO B;  2E5L L;  4NXN Q;  3IKJ A;  5JOB A;  3CKI B;  3M4Q A;  3UDX A;  3MXG A;  4JI5 Q;  4A3G G;  4QJF A;  4L8J A;  1XNR Q;  4B3T L;  2R7Z G;  1NE3 A;  1TWC B;  2F0H A;  5KNC A;  2ZTD A;  3W1B A;  5H1S E;  4DR4 L;  1EQT A;  5C4J B;  4DR3 L;  4E6I A;  1OXT A;  1TS3 A;  1MGS A;  2B2T C;  4CDE C;  2NVX H;  1TKW B;  2HCC A;  1T5X D;  2UUC L;  4GNX C;  4HCS A;  2FFK B;  4K8I A;  1HA6 A;  5LMN Q;  2J0T D;  2B63 G;  4FXG C;  5C44 G;  3SGI A;  3RZO H;  5M3M B;  3TEH B;  2JK8 A;  4HMI A;  4AIM A;  4R1J A;  2OF1 A;  3OWF A;  3D3R A;  1SE4 A;  3ULL A;  1KXL A;  1F2Y A;  1JWU D;  1L1O C;  2F0W A;  3HKS A;  1TT2 A;  4ZYS A;  1V1P B;  1V8Q A;  4DAV A;  1Q86 C;  2F0D A;  2BE5 D;  4A3D H;  4LFA L;  3NXW A;  3OTO Q;  1F9R A;  2JEB I;  3FVQ A;  3I4N B;  2EYP A;  1SNP A;  2JA6 G;  5IGF A;  2ZXR A;  4X3T A;  2C35 B;  2IX0 A;  2E75 C;  4K6L A;  3S17 H;  1SYF A;  1LTT D;  3CCE A;  1Y1V G;  1BCP C;  2EXD A;  3I4M G;  4JV5 Q;  2VUM H;  1NAP A;  1QVC A;  4ULL A;  5K36 H;  4DNR B;  4G7Z C;  1PRT D;  1EUJ A;  1X3E A;  2ATW A;  1PH5 A;  5IYD G;  1XMQ L;  1GJX A;  1XPR A;  4Z9C B;  1DJR D;  1X3Q A;  1C48 A;  1VQ4 A;  1ICF B;  4IO9 A;  2EY5 A;  3OHX C;  1IL8 A;  3AYH B;  3J81 E;  1VF7 A;  2IX1 A;  3PUV A;  3N52 A;  3FKI B;  3JC6 6;  2BH2 A;  2NVY H;  1PH6 A;  1LM0 A;  4YWK A;  3RD4 A;  2R6G A;  1UWV A;  1C0A A;  4EQ5 A;  1I94 Q;  1W6J A;  4B3S Q;  1G6Z A;  5IT9 E;  5COR A;  4HIM A;  5AJ3 Q;  2RCN A;  3M4O H;  2M00 A;  3MAQ A;  5C3E H;  2CKZ B;  3GTO H;  2RA4 A;  3HOY G;  2PNH A;  3S9W A;  1QZH A;  5GRO A;  3EVQ A;  3CQZ H;  3QR8 A;  3A56 A;  1SEB D;  4R4Q A;  4QCL A;  2E2I H;  5KNB A;  1ML0 D;  3J81 c;  3NQI A;  5KEE A;  3NBH B;  5EKL A;  4A3I B;  1YHB A;  1H9R A;  2CW0 D;  2VB3 X;  3A5Z B;  1UNS A;  3MA2 B;  5E1F A;  5FLX E;  5IGB A;  2EJF C;  2QF7 A;  3R93 A;  1YNN D;  1YIJ A;  3QJY A;  4XDX A;  3TME A;  4BA2 I;  1D1K A;  5FK9 C;  2CQO A;  4KK7 A;  4IFD H;  4IJH A;  5M5W B;  1QOH A;  5IT9 c;  1EY5 A;  2MHV A;  4K6D A;  4QY7 A;  1CT1 D;  5I2X A;  5M9O A;  2N88 A;  5CV6 A;  1SE3 A;  4HIO A;  1PLF A;  1IXR A;  3BDC A;  3F1Z A;  1JWM D;  4N9T A;  4X64 L;  2XRS D;  4A3M B;  3K8A A;  1NTG A;  4A4I A;  4ALP A;  3Q23 A;  3TQY A;  3GD7 A;  5EPJ A;  3J80 L;  1G6P A;  3TP6 A;  4BS9 A;  5C4J H;  5IYB G;  4QB4 A;  1DGS A;  1JE4 A;  1FNV A;  1EU4 A;  2L4N A;  3M7N A;  1LAB A;  2IW3 A;  5EPL A;  4KMU C;  2IHF A;  1RCV D;  3O13 A;  5FLX c;  5EPK A;  3I73 A;  4JBK A;  2NVQ H;  1U0L A;  2QA4 A;  3KLS X;  1CZG A;  4JI3 L;  4MNO A;  5JPM C;  1EY9 A;  5M3M H;  2XN9 C;  2AQ3 B;  1Q8K A;  5IWA Q;  1BXT A;  3HOW H;  4LF9 L;  4AH6 A;  2R92 G;  3NSW A;  1TVX A;  3KBG A;  2YTV A;  2CWP A;  4OEM B;  3CCJ A;  4O2D A;  2A6H D;  3OW2 A;  2K04 A;  4F88 A;  3KYH C;  3I4N H;  1U4P A;  1A63 A;  1PFM A;  2XIW A;  1HH2 P;  4LMQ D;  3S24 A;  1STY A;  1J9O A;  1PFB A;  3K7A B;  4CBV A;  5KIX A;  1VCI A;  4LF6 Q;  4HN7 A;  2EYL A;  1KNE A;  3HZX A;  1XMO L;  1LTB D;  3T4A C;  3HG9 A;  1STN A;  3AU7 A;  4UAI A;  1HZA A;  2VW9 A;  2Y0S G;  2MQH A;  2VXW A;  4LJZ C;  4XYO A;  2HHH Q;  3GTQ H;  1DOK A;  4M1U B;  2B2W C;  1RJT A;  4PZ6 A;  5IP9 H;  1QNK A;  2L15 A;  1MJC A;  2MPM A;  1II3 A;  3E3X A;  2Q8I B;  4LFC L;  3IAY A;  1F2Z A;  1B9M A;  3HOZ G;  2JYO A;  1C4Q A;  4KY7 A;  5EQ0 A;  5D3D A;  3F2C A;  1OXU A;  1Q7Y C;  2EY1 A;  5C3X A;  4L63 B;  2KCC A;  2R7D A;  4RGM A;  4S3S A;  2EDG A;  4CGY B;  1PTO B;  1YJ9 A;  1Q12 A;  3UDG A;  2MFI A;  1HQR D;  4JW0 A;  1JOQ A;  2DY7 A;  5BN5 A;  1YNJ D;  5GAG C;  1XXG A;  3NTK A;  1X32 A;  1WTP A;  2ZM6 L;  4DUY Q;  3M4Y A;  2A19 A;  3TZU A;  3R3O A;  4V19 0;  1E24 A;  3TP5 A;  3KJO A;  1PH3 A;  4ODG A;  5ISR A;  4A3B B;  3BVM A;  2NVT B;  1LTG D;  4LF8 Q;  1ROD A;  3ER0 A;  2CQA A;  1EFW A;  2ES2 A;  5BN3 A;  1VQN A;  1CKM A;  3PGZ A;  1Y14 B;  4KKS A;  4ZUJ A;  2F0J A;  3JAM i;  3PUX A;  3PUZ A;  3GV6 A;  1I4G A;  4NXM L;  2UUA L;  1EZ6 A;  1BVS A;  2CCZ A;  4DU9 A;  3CD6 A;  1E1T A;  4HSP A;  1B4O A;  1KAB A;  3BDO A;  2NN6 G;  3DUZ A;  3UI2 A;  4CKB A;  3QIA A;  2JA7 G;  1SSO A;  3TP8 A;  3K5M A;  3NBI A;  1GKH A;  3BS1 A;  1BCP B;  2C9O A;  3NQT A;  1E22 A;  4DV0 L;  4IUT A;  5FJ8 G;  3NEN A;  1IBL L;  4R4T A;  3U58 A;  1SXT A;  3TRE A;  2M2L A;  3IFD A;  1B44 D;  3LGJ A;  1HNZ L;  4MTN A;  4C3I G;  4AYB B;  1K73 C;  1GUO A;  1S3O A;  2D62 A;  2KA7 A;  5CV7 A;  4Y7N H;  1K83 B;  2F3I A;  2SNS A;  4DN4 M;  3UDI A;  3RZD B;  3D0F A;  2AMC B;  3CP0 A;  3PV0 A;  4OWW B;  1G2T A;  2L55 A;  3V05 A;  3ZJY C;  3ND8 A;  2VQF Q;  1A2U A;  5K5P A;  2Q2T A;  1S5E D;  2JA8 G;  2YV5 A;  2UUB L;  4Y52 H;  2ALY B;  1O78 A;  1VF5 C;  2E2J B;  3CCV A;  2D0O A;  4FDB A;  2JQO A;  4X3S A;  1M4V A;  5EAY A;  4RMF A;  4NW2 A;  4LNQ A;  2D5D A;  4O0A A;  1OO9 B;  3Q8D A;  2R93 G;  1SYB A;  5FO9 B;  1Y1W G;  1YHQ A;  1AFP A;  1EL0 A;  3H3V H;  1CKN B;  3K7A H;  2EE1 A;  4QMG A;  4LF5 L;  4GKJ Q;  3VA5 A;  1MD2 D;  3S1M B;  1PTO D;  1VS0 A;  3TBI B;  3T51 B;  2DJG C;  4B3R Q;  4KKT A;  2EY2 A;  3A54 A;  3GTJ B;  4DV3 L;  1VQK A;  5BN4 A;  2CW0 C;  4IUR A;  2UXC Q;  1PV4 A;  4BXX H;  4UHV A;  3L2P A;  1NCV A;  1YNN C;  2HDM A;  3D6W A;  4WRD A;  2BA1 A;  4A3F B;  2PQA B;  5IY0 A;  4JI6 L;  5ELC A;  2EOT A;  4GLV B;  5LMU L;  2DNE A;  2EJG C;  2WAQ E;  3D8G A;  1R4P B;  2ZTE A;  3MHB A;  1TXY A;  1ILQ A;  3DM3 A;  4PNY A;  1EOV A;  1N36 L;  4PZ8 A;  1YIT A;  2BDN A;  1S4Z A;  4DK0 A;  2ICE C;  1IYU A;  4A93 H;  4DXF A;  5JJZ A;  1SNM A;  2WB1 G;  1MSH A;  2SNM A;  4B3S L;  4JI0 L;  1GHJ A;  1EYD A;  1O7Y A;  2Z4H A;  3PIO A;  2VQE Q;  3TP7 A;  1LT6 D;  1BQQ T;  4XQQ A;  1PH4 A;  1JJC B;  1T5E A;  1WTQ A;  3RNU A;  2Z6K A;  4X66 L;  2A6H C;  4ZCK A;  3NK9 A;  1CHQ D;  4UY8 C;  4GN3 B;  3K59 A;  1JIC A;  3F2U A;  4PMC A;  5IP7 G;  4POG A;  4RGN A;  4IPH A;  3PUW A;  4JBM A;  4DR6 Q;  1EQQ A;  2JA5 B;  3I70 A;  4KHP Q;  2XWB B;  3CCS A;  2RQX A;  4A3L G;  2PMZ B;  2A8V A;  4IAL A;  2WAC A;  4DUZ Q;  2UXB L;  1TWH B;  1VQL A;  1STE A;  5FKA C;  1ZKO A;  1N32 Q;  4A3G B;  4LAA A;  2RHS B;  1XWE A;  4YCU A;  5G3L D;  4ZLT F;  1HNW Q;  1PYS B;  1K83 H;  1JOK A;  1FYC A;  2R7Z B;  3PF4 A;  2QGQ A;  5C5M A;  3RZD H;  3P75 A;  2G5D A;  1HZB A;  1PHJ A;  4A3C G;  4POF A;  1DM0 B;  3BYY B;  4OX9 L;  1B1Z A;  3HOU G;  3W3A A;  3T1H Q;  2HCI A;  2B63 B;  4OEL B;  5C44 B;  1FGU A;  2KOL A;  1PH7 A;  1VMC A;  5JJK A;  1LTS D;  1RTN A;  4K0K Q;  1PVO A;  5T1I A;  3SK5 A;  4JCV E;  4GOP A;  4M8A A;  3KJP A;  2NN6 I;  4EQP A;  3DWA A;  3S1M H;  1U5K A;  4UDU C;  2B8F A;  3A5U A;  1IKL A;  2JA6 B;  2VZA A;  2F52 A;  1I6V C;  1I6H B;  3VR4 A;  4ME5 A;  2LSS A;  4NMZ A;  3KDF B;  4DV7 L;  2KHI A;  3SE0 A;  4DR5 Q;  2F0N A;  1A3U A;  3CRK C;  1CSP A;  2Z6B A;  5M3F G;  2LKV A;  1HTL D;  1Y1V B;  1LLR D;  3SK4 A;  3I4M B;  1HZC A;  1VQP A;  4LWC A;  2ZTC A;  1IBK L;  4F7X A;  1B7Y B;  3H94 A;  1HR0 L;  4NXN L;  4A3F H;  2K1B A;  5ELF A;  4O42 A;  1U4M A;  3CXC A;  3ULP A;  4LUZ A;  4JI5 L;  5A2Q E;  3DLL A;  2BH8 A;  1IYJ B;  1XNR L;  3X3M A;  1I5F A;  4NDX A;  3MZ5 A;  3OWE B;  1ESF A;  5CYU A;  2NB0 A;  3CCL A;  1BCP F;  2R7F A;  1VQE A;  4C1N K;  4A75 A;  5I4D A;  2PMZ E;  3GO5 A;  5IGC A;  1B3Q A;  5KND A;  3H0G B;  1WTH A;  4N8X 1;  3T1Y Q;  5IE8 A;  4DAP A;  4JBW A;  3TS2 A;  1TWG B;  2F1M A;  4B3M Q;  5LMN L;  4CJ0 B;  3C3L A;  2KEC A;  3SR1 A;  2WKD A;  1S5F D;  4FXD A;  5DAU A;  2AQ2 B;  1WCM G;  1JB7 A;  2I07 B;  1R4Q B;  5AFW A;  1QVF A;  5J22 A;  3HOY B;  1RL2 A;  4DR1 Q;  4IZ8 A;  4EVO A;  4IUP A;  3TSS A;  1EYC A;  1PDQ A;  3I91 A;  4J1M A;  3K5O A;  3OOC A;  4XQN A;  4JK1 C;  3GTM B;  4EGV A;  1EU3 A;  4JI4 Q;  3KF8 B;  3PUY A;  1EY4 A;  3CC2 A;  1EFI D;  2DJF C;  2KQ3 A;  3HKZ G;  3D6C A;  2F0G A;  5DEH A;  1H9S B;  5C4X G;  4DAY A;  3CW2 C;  2JA5 H;  4RA8 A;  1JJG A;  4RHR A;  5GAE C;  1SRU A;  4LW1 A;  5CBA E;  1PTO C;  4IUV A;  1CSQ A;  2UXD Q;  2K05 A;  4Q0F A;  2PZU A;  2F4V Q;  1TWH H;  3MEH A;  1Y8N B;  4LF4 Q;  4CJ2 C;  1XNQ L;  4JI2 Q;  1D2B A;  4A3G H;  2L11 A;  1ENC A;  1STA A;  3J80 E;  1JOR A;  4I7A A;  4JBJ A;  1FGB D;  3G7L A;  2Z9H A;  3E0E A;  1K28 A;  3R8B A;  1GOZ A;  5CC4 A;  5E4W C;  4DR7 Q;  1NR2 A;  1NY4 A;  1A2T A;  2PO4 A;  2QCP X;  2F4I A;  2B2U C;  2PQE A;  1CQV A;  2RKS A;  2R61 A;  4DF7 A;  1I94 L;  4PV1 C;  3I4O A;  4A3D G;  4RKB A;  2CFM A;  1O7Z A;  2EYH A;  1A0I A;  3AQQ A;  1SE2 A;  3SEB A;  3VYU A;  5AJ3 L;  1IYV A;  5E3F A;  5CV8 A;  2FXQ A;  1J6Q A;  1PZI D;  2R92 B;  4G4K A;  5M5X B;  3JAM L;  1G2S A;  3VYR A;  1LTR D;  3EFX D;  3PO3 H;  3S15 B;  3J80 c;  3H6M A;  3RLN A;  1K9M C;  3Q24 A;  3MXN A;  2I5L X;  1A6X A;  4LFB Q;  4V0B A;  3UE1 A;  4DPG A;  2HIV A;  2JA6 H;  4LUO A;  1I6H H;  1VQJ A;  3Q6S A;  4NKL A;  2IX3 A;  4MN3 A;  3BZD B;  1KLU D;  4WFN 3;  3OMC A;  2RCF A;  3BZK A;  3S1Q H;  1F9S A;  3OYY A;  4BY1 G;  1U4R A;  2HT1 A;  2NWG A;  3GTK B;  5COY A;  1WJJ A;  4RH6 A;  1Q46 A;  4H02 A;  3T16 A;  1XPU A;  5IYD H;  1CA5 A;  4C2M H;  1QNU A;  2XWJ B;  4X62 L;  2D0P A;  3HOV H;  4AQY L;  2CHB D;  1LO5 D;  2CVR A;  5CV4 A;  4CKE A;  1I50 H;  2IL8 A;  1CI3 M;  1WFQ A;  3HOZ B;  4UP9 A;  1SRO A;  2K5W A;  2IT1 A;  2EQS A;  1BNZ A;  1AZQ A;  2L0C A;  1L0W A;  3H0G H;  1N9W A;  1X56 A;  4H0L C;  1X55 A;  2KHJ A;  2K5H A;  3HGB A;  4GLX A;  4QQB X;  4A3J H;  1TWG H;  4YY3 Q;  3CPF A;  1SNQ A;  1HUM A;  4KN4 C;  2H1E A;  1ENA A;  1H9M A;  5IWA L;  1WYD A;  2GVA A;  1BKB A;  4DNT B;  1LT3 D;  2KED A;  3TN2 A;  4C1N I;  1RDP D;  3GTG B;  1G91 A;  4IPG A;  4JI1 Q;  3HOY H;  1Q1B A;  3L3O C;  3DM1 A;  3S1R B;  1SJH D;  1AE3 A;  1RD9 D;  2KEE A;  3L7Z C;  4FYD A;  3GTM H;  4IFD G;  3S2H B;  2R3Z A;  3PMF A;  4JPB W;  2HDL A;  2IHE A;  5C4Z A;  2DGY A;  4BA1 I;  1H95 A;  1KDA A;  1QZG A;  3Q22 A;  1A3V A;  1KC8 C;  4LF6 L;  3GV3 A;  3G4S A;  1WTV A;  1AZP A;  4B9W A;  2IJ0 A;  2B2Y C;  4KLK A;  1TWC H;  2JP1 A;  4XYQ A;  2O4X A;  3ERS X;  4BBR G;  1HR0 W;  2AQ1 B;  5TSS A;  1DCZ A;  2HHH L;  3TZD A;  2RDH A;  4K5X A;  4RFB A;  4DAM A;  2YYZ A;  4PZ7 A;  2JA7 B;  1D5M C;  1IW7 C;  2F0L A;  4C3J B;  2ZT9 C;  3LWU A;  2F0K A;  1VMP A;  1NUC A;  4GLA C;  3FHW A;  4RWS C;  1SYG A;  3W5O A;  4BBS B;  1KTK A;  4C3I B;  2AWN A;  3HOW G;  1SLJ A;  4EQN A;  4YWL A;  1GUN A;  1SN8 A;  2Q8R E;  3VR2 A;  3SK8 A;  1CZW A;  2E2H B;  1SNC A;  2F0M A;  1NNX A;  3RR5 A;  1EOT A;  3AMU A;  5ELE A;  4P2C B;  3LNN A;  5IGG A;  4F8M A;  1I3Q B;  1JOO A;  4JI8 Q;  1SAP A;  3A8K E;  1PRT F;  4YCV A;  3W1G A;  1TY2 A;  2JA8 B;  5M5X H;  2Z0S A;  2CH4 W;  5T1G A;  4DUY L;  1V1P A;  5C4H A;  4LF7 Q;  1PYW D;  3S15 H;  5ELD A;  1VQ7 A;  3OIP A;  1RKN A;  3Q0A A;  2KCM A;  4DR2 Q;  3PIO 3;  4LF8 L;  2R93 B;  1FNW A;  3FPP A;  4DKA C;  1WI5 A;  3PQI A;  4OWT B;  3TS0 A;  2BCO A;  1CUK A;  2AWO A;  2MGS A;  3MXP A;  3GTK H;  4X64 Q;  1UEA B;  1K0R A;  4O1N A;  3FKI H;  4RKL A;  1IBM Q;  3EA6 A;  1D8L A;  3I2Z A;  3NHH A;  1EZ8 A;  3URY A;  5I2Y A;  1QUQ B;  1J5E Q;  5C0X H;  1HFN A;  5DNF A;  5FOB B;  3DMU A;  2A68 D;  3RN2 A;  4GKK Q;  1PZJ D;  1YBY A;  3HOZ H;  1MIU A;  5FO7 B;  2RSO A;  4HMJ A;  4R4C A;  2XRQ D;  2NTT A;  4FNF A;  2KUM A;  2F0E A;  5EGT A;  1JMC A;  5J39 A;  1M90 C;  5CR3 A;  1QB5 D;  3C46 A;  2OQ0 A;  3FEW X;  5C0X J;  2HIX A;  3H91 A;  3RN5 A;  1FD7 D;  2EYJ A;  3HRZ C;  2VB2 X;  3K81 C;  4K5V A;  2PPB C;  4A3I H;  5FLM G;  4ZKB B;  2B2V A;  2KEN A;  4ZKC B;  5JVH 3;  4HJA A;  3TDQ A;  3GTG H;  3KLS A;  4XT3 B;  1J8I A;  4WJW A;  1B53 A;  3CC7 A;  2WB1 B;  1HXY D;  5JEA G;  2WIN B;  1A62 A;  4ID6 A;  4A3E G;  3NPP A;  2F0T A;  5M5W H;  4HR7 B;  2K33 A;  5FLX L;  1WTO A;  2A6E D;  3NTI A;  3OMG A;  1YHA A;  1XJV A;  3I90 A;  1M8A A;  4GKJ L;  2Q2I A;  2YTX A;  4A3M H;  1MJE A;  3WOE A;  3B6Y A;  3MVV A;  1EEI D;  1ESR A;  2EXZ A;  3I56 A;  4B3R L;  2GN5 A;  1XTD A;  2KHS A;  1B2T A;  1BF4 A;  3CCM A;  2J7Z A;  2UXC L;  2JN4 A;  2PNR C;  2JA7 H;  1I4Q A;  2LY7 A;  2FMM A;  4DV4 L;  5HGQ A;  5C5L A;  5EKK A;  4C3J H;  3EQL C;  4CHT B;  3MFY A;  3MXU A;  1HQM C;  2K5D A;  1EIY B;  3PO2 B;  1AEX A;  1QVG A;  3H09 A;  1HCZ A;  4BBS H;  4TKO B;  3PIP A;  4HED A;  4C3I H;  2PI2 E;  2ID0 A;  2RDF A;  3V2T A;  1W3S A;  1WTW A;  4NB3 A;  3T53 B;  4DK3 C;  1BO0 A;  2RSN A;  4A3K G;  2E2H H;  4WJ4 A;  2O5I C;  2ZM6 Q;  3M4P A;  1KL9 A;  5I6Y A;  1BBX C;  5BR8 Q;  1I3Q H;  4FP5 D;  2ZJR A;  3U4Z A;  2OT2 A;  4XIG S;  3CHB D;  2F0F A;  4WJ3 M;  3HOU B;  1S40 A;  2JA8 H;  4IFD I;  2ZXP A;  3ICE A;  4DXG A;  4UP7 A;  2F03 A;  3KBX A;  3ND9 A;  2ZXO A;  3FDT A;  1K8O A;  1STG A;  1D6E C;  3BJU A;  3VR5 A;  4DK1 A;  4U67 3;  2VQE L;  3U50 C;  5A35 A;  2F0I A;  4TRD A;  1EY0 A;  4ZUI A;  3ERQ A;  2C5C A;  1D7Q A;  1KAA A;  1Q90 A;  3CMA A;  2J4X A;  3QOL A;  1GM5 A;  3AFP A;  3DWP A;  1BBW A;  4BXX G;  1EQR A;  2ZJQ A;  4JOI A;  4KY6 A;  4QIW B;  3NWT A;  2I0Q A;  2WB1 E;  5KYI A;  1X65 A;  3VA7 A;  4N8F A;  3HEJ A;  4H13 C;  1Y69 U;  1E1O A;  2E8G A;  1E2V A;  3U4V A;  4IUQ A;  3ULJ A;  4DR6 L;  1HNX Q;  1JCK B;  4F87 A;  1DON A;  4PMB A;  5M3F B;  4KHP L;  3NWS A;  1CKO A;  1VQC A;  2QKI C;  2N3S A;  3NTH A;  2OTJ A;  2GA4 B;  1QIL A;  1T9H A;  2QEJ C;  1N34 L;  4I7Z C;  1LUZ A;  1PTO H;  4DUZ L;  1EIF A;  2HQL A;  1KHI A;  1K0S A;  1GVP A;  1UUP A;  3S16 B;  2PZW A;  1FJG L;  1H9K A;  4AYB E;  2UU9 L;  3HP3 A;  1HNW L;  4G57 A;  4H7B A;  4A93 G;  1X9N A;  2VY3 A;  4GZY C;  2HUG A;  3OTO L;  1TWF B;  4DV2 Q;  4BY7 G;  1HHV A;  2FMC A;  4A3B H;  2SEB D;  2NVT H;  2JE6 I;  3EBE A;  4APV A;  2TSS A;  4L5Q A;  4CDC C;  2DN8 A;  1ET9 A;  3UDF A;  2F3W A;  2PZT A;  3T1H L;  3E6Z X;  2AUJ D;  2B2T A;  4GNX A;  5D65 A;  1KRT A;  3PSI A;  1Q1E A;  1GO3 E;  1WCM B;  4K0K L;  1W6K A;  1EIH A;  4JYA Q;  2EY6 A;  2O2L D;  3S2D B;  1D5Z C;  2JJQ A;  4OXP A;  1AN8 A;  4DAY B;  2WAQ G;  1L1O A;  2WFW A;  4P73 A;  3CU7 A;  2ENB A;  5J3B A;  1F9P A;  1JE5 A;  1F2M A;  4X65 Q;  5IP7 H;  2YTY A;  4DR5 L;  3HKZ B;  4JVZ A;  3SDZ A;  1XX8 A;  2AUK A;  5C4X B;  3DXJ C;  3J81 i;  3GQB A;  5EKI A;  1E2W A;  2F0P A;  5LMU Q;  3KUP A;  1G8Z D;  1V1O A;  4R8I A;  2L5T A;  1VDZ A;  4DGZ A;  3PO2 H;  3MEF A;  2A5H A;  1KLG D;  1YJN A;  1YEZ A;  3TRZ A;  1X3P A;  1JWS D;  3ERO A;  3LX0 A;  3HOX G;  1VQI A;  1ET6 A;  5IGE A;  1E2Z A;  2E2J H;  4OO1 G;  2A68 C;  3STB D;  4HCE A;  2ASB A;  1PTO F;  5CV9 A;  3T1Y L;  1B50 A;  4KY5 A;  5I6W A;  1FL0 A;  3X3N A;  2KJX A;  4TQU S;  4B3M L;  3HOU H;  3F8T A;  1MHW C;  5JPN C;  4A3D B;  5NUC A;  1QG7 A;  1ZYR D;  1S5B D;  1JJ2 A;  4BWG B;  3JAM E;  4L5R C;  1UE5 A;  1UE1 A;  3D4W A;  2EZV A;  1LAC A;  1AW7 A;  4ILW A;  4KKU A;  4OIJ A;  2B29 A;  1HPC A;  5FO8 B;  1E0B A;  2CH4 A;  4KD3 A;  4RCN A;  3GTJ H;  3E9I A;  3G6J B;  1VQ9 A;  2MO1 A;  2NZH A;  1STH A;  1IW7 D;  5E4X A;  4DR1 L;  2DNC A;  3S17 B;  1QE6 A;  1JQY D;  3KLR A;  1CKN A;  4YIJ A;  2YU9 B;  1V1Q A;  3A74 A;  2E76 C;  4CDD C;  4ZRZ A;  3I4L A;  2A6E C;  3HFZ B;  5IGD A;  2A1A A;  4RGO S;  2E2D C;  2OQK A;  2UXB Q;  4K2K A;  5F2D A;  5M3F H;  3VDY A;  1C9O A;  5ELB A;  3SK6 A;  4BY1 B;  2UXD L;  4B9X A;  4C3H G;  3JAM c;  2F4V L;  4LF4 L;  1L0X B;  1N33 Q;  4JI2 L;  2PQA A;  1O80 A;  1BOS A;  2NYZ D;  3DHQ A;  1Z6H A;  5IYC H;  3MFG A;  2F0V A;  2G9H D;  2EPB A;  3HKZ E;  3MTS A;  4PG3 A;  2SDF A;  1V9P A;  1RIP A;  1PFN A;  1HFG A;  1EQV A;  2Z8L A;  1TWF H;  4MHE A;  4R4O A;  1VQO A;  3QG1 A;  1DYQ A;  3H3V I;  4DR7 L;  3I3C A;  4CDF C;  2V4D A;  5HUR A;  2K5N A;  3EN2 A;  4LUV A;  2V1C C;  4DV5 Q;  3J7Z C;  3GTP B;  4FVM A;  2MNA A;  1SMX A;  1VQA A;  5DM7 3;  4JI7 Q;  1KIX A;  1X3F A;  1B9N A;  2WII B;  3CQZ B;  1SMY D;  5HGT A;  1K3B C;  3K0X A;  2E2I B;  2D2C C;  1WCM H;  1ENF A;  1E7Z A;  1ASY A;  1HTP A;  1UE6 A;  3S2D H;  3NP8 A;  3OPO A;  4JV5 L;  5D14 A;  1HA5 A;  3GTL B;  3M7G A;  5G3L F;  4LFB L;  5M5Y B;  4QUF A;  3W2D A;  1WD1 A;  2ZJP A;  2D9U A;  1HR0 Q;  3SVM A;  4GN5 A;  4MZ9 A;  3U9S A;  1Q81 C;  5C4X H;  1OXS C;  2PYK A;  2R7Z H;  2OCE A;  2E74 C;  4BBR B;  3M85 A;  1LTI D;  2EYM A;  1SDF A;  1NJI C;  3ITP A;  1EIG A;  3GP7 A;  2F0O A;  1LTA D;  2B2W A;  4DV6 Q;  3J7A V;  2Z6K C;  2RVL A;  5D3I B;  3P1H A;  3A8J E;  2NVQ B;  2B63 H;  2Z4I A;  5C44 H;  3EJI A;  3SXH A;  2P5Z X;  4IUU A;  2WV6 D;  1PH2 A;  3HOW B;  1TS2 A;  1PMR A;  4J8Q A;  4YHH Q;  4G7H C;  1KRS A;  1U4L A;  3KF6 A;  1X54 A;  2QDB A;  3CF5 A;  4FF4 A;  4YY3 L;  1BBU A;  3RLO A;  1DOM A;  1TY0 A;  2VUM G;  3PO3 G;  3BVZ A;  3S14 B;  4DV1 Q;  5K36 G;  1A8V A;  3CCQ A;  3DWQ A;  1SR3 A;  1OXX K;  4K8J A;  2K4K A;  1YNX A;  2IWH A;  4KD4 A;  2E5L Q;  1XYI A;  1GUW A;  5CV5 A;  5JVG 3;  4JI1 L;  3RUZ A;  3QO2 A;  3OIQ A;  3G6E A;  2JEA I;  1Y1V H;  4XTC S;  3I4M H;  1L2F A;  4HID A;  2YU9 H;  4HTH A;  4ME3 A;  1VQ8 A;  4B3T Q;  1CM9 A;  1DZ1 A;  1DD2 A;  4RHS A;  3VR6 A;  4YWM A;  4KN7 C;  4WOR A;  5CMD A;  2Y0S B;  4DR4 Q;  1MKH A;  3GTQ B;  2K32 A;  4DR3 Q;  3KDF A;  5GAH C;  3A7L A;  2QIL A;  1XNQ Q;  3HOV G;  3A8I E;  2K01 A;  4BY1 H;  1KNA A;  1LV9 A;  2UUC Q;  1C8C A;  3DEP A;  5A2Q L;  2FIN B;  2L12 A;  3BYT B;  5C3E G;  1W2B A;  4GOP C;  1DOL A;  4HJ8 A;  4Q5V A;  4XT1 B;  4OO1 I;  5LHY 1;  3H0G G;  3ZYY X;  1D5X C;  1D1I A;  3AB9 A;  4A3J G;  5E7N A;  1ASZ A;  1K8A C;  1QCB D;  1PFS A;  1AH9 A;  4LFA Q;  2F3V A;  1MSG A;  1EYA A;  1TS5 A;  2N55 A;  1GHK A;  4L6T B;  2PCF B;  3J7A 5;  5I9O A;  3PIP 3;  3MWY W;  2XGT A;  1PH1 A;  1WD0 A;  4K14 A;  5EBD A;  4PQX A;  4IN3 A;  4C56 C;  3GTP H;  1XTC D;  4QF4 A;  1HUN A;  2OWO A;  3STB C;  5GAD C;  4JI8 L;  4DA2 A;  4CJ1 B;  1G51 A;  5KRU A;  1V43 A;  3I72 A;  2AKW B;  2M9V A;  1XMQ Q;  2SOB A;  3CPW A;  4LF7 L;  4N9P A;  1HZ9 A;  3GTL H;  3QB3 A;  2XVS A;  1ZYR C;  3OW7 A;  3BU2 A;  4KTA A;  4DNI A;  5M5Y H;  4A3E B;  4FF1 A;  2Q2U A;  4DR2 L;  5EJW A;  3HS0 C;  2K75 A;  3KF8 A;  4IQZ A;  1IL2 A;  1TQO A;  1EWH A;  3NUC A;  2H5X A;  1Q8I A;  4XQJ A;  5JAV A;  4KHZ A;  2HQE A;  3A55 A;  3K5N A;  2XTI A;  3K5L A;  1H9S A;  1JT8 A;  1B70 B;  4X62 Q;  4HJ7 A;  4AQY Q;  4OHJ A;  3CC4 A;  4BBR H;  1FNU A;  5M3M G;  5ELO A;  3G71 A;  4RAU C;  2KCT A;  1IBM L;  5IYB H;  2PW7 A;  4IFD J;  2Y0S E;  1J5E L;  2I5M X;  4A76 A;  3RMH A;  2N8N A;  5LMN W;  1RF2 D;  1JB3 A;  4Y7N B;  1WOC A;  2EIF A;  4GKK L;  3K58 A;  3I4N G;  2QEX A;  1ZEQ X;  3A0J A;  1Z7T A;  3EIV A;  3CME A;  2JXM B;  4K2L A;  2I5H A;  4TSS A;  2Z1C A;  2R92 H;  4NP5 A;  1U9R A;  1TS4 A;  3UE0 A;  2MO0 A;  1OTC A;  1RHP A;  2L9H A;  3C1E A;  5C6A A;  4A3K B;  1SYD A;  3S14 H;  1PYB A;  1ONL A;  3FMC A;  4B08 A;  4HIK A;  3D4R A;  3ONA B;  1M1K C;  1Y1W B;  4QUC A;  1F77 A;  2B3G A;  5IP9 G;  3J81 j;  2K5Q A;  1VQ6 A;  1UEB A;  1SMY C;  5CBE E;  5HY6 A;  3WOF A;  3R2I A;  1LTL A;  1WTR A;  3I8Z A;  4IJL A;  3FKI G;  3A7A B;  1XPO A;  4UPA A;  1C7Y A;  5IOD A;  1RTO A;  2A69 D;  3J81 L;  1EWC A;  5C0X G;  2LXJ A;  4TVA B;  1Y8P B;  5LL6 X;  3D4D A;  1NMF A;  1DXM A;  5KYL A;  4JI3 Q;  4FO2 A;  5KGU A;  2RDG A;  4KHV A;  1GD7 A;  3K7U C;  1N8R C;  4YCW A;  1VQG A;  1TII D;  2LMC B;  4LF9 Q;  2LS0 1;  3OSO A;  4HAE A;  5IT9 L;  3BZC A;  5L37 A;  4KI0 A;  4FXK C;  2VQF L;  3H15 A;  5IIF A;  4ZQ3 A;  3NEL A;  1HJP A;  3QWN A;  4A3I G;  2X6L A;  4KJO A;  2FHT A;  4A93 B;  3F2D A;  4OON A;  1TU2 B;  3S1R H;  4GNX B;  3VR3 A;  1G29 1;  4OGQ C;  1PZK D;  2KCN A;  3C2P A;  4X6A H;  2XNA C;  3FP9 A;  5BR8 L;  4BY7 B;  1XMO Q;  3P7J A;  4KV6 A;  3S2H H;  2VL6 A;  1P8L A;  3AFQ A;  3PF5 A;  3FRP B;  3NBH A;  1O7I A;  5FLM H;  4QL5 A;  1VQD A;  1R9T B;  2NUC A;  2B8G A;  1L1O B;  5DM6 3;  1Q3L A;  2K14 A;  2BE5 C;  1EWI A;  2NBF A;  5JEA H;  4A3M G;  3IFT A;  4OL7 A;  1NSN S;  2DY8 A;  4A3E H;  4LFC Q;  1GUS A;  2JSO A;  2NN6 H;  1VQ5 A;  4JG2 A;  1KDC A;  3BVG A;  2Q8T A;  2WAQ B;  3MC0 B;  3I7F A;  4C3J G;  3VYS A;  3CCR A;  1KQS A;  5FJ8 H;  2VNU D;  1BUV T;  5JJI A;  1QWY A;  5JEA J;  1F2L A;  1PRT C;  2HD3 A;  1HNX L;  4BBS G;  3L9A X;  4L5T A;  3L0O A;  1HRJ A;  5J1Z A;  3FPU B;  4FF2 A;  4OWX B;  3LWE A;  1KDB A;  3S1N B;  1Y8O B;  1NMG A;  1B8A A;  4KJN A;  3CRL C;  4OIK A;  2A74 C;  4GOP B;  4R4I A;  5IOC A;  2MJ8 A;  3HOX B;  1ILP A;  3KLW A;  4FF3 A;  4DV2 L;  4H44 C;  1JR0 D;  1SNO A;  1P16 A;  4I65 A;  4A3K H;  2UUA Q;  4NXM Q;  1MI2 A;  1S5D D;  1K3R A;  3E0J A;  3GDE A;  2R93 H;  1Y1W H;  1PH8 A;  1KD1 C;  1STB A;  2N49 A;  2VS1 A;  2EYF A;  2F0Q A;  4X3U A;  2KBN A;  3KFU A;  1EYG A;  4P74 A;  3C1F A;  4DV0 Q;  1CHP D;  1Z9F A;  1TWA B;  1IBL Q;  1VQH A;  4JYA L;  2O5J C;  1HNZ Q;  4QGU A;  1BDO A;  1WVL A;  1B3A A;  2F0U A;  4G7O C;  2K03 A;  1EY7 A;  4DV4 Q;  2I46 A;  1YVC A;  4X65 L;  1N32 L;  1SND A;  3E5S A;  4L5S A;  3G48 A;  3J80 i;  3N6R A;  1O7L A;  2PI2 A;  5GQO A;  1AP0 A;  2N78 A;  4NPS A;  4ZK9 B;  1LT5 D;  1QUQ A;  1CFM A;  1CA6 A;  1YZ6 A;  3V96 A;  2H4O A;  1OXV A;  2UUB Q;  3KK7 A;  4P72 A;  4RCO A;  1A15 A;  1SFO B;  1A3T A;  4C3H B;  4A3B G;  4HJ9 A;  1S5C D;  1H9J A;  1Z47 A;  3WDN A;  2BDO A;  4R9W A;  1TR5 A;  4J15 A;  4RG1 A;  1BCP D;  4GN4 B;  2QW7 A;  3DEO A;  1EY8 A;  2LFN A;  4LF5 Q;  1CTM A;  3M3Y B;  2JA9 A;  1KAW A;  5DLQ E;  3F2B A;  4BY7 H;  4X3K A;  4HJ5 A;  4PMW A;  1I4R A;  1Q82 C;  2Q2H A;  4DV3 Q;  2BOS A;  2EJM A;  2PW5 A;  3J7Y W;  1R9T H;  2B2U A;  2IPK D;  1AE2 A;  4ABN A;  3R2T A;  1CQF A;  1NBW A;  2RF4 A;  5EBC A;  3CCU A;  4IPD A;  4R8N A;  2MUY A;  1EY6 A;  3K80 C;  5C0X I;  2B39 A;  3WWV A;  4AYB G;  1SYC A;  4JI6 Q;  1K8M A;  1UE7 A;  2K7V A;  1K8G A;  1QJO A;  3M9B A;  4JC0 A;  4A3L H;  3NE5 B;  1UAP A;  4QIW E;  4IPC A;  2ICI A;  1VQB A;  3I55 A;  1N34 Q;  2WP8 J;  4IOA A;  3PO2 G;  2X69 A;  2OXP A;  3E9H A;  2B2V C;  1N36 Q;  1ZXT A;  2A69 C;  3PCO B;  4U68 A;  3VYT A;  5JJL A;  2NVX B;  2FJ2 A;  1FJG Q;  2UU9 Q;  3S1N H;  2EVB A;  1X3G A;  1GUT A;  2EYO A;  2NZO A;  3RZO B;  1FVI A;  2IY5 B;  2WKC A;  1N33 L;  2XSC A;  4JI0 Q;  4A3C H; 
#chains in the Genus database with same CATH homology
 2NTS A;  2L1B A;  5I9P A;  1IHZ A;  1EEF D;  3RLF A;  2F0S A;  4OO1 H;  1I4P A;  4DFA A;  3P20 A;  4J6H A;  1YNJ C;  3T13 A;  3K0Y A;  3PO3 B;  2VUM B;  2TMP A;  1MBY A;  1BR9 A;  3T56 B;  4K5W A;  4LK1 C;  1NR4 A;  3S1Q B;  3K6O A;  4HSV A;  1I4H A;  1FR3 A;  1SBB B;  1SJE D;  1SYE A;  5C3W A;  1L0Y B;  1I4X A;  3SHL A;  4XXE A;  2G9D A;  2NVY B;  4IUN A;  4C2M B;  2K6A A;  1JC7 A;  1GXD C;  2A73 B;  3HOV B;  4RGT A;  5CGK A;  2RBM A;  1I50 B;  2B2Y A;  3QOJ A;  1ICW A;  3IL8 A;  3M4O B;  1PRT B;  5C3E B;  2BA0 A;  1CK1 A;  1GUG A;  4ZAI A;  3GTO B;  4CKC A;  3BDL A;  2X6G A;  3H3V C;  4MIU A;  4A3J B;  3D31 A;  3U9O A;  5LL6 S;  1IKM A;  3K57 A;  1F9Q A;  2KVM A;  2MP1 A;  4EQO A;  1LT4 D;  3BG3 A;  3J7A F;  1PXU A;  2K28 A;  2OEO A;  1WTX A;  2NZ1 D;  3IKJ A;  5JOB A;  3CKI B;  3MXG A;  4L8J A;  1TWC B;  2F0H A;  5KNC A;  1EQT A;  5C4J B;  4E6I A;  1OXT A;  1TS3 A;  1MGS A;  2B2T C;  1TKW B;  2HCC A;  1T5X D;  4HCS A;  2FFK B;  4K8I A;  1HA6 A;  2J0T D;  4FXG C;  5M3M B;  4HMI A;  2OF1 A;  3OWF A;  3D3R A;  1SE4 A;  1F2Y A;  1JWU D;  2F0W A;  4ZYS A;  4DAV A;  1TT2 A;  1V1P B;  1V8Q A;  2F0D A;  2BE5 D;  3NXW A;  1F9R A;  2JEB I;  3FVQ A;  3I4N B;  2EYP A;  1SNP A;  5IGF A;  2ZXR A;  4X3T A;  2IX0 A;  2E75 C;  4K6L A;  1SYF A;  1LTT D;  1BCP C;  1NAP A;  4ULL A;  5K36 H;  4DNR B;  4G7Z C;  1PRT D;  1GJX A;  4Z9C B;  1DJR D;  1X3Q A;  1C48 A;  2EY5 A;  3OHX C;  1IL8 A;  3J81 E;  1VF7 A;  2IX1 A;  3PUV A;  3N52 A;  3FKI B;  3RD4 A;  2R6G A;  1W6J A;  1G6Z A;  5IT9 E;  5COR A;  2M00 A;  3MAQ A;  2RA4 A;  3S9W A;  3EVQ A;  3A56 A;  1SEB D;  4QCL A;  5KNB A;  1ML0 D;  3NQI A;  5KEE A;  5EKL A;  4A3I B;  1H9R A;  2CW0 D;  2VB3 X;  1UNS A;  3MA2 B;  5E1F A;  5FLX E;  5IGB A;  2EJF C;  2QF7 A;  3R93 A;  1YNN D;  3QJY A;  4XDX A;  3TME A;  4BA2 I;  1D1K A;  5FK9 C;  4KK7 A;  4IFD H;  5M5W B;  1QOH A;  1EY5 A;  2MHV A;  4K6D A;  1CT1 D;  5I2X A;  5M9O A;  2N88 A;  5CV6 A;  1SE3 A;  1PLF A;  3BDC A;  1JWM D;  4N9T A;  2XRS D;  4A3M B;  3Q23 A;  3GD7 A;  5EPJ A;  3J80 L;  3TP6 A;  4BS9 A;  4QB4 A;  1JE4 A;  1FNV A;  1EU4 A;  2L4N A;  3M7N A;  1LAB A;  2IW3 A;  5EPL A;  4KMU C;  1RCV D;  3O13 A;  5EPK A;  3I73 A;  3KLS X;  1CZG A;  5JPM C;  1EY9 A;  2XN9 C;  2AQ3 B;  1BXT A;  3NSW A;  1TVX A;  3KBG A;  2A6H D;  2K04 A;  4F88 A;  1U4P A;  1PFM A;  2XIW A;  4LMQ D;  1STY A;  1J9O A;  1PFB A;  3K7A B;  4CBV A;  5KIX A;  1VCI A;  4HN7 A;  2EYL A;  1KNE A;  3HZX A;  1LTB D;  3T4A C;  3HG9 A;  1STN A;  3AU7 A;  4UAI A;  4LJZ C;  2VXW A;  4XYO A;  1DOK A;  4M1U B;  2B2W C;  1RJT A;  1QNK A;  2MPM A;  1II3 A;  2Q8I B;  3IAY A;  1F2Z A;  1B9M A;  2JYO A;  1C4Q A;  4KY7 A;  5EQ0 A;  5D3D A;  1OXU A;  2EY1 A;  5C3X A;  4L63 B;  2KCC A;  4RGM A;  4S3S A;  2EDG A;  4CGY B;  1PTO B;  1Q12 A;  1HQR D;  1JOQ A;  2DY7 A;  5BN5 A;  1YNJ D;  1XXG A;  3NTK A;  1X32 A;  1WTP A;  3M4Y A;  3TZU A;  3R3O A;  4V19 0;  3TP5 A;  4ODG A;  5ISR A;  4A3B B;  3BVM A;  2NVT B;  1LTG D;  1ROD A;  2CQA A;  5BN3 A;  4KKS A;  4ZUJ A;  2F0J A;  3PUX A;  3PUZ A;  3GV6 A;  1I4G A;  1EZ6 A;  4DU9 A;  4HSP A;  1B4O A;  1KAB A;  3BDO A;  2NN6 G;  3DUZ A;  3UI2 A;  4CKB A;  3QIA A;  1SSO A;  3TP8 A;  3K5M A;  3NBI A;  3BS1 A;  1BCP B;  2C9O A;  3NQT A;  4IUT A;  1SXT A;  2M2L A;  3IFD A;  1B44 D;  4C3I G;  4AYB B;  1GUO A;  2D62 A;  2KA7 A;  5CV7 A;  1K83 B;  2SNS A;  4DN4 M;  3RZD B;  3PV0 A;  1G2T A;  2L55 A;  3V05 A;  3ND8 A;  1A2U A;  5K5P A;  1S5E D;  1O78 A;  1VF5 C;  2E2J B;  4X3S A;  1M4V A;  4NW2 A;  2D5D A;  1OO9 B;  1SYB A;  5FO9 B;  1EL0 A;  1AFP A;  2EE1 A;  4QMG A;  3VA5 A;  1MD2 D;  3S1M B;  1PTO D;  3TBI B;  3T51 B;  4KKT A;  2EY2 A;  3A54 A;  3GTJ B;  5BN4 A;  2CW0 C;  4IUR A;  1NCV A;  1YNN C;  2HDM A;  3D6W A;  4WRD A;  2BA1 A;  4A3F B;  5ELC A;  2EOT A;  2DNE A;  2EJG C;  3D8G A;  1R4P B;  3MHB A;  1ILQ A;  4PNY A;  2BDN A;  1S4Z A;  4DK0 A;  2ICE C;  1IYU A;  4DXF A;  5JJZ A;  1SNM A;  1MSH A;  2SNM A;  1GHJ A;  1EYD A;  1O7Y A;  2Z4H A;  3TP7 A;  1LT6 D;  1BQQ T;  4XQQ A;  1T5E A;  1WTQ A;  2A6H C;  3NK9 A;  1CHQ D;  3K59 A;  1JIC A;  3F2U A;  4PMC A;  4RGN A;  3PUW A;  2JA5 B;  3I70 A;  2XWB B;  2RQX A;  2PMZ B;  4IAL A;  2WAC A;  1TWH B;  1STE A;  5FKA C;  1ZKO A;  4A3G B;  4LAA A;  1XWE A;  5G3L D;  4ZLT F;  1JOK A;  1FYC A;  2R7Z B;  5C5M A;  3P75 A;  1DM0 B;  3BYY B;  1B1Z A;  3W3A A;  2HCI A;  2B63 B;  5C44 B;  2KOL A;  1VMC A;  1LTS D;  1RTN A;  5T1I A;  3SK5 A;  4M8A A;  2NN6 I;  4EQP A;  3DWA A;  4UDU C;  2B8F A;  1IKL A;  2JA6 B;  1I6V C;  1I6H B;  3VR4 A;  4ME5 A;  4NMZ A;  3SE0 A;  2F0N A;  1A3U A;  3CRK C;  2LKV A;  1HTL D;  1Y1V B;  1LLR D;  3SK4 A;  3I4M B;  4F7X A;  3H94 A;  2K1B A;  5ELF A;  4O42 A;  1U4M A;  5A2Q E;  3X3M A;  4NDX A;  3MZ5 A;  3OWE B;  1ESF A;  5CYU A;  2NB0 A;  1BCP F;  4C1N K;  5I4D A;  3GO5 A;  5IGC A;  5KND A;  3H0G B;  4DAP A;  4JBW A;  1TWG B;  2F1M A;  4CJ0 B;  3C3L A;  2KEC A;  3SR1 A;  2WKD A;  1S5F D;  4FXD A;  5DAU A;  2AQ2 B;  2I07 B;  1R4Q B;  5AFW A;  5J22 A;  3HOY B;  4IZ8 A;  4EVO A;  4IUP A;  3TSS A;  1EYC A;  1PDQ A;  3I91 A;  4J1M A;  3K5O A;  3OOC A;  4XQN A;  4JK1 C;  3GTM B;  4EGV A;  1EU3 A;  3PUY A;  1EY4 A;  1EFI D;  2KQ3 A;  3D6C A;  2F0G A;  5DEH A;  1H9S B;  4DAY A;  4RA8 A;  4RHR A;  5CBA E;  1PTO C;  4IUV A;  2K05 A;  4Q0F A;  2PZU A;  3MEH A;  1Y8N B;  4CJ2 C;  1D2B A;  2L11 A;  1ENC A;  1STA A;  3J80 E;  1JOR A;  1FGB D;  3G7L A;  3R8B A;  1GOZ A;  5CC4 A;  5E4W C;  1NR2 A;  1A2T A;  2PO4 A;  2QCP X;  2F4I A;  2B2U C;  2PQE A;  1CQV A;  2RKS A;  2R61 A;  4DF7 A;  4PV1 C;  4RKB A;  1O7Z A;  2EYH A;  1SE2 A;  3SEB A;  3VYU A;  1IYV A;  5E3F A;  5CV8 A;  1PZI D;  2R92 B;  4G4K A;  5M5X B;  3JAM L;  1G2S A;  3VYR A;  1LTR D;  3EFX D;  3S15 B;  3H6M A;  3Q24 A;  3MXN A;  1A6X A;  4V0B A;  3Q6S A;  4NKL A;  2IX3 A;  4MN3 A;  3BZD B;  1KLU D;  4WFN 3;  3OMC A;  1F9S A;  1U4R A;  2NWG A;  3GTK B;  5COY A;  4RH6 A;  3T16 A;  1CA5 A;  1QNU A;  2XWJ B;  2CHB D;  1LO5 D;  2CVR A;  5CV4 A;  4CKE A;  2IL8 A;  1CI3 M;  3HOZ B;  2K5W A;  2IT1 A;  1BNZ A;  1AZQ A;  2L0C A;  4H0L C;  3HGB A;  1SNQ A;  1HUM A;  4KN4 C;  2H1E A;  1ENA A;  1H9M A;  4DNT B;  1LT3 D;  2KED A;  3TN2 A;  4C1N I;  1RDP D;  3GTG B;  1G91 A;  1Q1B A;  3L3O C;  3DM1 A;  3S1R B;  1SJH D;  1RD9 D;  2KEE A;  3L7Z C;  4FYD A;  4IFD G;  3S2H B;  2R3Z A;  3PMF A;  2HDL A;  5C4Z A;  4BA1 I;  1KDA A;  3Q22 A;  1A3V A;  3GV3 A;  1WTV A;  1AZP A;  4B9W A;  2IJ0 A;  2B2Y C;  2JP1 A;  4XYQ A;  2O4X A;  2AQ1 B;  5TSS A;  1DCZ A;  3TZD A;  2RDH A;  4K5X A;  4RFB A;  2YYZ A;  2JA7 B;  1D5M C;  1IW7 C;  2F0L A;  4C3J B;  2ZT9 C;  3LWU A;  2F0K A;  1VMP A;  1NUC A;  4RWS C;  1SYG A;  4BBS B;  1KTK A;  4C3I B;  2AWN A;  4EQN A;  1GUN A;  2Q8R E;  3VR2 A;  3SK8 A;  1CZW A;  2E2H B;  1SNC A;  2F0M A;  1EOT A;  3AMU A;  5ELE A;  4P2C B;  3LNN A;  5IGG A;  4F8M A;  1I3Q B;  1JOO A;  1SAP A;  3A8K E;  1PRT F;  1TY2 A;  2JA8 B;  5T1G A;  1V1P A;  5C4H A;  1PYW D;  5ELD A;  3OIP A;  1RKN A;  3Q0A A;  3PIO 3;  2R93 B;  1FNW A;  3FPP A;  2BCO A;  2AWO A;  2MGS A;  3MXP A;  1UEA B;  4O1N A;  4RKL A;  3EA6 A;  3NHH A;  1EZ8 A;  3URY A;  5I2Y A;  5C0X H;  1HFN A;  5DNF A;  5FOB B;  3DMU A;  2A68 D;  1PZJ D;  5FO7 B;  2RSO A;  4HMJ A;  2XRQ D;  2NTT A;  4FNF A;  2KUM A;  2F0E A;  5EGT A;  5J39 A;  5CR3 A;  1QB5 D;  3C46 A;  5C0X J;  3FEW X;  3H91 A;  1FD7 D;  2EYJ A;  3HRZ C;  2VB2 X;  4K5V A;  2PPB C;  4ZKB B;  2B2V A;  4ZKC B;  5JVH 3;  3TDQ A;  3KLS A;  4XT3 B;  1J8I A;  4WJW A;  1B53 A;  2WB1 B;  1HXY D;  5JEA G;  2WIN B;  4ID6 A;  3NPP A;  2F0T A;  4HR7 B;  2K33 A;  5FLX L;  1WTO A;  2A6E D;  3NTI A;  3OMG A;  3I90 A;  1M8A A;  3WOE A;  3MVV A;  1EEI D;  1ESR A;  2EXZ A;  2KHS A;  1B2T A;  1BF4 A;  2J7Z A;  2PNR C;  1I4Q A;  2LY7 A;  2FMM A;  5C5L A;  5EKK A;  3EQL C;  4CHT B;  3MFY A;  3MXU A;  1HQM C;  2K5D A;  3PO2 B;  1AEX A;  3H09 A;  1HCZ A;  4TKO B;  4HED A;  2ID0 A;  2RDF A;  3V2T A;  1WTW A;  3T53 B;  1BO0 A;  2RSN A;  2O5I C;  5I6Y A;  1BBX C;  4FP5 D;  2OT2 A;  4XIG S;  3CHB D;  2F0F A;  3HOU B;  4IFD I;  2ZXP A;  4DXG A;  2F03 A;  3KBX A;  3ND9 A;  2ZXO A;  3FDT A;  1K8O A;  1STG A;  1D6E C;  3VR5 A;  4DK1 A;  4U67 3;  5A35 A;  2F0I A;  4TRD A;  1EY0 A;  4ZUI A;  3ERQ A;  2C5C A;  1Q90 A;  1KAA A;  2J4X A;  3QOL A;  3DWP A;  4KY6 A;  4QIW B;  3NWT A;  5KYI A;  3VA7 A;  3HEJ A;  4H13 C;  1Y69 U;  1E2V A;  4IUQ A;  1JCK B;  4F87 A;  1DON A;  4PMB A;  5M3F B;  3NWS A;  2QKI C;  3NTH A;  2GA4 B;  1QIL A;  2QEJ C;  4I7Z C;  1PTO H;  1UUP A;  3S16 B;  2PZW A;  1H9K A;  3HP3 A;  4G57 A;  4H7B A;  4GZY C;  2HUG A;  1TWF B;  1HHV A;  2FMC A;  2SEB D;  2JE6 I;  2TSS A;  2DN8 A;  1ET9 A;  2F3W A;  2PZT A;  3E6Z X;  2AUJ D;  2B2T A;  5D65 A;  1Q1E A;  1WCM B;  1W6K A;  1EIH A;  2EY6 A;  2O2L D;  3S2D B;  1D5Z C;  1AN8 A;  3CU7 A;  2ENB A;  1F9P A;  1F2M A;  3HKZ B;  3SDZ A;  1XX8 A;  2AUK A;  5C4X B;  3DXJ C;  3GQB A;  5EKI A;  1E2W A;  2F0P A;  3KUP A;  1G8Z D;  1V1O A;  4R8I A;  2L5T A;  1VDZ A;  4DGZ A;  2A5H A;  1KLG D;  1X3P A;  1JWS D;  3ERO A;  3LX0 A;  1ET6 A;  5IGE A;  1E2Z A;  4OO1 G;  2A68 C;  4HCE A;  1PTO F;  5CV9 A;  1B50 A;  4KY5 A;  5I6W A;  3X3N A;  2KJX A;  4TQU S;  5JPN C;  4A3D B;  5NUC A;  1QG7 A;  1ZYR D;  1S5B D;  4BWG B;  3JAM E;  2EZV A;  3D4W A;  1LAC A;  1AW7 A;  4ILW A;  4KKU A;  4OIJ A;  1HPC A;  5FO8 B;  1E0B A;  4KD3 A;  4RCN A;  3G6J B;  1STH A;  1IW7 D;  5E4X A;  2DNC A;  3S17 B;  1QE6 A;  1JQY D;  3KLR A;  4YIJ A;  2YU9 B;  2E76 C;  4ZRZ A;  3I4L A;  2A6E C;  5IGD A;  4RGO S;  2E2D C;  4K2K A;  5F2D A;  5ELB A;  3SK6 A;  4BY1 B;  4B9X A;  4C3H G;  1L0X B;  1O80 A;  1BOS A;  2NYZ D;  3DHQ A;  1Z6H A;  3MFG A;  2F0V A;  2G9H D;  2EPB A;  3MTS A;  2SDF A;  1PFN A;  1HFG A;  1EQV A;  2Z8L A;  4MHE A;  3QG1 A;  1DYQ A;  3I3C A;  2V4D A;  5HUR A;  3GTP B;  4FVM A;  5DM7 3;  1B9N A;  2WII B;  3CQZ B;  1SMY D;  5HGT A;  2E2I B;  2D2C C;  1ENF A;  1HTP A;  3NP8 A;  3OPO A;  5D14 A;  1HA5 A;  3GTL B;  3M7G A;  5G3L F;  5M5Y B;  4QUF A;  3W2D A;  1WD1 A;  2D9U A;  3SVM A;  3U9S A;  1OXS C;  2PYK A;  2E74 C;  4BBR B;  3M85 A;  1LTI D;  2EYM A;  1SDF A;  3ITP A;  1EIG A;  3GP7 A;  2F0O A;  1LTA D;  2B2W A;  3J7A V;  2RVL A;  5D3I B;  3P1H A;  3A8J E;  2NVQ B;  2Z4I A;  3SXH A;  3EJI A;  4IUU A;  2WV6 D;  3HOW B;  1TS2 A;  1PMR A;  4J8Q A;  4G7H C;  1U4L A;  2QDB A;  4FF4 A;  1DOM A;  1TY0 A;  3BVZ A;  3S14 B;  5K36 G;  3DWQ A;  1OXX K;  4K8J A;  2IWH A;  4KD4 A;  1XYI A;  1GUW A;  5CV5 A;  5JVG 3;  3RUZ A;  3QO2 A;  3OIQ A;  2JEA I;  4XTC S;  4HTH A;  1CM9 A;  1DZ1 A;  1DD2 A;  4RHS A;  3VR6 A;  4KN7 C;  4WOR A;  5CMD A;  2Y0S B;  3GTQ B;  2K32 A;  3A7L A;  2QIL A;  3A8I E;  2K01 A;  1KNA A;  1LV9 A;  1C8C A;  3DEP A;  5A2Q L;  2FIN B;  2L12 A;  3BYT B;  1DOL A;  4Q5V A;  4XT1 B;  4OO1 I;  5LHY 1;  3ZYY X;  1D5X C;  1D1I A;  3AB9 A;  1QCB D;  2F3V A;  1MSG A;  1EYA A;  1TS5 A;  2N55 A;  1GHK A;  4L6T B;  2PCF B;  5I9O A;  3PIP 3;  3MWY W;  1WD0 A;  4K14 A;  5EBD A;  4PQX A;  4IN3 A;  4C56 C;  1XTC D;  4QF4 A;  1HUN A;  4DA2 A;  4CJ1 B;  5KRU A;  1V43 A;  3I72 A;  2M9V A;  2SOB A;  4N9P A;  3QB3 A;  2XVS A;  1ZYR C;  3OW7 A;  4KTA A;  4A3E B;  4FF1 A;  5EJW A;  3HS0 C;  3KF8 A;  4IQZ A;  1TQO A;  1EWH A;  3NUC A;  1Q8I A;  4XQJ A;  5JAV A;  4KHZ A;  2HQE A;  3A55 A;  3K5N A;  3K5L A;  1H9S A;  4OHJ A;  1FNU A;  4RAU C;  2PW7 A;  4IFD J;  3RMH A;  1RF2 D;  1JB3 A;  4Y7N B;  3K58 A;  1ZEQ X;  1Z7T A;  2JXM B;  4K2L A;  4TSS A;  2Z1C A;  4NP5 A;  1U9R A;  1TS4 A;  1RHP A;  2L9H A;  3C1E A;  5C6A A;  4A3K B;  1SYD A;  1ONL A;  3FMC A;  4B08 A;  3D4R A;  3ONA B;  1Y1W B;  4QUC A;  1F77 A;  2K5Q A;  1SMY C;  5CBE E;  3WOF A;  3R2I A;  1WTR A;  3I8Z A;  3A7A B;  5IOD A;  1RTO A;  2A69 D;  3J81 L;  1EWC A;  5C0X G;  1Y8P B;  5LL6 X;  3D4D A;  1DXM A;  5KYL A;  4FO2 A;  5KGU A;  2RDG A;  4KHV A;  2LMC B;  1TII D;  2LS0 1;  3OSO A;  4HAE A;  5IT9 L;  4KI0 A;  4FXK C;  5IIF A;  4ZQ3 A;  3QWN A;  2X6L A;  4KJO A;  2FHT A;  4A93 B;  1TU2 B;  3VR3 A;  1G29 1;  4OGQ C;  1PZK D;  2KCN A;  3C2P A;  2XNA C;  4BY7 B;  3P7J A;  4KV6 A;  3FRP B;  3NBH A;  1R9T B;  2NUC A;  2B8G A;  5DM6 3;  1Q3L A;  2BE5 C;  2NBF A;  5JEA H;  3IFT A;  4OL7 A;  1NSN S;  2DY8 A;  1GUS A;  2JSO A;  2NN6 H;  1KDC A;  3BVG A;  2Q8T A;  2WAQ B;  3MC0 B;  4C3J G;  3VYS A;  2VNU D;  1BUV T;  1QWY A;  5JEA J;  1F2L A;  1PRT C;  3L9A X;  1HRJ A;  5J1Z A;  3FPU B;  4FF2 A;  3LWE A;  1KDB A;  3S1N B;  1Y8O B;  4KJN A;  3CRL C;  4OIK A;  2A74 C;  5IOC A;  2MJ8 A;  3HOX B;  1ILP A;  4FF3 A;  4H44 C;  1JR0 D;  1SNO A;  4I65 A;  1MI2 A;  1S5D D;  3E0J A;  1STB A;  2EYF A;  2F0Q A;  4X3U A;  3C1F A;  1CHP D;  1TWA B;  2O5J C;  1BDO A;  1WVL A;  1B3A A;  2F0U A;  4G7O C;  2K03 A;  1EY7 A;  2I46 A;  1SND A;  3E5S A;  3N6R A;  1O7L A;  1AP0 A;  4ZK9 B;  1LT5 D;  1CFM A;  1CA6 A;  3V96 A;  2H4O A;  1OXV A;  3KK7 A;  4RCO A;  1A15 A;  1SFO B;  1A3T A;  4C3H B;  1S5C D;  1H9J A;  1Z47 A;  3WDN A;  2BDO A;  4R9W A;  1TR5 A;  1BCP D;  3DEO A;  1EY8 A;  2LFN A;  1CTM A;  3M3Y B;  4X3K A;  4PMW A;  1I4R A;  2BOS A;  2EJM A;  2PW5 A;  3J7Y W;  2B2U A;  2IPK D;  4ABN A;  3R2T A;  1CQF A;  5EBC A;  4R8N A;  2MUY A;  1EY6 A;  5C0X I;  2B39 A;  1SYC A;  1K8M A;  2K7V A;  1QJO A;  3NE5 B;  1UAP A;  2ICI A;  2WP8 J;  2X69 A;  2OXP A;  2B2V C;  1ZXT A;  2A69 C;  4U68 A;  3VYT A;  2NVX B;  2FJ2 A;  2EVB A;  1GUT A;  2EYO A;  3RZO B;  2WKC A;  2XSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...