5F2DA

Crystal structure of staphylococcal nuclease variant delta+phs i92n/v99t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYNYADGKMTNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92N/V99T at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5f2dA00
5J39A 5IIFA 3OMGA 3SXHA 5KRUA 1A3VA 5EKLA 3EJIA 4K8IA 2EXZA 1EZ6A 3MHBA 1JOOA 2F0SA 3H6MA 1EYDA 2RBMA 4OL7A 2RKSA 2EYLA 4ZUJA 2F0FA 2F0LA 4K5WA 4K8JA 1SNQA 2F0IA 4TRDA 4KHVA 4I65A 4KJNA 4NMZA 3TP5A 5IGEA 5KGUA 2F0TA 3RUZA 1ENAA 2F0JA 4E6IA 2PW7A 1A2TA 3NP8A 1SYBA 1F2MA 4N9TA 1A2UA 5JAVA 3TP6A 1TR5A 2EY1A 2RDFA 1SNMA 2KHSA 1KAAA 3T16A 2PQEA 5DAUA 3QB3A 5KYLA 1EZ8A 1ENCA 4IUNA 4K2KA 3V2TA 4B9XA 3ERQA 5IGCA 3HEJA 3QOLA 1NSNS 1SNDA 2F0QA 2PW5A 2PZWA 2SNMA 4HMIA 4K2LA 1EYAA 4KY7A 4ODGA 5I6YA 4WORA 1EY4A 1JOQA 2F0NA 2F3VA 5CR3A 5CV9A 2F0KA 3R3OA 5IODA 5CV6A 5C3XA 4H7BA 2F0PA 3DHQA 4PNYA 4K5XA 5E1FA 4RKBA 2QDBA 4PMCA 1EY7A 2HQEA 1SNPA 2F0HA 3MZ5A 4N9PA 4ID6A 2F0EA 1NUCA 2EYMA 5CC4A 5IGDA 2EY2A 5ISRA 5IGGA 1TT2A 4WRDA 1STBA 3NXWA 5I9OA 1KDAA 2F0VA 1STAA 3NUCA 1F2YA 2F0MA 1EY8A 5C5MA 4ZUIA 1STNA 3T13A 1SYDA 2EYJA 1A3UA 2F0WA 2PZUA 4EQOA 4HTHA 3D4DA 4J1MA 4K5VA 4LAAA 2M00A 3EVQA 1EY5A 3SK5A 4DF7A 5CGKA 3DMUA 3OMCA 4S3SA 5KEEA 1AEXA 2EYPA 2F0DA 5C5LA 5KYIA 1STYA 3NK9A 1KDCA 4G57A 3EROA 4ZQ3A 3MVVA 5CV4A 2KQ3A 5NUCA 3D4WA 1EY6A 1RKNA 3LX0A 2EYHA 1JOKA 2SOBA 3C1EA 4IALA 5CV7A 2OXPA 3BDLA 1U9RA 3MEHA 4KD3A 4YIJA 5C3WA 4IZ8A 1EYCA 5EKKA 2F0GA 3OWFA 5IGFA 5M9OA 1F2ZA 5CV5A 2WACA 2PZTA 5HGTA 1JORA 2NUCA 4ME5A 3P75A 5J22A 5JOBA 1II3A 4QMGA 1SYFA 2OF1A 4J6HA 3SK6A 3ITPA 4PMBA 4KTAA 4DGZA 3NQTA 3MXPA 3SK8A 2LKVA 1STHA 5KIXA 3TMEA 1SNOA 3E5SA 4KJOA 4KY6A 4NP5A 2OEOA 4KV6A 4EVOA 5I9PA 5IOCA 2EYOA 5DEHA 3S9WA 1EY9A 3QOJA 4NDXA 3D6CA 4B9WA 5C6AA 1KDBA 5C4ZA 1KABA 2F0UA 1SNCA 2SNSA 3NHHA 3U9OA 4KY5A 1EY0A 1STGA 4QF4A 5CV8A 5HURA 2ENBA 4QB4A 4DFAA 2EYFA 4RKLA 3TP7A 5E3FA 2PYKA 3HZXA 1SYEA 4EQPA 5K5PA 4K14A 5IGBA 3D8GA 4KD4A 3SR1A 4HMJA 3VA5A 4EQNA 1SYGA 5F2DA 5C4HA 3TP8A 2EY6A 5J1ZA 2F0OA 3OSOA 2EY5A 3BDCA 4MIUA 3SK4A 3SHLA 1TQOA 5EGTA 2O4XA 4DU9A 5I6WA 4K6DA 4F7XA 4NKLA 3P1HA 4F8MA 3C1FA 1IHZA 1EQVA 1SYCA 2F3WA 4R8NA 3PMFA 1A3TA
chains in the Genus database with same CATH superfamily
2EJFC 5K36G 1V8QA 2KCTA 4FF1A 4K5WA 4P72A 4K8JA 2F0IA 2JA6H 5IGEA 4EX5A 3HOXH 1XXGA 3HOYH 1SFOH 4B3SL 1P16A 2B2YC 2A6HD 3HKZB 4DPGA 4FXGC 1YEZA 2VL6A 3GTGH 4PG3A 3GQBA 4LF7L 2ZT9C 1VQ6A 5KYLA 3VR4A 1WTOA 4HJ9A 4JI6Q 4G4KA 4DK0A 5C0XG 1TWGH 3DLLA 3K80C 2E2IH 4U68A 1SNDA 1LT5D 2LMCB 2PZWA 1BDOA 1PFNA 2Z6BA 4J15A 1D7QA 2ZTCA 5IYCG 1JJ2A 3U58A 3KLSX 2JA5H 5C3XA 4BY1B 3I4NH 5G3LF 4A3IB 4MTNA 4Z9CB 1NTGA 4FYDA 3PUWA 4JI5Q 3DUZA 3RLOA 3MEFA 1TS3A 1LV9A 1SNPA 2DJGC 5M3FH 3EN2A 2MQHA 5FLXE 3T53B 4LFAQ 2BOSA 2BH8A 4WRDA 4FF2A 3HOWB 5JVH3 1EIYB 2Q8IB 4EQOA 1WTVA 4IFDG 5CBEE 2C9OA 2I07B 2K75A 3I56A 2VUMH 4DR4L 4CKBA 2VNUD 2WAQE 5KYIA 2JSOA 2N8NA 2Z8LA 2OXPA 1RTOA 1EL0A 4H0LC 4DXFA 1L0WA 3GTMH 1TS5A 4JOIC 4WFN3 3MWYW 3CW2C 1L0XB 1EEID 1Y8OB 2RA4A 1CSPA 1EIFA 3I70A 2IX1A 4JI0L 2EXDA 2WAQG 2IY5B 4IPCA 1D8LA 2OEOA 3EFXD 5M3MH 4RGOS 4KHZA 1EOTA 4G7OC 1VMCA 1Z47A 1KABA 4FO2A 4YCVA 1O78A 2ZM6L 2NZHA 3T51B 4QB4A 3PO2B 4RKLA 2K32A 1E3PA 1UUPA 3J81E 4WJ4A 1EWCA 1O7LA 2O5JC 1VMPA 4NXMQ 4DV6L 3J7YW 1EU4A 4CJ0B 1J5EL 2R7ZH 4JCVE 1YNNC 4A3CH 4GN3B 2R93B 1CUKA 2ZTEA 1EYGA 4FNFA 2RKSA 2Y0SE 3ONAB 3L2PA 1V1OA 1PFBA 3SE0A 1EU3A 2F0JA 2YTVA 2PW7A 4DNIA 3KFUA 5JAVA 4LF5L 4JI1Q 3S2HH 4FP5D 1PHJA 3I2ZA 2DNCA 1WTXA 1DGSA 3OIPA 2XNAC 5A2QE 1O7YA 3K7AH 3CKIB 4OIKA 1I94Q 4LF4L 2UU9Q 4K2LA 2UXBQ 4KY7A 4XQQA 2GA4B 3DWAA 1V9PA 4DV1Q 3J7AF 1DONA 1HUNA 3OWEB 5KNDA 3I73A 1BOSA 1H9SA 4JW0A 1GOZA 4B08A 1X6OA 4LWCA 1BNZA 1SR3A 4HJAA 1E2ZA 4X3SA 1TT2A 1SJED 3KDFA 1QVCA 1TWHB 3NUCA 2JK8A 4OWTB 1HHVA 1JJCB 1PYSB 1BCPF 1JICA 1S72A 3T1HL 2ZJQA 3JAME 5JEAH 2EYPA 1OXXK 2A5HA 5IYBH 3MVVA 4HIKA 5FK9C 1B3QA 4P71A 5CYUA 3Q8DA 3TSSA 1U9RA 2O5IC 2RSNA 5LMNW 1YHQA 4ME5A 5FOBB 1Y1VB 3D6WA 1WCMB 5CORA 1VQEA 2KBNA 4V190 1JE4A 3MAQA 1QVFA 5D3IB 2EYOA 1WFQA 3QOJA 2NVYB 1IBLQ 3FMCA 3K8AA 3J81i 5M5WH 1X54A 3BYTB 1YVCA 1CTMA 3J7ZC 4YY3Q 2CWAA 1L0YB 3GTQB 4PZ8A 1Y1WB 4H44C 3OW2A 4JG2A 4PZ7A 5BN3A 1NE3A 1EUJA 2A6EC 1BO0A 2UUCQ 1B4OA 2B2UA 1K28A 3R93A 2YTYA 1STEA 2B63G 3FPPA 1KD1C 3K57A 3H6MA 5T1IA 4V0BA 5GROA 1G2SA 3J80L 1NY4A 1K3RA 5JJLA 1KL9A 1U5KA 4N9TA 4J8QA 2EY1A 1I50B 1E1TA 1IYUA 4XQJA 3ERQA 1WD0A 3KK7A 1MSGA 4A3DG 2WKCA 3HOZB 2KECA 3K58A 4OIJA 1TS4A 1EY4A 2QDLA 2F3VA 3JC66 3P20A 1UEAB 5CV9A 4CKCA 1K9MC 3HOUG 2F0PA 3ND9A 5IWAQ 4K5XA 5ELEA 4KHPQ 2XTIA 1PTOB 1A62A 4JI6L 3RZDB 4DV0L 4OONA 4GN4B 3K5LA 2NVQH 5ELBA 4C3JB 5LL6S 3VYRA 2L1BA 2HD3A 3KJOA 4OWWB 3I55A 4BS9A 3F8TA 2F0WA 2NN6H 3SGIA 4BBSH 4A93B 4JBJA 4K5VA 3NBHA 3OMCA 3URYA 1L1OC 2HCCA 1HUMA 2Q2HA 3WDNA 2Z6KA 4FXDA 3G71A 5E4WC 1AZPA 3S1MH 4YWLA 2K01A 2D62A 4DGZA 1H9SB 3NQTA 1OTCA 1SDFA 3TMEA 1S5BD 2Q8TA 4GKJQ 1X9NA 3H3VH 3C2PA 1FYCA 1A6XA 1EY0A 5ELNA 1HNWL 1C0AA 3KDFB 1PFMA 1EIHA 2QCPX 3PIOA 4X64Q 2P5ZX 3PGZA 3A0JA 4QIWB 4F88A 3ZJYC 3V05A 1JE5A 1UE6A 2O2LD 3UE1A 4BY7G 3I4OA 5H1SE 1SLJA 2JA8B 3PIO3 1D2BA 3IFTA 2F4VQ 4IPGA 3NQIA 2RHQB 3KJPA 2NVTB 2DJFC 4NXML 3OMGA 1G91A 4DR6Q 3OIQA 4A3GG 1BF4A 2EVBA 3MXGA 1HQMC 1K83B 2KVMA 4I65A 2EJMA 2MO0A 4JI7Q 1MKHA 4LNQA 2JA9A 3GP7A 2Z4HA 1G291 2AHOB 1IW7C 2F1MA 1BXTA 2D2CC 3H91A 1LO5D 3CRLC 1JWSD 3E0EA 4C3HB 5KNBA 4R1JA 2XSCA 4IUNA 2L12A 3BU2A 2NYZD 1VQ9A 4AYBE 2AUJD 2JA6B 3LWEA 1BUVT 3X3MA 1MD2D 2WV6D 4R4QA 2SNMA 2QILA 4JI1L 3HOXB 3GDEA 5IE8A 3HOYB 1SFOB 1VS0A 1RODA 1U4RA 5E1FA 5IT9E 3GTGB 1UE5A 1B9NA 1IBMQ 2HQEA 1GM5A 3M7NA 4YHHQ 4ZLTF 4X3KA 2UXBL 2UU9L 2EZVA 4DV5Q 1TWGB 2PI2E 4AYBG 2E2IB 3I3CA 4DV1L 1A15A 3K81C 2Q2IA 1K8AC 3RD4A 4LUZA 2JA5B 2ICIA 3I4NB 1NR4A 4BWGB 4O1NA 3D0FA 1HZCA 1FGBD 2BE5C 1EIGA 2N78A 1PA6A 2EPBA 2R61A 3CCMA 4DR1Q 5E7NA 5M3FB 1YNJD 2A1AA 1EWHA 1JT8A 5CV7A 2NZ1D 2KCNA 4XQNA 4DR4Q 2PO4A 3P75A 4QMGA 3SK6A 4C3IH 3A7AB 5C3EG 1QILA 1B8AA 5KIXA 2J7ZA 4ULLA 3PO3B 4KJOA 4KV6A 5DEHA 2A6HC 4K6LA 3GTMB 1G6ZA 4KY5A 1STGA 1Q90A 1X3QA 4KN7C 2A74C 1TWCH 3FRPB 2ENBA 2EYFA 1B7YB 1B1ZA 4JI0Q 4HR7B 4LF6L 1DOMA 3HKZE 4CJ1B 1JJGA 2ZXOA 1O7ZA 4IUVA 5GQOA 5C0XH 3NBHB 1PRTB 1IBLL 1U4PA 5M3MB 5I2XA 5IYCH 3Q23A 4YY3L 4BA2I 1E7ZA 2YU9B 4KMUC 4R8NA 4EQ5A 2VW9A 3EJIA 1K73C 2RBMA 3LGJA 3J81j 1RTNA 3AFPA 1X3FA 1I4QA 2TMPA 2R7ZB 1UAPA 3T1YL 1SYBA 3H09A 3R2TA 5M5XH 2KHSA 4R9WA 4ZK9B 3VDYA 3E9IA 4IFDH 3S17H 2JYOA 1FL0A 2IT1A 3PCOB 4XDXA 4A3IG 1TS2A 3KYHC 1B3AA 3BVZA 2K6AA 2MJ8A 4WORA 3I91A 5JEAJ 1SEBD 5FLXc 3GTJB 3S2HB 4DR7Q 3MFYA 3RZOH 1H9KA 2B2TA 1F2LA 2XGTA 3RR5A 2PNRC 4N8FA 4RCOA 2JE6I 3WWVA 4NXNL 5CC4A 3K7AB 2VQFQ 1VQJA 5IWAL 2JEBI 1STBA 3NE5B 1F9PA 4KHPL 3A7LA 1A3UA 3D4DA 2EOTA 1EY5A 3NENA 3EA6A 1VDZA 3G6JB 3H0GG 2CH4W 5KEEA 2X6LA 1I4XA 4G57A 2NWGA 4IALA 4WJ3M 2MO1A 3ND8A 4DUZQ 4DV4Q 2F0GA 2RVLA 5A35A 3S15B 1AE3A 5CV5A 3VR5A 3T1HQ 3J80i 1II3A 2E75C 1PH4A 2EJGC 1S5ED 3IKJA 2E8GA 4JPBW 1IYJB 3M85A 2VB2X 4GNXA 4CHTB 4B9WA 1P8LA 3CAMA 1JCKB 1PDQA 3M4YA 3WOEA 4DN4M 1XNQQ 2OCEA 3E9HA 1W3SA 5C44G 3D8GA 1XNRL 2ZJRA 2K5VA 3PIPA 4DR3Q 2Z4IA 3VR3A 2R93G 1YHAA 3SHLA 1CT1D 4Q5VA 1RDPD 4LF8L 2RDHA 1YNXA 4O0AA 5COYA 3OPOA 1B44D 1XX8A 2MP1A 3BVMA 5M5WB 1G2TA 1DOLA 1D5XC 1I4GA 1LYLA 2CFMA 2L55A 3W2DA 3EBEA 2F0LA 2LXJA 4DV3Q 2OWOA 2F4VL 1QE6A 1I6HH 3ULPA 3T56B 4DR6L 2B2WC 1N33L 2H5XA 1K83H 3WOFA 4BXXG 4JI4Q 3OOCA 5D65A 3V2TA 5IGCA 4K2KA 3CC7A 4JI7L 2K4KA 1WJJA 2R92G 3QOLA 1BBWA 4DR2Q 1K8MA 4Q0FA 4C3HH 1YI2A 1HFNA 2ZXRA 3R3OA 3K7UC 4IJLA 1RIPA 1LT3D 3M4QA 4UP7A 3Q6SA 1X3EA 5FO7B 3TREA 3OTOL 2K14A 3I72A 3KOJA 2PQAA 1Q81C 3JAMc 1B9MA 3STBD 4A4IA 1IZ6A 4TKOB 1VQNA 1IYVA 2AUKA 3F2CA 2EYJA 3FKIH 1IBML 4YHHL 4A3KH 1CZGA 1DD2A 2XN9C 4DV0Q 1LM0A 3SK5A 5GAEC 3I8ZA 4BBRG 2JA7B 4DV5L 5C5LA 3M3YH 4MNOA 2OTLA 2JQOA 2CCZA 2NVQB 1YITA 1S5CD 5L37A 3A5ZB 1FNVA 3MTSA 2B63H 4A75A 5E4XA 1N8RC 1V1PA 4BBSB 5EPJA 4DR1L 3S1RB 1R4PB 2C35B 3S24A 1I6VC 3E5SA 4RFBA 3MXNA 5EBDA 1O80A 3A8KE 3S1MB 2B3GA 4UAIA 3U9OA 5HURA 1BKBA 3PO3H 1VQ7A 3K5MA 4OHJA 1KAWA 2AQ3B 3NWSA 4HN7A 4A3DH 3VR6A 4OO1G 2V4DA 1T5EA 5J1ZA 4AQYQ 2OT2A 1KQSA 5EGTA 3HOUH 1HNWQ 2R7DA 3I4MG 1N9WA 1EQVA 4GOPC 1JC7A 4LK1C 4K8IA 2EXZA 2B8FA 1YJ9A 4OL7A 1Z7TA 2EE1A 2I5LX 4JI2Q 1CHQD 4OXPA 1LTRD 1LTID 4ZAIA 2YU9H 2H4OA 3KBGA 4AH6A 4E6IA 1MI2A 2E2JH 3NP8A 1OXTA 1PTOD 3RMHA 4GNXB 2L9HA 5HY6A 3DXJC 2IL8A 3L3OC 1S3OA 1CKNA 1PH6A 4R4OA 2SEBD 1I4RA 3TS0A 2D9UA 1HNZQ 4A3LG 1ILQA 1EYAA 4A3JG 3ULJA 2K5WA 4PNYA 1TWAH 2KEEA 1EQRA 1HA6A 2QDBA 1K0SA 4DA2A 4FDBA 4A3MG 3NPPA 2L11A 4RG1A 4CJ2C 3GTJH 2F0EA 3PUZA 2DY8A 2HQLA 4PQXA 4PZ6A 1M1KC 5JPNC 5EAYA 1VQ8A 1KRTA 4DR7L 3CMEA 2F0MA 1D6EC 1EY8A 3K5OA 3TZUA 1E1OA 1RHPA 2Y0SG 2PCFB 1E0BA 4DV7L 3DMUA 1M8AA 1PMRA 1AEXA 3HFZB 2VQFL 1Q8IA 1KDCA 1ZKOA 4RCNA 4RH6A 5NUCA 2HIXA 4BY7H 1HFGA 2K5DA 4YIJA 4QIWE 2B2VC 4DK3C 5LMNQ 1QWYA 4IZ8A 3BZKA 5C0XJ 2MGSA 1HR0W 1CM9A 4A3GH 4PMBA 4KTAA 1HRJA 3S15H 4DUZL 4JYAQ 4DV4L 2TSSA 1QZHA 1VQGA 1VQLA 2BDNA 1EY9A 1IBKQ 2PQAB 4A3BG 1CHPD 1WOCA 3S1QH 5DLQE 2FMMA 4IUUA 3CCLA 1PZID 5FO9B 4X3TA 3CRKC 4QQBX 4JBMA 4C3IB 4ZKCB 1W6KA 2VY3A 3J7AV 2X69A 1QNKA 4JI8Q 3BDCA 1QVGA 4IFDJ 2O4XA 1N34Q 1XNQL 4JV5L 2FXQA 4XT1B 1QG7A 3HP3A 3C1FA 4LF6Q 4A76A 1K8GA 1A3TA 1TWCB 4DR3L 2Q2UA 4UY8C 2F0SA 1EWIA 1GD7A 2F0FA 1W2BA 4TRDA 2EIFA 1V1PB 3TP5A 4NMZA 2B2WA 1LABA 1ENAA 1F2MA 2MPMA 1S5FD 2KENA 1ASZA 3MXNB 4ZRZA 5LHY1 3PV0A 3C46A 4M8AA 5ELDA 1X56A 3HOXG 4DV3L 4YWKA 1YNJC 1Y8NB 3DWQA 2RCNA 1X55A 3T1YQ 1ZYRD 2PW5A 3P7JA 4FVMA 1VQPA 4HMIA 2E2DC 3EQLC 3RNUA 4XXEA 2F03A 1LTLA 1GKHA 1CFMA 1PVOA 4JI4L 4QUFA 2B2YA 1CQVA 5M5XB 4PMCA 4KKUA 3S17B 4CDDC 1EY7A 5GADC 5C3EH 4DR2L 3I4NG 3NTHA 1J6QA 2C5CA 4RGNA 4GLVB 4RGMA 3BYYB 1E22A 2IX3A 1Q82C 3AMUA 2K50A 3VYSA 4ZUIA 3T13A 1SMYD 2I0QA 1A0IA 3RZOB 4GKKQ 1C48A 1T9HA 4HSVA 5EBCA 4NXNQ 3N6RA 3BVGA 1CKNB 3CD6A 3D4WA 2VUMG 1JOKA 1EFWA 4M1UB 5IGFA 3Q24A 2DNEA 2JA7H 3FPUB 1H95A 3CPFA 1UE1A 4A3FG 4I7AA 4XT3B 2J0TD 3TQYA 4ALPA 2LS01 1PRTD 1G51A 3CC2A 4QCLA 3SDZA 4ZCKA 1AH9A 1KDBA 4QL5A 3S1RH 3FP9A 3ICEA 2CWPA 4JOIA 3Q22A 3GTKH 1QCBD 2GVAA 1U0LA 2BDOA 1IKMA 4C2MB 1YIJA 1EQQA 5FKAC 5FJ8H 2XRQD 3SK4A 3UDIA 1RJTA 4KK7A 4DAVA 1JWMD 1KAAA 1D5ZC 2EQSA 5J39A 3SXHA 1XNRQ 1CK1A 1ICWA 4IUPA 4A3CG 4AQYL 1Q8KA 1BCPB 2QW7A 1SNQA 1VF7A 4KHVA 4LF8Q 2LXKA 1VF5C 1J8IA 3S2DH 4MZ9A 1OO9B 1K0RA 2N3SA 4X62Q 1AZQA 1PH2A 4UPAA 4JI2L 3H0GH 2Z1CA 2XVSA 3QB3A 1ENCA 2NB0A 2RF4A 1LTGD 2XIWA 2HDLA 1GUOA 3NTIA 5ELFA 1N33Q 5CR3A 1HZBA 1I6HB 4WJWA 1XJVA 3VYTA 1CQFA 4RKBA 2ALYB 2IPKD 4IPHA 1PH9A 5IP7G 5C4XG 1IKLA 1HNZL 2FINB 2QA4A 2AQ2B 2WINB 1CSQA 4JC0A 3GD7A 4BA1I 3PUXA 4YCUA 3AEVA 2CW0D 2NN6I 3OTOQ 1SN8A 5C44H 3BG3A 2DN8A 1PZKD 1VQDA 2F3IA 2WB1E 2NTTA 3DWPA 5CV4A 4L5RC 1HNXL 3K6OA 3LX0A 4QGUA 5JEAG 1HTPA 1KIXA 1I3QH 3OWFA 5M9OA 5IYBG 2HT1A 1LUZA 3BDOA 3FKIB 4RMFA 5JOBA 4A3KB 1SXTA 1GXDC 3ITPA 3UDXA 2YTXA 3M3YB 3CP0A 2VQEL 5LMNL 2WB1G 1UEBA 3H3VI 1C4QA 2FMCA 5EQ0A 4C1NI 2B63B 1YHBA 4IQZA 2QEXA 4FXKC 3CU7A 2NZOA 4K14A 1NCVA 4JYAL 3SR1A 1SYGA 2R92H 3M4OH 4L8JA 3GTPH 1IBKL 1E2WA 3HOVH 2L0CA 5GAHC 1SE4A 1JWUD 1B50A 5I6WA 1Q46A 5C4JH 3J80E 5K36H 3P1HA 4F8MA 4A3EG 1IHZA 1GUNA 2KUMA 4P75A 2CQOA 2NTSA 4JI8L 4A3DB 3STBC 2IJ0A 5KGUA 3CF5A 1N34L 3S16H 2K7VA 2NVXH 3NEMA 4U673 3CCVA 1G6PA 3HOUB 3PUVA 1TR5A 4IOCA 1SNMA 4P74A 3T16A 2N88A 3GTLH 2PMZB 5DAUA 5I2YA 2KOLA 3H15A 2KA7A 3EIVA 1GO3E 1SJHD 2D5DA 2E2JB 4RAUC 3BJUA 3F2BA 2NBFA 3NTKA 3HKZG 3DHQA 2ICEC 3BZDB 3A8JE 5KNCA 3W1BA 4N9PA 4CKEA 2X6GA 3FEWX 1NJIC 1SE8A 1HCZA 1I4PA 1HPCA 4ME3A 1Q86C 4BY1G 1WI5A 1VCIA 1X65A 4DV2Q 1M90C 1TWAB 4N8X1 3EVQA 2AKWB 5FLXL 1XTCD 4OO1H 2K52A 2EYHA 5HGQA 3S14H 1AFPA 1ONLA 3HOWG 1EYCA 2HHHQ 3I4MH 3IRBA 3NSWA 2UXCL 2GN5A 2RSOA 4DV7Q 4GKKL 2BH2A 1WD1A 1QNUA 5LMUQ 3KBXA 4QUCA 1L1OA 4OGQC 3GV3A 1SNOA 4C56C 4BY7B 2WFWA 1ESFA 1PTOC 2K1BA 3D6CA 3AQQA 3UDFA 1ZXTA 4QF4A 3TZDA 4B3TL 3KF6A 1ENFA 3C3LA 2K33A 2OQ0A 3HZXA 4EQPA 4A3GB 3FHWA 5IGBA 1PH8A 4KD4A 1DOKA 3I7FA 5C0XI 3U4ZA 1XMQL 4HAEA 3J81L 3QR8A 4C2MH 4A3JH 2QGQA 3ER0A 3S1QB 3J81c 1ASYA 3PO2G 1SYCA 1EOVA 1TVXA 4LMQD 1JOOA 2QKIC 4A3MH 4LUOA 4ZUJA 1GVPA 3PF4A 4JV5Q 1BR9A 1KC8C 3GTOH 3KF8A 3W1GA 4C1NK 1KRSA 3ULLA 2D0PA 1R4QB 4IFDI 2IWHA 3U4VA 4MHEA 1GUGA 1Y8PB 4EGVA 5JJZA 1OXSC 4L63B 5IYDG 1NNXA 1JB3A 2QEJC 3G4SA 4AYBB 4X62L 1PYWD 5I6YA 4LFBQ 3M9BA 2JEAI 5IODA 2BCOA 2AQ1B 1DJRD 1KNAA 5A2QL 1ESRA 4ZYSA 1F9SA 3DEPA 2E76C 3BZCA 1W6JA 1DXMA 1QUQA 2FHTA 2EY2A 4A3BH 4OELB 1WYDA 1MBYA 2RHSB 1H9JA 4J1MA 5CGKA 1EQTA 4S3SA 2CHBD 5C3EB 2F0DA 3NBIA 1TKWB 3UDGA 1RKNA 5C4ZA 5JPMC 5LL6X 2A68D 4DXGA 4HIMA 1F2ZA 3JAML 4KKSA 5G3LD 3R2IA 4J6HA 3M7GA 2B29A 3IAYA 1WTRA 4KLKA 3PSIA 3E3XA 4XIGS 2B2UC 4C3IG 1KNEA 5J3BA 2SNSA 1LT6D 1I4HA 3CCSA 4IN3A 1HJPA 1Y1VG 4OWXB 3W5OA 2K28A 1WCMG 5GAGC 1EEFD 4HSPA 1J9OA 1HTLD 1SAPA 1TWFH 1ZYRC 2R7FA 2V1CC 5F2DA 1HXYD 4DNTB 5FLMG 4IO9A 1TQOA 4TVAB 2YV5A 4NKLA 3MC0B 4H13C 2AMCB 2ID0A 2UUBQ 3GTKB 3PQIA 5KRUA 4P73A 1A3VA 1XPRA 4DR5Q 1G8ZD 1S4ZA 4R4CA 1Y1WG 2IHEA 2ZTDA 4LW1A 2F0TA 1HZ9A 3U50C 1VQOA 3L9AX 3O13A 1GUWA 2A69D 1L1OB 4ILWA 1SMYC 2XRSD 2JN4A 2N49A 1WTQA 1DZ1A 2B39A 3KF6B 1PYBA 3QJYA 1VQFA 1BVSA 1NMFA 2GVBA 1XMOL 2HUGA 3PUYA 4ZKBB 3S2DB 3VYUA 2WIIB 3E0JA 4A3FH 1KLUD 2B8GA 1WTHA 3UI2A 4HJ8A 1PRTC 1HQRD 2H1EA 3L7ZC 1T5XD 2G9DA 3H0GB 1F77A 2Z6KC 2AWOA 3HOZG 1ILPA 1QB5D 2EYMA 4B3RQ 1R9TH 4DKAC 5D3DA 2F0VA 1DCZA 1NBWA 4YWMA 2JP1A 3KF8B 5EPLA 1JR0D 1AE2A 1OXVA 4X65Q 2I5MX 1BQQT 1TIID 2M9VA 4C3JG 2OQKA 4KD3A 4UP8A 4DV2L 4R4TA 5BN4A 1FGUA 2KHJA 2WACA 2PZTA 1HR0Q 4A93G 4B3MQ 3Q0AA 1D1KA 3IL8A 4JK1C 5C44B 3RN2A 1LTBD 4R4IA 3CCQA 3SK8A 1HNXQ 2HIVA 1UWVA 3ZYYX 2HHHL 1FR3A 4RA8A 2Q2TA 2UUAQ 2CKZB 1X3GA 1PTOF 3CQZH 3UE0A 2F0UA 1SNCA 4H02A 4OX9L 1I3QB 1QUQB 5LMUL 4DFAA 4FF4A 1BCPD 5FO8B 3CCEA 4L5QA 1LTAD 3CHBD 2VQEQ 1S5DD 4X6AH 1CKMA 4EQNA 1B70B 3TP8A 4KN4C 2F0OA 3TS2A 2CQAA 4DU9A 5IP9G 4O42A 3AYHB 4CDCC 2F3WA 3NHHA 5M5YH 1A8VA 1H9MA 1C8CA 5IIFA 5IP7H 2HDMA 1E2VA 5C4XH 3CCJA 3MHBA 3TEHB 1EYDA 1KXLA 2E74C 2R6GA 1AW7A 3HKSA 4DAYA 3SEBA 3VA7A 2R92B 4KJNA 3M4OB 3GTPB 3HOVB 4XYQA 1VQKA 3QO2A 4LFCQ 2JA8G 2CW0C 1MHWC 5C4JB 1VQMA 1JMCA 1A2UA 1KHIA 1SBBB 1PV4A 4P2CB 4QJFA 2JXMB 2PQEA 1EZ8A 1TU2B 3HS0C 3FDTA 3S1NH 4JI3Q 2F0QA 1OXUA 3S16B 2NVXB 3RLFA 3AB9A 2F0NA 2F0KA 4LUVA 4JVZA 1MJEA 2F52A 4C3HG 1CA5A 3GTLB 1XPOA 4TSSA 4BBRB 2F0HA 3MZ5A 4QY7A 3SVMA 3CXCA 4XTCS 3D31A 3ERSX 4ID6A 2E2HH 2JA6G 1NUCA 4LFBL 1PLFA 5IGDA 5IGGA 5IT9L 5BN5A 5CMDA 3HOYG 4Y7NH 3QG1A 5IT9c 1SYDA 3TBIB 2YYZA 2RDGA 4DF7A 2JJQA 1XPUA 2LY7A 1CI3M 2E5LQ 3NK9A 1PFSA 4HCSA 4XYOA 3FKIG 4POFA 4A3KG 1XWEA 4PMWA 3CCUA 3GV6A 5EKKA 4A3EH 3K0XA 2ASBA 3F2UA 2JA5G 5BR8L 1VQAA 2MHVA 1F9QA 3FVQA 4CDEC 1MIUA 1AN8A 2ATWA 3A55A 1N36Q 5IY0A 4NP5A 5M3FG 3S9WA 4KI0A 2I46A 2KEDA 2MUYA 1HA5A 1JB7A 1NAPA 3S14B 2UXCQ 2QF7A 3K5NA 3I4MB 2WAQB 4RHRA 1VQHA 5E3FA 3J80c 3CPWA 5K5PA 3AFQA 1D5MC 3PO3G 2PMZE 4IUTA 2K05A 2XWBB 1NR2A 2J4XA 4K6DA 1ET6A 3KLSA 4B3TQ 1MSHA 1N32Q 3B6YA 3W3AA 2FFKB 1S40A 3CC4A 1EZ6A 1HH2P 1ICFB 2Q8RE 1SE2A 4IURA 3DEOA 1XMQQ 5DM73 1WTPA 4FF3A 5M3MG 1A2TA 4IJHA 4A3JB 2UUBL 4BY1H 4A3IH 4DR5L 1PH3A 2B2TC 4GOPA 5D14A 1GHKA 4B9XA 2KCCA 2MFIA 4JI5L 1HZAA 1PH5A 4A3MB 3T4AC 1ET9A 2VXWA 1QOHA 3JAMi 1LTTD 3X3NA 1NMGA 2R7ZG 1X32A 4X66Q 3GTOB 1ZEQX 4LFAL 3HOWH 3N52A 5AFWA 5TSSA 1GUTA 3E6ZX 1YNND 4UDUC 2Y0SB 4PV1C 2BA0A 2SDFA 3CMAA 1PRTF 3TN2A 1QJOA 3KLRA 3H3VC 2DUDA 3NELA 1BBUA 2DGYA 2CH4A 1K8OA 4DAYB 1O7IA 1STAA 3D3RA 1F2YA 3MFGA 4NPSA 3HGBA 5C5MA 4DNRB 1STNA 2PZUA 4LF9Q 2VS1A 4GN5A 2UXDQ 4B3RL 3R8BA 1E24A 3QIAA 3A56A 4ZQ3A 2IW3A 4GNXC 1EY6A 4G7ZC 1FJGQ 3BDLA 4R8IA 4A3BB 1A63A 1CKOA 3VR2A 2KHIA 3PO2H 1TY2A 2NUCA 4X65L 2L4NA 4IOAA 4GZYC 5AJ3Q 3AU7A 1YBYA 4DUYQ 4YCWA 2LKVA 4Y52H 5I9PA 3PF5A 4EVOA 4K0KQ 3LNNA 4MN3A 4NDXA 1PZJD 5C6AA 2B2VA 1HR0L 2R3ZA 1Q7YC 3A5UA 4B3ML 4HJ5A 3K0YA 5CV8A 2ES2A 3NWTA 2R93H 1LLRD 1V43A 1SYEA 3OYYA 2A73B 2AWNA 5IYDH 2WKDA 1PH7A 2UUAL 5C4HA 1Z9FA 1SRUA 1VQ5A 4MIUA 2EY5A 1F9RA 2VB3X 3CCRA 1DM0B 2IX0A 2L5TA 4B3SQ 1IL2A 1GHJA 1VQIA 1Q1BA 5EKLA 2N55A 4KKTA 1GJXA 1Z6HA 1TWFB 4POGA 4LF7Q 4NB3A 2Z0SA 4BXXH 1LT4D 1FNWA 4MTKA 1KLGD 1MGSA 1I94L 5JVG3 3TP6A 2IHFA 2RDFA 1CZWA 4APVA 4X3UA 5ELCA 1Y69U 4LFCL 1NSNS 2A68C 3TRZA 3DM1A 4ODGA 4OEMB 2Z9HA 4L6TB 1TWHH 2ZJPA 2PNHA 2A6ED 1XTDA 2PI2A 1U4MA 1DYQA 5DM63 1Q12A 4CGYB 2M2LA 4ABNA 3A8IE 4JI3L 3I4LA 4I7ZC 1XMOQ 1VQ4A 3DM3A 2VUMB 5ISRA 4HJ7A 3NXWA 5I9OA 1VQBA 4BBRH 2D0OA 4A3FB 3V96A 1Y1VH 1FD7D 4HTHA 1WCMH 1D1IA 2M00A 3LWUA 5ELOA 1WTWA 2ZXPA 1Q1EA 1RF2D 3G7LA 5JJKA 3F1ZA 4GOPB 3EROA 1LTSD 1PH1A 3IFDA 5FLMH 1R9TB 1BBXC 1TY0A 3C1EA 2NVYH 5C3WA 1H9RA 3G48A 4L5SA 4DAMA 2WP8J 1UE7A 3OHXC 4G7HC 2E5LL 2ZM6Q 1GUSA 5JJIA 3GTQH 1M4VA 2G5DA 1RD9D 3H94A 1WVLA 1C9OA 1L2FA 1Y1WH 2JA7G 3MXPA 1V1QA 1STHA 3M4PA 2A69C 4HEDA 5IOCA 3MA2B 4DV6Q 2K5QA 1C7YA 2K5HA 1AP0A 1J5EQ 2UUCL 2K03A 2NN6G 3TDQA 1UNSA 4BBSG 2KCMA 1YJWA 1N36L 1SROA 2KJXA 5DNFA 2EY6A 3D4RA 4TQUS 4OX9Q 1YJNA 3CQZB 5FJ8G 3GO5A 4LJZC 1I50H 3RLNA 1SMXA 4LF5Q 1SSOA 2DY7A 1IXRA 2EYLA 3BS1A 4JBKA 3F2DA 3HOZH 4UHVA 3L0OA 4RWSC 3HRZC 1RL2A 3G6EA 3J7A5 3RUZA 5CBAE 2XWJB 3OW7A 1X3PA 2CVRA 1N32L 1IL8A 4LF4Q 1PXUA 5T1GA 1I5FA 1VQCA 1PTOH 4GLAC 5M5YB 1KTKA 2PPBC 4A3LH 1Y14B 1EFID 3RZDH 2OTJA 3KUPA 5C4XB 3HEJA 2I5HA 3KLWA 2MNAA 4UP9A 4C3JH 2F4IA 1JOQA 2K04A 5CV6A 4H7BA 1FVIA 1U4LA 4A93H 1FNUA 2FJ2A 4DAPA 2EDGA 1XYIA 4X66L 1ML0D 4JBWA 3S1NB 2LFNA 4DK1A 1KDAA 4HCEA 2G9HD 2HCIA 2RCFA 4HIOA 1BCPC 4GS3A 4CBVA 4AIMA 1IW7D 4LAAA 2RQXA 1YZ6A 3QWNA 1STYA 2VZAA 4OO1I 4CDFC 2BA1A 4F87A 4GLXA 2KQ3A 2E2HB 2WB1B 2SOBA 3I90A 2A19A 3MEHA 4HIDA 5IP9H 4L5TA 4NW2A 1B2TA 4IPDA 4GKJL 4LF9L 5HGTA 4Y7NB 1JORA 1JQYD 3A74A 2A8VA 2UXDL 5J22A 5I4DA 3U9SA 2L15A 1SYFA 2OF1A 5EPKA 1B53A 3PIP3 1MJCA 1TXYA 1FJGL 1SE3A 5EJWA 4KY6A 4X64L 1LACA 2K5NA 1CA6A 3MXUA 1QZGA 4O2DA 4RHSA 4RGTA 2JA8H 5BR8Q 4DK6C 4A3EB 2NVTH 5AJ3L 1Q3LA 3HG9A 1K3BC 3RN5A 4DUYL 3TP7A 2LSSA 2PYKA 3K59A 1RCVD 4K0KL 3A54A 2BE5D 4HMJA 3VA5A 3OSOA 4IUQA 4F7XA 3HOVG 5EKIA 3PMFA
chains in the Genus database with same CATH topology
2EJFC 5K36G 1V8QA 4FF1A 4K5WA 4K8JA 2F0IA 5IGEA 1XXGA 2B2YC 2A6HD 3HKZB 4FXGC 3GQBA 2ZT9C 5KYLA 3VR4A 1WTOA 4G4KA 4DK0A 5C0XG 4U68A 1SNDA 1LT5D 2LMCB 2PZWA 1BDOA 1PFNA 4BY1B 3KLSX 5C3XA 5G3LF 4A3IB 4Z9CB 4FYDA 3PUWA 3DUZA 1TS3A 1LV9A 1SNPA 5FLXE 3T53B 2BOSA 4WRDA 4FF2A 3HOWB 5JVH3 2Q8IB 4EQOA 1WTVA 4IFDG 5CBEE 2C9OA 2I07B 4CKBA 2VNUD 5KYIA 2JSOA 2Z8LA 2OXPA 1RTOA 1EL0A 4H0LC 4DXFA 1TS5A 4WFN3 3MWYW 1L0XB 1EEID 1Y8OB 2RA4A 3I70A 2IX1A 2OEOA 3EFXD 4RGOS 4KHZA 1EOTA 4G7OC 1VMCA 1Z47A 1KABA 4FO2A 1O78A 3T51B 4QB4A 3PO2B 4RKLA 2K32A 1UUPA 3J81E 1EWCA 1O7LA 2O5JC 1VMPA 3J7YW 1EU4A 4CJ0B 1YNNC 2R93B 4FNFA 2RKSA 3ONAB 1V1OA 1PFBA 3SE0A 1EU3A 2F0JA 2PW7A 5JAVA 4FP5D 2DNCA 1WTXA 3OIPA 2XNAC 5A2QE 1O7YA 3CKIB 4OIKA 4K2LA 4KY7A 4XQQA 2GA4B 3DWAA 3J7AF 1DONA 1HUNA 3OWEB 5KNDA 3I73A 1BOSA 1H9SA 1GOZA 4B08A 1BNZA 1E2ZA 4X3SA 1TT2A 1SJED 1TWHB 3NUCA 1HHVA 1BCPF 1JICA 3JAME 5JEAH 2EYPA 1OXXK 2A5HA 3MVVA 5FK9C 5CYUA 3TSSA 1U9RA 2O5IC 2RSNA 4ME5A 5FOBB 1Y1VB 3D6WA 1WCMB 5CORA 4V190 1JE4A 3MAQA 5D3IB 2EYOA 3QOJA 2NVYB 3FMCA 3BYTB 1CTMA 1L0YB 3GTQB 1Y1WB 4H44C 5BN3A 2A6EC 1BO0A 1B4OA 2B2UA 3R93A 1STEA 3FPPA 3K57A 3H6MA 5T1IA 4V0BA 1G2SA 3J80L 4N9TA 4J8QA 2EY1A 1I50B 1IYUA 4XQJA 3ERQA 1WD0A 3KK7A 1MSGA 2WKCA 3HOZB 2KECA 3K58A 4OIJA 1TS4A 1EY4A 4CKCA 2F3VA 3P20A 5CV9A 1UEAB 2F0PA 3ND9A 4K5XA 5ELEA 1PTOB 3RZDB 3K5LA 5ELBA 4C3JB 5LL6S 3VYRA 2L1BA 4BS9A 2F0WA 2NN6H 4A93B 4K5VA 3NBHA 3OMCA 3URYA 2HCCA 1HUMA 3WDNA 4FXDA 5E4WC 1AZPA 2K01A 2D62A 4DGZA 1H9SB 3NQTA 1SDFA 3TMEA 1S5BD 2Q8TA 3C2PA 1FYCA 1A6XA 1EY0A 1PFMA 1EIHA 2QCPX 4QIWB 4F88A 3V05A 2O2LD 2JA8B 3PIO3 1D2BA 3IFTA 3NQIA 2NVTB 3OMGA 1G91A 3OIQA 1BF4A 2EVBA 3MXGA 1HQMC 1K83B 2KVMA 4I65A 2EJMA 3GP7A 2Z4HA 1G291 1IW7C 2F1MA 1BXTA 2D2CC 3H91A 1LO5D 3CRLC 1JWSD 4C3HB 5KNBA 2XSCA 4IUNA 2L12A 2NYZD 2AUJD 2JA6B 3LWEA 1BUVT 3X3MA 1MD2D 2WV6D 2SNMA 2QILA 3HOXB 3HOYB 1SFOB 1RODA 1U4RA 5E1FA 5IT9E 3GTGB 1B9NA 3M7NA 2HQEA 4ZLTF 4X3KA 2EZVA 1TWGB 2E2IB 3I3CA 1A15A 3RD4A 2JA5B 2ICIA 3I4NB 1NR4A 4BWGB 4O1NA 2BE5C 1FGBD 1EIGA 2EPBA 2R61A 5M3FB 1YNJD 1EWHA 5CV7A 2NZ1D 2KCNA 4XQNA 2PO4A 3P75A 4QMGA 3SK6A 3A7AB 1QILA 5KIXA 2J7ZA 4ULLA 3PO3B 4KJOA 4KV6A 5DEHA 2A6HC 4K6LA 3GTMB 1G6ZA 4KY5A 1STGA 1Q90A 1X3QA 4KN7C 2A74C 2ENBA 3FRPB 2EYFA 1B1ZA 4HR7B 1DOMA 4CJ1B 2ZXOA 1O7ZA 4IUVA 5C0XH 1PRTB 1U4PA 5M3MB 5I2XA 3Q23A 4BA2I 2YU9B 4KMUC 4R8NA 3EJIA 2RBMA 1RTNA 1I4QA 2TMPA 2R7ZB 1UAPA 1SYBA 3H09A 3R2TA 2KHSA 4R9WA 4ZK9B 4IFDH 2JYOA 2IT1A 4XDXA 1TS2A 1B3AA 3BVZA 2K6AA 2MJ8A 4WORA 3I91A 5JEAJ 1SEBD 3GTJB 3S2HB 3MFYA 1H9KA 2B2TA 1F2LA 2PNRC 4RCOA 2JE6I 5CC4A 3K7AB 2JEBI 1STBA 3NE5B 1F9PA 3A7LA 1A3UA 3D4DA 2EOTA 1EY5A 3EA6A 1VDZA 3G6JB 5KEEA 2X6LA 1I4XA 4G57A 2NWGA 4IALA 3ND8A 2F0GA 2RVLA 5A35A 3S15B 5CV5A 3VR5A 1II3A 2E75C 2EJGC 1S5ED 3IKJA 3M85A 2VB2X 4CHTB 4B9WA 1JCKB 1PDQA 3M4YA 3WOEA 4DN4M 3D8GA 2Z4IA 3VR3A 3SHLA 1CT1D 4Q5VA 1RDPD 2RDHA 5COYA 3OPOA 1B44D 1XX8A 2MP1A 3BVMA 5M5WB 1G2TA 1DOLA 1D5XC 1I4GA 2L55A 3W2DA 2F0LA 1QE6A 3T56B 2B2WC 3WOFA 3OOCA 5D65A 3V2TA 5IGCA 4K2KA 3QOLA 1K8MA 4Q0FA 1HFNA 2ZXRA 3R3OA 1LT3D 3Q6SA 5FO7B 3I72A 1B9MA 4TKOB 1IYVA 2AUKA 2EYJA 1DD2A 1CZGA 2XN9C 3SK5A 3I8ZA 2JA7B 5C5LA 2NVQB 1S5CD 1FNVA 3MTSA 5E4XA 1V1PA 4BBSB 5EPJA 3S1RB 1R4PB 1I6VC 3E5SA 4RFBA 3MXNA 5EBDA 1O80A 3A8KE 3S1MB 4UAIA 3U9OA 5HURA 3K5MA 4OHJA 2AQ3B 3NWSA 4HN7A 3VR6A 4OO1G 2V4DA 1T5EA 5J1ZA 2OT2A 5EGTA 1EQVA 1JC7A 4LK1C 4K8IA 2EXZA 2B8FA 4OL7A 1Z7TA 2EE1A 1CHQD 1LTRD 1LTID 4ZAIA 2H4OA 3KBGA 4E6IA 1MI2A 3NP8A 1OXTA 1PTOD 3RMHA 2L9HA 3DXJC 2IL8A 3L3OC 2SEBD 1I4RA 2D9UA 1ILQA 1EYAA 2K5WA 4PNYA 2KEEA 1HA6A 2QDBA 4DA2A 3NPPA 2L11A 4CJ2C 2F0EA 3PUZA 2DY8A 4PQXA 5JPNC 2F0MA 1D6EC 1EY8A 3K5OA 3TZUA 1RHPA 2PCFB 1E0BA 3DMUA 1M8AA 1PMRA 1AEXA 1Q8IA 1KDCA 1ZKOA 4RCNA 4RH6A 5NUCA 1HFGA 2K5DA 4YIJA 2B2VC 1QWYA 4IZ8A 5C0XJ 2MGSA 1CM9A 4PMBA 4KTAA 1HRJA 2TSSA 2BDNA 1EY9A 1CHPD 2FMMA 4IUUA 1PZID 5FO9B 4X3TA 3CRKC 4C3IB 4ZKCB 1W6KA 3J7AV 2X69A 1QNKA 3BDCA 4IFDJ 2O4XA 4XT1B 1QG7A 3HP3A 3C1FA 1A3TA 1TWCB 2F0SA 2F0FA 4TRDA 3TP5A 1V1PB 4NMZA 2B2WA 1LABA 1ENAA 1F2MA 2MPMA 1S5FD 4ZRZA 5LHY1 3PV0A 3C46A 4M8AA 5ELDA 1YNJC 1Y8NB 3DWQA 1ZYRD 2PW5A 3P7JA 4FVMA 4HMIA 2E2DC 3EQLC 2F03A 4XXEA 1CFMA 4QUFA 2B2YA 1CQVA 5M5XB 4PMCA 4KKUA 3S17B 1EY7A 3NTHA 2C5CA 4RGNA 4RGMA 3BYYB 2IX3A 3AMUA 3VYSA 4ZUIA 3T13A 1SMYD 3RZOB 1C48A 4HSVA 5EBCA 3N6RA 3BVGA 3D4WA 1JOKA 4M1UB 5IGFA 3Q24A 2DNEA 3FPUB 4XT3B 2J0TD 2LS01 1PRTD 4QCLA 3SDZA 1KDBA 3Q22A 1QCBD 2BDOA 1IKMA 4C2MB 5FKAC 2XRQD 3SK4A 1RJTA 4KK7A 4DAVA 1JWMD 1KAAA 1D5ZC 5J39A 3SXHA 1CK1A 1ICWA 4IUPA 1BCPB 1SNQA 1VF7A 4KHVA 1VF5C 1J8IA 1OO9B 1AZQA 2Z1CA 2XVSA 3QB3A 1ENCA 2NB0A 1LTGD 2XIWA 2HDLA 1GUOA 3NTIA 5ELFA 5CR3A 1I6HB 4WJWA 3VYTA 1CQFA 4RKBA 2IPKD 1IKLA 2FINB 2AQ2B 2WINB 3GD7A 4BA1I 3PUXA 2CW0D 2NN6I 3BG3A 2DN8A 1PZKD 2NTTA 3DWPA 5CV4A 3K6OA 3LX0A 5JEAG 1HTPA 3OWFA 5M9OA 3BDOA 3FKIB 5JOBA 4A3KB 1SXTA 1GXDC 3ITPA 3M3YB 1C4QA 2FMCA 5EQ0A 4C1NI 2B63B 4IQZA 4FXKC 3CU7A 4K14A 1NCVA 3SR1A 1SYGA 4L8JA 1E2WA 2L0CA 1SE4A 1JWUD 1B50A 5I6WA 3J80E 5K36H 3P1HA 4F8MA 1IHZA 1GUNA 2KUMA 2NTSA 4A3DB 2IJ0A 5KGUA 2K7VA 4U673 3HOUB 3PUVA 1TR5A 1SNMA 3T16A 2N88A 2PMZB 5DAUA 5I2YA 2KOLA 2KA7A 1SJHD 2D5DA 2E2JB 4RAUC 2NBFA 3NTKA 3DHQA 2ICEC 3BZDB 3A8JE 5KNCA 4N9PA 4CKEA 2X6GA 3FEWX 1HCZA 1I4PA 1HPCA 1VCIA 1TWAB 3EVQA 5FLXL 1XTCD 4OO1H 2EYHA 1AFPA 1ONLA 1EYCA 3NSWA 2RSOA 1WD1A 1QNUA 3KBXA 4QUCA 4OGQC 3GV3A 1SNOA 4C56C 4BY7B 1ESFA 1PTOC 2K1BA 3D6CA 1ZXTA 4QF4A 3TZDA 1ENFA 3C3LA 2K33A 3HZXA 4EQPA 4A3GB 5IGBA 4KD4A 1DOKA 5C0XI 4HAEA 3J81L 3S1QB 1SYCA 1TVXA 4LMQD 1JOOA 2QKIC 4ZUJA 1BR9A 3KF8A 4C1NK 1R4QB 4IFDI 2IWHA 4MHEA 1GUGA 1Y8PB 4EGVA 5JJZA 1OXSC 4L63B 1JB3A 2QEJC 4AYBB 1PYWD 5I6YA 2JEAI 5IODA 2BCOA 2AQ1B 1DJRD 1KNAA 5A2QL 1ESRA 4ZYSA 1F9SA 3DEPA 2E76C 1W6JA 1DXMA 2FHTA 2EY2A 1MBYA 1H9JA 4J1MA 5CGKA 1EQTA 4S3SA 2CHBD 5C3EB 2F0DA 3NBIA 1TKWB 1RKNA 5C4ZA 5JPMC 5LL6X 2A68D 4DXGA 1F2ZA 3JAML 4KKSA 5G3LD 3R2IA 4J6HA 3M7GA 3IAYA 1WTRA 4XIGS 2B2UC 4C3IG 1KNEA 2SNSA 1LT6D 1I4HA 4IN3A 2K28A 1EEFD 4HSPA 1J9OA 1HTLD 1SAPA 1ZYRC 5F2DA 1HXYD 4DNTB 1TQOA 4NKLA 3MC0B 4H13C 2ID0A 3GTKB 5KRUA 1A3VA 1G8ZD 1S4ZA 2F0TA 3L9AX 3O13A 1GUWA 2A69D 4ILWA 1SMYC 2XRSD 1WTQA 1DZ1A 2B39A 3QJYA 2HUGA 3PUYA 4ZKBB 3S2DB 3VYUA 2WIIB 3E0JA 1KLUD 2B8GA 3UI2A 1PRTC 1HQRD 2H1EA 3L7ZC 1T5XD 2G9DA 3H0GB 1F77A 2AWOA 1ILPA 1QB5D 2EYMA 5D3DA 2F0VA 1DCZA 2JP1A 5EPLA 1JR0D 1OXVA 1BQQT 1TIID 2M9VA 4C3JG 4KD3A 5BN4A 2WACA 2PZTA 3Q0AA 1D1KA 3IL8A 4JK1C 5C44B 1LTBD 3SK8A 3ZYYX 1FR3A 4RA8A 1PTOF 2F0UA 1SNCA 1I3QB 4DFAA 4FF4A 1BCPD 5FO8B 1LTAD 3CHBD 1S5DD 4EQNA 3TP8A 4KN4C 2F0OA 2CQAA 4DU9A 4O42A 2F3WA 3NHHA 1H9MA 1C8CA 5IIFA 2HDMA 1E2VA 3MHBA 1EYDA 2E74C 2R6GA 1AW7A 4DAYA 3SEBA 3VA7A 2R92B 4KJNA 3M4OB 3GTPB 3HOVB 4XYQA 3QO2A 2CW0C 5C4JB 1A2UA 1SBBB 4P2CB 2JXMB 2PQEA 1EZ8A 1TU2B 3HS0C 3FDTA 3S16B 2F0QA 1OXUA 2NVXB 3RLFA 3AB9A 2F0NA 2F0KA 4C3HG 1CA5A 3GTLB 4TSSA 4BBRB 2F0HA 3MZ5A 3SVMA 4XTCS 3D31A 4ID6A 1NUCA 1PLFA 5IGDA 5IGGA 5IT9L 5BN5A 5CMDA 3QG1A 1SYDA 3TBIB 2YYZA 2RDGA 4DF7A 2LY7A 1CI3M 3NK9A 4HCSA 4XYOA 1XWEA 4PMWA 3GV6A 5EKKA 3F2UA 2MHVA 1F9QA 3FVQA 1AN8A 3A55A 4NP5A 3S9WA 4KI0A 2I46A 2KEDA 2MUYA 1HA5A 1NAPA 3S14B 2QF7A 3K5NA 3I4MB 2WAQB 4RHRA 5E3FA 5K5PA 1D5MC 4IUTA 2K05A 2XWBB 1NR2A 2J4XA 4K6DA 1ET6A 3KLSA 1MSHA 3W3AA 2FFKB 1EZ6A 2Q8RE 1SE2A 4IURA 3DEOA 5DM73 1WTPA 4FF3A 1A2TA 4A3JB 2B2TC 5D14A 1GHKA 4B9XA 2KCCA 4A3MB 3T4AC 1ET9A 2VXWA 1QOHA 1LTTD 3X3NA 1X32A 3GTOB 1ZEQX 3N52A 5AFWA 5TSSA 1GUTA 3E6ZX 1YNND 4UDUC 2Y0SB 4PV1C 2BA0A 2SDFA 1PRTF 3TN2A 1QJOA 3KLRA 3H3VC 1K8OA 1STAA 3D3RA 1F2YA 3MFGA 5C5MA 3HGBA 4DNRB 1STNA 2PZUA 3R8BA 3QIAA 3A56A 4ZQ3A 2IW3A 1EY6A 4G7ZC 3BDLA 4R8IA 4A3BB 3VR2A 1TY2A 2NUCA 2L4NA 4GZYC 3AU7A 2LKVA 5I9PA 4EVOA 3LNNA 4MN3A 4NDXA 1PZJD 5C6AA 2B2VA 2R3ZA 3K0YA 5CV8A 3NWTA 1LLRD 1V43A 1SYEA 2A73B 2AWNA 2WKDA 5C4HA 4MIUA 2EY5A 1F9RA 2VB3X 1DM0B 2IX0A 2L5TA 1GHJA 1Q1BA 5EKLA 2N55A 4KKTA 1GJXA 1Z6HA 1TWFB 1LT4D 1FNWA 1KLGD 1MGSA 5JVG3 3TP6A 2RDFA 1CZWA 4X3UA 5ELCA 1Y69U 1NSNS 2A68C 3DM1A 4ODGA 4L6TB 2A6ED 1U4MA 1DYQA 5DM63 1Q12A 4CGYB 2M2LA 4ABNA 3A8IE 3I4LA 4I7ZC 2VUMB 5ISRA 3NXWA 5I9OA 4A3FB 3V96A 1FD7D 4HTHA 1D1IA 2M00A 3LWUA 1WTWA 2ZXPA 1Q1EA 1RF2D 3G7LA 3EROA 1LTSD 3IFDA 1R9TB 1BBXC 1TY0A 3C1EA 5C3WA 1H9RA 2WP8J 3OHXC 4G7HC 1GUSA 1M4VA 3H94A 1RD9D 1WVLA 3MXPA 1STHA 2A69C 4HEDA 5IOCA 3MA2B 2K5QA 1AP0A 2K03A 2NN6G 3TDQA 1UNSA 2KJXA 5DNFA 2EY6A 3D4RA 4TQUS 3CQZB 3GO5A 4LJZC 1SSOA 2DY7A 2EYLA 3BS1A 4RWSC 3HRZC 3RUZA 5CBAE 2XWJB 1X3PA 3OW7A 2CVRA 1IL8A 1PXUA 5T1GA 1PTOH 5M5YB 1KTKA 2PPBC 1EFID 5C4XB 3KUPA 3HEJA 2F4IA 1JOQA 2K04A 5CV6A 4H7BA 1U4LA 1FNUA 2FJ2A 4DAPA 2EDGA 1XYIA 1ML0D 4JBWA 3S1NB 2LFNA 4DK1A 1KDAA 4HCEA 2G9HD 2HCIA 1BCPC 4CBVA 1IW7D 4LAAA 2RQXA 3QWNA 1STYA 4OO1I 2BA1A 4F87A 2KQ3A 2E2HB 2WB1B 2SOBA 3I90A 3MEHA 4NW2A 1B2TA 5HGTA 4Y7NB 1JORA 1JQYD 5J22A 5I4DA 3U9SA 1SYFA 2OF1A 5EPKA 1B53A 3PIP3 1SE3A 5EJWA 4KY6A 1LACA 1CA6A 3MXUA 4RHSA 4RGTA 4A3EB 1Q3LA 3HG9A 3TP7A 2PYKA 3K59A 1RCVD 3A54A 2BE5D 4HMJA 3VA5A 3OSOA 4IUQA 4F7XA 5EKIA 3PMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J39 A;  5IIF A;  3OMG A;  3SXH A;  5KRU A;  1A3V A;  5EKL A;  3EJI A;  4K8I A;  2EXZ A;  1EZ6 A;  3MHB A;  1JOO A;  2F0S A;  3H6M A;  1EYD A;  2RBM A;  4OL7 A;  2RKS A;  2EYL A;  4ZUJ A;  2F0F A;  2F0L A;  4K5W A;  4K8J A;  1SNQ A;  2F0I A;  4TRD A;  4KHV A;  4I65 A;  4KJN A;  4NMZ A;  3TP5 A;  5IGE A;  5KGU A;  2F0T A;  3RUZ A;  1ENA A;  2F0J A;  4E6I A;  2PW7 A;  1A2T A;  3NP8 A;  1SYB A;  1F2M A;  4N9T A;  1A2U A;  5JAV A;  3TP6 A;  1TR5 A;  2EY1 A;  2RDF A;  1SNM A;  2KHS A;  1KAA A;  3T16 A;  2PQE A;  5DAU A;  3QB3 A;  5KYL A;  1EZ8 A;  1ENC A;  4IUN A;  4K2K A;  3V2T A;  4B9X A;  3ERQ A;  5IGC A;  3HEJ A;  3QOL A;  1NSN S;  1SND A;  2F0Q A;  2PW5 A;  2PZW A;  2SNM A;  4HMI A;  4K2L A;  1EYA A;  4KY7 A;  4ODG A;  5I6Y A;  4WOR A;  1EY4 A;  1JOQ A;  2F0N A;  2F3V A;  5CR3 A;  5CV9 A;  2F0K A;  3R3O A;  5IOD A;  5CV6 A;  5C3X A;  4H7B A;  2F0P A;  3DHQ A;  4PNY A;  4K5X A;  5E1F A;  4RKB A;  2QDB A;  4PMC A;  1EY7 A;  2HQE A;  1SNP A;  2F0H A;  3MZ5 A;  4N9P A;  4ID6 A;  2F0E A;  1NUC A;  2EYM A;  5CC4 A;  5IGD A;  2EY2 A;  5ISR A;  5IGG A;  1TT2 A;  4WRD A;  1STB A;  3NXW A;  5I9O A;  1KDA A;  2F0V A;  1STA A;  3NUC A;  1F2Y A;  2F0M A;  1EY8 A;  5C5M A;  4ZUI A;  1STN A;  3T13 A;  1SYD A;  2EYJ A;  1A3U A;  2F0W A;  2PZU A;  4EQO A;  4HTH A;  3D4D A;  4J1M A;  4K5V A;  4LAA A;  2M00 A;  3EVQ A;  1EY5 A;  3SK5 A;  4DF7 A;  5CGK A;  3DMU A;  3OMC A;  4S3S A;  5KEE A;  1AEX A;  2EYP A;  2F0D A;  5C5L A;  5KYI A;  1STY A;  3NK9 A;  1KDC A;  4G57 A;  3ERO A;  4ZQ3 A;  3MVV A;  5CV4 A;  2KQ3 A;  5NUC A;  3D4W A;  1EY6 A;  1RKN A;  3LX0 A;  2EYH A;  1JOK A;  2SOB A;  3C1E A;  4IAL A;  5CV7 A;  2OXP A;  3BDL A;  1U9R A;  3MEH A;  4KD3 A;  4YIJ A;  5C3W A;  4IZ8 A;  1EYC A;  5EKK A;  2F0G A;  3OWF A;  5IGF A;  5M9O A;  1F2Z A;  5CV5 A;  2WAC A;  2PZT A;  5HGT A;  1JOR A;  2NUC A;  4ME5 A;  3P75 A;  5J22 A;  5JOB A;  1II3 A;  4QMG A;  1SYF A;  2OF1 A;  4J6H A;  3SK6 A;  3ITP A;  4PMB A;  4KTA A;  4DGZ A;  3NQT A;  3MXP A;  3SK8 A;  2LKV A;  1STH A;  5KIX A;  3TME A;  1SNO A;  3E5S A;  4KJO A;  4KY6 A;  4NP5 A;  2OEO A;  4KV6 A;  4EVO A;  5I9P A;  5IOC A;  2EYO A;  5DEH A;  3S9W A;  1EY9 A;  3QOJ A;  4NDX A;  3D6C A;  4B9W A;  5C6A A;  1KDB A;  5C4Z A;  1KAB A;  2F0U A;  1SNC A;  2SNS A;  3NHH A;  3U9O A;  4KY5 A;  1EY0 A;  1STG A;  4QF4 A;  5CV8 A;  5HUR A;  2ENB A;  4QB4 A;  4DFA A;  2EYF A;  4RKL A;  3TP7 A;  5E3F A;  2PYK A;  3HZX A;  1SYE A;  4EQP A;  5K5P A;  4K14 A;  5IGB A;  3D8G A;  4KD4 A;  3SR1 A;  4HMJ A;  3VA5 A;  4EQN A;  1SYG A;  5F2D A;  5C4H A;  3TP8 A;  2EY6 A;  5J1Z A;  2F0O A;  3OSO A;  2EY5 A;  3BDC A;  4MIU A;  3SK4 A;  3SHL A;  1TQO A;  5EGT A;  2O4X A;  4DU9 A;  5I6W A;  4K6D A;  4F7X A;  4NKL A;  3P1H A;  4F8M A;  3C1F A;  1IHZ A;  1EQV A;  1SYC A;  2F3W A;  4R8N A;  3PMF A;  1A3T A; 
#chains in the Genus database with same CATH topology
 2EJF C;  5K36 G;  1V8Q A;  2KCT A;  4FF1 A;  4K5W A;  4P72 A;  4K8J A;  2F0I A;  2JA6 H;  5IGE A;  4EX5 A;  3HOX H;  1XXG A;  3HOY H;  1SFO H;  4B3S L;  1P16 A;  2B2Y C;  2A6H D;  3HKZ B;  4DPG A;  4FXG C;  1YEZ A;  2VL6 A;  3GTG H;  4PG3 A;  3GQB A;  4LF7 L;  2ZT9 C;  1VQ6 A;  5KYL A;  3VR4 A;  1WTO A;  4HJ9 A;  4JI6 Q;  4G4K A;  4DK0 A;  5C0X G;  1TWG H;  3DLL A;  3K80 C;  2E2I H;  4U68 A;  1SND A;  1LT5 D;  2LMC B;  2PZW A;  1BDO A;  1PFN A;  2Z6B A;  4J15 A;  1D7Q A;  2ZTC A;  5IYC G;  1JJ2 A;  3U58 A;  3KLS X;  2JA5 H;  5C3X A;  4BY1 B;  3I4N H;  5G3L F;  4A3I B;  4MTN A;  4Z9C B;  1NTG A;  4FYD A;  3PUW A;  4JI5 Q;  3DUZ A;  3RLO A;  3MEF A;  1TS3 A;  1LV9 A;  1SNP A;  2DJG C;  5M3F H;  3EN2 A;  2MQH A;  5FLX E;  3T53 B;  4LFA Q;  2BOS A;  2BH8 A;  4WRD A;  4FF2 A;  3HOW B;  5JVH 3;  1EIY B;  2Q8I B;  4EQO A;  1WTV A;  4IFD G;  5CBE E;  2C9O A;  2I07 B;  2K75 A;  3I56 A;  2VUM H;  4DR4 L;  4CKB A;  2VNU D;  2WAQ E;  5KYI A;  2JSO A;  2N8N A;  2Z8L A;  2OXP A;  1RTO A;  1EL0 A;  4H0L C;  4DXF A;  1L0W A;  3GTM H;  1TS5 A;  4JOI C;  4WFN 3;  3MWY W;  3CW2 C;  1L0X B;  1EEI D;  1Y8O B;  2RA4 A;  1CSP A;  1EIF A;  3I70 A;  2IX1 A;  4JI0 L;  2EXD A;  2WAQ G;  2IY5 B;  4IPC A;  1D8L A;  2OEO A;  3EFX D;  5M3M H;  4RGO S;  4KHZ A;  1EOT A;  4G7O C;  1VMC A;  1Z47 A;  1KAB A;  4FO2 A;  4YCV A;  1O78 A;  2ZM6 L;  2NZH A;  3T51 B;  4QB4 A;  3PO2 B;  4RKL A;  2K32 A;  1E3P A;  1UUP A;  3J81 E;  4WJ4 A;  1EWC A;  1O7L A;  2O5J C;  1VMP A;  4NXM Q;  4DV6 L;  3J7Y W;  1EU4 A;  4CJ0 B;  1J5E L;  2R7Z H;  4JCV E;  1YNN C;  4A3C H;  4GN3 B;  2R93 B;  1CUK A;  2ZTE A;  1EYG A;  4FNF A;  2RKS A;  2Y0S E;  3ONA B;  3L2P A;  1V1O A;  1PFB A;  3SE0 A;  1EU3 A;  2F0J A;  2YTV A;  2PW7 A;  4DNI A;  3KFU A;  5JAV A;  4LF5 L;  4JI1 Q;  3S2H H;  4FP5 D;  1PHJ A;  3I2Z A;  2DNC A;  1WTX A;  1DGS A;  3OIP A;  2XNA C;  5A2Q E;  1O7Y A;  3K7A H;  3CKI B;  4OIK A;  1I94 Q;  4LF4 L;  2UU9 Q;  4K2L A;  2UXB Q;  4KY7 A;  4XQQ A;  2GA4 B;  3DWA A;  1V9P A;  4DV1 Q;  3J7A F;  1DON A;  1HUN A;  3OWE B;  5KND A;  3I73 A;  1BOS A;  1H9S A;  4JW0 A;  1GOZ A;  4B08 A;  1X6O A;  4LWC A;  1BNZ A;  1SR3 A;  4HJA A;  1E2Z A;  4X3S A;  1TT2 A;  1SJE D;  3KDF A;  1QVC A;  1TWH B;  3NUC A;  2JK8 A;  4OWT B;  1HHV A;  1JJC B;  1PYS B;  1BCP F;  1JIC A;  1S72 A;  3T1H L;  2ZJQ A;  3JAM E;  5JEA H;  2EYP A;  1OXX K;  2A5H A;  5IYB H;  3MVV A;  4HIK A;  5FK9 C;  1B3Q A;  4P71 A;  5CYU A;  3Q8D A;  3TSS A;  1U9R A;  2O5I C;  2RSN A;  5LMN W;  1YHQ A;  4ME5 A;  5FOB B;  1Y1V B;  3D6W A;  1WCM B;  5COR A;  1VQE A;  2KBN A;  4V19 0;  1JE4 A;  3MAQ A;  1QVF A;  5D3I B;  2EYO A;  1WFQ A;  3QOJ A;  2NVY B;  1IBL Q;  3FMC A;  3K8A A;  3J81 i;  5M5W H;  1X54 A;  3BYT B;  1YVC A;  1CTM A;  3J7Z C;  4YY3 Q;  2CWA A;  1L0Y B;  3GTQ B;  4PZ8 A;  1Y1W B;  4H44 C;  3OW2 A;  4JG2 A;  4PZ7 A;  5BN3 A;  1NE3 A;  1EUJ A;  2A6E C;  1BO0 A;  2UUC Q;  1B4O A;  2B2U A;  1K28 A;  3R93 A;  2YTY A;  1STE A;  2B63 G;  3FPP A;  1KD1 C;  3K57 A;  3H6M A;  5T1I A;  4V0B A;  5GRO A;  1G2S A;  3J80 L;  1NY4 A;  1K3R A;  5JJL A;  1KL9 A;  1U5K A;  4N9T A;  4J8Q A;  2EY1 A;  1I50 B;  1E1T A;  1IYU A;  4XQJ A;  3ERQ A;  1WD0 A;  3KK7 A;  1MSG A;  4A3D G;  2WKC A;  3HOZ B;  2KEC A;  3K58 A;  4OIJ A;  1TS4 A;  1EY4 A;  2QDL A;  2F3V A;  3JC6 6;  3P20 A;  1UEA B;  5CV9 A;  4CKC A;  1K9M C;  3HOU G;  2F0P A;  3ND9 A;  5IWA Q;  4K5X A;  5ELE A;  4KHP Q;  2XTI A;  1PTO B;  1A62 A;  4JI6 L;  3RZD B;  4DV0 L;  4OON A;  4GN4 B;  3K5L A;  2NVQ H;  5ELB A;  4C3J B;  5LL6 S;  3VYR A;  2L1B A;  2HD3 A;  3KJO A;  4OWW B;  3I55 A;  4BS9 A;  3F8T A;  2F0W A;  2NN6 H;  3SGI A;  4BBS H;  4A93 B;  4JBJ A;  4K5V A;  3NBH A;  3OMC A;  3URY A;  1L1O C;  2HCC A;  1HUM A;  2Q2H A;  3WDN A;  2Z6K A;  4FXD A;  3G71 A;  5E4W C;  1AZP A;  3S1M H;  4YWL A;  2K01 A;  2D62 A;  4DGZ A;  1H9S B;  3NQT A;  1OTC A;  1SDF A;  3TME A;  1S5B D;  2Q8T A;  4GKJ Q;  1X9N A;  3H3V H;  3C2P A;  1FYC A;  1A6X A;  1EY0 A;  5ELN A;  1HNW L;  1C0A A;  3KDF B;  1PFM A;  1EIH A;  2QCP X;  3PIO A;  4X64 Q;  2P5Z X;  3PGZ A;  3A0J A;  4QIW B;  4F88 A;  3ZJY C;  3V05 A;  1JE5 A;  1UE6 A;  2O2L D;  3UE1 A;  4BY7 G;  3I4O A;  5H1S E;  1SLJ A;  2JA8 B;  3PIO 3;  1D2B A;  3IFT A;  2F4V Q;  4IPG A;  3NQI A;  2RHQ B;  3KJP A;  2NVT B;  2DJF C;  4NXM L;  3OMG A;  1G91 A;  4DR6 Q;  3OIQ A;  4A3G G;  1BF4 A;  2EVB A;  3MXG A;  1HQM C;  1K83 B;  2KVM A;  4I65 A;  2EJM A;  2MO0 A;  4JI7 Q;  1MKH A;  4LNQ A;  2JA9 A;  3GP7 A;  2Z4H A;  1G29 1;  2AHO B;  1IW7 C;  2F1M A;  1BXT A;  2D2C C;  3H91 A;  1LO5 D;  3CRL C;  1JWS D;  3E0E A;  4C3H B;  5KNB A;  4R1J A;  2XSC A;  4IUN A;  2L12 A;  3BU2 A;  2NYZ D;  1VQ9 A;  4AYB E;  2AUJ D;  2JA6 B;  3LWE A;  1BUV T;  3X3M A;  1MD2 D;  2WV6 D;  4R4Q A;  2SNM A;  2QIL A;  4JI1 L;  3HOX B;  3GDE A;  5IE8 A;  3HOY B;  1SFO B;  1VS0 A;  1ROD A;  1U4R A;  5E1F A;  5IT9 E;  3GTG B;  1UE5 A;  1B9N A;  1IBM Q;  2HQE A;  1GM5 A;  3M7N A;  4YHH Q;  4ZLT F;  4X3K A;  2UXB L;  2UU9 L;  2EZV A;  4DV5 Q;  1TWG B;  2PI2 E;  4AYB G;  2E2I B;  3I3C A;  4DV1 L;  1A15 A;  3K81 C;  2Q2I A;  1K8A C;  3RD4 A;  4LUZ A;  2JA5 B;  2ICI A;  3I4N B;  1NR4 A;  4BWG B;  4O1N A;  3D0F A;  1HZC A;  1FGB D;  2BE5 C;  1EIG A;  2N78 A;  1PA6 A;  2EPB A;  2R61 A;  3CCM A;  4DR1 Q;  5E7N A;  5M3F B;  1YNJ D;  2A1A A;  1EWH A;  1JT8 A;  5CV7 A;  2NZ1 D;  2KCN A;  4XQN A;  4DR4 Q;  2PO4 A;  3P75 A;  4QMG A;  3SK6 A;  4C3I H;  3A7A B;  5C3E G;  1QIL A;  1B8A A;  5KIX A;  2J7Z A;  4ULL A;  3PO3 B;  4KJO A;  4KV6 A;  5DEH A;  2A6H C;  4K6L A;  3GTM B;  1G6Z A;  4KY5 A;  1STG A;  1Q90 A;  1X3Q A;  4KN7 C;  2A74 C;  1TWC H;  3FRP B;  2ENB A;  2EYF A;  1B7Y B;  1B1Z A;  4JI0 Q;  4HR7 B;  4LF6 L;  1DOM A;  3HKZ E;  4CJ1 B;  1JJG A;  2ZXO A;  1O7Z A;  4IUV A;  5GQO A;  5C0X H;  3NBH B;  1PRT B;  1IBL L;  1U4P A;  5M3M B;  5I2X A;  5IYC H;  3Q23 A;  4YY3 L;  4BA2 I;  1E7Z A;  2YU9 B;  4KMU C;  4R8N A;  4EQ5 A;  2VW9 A;  3EJI A;  1K73 C;  2RBM A;  3LGJ A;  3J81 j;  1RTN A;  3AFP A;  1X3F A;  1I4Q A;  2TMP A;  2R7Z B;  1UAP A;  3T1Y L;  1SYB A;  3H09 A;  3R2T A;  5M5X H;  2KHS A;  4R9W A;  4ZK9 B;  3VDY A;  3E9I A;  4IFD H;  3S17 H;  2JYO A;  1FL0 A;  2IT1 A;  3PCO B;  4XDX A;  4A3I G;  1TS2 A;  3KYH C;  1B3A A;  3BVZ A;  2K6A A;  2MJ8 A;  4WOR A;  3I91 A;  5JEA J;  1SEB D;  5FLX c;  3GTJ B;  3S2H B;  4DR7 Q;  3MFY A;  3RZO H;  1H9K A;  2B2T A;  1F2L A;  2XGT A;  3RR5 A;  2PNR C;  4N8F A;  4RCO A;  2JE6 I;  3WWV A;  4NXN L;  5CC4 A;  3K7A B;  2VQF Q;  1VQJ A;  5IWA L;  2JEB I;  1STB A;  3NE5 B;  1F9P A;  4KHP L;  3A7L A;  1A3U A;  3D4D A;  2EOT A;  1EY5 A;  3NEN A;  3EA6 A;  1VDZ A;  3G6J B;  3H0G G;  2CH4 W;  5KEE A;  2X6L A;  1I4X A;  4G57 A;  2NWG A;  4IAL A;  4WJ3 M;  2MO1 A;  3ND8 A;  4DUZ Q;  4DV4 Q;  2F0G A;  2RVL A;  5A35 A;  3S15 B;  1AE3 A;  5CV5 A;  3VR5 A;  3T1H Q;  3J80 i;  1II3 A;  2E75 C;  1PH4 A;  2EJG C;  1S5E D;  3IKJ A;  2E8G A;  4JPB W;  1IYJ B;  3M85 A;  2VB2 X;  4GNX A;  4CHT B;  4B9W A;  1P8L A;  3CAM A;  1JCK B;  1PDQ A;  3M4Y A;  3WOE A;  4DN4 M;  1XNQ Q;  2OCE A;  3E9H A;  1W3S A;  5C44 G;  3D8G A;  1XNR L;  2ZJR A;  2K5V A;  3PIP A;  4DR3 Q;  2Z4I A;  3VR3 A;  2R93 G;  1YHA A;  3SHL A;  1CT1 D;  4Q5V A;  1RDP D;  4LF8 L;  2RDH A;  1YNX A;  4O0A A;  5COY A;  3OPO A;  1B44 D;  1XX8 A;  2MP1 A;  3BVM A;  5M5W B;  1G2T A;  1DOL A;  1D5X C;  1I4G A;  1LYL A;  2CFM A;  2L55 A;  3W2D A;  3EBE A;  2F0L A;  2LXJ A;  4DV3 Q;  2OWO A;  2F4V L;  1QE6 A;  1I6H H;  3ULP A;  3T56 B;  4DR6 L;  2B2W C;  1N33 L;  2H5X A;  1K83 H;  3WOF A;  4BXX G;  4JI4 Q;  3OOC A;  5D65 A;  3V2T A;  5IGC A;  4K2K A;  3CC7 A;  4JI7 L;  2K4K A;  1WJJ A;  2R92 G;  3QOL A;  1BBW A;  4DR2 Q;  1K8M A;  4Q0F A;  4C3H H;  1YI2 A;  1HFN A;  2ZXR A;  3R3O A;  3K7U C;  4IJL A;  1RIP A;  1LT3 D;  3M4Q A;  4UP7 A;  3Q6S A;  1X3E A;  5FO7 B;  3TRE A;  3OTO L;  2K14 A;  3I72 A;  3KOJ A;  2PQA A;  1Q81 C;  3JAM c;  1B9M A;  3STB D;  4A4I A;  1IZ6 A;  4TKO B;  1VQN A;  1IYV A;  2AUK A;  3F2C A;  2EYJ A;  3FKI H;  1IBM L;  4YHH L;  4A3K H;  1CZG A;  1DD2 A;  2XN9 C;  4DV0 Q;  1LM0 A;  3SK5 A;  5GAE C;  3I8Z A;  4BBR G;  2JA7 B;  4DV5 L;  5C5L A;  3M3Y H;  4MNO A;  2OTL A;  2JQO A;  2CCZ A;  2NVQ B;  1YIT A;  1S5C D;  5L37 A;  3A5Z B;  1FNV A;  3MTS A;  2B63 H;  4A75 A;  5E4X A;  1N8R C;  1V1P A;  4BBS B;  5EPJ A;  4DR1 L;  3S1R B;  1R4P B;  2C35 B;  3S24 A;  1I6V C;  3E5S A;  4RFB A;  3MXN A;  5EBD A;  1O80 A;  3A8K E;  3S1M B;  2B3G A;  4UAI A;  3U9O A;  5HUR A;  1BKB A;  3PO3 H;  1VQ7 A;  3K5M A;  4OHJ A;  1KAW A;  2AQ3 B;  3NWS A;  4HN7 A;  4A3D H;  3VR6 A;  4OO1 G;  2V4D A;  1T5E A;  5J1Z A;  4AQY Q;  2OT2 A;  1KQS A;  5EGT A;  3HOU H;  1HNW Q;  2R7D A;  3I4M G;  1N9W A;  1EQV A;  4GOP C;  1JC7 A;  4LK1 C;  4K8I A;  2EXZ A;  2B8F A;  1YJ9 A;  4OL7 A;  1Z7T A;  2EE1 A;  2I5L X;  4JI2 Q;  1CHQ D;  4OXP A;  1LTR D;  1LTI D;  4ZAI A;  2YU9 H;  2H4O A;  3KBG A;  4AH6 A;  4E6I A;  1MI2 A;  2E2J H;  3NP8 A;  1OXT A;  1PTO D;  3RMH A;  4GNX B;  2L9H A;  5HY6 A;  3DXJ C;  2IL8 A;  3L3O C;  1S3O A;  1CKN A;  1PH6 A;  4R4O A;  2SEB D;  1I4R A;  3TS0 A;  2D9U A;  1HNZ Q;  4A3L G;  1ILQ A;  1EYA A;  4A3J G;  3ULJ A;  2K5W A;  4PNY A;  1TWA H;  2KEE A;  1EQR A;  1HA6 A;  2QDB A;  1K0S A;  4DA2 A;  4FDB A;  4A3M G;  3NPP A;  2L11 A;  4RG1 A;  4CJ2 C;  3GTJ H;  2F0E A;  3PUZ A;  2DY8 A;  2HQL A;  4PQX A;  4PZ6 A;  1M1K C;  5JPN C;  5EAY A;  1VQ8 A;  1KRT A;  4DR7 L;  3CME A;  2F0M A;  1D6E C;  1EY8 A;  3K5O A;  3TZU A;  1E1O A;  1RHP A;  2Y0S G;  2PCF B;  1E0B A;  4DV7 L;  3DMU A;  1M8A A;  1PMR A;  1AEX A;  3HFZ B;  2VQF L;  1Q8I A;  1KDC A;  1ZKO A;  4RCN A;  4RH6 A;  5NUC A;  2HIX A;  4BY7 H;  1HFG A;  2K5D A;  4YIJ A;  4QIW E;  2B2V C;  4DK3 C;  5LMN Q;  1QWY A;  4IZ8 A;  3BZK A;  5C0X J;  2MGS A;  1HR0 W;  1CM9 A;  4A3G H;  4PMB A;  4KTA A;  1HRJ A;  3S15 H;  4DUZ L;  4JYA Q;  4DV4 L;  2TSS A;  1QZH A;  1VQG A;  1VQL A;  2BDN A;  1EY9 A;  1IBK Q;  2PQA B;  4A3B G;  1CHP D;  1WOC A;  3S1Q H;  5DLQ E;  2FMM A;  4IUU A;  3CCL A;  1PZI D;  5FO9 B;  4X3T A;  3CRK C;  4QQB X;  4JBM A;  4C3I B;  4ZKC B;  1W6K A;  2VY3 A;  3J7A V;  2X69 A;  1QNK A;  4JI8 Q;  3BDC A;  1QVG A;  4IFD J;  2O4X A;  1N34 Q;  1XNQ L;  4JV5 L;  2FXQ A;  4XT1 B;  1QG7 A;  3HP3 A;  3C1F A;  4LF6 Q;  4A76 A;  1K8G A;  1A3T A;  1TWC B;  4DR3 L;  2Q2U A;  4UY8 C;  2F0S A;  1EWI A;  1GD7 A;  2F0F A;  1W2B A;  4TRD A;  2EIF A;  1V1P B;  3TP5 A;  4NMZ A;  2B2W A;  1LAB A;  1ENA A;  1F2M A;  2MPM A;  1S5F D;  2KEN A;  1ASZ A;  3MXN B;  4ZRZ A;  5LHY 1;  3PV0 A;  3C46 A;  4M8A A;  5ELD A;  1X56 A;  3HOX G;  4DV3 L;  4YWK A;  1YNJ C;  1Y8N B;  3DWQ A;  2RCN A;  1X55 A;  3T1Y Q;  1ZYR D;  2PW5 A;  3P7J A;  4FVM A;  1VQP A;  4HMI A;  2E2D C;  3EQL C;  3RNU A;  4XXE A;  2F03 A;  1LTL A;  1GKH A;  1CFM A;  1PVO A;  4JI4 L;  4QUF A;  2B2Y A;  1CQV A;  5M5X B;  4PMC A;  4KKU A;  3S17 B;  4CDD C;  1EY7 A;  5GAD C;  5C3E H;  4DR2 L;  3I4N G;  3NTH A;  1J6Q A;  2C5C A;  4RGN A;  4GLV B;  4RGM A;  3BYY B;  1E22 A;  2IX3 A;  1Q82 C;  3AMU A;  2K50 A;  3VYS A;  4ZUI A;  3T13 A;  1SMY D;  2I0Q A;  1A0I A;  3RZO B;  4GKK Q;  1C48 A;  1T9H A;  4HSV A;  5EBC A;  4NXN Q;  3N6R A;  3BVG A;  1CKN B;  3CD6 A;  3D4W A;  2VUM G;  1JOK A;  1EFW A;  4M1U B;  5IGF A;  3Q24 A;  2DNE A;  2JA7 H;  3FPU B;  1H95 A;  3CPF A;  1UE1 A;  4A3F G;  4I7A A;  4XT3 B;  2J0T D;  3TQY A;  4ALP A;  2LS0 1;  1PRT D;  1G51 A;  3CC2 A;  4QCL A;  3SDZ A;  4ZCK A;  1AH9 A;  1KDB A;  4QL5 A;  3S1R H;  3FP9 A;  3ICE A;  2CWP A;  4JOI A;  3Q22 A;  3GTK H;  1QCB D;  2GVA A;  1U0L A;  2BDO A;  1IKM A;  4C2M B;  1YIJ A;  1EQQ A;  5FKA C;  5FJ8 H;  2XRQ D;  3SK4 A;  3UDI A;  1RJT A;  4KK7 A;  4DAV A;  1JWM D;  1KAA A;  1D5Z C;  2EQS A;  5J39 A;  3SXH A;  1XNR Q;  1CK1 A;  1ICW A;  4IUP A;  4A3C G;  4AQY L;  1Q8K A;  1BCP B;  2QW7 A;  1SNQ A;  1VF7 A;  4KHV A;  4LF8 Q;  2LXK A;  1VF5 C;  1J8I A;  3S2D H;  4MZ9 A;  1OO9 B;  1K0R A;  2N3S A;  4X62 Q;  1AZQ A;  1PH2 A;  4UPA A;  4JI2 L;  3H0G H;  2Z1C A;  2XVS A;  3QB3 A;  1ENC A;  2NB0 A;  2RF4 A;  1LTG D;  2XIW A;  2HDL A;  1GUO A;  3NTI A;  5ELF A;  1N33 Q;  5CR3 A;  1HZB A;  1I6H B;  4WJW A;  1XJV A;  3VYT A;  1CQF A;  4RKB A;  2ALY B;  2IPK D;  4IPH A;  1PH9 A;  5IP7 G;  5C4X G;  1IKL A;  1HNZ L;  2FIN B;  2QA4 A;  2AQ2 B;  2WIN B;  1CSQ A;  4JC0 A;  3GD7 A;  4BA1 I;  3PUX A;  4YCU A;  3AEV A;  2CW0 D;  2NN6 I;  3OTO Q;  1SN8 A;  5C44 H;  3BG3 A;  2DN8 A;  1PZK D;  1VQD A;  2F3I A;  2WB1 E;  2NTT A;  3DWP A;  5CV4 A;  4L5R C;  1HNX L;  3K6O A;  3LX0 A;  4QGU A;  5JEA G;  1HTP A;  1KIX A;  1I3Q H;  3OWF A;  5M9O A;  5IYB G;  2HT1 A;  1LUZ A;  3BDO A;  3FKI B;  4RMF A;  5JOB A;  4A3K B;  1SXT A;  1GXD C;  3ITP A;  3UDX A;  2YTX A;  3M3Y B;  3CP0 A;  2VQE L;  5LMN L;  2WB1 G;  1UEB A;  3H3V I;  1C4Q A;  2FMC A;  5EQ0 A;  4C1N I;  2B63 B;  1YHB A;  4IQZ A;  2QEX A;  4FXK C;  3CU7 A;  2NZO A;  4K14 A;  1NCV A;  4JYA L;  3SR1 A;  1SYG A;  2R92 H;  3M4O H;  4L8J A;  3GTP H;  1IBK L;  1E2W A;  3HOV H;  2L0C A;  5GAH C;  1SE4 A;  1JWU D;  1B50 A;  5I6W A;  1Q46 A;  5C4J H;  3J80 E;  5K36 H;  3P1H A;  4F8M A;  4A3E G;  1IHZ A;  1GUN A;  2KUM A;  4P75 A;  2CQO A;  2NTS A;  4JI8 L;  4A3D B;  3STB C;  2IJ0 A;  5KGU A;  3CF5 A;  1N34 L;  3S16 H;  2K7V A;  2NVX H;  3NEM A;  4U67 3;  3CCV A;  1G6P A;  3HOU B;  3PUV A;  1TR5 A;  4IOC A;  1SNM A;  4P74 A;  3T16 A;  2N88 A;  3GTL H;  2PMZ B;  5DAU A;  5I2Y A;  2KOL A;  3H15 A;  2KA7 A;  3EIV A;  1GO3 E;  1SJH D;  2D5D A;  2E2J B;  4RAU C;  3BJU A;  3F2B A;  2NBF A;  3NTK A;  3HKZ G;  3DHQ A;  2ICE C;  3BZD B;  3A8J E;  5KNC A;  3W1B A;  4N9P A;  4CKE A;  2X6G A;  3FEW X;  1NJI C;  1SE8 A;  1HCZ A;  1I4P A;  1HPC A;  4ME3 A;  1Q86 C;  4BY1 G;  1WI5 A;  1VCI A;  1X65 A;  4DV2 Q;  1M90 C;  1TWA B;  4N8X 1;  3EVQ A;  2AKW B;  5FLX L;  1XTC D;  4OO1 H;  2K52 A;  2EYH A;  5HGQ A;  3S14 H;  1AFP A;  1ONL A;  3HOW G;  1EYC A;  2HHH Q;  3I4M H;  3IRB A;  3NSW A;  2UXC L;  2GN5 A;  2RSO A;  4DV7 Q;  4GKK L;  2BH2 A;  1WD1 A;  1QNU A;  5LMU Q;  3KBX A;  4QUC A;  1L1O A;  4OGQ C;  3GV3 A;  1SNO A;  4C56 C;  4BY7 B;  2WFW A;  1ESF A;  1PTO C;  2K1B A;  3D6C A;  3AQQ A;  3UDF A;  1ZXT A;  4QF4 A;  3TZD A;  4B3T L;  3KF6 A;  1ENF A;  3C3L A;  2K33 A;  2OQ0 A;  3HZX A;  4EQP A;  4A3G B;  3FHW A;  5IGB A;  1PH8 A;  4KD4 A;  1DOK A;  3I7F A;  5C0X I;  3U4Z A;  1XMQ L;  4HAE A;  3J81 L;  3QR8 A;  4C2M H;  4A3J H;  2QGQ A;  3ER0 A;  3S1Q B;  3J81 c;  1ASY A;  3PO2 G;  1SYC A;  1EOV A;  1TVX A;  4LMQ D;  1JOO A;  2QKI C;  4A3M H;  4LUO A;  4ZUJ A;  1GVP A;  3PF4 A;  4JV5 Q;  1BR9 A;  1KC8 C;  3GTO H;  3KF8 A;  3W1G A;  4C1N K;  1KRS A;  3ULL A;  2D0P A;  1R4Q B;  4IFD I;  2IWH A;  3U4V A;  4MHE A;  1GUG A;  1Y8P B;  4EGV A;  5JJZ A;  1OXS C;  4L63 B;  5IYD G;  1NNX A;  1JB3 A;  2QEJ C;  3G4S A;  4AYB B;  4X62 L;  1PYW D;  5I6Y A;  4LFB Q;  3M9B A;  2JEA I;  5IOD A;  2BCO A;  2AQ1 B;  1DJR D;  1KNA A;  5A2Q L;  1ESR A;  4ZYS A;  1F9S A;  3DEP A;  2E76 C;  3BZC A;  1W6J A;  1DXM A;  1QUQ A;  2FHT A;  2EY2 A;  4A3B H;  4OEL B;  1WYD A;  1MBY A;  2RHS B;  1H9J A;  4J1M A;  5CGK A;  1EQT A;  4S3S A;  2CHB D;  5C3E B;  2F0D A;  3NBI A;  1TKW B;  3UDG A;  1RKN A;  5C4Z A;  5JPM C;  5LL6 X;  2A68 D;  4DXG A;  4HIM A;  1F2Z A;  3JAM L;  4KKS A;  5G3L D;  3R2I A;  4J6H A;  3M7G A;  2B29 A;  3IAY A;  1WTR A;  4KLK A;  3PSI A;  3E3X A;  4XIG S;  2B2U C;  4C3I G;  1KNE A;  5J3B A;  2SNS A;  1LT6 D;  1I4H A;  3CCS A;  4IN3 A;  1HJP A;  1Y1V G;  4OWX B;  3W5O A;  2K28 A;  1WCM G;  5GAG C;  1EEF D;  4HSP A;  1J9O A;  1HTL D;  1SAP A;  1TWF H;  1ZYR C;  2R7F A;  2V1C C;  5F2D A;  1HXY D;  4DNT B;  5FLM G;  4IO9 A;  1TQO A;  4TVA B;  2YV5 A;  4NKL A;  3MC0 B;  4H13 C;  2AMC B;  2ID0 A;  2UUB Q;  3GTK B;  3PQI A;  5KRU A;  4P73 A;  1A3V A;  1XPR A;  4DR5 Q;  1G8Z D;  1S4Z A;  4R4C A;  1Y1W G;  2IHE A;  2ZTD A;  4LW1 A;  2F0T A;  1HZ9 A;  3U50 C;  1VQO A;  3L9A X;  3O13 A;  1GUW A;  2A69 D;  1L1O B;  4ILW A;  1SMY C;  2XRS D;  2JN4 A;  2N49 A;  1WTQ A;  1DZ1 A;  2B39 A;  3KF6 B;  1PYB A;  3QJY A;  1VQF A;  1BVS A;  1NMF A;  2GVB A;  1XMO L;  2HUG A;  3PUY A;  4ZKB B;  3S2D B;  3VYU A;  2WII B;  3E0J A;  4A3F H;  1KLU D;  2B8G A;  1WTH A;  3UI2 A;  4HJ8 A;  1PRT C;  1HQR D;  2H1E A;  3L7Z C;  1T5X D;  2G9D A;  3H0G B;  1F77 A;  2Z6K C;  2AWO A;  3HOZ G;  1ILP A;  1QB5 D;  2EYM A;  4B3R Q;  1R9T H;  4DKA C;  5D3D A;  2F0V A;  1DCZ A;  1NBW A;  4YWM A;  2JP1 A;  3KF8 B;  5EPL A;  1JR0 D;  1AE2 A;  1OXV A;  4X65 Q;  2I5M X;  1BQQ T;  1TII D;  2M9V A;  4C3J G;  2OQK A;  4KD3 A;  4UP8 A;  4DV2 L;  4R4T A;  5BN4 A;  1FGU A;  2KHJ A;  2WAC A;  2PZT A;  1HR0 Q;  4A93 G;  4B3M Q;  3Q0A A;  1D1K A;  3IL8 A;  4JK1 C;  5C44 B;  3RN2 A;  1LTB D;  4R4I A;  3CCQ A;  3SK8 A;  1HNX Q;  2HIV A;  1UWV A;  3ZYY X;  2HHH L;  1FR3 A;  4RA8 A;  2Q2T A;  2UUA Q;  2CKZ B;  1X3G A;  1PTO F;  3CQZ H;  3UE0 A;  2F0U A;  1SNC A;  4H02 A;  4OX9 L;  1I3Q B;  1QUQ B;  5LMU L;  4DFA A;  4FF4 A;  1BCP D;  5FO8 B;  3CCE A;  4L5Q A;  1LTA D;  3CHB D;  2VQE Q;  1S5D D;  4X6A H;  1CKM A;  4EQN A;  1B70 B;  3TP8 A;  4KN4 C;  2F0O A;  3TS2 A;  2CQA A;  4DU9 A;  5IP9 G;  4O42 A;  3AYH B;  4CDC C;  2F3W A;  3NHH A;  5M5Y H;  1A8V A;  1H9M A;  1C8C A;  5IIF A;  5IP7 H;  2HDM A;  1E2V A;  5C4X H;  3CCJ A;  3MHB A;  3TEH B;  1EYD A;  1KXL A;  2E74 C;  2R6G A;  1AW7 A;  3HKS A;  4DAY A;  3SEB A;  3VA7 A;  2R92 B;  4KJN A;  3M4O B;  3GTP B;  3HOV B;  4XYQ A;  1VQK A;  3QO2 A;  4LFC Q;  2JA8 G;  2CW0 C;  1MHW C;  5C4J B;  1VQM A;  1JMC A;  1A2U A;  1KHI A;  1SBB B;  1PV4 A;  4P2C B;  4QJF A;  2JXM B;  2PQE A;  1EZ8 A;  1TU2 B;  3HS0 C;  3FDT A;  3S1N H;  4JI3 Q;  2F0Q A;  1OXU A;  3S16 B;  2NVX B;  3RLF A;  3AB9 A;  2F0N A;  2F0K A;  4LUV A;  4JVZ A;  1MJE A;  2F52 A;  4C3H G;  1CA5 A;  3GTL B;  1XPO A;  4TSS A;  4BBR B;  2F0H A;  3MZ5 A;  4QY7 A;  3SVM A;  3CXC A;  4XTC S;  3D31 A;  3ERS X;  4ID6 A;  2E2H H;  2JA6 G;  1NUC A;  4LFB L;  1PLF A;  5IGD A;  5IGG A;  5IT9 L;  5BN5 A;  5CMD A;  3HOY G;  4Y7N H;  3QG1 A;  5IT9 c;  1SYD A;  3TBI B;  2YYZ A;  2RDG A;  4DF7 A;  2JJQ A;  1XPU A;  2LY7 A;  1CI3 M;  2E5L Q;  3NK9 A;  1PFS A;  4HCS A;  4XYO A;  3FKI G;  4POF A;  4A3K G;  1XWE A;  4PMW A;  3CCU A;  3GV6 A;  5EKK A;  4A3E H;  3K0X A;  2ASB A;  3F2U A;  2JA5 G;  5BR8 L;  1VQA A;  2MHV A;  1F9Q A;  3FVQ A;  4CDE C;  1MIU A;  1AN8 A;  2ATW A;  3A55 A;  1N36 Q;  5IY0 A;  4NP5 A;  5M3F G;  3S9W A;  4KI0 A;  2I46 A;  2KED A;  2MUY A;  1HA5 A;  1JB7 A;  1NAP A;  3S14 B;  2UXC Q;  2QF7 A;  3K5N A;  3I4M B;  2WAQ B;  4RHR A;  1VQH A;  5E3F A;  3J80 c;  3CPW A;  5K5P A;  3AFQ A;  1D5M C;  3PO3 G;  2PMZ E;  4IUT A;  2K05 A;  2XWB B;  1NR2 A;  2J4X A;  4K6D A;  1ET6 A;  3KLS A;  4B3T Q;  1MSH A;  1N32 Q;  3B6Y A;  3W3A A;  2FFK B;  1S40 A;  3CC4 A;  1EZ6 A;  1HH2 P;  1ICF B;  2Q8R E;  1SE2 A;  4IUR A;  3DEO A;  1XMQ Q;  5DM7 3;  1WTP A;  4FF3 A;  5M3M G;  1A2T A;  4IJH A;  4A3J B;  2UUB L;  4BY1 H;  4A3I H;  4DR5 L;  1PH3 A;  2B2T C;  4GOP A;  5D14 A;  1GHK A;  4B9X A;  2KCC A;  2MFI A;  4JI5 L;  1HZA A;  1PH5 A;  4A3M B;  3T4A C;  1ET9 A;  2VXW A;  1QOH A;  3JAM i;  1LTT D;  3X3N A;  1NMG A;  2R7Z G;  1X32 A;  4X66 Q;  3GTO B;  1ZEQ X;  4LFA L;  3HOW H;  3N52 A;  5AFW A;  5TSS A;  1GUT A;  3E6Z X;  1YNN D;  4UDU C;  2Y0S B;  4PV1 C;  2BA0 A;  2SDF A;  3CMA A;  1PRT F;  3TN2 A;  1QJO A;  3KLR A;  3H3V C;  2DUD A;  3NEL A;  1BBU A;  2DGY A;  2CH4 A;  1K8O A;  4DAY B;  1O7I A;  1STA A;  3D3R A;  1F2Y A;  3MFG A;  4NPS A;  3HGB A;  5C5M A;  4DNR B;  1STN A;  2PZU A;  4LF9 Q;  2VS1 A;  4GN5 A;  2UXD Q;  4B3R L;  3R8B A;  1E24 A;  3QIA A;  3A56 A;  4ZQ3 A;  2IW3 A;  4GNX C;  1EY6 A;  4G7Z C;  1FJG Q;  3BDL A;  4R8I A;  4A3B B;  1A63 A;  1CKO A;  3VR2 A;  2KHI A;  3PO2 H;  1TY2 A;  2NUC A;  4X65 L;  2L4N A;  4IOA A;  4GZY C;  5AJ3 Q;  3AU7 A;  1YBY A;  4DUY Q;  4YCW A;  2LKV A;  4Y52 H;  5I9P A;  3PF5 A;  4EVO A;  4K0K Q;  3LNN A;  4MN3 A;  4NDX A;  1PZJ D;  5C6A A;  2B2V A;  1HR0 L;  2R3Z A;  1Q7Y C;  3A5U A;  4B3M L;  4HJ5 A;  3K0Y A;  5CV8 A;  2ES2 A;  3NWT A;  2R93 H;  1LLR D;  1V43 A;  1SYE A;  3OYY A;  2A73 B;  2AWN A;  5IYD H;  2WKD A;  1PH7 A;  2UUA L;  5C4H A;  1Z9F A;  1SRU A;  1VQ5 A;  4MIU A;  2EY5 A;  1F9R A;  2VB3 X;  3CCR A;  1DM0 B;  2IX0 A;  2L5T A;  4B3S Q;  1IL2 A;  1GHJ A;  1VQI A;  1Q1B A;  5EKL A;  2N55 A;  4KKT A;  1GJX A;  1Z6H A;  1TWF B;  4POG A;  4LF7 Q;  4NB3 A;  2Z0S A;  4BXX H;  1LT4 D;  1FNW A;  4MTK A;  1KLG D;  1MGS A;  1I94 L;  5JVG 3;  3TP6 A;  2IHF A;  2RDF A;  1CZW A;  4APV A;  4X3U A;  5ELC A;  1Y69 U;  4LFC L;  1NSN S;  2A68 C;  3TRZ A;  3DM1 A;  4ODG A;  4OEM B;  2Z9H A;  4L6T B;  1TWH H;  2ZJP A;  2PNH A;  2A6E D;  1XTD A;  2PI2 A;  1U4M A;  1DYQ A;  5DM6 3;  1Q12 A;  4CGY B;  2M2L A;  4ABN A;  3A8I E;  4JI3 L;  3I4L A;  4I7Z C;  1XMO Q;  1VQ4 A;  3DM3 A;  2VUM B;  5ISR A;  4HJ7 A;  3NXW A;  5I9O A;  1VQB A;  4BBR H;  2D0O A;  4A3F B;  3V96 A;  1Y1V H;  1FD7 D;  4HTH A;  1WCM H;  1D1I A;  2M00 A;  3LWU A;  5ELO A;  1WTW A;  2ZXP A;  1Q1E A;  1RF2 D;  3G7L A;  5JJK A;  3F1Z A;  4GOP B;  3ERO A;  1LTS D;  1PH1 A;  3IFD A;  5FLM H;  1R9T B;  1BBX C;  1TY0 A;  3C1E A;  2NVY H;  5C3W A;  1H9R A;  3G48 A;  4L5S A;  4DAM A;  2WP8 J;  1UE7 A;  3OHX C;  4G7H C;  2E5L L;  2ZM6 Q;  1GUS A;  5JJI A;  3GTQ H;  1M4V A;  2G5D A;  1RD9 D;  3H94 A;  1WVL A;  1C9O A;  1L2F A;  1Y1W H;  2JA7 G;  3MXP A;  1V1Q A;  1STH A;  3M4P A;  2A69 C;  4HED A;  5IOC A;  3MA2 B;  4DV6 Q;  2K5Q A;  1C7Y A;  2K5H A;  1AP0 A;  1J5E Q;  2UUC L;  2K03 A;  2NN6 G;  3TDQ A;  1UNS A;  4BBS G;  2KCM A;  1YJW A;  1N36 L;  1SRO A;  2KJX A;  5DNF A;  2EY6 A;  3D4R A;  4TQU S;  4OX9 Q;  1YJN A;  3CQZ B;  5FJ8 G;  3GO5 A;  4LJZ C;  1I50 H;  3RLN A;  1SMX A;  4LF5 Q;  1SSO A;  2DY7 A;  1IXR A;  2EYL A;  3BS1 A;  4JBK A;  3F2D A;  3HOZ H;  4UHV A;  3L0O A;  4RWS C;  3HRZ C;  1RL2 A;  3G6E A;  3J7A 5;  3RUZ A;  5CBA E;  2XWJ B;  3OW7 A;  1X3P A;  2CVR A;  1N32 L;  1IL8 A;  4LF4 Q;  1PXU A;  5T1G A;  1I5F A;  1VQC A;  1PTO H;  4GLA C;  5M5Y B;  1KTK A;  2PPB C;  4A3L H;  1Y14 B;  1EFI D;  3RZD H;  2OTJ A;  3KUP A;  5C4X B;  3HEJ A;  2I5H A;  3KLW A;  2MNA A;  4UP9 A;  4C3J H;  2F4I A;  1JOQ A;  2K04 A;  5CV6 A;  4H7B A;  1FVI A;  1U4L A;  4A93 H;  1FNU A;  2FJ2 A;  4DAP A;  2EDG A;  1XYI A;  4X66 L;  1ML0 D;  4JBW A;  3S1N B;  2LFN A;  4DK1 A;  1KDA A;  4HCE A;  2G9H D;  2HCI A;  2RCF A;  4HIO A;  1BCP C;  4GS3 A;  4CBV A;  4AIM A;  1IW7 D;  4LAA A;  2RQX A;  1YZ6 A;  3QWN A;  1STY A;  2VZA A;  4OO1 I;  4CDF C;  2BA1 A;  4F87 A;  4GLX A;  2KQ3 A;  2E2H B;  2WB1 B;  2SOB A;  3I90 A;  2A19 A;  3MEH A;  4HID A;  5IP9 H;  4L5T A;  4NW2 A;  1B2T A;  4IPD A;  4GKJ L;  4LF9 L;  5HGT A;  4Y7N B;  1JOR A;  1JQY D;  3A74 A;  2A8V A;  2UXD L;  5J22 A;  5I4D A;  3U9S A;  2L15 A;  1SYF A;  2OF1 A;  5EPK A;  1B53 A;  3PIP 3;  1MJC A;  1TXY A;  1FJG L;  1SE3 A;  5EJW A;  4KY6 A;  4X64 L;  1LAC A;  2K5N A;  1CA6 A;  3MXU A;  1QZG A;  4O2D A;  4RHS A;  4RGT A;  2JA8 H;  5BR8 Q;  4DK6 C;  4A3E B;  2NVT H;  5AJ3 L;  1Q3L A;  3HG9 A;  1K3B C;  3RN5 A;  4DUY L;  3TP7 A;  2LSS A;  2PYK A;  3K59 A;  1RCV D;  4K0K L;  3A54 A;  2BE5 D;  4HMJ A;  3VA5 A;  3OSO A;  4IUQ A;  4F7X A;  3HOV G;  5EKI A;  3PMF A; 
#chains in the Genus database with same CATH homology
 2EJF C;  5K36 G;  1V8Q A;  4FF1 A;  4K5W A;  4K8J A;  2F0I A;  5IGE A;  1XXG A;  2B2Y C;  2A6H D;  3HKZ B;  4FXG C;  3GQB A;  2ZT9 C;  5KYL A;  3VR4 A;  1WTO A;  4G4K A;  4DK0 A;  5C0X G;  4U68 A;  1SND A;  1LT5 D;  2LMC B;  2PZW A;  1BDO A;  1PFN A;  4BY1 B;  3KLS X;  5C3X A;  5G3L F;  4A3I B;  4Z9C B;  4FYD A;  3PUW A;  3DUZ A;  1TS3 A;  1LV9 A;  1SNP A;  5FLX E;  3T53 B;  2BOS A;  4WRD A;  4FF2 A;  3HOW B;  5JVH 3;  2Q8I B;  4EQO A;  1WTV A;  4IFD G;  5CBE E;  2C9O A;  2I07 B;  4CKB A;  2VNU D;  5KYI A;  2JSO A;  2Z8L A;  2OXP A;  1RTO A;  1EL0 A;  4H0L C;  4DXF A;  1TS5 A;  4WFN 3;  3MWY W;  1L0X B;  1EEI D;  1Y8O B;  2RA4 A;  3I70 A;  2IX1 A;  2OEO A;  3EFX D;  4RGO S;  4KHZ A;  1EOT A;  4G7O C;  1VMC A;  1Z47 A;  1KAB A;  4FO2 A;  1O78 A;  3T51 B;  4QB4 A;  3PO2 B;  4RKL A;  2K32 A;  1UUP A;  3J81 E;  1EWC A;  1O7L A;  2O5J C;  1VMP A;  3J7Y W;  1EU4 A;  4CJ0 B;  1YNN C;  2R93 B;  4FNF A;  2RKS A;  3ONA B;  1V1O A;  1PFB A;  3SE0 A;  1EU3 A;  2F0J A;  2PW7 A;  5JAV A;  4FP5 D;  2DNC A;  1WTX A;  3OIP A;  2XNA C;  5A2Q E;  1O7Y A;  3CKI B;  4OIK A;  4K2L A;  4KY7 A;  4XQQ A;  2GA4 B;  3DWA A;  3J7A F;  1DON A;  1HUN A;  3OWE B;  5KND A;  3I73 A;  1BOS A;  1H9S A;  1GOZ A;  4B08 A;  1BNZ A;  1E2Z A;  4X3S A;  1TT2 A;  1SJE D;  1TWH B;  3NUC A;  1HHV A;  1BCP F;  1JIC A;  3JAM E;  5JEA H;  2EYP A;  1OXX K;  2A5H A;  3MVV A;  5FK9 C;  5CYU A;  3TSS A;  1U9R A;  2O5I C;  2RSN A;  4ME5 A;  5FOB B;  1Y1V B;  3D6W A;  1WCM B;  5COR A;  4V19 0;  1JE4 A;  3MAQ A;  5D3I B;  2EYO A;  3QOJ A;  2NVY B;  3FMC A;  3BYT B;  1CTM A;  1L0Y B;  3GTQ B;  1Y1W B;  4H44 C;  5BN3 A;  2A6E C;  1BO0 A;  1B4O A;  2B2U A;  3R93 A;  1STE A;  3FPP A;  3K57 A;  3H6M A;  5T1I A;  4V0B A;  1G2S A;  3J80 L;  4N9T A;  4J8Q A;  2EY1 A;  1I50 B;  1IYU A;  4XQJ A;  3ERQ A;  1WD0 A;  3KK7 A;  1MSG A;  2WKC A;  3HOZ B;  2KEC A;  3K58 A;  4OIJ A;  1TS4 A;  1EY4 A;  4CKC A;  2F3V A;  3P20 A;  5CV9 A;  1UEA B;  2F0P A;  3ND9 A;  4K5X A;  5ELE A;  1PTO B;  3RZD B;  3K5L A;  5ELB A;  4C3J B;  5LL6 S;  3VYR A;  2L1B A;  4BS9 A;  2F0W A;  2NN6 H;  4A93 B;  4K5V A;  3NBH A;  3OMC A;  3URY A;  2HCC A;  1HUM A;  3WDN A;  4FXD A;  5E4W C;  1AZP A;  2K01 A;  2D62 A;  4DGZ A;  1H9S B;  3NQT A;  1SDF A;  3TME A;  1S5B D;  2Q8T A;  3C2P A;  1FYC A;  1A6X A;  1EY0 A;  1PFM A;  1EIH A;  2QCP X;  4QIW B;  4F88 A;  3V05 A;  2O2L D;  2JA8 B;  3PIO 3;  1D2B A;  3IFT A;  3NQI A;  2NVT B;  3OMG A;  1G91 A;  3OIQ A;  1BF4 A;  2EVB A;  3MXG A;  1HQM C;  1K83 B;  2KVM A;  4I65 A;  2EJM A;  3GP7 A;  2Z4H A;  1G29 1;  1IW7 C;  2F1M A;  1BXT A;  2D2C C;  3H91 A;  1LO5 D;  3CRL C;  1JWS D;  4C3H B;  5KNB A;  2XSC A;  4IUN A;  2L12 A;  2NYZ D;  2AUJ D;  2JA6 B;  3LWE A;  1BUV T;  3X3M A;  1MD2 D;  2WV6 D;  2SNM A;  2QIL A;  3HOX B;  3HOY B;  1SFO B;  1ROD A;  1U4R A;  5E1F A;  5IT9 E;  3GTG B;  1B9N A;  3M7N A;  2HQE A;  4ZLT F;  4X3K A;  2EZV A;  1TWG B;  2E2I B;  3I3C A;  1A15 A;  3RD4 A;  2JA5 B;  2ICI A;  3I4N B;  1NR4 A;  4BWG B;  4O1N A;  2BE5 C;  1FGB D;  1EIG A;  2EPB A;  2R61 A;  5M3F B;  1YNJ D;  1EWH A;  5CV7 A;  2NZ1 D;  2KCN A;  4XQN A;  2PO4 A;  3P75 A;  4QMG A;  3SK6 A;  3A7A B;  1QIL A;  5KIX A;  2J7Z A;  4ULL A;  3PO3 B;  4KJO A;  4KV6 A;  5DEH A;  2A6H C;  4K6L A;  3GTM B;  1G6Z A;  4KY5 A;  1STG A;  1Q90 A;  1X3Q A;  4KN7 C;  2A74 C;  2ENB A;  3FRP B;  2EYF A;  1B1Z A;  4HR7 B;  1DOM A;  4CJ1 B;  2ZXO A;  1O7Z A;  4IUV A;  5C0X H;  1PRT B;  1U4P A;  5M3M B;  5I2X A;  3Q23 A;  4BA2 I;  2YU9 B;  4KMU C;  4R8N A;  3EJI A;  2RBM A;  1RTN A;  1I4Q A;  2TMP A;  2R7Z B;  1UAP A;  1SYB A;  3H09 A;  3R2T A;  2KHS A;  4R9W A;  4ZK9 B;  4IFD H;  2JYO A;  2IT1 A;  4XDX A;  1TS2 A;  1B3A A;  3BVZ A;  2K6A A;  2MJ8 A;  4WOR A;  3I91 A;  5JEA J;  1SEB D;  3GTJ B;  3S2H B;  3MFY A;  1H9K A;  2B2T A;  1F2L A;  2PNR C;  4RCO A;  2JE6 I;  5CC4 A;  3K7A B;  2JEB I;  1STB A;  3NE5 B;  1F9P A;  3A7L A;  1A3U A;  3D4D A;  2EOT A;  1EY5 A;  3EA6 A;  1VDZ A;  3G6J B;  5KEE A;  2X6L A;  1I4X A;  4G57 A;  2NWG A;  4IAL A;  3ND8 A;  2F0G A;  2RVL A;  5A35 A;  3S15 B;  5CV5 A;  3VR5 A;  1II3 A;  2E75 C;  2EJG C;  1S5E D;  3IKJ A;  3M85 A;  2VB2 X;  4CHT B;  4B9W A;  1JCK B;  1PDQ A;  3M4Y A;  3WOE A;  4DN4 M;  3D8G A;  2Z4I A;  3VR3 A;  3SHL A;  1CT1 D;  4Q5V A;  1RDP D;  2RDH A;  5COY A;  3OPO A;  1B44 D;  1XX8 A;  2MP1 A;  3BVM A;  5M5W B;  1G2T A;  1DOL A;  1D5X C;  1I4G A;  2L55 A;  3W2D A;  2F0L A;  1QE6 A;  3T56 B;  2B2W C;  3WOF A;  3OOC A;  5D65 A;  3V2T A;  5IGC A;  4K2K A;  3QOL A;  1K8M A;  4Q0F A;  1HFN A;  2ZXR A;  3R3O A;  1LT3 D;  3Q6S A;  5FO7 B;  3I72 A;  1B9M A;  4TKO B;  1IYV A;  2AUK A;  2EYJ A;  1DD2 A;  1CZG A;  2XN9 C;  3SK5 A;  3I8Z A;  2JA7 B;  5C5L A;  2NVQ B;  1S5C D;  1FNV A;  3MTS A;  5E4X A;  1V1P A;  4BBS B;  5EPJ A;  3S1R B;  1R4P B;  1I6V C;  3E5S A;  4RFB A;  3MXN A;  5EBD A;  1O80 A;  3A8K E;  3S1M B;  4UAI A;  3U9O A;  5HUR A;  3K5M A;  4OHJ A;  2AQ3 B;  3NWS A;  4HN7 A;  3VR6 A;  4OO1 G;  2V4D A;  1T5E A;  5J1Z A;  2OT2 A;  5EGT A;  1EQV A;  1JC7 A;  4LK1 C;  4K8I A;  2EXZ A;  2B8F A;  4OL7 A;  1Z7T A;  2EE1 A;  1CHQ D;  1LTR D;  1LTI D;  4ZAI A;  2H4O A;  3KBG A;  4E6I A;  1MI2 A;  3NP8 A;  1OXT A;  1PTO D;  3RMH A;  2L9H A;  3DXJ C;  2IL8 A;  3L3O C;  2SEB D;  1I4R A;  2D9U A;  1ILQ A;  1EYA A;  2K5W A;  4PNY A;  2KEE A;  1HA6 A;  2QDB A;  4DA2 A;  3NPP A;  2L11 A;  4CJ2 C;  2F0E A;  3PUZ A;  2DY8 A;  4PQX A;  5JPN C;  2F0M A;  1D6E C;  1EY8 A;  3K5O A;  3TZU A;  1RHP A;  2PCF B;  1E0B A;  3DMU A;  1M8A A;  1PMR A;  1AEX A;  1Q8I A;  1KDC A;  1ZKO A;  4RCN A;  4RH6 A;  5NUC A;  1HFG A;  2K5D A;  4YIJ A;  2B2V C;  1QWY A;  4IZ8 A;  5C0X J;  2MGS A;  1CM9 A;  4PMB A;  4KTA A;  1HRJ A;  2TSS A;  2BDN A;  1EY9 A;  1CHP D;  2FMM A;  4IUU A;  1PZI D;  5FO9 B;  4X3T A;  3CRK C;  4C3I B;  4ZKC B;  1W6K A;  3J7A V;  2X69 A;  1QNK A;  3BDC A;  4IFD J;  2O4X A;  4XT1 B;  1QG7 A;  3HP3 A;  3C1F A;  1A3T A;  1TWC B;  2F0S A;  2F0F A;  4TRD A;  3TP5 A;  1V1P B;  4NMZ A;  2B2W A;  1LAB A;  1ENA A;  1F2M A;  2MPM A;  1S5F D;  4ZRZ A;  5LHY 1;  3PV0 A;  3C46 A;  4M8A A;  5ELD A;  1YNJ C;  1Y8N B;  3DWQ A;  1ZYR D;  2PW5 A;  3P7J A;  4FVM A;  4HMI A;  2E2D C;  3EQL C;  2F03 A;  4XXE A;  1CFM A;  4QUF A;  2B2Y A;  1CQV A;  5M5X B;  4PMC A;  4KKU A;  3S17 B;  1EY7 A;  3NTH A;  2C5C A;  4RGN A;  4RGM A;  3BYY B;  2IX3 A;  3AMU A;  3VYS A;  4ZUI A;  3T13 A;  1SMY D;  3RZO B;  1C48 A;  4HSV A;  5EBC A;  3N6R A;  3BVG A;  3D4W A;  1JOK A;  4M1U B;  5IGF A;  3Q24 A;  2DNE A;  3FPU B;  4XT3 B;  2J0T D;  2LS0 1;  1PRT D;  4QCL A;  3SDZ A;  1KDB A;  3Q22 A;  1QCB D;  2BDO A;  1IKM A;  4C2M B;  5FKA C;  2XRQ D;  3SK4 A;  1RJT A;  4KK7 A;  4DAV A;  1JWM D;  1KAA A;  1D5Z C;  5J39 A;  3SXH A;  1CK1 A;  1ICW A;  4IUP A;  1BCP B;  1SNQ A;  1VF7 A;  4KHV A;  1VF5 C;  1J8I A;  1OO9 B;  1AZQ A;  2Z1C A;  2XVS A;  3QB3 A;  1ENC A;  2NB0 A;  1LTG D;  2XIW A;  2HDL A;  1GUO A;  3NTI A;  5ELF A;  5CR3 A;  1I6H B;  4WJW A;  3VYT A;  1CQF A;  4RKB A;  2IPK D;  1IKL A;  2FIN B;  2AQ2 B;  2WIN B;  3GD7 A;  4BA1 I;  3PUX A;  2CW0 D;  2NN6 I;  3BG3 A;  2DN8 A;  1PZK D;  2NTT A;  3DWP A;  5CV4 A;  3K6O A;  3LX0 A;  5JEA G;  1HTP A;  3OWF A;  5M9O A;  3BDO A;  3FKI B;  5JOB A;  4A3K B;  1SXT A;  1GXD C;  3ITP A;  3M3Y B;  1C4Q A;  2FMC A;  5EQ0 A;  4C1N I;  2B63 B;  4IQZ A;  4FXK C;  3CU7 A;  4K14 A;  1NCV A;  3SR1 A;  1SYG A;  4L8J A;  1E2W A;  2L0C A;  1SE4 A;  1JWU D;  1B50 A;  5I6W A;  3J80 E;  5K36 H;  3P1H A;  4F8M A;  1IHZ A;  1GUN A;  2KUM A;  2NTS A;  4A3D B;  2IJ0 A;  5KGU A;  2K7V A;  4U67 3;  3HOU B;  3PUV A;  1TR5 A;  1SNM A;  3T16 A;  2N88 A;  2PMZ B;  5DAU A;  5I2Y A;  2KOL A;  2KA7 A;  1SJH D;  2D5D A;  2E2J B;  4RAU C;  2NBF A;  3NTK A;  3DHQ A;  2ICE C;  3BZD B;  3A8J E;  5KNC A;  4N9P A;  4CKE A;  2X6G A;  3FEW X;  1HCZ A;  1I4P A;  1HPC A;  1VCI A;  1TWA B;  3EVQ A;  5FLX L;  1XTC D;  4OO1 H;  2EYH A;  1AFP A;  1ONL A;  1EYC A;  3NSW A;  2RSO A;  1WD1 A;  1QNU A;  3KBX A;  4QUC A;  4OGQ C;  3GV3 A;  1SNO A;  4C56 C;  4BY7 B;  1ESF A;  1PTO C;  2K1B A;  3D6C A;  1ZXT A;  4QF4 A;  3TZD A;  1ENF A;  3C3L A;  2K33 A;  3HZX A;  4EQP A;  4A3G B;  5IGB A;  4KD4 A;  1DOK A;  5C0X I;  4HAE A;  3J81 L;  3S1Q B;  1SYC A;  1TVX A;  4LMQ D;  1JOO A;  2QKI C;  4ZUJ A;  1BR9 A;  3KF8 A;  4C1N K;  1R4Q B;  4IFD I;  2IWH A;  4MHE A;  1GUG A;  1Y8P B;  4EGV A;  5JJZ A;  1OXS C;  4L63 B;  1JB3 A;  2QEJ C;  4AYB B;  1PYW D;  5I6Y A;  2JEA I;  5IOD A;  2BCO A;  2AQ1 B;  1DJR D;  1KNA A;  5A2Q L;  1ESR A;  4ZYS A;  1F9S A;  3DEP A;  2E76 C;  1W6J A;  1DXM A;  2FHT A;  2EY2 A;  1MBY A;  1H9J A;  4J1M A;  5CGK A;  1EQT A;  4S3S A;  2CHB D;  5C3E B;  2F0D A;  3NBI A;  1TKW B;  1RKN A;  5C4Z A;  5JPM C;  5LL6 X;  2A68 D;  4DXG A;  1F2Z A;  3JAM L;  4KKS A;  5G3L D;  3R2I A;  4J6H A;  3M7G A;  3IAY A;  1WTR A;  4XIG S;  2B2U C;  4C3I G;  1KNE A;  2SNS A;  1LT6 D;  1I4H A;  4IN3 A;  2K28 A;  1EEF D;  4HSP A;  1J9O A;  1HTL D;  1SAP A;  1ZYR C;  5F2D A;  1HXY D;  4DNT B;  1TQO A;  4NKL A;  3MC0 B;  4H13 C;  2ID0 A;  3GTK B;  5KRU A;  1A3V A;  1G8Z D;  1S4Z A;  2F0T A;  3L9A X;  3O13 A;  1GUW A;  2A69 D;  4ILW A;  1SMY C;  2XRS D;  1WTQ A;  1DZ1 A;  2B39 A;  3QJY A;  2HUG A;  3PUY A;  4ZKB B;  3S2D B;  3VYU A;  2WII B;  3E0J A;  1KLU D;  2B8G A;  3UI2 A;  1PRT C;  1HQR D;  2H1E A;  3L7Z C;  1T5X D;  2G9D A;  3H0G B;  1F77 A;  2AWO A;  1ILP A;  1QB5 D;  2EYM A;  5D3D A;  2F0V A;  1DCZ A;  2JP1 A;  5EPL A;  1JR0 D;  1OXV A;  1BQQ T;  1TII D;  2M9V A;  4C3J G;  4KD3 A;  5BN4 A;  2WAC A;  2PZT A;  3Q0A A;  1D1K A;  3IL8 A;  4JK1 C;  5C44 B;  1LTB D;  3SK8 A;  3ZYY X;  1FR3 A;  4RA8 A;  1PTO F;  2F0U A;  1SNC A;  1I3Q B;  4DFA A;  4FF4 A;  1BCP D;  5FO8 B;  1LTA D;  3CHB D;  1S5D D;  4EQN A;  3TP8 A;  4KN4 C;  2F0O A;  2CQA A;  4DU9 A;  4O42 A;  2F3W A;  3NHH A;  1H9M A;  1C8C A;  5IIF A;  2HDM A;  1E2V A;  3MHB A;  1EYD A;  2E74 C;  2R6G A;  1AW7 A;  4DAY A;  3SEB A;  3VA7 A;  2R92 B;  4KJN A;  3M4O B;  3GTP B;  3HOV B;  4XYQ A;  3QO2 A;  2CW0 C;  5C4J B;  1A2U A;  1SBB B;  4P2C B;  2JXM B;  2PQE A;  1EZ8 A;  1TU2 B;  3HS0 C;  3FDT A;  3S16 B;  2F0Q A;  1OXU A;  2NVX B;  3RLF A;  3AB9 A;  2F0N A;  2F0K A;  4C3H G;  1CA5 A;  3GTL B;  4TSS A;  4BBR B;  2F0H A;  3MZ5 A;  3SVM A;  4XTC S;  3D31 A;  4ID6 A;  1NUC A;  1PLF A;  5IGD A;  5IGG A;  5IT9 L;  5BN5 A;  5CMD A;  3QG1 A;  1SYD A;  3TBI B;  2YYZ A;  2RDG A;  4DF7 A;  2LY7 A;  1CI3 M;  3NK9 A;  4HCS A;  4XYO A;  1XWE A;  4PMW A;  3GV6 A;  5EKK A;  3F2U A;  2MHV A;  1F9Q A;  3FVQ A;  1AN8 A;  3A55 A;  4NP5 A;  3S9W A;  4KI0 A;  2I46 A;  2KED A;  2MUY A;  1HA5 A;  1NAP A;  3S14 B;  2QF7 A;  3K5N A;  3I4M B;  2WAQ B;  4RHR A;  5E3F A;  5K5P A;  1D5M C;  4IUT A;  2K05 A;  2XWB B;  1NR2 A;  2J4X A;  4K6D A;  1ET6 A;  3KLS A;  1MSH A;  3W3A A;  2FFK B;  1EZ6 A;  2Q8R E;  1SE2 A;  4IUR A;  3DEO A;  5DM7 3;  1WTP A;  4FF3 A;  1A2T A;  4A3J B;  2B2T C;  5D14 A;  1GHK A;  4B9X A;  2KCC A;  4A3M B;  3T4A C;  1ET9 A;  2VXW A;  1QOH A;  1LTT D;  3X3N A;  1X32 A;  3GTO B;  1ZEQ X;  3N52 A;  5AFW A;  5TSS A;  1GUT A;  3E6Z X;  1YNN D;  4UDU C;  2Y0S B;  4PV1 C;  2BA0 A;  2SDF A;  1PRT F;  3TN2 A;  1QJO A;  3KLR A;  3H3V C;  1K8O A;  1STA A;  3D3R A;  1F2Y A;  3MFG A;  5C5M A;  3HGB A;  4DNR B;  1STN A;  2PZU A;  3R8B A;  3QIA A;  3A56 A;  4ZQ3 A;  2IW3 A;  1EY6 A;  4G7Z C;  3BDL A;  4R8I A;  4A3B B;  3VR2 A;  1TY2 A;  2NUC A;  2L4N A;  4GZY C;  3AU7 A;  2LKV A;  5I9P A;  4EVO A;  3LNN A;  4MN3 A;  4NDX A;  1PZJ D;  5C6A A;  2B2V A;  2R3Z A;  3K0Y A;  5CV8 A;  3NWT A;  1LLR D;  1V43 A;  1SYE A;  2A73 B;  2AWN A;  2WKD A;  5C4H A;  4MIU A;  2EY5 A;  1F9R A;  2VB3 X;  1DM0 B;  2IX0 A;  2L5T A;  1GHJ A;  1Q1B A;  5EKL A;  2N55 A;  4KKT A;  1GJX A;  1Z6H A;  1TWF B;  1LT4 D;  1FNW A;  1KLG D;  1MGS A;  5JVG 3;  3TP6 A;  2RDF A;  1CZW A;  4X3U A;  5ELC A;  1Y69 U;  1NSN S;  2A68 C;  3DM1 A;  4ODG A;  4L6T B;  2A6E D;  1U4M A;  1DYQ A;  5DM6 3;  1Q12 A;  4CGY B;  2M2L A;  4ABN A;  3A8I E;  3I4L A;  4I7Z C;  2VUM B;  5ISR A;  3NXW A;  5I9O A;  4A3F B;  3V96 A;  1FD7 D;  4HTH A;  1D1I A;  2M00 A;  3LWU A;  1WTW A;  2ZXP A;  1Q1E A;  1RF2 D;  3G7L A;  3ERO A;  1LTS D;  3IFD A;  1R9T B;  1BBX C;  1TY0 A;  3C1E A;  5C3W A;  1H9R A;  2WP8 J;  3OHX C;  4G7H C;  1GUS A;  1M4V A;  3H94 A;  1RD9 D;  1WVL A;  3MXP A;  1STH A;  2A69 C;  4HED A;  5IOC A;  3MA2 B;  2K5Q A;  1AP0 A;  2K03 A;  2NN6 G;  3TDQ A;  1UNS A;  2KJX A;  5DNF A;  2EY6 A;  3D4R A;  4TQU S;  3CQZ B;  3GO5 A;  4LJZ C;  1SSO A;  2DY7 A;  2EYL A;  3BS1 A;  4RWS C;  3HRZ C;  3RUZ A;  5CBA E;  2XWJ B;  1X3P A;  3OW7 A;  2CVR A;  1IL8 A;  1PXU A;  5T1G A;  1PTO H;  5M5Y B;  1KTK A;  2PPB C;  1EFI D;  5C4X B;  3KUP A;  3HEJ A;  2F4I A;  1JOQ A;  2K04 A;  5CV6 A;  4H7B A;  1U4L A;  1FNU A;  2FJ2 A;  4DAP A;  2EDG A;  1XYI A;  1ML0 D;  4JBW A;  3S1N B;  2LFN A;  4DK1 A;  1KDA A;  4HCE A;  2G9H D;  2HCI A;  1BCP C;  4CBV A;  1IW7 D;  4LAA A;  2RQX A;  3QWN A;  1STY A;  4OO1 I;  2BA1 A;  4F87 A;  2KQ3 A;  2E2H B;  2WB1 B;  2SOB A;  3I90 A;  3MEH A;  4NW2 A;  1B2T A;  5HGT A;  4Y7N B;  1JOR A;  1JQY D;  5J22 A;  5I4D A;  3U9S A;  1SYF A;  2OF1 A;  5EPK A;  1B53 A;  3PIP 3;  1SE3 A;  5EJW A;  4KY6 A;  1LAC A;  1CA6 A;  3MXU A;  4RHS A;  4RGT A;  4A3E B;  1Q3L A;  3HG9 A;  3TP7 A;  2PYK A;  3K59 A;  1RCV D;  3A54 A;  2BE5 D;  4HMJ A;  3VA5 A;  3OSO A;  4IUQ A;  4F7X A;  5EKI A;  3PMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...