5F2DA

Crystal structure of staphylococcal nuclease variant delta+phs i92n/v99t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYNYADGKMTNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92N/V99T at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5f2dA00
4B9XA 5KYIA 1SNPA 2LKVA 2PW7A 4RKBA 4S3SA 4N9PA 5CV7A 4DGZA 5KRUA 1F2ZA 1SNQA 1ENCA 3D6CA 4ID6A 1EYCA 3LX0A 4K2LA 5EKKA 1EY0A 2PZWA 3EROA 4KHVA 3R3OA 4DU9A 2F3WA 3QOJA 3SK4A 5C4HA 3DMUA 1SYGA 4HMIA 2O4XA 3ERQA 3MVVA 5CV9A 2SNMA 5IODA 3OMGA 4PMBA 2RKSA 2HQEA 1SNOA 1STYA 2F3VA 2PZUA 3TP5A 1JOOA 3NP8A 5I9PA 4EQNA 2QDBA 4TRDA 1EQVA 3TMEA 2EXZA 1F2MA 2F0VA 2OEOA 2OXPA 2RDFA 4HTHA 4K5XA 4PNYA 1EY9A 2EYFA 4EQPA 4ZUJA 2F0LA 5C3WA 3MHBA 5IGCA 4K8JA 1KABA 1EY5A 4NP5A 3SR1A 1SYDA 3OWFA 2F0MA 1JORA 2F0FA 3T13A 5DAUA 2EYMA 4K8IA 1A3TA 3MEHA 2F0OA 1KDBA 1EZ8A 2M00A 3H6MA 3QOLA 4QMGA 4RKLA 5IGGA 3TP8A 1SYEA 4IUNA 1KDCA 2F0GA 4H7BA 4K14A 5CV6A 4EQOA 5KEEA 2EY2A 1F2YA 4K5VA 4OL7A 5IGDA 2EYHA 4IALA 1ENAA 2F0PA 2KHSA 2NUCA 2SOBA 1SYFA 4K5WA 5JOBA 4NMZA 2F0EA 2PW5A 3P1HA 4DFAA 3VA5A 2PZTA 3S9WA 1TR5A 1STAA 1SYCA 4WORA 3E5SA 5E1FA 4NKLA 5C3XA 2OF1A 2F0TA 5JAVA 4QB4A 1AEXA 5ISRA 2EY6A 4ME5A 3MZ5A 4QF4A 2F0SA 2F0NA 2F0JA 5IGBA 1II3A 5C6AA 4KY7A 1NUCA 4J6HA 4K6DA 1JOKA 4K2KA 2WACA 3TP6A 4J1MA 2KQ3A 3ITPA 3NK9A 4WRDA 3SK6A 2F0DA 2F0WA 3SXHA 3U9OA 5CGKA 5J39A 3MXPA 1EY7A 3D8GA 2F0HA 3RUZA 1KDAA 2ENBA 4F7XA 3NHHA 4KV6A 4DF7A 1A3VA 5HURA 3D4WA 5J1ZA 5I6WA 1SNMA 1SYBA 5I9OA 5C4ZA 1RKNA 5CV5A 5F2DA 1TQOA 4MIUA 3EJIA 1EYDA 1NSNS 3NXWA 3OSOA 4HMJA 3SK8A 5E3FA 1EYAA 1A2TA 1STNA 4ZQ3A 5NUCA 5HGTA 5CV4A 5CV8A 1KAAA 3HEJA 2F0KA 2F0QA 4IZ8A 2F0UA 3DHQA 5IOCA 2EYOA 4NDXA 4G57A 4R8NA 5I6YA 5IGEA 5KYLA 3C1EA 2PYKA 1TT2A 5K5PA 3TP7A 3PMFA 4PMCA 5CR3A 2PQEA 1STGA 4KJOA 2F0IA 1U9RA 3EVQA 3NUCA 3P75A 1JOQA 3D4DA 2EYPA 3BDLA 3SHLA 4LAAA 1A2UA 3C1FA 5EGTA 1IHZA 1STHA 5IIFA 2EY5A 4KD3A 4ODGA 3SK5A 1SNDA 4N9TA 1EY8A 5J22A 4B9WA 2RBMA 4E6IA 5DEHA 3HZXA 4KD4A 1SNCA 4KY6A 1A3UA 2EYLA 5EKLA 5C5LA 5KIXA 4YIJA 4ZUIA 3T16A 2EY1A 2EYJA 1EZ6A 1EY4A 3BDCA 3QB3A 3V2TA 4KY5A 5IGFA 3OMCA 5KGUA 4KTAA 4EVOA 4KJNA 5C5MA 1STBA 1EY6A 3NQTA 5CC4A 5M9OA 4I65A 2SNSA 4F8MA
chains in the Genus database with same CATH superfamily
2UXBL 2A68C 2PW7A 1GM5A 3HOWG 4ID6A 3R93A 3MFYA 3J7ZC 5C44B 4OO1H 1GUOA 3GTKH 4HCEA 2AUJD 1I94L 3JAME 1TKWB 3RZOH 2NTSA 2RKSA 3TP5A 2F3VA 2PZUA 1Q3LA 2SEBD 1B3AA 4HN7A 2RDFA 4TQUS 1X9NA 3HOWB 1JICA 2OQKA 4DR2L 3PUWA 3R2TA 3S1QB 4A3CG 1EFWA 3I4MG 4O42A 3M7GA 1KHIA 2M00A 2LY7A 1DM0B 3K5MA 3SGIA 4YCWA 4CKBA 4FF1A 1SYFA 1B7YB 2VY3A 3A7LA 1KD1C 3P1HA 3HOYG 3GDEA 2YTXA 2PI2A 3Q6SA 4A3EH 1JJ2A 3CU7A 2F0JA 1KLGD 3HOVH 4RCNA 5GAGC 4OO1G 3K5OA 4CGYB 3E3XA 3MAQA 1KL9A 4TVAB 3RUZA 1CSPA 3HOYB 1N32Q 2YYZA 2N55A 1GUSA 1PH1A 2Z4HA 1UE1A 1QZHA 1JWUD 1B9NA 1IBMQ 2JEAI 1HFNA 2XRSD 2K5HA 1V1PB 5BN4A 4XQQA 3NXWA 3LWEA 1YI2A 3J81j 4LF8Q 2KHJA 2K5DA 2JJQA 3W1BA 5D14A 2VUMH 1K73C 1TT2A 1QE6A 4QUFA 2F4VL 1IBKQ 1QUQA 3S17H 1I4RA 1EWCA 1N32L 4A3EG 3HOVG 1O7LA 1ZYRD 2B39A 1HNWQ 1U5KA 2VS1A 2EJGC 3G7LA 5KIXA 1QWYA 3K58A 5FO7B 2MNAA 4LF8L 1U4MA 3IRBA 1BCPB 3KLWA 1C0AA 4A3EB 1EQRA 2WAQG 4F8MA 3HOVB 2B3GA 2I46A 4S3SA 5IY0A 3D6WA 3NWTA 5FOBB 4BBRH 3CCQA 3V96A 4LFBQ 4KHVA 1O78A 1QOHA 1E2WA 3DMUA 3I72A 3TDQA 3VYUA 3FKIH 2VUMG 1HNWL 4RGOS 4PMBA 3GD7A 4M1UB 4P75A 5I9PA 2KVMA 2WAQB 1LUZA 4GNXB 1CM9A 2OEOA 2RSOA 5AFWA 4BA1I 2Q8TA 4EQPA 2E2HH 2HCIA 5ELNA 1DXMA 1OXSC 2EZVA 1WTPA 4A3BH 4OWWB 4FP5D 3RN5A 1JB7A 2VUMB 1TY0A 3I56A 4LFBL 2K7VA 3S17B 1GO3E 4A93H 2OQ0A 3AU7A 3CC2A 1XX8A 2SOBA 5M5XH 3FPPA 4K5WA 1OO9B 5I4DA 4I7ZC 1EUJA 3NTIA 4R4OA 2R92H 3QIAA 5EKIA 1DJRD 4LF7Q 1Q8IA 3MZ5A 4QF4A 3U4VA 3RLOA 5C6AA 2HCCA 4J15A 4OO1I 3FHWA 1KRTA 4BBRG 3U9SA 1Q81C 4JI1Q 1KIXA 4J1MA 2K5QA 3CCRA 2F0WA 3HRZC 3FKIG 2B2YA 1MSGA 4JI0Q 1HUMA 1PLFA 2ENBA 3GTJH 2QCPX 4B3RL 2ID0A 3UE0A 4DA2A 1K3RA 2NZHA 4A3IH 1TQOA 4F87A 1K8GA 3OSOA 2I5MX 4R1JA 5CV4A 4A3BG 4LF7L 1EFID 1QJOA 4LF5Q 1VQMA 2OWOA 3FKIB 2UXDQ 1V1PA 4JI1L 4PMCA 1V9PA 4FF2A 4A93G 1WTWA 1RTOA 3A54A 2E2HB 2N49A 2E2IH 3F2DA 2EYPA 1VQOA 1G91A 1HPCA 4JI0L 1X32A 1FJGQ 2R92G 1XPRA 1N34Q 2AWNA 4A3BB 3GO5A 4OIKA 4E6IA 2NN6I 3CD6A 2K03A 5GAHC 1BCPC 2EYLA 3I4NH 4Z9CB 3T16A 5E4WC 4A93B 1EY4A 1TWFH 5M5XB 4KTAA 3KF8B 2VQFQ 5EQ0A 2UXDL 2D2CC 2R92B 5ELOA 1K8AC 3VA7A 3CCUA 2Q2TA 1C8CA 4A3IG 2YTVA 4DV0Q 4AH6A 1FVIA 1N34L 1L0XB 2VW9A 2DGYA 2RCNA 2OCEA 4QY7A 2O4XA 5CV9A 1OXUA 1G8ZD 3GTJB 4P2CB 4EQNA 1F2MA 4V190 4A3IB 4JVZA 3K7UC 2QGQA 5JJLA 4X3TA 1N36L 2IX1A 1PH8A 1Y1VH 1VCIA 4DAMA 2ES2A 1JORA 4DV0L 4GNXA 3H6MA 3DM1A 3K81C 3I4NG 1DZ1A 1J5EQ 5IWAQ 2XVSA 2RDGA 3CRKC 1EU3A 1FYCA 2E2IB 1BOSA 4DFAA 4LF4Q 2RF4A 3A0JA 2PI2E 3NTKA 4V0BA 5IGBA 2A6ED 1RL2A 1SJHD 3I4NB 4MZ9A 2F03A 2BA0A 3AQQA 4FDBA 4P72A 1IL8A 2A6HD 1TWFB 1E1OA 3K0YA 4XQNA 5EPKA 2FFKB 1X56A 3W2DA 3T56B 1BNZA 3DXJC 1YNXA 1J5EL 5IWAL 3E0JA 4MN3A 4GLVB 1GUWA 4A3KH 3GQBA 3GTPH 4DNTB 2ATWA 4LF4L 1Y1VG 1R4QB 3E0EA 1IKMA 4DK6C 2F0UA 2RDHA 2ZXRA 3H94A 4NDXA 4CJ2C 2TMPA 2R6GA 1K3BC 2PYKA 5C0XH 3K59A 4Y52H 1PMRA 1STGA 4DR1Q 2PMZE 3PV0A 3U58A 1I5FA 2HT1A 4YWKA 5A2QE 4JBMA 2EVBA 1VQ6A 1UNSA 2V4DA 3UDFA 3OMCA 2X6LA 5DM63 5JJIA 5LMUQ 3A8IE 3TS0A 1MKHA 2B2VC 4HSVA 4DR1L 1C7YA 1YJ9A 3IFTA 1WI5A 3OIPA 4QQBX 1TXYA 4LWCA 3J81i 2BCOA 1N33Q 2PZWA 3EROA 4HJ7A 2QDLA 4YWLA 3RR5A 1XMQQ 1VDZA 5C0XG 2PQAA 2I5HA 1JE5A 4X66Q 1PH4A 4A3KB 3GTPB 2JYOA 1C48A 3KDFB 4A3LH 3PIP3 2VNUD 1D8LA 2LMCB 4GLXA 5HY6A 2QEXA 5LMUL 3CW2C 5DAUA 2E74C 5IGGA 2ZXOA 3KF6B 3TP8A 3CCSA 4YCUA 1N33L 1YVCA 5JOBA 1XMQL 1S5CD 4GLAC 3A8JE 3OW7A 1LTTD 4J6HA 2WACA 2F1MA 1IZ6A 5JVG3 2PCFB 5DLQE 1SROA 3JC66 5FLXL 1L1OC 1EY7A 2UUCL 4G7HC 2RA4A 1NAPA 2H1EA 3DWAA 4JYAQ 3MFGA 4DXGA 1SE2A 1HTPA 4QUCA 1EIYB 4MIUA 2CH4W 3TN2A 2QF7A 3SK8A 4CHTB 4GKJQ 4ZQ3A 2DJGC 4R8IA 1O80A 1YHQA 1Q7YC 2EQSA 3EN2A 3OTOQ 3J80L 1DOLA 2YU9H 1CQVA 4OEMB 4DV2Q 3L9AX 2LFNA 1STHA 4JYAL 3A74A 1RODA 4DV4Q 1XWEA 4DN4M 4KHPQ 4ILWA 3M7NA 4LF9L 5C5LA 3WOFA 4GKJL 4GZYC 5LL6X 3A8KE 4DKAC 1DYQA 2K52A 2B2UC 2ZTCA 2B63H 4KHZA 5CBAE 4X3UA 3HKZG 2IL8A 3CCVA 1X54A 2DNEA 3A7AB 5LL6S 1SE8A 1FD7D 3A5ZB 1PRTB 4IPCA 1I6HH 3D0FA 3OTOL 5BN3A 3LWUA 4M8AA 4BA2I 1WYDA 4G7ZC 4NW2A 4DV2L 2A74C 1XNRQ 2B2WC 4K2LA 5JEAJ 2FMCA 4DV4L 1WJJA 4B3MQ 4KHPL 3I4OA 4FF3A 5C0XI 1Y69U 1PFBA 2N78A 3HKZB 1SN8A 1Z7TA 4TRDA 4L6TB 1SE4A 3H3VH 1S4ZA 1QB5D 4FVMA 3MTSA 2FJ2A 1AH9A 5J3BA 2IHFA 4JV5Q 2WAQE 2F0OA 2GVAA 4IUQA 4QMGA 3KDFA 2AMCB 2AUKA 4IUUA 5CV6A 1CKOA 4LNQA 4B3ML 2B63G 4PZ6A 5IGDA 5JEAH 4IALA 2A68D 3L2PA 2YU9B 4NMZA 1S72A 4GKKQ 3E9HA 2MQHA 4RGTA 1F2LA 3G48A 4ABNA 3FVQA 2OF1A 2NVXH 4QB4A 1DOKA 4ZKBB 4DR4Q 1GVPA 5ELCA 1EIHA 4B3TQ 1M4VA 3L0OA 2K5VA 4K2KA 1Z9FA 3ONAB 4JCVE 1Y1WH 5AJ3Q 1I3QH 1E7ZA 2B63B 2Q8IB 4JV5L 3VYTA 4UAIA 4DAYA 3AFPA 5CMDA 1A3VA 1SMXA 1I6HB 1AFPA 3U4ZA 4GKKL 1FNUA 1EYAA 1A2TA 1VQBA 1K0RA 2K05A 2XNAC 3FEWX 2NWGA 1GUGA 4DR4L 4L5RC 4B3TL 2N3SA 4CJ1B 5AJ3L 1QVGA 2ZXPA 5JEAG 4O0AA 1ZEQX 3P75A 1VMPA 2NVQH 1IYVA 3IFDA 2A5HA 1SBBB 3TZUA 1VF5C 1TIID 3J81E 3S1MH 4JOIC 1FNWA 2A73B 1I6VC 2G9DA 4LUOA 4RFBA 3EA6A 1ONLA 1JMCA 1CKMA 1Y1WG 1SSOA 1K28A 2MJ8A 1YITA 1R4PB 3QB3A 5IGFA 4JBWA 4C3JH 4CJ0B 4RGMA 4X3SA 5C5MA 2XIWA 2NVXB 1BF4A 4J8QA 1N8RC 3JAML 1SXTA 4N9PA 1AP0A 1SNQA 1EOTA 1VQHA 2H4OA 1Y1WB 4O2DA 3CF5A 2BDNA 4DU9A 2DY8A 5C4HA 3S14H 4HIKA 1CI3M 3ERQA 2QKIC 3OMGA 2JA9A 4OHJA 1RIPA 4IPDA 1D1IA 2KEDA 4HEDA 2I5LX 4QIWB 3C3LA 4K5XA 5EJWA 4C3IH 3ERSX 1LTAD 4JW0A 2K6AA 1FGUA 4K0KQ 3H91A 4K8JA 1KABA 4APVA 1SEBD 1XTCD 3SE0A 4HJAA 5D3DA 1UE7A 4RKLA 2B8FA 1SYEA 4JI5L 2ICIA 2DN8A 1F2YA 1H9RA 4C3JG 2NVQB 4NXNL 3S9WA 4BXXG 1L2FA 3NBHB 4LW1A 3S1MB 2EIFA 1MSHA 3D3RA 1ILPA 2X69A 1NMGA 4RAUC 3M4OH 4K0KL 4R4CA 3TREA 2F0DA 3SXHA 4C3JB 2QA4A 5M3FH 4JI8Q 3D8GA 1HTLD 3I3CA 1IL2A 3OOCA 1IBLQ 1VQCA 1SNMA 1HRJA 1ET9A 4R4IA 4HMJA 4WJWA 3PQIA 1X55A 3F8TA 2F0QA 4OXPA 4CDEC 3S14B 4U68A 2GA4B 2Z9HA 1PYWD 4HCSA 5M5YH 3C1EA 2KJXA 4RHRA 4UPAA 4QL5A 4KJOA 2F0IA 1JOQA 4C3IB 1K0SA 3GTQH 4JI8L 2ASBA 4OONA 1CUKA 5EGTA 1M1KC 1JE4A 4KKTA 4TKOB 4HJ5A 3Q8DA 4IN3A 5KNDA 2VB3X 5I2YA 3BDCA 3E9IA 5M3FG 4IUVA 3DLLA 1SRUA 4DR3Q 1AZPA 1DD2A 3BYYB 1A15A 3D31A 1HXYD 1NCVA 1H9MA 3FMCA 3M4OB 3KOJA 2FMMA 1QZGA 2HHHQ 2JA6H 2A1AA 1PTOF 2AQ2B 4GN5A 4LF6Q 4RG1A 1TS4A 2ALYB 3QOJA 5M3FB 1IBML 3S15H 1A8VA 1V1OA 2UUBQ 2OXPA 1Q46A 2LXJA 1PYSB 3QG1A 1BCPD 1K83H 4HSPA 1G291 4DR3L 1SYDA 1RDPD 3T13A 1IBKL 2O5IC 3MEHA 5M5YB 3X3NA 4PQXA 5ELBA 2JK8A 4DPGA 5FLXc 2HHHL 4A4IA 4LF6L 2OTLA 3ND9A 3AEVA 3GTQB 1KLUD 4HJ9A 1YHBA 2RQXA 1TR5A 2UUBL 4XT3B 1LO5D 2IT1A 1EYGA 1JOKA 4DK1A 2JA6G 3P20A 1CTMA 1CA6A 3NBHA 4DR7Q 1XNQQ 1W6JA 1E2ZA 3PSIA 3I2ZA 3J80c 5I2XA 5HURA 4F88A 2IJ0A 2B2YC 5F2DA 3PO3H 3IKJA 2JA6B 2F0KA 3VR5A 1VQEA 3S15B 1EOVA 1VQJA 3WDNA 4DR7L 5IT9E 3AFQA 3D4DA 4IUTA 3W5OA 2R7FA 3S1RH 1K83B 4ZAIA 1B2TA 3CHBD 1LTBD 1MD2D 4RWSC 4P71A 4A3MH 1YZ6A 3NE5B 2CHBD 2WKCA 4JI6Q 3PCOB 4JI2Q 1ML0D 1K8MA 1YNNC 4H13C 2VQEQ 1PRTF 5HGQA 2A19A 1HH2P 2R7DA 3NSWA 4YHHQ 3KLSA 1ICFB 2KEEA 1WCMH 3NELA 1LYLA 3ICEA 2HD3A 2AKWB 1NR4A 2CQOA 2CFMA 1A62A 3FPUB 2Z6KA 4JI6L 3C2PA 4ZKCB 4JI2L 4LUZA 2M2LA 3SEBA 1U4PA 2VQEL 2F0VA 4RGNA 3QR8A 4LF5L 3PO3B 1EY9A 1FGBD 5C4JH 1QNUA 1HCZA 4YHHL 1EY5A 3HKZE 1LTLA 1Q12A 2L4NA 1Y8OB 4DK3C 3OW2A 2EYMA 1B53A 4K8IA 1EQQA 1KDBA 3QOLA 2PQAB 2WIIB 2JEBI 3VYRA 1FJGL 2JXMB 4A3GH 1KTKA 1PH7A 3BDOA 1VQKA 4RA8A 2EYHA 4GNXC 3I55A 3S1RB 2QILA 4KN4C 4XT1B 3VA5A 1FNVA 1VQLA 1STAA 2LSSA 4FYDA 4WORA 5E1FA 4X64Q 1HZ9A 1CHPD 1WCMG 2B8GA 1QG7A 1KRSA 1II3A 4A3MB 3K80C 2YV5A 1IKLA 1CQFA 4CDCC 3BYTB 2VQFL 3RD4A 4N8X1 1LV9A 5CGKA 5G3LD 3A5UA 1OXXK 4GN4B 1WCMB 3Q24A 5FJ8H 3EJIA 1WVLA 2KECA 1STNA 2MUYA 1EIGA 3TEHB 4X64L 3CCMA 5IOCA 4KI0A 2FXQA 3ND8A 2G5DA 1E3PA 2HIXA 5C3EH 5A2QL 3FDTA 2ZM6Q 2I0QA 1U9RA 3JAMc 2EDGA 3CC4A 3HOZH 1CHQD 1AE2A 5C4JB 4XXEA 1QNKA 1WTQA 1IHZA 4GOPA 1PTOH 1D5MC 2Q2UA 1Q86C 1TS2A 5ELFA 1AE3A 4A3GB 4YIJA 1LTID 1R9TH 1A63A 2K28A 5M5WB 1CZGA 5L37A 2CWAA 3H0GH 3PIO3 4Q5VA 2R93H 1EWIA 2ZM6L 3KJPA 4A3FH 1GHJA 2FINB 5KYIA 5FJ8G 3MA2B 5JVH3 2XTIA 4EQ5A 1JR0D 1B9MA 3GP7A 3AMUA 2PNRC 4QJFA 5EBDA 3PUVA 5C3EG 3I73A 1DGSA 3A55A 1QVFA 2RCFA 1ET6A 1PH5A 1PHJA 3HOZG 1SLJA 1MBYA 2VZAA 4ZUJA 3CKIB 4HJ8A 2BDOA 3OIQA 4NB3A 1PH3A 1LT6D 2L12A 4X62Q 2F0MA 2SDFA 5CORA 4A3KG 1JQYD 5EPLA 1EZ8A 4QIWE 4IFDJ 2L0CA 1KXLA 4WFN3 5C3EB 1VQFA 2F0GA 1IYJB 4LFAQ 1ASYA 3HOZB 4XYQA 5BR8Q 1ENAA 3CPWA 3BG3A 4NPSA 3H0GG 2GN5A 2ZJPA 1VQ5A 1NR2A 2MO0A 1E24A 5JAVA 4TSSA 1PTOB 1SAPA 3MXGA 4IURA 3CP0A 4KMUC 3I4LA 1R9TB 4X62L 1EEFD 1D5XC 4IPHA 1V8QA 3H0GB 1G6ZA 4IOAA 3NHHA 4IFDH 2R93B 4XDXA 4A3FB 1TWAB 4DV1Q 4LFAL 5I9OA 4CBVA 3LNNA 3W1GA 1ASZA 1IYUA 2GVBA 5FK9C 2AQ3B 3PGZA 4X66L 3S1NH 1TWCB 4XIGS 4R8NA 4C2MH 4DAYB 5I6YA 1UEAB 4A76A 3T51B 5K5PA 1S5DD 2F4IA 3UE1A 4EGVA 2XGTA 2JP1A 2E76C 2HIVA 1HUNA 1F9RA 3C1FA 3K7AH 3ER0A 4CKCA 4ODGA 4DV1L 1EY8A 4C1NI 4A3LG 3HZXA 4IJLA 5K36H 3RLFA 1RTNA 2E75C 4ME3A 2ZT9C 2K4KA 1EEID 5ELEA 2RVLA 3J7AF 4AYBB 5A35A 2JA7H 2KUMA 3KLRA 1HR0Q 1STBA 1ENFA 3EQLC 3OYYA 4B9XA 1WOCA 1K8OA 3K57A 1ENCA 2NVYH 1J8IA 1GHKA 5T1GA 2A69C 3TRZA 4MHEA 1BKBA 3SK4A 5DNFA 2OT2A 1LTRD 4RCOA 3GTMH 2IHEA 3IL8A 4L5SA 1O7IA 2QDBA 3NWSA 3AB9A 4AIMA 5IP7H 2MHVA 1HR0L 4Q0FA 2CQAA 3K6OA 3VYSA 4NP5A 3SR1A 1PRTD 4HIDA 3S1NB 4UY8C 5K36G 4C2MB 4ULLA 5JPNC 2Q8RE 1PTOC 1VQ4A 1MIUA 2F0PA 2JA7G 2F52A 3K7AB 1PV4A 1P16A 2EJMA 1CA5A 2JA8H 1VQIA 1KQSA 2F0SA 3F1ZA 3URYA 5C4XH 1P8LA 3KBGA 2K5NA 1YEZA 3M4YA 3U9OA 1F9PA 1Q1EA 1TWGH 2JA7B 1XXGA 2AWOA 3VR6A 2F0HA 3N52A 3KJOA 1IW7C 4DF7A 4R9WA 3ZYYX 2Q2HA 1XNRL 3M3YH 1HNXQ 2L11A 5IP7G 3J7AV 4ZLTF 4XTCS 2NVYB 3BZDB 3D4RA 3S16H 1TS3A 3GTMB 3K0XA 4G57A 3J81L 4JK1C 2N8NA 4GN3B 1E22A 1G2TA 1D1KA 1XTDA 4JI7Q 1HQRD 4ALPA 3S24A 2JSOA 1H9JA 1VQGA 5FLMH 2LXKA 2JA8G 4LMQD 1H95A 4HIMA 4FXGC 3Q0AA 1FR3A 2CVRA 5DEHA 4KD4A 4JG2A 1VQNA 5C4XG 1VQ9A 4KY6A 3EIVA 1G6PA 1EZ6A 1HFGA 1X65A 3HFZB 1WTXA 1NTGA 1FL0A 4PZ7A 1YHAA 1ICWA 2X6GA 5CC4A 2Y0SG 4I65A 2JA8B 1Y14B 2K32A 5EBCA 4JI7L 4DUYQ 5C4XB 3K5LA 1EYCA 1UE6A 2Z1CA 4P73A 4YCVA 1SMYD 3NTHA 4RHSA 1BBUA 1TWGB 2F3WA 1ILQA 3MVVA 1XYIA 4BBSH 3PUXA 3M3YB 1SNOA 3HGBA 4DNIA 2K1BA 2Y0SB 1PRTC 1TU2B 4JBJA 1KC8C 4ZYSA 2C5CA 3BU2A 1C4QA 3S16B 1D5ZC 3QJYA 1WTOA 1IXRA 5M9OA 2KHSA 3PUYA 3MXNB 5JPMC 3CCLA 3PF4A 1UWVA 5ISRA 1CKNB 2P5ZX 3A56A 4BY1H 4ME5A 4LJZC 4A75A 2R61A 3N6RA 1T5XD 2KOLA 1RF2D 3K5NA 5T1IA 2FHTA 4BBSG 4C1NK 1G51A 4UDUC 3F2UA 5I6WA 3CMAA 4A3CH 1GOZA 4N8FA 1SYBA 4X3KA 5C4ZA 1HR0W 1RKNA 2B2TA 4B3SQ 3RZDH 1I4QA 1NSNS 2BH2A 2K01A 4YY3Q 1PZKD 5NUCA 4LUVA 3O13A 1LT3D 1QCBD 1PH6A 2R7ZH 5IGEA 4BBSB 1XMOQ 2WB1E 5IP9H 1J9OA 3PMFA 2DJFC 3EVQA 1QVCA 1RCVD 1CZWA 4LAAA 2VL6A 3OHXC 4BY1G 3H3VI 2CWPA 4B3SL 2D0PA 4C3IG 1H9KA 1V1QA 3I7FA 4YY3L 1Z6HA 2MP1A 3R2IA 3I8ZA 4QCLA 3H3VC 4H0LC 2NB0A 1XMOL 4OGQC 4BY1B 4QGUA 3UDIA 4MNOA 1SMYC 2YTYA 2C35B 1LLRD 4YWMA 5KRUA 3HS0C 1VF7A 1NNXA 1ZKOA 1B44D 1U4LA 3DM3A 3AYHB 1RHPA 4HAEA 1IBLL 4NXMQ 1PA6A 2R7ZG 1X3QA 1QILA 1S5BD 5IP9G 3PUZA 4DAPA 2HQEA 1BUVT 1PZID 3TMEA 3I4MB 2EXZA 3CCEA 1Q8KA 3UDGA 3RZDB 4PNYA 1BDOA 1SE3A 5CBEE 2D5DA 2F3IA 2NN6H 3KUPA 2F4VQ 3MHBA 1YNND 3TSSA 1LTGD 2F0FA 1EWHA 1OXTA 2R7ZB 3BVZA 4GS3A 1JJGA 5KEEA 2CH4A 5COYA 1PFNA 4NXML 4OL7A 2IY5B 2NBFA 3RMHA 1JT8A 3MEFA 3GTKB 4NKLA 5JJKA 3EBEA 1AEXA 3QWNA 4ZCKA 3G71A 1X3EA 3RZOB 2WFWA 1H9SB 5TSSA 1NUCA 4B08A 1PYBA 1B50A 4K6DA 3MXNA 1LT4D 1B3QA 1AN8A 3SK6A 4IJHA 1CKNA 4DV7Q 5IYBH 3QO2A 1YIJA 1PFMA 1V43A 1W6KA 1A0IA 4L8JA 1TWHH 5H1SE 1DONA 2NN6G 4KK7A 4UP9A 2PPBC 1S5FD 5EAYA 5M3MH 5IT9L 5ELDA 1N9WA 4R4QA 4IZ8A 2EYOA 3OPOA 3RLNA 1NMFA 2WV6D 3VDYA 2XWJB 1M8AA 1MJCA 4PMWA 4DV7L 2L1BA 2DUDA 2EY5A 1GXDC 4OIJA 3WOEA 1B4OA 4R4TA 1WTRA 5EKLA 1GUNA 1XPUA 1KNAA 1CFMA 5IYBG 3V2TA 4CDFC 1PVOA 3GTGH 3BZKA 2IWHA 1EL0A 1SFOH 4EVOA 4GOPB 2ZJQA 4JI3Q 1UEBA 3ULPA 1JB3A 3J7YW 3TS2A 4DGZA 1XNQL 2J0TD 1T5EA 4HR7B 4AYBE 5M3MG 4B3RQ 1D2BA 5GAEC 3STBD 3ZJYC 4HMIA 4UHVA 1GD7A 3DUZA 1TWHB 3TZDA 4KLKA 1L0WA 4IUPA 3UI2A 4MTNA 5CR3A 1MHWC 2Z6KC 2EYFA 2F0LA 4DK0A 5M3MB 4JI3L 3OWFA 1TY2A 3PO3G 3FP9A 3Q23A 3NENA 4ZRZA 2ICEC 1KDCA 4H7BA 5D65A 2XWBB 3ULLA 1DOMA 1YNJD 3DEPA 2RHSB 4C56C 4BBRB 2RSNA 3PO2H 1VQAA 1SYCA 1YJWA 3E5SA 1Y8PB 2EOTA 4O1NA 1SJED 2E2DC 1BQQT 1ZXTA 3T53B 3J81c 1NE3A 3ITPA 3I70A 3T4AC 5IE8A 2IX3A 1K9MC 1ZYRC 2EXDA 3GTGB 3FRPB 4A3MG 1SFOB 1H9SA 4JI4Q 3PIOA 5J1ZA 4P74A 4DNRB 1HZAA 4FXKC 2H5XA 5M5WH 3KK7A 1JC7A 5HGTA 1VQ7A 5CV8A 4JBKA 4DAVA 1N36Q 1OXVA 2WB1G 2Z0SA 3Q22A 5LMNQ 1E0BA 2L5TA 3NUCA 2UU9Q 2KCTA 3PO2G 3V05A 3SHLA 2WKDA 1I50H 4KKUA 4BWGB 4ZK9B 4JI4L 4KD3A 5J22A 3CC7A 5DM73 2VB2X 3W3AA 5FKAC 4GOPC 2WB1B 1GKHA 3X3MA 2O5JC 4K6LA 3SDZA 4DV6Q 5KGUA 3H09A 1B1ZA 3S2DH 2WP8J 4LK1C 1VQPA 3PO2B 2M9VA 2K50A 1JCKB 1EY6A 3L3OC 5LMNL 4A3GG 4LFCQ 1KAWA 3IAYA 3H15A 4BY7H 3STBC 5CV7A 2UU9L 1A6XA 3D6CA 5EKKA 4DUZQ 5E7NA 3LX0A 3PIPA 1I4XA 2ZJRA 2O2LD 3KFUA 1F9QA 1CSQA 3S2HH 4L63B 3J80i 2K04A 2SNMA 3CRLC 4XQJA 2JQOA 3NP8A 4DV6L 1CT1D 1EQVA 3M85A 5C0XJ 4FXDA 2WINB 1G2SA 2K75A 4I7AA 2KBNA 2BOSA 1RJTA 1KNEA 2PNHA 2I07B 4LFCL 2HQLA 1STEA 1ESFA 2BA1A 1VQDA 1XJVA 2Y0SE 1TWAH 2L9HA 4PV1C 1F9SA 1YNJC 4DUZL 2C9OA 3CQZH 1J6QA 2EY2A 4K5VA 3G4SA 1L1OB 1I50B 2F0EA 4RH6A 4Y7NH 1TWCH 3E6ZX 1LM0A 5C3XA 4BY7G 5D3IB 2A69D 1O7YA 1PXUA 1HNZQ 1MI2A 3MXUA 2J7ZA 4A3JH 1JWSD 3TP6A 5CYUA 3WWVA 1Q82C 4FNFA 4OWTB 4WRDA 3S2DB 3C46A 2CKZB 2E2JH 2BE5D 4POGA 1Y1VB 4EX5A 1X3PA 1I4GA 4KV6A 4F7XA 2NTTA 4BY7B 5FO8B 1VQ8A 1EQTA 2HUGA 3KLSX 1VMCA 2K5WA 3I90A 5KNCA 5E3FA 5GQOA 1PTOD 1KAAA 2R93G 2E8GA 1BVSA 2G9HD 1O7ZA 3HKSA 4A3FG 1I4HA 1HNZL 5E4XA 3S2HB 2Z6BA 1HHVA 3VR2A 4XYOA 3CCJA 1JWMD 3U50C 5JJZA 3BVMA 3DEOA 3OWEB 1WTHA 3KF8A 1X6OA 1C9OA 1A2UA 1HA6A 5IIFA 3HOUH 2JE6I 3SK5A 4B9WA 1BBWA 1SDFA 4A3JG 2KENA 4C3HH 5BR8L 1SNCA 3SVMA 1GJXA 3M4PA 4OX9Q 3CQZB 2QEJC 1IW7D 4POFA 1MJEA 2XSCA 2EY1A 4PZ8A 2V1CC 2B2VA 1UUPA 2AQ1B 4Y7NB 3M4QA 1HZBA 3PF5A 3BZCA 1E1TA 2HDMA 4AYBG 4RKBA 4A3JB 3F2BA 2UUCQ 1AW7A 1F2ZA 2HDLA 1DCZA 3R3OA 1MGSA 4DR6Q 1Z47A 2A6EC 2E2JB 2JN4A 4KN7C 2J4XA 4IQZA 5IODA 4OX9L 3NBIA 2A8VA 4X6AH 4OELB 1JOOA 2A6HC 2KA7A 5LHY1 1PZJD 1TVXA 3BJUA 1E2VA 5C3WA 3RN2A 2EE1A 3HOUG 4IFDG 3DWQA 4L5TA 3GTOH 4C3HG 1A3TA 3VR3A 1UE5A 2Z8LA 5IYCH 2NVTH 2Q2IA 3VR4A 4EQOA 2B29A 2K33A 3HG9A 3JAMi 3T1YQ 4DR6L 2NUCA 2MGSA 4LF9Q 5LMNW 2PZTA 4DV5Q 4DR5Q 3HOUB 2DY7A 3HOXH 2F0TA 1NBWA 2N88A 4H02A 4JPBW 5IT9c 2F0NA 4C3HB 4KY7A 2BH8A 3CMEA 3KBXA 1L1OA 1VS0A 2BE5C 2XN9C 1PH9A 4CKEA 2NYZD 3G6JB 4L5QA 1JJCB 1X3FA 2DNCA 3MXPA 1OTCA 2TSSA 1EIFA 1KDAA 3GV3A 3BS1A 4WJ3M 2L55A 3D4WA 2L15A 1EU4A 2VXWA 4AQYQ 3MC0B 4H44C 3F2CA 5GADC 3T1YL 2MO1A 1TS5A 4PG3A 1BCPF 2AHOB 3BVGA 5FLXE 4DV5L 3EFXD 4DR5L 1CK1A 2ZTDA 3HEJA 1NY4A 4BS9A 1HZCA 3DHQA 5IYCG 2K14A 3HP3A 3TP7A 4G4KA 1NJIC 3TQYA 3T1HQ 2EJFC 2PQEA 1M90C 4FO2A 2CW0D 2UXCQ 1S3OA 2KCNA 2KCCA 2UUAQ 1S5ED 3HOXG 4RMFA 2KCMA 2OTJA 3GTOB 2JA5H 4AQYL 1SNDA 3CXCA 2RBMA 1XPOA 2NVTB 2B2UA 3J80E 4OWXB 5GROA 1A3UA 2D0OA 1Q90A 3LGJA 4X65Q 3ULJA 3KYHC 3CPFA 3R8BA 4KY5A 1PFSA 1U4RA 4WJ4A 3MWYW 4IOCA 3GV6A 1F77A 4CDDC 1Q1BA 4MTKA 3NPPA 4UP7A 3M9BA 3HOXB 2B2WA 4KKSA 2SNSA 3T1HL 1YJNA 1SNPA 2LKVA 2UXCL 2UUAL 3B6YA 1PH2A 2NZ1D 2MFIA 1LACA 4A3DH 1EY0A 3CAMA 1GUTA 2E5LQ 1D7QA 3NQIA 1HNXL 2IPKD 1I4PA 1SYGA 1RD9D 1HA5A 3KF6A 3UDXA 1BO0A 3GTLH 4X65L 1LT5D 1STYA 2Z4IA 4HTHA 4IFDI 2EPBA 4UP8A 5IGCA 2JA5G 4FF4A 3L7ZC 1BR9A 3DWPA 1T9HA 1B70B 1X3GA 4IUNA 4K14A 2E5LL 3P7JA 5IYDH 5BN5A 3RNUA 2XRQD 1BXTA 2PW5A 1ESRA 1SR3A 2JA5B 2EY6A 1U0LA 4A3DG 5FLMG 2PO4A 2KQ3A 3NK9A 5C44H 2R3ZA 5KNBA 2D9UA 5J39A 4G7OC 4DUYL 1WTVA 1YBYA 2RHQB 2CCZA 1LTSD 1HQMC 2KHIA 4DV3Q 1LABA 1L0YB 4U673 3I91A 5CV5A 4IPGA 3K8AA 1EYDA 3HOWH 2D62A 1HJPA 4A3DB 1QUQB 2PMZB 4JC0A 3S1QH 1S40A 1B8AA 2B2TC 1WD1A 2CW0C 2QW7A 5KYLA 3GTLB 4BXXH 4IO9A 3TBIB 5FO9B 5IYDG 1D6EC 4JOIA 1WD0A 2UXBQ 3BDLA 2IX0A 4DV3L 4JI5Q 1I3QB 4HIOA 4N9TA 2LS01 1I94Q 2MPMA 4NXNQ 2NZOA 3I4MH 4DXFA 1Y8NB 3NEMA 3G6EA 1UAPA 2ZTEA 1W3SA 3J7A5 5C44G 4ZUIA 5EPJA 2EYJA 1AZQA 5G3LF 2IW3A 4KJNA 4DR2Q 1BBXC 3NQTA 3HOYH 1PDQA 1W2BA 1WFQA
chains in the Genus database with same CATH topology
2A68C 2PW7A 4ID6A 3R93A 3MFYA 5C44B 4OO1H 1GUOA 4HCEA 2AUJD 3JAME 1TKWB 2NTSA 2RKSA 3TP5A 2F3VA 2PZUA 1Q3LA 2SEBD 1B3AA 4HN7A 2RDFA 4TQUS 3HOWB 1JICA 3PUWA 3R2TA 3S1QB 4O42A 3M7GA 2M00A 2LY7A 1DM0B 3K5MA 4CKBA 4FF1A 1SYFA 3A7LA 3P1HA 3Q6SA 3CU7A 2F0JA 1KLGD 4RCNA 4OO1G 3K5OA 4CGYB 3MAQA 3RUZA 3HOYB 2YYZA 2N55A 1GUSA 2Z4HA 1JWUD 1B9NA 2JEAI 1HFNA 2XRSD 1V1PB 5BN4A 4XQQA 3NXWA 3LWEA 2K5DA 5D14A 1TT2A 1QE6A 4QUFA 1I4RA 1EWCA 1O7LA 1ZYRD 2B39A 2EJGC 3G7LA 5KIXA 1QWYA 3K58A 5FO7B 1U4MA 1BCPB 4A3EB 4F8MA 3HOVB 4S3SA 2I46A 3D6WA 3NWTA 5FOBB 3V96A 4KHVA 1O78A 1QOHA 3VYUA 1E2WA 3DMUA 3I72A 3TDQA 4RGOS 4PMBA 3GD7A 4M1UB 5I9PA 2KVMA 2WAQB 1CM9A 2OEOA 2RSOA 5AFWA 4BA1I 2Q8TA 4EQPA 2HCIA 1DXMA 1OXSC 2EZVA 1WTPA 4FP5D 2VUMB 1TY0A 2K7VA 3S17B 3AU7A 1XX8A 2SOBA 3FPPA 4K5WA 1OO9B 5I4DA 4I7ZC 3NTIA 3QIAA 5EKIA 1DJRD 1Q8IA 3MZ5A 4QF4A 5C6AA 2HCCA 4OO1I 3U9SA 4J1MA 2K5QA 2F0WA 3HRZC 2B2YA 1MSGA 1HUMA 1PLFA 2ENBA 2QCPX 2ID0A 4DA2A 1TQOA 4F87A 3OSOA 5CV4A 1EFID 1QJOA 3FKIB 1V1PA 4FF2A 4PMCA 1WTWA 1RTOA 3A54A 2E2HB 2EYPA 1G91A 1HPCA 1X32A 2AWNA 4A3BB 3GO5A 4OIKA 4E6IA 2NN6I 2K03A 1BCPC 2EYLA 4Z9CB 3T16A 5E4WC 4A93B 1EY4A 5M5XB 4KTAA 5EQ0A 2D2CC 2R92B 3VA7A 1C8CA 1L0XB 2O4XA 5CV9A 1OXUA 1G8ZD 3GTJB 4P2CB 4EQNA 1F2MA 4V190 4A3IB 4X3TA 2IX1A 1VCIA 1JORA 3H6MA 3DM1A 1DZ1A 2XVSA 2RDGA 3CRKC 1EU3A 1FYCA 2E2IB 1BOSA 4DFAA 3NTKA 4V0BA 5IGBA 2A6ED 1SJHD 3I4NB 2F03A 2BA0A 1IL8A 2A6HD 1TWFB 3K0YA 4XQNA 5EPKA 2FFKB 3W2DA 3T56B 1BNZA 3DXJC 3E0JA 4MN3A 1GUWA 3GQBA 4DNTB 1R4QB 1IKMA 2F0UA 2RDHA 2ZXRA 3H94A 4NDXA 4CJ2C 2TMPA 2R6GA 2PYKA 5C0XH 3K59A 1PMRA 1STGA 3PV0A 5A2QE 2EVBA 1UNSA 2V4DA 3OMCA 2X6LA 5DM63 3A8IE 2B2VC 4HSVA 3IFTA 3OIPA 2BCOA 2PZWA 3EROA 1VDZA 5C0XG 4A3KB 3GTPB 2JYOA 1C48A 3PIP3 2VNUD 2LMCB 5DAUA 2E74C 5IGGA 2ZXOA 3TP8A 5JOBA 1S5CD 3A8JE 3OW7A 1LTTD 4J6HA 2WACA 2F1MA 5JVG3 2PCFB 5FLXL 1EY7A 4G7HC 2RA4A 1NAPA 2H1EA 3DWAA 3MFGA 4DXGA 1SE2A 1HTPA 4QUCA 4MIUA 3TN2A 2QF7A 3SK8A 4CHTB 4ZQ3A 4R8IA 1O80A 3J80L 1DOLA 1CQVA 3L9AX 2LFNA 1STHA 1RODA 1XWEA 4DN4M 4ILWA 3M7NA 5C5LA 3WOFA 4GZYC 5LL6X 3A8KE 1DYQA 2B2UC 4KHZA 5CBAE 4X3UA 2IL8A 2DNEA 3A7AB 5LL6S 1FD7D 1PRTB 5BN3A 3LWUA 4M8AA 4BA2I 4G7ZC 4NW2A 2A74C 2B2WC 4K2LA 5JEAJ 2FMCA 4FF3A 5C0XI 1Y69U 1PFBA 3HKZB 1Z7TA 4TRDA 4L6TB 1SE4A 1S4ZA 1QB5D 4FVMA 3MTSA 2FJ2A 2F0OA 4IUQA 4QMGA 2AUKA 4IUUA 5CV6A 5IGDA 5JEAH 4IALA 2A68D 2YU9B 4NMZA 4RGTA 1F2LA 4ABNA 3FVQA 2OF1A 4QB4A 1DOKA 4ZKBB 5ELCA 1EIHA 1M4VA 4K2KA 3ONAB 2B63B 2Q8IB 3VYTA 4UAIA 4DAYA 5CMDA 1A3VA 1I6HB 1AFPA 1FNUA 1EYAA 1A2TA 2K05A 2XNAC 3FEWX 2NWGA 1GUGA 4CJ1B 2ZXPA 5JEAG 1ZEQX 3P75A 1VMPA 1IYVA 3IFDA 2A5HA 1SBBB 3TZUA 1VF5C 1TIID 3J81E 1FNWA 2A73B 1I6VC 2G9DA 4RFBA 3EA6A 1ONLA 1SSOA 2MJ8A 1R4PB 3QB3A 5IGFA 4JBWA 4CJ0B 4RGMA 4X3SA 5C5MA 2XIWA 2NVXB 1BF4A 4J8QA 3JAML 1SXTA 4N9PA 1AP0A 1SNQA 1EOTA 2H4OA 1Y1WB 2BDNA 4DU9A 2DY8A 5C4HA 1CI3M 3ERQA 2QKIC 3OMGA 4OHJA 1D1IA 2KEDA 4HEDA 4QIWB 3C3LA 4K5XA 5EJWA 1LTAD 2K6AA 3H91A 4K8JA 1KABA 1SEBD 1XTCD 3SE0A 5D3DA 4RKLA 2B8FA 1SYEA 2ICIA 2DN8A 1F2YA 1H9RA 4C3JG 2NVQB 3S9WA 3S1MB 1MSHA 3D3RA 1ILPA 2X69A 4RAUC 2F0DA 3SXHA 4C3JB 3D8GA 1HTLD 3I3CA 3OOCA 1SNMA 1HRJA 1ET9A 4HMJA 4WJWA 2F0QA 3S14B 4U68A 2GA4B 1PYWD 4HCSA 3C1EA 2KJXA 4RHRA 4KJOA 2F0IA 1JOQA 4C3IB 5EGTA 1JE4A 4KKTA 4TKOB 4IN3A 5KNDA 2VB3X 5I2YA 3BDCA 4IUVA 1AZPA 1DD2A 3BYYB 1A15A 3D31A 1HXYD 1NCVA 1H9MA 3FMCA 3M4OB 2FMMA 1PTOF 2AQ2B 1TS4A 3QOJA 5M3FB 1V1OA 2OXPA 3QG1A 1BCPD 4HSPA 1G291 1SYDA 1RDPD 3T13A 2O5IC 3MEHA 5M5YB 3X3NA 4PQXA 5ELBA 3ND9A 3GTQB 1KLUD 2RQXA 1TR5A 4XT3B 1LO5D 2IT1A 1JOKA 4DK1A 3P20A 1CTMA 1CA6A 3NBHA 1W6JA 1E2ZA 5I2XA 5HURA 4F88A 2IJ0A 2B2YC 5F2DA 3IKJA 2JA6B 2F0KA 3VR5A 3S15B 3WDNA 5IT9E 3D4DA 4IUTA 1K83B 4ZAIA 1B2TA 3CHBD 1LTBD 1MD2D 4RWSC 2CHBD 3NE5B 2WKCA 1ML0D 1K8MA 1YNNC 4H13C 1PRTF 3NSWA 3KLSA 2KEEA 1NR4A 3FPUB 3C2PA 4ZKCB 3SEBA 2M2LA 1U4PA 2F0VA 4RGNA 3PO3B 1EY9A 1FGBD 1QNUA 1HCZA 1EY5A 1Q12A 2L4NA 1Y8OB 2EYMA 1B53A 4K8IA 1KDBA 3QOLA 2WIIB 2JEBI 3VYRA 2JXMB 1KTKA 3BDOA 4RA8A 2EYHA 3S1RB 2QILA 4KN4C 4XT1B 3VA5A 1FNVA 1STAA 4FYDA 4WORA 5E1FA 1CHPD 2B8GA 1QG7A 1II3A 4A3MB 1IKLA 1CQFA 3BYTB 3RD4A 1LV9A 5CGKA 5G3LD 1OXXK 1WCMB 3Q24A 3EJIA 1WVLA 2KECA 1STNA 2MUYA 1EIGA 5IOCA 4KI0A 3ND8A 5A2QL 3FDTA 1U9RA 2EDGA 1CHQD 5C4JB 4XXEA 1QNKA 1WTQA 1IHZA 1PTOH 1D5MC 1TS2A 5ELFA 4A3GB 4YIJA 1LTID 2K28A 5M5WB 1CZGA 3PIO3 4Q5VA 1GHJA 2FINB 5KYIA 3MA2B 5JVH3 1JR0D 1B9MA 3GP7A 3AMUA 2PNRC 5EBDA 3PUVA 3I73A 3A55A 1ET6A 1MBYA 4ZUJA 3CKIB 2BDOA 3OIQA 1LT6D 2L12A 2F0MA 2SDFA 5CORA 1JQYD 5EPLA 1EZ8A 4IFDJ 2L0CA 4WFN3 5C3EB 2F0GA 3HOZB 4XYQA 1ENAA 3BG3A 1NR2A 5JAVA 4TSSA 1PTOB 1SAPA 3MXGA 4IURA 4KMUC 3I4LA 1R9TB 1EEFD 1D5XC 1V8QA 3H0GB 1G6ZA 3NHHA 4IFDH 2R93B 4XDXA 4A3FB 1TWAB 5I9OA 4CBVA 3LNNA 1IYUA 5FK9C 2AQ3B 1TWCB 4XIGS 4R8NA 5I6YA 1UEAB 3T51B 5K5PA 1S5DD 2F4IA 4EGVA 2JP1A 2E76C 1HUNA 1F9RA 3C1FA 4CKCA 4ODGA 1EY8A 4C1NI 3HZXA 5K36H 3RLFA 1RTNA 2E75C 2ZT9C 1EEID 5ELEA 2RVLA 3J7AF 4AYBB 5A35A 2KUMA 3KLRA 1STBA 1ENFA 3EQLC 4B9XA 1K8OA 3K57A 1ENCA 1J8IA 1GHKA 5T1GA 2A69C 4MHEA 3SK4A 5DNFA 2OT2A 1LTRD 4RCOA 3IL8A 2QDBA 3NWSA 3AB9A 2MHVA 4Q0FA 2CQAA 3K6OA 3VYSA 4NP5A 3SR1A 1PRTD 3S1NB 5K36G 4C2MB 4ULLA 5JPNC 2Q8RE 1PTOC 2F0PA 3K7AB 2EJMA 1CA5A 2F0SA 3URYA 3KBGA 3M4YA 3U9OA 1F9PA 1Q1EA 2JA7B 1XXGA 2AWOA 3VR6A 2F0HA 3N52A 1IW7C 4DF7A 4R9WA 3ZYYX 2L11A 3J7AV 4ZLTF 4XTCS 2NVYB 3BZDB 3D4RA 1TS3A 3GTMB 4G57A 3J81L 4JK1C 1G2TA 1D1KA 1HQRD 2JSOA 1H9JA 4LMQD 4FXGC 3Q0AA 1FR3A 2CVRA 5DEHA 4KD4A 4KY6A 1EZ6A 1HFGA 1WTXA 5CC4A 1ICWA 2X6GA 2JA8B 4I65A 2K32A 5EBCA 5C4XB 3K5LA 1EYCA 2Z1CA 1SMYD 3NTHA 4RHSA 1TWGB 2F3WA 1ILQA 3MVVA 1XYIA 3PUXA 3M3YB 1SNOA 3HGBA 2K1BA 2Y0SB 1PRTC 1TU2B 4ZYSA 2C5CA 1C4QA 3S16B 1D5ZC 3QJYA 1WTOA 5M9OA 2KHSA 3PUYA 5JPMC 5ISRA 3A56A 4ME5A 4LJZC 2R61A 3N6RA 1T5XD 2KOLA 1RF2D 3K5NA 5T1IA 2FHTA 4C1NK 4UDUC 3F2UA 5I6WA 1GOZA 1SYBA 4X3KA 5C4ZA 1RKNA 2B2TA 1I4QA 1NSNS 2K01A 1PZKD 5NUCA 3O13A 1LT3D 1QCBD 5IGEA 4BBSB 1J9OA 3PMFA 3EVQA 1RCVD 1CZWA 4LAAA 3OHXC 4C3IG 1H9KA 1Z6HA 2MP1A 3R2IA 3I8ZA 4QCLA 3H3VC 4H0LC 2NB0A 4OGQC 4BY1B 1SMYC 1LLRD 5KRUA 3HS0C 1VF7A 1ZKOA 1B44D 1U4LA 4HAEA 1RHPA 1X3QA 1QILA 1S5BD 3PUZA 4DAPA 2HQEA 1BUVT 1PZID 3TMEA 3I4MB 2EXZA 3RZDB 4PNYA 1BDOA 1SE3A 5CBEE 2D5DA 2NN6H 3KUPA 3MHBA 1YNND 3TSSA 1LTGD 2F0FA 1EWHA 1OXTA 2R7ZB 3BVZA 5KEEA 5COYA 1PFNA 4OL7A 2NBFA 3RMHA 3GTKB 4NKLA 1AEXA 3QWNA 3RZOB 1H9SB 5TSSA 1NUCA 4B08A 1B50A 4K6DA 3MXNA 1LT4D 1AN8A 3SK6A 3QO2A 1PFMA 1V43A 1W6KA 4L8JA 1DONA 2NN6G 4KK7A 2PPBC 1S5FD 5IT9L 5ELDA 4IZ8A 2EYOA 3OPOA 2WV6D 2XWJB 1M8AA 4PMWA 2L1BA 2EY5A 1GXDC 4OIJA 3WOEA 1B4OA 1WTRA 5EKLA 1GUNA 1KNAA 1CFMA 3V2TA 2IWHA 1EL0A 4EVOA 1JB3A 3J7YW 4DGZA 2J0TD 1T5EA 4HR7B 1D2BA 4HMIA 3DUZA 1TWHB 3TZDA 4IUPA 3UI2A 5CR3A 2EYFA 2F0LA 4DK0A 5M3MB 3OWFA 1TY2A 3Q23A 4ZRZA 2ICEC 1KDCA 4H7BA 5D65A 2XWBB 1DOMA 1YNJD 3DEPA 4C56C 4BBRB 2RSNA 1SYCA 3E5SA 1Y8PB 2EOTA 4O1NA 1SJED 2E2DC 1BQQT 1ZXTA 3T53B 3ITPA 3I70A 3T4AC 2IX3A 1ZYRC 3GTGB 3FRPB 1SFOB 1H9SA 5J1ZA 4DNRB 4FXKC 3KK7A 1JC7A 5HGTA 5CV8A 4DAVA 1OXVA 3Q22A 1E0BA 2L5TA 3NUCA 3V05A 3SHLA 2WKDA 4KKUA 4BWGB 4ZK9B 4KD3A 5J22A 5DM73 2VB2X 3W3AA 5FKAC 2WB1B 3X3MA 2O5JC 4K6LA 3SDZA 5KGUA 3H09A 1B1ZA 2WP8J 4LK1C 3PO2B 2M9VA 1JCKB 1EY6A 3L3OC 3IAYA 5CV7A 1A6XA 3D6CA 5EKKA 3LX0A 1I4XA 2O2LD 1F9QA 4L63B 2K04A 2SNMA 3CRLC 4XQJA 3NP8A 1CT1D 1EQVA 3M85A 5C0XJ 4FXDA 2WINB 1G2SA 2BOSA 1RJTA 1KNEA 2I07B 1STEA 1ESFA 2BA1A 2L9HA 4PV1C 1F9SA 1YNJC 2C9OA 2EY2A 4K5VA 1I50B 2F0EA 4RH6A 3E6ZX 5C3XA 5D3IB 2A69D 1O7YA 1PXUA 1MI2A 3MXUA 2J7ZA 1JWSD 3TP6A 5CYUA 4FNFA 4WRDA 3S2DB 3C46A 2BE5D 1Y1VB 1X3PA 1I4GA 4KV6A 4F7XA 2NTTA 4BY7B 5FO8B 1EQTA 2HUGA 3KLSX 1VMCA 2K5WA 3I90A 5KNCA 5E3FA 1PTOD 1KAAA 2G9HD 1O7ZA 1I4HA 3S2HB 5E4XA 1HHVA 3VR2A 4XYOA 1JWMD 5JJZA 3BVMA 3DEOA 3OWEB 3KF8A 1A2UA 1HA6A 5IIFA 2JE6I 3SK5A 4B9WA 1SDFA 1SNCA 3SVMA 1GJXA 3CQZB 2QEJC 1IW7D 2XSCA 2EY1A 2B2VA 1UUPA 2AQ1B 4Y7NB 2HDMA 4A3JB 4RKBA 1AW7A 1F2ZA 2HDLA 1DCZA 3R3OA 1MGSA 1Z47A 2A6EC 2E2JB 4KN7C 2J4XA 4IQZA 5IODA 3NBIA 1JOOA 2A6HC 2KA7A 5LHY1 1PZJD 1TVXA 1E2VA 5C3WA 2EE1A 4IFDG 3DWQA 4C3HG 1A3TA 3VR3A 2Z8LA 3VR4A 4EQOA 2K33A 3HG9A 2NUCA 2MGSA 2PZTA 3HOUB 2DY7A 2F0TA 2N88A 2F0NA 4C3HB 4KY7A 3KBXA 2BE5C 2XN9C 4CKEA 2NYZD 3G6JB 2DNCA 3MXPA 2TSSA 1KDAA 3GV3A 3BS1A 2L55A 3D4WA 1EU4A 2VXWA 3MC0B 4H44C 1TS5A 1BCPF 3BVGA 5FLXE 3EFXD 1CK1A 3HEJA 4BS9A 3DHQA 3HP3A 3TP7A 4G4KA 2EJFC 2PQEA 4FO2A 2CW0D 2KCNA 2KCCA 1S5ED 3GTOB 1SNDA 2RBMA 2NVTB 2B2UA 3J80E 1A3UA 1Q90A 3R8BA 4KY5A 1U4RA 3MWYW 3GV6A 1F77A 1Q1BA 3NPPA 3HOXB 2B2WA 4KKSA 2SNSA 1SNPA 2LKVA 2NZ1D 1LACA 1EY0A 1GUTA 3NQIA 2IPKD 1I4PA 1SYGA 1RD9D 1HA5A 1BO0A 1LT5D 1STYA 2Z4IA 4HTHA 4IFDI 2EPBA 5IGCA 4FF4A 3L7ZC 1BR9A 3DWPA 4IUNA 4K14A 3P7JA 5BN5A 2XRQD 1BXTA 2PW5A 1ESRA 2JA5B 2EY6A 2PO4A 2KQ3A 3NK9A 2R3ZA 5KNBA 2D9UA 5J39A 4G7OC 1WTVA 1LTSD 1HQMC 1LABA 1L0YB 4U673 3I91A 5CV5A 1EYDA 2D62A 4A3DB 2PMZB 2B2TC 1WD1A 2CW0C 5KYLA 3GTLB 3TBIB 5FO9B 1D6EC 1WD0A 3BDLA 2IX0A 1I3QB 4N9TA 2LS01 2MPMA 4DXFA 1Y8NB 1UAPA 4ZUIA 5EPJA 2EYJA 1AZQA 5G3LF 2IW3A 4KJNA 1BBXC 3NQTA 1PDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9X A;  5KYI A;  1SNP A;  2LKV A;  2PW7 A;  4RKB A;  4S3S A;  4N9P A;  5CV7 A;  4DGZ A;  5KRU A;  1F2Z A;  1SNQ A;  1ENC A;  3D6C A;  4ID6 A;  1EYC A;  3LX0 A;  4K2L A;  5EKK A;  1EY0 A;  2PZW A;  3ERO A;  4KHV A;  3R3O A;  4DU9 A;  2F3W A;  3QOJ A;  3SK4 A;  5C4H A;  3DMU A;  1SYG A;  4HMI A;  2O4X A;  3ERQ A;  3MVV A;  5CV9 A;  2SNM A;  5IOD A;  3OMG A;  4PMB A;  2RKS A;  2HQE A;  1SNO A;  1STY A;  2F3V A;  2PZU A;  3TP5 A;  1JOO A;  3NP8 A;  5I9P A;  4EQN A;  2QDB A;  4TRD A;  1EQV A;  3TME A;  2EXZ A;  1F2M A;  2F0V A;  2OEO A;  2OXP A;  2RDF A;  4HTH A;  4K5X A;  4PNY A;  1EY9 A;  2EYF A;  4EQP A;  4ZUJ A;  2F0L A;  5C3W A;  3MHB A;  5IGC A;  4K8J A;  1KAB A;  1EY5 A;  4NP5 A;  3SR1 A;  1SYD A;  3OWF A;  2F0M A;  1JOR A;  2F0F A;  3T13 A;  5DAU A;  2EYM A;  4K8I A;  1A3T A;  3MEH A;  2F0O A;  1KDB A;  1EZ8 A;  2M00 A;  3H6M A;  3QOL A;  4QMG A;  4RKL A;  5IGG A;  3TP8 A;  1SYE A;  4IUN A;  1KDC A;  2F0G A;  4H7B A;  4K14 A;  5CV6 A;  4EQO A;  5KEE A;  2EY2 A;  1F2Y A;  4K5V A;  4OL7 A;  5IGD A;  2EYH A;  4IAL A;  1ENA A;  2F0P A;  2KHS A;  2NUC A;  2SOB A;  1SYF A;  4K5W A;  5JOB A;  4NMZ A;  2F0E A;  2PW5 A;  3P1H A;  4DFA A;  3VA5 A;  2PZT A;  3S9W A;  1TR5 A;  1STA A;  1SYC A;  4WOR A;  3E5S A;  5E1F A;  4NKL A;  5C3X A;  2OF1 A;  2F0T A;  5JAV A;  4QB4 A;  1AEX A;  5ISR A;  2EY6 A;  4ME5 A;  3MZ5 A;  4QF4 A;  2F0S A;  2F0N A;  2F0J A;  5IGB A;  1II3 A;  5C6A A;  4KY7 A;  1NUC A;  4J6H A;  4K6D A;  1JOK A;  4K2K A;  2WAC A;  3TP6 A;  4J1M A;  2KQ3 A;  3ITP A;  3NK9 A;  4WRD A;  3SK6 A;  2F0D A;  2F0W A;  3SXH A;  3U9O A;  5CGK A;  5J39 A;  3MXP A;  1EY7 A;  3D8G A;  2F0H A;  3RUZ A;  1KDA A;  2ENB A;  4F7X A;  3NHH A;  4KV6 A;  4DF7 A;  1A3V A;  5HUR A;  3D4W A;  5J1Z A;  5I6W A;  1SNM A;  1SYB A;  5I9O A;  5C4Z A;  1RKN A;  5CV5 A;  5F2D A;  1TQO A;  4MIU A;  3EJI A;  1EYD A;  1NSN S;  3NXW A;  3OSO A;  4HMJ A;  3SK8 A;  5E3F A;  1EYA A;  1A2T A;  1STN A;  4ZQ3 A;  5NUC A;  5HGT A;  5CV4 A;  5CV8 A;  1KAA A;  3HEJ A;  2F0K A;  2F0Q A;  4IZ8 A;  2F0U A;  3DHQ A;  5IOC A;  2EYO A;  4NDX A;  4G57 A;  4R8N A;  5I6Y A;  5IGE A;  5KYL A;  3C1E A;  2PYK A;  1TT2 A;  5K5P A;  3TP7 A;  3PMF A;  4PMC A;  5CR3 A;  2PQE A;  1STG A;  4KJO A;  2F0I A;  1U9R A;  3EVQ A;  3NUC A;  3P75 A;  1JOQ A;  3D4D A;  2EYP A;  3BDL A;  3SHL A;  4LAA A;  1A2U A;  3C1F A;  5EGT A;  1IHZ A;  1STH A;  5IIF A;  2EY5 A;  4KD3 A;  4ODG A;  3SK5 A;  1SND A;  4N9T A;  1EY8 A;  5J22 A;  4B9W A;  2RBM A;  4E6I A;  5DEH A;  3HZX A;  4KD4 A;  1SNC A;  4KY6 A;  1A3U A;  2EYL A;  5EKL A;  5C5L A;  5KIX A;  4YIJ A;  4ZUI A;  3T16 A;  2EY1 A;  2EYJ A;  1EZ6 A;  1EY4 A;  3BDC A;  3QB3 A;  3V2T A;  4KY5 A;  5IGF A;  3OMC A;  5KGU A;  4KTA A;  4EVO A;  4KJN A;  5C5M A;  1STB A;  1EY6 A;  3NQT A;  5CC4 A;  5M9O A;  4I65 A;  2SNS A;  4F8M A; 
#chains in the Genus database with same CATH topology
 2UXB L;  2A68 C;  2PW7 A;  1GM5 A;  3HOW G;  4ID6 A;  3R93 A;  3MFY A;  3J7Z C;  5C44 B;  4OO1 H;  1GUO A;  3GTK H;  4HCE A;  2AUJ D;  1I94 L;  3JAM E;  1TKW B;  3RZO H;  2NTS A;  2RKS A;  3TP5 A;  2F3V A;  2PZU A;  1Q3L A;  2SEB D;  1B3A A;  4HN7 A;  2RDF A;  4TQU S;  1X9N A;  3HOW B;  1JIC A;  2OQK A;  4DR2 L;  3PUW A;  3R2T A;  3S1Q B;  4A3C G;  1EFW A;  3I4M G;  4O42 A;  3M7G A;  1KHI A;  2M00 A;  2LY7 A;  1DM0 B;  3K5M A;  3SGI A;  4YCW A;  4CKB A;  4FF1 A;  1SYF A;  1B7Y B;  2VY3 A;  3A7L A;  1KD1 C;  3P1H A;  3HOY G;  3GDE A;  2YTX A;  2PI2 A;  3Q6S A;  4A3E H;  1JJ2 A;  3CU7 A;  2F0J A;  1KLG D;  3HOV H;  4RCN A;  5GAG C;  4OO1 G;  3K5O A;  4CGY B;  3E3X A;  3MAQ A;  1KL9 A;  4TVA B;  3RUZ A;  1CSP A;  3HOY B;  1N32 Q;  2YYZ A;  2N55 A;  1GUS A;  1PH1 A;  2Z4H A;  1UE1 A;  1QZH A;  1JWU D;  1B9N A;  1IBM Q;  2JEA I;  1HFN A;  2XRS D;  2K5H A;  1V1P B;  5BN4 A;  4XQQ A;  3NXW A;  3LWE A;  1YI2 A;  3J81 j;  4LF8 Q;  2KHJ A;  2K5D A;  2JJQ A;  3W1B A;  5D14 A;  2VUM H;  1K73 C;  1TT2 A;  1QE6 A;  4QUF A;  2F4V L;  1IBK Q;  1QUQ A;  3S17 H;  1I4R A;  1EWC A;  1N32 L;  4A3E G;  3HOV G;  1O7L A;  1ZYR D;  2B39 A;  1HNW Q;  1U5K A;  2VS1 A;  2EJG C;  3G7L A;  5KIX A;  1QWY A;  3K58 A;  5FO7 B;  2MNA A;  4LF8 L;  1U4M A;  3IRB A;  1BCP B;  3KLW A;  1C0A A;  4A3E B;  1EQR A;  2WAQ G;  4F8M A;  3HOV B;  2B3G A;  2I46 A;  4S3S A;  5IY0 A;  3D6W A;  3NWT A;  5FOB B;  4BBR H;  3CCQ A;  3V96 A;  4LFB Q;  4KHV A;  1O78 A;  1QOH A;  1E2W A;  3DMU A;  3I72 A;  3TDQ A;  3VYU A;  3FKI H;  2VUM G;  1HNW L;  4RGO S;  4PMB A;  3GD7 A;  4M1U B;  4P75 A;  5I9P A;  2KVM A;  2WAQ B;  1LUZ A;  4GNX B;  1CM9 A;  2OEO A;  2RSO A;  5AFW A;  4BA1 I;  2Q8T A;  4EQP A;  2E2H H;  2HCI A;  5ELN A;  1DXM A;  1OXS C;  2EZV A;  1WTP A;  4A3B H;  4OWW B;  4FP5 D;  3RN5 A;  1JB7 A;  2VUM B;  1TY0 A;  3I56 A;  4LFB L;  2K7V A;  3S17 B;  1GO3 E;  4A93 H;  2OQ0 A;  3AU7 A;  3CC2 A;  1XX8 A;  2SOB A;  5M5X H;  3FPP A;  4K5W A;  1OO9 B;  5I4D A;  4I7Z C;  1EUJ A;  3NTI A;  4R4O A;  2R92 H;  3QIA A;  5EKI A;  1DJR D;  4LF7 Q;  1Q8I A;  3MZ5 A;  4QF4 A;  3U4V A;  3RLO A;  5C6A A;  2HCC A;  4J15 A;  4OO1 I;  3FHW A;  1KRT A;  4BBR G;  3U9S A;  1Q81 C;  4JI1 Q;  1KIX A;  4J1M A;  2K5Q A;  3CCR A;  2F0W A;  3HRZ C;  3FKI G;  2B2Y A;  1MSG A;  4JI0 Q;  1HUM A;  1PLF A;  2ENB A;  3GTJ H;  2QCP X;  4B3R L;  2ID0 A;  3UE0 A;  4DA2 A;  1K3R A;  2NZH A;  4A3I H;  1TQO A;  4F87 A;  1K8G A;  3OSO A;  2I5M X;  4R1J A;  5CV4 A;  4A3B G;  4LF7 L;  1EFI D;  1QJO A;  4LF5 Q;  1VQM A;  2OWO A;  3FKI B;  2UXD Q;  1V1P A;  4JI1 L;  4PMC A;  1V9P A;  4FF2 A;  4A93 G;  1WTW A;  1RTO A;  3A54 A;  2E2H B;  2N49 A;  2E2I H;  3F2D A;  2EYP A;  1VQO A;  1G91 A;  1HPC A;  4JI0 L;  1X32 A;  1FJG Q;  2R92 G;  1XPR A;  1N34 Q;  2AWN A;  4A3B B;  3GO5 A;  4OIK A;  4E6I A;  2NN6 I;  3CD6 A;  2K03 A;  5GAH C;  1BCP C;  2EYL A;  3I4N H;  4Z9C B;  3T16 A;  5E4W C;  4A93 B;  1EY4 A;  1TWF H;  5M5X B;  4KTA A;  3KF8 B;  2VQF Q;  5EQ0 A;  2UXD L;  2D2C C;  2R92 B;  5ELO A;  1K8A C;  3VA7 A;  3CCU A;  2Q2T A;  1C8C A;  4A3I G;  2YTV A;  4DV0 Q;  4AH6 A;  1FVI A;  1N34 L;  1L0X B;  2VW9 A;  2DGY A;  2RCN A;  2OCE A;  4QY7 A;  2O4X A;  5CV9 A;  1OXU A;  1G8Z D;  3GTJ B;  4P2C B;  4EQN A;  1F2M A;  4V19 0;  4A3I B;  4JVZ A;  3K7U C;  2QGQ A;  5JJL A;  4X3T A;  1N36 L;  2IX1 A;  1PH8 A;  1Y1V H;  1VCI A;  4DAM A;  2ES2 A;  1JOR A;  4DV0 L;  4GNX A;  3H6M A;  3DM1 A;  3K81 C;  3I4N G;  1DZ1 A;  1J5E Q;  5IWA Q;  2XVS A;  2RDG A;  3CRK C;  1EU3 A;  1FYC A;  2E2I B;  1BOS A;  4DFA A;  4LF4 Q;  2RF4 A;  3A0J A;  2PI2 E;  3NTK A;  4V0B A;  5IGB A;  2A6E D;  1RL2 A;  1SJH D;  3I4N B;  4MZ9 A;  2F03 A;  2BA0 A;  3AQQ A;  4FDB A;  4P72 A;  1IL8 A;  2A6H D;  1TWF B;  1E1O A;  3K0Y A;  4XQN A;  5EPK A;  2FFK B;  1X56 A;  3W2D A;  3T56 B;  1BNZ A;  3DXJ C;  1YNX A;  1J5E L;  5IWA L;  3E0J A;  4MN3 A;  4GLV B;  1GUW A;  4A3K H;  3GQB A;  3GTP H;  4DNT B;  2ATW A;  4LF4 L;  1Y1V G;  1R4Q B;  3E0E A;  1IKM A;  4DK6 C;  2F0U A;  2RDH A;  2ZXR A;  3H94 A;  4NDX A;  4CJ2 C;  2TMP A;  2R6G A;  1K3B C;  2PYK A;  5C0X H;  3K59 A;  4Y52 H;  1PMR A;  1STG A;  4DR1 Q;  2PMZ E;  3PV0 A;  3U58 A;  1I5F A;  2HT1 A;  4YWK A;  5A2Q E;  4JBM A;  2EVB A;  1VQ6 A;  1UNS A;  2V4D A;  3UDF A;  3OMC A;  2X6L A;  5DM6 3;  5JJI A;  5LMU Q;  3A8I E;  3TS0 A;  1MKH A;  2B2V C;  4HSV A;  4DR1 L;  1C7Y A;  1YJ9 A;  3IFT A;  1WI5 A;  3OIP A;  4QQB X;  1TXY A;  4LWC A;  3J81 i;  2BCO A;  1N33 Q;  2PZW A;  3ERO A;  4HJ7 A;  2QDL A;  4YWL A;  3RR5 A;  1XMQ Q;  1VDZ A;  5C0X G;  2PQA A;  2I5H A;  1JE5 A;  4X66 Q;  1PH4 A;  4A3K B;  3GTP B;  2JYO A;  1C48 A;  3KDF B;  4A3L H;  3PIP 3;  2VNU D;  1D8L A;  2LMC B;  4GLX A;  5HY6 A;  2QEX A;  5LMU L;  3CW2 C;  5DAU A;  2E74 C;  5IGG A;  2ZXO A;  3KF6 B;  3TP8 A;  3CCS A;  4YCU A;  1N33 L;  1YVC A;  5JOB A;  1XMQ L;  1S5C D;  4GLA C;  3A8J E;  3OW7 A;  1LTT D;  4J6H A;  2WAC A;  2F1M A;  1IZ6 A;  5JVG 3;  2PCF B;  5DLQ E;  1SRO A;  3JC6 6;  5FLX L;  1L1O C;  1EY7 A;  2UUC L;  4G7H C;  2RA4 A;  1NAP A;  2H1E A;  3DWA A;  4JYA Q;  3MFG A;  4DXG A;  1SE2 A;  1HTP A;  4QUC A;  1EIY B;  4MIU A;  2CH4 W;  3TN2 A;  2QF7 A;  3SK8 A;  4CHT B;  4GKJ Q;  4ZQ3 A;  2DJG C;  4R8I A;  1O80 A;  1YHQ A;  1Q7Y C;  2EQS A;  3EN2 A;  3OTO Q;  3J80 L;  1DOL A;  2YU9 H;  1CQV A;  4OEM B;  4DV2 Q;  3L9A X;  2LFN A;  1STH A;  4JYA L;  3A74 A;  1ROD A;  4DV4 Q;  1XWE A;  4DN4 M;  4KHP Q;  4ILW A;  3M7N A;  4LF9 L;  5C5L A;  3WOF A;  4GKJ L;  4GZY C;  5LL6 X;  3A8K E;  4DKA C;  1DYQ A;  2K52 A;  2B2U C;  2ZTC A;  2B63 H;  4KHZ A;  5CBA E;  4X3U A;  3HKZ G;  2IL8 A;  3CCV A;  1X54 A;  2DNE A;  3A7A B;  5LL6 S;  1SE8 A;  1FD7 D;  3A5Z B;  1PRT B;  4IPC A;  1I6H H;  3D0F A;  3OTO L;  5BN3 A;  3LWU A;  4M8A A;  4BA2 I;  1WYD A;  4G7Z C;  4NW2 A;  4DV2 L;  2A74 C;  1XNR Q;  2B2W C;  4K2L A;  5JEA J;  2FMC A;  4DV4 L;  1WJJ A;  4B3M Q;  4KHP L;  3I4O A;  4FF3 A;  5C0X I;  1Y69 U;  1PFB A;  2N78 A;  3HKZ B;  1SN8 A;  1Z7T A;  4TRD A;  4L6T B;  1SE4 A;  3H3V H;  1S4Z A;  1QB5 D;  4FVM A;  3MTS A;  2FJ2 A;  1AH9 A;  5J3B A;  2IHF A;  4JV5 Q;  2WAQ E;  2F0O A;  2GVA A;  4IUQ A;  4QMG A;  3KDF A;  2AMC B;  2AUK A;  4IUU A;  5CV6 A;  1CKO A;  4LNQ A;  4B3M L;  2B63 G;  4PZ6 A;  5IGD A;  5JEA H;  4IAL A;  2A68 D;  3L2P A;  2YU9 B;  4NMZ A;  1S72 A;  4GKK Q;  3E9H A;  2MQH A;  4RGT A;  1F2L A;  3G48 A;  4ABN A;  3FVQ A;  2OF1 A;  2NVX H;  4QB4 A;  1DOK A;  4ZKB B;  4DR4 Q;  1GVP A;  5ELC A;  1EIH A;  4B3T Q;  1M4V A;  3L0O A;  2K5V A;  4K2K A;  1Z9F A;  3ONA B;  4JCV E;  1Y1W H;  5AJ3 Q;  1I3Q H;  1E7Z A;  2B63 B;  2Q8I B;  4JV5 L;  3VYT A;  4UAI A;  4DAY A;  3AFP A;  5CMD A;  1A3V A;  1SMX A;  1I6H B;  1AFP A;  3U4Z A;  4GKK L;  1FNU A;  1EYA A;  1A2T A;  1VQB A;  1K0R A;  2K05 A;  2XNA C;  3FEW X;  2NWG A;  1GUG A;  4DR4 L;  4L5R C;  4B3T L;  2N3S A;  4CJ1 B;  5AJ3 L;  1QVG A;  2ZXP A;  5JEA G;  4O0A A;  1ZEQ X;  3P75 A;  1VMP A;  2NVQ H;  1IYV A;  3IFD A;  2A5H A;  1SBB B;  3TZU A;  1VF5 C;  1TII D;  3J81 E;  3S1M H;  4JOI C;  1FNW A;  2A73 B;  1I6V C;  2G9D A;  4LUO A;  4RFB A;  3EA6 A;  1ONL A;  1JMC A;  1CKM A;  1Y1W G;  1SSO A;  1K28 A;  2MJ8 A;  1YIT A;  1R4P B;  3QB3 A;  5IGF A;  4JBW A;  4C3J H;  4CJ0 B;  4RGM A;  4X3S A;  5C5M A;  2XIW A;  2NVX B;  1BF4 A;  4J8Q A;  1N8R C;  3JAM L;  1SXT A;  4N9P A;  1AP0 A;  1SNQ A;  1EOT A;  1VQH A;  2H4O A;  1Y1W B;  4O2D A;  3CF5 A;  2BDN A;  4DU9 A;  2DY8 A;  5C4H A;  3S14 H;  4HIK A;  1CI3 M;  3ERQ A;  2QKI C;  3OMG A;  2JA9 A;  4OHJ A;  1RIP A;  4IPD A;  1D1I A;  2KED A;  4HED A;  2I5L X;  4QIW B;  3C3L A;  4K5X A;  5EJW A;  4C3I H;  3ERS X;  1LTA D;  4JW0 A;  2K6A A;  1FGU A;  4K0K Q;  3H91 A;  4K8J A;  1KAB A;  4APV A;  1SEB D;  1XTC D;  3SE0 A;  4HJA A;  5D3D A;  1UE7 A;  4RKL A;  2B8F A;  1SYE A;  4JI5 L;  2ICI A;  2DN8 A;  1F2Y A;  1H9R A;  4C3J G;  2NVQ B;  4NXN L;  3S9W A;  4BXX G;  1L2F A;  3NBH B;  4LW1 A;  3S1M B;  2EIF A;  1MSH A;  3D3R A;  1ILP A;  2X69 A;  1NMG A;  4RAU C;  3M4O H;  4K0K L;  4R4C A;  3TRE A;  2F0D A;  3SXH A;  4C3J B;  2QA4 A;  5M3F H;  4JI8 Q;  3D8G A;  1HTL D;  3I3C A;  1IL2 A;  3OOC A;  1IBL Q;  1VQC A;  1SNM A;  1HRJ A;  1ET9 A;  4R4I A;  4HMJ A;  4WJW A;  3PQI A;  1X55 A;  3F8T A;  2F0Q A;  4OXP A;  4CDE C;  3S14 B;  4U68 A;  2GA4 B;  2Z9H A;  1PYW D;  4HCS A;  5M5Y H;  3C1E A;  2KJX A;  4RHR A;  4UPA A;  4QL5 A;  4KJO A;  2F0I A;  1JOQ A;  4C3I B;  1K0S A;  3GTQ H;  4JI8 L;  2ASB A;  4OON A;  1CUK A;  5EGT A;  1M1K C;  1JE4 A;  4KKT A;  4TKO B;  4HJ5 A;  3Q8D A;  4IN3 A;  5KND A;  2VB3 X;  5I2Y A;  3BDC A;  3E9I A;  5M3F G;  4IUV A;  3DLL A;  1SRU A;  4DR3 Q;  1AZP A;  1DD2 A;  3BYY B;  1A15 A;  3D31 A;  1HXY D;  1NCV A;  1H9M A;  3FMC A;  3M4O B;  3KOJ A;  2FMM A;  1QZG A;  2HHH Q;  2JA6 H;  2A1A A;  1PTO F;  2AQ2 B;  4GN5 A;  4LF6 Q;  4RG1 A;  1TS4 A;  2ALY B;  3QOJ A;  5M3F B;  1IBM L;  3S15 H;  1A8V A;  1V1O A;  2UUB Q;  2OXP A;  1Q46 A;  2LXJ A;  1PYS B;  3QG1 A;  1BCP D;  1K83 H;  4HSP A;  1G29 1;  4DR3 L;  1SYD A;  1RDP D;  3T13 A;  1IBK L;  2O5I C;  3MEH A;  5M5Y B;  3X3N A;  4PQX A;  5ELB A;  2JK8 A;  4DPG A;  5FLX c;  2HHH L;  4A4I A;  4LF6 L;  2OTL A;  3ND9 A;  3AEV A;  3GTQ B;  1KLU D;  4HJ9 A;  1YHB A;  2RQX A;  1TR5 A;  2UUB L;  4XT3 B;  1LO5 D;  2IT1 A;  1EYG A;  1JOK A;  4DK1 A;  2JA6 G;  3P20 A;  1CTM A;  1CA6 A;  3NBH A;  4DR7 Q;  1XNQ Q;  1W6J A;  1E2Z A;  3PSI A;  3I2Z A;  3J80 c;  5I2X A;  5HUR A;  4F88 A;  2IJ0 A;  2B2Y C;  5F2D A;  3PO3 H;  3IKJ A;  2JA6 B;  2F0K A;  3VR5 A;  1VQE A;  3S15 B;  1EOV A;  1VQJ A;  3WDN A;  4DR7 L;  5IT9 E;  3AFQ A;  3D4D A;  4IUT A;  3W5O A;  2R7F A;  3S1R H;  1K83 B;  4ZAI A;  1B2T A;  3CHB D;  1LTB D;  1MD2 D;  4RWS C;  4P71 A;  4A3M H;  1YZ6 A;  3NE5 B;  2CHB D;  2WKC A;  4JI6 Q;  3PCO B;  4JI2 Q;  1ML0 D;  1K8M A;  1YNN C;  4H13 C;  2VQE Q;  1PRT F;  5HGQ A;  2A19 A;  1HH2 P;  2R7D A;  3NSW A;  4YHH Q;  3KLS A;  1ICF B;  2KEE A;  1WCM H;  3NEL A;  1LYL A;  3ICE A;  2HD3 A;  2AKW B;  1NR4 A;  2CQO A;  2CFM A;  1A62 A;  3FPU B;  2Z6K A;  4JI6 L;  3C2P A;  4ZKC B;  4JI2 L;  4LUZ A;  2M2L A;  3SEB A;  1U4P A;  2VQE L;  2F0V A;  4RGN A;  3QR8 A;  4LF5 L;  3PO3 B;  1EY9 A;  1FGB D;  5C4J H;  1QNU A;  1HCZ A;  4YHH L;  1EY5 A;  3HKZ E;  1LTL A;  1Q12 A;  2L4N A;  1Y8O B;  4DK3 C;  3OW2 A;  2EYM A;  1B53 A;  4K8I A;  1EQQ A;  1KDB A;  3QOL A;  2PQA B;  2WII B;  2JEB I;  3VYR A;  1FJG L;  2JXM B;  4A3G H;  1KTK A;  1PH7 A;  3BDO A;  1VQK A;  4RA8 A;  2EYH A;  4GNX C;  3I55 A;  3S1R B;  2QIL A;  4KN4 C;  4XT1 B;  3VA5 A;  1FNV A;  1VQL A;  1STA A;  2LSS A;  4FYD A;  4WOR A;  5E1F A;  4X64 Q;  1HZ9 A;  1CHP D;  1WCM G;  2B8G A;  1QG7 A;  1KRS A;  1II3 A;  4A3M B;  3K80 C;  2YV5 A;  1IKL A;  1CQF A;  4CDC C;  3BYT B;  2VQF L;  3RD4 A;  4N8X 1;  1LV9 A;  5CGK A;  5G3L D;  3A5U A;  1OXX K;  4GN4 B;  1WCM B;  3Q24 A;  5FJ8 H;  3EJI A;  1WVL A;  2KEC A;  1STN A;  2MUY A;  1EIG A;  3TEH B;  4X64 L;  3CCM A;  5IOC A;  4KI0 A;  2FXQ A;  3ND8 A;  2G5D A;  1E3P A;  2HIX A;  5C3E H;  5A2Q L;  3FDT A;  2ZM6 Q;  2I0Q A;  1U9R A;  3JAM c;  2EDG A;  3CC4 A;  3HOZ H;  1CHQ D;  1AE2 A;  5C4J B;  4XXE A;  1QNK A;  1WTQ A;  1IHZ A;  4GOP A;  1PTO H;  1D5M C;  2Q2U A;  1Q86 C;  1TS2 A;  5ELF A;  1AE3 A;  4A3G B;  4YIJ A;  1LTI D;  1R9T H;  1A63 A;  2K28 A;  5M5W B;  1CZG A;  5L37 A;  2CWA A;  3H0G H;  3PIO 3;  4Q5V A;  2R93 H;  1EWI A;  2ZM6 L;  3KJP A;  4A3F H;  1GHJ A;  2FIN B;  5KYI A;  5FJ8 G;  3MA2 B;  5JVH 3;  2XTI A;  4EQ5 A;  1JR0 D;  1B9M A;  3GP7 A;  3AMU A;  2PNR C;  4QJF A;  5EBD A;  3PUV A;  5C3E G;  3I73 A;  1DGS A;  3A55 A;  1QVF A;  2RCF A;  1ET6 A;  1PH5 A;  1PHJ A;  3HOZ G;  1SLJ A;  1MBY A;  2VZA A;  4ZUJ A;  3CKI B;  4HJ8 A;  2BDO A;  3OIQ A;  4NB3 A;  1PH3 A;  1LT6 D;  2L12 A;  4X62 Q;  2F0M A;  2SDF A;  5COR A;  4A3K G;  1JQY D;  5EPL A;  1EZ8 A;  4QIW E;  4IFD J;  2L0C A;  1KXL A;  4WFN 3;  5C3E B;  1VQF A;  2F0G A;  1IYJ B;  4LFA Q;  1ASY A;  3HOZ B;  4XYQ A;  5BR8 Q;  1ENA A;  3CPW A;  3BG3 A;  4NPS A;  3H0G G;  2GN5 A;  2ZJP A;  1VQ5 A;  1NR2 A;  2MO0 A;  1E24 A;  5JAV A;  4TSS A;  1PTO B;  1SAP A;  3MXG A;  4IUR A;  3CP0 A;  4KMU C;  3I4L A;  1R9T B;  4X62 L;  1EEF D;  1D5X C;  4IPH A;  1V8Q A;  3H0G B;  1G6Z A;  4IOA A;  3NHH A;  4IFD H;  2R93 B;  4XDX A;  4A3F B;  1TWA B;  4DV1 Q;  4LFA L;  5I9O A;  4CBV A;  3LNN A;  3W1G A;  1ASZ A;  1IYU A;  2GVB A;  5FK9 C;  2AQ3 B;  3PGZ A;  4X66 L;  3S1N H;  1TWC B;  4XIG S;  4R8N A;  4C2M H;  4DAY B;  5I6Y A;  1UEA B;  4A76 A;  3T51 B;  5K5P A;  1S5D D;  2F4I A;  3UE1 A;  4EGV A;  2XGT A;  2JP1 A;  2E76 C;  2HIV A;  1HUN A;  1F9R A;  3C1F A;  3K7A H;  3ER0 A;  4CKC A;  4ODG A;  4DV1 L;  1EY8 A;  4C1N I;  4A3L G;  3HZX A;  4IJL A;  5K36 H;  3RLF A;  1RTN A;  2E75 C;  4ME3 A;  2ZT9 C;  2K4K A;  1EEI D;  5ELE A;  2RVL A;  3J7A F;  4AYB B;  5A35 A;  2JA7 H;  2KUM A;  3KLR A;  1HR0 Q;  1STB A;  1ENF A;  3EQL C;  3OYY A;  4B9X A;  1WOC A;  1K8O A;  3K57 A;  1ENC A;  2NVY H;  1J8I A;  1GHK A;  5T1G A;  2A69 C;  3TRZ A;  4MHE A;  1BKB A;  3SK4 A;  5DNF A;  2OT2 A;  1LTR D;  4RCO A;  3GTM H;  2IHE A;  3IL8 A;  4L5S A;  1O7I A;  2QDB A;  3NWS A;  3AB9 A;  4AIM A;  5IP7 H;  2MHV A;  1HR0 L;  4Q0F A;  2CQA A;  3K6O A;  3VYS A;  4NP5 A;  3SR1 A;  1PRT D;  4HID A;  3S1N B;  4UY8 C;  5K36 G;  4C2M B;  4ULL A;  5JPN C;  2Q8R E;  1PTO C;  1VQ4 A;  1MIU A;  2F0P A;  2JA7 G;  2F52 A;  3K7A B;  1PV4 A;  1P16 A;  2EJM A;  1CA5 A;  2JA8 H;  1VQI A;  1KQS A;  2F0S A;  3F1Z A;  3URY A;  5C4X H;  1P8L A;  3KBG A;  2K5N A;  1YEZ A;  3M4Y A;  3U9O A;  1F9P A;  1Q1E A;  1TWG H;  2JA7 B;  1XXG A;  2AWO A;  3VR6 A;  2F0H A;  3N52 A;  3KJO A;  1IW7 C;  4DF7 A;  4R9W A;  3ZYY X;  2Q2H A;  1XNR L;  3M3Y H;  1HNX Q;  2L11 A;  5IP7 G;  3J7A V;  4ZLT F;  4XTC S;  2NVY B;  3BZD B;  3D4R A;  3S16 H;  1TS3 A;  3GTM B;  3K0X A;  4G57 A;  3J81 L;  4JK1 C;  2N8N A;  4GN3 B;  1E22 A;  1G2T A;  1D1K A;  1XTD A;  4JI7 Q;  1HQR D;  4ALP A;  3S24 A;  2JSO A;  1H9J A;  1VQG A;  5FLM H;  2LXK A;  2JA8 G;  4LMQ D;  1H95 A;  4HIM A;  4FXG C;  3Q0A A;  1FR3 A;  2CVR A;  5DEH A;  4KD4 A;  4JG2 A;  1VQN A;  5C4X G;  1VQ9 A;  4KY6 A;  3EIV A;  1G6P A;  1EZ6 A;  1HFG A;  1X65 A;  3HFZ B;  1WTX A;  1NTG A;  1FL0 A;  4PZ7 A;  1YHA A;  1ICW A;  2X6G A;  5CC4 A;  2Y0S G;  4I65 A;  2JA8 B;  1Y14 B;  2K32 A;  5EBC A;  4JI7 L;  4DUY Q;  5C4X B;  3K5L A;  1EYC A;  1UE6 A;  2Z1C A;  4P73 A;  4YCV A;  1SMY D;  3NTH A;  4RHS A;  1BBU A;  1TWG B;  2F3W A;  1ILQ A;  3MVV A;  1XYI A;  4BBS H;  3PUX A;  3M3Y B;  1SNO A;  3HGB A;  4DNI A;  2K1B A;  2Y0S B;  1PRT C;  1TU2 B;  4JBJ A;  1KC8 C;  4ZYS A;  2C5C A;  3BU2 A;  1C4Q A;  3S16 B;  1D5Z C;  3QJY A;  1WTO A;  1IXR A;  5M9O A;  2KHS A;  3PUY A;  3MXN B;  5JPM C;  3CCL A;  3PF4 A;  1UWV A;  5ISR A;  1CKN B;  2P5Z X;  3A56 A;  4BY1 H;  4ME5 A;  4LJZ C;  4A75 A;  2R61 A;  3N6R A;  1T5X D;  2KOL A;  1RF2 D;  3K5N A;  5T1I A;  2FHT A;  4BBS G;  4C1N K;  1G51 A;  4UDU C;  3F2U A;  5I6W A;  3CMA A;  4A3C H;  1GOZ A;  4N8F A;  1SYB A;  4X3K A;  5C4Z A;  1HR0 W;  1RKN A;  2B2T A;  4B3S Q;  3RZD H;  1I4Q A;  1NSN S;  2BH2 A;  2K01 A;  4YY3 Q;  1PZK D;  5NUC A;  4LUV A;  3O13 A;  1LT3 D;  1QCB D;  1PH6 A;  2R7Z H;  5IGE A;  4BBS B;  1XMO Q;  2WB1 E;  5IP9 H;  1J9O A;  3PMF A;  2DJF C;  3EVQ A;  1QVC A;  1RCV D;  1CZW A;  4LAA A;  2VL6 A;  3OHX C;  4BY1 G;  3H3V I;  2CWP A;  4B3S L;  2D0P A;  4C3I G;  1H9K A;  1V1Q A;  3I7F A;  4YY3 L;  1Z6H A;  2MP1 A;  3R2I A;  3I8Z A;  4QCL A;  3H3V C;  4H0L C;  2NB0 A;  1XMO L;  4OGQ C;  4BY1 B;  4QGU A;  3UDI A;  4MNO A;  1SMY C;  2YTY A;  2C35 B;  1LLR D;  4YWM A;  5KRU A;  3HS0 C;  1VF7 A;  1NNX A;  1ZKO A;  1B44 D;  1U4L A;  3DM3 A;  3AYH B;  1RHP A;  4HAE A;  1IBL L;  4NXM Q;  1PA6 A;  2R7Z G;  1X3Q A;  1QIL A;  1S5B D;  5IP9 G;  3PUZ A;  4DAP A;  2HQE A;  1BUV T;  1PZI D;  3TME A;  3I4M B;  2EXZ A;  3CCE A;  1Q8K A;  3UDG A;  3RZD B;  4PNY A;  1BDO A;  1SE3 A;  5CBE E;  2D5D A;  2F3I A;  2NN6 H;  3KUP A;  2F4V Q;  3MHB A;  1YNN D;  3TSS A;  1LTG D;  2F0F A;  1EWH A;  1OXT A;  2R7Z B;  3BVZ A;  4GS3 A;  1JJG A;  5KEE A;  2CH4 A;  5COY A;  1PFN A;  4NXM L;  4OL7 A;  2IY5 B;  2NBF A;  3RMH A;  1JT8 A;  3MEF A;  3GTK B;  4NKL A;  5JJK A;  3EBE A;  1AEX A;  3QWN A;  4ZCK A;  3G71 A;  1X3E A;  3RZO B;  2WFW A;  1H9S B;  5TSS A;  1NUC A;  4B08 A;  1PYB A;  1B50 A;  4K6D A;  3MXN A;  1LT4 D;  1B3Q A;  1AN8 A;  3SK6 A;  4IJH A;  1CKN A;  4DV7 Q;  5IYB H;  3QO2 A;  1YIJ A;  1PFM A;  1V43 A;  1W6K A;  1A0I A;  4L8J A;  1TWH H;  5H1S E;  1DON A;  2NN6 G;  4KK7 A;  4UP9 A;  2PPB C;  1S5F D;  5EAY A;  5M3M H;  5IT9 L;  5ELD A;  1N9W A;  4R4Q A;  4IZ8 A;  2EYO A;  3OPO A;  3RLN A;  1NMF A;  2WV6 D;  3VDY A;  2XWJ B;  1M8A A;  1MJC A;  4PMW A;  4DV7 L;  2L1B A;  2DUD A;  2EY5 A;  1GXD C;  4OIJ A;  3WOE A;  1B4O A;  4R4T A;  1WTR A;  5EKL A;  1GUN A;  1XPU A;  1KNA A;  1CFM A;  5IYB G;  3V2T A;  4CDF C;  1PVO A;  3GTG H;  3BZK A;  2IWH A;  1EL0 A;  1SFO H;  4EVO A;  4GOP B;  2ZJQ A;  4JI3 Q;  1UEB A;  3ULP A;  1JB3 A;  3J7Y W;  3TS2 A;  4DGZ A;  1XNQ L;  2J0T D;  1T5E A;  4HR7 B;  4AYB E;  5M3M G;  4B3R Q;  1D2B A;  5GAE C;  3STB D;  3ZJY C;  4HMI A;  4UHV A;  1GD7 A;  3DUZ A;  1TWH B;  3TZD A;  4KLK A;  1L0W A;  4IUP A;  3UI2 A;  4MTN A;  5CR3 A;  1MHW C;  2Z6K C;  2EYF A;  2F0L A;  4DK0 A;  5M3M B;  4JI3 L;  3OWF A;  1TY2 A;  3PO3 G;  3FP9 A;  3Q23 A;  3NEN A;  4ZRZ A;  2ICE C;  1KDC A;  4H7B A;  5D65 A;  2XWB B;  3ULL A;  1DOM A;  1YNJ D;  3DEP A;  2RHS B;  4C56 C;  4BBR B;  2RSN A;  3PO2 H;  1VQA A;  1SYC A;  1YJW A;  3E5S A;  1Y8P B;  2EOT A;  4O1N A;  1SJE D;  2E2D C;  1BQQ T;  1ZXT A;  3T53 B;  3J81 c;  1NE3 A;  3ITP A;  3I70 A;  3T4A C;  5IE8 A;  2IX3 A;  1K9M C;  1ZYR C;  2EXD A;  3GTG B;  3FRP B;  4A3M G;  1SFO B;  1H9S A;  4JI4 Q;  3PIO A;  5J1Z A;  4P74 A;  4DNR B;  1HZA A;  4FXK C;  2H5X A;  5M5W H;  3KK7 A;  1JC7 A;  5HGT A;  1VQ7 A;  5CV8 A;  4JBK A;  4DAV A;  1N36 Q;  1OXV A;  2WB1 G;  2Z0S A;  3Q22 A;  5LMN Q;  1E0B A;  2L5T A;  3NUC A;  2UU9 Q;  2KCT A;  3PO2 G;  3V05 A;  3SHL A;  2WKD A;  1I50 H;  4KKU A;  4BWG B;  4ZK9 B;  4JI4 L;  4KD3 A;  5J22 A;  3CC7 A;  5DM7 3;  2VB2 X;  3W3A A;  5FKA C;  4GOP C;  2WB1 B;  1GKH A;  3X3M A;  2O5J C;  4K6L A;  3SDZ A;  4DV6 Q;  5KGU A;  3H09 A;  1B1Z A;  3S2D H;  2WP8 J;  4LK1 C;  1VQP A;  3PO2 B;  2M9V A;  2K50 A;  1JCK B;  1EY6 A;  3L3O C;  5LMN L;  4A3G G;  4LFC Q;  1KAW A;  3IAY A;  3H15 A;  4BY7 H;  3STB C;  5CV7 A;  2UU9 L;  1A6X A;  3D6C A;  5EKK A;  4DUZ Q;  5E7N A;  3LX0 A;  3PIP A;  1I4X A;  2ZJR A;  2O2L D;  3KFU A;  1F9Q A;  1CSQ A;  3S2H H;  4L63 B;  3J80 i;  2K04 A;  2SNM A;  3CRL C;  4XQJ A;  2JQO A;  3NP8 A;  4DV6 L;  1CT1 D;  1EQV A;  3M85 A;  5C0X J;  4FXD A;  2WIN B;  1G2S A;  2K75 A;  4I7A A;  2KBN A;  2BOS A;  1RJT A;  1KNE A;  2PNH A;  2I07 B;  4LFC L;  2HQL A;  1STE A;  1ESF A;  2BA1 A;  1VQD A;  1XJV A;  2Y0S E;  1TWA H;  2L9H A;  4PV1 C;  1F9S A;  1YNJ C;  4DUZ L;  2C9O A;  3CQZ H;  1J6Q A;  2EY2 A;  4K5V A;  3G4S A;  1L1O B;  1I50 B;  2F0E A;  4RH6 A;  4Y7N H;  1TWC H;  3E6Z X;  1LM0 A;  5C3X A;  4BY7 G;  5D3I B;  2A69 D;  1O7Y A;  1PXU A;  1HNZ Q;  1MI2 A;  3MXU A;  2J7Z A;  4A3J H;  1JWS D;  3TP6 A;  5CYU A;  3WWV A;  1Q82 C;  4FNF A;  4OWT B;  4WRD A;  3S2D B;  3C46 A;  2CKZ B;  2E2J H;  2BE5 D;  4POG A;  1Y1V B;  4EX5 A;  1X3P A;  1I4G A;  4KV6 A;  4F7X A;  2NTT A;  4BY7 B;  5FO8 B;  1VQ8 A;  1EQT A;  2HUG A;  3KLS X;  1VMC A;  2K5W A;  3I90 A;  5KNC A;  5E3F A;  5GQO A;  1PTO D;  1KAA A;  2R93 G;  2E8G A;  1BVS A;  2G9H D;  1O7Z A;  3HKS A;  4A3F G;  1I4H A;  1HNZ L;  5E4X A;  3S2H B;  2Z6B A;  1HHV A;  3VR2 A;  4XYO A;  3CCJ A;  1JWM D;  3U50 C;  5JJZ A;  3BVM A;  3DEO A;  3OWE B;  1WTH A;  3KF8 A;  1X6O A;  1C9O A;  1A2U A;  1HA6 A;  5IIF A;  3HOU H;  2JE6 I;  3SK5 A;  4B9W A;  1BBW A;  1SDF A;  4A3J G;  2KEN A;  4C3H H;  5BR8 L;  1SNC A;  3SVM A;  1GJX A;  3M4P A;  4OX9 Q;  3CQZ B;  2QEJ C;  1IW7 D;  4POF A;  1MJE A;  2XSC A;  2EY1 A;  4PZ8 A;  2V1C C;  2B2V A;  1UUP A;  2AQ1 B;  4Y7N B;  3M4Q A;  1HZB A;  3PF5 A;  3BZC A;  1E1T A;  2HDM A;  4AYB G;  4RKB A;  4A3J B;  3F2B A;  2UUC Q;  1AW7 A;  1F2Z A;  2HDL A;  1DCZ A;  3R3O A;  1MGS A;  4DR6 Q;  1Z47 A;  2A6E C;  2E2J B;  2JN4 A;  4KN7 C;  2J4X A;  4IQZ A;  5IOD A;  4OX9 L;  3NBI A;  2A8V A;  4X6A H;  4OEL B;  1JOO A;  2A6H C;  2KA7 A;  5LHY 1;  1PZJ D;  1TVX A;  3BJU A;  1E2V A;  5C3W A;  3RN2 A;  2EE1 A;  3HOU G;  4IFD G;  3DWQ A;  4L5T A;  3GTO H;  4C3H G;  1A3T A;  3VR3 A;  1UE5 A;  2Z8L A;  5IYC H;  2NVT H;  2Q2I A;  3VR4 A;  4EQO A;  2B29 A;  2K33 A;  3HG9 A;  3JAM i;  3T1Y Q;  4DR6 L;  2NUC A;  2MGS A;  4LF9 Q;  5LMN W;  2PZT A;  4DV5 Q;  4DR5 Q;  3HOU B;  2DY7 A;  3HOX H;  2F0T A;  1NBW A;  2N88 A;  4H02 A;  4JPB W;  5IT9 c;  2F0N A;  4C3H B;  4KY7 A;  2BH8 A;  3CME A;  3KBX A;  1L1O A;  1VS0 A;  2BE5 C;  2XN9 C;  1PH9 A;  4CKE A;  2NYZ D;  3G6J B;  4L5Q A;  1JJC B;  1X3F A;  2DNC A;  3MXP A;  1OTC A;  2TSS A;  1EIF A;  1KDA A;  3GV3 A;  3BS1 A;  4WJ3 M;  2L55 A;  3D4W A;  2L15 A;  1EU4 A;  2VXW A;  4AQY Q;  3MC0 B;  4H44 C;  3F2C A;  5GAD C;  3T1Y L;  2MO1 A;  1TS5 A;  4PG3 A;  1BCP F;  2AHO B;  3BVG A;  5FLX E;  4DV5 L;  3EFX D;  4DR5 L;  1CK1 A;  2ZTD A;  3HEJ A;  1NY4 A;  4BS9 A;  1HZC A;  3DHQ A;  5IYC G;  2K14 A;  3HP3 A;  3TP7 A;  4G4K A;  1NJI C;  3TQY A;  3T1H Q;  2EJF C;  2PQE A;  1M90 C;  4FO2 A;  2CW0 D;  2UXC Q;  1S3O A;  2KCN A;  2KCC A;  2UUA Q;  1S5E D;  3HOX G;  4RMF A;  2KCM A;  2OTJ A;  3GTO B;  2JA5 H;  4AQY L;  1SND A;  3CXC A;  2RBM A;  1XPO A;  2NVT B;  2B2U A;  3J80 E;  4OWX B;  5GRO A;  1A3U A;  2D0O A;  1Q90 A;  3LGJ A;  4X65 Q;  3ULJ A;  3KYH C;  3CPF A;  3R8B A;  4KY5 A;  1PFS A;  1U4R A;  4WJ4 A;  3MWY W;  4IOC A;  3GV6 A;  1F77 A;  4CDD C;  1Q1B A;  4MTK A;  3NPP A;  4UP7 A;  3M9B A;  3HOX B;  2B2W A;  4KKS A;  2SNS A;  3T1H L;  1YJN A;  1SNP A;  2LKV A;  2UXC L;  2UUA L;  3B6Y A;  1PH2 A;  2NZ1 D;  2MFI A;  1LAC A;  4A3D H;  1EY0 A;  3CAM A;  1GUT A;  2E5L Q;  1D7Q A;  3NQI A;  1HNX L;  2IPK D;  1I4P A;  1SYG A;  1RD9 D;  1HA5 A;  3KF6 A;  3UDX A;  1BO0 A;  3GTL H;  4X65 L;  1LT5 D;  1STY A;  2Z4I A;  4HTH A;  4IFD I;  2EPB A;  4UP8 A;  5IGC A;  2JA5 G;  4FF4 A;  3L7Z C;  1BR9 A;  3DWP A;  1T9H A;  1B70 B;  1X3G A;  4IUN A;  4K14 A;  2E5L L;  3P7J A;  5IYD H;  5BN5 A;  3RNU A;  2XRQ D;  1BXT A;  2PW5 A;  1ESR A;  1SR3 A;  2JA5 B;  2EY6 A;  1U0L A;  4A3D G;  5FLM G;  2PO4 A;  2KQ3 A;  3NK9 A;  5C44 H;  2R3Z A;  5KNB A;  2D9U A;  5J39 A;  4G7O C;  4DUY L;  1WTV A;  1YBY A;  2RHQ B;  2CCZ A;  1LTS D;  1HQM C;  2KHI A;  4DV3 Q;  1LAB A;  1L0Y B;  4U67 3;  3I91 A;  5CV5 A;  4IPG A;  3K8A A;  1EYD A;  3HOW H;  2D62 A;  1HJP A;  4A3D B;  1QUQ B;  2PMZ B;  4JC0 A;  3S1Q H;  1S40 A;  1B8A A;  2B2T C;  1WD1 A;  2CW0 C;  2QW7 A;  5KYL A;  3GTL B;  4BXX H;  4IO9 A;  3TBI B;  5FO9 B;  5IYD G;  1D6E C;  4JOI A;  1WD0 A;  2UXB Q;  3BDL A;  2IX0 A;  4DV3 L;  4JI5 Q;  1I3Q B;  4HIO A;  4N9T A;  2LS0 1;  1I94 Q;  2MPM A;  4NXN Q;  2NZO A;  3I4M H;  4DXF A;  1Y8N B;  3NEM A;  3G6E A;  1UAP A;  2ZTE A;  1W3S A;  3J7A 5;  5C44 G;  4ZUI A;  5EPJ A;  2EYJ A;  1AZQ A;  5G3L F;  2IW3 A;  4KJN A;  4DR2 Q;  1BBX C;  3NQT A;  3HOY H;  1PDQ A;  1W2B A;  1WFQ A; 
#chains in the Genus database with same CATH homology
 2A68 C;  2PW7 A;  4ID6 A;  3R93 A;  3MFY A;  5C44 B;  4OO1 H;  1GUO A;  4HCE A;  2AUJ D;  3JAM E;  1TKW B;  2NTS A;  2RKS A;  3TP5 A;  2F3V A;  2PZU A;  1Q3L A;  2SEB D;  1B3A A;  4HN7 A;  2RDF A;  4TQU S;  3HOW B;  1JIC A;  3PUW A;  3R2T A;  3S1Q B;  4O42 A;  3M7G A;  2M00 A;  2LY7 A;  1DM0 B;  3K5M A;  4CKB A;  4FF1 A;  1SYF A;  3A7L A;  3P1H A;  3Q6S A;  3CU7 A;  2F0J A;  1KLG D;  4RCN A;  4OO1 G;  3K5O A;  4CGY B;  3MAQ A;  3RUZ A;  3HOY B;  2YYZ A;  2N55 A;  1GUS A;  2Z4H A;  1JWU D;  1B9N A;  2JEA I;  1HFN A;  2XRS D;  1V1P B;  5BN4 A;  4XQQ A;  3NXW A;  3LWE A;  2K5D A;  5D14 A;  1TT2 A;  1QE6 A;  4QUF A;  1I4R A;  1EWC A;  1O7L A;  1ZYR D;  2B39 A;  2EJG C;  3G7L A;  5KIX A;  1QWY A;  3K58 A;  5FO7 B;  1U4M A;  1BCP B;  4A3E B;  4F8M A;  3HOV B;  4S3S A;  2I46 A;  3D6W A;  3NWT A;  5FOB B;  3V96 A;  4KHV A;  1O78 A;  1QOH A;  3VYU A;  1E2W A;  3DMU A;  3I72 A;  3TDQ A;  4RGO S;  4PMB A;  3GD7 A;  4M1U B;  5I9P A;  2KVM A;  2WAQ B;  1CM9 A;  2OEO A;  2RSO A;  5AFW A;  4BA1 I;  2Q8T A;  4EQP A;  2HCI A;  1DXM A;  1OXS C;  2EZV A;  1WTP A;  4FP5 D;  2VUM B;  1TY0 A;  2K7V A;  3S17 B;  3AU7 A;  1XX8 A;  2SOB A;  3FPP A;  4K5W A;  1OO9 B;  5I4D A;  4I7Z C;  3NTI A;  3QIA A;  5EKI A;  1DJR D;  1Q8I A;  3MZ5 A;  4QF4 A;  5C6A A;  2HCC A;  4OO1 I;  3U9S A;  4J1M A;  2K5Q A;  2F0W A;  3HRZ C;  2B2Y A;  1MSG A;  1HUM A;  1PLF A;  2ENB A;  2QCP X;  2ID0 A;  4DA2 A;  1TQO A;  4F87 A;  3OSO A;  5CV4 A;  1EFI D;  1QJO A;  3FKI B;  1V1P A;  4FF2 A;  4PMC A;  1WTW A;  1RTO A;  3A54 A;  2E2H B;  2EYP A;  1G91 A;  1HPC A;  1X32 A;  2AWN A;  4A3B B;  3GO5 A;  4OIK A;  4E6I A;  2NN6 I;  2K03 A;  1BCP C;  2EYL A;  4Z9C B;  3T16 A;  5E4W C;  4A93 B;  1EY4 A;  5M5X B;  4KTA A;  5EQ0 A;  2D2C C;  2R92 B;  3VA7 A;  1C8C A;  1L0X B;  2O4X A;  5CV9 A;  1OXU A;  1G8Z D;  3GTJ B;  4P2C B;  4EQN A;  1F2M A;  4V19 0;  4A3I B;  4X3T A;  2IX1 A;  1VCI A;  1JOR A;  3H6M A;  3DM1 A;  1DZ1 A;  2XVS A;  2RDG A;  3CRK C;  1EU3 A;  1FYC A;  2E2I B;  1BOS A;  4DFA A;  3NTK A;  4V0B A;  5IGB A;  2A6E D;  1SJH D;  3I4N B;  2F03 A;  2BA0 A;  1IL8 A;  2A6H D;  1TWF B;  3K0Y A;  4XQN A;  5EPK A;  2FFK B;  3W2D A;  3T56 B;  1BNZ A;  3DXJ C;  3E0J A;  4MN3 A;  1GUW A;  3GQB A;  4DNT B;  1R4Q B;  1IKM A;  2F0U A;  2RDH A;  2ZXR A;  3H94 A;  4NDX A;  4CJ2 C;  2TMP A;  2R6G A;  2PYK A;  5C0X H;  3K59 A;  1PMR A;  1STG A;  3PV0 A;  5A2Q E;  2EVB A;  1UNS A;  2V4D A;  3OMC A;  2X6L A;  5DM6 3;  3A8I E;  2B2V C;  4HSV A;  3IFT A;  3OIP A;  2BCO A;  2PZW A;  3ERO A;  1VDZ A;  5C0X G;  4A3K B;  3GTP B;  2JYO A;  1C48 A;  3PIP 3;  2VNU D;  2LMC B;  5DAU A;  2E74 C;  5IGG A;  2ZXO A;  3TP8 A;  5JOB A;  1S5C D;  3A8J E;  3OW7 A;  1LTT D;  4J6H A;  2WAC A;  2F1M A;  5JVG 3;  2PCF B;  5FLX L;  1EY7 A;  4G7H C;  2RA4 A;  1NAP A;  2H1E A;  3DWA A;  3MFG A;  4DXG A;  1SE2 A;  1HTP A;  4QUC A;  4MIU A;  3TN2 A;  2QF7 A;  3SK8 A;  4CHT B;  4ZQ3 A;  4R8I A;  1O80 A;  3J80 L;  1DOL A;  1CQV A;  3L9A X;  2LFN A;  1STH A;  1ROD A;  1XWE A;  4DN4 M;  4ILW A;  3M7N A;  5C5L A;  3WOF A;  4GZY C;  5LL6 X;  3A8K E;  1DYQ A;  2B2U C;  4KHZ A;  5CBA E;  4X3U A;  2IL8 A;  2DNE A;  3A7A B;  5LL6 S;  1FD7 D;  1PRT B;  5BN3 A;  3LWU A;  4M8A A;  4BA2 I;  4G7Z C;  4NW2 A;  2A74 C;  2B2W C;  4K2L A;  5JEA J;  2FMC A;  4FF3 A;  5C0X I;  1Y69 U;  1PFB A;  3HKZ B;  1Z7T A;  4TRD A;  4L6T B;  1SE4 A;  1S4Z A;  1QB5 D;  4FVM A;  3MTS A;  2FJ2 A;  2F0O A;  4IUQ A;  4QMG A;  2AUK A;  4IUU A;  5CV6 A;  5IGD A;  5JEA H;  4IAL A;  2A68 D;  2YU9 B;  4NMZ A;  4RGT A;  1F2L A;  4ABN A;  3FVQ A;  2OF1 A;  4QB4 A;  1DOK A;  4ZKB B;  5ELC A;  1EIH A;  1M4V A;  4K2K A;  3ONA B;  2B63 B;  2Q8I B;  3VYT A;  4UAI A;  4DAY A;  5CMD A;  1A3V A;  1I6H B;  1AFP A;  1FNU A;  1EYA A;  1A2T A;  2K05 A;  2XNA C;  3FEW X;  2NWG A;  1GUG A;  4CJ1 B;  2ZXP A;  5JEA G;  1ZEQ X;  3P75 A;  1VMP A;  1IYV A;  3IFD A;  2A5H A;  1SBB B;  3TZU A;  1VF5 C;  1TII D;  3J81 E;  1FNW A;  2A73 B;  1I6V C;  2G9D A;  4RFB A;  3EA6 A;  1ONL A;  1SSO A;  2MJ8 A;  1R4P B;  3QB3 A;  5IGF A;  4JBW A;  4CJ0 B;  4RGM A;  4X3S A;  5C5M A;  2XIW A;  2NVX B;  1BF4 A;  4J8Q A;  3JAM L;  1SXT A;  4N9P A;  1AP0 A;  1SNQ A;  1EOT A;  2H4O A;  1Y1W B;  2BDN A;  4DU9 A;  2DY8 A;  5C4H A;  1CI3 M;  3ERQ A;  2QKI C;  3OMG A;  4OHJ A;  1D1I A;  2KED A;  4HED A;  4QIW B;  3C3L A;  4K5X A;  5EJW A;  1LTA D;  2K6A A;  3H91 A;  4K8J A;  1KAB A;  1SEB D;  1XTC D;  3SE0 A;  5D3D A;  4RKL A;  2B8F A;  1SYE A;  2ICI A;  2DN8 A;  1F2Y A;  1H9R A;  4C3J G;  2NVQ B;  3S9W A;  3S1M B;  1MSH A;  3D3R A;  1ILP A;  2X69 A;  4RAU C;  2F0D A;  3SXH A;  4C3J B;  3D8G A;  1HTL D;  3I3C A;  3OOC A;  1SNM A;  1HRJ A;  1ET9 A;  4HMJ A;  4WJW A;  2F0Q A;  3S14 B;  4U68 A;  2GA4 B;  1PYW D;  4HCS A;  3C1E A;  2KJX A;  4RHR A;  4KJO A;  2F0I A;  1JOQ A;  4C3I B;  5EGT A;  1JE4 A;  4KKT A;  4TKO B;  4IN3 A;  5KND A;  2VB3 X;  5I2Y A;  3BDC A;  4IUV A;  1AZP A;  1DD2 A;  3BYY B;  1A15 A;  3D31 A;  1HXY D;  1NCV A;  1H9M A;  3FMC A;  3M4O B;  2FMM A;  1PTO F;  2AQ2 B;  1TS4 A;  3QOJ A;  5M3F B;  1V1O A;  2OXP A;  3QG1 A;  1BCP D;  4HSP A;  1G29 1;  1SYD A;  1RDP D;  3T13 A;  2O5I C;  3MEH A;  5M5Y B;  3X3N A;  4PQX A;  5ELB A;  3ND9 A;  3GTQ B;  1KLU D;  2RQX A;  1TR5 A;  4XT3 B;  1LO5 D;  2IT1 A;  1JOK A;  4DK1 A;  3P20 A;  1CTM A;  1CA6 A;  3NBH A;  1W6J A;  1E2Z A;  5I2X A;  5HUR A;  4F88 A;  2IJ0 A;  2B2Y C;  5F2D A;  3IKJ A;  2JA6 B;  2F0K A;  3VR5 A;  3S15 B;  3WDN A;  5IT9 E;  3D4D A;  4IUT A;  1K83 B;  4ZAI A;  1B2T A;  3CHB D;  1LTB D;  1MD2 D;  4RWS C;  2CHB D;  3NE5 B;  2WKC A;  1ML0 D;  1K8M A;  1YNN C;  4H13 C;  1PRT F;  3NSW A;  3KLS A;  2KEE A;  1NR4 A;  3FPU B;  3C2P A;  4ZKC B;  3SEB A;  2M2L A;  1U4P A;  2F0V A;  4RGN A;  3PO3 B;  1EY9 A;  1FGB D;  1QNU A;  1HCZ A;  1EY5 A;  1Q12 A;  2L4N A;  1Y8O B;  2EYM A;  1B53 A;  4K8I A;  1KDB A;  3QOL A;  2WII B;  2JEB I;  3VYR A;  2JXM B;  1KTK A;  3BDO A;  4RA8 A;  2EYH A;  3S1R B;  2QIL A;  4KN4 C;  4XT1 B;  3VA5 A;  1FNV A;  1STA A;  4FYD A;  4WOR A;  5E1F A;  1CHP D;  2B8G A;  1QG7 A;  1II3 A;  4A3M B;  1IKL A;  1CQF A;  3BYT B;  3RD4 A;  1LV9 A;  5CGK A;  5G3L D;  1OXX K;  1WCM B;  3Q24 A;  3EJI A;  1WVL A;  2KEC A;  1STN A;  2MUY A;  1EIG A;  5IOC A;  4KI0 A;  3ND8 A;  5A2Q L;  3FDT A;  1U9R A;  2EDG A;  1CHQ D;  5C4J B;  4XXE A;  1QNK A;  1WTQ A;  1IHZ A;  1PTO H;  1D5M C;  1TS2 A;  5ELF A;  4A3G B;  4YIJ A;  1LTI D;  2K28 A;  5M5W B;  1CZG A;  3PIO 3;  4Q5V A;  1GHJ A;  2FIN B;  5KYI A;  3MA2 B;  5JVH 3;  1JR0 D;  1B9M A;  3GP7 A;  3AMU A;  2PNR C;  5EBD A;  3PUV A;  3I73 A;  3A55 A;  1ET6 A;  1MBY A;  4ZUJ A;  3CKI B;  2BDO A;  3OIQ A;  1LT6 D;  2L12 A;  2F0M A;  2SDF A;  5COR A;  1JQY D;  5EPL A;  1EZ8 A;  4IFD J;  2L0C A;  4WFN 3;  5C3E B;  2F0G A;  3HOZ B;  4XYQ A;  1ENA A;  3BG3 A;  1NR2 A;  5JAV A;  4TSS A;  1PTO B;  1SAP A;  3MXG A;  4IUR A;  4KMU C;  3I4L A;  1R9T B;  1EEF D;  1D5X C;  1V8Q A;  3H0G B;  1G6Z A;  3NHH A;  4IFD H;  2R93 B;  4XDX A;  4A3F B;  1TWA B;  5I9O A;  4CBV A;  3LNN A;  1IYU A;  5FK9 C;  2AQ3 B;  1TWC B;  4XIG S;  4R8N A;  5I6Y A;  1UEA B;  3T51 B;  5K5P A;  1S5D D;  2F4I A;  4EGV A;  2JP1 A;  2E76 C;  1HUN A;  1F9R A;  3C1F A;  4CKC A;  4ODG A;  1EY8 A;  4C1N I;  3HZX A;  5K36 H;  3RLF A;  1RTN A;  2E75 C;  2ZT9 C;  1EEI D;  5ELE A;  2RVL A;  3J7A F;  4AYB B;  5A35 A;  2KUM A;  3KLR A;  1STB A;  1ENF A;  3EQL C;  4B9X A;  1K8O A;  3K57 A;  1ENC A;  1J8I A;  1GHK A;  5T1G A;  2A69 C;  4MHE A;  3SK4 A;  5DNF A;  2OT2 A;  1LTR D;  4RCO A;  3IL8 A;  2QDB A;  3NWS A;  3AB9 A;  2MHV A;  4Q0F A;  2CQA A;  3K6O A;  3VYS A;  4NP5 A;  3SR1 A;  1PRT D;  3S1N B;  5K36 G;  4C2M B;  4ULL A;  5JPN C;  2Q8R E;  1PTO C;  2F0P A;  3K7A B;  2EJM A;  1CA5 A;  2F0S A;  3URY A;  3KBG A;  3M4Y A;  3U9O A;  1F9P A;  1Q1E A;  2JA7 B;  1XXG A;  2AWO A;  3VR6 A;  2F0H A;  3N52 A;  1IW7 C;  4DF7 A;  4R9W A;  3ZYY X;  2L11 A;  3J7A V;  4ZLT F;  4XTC S;  2NVY B;  3BZD B;  3D4R A;  1TS3 A;  3GTM B;  4G57 A;  3J81 L;  4JK1 C;  1G2T A;  1D1K A;  1HQR D;  2JSO A;  1H9J A;  4LMQ D;  4FXG C;  3Q0A A;  1FR3 A;  2CVR A;  5DEH A;  4KD4 A;  4KY6 A;  1EZ6 A;  1HFG A;  1WTX A;  5CC4 A;  1ICW A;  2X6G A;  2JA8 B;  4I65 A;  2K32 A;  5EBC A;  5C4X B;  3K5L A;  1EYC A;  2Z1C A;  1SMY D;  3NTH A;  4RHS A;  1TWG B;  2F3W A;  1ILQ A;  3MVV A;  1XYI A;  3PUX A;  3M3Y B;  1SNO A;  3HGB A;  2K1B A;  2Y0S B;  1PRT C;  1TU2 B;  4ZYS A;  2C5C A;  1C4Q A;  3S16 B;  1D5Z C;  3QJY A;  1WTO A;  5M9O A;  2KHS A;  3PUY A;  5JPM C;  5ISR A;  3A56 A;  4ME5 A;  4LJZ C;  2R61 A;  3N6R A;  1T5X D;  2KOL A;  1RF2 D;  3K5N A;  5T1I A;  2FHT A;  4C1N K;  4UDU C;  3F2U A;  5I6W A;  1GOZ A;  1SYB A;  4X3K A;  5C4Z A;  1RKN A;  2B2T A;  1I4Q A;  1NSN S;  2K01 A;  1PZK D;  5NUC A;  3O13 A;  1LT3 D;  1QCB D;  5IGE A;  4BBS B;  1J9O A;  3PMF A;  3EVQ A;  1RCV D;  1CZW A;  4LAA A;  3OHX C;  4C3I G;  1H9K A;  1Z6H A;  2MP1 A;  3R2I A;  3I8Z A;  4QCL A;  3H3V C;  4H0L C;  2NB0 A;  4OGQ C;  4BY1 B;  1SMY C;  1LLR D;  5KRU A;  3HS0 C;  1VF7 A;  1ZKO A;  1B44 D;  1U4L A;  4HAE A;  1RHP A;  1X3Q A;  1QIL A;  1S5B D;  3PUZ A;  4DAP A;  2HQE A;  1BUV T;  1PZI D;  3TME A;  3I4M B;  2EXZ A;  3RZD B;  4PNY A;  1BDO A;  1SE3 A;  5CBE E;  2D5D A;  2NN6 H;  3KUP A;  3MHB A;  1YNN D;  3TSS A;  1LTG D;  2F0F A;  1EWH A;  1OXT A;  2R7Z B;  3BVZ A;  5KEE A;  5COY A;  1PFN A;  4OL7 A;  2NBF A;  3RMH A;  3GTK B;  4NKL A;  1AEX A;  3QWN A;  3RZO B;  1H9S B;  5TSS A;  1NUC A;  4B08 A;  1B50 A;  4K6D A;  3MXN A;  1LT4 D;  1AN8 A;  3SK6 A;  3QO2 A;  1PFM A;  1V43 A;  1W6K A;  4L8J A;  1DON A;  2NN6 G;  4KK7 A;  2PPB C;  1S5F D;  5IT9 L;  5ELD A;  4IZ8 A;  2EYO A;  3OPO A;  2WV6 D;  2XWJ B;  1M8A A;  4PMW A;  2L1B A;  2EY5 A;  1GXD C;  4OIJ A;  3WOE A;  1B4O A;  1WTR A;  5EKL A;  1GUN A;  1KNA A;  1CFM A;  3V2T A;  2IWH A;  1EL0 A;  4EVO A;  1JB3 A;  3J7Y W;  4DGZ A;  2J0T D;  1T5E A;  4HR7 B;  1D2B A;  4HMI A;  3DUZ A;  1TWH B;  3TZD A;  4IUP A;  3UI2 A;  5CR3 A;  2EYF A;  2F0L A;  4DK0 A;  5M3M B;  3OWF A;  1TY2 A;  3Q23 A;  4ZRZ A;  2ICE C;  1KDC A;  4H7B A;  5D65 A;  2XWB B;  1DOM A;  1YNJ D;  3DEP A;  4C56 C;  4BBR B;  2RSN A;  1SYC A;  3E5S A;  1Y8P B;  2EOT A;  4O1N A;  1SJE D;  2E2D C;  1BQQ T;  1ZXT A;  3T53 B;  3ITP A;  3I70 A;  3T4A C;  2IX3 A;  1ZYR C;  3GTG B;  3FRP B;  1SFO B;  1H9S A;  5J1Z A;  4DNR B;  4FXK C;  3KK7 A;  1JC7 A;  5HGT A;  5CV8 A;  4DAV A;  1OXV A;  3Q22 A;  1E0B A;  2L5T A;  3NUC A;  3V05 A;  3SHL A;  2WKD A;  4KKU A;  4BWG B;  4ZK9 B;  4KD3 A;  5J22 A;  5DM7 3;  2VB2 X;  3W3A A;  5FKA C;  2WB1 B;  3X3M A;  2O5J C;  4K6L A;  3SDZ A;  5KGU A;  3H09 A;  1B1Z A;  2WP8 J;  4LK1 C;  3PO2 B;  2M9V A;  1JCK B;  1EY6 A;  3L3O C;  3IAY A;  5CV7 A;  1A6X A;  3D6C A;  5EKK A;  3LX0 A;  1I4X A;  2O2L D;  1F9Q A;  4L63 B;  2K04 A;  2SNM A;  3CRL C;  4XQJ A;  3NP8 A;  1CT1 D;  1EQV A;  3M85 A;  5C0X J;  4FXD A;  2WIN B;  1G2S A;  2BOS A;  1RJT A;  1KNE A;  2I07 B;  1STE A;  1ESF A;  2BA1 A;  2L9H A;  4PV1 C;  1F9S A;  1YNJ C;  2C9O A;  2EY2 A;  4K5V A;  1I50 B;  2F0E A;  4RH6 A;  3E6Z X;  5C3X A;  5D3I B;  2A69 D;  1O7Y A;  1PXU A;  1MI2 A;  3MXU A;  2J7Z A;  1JWS D;  3TP6 A;  5CYU A;  4FNF A;  4WRD A;  3S2D B;  3C46 A;  2BE5 D;  1Y1V B;  1X3P A;  1I4G A;  4KV6 A;  4F7X A;  2NTT A;  4BY7 B;  5FO8 B;  1EQT A;  2HUG A;  3KLS X;  1VMC A;  2K5W A;  3I90 A;  5KNC A;  5E3F A;  1PTO D;  1KAA A;  2G9H D;  1O7Z A;  1I4H A;  3S2H B;  5E4X A;  1HHV A;  3VR2 A;  4XYO A;  1JWM D;  5JJZ A;  3BVM A;  3DEO A;  3OWE B;  3KF8 A;  1A2U A;  1HA6 A;  5IIF A;  2JE6 I;  3SK5 A;  4B9W A;  1SDF A;  1SNC A;  3SVM A;  1GJX A;  3CQZ B;  2QEJ C;  1IW7 D;  2XSC A;  2EY1 A;  2B2V A;  1UUP A;  2AQ1 B;  4Y7N B;  2HDM A;  4A3J B;  4RKB A;  1AW7 A;  1F2Z A;  2HDL A;  1DCZ A;  3R3O A;  1MGS A;  1Z47 A;  2A6E C;  2E2J B;  4KN7 C;  2J4X A;  4IQZ A;  5IOD A;  3NBI A;  1JOO A;  2A6H C;  2KA7 A;  5LHY 1;  1PZJ D;  1TVX A;  1E2V A;  5C3W A;  2EE1 A;  4IFD G;  3DWQ A;  4C3H G;  1A3T A;  3VR3 A;  2Z8L A;  3VR4 A;  4EQO A;  2K33 A;  3HG9 A;  2NUC A;  2MGS A;  2PZT A;  3HOU B;  2DY7 A;  2F0T A;  2N88 A;  2F0N A;  4C3H B;  4KY7 A;  3KBX A;  2BE5 C;  2XN9 C;  4CKE A;  2NYZ D;  3G6J B;  2DNC A;  3MXP A;  2TSS A;  1KDA A;  3GV3 A;  3BS1 A;  2L55 A;  3D4W A;  1EU4 A;  2VXW A;  3MC0 B;  4H44 C;  1TS5 A;  1BCP F;  3BVG A;  5FLX E;  3EFX D;  1CK1 A;  3HEJ A;  4BS9 A;  3DHQ A;  3HP3 A;  3TP7 A;  4G4K A;  2EJF C;  2PQE A;  4FO2 A;  2CW0 D;  2KCN A;  2KCC A;  1S5E D;  3GTO B;  1SND A;  2RBM A;  2NVT B;  2B2U A;  3J80 E;  1A3U A;  1Q90 A;  3R8B A;  4KY5 A;  1U4R A;  3MWY W;  3GV6 A;  1F77 A;  1Q1B A;  3NPP A;  3HOX B;  2B2W A;  4KKS A;  2SNS A;  1SNP A;  2LKV A;  2NZ1 D;  1LAC A;  1EY0 A;  1GUT A;  3NQI A;  2IPK D;  1I4P A;  1SYG A;  1RD9 D;  1HA5 A;  1BO0 A;  1LT5 D;  1STY A;  2Z4I A;  4HTH A;  4IFD I;  2EPB A;  5IGC A;  4FF4 A;  3L7Z C;  1BR9 A;  3DWP A;  4IUN A;  4K14 A;  3P7J A;  5BN5 A;  2XRQ D;  1BXT A;  2PW5 A;  1ESR A;  2JA5 B;  2EY6 A;  2PO4 A;  2KQ3 A;  3NK9 A;  2R3Z A;  5KNB A;  2D9U A;  5J39 A;  4G7O C;  1WTV A;  1LTS D;  1HQM C;  1LAB A;  1L0Y B;  4U67 3;  3I91 A;  5CV5 A;  1EYD A;  2D62 A;  4A3D B;  2PMZ B;  2B2T C;  1WD1 A;  2CW0 C;  5KYL A;  3GTL B;  3TBI B;  5FO9 B;  1D6E C;  1WD0 A;  3BDL A;  2IX0 A;  1I3Q B;  4N9T A;  2LS0 1;  2MPM A;  4DXF A;  1Y8N B;  1UAP A;  4ZUI A;  5EPJ A;  2EYJ A;  1AZQ A;  5G3L F;  2IW3 A;  4KJN A;  1BBX C;  3NQT A;  1PDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...