5F2DA

Crystal structure of staphylococcal nuclease variant delta+phs i92n/v99t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYNYADGKMTNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92N/V99T at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5f2dA00
4KJNA 2LKVA 5I6WA 2F0WA 3V2TA 3D4DA 5C4ZA 4EQNA 2F0JA 3DHQA 3S9WA 2F0VA 3U9OA 2EXZA 3NP8A 3NHHA 1TR5A 1JOOA 3EJIA 2F3WA 4KD4A 4DU9A 5K5PA 2F0SA 1EY4A 5J39A 4G57A 2EYHA 5CR3A 1STGA 3SK4A 1IHZA 5ISRA 1F2MA 2EYLA 3SHLA 4QB4A 2F3VA 2PQEA 5JOBA 3SK8A 1EY7A 3OMCA 4K8JA 4K5XA 1EY8A 5IIFA 2F0UA 1SNMA 1JORA 4HMIA 5CV4A 4ID6A 3MZ5A 3P75A 1A2UA 4EQOA 5IODA 4B9XA 5C3XA 2F0MA 2NUCA 5IGDA 4DF7A 5IGGA 5IGEA 2F0GA 4K8IA 1A3VA 3SK5A 4NDXA 2F0LA 4IZ8A 2EYJA 3SK6A 1F2ZA 5C6AA 5I9PA 5IGCA 5HURA 1JOQA 2KQ3A 2RDFA 2QDBA 4OL7A 3DMUA 3MHBA 2PZWA 1F2YA 2F0FA 4ZUJA 2PW7A 5CC4A 5IGFA 2O4XA 2SNMA 3R3OA 4H7BA 4PNYA 3TMEA 2RKSA 5KYLA 1TQOA 1KDCA 4J1MA 4E6IA 1AEXA 4N9TA 5I9OA 4F7XA 4NKLA 4S3SA 1EZ8A 2F0DA 1EY0A 3QOLA 4KY6A 4ZUIA 1EYAA 1SNOA 1U9RA 1EYDA 1STBA 5I6YA 5KRUA 5J22A 3D6CA 4TRDA 2M00A 5JAVA 5IOCA 3SXHA 1SNPA 4K5WA 5KIXA 3NQTA 3LX0A 1SYGA 1EZ6A 1NUCA 2PZUA 2EY6A 2SOBA 5KEEA 3H6MA 3OMGA 3OWFA 4K6DA 4KJOA 5EGTA 1A2TA 1ENAA 3C1FA 3EVQA 2EYOA 3MVVA 4NMZA 4PMCA 5CV9A 5C5LA 4DGZA 1EY5A 3PMFA 2SNSA 2F0OA 4HTHA 2EY1A 5IGBA 3ERQA 4WRDA 2OXPA 3QOJA 4R8NA 4KHVA 3SR1A 1SNQA 4EVOA 4K2KA 4NP5A 4ZQ3A 1KABA 1SNCA 3E5SA 1SNDA 4F8MA 5C5MA 3TP7A 5CV7A 1A3UA 1EYCA 1KDAA 1STNA 1KDBA 2KHSA 2EYMA 3VA5A 5C4HA 2F0PA 5NUCA 3ITPA 4QF4A 1KAAA 4IUNA 5CV8A 1EY9A 2F0KA 4HMJA 4I65A 2PYKA 2F0QA 5J1ZA 3TP6A 4K5VA 4WORA 5CGKA 4YIJA 3OSOA 5KYIA 1SYDA 1EY6A 4K14A 2OF1A 2F0IA 5DAUA 4B9WA 1EQVA 1ENCA 3QB3A 3TP5A 5EKKA 1SYCA 2PZTA 3D8GA 1NSNS 3P1HA 5KGUA 3HEJA 4ODGA 4PMBA 5M9OA 2F0NA 4J6HA 1STAA 2F0EA 1STYA 2HQEA 1STHA 3T13A 3NXWA 2EY5A 4KV6A 1A3TA 5CV5A 3MEHA 3NUCA 5E1FA 3BDCA 3MXPA 3RUZA 2EY2A 1SYFA 4K2LA 2WACA 2PW5A 2RBMA 3HZXA 4IALA 1II3A 4KY5A 3EROA 4KTAA 3D4WA 4RKLA 2EYFA 2F0TA 2OEOA 3T16A 5F2DA 3TP8A 5HGTA 1JOKA 2EYPA 4KD3A 1SYEA 3C1EA 4KY7A 4ME5A 5DEHA 3BDLA 4QMGA 4MIUA 4N9PA 1TT2A 2ENBA 4RKBA 5E3FA 5EKLA 4LAAA 4DFAA 2F0HA 4EQPA 5C3WA 1SYBA 5CV6A 3NK9A 1RKNA
chains in the Genus database with same CATH superfamily
4DAMA 4H13C 1JB7A 4EQNA 4MHEA 4DR1L 1K28A 2D0OA 2E74C 3NEMA 1TS4A 4JK1C 1O7ZA 1C8CA 1HR0Q 3BDOA 1XPRA 2FFKB 5ISRA 3HOWB 1L0XB 2NTSA 1V1QA 4L5QA 4KKTA 5M5YB 2RCFA 3HS0C 3KYHC 1B53A 3ZYYX 1DGSA 3NE5B 1N32L 5IODA 4FF2A 1QNKA 2B2WC 3EN2A 1STEA 1YIJA 3LWEA 1N33L 3VR6A 1BCPC 3FKIH 1LACA 1HNZL 4A3FG 1Z47A 2PZWA 1D8LA 2EJMA 4G4KA 4RGOS 5ELDA 4A76A 4H7BA 4GOPB 1TWFB 3U9SA 5IY0A 3X3NA 2F4VL 3MC0B 4QGUA 1Q81C 2RA4A 4X64Q 4IJHA 3HOUH 5KRUA 3DWPA 3MA2B 1Q3LA 3IRBA 2K14A 3J7YW 3RLOA 3I4MB 4CKCA 1EZ6A 1HQRD 2K05A 3J81j 2NVQH 5E7NA 4UY8C 1EIFA 4JI8L 5IYBG 4A3KB 1N36Q 4YHHL 1HFGA 2E5LL 5JEAJ 1T9HA 3DM3A 4JBMA 1J8IA 3VA7A 1MSGA 1N34Q 1EL0A 4A4IA 4OGQC 1PFMA 4B08A 4C1NI 5C5MA 4A3IG 3ITPA 3OWEB 3S16B 2PYKA 3J81c 1W3SA 2R61A 2OQKA 3A55A 1UEBA 1NCVA 4ZCKA 2MUYA 1M4VA 2AKWB 1E0BA 5FLXE 5IT9L 1NY4A 4APVA 1PZJD 4A3MG 4KV6A 3MFYA 1CKNB 3S1RH 4RWSC 3HKZB 4DV4Q 1JJ2A 3RUZA 4BXXG 3GV3A 1QILA 2WACA 2RBMA 1OXUA 3SEBA 4BBSG 5LL6S 1CA6A 4P75A 1RHPA 3MXNB 3S16H 5EBCA 3RMHA 5C3WA 4IUQA 1QJOA 1YEZA 4PMWA 3F2CA 1NUCA 4JC0A 2K5WA 1B2TA 3PUYA 4X6AH 1VQ4A 4R4OA 3K58A 3J7ZC 1P16A 3NP8A 4A3LH 1VCIA 2QA4A 4LFAL 2NTTA 1IBKL 4GN3B 1JJGA 2A5HA 1JORA 3S15B 3A7AB 2MP1A 3HP3A 4B3ML 3KDFA 3BVZA 3P75A 1I50H 5LMUQ 3J7AV 4IZ8A 2EYJA 1Y1VB 2KCCA 2OTJA 2KQ3A 2B2YA 2RDFA 3PCOB 1TS5A 2A6HC 5FLMG 3TMEA 1KDCA 1SFOB 3AYHB 4WJ3M 2I46A 4KHZA 1WTQA 3DXJC 4NPSA 2K5HA 2Z1CA 4ZUIA 1XMOQ 1J5EL 4CBVA 1F77A 5I6YA 3JAMc 2MGSA 3KUPA 5EBDA 5D3DA 3I7FA 1HNWQ 3K5MA 2SOBA 1IBLL 2EY6A 1HZ9A 5IP7G 4K6LA 1ENAA 4EVOA 3C1FA 5AJ3Q 1H95A 1WOCA 4AQYQ 4OELB 3CQZH 2K04A 1LTBD 3CCLA 2JXMB 3RNUA 3VR3A 3PO2B 5JVG3 4DR4Q 2KCNA 2B29A 1SNCA 4IFDI 1SFOH 1BUVT 4LNQA 1PA6A 1VQNA 1U4PA 4OWXB 2V1CC 4QJFA 3VYUA 1EY9A 2F0KA 4HMJA 2K5VA 4N8FA 2X6LA 1IW7C 1LTAD 3KF8A 4JI7Q 3I72A 1D6EC 2K50A 4J15A 1PH3A 5FO8B 3UE1A 3FDTA 1VQ9A 3MFGA 5JPNC 3R2TA 3H91A 4IALA 4KY5A 2OCEA 3FP9A 2EYFA 1K3RA 4A3GG 1JR0D 4RKBA 1QVCA 3DWAA 4HEDA 2B8GA 3NK9A 4RGTA 1GHJA 2HDMA 1TWAB 4QIWB 1G2SA 4RMFA 2WB1G 1U5KA 3KK7A 4JBWA 5DM73 1UE7A 3R8BA 2X69A 2UU9Q 5JEAG 1GUNA 3SGIA 5FJ8H 1Q46A 4NXNQ 1IZ6A 1RJTA 3M4OB 1H9RA 4RGMA 1CUKA 4MN3A 5C3XA 4POGA 3IAYA 1Q1EA 1YZ6A 4K0KL 1Y1WH 5C4JB 1W2BA 1GKHA 5HURA 1EU4A 1HR0W 4ZUJA 2I07B 4WFN3 3OOCA 4DV5Q 1PH4A 2RKSA 1Z7TA 5IYCG 1SXTA 1I5FA 1K8MA 2E2HH 2F3IA 1XNRL 2WV6D 3WOEA 4A75A 1SE2A 3GTOH 2HCIA 4BY7H 4DR7L 3OTOL 3V96A 3M4OH 1B3QA 2BE5C 4KN7C 2WB1E 4R4CA 5HGQA 3LX0A 1IYVA 1QZGA 2BE5D 4WJWA 1VQHA 2VW9A 1DZ1A 5C4JH 2QDLA 3NTKA 2ALYB 2EXDA 2UUCQ 2OQ0A 1B7YB 2JA5B 2TSSA 1HTPA 4M8AA 1AN8A 1UEAB 3CF5A 1WTPA 1HH2P 4DR2L 1RD9D 3O13A 3CC7A 1UE1A 3J80E 5BN4A 2PI2E 4B3TL 2VQEL 3S17B 2KUMA 2NN6I 2AMCB 4FYDA 2QEXA 1CFMA 2LXJA 2RDHA 3FVQA 4X62Q 3PO3B 1PMRA 4I65A 1LTID 1AE2A 3SDZA 3K0XA 4B9WA 3S24A 1EQVA 3CW2C 2PZTA 5COYA 3VYTA 4R9WA 2F0EA 1TWHH 2HQEA 3AMUA 3MEFA 2ZJRA 2JA5H 1Q86C 2YTVA 1X6OA 3FKIG 1LT5D 5FLXc 4FF1A 2F4IA 3CC4A 1B8AA 2KJXA 1ZXTA 4OXPA 5F2DA 3EIVA 5G3LF 2YTXA 1HA5A 3RLFA 2IW3A 3PO3H 4LAAA 3NQIA 1Q82C 1DOMA 4IJLA 4A3FH 3HOUG 1CKMA 1RKNA 5K36H 2ICEC 3I4OA 5LL6X 4V190 1XTDA 2IJ0A 2LY7A 2F0JA 4AYBE 4DV1Q 1MI2A 1XTCD 2HCCA 1D7QA 1STGA 1BOSA 1BBWA 1BO0A 2KEDA 3HOZB 4JV5Q 1SR3A 1AP0A 5ELCA 2N3SA 3GTGH 3A8IE 5FK9C 3RN2A 4GOPC 1XPUA 1A15A 3Q22A 5C6AA 1TWCB 2VUMB 1CZGA 2CVRA 5M5WB 3MHBA 2PNHA 3K5NA 2F0FA 2G9HD 2O4XA 3I4MG 4A3IH 4HJAA 4OX9Q 1RTNA 1K0RA 3ER0A 5KYLA 2XVSA 4YCWA 3WWVA 4X3UA 2EJGC 4BA1I 3G71A 2K5DA 3PIOA 4P71A 5D65A 4QCLA 2XWJB 3S2HB 4DPGA 1B44D 2B63H 4JBKA 1QOHA 1U0LA 1EWHA 2VZAA 3EVQA 2DJFC 1K0SA 2L12A 5I2XA 2PO4A 1VQJA 1TWCH 2QEJC 4JI1L 4GKKQ 2VUMH 1UNSA 4BXXH 1PHJA 4XTCS 3HOYB 4BBSH 3CD6A 4A3LG 2RCNA 2Z6KA 2F0PA 4LF4L 3SE0A 3S2HH 4JYAQ 4A3CG 4XIGS 1SRUA 2D62A 5J1ZA 3HKZG 4K5VA 4WORA 3L9AX 4YIJA 4L5TA 2CFMA 5AFWA 5BR8Q 4C2MB 3NTIA 2NVTB 1WD1A 1D1IA 1BVSA 1CSPA 1TY0A 2CQOA 1QZHA 1ILQA 2WIIB 1A62A 5LMNL 1L1OC 3HOYH 4X3TA 2K52A 1WTWA 2JA6B 4ME3A 1CA5A 3GV6A 1LM0A 5EAYA 3BZCA 4C3HB 3KLSX 2E2IB 2D5DA 3CCSA 2XGTA 5ELEA 1WTOA 5D14A 4XXEA 2IY5B 4DNIA 2F0WA 3V2TA 4DR3Q 4B3RL 4OHJA 4GLVB 1E3PA 5GAHC 2KHJA 1TR5A 3EFXD 5J39A 1PTOD 3S1QB 4A3DB 4LK1C 3QG1A 1Y1VG 5A2QE 2G9DA 1B1ZA 1HQMC 4DV3L 1VQPA 3HKZE 1SE3A 1K83B 5CBEE 1VQ6A 2R93B 3MZ5A 3K57A 4C3HH 4JI4Q 4JPBW 2X6GA 2E2IH 4DF7A 2CQAA 1MJCA 4LJZC 5FKAC 1CT1D 3NBHB 1AFPA 1OTCA 1NR2A 3J7AF 2XN9C 4OL7A 2JA8B 1V1OA 3GTLH 4FVMA 5CC4A 1UE6A 3NENA 1YNNC 3BZKA 3I91A 5I9OA 1BQQT 2PQAA 1XPOA 3K8AA 1U9RA 4CDEC 2R92H 1S5ED 3PO2G 5IT9E 4NXMQ 1ICFB 1FYCA 5C4XB 3E0JA 4K5WA 4HIDA 5EPLA 3AEVA 3M7NA 1PFNA 4A3BB 4JOIA 1QUQA 2NVYB 4NMZA 2DY8A 3KBXA 4QL5A 1E1OA 2A73B 4U68A 4YWMA 4HIOA 4WRDA 3STBD 1I4XA 3L0OA 1ZYRD 3KJPA 2RQXA 3C46A 1TS2A 2J4XA 2I0QA 2HHHQ 4YY3L 1VQ5A 3S1MB 2MJ8A 5TSSA 1VQAA 4CJ1B 4QF4A 5JJLA 1OXTA 4XYQA 1EU3A 5FJ8G 2PNRC 1SJED 3J80c 3W2DA 1D5XC 2O5JC 2F0IA 1XNQL 1PRTF 4A3BH 4JCVE 2NVYH 3IFTA 1STAA 2Q2TA 3PIPA 3MEHA 1O78A 3W3AA 3S14H 4CJ0B 3P7JA 1VQOA 1VQFA 4DR6Q 3KLRA 4LF7L 2PI2A 3S1MH 4LFBQ 4KD3A 1SYEA 3RR5A 4DR4L 1SMYD 4MIUA 2ZJQA 2ENBA 4EQPA 2K32A 4NB3A 5GQOA 1IYJB 3CCUA 1LTLA 4OIJA 2A6EC 4JI0L 3T4AC 3DHQA 3PV0A 1PH2A 3U9OA 1Q1BA 5J3BA 1J6QA 4DA2A 2A6ED 3VDYA 2UUBQ 2F3WA 2F0SA 5ELBA 2L1BA 4CHTB 5CR3A 3CMAA 1MKHA 1H9KA 1SAPA 3RLNA 5DM63 4LF5Q 5JOBA 1FNUA 1ESRA 1B70B 1EY8A 1AZPA 1V9PA 4DNRB 2QGQA 4OO1I 3S2DH 4GKJQ 4B3SL 4IPCA 4DR1Q 1TKWB 5M3FB 1S40A 1LTSD 3SK6A 4UP7A 1WTXA 2RF4A 2C5CA 2R3ZA 2GVAA 1F9RA 2OT2A 2Z4IA 2KA7A 2KECA 1ENFA 3IL8A 4LWCA 1JWMD 2B2VA 4CDFC 5C0XH 1EY0A 4GNXC 1Q8KA 2JA5G 3OW7A 5I4DA 2E2JH 5KIXA 5T1GA 3T1HL 2HIXA 1LABA 1NE3A 3A56A 4KKSA 4KJOA 5EGTA 4R4TA 4IO9A 1E24A 1PH8A 3PO3G 4QUCA 4O0AA 4ALPA 4Y7NB 5K36G 1BCPD 1YVCA 2OWOA 1TWGB 1KABA 3AQQA 2Z6BA 3TP7A 1YBYA 1JE4A 4YWKA 3HOWH 3CAMA 4JI8Q 1NJIC 1HZBA 2YU9B 5M5YH 3J81L 4CDDC 3H3VI 5KYIA 2GA4B 4K14A 1K8OA 1HUMA 3A8KE 3PSIA 4LF8Q 5EKKA 3D8GA 1CSQA 2K5NA 2HDLA 4P73A 2B39A 2V4DA 3NUCA 4X66L 4EGVA 3J81i 3KF6A 1TWFH 3K7AB 1SYFA 2IWHA 3HZXA 1O7LA 3L3OC 3EROA 5HGTA 1YJ9A 2OEOA 2H4OA 1PZKD 1X65A 2N78A 5EKLA 4X64L 1GHKA 2K03A 5FO7B 2I5MX 2B63G 3E9IA 3I4MH 3A7LA 3HOZG 4BS9A 5EPKA 3D6WA 4A3KH 3NTHA 3EJIA 3SK4A 2K33A 1F2MA 2VUMG 4J8QA 1EY7A 1LV9A 3K7AH 4LFCL 4LF6Q 1K8GA 4XYOA 3LGJA 3Q23A 4HMIA 1DXMA 4EQOA 2F0MA 1YHAA 1V43A 4L63B 1I94L 1WFQA 1LTGD 5E4WC 5IGFA 1YITA 1KRTA 3KDFB 1A63A 1HCZA 1TQOA 2VB3X 2K01A 4HJ5A 2K75A 4B3MQ 4A3CH 5C0XJ 3I3CA 2DNEA 1VQKA 2KEEA 3PUXA 3JAML 1Y8PB 4DV4L 2TMPA 3D6CA 3SVMA 1E2ZA 3HOYG 2IPKD 2Y0SB 2QF7A 2KCTA 2N88A 5CBAE 1LYLA 2NZ1D 4V0BA 4GLXA 2JE6I 3BZDB 1FD7D 5IT9c 2F03A 4XT1B 5ELFA 2EY1A 2LMCB 1FGUA 3JAMi 4JI3Q 4HN7A 3ZJYC 3CCQA 2A6HD 2WAQB 1QVFA 4FDBA 2XNAC 2L55A 1FJGL 3CMEA 4HR7B 3S15H 3TP6A 1HZCA 1GVPA 5BN5A 2JA6G 1EY6A 5M5XB 3Q24A 4LUZA 2JK8A 2EOTA 4C3HG 2DJGC 1VQ8A 2A68C 2CWAA 2O2LD 5LMUL 1Y1VH 4HJ9A 2A68D 5JPMC 2MHVA 5CV5A 3BDCA 3KF8B 1IKMA 1PDQA 4K2LA 3BJUA 2ZM6L 1WJJA 1AZQA 1S5FD 1WI5A 3VR5A 5C44B 4HCEA 4A3DG 2R7ZB 4N9PA 1QE6A 1F9PA 1OXSC 2BH8A 3OIQA 3NPPA 4IPHA 4DAVA 2KOLA 2R92G 5GROA 1Q7YC 2JYOA 1EWIA 3AFQA 1IW7D 1YJWA 3D4DA 5HY6A 2F52A 4NW2A 2N49A 4MTNA 1CM9A 1ZEQX 5AJ3L 4AQYL 1H9SA 1VQ7A 3T56B 3PO2H 4DK6C 4CJ2C 3C3LA 1YNXA 1PRTB 1SE4A 2F3VA 2JA8G 4C56C 2B2UC 2EE1A 3VYRA 1BDOA 3F8TA 1RCVD 2PPBC 1VQEA 4DUYL 1SE8A 2R7ZH 1K9MC 1A3VA 4PQXA 2XWBB 1I6VC 3HKSA 1NNXA 3KOJA 3D4RA 4JI7L 1NAPA 2Q2HA 2QDBA 4GN5A 5C4XG 1HPCA 1F2YA 1R4PB 2PW7A 1C4QA 2ZT9C 2FMCA 1VMPA 3EQLC 4A3BG 1JB3A 4XQJA 4I7AA 1I6HB 2AQ2B 1O7IA 4K0KQ 4IOAA 3GQBA 4R4IA 4RG1A 3M85A 4ZK9B 1BKBA 1CZWA 1RIPA 4FXKC 3SXHA 1Q8IA 5CORA 3ND8A 3FPPA 4RHSA 3OMGA 1MD2D 2IL8A 1JICA 2B2TA 2CCZA 1ML0D 2EYOA 1K3BC 1AW7A 3NELA 3D0FA 1TWAH 3K0YA 3PMFA 1WD0A 4MTKA 1XNRQ 4HTHA 2AUJD 3URYA 3QOJA 4K2KA 1HNXQ 3OTOQ 4PZ8A 3S1NB 1YHQA 2UXBL 3Q8DA 5EJWA 1I6HH 4XQNA 3VYSA 1FNVA 3V05A 1G291 4NXNL 3PF4A 1WTVA 1KRSA 5IP9H 2OF1A 3T1YQ 1IBML 4DR2Q 3CKIB 1CTMA 1LT4D 5I2YA 1WCMB 3WOFA 1IL8A 1YNJC 3MXGA 2P5ZX 5ELOA 4DR5L 4ZKCB 2LXKA 4DV5L 4JBJA 5FLXL 4A3JB 1II3A 3G7LA 1Y69U 3S1NH 2ID0A 1IL2A 1Y14B 4JI2Q 5C0XG 4QMGA 3GD7A 1QG7A 3NWSA 2D2CC 1E1TA 1GUGA 4KJNA 4RHRA 5I6WA 1TY2A 2IT1A 2WKDA 3S9WA 1Z9FA 3CRKC 4IPDA 1TXYA 4GNXA 1JOOA 5M3FG 4G57A 1WCMH 2UUCL 3TRZA 3H3VH 4LMQD 4JI6Q 3IKJA 3RZDB 3S17H 2B2WA 1A2UA 4Y52H 4X62L 3HOWG 3SK5A 2JSOA 5C3EB 2L5TA 1LLRD 2K6AA 4JI5L 1KD1C 2H1EA 1CQVA 3L2PA 1JE5A 1IXRA 2RDGA 2R7DA 2K28A 3BYTB 3P20A 4JW0A 3BS1A 2R7FA 1GUTA 3K7UC 2PMZB 2Q8TA 1ONLA 2Z9HA 3GTMB 1W6JA 3A74A 3QO2A 3I90A 2UXDQ 1F9QA 4KN4C 2L4NA 1XXGA 2MPMA 1HXYD 4GZYC 2KENA 3H6MA 4K6DA 1LUZA 3FHWA 5C5LA 3G6EA 5C3EH 2ICIA 1S72A 4RFBA 4F87A 4CDCC 1MGSA 2LS01 3E0EA 1XX8A 3M7GA 3CCMA 1SNDA 2CW0C 1VF7A 4F8MA 4A3KG 5CV7A 1WVLA 4H44C 1KLUD 1LO5D 1XMQQ 2CW0D 1EWCA 1X3GA 2QCPX 3HOZH 1I3QB 3DEPA 4A3MB 2ZJPA 4JI1Q 2IX3A 4JV5L 2Z4HA 1SYCA 4R8IA 5KGUA 3I4NB 4ODGA 4P72A 5M5WH 4UAIA 4F88A 4RA8A 4LF9Q 4KHPL 1IYUA 1C9OA 3TSSA 4Q5VA 4DV6Q 4X65Q 1CK1A 2C35B 1Q12A 1MBYA 1D2BA 4DV0Q 4DV7Q 1I3QH 2VQFL 1SYBA 2M2LA 2NZHA 2PCFB 4YCUA 5LMNQ 4DUZL 3CU7A 2EXZA 5IE8A 2E75C 2MQHA 3I4NH 1HUNA 1UWVA 2VXWA 4OEMB 3SHLA 4HJ7A 3E6ZX 2PQEA 1JWUD 5IIFA 1HTLD 1DOLA 3M9BA 4IUTA 1VMCA 1BNZA 2IX1A 3N6RA 4B9XA 2NUCA 3KLWA 1SMXA 4WJ4A 3MXUA 1F2ZA 1RF2D 3G48A 2CH4W 1CHPD 1X3QA 3I55A 1PFBA 1PH1A 3PQIA 4C2MH 4IFDH 4QY7A 4FO2A 3CPFA 5BR8L 2NVTH 2Y0SG 3JC66 4IOCA 2BDOA 2EDGA 5JJIA 3QR8A 4J1MA 1HA6A 2YYZA 3NBIA 1FL0A 1Y8NB 3GTQB 1GUOA 1SNOA 1YHBA 1D1KA 2JA6H 2JEBI 3K80C 1V1PA 2WAQG 2PZUA 1S5BD 2BDNA 1XJVA 3TREA 5IWAL 5CV9A 2PQAB 1PTOF 4GN4B 4BA2I 2B8FA 4FXGC 4O42A 4A3EB 5A35A 2OXPA 4BY1B 2DY7A 1GUWA 4ZQ3A 4DV2L 1GXDC 3S1QH 1I4GA 4A3DH 3CCVA 1YNND 1STNA 3RN5A 1KDBA 1QUQB 4IUPA 1KAAA 1K83H 2R93H 1GJXA 4BBRB 1RODA 4JI4L 3F2UA 2OTLA 4RH6A 5C44G 3I56A 4ILWA 2R7ZG 1KNAA 1ET6A 1STYA 4A3GB 1STHA 3FMCA 2JA8H 4A3EH 3UDXA 5IYDG 1FR3A 3J80i 4QUFA 1DD2A 1PFSA 2WB1B 2WAQE 3E9HA 4DFAA 4KY7A 3FRPB 3K81C 5E3FA 1NMGA 1OO9B 3VR2A 5C4XH 4LW1A 5EPJA 4BBRH 2BOSA 2I5LX 1VDZA 1EEFD 5C4ZA 1PRTC 1PH6A 1ASZA 2ZTCA 2FJ2A 1PLFA 4G7ZC 1ET9A 5H1SE 2C9OA 3A54A 4O2DA 3SK8A 3H09A 5EQ0A 2HD3A 1SDFA 1PZID 1QWYA 4JI0Q 3F1ZA 4TKOB 2Z8LA 1E2VA 1TS3A 4C3JB 4FF4A 4OIKA 4IFDJ 1EOVA 4YWLA 3GTKB 2NN6H 3R2IA 5IP9G 2K7VA 3GP7A 5T1IA 3TZDA 2UUAL 4KY6A 3QOLA 1HZAA 2FHTA 2FINB 2VB2X 3H0GB 1E2WA 2B3GA 3C2PA 3B6YA 3T51B 5J22A 2BH2A 1KAWA 3OIPA 2XSCA 4G7HC 1B3AA 3TS0A 4EX5A 1EIHA 4AYBB 2UXCL 4DNTB 1KIXA 4C3JH 4QIWE 1WTRA 1HHVA 2EVBA 3GTKH 4DAYA 4KHVA 1JWSD 1PVOA 2CKZB 3ULJA 3G4SA 4UP9A 1MHWC 2MO0A 4O1NA 3T1HQ 1N32Q 2EYMA 2VL6A 5C4HA 5NUCA 3H0GH 1WCMG 1WTHA 1S3OA 4LF5L 1HFNA 1N33Q 2R6GA 3TQYA 4CKBA 1HNZQ 1J9OA 3FKIB 1FGBD 3H3VC 3QIAA 5M3FH 1Y8OB 4GKJL 2NYZD 1F9SA 1L2FA 3ND9A 2GVBA 2F4VQ 3NXWA 4PZ6A 2EY5A 3CRLC 4HSVA 3MXPA 3HOUB 1VQGA 2JJQA 2XRSD 4RKLA 1HR0L 2EYPA 1ZKOA 2LSSA 2NVQB 4YHHQ 5E4XA 2E5LQ 4FF3A 1MJEA 1JCKB 1BCPF 3KF6B 2EPBA 4X66Q 2VY3A 3PUVA 2ZTDA 4UHVA 1O7YA 4POFA 3TS2A 2JN4A 1CKOA 3NHHA 1SSOA 3W1GA 2QW7A 4DU9A 4C3IB 1H9JA 5C3EG 4IUUA 4Y7NH 2EYLA 3U50C 4PZ7A 1TWGH 1ILPA 2FMMA 4JVZA 3E3XA 3J7A5 3HOVB 2F0UA 1DJRD 4GOPA 3CCEA 1M8AA 1PH5A 2K4KA 5LMNW 2AQ3B 5A2QL 2F0GA 2ZXPA 4K8IA 2YU9H 1EOTA 4NDXA 2L15A 2AQ1B 5IGCA 1NMFA 3DMUA 2JEAI 5L37A 4LF8L 3KLSA 1CI3M 4TVAB 3S1RB 1PH9A 1N36L 1TU2B 4LFCQ 1NR4A 2XRQD 1AEXA 2XTIA 4F7XA 2AWOA 4C3IH 4RCNA 2A1AA 4I7ZC 3ULPA 4X3SA 5EKIA 3F2DA 1DCZA 1STBA 4AIMA 1QVGA 4HSPA 1N34L 1TIID 2J0TD 3GO5A 5JAVA 1I94Q 3HOVH 5KNCA 1FVIA 2SDFA 2JA7B 3A8JE 4DXGA 1A2TA 3K59A 3UDGA 2ATWA 2SNSA 4LFAQ 5IGBA 1A8VA 4ZKBB 1IBKQ 5DNFA 5LHY1 1PH7A 2FXQA 4HAEA 3LNNA 1A3UA 1LT3D 3I4NG 3AFPA 1I50B 4L8JA 1EQRA 4IUNA 2PMZE 1L1OB 2Z6KC 1CKNA 4LF6L 2XIWA 5CGKA 1V8QA 3OSOA 1E22A 1UE5A 2BCOA 2JA7H 4ULLA 1G91A 1U4LA 2F0NA 3MXNA 4J6HA 1EFID 1L1OA 1J5EQ 3PIO3 1R9TB 1FJGQ 3TN2A 4IFDG 3KFUA 2HT1A 2PW5A 1PTOB 2QILA 1U4MA 3KBGA 3F2BA 4KTAA 5GAEC 3T16A 3EA6A 3HOXB 1IBLQ 1JOKA 3I8ZA 1CQFA 2AWNA 2F0HA 5CV6A 1QCBD 4LUOA 1VF5C 2LKVA 3CQZB 5JJKA 2JQOA 1KNEA 1Q90A 4IURA 2ZM6Q 3K5LA 3PGZA 1YJNA 1IHZA 1R9TH 4JI3L 2CHBD 2H5XA 1W6KA 1G2TA 1KHIA 3DM1A 1PTOH 2ZXOA 5M3MB 1SNMA 2O5IC 1JT8A 3M4QA 5CV4A 3HOXH 1EQTA 1PYWD 1XMOL 5IGDA 1LTRD 1H9SB 4ABNA 4A93B 5M5XH 1NTGA 3WDNA 1HNWL 2R93G 3NWTA 4X3KA 1SEBD 2BA0A 3R3OA 4QQBX 1KLGD 1S5DD 2N55A 2EIFA 4MNOA 2Q2IA 2L9HA 4DUYQ 4UP8A 4KK7A 1EIGA 2D0PA 1BXTA 1EEID 1EUJA 5CMDA 3KJOA 3EBEA 4H0LC 5JVH3 4A3EG 4TRDA 2Q8RE 2M00A 2YTYA 4BY1G 4DK1A 2I5HA 5M3MH 4RGNA 3MAQA 5C44H 3D31A 2E8GA 1GD7A 4Q0FA 4A93H 1EY5A 4JOIC 5IYDH 4BBRG 2RHQB 3A0JA 1UUPA 2N8NA 4NP5A 4DXFA 1A0IA 1I4QA 1HRJA 1EYCA 1M1KC 5BN3A 2DUDA 2MO1A 1T5XD 1BBXC 1VQBA 5DLQE 1VQLA 2F0QA 4HJ8A 1EQQA 1Y1WB 4OWTB 1SYDA 2AHOB 5DAUA 4U673 3HGBA 2L0CA 1ENCA 1X3FA 2QKIC 1NSNS 2K5QA 2GN5A 4IUVA 3CXCA 2A69C 2EJFC 2UXBQ 2JA9A 2E2HB 2KHIA 4L6TB 2NVXB 3Q6SA 2A69D 2CWPA 3GTOB 4OO1H 3ULLA 4DR7Q 2NN6G 3DWQA 2UU9L 4BY7B 3D4WA 3CCRA 2E76C 3BYYB 1DM0B 1GM5A 4ME5A 2F1MA 1IBMQ 1UAPA 3U4ZA 2D9UA 2ZTEA 1FNWA 4IN3A 3UDFA 4DR5Q 2G5DA 2F0VA 4B3TQ 1X3EA 2VQEQ 1EY4A 2EYHA 2CH4A 2NVXH 4C3JG 1RL2A 4QB4A 1YNJD 5FOBB 1PXUA 3OHXC 1HNXL 3OMCA 4K8JA 4K5XA 3K5OA 3QWNA 4DN4M 4GNXB 1GUSA 4C1NK 2RSOA 3H0GG 1C0AA 1TWHB 1ESFA 1X9NA 1NBWA 3X3MA 3PIP3 3UDIA 3TDQA 4DAPA 2M9VA 3FEWX 1K73C 1Z6HA 1B4OA 3T1YL 5GAGC 3BVMA 4E6IA 4AYBG 3PF5A 4S3SA 5ELNA 2F0DA 1BCPB 1JQYD 4P74A 3FPUB 2B2VC 4XDXA 2VS1A 2A74C 4A3JH 3H94A 4FXDA 5IOCA 4A3FB 4JI5Q 1SYGA 1EIYB 2DGYA 5G3LD 4JI2L 2Z0SA 4PMCA 1O80A 2ASBA 5D3IB 1DONA 2F0OA 4TQUS 3ERQA 1C7YA 3CCJA 1SNQA 3RZOB 1A6XA 1KTKA 3H15A 4N8X1 5CYUA 3E5SA 3VA5A 1JJCB 1ASYA 3GTGB 2ES2A 2HUGA 4JI6L 4HCSA 5C0XI 4BWGB 3RZDH 2ZXRA 3TBIB 4KI0A 3TP5A 3AB9A 1SJHD 3LWUA 4A3IB 4P2CB 4PMBA 1QNUA 1C48A 4DK3C 1HJPA 3CP0A 4GLAC 1A3TA 1I4HA 3CC2A 3RZOH 1H9MA 2B63B 1B9MA 1PYSB 2LFNA 4DV1L 4CKEA 1OXVA 3TP8A 4TSSA 3L7ZC 3C1EA 4C3IG 5IYBH 1EFWA 2NZOA 4ZAIA 3GTMH 3MTSA 3GTJB 4MZ9A 2HQLA 4AH6A 1G8ZD 2UXDL 1VQDA 3UI2A 3CPWA 3HOVG 2E2DC 1TVXA 1RDPD 4H02A 2WP8J 4KHPQ 3PUWA 5GADC 4BBSB 3TEHB 3M4PA 4KD4A 1YI2A 4LF4Q 3OPOA 4KMUC 1XYIA 4DKAC 2VQFQ 1N8RC 4OX9L 4R4QA 2J7ZA 1SBBB 3D3RA 4ID6A 2IX0A 1XMQL 4DUZQ 3M4YA 3W5OA 5IGEA 1L0YB 5IGGA 4A3MH 4LUVA 3GTJH 5I9PA 1M90C 4ZLTF 1X55A 2JA7G 1B9NA 2DN8A 4XT3B 4GKKL 1EZ8A 2NWGA 4FNFA 4LF9L 4IPGA 1SNPA 3NQTA 1BBUA 3K6OA 4DV6L 1LTTD 4EQ5A 4X65L 4B3RQ 3Q0AA 4JYAL 2Q2UA 4DV0L 4JG2A 4DV7L 2YV5A 1SLJA 3NSWA 1X56A 1KL9A 3SR1A 2B2YC 4DV3Q 3J81E 2BA1A 1V1PB 5FO9B 1E7ZA 3BVGA 3I2ZA 1X32A 3TZUA 1KDAA 2NBFA 2RHSB 1BR9A 1L0WA 2EQSA 4YCVA 5IWAQ 5KNDA 1PYBA 1SN8A 3HRZC 3R93A 2JP1A 5FLMH 4ZYSA 1X54A 1VQMA 3GTLB 3HOXG 3P1HA 1PTOC 3HEJA 4DV2Q 5M9OA 3I73A 3T13A 2KBNA 2HIVA 5E1FA 1T5EA 3IFDA 2Q8IB 4DR3L 4HIKA 2R92B 2KCMA 3DEOA 3GTQH 1WYDA 1G6PA 2F0TA 2L11A 5IP7H 4PG3A 2K1BA 3M3YB 4PV1C 3ICEA 4OWWB 1TT2A 4XQQA 3CHBD 4G7OC 5KNBA 3J80L 4L5SA 1VS0A 2Y0SE 5M3MG 1GOZA 3PUZA 1PV4A 4DK0A 3DLLA 2RSNA 4Z9CB 4YY3Q 5K5PA 3NBHA 4RAUC 2VNUD 2WKCA 1CHQD 4BY1H 4A93G 4KLKA 1F2LA 2B2UA 1R4QB 4UDUC 3GTPB 1VQIA 1VQCA 1MIUA 1XNQQ 3M3YH 3U4VA 1KQSA 3T53B 2DNCA 1XWEA 3OYYA 1D5ZC 2F0LA 4NXML 3STBC 1JOQA 1ZYRC 2IHFA 2WFWA 3BU2A 4FP5D 4CGYB 2SNMA 3JAME 4KKUA 4PNYA 1BF4A 3MWYW 3S14B 1PRTD 3GDEA 4OONA 4N9TA 4LF7Q 4A3GH 4NKLA 3VR4A 2AUKA 1EYAA 1S5CD 3W1BA 1EYDA 3GTPH 3I70A 2HHHL 4OO1G 2MNAA 1N9WA 1KC8C 5KEEA 1I4RA 3OWFA 1B50A 4GS3A 1U4RA 3MVVA 2MFIA 5JEAH 5JJZA 4DGZA 4R1JA 2B2TC 2UUAQ 1D5MC 2KVMA 3I4LA 3G6JB 1Y1WG 1EYGA 2A8VA 4RCOA 4UPAA 1DYQA 4R8NA 1G51A 1KXLA 3QJYA 1JMCA 3N52A 1SMYC 1K8AC 2KHSA 1QB5D 2EZVA 4B3SQ 1AE3A 1DOKA 3S2DB 2UXCQ 1SROA 3BG3A 5CV8A 4ZRZA 4IQZA 3A5ZB 1RTOA 1GO3E 1ICWA 4DR6L 4DAYB 2WINB 4BY7G 1I4PA 4LFBL 4HIMA 1MSHA 3ONAB 3QB3A 1IKLA 3U58A 5IYCH 3RD4A 3UE0A 4L5RC 2SEBD 3HFZB 4M1UB 2EY2A 2NB0A 2UUBL 3A5UA 2IHEA 2E2JB 1G6ZA 1JC7A 1P8LA 3DUZA 5DEHA 2RVLA 3BDLA 3OW2A 1AH9A 1X3PA 1LT6D 3ERSX 3HG9A 1OXXK 4A3JG 1S4ZA 3AU7A 2A19A
chains in the Genus database with same CATH topology
4H13C 4EQNA 4MHEA 2E74C 1TS4A 4JK1C 1O7ZA 1C8CA 3BDOA 2FFKB 5ISRA 3HOWB 1L0XB 2NTSA 4KKTA 5M5YB 3HS0C 1B53A 3ZYYX 3NE5B 5IODA 4FF2A 1QNKA 2B2WC 1STEA 3LWEA 3VR6A 1BCPC 1LACA 1Z47A 2PZWA 2EJMA 4G4KA 4RGOS 5ELDA 4H7BA 1TWFB 3U9SA 3X3NA 3MC0B 2RA4A 5KRUA 3DWPA 3MA2B 1Q3LA 3J7YW 3I4MB 4CKCA 1EZ6A 1HQRD 2K05A 4A3KB 1HFGA 5JEAJ 1J8IA 3VA7A 1MSGA 1EL0A 4OGQC 1PFMA 4B08A 4C1NI 5C5MA 3ITPA 3OWEB 3S16B 2PYKA 2R61A 3A55A 1NCVA 2MUYA 1M4VA 1E0BA 5FLXE 5IT9L 1PZJD 4KV6A 3MFYA 4RWSC 3HKZB 3RUZA 3GV3A 1QILA 2WACA 2RBMA 1OXUA 3SEBA 5LL6S 1CA6A 1RHPA 5EBCA 3RMHA 5C3WA 4IUQA 1QJOA 4PMWA 1NUCA 2K5WA 1B2TA 3PUYA 3K58A 3NP8A 1VCIA 2NTTA 2A5HA 1JORA 3S15B 3A7AB 2MP1A 3HP3A 3BVZA 3P75A 3J7AV 4IZ8A 2EYJA 1Y1VB 2KCCA 2KQ3A 2B2YA 2RDFA 1TS5A 2A6HC 3TMEA 1KDCA 1SFOB 2I46A 4KHZA 1WTQA 3DXJC 4ZUIA 2Z1CA 4CBVA 1F77A 5I6YA 2MGSA 3KUPA 5EBDA 5D3DA 3K5MA 2SOBA 2EY6A 4K6LA 1ENAA 4EVOA 3C1FA 2K04A 1LTBD 2JXMB 3PO2B 3VR3A 5JVG3 2KCNA 1SNCA 4IFDI 1BUVT 1U4PA 3VYUA 1EY9A 2F0KA 4HMJA 2X6LA 1IW7C 1LTAD 3KF8A 3I72A 1D6EC 5FO8B 3FDTA 3MFGA 5JPNC 3R2TA 3H91A 4IALA 4KY5A 2EYFA 1JR0D 4RKBA 3DWAA 4HEDA 2B8GA 3NK9A 4RGTA 1GHJA 2HDMA 1TWAB 4QIWB 1G2SA 3KK7A 4JBWA 5DM73 3R8BA 2X69A 5JEAG 1GUNA 1RJTA 3M4OB 1H9RA 4RGMA 4MN3A 5C3XA 3IAYA 1Q1EA 5C4JB 5HURA 1EU4A 4ZUJA 2I07B 4WFN3 3OOCA 2RKSA 1Z7TA 1SXTA 1K8MA 2WV6D 3WOEA 1SE2A 2HCIA 3V96A 2BE5C 4KN7C 3LX0A 1IYVA 2BE5D 4WJWA 1DZ1A 3NTKA 2JA5B 2TSSA 1HTPA 4M8AA 1AN8A 1UEAB 1WTPA 1RD9D 3O13A 3J80E 5BN4A 3S17B 2KUMA 2NN6I 4FYDA 1CFMA 2RDHA 3FVQA 3PO3B 1PMRA 4I65A 1LTID 3SDZA 4B9WA 1EQVA 2PZTA 5COYA 3VYTA 4R9WA 2F0EA 2HQEA 3AMUA 1LT5D 4FF1A 2F4IA 2KJXA 1ZXTA 5F2DA 5G3LF 1HA5A 3RLFA 2IW3A 4LAAA 3NQIA 1DOMA 1RKNA 5K36H 2ICEC 5LL6X 4V190 2IJ0A 2LY7A 2F0JA 1MI2A 1XTCD 2HCCA 1STGA 1BOSA 1BO0A 2KEDA 3HOZB 1AP0A 5ELCA 3A8IE 5FK9C 1A15A 3Q22A 5C6AA 1TWCB 2VUMB 1CZGA 2CVRA 5M5WB 3MHBA 3K5NA 2F0FA 2G9HD 2O4XA 1RTNA 5KYLA 2XVSA 4X3UA 2EJGC 4BA1I 2K5DA 5D65A 4QCLA 2XWJB 3S2HB 1B44D 1QOHA 1EWHA 3EVQA 2L12A 5I2XA 2PO4A 2QEJC 1UNSA 4XTCS 3HOYB 2F0PA 3SE0A 4XIGS 2D62A 5J1ZA 4K5VA 4WORA 3L9AX 4YIJA 5AFWA 4C2MB 3NTIA 2NVTB 1WD1A 1D1IA 1TY0A 1ILQA 2WIIB 4X3TA 1WTWA 2JA6B 1CA5A 3GV6A 4C3HB 3KLSX 2E2IB 2D5DA 5ELEA 1WTOA 5D14A 4XXEA 2F0WA 3V2TA 4OHJA 1TR5A 3EFXD 5J39A 1PTOD 3S1QB 4A3DB 4LK1C 3QG1A 5A2QE 2G9DA 1B1ZA 1HQMC 1SE3A 1K83B 5CBEE 2R93B 3MZ5A 3K57A 2X6GA 4DF7A 2CQAA 4LJZC 5FKAC 1CT1D 1AFPA 1NR2A 3J7AF 2XN9C 4OL7A 2JA8B 1V1OA 4FVMA 5CC4A 1YNNC 3I91A 5I9OA 1BQQT 1U9RA 1S5ED 5IT9E 1FYCA 5C4XB 3E0JA 4K5WA 5EPLA 3M7NA 1PFNA 4A3BB 2NVYB 4NMZA 2DY8A 3KBXA 2A73B 4U68A 4WRDA 1I4XA 1ZYRD 3C46A 2RQXA 1TS2A 2J4XA 3S1MB 2MJ8A 5TSSA 4CJ1B 4QF4A 1OXTA 4XYQA 1EU3A 2PNRC 1SJED 3W2DA 1D5XC 2O5JC 2F0IA 1PRTF 3IFTA 1STAA 3MEHA 1O78A 3W3AA 4CJ0B 3P7JA 3KLRA 4KD3A 1SYEA 1SMYD 4MIUA 2ENBA 4EQPA 2K32A 4OIJA 2A6EC 3T4AC 3DHQA 3PV0A 3U9OA 1Q1BA 4DA2A 2A6ED 2F3WA 2F0SA 5ELBA 2L1BA 4CHTB 5CR3A 1H9KA 1SAPA 5DM63 5JOBA 1FNUA 1ESRA 1EY8A 1AZPA 4DNRB 4OO1I 1TKWB 5M3FB 1LTSD 3SK6A 1WTXA 2C5CA 2R3ZA 1F9RA 2OT2A 2Z4IA 2KA7A 2KECA 1ENFA 3IL8A 1JWMD 2B2VA 5C0XH 1EY0A 3OW7A 5I4DA 5KIXA 5T1GA 1LABA 3A56A 4KKSA 4KJOA 5EGTA 4QUCA 4Y7NB 5K36G 1BCPD 1TWGB 1KABA 3TP7A 1JE4A 2YU9B 3J81L 5KYIA 2GA4B 4K14A 1K8OA 1HUMA 3A8KE 5EKKA 3D8GA 2HDLA 2B39A 2V4DA 3NUCA 4EGVA 3K7AB 1SYFA 2IWHA 3HZXA 1O7LA 3L3OC 3EROA 5HGTA 2OEOA 2H4OA 1PZKD 5EKLA 1GHKA 2K03A 5FO7B 3A7LA 4BS9A 5EPKA 3D6WA 3NTHA 3EJIA 3SK4A 2K33A 1F2MA 4J8QA 1EY7A 1LV9A 4XYOA 3Q23A 4HMIA 1DXMA 4EQOA 2F0MA 1V43A 4L63B 1LTGD 5E4WC 5IGFA 1HCZA 1TQOA 2VB3X 2K01A 5C0XJ 3I3CA 2DNEA 2KEEA 3PUXA 3JAML 1Y8PB 2TMPA 3D6CA 3SVMA 1E2ZA 2IPKD 2Y0SB 2QF7A 2N88A 5CBAE 2NZ1D 4V0BA 2JE6I 3BZDB 1FD7D 2F03A 4XT1B 5ELFA 2EY1A 2LMCB 4HN7A 2A6HD 2WAQB 2XNAC 2L55A 4HR7B 3TP6A 5BN5A 1EY6A 5M5XB 3Q24A 2EOTA 4C3HG 2A68C 2O2LD 2A68D 5JPMC 2MHVA 5CV5A 3BDCA 1IKMA 1PDQA 4K2LA 1AZQA 1S5FD 3VR5A 5C44B 4HCEA 2R7ZB 4N9PA 1QE6A 1F9PA 1OXSC 3OIQA 3NPPA 4DAVA 2KOLA 2JYOA 1IW7D 3D4DA 4NW2A 1CM9A 1ZEQX 1H9SA 3T56B 4CJ2C 3C3LA 1PRTB 1SE4A 2F3VA 4C56C 2B2UC 2EE1A 3VYRA 1BDOA 1RCVD 2PPBC 1A3VA 4PQXA 2XWBB 1I6VC 3D4RA 1NAPA 2QDBA 1HPCA 1F2YA 1R4PB 2PW7A 1C4QA 2ZT9C 2FMCA 1VMPA 3EQLC 1JB3A 4XQJA 1I6HB 2AQ2B 3GQBA 3M85A 4ZK9B 3SXHA 1CZWA 4FXKC 1Q8IA 5CORA 3ND8A 3FPPA 4RHSA 3OMGA 1MD2D 2IL8A 1JICA 2B2TA 1ML0D 2EYOA 1AW7A 3K0YA 3PMFA 1WD0A 4HTHA 2AUJD 3URYA 3QOJA 4K2KA 3S1NB 5EJWA 4XQNA 3VYSA 1FNVA 3V05A 1G291 1WTVA 2OF1A 3CKIB 1CTMA 1LT4D 5I2YA 1WCMB 3WOFA 1IL8A 1YNJC 3MXGA 4ZKCB 4A3JB 5FLXL 1II3A 3G7LA 1Y69U 2ID0A 5C0XG 4QMGA 3GD7A 1QG7A 3NWSA 2D2CC 1GUGA 4KJNA 4RHRA 5I6WA 1TY2A 2IT1A 2WKDA 3S9WA 3CRKC 1JOOA 4G57A 4LMQD 3IKJA 3RZDB 2B2WA 1A2UA 3SK5A 2JSOA 5C3EB 2L5TA 1LLRD 2K6AA 2H1EA 1CQVA 2RDGA 2K28A 3BYTB 3P20A 3BS1A 1GUTA 2PMZB 2Q8TA 1ONLA 3GTMB 1W6JA 3QO2A 3I90A 1F9QA 4KN4C 2L4NA 1XXGA 2MPMA 1HXYD 4GZYC 3H6MA 4K6DA 5C5LA 2ICIA 4RFBA 4F87A 1MGSA 2LS01 1XX8A 3M7GA 1SNDA 2CW0C 1VF7A 4F8MA 5CV7A 1WVLA 4H44C 1KLUD 1LO5D 2CW0D 1EWCA 2QCPX 1I3QB 3DEPA 4A3MB 2IX3A 2Z4HA 1SYCA 4R8IA 5KGUA 3I4NB 4ODGA 4UAIA 4F88A 4RA8A 1IYUA 3TSSA 4Q5VA 1CK1A 1Q12A 1MBYA 1D2BA 1SYBA 2M2LA 2PCFB 3CU7A 2EXZA 2E75C 1HUNA 2VXWA 3SHLA 3E6ZX 2PQEA 1JWUD 5IIFA 1HTLD 1DOLA 4IUTA 1VMCA 1BNZA 2IX1A 3N6RA 4B9XA 2NUCA 3MXUA 1F2ZA 1RF2D 1CHPD 1X3QA 1PFBA 4IFDH 4FO2A 2BDOA 2EDGA 4J1MA 1HA6A 2YYZA 3NBIA 1Y8NB 3GTQB 1GUOA 1SNOA 1D1KA 2JEBI 1V1PA 2PZUA 1S5BD 2BDNA 5CV9A 1PTOF 4BA2I 2B8FA 4FXGC 4O42A 4A3EB 5A35A 2OXPA 4BY1B 2DY7A 1GUWA 4ZQ3A 1GXDC 1I4GA 1YNND 1STNA 1KDBA 4IUPA 1KAAA 1GJXA 4BBRB 1RODA 3F2UA 4RH6A 4ILWA 1KNAA 1ET6A 1STYA 4A3GB 1STHA 3FMCA 1FR3A 4QUFA 1DD2A 2WB1B 4DFAA 4KY7A 3FRPB 5E3FA 1OO9B 3VR2A 5EPJA 2BOSA 1VDZA 1EEFD 5C4ZA 1PRTC 2FJ2A 1PLFA 4G7ZC 1ET9A 2C9OA 3A54A 3SK8A 3H09A 5EQ0A 1SDFA 1PZID 1QWYA 4TKOB 2Z8LA 1E2VA 1TS3A 4C3JB 4FF4A 4OIKA 4IFDJ 3GTKB 2NN6H 3R2IA 2K7VA 3GP7A 5T1IA 3TZDA 4KY6A 3QOLA 2FHTA 2FINB 2VB2X 3H0GB 1E2WA 3C2PA 3T51B 5J22A 3OIPA 2XSCA 4G7HC 1B3AA 1EIHA 4AYBB 4DNTB 1WTRA 1HHVA 2EVBA 4DAYA 4KHVA 1JWSD 4O1NA 2EYMA 5C4HA 5NUCA 1HFNA 2R6GA 4CKBA 1J9OA 3FKIB 1FGBD 3H3VC 3QIAA 1Y8OB 2NYZD 1F9SA 3ND9A 3NXWA 2EY5A 3CRLC 4HSVA 3MXPA 3HOUB 2XRSD 4RKLA 2EYPA 1ZKOA 2NVQB 5E4XA 4FF3A 1JCKB 1BCPF 2EPBA 3PUVA 1O7YA 3NHHA 1SSOA 4DU9A 4C3IB 1H9JA 4IUUA 2EYLA 1ILPA 2FMMA 3HOVB 2F0UA 1DJRD 1M8AA 2AQ3B 5A2QL 2F0GA 2ZXPA 4K8IA 1EOTA 4NDXA 2AQ1B 5IGCA 3DMUA 2JEAI 3KLSA 1CI3M 3S1RB 1TU2B 1NR4A 2XRQD 1AEXA 4F7XA 2AWOA 4RCNA 4I7ZC 4X3SA 5EKIA 1DCZA 1STBA 4HSPA 1TIID 2J0TD 3GO5A 5JAVA 5KNCA 2SDFA 2JA7B 3A8JE 4DXGA 1A2TA 3K59A 2SNSA 5IGBA 4ZKBB 5DNFA 5LHY1 4HAEA 3LNNA 1A3UA 1LT3D 1I50B 4L8JA 4IUNA 2XIWA 5CGKA 1V8QA 3OSOA 2BCOA 4ULLA 1G91A 1U4LA 2F0NA 3MXNA 4J6HA 1EFID 3PIO3 1R9TB 3TN2A 4IFDG 2PW5A 1PTOB 2QILA 1U4MA 3KBGA 4KTAA 3T16A 3EA6A 3HOXB 1JOKA 3I8ZA 1CQFA 2AWNA 2F0HA 5CV6A 1QCBD 1VF5C 2LKVA 3CQZB 1KNEA 1Q90A 4IURA 3K5LA 1IHZA 2CHBD 1W6KA 1G2TA 3DM1A 1PTOH 2ZXOA 5M3MB 1SNMA 2O5IC 5CV4A 1EQTA 1PYWD 5IGDA 1LTRD 1H9SB 4ABNA 4A93B 3WDNA 3NWTA 4X3KA 1SEBD 2BA0A 3R3OA 1KLGD 1S5DD 2N55A 2L9HA 4KK7A 1EIGA 1BXTA 1EEID 5CMDA 5JVH3 4H0LC 4TRDA 2Q8RE 2M00A 4DK1A 4RGNA 3MAQA 3D31A 4Q0FA 1EY5A 1UUPA 4NP5A 4DXFA 1I4QA 1HRJA 1EYCA 5BN3A 1T5XD 1BBXC 2F0QA 1Y1WB 1SYDA 5DAUA 4U673 3HGBA 2L0CA 1ENCA 2QKIC 1NSNS 2K5QA 4IUVA 2A69C 2EJFC 2E2HB 4L6TB 2NVXB 3Q6SA 2A69D 3GTOB 4OO1H 2NN6G 3DWQA 4BY7B 3D4WA 2E76C 3BYYB 1DM0B 4ME5A 2F1MA 1UAPA 2D9UA 1FNWA 4IN3A 2F0VA 1EY4A 2EYHA 4C3JG 4QB4A 1YNJD 5FOBB 1PXUA 3OHXC 3OMCA 4K8JA 4K5XA 3K5OA 3QWNA 4DN4M 1GUSA 4C1NK 2RSOA 1TWHB 1ESFA 3X3MA 3PIP3 3TDQA 4DAPA 2M9VA 3FEWX 1Z6HA 1B4OA 3BVMA 4E6IA 4S3SA 2F0DA 1BCPB 1JQYD 3FPUB 2B2VC 4XDXA 2A74C 3H94A 4FXDA 5IOCA 4A3FB 1SYGA 5G3LD 4PMCA 1O80A 5D3IB 1DONA 2F0OA 4TQUS 3ERQA 1SNQA 3RZOB 1A6XA 1KTKA 5CYUA 3E5SA 3VA5A 3GTGB 2HUGA 4HCSA 5C0XI 4BWGB 2ZXRA 3TBIB 4KI0A 3TP5A 3AB9A 1SJHD 3LWUA 4A3IB 4P2CB 4PMBA 1QNUA 1C48A 1A3TA 1I4HA 1H9MA 2B63B 1B9MA 2LFNA 4CKEA 1OXVA 3TP8A 4TSSA 3L7ZC 3C1EA 4C3IG 3MTSA 3GTJB 1G8ZD 3UI2A 2E2DC 1TVXA 1RDPD 2WP8J 3PUWA 4BBSB 4KD4A 3OPOA 4KMUC 1XYIA 2J7ZA 1SBBB 3D3RA 4ID6A 2IX0A 3M4YA 5IGEA 1L0YB 5IGGA 5I9PA 4ZLTF 1B9NA 2DN8A 4XT3B 1EZ8A 2NWGA 4FNFA 1SNPA 3NQTA 3K6OA 1LTTD 3Q0AA 3NSWA 3SR1A 2B2YC 3J81E 2BA1A 1V1PB 5FO9B 3BVGA 1X32A 3TZUA 1KDAA 2NBFA 1BR9A 5KNDA 3HRZC 3R93A 2JP1A 4ZYSA 3GTLB 3P1HA 1PTOC 3HEJA 5M9OA 3I73A 3T13A 5E1FA 1T5EA 3IFDA 2Q8IB 2R92B 3DEOA 2F0TA 2L11A 2K1BA 3M3YB 4PV1C 1TT2A 4XQQA 3CHBD 4G7OC 5KNBA 3J80L 1GOZA 3PUZA 4DK0A 2RSNA 4Z9CB 5K5PA 3NBHA 4RAUC 2VNUD 2WKCA 1CHQD 1F2LA 2B2UA 1R4QB 4UDUC 3GTPB 3T53B 2DNCA 1XWEA 1D5ZC 2F0LA 1JOQA 1ZYRC 4FP5D 4CGYB 2SNMA 3JAME 4KKUA 4PNYA 1BF4A 3MWYW 3S14B 1PRTD 4N9TA 4NKLA 3VR4A 2AUKA 1EYAA 1S5CD 1EYDA 3I70A 4OO1G 5KEEA 1I4RA 3OWFA 1B50A 1U4RA 3MVVA 5JEAH 5JJZA 4DGZA 2B2TC 1D5MC 2KVMA 3I4LA 3G6JB 4RCOA 1DYQA 4R8NA 3QJYA 3N52A 1SMYC 2KHSA 1QB5D 2EZVA 1DOKA 3S2DB 3BG3A 5CV8A 4ZRZA 4IQZA 1RTOA 1ICWA 2WINB 1I4PA 1MSHA 3ONAB 3QB3A 1IKLA 3RD4A 2SEBD 4M1UB 2EY2A 2NB0A 2E2JB 1G6ZA 1JC7A 3DUZA 5DEHA 2RVLA 3BDLA 1X3PA 1LT6D 3HG9A 1OXXK 1S4ZA 3AU7A 4ZAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJN A;  2LKV A;  5I6W A;  2F0W A;  3V2T A;  3D4D A;  5C4Z A;  4EQN A;  2F0J A;  3DHQ A;  3S9W A;  2F0V A;  3U9O A;  2EXZ A;  3NP8 A;  3NHH A;  1TR5 A;  1JOO A;  3EJI A;  2F3W A;  4KD4 A;  4DU9 A;  5K5P A;  2F0S A;  1EY4 A;  5J39 A;  4G57 A;  2EYH A;  5CR3 A;  1STG A;  3SK4 A;  1IHZ A;  5ISR A;  1F2M A;  2EYL A;  3SHL A;  4QB4 A;  2F3V A;  2PQE A;  5JOB A;  3SK8 A;  1EY7 A;  3OMC A;  4K8J A;  4K5X A;  1EY8 A;  5IIF A;  2F0U A;  1SNM A;  1JOR A;  4HMI A;  5CV4 A;  4ID6 A;  3MZ5 A;  3P75 A;  1A2U A;  4EQO A;  5IOD A;  4B9X A;  5C3X A;  2F0M A;  2NUC A;  5IGD A;  4DF7 A;  5IGG A;  5IGE A;  2F0G A;  4K8I A;  1A3V A;  3SK5 A;  4NDX A;  2F0L A;  4IZ8 A;  2EYJ A;  3SK6 A;  1F2Z A;  5C6A A;  5I9P A;  5IGC A;  5HUR A;  1JOQ A;  2KQ3 A;  2RDF A;  2QDB A;  4OL7 A;  3DMU A;  3MHB A;  2PZW A;  1F2Y A;  2F0F A;  4ZUJ A;  2PW7 A;  5CC4 A;  5IGF A;  2O4X A;  2SNM A;  3R3O A;  4H7B A;  4PNY A;  3TME A;  2RKS A;  5KYL A;  1TQO A;  1KDC A;  4J1M A;  4E6I A;  1AEX A;  4N9T A;  5I9O A;  4F7X A;  4NKL A;  4S3S A;  1EZ8 A;  2F0D A;  1EY0 A;  3QOL A;  4KY6 A;  4ZUI A;  1EYA A;  1SNO A;  1U9R A;  1EYD A;  1STB A;  5I6Y A;  5KRU A;  5J22 A;  3D6C A;  4TRD A;  2M00 A;  5JAV A;  5IOC A;  3SXH A;  1SNP A;  4K5W A;  5KIX A;  3NQT A;  3LX0 A;  1SYG A;  1EZ6 A;  1NUC A;  2PZU A;  2EY6 A;  2SOB A;  5KEE A;  3H6M A;  3OMG A;  3OWF A;  4K6D A;  4KJO A;  5EGT A;  1A2T A;  1ENA A;  3C1F A;  3EVQ A;  2EYO A;  3MVV A;  4NMZ A;  4PMC A;  5CV9 A;  5C5L A;  4DGZ A;  1EY5 A;  3PMF A;  2SNS A;  2F0O A;  4HTH A;  2EY1 A;  5IGB A;  3ERQ A;  4WRD A;  2OXP A;  3QOJ A;  4R8N A;  4KHV A;  3SR1 A;  1SNQ A;  4EVO A;  4K2K A;  4NP5 A;  4ZQ3 A;  1KAB A;  1SNC A;  3E5S A;  1SND A;  4F8M A;  5C5M A;  3TP7 A;  5CV7 A;  1A3U A;  1EYC A;  1KDA A;  1STN A;  1KDB A;  2KHS A;  2EYM A;  3VA5 A;  5C4H A;  2F0P A;  5NUC A;  3ITP A;  4QF4 A;  1KAA A;  4IUN A;  5CV8 A;  1EY9 A;  2F0K A;  4HMJ A;  4I65 A;  2PYK A;  2F0Q A;  5J1Z A;  3TP6 A;  4K5V A;  4WOR A;  5CGK A;  4YIJ A;  3OSO A;  5KYI A;  1SYD A;  1EY6 A;  4K14 A;  2OF1 A;  2F0I A;  5DAU A;  4B9W A;  1EQV A;  1ENC A;  3QB3 A;  3TP5 A;  5EKK A;  1SYC A;  2PZT A;  3D8G A;  1NSN S;  3P1H A;  5KGU A;  3HEJ A;  4ODG A;  4PMB A;  5M9O A;  2F0N A;  4J6H A;  1STA A;  2F0E A;  1STY A;  2HQE A;  1STH A;  3T13 A;  3NXW A;  2EY5 A;  4KV6 A;  1A3T A;  5CV5 A;  3MEH A;  3NUC A;  5E1F A;  3BDC A;  3MXP A;  3RUZ A;  2EY2 A;  1SYF A;  4K2L A;  2WAC A;  2PW5 A;  2RBM A;  3HZX A;  4IAL A;  1II3 A;  4KY5 A;  3ERO A;  4KTA A;  3D4W A;  4RKL A;  2EYF A;  2F0T A;  2OEO A;  3T16 A;  5F2D A;  3TP8 A;  5HGT A;  1JOK A;  2EYP A;  4KD3 A;  1SYE A;  3C1E A;  4KY7 A;  4ME5 A;  5DEH A;  3BDL A;  4QMG A;  4MIU A;  4N9P A;  1TT2 A;  2ENB A;  4RKB A;  5E3F A;  5EKL A;  4LAA A;  4DFA A;  2F0H A;  4EQP A;  5C3W A;  1SYB A;  5CV6 A;  3NK9 A;  1RKN A; 
#chains in the Genus database with same CATH topology
 4DAM A;  4H13 C;  1JB7 A;  4EQN A;  4MHE A;  4DR1 L;  1K28 A;  2D0O A;  2E74 C;  3NEM A;  1TS4 A;  4JK1 C;  1O7Z A;  1C8C A;  1HR0 Q;  3BDO A;  1XPR A;  2FFK B;  5ISR A;  3HOW B;  1L0X B;  2NTS A;  1V1Q A;  4L5Q A;  4KKT A;  5M5Y B;  2RCF A;  3HS0 C;  3KYH C;  1B53 A;  3ZYY X;  1DGS A;  3NE5 B;  1N32 L;  5IOD A;  4FF2 A;  1QNK A;  2B2W C;  3EN2 A;  1STE A;  1YIJ A;  3LWE A;  1N33 L;  3VR6 A;  1BCP C;  3FKI H;  1LAC A;  1HNZ L;  4A3F G;  1Z47 A;  2PZW A;  1D8L A;  2EJM A;  4G4K A;  4RGO S;  5ELD A;  4A76 A;  4H7B A;  4GOP B;  1TWF B;  3U9S A;  5IY0 A;  3X3N A;  2F4V L;  3MC0 B;  4QGU A;  1Q81 C;  2RA4 A;  4X64 Q;  4IJH A;  3HOU H;  5KRU A;  3DWP A;  3MA2 B;  1Q3L A;  3IRB A;  2K14 A;  3J7Y W;  3RLO A;  3I4M B;  4CKC A;  1EZ6 A;  1HQR D;  2K05 A;  3J81 j;  2NVQ H;  5E7N A;  4UY8 C;  1EIF A;  4JI8 L;  5IYB G;  4A3K B;  1N36 Q;  4YHH L;  1HFG A;  2E5L L;  5JEA J;  1T9H A;  3DM3 A;  4JBM A;  1J8I A;  3VA7 A;  1MSG A;  1N34 Q;  1EL0 A;  4A4I A;  4OGQ C;  1PFM A;  4B08 A;  4C1N I;  5C5M A;  4A3I G;  3ITP A;  3OWE B;  3S16 B;  2PYK A;  3J81 c;  1W3S A;  2R61 A;  2OQK A;  3A55 A;  1UEB A;  1NCV A;  4ZCK A;  2MUY A;  1M4V A;  2AKW B;  1E0B A;  5FLX E;  5IT9 L;  1NY4 A;  4APV A;  1PZJ D;  4A3M G;  4KV6 A;  3MFY A;  1CKN B;  3S1R H;  4RWS C;  3HKZ B;  4DV4 Q;  1JJ2 A;  3RUZ A;  4BXX G;  3GV3 A;  1QIL A;  2WAC A;  2RBM A;  1OXU A;  3SEB A;  4BBS G;  5LL6 S;  1CA6 A;  4P75 A;  1RHP A;  3MXN B;  3S16 H;  5EBC A;  3RMH A;  5C3W A;  4IUQ A;  1QJO A;  1YEZ A;  4PMW A;  3F2C A;  1NUC A;  4JC0 A;  2K5W A;  1B2T A;  3PUY A;  4X6A H;  1VQ4 A;  4R4O A;  3K58 A;  3J7Z C;  1P16 A;  3NP8 A;  4A3L H;  1VCI A;  2QA4 A;  4LFA L;  2NTT A;  1IBK L;  4GN3 B;  1JJG A;  2A5H A;  1JOR A;  3S15 B;  3A7A B;  2MP1 A;  3HP3 A;  4B3M L;  3KDF A;  3BVZ A;  3P75 A;  1I50 H;  5LMU Q;  3J7A V;  4IZ8 A;  2EYJ A;  1Y1V B;  2KCC A;  2OTJ A;  2KQ3 A;  2B2Y A;  2RDF A;  3PCO B;  1TS5 A;  2A6H C;  5FLM G;  3TME A;  1KDC A;  1SFO B;  3AYH B;  4WJ3 M;  2I46 A;  4KHZ A;  1WTQ A;  3DXJ C;  4NPS A;  2K5H A;  2Z1C A;  4ZUI A;  1XMO Q;  1J5E L;  4CBV A;  1F77 A;  5I6Y A;  3JAM c;  2MGS A;  3KUP A;  5EBD A;  5D3D A;  3I7F A;  1HNW Q;  3K5M A;  2SOB A;  1IBL L;  2EY6 A;  1HZ9 A;  5IP7 G;  4K6L A;  1ENA A;  4EVO A;  3C1F A;  5AJ3 Q;  1H95 A;  1WOC A;  4AQY Q;  4OEL B;  3CQZ H;  2K04 A;  1LTB D;  3CCL A;  2JXM B;  3RNU A;  3VR3 A;  3PO2 B;  5JVG 3;  4DR4 Q;  2KCN A;  2B29 A;  1SNC A;  4IFD I;  1SFO H;  1BUV T;  4LNQ A;  1PA6 A;  1VQN A;  1U4P A;  4OWX B;  2V1C C;  4QJF A;  3VYU A;  1EY9 A;  2F0K A;  4HMJ A;  2K5V A;  4N8F A;  2X6L A;  1IW7 C;  1LTA D;  3KF8 A;  4JI7 Q;  3I72 A;  1D6E C;  2K50 A;  4J15 A;  1PH3 A;  5FO8 B;  3UE1 A;  3FDT A;  1VQ9 A;  3MFG A;  5JPN C;  3R2T A;  3H91 A;  4IAL A;  4KY5 A;  2OCE A;  3FP9 A;  2EYF A;  1K3R A;  4A3G G;  1JR0 D;  4RKB A;  1QVC A;  3DWA A;  4HED A;  2B8G A;  3NK9 A;  4RGT A;  1GHJ A;  2HDM A;  1TWA B;  4QIW B;  1G2S A;  4RMF A;  2WB1 G;  1U5K A;  3KK7 A;  4JBW A;  5DM7 3;  1UE7 A;  3R8B A;  2X69 A;  2UU9 Q;  5JEA G;  1GUN A;  3SGI A;  5FJ8 H;  1Q46 A;  4NXN Q;  1IZ6 A;  1RJT A;  3M4O B;  1H9R A;  4RGM A;  1CUK A;  4MN3 A;  5C3X A;  4POG A;  3IAY A;  1Q1E A;  1YZ6 A;  4K0K L;  1Y1W H;  5C4J B;  1W2B A;  1GKH A;  5HUR A;  1EU4 A;  1HR0 W;  4ZUJ A;  2I07 B;  4WFN 3;  3OOC A;  4DV5 Q;  1PH4 A;  2RKS A;  1Z7T A;  5IYC G;  1SXT A;  1I5F A;  1K8M A;  2E2H H;  2F3I A;  1XNR L;  2WV6 D;  3WOE A;  4A75 A;  1SE2 A;  3GTO H;  2HCI A;  4BY7 H;  4DR7 L;  3OTO L;  3V96 A;  3M4O H;  1B3Q A;  2BE5 C;  4KN7 C;  2WB1 E;  4R4C A;  5HGQ A;  3LX0 A;  1IYV A;  1QZG A;  2BE5 D;  4WJW A;  1VQH A;  2VW9 A;  1DZ1 A;  5C4J H;  2QDL A;  3NTK A;  2ALY B;  2EXD A;  2UUC Q;  2OQ0 A;  1B7Y B;  2JA5 B;  2TSS A;  1HTP A;  4M8A A;  1AN8 A;  1UEA B;  3CF5 A;  1WTP A;  1HH2 P;  4DR2 L;  1RD9 D;  3O13 A;  3CC7 A;  1UE1 A;  3J80 E;  5BN4 A;  2PI2 E;  4B3T L;  2VQE L;  3S17 B;  2KUM A;  2NN6 I;  2AMC B;  4FYD A;  2QEX A;  1CFM A;  2LXJ A;  2RDH A;  3FVQ A;  4X62 Q;  3PO3 B;  1PMR A;  4I65 A;  1LTI D;  1AE2 A;  3SDZ A;  3K0X A;  4B9W A;  3S24 A;  1EQV A;  3CW2 C;  2PZT A;  5COY A;  3VYT A;  4R9W A;  2F0E A;  1TWH H;  2HQE A;  3AMU A;  3MEF A;  2ZJR A;  2JA5 H;  1Q86 C;  2YTV A;  1X6O A;  3FKI G;  1LT5 D;  5FLX c;  4FF1 A;  2F4I A;  3CC4 A;  1B8A A;  2KJX A;  1ZXT A;  4OXP A;  5F2D A;  3EIV A;  5G3L F;  2YTX A;  1HA5 A;  3RLF A;  2IW3 A;  3PO3 H;  4LAA A;  3NQI A;  1Q82 C;  1DOM A;  4IJL A;  4A3F H;  3HOU G;  1CKM A;  1RKN A;  5K36 H;  2ICE C;  3I4O A;  5LL6 X;  4V19 0;  1XTD A;  2IJ0 A;  2LY7 A;  2F0J A;  4AYB E;  4DV1 Q;  1MI2 A;  1XTC D;  2HCC A;  1D7Q A;  1STG A;  1BOS A;  1BBW A;  1BO0 A;  2KED A;  3HOZ B;  4JV5 Q;  1SR3 A;  1AP0 A;  5ELC A;  2N3S A;  3GTG H;  3A8I E;  5FK9 C;  3RN2 A;  4GOP C;  1XPU A;  1A15 A;  3Q22 A;  5C6A A;  1TWC B;  2VUM B;  1CZG A;  2CVR A;  5M5W B;  3MHB A;  2PNH A;  3K5N A;  2F0F A;  2G9H D;  2O4X A;  3I4M G;  4A3I H;  4HJA A;  4OX9 Q;  1RTN A;  1K0R A;  3ER0 A;  5KYL A;  2XVS A;  4YCW A;  3WWV A;  4X3U A;  2EJG C;  4BA1 I;  3G71 A;  2K5D A;  3PIO A;  4P71 A;  5D65 A;  4QCL A;  2XWJ B;  3S2H B;  4DPG A;  1B44 D;  2B63 H;  4JBK A;  1QOH A;  1U0L A;  1EWH A;  2VZA A;  3EVQ A;  2DJF C;  1K0S A;  2L12 A;  5I2X A;  2PO4 A;  1VQJ A;  1TWC H;  2QEJ C;  4JI1 L;  4GKK Q;  2VUM H;  1UNS A;  4BXX H;  1PHJ A;  4XTC S;  3HOY B;  4BBS H;  3CD6 A;  4A3L G;  2RCN A;  2Z6K A;  2F0P A;  4LF4 L;  3SE0 A;  3S2H H;  4JYA Q;  4A3C G;  4XIG S;  1SRU A;  2D62 A;  5J1Z A;  3HKZ G;  4K5V A;  4WOR A;  3L9A X;  4YIJ A;  4L5T A;  2CFM A;  5AFW A;  5BR8 Q;  4C2M B;  3NTI A;  2NVT B;  1WD1 A;  1D1I A;  1BVS A;  1CSP A;  1TY0 A;  2CQO A;  1QZH A;  1ILQ A;  2WII B;  1A62 A;  5LMN L;  1L1O C;  3HOY H;  4X3T A;  2K52 A;  1WTW A;  2JA6 B;  4ME3 A;  1CA5 A;  3GV6 A;  1LM0 A;  5EAY A;  3BZC A;  4C3H B;  3KLS X;  2E2I B;  2D5D A;  3CCS A;  2XGT A;  5ELE A;  1WTO A;  5D14 A;  4XXE A;  2IY5 B;  4DNI A;  2F0W A;  3V2T A;  4DR3 Q;  4B3R L;  4OHJ A;  4GLV B;  1E3P A;  5GAH C;  2KHJ A;  1TR5 A;  3EFX D;  5J39 A;  1PTO D;  3S1Q B;  4A3D B;  4LK1 C;  3QG1 A;  1Y1V G;  5A2Q E;  2G9D A;  1B1Z A;  1HQM C;  4DV3 L;  1VQP A;  3HKZ E;  1SE3 A;  1K83 B;  5CBE E;  1VQ6 A;  2R93 B;  3MZ5 A;  3K57 A;  4C3H H;  4JI4 Q;  4JPB W;  2X6G A;  2E2I H;  4DF7 A;  2CQA A;  1MJC A;  4LJZ C;  5FKA C;  1CT1 D;  3NBH B;  1AFP A;  1OTC A;  1NR2 A;  3J7A F;  2XN9 C;  4OL7 A;  2JA8 B;  1V1O A;  3GTL H;  4FVM A;  5CC4 A;  1UE6 A;  3NEN A;  1YNN C;  3BZK A;  3I91 A;  5I9O A;  1BQQ T;  2PQA A;  1XPO A;  3K8A A;  1U9R A;  4CDE C;  2R92 H;  1S5E D;  3PO2 G;  5IT9 E;  4NXM Q;  1ICF B;  1FYC A;  5C4X B;  3E0J A;  4K5W A;  4HID A;  5EPL A;  3AEV A;  3M7N A;  1PFN A;  4A3B B;  4JOI A;  1QUQ A;  2NVY B;  4NMZ A;  2DY8 A;  3KBX A;  4QL5 A;  1E1O A;  2A73 B;  4U68 A;  4YWM A;  4HIO A;  4WRD A;  3STB D;  1I4X A;  3L0O A;  1ZYR D;  3KJP A;  2RQX A;  3C46 A;  1TS2 A;  2J4X A;  2I0Q A;  2HHH Q;  4YY3 L;  1VQ5 A;  3S1M B;  2MJ8 A;  5TSS A;  1VQA A;  4CJ1 B;  4QF4 A;  5JJL A;  1OXT A;  4XYQ A;  1EU3 A;  5FJ8 G;  2PNR C;  1SJE D;  3J80 c;  3W2D A;  1D5X C;  2O5J C;  2F0I A;  1XNQ L;  1PRT F;  4A3B H;  4JCV E;  2NVY H;  3IFT A;  1STA A;  2Q2T A;  3PIP A;  3MEH A;  1O78 A;  3W3A A;  3S14 H;  4CJ0 B;  3P7J A;  1VQO A;  1VQF A;  4DR6 Q;  3KLR A;  4LF7 L;  2PI2 A;  3S1M H;  4LFB Q;  4KD3 A;  1SYE A;  3RR5 A;  4DR4 L;  1SMY D;  4MIU A;  2ZJQ A;  2ENB A;  4EQP A;  2K32 A;  4NB3 A;  5GQO A;  1IYJ B;  3CCU A;  1LTL A;  4OIJ A;  2A6E C;  4JI0 L;  3T4A C;  3DHQ A;  3PV0 A;  1PH2 A;  3U9O A;  1Q1B A;  5J3B A;  1J6Q A;  4DA2 A;  2A6E D;  3VDY A;  2UUB Q;  2F3W A;  2F0S A;  5ELB A;  2L1B A;  4CHT B;  5CR3 A;  3CMA A;  1MKH A;  1H9K A;  1SAP A;  3RLN A;  5DM6 3;  4LF5 Q;  5JOB A;  1FNU A;  1ESR A;  1B70 B;  1EY8 A;  1AZP A;  1V9P A;  4DNR B;  2QGQ A;  4OO1 I;  3S2D H;  4GKJ Q;  4B3S L;  4IPC A;  4DR1 Q;  1TKW B;  5M3F B;  1S40 A;  1LTS D;  3SK6 A;  4UP7 A;  1WTX A;  2RF4 A;  2C5C A;  2R3Z A;  2GVA A;  1F9R A;  2OT2 A;  2Z4I A;  2KA7 A;  2KEC A;  1ENF A;  3IL8 A;  4LWC A;  1JWM D;  2B2V A;  4CDF C;  5C0X H;  1EY0 A;  4GNX C;  1Q8K A;  2JA5 G;  3OW7 A;  5I4D A;  2E2J H;  5KIX A;  5T1G A;  3T1H L;  2HIX A;  1LAB A;  1NE3 A;  3A56 A;  4KKS A;  4KJO A;  5EGT A;  4R4T A;  4IO9 A;  1E24 A;  1PH8 A;  3PO3 G;  4QUC A;  4O0A A;  4ALP A;  4Y7N B;  5K36 G;  1BCP D;  1YVC A;  2OWO A;  1TWG B;  1KAB A;  3AQQ A;  2Z6B A;  3TP7 A;  1YBY A;  1JE4 A;  4YWK A;  3HOW H;  3CAM A;  4JI8 Q;  1NJI C;  1HZB A;  2YU9 B;  5M5Y H;  3J81 L;  4CDD C;  3H3V I;  5KYI A;  2GA4 B;  4K14 A;  1K8O A;  1HUM A;  3A8K E;  3PSI A;  4LF8 Q;  5EKK A;  3D8G A;  1CSQ A;  2K5N A;  2HDL A;  4P73 A;  2B39 A;  2V4D A;  3NUC A;  4X66 L;  4EGV A;  3J81 i;  3KF6 A;  1TWF H;  3K7A B;  1SYF A;  2IWH A;  3HZX A;  1O7L A;  3L3O C;  3ERO A;  5HGT A;  1YJ9 A;  2OEO A;  2H4O A;  1PZK D;  1X65 A;  2N78 A;  5EKL A;  4X64 L;  1GHK A;  2K03 A;  5FO7 B;  2I5M X;  2B63 G;  3E9I A;  3I4M H;  3A7L A;  3HOZ G;  4BS9 A;  5EPK A;  3D6W A;  4A3K H;  3NTH A;  3EJI A;  3SK4 A;  2K33 A;  1F2M A;  2VUM G;  4J8Q A;  1EY7 A;  1LV9 A;  3K7A H;  4LFC L;  4LF6 Q;  1K8G A;  4XYO A;  3LGJ A;  3Q23 A;  4HMI A;  1DXM A;  4EQO A;  2F0M A;  1YHA A;  1V43 A;  4L63 B;  1I94 L;  1WFQ A;  1LTG D;  5E4W C;  5IGF A;  1YIT A;  1KRT A;  3KDF B;  1A63 A;  1HCZ A;  1TQO A;  2VB3 X;  2K01 A;  4HJ5 A;  2K75 A;  4B3M Q;  4A3C H;  5C0X J;  3I3C A;  2DNE A;  1VQK A;  2KEE A;  3PUX A;  3JAM L;  1Y8P B;  4DV4 L;  2TMP A;  3D6C A;  3SVM A;  1E2Z A;  3HOY G;  2IPK D;  2Y0S B;  2QF7 A;  2KCT A;  2N88 A;  5CBA E;  1LYL A;  2NZ1 D;  4V0B A;  4GLX A;  2JE6 I;  3BZD B;  1FD7 D;  5IT9 c;  2F03 A;  4XT1 B;  5ELF A;  2EY1 A;  2LMC B;  1FGU A;  3JAM i;  4JI3 Q;  4HN7 A;  3ZJY C;  3CCQ A;  2A6H D;  2WAQ B;  1QVF A;  4FDB A;  2XNA C;  2L55 A;  1FJG L;  3CME A;  4HR7 B;  3S15 H;  3TP6 A;  1HZC A;  1GVP A;  5BN5 A;  2JA6 G;  1EY6 A;  5M5X B;  3Q24 A;  4LUZ A;  2JK8 A;  2EOT A;  4C3H G;  2DJG C;  1VQ8 A;  2A68 C;  2CWA A;  2O2L D;  5LMU L;  1Y1V H;  4HJ9 A;  2A68 D;  5JPM C;  2MHV A;  5CV5 A;  3BDC A;  3KF8 B;  1IKM A;  1PDQ A;  4K2L A;  3BJU A;  2ZM6 L;  1WJJ A;  1AZQ A;  1S5F D;  1WI5 A;  3VR5 A;  5C44 B;  4HCE A;  4A3D G;  2R7Z B;  4N9P A;  1QE6 A;  1F9P A;  1OXS C;  2BH8 A;  3OIQ A;  3NPP A;  4IPH A;  4DAV A;  2KOL A;  2R92 G;  5GRO A;  1Q7Y C;  2JYO A;  1EWI A;  3AFQ A;  1IW7 D;  1YJW A;  3D4D A;  5HY6 A;  2F52 A;  4NW2 A;  2N49 A;  4MTN A;  1CM9 A;  1ZEQ X;  5AJ3 L;  4AQY L;  1H9S A;  1VQ7 A;  3T56 B;  3PO2 H;  4DK6 C;  4CJ2 C;  3C3L A;  1YNX A;  1PRT B;  1SE4 A;  2F3V A;  2JA8 G;  4C56 C;  2B2U C;  2EE1 A;  3VYR A;  1BDO A;  3F8T A;  1RCV D;  2PPB C;  1VQE A;  4DUY L;  1SE8 A;  2R7Z H;  1K9M C;  1A3V A;  4PQX A;  2XWB B;  1I6V C;  3HKS A;  1NNX A;  3KOJ A;  3D4R A;  4JI7 L;  1NAP A;  2Q2H A;  2QDB A;  4GN5 A;  5C4X G;  1HPC A;  1F2Y A;  1R4P B;  2PW7 A;  1C4Q A;  2ZT9 C;  2FMC A;  1VMP A;  3EQL C;  4A3B G;  1JB3 A;  4XQJ A;  4I7A A;  1I6H B;  2AQ2 B;  1O7I A;  4K0K Q;  4IOA A;  3GQB A;  4R4I A;  4RG1 A;  3M85 A;  4ZK9 B;  1BKB A;  1CZW A;  1RIP A;  4FXK C;  3SXH A;  1Q8I A;  5COR A;  3ND8 A;  3FPP A;  4RHS A;  3OMG A;  1MD2 D;  2IL8 A;  1JIC A;  2B2T A;  2CCZ A;  1ML0 D;  2EYO A;  1K3B C;  1AW7 A;  3NEL A;  3D0F A;  1TWA H;  3K0Y A;  3PMF A;  1WD0 A;  4MTK A;  1XNR Q;  4HTH A;  2AUJ D;  3URY A;  3QOJ A;  4K2K A;  1HNX Q;  3OTO Q;  4PZ8 A;  3S1N B;  1YHQ A;  2UXB L;  3Q8D A;  5EJW A;  1I6H H;  4XQN A;  3VYS A;  1FNV A;  3V05 A;  1G29 1;  4NXN L;  3PF4 A;  1WTV A;  1KRS A;  5IP9 H;  2OF1 A;  3T1Y Q;  1IBM L;  4DR2 Q;  3CKI B;  1CTM A;  1LT4 D;  5I2Y A;  1WCM B;  3WOF A;  1IL8 A;  1YNJ C;  3MXG A;  2P5Z X;  5ELO A;  4DR5 L;  4ZKC B;  2LXK A;  4DV5 L;  4JBJ A;  5FLX L;  4A3J B;  1II3 A;  3G7L A;  1Y69 U;  3S1N H;  2ID0 A;  1IL2 A;  1Y14 B;  4JI2 Q;  5C0X G;  4QMG A;  3GD7 A;  1QG7 A;  3NWS A;  2D2C C;  1E1T A;  1GUG A;  4KJN A;  4RHR A;  5I6W A;  1TY2 A;  2IT1 A;  2WKD A;  3S9W A;  1Z9F A;  3CRK C;  4IPD A;  1TXY A;  4GNX A;  1JOO A;  5M3F G;  4G57 A;  1WCM H;  2UUC L;  3TRZ A;  3H3V H;  4LMQ D;  4JI6 Q;  3IKJ A;  3RZD B;  3S17 H;  2B2W A;  1A2U A;  4Y52 H;  4X62 L;  3HOW G;  3SK5 A;  2JSO A;  5C3E B;  2L5T A;  1LLR D;  2K6A A;  4JI5 L;  1KD1 C;  2H1E A;  1CQV A;  3L2P A;  1JE5 A;  1IXR A;  2RDG A;  2R7D A;  2K28 A;  3BYT B;  3P20 A;  4JW0 A;  3BS1 A;  2R7F A;  1GUT A;  3K7U C;  2PMZ B;  2Q8T A;  1ONL A;  2Z9H A;  3GTM B;  1W6J A;  3A74 A;  3QO2 A;  3I90 A;  2UXD Q;  1F9Q A;  4KN4 C;  2L4N A;  1XXG A;  2MPM A;  1HXY D;  4GZY C;  2KEN A;  3H6M A;  4K6D A;  1LUZ A;  3FHW A;  5C5L A;  3G6E A;  5C3E H;  2ICI A;  1S72 A;  4RFB A;  4F87 A;  4CDC C;  1MGS A;  2LS0 1;  3E0E A;  1XX8 A;  3M7G A;  3CCM A;  1SND A;  2CW0 C;  1VF7 A;  4F8M A;  4A3K G;  5CV7 A;  1WVL A;  4H44 C;  1KLU D;  1LO5 D;  1XMQ Q;  2CW0 D;  1EWC A;  1X3G A;  2QCP X;  3HOZ H;  1I3Q B;  3DEP A;  4A3M B;  2ZJP A;  4JI1 Q;  2IX3 A;  4JV5 L;  2Z4H A;  1SYC A;  4R8I A;  5KGU A;  3I4N B;  4ODG A;  4P72 A;  5M5W H;  4UAI A;  4F88 A;  4RA8 A;  4LF9 Q;  4KHP L;  1IYU A;  1C9O A;  3TSS A;  4Q5V A;  4DV6 Q;  4X65 Q;  1CK1 A;  2C35 B;  1Q12 A;  1MBY A;  1D2B A;  4DV0 Q;  4DV7 Q;  1I3Q H;  2VQF L;  1SYB A;  2M2L A;  2NZH A;  2PCF B;  4YCU A;  5LMN Q;  4DUZ L;  3CU7 A;  2EXZ A;  5IE8 A;  2E75 C;  2MQH A;  3I4N H;  1HUN A;  1UWV A;  2VXW A;  4OEM B;  3SHL A;  4HJ7 A;  3E6Z X;  2PQE A;  1JWU D;  5IIF A;  1HTL D;  1DOL A;  3M9B A;  4IUT A;  1VMC A;  1BNZ A;  2IX1 A;  3N6R A;  4B9X A;  2NUC A;  3KLW A;  1SMX A;  4WJ4 A;  3MXU A;  1F2Z A;  1RF2 D;  3G48 A;  2CH4 W;  1CHP D;  1X3Q A;  3I55 A;  1PFB A;  1PH1 A;  3PQI A;  4C2M H;  4IFD H;  4QY7 A;  4FO2 A;  3CPF A;  5BR8 L;  2NVT H;  2Y0S G;  3JC6 6;  4IOC A;  2BDO A;  2EDG A;  5JJI A;  3QR8 A;  4J1M A;  1HA6 A;  2YYZ A;  3NBI A;  1FL0 A;  1Y8N B;  3GTQ B;  1GUO A;  1SNO A;  1YHB A;  1D1K A;  2JA6 H;  2JEB I;  3K80 C;  1V1P A;  2WAQ G;  2PZU A;  1S5B D;  2BDN A;  1XJV A;  3TRE A;  5IWA L;  5CV9 A;  2PQA B;  1PTO F;  4GN4 B;  4BA2 I;  2B8F A;  4FXG C;  4O42 A;  4A3E B;  5A35 A;  2OXP A;  4BY1 B;  2DY7 A;  1GUW A;  4ZQ3 A;  4DV2 L;  1GXD C;  3S1Q H;  1I4G A;  4A3D H;  3CCV A;  1YNN D;  1STN A;  3RN5 A;  1KDB A;  1QUQ B;  4IUP A;  1KAA A;  1K83 H;  2R93 H;  1GJX A;  4BBR B;  1ROD A;  4JI4 L;  3F2U A;  2OTL A;  4RH6 A;  5C44 G;  3I56 A;  4ILW A;  2R7Z G;  1KNA A;  1ET6 A;  1STY A;  4A3G B;  1STH A;  3FMC A;  2JA8 H;  4A3E H;  3UDX A;  5IYD G;  1FR3 A;  3J80 i;  4QUF A;  1DD2 A;  1PFS A;  2WB1 B;  2WAQ E;  3E9H A;  4DFA A;  4KY7 A;  3FRP B;  3K81 C;  5E3F A;  1NMG A;  1OO9 B;  3VR2 A;  5C4X H;  4LW1 A;  5EPJ A;  4BBR H;  2BOS A;  2I5L X;  1VDZ A;  1EEF D;  5C4Z A;  1PRT C;  1PH6 A;  1ASZ A;  2ZTC A;  2FJ2 A;  1PLF A;  4G7Z C;  1ET9 A;  5H1S E;  2C9O A;  3A54 A;  4O2D A;  3SK8 A;  3H09 A;  5EQ0 A;  2HD3 A;  1SDF A;  1PZI D;  1QWY A;  4JI0 Q;  3F1Z A;  4TKO B;  2Z8L A;  1E2V A;  1TS3 A;  4C3J B;  4FF4 A;  4OIK A;  4IFD J;  1EOV A;  4YWL A;  3GTK B;  2NN6 H;  3R2I A;  5IP9 G;  2K7V A;  3GP7 A;  5T1I A;  3TZD A;  2UUA L;  4KY6 A;  3QOL A;  1HZA A;  2FHT A;  2FIN B;  2VB2 X;  3H0G B;  1E2W A;  2B3G A;  3C2P A;  3B6Y A;  3T51 B;  5J22 A;  2BH2 A;  1KAW A;  3OIP A;  2XSC A;  4G7H C;  1B3A A;  3TS0 A;  4EX5 A;  1EIH A;  4AYB B;  2UXC L;  4DNT B;  1KIX A;  4C3J H;  4QIW E;  1WTR A;  1HHV A;  2EVB A;  3GTK H;  4DAY A;  4KHV A;  1JWS D;  1PVO A;  2CKZ B;  3ULJ A;  3G4S A;  4UP9 A;  1MHW C;  2MO0 A;  4O1N A;  3T1H Q;  1N32 Q;  2EYM A;  2VL6 A;  5C4H A;  5NUC A;  3H0G H;  1WCM G;  1WTH A;  1S3O A;  4LF5 L;  1HFN A;  1N33 Q;  2R6G A;  3TQY A;  4CKB A;  1HNZ Q;  1J9O A;  3FKI B;  1FGB D;  3H3V C;  3QIA A;  5M3F H;  1Y8O B;  4GKJ L;  2NYZ D;  1F9S A;  1L2F A;  3ND9 A;  2GVB A;  2F4V Q;  3NXW A;  4PZ6 A;  2EY5 A;  3CRL C;  4HSV A;  3MXP A;  3HOU B;  1VQG A;  2JJQ A;  2XRS D;  4RKL A;  1HR0 L;  2EYP A;  1ZKO A;  2LSS A;  2NVQ B;  4YHH Q;  5E4X A;  2E5L Q;  4FF3 A;  1MJE A;  1JCK B;  1BCP F;  3KF6 B;  2EPB A;  4X66 Q;  2VY3 A;  3PUV A;  2ZTD A;  4UHV A;  1O7Y A;  4POF A;  3TS2 A;  2JN4 A;  1CKO A;  3NHH A;  1SSO A;  3W1G A;  2QW7 A;  4DU9 A;  4C3I B;  1H9J A;  5C3E G;  4IUU A;  4Y7N H;  2EYL A;  3U50 C;  4PZ7 A;  1TWG H;  1ILP A;  2FMM A;  4JVZ A;  3E3X A;  3J7A 5;  3HOV B;  2F0U A;  1DJR D;  4GOP A;  3CCE A;  1M8A A;  1PH5 A;  2K4K A;  5LMN W;  2AQ3 B;  5A2Q L;  2F0G A;  2ZXP A;  4K8I A;  2YU9 H;  1EOT A;  4NDX A;  2L15 A;  2AQ1 B;  5IGC A;  1NMF A;  3DMU A;  2JEA I;  5L37 A;  4LF8 L;  3KLS A;  1CI3 M;  4TVA B;  3S1R B;  1PH9 A;  1N36 L;  1TU2 B;  4LFC Q;  1NR4 A;  2XRQ D;  1AEX A;  2XTI A;  4F7X A;  2AWO A;  4C3I H;  4RCN A;  2A1A A;  4I7Z C;  3ULP A;  4X3S A;  5EKI A;  3F2D A;  1DCZ A;  1STB A;  4AIM A;  1QVG A;  4HSP A;  1N34 L;  1TII D;  2J0T D;  3GO5 A;  5JAV A;  1I94 Q;  3HOV H;  5KNC A;  1FVI A;  2SDF A;  2JA7 B;  3A8J E;  4DXG A;  1A2T A;  3K59 A;  3UDG A;  2ATW A;  2SNS A;  4LFA Q;  5IGB A;  1A8V A;  4ZKB B;  1IBK Q;  5DNF A;  5LHY 1;  1PH7 A;  2FXQ A;  4HAE A;  3LNN A;  1A3U A;  1LT3 D;  3I4N G;  3AFP A;  1I50 B;  4L8J A;  1EQR A;  4IUN A;  2PMZ E;  1L1O B;  2Z6K C;  1CKN A;  4LF6 L;  2XIW A;  5CGK A;  1V8Q A;  3OSO A;  1E22 A;  1UE5 A;  2BCO A;  2JA7 H;  4ULL A;  1G91 A;  1U4L A;  2F0N A;  3MXN A;  4J6H A;  1EFI D;  1L1O A;  1J5E Q;  3PIO 3;  1R9T B;  1FJG Q;  3TN2 A;  4IFD G;  3KFU A;  2HT1 A;  2PW5 A;  1PTO B;  2QIL A;  1U4M A;  3KBG A;  3F2B A;  4KTA A;  5GAE C;  3T16 A;  3EA6 A;  3HOX B;  1IBL Q;  1JOK A;  3I8Z A;  1CQF A;  2AWN A;  2F0H A;  5CV6 A;  1QCB D;  4LUO A;  1VF5 C;  2LKV A;  3CQZ B;  5JJK A;  2JQO A;  1KNE A;  1Q90 A;  4IUR A;  2ZM6 Q;  3K5L A;  3PGZ A;  1YJN A;  1IHZ A;  1R9T H;  4JI3 L;  2CHB D;  2H5X A;  1W6K A;  1G2T A;  1KHI A;  3DM1 A;  1PTO H;  2ZXO A;  5M3M B;  1SNM A;  2O5I C;  1JT8 A;  3M4Q A;  5CV4 A;  3HOX H;  1EQT A;  1PYW D;  1XMO L;  5IGD A;  1LTR D;  1H9S B;  4ABN A;  4A93 B;  5M5X H;  1NTG A;  3WDN A;  1HNW L;  2R93 G;  3NWT A;  4X3K A;  1SEB D;  2BA0 A;  3R3O A;  4QQB X;  1KLG D;  1S5D D;  2N55 A;  2EIF A;  4MNO A;  2Q2I A;  2L9H A;  4DUY Q;  4UP8 A;  4KK7 A;  1EIG A;  2D0P A;  1BXT A;  1EEI D;  1EUJ A;  5CMD A;  3KJO A;  3EBE A;  4H0L C;  5JVH 3;  4A3E G;  4TRD A;  2Q8R E;  2M00 A;  2YTY A;  4BY1 G;  4DK1 A;  2I5H A;  5M3M H;  4RGN A;  3MAQ A;  5C44 H;  3D31 A;  2E8G A;  1GD7 A;  4Q0F A;  4A93 H;  1EY5 A;  4JOI C;  5IYD H;  4BBR G;  2RHQ B;  3A0J A;  1UUP A;  2N8N A;  4NP5 A;  4DXF A;  1A0I A;  1I4Q A;  1HRJ A;  1EYC A;  1M1K C;  5BN3 A;  2DUD A;  2MO1 A;  1T5X D;  1BBX C;  1VQB A;  5DLQ E;  1VQL A;  2F0Q A;  4HJ8 A;  1EQQ A;  1Y1W B;  4OWT B;  1SYD A;  2AHO B;  5DAU A;  4U67 3;  3HGB A;  2L0C A;  1ENC A;  1X3F A;  2QKI C;  1NSN S;  2K5Q A;  2GN5 A;  4IUV A;  3CXC A;  2A69 C;  2EJF C;  2UXB Q;  2JA9 A;  2E2H B;  2KHI A;  4L6T B;  2NVX B;  3Q6S A;  2A69 D;  2CWP A;  3GTO B;  4OO1 H;  3ULL A;  4DR7 Q;  2NN6 G;  3DWQ A;  2UU9 L;  4BY7 B;  3D4W A;  3CCR A;  2E76 C;  3BYY B;  1DM0 B;  1GM5 A;  4ME5 A;  2F1M A;  1IBM Q;  1UAP A;  3U4Z A;  2D9U A;  2ZTE A;  1FNW A;  4IN3 A;  3UDF A;  4DR5 Q;  2G5D A;  2F0V A;  4B3T Q;  1X3E A;  2VQE Q;  1EY4 A;  2EYH A;  2CH4 A;  2NVX H;  4C3J G;  1RL2 A;  4QB4 A;  1YNJ D;  5FOB B;  1PXU A;  3OHX C;  1HNX L;  3OMC A;  4K8J A;  4K5X A;  3K5O A;  3QWN A;  4DN4 M;  4GNX B;  1GUS A;  4C1N K;  2RSO A;  3H0G G;  1C0A A;  1TWH B;  1ESF A;  1X9N A;  1NBW A;  3X3M A;  3PIP 3;  3UDI A;  3TDQ A;  4DAP A;  2M9V A;  3FEW X;  1K73 C;  1Z6H A;  1B4O A;  3T1Y L;  5GAG C;  3BVM A;  4E6I A;  4AYB G;  3PF5 A;  4S3S A;  5ELN A;  2F0D A;  1BCP B;  1JQY D;  4P74 A;  3FPU B;  2B2V C;  4XDX A;  2VS1 A;  2A74 C;  4A3J H;  3H94 A;  4FXD A;  5IOC A;  4A3F B;  4JI5 Q;  1SYG A;  1EIY B;  2DGY A;  5G3L D;  4JI2 L;  2Z0S A;  4PMC A;  1O80 A;  2ASB A;  5D3I B;  1DON A;  2F0O A;  4TQU S;  3ERQ A;  1C7Y A;  3CCJ A;  1SNQ A;  3RZO B;  1A6X A;  1KTK A;  3H15 A;  4N8X 1;  5CYU A;  3E5S A;  3VA5 A;  1JJC B;  1ASY A;  3GTG B;  2ES2 A;  2HUG A;  4JI6 L;  4HCS A;  5C0X I;  4BWG B;  3RZD H;  2ZXR A;  3TBI B;  4KI0 A;  3TP5 A;  3AB9 A;  1SJH D;  3LWU A;  4A3I B;  4P2C B;  4PMB A;  1QNU A;  1C48 A;  4DK3 C;  1HJP A;  3CP0 A;  4GLA C;  1A3T A;  1I4H A;  3CC2 A;  3RZO H;  1H9M A;  2B63 B;  1B9M A;  1PYS B;  2LFN A;  4DV1 L;  4CKE A;  1OXV A;  3TP8 A;  4TSS A;  3L7Z C;  3C1E A;  4C3I G;  5IYB H;  1EFW A;  2NZO A;  4ZAI A;  3GTM H;  3MTS A;  3GTJ B;  4MZ9 A;  2HQL A;  4AH6 A;  1G8Z D;  2UXD L;  1VQD A;  3UI2 A;  3CPW A;  3HOV G;  2E2D C;  1TVX A;  1RDP D;  4H02 A;  2WP8 J;  4KHP Q;  3PUW A;  5GAD C;  4BBS B;  3TEH B;  3M4P A;  4KD4 A;  1YI2 A;  4LF4 Q;  3OPO A;  4KMU C;  1XYI A;  4DKA C;  2VQF Q;  1N8R C;  4OX9 L;  4R4Q A;  2J7Z A;  1SBB B;  3D3R A;  4ID6 A;  2IX0 A;  1XMQ L;  4DUZ Q;  3M4Y A;  3W5O A;  5IGE A;  1L0Y B;  5IGG A;  4A3M H;  4LUV A;  3GTJ H;  5I9P A;  1M90 C;  4ZLT F;  1X55 A;  2JA7 G;  1B9N A;  2DN8 A;  4XT3 B;  4GKK L;  1EZ8 A;  2NWG A;  4FNF A;  4LF9 L;  4IPG A;  1SNP A;  3NQT A;  1BBU A;  3K6O A;  4DV6 L;  1LTT D;  4EQ5 A;  4X65 L;  4B3R Q;  3Q0A A;  4JYA L;  2Q2U A;  4DV0 L;  4JG2 A;  4DV7 L;  2YV5 A;  1SLJ A;  3NSW A;  1X56 A;  1KL9 A;  3SR1 A;  2B2Y C;  4DV3 Q;  3J81 E;  2BA1 A;  1V1P B;  5FO9 B;  1E7Z A;  3BVG A;  3I2Z A;  1X32 A;  3TZU A;  1KDA A;  2NBF A;  2RHS B;  1BR9 A;  1L0W A;  2EQS A;  4YCV A;  5IWA Q;  5KND A;  1PYB A;  1SN8 A;  3HRZ C;  3R93 A;  2JP1 A;  5FLM H;  4ZYS A;  1X54 A;  1VQM A;  3GTL B;  3HOX G;  3P1H A;  1PTO C;  3HEJ A;  4DV2 Q;  5M9O A;  3I73 A;  3T13 A;  2KBN A;  2HIV A;  5E1F A;  1T5E A;  3IFD A;  2Q8I B;  4DR3 L;  4HIK A;  2R92 B;  2KCM A;  3DEO A;  3GTQ H;  1WYD A;  1G6P A;  2F0T A;  2L11 A;  5IP7 H;  4PG3 A;  2K1B A;  3M3Y B;  4PV1 C;  3ICE A;  4OWW B;  1TT2 A;  4XQQ A;  3CHB D;  4G7O C;  5KNB A;  3J80 L;  4L5S A;  1VS0 A;  2Y0S E;  5M3M G;  1GOZ A;  3PUZ A;  1PV4 A;  4DK0 A;  3DLL A;  2RSN A;  4Z9C B;  4YY3 Q;  5K5P A;  3NBH A;  4RAU C;  2VNU D;  2WKC A;  1CHQ D;  4BY1 H;  4A93 G;  4KLK A;  1F2L A;  2B2U A;  1R4Q B;  4UDU C;  3GTP B;  1VQI A;  1VQC A;  1MIU A;  1XNQ Q;  3M3Y H;  3U4V A;  1KQS A;  3T53 B;  2DNC A;  1XWE A;  3OYY A;  1D5Z C;  2F0L A;  4NXM L;  3STB C;  1JOQ A;  1ZYR C;  2IHF A;  2WFW A;  3BU2 A;  4FP5 D;  4CGY B;  2SNM A;  3JAM E;  4KKU A;  4PNY A;  1BF4 A;  3MWY W;  3S14 B;  1PRT D;  3GDE A;  4OON A;  4N9T A;  4LF7 Q;  4A3G H;  4NKL A;  3VR4 A;  2AUK A;  1EYA A;  1S5C D;  3W1B A;  1EYD A;  3GTP H;  3I70 A;  2HHH L;  4OO1 G;  2MNA A;  1N9W A;  1KC8 C;  5KEE A;  1I4R A;  3OWF A;  1B50 A;  4GS3 A;  1U4R A;  3MVV A;  2MFI A;  5JEA H;  5JJZ A;  4DGZ A;  4R1J A;  2B2T C;  2UUA Q;  1D5M C;  2KVM A;  3I4L A;  3G6J B;  1Y1W G;  1EYG A;  2A8V A;  4RCO A;  4UPA A;  1DYQ A;  4R8N A;  1G51 A;  1KXL A;  3QJY A;  1JMC A;  3N52 A;  1SMY C;  1K8A C;  2KHS A;  1QB5 D;  2EZV A;  4B3S Q;  1AE3 A;  1DOK A;  3S2D B;  2UXC Q;  1SRO A;  3BG3 A;  5CV8 A;  4ZRZ A;  4IQZ A;  3A5Z B;  1RTO A;  1GO3 E;  1ICW A;  4DR6 L;  4DAY B;  2WIN B;  4BY7 G;  1I4P A;  4LFB L;  4HIM A;  1MSH A;  3ONA B;  3QB3 A;  1IKL A;  3U58 A;  5IYC H;  3RD4 A;  3UE0 A;  4L5R C;  2SEB D;  3HFZ B;  4M1U B;  2EY2 A;  2NB0 A;  2UUB L;  3A5U A;  2IHE A;  2E2J B;  1G6Z A;  1JC7 A;  1P8L A;  3DUZ A;  5DEH A;  2RVL A;  3BDL A;  3OW2 A;  1AH9 A;  1X3P A;  1LT6 D;  3ERS X;  3HG9 A;  1OXX K;  4A3J G;  1S4Z A;  3AU7 A;  2A19 A; 
#chains in the Genus database with same CATH homology
 4H13 C;  4EQN A;  4MHE A;  2E74 C;  1TS4 A;  4JK1 C;  1O7Z A;  1C8C A;  3BDO A;  2FFK B;  5ISR A;  3HOW B;  1L0X B;  2NTS A;  4KKT A;  5M5Y B;  3HS0 C;  1B53 A;  3ZYY X;  3NE5 B;  5IOD A;  4FF2 A;  1QNK A;  2B2W C;  1STE A;  3LWE A;  3VR6 A;  1BCP C;  1LAC A;  1Z47 A;  2PZW A;  2EJM A;  4G4K A;  4RGO S;  5ELD A;  4H7B A;  1TWF B;  3U9S A;  3X3N A;  3MC0 B;  2RA4 A;  5KRU A;  3DWP A;  3MA2 B;  1Q3L A;  3J7Y W;  3I4M B;  4CKC A;  1EZ6 A;  1HQR D;  2K05 A;  4A3K B;  1HFG A;  5JEA J;  1J8I A;  3VA7 A;  1MSG A;  1EL0 A;  4OGQ C;  1PFM A;  4B08 A;  4C1N I;  5C5M A;  3ITP A;  3OWE B;  3S16 B;  2PYK A;  2R61 A;  3A55 A;  1NCV A;  2MUY A;  1M4V A;  1E0B A;  5FLX E;  5IT9 L;  1PZJ D;  4KV6 A;  3MFY A;  4RWS C;  3HKZ B;  3RUZ A;  3GV3 A;  1QIL A;  2WAC A;  2RBM A;  1OXU A;  3SEB A;  5LL6 S;  1CA6 A;  1RHP A;  5EBC A;  3RMH A;  5C3W A;  4IUQ A;  1QJO A;  4PMW A;  1NUC A;  2K5W A;  1B2T A;  3PUY A;  3K58 A;  3NP8 A;  1VCI A;  2NTT A;  2A5H A;  1JOR A;  3S15 B;  3A7A B;  2MP1 A;  3HP3 A;  3BVZ A;  3P75 A;  3J7A V;  4IZ8 A;  2EYJ A;  1Y1V B;  2KCC A;  2KQ3 A;  2B2Y A;  2RDF A;  1TS5 A;  2A6H C;  3TME A;  1KDC A;  1SFO B;  2I46 A;  4KHZ A;  1WTQ A;  3DXJ C;  4ZUI A;  2Z1C A;  4CBV A;  1F77 A;  5I6Y A;  2MGS A;  3KUP A;  5EBD A;  5D3D A;  3K5M A;  2SOB A;  2EY6 A;  4K6L A;  1ENA A;  4EVO A;  3C1F A;  2K04 A;  1LTB D;  2JXM B;  3PO2 B;  3VR3 A;  5JVG 3;  2KCN A;  1SNC A;  4IFD I;  1BUV T;  1U4P A;  3VYU A;  1EY9 A;  2F0K A;  4HMJ A;  2X6L A;  1IW7 C;  1LTA D;  3KF8 A;  3I72 A;  1D6E C;  5FO8 B;  3FDT A;  3MFG A;  5JPN C;  3R2T A;  3H91 A;  4IAL A;  4KY5 A;  2EYF A;  1JR0 D;  4RKB A;  3DWA A;  4HED A;  2B8G A;  3NK9 A;  4RGT A;  1GHJ A;  2HDM A;  1TWA B;  4QIW B;  1G2S A;  3KK7 A;  4JBW A;  5DM7 3;  3R8B A;  2X69 A;  5JEA G;  1GUN A;  1RJT A;  3M4O B;  1H9R A;  4RGM A;  4MN3 A;  5C3X A;  3IAY A;  1Q1E A;  5C4J B;  5HUR A;  1EU4 A;  4ZUJ A;  2I07 B;  4WFN 3;  3OOC A;  2RKS A;  1Z7T A;  1SXT A;  1K8M A;  2WV6 D;  3WOE A;  1SE2 A;  2HCI A;  3V96 A;  2BE5 C;  4KN7 C;  3LX0 A;  1IYV A;  2BE5 D;  4WJW A;  1DZ1 A;  3NTK A;  2JA5 B;  2TSS A;  1HTP A;  4M8A A;  1AN8 A;  1UEA B;  1WTP A;  1RD9 D;  3O13 A;  3J80 E;  5BN4 A;  3S17 B;  2KUM A;  2NN6 I;  4FYD A;  1CFM A;  2RDH A;  3FVQ A;  3PO3 B;  1PMR A;  4I65 A;  1LTI D;  3SDZ A;  4B9W A;  1EQV A;  2PZT A;  5COY A;  3VYT A;  4R9W A;  2F0E A;  2HQE A;  3AMU A;  1LT5 D;  4FF1 A;  2F4I A;  2KJX A;  1ZXT A;  5F2D A;  5G3L F;  1HA5 A;  3RLF A;  2IW3 A;  4LAA A;  3NQI A;  1DOM A;  1RKN A;  5K36 H;  2ICE C;  5LL6 X;  4V19 0;  2IJ0 A;  2LY7 A;  2F0J A;  1MI2 A;  1XTC D;  2HCC A;  1STG A;  1BOS A;  1BO0 A;  2KED A;  3HOZ B;  1AP0 A;  5ELC A;  3A8I E;  5FK9 C;  1A15 A;  3Q22 A;  5C6A A;  1TWC B;  2VUM B;  1CZG A;  2CVR A;  5M5W B;  3MHB A;  3K5N A;  2F0F A;  2G9H D;  2O4X A;  1RTN A;  5KYL A;  2XVS A;  4X3U A;  2EJG C;  4BA1 I;  2K5D A;  5D65 A;  4QCL A;  2XWJ B;  3S2H B;  1B44 D;  1QOH A;  1EWH A;  3EVQ A;  2L12 A;  5I2X A;  2PO4 A;  2QEJ C;  1UNS A;  4XTC S;  3HOY B;  2F0P A;  3SE0 A;  4XIG S;  2D62 A;  5J1Z A;  4K5V A;  4WOR A;  3L9A X;  4YIJ A;  5AFW A;  4C2M B;  3NTI A;  2NVT B;  1WD1 A;  1D1I A;  1TY0 A;  1ILQ A;  2WII B;  4X3T A;  1WTW A;  2JA6 B;  1CA5 A;  3GV6 A;  4C3H B;  3KLS X;  2E2I B;  2D5D A;  5ELE A;  1WTO A;  5D14 A;  4XXE A;  2F0W A;  3V2T A;  4OHJ A;  1TR5 A;  3EFX D;  5J39 A;  1PTO D;  3S1Q B;  4A3D B;  4LK1 C;  3QG1 A;  5A2Q E;  2G9D A;  1B1Z A;  1HQM C;  1SE3 A;  1K83 B;  5CBE E;  2R93 B;  3MZ5 A;  3K57 A;  2X6G A;  4DF7 A;  2CQA A;  4LJZ C;  5FKA C;  1CT1 D;  1AFP A;  1NR2 A;  3J7A F;  2XN9 C;  4OL7 A;  2JA8 B;  1V1O A;  4FVM A;  5CC4 A;  1YNN C;  3I91 A;  5I9O A;  1BQQ T;  1U9R A;  1S5E D;  5IT9 E;  1FYC A;  5C4X B;  3E0J A;  4K5W A;  5EPL A;  3M7N A;  1PFN A;  4A3B B;  2NVY B;  4NMZ A;  2DY8 A;  3KBX A;  2A73 B;  4U68 A;  4WRD A;  1I4X A;  1ZYR D;  3C46 A;  2RQX A;  1TS2 A;  2J4X A;  3S1M B;  2MJ8 A;  5TSS A;  4CJ1 B;  4QF4 A;  1OXT A;  4XYQ A;  1EU3 A;  2PNR C;  1SJE D;  3W2D A;  1D5X C;  2O5J C;  2F0I A;  1PRT F;  3IFT A;  1STA A;  3MEH A;  1O78 A;  3W3A A;  4CJ0 B;  3P7J A;  3KLR A;  4KD3 A;  1SYE A;  1SMY D;  4MIU A;  2ENB A;  4EQP A;  2K32 A;  4OIJ A;  2A6E C;  3T4A C;  3DHQ A;  3PV0 A;  3U9O A;  1Q1B A;  4DA2 A;  2A6E D;  2F3W A;  2F0S A;  5ELB A;  2L1B A;  4CHT B;  5CR3 A;  1H9K A;  1SAP A;  5DM6 3;  5JOB A;  1FNU A;  1ESR A;  1EY8 A;  1AZP A;  4DNR B;  4OO1 I;  1TKW B;  5M3F B;  1LTS D;  3SK6 A;  1WTX A;  2C5C A;  2R3Z A;  1F9R A;  2OT2 A;  2Z4I A;  2KA7 A;  2KEC A;  1ENF A;  3IL8 A;  1JWM D;  2B2V A;  5C0X H;  1EY0 A;  3OW7 A;  5I4D A;  5KIX A;  5T1G A;  1LAB A;  3A56 A;  4KKS A;  4KJO A;  5EGT A;  4QUC A;  4Y7N B;  5K36 G;  1BCP D;  1TWG B;  1KAB A;  3TP7 A;  1JE4 A;  2YU9 B;  3J81 L;  5KYI A;  2GA4 B;  4K14 A;  1K8O A;  1HUM A;  3A8K E;  5EKK A;  3D8G A;  2HDL A;  2B39 A;  2V4D A;  3NUC A;  4EGV A;  3K7A B;  1SYF A;  2IWH A;  3HZX A;  1O7L A;  3L3O C;  3ERO A;  5HGT A;  2OEO A;  2H4O A;  1PZK D;  5EKL A;  1GHK A;  2K03 A;  5FO7 B;  3A7L A;  4BS9 A;  5EPK A;  3D6W A;  3NTH A;  3EJI A;  3SK4 A;  2K33 A;  1F2M A;  4J8Q A;  1EY7 A;  1LV9 A;  4XYO A;  3Q23 A;  4HMI A;  1DXM A;  4EQO A;  2F0M A;  1V43 A;  4L63 B;  1LTG D;  5E4W C;  5IGF A;  1HCZ A;  1TQO A;  2VB3 X;  2K01 A;  5C0X J;  3I3C A;  2DNE A;  2KEE A;  3PUX A;  3JAM L;  1Y8P B;  2TMP A;  3D6C A;  3SVM A;  1E2Z A;  2IPK D;  2Y0S B;  2QF7 A;  2N88 A;  5CBA E;  2NZ1 D;  4V0B A;  2JE6 I;  3BZD B;  1FD7 D;  2F03 A;  4XT1 B;  5ELF A;  2EY1 A;  2LMC B;  4HN7 A;  2A6H D;  2WAQ B;  2XNA C;  2L55 A;  4HR7 B;  3TP6 A;  5BN5 A;  1EY6 A;  5M5X B;  3Q24 A;  2EOT A;  4C3H G;  2A68 C;  2O2L D;  2A68 D;  5JPM C;  2MHV A;  5CV5 A;  3BDC A;  1IKM A;  1PDQ A;  4K2L A;  1AZQ A;  1S5F D;  3VR5 A;  5C44 B;  4HCE A;  2R7Z B;  4N9P A;  1QE6 A;  1F9P A;  1OXS C;  3OIQ A;  3NPP A;  4DAV A;  2KOL A;  2JYO A;  1IW7 D;  3D4D A;  4NW2 A;  1CM9 A;  1ZEQ X;  1H9S A;  3T56 B;  4CJ2 C;  3C3L A;  1PRT B;  1SE4 A;  2F3V A;  4C56 C;  2B2U C;  2EE1 A;  3VYR A;  1BDO A;  1RCV D;  2PPB C;  1A3V A;  4PQX A;  2XWB B;  1I6V C;  3D4R A;  1NAP A;  2QDB A;  1HPC A;  1F2Y A;  1R4P B;  2PW7 A;  1C4Q A;  2ZT9 C;  2FMC A;  1VMP A;  3EQL C;  1JB3 A;  4XQJ A;  1I6H B;  2AQ2 B;  3GQB A;  3M85 A;  4ZK9 B;  3SXH A;  1CZW A;  4FXK C;  1Q8I A;  5COR A;  3ND8 A;  3FPP A;  4RHS A;  3OMG A;  1MD2 D;  2IL8 A;  1JIC A;  2B2T A;  1ML0 D;  2EYO A;  1AW7 A;  3K0Y A;  3PMF A;  1WD0 A;  4HTH A;  2AUJ D;  3URY A;  3QOJ A;  4K2K A;  3S1N B;  5EJW A;  4XQN A;  3VYS A;  1FNV A;  3V05 A;  1G29 1;  1WTV A;  2OF1 A;  3CKI B;  1CTM A;  1LT4 D;  5I2Y A;  1WCM B;  3WOF A;  1IL8 A;  1YNJ C;  3MXG A;  4ZKC B;  4A3J B;  5FLX L;  1II3 A;  3G7L A;  1Y69 U;  2ID0 A;  5C0X G;  4QMG A;  3GD7 A;  1QG7 A;  3NWS A;  2D2C C;  1GUG A;  4KJN A;  4RHR A;  5I6W A;  1TY2 A;  2IT1 A;  2WKD A;  3S9W A;  3CRK C;  1JOO A;  4G57 A;  4LMQ D;  3IKJ A;  3RZD B;  2B2W A;  1A2U A;  3SK5 A;  2JSO A;  5C3E B;  2L5T A;  1LLR D;  2K6A A;  2H1E A;  1CQV A;  2RDG A;  2K28 A;  3BYT B;  3P20 A;  3BS1 A;  1GUT A;  2PMZ B;  2Q8T A;  1ONL A;  3GTM B;  1W6J A;  3QO2 A;  3I90 A;  1F9Q A;  4KN4 C;  2L4N A;  1XXG A;  2MPM A;  1HXY D;  4GZY C;  3H6M A;  4K6D A;  5C5L A;  2ICI A;  4RFB A;  4F87 A;  1MGS A;  2LS0 1;  1XX8 A;  3M7G A;  1SND A;  2CW0 C;  1VF7 A;  4F8M A;  5CV7 A;  1WVL A;  4H44 C;  1KLU D;  1LO5 D;  2CW0 D;  1EWC A;  2QCP X;  1I3Q B;  3DEP A;  4A3M B;  2IX3 A;  2Z4H A;  1SYC A;  4R8I A;  5KGU A;  3I4N B;  4ODG A;  4UAI A;  4F88 A;  4RA8 A;  1IYU A;  3TSS A;  4Q5V A;  1CK1 A;  1Q12 A;  1MBY A;  1D2B A;  1SYB A;  2M2L A;  2PCF B;  3CU7 A;  2EXZ A;  2E75 C;  1HUN A;  2VXW A;  3SHL A;  3E6Z X;  2PQE A;  1JWU D;  5IIF A;  1HTL D;  1DOL A;  4IUT A;  1VMC A;  1BNZ A;  2IX1 A;  3N6R A;  4B9X A;  2NUC A;  3MXU A;  1F2Z A;  1RF2 D;  1CHP D;  1X3Q A;  1PFB A;  4IFD H;  4FO2 A;  2BDO A;  2EDG A;  4J1M A;  1HA6 A;  2YYZ A;  3NBI A;  1Y8N B;  3GTQ B;  1GUO A;  1SNO A;  1D1K A;  2JEB I;  1V1P A;  2PZU A;  1S5B D;  2BDN A;  5CV9 A;  1PTO F;  4BA2 I;  2B8F A;  4FXG C;  4O42 A;  4A3E B;  5A35 A;  2OXP A;  4BY1 B;  2DY7 A;  1GUW A;  4ZQ3 A;  1GXD C;  1I4G A;  1YNN D;  1STN A;  1KDB A;  4IUP A;  1KAA A;  1GJX A;  4BBR B;  1ROD A;  3F2U A;  4RH6 A;  4ILW A;  1KNA A;  1ET6 A;  1STY A;  4A3G B;  1STH A;  3FMC A;  1FR3 A;  4QUF A;  1DD2 A;  2WB1 B;  4DFA A;  4KY7 A;  3FRP B;  5E3F A;  1OO9 B;  3VR2 A;  5EPJ A;  2BOS A;  1VDZ A;  1EEF D;  5C4Z A;  1PRT C;  2FJ2 A;  1PLF A;  4G7Z C;  1ET9 A;  2C9O A;  3A54 A;  3SK8 A;  3H09 A;  5EQ0 A;  1SDF A;  1PZI D;  1QWY A;  4TKO B;  2Z8L A;  1E2V A;  1TS3 A;  4C3J B;  4FF4 A;  4OIK A;  4IFD J;  3GTK B;  2NN6 H;  3R2I A;  2K7V A;  3GP7 A;  5T1I A;  3TZD A;  4KY6 A;  3QOL A;  2FHT A;  2FIN B;  2VB2 X;  3H0G B;  1E2W A;  3C2P A;  3T51 B;  5J22 A;  3OIP A;  2XSC A;  4G7H C;  1B3A A;  1EIH A;  4AYB B;  4DNT B;  1WTR A;  1HHV A;  2EVB A;  4DAY A;  4KHV A;  1JWS D;  4O1N A;  2EYM A;  5C4H A;  5NUC A;  1HFN A;  2R6G A;  4CKB A;  1J9O A;  3FKI B;  1FGB D;  3H3V C;  3QIA A;  1Y8O B;  2NYZ D;  1F9S A;  3ND9 A;  3NXW A;  2EY5 A;  3CRL C;  4HSV A;  3MXP A;  3HOU B;  2XRS D;  4RKL A;  2EYP A;  1ZKO A;  2NVQ B;  5E4X A;  4FF3 A;  1JCK B;  1BCP F;  2EPB A;  3PUV A;  1O7Y A;  3NHH A;  1SSO A;  4DU9 A;  4C3I B;  1H9J A;  4IUU A;  2EYL A;  1ILP A;  2FMM A;  3HOV B;  2F0U A;  1DJR D;  1M8A A;  2AQ3 B;  5A2Q L;  2F0G A;  2ZXP A;  4K8I A;  1EOT A;  4NDX A;  2AQ1 B;  5IGC A;  3DMU A;  2JEA I;  3KLS A;  1CI3 M;  3S1R B;  1TU2 B;  1NR4 A;  2XRQ D;  1AEX A;  4F7X A;  2AWO A;  4RCN A;  4I7Z C;  4X3S A;  5EKI A;  1DCZ A;  1STB A;  4HSP A;  1TII D;  2J0T D;  3GO5 A;  5JAV A;  5KNC A;  2SDF A;  2JA7 B;  3A8J E;  4DXG A;  1A2T A;  3K59 A;  2SNS A;  5IGB A;  4ZKB B;  5DNF A;  5LHY 1;  4HAE A;  3LNN A;  1A3U A;  1LT3 D;  1I50 B;  4L8J A;  4IUN A;  2XIW A;  5CGK A;  1V8Q A;  3OSO A;  2BCO A;  4ULL A;  1G91 A;  1U4L A;  2F0N A;  3MXN A;  4J6H A;  1EFI D;  3PIO 3;  1R9T B;  3TN2 A;  4IFD G;  2PW5 A;  1PTO B;  2QIL A;  1U4M A;  3KBG A;  4KTA A;  3T16 A;  3EA6 A;  3HOX B;  1JOK A;  3I8Z A;  1CQF A;  2AWN A;  2F0H A;  5CV6 A;  1QCB D;  1VF5 C;  2LKV A;  3CQZ B;  1KNE A;  1Q90 A;  4IUR A;  3K5L A;  1IHZ A;  2CHB D;  1W6K A;  1G2T A;  3DM1 A;  1PTO H;  2ZXO A;  5M3M B;  1SNM A;  2O5I C;  5CV4 A;  1EQT A;  1PYW D;  5IGD A;  1LTR D;  1H9S B;  4ABN A;  4A93 B;  3WDN A;  3NWT A;  4X3K A;  1SEB D;  2BA0 A;  3R3O A;  1KLG D;  1S5D D;  2N55 A;  2L9H A;  4KK7 A;  1EIG A;  1BXT A;  1EEI D;  5CMD A;  5JVH 3;  4H0L C;  4TRD A;  2Q8R E;  2M00 A;  4DK1 A;  4RGN A;  3MAQ A;  3D31 A;  4Q0F A;  1EY5 A;  1UUP A;  4NP5 A;  4DXF A;  1I4Q A;  1HRJ A;  1EYC A;  5BN3 A;  1T5X D;  1BBX C;  2F0Q A;  1Y1W B;  1SYD A;  5DAU A;  4U67 3;  3HGB A;  2L0C A;  1ENC A;  2QKI C;  1NSN S;  2K5Q A;  4IUV A;  2A69 C;  2EJF C;  2E2H B;  4L6T B;  2NVX B;  3Q6S A;  2A69 D;  3GTO B;  4OO1 H;  2NN6 G;  3DWQ A;  4BY7 B;  3D4W A;  2E76 C;  3BYY B;  1DM0 B;  4ME5 A;  2F1M A;  1UAP A;  2D9U A;  1FNW A;  4IN3 A;  2F0V A;  1EY4 A;  2EYH A;  4C3J G;  4QB4 A;  1YNJ D;  5FOB B;  1PXU A;  3OHX C;  3OMC A;  4K8J A;  4K5X A;  3K5O A;  3QWN A;  4DN4 M;  1GUS A;  4C1N K;  2RSO A;  1TWH B;  1ESF A;  3X3M A;  3PIP 3;  3TDQ A;  4DAP A;  2M9V A;  3FEW X;  1Z6H A;  1B4O A;  3BVM A;  4E6I A;  4S3S A;  2F0D A;  1BCP B;  1JQY D;  3FPU B;  2B2V C;  4XDX A;  2A74 C;  3H94 A;  4FXD A;  5IOC A;  4A3F B;  1SYG A;  5G3L D;  4PMC A;  1O80 A;  5D3I B;  1DON A;  2F0O A;  4TQU S;  3ERQ A;  1SNQ A;  3RZO B;  1A6X A;  1KTK A;  5CYU A;  3E5S A;  3VA5 A;  3GTG B;  2HUG A;  4HCS A;  5C0X I;  4BWG B;  2ZXR A;  3TBI B;  4KI0 A;  3TP5 A;  3AB9 A;  1SJH D;  3LWU A;  4A3I B;  4P2C B;  4PMB A;  1QNU A;  1C48 A;  1A3T A;  1I4H A;  1H9M A;  2B63 B;  1B9M A;  2LFN A;  4CKE A;  1OXV A;  3TP8 A;  4TSS A;  3L7Z C;  3C1E A;  4C3I G;  3MTS A;  3GTJ B;  1G8Z D;  3UI2 A;  2E2D C;  1TVX A;  1RDP D;  2WP8 J;  3PUW A;  4BBS B;  4KD4 A;  3OPO A;  4KMU C;  1XYI A;  2J7Z A;  1SBB B;  3D3R A;  4ID6 A;  2IX0 A;  3M4Y A;  5IGE A;  1L0Y B;  5IGG A;  5I9P A;  4ZLT F;  1B9N A;  2DN8 A;  4XT3 B;  1EZ8 A;  2NWG A;  4FNF A;  1SNP A;  3NQT A;  3K6O A;  1LTT D;  3Q0A A;  3NSW A;  3SR1 A;  2B2Y C;  3J81 E;  2BA1 A;  1V1P B;  5FO9 B;  3BVG A;  1X32 A;  3TZU A;  1KDA A;  2NBF A;  1BR9 A;  5KND A;  3HRZ C;  3R93 A;  2JP1 A;  4ZYS A;  3GTL B;  3P1H A;  1PTO C;  3HEJ A;  5M9O A;  3I73 A;  3T13 A;  5E1F A;  1T5E A;  3IFD A;  2Q8I B;  2R92 B;  3DEO A;  2F0T A;  2L11 A;  2K1B A;  3M3Y B;  4PV1 C;  1TT2 A;  4XQQ A;  3CHB D;  4G7O C;  5KNB A;  3J80 L;  1GOZ A;  3PUZ A;  4DK0 A;  2RSN A;  4Z9C B;  5K5P A;  3NBH A;  4RAU C;  2VNU D;  2WKC A;  1CHQ D;  1F2L A;  2B2U A;  1R4Q B;  4UDU C;  3GTP B;  3T53 B;  2DNC A;  1XWE A;  1D5Z C;  2F0L A;  1JOQ A;  1ZYR C;  4FP5 D;  4CGY B;  2SNM A;  3JAM E;  4KKU A;  4PNY A;  1BF4 A;  3MWY W;  3S14 B;  1PRT D;  4N9T A;  4NKL A;  3VR4 A;  2AUK A;  1EYA A;  1S5C D;  1EYD A;  3I70 A;  4OO1 G;  5KEE A;  1I4R A;  3OWF A;  1B50 A;  1U4R A;  3MVV A;  5JEA H;  5JJZ A;  4DGZ A;  2B2T C;  1D5M C;  2KVM A;  3I4L A;  3G6J B;  4RCO A;  1DYQ A;  4R8N A;  3QJY A;  3N52 A;  1SMY C;  2KHS A;  1QB5 D;  2EZV A;  1DOK A;  3S2D B;  3BG3 A;  5CV8 A;  4ZRZ A;  4IQZ A;  1RTO A;  1ICW A;  2WIN B;  1I4P A;  1MSH A;  3ONA B;  3QB3 A;  1IKL A;  3RD4 A;  2SEB D;  4M1U B;  2EY2 A;  2NB0 A;  2E2J B;  1G6Z A;  1JC7 A;  3DUZ A;  5DEH A;  2RVL A;  3BDL A;  1X3P A;  1LT6 D;  3HG9 A;  1OXX K;  1S4Z A;  3AU7 A;  4ZAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...