2PNRC

Crystal structure of the asymmetric pdk3-l2 complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of an Asymmetric complex of Pyruvate Dehydrogenase Kinase 3 with Lipoyl domain 2 and its Biological Implications
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
total genus 10
structure length 79
sequence length 79
chains with identical sequence G
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pnrC01
3U9SA 3T51B 4G7OC 5KNDA 3D31A 2IT1A 2A6ED 2A6HC 1HTPA 5C0XH 2PPBC 5BN4A 3GQBA 3DXJC 1Y8NB 4KKTA 5A35A 4OO1H 2A68D 2AWOA 3BDOA 5C0XG 3PUXA 3VR4A 2PNRC 2DN8A 2Q8IB 1VDZA 2CW0C 3QIAA 3A8KE 2D2CC 3I4LA 1ZYRC 3P20A 3MXUA 1H9SB 2B8FA 1GHJA 4IQZA 1GUNA 1GUOA 2AUJD 2B8GA 1B9MA 1K8OA 4KKUA 1VF5C 2EVBA 5BN5A 1Q1EA 1CTMA 2A68C 2PCFB 1V43A 4KHZA 3MFYA 1SMYC 3I73A 1VF7A 1FR3A 3M4YA 3EQLC 3A8IE 4KI0A 2L5TA 3SE0A 2O5IC 1Z7TA 2ZT9C 3ND8A 2E74C 1IW7D 4KKSA 3VR5A 2QF7A 4KMUC 2AUKA 3FPPA 1H9RA 4JK1C 3PUVA 1OXTA 1PMRA 1E2ZA 3M7NA 1GUGA 1A6XA 2D62A 4G7ZC 3IFTA 5KNBA 1E2VA 3N6RA 4DK1A 4G7HC 1QJOA 4H13C 2F1MA 1Q12A 2EJMA 3AB9A 3L7ZC 3PUYA 3IKJA 4L8JA 4KN7C 1O7LA 3ND9A 4XTCS 2O5JC 1DCZA 4JBWA 1IW7C 1GUSA 4PV1C 1IYVA 3CRKC 2A6HD 1E2WA 4TQUS 1K8MA 1LABA 1VCIA 3LWUA 1GJXA 1O78A 4GZYC 5K36H 2BE5C 5JEAH 3QJYA 1GUTA 3A8JE 3HGBA 3KLRA 3GD7A 4KN4C 1TU2B 2NN6I 1V8QA 4BA2I 2D5DA 3OW7A 2BE5D 3W3AA 3T56B 3TZUA 1YNJC 1TKWB 4OO1G 2A6EC 4RCNA 1H9MA 2A69D 2KCCA 4LJZC 2LMCB 1EWHA 2A69C 3T53B 4LK1C 4IFDG 1Y8OB 1DD2A 5KNCA 1Q1BA 2NN6G 1OXSC 1OXVA 2E75C 2K33A 2NN6H 1Z6HA 3BG3A 4H44C 1Q90A 2BDOA 4TKOB 2BA0A 2JEAI 2DNEA 4OGQC 4H0LC 3LNNA 2JEBI 1YNNC 1HPCA 3CRLC 3M85A 1ONLA 3D4RA 1H9SA 3H94A 1H9KA 1HQMC 1G291 1IYUA 1H9JA 3VA7A 4HR7B 5JEAG 1B9NA 2DNCA 3OPOA 1I6VC 3VR2A 2R6GA 1ZKOA 3PUZA 1CFMA 3VR6A 2K32A 2KA7A 3SDZA 2K7VA 3OOCA 3RLFA 1Y8PB 2BA1A 1OXUA 2EDGA 1Y69U 1GHKA 2JXMB 3A7LA 2YYZA 1DXMA 4IFDH 2EJFC 2EJGC 3PUWA 1HCZA 4BA1I 3PV0A 1BDOA 3VR3A 4DNTB 1CI3M 4DNRB 2JE6I 2E76C 5K36G 1LACA 3I72A 1OXXK 2V4DA 3FMCA 3QG1A 4XIGS 5BN3A 3NE5B 1T5EA 4DK0A 1FYCA 3WDNA 3A7AB 4I7ZC
chains in the Genus database with same CATH superfamily
5JJIA 5KNDA 3H0GB 4XXEA 4YY3Q 2ALYB 5A35A 4OO1H 5F2DA 1HA6A 1E1TA 2JA5G 2Q2TA 1PZKD 5A2QE 1Y1VH 3HOWG 4B9XA 1KDAA 2GVAA 4CKBA 3NWTA 4C3IB 3OMGA 5IP9G 2DUDA 4X3SA 1STNA 3S1MH 1B50A 2LY7A 3TP5A 1HA5A 4UP7A 5AFWA 3S2DH 1IW7D 2H1EA 3CKIB 4K6DA 4LFCL 4A4IA 4HJ5A 4LMQD 3NSWA 2SDFA 4G7HC 3QO2A 3OWFA 3CCVA 4XQJA 1BBXC 1AH9A 2HD3A 5D3DA 3RN5A 1STGA 4A3MH 2F0FA 2Q8TA 4DN4M 1B2TA 3FDTA 1WOCA 2ES2A 1TT2A 4DR4L 2RVLA 1GJXA 4GOPA 3PO2H 2DJGC 2FXQA 2Z6BA 4J1MA 5HY6A 2MFIA 2ZM6Q 1JMCA 1VQFA 1YNJC 4RCNA 1PYSB 2LMCB 2RDGA 4Y7NB 4R4TA 4HSPA 3HOZH 1VQCA 5J39A 2A69C 4WJ3M 1LYLA 2K1BA 3RUZA 5EPLA 1ICWA 1XNQQ 4PMBA 2YU9H 2K33A 3AU7A 2MUYA 5CMDA 3CMAA 3UE0A 3P7JA 3ZYYX 3TREA 3J81L 3OPOA 3LGJA 4DK3C 3TP6A 2X69A 4LF9Q 1GKHA 3NBHB 4C2MH 4YWMA 3S16H 3OOCA 1Y8PB 3HOZB 3PIP3 1O80A 5LMNL 1VQIA 1VQBA 2R7ZB 2EJFC 1QVGA 4B3SQ 1NBWA 2ZXPA 2NWGA 5ELOA 2K14A 1BR9A 1L0YB 1OXXK 3X3MA 2XSCA 3WDNA 1DOMA 3K81C 4RWSC 5HGTA 1G51A 3CQZH 3U4VA 2IT1A 4DR2L 5DM63 3DWPA 1YNJD 4HCEA 2O2LD 4PQXA 5M9OA 4P72A 1PH2A 3DWQA 1Q82C 2MGSA 1QNKA 2ATWA 3DXJC 1PH5A 3GP7A 2CW0D 3PUXA 2JA7B 2Q8IB 3R8BA 4EX5A 1S3OA 3HG9A 5C4ZA 4B3RQ 3AYHB 1B1ZA 4IJHA 1JWUD 2Z6KA 3WOEA 2KJXA 3ERQA 1WI5A 1NTGA 2JJQA 1AFPA 2UU9Q 2Z9HA 4C3HG 2VQFL 4AYBG 2OTJA 2OCEA 1EY4A 3DLLA 4LF4L 5DNFA 1VQJA 4QQBX 5FLMH 1KDCA 4XYQA 2F0EA 4XTCS 4DF7A 4UHVA 1BUVT 3CQZB 3KOJA 1PRTF 4GOPC 1JICA 3SK8A 3S15H 3FKIG 1A62A 2AMCB 1PTOB 4IPCA 5FO8B 1EQQA 3L0OA 1RDPD 2R92H 2I07B 2PZWA 1LM0A 2I46A 3A74A 3BVMA 3G71A 5IOCA 3I2ZA 1QILA 4C3JH 1DM0B 2NZHA 3RD4A 2OQKA 3NTHA 3MAQA 5IWAQ 3LWEA 5M5WH 3PO2G 5EBDA 2WKDA 1Z9FA 3S16B 1HPCA 3D8GA 3M85A 5IT9E 3FVQA 2F0IA 1HNZQ 2RDFA 1EZ8A 4TSSA 2C9OA 5IYBH 3JAMc 5C5LA 4B08A 5IP7H 4GN5A 2NB0A 2ZJQA 1CQFA 3AFQA 3CCMA 5IT9L 4C3HB 2N55A 2B63B 2EJGC 1KIXA 1E7ZA 3D6CA 1XMOQ 4P73A 3J81i 2K5WA 3I72A 2VQEQ 3PO2B 1TY2A 4JYAQ 4DK0A 3Q23A 1JC7A 1F2ZA 1ILPA 1D5MC 1TWFH 1WTXA 3GTQB 1HNWQ 4GNXC 1V9PA 1TWCH 1YHBA 1HTPA 4ZQ3A 4A3MB 1PFMA 1PH8A 4OWXB 1Y8NB 4KD3A 4QIWE 3CF5A 4A3DG 3HOUH 1D5ZC 1PA6A 4A3JH 1SNMA 3TBIB 2C5CA 4ABNA 3A8KE 2D2CC 4OX9Q 4UPAA 4JI6Q 1Q8IA 2WP8J 4HJ9A 4CBVA 1GUOA 3FKIH 3BJUA 1I3QB 1AZQA 3PIO3 3M4OH 1KL9A 4DR2Q 1CKNB 3TRZA 1F77A 1BBUA 2F4IA 2UU9L 1JWMD 3CHBD 2D62A 4DR5L 2Z8LA 4DK1A 4C3IH 1L1OA 3DM3A 5C0XI 4A3EG 3F2CA 1VQ8A 4JBWA 4A3BG 1STEA 1BOSA 1PZJD 2A6HD 1E2WA 3OWEB 1WTWA 2VUMG 1LABA 4J15A 4DAPA 3S2HB 4LF6Q 3X3NA 4OIJA 4JI8L 1PFNA 1PTOC 2K52A 4WORA 2TMPA 2R7ZH 3J80E 5C44H 3STBD 4QF4A 2JA8B 1O7YA 2QW7A 3SGIA 3EIVA 2UUCQ 1HR0W 2WB1G 1TR5A 4Y52H 3I90A 4X3KA 1V1PB 1S72A 4DUYQ 2N88A 3S1RB 1S4ZA 1EQTA 1Z6HA 1Q90A 1JE5A 3J80L 3BZCA 3I56A 2Z6KC 4BBRG 1VS0A 3IFDA 2VZAA 3K5NA 1H9SA 3QOLA 3H94A 1HQMC 4IN3A 2KVMA 2D0PA 5G3LF 4DAVA 4A3KG 3PUZA 1HUNA 1CFMA 3VR6A 3H3VC 3KLSX 4IPHA 1B4OA 4DXGA 1U4RA 4DV7Q 1HR0Q 5C4HA 2IW3A 4IUNA 2J0TD 1F9RA 2EDGA 4NPSA 1NJIC 4IFDH 2QDLA 1ZXTA 3PMFA 4DNTB 1CI3M 2R93G 4A3JB 3J80c 2JE6I 3K7AB 5E4WC 2V4DA 3FMCA 4LUZA 2UUAQ 4NXMQ 1PH7A 3Q22A 4K5VA 1MKHA 4TVAB 2IPKD 5C4JB 1PHJA 5I6YA 1TQOA 1U4MA 1STAA 4JPBW 4QUFA 3M3YB 3BDOA 1CZWA 4DV2Q 4BBRB 1HZCA 4DPGA 1X6OA 2E2IH 1UEAB 4X64Q 2NVXH 4DV4Q 1EL0A 2ZJRA 3G7LA 4DA2A 2M2LA 4CKCA 2QGQA 3I73A 5H1SE 4CDEC 2BH2A 3TS2A 4RHRA 2MP1A 4YIJA 2L5TA 3SE0A 3K58A 3MXNB 2O5IC 3U58A 5C4XG 1EWIA 5CV6A 1A6XA 1V1PA 1GUGA 4BY1G 3OMCA 3BVZA 3N6RA 4GNXB 1HZAA 5DLQE 4R4CA 4ZUJA 1UUPA 1O7LA 4B9WA 2CH4W 1TS2A 2NVXB 2F3VA 1LTTD 4B3RL 1L0XB 2F03A 1VQOA 2EXZA 1TU2B 4ODGA 3DEOA 5C3XA 2SNMA 1NY4A 1ENAA 3T56B 1X56A 4GKJL 2A69D 1SNCA 5NUCA 3UE1A 3OSOA 3CAMA 1KXLA 3DEPA 1XNRL 2FHTA 2XGTA 3KF8B 4JI1Q 5IGFA 5EKIA 1B44D 2KHJA 2F0NA 2Y0SB 2NN6H 3CCRA 4OX9L 3BG3A 2R93H 5IODA 1RODA 3UI2A 4Q5VA 1SEBD 5IT9c 4H02A 3T4AC 4GKJQ 4OEMB 1ZKOA 3K0XA 2UXBQ 4APVA 4A76A 2EYJA 5FLXL 4CJ1B 2RA4A 1E1OA 2AQ3B 2VL6A 2Z4HA 2YYZA 1DXMA 3I3CA 4GLAC 1SJHD 4DV1L 3J81j 2R3ZA 3K57A 1KABA 2NBFA 3KK7A 5DEHA 1SYGA 5CV5A 4ZAIA 2A8VA 4XT1B 5M5YH 3DM1A 4DV5Q 3T1YQ 3J7AF 2MO0A 3T16A 2F0JA 5A2QL 1I4PA 4G7OC 3E0JA 3PF4A 1HNXQ 1B3QA 2PPBC 2I5MX 5EAYA 4HJAA 1LT3D 2PNRC 1VDZA 1PV4A 4OL7A 5T1GA 3H0GG 4KLKA 1LTGD 3MXUA 4LUOA 2OT2A 3S1NH 1IL2A 2QCPX 2RCNA 1S5FD 4HEDA 3TP7A 4JW0A 4LF8Q 2B2YC 1BCPD 1QZGA 5JJZA 1IL8A 3VA5A 1B7YB 4MTKA 3EVQA 4KI0A 3BYTB 1YJ9A 1A63A 4KKSA 4FF4A 2QF7A 4AYBE 2F0MA 2VUMB 3NELA 3FKIB 1AW7A 1X3FA 1KDBA 1WD0A 3KUPA 2PMZE 1IW7C 4DAMA 1GUSA 4NW2A 4E6IA 1UE1A 5C4JH 2AHOB 3EFXD 2JQOA 1FVIA 1K8MA 1UAPA 1N36Q 4L5RC 4KN4C 4EQNA 2HHHQ 3BDCA 1XPRA 3S17B 4K0KQ 2NZOA 1I94L 4A3GB 1Z47A 1JORA 3BS1A 2EYOA 2MPMA 4IALA 4P71A 1K0SA 1RTOA 3HOXH 4EQPA 5CORA 4LK1C 3HOYB 1XPOA 3DHQA 1Y8OB 1Q8KA 1CKMA 1N9WA 2B63H 4UP9A 2PI2A 3AFPA 3I4OA 2KBNA 4A3CH 1JJCB 4M8AA 4TRDA 5M3MH 3CRLC 1E22A 5JJKA 1D6EC 3HKZE 3KF6B 1PH9A 1PYWD 1B9NA 4X3UA 3ER0A 4LWCA 1II3A 1RCVD 2RSNA 5I9OA 2E2IB 5KIXA 3H91A 1EQVA 4UDUC 2K7VA 3UDIA 2NTSA 1QOHA 2KEEA 4YCVA 3QR8A 3E9HA 1PDQA 1Y1VB 5FO9B 1VQGA 5FK9C 1KD1C 4BA1I 4DNRB 4RMFA 4MIUA 1LT4D 5GAHC 1LACA 1WTRA 5BN3A 1XWEA 3NE5B 2SNSA 4R4QA 4A3KB 4B3TL 1DONA 1NR4A 3BYYB 5COYA 2LXJA 4MN3A 1A2UA 2XVSA 1BCPF 4GN4B 1K83B 4B3TQ 2YTXA 1R9TH 1S5CD 5HURA 4KJNA 4NDXA 3VR4A 4DV6Q 1FJGL 2JK8A 3QIAA 4JI3L 1I50B 4Z9CB 1WTOA 1HFGA 2XRSD 3NXWA 3URYA 5I2XA 1GVPA 5C0XJ 3I4MB 5JVG3 2JA6H 1OTCA 1VF7A 4IURA 4OO1I 4K6LA 2N3SA 3D0FA 3SK6A 1E0BA 1Q7YC 1XTCD 1DOKA 2YTVA 4K2LA 5IGDA 3C3LA 1H9RA 1VMPA 2WAQG 1IBLQ 1TWHH 2IHFA 4BY1H 1WFQA 3HKZB 2QA4A 1Q12A 4L8JA 1MSGA 1ENFA 2IX3A 2OQ0A 4A3CG 2WACA 2L55A 4X64L 3KFUA 1GUWA 3GTOH 4GZYC 2PYKA 2Z0SA 1WTHA 2D9UA 2MNAA 1QNUA 2VY3A 2ICIA 5KEEA 3RMHA 2B29A 1BXTA 3S9WA 2KUMA 3Q24A 2OF1A 4A3EB 2EYMA 5GROA 4DR4Q 1NNXA 2WAQB 2KENA 4N8X1 5JPMC 4HSVA 2M00A 4DV2L 4PMCA 2QILA 1SNPA 4FYDA 1KAWA 3CCJA 3KLWA 4IZ8A 3C2PA 5M5WB 3UDFA 4YCWA 4HIMA 2FJ2A 1N34Q 1R4QB 2KA7A 2RHQB 5IYCH 3D6WA 4IUQA 2A1AA 4HN7A 3K7AH 3GTKH 1VQNA 4A93G 1X54A 4X66L 4A3DB 1C0AA 1VMCA 2KCNA 1Y1WH 5D14A 1BDOA 2B2UC 2K50A 4YCUA 5AJ3L 4KJOA 2CHBD 5BR8Q 3CU7A 4ZYSA 1A3VA 2VUMH 3S15B 4UP8A 1KHIA 1O7ZA 3ULPA 3T51B 2L0CA 3T1HL 2Q2UA 4M1UB 3GTJH 3NBIA 1QE6A 4LF6L 2N78A 1M4VA 2KHIA 2AWOA 3ERSX 3GTMB 2UXCQ 3H3VI 3F2UA 3RZDB 2B2VC 3WWVA 1WTPA 4K8IA 2XWJB 1WTQA 1KNEA 3F2DA 1W3SA 2NVYB 4KHPQ 1T9HA 2JA8G 1VF5C 3NHHA 4POFA 2E8GA 2PCFB 1V43A 2LSSA 3GTLB 2UXDL 2M9VA 3A8IE 2L9HA 5JEAJ 4NXNL 3ND8A 3C46A 2E74C 2HDLA 3VDYA 1OO9B 2UXBL 1VQDA 1PMRA 3HOYG 2K5QA 1LTBD 1H95A 1I3QH 2EYLA 4RGMA 1AZPA 4IOAA 3EROA 3AB9A 4JI5Q 3SEBA 4A3LG 1DCZA 3VYUA 1LO5D 4JI5L 4CGYB 1PLFA 3S2HH 1DGSA 2B2UA 2PZTA 5G3LD 1IYJB 3JAME 2B2WC 2EYFA 1JCKB 4G4KA 2PW5A 2PO4A 3E0EA 1RD9D 2NN6I 1RHPA 3Q8DA 3W3AA 1TWFB 1TKWB 2G9DA 1FNVA 4LW1A 1TWAH 4DR7L 3MHBA 1BVSA 4K14A 3U9OA 1HQRD 1X3EA 4LF5Q 4BY7H 5LHY1 1TS4A 1YEZA 1LLRD 1V1QA 3GTKB 3LNNA 1MHWC 2V1CC 3FPUB 3HOUB 4JV5Q 4DR1Q 1ONLA 2RBMA 5C3WA 3TZDA 5FLXE 3VR2A 1EOVA 3S2DB 1CHQD 1UE7A 2ZTDA 1N36L 1G6PA 4CJ2C 1SROA 4C3JG 5D65A 4CJ0B 2JA7H 2UUAL 3D4WA 1ILQA 3G6JB 4DK6C 1XXGA 2JXMB 3A7LA 5IIFA 2GA4B 3I7FA 4QL5A 1L1OC 4P2CB 1P8LA 1KLUD 5BN4A 4XYOA 1EYAA 1SE8A 2NUCA 3EBEA 1PZID 4IUVA 1PTOD 4HIDA 4EGVA 2K03A 5CR3A 3TS0A 2AKWB 1VQHA 2A74C 3GQBA 1WCMB 3NTKA 4JC0A 1PRTD 4JI2Q 4KKTA 5FLMG 2F0LA 4K8JA 4J8QA 2HHHL 4DV3Q 1X3QA 1EYGA 4XQQA 1EIGA 5EPJA 3I70A 3OIPA 1YZ6A 5CV4A 3U4ZA 3SHLA 2ICEC 1BCPB 2AUJD 3J80i 2HQEA 1YNND 3CXCA 2XN9C 3I4MH 5C3EH 1HFNA 1GOZA 4GKKL 3B6YA 3NQIA 3VR5A 1PXUA 5D3IB 1I50H 1MBYA 2AUKA 3S14H 1DZ1A 3TSSA 1PTOH 2YTYA 1EFWA 1N32L 5T1IA 4JI4L 3K7UC 1K3BC 1QVCA 1G6ZA 5GAGC 2MO1A 2WINB 2BOSA 1IBKL 4PV1C 4DV6L 3CD6A 3QWNA 3MWYW 3NWSA 4V190 4ZCKA 4JI3Q 1TXYA 1O78A 3PIOA 3KLRA 4DR5Q 3OHXC 4X65Q 1JT8A 1MD2D 4NXNQ 2BE5D 2OWOA 1CM9A 1Q3LA 3TZUA 4QGUA 4A3BB 2KCCA 4A3FG 1K8GA 3KBXA 3H6MA 2HCIA 2HQLA 1KAAA 1MJCA 4C3IG 5I9PA 3I55A 2EPBA 4HCSA 4DUZL 5J3BA 3K0YA 1A8VA 1L1OB 4PZ8A 1C7YA 1OXSC 5C4XB 2KOLA 4H44C 3MXGA 1SRUA 4TKOB 2BA0A 3NBHA 4LUVA 1SFOB 5ISRA 5GAEC 2LXKA 5FO7B 3K5MA 3U50C 3A0JA 4ID6A 4OHJA 3KBGA 5EJWA 3HKZG 2HIXA 1XTDA 4DU9A 1I6VC 2R6GA 5IP7G 1EIFA 3V96A 1FL0A 1TVXA 1CKOA 2K32A 1QWYA 3R93A 1G2SA 4LF7Q 4YHHQ 1U5KA 2HUGA 4R4IA 1LT5D 1GD7A 3S17H 1PH3A 4CDFC 1EU4A 5IGCA 4C2MB 3NPPA 1JJGA 3A7AB 2WKCA 3TEHB 2EY6A 3HS0C 4RGOS 1AP0A 2I5LX 4HMJA 1Y1WB 1XMQQ 3PO3H 4A3DH 1W6KA 3M4OB 1K28A 3ONAB 1GO3E 2KCMA 1S40A 2XTIA 4EQOA 1XNQL 1UNSA 3KF8A 5GADC 4DV3L 4JI7Q 2ZXOA 3HOWH 3CCUA 1CSPA 1Q1EA 2K4KA 3A5UA 3MXPA 1SMYC 4A75A 2B2VA 3IL8A 2VW9A 3BDLA 2VB2X 5EPKA 1STHA 2IJ0A 2ZT9C 3DWAA 2XRQD 4N8FA 5FJ8H 1D5XC 1U4LA 2WAQE 3VYSA 4FXGC 3CCSA 4G7ZC 3OYYA 3SK4A 3G4SA 4AIMA 1DD2A 1K0RA 2K01A 2K5HA 4I7AA 1EIYB 5KYLA 1YVCA 5GQOA 4KD4A 4TQUS 1VCIA 1HH2P 5K36H 5JEAH 3P1HA 4LFAQ 3GD7A 5C44B 2HT1A 1CT1D 5IYDH 3F2BA 2IWHA 4YY3L 1X9NA 1XX8A 1GM5A 4LJZC 3G48A 3S24A 2HDMA 2RKSA 5M5YB 2KEDA 4N9TA 4IFDG 3CCLA 4KY5A 1LTLA 1EEID 4BWGB 4DAYA 1ZYRD 5E3FA 4DR6L 4FF2A 2BDOA 3F1ZA 2JEAI 3HP3A 3GTPH 4CKEA 4C3JB 2ZXRA 3D4RA 1J9OA 1JOQA 2F0UA 3VA7A 5K5PA 2NVTH 1A3UA 2VQFQ 3JAMi 2CCZA 4S3SA 3M7GA 1Q46A 2FMCA 3I4NH 3GTOB 2RCFA 1UE5A 4LAAA 4P75A 5CV9A 3Q0AA 3L9AX 3TMEA 3H0GH 3R3OA 1IKLA 1SE4A 2J7ZA 3J81E 1C8CA 2E2JB 1VQEA 1M8AA 2E76C 1SLJA 3IAYA 4ZKCB 3K6OA 1FJGQ 1BKBA 4KKUA 1DOLA 2CH4A 4A3IH 3U9SA 1J5EQ 3D31A 2A6ED 2A6HC 2MQHA 3NP8A 3W5OA 4ZUIA 5C0XH 2EYPA 2JP1A 2A68D 5C0XG 1HTLD 4IFDJ 2G5DA 2NZ1D 3QB3A 3A54A 1CKNA 1ZYRC 3K5OA 3RLOA 4CDCC 1Y1WG 2XWBB 5ELFA 1I4XA 2JSOA 1I4QA 2K5NA 1UWVA 1F9SA 1U4PA 5M3MB 1UE6A 3L3OC 4O42A 1HNWL 1FGUA 4XQNA 3HOVB 3PO3G 5J1ZA 2BH8A 3PIPA 4J6HA 2Z1CA 1L0WA 2ZM6L 3V05A 1A3TA 1W2BA 2PMZB 4DAYB 5CV8A 4RHSA 5KNBA 5CC4A 4KTAA 1EIHA 2L12A 4L63B 1KRTA 5FOBB 4JI6L 3BVGA 1IYVA 3PCOB 2CQAA 4EQ5A 1YIJA 5IP9H 3HFZB 3AQQA 3CCEA 5M5XB 5M3FB 1MGSA 1S5DD 1VQMA 5LMNW 3HOVH 1B8AA 3PSIA 3NENA 4JBJA 2GN5A 2KHSA 4IPGA 4X65L 5CGKA 4FO2A 2I0QA 4A3JG 2H4OA 3OTOQ 2E75C 4XT3B 1B53A 3N52A 5KGUA 2N8NA 1Y1VG 4QIWB 1NMFA 1SR3A 1T5XD 1EY7A 5E4XA 1QB5D 1MJEA 5C4XH 1CQVA 1TWGB 1SAPA 3HOWB 3CC4A 1YBYA 1K9MC 3QOJA 1RIPA 1BF4A 4R8NA 3TDQA 3ITPA 4DV0L 1A2TA 3M9BA 3R2TA 1WD1A 3W1GA 3TN2A 4A3IB 4R4OA 1WCMG 4X62Q 2PZUA 1IBLL 2R92G 2X6GA 2E2DC 2MJ8A 1VQPA 3KF6A 2PQEA 2F52A 4FXDA 4O0AA 4UAIA 3IRBA 4KY6A 4JV5L 4B3ML 4ZRZA 3CC7A 2JN4A 2F0WA 2CW0C 3CW2C 1X32A 3EA6A 3P20A 1ZEQX 4A93H 5I6WA 1TWGH 4DUYL 1GHJA 4HJ7A 2EXDA 3GTLH 5JJLA 4JCVE 4DXFA 3GTMH 3E3XA 1SDFA 1PTOF 2LFNA 4JBMA 2JA8H 1WYDA 4RGNA 2J4XA 2NVYH 4ZKBB 2EIFA 3ULLA 3J7ZC 4A3FH 4JOIA 3JAML 4KMUC 2PQAB 4JK1C 3H15A 2RHSB 4JVZA 2F0QA 1D8LA 1QJOA 2F1MA 1IBML 3I4NG 1WVLA 2ID0A 3IKJA 4A3GH 3ND9A 1TY0A 3ZJYC 3WOFA 3GTQH 1G91A 5M3MG 3GDEA 5M5XH 4QMGA 2BE5C 1N33L 4LF5L 3A8JE 2B2TA 1V8QA 4FNFA 2R7ZG 1ASYA 4AQYQ 3MZ5A 1MIUA 2GVBA 3A56A 2FMMA 4HIKA 5IGGA 3HOZG 4JYAL 3K8AA 4YWKA 5EBCA 5IYCG 2NVQH 4LFBL 4NP5A 2L11A 5KNCA 2R93B 1IHZA 1Q1BA 2EY2A 4C1NK 4PMWA 4DV4L 2FINB 2K75A 3T13A 4B3SL 1EFID 3HKSA 1HXYD 2PQAA 2UUBL 1KLGD 2B39A 2K05A 1MI2A 1PH4A 4XDXA 5I4DA 1Q81C 4DR3L 1G291 3F8TA 5LL6X 4HR7B 3J7AV 3NTIA 1JB7A 2F0DA 3GO5A 1FNWA 3HEJA 2ZTEA 1I6HB 1SXTA 2DGYA 3VYTA 4RG1A 1EEFD 2L4NA 5ELEA 1ET6A 1L2FA 2IX1A 5FKAC 4QJFA 5ELNA 3SK5A 4A3EH 2F0HA 3NK9A 1WJJA 2F0GA 2K5VA 3OTOL 4N9PA 2F4VL 1NCVA 1RL2A 4A3BH 3K5LA 3S1QB 1QG7A 4RH6A 1E24A 4L5QA 5CYUA 1WTVA 4NMZA 1YITA 5K36G 3E6ZX 1HJPA 1F9PA 2DY8A 3P75A 2FFKB 2F0SA 2KECA 2E2JH 5CV7A 5IGEA 5LMUQ 3GTGH 4ZLTF 1VQ5A 5EGTA 2ASBA 2Y0SE 1PH1A 1X3PA 4F87A 4BY7G 3MFGA 1F9QA 2JA6B 4DGZA 3CP0A 1M1KC 4JI0Q 4V0BA 5CBEE 1DYQA 3MTSA 1LV9A 1PRTC 2EVBA 4LF4Q 1CTMA 2XNAC 3A55A 3GV3A 4DV0Q 2JA6G 3CCQA 1HNXL 3M4YA 3S14B 2XIWA 1AN8A 4HIOA 3GV6A 3H3VH 1LUZA 1Z7TA 1U9RA 1NUCA 5C3EB 2JA7G 1GXDC 2CWPA 1E2ZA 1NR2A 2QEJC 1QVFA 1BBWA 1HNZL 1HRJA 1E2VA 3UDGA 3FRPB 4KV6A 1Q86C 3PO3B 2DJFC 3G6EA 1R9TB 2O5JC 3M4PA 1G2TA 1C9OA 4DV1Q 2K04A 5IWAL 3MEFA 4NB3A 1VQKA 1ICFB 5EQ0A 2EE1A 3BZDB 1I4HA 1K8AC 2NVTB 4RFBA 1J5EL 1P16A 1LT6D 5EKKA 1LTAD 2AQ2B 2HIVA 4IO9A 1I6HH 1NAPA 1JB3A 2DY7A 2Q8RE 1SYFA 4IPDA 4MTNA 2CWAA 2R7DA 1EOTA 2JEBI 4OWWB 1YNNC 4BY1B 3UDXA 4IUPA 1SFOH 5ELCA 1I94Q 3HOXB 2DNCA 1EU3A 2NYZD 3FP9A 1LTSD 4WJ4A 2AQ1B 1EWCA 5ELBA 3RZOH 2IHEA 1SMXA 5IY0A 4Y7NH 4GLVB 2F0VA 1HUMA 1QZHA 1JQYD 5DM73 5LMNQ 3PUWA 2CKZB 2LS01 1O7IA 4GOPB 2BCOA 2JA9A 4ME3A 2RQXA 1CZGA 1AEXA 1EY6A 1PH6A 4BBSB 3STBC 1IKMA 3SVMA 1K83H 2EZVA 2ENBA 4ME5A 4KHVA 4C3HH 2G9HD 4DKAC 1D1IA 4A3KH 1XYIA 4LFAL 1KQSA 2DN8A 1QUQB 2VNUD 1TS3A 2JYOA 4CHTB 1RF2D 3MA2B 1H9SB 1SE2A 2EY5A 4PZ7A 4IQZA 1M90C 1GUNA 2B8GA 4I65A 2B3GA 5J22A 4JI2L 4KHZA 4IFDI 1N34L 2YV5A 3EQLC 1D7QA 4O1NA 1CSQA 1C48A 2K28A 3FHWA 4RKLA 1EUJA 4H7BA 5L37A 3R2IA 4H13C 1SMYD 3PUYA 4LNQA 3GTJB 1EQRA 2F4VQ 2Z4IA 1HR0L 2CVRA 3DMUA 3GTGB 5C6AA 4F88A 3CRKC 1SYBA 2UUCL 3L2PA 4BXXG 4RA8A 3QJYA 5C3EG 3OW7A 4WRDA 1QUQA 3NQTA 3D4DA 1BO0A 1ESRA 1CA5A 4JI8Q 4IOCA 2F3IA 3C1FA 3T1YL 4POGA 4C56C 2QKIC 4BS9A 2PI2E 5ELDA 1LTRD 1IBMQ 1ML0D 3AEVA 3MXNA 2WFWA 4LF7L 1EY0A 1H9KA 1IYUA 1H9JA 5JEAG 3PGZA 1TWCB 1FNUA 4BBSG 3TP8A 5IYDG 1JWSD 3HOYH 2PW7A 3ICEA 4BBSH 1BQQT 2F0PA 1W6JA 1STBA 4PZ6A 4DR3Q 3RR5A 4HAEA 4DR1L 3O13A 1XJVA 4UY8C 2BA1A 5KRUA 4QY7A 1OXUA 3NUCA 3DUZA 1Y69U 2BDNA 5C5MA 2WB1B 1I4GA 4MNOA 4C1NI 5JAVA 2CQOA 4I7ZC 1YJWA 2D0OA 2RF4A 3A5ZB 3S1QH 4AQYL 4FF1A 4QUCA 3HOXG 4FXKC 4GLXA 1EYCA 1YHQA 3HOVG 1VQLA 2X6LA 1A0IA 1XMOL 4OWTB 5HGQA 4OONA 2R61A 4ALPA 1KRSA 5AJ3Q 2L15A 4R8IA 2O4XA 4OXPA 2PNHA 3I4LA 3KJOA 1F2YA 1C4QA 3I8ZA 2VS1A 3E9IA 1K8OA 5IGBA 2A68C 1J8IA 3MFYA 4L5SA 4LF9L 1KTKA 4JBKA 4DFAA 1RJTA 4EVOA 1EY8A 2YU9B 1QCBD 1SJED 4K0KL 2I5HA 1A15A 3FPPA 1SBBB 3PUVA 4PG3A 3IFTA 1SNDA 3C1EA 3V2TA 4IUUA 3NEMA 4KN7C 2EY1A 1R4PB 4KHPL 3KJPA 3BZKA 5FLXc 3AMUA 4JI0L 4K5XA 4AH6A 2C35B 3LWUA 1JJ2A 4WJWA 3ULJA 4BA2I 2H5XA 4B3MQ 2A19A 3MEHA 2A6EC 4KK7A 4MZ9A 2Q2IA 1ASZA 4X62L 1EWHA 1F2MA 3I91A 3RN2A 5LMUL 2B2TC 1VQ7A 1PFSA 1JE4A 2QDBA 4A3GG 2NN6G 4R9WA 1OXVA 2SOBA 4FF3A 4BXXH 3K80C 1AE2A 3E5SA 3HZXA 4BY7B 2WV6D 4DV7L 4L5TA 4RCOA 4G57A 2CFMA 4K2KA 5EKLA 5DAUA 1N32Q 2OTLA 4P74A 4LFCQ 1YNXA 2LKVA 3SDZA 1SE3A 2F0TA 4DV5L 1D2BA 3GTPB 1B3AA 2SEBD 4F7XA 2OXPA 1HZ9A 1EYDA 4K5WA 1JOKA 4RGTA 3KDFB 1UEBA 1RTNA 1EZ6A 3Q6SA 4BBRH 5I2YA 1SYEA 5E1FA 4XIGS 3I4MG 1FYCA 1TIID 3BU2A 4DR7Q 1N8RC 2Y0SG 4GNXA 2K5DA 1MSHA 1NE3A 1SYDA 2EQSA 3MC0B 3CPWA 1VQ9A 4O2DA 1CHPD 1Y14B 1E3PA 4L6TB 1BNZA 5LL6S 3MVVA 2OEOA 2Q2HA 4R1JA 4JG2A 3LX0A 1IXRA 3D3RA 4A3FB 2F0KA 4JOIC 3S1NB 3W2DA 4CDDC 1S5ED 1K73C 2N49A 1ENCA 2VQEL 1PYBA 4X3TA 3KDFA 5FJ8G 1OXTA 3M7NA 4RKBA 1JOOA 1N33Q 1RKNA 3M3YH 2F3WA 4IUTA 4MHEA 1CUKA 1NMGA 2EJMA 2VB3X 3L7ZC 4X66Q 4ILWA 2F0OA 2JA5H 2L1BA 4WFN3 4U673 1G8ZD 4Q0FA 1NSNS 1V1OA 3CPFA 3HGBA 4U68A 3PF5A 2E2HH 2D5DA 4ULLA 5JVH3 4GKKQ 1D1KA 3T1HQ 4QCLA 2UXDQ 5IYBG 2RDHA 4OO1G 1H9MA 3J7A5 1EY5A 3S1MB 3I4NB 1PVOA 3SXHA 1F2LA 1X3GA 3FEWX 4A3MG 1KC8C 2UXCL 4OGQC 4H0LC 2NTTA 3J7YW 4OELB 4JI4Q 3KLSA 4A93B 1YI2A 1PRTB 2R92B 2IL8A 1BCPC 1X65A 2ZJPA 1K3RA 3RLNA 3RLFA 5KYIA 2B2WA 1STYA 4HJ8A 3SR1A 1IBKQ 1HCZA 2EOTA 3VR3A 4FP5D 1ET9A 1XPUA 3RZDH 3OIQA 2P5ZX 2TSSA 1EY9A 1SN8A 4GS3A 3KYHC 3VYRA 4GN3B 1YJNA 4A3IG 2IX0A 1VQ6A 2HCCA 2AWNA 4LF8L 2B2YA 2KCTA 1S5BD 2B63G 1CA6A 4NXML 2E5LQ 3OW2A 2B8FA 2E5LL 3RNUA 1I5FA 1B9MA 5JOBA 5BN5A 3RZOB 1FR3A 1U0LA 5M3FG 3J81c 5M3FH 3S1RH 1AE3A 5C44G 1FGBD 1B70B 1SSOA 1SNOA 4FDBA 3EJIA 3H09A 2UUBQ 3PQIA 4YWLA 4JI7L 1JR0D 4DNIA 4YHHL 1ESFA 2K6AA 1X55A 1HZBA 5TSSA 5JPNC 2A5HA 3HRZC 2E2HB 5CBAE 1VQ4A 4LFBQ 1GUTA 3EN2A 4HTHA 1XMQL 4QB4A 2MHVA 1TS5A 4PNYA 1J6QA 1TWHB 3T53B 3HOUG 3W1BA 2KQ3A 3CMEA 2WB1E 1CK1A 3CC2A 2EYHA 4NKLA 3JC66 2DNEA 3M4QA 2QEXA 2R7FA 2NVQB 1SYCA 1XNRQ 2RSOA 1I4RA 4RAUC 4F8MA 2ZTCA 1FD7D 5BR8L 2VXWA 4KY7A 1HHVA 2A73B 1DJRD 4X6AH 1LTID 5E7NA 2WIIB 4DR6Q 5IE8A 1GHKA 1YHAA 2IY5B 4OIKA 4HMIA 4IJLA 4AYBB 4ZK9B 2JA5B 4FVMA 4A3LH 3PV0A 4DUZQ 1SNQA 1PFBA 1IZ6A 4JI1L 3K59A 3QG1A 1KNAA 3TQYA 1TWAB 1T5EA 1WCMH 1VQAA
chains in the Genus database with same CATH topology
5KNDA 3H0GB 4XXEA 5A35A 4OO1H 5F2DA 1HA6A 1PZKD 5A2QE 4B9XA 1KDAA 4CKBA 3NWTA 4C3IB 3OMGA 4X3SA 1STNA 1B50A 2LY7A 3TP5A 1HA5A 5AFWA 1IW7D 2H1EA 3CKIB 4K6DA 4LMQD 3NSWA 2SDFA 4G7HC 3QO2A 3OWFA 4XQJA 1BBXC 5D3DA 1STGA 2F0FA 2Q8TA 4DN4M 1B2TA 3FDTA 1TT2A 2RVLA 1GJXA 4J1MA 1YNJC 4RCNA 2LMCB 2RDGA 4Y7NB 4HSPA 5J39A 2A69C 2K1BA 3RUZA 5EPLA 1ICWA 4PMBA 2K33A 3AU7A 2MUYA 5CMDA 3P7JA 3ZYYX 3J81L 3OPOA 3TP6A 2X69A 3OOCA 1Y8PB 3HOZB 3PIP3 1O80A 2R7ZB 2EJFC 2ZXPA 2NWGA 1BR9A 1L0YB 1OXXK 3X3MA 2XSCA 3WDNA 1DOMA 4RWSC 5HGTA 2IT1A 5DM63 3DWPA 1YNJD 4HCEA 2O2LD 4PQXA 5M9OA 3DWQA 2MGSA 1QNKA 3DXJC 3GP7A 2CW0D 3PUXA 2JA7B 2Q8IB 3R8BA 3HG9A 5C4ZA 1B1ZA 1JWUD 3WOEA 2KJXA 3ERQA 1AFPA 4C3HG 1EY4A 5DNFA 1KDCA 4XYQA 2F0EA 4XTCS 4DF7A 1BUVT 3CQZB 1PRTF 1JICA 3SK8A 1PTOB 5FO8B 1RDPD 2I07B 2PZWA 2I46A 3BVMA 5IOCA 1QILA 1DM0B 3RD4A 3NTHA 3MAQA 3LWEA 5EBDA 2WKDA 3S16B 1HPCA 3D8GA 3M85A 5IT9E 3FVQA 2F0IA 2RDFA 1EZ8A 4TSSA 2C9OA 5C5LA 4B08A 2NB0A 1CQFA 5IT9L 4C3HB 2N55A 2B63B 2EJGC 3D6CA 2K5WA 3I72A 3PO2B 1TY2A 4DK0A 3Q23A 1JC7A 1F2ZA 1ILPA 1D5MC 1WTXA 3GTQB 1HTPA 4ZQ3A 4A3MB 1PFMA 1Y8NB 4KD3A 1D5ZC 1SNMA 3TBIB 2C5CA 4ABNA 3A8KE 2D2CC 1Q8IA 2WP8J 4CBVA 1GUOA 1I3QB 1AZQA 3PIO3 1F77A 2F4IA 1JWMD 3CHBD 2D62A 2Z8LA 4DK1A 5C0XI 4JBWA 1STEA 1BOSA 1PZJD 2A6HD 1E2WA 1WTWA 3OWEB 1LABA 4DAPA 3S2HB 3X3NA 4OIJA 1PFNA 1PTOC 4WORA 2TMPA 3J80E 4QF4A 2JA8B 1O7YA 1TR5A 3I90A 4X3KA 1V1PB 2N88A 3S1RB 1S4ZA 1EQTA 1Z6HA 1Q90A 3J80L 3IFDA 3K5NA 1H9SA 3QOLA 3H94A 1HQMC 4IN3A 2KVMA 5G3LF 4DAVA 3PUZA 1HUNA 1CFMA 3H3VC 3VR6A 3KLSX 1B4OA 4DXGA 1U4RA 5C4HA 2IW3A 4IUNA 2J0TD 1F9RA 2EDGA 4IFDH 1ZXTA 3PMFA 4DNTB 1CI3M 4A3JB 2JE6I 3K7AB 5E4WC 2V4DA 3FMCA 3Q22A 4K5VA 2IPKD 5C4JB 5I6YA 1TQOA 1U4MA 1STAA 4QUFA 3M3YB 3BDOA 1CZWA 4BBRB 1UEAB 1EL0A 3G7LA 4DA2A 2M2LA 4CKCA 3I73A 4RHRA 2MP1A 4YIJA 2L5TA 3SE0A 3K58A 2O5IC 5CV6A 1A6XA 1V1PA 1GUGA 3OMCA 3BVZA 3N6RA 4ZUJA 1UUPA 1O7LA 4B9WA 1TS2A 2NVXB 2F3VA 1LTTD 1L0XB 2F03A 2EXZA 1TU2B 4ODGA 3DEOA 5C3XA 2SNMA 3T56B 1ENAA 2A69D 1SNCA 5NUCA 3OSOA 3DEPA 2FHTA 5IGFA 5EKIA 1B44D 2F0NA 2Y0SB 2NN6H 3BG3A 5IODA 1RODA 3UI2A 4Q5VA 1SEBD 3T4AC 1ZKOA 2EYJA 5FLXL 4CJ1B 2RA4A 2AQ3B 2Z4HA 2YYZA 1DXMA 3I3CA 1SJHD 2R3ZA 3K57A 1KABA 2NBFA 3KK7A 5DEHA 1SYGA 5CV5A 4ZAIA 4XT1B 3DM1A 3J7AF 3T16A 2F0JA 5A2QL 1I4PA 4G7OC 3E0JA 2PPBC 1LT3D 2PNRC 1VDZA 4OL7A 5T1GA 1LTGD 3MXUA 2OT2A 2QCPX 1S5FD 4HEDA 3TP7A 2B2YC 1BCPD 5JJZA 1IL8A 3VA5A 3EVQA 4KI0A 3BYTB 4KKSA 4FF4A 2QF7A 2F0MA 2VUMB 3FKIB 1AW7A 1KDBA 1WD0A 3KUPA 1IW7C 4E6IA 1GUSA 4NW2A 3EFXD 1K8MA 1UAPA 4KN4C 4EQNA 3BDCA 3S17B 4A3GB 1Z47A 1JORA 3BS1A 2EYOA 2MPMA 4IALA 1RTOA 4EQPA 5CORA 4LK1C 3HOYB 3DHQA 1Y8OB 4M8AA 4TRDA 3CRLC 1D6EC 1PYWD 1B9NA 4X3UA 1II3A 1RCVD 2RSNA 5I9OA 2E2IB 5KIXA 3H91A 1EQVA 4UDUC 2K7VA 2NTSA 1QOHA 2KEEA 5FO9B 1PDQA 1Y1VB 5FK9C 4BA1I 4DNRB 4MIUA 1LT4D 1LACA 1WTRA 5BN3A 1XWEA 3NE5B 2SNSA 4A3KB 1DONA 1NR4A 3BYYB 5COYA 4MN3A 1A2UA 2XVSA 1BCPF 1K83B 1S5CD 5HURA 4KJNA 4NDXA 3VR4A 3QIAA 1I50B 4Z9CB 1WTOA 1HFGA 2XRSD 3NXWA 3URYA 5I2XA 5C0XJ 3I4MB 5JVG3 1VF7A 4IURA 4OO1I 4K6LA 3SK6A 1E0BA 1XTCD 1DOKA 4K2LA 5IGDA 3C3LA 1H9RA 1VMPA 3HKZB 1Q12A 4L8JA 1MSGA 1ENFA 2IX3A 2WACA 2L55A 1GUWA 4GZYC 2PYKA 2D9UA 1QNUA 5KEEA 2ICIA 3RMHA 1BXTA 3S9WA 2KUMA 3Q24A 2OF1A 4A3EB 2EYMA 2WAQB 5JPMC 4HSVA 2M00A 4PMCA 2QILA 1SNPA 4FYDA 4IZ8A 3C2PA 5M5WB 2FJ2A 1R4QB 2KA7A 3D6WA 4IUQA 4HN7A 4A3DB 1VMCA 2KCNA 5D14A 1BDOA 2B2UC 4KJOA 2CHBD 3CU7A 4ZYSA 1A3VA 3S15B 1O7ZA 3T51B 2L0CA 4M1UB 3NBIA 1QE6A 1M4VA 2AWOA 3GTMB 3F2UA 3RZDB 2B2VC 1WTPA 4K8IA 2XWJB 1WTQA 1KNEA 2NVYB 1VF5C 3NHHA 2PCFB 1V43A 3GTLB 2M9VA 3A8IE 2L9HA 5JEAJ 3ND8A 3C46A 2E74C 2HDLA 1OO9B 1PMRA 2K5QA 1LTBD 2EYLA 4RGMA 1AZPA 3EROA 3AB9A 3SEBA 1DCZA 3VYUA 1LO5D 4CGYB 1PLFA 2B2UA 2PZTA 5G3LD 3JAME 2B2WC 2EYFA 1JCKB 4G4KA 2PW5A 2PO4A 1RD9D 2NN6I 1RHPA 3W3AA 1TWFB 1TKWB 2G9DA 1FNVA 3MHBA 4K14A 3U9OA 1HQRD 5LHY1 1TS4A 1LLRD 3GTKB 3LNNA 3FPUB 3HOUB 1ONLA 2RBMA 5C3WA 3TZDA 5FLXE 3VR2A 3S2DB 1CHQD 4CJ2C 4C3JG 5D65A 4CJ0B 3D4WA 1ILQA 3G6JB 1XXGA 2JXMB 3A7LA 5IIFA 2GA4B 4P2CB 1KLUD 5BN4A 4XYOA 1EYAA 2NUCA 1PZID 4IUVA 1PTOD 4EGVA 2K03A 5CR3A 3NTKA 2A74C 3GQBA 1WCMB 1PRTD 4KKTA 2F0LA 4K8JA 4J8QA 1X3QA 4XQQA 1EIGA 5EPJA 3I70A 3OIPA 5CV4A 3SHLA 2ICEC 1BCPB 2AUJD 2HQEA 1YNND 2XN9C 1HFNA 1GOZA 3NQIA 3VR5A 1PXUA 5D3IB 1MBYA 2AUKA 1DZ1A 3TSSA 1PTOH 5T1IA 1G6ZA 2WINB 2BOSA 4PV1C 3QWNA 3MWYW 3NWSA 4V190 1O78A 3KLRA 3OHXC 1MD2D 2BE5D 1CM9A 1Q3LA 3TZUA 4A3BB 2KCCA 3KBXA 3H6MA 2HCIA 1KAAA 4C3IG 5I9PA 2EPBA 4HCSA 3K0YA 1OXSC 5C4XB 2KOLA 4H44C 3MXGA 4TKOB 2BA0A 3NBHA 1SFOB 5ISRA 5FO7B 3K5MA 4ID6A 4OHJA 3KBGA 5EJWA 4DU9A 1I6VC 2R6GA 3V96A 1TVXA 2K32A 1QWYA 3R93A 1G2SA 2HUGA 1LT5D 1EU4A 5IGCA 4C2MB 3NPPA 3A7AB 2WKCA 2EY6A 3HS0C 4RGOS 1AP0A 4HMJA 1Y1WB 1W6KA 3M4OB 3ONAB 4EQOA 1UNSA 3KF8A 2ZXOA 1Q1EA 3MXPA 1SMYC 2B2VA 3IL8A 3BDLA 2VB2X 5EPKA 1STHA 2IJ0A 2ZT9C 3DWAA 2XRQD 1D5XC 1U4LA 3VYSA 4FXGC 4G7ZC 3SK4A 1DD2A 2K01A 5KYLA 4KD4A 4TQUS 1VCIA 5K36H 5JEAH 3P1HA 3GD7A 5C44B 1CT1D 2IWHA 1XX8A 4LJZC 2HDMA 2RKSA 5M5YB 2KEDA 4N9TA 4IFDG 4KY5A 1EEID 4BWGB 4DAYA 1ZYRD 5E3FA 4FF2A 2BDOA 2JEAI 3HP3A 4CKEA 4C3JB 2ZXRA 3D4RA 1J9OA 1JOQA 2F0UA 3VA7A 5K5PA 1A3UA 4S3SA 3M7GA 2FMCA 3GTOB 5CV9A 4LAAA 3Q0AA 3L9AX 3TMEA 3R3OA 1IKLA 1SE4A 2J7ZA 3J81E 1C8CA 2E2JB 1M8AA 2E76C 3IAYA 4ZKCB 3K6OA 4KKUA 1DOLA 3U9SA 3D31A 2A6ED 2A6HC 3NP8A 4ZUIA 5C0XH 2EYPA 2JP1A 2A68D 5C0XG 1HTLD 4IFDJ 2NZ1D 3QB3A 3A54A 1ZYRC 3K5OA 2XWBB 5ELFA 1I4XA 2JSOA 1I4QA 1F9SA 1U4PA 5M3MB 3L3OC 4O42A 4XQNA 3HOVB 5J1ZA 4J6HA 2Z1CA 3V05A 1A3TA 2PMZB 5CV8A 4RHSA 5KNBA 5CC4A 4KTAA 1EIHA 2L12A 4L63B 5FOBB 3BVGA 1IYVA 2CQAA 5M5XB 5M3FB 1MGSA 1S5DD 2KHSA 5CGKA 4FO2A 2H4OA 2E75C 4XT3B 1B53A 3N52A 5KGUA 4QIWB 1T5XD 1EY7A 5E4XA 1QB5D 1CQVA 1TWGB 1SAPA 3HOWB 3QOJA 1BF4A 4R8NA 3TDQA 3ITPA 1A2TA 3R2TA 1WD1A 3TN2A 4A3IB 2PZUA 2X6GA 2E2DC 2MJ8A 2PQEA 4FXDA 4UAIA 4KY6A 4ZRZA 2F0WA 2CW0C 1X32A 3EA6A 3P20A 1ZEQX 5I6WA 1GHJA 4DXFA 1SDFA 1PTOF 2LFNA 4RGNA 2J4XA 4ZKBB 3JAML 4KMUC 4JK1C 2F0QA 1QJOA 2F1MA 1WVLA 2ID0A 3IKJA 3ND9A 1TY0A 3WOFA 1G91A 4QMGA 2BE5C 3A8JE 2B2TA 1V8QA 4FNFA 3MZ5A 3A56A 2FMMA 5IGGA 5EBCA 4NP5A 2L11A 5KNCA 2R93B 1IHZA 1Q1BA 2EY2A 4C1NK 4PMWA 2FINB 3T13A 1EFID 1HXYD 1KLGD 2B39A 2K05A 1MI2A 4XDXA 5I4DA 1G291 5LL6X 4HR7B 3J7AV 3NTIA 2F0DA 3GO5A 1FNWA 3HEJA 1I6HB 1SXTA 3VYTA 1EEFD 2L4NA 5ELEA 1ET6A 2IX1A 5FKAC 3SK5A 2F0HA 3NK9A 2F0GA 4N9PA 1NCVA 3K5LA 3S1QB 1QG7A 4RH6A 5CYUA 1WTVA 4NMZA 5K36G 3E6ZX 1F9PA 2DY8A 3P75A 2FFKB 2F0SA 2KECA 5CV7A 5IGEA 4ZLTF 5EGTA 1X3PA 4F87A 3MFGA 1F9QA 2JA6B 4DGZA 4V0BA 5CBEE 1DYQA 3MTSA 1LV9A 1PRTC 2EVBA 1CTMA 2XNAC 3A55A 3GV3A 3M4YA 3S14B 2XIWA 1AN8A 3GV6A 1Z7TA 1U9RA 1NUCA 5C3EB 1GXDC 1E2ZA 1NR2A 2QEJC 1HRJA 1E2VA 3FRPB 4KV6A 3PO3B 1R9TB 2O5JC 1G2TA 2K04A 5EQ0A 2EE1A 3BZDB 1I4HA 2NVTB 4RFBA 1LT6D 5EKKA 1LTAD 2AQ2B 1NAPA 1JB3A 2DY7A 2Q8RE 1SYFA 1EOTA 2JEBI 1YNNC 4BY1B 4IUPA 5ELCA 3HOXB 2DNCA 1EU3A 2NYZD 1LTSD 2AQ1B 1EWCA 5ELBA 2F0VA 1HUMA 1JQYD 5DM73 3PUWA 2LS01 2BCOA 2RQXA 1CZGA 1AEXA 1EY6A 4BBSB 1IKMA 3SVMA 2EZVA 2ENBA 4ME5A 4KHVA 2G9HD 1D1IA 1XYIA 2DN8A 2VNUD 1TS3A 2JYOA 4CHTB 1RF2D 3MA2B 1H9SB 1SE2A 2EY5A 4IQZA 1GUNA 2B8GA 4I65A 5J22A 4KHZA 4IFDI 3EQLC 4O1NA 1C48A 2K28A 4RKLA 4H7BA 3R2IA 4H13C 1SMYD 3PUYA 3GTJB 2Z4IA 3GTGB 2CVRA 3DMUA 5C6AA 4F88A 3CRKC 1SYBA 4RA8A 3QJYA 3OW7A 4WRDA 3NQTA 3D4DA 1BO0A 1ESRA 1CA5A 3C1FA 4C56C 2QKIC 4BS9A 5ELDA 1LTRD 1ML0D 3MXNA 1EY0A 1H9KA 1IYUA 1H9JA 5JEAG 1TWCB 1FNUA 3TP8A 1JWSD 2PW7A 1BQQT 2F0PA 1W6JA 1STBA 4HAEA 3O13A 2BA1A 5KRUA 1OXUA 3NUCA 3DUZA 1Y69U 2BDNA 5C5MA 2WB1B 1I4GA 4C1NI 5JAVA 4I7ZC 4FF1A 4QUCA 4FXKC 1EYCA 2X6LA 2R61A 4R8IA 2O4XA 3I4LA 1F2YA 1C4QA 3I8ZA 1K8OA 5IGBA 2A68C 1J8IA 3MFYA 1KTKA 4DFAA 1RJTA 4EVOA 1EY8A 2YU9B 1QCBD 1SJED 1A15A 3FPPA 1SBBB 3PUVA 3IFTA 1SNDA 3C1EA 3V2TA 4IUUA 4KN7C 2EY1A 1R4PB 3AMUA 4K5XA 3LWUA 4WJWA 4BA2I 3MEHA 2A6EC 4KK7A 1EWHA 1F2MA 3I91A 2B2TC 1JE4A 2QDBA 2NN6G 4R9WA 1OXVA 2SOBA 4FF3A 3E5SA 3HZXA 4BY7B 2WV6D 4RCOA 4G57A 4K2KA 5EKLA 5DAUA 2LKVA 3SDZA 1SE3A 2F0TA 1D2BA 3GTPB 1B3AA 2SEBD 4F7XA 2OXPA 1EYDA 4K5WA 1JOKA 4RGTA 1RTNA 1EZ6A 3Q6SA 5I2YA 1SYEA 5E1FA 4XIGS 1FYCA 1TIID 2K5DA 1MSHA 1SYDA 3MC0B 1CHPD 1BNZA 4L6TB 5LL6S 3MVVA 2OEOA 3LX0A 3D3RA 4A3FB 2F0KA 3S1NB 3W2DA 1S5ED 1ENCA 4X3TA 1OXTA 3M7NA 4RKBA 1JOOA 1RKNA 2F3WA 4IUTA 4MHEA 2EJMA 2VB3X 3L7ZC 4ILWA 2F0OA 2L1BA 4WFN3 4U673 1G8ZD 4Q0FA 1NSNS 1V1OA 3HGBA 4U68A 2D5DA 4ULLA 5JVH3 1D1KA 4QCLA 2RDHA 4OO1G 1H9MA 1EY5A 3S1MB 3I4NB 3SXHA 1F2LA 3FEWX 4OGQC 4H0LC 2NTTA 3J7YW 3KLSA 4A93B 1PRTB 2R92B 2IL8A 1BCPC 3RLFA 5KYIA 2B2WA 1STYA 3SR1A 1HCZA 2EOTA 3VR3A 4FP5D 1ET9A 3OIQA 2TSSA 1EY9A 3VYRA 2IX0A 2HCCA 2AWNA 2B2YA 1S5BD 1CA6A 2B8FA 1B9MA 5JOBA 5BN5A 3RZOB 1FR3A 1FGBD 1SSOA 1SNOA 3EJIA 3H09A 1JR0D 1ESFA 2K6AA 5TSSA 5JPNC 2A5HA 3HRZC 2E2HB 5CBAE 1GUTA 4HTHA 4QB4A 2MHVA 1TS5A 4PNYA 1TWHB 3T53B 2KQ3A 1CK1A 2EYHA 4NKLA 2DNEA 2NVQB 1SYCA 2RSOA 1I4RA 4RAUC 4F8MA 1FD7D 2VXWA 4KY7A 1HHVA 2A73B 1DJRD 1LTID 2WIIB 1GHKA 4OIKA 4ZK9B 4HMIA 4AYBB 2JA5B 4FVMA 3PV0A 1SNQA 1PFBA 3K59A 3QG1A 1KNAA 1TWAB 1T5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9S A;  3T51 B;  4G7O C;  5KND A;  3D31 A;  2IT1 A;  2A6E D;  2A6H C;  1HTP A;  5C0X H;  2PPB C;  5BN4 A;  3GQB A;  3DXJ C;  1Y8N B;  4KKT A;  5A35 A;  4OO1 H;  2A68 D;  2AWO A;  3BDO A;  5C0X G;  3PUX A;  3VR4 A;  2PNR C;  2DN8 A;  2Q8I B;  1VDZ A;  2CW0 C;  3QIA A;  3A8K E;  2D2C C;  3I4L A;  1ZYR C;  3P20 A;  3MXU A;  1H9S B;  2B8F A;  1GHJ A;  4IQZ A;  1GUN A;  1GUO A;  2AUJ D;  2B8G A;  1B9M A;  1K8O A;  4KKU A;  1VF5 C;  2EVB A;  5BN5 A;  1Q1E A;  1CTM A;  2A68 C;  2PCF B;  1V43 A;  4KHZ A;  3MFY A;  1SMY C;  3I73 A;  1VF7 A;  1FR3 A;  3M4Y A;  3EQL C;  3A8I E;  4KI0 A;  2L5T A;  3SE0 A;  2O5I C;  1Z7T A;  2ZT9 C;  3ND8 A;  2E74 C;  1IW7 D;  4KKS A;  3VR5 A;  2QF7 A;  4KMU C;  2AUK A;  3FPP A;  1H9R A;  4JK1 C;  3PUV A;  1OXT A;  1PMR A;  1E2Z A;  3M7N A;  1GUG A;  1A6X A;  2D62 A;  4G7Z C;  3IFT A;  5KNB A;  1E2V A;  3N6R A;  4DK1 A;  4G7H C;  1QJO A;  4H13 C;  2F1M A;  1Q12 A;  2EJM A;  3AB9 A;  3L7Z C;  3PUY A;  3IKJ A;  4L8J A;  4KN7 C;  1O7L A;  3ND9 A;  4XTC S;  2O5J C;  1DCZ A;  4JBW A;  1IW7 C;  1GUS A;  4PV1 C;  1IYV A;  3CRK C;  2A6H D;  1E2W A;  4TQU S;  1K8M A;  1LAB A;  1VCI A;  3LWU A;  1GJX A;  1O78 A;  4GZY C;  5K36 H;  2BE5 C;  5JEA H;  3QJY A;  1GUT A;  3A8J E;  3HGB A;  3KLR A;  3GD7 A;  4KN4 C;  1TU2 B;  2NN6 I;  1V8Q A;  4BA2 I;  2D5D A;  3OW7 A;  2BE5 D;  3W3A A;  3T56 B;  3TZU A;  1YNJ C;  1TKW B;  4OO1 G;  2A6E C;  4RCN A;  1H9M A;  2A69 D;  2KCC A;  4LJZ C;  2LMC B;  1EWH A;  2A69 C;  3T53 B;  4LK1 C;  4IFD G;  1Y8O B;  1DD2 A;  5KNC A;  1Q1B A;  2NN6 G;  1OXS C;  1OXV A;  2E75 C;  2K33 A;  2NN6 H;  1Z6H A;  3BG3 A;  4H44 C;  1Q90 A;  2BDO A;  4TKO B;  2BA0 A;  2JEA I;  2DNE A;  4OGQ C;  4H0L C;  3LNN A;  2JEB I;  1YNN C;  1HPC A;  3CRL C;  3M85 A;  1ONL A;  3D4R A;  1H9S A;  3H94 A;  1H9K A;  1HQM C;  1G29 1;  1IYU A;  1H9J A;  3VA7 A;  4HR7 B;  5JEA G;  1B9N A;  2DNC A;  3OPO A;  1I6V C;  3VR2 A;  2R6G A;  1ZKO A;  3PUZ A;  1CFM A;  3VR6 A;  2K32 A;  2KA7 A;  3SDZ A;  2K7V A;  3OOC A;  3RLF A;  1Y8P B;  2BA1 A;  1OXU A;  2EDG A;  1Y69 U;  1GHK A;  2JXM B;  3A7L A;  2YYZ A;  1DXM A;  4IFD H;  2EJF C;  2EJG C;  3PUW A;  1HCZ A;  4BA1 I;  3PV0 A;  1BDO A;  3VR3 A;  4DNT B;  1CI3 M;  4DNR B;  2JE6 I;  2E76 C;  5K36 G;  1LAC A;  3I72 A;  1OXX K;  2V4D A;  3FMC A;  3QG1 A;  4XIG S;  5BN3 A;  3NE5 B;  1T5E A;  4DK0 A;  1FYC A;  3WDN A;  3A7A B;  4I7Z C; 
#chains in the Genus database with same CATH topology
 5JJI A;  5KND A;  3H0G B;  4XXE A;  4YY3 Q;  2ALY B;  5A35 A;  4OO1 H;  5F2D A;  1HA6 A;  1E1T A;  2JA5 G;  2Q2T A;  1PZK D;  5A2Q E;  1Y1V H;  3HOW G;  4B9X A;  1KDA A;  2GVA A;  4CKB A;  3NWT A;  4C3I B;  3OMG A;  5IP9 G;  2DUD A;  4X3S A;  1STN A;  3S1M H;  1B50 A;  2LY7 A;  3TP5 A;  1HA5 A;  4UP7 A;  5AFW A;  3S2D H;  1IW7 D;  2H1E A;  3CKI B;  4K6D A;  4LFC L;  4A4I A;  4HJ5 A;  4LMQ D;  3NSW A;  2SDF A;  4G7H C;  3QO2 A;  3OWF A;  3CCV A;  4XQJ A;  1BBX C;  1AH9 A;  2HD3 A;  5D3D A;  3RN5 A;  1STG A;  4A3M H;  2F0F A;  2Q8T A;  4DN4 M;  1B2T A;  3FDT A;  1WOC A;  2ES2 A;  1TT2 A;  4DR4 L;  2RVL A;  1GJX A;  4GOP A;  3PO2 H;  2DJG C;  2FXQ A;  2Z6B A;  4J1M A;  5HY6 A;  2MFI A;  2ZM6 Q;  1JMC A;  1VQF A;  1YNJ C;  4RCN A;  1PYS B;  2LMC B;  2RDG A;  4Y7N B;  4R4T A;  4HSP A;  3HOZ H;  1VQC A;  5J39 A;  2A69 C;  4WJ3 M;  1LYL A;  2K1B A;  3RUZ A;  5EPL A;  1ICW A;  1XNQ Q;  4PMB A;  2YU9 H;  2K33 A;  3AU7 A;  2MUY A;  5CMD A;  3CMA A;  3UE0 A;  3P7J A;  3ZYY X;  3TRE A;  3J81 L;  3OPO A;  3LGJ A;  4DK3 C;  3TP6 A;  2X69 A;  4LF9 Q;  1GKH A;  3NBH B;  4C2M H;  4YWM A;  3S16 H;  3OOC A;  1Y8P B;  3HOZ B;  3PIP 3;  1O80 A;  5LMN L;  1VQI A;  1VQB A;  2R7Z B;  2EJF C;  1QVG A;  4B3S Q;  1NBW A;  2ZXP A;  2NWG A;  5ELO A;  2K14 A;  1BR9 A;  1L0Y B;  1OXX K;  3X3M A;  2XSC A;  3WDN A;  1DOM A;  3K81 C;  4RWS C;  5HGT A;  1G51 A;  3CQZ H;  3U4V A;  2IT1 A;  4DR2 L;  5DM6 3;  3DWP A;  1YNJ D;  4HCE A;  2O2L D;  4PQX A;  5M9O A;  4P72 A;  1PH2 A;  3DWQ A;  1Q82 C;  2MGS A;  1QNK A;  2ATW A;  3DXJ C;  1PH5 A;  3GP7 A;  2CW0 D;  3PUX A;  2JA7 B;  2Q8I B;  3R8B A;  4EX5 A;  1S3O A;  3HG9 A;  5C4Z A;  4B3R Q;  3AYH B;  1B1Z A;  4IJH A;  1JWU D;  2Z6K A;  3WOE A;  2KJX A;  3ERQ A;  1WI5 A;  1NTG A;  2JJQ A;  1AFP A;  2UU9 Q;  2Z9H A;  4C3H G;  2VQF L;  4AYB G;  2OTJ A;  2OCE A;  1EY4 A;  3DLL A;  4LF4 L;  5DNF A;  1VQJ A;  4QQB X;  5FLM H;  1KDC A;  4XYQ A;  2F0E A;  4XTC S;  4DF7 A;  4UHV A;  1BUV T;  3CQZ B;  3KOJ A;  1PRT F;  4GOP C;  1JIC A;  3SK8 A;  3S15 H;  3FKI G;  1A62 A;  2AMC B;  1PTO B;  4IPC A;  5FO8 B;  1EQQ A;  3L0O A;  1RDP D;  2R92 H;  2I07 B;  2PZW A;  1LM0 A;  2I46 A;  3A74 A;  3BVM A;  3G71 A;  5IOC A;  3I2Z A;  1QIL A;  4C3J H;  1DM0 B;  2NZH A;  3RD4 A;  2OQK A;  3NTH A;  3MAQ A;  5IWA Q;  3LWE A;  5M5W H;  3PO2 G;  5EBD A;  2WKD A;  1Z9F A;  3S16 B;  1HPC A;  3D8G A;  3M85 A;  5IT9 E;  3FVQ A;  2F0I A;  1HNZ Q;  2RDF A;  1EZ8 A;  4TSS A;  2C9O A;  5IYB H;  3JAM c;  5C5L A;  4B08 A;  5IP7 H;  4GN5 A;  2NB0 A;  2ZJQ A;  1CQF A;  3AFQ A;  3CCM A;  5IT9 L;  4C3H B;  2N55 A;  2B63 B;  2EJG C;  1KIX A;  1E7Z A;  3D6C A;  1XMO Q;  4P73 A;  3J81 i;  2K5W A;  3I72 A;  2VQE Q;  3PO2 B;  1TY2 A;  4JYA Q;  4DK0 A;  3Q23 A;  1JC7 A;  1F2Z A;  1ILP A;  1D5M C;  1TWF H;  1WTX A;  3GTQ B;  1HNW Q;  4GNX C;  1V9P A;  1TWC H;  1YHB A;  1HTP A;  4ZQ3 A;  4A3M B;  1PFM A;  1PH8 A;  4OWX B;  1Y8N B;  4KD3 A;  4QIW E;  3CF5 A;  4A3D G;  3HOU H;  1D5Z C;  1PA6 A;  4A3J H;  1SNM A;  3TBI B;  2C5C A;  4ABN A;  3A8K E;  2D2C C;  4OX9 Q;  4UPA A;  4JI6 Q;  1Q8I A;  2WP8 J;  4HJ9 A;  4CBV A;  1GUO A;  3FKI H;  3BJU A;  1I3Q B;  1AZQ A;  3PIO 3;  3M4O H;  1KL9 A;  4DR2 Q;  1CKN B;  3TRZ A;  1F77 A;  1BBU A;  2F4I A;  2UU9 L;  1JWM D;  3CHB D;  2D62 A;  4DR5 L;  2Z8L A;  4DK1 A;  4C3I H;  1L1O A;  3DM3 A;  5C0X I;  4A3E G;  3F2C A;  1VQ8 A;  4JBW A;  4A3B G;  1STE A;  1BOS A;  1PZJ D;  2A6H D;  1E2W A;  3OWE B;  1WTW A;  2VUM G;  1LAB A;  4J15 A;  4DAP A;  3S2H B;  4LF6 Q;  3X3N A;  4OIJ A;  4JI8 L;  1PFN A;  1PTO C;  2K52 A;  4WOR A;  2TMP A;  2R7Z H;  3J80 E;  5C44 H;  3STB D;  4QF4 A;  2JA8 B;  1O7Y A;  2QW7 A;  3SGI A;  3EIV A;  2UUC Q;  1HR0 W;  2WB1 G;  1TR5 A;  4Y52 H;  3I90 A;  4X3K A;  1V1P B;  1S72 A;  4DUY Q;  2N88 A;  3S1R B;  1S4Z A;  1EQT A;  1Z6H A;  1Q90 A;  1JE5 A;  3J80 L;  3BZC A;  3I56 A;  2Z6K C;  4BBR G;  1VS0 A;  3IFD A;  2VZA A;  3K5N A;  1H9S A;  3QOL A;  3H94 A;  1HQM C;  4IN3 A;  2KVM A;  2D0P A;  5G3L F;  4DAV A;  4A3K G;  3PUZ A;  1HUN A;  1CFM A;  3VR6 A;  3H3V C;  3KLS X;  4IPH A;  1B4O A;  4DXG A;  1U4R A;  4DV7 Q;  1HR0 Q;  5C4H A;  2IW3 A;  4IUN A;  2J0T D;  1F9R A;  2EDG A;  4NPS A;  1NJI C;  4IFD H;  2QDL A;  1ZXT A;  3PMF A;  4DNT B;  1CI3 M;  2R93 G;  4A3J B;  3J80 c;  2JE6 I;  3K7A B;  5E4W C;  2V4D A;  3FMC A;  4LUZ A;  2UUA Q;  4NXM Q;  1PH7 A;  3Q22 A;  4K5V A;  1MKH A;  4TVA B;  2IPK D;  5C4J B;  1PHJ A;  5I6Y A;  1TQO A;  1U4M A;  1STA A;  4JPB W;  4QUF A;  3M3Y B;  3BDO A;  1CZW A;  4DV2 Q;  4BBR B;  1HZC A;  4DPG A;  1X6O A;  2E2I H;  1UEA B;  4X64 Q;  2NVX H;  4DV4 Q;  1EL0 A;  2ZJR A;  3G7L A;  4DA2 A;  2M2L A;  4CKC A;  2QGQ A;  3I73 A;  5H1S E;  4CDE C;  2BH2 A;  3TS2 A;  4RHR A;  2MP1 A;  4YIJ A;  2L5T A;  3SE0 A;  3K58 A;  3MXN B;  2O5I C;  3U58 A;  5C4X G;  1EWI A;  5CV6 A;  1A6X A;  1V1P A;  1GUG A;  4BY1 G;  3OMC A;  3BVZ A;  3N6R A;  4GNX B;  1HZA A;  5DLQ E;  4R4C A;  4ZUJ A;  1UUP A;  1O7L A;  4B9W A;  2CH4 W;  1TS2 A;  2NVX B;  2F3V A;  1LTT D;  4B3R L;  1L0X B;  2F03 A;  1VQO A;  2EXZ A;  1TU2 B;  4ODG A;  3DEO A;  5C3X A;  2SNM A;  1NY4 A;  1ENA A;  3T56 B;  1X56 A;  4GKJ L;  2A69 D;  1SNC A;  5NUC A;  3UE1 A;  3OSO A;  3CAM A;  1KXL A;  3DEP A;  1XNR L;  2FHT A;  2XGT A;  3KF8 B;  4JI1 Q;  5IGF A;  5EKI A;  1B44 D;  2KHJ A;  2F0N A;  2Y0S B;  2NN6 H;  3CCR A;  4OX9 L;  3BG3 A;  2R93 H;  5IOD A;  1ROD A;  3UI2 A;  4Q5V A;  1SEB D;  5IT9 c;  4H02 A;  3T4A C;  4GKJ Q;  4OEM B;  1ZKO A;  3K0X A;  2UXB Q;  4APV A;  4A76 A;  2EYJ A;  5FLX L;  4CJ1 B;  2RA4 A;  1E1O A;  2AQ3 B;  2VL6 A;  2Z4H A;  2YYZ A;  1DXM A;  3I3C A;  4GLA C;  1SJH D;  4DV1 L;  3J81 j;  2R3Z A;  3K57 A;  1KAB A;  2NBF A;  3KK7 A;  5DEH A;  1SYG A;  5CV5 A;  4ZAI A;  2A8V A;  4XT1 B;  5M5Y H;  3DM1 A;  4DV5 Q;  3T1Y Q;  3J7A F;  2MO0 A;  3T16 A;  2F0J A;  5A2Q L;  1I4P A;  4G7O C;  3E0J A;  3PF4 A;  1HNX Q;  1B3Q A;  2PPB C;  2I5M X;  5EAY A;  4HJA A;  1LT3 D;  2PNR C;  1VDZ A;  1PV4 A;  4OL7 A;  5T1G A;  3H0G G;  4KLK A;  1LTG D;  3MXU A;  4LUO A;  2OT2 A;  3S1N H;  1IL2 A;  2QCP X;  2RCN A;  1S5F D;  4HED A;  3TP7 A;  4JW0 A;  4LF8 Q;  2B2Y C;  1BCP D;  1QZG A;  5JJZ A;  1IL8 A;  3VA5 A;  1B7Y B;  4MTK A;  3EVQ A;  4KI0 A;  3BYT B;  1YJ9 A;  1A63 A;  4KKS A;  4FF4 A;  2QF7 A;  4AYB E;  2F0M A;  2VUM B;  3NEL A;  3FKI B;  1AW7 A;  1X3F A;  1KDB A;  1WD0 A;  3KUP A;  2PMZ E;  1IW7 C;  4DAM A;  1GUS A;  4NW2 A;  4E6I A;  1UE1 A;  5C4J H;  2AHO B;  3EFX D;  2JQO A;  1FVI A;  1K8M A;  1UAP A;  1N36 Q;  4L5R C;  4KN4 C;  4EQN A;  2HHH Q;  3BDC A;  1XPR A;  3S17 B;  4K0K Q;  2NZO A;  1I94 L;  4A3G B;  1Z47 A;  1JOR A;  3BS1 A;  2EYO A;  2MPM A;  4IAL A;  4P71 A;  1K0S A;  1RTO A;  3HOX H;  4EQP A;  5COR A;  4LK1 C;  3HOY B;  1XPO A;  3DHQ A;  1Y8O B;  1Q8K A;  1CKM A;  1N9W A;  2B63 H;  4UP9 A;  2PI2 A;  3AFP A;  3I4O A;  2KBN A;  4A3C H;  1JJC B;  4M8A A;  4TRD A;  5M3M H;  3CRL C;  1E22 A;  5JJK A;  1D6E C;  3HKZ E;  3KF6 B;  1PH9 A;  1PYW D;  1B9N A;  4X3U A;  3ER0 A;  4LWC A;  1II3 A;  1RCV D;  2RSN A;  5I9O A;  2E2I B;  5KIX A;  3H91 A;  1EQV A;  4UDU C;  2K7V A;  3UDI A;  2NTS A;  1QOH A;  2KEE A;  4YCV A;  3QR8 A;  3E9H A;  1PDQ A;  1Y1V B;  5FO9 B;  1VQG A;  5FK9 C;  1KD1 C;  4BA1 I;  4DNR B;  4RMF A;  4MIU A;  1LT4 D;  5GAH C;  1LAC A;  1WTR A;  5BN3 A;  1XWE A;  3NE5 B;  2SNS A;  4R4Q A;  4A3K B;  4B3T L;  1DON A;  1NR4 A;  3BYY B;  5COY A;  2LXJ A;  4MN3 A;  1A2U A;  2XVS A;  1BCP F;  4GN4 B;  1K83 B;  4B3T Q;  2YTX A;  1R9T H;  1S5C D;  5HUR A;  4KJN A;  4NDX A;  3VR4 A;  4DV6 Q;  1FJG L;  2JK8 A;  3QIA A;  4JI3 L;  1I50 B;  4Z9C B;  1WTO A;  1HFG A;  2XRS D;  3NXW A;  3URY A;  5I2X A;  1GVP A;  5C0X J;  3I4M B;  5JVG 3;  2JA6 H;  1OTC A;  1VF7 A;  4IUR A;  4OO1 I;  4K6L A;  2N3S A;  3D0F A;  3SK6 A;  1E0B A;  1Q7Y C;  1XTC D;  1DOK A;  2YTV A;  4K2L A;  5IGD A;  3C3L A;  1H9R A;  1VMP A;  2WAQ G;  1IBL Q;  1TWH H;  2IHF A;  4BY1 H;  1WFQ A;  3HKZ B;  2QA4 A;  1Q12 A;  4L8J A;  1MSG A;  1ENF A;  2IX3 A;  2OQ0 A;  4A3C G;  2WAC A;  2L55 A;  4X64 L;  3KFU A;  1GUW A;  3GTO H;  4GZY C;  2PYK A;  2Z0S A;  1WTH A;  2D9U A;  2MNA A;  1QNU A;  2VY3 A;  2ICI A;  5KEE A;  3RMH A;  2B29 A;  1BXT A;  3S9W A;  2KUM A;  3Q24 A;  2OF1 A;  4A3E B;  2EYM A;  5GRO A;  4DR4 Q;  1NNX A;  2WAQ B;  2KEN A;  4N8X 1;  5JPM C;  4HSV A;  2M00 A;  4DV2 L;  4PMC A;  2QIL A;  1SNP A;  4FYD A;  1KAW A;  3CCJ A;  3KLW A;  4IZ8 A;  3C2P A;  5M5W B;  3UDF A;  4YCW A;  4HIM A;  2FJ2 A;  1N34 Q;  1R4Q B;  2KA7 A;  2RHQ B;  5IYC H;  3D6W A;  4IUQ A;  2A1A A;  4HN7 A;  3K7A H;  3GTK H;  1VQN A;  4A93 G;  1X54 A;  4X66 L;  4A3D B;  1C0A A;  1VMC A;  2KCN A;  1Y1W H;  5D14 A;  1BDO A;  2B2U C;  2K50 A;  4YCU A;  5AJ3 L;  4KJO A;  2CHB D;  5BR8 Q;  3CU7 A;  4ZYS A;  1A3V A;  2VUM H;  3S15 B;  4UP8 A;  1KHI A;  1O7Z A;  3ULP A;  3T51 B;  2L0C A;  3T1H L;  2Q2U A;  4M1U B;  3GTJ H;  3NBI A;  1QE6 A;  4LF6 L;  2N78 A;  1M4V A;  2KHI A;  2AWO A;  3ERS X;  3GTM B;  2UXC Q;  3H3V I;  3F2U A;  3RZD B;  2B2V C;  3WWV A;  1WTP A;  4K8I A;  2XWJ B;  1WTQ A;  1KNE A;  3F2D A;  1W3S A;  2NVY B;  4KHP Q;  1T9H A;  2JA8 G;  1VF5 C;  3NHH A;  4POF A;  2E8G A;  2PCF B;  1V43 A;  2LSS A;  3GTL B;  2UXD L;  2M9V A;  3A8I E;  2L9H A;  5JEA J;  4NXN L;  3ND8 A;  3C46 A;  2E74 C;  2HDL A;  3VDY A;  1OO9 B;  2UXB L;  1VQD A;  1PMR A;  3HOY G;  2K5Q A;  1LTB D;  1H95 A;  1I3Q H;  2EYL A;  4RGM A;  1AZP A;  4IOA A;  3ERO A;  3AB9 A;  4JI5 Q;  3SEB A;  4A3L G;  1DCZ A;  3VYU A;  1LO5 D;  4JI5 L;  4CGY B;  1PLF A;  3S2H H;  1DGS A;  2B2U A;  2PZT A;  5G3L D;  1IYJ B;  3JAM E;  2B2W C;  2EYF A;  1JCK B;  4G4K A;  2PW5 A;  2PO4 A;  3E0E A;  1RD9 D;  2NN6 I;  1RHP A;  3Q8D A;  3W3A A;  1TWF B;  1TKW B;  2G9D A;  1FNV A;  4LW1 A;  1TWA H;  4DR7 L;  3MHB A;  1BVS A;  4K14 A;  3U9O A;  1HQR D;  1X3E A;  4LF5 Q;  4BY7 H;  5LHY 1;  1TS4 A;  1YEZ A;  1LLR D;  1V1Q A;  3GTK B;  3LNN A;  1MHW C;  2V1C C;  3FPU B;  3HOU B;  4JV5 Q;  4DR1 Q;  1ONL A;  2RBM A;  5C3W A;  3TZD A;  5FLX E;  3VR2 A;  1EOV A;  3S2D B;  1CHQ D;  1UE7 A;  2ZTD A;  1N36 L;  1G6P A;  4CJ2 C;  1SRO A;  4C3J G;  5D65 A;  4CJ0 B;  2JA7 H;  2UUA L;  3D4W A;  1ILQ A;  3G6J B;  4DK6 C;  1XXG A;  2JXM B;  3A7L A;  5IIF A;  2GA4 B;  3I7F A;  4QL5 A;  1L1O C;  4P2C B;  1P8L A;  1KLU D;  5BN4 A;  4XYO A;  1EYA A;  1SE8 A;  2NUC A;  3EBE A;  1PZI D;  4IUV A;  1PTO D;  4HID A;  4EGV A;  2K03 A;  5CR3 A;  3TS0 A;  2AKW B;  1VQH A;  2A74 C;  3GQB A;  1WCM B;  3NTK A;  4JC0 A;  1PRT D;  4JI2 Q;  4KKT A;  5FLM G;  2F0L A;  4K8J A;  4J8Q A;  2HHH L;  4DV3 Q;  1X3Q A;  1EYG A;  4XQQ A;  1EIG A;  5EPJ A;  3I70 A;  3OIP A;  1YZ6 A;  5CV4 A;  3U4Z A;  3SHL A;  2ICE C;  1BCP B;  2AUJ D;  3J80 i;  2HQE A;  1YNN D;  3CXC A;  2XN9 C;  3I4M H;  5C3E H;  1HFN A;  1GOZ A;  4GKK L;  3B6Y A;  3NQI A;  3VR5 A;  1PXU A;  5D3I B;  1I50 H;  1MBY A;  2AUK A;  3S14 H;  1DZ1 A;  3TSS A;  1PTO H;  2YTY A;  1EFW A;  1N32 L;  5T1I A;  4JI4 L;  3K7U C;  1K3B C;  1QVC A;  1G6Z A;  5GAG C;  2MO1 A;  2WIN B;  2BOS A;  1IBK L;  4PV1 C;  4DV6 L;  3CD6 A;  3QWN A;  3MWY W;  3NWS A;  4V19 0;  4ZCK A;  4JI3 Q;  1TXY A;  1O78 A;  3PIO A;  3KLR A;  4DR5 Q;  3OHX C;  4X65 Q;  1JT8 A;  1MD2 D;  4NXN Q;  2BE5 D;  2OWO A;  1CM9 A;  1Q3L A;  3TZU A;  4QGU A;  4A3B B;  2KCC A;  4A3F G;  1K8G A;  3KBX A;  3H6M A;  2HCI A;  2HQL A;  1KAA A;  1MJC A;  4C3I G;  5I9P A;  3I55 A;  2EPB A;  4HCS A;  4DUZ L;  5J3B A;  3K0Y A;  1A8V A;  1L1O B;  4PZ8 A;  1C7Y A;  1OXS C;  5C4X B;  2KOL A;  4H44 C;  3MXG A;  1SRU A;  4TKO B;  2BA0 A;  3NBH A;  4LUV A;  1SFO B;  5ISR A;  5GAE C;  2LXK A;  5FO7 B;  3K5M A;  3U50 C;  3A0J A;  4ID6 A;  4OHJ A;  3KBG A;  5EJW A;  3HKZ G;  2HIX A;  1XTD A;  4DU9 A;  1I6V C;  2R6G A;  5IP7 G;  1EIF A;  3V96 A;  1FL0 A;  1TVX A;  1CKO A;  2K32 A;  1QWY A;  3R93 A;  1G2S A;  4LF7 Q;  4YHH Q;  1U5K A;  2HUG A;  4R4I A;  1LT5 D;  1GD7 A;  3S17 H;  1PH3 A;  4CDF C;  1EU4 A;  5IGC A;  4C2M B;  3NPP A;  1JJG A;  3A7A B;  2WKC A;  3TEH B;  2EY6 A;  3HS0 C;  4RGO S;  1AP0 A;  2I5L X;  4HMJ A;  1Y1W B;  1XMQ Q;  3PO3 H;  4A3D H;  1W6K A;  3M4O B;  1K28 A;  3ONA B;  1GO3 E;  2KCM A;  1S40 A;  2XTI A;  4EQO A;  1XNQ L;  1UNS A;  3KF8 A;  5GAD C;  4DV3 L;  4JI7 Q;  2ZXO A;  3HOW H;  3CCU A;  1CSP A;  1Q1E A;  2K4K A;  3A5U A;  3MXP A;  1SMY C;  4A75 A;  2B2V A;  3IL8 A;  2VW9 A;  3BDL A;  2VB2 X;  5EPK A;  1STH A;  2IJ0 A;  2ZT9 C;  3DWA A;  2XRQ D;  4N8F A;  5FJ8 H;  1D5X C;  1U4L A;  2WAQ E;  3VYS A;  4FXG C;  3CCS A;  4G7Z C;  3OYY A;  3SK4 A;  3G4S A;  4AIM A;  1DD2 A;  1K0R A;  2K01 A;  2K5H A;  4I7A A;  1EIY B;  5KYL A;  1YVC A;  5GQO A;  4KD4 A;  4TQU S;  1VCI A;  1HH2 P;  5K36 H;  5JEA H;  3P1H A;  4LFA Q;  3GD7 A;  5C44 B;  2HT1 A;  1CT1 D;  5IYD H;  3F2B A;  2IWH A;  4YY3 L;  1X9N A;  1XX8 A;  1GM5 A;  4LJZ C;  3G48 A;  3S24 A;  2HDM A;  2RKS A;  5M5Y B;  2KED A;  4N9T A;  4IFD G;  3CCL A;  4KY5 A;  1LTL A;  1EEI D;  4BWG B;  4DAY A;  1ZYR D;  5E3F A;  4DR6 L;  4FF2 A;  2BDO A;  3F1Z A;  2JEA I;  3HP3 A;  3GTP H;  4CKE A;  4C3J B;  2ZXR A;  3D4R A;  1J9O A;  1JOQ A;  2F0U A;  3VA7 A;  5K5P A;  2NVT H;  1A3U A;  2VQF Q;  3JAM i;  2CCZ A;  4S3S A;  3M7G A;  1Q46 A;  2FMC A;  3I4N H;  3GTO B;  2RCF A;  1UE5 A;  4LAA A;  4P75 A;  5CV9 A;  3Q0A A;  3L9A X;  3TME A;  3H0G H;  3R3O A;  1IKL A;  1SE4 A;  2J7Z A;  3J81 E;  1C8C A;  2E2J B;  1VQE A;  1M8A A;  2E76 C;  1SLJ A;  3IAY A;  4ZKC B;  3K6O A;  1FJG Q;  1BKB A;  4KKU A;  1DOL A;  2CH4 A;  4A3I H;  3U9S A;  1J5E Q;  3D31 A;  2A6E D;  2A6H C;  2MQH A;  3NP8 A;  3W5O A;  4ZUI A;  5C0X H;  2EYP A;  2JP1 A;  2A68 D;  5C0X G;  1HTL D;  4IFD J;  2G5D A;  2NZ1 D;  3QB3 A;  3A54 A;  1CKN A;  1ZYR C;  3K5O A;  3RLO A;  4CDC C;  1Y1W G;  2XWB B;  5ELF A;  1I4X A;  2JSO A;  1I4Q A;  2K5N A;  1UWV A;  1F9S A;  1U4P A;  5M3M B;  1UE6 A;  3L3O C;  4O42 A;  1HNW L;  1FGU A;  4XQN A;  3HOV B;  3PO3 G;  5J1Z A;  2BH8 A;  3PIP A;  4J6H A;  2Z1C A;  1L0W A;  2ZM6 L;  3V05 A;  1A3T A;  1W2B A;  2PMZ B;  4DAY B;  5CV8 A;  4RHS A;  5KNB A;  5CC4 A;  4KTA A;  1EIH A;  2L12 A;  4L63 B;  1KRT A;  5FOB B;  4JI6 L;  3BVG A;  1IYV A;  3PCO B;  2CQA A;  4EQ5 A;  1YIJ A;  5IP9 H;  3HFZ B;  3AQQ A;  3CCE A;  5M5X B;  5M3F B;  1MGS A;  1S5D D;  1VQM A;  5LMN W;  3HOV H;  1B8A A;  3PSI A;  3NEN A;  4JBJ A;  2GN5 A;  2KHS A;  4IPG A;  4X65 L;  5CGK A;  4FO2 A;  2I0Q A;  4A3J G;  2H4O A;  3OTO Q;  2E75 C;  4XT3 B;  1B53 A;  3N52 A;  5KGU A;  2N8N A;  1Y1V G;  4QIW B;  1NMF A;  1SR3 A;  1T5X D;  1EY7 A;  5E4X A;  1QB5 D;  1MJE A;  5C4X H;  1CQV A;  1TWG B;  1SAP A;  3HOW B;  3CC4 A;  1YBY A;  1K9M C;  3QOJ A;  1RIP A;  1BF4 A;  4R8N A;  3TDQ A;  3ITP A;  4DV0 L;  1A2T A;  3M9B A;  3R2T A;  1WD1 A;  3W1G A;  3TN2 A;  4A3I B;  4R4O A;  1WCM G;  4X62 Q;  2PZU A;  1IBL L;  2R92 G;  2X6G A;  2E2D C;  2MJ8 A;  1VQP A;  3KF6 A;  2PQE A;  2F52 A;  4FXD A;  4O0A A;  4UAI A;  3IRB A;  4KY6 A;  4JV5 L;  4B3M L;  4ZRZ A;  3CC7 A;  2JN4 A;  2F0W A;  2CW0 C;  3CW2 C;  1X32 A;  3EA6 A;  3P20 A;  1ZEQ X;  4A93 H;  5I6W A;  1TWG H;  4DUY L;  1GHJ A;  4HJ7 A;  2EXD A;  3GTL H;  5JJL A;  4JCV E;  4DXF A;  3GTM H;  3E3X A;  1SDF A;  1PTO F;  2LFN A;  4JBM A;  2JA8 H;  1WYD A;  4RGN A;  2J4X A;  2NVY H;  4ZKB B;  2EIF A;  3ULL A;  3J7Z C;  4A3F H;  4JOI A;  3JAM L;  4KMU C;  2PQA B;  4JK1 C;  3H15 A;  2RHS B;  4JVZ A;  2F0Q A;  1D8L A;  1QJO A;  2F1M A;  1IBM L;  3I4N G;  1WVL A;  2ID0 A;  3IKJ A;  4A3G H;  3ND9 A;  1TY0 A;  3ZJY C;  3WOF A;  3GTQ H;  1G91 A;  5M3M G;  3GDE A;  5M5X H;  4QMG A;  2BE5 C;  1N33 L;  4LF5 L;  3A8J E;  2B2T A;  1V8Q A;  4FNF A;  2R7Z G;  1ASY A;  4AQY Q;  3MZ5 A;  1MIU A;  2GVB A;  3A56 A;  2FMM A;  4HIK A;  5IGG A;  3HOZ G;  4JYA L;  3K8A A;  4YWK A;  5EBC A;  5IYC G;  2NVQ H;  4LFB L;  4NP5 A;  2L11 A;  5KNC A;  2R93 B;  1IHZ A;  1Q1B A;  2EY2 A;  4C1N K;  4PMW A;  4DV4 L;  2FIN B;  2K75 A;  3T13 A;  4B3S L;  1EFI D;  3HKS A;  1HXY D;  2PQA A;  2UUB L;  1KLG D;  2B39 A;  2K05 A;  1MI2 A;  1PH4 A;  4XDX A;  5I4D A;  1Q81 C;  4DR3 L;  1G29 1;  3F8T A;  5LL6 X;  4HR7 B;  3J7A V;  3NTI A;  1JB7 A;  2F0D A;  3GO5 A;  1FNW A;  3HEJ A;  2ZTE A;  1I6H B;  1SXT A;  2DGY A;  3VYT A;  4RG1 A;  1EEF D;  2L4N A;  5ELE A;  1ET6 A;  1L2F A;  2IX1 A;  5FKA C;  4QJF A;  5ELN A;  3SK5 A;  4A3E H;  2F0H A;  3NK9 A;  1WJJ A;  2F0G A;  2K5V A;  3OTO L;  4N9P A;  2F4V L;  1NCV A;  1RL2 A;  4A3B H;  3K5L A;  3S1Q B;  1QG7 A;  4RH6 A;  1E24 A;  4L5Q A;  5CYU A;  1WTV A;  4NMZ A;  1YIT A;  5K36 G;  3E6Z X;  1HJP A;  1F9P A;  2DY8 A;  3P75 A;  2FFK B;  2F0S A;  2KEC A;  2E2J H;  5CV7 A;  5IGE A;  5LMU Q;  3GTG H;  4ZLT F;  1VQ5 A;  5EGT A;  2ASB A;  2Y0S E;  1PH1 A;  1X3P A;  4F87 A;  4BY7 G;  3MFG A;  1F9Q A;  2JA6 B;  4DGZ A;  3CP0 A;  1M1K C;  4JI0 Q;  4V0B A;  5CBE E;  1DYQ A;  3MTS A;  1LV9 A;  1PRT C;  2EVB A;  4LF4 Q;  1CTM A;  2XNA C;  3A55 A;  3GV3 A;  4DV0 Q;  2JA6 G;  3CCQ A;  1HNX L;  3M4Y A;  3S14 B;  2XIW A;  1AN8 A;  4HIO A;  3GV6 A;  3H3V H;  1LUZ A;  1Z7T A;  1U9R A;  1NUC A;  5C3E B;  2JA7 G;  1GXD C;  2CWP A;  1E2Z A;  1NR2 A;  2QEJ C;  1QVF A;  1BBW A;  1HNZ L;  1HRJ A;  1E2V A;  3UDG A;  3FRP B;  4KV6 A;  1Q86 C;  3PO3 B;  2DJF C;  3G6E A;  1R9T B;  2O5J C;  3M4P A;  1G2T A;  1C9O A;  4DV1 Q;  2K04 A;  5IWA L;  3MEF A;  4NB3 A;  1VQK A;  1ICF B;  5EQ0 A;  2EE1 A;  3BZD B;  1I4H A;  1K8A C;  2NVT B;  4RFB A;  1J5E L;  1P16 A;  1LT6 D;  5EKK A;  1LTA D;  2AQ2 B;  2HIV A;  4IO9 A;  1I6H H;  1NAP A;  1JB3 A;  2DY7 A;  2Q8R E;  1SYF A;  4IPD A;  4MTN A;  2CWA A;  2R7D A;  1EOT A;  2JEB I;  4OWW B;  1YNN C;  4BY1 B;  3UDX A;  4IUP A;  1SFO H;  5ELC A;  1I94 Q;  3HOX B;  2DNC A;  1EU3 A;  2NYZ D;  3FP9 A;  1LTS D;  4WJ4 A;  2AQ1 B;  1EWC A;  5ELB A;  3RZO H;  2IHE A;  1SMX A;  5IY0 A;  4Y7N H;  4GLV B;  2F0V A;  1HUM A;  1QZH A;  1JQY D;  5DM7 3;  5LMN Q;  3PUW A;  2CKZ B;  2LS0 1;  1O7I A;  4GOP B;  2BCO A;  2JA9 A;  4ME3 A;  2RQX A;  1CZG A;  1AEX A;  1EY6 A;  1PH6 A;  4BBS B;  3STB C;  1IKM A;  3SVM A;  1K83 H;  2EZV A;  2ENB A;  4ME5 A;  4KHV A;  4C3H H;  2G9H D;  4DKA C;  1D1I A;  4A3K H;  1XYI A;  4LFA L;  1KQS A;  2DN8 A;  1QUQ B;  2VNU D;  1TS3 A;  2JYO A;  4CHT B;  1RF2 D;  3MA2 B;  1H9S B;  1SE2 A;  2EY5 A;  4PZ7 A;  4IQZ A;  1M90 C;  1GUN A;  2B8G A;  4I65 A;  2B3G A;  5J22 A;  4JI2 L;  4KHZ A;  4IFD I;  1N34 L;  2YV5 A;  3EQL C;  1D7Q A;  4O1N A;  1CSQ A;  1C48 A;  2K28 A;  3FHW A;  4RKL A;  1EUJ A;  4H7B A;  5L37 A;  3R2I A;  4H13 C;  1SMY D;  3PUY A;  4LNQ A;  3GTJ B;  1EQR A;  2F4V Q;  2Z4I A;  1HR0 L;  2CVR A;  3DMU A;  3GTG B;  5C6A A;  4F88 A;  3CRK C;  1SYB A;  2UUC L;  3L2P A;  4BXX G;  4RA8 A;  3QJY A;  5C3E G;  3OW7 A;  4WRD A;  1QUQ A;  3NQT A;  3D4D A;  1BO0 A;  1ESR A;  1CA5 A;  4JI8 Q;  4IOC A;  2F3I A;  3C1F A;  3T1Y L;  4POG A;  4C56 C;  2QKI C;  4BS9 A;  2PI2 E;  5ELD A;  1LTR D;  1IBM Q;  1ML0 D;  3AEV A;  3MXN A;  2WFW A;  4LF7 L;  1EY0 A;  1H9K A;  1IYU A;  1H9J A;  5JEA G;  3PGZ A;  1TWC B;  1FNU A;  4BBS G;  3TP8 A;  5IYD G;  1JWS D;  3HOY H;  2PW7 A;  3ICE A;  4BBS H;  1BQQ T;  2F0P A;  1W6J A;  1STB A;  4PZ6 A;  4DR3 Q;  3RR5 A;  4HAE A;  4DR1 L;  3O13 A;  1XJV A;  4UY8 C;  2BA1 A;  5KRU A;  4QY7 A;  1OXU A;  3NUC A;  3DUZ A;  1Y69 U;  2BDN A;  5C5M A;  2WB1 B;  1I4G A;  4MNO A;  4C1N I;  5JAV A;  2CQO A;  4I7Z C;  1YJW A;  2D0O A;  2RF4 A;  3A5Z B;  3S1Q H;  4AQY L;  4FF1 A;  4QUC A;  3HOX G;  4FXK C;  4GLX A;  1EYC A;  1YHQ A;  3HOV G;  1VQL A;  2X6L A;  1A0I A;  1XMO L;  4OWT B;  5HGQ A;  4OON A;  2R61 A;  4ALP A;  1KRS A;  5AJ3 Q;  2L15 A;  4R8I A;  2O4X A;  4OXP A;  2PNH A;  3I4L A;  3KJO A;  1F2Y A;  1C4Q A;  3I8Z A;  2VS1 A;  3E9I A;  1K8O A;  5IGB A;  2A68 C;  1J8I A;  3MFY A;  4L5S A;  4LF9 L;  1KTK A;  4JBK A;  4DFA A;  1RJT A;  4EVO A;  1EY8 A;  2YU9 B;  1QCB D;  1SJE D;  4K0K L;  2I5H A;  1A15 A;  3FPP A;  1SBB B;  3PUV A;  4PG3 A;  3IFT A;  1SND A;  3C1E A;  3V2T A;  4IUU A;  3NEM A;  4KN7 C;  2EY1 A;  1R4P B;  4KHP L;  3KJP A;  3BZK A;  5FLX c;  3AMU A;  4JI0 L;  4K5X A;  4AH6 A;  2C35 B;  3LWU A;  1JJ2 A;  4WJW A;  3ULJ A;  4BA2 I;  2H5X A;  4B3M Q;  2A19 A;  3MEH A;  2A6E C;  4KK7 A;  4MZ9 A;  2Q2I A;  1ASZ A;  4X62 L;  1EWH A;  1F2M A;  3I91 A;  3RN2 A;  5LMU L;  2B2T C;  1VQ7 A;  1PFS A;  1JE4 A;  2QDB A;  4A3G G;  2NN6 G;  4R9W A;  1OXV A;  2SOB A;  4FF3 A;  4BXX H;  3K80 C;  1AE2 A;  3E5S A;  3HZX A;  4BY7 B;  2WV6 D;  4DV7 L;  4L5T A;  4RCO A;  4G57 A;  2CFM A;  4K2K A;  5EKL A;  5DAU A;  1N32 Q;  2OTL A;  4P74 A;  4LFC Q;  1YNX A;  2LKV A;  3SDZ A;  1SE3 A;  2F0T A;  4DV5 L;  1D2B A;  3GTP B;  1B3A A;  2SEB D;  4F7X A;  2OXP A;  1HZ9 A;  1EYD A;  4K5W A;  1JOK A;  4RGT A;  3KDF B;  1UEB A;  1RTN A;  1EZ6 A;  3Q6S A;  4BBR H;  5I2Y A;  1SYE A;  5E1F A;  4XIG S;  3I4M G;  1FYC A;  1TII D;  3BU2 A;  4DR7 Q;  1N8R C;  2Y0S G;  4GNX A;  2K5D A;  1MSH A;  1NE3 A;  1SYD A;  2EQS A;  3MC0 B;  3CPW A;  1VQ9 A;  4O2D A;  1CHP D;  1Y14 B;  1E3P A;  4L6T B;  1BNZ A;  5LL6 S;  3MVV A;  2OEO A;  2Q2H A;  4R1J A;  4JG2 A;  3LX0 A;  1IXR A;  3D3R A;  4A3F B;  2F0K A;  4JOI C;  3S1N B;  3W2D A;  4CDD C;  1S5E D;  1K73 C;  2N49 A;  1ENC A;  2VQE L;  1PYB A;  4X3T A;  3KDF A;  5FJ8 G;  1OXT A;  3M7N A;  4RKB A;  1JOO A;  1N33 Q;  1RKN A;  3M3Y H;  2F3W A;  4IUT A;  4MHE A;  1CUK A;  1NMG A;  2EJM A;  2VB3 X;  3L7Z C;  4X66 Q;  4ILW A;  2F0O A;  2JA5 H;  2L1B A;  4WFN 3;  4U67 3;  1G8Z D;  4Q0F A;  1NSN S;  1V1O A;  3CPF A;  3HGB A;  4U68 A;  3PF5 A;  2E2H H;  2D5D A;  4ULL A;  5JVH 3;  4GKK Q;  1D1K A;  3T1H Q;  4QCL A;  2UXD Q;  5IYB G;  2RDH A;  4OO1 G;  1H9M A;  3J7A 5;  1EY5 A;  3S1M B;  3I4N B;  1PVO A;  3SXH A;  1F2L A;  1X3G A;  3FEW X;  4A3M G;  1KC8 C;  2UXC L;  4OGQ C;  4H0L C;  2NTT A;  3J7Y W;  4OEL B;  4JI4 Q;  3KLS A;  4A93 B;  1YI2 A;  1PRT B;  2R92 B;  2IL8 A;  1BCP C;  1X65 A;  2ZJP A;  1K3R A;  3RLN A;  3RLF A;  5KYI A;  2B2W A;  1STY A;  4HJ8 A;  3SR1 A;  1IBK Q;  1HCZ A;  2EOT A;  3VR3 A;  4FP5 D;  1ET9 A;  1XPU A;  3RZD H;  3OIQ A;  2P5Z X;  2TSS A;  1EY9 A;  1SN8 A;  4GS3 A;  3KYH C;  3VYR A;  4GN3 B;  1YJN A;  4A3I G;  2IX0 A;  1VQ6 A;  2HCC A;  2AWN A;  4LF8 L;  2B2Y A;  2KCT A;  1S5B D;  2B63 G;  1CA6 A;  4NXM L;  2E5L Q;  3OW2 A;  2B8F A;  2E5L L;  3RNU A;  1I5F A;  1B9M A;  5JOB A;  5BN5 A;  3RZO B;  1FR3 A;  1U0L A;  5M3F G;  3J81 c;  5M3F H;  3S1R H;  1AE3 A;  5C44 G;  1FGB D;  1B70 B;  1SSO A;  1SNO A;  4FDB A;  3EJI A;  3H09 A;  2UUB Q;  3PQI A;  4YWL A;  4JI7 L;  1JR0 D;  4DNI A;  4YHH L;  1ESF A;  2K6A A;  1X55 A;  1HZB A;  5TSS A;  5JPN C;  2A5H A;  3HRZ C;  2E2H B;  5CBA E;  1VQ4 A;  4LFB Q;  1GUT A;  3EN2 A;  4HTH A;  1XMQ L;  4QB4 A;  2MHV A;  1TS5 A;  4PNY A;  1J6Q A;  1TWH B;  3T53 B;  3HOU G;  3W1B A;  2KQ3 A;  3CME A;  2WB1 E;  1CK1 A;  3CC2 A;  2EYH A;  4NKL A;  3JC6 6;  2DNE A;  3M4Q A;  2QEX A;  2R7F A;  2NVQ B;  1SYC A;  1XNR Q;  2RSO A;  1I4R A;  4RAU C;  4F8M A;  2ZTC A;  1FD7 D;  5BR8 L;  2VXW A;  4KY7 A;  1HHV A;  2A73 B;  1DJR D;  4X6A H;  1LTI D;  5E7N A;  2WII B;  4DR6 Q;  5IE8 A;  1GHK A;  1YHA A;  2IY5 B;  4OIK A;  4HMI A;  4IJL A;  4AYB B;  4ZK9 B;  2JA5 B;  4FVM A;  4A3L H;  3PV0 A;  4DUZ Q;  1SNQ A;  1PFB A;  1IZ6 A;  4JI1 L;  3K59 A;  3QG1 A;  1KNA A;  3TQY A;  1TWA B;  1T5E A;  1WCM H;  1VQA A; 
#chains in the Genus database with same CATH homology
 5KND A;  3H0G B;  4XXE A;  5A35 A;  4OO1 H;  5F2D A;  1HA6 A;  1PZK D;  5A2Q E;  4B9X A;  1KDA A;  4CKB A;  3NWT A;  4C3I B;  3OMG A;  4X3S A;  1STN A;  1B50 A;  2LY7 A;  3TP5 A;  1HA5 A;  5AFW A;  1IW7 D;  2H1E A;  3CKI B;  4K6D A;  4LMQ D;  3NSW A;  2SDF A;  4G7H C;  3QO2 A;  3OWF A;  4XQJ A;  1BBX C;  5D3D A;  1STG A;  2F0F A;  2Q8T A;  4DN4 M;  1B2T A;  3FDT A;  1TT2 A;  2RVL A;  1GJX A;  4J1M A;  1YNJ C;  4RCN A;  2LMC B;  2RDG A;  4Y7N B;  4HSP A;  5J39 A;  2A69 C;  2K1B A;  3RUZ A;  5EPL A;  1ICW A;  4PMB A;  2K33 A;  3AU7 A;  2MUY A;  5CMD A;  3P7J A;  3ZYY X;  3J81 L;  3OPO A;  3TP6 A;  2X69 A;  3OOC A;  1Y8P B;  3HOZ B;  3PIP 3;  1O80 A;  2R7Z B;  2EJF C;  2ZXP A;  2NWG A;  1BR9 A;  1L0Y B;  1OXX K;  3X3M A;  2XSC A;  3WDN A;  1DOM A;  4RWS C;  5HGT A;  2IT1 A;  5DM6 3;  3DWP A;  1YNJ D;  4HCE A;  2O2L D;  4PQX A;  5M9O A;  3DWQ A;  2MGS A;  1QNK A;  3DXJ C;  3GP7 A;  2CW0 D;  3PUX A;  2JA7 B;  2Q8I B;  3R8B A;  3HG9 A;  5C4Z A;  1B1Z A;  1JWU D;  3WOE A;  2KJX A;  3ERQ A;  1AFP A;  4C3H G;  1EY4 A;  5DNF A;  1KDC A;  4XYQ A;  2F0E A;  4XTC S;  4DF7 A;  1BUV T;  3CQZ B;  1PRT F;  1JIC A;  3SK8 A;  1PTO B;  5FO8 B;  1RDP D;  2I07 B;  2PZW A;  2I46 A;  3BVM A;  5IOC A;  1QIL A;  1DM0 B;  3RD4 A;  3NTH A;  3MAQ A;  3LWE A;  5EBD A;  2WKD A;  3S16 B;  1HPC A;  3D8G A;  3M85 A;  5IT9 E;  3FVQ A;  2F0I A;  2RDF A;  1EZ8 A;  4TSS A;  2C9O A;  5C5L A;  4B08 A;  2NB0 A;  1CQF A;  5IT9 L;  4C3H B;  2N55 A;  2B63 B;  2EJG C;  3D6C A;  2K5W A;  3I72 A;  3PO2 B;  1TY2 A;  4DK0 A;  3Q23 A;  1JC7 A;  1F2Z A;  1ILP A;  1D5M C;  1WTX A;  3GTQ B;  1HTP A;  4ZQ3 A;  4A3M B;  1PFM A;  1Y8N B;  4KD3 A;  1D5Z C;  1SNM A;  3TBI B;  2C5C A;  4ABN A;  3A8K E;  2D2C C;  1Q8I A;  2WP8 J;  4CBV A;  1GUO A;  1I3Q B;  1AZQ A;  3PIO 3;  1F77 A;  2F4I A;  1JWM D;  3CHB D;  2D62 A;  2Z8L A;  4DK1 A;  5C0X I;  4JBW A;  1STE A;  1BOS A;  1PZJ D;  2A6H D;  1E2W A;  1WTW A;  3OWE B;  1LAB A;  4DAP A;  3S2H B;  3X3N A;  4OIJ A;  1PFN A;  1PTO C;  4WOR A;  2TMP A;  3J80 E;  4QF4 A;  2JA8 B;  1O7Y A;  1TR5 A;  3I90 A;  4X3K A;  1V1P B;  2N88 A;  3S1R B;  1S4Z A;  1EQT A;  1Z6H A;  1Q90 A;  3J80 L;  3IFD A;  3K5N A;  1H9S A;  3QOL A;  3H94 A;  1HQM C;  4IN3 A;  2KVM A;  5G3L F;  4DAV A;  3PUZ A;  1HUN A;  1CFM A;  3H3V C;  3VR6 A;  3KLS X;  1B4O A;  4DXG A;  1U4R A;  5C4H A;  2IW3 A;  4IUN A;  2J0T D;  1F9R A;  2EDG A;  4IFD H;  1ZXT A;  3PMF A;  4DNT B;  1CI3 M;  4A3J B;  2JE6 I;  3K7A B;  5E4W C;  2V4D A;  3FMC A;  3Q22 A;  4K5V A;  2IPK D;  5C4J B;  5I6Y A;  1TQO A;  1U4M A;  1STA A;  4QUF A;  3M3Y B;  3BDO A;  1CZW A;  4BBR B;  1UEA B;  1EL0 A;  3G7L A;  4DA2 A;  2M2L A;  4CKC A;  3I73 A;  4RHR A;  2MP1 A;  4YIJ A;  2L5T A;  3SE0 A;  3K58 A;  2O5I C;  5CV6 A;  1A6X A;  1V1P A;  1GUG A;  3OMC A;  3BVZ A;  3N6R A;  4ZUJ A;  1UUP A;  1O7L A;  4B9W A;  1TS2 A;  2NVX B;  2F3V A;  1LTT D;  1L0X B;  2F03 A;  2EXZ A;  1TU2 B;  4ODG A;  3DEO A;  5C3X A;  2SNM A;  3T56 B;  1ENA A;  2A69 D;  1SNC A;  5NUC A;  3OSO A;  3DEP A;  2FHT A;  5IGF A;  5EKI A;  1B44 D;  2F0N A;  2Y0S B;  2NN6 H;  3BG3 A;  5IOD A;  1ROD A;  3UI2 A;  4Q5V A;  1SEB D;  3T4A C;  1ZKO A;  2EYJ A;  5FLX L;  4CJ1 B;  2RA4 A;  2AQ3 B;  2Z4H A;  2YYZ A;  1DXM A;  3I3C A;  1SJH D;  2R3Z A;  3K57 A;  1KAB A;  2NBF A;  3KK7 A;  5DEH A;  1SYG A;  5CV5 A;  4ZAI A;  4XT1 B;  3DM1 A;  3J7A F;  3T16 A;  2F0J A;  5A2Q L;  1I4P A;  4G7O C;  3E0J A;  2PPB C;  1LT3 D;  2PNR C;  1VDZ A;  4OL7 A;  5T1G A;  1LTG D;  3MXU A;  2OT2 A;  2QCP X;  1S5F D;  4HED A;  3TP7 A;  2B2Y C;  1BCP D;  5JJZ A;  1IL8 A;  3VA5 A;  3EVQ A;  4KI0 A;  3BYT B;  4KKS A;  4FF4 A;  2QF7 A;  2F0M A;  2VUM B;  3FKI B;  1AW7 A;  1KDB A;  1WD0 A;  3KUP A;  1IW7 C;  4E6I A;  1GUS A;  4NW2 A;  3EFX D;  1K8M A;  1UAP A;  4KN4 C;  4EQN A;  3BDC A;  3S17 B;  4A3G B;  1Z47 A;  1JOR A;  3BS1 A;  2EYO A;  2MPM A;  4IAL A;  1RTO A;  4EQP A;  5COR A;  4LK1 C;  3HOY B;  3DHQ A;  1Y8O B;  4M8A A;  4TRD A;  3CRL C;  1D6E C;  1PYW D;  1B9N A;  4X3U A;  1II3 A;  1RCV D;  2RSN A;  5I9O A;  2E2I B;  5KIX A;  3H91 A;  1EQV A;  4UDU C;  2K7V A;  2NTS A;  1QOH A;  2KEE A;  5FO9 B;  1PDQ A;  1Y1V B;  5FK9 C;  4BA1 I;  4DNR B;  4MIU A;  1LT4 D;  1LAC A;  1WTR A;  5BN3 A;  1XWE A;  3NE5 B;  2SNS A;  4A3K B;  1DON A;  1NR4 A;  3BYY B;  5COY A;  4MN3 A;  1A2U A;  2XVS A;  1BCP F;  1K83 B;  1S5C D;  5HUR A;  4KJN A;  4NDX A;  3VR4 A;  3QIA A;  1I50 B;  4Z9C B;  1WTO A;  1HFG A;  2XRS D;  3NXW A;  3URY A;  5I2X A;  5C0X J;  3I4M B;  5JVG 3;  1VF7 A;  4IUR A;  4OO1 I;  4K6L A;  3SK6 A;  1E0B A;  1XTC D;  1DOK A;  4K2L A;  5IGD A;  3C3L A;  1H9R A;  1VMP A;  3HKZ B;  1Q12 A;  4L8J A;  1MSG A;  1ENF A;  2IX3 A;  2WAC A;  2L55 A;  1GUW A;  4GZY C;  2PYK A;  2D9U A;  1QNU A;  5KEE A;  2ICI A;  3RMH A;  1BXT A;  3S9W A;  2KUM A;  3Q24 A;  2OF1 A;  4A3E B;  2EYM A;  2WAQ B;  5JPM C;  4HSV A;  2M00 A;  4PMC A;  2QIL A;  1SNP A;  4FYD A;  4IZ8 A;  3C2P A;  5M5W B;  2FJ2 A;  1R4Q B;  2KA7 A;  3D6W A;  4IUQ A;  4HN7 A;  4A3D B;  1VMC A;  2KCN A;  5D14 A;  1BDO A;  2B2U C;  4KJO A;  2CHB D;  3CU7 A;  4ZYS A;  1A3V A;  3S15 B;  1O7Z A;  3T51 B;  2L0C A;  4M1U B;  3NBI A;  1QE6 A;  1M4V A;  2AWO A;  3GTM B;  3F2U A;  3RZD B;  2B2V C;  1WTP A;  4K8I A;  2XWJ B;  1WTQ A;  1KNE A;  2NVY B;  1VF5 C;  3NHH A;  2PCF B;  1V43 A;  3GTL B;  2M9V A;  3A8I E;  2L9H A;  5JEA J;  3ND8 A;  3C46 A;  2E74 C;  2HDL A;  1OO9 B;  1PMR A;  2K5Q A;  1LTB D;  2EYL A;  4RGM A;  1AZP A;  3ERO A;  3AB9 A;  3SEB A;  1DCZ A;  3VYU A;  1LO5 D;  4CGY B;  1PLF A;  2B2U A;  2PZT A;  5G3L D;  3JAM E;  2B2W C;  2EYF A;  1JCK B;  4G4K A;  2PW5 A;  2PO4 A;  1RD9 D;  2NN6 I;  1RHP A;  3W3A A;  1TWF B;  1TKW B;  2G9D A;  1FNV A;  3MHB A;  4K14 A;  3U9O A;  1HQR D;  5LHY 1;  1TS4 A;  1LLR D;  3GTK B;  3LNN A;  3FPU B;  3HOU B;  1ONL A;  2RBM A;  5C3W A;  3TZD A;  5FLX E;  3VR2 A;  3S2D B;  1CHQ D;  4CJ2 C;  4C3J G;  5D65 A;  4CJ0 B;  3D4W A;  1ILQ A;  3G6J B;  1XXG A;  2JXM B;  3A7L A;  5IIF A;  2GA4 B;  4P2C B;  1KLU D;  5BN4 A;  4XYO A;  1EYA A;  2NUC A;  1PZI D;  4IUV A;  1PTO D;  4EGV A;  2K03 A;  5CR3 A;  3NTK A;  2A74 C;  3GQB A;  1WCM B;  1PRT D;  4KKT A;  2F0L A;  4K8J A;  4J8Q A;  1X3Q A;  4XQQ A;  1EIG A;  5EPJ A;  3I70 A;  3OIP A;  5CV4 A;  3SHL A;  2ICE C;  1BCP B;  2AUJ D;  2HQE A;  1YNN D;  2XN9 C;  1HFN A;  1GOZ A;  3NQI A;  3VR5 A;  1PXU A;  5D3I B;  1MBY A;  2AUK A;  1DZ1 A;  3TSS A;  1PTO H;  5T1I A;  1G6Z A;  2WIN B;  2BOS A;  4PV1 C;  3QWN A;  3MWY W;  3NWS A;  4V19 0;  1O78 A;  3KLR A;  3OHX C;  1MD2 D;  2BE5 D;  1CM9 A;  1Q3L A;  3TZU A;  4A3B B;  2KCC A;  3KBX A;  3H6M A;  2HCI A;  1KAA A;  4C3I G;  5I9P A;  2EPB A;  4HCS A;  3K0Y A;  1OXS C;  5C4X B;  2KOL A;  4H44 C;  3MXG A;  4TKO B;  2BA0 A;  3NBH A;  1SFO B;  5ISR A;  5FO7 B;  3K5M A;  4ID6 A;  4OHJ A;  3KBG A;  5EJW A;  4DU9 A;  1I6V C;  2R6G A;  3V96 A;  1TVX A;  2K32 A;  1QWY A;  3R93 A;  1G2S A;  2HUG A;  1LT5 D;  1EU4 A;  5IGC A;  4C2M B;  3NPP A;  3A7A B;  2WKC A;  2EY6 A;  3HS0 C;  4RGO S;  1AP0 A;  4HMJ A;  1Y1W B;  1W6K A;  3M4O B;  3ONA B;  4EQO A;  1UNS A;  3KF8 A;  2ZXO A;  1Q1E A;  3MXP A;  1SMY C;  2B2V A;  3IL8 A;  3BDL A;  2VB2 X;  5EPK A;  1STH A;  2IJ0 A;  2ZT9 C;  3DWA A;  2XRQ D;  1D5X C;  1U4L A;  3VYS A;  4FXG C;  4G7Z C;  3SK4 A;  1DD2 A;  2K01 A;  5KYL A;  4KD4 A;  4TQU S;  1VCI A;  5K36 H;  5JEA H;  3P1H A;  3GD7 A;  5C44 B;  1CT1 D;  2IWH A;  1XX8 A;  4LJZ C;  2HDM A;  2RKS A;  5M5Y B;  2KED A;  4N9T A;  4IFD G;  4KY5 A;  1EEI D;  4BWG B;  4DAY A;  1ZYR D;  5E3F A;  4FF2 A;  2BDO A;  2JEA I;  3HP3 A;  4CKE A;  4C3J B;  2ZXR A;  3D4R A;  1J9O A;  1JOQ A;  2F0U A;  3VA7 A;  5K5P A;  1A3U A;  4S3S A;  3M7G A;  2FMC A;  3GTO B;  5CV9 A;  4LAA A;  3Q0A A;  3L9A X;  3TME A;  3R3O A;  1IKL A;  1SE4 A;  2J7Z A;  3J81 E;  1C8C A;  2E2J B;  1M8A A;  2E76 C;  3IAY A;  4ZKC B;  3K6O A;  4KKU A;  1DOL A;  3U9S A;  3D31 A;  2A6E D;  2A6H C;  3NP8 A;  4ZUI A;  5C0X H;  2EYP A;  2JP1 A;  2A68 D;  5C0X G;  1HTL D;  4IFD J;  2NZ1 D;  3QB3 A;  3A54 A;  1ZYR C;  3K5O A;  2XWB B;  5ELF A;  1I4X A;  2JSO A;  1I4Q A;  1F9S A;  1U4P A;  5M3M B;  3L3O C;  4O42 A;  4XQN A;  3HOV B;  5J1Z A;  4J6H A;  2Z1C A;  3V05 A;  1A3T A;  2PMZ B;  5CV8 A;  4RHS A;  5KNB A;  5CC4 A;  4KTA A;  1EIH A;  2L12 A;  4L63 B;  5FOB B;  3BVG A;  1IYV A;  2CQA A;  5M5X B;  5M3F B;  1MGS A;  1S5D D;  2KHS A;  5CGK A;  4FO2 A;  2H4O A;  2E75 C;  4XT3 B;  1B53 A;  3N52 A;  5KGU A;  4QIW B;  1T5X D;  1EY7 A;  5E4X A;  1QB5 D;  1CQV A;  1TWG B;  1SAP A;  3HOW B;  3QOJ A;  1BF4 A;  4R8N A;  3TDQ A;  3ITP A;  1A2T A;  3R2T A;  1WD1 A;  3TN2 A;  4A3I B;  2PZU A;  2X6G A;  2E2D C;  2MJ8 A;  2PQE A;  4FXD A;  4UAI A;  4KY6 A;  4ZRZ A;  2F0W A;  2CW0 C;  1X32 A;  3EA6 A;  3P20 A;  1ZEQ X;  5I6W A;  1GHJ A;  4DXF A;  1SDF A;  1PTO F;  2LFN A;  4RGN A;  2J4X A;  4ZKB B;  3JAM L;  4KMU C;  4JK1 C;  2F0Q A;  1QJO A;  2F1M A;  1WVL A;  2ID0 A;  3IKJ A;  3ND9 A;  1TY0 A;  3WOF A;  1G91 A;  4QMG A;  2BE5 C;  3A8J E;  2B2T A;  1V8Q A;  4FNF A;  3MZ5 A;  3A56 A;  2FMM A;  5IGG A;  5EBC A;  4NP5 A;  2L11 A;  5KNC A;  2R93 B;  1IHZ A;  1Q1B A;  2EY2 A;  4C1N K;  4PMW A;  2FIN B;  3T13 A;  1EFI D;  1HXY D;  1KLG D;  2B39 A;  2K05 A;  1MI2 A;  4XDX A;  5I4D A;  1G29 1;  5LL6 X;  4HR7 B;  3J7A V;  3NTI A;  2F0D A;  3GO5 A;  1FNW A;  3HEJ A;  1I6H B;  1SXT A;  3VYT A;  1EEF D;  2L4N A;  5ELE A;  1ET6 A;  2IX1 A;  5FKA C;  3SK5 A;  2F0H A;  3NK9 A;  2F0G A;  4N9P A;  1NCV A;  3K5L A;  3S1Q B;  1QG7 A;  4RH6 A;  5CYU A;  1WTV A;  4NMZ A;  5K36 G;  3E6Z X;  1F9P A;  2DY8 A;  3P75 A;  2FFK B;  2F0S A;  2KEC A;  5CV7 A;  5IGE A;  4ZLT F;  5EGT A;  1X3P A;  4F87 A;  3MFG A;  1F9Q A;  2JA6 B;  4DGZ A;  4V0B A;  5CBE E;  1DYQ A;  3MTS A;  1LV9 A;  1PRT C;  2EVB A;  1CTM A;  2XNA C;  3A55 A;  3GV3 A;  3M4Y A;  3S14 B;  2XIW A;  1AN8 A;  3GV6 A;  1Z7T A;  1U9R A;  1NUC A;  5C3E B;  1GXD C;  1E2Z A;  1NR2 A;  2QEJ C;  1HRJ A;  1E2V A;  3FRP B;  4KV6 A;  3PO3 B;  1R9T B;  2O5J C;  1G2T A;  2K04 A;  5EQ0 A;  2EE1 A;  3BZD B;  1I4H A;  2NVT B;  4RFB A;  1LT6 D;  5EKK A;  1LTA D;  2AQ2 B;  1NAP A;  1JB3 A;  2DY7 A;  2Q8R E;  1SYF A;  1EOT A;  2JEB I;  1YNN C;  4BY1 B;  4IUP A;  5ELC A;  3HOX B;  2DNC A;  1EU3 A;  2NYZ D;  1LTS D;  2AQ1 B;  1EWC A;  5ELB A;  2F0V A;  1HUM A;  1JQY D;  5DM7 3;  3PUW A;  2LS0 1;  2BCO A;  2RQX A;  1CZG A;  1AEX A;  1EY6 A;  4BBS B;  1IKM A;  3SVM A;  2EZV A;  2ENB A;  4ME5 A;  4KHV A;  2G9H D;  1D1I A;  1XYI A;  2DN8 A;  2VNU D;  1TS3 A;  2JYO A;  4CHT B;  1RF2 D;  3MA2 B;  1H9S B;  1SE2 A;  2EY5 A;  4IQZ A;  1GUN A;  2B8G A;  4I65 A;  5J22 A;  4KHZ A;  4IFD I;  3EQL C;  4O1N A;  1C48 A;  2K28 A;  4RKL A;  4H7B A;  3R2I A;  4H13 C;  1SMY D;  3PUY A;  3GTJ B;  2Z4I A;  3GTG B;  2CVR A;  3DMU A;  5C6A A;  4F88 A;  3CRK C;  1SYB A;  4RA8 A;  3QJY A;  3OW7 A;  4WRD A;  3NQT A;  3D4D A;  1BO0 A;  1ESR A;  1CA5 A;  3C1F A;  4C56 C;  2QKI C;  4BS9 A;  5ELD A;  1LTR D;  1ML0 D;  3MXN A;  1EY0 A;  1H9K A;  1IYU A;  1H9J A;  5JEA G;  1TWC B;  1FNU A;  3TP8 A;  1JWS D;  2PW7 A;  1BQQ T;  2F0P A;  1W6J A;  1STB A;  4HAE A;  3O13 A;  2BA1 A;  5KRU A;  1OXU A;  3NUC A;  3DUZ A;  1Y69 U;  2BDN A;  5C5M A;  2WB1 B;  1I4G A;  4C1N I;  5JAV A;  4I7Z C;  4FF1 A;  4QUC A;  4FXK C;  1EYC A;  2X6L A;  2R61 A;  4R8I A;  2O4X A;  3I4L A;  1F2Y A;  1C4Q A;  3I8Z A;  1K8O A;  5IGB A;  2A68 C;  1J8I A;  3MFY A;  1KTK A;  4DFA A;  1RJT A;  4EVO A;  1EY8 A;  2YU9 B;  1QCB D;  1SJE D;  1A15 A;  3FPP A;  1SBB B;  3PUV A;  3IFT A;  1SND A;  3C1E A;  3V2T A;  4IUU A;  4KN7 C;  2EY1 A;  1R4P B;  3AMU A;  4K5X A;  3LWU A;  4WJW A;  4BA2 I;  3MEH A;  2A6E C;  4KK7 A;  1EWH A;  1F2M A;  3I91 A;  2B2T C;  1JE4 A;  2QDB A;  2NN6 G;  4R9W A;  1OXV A;  2SOB A;  4FF3 A;  3E5S A;  3HZX A;  4BY7 B;  2WV6 D;  4RCO A;  4G57 A;  4K2K A;  5EKL A;  5DAU A;  2LKV A;  3SDZ A;  1SE3 A;  2F0T A;  1D2B A;  3GTP B;  1B3A A;  2SEB D;  4F7X A;  2OXP A;  1EYD A;  4K5W A;  1JOK A;  4RGT A;  1RTN A;  1EZ6 A;  3Q6S A;  5I2Y A;  1SYE A;  5E1F A;  4XIG S;  1FYC A;  1TII D;  2K5D A;  1MSH A;  1SYD A;  3MC0 B;  1CHP D;  1BNZ A;  4L6T B;  5LL6 S;  3MVV A;  2OEO A;  3LX0 A;  3D3R A;  4A3F B;  2F0K A;  3S1N B;  3W2D A;  1S5E D;  1ENC A;  4X3T A;  1OXT A;  3M7N A;  4RKB A;  1JOO A;  1RKN A;  2F3W A;  4IUT A;  4MHE A;  2EJM A;  2VB3 X;  3L7Z C;  4ILW A;  2F0O A;  2L1B A;  4WFN 3;  4U67 3;  1G8Z D;  4Q0F A;  1NSN S;  1V1O A;  3HGB A;  4U68 A;  2D5D A;  4ULL A;  5JVH 3;  1D1K A;  4QCL A;  2RDH A;  4OO1 G;  1H9M A;  1EY5 A;  3S1M B;  3I4N B;  3SXH A;  1F2L A;  3FEW X;  4OGQ C;  4H0L C;  2NTT A;  3J7Y W;  3KLS A;  4A93 B;  1PRT B;  2R92 B;  2IL8 A;  1BCP C;  3RLF A;  5KYI A;  2B2W A;  1STY A;  3SR1 A;  1HCZ A;  2EOT A;  3VR3 A;  4FP5 D;  1ET9 A;  3OIQ A;  2TSS A;  1EY9 A;  3VYR A;  2IX0 A;  2HCC A;  2AWN A;  2B2Y A;  1S5B D;  1CA6 A;  2B8F A;  1B9M A;  5JOB A;  5BN5 A;  3RZO B;  1FR3 A;  1FGB D;  1SSO A;  1SNO A;  3EJI A;  3H09 A;  1JR0 D;  1ESF A;  2K6A A;  5TSS A;  5JPN C;  2A5H A;  3HRZ C;  2E2H B;  5CBA E;  1GUT A;  4HTH A;  4QB4 A;  2MHV A;  1TS5 A;  4PNY A;  1TWH B;  3T53 B;  2KQ3 A;  1CK1 A;  2EYH A;  4NKL A;  2DNE A;  2NVQ B;  1SYC A;  2RSO A;  1I4R A;  4RAU C;  4F8M A;  1FD7 D;  2VXW A;  4KY7 A;  1HHV A;  2A73 B;  1DJR D;  1LTI D;  2WII B;  1GHK A;  4OIK A;  4ZK9 B;  4HMI A;  4AYB B;  2JA5 B;  4FVM A;  3PV0 A;  1SNQ A;  1PFB A;  3K59 A;  3QG1 A;  1KNA A;  1TWA B;  1T5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...