2PNRC

Crystal structure of the asymmetric pdk3-l2 complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Crystal Structure of an Asymmetric complex of Pyruvate Dehydrogenase Kinase 3 with Lipoyl domain 2 and its Biological Implications
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 79
sequence length 79
chains with identical sequence G
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pnrC01
1DD2A 3NE5B 2CW0C 3VR6A 1GHJA 2B8FA 2EJFC 3M85A 2KCCA 5BN3A 4DK1A 1OXVA 4BA2I 2EJMA 1H9JA 1Y8OB 2NN6H 3VR4A 4G7HC 4KI0A 4OGQC 1Y8PB 1A6XA 3OOCA 1K8OA 1E2ZA 2BE5D 4RCNA 1IYUA 1GUNA 1OXTA 1DXMA 4LJZC 4KKUA 2K7VA 2DNCA 4G7ZC 5C0XG 1H9SA 1H9MA 1SMYC 1Q90A 5KNBA 3I73A 4L8JA 4DNTB 1Y69U 1CFMA 2PPBC 5K36G 1TKWB 1I6VC 4IFDG 3PUWA 1VF5C 2A68C 3VR2A 1G291 1Z6HA 2D62A 1LACA 1ZKOA 3L7ZC 1HTPA 5JEAG 2JEAI 4TKOB 3N6RA 2JEBI 3WDNA 4KN4C 4BA1I 1Q1BA 2A6HD 3I72A 3MXUA 3PUZA 1PMRA 5C0XH 4PV1C 1B9MA 1V8QA 3D31A 5K36H 1BDOA 3I4LA 3A8JE 3OPOA 4G7OC 3CRLC 1TU2B 4DK0A 4KKSA 1K8MA 3AB9A 2BA1A 2E74C 4JK1C 1H9KA 5JEAH 1O78A 3GD7A 3T53B 1H9SB 2YYZA 3W3AA 1E2WA 4TQUS 3U9SA 1VDZA 2A6ED 3MFYA 1ONLA 2V4DA 2AUKA 3BDOA 1CTMA 2R6GA 2AWOA 1IW7C 2O5IC 2BA0A 1FYCA 1GUSA 4KMUC 1B9NA 2IT1A 5KNDA 4IQZA 2JXMB 3VR5A 3P20A 3IFTA 1IYVA 3GQBA 2A69C 1OXSC 1EWHA 1GUTA 2BE5C 2KA7A 1HPCA 2EDGA 4XIGS 4GZYC 1HCZA 1LABA 2A68D 3PUYA 2K32A 1ZYRC 2ZT9C 2EJGC 2D2CC 3FMCA 3T56B 3QJYA 3BG3A 4KN7C 3CRKC 2EVBA 3DXJC 4IFDH 2NN6I 1CI3M 3HGBA 4KKTA 2PNRC 2DN8A 4LK1C 2B8GA 3PV0A 3A7AB 3T51B 1YNJC 3SDZA 5KNCA 3PUVA 3RLFA 1Y8NB 1Q1EA 3OW7A 3D4RA 2QF7A 3IKJA 3EQLC 5A35A 1E2VA 1VCIA 3A7LA 1GUOA 3QG1A 4I7ZC 3A8IE 1FR3A 2BDOA 1V43A 1H9RA 1OXUA 1Z7TA 2JE6I 1GJXA 4HR7B 1IW7D 3M4YA 3PUXA 4JBWA 2E76C 5BN4A 4OO1G 2K33A 1T5EA 4H44C 2A6EC 2DNEA 2O5JC 3LNNA 1GHKA 2A69D 3QIAA 1DCZA 3VR3A 1GUGA 3FPPA 3SE0A 5BN5A 3TZUA 2LMCB 3KLRA 2E75C 3VA7A 1YNNC 2PCFB 4DNRB 1Q12A 1OXXK 3ND8A 2NN6G 3H94A 2D5DA 4OO1H 2A6HC 4XTCS 3ND9A 1QJOA 2L5TA 4KHZA 3M7NA 2AUJD 2Q8IB 3LWUA 3A8KE 1HQMC 4H0LC 1VF7A 4H13C 1O7LA 2F1MA
chains in the Genus database with same CATH superfamily
4C3HG 1PV4A 1EYGA 5IODA 4GLXA 1AZPA 3F8TA 3J81c 3H0GH 4UHVA 4DK1A 5TSSA 2MPMA 2VY3A 1RTOA 4IN3A 3HOZG 4XT1B 3NEMA 4FF4A 1PYBA 1EU4A 1O7IA 3E5SA 1HXYD 4A3BH 4GNXC 2F3IA 1IYUA 1TIID 4JYAL 2DUDA 5FJ8G 3C3LA 3TSSA 1UNSA 1EQQA 1VF5C 4YCWA 4C2MB 1CHPD 3DHQA 2DY7A 5FOBB 2L15A 2JEAI 1EFID 2CH4W 1JR0D 1I4RA 4TKOB 4GKJQ 3WDNA 4DR3L 1B3QA 5JAVA 3PO3G 2A6HD 5EPLA 1NMFA 3D31A 1NNXA 5COYA 1S72A 2VUMB 5BR8L 1GVPA 1BR9A 3U4ZA 4QF4A 2YYZA 5JPMC 4UP9A 3RZOH 3IL8A 4HJ7A 1ONLA 1Y1VB 2B2VA 3KLWA 3NBHA 5KNDA 1STNA 2IJ0A 3J81i 4N8FA 1OXSC 3V05A 1HPCA 4XIGS 1LUZA 2NTSA 4A3EB 1TS4A 1IBKL 2N55A 3CRKC 3CXCA 1ILQA 4XYQA 3HGBA 1A3TA 3I4MG 1G2TA 4JI1L 2UUCQ 3SDZA 4PNYA 1TWFH 5HGQA 5C4XB 2BDNA 2SEBD 1CUKA 1MSHA 2L9HA 2PQAA 2E2DC 1OO9B 1ESFA 4NW2A 4KY6A 2OWOA 2FMCA 4EQNA 2E76C 2HT1A 1JOOA 3ER0A 3A5ZB 3GTQB 1HNZQ 2Q2UA 4O42A 1STYA 1WCMG 2MFIA 2OQ0A 3SE0A 2N49A 4U673 3VYRA 3D6WA 1PTOH 1SJED 2E2JH 2QCPX 3F2CA 4LF6L 3K58A 3RN5A 2Q8IB 4A3CG 5E7NA 3D3RA 4OONA 1QG7A 2WP8J 4CKEA 3I7FA 3K6OA 4AYBE 4AH6A 1E1OA 1YVCA 2VB2X 3GTPH 3TEHB 5ELCA 1GUNA 4BY1H 2K7VA 5GQOA 4X3KA 1H9MA 1SYCA 1X3GA 2B29A 3T1HQ 1TKWB 3D4DA 1IL2A 4IFDG 3K5LA 3A56A 5FLMH 2FFKB 5IWAL 1YNJD 4N9PA 4C3IH 1M1KC 5I6WA 4LF8Q 1JC7A 2E5LL 2EY6A 1TWHH 4DNIA 2LXKA 3HOWG 3RLNA 1PRTD 1HQRD 4XDXA 1O78A 1H9SB 3K7AB 1CM9A 1K28A 2A6ED 1SE8A 1EQVA 1FYCA 2K75A 3HKZE 3QR8A 3JAML 2E2HH 2WAQG 1JOQA 2Q2HA 2RDFA 3MA2B 1PH4A 2K05A 1B3AA 3G6EA 4LFCQ 2F52A 3MXGA 3GTOH 1D2BA 1KXLA 2A68D 4IOCA 1UEBA 4L6TB 4CKCA 3Q23A 5D14A 1EIGA 4NMZA 2L11A 2Q8TA 3S2HB 2EXZA 1EIHA 1CZGA 4PMCA 2JA5H 4YWKA 1N33Q 3NTHA 4ZK9B 2E2IH 4LF4Q 2K1BA 2F4VL 4DXFA 4JBKA 4K6DA 1SE2A 4K5WA 4KD4A 1U4MA 4MNOA 4ZRZA 5K5PA 3CQZB 1PFNA 2RF4A 3IAYA 4J8QA 1L1OC 2QDLA 1A3VA 4HIDA 1FGBD 1G2SA 1Z7TA 4JI8L 2YTYA 1SNPA 5IYBG 4L5QA 1P8LA 5FLXE 4A3DB 5BN4A 3R93A 1QUQB 1M4VA 2NZOA 4BBSG 3TS2A 2F0LA 1QZGA 4LF7L 1CK1A 3HOVG 3MXPA 5IYDH 4X3SA 4B3SL 4A3BB 3DWPA 4DXGA 1PTOF 2G9HD 1W2BA 2ZM6Q 3ND8A 2NZHA 4ALPA 1NUCA 4E6IA 3DM1A 2KHJA 5JPNC 1N8RC 4OX9L 3DMUA 2PW7A 4DN4M 1VF7A 5EKKA 2OCEA 2XN9C 4MIUA 1SYBA 2K01A 2VZAA 4ZLTF 3UE0A 2L1BA 4KI0A 1OXTA 1K73C 4ZAIA 1LT5D 4IUVA 2VQEL 1SMYC 3CMEA 1PZKD 1S5DD 5C44G 1IBLL 2UXCQ 1X3EA 4DV5L 3RZOB 4RGMA 1ZKOA 3L7ZC 4FF2A 1JMCA 2RHQB 1VMPA 3FPUB 5K36H 4HN7A 1B70B 2F0OA 3HG9A 2F0HA 1A2UA 4KKSA 1SYGA 4F88A 5E4XA 1GM5A 2E74C 1JJGA 1QOHA 2HDMA 3GD7A 3PSIA 3W3AA 3E0EA 1K3RA 2B39A 5CV5A 1SBBB 2JA7G 4IPGA 4K0KL 5IGGA 2PZUA 1TWFB 5ELEA 4C3JH 4DAVA 1PH8A 4JBJA 3HOUH 1C48A 1TWAH 1LTLA 2AQ3B 2EDGA 1I6HH 1EIYB 1C8CA 2HCIA 4MTKA 3K0YA 4JYAQ 3K0XA 2EYPA 2B63G 2B8GA 1LV9A 3PV0A 4NXNL 1W6JA 1FJGQ 1XNQQ 2L55A 2AKWB 3RLFA 2WKDA 5IP7H 5M3FH 1Q81C 1PTOB 5FO8B 2E2JB 2KCNA 1HFGA 2BDOA 5EKIA 1EEFD 4IPDA 3SGIA 2M2LA 5BR8Q 2VNUD 1A3UA 1KC8C 1EY6A 3S17H 4HTHA 4CDCC 3U9OA 1YZ6A 2F0SA 4QMGA 2PO4A 4FXKC 3GTPB 1YNNC 3KJPA 1SYDA 1TXYA 4BY1B 4DPGA 3VYUA 4TVAB 3E9HA 4A3GG 3M7NA 3CKIB 5IP9H 3J7ZC 1IBKQ 1B7YB 4KN7C 3SK6A 1DD2A 3CMAA 4EQ5A 3PMFA 2LSSA 1F2ZA 1HRJA 1AN8A 4C3IB 4KLKA 3UDIA 4BA2I 1EWCA 3PIPA 4G7HC 1K8OA 3W1GA 1TWHB 1IZ6A 5I2YA 2BE5D 4B9XA 4LW1A 4X65Q 5M3MH 2CKZB 1EU3A 2F03A 3GTMB 3HS0C 1I6VC 2V1CC 3CP0A 3HOZH 3BYYB 3NP8A 3PO2G 5E3FA 1XTDA 2E2HB 4BA1I 2JP1A 1B9MA 5FJ8H 3OPOA 3GTOB 4YHHQ 3GTJB 1D5ZC 4JK1C 2N3SA 2DJFC 4LF6Q 1WJJA 2WB1G 4DAYB 4AYBB 3PO3H 3LGJA 2E2IB 1CTMA 1AFPA 2I46A 2NB0A 3NWSA 4A3MG 1X9NA 4DR1L 1EOVA 1S5FD 3AFQA 2EOTA 2WIIB 3DUZA 3H15A 4CJ2C 4GZYC 2ENBA 1D7QA 5C4HA 3H3VH 2YTVA 2F0PA 1RODA 4KKTA 3CCMA 2XWBB 3BYTB 3CC2A 3OMCA 3FDTA 3K5NA 1VQ4A 5IWAQ 4H7BA 2YU9H 5KNCA 2HCCA 1CKNB 3RZDH 4R9WA 3V96A 4LF5L 1V1PB 3D4RA 3CCRA 2E5LQ 4CKBA 2B2TA 1VCIA 3QG1A 3CC7A 1SNQA 2J4XA 2VB3X 1O7YA 2JQOA 1XJVA 1BXTA 3HKZB 4H44C 2QEXA 1ICFB 2PZWA 4UPAA 4JPBW 4O1NA 3VA5A 3VR3A 2F0VA 3S1MH 2E75C 2PCFB 3OSOA 2OQKA 4LMQD 2QKIC 1EYAA 2Q8RE 1F2LA 1Q8IA 1EY5A 2HQEA 1WVLA 5EBCA 5GROA 4DKAC 5JJZA 4K5VA 1WCMH 1RHPA 4RMFA 1GD7A 3HP3A 3KF6A 2F4VQ 2WAQE 1NR2A 1Y8PB 5CV8A 5FO7B 4GOPA 3GO5A 4A3CH 1E7ZA 4DR2L 1ZYRD 3H09A 5T1GA 4ZUIA 4DNTB 4JI8Q 2F0JA 4HSVA 1NMGA 1Q7YC 4EVOA 3PUWA 4HMIA 3D8GA 1EL0A 1U4LA 1PH9A 2K14A 1Q46A 1L1OB 2GN5A 4J15A 1SDFA 3OMGA 4DK6C 1S4ZA 4BS9A 1EOTA 4Y52H 1KRTA 4C3JB 4LF7Q 2CQOA 4PV1C 2CWPA 3FHWA 3HOUB 5KGUA 1UWVA 1TWAB 2Y0SG 1QUQA 4B3SQ 3MAQA 1I6HB 4DK0A 1WTPA 3KF8B 3NQIA 4A3IG 1JJCB 1K8GA 4LF9L 2F3WA 4OX9Q 2BH2A 1BF4A 1E2WA 4TQUS 3AEVA 1VQAA 2AWOA 5EPKA 1GUSA 5A2QL 1QVGA 1W3SA 3HOWH 5M3FB 2QW7A 5IYCH 3K81C 2R61A 2WACA 1BOSA 2NZ1D 3P1HA 1SYEA 3T1YL 4A3KH 4DR6L 2VQEQ 2L0CA 2XWJB 2EYMA 2F0KA 2SOBA 1IBLQ 3SR1A 3S17B 1ILPA 4DV5Q 1XWEA 1XMOQ 3T4AC 4RAUC 1A63A 1EY9A 2D0OA 4JI5L 4UP8A 1EZ6A 2NWGA 2KUMA 4H02A 2RCFA 5C0XJ 4DAPA 3S1RH 1C0AA 2R92H 1S5CD 3K57A 3EA6A 5FLXc 1I3QB 3NTKA 4V0BA 2N88A 4RHRA 5M5YH 1PH7A 3QO2A 2HHHL 4K0KQ 4M8AA 1JCKB 4DAMA 4A93G 1GUGA 3S24A 4DV3L 3TZUA 1E22A 4ME3A 3TS0A 1KL9A 1UE1A 3U50C 2IX1A 1PH5A 2EYFA 1KHIA 1SSOA 2AUJD 1KIXA 1S5BD 4BBSH 3HOZB 2PZTA 3OIPA 1CSQA 4IOAA 3HOVH 5D3DA 1I5FA 2MO0A 3QOLA 2NYZD 1TY0A 3QWNA 4ZKCB 1JWUD 5BN3A 4NXNQ 1YI2A 1H9JA 3KUPA 1B1ZA 3J81L 3CCLA 4OGQC 2Z4HA 3H3VI 3MXNB 2CWAA 2F0MA 4GNXA 1G91A 1E0BA 4QJFA 1DXMA 4HCEA 4FO2A 1LTAD 2PPBC 5CV4A 1HR0W 1PLFA 1UE6A 4OIKA 4MZ9A 3PO3B 5GAGC 1G291 1XNRL 4HIOA 1U4PA 1SRUA 3N6RA 4FP5D 1B53A 3NPPA 1A0IA 3MXUA 3PUZA 1VMCA 1XX8A 2R3ZA 1TS3A 2HUGA 4XXEA 2K5DA 3SVMA 1JWSD 5C44H 1TU2B 1GOZA 4IUQA 4QGUA 3FRPB 2EYJA 3I91A 2MGSA 3WOEA 2FJ2A 1KAAA 1XPUA 4DFAA 1DM0B 2EXDA 4X66L 1XYIA 1PFMA 1Y14B 4QY7A 2PI2A 2CCZA 3KDFA 1PTOC 5KYIA 5IGCA 1GUTA 5ISRA 2DY8A 2ZT9C 1F2YA 4DU9A 3OTOL 4KJOA 2JA7H 1JE5A 1HZCA 4DA2A 4BBRG 4BY7G 4LK1C 5JJLA 3DLLA 1E24A 2RDGA 1YNJC 2ALYB 3S1MB 1Q82C 3KFUA 3K5MA 5A35A 1QB5D 3HZXA 2B63H 1SFOH 2A19A 2PYKA 5F2DA 4OO1G 1O7ZA 1WCMB 1J6QA 2A6EC 1RIPA 3HFZB 1CQFA 4P71A 5AJ3L 2CQAA 4RHSA 1NJIC 1VQ7A 1VQMA 1DCZA 2MUYA 4RKLA 4ZQ3A 5LL6S 3STBC 1TS5A 4DR1Q 2GVAA 3GTGB 1WD1A 4LFAQ 4RKBA 1IBML 1MHWC 4IALA 4R4TA 5E4WC 4IUPA 4FXDA 2RA4A 2WB1E 4JBMA 2F1MA 1HHVA 3M85A 1D1KA 3S9WA 3ERQA 4HJ5A 2IW3A 2I5HA 1D5MC 3TREA 1SE4A 4CDFC 1Y8OB 1PXUA 4L5SA 5M5XH 2F0QA 3CCVA 4LF5Q 5C3WA 1Z47A 5ELBA 3R8BA 3J7AF 3PIOA 4WORA 4RCNA 1GXDC 4KKUA 2LFNA 2K52A 2K5WA 5C0XG 3MZ5A 4HCSA 3A55A 2UXDL 3RMHA 1FNUA 5M5WH 2OTJA 3K59A 4K6LA 3NBIA 4A3LG 1LACA 1Y1VG 2Z0SA 1EQTA 3HOWB 2OF1A 4JI0L 1BDOA 1GUWA 3NTIA 1VS0A 4P72A 2EY2A 4A3KB 4LNQA 3L3OC 3A5UA 3I4NG 4BWGB 4R4IA 4QQBX 2KCMA 4X3TA 3PO2H 3KBXA 4L5RC 2AQ1B 2WAQB 3K8AA 1C4QA 1I4QA 2RDHA 3BDOA 5JJIA 2R6GA 1K83H 4A3FG 1IW7C 3Q24A 4HAEA 1BCPD 3M4OH 4LFBL 5G3LD 1E3PA 3DEOA 2KHIA 1BBUA 3KLSX 3S1RB 1FD7D 1HTLD 3VR5A 2L12A 3P20A 2R92B 5C4XG 5CV9A 1EWHA 3G48A 1YJ9A 3K7UC 4DR2Q 1YHBA 1ZEQX 3QJYA 1GKHA 2WINB 4DR7L 1PZID 1PDQA 1F9QA 1XXGA 5M5YB 4A3MH 3BVGA 1VQOA 1WD0A 4B3MQ 2Z1CA 1HNXL 1CZWA 2ZJQA 2EYOA 3HOYG 3SK4A 1LTGD 4IPCA 1JT8A 2QF7A 1L1OA 4EQOA 3A7LA 3CHBD 2XGTA 2JE6I 3I3CA 1CKOA 4DV0L 2R7ZG 4LF9Q 3HOVB 5LMUL 1RTNA 5KYLA 2VQFL 2NVTH 4OWWB 3Q6SA 1LT3D 4IURA 3NSWA 4C1NK 1JICA 4RFBA 3ERSX 1JORA 2UUBL 2IHEA 3G7LA 3T1YQ 3LWUA 4DR6Q 2NVYH 2CW0C 1GHJA 1PHJA 4HIKA 3KBGA 3ULLA 3H0GB 1WOCA 4OIJA 4ZUJA 3ZJYC 3J80E 4JI5Q 1XPOA 1AE3A 2XNAC 3FKIH 5DLQE 5C44B 4KTAA 4LJZC 1KABA 4G7ZC 1QE6A 1EY7A 5AFWA 4L8JA 1VQCA 2UXBL 1DGSA 4Q0FA 1N34Q 2RBMA 1Z6HA 2XSCA 5GADC 2G5DA 2HHHQ 5IT9L 3S1NH 4RA8A 4JW0A 3HRZC 1OTCA 1DONA 3F2BA 5KRUA 5DM73 4DV3Q 5I6YA 3CRLC 1X3QA 2LY7A 2TMPA 2JA7B 1MJEA 4RWSC 3K5OA 1HH2P 1DYQA 1L2FA 3L0OA 1L0WA 2QGQA 2BOSA 1IHZA 1PFSA 2V4DA 1PRTF 4KMUC 3BZKA 4C56C 2ZXOA 3IFTA 4A3IH 1LM0A 2BE5C 1SR3A 3U4VA 2K32A 1KNEA 2F3VA 1NE3A 1EY8A 4IPHA 2IWHA 3D0FA 3MXNA 4A3DG 1S3OA 5CYUA 1FGUA 1IYJB 2DN8A 4G4KA 5D3IB 2YTXA 1XNRQ 3GV3A 4JV5L 3PUVA 1STBA 4KK7A 1R9TH 4QUFA 1D6EC 1H95A 2ZTEA 1QWYA 1U4RA 5CV6A 2XIWA 4A3JH 5LL6X 1V43A 5ELNA 3G4SA 1GJXA 1EEID 1KDBA 1JB7A 3CF5A 1WTXA 4GN5A 4HEDA 1K8AC 2ZXPA 1IL8A 2EY1A 1Z9FA 1RD9D 3LNNA 3CC4A 1D1IA 4X66Q 2ASBA 3DWAA 5M5XB 3FPPA 3KLRA 1TS2A 4LWCA 2NN6G 3CPFA 3BS1A 4DR3Q 4JI2L 5E1FA 3PF5A 1ENCA 3L9AX 5M5WB 3TBIB 4B3TL 3OTOQ 4GKKL 2B8FA 2AHOB 3MTSA 3F2DA 4GN4B 3S16H 1VQLA 2C5CA 4NPSA 2F0FA 3T13A 3H3VC 4JOIC 1X6OA 4I7AA 2YV5A 4R4QA 2ZJPA 1NCVA 4N8X1 3BDCA 3PO2B 5JJKA 3VR2A 1KQSA 1K83B 1HZAA 4YWMA 4U68A 1B44D 3M4OB 1JWMD 1PRTB 5AJ3Q 5J3BA 4UAIA 1KNAA 3AYHB 4JI1Q 3I4LA 4JCVE 3TRZA 4ODGA 4G7OC 3M3YH 2WB1B 2M9VA 4FDBA 2KBNA 1YEZA 2EIFA 1IBMQ 1B2TA 1JE4A 4OL7A 2MHVA 2ZTDA 1J8IA 1W6KA 4K2KA 4A3MB 3QOJA 2P5ZX 3MFYA 4C3HH 3ITPA 3UE1A 2F0NA 1AZQA 1KAWA 1NR4A 1ZXTA 1J9OA 1SMYD 4TSSA 2JXMB 1HA6A 3VYSA 1DOMA 2A69C 2F0DA 1SNCA 4IUNA 1LABA 1I50H 1ZYRC 1AW7A 2K6AA 2CVRA 3UDXA 1IKLA 2KQ3A 4ZYSA 2NVXH 2O4XA 3UDGA 4ID6A 2UXDQ 4ABNA 3I70A 1STEA 4ULLA 1WTHA 1X54A 2EYHA 2NVTB 5EGTA 1STAA 2Q2IA 4ME5A 2RQXA 2JA5B 5I9OA 2Q2TA 3NUCA 4R4CA 1TR5A 3DM3A 3E9IA 3EQLC 3NBHB 5H1SE 4JI0Q 4X3UA 4X6AH 4BBRH 4I7ZC 2SNSA 2XTIA 4KY5A 3R2IA 4BY7H 5CGKA 5C3EG 5JEAJ 2NVYB 4I65A 1B8AA 1T5EA 4GN3B 3TP5A 1YBYA 2O5JC 1SJHD 4LFBQ 1VQGA 3WOFA 3S14H 3FKIB 4R1JA 4OO1H 5HGTA 4FF1A 3A8KE 3W2DA 2O2LD 4DR7Q 5J22A 3I4MH 5EJWA 1STGA 4PZ6A 4QUCA 4DR5L 2KENA 2VW9A 4F7XA 1HNXQ 3S1NB 2OEOA 2ICEC 1CQVA 1O80A 4EQPA 4NKLA 1Q3LA 3PIO3 2B2UC 2H1EA 4AIMA 2R7FA 3OHXC 1UAPA 2WKCA 1ICWA 1H9SA 1JQYD 1VQFA 5JOBA 1UEAB 1EQRA 4X62L 5DEHA 4DV0Q 4AYBG 3KJOA 2R93G 1YNND 3M7GA 5LMUQ 2NVQH 4KN4C 4JVZA 2TSSA 4X64L 5C0XH 1QCBD 4WFN3 4A3IB 1DOKA 1K8MA 2UUAL 2JA6G 5FKAC 4A3LH 2UUBQ 1TWGH 4KD3A 4NXML 3T53B 4CJ0B 5ELDA 3NXWA 1ASYA 1HUNA 1FNVA 1G51A 1HNWL 1B9NA 1R9TB 1T5XD 3CCQA 2F0IA 1IYVA 3I4NH 4DR4L 3TP6A 1K0SA 2Z6KC 1LTRD 4A3JB 4DV7L 3OIQA 1F2MA 1VQEA 1WTRA 1NSNS 3A0JA 4HIMA 4A3FH 2UXBQ 4LF8L 4IFDH 2XVSA 3HKZG 3N52A 1ENAA 1S40A 3EROA 4OWTB 1MBYA 1BBWA 1F9PA 2PNHA 1XPRA 1F9SA 3OYYA 1STHA 1DZ1A 1MJCA 1M8AA 3LX0A 5LMNL 2AQ2B 3PUXA 4A75A 1Y1WG 2B2WC 2DJGC 1WTWA 3HOYH 4MN3A 5FLXL 3HOXG 3S16B 2CH4A 2I5LX 5C3XA 2K5HA 1D5XC 1X55A 3D4WA 1RCVD 1JOKA 5J39A 3C46A 3VA7A 1L0XB 1OXXK 3GTKH 1BUVT 2R7ZH 3NHHA 2A6HC 4HJ8A 3ND9A 2OXPA 4H0LC 1N32L 1AP0A 1O7LA 2J0TD 2MNAA 3IRBA 2KCCA 2A8VA 1OXVA 4O2DA 3J80c 4JV5Q 4RGOS 3AQQA 3EFXD 4A4IA 4XQNA 2FXQA 4Z9CB 4QB4A 2MP1A 3M3YB 2JA8G 2FHTA 1Q8KA 3ZYYX 4DV2L 2ID0A 4P74A 1JB3A 1LT4D 3AFPA 5IYBH 2QEJC 3PF4A 5M3MB 1HZBA 4C3HB 4L63B 1AEXA 2D62A 4JI7L 5JEAG 2ZM6L 2PMZE 5DM63 4NP5A 5GAEC 3J81j 3C2PA 1PMRA 4UP7A 3A8JE 3EN2A 5IGEA 1HA5A 1I50B 1BQQT 1EZ8A 3JC66 1FVIA 4JI2Q 1CT1D 2NVXB 1H9KA 1T9HA 1VQJA 3X3MA 4B3TQ 4GKKQ 1YIJA 1PH6A 1MI2A 2H5XA 1KDCA 4OWXB 3S2DH 3BVMA 1LTBD 3E3XA 4OO1I 1LLRD 1PYSB 2A73B 3X3NA 1G6ZA 3SK5A 3GQBA 1VQKA 2A5HA 1PA6A 4YCUA 4BBRB 4A76A 4BY7B 3J80i 5CORA 3TP7A 3MHBA 4JG2A 4CGYB 3EVQA 1J5EL 3NK9A 1LO5D 2B2YC 3PGZA 2ATWA 3MFGA 2PNRC 5C5MA 4UDUC 2K4KA 1VQHA 4UY8C 1EYCA 1VQNA 2RVLA 3S14B 4DUYL 2IX3A 2YU9B 2KJXA 3IKJA 4IJHA 3RZDB 2MO1A 3UI2A 4DF7A 1X56A 4LUZA 5EQ0A 2K33A 3I4MB 5C0XI 3RN2A 4PG3A 1QILA 1CA5A 1ASZA 1BCPC 1HZ9A 1R4PB 3C1FA 4Q5VA 3J7A5 3CCSA 3P7JA 3H94A 2MQHA 2C9OA 2L5TA 1FJGL 1XNQL 2F0EA 4K2LA 3SK8A 3ICEA 2EJFC 1PRTC 1KLUD 1PYWD 4POGA 1BO0A 4OEMB 2NVQB 1TQOA 4RG1A 2NN6H 2HIVA 4AQYL 3OOCA 1WTOA 1E2ZA 2BCOA 4IFDI 4JI6L 2DNCA 2I5MX 4DAYA 1Q90A 1TWGB 3I73A 1LTID 4MTNA 1Y69U 2C35B 3AU7A 3MWYW 4J6HA 1R4QB 2A68C 3CCEA 1TVXA 1I94L 3I56A 2ICIA 1EYDA 4KJNA 3BDLA 1E1TA 4FNFA 4XQQA 2K5QA 3I4NB 5DNFA 3PIP3 4YY3L 3AB9A 4A3GH 3AMUA 4A3FB 2PI2E 5JVG3 1K3BC 4CJ1B 2EY5A 1XMQL 2VUMG 1CKMA 1NAPA 1RF2D 4LAAA 1CKNA 3ONAB 5EKLA 1V1PA 3NENA 4X65L 2O5IC 2B2VC 1I4PA 4TRDA 5ELOA 4DR5Q 2UU9L 1MD2D 3VYTA 5C6AA 2KOLA 4EX5A 5CV7A 2KA7A 2JA9A 1K9MC 4K8JA 3KYHC 3BG3A 2KCTA 2L4NA 3QB3A 4B08A 1KD1C 3HOYB 1NY4A 1C7YA 5LHY1 4HJ9A 4DUZL 4X62Q 2GVBA 3RUZA 2G9DA 4KV6A 4BXXG 4A3EG 1P16A 2DGYA 1LTTD 3HEJA 4YHHL 3B6YA 4QIWE 5M9OA 1BVSA 3CW2C 4KHPL 1Q1EA 3OW7A 4X64Q 4DV1L 1L0YB 3GTKB 2R7ZB 4K8IA 3BVZA 1M90C 1I4GA 3A8IE 2RHSB 3WWVA 2UUAQ 1EY4A 2IPKD 1LT6D 1UUPA 1AE2A 4NXMQ 1DOLA 1ML0D 1RJTA 3I4OA 3S15H 1IXRA 5J1ZA 1PTOD 4NB3A 2LKVA 3DEPA 1VQPA 4B9WA 1HNWQ 1TWCH 3FP9A 5CC4A 5KEEA 2HDLA 1JJ2A 3TZDA 1Q12A 4FYDA 1FL0A 4JI3L 2VS1A 5HURA 5C3EH 4DR4Q 2D5DA 3Q8DA 5IE8A 1CSPA 4HSPA 4DV7Q 1QJOA 4KHZA 1N36L 1XTCD 2MJ8A 4WJ4A 4H13C 3V2TA 2NBFA 3NE5B 4LUVA 3E0JA 3I55A 4P2CB 3IFDA 4BBSB 1QNUA 3H6MA 2K04A 3KF8A 3BZDB 5IYCG 4QL5A 4RCOA 3CPWA 2EZVA 3GTMH 1HUMA 2IL8A 1D8LA 2X69A 3RNUA 4A3KG 3I90A 3K80C 1SNOA 5IY0A 5LMNQ 2Y0SE 1SNMA 2M00A 3STBD 1KRSA 3S2DB 1HTPA 3S1QH 1ET9A 3GTJH 4DK3C 1QZHA 1F9RA 1BKBA 3KF6B 2D0PA 2R92G 3MC0B 2LXJA 2R93H 4B3RL 1PZJD 4GOPB 2OTLA 4DV4L 3JAMc 1N32Q 2IX0A 3RLOA 5C4ZA 2AUKA 3E6ZX 5A2QE 4O0AA 3ULJA 4YCVA 4P75A 3TP8A 1QVCA 3GV6A 1LYLA 1PFBA 4CDEC 5I4DA 2JA6H 3EIVA 4L5TA 5EBDA 4PQXA 2VXWA 1K0RA 1V9PA 1U0LA 1BCPF 1HCZA 5G3LF 1A2TA 2IHFA 5C4JH 1I4XA 3FMCA 4DV2Q 2PMZB 4YIJA 3CD6A 2NN6I 1X65A 2N78A 2Z4IA 4JI7Q 4NDXA 3U58A 1MSGA 3F2UA 2EQSA 1HR0L 1AH9A 2OT2A 1GUOA 4DGZA 2IY5B 4PMBA 1IW7D 3OW2A 3EBEA 2B63B 2F0TA 4M1UB 4PZ8A 1SFOB 4ZKBB 4XQJA 4Y7NH 4JC0A 3G71A 3BJUA 2JSOA 3GDEA 3JAMi 3H0GG 2J7ZA 2XRSD 5IT9c 1QVFA 1Y1WH 4FVMA 2I07B 5EPJA 1XMOL 5LMNW 3TMEA 4A3BG 3HOXH 3T16A 1HQMC 1ET6A 5IIFA 3L2PA 1J5EQ 3PCOB 1QNKA 3J81E 4WJ3M 1SROA 2EJMA 3VR4A 1N9WA 3TN2A 1RL2A 4DUYQ 4P73A 1B50A 4JOIA 4DV6L 2PQEA 1V1QA 5IGBA 5DAUA 4A3GB 5CR3A 4POFA 1YNXA 1A8VA 1WI5A 4IUTA 2WV6D 2K5VA 1YITA 2F0WA 3A54A 1YJWA 1EY0A 4IJLA 3HKSA 5HY6A 1SNDA 2JEBI 2KEDA 2JA8H 4A93H 4XT3B 5CMDA 4HJAA 4HMJA 2CW0D 4GNXB 2BA1A 2HD3A 1BCPB 1IKMA 1II3A 5JEAH 3BZCA 4APVA 3U9SA 1VDZA 1YHQA 1B4OA 1CA6A 3P75A 5L37A 4IO9A 1ENFA 1Q86C 3SXHA 3NWTA 4XYOA 4JI4L 2KVMA 4IQZA 4AQYQ 1WTQA 3PUYA 4JI6Q 2D2CC 3I8ZA 1U5KA 2EVBA 2QA4A 3TDQA 4K5XA 3S15B 4K14A 2I0QA 1I94Q 1SMXA 2Z8LA 1TWCB 2EPBA 1TT2A 2RSOA 3M4QA 1WTVA 2WFWA 5FO9B 1I3QH 5C3EB 5IGDA 3KDFB 5T1IA 4FXGC 4KY7A 4YY3Q 1G8ZD 1FR3A 3C1EA 4HR7B 3CCUA 3M4YA 2NUCA 2FINB 4GLAC 4JBWA 4F87A 3LWEA 4GS3A 1BBXC 1HJPA 1HFNA 2ZTCA 2H4OA 1XMQQ 4GKJL 4C1NI 1UE7A 1VQ9A 2UU9Q 3PQIA 4DNRB 2A74C 3GTLH 3A74A 4PZ7A 4CDDC 5GAHC 1VQDA 1CHQD 3Q22A 5FK9C 4BY1G 4QIWB 3VR6A 4J1MA 3G6JB 1BNZA 1YHAA 4DUZQ 3S1QB 3NQTA 5NUCA 3ULPA 4QCLA 4V190 1FNWA 1GO3E 2X6LA 2X6GA 5FLMG 2B2UA 5I2XA 4R4OA 1A6XA 1SEBD 3KOJA 4EGVA 4C3IG 4KHPQ 3GP7A 5KIXA 4DV1Q 2R93B 1F77A 2KECA 3VDYA 1SE3A 1RKNA 2A1AA 2K03A 2GA4B 2UUCL 3UDFA 4LFAL 5ELFA 1VQ6A 1PVOA 2PQAB 3OWEB 3MVVA 2JA6B 1Q1BA 1X3PA 3I72A 4N9TA 1V8QA 3CU7A 1EFWA 4ILWA 4OHJA 2KEEA 2JJQA 2AWNA 4JI3Q 5C4JB 1V1OA 3OWFA 2D9UA 4F8MA 1ESRA 1N36Q 3H91A 1KDAA 4C2MH 1HNZL 3M9BA 2IT1A 2JA5G 2VL6A 2Z6KA 2Y0SB 1EUJA 1VQIA 2VQFQ 4LUOA 4YWLA 3T56B 2VUMH 4FF3A 2QDBA 1KTKA 3DXJC 2ZJRA 2B3GA 3J7YW 2SNMA 4Y7NB 3O13A 4G57A 4CBVA 1KLGD 1Y1VH 1C9OA 1MIUA 1UE5A 1PH2A 2R7DA 3FEWX 2JN4A 3JAME 2AMCB 3FKIG 1U9RA 1Y1WB 3KK7A 5IYDG 2B2TC 3MEFA 1OXUA 3HOXB 3T1HL 2ES2A 2B2WA 4BXXH 4B3RQ 4A3EH 1DJRD 3R2TA 4DV4Q 4PMWA 2K28A 3R3OA 2Z6BA 2A69D 1VQBA 4OXPA 3GTGH 3QIAA 3BU2A 2BH8A 5C4XH 4KHVA 1PH3A 3W5OA 1SLJA 1SXTA 5JVH3 1X32A 4B3ML 1PH1A 3RR5A 2EYLA 4CHTB 4R8IA 2EE1A 1MKHA 2JA8B 4A93B 3GTQH 4RGTA 4IZ8A 4LFCL 5CBEE 5IOCA 1MGSA 1SN8A 3J80L 1HR0Q 2LS01 2SDFA 3KLSA 4GOPC 4ZCKA 5KNBA 4GLVB 5K36G 2F0UA 1CFMA 2Z9HA 1NTGA 3URYA 3M4PA 1A62A 2K50A 5IT9E 2F0GA 1N33L 4LF4L 1A15A 1YJNA 2JYOA 1VQ8A 2CFMA 5IGFA 3I2ZA 2RSNA 4IUUA 1SYFA 4OELB 5D65A 4A3JG 4C3JG 3DWQA 3W1BA 3HOUG 1EIFA 2XRQD 2JK8A 2FMMA 2F4IA 1I4HA 3NELA 1SAPA 2BA0A 1TY2A 2RCNA 3CAMA 2NTTA 3FVQA 2ZXRA 1EWIA 1N34L 3SHLA 3RD4A 4DV6Q 5IP7G 4WRDA 4MHEA 2EJGC 5M3FG 3MEHA 2B2YA 3EJIA 4R8NA 1CI3M 2PW5A 3K7AH 2HQLA 1G6PA 3A7AB 4WJWA 3T51B 3J7AV 2CHBD 1S5ED 1Y8NB 3D6CA 3GTLB 3CCJA 1E2VA 4S3SA 1X3FA 4IFDJ 5EAYA 1VQ5A 4RH6A 1H9RA 4RGNA 1NBWA 2UXCL 1RDPD 2E8GA 2QILA 3S2HH 2DNEA 5IP9G 2KHSA 5C5LA 1GHKA 1WFQA 3TQYA 2HIXA 3Q0AA 3F1ZA 4JI4Q 5BN5A 2K5NA 2LMCB 3CQZH 3SEBA 5CBAE 1WYDA 2N8NA 4XTCS 2RKSA 1LTSD 5I9PA 4A3DH 5M3MG
chains in the Genus database with same CATH topology
4C3HG 5IODA 1AZPA 4DK1A 5TSSA 2MPMA 4IN3A 1RTOA 4XT1B 4FF4A 1EU4A 3E5SA 1HXYD 1IYUA 1TIID 3C3LA 3TSSA 1UNSA 1VF5C 4C2MB 1CHPD 3DHQA 2DY7A 5FOBB 2JEAI 1EFID 1JR0D 1I4RA 4TKOB 3WDNA 5JAVA 2A6HD 5EPLA 3D31A 5COYA 2VUMB 1BR9A 4QF4A 2YYZA 5JPMC 3IL8A 1ONLA 1Y1VB 2B2VA 3NBHA 5KNDA 1STNA 2IJ0A 1OXSC 3V05A 1HPCA 4XIGS 2NTSA 4A3EB 1TS4A 2N55A 3CRKC 1ILQA 4XYQA 3HGBA 1A3TA 1G2TA 3SDZA 4PNYA 5C4XB 2BDNA 2SEBD 1MSHA 2L9HA 2E2DC 1OO9B 1ESFA 4NW2A 4KY6A 2FMCA 4EQNA 2E76C 1JOOA 3GTQB 4O42A 1STYA 3SE0A 4U673 3VYRA 3D6WA 1PTOH 1SJED 2QCPX 3K58A 2Q8IB 3D3RA 1QG7A 2WP8J 4CKEA 3K6OA 2VB2X 5ELCA 1GUNA 2K7VA 4X3KA 1H9MA 1SYCA 1TKWB 3D4DA 4IFDG 3K5LA 3A56A 2FFKB 1YNJD 4N9PA 5I6WA 1JC7A 2EY6A 1PRTD 1HQRD 4XDXA 1O78A 1H9SB 3K7AB 1CM9A 2A6ED 1EQVA 1FYCA 3JAML 1JOQA 2RDFA 3MA2B 2K05A 1B3AA 3MXGA 1D2BA 2A68D 4L6TB 4CKCA 3Q23A 5D14A 1EIGA 4NMZA 2L11A 2Q8TA 3S2HB 2EXZA 1EIHA 1CZGA 4PMCA 3NTHA 4ZK9B 2K1BA 4DXFA 4K6DA 1SE2A 4K5WA 4KD4A 1U4MA 4ZRZA 5K5PA 3CQZB 1PFNA 3IAYA 4J8QA 1A3VA 1FGBD 1G2SA 1Z7TA 1SNPA 5FLXE 4A3DB 5BN4A 3R93A 1M4VA 2F0LA 1CK1A 3MXPA 4X3SA 4A3BB 3DWPA 4DXGA 1PTOF 2G9HD 3ND8A 1NUCA 4E6IA 3DM1A 5JPNC 3DMUA 2PW7A 4DN4M 1VF7A 5EKKA 2XN9C 4MIUA 1SYBA 2K01A 4ZLTF 2L1BA 4KI0A 1OXTA 4ZAIA 1LT5D 4IUVA 1SMYC 1PZKD 1S5DD 3RZOB 4RGMA 1ZKOA 3L7ZC 4FF2A 1VMPA 3FPUB 5K36H 4HN7A 2F0OA 3HG9A 2F0HA 1A2UA 4KKSA 1SYGA 4F88A 5E4XA 2E74C 1QOHA 2HDMA 3GD7A 3W3AA 2B39A 5CV5A 1SBBB 5IGGA 2PZUA 1TWFB 5ELEA 4DAVA 1C48A 2AQ3B 2EDGA 1C8CA 2HCIA 3K0YA 2EYPA 2B8GA 1LV9A 3PV0A 1W6JA 2L55A 3RLFA 2WKDA 1PTOB 5FO8B 2E2JB 2KCNA 1HFGA 2BDOA 5EKIA 1EEFD 2M2LA 2VNUD 1A3UA 1EY6A 4HTHA 3U9OA 2F0SA 4QMGA 2PO4A 4FXKC 3GTPB 1YNNC 1SYDA 4BY1B 3VYUA 3M7NA 3CKIB 4KN7C 3SK6A 1DD2A 3PMFA 1HRJA 1F2ZA 1AN8A 4C3IB 4BA2I 1EWCA 4G7HC 1K8OA 1TWHB 5I2YA 2BE5D 4B9XA 1EU3A 2F03A 3GTMB 3HS0C 1I6VC 3BYYB 3NP8A 5E3FA 2E2HB 4BA1I 2JP1A 1B9MA 3OPOA 3GTOB 3GTJB 1D5ZC 4JK1C 4AYBB 2E2IB 1CTMA 1AFPA 2I46A 2NB0A 3NWSA 1S5FD 2EOTA 2WIIB 3DUZA 4CJ2C 4GZYC 2ENBA 5C4HA 2F0PA 1RODA 4KKTA 2XWBB 3BYTB 3OMCA 3FDTA 3K5NA 4H7BA 5KNCA 2HCCA 4R9WA 3V96A 1V1PB 3D4RA 4CKBA 2B2TA 1VCIA 3QG1A 1SNQA 2J4XA 2VB3X 1O7YA 1BXTA 3HKZB 4H44C 2PZWA 3VA5A 4O1NA 3VR3A 2F0VA 2E75C 2PCFB 3OSOA 4LMQD 2QKIC 1EYAA 2Q8RE 1F2LA 1Q8IA 1EY5A 2HQEA 1WVLA 5EBCA 5JJZA 4K5VA 1RHPA 3HP3A 1NR2A 1Y8PB 5CV8A 5FO7B 3GO5A 1ZYRD 3H09A 5T1GA 4ZUIA 4DNTB 2F0JA 4HSVA 4EVOA 3PUWA 4HMIA 3D8GA 1EL0A 1U4LA 1SDFA 3OMGA 1S4ZA 4BS9A 1EOTA 4C3JB 4PV1C 3HOUB 5KGUA 1TWAB 3MAQA 1I6HB 4DK0A 1WTPA 3NQIA 2F3WA 1BF4A 1E2WA 4TQUS 2AWOA 5EPKA 1GUSA 5A2QL 5M3FB 2R61A 2WACA 1BOSA 2NZ1D 3P1HA 1SYEA 2L0CA 2XWJB 2EYMA 2F0KA 2SOBA 3SR1A 3S17B 1ILPA 1XWEA 3T4AC 4RAUC 1EY9A 1EZ6A 2NWGA 2KUMA 5C0XJ 4DAPA 1S5CD 3K57A 3EA6A 1I3QB 3NTKA 4V0BA 2N88A 4RHRA 3QO2A 4M8AA 1JCKB 1GUGA 3TZUA 2IX1A 2EYFA 1SSOA 2AUJD 1S5BD 3HOZB 2PZTA 3OIPA 5D3DA 4ZKCB 3QOLA 2NYZD 1TY0A 3QWNA 5BN3A 1JWUD 1H9JA 3KUPA 1B1ZA 3J81L 4OGQC 2Z4HA 2F0MA 1G91A 1E0BA 1DXMA 4HCEA 4FO2A 1LTAD 2PPBC 5CV4A 1PLFA 4OIKA 3PO3B 1G291 1U4PA 3N6RA 4FP5D 1B53A 3NPPA 3MXUA 3PUZA 1VMCA 1XX8A 2R3ZA 1TS3A 2HUGA 4XXEA 2K5DA 3SVMA 1JWSD 1TU2B 1GOZA 4IUQA 3FRPB 2EYJA 3I91A 2MGSA 3WOEA 2FJ2A 1KAAA 4DFAA 1DM0B 1XYIA 1PFMA 1PTOC 5KYIA 5IGCA 1GUTA 5ISRA 2DY8A 2ZT9C 1F2YA 4DU9A 4KJOA 4DA2A 4LK1C 2RDGA 1YNJC 3S1MB 3K5MA 5A35A 1QB5D 3HZXA 2PYKA 5F2DA 4OO1G 1O7ZA 1WCMB 2A6EC 1CQFA 2CQAA 4RHSA 1DCZA 2MUYA 4RKLA 4ZQ3A 5LL6S 1TS5A 3GTGB 1WD1A 4RKBA 4IALA 5E4WC 4IUPA 4FXDA 2RA4A 2F1MA 1HHVA 3M85A 1D1KA 3S9WA 3ERQA 2IW3A 1D5MC 1SE4A 1Y8OB 1PXUA 2F0QA 5C3WA 1Z47A 5ELBA 3R8BA 3J7AF 4WORA 4RCNA 1GXDC 4KKUA 2LFNA 2K5WA 5C0XG 3MZ5A 4HCSA 3A55A 3RMHA 1FNUA 3K59A 4K6LA 3NBIA 1LACA 1EQTA 3HOWB 2OF1A 1BDOA 1GUWA 3NTIA 2EY2A 4A3KB 3L3OC 4BWGB 4X3TA 3KBXA 2AQ1B 2WAQB 1C4QA 1I4QA 2RDHA 3BDOA 2R6GA 1IW7C 3Q24A 4HAEA 1BCPD 5G3LD 3DEOA 3KLSX 3S1RB 1FD7D 1HTLD 3VR5A 2L12A 3P20A 2R92B 5CV9A 1EWHA 1ZEQX 3QJYA 2WINB 1PZID 1PDQA 1F9QA 1XXGA 5M5YB 3BVGA 1WD0A 2Z1CA 1CZWA 2EYOA 3SK4A 1LTGD 2QF7A 4EQOA 3A7LA 3CHBD 2JE6I 3I3CA 3HOVB 1RTNA 5KYLA 3Q6SA 1LT3D 4IURA 3NSWA 4C1NK 1JICA 4RFBA 1JORA 3G7LA 3LWUA 2CW0C 1GHJA 3KBGA 3H0GB 3J80E 4OIJA 4ZUJA 2XNAC 5C44B 4KTAA 4LJZC 1KABA 4G7ZC 1QE6A 1EY7A 5AFWA 4L8JA 4Q0FA 2RBMA 1Z6HA 2XSCA 5IT9L 4RA8A 3HRZC 1DONA 5KRUA 5DM73 5I6YA 3CRLC 1X3QA 2LY7A 2TMPA 2JA7B 4RWSC 3K5OA 1DYQA 2BOSA 1IHZA 2V4DA 1PRTF 4KMUC 4C56C 2ZXOA 3IFTA 2BE5C 2K32A 1KNEA 2F3VA 1EY8A 2IWHA 3MXNA 5CYUA 2DN8A 4G4KA 5D3IB 3GV3A 3PUVA 1STBA 4KK7A 4QUFA 1D6EC 1QWYA 1U4RA 5CV6A 2XIWA 5LL6X 1V43A 1GJXA 1EEID 1KDBA 1WTXA 4HEDA 2ZXPA 1IL8A 2EY1A 1RD9D 3LNNA 1D1IA 3DWAA 5M5XB 3FPPA 3KLRA 1TS2A 2NN6G 3BS1A 5E1FA 1ENCA 3L9AX 5M5WB 3TBIB 2B8FA 3MTSA 2C5CA 2F0FA 3T13A 3H3VC 1NCVA 3BDCA 3PO2B 3VR2A 1K83B 4U68A 1B44D 3M4OB 1JWMD 1PRTB 4UAIA 1KNAA 3I4LA 4ODGA 4G7OC 2WB1B 2M9VA 1B2TA 1JE4A 4OL7A 2MHVA 1J8IA 1W6KA 4K2KA 4A3MB 3QOJA 3MFYA 3ITPA 2F0NA 1AZQA 1NR4A 1ZXTA 1J9OA 1SMYD 4TSSA 2JXMB 1HA6A 3VYSA 1DOMA 2A69C 2F0DA 4IUNA 1SNCA 1LABA 2K6AA 1ZYRC 1AW7A 2CVRA 1IKLA 2KQ3A 4ZYSA 2O4XA 4ID6A 4ABNA 3I70A 1STEA 4ULLA 2EYHA 2NVTB 5EGTA 1STAA 4ME5A 2RQXA 2JA5B 5I9OA 3NUCA 1TR5A 3EQLC 4X3UA 4I7ZC 2SNSA 4KY5A 3R2IA 5CGKA 5JEAJ 2NVYB 4I65A 1T5EA 3TP5A 2O5JC 1SJHD 3WOFA 3FKIB 4OO1H 5HGTA 4FF1A 3A8KE 3W2DA 2O2LD 5J22A 5EJWA 1STGA 4QUCA 4F7XA 3S1NB 2OEOA 2ICEC 1CQVA 1O80A 4EQPA 4NKLA 1Q3LA 3PIO3 2B2UC 2H1EA 3OHXC 1UAPA 2WKCA 1ICWA 1H9SA 1JQYD 5JOBA 1UEAB 5DEHA 1YNND 3M7GA 4KN4C 2TSSA 5C0XH 1QCBD 4WFN3 4A3IB 1DOKA 1K8MA 5FKAC 4KD3A 3T53B 4CJ0B 5ELDA 3NXWA 1HUNA 1FNVA 1B9NA 1R9TB 1T5XD 2F0IA 1IYVA 3TP6A 1LTRD 4A3JB 3OIQA 1F2MA 1WTRA 1NSNS 4IFDH 2XVSA 3N52A 1ENAA 3EROA 1MBYA 1F9PA 1F9SA 1STHA 1DZ1A 1M8AA 3LX0A 2AQ2B 3PUXA 2B2WC 1WTWA 4MN3A 5FLXL 3S16B 5C3XA 1D5XC 3D4WA 1RCVD 1JOKA 5J39A 3C46A 3VA7A 1L0XB 1OXXK 1BUVT 3NHHA 2A6HC 3ND9A 2OXPA 4H0LC 1AP0A 1O7LA 2J0TD 2KCCA 1OXVA 4RGOS 3EFXD 4XQNA 4Z9CB 4QB4A 2MP1A 3M3YB 2FHTA 3ZYYX 2ID0A 1JB3A 1LT4D 2QEJC 5M3MB 4C3HB 4L63B 1AEXA 2D62A 5JEAG 5DM63 4NP5A 3C2PA 1PMRA 3A8JE 5IGEA 1HA5A 1I50B 1BQQT 1EZ8A 1CT1D 2NVXB 1H9KA 3X3MA 1MI2A 1KDCA 3BVMA 1LTBD 4OO1I 1LLRD 2A73B 3X3NA 1G6ZA 3SK5A 3GQBA 2A5HA 4BBRB 4BY7B 5CORA 3TP7A 3MHBA 4CGYB 3EVQA 3NK9A 1LO5D 2B2YC 3MFGA 2PNRC 5C5MA 4UDUC 1EYCA 2RVLA 3S14B 2IX3A 2YU9B 2KJXA 3IKJA 3RZDB 3UI2A 4DF7A 5EQ0A 2K33A 3I4MB 5C0XI 1QILA 1CA5A 1BCPC 1R4PB 3C1FA 4Q5VA 3P7JA 3H94A 2C9OA 2L5TA 2F0EA 4K2LA 3SK8A 2EJFC 1PRTC 1KLUD 1PYWD 1BO0A 2NVQB 1TQOA 2NN6H 3OOCA 1WTOA 1E2ZA 2BCOA 4IFDI 2DNCA 4DAYA 1Q90A 1TWGB 1LTID 3I73A 1Y69U 3AU7A 3MWYW 4J6HA 1R4QB 2A68C 1TVXA 2ICIA 1EYDA 4KJNA 3BDLA 4FNFA 4XQQA 2K5QA 3I4NB 5DNFA 3PIP3 3AB9A 3AMUA 4A3FB 5JVG3 4CJ1B 2EY5A 1NAPA 1RF2D 4LAAA 3ONAB 5EKLA 1V1PA 2O5IC 2B2VC 1I4PA 4TRDA 1MD2D 3VYTA 5C6AA 2KOLA 5CV7A 2KA7A 4K8JA 3BG3A 2L4NA 3QB3A 4B08A 3HOYB 5LHY1 3RUZA 2G9DA 4KV6A 1LTTD 3HEJA 5M9OA 1Q1EA 3OW7A 1L0YB 3GTKB 2R7ZB 4K8IA 3BVZA 1I4GA 3A8IE 1EY4A 2IPKD 1LT6D 1UUPA 1DOLA 1ML0D 1RJTA 5J1ZA 1PTOD 2LKVA 3DEPA 4B9WA 5CC4A 5KEEA 2HDLA 3TZDA 1Q12A 4FYDA 5HURA 2D5DA 4HSPA 1QJOA 4KHZA 1XTCD 2MJ8A 4H13C 3V2TA 2NBFA 3NE5B 3E0JA 4P2CB 3IFDA 4BBSB 1QNUA 3H6MA 2K04A 3KF8A 3BZDB 4RCOA 2EZVA 1HUMA 2IL8A 2X69A 3I90A 1SNOA 1SNMA 2M00A 3S2DB 1HTPA 1ET9A 1F9RA 3MC0B 1PZJD 2IX0A 5C4ZA 2AUKA 3E6ZX 5A2QE 3TP8A 3GV6A 1PFBA 5I4DA 5EBDA 4PQXA 2VXWA 1BCPF 1HCZA 5G3LF 1A2TA 1I4XA 3FMCA 2PMZB 4YIJA 2NN6I 2Z4IA 4NDXA 1MSGA 3F2UA 2OT2A 1GUOA 4DGZA 4PMBA 1IW7D 2B63B 2F0TA 4M1UB 1SFOB 4ZKBB 4XQJA 2JSOA 2J7ZA 2XRSD 4FVMA 2I07B 5EPJA 3TMEA 3T16A 1HQMC 1ET6A 5IIFA 1QNKA 3J81E 2EJMA 3VR4A 3TN2A 1B50A 2PQEA 5IGBA 5DAUA 4A3GB 5CR3A 4IUTA 2WV6D 2F0WA 3A54A 1EY0A 1SNDA 2JEBI 2KEDA 4XT3B 5CMDA 4HMJA 2CW0D 2BA1A 1BCPB 1IKMA 1II3A 5JEAH 3U9SA 1VDZA 1CA6A 1B4OA 3P75A 1ENFA 3SXHA 3NWTA 4XYOA 2KVMA 4IQZA 1WTQA 3PUYA 2D2CC 3I8ZA 2EVBA 3TDQA 4K5XA 3S15B 4K14A 2Z8LA 1TWCB 2EPBA 1TT2A 2RSOA 1WTVA 5FO9B 5C3EB 5IGDA 5T1IA 4FXGC 4KY7A 1G8ZD 1FR3A 3C1EA 4HR7B 3M4YA 2NUCA 2FINB 4JBWA 4F87A 3LWEA 1BBXC 1HFNA 2H4OA 4C1NI 4DNRB 2A74C 1CHQD 3Q22A 5FK9C 4QIWB 3VR6A 4J1MA 3G6JB 1BNZA 3S1QB 3NQTA 5NUCA 4QCLA 4V190 1FNWA 2X6LA 2X6GA 2B2UA 5I2XA 1A6XA 1SEBD 4EGVA 4C3IG 3GP7A 5KIXA 2R93B 1F77A 2KECA 1SE3A 1RKNA 2K03A 2GA4B 5ELFA 3OWEB 3MVVA 2JA6B 1Q1BA 1X3PA 3I72A 4N9TA 1V8QA 3CU7A 4ILWA 4OHJA 2KEEA 2AWNA 5C4JB 1V1OA 3OWFA 2D9UA 4F8MA 1ESRA 3H91A 1KDAA 2IT1A 2Y0SB 3T56B 4FF3A 2QDBA 1KTKA 3DXJC 3J7YW 2SNMA 4Y7NB 3O13A 4G57A 4CBVA 1KLGD 3FEWX 3JAME 1U9RA 1Y1WB 3KK7A 2B2TC 1OXUA 3HOXB 2B2WA 1DJRD 3R2TA 4PMWA 2K28A 3R3OA 2A69D 3QIAA 4KHVA 1SXTA 5JVH3 1X32A 2EYLA 4CHTB 4R8IA 2EE1A 2JA8B 4A93B 4RGTA 4IZ8A 5CBEE 5IOCA 1MGSA 3J80L 2LS01 2SDFA 3KLSA 5KNBA 5K36G 2F0UA 1CFMA 3URYA 5IT9E 2F0GA 1A15A 2JYOA 5IGFA 2RSNA 4IUUA 1SYFA 5D65A 4C3JG 3DWQA 2XRQD 2FMMA 2F4IA 1I4HA 1SAPA 2BA0A 1TY2A 2NTTA 3FVQA 2ZXRA 3SHLA 3RD4A 4WRDA 4MHEA 2EJGC 3MEHA 2B2YA 3EJIA 4R8NA 1CI3M 2PW5A 3A7AB 4WJWA 3T51B 3J7AV 2CHBD 1S5ED 1Y8NB 3D6CA 3GTLB 1E2VA 4S3SA 4IFDJ 4RH6A 1H9RA 4RGNA 1RDPD 2QILA 2DNEA 2KHSA 5C5LA 1GHKA 3Q0AA 5BN5A 2LMCB 5CBAE 3SEBA 4XTCS 2RKSA 1LTSD 5I9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DD2 A;  3NE5 B;  2CW0 C;  3VR6 A;  1GHJ A;  2B8F A;  2EJF C;  3M85 A;  2KCC A;  5BN3 A;  4DK1 A;  1OXV A;  4BA2 I;  2EJM A;  1H9J A;  1Y8O B;  2NN6 H;  3VR4 A;  4G7H C;  4KI0 A;  4OGQ C;  1Y8P B;  1A6X A;  3OOC A;  1K8O A;  1E2Z A;  2BE5 D;  4RCN A;  1IYU A;  1GUN A;  1OXT A;  1DXM A;  4LJZ C;  4KKU A;  2K7V A;  2DNC A;  4G7Z C;  5C0X G;  1H9S A;  1H9M A;  1SMY C;  1Q90 A;  5KNB A;  3I73 A;  4L8J A;  4DNT B;  1Y69 U;  1CFM A;  2PPB C;  5K36 G;  1TKW B;  1I6V C;  4IFD G;  3PUW A;  1VF5 C;  2A68 C;  3VR2 A;  1G29 1;  1Z6H A;  2D62 A;  1LAC A;  1ZKO A;  3L7Z C;  1HTP A;  5JEA G;  2JEA I;  4TKO B;  3N6R A;  2JEB I;  3WDN A;  4KN4 C;  4BA1 I;  1Q1B A;  2A6H D;  3I72 A;  3MXU A;  3PUZ A;  1PMR A;  5C0X H;  4PV1 C;  1B9M A;  1V8Q A;  3D31 A;  5K36 H;  1BDO A;  3I4L A;  3A8J E;  3OPO A;  4G7O C;  3CRL C;  1TU2 B;  4DK0 A;  4KKS A;  1K8M A;  3AB9 A;  2BA1 A;  2E74 C;  4JK1 C;  1H9K A;  5JEA H;  1O78 A;  3GD7 A;  3T53 B;  1H9S B;  2YYZ A;  3W3A A;  1E2W A;  4TQU S;  3U9S A;  1VDZ A;  2A6E D;  3MFY A;  1ONL A;  2V4D A;  2AUK A;  3BDO A;  1CTM A;  2R6G A;  2AWO A;  1IW7 C;  2O5I C;  2BA0 A;  1FYC A;  1GUS A;  4KMU C;  1B9N A;  2IT1 A;  5KND A;  4IQZ A;  2JXM B;  3VR5 A;  3P20 A;  3IFT A;  1IYV A;  3GQB A;  2A69 C;  1OXS C;  1EWH A;  1GUT A;  2BE5 C;  2KA7 A;  1HPC A;  2EDG A;  4XIG S;  4GZY C;  1HCZ A;  1LAB A;  2A68 D;  3PUY A;  2K32 A;  1ZYR C;  2ZT9 C;  2EJG C;  2D2C C;  3FMC A;  3T56 B;  3QJY A;  3BG3 A;  4KN7 C;  3CRK C;  2EVB A;  3DXJ C;  4IFD H;  2NN6 I;  1CI3 M;  3HGB A;  4KKT A;  2PNR C;  2DN8 A;  4LK1 C;  2B8G A;  3PV0 A;  3A7A B;  3T51 B;  1YNJ C;  3SDZ A;  5KNC A;  3PUV A;  3RLF A;  1Y8N B;  1Q1E A;  3OW7 A;  3D4R A;  2QF7 A;  3IKJ A;  3EQL C;  5A35 A;  1E2V A;  1VCI A;  3A7L A;  1GUO A;  3QG1 A;  4I7Z C;  3A8I E;  1FR3 A;  2BDO A;  1V43 A;  1H9R A;  1OXU A;  1Z7T A;  2JE6 I;  1GJX A;  4HR7 B;  1IW7 D;  3M4Y A;  3PUX A;  4JBW A;  2E76 C;  5BN4 A;  4OO1 G;  2K33 A;  1T5E A;  4H44 C;  2A6E C;  2DNE A;  2O5J C;  3LNN A;  1GHK A;  2A69 D;  3QIA A;  1DCZ A;  3VR3 A;  1GUG A;  3FPP A;  3SE0 A;  5BN5 A;  3TZU A;  2LMC B;  3KLR A;  2E75 C;  3VA7 A;  1YNN C;  2PCF B;  4DNR B;  1Q12 A;  1OXX K;  3ND8 A;  2NN6 G;  3H94 A;  2D5D A;  4OO1 H;  2A6H C;  4XTC S;  3ND9 A;  1QJO A;  2L5T A;  4KHZ A;  3M7N A;  2AUJ D;  2Q8I B;  3LWU A;  3A8K E;  1HQM C;  4H0L C;  1VF7 A;  4H13 C;  1O7L A;  2F1M A; 
#chains in the Genus database with same CATH topology
 4C3H G;  1PV4 A;  1EYG A;  5IOD A;  4GLX A;  1AZP A;  3F8T A;  3J81 c;  3H0G H;  4UHV A;  4DK1 A;  5TSS A;  2MPM A;  2VY3 A;  1RTO A;  4IN3 A;  3HOZ G;  4XT1 B;  3NEM A;  4FF4 A;  1PYB A;  1EU4 A;  1O7I A;  3E5S A;  1HXY D;  4A3B H;  4GNX C;  2F3I A;  1IYU A;  1TII D;  4JYA L;  2DUD A;  5FJ8 G;  3C3L A;  3TSS A;  1UNS A;  1EQQ A;  1VF5 C;  4YCW A;  4C2M B;  1CHP D;  3DHQ A;  2DY7 A;  5FOB B;  2L15 A;  2JEA I;  1EFI D;  2CH4 W;  1JR0 D;  1I4R A;  4TKO B;  4GKJ Q;  3WDN A;  4DR3 L;  1B3Q A;  5JAV A;  3PO3 G;  2A6H D;  5EPL A;  1NMF A;  3D31 A;  1NNX A;  5COY A;  1S72 A;  2VUM B;  5BR8 L;  1GVP A;  1BR9 A;  3U4Z A;  4QF4 A;  2YYZ A;  5JPM C;  4UP9 A;  3RZO H;  3IL8 A;  4HJ7 A;  1ONL A;  1Y1V B;  2B2V A;  3KLW A;  3NBH A;  5KND A;  1STN A;  2IJ0 A;  3J81 i;  4N8F A;  1OXS C;  3V05 A;  1HPC A;  4XIG S;  1LUZ A;  2NTS A;  4A3E B;  1TS4 A;  1IBK L;  2N55 A;  3CRK C;  3CXC A;  1ILQ A;  4XYQ A;  3HGB A;  1A3T A;  3I4M G;  1G2T A;  4JI1 L;  2UUC Q;  3SDZ A;  4PNY A;  1TWF H;  5HGQ A;  5C4X B;  2BDN A;  2SEB D;  1CUK A;  1MSH A;  2L9H A;  2PQA A;  2E2D C;  1OO9 B;  1ESF A;  4NW2 A;  4KY6 A;  2OWO A;  2FMC A;  4EQN A;  2E76 C;  2HT1 A;  1JOO A;  3ER0 A;  3A5Z B;  3GTQ B;  1HNZ Q;  2Q2U A;  4O42 A;  1STY A;  1WCM G;  2MFI A;  2OQ0 A;  3SE0 A;  2N49 A;  4U67 3;  3VYR A;  3D6W A;  1PTO H;  1SJE D;  2E2J H;  2QCP X;  3F2C A;  4LF6 L;  3K58 A;  3RN5 A;  2Q8I B;  4A3C G;  5E7N A;  3D3R A;  4OON A;  1QG7 A;  2WP8 J;  4CKE A;  3I7F A;  3K6O A;  4AYB E;  4AH6 A;  1E1O A;  1YVC A;  2VB2 X;  3GTP H;  3TEH B;  5ELC A;  1GUN A;  4BY1 H;  2K7V A;  5GQO A;  4X3K A;  1H9M A;  1SYC A;  1X3G A;  2B29 A;  3T1H Q;  1TKW B;  3D4D A;  1IL2 A;  4IFD G;  3K5L A;  3A56 A;  5FLM H;  2FFK B;  5IWA L;  1YNJ D;  4N9P A;  4C3I H;  1M1K C;  5I6W A;  4LF8 Q;  1JC7 A;  2E5L L;  2EY6 A;  1TWH H;  4DNI A;  2LXK A;  3HOW G;  3RLN A;  1PRT D;  1HQR D;  4XDX A;  1O78 A;  1H9S B;  3K7A B;  1CM9 A;  1K28 A;  2A6E D;  1SE8 A;  1EQV A;  1FYC A;  2K75 A;  3HKZ E;  3QR8 A;  3JAM L;  2E2H H;  2WAQ G;  1JOQ A;  2Q2H A;  2RDF A;  3MA2 B;  1PH4 A;  2K05 A;  1B3A A;  3G6E A;  4LFC Q;  2F52 A;  3MXG A;  3GTO H;  1D2B A;  1KXL A;  2A68 D;  4IOC A;  1UEB A;  4L6T B;  4CKC A;  3Q23 A;  5D14 A;  1EIG A;  4NMZ A;  2L11 A;  2Q8T A;  3S2H B;  2EXZ A;  1EIH A;  1CZG A;  4PMC A;  2JA5 H;  4YWK A;  1N33 Q;  3NTH A;  4ZK9 B;  2E2I H;  4LF4 Q;  2K1B A;  2F4V L;  4DXF A;  4JBK A;  4K6D A;  1SE2 A;  4K5W A;  4KD4 A;  1U4M A;  4MNO A;  4ZRZ A;  5K5P A;  3CQZ B;  1PFN A;  2RF4 A;  3IAY A;  4J8Q A;  1L1O C;  2QDL A;  1A3V A;  4HID A;  1FGB D;  1G2S A;  1Z7T A;  4JI8 L;  2YTY A;  1SNP A;  5IYB G;  4L5Q A;  1P8L A;  5FLX E;  4A3D B;  5BN4 A;  3R93 A;  1QUQ B;  1M4V A;  2NZO A;  4BBS G;  3TS2 A;  2F0L A;  1QZG A;  4LF7 L;  1CK1 A;  3HOV G;  3MXP A;  5IYD H;  4X3S A;  4B3S L;  4A3B B;  3DWP A;  4DXG A;  1PTO F;  2G9H D;  1W2B A;  2ZM6 Q;  3ND8 A;  2NZH A;  4ALP A;  1NUC A;  4E6I A;  3DM1 A;  2KHJ A;  5JPN C;  1N8R C;  4OX9 L;  3DMU A;  2PW7 A;  4DN4 M;  1VF7 A;  5EKK A;  2OCE A;  2XN9 C;  4MIU A;  1SYB A;  2K01 A;  2VZA A;  4ZLT F;  3UE0 A;  2L1B A;  4KI0 A;  1OXT A;  1K73 C;  4ZAI A;  1LT5 D;  4IUV A;  2VQE L;  1SMY C;  3CME A;  1PZK D;  1S5D D;  5C44 G;  1IBL L;  2UXC Q;  1X3E A;  4DV5 L;  3RZO B;  4RGM A;  1ZKO A;  3L7Z C;  4FF2 A;  1JMC A;  2RHQ B;  1VMP A;  3FPU B;  5K36 H;  4HN7 A;  1B70 B;  2F0O A;  3HG9 A;  2F0H A;  1A2U A;  4KKS A;  1SYG A;  4F88 A;  5E4X A;  1GM5 A;  2E74 C;  1JJG A;  1QOH A;  2HDM A;  3GD7 A;  3PSI A;  3W3A A;  3E0E A;  1K3R A;  2B39 A;  5CV5 A;  1SBB B;  2JA7 G;  4IPG A;  4K0K L;  5IGG A;  2PZU A;  1TWF B;  5ELE A;  4C3J H;  4DAV A;  1PH8 A;  4JBJ A;  3HOU H;  1C48 A;  1TWA H;  1LTL A;  2AQ3 B;  2EDG A;  1I6H H;  1EIY B;  1C8C A;  2HCI A;  4MTK A;  3K0Y A;  4JYA Q;  3K0X A;  2EYP A;  2B63 G;  2B8G A;  1LV9 A;  3PV0 A;  4NXN L;  1W6J A;  1FJG Q;  1XNQ Q;  2L55 A;  2AKW B;  3RLF A;  2WKD A;  5IP7 H;  5M3F H;  1Q81 C;  1PTO B;  5FO8 B;  2E2J B;  2KCN A;  1HFG A;  2BDO A;  5EKI A;  1EEF D;  4IPD A;  3SGI A;  2M2L A;  5BR8 Q;  2VNU D;  1A3U A;  1KC8 C;  1EY6 A;  3S17 H;  4HTH A;  4CDC C;  3U9O A;  1YZ6 A;  2F0S A;  4QMG A;  2PO4 A;  4FXK C;  3GTP B;  1YNN C;  3KJP A;  1SYD A;  1TXY A;  4BY1 B;  4DPG A;  3VYU A;  4TVA B;  3E9H A;  4A3G G;  3M7N A;  3CKI B;  5IP9 H;  3J7Z C;  1IBK Q;  1B7Y B;  4KN7 C;  3SK6 A;  1DD2 A;  3CMA A;  4EQ5 A;  3PMF A;  2LSS A;  1F2Z A;  1HRJ A;  1AN8 A;  4C3I B;  4KLK A;  3UDI A;  4BA2 I;  1EWC A;  3PIP A;  4G7H C;  1K8O A;  3W1G A;  1TWH B;  1IZ6 A;  5I2Y A;  2BE5 D;  4B9X A;  4LW1 A;  4X65 Q;  5M3M H;  2CKZ B;  1EU3 A;  2F03 A;  3GTM B;  3HS0 C;  1I6V C;  2V1C C;  3CP0 A;  3HOZ H;  3BYY B;  3NP8 A;  3PO2 G;  5E3F A;  1XTD A;  2E2H B;  4BA1 I;  2JP1 A;  1B9M A;  5FJ8 H;  3OPO A;  3GTO B;  4YHH Q;  3GTJ B;  1D5Z C;  4JK1 C;  2N3S A;  2DJF C;  4LF6 Q;  1WJJ A;  2WB1 G;  4DAY B;  4AYB B;  3PO3 H;  3LGJ A;  2E2I B;  1CTM A;  1AFP A;  2I46 A;  2NB0 A;  3NWS A;  4A3M G;  1X9N A;  4DR1 L;  1EOV A;  1S5F D;  3AFQ A;  2EOT A;  2WII B;  3DUZ A;  3H15 A;  4CJ2 C;  4GZY C;  2ENB A;  1D7Q A;  5C4H A;  3H3V H;  2YTV A;  2F0P A;  1ROD A;  4KKT A;  3CCM A;  2XWB B;  3BYT B;  3CC2 A;  3OMC A;  3FDT A;  3K5N A;  1VQ4 A;  5IWA Q;  4H7B A;  2YU9 H;  5KNC A;  2HCC A;  1CKN B;  3RZD H;  4R9W A;  3V96 A;  4LF5 L;  1V1P B;  3D4R A;  3CCR A;  2E5L Q;  4CKB A;  2B2T A;  1VCI A;  3QG1 A;  3CC7 A;  1SNQ A;  2J4X A;  2VB3 X;  1O7Y A;  2JQO A;  1XJV A;  1BXT A;  3HKZ B;  4H44 C;  2QEX A;  1ICF B;  2PZW A;  4UPA A;  4JPB W;  4O1N A;  3VA5 A;  3VR3 A;  2F0V A;  3S1M H;  2E75 C;  2PCF B;  3OSO A;  2OQK A;  4LMQ D;  2QKI C;  1EYA A;  2Q8R E;  1F2L A;  1Q8I A;  1EY5 A;  2HQE A;  1WVL A;  5EBC A;  5GRO A;  4DKA C;  5JJZ A;  4K5V A;  1WCM H;  1RHP A;  4RMF A;  1GD7 A;  3HP3 A;  3KF6 A;  2F4V Q;  2WAQ E;  1NR2 A;  1Y8P B;  5CV8 A;  5FO7 B;  4GOP A;  3GO5 A;  4A3C H;  1E7Z A;  4DR2 L;  1ZYR D;  3H09 A;  5T1G A;  4ZUI A;  4DNT B;  4JI8 Q;  2F0J A;  4HSV A;  1NMG A;  1Q7Y C;  4EVO A;  3PUW A;  4HMI A;  3D8G A;  1EL0 A;  1U4L A;  1PH9 A;  2K14 A;  1Q46 A;  1L1O B;  2GN5 A;  4J15 A;  1SDF A;  3OMG A;  4DK6 C;  1S4Z A;  4BS9 A;  1EOT A;  4Y52 H;  1KRT A;  4C3J B;  4LF7 Q;  2CQO A;  4PV1 C;  2CWP A;  3FHW A;  3HOU B;  5KGU A;  1UWV A;  1TWA B;  2Y0S G;  1QUQ A;  4B3S Q;  3MAQ A;  1I6H B;  4DK0 A;  1WTP A;  3KF8 B;  3NQI A;  4A3I G;  1JJC B;  1K8G A;  4LF9 L;  2F3W A;  4OX9 Q;  2BH2 A;  1BF4 A;  1E2W A;  4TQU S;  3AEV A;  1VQA A;  2AWO A;  5EPK A;  1GUS A;  5A2Q L;  1QVG A;  1W3S A;  3HOW H;  5M3F B;  2QW7 A;  5IYC H;  3K81 C;  2R61 A;  2WAC A;  1BOS A;  2NZ1 D;  3P1H A;  1SYE A;  3T1Y L;  4A3K H;  4DR6 L;  2VQE Q;  2L0C A;  2XWJ B;  2EYM A;  2F0K A;  2SOB A;  1IBL Q;  3SR1 A;  3S17 B;  1ILP A;  4DV5 Q;  1XWE A;  1XMO Q;  3T4A C;  4RAU C;  1A63 A;  1EY9 A;  2D0O A;  4JI5 L;  4UP8 A;  1EZ6 A;  2NWG A;  2KUM A;  4H02 A;  2RCF A;  5C0X J;  4DAP A;  3S1R H;  1C0A A;  2R92 H;  1S5C D;  3K57 A;  3EA6 A;  5FLX c;  1I3Q B;  3NTK A;  4V0B A;  2N88 A;  4RHR A;  5M5Y H;  1PH7 A;  3QO2 A;  2HHH L;  4K0K Q;  4M8A A;  1JCK B;  4DAM A;  4A93 G;  1GUG A;  3S24 A;  4DV3 L;  3TZU A;  1E22 A;  4ME3 A;  3TS0 A;  1KL9 A;  1UE1 A;  3U50 C;  2IX1 A;  1PH5 A;  2EYF A;  1KHI A;  1SSO A;  2AUJ D;  1KIX A;  1S5B D;  4BBS H;  3HOZ B;  2PZT A;  3OIP A;  1CSQ A;  4IOA A;  3HOV H;  5D3D A;  1I5F A;  2MO0 A;  3QOL A;  2NYZ D;  1TY0 A;  3QWN A;  4ZKC B;  1JWU D;  5BN3 A;  4NXN Q;  1YI2 A;  1H9J A;  3KUP A;  1B1Z A;  3J81 L;  3CCL A;  4OGQ C;  2Z4H A;  3H3V I;  3MXN B;  2CWA A;  2F0M A;  4GNX A;  1G91 A;  1E0B A;  4QJF A;  1DXM A;  4HCE A;  4FO2 A;  1LTA D;  2PPB C;  5CV4 A;  1HR0 W;  1PLF A;  1UE6 A;  4OIK A;  4MZ9 A;  3PO3 B;  5GAG C;  1G29 1;  1XNR L;  4HIO A;  1U4P A;  1SRU A;  3N6R A;  4FP5 D;  1B53 A;  3NPP A;  1A0I A;  3MXU A;  3PUZ A;  1VMC A;  1XX8 A;  2R3Z A;  1TS3 A;  2HUG A;  4XXE A;  2K5D A;  3SVM A;  1JWS D;  5C44 H;  1TU2 B;  1GOZ A;  4IUQ A;  4QGU A;  3FRP B;  2EYJ A;  3I91 A;  2MGS A;  3WOE A;  2FJ2 A;  1KAA A;  1XPU A;  4DFA A;  1DM0 B;  2EXD A;  4X66 L;  1XYI A;  1PFM A;  1Y14 B;  4QY7 A;  2PI2 A;  2CCZ A;  3KDF A;  1PTO C;  5KYI A;  5IGC A;  1GUT A;  5ISR A;  2DY8 A;  2ZT9 C;  1F2Y A;  4DU9 A;  3OTO L;  4KJO A;  2JA7 H;  1JE5 A;  1HZC A;  4DA2 A;  4BBR G;  4BY7 G;  4LK1 C;  5JJL A;  3DLL A;  1E24 A;  2RDG A;  1YNJ C;  2ALY B;  3S1M B;  1Q82 C;  3KFU A;  3K5M A;  5A35 A;  1QB5 D;  3HZX A;  2B63 H;  1SFO H;  2A19 A;  2PYK A;  5F2D A;  4OO1 G;  1O7Z A;  1WCM B;  1J6Q A;  2A6E C;  1RIP A;  3HFZ B;  1CQF A;  4P71 A;  5AJ3 L;  2CQA A;  4RHS A;  1NJI C;  1VQ7 A;  1VQM A;  1DCZ A;  2MUY A;  4RKL A;  4ZQ3 A;  5LL6 S;  3STB C;  1TS5 A;  4DR1 Q;  2GVA A;  3GTG B;  1WD1 A;  4LFA Q;  4RKB A;  1IBM L;  1MHW C;  4IAL A;  4R4T A;  5E4W C;  4IUP A;  4FXD A;  2RA4 A;  2WB1 E;  4JBM A;  2F1M A;  1HHV A;  3M85 A;  1D1K A;  3S9W A;  3ERQ A;  4HJ5 A;  2IW3 A;  2I5H A;  1D5M C;  3TRE A;  1SE4 A;  4CDF C;  1Y8O B;  1PXU A;  4L5S A;  5M5X H;  2F0Q A;  3CCV A;  4LF5 Q;  5C3W A;  1Z47 A;  5ELB A;  3R8B A;  3J7A F;  3PIO A;  4WOR A;  4RCN A;  1GXD C;  4KKU A;  2LFN A;  2K52 A;  2K5W A;  5C0X G;  3MZ5 A;  4HCS A;  3A55 A;  2UXD L;  3RMH A;  1FNU A;  5M5W H;  2OTJ A;  3K59 A;  4K6L A;  3NBI A;  4A3L G;  1LAC A;  1Y1V G;  2Z0S A;  1EQT A;  3HOW B;  2OF1 A;  4JI0 L;  1BDO A;  1GUW A;  3NTI A;  1VS0 A;  4P72 A;  2EY2 A;  4A3K B;  4LNQ A;  3L3O C;  3A5U A;  3I4N G;  4BWG B;  4R4I A;  4QQB X;  2KCM A;  4X3T A;  3PO2 H;  3KBX A;  4L5R C;  2AQ1 B;  2WAQ B;  3K8A A;  1C4Q A;  1I4Q A;  2RDH A;  3BDO A;  5JJI A;  2R6G A;  1K83 H;  4A3F G;  1IW7 C;  3Q24 A;  4HAE A;  1BCP D;  3M4O H;  4LFB L;  5G3L D;  1E3P A;  3DEO A;  2KHI A;  1BBU A;  3KLS X;  3S1R B;  1FD7 D;  1HTL D;  3VR5 A;  2L12 A;  3P20 A;  2R92 B;  5C4X G;  5CV9 A;  1EWH A;  3G48 A;  1YJ9 A;  3K7U C;  4DR2 Q;  1YHB A;  1ZEQ X;  3QJY A;  1GKH A;  2WIN B;  4DR7 L;  1PZI D;  1PDQ A;  1F9Q A;  1XXG A;  5M5Y B;  4A3M H;  3BVG A;  1VQO A;  1WD0 A;  4B3M Q;  2Z1C A;  1HNX L;  1CZW A;  2ZJQ A;  2EYO A;  3HOY G;  3SK4 A;  1LTG D;  4IPC A;  1JT8 A;  2QF7 A;  1L1O A;  4EQO A;  3A7L A;  3CHB D;  2XGT A;  2JE6 I;  3I3C A;  1CKO A;  4DV0 L;  2R7Z G;  4LF9 Q;  3HOV B;  5LMU L;  1RTN A;  5KYL A;  2VQF L;  2NVT H;  4OWW B;  3Q6S A;  1LT3 D;  4IUR A;  3NSW A;  4C1N K;  1JIC A;  4RFB A;  3ERS X;  1JOR A;  2UUB L;  2IHE A;  3G7L A;  3T1Y Q;  3LWU A;  4DR6 Q;  2NVY H;  2CW0 C;  1GHJ A;  1PHJ A;  4HIK A;  3KBG A;  3ULL A;  3H0G B;  1WOC A;  4OIJ A;  4ZUJ A;  3ZJY C;  3J80 E;  4JI5 Q;  1XPO A;  1AE3 A;  2XNA C;  3FKI H;  5DLQ E;  5C44 B;  4KTA A;  4LJZ C;  1KAB A;  4G7Z C;  1QE6 A;  1EY7 A;  5AFW A;  4L8J A;  1VQC A;  2UXB L;  1DGS A;  4Q0F A;  1N34 Q;  2RBM A;  1Z6H A;  2XSC A;  5GAD C;  2G5D A;  2HHH Q;  5IT9 L;  3S1N H;  4RA8 A;  4JW0 A;  3HRZ C;  1OTC A;  1DON A;  3F2B A;  5KRU A;  5DM7 3;  4DV3 Q;  5I6Y A;  3CRL C;  1X3Q A;  2LY7 A;  2TMP A;  2JA7 B;  1MJE A;  4RWS C;  3K5O A;  1HH2 P;  1DYQ A;  1L2F A;  3L0O A;  1L0W A;  2QGQ A;  2BOS A;  1IHZ A;  1PFS A;  2V4D A;  1PRT F;  4KMU C;  3BZK A;  4C56 C;  2ZXO A;  3IFT A;  4A3I H;  1LM0 A;  2BE5 C;  1SR3 A;  3U4V A;  2K32 A;  1KNE A;  2F3V A;  1NE3 A;  1EY8 A;  4IPH A;  2IWH A;  3D0F A;  3MXN A;  4A3D G;  1S3O A;  5CYU A;  1FGU A;  1IYJ B;  2DN8 A;  4G4K A;  5D3I B;  2YTX A;  1XNR Q;  3GV3 A;  4JV5 L;  3PUV A;  1STB A;  4KK7 A;  1R9T H;  4QUF A;  1D6E C;  1H95 A;  2ZTE A;  1QWY A;  1U4R A;  5CV6 A;  2XIW A;  4A3J H;  5LL6 X;  1V43 A;  5ELN A;  3G4S A;  1GJX A;  1EEI D;  1KDB A;  1JB7 A;  3CF5 A;  1WTX A;  4GN5 A;  4HED A;  1K8A C;  2ZXP A;  1IL8 A;  2EY1 A;  1Z9F A;  1RD9 D;  3LNN A;  3CC4 A;  1D1I A;  4X66 Q;  2ASB A;  3DWA A;  5M5X B;  3FPP A;  3KLR A;  1TS2 A;  4LWC A;  2NN6 G;  3CPF A;  3BS1 A;  4DR3 Q;  4JI2 L;  5E1F A;  3PF5 A;  1ENC A;  3L9A X;  5M5W B;  3TBI B;  4B3T L;  3OTO Q;  4GKK L;  2B8F A;  2AHO B;  3MTS A;  3F2D A;  4GN4 B;  3S16 H;  1VQL A;  2C5C A;  4NPS A;  2F0F A;  3T13 A;  3H3V C;  4JOI C;  1X6O A;  4I7A A;  2YV5 A;  4R4Q A;  2ZJP A;  1NCV A;  4N8X 1;  3BDC A;  3PO2 B;  5JJK A;  3VR2 A;  1KQS A;  1K83 B;  1HZA A;  4YWM A;  4U68 A;  1B44 D;  3M4O B;  1JWM D;  1PRT B;  5AJ3 Q;  5J3B A;  4UAI A;  1KNA A;  3AYH B;  4JI1 Q;  3I4L A;  4JCV E;  3TRZ A;  4ODG A;  4G7O C;  3M3Y H;  2WB1 B;  2M9V A;  4FDB A;  2KBN A;  1YEZ A;  2EIF A;  1IBM Q;  1B2T A;  1JE4 A;  4OL7 A;  2MHV A;  2ZTD A;  1J8I A;  1W6K A;  4K2K A;  4A3M B;  3QOJ A;  2P5Z X;  3MFY A;  4C3H H;  3ITP A;  3UE1 A;  2F0N A;  1AZQ A;  1KAW A;  1NR4 A;  1ZXT A;  1J9O A;  1SMY D;  4TSS A;  2JXM B;  1HA6 A;  3VYS A;  1DOM A;  2A69 C;  2F0D A;  1SNC A;  4IUN A;  1LAB A;  1I50 H;  1ZYR C;  1AW7 A;  2K6A A;  2CVR A;  3UDX A;  1IKL A;  2KQ3 A;  4ZYS A;  2NVX H;  2O4X A;  3UDG A;  4ID6 A;  2UXD Q;  4ABN A;  3I70 A;  1STE A;  4ULL A;  1WTH A;  1X54 A;  2EYH A;  2NVT B;  5EGT A;  1STA A;  2Q2I A;  4ME5 A;  2RQX A;  2JA5 B;  5I9O A;  2Q2T A;  3NUC A;  4R4C A;  1TR5 A;  3DM3 A;  3E9I A;  3EQL C;  3NBH B;  5H1S E;  4JI0 Q;  4X3U A;  4X6A H;  4BBR H;  4I7Z C;  2SNS A;  2XTI A;  4KY5 A;  3R2I A;  4BY7 H;  5CGK A;  5C3E G;  5JEA J;  2NVY B;  4I65 A;  1B8A A;  1T5E A;  4GN3 B;  3TP5 A;  1YBY A;  2O5J C;  1SJH D;  4LFB Q;  1VQG A;  3WOF A;  3S14 H;  3FKI B;  4R1J A;  4OO1 H;  5HGT A;  4FF1 A;  3A8K E;  3W2D A;  2O2L D;  4DR7 Q;  5J22 A;  3I4M H;  5EJW A;  1STG A;  4PZ6 A;  4QUC A;  4DR5 L;  2KEN A;  2VW9 A;  4F7X A;  1HNX Q;  3S1N B;  2OEO A;  2ICE C;  1CQV A;  1O80 A;  4EQP A;  4NKL A;  1Q3L A;  3PIO 3;  2B2U C;  2H1E A;  4AIM A;  2R7F A;  3OHX C;  1UAP A;  2WKC A;  1ICW A;  1H9S A;  1JQY D;  1VQF A;  5JOB A;  1UEA B;  1EQR A;  4X62 L;  5DEH A;  4DV0 Q;  4AYB G;  3KJO A;  2R93 G;  1YNN D;  3M7G A;  5LMU Q;  2NVQ H;  4KN4 C;  4JVZ A;  2TSS A;  4X64 L;  5C0X H;  1QCB D;  4WFN 3;  4A3I B;  1DOK A;  1K8M A;  2UUA L;  2JA6 G;  5FKA C;  4A3L H;  2UUB Q;  1TWG H;  4KD3 A;  4NXM L;  3T53 B;  4CJ0 B;  5ELD A;  3NXW A;  1ASY A;  1HUN A;  1FNV A;  1G51 A;  1HNW L;  1B9N A;  1R9T B;  1T5X D;  3CCQ A;  2F0I A;  1IYV A;  3I4N H;  4DR4 L;  3TP6 A;  1K0S A;  2Z6K C;  1LTR D;  4A3J B;  4DV7 L;  3OIQ A;  1F2M A;  1VQE A;  1WTR A;  1NSN S;  3A0J A;  4HIM A;  4A3F H;  2UXB Q;  4LF8 L;  4IFD H;  2XVS A;  3HKZ G;  3N52 A;  1ENA A;  1S40 A;  3ERO A;  4OWT B;  1MBY A;  1BBW A;  1F9P A;  2PNH A;  1XPR A;  1F9S A;  3OYY A;  1STH A;  1DZ1 A;  1MJC A;  1M8A A;  3LX0 A;  5LMN L;  2AQ2 B;  3PUX A;  4A75 A;  1Y1W G;  2B2W C;  2DJG C;  1WTW A;  3HOY H;  4MN3 A;  5FLX L;  3HOX G;  3S16 B;  2CH4 A;  2I5L X;  5C3X A;  2K5H A;  1D5X C;  1X55 A;  3D4W A;  1RCV D;  1JOK A;  5J39 A;  3C46 A;  3VA7 A;  1L0X B;  1OXX K;  3GTK H;  1BUV T;  2R7Z H;  3NHH A;  2A6H C;  4HJ8 A;  3ND9 A;  2OXP A;  4H0L C;  1N32 L;  1AP0 A;  1O7L A;  2J0T D;  2MNA A;  3IRB A;  2KCC A;  2A8V A;  1OXV A;  4O2D A;  3J80 c;  4JV5 Q;  4RGO S;  3AQQ A;  3EFX D;  4A4I A;  4XQN A;  2FXQ A;  4Z9C B;  4QB4 A;  2MP1 A;  3M3Y B;  2JA8 G;  2FHT A;  1Q8K A;  3ZYY X;  4DV2 L;  2ID0 A;  4P74 A;  1JB3 A;  1LT4 D;  3AFP A;  5IYB H;  2QEJ C;  3PF4 A;  5M3M B;  1HZB A;  4C3H B;  4L63 B;  1AEX A;  2D62 A;  4JI7 L;  5JEA G;  2ZM6 L;  2PMZ E;  5DM6 3;  4NP5 A;  5GAE C;  3J81 j;  3C2P A;  1PMR A;  4UP7 A;  3A8J E;  3EN2 A;  5IGE A;  1HA5 A;  1I50 B;  1BQQ T;  1EZ8 A;  3JC6 6;  1FVI A;  4JI2 Q;  1CT1 D;  2NVX B;  1H9K A;  1T9H A;  1VQJ A;  3X3M A;  4B3T Q;  4GKK Q;  1YIJ A;  1PH6 A;  1MI2 A;  2H5X A;  1KDC A;  4OWX B;  3S2D H;  3BVM A;  1LTB D;  3E3X A;  4OO1 I;  1LLR D;  1PYS B;  2A73 B;  3X3N A;  1G6Z A;  3SK5 A;  3GQB A;  1VQK A;  2A5H A;  1PA6 A;  4YCU A;  4BBR B;  4A76 A;  4BY7 B;  3J80 i;  5COR A;  3TP7 A;  3MHB A;  4JG2 A;  4CGY B;  3EVQ A;  1J5E L;  3NK9 A;  1LO5 D;  2B2Y C;  3PGZ A;  2ATW A;  3MFG A;  2PNR C;  5C5M A;  4UDU C;  2K4K A;  1VQH A;  4UY8 C;  1EYC A;  1VQN A;  2RVL A;  3S14 B;  4DUY L;  2IX3 A;  2YU9 B;  2KJX A;  3IKJ A;  4IJH A;  3RZD B;  2MO1 A;  3UI2 A;  4DF7 A;  1X56 A;  4LUZ A;  5EQ0 A;  2K33 A;  3I4M B;  5C0X I;  3RN2 A;  4PG3 A;  1QIL A;  1CA5 A;  1ASZ A;  1BCP C;  1HZ9 A;  1R4P B;  3C1F A;  4Q5V A;  3J7A 5;  3CCS A;  3P7J A;  3H94 A;  2MQH A;  2C9O A;  2L5T A;  1FJG L;  1XNQ L;  2F0E A;  4K2L A;  3SK8 A;  3ICE A;  2EJF C;  1PRT C;  1KLU D;  1PYW D;  4POG A;  1BO0 A;  4OEM B;  2NVQ B;  1TQO A;  4RG1 A;  2NN6 H;  2HIV A;  4AQY L;  3OOC A;  1WTO A;  1E2Z A;  2BCO A;  4IFD I;  4JI6 L;  2DNC A;  2I5M X;  4DAY A;  1Q90 A;  1TWG B;  3I73 A;  1LTI D;  4MTN A;  1Y69 U;  2C35 B;  3AU7 A;  3MWY W;  4J6H A;  1R4Q B;  2A68 C;  3CCE A;  1TVX A;  1I94 L;  3I56 A;  2ICI A;  1EYD A;  4KJN A;  3BDL A;  1E1T A;  4FNF A;  4XQQ A;  2K5Q A;  3I4N B;  5DNF A;  3PIP 3;  4YY3 L;  3AB9 A;  4A3G H;  3AMU A;  4A3F B;  2PI2 E;  5JVG 3;  1K3B C;  4CJ1 B;  2EY5 A;  1XMQ L;  2VUM G;  1CKM A;  1NAP A;  1RF2 D;  4LAA A;  1CKN A;  3ONA B;  5EKL A;  1V1P A;  3NEN A;  4X65 L;  2O5I C;  2B2V C;  1I4P A;  4TRD A;  5ELO A;  4DR5 Q;  2UU9 L;  1MD2 D;  3VYT A;  5C6A A;  2KOL A;  4EX5 A;  5CV7 A;  2KA7 A;  2JA9 A;  1K9M C;  4K8J A;  3KYH C;  3BG3 A;  2KCT A;  2L4N A;  3QB3 A;  4B08 A;  1KD1 C;  3HOY B;  1NY4 A;  1C7Y A;  5LHY 1;  4HJ9 A;  4DUZ L;  4X62 Q;  2GVB A;  3RUZ A;  2G9D A;  4KV6 A;  4BXX G;  4A3E G;  1P16 A;  2DGY A;  1LTT D;  3HEJ A;  4YHH L;  3B6Y A;  4QIW E;  5M9O A;  1BVS A;  3CW2 C;  4KHP L;  1Q1E A;  3OW7 A;  4X64 Q;  4DV1 L;  1L0Y B;  3GTK B;  2R7Z B;  4K8I A;  3BVZ A;  1M90 C;  1I4G A;  3A8I E;  2RHS B;  3WWV A;  2UUA Q;  1EY4 A;  2IPK D;  1LT6 D;  1UUP A;  1AE2 A;  4NXM Q;  1DOL A;  1ML0 D;  1RJT A;  3I4O A;  3S15 H;  1IXR A;  5J1Z A;  1PTO D;  4NB3 A;  2LKV A;  3DEP A;  1VQP A;  4B9W A;  1HNW Q;  1TWC H;  3FP9 A;  5CC4 A;  5KEE A;  2HDL A;  1JJ2 A;  3TZD A;  1Q12 A;  4FYD A;  1FL0 A;  4JI3 L;  2VS1 A;  5HUR A;  5C3E H;  4DR4 Q;  2D5D A;  3Q8D A;  5IE8 A;  1CSP A;  4HSP A;  4DV7 Q;  1QJO A;  4KHZ A;  1N36 L;  1XTC D;  2MJ8 A;  4WJ4 A;  4H13 C;  3V2T A;  2NBF A;  3NE5 B;  4LUV A;  3E0J A;  3I55 A;  4P2C B;  3IFD A;  4BBS B;  1QNU A;  3H6M A;  2K04 A;  3KF8 A;  3BZD B;  5IYC G;  4QL5 A;  4RCO A;  3CPW A;  2EZV A;  3GTM H;  1HUM A;  2IL8 A;  1D8L A;  2X69 A;  3RNU A;  4A3K G;  3I90 A;  3K80 C;  1SNO A;  5IY0 A;  5LMN Q;  2Y0S E;  1SNM A;  2M00 A;  3STB D;  1KRS A;  3S2D B;  1HTP A;  3S1Q H;  1ET9 A;  3GTJ H;  4DK3 C;  1QZH A;  1F9R A;  1BKB A;  3KF6 B;  2D0P A;  2R92 G;  3MC0 B;  2LXJ A;  2R93 H;  4B3R L;  1PZJ D;  4GOP B;  2OTL A;  4DV4 L;  3JAM c;  1N32 Q;  2IX0 A;  3RLO A;  5C4Z A;  2AUK A;  3E6Z X;  5A2Q E;  4O0A A;  3ULJ A;  4YCV A;  4P75 A;  3TP8 A;  1QVC A;  3GV6 A;  1LYL A;  1PFB A;  4CDE C;  5I4D A;  2JA6 H;  3EIV A;  4L5T A;  5EBD A;  4PQX A;  2VXW A;  1K0R A;  1V9P A;  1U0L A;  1BCP F;  1HCZ A;  5G3L F;  1A2T A;  2IHF A;  5C4J H;  1I4X A;  3FMC A;  4DV2 Q;  2PMZ B;  4YIJ A;  3CD6 A;  2NN6 I;  1X65 A;  2N78 A;  2Z4I A;  4JI7 Q;  4NDX A;  3U58 A;  1MSG A;  3F2U A;  2EQS A;  1HR0 L;  1AH9 A;  2OT2 A;  1GUO A;  4DGZ A;  2IY5 B;  4PMB A;  1IW7 D;  3OW2 A;  3EBE A;  2B63 B;  2F0T A;  4M1U B;  4PZ8 A;  1SFO B;  4ZKB B;  4XQJ A;  4Y7N H;  4JC0 A;  3G71 A;  3BJU A;  2JSO A;  3GDE A;  3JAM i;  3H0G G;  2J7Z A;  2XRS D;  5IT9 c;  1QVF A;  1Y1W H;  4FVM A;  2I07 B;  5EPJ A;  1XMO L;  5LMN W;  3TME A;  4A3B G;  3HOX H;  3T16 A;  1HQM C;  1ET6 A;  5IIF A;  3L2P A;  1J5E Q;  3PCO B;  1QNK A;  3J81 E;  4WJ3 M;  1SRO A;  2EJM A;  3VR4 A;  1N9W A;  3TN2 A;  1RL2 A;  4DUY Q;  4P73 A;  1B50 A;  4JOI A;  4DV6 L;  2PQE A;  1V1Q A;  5IGB A;  5DAU A;  4A3G B;  5CR3 A;  4POF A;  1YNX A;  1A8V A;  1WI5 A;  4IUT A;  2WV6 D;  2K5V A;  1YIT A;  2F0W A;  3A54 A;  1YJW A;  1EY0 A;  4IJL A;  3HKS A;  5HY6 A;  1SND A;  2JEB I;  2KED A;  2JA8 H;  4A93 H;  4XT3 B;  5CMD A;  4HJA A;  4HMJ A;  2CW0 D;  4GNX B;  2BA1 A;  2HD3 A;  1BCP B;  1IKM A;  1II3 A;  5JEA H;  3BZC A;  4APV A;  3U9S A;  1VDZ A;  1YHQ A;  1B4O A;  1CA6 A;  3P75 A;  5L37 A;  4IO9 A;  1ENF A;  1Q86 C;  3SXH A;  3NWT A;  4XYO A;  4JI4 L;  2KVM A;  4IQZ A;  4AQY Q;  1WTQ A;  3PUY A;  4JI6 Q;  2D2C C;  3I8Z A;  1U5K A;  2EVB A;  2QA4 A;  3TDQ A;  4K5X A;  3S15 B;  4K14 A;  2I0Q A;  1I94 Q;  1SMX A;  2Z8L A;  1TWC B;  2EPB A;  1TT2 A;  2RSO A;  3M4Q A;  1WTV A;  2WFW A;  5FO9 B;  1I3Q H;  5C3E B;  5IGD A;  3KDF B;  5T1I A;  4FXG C;  4KY7 A;  4YY3 Q;  1G8Z D;  1FR3 A;  3C1E A;  4HR7 B;  3CCU A;  3M4Y A;  2NUC A;  2FIN B;  4GLA C;  4JBW A;  4F87 A;  3LWE A;  4GS3 A;  1BBX C;  1HJP A;  1HFN A;  2ZTC A;  2H4O A;  1XMQ Q;  4GKJ L;  4C1N I;  1UE7 A;  1VQ9 A;  2UU9 Q;  3PQI A;  4DNR B;  2A74 C;  3GTL H;  3A74 A;  4PZ7 A;  4CDD C;  5GAH C;  1VQD A;  1CHQ D;  3Q22 A;  5FK9 C;  4BY1 G;  4QIW B;  3VR6 A;  4J1M A;  3G6J B;  1BNZ A;  1YHA A;  4DUZ Q;  3S1Q B;  3NQT A;  5NUC A;  3ULP A;  4QCL A;  4V19 0;  1FNW A;  1GO3 E;  2X6L A;  2X6G A;  5FLM G;  2B2U A;  5I2X A;  4R4O A;  1A6X A;  1SEB D;  3KOJ A;  4EGV A;  4C3I G;  4KHP Q;  3GP7 A;  5KIX A;  4DV1 Q;  2R93 B;  1F77 A;  2KEC A;  3VDY A;  1SE3 A;  1RKN A;  2A1A A;  2K03 A;  2GA4 B;  2UUC L;  3UDF A;  4LFA L;  5ELF A;  1VQ6 A;  1PVO A;  2PQA B;  3OWE B;  3MVV A;  2JA6 B;  1Q1B A;  1X3P A;  3I72 A;  4N9T A;  1V8Q A;  3CU7 A;  1EFW A;  4ILW A;  4OHJ A;  2KEE A;  2JJQ A;  2AWN A;  4JI3 Q;  5C4J B;  1V1O A;  3OWF A;  2D9U A;  4F8M A;  1ESR A;  1N36 Q;  3H91 A;  1KDA A;  4C2M H;  1HNZ L;  3M9B A;  2IT1 A;  2JA5 G;  2VL6 A;  2Z6K A;  2Y0S B;  1EUJ A;  1VQI A;  2VQF Q;  4LUO A;  4YWL A;  3T56 B;  2VUM H;  4FF3 A;  2QDB A;  1KTK A;  3DXJ C;  2ZJR A;  2B3G A;  3J7Y W;  2SNM A;  4Y7N B;  3O13 A;  4G57 A;  4CBV A;  1KLG D;  1Y1V H;  1C9O A;  1MIU A;  1UE5 A;  1PH2 A;  2R7D A;  3FEW X;  2JN4 A;  3JAM E;  2AMC B;  3FKI G;  1U9R A;  1Y1W B;  3KK7 A;  5IYD G;  2B2T C;  3MEF A;  1OXU A;  3HOX B;  3T1H L;  2ES2 A;  2B2W A;  4BXX H;  4B3R Q;  4A3E H;  1DJR D;  3R2T A;  4DV4 Q;  4PMW A;  2K28 A;  3R3O A;  2Z6B A;  2A69 D;  1VQB A;  4OXP A;  3GTG H;  3QIA A;  3BU2 A;  2BH8 A;  5C4X H;  4KHV A;  1PH3 A;  3W5O A;  1SLJ A;  1SXT A;  5JVH 3;  1X32 A;  4B3M L;  1PH1 A;  3RR5 A;  2EYL A;  4CHT B;  4R8I A;  2EE1 A;  1MKH A;  2JA8 B;  4A93 B;  3GTQ H;  4RGT A;  4IZ8 A;  4LFC L;  5CBE E;  5IOC A;  1MGS A;  1SN8 A;  3J80 L;  1HR0 Q;  2LS0 1;  2SDF A;  3KLS A;  4GOP C;  4ZCK A;  5KNB A;  4GLV B;  5K36 G;  2F0U A;  1CFM A;  2Z9H A;  1NTG A;  3URY A;  3M4P A;  1A62 A;  2K50 A;  5IT9 E;  2F0G A;  1N33 L;  4LF4 L;  1A15 A;  1YJN A;  2JYO A;  1VQ8 A;  2CFM A;  5IGF A;  3I2Z A;  2RSN A;  4IUU A;  1SYF A;  4OEL B;  5D65 A;  4A3J G;  4C3J G;  3DWQ A;  3W1B A;  3HOU G;  1EIF A;  2XRQ D;  2JK8 A;  2FMM A;  2F4I A;  1I4H A;  3NEL A;  1SAP A;  2BA0 A;  1TY2 A;  2RCN A;  3CAM A;  2NTT A;  3FVQ A;  2ZXR A;  1EWI A;  1N34 L;  3SHL A;  3RD4 A;  4DV6 Q;  5IP7 G;  4WRD A;  4MHE A;  2EJG C;  5M3F G;  3MEH A;  2B2Y A;  3EJI A;  4R8N A;  1CI3 M;  2PW5 A;  3K7A H;  2HQL A;  1G6P A;  3A7A B;  4WJW A;  3T51 B;  3J7A V;  2CHB D;  1S5E D;  1Y8N B;  3D6C A;  3GTL B;  3CCJ A;  1E2V A;  4S3S A;  1X3F A;  4IFD J;  5EAY A;  1VQ5 A;  4RH6 A;  1H9R A;  4RGN A;  1NBW A;  2UXC L;  1RDP D;  2E8G A;  2QIL A;  3S2H H;  2DNE A;  5IP9 G;  2KHS A;  5C5L A;  1GHK A;  1WFQ A;  3TQY A;  2HIX A;  3Q0A A;  3F1Z A;  4JI4 Q;  5BN5 A;  2K5N A;  2LMC B;  3CQZ H;  3SEB A;  5CBA E;  1WYD A;  2N8N A;  4XTC S;  2RKS A;  1LTS D;  5I9P A;  4A3D H;  5M3M G; 
#chains in the Genus database with same CATH homology
 4C3H G;  5IOD A;  1AZP A;  4DK1 A;  5TSS A;  2MPM A;  4IN3 A;  1RTO A;  4XT1 B;  4FF4 A;  1EU4 A;  3E5S A;  1HXY D;  1IYU A;  1TII D;  3C3L A;  3TSS A;  1UNS A;  1VF5 C;  4C2M B;  1CHP D;  3DHQ A;  2DY7 A;  5FOB B;  2JEA I;  1EFI D;  1JR0 D;  1I4R A;  4TKO B;  3WDN A;  5JAV A;  2A6H D;  5EPL A;  3D31 A;  5COY A;  2VUM B;  1BR9 A;  4QF4 A;  2YYZ A;  5JPM C;  3IL8 A;  1ONL A;  1Y1V B;  2B2V A;  3NBH A;  5KND A;  1STN A;  2IJ0 A;  1OXS C;  3V05 A;  1HPC A;  4XIG S;  2NTS A;  4A3E B;  1TS4 A;  2N55 A;  3CRK C;  1ILQ A;  4XYQ A;  3HGB A;  1A3T A;  1G2T A;  3SDZ A;  4PNY A;  5C4X B;  2BDN A;  2SEB D;  1MSH A;  2L9H A;  2E2D C;  1OO9 B;  1ESF A;  4NW2 A;  4KY6 A;  2FMC A;  4EQN A;  2E76 C;  1JOO A;  3GTQ B;  4O42 A;  1STY A;  3SE0 A;  4U67 3;  3VYR A;  3D6W A;  1PTO H;  1SJE D;  2QCP X;  3K58 A;  2Q8I B;  3D3R A;  1QG7 A;  2WP8 J;  4CKE A;  3K6O A;  2VB2 X;  5ELC A;  1GUN A;  2K7V A;  4X3K A;  1H9M A;  1SYC A;  1TKW B;  3D4D A;  4IFD G;  3K5L A;  3A56 A;  2FFK B;  1YNJ D;  4N9P A;  5I6W A;  1JC7 A;  2EY6 A;  1PRT D;  1HQR D;  4XDX A;  1O78 A;  1H9S B;  3K7A B;  1CM9 A;  2A6E D;  1EQV A;  1FYC A;  3JAM L;  1JOQ A;  2RDF A;  3MA2 B;  2K05 A;  1B3A A;  3MXG A;  1D2B A;  2A68 D;  4L6T B;  4CKC A;  3Q23 A;  5D14 A;  1EIG A;  4NMZ A;  2L11 A;  2Q8T A;  3S2H B;  2EXZ A;  1EIH A;  1CZG A;  4PMC A;  3NTH A;  4ZK9 B;  2K1B A;  4DXF A;  4K6D A;  1SE2 A;  4K5W A;  4KD4 A;  1U4M A;  4ZRZ A;  5K5P A;  3CQZ B;  1PFN A;  3IAY A;  4J8Q A;  1A3V A;  1FGB D;  1G2S A;  1Z7T A;  1SNP A;  5FLX E;  4A3D B;  5BN4 A;  3R93 A;  1M4V A;  2F0L A;  1CK1 A;  3MXP A;  4X3S A;  4A3B B;  3DWP A;  4DXG A;  1PTO F;  2G9H D;  3ND8 A;  1NUC A;  4E6I A;  3DM1 A;  5JPN C;  3DMU A;  2PW7 A;  4DN4 M;  1VF7 A;  5EKK A;  2XN9 C;  4MIU A;  1SYB A;  2K01 A;  4ZLT F;  2L1B A;  4KI0 A;  1OXT A;  4ZAI A;  1LT5 D;  4IUV A;  1SMY C;  1PZK D;  1S5D D;  3RZO B;  4RGM A;  1ZKO A;  3L7Z C;  4FF2 A;  1VMP A;  3FPU B;  5K36 H;  4HN7 A;  2F0O A;  3HG9 A;  2F0H A;  1A2U A;  4KKS A;  1SYG A;  4F88 A;  5E4X A;  2E74 C;  1QOH A;  2HDM A;  3GD7 A;  3W3A A;  2B39 A;  5CV5 A;  1SBB B;  5IGG A;  2PZU A;  1TWF B;  5ELE A;  4DAV A;  1C48 A;  2AQ3 B;  2EDG A;  1C8C A;  2HCI A;  3K0Y A;  2EYP A;  2B8G A;  1LV9 A;  3PV0 A;  1W6J A;  2L55 A;  3RLF A;  2WKD A;  1PTO B;  5FO8 B;  2E2J B;  2KCN A;  1HFG A;  2BDO A;  5EKI A;  1EEF D;  2M2L A;  2VNU D;  1A3U A;  1EY6 A;  4HTH A;  3U9O A;  2F0S A;  4QMG A;  2PO4 A;  4FXK C;  3GTP B;  1YNN C;  1SYD A;  4BY1 B;  3VYU A;  3M7N A;  3CKI B;  4KN7 C;  3SK6 A;  1DD2 A;  3PMF A;  1HRJ A;  1F2Z A;  1AN8 A;  4C3I B;  4BA2 I;  1EWC A;  4G7H C;  1K8O A;  1TWH B;  5I2Y A;  2BE5 D;  4B9X A;  1EU3 A;  2F03 A;  3GTM B;  3HS0 C;  1I6V C;  3BYY B;  3NP8 A;  5E3F A;  2E2H B;  4BA1 I;  2JP1 A;  1B9M A;  3OPO A;  3GTO B;  3GTJ B;  1D5Z C;  4JK1 C;  4AYB B;  2E2I B;  1CTM A;  1AFP A;  2I46 A;  2NB0 A;  3NWS A;  1S5F D;  2EOT A;  2WII B;  3DUZ A;  4CJ2 C;  4GZY C;  2ENB A;  5C4H A;  2F0P A;  1ROD A;  4KKT A;  2XWB B;  3BYT B;  3OMC A;  3FDT A;  3K5N A;  4H7B A;  5KNC A;  2HCC A;  4R9W A;  3V96 A;  1V1P B;  3D4R A;  4CKB A;  2B2T A;  1VCI A;  3QG1 A;  1SNQ A;  2J4X A;  2VB3 X;  1O7Y A;  1BXT A;  3HKZ B;  4H44 C;  2PZW A;  3VA5 A;  4O1N A;  3VR3 A;  2F0V A;  2E75 C;  2PCF B;  3OSO A;  4LMQ D;  2QKI C;  1EYA A;  2Q8R E;  1F2L A;  1Q8I A;  1EY5 A;  2HQE A;  1WVL A;  5EBC A;  5JJZ A;  4K5V A;  1RHP A;  3HP3 A;  1NR2 A;  1Y8P B;  5CV8 A;  5FO7 B;  3GO5 A;  1ZYR D;  3H09 A;  5T1G A;  4ZUI A;  4DNT B;  2F0J A;  4HSV A;  4EVO A;  3PUW A;  4HMI A;  3D8G A;  1EL0 A;  1U4L A;  1SDF A;  3OMG A;  1S4Z A;  4BS9 A;  1EOT A;  4C3J B;  4PV1 C;  3HOU B;  5KGU A;  1TWA B;  3MAQ A;  1I6H B;  4DK0 A;  1WTP A;  3NQI A;  2F3W A;  1BF4 A;  1E2W A;  4TQU S;  2AWO A;  5EPK A;  1GUS A;  5A2Q L;  5M3F B;  2R61 A;  2WAC A;  1BOS A;  2NZ1 D;  3P1H A;  1SYE A;  2L0C A;  2XWJ B;  2EYM A;  2F0K A;  2SOB A;  3SR1 A;  3S17 B;  1ILP A;  1XWE A;  3T4A C;  4RAU C;  1EY9 A;  1EZ6 A;  2NWG A;  2KUM A;  5C0X J;  4DAP A;  1S5C D;  3K57 A;  3EA6 A;  1I3Q B;  3NTK A;  4V0B A;  2N88 A;  4RHR A;  3QO2 A;  4M8A A;  1JCK B;  1GUG A;  3TZU A;  2IX1 A;  2EYF A;  1SSO A;  2AUJ D;  1S5B D;  3HOZ B;  2PZT A;  3OIP A;  5D3D A;  4ZKC B;  3QOL A;  2NYZ D;  1TY0 A;  3QWN A;  5BN3 A;  1JWU D;  1H9J A;  3KUP A;  1B1Z A;  3J81 L;  4OGQ C;  2Z4H A;  2F0M A;  1G91 A;  1E0B A;  1DXM A;  4HCE A;  4FO2 A;  1LTA D;  2PPB C;  5CV4 A;  1PLF A;  4OIK A;  3PO3 B;  1G29 1;  1U4P A;  3N6R A;  4FP5 D;  1B53 A;  3NPP A;  3MXU A;  3PUZ A;  1VMC A;  1XX8 A;  2R3Z A;  1TS3 A;  2HUG A;  4XXE A;  2K5D A;  3SVM A;  1JWS D;  1TU2 B;  1GOZ A;  4IUQ A;  3FRP B;  2EYJ A;  3I91 A;  2MGS A;  3WOE A;  2FJ2 A;  1KAA A;  4DFA A;  1DM0 B;  1XYI A;  1PFM A;  1PTO C;  5KYI A;  5IGC A;  1GUT A;  5ISR A;  2DY8 A;  2ZT9 C;  1F2Y A;  4DU9 A;  4KJO A;  4DA2 A;  4LK1 C;  2RDG A;  1YNJ C;  3S1M B;  3K5M A;  5A35 A;  1QB5 D;  3HZX A;  2PYK A;  5F2D A;  4OO1 G;  1O7Z A;  1WCM B;  2A6E C;  1CQF A;  2CQA A;  4RHS A;  1DCZ A;  2MUY A;  4RKL A;  4ZQ3 A;  5LL6 S;  1TS5 A;  3GTG B;  1WD1 A;  4RKB A;  4IAL A;  5E4W C;  4IUP A;  4FXD A;  2RA4 A;  2F1M A;  1HHV A;  3M85 A;  1D1K A;  3S9W A;  3ERQ A;  2IW3 A;  1D5M C;  1SE4 A;  1Y8O B;  1PXU A;  2F0Q A;  5C3W A;  1Z47 A;  5ELB A;  3R8B A;  3J7A F;  4WOR A;  4RCN A;  1GXD C;  4KKU A;  2LFN A;  2K5W A;  5C0X G;  3MZ5 A;  4HCS A;  3A55 A;  3RMH A;  1FNU A;  3K59 A;  4K6L A;  3NBI A;  1LAC A;  1EQT A;  3HOW B;  2OF1 A;  1BDO A;  1GUW A;  3NTI A;  2EY2 A;  4A3K B;  3L3O C;  4BWG B;  4X3T A;  3KBX A;  2AQ1 B;  2WAQ B;  1C4Q A;  1I4Q A;  2RDH A;  3BDO A;  2R6G A;  1IW7 C;  3Q24 A;  4HAE A;  1BCP D;  5G3L D;  3DEO A;  3KLS X;  3S1R B;  1FD7 D;  1HTL D;  3VR5 A;  2L12 A;  3P20 A;  2R92 B;  5CV9 A;  1EWH A;  1ZEQ X;  3QJY A;  2WIN B;  1PZI D;  1PDQ A;  1F9Q A;  1XXG A;  5M5Y B;  3BVG A;  1WD0 A;  2Z1C A;  1CZW A;  2EYO A;  3SK4 A;  1LTG D;  2QF7 A;  4EQO A;  3A7L A;  3CHB D;  2JE6 I;  3I3C A;  3HOV B;  1RTN A;  5KYL A;  3Q6S A;  1LT3 D;  4IUR A;  3NSW A;  4C1N K;  1JIC A;  4RFB A;  1JOR A;  3G7L A;  3LWU A;  2CW0 C;  1GHJ A;  3KBG A;  3H0G B;  3J80 E;  4OIJ A;  4ZUJ A;  2XNA C;  5C44 B;  4KTA A;  4LJZ C;  1KAB A;  4G7Z C;  1QE6 A;  1EY7 A;  5AFW A;  4L8J A;  4Q0F A;  2RBM A;  1Z6H A;  2XSC A;  5IT9 L;  4RA8 A;  3HRZ C;  1DON A;  5KRU A;  5DM7 3;  5I6Y A;  3CRL C;  1X3Q A;  2LY7 A;  2TMP A;  2JA7 B;  4RWS C;  3K5O A;  1DYQ A;  2BOS A;  1IHZ A;  2V4D A;  1PRT F;  4KMU C;  4C56 C;  2ZXO A;  3IFT A;  2BE5 C;  2K32 A;  1KNE A;  2F3V A;  1EY8 A;  2IWH A;  3MXN A;  5CYU A;  2DN8 A;  4G4K A;  5D3I B;  3GV3 A;  3PUV A;  1STB A;  4KK7 A;  4QUF A;  1D6E C;  1QWY A;  1U4R A;  5CV6 A;  2XIW A;  5LL6 X;  1V43 A;  1GJX A;  1EEI D;  1KDB A;  1WTX A;  4HED A;  2ZXP A;  1IL8 A;  2EY1 A;  1RD9 D;  3LNN A;  1D1I A;  3DWA A;  5M5X B;  3FPP A;  3KLR A;  1TS2 A;  2NN6 G;  3BS1 A;  5E1F A;  1ENC A;  3L9A X;  5M5W B;  3TBI B;  2B8F A;  3MTS A;  2C5C A;  2F0F A;  3T13 A;  3H3V C;  1NCV A;  3BDC A;  3PO2 B;  3VR2 A;  1K83 B;  4U68 A;  1B44 D;  3M4O B;  1JWM D;  1PRT B;  4UAI A;  1KNA A;  3I4L A;  4ODG A;  4G7O C;  2WB1 B;  2M9V A;  1B2T A;  1JE4 A;  4OL7 A;  2MHV A;  1J8I A;  1W6K A;  4K2K A;  4A3M B;  3QOJ A;  3MFY A;  3ITP A;  2F0N A;  1AZQ A;  1NR4 A;  1ZXT A;  1J9O A;  1SMY D;  4TSS A;  2JXM B;  1HA6 A;  3VYS A;  1DOM A;  2A69 C;  2F0D A;  4IUN A;  1SNC A;  1LAB A;  2K6A A;  1ZYR C;  1AW7 A;  2CVR A;  1IKL A;  2KQ3 A;  4ZYS A;  2O4X A;  4ID6 A;  4ABN A;  3I70 A;  1STE A;  4ULL A;  2EYH A;  2NVT B;  5EGT A;  1STA A;  4ME5 A;  2RQX A;  2JA5 B;  5I9O A;  3NUC A;  1TR5 A;  3EQL C;  4X3U A;  4I7Z C;  2SNS A;  4KY5 A;  3R2I A;  5CGK A;  5JEA J;  2NVY B;  4I65 A;  1T5E A;  3TP5 A;  2O5J C;  1SJH D;  3WOF A;  3FKI B;  4OO1 H;  5HGT A;  4FF1 A;  3A8K E;  3W2D A;  2O2L D;  5J22 A;  5EJW A;  1STG A;  4QUC A;  4F7X A;  3S1N B;  2OEO A;  2ICE C;  1CQV A;  1O80 A;  4EQP A;  4NKL A;  1Q3L A;  3PIO 3;  2B2U C;  2H1E A;  3OHX C;  1UAP A;  2WKC A;  1ICW A;  1H9S A;  1JQY D;  5JOB A;  1UEA B;  5DEH A;  1YNN D;  3M7G A;  4KN4 C;  2TSS A;  5C0X H;  1QCB D;  4WFN 3;  4A3I B;  1DOK A;  1K8M A;  5FKA C;  4KD3 A;  3T53 B;  4CJ0 B;  5ELD A;  3NXW A;  1HUN A;  1FNV A;  1B9N A;  1R9T B;  1T5X D;  2F0I A;  1IYV A;  3TP6 A;  1LTR D;  4A3J B;  3OIQ A;  1F2M A;  1WTR A;  1NSN S;  4IFD H;  2XVS A;  3N52 A;  1ENA A;  3ERO A;  1MBY A;  1F9P A;  1F9S A;  1STH A;  1DZ1 A;  1M8A A;  3LX0 A;  2AQ2 B;  3PUX A;  2B2W C;  1WTW A;  4MN3 A;  5FLX L;  3S16 B;  5C3X A;  1D5X C;  3D4W A;  1RCV D;  1JOK A;  5J39 A;  3C46 A;  3VA7 A;  1L0X B;  1OXX K;  1BUV T;  3NHH A;  2A6H C;  3ND9 A;  2OXP A;  4H0L C;  1AP0 A;  1O7L A;  2J0T D;  2KCC A;  1OXV A;  4RGO S;  3EFX D;  4XQN A;  4Z9C B;  4QB4 A;  2MP1 A;  3M3Y B;  2FHT A;  3ZYY X;  2ID0 A;  1JB3 A;  1LT4 D;  2QEJ C;  5M3M B;  4C3H B;  4L63 B;  1AEX A;  2D62 A;  5JEA G;  5DM6 3;  4NP5 A;  3C2P A;  1PMR A;  3A8J E;  5IGE A;  1HA5 A;  1I50 B;  1BQQ T;  1EZ8 A;  1CT1 D;  2NVX B;  1H9K A;  3X3M A;  1MI2 A;  1KDC A;  3BVM A;  1LTB D;  4OO1 I;  1LLR D;  2A73 B;  3X3N A;  1G6Z A;  3SK5 A;  3GQB A;  2A5H A;  4BBR B;  4BY7 B;  5COR A;  3TP7 A;  3MHB A;  4CGY B;  3EVQ A;  3NK9 A;  1LO5 D;  2B2Y C;  3MFG A;  2PNR C;  5C5M A;  4UDU C;  1EYC A;  2RVL A;  3S14 B;  2IX3 A;  2YU9 B;  2KJX A;  3IKJ A;  3RZD B;  3UI2 A;  4DF7 A;  5EQ0 A;  2K33 A;  3I4M B;  5C0X I;  1QIL A;  1CA5 A;  1BCP C;  1R4P B;  3C1F A;  4Q5V A;  3P7J A;  3H94 A;  2C9O A;  2L5T A;  2F0E A;  4K2L A;  3SK8 A;  2EJF C;  1PRT C;  1KLU D;  1PYW D;  1BO0 A;  2NVQ B;  1TQO A;  2NN6 H;  3OOC A;  1WTO A;  1E2Z A;  2BCO A;  4IFD I;  2DNC A;  4DAY A;  1Q90 A;  1TWG B;  1LTI D;  3I73 A;  1Y69 U;  3AU7 A;  3MWY W;  4J6H A;  1R4Q B;  2A68 C;  1TVX A;  2ICI A;  1EYD A;  4KJN A;  3BDL A;  4FNF A;  4XQQ A;  2K5Q A;  3I4N B;  5DNF A;  3PIP 3;  3AB9 A;  3AMU A;  4A3F B;  5JVG 3;  4CJ1 B;  2EY5 A;  1NAP A;  1RF2 D;  4LAA A;  3ONA B;  5EKL A;  1V1P A;  2O5I C;  2B2V C;  1I4P A;  4TRD A;  1MD2 D;  3VYT A;  5C6A A;  2KOL A;  5CV7 A;  2KA7 A;  4K8J A;  3BG3 A;  2L4N A;  3QB3 A;  4B08 A;  3HOY B;  5LHY 1;  3RUZ A;  2G9D A;  4KV6 A;  1LTT D;  3HEJ A;  5M9O A;  1Q1E A;  3OW7 A;  1L0Y B;  3GTK B;  2R7Z B;  4K8I A;  3BVZ A;  1I4G A;  3A8I E;  1EY4 A;  2IPK D;  1LT6 D;  1UUP A;  1DOL A;  1ML0 D;  1RJT A;  5J1Z A;  1PTO D;  2LKV A;  3DEP A;  4B9W A;  5CC4 A;  5KEE A;  2HDL A;  3TZD A;  1Q12 A;  4FYD A;  5HUR A;  2D5D A;  4HSP A;  1QJO A;  4KHZ A;  1XTC D;  2MJ8 A;  4H13 C;  3V2T A;  2NBF A;  3NE5 B;  3E0J A;  4P2C B;  3IFD A;  4BBS B;  1QNU A;  3H6M A;  2K04 A;  3KF8 A;  3BZD B;  4RCO A;  2EZV A;  1HUM A;  2IL8 A;  2X69 A;  3I90 A;  1SNO A;  1SNM A;  2M00 A;  3S2D B;  1HTP A;  1ET9 A;  1F9R A;  3MC0 B;  1PZJ D;  2IX0 A;  5C4Z A;  2AUK A;  3E6Z X;  5A2Q E;  3TP8 A;  3GV6 A;  1PFB A;  5I4D A;  5EBD A;  4PQX A;  2VXW A;  1BCP F;  1HCZ A;  5G3L F;  1A2T A;  1I4X A;  3FMC A;  2PMZ B;  4YIJ A;  2NN6 I;  2Z4I A;  4NDX A;  1MSG A;  3F2U A;  2OT2 A;  1GUO A;  4DGZ A;  4PMB A;  1IW7 D;  2B63 B;  2F0T A;  4M1U B;  1SFO B;  4ZKB B;  4XQJ A;  2JSO A;  2J7Z A;  2XRS D;  4FVM A;  2I07 B;  5EPJ A;  3TME A;  3T16 A;  1HQM C;  1ET6 A;  5IIF A;  1QNK A;  3J81 E;  2EJM A;  3VR4 A;  3TN2 A;  1B50 A;  2PQE A;  5IGB A;  5DAU A;  4A3G B;  5CR3 A;  4IUT A;  2WV6 D;  2F0W A;  3A54 A;  1EY0 A;  1SND A;  2JEB I;  2KED A;  4XT3 B;  5CMD A;  4HMJ A;  2CW0 D;  2BA1 A;  1BCP B;  1IKM A;  1II3 A;  5JEA H;  3U9S A;  1VDZ A;  1CA6 A;  1B4O A;  3P75 A;  1ENF A;  3SXH A;  3NWT A;  4XYO A;  2KVM A;  4IQZ A;  1WTQ A;  3PUY A;  2D2C C;  3I8Z A;  2EVB A;  3TDQ A;  4K5X A;  3S15 B;  4K14 A;  2Z8L A;  1TWC B;  2EPB A;  1TT2 A;  2RSO A;  1WTV A;  5FO9 B;  5C3E B;  5IGD A;  5T1I A;  4FXG C;  4KY7 A;  1G8Z D;  1FR3 A;  3C1E A;  4HR7 B;  3M4Y A;  2NUC A;  2FIN B;  4JBW A;  4F87 A;  3LWE A;  1BBX C;  1HFN A;  2H4O A;  4C1N I;  4DNR B;  2A74 C;  1CHQ D;  3Q22 A;  5FK9 C;  4QIW B;  3VR6 A;  4J1M A;  3G6J B;  1BNZ A;  3S1Q B;  3NQT A;  5NUC A;  4QCL A;  4V19 0;  1FNW A;  2X6L A;  2X6G A;  2B2U A;  5I2X A;  1A6X A;  1SEB D;  4EGV A;  4C3I G;  3GP7 A;  5KIX A;  2R93 B;  1F77 A;  2KEC A;  1SE3 A;  1RKN A;  2K03 A;  2GA4 B;  5ELF A;  3OWE B;  3MVV A;  2JA6 B;  1Q1B A;  1X3P A;  3I72 A;  4N9T A;  1V8Q A;  3CU7 A;  4ILW A;  4OHJ A;  2KEE A;  2AWN A;  5C4J B;  1V1O A;  3OWF A;  2D9U A;  4F8M A;  1ESR A;  3H91 A;  1KDA A;  2IT1 A;  2Y0S B;  3T56 B;  4FF3 A;  2QDB A;  1KTK A;  3DXJ C;  3J7Y W;  2SNM A;  4Y7N B;  3O13 A;  4G57 A;  4CBV A;  1KLG D;  3FEW X;  3JAM E;  1U9R A;  1Y1W B;  3KK7 A;  2B2T C;  1OXU A;  3HOX B;  2B2W A;  1DJR D;  3R2T A;  4PMW A;  2K28 A;  3R3O A;  2A69 D;  3QIA A;  4KHV A;  1SXT A;  5JVH 3;  1X32 A;  2EYL A;  4CHT B;  4R8I A;  2EE1 A;  2JA8 B;  4A93 B;  4RGT A;  4IZ8 A;  5CBE E;  5IOC A;  1MGS A;  3J80 L;  2LS0 1;  2SDF A;  3KLS A;  5KNB A;  5K36 G;  2F0U A;  1CFM A;  3URY A;  5IT9 E;  2F0G A;  1A15 A;  2JYO A;  5IGF A;  2RSN A;  4IUU A;  1SYF A;  5D65 A;  4C3J G;  3DWQ A;  2XRQ D;  2FMM A;  2F4I A;  1I4H A;  1SAP A;  2BA0 A;  1TY2 A;  2NTT A;  3FVQ A;  2ZXR A;  3SHL A;  3RD4 A;  4WRD A;  4MHE A;  2EJG C;  3MEH A;  2B2Y A;  3EJI A;  4R8N A;  1CI3 M;  2PW5 A;  3A7A B;  4WJW A;  3T51 B;  3J7A V;  2CHB D;  1S5E D;  1Y8N B;  3D6C A;  3GTL B;  1E2V A;  4S3S A;  4IFD J;  4RH6 A;  1H9R A;  4RGN A;  1RDP D;  2QIL A;  2DNE A;  2KHS A;  5C5L A;  1GHK A;  3Q0A A;  5BN5 A;  2LMC B;  5CBA E;  3SEB A;  4XTC S;  2RKS A;  1LTS D;  5I9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...