2PNRC

Crystal structure of the asymmetric pdk3-l2 complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
VLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Crystal Structure of an Asymmetric complex of Pyruvate Dehydrogenase Kinase 3 with Lipoyl domain 2 and its Biological Implications
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 10
structure length 79
sequence length 79
chains with identical sequence G
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2007-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pnrC01
3BG3A 1Z7TA 1H9SA 2EJGC 4H13C 1Q90A 1IYVA 1O7LA 2D2CC 5BN3A 1Y8PB 1GHKA 1TU2B 1E2WA 1Q12A 3A7AB 4H44C 3CRLC 4JK1C 3AB9A 1ZKOA 3BDOA 3QIAA 3I4LA 3WDNA 4LJZC 2R6GA 3QJYA 2QF7A 2D5DA 1HQMC 3GD7A 2EVBA 3GQBA 2NN6G 4G7HC 2JE6I 3PUXA 2JEAI 3VR4A 3PUZA 1LABA 3A7LA 4KN7C 1CI3M 3MXUA 2AUJD 4PV1C 2BA1A 2EJMA 1H9MA 4TQUS 1A6XA 1DCZA 1GUOA 2AUKA 1VCIA 1VF5C 1GJXA 1FYCA 2E76C 1CFMA 1V43A 2NN6I 4BA2I 2O5JC 2BE5D 1ONLA 3FPPA 4G7OC 1HCZA 2A68C 2D62A 5A35A 3M7NA 3SDZA 3DXJC 3NE5B 1QJOA 4KKSA 1IW7D 1SMYC 4I7ZC 1H9JA 5BN5A 3PV0A 2O5IC 2A6HD 5KNDA 1VF7A 4DK1A 4IFDG 5JEAG 5K36G 5C0XG 1I6VC 2KCCA 3A8IE 3W3AA 4DNRB 1V8QA 1YNJC 1GUSA 1BDOA 3SE0A 1GUTA 2B8FA 3MFYA 4XIGS 1B9NA 2CW0C 4KI0A 1E2VA 2F1MA 1GHJA 3I73A 3OOCA 1T5EA 1ZYRC 3IKJA 3N6RA 3LNNA 4LK1C 1LACA 2BDOA 4KN4C 2A6EC 3P20A 3L7ZC 3OPOA 4OO1G 2K32A 2IT1A 3H94A 1EWHA 2DNCA 2JEBI 2KA7A 3A8KE 2PPBC 5JEAH 4IFDH 1Y69U 3KLRA 5K36H 3D31A 5C0XH 1DXMA 1K8OA 2E75C 2NN6H 4XTCS 3T51B 3D4RA 2PCFB 1GUNA 3OW7A 5KNCA 2PNRC 1IYUA 1Y8OB 3ND9A 2AWOA 5BN4A 1OXXK 1FR3A 2DN8A 1H9KA 4BA1I 2ZT9C 2A68D 3ND8A 1Q1BA 3PUWA 1OXTA 3U9SA 3VR6A 3RLFA 4DK0A 2JXMB 4DNTB 2A69C 2B8GA 2LMCB 2YYZA 4KKTA 1H9SB 1VDZA 3IFTA 1OXSC 3PUYA 3HGBA 4JBWA 1PMRA 3T53B 1Y8NB 3VA7A 1G291 2K7VA 3QG1A 3CRKC 3T56B 4HR7B 1TKWB 4OGQC 3TZUA 4L8JA 1GUGA 1HPCA 1OXUA 4KKUA 2A69D 1DD2A 2BE5C 2L5TA 1O78A 1YNNC 4TKOB 2Q8IB 3I72A 1Z6HA 2A6ED 2K33A 3EQLC 3PUVA 4H0LC 4RCNA 1E2ZA 2BA0A 2V4DA 3VR5A 4KHZA 5KNBA 1IW7C 1CTMA 4OO1H 1OXVA 3LWUA 3FMCA 2A6HC 3M4YA 4KMUC 1Q1EA 1H9RA 3VR3A 2EJFC 1B9MA 2E74C 3M85A 4IQZA 4GZYC 3A8JE 4G7ZC 1K8MA 3VR2A 1HTPA 2DNEA 2EDGA
chains in the Genus database with same CATH superfamily
1CKMA 3K7AH 2KCTA 3G6JB 1HRJA 1B1ZA 1K3BC 2EXZA 4C3HB 1Q8IA 4A3KG 4C56C 3DM1A 5DEHA 4APVA 1WCMG 4LMQD 1HNWL 3NWTA 1Y1VB 1PDQA 2Z0SA 3F2DA 1X65A 2Q2UA 4R4OA 4L5QA 1NSNS 4LNQA 2XWBB 4A3GB 4P2CB 1HZCA 3ULPA 4BY1B 1BBWA 1OO9B 4LF9Q 3H3VI 2D62A 3MFGA 1YHAA 3SDZA 1LV9A 1K0RA 2AWNA 4IURA 5FO8B 2UUAQ 1VQ9A 4AYBB 1A3TA 4C3JB 5KNDA 2EY5A 2XWJB 3CHBD 4O2DA 1EYDA 2B2TC 5A2QE 1A3UA 1VQDA 1MJEA 1EY5A 2R7ZH 4IPGA 4JW0A 5CGKA 1JJCB 4KI0A 2PQAA 1FNUA 1I4PA 4CKBA 1U9RA 1K8GA 2YV5A 1Q7YC 4KN4C 3GTJH 1N8RC 3SK5A 2XRQD 3PO3B 3E9HA 4AIMA 1K73C 5ELCA 4WFN3 4FF4A 5C4XG 2VB3X 1PRTF 3HOWH 4OO1I 4A3EG 4OX9L 4A3DG 1RODA 4OWXB 1PH7A 3J7AF 3GTOH 2MJ8A 3I4MB 3EBEA 1F9SA 2VB2X 4IUQA 5J1ZA 3RLFA 4LW1A 1PFNA 2B2UC 3L0OA 1R9TB 1NNXA 2E2HH 2FMCA 4DV7Q 1C9OA 2WAQE 4AQYL 4JBWA 3EN2A 1Y8NB 4IN3A 3VA7A 2K03A 3AMUA 4Q0FA 2VW9A 4DXFA 3AU7A 1DD2A 1YIJA 3STBD 1V1PA 3AEVA 5CORA 4BBRB 1SE2A 3GTGB 1IZ6A 4OO1H 1UUPA 1SDFA 3FMCA 1EY7A 1KAWA 3M4YA 5LL6X 1B9MA 5J39A 4A3CH 4JOIA 3S2DB 1K8MA 1DOLA 1MD2D 2OQ0A 3PMFA 2WIIB 1HQRD 3FKIH 1T9HA 4A3IH 2ZM6Q 3WWVA 1I4QA 4O0AA 2AQ1B 4H44C 5I4DA 1PZKD 4DUZQ 2JA8G 3J7YW 4LF4Q 3BVMA 1HH2P 2N88A 3NENA 3KF8A 4IOAA 1ILQA 2AUJD 2KHJA 4JV5Q 3D4DA 1BUVT 4RMFA 1XTDA 1TWGH 2ICIA 2JQOA 1BBXC 2NN6I 4BA2I 1JQYD 5D3DA 1XJVA 5A35A 3Q6SA 3KK7A 4TRDA 4TSSA 4X65Q 1PVOA 4MTKA 3NE5B 1BVSA 1X3GA 3CCQA 5C44B 1ASYA 2E8GA 3VA5A 2F0KA 4ILWA 5LL6S 3HOVH 3S1QB 1U5KA 4IOCA 3G71A 2Z1CA 4DV3L 1CKNA 2YTYA 4MN3A 2E5LQ 2F0HA 2CQOA 1XTCD 3U9OA 4CDCC 3TP6A 3OTOL 1D8LA 1C48A 3GTLB 3CMEA 2QA4A 3R93A 3DWQA 3JC66 4DV6Q 2KBNA 4NW2A 5EKKA 2L55A 2NN6H 4CKCA 3I4NH 3OW7A 3B6YA 1IYUA 2K5NA 1ESRA 4IZ8A 5COYA 2Z6BA 1FR3A 2ENBA 3CCUA 4O42A 1JB3A 1EFWA 1MSGA 2B2WC 3PUWA 2Y0SB 5G3LF 1HNWQ 2DY8A 2XNAC 4P72A 1KRSA 2RHSB 2K5DA 3KBGA 2RDHA 4LUVA 4F7XA 1SYGA 5EKIA 4HR7B 5C3WA 2R93B 4DR1Q 2F03A 1NY4A 4C3HG 4NPSA 2BE5C 1BR9A 2A6ED 5GROA 1EFID 1TVXA 1BCPD 2A73B 1JT8A 3FVQA 1CTMA 5KNBA 1UE1A 3J80E 3I56A 3RN2A 1C7YA 5E3FA 4A3GG 1IKLA 4R4TA 3WOEA 4BY1G 2D2CC 1FGUA 4FF3A 3CRLC 3I55A 3CCRA 4QUFA 4Z9CB 3GD7A 4AYBG 3D0FA 5C3EH 4C3JG 4DR7L 1EY6A 1CKNB 3HOXB 4IUPA 4JPBW 5M9OA 4OX9Q 4A3FG 4A3JB 5E1FA 1PH9A 4HIDA 1STYA 5I2XA 1GVPA 1L1OA 4NB3A 4POGA 3PO3G 1UE6A 1N32L 1AZPA 1TS2A 1WVLA 1SMYC 1X3EA 5BN5A 1S5ED 1SAPA 4AQYQ 1S72A 3S9WA 4JBKA 1F9QA 1LT5D 3GDEA 3W3AA 1VQ8A 4DR2L 2TMPA 4FXKC 5GAEC 3SE0A 1C8CA 4DV0L 4JI7L 4HIOA 3PCOB 1YVCA 1EY8A 1GHJA 2NVTB 4BY7H 3I4MG 1P8LA 1PTOF 4GN3B 1AE2A 2JA6B 3CF5A 3IL8A 2LFNA 3H94A 1EWHA 2MP1A 1KHIA 2UXDL 4EQNA 1KTKA 3I70A 2F4IA 3DEPA 4FVMA 1IL2A 2OTJA 1TY2A 4N9TA 4ZQ3A 4RHRA 4DA2A 2RSNA 2MFIA 4C1NK 1SYCA 2K5WA 3HS0C 3MXNA 1E3PA 2NZ1D 2ZT9C 2ATWA 2F3IA 1NR4A 4KJNA 2PI2E 1X9NA 5I6YA 4BBRG 5J3BA 5FLXE 2JXMB 2R7DA 4B9WA 5FJ8H 1PFMA 4LUZA 5IWAQ 4KLKA 2P5ZX 1SE4A 1QILA 2WKCA 1I3QB 5ELFA 1STGA 2B2VC 2D0OA 1A2UA 1AW7A 1B4OA 1SNOA 3I72A 4RCNA 3VR5A 3J7A5 1Y14B 3EVQA 3HRZC 5ELEA 1LTLA 1SRUA 4JI8L 3NEMA 3JAML 3CPWA 1YEZA 3MC0B 3NELA 3M85A 3KJOA 3RLOA 5DAUA 3KFUA 4ZRZA 3OTOQ 3EFXD 2V1CC 5LMUL 4DV2L 4ZCKA 1O7ZA 5M5YH 2QF7A 2JEAI 5C44G 2JE6I 3VR4A 1O7IA 2EYPA 2CH4A 1Y1WB 1XPRA 2K75A 4WRDA 2G9DA 2PMZE 1DCZA 2AUKA 1YITA 4JYAL 3KUPA 3MEHA 2B63H 4YHHL 3FEWX 2HCIA 4LF8L 3NP8A 3T4AC 3F2BA 2BOSA 4BWGB 1EL0A 3T1YQ 1WCMH 3CCMA 4HCSA 5M5XH 1PYBA 1MIUA 5EBDA 1KDBA 4LF6L 5IP7H 1FVIA 4B08A 4DKAC 2KEDA 1YNJC 3UDXA 1VMPA 1BDOA 3GV6A 3K7UC 2B8FA 4O1NA 4GNXA 4N9PA 1X32A 3N6RA 4QF4A 2PW5A 4JBJA 1S5FD 4DR5Q 1TXYA 5DLQE 2Y0SG 1JJ2A 4RGMA 2ZTEA 3NSWA 2PI2A 1TIID 1PZID 1DXMA 2A74C 4A3LH 2B39A 1XNRQ 1B53A 1IBLL 2I5HA 5KYLA 2CWPA 3NPPA 3KF6A 4LFBL 4A75A 2R93G 5CV5A 2K6AA 5FKAC 1AH9A 3KYHC 5C4JB 3H6MA 5CR3A 2NVQB 2EYFA 3TSSA 1A63A 2Z6KA 3MZ5A 4DR7Q 2KOLA 3R2IA 2KENA 5C4XH 2B8GA 3IFTA 1PRTD 4RH6A 3K59A 4A3BH 3NTHA 2A1AA 4A3EH 1CUKA 1G291 1K9MC 1GUWA 1CHQD 1BBUA 4WJ4A 4X3SA 1TKWB 1GXDC 1EQVA 5CBEE 4L8JA 2HHHL 2LXKA 2F0FA 3K8AA 3RZOB 4HJ7A 4H0LC 1E2ZA 4MTNA 2RCFA 1I50H 2N78A 2AQ3B 1EUJA 3HOXG 1TWHB 2K28A 1J9OA 2Q2IA 1EOVA 4DV0Q 4A3JG 3VR2A 3TMEA 5IE8A 1EQTA 1H9SA 5M3MB 4H13C 2NUCA 2H4OA 3K81C 5JOBA 4XQNA 2R7FA 3ICEA 3QIAA 3J7ZC 1KNAA 1PYWD 4MIUA 1UEAB 3GQBA 2D5DA 3VYUA 2CCZA 3ER0A 2R92H 1IHZA 4NXNQ 1LABA 5IODA 1BOSA 5AJ3Q 2KUMA 2Q8TA 3RR5A 4L5SA 2BA1A 3K0YA 1WTOA 5IT9L 1G51A 1X3FA 2IHEA 2D9UA 3HOYG 1KLUD 3I7FA 4B3SL 2LSSA 5IYCG 1RTOA 2JA6G 3S1MB 3H15A 2F4VL 2E2JB 5TSSA 1R4QB 1RKNA 2O5IC 4XQJA 1P16A 5IYDH 1N36L 4IFDG 5JEAG 1I6HB 2HQLA 3GTKB 4ODGA 1I5FA 1SN8A 3I73A 4OHJA 3S2HH 4GOPB 4OIJA 5JVH3 2BDOA 3P20A 1L0WA 5I9PA 2I5LX 3E9IA 3HOUB 2DNCA 5C4HA 1SJED 3HP3A 4K14A 5IGDA 1F2MA 2HDLA 2WFWA 2CWAA 2WKDA 2J4XA 3QB3A 2NZOA 5BN4A 1I4HA 1HFGA 3HOZH 4JI6L 2K14A 1AZQA 2L12A 4HJAA 2RDGA 1AFPA 2NVYH 2L4NA 2E2IB 3IRBA 4ME5A 2LMCB 1H9SB 1PH5A 4QUCA 1PMRA 1WYDA 1SFOH 4YHHQ 1LT6D 5KRUA 3J7AV 1WTRA 2SEBD 4LF8Q 3CC2A 4X66Q 1CT1D 1KNEA 4R8IA 4UHVA 4TKOB 3MXPA 5G3LD 4GOPC 1Q82C 4B3ML 3S1RH 1IW7C 5CV9A 1HA6A 2RKSA 4K2LA 3GV3A 2F0NA 4CJ0B 3K58A 5IP9H 1Q46A 1EZ6A 1QCBD 4DAVA 1HA5A 3D4RA 3SHLA 3NTKA 2RVLA 5FOBB 2VQEL 5CMDA 2Q2HA 3NBHA 3GTPB 5JJIA 1PTOH 2FJ2A 3VYRA 1JICA 4F87A 1G8ZD 4LJZC 1Y1VH 3PIPA 2QGQA 3LGJA 4X64L 1EQRA 2QKIC 3A56A 3S14B 1U4LA 2EY1A 4BXXH 1VQPA 2X6LA 4KN7C 3V2TA 1IBLQ 5CYUA 5IT9c 1KD1C 3VYSA 2HD3A 3MTSA 4OWWB 1WTHA 1QVGA 1MGSA 2A68C 3PIOA 3M7NA 3P7JA 2B2YA 3D6WA 3FRPB 1S3OA 4IALA 4POFA 1EYCA 2SDFA 3PV0A 1T5XD 2UUCL 1QUQB 3E3XA 1N34Q 5K36G 4DV1L 1YNXA 3E0EA 2N49A 4K5XA 5FLMG 4JI5L 2RHQB 5H1SE 2DGYA 1B9NA 2XRSD 5IYBH 3IKJA 2OXPA 2VY3A 1VQEA 3RZDB 3W5OA 3QOJA 3A5UA 3OMCA 1IYJB 3E5SA 5E4WC 4ULLA 1PH6A 3CC4A 3S16H 2UXCL 1I4XA 2CVRA 2F0IA 2Y0SE 4QCLA 2ZJRA 3K5LA 3I90A 1LTGD 1I4RA 4BA1I 1PTOD 5GADC 1S40A 3CCLA 4A3FB 4WJ3M 4Q5VA 1OXTA 1R9TH 1TS4A 3CXCA 3C3LA 2A69C 1PH3A 1O80A 1D5ZC 1VDZA 5M5WB 1LTRD 1EY9A 1HR0W 1PA6A 3K7AB 4KY5A 1PHJA 1A62A 5M3MG 3G48A 1STAA 2IW3A 3CRKC 2NZHA 1WOCA 1XX8A 5CC4A 1A8VA 2L5TA 3TN2A 1SNMA 1SR3A 3DM3A 1VQ5A 4RWSC 3UDFA 4A76A 2XVSA 2UU9L 1RF2D 2KHIA 1BNZA 1KDCA 3SK4A 5AFWA 3NK9A 2IHFA 2F0VA 2F0JA 1AN8A 4IUNA 4B9XA 3DMUA 3ZJYC 3RN5A 4CJ2C 3QJYA 2FHTA 2C5CA 2EVBA 2XIWA 5C5LA 2M9VA 2GVAA 2R7ZB 1TR5A 4ME3A 4TQUS 4DV5L 1VQBA 3R3OA 1L0XB 1VCIA 1CZWA 1CK1A 3CPFA 1PFBA 3GTJB 4JI6Q 3EIVA 1HCZA 1QVFA 1Q3LA 3BDCA 3BU2A 3DXJC 5C44H 3HOUG 1QJOA 1H9JA 3P75A 2WP8J 1Q86C 3M4OH 4KD4A 5BR8L 3C2PA 3HOWB 1UE7A 2IWHA 4XDXA 4K0KL 1E22A 3PQIA 1XNQL 3AQQA 3D6CA 3RLNA 5EJWA 2PQAB 4XYQA 3PF4A 1STEA 1J6QA 4M8AA 3STBC 4B3MQ 4EVOA 2CH4W 5I2YA 4DR3L 2ZTCA 5IIFA 1ENFA 1W3SA 2OT2A 3CQZH 3HFZB 1KXLA 4CJ1B 3H0GB 3K80C 2VQEQ 2ZJPA 2RDFA 3GO5A 2NVXH 5EQ0A 2H5XA 2LS01 5LMNQ 1F2LA 3PSIA 1MHWC 3MHBA 3J80i 1QE6A 2CQAA 2MO1A 3ZYYX 4PMCA 4X64Q 2CFMA 1B7YB 4HMJA 5JJZA 2L0CA 1JMCA 4HSVA 3CCSA 3PUYA 2EY6A 1FL0A 2F0MA 3H3VC 3T53B 4GKJL 1JB7A 1AE3A 4XQQA 4J6HA 3FKIB 3HKZB 5EPLA 4OGQC 1UE5A 2KVMA 3OIQA 4KKUA 2VUMG 1V1PB 4IFDJ 5JEAJ 3M7GA 1XMQL 4BBSB 1RD9D 1VQLA 5FO7B 2F0DA 4FF1A 3HZXA 4KMUC 2I07B 1Q1EA 1C0AA 4JI5Q 5EAYA 1TWGB 1YHBA 3A8JE 3MXUA 3VR6A 2EDGA 2F0LA 2LXJA 2EJGC 5M3FH 1O7LA 1OTCA 1TU2B 2F3VA 4R8NA 2VQFL 1BCPB 3BDOA 2JSOA 5C5MA 3WDNA 5IY0A 2B3GA 1GO3E 3O13A 3KF8B 4HAEA 4DAYA 1WFQA 2DJGC 3HOVB 2FMMA 2EYOA 1LTTD 4EX5A 3BDLA 2ASBA 1EY4A 2EYMA 1LO5D 1HJPA 1EIYB 4IFDI 4CKEA 1HR0L 2RF4A 1ENAA 4G7OC 3T16A 4CBVA 1ET6A 1CA6A 3QO2A 3U58A 1JOKA 1LT4D 2NYZD 2A6HD 4DK1A 2JA5H 1U4PA 1V8QA 1XPUA 2NVTH 4JOIC 1JC7A 3NHHA 4Y7NH 3PF5A 2SNSA 2H1EA 1KQSA 2YU9B 4E6IA 5IYCH 1YJNA 1NR2A 4DR4L 2A6EC 4LAAA 3L7ZC 4HJ9A 2UU9Q 1VQ6A 1BCPC 4RFBA 2MGSA 4C2MH 1B2TA 2KA7A 4IFDH 5ISRA 5JEAH 1QNKA 1LT3D 3J80L 4IUTA 3D31A 4JC0A 2G5DA 1HNXL 1WTVA 4LWCA 1CSPA 2WAQB 3R8BA 2EOTA 1KABA 3S15H 1SE3A 1S5CD 2K05A 3EA6A 2R61A 3DWPA 3ITPA 4C3IB 1ICFB 3ND8A 1E24A 4QB4A 3HOYB 3PIO3 2SOBA 4L63B 4DV5Q 4JI1L 1KLGD 1ZXTA 1E0BA 2AHOB 1V9PA 2K7VA 2KCMA 3HKSA 3G6EA 5I6WA 2EQSA 3T56B 4RA8A 3J81E 2K01A 1SNQA 1EEID 3BZCA 4QL5A 1M90C 1PH2A 2V4DA 5ELOA 1K3RA 2K5VA 1DOKA 2F3WA 1I4GA 1TWCB 3I8ZA 4XYOA 4K0KQ 2R7ZG 1W2BA 1E1OA 3AFPA 1QZGA 3I4OA 2M00A 1Q90A 3I3CA 5BN3A 4XT3B 3OWEB 3AB9A 3TREA 4DR3Q 2HCCA 3JAME 1D6EC 4H02A 4UDUC 3PUZA 4FXGC 4IPHA 1Y1WH 3HOWG 3IFDA 4OELB 5KYIA 1H9MA 3DEOA 1NBWA 2PQEA 3TP8A 1FYCA 4XXEA 1STBA 2NTSA 1CFMA 4J8QA 4DV3Q 5DM73 1L1OB 2TSSA 1UNSA 4FO2A 3NBIA 4KV6A 3A74A 3BJUA 2X6GA 4DR6L 1A2TA 1VF7A 4EQPA 4GKJQ 5FK9C 1Q81C 4AH6A 4YWKA 3H0GG 4JI0L 4U673 1JE5A 1D1KA 4RKBA 5D14A 1GUTA 2BH2A 2F1MA 3OOCA 3RNUA 1XMQQ 5LHY1 4OO1G 4V190 3C1FA 1R4PB 5EPKA 3DWAA 3OW2A 4A3KH 2XSCA 3J80c 3CMAA 5K36H 4A3CG 4NP5A 5FLMH 1L2FA 1HUNA 3TP7A 3OHXC 3U4ZA 1BXTA 3U4VA 2PNRC 3FDTA 3FKIG 3HKZG 2AWOA 5C4JH 3MXNB 5JVG3 1VQ7A 1NE3A 4BBSG 1L1OC 1TT2A 4LF7L 3G4SA 3BVGA 1M8AA 4KKTA 4C1NI 5IGGA 1B3AA 1LTBD 3CKIB 2AQ2B 3SK6A 3TZUA 1SYDA 1VS0A 2K5QA 4PNYA 4Y52H 2A19A 3RZOH 1A0IA 1OXUA 4KY6A 4JI3L 2C9OA 1VQIA 5M5YB 3T1HL 3EQLC 2BA0A 4DK6C 4IPDA 4R4CA 1TWHH 4HIKA 3HOVG 1UEBA 4KTAA 4YCWA 1PRTB 5D3IB 4MNOA 1CKOA 3VR3A 3CP0A 1NCVA 1ZEQX 4J15A 3S17H 4IQZA 4GZYC 2B63B 1HTPA 1QWYA 4S3SA 1RIPA 1TWAB 3H09A 2Z8LA 1IL8A 3C1EA 4DR4Q 4A3DH 1WTQA 2WB1B 3F2UA 2JN4A 2NN6G 1HNXQ 3I4NG 1N32Q 3A7LA 2A8VA 2XTIA 2R3ZA 4EQOA 1E1TA 4I7AA 3BVZA 3KDFA 4QJFA 1ET9A 3K6OA 4EGVA 3PO2B 4GN5A 3MAQA 1GJXA 1JE4A 4DR2Q 1IXRA 1FJGL 3GTQH 4JI7Q 3FPPA 4A93B 2IPKD 4ALPA 1VQKA 4V0BA 4J1MA 4QGUA 4R1JA 3KLSX 5FLXc 1I6HH 5IT9E 2WV6D 2NTTA 1RJTA 2JJQA 1PRTC 2UXDQ 2GA4B 3GTKH 1JJGA 2WAQG 2J7ZA 2SNMA 1K0SA 4GNXB 2IJ0A 1NJIC 5C4ZA 1TWFH 4C3IG 1A15A 2WINB 4N8X1 2UUAL 2Z4HA 1VQ4A 2Q2TA 1G2SA 4U68A 1U4RA 4G57A 5GAGC 1DZ1A 4AYBE 3F1ZA 4YY3L 4ABNA 2JA8H 4A3BB 1UAPA 3CU7A 4FDBA 1K8OA 1L0YB 1QVCA 1ILPA 2Q8RE 4XTCS 2EXDA 3UDIA 1F77A 3A54A 2MNAA 3D3RA 3KF6B 4NXML 2A5HA 1M4VA 2QEJC 1F9PA 4OONA 4FF2A 2ZXPA 1YZ6A 5C3EG 3EROA 2PYKA 3NQTA 1S5BD 3U9SA 1FNWA 4OIKA 5C3XA 1CQVA 5KGUA 4L5TA 4ZUIA 4NDXA 4DGZA 1VMCA 1SYEA 4KY7A 3HGBA 5DM63 4JI8Q 3J81j 1YI2A 1PLFA 1F2ZA 2CW0D 2NB0A 4QIWB 1QNUA 1ZYRD 3R2TA 2N8NA 4GNXC 4OEMB 4N8FA 1D2BA 2C35B 3TS0A 4DF7A 4JG2A 5LMUQ 4DV2Q 1IBKL 2R92B 4DR6Q 2RBMA 2OEOA 1UWVA 5KEEA 3FP9A 2ICEC 4JI0Q 2B2TA 2MHVA 2E74C 3TZDA 1JWSD 4K8IA 5EBCA 3GTPH 2JP1A 2PZUA 3SK8A 4BY7G 3BG3A 3C46A 2PMZB 4JYAQ 3S1NH 4GKKL 2QEXA 1MKHA 4G4KA 2ID0A 3VYTA 3MVVA 2Z6KC 2Z9HA 3CCVA 3PUXA 3DUZA 5EKLA 3OIPA 2EJMA 4OL7A 4LF6Q 1HNZL 2E76C 3UE1A 1N33L 3G7LA 1YNND 4LF4L 2VZAA 4A3MB 4C3HH 4K8JA 2K1BA 5FJ8G 4LF7Q 4KKSA 2ZJQA 2B2UA 2VUMB 3M9BA 2L15A 1BO0A 1EQQA 1SYFA 5CV7A 4JI2L 3KOJA 4DNRB 1K83B 1EU3A 2I5MX 1C4QA 1JOOA 4BS9A 3MFYA 4A3GH 4B3TL 3MXGA 4JI3Q 1F2YA 4X65L 4X3KA 1T5EA 4ZLTF 3T1HQ 4LFBQ 3RZDH 4BY1H 1AP0A 2K32A 2QDBA 1EOTA 2ZTDA 1EWIA 2BDNA 5ELBA 3KJPA 1SFOB 3GTMB 2N3SA 4PZ6A 4C3JH 1JOQA 2PCFB 4IO9A 1GUNA 1PXUA 4PG3A 4LFAL 1WI5A 1PZJD 2D0PA 1TS3A 4M1UB 4A3FH 1EWCA 4PZ7A 4ZKBB 2OCEA 2HHHQ 4OWTB 1N9WA 2JK8A 5M5WH 3PO3H 2FFKB 4YCUA 1K28A 4DUYL 3N52A 1JCKB 2B63G 1X3PA 1SYBA 3M4PA 3TRZA 4JCVE 4GLAC 4YWLA 1FJGQ 5D65A 2OF1A 4RCOA 1PTOB 3M3YB 2A69D 3SEBA 4MZ9A 2Q8IB 3U50C 2DY7A 2WB1G 2JA7B 1BF4A 3TQYA 3I4MH 3NWSA 1LTSD 3FHWA 5IP7G 1LTID 1KDAA 4ZYSA 4DR1L 4G7ZC 1KAAA 3PO2G 4R9WA 3NBHB 2K50A 4K5VA 1IYVA 3MEFA 4HSPA 2HUGA 4DAMA 2HQEA 4A93G 1E2WA 5IOCA 2RQXA 4B3SQ 3I4LA 5HURA 4YY3Q 5ELDA 2R6GA 4A3LG 4BBRH 1D5MC 2UUBL 3ERSX 2DJFC 2F4VQ 3GTGH 3H91A 4LFCL 2F0UA 2HT1A 1J5EL 1N36Q 4NXMQ 1HZAA 4P71A 4R4QA 2F0EA 3LWEA 3BS1A 3S2DH 2O5JC 1EYGA 5A2QL 3CD6A 4RGTA 1PTOC 2B2WA 3CW2C 1B44D 5J22A 3TDQA 5IGCA 4ZK9B 3CCJA 1K8AC 3H3VH 2L11A 1PV4A 1FNVA 4A3BG 3KLSA 3S16B 1D5XC 1CQFA 1LM0A 2F0OA 4XIGS 2M2LA 2AKWB 4UPAA 3Q0AA 1IBKQ 2JEBI 2OQKA 1QB5D 1EY0A 1EEFD 4MHEA 1O7YA 3H0GH 2F0QA 2CHBD 2E75C 1SXTA 2F52A 3E6ZX 3P1HA 3SVMA 5IGFA 5I9OA 5JPNC 2VNUD 4X3TA 1Q8KA 3S1QH 1SEBD 3X3NA 3RUZA 1VQOA 4GKKQ 1X3QA 4YCVA 4H7BA 2ZXOA 5HGQA 1LYLA 3GTOB 2R92G 1Q1BA 2B2YC 3GTLH 1ENCA 4RHSA 3QR8A 2E2HB 2QILA 1HNZQ 3TS2A 1N33Q 1YJ9A 3TBIB 4BBSH 2RSOA 2K33A 3PUVA 3IAYA 4JI4L 5IYDG 5IWAL 2K4KA 4JI2Q 2EE1A 1YBYA 4HIMA 1CA5A 4FP5D 2NBFA 2YTXA 4P73A 3TP5A 4B3TQ 3VDYA 2PO4A 4B3RL 4KHPL 2XN9C 2X69A 2IY5B 1X6OA 4CDDC 1S4ZA 2EYHA 2R93H 4A3MG 4JK1C 1D7QA 1ZKOA 3K5NA 4CGYB 4A3IB 4LF5L 5FO9B 3M4OB 1HQMC 2FXQA 1HUMA 1PFSA 1VQGA 3NQIA 5T1GA 3SXHA 5JPMC 1DGSA 2OTLA 4LFAQ 4PV1C 2UUCQ 3Q23A 1EIFA 1B70B 1GUOA 4DV1Q 3UI2A 1SE8A 1VF5C 4UP9A 1AEXA 1DONA 3HOZG 4RAUC 1V43A 2BE5D 1ONLA 4DFAA 4PZ8A 1JR0D 1SMXA 4PMBA 1JORA 3F8TA 1G6ZA 3CQZB 1WTPA 3RMHA 4DUYQ 2I0QA 4PMWA 3I2ZA 5C0XG 1I6VC 2KCCA 3HOXH 4TVAB 2NVXB 2B2VA 5CBAE 3SR1A 2UXCQ 2YU9H 4HN7A 1E2VA 4A3JH 3RD4A 1SNCA 3Q24A 3T1YL 2Z4IA 3LNNA 3M4QA 3K57A 2ALYB 2IT1A 2VL6A 1NMGA 5IP9G 2PPBC 1Y69U 4GN4B 3KLRA 2L9HA 1XWEA 3L2PA 3J81i 2ZXRA 3T51B 3QWNA 3ND9A 4QY7A 3V96A 1WD1A 4ZAIA 4C3IH 3I4NB 4DR5L 3ULJA 2F0TA 2MQHA 2JA7G 3HOYH 1Y1VG 1MSHA 4KK7A 2UUBQ 1SMYD 4BXXG 1DOMA 4DK0A 4LFCQ 1JWMD 2JA6H 4ZUJA 1B50A 1XNRL 5GQOA 4XT1B 1J5EQ 1EIHA 2O4XA 3OWFA 5M3FB 1VQJA 3PIP3 2G9HD 3JAMi 1G6PA 2DUDA 5JJLA 1STNA 1TWCH 3D8GA 5ELNA 3LWUA 1KRTA 2A6HC 5CV6A 1YHQA 2EJFC 5CV4A 2WB1E 4DN4M 5IYBG 5IGEA 5NUCA 4LUOA 1Z47A 2EPBA 2ES2A 1I3QH 1FD7D 1GHKA 3A7AB 1A3VA 3LX0A 4DV4L 2QW7A 4DAYB 4IJHA 4QMGA 1RL2A 1PH1A 2JA5B 2L1BA 5HY6A 5C3EB 1EYAA 4PQXA 4JVZA 3EJIA 3ULLA 1XMOL 4Y7NB 1D1IA 5BR8Q 3BYTB 2HIVA 3QOLA 4GS3A 1XNQQ 1RHPA 1SNDA 4CHTB 3I91A 3W1BA 4C2MB 3T13A 4NXNL 1KC8C 5AJ3L 1LLRD 1X55A 4I7ZC 3K5MA 4EQ5A 2GVBA 2PNHA 3S15B 1CZGA 3J81L 4X6AH 2PZTA 4RG1A 3S24A 1MBYA 1X54A 3OYYA 2MPMA 1GM5A 3ERQA 4JI4Q 2LY7A 4HTHA 1I94L 4BY7B 3KBXA 3OPOA 4X62L 1PH8A 3A8KE 2K52A 1KIXA 5T1IA 2QDLA 5FLXL 4B3RQ 4KHPQ 2QCPX 1XYIA 1EIGA 1OXXK 2GN5A 2JYOA 4X3UA 4LF5Q 1W6JA 1M1KC 2VS1A 5E7NA 1IBML 3HEJA 4QQBX 2RA4A 1WD0A 4QIWE 2BCOA 2YYZA 4HJ8A 1QG7A 1NAPA 1OXSC 1VQAA 3FPUB 3Q22A 4K5WA 1YNJD 1E7ZA 1EZ8A 4A4IA 1HFNA 4UP7A 1V1OA 4I65A 3DLLA 2LKVA 3HG9A 3Q8DA 4K6LA 3D4WA 2KECA 4A3IG 4WJWA 3NUCA 2NVQH 2VQFQ 3NTIA 1VQHA 2AMCB 1OXVA 3K5OA 1SJHD 5EPJA 3MA2B 2IX0A 2J0TD 1FGBD 3MWYW 3KLWA 4X66L 2UXBL 1TWAH 2DNEA 1CM9A 1RDPD 1HR0Q 4IPCA 3TEHB 2MO0A 2FINB 1XPOA 4DNIA 1KL9A 4G7HC 4YIJA 1F9RA 4K2KA 1SNPA 1HXYD 4WORA 3A5ZB 2EYJA 4HJ5A 3PO2H 1V1QA 4DAPA 1A6XA 3K0XA 1HHVA 1LTAD 4A93H 1II3A 5M3MH 3AFQA 1W6KA 4K6DA 2PZWA 4A3KB 4KJOA 1CHPD 1TY0A 3W2DA 1X56A 1U0LA 1WCMB 3A55A 2F0SA 1G2TA 3CAMA 2EY2A 4DK3C 5LMNW 2IL8A 5M5XB 2RCNA 2KCNA 4IJLA 2N55A 4OXPA 5EGTA 2F0GA 1ICWA 1NUCA 3DHQA 1SROA 1MJCA 3J81c 1G91A 3NXWA 2HIXA 4F8MA 4GOPA 4KD3A 1SSOA 4L6TB 2NWGA 1N34L 3S1MH 2E2JH 4HCEA 2EIFA 1B8AA 1DM0B 5M3FG 4JI1Q 1Y8OB 2F0PA 2EYLA 2DN8A 3AYHB 4R4IA 4DV4Q 4LF9L 3CC7A 1NTGA 4IUVA 4YWMA 3JAMc 1BCPF 4DNTB 3HOUH 4HMIA 2KQ3A 1XMOQ 3S17B 3OSOA 5C4XB 1STHA 1YJWA 3OMGA 4NMZA 4CDFC 1VQCA 1SLJA 3BYYB 4A3EB 1RTNA 1H95A 4A3DB 1B3QA 5JJKA 2EZVA 1QZHA 1JWUD 3GP7A 3BZDB 2BH8A 1VQNA 5C0XJ 5CV8A 2JA5G 2E2IH 1I50B 5K5PA 1VQMA 5C6AA 1MI2A 1EU4A 3L3OC 4RGNA 2PW7A 1Z7TA 3GTQB 2MUYA 5JAVA 1Y8PB 5DNFA 1Q12A 1I94Q 1DJRD 1PH4A 4X62Q 2IX1A 5L37A 1VQFA 5HGTA 2KJXA 2HDMA 2IX3A 3BZKA 2B29A 1CI3M 3KDFB 1NMFA 4DV7L 4FNFA 1TWFB 1BKBA 5C0XI 2YTVA 4RGOS 4A3MH 3V05A 4FYDA 2K04A 4DXGA 3A0JA 4DPGA 3X3MA 1IBMQ 4NKLA 4UAIA 5KIXA 2VUMH 4HEDA 1U4MA 2JA8B 2KHSA 1IW7D 1GKHA 5GAHC 1SBBB 2WACA 1K83H 1QUQA 1S5DD 1WJJA 3S14H 3W1GA 3A8IE 4ID6A 1GUSA 4FXDA 2CW0C 2OWOA 2VXWA 1HZBA 1ZYRC 4UP8A 4LK1C 2O2LD 1LACA 2ZM6L 1ESFA 3S2HB 4DUZL 1QOHA 3GTMH 1HZ9A 1TQOA 2KEEA 5C0XH 1LUZA 4IUUA 2UXBQ 5F2DA 5KNCA 4JV5L 2JA9A 4JBMA 1H9KA 2A68D 3HOZB 1Y1WG 3PGZA 3L9AX 2NVYB 3E0JA 5E4XA 1GOZA 2CKZB 3SGIA 4P75A 2K5HA 3URYA 4UY8C 5IGBA 5LMNL 3QG1A 3M3YH 2I46A 4ZKCB 1PYSB 4GLXA 3S1NB 1XXGA 1DYQA 2JA7H 4CDEC 1GUGA 1HPCA 1WTXA 2E5LL 3ONAB 1CSQA 1O78A 1YNNC 1Z9FA 3UE0A 1Z6HA 1HTLD 1TS5A 4RKLA 1IKMA 3WOFA 2E2DC 4KHVA 4KHZA 1ASZA 1J8IA 4DV6L 3S1RB 1ML0D 4F88A 3CCEA 1H9RA 1BQQT 1WTWA 4P74A 4L5RC 4GLVB 3F2CA 3UDGA 3HKZE 2F0WA 4DU9A 1GD7A 1RCVD 2XGTA
chains in the Genus database with same CATH topology
3G6JB 1HRJA 1B1ZA 2EXZA 4C3HB 1Q8IA 4C56C 3DM1A 5DEHA 4LMQD 3NWTA 1Y1VB 1PDQA 1NSNS 2XWBB 4A3GB 4P2CB 4BY1B 1OO9B 2D62A 3MFGA 3SDZA 1LV9A 2AWNA 4IURA 5FO8B 4AYBB 1A3TA 4C3JB 5KNDA 2EY5A 2XWJB 3CHBD 1EYDA 2B2TC 5A2QE 1A3UA 1EY5A 5CGKA 4KI0A 1FNUA 1I4PA 4CKBA 1U9RA 4KN4C 3SK5A 2XRQD 3PO3B 5ELCA 4WFN3 4FF4A 2VB3X 1PRTF 4OO1I 1RODA 3J7AF 2MJ8A 3I4MB 1F9SA 2VB2X 4IUQA 5J1ZA 3RLFA 1PFNA 2B2UC 1R9TB 2FMCA 4JBWA 1Y8NB 4IN3A 3VA7A 2K03A 3AMUA 4Q0FA 4DXFA 3AU7A 1DD2A 1V1PA 5CORA 4BBRB 1SE2A 3GTGB 4OO1H 1UUPA 1SDFA 3FMCA 1EY7A 3M4YA 5LL6X 1B9MA 5J39A 3S2DB 1K8MA 1DOLA 1MD2D 3PMFA 2WIIB 1HQRD 1I4QA 2AQ1B 4H44C 5I4DA 1PZKD 3J7YW 3BVMA 2N88A 3KF8A 1ILQA 2AUJD 3D4DA 1BUVT 2ICIA 1BBXC 2NN6I 4BA2I 1JQYD 5D3DA 5A35A 3Q6SA 3KK7A 4TRDA 4TSSA 3NE5B 5C44B 3VA5A 2F0KA 4ILWA 5LL6S 3S1QB 2Z1CA 4MN3A 2F0HA 3U9OA 1XTCD 3TP6A 1C48A 3GTLB 3R93A 3DWQA 4NW2A 5EKKA 2L55A 2NN6H 4CKCA 3OW7A 1IYUA 1ESRA 4IZ8A 5COYA 1FR3A 2ENBA 4O42A 1JB3A 1MSGA 2B2WC 3PUWA 2Y0SB 5G3LF 2DY8A 2XNAC 2K5DA 3KBGA 2RDHA 4F7XA 1SYGA 5EKIA 5C3WA 4HR7B 2R93B 2F03A 4C3HG 2BE5C 1BR9A 2A6ED 1EFID 1TVXA 1BCPD 2A73B 3FVQA 1CTMA 5KNBA 3J80E 5E3FA 1IKLA 3WOEA 2D2CC 4FF3A 3CRLC 4QUFA 4Z9CB 3GD7A 4C3JG 1EY6A 3HOXB 4IUPA 5M9OA 4A3JB 5E1FA 1STYA 5I2XA 1AZPA 1TS2A 1WVLA 1SMYC 5BN5A 1S5ED 1SAPA 3S9WA 1F9QA 1LT5D 3W3AA 2TMPA 4FXKC 3SE0A 1C8CA 1EY8A 1GHJA 2NVTB 1PTOF 2JA6B 3IL8A 2LFNA 3H94A 1EWHA 2MP1A 4EQNA 1KTKA 3I70A 2F4IA 3DEPA 4FVMA 1TY2A 4N9TA 4ZQ3A 4RHRA 4DA2A 2RSNA 4C1NK 1SYCA 2K5WA 3HS0C 3MXNA 2NZ1D 2ZT9C 1NR4A 4KJNA 5I6YA 5FLXE 2JXMB 4B9WA 1PFMA 1SE4A 1QILA 2WKCA 1I3QB 5ELFA 1STGA 2B2VC 1A2UA 1AW7A 1B4OA 1SNOA 3I72A 4RCNA 3VR5A 3EVQA 3HRZC 5ELEA 3JAML 3MC0B 3M85A 5DAUA 4ZRZA 3EFXD 1O7ZA 2QF7A 2JEAI 2JE6I 3VR4A 2EYPA 1Y1WB 4WRDA 2G9DA 1DCZA 2AUKA 3KUPA 3MEHA 3FEWX 2HCIA 3NP8A 3T4AC 2BOSA 4BWGB 1EL0A 4HCSA 5EBDA 1KDBA 4B08A 2KEDA 1YNJC 1VMPA 1BDOA 3GV6A 2B8FA 4O1NA 4N9PA 1X32A 3N6RA 4QF4A 2PW5A 1S5FD 4RGMA 3NSWA 1TIID 1PZID 1DXMA 2A74C 2B39A 1B53A 5KYLA 3NPPA 5CV5A 5FKAC 2K6AA 5C4JB 3H6MA 5CR3A 2NVQB 2EYFA 3TSSA 3MZ5A 2KOLA 3R2IA 2B8GA 3IFTA 1PRTD 4RH6A 3K59A 3NTHA 1G291 1GUWA 1CHQD 4X3SA 1TKWB 1GXDC 1EQVA 5CBEE 4L8JA 2F0FA 3RZOB 4H0LC 1E2ZA 2AQ3B 1TWHB 2K28A 1J9OA 3VR2A 3TMEA 1EQTA 1H9SA 5M3MB 4H13C 2NUCA 2H4OA 5JOBA 4XQNA 3QIAA 1KNAA 1PYWD 4MIUA 1UEAB 3GQBA 2D5DA 3VYUA 1IHZA 1LABA 5IODA 1BOSA 2KUMA 2Q8TA 2BA1A 3K0YA 1WTOA 5IT9L 2D9UA 1KLUD 1RTOA 3S1MB 2E2JB 5TSSA 1R4QB 1RKNA 2O5IC 4XQJA 4IFDG 5JEAG 1I6HB 3GTKB 4ODGA 3I73A 4OHJA 4OIJA 5JVH3 2BDOA 3P20A 5I9PA 3HOUB 2DNCA 5C4HA 1SJED 3HP3A 4K14A 5IGDA 1F2MA 2HDLA 2WKDA 2J4XA 3QB3A 5BN4A 1I4HA 1HFGA 1AZQA 2L12A 2RDGA 1AFPA 2L4NA 2E2IB 4ME5A 2LMCB 1H9SB 4QUCA 1PMRA 1LT6D 5KRUA 3J7AV 1WTRA 2SEBD 1CT1D 1KNEA 4R8IA 4TKOB 3MXPA 5G3LD 1IW7C 5CV9A 1HA6A 2RKSA 4K2LA 3GV3A 2F0NA 4CJ0B 3K58A 1EZ6A 1QCBD 4DAVA 1HA5A 3D4RA 3SHLA 3NTKA 2RVLA 5FOBB 5CMDA 3NBHA 3GTPB 1PTOH 2FJ2A 3VYRA 1JICA 4F87A 1G8ZD 4LJZC 2QKIC 3A56A 3S14B 1U4LA 2EY1A 2X6LA 4KN7C 3V2TA 5CYUA 3VYSA 3MTSA 1MGSA 2A68C 3M7NA 3P7JA 2B2YA 3D6WA 3FRPB 4IALA 1EYCA 2SDFA 3PV0A 1T5XD 5K36G 4K5XA 1B9NA 2XRSD 3IKJA 2OXPA 3RZDB 3QOJA 3OMCA 3E5SA 5E4WC 4ULLA 1I4XA 2CVRA 2F0IA 4QCLA 3K5LA 3I90A 1LTGD 1I4RA 4BA1I 1PTOD 4A3FB 4Q5VA 1OXTA 1TS4A 3C3LA 2A69C 1O80A 1D5ZC 1VDZA 5M5WB 1LTRD 1EY9A 3K7AB 4KY5A 1STAA 2IW3A 3CRKC 1XX8A 5CC4A 2L5TA 3TN2A 1SNMA 4RWSC 2XVSA 1RF2D 1BNZA 1KDCA 3SK4A 5AFWA 3NK9A 2F0VA 2F0JA 1AN8A 4IUNA 4B9XA 3DMUA 4CJ2C 3QJYA 2FHTA 2C5CA 2EVBA 2XIWA 5C5LA 2M9VA 2R7ZB 1TR5A 4TQUS 3R3OA 1L0XB 1VCIA 1CZWA 1CK1A 1PFBA 3GTJB 1HCZA 1Q3LA 3BDCA 3DXJC 1QJOA 1H9JA 3P75A 2WP8J 4KD4A 3C2PA 3HOWB 2IWHA 4XDXA 3D6CA 5EJWA 4XYQA 1STEA 4M8AA 4EVOA 5I2YA 5IIFA 1ENFA 2OT2A 4CJ1B 3H0GB 2RDFA 3GO5A 5EQ0A 2LS01 1F2LA 3MHBA 1QE6A 2CQAA 3ZYYX 4PMCA 4HMJA 5JJZA 2L0CA 4HSVA 3PUYA 2EY6A 2F0MA 3H3VC 3T53B 4XQQA 4J6HA 3FKIB 3HKZB 5EPLA 4OGQC 2KVMA 3OIQA 4KKUA 1V1PB 4IFDJ 5JEAJ 3M7GA 4BBSB 1RD9D 5FO7B 2F0DA 4FF1A 3HZXA 4KMUC 2I07B 1Q1EA 1TWGB 3A8JE 3MXUA 3VR6A 2EDGA 2F0LA 2EJGC 1O7LA 1TU2B 2F3VA 4R8NA 1BCPB 3BDOA 2JSOA 5C5MA 3WDNA 4DAYA 3O13A 4HAEA 3HOVB 2FMMA 2EYOA 1LTTD 3BDLA 1EY4A 2EYMA 1LO5D 4IFDI 4CKEA 1ENAA 4G7OC 3T16A 4CBVA 1ET6A 1CA6A 3QO2A 1JOKA 1LT4D 2NYZD 2A6HD 4DK1A 1U4PA 1V8QA 1JC7A 3NHHA 2SNSA 2H1EA 2YU9B 4E6IA 1NR2A 2A6EC 4LAAA 3L7ZC 1BCPC 4RFBA 2MGSA 1B2TA 2KA7A 4IFDH 5ISRA 5JEAH 1QNKA 1LT3D 3J80L 4IUTA 3D31A 1WTVA 2WAQB 3R8BA 2EOTA 1KABA 1SE3A 1S5CD 2K05A 3EA6A 2R61A 3DWPA 3ITPA 4C3IB 3ND8A 4QB4A 3HOYB 3PIO3 2SOBA 4L63B 1KLGD 1ZXTA 1E0BA 2K7VA 5I6WA 3T56B 4RA8A 3J81E 2K01A 1SNQA 1EEID 2V4DA 1DOKA 2F3WA 1I4GA 1TWCB 3I8ZA 4XYOA 2M00A 1Q90A 3I3CA 5BN3A 4XT3B 3OWEB 3AB9A 2HCCA 3JAME 1D6EC 4UDUC 3PUZA 4FXGC 3IFDA 5KYIA 1H9MA 3DEOA 2PQEA 3TP8A 1FYCA 4XXEA 1STBA 2NTSA 1CFMA 4J8QA 5DM73 2TSSA 1UNSA 4FO2A 3NBIA 4KV6A 2X6GA 1A2TA 1VF7A 4EQPA 5FK9C 4U673 1D1KA 4RKBA 5D14A 1GUTA 2F1MA 3OOCA 5LHY1 4OO1G 4V190 3C1FA 1R4PB 5EPKA 3DWAA 2XSCA 5K36H 4NP5A 1HUNA 3TP7A 3OHXC 1BXTA 2PNRC 3FDTA 2AWOA 5JVG3 1TT2A 3BVGA 1M8AA 4KKTA 4C1NI 5IGGA 1B3AA 1LTBD 3CKIB 2AQ2B 3SK6A 3TZUA 1SYDA 2K5QA 4PNYA 1OXUA 4KY6A 2C9OA 5M5YB 3EQLC 2BA0A 4KTAA 1PRTB 5D3IB 3VR3A 1NCVA 1ZEQX 4IQZA 4GZYC 2B63B 1QWYA 1HTPA 4S3SA 1TWAB 3H09A 2Z8LA 1IL8A 3C1EA 1WTQA 2WB1B 3F2UA 2NN6G 3A7LA 2R3ZA 4EQOA 3BVZA 1ET9A 3K6OA 4EGVA 3PO2B 3MAQA 1GJXA 1JE4A 4A93B 3FPPA 2IPKD 4V0BA 4J1MA 3KLSX 5IT9E 2WV6D 2NTTA 1RJTA 1PRTC 2GA4B 2J7ZA 2SNMA 2IJ0A 5C4ZA 4C3IG 1A15A 2WINB 2Z4HA 1G2SA 4U68A 1U4RA 4G57A 1DZ1A 4ABNA 4A3BB 1UAPA 3CU7A 1K8OA 1L0YB 1ILPA 2Q8RE 4XTCS 1F77A 3A54A 3D3RA 2A5HA 1M4VA 2QEJC 1F9PA 4FF2A 2ZXPA 3EROA 2PYKA 3NQTA 1S5BD 3U9SA 1FNWA 4OIKA 5C3XA 1CQVA 5KGUA 4ZUIA 4NDXA 4DGZA 1VMCA 1SYEA 4KY7A 3HGBA 5DM63 1PLFA 1F2ZA 2CW0D 2NB0A 4QIWB 1QNUA 1ZYRD 3R2TA 1D2BA 4DF7A 2R92B 2RBMA 2OEOA 5KEEA 2ICEC 2B2TA 2MHVA 2E74C 3TZDA 1JWSD 4K8IA 5EBCA 2JP1A 2PZUA 3SK8A 3BG3A 3C46A 2PMZB 4G4KA 2ID0A 3VYTA 3MVVA 3PUXA 3DUZA 5EKLA 3OIPA 2EJMA 4OL7A 2E76C 3G7LA 1YNND 4A3MB 4K8JA 2K1BA 4KKSA 2B2UA 2VUMB 1BO0A 1SYFA 5CV7A 4DNRB 1K83B 1EU3A 1C4QA 1JOOA 4BS9A 3MFYA 3MXGA 1F2YA 4X3KA 1T5EA 4ZLTF 1AP0A 2K32A 2QDBA 1EOTA 2BDNA 5ELBA 1SFOB 3GTMB 1JOQA 2PCFB 1GUNA 1PXUA 1PZJD 1TS3A 4M1UB 1EWCA 4ZKBB 2FFKB 3N52A 1JCKB 1X3PA 1SYBA 5D65A 2OF1A 4RCOA 1PTOB 3M3YB 2A69D 3SEBA 2Q8IB 2DY7A 2JA7B 1BF4A 3NWSA 1LTSD 1LTID 1KDAA 4ZYSA 4G7ZC 1KAAA 4R9WA 4K5VA 1IYVA 4HSPA 2HUGA 2HQEA 1E2WA 5IOCA 2RQXA 3I4LA 5HURA 5ELDA 2R6GA 1D5MC 3H91A 2F0UA 2F0EA 3LWEA 3BS1A 2O5JC 5A2QL 4RGTA 1PTOC 2B2WA 1B44D 5J22A 3TDQA 5IGCA 4ZK9B 2L11A 1FNVA 3KLSA 3S16B 1D5XC 1CQFA 2F0OA 4XIGS 2M2LA 3Q0AA 2JEBI 1QB5D 1EY0A 4MHEA 1EEFD 1O7YA 2F0QA 2CHBD 2E75C 1SXTA 3E6ZX 3P1HA 3SVMA 5IGFA 5I9OA 5JPNC 2VNUD 4X3TA 1SEBD 3X3NA 3RUZA 1X3QA 4H7BA 2ZXOA 3GTOB 1Q1BA 2B2YC 1ENCA 4RHSA 2E2HB 2QILA 3TBIB 2RSOA 2K33A 3PUVA 3IAYA 2EE1A 1CA5A 4FP5D 2NBFA 3TP5A 2PO4A 2XN9C 2X69A 1S4ZA 2EYHA 4JK1C 1ZKOA 3K5NA 4CGYB 4A3IB 5FO9B 3M4OB 1HQMC 1HUMA 5T1GA 3SXHA 3NQIA 5JPMC 4PV1C 3Q23A 1GUOA 3UI2A 1VF5C 1DONA 1AEXA 4RAUC 1V43A 2BE5D 1ONLA 4DFAA 1JR0D 4PMBA 1JORA 1G6ZA 3CQZB 1WTPA 3RMHA 4PMWA 5C0XG 1I6VC 2KCCA 2NVXB 2B2VA 5CBAE 3SR1A 4HN7A 1E2VA 3RD4A 1SNCA 3Q24A 2Z4IA 3LNNA 3K57A 2IT1A 2PPBC 1Y69U 3KLRA 2L9HA 1XWEA 2ZXRA 3T51B 3QWNA 3ND9A 3V96A 1WD1A 4ZAIA 3I4NB 2F0TA 1MSHA 4KK7A 1SMYD 1DOMA 4DK0A 1JWMD 1B50A 4ZUJA 4XT1B 1EIHA 2O4XA 3OWFA 5M3FB 3PIP3 2G9HD 1STNA 3D8GA 3LWUA 2A6HC 5CV6A 2EJFC 5CV4A 4DN4M 5IGEA 5NUCA 1Z47A 2EPBA 1FD7D 1GHKA 3A7AB 1A3VA 3LX0A 4QMGA 2JA5B 2L1BA 5C3EB 1EYAA 4PQXA 3EJIA 4Y7NB 1D1IA 3BYTB 3QOLA 1RHPA 1SNDA 4CHTB 3I91A 4C2MB 3T13A 1LLRD 4I7ZC 3K5MA 3S15B 1CZGA 3J81L 2PZTA 1MBYA 2MPMA 3ERQA 2LY7A 4HTHA 4BY7B 3KBXA 3OPOA 3A8KE 5T1IA 5FLXL 2QCPX 1XYIA 1EIGA 1OXXK 2JYOA 4X3UA 1W6JA 3HEJA 2RA4A 1WD0A 2BCOA 2YYZA 1QG7A 1NAPA 1OXSC 3FPUB 3Q22A 4K5WA 1YNJD 1HFNA 1EZ8A 1V1OA 4I65A 2LKVA 3HG9A 4K6LA 3D4WA 2KECA 4WJWA 3NUCA 3NTIA 1OXVA 3K5OA 1SJHD 5EPJA 3MA2B 2IX0A 2J0TD 1FGBD 3MWYW 2DNEA 1CM9A 1RDPD 2FINB 4G7HC 4YIJA 1F9RA 4K2KA 1SNPA 1HXYD 4WORA 2EYJA 4DAPA 1A6XA 1HHVA 1LTAD 1II3A 1W6KA 4K6DA 2PZWA 4A3KB 4KJOA 1CHPD 1TY0A 3W2DA 3A55A 1WCMB 1G2TA 2F0SA 2EY2A 2IL8A 5M5XB 2KCNA 2N55A 5EGTA 2F0GA 1ICWA 1NUCA 3DHQA 1G91A 3NXWA 4F8MA 4KD3A 1SSOA 4L6TB 2NWGA 4HCEA 1DM0B 1Y8OB 2F0PA 2EYLA 2DN8A 4IUVA 1BCPF 4DNTB 4HMIA 2KQ3A 3S17B 3OSOA 5C4XB 1STHA 3OMGA 4NMZA 3BYYB 4A3EB 1RTNA 4A3DB 2EZVA 1JWUD 3GP7A 3BZDB 5C0XJ 5CV8A 1I50B 5K5PA 5C6AA 1MI2A 1EU4A 3L3OC 4RGNA 2PW7A 1Z7TA 3GTQB 2MUYA 5JAVA 1Y8PB 5DNFA 1Q12A 1DJRD 2IX1A 5HGTA 2KJXA 2HDMA 2IX3A 1CI3M 4FNFA 1TWFB 5C0XI 4RGOS 3V05A 4FYDA 2K04A 4DXGA 3X3MA 4NKLA 4UAIA 5KIXA 4HEDA 1U4MA 2JA8B 2KHSA 1IW7D 1SBBB 2WACA 1S5DD 3A8IE 4ID6A 1GUSA 4FXDA 2CW0C 2VXWA 1ZYRC 4LK1C 2O2LD 1LACA 1ESFA 3S2HB 1QOHA 1TQOA 2KEEA 5C0XH 4IUUA 5F2DA 5KNCA 1H9KA 2A68D 3HOZB 3L9AX 2NVYB 3E0JA 5E4XA 1GOZA 3URYA 5IGBA 3QG1A 2I46A 4ZKCB 3S1NB 1XXGA 1DYQA 1GUGA 1HPCA 1WTXA 3ONAB 1O78A 1YNNC 1Z6HA 1HTLD 1TS5A 4RKLA 1IKMA 3WOFA 2E2DC 4KHVA 4KHZA 1J8IA 3S1RB 1ML0D 4F88A 1H9RA 1BQQT 1WTWA 2F0WA 4DU9A 1RCVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG3 A;  1Z7T A;  1H9S A;  2EJG C;  4H13 C;  1Q90 A;  1IYV A;  1O7L A;  2D2C C;  5BN3 A;  1Y8P B;  1GHK A;  1TU2 B;  1E2W A;  1Q12 A;  3A7A B;  4H44 C;  3CRL C;  4JK1 C;  3AB9 A;  1ZKO A;  3BDO A;  3QIA A;  3I4L A;  3WDN A;  4LJZ C;  2R6G A;  3QJY A;  2QF7 A;  2D5D A;  1HQM C;  3GD7 A;  2EVB A;  3GQB A;  2NN6 G;  4G7H C;  2JE6 I;  3PUX A;  2JEA I;  3VR4 A;  3PUZ A;  1LAB A;  3A7L A;  4KN7 C;  1CI3 M;  3MXU A;  2AUJ D;  4PV1 C;  2BA1 A;  2EJM A;  1H9M A;  4TQU S;  1A6X A;  1DCZ A;  1GUO A;  2AUK A;  1VCI A;  1VF5 C;  1GJX A;  1FYC A;  2E76 C;  1CFM A;  1V43 A;  2NN6 I;  4BA2 I;  2O5J C;  2BE5 D;  1ONL A;  3FPP A;  4G7O C;  1HCZ A;  2A68 C;  2D62 A;  5A35 A;  3M7N A;  3SDZ A;  3DXJ C;  3NE5 B;  1QJO A;  4KKS A;  1IW7 D;  1SMY C;  4I7Z C;  1H9J A;  5BN5 A;  3PV0 A;  2O5I C;  2A6H D;  5KND A;  1VF7 A;  4DK1 A;  4IFD G;  5JEA G;  5K36 G;  5C0X G;  1I6V C;  2KCC A;  3A8I E;  3W3A A;  4DNR B;  1V8Q A;  1YNJ C;  1GUS A;  1BDO A;  3SE0 A;  1GUT A;  2B8F A;  3MFY A;  4XIG S;  1B9N A;  2CW0 C;  4KI0 A;  1E2V A;  2F1M A;  1GHJ A;  3I73 A;  3OOC A;  1T5E A;  1ZYR C;  3IKJ A;  3N6R A;  3LNN A;  4LK1 C;  1LAC A;  2BDO A;  4KN4 C;  2A6E C;  3P20 A;  3L7Z C;  3OPO A;  4OO1 G;  2K32 A;  2IT1 A;  3H94 A;  1EWH A;  2DNC A;  2JEB I;  2KA7 A;  3A8K E;  2PPB C;  5JEA H;  4IFD H;  1Y69 U;  3KLR A;  5K36 H;  3D31 A;  5C0X H;  1DXM A;  1K8O A;  2E75 C;  2NN6 H;  4XTC S;  3T51 B;  3D4R A;  2PCF B;  1GUN A;  3OW7 A;  5KNC A;  2PNR C;  1IYU A;  1Y8O B;  3ND9 A;  2AWO A;  5BN4 A;  1OXX K;  1FR3 A;  2DN8 A;  1H9K A;  4BA1 I;  2ZT9 C;  2A68 D;  3ND8 A;  1Q1B A;  3PUW A;  1OXT A;  3U9S A;  3VR6 A;  3RLF A;  4DK0 A;  2JXM B;  4DNT B;  2A69 C;  2B8G A;  2LMC B;  2YYZ A;  4KKT A;  1H9S B;  1VDZ A;  3IFT A;  1OXS C;  3PUY A;  3HGB A;  4JBW A;  1PMR A;  3T53 B;  1Y8N B;  3VA7 A;  1G29 1;  2K7V A;  3QG1 A;  3CRK C;  3T56 B;  4HR7 B;  1TKW B;  4OGQ C;  3TZU A;  4L8J A;  1GUG A;  1HPC A;  1OXU A;  4KKU A;  2A69 D;  1DD2 A;  2BE5 C;  2L5T A;  1O78 A;  1YNN C;  4TKO B;  2Q8I B;  3I72 A;  1Z6H A;  2A6E D;  2K33 A;  3EQL C;  3PUV A;  4H0L C;  4RCN A;  1E2Z A;  2BA0 A;  2V4D A;  3VR5 A;  4KHZ A;  5KNB A;  1IW7 C;  1CTM A;  4OO1 H;  1OXV A;  3LWU A;  3FMC A;  2A6H C;  3M4Y A;  4KMU C;  1Q1E A;  1H9R A;  3VR3 A;  2EJF C;  1B9M A;  2E74 C;  3M85 A;  4IQZ A;  4GZY C;  3A8J E;  4G7Z C;  1K8M A;  3VR2 A;  1HTP A;  2DNE A;  2EDG A; 
#chains in the Genus database with same CATH topology
 1CKM A;  3K7A H;  2KCT A;  3G6J B;  1HRJ A;  1B1Z A;  1K3B C;  2EXZ A;  4C3H B;  1Q8I A;  4A3K G;  4C56 C;  3DM1 A;  5DEH A;  4APV A;  1WCM G;  4LMQ D;  1HNW L;  3NWT A;  1Y1V B;  1PDQ A;  2Z0S A;  3F2D A;  1X65 A;  2Q2U A;  4R4O A;  4L5Q A;  1NSN S;  4LNQ A;  2XWB B;  4A3G B;  4P2C B;  1HZC A;  3ULP A;  4BY1 B;  1BBW A;  1OO9 B;  4LF9 Q;  3H3V I;  2D62 A;  3MFG A;  1YHA A;  3SDZ A;  1LV9 A;  1K0R A;  2AWN A;  4IUR A;  5FO8 B;  2UUA Q;  1VQ9 A;  4AYB B;  1A3T A;  4C3J B;  5KND A;  2EY5 A;  2XWJ B;  3CHB D;  4O2D A;  1EYD A;  2B2T C;  5A2Q E;  1A3U A;  1VQD A;  1MJE A;  1EY5 A;  2R7Z H;  4IPG A;  4JW0 A;  5CGK A;  1JJC B;  4KI0 A;  2PQA A;  1FNU A;  1I4P A;  4CKB A;  1U9R A;  1K8G A;  2YV5 A;  1Q7Y C;  4KN4 C;  3GTJ H;  1N8R C;  3SK5 A;  2XRQ D;  3PO3 B;  3E9H A;  4AIM A;  1K73 C;  5ELC A;  4WFN 3;  4FF4 A;  5C4X G;  2VB3 X;  1PRT F;  3HOW H;  4OO1 I;  4A3E G;  4OX9 L;  4A3D G;  1ROD A;  4OWX B;  1PH7 A;  3J7A F;  3GTO H;  2MJ8 A;  3I4M B;  3EBE A;  1F9S A;  2VB2 X;  4IUQ A;  5J1Z A;  3RLF A;  4LW1 A;  1PFN A;  2B2U C;  3L0O A;  1R9T B;  1NNX A;  2E2H H;  2FMC A;  4DV7 Q;  1C9O A;  2WAQ E;  4AQY L;  4JBW A;  3EN2 A;  1Y8N B;  4IN3 A;  3VA7 A;  2K03 A;  3AMU A;  4Q0F A;  2VW9 A;  4DXF A;  3AU7 A;  1DD2 A;  1YIJ A;  3STB D;  1V1P A;  3AEV A;  5COR A;  4BBR B;  1SE2 A;  3GTG B;  1IZ6 A;  4OO1 H;  1UUP A;  1SDF A;  3FMC A;  1EY7 A;  1KAW A;  3M4Y A;  5LL6 X;  1B9M A;  5J39 A;  4A3C H;  4JOI A;  3S2D B;  1K8M A;  1DOL A;  1MD2 D;  2OQ0 A;  3PMF A;  2WII B;  1HQR D;  3FKI H;  1T9H A;  4A3I H;  2ZM6 Q;  3WWV A;  1I4Q A;  4O0A A;  2AQ1 B;  4H44 C;  5I4D A;  1PZK D;  4DUZ Q;  2JA8 G;  3J7Y W;  4LF4 Q;  3BVM A;  1HH2 P;  2N88 A;  3NEN A;  3KF8 A;  4IOA A;  1ILQ A;  2AUJ D;  2KHJ A;  4JV5 Q;  3D4D A;  1BUV T;  4RMF A;  1XTD A;  1TWG H;  2ICI A;  2JQO A;  1BBX C;  2NN6 I;  4BA2 I;  1JQY D;  5D3D A;  1XJV A;  5A35 A;  3Q6S A;  3KK7 A;  4TRD A;  4TSS A;  4X65 Q;  1PVO A;  4MTK A;  3NE5 B;  1BVS A;  1X3G A;  3CCQ A;  5C44 B;  1ASY A;  2E8G A;  3VA5 A;  2F0K A;  4ILW A;  5LL6 S;  3HOV H;  3S1Q B;  1U5K A;  4IOC A;  3G71 A;  2Z1C A;  4DV3 L;  1CKN A;  2YTY A;  4MN3 A;  2E5L Q;  2F0H A;  2CQO A;  1XTC D;  3U9O A;  4CDC C;  3TP6 A;  3OTO L;  1D8L A;  1C48 A;  3GTL B;  3CME A;  2QA4 A;  3R93 A;  3DWQ A;  3JC6 6;  4DV6 Q;  2KBN A;  4NW2 A;  5EKK A;  2L55 A;  2NN6 H;  4CKC A;  3I4N H;  3OW7 A;  3B6Y A;  1IYU A;  2K5N A;  1ESR A;  4IZ8 A;  5COY A;  2Z6B A;  1FR3 A;  2ENB A;  3CCU A;  4O42 A;  1JB3 A;  1EFW A;  1MSG A;  2B2W C;  3PUW A;  2Y0S B;  5G3L F;  1HNW Q;  2DY8 A;  2XNA C;  4P72 A;  1KRS A;  2RHS B;  2K5D A;  3KBG A;  2RDH A;  4LUV A;  4F7X A;  1SYG A;  5EKI A;  4HR7 B;  5C3W A;  2R93 B;  4DR1 Q;  2F03 A;  1NY4 A;  4C3H G;  4NPS A;  2BE5 C;  1BR9 A;  2A6E D;  5GRO A;  1EFI D;  1TVX A;  1BCP D;  2A73 B;  1JT8 A;  3FVQ A;  1CTM A;  5KNB A;  1UE1 A;  3J80 E;  3I56 A;  3RN2 A;  1C7Y A;  5E3F A;  4A3G G;  1IKL A;  4R4T A;  3WOE A;  4BY1 G;  2D2C C;  1FGU A;  4FF3 A;  3CRL C;  3I55 A;  3CCR A;  4QUF A;  4Z9C B;  3GD7 A;  4AYB G;  3D0F A;  5C3E H;  4C3J G;  4DR7 L;  1EY6 A;  1CKN B;  3HOX B;  4IUP A;  4JPB W;  5M9O A;  4OX9 Q;  4A3F G;  4A3J B;  5E1F A;  1PH9 A;  4HID A;  1STY A;  5I2X A;  1GVP A;  1L1O A;  4NB3 A;  4POG A;  3PO3 G;  1UE6 A;  1N32 L;  1AZP A;  1TS2 A;  1WVL A;  1SMY C;  1X3E A;  5BN5 A;  1S5E D;  1SAP A;  4AQY Q;  1S72 A;  3S9W A;  4JBK A;  1F9Q A;  1LT5 D;  3GDE A;  3W3A A;  1VQ8 A;  4DR2 L;  2TMP A;  4FXK C;  5GAE C;  3SE0 A;  1C8C A;  4DV0 L;  4JI7 L;  4HIO A;  3PCO B;  1YVC A;  1EY8 A;  1GHJ A;  2NVT B;  4BY7 H;  3I4M G;  1P8L A;  1PTO F;  4GN3 B;  1AE2 A;  2JA6 B;  3CF5 A;  3IL8 A;  2LFN A;  3H94 A;  1EWH A;  2MP1 A;  1KHI A;  2UXD L;  4EQN A;  1KTK A;  3I70 A;  2F4I A;  3DEP A;  4FVM A;  1IL2 A;  2OTJ A;  1TY2 A;  4N9T A;  4ZQ3 A;  4RHR A;  4DA2 A;  2RSN A;  2MFI A;  4C1N K;  1SYC A;  2K5W A;  3HS0 C;  3MXN A;  1E3P A;  2NZ1 D;  2ZT9 C;  2ATW A;  2F3I A;  1NR4 A;  4KJN A;  2PI2 E;  1X9N A;  5I6Y A;  4BBR G;  5J3B A;  5FLX E;  2JXM B;  2R7D A;  4B9W A;  5FJ8 H;  1PFM A;  4LUZ A;  5IWA Q;  4KLK A;  2P5Z X;  1SE4 A;  1QIL A;  2WKC A;  1I3Q B;  5ELF A;  1STG A;  2B2V C;  2D0O A;  1A2U A;  1AW7 A;  1B4O A;  1SNO A;  3I72 A;  4RCN A;  3VR5 A;  3J7A 5;  1Y14 B;  3EVQ A;  3HRZ C;  5ELE A;  1LTL A;  1SRU A;  4JI8 L;  3NEM A;  3JAM L;  3CPW A;  1YEZ A;  3MC0 B;  3NEL A;  3M85 A;  3KJO A;  3RLO A;  5DAU A;  3KFU A;  4ZRZ A;  3OTO Q;  3EFX D;  2V1C C;  5LMU L;  4DV2 L;  4ZCK A;  1O7Z A;  5M5Y H;  2QF7 A;  2JEA I;  5C44 G;  2JE6 I;  3VR4 A;  1O7I A;  2EYP A;  2CH4 A;  1Y1W B;  1XPR A;  2K75 A;  4WRD A;  2G9D A;  2PMZ E;  1DCZ A;  2AUK A;  1YIT A;  4JYA L;  3KUP A;  3MEH A;  2B63 H;  4YHH L;  3FEW X;  2HCI A;  4LF8 L;  3NP8 A;  3T4A C;  3F2B A;  2BOS A;  4BWG B;  1EL0 A;  3T1Y Q;  1WCM H;  3CCM A;  4HCS A;  5M5X H;  1PYB A;  1MIU A;  5EBD A;  1KDB A;  4LF6 L;  5IP7 H;  1FVI A;  4B08 A;  4DKA C;  2KED A;  1YNJ C;  3UDX A;  1VMP A;  1BDO A;  3GV6 A;  3K7U C;  2B8F A;  4O1N A;  4GNX A;  4N9P A;  1X32 A;  3N6R A;  4QF4 A;  2PW5 A;  4JBJ A;  1S5F D;  4DR5 Q;  1TXY A;  5DLQ E;  2Y0S G;  1JJ2 A;  4RGM A;  2ZTE A;  3NSW A;  2PI2 A;  1TII D;  1PZI D;  1DXM A;  2A74 C;  4A3L H;  2B39 A;  1XNR Q;  1B53 A;  1IBL L;  2I5H A;  5KYL A;  2CWP A;  3NPP A;  3KF6 A;  4LFB L;  4A75 A;  2R93 G;  5CV5 A;  2K6A A;  5FKA C;  1AH9 A;  3KYH C;  5C4J B;  3H6M A;  5CR3 A;  2NVQ B;  2EYF A;  3TSS A;  1A63 A;  2Z6K A;  3MZ5 A;  4DR7 Q;  2KOL A;  3R2I A;  2KEN A;  5C4X H;  2B8G A;  3IFT A;  1PRT D;  4RH6 A;  3K59 A;  4A3B H;  3NTH A;  2A1A A;  4A3E H;  1CUK A;  1G29 1;  1K9M C;  1GUW A;  1CHQ D;  1BBU A;  4WJ4 A;  4X3S A;  1TKW B;  1GXD C;  1EQV A;  5CBE E;  4L8J A;  2HHH L;  2LXK A;  2F0F A;  3K8A A;  3RZO B;  4HJ7 A;  4H0L C;  1E2Z A;  4MTN A;  2RCF A;  1I50 H;  2N78 A;  2AQ3 B;  1EUJ A;  3HOX G;  1TWH B;  2K28 A;  1J9O A;  2Q2I A;  1EOV A;  4DV0 Q;  4A3J G;  3VR2 A;  3TME A;  5IE8 A;  1EQT A;  1H9S A;  5M3M B;  4H13 C;  2NUC A;  2H4O A;  3K81 C;  5JOB A;  4XQN A;  2R7F A;  3ICE A;  3QIA A;  3J7Z C;  1KNA A;  1PYW D;  4MIU A;  1UEA B;  3GQB A;  2D5D A;  3VYU A;  2CCZ A;  3ER0 A;  2R92 H;  1IHZ A;  4NXN Q;  1LAB A;  5IOD A;  1BOS A;  5AJ3 Q;  2KUM A;  2Q8T A;  3RR5 A;  4L5S A;  2BA1 A;  3K0Y A;  1WTO A;  5IT9 L;  1G51 A;  1X3F A;  2IHE A;  2D9U A;  3HOY G;  1KLU D;  3I7F A;  4B3S L;  2LSS A;  5IYC G;  1RTO A;  2JA6 G;  3S1M B;  3H15 A;  2F4V L;  2E2J B;  5TSS A;  1R4Q B;  1RKN A;  2O5I C;  4XQJ A;  1P16 A;  5IYD H;  1N36 L;  4IFD G;  5JEA G;  1I6H B;  2HQL A;  3GTK B;  4ODG A;  1I5F A;  1SN8 A;  3I73 A;  4OHJ A;  3S2H H;  4GOP B;  4OIJ A;  5JVH 3;  2BDO A;  3P20 A;  1L0W A;  5I9P A;  2I5L X;  3E9I A;  3HOU B;  2DNC A;  5C4H A;  1SJE D;  3HP3 A;  4K14 A;  5IGD A;  1F2M A;  2HDL A;  2WFW A;  2CWA A;  2WKD A;  2J4X A;  3QB3 A;  2NZO A;  5BN4 A;  1I4H A;  1HFG A;  3HOZ H;  4JI6 L;  2K14 A;  1AZQ A;  2L12 A;  4HJA A;  2RDG A;  1AFP A;  2NVY H;  2L4N A;  2E2I B;  3IRB A;  4ME5 A;  2LMC B;  1H9S B;  1PH5 A;  4QUC A;  1PMR A;  1WYD A;  1SFO H;  4YHH Q;  1LT6 D;  5KRU A;  3J7A V;  1WTR A;  2SEB D;  4LF8 Q;  3CC2 A;  4X66 Q;  1CT1 D;  1KNE A;  4R8I A;  4UHV A;  4TKO B;  3MXP A;  5G3L D;  4GOP C;  1Q82 C;  4B3M L;  3S1R H;  1IW7 C;  5CV9 A;  1HA6 A;  2RKS A;  4K2L A;  3GV3 A;  2F0N A;  4CJ0 B;  3K58 A;  5IP9 H;  1Q46 A;  1EZ6 A;  1QCB D;  4DAV A;  1HA5 A;  3D4R A;  3SHL A;  3NTK A;  2RVL A;  5FOB B;  2VQE L;  5CMD A;  2Q2H A;  3NBH A;  3GTP B;  5JJI A;  1PTO H;  2FJ2 A;  3VYR A;  1JIC A;  4F87 A;  1G8Z D;  4LJZ C;  1Y1V H;  3PIP A;  2QGQ A;  3LGJ A;  4X64 L;  1EQR A;  2QKI C;  3A56 A;  3S14 B;  1U4L A;  2EY1 A;  4BXX H;  1VQP A;  2X6L A;  4KN7 C;  3V2T A;  1IBL Q;  5CYU A;  5IT9 c;  1KD1 C;  3VYS A;  2HD3 A;  3MTS A;  4OWW B;  1WTH A;  1QVG A;  1MGS A;  2A68 C;  3PIO A;  3M7N A;  3P7J A;  2B2Y A;  3D6W A;  3FRP B;  1S3O A;  4IAL A;  4POF A;  1EYC A;  2SDF A;  3PV0 A;  1T5X D;  2UUC L;  1QUQ B;  3E3X A;  1N34 Q;  5K36 G;  4DV1 L;  1YNX A;  3E0E A;  2N49 A;  4K5X A;  5FLM G;  4JI5 L;  2RHQ B;  5H1S E;  2DGY A;  1B9N A;  2XRS D;  5IYB H;  3IKJ A;  2OXP A;  2VY3 A;  1VQE A;  3RZD B;  3W5O A;  3QOJ A;  3A5U A;  3OMC A;  1IYJ B;  3E5S A;  5E4W C;  4ULL A;  1PH6 A;  3CC4 A;  3S16 H;  2UXC L;  1I4X A;  2CVR A;  2F0I A;  2Y0S E;  4QCL A;  2ZJR A;  3K5L A;  3I90 A;  1LTG D;  1I4R A;  4BA1 I;  1PTO D;  5GAD C;  1S40 A;  3CCL A;  4A3F B;  4WJ3 M;  4Q5V A;  1OXT A;  1R9T H;  1TS4 A;  3CXC A;  3C3L A;  2A69 C;  1PH3 A;  1O80 A;  1D5Z C;  1VDZ A;  5M5W B;  1LTR D;  1EY9 A;  1HR0 W;  1PA6 A;  3K7A B;  4KY5 A;  1PHJ A;  1A62 A;  5M3M G;  3G48 A;  1STA A;  2IW3 A;  3CRK C;  2NZH A;  1WOC A;  1XX8 A;  5CC4 A;  1A8V A;  2L5T A;  3TN2 A;  1SNM A;  1SR3 A;  3DM3 A;  1VQ5 A;  4RWS C;  3UDF A;  4A76 A;  2XVS A;  2UU9 L;  1RF2 D;  2KHI A;  1BNZ A;  1KDC A;  3SK4 A;  5AFW A;  3NK9 A;  2IHF A;  2F0V A;  2F0J A;  1AN8 A;  4IUN A;  4B9X A;  3DMU A;  3ZJY C;  3RN5 A;  4CJ2 C;  3QJY A;  2FHT A;  2C5C A;  2EVB A;  2XIW A;  5C5L A;  2M9V A;  2GVA A;  2R7Z B;  1TR5 A;  4ME3 A;  4TQU S;  4DV5 L;  1VQB A;  3R3O A;  1L0X B;  1VCI A;  1CZW A;  1CK1 A;  3CPF A;  1PFB A;  3GTJ B;  4JI6 Q;  3EIV A;  1HCZ A;  1QVF A;  1Q3L A;  3BDC A;  3BU2 A;  3DXJ C;  5C44 H;  3HOU G;  1QJO A;  1H9J A;  3P75 A;  2WP8 J;  1Q86 C;  3M4O H;  4KD4 A;  5BR8 L;  3C2P A;  3HOW B;  1UE7 A;  2IWH A;  4XDX A;  4K0K L;  1E22 A;  3PQI A;  1XNQ L;  3AQQ A;  3D6C A;  3RLN A;  5EJW A;  2PQA B;  4XYQ A;  3PF4 A;  1STE A;  1J6Q A;  4M8A A;  3STB C;  4B3M Q;  4EVO A;  2CH4 W;  5I2Y A;  4DR3 L;  2ZTC A;  5IIF A;  1ENF A;  1W3S A;  2OT2 A;  3CQZ H;  3HFZ B;  1KXL A;  4CJ1 B;  3H0G B;  3K80 C;  2VQE Q;  2ZJP A;  2RDF A;  3GO5 A;  2NVX H;  5EQ0 A;  2H5X A;  2LS0 1;  5LMN Q;  1F2L A;  3PSI A;  1MHW C;  3MHB A;  3J80 i;  1QE6 A;  2CQA A;  2MO1 A;  3ZYY X;  4PMC A;  4X64 Q;  2CFM A;  1B7Y B;  4HMJ A;  5JJZ A;  2L0C A;  1JMC A;  4HSV A;  3CCS A;  3PUY A;  2EY6 A;  1FL0 A;  2F0M A;  3H3V C;  3T53 B;  4GKJ L;  1JB7 A;  1AE3 A;  4XQQ A;  4J6H A;  3FKI B;  3HKZ B;  5EPL A;  4OGQ C;  1UE5 A;  2KVM A;  3OIQ A;  4KKU A;  2VUM G;  1V1P B;  4IFD J;  5JEA J;  3M7G A;  1XMQ L;  4BBS B;  1RD9 D;  1VQL A;  5FO7 B;  2F0D A;  4FF1 A;  3HZX A;  4KMU C;  2I07 B;  1Q1E A;  1C0A A;  4JI5 Q;  5EAY A;  1TWG B;  1YHB A;  3A8J E;  3MXU A;  3VR6 A;  2EDG A;  2F0L A;  2LXJ A;  2EJG C;  5M3F H;  1O7L A;  1OTC A;  1TU2 B;  2F3V A;  4R8N A;  2VQF L;  1BCP B;  3BDO A;  2JSO A;  5C5M A;  3WDN A;  5IY0 A;  2B3G A;  1GO3 E;  3O13 A;  3KF8 B;  4HAE A;  4DAY A;  1WFQ A;  2DJG C;  3HOV B;  2FMM A;  2EYO A;  1LTT D;  4EX5 A;  3BDL A;  2ASB A;  1EY4 A;  2EYM A;  1LO5 D;  1HJP A;  1EIY B;  4IFD I;  4CKE A;  1HR0 L;  2RF4 A;  1ENA A;  4G7O C;  3T16 A;  4CBV A;  1ET6 A;  1CA6 A;  3QO2 A;  3U58 A;  1JOK A;  1LT4 D;  2NYZ D;  2A6H D;  4DK1 A;  2JA5 H;  1U4P A;  1V8Q A;  1XPU A;  2NVT H;  4JOI C;  1JC7 A;  3NHH A;  4Y7N H;  3PF5 A;  2SNS A;  2H1E A;  1KQS A;  2YU9 B;  4E6I A;  5IYC H;  1YJN A;  1NR2 A;  4DR4 L;  2A6E C;  4LAA A;  3L7Z C;  4HJ9 A;  2UU9 Q;  1VQ6 A;  1BCP C;  4RFB A;  2MGS A;  4C2M H;  1B2T A;  2KA7 A;  4IFD H;  5ISR A;  5JEA H;  1QNK A;  1LT3 D;  3J80 L;  4IUT A;  3D31 A;  4JC0 A;  2G5D A;  1HNX L;  1WTV A;  4LWC A;  1CSP A;  2WAQ B;  3R8B A;  2EOT A;  1KAB A;  3S15 H;  1SE3 A;  1S5C D;  2K05 A;  3EA6 A;  2R61 A;  3DWP A;  3ITP A;  4C3I B;  1ICF B;  3ND8 A;  1E24 A;  4QB4 A;  3HOY B;  3PIO 3;  2SOB A;  4L63 B;  4DV5 Q;  4JI1 L;  1KLG D;  1ZXT A;  1E0B A;  2AHO B;  1V9P A;  2K7V A;  2KCM A;  3HKS A;  3G6E A;  5I6W A;  2EQS A;  3T56 B;  4RA8 A;  3J81 E;  2K01 A;  1SNQ A;  1EEI D;  3BZC A;  4QL5 A;  1M90 C;  1PH2 A;  2V4D A;  5ELO A;  1K3R A;  2K5V A;  1DOK A;  2F3W A;  1I4G A;  1TWC B;  3I8Z A;  4XYO A;  4K0K Q;  2R7Z G;  1W2B A;  1E1O A;  3AFP A;  1QZG A;  3I4O A;  2M00 A;  1Q90 A;  3I3C A;  5BN3 A;  4XT3 B;  3OWE B;  3AB9 A;  3TRE A;  4DR3 Q;  2HCC A;  3JAM E;  1D6E C;  4H02 A;  4UDU C;  3PUZ A;  4FXG C;  4IPH A;  1Y1W H;  3HOW G;  3IFD A;  4OEL B;  5KYI A;  1H9M A;  3DEO A;  1NBW A;  2PQE A;  3TP8 A;  1FYC A;  4XXE A;  1STB A;  2NTS A;  1CFM A;  4J8Q A;  4DV3 Q;  5DM7 3;  1L1O B;  2TSS A;  1UNS A;  4FO2 A;  3NBI A;  4KV6 A;  3A74 A;  3BJU A;  2X6G A;  4DR6 L;  1A2T A;  1VF7 A;  4EQP A;  4GKJ Q;  5FK9 C;  1Q81 C;  4AH6 A;  4YWK A;  3H0G G;  4JI0 L;  4U67 3;  1JE5 A;  1D1K A;  4RKB A;  5D14 A;  1GUT A;  2BH2 A;  2F1M A;  3OOC A;  3RNU A;  1XMQ Q;  5LHY 1;  4OO1 G;  4V19 0;  3C1F A;  1R4P B;  5EPK A;  3DWA A;  3OW2 A;  4A3K H;  2XSC A;  3J80 c;  3CMA A;  5K36 H;  4A3C G;  4NP5 A;  5FLM H;  1L2F A;  1HUN A;  3TP7 A;  3OHX C;  3U4Z A;  1BXT A;  3U4V A;  2PNR C;  3FDT A;  3FKI G;  3HKZ G;  2AWO A;  5C4J H;  3MXN B;  5JVG 3;  1VQ7 A;  1NE3 A;  4BBS G;  1L1O C;  1TT2 A;  4LF7 L;  3G4S A;  3BVG A;  1M8A A;  4KKT A;  4C1N I;  5IGG A;  1B3A A;  1LTB D;  3CKI B;  2AQ2 B;  3SK6 A;  3TZU A;  1SYD A;  1VS0 A;  2K5Q A;  4PNY A;  4Y52 H;  2A19 A;  3RZO H;  1A0I A;  1OXU A;  4KY6 A;  4JI3 L;  2C9O A;  1VQI A;  5M5Y B;  3T1H L;  3EQL C;  2BA0 A;  4DK6 C;  4IPD A;  4R4C A;  1TWH H;  4HIK A;  3HOV G;  1UEB A;  4KTA A;  4YCW A;  1PRT B;  5D3I B;  4MNO A;  1CKO A;  3VR3 A;  3CP0 A;  1NCV A;  1ZEQ X;  4J15 A;  3S17 H;  4IQZ A;  4GZY C;  2B63 B;  1HTP A;  1QWY A;  4S3S A;  1RIP A;  1TWA B;  3H09 A;  2Z8L A;  1IL8 A;  3C1E A;  4DR4 Q;  4A3D H;  1WTQ A;  2WB1 B;  3F2U A;  2JN4 A;  2NN6 G;  1HNX Q;  3I4N G;  1N32 Q;  3A7L A;  2A8V A;  2XTI A;  2R3Z A;  4EQO A;  1E1T A;  4I7A A;  3BVZ A;  3KDF A;  4QJF A;  1ET9 A;  3K6O A;  4EGV A;  3PO2 B;  4GN5 A;  3MAQ A;  1GJX A;  1JE4 A;  4DR2 Q;  1IXR A;  1FJG L;  3GTQ H;  4JI7 Q;  3FPP A;  4A93 B;  2IPK D;  4ALP A;  1VQK A;  4V0B A;  4J1M A;  4QGU A;  4R1J A;  3KLS X;  5FLX c;  1I6H H;  5IT9 E;  2WV6 D;  2NTT A;  1RJT A;  2JJQ A;  1PRT C;  2UXD Q;  2GA4 B;  3GTK H;  1JJG A;  2WAQ G;  2J7Z A;  2SNM A;  1K0S A;  4GNX B;  2IJ0 A;  1NJI C;  5C4Z A;  1TWF H;  4C3I G;  1A15 A;  2WIN B;  4N8X 1;  2UUA L;  2Z4H A;  1VQ4 A;  2Q2T A;  1G2S A;  4U68 A;  1U4R A;  4G57 A;  5GAG C;  1DZ1 A;  4AYB E;  3F1Z A;  4YY3 L;  4ABN A;  2JA8 H;  4A3B B;  1UAP A;  3CU7 A;  4FDB A;  1K8O A;  1L0Y B;  1QVC A;  1ILP A;  2Q8R E;  4XTC S;  2EXD A;  3UDI A;  1F77 A;  3A54 A;  2MNA A;  3D3R A;  3KF6 B;  4NXM L;  2A5H A;  1M4V A;  2QEJ C;  1F9P A;  4OON A;  4FF2 A;  2ZXP A;  1YZ6 A;  5C3E G;  3ERO A;  2PYK A;  3NQT A;  1S5B D;  3U9S A;  1FNW A;  4OIK A;  5C3X A;  1CQV A;  5KGU A;  4L5T A;  4ZUI A;  4NDX A;  4DGZ A;  1VMC A;  1SYE A;  4KY7 A;  3HGB A;  5DM6 3;  4JI8 Q;  3J81 j;  1YI2 A;  1PLF A;  1F2Z A;  2CW0 D;  2NB0 A;  4QIW B;  1QNU A;  1ZYR D;  3R2T A;  2N8N A;  4GNX C;  4OEM B;  4N8F A;  1D2B A;  2C35 B;  3TS0 A;  4DF7 A;  4JG2 A;  5LMU Q;  4DV2 Q;  1IBK L;  2R92 B;  4DR6 Q;  2RBM A;  2OEO A;  1UWV A;  5KEE A;  3FP9 A;  2ICE C;  4JI0 Q;  2B2T A;  2MHV A;  2E74 C;  3TZD A;  1JWS D;  4K8I A;  5EBC A;  3GTP H;  2JP1 A;  2PZU A;  3SK8 A;  4BY7 G;  3BG3 A;  3C46 A;  2PMZ B;  4JYA Q;  3S1N H;  4GKK L;  2QEX A;  1MKH A;  4G4K A;  2ID0 A;  3VYT A;  3MVV A;  2Z6K C;  2Z9H A;  3CCV A;  3PUX A;  3DUZ A;  5EKL A;  3OIP A;  2EJM A;  4OL7 A;  4LF6 Q;  1HNZ L;  2E76 C;  3UE1 A;  1N33 L;  3G7L A;  1YNN D;  4LF4 L;  2VZA A;  4A3M B;  4C3H H;  4K8J A;  2K1B A;  5FJ8 G;  4LF7 Q;  4KKS A;  2ZJQ A;  2B2U A;  2VUM B;  3M9B A;  2L15 A;  1BO0 A;  1EQQ A;  1SYF A;  5CV7 A;  4JI2 L;  3KOJ A;  4DNR B;  1K83 B;  1EU3 A;  2I5M X;  1C4Q A;  1JOO A;  4BS9 A;  3MFY A;  4A3G H;  4B3T L;  3MXG A;  4JI3 Q;  1F2Y A;  4X65 L;  4X3K A;  1T5E A;  4ZLT F;  3T1H Q;  4LFB Q;  3RZD H;  4BY1 H;  1AP0 A;  2K32 A;  2QDB A;  1EOT A;  2ZTD A;  1EWI A;  2BDN A;  5ELB A;  3KJP A;  1SFO B;  3GTM B;  2N3S A;  4PZ6 A;  4C3J H;  1JOQ A;  2PCF B;  4IO9 A;  1GUN A;  1PXU A;  4PG3 A;  4LFA L;  1WI5 A;  1PZJ D;  2D0P A;  1TS3 A;  4M1U B;  4A3F H;  1EWC A;  4PZ7 A;  4ZKB B;  2OCE A;  2HHH Q;  4OWT B;  1N9W A;  2JK8 A;  5M5W H;  3PO3 H;  2FFK B;  4YCU A;  1K28 A;  4DUY L;  3N52 A;  1JCK B;  2B63 G;  1X3P A;  1SYB A;  3M4P A;  3TRZ A;  4JCV E;  4GLA C;  4YWL A;  1FJG Q;  5D65 A;  2OF1 A;  4RCO A;  1PTO B;  3M3Y B;  2A69 D;  3SEB A;  4MZ9 A;  2Q8I B;  3U50 C;  2DY7 A;  2WB1 G;  2JA7 B;  1BF4 A;  3TQY A;  3I4M H;  3NWS A;  1LTS D;  3FHW A;  5IP7 G;  1LTI D;  1KDA A;  4ZYS A;  4DR1 L;  4G7Z C;  1KAA A;  3PO2 G;  4R9W A;  3NBH B;  2K50 A;  4K5V A;  1IYV A;  3MEF A;  4HSP A;  2HUG A;  4DAM A;  2HQE A;  4A93 G;  1E2W A;  5IOC A;  2RQX A;  4B3S Q;  3I4L A;  5HUR A;  4YY3 Q;  5ELD A;  2R6G A;  4A3L G;  4BBR H;  1D5M C;  2UUB L;  3ERS X;  2DJF C;  2F4V Q;  3GTG H;  3H91 A;  4LFC L;  2F0U A;  2HT1 A;  1J5E L;  1N36 Q;  4NXM Q;  1HZA A;  4P71 A;  4R4Q A;  2F0E A;  3LWE A;  3BS1 A;  3S2D H;  2O5J C;  1EYG A;  5A2Q L;  3CD6 A;  4RGT A;  1PTO C;  2B2W A;  3CW2 C;  1B44 D;  5J22 A;  3TDQ A;  5IGC A;  4ZK9 B;  3CCJ A;  1K8A C;  3H3V H;  2L11 A;  1PV4 A;  1FNV A;  4A3B G;  3KLS A;  3S16 B;  1D5X C;  1CQF A;  1LM0 A;  2F0O A;  4XIG S;  2M2L A;  2AKW B;  4UPA A;  3Q0A A;  1IBK Q;  2JEB I;  2OQK A;  1QB5 D;  1EY0 A;  1EEF D;  4MHE A;  1O7Y A;  3H0G H;  2F0Q A;  2CHB D;  2E75 C;  1SXT A;  2F52 A;  3E6Z X;  3P1H A;  3SVM A;  5IGF A;  5I9O A;  5JPN C;  2VNU D;  4X3T A;  1Q8K A;  3S1Q H;  1SEB D;  3X3N A;  3RUZ A;  1VQO A;  4GKK Q;  1X3Q A;  4YCV A;  4H7B A;  2ZXO A;  5HGQ A;  1LYL A;  3GTO B;  2R92 G;  1Q1B A;  2B2Y C;  3GTL H;  1ENC A;  4RHS A;  3QR8 A;  2E2H B;  2QIL A;  1HNZ Q;  3TS2 A;  1N33 Q;  1YJ9 A;  3TBI B;  4BBS H;  2RSO A;  2K33 A;  3PUV A;  3IAY A;  4JI4 L;  5IYD G;  5IWA L;  2K4K A;  4JI2 Q;  2EE1 A;  1YBY A;  4HIM A;  1CA5 A;  4FP5 D;  2NBF A;  2YTX A;  4P73 A;  3TP5 A;  4B3T Q;  3VDY A;  2PO4 A;  4B3R L;  4KHP L;  2XN9 C;  2X69 A;  2IY5 B;  1X6O A;  4CDD C;  1S4Z A;  2EYH A;  2R93 H;  4A3M G;  4JK1 C;  1D7Q A;  1ZKO A;  3K5N A;  4CGY B;  4A3I B;  4LF5 L;  5FO9 B;  3M4O B;  1HQM C;  2FXQ A;  1HUM A;  1PFS A;  1VQG A;  3NQI A;  5T1G A;  3SXH A;  5JPM C;  1DGS A;  2OTL A;  4LFA Q;  4PV1 C;  2UUC Q;  3Q23 A;  1EIF A;  1B70 B;  1GUO A;  4DV1 Q;  3UI2 A;  1SE8 A;  1VF5 C;  4UP9 A;  1AEX A;  1DON A;  3HOZ G;  4RAU C;  1V43 A;  2BE5 D;  1ONL A;  4DFA A;  4PZ8 A;  1JR0 D;  1SMX A;  4PMB A;  1JOR A;  3F8T A;  1G6Z A;  3CQZ B;  1WTP A;  3RMH A;  4DUY Q;  2I0Q A;  4PMW A;  3I2Z A;  5C0X G;  1I6V C;  2KCC A;  3HOX H;  4TVA B;  2NVX B;  2B2V A;  5CBA E;  3SR1 A;  2UXC Q;  2YU9 H;  4HN7 A;  1E2V A;  4A3J H;  3RD4 A;  1SNC A;  3Q24 A;  3T1Y L;  2Z4I A;  3LNN A;  3M4Q A;  3K57 A;  2ALY B;  2IT1 A;  2VL6 A;  1NMG A;  5IP9 G;  2PPB C;  1Y69 U;  4GN4 B;  3KLR A;  2L9H A;  1XWE A;  3L2P A;  3J81 i;  2ZXR A;  3T51 B;  3QWN A;  3ND9 A;  4QY7 A;  3V96 A;  1WD1 A;  4ZAI A;  4C3I H;  3I4N B;  4DR5 L;  3ULJ A;  2F0T A;  2MQH A;  2JA7 G;  3HOY H;  1Y1V G;  1MSH A;  4KK7 A;  2UUB Q;  1SMY D;  4BXX G;  1DOM A;  4DK0 A;  4LFC Q;  1JWM D;  2JA6 H;  4ZUJ A;  1B50 A;  1XNR L;  5GQO A;  4XT1 B;  1J5E Q;  1EIH A;  2O4X A;  3OWF A;  5M3F B;  1VQJ A;  3PIP 3;  2G9H D;  3JAM i;  1G6P A;  2DUD A;  5JJL A;  1STN A;  1TWC H;  3D8G A;  5ELN A;  3LWU A;  1KRT A;  2A6H C;  5CV6 A;  1YHQ A;  2EJF C;  5CV4 A;  2WB1 E;  4DN4 M;  5IYB G;  5IGE A;  5NUC A;  4LUO A;  1Z47 A;  2EPB A;  2ES2 A;  1I3Q H;  1FD7 D;  1GHK A;  3A7A B;  1A3V A;  3LX0 A;  4DV4 L;  2QW7 A;  4DAY B;  4IJH A;  4QMG A;  1RL2 A;  1PH1 A;  2JA5 B;  2L1B A;  5HY6 A;  5C3E B;  1EYA A;  4PQX A;  4JVZ A;  3EJI A;  3ULL A;  1XMO L;  4Y7N B;  1D1I A;  5BR8 Q;  3BYT B;  2HIV A;  3QOL A;  4GS3 A;  1XNQ Q;  1RHP A;  1SND A;  4CHT B;  3I91 A;  3W1B A;  4C2M B;  3T13 A;  4NXN L;  1KC8 C;  5AJ3 L;  1LLR D;  1X55 A;  4I7Z C;  3K5M A;  4EQ5 A;  2GVB A;  2PNH A;  3S15 B;  1CZG A;  3J81 L;  4X6A H;  2PZT A;  4RG1 A;  3S24 A;  1MBY A;  1X54 A;  3OYY A;  2MPM A;  1GM5 A;  3ERQ A;  4JI4 Q;  2LY7 A;  4HTH A;  1I94 L;  4BY7 B;  3KBX A;  3OPO A;  4X62 L;  1PH8 A;  3A8K E;  2K52 A;  1KIX A;  5T1I A;  2QDL A;  5FLX L;  4B3R Q;  4KHP Q;  2QCP X;  1XYI A;  1EIG A;  1OXX K;  2GN5 A;  2JYO A;  4X3U A;  4LF5 Q;  1W6J A;  1M1K C;  2VS1 A;  5E7N A;  1IBM L;  3HEJ A;  4QQB X;  2RA4 A;  1WD0 A;  4QIW E;  2BCO A;  2YYZ A;  4HJ8 A;  1QG7 A;  1NAP A;  1OXS C;  1VQA A;  3FPU B;  3Q22 A;  4K5W A;  1YNJ D;  1E7Z A;  1EZ8 A;  4A4I A;  1HFN A;  4UP7 A;  1V1O A;  4I65 A;  3DLL A;  2LKV A;  3HG9 A;  3Q8D A;  4K6L A;  3D4W A;  2KEC A;  4A3I G;  4WJW A;  3NUC A;  2NVQ H;  2VQF Q;  3NTI A;  1VQH A;  2AMC B;  1OXV A;  3K5O A;  1SJH D;  5EPJ A;  3MA2 B;  2IX0 A;  2J0T D;  1FGB D;  3MWY W;  3KLW A;  4X66 L;  2UXB L;  1TWA H;  2DNE A;  1CM9 A;  1RDP D;  1HR0 Q;  4IPC A;  3TEH B;  2MO0 A;  2FIN B;  1XPO A;  4DNI A;  1KL9 A;  4G7H C;  4YIJ A;  1F9R A;  4K2K A;  1SNP A;  1HXY D;  4WOR A;  3A5Z B;  2EYJ A;  4HJ5 A;  3PO2 H;  1V1Q A;  4DAP A;  1A6X A;  3K0X A;  1HHV A;  1LTA D;  4A93 H;  1II3 A;  5M3M H;  3AFQ A;  1W6K A;  4K6D A;  2PZW A;  4A3K B;  4KJO A;  1CHP D;  1TY0 A;  3W2D A;  1X56 A;  1U0L A;  1WCM B;  3A55 A;  2F0S A;  1G2T A;  3CAM A;  2EY2 A;  4DK3 C;  5LMN W;  2IL8 A;  5M5X B;  2RCN A;  2KCN A;  4IJL A;  2N55 A;  4OXP A;  5EGT A;  2F0G A;  1ICW A;  1NUC A;  3DHQ A;  1SRO A;  1MJC A;  3J81 c;  1G91 A;  3NXW A;  2HIX A;  4F8M A;  4GOP A;  4KD3 A;  1SSO A;  4L6T B;  2NWG A;  1N34 L;  3S1M H;  2E2J H;  4HCE A;  2EIF A;  1B8A A;  1DM0 B;  5M3F G;  4JI1 Q;  1Y8O B;  2F0P A;  2EYL A;  2DN8 A;  3AYH B;  4R4I A;  4DV4 Q;  4LF9 L;  3CC7 A;  1NTG A;  4IUV A;  4YWM A;  3JAM c;  1BCP F;  4DNT B;  3HOU H;  4HMI A;  2KQ3 A;  1XMO Q;  3S17 B;  3OSO A;  5C4X B;  1STH A;  1YJW A;  3OMG A;  4NMZ A;  4CDF C;  1VQC A;  1SLJ A;  3BYY B;  4A3E B;  1RTN A;  1H95 A;  4A3D B;  1B3Q A;  5JJK A;  2EZV A;  1QZH A;  1JWU D;  3GP7 A;  3BZD B;  2BH8 A;  1VQN A;  5C0X J;  5CV8 A;  2JA5 G;  2E2I H;  1I50 B;  5K5P A;  1VQM A;  5C6A A;  1MI2 A;  1EU4 A;  3L3O C;  4RGN A;  2PW7 A;  1Z7T A;  3GTQ B;  2MUY A;  5JAV A;  1Y8P B;  5DNF A;  1Q12 A;  1I94 Q;  1DJR D;  1PH4 A;  4X62 Q;  2IX1 A;  5L37 A;  1VQF A;  5HGT A;  2KJX A;  2HDM A;  2IX3 A;  3BZK A;  2B29 A;  1CI3 M;  3KDF B;  1NMF A;  4DV7 L;  4FNF A;  1TWF B;  1BKB A;  5C0X I;  2YTV A;  4RGO S;  4A3M H;  3V05 A;  4FYD A;  2K04 A;  4DXG A;  3A0J A;  4DPG A;  3X3M A;  1IBM Q;  4NKL A;  4UAI A;  5KIX A;  2VUM H;  4HED A;  1U4M A;  2JA8 B;  2KHS A;  1IW7 D;  1GKH A;  5GAH C;  1SBB B;  2WAC A;  1K83 H;  1QUQ A;  1S5D D;  1WJJ A;  3S14 H;  3W1G A;  3A8I E;  4ID6 A;  1GUS A;  4FXD A;  2CW0 C;  2OWO A;  2VXW A;  1HZB A;  1ZYR C;  4UP8 A;  4LK1 C;  2O2L D;  1LAC A;  2ZM6 L;  1ESF A;  3S2H B;  4DUZ L;  1QOH A;  3GTM H;  1HZ9 A;  1TQO A;  2KEE A;  5C0X H;  1LUZ A;  4IUU A;  2UXB Q;  5F2D A;  5KNC A;  4JV5 L;  2JA9 A;  4JBM A;  1H9K A;  2A68 D;  3HOZ B;  1Y1W G;  3PGZ A;  3L9A X;  2NVY B;  3E0J A;  5E4X A;  1GOZ A;  2CKZ B;  3SGI A;  4P75 A;  2K5H A;  3URY A;  4UY8 C;  5IGB A;  5LMN L;  3QG1 A;  3M3Y H;  2I46 A;  4ZKC B;  1PYS B;  4GLX A;  3S1N B;  1XXG A;  1DYQ A;  2JA7 H;  4CDE C;  1GUG A;  1HPC A;  1WTX A;  2E5L L;  3ONA B;  1CSQ A;  1O78 A;  1YNN C;  1Z9F A;  3UE0 A;  1Z6H A;  1HTL D;  1TS5 A;  4RKL A;  1IKM A;  3WOF A;  2E2D C;  4KHV A;  4KHZ A;  1ASZ A;  1J8I A;  4DV6 L;  3S1R B;  1ML0 D;  4F88 A;  3CCE A;  1H9R A;  1BQQ T;  1WTW A;  4P74 A;  4L5R C;  4GLV B;  3F2C A;  3UDG A;  3HKZ E;  2F0W A;  4DU9 A;  1GD7 A;  1RCV D;  2XGT A; 
#chains in the Genus database with same CATH homology
 3G6J B;  1HRJ A;  1B1Z A;  2EXZ A;  4C3H B;  1Q8I A;  4C56 C;  3DM1 A;  5DEH A;  4LMQ D;  3NWT A;  1Y1V B;  1PDQ A;  1NSN S;  2XWB B;  4A3G B;  4P2C B;  4BY1 B;  1OO9 B;  2D62 A;  3MFG A;  3SDZ A;  1LV9 A;  2AWN A;  4IUR A;  5FO8 B;  4AYB B;  1A3T A;  4C3J B;  5KND A;  2EY5 A;  2XWJ B;  3CHB D;  1EYD A;  2B2T C;  5A2Q E;  1A3U A;  1EY5 A;  5CGK A;  4KI0 A;  1FNU A;  1I4P A;  4CKB A;  1U9R A;  4KN4 C;  3SK5 A;  2XRQ D;  3PO3 B;  5ELC A;  4WFN 3;  4FF4 A;  2VB3 X;  1PRT F;  4OO1 I;  1ROD A;  3J7A F;  2MJ8 A;  3I4M B;  1F9S A;  2VB2 X;  4IUQ A;  5J1Z A;  3RLF A;  1PFN A;  2B2U C;  1R9T B;  2FMC A;  4JBW A;  1Y8N B;  4IN3 A;  3VA7 A;  2K03 A;  3AMU A;  4Q0F A;  4DXF A;  3AU7 A;  1DD2 A;  1V1P A;  5COR A;  4BBR B;  1SE2 A;  3GTG B;  4OO1 H;  1UUP A;  1SDF A;  3FMC A;  1EY7 A;  3M4Y A;  5LL6 X;  1B9M A;  5J39 A;  3S2D B;  1K8M A;  1DOL A;  1MD2 D;  3PMF A;  2WII B;  1HQR D;  1I4Q A;  2AQ1 B;  4H44 C;  5I4D A;  1PZK D;  3J7Y W;  3BVM A;  2N88 A;  3KF8 A;  1ILQ A;  2AUJ D;  3D4D A;  1BUV T;  2ICI A;  1BBX C;  2NN6 I;  4BA2 I;  1JQY D;  5D3D A;  5A35 A;  3Q6S A;  3KK7 A;  4TRD A;  4TSS A;  3NE5 B;  5C44 B;  3VA5 A;  2F0K A;  4ILW A;  5LL6 S;  3S1Q B;  2Z1C A;  4MN3 A;  2F0H A;  3U9O A;  1XTC D;  3TP6 A;  1C48 A;  3GTL B;  3R93 A;  3DWQ A;  4NW2 A;  5EKK A;  2L55 A;  2NN6 H;  4CKC A;  3OW7 A;  1IYU A;  1ESR A;  4IZ8 A;  5COY A;  1FR3 A;  2ENB A;  4O42 A;  1JB3 A;  1MSG A;  2B2W C;  3PUW A;  2Y0S B;  5G3L F;  2DY8 A;  2XNA C;  2K5D A;  3KBG A;  2RDH A;  4F7X A;  1SYG A;  5EKI A;  5C3W A;  4HR7 B;  2R93 B;  2F03 A;  4C3H G;  2BE5 C;  1BR9 A;  2A6E D;  1EFI D;  1TVX A;  1BCP D;  2A73 B;  3FVQ A;  1CTM A;  5KNB A;  3J80 E;  5E3F A;  1IKL A;  3WOE A;  2D2C C;  4FF3 A;  3CRL C;  4QUF A;  4Z9C B;  3GD7 A;  4C3J G;  1EY6 A;  3HOX B;  4IUP A;  5M9O A;  4A3J B;  5E1F A;  1STY A;  5I2X A;  1AZP A;  1TS2 A;  1WVL A;  1SMY C;  5BN5 A;  1S5E D;  1SAP A;  3S9W A;  1F9Q A;  1LT5 D;  3W3A A;  2TMP A;  4FXK C;  3SE0 A;  1C8C A;  1EY8 A;  1GHJ A;  2NVT B;  1PTO F;  2JA6 B;  3IL8 A;  2LFN A;  3H94 A;  1EWH A;  2MP1 A;  4EQN A;  1KTK A;  3I70 A;  2F4I A;  3DEP A;  4FVM A;  1TY2 A;  4N9T A;  4ZQ3 A;  4RHR A;  4DA2 A;  2RSN A;  4C1N K;  1SYC A;  2K5W A;  3HS0 C;  3MXN A;  2NZ1 D;  2ZT9 C;  1NR4 A;  4KJN A;  5I6Y A;  5FLX E;  2JXM B;  4B9W A;  1PFM A;  1SE4 A;  1QIL A;  2WKC A;  1I3Q B;  5ELF A;  1STG A;  2B2V C;  1A2U A;  1AW7 A;  1B4O A;  1SNO A;  3I72 A;  4RCN A;  3VR5 A;  3EVQ A;  3HRZ C;  5ELE A;  3JAM L;  3MC0 B;  3M85 A;  5DAU A;  4ZRZ A;  3EFX D;  1O7Z A;  2QF7 A;  2JEA I;  2JE6 I;  3VR4 A;  2EYP A;  1Y1W B;  4WRD A;  2G9D A;  1DCZ A;  2AUK A;  3KUP A;  3MEH A;  3FEW X;  2HCI A;  3NP8 A;  3T4A C;  2BOS A;  4BWG B;  1EL0 A;  4HCS A;  5EBD A;  1KDB A;  4B08 A;  2KED A;  1YNJ C;  1VMP A;  1BDO A;  3GV6 A;  2B8F A;  4O1N A;  4N9P A;  1X32 A;  3N6R A;  4QF4 A;  2PW5 A;  1S5F D;  4RGM A;  3NSW A;  1TII D;  1PZI D;  1DXM A;  2A74 C;  2B39 A;  1B53 A;  5KYL A;  3NPP A;  5CV5 A;  5FKA C;  2K6A A;  5C4J B;  3H6M A;  5CR3 A;  2NVQ B;  2EYF A;  3TSS A;  3MZ5 A;  2KOL A;  3R2I A;  2B8G A;  3IFT A;  1PRT D;  4RH6 A;  3K59 A;  3NTH A;  1G29 1;  1GUW A;  1CHQ D;  4X3S A;  1TKW B;  1GXD C;  1EQV A;  5CBE E;  4L8J A;  2F0F A;  3RZO B;  4H0L C;  1E2Z A;  2AQ3 B;  1TWH B;  2K28 A;  1J9O A;  3VR2 A;  3TME A;  1EQT A;  1H9S A;  5M3M B;  4H13 C;  2NUC A;  2H4O A;  5JOB A;  4XQN A;  3QIA A;  1KNA A;  1PYW D;  4MIU A;  1UEA B;  3GQB A;  2D5D A;  3VYU A;  1IHZ A;  1LAB A;  5IOD A;  1BOS A;  2KUM A;  2Q8T A;  2BA1 A;  3K0Y A;  1WTO A;  5IT9 L;  2D9U A;  1KLU D;  1RTO A;  3S1M B;  2E2J B;  5TSS A;  1R4Q B;  1RKN A;  2O5I C;  4XQJ A;  4IFD G;  5JEA G;  1I6H B;  3GTK B;  4ODG A;  3I73 A;  4OHJ A;  4OIJ A;  5JVH 3;  2BDO A;  3P20 A;  5I9P A;  3HOU B;  2DNC A;  5C4H A;  1SJE D;  3HP3 A;  4K14 A;  5IGD A;  1F2M A;  2HDL A;  2WKD A;  2J4X A;  3QB3 A;  5BN4 A;  1I4H A;  1HFG A;  1AZQ A;  2L12 A;  2RDG A;  1AFP A;  2L4N A;  2E2I B;  4ME5 A;  2LMC B;  1H9S B;  4QUC A;  1PMR A;  1LT6 D;  5KRU A;  3J7A V;  1WTR A;  2SEB D;  1CT1 D;  1KNE A;  4R8I A;  4TKO B;  3MXP A;  5G3L D;  1IW7 C;  5CV9 A;  1HA6 A;  2RKS A;  4K2L A;  3GV3 A;  2F0N A;  4CJ0 B;  3K58 A;  1EZ6 A;  1QCB D;  4DAV A;  1HA5 A;  3D4R A;  3SHL A;  3NTK A;  2RVL A;  5FOB B;  5CMD A;  3NBH A;  3GTP B;  1PTO H;  2FJ2 A;  3VYR A;  1JIC A;  4F87 A;  1G8Z D;  4LJZ C;  2QKI C;  3A56 A;  3S14 B;  1U4L A;  2EY1 A;  2X6L A;  4KN7 C;  3V2T A;  5CYU A;  3VYS A;  3MTS A;  1MGS A;  2A68 C;  3M7N A;  3P7J A;  2B2Y A;  3D6W A;  3FRP B;  4IAL A;  1EYC A;  2SDF A;  3PV0 A;  1T5X D;  5K36 G;  4K5X A;  1B9N A;  2XRS D;  3IKJ A;  2OXP A;  3RZD B;  3QOJ A;  3OMC A;  3E5S A;  5E4W C;  4ULL A;  1I4X A;  2CVR A;  2F0I A;  4QCL A;  3K5L A;  3I90 A;  1LTG D;  1I4R A;  4BA1 I;  1PTO D;  4A3F B;  4Q5V A;  1OXT A;  1TS4 A;  3C3L A;  2A69 C;  1O80 A;  1D5Z C;  1VDZ A;  5M5W B;  1LTR D;  1EY9 A;  3K7A B;  4KY5 A;  1STA A;  2IW3 A;  3CRK C;  1XX8 A;  5CC4 A;  2L5T A;  3TN2 A;  1SNM A;  4RWS C;  2XVS A;  1RF2 D;  1BNZ A;  1KDC A;  3SK4 A;  5AFW A;  3NK9 A;  2F0V A;  2F0J A;  1AN8 A;  4IUN A;  4B9X A;  3DMU A;  4CJ2 C;  3QJY A;  2FHT A;  2C5C A;  2EVB A;  2XIW A;  5C5L A;  2M9V A;  2R7Z B;  1TR5 A;  4TQU S;  3R3O A;  1L0X B;  1VCI A;  1CZW A;  1CK1 A;  1PFB A;  3GTJ B;  1HCZ A;  1Q3L A;  3BDC A;  3DXJ C;  1QJO A;  1H9J A;  3P75 A;  2WP8 J;  4KD4 A;  3C2P A;  3HOW B;  2IWH A;  4XDX A;  3D6C A;  5EJW A;  4XYQ A;  1STE A;  4M8A A;  4EVO A;  5I2Y A;  5IIF A;  1ENF A;  2OT2 A;  4CJ1 B;  3H0G B;  2RDF A;  3GO5 A;  5EQ0 A;  2LS0 1;  1F2L A;  3MHB A;  1QE6 A;  2CQA A;  3ZYY X;  4PMC A;  4HMJ A;  5JJZ A;  2L0C A;  4HSV A;  3PUY A;  2EY6 A;  2F0M A;  3H3V C;  3T53 B;  4XQQ A;  4J6H A;  3FKI B;  3HKZ B;  5EPL A;  4OGQ C;  2KVM A;  3OIQ A;  4KKU A;  1V1P B;  4IFD J;  5JEA J;  3M7G A;  4BBS B;  1RD9 D;  5FO7 B;  2F0D A;  4FF1 A;  3HZX A;  4KMU C;  2I07 B;  1Q1E A;  1TWG B;  3A8J E;  3MXU A;  3VR6 A;  2EDG A;  2F0L A;  2EJG C;  1O7L A;  1TU2 B;  2F3V A;  4R8N A;  1BCP B;  3BDO A;  2JSO A;  5C5M A;  3WDN A;  4DAY A;  3O13 A;  4HAE A;  3HOV B;  2FMM A;  2EYO A;  1LTT D;  3BDL A;  1EY4 A;  2EYM A;  1LO5 D;  4IFD I;  4CKE A;  1ENA A;  4G7O C;  3T16 A;  4CBV A;  1ET6 A;  1CA6 A;  3QO2 A;  1JOK A;  1LT4 D;  2NYZ D;  2A6H D;  4DK1 A;  1U4P A;  1V8Q A;  1JC7 A;  3NHH A;  2SNS A;  2H1E A;  2YU9 B;  4E6I A;  1NR2 A;  2A6E C;  4LAA A;  3L7Z C;  1BCP C;  4RFB A;  2MGS A;  1B2T A;  2KA7 A;  4IFD H;  5ISR A;  5JEA H;  1QNK A;  1LT3 D;  3J80 L;  4IUT A;  3D31 A;  1WTV A;  2WAQ B;  3R8B A;  2EOT A;  1KAB A;  1SE3 A;  1S5C D;  2K05 A;  3EA6 A;  2R61 A;  3DWP A;  3ITP A;  4C3I B;  3ND8 A;  4QB4 A;  3HOY B;  3PIO 3;  2SOB A;  4L63 B;  1KLG D;  1ZXT A;  1E0B A;  2K7V A;  5I6W A;  3T56 B;  4RA8 A;  3J81 E;  2K01 A;  1SNQ A;  1EEI D;  2V4D A;  1DOK A;  2F3W A;  1I4G A;  1TWC B;  3I8Z A;  4XYO A;  2M00 A;  1Q90 A;  3I3C A;  5BN3 A;  4XT3 B;  3OWE B;  3AB9 A;  2HCC A;  3JAM E;  1D6E C;  4UDU C;  3PUZ A;  4FXG C;  3IFD A;  5KYI A;  1H9M A;  3DEO A;  2PQE A;  3TP8 A;  1FYC A;  4XXE A;  1STB A;  2NTS A;  1CFM A;  4J8Q A;  5DM7 3;  2TSS A;  1UNS A;  4FO2 A;  3NBI A;  4KV6 A;  2X6G A;  1A2T A;  1VF7 A;  4EQP A;  5FK9 C;  4U67 3;  1D1K A;  4RKB A;  5D14 A;  1GUT A;  2F1M A;  3OOC A;  5LHY 1;  4OO1 G;  4V19 0;  3C1F A;  1R4P B;  5EPK A;  3DWA A;  2XSC A;  5K36 H;  4NP5 A;  1HUN A;  3TP7 A;  3OHX C;  1BXT A;  2PNR C;  3FDT A;  2AWO A;  5JVG 3;  1TT2 A;  3BVG A;  1M8A A;  4KKT A;  4C1N I;  5IGG A;  1B3A A;  1LTB D;  3CKI B;  2AQ2 B;  3SK6 A;  3TZU A;  1SYD A;  2K5Q A;  4PNY A;  1OXU A;  4KY6 A;  2C9O A;  5M5Y B;  3EQL C;  2BA0 A;  4KTA A;  1PRT B;  5D3I B;  3VR3 A;  1NCV A;  1ZEQ X;  4IQZ A;  4GZY C;  2B63 B;  1QWY A;  1HTP A;  4S3S A;  1TWA B;  3H09 A;  2Z8L A;  1IL8 A;  3C1E A;  1WTQ A;  2WB1 B;  3F2U A;  2NN6 G;  3A7L A;  2R3Z A;  4EQO A;  3BVZ A;  1ET9 A;  3K6O A;  4EGV A;  3PO2 B;  3MAQ A;  1GJX A;  1JE4 A;  4A93 B;  3FPP A;  2IPK D;  4V0B A;  4J1M A;  3KLS X;  5IT9 E;  2WV6 D;  2NTT A;  1RJT A;  1PRT C;  2GA4 B;  2J7Z A;  2SNM A;  2IJ0 A;  5C4Z A;  4C3I G;  1A15 A;  2WIN B;  2Z4H A;  1G2S A;  4U68 A;  1U4R A;  4G57 A;  1DZ1 A;  4ABN A;  4A3B B;  1UAP A;  3CU7 A;  1K8O A;  1L0Y B;  1ILP A;  2Q8R E;  4XTC S;  1F77 A;  3A54 A;  3D3R A;  2A5H A;  1M4V A;  2QEJ C;  1F9P A;  4FF2 A;  2ZXP A;  3ERO A;  2PYK A;  3NQT A;  1S5B D;  3U9S A;  1FNW A;  4OIK A;  5C3X A;  1CQV A;  5KGU A;  4ZUI A;  4NDX A;  4DGZ A;  1VMC A;  1SYE A;  4KY7 A;  3HGB A;  5DM6 3;  1PLF A;  1F2Z A;  2CW0 D;  2NB0 A;  4QIW B;  1QNU A;  1ZYR D;  3R2T A;  1D2B A;  4DF7 A;  2R92 B;  2RBM A;  2OEO A;  5KEE A;  2ICE C;  2B2T A;  2MHV A;  2E74 C;  3TZD A;  1JWS D;  4K8I A;  5EBC A;  2JP1 A;  2PZU A;  3SK8 A;  3BG3 A;  3C46 A;  2PMZ B;  4G4K A;  2ID0 A;  3VYT A;  3MVV A;  3PUX A;  3DUZ A;  5EKL A;  3OIP A;  2EJM A;  4OL7 A;  2E76 C;  3G7L A;  1YNN D;  4A3M B;  4K8J A;  2K1B A;  4KKS A;  2B2U A;  2VUM B;  1BO0 A;  1SYF A;  5CV7 A;  4DNR B;  1K83 B;  1EU3 A;  1C4Q A;  1JOO A;  4BS9 A;  3MFY A;  3MXG A;  1F2Y A;  4X3K A;  1T5E A;  4ZLT F;  1AP0 A;  2K32 A;  2QDB A;  1EOT A;  2BDN A;  5ELB A;  1SFO B;  3GTM B;  1JOQ A;  2PCF B;  1GUN A;  1PXU A;  1PZJ D;  1TS3 A;  4M1U B;  1EWC A;  4ZKB B;  2FFK B;  3N52 A;  1JCK B;  1X3P A;  1SYB A;  5D65 A;  2OF1 A;  4RCO A;  1PTO B;  3M3Y B;  2A69 D;  3SEB A;  2Q8I B;  2DY7 A;  2JA7 B;  1BF4 A;  3NWS A;  1LTS D;  1LTI D;  1KDA A;  4ZYS A;  4G7Z C;  1KAA A;  4R9W A;  4K5V A;  1IYV A;  4HSP A;  2HUG A;  2HQE A;  1E2W A;  5IOC A;  2RQX A;  3I4L A;  5HUR A;  5ELD A;  2R6G A;  1D5M C;  3H91 A;  2F0U A;  2F0E A;  3LWE A;  3BS1 A;  2O5J C;  5A2Q L;  4RGT A;  1PTO C;  2B2W A;  1B44 D;  5J22 A;  3TDQ A;  5IGC A;  4ZK9 B;  2L11 A;  1FNV A;  3KLS A;  3S16 B;  1D5X C;  1CQF A;  2F0O A;  4XIG S;  2M2L A;  3Q0A A;  2JEB I;  1QB5 D;  1EY0 A;  4MHE A;  1EEF D;  1O7Y A;  2F0Q A;  2CHB D;  2E75 C;  1SXT A;  3E6Z X;  3P1H A;  3SVM A;  5IGF A;  5I9O A;  5JPN C;  2VNU D;  4X3T A;  1SEB D;  3X3N A;  3RUZ A;  1X3Q A;  4H7B A;  2ZXO A;  3GTO B;  1Q1B A;  2B2Y C;  1ENC A;  4RHS A;  2E2H B;  2QIL A;  3TBI B;  2RSO A;  2K33 A;  3PUV A;  3IAY A;  2EE1 A;  1CA5 A;  4FP5 D;  2NBF A;  3TP5 A;  2PO4 A;  2XN9 C;  2X69 A;  1S4Z A;  2EYH A;  4JK1 C;  1ZKO A;  3K5N A;  4CGY B;  4A3I B;  5FO9 B;  3M4O B;  1HQM C;  1HUM A;  5T1G A;  3SXH A;  3NQI A;  5JPM C;  4PV1 C;  3Q23 A;  1GUO A;  3UI2 A;  1VF5 C;  1DON A;  1AEX A;  4RAU C;  1V43 A;  2BE5 D;  1ONL A;  4DFA A;  1JR0 D;  4PMB A;  1JOR A;  1G6Z A;  3CQZ B;  1WTP A;  3RMH A;  4PMW A;  5C0X G;  1I6V C;  2KCC A;  2NVX B;  2B2V A;  5CBA E;  3SR1 A;  4HN7 A;  1E2V A;  3RD4 A;  1SNC A;  3Q24 A;  2Z4I A;  3LNN A;  3K57 A;  2IT1 A;  2PPB C;  1Y69 U;  3KLR A;  2L9H A;  1XWE A;  2ZXR A;  3T51 B;  3QWN A;  3ND9 A;  3V96 A;  1WD1 A;  4ZAI A;  3I4N B;  2F0T A;  1MSH A;  4KK7 A;  1SMY D;  1DOM A;  4DK0 A;  1JWM D;  1B50 A;  4ZUJ A;  4XT1 B;  1EIH A;  2O4X A;  3OWF A;  5M3F B;  3PIP 3;  2G9H D;  1STN A;  3D8G A;  3LWU A;  2A6H C;  5CV6 A;  2EJF C;  5CV4 A;  4DN4 M;  5IGE A;  5NUC A;  1Z47 A;  2EPB A;  1FD7 D;  1GHK A;  3A7A B;  1A3V A;  3LX0 A;  4QMG A;  2JA5 B;  2L1B A;  5C3E B;  1EYA A;  4PQX A;  3EJI A;  4Y7N B;  1D1I A;  3BYT B;  3QOL A;  1RHP A;  1SND A;  4CHT B;  3I91 A;  4C2M B;  3T13 A;  1LLR D;  4I7Z C;  3K5M A;  3S15 B;  1CZG A;  3J81 L;  2PZT A;  1MBY A;  2MPM A;  3ERQ A;  2LY7 A;  4HTH A;  4BY7 B;  3KBX A;  3OPO A;  3A8K E;  5T1I A;  5FLX L;  2QCP X;  1XYI A;  1EIG A;  1OXX K;  2JYO A;  4X3U A;  1W6J A;  3HEJ A;  2RA4 A;  1WD0 A;  2BCO A;  2YYZ A;  1QG7 A;  1NAP A;  1OXS C;  3FPU B;  3Q22 A;  4K5W A;  1YNJ D;  1HFN A;  1EZ8 A;  1V1O A;  4I65 A;  2LKV A;  3HG9 A;  4K6L A;  3D4W A;  2KEC A;  4WJW A;  3NUC A;  3NTI A;  1OXV A;  3K5O A;  1SJH D;  5EPJ A;  3MA2 B;  2IX0 A;  2J0T D;  1FGB D;  3MWY W;  2DNE A;  1CM9 A;  1RDP D;  2FIN B;  4G7H C;  4YIJ A;  1F9R A;  4K2K A;  1SNP A;  1HXY D;  4WOR A;  2EYJ A;  4DAP A;  1A6X A;  1HHV A;  1LTA D;  1II3 A;  1W6K A;  4K6D A;  2PZW A;  4A3K B;  4KJO A;  1CHP D;  1TY0 A;  3W2D A;  3A55 A;  1WCM B;  1G2T A;  2F0S A;  2EY2 A;  2IL8 A;  5M5X B;  2KCN A;  2N55 A;  5EGT A;  2F0G A;  1ICW A;  1NUC A;  3DHQ A;  1G91 A;  3NXW A;  4F8M A;  4KD3 A;  1SSO A;  4L6T B;  2NWG A;  4HCE A;  1DM0 B;  1Y8O B;  2F0P A;  2EYL A;  2DN8 A;  4IUV A;  1BCP F;  4DNT B;  4HMI A;  2KQ3 A;  3S17 B;  3OSO A;  5C4X B;  1STH A;  3OMG A;  4NMZ A;  3BYY B;  4A3E B;  1RTN A;  4A3D B;  2EZV A;  1JWU D;  3GP7 A;  3BZD B;  5C0X J;  5CV8 A;  1I50 B;  5K5P A;  5C6A A;  1MI2 A;  1EU4 A;  3L3O C;  4RGN A;  2PW7 A;  1Z7T A;  3GTQ B;  2MUY A;  5JAV A;  1Y8P B;  5DNF A;  1Q12 A;  1DJR D;  2IX1 A;  5HGT A;  2KJX A;  2HDM A;  2IX3 A;  1CI3 M;  4FNF A;  1TWF B;  5C0X I;  4RGO S;  3V05 A;  4FYD A;  2K04 A;  4DXG A;  3X3M A;  4NKL A;  4UAI A;  5KIX A;  4HED A;  1U4M A;  2JA8 B;  2KHS A;  1IW7 D;  1SBB B;  2WAC A;  1S5D D;  3A8I E;  4ID6 A;  1GUS A;  4FXD A;  2CW0 C;  2VXW A;  1ZYR C;  4LK1 C;  2O2L D;  1LAC A;  1ESF A;  3S2H B;  1QOH A;  1TQO A;  2KEE A;  5C0X H;  4IUU A;  5F2D A;  5KNC A;  1H9K A;  2A68 D;  3HOZ B;  3L9A X;  2NVY B;  3E0J A;  5E4X A;  1GOZ A;  3URY A;  5IGB A;  3QG1 A;  2I46 A;  4ZKC B;  3S1N B;  1XXG A;  1DYQ A;  1GUG A;  1HPC A;  1WTX A;  3ONA B;  1O78 A;  1YNN C;  1Z6H A;  1HTL D;  1TS5 A;  4RKL A;  1IKM A;  3WOF A;  2E2D C;  4KHV A;  4KHZ A;  1J8I A;  3S1R B;  1ML0 D;  4F88 A;  1H9R A;  1BQQ T;  1WTW A;  2F0W A;  4DU9 A;  1RCV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...