2K32A

Truncated acra from campylobacter jejuni for glycosylation studies
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
DVIIKPQVSGVIVNKLFKAGDKVKKGQTLFIIEQDQASKDFNRSKALFSQSAISQKEYDSSLATLDHTEIKAPFDGTIGDALVNIGDYVSASTTELVRVTNLNPIYADGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords A
publication title NMR structure determination of a segmentally labeled glycoprotein using in vitro glycosylation.
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k32A00
2K33A 4TKOB 2BA0A 1VF7A 4KMUC 2K32A 1OXSC 1B9MA 5KNCA 4LJZC 1Q12A 3QIAA 4OO1G 4I7ZC 2E74C 1CI3M 1GJXA 2D5DA 3FPPA 2JE6I 4L8JA 1A6XA 4DK1A 4G7HC 2AWOA 3QJYA 3EQLC 3N6RA 3PV0A 5A35A 4JK1C 2E75C 1OXTA 1YNNC 2KCCA 4G7ZC 1H9JA 2YYZA 1E2ZA 3VA7A 2PNRC 3GQBA 3I73A 3H94A 4PV1C 3QG1A 1H9SB 5KNDA 2A69D 3L7ZC 1FYCA 2R6GA 4IFDH 2A69C 1Y8OB 3P20A 3MXUA 1K8OA 1GHJA 2B8GA 1K8MA 1CFMA 3OOCA 5K36G 4G7OC 4BA2I 4KN4C 2AUKA 2DNCA 2EDGA 2JXMB 2PCFB 2NN6H 1EWHA 4KHZA 4DNTB 1VCIA 2BDOA 3KLRA 1Q1EA 3T51B 1Y8NB 1V43A 3LNNA 2A68C 1GUTA 3NE5B 3A7LA 3D4RA 1SMYC 3HGBA 3SDZA 4OO1H 2KA7A 3M7NA 1VF5C 1LABA 2K7VA 2EJFC 1I6VC 2CW0C 3VR6A 5BN4A 4KKSA 1HCZA 1HQMC 3I4LA 2A6EC 5JEAG 4KKTA 1OXVA 3RLFA 1O7LA 3VR5A 3WDNA 4H0LC 3BG3A 2EJMA 3GD7A 2D62A 2QF7A 4KI0A 1H9KA 2JEBI 3FMCA 2BE5D 2BA1A 2LMCB 2BE5C 1BDOA 1HPCA 2A6HC 4XIGS 5C0XG 4XTCS 2F1MA 1FR3A 1IYUA 2O5JC 1Q1BA 3MFYA 1V8QA 2B8FA 1H9RA 1Y8PB 2L5TA 3LWUA 2D2CC 2A68D 3A8KE 3DXJC 1GUNA 4LK1C 5BN3A 3W3AA 2O5IC 1H9MA 2EVBA 2PPBC 1DXMA 1HTPA 3VR2A 3T53B 4TQUS 3PUWA 2EJGC 1Z7TA 1ZKOA 4DK0A 4H44C 2IT1A 3PUYA 1G291 1GUGA 3T56B 4DNRB 1IW7C 1VDZA 2A6ED 2Q8IB 1TU2B 1PMRA 4JBWA 3CRLC 1H9SA 1B9NA 3CRKC 2V4DA 3PUVA 4IQZA 1YNJC 2DNEA 2ZT9C 3M4YA 3OPOA 1CTMA 1DCZA 1Z6HA 3PUZA 4HR7B 4KN7C 1LACA 2A6HD 3VR4A 5JEAH 1E2WA 3I72A 3ND9A 5K36H 1ZYRC 4BA1I 3TZUA 3M85A 4KKUA 1O78A 1Q90A 4IFDG 2E76C 3OW7A 3U9SA 2JEAI 2NN6I 5C0XH 3IFTA 4RCNA 1OXXK 5KNBA 3VR3A 3PUXA 5BN5A 1Y69U 4OGQC 1GHKA 3D31A 1OXUA 4H13C 4GZYC 3BDOA 3A7AB 1IW7D 3ND8A 2NN6G 3A8JE 1GUOA 1TKWB 1IYVA 1T5EA 3A8IE 1ONLA 3AB9A 2DN8A 1DD2A 1QJOA 3IKJA 3SE0A 1E2VA 1GUSA 2AUJD
chains in the Genus database with same CATH superfamily
3S2DH 2K33A 2F0DA 2BA0A 2K32A 4CDFC 4RFBA 4C3IB 2PO4A 4LJZC 3QIAA 1GJXA 3QOLA 4MTNA 5FLMH 1IZ6A 1VQEA 4DV6L 4R4IA 4HJ9A 2KCCA 4KY5A 1GVPA 1QE6A 4HMJA 1RDPD 2B2TC 1LT4D 1B53A 4ULLA 3HP3A 4JCVE 2CCZA 4OHJA 1HR0L 4BXXG 2X69A 4JI5L 2MO1A 2EXDA 5C5MA 2PCFB 3SGIA 1EWCA 1SYCA 3WOFA 1CKMA 4KTAA 4LF8L 5BR8Q 4GNXC 1SSOA 3CP0A 1KAWA 3GTLB 4KHVA 2RQXA 2N49A 3H91A 1PH2A 1YEZA 3FPUB 2XNAC 1BR9A 3RN2A 1OXVA 5IGBA 2ZJRA 4BBSH 2ZXRA 1BNZA 4ZQ3A 4X6AH 1VQCA 4K14A 1STYA 3FMCA 3RZDB 1RCVD 4LFBL 2K28A 3E5SA 4KV6A 4QCLA 4QUFA 1K0RA 1HH2P 4IALA 5C0XG 1VQAA 2VUMG 4JI3Q 4LWCA 1KQSA 1VMCA 4JI7L 2F4VL 5HURA 3KUPA 5FO8B 3I90A 4X64Q 1Y1VG 4NXNL 1D1IA 1EY6A 2B2WC 2I0QA 4X66Q 1HUNA 3C46A 4RGMA 2XVSA 4S3SA 2KBNA 3AFQA 1HNZL 2UUAQ 3HOZB 4HIKA 3CQZB 1TWGH 3SK6A 2F0LA 4BS9A 4PMWA 1LUZA 1PH4A 4FO2A 4KKUA 5M5XB 4K0KQ 1NBWA 4FDBA 3S1NH 1TY0A 2JA7H 1WCMG 4C2MB 4NKLA 5GAEC 1EYDA 5HGTA 3D31A 1VQKA 4LF4Q 3Q24A 5IT9E 5FO9B 4OO1I 1PH1A 5LMNQ 3PO2B 1JORA 2WKCA 1SNOA 4FP5D 1EFWA 3J81j 1F9RA 1N34L 4UP8A 4JI6L 5KEEA 5JEAJ 3I91A 4YWMA 1OXTA 1SYEA 3CAMA 1HFGA 2F0WA 4G7ZC 2F0GA 1H9JA 1X3FA 1YIJA 1VQLA 1M4VA 4DAMA 1BXTA 3I73A 2MGSA 4WJ3M 4BWGB 2CH4A 4A3BH 1RHPA 2Q2TA 5M3FB 2RSNA 2QKIC 1NCVA 1D1KA 2DNCA 5E4XA 2BH8A 4A3DG 3RN5A 1SMXA 2RDGA 1O7IA 1Q82C 1KLUD 1VQ8A 1HNWQ 4GN4B 4JI2Q 3KLRA 1Q1EA 2WINB 2EZVA 1XTCD 2HHHL 3E0EA 3G7LA 1VQ6A 4DR7L 1EIHA 1X55A 1JWSD 2R92B 1BBWA 4J1MA 4DUZL 4GS3A 1UE5A 3NQIA 4IZ8A 1S3OA 2HDLA 4PQXA 1I50B 1HQMC 1J6QA 5JJLA 1G51A 2IW3A 3V05A 3J80E 5DEHA 4OL7A 2ZJPA 3GD7A 5T1IA 2L4NA 4R4QA 1A3UA 2L1BA 1U9RA 3GTKH 2Q2IA 2ZM6Q 2B8FA 3K5OA 1B1ZA 2RDHA 4DGZA 1EWIA 3R93A 1WTWA 1ET6A 2QGQA 3RR5A 1II3A 3PUYA 1G291 1GUGA 3T16A 2Y0SE 1S72A 3MA2B 4A4IA 2B39A 1FGBD 3CU7A 1CUKA 5FLXc 3TDQA 3PUVA 1R4PB 4IQZA 2KENA 1S4ZA 4A3KG 4EQNA 3K7AB 2E5LL 1F2YA 2KHIA 3GTPB 3LX0A 2HIVA 3H15A 2EYMA 4R9WA 5IY0A 3H3VH 3IFTA 2YTYA 3KK7A 3PSIA 4XXEA 1Q81C 1NTGA 1JQYD 4LNQA 3KLSX 2JN4A 2J7ZA 5C4XH 5JVH3 2UU9Q 3J81c 2E2DC 1GUSA 4XDXA 5IT9L 3D4WA 4OO1G 1L1OC 1F77A 2HDMA 1WJJA 1NE3A 2X6LA 4DK1A 3F2CA 2AWOA 4FVMA 4Y52H 3VYUA 1GKHA 2D9UA 2VW9A 2X6GA 1Q3LA 1LTBD 2IL8A 2P5ZX 1VQFA 5H1SE 4OELB 3J81i 1SFOB 5LMUQ 1IL8A 3LWEA 2F3VA 2R6GA 1IYJB 2A69C 1GHJA 3OOCA 4C3HH 4IPHA 3S2DB 3UE1A 2F3IA 3L0OA 1I4QA 2L15A 4HMIA 3PCOB 5DNFA 1B3AA 4DR2Q 1Y8NB 2DGYA 5M3MH 1PHJA 1JE5A 3ERSX 2G9HD 2H4OA 2VQFQ 4A3KH 1MBYA 4KJOA 2B2TA 5DAUA 4N9PA 1I4HA 3G6EA 2MO0A 3CC2A 1YHQA 1L2FA 2E2JH 3OWFA 4C3IG 3BG3A 4KI0A 1H9KA 2BA1A 1YBYA 1G8ZD 1TWCH 5TSSA 4DV3L 3J80L 4XTCS 4AQYL 4A3LG 3KJOA 1U5KA 4QUCA 4GNXA 3CW2C 3GV6A 3MHBA 5BN3A 4K8IA 4CJ2C 1LM0A 2NYZD 1U4LA 3CMAA 2WAQB 1SNDA 4DV4Q 2R7DA 1HNXQ 3SXHA 1PRTF 1SYFA 3C1FA 4DAPA 4BBSB 2V1CC 1W6JA 1XX8A 2E2HH 2RBMA 4B3TQ 1X3QA 4UPAA 4F8MA 4JYAQ 2HIXA 2V4DA 1X65A 3AEVA 1I3QH 3KOJA 4DU9A 3NTHA 3OSOA 3RLNA 2I5LX 1Q46A 2LXKA 3BU2A 1X32A 2RA4A 3MFGA 2Z6BA 1YHAA 1PA6A 2B2WA 5ELBA 1HZCA 4C1NK 4B3ML 1X6OA 2WB1B 3A8IE 1HUMA 2KJXA 2AKWB 1MGSA 5C6AA 2Z6KC 1V1OA 5IGFA 1TWGB 1OXSC 1MD2D 3IRBA 2AQ1B 1JICA 5I6YA 4C3IH 2F03A 3S1NB 2JA7B 5EGTA 1J5EQ 1G2TA 4L5QA 4JOIC 3VA7A 1NSNS 1UE6A 1Z9FA 4J8QA 1STGA 3HOZG 4K5VA 5D3IB 5C0XJ 2B8GA 1K8MA 1XYIA 2H1EA 5CV4A 3KF6B 1IBLL 5CC4A 2NN6H 2EY5A 1GD7A 1N32Q 3H09A 1PXUA 3X3MA 4JI1Q 2DY7A 5IP7G 3HS0C 3MWYW 2I46A 1VF5C 2QDBA 4A3BB 2XWJB 1I6VC 4P2CB 5BN4A 3PO2G 3SVMA 1AW7A 3J7A5 3WDNA 1XMOL 2QF7A 1LT3D 5M5WH 2BOSA 3EVQA 3RLOA 3I4MH 1HPCA 1SXTA 1LLRD 3CHBD 2F0FA 4DR4Q 1MJCA 2XGTA 4APVA 3FKIH 4LK1C 2L12A 2MP1A 2JP1A 1CZWA 5M3FG 2E2IH 4RGOS 4MIUA 5EPJA 3AQQA 1BUVT 3K5NA 3K7UC 2NTSA 2A5HA 3CCLA 2ZJQA 1BCPB 1SNPA 3C2PA 2D0OA 3HOWH 1IKMA 2R92G 4RHRA 4DUYQ 1KDBA 2UXDL 2E76C 4X3TA 1Y1WH 1PH8A 3CD6A 1CM9A 2IX0A 4HJ8A 1ENFA 1UEAB 4Z9CB 4OX9Q 4PZ8A 1BVSA 1ET9A 5IP7H 1AFPA 1S5CD 2NB0A 2L5TA 2CH4W 5FO7B 1VMPA 4FXDA 1CQFA 3A74A 3EROA 1XPUA 1HJPA 1LTSD 2D5DA 1SE3A 4L8JA 3Q22A 2EE1A 2NZHA 5J22A 2KCNA 4EVOA 4WFN3 5ELCA 5J39A 3QG1A 4NPSA 5C4XB 1ILPA 1CKOA 2ZTDA 1EL0A 2CKZB 1Q86C 1IXRA 1AP0A 1F2MA 1VQBA 3MXUA 3URYA 1CFMA 2MFIA 1A2TA 1RD9D 5IP9H 3PMFA 1ESRA 1U4PA 3CKIB 1SRUA 3CC7A 4CGYB 1M1KC 3CCEA 4KHPL 2K5DA 2HQLA 4NXMQ 4DK3C 4HTHA 1PH3A 5K5PA 1A62A 1L1OA 4MNOA 4ZUJA 5I9PA 3ICEA 4B3RL 5CV9A 3SDZA 2OT2A 3E0JA 4HCSA 1XMQQ 2CQAA 1JCKB 1NR2A 4RWSC 2PI2A 2RHQB 4HN7A 4C3HB 5DLQE 1NNXA 1I50H 3I2ZA 3VA5A 3K59A 5LHY1 1SE4A 1QVGA 1TWHH 1B70B 3KF8A 3AFPA 4DR3Q 3N52A 5M3MB 1RJTA 1LTID 4POFA 5EPKA 1K3RA 1Y14B 4WRDA 3MXNA 1ZXTA 4DPGA 2F4IA 2EJGC 3T56B 2E2JB 4MZ9A 4JI4Q 5GROA 5KGUA 5FLMG 4GKJL 4O42A 5C3WA 1TWCB 3GTGH 2BCOA 1X3PA 3PUZA 5IWAL 2EPBA 4GOPC 3OIPA 4CJ0B 3CCUA 1JE4A 1EYCA 1XXGA 4CKBA 3TZUA 4YCWA 2BH2A 1E24A 3ULJA 2HT1A 4UP9A 4TRDA 3GTPH 1TWAH 4F7XA 1Y69U 1O7YA 2FJ2A 4O0AA 4DV2L 4YCUA 4GZYC 1SE8A 1LTAD 3KJPA 1JR0D 3A5ZB 2E2HB 2VQEL 3AB9A 3T4AC 3CCQA 4DV1Q 5LL6X 4Y7NH 5EBCA 1HHVA 4X62L 3MZ5A 1I3QB 1N33Q 4TKOB 4KMUC 1SROA 4JI8L 2OXPA 3G48A 1WTXA 3ONAB 2WAQG 1XNQL 4G7HC 1WYDA 3S24A 3PV0A 4DR6Q 3K6OA 1RF2D 1SYGA 2NUCA 5E3FA 1EY4A 1PLFA 3GQBA 3EA6A 1I94L 4JV5Q 1FJGL 3ULLA 1SFOH 3TSSA 1PVOA 1HZBA 2K5VA 2UXCL 1XNRQ 4DR5L 2Z6KA 1H95A 2K04A 1B4OA 4RMFA 2L11A 2Z1CA 4EX5A 1JMCA 2R93H 4GN5A 4DR1L 4YY3L 4JI0L 4IURA 3OTOQ 4X65Q 1V43A 3LNNA 3NE5B 4A3EH 2WB1G 4JOIA 4B3SQ 3TP8A 3SR1A 4RKLA 1KNEA 1EU4A 1KTKA 2LXJA 2ZTEA 1E22A 3H3VI 2BE5D 2EYLA 1RIPA 2EYJA 4FF4A 2JA7G 1EY5A 3D4DA 1VQDA 1YI2A 1VQGA 3T1HQ 2O5JC 2NTTA 2O4XA 1G91A 3ULPA 3FDTA 1MSGA 2XRSD 1GUNA 2O5IC 1YITA 2UXBQ 1DXMA 3PUWA 3A54A 1NR4A 3OHXC 5C4JH 4LF7L 4A3GH 5CBAE 1A63A 1QCBD 2E8GA 1SYBA 3CRKC 3I4OA 4E6IA 5M5WB 3S1QH 3I4MB 4NDXA 2DNEA 2B29A 3OPOA 4HR7B 1Q8IA 4KJNA 2N78A 3FKIB 4H02A 3M85A 1A15A 2KECA 3RMHA 4A3BG 1C9OA 3CCSA 3KBGA 2E2IB 1YJ9A 2JEAI 5I4DA 1OXXK 4DV5Q 1NMGA 3QR8A 4LMQD 1FL0A 3ND8A 5CORA 4YHHL 4HIDA 4LFAL 2Z4IA 1T5EA 4A76A 2UUBQ 5JAVA 4ZLTF 1DD2A 3W3AA 2F0VA 5J3BA 3HOWB 1F9SA 1S40A 2N55A 2XRQD 3NELA 4AYBE 4K5WA 1E3PA 1F9PA 3BZCA 1JJ2A 4O2DA 1CSPA 1ICFB 1Y1WB 5IT9c 3BZKA 1X54A 1B7YB 4C3JH 4LF6L 5KNDA 3HOYH 5LMNW 5JJKA 2R7ZH 1DYQA 1JC7A 4DAYA 1SEBD 2XN9C 4AH6A 3H0GH 4B9WA 1C8CA 4LF9L 1QWYA 1UWVA 2FFKB 3BJUA 5HY6A 3TQYA 3T51B 4FF3A 3HKZE 4QMGA 1I6HH 1VS0A 2EJFC 4N8FA 4DV0Q 3R8BA 1IBML 4IO9A 5JPNC 1MKHA 2PYKA 4YWKA 1CHPD 2PQAA 2QEXA 1OO9B 5ISRA 3J7YW 2OTLA 3TS2A 3VYRA 1JOOA 4KD4A 1Q1BA 2XTIA 1HQRD 3F2DA 1E0BA 3T1YQ 3MXGA 3WWVA 5C4XG 3DXJC 4U673 2ICEC 1HTPA 2K5WA 4IPDA 3EIVA 2IT1A 2F0KA 3U50C 3V96A 5DM63 3J80c 1J8IA 5KYLA 1TWFH 2Q8IB 4KY7A 1WTVA 4C56C 3U58A 2F0IA 2OEOA 1A3TA 4DV7Q 1Z6HA 4ALPA 1TWHB 2EXZA 1TS2A 1X56A 4N8X1 2A73B 2YV5A 4DKAC 5IODA 2MNAA 2NN6I 3J80i 3UDFA 4C3HG 1UEBA 2IWHA 4LUOA 2F0PA 3GTGB 2K75A 1E2VA 1E1OA 4LW1A 3M9BA 5M3MG 1ZEQX 1PYWD 4K8JA 4GNXB 1EFID 1EY7A 5KNCA 4GOPA 5BR8L 4WJWA 4I7ZC 3W1BA 3Q0AA 2JE6I 5EKKA 1JOKA 2UXBL 3PIP3 2EIFA 2RHSB 4CJ1B 2E75C 1RODA 1TWAB 4UDUC 4YCVA 1YNNC 4QB4A 3KBXA 4CDEC 3S2HH 4IOAA 4ZKCB 2F0QA 1X3GA 2NVXH 5C44H 4PV1C 3PIPA 1MSHA 1FNVA 1N36Q 3UDGA 3S1MH 2G9DA 3VYSA 4AYBB 4HCEA 5C3XA 4Y7NB 2QW7A 1QNUA 1U4RA 2QCPX 4OIKA 1ASYA 4JI3L 4ZCKA 2BDOA 1QUQA 1U0LA 5JVG3 1B50A 2Z8LA 4X64L 5I2XA 3RD4A 4PZ6A 1L0WA 3E6ZX 4X66L 4KLKA 5FOBB 4GKKQ 4A75A 2Q8RE 2K5QA 2KHSA 1ENCA 2UUAL 1SR3A 3EJIA 1K83H 3HFZB 1PRTC 4CBVA 2VZAA 2R93B 2B3GA 2F0SA 3Q8DA 5EBDA 1C48A 1QNKA 4F88A 4K0KL 1IYUA 3NSWA 3MFYA 1P16A 1UE1A 4A93G 1H9RA 1Y8PB 4DK6C 4XT1B 3TN2A 4A3EB 1YJWA 2F0UA 4LF4L 2VL6A 3VR2A 4HEDA 4H44C 3OMCA 4IN3A 1HA6A 2JK8A 4FNFA 3TRZA 1TS3A 5LMNL 1SNCA 2DUDA 2PI2E 2EYHA 4X3SA 2KOLA 2Q2UA 1KDCA 1T9HA 1TIID 2K14A 3EN2A 1ML0D 2HD3A 3HKSA 1BCPC 2MJ8A 2EYFA 3U9SA 1DJRD 1SDFA 2KEDA 1NAPA 1PFMA 3ER0A 1FGUA 4HSVA 5C4JB 4A3GB 3G71A 2NN6G 4RGTA 1CA6A 5IGGA 4K6DA 4KY6A 3HEJA 1ONLA 4ABNA 3S1QB 1W6KA 5EPLA 1D5MC 3E9HA 3SE0A 1HNWL 1T5XD 4JI2L 5EKLA 5AJ3Q 1DOLA 3OMGA 1B9MA 4JBJA 4JBMA 1VQPA 4OIJA 3DEOA 2Y0SB 4JK1C 4IUNA 5IGEA 3J7AV 2J4XA 1C4QA 2PMZE 3H3VC 3QWNA 4A93H 1VQHA 1LTLA 4P73A 4IFDH 2XIWA 1PFNA 3I4MG 3K0YA 1PTOH 2JJQA 4WJ4A 1BCPF 2EDGA 3D6CA 1K3BC 3VYTA 3FKIG 1EY9A 5JPMC 2ZM6L 1DGSA 1IBKQ 1AE3A 1CK1A 3KDFA 5M5YH 1YNND 3D4RA 5CV8A 4C3JB 1VQ7A 3PF5A 3HOYB 1STNA 1BKBA 3TEHB 2R7ZB 1O7LA 3A56A 3HOWG 2FMMA 3H0GB 2VS1A 2D62A 4OXPA 2JEBI 3U9OA 2A19A 2VY3A 5COYA 5E1FA 3TBIB 2LSSA 1FR3A 2F0OA 3K80C 1Y1WG 1D5XC 1EEID 1I6HB 1D2BA 2CHBD 1CA5A 1I4PA 4CDDC 2R7FA 3D6WA 5ELFA 3BVZA 5IOCA 1Z7TA 2UU9L 1AE2A 1WVLA 3W1GA 2OQ0A 3MVVA 2HCCA 2NZOA 4JBWA 1EQVA 1Q8KA 2Z0SA 3V2TA 1TVXA 5C5LA 3QOJA 5ELOA 1PRTD 1SJHD 1XJVA 1JB7A 1L1OB 2JSOA 3BYYB 3RUZA 4FYDA 2JA5H 2GVBA 3S14H 3I3CA 3NUCA 1JJCB 2PW5A 3JAME 2RVLA 1D7QA 4LF5Q 1KL9A 1STEA 2O2LD 1BF4A 1GUWA 5LMUL 2EY2A 4QF4A 1CKNB 5IP9G 5IE8A 3ZYYX 1TWFB 3OYYA 1AZQA 5FK9C 4A3MH 3P75A 3DM1A 2IX3A 1AH9A 4QIWE 1GUOA 1IYVA 4DNIA 1JWMD 3HZXA 3JAMi 3KF8B 3NEMA 4TVAB 2RCNA 4CHTB 1V1QA 4BY1H 4DR2L 1YVCA 4XQQA 4LFCQ 2K4KA 1BCPD 3OW2A 2QDLA 3MXNB 3CCJA 1JT8A 4F87A 3EQLC 5A35A 2VQFL 1TS4A 1EYAA 1RKNA 3HOVB 4RG1A 4C1NI 5IGCA 5KYIA 4DXFA 4EGVA 2MUYA 4RKBA 3P20A 4ZUIA 3GTQH 3E9IA 4BA2I 3DMUA 2JA6H 3Q6SA 4KD3A 4OWWB 3F8TA 2PMZB 1QVFA 4ODGA 2F0HA 5KRUA 1TY2A 3VDYA 1X9NA 1LT6D 2SEBD 1Q7YC 4IJLA 1CT1D 3S2HB 3K5MA 3NK9A 4DV4L 4DV6Q 1HNXL 3A7LA 1JJGA 1STAA 1WTPA 2NVXB 5C44B 1IKLA 2K7VA 1LTRD 1QZGA 4B3TL 2EQSA 3FRPB 3NBHB 4KKSA 4OWXB 3S1MB 5IYDH 4P74A 4JYAL 3I56A 1PFSA 5KIXA 2HQEA 2IPKD 1HR0Q 4IPGA 3RNUA 4JI5Q 2BE5C 3DLLA 1PH9A 2IY5B 3R2IA 1PZID 5I9OA 2K5HA 1V8QA 2D2CC 4HAEA 2NZ1D 4RA8A 4LF8Q 2R61A 4AIMA 1IHZA 2IHFA 2K5NA 2GA4B 3EFXD 4AYBG 1ASZA 1K83B 3SHLA 1EOVA 1GO3E 1YNJC 5JEAH 3ERQA 1UAPA 1Z47A 2N3SA 3NENA 4RAUC 1W2BA 4LFBQ 2OQKA 3GTOH 4XQNA 4I7AA 2ENBA 1NJIC 3TP7A 1J5EL 1QG7A 1OTCA 2KUMA 3LGJA 5LL6S 5IYBH 2B63H 2I5HA 2F4VQ 3AYHB 1K73C 3PIO3 3JAML 2KQ3A 1GHKA 2XWBB 4NXNQ 2PW7A 3A8JE 2R93G 3PIOA 2Q2HA 2K1BA 1WOCA 1HNZQ 1N32L 4A3IB 1B2TA 1SLJA 1S5BD 4JG2A 1MIUA 5JJZA 3Q23A 4A3CG 4A3EG 5L37A 1RTOA 1LT5D 4JI1L 4HJAA 5HGQA 2CQOA 1EY8A 2HCIA 2KEEA 3H94A 1N8RC 3GP7A 1S5FD 3FEWX 3SK4A 1PZJD 3PF4A 3SEBA 3HOXH 4IOCA 2GVAA 1VQ9A 5C3EH 2F0TA 1MI2A 5IYCG 3NQTA 5CV6A 4DR4L 4UY8C 4XYOA 2C35B 1V1PA 4U68A 2AHOB 1N34Q 2UUCQ 3NTIA 1WFQA 4A3GG 2XSCA 2AMCB 1F2LA 4YWLA 3M7NA 4M1UB 3I55A 1PYBA 4A93B 1EQTA 4EQ5A 5E7NA 1PTOB 2AQ3B 5G3LF 4IPCA 3DUZA 4UHVA 2QA4A 1XPOA 4IUQA 2EJMA 1HA5A 1LTGD 2I07B 3SK8A 3ZJYC 2Y0SG 2FHTA 4DAVA 4DUYL 1KIXA 3PGZA 2MHVA 3U4ZA 5AFWA 2PNHA 5M5YB 1PYSB 1QILA 2SDFA 1JOQA 2HHHQ 5C4ZA 4A3CH 4DAYB 3WOEA 4DUZQ 3ITPA 4DNRB 4OX9L 5C4HA 1IW7C 4A3JH 3DEPA 1DOMA 3CRLC 1H9SA 2CVRA 2PZWA 2ZT9C 1CTMA 1HZAA 5A2QE 3CMEA 2DJFC 3HOUH 1KNAA 4C3JG 1O78A 1Q90A 3B6YA 3HOYG 3NWTA 3M4OH 2R7ZG 5IYCH 3GO5A 4DXGA 4HJ7A 1UNSA 5D65A 1A0IA 1I4XA 2TMPA 3H0GG 3GDEA 2PQAB 2NVYH 4ME5A 2NVQH 1G2SA 3GTJH 1STBA 1YNJD 4L5RC 4NXML 1F9QA 2JA5B 5JOBA 3S14B 4BBRH 1KD1C 4LAAA 5CR3A 1TT2A 1SBBB 1EIYB 1NMFA 2ID0A 2QEJC 2E5LQ 1XMQL 1KXLA 2A74C 4JVZA 4J15A 2JQOA 2JA8B 4A3MB 3KYHC 3F2BA 1VQJA 4G7OC 5JJIA 1PZKD 4ZAIA 4BY1B 1EZ6A 2JXMB 3MEFA 5G3LD 4ID6A 4DR3L 2N88A 3S1RH 4A3FH 5M9OA 4O1NA 2F0EA 1FNUA 1P8LA 1YJNA 1BQQT 4LUVA 4POGA 1HFNA 1LABA 2D0PA 2CW0C 4JI4L 2K6AA 3F2UA 3I4LA 1SYDA 3HG9A 4G57A 3GTQB 3VR5A 1G6ZA 2JA6B 1EIFA 4IUTA 4GOPB 1I4GA 1KDAA 1SAPA 2CFMA 2LMCB 1XPRA 1FNWA 2A6HC 2IJ0A 4BXXH 2F1MA 2Q8TA 4ZYSA 2WIIB 3K81C 3HOVG 1PFBA 2B2YC 3LWUA 3PO3G 1BBUA 1K0SA 3A8KE 4IUVA 2NBFA 2EVBA 2RDFA 3NBIA 5E4WC 3TS0A 1BO0A 4DV1L 2FMCA 1SN8A 1ICWA 1N33L 3G6JB 1VQ4A 1QUQB 3I70A 3G4SA 1C0AA 4KN7C 2LFNA 1DCZA 3KLWA 1E7ZA 1QOHA 2VB2X 3VR4A 1LACA 3K8AA 1QZHA 4IFDI 2UUCL 3I72A 5GAHC 4DV3Q 4X3KA 1ZYRC 2WFWA 4DR6L 5C44G 1WI5A 4AQYQ 4V190 5A2QL 2PZTA 2M2LA 4HIMA 1R4QB 5C0XH 4JV5L 5J1ZA 2VUMH 2PQEA 5BN5A 3CCVA 2IX1A 3J7AF 4BY7B 2RKSA 3BDOA 1VQIA 1IW7D 1YZ6A 4RH6A 2SOBA 1KRTA 3CCRA 1EQQA 3NHHA 1XNRL 1Y1VH 3OIQA 1SE2A 1K9MC 3E3XA 3R2TA 4JC0A 2VNUD 3L2PA 1VF7A 3I4NB 1DZ1A 3GTOB 3OTOL 4X65L 2ES2A 2RF4A 3M3YH 4L63B 1IL2A 4OWTB 2YTXA 2B63B 1STHA 4RCOA 1CSQA 3N6RA 1O80A 3GV3A 2L55A 4ILWA 4B3SL 4R8IA 4RGNA 4CDCC 4V0BA 3HOVH 3NWSA 3L7ZC 4K5XA 3PO3H 2Z9HA 3W2DA 1WCMH 1Y8OB 1UUPA 2H5XA 4DA2A 4FF2A 3NPPA 2WAQE 5GADC 2MQHA 4B3MQ 3FP9A 2AUKA 2YU9H 3TP6A 3FVQA 2K03A 3T1HL 2DY8A 3CC4A 3X3NA 1VCIA 2OWOA 2RCFA 5D3DA 3S16H 1CQVA 2A68C 2WACA 4FF1A 2VB3X 2LKVA 2KA7A 4PG3A 1O7ZA 2KHJA 4H7BA 1B3QA 4LUZA 3HRZC 4XYQA 1HCZA 3RZOH 3MTSA 4A3IG 3HOXB 2EYOA 1EY0A 4Q5VA 2Z4HA 5C3EB 4GLAC 3AMUA 5NUCA 2ZXOA 5FLXE 1IBLQ 2WB1E 5IGDA 4NW2A 3K57A 3F1ZA 4A3DH 4DN4M 1PH6A 1J9OA 2R3ZA 3CXCA 3BVMA 3DM3A 4DV5L 1K8AC 1A3VA 2A1AA 3T53B 4TQUS 5ELNA 2CW0D 1AN8A 2NVTH 2SNMA 2UUBL 1SJED 1TU2B 1PMRA 5FJ8G 4K2KA 4EQOA 3HKZB 3J81E 4DFAA 1XMOQ 4PZ7A 3KDFB 2A6HD 2EYPA 4R4OA 3BS1A 4QGUA 3JC66 4CKCA 1DOKA 4IFDG 3P1HA 1M8AA 1TS5A 3K58A 5KNBA 1YNXA 3VR3A 1N9WA 3BZDB 4R4CA 4OGQC 1LV9A 5I6WA 1D6EC 1X3EA 4A3JB 2B2UC 3A7AB 1HRJA 5FKAC 3K5LA 3J7ZC 1FD7D 1KHIA 1QVCA 2B2VC 2DN8A 2M9VA 1QJOA 4MTKA 1G6PA 3S9WA 3S17H 1TXYA 2AUJD 2DJGC 1HTLD 3HOUB 1KABA 4A3IH 1ENAA 2E74C 4OEMB 1ZYRD 3FHWA 1B44D 1BOSA 4IUPA 5ELDA 3M4OB 1SNQA 2LY7A 4IUUA 5EKIA 2AWNA 5GAGC 2YYZA 2NWGA 1E2ZA 2UXDQ 4DV0L 2PNRC 1SNMA 2NVYB 2NVQB 4Q0FA 1EQRA 1CHQD 1A2UA 4NMZA 3GTMH 1NY4A 3GTJB 1WTOA 2L9HA 3S15H 3C1EA 4BBRB 1B8AA 1L0YB 2RSOA 1BBXC 1E1TA 4KHZA 4DNTB 3QB3A 5FJ8H 3T1YL 2IHEA 1FVIA 1XTDA 3KLSA 4HIOA 2K05A 1W3SA 1GUTA 3IFDA 2A8VA 1SMYC 1WTQA 3BDCA 1YHBA 4OO1H 4PMCA 4JW0A 4HJ5A 5T1GA 1QB5D 2JA5G 4RHSA 1NUCA 4L6TB 1XWEA 4DV7L 1MJEA 2CWAA 4L5TA 3SK5A 3PQIA 3TREA 4R8NA 3S1RB 1BDOA 4YIJA 4A3FB 3W5OA 3DHQA 4XIGS 4KHPQ 2ICIA 2JA8G 1RL2A 2A68D 5FLXL 4A3MG 3A5UA 2OCEA 4WORA 1H9MA 2F0NA 4DK0A 4QY7A 4B3RQ 4JBKA 4MHEA 4BY1G 1R9TH 1VDZA 4ZKBB 2F0MA 4GN3B 3DWPA 4TSSA 4P75A 1EUJA 3NP8A 1EYGA 2WV6D 4IJHA 3P7JA 1V9PA 2OF1A 3UE0A 1E2WA 3ND9A 2FINB 3J81L 2TSSA 2B2YA 3D8GA 1GXDC 1D8LA 5CV7A 4A3LH 3PUXA 1TQOA 1U4MA 3I8ZA 3M4PA 1N36L 2JA6G 4H13C 4K2LA 4PNYA 3STBC 1TKWB 3UDIA 3MAQA 5CMDA 4HSPA 5IIFA 4R4TA 3IKJA 3VR6A 5CGKA 4GKJQ 1MHWC 3JAMc 4J6HA 5EAYA 5IWAQ 3FPPA 3H6MA 2L0CA 1A6XA 1LYLA 3QJYA 1PH7A 5IYDG 2VUMB 3TZDA 3L9AX 4GKKL 3GTLH 1HXYD 4PMBA 5I2YA 3CPFA 1VQNA 2A69D 1FYCA 2JA8H 2ATWA 1Y1VB 1PRTB 4B9XA 3U4VA 4DV2Q 1K8OA 5K36G 4KN4C 2VQEQ 1TR5A 2N8NA 2F0JA 3M3YB 3OWEB 4B08A 3RZDH 2G5DA 4X62Q 2LS01 1WD0A 1UE7A 3DWQA 2YTVA 4JI8Q 2VXWA 3BYTB 1AEXA 2K01A 3BVGA 4BY7G 1I5FA 1XNQQ 2F52A 3R3OA 2JYOA 1GOZA 1GM5A 3PO3B 1HZ9A 1WCMB 2KCTA 4KK7A 5JEAG 2A6EC 1I94Q 3EBEA 2WP8J 4KKTA 3RLFA 3TP5A 1FJGQ 1L0XB 2C5CA 3I4NG 1PTOC 2YU9B 2OTJA 3QO2A 3HOZH 2UXCQ 1K8GA 5IYBG 4DR5Q 2B63G 3GTKB 1KC8C 1WTRA 3CQZH 3S16B 1D5ZC 2JA9A 2KCMA 4DR1Q 1C7YA 4YY3Q 3IL8A 3IAYA 4JI0Q 3D3RA 5M5XH 3NTKA 1SMYD 3T13A 3AU7A 4C2MH 1WD1A 3RZOB 2SNSA 2ASBA 3NXWA 4CKEA 1HR0W 3I7FA 1VQ5A 1B9NA 1DM0B 1K28A 5AJ3L 1EOTA 2ZTCA 4NB3A 3PO2H 1V1PB 3A0JA 5CYUA 3KF6A 5K36H 4JPBW 4A3DB 4BA1I 5DM73 5CBEE 4X3UA 3OW7A 3D0FA 5F2DA 1DONA 4RCNA 1PTOF 2NVTB 4L5SA 3HOXG 5CV5A 1OXUA 2C9OA 5C3EG 2KVMA 4BY7H 3L3OC 5M3FH 3KFUA 1PDQA 4LF7Q 1WTHA 3MXPA 4XT3B 3MC0B 4ZK9B 2EY1A 1EIGA 1Q12A 2J0TD 1IBKL 4FXKC 1CI3M 2CWPA 3I4NH 3UI2A 3CF5A 4OONA 4R1JA 4JI7Q 2R92H 1JB3A 5EQ0A 1H9SB 2B2UA 1LTTD 3HKZG 1CKNA 3A55A 4NP5A 3STBD 5EJWA 2FXQA 4LFAQ 4YHHQ 2HUGA 1EZ8A 2B2VA 4P72A 3S17B 4I65A 1EU3A 1EWHA 1AZPA 3MEHA 4QQBX 1RTNA 4M8AA 4A3JG 1LO5D 4A3KB 5D14A 1KLGD 4QIWB 3CPWA 3HGBA 4GLXA 2AQ2B 2ZXPA 3O13A 4DF7A 1ILQA 3TMEA 3GTMB 3K0XA 2BDNA 4QJFA 1I4RA 4LF6Q 1S5DD 3HOUG 5ELEA 4H0LC 3S15B 5C0XI 4UP7A 2K52A 4IFDJ 1M90C 4EQPA 4XQJA 2MPMA 4LF9Q 2GN5A 1CZGA 3UDXA 4LF5L 3K7AH 3DWAA 1VQMA 4ZRZA 4K6LA 4JI6Q 3M7GA 2PPBC 1JWUD 1ZKOA 4GLVB 2EOTA 2M00A 1KAAA 4MN3A 2A6ED 4FXGC 3M4QA 4BBRG 4P71A 2F3WA 4G4KA 2WKDA 3CCMA 1PTOD 1IBMQ 3NBHA 3BDLA 1ESFA 4QL5A 1VQOA 2QILA 4N9TA 1KRSA 3M4YA 4LFCL 1EEFD 2K50A 1A8VA 2ALYB 2I5MX 4UAIA 4BBSG 1S5ED 4ME3A 1F2ZA 2EY6A 4DR7Q 1R9TB 1PV4A 3C3LA 4A3FG 2PZUA 5GQOA 1PH5A
chains in the Genus database with same CATH topology
2K33A 2F0DA 2BA0A 2K32A 4RFBA 4C3IB 2PO4A 4LJZC 3QIAA 1GJXA 3QOLA 2KCCA 4KY5A 1QE6A 4HMJA 1RDPD 2B2TC 1LT4D 1B53A 4ULLA 3HP3A 4OHJA 2X69A 5C5MA 2PCFB 1EWCA 1SYCA 3WOFA 4KTAA 1SSOA 3GTLB 4KHVA 2RQXA 3H91A 3FPUB 2XNAC 1BR9A 1OXVA 5IGBA 2ZXRA 1BNZA 4ZQ3A 4K14A 1STYA 3FMCA 3RZDB 1RCVD 2K28A 3E5SA 4KV6A 4QCLA 4QUFA 4IALA 5C0XG 1VMCA 5HURA 3KUPA 5FO8B 3I90A 1D1IA 1EY6A 2B2WC 1HUNA 3C46A 4RGMA 2XVSA 4S3SA 3HOZB 3CQZB 3SK6A 2F0LA 4BS9A 4PMWA 4FO2A 4KKUA 5M5XB 1TY0A 4C2MB 4NKLA 1EYDA 5HGTA 3D31A 3Q24A 5IT9E 5FO9B 4OO1I 3PO2B 1JORA 2WKCA 1SNOA 4FP5D 1F9RA 5KEEA 5JEAJ 3I91A 1OXTA 1SYEA 1HFGA 2F0WA 4G7ZC 2F0GA 1H9JA 1M4VA 1BXTA 3I73A 2MGSA 4BWGB 1RHPA 5M3FB 2RSNA 2QKIC 1NCVA 1D1KA 2DNCA 5E4XA 2RDGA 1KLUD 3KLRA 1Q1EA 2WINB 2EZVA 1XTCD 3G7LA 1EIHA 1JWSD 2R92B 4J1MA 4IZ8A 3NQIA 2HDLA 4PQXA 1I50B 1HQMC 2IW3A 3V05A 3J80E 5DEHA 4OL7A 3GD7A 5T1IA 2L4NA 1A3UA 2L1BA 1U9RA 2B8FA 3K5OA 1B1ZA 2RDHA 4DGZA 3R93A 1WTWA 1ET6A 1II3A 3PUYA 1G291 1GUGA 3T16A 3MA2B 2B39A 1FGBD 3CU7A 3TDQA 3PUVA 1R4PB 4IQZA 1S4ZA 4EQNA 3K7AB 1F2YA 3GTPB 3LX0A 2EYMA 4R9WA 3IFTA 3KK7A 4XXEA 1JQYD 3KLSX 2J7ZA 5JVH3 2E2DC 1GUSA 4XDXA 5IT9L 3D4WA 4OO1G 1F77A 2HDMA 2X6LA 4DK1A 2AWOA 4FVMA 3VYUA 2D9UA 2X6GA 1Q3LA 1LTBD 2IL8A 1SFOB 1IL8A 3LWEA 2F3VA 2R6GA 2A69C 1GHJA 3OOCA 3S2DB 1I4QA 4HMIA 5DNFA 1B3AA 1Y8NB 2G9HD 2H4OA 1MBYA 4KJOA 2B2TA 5DAUA 4N9PA 1I4HA 3OWFA 4C3IG 3BG3A 4KI0A 1H9KA 2BA1A 1G8ZD 5TSSA 3J80L 4XTCS 4QUCA 3GV6A 3MHBA 5BN3A 4K8IA 4CJ2C 2NYZD 1U4LA 2WAQB 1SNDA 3SXHA 1PRTF 1SYFA 3C1FA 4DAPA 4BBSB 1W6JA 1XX8A 2RBMA 1X3QA 4F8MA 2V4DA 4DU9A 3NTHA 3OSOA 1X32A 2RA4A 3MFGA 2B2WA 5ELBA 4C1NK 2WB1B 3A8IE 1HUMA 2KJXA 1MGSA 5C6AA 5IGFA 1V1OA 1TWGB 1OXSC 1MD2D 2AQ1B 1JICA 5I6YA 2F03A 3S1NB 2JA7B 5EGTA 1G2TA 3VA7A 1NSNS 4J8QA 1STGA 4K5VA 5D3IB 5C0XJ 2B8GA 1K8MA 1XYIA 2H1EA 5CV4A 5CC4A 2NN6H 2EY5A 3H09A 1PXUA 3X3MA 2DY7A 3HS0C 3MWYW 2I46A 1VF5C 2QDBA 4A3BB 2XWJB 1I6VC 4P2CB 5BN4A 3SVMA 1AW7A 3WDNA 2QF7A 1LT3D 2BOSA 3EVQA 1HPCA 1SXTA 1LLRD 3CHBD 2F0FA 4LK1C 2L12A 2MP1A 2JP1A 1CZWA 4RGOS 4MIUA 5EPJA 1BUVT 3K5NA 2NTSA 2A5HA 1BCPB 1SNPA 3C2PA 1IKMA 4RHRA 1KDBA 2E76C 4X3TA 1CM9A 2IX0A 1ENFA 1UEAB 4Z9CB 1ET9A 1AFPA 1S5CD 2NB0A 2L5TA 5FO7B 1VMPA 4FXDA 1CQFA 3EROA 1LTSD 2D5DA 1SE3A 4L8JA 3Q22A 2EE1A 5J22A 2KCNA 4EVOA 4WFN3 5ELCA 5J39A 3QG1A 5C4XB 1ILPA 1EL0A 1AP0A 1F2MA 3MXUA 3URYA 1CFMA 1A2TA 1RD9D 3PMFA 1ESRA 1U4PA 3CKIB 4CGYB 2K5DA 4HTHA 5K5PA 5I9PA 4ZUJA 5CV9A 3SDZA 2OT2A 3E0JA 4HCSA 2CQAA 1JCKB 1NR2A 4RWSC 4HN7A 4C3HB 3VA5A 3K59A 5LHY1 1SE4A 3KF8A 3N52A 5M3MB 1RJTA 1LTID 5EPKA 4WRDA 3MXNA 1ZXTA 2F4IA 2EJGC 3T56B 2E2JB 5KGUA 4O42A 5C3WA 1TWCB 2BCOA 1X3PA 3PUZA 2EPBA 3OIPA 4CJ0B 1JE4A 1EYCA 1XXGA 4CKBA 3TZUA 4TRDA 4F7XA 1Y69U 1O7YA 2FJ2A 4GZYC 1LTAD 1JR0D 2E2HB 3AB9A 3T4AC 5LL6X 5EBCA 1HHVA 3MZ5A 1I3QB 4TKOB 4KMUC 2OXPA 1WTXA 3ONAB 4G7HC 3PV0A 3K6OA 1RF2D 1SYGA 2NUCA 5E3FA 1EY4A 1PLFA 3GQBA 3EA6A 3TSSA 2K04A 1B4OA 2L11A 2Z1CA 4IURA 1V43A 3LNNA 3NE5B 3TP8A 3SR1A 4RKLA 1KNEA 1EU4A 1KTKA 2BE5D 2EYLA 2EYJA 4FF4A 1EY5A 3D4DA 2O5JC 2NTTA 2O4XA 1G91A 3FDTA 1MSGA 2XRSD 1GUNA 2O5IC 1DXMA 3PUWA 3A54A 1NR4A 3OHXC 5CBAE 1QCBD 1SYBA 3CRKC 4E6IA 5M5WB 3I4MB 4NDXA 2DNEA 3OPOA 4HR7B 1Q8IA 4KJNA 3FKIB 3M85A 1A15A 2KECA 3RMHA 3KBGA 2E2IB 2JEAI 5I4DA 1OXXK 4LMQD 3ND8A 5CORA 2Z4IA 1T5EA 5JAVA 4ZLTF 1DD2A 3W3AA 2F0VA 3HOWB 1F9SA 2N55A 2XRQD 4K5WA 1F9PA 1Y1WB 5KNDA 1DYQA 1JC7A 4DAYA 1SEBD 2XN9C 4B9WA 1C8CA 1QWYA 2FFKB 3T51B 4FF3A 4QMGA 2EJFC 3R8BA 5JPNC 2PYKA 1CHPD 1OO9B 5ISRA 3J7YW 3VYRA 1JOOA 4KD4A 1Q1BA 1HQRD 1E0BA 3MXGA 3DXJC 4U673 2ICEC 1HTPA 2K5WA 2IT1A 2F0KA 3V96A 5DM63 1J8IA 5KYLA 2Q8IB 4KY7A 1WTVA 4C56C 2F0IA 2OEOA 1A3TA 1Z6HA 1TWHB 2EXZA 1TS2A 2A73B 5IODA 2NN6I 4C3HG 2IWHA 2F0PA 3GTGB 1E2VA 1ZEQX 1PYWD 4K8JA 1EFID 1EY7A 5KNCA 4WJWA 4I7ZC 3Q0AA 2JE6I 5EKKA 1JOKA 3PIP3 4CJ1B 2E75C 1RODA 1TWAB 4UDUC 1YNNC 4QB4A 3KBXA 4ZKCB 2F0QA 4PV1C 1MSHA 1FNVA 2G9DA 3VYSA 4AYBB 4HCEA 5C3XA 4Y7NB 1QNUA 1U4RA 2QCPX 4OIKA 2BDOA 5JVG3 1B50A 2Z8LA 5I2XA 3RD4A 3E6ZX 5FOBB 2Q8RE 2K5QA 2KHSA 1ENCA 3EJIA 1PRTC 4CBVA 2R93B 2F0SA 5EBDA 1C48A 1QNKA 4F88A 1IYUA 3NSWA 3MFYA 1H9RA 1Y8PB 4XT1B 3TN2A 4A3EB 2F0UA 3VR2A 4HEDA 4H44C 3OMCA 4IN3A 1HA6A 4FNFA 1TS3A 1SNCA 2EYHA 4X3SA 2KOLA 1KDCA 1TIID 1ML0D 1BCPC 2MJ8A 2EYFA 3U9SA 1DJRD 1SDFA 2KEDA 1NAPA 1PFMA 4HSVA 5C4JB 4A3GB 2NN6G 4RGTA 1CA6A 5IGGA 4K6DA 4KY6A 3HEJA 1ONLA 4ABNA 3S1QB 1W6KA 5EPLA 1D5MC 3SE0A 1T5XD 5EKLA 1DOLA 3OMGA 1B9MA 4OIJA 3DEOA 2Y0SB 4JK1C 4IUNA 5IGEA 3J7AV 2J4XA 1C4QA 3H3VC 3QWNA 4IFDH 2XIWA 1PFNA 3K0YA 1PTOH 1BCPF 2EDGA 3D6CA 3VYTA 1EY9A 5JPMC 1CK1A 1YNND 3D4RA 5CV8A 4C3JB 3HOYB 1STNA 2R7ZB 1O7LA 3A56A 2FMMA 3H0GB 2D62A 2JEBI 3U9OA 5COYA 5E1FA 3TBIB 1FR3A 2F0OA 1D5XC 1EEID 1I6HB 1D2BA 2CHBD 1CA5A 1I4PA 3D6WA 5ELFA 3BVZA 5IOCA 1Z7TA 1WVLA 3MVVA 2HCCA 4JBWA 1EQVA 3V2TA 1TVXA 5C5LA 3QOJA 1PRTD 1SJHD 3BYYB 2JSOA 3RUZA 4FYDA 3I3CA 3NUCA 2PW5A 3JAME 2RVLA 1STEA 2O2LD 1BF4A 1GUWA 2EY2A 4QF4A 3ZYYX 1TWFB 1AZQA 5FK9C 3P75A 3DM1A 2IX3A 1GUOA 1IYVA 1JWMD 3HZXA 4CHTB 4XQQA 1BCPD 4F87A 3EQLC 5A35A 1TS4A 1EYAA 1RKNA 3HOVB 4C1NI 5IGCA 5KYIA 4DXFA 4EGVA 2MUYA 4RKBA 3P20A 4ZUIA 4BA2I 3DMUA 3Q6SA 4KD3A 2PMZB 4ODGA 2F0HA 5KRUA 1TY2A 1LT6D 2SEBD 1CT1D 3S2HB 3K5MA 3NK9A 3A7LA 1STAA 1WTPA 2NVXB 5C44B 1IKLA 2K7VA 1LTRD 4KKSA 3FRPB 3S1MB 5KIXA 2HQEA 2IPKD 2BE5C 3R2IA 1PZID 5I9OA 1V8QA 2D2CC 4HAEA 2NZ1D 4RA8A 2R61A 1IHZA 2GA4B 3EFXD 1K83B 3SHLA 1YNJC 5JEAH 3ERQA 1UAPA 1Z47A 4RAUC 4XQNA 2ENBA 3TP7A 1QG7A 2KUMA 5LL6S 3PIO3 3JAML 2KQ3A 1GHKA 2XWBB 2PW7A 3A8JE 2K1BA 1B2TA 4A3IB 1S5BD 5JJZA 3Q23A 1RTOA 1LT5D 1EY8A 2HCIA 2KEEA 3H94A 3GP7A 1S5FD 3FEWX 3SK4A 1PZJD 3SEBA 2F0TA 1MI2A 3NQTA 5CV6A 4XYOA 1V1PA 4U68A 3NTIA 2XSCA 1F2LA 3M7NA 4M1UB 4A93B 1EQTA 1PTOB 2AQ3B 5G3LF 3DUZA 4IUQA 2EJMA 1HA5A 1LTGD 2I07B 3SK8A 2FHTA 4DAVA 2MHVA 5AFWA 5M5YB 1QILA 2SDFA 1JOQA 5C4ZA 3WOEA 3ITPA 4DNRB 5C4HA 1IW7C 3DEPA 1DOMA 3CRLC 1H9SA 2CVRA 2PZWA 2ZT9C 1CTMA 5A2QE 1KNAA 4C3JG 1O78A 1Q90A 3NWTA 3GO5A 4DXGA 1UNSA 5D65A 1I4XA 2TMPA 4ME5A 1G2SA 1STBA 1YNJD 1F9QA 2JA5B 5JOBA 3S14B 4LAAA 5CR3A 1TT2A 1SBBB 2ID0A 2QEJC 2A74C 2JA8B 4A3MB 4G7OC 1PZKD 4ZAIA 4BY1B 1EZ6A 2JXMB 5G3LD 4ID6A 2N88A 5M9OA 4O1NA 2F0EA 1FNUA 1BQQT 1HFNA 1LABA 2CW0C 2K6AA 3F2UA 3I4LA 1SYDA 3HG9A 4G57A 3GTQB 3VR5A 1G6ZA 2JA6B 4IUTA 1I4GA 1KDAA 1SAPA 2LMCB 1FNWA 2A6HC 2IJ0A 2F1MA 2Q8TA 4ZYSA 2WIIB 1PFBA 2B2YC 3LWUA 3A8KE 4IUVA 2NBFA 2EVBA 2RDFA 3NBIA 5E4WC 1BO0A 2FMCA 1ICWA 3G6JB 3I70A 4KN7C 2LFNA 1DCZA 2VB2X 1QOHA 3VR4A 1LACA 4IFDI 3I72A 4X3KA 1ZYRC 4V190 5A2QL 2PZTA 2M2LA 1R4QB 5C0XH 5J1ZA 2PQEA 5BN5A 2IX1A 3J7AF 4BY7B 2RKSA 3BDOA 1IW7D 4RH6A 2SOBA 3NHHA 3OIQA 1SE2A 3R2TA 2VNUD 1VF7A 3I4NB 1DZ1A 3GTOB 4L63B 2B63B 1STHA 4RCOA 3N6RA 1O80A 3GV3A 2L55A 4ILWA 4R8IA 4RGNA 4V0BA 3NWSA 3L7ZC 4K5XA 3W2DA 1Y8OB 1UUPA 4DA2A 4FF2A 3NPPA 2AUKA 3TP6A 3FVQA 2K03A 2DY8A 3X3NA 1VCIA 5D3DA 1CQVA 2A68C 2WACA 4FF1A 2VB3X 2LKVA 2KA7A 1O7ZA 4H7BA 3HRZC 4XYQA 1HCZA 3MTSA 3HOXB 2EYOA 1EY0A 4Q5VA 2Z4HA 5C3EB 3AMUA 5NUCA 2ZXOA 5FLXE 5IGDA 4NW2A 3K57A 4DN4M 1J9OA 2R3ZA 3BVMA 1A3VA 3T53B 4TQUS 2CW0D 1AN8A 2SNMA 1SJED 1TU2B 1PMRA 4K2KA 4EQOA 3HKZB 3J81E 4DFAA 2A6HD 2EYPA 3BS1A 4CKCA 1DOKA 4IFDG 3P1HA 1M8AA 1TS5A 3K58A 5KNBA 3VR3A 3BZDB 4OGQC 1LV9A 5I6WA 1D6EC 4A3JB 2B2UC 3A7AB 1HRJA 5FKAC 3K5LA 1FD7D 2B2VC 2DN8A 2M9VA 1QJOA 3S9WA 2AUJD 1HTLD 3HOUB 1KABA 1ENAA 2E74C 1ZYRD 1B44D 1BOSA 4IUPA 5ELDA 3M4OB 1SNQA 2LY7A 4IUUA 5EKIA 2AWNA 2YYZA 2NWGA 1E2ZA 2PNRC 1SNMA 2NVYB 2NVQB 4Q0FA 1CHQD 1A2UA 4NMZA 3GTJB 1WTOA 2L9HA 3C1EA 4BBRB 1BBXC 1L0YB 2RSOA 4KHZA 4DNTB 3QB3A 3KLSA 2K05A 1GUTA 3IFDA 1SMYC 1WTQA 3BDCA 4OO1H 4PMCA 5T1GA 1QB5D 4RHSA 1NUCA 4L6TB 1XWEA 3SK5A 4R8NA 3S1RB 1BDOA 4YIJA 4A3FB 3DHQA 4XIGS 2ICIA 2A68D 5FLXL 4WORA 1H9MA 2F0NA 4DK0A 4MHEA 1VDZA 4ZKBB 2F0MA 3DWPA 4TSSA 3NP8A 2WV6D 3P7JA 2OF1A 1E2WA 3ND9A 2FINB 3J81L 2TSSA 2B2YA 3D8GA 1GXDC 5CV7A 3PUXA 1TQOA 1U4MA 3I8ZA 4H13C 4K2LA 4PNYA 1TKWB 3MAQA 5CMDA 4HSPA 5IIFA 3IKJA 3VR6A 5CGKA 4J6HA 3FPPA 3H6MA 2L0CA 1A6XA 3QJYA 2VUMB 3TZDA 3L9AX 1HXYD 4PMBA 5I2YA 2A69D 1FYCA 1Y1VB 1PRTB 4B9XA 1K8OA 5K36G 4KN4C 1TR5A 2F0JA 3M3YB 3OWEB 4B08A 2LS01 1WD0A 3DWQA 2VXWA 3BYTB 1AEXA 2K01A 3BVGA 3R3OA 2JYOA 1GOZA 3PO3B 1WCMB 4KK7A 5JEAG 2A6EC 4KKTA 2WP8J 3RLFA 3TP5A 1L0XB 2C5CA 1PTOC 2YU9B 3QO2A 3GTKB 1WTRA 3S16B 1D5ZC 3IAYA 3IL8A 3D3RA 3NTKA 1SMYD 3T13A 3AU7A 1WD1A 3RZOB 2SNSA 3NXWA 4CKEA 1B9NA 1DM0B 1EOTA 1V1PB 5CYUA 5K36H 4A3DB 4BA1I 5DM73 5CBEE 4X3UA 3OW7A 1DONA 5F2DA 4RCNA 1PTOF 2NVTB 5CV5A 1OXUA 2C9OA 2KVMA 3L3OC 1PDQA 3MXPA 4XT3B 3MC0B 4ZK9B 2EY1A 1EIGA 1Q12A 2J0TD 4FXKC 1CI3M 3UI2A 1JB3A 5EQ0A 1H9SB 2B2UA 1LTTD 4NP5A 3A55A 5EJWA 2HUGA 1EZ8A 2B2VA 3S17B 4I65A 1EU3A 1EWHA 1AZPA 3MEHA 1RTNA 4M8AA 1LO5D 4A3KB 5D14A 1KLGD 4QIWB 3HGBA 2AQ2B 2ZXPA 3O13A 4DF7A 1ILQA 3TMEA 3GTMB 2BDNA 1I4RA 1S5DD 5ELEA 4H0LC 3S15B 5C0XI 4IFDJ 4EQPA 4XQJA 2MPMA 1CZGA 3DWAA 4ZRZA 4K6LA 3M7GA 2PPBC 1JWUD 1ZKOA 2EOTA 2M00A 1KAAA 4MN3A 2A6ED 4FXGC 2F3WA 4G4KA 2WKDA 1PTOD 3NBHA 3BDLA 1ESFA 2QILA 4N9TA 3M4YA 1EEFD 4UAIA 1S5ED 1F2ZA 2EY6A 1R9TB 3C3LA 2PZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K33 A;  4TKO B;  2BA0 A;  1VF7 A;  4KMU C;  2K32 A;  1OXS C;  1B9M A;  5KNC A;  4LJZ C;  1Q12 A;  3QIA A;  4OO1 G;  4I7Z C;  2E74 C;  1CI3 M;  1GJX A;  2D5D A;  3FPP A;  2JE6 I;  4L8J A;  1A6X A;  4DK1 A;  4G7H C;  2AWO A;  3QJY A;  3EQL C;  3N6R A;  3PV0 A;  5A35 A;  4JK1 C;  2E75 C;  1OXT A;  1YNN C;  2KCC A;  4G7Z C;  1H9J A;  2YYZ A;  1E2Z A;  3VA7 A;  2PNR C;  3GQB A;  3I73 A;  3H94 A;  4PV1 C;  3QG1 A;  1H9S B;  5KND A;  2A69 D;  3L7Z C;  1FYC A;  2R6G A;  4IFD H;  2A69 C;  1Y8O B;  3P20 A;  3MXU A;  1K8O A;  1GHJ A;  2B8G A;  1K8M A;  1CFM A;  3OOC A;  5K36 G;  4G7O C;  4BA2 I;  4KN4 C;  2AUK A;  2DNC A;  2EDG A;  2JXM B;  2PCF B;  2NN6 H;  1EWH A;  4KHZ A;  4DNT B;  1VCI A;  2BDO A;  3KLR A;  1Q1E A;  3T51 B;  1Y8N B;  1V43 A;  3LNN A;  2A68 C;  1GUT A;  3NE5 B;  3A7L A;  3D4R A;  1SMY C;  3HGB A;  3SDZ A;  4OO1 H;  2KA7 A;  3M7N A;  1VF5 C;  1LAB A;  2K7V A;  2EJF C;  1I6V C;  2CW0 C;  3VR6 A;  5BN4 A;  4KKS A;  1HCZ A;  1HQM C;  3I4L A;  2A6E C;  5JEA G;  4KKT A;  1OXV A;  3RLF A;  1O7L A;  3VR5 A;  3WDN A;  4H0L C;  3BG3 A;  2EJM A;  3GD7 A;  2D62 A;  2QF7 A;  4KI0 A;  1H9K A;  2JEB I;  3FMC A;  2BE5 D;  2BA1 A;  2LMC B;  2BE5 C;  1BDO A;  1HPC A;  2A6H C;  4XIG S;  5C0X G;  4XTC S;  2F1M A;  1FR3 A;  1IYU A;  2O5J C;  1Q1B A;  3MFY A;  1V8Q A;  2B8F A;  1H9R A;  1Y8P B;  2L5T A;  3LWU A;  2D2C C;  2A68 D;  3A8K E;  3DXJ C;  1GUN A;  4LK1 C;  5BN3 A;  3W3A A;  2O5I C;  1H9M A;  2EVB A;  2PPB C;  1DXM A;  1HTP A;  3VR2 A;  3T53 B;  4TQU S;  3PUW A;  2EJG C;  1Z7T A;  1ZKO A;  4DK0 A;  4H44 C;  2IT1 A;  3PUY A;  1G29 1;  1GUG A;  3T56 B;  4DNR B;  1IW7 C;  1VDZ A;  2A6E D;  2Q8I B;  1TU2 B;  1PMR A;  4JBW A;  3CRL C;  1H9S A;  1B9N A;  3CRK C;  2V4D A;  3PUV A;  4IQZ A;  1YNJ C;  2DNE A;  2ZT9 C;  3M4Y A;  3OPO A;  1CTM A;  1DCZ A;  1Z6H A;  3PUZ A;  4HR7 B;  4KN7 C;  1LAC A;  2A6H D;  3VR4 A;  5JEA H;  1E2W A;  3I72 A;  3ND9 A;  5K36 H;  1ZYR C;  4BA1 I;  3TZU A;  3M85 A;  4KKU A;  1O78 A;  1Q90 A;  4IFD G;  2E76 C;  3OW7 A;  3U9S A;  2JEA I;  2NN6 I;  5C0X H;  3IFT A;  4RCN A;  1OXX K;  5KNB A;  3VR3 A;  3PUX A;  5BN5 A;  1Y69 U;  4OGQ C;  1GHK A;  3D31 A;  1OXU A;  4H13 C;  4GZY C;  3BDO A;  3A7A B;  1IW7 D;  3ND8 A;  2NN6 G;  3A8J E;  1GUO A;  1TKW B;  1IYV A;  1T5E A;  3A8I E;  1ONL A;  3AB9 A;  2DN8 A;  1DD2 A;  1QJO A;  3IKJ A;  3SE0 A;  1E2V A;  1GUS A;  2AUJ D; 
#chains in the Genus database with same CATH topology
 3S2D H;  2K33 A;  2F0D A;  2BA0 A;  2K32 A;  4CDF C;  4RFB A;  4C3I B;  2PO4 A;  4LJZ C;  3QIA A;  1GJX A;  3QOL A;  4MTN A;  5FLM H;  1IZ6 A;  1VQE A;  4DV6 L;  4R4I A;  4HJ9 A;  2KCC A;  4KY5 A;  1GVP A;  1QE6 A;  4HMJ A;  1RDP D;  2B2T C;  1LT4 D;  1B53 A;  4ULL A;  3HP3 A;  4JCV E;  2CCZ A;  4OHJ A;  1HR0 L;  4BXX G;  2X69 A;  4JI5 L;  2MO1 A;  2EXD A;  5C5M A;  2PCF B;  3SGI A;  1EWC A;  1SYC A;  3WOF A;  1CKM A;  4KTA A;  4LF8 L;  5BR8 Q;  4GNX C;  1SSO A;  3CP0 A;  1KAW A;  3GTL B;  4KHV A;  2RQX A;  2N49 A;  3H91 A;  1PH2 A;  1YEZ A;  3FPU B;  2XNA C;  1BR9 A;  3RN2 A;  1OXV A;  5IGB A;  2ZJR A;  4BBS H;  2ZXR A;  1BNZ A;  4ZQ3 A;  4X6A H;  1VQC A;  4K14 A;  1STY A;  3FMC A;  3RZD B;  1RCV D;  4LFB L;  2K28 A;  3E5S A;  4KV6 A;  4QCL A;  4QUF A;  1K0R A;  1HH2 P;  4IAL A;  5C0X G;  1VQA A;  2VUM G;  4JI3 Q;  4LWC A;  1KQS A;  1VMC A;  4JI7 L;  2F4V L;  5HUR A;  3KUP A;  5FO8 B;  3I90 A;  4X64 Q;  1Y1V G;  4NXN L;  1D1I A;  1EY6 A;  2B2W C;  2I0Q A;  4X66 Q;  1HUN A;  3C46 A;  4RGM A;  2XVS A;  4S3S A;  2KBN A;  3AFQ A;  1HNZ L;  2UUA Q;  3HOZ B;  4HIK A;  3CQZ B;  1TWG H;  3SK6 A;  2F0L A;  4BS9 A;  4PMW A;  1LUZ A;  1PH4 A;  4FO2 A;  4KKU A;  5M5X B;  4K0K Q;  1NBW A;  4FDB A;  3S1N H;  1TY0 A;  2JA7 H;  1WCM G;  4C2M B;  4NKL A;  5GAE C;  1EYD A;  5HGT A;  3D31 A;  1VQK A;  4LF4 Q;  3Q24 A;  5IT9 E;  5FO9 B;  4OO1 I;  1PH1 A;  5LMN Q;  3PO2 B;  1JOR A;  2WKC A;  1SNO A;  4FP5 D;  1EFW A;  3J81 j;  1F9R A;  1N34 L;  4UP8 A;  4JI6 L;  5KEE A;  5JEA J;  3I91 A;  4YWM A;  1OXT A;  1SYE A;  3CAM A;  1HFG A;  2F0W A;  4G7Z C;  2F0G A;  1H9J A;  1X3F A;  1YIJ A;  1VQL A;  1M4V A;  4DAM A;  1BXT A;  3I73 A;  2MGS A;  4WJ3 M;  4BWG B;  2CH4 A;  4A3B H;  1RHP A;  2Q2T A;  5M3F B;  2RSN A;  2QKI C;  1NCV A;  1D1K A;  2DNC A;  5E4X A;  2BH8 A;  4A3D G;  3RN5 A;  1SMX A;  2RDG A;  1O7I A;  1Q82 C;  1KLU D;  1VQ8 A;  1HNW Q;  4GN4 B;  4JI2 Q;  3KLR A;  1Q1E A;  2WIN B;  2EZV A;  1XTC D;  2HHH L;  3E0E A;  3G7L A;  1VQ6 A;  4DR7 L;  1EIH A;  1X55 A;  1JWS D;  2R92 B;  1BBW A;  4J1M A;  4DUZ L;  4GS3 A;  1UE5 A;  3NQI A;  4IZ8 A;  1S3O A;  2HDL A;  4PQX A;  1I50 B;  1HQM C;  1J6Q A;  5JJL A;  1G51 A;  2IW3 A;  3V05 A;  3J80 E;  5DEH A;  4OL7 A;  2ZJP A;  3GD7 A;  5T1I A;  2L4N A;  4R4Q A;  1A3U A;  2L1B A;  1U9R A;  3GTK H;  2Q2I A;  2ZM6 Q;  2B8F A;  3K5O A;  1B1Z A;  2RDH A;  4DGZ A;  1EWI A;  3R93 A;  1WTW A;  1ET6 A;  2QGQ A;  3RR5 A;  1II3 A;  3PUY A;  1G29 1;  1GUG A;  3T16 A;  2Y0S E;  1S72 A;  3MA2 B;  4A4I A;  2B39 A;  1FGB D;  3CU7 A;  1CUK A;  5FLX c;  3TDQ A;  3PUV A;  1R4P B;  4IQZ A;  2KEN A;  1S4Z A;  4A3K G;  4EQN A;  3K7A B;  2E5L L;  1F2Y A;  2KHI A;  3GTP B;  3LX0 A;  2HIV A;  3H15 A;  2EYM A;  4R9W A;  5IY0 A;  3H3V H;  3IFT A;  2YTY A;  3KK7 A;  3PSI A;  4XXE A;  1Q81 C;  1NTG A;  1JQY D;  4LNQ A;  3KLS X;  2JN4 A;  2J7Z A;  5C4X H;  5JVH 3;  2UU9 Q;  3J81 c;  2E2D C;  1GUS A;  4XDX A;  5IT9 L;  3D4W A;  4OO1 G;  1L1O C;  1F77 A;  2HDM A;  1WJJ A;  1NE3 A;  2X6L A;  4DK1 A;  3F2C A;  2AWO A;  4FVM A;  4Y52 H;  3VYU A;  1GKH A;  2D9U A;  2VW9 A;  2X6G A;  1Q3L A;  1LTB D;  2IL8 A;  2P5Z X;  1VQF A;  5H1S E;  4OEL B;  3J81 i;  1SFO B;  5LMU Q;  1IL8 A;  3LWE A;  2F3V A;  2R6G A;  1IYJ B;  2A69 C;  1GHJ A;  3OOC A;  4C3H H;  4IPH A;  3S2D B;  3UE1 A;  2F3I A;  3L0O A;  1I4Q A;  2L15 A;  4HMI A;  3PCO B;  5DNF A;  1B3A A;  4DR2 Q;  1Y8N B;  2DGY A;  5M3M H;  1PHJ A;  1JE5 A;  3ERS X;  2G9H D;  2H4O A;  2VQF Q;  4A3K H;  1MBY A;  4KJO A;  2B2T A;  5DAU A;  4N9P A;  1I4H A;  3G6E A;  2MO0 A;  3CC2 A;  1YHQ A;  1L2F A;  2E2J H;  3OWF A;  4C3I G;  3BG3 A;  4KI0 A;  1H9K A;  2BA1 A;  1YBY A;  1G8Z D;  1TWC H;  5TSS A;  4DV3 L;  3J80 L;  4XTC S;  4AQY L;  4A3L G;  3KJO A;  1U5K A;  4QUC A;  4GNX A;  3CW2 C;  3GV6 A;  3MHB A;  5BN3 A;  4K8I A;  4CJ2 C;  1LM0 A;  2NYZ D;  1U4L A;  3CMA A;  2WAQ B;  1SND A;  4DV4 Q;  2R7D A;  1HNX Q;  3SXH A;  1PRT F;  1SYF A;  3C1F A;  4DAP A;  4BBS B;  2V1C C;  1W6J A;  1XX8 A;  2E2H H;  2RBM A;  4B3T Q;  1X3Q A;  4UPA A;  4F8M A;  4JYA Q;  2HIX A;  2V4D A;  1X65 A;  3AEV A;  1I3Q H;  3KOJ A;  4DU9 A;  3NTH A;  3OSO A;  3RLN A;  2I5L X;  1Q46 A;  2LXK A;  3BU2 A;  1X32 A;  2RA4 A;  3MFG A;  2Z6B A;  1YHA A;  1PA6 A;  2B2W A;  5ELB A;  1HZC A;  4C1N K;  4B3M L;  1X6O A;  2WB1 B;  3A8I E;  1HUM A;  2KJX A;  2AKW B;  1MGS A;  5C6A A;  2Z6K C;  1V1O A;  5IGF A;  1TWG B;  1OXS C;  1MD2 D;  3IRB A;  2AQ1 B;  1JIC A;  5I6Y A;  4C3I H;  2F03 A;  3S1N B;  2JA7 B;  5EGT A;  1J5E Q;  1G2T A;  4L5Q A;  4JOI C;  3VA7 A;  1NSN S;  1UE6 A;  1Z9F A;  4J8Q A;  1STG A;  3HOZ G;  4K5V A;  5D3I B;  5C0X J;  2B8G A;  1K8M A;  1XYI A;  2H1E A;  5CV4 A;  3KF6 B;  1IBL L;  5CC4 A;  2NN6 H;  2EY5 A;  1GD7 A;  1N32 Q;  3H09 A;  1PXU A;  3X3M A;  4JI1 Q;  2DY7 A;  5IP7 G;  3HS0 C;  3MWY W;  2I46 A;  1VF5 C;  2QDB A;  4A3B B;  2XWJ B;  1I6V C;  4P2C B;  5BN4 A;  3PO2 G;  3SVM A;  1AW7 A;  3J7A 5;  3WDN A;  1XMO L;  2QF7 A;  1LT3 D;  5M5W H;  2BOS A;  3EVQ A;  3RLO A;  3I4M H;  1HPC A;  1SXT A;  1LLR D;  3CHB D;  2F0F A;  4DR4 Q;  1MJC A;  2XGT A;  4APV A;  3FKI H;  4LK1 C;  2L12 A;  2MP1 A;  2JP1 A;  1CZW A;  5M3F G;  2E2I H;  4RGO S;  4MIU A;  5EPJ A;  3AQQ A;  1BUV T;  3K5N A;  3K7U C;  2NTS A;  2A5H A;  3CCL A;  2ZJQ A;  1BCP B;  1SNP A;  3C2P A;  2D0O A;  3HOW H;  1IKM A;  2R92 G;  4RHR A;  4DUY Q;  1KDB A;  2UXD L;  2E76 C;  4X3T A;  1Y1W H;  1PH8 A;  3CD6 A;  1CM9 A;  2IX0 A;  4HJ8 A;  1ENF A;  1UEA B;  4Z9C B;  4OX9 Q;  4PZ8 A;  1BVS A;  1ET9 A;  5IP7 H;  1AFP A;  1S5C D;  2NB0 A;  2L5T A;  2CH4 W;  5FO7 B;  1VMP A;  4FXD A;  1CQF A;  3A74 A;  3ERO A;  1XPU A;  1HJP A;  1LTS D;  2D5D A;  1SE3 A;  4L8J A;  3Q22 A;  2EE1 A;  2NZH A;  5J22 A;  2KCN A;  4EVO A;  4WFN 3;  5ELC A;  5J39 A;  3QG1 A;  4NPS A;  5C4X B;  1ILP A;  1CKO A;  2ZTD A;  1EL0 A;  2CKZ B;  1Q86 C;  1IXR A;  1AP0 A;  1F2M A;  1VQB A;  3MXU A;  3URY A;  1CFM A;  2MFI A;  1A2T A;  1RD9 D;  5IP9 H;  3PMF A;  1ESR A;  1U4P A;  3CKI B;  1SRU A;  3CC7 A;  4CGY B;  1M1K C;  3CCE A;  4KHP L;  2K5D A;  2HQL A;  4NXM Q;  4DK3 C;  4HTH A;  1PH3 A;  5K5P A;  1A62 A;  1L1O A;  4MNO A;  4ZUJ A;  5I9P A;  3ICE A;  4B3R L;  5CV9 A;  3SDZ A;  2OT2 A;  3E0J A;  4HCS A;  1XMQ Q;  2CQA A;  1JCK B;  1NR2 A;  4RWS C;  2PI2 A;  2RHQ B;  4HN7 A;  4C3H B;  5DLQ E;  1NNX A;  1I50 H;  3I2Z A;  3VA5 A;  3K59 A;  5LHY 1;  1SE4 A;  1QVG A;  1TWH H;  1B70 B;  3KF8 A;  3AFP A;  4DR3 Q;  3N52 A;  5M3M B;  1RJT A;  1LTI D;  4POF A;  5EPK A;  1K3R A;  1Y14 B;  4WRD A;  3MXN A;  1ZXT A;  4DPG A;  2F4I A;  2EJG C;  3T56 B;  2E2J B;  4MZ9 A;  4JI4 Q;  5GRO A;  5KGU A;  5FLM G;  4GKJ L;  4O42 A;  5C3W A;  1TWC B;  3GTG H;  2BCO A;  1X3P A;  3PUZ A;  5IWA L;  2EPB A;  4GOP C;  3OIP A;  4CJ0 B;  3CCU A;  1JE4 A;  1EYC A;  1XXG A;  4CKB A;  3TZU A;  4YCW A;  2BH2 A;  1E24 A;  3ULJ A;  2HT1 A;  4UP9 A;  4TRD A;  3GTP H;  1TWA H;  4F7X A;  1Y69 U;  1O7Y A;  2FJ2 A;  4O0A A;  4DV2 L;  4YCU A;  4GZY C;  1SE8 A;  1LTA D;  3KJP A;  1JR0 D;  3A5Z B;  2E2H B;  2VQE L;  3AB9 A;  3T4A C;  3CCQ A;  4DV1 Q;  5LL6 X;  4Y7N H;  5EBC A;  1HHV A;  4X62 L;  3MZ5 A;  1I3Q B;  1N33 Q;  4TKO B;  4KMU C;  1SRO A;  4JI8 L;  2OXP A;  3G48 A;  1WTX A;  3ONA B;  2WAQ G;  1XNQ L;  4G7H C;  1WYD A;  3S24 A;  3PV0 A;  4DR6 Q;  3K6O A;  1RF2 D;  1SYG A;  2NUC A;  5E3F A;  1EY4 A;  1PLF A;  3GQB A;  3EA6 A;  1I94 L;  4JV5 Q;  1FJG L;  3ULL A;  1SFO H;  3TSS A;  1PVO A;  1HZB A;  2K5V A;  2UXC L;  1XNR Q;  4DR5 L;  2Z6K A;  1H95 A;  2K04 A;  1B4O A;  4RMF A;  2L11 A;  2Z1C A;  4EX5 A;  1JMC A;  2R93 H;  4GN5 A;  4DR1 L;  4YY3 L;  4JI0 L;  4IUR A;  3OTO Q;  4X65 Q;  1V43 A;  3LNN A;  3NE5 B;  4A3E H;  2WB1 G;  4JOI A;  4B3S Q;  3TP8 A;  3SR1 A;  4RKL A;  1KNE A;  1EU4 A;  1KTK A;  2LXJ A;  2ZTE A;  1E22 A;  3H3V I;  2BE5 D;  2EYL A;  1RIP A;  2EYJ A;  4FF4 A;  2JA7 G;  1EY5 A;  3D4D A;  1VQD A;  1YI2 A;  1VQG A;  3T1H Q;  2O5J C;  2NTT A;  2O4X A;  1G91 A;  3ULP A;  3FDT A;  1MSG A;  2XRS D;  1GUN A;  2O5I C;  1YIT A;  2UXB Q;  1DXM A;  3PUW A;  3A54 A;  1NR4 A;  3OHX C;  5C4J H;  4LF7 L;  4A3G H;  5CBA E;  1A63 A;  1QCB D;  2E8G A;  1SYB A;  3CRK C;  3I4O A;  4E6I A;  5M5W B;  3S1Q H;  3I4M B;  4NDX A;  2DNE A;  2B29 A;  3OPO A;  4HR7 B;  1Q8I A;  4KJN A;  2N78 A;  3FKI B;  4H02 A;  3M85 A;  1A15 A;  2KEC A;  3RMH A;  4A3B G;  1C9O A;  3CCS A;  3KBG A;  2E2I B;  1YJ9 A;  2JEA I;  5I4D A;  1OXX K;  4DV5 Q;  1NMG A;  3QR8 A;  4LMQ D;  1FL0 A;  3ND8 A;  5COR A;  4YHH L;  4HID A;  4LFA L;  2Z4I A;  1T5E A;  4A76 A;  2UUB Q;  5JAV A;  4ZLT F;  1DD2 A;  3W3A A;  2F0V A;  5J3B A;  3HOW B;  1F9S A;  1S40 A;  2N55 A;  2XRQ D;  3NEL A;  4AYB E;  4K5W A;  1E3P A;  1F9P A;  3BZC A;  1JJ2 A;  4O2D A;  1CSP A;  1ICF B;  1Y1W B;  5IT9 c;  3BZK A;  1X54 A;  1B7Y B;  4C3J H;  4LF6 L;  5KND A;  3HOY H;  5LMN W;  5JJK A;  2R7Z H;  1DYQ A;  1JC7 A;  4DAY A;  1SEB D;  2XN9 C;  4AH6 A;  3H0G H;  4B9W A;  1C8C A;  4LF9 L;  1QWY A;  1UWV A;  2FFK B;  3BJU A;  5HY6 A;  3TQY A;  3T51 B;  4FF3 A;  3HKZ E;  4QMG A;  1I6H H;  1VS0 A;  2EJF C;  4N8F A;  4DV0 Q;  3R8B A;  1IBM L;  4IO9 A;  5JPN C;  1MKH A;  2PYK A;  4YWK A;  1CHP D;  2PQA A;  2QEX A;  1OO9 B;  5ISR A;  3J7Y W;  2OTL A;  3TS2 A;  3VYR A;  1JOO A;  4KD4 A;  1Q1B A;  2XTI A;  1HQR D;  3F2D A;  1E0B A;  3T1Y Q;  3MXG A;  3WWV A;  5C4X G;  3DXJ C;  4U67 3;  2ICE C;  1HTP A;  2K5W A;  4IPD A;  3EIV A;  2IT1 A;  2F0K A;  3U50 C;  3V96 A;  5DM6 3;  3J80 c;  1J8I A;  5KYL A;  1TWF H;  2Q8I B;  4KY7 A;  1WTV A;  4C56 C;  3U58 A;  2F0I A;  2OEO A;  1A3T A;  4DV7 Q;  1Z6H A;  4ALP A;  1TWH B;  2EXZ A;  1TS2 A;  1X56 A;  4N8X 1;  2A73 B;  2YV5 A;  4DKA C;  5IOD A;  2MNA A;  2NN6 I;  3J80 i;  3UDF A;  4C3H G;  1UEB A;  2IWH A;  4LUO A;  2F0P A;  3GTG B;  2K75 A;  1E2V A;  1E1O A;  4LW1 A;  3M9B A;  5M3M G;  1ZEQ X;  1PYW D;  4K8J A;  4GNX B;  1EFI D;  1EY7 A;  5KNC A;  4GOP A;  5BR8 L;  4WJW A;  4I7Z C;  3W1B A;  3Q0A A;  2JE6 I;  5EKK A;  1JOK A;  2UXB L;  3PIP 3;  2EIF A;  2RHS B;  4CJ1 B;  2E75 C;  1ROD A;  1TWA B;  4UDU C;  4YCV A;  1YNN C;  4QB4 A;  3KBX A;  4CDE C;  3S2H H;  4IOA A;  4ZKC B;  2F0Q A;  1X3G A;  2NVX H;  5C44 H;  4PV1 C;  3PIP A;  1MSH A;  1FNV A;  1N36 Q;  3UDG A;  3S1M H;  2G9D A;  3VYS A;  4AYB B;  4HCE A;  5C3X A;  4Y7N B;  2QW7 A;  1QNU A;  1U4R A;  2QCP X;  4OIK A;  1ASY A;  4JI3 L;  4ZCK A;  2BDO A;  1QUQ A;  1U0L A;  5JVG 3;  1B50 A;  2Z8L A;  4X64 L;  5I2X A;  3RD4 A;  4PZ6 A;  1L0W A;  3E6Z X;  4X66 L;  4KLK A;  5FOB B;  4GKK Q;  4A75 A;  2Q8R E;  2K5Q A;  2KHS A;  1ENC A;  2UUA L;  1SR3 A;  3EJI A;  1K83 H;  3HFZ B;  1PRT C;  4CBV A;  2VZA A;  2R93 B;  2B3G A;  2F0S A;  3Q8D A;  5EBD A;  1C48 A;  1QNK A;  4F88 A;  4K0K L;  1IYU A;  3NSW A;  3MFY A;  1P16 A;  1UE1 A;  4A93 G;  1H9R A;  1Y8P B;  4DK6 C;  4XT1 B;  3TN2 A;  4A3E B;  1YJW A;  2F0U A;  4LF4 L;  2VL6 A;  3VR2 A;  4HED A;  4H44 C;  3OMC A;  4IN3 A;  1HA6 A;  2JK8 A;  4FNF A;  3TRZ A;  1TS3 A;  5LMN L;  1SNC A;  2DUD A;  2PI2 E;  2EYH A;  4X3S A;  2KOL A;  2Q2U A;  1KDC A;  1T9H A;  1TII D;  2K14 A;  3EN2 A;  1ML0 D;  2HD3 A;  3HKS A;  1BCP C;  2MJ8 A;  2EYF A;  3U9S A;  1DJR D;  1SDF A;  2KED A;  1NAP A;  1PFM A;  3ER0 A;  1FGU A;  4HSV A;  5C4J B;  4A3G B;  3G71 A;  2NN6 G;  4RGT A;  1CA6 A;  5IGG A;  4K6D A;  4KY6 A;  3HEJ A;  1ONL A;  4ABN A;  3S1Q B;  1W6K A;  5EPL A;  1D5M C;  3E9H A;  3SE0 A;  1HNW L;  1T5X D;  4JI2 L;  5EKL A;  5AJ3 Q;  1DOL A;  3OMG A;  1B9M A;  4JBJ A;  4JBM A;  1VQP A;  4OIJ A;  3DEO A;  2Y0S B;  4JK1 C;  4IUN A;  5IGE A;  3J7A V;  2J4X A;  1C4Q A;  2PMZ E;  3H3V C;  3QWN A;  4A93 H;  1VQH A;  1LTL A;  4P73 A;  4IFD H;  2XIW A;  1PFN A;  3I4M G;  3K0Y A;  1PTO H;  2JJQ A;  4WJ4 A;  1BCP F;  2EDG A;  3D6C A;  1K3B C;  3VYT A;  3FKI G;  1EY9 A;  5JPM C;  2ZM6 L;  1DGS A;  1IBK Q;  1AE3 A;  1CK1 A;  3KDF A;  5M5Y H;  1YNN D;  3D4R A;  5CV8 A;  4C3J B;  1VQ7 A;  3PF5 A;  3HOY B;  1STN A;  1BKB A;  3TEH B;  2R7Z B;  1O7L A;  3A56 A;  3HOW G;  2FMM A;  3H0G B;  2VS1 A;  2D62 A;  4OXP A;  2JEB I;  3U9O A;  2A19 A;  2VY3 A;  5COY A;  5E1F A;  3TBI B;  2LSS A;  1FR3 A;  2F0O A;  3K80 C;  1Y1W G;  1D5X C;  1EEI D;  1I6H B;  1D2B A;  2CHB D;  1CA5 A;  1I4P A;  4CDD C;  2R7F A;  3D6W A;  5ELF A;  3BVZ A;  5IOC A;  1Z7T A;  2UU9 L;  1AE2 A;  1WVL A;  3W1G A;  2OQ0 A;  3MVV A;  2HCC A;  2NZO A;  4JBW A;  1EQV A;  1Q8K A;  2Z0S A;  3V2T A;  1TVX A;  5C5L A;  3QOJ A;  5ELO A;  1PRT D;  1SJH D;  1XJV A;  1JB7 A;  1L1O B;  2JSO A;  3BYY B;  3RUZ A;  4FYD A;  2JA5 H;  2GVB A;  3S14 H;  3I3C A;  3NUC A;  1JJC B;  2PW5 A;  3JAM E;  2RVL A;  1D7Q A;  4LF5 Q;  1KL9 A;  1STE A;  2O2L D;  1BF4 A;  1GUW A;  5LMU L;  2EY2 A;  4QF4 A;  1CKN B;  5IP9 G;  5IE8 A;  3ZYY X;  1TWF B;  3OYY A;  1AZQ A;  5FK9 C;  4A3M H;  3P75 A;  3DM1 A;  2IX3 A;  1AH9 A;  4QIW E;  1GUO A;  1IYV A;  4DNI A;  1JWM D;  3HZX A;  3JAM i;  3KF8 B;  3NEM A;  4TVA B;  2RCN A;  4CHT B;  1V1Q A;  4BY1 H;  4DR2 L;  1YVC A;  4XQQ A;  4LFC Q;  2K4K A;  1BCP D;  3OW2 A;  2QDL A;  3MXN B;  3CCJ A;  1JT8 A;  4F87 A;  3EQL C;  5A35 A;  2VQF L;  1TS4 A;  1EYA A;  1RKN A;  3HOV B;  4RG1 A;  4C1N I;  5IGC A;  5KYI A;  4DXF A;  4EGV A;  2MUY A;  4RKB A;  3P20 A;  4ZUI A;  3GTQ H;  3E9I A;  4BA2 I;  3DMU A;  2JA6 H;  3Q6S A;  4KD3 A;  4OWW B;  3F8T A;  2PMZ B;  1QVF A;  4ODG A;  2F0H A;  5KRU A;  1TY2 A;  3VDY A;  1X9N A;  1LT6 D;  2SEB D;  1Q7Y C;  4IJL A;  1CT1 D;  3S2H B;  3K5M A;  3NK9 A;  4DV4 L;  4DV6 Q;  1HNX L;  3A7L A;  1JJG A;  1STA A;  1WTP A;  2NVX B;  5C44 B;  1IKL A;  2K7V A;  1LTR D;  1QZG A;  4B3T L;  2EQS A;  3FRP B;  3NBH B;  4KKS A;  4OWX B;  3S1M B;  5IYD H;  4P74 A;  4JYA L;  3I56 A;  1PFS A;  5KIX A;  2HQE A;  2IPK D;  1HR0 Q;  4IPG A;  3RNU A;  4JI5 Q;  2BE5 C;  3DLL A;  1PH9 A;  2IY5 B;  3R2I A;  1PZI D;  5I9O A;  2K5H A;  1V8Q A;  2D2C C;  4HAE A;  2NZ1 D;  4RA8 A;  4LF8 Q;  2R61 A;  4AIM A;  1IHZ A;  2IHF A;  2K5N A;  2GA4 B;  3EFX D;  4AYB G;  1ASZ A;  1K83 B;  3SHL A;  1EOV A;  1GO3 E;  1YNJ C;  5JEA H;  3ERQ A;  1UAP A;  1Z47 A;  2N3S A;  3NEN A;  4RAU C;  1W2B A;  4LFB Q;  2OQK A;  3GTO H;  4XQN A;  4I7A A;  2ENB A;  1NJI C;  3TP7 A;  1J5E L;  1QG7 A;  1OTC A;  2KUM A;  3LGJ A;  5LL6 S;  5IYB H;  2B63 H;  2I5H A;  2F4V Q;  3AYH B;  1K73 C;  3PIO 3;  3JAM L;  2KQ3 A;  1GHK A;  2XWB B;  4NXN Q;  2PW7 A;  3A8J E;  2R93 G;  3PIO A;  2Q2H A;  2K1B A;  1WOC A;  1HNZ Q;  1N32 L;  4A3I B;  1B2T A;  1SLJ A;  1S5B D;  4JG2 A;  1MIU A;  5JJZ A;  3Q23 A;  4A3C G;  4A3E G;  5L37 A;  1RTO A;  1LT5 D;  4JI1 L;  4HJA A;  5HGQ A;  2CQO A;  1EY8 A;  2HCI A;  2KEE A;  3H94 A;  1N8R C;  3GP7 A;  1S5F D;  3FEW X;  3SK4 A;  1PZJ D;  3PF4 A;  3SEB A;  3HOX H;  4IOC A;  2GVA A;  1VQ9 A;  5C3E H;  2F0T A;  1MI2 A;  5IYC G;  3NQT A;  5CV6 A;  4DR4 L;  4UY8 C;  4XYO A;  2C35 B;  1V1P A;  4U68 A;  2AHO B;  1N34 Q;  2UUC Q;  3NTI A;  1WFQ A;  4A3G G;  2XSC A;  2AMC B;  1F2L A;  4YWL A;  3M7N A;  4M1U B;  3I55 A;  1PYB A;  4A93 B;  1EQT A;  4EQ5 A;  5E7N A;  1PTO B;  2AQ3 B;  5G3L F;  4IPC A;  3DUZ A;  4UHV A;  2QA4 A;  1XPO A;  4IUQ A;  2EJM A;  1HA5 A;  1LTG D;  2I07 B;  3SK8 A;  3ZJY C;  2Y0S G;  2FHT A;  4DAV A;  4DUY L;  1KIX A;  3PGZ A;  2MHV A;  3U4Z A;  5AFW A;  2PNH A;  5M5Y B;  1PYS B;  1QIL A;  2SDF A;  1JOQ A;  2HHH Q;  5C4Z A;  4A3C H;  4DAY B;  3WOE A;  4DUZ Q;  3ITP A;  4DNR B;  4OX9 L;  5C4H A;  1IW7 C;  4A3J H;  3DEP A;  1DOM A;  3CRL C;  1H9S A;  2CVR A;  2PZW A;  2ZT9 C;  1CTM A;  1HZA A;  5A2Q E;  3CME A;  2DJF C;  3HOU H;  1KNA A;  4C3J G;  1O78 A;  1Q90 A;  3B6Y A;  3HOY G;  3NWT A;  3M4O H;  2R7Z G;  5IYC H;  3GO5 A;  4DXG A;  4HJ7 A;  1UNS A;  5D65 A;  1A0I A;  1I4X A;  2TMP A;  3H0G G;  3GDE A;  2PQA B;  2NVY H;  4ME5 A;  2NVQ H;  1G2S A;  3GTJ H;  1STB A;  1YNJ D;  4L5R C;  4NXM L;  1F9Q A;  2JA5 B;  5JOB A;  3S14 B;  4BBR H;  1KD1 C;  4LAA A;  5CR3 A;  1TT2 A;  1SBB B;  1EIY B;  1NMF A;  2ID0 A;  2QEJ C;  2E5L Q;  1XMQ L;  1KXL A;  2A74 C;  4JVZ A;  4J15 A;  2JQO A;  2JA8 B;  4A3M B;  3KYH C;  3F2B A;  1VQJ A;  4G7O C;  5JJI A;  1PZK D;  4ZAI A;  4BY1 B;  1EZ6 A;  2JXM B;  3MEF A;  5G3L D;  4ID6 A;  4DR3 L;  2N88 A;  3S1R H;  4A3F H;  5M9O A;  4O1N A;  2F0E A;  1FNU A;  1P8L A;  1YJN A;  1BQQ T;  4LUV A;  4POG A;  1HFN A;  1LAB A;  2D0P A;  2CW0 C;  4JI4 L;  2K6A A;  3F2U A;  3I4L A;  1SYD A;  3HG9 A;  4G57 A;  3GTQ B;  3VR5 A;  1G6Z A;  2JA6 B;  1EIF A;  4IUT A;  4GOP B;  1I4G A;  1KDA A;  1SAP A;  2CFM A;  2LMC B;  1XPR A;  1FNW A;  2A6H C;  2IJ0 A;  4BXX H;  2F1M A;  2Q8T A;  4ZYS A;  2WII B;  3K81 C;  3HOV G;  1PFB A;  2B2Y C;  3LWU A;  3PO3 G;  1BBU A;  1K0S A;  3A8K E;  4IUV A;  2NBF A;  2EVB A;  2RDF A;  3NBI A;  5E4W C;  3TS0 A;  1BO0 A;  4DV1 L;  2FMC A;  1SN8 A;  1ICW A;  1N33 L;  3G6J B;  1VQ4 A;  1QUQ B;  3I70 A;  3G4S A;  1C0A A;  4KN7 C;  2LFN A;  1DCZ A;  3KLW A;  1E7Z A;  1QOH A;  2VB2 X;  3VR4 A;  1LAC A;  3K8A A;  1QZH A;  4IFD I;  2UUC L;  3I72 A;  5GAH C;  4DV3 Q;  4X3K A;  1ZYR C;  2WFW A;  4DR6 L;  5C44 G;  1WI5 A;  4AQY Q;  4V19 0;  5A2Q L;  2PZT A;  2M2L A;  4HIM A;  1R4Q B;  5C0X H;  4JV5 L;  5J1Z A;  2VUM H;  2PQE A;  5BN5 A;  3CCV A;  2IX1 A;  3J7A F;  4BY7 B;  2RKS A;  3BDO A;  1VQI A;  1IW7 D;  1YZ6 A;  4RH6 A;  2SOB A;  1KRT A;  3CCR A;  1EQQ A;  3NHH A;  1XNR L;  1Y1V H;  3OIQ A;  1SE2 A;  1K9M C;  3E3X A;  3R2T A;  4JC0 A;  2VNU D;  3L2P A;  1VF7 A;  3I4N B;  1DZ1 A;  3GTO B;  3OTO L;  4X65 L;  2ES2 A;  2RF4 A;  3M3Y H;  4L63 B;  1IL2 A;  4OWT B;  2YTX A;  2B63 B;  1STH A;  4RCO A;  1CSQ A;  3N6R A;  1O80 A;  3GV3 A;  2L55 A;  4ILW A;  4B3S L;  4R8I A;  4RGN A;  4CDC C;  4V0B A;  3HOV H;  3NWS A;  3L7Z C;  4K5X A;  3PO3 H;  2Z9H A;  3W2D A;  1WCM H;  1Y8O B;  1UUP A;  2H5X A;  4DA2 A;  4FF2 A;  3NPP A;  2WAQ E;  5GAD C;  2MQH A;  4B3M Q;  3FP9 A;  2AUK A;  2YU9 H;  3TP6 A;  3FVQ A;  2K03 A;  3T1H L;  2DY8 A;  3CC4 A;  3X3N A;  1VCI A;  2OWO A;  2RCF A;  5D3D A;  3S16 H;  1CQV A;  2A68 C;  2WAC A;  4FF1 A;  2VB3 X;  2LKV A;  2KA7 A;  4PG3 A;  1O7Z A;  2KHJ A;  4H7B A;  1B3Q A;  4LUZ A;  3HRZ C;  4XYQ A;  1HCZ A;  3RZO H;  3MTS A;  4A3I G;  3HOX B;  2EYO A;  1EY0 A;  4Q5V A;  2Z4H A;  5C3E B;  4GLA C;  3AMU A;  5NUC A;  2ZXO A;  5FLX E;  1IBL Q;  2WB1 E;  5IGD A;  4NW2 A;  3K57 A;  3F1Z A;  4A3D H;  4DN4 M;  1PH6 A;  1J9O A;  2R3Z A;  3CXC A;  3BVM A;  3DM3 A;  4DV5 L;  1K8A C;  1A3V A;  2A1A A;  3T53 B;  4TQU S;  5ELN A;  2CW0 D;  1AN8 A;  2NVT H;  2SNM A;  2UUB L;  1SJE D;  1TU2 B;  1PMR A;  5FJ8 G;  4K2K A;  4EQO A;  3HKZ B;  3J81 E;  4DFA A;  1XMO Q;  4PZ7 A;  3KDF B;  2A6H D;  2EYP A;  4R4O A;  3BS1 A;  4QGU A;  3JC6 6;  4CKC A;  1DOK A;  4IFD G;  3P1H A;  1M8A A;  1TS5 A;  3K58 A;  5KNB A;  1YNX A;  3VR3 A;  1N9W A;  3BZD B;  4R4C A;  4OGQ C;  1LV9 A;  5I6W A;  1D6E C;  1X3E A;  4A3J B;  2B2U C;  3A7A B;  1HRJ A;  5FKA C;  3K5L A;  3J7Z C;  1FD7 D;  1KHI A;  1QVC A;  2B2V C;  2DN8 A;  2M9V A;  1QJO A;  4MTK A;  1G6P A;  3S9W A;  3S17 H;  1TXY A;  2AUJ D;  2DJG C;  1HTL D;  3HOU B;  1KAB A;  4A3I H;  1ENA A;  2E74 C;  4OEM B;  1ZYR D;  3FHW A;  1B44 D;  1BOS A;  4IUP A;  5ELD A;  3M4O B;  1SNQ A;  2LY7 A;  4IUU A;  5EKI A;  2AWN A;  5GAG C;  2YYZ A;  2NWG A;  1E2Z A;  2UXD Q;  4DV0 L;  2PNR C;  1SNM A;  2NVY B;  2NVQ B;  4Q0F A;  1EQR A;  1CHQ D;  1A2U A;  4NMZ A;  3GTM H;  1NY4 A;  3GTJ B;  1WTO A;  2L9H A;  3S15 H;  3C1E A;  4BBR B;  1B8A A;  1L0Y B;  2RSO A;  1BBX C;  1E1T A;  4KHZ A;  4DNT B;  3QB3 A;  5FJ8 H;  3T1Y L;  2IHE A;  1FVI A;  1XTD A;  3KLS A;  4HIO A;  2K05 A;  1W3S A;  1GUT A;  3IFD A;  2A8V A;  1SMY C;  1WTQ A;  3BDC A;  1YHB A;  4OO1 H;  4PMC A;  4JW0 A;  4HJ5 A;  5T1G A;  1QB5 D;  2JA5 G;  4RHS A;  1NUC A;  4L6T B;  1XWE A;  4DV7 L;  1MJE A;  2CWA A;  4L5T A;  3SK5 A;  3PQI A;  3TRE A;  4R8N A;  3S1R B;  1BDO A;  4YIJ A;  4A3F B;  3W5O A;  3DHQ A;  4XIG S;  4KHP Q;  2ICI A;  2JA8 G;  1RL2 A;  2A68 D;  5FLX L;  4A3M G;  3A5U A;  2OCE A;  4WOR A;  1H9M A;  2F0N A;  4DK0 A;  4QY7 A;  4B3R Q;  4JBK A;  4MHE A;  4BY1 G;  1R9T H;  1VDZ A;  4ZKB B;  2F0M A;  4GN3 B;  3DWP A;  4TSS A;  4P75 A;  1EUJ A;  3NP8 A;  1EYG A;  2WV6 D;  4IJH A;  3P7J A;  1V9P A;  2OF1 A;  3UE0 A;  1E2W A;  3ND9 A;  2FIN B;  3J81 L;  2TSS A;  2B2Y A;  3D8G A;  1GXD C;  1D8L A;  5CV7 A;  4A3L H;  3PUX A;  1TQO A;  1U4M A;  3I8Z A;  3M4P A;  1N36 L;  2JA6 G;  4H13 C;  4K2L A;  4PNY A;  3STB C;  1TKW B;  3UDI A;  3MAQ A;  5CMD A;  4HSP A;  5IIF A;  4R4T A;  3IKJ A;  3VR6 A;  5CGK A;  4GKJ Q;  1MHW C;  3JAM c;  4J6H A;  5EAY A;  5IWA Q;  3FPP A;  3H6M A;  2L0C A;  1A6X A;  1LYL A;  3QJY A;  1PH7 A;  5IYD G;  2VUM B;  3TZD A;  3L9A X;  4GKK L;  3GTL H;  1HXY D;  4PMB A;  5I2Y A;  3CPF A;  1VQN A;  2A69 D;  1FYC A;  2JA8 H;  2ATW A;  1Y1V B;  1PRT B;  4B9X A;  3U4V A;  4DV2 Q;  1K8O A;  5K36 G;  4KN4 C;  2VQE Q;  1TR5 A;  2N8N A;  2F0J A;  3M3Y B;  3OWE B;  4B08 A;  3RZD H;  2G5D A;  4X62 Q;  2LS0 1;  1WD0 A;  1UE7 A;  3DWQ A;  2YTV A;  4JI8 Q;  2VXW A;  3BYT B;  1AEX A;  2K01 A;  3BVG A;  4BY7 G;  1I5F A;  1XNQ Q;  2F52 A;  3R3O A;  2JYO A;  1GOZ A;  1GM5 A;  3PO3 B;  1HZ9 A;  1WCM B;  2KCT A;  4KK7 A;  5JEA G;  2A6E C;  1I94 Q;  3EBE A;  2WP8 J;  4KKT A;  3RLF A;  3TP5 A;  1FJG Q;  1L0X B;  2C5C A;  3I4N G;  1PTO C;  2YU9 B;  2OTJ A;  3QO2 A;  3HOZ H;  2UXC Q;  1K8G A;  5IYB G;  4DR5 Q;  2B63 G;  3GTK B;  1KC8 C;  1WTR A;  3CQZ H;  3S16 B;  1D5Z C;  2JA9 A;  2KCM A;  4DR1 Q;  1C7Y A;  4YY3 Q;  3IL8 A;  3IAY A;  4JI0 Q;  3D3R A;  5M5X H;  3NTK A;  1SMY D;  3T13 A;  3AU7 A;  4C2M H;  1WD1 A;  3RZO B;  2SNS A;  2ASB A;  3NXW A;  4CKE A;  1HR0 W;  3I7F A;  1VQ5 A;  1B9N A;  1DM0 B;  1K28 A;  5AJ3 L;  1EOT A;  2ZTC A;  4NB3 A;  3PO2 H;  1V1P B;  3A0J A;  5CYU A;  3KF6 A;  5K36 H;  4JPB W;  4A3D B;  4BA1 I;  5DM7 3;  5CBE E;  4X3U A;  3OW7 A;  3D0F A;  5F2D A;  1DON A;  4RCN A;  1PTO F;  2NVT B;  4L5S A;  3HOX G;  5CV5 A;  1OXU A;  2C9O A;  5C3E G;  2KVM A;  4BY7 H;  3L3O C;  5M3F H;  3KFU A;  1PDQ A;  4LF7 Q;  1WTH A;  3MXP A;  4XT3 B;  3MC0 B;  4ZK9 B;  2EY1 A;  1EIG A;  1Q12 A;  2J0T D;  1IBK L;  4FXK C;  1CI3 M;  2CWP A;  3I4N H;  3UI2 A;  3CF5 A;  4OON A;  4R1J A;  4JI7 Q;  2R92 H;  1JB3 A;  5EQ0 A;  1H9S B;  2B2U A;  1LTT D;  3HKZ G;  1CKN A;  3A55 A;  4NP5 A;  3STB D;  5EJW A;  2FXQ A;  4LFA Q;  4YHH Q;  2HUG A;  1EZ8 A;  2B2V A;  4P72 A;  3S17 B;  4I65 A;  1EU3 A;  1EWH A;  1AZP A;  3MEH A;  4QQB X;  1RTN A;  4M8A A;  4A3J G;  1LO5 D;  4A3K B;  5D14 A;  1KLG D;  4QIW B;  3CPW A;  3HGB A;  4GLX A;  2AQ2 B;  2ZXP A;  3O13 A;  4DF7 A;  1ILQ A;  3TME A;  3GTM B;  3K0X A;  2BDN A;  4QJF A;  1I4R A;  4LF6 Q;  1S5D D;  3HOU G;  5ELE A;  4H0L C;  3S15 B;  5C0X I;  4UP7 A;  2K52 A;  4IFD J;  1M90 C;  4EQP A;  4XQJ A;  2MPM A;  4LF9 Q;  2GN5 A;  1CZG A;  3UDX A;  4LF5 L;  3K7A H;  3DWA A;  1VQM A;  4ZRZ A;  4K6L A;  4JI6 Q;  3M7G A;  2PPB C;  1JWU D;  1ZKO A;  4GLV B;  2EOT A;  2M00 A;  1KAA A;  4MN3 A;  2A6E D;  4FXG C;  3M4Q A;  4BBR G;  4P71 A;  2F3W A;  4G4K A;  2WKD A;  3CCM A;  1PTO D;  1IBM Q;  3NBH A;  3BDL A;  1ESF A;  4QL5 A;  1VQO A;  2QIL A;  4N9T A;  1KRS A;  3M4Y A;  4LFC L;  1EEF D;  2K50 A;  1A8V A;  2ALY B;  2I5M X;  4UAI A;  4BBS G;  1S5E D;  4ME3 A;  1F2Z A;  2EY6 A;  4DR7 Q;  1R9T B;  1PV4 A;  3C3L A;  4A3F G;  2PZU A;  5GQO A;  1PH5 A; 
#chains in the Genus database with same CATH homology
 2K33 A;  2F0D A;  2BA0 A;  2K32 A;  4RFB A;  4C3I B;  2PO4 A;  4LJZ C;  3QIA A;  1GJX A;  3QOL A;  2KCC A;  4KY5 A;  1QE6 A;  4HMJ A;  1RDP D;  2B2T C;  1LT4 D;  1B53 A;  4ULL A;  3HP3 A;  4OHJ A;  2X69 A;  5C5M A;  2PCF B;  1EWC A;  1SYC A;  3WOF A;  4KTA A;  1SSO A;  3GTL B;  4KHV A;  2RQX A;  3H91 A;  3FPU B;  2XNA C;  1BR9 A;  1OXV A;  5IGB A;  2ZXR A;  1BNZ A;  4ZQ3 A;  4K14 A;  1STY A;  3FMC A;  3RZD B;  1RCV D;  2K28 A;  3E5S A;  4KV6 A;  4QCL A;  4QUF A;  4IAL A;  5C0X G;  1VMC A;  5HUR A;  3KUP A;  5FO8 B;  3I90 A;  1D1I A;  1EY6 A;  2B2W C;  1HUN A;  3C46 A;  4RGM A;  2XVS A;  4S3S A;  3HOZ B;  3CQZ B;  3SK6 A;  2F0L A;  4BS9 A;  4PMW A;  4FO2 A;  4KKU A;  5M5X B;  1TY0 A;  4C2M B;  4NKL A;  1EYD A;  5HGT A;  3D31 A;  3Q24 A;  5IT9 E;  5FO9 B;  4OO1 I;  3PO2 B;  1JOR A;  2WKC A;  1SNO A;  4FP5 D;  1F9R A;  5KEE A;  5JEA J;  3I91 A;  1OXT A;  1SYE A;  1HFG A;  2F0W A;  4G7Z C;  2F0G A;  1H9J A;  1M4V A;  1BXT A;  3I73 A;  2MGS A;  4BWG B;  1RHP A;  5M3F B;  2RSN A;  2QKI C;  1NCV A;  1D1K A;  2DNC A;  5E4X A;  2RDG A;  1KLU D;  3KLR A;  1Q1E A;  2WIN B;  2EZV A;  1XTC D;  3G7L A;  1EIH A;  1JWS D;  2R92 B;  4J1M A;  4IZ8 A;  3NQI A;  2HDL A;  4PQX A;  1I50 B;  1HQM C;  2IW3 A;  3V05 A;  3J80 E;  5DEH A;  4OL7 A;  3GD7 A;  5T1I A;  2L4N A;  1A3U A;  2L1B A;  1U9R A;  2B8F A;  3K5O A;  1B1Z A;  2RDH A;  4DGZ A;  3R93 A;  1WTW A;  1ET6 A;  1II3 A;  3PUY A;  1G29 1;  1GUG A;  3T16 A;  3MA2 B;  2B39 A;  1FGB D;  3CU7 A;  3TDQ A;  3PUV A;  1R4P B;  4IQZ A;  1S4Z A;  4EQN A;  3K7A B;  1F2Y A;  3GTP B;  3LX0 A;  2EYM A;  4R9W A;  3IFT A;  3KK7 A;  4XXE A;  1JQY D;  3KLS X;  2J7Z A;  5JVH 3;  2E2D C;  1GUS A;  4XDX A;  5IT9 L;  3D4W A;  4OO1 G;  1F77 A;  2HDM A;  2X6L A;  4DK1 A;  2AWO A;  4FVM A;  3VYU A;  2D9U A;  2X6G A;  1Q3L A;  1LTB D;  2IL8 A;  1SFO B;  1IL8 A;  3LWE A;  2F3V A;  2R6G A;  2A69 C;  1GHJ A;  3OOC A;  3S2D B;  1I4Q A;  4HMI A;  5DNF A;  1B3A A;  1Y8N B;  2G9H D;  2H4O A;  1MBY A;  4KJO A;  2B2T A;  5DAU A;  4N9P A;  1I4H A;  3OWF A;  4C3I G;  3BG3 A;  4KI0 A;  1H9K A;  2BA1 A;  1G8Z D;  5TSS A;  3J80 L;  4XTC S;  4QUC A;  3GV6 A;  3MHB A;  5BN3 A;  4K8I A;  4CJ2 C;  2NYZ D;  1U4L A;  2WAQ B;  1SND A;  3SXH A;  1PRT F;  1SYF A;  3C1F A;  4DAP A;  4BBS B;  1W6J A;  1XX8 A;  2RBM A;  1X3Q A;  4F8M A;  2V4D A;  4DU9 A;  3NTH A;  3OSO A;  1X32 A;  2RA4 A;  3MFG A;  2B2W A;  5ELB A;  4C1N K;  2WB1 B;  3A8I E;  1HUM A;  2KJX A;  1MGS A;  5C6A A;  5IGF A;  1V1O A;  1TWG B;  1OXS C;  1MD2 D;  2AQ1 B;  1JIC A;  5I6Y A;  2F03 A;  3S1N B;  2JA7 B;  5EGT A;  1G2T A;  3VA7 A;  1NSN S;  4J8Q A;  1STG A;  4K5V A;  5D3I B;  5C0X J;  2B8G A;  1K8M A;  1XYI A;  2H1E A;  5CV4 A;  5CC4 A;  2NN6 H;  2EY5 A;  3H09 A;  1PXU A;  3X3M A;  2DY7 A;  3HS0 C;  3MWY W;  2I46 A;  1VF5 C;  2QDB A;  4A3B B;  2XWJ B;  1I6V C;  4P2C B;  5BN4 A;  3SVM A;  1AW7 A;  3WDN A;  2QF7 A;  1LT3 D;  2BOS A;  3EVQ A;  1HPC A;  1SXT A;  1LLR D;  3CHB D;  2F0F A;  4LK1 C;  2L12 A;  2MP1 A;  2JP1 A;  1CZW A;  4RGO S;  4MIU A;  5EPJ A;  1BUV T;  3K5N A;  2NTS A;  2A5H A;  1BCP B;  1SNP A;  3C2P A;  1IKM A;  4RHR A;  1KDB A;  2E76 C;  4X3T A;  1CM9 A;  2IX0 A;  1ENF A;  1UEA B;  4Z9C B;  1ET9 A;  1AFP A;  1S5C D;  2NB0 A;  2L5T A;  5FO7 B;  1VMP A;  4FXD A;  1CQF A;  3ERO A;  1LTS D;  2D5D A;  1SE3 A;  4L8J A;  3Q22 A;  2EE1 A;  5J22 A;  2KCN A;  4EVO A;  4WFN 3;  5ELC A;  5J39 A;  3QG1 A;  5C4X B;  1ILP A;  1EL0 A;  1AP0 A;  1F2M A;  3MXU A;  3URY A;  1CFM A;  1A2T A;  1RD9 D;  3PMF A;  1ESR A;  1U4P A;  3CKI B;  4CGY B;  2K5D A;  4HTH A;  5K5P A;  5I9P A;  4ZUJ A;  5CV9 A;  3SDZ A;  2OT2 A;  3E0J A;  4HCS A;  2CQA A;  1JCK B;  1NR2 A;  4RWS C;  4HN7 A;  4C3H B;  3VA5 A;  3K59 A;  5LHY 1;  1SE4 A;  3KF8 A;  3N52 A;  5M3M B;  1RJT A;  1LTI D;  5EPK A;  4WRD A;  3MXN A;  1ZXT A;  2F4I A;  2EJG C;  3T56 B;  2E2J B;  5KGU A;  4O42 A;  5C3W A;  1TWC B;  2BCO A;  1X3P A;  3PUZ A;  2EPB A;  3OIP A;  4CJ0 B;  1JE4 A;  1EYC A;  1XXG A;  4CKB A;  3TZU A;  4TRD A;  4F7X A;  1Y69 U;  1O7Y A;  2FJ2 A;  4GZY C;  1LTA D;  1JR0 D;  2E2H B;  3AB9 A;  3T4A C;  5LL6 X;  5EBC A;  1HHV A;  3MZ5 A;  1I3Q B;  4TKO B;  4KMU C;  2OXP A;  1WTX A;  3ONA B;  4G7H C;  3PV0 A;  3K6O A;  1RF2 D;  1SYG A;  2NUC A;  5E3F A;  1EY4 A;  1PLF A;  3GQB A;  3EA6 A;  3TSS A;  2K04 A;  1B4O A;  2L11 A;  2Z1C A;  4IUR A;  1V43 A;  3LNN A;  3NE5 B;  3TP8 A;  3SR1 A;  4RKL A;  1KNE A;  1EU4 A;  1KTK A;  2BE5 D;  2EYL A;  2EYJ A;  4FF4 A;  1EY5 A;  3D4D A;  2O5J C;  2NTT A;  2O4X A;  1G91 A;  3FDT A;  1MSG A;  2XRS D;  1GUN A;  2O5I C;  1DXM A;  3PUW A;  3A54 A;  1NR4 A;  3OHX C;  5CBA E;  1QCB D;  1SYB A;  3CRK C;  4E6I A;  5M5W B;  3I4M B;  4NDX A;  2DNE A;  3OPO A;  4HR7 B;  1Q8I A;  4KJN A;  3FKI B;  3M85 A;  1A15 A;  2KEC A;  3RMH A;  3KBG A;  2E2I B;  2JEA I;  5I4D A;  1OXX K;  4LMQ D;  3ND8 A;  5COR A;  2Z4I A;  1T5E A;  5JAV A;  4ZLT F;  1DD2 A;  3W3A A;  2F0V A;  3HOW B;  1F9S A;  2N55 A;  2XRQ D;  4K5W A;  1F9P A;  1Y1W B;  5KND A;  1DYQ A;  1JC7 A;  4DAY A;  1SEB D;  2XN9 C;  4B9W A;  1C8C A;  1QWY A;  2FFK B;  3T51 B;  4FF3 A;  4QMG A;  2EJF C;  3R8B A;  5JPN C;  2PYK A;  1CHP D;  1OO9 B;  5ISR A;  3J7Y W;  3VYR A;  1JOO A;  4KD4 A;  1Q1B A;  1HQR D;  1E0B A;  3MXG A;  3DXJ C;  4U67 3;  2ICE C;  1HTP A;  2K5W A;  2IT1 A;  2F0K A;  3V96 A;  5DM6 3;  1J8I A;  5KYL A;  2Q8I B;  4KY7 A;  1WTV A;  4C56 C;  2F0I A;  2OEO A;  1A3T A;  1Z6H A;  1TWH B;  2EXZ A;  1TS2 A;  2A73 B;  5IOD A;  2NN6 I;  4C3H G;  2IWH A;  2F0P A;  3GTG B;  1E2V A;  1ZEQ X;  1PYW D;  4K8J A;  1EFI D;  1EY7 A;  5KNC A;  4WJW A;  4I7Z C;  3Q0A A;  2JE6 I;  5EKK A;  1JOK A;  3PIP 3;  4CJ1 B;  2E75 C;  1ROD A;  1TWA B;  4UDU C;  1YNN C;  4QB4 A;  3KBX A;  4ZKC B;  2F0Q A;  4PV1 C;  1MSH A;  1FNV A;  2G9D A;  3VYS A;  4AYB B;  4HCE A;  5C3X A;  4Y7N B;  1QNU A;  1U4R A;  2QCP X;  4OIK A;  2BDO A;  5JVG 3;  1B50 A;  2Z8L A;  5I2X A;  3RD4 A;  3E6Z X;  5FOB B;  2Q8R E;  2K5Q A;  2KHS A;  1ENC A;  3EJI A;  1PRT C;  4CBV A;  2R93 B;  2F0S A;  5EBD A;  1C48 A;  1QNK A;  4F88 A;  1IYU A;  3NSW A;  3MFY A;  1H9R A;  1Y8P B;  4XT1 B;  3TN2 A;  4A3E B;  2F0U A;  3VR2 A;  4HED A;  4H44 C;  3OMC A;  4IN3 A;  1HA6 A;  4FNF A;  1TS3 A;  1SNC A;  2EYH A;  4X3S A;  2KOL A;  1KDC A;  1TII D;  1ML0 D;  1BCP C;  2MJ8 A;  2EYF A;  3U9S A;  1DJR D;  1SDF A;  2KED A;  1NAP A;  1PFM A;  4HSV A;  5C4J B;  4A3G B;  2NN6 G;  4RGT A;  1CA6 A;  5IGG A;  4K6D A;  4KY6 A;  3HEJ A;  1ONL A;  4ABN A;  3S1Q B;  1W6K A;  5EPL A;  1D5M C;  3SE0 A;  1T5X D;  5EKL A;  1DOL A;  3OMG A;  1B9M A;  4OIJ A;  3DEO A;  2Y0S B;  4JK1 C;  4IUN A;  5IGE A;  3J7A V;  2J4X A;  1C4Q A;  3H3V C;  3QWN A;  4IFD H;  2XIW A;  1PFN A;  3K0Y A;  1PTO H;  1BCP F;  2EDG A;  3D6C A;  3VYT A;  1EY9 A;  5JPM C;  1CK1 A;  1YNN D;  3D4R A;  5CV8 A;  4C3J B;  3HOY B;  1STN A;  2R7Z B;  1O7L A;  3A56 A;  2FMM A;  3H0G B;  2D62 A;  2JEB I;  3U9O A;  5COY A;  5E1F A;  3TBI B;  1FR3 A;  2F0O A;  1D5X C;  1EEI D;  1I6H B;  1D2B A;  2CHB D;  1CA5 A;  1I4P A;  3D6W A;  5ELF A;  3BVZ A;  5IOC A;  1Z7T A;  1WVL A;  3MVV A;  2HCC A;  4JBW A;  1EQV A;  3V2T A;  1TVX A;  5C5L A;  3QOJ A;  1PRT D;  1SJH D;  3BYY B;  2JSO A;  3RUZ A;  4FYD A;  3I3C A;  3NUC A;  2PW5 A;  3JAM E;  2RVL A;  1STE A;  2O2L D;  1BF4 A;  1GUW A;  2EY2 A;  4QF4 A;  3ZYY X;  1TWF B;  1AZQ A;  5FK9 C;  3P75 A;  3DM1 A;  2IX3 A;  1GUO A;  1IYV A;  1JWM D;  3HZX A;  4CHT B;  4XQQ A;  1BCP D;  4F87 A;  3EQL C;  5A35 A;  1TS4 A;  1EYA A;  1RKN A;  3HOV B;  4C1N I;  5IGC A;  5KYI A;  4DXF A;  4EGV A;  2MUY A;  4RKB A;  3P20 A;  4ZUI A;  4BA2 I;  3DMU A;  3Q6S A;  4KD3 A;  2PMZ B;  4ODG A;  2F0H A;  5KRU A;  1TY2 A;  1LT6 D;  2SEB D;  1CT1 D;  3S2H B;  3K5M A;  3NK9 A;  3A7L A;  1STA A;  1WTP A;  2NVX B;  5C44 B;  1IKL A;  2K7V A;  1LTR D;  4KKS A;  3FRP B;  3S1M B;  5KIX A;  2HQE A;  2IPK D;  2BE5 C;  3R2I A;  1PZI D;  5I9O A;  1V8Q A;  2D2C C;  4HAE A;  2NZ1 D;  4RA8 A;  2R61 A;  1IHZ A;  2GA4 B;  3EFX D;  1K83 B;  3SHL A;  1YNJ C;  5JEA H;  3ERQ A;  1UAP A;  1Z47 A;  4RAU C;  4XQN A;  2ENB A;  3TP7 A;  1QG7 A;  2KUM A;  5LL6 S;  3PIO 3;  3JAM L;  2KQ3 A;  1GHK A;  2XWB B;  2PW7 A;  3A8J E;  2K1B A;  1B2T A;  4A3I B;  1S5B D;  5JJZ A;  3Q23 A;  1RTO A;  1LT5 D;  1EY8 A;  2HCI A;  2KEE A;  3H94 A;  3GP7 A;  1S5F D;  3FEW X;  3SK4 A;  1PZJ D;  3SEB A;  2F0T A;  1MI2 A;  3NQT A;  5CV6 A;  4XYO A;  1V1P A;  4U68 A;  3NTI A;  2XSC A;  1F2L A;  3M7N A;  4M1U B;  4A93 B;  1EQT A;  1PTO B;  2AQ3 B;  5G3L F;  3DUZ A;  4IUQ A;  2EJM A;  1HA5 A;  1LTG D;  2I07 B;  3SK8 A;  2FHT A;  4DAV A;  2MHV A;  5AFW A;  5M5Y B;  1QIL A;  2SDF A;  1JOQ A;  5C4Z A;  3WOE A;  3ITP A;  4DNR B;  5C4H A;  1IW7 C;  3DEP A;  1DOM A;  3CRL C;  1H9S A;  2CVR A;  2PZW A;  2ZT9 C;  1CTM A;  5A2Q E;  1KNA A;  4C3J G;  1O78 A;  1Q90 A;  3NWT A;  3GO5 A;  4DXG A;  1UNS A;  5D65 A;  1I4X A;  2TMP A;  4ME5 A;  1G2S A;  1STB A;  1YNJ D;  1F9Q A;  2JA5 B;  5JOB A;  3S14 B;  4LAA A;  5CR3 A;  1TT2 A;  1SBB B;  2ID0 A;  2QEJ C;  2A74 C;  2JA8 B;  4A3M B;  4G7O C;  1PZK D;  4ZAI A;  4BY1 B;  1EZ6 A;  2JXM B;  5G3L D;  4ID6 A;  2N88 A;  5M9O A;  4O1N A;  2F0E A;  1FNU A;  1BQQ T;  1HFN A;  1LAB A;  2CW0 C;  2K6A A;  3F2U A;  3I4L A;  1SYD A;  3HG9 A;  4G57 A;  3GTQ B;  3VR5 A;  1G6Z A;  2JA6 B;  4IUT A;  1I4G A;  1KDA A;  1SAP A;  2LMC B;  1FNW A;  2A6H C;  2IJ0 A;  2F1M A;  2Q8T A;  4ZYS A;  2WII B;  1PFB A;  2B2Y C;  3LWU A;  3A8K E;  4IUV A;  2NBF A;  2EVB A;  2RDF A;  3NBI A;  5E4W C;  1BO0 A;  2FMC A;  1ICW A;  3G6J B;  3I70 A;  4KN7 C;  2LFN A;  1DCZ A;  2VB2 X;  1QOH A;  3VR4 A;  1LAC A;  4IFD I;  3I72 A;  4X3K A;  1ZYR C;  4V19 0;  5A2Q L;  2PZT A;  2M2L A;  1R4Q B;  5C0X H;  5J1Z A;  2PQE A;  5BN5 A;  2IX1 A;  3J7A F;  4BY7 B;  2RKS A;  3BDO A;  1IW7 D;  4RH6 A;  2SOB A;  3NHH A;  3OIQ A;  1SE2 A;  3R2T A;  2VNU D;  1VF7 A;  3I4N B;  1DZ1 A;  3GTO B;  4L63 B;  2B63 B;  1STH A;  4RCO A;  3N6R A;  1O80 A;  3GV3 A;  2L55 A;  4ILW A;  4R8I A;  4RGN A;  4V0B A;  3NWS A;  3L7Z C;  4K5X A;  3W2D A;  1Y8O B;  1UUP A;  4DA2 A;  4FF2 A;  3NPP A;  2AUK A;  3TP6 A;  3FVQ A;  2K03 A;  2DY8 A;  3X3N A;  1VCI A;  5D3D A;  1CQV A;  2A68 C;  2WAC A;  4FF1 A;  2VB3 X;  2LKV A;  2KA7 A;  1O7Z A;  4H7B A;  3HRZ C;  4XYQ A;  1HCZ A;  3MTS A;  3HOX B;  2EYO A;  1EY0 A;  4Q5V A;  2Z4H A;  5C3E B;  3AMU A;  5NUC A;  2ZXO A;  5FLX E;  5IGD A;  4NW2 A;  3K57 A;  4DN4 M;  1J9O A;  2R3Z A;  3BVM A;  1A3V A;  3T53 B;  4TQU S;  2CW0 D;  1AN8 A;  2SNM A;  1SJE D;  1TU2 B;  1PMR A;  4K2K A;  4EQO A;  3HKZ B;  3J81 E;  4DFA A;  2A6H D;  2EYP A;  3BS1 A;  4CKC A;  1DOK A;  4IFD G;  3P1H A;  1M8A A;  1TS5 A;  3K58 A;  5KNB A;  3VR3 A;  3BZD B;  4OGQ C;  1LV9 A;  5I6W A;  1D6E C;  4A3J B;  2B2U C;  3A7A B;  1HRJ A;  5FKA C;  3K5L A;  1FD7 D;  2B2V C;  2DN8 A;  2M9V A;  1QJO A;  3S9W A;  2AUJ D;  1HTL D;  3HOU B;  1KAB A;  1ENA A;  2E74 C;  1ZYR D;  1B44 D;  1BOS A;  4IUP A;  5ELD A;  3M4O B;  1SNQ A;  2LY7 A;  4IUU A;  5EKI A;  2AWN A;  2YYZ A;  2NWG A;  1E2Z A;  2PNR C;  1SNM A;  2NVY B;  2NVQ B;  4Q0F A;  1CHQ D;  1A2U A;  4NMZ A;  3GTJ B;  1WTO A;  2L9H A;  3C1E A;  4BBR B;  1BBX C;  1L0Y B;  2RSO A;  4KHZ A;  4DNT B;  3QB3 A;  3KLS A;  2K05 A;  1GUT A;  3IFD A;  1SMY C;  1WTQ A;  3BDC A;  4OO1 H;  4PMC A;  5T1G A;  1QB5 D;  4RHS A;  1NUC A;  4L6T B;  1XWE A;  3SK5 A;  4R8N A;  3S1R B;  1BDO A;  4YIJ A;  4A3F B;  3DHQ A;  4XIG S;  2ICI A;  2A68 D;  5FLX L;  4WOR A;  1H9M A;  2F0N A;  4DK0 A;  4MHE A;  1VDZ A;  4ZKB B;  2F0M A;  3DWP A;  4TSS A;  3NP8 A;  2WV6 D;  3P7J A;  2OF1 A;  1E2W A;  3ND9 A;  2FIN B;  3J81 L;  2TSS A;  2B2Y A;  3D8G A;  1GXD C;  5CV7 A;  3PUX A;  1TQO A;  1U4M A;  3I8Z A;  4H13 C;  4K2L A;  4PNY A;  1TKW B;  3MAQ A;  5CMD A;  4HSP A;  5IIF A;  3IKJ A;  3VR6 A;  5CGK A;  4J6H A;  3FPP A;  3H6M A;  2L0C A;  1A6X A;  3QJY A;  2VUM B;  3TZD A;  3L9A X;  1HXY D;  4PMB A;  5I2Y A;  2A69 D;  1FYC A;  1Y1V B;  1PRT B;  4B9X A;  1K8O A;  5K36 G;  4KN4 C;  1TR5 A;  2F0J A;  3M3Y B;  3OWE B;  4B08 A;  2LS0 1;  1WD0 A;  3DWQ A;  2VXW A;  3BYT B;  1AEX A;  2K01 A;  3BVG A;  3R3O A;  2JYO A;  1GOZ A;  3PO3 B;  1WCM B;  4KK7 A;  5JEA G;  2A6E C;  4KKT A;  2WP8 J;  3RLF A;  3TP5 A;  1L0X B;  2C5C A;  1PTO C;  2YU9 B;  3QO2 A;  3GTK B;  1WTR A;  3S16 B;  1D5Z C;  3IAY A;  3IL8 A;  3D3R A;  3NTK A;  1SMY D;  3T13 A;  3AU7 A;  1WD1 A;  3RZO B;  2SNS A;  3NXW A;  4CKE A;  1B9N A;  1DM0 B;  1EOT A;  1V1P B;  5CYU A;  5K36 H;  4A3D B;  4BA1 I;  5DM7 3;  5CBE E;  4X3U A;  3OW7 A;  1DON A;  5F2D A;  4RCN A;  1PTO F;  2NVT B;  5CV5 A;  1OXU A;  2C9O A;  2KVM A;  3L3O C;  1PDQ A;  3MXP A;  4XT3 B;  3MC0 B;  4ZK9 B;  2EY1 A;  1EIG A;  1Q12 A;  2J0T D;  4FXK C;  1CI3 M;  3UI2 A;  1JB3 A;  5EQ0 A;  1H9S B;  2B2U A;  1LTT D;  4NP5 A;  3A55 A;  5EJW A;  2HUG A;  1EZ8 A;  2B2V A;  3S17 B;  4I65 A;  1EU3 A;  1EWH A;  1AZP A;  3MEH A;  1RTN A;  4M8A A;  1LO5 D;  4A3K B;  5D14 A;  1KLG D;  4QIW B;  3HGB A;  2AQ2 B;  2ZXP A;  3O13 A;  4DF7 A;  1ILQ A;  3TME A;  3GTM B;  2BDN A;  1I4R A;  1S5D D;  5ELE A;  4H0L C;  3S15 B;  5C0X I;  4IFD J;  4EQP A;  4XQJ A;  2MPM A;  1CZG A;  3DWA A;  4ZRZ A;  4K6L A;  3M7G A;  2PPB C;  1JWU D;  1ZKO A;  2EOT A;  2M00 A;  1KAA A;  4MN3 A;  2A6E D;  4FXG C;  2F3W A;  4G4K A;  2WKD A;  1PTO D;  3NBH A;  3BDL A;  1ESF A;  2QIL A;  4N9T A;  3M4Y A;  1EEF D;  4UAI A;  1S5E D;  1F2Z A;  2EY6 A;  1R9T B;  3C3L A;  2PZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...