2K32A

Truncated acra from campylobacter jejuni for glycosylation studies
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
DVIIKPQVSGVIVNKLFKAGDKVKKGQTLFIIEQDQASKDFNRSKALFSQSAISQKEYDSSLATLDHTEIKAPFDGTIGDALVNIGDYVSASTTELVRVTNLNPIYADGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A
publication title NMR structure determination of a segmentally labeled glycoprotein using in vitro glycosylation.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Membrane protein, transport protein
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k32A00
3GQBA 2PPBC 4G7HC 2DNEA 2A69C 1CFMA 2EJFC 5KNBA 1IYUA 2EDGA 1CI3M 1ZKOA 1H9SA 3VR5A 1IW7D 3M7NA 2YYZA 4TKOB 2V4DA 2IT1A 1DD2A 3IFTA 1OXTA 5C0XG 2R6GA 1ZYRC 4JK1C 2AWOA 2QF7A 1Y69U 4IFDH 1Z7TA 3D31A 3N6RA 1HQMC 4H0LC 4HR7B 1G291 3RLFA 3CRLC 4LK1C 2CW0C 3A8KE 5A35A 3OPOA 2E74C 1B9NA 1DCZA 1H9RA 1Y8OB 1Y8PB 3A7AB 1GUSA 4KN4C 3MFYA 4H44C 3I4LA 2A6ED 3CRKC 3T53B 4DNRB 2KA7A 1VF5C 2JEAI 3BG3A 1VDZA 1CTMA 2B8GA 2DNCA 2K32A 2E76C 2BE5C 1Q12A 1DXMA 2NN6I 1Q1BA 3FPPA 1GUGA 1SMYC 3QG1A 1GUNA 2AUJD 5K36H 2JEBI 2DN8A 3MXUA 3VR2A 2F1MA 3AB9A 3BDOA 5KNDA 1V43A 4XTCS 3OW7A 1FYCA 3ND9A 2EVBA 1GUTA 2O5IC 4I7ZC 3IKJA 5JEAG 1IW7C 4BA2I 1EWHA 3A8JE 1IYVA 4DNTB 4KN7C 3T51B 4DK0A 2PNRC 3I72A 3QIAA 2Q8IB 4IQZA 5C0XH 3GD7A 4OO1G 1GHKA 3PUVA 2JXMB 1LACA 1YNJC 3L7ZC 3VR6A 1FR3A 3LWUA 3VR4A 3WDNA 2B8FA 4OGQC 2A6HD 1K8MA 1I6VC 1Z6HA 2A68D 2D2CC 3LNNA 2A6EC 4KHZA 3HGBA 4KMUC 1OXXK 1K8OA 2NN6G 1HPCA 1LABA 3M4YA 3W3AA 3U9SA 5KNCA 2D62A 5BN3A 1E2WA 2LMCB 3FMCA 4G7ZC 1V8QA 3I73A 3P20A 1VF7A 1OXVA 4KI0A 3H94A 2D5DA 4DK1A 1O7LA 1H9MA 2A69D 3A7LA 3PUXA 1BDOA 2EJMA 5BN5A 4G7OC 1VCIA 3VR3A 3PV0A 1Q1EA 3DXJC 3TZUA 2JE6I 3EQLC 4LJZC 1OXUA 5JEAH 1HTPA 1QJOA 1ONLA 2BA0A 4IFDG 3SE0A 1H9SB 1HCZA 2BDOA 3OOCA 3T56B 1A6XA 4L8JA 1H9KA 1T5EA 1GUOA 4KKSA 2K33A 4KKTA 1YNNC 1TU2B 1H9JA 4BA1I 3M85A 2EJGC 1GJXA 1E2VA 4OO1H 3PUZA 2O5JC 2A6HC 2A68C 3PUWA 1TKWB 1GHJA 1B9MA 1O78A 2K7VA 2PCFB 3KLRA 4KKUA 3D4RA 3ND8A 1Y8NB 2BA1A 2KCCA 3PUYA 4PV1C 4GZYC 4RCNA 3A8IE 4XIGS 1OXSC 2ZT9C 1Q90A 4TQUS 2NN6H 2AUKA 3VA7A 5K36G 2BE5D 2L5TA 4H13C 3SDZA 1PMRA 3QJYA 3NE5B 1E2ZA 4JBWA 2E75C 5BN4A
chains in the Genus database with same CATH superfamily
3SHLA 2CWPA 5IP7G 5BR8Q 1G6ZA 4GOPA 1PZID 4GS3A 4XQNA 4G4KA 3M7NA 4UP8A 1PH5A 2RSNA 1S5DD 1EWIA 1L1OB 4J6HA 1FJGQ 2ATWA 1EL0A 1HQMC 2F0GA 4R4QA 4HCEA 2C35B 4IFDJ 1MBYA 1IBLQ 1VQ7A 2JA8G 4FNFA 2ICIA 5CV5A 5T1IA 4R8IA 3C1EA 4DR7Q 4BBSG 2WB1B 1BBUA 3BG3A 4OIKA 1CTMA 4RFBA 3R93A 3NELA 4A3GG 1FJGL 1BVSA 1K8AC 1EU4A 1CK1A 1SRUA 3J81j 2F0UA 1JWUD 3PIPA 2IX1A 2ZM6Q 3TZDA 4A3MG 1VQPA 2CKZB 1QILA 2BCOA 2B39A 5M3MG 3M4OH 2QCPX 1XTDA 2R92G 4CDCC 3TS2A 2A5HA 4KHPL 4POFA 4RA8A 4A75A 1HZ9A 3HGBA 2ZM6L 5LMNW 3GTKB 1CKNA 1TS5A 2K50A 3CW2C 3W1BA 4DPGA 5I6YA 1C9OA 5ELDA 4XXEA 5KEEA 2B29A 2KCNA 2VZAA 2TMPA 1EQRA 5FK9C 2LFNA 2CVRA 2YU9B 1B7YB 3GTPH 4K5WA 2IW3A 1AFPA 1JE5A 1XMOL 3HOWH 4DV6L 3ULLA 1ONLA 4RGMA 1PH6A 1VQKA 1ILQA 3ITPA 3A54A 2Q2IA 4ODGA 2NWGA 4QGUA 3TP6A 1PYBA 5FLMH 1SAPA 3VA5A 4JPBW 1VQ6A 2D0PA 1XPRA 4OO1H 3HG9A 4RAUC 1EFWA 2A68C 4PZ8A 1YBYA 3NK9A 4KKUA 4IPDA 3D4RA 3TP8A 5GROA 2OXPA 1CSQA 3I4MG 4FXGC 2ZT9C 4X64L 5FKAC 4IALA 1SYDA 3A5UA 1Y1VG 2F52A 2NZOA 3QR8A 1E2ZA 2B63B 1I5FA 1U4RA 4AQYQ 3GTMB 2EPBA 2Q2UA 1AZPA 2PPBC 2M00A 4B3SQ 3PO2G 5KNBA 3PIOA 3K5LA 4DV7Q 3LGJA 2OQKA 1G91A 1HRJA 2KJXA 2UUBQ 5ISRA 4LNQA 3ER0A 2PI2A 4DAVA 3OTOL 1CSPA 4BS9A 3IFTA 1V9PA 1V1QA 1VQNA 1I50B 1DOLA 3Q8DA 4ID6A 5COYA 5M3FB 2OEOA 3TBIB 1PDQA 2CW0C 4AQYL 2B2TC 1I94Q 1H9RA 2B2VA 3MXPA 3A7AB 3S1NH 3CXCA 3NSWA 5LL6X 2UUBL 4FXKC 3GTJB 2K32A 3NPPA 1K3RA 1EFID 2BE5C 4KD3A 3F2CA 3PO3B 4DF7A 1GUNA 4A3FB 2PZUA 2AMCB 3EROA 1BOSA 5HY6A 5IYBG 4XTCS 4F7XA 1I94L 5ELFA 4DV0L 4ABNA 3SK5A 3JAMi 1X32A 4NMZA 1OTCA 1AEXA 4KN7C 4C2MB 2SNSA 3AFQA 1U9RA 4LUVA 4XQQA 3GTOH 2F0QA 5E3FA 3W5OA 4XYQA 4CDEC 1IZ6A 1XYIA 4OGQC 1CKMA 3U58A 3HRZC 3KF6A 4FF2A 1PTOB 2IHEA 4LFBQ 4YCVA 4HSVA 3KBXA 3E9HA 4BY1B 5IT9E 1PZJD 1PYWD 1A3VA 4B9XA 1AZQA 3I91A 1L1OA 3CC4A 3H94A 3F2BA 1AW7A 1BDOA 4OEMB 3DM1A 2J7ZA 2M2LA 3KK7A 4YWLA 1OXUA 1YIJA 2F0EA 1A6XA 3CCVA 1PFNA 5IYCH 3M85A 3PUWA 5IGEA 2Z6KC 5C4XB 2JK8A 4DR1L 2FMMA 2SOBA 3PUYA 4DV1L 3A8IE 1U0LA 3Q24A 1LO5D 2F03A 3KJPA 1L0WA 3GTLB 3M4QA 2OTJA 3ICEA 3RZOB 4A3KG 1XNQQ 3DM3A 2FXQA 1YJWA 4DK6C 2KHSA 2E2JH 1IW7D 5C0XI 1NY4A 3D3RA 4IUPA 1VQHA 1DD2A 3JAME 4NXNL 2IX3A 1PXUA 5E4WC 2BH2A 2UUAL 1PVOA 1EY5A 4N8X1 4GNXC 5C6AA 4B3TL 5IE8A 5EKIA 3U9OA 1TQOA 4KK7A 5C3XA 1E1TA 4X62Q 1CUKA 2EY6A 2K5QA 5C3EB 1YVCA 4AIMA 5C4ZA 3MEFA 2R7DA 5JPNC 5IIFA 1A2TA 4NW2A 1WTXA 4IOAA 2DJFC 2K5WA 4UDUC 2B8GA 4RKLA 4A3JB 2FINB 1EQVA 3CCSA 1T5XD 1SMYC 1PTOD 1SLJA 2QDLA 4LWCA 3RNUA 3L2PA 1X3FA 3CF5A 5ELEA 4DV3Q 5CORA 2I5LX 3H3VH 5JOBA 2EY5A 4QF4A 1SYGA 3QIAA 5EQ0A 3GTKH 1KDBA 2UXDQ 4DGZA 4L5QA 2JXMB 4MNOA 4PZ6A 5M5YB 4PQXA 2EYMA 3PSIA 4R9WA 1DM0B 2B2WA 4KHZA 4JI1Q 4GOPC 1C7YA 4X65Q 1FVIA 4HN7A 3HOYG 2F3WA 2A8VA 4ZK9B 1Y1WG 4ZKCB 1WTVA 2UXDL 2NTSA 2WV6D 1J5EL 1TS2A 5C5LA 2D5DA 4NDXA 4DK1A 5EPKA 3X3MA 5AJ3L 1AE3A 3L3OC 1VCIA 2QEJC 4B3RL 4IURA 1LTLA 3P75A 2N88A 4IFDI 1STNA 3MTSA 4ILWA 3R3OA 1SR3A 3QWNA 3T56B 2BDOA 4DV5Q 1T5EA 3RZDH 3K8AA 2Z8LA 4KTAA 4QIWE 4HTHA 2K5DA 2O5JC 3J7A5 1O78A 2G9HD 5EJWA 3KLRA 2B63H 1VQGA 3GTMH 1Y8NB 2Q8RE 1NE3A 3I70A 3NEMA 4L5SA 4QIWB 2ZTDA 1DJRD 1A8VA 4LF5L 5LMNQ 1WI5A 2NN6H 1RD9D 2E75C 2EYOA 5E4XA 5I2YA 2B3GA 1TS3A 2PQAB 3AEVA 2IHFA 2JA6H 5M3FH 3MA2B 1NTGA 3SR1A 4P73A 5AFWA 1LT4D 5KRUA 4FXDA 4DAMA 2CWAA 2V4DA 4AYBB 5CGKA 5KGUA 4GN5A 3H15A 3TSSA 1ASZA 5LMNL 1S5CD 1BR9A 1X54A 2XWBB 4OONA 2H4OA 1EZ8A 4LK1C 2E2IB 2F0FA 3OPOA 1YNJD 1E22A 4S3SA 4A3FH 1ESFA 3T53B 3CKIB 4C3JH 3S24A 5FLXE 3C1FA 4C1NK 4ZRZA 4F87A 3UE0A 5IY0A 3QG1A 1EOTA 1YHAA 4XT1B 3DMUA 3G6EA 3BDOA 4GNXB 2JQOA 3CCJA 3ND9A 2KHIA 4IUTA 4DNTB 3T51B 4DR5L 1SEBD 5FLMG 2F0HA 2A1AA 3ZYYX 1PTOH 1BQQT 4OO1G 3HOUB 4BY1H 1FR3A 1NR4A 2AQ3B 2B8FA 2DUDA 1BO0A 1F9RA 2A6HD 1CKOA 1VS0A 2NVTH 4WJ3M 3A0JA 2C5CA 4A3BH 1ET6A 1PTOF 1PH8A 3DEPA 4X66Q 2L1BA 1M8AA 2HQEA 2OQ0A 3P7JA 4JI7Q 4JI3Q 1O7ZA 3TDQA 1QB5D 4R1JA 1ILPA 1SXTA 3PGZA 2B2VC 1EY0A 1EIYB 1PRTB 5CV9A 2K75A 3PV0A 2JE6I 2DY7A 4LJZC 3HKZE 1O7YA 5C4XH 1AE2A 1HCZA 2MNAA 2ZXRA 4JI3L 2NZ1D 1EYAA 3GTLH 1JICA 4MZ9A 1EUJA 4RCNA 2E2DC 1IBML 4DR2Q 2PW7A 4UP7A 3V05A 4ALPA 3S2DB 3QJYA 1KABA 3NE5B 1K9MC 1I4XA 4I65A 2R7ZB 3VR5A 1SMXA 2HUGA 3RLNA 2DNEA 3OIQA 5A2QL 2XN9C 4P74A 2HQLA 1HTLD 2MO0A 3HOWB 5C3EH 2IT1A 2Z4IA 3F2UA 3C2PA 4A3JH 4NXML 1L1OC 3S2HH 4QCLA 1HNZL 4DUZL 2HCIA 3I4LA 5CV7A 5IP9H 1X3PA 1SMYD 3HZXA 4KY5A 1Q12A 5EPJA 1F9SA 2AUJD 4CKBA 1E3PA 3CCRA 4I7AA 2F1MA 5F2DA 4LF6L 3J81c 2KQ3A 3EBEA 4P75A 4EX5A 2KUMA 2LXJA 3OHXC 1NNXA 1RODA 5KYLA 3I4NG 2RDFA 5C3WA 1V1PB 2RVLA 1WTPA 5IYCG 1PRTD 2EYJA 1VQCA 4A3EH 3QO2A 4O42A 3SEBA 3KOJA 4DAYA 1LT3D 3J7ZC 1SSOA 2F0LA 1Z6HA 2JA7B 1A3TA 2PQAA 1RJTA 4TVAB 3HEJA 2B2UA 1JJCB 5C4JH 2HDMA 4X3SA 5GAGC 3P20A 1QVCA 4KI0A 1E1OA 1STAA 3A7LA 4LFAL 4NB3A 1STBA 1FGBD 4FO2A 3QOJA 1JJ2A 2WB1G 1UEAB 3SK4A 4UP9A 3AMUA 4RCOA 1SJED 2EJGC 1GJXA 5J3BA 4HIOA 1I4GA 1HNWQ 2CFMA 2KCCA 1SBBB 3GO5A 1JB7A 4LF4Q 2J0TD 3X3NA 2EY2A 1LTTD 1TWGH 2L5TA 2EYHA 4RHRA 2WKCA 1PFSA 5BN4A 3GQBA 4G7HC 5CYUA 1CFMA 4XYOA 5IWAQ 3EA6A 5D3DA 3R2IA 2B2WC 3CPWA 2E2IH 4A3CH 3FKIB 2A19A 2LSSA 1TWCH 4L63B 1WTRA 1QNKA 3BVZA 4DR3Q 5EBDA 5J22A 4EQNA 1XX8A 5GAHC 3TREA 4RH6A 4HR7B 1G291 4FDBA 2X69A 1DGSA 5CV6A 3BS1A 1IL8A 2RHQB 1GUSA 1GXDC 1DYQA 2F3IA 4DA2A 4HIDA 4UHVA 1BUVT 2PMZE 4CDDC 4JI5L 2F0VA 2I46A 1JC7A 2QILA 3A5ZB 3EIVA 1SNOA 1A0IA 2K52A 3O13A 4R4TA 4JI6Q 2GA4B 4RGNA 4UY8C 2PMZB 3HOUH 5I9PA 1IW7C 4C56C 1S5FD 1IYVA 3UE1A 5JJLA 5CC4A 1XPOA 2E2JB 4QB4A 4K2LA 2Q8IB 4JBKA 1RIPA 3SK8A 1D6EC 3W1GA 2DJGC 1K8GA 1JOKA 3KDFA 1D8LA 4X3UA 4QUFA 4BXXH 2B63G 4KY6A 1LTGD 4JI6L 4UAIA 3I8ZA 1QUQA 3S9WA 2NN6G 1N33Q 1HPCA 1LABA 2GVAA 2D62A 1K28A 3D6WA 4KHPQ 3EN2A 2LMCB 4K5VA 1JOQA 1PTOC 4F8MA 1P8LA 3HOXH 1V8QA 5M3FG 1N8RC 1EEFD 3K57A 1IYJB 4JI0Q 1B4OA 3URYA 4LFCL 5M5WB 1PRTF 2G5DA 4IZ8A 1WYDA 3FVQA 4IPHA 2LXKA 4P2CB 1Q3LA 5JEAH 1HTPA 3HOVB 1N33L 2I5MX 2VUMB 1HR0W 1S4ZA 3G48A 3KUPA 1XMOQ 4HJ9A 3PO3G 4DV6Q 2QDBA 2YTXA 4JI0L 4A3FG 3S2DH 2P5ZX 1G2SA 2AQ2B 2R7ZH 1F9PA 4J1MA 2F0KA 1KDAA 4PV1C 1MHWC 4JI8L 1OXSC 2VL6A 1VQAA 3OMCA 1PMRA 1STYA 4FYDA 4HJ7A 2MHVA 2O2LD 2RDHA 1VMCA 2VB2X 1V1PA 4R4CA 2XGTA 2AHOB 4DV2L 4X64Q 4MHEA 2D9UA 3CQZH 5FJ8H 3NTKA 2JA5B 3J80L 1UWVA 1K0RA 1Y69U 2CH4A 1ENAA 3G7LA 2IX0A 4BY1G 2L55A 4JCVE 2PNHA 1TWFB 3RZDB 1EOVA 1HFGA 3S17B 3OTOQ 1DOMA 1Y14B 5IOCA 1X3QA 4E6IA 3CMEA 4ME5A 4A3BG 3HFZB 3R2TA 4QL5A 4DNRB 1YNXA 3J7AF 1TY0A 5DAUA 2XTIA 1T9HA 4Q0FA 2RSOA 3KJOA 2RCNA 5FO9B 4OWTB 4ZKBB 5K36H 3OIPA 4R8NA 1FYCA 1G2TA 2ICEC 1ML0D 1IKLA 3WWVA 2O4XA 5IGDA 2JA6B 1HFNA 5C4XG 3SK6A 2VS1A 3C46A 2JA7H 4IUVA 4K14A 1LTID 1I3QB 3F8TA 4DV0Q 1D1KA 3TP5A 1HA6A 4HJ8A 2WKDA 1YNJC 2NVQH 2HIXA 4OIJA 1N36Q 2MO1A 1TWAB 2VQEL 3PQIA 4PMBA 1K8MA 3WOEA 2OTLA 3L0OA 2H5XA 4FF1A 4YHHQ 1D5ZC 1VQMA 3MXNA 4IOCA 2VXWA 5H1SE 1HQRD 2HCCA 1E2WA 3DLLA 4C3JB 2MUYA 3SVMA 4F88A 4U673 5DM63 1EY6A 1JJGA 3G71A 3CCUA 1PH9A 1N36L 1SROA 4R4OA 3FEWX 5C3EG 3H3VI 3RMHA 2MGSA 5ELCA 4YHHL 1PH3A 1QJOA 2OF1A 1IXRA 5ELBA 1H9KA 4A3JG 5IT9c 4MIUA 1VQ5A 4HAEA 1F2MA 2KEDA 4BBRB 2K14A 4O0AA 2A6HC 4WJWA 1B9MA 5IP9G 2K1BA 5D3IB 1SE8A 2JN4A 1HH2P 2NVTB 4RGTA 3FP9A 5D14A 1Q90A 4A3BB 3FKIH 1I4QA 2Z1CA 4QY7A 2IY5B 2MFIA 5FOBB 5JJIA 4JBWA 5EPLA 4DR1Q 1XNRL 1B50A 4DV1Q 1VQDA 5I2XA 1IYUA 5EAYA 4A3LH 1LT6D 1WTWA 1H9SA 2L12A 1MSGA 1B3QA 2NYZD 1WCMB 2B2UC 2K28A 4HMIA 1UUPA 1JQYD 4CKCA 4JK1C 1RL2A 2IWHA 1M1KC 1MGSA 5A35A 3K5NA 1HJPA 3S16B 4NXNQ 3GTGB 3J7YW 2UUAQ 1VF5C 4B3TQ 2B2YA 1R4QB 4X3KA 1QVGA 2E2HH 3MFGA 3H09A 1WOCA 2NN6I 3KLSA 3JAMc 1CQFA 1Q1BA 3FPPA 1EQQA 2DN8A 3VR2A 2N49A 5KNDA 3BU2A 3K58A 4I7ZC 2EE1A 3IKJA 4KY7A 1RKNA 3HS0C 3DHQA 1VQ9A 4DK0A 1TVXA 3I4OA 2KOLA 1PH7A 1X6OA 3S2HB 4U68A 1U4LA 1I4HA 1OXXK 1HNXL 1TXYA 4HJ5A 2OWOA 1JWSD 3BZKA 5M5WH 3BDLA 5BN3A 2E8GA 3ZJYC 4AYBG 1PLFA 3ERQA 4YCWA 5E1FA 3HOVH 1A2UA 3RLOA 2Z4HA 1W3SA 2VUMH 1IKMA 3RR5A 4A3CG 1O7LA 1H9MA 2AQ1B 4YCUA 3OWEB 3WOFA 1K73C 3TZUA 4IUQA 3E3XA 2AWNA 4WJ4A 4IPGA 4JG2A 1FD7D 1J5EQ 4DAPA 1PRTC 2CQOA 1KIXA 2NVXH 4XT3B 4K6LA 5AJ3Q 4B08A 4B3RQ 4BA1I 3BZCA 4A3EB 1II3A 1QOHA 2ZXPA 3CMAA 4BY7B 4WRDA 3L9AX 3OYYA 3ND8A 4NP5A 3GP7A 4DN4M 1UAPA 2UUCL 3KFUA 1H95A 3T16A 4ZLTF 4PMWA 5LHY1 1YHQA 3VA7A 2XVSA 3VYRA 2JA5H 2XWJB 1R9TH 4BWGB 4N8FA 4A3IB 5C4JB 3NQIA 3S1MH 3U4ZA 1KAWA 3D4DA 3HOUG 4LF5Q 1TWFH 3CPFA 3S17H 1P16A 4C3IB 2EOTA 1MSHA 4M1UB 2PYKA 4LF8Q 1S3OA 1IL2A 5CV8A 4BXXG 3MWYW 4LMQD 1EZ6A 5KYIA 4JBJA 1HR0Q 1EY8A 2UXBL 1HZCA 2EXDA 1Y8OB 4DAYB 3IFDA 1VDZA 5DLQE 4LF8L 1NUCA 5LL6S 2L9HA 2JA8H 3IAYA 3S15B 1GUGA 3B6YA 1TWGB 2WAQE 4BBSH 2H1EA 1HR0L 1I3QH 4A3GH 5I6WA 3OW7A 1VQIA 2EVBA 2TSSA 1GUTA 1WVLA 1WTQA 2O5IC 5JEAG 2KEEA 4IO9A 1TWAH 2WAQB 1C8CA 1TWCB 1PYSB 3H0GB 5FLXc 2F0SA 4V0BA 5C0XH 1NCVA 1U4MA 2DGYA 1VQBA 1UE7A 1IBKL 5IODA 5LMUQ 3VR4A 2R7ZG 4DR5Q 3T1YQ 3LNNA 3E0EA 4M8AA 2F0WA 2MQHA 4CHTB 3V2TA 2KCTA 2K5HA 1XJVA 3HOWG 3D8GA 3QOLA 2PZTA 5LMUL 3BYYB 1EYDA 2F0JA 1VF7A 2VB3X 2V1CC 3T1YL 4PZ7A 4G7OC 4DU9A 2F0OA 3VR3A 4BBRH 3DXJC 1J9OA 2BA0A 2I07B 5JPMC 4ZAIA 1JB3A 2YTVA 2L15A 1NMFA 1JT8A 1TR5A 3VDYA 2R3ZA 2PCFB 1EIHA 1PZKD 4EQ5A 1BBXC 3J80i 3Q23A 1JCKB 5K36G 3FPUB 5CBEE 3E5SA 1WCMH 2RKSA 2BDNA 2YV5A 1SE2A 3H91A 1IBMQ 2Q2TA 3HOXB 1CQVA 1G8ZD 1EIGA 1Y1VH 1I6HB 2JA7G 1GVPA 4FVMA 3S16H 3K7UC 3HKZB 4RWSC 3GTGH 2KENA 4IFDH 3KLWA 5C4HA 5IGCA 2UXCL 4Q5VA 3A8KE 1XWEA 1F77A 3VYTA 3NBHB 4GLXA 2X6GA 3T1HL 4Y52H 1C4QA 2F4VL 3KDFB 4CJ1B 4KN4C 3NTIA 3CRKC 3KF8B 1L0YB 2GVBA 4QUCA 3AQQA 3H6MA 4XDXA 4NXMQ 1B44D 4G57A 1QUQB 2IJ0A 1HNZQ 2RHSB 4DUZQ 1PHJA 5GAEC 4EQPA 4HIMA 3STBD 4O2DA 4LF9Q 4EGVA 2QKIC 2K5VA 4DR6Q 3MHBA 5HGTA 5DEHA 2EY1A 3UDGA 3VYSA 2NZHA 3CQZB 1WTHA 4LF6Q 3UDIA 1X65A 2N55A 2Z6BA 4YWKA 1X56A 1FNVA 2JA9A 3PUVA 3P1HA 2L4NA 3LWUA 4KHVA 4LF9L 1SNPA 4QMGA 3NXWA 4DR6L 2EYPA 3F1ZA 4GLVB 3FKIG 3M4YA 3W3AA 3GTQB 4YY3L 3J80E 2KECA 2UU9L 2R61A 1W6JA 4JOIC 5EGTA 1OXVA 4Z9CB 4A3LG 3SXHA 4ZUIA 2EJMA 1TIID 3HOZB 3S1RH 2B2YC 4Y7NB 4BY7H 3NP8A 2Q2HA 1GUWA 2K05A 3OOCA 4LFAQ 3K81C 5ELOA 2WACA 1WFQA 2CHBD 3NTHA 5G3LD 1X9NA 3OMGA 4AH6A 4GKKL 1SYFA 3FRPB 3CP0A 4DUYL 2NVQB 4A3IH 4C3HB 2K7VA 1N32L 1Q7YC 1NBWA 2BA1A 2F0TA 4JI4Q 1G6PA 1KQSA 3EVQA 2E5LQ 1AH9A 1YZ6A 3NWTA 1MJCA 4QQBX 4C3IH 4P71A 2ZJPA 2C9OA 2K5NA 1WJJA 2HT1A 3DUZA 4ZYSA 3ULPA 1GD7A 4A3DH 5JJZA 4IPCA 1RDPD 4JI4L 1J6QA 4A3KH 3E6ZX 4K8IA 2E5LL 2OT2A 3TN2A 1LTBD 2HD3A 3D31A 4LUZA 2HHHL 1KD1C 3FHWA 5IGGA 1B9NA 1K83B 2F0NA 4K8JA 3S15H 3K5MA 1TWHH 2A6ED 4A76A 2R93B 1UEBA 4JVZA 3HOVG 3MXNB 4CJ2C 2VUMG 1K3BC 4JI2L 4HMJA 2Q8TA 1KL9A 3H0GH 3T4AC 3AB9A 1Q8KA 3GV3A 5IGFA 3EFXD 4OX9L 3M7GA 4JI5Q 4DKAC 1S40A 2PO4A 2QGQA 2FJ2A 3I72A 5FLXL 4FF3A 4OO1I 2F0DA 2WIIB 4P72A 4OWWB 4KJNA 2Y0SE 3GV6A 3L7ZC 5DM73 1EQTA 1AN8A 3NBIA 2D2CC 1Z9FA 1QE6A 3TEHB 1K8OA 2Y0SB 4L5TA 1F2LA 4CBVA 1SE4A 2EZVA 2JA5G 5J39A 2E2HB 5I4DA 1N34L 4G7ZC 3I73A 4K0KQ 1ZXTA 1ICWA 1BNZA 5JJKA 1S5BD 2A69D 2ZTCA 1LTRD 1Q82C 1B3AA 4A4IA 3NBHA 1W6KA 2FMCA 2PZWA 3TS0A 1H9SB 2QA4A 1OO9B 4B3ML 2YTYA 2ZJRA 3KF8A 2KVMA 1ZYRD 4LFCQ 2RA4A 3AYHB 1E2VA 4LF7L 4K0KL 4NPSA 1KTKA 2WB1E 4H7BA 4GZYC 1O80A 2JA6G 2I0QA 5J1ZA 1DONA 5BR8L 1Z47A 4RHSA 2AUKA 3E9IA 1I6HH 3DWPA 3CCMA 1K0SA 2XRQD 1QVFA 3HKSA 1KC8C 2ZTEA 4JI8Q 1PFBA 1SJHD 1PFMA 1ZKOA 2EDGA 4MTKA 2EYLA 2YYZA 5G3LF 5FO8B 1IBLL 1OXTA 5C0XG 1C48A 3RN5A 3G6JB 4DV2Q 1TT2A 2QF7A 2Z9HA 4DR7L 1Q86C 5C44B 2NVXB 1X55A 3Q6SA 4C3JG 1JR0D 1B70B 4FP5D 3Q22A 1DCZA 3MFYA 3MAQA 1X3EA 1KHIA 5ELNA 4B9WA 3A55A 2E76C 3DWQA 1CT1D 2F3VA 3DWAA 1U4PA 5L37A 1R9TB 1KRTA 3K80C 3KYHC 1V43A 1M90C 1D7QA 4BBRG 3S1MB 3R8BA 1PH2A 3A8JE 2EIFA 3T13A 3CU7A 2IL8A 3M4PA 1WTOA 3UDFA 3GD7A 3GTQH 1GHKA 1PV4A 3A74A 4CDFC 2VNUD 1L0XB 2LY7A 3LWEA 1SFOB 1JE4A 4WORA 5HURA 3CD6A 1CZGA 1ET9A 3N52A 5E7NA 2VQEQ 3HOZH 1WCMG 4TRDA 4DXGA 3J81L 4Y7NH 3FMCA 1SYEA 4OWXB 1YJNA 2JA8B 2VQFQ 4PNYA 3MXGA 3PUXA 2I5HA 1U5KA 4BBSB 4A3GB 3CCEA 1Q1EA 3K7AB 3PCOB 2CCZA 4IFDG 5IYDH 3SE0A 4C3HH 2SDFA 3LX0A 1LT5D 5I9OA 1ICFB 2K33A 1EIFA 1A15A 3E0JA 4PG3A 1TU2B 3OWFA 1BCPB 2VQFL 3BZDB 3K0XA 4A3MB 4GKJQ 2A74C 5M3MB 1ENCA 4B3SL 3I55A 4TQUS 4DV7L 3MZ5A 1CHPD 1BXTA 2R92B 3SDZA 4DR3L 1VQJA 2HIVA 3RD4A 4OELB 4RGOS 1VMPA 3EJIA 3U4VA 3OSOA 1XNRQ 4GKJL 1K83H 4TKOB 5EKLA 3K59A 2AKWB 2R6GA 2K03A 4DK3C 1ZEQX 1BF4A 2R93H 4H0LC 3KLSX 3CRLC 2ES2A 1HZAA 3S1QH 1I4PA 5M5XB 1MKHA 1Y8PB 4H44C 1QZHA 2M9VA 3K5OA 4RKBA 4A93H 1E0BA 1SNCA 3KBGA 2NB0A 3BYTB 1KXLA 3IL8A 1HUNA 3OW2A 3RUZA 1HXYD 3MXUA 4A3EG 3MEHA 4BY7G 3I4MB 1EWHA 2VW9A 4JOIA 1Y1VB 2PNRC 1W2BA 1XXGA 5NUCA 1SNQA 1TY2A 5EBCA 4ME3A 3PO2B 1S5ED 4LFBL 3MC0B 3VR6A 4POGA 4A3IG 3I4NH 1EY7A 1IHZA 1CM9A 1BCPD 3M3YB 3F2DA 3U9SA 4C3IG 2FHTA 4J8QA 2N78A 5DNFA 1HNXQ 3STBC 3K0YA 4A3DG 3Q0AA 1JOOA 4HEDA 4GN4B 3BVGA 2F0MA 3AFPA 2KHJA 4GN3B 3IRBA 4ZUJA 1NJIC 3J7AV 4KJOA 5HGQA 5JEAJ 4KKSA 4IUUA 2XNAC 1A3UA 1UE6A 5A2QE 1CHQD 1B53A 1KAAA 1MD2D 3I3CA 4V190 1XNQL 1GKHA 1MI2A 1RCVD 2XIWA 2WAQG 3M9BA 1D5MC 3H0GG 2UUCQ 1QNUA 2NUCA 2ENBA 1YJ9A 2EJFC 2SNMA 5C44H 3PF5A 1CI3M 3CAMA 3PIP3 4NKLA 1ESRA 1MJEA 3S1RB 4X62L 5K5PA 2AWOA 5FO7B 1Z7TA 1F2YA 1YI2A 2WP8J 1FNWA 3PF4A 1SYBA 1LTAD 1UE5A 1VQFA 4IN3A 4OHJA 3CC2A 1WD0A 4JBMA 1LLRD 2KA7A 1PH4A 2JEAI 4PMCA 1QWYA 1PH1A 4CGYB 3D0FA 4DV3L 2UXBQ 2K01A 1DXMA 5IGBA 2YU9H 4JW0A 4DR4Q 1HUMA 4HSPA 4IJHA 3FDTA 1F2ZA 4C1NI 2IPKD 5IP7H 2QEXA 4BA2I 5C5MA 4OXPA 1QG7A 4A3DB 4TSSA 4X6AH 1SFOH 1XPUA 1VQOA 1V1OA 4JI1L 1DOKA 4A3KB 4X65L 1HHVA 4DR4L 2NBFA 3I56A 1KNEA 4UPAA 1L2FA 2WFWA 2JYOA 2A68D 1I6VC 3TMEA 2D0OA 2A6EC 3HOXG 1IBKQ 1TWHB 2F0IA 5KNCA 4IUNA 4K5XA 1MIUA 4DXFA 3NUCA 3K7AH 2RDGA 3HKZG 1RHPA 3A56A 4N9PA 5GQOA 4YIJA 1B8AA 1BBWA 1NAPA 4DV5L 4IJLA 3PIO3 4AYBE 1I50H 1HA5A 2EXZA 1CZWA 2NVYB 3K6OA 4QJFA 4ZQ3A 4A3MH 2L11A 3ONAB 1J8IA 5M3MH 4RMFA 3TRZA 1YNNC 1EY4A 1BCPF 2CW0D 2EYFA 3VYUA 2R92H 4DV4Q 3GTJH 1RTOA 5T1GA 4CKEA 3PO3H 2KBNA 2JP1A 3NWSA 4XIGS 2Z0SA 4DFAA 2ASBA 1EYCA 5FJ8G 2BE5D 4HJAA 3S14B 4LW1A 3C3LA 1DZ1A 4J15A 1SNDA 2A69C 1C0AA 3D6CA 1FNUA 4DV4L 1GO3E 1VQ4A 3HOYB 5IT9L 2ZJQA 1PA6A 5M5XH 1FL0A 4C2MH 1KRSA 1Q46A 1SYCA 5KIXA 1VQLA 4LAAA 5EKKA 1Y1WB 1EY9A 2F0PA 1I4RA 1ZYRC 1G51A 3N6RA 3RLFA 3DEOA 2E74C 2RF4A 2QW7A 2J4XA 1HZBA 4MN3A 2UXCQ 2K04A 1XMQQ 3HOZG 3T1HQ 5D65A 3UI2A 3I4MH 2F4VQ 5JVG3 4KV6A 2XRSD 4RG1A 1JMCA 3G4SA 4YWMA 3JC66 2ID0A 4KD4A 2CH4W 3NENA 1EYGA 1R4PB 3D4WA 3PO2H 3ERSX 5IYDG 2MP1A 4K2KA 4C3HG 1E24A 1STGA 1XMQL 1S72A 2EQSA 4L6TB 1EWCA 1E7ZA 4JV5Q 3J81i 2ALYB 3M3YH 1SDFA 2JJQA 4ZCKA 4GOPB 4KLKA 3WDNA 3RN2A 4X66L 1STHA 1KLGD 1D2BA 3JAML 1Q81C 4JI7L 1Q8IA 1SN8A 3I2ZA 3M4OB 1AP0A 1D5XC 3ULJA 1YITA 3BDCA 3RZOH 4JV5L 1QZGA 2LS01 4OL7A 4LUOA 2ZXOA 2B2TA 4EQOA 5BN5A 1UNSA 1JWMD 3AU7A 4YY3Q 5IYBH 3BJUA 2CQAA 1JORA 1UE1A 2UU9Q 1KLUD 2R93G 3GTPB 1BKBA 2RQXA 4L8JA 3HP3A 2MJ8A 3U50C 3V96A 3CHBD 3CCQA 1RF2D 3J80c 3I90A 4DR2L 3PUZA 1F9QA 5JVH3 1TKWB 5GADC 1GHJA 3I7FA 2HDLA 1ASYA 4A93G 1NMGA 1SNMA 3CC7A 4GKKQ 1CA5A 4DUYQ 2BH8A 4H13C 1N9WA 1N32Q 2PW5A 1EEID 1CKNB 1XTCD 5JAVA 2G9DA 2N8NA 1B2TA 2PQEA 5CR3A 1QCBD 2Y0SG 4N9TA 1YHBA 5M5YH 2GN5A 2K4KA 3J81E 2DY8A 2RBMA 4FF4A 4CJ0B 3W2DA 1EU3A 2HHHQ 1D1IA 2DNCA 4R4IA 4HCSA 2WINB 3H3VC 3SGIA 4WFN3 2K6AA 1VQ8A 3S1NB 4GLAC 2JEBI 2L0CA 1RTNA 4X3TA 1ENFA 4H02A 2Z6KA 4EVOA 4O1NA 4ULLA 1LYLA 4JI2Q 1GOZA 2PI2E 3UDXA 1NSNS 2FFKB 1LTSD 2NTTA 4IQZA 4OX9Q 4JC0A 3TP7A 1KDCA 1LACA 1A63A 1A62A 5C0XJ 3CCLA 3MVVA 3S1QB 4KMUC 3GDEA 2JSOA 3GTOB 3NQTA 3PMFA 1KNAA 2N3SA 5M9OA 2RCFA 2A73B 2R7FA 1WD1A 1FGUA 2VY3A 4A93B 4DNIA 1GM5A 2MPMA 2BOSA 2LKVA 2KCMA 2NVYH 1CA6A 4GNXA 1LV9A 5C44G 4XQJA 2OCEA 4JYAQ 2F4IA 4MTNA 1O7IA 1N34Q 1SE3A 1TS4A 3EQLC 1STEA 1B1ZA 1YNND 1HNWL 1GUOA 4KKTA 1NR2A 1M4VA 1H9JA 1YEZA 4L5RC 3NHHA 5CBAE 4HIKA 4LF4L 2X6LA 3S14H 1LM0A 4JYAL 4B3MQ 1BCPC 3I4NB 2XSCA 5TSSA 3QB3A 3TQYA 4LF7Q 5IWAL 2SEBD 1X3GA 1LUZA 3HOYH 3BVMA 4K6DA 5CV4A 5CMDA 1Y1WH 4APVA 1VQEA 3KF6B
chains in the Genus database with same CATH topology
3SHLA 1G6ZA 1PZID 4XQNA 4G4KA 3M7NA 2RSNA 1S5DD 4J6HA 1EL0A 1HQMC 2F0GA 4HCEA 4IFDJ 1MBYA 4FNFA 2ICIA 5CV5A 5T1IA 4R8IA 3C1EA 2WB1B 4RFBA 3BG3A 4OIKA 1CTMA 3R93A 1EU4A 1CK1A 2F0UA 1JWUD 2IX1A 3TZDA 1QILA 2BCOA 2B39A 2QCPX 2A5HA 4RA8A 3HGBA 3GTKB 1TS5A 5I6YA 5ELDA 4XXEA 5KEEA 2KCNA 2TMPA 5FK9C 2LFNA 2CVRA 2YU9B 4K5WA 2IW3A 1AFPA 1ONLA 4RGMA 1ILQA 3ITPA 3A54A 4ODGA 2NWGA 3TP6A 1SAPA 3VA5A 4OO1H 3HG9A 4RAUC 2A68C 3NK9A 4KKUA 3TP8A 3D4RA 2OXPA 4FXGC 2ZT9C 5FKAC 4IALA 1SYDA 1E2ZA 2B63B 1U4RA 3GTMB 2EPBA 2PPBC 1AZPA 2M00A 5KNBA 3K5LA 1G91A 1HRJA 2KJXA 5ISRA 4DAVA 4BS9A 3IFTA 1I50B 1DOLA 4ID6A 5COYA 5M3FB 2OEOA 3TBIB 1PDQA 2CW0C 2B2TC 1H9RA 2B2VA 3MXPA 3A7AB 3NSWA 5LL6X 4FXKC 3GTJB 2K32A 3NPPA 1EFID 2BE5C 4KD3A 3PO3B 4DF7A 1GUNA 4A3FB 2PZUA 3EROA 1BOSA 4XTCS 4F7XA 5ELFA 4ABNA 3SK5A 1X32A 4NMZA 1AEXA 4KN7C 4C2MB 2SNSA 1U9RA 4XQQA 2F0QA 5E3FA 4XYQA 1XYIA 4OGQC 3HRZC 4FF2A 1PTOB 4HSVA 3KBXA 4BY1B 5IT9E 1PZJD 1PYWD 1A3VA 4B9XA 1AZQA 3I91A 3H94A 1AW7A 1BDOA 3DM1A 2J7ZA 2M2LA 3KK7A 1OXUA 2F0EA 1A6XA 1PFNA 3M85A 3PUWA 5IGEA 5C4XB 2FMMA 2SOBA 3PUYA 3A8IE 3Q24A 1LO5D 2F03A 3GTLB 3RZOB 2KHSA 1IW7D 5C0XI 3D3RA 4IUPA 1DD2A 3JAME 2IX3A 1PXUA 5E4WC 1EY5A 5C6AA 5C3XA 5EKIA 1TQOA 4KK7A 3U9OA 2EY6A 2K5QA 5C3EB 5C4ZA 5JPNC 5IIFA 1A2TA 4NW2A 1WTXA 2K5WA 4UDUC 2B8GA 4RKLA 4A3JB 2FINB 1EQVA 1T5XD 1SMYC 1PTOD 5ELEA 5CORA 5JOBA 2EY5A 4QF4A 1SYGA 3QIAA 5EQ0A 1KDBA 4DGZA 2JXMB 5M5YB 4PQXA 2EYMA 4R9WA 1DM0B 2B2WA 4KHZA 4HN7A 2F3WA 4ZK9B 4ZKCB 1WTVA 2NTSA 2WV6D 1TS2A 5C5LA 2D5DA 4NDXA 4DK1A 5EPKA 3X3MA 3L3OC 1VCIA 2QEJC 4IURA 3P75A 2N88A 4IFDI 1STNA 3MTSA 4ILWA 3R3OA 3QWNA 3T56B 2BDOA 1T5EA 2Z8LA 4KTAA 4HTHA 2K5DA 2O5JC 1O78A 2G9HD 5EJWA 3KLRA 1Y8NB 2Q8RE 3I70A 4QIWB 1DJRD 2NN6H 1RD9D 2E75C 2EYOA 5E4XA 5I2YA 1TS3A 3MA2B 3SR1A 5AFWA 1LT4D 5KRUA 4FXDA 2V4DA 5KGUA 5CGKA 4AYBB 3TSSA 1S5CD 1BR9A 2XWBB 2E2IB 2H4OA 1EZ8A 4LK1C 2F0FA 3OPOA 1YNJD 4S3SA 1ESFA 3T53B 3CKIB 5FLXE 3C1FA 4C1NK 4ZRZA 4F87A 3QG1A 1EOTA 4XT1B 3DMUA 3BDOA 3ND9A 4IUTA 4DNTB 3T51B 1SEBD 2F0HA 3ZYYX 1PTOH 1BQQT 4OO1G 3HOUB 1FR3A 1NR4A 2AQ3B 2B8FA 1BO0A 1F9RA 2A6HD 2C5CA 1ET6A 1PTOF 3DEPA 2L1BA 1M8AA 2HQEA 3P7JA 1O7ZA 3TDQA 1QB5D 1ILPA 1SXTA 2B2VC 1EY0A 1PRTB 5CV9A 3PV0A 2JE6I 2DY7A 4LJZC 1O7YA 1HCZA 2ZXRA 2NZ1D 1EYAA 1JICA 4RCNA 2E2DC 2PW7A 3V05A 3S2DB 3QJYA 1KABA 3NE5B 4I65A 2R7ZB 3VR5A 2HUGA 2DNEA 3OIQA 5A2QL 2XN9C 1HTLD 3HOWB 2IT1A 2Z4IA 3F2UA 3C2PA 4QCLA 2HCIA 3I4LA 5CV7A 1X3PA 1SMYD 3HZXA 4KY5A 1Q12A 5EPJA 1F9SA 2AUJD 4CKBA 2F1MA 5F2DA 2KQ3A 2KUMA 3OHXC 1RODA 5KYLA 2RDFA 5C3WA 1V1PB 2RVLA 1WTPA 1PRTD 2EYJA 3QO2A 4O42A 3SEBA 4DAYA 1LT3D 1SSOA 2F0LA 1Z6HA 2JA7B 1A3TA 1RJTA 3HEJA 2B2UA 2HDMA 4X3SA 3P20A 4KI0A 1STAA 3A7LA 1STBA 1FGBD 4FO2A 3QOJA 1UEAB 3SK4A 3AMUA 4RCOA 1SJED 2EJGC 1GJXA 1I4GA 2KCCA 1SBBB 3GO5A 2J0TD 3X3NA 2EY2A 1LTTD 2L5TA 2EYHA 4RHRA 2WKCA 5BN4A 3GQBA 4G7HC 5CYUA 1CFMA 4XYOA 3EA6A 5D3DA 3R2IA 2B2WC 3FKIB 4L63B 1WTRA 1QNKA 3BVZA 5EBDA 5J22A 4EQNA 1XX8A 4RH6A 4HR7B 1G291 2X69A 5CV6A 3BS1A 1IL8A 1GUSA 1GXDC 1DYQA 4DA2A 1BUVT 2F0VA 2I46A 1JC7A 2QILA 1SNOA 3O13A 2GA4B 4RGNA 2PMZB 5I9PA 1IW7C 4C56C 1S5FD 1IYVA 5CC4A 2E2JB 4QB4A 4K2LA 2Q8IB 3SK8A 1D6EC 1JOKA 4X3UA 4QUFA 4KY6A 1LTGD 4UAIA 3I8ZA 3S9WA 2NN6G 1HPCA 1LABA 2D62A 3D6WA 2LMCB 4K5VA 1JOQA 1PTOC 4F8MA 1V8QA 1EEFD 3K57A 1B4OA 3URYA 5M5WB 1PRTF 4IZ8A 3FVQA 4P2CB 1Q3LA 5JEAH 1HTPA 3HOVB 2VUMB 1S4ZA 3KUPA 2QDBA 1G2SA 2AQ2B 1F9PA 4J1MA 2F0KA 1KDAA 4PV1C 1OXSC 3OMCA 1PMRA 1STYA 4FYDA 2MHVA 2O2LD 2RDHA 1VMCA 2VB2X 1V1PA 4MHEA 2D9UA 3NTKA 2JA5B 3J80L 1Y69U 1ENAA 3G7LA 2IX0A 2L55A 1TWFB 3RZDB 1HFGA 3S17B 1DOMA 5IOCA 1X3QA 4E6IA 4ME5A 3R2TA 4DNRB 3J7AF 1TY0A 5DAUA 4Q0FA 2RSOA 5FO9B 5K36H 4ZKBB 3OIPA 4R8NA 1FYCA 1G2TA 2ICEC 1ML0D 1IKLA 2O4XA 5IGDA 2JA6B 1HFNA 3SK6A 3C46A 4IUVA 4K14A 1LTID 1I3QB 1D1KA 3TP5A 1HA6A 2WKDA 1YNJC 4OIJA 1TWAB 4PMBA 1K8MA 3WOEA 4FF1A 1D5ZC 3MXNA 2VXWA 1HQRD 2HCCA 1E2WA 4C3JB 2MUYA 3SVMA 4F88A 4U673 5DM63 1EY6A 3FEWX 3RMHA 2MGSA 5ELCA 1QJOA 2OF1A 5ELBA 1H9KA 4MIUA 4HAEA 1F2MA 2KEDA 4BBRB 2A6HC 4WJWA 1B9MA 2K1BA 5D3IB 2NVTB 4RGTA 5D14A 1Q90A 4A3BB 1I4QA 2Z1CA 5FOBB 4JBWA 5EPLA 1B50A 5I2XA 1IYUA 1LT6D 1WTWA 1H9SA 2L12A 1MSGA 2NYZD 1WCMB 2B2UC 2K28A 4HMIA 1UUPA 1JQYD 4CKCA 4JK1C 2IWHA 1MGSA 5A35A 3K5NA 3S16B 3GTGB 3J7YW 1VF5C 2B2YA 1R4QB 4X3KA 3MFGA 3H09A 2NN6I 3KLSA 1CQFA 1Q1BA 3FPPA 2DN8A 3VR2A 5KNDA 3K58A 4I7ZC 2EE1A 3IKJA 4KY7A 1RKNA 3HS0C 3DHQA 4DK0A 1TVXA 2KOLA 3S2HB 4U68A 1U4LA 1I4HA 1OXXK 1JWSD 3BDLA 5BN3A 1PLFA 3ERQA 5E1FA 1A2UA 2Z4HA 1IKMA 1O7LA 1H9MA 2AQ1B 3OWEB 3WOFA 3TZUA 4IUQA 2AWNA 1FD7D 4DAPA 1PRTC 4XT3B 4K6LA 4B08A 4BA1I 4A3EB 1II3A 1QOHA 2ZXPA 4BY7B 4WRDA 3L9AX 3ND8A 4NP5A 3GP7A 4DN4M 1UAPA 3T16A 4ZLTF 4PMWA 5LHY1 3VA7A 2XVSA 3VYRA 2XWJB 4BWGB 4A3IB 5C4JB 3NQIA 3D4DA 4C3IB 2EOTA 1MSHA 4M1UB 2PYKA 5CV8A 3MWYW 4LMQD 1EZ6A 5KYIA 1EY8A 1Y8OB 3IFDA 1VDZA 1NUCA 5LL6S 2L9HA 3IAYA 3S15B 1GUGA 1TWGB 2H1EA 5I6WA 3OW7A 2EVBA 2TSSA 1GUTA 1WVLA 1WTQA 2O5IC 5JEAG 2KEEA 2WAQB 1C8CA 1TWCB 3H0GB 2F0SA 4V0BA 5C0XH 1NCVA 1U4MA 5IODA 3VR4A 3LNNA 4M8AA 2F0WA 4CHTB 3V2TA 3D8GA 3QOLA 2PZTA 3BYYB 1EYDA 2F0JA 1VF7A 2VB3X 4G7OC 4DU9A 2F0OA 3VR3A 3DXJC 1J9OA 2BA0A 2I07B 5JPMC 4ZAIA 1JB3A 1TR5A 2R3ZA 2PCFB 1EIHA 1PZKD 1BBXC 3Q23A 1JCKB 5K36G 3FPUB 5CBEE 3E5SA 2RKSA 2BDNA 1SE2A 3H91A 3HOXB 1CQVA 1G8ZD 1EIGA 1I6HB 4FVMA 3HKZB 4RWSC 4IFDH 5C4HA 5IGCA 4Q5VA 3A8KE 1XWEA 1F77A 3VYTA 2X6GA 1C4QA 4CJ1B 4KN4C 3NTIA 3CRKC 1L0YB 4QUCA 3H6MA 4XDXA 1B44D 4G57A 2IJ0A 4EQPA 4EGVA 2QKIC 3MHBA 5HGTA 5DEHA 2EY1A 3VYSA 3CQZB 2N55A 1FNVA 3PUVA 3P1HA 2L4NA 3LWUA 4KHVA 1SNPA 4QMGA 3NXWA 2EYPA 3M4YA 3W3AA 3GTQB 3J80E 2KECA 2R61A 1W6JA 5EGTA 1OXVA 4Z9CB 3SXHA 4ZUIA 2EJMA 1TIID 3HOZB 2B2YC 4Y7NB 3NP8A 1GUWA 2K05A 3OOCA 2WACA 2CHBD 3NTHA 5G3LD 3OMGA 1SYFA 3FRPB 2NVQB 4C3HB 2K7VA 2BA1A 2F0TA 3EVQA 3NWTA 2C9OA 3DUZA 4ZYSA 5JJZA 1RDPD 3E6ZX 4K8IA 2OT2A 3TN2A 1LTBD 3D31A 5IGGA 1B9NA 1K83B 2F0NA 4K8JA 3K5MA 2A6ED 2R93B 4CJ2C 4HMJA 2Q8TA 3T4AC 3AB9A 3GV3A 5IGFA 3EFXD 3M7GA 2PO4A 3I72A 2FJ2A 4FF3A 5FLXL 4OO1I 2F0DA 2WIIB 4KJNA 3GV6A 3L7ZC 5DM73 1EQTA 1AN8A 3NBIA 2D2CC 1QE6A 1K8OA 2Y0SB 1F2LA 4CBVA 1SE4A 2EZVA 5J39A 2E2HB 5I4DA 4G7ZC 3I73A 1ZXTA 1ICWA 1BNZA 1S5BD 2A69D 1LTRD 1B3AA 3NBHA 1W6KA 2FMCA 2PZWA 1H9SB 1OO9B 3KF8A 2KVMA 1ZYRD 2RA4A 1E2VA 1KTKA 4H7BA 4GZYC 1O80A 5J1ZA 1DONA 1Z47A 4RHSA 2AUKA 3DWPA 2XRQD 1PFBA 1SJHD 1PFMA 1ZKOA 2EDGA 5G3LF 2EYLA 2YYZA 5FO8B 1OXTA 5C0XG 1C48A 3G6JB 1TT2A 2QF7A 5C44B 2NVXB 3Q6SA 4C3JG 1JR0D 4FP5D 3Q22A 1DCZA 3MFYA 3MAQA 4B9WA 3A55A 2E76C 3DWQA 1CT1D 2F3VA 3DWAA 1U4PA 1R9TB 1V43A 3S1MB 3R8BA 3A8JE 3T13A 3CU7A 2IL8A 1WTOA 3GD7A 1GHKA 2VNUD 1L0XB 2LY7A 3LWEA 1SFOB 1JE4A 4WORA 5HURA 1CZGA 1ET9A 3N52A 3J81L 4TRDA 4DXGA 1SYEA 3FMCA 2JA8B 4PNYA 3MXGA 3PUXA 4BBSB 4A3GB 1Q1EA 3K7AB 4IFDG 3SE0A 2SDFA 3LX0A 1LT5D 5I9OA 2K33A 1A15A 3E0JA 1TU2B 3OWFA 1BCPB 3BZDB 4A3MB 2A74C 5M3MB 1ENCA 4TQUS 3MZ5A 1CHPD 1BXTA 2R92B 3SDZA 3RD4A 4RGOS 1VMPA 3EJIA 3OSOA 4TKOB 5EKLA 3K59A 2R6GA 2K03A 1ZEQX 1BF4A 4H0LC 3KLSX 3CRLC 1I4PA 5M5XB 1Y8PB 4H44C 2M9VA 3K5OA 4RKBA 1E0BA 1SNCA 3KBGA 2NB0A 3BYTB 3IL8A 1HUNA 3RUZA 1HXYD 3MXUA 3MEHA 3I4MB 1EWHA 1Y1VB 2PNRC 1XXGA 5NUCA 1SNQA 1TY2A 5EBCA 3PO2B 1S5ED 3MC0B 3VR6A 1EY7A 1IHZA 1CM9A 1BCPD 3M3YB 3U9SA 4C3IG 2FHTA 4J8QA 5DNFA 3K0YA 3Q0AA 1JOOA 4HEDA 3BVGA 2F0MA 4ZUJA 3J7AV 4KJOA 5JEAJ 4KKSA 4IUUA 2XNAC 1A3UA 5A2QE 1CHQD 1B53A 1KAAA 1MD2D 3I3CA 4V190 1MI2A 1RCVD 2XIWA 1D5MC 1QNUA 2NUCA 2ENBA 2EJFC 2SNMA 1CI3M 3PIP3 4NKLA 1ESRA 3S1RB 5K5PA 2AWOA 5FO7B 1Z7TA 1F2YA 2WP8J 1FNWA 1SYBA 1LTAD 4IN3A 4OHJA 1WD0A 1LLRD 2KA7A 2JEAI 4PMCA 1QWYA 4CGYB 2K01A 1DXMA 5IGBA 1HUMA 4HSPA 3FDTA 1F2ZA 4C1NI 2IPKD 4BA2I 5C5MA 1QG7A 4A3DB 4TSSA 1V1OA 1DOKA 4A3KB 1HHVA 2NBFA 1KNEA 2JYOA 2A68D 1I6VC 3TMEA 2A6EC 1TWHB 2F0IA 5KNCA 4IUNA 4K5XA 4DXFA 3NUCA 2RDGA 1RHPA 3A56A 4N9PA 4YIJA 1NAPA 3PIO3 1HA5A 2EXZA 1CZWA 2NVYB 3K6OA 4ZQ3A 2L11A 3ONAB 1J8IA 1YNNC 1EY4A 1BCPF 2CW0D 2EYFA 3VYUA 1RTOA 5T1GA 4CKEA 4XIGS 2JP1A 3NWSA 4DFAA 1EYCA 2BE5D 3S14B 3C3LA 1DZ1A 1SNDA 2A69C 3D6CA 1FNUA 3HOYB 5IT9L 1SYCA 5KIXA 4LAAA 5EKKA 1Y1WB 1EY9A 2F0PA 1I4RA 1ZYRC 3N6RA 3RLFA 3DEOA 2E74C 2J4XA 4MN3A 2K04A 5D65A 3UI2A 5JVG3 4KV6A 2XRSD 2ID0A 4KD4A 1R4PB 3D4WA 2MP1A 4K2KA 4C3HG 1STGA 4L6TB 1EWCA 1SDFA 3WDNA 1STHA 1KLGD 1D2BA 3JAML 1Q8IA 3M4OB 1AP0A 1D5XC 3BDCA 2LS01 4OL7A 2ZXOA 2B2TA 4EQOA 5BN5A 1UNSA 1JWMD 3AU7A 2CQAA 1JORA 1KLUD 3GTPB 2RQXA 4L8JA 3HP3A 2MJ8A 3V96A 3CHBD 1RF2D 3I90A 3PUZA 1F9QA 5JVH3 1TKWB 1GHJA 2HDLA 1SNMA 1CA5A 4H13C 2PW5A 1EEID 1XTCD 5JAVA 2G9DA 1B2TA 2PQEA 5CR3A 1QCBD 4N9TA 3J81E 2DY8A 2RBMA 4FF4A 4CJ0B 3W2DA 1EU3A 1D1IA 2DNCA 4HCSA 2WINB 3H3VC 4WFN3 2K6AA 3S1NB 2JEBI 2L0CA 1RTNA 4X3TA 1ENFA 4EVOA 4O1NA 4ULLA 1GOZA 1NSNS 2FFKB 1LTSD 2NTTA 4IQZA 3TP7A 1KDCA 1LACA 5C0XJ 3MVVA 3S1QB 4KMUC 2JSOA 3GTOB 3NQTA 3PMFA 1KNAA 5M9OA 1WD1A 2A73B 4A93B 2MPMA 2BOSA 2LKVA 1CA6A 1LV9A 4XQJA 2F4IA 1SE3A 1TS4A 3EQLC 1STEA 1B1ZA 1YNND 1GUOA 4KKTA 1NR2A 1M4VA 1H9JA 3NHHA 5CBAE 2X6LA 1BCPC 3I4NB 2XSCA 5TSSA 3QB3A 2SEBD 3BVMA 4K6DA 5CV4A 5CMDA 1I4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQB A;  2PPB C;  4G7H C;  2DNE A;  2A69 C;  1CFM A;  2EJF C;  5KNB A;  1IYU A;  2EDG A;  1CI3 M;  1ZKO A;  1H9S A;  3VR5 A;  1IW7 D;  3M7N A;  2YYZ A;  4TKO B;  2V4D A;  2IT1 A;  1DD2 A;  3IFT A;  1OXT A;  5C0X G;  2R6G A;  1ZYR C;  4JK1 C;  2AWO A;  2QF7 A;  1Y69 U;  4IFD H;  1Z7T A;  3D31 A;  3N6R A;  1HQM C;  4H0L C;  4HR7 B;  1G29 1;  3RLF A;  3CRL C;  4LK1 C;  2CW0 C;  3A8K E;  5A35 A;  3OPO A;  2E74 C;  1B9N A;  1DCZ A;  1H9R A;  1Y8O B;  1Y8P B;  3A7A B;  1GUS A;  4KN4 C;  3MFY A;  4H44 C;  3I4L A;  2A6E D;  3CRK C;  3T53 B;  4DNR B;  2KA7 A;  1VF5 C;  2JEA I;  3BG3 A;  1VDZ A;  1CTM A;  2B8G A;  2DNC A;  2K32 A;  2E76 C;  2BE5 C;  1Q12 A;  1DXM A;  2NN6 I;  1Q1B A;  3FPP A;  1GUG A;  1SMY C;  3QG1 A;  1GUN A;  2AUJ D;  5K36 H;  2JEB I;  2DN8 A;  3MXU A;  3VR2 A;  2F1M A;  3AB9 A;  3BDO A;  5KND A;  1V43 A;  4XTC S;  3OW7 A;  1FYC A;  3ND9 A;  2EVB A;  1GUT A;  2O5I C;  4I7Z C;  3IKJ A;  5JEA G;  1IW7 C;  4BA2 I;  1EWH A;  3A8J E;  1IYV A;  4DNT B;  4KN7 C;  3T51 B;  4DK0 A;  2PNR C;  3I72 A;  3QIA A;  2Q8I B;  4IQZ A;  5C0X H;  3GD7 A;  4OO1 G;  1GHK A;  3PUV A;  2JXM B;  1LAC A;  1YNJ C;  3L7Z C;  3VR6 A;  1FR3 A;  3LWU A;  3VR4 A;  3WDN A;  2B8F A;  4OGQ C;  2A6H D;  1K8M A;  1I6V C;  1Z6H A;  2A68 D;  2D2C C;  3LNN A;  2A6E C;  4KHZ A;  3HGB A;  4KMU C;  1OXX K;  1K8O A;  2NN6 G;  1HPC A;  1LAB A;  3M4Y A;  3W3A A;  3U9S A;  5KNC A;  2D62 A;  5BN3 A;  1E2W A;  2LMC B;  3FMC A;  4G7Z C;  1V8Q A;  3I73 A;  3P20 A;  1VF7 A;  1OXV A;  4KI0 A;  3H94 A;  2D5D A;  4DK1 A;  1O7L A;  1H9M A;  2A69 D;  3A7L A;  3PUX A;  1BDO A;  2EJM A;  5BN5 A;  4G7O C;  1VCI A;  3VR3 A;  3PV0 A;  1Q1E A;  3DXJ C;  3TZU A;  2JE6 I;  3EQL C;  4LJZ C;  1OXU A;  5JEA H;  1HTP A;  1QJO A;  1ONL A;  2BA0 A;  4IFD G;  3SE0 A;  1H9S B;  1HCZ A;  2BDO A;  3OOC A;  3T56 B;  1A6X A;  4L8J A;  1H9K A;  1T5E A;  1GUO A;  4KKS A;  2K33 A;  4KKT A;  1YNN C;  1TU2 B;  1H9J A;  4BA1 I;  3M85 A;  2EJG C;  1GJX A;  1E2V A;  4OO1 H;  3PUZ A;  2O5J C;  2A6H C;  2A68 C;  3PUW A;  1TKW B;  1GHJ A;  1B9M A;  1O78 A;  2K7V A;  2PCF B;  3KLR A;  4KKU A;  3D4R A;  3ND8 A;  1Y8N B;  2BA1 A;  2KCC A;  3PUY A;  4PV1 C;  4GZY C;  4RCN A;  3A8I E;  4XIG S;  1OXS C;  2ZT9 C;  1Q90 A;  4TQU S;  2NN6 H;  2AUK A;  3VA7 A;  5K36 G;  2BE5 D;  2L5T A;  4H13 C;  3SDZ A;  1PMR A;  3QJY A;  3NE5 B;  1E2Z A;  4JBW A;  2E75 C;  5BN4 A; 
#chains in the Genus database with same CATH topology
 3SHL A;  2CWP A;  5IP7 G;  5BR8 Q;  1G6Z A;  4GOP A;  1PZI D;  4GS3 A;  4XQN A;  4G4K A;  3M7N A;  4UP8 A;  1PH5 A;  2RSN A;  1S5D D;  1EWI A;  1L1O B;  4J6H A;  1FJG Q;  2ATW A;  1EL0 A;  1HQM C;  2F0G A;  4R4Q A;  4HCE A;  2C35 B;  4IFD J;  1MBY A;  1IBL Q;  1VQ7 A;  2JA8 G;  4FNF A;  2ICI A;  5CV5 A;  5T1I A;  4R8I A;  3C1E A;  4DR7 Q;  4BBS G;  2WB1 B;  1BBU A;  3BG3 A;  4OIK A;  1CTM A;  4RFB A;  3R93 A;  3NEL A;  4A3G G;  1FJG L;  1BVS A;  1K8A C;  1EU4 A;  1CK1 A;  1SRU A;  3J81 j;  2F0U A;  1JWU D;  3PIP A;  2IX1 A;  2ZM6 Q;  3TZD A;  4A3M G;  1VQP A;  2CKZ B;  1QIL A;  2BCO A;  2B39 A;  5M3M G;  3M4O H;  2QCP X;  1XTD A;  2R92 G;  4CDC C;  3TS2 A;  2A5H A;  4KHP L;  4POF A;  4RA8 A;  4A75 A;  1HZ9 A;  3HGB A;  2ZM6 L;  5LMN W;  3GTK B;  1CKN A;  1TS5 A;  2K50 A;  3CW2 C;  3W1B A;  4DPG A;  5I6Y A;  1C9O A;  5ELD A;  4XXE A;  5KEE A;  2B29 A;  2KCN A;  2VZA A;  2TMP A;  1EQR A;  5FK9 C;  2LFN A;  2CVR A;  2YU9 B;  1B7Y B;  3GTP H;  4K5W A;  2IW3 A;  1AFP A;  1JE5 A;  1XMO L;  3HOW H;  4DV6 L;  3ULL A;  1ONL A;  4RGM A;  1PH6 A;  1VQK A;  1ILQ A;  3ITP A;  3A54 A;  2Q2I A;  4ODG A;  2NWG A;  4QGU A;  3TP6 A;  1PYB A;  5FLM H;  1SAP A;  3VA5 A;  4JPB W;  1VQ6 A;  2D0P A;  1XPR A;  4OO1 H;  3HG9 A;  4RAU C;  1EFW A;  2A68 C;  4PZ8 A;  1YBY A;  3NK9 A;  4KKU A;  4IPD A;  3D4R A;  3TP8 A;  5GRO A;  2OXP A;  1CSQ A;  3I4M G;  4FXG C;  2ZT9 C;  4X64 L;  5FKA C;  4IAL A;  1SYD A;  3A5U A;  1Y1V G;  2F52 A;  2NZO A;  3QR8 A;  1E2Z A;  2B63 B;  1I5F A;  1U4R A;  4AQY Q;  3GTM B;  2EPB A;  2Q2U A;  1AZP A;  2PPB C;  2M00 A;  4B3S Q;  3PO2 G;  5KNB A;  3PIO A;  3K5L A;  4DV7 Q;  3LGJ A;  2OQK A;  1G91 A;  1HRJ A;  2KJX A;  2UUB Q;  5ISR A;  4LNQ A;  3ER0 A;  2PI2 A;  4DAV A;  3OTO L;  1CSP A;  4BS9 A;  3IFT A;  1V9P A;  1V1Q A;  1VQN A;  1I50 B;  1DOL A;  3Q8D A;  4ID6 A;  5COY A;  5M3F B;  2OEO A;  3TBI B;  1PDQ A;  2CW0 C;  4AQY L;  2B2T C;  1I94 Q;  1H9R A;  2B2V A;  3MXP A;  3A7A B;  3S1N H;  3CXC A;  3NSW A;  5LL6 X;  2UUB L;  4FXK C;  3GTJ B;  2K32 A;  3NPP A;  1K3R A;  1EFI D;  2BE5 C;  4KD3 A;  3F2C A;  3PO3 B;  4DF7 A;  1GUN A;  4A3F B;  2PZU A;  2AMC B;  3ERO A;  1BOS A;  5HY6 A;  5IYB G;  4XTC S;  4F7X A;  1I94 L;  5ELF A;  4DV0 L;  4ABN A;  3SK5 A;  3JAM i;  1X32 A;  4NMZ A;  1OTC A;  1AEX A;  4KN7 C;  4C2M B;  2SNS A;  3AFQ A;  1U9R A;  4LUV A;  4XQQ A;  3GTO H;  2F0Q A;  5E3F A;  3W5O A;  4XYQ A;  4CDE C;  1IZ6 A;  1XYI A;  4OGQ C;  1CKM A;  3U58 A;  3HRZ C;  3KF6 A;  4FF2 A;  1PTO B;  2IHE A;  4LFB Q;  4YCV A;  4HSV A;  3KBX A;  3E9H A;  4BY1 B;  5IT9 E;  1PZJ D;  1PYW D;  1A3V A;  4B9X A;  1AZQ A;  3I91 A;  1L1O A;  3CC4 A;  3H94 A;  3F2B A;  1AW7 A;  1BDO A;  4OEM B;  3DM1 A;  2J7Z A;  2M2L A;  3KK7 A;  4YWL A;  1OXU A;  1YIJ A;  2F0E A;  1A6X A;  3CCV A;  1PFN A;  5IYC H;  3M85 A;  3PUW A;  5IGE A;  2Z6K C;  5C4X B;  2JK8 A;  4DR1 L;  2FMM A;  2SOB A;  3PUY A;  4DV1 L;  3A8I E;  1U0L A;  3Q24 A;  1LO5 D;  2F03 A;  3KJP A;  1L0W A;  3GTL B;  3M4Q A;  2OTJ A;  3ICE A;  3RZO B;  4A3K G;  1XNQ Q;  3DM3 A;  2FXQ A;  1YJW A;  4DK6 C;  2KHS A;  2E2J H;  1IW7 D;  5C0X I;  1NY4 A;  3D3R A;  4IUP A;  1VQH A;  1DD2 A;  3JAM E;  4NXN L;  2IX3 A;  1PXU A;  5E4W C;  2BH2 A;  2UUA L;  1PVO A;  1EY5 A;  4N8X 1;  4GNX C;  5C6A A;  4B3T L;  5IE8 A;  5EKI A;  3U9O A;  1TQO A;  4KK7 A;  5C3X A;  1E1T A;  4X62 Q;  1CUK A;  2EY6 A;  2K5Q A;  5C3E B;  1YVC A;  4AIM A;  5C4Z A;  3MEF A;  2R7D A;  5JPN C;  5IIF A;  1A2T A;  4NW2 A;  1WTX A;  4IOA A;  2DJF C;  2K5W A;  4UDU C;  2B8G A;  4RKL A;  4A3J B;  2FIN B;  1EQV A;  3CCS A;  1T5X D;  1SMY C;  1PTO D;  1SLJ A;  2QDL A;  4LWC A;  3RNU A;  3L2P A;  1X3F A;  3CF5 A;  5ELE A;  4DV3 Q;  5COR A;  2I5L X;  3H3V H;  5JOB A;  2EY5 A;  4QF4 A;  1SYG A;  3QIA A;  5EQ0 A;  3GTK H;  1KDB A;  2UXD Q;  4DGZ A;  4L5Q A;  2JXM B;  4MNO A;  4PZ6 A;  5M5Y B;  4PQX A;  2EYM A;  3PSI A;  4R9W A;  1DM0 B;  2B2W A;  4KHZ A;  4JI1 Q;  4GOP C;  1C7Y A;  4X65 Q;  1FVI A;  4HN7 A;  3HOY G;  2F3W A;  2A8V A;  4ZK9 B;  1Y1W G;  4ZKC B;  1WTV A;  2UXD L;  2NTS A;  2WV6 D;  1J5E L;  1TS2 A;  5C5L A;  2D5D A;  4NDX A;  4DK1 A;  5EPK A;  3X3M A;  5AJ3 L;  1AE3 A;  3L3O C;  1VCI A;  2QEJ C;  4B3R L;  4IUR A;  1LTL A;  3P75 A;  2N88 A;  4IFD I;  1STN A;  3MTS A;  4ILW A;  3R3O A;  1SR3 A;  3QWN A;  3T56 B;  2BDO A;  4DV5 Q;  1T5E A;  3RZD H;  3K8A A;  2Z8L A;  4KTA A;  4QIW E;  4HTH A;  2K5D A;  2O5J C;  3J7A 5;  1O78 A;  2G9H D;  5EJW A;  3KLR A;  2B63 H;  1VQG A;  3GTM H;  1Y8N B;  2Q8R E;  1NE3 A;  3I70 A;  3NEM A;  4L5S A;  4QIW B;  2ZTD A;  1DJR D;  1A8V A;  4LF5 L;  5LMN Q;  1WI5 A;  2NN6 H;  1RD9 D;  2E75 C;  2EYO A;  5E4X A;  5I2Y A;  2B3G A;  1TS3 A;  2PQA B;  3AEV A;  2IHF A;  2JA6 H;  5M3F H;  3MA2 B;  1NTG A;  3SR1 A;  4P73 A;  5AFW A;  1LT4 D;  5KRU A;  4FXD A;  4DAM A;  2CWA A;  2V4D A;  4AYB B;  5CGK A;  5KGU A;  4GN5 A;  3H15 A;  3TSS A;  1ASZ A;  5LMN L;  1S5C D;  1BR9 A;  1X54 A;  2XWB B;  4OON A;  2H4O A;  1EZ8 A;  4LK1 C;  2E2I B;  2F0F A;  3OPO A;  1YNJ D;  1E22 A;  4S3S A;  4A3F H;  1ESF A;  3T53 B;  3CKI B;  4C3J H;  3S24 A;  5FLX E;  3C1F A;  4C1N K;  4ZRZ A;  4F87 A;  3UE0 A;  5IY0 A;  3QG1 A;  1EOT A;  1YHA A;  4XT1 B;  3DMU A;  3G6E A;  3BDO A;  4GNX B;  2JQO A;  3CCJ A;  3ND9 A;  2KHI A;  4IUT A;  4DNT B;  3T51 B;  4DR5 L;  1SEB D;  5FLM G;  2F0H A;  2A1A A;  3ZYY X;  1PTO H;  1BQQ T;  4OO1 G;  3HOU B;  4BY1 H;  1FR3 A;  1NR4 A;  2AQ3 B;  2B8F A;  2DUD A;  1BO0 A;  1F9R A;  2A6H D;  1CKO A;  1VS0 A;  2NVT H;  4WJ3 M;  3A0J A;  2C5C A;  4A3B H;  1ET6 A;  1PTO F;  1PH8 A;  3DEP A;  4X66 Q;  2L1B A;  1M8A A;  2HQE A;  2OQ0 A;  3P7J A;  4JI7 Q;  4JI3 Q;  1O7Z A;  3TDQ A;  1QB5 D;  4R1J A;  1ILP A;  1SXT A;  3PGZ A;  2B2V C;  1EY0 A;  1EIY B;  1PRT B;  5CV9 A;  2K75 A;  3PV0 A;  2JE6 I;  2DY7 A;  4LJZ C;  3HKZ E;  1O7Y A;  5C4X H;  1AE2 A;  1HCZ A;  2MNA A;  2ZXR A;  4JI3 L;  2NZ1 D;  1EYA A;  3GTL H;  1JIC A;  4MZ9 A;  1EUJ A;  4RCN A;  2E2D C;  1IBM L;  4DR2 Q;  2PW7 A;  4UP7 A;  3V05 A;  4ALP A;  3S2D B;  3QJY A;  1KAB A;  3NE5 B;  1K9M C;  1I4X A;  4I65 A;  2R7Z B;  3VR5 A;  1SMX A;  2HUG A;  3RLN A;  2DNE A;  3OIQ A;  5A2Q L;  2XN9 C;  4P74 A;  2HQL A;  1HTL D;  2MO0 A;  3HOW B;  5C3E H;  2IT1 A;  2Z4I A;  3F2U A;  3C2P A;  4A3J H;  4NXM L;  1L1O C;  3S2H H;  4QCL A;  1HNZ L;  4DUZ L;  2HCI A;  3I4L A;  5CV7 A;  5IP9 H;  1X3P A;  1SMY D;  3HZX A;  4KY5 A;  1Q12 A;  5EPJ A;  1F9S A;  2AUJ D;  4CKB A;  1E3P A;  3CCR A;  4I7A A;  2F1M A;  5F2D A;  4LF6 L;  3J81 c;  2KQ3 A;  3EBE A;  4P75 A;  4EX5 A;  2KUM A;  2LXJ A;  3OHX C;  1NNX A;  1ROD A;  5KYL A;  3I4N G;  2RDF A;  5C3W A;  1V1P B;  2RVL A;  1WTP A;  5IYC G;  1PRT D;  2EYJ A;  1VQC A;  4A3E H;  3QO2 A;  4O42 A;  3SEB A;  3KOJ A;  4DAY A;  1LT3 D;  3J7Z C;  1SSO A;  2F0L A;  1Z6H A;  2JA7 B;  1A3T A;  2PQA A;  1RJT A;  4TVA B;  3HEJ A;  2B2U A;  1JJC B;  5C4J H;  2HDM A;  4X3S A;  5GAG C;  3P20 A;  1QVC A;  4KI0 A;  1E1O A;  1STA A;  3A7L A;  4LFA L;  4NB3 A;  1STB A;  1FGB D;  4FO2 A;  3QOJ A;  1JJ2 A;  2WB1 G;  1UEA B;  3SK4 A;  4UP9 A;  3AMU A;  4RCO A;  1SJE D;  2EJG C;  1GJX A;  5J3B A;  4HIO A;  1I4G A;  1HNW Q;  2CFM A;  2KCC A;  1SBB B;  3GO5 A;  1JB7 A;  4LF4 Q;  2J0T D;  3X3N A;  2EY2 A;  1LTT D;  1TWG H;  2L5T A;  2EYH A;  4RHR A;  2WKC A;  1PFS A;  5BN4 A;  3GQB A;  4G7H C;  5CYU A;  1CFM A;  4XYO A;  5IWA Q;  3EA6 A;  5D3D A;  3R2I A;  2B2W C;  3CPW A;  2E2I H;  4A3C H;  3FKI B;  2A19 A;  2LSS A;  1TWC H;  4L63 B;  1WTR A;  1QNK A;  3BVZ A;  4DR3 Q;  5EBD A;  5J22 A;  4EQN A;  1XX8 A;  5GAH C;  3TRE A;  4RH6 A;  4HR7 B;  1G29 1;  4FDB A;  2X69 A;  1DGS A;  5CV6 A;  3BS1 A;  1IL8 A;  2RHQ B;  1GUS A;  1GXD C;  1DYQ A;  2F3I A;  4DA2 A;  4HID A;  4UHV A;  1BUV T;  2PMZ E;  4CDD C;  4JI5 L;  2F0V A;  2I46 A;  1JC7 A;  2QIL A;  3A5Z B;  3EIV A;  1SNO A;  1A0I A;  2K52 A;  3O13 A;  4R4T A;  4JI6 Q;  2GA4 B;  4RGN A;  4UY8 C;  2PMZ B;  3HOU H;  5I9P A;  1IW7 C;  4C56 C;  1S5F D;  1IYV A;  3UE1 A;  5JJL A;  5CC4 A;  1XPO A;  2E2J B;  4QB4 A;  4K2L A;  2Q8I B;  4JBK A;  1RIP A;  3SK8 A;  1D6E C;  3W1G A;  2DJG C;  1K8G A;  1JOK A;  3KDF A;  1D8L A;  4X3U A;  4QUF A;  4BXX H;  2B63 G;  4KY6 A;  1LTG D;  4JI6 L;  4UAI A;  3I8Z A;  1QUQ A;  3S9W A;  2NN6 G;  1N33 Q;  1HPC A;  1LAB A;  2GVA A;  2D62 A;  1K28 A;  3D6W A;  4KHP Q;  3EN2 A;  2LMC B;  4K5V A;  1JOQ A;  1PTO C;  4F8M A;  1P8L A;  3HOX H;  1V8Q A;  5M3F G;  1N8R C;  1EEF D;  3K57 A;  1IYJ B;  4JI0 Q;  1B4O A;  3URY A;  4LFC L;  5M5W B;  1PRT F;  2G5D A;  4IZ8 A;  1WYD A;  3FVQ A;  4IPH A;  2LXK A;  4P2C B;  1Q3L A;  5JEA H;  1HTP A;  3HOV B;  1N33 L;  2I5M X;  2VUM B;  1HR0 W;  1S4Z A;  3G48 A;  3KUP A;  1XMO Q;  4HJ9 A;  3PO3 G;  4DV6 Q;  2QDB A;  2YTX A;  4JI0 L;  4A3F G;  3S2D H;  2P5Z X;  1G2S A;  2AQ2 B;  2R7Z H;  1F9P A;  4J1M A;  2F0K A;  1KDA A;  4PV1 C;  1MHW C;  4JI8 L;  1OXS C;  2VL6 A;  1VQA A;  3OMC A;  1PMR A;  1STY A;  4FYD A;  4HJ7 A;  2MHV A;  2O2L D;  2RDH A;  1VMC A;  2VB2 X;  1V1P A;  4R4C A;  2XGT A;  2AHO B;  4DV2 L;  4X64 Q;  4MHE A;  2D9U A;  3CQZ H;  5FJ8 H;  3NTK A;  2JA5 B;  3J80 L;  1UWV A;  1K0R A;  1Y69 U;  2CH4 A;  1ENA A;  3G7L A;  2IX0 A;  4BY1 G;  2L55 A;  4JCV E;  2PNH A;  1TWF B;  3RZD B;  1EOV A;  1HFG A;  3S17 B;  3OTO Q;  1DOM A;  1Y14 B;  5IOC A;  1X3Q A;  4E6I A;  3CME A;  4ME5 A;  4A3B G;  3HFZ B;  3R2T A;  4QL5 A;  4DNR B;  1YNX A;  3J7A F;  1TY0 A;  5DAU A;  2XTI A;  1T9H A;  4Q0F A;  2RSO A;  3KJO A;  2RCN A;  5FO9 B;  4OWT B;  4ZKB B;  5K36 H;  3OIP A;  4R8N A;  1FYC A;  1G2T A;  2ICE C;  1ML0 D;  1IKL A;  3WWV A;  2O4X A;  5IGD A;  2JA6 B;  1HFN A;  5C4X G;  3SK6 A;  2VS1 A;  3C46 A;  2JA7 H;  4IUV A;  4K14 A;  1LTI D;  1I3Q B;  3F8T A;  4DV0 Q;  1D1K A;  3TP5 A;  1HA6 A;  4HJ8 A;  2WKD A;  1YNJ C;  2NVQ H;  2HIX A;  4OIJ A;  1N36 Q;  2MO1 A;  1TWA B;  2VQE L;  3PQI A;  4PMB A;  1K8M A;  3WOE A;  2OTL A;  3L0O A;  2H5X A;  4FF1 A;  4YHH Q;  1D5Z C;  1VQM A;  3MXN A;  4IOC A;  2VXW A;  5H1S E;  1HQR D;  2HCC A;  1E2W A;  3DLL A;  4C3J B;  2MUY A;  3SVM A;  4F88 A;  4U67 3;  5DM6 3;  1EY6 A;  1JJG A;  3G71 A;  3CCU A;  1PH9 A;  1N36 L;  1SRO A;  4R4O A;  3FEW X;  5C3E G;  3H3V I;  3RMH A;  2MGS A;  5ELC A;  4YHH L;  1PH3 A;  1QJO A;  2OF1 A;  1IXR A;  5ELB A;  1H9K A;  4A3J G;  5IT9 c;  4MIU A;  1VQ5 A;  4HAE A;  1F2M A;  2KED A;  4BBR B;  2K14 A;  4O0A A;  2A6H C;  4WJW A;  1B9M A;  5IP9 G;  2K1B A;  5D3I B;  1SE8 A;  2JN4 A;  1HH2 P;  2NVT B;  4RGT A;  3FP9 A;  5D14 A;  1Q90 A;  4A3B B;  3FKI H;  1I4Q A;  2Z1C A;  4QY7 A;  2IY5 B;  2MFI A;  5FOB B;  5JJI A;  4JBW A;  5EPL A;  4DR1 Q;  1XNR L;  1B50 A;  4DV1 Q;  1VQD A;  5I2X A;  1IYU A;  5EAY A;  4A3L H;  1LT6 D;  1WTW A;  1H9S A;  2L12 A;  1MSG A;  1B3Q A;  2NYZ D;  1WCM B;  2B2U C;  2K28 A;  4HMI A;  1UUP A;  1JQY D;  4CKC A;  4JK1 C;  1RL2 A;  2IWH A;  1M1K C;  1MGS A;  5A35 A;  3K5N A;  1HJP A;  3S16 B;  4NXN Q;  3GTG B;  3J7Y W;  2UUA Q;  1VF5 C;  4B3T Q;  2B2Y A;  1R4Q B;  4X3K A;  1QVG A;  2E2H H;  3MFG A;  3H09 A;  1WOC A;  2NN6 I;  3KLS A;  3JAM c;  1CQF A;  1Q1B A;  3FPP A;  1EQQ A;  2DN8 A;  3VR2 A;  2N49 A;  5KND A;  3BU2 A;  3K58 A;  4I7Z C;  2EE1 A;  3IKJ A;  4KY7 A;  1RKN A;  3HS0 C;  3DHQ A;  1VQ9 A;  4DK0 A;  1TVX A;  3I4O A;  2KOL A;  1PH7 A;  1X6O A;  3S2H B;  4U68 A;  1U4L A;  1I4H A;  1OXX K;  1HNX L;  1TXY A;  4HJ5 A;  2OWO A;  1JWS D;  3BZK A;  5M5W H;  3BDL A;  5BN3 A;  2E8G A;  3ZJY C;  4AYB G;  1PLF A;  3ERQ A;  4YCW A;  5E1F A;  3HOV H;  1A2U A;  3RLO A;  2Z4H A;  1W3S A;  2VUM H;  1IKM A;  3RR5 A;  4A3C G;  1O7L A;  1H9M A;  2AQ1 B;  4YCU A;  3OWE B;  3WOF A;  1K73 C;  3TZU A;  4IUQ A;  3E3X A;  2AWN A;  4WJ4 A;  4IPG A;  4JG2 A;  1FD7 D;  1J5E Q;  4DAP A;  1PRT C;  2CQO A;  1KIX A;  2NVX H;  4XT3 B;  4K6L A;  5AJ3 Q;  4B08 A;  4B3R Q;  4BA1 I;  3BZC A;  4A3E B;  1II3 A;  1QOH A;  2ZXP A;  3CMA A;  4BY7 B;  4WRD A;  3L9A X;  3OYY A;  3ND8 A;  4NP5 A;  3GP7 A;  4DN4 M;  1UAP A;  2UUC L;  3KFU A;  1H95 A;  3T16 A;  4ZLT F;  4PMW A;  5LHY 1;  1YHQ A;  3VA7 A;  2XVS A;  3VYR A;  2JA5 H;  2XWJ B;  1R9T H;  4BWG B;  4N8F A;  4A3I B;  5C4J B;  3NQI A;  3S1M H;  3U4Z A;  1KAW A;  3D4D A;  3HOU G;  4LF5 Q;  1TWF H;  3CPF A;  3S17 H;  1P16 A;  4C3I B;  2EOT A;  1MSH A;  4M1U B;  2PYK A;  4LF8 Q;  1S3O A;  1IL2 A;  5CV8 A;  4BXX G;  3MWY W;  4LMQ D;  1EZ6 A;  5KYI A;  4JBJ A;  1HR0 Q;  1EY8 A;  2UXB L;  1HZC A;  2EXD A;  1Y8O B;  4DAY B;  3IFD A;  1VDZ A;  5DLQ E;  4LF8 L;  1NUC A;  5LL6 S;  2L9H A;  2JA8 H;  3IAY A;  3S15 B;  1GUG A;  3B6Y A;  1TWG B;  2WAQ E;  4BBS H;  2H1E A;  1HR0 L;  1I3Q H;  4A3G H;  5I6W A;  3OW7 A;  1VQI A;  2EVB A;  2TSS A;  1GUT A;  1WVL A;  1WTQ A;  2O5I C;  5JEA G;  2KEE A;  4IO9 A;  1TWA H;  2WAQ B;  1C8C A;  1TWC B;  1PYS B;  3H0G B;  5FLX c;  2F0S A;  4V0B A;  5C0X H;  1NCV A;  1U4M A;  2DGY A;  1VQB A;  1UE7 A;  1IBK L;  5IOD A;  5LMU Q;  3VR4 A;  2R7Z G;  4DR5 Q;  3T1Y Q;  3LNN A;  3E0E A;  4M8A A;  2F0W A;  2MQH A;  4CHT B;  3V2T A;  2KCT A;  2K5H A;  1XJV A;  3HOW G;  3D8G A;  3QOL A;  2PZT A;  5LMU L;  3BYY B;  1EYD A;  2F0J A;  1VF7 A;  2VB3 X;  2V1C C;  3T1Y L;  4PZ7 A;  4G7O C;  4DU9 A;  2F0O A;  3VR3 A;  4BBR H;  3DXJ C;  1J9O A;  2BA0 A;  2I07 B;  5JPM C;  4ZAI A;  1JB3 A;  2YTV A;  2L15 A;  1NMF A;  1JT8 A;  1TR5 A;  3VDY A;  2R3Z A;  2PCF B;  1EIH A;  1PZK D;  4EQ5 A;  1BBX C;  3J80 i;  3Q23 A;  1JCK B;  5K36 G;  3FPU B;  5CBE E;  3E5S A;  1WCM H;  2RKS A;  2BDN A;  2YV5 A;  1SE2 A;  3H91 A;  1IBM Q;  2Q2T A;  3HOX B;  1CQV A;  1G8Z D;  1EIG A;  1Y1V H;  1I6H B;  2JA7 G;  1GVP A;  4FVM A;  3S16 H;  3K7U C;  3HKZ B;  4RWS C;  3GTG H;  2KEN A;  4IFD H;  3KLW A;  5C4H A;  5IGC A;  2UXC L;  4Q5V A;  3A8K E;  1XWE A;  1F77 A;  3VYT A;  3NBH B;  4GLX A;  2X6G A;  3T1H L;  4Y52 H;  1C4Q A;  2F4V L;  3KDF B;  4CJ1 B;  4KN4 C;  3NTI A;  3CRK C;  3KF8 B;  1L0Y B;  2GVB A;  4QUC A;  3AQQ A;  3H6M A;  4XDX A;  4NXM Q;  1B44 D;  4G57 A;  1QUQ B;  2IJ0 A;  1HNZ Q;  2RHS B;  4DUZ Q;  1PHJ A;  5GAE C;  4EQP A;  4HIM A;  3STB D;  4O2D A;  4LF9 Q;  4EGV A;  2QKI C;  2K5V A;  4DR6 Q;  3MHB A;  5HGT A;  5DEH A;  2EY1 A;  3UDG A;  3VYS A;  2NZH A;  3CQZ B;  1WTH A;  4LF6 Q;  3UDI A;  1X65 A;  2N55 A;  2Z6B A;  4YWK A;  1X56 A;  1FNV A;  2JA9 A;  3PUV A;  3P1H A;  2L4N A;  3LWU A;  4KHV A;  4LF9 L;  1SNP A;  4QMG A;  3NXW A;  4DR6 L;  2EYP A;  3F1Z A;  4GLV B;  3FKI G;  3M4Y A;  3W3A A;  3GTQ B;  4YY3 L;  3J80 E;  2KEC A;  2UU9 L;  2R61 A;  1W6J A;  4JOI C;  5EGT A;  1OXV A;  4Z9C B;  4A3L G;  3SXH A;  4ZUI A;  2EJM A;  1TII D;  3HOZ B;  3S1R H;  2B2Y C;  4Y7N B;  4BY7 H;  3NP8 A;  2Q2H A;  1GUW A;  2K05 A;  3OOC A;  4LFA Q;  3K81 C;  5ELO A;  2WAC A;  1WFQ A;  2CHB D;  3NTH A;  5G3L D;  1X9N A;  3OMG A;  4AH6 A;  4GKK L;  1SYF A;  3FRP B;  3CP0 A;  4DUY L;  2NVQ B;  4A3I H;  4C3H B;  2K7V A;  1N32 L;  1Q7Y C;  1NBW A;  2BA1 A;  2F0T A;  4JI4 Q;  1G6P A;  1KQS A;  3EVQ A;  2E5L Q;  1AH9 A;  1YZ6 A;  3NWT A;  1MJC A;  4QQB X;  4C3I H;  4P71 A;  2ZJP A;  2C9O A;  2K5N A;  1WJJ A;  2HT1 A;  3DUZ A;  4ZYS A;  3ULP A;  1GD7 A;  4A3D H;  5JJZ A;  4IPC A;  1RDP D;  4JI4 L;  1J6Q A;  4A3K H;  3E6Z X;  4K8I A;  2E5L L;  2OT2 A;  3TN2 A;  1LTB D;  2HD3 A;  3D31 A;  4LUZ A;  2HHH L;  1KD1 C;  3FHW A;  5IGG A;  1B9N A;  1K83 B;  2F0N A;  4K8J A;  3S15 H;  3K5M A;  1TWH H;  2A6E D;  4A76 A;  2R93 B;  1UEB A;  4JVZ A;  3HOV G;  3MXN B;  4CJ2 C;  2VUM G;  1K3B C;  4JI2 L;  4HMJ A;  2Q8T A;  1KL9 A;  3H0G H;  3T4A C;  3AB9 A;  1Q8K A;  3GV3 A;  5IGF A;  3EFX D;  4OX9 L;  3M7G A;  4JI5 Q;  4DKA C;  1S40 A;  2PO4 A;  2QGQ A;  2FJ2 A;  3I72 A;  5FLX L;  4FF3 A;  4OO1 I;  2F0D A;  2WII B;  4P72 A;  4OWW B;  4KJN A;  2Y0S E;  3GV6 A;  3L7Z C;  5DM7 3;  1EQT A;  1AN8 A;  3NBI A;  2D2C C;  1Z9F A;  1QE6 A;  3TEH B;  1K8O A;  2Y0S B;  4L5T A;  1F2L A;  4CBV A;  1SE4 A;  2EZV A;  2JA5 G;  5J39 A;  2E2H B;  5I4D A;  1N34 L;  4G7Z C;  3I73 A;  4K0K Q;  1ZXT A;  1ICW A;  1BNZ A;  5JJK A;  1S5B D;  2A69 D;  2ZTC A;  1LTR D;  1Q82 C;  1B3A A;  4A4I A;  3NBH A;  1W6K A;  2FMC A;  2PZW A;  3TS0 A;  1H9S B;  2QA4 A;  1OO9 B;  4B3M L;  2YTY A;  2ZJR A;  3KF8 A;  2KVM A;  1ZYR D;  4LFC Q;  2RA4 A;  3AYH B;  1E2V A;  4LF7 L;  4K0K L;  4NPS A;  1KTK A;  2WB1 E;  4H7B A;  4GZY C;  1O80 A;  2JA6 G;  2I0Q A;  5J1Z A;  1DON A;  5BR8 L;  1Z47 A;  4RHS A;  2AUK A;  3E9I A;  1I6H H;  3DWP A;  3CCM A;  1K0S A;  2XRQ D;  1QVF A;  3HKS A;  1KC8 C;  2ZTE A;  4JI8 Q;  1PFB A;  1SJH D;  1PFM A;  1ZKO A;  2EDG A;  4MTK A;  2EYL A;  2YYZ A;  5G3L F;  5FO8 B;  1IBL L;  1OXT A;  5C0X G;  1C48 A;  3RN5 A;  3G6J B;  4DV2 Q;  1TT2 A;  2QF7 A;  2Z9H A;  4DR7 L;  1Q86 C;  5C44 B;  2NVX B;  1X55 A;  3Q6S A;  4C3J G;  1JR0 D;  1B70 B;  4FP5 D;  3Q22 A;  1DCZ A;  3MFY A;  3MAQ A;  1X3E A;  1KHI A;  5ELN A;  4B9W A;  3A55 A;  2E76 C;  3DWQ A;  1CT1 D;  2F3V A;  3DWA A;  1U4P A;  5L37 A;  1R9T B;  1KRT A;  3K80 C;  3KYH C;  1V43 A;  1M90 C;  1D7Q A;  4BBR G;  3S1M B;  3R8B A;  1PH2 A;  3A8J E;  2EIF A;  3T13 A;  3CU7 A;  2IL8 A;  3M4P A;  1WTO A;  3UDF A;  3GD7 A;  3GTQ H;  1GHK A;  1PV4 A;  3A74 A;  4CDF C;  2VNU D;  1L0X B;  2LY7 A;  3LWE A;  1SFO B;  1JE4 A;  4WOR A;  5HUR A;  3CD6 A;  1CZG A;  1ET9 A;  3N52 A;  5E7N A;  2VQE Q;  3HOZ H;  1WCM G;  4TRD A;  4DXG A;  3J81 L;  4Y7N H;  3FMC A;  1SYE A;  4OWX B;  1YJN A;  2JA8 B;  2VQF Q;  4PNY A;  3MXG A;  3PUX A;  2I5H A;  1U5K A;  4BBS B;  4A3G B;  3CCE A;  1Q1E A;  3K7A B;  3PCO B;  2CCZ A;  4IFD G;  5IYD H;  3SE0 A;  4C3H H;  2SDF A;  3LX0 A;  1LT5 D;  5I9O A;  1ICF B;  2K33 A;  1EIF A;  1A15 A;  3E0J A;  4PG3 A;  1TU2 B;  3OWF A;  1BCP B;  2VQF L;  3BZD B;  3K0X A;  4A3M B;  4GKJ Q;  2A74 C;  5M3M B;  1ENC A;  4B3S L;  3I55 A;  4TQU S;  4DV7 L;  3MZ5 A;  1CHP D;  1BXT A;  2R92 B;  3SDZ A;  4DR3 L;  1VQJ A;  2HIV A;  3RD4 A;  4OEL B;  4RGO S;  1VMP A;  3EJI A;  3U4V A;  3OSO A;  1XNR Q;  4GKJ L;  1K83 H;  4TKO B;  5EKL A;  3K59 A;  2AKW B;  2R6G A;  2K03 A;  4DK3 C;  1ZEQ X;  1BF4 A;  2R93 H;  4H0L C;  3KLS X;  3CRL C;  2ES2 A;  1HZA A;  3S1Q H;  1I4P A;  5M5X B;  1MKH A;  1Y8P B;  4H44 C;  1QZH A;  2M9V A;  3K5O A;  4RKB A;  4A93 H;  1E0B A;  1SNC A;  3KBG A;  2NB0 A;  3BYT B;  1KXL A;  3IL8 A;  1HUN A;  3OW2 A;  3RUZ A;  1HXY D;  3MXU A;  4A3E G;  3MEH A;  4BY7 G;  3I4M B;  1EWH A;  2VW9 A;  4JOI A;  1Y1V B;  2PNR C;  1W2B A;  1XXG A;  5NUC A;  1SNQ A;  1TY2 A;  5EBC A;  4ME3 A;  3PO2 B;  1S5E D;  4LFB L;  3MC0 B;  3VR6 A;  4POG A;  4A3I G;  3I4N H;  1EY7 A;  1IHZ A;  1CM9 A;  1BCP D;  3M3Y B;  3F2D A;  3U9S A;  4C3I G;  2FHT A;  4J8Q A;  2N78 A;  5DNF A;  1HNX Q;  3STB C;  3K0Y A;  4A3D G;  3Q0A A;  1JOO A;  4HED A;  4GN4 B;  3BVG A;  2F0M A;  3AFP A;  2KHJ A;  4GN3 B;  3IRB A;  4ZUJ A;  1NJI C;  3J7A V;  4KJO A;  5HGQ A;  5JEA J;  4KKS A;  4IUU A;  2XNA C;  1A3U A;  1UE6 A;  5A2Q E;  1CHQ D;  1B53 A;  1KAA A;  1MD2 D;  3I3C A;  4V19 0;  1XNQ L;  1GKH A;  1MI2 A;  1RCV D;  2XIW A;  2WAQ G;  3M9B A;  1D5M C;  3H0G G;  2UUC Q;  1QNU A;  2NUC A;  2ENB A;  1YJ9 A;  2EJF C;  2SNM A;  5C44 H;  3PF5 A;  1CI3 M;  3CAM A;  3PIP 3;  4NKL A;  1ESR A;  1MJE A;  3S1R B;  4X62 L;  5K5P A;  2AWO A;  5FO7 B;  1Z7T A;  1F2Y A;  1YI2 A;  2WP8 J;  1FNW A;  3PF4 A;  1SYB A;  1LTA D;  1UE5 A;  1VQF A;  4IN3 A;  4OHJ A;  3CC2 A;  1WD0 A;  4JBM A;  1LLR D;  2KA7 A;  1PH4 A;  2JEA I;  4PMC A;  1QWY A;  1PH1 A;  4CGY B;  3D0F A;  4DV3 L;  2UXB Q;  2K01 A;  1DXM A;  5IGB A;  2YU9 H;  4JW0 A;  4DR4 Q;  1HUM A;  4HSP A;  4IJH A;  3FDT A;  1F2Z A;  4C1N I;  2IPK D;  5IP7 H;  2QEX A;  4BA2 I;  5C5M A;  4OXP A;  1QG7 A;  4A3D B;  4TSS A;  4X6A H;  1SFO H;  1XPU A;  1VQO A;  1V1O A;  4JI1 L;  1DOK A;  4A3K B;  4X65 L;  1HHV A;  4DR4 L;  2NBF A;  3I56 A;  1KNE A;  4UPA A;  1L2F A;  2WFW A;  2JYO A;  2A68 D;  1I6V C;  3TME A;  2D0O A;  2A6E C;  3HOX G;  1IBK Q;  1TWH B;  2F0I A;  5KNC A;  4IUN A;  4K5X A;  1MIU A;  4DXF A;  3NUC A;  3K7A H;  2RDG A;  3HKZ G;  1RHP A;  3A56 A;  4N9P A;  5GQO A;  4YIJ A;  1B8A A;  1BBW A;  1NAP A;  4DV5 L;  4IJL A;  3PIO 3;  4AYB E;  1I50 H;  1HA5 A;  2EXZ A;  1CZW A;  2NVY B;  3K6O A;  4QJF A;  4ZQ3 A;  4A3M H;  2L11 A;  3ONA B;  1J8I A;  5M3M H;  4RMF A;  3TRZ A;  1YNN C;  1EY4 A;  1BCP F;  2CW0 D;  2EYF A;  3VYU A;  2R92 H;  4DV4 Q;  3GTJ H;  1RTO A;  5T1G A;  4CKE A;  3PO3 H;  2KBN A;  2JP1 A;  3NWS A;  4XIG S;  2Z0S A;  4DFA A;  2ASB A;  1EYC A;  5FJ8 G;  2BE5 D;  4HJA A;  3S14 B;  4LW1 A;  3C3L A;  1DZ1 A;  4J15 A;  1SND A;  2A69 C;  1C0A A;  3D6C A;  1FNU A;  4DV4 L;  1GO3 E;  1VQ4 A;  3HOY B;  5IT9 L;  2ZJQ A;  1PA6 A;  5M5X H;  1FL0 A;  4C2M H;  1KRS A;  1Q46 A;  1SYC A;  5KIX A;  1VQL A;  4LAA A;  5EKK A;  1Y1W B;  1EY9 A;  2F0P A;  1I4R A;  1ZYR C;  1G51 A;  3N6R A;  3RLF A;  3DEO A;  2E74 C;  2RF4 A;  2QW7 A;  2J4X A;  1HZB A;  4MN3 A;  2UXC Q;  2K04 A;  1XMQ Q;  3HOZ G;  3T1H Q;  5D65 A;  3UI2 A;  3I4M H;  2F4V Q;  5JVG 3;  4KV6 A;  2XRS D;  4RG1 A;  1JMC A;  3G4S A;  4YWM A;  3JC6 6;  2ID0 A;  4KD4 A;  2CH4 W;  3NEN A;  1EYG A;  1R4P B;  3D4W A;  3PO2 H;  3ERS X;  5IYD G;  2MP1 A;  4K2K A;  4C3H G;  1E24 A;  1STG A;  1XMQ L;  1S72 A;  2EQS A;  4L6T B;  1EWC A;  1E7Z A;  4JV5 Q;  3J81 i;  2ALY B;  3M3Y H;  1SDF A;  2JJQ A;  4ZCK A;  4GOP B;  4KLK A;  3WDN A;  3RN2 A;  4X66 L;  1STH A;  1KLG D;  1D2B A;  3JAM L;  1Q81 C;  4JI7 L;  1Q8I A;  1SN8 A;  3I2Z A;  3M4O B;  1AP0 A;  1D5X C;  3ULJ A;  1YIT A;  3BDC A;  3RZO H;  4JV5 L;  1QZG A;  2LS0 1;  4OL7 A;  4LUO A;  2ZXO A;  2B2T A;  4EQO A;  5BN5 A;  1UNS A;  1JWM D;  3AU7 A;  4YY3 Q;  5IYB H;  3BJU A;  2CQA A;  1JOR A;  1UE1 A;  2UU9 Q;  1KLU D;  2R93 G;  3GTP B;  1BKB A;  2RQX A;  4L8J A;  3HP3 A;  2MJ8 A;  3U50 C;  3V96 A;  3CHB D;  3CCQ A;  1RF2 D;  3J80 c;  3I90 A;  4DR2 L;  3PUZ A;  1F9Q A;  5JVH 3;  1TKW B;  5GAD C;  1GHJ A;  3I7F A;  2HDL A;  1ASY A;  4A93 G;  1NMG A;  1SNM A;  3CC7 A;  4GKK Q;  1CA5 A;  4DUY Q;  2BH8 A;  4H13 C;  1N9W A;  1N32 Q;  2PW5 A;  1EEI D;  1CKN B;  1XTC D;  5JAV A;  2G9D A;  2N8N A;  1B2T A;  2PQE A;  5CR3 A;  1QCB D;  2Y0S G;  4N9T A;  1YHB A;  5M5Y H;  2GN5 A;  2K4K A;  3J81 E;  2DY8 A;  2RBM A;  4FF4 A;  4CJ0 B;  3W2D A;  1EU3 A;  2HHH Q;  1D1I A;  2DNC A;  4R4I A;  4HCS A;  2WIN B;  3H3V C;  3SGI A;  4WFN 3;  2K6A A;  1VQ8 A;  3S1N B;  4GLA C;  2JEB I;  2L0C A;  1RTN A;  4X3T A;  1ENF A;  4H02 A;  2Z6K A;  4EVO A;  4O1N A;  4ULL A;  1LYL A;  4JI2 Q;  1GOZ A;  2PI2 E;  3UDX A;  1NSN S;  2FFK B;  1LTS D;  2NTT A;  4IQZ A;  4OX9 Q;  4JC0 A;  3TP7 A;  1KDC A;  1LAC A;  1A63 A;  1A62 A;  5C0X J;  3CCL A;  3MVV A;  3S1Q B;  4KMU C;  3GDE A;  2JSO A;  3GTO B;  3NQT A;  3PMF A;  1KNA A;  2N3S A;  5M9O A;  2RCF A;  2A73 B;  2R7F A;  1WD1 A;  1FGU A;  2VY3 A;  4A93 B;  4DNI A;  1GM5 A;  2MPM A;  2BOS A;  2LKV A;  2KCM A;  2NVY H;  1CA6 A;  4GNX A;  1LV9 A;  5C44 G;  4XQJ A;  2OCE A;  4JYA Q;  2F4I A;  4MTN A;  1O7I A;  1N34 Q;  1SE3 A;  1TS4 A;  3EQL C;  1STE A;  1B1Z A;  1YNN D;  1HNW L;  1GUO A;  4KKT A;  1NR2 A;  1M4V A;  1H9J A;  1YEZ A;  4L5R C;  3NHH A;  5CBA E;  4HIK A;  4LF4 L;  2X6L A;  3S14 H;  1LM0 A;  4JYA L;  4B3M Q;  1BCP C;  3I4N B;  2XSC A;  5TSS A;  3QB3 A;  3TQY A;  4LF7 Q;  5IWA L;  2SEB D;  1X3G A;  1LUZ A;  3HOY H;  3BVM A;  4K6D A;  5CV4 A;  5CMD A;  1Y1W H;  4APV A;  1VQE A;  3KF6 B; 
#chains in the Genus database with same CATH homology
 3SHL A;  1G6Z A;  1PZI D;  4XQN A;  4G4K A;  3M7N A;  2RSN A;  1S5D D;  4J6H A;  1EL0 A;  1HQM C;  2F0G A;  4HCE A;  4IFD J;  1MBY A;  4FNF A;  2ICI A;  5CV5 A;  5T1I A;  4R8I A;  3C1E A;  2WB1 B;  4RFB A;  3BG3 A;  4OIK A;  1CTM A;  3R93 A;  1EU4 A;  1CK1 A;  2F0U A;  1JWU D;  2IX1 A;  3TZD A;  1QIL A;  2BCO A;  2B39 A;  2QCP X;  2A5H A;  4RA8 A;  3HGB A;  3GTK B;  1TS5 A;  5I6Y A;  5ELD A;  4XXE A;  5KEE A;  2KCN A;  2TMP A;  5FK9 C;  2LFN A;  2CVR A;  2YU9 B;  4K5W A;  2IW3 A;  1AFP A;  1ONL A;  4RGM A;  1ILQ A;  3ITP A;  3A54 A;  4ODG A;  2NWG A;  3TP6 A;  1SAP A;  3VA5 A;  4OO1 H;  3HG9 A;  4RAU C;  2A68 C;  3NK9 A;  4KKU A;  3TP8 A;  3D4R A;  2OXP A;  4FXG C;  2ZT9 C;  5FKA C;  4IAL A;  1SYD A;  1E2Z A;  2B63 B;  1U4R A;  3GTM B;  2EPB A;  2PPB C;  1AZP A;  2M00 A;  5KNB A;  3K5L A;  1G91 A;  1HRJ A;  2KJX A;  5ISR A;  4DAV A;  4BS9 A;  3IFT A;  1I50 B;  1DOL A;  4ID6 A;  5COY A;  5M3F B;  2OEO A;  3TBI B;  1PDQ A;  2CW0 C;  2B2T C;  1H9R A;  2B2V A;  3MXP A;  3A7A B;  3NSW A;  5LL6 X;  4FXK C;  3GTJ B;  2K32 A;  3NPP A;  1EFI D;  2BE5 C;  4KD3 A;  3PO3 B;  4DF7 A;  1GUN A;  4A3F B;  2PZU A;  3ERO A;  1BOS A;  4XTC S;  4F7X A;  5ELF A;  4ABN A;  3SK5 A;  1X32 A;  4NMZ A;  1AEX A;  4KN7 C;  4C2M B;  2SNS A;  1U9R A;  4XQQ A;  2F0Q A;  5E3F A;  4XYQ A;  1XYI A;  4OGQ C;  3HRZ C;  4FF2 A;  1PTO B;  4HSV A;  3KBX A;  4BY1 B;  5IT9 E;  1PZJ D;  1PYW D;  1A3V A;  4B9X A;  1AZQ A;  3I91 A;  3H94 A;  1AW7 A;  1BDO A;  3DM1 A;  2J7Z A;  2M2L A;  3KK7 A;  1OXU A;  2F0E A;  1A6X A;  1PFN A;  3M85 A;  3PUW A;  5IGE A;  5C4X B;  2FMM A;  2SOB A;  3PUY A;  3A8I E;  3Q24 A;  1LO5 D;  2F03 A;  3GTL B;  3RZO B;  2KHS A;  1IW7 D;  5C0X I;  3D3R A;  4IUP A;  1DD2 A;  3JAM E;  2IX3 A;  1PXU A;  5E4W C;  1EY5 A;  5C6A A;  5C3X A;  5EKI A;  1TQO A;  4KK7 A;  3U9O A;  2EY6 A;  2K5Q A;  5C3E B;  5C4Z A;  5JPN C;  5IIF A;  1A2T A;  4NW2 A;  1WTX A;  2K5W A;  4UDU C;  2B8G A;  4RKL A;  4A3J B;  2FIN B;  1EQV A;  1T5X D;  1SMY C;  1PTO D;  5ELE A;  5COR A;  5JOB A;  2EY5 A;  4QF4 A;  1SYG A;  3QIA A;  5EQ0 A;  1KDB A;  4DGZ A;  2JXM B;  5M5Y B;  4PQX A;  2EYM A;  4R9W A;  1DM0 B;  2B2W A;  4KHZ A;  4HN7 A;  2F3W A;  4ZK9 B;  4ZKC B;  1WTV A;  2NTS A;  2WV6 D;  1TS2 A;  5C5L A;  2D5D A;  4NDX A;  4DK1 A;  5EPK A;  3X3M A;  3L3O C;  1VCI A;  2QEJ C;  4IUR A;  3P75 A;  2N88 A;  4IFD I;  1STN A;  3MTS A;  4ILW A;  3R3O A;  3QWN A;  3T56 B;  2BDO A;  1T5E A;  2Z8L A;  4KTA A;  4HTH A;  2K5D A;  2O5J C;  1O78 A;  2G9H D;  5EJW A;  3KLR A;  1Y8N B;  2Q8R E;  3I70 A;  4QIW B;  1DJR D;  2NN6 H;  1RD9 D;  2E75 C;  2EYO A;  5E4X A;  5I2Y A;  1TS3 A;  3MA2 B;  3SR1 A;  5AFW A;  1LT4 D;  5KRU A;  4FXD A;  2V4D A;  5KGU A;  5CGK A;  4AYB B;  3TSS A;  1S5C D;  1BR9 A;  2XWB B;  2E2I B;  2H4O A;  1EZ8 A;  4LK1 C;  2F0F A;  3OPO A;  1YNJ D;  4S3S A;  1ESF A;  3T53 B;  3CKI B;  5FLX E;  3C1F A;  4C1N K;  4ZRZ A;  4F87 A;  3QG1 A;  1EOT A;  4XT1 B;  3DMU A;  3BDO A;  3ND9 A;  4IUT A;  4DNT B;  3T51 B;  1SEB D;  2F0H A;  3ZYY X;  1PTO H;  1BQQ T;  4OO1 G;  3HOU B;  1FR3 A;  1NR4 A;  2AQ3 B;  2B8F A;  1BO0 A;  1F9R A;  2A6H D;  2C5C A;  1ET6 A;  1PTO F;  3DEP A;  2L1B A;  1M8A A;  2HQE A;  3P7J A;  1O7Z A;  3TDQ A;  1QB5 D;  1ILP A;  1SXT A;  2B2V C;  1EY0 A;  1PRT B;  5CV9 A;  3PV0 A;  2JE6 I;  2DY7 A;  4LJZ C;  1O7Y A;  1HCZ A;  2ZXR A;  2NZ1 D;  1EYA A;  1JIC A;  4RCN A;  2E2D C;  2PW7 A;  3V05 A;  3S2D B;  3QJY A;  1KAB A;  3NE5 B;  4I65 A;  2R7Z B;  3VR5 A;  2HUG A;  2DNE A;  3OIQ A;  5A2Q L;  2XN9 C;  1HTL D;  3HOW B;  2IT1 A;  2Z4I A;  3F2U A;  3C2P A;  4QCL A;  2HCI A;  3I4L A;  5CV7 A;  1X3P A;  1SMY D;  3HZX A;  4KY5 A;  1Q12 A;  5EPJ A;  1F9S A;  2AUJ D;  4CKB A;  2F1M A;  5F2D A;  2KQ3 A;  2KUM A;  3OHX C;  1ROD A;  5KYL A;  2RDF A;  5C3W A;  1V1P B;  2RVL A;  1WTP A;  1PRT D;  2EYJ A;  3QO2 A;  4O42 A;  3SEB A;  4DAY A;  1LT3 D;  1SSO A;  2F0L A;  1Z6H A;  2JA7 B;  1A3T A;  1RJT A;  3HEJ A;  2B2U A;  2HDM A;  4X3S A;  3P20 A;  4KI0 A;  1STA A;  3A7L A;  1STB A;  1FGB D;  4FO2 A;  3QOJ A;  1UEA B;  3SK4 A;  3AMU A;  4RCO A;  1SJE D;  2EJG C;  1GJX A;  1I4G A;  2KCC A;  1SBB B;  3GO5 A;  2J0T D;  3X3N A;  2EY2 A;  1LTT D;  2L5T A;  2EYH A;  4RHR A;  2WKC A;  5BN4 A;  3GQB A;  4G7H C;  5CYU A;  1CFM A;  4XYO A;  3EA6 A;  5D3D A;  3R2I A;  2B2W C;  3FKI B;  4L63 B;  1WTR A;  1QNK A;  3BVZ A;  5EBD A;  5J22 A;  4EQN A;  1XX8 A;  4RH6 A;  4HR7 B;  1G29 1;  2X69 A;  5CV6 A;  3BS1 A;  1IL8 A;  1GUS A;  1GXD C;  1DYQ A;  4DA2 A;  1BUV T;  2F0V A;  2I46 A;  1JC7 A;  2QIL A;  1SNO A;  3O13 A;  2GA4 B;  4RGN A;  2PMZ B;  5I9P A;  1IW7 C;  4C56 C;  1S5F D;  1IYV A;  5CC4 A;  2E2J B;  4QB4 A;  4K2L A;  2Q8I B;  3SK8 A;  1D6E C;  1JOK A;  4X3U A;  4QUF A;  4KY6 A;  1LTG D;  4UAI A;  3I8Z A;  3S9W A;  2NN6 G;  1HPC A;  1LAB A;  2D62 A;  3D6W A;  2LMC B;  4K5V A;  1JOQ A;  1PTO C;  4F8M A;  1V8Q A;  1EEF D;  3K57 A;  1B4O A;  3URY A;  5M5W B;  1PRT F;  4IZ8 A;  3FVQ A;  4P2C B;  1Q3L A;  5JEA H;  1HTP A;  3HOV B;  2VUM B;  1S4Z A;  3KUP A;  2QDB A;  1G2S A;  2AQ2 B;  1F9P A;  4J1M A;  2F0K A;  1KDA A;  4PV1 C;  1OXS C;  3OMC A;  1PMR A;  1STY A;  4FYD A;  2MHV A;  2O2L D;  2RDH A;  1VMC A;  2VB2 X;  1V1P A;  4MHE A;  2D9U A;  3NTK A;  2JA5 B;  3J80 L;  1Y69 U;  1ENA A;  3G7L A;  2IX0 A;  2L55 A;  1TWF B;  3RZD B;  1HFG A;  3S17 B;  1DOM A;  5IOC A;  1X3Q A;  4E6I A;  4ME5 A;  3R2T A;  4DNR B;  3J7A F;  1TY0 A;  5DAU A;  4Q0F A;  2RSO A;  5FO9 B;  5K36 H;  4ZKB B;  3OIP A;  4R8N A;  1FYC A;  1G2T A;  2ICE C;  1ML0 D;  1IKL A;  2O4X A;  5IGD A;  2JA6 B;  1HFN A;  3SK6 A;  3C46 A;  4IUV A;  4K14 A;  1LTI D;  1I3Q B;  1D1K A;  3TP5 A;  1HA6 A;  2WKD A;  1YNJ C;  4OIJ A;  1TWA B;  4PMB A;  1K8M A;  3WOE A;  4FF1 A;  1D5Z C;  3MXN A;  2VXW A;  1HQR D;  2HCC A;  1E2W A;  4C3J B;  2MUY A;  3SVM A;  4F88 A;  4U67 3;  5DM6 3;  1EY6 A;  3FEW X;  3RMH A;  2MGS A;  5ELC A;  1QJO A;  2OF1 A;  5ELB A;  1H9K A;  4MIU A;  4HAE A;  1F2M A;  2KED A;  4BBR B;  2A6H C;  4WJW A;  1B9M A;  2K1B A;  5D3I B;  2NVT B;  4RGT A;  5D14 A;  1Q90 A;  4A3B B;  1I4Q A;  2Z1C A;  5FOB B;  4JBW A;  5EPL A;  1B50 A;  5I2X A;  1IYU A;  1LT6 D;  1WTW A;  1H9S A;  2L12 A;  1MSG A;  2NYZ D;  1WCM B;  2B2U C;  2K28 A;  4HMI A;  1UUP A;  1JQY D;  4CKC A;  4JK1 C;  2IWH A;  1MGS A;  5A35 A;  3K5N A;  3S16 B;  3GTG B;  3J7Y W;  1VF5 C;  2B2Y A;  1R4Q B;  4X3K A;  3MFG A;  3H09 A;  2NN6 I;  3KLS A;  1CQF A;  1Q1B A;  3FPP A;  2DN8 A;  3VR2 A;  5KND A;  3K58 A;  4I7Z C;  2EE1 A;  3IKJ A;  4KY7 A;  1RKN A;  3HS0 C;  3DHQ A;  4DK0 A;  1TVX A;  2KOL A;  3S2H B;  4U68 A;  1U4L A;  1I4H A;  1OXX K;  1JWS D;  3BDL A;  5BN3 A;  1PLF A;  3ERQ A;  5E1F A;  1A2U A;  2Z4H A;  1IKM A;  1O7L A;  1H9M A;  2AQ1 B;  3OWE B;  3WOF A;  3TZU A;  4IUQ A;  2AWN A;  1FD7 D;  4DAP A;  1PRT C;  4XT3 B;  4K6L A;  4B08 A;  4BA1 I;  4A3E B;  1II3 A;  1QOH A;  2ZXP A;  4BY7 B;  4WRD A;  3L9A X;  3ND8 A;  4NP5 A;  3GP7 A;  4DN4 M;  1UAP A;  3T16 A;  4ZLT F;  4PMW A;  5LHY 1;  3VA7 A;  2XVS A;  3VYR A;  2XWJ B;  4BWG B;  4A3I B;  5C4J B;  3NQI A;  3D4D A;  4C3I B;  2EOT A;  1MSH A;  4M1U B;  2PYK A;  5CV8 A;  3MWY W;  4LMQ D;  1EZ6 A;  5KYI A;  1EY8 A;  1Y8O B;  3IFD A;  1VDZ A;  1NUC A;  5LL6 S;  2L9H A;  3IAY A;  3S15 B;  1GUG A;  1TWG B;  2H1E A;  5I6W A;  3OW7 A;  2EVB A;  2TSS A;  1GUT A;  1WVL A;  1WTQ A;  2O5I C;  5JEA G;  2KEE A;  2WAQ B;  1C8C A;  1TWC B;  3H0G B;  2F0S A;  4V0B A;  5C0X H;  1NCV A;  1U4M A;  5IOD A;  3VR4 A;  3LNN A;  4M8A A;  2F0W A;  4CHT B;  3V2T A;  3D8G A;  3QOL A;  2PZT A;  3BYY B;  1EYD A;  2F0J A;  1VF7 A;  2VB3 X;  4G7O C;  4DU9 A;  2F0O A;  3VR3 A;  3DXJ C;  1J9O A;  2BA0 A;  2I07 B;  5JPM C;  4ZAI A;  1JB3 A;  1TR5 A;  2R3Z A;  2PCF B;  1EIH A;  1PZK D;  1BBX C;  3Q23 A;  1JCK B;  5K36 G;  3FPU B;  5CBE E;  3E5S A;  2RKS A;  2BDN A;  1SE2 A;  3H91 A;  3HOX B;  1CQV A;  1G8Z D;  1EIG A;  1I6H B;  4FVM A;  3HKZ B;  4RWS C;  4IFD H;  5C4H A;  5IGC A;  4Q5V A;  3A8K E;  1XWE A;  1F77 A;  3VYT A;  2X6G A;  1C4Q A;  4CJ1 B;  4KN4 C;  3NTI A;  3CRK C;  1L0Y B;  4QUC A;  3H6M A;  4XDX A;  1B44 D;  4G57 A;  2IJ0 A;  4EQP A;  4EGV A;  2QKI C;  3MHB A;  5HGT A;  5DEH A;  2EY1 A;  3VYS A;  3CQZ B;  2N55 A;  1FNV A;  3PUV A;  3P1H A;  2L4N A;  3LWU A;  4KHV A;  1SNP A;  4QMG A;  3NXW A;  2EYP A;  3M4Y A;  3W3A A;  3GTQ B;  3J80 E;  2KEC A;  2R61 A;  1W6J A;  5EGT A;  1OXV A;  4Z9C B;  3SXH A;  4ZUI A;  2EJM A;  1TII D;  3HOZ B;  2B2Y C;  4Y7N B;  3NP8 A;  1GUW A;  2K05 A;  3OOC A;  2WAC A;  2CHB D;  3NTH A;  5G3L D;  3OMG A;  1SYF A;  3FRP B;  2NVQ B;  4C3H B;  2K7V A;  2BA1 A;  2F0T A;  3EVQ A;  3NWT A;  2C9O A;  3DUZ A;  4ZYS A;  5JJZ A;  1RDP D;  3E6Z X;  4K8I A;  2OT2 A;  3TN2 A;  1LTB D;  3D31 A;  5IGG A;  1B9N A;  1K83 B;  2F0N A;  4K8J A;  3K5M A;  2A6E D;  2R93 B;  4CJ2 C;  4HMJ A;  2Q8T A;  3T4A C;  3AB9 A;  3GV3 A;  5IGF A;  3EFX D;  3M7G A;  2PO4 A;  3I72 A;  2FJ2 A;  4FF3 A;  5FLX L;  4OO1 I;  2F0D A;  2WII B;  4KJN A;  3GV6 A;  3L7Z C;  5DM7 3;  1EQT A;  1AN8 A;  3NBI A;  2D2C C;  1QE6 A;  1K8O A;  2Y0S B;  1F2L A;  4CBV A;  1SE4 A;  2EZV A;  5J39 A;  2E2H B;  5I4D A;  4G7Z C;  3I73 A;  1ZXT A;  1ICW A;  1BNZ A;  1S5B D;  2A69 D;  1LTR D;  1B3A A;  3NBH A;  1W6K A;  2FMC A;  2PZW A;  1H9S B;  1OO9 B;  3KF8 A;  2KVM A;  1ZYR D;  2RA4 A;  1E2V A;  1KTK A;  4H7B A;  4GZY C;  1O80 A;  5J1Z A;  1DON A;  1Z47 A;  4RHS A;  2AUK A;  3DWP A;  2XRQ D;  1PFB A;  1SJH D;  1PFM A;  1ZKO A;  2EDG A;  5G3L F;  2EYL A;  2YYZ A;  5FO8 B;  1OXT A;  5C0X G;  1C48 A;  3G6J B;  1TT2 A;  2QF7 A;  5C44 B;  2NVX B;  3Q6S A;  4C3J G;  1JR0 D;  4FP5 D;  3Q22 A;  1DCZ A;  3MFY A;  3MAQ A;  4B9W A;  3A55 A;  2E76 C;  3DWQ A;  1CT1 D;  2F3V A;  3DWA A;  1U4P A;  1R9T B;  1V43 A;  3S1M B;  3R8B A;  3A8J E;  3T13 A;  3CU7 A;  2IL8 A;  1WTO A;  3GD7 A;  1GHK A;  2VNU D;  1L0X B;  2LY7 A;  3LWE A;  1SFO B;  1JE4 A;  4WOR A;  5HUR A;  1CZG A;  1ET9 A;  3N52 A;  3J81 L;  4TRD A;  4DXG A;  1SYE A;  3FMC A;  2JA8 B;  4PNY A;  3MXG A;  3PUX A;  4BBS B;  4A3G B;  1Q1E A;  3K7A B;  4IFD G;  3SE0 A;  2SDF A;  3LX0 A;  1LT5 D;  5I9O A;  2K33 A;  1A15 A;  3E0J A;  1TU2 B;  3OWF A;  1BCP B;  3BZD B;  4A3M B;  2A74 C;  5M3M B;  1ENC A;  4TQU S;  3MZ5 A;  1CHP D;  1BXT A;  2R92 B;  3SDZ A;  3RD4 A;  4RGO S;  1VMP A;  3EJI A;  3OSO A;  4TKO B;  5EKL A;  3K59 A;  2R6G A;  2K03 A;  1ZEQ X;  1BF4 A;  4H0L C;  3KLS X;  3CRL C;  1I4P A;  5M5X B;  1Y8P B;  4H44 C;  2M9V A;  3K5O A;  4RKB A;  1E0B A;  1SNC A;  3KBG A;  2NB0 A;  3BYT B;  3IL8 A;  1HUN A;  3RUZ A;  1HXY D;  3MXU A;  3MEH A;  3I4M B;  1EWH A;  1Y1V B;  2PNR C;  1XXG A;  5NUC A;  1SNQ A;  1TY2 A;  5EBC A;  3PO2 B;  1S5E D;  3MC0 B;  3VR6 A;  1EY7 A;  1IHZ A;  1CM9 A;  1BCP D;  3M3Y B;  3U9S A;  4C3I G;  2FHT A;  4J8Q A;  5DNF A;  3K0Y A;  3Q0A A;  1JOO A;  4HED A;  3BVG A;  2F0M A;  4ZUJ A;  3J7A V;  4KJO A;  5JEA J;  4KKS A;  4IUU A;  2XNA C;  1A3U A;  5A2Q E;  1CHQ D;  1B53 A;  1KAA A;  1MD2 D;  3I3C A;  4V19 0;  1MI2 A;  1RCV D;  2XIW A;  1D5M C;  1QNU A;  2NUC A;  2ENB A;  2EJF C;  2SNM A;  1CI3 M;  3PIP 3;  4NKL A;  1ESR A;  3S1R B;  5K5P A;  2AWO A;  5FO7 B;  1Z7T A;  1F2Y A;  2WP8 J;  1FNW A;  1SYB A;  1LTA D;  4IN3 A;  4OHJ A;  1WD0 A;  1LLR D;  2KA7 A;  2JEA I;  4PMC A;  1QWY A;  4CGY B;  2K01 A;  1DXM A;  5IGB A;  1HUM A;  4HSP A;  3FDT A;  1F2Z A;  4C1N I;  2IPK D;  4BA2 I;  5C5M A;  1QG7 A;  4A3D B;  4TSS A;  1V1O A;  1DOK A;  4A3K B;  1HHV A;  2NBF A;  1KNE A;  2JYO A;  2A68 D;  1I6V C;  3TME A;  2A6E C;  1TWH B;  2F0I A;  5KNC A;  4IUN A;  4K5X A;  4DXF A;  3NUC A;  2RDG A;  1RHP A;  3A56 A;  4N9P A;  4YIJ A;  1NAP A;  3PIO 3;  1HA5 A;  2EXZ A;  1CZW A;  2NVY B;  3K6O A;  4ZQ3 A;  2L11 A;  3ONA B;  1J8I A;  1YNN C;  1EY4 A;  1BCP F;  2CW0 D;  2EYF A;  3VYU A;  1RTO A;  5T1G A;  4CKE A;  4XIG S;  2JP1 A;  3NWS A;  4DFA A;  1EYC A;  2BE5 D;  3S14 B;  3C3L A;  1DZ1 A;  1SND A;  2A69 C;  3D6C A;  1FNU A;  3HOY B;  5IT9 L;  1SYC A;  5KIX A;  4LAA A;  5EKK A;  1Y1W B;  1EY9 A;  2F0P A;  1I4R A;  1ZYR C;  3N6R A;  3RLF A;  3DEO A;  2E74 C;  2J4X A;  4MN3 A;  2K04 A;  5D65 A;  3UI2 A;  5JVG 3;  4KV6 A;  2XRS D;  2ID0 A;  4KD4 A;  1R4P B;  3D4W A;  2MP1 A;  4K2K A;  4C3H G;  1STG A;  4L6T B;  1EWC A;  1SDF A;  3WDN A;  1STH A;  1KLG D;  1D2B A;  3JAM L;  1Q8I A;  3M4O B;  1AP0 A;  1D5X C;  3BDC A;  2LS0 1;  4OL7 A;  2ZXO A;  2B2T A;  4EQO A;  5BN5 A;  1UNS A;  1JWM D;  3AU7 A;  2CQA A;  1JOR A;  1KLU D;  3GTP B;  2RQX A;  4L8J A;  3HP3 A;  2MJ8 A;  3V96 A;  3CHB D;  1RF2 D;  3I90 A;  3PUZ A;  1F9Q A;  5JVH 3;  1TKW B;  1GHJ A;  2HDL A;  1SNM A;  1CA5 A;  4H13 C;  2PW5 A;  1EEI D;  1XTC D;  5JAV A;  2G9D A;  1B2T A;  2PQE A;  5CR3 A;  1QCB D;  4N9T A;  3J81 E;  2DY8 A;  2RBM A;  4FF4 A;  4CJ0 B;  3W2D A;  1EU3 A;  1D1I A;  2DNC A;  4HCS A;  2WIN B;  3H3V C;  4WFN 3;  2K6A A;  3S1N B;  2JEB I;  2L0C A;  1RTN A;  4X3T A;  1ENF A;  4EVO A;  4O1N A;  4ULL A;  1GOZ A;  1NSN S;  2FFK B;  1LTS D;  2NTT A;  4IQZ A;  3TP7 A;  1KDC A;  1LAC A;  5C0X J;  3MVV A;  3S1Q B;  4KMU C;  2JSO A;  3GTO B;  3NQT A;  3PMF A;  1KNA A;  5M9O A;  1WD1 A;  2A73 B;  4A93 B;  2MPM A;  2BOS A;  2LKV A;  1CA6 A;  1LV9 A;  4XQJ A;  2F4I A;  1SE3 A;  1TS4 A;  3EQL C;  1STE A;  1B1Z A;  1YNN D;  1GUO A;  4KKT A;  1NR2 A;  1M4V A;  1H9J A;  3NHH A;  5CBA E;  2X6L A;  1BCP C;  3I4N B;  2XSC A;  5TSS A;  3QB3 A;  2SEB D;  3BVM A;  4K6D A;  5CV4 A;  5CMD A;  1I4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...