2K32A

Truncated acra from campylobacter jejuni for glycosylation studies
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
b'DVIIKPQVSGVIVNKLFKAGDKVKKGQTLFIIEQDQASKDFNRSKALFSQSAISQKEYDSSLATLDHTEIKAPFDGTIGDALVNIGDYVSASTTELVRVTNLNPIYADGSHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A
publication title NMR structure determination of a segmentally labeled glycoprotein using in vitro glycosylation.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Membrane protein, transport protein
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k32A00
2AUKA 2A6EC 3I4LA 1YNNC 2V4DA 3A8IE 1YNJC 1FR3A 3OOCA 1O78A 1CTMA 5KNBA 2JEBI 2F1MA 3BDOA 4IFDH 4G7HC 1ONLA 1OXVA 3D4RA 2EJMA 5K36H 3H94A 3LNNA 2O5IC 1OXXK 1H9MA 2D5DA 3OPOA 3M85A 3QJYA 3EQLC 4PV1C 2O5JC 4LK1C 2QF7A 3A7LA 3W3AA 2B8FA 1B9NA 4IQZA 4OO1H 3D31A 3OW7A 3A7AB 1GHJA 1OXSC 2EJFC 1VF5C 4L8JA 1K8OA 1IW7D 2KA7A 3HGBA 1IYUA 3I72A 4LJZC 1DCZA 3PUYA 2L5TA 2D62A 2YYZA 1GUNA 1B9MA 5C0XH 3PUVA 2EJGC 1Y69U 2BA1A 2BE5C 3KLRA 3PUXA 3SE0A 2NN6I 4DNTB 5BN4A 5JEAH 1HPCA 1HQMC 1E2VA 1TU2B 3GD7A 1G291 1CFMA 1VDZA 2K33A 3VR2A 2A68C 2EVBA 4H44C 2A69C 2PCFB 2JE6I 4DK0A 2PPBC 3T56B 2IT1A 1CI3M 1FYCA 2AUJD 3I73A 2D2CC 4KN7C 3U9SA 4KHZA 1GUTA 2R6GA 3QIAA 2E74C 2DNEA 3VR5A 3SDZA 5BN3A 2E75C 3AB9A 2CW0C 1Q1EA 1SMYC 4JK1C 3T51B 1Z6HA 2A6ED 3ND8A 3FPPA 2Q8IB 1Z7TA 1Q90A 2EDGA 2K7VA 4TKOB 4G7OC 3BG3A 3ND9A 3WDNA 1T5EA 4DK1A 4GZYC 4TQUS 1Q1BA 2A6HC 2BA0A 3P20A 5KNCA 1I6VC 3LWUA 1GUSA 2BDOA 3PV0A 4JBWA 3RLFA 4H13C 3M7NA 4I7ZC 3T53B 3IFTA 1Y8NB 4KMUC 2NN6G 2E76C 5C0XG 4G7ZC 3M4YA 1DXMA 1ZYRC 1Q12A 2LMCB 1EWHA 4DNRB 3VR3A 1HCZA 4H0LC 3DXJC 2B8GA 1PMRA 3PUZA 4HR7B 4IFDG 1DD2A 4BA2I 1BDOA 3TZUA 3VR4A 2BE5D 5K36G 1H9KA 1Y8OB 5KNDA 1H9SB 1TKWB 1ZKOA 2K32A 3A8JE 4KKTA 3IKJA 1A6XA 4KKSA 3L7ZC 1IW7C 3MFYA 4RCNA 1H9JA 1GHKA 1H9RA 1O7LA 1Y8PB 2A68D 3QG1A 5BN5A 1V43A 2A69D 2AWOA 2DNCA 4OO1G 1V8QA 4OGQC 1QJOA 3VR6A 1OXUA 1GJXA 4BA1I 1LABA 2KCCA 2PNRC 2JXMB 3CRLC 1OXTA 1LACA 4XIGS 3VA7A 3A8KE 3FMCA 1GUOA 1HTPA 1VCIA 1H9SA 4XTCS 5JEAG 2JEAI 4KI0A 1E2ZA 2DN8A 3CRKC 1VF7A 3PUWA 1GUGA 2ZT9C 4KKUA 4KN4C 3GQBA 3NE5B 2A6HD 3MXUA 2NN6H 1K8MA 5A35A 1IYVA 1E2WA 3N6RA
chains in the Genus database with same CATH superfamily
1UE7A 4YWMA 2YU9H 3TREA 1I4PA 1F2MA 1FNUA 5T1GA 3ER0A 4DPGA 4IFDH 2OT2A 2MUYA 1K28A 1B53A 5K5PA 1ZYRD 1KQSA 3PMFA 1Y14B 3QJYA 4C3JB 2VW9A 1SFOB 2VQEQ 1F9PA 3S1NB 2Q2IA 2UXBQ 3DMUA 3PF5A 1ENFA 3LWEA 1ESRA 3I4NG 4PQXA 1LLRD 3T1HL 3KK7A 3I72A 4LJZC 2QEJC 1DYQA 3PUYA 2D62A 4KY7A 4X3KA 4ZUIA 1GUNA 1L0WA 4A3BB 4POGA 5C4XB 4G4KA 2RDHA 2ZTCA 2RSNA 2RHSB 3G48A 4IUTA 4PMWA 5IY0A 1VQ5A 4KHPQ 1SYEA 4P73A 1TS5A 1XMOQ 2GA4B 3NP8A 1HR0Q 2XWJB 1ENCA 3STBC 4KHZA 3RZDH 3TS2A 2DNEA 3RZOB 3I4MH 2WKCA 2JA7H 2NZHA 1GD7A 2QCPX 2EY2A 1Z6HA 3A74A 1HUNA 4XYQA 1Q90A 1A0IA 2NYZD 1WTXA 4GZYC 5C4JH 3HOZH 2BA0A 4LF8Q 1I94L 1QB5D 3ERQA 4HMJA 5GADC 3NK9A 1UE5A 2B2WC 1JOOA 4B3RL 4LWCA 1L0YB 2F0IA 2OCEA 5C0XJ 4OWWB 3NHHA 1A62A 1DD2A 4MZ9A 2JJQA 1SNMA 2NUCA 2K05A 1LTSD 1XNQL 1RL2A 4X3UA 2WIIB 3OHXC 4P75A 3UE1A 1O7LA 1Y8PB 1QVCA 1GKHA 4OGQC 4BA1I 3STBD 1A2UA 3DWAA 3T1HQ 1SYBA 4RHSA 3FKIG 4B08A 1E2ZA 1Q46A 1HNXL 1STEA 3K7AB 2MHVA 4XDXA 1CUKA 1PH7A 3OW2A 2Y0SG 5LHY1 3A5UA 4RG1A 5KNBA 1VQ8A 1EY9A 1ZEQX 2FINB 1L1OB 3C1EA 1HFNA 3NSWA 4H7BA 4YWKA 1J9OA 2ZM6L 5ELOA 2RQXA 4ZK9B 3GTOH 1VQCA 2EJFC 1I94Q 3HGBA 1DGSA 1EYDA 1DCZA 3MZ5A 5IGFA 5JVH3 4MNOA 5C0XH 3W1GA 3CPWA 1Y69U 3KLRA 4KK7A 1LT6D 1YHAA 3CKIB 3CPFA 3IL8A 5C5LA 3OTOL 1KL9A 4B3RQ 3AEVA 2LXKA 4A3IG 3RD4A 1EQRA 2XNAC 2KENA 4RH6A 2XRSD 4JBJA 5FLMH 1XNQQ 5JPMC 1I3QH 3AB9A 1SR3A 3FPPA 4C3IG 5IYCH 2F0NA 3Q23A 1YITA 1I4GA 2R92H 4CDFC 3RN5A 4A3JH 3HOVB 3Q24A 3S14B 3GTPH 3HKZB 1XTDA 1PTOF 3BZCA 5EPJA 4GLXA 2GVBA 3CAMA 1WTPA 1BUVT 1D5ZC 3C46A 1Q8KA 1C9OA 1I6VC 1D2BA 4RGMA 3AFPA 3IFTA 3QO2A 1EY5A 1HNXQ 2Q8TA 3FRPB 4A76A 1V1QA 3P75A 3GTGB 2MO0A 3P7JA 4R4TA 1TR5A 3S1RB 1P8LA 3F2CA 3PUZA 5DM63 4HIKA 2F52A 1BDOA 2Q2HA 1VQ6A 1D5XC 2K32A 1A6XA 5ELEA 1BNZA 4BY7G 4JCVE 4TRDA 4U68A 3VYUA 2C35B 2F0LA 3E9IA 2ZM6Q 3Q22A 3J81E 2K04A 5BN5A 4BBRG 2DNCA 3Q0AA 1CHPD 4QJFA 2KBNA 2F0GA 4JI0L 3H3VC 2ENBA 5FLXE 1VMPA 1LTTD 4DV3L 3KF6A 4DU9A 4A3LH 5FJ8H 2HQLA 2ZJQA 3OTOQ 1PXUA 2LS01 1HR0W 2JA6H 2ZTDA 4EGVA 1LT3D 1XYIA 2AUKA 3NTHA 2WAQB 2IX3A 1M1KC 1QE6A 2M2LA 1QUQB 2SEBD 2PNHA 1NBWA 4G7HC 3D4RA 4C2MH 1TIID 1PA6A 5K36H 3F1ZA 2BH2A 3VYRA 4I65A 3CC2A 4K0KL 4L6TB 3EA6A 5IP9G 3J7A5 3S2HH 2N49A 4ULLA 4LK1C 2R93H 4MN3A 4X65Q 2ASBA 1HNZL 2WB1E 3GTLH 1BKBA 3A7LA 1EFID 1TQOA 5HGQA 4OO1H 4P2CB 4L8JA 1Q86C 3N52A 5IE8A 5C0XI 4C3JH 1SFOH 5EKLA 4OWXB 1AZQA 3IAYA 3S1NH 3NBHA 1PV4A 5M5YB 1CFMA 3TP6A 1NR4A 2F0EA 3VR2A 1JWSD 1UE6A 4JC0A 1F9SA 4LF5L 1E1OA 1KAWA 5G3LF 3H91A 1DJRD 4A3BH 3K5LA 3C1FA 2CW0C 5C4XH 4DV4L 1PVOA 3QR8A 4AYBB 4KV6A 1U4MA 1PTOC 3TEHB 4CDEC 2WFWA 3ULPA 3DEOA 5KNCA 4JI0Q 1RJTA 1MSGA 1GUSA 3PV0A 4N9TA 4KHVA 4H13C 4HCSA 5IT9c 4DV3Q 5C0XG 5M5WH 1EIGA 4BY1G 3OMGA 1C0AA 2QILA 5IYBG 2TMPA 4QL5A 1U4PA 1H9KA 2DY8A 1UNSA 2G9DA 2KHSA 4K0KQ 5IGGA 4GLAC 4E6IA 1EIFA 1KRTA 2YTVA 1OXUA 1HNZQ 2YTXA 2R92G 4MIUA 1S5BD 3VA7A 1OXTA 4CBVA 5EAYA 1PH9A 4J15A 2CW0D 2F3VA 3R2TA 2B3GA 2QGQA 4RA8A 4OIJA 3UDIA 1WTRA 3TSSA 1PTOD 1L0XB 1E2WA 5H1SE 4A75A 1PH8A 1EOVA 1YNJC 2K50A 4R9WA 1V1PA 5LMUL 3URYA 1CKNA 1PFBA 2F1MA 2PYKA 4LF5Q 1YJWA 2IY5B 1F9QA 3T16A 1Q3LA 1F9RA 1H9MA 1EZ6A 1GXDC 3OPOA 3K7AH 2B2UC 3RUZA 4DV4Q 4IUPA 2O5JC 3J7ZC 2R7ZB 1VQMA 3SK4A 5C4HA 1K83B 4PZ8A 5EPLA 2LY7A 1E22A 1K73C 2K14A 5JOBA 5DLQE 2CH4W 1DM0B 1FD7D 1SE8A 4OO1I 2RCNA 4FDBA 1DONA 4G57A 1JJCB 2KJXA 2PO4A 4K2KA 3X3NA 2KEEA 1HPCA 1LV9A 2PQAA 1M90C 2RBMA 2DJGC 3M3YB 2XVSA 2AMCB 2IT1A 5FKAC 2CWAA 1PZID 1IHZA 4GKKL 3QIAA 3K5NA 4NW2A 3OIQA 3RR5A 4JK1C 3CQZH 1TY0A 4HJAA 2MFIA 1YNJD 2E2JB 4A3KG 3UI2A 4JVZA 3I4MB 4CKBA 2JA7B 2P5ZX 3M7NA 2F0OA 3OYYA 5E3FA 1VQNA 5I9OA 2E2DC 1WOCA 4F87A 2X6LA 1QG7A 3MWYW 3IRBA 3HOVH 4C56C 4LFBL 1HCZA 3S14H 5I6WA 1C7YA 1D1IA 3DEPA 5LMUQ 1B4OA 4GOPA 2ZXRA 2KHIA 1NCVA 1TY2A 2N3SA 3R2IA 4A3BG 3GTGH 1SYFA 3OWFA 3BS1A 4DXFA 5G3LD 1X3QA 3ULLA 4QGUA 3S1RH 1LABA 3PIPA 1AFPA 1QZHA 4R4QA 2OF1A 5M3MB 3CCEA 1RDPD 2DN8A 3JC66 1BCPF 1X3GA 1YJ9A 1YHQA 1D8LA 1S5CD 1U9RA 4JI1L 3RLOA 2K6AA 1G6ZA 3NQIA 3MXUA 5KRUA 2DUDA 2I5HA 2VUMB 5AFWA 3I7FA 5IGBA 5ELCA 2F0TA 2E2HH 2E8GA 2Z4IA 4GKKQ 1B1ZA 4QIWE 2EYOA 4CJ2C 3I8ZA 3SK5A 3PO3B 1J5EL 4GN5A 3U4VA 1Q8IA 1WJJA 5IT9E 4XXEA 1TT2A 2B8FA 5FO8B 2EYJA 5A2QE 2YV5A 3J81j 2I46A 2NTTA 4DR7L 1DOMA 3W5OA 1CZWA 1GUWA 2VXWA 1ICWA 4RCOA 4QQBX 5IYDH 1ASYA 1HQMC 3A0JA 1TU2B 5FK9C 1UAPA 5CV8A 2UUAL 3HOYB 4LFBQ 4EVOA 1WTOA 2ICEC 3E9HA 5HGTA 2ZJPA 2QDLA 2KCTA 2VNUD 2Z6KA 1K8GA 1IZ6A 2O2LD 3KFUA 5M5YH 2R61A 2JYOA 2L0CA 3LGJA 3J80L 1N33L 3I90A 1CA6A 1RF2D 4DUYL 3HP3A 4LUVA 5KGUA 2L15A 1XPRA 1X32A 2EYFA 3SEBA 4JG2A 1PRTF 4Y7NH 4A3JB 3EVQA 2HUGA 4JI1Q 4DV1L 3CMEA 2PMZB 1DXMA 1EWIA 3ERSX 1GVPA 1STNA 4QMGA 4X64L 1SNOA 4IPHA 1QCBD 2NVYB 1ZKOA 2B63G 1K3RA 5D14A 2F03A 4PZ6A 2EY6A 2SNSA 1ASZA 2EPBA 4IJLA 1J5EQ 2VB3X 5AJ3L 1V8QA 4RMFA 2PI2E 4ZLTF 4A3GG 2FFKB 4DN4M 4XIGS 1ET9A 2EQSA 4CDCC 1KDBA 4K2LA 4XT1B 1ILQA 4DR7Q 5JEAG 1SNQA 2C9OA 5KYIA 3I91A 3PUWA 1LT4D 3GQBA 1GO3E 4JI8L 5CGKA 3L9AX 1BO0A 3GO5A 2UUAQ 2V4DA 1XPOA 4KJNA 4LUOA 1TS4A 3OOCA 3HKZG 1K0RA 1HFGA 3MHBA 4ME3A 2JEBI 4GKJL 1YHBA 4X3SA 2JA6B 1WD1A 2KOLA 5DAUA 3H3VH 4UHVA 2X69A 4R4CA 3D6WA 1HXYD 3OWEB 2QDBA 4IURA 3D31A 3R93A 2MP1A 4GOPC 1N33Q 1VS0A 4DUYQ 3J7AV 1HRJA 4C1NI 2UXDL 4DA2A 2BE5C 3SE0A 2AWNA 5BN4A 4DV1Q 3SK6A 3A55A 3S24A 2R7ZH 1CQVA 1K83H 1NNXA 4H44C 4JOIA 2WB1G 4DK0A 5IWAL 4X64Q 1VQPA 3HKSA 2D2CC 1A3TA 4OHJA 1ZXTA 3GDEA 5I2XA 3JAML 1E0BA 2B2TA 1TS2A 1K0SA 4CJ0B 2Q8IB 1EEFD 2R7DA 1FJGL 2AQ3B 4TKOB 1W2BA 1WFQA 5AJ3Q 3J81c 3M3YH 3GTKB 5JJIA 3KBXA 2WP8J 4R8NA 3MXNA 3KDFA 4J8QA 1WCMB 5FLXc 2CWPA 3H0GB 5GAGC 3OMCA 3E3XA 3CCLA 3L0OA 2MPMA 1CZGA 1Q12A 4BWGB 2B2YA 1JR0D 3VR3A 4JI8Q 2E2JH 4NXML 2RF4A 4LMQD 1LTRD 1R4PB 4UDUC 3PO2B 2BE5D 2ICIA 5M5WB 2N55A 4GKJQ 1PTOH 1O7IA 1JOKA 4QCLA 1T5XD 3F2BA 4M1UB 4C3HB 3G71A 1S72A 1I4XA 3MXGA 1V43A 3S9WA 2C5CA 3TP5A 1SE2A 3VR6A 4EX5A 3UDGA 4HN7A 4IPDA 4NXNL 2RCFA 2JQOA 2RDFA 4KLKA 1MJCA 4YCVA 4ZYSA 1H9SA 2EXZA 1MKHA 2UXDQ 4AQYL 2K03A 1EU3A 2Z6KC 3GTJB 2A1AA 3NE5B 3HOWB 1EY7A 1K8MA 3CXCA 1QVFA 2FMCA 4YY3L 1MBYA 1SJED 1M4VA 1MSHA 4NKLA 1EEID 5IP7H 1KLGD 5IWAQ 5C5MA 2F0DA 3BDOA 5M3MH 2IWHA 3D3RA 1HNWL 1OXXK 1NE3A 3NENA 4N8FA 1FJGQ 4IZ8A 3CCUA 3M4PA 1V1OA 2VUMH 1EY0A 3BVZA 2A8VA 1EOTA 1JMCA 1ET6A 1K8OA 5EBCA 1VF5C 2FXQA 1QILA 1IYUA 2EIFA 2Z4HA 1CA5A 4DR5L 3PUXA 5IGEA 2NN6I 3PO3H 2J0TD 1QWYA 2IX0A 1C48A 3FEWX 4JI3L 1SNCA 3WOFA 1VDZA 1S4ZA 2BCOA 3P1HA 1EUJA 1SMXA 4NXMQ 4IFDI 2PPBC 1K3BC 1X56A 5C3EB 4WJ3M 1NMFA 2WACA 1SE3A 1S5DD 1J6QA 2JA8B 4DAYA 3HOUB 1AH9A 1X3FA 1Z7TA 2EDGA 4G7OC 3HOYH 4IOAA 4NXNQ 3P20A 1BVSA 4GNXA 1BF4A 2OEOA 2MJ8A 3CQZB 5CMDA 2CKZB 4HAEA 2XN9C 4UY8C 1AW7A 5L37A 4OWTB 4DV7L 2NN6G 4AQYQ 5CV5A 4BBSB 1EWHA 1IL2A 4L5RC 1F2ZA 1PH6A 5ELNA 4UP9A 4YY3Q 2R7ZG 5C44B 1BOSA 5C3WA 4IFDG 2PQEA 2KVMA 2I07B 4ODGA 1YNXA 3L7ZC 4IO9A 1HNWQ 3J80i 4ILWA 4PZ7A 1AP0A 5JAVA 2EYHA 1R4QB 4JOIC 2AKWB 5EKIA 1E3PA 2EY5A 2K1BA 2K4KA 3CCRA 2NVYH 1MD2D 4R1JA 4OEMB 1EY8A 4DR5Q 1FGBD 4GS3A 4A3CH 4OL7A 4GN3B 4C1NK 1EY6A 1PFNA 4NDXA 4JI3Q 1E1TA 1NJIC 2EYLA 1ICFB 1FR3A 5EKKA 1B50A 3I4MG 5ISRA 5C3XA 3TBIB 2JA7G 2JK8A 1OXVA 3K6OA 3X3MA 4A3MB 1AE3A 2XGTA 3HKZE 4A3DB 3K80C 3HOZG 2E2HB 3C3LA 2XSCA 1XJVA 1PZKD 4A3FH 1GHJA 4JW0A 2KA7A 1EYAA 2L4NA 4YCUA 4DV7Q 1N9WA 5DEHA 1PFSA 3U9OA 3EN2A 4ZCKA 2RA4A 5IP7G 4QUFA 1Y1VH 2K5QA 1RIPA 3S16B 5COYA 1LTID 2WV6D 4A93B 4UP7A 5EJWA 2L55A 3ND9A 3CP0A 2A6HC 1BXTA 1EWCA 3K59A 4WORA 3LWUA 5GAEC 2B2VA 1EZ8A 1KXLA 2F0MA 4ZAIA 4FF4A 3U50C 2WAQE 5JJKA 4R8IA 3M4YA 5CYUA 2ZXPA 4NB3A 2IJ0A 4J6HA 3K8AA 3GTKH 4JI4L 1SRUA 1WTHA 4PMCA 4Y7NB 5J1ZA 3TZUA 4QY7A 1JORA 5KNDA 1TKWB 3HRZC 4KY5A 2JA5B 4RWSC 4KKSA 1WCMH 3H0GH 3B6YA 3GTQH 1PH4A 1EL0A 2RVLA 3MA2B 3D8GA 4AIMA 3S15B 1GJXA 1UUPA 1JWMD 2CHBD 3KF8A 4FNFA 3PO2H 1PZJD 4ALPA 4HMIA 4DGZA 1CT1D 4K6DA 1W6KA 3SK8A 3ZYYX 4IPGA 1GUGA 2Z9HA 4OONA 4IJHA 4C3HH 1KD1C 4Q5VA 3T13A 2A6HD 3V96A 1TVXA 3A56A 1YZ6A 2WINB 4GNXC 5FLMG 4DR6L 1JOQA 2NZ1D 1BR9A 1G2TA 4AYBE 2Z1CA 5IYCG 2K5HA 3GTJH 1E7ZA 3M85A 3FKIB 4A3JG 4EQNA 2RDGA 3HOWH 4DR4L 1SBBB 3NBIA 1S5FD 1I6HB 2Y0SB 3BYTB 1STBA 4ZRZA 4FF1A 4FF2A 1HUMA 3BJUA 3M4QA 1PH1A 4U673 1SYDA 5KEEA 1XNRL 3K5OA 1KC8C 3I2ZA 2BDNA 3FDTA 2NVXB 2K33A 2D0OA 4N8X1 4X3TA 1JC7A 4JI4Q 2JE6I 1EFWA 3U9SA 4K14A 1Q82C 3KJOA 2MNAA 1HJPA 5CORA 1HZCA 3GV3A 1EIYB 2NVQB 3WDNA 1T5EA 4LAAA 1XTCD 4V0BA 5CV6A 1JJGA 2ES2A 1DOKA 2PZTA 2FJ2A 4A3IB 5C3EH 2F0JA 2BDOA 3PIOA 4A3LG 2K5DA 1RKNA 5FJ8G 1YBYA 4KJOA 1NSNS 4KMUC 1SNPA 2JA6G 2JA8H 3HOUH 1IYJB 1STHA 3NTKA 4BXXH 3G4SA 1EU4A 2LMCB 4RGTA 4WJ4A 3V2TA 1AN8A 3M7GA 1TWAB 3AQQA 3CHBD 5C4ZA 1A15A 1BBWA 1Y8OB 5K36G 3IFDA 3S1MB 4DR6Q 1CSPA 2ATWA 4FO2A 1SAPA 1VMCA 1BBUA 1IW7C 3MEFA 4M8AA 3RNUA 2R93G 4O2DA 3WOEA 4BBSH 4FYDA 4K5WA 3D6CA 1LTLA 3ICEA 4R4IA 4DR4Q 1VQGA 4OO1G 3M9BA 3S1QB 2NVTB 1PTOB 4WJWA 1A8VA 2X6GA 5C44H 1TWCB 1AE2A 1LACA 4DR2L 1CM9A 5CC4A 4N9PA 1WI5A 1VCIA 4C3JG 4FVMA 1FNVA 4KI0A 5GAHC 4EQPA 2VY3A 1XNRQ 2ZT9C 1VQHA 4BY7B 2EYMA 4LFAL 4F88A 1CQFA 1HZAA 1T9HA 1O78A 2D9UA 2K01A 2B2VC 2SNMA 5C4XG 2BH8A 4O1NA 2F0UA 1IKMA 3LNNA 2EZVA 2IX1A 2RKSA 3PF4A 1HA5A 5LMNL 4YHHL 2LXJA 3BDCA 1KHIA 3SVMA 2L9HA 3A7AB 5E4XA 1IW7D 3D4WA 4L63B 5I4DA 4A3MH 1L1OA 2CH4A 4K6LA 3MFGA 2QKIC 4A3DH 1I5FA 3HOXB 4OXPA 3GD7A 1RD9D 3AMUA 3K7UC 3AFQA 3KUPA 1X54A 2XTIA 1G91A 3VYTA 1CI3M 1ML0D 3E0EA 1GUTA 2R6GA 2PZWA 3RLNA 3FPUB 3CCQA 4K8IA 4FXGC 3T51B 4JBMA 2AQ1B 4DV2L 1UWVA 4DK1A 4WFN3 3HEJA 5M9OA 1VQAA 2ZXOA 3QOLA 4DR2Q 3I4NH 3DWPA 2F3IA 1PHJA 3BZKA 1VQOA 3L3OC 4QUCA 4ZKCB 2E76C 1X3EA 3S16H 2UU9L 3KOJA 4A93H 3FHWA 1A3VA 2PW5A 2OTLA 4LFAQ 4H0LC 3DXJC 1R9TH 4DAVA 2NBFA 1U4RA 1HHVA 1X9NA 1TWHB 4BS9A 4Y52H 2Q2TA 4UAIA 3KF6B 4IUUA 3A54A 4DUZL 3NUCA 4FXDA 1STYA 2HHHL 3RMHA 4FP5D 1B2TA 5LMNQ 4OX9L 4YHHQ 1JB3A 1XXGA 3D4DA 4GLVB 4BY1B 1PH3A 1U0LA 2K28A 4NPSA 2JA5H 1HZBA 1SYCA 3TP8A 3Q8DA 2JA9A 5C3EG 4B3ML 2HIXA 3BVMA 4X66L 1WTQA 5CBAE 1NMGA 3S15H 3O13A 1VQJA 2JSOA 2L1BA 4MTNA 3OIPA 1CTMA 1JE4A 2OXPA 3KYHC 4NMZA 2K75A 2O5IC 1YJNA 3NTIA 3BYYB 3NBHB 1MI2A 4XT3B 4DV2Q 2N8NA 3HG9A 1BCPC 1S5ED 2QF7A 1RTNA 2HQEA 4IQZA 2SDFA 3OW7A 1JT8A 2JP1A 4DK6C 2QA4A 2PMZE 1XMQL 1PLFA 1VQBA 1B9MA 2K5WA 2YYZA 3PUVA 5J39A 1X55A 1QZGA 4JI2L 1YIJA 3TRZA 5DNFA 4I7AA 3J80E 2DY7A 3FKIH 5E1FA 4A3FB 3BVGA 1Y1WB 3HOVG 2UU9Q 1RODA 2R7FA 2DGYA 2OWOA 2A68C 2PCFB 1I6HH 3CCVA 2HDLA 3I55A 5KYLA 2DJFC 2F0KA 3I73A 5FOBB 4KHPL 2E74C 3CU7A 3VR5A 5BN3A 1H95A 4P71A 4TSSA 4DUZQ 1S3OA 2HHHQ 5CR3A 3ND8A 4ME5A 5M3FB 4APVA 2NVXH 4OX9Q 1Q1BA 1Y1VB 3KLSA 4IUNA 3OSOA 4JBWA 3T53B 4B3MQ 1VQIA 1SN8A 5IOCA 2NVQH 1BCPD 4X66Q 2I5MX 4HJ8A 3MVVA 1W3SA 2MQHA 5E7NA 4A3KB 3VR4A 4A3IH 1L1OC 1K9MC 3EBEA 2AHOB 1SROA 4PNYA 1GHKA 3PIO3 1OO9B 2L12A 2A68D 4H02A 2WAQG 3C2PA 3J7AF 2F0SA 4C3IH 1PRTC 1V1PB 1XPUA 1TWAH 1CKNB 1MGSA 3A8KE 4DXGA 3GTQB 3S1MH 1CKMA 3R8BA 4RFBA 1TS3A 1VQKA 2J4XA 2FMMA 5IYDG 4JI2Q 1IKLA 1XMQQ 2VQFL 1VF7A 4JV5L 3H6MA 2NVTH 3S1QH 1DOLA 4A93G 1TWCH 2Z8LA 1SE4A 1FNWA 2J7ZA 4X6AH 4J1MA 2F4VL 3S17B 2PQAB 1XX8A 4PG3A 2FHTA 3GTMB 4BY7H 3TZDA 1JCKB 1CHQD 1KTKA 4HJ5A 3J7YW 4BBRH 2KHJA 3JAME 4P74A 4L5TA 1OXSC 3F2DA 4DV5L 1BCPB 1I50B 4DNIA 2EJGC 4JI5L 2I5LX 2JA5G 3ITPA 4AYBG 3TS0A 1PRTD 5IGCA 4CKCA 2ID0A 5JVG3 3PIP3 1HZ9A 2Q8RE 1PYSB 1ENAA 3FP9A 2EVBA 2V1CC 4OELB 2AUJD 4KN7C 5EGTA 4YWLA 3H3VI 1O7YA 1VQ4A 2KEDA 1SYGA 5LMNW 3H15A 3CCJA 3SDZA 4JYAL 5ELBA 1G2SA 3ULJA 1Q1EA 4POFA 4HIMA 3LX0A 3HOXH 5JJZA 5IP9H 4LFCL 1LUZA 1HQRD 3E6ZX 1WD0A 3H09A 4GOPB 2CQAA 2H5XA 1A2TA 1MJEA 2EY1A 2RSOA 1JB7A 1YI2A 2OQKA 2VQFQ 2WKDA 4JV5Q 4HSVA 1CSQA 1IBML 2E5LL 1WYDA 5CV9A 1SXTA 5KIXA 1PMRA 2HCIA 1G8ZD 1VQLA 2XWBB 4KKTA 2F4VQ 2F0HA 1GOZA 1RHPA 1WTVA 2AWOA 2CFMA 4HCEA 1QJOA 3ONAB 2JXMB 4DR1L 5IGDA 1BQQT 1TWHH 1VQ7A 1PRTB 5IODA 3CC4A 1C4QA 4DV5Q 2N88A 2JEAI 4B3TL 4LF6L 3VA5A 4DAPA 4DF7A 4JI5Q 2B63B 4ID6A 4KN4C 1IBLL 2K52A 2MGSA 1VQ9A 2A6EC 4BY1H 4JI6L 5IYBH 3K0XA 2F0VA 4A3GB 3J81L 3T1YL 2KECA 2GN5A 1L2FA 3TQYA 2H1EA 2D5DA 4JYAQ 1IXRA 4YIJA 4PV1C 3NWSA 1B3AA 4YCWA 3FVQA 5FLXL 1B3QA 3M4OB 1WVLA 3TN2A 4LFCQ 3K0YA 2B2TC 1EIHA 1VQFA 4X65L 3VYSA 2HCCA 4UPAA 2KCMA 1Z47A 1SDFA 2ALYB 3HFZB 3CCSA 1IBMQ 2E5LQ 3TMEA 1I4HA 1A63A 1WTWA 1KNAA 4DKAC 2UUBL 2B2UA 2ZTEA 2GVAA 2B2YC 2RHQB 5T1IA 4A3EB 2N78A 3BZDB 3DM3A 4HIOA 1SMYC 2A6ED 4AH6A 4K5VA 1Y1WH 2G9HD 3NEMA 2M9VA 2EOTA 1B8AA 4HEDA 1A3UA 1JWUD 2HDMA 2TSSA 4DR1Q 3KLWA 2WB1B 1Q81C 4ZQ3A 2M00A 2NB0A 4I7ZC 1Y8NB 1QNUA 3RN2A 3AU7A 4B3TQ 4LF6Q 5M3FH 2E2IH 3I4NB 1IBLQ 2R3ZA 1O7ZA 4UP8A 3G6JB 4JI6Q 2PI2A 5M3MG 1NTGA 2F0WA 3I3CA 1MHWC 1SEBD 1AEXA 3T1YQ 1Q7YC 1P16A 3IKJA 4RHRA 5J22A 5M5XB 3U58A 1I4QA 3MFYA 4RCNA 2L11A 2VUMG 1R9TB 1EYGA 1UEAB 2NZOA 3QG1A 4HIDA 2PW7A 1UE1A 4IUVA 3HOXG 1LM0A 1MIUA 5BR8L 1QVGA 3S2DB 5J3BA 1UEBA 5EBDA 4A3KH 3FMCA 3W2DA 1TWGH 1SMYD 2XRQD 1KIXA 4LF9L 3PO3G 2KQ3A 3I56A 3CRKC 3GV6A 4B9XA 1HTLD 2A73B 4DFAA 2MO1A 3KBGA 3MEHA 3JAMi 1IYVA 1D5MC 5A35A 5F2DA 3A8IE 5D65A 4XQJA 4LNQA 2UUBQ 1QOHA 3NELA 4CKEA 1ONLA 2IPKD 2EJMA 4KD3A 3H94A 4TVAB 1LTAD 3GP7A 1PFMA 3EQLC 5CV7A 1N8RC 4JPBW 3HOYG 2ZJRA 2H4OA 1PH5A 1LYLA 3DHQA 3W3AA 4DAMA 1SSOA 2D0PA 3KJPA 2L5TA 4O0AA 4Q0FA 4S3SA 5EQ0A 1D6EC 3EFXD 2BA1A 4DNTB 3S17H 4LUZA 1RCVD 3GTMH 4V190 3RZOH 1HA6A 1G291 3UDFA 1EQTA 5GROA 2A69C 4IOCA 3MXNB 2F4IA 5D3IB 3I4OA 4O42A 4EQ5A 5I9PA 3KDFB 4X62L 1I50H 1G6PA 2PZUA 1LO5D 1FGUA 4IUQA 1X6OA 1LTBD 1TWFB 1HH2P 3NPPA 1N34L 3QB3A 4RAUC 3NQTA 4PMBA 4TQUS 5BR8Q 1SNDA 4RKLA 4HJ9A 2OTJA 5E4WC 4B3SL 4LF9Q 4A3CG 3NWTA 4A4IA 4G7ZC 2BOSA 4ZUJA 4NP5A 3D0FA 4DNRB 1YEZA 1RTOA 4LF7L 1IL8A 1JICA 2B29A 4L5QA 5JEAJ 3CW2C 4FXKC 4BA2I 1NR2A 3ZJYC 3MXPA 1H9SB 3CC7A 1F2LA 3A8JE 2AQ2B 4CHTB 1I4RA 1H9JA 3MC0B 4DR3L 2A69D 2Y0SE 1B44D 4A3FG 1Y1WG 3KLSX 3NXWA 3QWNA 2YU9B 4FF3A 5C6AA 1NUCA 1LT5D 1SJHD 4JI7L 2UXCL 4RGNA 4C3IB 2A5HA 1VQEA 4WRDA 1JJ2A 3J80c 4XYOA 5M3FG 2F0FA 3I4LA 1YNNC 4IALA 2VL6A 2Q2UA 3SHLA 4F7XA 3UE0A 3K81C 1Y1VG 4ZKBB 2SOBA 1K8AC 4X62Q 4KTAA 2Z0SA 2CQOA 4F8MA 1D7QA 2B63H 4IPCA 1YVCA 2K5VA 1N34Q 2EE1A 2IW3A 4DK3C 3L2PA 1B9NA 2KUMA 3QOJA 4R4OA 4HJ7A 2UUCL 4A3GH 4K5XA 3RZDB 1STAA 4JBKA 1B7YB 3PQIA 4B3SQ 3CMAA 4DAYB 2B39A 5CV4A 1W6JA 1BBXC 2HT1A 1EY4A 4BBRB 2KCNA 2F0PA 1Z9FA 5NUCA 3HS0C 5JEAH 3AYHB 3CCMA 3J81i 3M4OH 1IBKL 4GN4B 5C4JB 3HOZB 4LF7Q 4GNXB 3MAQA 1E24A 3F8TA 1WCMG 3H0GG 3K57A 1N32L 4LF4L 4XQQA 5IT9L 2E75C 1EYCA 1J8IA 3EIVA 5A2QL 1YNND 4DR3Q 2K7VA 4QIWB 5IIFA 1SLJA 3Q6SA 5GQOA 3PO2G 5FO9B 1KAAA 1M8AA 4RGOS 1KLUD 3UDXA 4DV0L 2HD3A 4A3EH 2IL8A 4JI7Q 1PYWD 4C3HG 2UXCQ 4QF4A 4OIKA 5DM73 3CD6A 1GM5A 1QNKA 3U4ZA 5HURA 1PDQA 2YTYA 4Z9CB 1DZ1A 4P72A 2B8GA 4HR7B 5ELFA 2HIVA 1F77A 1V9PA 4CJ1B 4EQOA 1STGA 2NTSA 4KY6A 3T4AC 3HOWG 2EXDA 2F3WA 3HZXA 4LW1A 5I2YA 4DV6L 5ELDA 2VB2X 3E0JA 3MTSA 2KCCA 2JN4A 2PNRC 1NY4A 5JPNC 3CRLC 2K5NA 3EJIA 3JAMc 2G5DA 2UUCQ 1HTPA 5LL6S 3PCOB 5M5XH 4K8JA 1N36L 2LFNA 4KKUA 2EYPA 3DUZA 1X65A 1NAPA 5TSSA 1ESFA 3PSIA 3N6RA 1O80A 1IBKQ 1X3PA 4L5SA 1JE5A 4IN3A 3S2DH 3GTOB 2A74C 4MTKA 4CDDC 2F0QA 1FL0A 1B70B 1D1KA 3PGZA 2XIWA 1G51A 1N32Q 4RKBA 4LF4Q 3W1BA 1LTGD 2B2WA 3DWQA 2I0QA 2CVRA 3I70A 3TP7A 1KDAA 2QEXA 1XWEA 3BDLA 4MHEA 4DV0Q 1C8CA 1PH2A 4KD4A 2JA8G 1U5KA 3E5SA 3HOUG 1I3QB 4BXXG 3WWVA 1KDCA 3CF5A 2IHFA 1PYBA 4HSPA 3G6EA 1E2VA 2R92B 2A19A 1ILPA 3GTPB 3EROA 1JQYD 3TDQA 3T56B 1FYCA 4CGYB 3K5MA 4XQNA 1KNEA 4B9WA 2Z6BA 4BBSG 1KRSA 3DLLA 2VQEL 1KABA 5CBEE 2UXBL 4IFDJ 5C44G 3SR1A 3BG3A 2IHEA 1QUQA 4DV6Q 2NWGA 3VDYA 5I6YA 3RLFA 1S40A 2CCZA 1EQQA 1EQVA 3SXHA 1F2YA 4HTHA 3SGIA 1N36Q 4QB4A 2VS1A 1CK1A 3BU2A 1II3A 1TWFH 1ZYRC 3A5ZB 5HY6A 3G7LA 3K58A 3KF8B 3R3OA 1XMOL 2OQ0A 1HR0L 2E2IB 5FO7B 1FVIA 1OTCA 2LSSA 2O4XA 1H9RA 5EPKA 5LL6X 2LKVA 3V05A 2VZAA 4LF8L 2QW7A 3DM1A 4A3MG 1TXYA 4ABNA 1GUOA 4XTCS 4C2MB 5JJLA 5D3DA 4A3DG 4A3EG 1U4LA 1VQDA 1CKOA 1AZPA 3S2HB 3F2UA 2NN6H 2R93B 3GTLB 1TWGB
chains in the Genus database with same CATH topology
1I4PA 1F2MA 1FNUA 5T1GA 4IFDH 2OT2A 2MUYA 1B53A 5K5PA 1ZYRD 3PMFA 3QJYA 4C3JB 1SFOB 1F9PA 3S1NB 3DMUA 1ENFA 3LWEA 1ESRA 4PQXA 1LLRD 3KK7A 3I72A 4LJZC 2QEJC 1DYQA 3PUYA 2D62A 4KY7A 4X3KA 4ZUIA 1GUNA 4A3BB 5C4XB 4G4KA 2RDHA 2RSNA 4IUTA 4PMWA 1SYEA 1TS5A 2GA4B 3NP8A 2XWJB 1ENCA 4KHZA 2DNEA 3RZOB 2WKCA 2QCPX 2EY2A 1Z6HA 1HUNA 4XYQA 1Q90A 2NYZD 1WTXA 4GZYC 2BA0A 1QB5D 3ERQA 4HMJA 3NK9A 2B2WC 1JOOA 1L0YB 2F0IA 5C0XJ 3NHHA 1DD2A 1SNMA 2NUCA 2K05A 1LTSD 4X3UA 2WIIB 3OHXC 1O7LA 1Y8PB 4OGQC 4BA1I 1A2UA 3DWAA 1SYBA 4RHSA 4B08A 1E2ZA 1STEA 3K7AB 2MHVA 4XDXA 5LHY1 5KNBA 1EY9A 1ZEQX 2FINB 3C1EA 1HFNA 3NSWA 4H7BA 1J9OA 2RQXA 4ZK9B 2EJFC 3HGBA 1EYDA 1DCZA 3MZ5A 5IGFA 5JVH3 5C0XH 1Y69U 3KLRA 4KK7A 1LT6D 3CKIB 3IL8A 5C5LA 3RD4A 2XNAC 4RH6A 2XRSD 5JPMC 3AB9A 4C3IG 3FPPA 2F0NA 3Q23A 1I4GA 3HOVB 3Q24A 3S14B 3HKZB 5EPJA 1PTOF 1WTPA 1BUVT 1D5ZC 3C46A 1I6VC 1D2BA 4RGMA 3IFTA 3QO2A 1EY5A 2Q8TA 3FRPB 3P75A 3GTGB 3P7JA 1TR5A 3S1RB 3PUZA 5DM63 1BDOA 1D5XC 2K32A 1A6XA 5ELEA 1BNZA 4TRDA 4U68A 3VYUA 2F0LA 3Q22A 3J81E 2K04A 5BN5A 3Q0AA 2DNCA 1CHPD 2F0GA 3H3VC 2ENBA 5FLXE 1VMPA 1LTTD 4DU9A 1PXUA 2LS01 4EGVA 1LT3D 1XYIA 2AUKA 3NTHA 2WAQB 2IX3A 1QE6A 2M2LA 2SEBD 4G7HC 3D4RA 1TIID 5K36H 3VYRA 4I65A 4L6TB 3EA6A 4ULLA 4LK1C 4MN3A 3A7LA 1EFID 1TQOA 4OO1H 4P2CB 4L8JA 3N52A 5C0XI 5EKLA 1AZQA 3IAYA 3NBHA 5M5YB 1CFMA 3TP6A 1NR4A 2F0EA 3VR2A 1JWSD 1F9SA 5G3LF 3H91A 1DJRD 3K5LA 3C1FA 2CW0C 4AYBB 4KV6A 1U4MA 1PTOC 3DEOA 5KNCA 1RJTA 1MSGA 1GUSA 3PV0A 4N9TA 4KHVA 4H13C 4HCSA 5C0XG 1EIGA 3OMGA 2QILA 2TMPA 1U4PA 1H9KA 2DY8A 1UNSA 2G9DA 2KHSA 5IGGA 4E6IA 1OXUA 4MIUA 1S5BD 3VA7A 1OXTA 4CBVA 2CW0D 2F3VA 3R2TA 4RA8A 4OIJA 1WTRA 3TSSA 1PTOD 1L0XB 1E2WA 1YNJC 4R9WA 1V1PA 3URYA 1PFBA 2F1MA 2PYKA 1F9QA 3T16A 1Q3LA 1F9RA 1H9MA 1EZ6A 1GXDC 3OPOA 3RUZA 2B2UC 4IUPA 2O5JC 2R7ZB 3SK4A 5C4HA 1K83B 5EPLA 2LY7A 5JOBA 1DM0B 1FD7D 4OO1I 1DONA 4G57A 2KJXA 2PO4A 4K2KA 3X3NA 2KEEA 1HPCA 1LV9A 2RBMA 3M3YB 2XVSA 2IT1A 5FKAC 1PZID 1IHZA 3QIAA 3K5NA 4NW2A 3OIQA 4JK1C 1TY0A 1YNJD 2E2JB 3UI2A 3I4MB 4CKBA 2JA7B 3M7NA 2F0OA 5E3FA 5I9OA 2E2DC 4F87A 2X6LA 1QG7A 3MWYW 4C56C 1HCZA 5I6WA 1D1IA 3DEPA 1B4OA 2ZXRA 1NCVA 1TY2A 3R2IA 1SYFA 3OWFA 3BS1A 4DXFA 5G3LD 1X3QA 1LABA 1AFPA 2OF1A 5M3MB 1RDPD 2DN8A 1BCPF 1U9RA 1S5CD 2K6AA 1G6ZA 3NQIA 3MXUA 5KRUA 2VUMB 5AFWA 5IGBA 5ELCA 2F0TA 2Z4IA 1B1ZA 2EYOA 4CJ2C 3I8ZA 3SK5A 3PO3B 1Q8IA 5IT9E 4XXEA 1TT2A 2B8FA 5FO8B 2EYJA 5A2QE 2I46A 2NTTA 1DOMA 1CZWA 1GUWA 2VXWA 1ICWA 4RCOA 1HQMC 1TU2B 5FK9C 1UAPA 5CV8A 3HOYB 4EVOA 1WTOA 2ICEC 5HGTA 2VNUD 2O2LD 2R61A 2JYOA 2L0CA 3J80L 3I90A 1CA6A 1RF2D 3HP3A 5KGUA 1X32A 2EYFA 3SEBA 1PRTF 4A3JB 3EVQA 2HUGA 2PMZB 1DXMA 1STNA 4QMGA 1SNOA 1QCBD 2NVYB 1ZKOA 5D14A 2F03A 2EY6A 2SNSA 2EPBA 2VB3X 1V8QA 4ZLTF 2FFKB 4DN4M 4XIGS 1ET9A 1KDBA 4K2LA 4XT1B 1ILQA 5JEAG 1SNQA 2C9OA 5KYIA 3I91A 3PUWA 1LT4D 3GQBA 5CGKA 3L9AX 1BO0A 3GO5A 2V4DA 4KJNA 1TS4A 3OOCA 1HFGA 3MHBA 2JEBI 4X3SA 2JA6B 1WD1A 2KOLA 5DAUA 2X69A 3D6WA 1HXYD 3OWEB 2QDBA 4IURA 3D31A 3R93A 2MP1A 3J7AV 1HRJA 4C1NI 4DA2A 2BE5C 3SE0A 2AWNA 5BN4A 3SK6A 3A55A 1CQVA 4H44C 4DK0A 2D2CC 1A3TA 4OHJA 1ZXTA 5I2XA 3JAML 1E0BA 2B2TA 1TS2A 4CJ0B 2Q8IB 1EEFD 2AQ3B 4TKOB 3GTKB 3KBXA 2WP8J 4R8NA 3MXNA 4J8QA 1WCMB 3H0GB 3OMCA 2MPMA 1CZGA 1Q12A 4BWGB 2B2YA 1JR0D 3VR3A 4LMQD 1LTRD 1R4PB 4UDUC 3PO2B 2BE5D 2ICIA 5M5WB 2N55A 1PTOH 1JOKA 4QCLA 1T5XD 4M1UB 4C3HB 1I4XA 3MXGA 1V43A 3S9WA 2C5CA 3TP5A 1SE2A 3VR6A 4HN7A 2RDFA 4ZYSA 1H9SA 2EXZA 2K03A 1EU3A 3GTJB 3NE5B 3HOWB 1EY7A 1K8MA 2FMCA 1MBYA 1SJED 1M4VA 1MSHA 4NKLA 1EEID 1KLGD 5C5MA 2F0DA 3BDOA 2IWHA 3D3RA 1OXXK 4IZ8A 1V1OA 1EY0A 3BVZA 1EOTA 1ET6A 1K8OA 5EBCA 1VF5C 1QILA 1IYUA 2Z4HA 1CA5A 3PUXA 5IGEA 2NN6I 2J0TD 1QWYA 2IX0A 1C48A 3FEWX 1SNCA 3WOFA 1VDZA 1S4ZA 2BCOA 3P1HA 4IFDI 2PPBC 5C3EB 2WACA 1SE3A 1S5DD 2JA8B 4DAYA 3HOUB 1Z7TA 2EDGA 4G7OC 3P20A 1BF4A 2OEOA 2MJ8A 3CQZB 5CMDA 4HAEA 2XN9C 1AW7A 2NN6G 5CV5A 4BBSB 1EWHA 1F2ZA 5C44B 1BOSA 5C3WA 4IFDG 2PQEA 2KVMA 2I07B 4ODGA 3L7ZC 4ILWA 1AP0A 5JAVA 2EYHA 1R4QB 5EKIA 2EY5A 2K1BA 1MD2D 1EY8A 1FGBD 4OL7A 4C1NK 1EY6A 1PFNA 4NDXA 2EYLA 1FR3A 5EKKA 1B50A 5ISRA 5C3XA 3TBIB 3X3MA 1OXVA 3K6OA 4A3MB 4A3DB 2E2HB 3C3LA 2XSCA 1PZKD 1GHJA 2KA7A 1EYAA 2L4NA 5DEHA 3U9OA 2RA4A 4QUFA 2K5QA 3S16B 5COYA 1LTID 2WV6D 4A93B 5EJWA 2L55A 3ND9A 2A6HC 1BXTA 1EWCA 3K59A 4WORA 3LWUA 2B2VA 1EZ8A 2F0MA 4ZAIA 4FF4A 4R8IA 3M4YA 5CYUA 2ZXPA 2IJ0A 4J6HA 4PMCA 4Y7NB 5J1ZA 3TZUA 1JORA 5KNDA 1TKWB 3HRZC 4KY5A 2JA5B 4RWSC 4KKSA 1EL0A 2RVLA 3MA2B 3D8GA 3S15B 1GJXA 1UUPA 1JWMD 2CHBD 3KF8A 4FNFA 1PZJD 4HMIA 4DGZA 1CT1D 4K6DA 1W6KA 3SK8A 3ZYYX 1GUGA 4Q5VA 3T13A 2A6HD 3V96A 1TVXA 3A56A 2WINB 1JOQA 2NZ1D 1BR9A 1G2TA 2Z1CA 3M85A 3FKIB 4EQNA 2RDGA 1SBBB 3NBIA 1S5FD 1I6HB 2Y0SB 3BYTB 1STBA 4ZRZA 4FF1A 4FF2A 1HUMA 4U673 1SYDA 5KEEA 3K5OA 2BDNA 3FDTA 2NVXB 2K33A 4X3TA 1JC7A 2JE6I 3U9SA 4K14A 5CORA 3GV3A 2NVQB 3WDNA 1T5EA 4LAAA 1XTCD 4V0BA 5CV6A 1DOKA 2PZTA 2FJ2A 4A3IB 2F0JA 2BDOA 2K5DA 1RKNA 4KJOA 1NSNS 4KMUC 1SNPA 1STHA 3NTKA 1EU4A 2LMCB 4RGTA 3V2TA 1AN8A 3M7GA 1TWAB 3CHBD 5C4ZA 1A15A 5K36G 1Y8OB 3IFDA 3S1MB 4FO2A 1SAPA 1VMCA 1IW7C 4M8AA 3WOEA 4FYDA 4K5WA 3D6CA 4OO1G 2NVTB 3S1QB 1PTOB 4WJWA 2X6GA 1TWCB 1LACA 1CM9A 5CC4A 4N9PA 1VCIA 4C3JG 4FVMA 1FNVA 4KI0A 4EQPA 2ZT9C 4BY7B 2EYMA 4F88A 1CQFA 1O78A 2D9UA 2K01A 2B2VC 2SNMA 4O1NA 2F0UA 1IKMA 3LNNA 2EZVA 2IX1A 2RKSA 1HA5A 3BDCA 3SVMA 2L9HA 3A7AB 5E4XA 1IW7D 3D4WA 4L63B 5I4DA 4K6LA 3MFGA 2QKIC 3HOXB 3GD7A 1RD9D 3AMUA 3KUPA 1G91A 3VYTA 1CI3M 1ML0D 1GUTA 2R6GA 2PZWA 3FPUB 4K8IA 4FXGC 3T51B 2AQ1B 4DK1A 4WFN3 3HEJA 5M9OA 2ZXOA 3QOLA 3DWPA 3L3OC 4QUCA 4ZKCB 2E76C 1A3VA 2PW5A 4H0LC 3DXJC 4DAVA 2NBFA 1U4RA 1HHVA 1TWHB 4BS9A 4UAIA 4IUUA 3A54A 3NUCA 4FXDA 1STYA 3RMHA 4FP5D 1B2TA 1JB3A 1XXGA 3D4DA 4BY1B 2K28A 1SYCA 3TP8A 3BVMA 1WTQA 5CBAE 3O13A 2JSOA 2L1BA 3OIPA 1CTMA 1JE4A 2OXPA 4NMZA 2O5IC 3NTIA 3BYYB 1MI2A 4XT3B 3HG9A 1BCPC 1S5ED 2QF7A 1RTNA 2HQEA 4IQZA 2SDFA 3OW7A 2JP1A 1PLFA 2YYZA 1B9MA 2K5WA 5J39A 3PUVA 5DNFA 3J80E 2DY7A 5E1FA 4A3FB 3BVGA 1Y1WB 1RODA 2A68C 2PCFB 2HDLA 5KYLA 2F0KA 3I73A 5FOBB 2E74C 3CU7A 3VR5A 5BN3A 4TSSA 5CR3A 3ND8A 4ME5A 5M3FB 1Q1BA 1Y1VB 3KLSA 4IUNA 3OSOA 4JBWA 3T53B 5IOCA 1BCPD 3MVVA 4A3KB 3VR4A 4PNYA 1GHKA 3PIO3 1OO9B 2L12A 2A68D 3C2PA 3J7AF 2F0SA 1PRTC 1V1PB 1MGSA 3A8KE 4DXGA 3GTQB 3R8BA 4RFBA 1TS3A 2J4XA 2FMMA 1IKLA 1VF7A 3H6MA 1DOLA 2Z8LA 1SE4A 1FNWA 2J7ZA 4J1MA 3S17B 1XX8A 2FHTA 3GTMB 3TZDA 1JCKB 1CHQD 1KTKA 3J7YW 3JAME 1OXSC 1BCPB 1I50B 2EJGC 3ITPA 1PRTD 5IGCA 4CKCA 2ID0A 5JVG3 3PIP3 2Q8RE 1ENAA 2EVBA 2AUJD 4KN7C 5EGTA 1O7YA 2KEDA 1SYGA 3SDZA 5ELBA 1G2SA 1Q1EA 3LX0A 5JJZA 1HQRD 3E6ZX 1WD0A 3H09A 2CQAA 1A2TA 2EY1A 2RSOA 2WKDA 4HSVA 5CV9A 1SXTA 5KIXA 1PMRA 2HCIA 1G8ZD 2XWBB 4KKTA 2F0HA 1GOZA 1RHPA 1WTVA 2AWOA 4HCEA 1QJOA 3ONAB 2JXMB 5IGDA 1BQQT 1PRTB 5IODA 1C4QA 2N88A 2JEAI 3VA5A 4DAPA 4DF7A 2B63B 4ID6A 4KN4C 2MGSA 2A6EC 2F0VA 4A3GB 3J81L 2KECA 2H1EA 2D5DA 4YIJA 4PV1C 3NWSA 1B3AA 3FVQA 5FLXL 3M4OB 1WVLA 3TN2A 3K0YA 2B2TC 1EIHA 3VYSA 2HCCA 1Z47A 1SDFA 3TMEA 1I4HA 1WTWA 1KNAA 2B2UA 2B2YC 5T1IA 4A3EB 3BZDB 1SMYC 2A6ED 4K5VA 2G9HD 2M9VA 2EOTA 4HEDA 1A3UA 1JWUD 2HDMA 2TSSA 2WB1B 4ZQ3A 2M00A 2NB0A 4I7ZC 1Y8NB 1QNUA 3AU7A 3I4NB 2R3ZA 1O7ZA 3G6JB 2F0WA 3I3CA 1SEBD 1AEXA 4RHRA 3IKJA 5J22A 5M5XB 1I4QA 3MFYA 4RCNA 2L11A 1R9TB 1UEAB 3QG1A 2PW7A 4IUVA 3S2DB 5EBDA 3FMCA 3W2DA 1SMYD 2XRQD 2KQ3A 3CRKC 3GV6A 4B9XA 1HTLD 2A73B 4DFAA 3MEHA 3KBGA 1IYVA 1D5MC 5A35A 5F2DA 3A8IE 5D65A 4XQJA 1QOHA 4CKEA 1ONLA 2IPKD 2EJMA 4KD3A 3H94A 1LTAD 3GP7A 1PFMA 3EQLC 5CV7A 2H4OA 3DHQA 3W3AA 1SSOA 2L5TA 4S3SA 4Q0FA 5EQ0A 1D6EC 3EFXD 2BA1A 4DNTB 1RCVD 4V190 1HA6A 1G291 1EQTA 2A69C 2F4IA 5D3IB 4O42A 5I9PA 2PZUA 1LO5D 4IUQA 1LTBD 1TWFB 3NPPA 3QB3A 4RAUC 3NQTA 4PMBA 4TQUS 1SNDA 4RKLA 5E4WC 3NWTA 4G7ZC 2BOSA 4ZUJA 4NP5A 4DNRB 1RTOA 1IL8A 1JICA 5JEAJ 4BA2I 4FXKC 1NR2A 3MXPA 1H9SB 1F2LA 3A8JE 2AQ2B 4CHTB 1I4RA 1H9JA 3MC0B 2A69D 1B44D 3KLSX 3NXWA 3QWNA 2YU9B 4FF3A 5C6AA 1LT5D 1NUCA 1SJHD 4RGNA 4C3IB 2A5HA 4WRDA 4XYOA 2F0FA 3I4LA 1YNNC 4IALA 3SHLA 4F7XA 4ZKBB 2SOBA 4KTAA 4F8MA 2EE1A 2IW3A 1B9NA 2KUMA 3QOJA 4K5XA 3RZDB 1STAA 2B39A 5CV4A 1W6JA 1BBXC 1EY4A 4BBRB 2KCNA 2F0PA 5JEAH 5NUCA 3HS0C 5C4JB 3HOZB 3MAQA 3K57A 4XQQA 5IT9L 2E75C 1EYCA 1J8IA 5A2QL 1YNND 2K7VA 4QIWB 5IIFA 3Q6SA 5FO9B 1KAAA 1M8AA 4RGOS 1KLUD 2IL8A 1PYWD 4C3HG 4QF4A 4OIKA 5DM73 1QNKA 5HURA 1PDQA 4Z9CB 1DZ1A 2B8GA 4HR7B 5ELFA 1F77A 4CJ1B 4EQOA 1STGA 2NTSA 4KY6A 3T4AC 2F3WA 3HZXA 5I2YA 5ELDA 2VB2X 3E0JA 3MTSA 2KCCA 2PNRC 5JPNC 3CRLC 3EJIA 5LL6S 1HTPA 4K8JA 2LFNA 4KKUA 2EYPA 3DUZA 1NAPA 5TSSA 1ESFA 3N6RA 1O80A 1X3PA 4IN3A 3GTOB 2A74C 2F0QA 1D1KA 2XIWA 4RKBA 1LTGD 2B2WA 3DWQA 2CVRA 3I70A 3TP7A 1KDAA 1XWEA 3BDLA 4MHEA 1C8CA 4KD4A 3E5SA 1I3QB 1KDCA 4HSPA 1E2VA 2R92B 1ILPA 3GTPB 3EROA 1JQYD 3TDQA 3T56B 1FYCA 4CGYB 3K5MA 4XQNA 1KNEA 4B9WA 1KABA 5CBEE 4IFDJ 3SR1A 3BG3A 2NWGA 5I6YA 3RLFA 1EQVA 3SXHA 1F2YA 4HTHA 4QB4A 1CK1A 1II3A 1ZYRC 3G7LA 3K58A 3R3OA 2E2IB 5FO7B 2O4XA 1H9RA 5EPKA 5LL6X 2LKVA 3V05A 3DM1A 4ABNA 1GUOA 4XTCS 4C2MB 5D3DA 1U4LA 1AZPA 3S2HB 3F2UA 2NN6H 2R93B 3GTLB 1TWGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUK A;  2A6E C;  3I4L A;  1YNN C;  2V4D A;  3A8I E;  1YNJ C;  1FR3 A;  3OOC A;  1O78 A;  1CTM A;  5KNB A;  2JEB I;  2F1M A;  3BDO A;  4IFD H;  4G7H C;  1ONL A;  1OXV A;  3D4R A;  2EJM A;  5K36 H;  3H94 A;  3LNN A;  2O5I C;  1OXX K;  1H9M A;  2D5D A;  3OPO A;  3M85 A;  3QJY A;  3EQL C;  4PV1 C;  2O5J C;  4LK1 C;  2QF7 A;  3A7L A;  3W3A A;  2B8F A;  1B9N A;  4IQZ A;  4OO1 H;  3D31 A;  3OW7 A;  3A7A B;  1GHJ A;  1OXS C;  2EJF C;  1VF5 C;  4L8J A;  1K8O A;  1IW7 D;  2KA7 A;  3HGB A;  1IYU A;  3I72 A;  4LJZ C;  1DCZ A;  3PUY A;  2L5T A;  2D62 A;  2YYZ A;  1GUN A;  1B9M A;  5C0X H;  3PUV A;  2EJG C;  1Y69 U;  2BA1 A;  2BE5 C;  3KLR A;  3PUX A;  3SE0 A;  2NN6 I;  4DNT B;  5BN4 A;  5JEA H;  1HPC A;  1HQM C;  1E2V A;  1TU2 B;  3GD7 A;  1G29 1;  1CFM A;  1VDZ A;  2K33 A;  3VR2 A;  2A68 C;  2EVB A;  4H44 C;  2A69 C;  2PCF B;  2JE6 I;  4DK0 A;  2PPB C;  3T56 B;  2IT1 A;  1CI3 M;  1FYC A;  2AUJ D;  3I73 A;  2D2C C;  4KN7 C;  3U9S A;  4KHZ A;  1GUT A;  2R6G A;  3QIA A;  2E74 C;  2DNE A;  3VR5 A;  3SDZ A;  5BN3 A;  2E75 C;  3AB9 A;  2CW0 C;  1Q1E A;  1SMY C;  4JK1 C;  3T51 B;  1Z6H A;  2A6E D;  3ND8 A;  3FPP A;  2Q8I B;  1Z7T A;  1Q90 A;  2EDG A;  2K7V A;  4TKO B;  4G7O C;  3BG3 A;  3ND9 A;  3WDN A;  1T5E A;  4DK1 A;  4GZY C;  4TQU S;  1Q1B A;  2A6H C;  2BA0 A;  3P20 A;  5KNC A;  1I6V C;  3LWU A;  1GUS A;  2BDO A;  3PV0 A;  4JBW A;  3RLF A;  4H13 C;  3M7N A;  4I7Z C;  3T53 B;  3IFT A;  1Y8N B;  4KMU C;  2NN6 G;  2E76 C;  5C0X G;  4G7Z C;  3M4Y A;  1DXM A;  1ZYR C;  1Q12 A;  2LMC B;  1EWH A;  4DNR B;  3VR3 A;  1HCZ A;  4H0L C;  3DXJ C;  2B8G A;  1PMR A;  3PUZ A;  4HR7 B;  4IFD G;  1DD2 A;  4BA2 I;  1BDO A;  3TZU A;  3VR4 A;  2BE5 D;  5K36 G;  1H9K A;  1Y8O B;  5KND A;  1H9S B;  1TKW B;  1ZKO A;  2K32 A;  3A8J E;  4KKT A;  3IKJ A;  1A6X A;  4KKS A;  3L7Z C;  1IW7 C;  3MFY A;  4RCN A;  1H9J A;  1GHK A;  1H9R A;  1O7L A;  1Y8P B;  2A68 D;  3QG1 A;  5BN5 A;  1V43 A;  2A69 D;  2AWO A;  2DNC A;  4OO1 G;  1V8Q A;  4OGQ C;  1QJO A;  3VR6 A;  1OXU A;  1GJX A;  4BA1 I;  1LAB A;  2KCC A;  2PNR C;  2JXM B;  3CRL C;  1OXT A;  1LAC A;  4XIG S;  3VA7 A;  3A8K E;  3FMC A;  1GUO A;  1HTP A;  1VCI A;  1H9S A;  4XTC S;  5JEA G;  2JEA I;  4KI0 A;  1E2Z A;  2DN8 A;  3CRK C;  1VF7 A;  3PUW A;  1GUG A;  2ZT9 C;  4KKU A;  4KN4 C;  3GQB A;  3NE5 B;  2A6H D;  3MXU A;  2NN6 H;  1K8M A;  5A35 A;  1IYV A;  1E2W A;  3N6R A; 
#chains in the Genus database with same CATH topology
 1UE7 A;  4YWM A;  2YU9 H;  3TRE A;  1I4P A;  1F2M A;  1FNU A;  5T1G A;  3ER0 A;  4DPG A;  4IFD H;  2OT2 A;  2MUY A;  1K28 A;  1B53 A;  5K5P A;  1ZYR D;  1KQS A;  3PMF A;  1Y14 B;  3QJY A;  4C3J B;  2VW9 A;  1SFO B;  2VQE Q;  1F9P A;  3S1N B;  2Q2I A;  2UXB Q;  3DMU A;  3PF5 A;  1ENF A;  3LWE A;  1ESR A;  3I4N G;  4PQX A;  1LLR D;  3T1H L;  3KK7 A;  3I72 A;  4LJZ C;  2QEJ C;  1DYQ A;  3PUY A;  2D62 A;  4KY7 A;  4X3K A;  4ZUI A;  1GUN A;  1L0W A;  4A3B B;  4POG A;  5C4X B;  4G4K A;  2RDH A;  2ZTC A;  2RSN A;  2RHS B;  3G48 A;  4IUT A;  4PMW A;  5IY0 A;  1VQ5 A;  4KHP Q;  1SYE A;  4P73 A;  1TS5 A;  1XMO Q;  2GA4 B;  3NP8 A;  1HR0 Q;  2XWJ B;  1ENC A;  3STB C;  4KHZ A;  3RZD H;  3TS2 A;  2DNE A;  3RZO B;  3I4M H;  2WKC A;  2JA7 H;  2NZH A;  1GD7 A;  2QCP X;  2EY2 A;  1Z6H A;  3A74 A;  1HUN A;  4XYQ A;  1Q90 A;  1A0I A;  2NYZ D;  1WTX A;  4GZY C;  5C4J H;  3HOZ H;  2BA0 A;  4LF8 Q;  1I94 L;  1QB5 D;  3ERQ A;  4HMJ A;  5GAD C;  3NK9 A;  1UE5 A;  2B2W C;  1JOO A;  4B3R L;  4LWC A;  1L0Y B;  2F0I A;  2OCE A;  5C0X J;  4OWW B;  3NHH A;  1A62 A;  1DD2 A;  4MZ9 A;  2JJQ A;  1SNM A;  2NUC A;  2K05 A;  1LTS D;  1XNQ L;  1RL2 A;  4X3U A;  2WII B;  3OHX C;  4P75 A;  3UE1 A;  1O7L A;  1Y8P B;  1QVC A;  1GKH A;  4OGQ C;  4BA1 I;  3STB D;  1A2U A;  3DWA A;  3T1H Q;  1SYB A;  4RHS A;  3FKI G;  4B08 A;  1E2Z A;  1Q46 A;  1HNX L;  1STE A;  3K7A B;  2MHV A;  4XDX A;  1CUK A;  1PH7 A;  3OW2 A;  2Y0S G;  5LHY 1;  3A5U A;  4RG1 A;  5KNB A;  1VQ8 A;  1EY9 A;  1ZEQ X;  2FIN B;  1L1O B;  3C1E A;  1HFN A;  3NSW A;  4H7B A;  4YWK A;  1J9O A;  2ZM6 L;  5ELO A;  2RQX A;  4ZK9 B;  3GTO H;  1VQC A;  2EJF C;  1I94 Q;  3HGB A;  1DGS A;  1EYD A;  1DCZ A;  3MZ5 A;  5IGF A;  5JVH 3;  4MNO A;  5C0X H;  3W1G A;  3CPW A;  1Y69 U;  3KLR A;  4KK7 A;  1LT6 D;  1YHA A;  3CKI B;  3CPF A;  3IL8 A;  5C5L A;  3OTO L;  1KL9 A;  4B3R Q;  3AEV A;  2LXK A;  4A3I G;  3RD4 A;  1EQR A;  2XNA C;  2KEN A;  4RH6 A;  2XRS D;  4JBJ A;  5FLM H;  1XNQ Q;  5JPM C;  1I3Q H;  3AB9 A;  1SR3 A;  3FPP A;  4C3I G;  5IYC H;  2F0N A;  3Q23 A;  1YIT A;  1I4G A;  2R92 H;  4CDF C;  3RN5 A;  4A3J H;  3HOV B;  3Q24 A;  3S14 B;  3GTP H;  3HKZ B;  1XTD A;  1PTO F;  3BZC A;  5EPJ A;  4GLX A;  2GVB A;  3CAM A;  1WTP A;  1BUV T;  1D5Z C;  3C46 A;  1Q8K A;  1C9O A;  1I6V C;  1D2B A;  4RGM A;  3AFP A;  3IFT A;  3QO2 A;  1EY5 A;  1HNX Q;  2Q8T A;  3FRP B;  4A76 A;  1V1Q A;  3P75 A;  3GTG B;  2MO0 A;  3P7J A;  4R4T A;  1TR5 A;  3S1R B;  1P8L A;  3F2C A;  3PUZ A;  5DM6 3;  4HIK A;  2F52 A;  1BDO A;  2Q2H A;  1VQ6 A;  1D5X C;  2K32 A;  1A6X A;  5ELE A;  1BNZ A;  4BY7 G;  4JCV E;  4TRD A;  4U68 A;  3VYU A;  2C35 B;  2F0L A;  3E9I A;  2ZM6 Q;  3Q22 A;  3J81 E;  2K04 A;  5BN5 A;  4BBR G;  2DNC A;  3Q0A A;  1CHP D;  4QJF A;  2KBN A;  2F0G A;  4JI0 L;  3H3V C;  2ENB A;  5FLX E;  1VMP A;  1LTT D;  4DV3 L;  3KF6 A;  4DU9 A;  4A3L H;  5FJ8 H;  2HQL A;  2ZJQ A;  3OTO Q;  1PXU A;  2LS0 1;  1HR0 W;  2JA6 H;  2ZTD A;  4EGV A;  1LT3 D;  1XYI A;  2AUK A;  3NTH A;  2WAQ B;  2IX3 A;  1M1K C;  1QE6 A;  2M2L A;  1QUQ B;  2SEB D;  2PNH A;  1NBW A;  4G7H C;  3D4R A;  4C2M H;  1TII D;  1PA6 A;  5K36 H;  3F1Z A;  2BH2 A;  3VYR A;  4I65 A;  3CC2 A;  4K0K L;  4L6T B;  3EA6 A;  5IP9 G;  3J7A 5;  3S2H H;  2N49 A;  4ULL A;  4LK1 C;  2R93 H;  4MN3 A;  4X65 Q;  2ASB A;  1HNZ L;  2WB1 E;  3GTL H;  1BKB A;  3A7L A;  1EFI D;  1TQO A;  5HGQ A;  4OO1 H;  4P2C B;  4L8J A;  1Q86 C;  3N52 A;  5IE8 A;  5C0X I;  4C3J H;  1SFO H;  5EKL A;  4OWX B;  1AZQ A;  3IAY A;  3S1N H;  3NBH A;  1PV4 A;  5M5Y B;  1CFM A;  3TP6 A;  1NR4 A;  2F0E A;  3VR2 A;  1JWS D;  1UE6 A;  4JC0 A;  1F9S A;  4LF5 L;  1E1O A;  1KAW A;  5G3L F;  3H91 A;  1DJR D;  4A3B H;  3K5L A;  3C1F A;  2CW0 C;  5C4X H;  4DV4 L;  1PVO A;  3QR8 A;  4AYB B;  4KV6 A;  1U4M A;  1PTO C;  3TEH B;  4CDE C;  2WFW A;  3ULP A;  3DEO A;  5KNC A;  4JI0 Q;  1RJT A;  1MSG A;  1GUS A;  3PV0 A;  4N9T A;  4KHV A;  4H13 C;  4HCS A;  5IT9 c;  4DV3 Q;  5C0X G;  5M5W H;  1EIG A;  4BY1 G;  3OMG A;  1C0A A;  2QIL A;  5IYB G;  2TMP A;  4QL5 A;  1U4P A;  1H9K A;  2DY8 A;  1UNS A;  2G9D A;  2KHS A;  4K0K Q;  5IGG A;  4GLA C;  4E6I A;  1EIF A;  1KRT A;  2YTV A;  1OXU A;  1HNZ Q;  2YTX A;  2R92 G;  4MIU A;  1S5B D;  3VA7 A;  1OXT A;  4CBV A;  5EAY A;  1PH9 A;  4J15 A;  2CW0 D;  2F3V A;  3R2T A;  2B3G A;  2QGQ A;  4RA8 A;  4OIJ A;  3UDI A;  1WTR A;  3TSS A;  1PTO D;  1L0X B;  1E2W A;  5H1S E;  4A75 A;  1PH8 A;  1EOV A;  1YNJ C;  2K50 A;  4R9W A;  1V1P A;  5LMU L;  3URY A;  1CKN A;  1PFB A;  2F1M A;  2PYK A;  4LF5 Q;  1YJW A;  2IY5 B;  1F9Q A;  3T16 A;  1Q3L A;  1F9R A;  1H9M A;  1EZ6 A;  1GXD C;  3OPO A;  3K7A H;  2B2U C;  3RUZ A;  4DV4 Q;  4IUP A;  2O5J C;  3J7Z C;  2R7Z B;  1VQM A;  3SK4 A;  5C4H A;  1K83 B;  4PZ8 A;  5EPL A;  2LY7 A;  1E22 A;  1K73 C;  2K14 A;  5JOB A;  5DLQ E;  2CH4 W;  1DM0 B;  1FD7 D;  1SE8 A;  4OO1 I;  2RCN A;  4FDB A;  1DON A;  4G57 A;  1JJC B;  2KJX A;  2PO4 A;  4K2K A;  3X3N A;  2KEE A;  1HPC A;  1LV9 A;  2PQA A;  1M90 C;  2RBM A;  2DJG C;  3M3Y B;  2XVS A;  2AMC B;  2IT1 A;  5FKA C;  2CWA A;  1PZI D;  1IHZ A;  4GKK L;  3QIA A;  3K5N A;  4NW2 A;  3OIQ A;  3RR5 A;  4JK1 C;  3CQZ H;  1TY0 A;  4HJA A;  2MFI A;  1YNJ D;  2E2J B;  4A3K G;  3UI2 A;  4JVZ A;  3I4M B;  4CKB A;  2JA7 B;  2P5Z X;  3M7N A;  2F0O A;  3OYY A;  5E3F A;  1VQN A;  5I9O A;  2E2D C;  1WOC A;  4F87 A;  2X6L A;  1QG7 A;  3MWY W;  3IRB A;  3HOV H;  4C56 C;  4LFB L;  1HCZ A;  3S14 H;  5I6W A;  1C7Y A;  1D1I A;  3DEP A;  5LMU Q;  1B4O A;  4GOP A;  2ZXR A;  2KHI A;  1NCV A;  1TY2 A;  2N3S A;  3R2I A;  4A3B G;  3GTG H;  1SYF A;  3OWF A;  3BS1 A;  4DXF A;  5G3L D;  1X3Q A;  3ULL A;  4QGU A;  3S1R H;  1LAB A;  3PIP A;  1AFP A;  1QZH A;  4R4Q A;  2OF1 A;  5M3M B;  3CCE A;  1RDP D;  2DN8 A;  3JC6 6;  1BCP F;  1X3G A;  1YJ9 A;  1YHQ A;  1D8L A;  1S5C D;  1U9R A;  4JI1 L;  3RLO A;  2K6A A;  1G6Z A;  3NQI A;  3MXU A;  5KRU A;  2DUD A;  2I5H A;  2VUM B;  5AFW A;  3I7F A;  5IGB A;  5ELC A;  2F0T A;  2E2H H;  2E8G A;  2Z4I A;  4GKK Q;  1B1Z A;  4QIW E;  2EYO A;  4CJ2 C;  3I8Z A;  3SK5 A;  3PO3 B;  1J5E L;  4GN5 A;  3U4V A;  1Q8I A;  1WJJ A;  5IT9 E;  4XXE A;  1TT2 A;  2B8F A;  5FO8 B;  2EYJ A;  5A2Q E;  2YV5 A;  3J81 j;  2I46 A;  2NTT A;  4DR7 L;  1DOM A;  3W5O A;  1CZW A;  1GUW A;  2VXW A;  1ICW A;  4RCO A;  4QQB X;  5IYD H;  1ASY A;  1HQM C;  3A0J A;  1TU2 B;  5FK9 C;  1UAP A;  5CV8 A;  2UUA L;  3HOY B;  4LFB Q;  4EVO A;  1WTO A;  2ICE C;  3E9H A;  5HGT A;  2ZJP A;  2QDL A;  2KCT A;  2VNU D;  2Z6K A;  1K8G A;  1IZ6 A;  2O2L D;  3KFU A;  5M5Y H;  2R61 A;  2JYO A;  2L0C A;  3LGJ A;  3J80 L;  1N33 L;  3I90 A;  1CA6 A;  1RF2 D;  4DUY L;  3HP3 A;  4LUV A;  5KGU A;  2L15 A;  1XPR A;  1X32 A;  2EYF A;  3SEB A;  4JG2 A;  1PRT F;  4Y7N H;  4A3J B;  3EVQ A;  2HUG A;  4JI1 Q;  4DV1 L;  3CME A;  2PMZ B;  1DXM A;  1EWI A;  3ERS X;  1GVP A;  1STN A;  4QMG A;  4X64 L;  1SNO A;  4IPH A;  1QCB D;  2NVY B;  1ZKO A;  2B63 G;  1K3R A;  5D14 A;  2F03 A;  4PZ6 A;  2EY6 A;  2SNS A;  1ASZ A;  2EPB A;  4IJL A;  1J5E Q;  2VB3 X;  5AJ3 L;  1V8Q A;  4RMF A;  2PI2 E;  4ZLT F;  4A3G G;  2FFK B;  4DN4 M;  4XIG S;  1ET9 A;  2EQS A;  4CDC C;  1KDB A;  4K2L A;  4XT1 B;  1ILQ A;  4DR7 Q;  5JEA G;  1SNQ A;  2C9O A;  5KYI A;  3I91 A;  3PUW A;  1LT4 D;  3GQB A;  1GO3 E;  4JI8 L;  5CGK A;  3L9A X;  1BO0 A;  3GO5 A;  2UUA Q;  2V4D A;  1XPO A;  4KJN A;  4LUO A;  1TS4 A;  3OOC A;  3HKZ G;  1K0R A;  1HFG A;  3MHB A;  4ME3 A;  2JEB I;  4GKJ L;  1YHB A;  4X3S A;  2JA6 B;  1WD1 A;  2KOL A;  5DAU A;  3H3V H;  4UHV A;  2X69 A;  4R4C A;  3D6W A;  1HXY D;  3OWE B;  2QDB A;  4IUR A;  3D31 A;  3R93 A;  2MP1 A;  4GOP C;  1N33 Q;  1VS0 A;  4DUY Q;  3J7A V;  1HRJ A;  4C1N I;  2UXD L;  4DA2 A;  2BE5 C;  3SE0 A;  2AWN A;  5BN4 A;  4DV1 Q;  3SK6 A;  3A55 A;  3S24 A;  2R7Z H;  1CQV A;  1K83 H;  1NNX A;  4H44 C;  4JOI A;  2WB1 G;  4DK0 A;  5IWA L;  4X64 Q;  1VQP A;  3HKS A;  2D2C C;  1A3T A;  4OHJ A;  1ZXT A;  3GDE A;  5I2X A;  3JAM L;  1E0B A;  2B2T A;  1TS2 A;  1K0S A;  4CJ0 B;  2Q8I B;  1EEF D;  2R7D A;  1FJG L;  2AQ3 B;  4TKO B;  1W2B A;  1WFQ A;  5AJ3 Q;  3J81 c;  3M3Y H;  3GTK B;  5JJI A;  3KBX A;  2WP8 J;  4R8N A;  3MXN A;  3KDF A;  4J8Q A;  1WCM B;  5FLX c;  2CWP A;  3H0G B;  5GAG C;  3OMC A;  3E3X A;  3CCL A;  3L0O A;  2MPM A;  1CZG A;  1Q12 A;  4BWG B;  2B2Y A;  1JR0 D;  3VR3 A;  4JI8 Q;  2E2J H;  4NXM L;  2RF4 A;  4LMQ D;  1LTR D;  1R4P B;  4UDU C;  3PO2 B;  2BE5 D;  2ICI A;  5M5W B;  2N55 A;  4GKJ Q;  1PTO H;  1O7I A;  1JOK A;  4QCL A;  1T5X D;  3F2B A;  4M1U B;  4C3H B;  3G71 A;  1S72 A;  1I4X A;  3MXG A;  1V43 A;  3S9W A;  2C5C A;  3TP5 A;  1SE2 A;  3VR6 A;  4EX5 A;  3UDG A;  4HN7 A;  4IPD A;  4NXN L;  2RCF A;  2JQO A;  2RDF A;  4KLK A;  1MJC A;  4YCV A;  4ZYS A;  1H9S A;  2EXZ A;  1MKH A;  2UXD Q;  4AQY L;  2K03 A;  1EU3 A;  2Z6K C;  3GTJ B;  2A1A A;  3NE5 B;  3HOW B;  1EY7 A;  1K8M A;  3CXC A;  1QVF A;  2FMC A;  4YY3 L;  1MBY A;  1SJE D;  1M4V A;  1MSH A;  4NKL A;  1EEI D;  5IP7 H;  1KLG D;  5IWA Q;  5C5M A;  2F0D A;  3BDO A;  5M3M H;  2IWH A;  3D3R A;  1HNW L;  1OXX K;  1NE3 A;  3NEN A;  4N8F A;  1FJG Q;  4IZ8 A;  3CCU A;  3M4P A;  1V1O A;  2VUM H;  1EY0 A;  3BVZ A;  2A8V A;  1EOT A;  1JMC A;  1ET6 A;  1K8O A;  5EBC A;  1VF5 C;  2FXQ A;  1QIL A;  1IYU A;  2EIF A;  2Z4H A;  1CA5 A;  4DR5 L;  3PUX A;  5IGE A;  2NN6 I;  3PO3 H;  2J0T D;  1QWY A;  2IX0 A;  1C48 A;  3FEW X;  4JI3 L;  1SNC A;  3WOF A;  1VDZ A;  1S4Z A;  2BCO A;  3P1H A;  1EUJ A;  1SMX A;  4NXM Q;  4IFD I;  2PPB C;  1K3B C;  1X56 A;  5C3E B;  4WJ3 M;  1NMF A;  2WAC A;  1SE3 A;  1S5D D;  1J6Q A;  2JA8 B;  4DAY A;  3HOU B;  1AH9 A;  1X3F A;  1Z7T A;  2EDG A;  4G7O C;  3HOY H;  4IOA A;  4NXN Q;  3P20 A;  1BVS A;  4GNX A;  1BF4 A;  2OEO A;  2MJ8 A;  3CQZ B;  5CMD A;  2CKZ B;  4HAE A;  2XN9 C;  4UY8 C;  1AW7 A;  5L37 A;  4OWT B;  4DV7 L;  2NN6 G;  4AQY Q;  5CV5 A;  4BBS B;  1EWH A;  1IL2 A;  4L5R C;  1F2Z A;  1PH6 A;  5ELN A;  4UP9 A;  4YY3 Q;  2R7Z G;  5C44 B;  1BOS A;  5C3W A;  4IFD G;  2PQE A;  2KVM A;  2I07 B;  4ODG A;  1YNX A;  3L7Z C;  4IO9 A;  1HNW Q;  3J80 i;  4ILW A;  4PZ7 A;  1AP0 A;  5JAV A;  2EYH A;  1R4Q B;  4JOI C;  2AKW B;  5EKI A;  1E3P A;  2EY5 A;  2K1B A;  2K4K A;  3CCR A;  2NVY H;  1MD2 D;  4R1J A;  4OEM B;  1EY8 A;  4DR5 Q;  1FGB D;  4GS3 A;  4A3C H;  4OL7 A;  4GN3 B;  4C1N K;  1EY6 A;  1PFN A;  4NDX A;  4JI3 Q;  1E1T A;  1NJI C;  2EYL A;  1ICF B;  1FR3 A;  5EKK A;  1B50 A;  3I4M G;  5ISR A;  5C3X A;  3TBI B;  2JA7 G;  2JK8 A;  1OXV A;  3K6O A;  3X3M A;  4A3M B;  1AE3 A;  2XGT A;  3HKZ E;  4A3D B;  3K80 C;  3HOZ G;  2E2H B;  3C3L A;  2XSC A;  1XJV A;  1PZK D;  4A3F H;  1GHJ A;  4JW0 A;  2KA7 A;  1EYA A;  2L4N A;  4YCU A;  4DV7 Q;  1N9W A;  5DEH A;  1PFS A;  3U9O A;  3EN2 A;  4ZCK A;  2RA4 A;  5IP7 G;  4QUF A;  1Y1V H;  2K5Q A;  1RIP A;  3S16 B;  5COY A;  1LTI D;  2WV6 D;  4A93 B;  4UP7 A;  5EJW A;  2L55 A;  3ND9 A;  3CP0 A;  2A6H C;  1BXT A;  1EWC A;  3K59 A;  4WOR A;  3LWU A;  5GAE C;  2B2V A;  1EZ8 A;  1KXL A;  2F0M A;  4ZAI A;  4FF4 A;  3U50 C;  2WAQ E;  5JJK A;  4R8I A;  3M4Y A;  5CYU A;  2ZXP A;  4NB3 A;  2IJ0 A;  4J6H A;  3K8A A;  3GTK H;  4JI4 L;  1SRU A;  1WTH A;  4PMC A;  4Y7N B;  5J1Z A;  3TZU A;  4QY7 A;  1JOR A;  5KND A;  1TKW B;  3HRZ C;  4KY5 A;  2JA5 B;  4RWS C;  4KKS A;  1WCM H;  3H0G H;  3B6Y A;  3GTQ H;  1PH4 A;  1EL0 A;  2RVL A;  3MA2 B;  3D8G A;  4AIM A;  3S15 B;  1GJX A;  1UUP A;  1JWM D;  2CHB D;  3KF8 A;  4FNF A;  3PO2 H;  1PZJ D;  4ALP A;  4HMI A;  4DGZ A;  1CT1 D;  4K6D A;  1W6K A;  3SK8 A;  3ZYY X;  4IPG A;  1GUG A;  2Z9H A;  4OON A;  4IJH A;  4C3H H;  1KD1 C;  4Q5V A;  3T13 A;  2A6H D;  3V96 A;  1TVX A;  3A56 A;  1YZ6 A;  2WIN B;  4GNX C;  5FLM G;  4DR6 L;  1JOQ A;  2NZ1 D;  1BR9 A;  1G2T A;  4AYB E;  2Z1C A;  5IYC G;  2K5H A;  3GTJ H;  1E7Z A;  3M85 A;  3FKI B;  4A3J G;  4EQN A;  2RDG A;  3HOW H;  4DR4 L;  1SBB B;  3NBI A;  1S5F D;  1I6H B;  2Y0S B;  3BYT B;  1STB A;  4ZRZ A;  4FF1 A;  4FF2 A;  1HUM A;  3BJU A;  3M4Q A;  1PH1 A;  4U67 3;  1SYD A;  5KEE A;  1XNR L;  3K5O A;  1KC8 C;  3I2Z A;  2BDN A;  3FDT A;  2NVX B;  2K33 A;  2D0O A;  4N8X 1;  4X3T A;  1JC7 A;  4JI4 Q;  2JE6 I;  1EFW A;  3U9S A;  4K14 A;  1Q82 C;  3KJO A;  2MNA A;  1HJP A;  5COR A;  1HZC A;  3GV3 A;  1EIY B;  2NVQ B;  3WDN A;  1T5E A;  4LAA A;  1XTC D;  4V0B A;  5CV6 A;  1JJG A;  2ES2 A;  1DOK A;  2PZT A;  2FJ2 A;  4A3I B;  5C3E H;  2F0J A;  2BDO A;  3PIO A;  4A3L G;  2K5D A;  1RKN A;  5FJ8 G;  1YBY A;  4KJO A;  1NSN S;  4KMU C;  1SNP A;  2JA6 G;  2JA8 H;  3HOU H;  1IYJ B;  1STH A;  3NTK A;  4BXX H;  3G4S A;  1EU4 A;  2LMC B;  4RGT A;  4WJ4 A;  3V2T A;  1AN8 A;  3M7G A;  1TWA B;  3AQQ A;  3CHB D;  5C4Z A;  1A15 A;  1BBW A;  1Y8O B;  5K36 G;  3IFD A;  3S1M B;  4DR6 Q;  1CSP A;  2ATW A;  4FO2 A;  1SAP A;  1VMC A;  1BBU A;  1IW7 C;  3MEF A;  4M8A A;  3RNU A;  2R93 G;  4O2D A;  3WOE A;  4BBS H;  4FYD A;  4K5W A;  3D6C A;  1LTL A;  3ICE A;  4R4I A;  4DR4 Q;  1VQG A;  4OO1 G;  3M9B A;  3S1Q B;  2NVT B;  1PTO B;  4WJW A;  1A8V A;  2X6G A;  5C44 H;  1TWC B;  1AE2 A;  1LAC A;  4DR2 L;  1CM9 A;  5CC4 A;  4N9P A;  1WI5 A;  1VCI A;  4C3J G;  4FVM A;  1FNV A;  4KI0 A;  5GAH C;  4EQP A;  2VY3 A;  1XNR Q;  2ZT9 C;  1VQH A;  4BY7 B;  2EYM A;  4LFA L;  4F88 A;  1CQF A;  1HZA A;  1T9H A;  1O78 A;  2D9U A;  2K01 A;  2B2V C;  2SNM A;  5C4X G;  2BH8 A;  4O1N A;  2F0U A;  1IKM A;  3LNN A;  2EZV A;  2IX1 A;  2RKS A;  3PF4 A;  1HA5 A;  5LMN L;  4YHH L;  2LXJ A;  3BDC A;  1KHI A;  3SVM A;  2L9H A;  3A7A B;  5E4X A;  1IW7 D;  3D4W A;  4L63 B;  5I4D A;  4A3M H;  1L1O A;  2CH4 A;  4K6L A;  3MFG A;  2QKI C;  4A3D H;  1I5F A;  3HOX B;  4OXP A;  3GD7 A;  1RD9 D;  3AMU A;  3K7U C;  3AFQ A;  3KUP A;  1X54 A;  2XTI A;  1G91 A;  3VYT A;  1CI3 M;  1ML0 D;  3E0E A;  1GUT A;  2R6G A;  2PZW A;  3RLN A;  3FPU B;  3CCQ A;  4K8I A;  4FXG C;  3T51 B;  4JBM A;  2AQ1 B;  4DV2 L;  1UWV A;  4DK1 A;  4WFN 3;  3HEJ A;  5M9O A;  1VQA A;  2ZXO A;  3QOL A;  4DR2 Q;  3I4N H;  3DWP A;  2F3I A;  1PHJ A;  3BZK A;  1VQO A;  3L3O C;  4QUC A;  4ZKC B;  2E76 C;  1X3E A;  3S16 H;  2UU9 L;  3KOJ A;  4A93 H;  3FHW A;  1A3V A;  2PW5 A;  2OTL A;  4LFA Q;  4H0L C;  3DXJ C;  1R9T H;  4DAV A;  2NBF A;  1U4R A;  1HHV A;  1X9N A;  1TWH B;  4BS9 A;  4Y52 H;  2Q2T A;  4UAI A;  3KF6 B;  4IUU A;  3A54 A;  4DUZ L;  3NUC A;  4FXD A;  1STY A;  2HHH L;  3RMH A;  4FP5 D;  1B2T A;  5LMN Q;  4OX9 L;  4YHH Q;  1JB3 A;  1XXG A;  3D4D A;  4GLV B;  4BY1 B;  1PH3 A;  1U0L A;  2K28 A;  4NPS A;  2JA5 H;  1HZB A;  1SYC A;  3TP8 A;  3Q8D A;  2JA9 A;  5C3E G;  4B3M L;  2HIX A;  3BVM A;  4X66 L;  1WTQ A;  5CBA E;  1NMG A;  3S15 H;  3O13 A;  1VQJ A;  2JSO A;  2L1B A;  4MTN A;  3OIP A;  1CTM A;  1JE4 A;  2OXP A;  3KYH C;  4NMZ A;  2K75 A;  2O5I C;  1YJN A;  3NTI A;  3BYY B;  3NBH B;  1MI2 A;  4XT3 B;  4DV2 Q;  2N8N A;  3HG9 A;  1BCP C;  1S5E D;  2QF7 A;  1RTN A;  2HQE A;  4IQZ A;  2SDF A;  3OW7 A;  1JT8 A;  2JP1 A;  4DK6 C;  2QA4 A;  2PMZ E;  1XMQ L;  1PLF A;  1VQB A;  1B9M A;  2K5W A;  2YYZ A;  3PUV A;  5J39 A;  1X55 A;  1QZG A;  4JI2 L;  1YIJ A;  3TRZ A;  5DNF A;  4I7A A;  3J80 E;  2DY7 A;  3FKI H;  5E1F A;  4A3F B;  3BVG A;  1Y1W B;  3HOV G;  2UU9 Q;  1ROD A;  2R7F A;  2DGY A;  2OWO A;  2A68 C;  2PCF B;  1I6H H;  3CCV A;  2HDL A;  3I55 A;  5KYL A;  2DJF C;  2F0K A;  3I73 A;  5FOB B;  4KHP L;  2E74 C;  3CU7 A;  3VR5 A;  5BN3 A;  1H95 A;  4P71 A;  4TSS A;  4DUZ Q;  1S3O A;  2HHH Q;  5CR3 A;  3ND8 A;  4ME5 A;  5M3F B;  4APV A;  2NVX H;  4OX9 Q;  1Q1B A;  1Y1V B;  3KLS A;  4IUN A;  3OSO A;  4JBW A;  3T53 B;  4B3M Q;  1VQI A;  1SN8 A;  5IOC A;  2NVQ H;  1BCP D;  4X66 Q;  2I5M X;  4HJ8 A;  3MVV A;  1W3S A;  2MQH A;  5E7N A;  4A3K B;  3VR4 A;  4A3I H;  1L1O C;  1K9M C;  3EBE A;  2AHO B;  1SRO A;  4PNY A;  1GHK A;  3PIO 3;  1OO9 B;  2L12 A;  2A68 D;  4H02 A;  2WAQ G;  3C2P A;  3J7A F;  2F0S A;  4C3I H;  1PRT C;  1V1P B;  1XPU A;  1TWA H;  1CKN B;  1MGS A;  3A8K E;  4DXG A;  3GTQ B;  3S1M H;  1CKM A;  3R8B A;  4RFB A;  1TS3 A;  1VQK A;  2J4X A;  2FMM A;  5IYD G;  4JI2 Q;  1IKL A;  1XMQ Q;  2VQF L;  1VF7 A;  4JV5 L;  3H6M A;  2NVT H;  3S1Q H;  1DOL A;  4A93 G;  1TWC H;  2Z8L A;  1SE4 A;  1FNW A;  2J7Z A;  4X6A H;  4J1M A;  2F4V L;  3S17 B;  2PQA B;  1XX8 A;  4PG3 A;  2FHT A;  3GTM B;  4BY7 H;  3TZD A;  1JCK B;  1CHQ D;  1KTK A;  4HJ5 A;  3J7Y W;  4BBR H;  2KHJ A;  3JAM E;  4P74 A;  4L5T A;  1OXS C;  3F2D A;  4DV5 L;  1BCP B;  1I50 B;  4DNI A;  2EJG C;  4JI5 L;  2I5L X;  2JA5 G;  3ITP A;  4AYB G;  3TS0 A;  1PRT D;  5IGC A;  4CKC A;  2ID0 A;  5JVG 3;  3PIP 3;  1HZ9 A;  2Q8R E;  1PYS B;  1ENA A;  3FP9 A;  2EVB A;  2V1C C;  4OEL B;  2AUJ D;  4KN7 C;  5EGT A;  4YWL A;  3H3V I;  1O7Y A;  1VQ4 A;  2KED A;  1SYG A;  5LMN W;  3H15 A;  3CCJ A;  3SDZ A;  4JYA L;  5ELB A;  1G2S A;  3ULJ A;  1Q1E A;  4POF A;  4HIM A;  3LX0 A;  3HOX H;  5JJZ A;  5IP9 H;  4LFC L;  1LUZ A;  1HQR D;  3E6Z X;  1WD0 A;  3H09 A;  4GOP B;  2CQA A;  2H5X A;  1A2T A;  1MJE A;  2EY1 A;  2RSO A;  1JB7 A;  1YI2 A;  2OQK A;  2VQF Q;  2WKD A;  4JV5 Q;  4HSV A;  1CSQ A;  1IBM L;  2E5L L;  1WYD A;  5CV9 A;  1SXT A;  5KIX A;  1PMR A;  2HCI A;  1G8Z D;  1VQL A;  2XWB B;  4KKT A;  2F4V Q;  2F0H A;  1GOZ A;  1RHP A;  1WTV A;  2AWO A;  2CFM A;  4HCE A;  1QJO A;  3ONA B;  2JXM B;  4DR1 L;  5IGD A;  1BQQ T;  1TWH H;  1VQ7 A;  1PRT B;  5IOD A;  3CC4 A;  1C4Q A;  4DV5 Q;  2N88 A;  2JEA I;  4B3T L;  4LF6 L;  3VA5 A;  4DAP A;  4DF7 A;  4JI5 Q;  2B63 B;  4ID6 A;  4KN4 C;  1IBL L;  2K52 A;  2MGS A;  1VQ9 A;  2A6E C;  4BY1 H;  4JI6 L;  5IYB H;  3K0X A;  2F0V A;  4A3G B;  3J81 L;  3T1Y L;  2KEC A;  2GN5 A;  1L2F A;  3TQY A;  2H1E A;  2D5D A;  4JYA Q;  1IXR A;  4YIJ A;  4PV1 C;  3NWS A;  1B3A A;  4YCW A;  3FVQ A;  5FLX L;  1B3Q A;  3M4O B;  1WVL A;  3TN2 A;  4LFC Q;  3K0Y A;  2B2T C;  1EIH A;  1VQF A;  4X65 L;  3VYS A;  2HCC A;  4UPA A;  2KCM A;  1Z47 A;  1SDF A;  2ALY B;  3HFZ B;  3CCS A;  1IBM Q;  2E5L Q;  3TME A;  1I4H A;  1A63 A;  1WTW A;  1KNA A;  4DKA C;  2UUB L;  2B2U A;  2ZTE A;  2GVA A;  2B2Y C;  2RHQ B;  5T1I A;  4A3E B;  2N78 A;  3BZD B;  3DM3 A;  4HIO A;  1SMY C;  2A6E D;  4AH6 A;  4K5V A;  1Y1W H;  2G9H D;  3NEM A;  2M9V A;  2EOT A;  1B8A A;  4HED A;  1A3U A;  1JWU D;  2HDM A;  2TSS A;  4DR1 Q;  3KLW A;  2WB1 B;  1Q81 C;  4ZQ3 A;  2M00 A;  2NB0 A;  4I7Z C;  1Y8N B;  1QNU A;  3RN2 A;  3AU7 A;  4B3T Q;  4LF6 Q;  5M3F H;  2E2I H;  3I4N B;  1IBL Q;  2R3Z A;  1O7Z A;  4UP8 A;  3G6J B;  4JI6 Q;  2PI2 A;  5M3M G;  1NTG A;  2F0W A;  3I3C A;  1MHW C;  1SEB D;  1AEX A;  3T1Y Q;  1Q7Y C;  1P16 A;  3IKJ A;  4RHR A;  5J22 A;  5M5X B;  3U58 A;  1I4Q A;  3MFY A;  4RCN A;  2L11 A;  2VUM G;  1R9T B;  1EYG A;  1UEA B;  2NZO A;  3QG1 A;  4HID A;  2PW7 A;  1UE1 A;  4IUV A;  3HOX G;  1LM0 A;  1MIU A;  5BR8 L;  1QVG A;  3S2D B;  5J3B A;  1UEB A;  5EBD A;  4A3K H;  3FMC A;  3W2D A;  1TWG H;  1SMY D;  2XRQ D;  1KIX A;  4LF9 L;  3PO3 G;  2KQ3 A;  3I56 A;  3CRK C;  3GV6 A;  4B9X A;  1HTL D;  2A73 B;  4DFA A;  2MO1 A;  3KBG A;  3MEH A;  3JAM i;  1IYV A;  1D5M C;  5A35 A;  5F2D A;  3A8I E;  5D65 A;  4XQJ A;  4LNQ A;  2UUB Q;  1QOH A;  3NEL A;  4CKE A;  1ONL A;  2IPK D;  2EJM A;  4KD3 A;  3H94 A;  4TVA B;  1LTA D;  3GP7 A;  1PFM A;  3EQL C;  5CV7 A;  1N8R C;  4JPB W;  3HOY G;  2ZJR A;  2H4O A;  1PH5 A;  1LYL A;  3DHQ A;  3W3A A;  4DAM A;  1SSO A;  2D0P A;  3KJP A;  2L5T A;  4O0A A;  4Q0F A;  4S3S A;  5EQ0 A;  1D6E C;  3EFX D;  2BA1 A;  4DNT B;  3S17 H;  4LUZ A;  1RCV D;  3GTM H;  4V19 0;  3RZO H;  1HA6 A;  1G29 1;  3UDF A;  1EQT A;  5GRO A;  2A69 C;  4IOC A;  3MXN B;  2F4I A;  5D3I B;  3I4O A;  4O42 A;  4EQ5 A;  5I9P A;  3KDF B;  4X62 L;  1I50 H;  1G6P A;  2PZU A;  1LO5 D;  1FGU A;  4IUQ A;  1X6O A;  1LTB D;  1TWF B;  1HH2 P;  3NPP A;  1N34 L;  3QB3 A;  4RAU C;  3NQT A;  4PMB A;  4TQU S;  5BR8 Q;  1SND A;  4RKL A;  4HJ9 A;  2OTJ A;  5E4W C;  4B3S L;  4LF9 Q;  4A3C G;  3NWT A;  4A4I A;  4G7Z C;  2BOS A;  4ZUJ A;  4NP5 A;  3D0F A;  4DNR B;  1YEZ A;  1RTO A;  4LF7 L;  1IL8 A;  1JIC A;  2B29 A;  4L5Q A;  5JEA J;  3CW2 C;  4FXK C;  4BA2 I;  1NR2 A;  3ZJY C;  3MXP A;  1H9S B;  3CC7 A;  1F2L A;  3A8J E;  2AQ2 B;  4CHT B;  1I4R A;  1H9J A;  3MC0 B;  4DR3 L;  2A69 D;  2Y0S E;  1B44 D;  4A3F G;  1Y1W G;  3KLS X;  3NXW A;  3QWN A;  2YU9 B;  4FF3 A;  5C6A A;  1NUC A;  1LT5 D;  1SJH D;  4JI7 L;  2UXC L;  4RGN A;  4C3I B;  2A5H A;  1VQE A;  4WRD A;  1JJ2 A;  3J80 c;  4XYO A;  5M3F G;  2F0F A;  3I4L A;  1YNN C;  4IAL A;  2VL6 A;  2Q2U A;  3SHL A;  4F7X A;  3UE0 A;  3K81 C;  1Y1V G;  4ZKB B;  2SOB A;  1K8A C;  4X62 Q;  4KTA A;  2Z0S A;  2CQO A;  4F8M A;  1D7Q A;  2B63 H;  4IPC A;  1YVC A;  2K5V A;  1N34 Q;  2EE1 A;  2IW3 A;  4DK3 C;  3L2P A;  1B9N A;  2KUM A;  3QOJ A;  4R4O A;  4HJ7 A;  2UUC L;  4A3G H;  4K5X A;  3RZD B;  1STA A;  4JBK A;  1B7Y B;  3PQI A;  4B3S Q;  3CMA A;  4DAY B;  2B39 A;  5CV4 A;  1W6J A;  1BBX C;  2HT1 A;  1EY4 A;  4BBR B;  2KCN A;  2F0P A;  1Z9F A;  5NUC A;  3HS0 C;  5JEA H;  3AYH B;  3CCM A;  3J81 i;  3M4O H;  1IBK L;  4GN4 B;  5C4J B;  3HOZ B;  4LF7 Q;  4GNX B;  3MAQ A;  1E24 A;  3F8T A;  1WCM G;  3H0G G;  3K57 A;  1N32 L;  4LF4 L;  4XQQ A;  5IT9 L;  2E75 C;  1EYC A;  1J8I A;  3EIV A;  5A2Q L;  1YNN D;  4DR3 Q;  2K7V A;  4QIW B;  5IIF A;  1SLJ A;  3Q6S A;  5GQO A;  3PO2 G;  5FO9 B;  1KAA A;  1M8A A;  4RGO S;  1KLU D;  3UDX A;  4DV0 L;  2HD3 A;  4A3E H;  2IL8 A;  4JI7 Q;  1PYW D;  4C3H G;  2UXC Q;  4QF4 A;  4OIK A;  5DM7 3;  3CD6 A;  1GM5 A;  1QNK A;  3U4Z A;  5HUR A;  1PDQ A;  2YTY A;  4Z9C B;  1DZ1 A;  4P72 A;  2B8G A;  4HR7 B;  5ELF A;  2HIV A;  1F77 A;  1V9P A;  4CJ1 B;  4EQO A;  1STG A;  2NTS A;  4KY6 A;  3T4A C;  3HOW G;  2EXD A;  2F3W A;  3HZX A;  4LW1 A;  5I2Y A;  4DV6 L;  5ELD A;  2VB2 X;  3E0J A;  3MTS A;  2KCC A;  2JN4 A;  2PNR C;  1NY4 A;  5JPN C;  3CRL C;  2K5N A;  3EJI A;  3JAM c;  2G5D A;  2UUC Q;  1HTP A;  5LL6 S;  3PCO B;  5M5X H;  4K8J A;  1N36 L;  2LFN A;  4KKU A;  2EYP A;  3DUZ A;  1X65 A;  1NAP A;  5TSS A;  1ESF A;  3PSI A;  3N6R A;  1O80 A;  1IBK Q;  1X3P A;  4L5S A;  1JE5 A;  4IN3 A;  3S2D H;  3GTO B;  2A74 C;  4MTK A;  4CDD C;  2F0Q A;  1FL0 A;  1B70 B;  1D1K A;  3PGZ A;  2XIW A;  1G51 A;  1N32 Q;  4RKB A;  4LF4 Q;  3W1B A;  1LTG D;  2B2W A;  3DWQ A;  2I0Q A;  2CVR A;  3I70 A;  3TP7 A;  1KDA A;  2QEX A;  1XWE A;  3BDL A;  4MHE A;  4DV0 Q;  1C8C A;  1PH2 A;  4KD4 A;  2JA8 G;  1U5K A;  3E5S A;  3HOU G;  1I3Q B;  4BXX G;  3WWV A;  1KDC A;  3CF5 A;  2IHF A;  1PYB A;  4HSP A;  3G6E A;  1E2V A;  2R92 B;  2A19 A;  1ILP A;  3GTP B;  3ERO A;  1JQY D;  3TDQ A;  3T56 B;  1FYC A;  4CGY B;  3K5M A;  4XQN A;  1KNE A;  4B9W A;  2Z6B A;  4BBS G;  1KRS A;  3DLL A;  2VQE L;  1KAB A;  5CBE E;  2UXB L;  4IFD J;  5C44 G;  3SR1 A;  3BG3 A;  2IHE A;  1QUQ A;  4DV6 Q;  2NWG A;  3VDY A;  5I6Y A;  3RLF A;  1S40 A;  2CCZ A;  1EQQ A;  1EQV A;  3SXH A;  1F2Y A;  4HTH A;  3SGI A;  1N36 Q;  4QB4 A;  2VS1 A;  1CK1 A;  3BU2 A;  1II3 A;  1TWF H;  1ZYR C;  3A5Z B;  5HY6 A;  3G7L A;  3K58 A;  3KF8 B;  3R3O A;  1XMO L;  2OQ0 A;  1HR0 L;  2E2I B;  5FO7 B;  1FVI A;  1OTC A;  2LSS A;  2O4X A;  1H9R A;  5EPK A;  5LL6 X;  2LKV A;  3V05 A;  2VZA A;  4LF8 L;  2QW7 A;  3DM1 A;  4A3M G;  1TXY A;  4ABN A;  1GUO A;  4XTC S;  4C2M B;  5JJL A;  5D3D A;  4A3D G;  4A3E G;  1U4L A;  1VQD A;  1CKO A;  1AZP A;  3S2H B;  3F2U A;  2NN6 H;  2R93 B;  3GTL B;  1TWG B; 
#chains in the Genus database with same CATH homology
 1I4P A;  1F2M A;  1FNU A;  5T1G A;  4IFD H;  2OT2 A;  2MUY A;  1B53 A;  5K5P A;  1ZYR D;  3PMF A;  3QJY A;  4C3J B;  1SFO B;  1F9P A;  3S1N B;  3DMU A;  1ENF A;  3LWE A;  1ESR A;  4PQX A;  1LLR D;  3KK7 A;  3I72 A;  4LJZ C;  2QEJ C;  1DYQ A;  3PUY A;  2D62 A;  4KY7 A;  4X3K A;  4ZUI A;  1GUN A;  4A3B B;  5C4X B;  4G4K A;  2RDH A;  2RSN A;  4IUT A;  4PMW A;  1SYE A;  1TS5 A;  2GA4 B;  3NP8 A;  2XWJ B;  1ENC A;  4KHZ A;  2DNE A;  3RZO B;  2WKC A;  2QCP X;  2EY2 A;  1Z6H A;  1HUN A;  4XYQ A;  1Q90 A;  2NYZ D;  1WTX A;  4GZY C;  2BA0 A;  1QB5 D;  3ERQ A;  4HMJ A;  3NK9 A;  2B2W C;  1JOO A;  1L0Y B;  2F0I A;  5C0X J;  3NHH A;  1DD2 A;  1SNM A;  2NUC A;  2K05 A;  1LTS D;  4X3U A;  2WII B;  3OHX C;  1O7L A;  1Y8P B;  4OGQ C;  4BA1 I;  1A2U A;  3DWA A;  1SYB A;  4RHS A;  4B08 A;  1E2Z A;  1STE A;  3K7A B;  2MHV A;  4XDX A;  5LHY 1;  5KNB A;  1EY9 A;  1ZEQ X;  2FIN B;  3C1E A;  1HFN A;  3NSW A;  4H7B A;  1J9O A;  2RQX A;  4ZK9 B;  2EJF C;  3HGB A;  1EYD A;  1DCZ A;  3MZ5 A;  5IGF A;  5JVH 3;  5C0X H;  1Y69 U;  3KLR A;  4KK7 A;  1LT6 D;  3CKI B;  3IL8 A;  5C5L A;  3RD4 A;  2XNA C;  4RH6 A;  2XRS D;  5JPM C;  3AB9 A;  4C3I G;  3FPP A;  2F0N A;  3Q23 A;  1I4G A;  3HOV B;  3Q24 A;  3S14 B;  3HKZ B;  5EPJ A;  1PTO F;  1WTP A;  1BUV T;  1D5Z C;  3C46 A;  1I6V C;  1D2B A;  4RGM A;  3IFT A;  3QO2 A;  1EY5 A;  2Q8T A;  3FRP B;  3P75 A;  3GTG B;  3P7J A;  1TR5 A;  3S1R B;  3PUZ A;  5DM6 3;  1BDO A;  1D5X C;  2K32 A;  1A6X A;  5ELE A;  1BNZ A;  4TRD A;  4U68 A;  3VYU A;  2F0L A;  3Q22 A;  3J81 E;  2K04 A;  5BN5 A;  3Q0A A;  2DNC A;  1CHP D;  2F0G A;  3H3V C;  2ENB A;  5FLX E;  1VMP A;  1LTT D;  4DU9 A;  1PXU A;  2LS0 1;  4EGV A;  1LT3 D;  1XYI A;  2AUK A;  3NTH A;  2WAQ B;  2IX3 A;  1QE6 A;  2M2L A;  2SEB D;  4G7H C;  3D4R A;  1TII D;  5K36 H;  3VYR A;  4I65 A;  4L6T B;  3EA6 A;  4ULL A;  4LK1 C;  4MN3 A;  3A7L A;  1EFI D;  1TQO A;  4OO1 H;  4P2C B;  4L8J A;  3N52 A;  5C0X I;  5EKL A;  1AZQ A;  3IAY A;  3NBH A;  5M5Y B;  1CFM A;  3TP6 A;  1NR4 A;  2F0E A;  3VR2 A;  1JWS D;  1F9S A;  5G3L F;  3H91 A;  1DJR D;  3K5L A;  3C1F A;  2CW0 C;  4AYB B;  4KV6 A;  1U4M A;  1PTO C;  3DEO A;  5KNC A;  1RJT A;  1MSG A;  1GUS A;  3PV0 A;  4N9T A;  4KHV A;  4H13 C;  4HCS A;  5C0X G;  1EIG A;  3OMG A;  2QIL A;  2TMP A;  1U4P A;  1H9K A;  2DY8 A;  1UNS A;  2G9D A;  2KHS A;  5IGG A;  4E6I A;  1OXU A;  4MIU A;  1S5B D;  3VA7 A;  1OXT A;  4CBV A;  2CW0 D;  2F3V A;  3R2T A;  4RA8 A;  4OIJ A;  1WTR A;  3TSS A;  1PTO D;  1L0X B;  1E2W A;  1YNJ C;  4R9W A;  1V1P A;  3URY A;  1PFB A;  2F1M A;  2PYK A;  1F9Q A;  3T16 A;  1Q3L A;  1F9R A;  1H9M A;  1EZ6 A;  1GXD C;  3OPO A;  3RUZ A;  2B2U C;  4IUP A;  2O5J C;  2R7Z B;  3SK4 A;  5C4H A;  1K83 B;  5EPL A;  2LY7 A;  5JOB A;  1DM0 B;  1FD7 D;  4OO1 I;  1DON A;  4G57 A;  2KJX A;  2PO4 A;  4K2K A;  3X3N A;  2KEE A;  1HPC A;  1LV9 A;  2RBM A;  3M3Y B;  2XVS A;  2IT1 A;  5FKA C;  1PZI D;  1IHZ A;  3QIA A;  3K5N A;  4NW2 A;  3OIQ A;  4JK1 C;  1TY0 A;  1YNJ D;  2E2J B;  3UI2 A;  3I4M B;  4CKB A;  2JA7 B;  3M7N A;  2F0O A;  5E3F A;  5I9O A;  2E2D C;  4F87 A;  2X6L A;  1QG7 A;  3MWY W;  4C56 C;  1HCZ A;  5I6W A;  1D1I A;  3DEP A;  1B4O A;  2ZXR A;  1NCV A;  1TY2 A;  3R2I A;  1SYF A;  3OWF A;  3BS1 A;  4DXF A;  5G3L D;  1X3Q A;  1LAB A;  1AFP A;  2OF1 A;  5M3M B;  1RDP D;  2DN8 A;  1BCP F;  1U9R A;  1S5C D;  2K6A A;  1G6Z A;  3NQI A;  3MXU A;  5KRU A;  2VUM B;  5AFW A;  5IGB A;  5ELC A;  2F0T A;  2Z4I A;  1B1Z A;  2EYO A;  4CJ2 C;  3I8Z A;  3SK5 A;  3PO3 B;  1Q8I A;  5IT9 E;  4XXE A;  1TT2 A;  2B8F A;  5FO8 B;  2EYJ A;  5A2Q E;  2I46 A;  2NTT A;  1DOM A;  1CZW A;  1GUW A;  2VXW A;  1ICW A;  4RCO A;  1HQM C;  1TU2 B;  5FK9 C;  1UAP A;  5CV8 A;  3HOY B;  4EVO A;  1WTO A;  2ICE C;  5HGT A;  2VNU D;  2O2L D;  2R61 A;  2JYO A;  2L0C A;  3J80 L;  3I90 A;  1CA6 A;  1RF2 D;  3HP3 A;  5KGU A;  1X32 A;  2EYF A;  3SEB A;  1PRT F;  4A3J B;  3EVQ A;  2HUG A;  2PMZ B;  1DXM A;  1STN A;  4QMG A;  1SNO A;  1QCB D;  2NVY B;  1ZKO A;  5D14 A;  2F03 A;  2EY6 A;  2SNS A;  2EPB A;  2VB3 X;  1V8Q A;  4ZLT F;  2FFK B;  4DN4 M;  4XIG S;  1ET9 A;  1KDB A;  4K2L A;  4XT1 B;  1ILQ A;  5JEA G;  1SNQ A;  2C9O A;  5KYI A;  3I91 A;  3PUW A;  1LT4 D;  3GQB A;  5CGK A;  3L9A X;  1BO0 A;  3GO5 A;  2V4D A;  4KJN A;  1TS4 A;  3OOC A;  1HFG A;  3MHB A;  2JEB I;  4X3S A;  2JA6 B;  1WD1 A;  2KOL A;  5DAU A;  2X69 A;  3D6W A;  1HXY D;  3OWE B;  2QDB A;  4IUR A;  3D31 A;  3R93 A;  2MP1 A;  3J7A V;  1HRJ A;  4C1N I;  4DA2 A;  2BE5 C;  3SE0 A;  2AWN A;  5BN4 A;  3SK6 A;  3A55 A;  1CQV A;  4H44 C;  4DK0 A;  2D2C C;  1A3T A;  4OHJ A;  1ZXT A;  5I2X A;  3JAM L;  1E0B A;  2B2T A;  1TS2 A;  4CJ0 B;  2Q8I B;  1EEF D;  2AQ3 B;  4TKO B;  3GTK B;  3KBX A;  2WP8 J;  4R8N A;  3MXN A;  4J8Q A;  1WCM B;  3H0G B;  3OMC A;  2MPM A;  1CZG A;  1Q12 A;  4BWG B;  2B2Y A;  1JR0 D;  3VR3 A;  4LMQ D;  1LTR D;  1R4P B;  4UDU C;  3PO2 B;  2BE5 D;  2ICI A;  5M5W B;  2N55 A;  1PTO H;  1JOK A;  4QCL A;  1T5X D;  4M1U B;  4C3H B;  1I4X A;  3MXG A;  1V43 A;  3S9W A;  2C5C A;  3TP5 A;  1SE2 A;  3VR6 A;  4HN7 A;  2RDF A;  4ZYS A;  1H9S A;  2EXZ A;  2K03 A;  1EU3 A;  3GTJ B;  3NE5 B;  3HOW B;  1EY7 A;  1K8M A;  2FMC A;  1MBY A;  1SJE D;  1M4V A;  1MSH A;  4NKL A;  1EEI D;  1KLG D;  5C5M A;  2F0D A;  3BDO A;  2IWH A;  3D3R A;  1OXX K;  4IZ8 A;  1V1O A;  1EY0 A;  3BVZ A;  1EOT A;  1ET6 A;  1K8O A;  5EBC A;  1VF5 C;  1QIL A;  1IYU A;  2Z4H A;  1CA5 A;  3PUX A;  5IGE A;  2NN6 I;  2J0T D;  1QWY A;  2IX0 A;  1C48 A;  3FEW X;  1SNC A;  3WOF A;  1VDZ A;  1S4Z A;  2BCO A;  3P1H A;  4IFD I;  2PPB C;  5C3E B;  2WAC A;  1SE3 A;  1S5D D;  2JA8 B;  4DAY A;  3HOU B;  1Z7T A;  2EDG A;  4G7O C;  3P20 A;  1BF4 A;  2OEO A;  2MJ8 A;  3CQZ B;  5CMD A;  4HAE A;  2XN9 C;  1AW7 A;  2NN6 G;  5CV5 A;  4BBS B;  1EWH A;  1F2Z A;  5C44 B;  1BOS A;  5C3W A;  4IFD G;  2PQE A;  2KVM A;  2I07 B;  4ODG A;  3L7Z C;  4ILW A;  1AP0 A;  5JAV A;  2EYH A;  1R4Q B;  5EKI A;  2EY5 A;  2K1B A;  1MD2 D;  1EY8 A;  1FGB D;  4OL7 A;  4C1N K;  1EY6 A;  1PFN A;  4NDX A;  2EYL A;  1FR3 A;  5EKK A;  1B50 A;  5ISR A;  5C3X A;  3TBI B;  3X3M A;  1OXV A;  3K6O A;  4A3M B;  4A3D B;  2E2H B;  3C3L A;  2XSC A;  1PZK D;  1GHJ A;  2KA7 A;  1EYA A;  2L4N A;  5DEH A;  3U9O A;  2RA4 A;  4QUF A;  2K5Q A;  3S16 B;  5COY A;  1LTI D;  2WV6 D;  4A93 B;  5EJW A;  2L55 A;  3ND9 A;  2A6H C;  1BXT A;  1EWC A;  3K59 A;  4WOR A;  3LWU A;  2B2V A;  1EZ8 A;  2F0M A;  4ZAI A;  4FF4 A;  4R8I A;  3M4Y A;  5CYU A;  2ZXP A;  2IJ0 A;  4J6H A;  4PMC A;  4Y7N B;  5J1Z A;  3TZU A;  1JOR A;  5KND A;  1TKW B;  3HRZ C;  4KY5 A;  2JA5 B;  4RWS C;  4KKS A;  1EL0 A;  2RVL A;  3MA2 B;  3D8G A;  3S15 B;  1GJX A;  1UUP A;  1JWM D;  2CHB D;  3KF8 A;  4FNF A;  1PZJ D;  4HMI A;  4DGZ A;  1CT1 D;  4K6D A;  1W6K A;  3SK8 A;  3ZYY X;  1GUG A;  4Q5V A;  3T13 A;  2A6H D;  3V96 A;  1TVX A;  3A56 A;  2WIN B;  1JOQ A;  2NZ1 D;  1BR9 A;  1G2T A;  2Z1C A;  3M85 A;  3FKI B;  4EQN A;  2RDG A;  1SBB B;  3NBI A;  1S5F D;  1I6H B;  2Y0S B;  3BYT B;  1STB A;  4ZRZ A;  4FF1 A;  4FF2 A;  1HUM A;  4U67 3;  1SYD A;  5KEE A;  3K5O A;  2BDN A;  3FDT A;  2NVX B;  2K33 A;  4X3T A;  1JC7 A;  2JE6 I;  3U9S A;  4K14 A;  5COR A;  3GV3 A;  2NVQ B;  3WDN A;  1T5E A;  4LAA A;  1XTC D;  4V0B A;  5CV6 A;  1DOK A;  2PZT A;  2FJ2 A;  4A3I B;  2F0J A;  2BDO A;  2K5D A;  1RKN A;  4KJO A;  1NSN S;  4KMU C;  1SNP A;  1STH A;  3NTK A;  1EU4 A;  2LMC B;  4RGT A;  3V2T A;  1AN8 A;  3M7G A;  1TWA B;  3CHB D;  5C4Z A;  1A15 A;  5K36 G;  1Y8O B;  3IFD A;  3S1M B;  4FO2 A;  1SAP A;  1VMC A;  1IW7 C;  4M8A A;  3WOE A;  4FYD A;  4K5W A;  3D6C A;  4OO1 G;  2NVT B;  3S1Q B;  1PTO B;  4WJW A;  2X6G A;  1TWC B;  1LAC A;  1CM9 A;  5CC4 A;  4N9P A;  1VCI A;  4C3J G;  4FVM A;  1FNV A;  4KI0 A;  4EQP A;  2ZT9 C;  4BY7 B;  2EYM A;  4F88 A;  1CQF A;  1O78 A;  2D9U A;  2K01 A;  2B2V C;  2SNM A;  4O1N A;  2F0U A;  1IKM A;  3LNN A;  2EZV A;  2IX1 A;  2RKS A;  1HA5 A;  3BDC A;  3SVM A;  2L9H A;  3A7A B;  5E4X A;  1IW7 D;  3D4W A;  4L63 B;  5I4D A;  4K6L A;  3MFG A;  2QKI C;  3HOX B;  3GD7 A;  1RD9 D;  3AMU A;  3KUP A;  1G91 A;  3VYT A;  1CI3 M;  1ML0 D;  1GUT A;  2R6G A;  2PZW A;  3FPU B;  4K8I A;  4FXG C;  3T51 B;  2AQ1 B;  4DK1 A;  4WFN 3;  3HEJ A;  5M9O A;  2ZXO A;  3QOL A;  3DWP A;  3L3O C;  4QUC A;  4ZKC B;  2E76 C;  1A3V A;  2PW5 A;  4H0L C;  3DXJ C;  4DAV A;  2NBF A;  1U4R A;  1HHV A;  1TWH B;  4BS9 A;  4UAI A;  4IUU A;  3A54 A;  3NUC A;  4FXD A;  1STY A;  3RMH A;  4FP5 D;  1B2T A;  1JB3 A;  1XXG A;  3D4D A;  4BY1 B;  2K28 A;  1SYC A;  3TP8 A;  3BVM A;  1WTQ A;  5CBA E;  3O13 A;  2JSO A;  2L1B A;  3OIP A;  1CTM A;  1JE4 A;  2OXP A;  4NMZ A;  2O5I C;  3NTI A;  3BYY B;  1MI2 A;  4XT3 B;  3HG9 A;  1BCP C;  1S5E D;  2QF7 A;  1RTN A;  2HQE A;  4IQZ A;  2SDF A;  3OW7 A;  2JP1 A;  1PLF A;  2YYZ A;  1B9M A;  2K5W A;  5J39 A;  3PUV A;  5DNF A;  3J80 E;  2DY7 A;  5E1F A;  4A3F B;  3BVG A;  1Y1W B;  1ROD A;  2A68 C;  2PCF B;  2HDL A;  5KYL A;  2F0K A;  3I73 A;  5FOB B;  2E74 C;  3CU7 A;  3VR5 A;  5BN3 A;  4TSS A;  5CR3 A;  3ND8 A;  4ME5 A;  5M3F B;  1Q1B A;  1Y1V B;  3KLS A;  4IUN A;  3OSO A;  4JBW A;  3T53 B;  5IOC A;  1BCP D;  3MVV A;  4A3K B;  3VR4 A;  4PNY A;  1GHK A;  3PIO 3;  1OO9 B;  2L12 A;  2A68 D;  3C2P A;  3J7A F;  2F0S A;  1PRT C;  1V1P B;  1MGS A;  3A8K E;  4DXG A;  3GTQ B;  3R8B A;  4RFB A;  1TS3 A;  2J4X A;  2FMM A;  1IKL A;  1VF7 A;  3H6M A;  1DOL A;  2Z8L A;  1SE4 A;  1FNW A;  2J7Z A;  4J1M A;  3S17 B;  1XX8 A;  2FHT A;  3GTM B;  3TZD A;  1JCK B;  1CHQ D;  1KTK A;  3J7Y W;  3JAM E;  1OXS C;  1BCP B;  1I50 B;  2EJG C;  3ITP A;  1PRT D;  5IGC A;  4CKC A;  2ID0 A;  5JVG 3;  3PIP 3;  2Q8R E;  1ENA A;  2EVB A;  2AUJ D;  4KN7 C;  5EGT A;  1O7Y A;  2KED A;  1SYG A;  3SDZ A;  5ELB A;  1G2S A;  1Q1E A;  3LX0 A;  5JJZ A;  1HQR D;  3E6Z X;  1WD0 A;  3H09 A;  2CQA A;  1A2T A;  2EY1 A;  2RSO A;  2WKD A;  4HSV A;  5CV9 A;  1SXT A;  5KIX A;  1PMR A;  2HCI A;  1G8Z D;  2XWB B;  4KKT A;  2F0H A;  1GOZ A;  1RHP A;  1WTV A;  2AWO A;  4HCE A;  1QJO A;  3ONA B;  2JXM B;  5IGD A;  1BQQ T;  1PRT B;  5IOD A;  1C4Q A;  2N88 A;  2JEA I;  3VA5 A;  4DAP A;  4DF7 A;  2B63 B;  4ID6 A;  4KN4 C;  2MGS A;  2A6E C;  2F0V A;  4A3G B;  3J81 L;  2KEC A;  2H1E A;  2D5D A;  4YIJ A;  4PV1 C;  3NWS A;  1B3A A;  3FVQ A;  5FLX L;  3M4O B;  1WVL A;  3TN2 A;  3K0Y A;  2B2T C;  1EIH A;  3VYS A;  2HCC A;  1Z47 A;  1SDF A;  3TME A;  1I4H A;  1WTW A;  1KNA A;  2B2U A;  2B2Y C;  5T1I A;  4A3E B;  3BZD B;  1SMY C;  2A6E D;  4K5V A;  2G9H D;  2M9V A;  2EOT A;  4HED A;  1A3U A;  1JWU D;  2HDM A;  2TSS A;  2WB1 B;  4ZQ3 A;  2M00 A;  2NB0 A;  4I7Z C;  1Y8N B;  1QNU A;  3AU7 A;  3I4N B;  2R3Z A;  1O7Z A;  3G6J B;  2F0W A;  3I3C A;  1SEB D;  1AEX A;  4RHR A;  3IKJ A;  5J22 A;  5M5X B;  1I4Q A;  3MFY A;  4RCN A;  2L11 A;  1R9T B;  1UEA B;  3QG1 A;  2PW7 A;  4IUV A;  3S2D B;  5EBD A;  3FMC A;  3W2D A;  1SMY D;  2XRQ D;  2KQ3 A;  3CRK C;  3GV6 A;  4B9X A;  1HTL D;  2A73 B;  4DFA A;  3MEH A;  3KBG A;  1IYV A;  1D5M C;  5A35 A;  5F2D A;  3A8I E;  5D65 A;  4XQJ A;  1QOH A;  4CKE A;  1ONL A;  2IPK D;  2EJM A;  4KD3 A;  3H94 A;  1LTA D;  3GP7 A;  1PFM A;  3EQL C;  5CV7 A;  2H4O A;  3DHQ A;  3W3A A;  1SSO A;  2L5T A;  4S3S A;  4Q0F A;  5EQ0 A;  1D6E C;  3EFX D;  2BA1 A;  4DNT B;  1RCV D;  4V19 0;  1HA6 A;  1G29 1;  1EQT A;  2A69 C;  2F4I A;  5D3I B;  4O42 A;  5I9P A;  2PZU A;  1LO5 D;  4IUQ A;  1LTB D;  1TWF B;  3NPP A;  3QB3 A;  4RAU C;  3NQT A;  4PMB A;  4TQU S;  1SND A;  4RKL A;  5E4W C;  3NWT A;  4G7Z C;  2BOS A;  4ZUJ A;  4NP5 A;  4DNR B;  1RTO A;  1IL8 A;  1JIC A;  5JEA J;  4BA2 I;  4FXK C;  1NR2 A;  3MXP A;  1H9S B;  1F2L A;  3A8J E;  2AQ2 B;  4CHT B;  1I4R A;  1H9J A;  3MC0 B;  2A69 D;  1B44 D;  3KLS X;  3NXW A;  3QWN A;  2YU9 B;  4FF3 A;  5C6A A;  1LT5 D;  1NUC A;  1SJH D;  4RGN A;  4C3I B;  2A5H A;  4WRD A;  4XYO A;  2F0F A;  3I4L A;  1YNN C;  4IAL A;  3SHL A;  4F7X A;  4ZKB B;  2SOB A;  4KTA A;  4F8M A;  2EE1 A;  2IW3 A;  1B9N A;  2KUM A;  3QOJ A;  4K5X A;  3RZD B;  1STA A;  2B39 A;  5CV4 A;  1W6J A;  1BBX C;  1EY4 A;  4BBR B;  2KCN A;  2F0P A;  5JEA H;  5NUC A;  3HS0 C;  5C4J B;  3HOZ B;  3MAQ A;  3K57 A;  4XQQ A;  5IT9 L;  2E75 C;  1EYC A;  1J8I A;  5A2Q L;  1YNN D;  2K7V A;  4QIW B;  5IIF A;  3Q6S A;  5FO9 B;  1KAA A;  1M8A A;  4RGO S;  1KLU D;  2IL8 A;  1PYW D;  4C3H G;  4QF4 A;  4OIK A;  5DM7 3;  1QNK A;  5HUR A;  1PDQ A;  4Z9C B;  1DZ1 A;  2B8G A;  4HR7 B;  5ELF A;  1F77 A;  4CJ1 B;  4EQO A;  1STG A;  2NTS A;  4KY6 A;  3T4A C;  2F3W A;  3HZX A;  5I2Y A;  5ELD A;  2VB2 X;  3E0J A;  3MTS A;  2KCC A;  2PNR C;  5JPN C;  3CRL C;  3EJI A;  5LL6 S;  1HTP A;  4K8J A;  2LFN A;  4KKU A;  2EYP A;  3DUZ A;  1NAP A;  5TSS A;  1ESF A;  3N6R A;  1O80 A;  1X3P A;  4IN3 A;  3GTO B;  2A74 C;  2F0Q A;  1D1K A;  2XIW A;  4RKB A;  1LTG D;  2B2W A;  3DWQ A;  2CVR A;  3I70 A;  3TP7 A;  1KDA A;  1XWE A;  3BDL A;  4MHE A;  1C8C A;  4KD4 A;  3E5S A;  1I3Q B;  1KDC A;  4HSP A;  1E2V A;  2R92 B;  1ILP A;  3GTP B;  3ERO A;  1JQY D;  3TDQ A;  3T56 B;  1FYC A;  4CGY B;  3K5M A;  4XQN A;  1KNE A;  4B9W A;  1KAB A;  5CBE E;  4IFD J;  3SR1 A;  3BG3 A;  2NWG A;  5I6Y A;  3RLF A;  1EQV A;  3SXH A;  1F2Y A;  4HTH A;  4QB4 A;  1CK1 A;  1II3 A;  1ZYR C;  3G7L A;  3K58 A;  3R3O A;  2E2I B;  5FO7 B;  2O4X A;  1H9R A;  5EPK A;  5LL6 X;  2LKV A;  3V05 A;  3DM1 A;  4ABN A;  1GUO A;  4XTC S;  4C2M B;  5D3D A;  1U4L A;  1AZP A;  3S2H B;  3F2U A;  2NN6 H;  2R93 B;  3GTL B;  1TWG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...