4TRDA

Crystal structure of staphylcoccal nuclease variant delta+phs i72k/v74k at ph 9.0 at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEKEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylcoccal nuclease variant Delta+PHS I72K/V74K at pH 9.0 at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 131
sequence length 131
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4trdA00
2RBMA 2F3WA 1KAAA 1ENCA 1SYDA 1EY8A 5CGKA 2EY1A 3MXPA 1STBA 4J1MA 4ME5A 4PMCA 3TP8A 5C5LA 1EY5A 2QDBA 3D4DA 1AEXA 2SNSA 4KHVA 4HMJA 5C4ZA 3QB3A 1TT2A 2O4XA 3NXWA 4ZQ3A 1TR5A 4KY7A 3P75A 3P1HA 3QOJA 2KQ3A 2F0IA 1KDBA 3NUCA 4MIUA 4RKLA 2F0MA 4B9XA 5HURA 2PZUA 1EY7A 1JORA 3DHQA 2PW5A 5KEEA 4F8MA 5M9OA 2F0LA 4K8JA 3TP7A 5CR3A 5HGTA 3H6MA 4HMIA 5I9OA 2F0GA 1EYAA 1A2UA 2EXZA 2NUCA 5DEHA 4DGZA 2F0WA 1NSNS 5J22A 4S3SA 5C3WA 1EZ6A 2SNMA 2F0JA 5E1FA 5CV4A 2F0EA 5CV8A 3OMGA 4N9PA 5KYLA 4ODGA 3V2TA 3EJIA 4YIJA 4EQOA 1STYA 1F2MA 4IUNA 3HZXA 5IODA 1JOKA 2F0QA 3MVVA 4WRDA 4LAAA 5J39A 3TP6A 1KABA 5IIFA 2F0SA 4EVOA 4OL7A 3BDCA 3TP5A 1SYEA 4I65A 4K5VA 2F0UA 2EYJA 1SNQA 2PQEA 1SNPA 3LX0A 4WORA 5CV9A 1STNA 1RKNA 5IGCA 3MHBA 3VA5A 5DAUA 1SNDA 3DMUA 4DF7A 4H7BA 5C3XA 4QF4A 3SK6A 3SK4A 4QMGA 1A2TA 1EY0A 2EY5A 1KDCA 2OXPA 1EY9A 4RKBA 5IGBA 2EY6A 5JOBA 4K5WA 3E5SA 4QB4A 4KY5A 1SNOA 5C6AA 2F0TA 1F2ZA 1A3VA 2PW7A 1EYCA 4E6IA 4KTAA 3EROA 4NMZA 4NP5A 2EYPA 1EYDA 4KD3A 2F0FA 3TMEA 5C4HA 5ISRA 3C1FA 2EYMA 5F2DA 3OMCA 4IZ8A 1ENAA 3SXHA 5E3FA 1STGA 1IHZA 2EYFA 3PMFA 4NDXA 5EGTA 4K6DA 3RUZA 5IGDA 4R8NA 5I6WA 2PYKA 2SOBA 5KGUA 1U9RA 1EY6A 5IGFA 1TQOA 3D6CA 4HTHA 1EZ8A 4K14A 2EYHA 3BDLA 2F0DA 3OWFA 3MEHA 2F0OA 4K2KA 3SR1A 5KIXA 5KRUA 1SYBA 1EY4A 3EVQA 5C5MA 3T13A 3NP8A 2F0VA 1STHA 4ZUJA 5EKLA 5CC4A 4ID6A 4DU9A 2RKSA 1KDAA 5CV5A 4DFAA 2PZTA 1SYFA 2KHSA 2LKVA 2WACA 4K5XA 4K8IA 1SYGA 4N9TA 4EQPA 1NUCA 2OF1A 5J1ZA 3U9OA 1JOQA 1EQVA 1F2YA 3HEJA 5IOCA 1SNMA 2EY2A 3OSOA 4KJNA 4EQNA 2PZWA 3S9WA 5CV7A 2RDFA 3C1EA 5I6YA 3ERQA 2M00A 4KD4A 2F0NA 3NHHA 3D8GA 3SK5A 3QOLA 4NKLA 5I9PA 3MZ5A 4KV6A 5JAVA 2ENBA 1STAA 2HQEA 3R3OA 5KYIA 2F0KA 2EYLA 2F0HA 5EKKA 3ITPA 4KY6A 1II3A 1SYCA 2F0PA 1A3TA 4J6HA 4PNYA 4TRDA 4B9WA 4F7XA 1A3UA 4G57A 5NUCA 2OEOA 5IGGA 5K5PA 4PMBA 3T16A 2EYOA 3SK8A 3NQTA 1JOOA 2F3VA 4IALA 3SHLA 4K2LA 1SNCA 5CV6A 4ZUIA 3NK9A 3D4WA 4KJOA 5IGEA
chains in the Genus database with same CATH superfamily
4DUYQ 1O7YA 1S5ED 1FD7D 1N8RC 1SAPA 2ZJRA 1BF4A 1CTMA 4JI2L 3TP8A 2IX1A 2UUAL 1I6VC 3NTKA 4KKUA 2O4XA 3Q6SA 1RJTA 1JJ2A 3HGBA 4JI7L 3GV3A 2K7VA 1Y1WG 2VNUD 1GUGA 3BG3A 5DLQE 1CM9A 2GN5A 2N55A 4YHHL 1N33Q 1PH5A 2KCCA 4S3SA 4CDDC 4OO1H 5C44H 5LL6X 2XVSA 3DM1A 1CKOA 4B3SQ 5IIFA 2L15A 2BOSA 1I50B 1DOMA 4A3EH 3ND8A 5CV9A 3SVMA 4JI1L 1J8IA 1BUVT 3M4OH 2R93B 2Z0SA 3WOFA 3CCQA 4HCSA 3S17B 4QB4A 1DJRD 2XWBB 1PTOB 4WJWA 1N36Q 2JQOA 4DUZQ 1EEFD 2L0CA 1MJEA 3VR3A 4C2MH 2F03A 3BYTB 4DV4L 3P7JA 4MTKA 1V1OA 1LTTD 2SOBA 4GNXA 2X6LA 1NBWA 3D6CA 3K80C 1NR4A 1QUQB 1OXSC 1WFQA 3HKZG 4ID6A 1CSPA 4GN5A 4K8IA 2WAQE 1MD2D 4MTNA 3HOXH 1M90C 4HAEA 4BBRB 3S9WA 1I94L 2HQLA 2F0NA 3SK5A 4A4IA 2HQEA 4CBVA 3H0GG 3W3AA 3JC66 1H95A 1A3TA 1X56A 1TIID 1CKNA 1HPCA 2HT1A 1K28A 3N6RA 4A3MB 3NK9A 2R7ZB 3GO5A 4ZLTF 3NBIA 4OIJA 2UUBQ 1D7QA 1PTOD 1SROA 2MPMA 2Q2IA 3CC4A 2E2DC 1O7ZA 4JI3Q 1SSOA 3H09A 3K8AA 3X3NA 3P75A 5A2QL 3NUCA 4EX5A 4X65L 5HURA 4ME3A 1E7ZA 5IYCH 2AWOA 3D4RA 3BZDB 5KNCA 4KMUC 1XMOQ 3UI2A 3OIPA 3A56A 1VQEA 2OTJA 1KRTA 5BN5A 1HRJA 1EZ6A 5IYBH 1VQ6A 2ZM6Q 4OONA 3L2PA 4J15A 1B3AA 2K5NA 1SJED 2A68C 2Z6KC 5GQOA 1L1OC 1PYWD 2QF7A 1S5BD 3KDFB 3DXJC 4DR1L 1IBKL 2JA7G 4HEDA 4LF5Q 2NN6H 1SNQA 3PV0A 4GKKQ 2HUGA 1PVOA 4LF9Q 5DAUA 4LFBQ 3NPPA 2D2CC 1HFGA 1Y8NB 4A3FB 1LT6D 3SK4A 1VMPA 4C3IB 1EY9A 1D5XC 5IGBA 4L5RC 3H91A 4H44C 2E2JH 1R4PB 1YJNA 3TBIB 2M9VA 3M85A 4NMZA 1D6EC 5IP7G 3E3XA 5M3FG 1WVLA 4MHEA 4OX9L 4BA2I 1QG7A 2E2IH 4RHRA 3NWTA 1E1TA 1RL2A 5IP9G 4R8IA 2XGTA 1W3SA 1JWSD 2KA7A 1B7YB 4C3JG 1F2LA 2L12A 3A7AB 2JYOA 2WIIB 1WD0A 1HNXL 1EY4A 3I3CA 1IYJB 2DN8A 4DKAC 1WOCA 5CC4A 1A8VA 4DU9A 4XXEA 5EAYA 2K75A 1I4PA 1NUCA 4QQBX 3DM3A 1B9NA 2FMCA 2MFIA 1Q90A 1ESRA 1HH2P 3ERQA 3LWEA 3CCRA 1VQNA 3NHHA 3MZ5A 1XWEA 2ENBA 3GD7A 4JW0A 1STEA 2IWHA 1EUJA 4TRDA 1DZ1A 1GUWA 4FXDA 1VQ8A 1TWGB 3PIOA 2JA5G 3NQTA 1JOOA 4X66L 4U673 1XPOA 1F9RA 2NVXH 5G3LD 1JMCA 5T1GA 3I90A 1VQKA 1ZXTA 3X3MA 4GNXB 3T1YQ 1IBLL 4R9WA 1JC7A 4IN3A 2M2LA 5EQ0A 4HJ5A 3F2UA 4O0AA 1ZYRC 1PH1A 4F8MA 1ICFB 2VY3A 3S1QH 2QEJC 2UUCL 3FKIB 3QWNA 2E5LQ 3CRLC 3DEOA 1TWFH 4AIMA 4IURA 5C0XI 4IFDJ 1WCMG 1E0BA 1QWYA 1B9MA 2E76C 1PRTF 5J22A 2FINB 4P72A 1XX8A 4X3UA 4ODGA 1GM5A 3VYSA 1STYA 1Y1VB 1LTLA 2N88A 2F4VQ 2MHVA 1CKNB 5FO9B 4H0LC 1KTKA 1NAPA 4R4QA 2CH4W 2SDFA 2IY5B 1CUKA 4GZYC 4DUYL 4HIKA 1LABA 4DV6Q 2NVTB 2E74C 3MHBA 3I72A 1BCPC 4IUPA 1JCKB 3HOUH 4L5TA 3EA6A 1SEBD 1EWCA 4L5QA 3VR2A 4JOIC 1XXGA 3KLWA 2EVBA 4IFDG 3HFZB 1ZKOA 1BQQT 3PUZA 2EYPA 2JK8A 3NWSA 3GTMB 1R9TB 1K3RA 3NQIA 1VQ9A 2WB1E 1PH2A 3IFDA 4A3DG 3O13A 3PF4A 4RGOS 1Q46A 1N33L 1X3EA 5EPJA 1JT8A 4B3TQ 3SDZA 3RUZA 3RN2A 1SBBB 4OWWB 1VQ7A 4NB3A 3A0JA 1PH3A 1X9NA 1WTRA 4B3SL 2G5DA 4OHJA 3VYUA 4DR3Q 4G4KA 3JAME 3C46A 4A3KG 4DV0L 2LKVA 3FDTA 3RLFA 4OELB 1JOQA 3J7YW 3JAMc 3HEJA 4A3LH 3RR5A 3Q24A 1EWIA 2B39A 3T1HQ 2QA4A 3C2PA 1EU4A 1X3QA 4PNYA 5FJ8G 2HDMA 4RG1A 3S1RB 1PH8A 1N36L 2KHJA 2K6AA 4GOPC 4JPBW 1JB7A 1CKMA 4QUCA 4QIWE 3L3OC 5IYDH 3U50C 5CGKA 4C2MB 5M3MG 4Y52H 1STBA 3BDOA 3I56A 4X3SA 2BE5C 3ND9A 3IRBA 1TWHH 3VR6A 1V1QA 4ZQ3A 1JJCB 2LS01 3Q8DA 1HNZQ 2K04A 3BVMA 4ZKCB 1CSQA 3S14B 2K1BA 1YHBA 1ILQA 3E6ZX 2NVQB 3H6MA 3K7AB 1I50H 1YIJA 2HHHQ 3QJYA 5DNFA 2B2YA 1K0RA 1GOZA 1HR0Q 5D3IB 4LAAA 1TVXA 4B3MQ 3DUZA 1SE8A 5JEAG 5JPNC 2F3IA 1PTOH 2Q2UA 1OO9B 1EIYB 4V0BA 4WORA 3U9SA 4DR7Q 2UUBL 4UP8A 1H9KA 2EXDA 2PNHA 4QF4A 3TZUA 2CQAA 1E2WA 3E9HA 4DR5L 1KDCA 2KCNA 3KUPA 3OPOA 5L37A 1QVGA 1S40A 1C0AA 1WTWA 2F0TA 2FXQA 2YYZA 4E6IA 4RFBA 3TMEA 3EROA 1XMOL 1ENAA 1QZHA 4IUQA 1PXUA 3IKJA 4ZCKA 4CJ0B 2ZM6L 3A5UA 4YWMA 1X3GA 3BS1A 1M1KC 5IGFA 1TQOA 4HTHA 2JA5H 3HP3A 2QW7A 1D5MC 1LTGD 3UDIA 2Z4HA 4DAPA 1IW7D 4L63B 2H4OA 2NZOA 2PZTA 3GTQB 2NWGA 1UUPA 3GTKH 3F2BA 4LJZC 3U9OA 4GKKL 1LTAD 3J81L 4LF9L 5J3BA 2V4DA 3K5NA 4LFBL 1G291 4A3MH 1L1OA 1DOKA 2JA8G 1BXTA 4BA1I 1K8GA 5I6YA 1VCIA 3WDNA 3I2ZA 1L0WA 4BY1G 2ICIA 3AFQA 2MNAA 3GTLH 4IALA 2I5LX 3G4SA 4K2LA 2R7DA 3EBEA 1O7LA 3D4WA 2XRQD 4DK3C 1CQVA 4ZYSA 4DR2Q 3K7UC 3TRZA 2E2IB 2EY1A 4DV3Q 3WOEA 1LM0A 2SNSA 5ELBA 4DPGA 3CMAA 3S1NH 1TT2A 4G7OC 3U4ZA 1HUNA 2K52A 4JCVE 2ZJQA 3RZDH 5JJZA 4TVAB 3VR4A 5M5XB 1LTRD 3J80E 2B63G 4HR7B 4IFDH 1FNWA 2EJGC 2EZVA 3I4OA 5E1FA 3J80c 4C3IH 5FLMG 4P2CB 3PQIA 3H94A 4A3DH 2Z4IA 1Y1WB 3TP6A 3F2CA 4KHPQ 4CHTB 5FK9C 3BDCA 2JP1A 1SYEA 2I07B 3I73A 1VQFA 4QY7A 1IYVA 1QOHA 3CC2A 2IX0A 3T1YL 4GLXA 3HRZC 2NVXB 5LMUQ 4JI5Q 1H9MA 2EY5A 4XT3B 4RKBA 1QILA 3PIO3 1HR0W 1ICWA 2RHQB 1JR0D 1MSHA 1RHPA 4KTAA 4WFN3 2E5LL 1SDFA 4ZK9B 3C1FA 1HTLD 3GV6A 4C1NI 1OTCA 2Q8RE 1TWFB 4HIOA 5I6WA 2VQFQ 1AE2A 3FPUB 2ICEC 3JAMi 2WAQG 1SXTA 1XTDA 4XDXA 3CCLA 2F4VL 4DV7Q 2PMZB 3HOVG 3BVGA 2JEBI 1JJGA 1YBYA 3HOYG 4QCLA 4FYDA 1NTGA 4DAYA 5M3MH 4DV6L 1TWGH 5J1ZA 5FLXL 1LT3D 3C1EA 5JAVA 2D0OA 3CCEA 1VQAA 4K6LA 3HKZB 1Q86C 5CORA 1HUMA 3ITPA 1E3PA 1LYLA 5BR8Q 2FMMA 1LLRD 1PYSB 1PTOF 1V1PA 2EYOA 3E0JA 1S5FD 2EQSA 5C4XG 1I4RA 3A74A 1NMGA 4FF4A 4JV5Q 1G91A 4PZ6A 1AZQA 3H0GB 3CAMA 3K5MA 3MXPA 3I4MG 1L2FA 3ULPA 4KHVA 3U4VA 4H02A 4ILWA 4DR3L 3QOJA 3I7FA 1X6OA 2A74C 1CZGA 2KQ3A 4RGMA 4B3RQ 4XQNA 1YNJC 3MA2B 2F0LA 3CD6A 4TQUS 1L1OB 1EQRA 2KJXA 5I2YA 4BXXG 2NVTH 3I8ZA 4DGZA 3BZKA 3MFYA 3I4NG 3LGJA 3STBC 4N9PA 2IT1A 1PV4A 4RWSC 2IHEA 1VQ4A 3OW2A 3MVVA 3E0EA 4N8FA 4X64L 3Q22A 3NENA 2K28A 3H3VH 3H3VI 3TP5A 1WTOA 4DR6Q 3GTMH 4V190 1R9TH 5E7NA 5IGCA 5GROA 1IYUA 2CH4A 3TSSA 3VA5A 1NNXA 2HIXA 3SK6A 4JBMA 3PIPA 2B2VC 3ICEA 4YCUA 2IPKD 5GAGC 1D1IA 1TWHB 2JA7B 1EYCA 2WV6D 1VQCA 2E8GA 5AFWA 1EYDA 4RA8A 1B70B 2F0FA 2A19A 1HXYD 3S24A 4IJLA 4Y7NH 4OO1I 5FKAC 3R2IA 2RDHA 4IZ8A 1KNAA 5IT9L 4LWCA 3OOCA 4BY1H 2HHHL 4LF6Q 3S2DH 2K50A 3OWFA 3VYTA 1UE5A 5IE8A 4LNQA 1K9MC 2B2WC 2A68D 2X6GA 3SEBA 4B3ML 5M3FB 2WKDA 3P20A 5CV5A 3S1RH 2I0QA 1KIXA 2YU9B 1EQVA 2WINB 1F2YA 1FJGQ 3LNNA 3IFTA 4C3JB 2VS1A 2Y0SE 3J7AF 1RTNA 1S5DD 2C5CA 3AB9A 2K32A 1GVPA 4P74A 1ML0D 4RCNA 4KY6A 5G3LF 4OEMB 4UY8C 4G57A 3K59A 5C0XG 2KCMA 5IGGA 3T16A 4KHZA 4EQ5A 4LF7Q 3AEVA 3S14H 1NMFA 1AZPA 1A63A 2F3WA 5FLMH 2NVQH 1Z9FA 3K7AH 3AFPA 4JI0Q 1RODA 3DWPA 4IOCA 3S1MH 2AKWB 4RMFA 3QB3A 1PH4A 2JA5B 3DWQA 3RN5A 4DAYB 4A3GG 1VS0A 4HN7A 2KHIA 2Z9HA 3J80i 4CJ1B 3GTKB 1H9JA 4LF4Q 1UE7A 1S3OA 1VQMA 3CW2C 3I91A 1X3PA 1TS4A 1SJHD 1ET6A 3CU7A 2F0JA 4RCOA 5A35A 2D62A 4DK1A 3CPWA 1BCPB 1V1PB 2B2TC 3EFXD 4DR4L 3QO2A 1WCMB 2LMCB 3M4QA 3M7GA 1CHPD 3GTLB 4I65A 2Q8TA 3T4AC 4DR2L 5K36G 2L9HA 2I46A 1PH9A 2OT2A 3HOVH 2R7FA 1SMYC 2CKZB 4POGA 1J6QA 1W6JA 2WB1G 5HGQA 2EY6A 4JI6L 1D8LA 1Q81C 3S1NB 4JI8Q 5CBEE 1ZYRD 2R3ZA 5JJLA 2MJ8A 4R4OA 1H9SA 4X3KA 5M5WH 1VQIA 1Q12A 5ELFA 3MXNA 3RZDB 3GTQH 2ZT9C 3V05A 3RNUA 4CJ2C 5LMNQ 2A73B 4A3IH 3UDXA 4R8NA 2PYKA 1TS3A 4IQZA 4M1UB 2NN6I 4JBJA 5GAEC 4A3BG 3QIAA 5AJ3Q 4KHPL 2NYZD 5FO8B 3PUYA 4J8QA 1CHQD 1TY2A 2K33A 2R61A 2VQEQ 4A3DB 1FGUA 4N9TA 3I4MH 2RDGA 3W2DA 4BWGB 3PO3G 3VR5A 3VYRA 1BCPD 4KJNA 3NELA 4JI5L 2OCEA 1U5KA 4TKOB 2R6GA 4KLKA 4AYBE 3QOLA 4UP7A 1G2SA 4FF1A 2F0KA 3WWVA 1AP0A 1EIGA 4A3KB 1GUOA 1A6XA 1EFID 1A3UA 4PQXA 1PLFA 3DWAA 4RH6A 4L5SA 2ASBA 4HJ9A 3I4NH 4WJ3M 1KAWA 4IPDA 5IGEA 2VQFL 3VDYA 2YV5A 5A2QE 3GTOH 5M5XH 1LACA 1SRUA 4DV2Q 3D6WA 4HMJA 3L9AX 4JI4Q 5EBDA 3P1HA 1AE3A 2HIVA 4C56C 1EY7A 2BH8A 4LUOA 1Y1WH 4DNTB 5M3MB 3FMCA 2KEEA 1E1OA 4Q0FA 3OIQA 3HOWG 1GO3E 1KRSA 4BBSG 1OXVA 5JPMC 3OMGA 5BR8L 3KBXA 2MO1A 5D65A 1F2MA 1K8OA 1Q3LA 4HSPA 2B3GA 3BZCA 2V1CC 4AQYQ 4JV5L 1N32L 2EYJA 4PZ7A 1STNA 1RKNA 2J7ZA 1JWUD 2BE5D 3EIVA 1E24A 3OYYA 4DAVA 2NB0A 4B3RL 3PUWA 1Y69U 1F2ZA 2PW7A 2NVYH 2JN4A 3KLSX 3I55A 3GQBA 2BH2A 1YVCA 4O1NA 3TEHB 1IKMA 4LFCQ 1PFMA 4KI0A 4NPSA 5C5LA 4AH6A 2D9UA 4K2KA 2CCZA 2XN9C 5KIXA 1DONA 1GD7A 3S15B 2OF1A 3AMUA 4A93G 4C3HG 1RD9D 3OSOA 5LMNW 1S5CD 1UEBA 2OQKA 2M00A 1Q8KA 4YY3Q 3D8GA 3H0GH 1XTCD 2N8NA 2CWAA 2QGQA 2F0HA 5EKKA 1L0XB 2JA9A 2PI2E 4J6HA 2O5JC 1HNWQ 2VUMG 1H9SB 4IO9A 4PMBA 2B2VA 3MXNB 5E4WC 4A75A 2LXJA 5EBCA 2JA8B 1QVCA 1BKBA 1K83H 5GAHC 3PIP3 4Y7NB 1PFSA 4LF6L 1LO5D 4A3FG 4DXGA 4ALPA 1IBMQ 2RQXA 4BY1B 1AEXA 3S2DB 1BBXC 1IL2A 4R4TA 1TR5A 4APVA 1TWCH 3KF8A 1CQFA 2ID0A 3RZOB 1KLGD 5IWAQ 2B2WA 2JSOA 1Y8OB 4K8JA 5HGTA 4HMIA 2VL6A 4DUZL 1XNRQ 4GN3B 4JC0A 1X55A 3GDEA 2UU9Q 1T5EA 5C3WA 2NBFA 1SE4A 1UE1A 2XSCA 1X65A 5JEAJ 3ULJA 2JA6G 1LT4D 3M4PA 2L1BA 3QG1A 5IODA 4WRDA 4LF7L 4HJ7A 2JA7H 3PO2G 4KK7A 4K5VA 4CKCA 2B63B 4A3BH 4LUZA 2ZJPA 2MP1A 4JI0L 3M9BA 3BYYB 4FO2A 1A2TA 1E2VA 1EY0A 4DK0A 1ESFA 5JOBA 3S1MB 3PO3H 3ER0A 1AFPA 3TQYA 5IP7H 5M3FH 1LV9A 4UPAA 3CCJA 5JVG3 4LF4L 3GP7A 1GJXA 3AQQA 2YU9H 1B50A 3HOZG 3ERSX 1IHZA 1G6ZA 1MIUA 5IP9H 1CZWA 1I4QA 2K5VA 3BVZA 3CC7A 4C3JH 3FVQA 5IGDA 5KGUA 1U9RA 4PZ8A 2K01A 1G8ZD 1SE2A 1U4PA 3SR1A 2UXBQ 3T13A 1DXMA 3AU7A 2HDLA 4F88A 3K58A 4ULLA 4JI3L 2L55A 1T5XD 2YTYA 4JBKA 1K0SA 3UDFA 3CCVA 2A69C 2G9DA 2NTTA 5C3EG 4R4IA 2OQ0A 1HA5A 3CPFA 2WAQB 1B53A 3TREA 1IKLA 5I9PA 4NKLA 3HOVB 4RAUC 5KYIA 4BY7G 1MBYA 4JI8L 3HOYB 4GNXC 3G6JB 4PV1C 2DJFC 2HCCA 1N34Q 1PZID 5EKIA 1JE4A 1FNUA 5M5WB 4ZUIA 4BBSH 4DNIA 4RHSA 4LF5L 1EY8A 1KC8C 1WD1A 4PMCA 4ME5A 4H13C 4A3IB 3VA7A 2Z6KA 2IL8A 3NXWA 1QCBD 2F1MA 4GKJQ 5DM63 4B08A 4MIUA 1KDBA 1C7YA 5C4XB 4B9XA 1B8AA 4FXGC 3FRPB 3EN2A 5ELOA 2A6HC 4LMQD 4R1JA 1Q1BA 1NCVA 5M5YH 5ELEA 4JBWA 4XT1B 1WCMH 3I4MB 2EXZA 3UE1A 1VMCA 2BA0A 2N78A 5LHY1 4KKSA 4KKTA 2VXWA 4Z9CB 4OWTB 3Q0AA 4OWXB 5C44G 3CKIB 1WTVA 3KLRA 4P75A 1JOKA 4XYQA 4XQQA 1XNQQ 4FVMA 4N8X1 1BBUA 1S72A 3NE5B 2Q2TA 5D3DA 3LX0A 4A3EG 3I4NB 3ZJYC 3KYHC 1YNNC 4H7BA 4DV2L 2E75C 1VQBA 1DGSA 3W1GA 3A8KE 4JI4L 2OXPA 3GTOB 1B2TA 2RHSB 3CCUA 4A93H 2WFWA 4BS9A 1GHKA 3KF8B 1QVFA 4IFDI 4KD3A 5ISRA 1YNJD 1M8AA 2EYMA 4NXMQ 5E3FA 1TS5A 2GVBA 3A5ZB 1P8LA 5KNDA 3PMFA 2ES2A 4K6DA 1B1ZA 1CFMA 2Z1CA 3STBD 2ZXOA 1EZ8A 1VQJA 3HG9A 2I5MX 1UE6A 1ASYA 2F0VA 2Y0SG 3J81E 5EKLA 4A3KH 2EOTA 1HQMC 4AQYL 3J81c 2F4IA 1V9PA 1SNMA 2EY2A 2IHFA 2XWJB 3HOXG 5KNBA 2RDFA 1F77A 1O78A 3A54A 3MWYW 2K5DA 3D0FA 1HA6A 1UEAB 1STAA 1SFOB 5IY0A 5FJ8H 4CKEA 1II3A 4IUVA 2NTSA 5K5PA 3B6YA 2JE6I 1PRTC 2NZHA 2TMPA 3K81C 3E9IA 2NVYB 4LFCL 2KCTA 5EJWA 1BNZA 1ENCA 1EIHA 2IW3A 2DUDA 2B2UC 3TN2A 2A6EC 1YHQA 2RSNA 1HNXQ 4X62Q 2QDBA 3D4DA 1QB5D 1QE6A 1Z6HA 1D2BA 1WJJA 1NE3A 4YCWA 1JQYD 3PGZA 3FPPA 1JORA 4A3JG 1KL9A 1B44D 4LF8Q 2GVAA 2K14A 3F1ZA 2LXKA 5CR3A 3V96A 1U4LA 1H9RA 2NUCA 1VQDA 4YY3L 1AW7A 1NR2A 2J0TD 2F0WA 4JOIA 2KOLA 5TSSA 5DM73 4B3TL 1HZ9A 3S2HB 2B8FA 4P73A 1HNWL 2CW0C 3NBHA 2Z6BA 3V2TA 4A3GB 2AQ2B 1WTPA 4IUNA 3HOZH 3GTJB 5FOBB 5JEAH 4ABNA 5CBAE 1EFWA 1I4HA 2BA1A 5ELDA 5JJIA 2PCFB 2Z8LA 3MEFA 2NN6G 1IBLQ 3OTOQ 1K83B 1IBML 4DN4M 4DF7A 3IAYA 3PUXA 4MNOA 1DM0B 4UDUC 1B3QA 3UE0A 3KJPA 1WI5A 4KY5A 1SNOA 1WTXA 3T56B 2C35B 5C3EH 1YZ6A 1MGSA 3NSWA 3T1HL 1YITA 1QJOA 3QR8A 5C4HA 1TWCB 3M3YH 3T53B 1XNRL 2LSSA 2YTVA 5F2DA 5GADC 3S15H 1VF5C 1NY4A 2DGYA 2EPBA 1AH9A 3MXGA 4YCVA 4Q5VA 4FXKC 5EGTA 2WB1B 3OWEB 3KJOA 1A0IA 1U4MA 3KF6A 1LUZA 1CA5A 2WP8J 2DJGC 2EYHA 2F0OA 4GOPA 4CDEC 3GTPH 3M4YA 5FLXE 1BCPF 1STHA 1P16A 4QL5A 3A8IE 4AYBG 2KHSA 2WACA 1HNZL 5FLXc 4QGUA 4CKBA 2JA8H 3DEPA 1D1KA 3SE0A 2KVMA 5CV7A 1SMYD 4A3BB 1ET9A 1BOSA 3CXCA 5C0XJ 1VQPA 3A8JE 3CRKC 5BN4A 1F9QA 2GA4B 2KECA 4QUFA 5NUCA 2OTLA 2OEOA 1EOTA 3PO3B 1Q82C 1HR0L 1PFBA 5C4JB 4IUTA 1XMQQ 3RZOH 2B8GA 2PNRC 4XQJA 4MZ9A 2VB3X 1SYDA 1PZJD 4J1MA 4DR7L 4QIWB 3MAQA 2UXBL 1RCVD 1LTSD 1BDOA 3KBGA 4DV0Q 4CDFC 1LTBD 1Q8IA 4LFAQ 3A7LA 1QNUA 1QNKA 1Q7YC 5T1IA 1KD1C 1I4XA 4OXPA 3TP7A 4POFA 2B63H 1IZ6A 1FNVA 2F52A 4LUVA 5CV4A 2VB2X 2LFNA 4EQOA 1N34L 1UWVA 5J39A 2AMCB 2H1EA 2XTIA 4OL7A 3PCOB 2D0PA 3HOWB 2PQEA 4CDCC 1HZCA 2EE1A 4BBSB 3DLLA 5H1SE 4QMGA 2L4NA 3HOUG 4GKJL 3FEWX 2KUMA 1TXYA 2R92G 5C6AA 2K5WA 1R4QB 2B2YC 1A3VA 3U58A 5IT9E 3CQZH 1MJCA 4HJ8A 3SGIA 3KOJA 3CP0A 3SXHA 1MHWC 5IT9c 1S4ZA 5M5YB 1XYIA 3RMHA 1K8AC 2PQAA 1A15A 1TKWB 1G51A 3J81i 3NBHB 1GKHA 3MEHA 4DV3L 2DY7A 1XNQL 3EVQA 3HS0C 1U4RA 1RTOA 3J81j 3HOYH 3M7NA 1OXUA 1SYFA 1WTQA 3GTGB 5IOCA 3K5OA 4U68A 1SR3A 4A3LG 4DR5Q 1TU2B 1ONLA 4A3JH 4KV6A 3R3OA 1I6HH 3G71A 1SYCA 4K0KQ 4B9WA 1DD2A 4HJAA 1VQ5A 4A93B 5C4XH 4C3HB 4NXML 1Y8PB 1EEID 3KLSA 1EOVA 1GHJA 2AUKA 4FNFA 5IYDG 3KF6B 1B4OA 1X32A 1NJIC 4GOPB 2VUMB 1OXXK 1VDZA 5LMUL 1KQSA 3J7AV 1IXRA 1I3QB 1UAPA 4QJFA 4RKLA 2F0MA 2PZUA 3DHQA 1XPRA 3K5LA 2N3SA 1KNEA 1HQRD 2KENA 5I9OA 1DYQA 2FFKB 2ZTDA 3CF5A 4BXXH 2F0GA 1DOLA 1EWHA 2E2HH 2R93G 5CV8A 1RDPD 3EJIA 4YIJA 2UXCQ 2J4XA 2ZTCA 3HZXA 5EPKA 1PDQA 1KABA 4DV7L 2F0SA 3BU2A 5FO7B 3KK7A 2EIFA 2P5ZX 1TWAH 2UXDQ 5BN3A 1JB3A 1K8MA 1OXTA 4X62L 1O80A 2JA6B 2KBNA 4HIDA 1PYBA 4K5WA 3E5SA 1PMRA 3D31A 3PO2B 4IOAA 4NW2A 2B2UA 1XPUA 1GXDC 4LF8L 3MTSA 2DNEA 1EU3A 2L5TA 4JVZA 2K4KA 2MO0A 2PMZE 1PTOC 4BBRG 5JVH3 4K14A 3BDLA 2F0DA 1EQQA 1VQLA 1SYBA 1SFOH 4ZUJA 2MGSA 2A8VA 3BJUA 5CMDA 3HOZB 1YHAA 4IJHA 2BCOA 3URYA 3OTOL 3JAML 4IPGA 3HKZE 5CYUA 4A3MG 1F9PA 2R7ZG 2Q8IB 1ZEQX 2BDOA 2G9HD 3CHBD 4DV1Q 2EYLA 1BVSA 1FGBD 2F0PA 2ALYB 4LK1C 5C0XH 1ENFA 4NXNQ 2D5DA 5C3EB 3SHLA 1BO0A 3M3YB 2PQAB 1JICA 3ZYYX 2RBMA 2PO4A 4DR6L 5D14A 3I70A 1YI2A 4BY7B 2H5XA 3MXUA 4JK1C 2RA4A 4DAMA 1E22A 3I4LA 5C4ZA 4DA2A 2ATWA 4IPCA 3S2HH 4A3GH 3GTPB 4UHVA 2A69D 3GTJH 3TZDA 1PHJA 2CWPA 3MC0B 4CGYB 1C9OA 5EPLA 1X3FA 1A2UA 1VQGA 2R92H 5DEHA 2AHOB 1HHVA 1NSNS 1SLJA 2SNMA 1J9OA 1MSGA 4FDBA 5KYLA 1Z7TA 1YJ9A 4OGQC 1L0YB 4C3IG 3KFUA 4JYAQ 4G7HC 1XMQL 2EJMA 4LW1A 4GLVB 5K36H 1I4GA 3ONAB 5E4XA 1FL0A 3K0XA 1PH6A 1J5EQ 1D5ZC 3L7ZC 3NTIA 4DV5Q 3PF5A 1HZBA 1FJGL 5I2XA 5C44B 3CCSA 3S16H 3F8TA 2CVRA 1FR3A 3FP9A 1CA6A 1Z47A 3CCMA 2XIWA 4LFAL 2A6HD 2BDNA 2K5HA 4XYOA 4A3EB 3G6EA 4O42A 2OWOA 3G48A 3MFGA 3M4OB 2EYFA 2TSSA 1G6PA 2MQHA 1YNXA 2HD3A 3PUVA 4M8AA 4C1NK 2FHTA 4P71A 4JI2Q 2QCPX 2AWNA 3J7ZC 4X64Q 3LWUA 1CT1D 2UUAQ 4GS3A 1GUTA 1VQHA 4JI7Q 1SYGA 2CFMA 4JG2A 5C4JH 1IL8A 2QKIC 1YNND 1GUSA 2DY8A 2PZWA 3G7LA 4WJ4A 1PRTB 4YHHQ 5LL6S 2Y0SB 2K03A 1EQTA 2O2LD 1HFNA 3K0YA 4UP9A 1G2TA 1DCZA 4FF3A 1K73C 2C9OA 1EL0A 3HOXB 3CQZB 1PA6A 2ZTEA 2R93H 2JXMB 2QEXA 4KJOA 1KAAA 3FKIG 2RF4A 4JI1Q 1HTPA 2XNAC 3S17H 1ILPA 4L6TB 2VZAA 3RLOA 1EY5A 4O2DA 1EYGA 2B2TA 1W6KA 4A3CG 3D3RA 4R4CA 3NEMA 2K05A 1HJPA 2IJ0A 2PW5A 1HZAA 1Y1VG 2AUJD 4UAIA 1U0LA 2JJQA 2AQ3B 4DXFA 1JE5A 1RIPA 1K3BC 1PFNA 3A55A 2VW9A 3HOWH 4DV4Q 5LMNL 4HSVA 1KHIA 3CMEA 2F0EA 4K0KL 2K5QA 4A3JB 3J80L 1I6HB 4A76A 3R8BA 1A62A 1PRTD 1CI3M 1O7IA 5AJ3L 3PSIA 3J7A5 1KXLA 4BBRH 2VQEL 2A6ED 4KN4C 4DNRB 4XIGS 2CHBD 4HCEA 1I94Q 4G7ZC 5ELNA 2XRSD 1YJWA 2AQ1B 1HCZA 1SE3A 1V8QA 2DNCA 3AYHB 3Q23A 2O5IC 4NP5A 4OO1G 2R7ZH 2PI2A 1JWMD 1I5FA 2YTXA 2MUYA 3NTHA 2Q2HA 2A5HA 3GTGH 3R93A 3H3VC 2ZXRA 4ZRZA 4I7ZC 3UDGA 3T51B 3TS2A 1BR9A 1EY6A 4PG3A 3IL8A 2CW0D 2RSOA 3FHWA 4EGVA 2UXCL 2E2JB 5KRUA 2RVLA 4DR4Q 2E2HB 1BBWA 3ULLA 2RKSA 4X3TA 4X65Q 2UXDL 1AN8A 4C3HH 1TWAB 4EQNA 4YWKA 4L8JA 4IPHA 1N9WA 4JI6Q 2ZXPA 3OW7A 4RGNA 4GLAC 4AYBB 2VUMH 1PH7A 2L11A 2NZ1D 1I3QH 1PZKD 3SK8A 2EDGA 3TDQA 2F3VA 4FF2A 1QZGA 2HCIA 1SNCA 1WYDA 4F7XA 4DR1Q 1IBKQ 3K6OA 4A3FH 1V43A 1C8CA 1F9SA 3H15A 2KEDA 2EJFC 2A1AA 3L0OA 1SN8A 2IX3A 1E2ZA 4KY7A 5I4DA 4DK6C 2F0IA 2RCFA 3N52A 1X54A 4ZKBB 1W2BA 5KEEA 5M9OA 1UNSA 1M4VA 1WTHA 2X69A 1ASZA 1Q1EA 4OX9Q 2FJ2A 3W1BA 3W5OA 2QDLA 1EYAA 4TSSA 2PPBC 4DV1L 1LT5D 4YWLA 2JA6H 4HIMA 1VF7A 4NXNL 1QUQA 2F0QA 2N49A 3S1QB 4IUUA 3HKSA 3PO2H 1IW7C 4EVOA 2F0UA 1SNPA 3RD4A 1C4QA 5HY6A 1SNDA 3DMUA 5IYCG 1CK1A 4RGTA 2JEAI 1XJVA 1EIFA 3K57A 4I7AA 1TY0A 3EQLC 2LY7A 2RCNA 1YEZA 5IYBG 3F2DA 5COYA 1FVIA 3OMCA 4X66Q 1STGA 1KLUD 5ELCA 4NDXA 3HOUB 1TS2A 4A3IG 1T9HA 4FP5D 2R92B 1RF2D 2QILA 4JYAL 3TS0A 5C5MA 1Y14B 3NP8A 3C3LA 2CQOA 1KDAA 3FKIH 1FYCA 4MN3A 4DFAA 1N32Q 1C48A 4K5XA 1J5EL 4EQPA 3OHXC 4X6AH 4DV5L 2UUCQ 5IWAL 4ZAIA 1MI2A 4A3CH 3RLNA 1SMXA 4KN7C 1MKHA 4KD4A 1VQOA 2I5HA 2SEBD 4XTCS 4BY7H 4PMWA 1Y1VH 2UU9L 2B29A 3R2TA 3S16B 2WKCA 5JJKA 3KDFA 4GN4B 5CV6A 1LTID 4OIKA 5C3XA 4F87A 1GUNA
chains in the Genus database with same CATH topology
1O7YA 1S5ED 1FD7D 1SAPA 1BF4A 1CTMA 3TP8A 2IX1A 1I6VC 3NTKA 4KKUA 2O4XA 3Q6SA 1RJTA 3HGBA 3GV3A 2K7VA 2VNUD 1GUGA 3BG3A 1CM9A 2N55A 2KCCA 4S3SA 4OO1H 5LL6X 2XVSA 3DM1A 5IIFA 2BOSA 1I50B 1DOMA 3ND8A 5CV9A 3SVMA 1J8IA 1BUVT 2R93B 3WOFA 4HCSA 3S17B 4QB4A 1DJRD 2XWBB 1PTOB 4WJWA 1EEFD 2L0CA 3VR3A 2F03A 3BYTB 3P7JA 1V1OA 1LTTD 2SOBA 2X6LA 3D6CA 1NR4A 1OXSC 4ID6A 4K8IA 1MD2D 4HAEA 4BBRB 3S9WA 2F0NA 3SK5A 2HQEA 4CBVA 3W3AA 1A3TA 1TIID 1HPCA 3N6RA 4A3MB 3NK9A 2R7ZB 3GO5A 4ZLTF 3NBIA 4OIJA 1PTOD 2MPMA 2E2DC 1O7ZA 1SSOA 3H09A 3X3NA 3P75A 5A2QL 3NUCA 5HURA 2AWOA 3D4RA 3BZDB 5KNCA 4KMUC 3UI2A 3OIPA 3A56A 5BN5A 1HRJA 1EZ6A 1B3AA 1SJED 2A68C 1PYWD 2QF7A 1S5BD 3DXJC 4HEDA 2NN6H 1SNQA 3PV0A 2HUGA 5DAUA 3NPPA 2D2CC 1HFGA 1Y8NB 4A3FB 1LT6D 3SK4A 1VMPA 4C3IB 1EY9A 1D5XC 5IGBA 3H91A 4H44C 1R4PB 3TBIB 2M9VA 3M85A 4NMZA 1D6EC 1WVLA 4BA2I 4MHEA 1QG7A 4RHRA 3NWTA 4R8IA 1JWSD 2KA7A 4C3JG 1F2LA 2L12A 3A7AB 2JYOA 2WIIB 1WD0A 1EY4A 3I3CA 2DN8A 5CC4A 4DU9A 4XXEA 1I4PA 1NUCA 1B9NA 2FMCA 1Q90A 1ESRA 3ERQA 3LWEA 3NHHA 3MZ5A 1XWEA 2ENBA 3GD7A 1STEA 2IWHA 4TRDA 1DZ1A 1GUWA 4FXDA 1TWGB 3NQTA 1JOOA 4U673 1F9RA 5G3LD 5T1GA 3I90A 1ZXTA 3X3MA 4R9WA 1JC7A 4IN3A 2M2LA 5EQ0A 3F2UA 1ZYRC 4F8MA 2QEJC 3FKIB 3QWNA 3CRLC 3DEOA 4IURA 5C0XI 4IFDJ 1E0BA 1QWYA 1B9MA 2E76C 1PRTF 5J22A 2FINB 1XX8A 4X3UA 4ODGA 3VYSA 1STYA 1Y1VB 2N88A 2MHVA 5FO9B 4H0LC 1KTKA 1NAPA 2SDFA 4GZYC 1LABA 2NVTB 2E74C 3MHBA 3I72A 1BCPC 4IUPA 1JCKB 3EA6A 1SEBD 1EWCA 3VR2A 1XXGA 2EVBA 4IFDG 1ZKOA 1BQQT 3PUZA 2EYPA 3NWSA 3GTMB 1R9TB 3NQIA 3IFDA 3O13A 4RGOS 5EPJA 3SDZA 3RUZA 1SBBB 1WTRA 4OHJA 3VYUA 4G4KA 3JAME 3C46A 2LKVA 3FDTA 3RLFA 1JOQA 3J7YW 3HEJA 3Q24A 2B39A 3C2PA 1EU4A 1X3QA 4PNYA 2HDMA 3S1RB 2K6AA 4QUCA 3L3OC 5CGKA 4C2MB 1STBA 3BDOA 4X3SA 2BE5C 3ND9A 3VR6A 4ZQ3A 2LS01 2K04A 3BVMA 4ZKCB 3S14B 2K1BA 1ILQA 3E6ZX 2NVQB 3H6MA 3K7AB 3QJYA 5DNFA 2B2YA 1GOZA 5D3IB 4LAAA 1TVXA 3DUZA 5JEAG 5JPNC 1PTOH 1OO9B 4V0BA 4WORA 3U9SA 1H9KA 4QF4A 3TZUA 2CQAA 1E2WA 1KDCA 2KCNA 3KUPA 3OPOA 1WTWA 2F0TA 2YYZA 4E6IA 4RFBA 3TMEA 3EROA 1ENAA 4IUQA 1PXUA 3IKJA 4CJ0B 3BS1A 5IGFA 1TQOA 4HTHA 3HP3A 1D5MC 1LTGD 2Z4HA 4DAPA 1IW7D 4L63B 2H4OA 2PZTA 3GTQB 2NWGA 1UUPA 4LJZC 3U9OA 1LTAD 3J81L 2V4DA 3K5NA 1G291 1DOKA 1BXTA 4BA1I 5I6YA 1VCIA 3WDNA 2ICIA 4IALA 4K2LA 1O7LA 3D4WA 2XRQD 1CQVA 4ZYSA 2E2IB 2EY1A 3WOEA 5ELBA 2SNSA 1TT2A 4G7OC 1HUNA 5JJZA 3VR4A 5M5XB 1LTRD 3J80E 4HR7B 4IFDH 1FNWA 2EJGC 2EZVA 5E1FA 4P2CB 3H94A 2Z4IA 1Y1WB 3TP6A 4CHTB 5FK9C 3BDCA 2JP1A 1SYEA 2I07B 3I73A 1IYVA 1QOHA 2IX0A 3HRZC 2NVXB 1H9MA 2EY5A 4XT3B 4RKBA 1QILA 3PIO3 1ICWA 1JR0D 1MSHA 1RHPA 4KTAA 4WFN3 1SDFA 4ZK9B 3C1FA 1HTLD 3GV6A 4C1NI 2Q8RE 1TWFB 5I6WA 3FPUB 2ICEC 1SXTA 4XDXA 2PMZB 3BVGA 2JEBI 4QCLA 4FYDA 4DAYA 5FLXL 5J1ZA 1LT3D 3C1EA 5JAVA 4K6LA 3HKZB 5CORA 1HUMA 3ITPA 2FMMA 1LLRD 1PTOF 1V1PA 2EYOA 3E0JA 1S5FD 1I4RA 4FF4A 1G91A 1AZQA 3H0GB 3K5MA 3MXPA 4KHVA 4ILWA 3QOJA 2KQ3A 2A74C 1CZGA 4RGMA 4XQNA 1YNJC 3MA2B 2F0LA 4TQUS 2KJXA 5I2YA 3I8ZA 4DGZA 3MFYA 4N9PA 2IT1A 4RWSC 3MVVA 3Q22A 2K28A 3TP5A 1WTOA 4V190 5IGCA 3TSSA 1IYUA 3VA5A 3SK6A 2B2VC 2IPKD 1D1IA 1TWHB 2JA7B 1EYCA 2WV6D 5AFWA 1EYDA 4RA8A 2F0FA 4OO1I 1HXYD 5FKAC 3R2IA 2RDHA 4IZ8A 1KNAA 5IT9L 3OOCA 3OWFA 3VYTA 2B2WC 2A68D 2X6GA 3SEBA 5M3FB 2WKDA 3P20A 5CV5A 2YU9B 1EQVA 2WINB 1F2YA 3IFTA 3LNNA 4C3JB 3J7AF 1S5DD 1RTNA 2C5CA 3AB9A 2K32A 1ML0D 4RCNA 4KY6A 5G3LF 4G57A 3K59A 5C0XG 5IGGA 3T16A 4KHZA 1AZPA 2F3WA 1RODA 3DWPA 3QB3A 2JA5B 3DWQA 4HN7A 4CJ1B 3GTKB 1H9JA 3I91A 1X3PA 1TS4A 1SJHD 1ET6A 3CU7A 2F0JA 4RCOA 5A35A 2D62A 4DK1A 1BCPB 1V1PB 2B2TC 3EFXD 3QO2A 1WCMB 2LMCB 3M7GA 3GTLB 1CHPD 4I65A 2Q8TA 3T4AC 5K36G 2L9HA 2I46A 2OT2A 1SMYC 1W6JA 2EY6A 3S1NB 5CBEE 1ZYRD 2R3ZA 2MJ8A 1H9SA 4X3KA 1Q12A 5ELFA 3MXNA 3RZDB 2ZT9C 3V05A 4CJ2C 2A73B 4R8NA 2PYKA 1TS3A 4IQZA 4M1UB 2NN6I 3QIAA 2NYZD 5FO8B 3PUYA 4J8QA 1CHQD 1TY2A 2K33A 2R61A 4A3DB 4N9TA 2RDGA 3W2DA 4BWGB 3VR5A 3VYRA 1BCPD 4KJNA 4TKOB 2R6GA 3QOLA 1G2SA 4FF1A 2F0KA 1AP0A 1EIGA 4A3KB 1GUOA 1A6XA 1EFID 1A3UA 4PQXA 1PLFA 3DWAA 4RH6A 5IGEA 5A2QE 1LACA 3D6WA 4HMJA 3L9AX 5EBDA 3P1HA 4C56C 1EY7A 4DNTB 5M3MB 3FMCA 2KEEA 4Q0FA 3OIQA 1OXVA 5JPMC 3OMGA 3KBXA 5D65A 1F2MA 1K8OA 1Q3LA 4HSPA 2EYJA 1STNA 1RKNA 2J7ZA 1JWUD 2BE5D 4DAVA 2NB0A 3PUWA 1Y69U 1F2ZA 2PW7A 3KLSX 3GQBA 4O1NA 1IKMA 1PFMA 4KI0A 5C5LA 2D9UA 4K2KA 2XN9C 5KIXA 1DONA 3S15B 2OF1A 3AMUA 4C3HG 1RD9D 3OSOA 1S5CD 2M00A 3D8GA 1XTCD 2F0HA 5EKKA 1L0XB 4J6HA 2O5JC 1H9SB 4PMBA 2B2VA 5E4WC 5EBCA 2JA8B 3PIP3 4Y7NB 1LO5D 4DXGA 2RQXA 4BY1B 1AEXA 3S2DB 1BBXC 1TR5A 3KF8A 1CQFA 2ID0A 3RZOB 1KLGD 2B2WA 2JSOA 1Y8OB 5HGTA 4K8JA 4HMIA 1T5EA 5C3WA 2NBFA 1SE4A 2XSCA 5JEAJ 1LT4D 3QG1A 2L1BA 5IODA 4WRDA 4KK7A 4K5VA 4CKCA 2B63B 2MP1A 3BYYB 4FO2A 1A2TA 1E2VA 1EY0A 4DK0A 1ESFA 5JOBA 3S1MB 1AFPA 1LV9A 5JVG3 3GP7A 1GJXA 1B50A 1IHZA 1G6ZA 1CZWA 1I4QA 3BVZA 3FVQA 5IGDA 5KGUA 1U9RA 2K01A 1G8ZD 1SE2A 1U4PA 3SR1A 3T13A 1DXMA 3AU7A 2HDLA 4F88A 3K58A 4ULLA 2L55A 1T5XD 2A69C 2G9DA 2NTTA 1HA5A 2WAQB 1B53A 1IKLA 5I9PA 4NKLA 3HOVB 4RAUC 5KYIA 1MBYA 3HOYB 3G6JB 4PV1C 2HCCA 1PZID 5EKIA 1JE4A 1FNUA 5M5WB 4ZUIA 4RHSA 1EY8A 1WD1A 4PMCA 4ME5A 4H13C 4A3IB 3VA7A 2IL8A 3NXWA 1QCBD 2F1MA 5DM63 4B08A 4MIUA 1KDBA 5C4XB 4B9XA 4FXGC 3FRPB 2A6HC 4LMQD 1Q1BA 1NCVA 5ELEA 4JBWA 4XT1B 3I4MB 2EXZA 1VMCA 2BA0A 5LHY1 4KKSA 4KKTA 2VXWA 4Z9CB 3Q0AA 3CKIB 1WTVA 3KLRA 1JOKA 4XYQA 4XQQA 4FVMA 3NE5B 5D3DA 3LX0A 3I4NB 1YNNC 4H7BA 2E75C 3A8KE 2OXPA 3GTOB 1B2TA 4BS9A 1GHKA 4IFDI 4KD3A 5ISRA 1YNJD 1M8AA 2EYMA 5E3FA 1TS5A 5KNDA 3PMFA 4K6DA 1B1ZA 1CFMA 2Z1CA 2ZXOA 1EZ8A 3HG9A 2F0VA 3J81E 5EKLA 2EOTA 1HQMC 2F4IA 1SNMA 2EY2A 2XWJB 5KNBA 2RDFA 1F77A 1O78A 3A54A 3MWYW 2K5DA 1HA6A 1UEAB 1STAA 1SFOB 4CKEA 1II3A 4IUVA 2NTSA 5K5PA 2JE6I 1PRTC 2TMPA 2NVYB 5EJWA 1BNZA 1ENCA 1EIHA 2IW3A 2B2UC 3TN2A 2A6EC 2RSNA 2QDBA 3D4DA 1QB5D 1QE6A 1Z6HA 1D2BA 1JQYD 3FPPA 1JORA 1B44D 5CR3A 3V96A 1U4LA 1H9RA 2NUCA 1AW7A 1NR2A 2J0TD 2F0WA 2KOLA 5TSSA 5DM73 3S2HB 2B8FA 2CW0C 3NBHA 3V2TA 4A3GB 2AQ2B 1WTPA 4IUNA 3GTJB 5FOBB 5JEAH 4ABNA 5CBAE 1I4HA 2BA1A 5ELDA 2PCFB 2Z8LA 2NN6G 1K83B 4DN4M 4DF7A 3IAYA 3PUXA 1DM0B 4UDUC 4KY5A 1SNOA 1WTXA 3T56B 1MGSA 3NSWA 1QJOA 5C4HA 1TWCB 3T53B 5F2DA 1VF5C 2EPBA 3MXGA 4Q5VA 4FXKC 5EGTA 2WB1B 3OWEB 1U4MA 1CA5A 2WP8J 2EYHA 2F0OA 3M4YA 5FLXE 1BCPF 1STHA 3A8IE 2KHSA 2WACA 4CKBA 3DEPA 1D1KA 3SE0A 2KVMA 5CV7A 1SMYD 4A3BB 1ET9A 1BOSA 5C0XJ 3A8JE 3CRKC 5BN4A 1F9QA 2GA4B 2KECA 4QUFA 5NUCA 2OEOA 1EOTA 3PO3B 1PFBA 5C4JB 4IUTA 2B8GA 2PNRC 4XQJA 2VB3X 1SYDA 1PZJD 4J1MA 4QIWB 3MAQA 1RCVD 1LTSD 1BDOA 3KBGA 1LTBD 1Q8IA 3A7LA 1QNUA 1QNKA 5T1IA 1I4XA 3TP7A 1FNVA 5CV4A 2VB2X 2LFNA 4EQOA 5J39A 2H1EA 4OL7A 3HOWB 2PQEA 2EE1A 4BBSB 4QMGA 2L4NA 3FEWX 2KUMA 5C6AA 2K5WA 1R4QB 2B2YC 1A3VA 5IT9E 3SXHA 1S4ZA 5M5YB 1XYIA 3RMHA 1A15A 1TKWB 3MEHA 2DY7A 3EVQA 3HS0C 1U4RA 1RTOA 3M7NA 1OXUA 1SYFA 1WTQA 3GTGB 5IOCA 3K5OA 4U68A 1TU2B 1ONLA 4KV6A 3R3OA 1SYCA 4B9WA 1DD2A 4A93B 4C3HB 1Y8PB 1EEID 3KLSA 1GHJA 2AUKA 4FNFA 1B4OA 1X32A 2VUMB 1OXXK 1VDZA 3J7AV 1I3QB 1UAPA 4RKLA 2F0MA 2PZUA 3DHQA 3K5LA 1KNEA 1HQRD 5I9OA 1DYQA 2FFKB 2F0GA 1DOLA 1EWHA 5CV8A 1RDPD 3EJIA 4YIJA 2J4XA 3HZXA 5EPKA 1PDQA 1KABA 2F0SA 5FO7B 3KK7A 5BN3A 1JB3A 1K8MA 1OXTA 1O80A 2JA6B 4K5WA 3E5SA 1PMRA 3D31A 3PO2B 4NW2A 2B2UA 1GXDC 3MTSA 2DNEA 1EU3A 2L5TA 1PTOC 5JVH3 4K14A 3BDLA 2F0DA 1SYBA 4ZUJA 2MGSA 5CMDA 3HOZB 2BCOA 3URYA 3JAML 5CYUA 1F9PA 2Q8IB 1ZEQX 2BDOA 2G9HD 3CHBD 2EYLA 1FGBD 2F0PA 4LK1C 5C0XH 1ENFA 2D5DA 5C3EB 3SHLA 1BO0A 3M3YB 1JICA 3ZYYX 2RBMA 2PO4A 5D14A 3I70A 4BY7B 3MXUA 4JK1C 2RA4A 3I4LA 5C4ZA 4DA2A 3GTPB 2A69D 3TZDA 3MC0B 4CGYB 5EPLA 1A2UA 5DEHA 1HHVA 1NSNS 2SNMA 1J9OA 1MSGA 5KYLA 1Z7TA 4OGQC 1L0YB 4C3IG 4G7HC 2EJMA 5K36H 1I4GA 3ONAB 5E4XA 1D5ZC 3L7ZC 3NTIA 5I2XA 5C44B 2CVRA 1FR3A 1CA6A 1Z47A 2XIWA 2A6HD 2BDNA 4XYOA 4A3EB 4O42A 3MFGA 3M4OB 2EYFA 2TSSA 3PUVA 4M8AA 4C1NK 2FHTA 2QCPX 2AWNA 3LWUA 1CT1D 1GUTA 1SYGA 1IL8A 2QKIC 1YNND 1GUSA 2DY8A 2PZWA 3G7LA 1PRTB 5LL6S 2Y0SB 2K03A 1EQTA 2O2LD 1HFNA 3K0YA 1G2TA 1DCZA 4FF3A 2C9OA 1EL0A 3HOXB 3CQZB 2JXMB 4KJOA 1KAAA 1HTPA 2XNAC 1ILPA 4L6TB 1EY5A 2B2TA 1W6KA 3D3RA 2K05A 2IJ0A 2PW5A 2AUJD 4UAIA 2AQ3B 4DXFA 1PFNA 3A55A 4HSVA 2F0EA 2K5QA 4A3JB 3J80L 1I6HB 3R8BA 1PRTD 1CI3M 2A6ED 4KN4C 4DNRB 4XIGS 2CHBD 4HCEA 4G7ZC 2XRSD 2AQ1B 1HCZA 1SE3A 1V8QA 2DNCA 3Q23A 2O5IC 4NP5A 4OO1G 1JWMD 2MUYA 3NTHA 2A5HA 3R93A 3H3VC 2ZXRA 4ZRZA 4I7ZC 3T51B 1BR9A 1EY6A 3IL8A 2CW0D 2RSOA 4EGVA 2E2JB 5KRUA 2RVLA 2E2HB 2RKSA 4X3TA 1AN8A 1TWAB 4EQNA 4L8JA 2ZXPA 3OW7A 4RGNA 4AYBB 2L11A 2NZ1D 1PZKD 3SK8A 2EDGA 3TDQA 2F3VA 4FF2A 2HCIA 1SNCA 4F7XA 3K6OA 1V43A 1C8CA 1F9SA 2KEDA 2EJFC 2IX3A 1E2ZA 4KY7A 5I4DA 2F0IA 3N52A 4ZKBB 5KEEA 5M9OA 1UNSA 1M4VA 2X69A 1Q1EA 2FJ2A 1EYAA 4TSSA 2PPBC 1LT5D 1VF7A 2F0QA 3S1QB 4IUUA 1IW7C 4EVOA 2F0UA 1SNPA 3RD4A 1C4QA 1SNDA 3DMUA 1CK1A 4RGTA 2JEAI 3K57A 1TY0A 3EQLC 2LY7A 5COYA 3OMCA 1STGA 1KLUD 5ELCA 4NDXA 3HOUB 1TS2A 4FP5D 2R92B 1RF2D 2QILA 5C5MA 3NP8A 3C3LA 1KDAA 1FYCA 4MN3A 4DFAA 1C48A 4K5XA 4EQPA 3OHXC 4ZAIA 1MI2A 4KN7C 4KD4A 2SEBD 4XTCS 4PMWA 3R2TA 3S16B 2WKCA 5CV6A 1LTID 4OIKA 5C3XA 4F87A 1GUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RBM A;  2F3W A;  1KAA A;  1ENC A;  1SYD A;  1EY8 A;  5CGK A;  2EY1 A;  3MXP A;  1STB A;  4J1M A;  4ME5 A;  4PMC A;  3TP8 A;  5C5L A;  1EY5 A;  2QDB A;  3D4D A;  1AEX A;  2SNS A;  4KHV A;  4HMJ A;  5C4Z A;  3QB3 A;  1TT2 A;  2O4X A;  3NXW A;  4ZQ3 A;  1TR5 A;  4KY7 A;  3P75 A;  3P1H A;  3QOJ A;  2KQ3 A;  2F0I A;  1KDB A;  3NUC A;  4MIU A;  4RKL A;  2F0M A;  4B9X A;  5HUR A;  2PZU A;  1EY7 A;  1JOR A;  3DHQ A;  2PW5 A;  5KEE A;  4F8M A;  5M9O A;  2F0L A;  4K8J A;  3TP7 A;  5CR3 A;  5HGT A;  3H6M A;  4HMI A;  5I9O A;  2F0G A;  1EYA A;  1A2U A;  2EXZ A;  2NUC A;  5DEH A;  4DGZ A;  2F0W A;  1NSN S;  5J22 A;  4S3S A;  5C3W A;  1EZ6 A;  2SNM A;  2F0J A;  5E1F A;  5CV4 A;  2F0E A;  5CV8 A;  3OMG A;  4N9P A;  5KYL A;  4ODG A;  3V2T A;  3EJI A;  4YIJ A;  4EQO A;  1STY A;  1F2M A;  4IUN A;  3HZX A;  5IOD A;  1JOK A;  2F0Q A;  3MVV A;  4WRD A;  4LAA A;  5J39 A;  3TP6 A;  1KAB A;  5IIF A;  2F0S A;  4EVO A;  4OL7 A;  3BDC A;  3TP5 A;  1SYE A;  4I65 A;  4K5V A;  2F0U A;  2EYJ A;  1SNQ A;  2PQE A;  1SNP A;  3LX0 A;  4WOR A;  5CV9 A;  1STN A;  1RKN A;  5IGC A;  3MHB A;  3VA5 A;  5DAU A;  1SND A;  3DMU A;  4DF7 A;  4H7B A;  5C3X A;  4QF4 A;  3SK6 A;  3SK4 A;  4QMG A;  1A2T A;  1EY0 A;  2EY5 A;  1KDC A;  2OXP A;  1EY9 A;  4RKB A;  5IGB A;  2EY6 A;  5JOB A;  4K5W A;  3E5S A;  4QB4 A;  4KY5 A;  1SNO A;  5C6A A;  2F0T A;  1F2Z A;  1A3V A;  2PW7 A;  1EYC A;  4E6I A;  4KTA A;  3ERO A;  4NMZ A;  4NP5 A;  2EYP A;  1EYD A;  4KD3 A;  2F0F A;  3TME A;  5C4H A;  5ISR A;  3C1F A;  2EYM A;  5F2D A;  3OMC A;  4IZ8 A;  1ENA A;  3SXH A;  5E3F A;  1STG A;  1IHZ A;  2EYF A;  3PMF A;  4NDX A;  5EGT A;  4K6D A;  3RUZ A;  5IGD A;  4R8N A;  5I6W A;  2PYK A;  2SOB A;  5KGU A;  1U9R A;  1EY6 A;  5IGF A;  1TQO A;  3D6C A;  4HTH A;  1EZ8 A;  4K14 A;  2EYH A;  3BDL A;  2F0D A;  3OWF A;  3MEH A;  2F0O A;  4K2K A;  3SR1 A;  5KIX A;  5KRU A;  1SYB A;  1EY4 A;  3EVQ A;  5C5M A;  3T13 A;  3NP8 A;  2F0V A;  1STH A;  4ZUJ A;  5EKL A;  5CC4 A;  4ID6 A;  4DU9 A;  2RKS A;  1KDA A;  5CV5 A;  4DFA A;  2PZT A;  1SYF A;  2KHS A;  2LKV A;  2WAC A;  4K5X A;  4K8I A;  1SYG A;  4N9T A;  4EQP A;  1NUC A;  2OF1 A;  5J1Z A;  3U9O A;  1JOQ A;  1EQV A;  1F2Y A;  3HEJ A;  5IOC A;  1SNM A;  2EY2 A;  3OSO A;  4KJN A;  4EQN A;  2PZW A;  3S9W A;  5CV7 A;  2RDF A;  3C1E A;  5I6Y A;  3ERQ A;  2M00 A;  4KD4 A;  2F0N A;  3NHH A;  3D8G A;  3SK5 A;  3QOL A;  4NKL A;  5I9P A;  3MZ5 A;  4KV6 A;  5JAV A;  2ENB A;  1STA A;  2HQE A;  3R3O A;  5KYI A;  2F0K A;  2EYL A;  2F0H A;  5EKK A;  3ITP A;  4KY6 A;  1II3 A;  1SYC A;  2F0P A;  1A3T A;  4J6H A;  4PNY A;  4TRD A;  4B9W A;  4F7X A;  1A3U A;  4G57 A;  5NUC A;  2OEO A;  5IGG A;  5K5P A;  4PMB A;  3T16 A;  2EYO A;  3SK8 A;  3NQT A;  1JOO A;  2F3V A;  4IAL A;  3SHL A;  4K2L A;  1SNC A;  5CV6 A;  4ZUI A;  3NK9 A;  3D4W A;  4KJO A;  5IGE A; 
#chains in the Genus database with same CATH topology
 4DUY Q;  1O7Y A;  1S5E D;  1FD7 D;  1N8R C;  1SAP A;  2ZJR A;  1BF4 A;  1CTM A;  4JI2 L;  3TP8 A;  2IX1 A;  2UUA L;  1I6V C;  3NTK A;  4KKU A;  2O4X A;  3Q6S A;  1RJT A;  1JJ2 A;  3HGB A;  4JI7 L;  3GV3 A;  2K7V A;  1Y1W G;  2VNU D;  1GUG A;  3BG3 A;  5DLQ E;  1CM9 A;  2GN5 A;  2N55 A;  4YHH L;  1N33 Q;  1PH5 A;  2KCC A;  4S3S A;  4CDD C;  4OO1 H;  5C44 H;  5LL6 X;  2XVS A;  3DM1 A;  1CKO A;  4B3S Q;  5IIF A;  2L15 A;  2BOS A;  1I50 B;  1DOM A;  4A3E H;  3ND8 A;  5CV9 A;  3SVM A;  4JI1 L;  1J8I A;  1BUV T;  3M4O H;  2R93 B;  2Z0S A;  3WOF A;  3CCQ A;  4HCS A;  3S17 B;  4QB4 A;  1DJR D;  2XWB B;  1PTO B;  4WJW A;  1N36 Q;  2JQO A;  4DUZ Q;  1EEF D;  2L0C A;  1MJE A;  3VR3 A;  4C2M H;  2F03 A;  3BYT B;  4DV4 L;  3P7J A;  4MTK A;  1V1O A;  1LTT D;  2SOB A;  4GNX A;  2X6L A;  1NBW A;  3D6C A;  3K80 C;  1NR4 A;  1QUQ B;  1OXS C;  1WFQ A;  3HKZ G;  4ID6 A;  1CSP A;  4GN5 A;  4K8I A;  2WAQ E;  1MD2 D;  4MTN A;  3HOX H;  1M90 C;  4HAE A;  4BBR B;  3S9W A;  1I94 L;  2HQL A;  2F0N A;  3SK5 A;  4A4I A;  2HQE A;  4CBV A;  3H0G G;  3W3A A;  3JC6 6;  1H95 A;  1A3T A;  1X56 A;  1TII D;  1CKN A;  1HPC A;  2HT1 A;  1K28 A;  3N6R A;  4A3M B;  3NK9 A;  2R7Z B;  3GO5 A;  4ZLT F;  3NBI A;  4OIJ A;  2UUB Q;  1D7Q A;  1PTO D;  1SRO A;  2MPM A;  2Q2I A;  3CC4 A;  2E2D C;  1O7Z A;  4JI3 Q;  1SSO A;  3H09 A;  3K8A A;  3X3N A;  3P75 A;  5A2Q L;  3NUC A;  4EX5 A;  4X65 L;  5HUR A;  4ME3 A;  1E7Z A;  5IYC H;  2AWO A;  3D4R A;  3BZD B;  5KNC A;  4KMU C;  1XMO Q;  3UI2 A;  3OIP A;  3A56 A;  1VQE A;  2OTJ A;  1KRT A;  5BN5 A;  1HRJ A;  1EZ6 A;  5IYB H;  1VQ6 A;  2ZM6 Q;  4OON A;  3L2P A;  4J15 A;  1B3A A;  2K5N A;  1SJE D;  2A68 C;  2Z6K C;  5GQO A;  1L1O C;  1PYW D;  2QF7 A;  1S5B D;  3KDF B;  3DXJ C;  4DR1 L;  1IBK L;  2JA7 G;  4HED A;  4LF5 Q;  2NN6 H;  1SNQ A;  3PV0 A;  4GKK Q;  2HUG A;  1PVO A;  4LF9 Q;  5DAU A;  4LFB Q;  3NPP A;  2D2C C;  1HFG A;  1Y8N B;  4A3F B;  1LT6 D;  3SK4 A;  1VMP A;  4C3I B;  1EY9 A;  1D5X C;  5IGB A;  4L5R C;  3H91 A;  4H44 C;  2E2J H;  1R4P B;  1YJN A;  3TBI B;  2M9V A;  3M85 A;  4NMZ A;  1D6E C;  5IP7 G;  3E3X A;  5M3F G;  1WVL A;  4MHE A;  4OX9 L;  4BA2 I;  1QG7 A;  2E2I H;  4RHR A;  3NWT A;  1E1T A;  1RL2 A;  5IP9 G;  4R8I A;  2XGT A;  1W3S A;  1JWS D;  2KA7 A;  1B7Y B;  4C3J G;  1F2L A;  2L12 A;  3A7A B;  2JYO A;  2WII B;  1WD0 A;  1HNX L;  1EY4 A;  3I3C A;  1IYJ B;  2DN8 A;  4DKA C;  1WOC A;  5CC4 A;  1A8V A;  4DU9 A;  4XXE A;  5EAY A;  2K75 A;  1I4P A;  1NUC A;  4QQB X;  3DM3 A;  1B9N A;  2FMC A;  2MFI A;  1Q90 A;  1ESR A;  1HH2 P;  3ERQ A;  3LWE A;  3CCR A;  1VQN A;  3NHH A;  3MZ5 A;  1XWE A;  2ENB A;  3GD7 A;  4JW0 A;  1STE A;  2IWH A;  1EUJ A;  4TRD A;  1DZ1 A;  1GUW A;  4FXD A;  1VQ8 A;  1TWG B;  3PIO A;  2JA5 G;  3NQT A;  1JOO A;  4X66 L;  4U67 3;  1XPO A;  1F9R A;  2NVX H;  5G3L D;  1JMC A;  5T1G A;  3I90 A;  1VQK A;  1ZXT A;  3X3M A;  4GNX B;  3T1Y Q;  1IBL L;  4R9W A;  1JC7 A;  4IN3 A;  2M2L A;  5EQ0 A;  4HJ5 A;  3F2U A;  4O0A A;  1ZYR C;  1PH1 A;  4F8M A;  1ICF B;  2VY3 A;  3S1Q H;  2QEJ C;  2UUC L;  3FKI B;  3QWN A;  2E5L Q;  3CRL C;  3DEO A;  1TWF H;  4AIM A;  4IUR A;  5C0X I;  4IFD J;  1WCM G;  1E0B A;  1QWY A;  1B9M A;  2E76 C;  1PRT F;  5J22 A;  2FIN B;  4P72 A;  1XX8 A;  4X3U A;  4ODG A;  1GM5 A;  3VYS A;  1STY A;  1Y1V B;  1LTL A;  2N88 A;  2F4V Q;  2MHV A;  1CKN B;  5FO9 B;  4H0L C;  1KTK A;  1NAP A;  4R4Q A;  2CH4 W;  2SDF A;  2IY5 B;  1CUK A;  4GZY C;  4DUY L;  4HIK A;  1LAB A;  4DV6 Q;  2NVT B;  2E74 C;  3MHB A;  3I72 A;  1BCP C;  4IUP A;  1JCK B;  3HOU H;  4L5T A;  3EA6 A;  1SEB D;  1EWC A;  4L5Q A;  3VR2 A;  4JOI C;  1XXG A;  3KLW A;  2EVB A;  4IFD G;  3HFZ B;  1ZKO A;  1BQQ T;  3PUZ A;  2EYP A;  2JK8 A;  3NWS A;  3GTM B;  1R9T B;  1K3R A;  3NQI A;  1VQ9 A;  2WB1 E;  1PH2 A;  3IFD A;  4A3D G;  3O13 A;  3PF4 A;  4RGO S;  1Q46 A;  1N33 L;  1X3E A;  5EPJ A;  1JT8 A;  4B3T Q;  3SDZ A;  3RUZ A;  3RN2 A;  1SBB B;  4OWW B;  1VQ7 A;  4NB3 A;  3A0J A;  1PH3 A;  1X9N A;  1WTR A;  4B3S L;  2G5D A;  4OHJ A;  3VYU A;  4DR3 Q;  4G4K A;  3JAM E;  3C46 A;  4A3K G;  4DV0 L;  2LKV A;  3FDT A;  3RLF A;  4OEL B;  1JOQ A;  3J7Y W;  3JAM c;  3HEJ A;  4A3L H;  3RR5 A;  3Q24 A;  1EWI A;  2B39 A;  3T1H Q;  2QA4 A;  3C2P A;  1EU4 A;  1X3Q A;  4PNY A;  5FJ8 G;  2HDM A;  4RG1 A;  3S1R B;  1PH8 A;  1N36 L;  2KHJ A;  2K6A A;  4GOP C;  4JPB W;  1JB7 A;  1CKM A;  4QUC A;  4QIW E;  3L3O C;  5IYD H;  3U50 C;  5CGK A;  4C2M B;  5M3M G;  4Y52 H;  1STB A;  3BDO A;  3I56 A;  4X3S A;  2BE5 C;  3ND9 A;  3IRB A;  1TWH H;  3VR6 A;  1V1Q A;  4ZQ3 A;  1JJC B;  2LS0 1;  3Q8D A;  1HNZ Q;  2K04 A;  3BVM A;  4ZKC B;  1CSQ A;  3S14 B;  2K1B A;  1YHB A;  1ILQ A;  3E6Z X;  2NVQ B;  3H6M A;  3K7A B;  1I50 H;  1YIJ A;  2HHH Q;  3QJY A;  5DNF A;  2B2Y A;  1K0R A;  1GOZ A;  1HR0 Q;  5D3I B;  4LAA A;  1TVX A;  4B3M Q;  3DUZ A;  1SE8 A;  5JEA G;  5JPN C;  2F3I A;  1PTO H;  2Q2U A;  1OO9 B;  1EIY B;  4V0B A;  4WOR A;  3U9S A;  4DR7 Q;  2UUB L;  4UP8 A;  1H9K A;  2EXD A;  2PNH A;  4QF4 A;  3TZU A;  2CQA A;  1E2W A;  3E9H A;  4DR5 L;  1KDC A;  2KCN A;  3KUP A;  3OPO A;  5L37 A;  1QVG A;  1S40 A;  1C0A A;  1WTW A;  2F0T A;  2FXQ A;  2YYZ A;  4E6I A;  4RFB A;  3TME A;  3ERO A;  1XMO L;  1ENA A;  1QZH A;  4IUQ A;  1PXU A;  3IKJ A;  4ZCK A;  4CJ0 B;  2ZM6 L;  3A5U A;  4YWM A;  1X3G A;  3BS1 A;  1M1K C;  5IGF A;  1TQO A;  4HTH A;  2JA5 H;  3HP3 A;  2QW7 A;  1D5M C;  1LTG D;  3UDI A;  2Z4H A;  4DAP A;  1IW7 D;  4L63 B;  2H4O A;  2NZO A;  2PZT A;  3GTQ B;  2NWG A;  1UUP A;  3GTK H;  3F2B A;  4LJZ C;  3U9O A;  4GKK L;  1LTA D;  3J81 L;  4LF9 L;  5J3B A;  2V4D A;  3K5N A;  4LFB L;  1G29 1;  4A3M H;  1L1O A;  1DOK A;  2JA8 G;  1BXT A;  4BA1 I;  1K8G A;  5I6Y A;  1VCI A;  3WDN A;  3I2Z A;  1L0W A;  4BY1 G;  2ICI A;  3AFQ A;  2MNA A;  3GTL H;  4IAL A;  2I5L X;  3G4S A;  4K2L A;  2R7D A;  3EBE A;  1O7L A;  3D4W A;  2XRQ D;  4DK3 C;  1CQV A;  4ZYS A;  4DR2 Q;  3K7U C;  3TRZ A;  2E2I B;  2EY1 A;  4DV3 Q;  3WOE A;  1LM0 A;  2SNS A;  5ELB A;  4DPG A;  3CMA A;  3S1N H;  1TT2 A;  4G7O C;  3U4Z A;  1HUN A;  2K52 A;  4JCV E;  2ZJQ A;  3RZD H;  5JJZ A;  4TVA B;  3VR4 A;  5M5X B;  1LTR D;  3J80 E;  2B63 G;  4HR7 B;  4IFD H;  1FNW A;  2EJG C;  2EZV A;  3I4O A;  5E1F A;  3J80 c;  4C3I H;  5FLM G;  4P2C B;  3PQI A;  3H94 A;  4A3D H;  2Z4I A;  1Y1W B;  3TP6 A;  3F2C A;  4KHP Q;  4CHT B;  5FK9 C;  3BDC A;  2JP1 A;  1SYE A;  2I07 B;  3I73 A;  1VQF A;  4QY7 A;  1IYV A;  1QOH A;  3CC2 A;  2IX0 A;  3T1Y L;  4GLX A;  3HRZ C;  2NVX B;  5LMU Q;  4JI5 Q;  1H9M A;  2EY5 A;  4XT3 B;  4RKB A;  1QIL A;  3PIO 3;  1HR0 W;  1ICW A;  2RHQ B;  1JR0 D;  1MSH A;  1RHP A;  4KTA A;  4WFN 3;  2E5L L;  1SDF A;  4ZK9 B;  3C1F A;  1HTL D;  3GV6 A;  4C1N I;  1OTC A;  2Q8R E;  1TWF B;  4HIO A;  5I6W A;  2VQF Q;  1AE2 A;  3FPU B;  2ICE C;  3JAM i;  2WAQ G;  1SXT A;  1XTD A;  4XDX A;  3CCL A;  2F4V L;  4DV7 Q;  2PMZ B;  3HOV G;  3BVG A;  2JEB I;  1JJG A;  1YBY A;  3HOY G;  4QCL A;  4FYD A;  1NTG A;  4DAY A;  5M3M H;  4DV6 L;  1TWG H;  5J1Z A;  5FLX L;  1LT3 D;  3C1E A;  5JAV A;  2D0O A;  3CCE A;  1VQA A;  4K6L A;  3HKZ B;  1Q86 C;  5COR A;  1HUM A;  3ITP A;  1E3P A;  1LYL A;  5BR8 Q;  2FMM A;  1LLR D;  1PYS B;  1PTO F;  1V1P A;  2EYO A;  3E0J A;  1S5F D;  2EQS A;  5C4X G;  1I4R A;  3A74 A;  1NMG A;  4FF4 A;  4JV5 Q;  1G91 A;  4PZ6 A;  1AZQ A;  3H0G B;  3CAM A;  3K5M A;  3MXP A;  3I4M G;  1L2F A;  3ULP A;  4KHV A;  3U4V A;  4H02 A;  4ILW A;  4DR3 L;  3QOJ A;  3I7F A;  1X6O A;  2A74 C;  1CZG A;  2KQ3 A;  4RGM A;  4B3R Q;  4XQN A;  1YNJ C;  3MA2 B;  2F0L A;  3CD6 A;  4TQU S;  1L1O B;  1EQR A;  2KJX A;  5I2Y A;  4BXX G;  2NVT H;  3I8Z A;  4DGZ A;  3BZK A;  3MFY A;  3I4N G;  3LGJ A;  3STB C;  4N9P A;  2IT1 A;  1PV4 A;  4RWS C;  2IHE A;  1VQ4 A;  3OW2 A;  3MVV A;  3E0E A;  4N8F A;  4X64 L;  3Q22 A;  3NEN A;  2K28 A;  3H3V H;  3H3V I;  3TP5 A;  1WTO A;  4DR6 Q;  3GTM H;  4V19 0;  1R9T H;  5E7N A;  5IGC A;  5GRO A;  1IYU A;  2CH4 A;  3TSS A;  3VA5 A;  1NNX A;  2HIX A;  3SK6 A;  4JBM A;  3PIP A;  2B2V C;  3ICE A;  4YCU A;  2IPK D;  5GAG C;  1D1I A;  1TWH B;  2JA7 B;  1EYC A;  2WV6 D;  1VQC A;  2E8G A;  5AFW A;  1EYD A;  4RA8 A;  1B70 B;  2F0F A;  2A19 A;  1HXY D;  3S24 A;  4IJL A;  4Y7N H;  4OO1 I;  5FKA C;  3R2I A;  2RDH A;  4IZ8 A;  1KNA A;  5IT9 L;  4LWC A;  3OOC A;  4BY1 H;  2HHH L;  4LF6 Q;  3S2D H;  2K50 A;  3OWF A;  3VYT A;  1UE5 A;  5IE8 A;  4LNQ A;  1K9M C;  2B2W C;  2A68 D;  2X6G A;  3SEB A;  4B3M L;  5M3F B;  2WKD A;  3P20 A;  5CV5 A;  3S1R H;  2I0Q A;  1KIX A;  2YU9 B;  1EQV A;  2WIN B;  1F2Y A;  1FJG Q;  3LNN A;  3IFT A;  4C3J B;  2VS1 A;  2Y0S E;  3J7A F;  1RTN A;  1S5D D;  2C5C A;  3AB9 A;  2K32 A;  1GVP A;  4P74 A;  1ML0 D;  4RCN A;  4KY6 A;  5G3L F;  4OEM B;  4UY8 C;  4G57 A;  3K59 A;  5C0X G;  2KCM A;  5IGG A;  3T16 A;  4KHZ A;  4EQ5 A;  4LF7 Q;  3AEV A;  3S14 H;  1NMF A;  1AZP A;  1A63 A;  2F3W A;  5FLM H;  2NVQ H;  1Z9F A;  3K7A H;  3AFP A;  4JI0 Q;  1ROD A;  3DWP A;  4IOC A;  3S1M H;  2AKW B;  4RMF A;  3QB3 A;  1PH4 A;  2JA5 B;  3DWQ A;  3RN5 A;  4DAY B;  4A3G G;  1VS0 A;  4HN7 A;  2KHI A;  2Z9H A;  3J80 i;  4CJ1 B;  3GTK B;  1H9J A;  4LF4 Q;  1UE7 A;  1S3O A;  1VQM A;  3CW2 C;  3I91 A;  1X3P A;  1TS4 A;  1SJH D;  1ET6 A;  3CU7 A;  2F0J A;  4RCO A;  5A35 A;  2D62 A;  4DK1 A;  3CPW A;  1BCP B;  1V1P B;  2B2T C;  3EFX D;  4DR4 L;  3QO2 A;  1WCM B;  2LMC B;  3M4Q A;  3M7G A;  1CHP D;  3GTL B;  4I65 A;  2Q8T A;  3T4A C;  4DR2 L;  5K36 G;  2L9H A;  2I46 A;  1PH9 A;  2OT2 A;  3HOV H;  2R7F A;  1SMY C;  2CKZ B;  4POG A;  1J6Q A;  1W6J A;  2WB1 G;  5HGQ A;  2EY6 A;  4JI6 L;  1D8L A;  1Q81 C;  3S1N B;  4JI8 Q;  5CBE E;  1ZYR D;  2R3Z A;  5JJL A;  2MJ8 A;  4R4O A;  1H9S A;  4X3K A;  5M5W H;  1VQI A;  1Q12 A;  5ELF A;  3MXN A;  3RZD B;  3GTQ H;  2ZT9 C;  3V05 A;  3RNU A;  4CJ2 C;  5LMN Q;  2A73 B;  4A3I H;  3UDX A;  4R8N A;  2PYK A;  1TS3 A;  4IQZ A;  4M1U B;  2NN6 I;  4JBJ A;  5GAE C;  4A3B G;  3QIA A;  5AJ3 Q;  4KHP L;  2NYZ D;  5FO8 B;  3PUY A;  4J8Q A;  1CHQ D;  1TY2 A;  2K33 A;  2R61 A;  2VQE Q;  4A3D B;  1FGU A;  4N9T A;  3I4M H;  2RDG A;  3W2D A;  4BWG B;  3PO3 G;  3VR5 A;  3VYR A;  1BCP D;  4KJN A;  3NEL A;  4JI5 L;  2OCE A;  1U5K A;  4TKO B;  2R6G A;  4KLK A;  4AYB E;  3QOL A;  4UP7 A;  1G2S A;  4FF1 A;  2F0K A;  3WWV A;  1AP0 A;  1EIG A;  4A3K B;  1GUO A;  1A6X A;  1EFI D;  1A3U A;  4PQX A;  1PLF A;  3DWA A;  4RH6 A;  4L5S A;  2ASB A;  4HJ9 A;  3I4N H;  4WJ3 M;  1KAW A;  4IPD A;  5IGE A;  2VQF L;  3VDY A;  2YV5 A;  5A2Q E;  3GTO H;  5M5X H;  1LAC A;  1SRU A;  4DV2 Q;  3D6W A;  4HMJ A;  3L9A X;  4JI4 Q;  5EBD A;  3P1H A;  1AE3 A;  2HIV A;  4C56 C;  1EY7 A;  2BH8 A;  4LUO A;  1Y1W H;  4DNT B;  5M3M B;  3FMC A;  2KEE A;  1E1O A;  4Q0F A;  3OIQ A;  3HOW G;  1GO3 E;  1KRS A;  4BBS G;  1OXV A;  5JPM C;  3OMG A;  5BR8 L;  3KBX A;  2MO1 A;  5D65 A;  1F2M A;  1K8O A;  1Q3L A;  4HSP A;  2B3G A;  3BZC A;  2V1C C;  4AQY Q;  4JV5 L;  1N32 L;  2EYJ A;  4PZ7 A;  1STN A;  1RKN A;  2J7Z A;  1JWU D;  2BE5 D;  3EIV A;  1E24 A;  3OYY A;  4DAV A;  2NB0 A;  4B3R L;  3PUW A;  1Y69 U;  1F2Z A;  2PW7 A;  2NVY H;  2JN4 A;  3KLS X;  3I55 A;  3GQB A;  2BH2 A;  1YVC A;  4O1N A;  3TEH B;  1IKM A;  4LFC Q;  1PFM A;  4KI0 A;  4NPS A;  5C5L A;  4AH6 A;  2D9U A;  4K2K A;  2CCZ A;  2XN9 C;  5KIX A;  1DON A;  1GD7 A;  3S15 B;  2OF1 A;  3AMU A;  4A93 G;  4C3H G;  1RD9 D;  3OSO A;  5LMN W;  1S5C D;  1UEB A;  2OQK A;  2M00 A;  1Q8K A;  4YY3 Q;  3D8G A;  3H0G H;  1XTC D;  2N8N A;  2CWA A;  2QGQ A;  2F0H A;  5EKK A;  1L0X B;  2JA9 A;  2PI2 E;  4J6H A;  2O5J C;  1HNW Q;  2VUM G;  1H9S B;  4IO9 A;  4PMB A;  2B2V A;  3MXN B;  5E4W C;  4A75 A;  2LXJ A;  5EBC A;  2JA8 B;  1QVC A;  1BKB A;  1K83 H;  5GAH C;  3PIP 3;  4Y7N B;  1PFS A;  4LF6 L;  1LO5 D;  4A3F G;  4DXG A;  4ALP A;  1IBM Q;  2RQX A;  4BY1 B;  1AEX A;  3S2D B;  1BBX C;  1IL2 A;  4R4T A;  1TR5 A;  4APV A;  1TWC H;  3KF8 A;  1CQF A;  2ID0 A;  3RZO B;  1KLG D;  5IWA Q;  2B2W A;  2JSO A;  1Y8O B;  4K8J A;  5HGT A;  4HMI A;  2VL6 A;  4DUZ L;  1XNR Q;  4GN3 B;  4JC0 A;  1X55 A;  3GDE A;  2UU9 Q;  1T5E A;  5C3W A;  2NBF A;  1SE4 A;  1UE1 A;  2XSC A;  1X65 A;  5JEA J;  3ULJ A;  2JA6 G;  1LT4 D;  3M4P A;  2L1B A;  3QG1 A;  5IOD A;  4WRD A;  4LF7 L;  4HJ7 A;  2JA7 H;  3PO2 G;  4KK7 A;  4K5V A;  4CKC A;  2B63 B;  4A3B H;  4LUZ A;  2ZJP A;  2MP1 A;  4JI0 L;  3M9B A;  3BYY B;  4FO2 A;  1A2T A;  1E2V A;  1EY0 A;  4DK0 A;  1ESF A;  5JOB A;  3S1M B;  3PO3 H;  3ER0 A;  1AFP A;  3TQY A;  5IP7 H;  5M3F H;  1LV9 A;  4UPA A;  3CCJ A;  5JVG 3;  4LF4 L;  3GP7 A;  1GJX A;  3AQQ A;  2YU9 H;  1B50 A;  3HOZ G;  3ERS X;  1IHZ A;  1G6Z A;  1MIU A;  5IP9 H;  1CZW A;  1I4Q A;  2K5V A;  3BVZ A;  3CC7 A;  4C3J H;  3FVQ A;  5IGD A;  5KGU A;  1U9R A;  4PZ8 A;  2K01 A;  1G8Z D;  1SE2 A;  1U4P A;  3SR1 A;  2UXB Q;  3T13 A;  1DXM A;  3AU7 A;  2HDL A;  4F88 A;  3K58 A;  4ULL A;  4JI3 L;  2L55 A;  1T5X D;  2YTY A;  4JBK A;  1K0S A;  3UDF A;  3CCV A;  2A69 C;  2G9D A;  2NTT A;  5C3E G;  4R4I A;  2OQ0 A;  1HA5 A;  3CPF A;  2WAQ B;  1B53 A;  3TRE A;  1IKL A;  5I9P A;  4NKL A;  3HOV B;  4RAU C;  5KYI A;  4BY7 G;  1MBY A;  4JI8 L;  3HOY B;  4GNX C;  3G6J B;  4PV1 C;  2DJF C;  2HCC A;  1N34 Q;  1PZI D;  5EKI A;  1JE4 A;  1FNU A;  5M5W B;  4ZUI A;  4BBS H;  4DNI A;  4RHS A;  4LF5 L;  1EY8 A;  1KC8 C;  1WD1 A;  4PMC A;  4ME5 A;  4H13 C;  4A3I B;  3VA7 A;  2Z6K A;  2IL8 A;  3NXW A;  1QCB D;  2F1M A;  4GKJ Q;  5DM6 3;  4B08 A;  4MIU A;  1KDB A;  1C7Y A;  5C4X B;  4B9X A;  1B8A A;  4FXG C;  3FRP B;  3EN2 A;  5ELO A;  2A6H C;  4LMQ D;  4R1J A;  1Q1B A;  1NCV A;  5M5Y H;  5ELE A;  4JBW A;  4XT1 B;  1WCM H;  3I4M B;  2EXZ A;  3UE1 A;  1VMC A;  2BA0 A;  2N78 A;  5LHY 1;  4KKS A;  4KKT A;  2VXW A;  4Z9C B;  4OWT B;  3Q0A A;  4OWX B;  5C44 G;  3CKI B;  1WTV A;  3KLR A;  4P75 A;  1JOK A;  4XYQ A;  4XQQ A;  1XNQ Q;  4FVM A;  4N8X 1;  1BBU A;  1S72 A;  3NE5 B;  2Q2T A;  5D3D A;  3LX0 A;  4A3E G;  3I4N B;  3ZJY C;  3KYH C;  1YNN C;  4H7B A;  4DV2 L;  2E75 C;  1VQB A;  1DGS A;  3W1G A;  3A8K E;  4JI4 L;  2OXP A;  3GTO B;  1B2T A;  2RHS B;  3CCU A;  4A93 H;  2WFW A;  4BS9 A;  1GHK A;  3KF8 B;  1QVF A;  4IFD I;  4KD3 A;  5ISR A;  1YNJ D;  1M8A A;  2EYM A;  4NXM Q;  5E3F A;  1TS5 A;  2GVB A;  3A5Z B;  1P8L A;  5KND A;  3PMF A;  2ES2 A;  4K6D A;  1B1Z A;  1CFM A;  2Z1C A;  3STB D;  2ZXO A;  1EZ8 A;  1VQJ A;  3HG9 A;  2I5M X;  1UE6 A;  1ASY A;  2F0V A;  2Y0S G;  3J81 E;  5EKL A;  4A3K H;  2EOT A;  1HQM C;  4AQY L;  3J81 c;  2F4I A;  1V9P A;  1SNM A;  2EY2 A;  2IHF A;  2XWJ B;  3HOX G;  5KNB A;  2RDF A;  1F77 A;  1O78 A;  3A54 A;  3MWY W;  2K5D A;  3D0F A;  1HA6 A;  1UEA B;  1STA A;  1SFO B;  5IY0 A;  5FJ8 H;  4CKE A;  1II3 A;  4IUV A;  2NTS A;  5K5P A;  3B6Y A;  2JE6 I;  1PRT C;  2NZH A;  2TMP A;  3K81 C;  3E9I A;  2NVY B;  4LFC L;  2KCT A;  5EJW A;  1BNZ A;  1ENC A;  1EIH A;  2IW3 A;  2DUD A;  2B2U C;  3TN2 A;  2A6E C;  1YHQ A;  2RSN A;  1HNX Q;  4X62 Q;  2QDB A;  3D4D A;  1QB5 D;  1QE6 A;  1Z6H A;  1D2B A;  1WJJ A;  1NE3 A;  4YCW A;  1JQY D;  3PGZ A;  3FPP A;  1JOR A;  4A3J G;  1KL9 A;  1B44 D;  4LF8 Q;  2GVA A;  2K14 A;  3F1Z A;  2LXK A;  5CR3 A;  3V96 A;  1U4L A;  1H9R A;  2NUC A;  1VQD A;  4YY3 L;  1AW7 A;  1NR2 A;  2J0T D;  2F0W A;  4JOI A;  2KOL A;  5TSS A;  5DM7 3;  4B3T L;  1HZ9 A;  3S2H B;  2B8F A;  4P73 A;  1HNW L;  2CW0 C;  3NBH A;  2Z6B A;  3V2T A;  4A3G B;  2AQ2 B;  1WTP A;  4IUN A;  3HOZ H;  3GTJ B;  5FOB B;  5JEA H;  4ABN A;  5CBA E;  1EFW A;  1I4H A;  2BA1 A;  5ELD A;  5JJI A;  2PCF B;  2Z8L A;  3MEF A;  2NN6 G;  1IBL Q;  3OTO Q;  1K83 B;  1IBM L;  4DN4 M;  4DF7 A;  3IAY A;  3PUX A;  4MNO A;  1DM0 B;  4UDU C;  1B3Q A;  3UE0 A;  3KJP A;  1WI5 A;  4KY5 A;  1SNO A;  1WTX A;  3T56 B;  2C35 B;  5C3E H;  1YZ6 A;  1MGS A;  3NSW A;  3T1H L;  1YIT A;  1QJO A;  3QR8 A;  5C4H A;  1TWC B;  3M3Y H;  3T53 B;  1XNR L;  2LSS A;  2YTV A;  5F2D A;  5GAD C;  3S15 H;  1VF5 C;  1NY4 A;  2DGY A;  2EPB A;  1AH9 A;  3MXG A;  4YCV A;  4Q5V A;  4FXK C;  5EGT A;  2WB1 B;  3OWE B;  3KJO A;  1A0I A;  1U4M A;  3KF6 A;  1LUZ A;  1CA5 A;  2WP8 J;  2DJG C;  2EYH A;  2F0O A;  4GOP A;  4CDE C;  3GTP H;  3M4Y A;  5FLX E;  1BCP F;  1STH A;  1P16 A;  4QL5 A;  3A8I E;  4AYB G;  2KHS A;  2WAC A;  1HNZ L;  5FLX c;  4QGU A;  4CKB A;  2JA8 H;  3DEP A;  1D1K A;  3SE0 A;  2KVM A;  5CV7 A;  1SMY D;  4A3B B;  1ET9 A;  1BOS A;  3CXC A;  5C0X J;  1VQP A;  3A8J E;  3CRK C;  5BN4 A;  1F9Q A;  2GA4 B;  2KEC A;  4QUF A;  5NUC A;  2OTL A;  2OEO A;  1EOT A;  3PO3 B;  1Q82 C;  1HR0 L;  1PFB A;  5C4J B;  4IUT A;  1XMQ Q;  3RZO H;  2B8G A;  2PNR C;  4XQJ A;  4MZ9 A;  2VB3 X;  1SYD A;  1PZJ D;  4J1M A;  4DR7 L;  4QIW B;  3MAQ A;  2UXB L;  1RCV D;  1LTS D;  1BDO A;  3KBG A;  4DV0 Q;  4CDF C;  1LTB D;  1Q8I A;  4LFA Q;  3A7L A;  1QNU A;  1QNK A;  1Q7Y C;  5T1I A;  1KD1 C;  1I4X A;  4OXP A;  3TP7 A;  4POF A;  2B63 H;  1IZ6 A;  1FNV A;  2F52 A;  4LUV A;  5CV4 A;  2VB2 X;  2LFN A;  4EQO A;  1N34 L;  1UWV A;  5J39 A;  2AMC B;  2H1E A;  2XTI A;  4OL7 A;  3PCO B;  2D0P A;  3HOW B;  2PQE A;  4CDC C;  1HZC A;  2EE1 A;  4BBS B;  3DLL A;  5H1S E;  4QMG A;  2L4N A;  3HOU G;  4GKJ L;  3FEW X;  2KUM A;  1TXY A;  2R92 G;  5C6A A;  2K5W A;  1R4Q B;  2B2Y C;  1A3V A;  3U58 A;  5IT9 E;  3CQZ H;  1MJC A;  4HJ8 A;  3SGI A;  3KOJ A;  3CP0 A;  3SXH A;  1MHW C;  5IT9 c;  1S4Z A;  5M5Y B;  1XYI A;  3RMH A;  1K8A C;  2PQA A;  1A15 A;  1TKW B;  1G51 A;  3J81 i;  3NBH B;  1GKH A;  3MEH A;  4DV3 L;  2DY7 A;  1XNQ L;  3EVQ A;  3HS0 C;  1U4R A;  1RTO A;  3J81 j;  3HOY H;  3M7N A;  1OXU A;  1SYF A;  1WTQ A;  3GTG B;  5IOC A;  3K5O A;  4U68 A;  1SR3 A;  4A3L G;  4DR5 Q;  1TU2 B;  1ONL A;  4A3J H;  4KV6 A;  3R3O A;  1I6H H;  3G71 A;  1SYC A;  4K0K Q;  4B9W A;  1DD2 A;  4HJA A;  1VQ5 A;  4A93 B;  5C4X H;  4C3H B;  4NXM L;  1Y8P B;  1EEI D;  3KLS A;  1EOV A;  1GHJ A;  2AUK A;  4FNF A;  5IYD G;  3KF6 B;  1B4O A;  1X32 A;  1NJI C;  4GOP B;  2VUM B;  1OXX K;  1VDZ A;  5LMU L;  1KQS A;  3J7A V;  1IXR A;  1I3Q B;  1UAP A;  4QJF A;  4RKL A;  2F0M A;  2PZU A;  3DHQ A;  1XPR A;  3K5L A;  2N3S A;  1KNE A;  1HQR D;  2KEN A;  5I9O A;  1DYQ A;  2FFK B;  2ZTD A;  3CF5 A;  4BXX H;  2F0G A;  1DOL A;  1EWH A;  2E2H H;  2R93 G;  5CV8 A;  1RDP D;  3EJI A;  4YIJ A;  2UXC Q;  2J4X A;  2ZTC A;  3HZX A;  5EPK A;  1PDQ A;  1KAB A;  4DV7 L;  2F0S A;  3BU2 A;  5FO7 B;  3KK7 A;  2EIF A;  2P5Z X;  1TWA H;  2UXD Q;  5BN3 A;  1JB3 A;  1K8M A;  1OXT A;  4X62 L;  1O80 A;  2JA6 B;  2KBN A;  4HID A;  1PYB A;  4K5W A;  3E5S A;  1PMR A;  3D31 A;  3PO2 B;  4IOA A;  4NW2 A;  2B2U A;  1XPU A;  1GXD C;  4LF8 L;  3MTS A;  2DNE A;  1EU3 A;  2L5T A;  4JVZ A;  2K4K A;  2MO0 A;  2PMZ E;  1PTO C;  4BBR G;  5JVH 3;  4K14 A;  3BDL A;  2F0D A;  1EQQ A;  1VQL A;  1SYB A;  1SFO H;  4ZUJ A;  2MGS A;  2A8V A;  3BJU A;  5CMD A;  3HOZ B;  1YHA A;  4IJH A;  2BCO A;  3URY A;  3OTO L;  3JAM L;  4IPG A;  3HKZ E;  5CYU A;  4A3M G;  1F9P A;  2R7Z G;  2Q8I B;  1ZEQ X;  2BDO A;  2G9H D;  3CHB D;  4DV1 Q;  2EYL A;  1BVS A;  1FGB D;  2F0P A;  2ALY B;  4LK1 C;  5C0X H;  1ENF A;  4NXN Q;  2D5D A;  5C3E B;  3SHL A;  1BO0 A;  3M3Y B;  2PQA B;  1JIC A;  3ZYY X;  2RBM A;  2PO4 A;  4DR6 L;  5D14 A;  3I70 A;  1YI2 A;  4BY7 B;  2H5X A;  3MXU A;  4JK1 C;  2RA4 A;  4DAM A;  1E22 A;  3I4L A;  5C4Z A;  4DA2 A;  2ATW A;  4IPC A;  3S2H H;  4A3G H;  3GTP B;  4UHV A;  2A69 D;  3GTJ H;  3TZD A;  1PHJ A;  2CWP A;  3MC0 B;  4CGY B;  1C9O A;  5EPL A;  1X3F A;  1A2U A;  1VQG A;  2R92 H;  5DEH A;  2AHO B;  1HHV A;  1NSN S;  1SLJ A;  2SNM A;  1J9O A;  1MSG A;  4FDB A;  5KYL A;  1Z7T A;  1YJ9 A;  4OGQ C;  1L0Y B;  4C3I G;  3KFU A;  4JYA Q;  4G7H C;  1XMQ L;  2EJM A;  4LW1 A;  4GLV B;  5K36 H;  1I4G A;  3ONA B;  5E4X A;  1FL0 A;  3K0X A;  1PH6 A;  1J5E Q;  1D5Z C;  3L7Z C;  3NTI A;  4DV5 Q;  3PF5 A;  1HZB A;  1FJG L;  5I2X A;  5C44 B;  3CCS A;  3S16 H;  3F8T A;  2CVR A;  1FR3 A;  3FP9 A;  1CA6 A;  1Z47 A;  3CCM A;  2XIW A;  4LFA L;  2A6H D;  2BDN A;  2K5H A;  4XYO A;  4A3E B;  3G6E A;  4O42 A;  2OWO A;  3G48 A;  3MFG A;  3M4O B;  2EYF A;  2TSS A;  1G6P A;  2MQH A;  1YNX A;  2HD3 A;  3PUV A;  4M8A A;  4C1N K;  2FHT A;  4P71 A;  4JI2 Q;  2QCP X;  2AWN A;  3J7Z C;  4X64 Q;  3LWU A;  1CT1 D;  2UUA Q;  4GS3 A;  1GUT A;  1VQH A;  4JI7 Q;  1SYG A;  2CFM A;  4JG2 A;  5C4J H;  1IL8 A;  2QKI C;  1YNN D;  1GUS A;  2DY8 A;  2PZW A;  3G7L A;  4WJ4 A;  1PRT B;  4YHH Q;  5LL6 S;  2Y0S B;  2K03 A;  1EQT A;  2O2L D;  1HFN A;  3K0Y A;  4UP9 A;  1G2T A;  1DCZ A;  4FF3 A;  1K73 C;  2C9O A;  1EL0 A;  3HOX B;  3CQZ B;  1PA6 A;  2ZTE A;  2R93 H;  2JXM B;  2QEX A;  4KJO A;  1KAA A;  3FKI G;  2RF4 A;  4JI1 Q;  1HTP A;  2XNA C;  3S17 H;  1ILP A;  4L6T B;  2VZA A;  3RLO A;  1EY5 A;  4O2D A;  1EYG A;  2B2T A;  1W6K A;  4A3C G;  3D3R A;  4R4C A;  3NEM A;  2K05 A;  1HJP A;  2IJ0 A;  2PW5 A;  1HZA A;  1Y1V G;  2AUJ D;  4UAI A;  1U0L A;  2JJQ A;  2AQ3 B;  4DXF A;  1JE5 A;  1RIP A;  1K3B C;  1PFN A;  3A55 A;  2VW9 A;  3HOW H;  4DV4 Q;  5LMN L;  4HSV A;  1KHI A;  3CME A;  2F0E A;  4K0K L;  2K5Q A;  4A3J B;  3J80 L;  1I6H B;  4A76 A;  3R8B A;  1A62 A;  1PRT D;  1CI3 M;  1O7I A;  5AJ3 L;  3PSI A;  3J7A 5;  1KXL A;  4BBR H;  2VQE L;  2A6E D;  4KN4 C;  4DNR B;  4XIG S;  2CHB D;  4HCE A;  1I94 Q;  4G7Z C;  5ELN A;  2XRS D;  1YJW A;  2AQ1 B;  1HCZ A;  1SE3 A;  1V8Q A;  2DNC A;  3AYH B;  3Q23 A;  2O5I C;  4NP5 A;  4OO1 G;  2R7Z H;  2PI2 A;  1JWM D;  1I5F A;  2YTX A;  2MUY A;  3NTH A;  2Q2H A;  2A5H A;  3GTG H;  3R93 A;  3H3V C;  2ZXR A;  4ZRZ A;  4I7Z C;  3UDG A;  3T51 B;  3TS2 A;  1BR9 A;  1EY6 A;  4PG3 A;  3IL8 A;  2CW0 D;  2RSO A;  3FHW A;  4EGV A;  2UXC L;  2E2J B;  5KRU A;  2RVL A;  4DR4 Q;  2E2H B;  1BBW A;  3ULL A;  2RKS A;  4X3T A;  4X65 Q;  2UXD L;  1AN8 A;  4C3H H;  1TWA B;  4EQN A;  4YWK A;  4L8J A;  4IPH A;  1N9W A;  4JI6 Q;  2ZXP A;  3OW7 A;  4RGN A;  4GLA C;  4AYB B;  2VUM H;  1PH7 A;  2L11 A;  2NZ1 D;  1I3Q H;  1PZK D;  3SK8 A;  2EDG A;  3TDQ A;  2F3V A;  4FF2 A;  1QZG A;  2HCI A;  1SNC A;  1WYD A;  4F7X A;  4DR1 Q;  1IBK Q;  3K6O A;  4A3F H;  1V43 A;  1C8C A;  1F9S A;  3H15 A;  2KED A;  2EJF C;  2A1A A;  3L0O A;  1SN8 A;  2IX3 A;  1E2Z A;  4KY7 A;  5I4D A;  4DK6 C;  2F0I A;  2RCF A;  3N52 A;  1X54 A;  4ZKB B;  1W2B A;  5KEE A;  5M9O A;  1UNS A;  1M4V A;  1WTH A;  2X69 A;  1ASZ A;  1Q1E A;  4OX9 Q;  2FJ2 A;  3W1B A;  3W5O A;  2QDL A;  1EYA A;  4TSS A;  2PPB C;  4DV1 L;  1LT5 D;  4YWL A;  2JA6 H;  4HIM A;  1VF7 A;  4NXN L;  1QUQ A;  2F0Q A;  2N49 A;  3S1Q B;  4IUU A;  3HKS A;  3PO2 H;  1IW7 C;  4EVO A;  2F0U A;  1SNP A;  3RD4 A;  1C4Q A;  5HY6 A;  1SND A;  3DMU A;  5IYC G;  1CK1 A;  4RGT A;  2JEA I;  1XJV A;  1EIF A;  3K57 A;  4I7A A;  1TY0 A;  3EQL C;  2LY7 A;  2RCN A;  1YEZ A;  5IYB G;  3F2D A;  5COY A;  1FVI A;  3OMC A;  4X66 Q;  1STG A;  1KLU D;  5ELC A;  4NDX A;  3HOU B;  1TS2 A;  4A3I G;  1T9H A;  4FP5 D;  2R92 B;  1RF2 D;  2QIL A;  4JYA L;  3TS0 A;  5C5M A;  1Y14 B;  3NP8 A;  3C3L A;  2CQO A;  1KDA A;  3FKI H;  1FYC A;  4MN3 A;  4DFA A;  1N32 Q;  1C48 A;  4K5X A;  1J5E L;  4EQP A;  3OHX C;  4X6A H;  4DV5 L;  2UUC Q;  5IWA L;  4ZAI A;  1MI2 A;  4A3C H;  3RLN A;  1SMX A;  4KN7 C;  1MKH A;  4KD4 A;  1VQO A;  2I5H A;  2SEB D;  4XTC S;  4BY7 H;  4PMW A;  1Y1V H;  2UU9 L;  2B29 A;  3R2T A;  3S16 B;  2WKC A;  5JJK A;  3KDF A;  4GN4 B;  5CV6 A;  1LTI D;  4OIK A;  5C3X A;  4F87 A;  1GUN A; 
#chains in the Genus database with same CATH homology
 1O7Y A;  1S5E D;  1FD7 D;  1SAP A;  1BF4 A;  1CTM A;  3TP8 A;  2IX1 A;  1I6V C;  3NTK A;  4KKU A;  2O4X A;  3Q6S A;  1RJT A;  3HGB A;  3GV3 A;  2K7V A;  2VNU D;  1GUG A;  3BG3 A;  1CM9 A;  2N55 A;  2KCC A;  4S3S A;  4OO1 H;  5LL6 X;  2XVS A;  3DM1 A;  5IIF A;  2BOS A;  1I50 B;  1DOM A;  3ND8 A;  5CV9 A;  3SVM A;  1J8I A;  1BUV T;  2R93 B;  3WOF A;  4HCS A;  3S17 B;  4QB4 A;  1DJR D;  2XWB B;  1PTO B;  4WJW A;  1EEF D;  2L0C A;  3VR3 A;  2F03 A;  3BYT B;  3P7J A;  1V1O A;  1LTT D;  2SOB A;  2X6L A;  3D6C A;  1NR4 A;  1OXS C;  4ID6 A;  4K8I A;  1MD2 D;  4HAE A;  4BBR B;  3S9W A;  2F0N A;  3SK5 A;  2HQE A;  4CBV A;  3W3A A;  1A3T A;  1TII D;  1HPC A;  3N6R A;  4A3M B;  3NK9 A;  2R7Z B;  3GO5 A;  4ZLT F;  3NBI A;  4OIJ A;  1PTO D;  2MPM A;  2E2D C;  1O7Z A;  1SSO A;  3H09 A;  3X3N A;  3P75 A;  5A2Q L;  3NUC A;  5HUR A;  2AWO A;  3D4R A;  3BZD B;  5KNC A;  4KMU C;  3UI2 A;  3OIP A;  3A56 A;  5BN5 A;  1HRJ A;  1EZ6 A;  1B3A A;  1SJE D;  2A68 C;  1PYW D;  2QF7 A;  1S5B D;  3DXJ C;  4HED A;  2NN6 H;  1SNQ A;  3PV0 A;  2HUG A;  5DAU A;  3NPP A;  2D2C C;  1HFG A;  1Y8N B;  4A3F B;  1LT6 D;  3SK4 A;  1VMP A;  4C3I B;  1EY9 A;  1D5X C;  5IGB A;  3H91 A;  4H44 C;  1R4P B;  3TBI B;  2M9V A;  3M85 A;  4NMZ A;  1D6E C;  1WVL A;  4BA2 I;  4MHE A;  1QG7 A;  4RHR A;  3NWT A;  4R8I A;  1JWS D;  2KA7 A;  4C3J G;  1F2L A;  2L12 A;  3A7A B;  2JYO A;  2WII B;  1WD0 A;  1EY4 A;  3I3C A;  2DN8 A;  5CC4 A;  4DU9 A;  4XXE A;  1I4P A;  1NUC A;  1B9N A;  2FMC A;  1Q90 A;  1ESR A;  3ERQ A;  3LWE A;  3NHH A;  3MZ5 A;  1XWE A;  2ENB A;  3GD7 A;  1STE A;  2IWH A;  4TRD A;  1DZ1 A;  1GUW A;  4FXD A;  1TWG B;  3NQT A;  1JOO A;  4U67 3;  1F9R A;  5G3L D;  5T1G A;  3I90 A;  1ZXT A;  3X3M A;  4R9W A;  1JC7 A;  4IN3 A;  2M2L A;  5EQ0 A;  3F2U A;  1ZYR C;  4F8M A;  2QEJ C;  3FKI B;  3QWN A;  3CRL C;  3DEO A;  4IUR A;  5C0X I;  4IFD J;  1E0B A;  1QWY A;  1B9M A;  2E76 C;  1PRT F;  5J22 A;  2FIN B;  1XX8 A;  4X3U A;  4ODG A;  3VYS A;  1STY A;  1Y1V B;  2N88 A;  2MHV A;  5FO9 B;  4H0L C;  1KTK A;  1NAP A;  2SDF A;  4GZY C;  1LAB A;  2NVT B;  2E74 C;  3MHB A;  3I72 A;  1BCP C;  4IUP A;  1JCK B;  3EA6 A;  1SEB D;  1EWC A;  3VR2 A;  1XXG A;  2EVB A;  4IFD G;  1ZKO A;  1BQQ T;  3PUZ A;  2EYP A;  3NWS A;  3GTM B;  1R9T B;  3NQI A;  3IFD A;  3O13 A;  4RGO S;  5EPJ A;  3SDZ A;  3RUZ A;  1SBB B;  1WTR A;  4OHJ A;  3VYU A;  4G4K A;  3JAM E;  3C46 A;  2LKV A;  3FDT A;  3RLF A;  1JOQ A;  3J7Y W;  3HEJ A;  3Q24 A;  2B39 A;  3C2P A;  1EU4 A;  1X3Q A;  4PNY A;  2HDM A;  3S1R B;  2K6A A;  4QUC A;  3L3O C;  5CGK A;  4C2M B;  1STB A;  3BDO A;  4X3S A;  2BE5 C;  3ND9 A;  3VR6 A;  4ZQ3 A;  2LS0 1;  2K04 A;  3BVM A;  4ZKC B;  3S14 B;  2K1B A;  1ILQ A;  3E6Z X;  2NVQ B;  3H6M A;  3K7A B;  3QJY A;  5DNF A;  2B2Y A;  1GOZ A;  5D3I B;  4LAA A;  1TVX A;  3DUZ A;  5JEA G;  5JPN C;  1PTO H;  1OO9 B;  4V0B A;  4WOR A;  3U9S A;  1H9K A;  4QF4 A;  3TZU A;  2CQA A;  1E2W A;  1KDC A;  2KCN A;  3KUP A;  3OPO A;  1WTW A;  2F0T A;  2YYZ A;  4E6I A;  4RFB A;  3TME A;  3ERO A;  1ENA A;  4IUQ A;  1PXU A;  3IKJ A;  4CJ0 B;  3BS1 A;  5IGF A;  1TQO A;  4HTH A;  3HP3 A;  1D5M C;  1LTG D;  2Z4H A;  4DAP A;  1IW7 D;  4L63 B;  2H4O A;  2PZT A;  3GTQ B;  2NWG A;  1UUP A;  4LJZ C;  3U9O A;  1LTA D;  3J81 L;  2V4D A;  3K5N A;  1G29 1;  1DOK A;  1BXT A;  4BA1 I;  5I6Y A;  1VCI A;  3WDN A;  2ICI A;  4IAL A;  4K2L A;  1O7L A;  3D4W A;  2XRQ D;  1CQV A;  4ZYS A;  2E2I B;  2EY1 A;  3WOE A;  5ELB A;  2SNS A;  1TT2 A;  4G7O C;  1HUN A;  5JJZ A;  3VR4 A;  5M5X B;  1LTR D;  3J80 E;  4HR7 B;  4IFD H;  1FNW A;  2EJG C;  2EZV A;  5E1F A;  4P2C B;  3H94 A;  2Z4I A;  1Y1W B;  3TP6 A;  4CHT B;  5FK9 C;  3BDC A;  2JP1 A;  1SYE A;  2I07 B;  3I73 A;  1IYV A;  1QOH A;  2IX0 A;  3HRZ C;  2NVX B;  1H9M A;  2EY5 A;  4XT3 B;  4RKB A;  1QIL A;  3PIO 3;  1ICW A;  1JR0 D;  1MSH A;  1RHP A;  4KTA A;  4WFN 3;  1SDF A;  4ZK9 B;  3C1F A;  1HTL D;  3GV6 A;  4C1N I;  2Q8R E;  1TWF B;  5I6W A;  3FPU B;  2ICE C;  1SXT A;  4XDX A;  2PMZ B;  3BVG A;  2JEB I;  4QCL A;  4FYD A;  4DAY A;  5FLX L;  5J1Z A;  1LT3 D;  3C1E A;  5JAV A;  4K6L A;  3HKZ B;  5COR A;  1HUM A;  3ITP A;  2FMM A;  1LLR D;  1PTO F;  1V1P A;  2EYO A;  3E0J A;  1S5F D;  1I4R A;  4FF4 A;  1G91 A;  1AZQ A;  3H0G B;  3K5M A;  3MXP A;  4KHV A;  4ILW A;  3QOJ A;  2KQ3 A;  2A74 C;  1CZG A;  4RGM A;  4XQN A;  1YNJ C;  3MA2 B;  2F0L A;  4TQU S;  2KJX A;  5I2Y A;  3I8Z A;  4DGZ A;  3MFY A;  4N9P A;  2IT1 A;  4RWS C;  3MVV A;  3Q22 A;  2K28 A;  3TP5 A;  1WTO A;  4V19 0;  5IGC A;  3TSS A;  1IYU A;  3VA5 A;  3SK6 A;  2B2V C;  2IPK D;  1D1I A;  1TWH B;  2JA7 B;  1EYC A;  2WV6 D;  5AFW A;  1EYD A;  4RA8 A;  2F0F A;  4OO1 I;  1HXY D;  5FKA C;  3R2I A;  2RDH A;  4IZ8 A;  1KNA A;  5IT9 L;  3OOC A;  3OWF A;  3VYT A;  2B2W C;  2A68 D;  2X6G A;  3SEB A;  5M3F B;  2WKD A;  3P20 A;  5CV5 A;  2YU9 B;  1EQV A;  2WIN B;  1F2Y A;  3IFT A;  3LNN A;  4C3J B;  3J7A F;  1S5D D;  1RTN A;  2C5C A;  3AB9 A;  2K32 A;  1ML0 D;  4RCN A;  4KY6 A;  5G3L F;  4G57 A;  3K59 A;  5C0X G;  5IGG A;  3T16 A;  4KHZ A;  1AZP A;  2F3W A;  1ROD A;  3DWP A;  3QB3 A;  2JA5 B;  3DWQ A;  4HN7 A;  4CJ1 B;  3GTK B;  1H9J A;  3I91 A;  1X3P A;  1TS4 A;  1SJH D;  1ET6 A;  3CU7 A;  2F0J A;  4RCO A;  5A35 A;  2D62 A;  4DK1 A;  1BCP B;  1V1P B;  2B2T C;  3EFX D;  3QO2 A;  1WCM B;  2LMC B;  3M7G A;  3GTL B;  1CHP D;  4I65 A;  2Q8T A;  3T4A C;  5K36 G;  2L9H A;  2I46 A;  2OT2 A;  1SMY C;  1W6J A;  2EY6 A;  3S1N B;  5CBE E;  1ZYR D;  2R3Z A;  2MJ8 A;  1H9S A;  4X3K A;  1Q12 A;  5ELF A;  3MXN A;  3RZD B;  2ZT9 C;  3V05 A;  4CJ2 C;  2A73 B;  4R8N A;  2PYK A;  1TS3 A;  4IQZ A;  4M1U B;  2NN6 I;  3QIA A;  2NYZ D;  5FO8 B;  3PUY A;  4J8Q A;  1CHQ D;  1TY2 A;  2K33 A;  2R61 A;  4A3D B;  4N9T A;  2RDG A;  3W2D A;  4BWG B;  3VR5 A;  3VYR A;  1BCP D;  4KJN A;  4TKO B;  2R6G A;  3QOL A;  1G2S A;  4FF1 A;  2F0K A;  1AP0 A;  1EIG A;  4A3K B;  1GUO A;  1A6X A;  1EFI D;  1A3U A;  4PQX A;  1PLF A;  3DWA A;  4RH6 A;  5IGE A;  5A2Q E;  1LAC A;  3D6W A;  4HMJ A;  3L9A X;  5EBD A;  3P1H A;  4C56 C;  1EY7 A;  4DNT B;  5M3M B;  3FMC A;  2KEE A;  4Q0F A;  3OIQ A;  1OXV A;  5JPM C;  3OMG A;  3KBX A;  5D65 A;  1F2M A;  1K8O A;  1Q3L A;  4HSP A;  2EYJ A;  1STN A;  1RKN A;  2J7Z A;  1JWU D;  2BE5 D;  4DAV A;  2NB0 A;  3PUW A;  1Y69 U;  1F2Z A;  2PW7 A;  3KLS X;  3GQB A;  4O1N A;  1IKM A;  1PFM A;  4KI0 A;  5C5L A;  2D9U A;  4K2K A;  2XN9 C;  5KIX A;  1DON A;  3S15 B;  2OF1 A;  3AMU A;  4C3H G;  1RD9 D;  3OSO A;  1S5C D;  2M00 A;  3D8G A;  1XTC D;  2F0H A;  5EKK A;  1L0X B;  4J6H A;  2O5J C;  1H9S B;  4PMB A;  2B2V A;  5E4W C;  5EBC A;  2JA8 B;  3PIP 3;  4Y7N B;  1LO5 D;  4DXG A;  2RQX A;  4BY1 B;  1AEX A;  3S2D B;  1BBX C;  1TR5 A;  3KF8 A;  1CQF A;  2ID0 A;  3RZO B;  1KLG D;  2B2W A;  2JSO A;  1Y8O B;  5HGT A;  4K8J A;  4HMI A;  1T5E A;  5C3W A;  2NBF A;  1SE4 A;  2XSC A;  5JEA J;  1LT4 D;  3QG1 A;  2L1B A;  5IOD A;  4WRD A;  4KK7 A;  4K5V A;  4CKC A;  2B63 B;  2MP1 A;  3BYY B;  4FO2 A;  1A2T A;  1E2V A;  1EY0 A;  4DK0 A;  1ESF A;  5JOB A;  3S1M B;  1AFP A;  1LV9 A;  5JVG 3;  3GP7 A;  1GJX A;  1B50 A;  1IHZ A;  1G6Z A;  1CZW A;  1I4Q A;  3BVZ A;  3FVQ A;  5IGD A;  5KGU A;  1U9R A;  2K01 A;  1G8Z D;  1SE2 A;  1U4P A;  3SR1 A;  3T13 A;  1DXM A;  3AU7 A;  2HDL A;  4F88 A;  3K58 A;  4ULL A;  2L55 A;  1T5X D;  2A69 C;  2G9D A;  2NTT A;  1HA5 A;  2WAQ B;  1B53 A;  1IKL A;  5I9P A;  4NKL A;  3HOV B;  4RAU C;  5KYI A;  1MBY A;  3HOY B;  3G6J B;  4PV1 C;  2HCC A;  1PZI D;  5EKI A;  1JE4 A;  1FNU A;  5M5W B;  4ZUI A;  4RHS A;  1EY8 A;  1WD1 A;  4PMC A;  4ME5 A;  4H13 C;  4A3I B;  3VA7 A;  2IL8 A;  3NXW A;  1QCB D;  2F1M A;  5DM6 3;  4B08 A;  4MIU A;  1KDB A;  5C4X B;  4B9X A;  4FXG C;  3FRP B;  2A6H C;  4LMQ D;  1Q1B A;  1NCV A;  5ELE A;  4JBW A;  4XT1 B;  3I4M B;  2EXZ A;  1VMC A;  2BA0 A;  5LHY 1;  4KKS A;  4KKT A;  2VXW A;  4Z9C B;  3Q0A A;  3CKI B;  1WTV A;  3KLR A;  1JOK A;  4XYQ A;  4XQQ A;  4FVM A;  3NE5 B;  5D3D A;  3LX0 A;  3I4N B;  1YNN C;  4H7B A;  2E75 C;  3A8K E;  2OXP A;  3GTO B;  1B2T A;  4BS9 A;  1GHK A;  4IFD I;  4KD3 A;  5ISR A;  1YNJ D;  1M8A A;  2EYM A;  5E3F A;  1TS5 A;  5KND A;  3PMF A;  4K6D A;  1B1Z A;  1CFM A;  2Z1C A;  2ZXO A;  1EZ8 A;  3HG9 A;  2F0V A;  3J81 E;  5EKL A;  2EOT A;  1HQM C;  2F4I A;  1SNM A;  2EY2 A;  2XWJ B;  5KNB A;  2RDF A;  1F77 A;  1O78 A;  3A54 A;  3MWY W;  2K5D A;  1HA6 A;  1UEA B;  1STA A;  1SFO B;  4CKE A;  1II3 A;  4IUV A;  2NTS A;  5K5P A;  2JE6 I;  1PRT C;  2TMP A;  2NVY B;  5EJW A;  1BNZ A;  1ENC A;  1EIH A;  2IW3 A;  2B2U C;  3TN2 A;  2A6E C;  2RSN A;  2QDB A;  3D4D A;  1QB5 D;  1QE6 A;  1Z6H A;  1D2B A;  1JQY D;  3FPP A;  1JOR A;  1B44 D;  5CR3 A;  3V96 A;  1U4L A;  1H9R A;  2NUC A;  1AW7 A;  1NR2 A;  2J0T D;  2F0W A;  2KOL A;  5TSS A;  5DM7 3;  3S2H B;  2B8F A;  2CW0 C;  3NBH A;  3V2T A;  4A3G B;  2AQ2 B;  1WTP A;  4IUN A;  3GTJ B;  5FOB B;  5JEA H;  4ABN A;  5CBA E;  1I4H A;  2BA1 A;  5ELD A;  2PCF B;  2Z8L A;  2NN6 G;  1K83 B;  4DN4 M;  4DF7 A;  3IAY A;  3PUX A;  1DM0 B;  4UDU C;  4KY5 A;  1SNO A;  1WTX A;  3T56 B;  1MGS A;  3NSW A;  1QJO A;  5C4H A;  1TWC B;  3T53 B;  5F2D A;  1VF5 C;  2EPB A;  3MXG A;  4Q5V A;  4FXK C;  5EGT A;  2WB1 B;  3OWE B;  1U4M A;  1CA5 A;  2WP8 J;  2EYH A;  2F0O A;  3M4Y A;  5FLX E;  1BCP F;  1STH A;  3A8I E;  2KHS A;  2WAC A;  4CKB A;  3DEP A;  1D1K A;  3SE0 A;  2KVM A;  5CV7 A;  1SMY D;  4A3B B;  1ET9 A;  1BOS A;  5C0X J;  3A8J E;  3CRK C;  5BN4 A;  1F9Q A;  2GA4 B;  2KEC A;  4QUF A;  5NUC A;  2OEO A;  1EOT A;  3PO3 B;  1PFB A;  5C4J B;  4IUT A;  2B8G A;  2PNR C;  4XQJ A;  2VB3 X;  1SYD A;  1PZJ D;  4J1M A;  4QIW B;  3MAQ A;  1RCV D;  1LTS D;  1BDO A;  3KBG A;  1LTB D;  1Q8I A;  3A7L A;  1QNU A;  1QNK A;  5T1I A;  1I4X A;  3TP7 A;  1FNV A;  5CV4 A;  2VB2 X;  2LFN A;  4EQO A;  5J39 A;  2H1E A;  4OL7 A;  3HOW B;  2PQE A;  2EE1 A;  4BBS B;  4QMG A;  2L4N A;  3FEW X;  2KUM A;  5C6A A;  2K5W A;  1R4Q B;  2B2Y C;  1A3V A;  5IT9 E;  3SXH A;  1S4Z A;  5M5Y B;  1XYI A;  3RMH A;  1A15 A;  1TKW B;  3MEH A;  2DY7 A;  3EVQ A;  3HS0 C;  1U4R A;  1RTO A;  3M7N A;  1OXU A;  1SYF A;  1WTQ A;  3GTG B;  5IOC A;  3K5O A;  4U68 A;  1TU2 B;  1ONL A;  4KV6 A;  3R3O A;  1SYC A;  4B9W A;  1DD2 A;  4A93 B;  4C3H B;  1Y8P B;  1EEI D;  3KLS A;  1GHJ A;  2AUK A;  4FNF A;  1B4O A;  1X32 A;  2VUM B;  1OXX K;  1VDZ A;  3J7A V;  1I3Q B;  1UAP A;  4RKL A;  2F0M A;  2PZU A;  3DHQ A;  3K5L A;  1KNE A;  1HQR D;  5I9O A;  1DYQ A;  2FFK B;  2F0G A;  1DOL A;  1EWH A;  5CV8 A;  1RDP D;  3EJI A;  4YIJ A;  2J4X A;  3HZX A;  5EPK A;  1PDQ A;  1KAB A;  2F0S A;  5FO7 B;  3KK7 A;  5BN3 A;  1JB3 A;  1K8M A;  1OXT A;  1O80 A;  2JA6 B;  4K5W A;  3E5S A;  1PMR A;  3D31 A;  3PO2 B;  4NW2 A;  2B2U A;  1GXD C;  3MTS A;  2DNE A;  1EU3 A;  2L5T A;  1PTO C;  5JVH 3;  4K14 A;  3BDL A;  2F0D A;  1SYB A;  4ZUJ A;  2MGS A;  5CMD A;  3HOZ B;  2BCO A;  3URY A;  3JAM L;  5CYU A;  1F9P A;  2Q8I B;  1ZEQ X;  2BDO A;  2G9H D;  3CHB D;  2EYL A;  1FGB D;  2F0P A;  4LK1 C;  5C0X H;  1ENF A;  2D5D A;  5C3E B;  3SHL A;  1BO0 A;  3M3Y B;  1JIC A;  3ZYY X;  2RBM A;  2PO4 A;  5D14 A;  3I70 A;  4BY7 B;  3MXU A;  4JK1 C;  2RA4 A;  3I4L A;  5C4Z A;  4DA2 A;  3GTP B;  2A69 D;  3TZD A;  3MC0 B;  4CGY B;  5EPL A;  1A2U A;  5DEH A;  1HHV A;  1NSN S;  2SNM A;  1J9O A;  1MSG A;  5KYL A;  1Z7T A;  4OGQ C;  1L0Y B;  4C3I G;  4G7H C;  2EJM A;  5K36 H;  1I4G A;  3ONA B;  5E4X A;  1D5Z C;  3L7Z C;  3NTI A;  5I2X A;  5C44 B;  2CVR A;  1FR3 A;  1CA6 A;  1Z47 A;  2XIW A;  2A6H D;  2BDN A;  4XYO A;  4A3E B;  4O42 A;  3MFG A;  3M4O B;  2EYF A;  2TSS A;  3PUV A;  4M8A A;  4C1N K;  2FHT A;  2QCP X;  2AWN A;  3LWU A;  1CT1 D;  1GUT A;  1SYG A;  1IL8 A;  2QKI C;  1YNN D;  1GUS A;  2DY8 A;  2PZW A;  3G7L A;  1PRT B;  5LL6 S;  2Y0S B;  2K03 A;  1EQT A;  2O2L D;  1HFN A;  3K0Y A;  1G2T A;  1DCZ A;  4FF3 A;  2C9O A;  1EL0 A;  3HOX B;  3CQZ B;  2JXM B;  4KJO A;  1KAA A;  1HTP A;  2XNA C;  1ILP A;  4L6T B;  1EY5 A;  2B2T A;  1W6K A;  3D3R A;  2K05 A;  2IJ0 A;  2PW5 A;  2AUJ D;  4UAI A;  2AQ3 B;  4DXF A;  1PFN A;  3A55 A;  4HSV A;  2F0E A;  2K5Q A;  4A3J B;  3J80 L;  1I6H B;  3R8B A;  1PRT D;  1CI3 M;  2A6E D;  4KN4 C;  4DNR B;  4XIG S;  2CHB D;  4HCE A;  4G7Z C;  2XRS D;  2AQ1 B;  1HCZ A;  1SE3 A;  1V8Q A;  2DNC A;  3Q23 A;  2O5I C;  4NP5 A;  4OO1 G;  1JWM D;  2MUY A;  3NTH A;  2A5H A;  3R93 A;  3H3V C;  2ZXR A;  4ZRZ A;  4I7Z C;  3T51 B;  1BR9 A;  1EY6 A;  3IL8 A;  2CW0 D;  2RSO A;  4EGV A;  2E2J B;  5KRU A;  2RVL A;  2E2H B;  2RKS A;  4X3T A;  1AN8 A;  1TWA B;  4EQN A;  4L8J A;  2ZXP A;  3OW7 A;  4RGN A;  4AYB B;  2L11 A;  2NZ1 D;  1PZK D;  3SK8 A;  2EDG A;  3TDQ A;  2F3V A;  4FF2 A;  2HCI A;  1SNC A;  4F7X A;  3K6O A;  1V43 A;  1C8C A;  1F9S A;  2KED A;  2EJF C;  2IX3 A;  1E2Z A;  4KY7 A;  5I4D A;  2F0I A;  3N52 A;  4ZKB B;  5KEE A;  5M9O A;  1UNS A;  1M4V A;  2X69 A;  1Q1E A;  2FJ2 A;  1EYA A;  4TSS A;  2PPB C;  1LT5 D;  1VF7 A;  2F0Q A;  3S1Q B;  4IUU A;  1IW7 C;  4EVO A;  2F0U A;  1SNP A;  3RD4 A;  1C4Q A;  1SND A;  3DMU A;  1CK1 A;  4RGT A;  2JEA I;  3K57 A;  1TY0 A;  3EQL C;  2LY7 A;  5COY A;  3OMC A;  1STG A;  1KLU D;  5ELC A;  4NDX A;  3HOU B;  1TS2 A;  4FP5 D;  2R92 B;  1RF2 D;  2QIL A;  5C5M A;  3NP8 A;  3C3L A;  1KDA A;  1FYC A;  4MN3 A;  4DFA A;  1C48 A;  4K5X A;  4EQP A;  3OHX C;  4ZAI A;  1MI2 A;  4KN7 C;  4KD4 A;  2SEB D;  4XTC S;  4PMW A;  3R2T A;  3S16 B;  2WKC A;  5CV6 A;  1LTI D;  4OIK A;  5C3X A;  4F87 A;  1GUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...