4TRDA

Crystal structure of staphylcoccal nuclease variant delta+phs i72k/v74k at ph 9.0 at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEKEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylcoccal nuclease variant Delta+PHS I72K/V74K at pH 9.0 at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 131
sequence length 131
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4trdA00
2EXZA 4DU9A 3S9WA 3VA5A 2F0IA 5DAUA 4K5XA 1SNQA 4K14A 3MXPA 5CR3A 1F2ZA 1F2YA 1JOKA 2OEOA 2RBMA 4H7BA 5NUCA 4K6DA 4K2LA 4K5VA 5DEHA 3V2TA 5C4ZA 5IGFA 5IOCA 3MEHA 2M00A 2PW5A 4NMZA 1STNA 5K5PA 4RKBA 3SK8A 5IGEA 5HGTA 4IZ8A 1EZ8A 3OMCA 2EY1A 5EKKA 5IIFA 2PZTA 5J39A 1TT2A 2F0HA 4KD4A 1A2UA 4QB4A 4NDXA 1STGA 1EYDA 3OWFA 1ENAA 3P1HA 4EQOA 1KDAA 5CC4A 1EY8A 5IGDA 3SHLA 1EY0A 5C4HA 5JOBA 3C1FA 1SYEA 5EKLA 4F7XA 1EY7A 3EVQA 2F0OA 5IGGA 1STYA 3H6MA 1RKNA 3TP5A 1EY9A 4ZUJA 2F3WA 1A3UA 4HMJA 2F0QA 2PZUA 1EZ6A 1U9RA 3QOLA 3TP6A 3MVVA 1EYAA 2KHSA 4K8JA 3T13A 2EY5A 4K8IA 4NKLA 1TQOA 1EQVA 4MIUA 4DFAA 4ME5A 4NP5A 4TRDA 3U9OA 3MHBA 4KHVA 1A3VA 4G57A 1JORA 1ENCA 4HMIA 4ID6A 5KRUA 5IGBA 3TMEA 1TR5A 4PMBA 5C5MA 2EYJA 5KYLA 2PZWA 4KY6A 3BDLA 3DHQA 3SK6A 4ODGA 1STBA 1KABA 5C3XA 5CV4A 3NXWA 2F0FA 5KIXA 2NUCA 3ITPA 1SYDA 1JOQA 4K2KA 2ENBA 2PQEA 4OL7A 4EVOA 1EY5A 5I9PA 2F0KA 5J22A 1STHA 3D4DA 5IODA 5CV5A 3SR1A 3HEJA 4DF7A 4KY7A 1EY4A 1KDBA 4YIJA 4E6IA 5I9OA 4R8NA 2RDFA 5I6YA 3SXHA 5ISRA 4DGZA 5EGTA 5C3WA 1STAA 1NSNS 1SYGA 2F0JA 2F0LA 3HZXA 3OMGA 3TP7A 4J6HA 5CGKA 5IGCA 3QB3A 2KQ3A 3NUCA 3RUZA 3TP8A 3NK9A 3SK4A 1SYFA 2F0UA 2WACA 1SNCA 5KEEA 2EYPA 2LKVA 2PYKA 5CV6A 5C5LA 5CV7A 3EJIA 3ERQA 4QMGA 4HTHA 4N9PA 4PMCA 1A3TA 4I65A 4WRDA 4B9WA 3BDCA 4PNYA 1JOOA 4K5WA 5C6AA 2F0PA 1SYBA 2PW7A 2F3VA 2RKSA 5CV9A 5HURA 4N9TA 3NP8A 3NHHA 2QDBA 5JAVA 4LAAA 4KTAA 1F2MA 1IHZA 3D8GA 2F0MA 4ZUIA 4F8MA 1NUCA 1KDCA 3SK5A 2SNMA 2OXPA 1EY6A 1SNMA 2F0VA 3LX0A 4KV6A 4J1MA 5KYIA 5M9OA 4B9XA 2F0GA 2EYHA 1SNDA 1AEXA 1II3A 4EQNA 3C1EA 4KJNA 3EROA 2EYMA 2HQEA 2F0WA 3T16A 1SNPA 5KGUA 3DMUA 2F0NA 5CV8A 2EYLA 3D6CA 2EYFA 1A2TA 3D4WA 3E5SA 2F0SA 3OSOA 2EY6A 5J1ZA 4WORA 2SOBA 1SNOA 4KY5A 4S3SA 4EQPA 5F2DA 3MZ5A 3P75A 4KJOA 2OF1A 4IALA 1SYCA 3NQTA 5E3FA 1KAAA 2EYOA 4QF4A 2O4XA 5I6WA 4RKLA 5E1FA 4ZQ3A 2F0TA 2EY2A 2F0EA 2SNSA 3QOJA 4KD3A 2F0DA 4IUNA 3PMFA 1EYCA 3R3OA
chains in the Genus database with same CATH superfamily
1EFWA 1GUTA 1PRTB 3QO2A 4K5VA 4JI0L 1B53A 3GDEA 2M00A 2Q8IB 2R92B 1VDZA 3CCMA 3PO3G 4H13C 4NDXA 4JI3L 3S14B 3HOXH 1KDAA 3GTOH 2VB2X 4GS3A 3K5MA 3K59A 4XYOA 3NELA 3Q24A 4JV5L 1D1IA 3DM3A 4IUPA 4LFBL 1PZJD 1B1ZA 1Y1WB 1EY9A 1LABA 2R92G 4JPBW 1RODA 5C4XB 4OWWB 2G9HD 1V43A 1EYGA 3GTKB 3CQZB 4P74A 4TRDA 3M7GA 4JBMA 2SEBD 3QG1A 5C5MA 5AFWA 4LF4L 5C4XG 5KYLA 3DUZA 3DM1A 3W3AA 1LUZA 4IOCA 1CHQD 4ZLTF 4KKTA 1EL0A 3RD4A 2F3IA 2F4VQ 3UDGA 4DR6L 2UUBL 4DXGA 3M4PA 4X65Q 4DGZA 2HD3A 2ZTCA 2OTLA 3OMGA 4POFA 1RD9D 4RFBA 2JP1A 4DUZQ 2KQ3A 2V1CC 5KEEA 3M4OB 2NTSA 1NE3A 2LKVA 3RZDB 2FHTA 1PH1A 4N9PA 2ZM6Q 2YTXA 4K5WA 3U4ZA 2UUCL 4DV7L 3CCVA 2YU9B 3KLWA 1SE3A 5JJIA 2MQHA 4LFAL 3SK5A 4P71A 5KYIA 2YTYA 3PIPA 1SE4A 2EYMA 1O7YA 2A8VA 4HIOA 4A3MB 2N88A 1ESRA 1VQBA 1CUKA 1SMXA 1F9SA 4P2CB 4A93B 1WD0A 4FP5D 2RDGA 2HDLA 5IP7H 1RJTA 5LMNL 1K8OA 2Z6KC 1CKOA 3I4NG 1XJVA 4OO1H 3CCEA 4A3MG 3T1HL 2F0DA 3H0GB 4A93G 1YNNC 1YEZA 2X6GA 3BZKA 4OWTB 4IOAA 1YHAA 4BY1B 4B3ML 3KF6A 4C3JG 1DCZA 1YHBA 1STNA 5HGQA 3K0XA 5EKKA 2I46A 1STGA 4BY1G 2L15A 2A74C 1ENAA 3E9HA 1S40A 3HOVG 2CWPA 1SDFA 1JQYD 1GHJA 2I5HA 4A3EH 4ZUJA 4CKBA 3QOLA 3KJOA 2RSNA 5C0XJ 2E2IH 3NBHB 1YNND 2LSSA 1EUJA 1KXLA 5IWAQ 1GHKA 3HRZC 4X3SA 4GNXC 5C0XG 1X3FA 1WTXA 1N36L 4DK3C 1PLFA 1UE7A 4FF3A 1UWVA 4ZCKA 3GTGH 3K80C 3KBXA 3HOXG 4Q0FA 3DXJC 2ES2A 2B39A 5I9OA 4JYAL 1U4LA 5I6YA 1PH8A 1STAA 1WTVA 4DNIA 4OXPA 1P8LA 3SDZA 4QUFA 5I4DA 1HH2P 5H1SE 4M8AA 3BU2A 1Y8NB 2UXCQ 1JOOA 2XNAC 5C3EH 2WB1E 1AH9A 1Z6HA 5ELFA 3CC4A 1PFBA 3TRZA 4QY7A 1EY6A 3T51B 2K14A 3IKJA 3I72A 3J81c 4LNQA 2E2HH 1NJIC 4KJNA 4QCLA 1AE3A 2B2WA 3TZDA 1KL9A 3DEPA 3S1MB 2A19A 2NVTH 3TEHB 2B8GA 5CBAE 1HNZL 1G51A 1DZ1A 1K73C 3KYHC 4CKEA 3PIP3 1PXUA 3T53B 3QOJA 4DNTB 5DLQE 2HHHQ 1XPOA 2VW9A 2PO4A 5DAUA 4JI6L 1F2YA 2OEOA 4FNFA 3W2DA 1ZYRC 4R4OA 1IBMQ 2ZXPA 4Y7NB 3IAYA 2KEEA 2OQ0A 3K0YA 5EPJA 4CJ1B 2BOSA 2TSSA 4U673 5JPMC 5IP7G 1PYWD 4GKJL 1G6ZA 1FNVA 3H91A 4OO1G 3MA2B 4PZ6A 3EA6A 1NR4A 3NQIA 3X3NA 4UDUC 2JA7B 2P5ZX 3GTPH 1TWGB 4ULLA 1BKBA 4JK1C 1UE1A 4GZYC 1JR0D 1HNWL 1TWAB 1ZYRD 2IL8A 3BDLA 1WI5A 3T56B 5FO8B 2K5DA 1IL2A 3GQBA 4J15A 1HZ9A 4DR4Q 3M4QA 2JSOA 4YIJA 5GROA 1EOTA 4A3EG 3GO5A 4KN4C 4A3IH 4BY7B 2Q2UA 4AH6A 1L0YB 1C8CA 1JC7A 5CV7A 3E6ZX 5C4JB 4DV5L 2JA8H 3CPFA 5EKIA 2ID0A 3BDCA 4PNYA 1SN8A 2XTIA 4DV6Q 3JC66 2Z1CA 4LMQD 2QDBA 4BY7G 2VQFQ 1YNXA 1LM0A 1QE6A 4HSPA 3G4SA 1IHZA 1YHQA 2F03A 2K7VA 4DV0Q 1PRTC 2D0OA 4CKCA 1YI2A 1L0WA 3C1EA 4OIJA 3J81i 4ME3A 3HP3A 1BR9A 3KBGA 3KF8A 4XQNA 4S3SA 4YHHL 4JG2A 5F2DA 1CK1A 2A69C 4OX9L 2O5JC 2WB1B 1L0XB 1DYQA 1UE5A 2E2HB 1DGSA 2EY2A 4A4IA 4X64L 2OWOA 1X9NA 5J3BA 5C0XI 4GKKL 2NVTB 2F0IA 2Z4HA 4RH6A 5D14A 1F2ZA 4L5SA 4KK7A 4IUTA 2A73B 2PMZE 1PRTD 3UI2A 3CCUA 1RL2A 4A3KB 4MTNA 1W6JA 4LUZA 1KNEA 3D31A 3OWEB 4QB4A 3J81j 4X6AH 4EQOA 3P1HA 2YV5A 1VQ6A 1QNKA 4AQYQ 2A69D 2G9DA 4A3KG 4JI2L 4O2DA 2K01A 3RN5A 5M3MH 1D5XC 3H3VI 1VQOA 3UE0A 1TQOA 2XWJB 4H0LC 3H09A 1G6PA 3S17H 4QGUA 3S15B 3S1RH 4G57A 2B2UA 2J7ZA 1B7YB 5CBEE 4PMWA 2IY5B 4LUVA 1DJRD 2N78A 3HOUB 4DR5L 2ZJQA 1WTRA 5M5WH 5BR8L 3MC0B 4AYBE 4TVAB 4JCVE 1XWEA 1CSPA 2DJFC 1NY4A 3U58A 1OXUA 1C48A 5A2QE 4A3DH 1RTOA 5ELNA 4J8QA 1NSNS 3HOUG 3TS0A 1I6HB 2E2DC 4XYQA 1CQFA 3F2BA 3CCSA 4JBWA 1BCPC 5CV6A 4ZK9B 1CKNA 3LWEA 1I50H 2B8FA 2Z0SA 3W5OA 1V1QA 2EQSA 2NVYH 1HNWQ 4TKOB 1SMYC 3PSIA 3G7LA 3ULPA 1S72A 2VNUD 4GN4B 1O7ZA 4FF4A 5LL6X 3S14H 5KNCA 2DJGC 2JXMB 3CRKC 1II3A 1BBWA 1LYLA 2HQEA 3K81C 3DWQA 4WORA 1S5ED 3C2PA 1XNQL 1CA6A 1LT3D 1P16A 4XT3B 4JI4L 4DV3L 4RGMA 4NXMQ 2B2VA 2MHVA 4POGA 1BCPD 1VQ4A 3W1BA 5C44H 2JA8G 4DUYQ 4GNXB 4FYDA 2VY3A 5CMDA 2K5HA 2ATWA 2LY7A 4EQ5A 1GOZA 1D1KA 2Z8LA 1PMRA 1OXVA 2K5QA 2R93H 4A3GH 3A55A 5CR3A 5ELDA 5IYDH 2PW5A 3EQLC 3NWTA 2EXDA 2JK8A 4RKBA 1B3QA 5J39A 1KRSA 1TT2A 4DR2Q 4RG1A 1VQ8A 1TVXA 2NZ1D 2VL6A 1BQQT 4XDXA 3H15A 1I94Q 1VQJA 3Q8DA 5DM63 5EKLA 3H3VC 1B44D 1RKNA 2N55A 2R92H 3DEOA 2JJQA 3FP9A 4UPAA 2RHSB 4X64Q 2F0QA 1VF7A 5EPKA 1QWYA 2L9HA 3IRBA 1SE8A 1LACA 3RLOA 1OO9B 2HIXA 5JJKA 1E2VA 5KNBA 1A3VA 1UNSA 1Y1WH 5K36G 1YBYA 1E24A 5KRUA 5C4XH 4IPCA 1CT1D 2KHJA 2FMMA 4ODGA 3CQZH 3FDTA 2F4VL 4ABNA 2B29A 3NXWA 2E8GA 3CD6A 1PH7A 3J7YW 1VCIA 3S17B 4IURA 4IPGA 4KY7A 2K28A 3SXHA 2YTVA 4DUZL 2G5DA 4BBSB 1SYGA 5M3MG 2C35B 1R4PB 2NZHA 1YIJA 2PYKA 2ZM6L 1JWMD 3IFDA 2QEXA 1ILQA 4F87A 1N32Q 1IL8A 3OTOQ 4A3DB 2XGTA 4BBSG 1SYBA 1B4OA 5CV9A 4AYBB 1HR0Q 3M4OH 4LUOA 1LT5D 4F8MA 3RZDH 1D5ZC 1E2ZA 1PFSA 3I70A 2Y0SB 4DV4Q 4M1UB 3GTLH 2F0WA 4A3DG 1SNPA 3VR4A 4AYBG 1PH3A 4PZ7A 1IYJB 2NVYB 3PCOB 1SNOA 4IUQA 4KY5A 1SSOA 5EBCA 3Q22A 3CMAA 2Y0SG 2MFIA 3I7FA 5I6WA 5E1FA 3I91A 4FO2A 5T1IA 1FD7D 3PUZA 3FHWA 4WFN3 3KOJA 1VF5C 1SRUA 5AJ3Q 1A0IA 2HCIA 4NB3A 2VUMB 1SFOB 2K5NA 1FJGQ 4K5XA 1XYIA 1W6KA 1NTGA 2ZXOA 1C0AA 3A0JA 5C4ZA 3H0GH 1K83B 2KCNA 3HKZE 4DAYB 2QA4A 2IPKD 3GV3A 3SEBA 4BY1H 2VUMG 3NPPA 5JJZA 2R93B 4A3GB 1VQIA 1LO5D 4UP7A 1LTTD 2F0OA 1TIID 3H6MA 4CDCC 4HN7A 3KJPA 3TDQA 1S5FD 2KHSA 4K8JA 1WJJA 2R93G 4K8IA 4A3GG 4RGOS 4WJWA 4X62Q 5IWAL 1U0LA 3J7AF 1CKMA 5C0XH 2BH2A 5IYDG 2OQKA 3TMEA 4B3RQ 2WIIB 3S1QH 1JJGA 5EAYA 3L2PA 3UDIA 2F1MA 3GTMB 3QIAA 2NUCA 1SYDA 1LTRD 2QW7A 1KQSA 1HXYD 1HR0W 3OHXC 4CDEC 4DV1Q 5T1GA 1VQMA 1PTOC 2E2JB 1HZBA 1H9SB 1NMFA 1KLUD 1T5XD 1HCZA 3TP7A 1B70B 2NN6I 4GLVB 3Q23A 1HTPA 2QF7A 1SYFA 2QCPX 4G7ZC 1L1OA 1FYCA 1IW7C 4L8JA 4HJ8A 3Q0AA 3J81E 3H3VH 2UXCL 4FXKC 1Y1WG 2K5WA 2KCTA 4IPDA 2Q2IA 2PW7A 2F3VA 4P75A 5FLXE 4JOIC 1QUQB 2I0QA 2J0TD 3L9AX 2RHQB 1XTDA 3VYTA 2D2CC 4YWMA 2XN9C 1JJ2A 4YCUA 1VQEA 5ELEA 1PTOD 1E0BA 3BDOA 3K6OA 1PH6A 2B2TC 1HA5A 2EJMA 1IBLQ 1EWCA 2A5HA 2OF1A 3I2ZA 2VQEQ 1KAAA 1IW7D 2L11A 2OT2A 4UP9A 2O4XA 2B2WC 2Q2TA 4IN3A 3LWUA 1LTBD 3GTLB 4HJ7A 2F0EA 2HHHL 3S1MH 2L1BA 4RCOA 1NAPA 1EYCA 2I5LX 1GUSA 4JC0A 2IHFA 4HEDA 2KCCA 3VR6A 1V1PB 3TREA 1PH4A 1IBML 5LHY1 5DEHA 2EJGC 4NXNQ 1CQVA 1QILA 4DNRB 1A2UA 1DOMA 1BCPB 1XXGA 2XRSD 2PNHA 4LF6Q 1K0SA 1EY7A 2CWAA 3EN2A 2M9VA 3BJUA 4Y7NH 3EIVA 1B8AA 1VQ5A 1QZHA 2RCNA 3BYTB 3A7LA 1EYAA 3T13A 4GOPA 1TKWB 1WD1A 4IPHA 4DFAA 5IT9L 1GM5A 4LK1C 4A3FH 1AP0A 4KKUA 3G71A 4L5RC 1ENCA 1RIPA 4ID6A 2FJ2A 3L7ZC 4HJAA 1BBUA 4ZRZA 3M3YB 3H0GG 1H9MA 2MNAA 1LTLA 1NBWA 4JBKA 3DHQA 1EWIA 4GLAC 2PQAA 4KMUC 2LXJA 2JA7H 1J9OA 1TWGH 2ENBA 2MO1A 4DR4L 1E1TA 1TWAH 2H1EA 3SR1A 3BZDB 1HQMC 3NTKA 2KVMA 2NZOA 3S1QB 5EJWA 2AQ2B 3HOZB 2Z6BA 4QJFA 4XTCS 4IO9A 4R8IA 2VXWA 1J8IA 1GJXA 4DV6L 2LMCB 4IUVA 3MXNA 2ZT9C 4PV1C 2VQFL 1RF2D 2AKWB 4BY7H 3A54A 1LLRD 3HOZG 1N9WA 1R4QB 4DV0L 1BBXC 1F2MA 1YJWA 2F0MA 4RMFA 1TY0A 1X32A 5C4JH 5M9OA 3M9BA 4C3IB 2IHEA 2L0CA 1LTSD 4EQNA 3G6EA 1AE2A 1GVPA 1B9MA 1S5DD 4CJ2C 5GAEC 2KA7A 1JJCB 2EY6A 3F8TA 2CQAA 2K6AA 4A3BH 2DY8A 3TN2A 2KENA 2AUJD 3EFXD 4DR3Q 3P75A 4B08A 1XMQQ 3CMEA 4OWXB 1U4RA 4JW0A 4X3KA 4ALPA 2CKZB 5E3FA 1YJNA 1O7LA 1PV4A 2BDOA 3M85A 4RGTA 4DPGA 1VQLA 4GN5A 3CF5A 3S16B 1KHIA 4HJ9A 3OOCA 1TY2A 2HIVA 3R3OA 1EQTA 3PQIA 1C7YA 3NTIA 1EEID 1SNQA 2PPBC 1PYSB 4OGQC 5NUCA 3I73A 1JOKA 2WAQE 1XNRQ 5IGFA 4B3SQ 5HGTA 5FLXc 4IFDI 4HCSA 3E0JA 3OWFA 1N34Q 4AQYL 1YVCA 1X54A 1S5CD 5IGGA 1PH2A 4A3KH 2IWHA 3PF4A 3X3MA 3CU7A 3KFUA 2OCEA 1PFNA 2CH4W 1A3UA 1T5EA 2PZUA 1U9RA 2E75C 4FXDA 4DR1Q 3QWNA 3S24A 1I6VC 1SE2A 3E3XA 4JBJA 1JMCA 1EWHA 5IGBA 4HR7B 2O5IC 2KECA 2PZWA 4DN4M 5IT9E 5C3XA 2B2UC 2ZXRA 3S15H 1CM9A 2LS01 3UDXA 3W1GA 4A3FB 4R4QA 4JI8Q 1VQHA 5J22A 5CV5A 1EY4A 1KDBA 1OXTA 4UHVA 5A35A 3HOUH 1HUMA 4QIWE 3TP8A 1HPCA 3SK4A 1QCBD 2F0UA 4A3FG 1V1OA 2AQ3B 1TU2B 1IKMA 4HIKA 4WRDA 1PH9A 3TS2A 1Y69U 1PRTF 1I6HH 2F0PA 2N3SA 4GOPB 3KF6B 1PFMA 1FNWA 5JAVA 2UU9Q 2JA7G 1A8VA 1M1KC 3KDFA 2RF4A 1F9RA 2F0VA 3T1YQ 1STEA 1E3PA 2EYHA 2ZJRA 1F9QA 3T16A 3TQYA 1GUOA 3SE0A 3D6CA 1A2TA 1CTMA 2IT1A 1Q1EA 4NXML 1FVIA 3ERSX 3J7AV 1QB5D 4DUYL 2NN6H 3EBEA 1Q82C 4QF4A 2A6EC 3ND8A 4X3TA 1B3AA 1U5KA 3AB9A 1ENFA 3K8AA 4G7OC 2R7FA 3GTQB 4A3BB 2B2VC 2EXZA 1TXYA 3STBC 2QKIC 3KLRA 4RHSA 1V9PA 1X3PA 2C9OA 3MXPA 3SGIA 1WTQA 1PTOB 1MJEA 5TSSA 5JJLA 1I5FA 3FEWX 2QDLA 3OIQA 4DR2L 1MI2A 4A3BG 1QOHA 1JICA 4KD4A 1LTAD 1QVGA 2CHBD 2MO0A 1I94L 1PDQA 3P7JA 3VYUA 2Z9HA 1STYA 3TP5A 2L5TA 4H02A 5EBDA 1KNAA 3HOWB 4JI5Q 1GUNA 5M3FH 3TP6A 1IBKQ 2WAQB 4DK6C 1EFID 2WB1G 2LFNA 4NP5A 1C4QA 5K36H 5COYA 3STBD 2Q8RE 2BCOA 1KLGD 3D0FA 1JORA 1EOVA 3C3LA 2KCMA 1TR5A 1KAWA 1ASZA 2R7ZH 4UY8C 3RNUA 2QILA 2ZTDA 3HOWG 3SK6A 3CW2C 5ELOA 3AFQA 2WAQG 1KABA 3NEMA 2PQEA 2KEDA 3F2CA 4BXXG 2BA1A 5IODA 2L55A 2NVQB 2JQOA 1QNUA 1ESFA 4ZKBB 2BA0A 2I07B 3SVMA 4R4TA 3HZXA 1WCMB 4RWSC 4U68A 3RR5A 1SNCA 5M5YH 3OPOA 4H44C 1PH5A 1N32L 3OTOL 1KD1C 4BBSH 5G3LF 1D7QA 2XVSA 1HR0L 3HGBA 1HA6A 1EU3A 1WCMG 4N9TA 1E1OA 3NP8A 2ICIA 1SJED 3HOYH 1HFNA 4DV4L 3T4AC 2V4DA 2Q8TA 5LL6S 3QR8A 4QIWB 2IX1A 3S1NB 1MIUA 3S2HB 1JB7A 4G7HC 4KHPQ 3FMCA 2EOTA 4DK0A 1XPUA 2JA5B 5IT9c 4WJ4A 1S5BD 3MZ5A 2MUYA 2MP1A 3NQTA 2B63B 2MJ8A 1TS3A 4DAMA 2TMPA 5AJ3L 3K58A 4GLXA 2KBNA 3I90A 4O1NA 2BE5C 4QL5A 2JA5G 4BS9A 4YY3Q 1FJGL 2ZTEA 2B63G 1I4XA 4K2LA 1X6OA 2L12A 4FF2A 2VUMH 3JAML 3OMCA 5IIFA 1SFOH 1VQ7A 2UUAQ 3S2DB 2NVXB 2GN5A 1DONA 1B9NA 1EY8A 4MZ9A 4OEMB 1Q8IA 5JOBA 3J7ZC 2NN6G 1TWFB 2HQLA 1K83H 1KRTA 2ASBA 1EIGA 1HHVA 2NWGA 3O13A 3CCLA 2WKDA 2AQ1B 2FXQA 4X62L 4DK1A 3RZOH 3AQQA 1SMYD 2BE5D 4GN3B 2H4OA 2MGSA 4PQXA 4B3RL 3I3CA 4F88A 4JI1Q 2R6GA 4AIMA 4PMBA 4N8FA 5KNDA 1IYVA 3L0OA 5M3FB 4G4KA 4L6TB 3OIPA 1E22A 1LT4D 4YWLA 3AYHB 3I4MB 4DV1L 1JOQA 1EY5A 1X55A 1CI3M 2EPBA 3KF8B 1BO0A 1V8QA 2RDFA 2ZJPA 2R7ZB 3MEFA 3C46A 3GTMH 2UXBQ 2PMZB 5M3FG 3NK9A 4DV2L 3I4MG 4HAEA 3D6WA 1EIHA 5C5LA 2E2JH 3J80L 4A3JB 3VDYA 4QMGA 1A6XA 4HTHA 1X3EA 2EZVA 2GVBA 4MTKA 1QG7A 2R7ZG 3G6JB 3I55A 4RA8A 1L1OC 4EX5A 1MBYA 5CYUA 3KK7A 4KTAA 1K28A 1RTNA 5M5YB 3PO2B 2XWBB 3VA7A 1SNDA 3ZJYC 1U4MA 1Z47A 2AUKA 2DGYA 4C2MH 5KGUA 2AWNA 1K8AC 3D4WA 2F0SA 1IBLL 4HSVA 3AMUA 1R9TH 1TWHB 3CC2A 3BVGA 2VQEL 4XT1B 5BN5A 3PO2G 3HOYB 3K5NA 2JE6I 1VQDA 1YZ6A 1KTKA 3E9IA 4LF7L 1W3SA 2B2YA 2A6HC 1IKLA 2K52A 1I4RA 1FR3A 1O80A 3VA5A 3WDNA 3HOYG 2AWOA 4PZ8A 4ZKCB 4K6DA 2DY7A 4RCNA 4NXNL 3MEHA 5I2XA 4XQQA 5K5PA 2AHOB 5IYCG 2J4XA 3NBIA 1AN8A 2RSOA 1EYDA 1OTCA 4LF6L 3HKSA 4XQJA 1GUWA 5C4HA 1ET9A 4A3LH 4FVMA 2JEAI 2K5VA 3JAME 4UP8A 1Q86C 2F3WA 1EZ6A 5M5XB 1BNZA 3M4YA 5BN4A 1G2TA 1WFQA 1CKNB 2A6HD 1CHPD 2IW3A 1EQVA 2CVRA 1A63A 1TWCB 2KUMA 2JA6H 1ZXTA 4BBRB 1XMOQ 3PUWA 3BZCA 4MNOA 4GOPC 3KLSA 4KY6A 2EE1A 1FL0A 2PNRC 3RZOB 5FLMG 2F0FA 1PA6A 4C3HH 1QZGA 4OL7A 5LMUQ 3M3YH 1VQNA 4MHEA 4RGNA 1C9OA 1SROA 2JN4A 2D9UA 5ISRA 4KN7C 5E7NA 3QB3A 1LT6D 1IZ6A 5FJ8G 2VB3X 2EYPA 2JYOA 3NBHA 4LFCQ 3AFPA 5EQ0A 2DNCA 4IFDJ 4A75A 3MXUA 2K05A 3HOZH 1ZEQX 4X66Q 1G291 5IYBG 3ONAB 1YNJC 1X65A 3PO3B 4IFDG 1SNMA 4KKSA 4KV6A 4J1MA 2YYZA 5GAHC 1Y8PB 1JE5A 3EROA 2K4KA 3FKIB 4DR3L 1ZKOA 5GAGC 1XMQL 3GTJB 3FRPB 1H9KA 4KJOA 4DV2Q 4C3IH 1SYCA 2N8NA 1J6QA 5E4WC 3CCJA 3I56A 2QGQA 2WKCA 3FKIG 4C2MB 4XXEA 4IQZA 3H94A 1RHPA 2DN8A 1Q90A 2Q2HA 1F9PA 1R9TB 3A5ZB 1XNRL 1Y1VH 2WINB 1YNJD 4H7BA 4B3SL 4IJHA 3E0EA 4K0KQ 1QVFA 1GXDC 1F77A 4BWGB 3S16H 1DXMA 1A62A 2AMCB 1GUGA 4R4CA 1N34L 1ML0D 4B3TQ 4TQUS 3LGJA 5IGDA 3SHLA 4OHJA 4CBVA 1TS5A 4CJ0B 2A68C 3QJYA 4LJZC 3F2UA 1MGSA 1DD2A 4DR1L 3BYYB 3CXCA 1MSGA 1HZCA 1SR3A 4LF7Q 1AFPA 3M7NA 2OTJA 1ICWA 2UXDQ 3MFGA 3CC7A 4A3CH 3GV6A 1M8AA 3N52A 4HJ5A 5HY6A 4LF8Q 2CH4A 2HUGA 2EYJA 3BS1A 2FINB 1STBA 4O42A 4JI8L 5L37A 4K2KA 4Y52H 5I9PA 2JA6B 1UEAB 4A3LG 5EPLA 1GD7A 1FGUA 2R7DA 4E6IA 1HNXQ 4PG3A 5EGTA 1MHWC 2A68D 2NB0A 2RA4A 3I4NB 4L5TA 5IGCA 5IP9G 3NUCA 3HKZB 4DR7Q 4JI7Q 3ZYYX 2JA6G 3DLLA 4C3HB 4HIDA 4WJ3M 4C3JB 4V0BA 3K7AB 2F52A 3JAMc 5C6AA 1N33Q 2UU9L 3P20A 3UDFA 2E5LQ 3G48A 2HT1A 4C56C 3T1YL 3HKZG 4ZUIA 3K5OA 3A56A 2EVBA 2NTTA 2K32A 4C3HG 3PF5A 1K3RA 2F0GA 3HOVB 1VS0A 1J5EQ 2WFWA 2EYLA 1Q3LA 4BA2I 1LTID 4LF5Q 4FXGC 1NMGA 4LF9L 4Q5VA 1DOLA 3U50C 2QEJC 1VQ9A 4ZQ3A 3CCQA 2F0TA 1VQAA 2HDMA 3HG9A 4IUNA 1I4HA 1Q7YC 1IYUA 4APVA 3D4RA 3VR2A 3ICEA 3WWVA 3R2IA 4K14A 2KOLA 1SEBD 3HOXB 3GTOB 1D6EC 1E2WA 2RBMA 3GP7A 1DM0B 4NPSA 1WVLA 3MFYA 3GTQH 1PHJA 4JI0Q 4IZ8A 1D2BA 1CSQA 1WTWA 1B50A 5CC4A 4UAIA 3J80c 1EY0A 4C3IG 4JI3Q 1PTOH 1Y1VB 3C1FA 1SYEA 4JI5L 3DWPA 1TS4A 4JV5Q 3CKIB 1IBKL 1L1OB 4LFBQ 1KIXA 2SDFA 2CW0C 1Y1VG 1H9RA 4JOIA 1F2LA 1HZAA 2FFKB 1HJPA 3HOWH 1PVOA 4DAPA 1Y14B 2B3GA 3AU7A 2E76C 4LF4Q 1KC8C 1BXTA 5KIXA 2LXKA 1JCKB 2IJ0A 4BXXH 2F0KA 1STHA 3VYRA 3VYSA 2B2TA 2D5DA 3NWSA 3MXGA 4DR6Q 2UUBQ 5FOBB 2BDNA 3CP0A 1EQRA 1YITA 1X56A 2NVQH 4A3CG 2CW0D 4Z9CB 3EJIA 5JEAH 3PV0A 3WOFA 3J7A5 2KJXA 4CHTB 3JAMi 1WCMH 1OXSC 1EIYB 1I4QA 1VQKA 1ILPA 2UUCQ 1BUVT 2D0PA 5JVH3 4DV7Q 1KDCA 3K7UC 2SNMA 3I4LA 3F1ZA 4LFAQ 3HFZB 3RMHA 3IFTA 1SAPA 5GADC 4KHPL 4RAUC 1M90C 5J1ZA 2EYFA 2Z6KA 4FDBA 3PUYA 1EU4A 2K03A 4IALA 3S1NH 3F2DA 3S2HH 2EYOA 3CRLC 4MN3A 1X3QA 2JA5H 2MPMA 4O0AA 4YY3L 5LMNQ 2JEBI 3T1HQ 3MTSA 2B63H 1MD2D 4B3MQ 1Z7TA 1G8ZD 3V2TA 2C5CA 3N6RA 5IOCA 1Z9FA 2PQAB 3TZUA 2UUAL 5IGEA 1U4PA 1WTHA 4A3EB 5A2QL 2K1BA 4BA1I 4LF9Q 3J80i 4P72A 2E2IB 3K5LA 1EQQA 3KLSX 1HUNA 3EVQA 1ICFB 4IJLA 3S2DH 3BVMA 2NVXH 2DNEA 4GNXA 3UE1A 1D8LA 5IE8A 2JA9A 4MIUA 1TWFH 3MXNB 4N8X1 3GTGB 3MWYW 4JI1L 3MHBA 1PZKD 1S4ZA 4X3UA 1H9JA 3GD7A 2BH8A 2F4IA 1VMCA 3A8JE 5BN3A 1N36Q 3HS0C 3ITPA 4OELB 4EVOA 3TBIB 3D4DA 3ULLA 3ER0A 5ELBA 2UXBL 2A6ED 2CCZA 2A1AA 4R8NA 1QJOA 1UEBA 1JT8A 4DAVA 4JYAQ 2K33A 5C3EB 3I4MH 3U9SA 3OYYA 5DNFA 1Q81C 1WOCA 4QQBX 2IX0A 2XSCA 1FGBD 5D65A 3PGZA 1SLJA 2IX3A 2RCFA 2NYZD 5FO9B 5DM73 1DOKA 1NNXA 5C3EG 2WP8J 3CAMA 2RVLA 4A3JH 5LMNW 2OXPA 3BG3A 4FF1A 1BCPF 2EJFC 1AZQA 3E5SA 5JEAJ 1Q12A 1RDPD 3DWAA 3V05A 5I2YA 1SJHD 3PO2H 3I8ZA 2VZAA 3VR5A 1BF4A 1MJCA 2CQOA 3R2TA 5JEAG 3MAQA 1WYDA 1L2FA 4JVZA 1HNZQ 1S3OA 5E4XA 4KD3A 3CCRA 2ICEC 1TWHH 4I7AA 1XX8A 1CZGA 1TS2A 3WOEA 4QUCA 2FMCA 4R1JA 4KI0A 1BVSA 2B2YC 5IYCH 4JI6Q 4NMZA 1H95A 3IL8A 3NTHA 2F0HA 3PIOA 1AZPA 4CDFC 1RCVD 4F7XA 4DXFA 1HQRD 1EIFA 1BOSA 3GTPB 4GKJQ 2EDGA 2X6LA 1EEFD 4HMJA 4YWKA 4HIMA 2X69A 2GVAA 2Y0SE 3OW2A 4NKLA 1XTCD 1LV9A 4ME5A 4ZAIA 1PYBA 2CFMA 1XMOL 1UE6A 2Z4IA 5D3IB 3R8BA 1G2SA 5M5XH 1SBBB 2R61A 5GQOA 2GA4B 3VR3A 3KDFB 1UAPA 1BDOA 5FLMH 4ILWA 1TWCH 1VMPA 4DAYA 5LMUL 4A3IB 4BBRH 1XPRA 1ASYA 5FO7B 1I3QH 3HEJA 4DF7A 3RLNA 3NENA 3FVQA 1MKHA 2JA8B 5CGKA 2F0JA 5FJ8H 2I5MX 4I7ZC 2D62A 3NSWA 2WACA 1FNUA 4A3IG 2ALYB 1Q8KA 2PCFB 4LFCL 4OO1I 5JVG3 2HCCA 4CDDC 3ERQA 1QVCA 4ZYSA 3R93A 3A8KE 4DV5Q 4X66L 2RKSA 3K57A 3CPWA 3A5UA 4LW1A 5IYBH 3NHHA 4OIKA 2VS1A 3V96A 4LAAA 3ULJA 1K9MC 3D8GA 4R9WA 4IFDH 1K8GA 1X3GA 3CHBD 1D5MC 3FPPA 5G3LD 3DMUA 2F0NA 5FK9C 1I4GA 3OSOA 3RLFA 3PO3H 2M2LA 1H9SA 3A8IE 3I4OA 4YHHQ 3B6YA 3Q6SA 1HRJA 4A76A 1Y8OB 2XRQD 3FKIH 3D3RA 4YCVA 1O7IA 4OX9Q 3NE5B 4RKLA 1CA5A 4XIGS 3GTJH 2PI2A 1E7ZA 1ONLA 1SXTA 3OW7A 4DU9A 5IY0A 3S9WA 4A3JG 2DUDA 4TSSA 1QUQA 1MSHA 4K0KL 4GKKQ 2E74C 1WTPA 3L3OC 4LWCA 3SK8A 4B3TL 1EZ8A 2EY1A 3KUPA 2PZTA 5CORA 1WTOA 3GTKH 2PI2E 5M3MB 2EIFA 4K6LA 3U4VA 4X65L 3S1RB 1LTGD 1CZWA 1N8RC 3J81L 4JI2Q 1JB3A 1NR2A 3MVVA 2UXDL 2EY5A 3PIO3 1CFMA 1G91A 4YCWA 1I4PA 2L4NA 5FLXL 3U9OA 1HTLD 4LF8L 4KHVA 5M5WB 5JPNC 2N49A 4HMIA 4KLKA 4RHRA 1VQCA 3FPUB 5FKAC 1V1PA 2K75A 3PUXA 3PUVA 1ET6A 5CV4A 4HCEA 4R4IA 2K04A 1B2TA 4DR5Q 2R3ZA 1K3BC 1PZID 5BR8Q 4C1NK 1HNXL 1W2BA 1K0RA 1IXRA 4L63B 1GKHA 3RN2A 2XIWA 5IP9H 1I50B 4DA2A 5C3WA 1VQFA 4DR7L 2F0LA 2YU9H 4J6HA 4JI7L 3RUZA 1JWUD 1NCVA 1O78A 1T9HA 2H5XA 1JWSD 2O2LD 2KHIA 1VQPA 1HFGA 1M4VA 4PMCA 3TSSA 1A3TA 4I65A 1N33L 4B9WA 1I3QB 2E5LL 3I4NH 1OXXK 2RDHA 5HURA 4A3MH 1PTOF 3A7AB 3ND9A 4IUUA 4A93H 1K8MA 4C1NI 4OONA 1Q1BA 1NUCA 2NBFA 3LX0A 4C3JH 3K7AH 1J5EL 4BBRG 4B9XA 3AEVA 2WV6D 5ELCA 1AEXA 3BVZA 2K50A 4CGYB 4V190 5CV8A 4LF5L 5C44B 4NW2A 2SOBA 4KHZA 4EQPA 3LNNA 1VQGA 4L5QA 1JE4A 1AW7A 1XNQQ 3HOVH 3A74A 2RQXA 1YJ9A 4EGVA 4DKAC 4JI4Q 4DV3Q 3URYA 5D3DA 1Q46A 1A15A 4P73A 5C44G 2SNSA 1UUPA 1GO3E 3PMFA 3J80E
chains in the Genus database with same CATH topology
1GUTA 1PRTB 3QO2A 4K5VA 1B53A 2M00A 2Q8IB 2R92B 1VDZA 4H13C 4NDXA 1KDAA 2VB2X 3K5MA 3K59A 4XYOA 3Q24A 1D1IA 4IUPA 1PZJD 1B1ZA 1Y1WB 1EY9A 1LABA 1RODA 5C4XB 2G9HD 1V43A 3GTKB 3CQZB 4TRDA 3M7GA 2SEBD 3QG1A 5C5MA 5AFWA 5KYLA 3DUZA 3DM1A 3W3AA 1CHQD 4ZLTF 4KKTA 1EL0A 3RD4A 4DXGA 4DGZA 3OMGA 1RD9D 4RFBA 2JP1A 2KQ3A 5KEEA 3M4OB 2NTSA 2LKVA 3RZDB 2FHTA 4N9PA 4K5WA 2YU9B 1SE3A 3SK5A 5KYIA 1SE4A 2EYMA 1O7YA 4A3MB 2N88A 1ESRA 1F9SA 4P2CB 4A93B 1WD0A 4FP5D 2RDGA 2HDLA 1RJTA 1K8OA 4OO1H 2F0DA 3H0GB 1YNNC 2X6GA 4BY1B 4C3JG 1DCZA 1STNA 5EKKA 2I46A 1STGA 2A74C 1ENAA 1SDFA 1JQYD 1GHJA 4ZUJA 4CKBA 3QOLA 2RSNA 5C0XJ 1YNND 1GHKA 3HRZC 4X3SA 5C0XG 1WTXA 1PLFA 4FF3A 3KBXA 4Q0FA 3DXJC 2B39A 5I9OA 1U4LA 5I6YA 1STAA 1WTVA 3SDZA 4QUFA 5I4DA 4M8AA 1Y8NB 1JOOA 2XNAC 1Z6HA 5ELFA 1PFBA 1EY6A 3T51B 3IKJA 3I72A 4QCLA 4KJNA 2B2WA 3TZDA 3DEPA 3S1MB 2B8GA 5CBAE 1DZ1A 4CKEA 3PIP3 1PXUA 3T53B 3QOJA 4DNTB 2PO4A 5DAUA 1F2YA 2OEOA 4FNFA 3W2DA 1ZYRC 2ZXPA 4Y7NB 3IAYA 2KEEA 3K0YA 5EPJA 4CJ1B 2BOSA 2TSSA 4U673 5JPMC 1PYWD 1G6ZA 1FNVA 3H91A 4OO1G 3MA2B 3EA6A 1NR4A 3NQIA 3X3NA 4UDUC 2JA7B 1TWGB 4ULLA 4JK1C 4GZYC 1JR0D 1TWAB 1ZYRD 2IL8A 3BDLA 3T56B 5FO8B 2K5DA 3GQBA 2JSOA 4YIJA 1EOTA 3GO5A 4KN4C 4BY7B 1L0YB 1C8CA 1JC7A 5CV7A 3E6ZX 5C4JB 5EKIA 2ID0A 3BDCA 4PNYA 2Z1CA 4LMQD 2QDBA 1QE6A 4HSPA 1IHZA 2F03A 2K7VA 1PRTC 4CKCA 3C1EA 4OIJA 3HP3A 1BR9A 3KBGA 3KF8A 4XQNA 4S3SA 5F2DA 1CK1A 2A69C 2O5JC 2WB1B 1L0XB 1DYQA 2E2HB 2EY2A 5C0XI 2NVTB 2F0IA 2Z4HA 4RH6A 5D14A 1F2ZA 4KK7A 4IUTA 2A73B 1PRTD 3UI2A 4A3KB 1W6JA 1KNEA 3D31A 3OWEB 4QB4A 4EQOA 3P1HA 1QNKA 2A69D 2G9DA 2K01A 1D5XC 1TQOA 2XWJB 4H0LC 3H09A 3S15B 4G57A 2B2UA 2J7ZA 5CBEE 4PMWA 1DJRD 3HOUB 1WTRA 3MC0B 1XWEA 1C48A 1OXUA 5A2QE 1RTOA 4J8QA 1NSNS 1I6HB 2E2DC 4XYQA 1CQFA 4JBWA 1BCPC 5CV6A 4ZK9B 3LWEA 2B8FA 4TKOB 1SMYC 3G7LA 2VNUD 1O7ZA 4FF4A 5LL6X 5KNCA 2JXMB 3CRKC 1II3A 2HQEA 3DWQA 4WORA 1S5ED 3C2PA 1CA6A 1LT3D 4XT3B 4RGMA 2B2VA 2MHVA 1BCPD 4FYDA 5CMDA 2LY7A 1GOZA 1D1KA 2Z8LA 1PMRA 1OXVA 2K5QA 3A55A 5CR3A 5ELDA 2PW5A 3EQLC 3NWTA 4RKBA 5J39A 1TT2A 1TVXA 2NZ1D 1BQQT 4XDXA 5DM63 5EKLA 3H3VC 1B44D 1RKNA 2N55A 3DEOA 2F0QA 1VF7A 5EPKA 1QWYA 2L9HA 1LACA 1OO9B 1E2VA 5KNBA 1A3VA 1UNSA 5K36G 5KRUA 1CT1D 2FMMA 4ODGA 3FDTA 4ABNA 3NXWA 3J7YW 1VCIA 3S17B 4IURA 4KY7A 2K28A 3SXHA 4BBSB 1SYGA 1R4PB 2PYKA 1JWMD 3IFDA 1ILQA 4F87A 1IL8A 4A3DB 1SYBA 1B4OA 5CV9A 4AYBB 1LT5D 4F8MA 1E2ZA 1D5ZC 3I70A 2Y0SB 4M1UB 2F0WA 1SNPA 3VR4A 2NVYB 1SNOA 4IUQA 4KY5A 1SSOA 5EBCA 3Q22A 5I6WA 5E1FA 3I91A 4FO2A 5T1IA 1FD7D 3PUZA 4WFN3 1VF5C 2HCIA 2VUMB 1SFOB 4K5XA 1XYIA 1W6KA 2ZXOA 5C4ZA 1K83B 2KCNA 2IPKD 3GV3A 3SEBA 3NPPA 5JJZA 2R93B 4A3GB 1LO5D 1LTTD 2F0OA 1TIID 3H6MA 4HN7A 3TDQA 1S5FD 2KHSA 4K8JA 4K8IA 4RGOS 4WJWA 3J7AF 5C0XH 3TMEA 2WIIB 2F1MA 3GTMB 3QIAA 2NUCA 1SYDA 1LTRD 1HXYD 3OHXC 5T1GA 1PTOC 2E2JB 1H9SB 1KLUD 1T5XD 1HCZA 3TP7A 2NN6I 3Q23A 1HTPA 2QF7A 1SYFA 2QCPX 4G7ZC 1FYCA 1IW7C 4L8JA 3Q0AA 3J81E 4FXKC 2K5WA 2PW7A 2F3VA 5FLXE 2J0TD 3L9AX 3VYTA 2D2CC 2XN9C 5ELEA 1PTOD 1E0BA 3BDOA 3K6OA 2B2TC 1HA5A 2EJMA 1EWCA 2A5HA 2OF1A 1KAAA 1IW7D 2L11A 2OT2A 2O4XA 2B2WC 4IN3A 3LWUA 1LTBD 3GTLB 2F0EA 2L1BA 4RCOA 1NAPA 1EYCA 1GUSA 4HEDA 2KCCA 3VR6A 1V1PB 5LHY1 5DEHA 2EJGC 1CQVA 1QILA 4DNRB 1A2UA 1DOMA 1BCPB 1XXGA 2XRSD 1EY7A 2M9VA 3BYTB 3A7LA 1EYAA 3T13A 1TKWB 1WD1A 4DFAA 5IT9L 4LK1C 1AP0A 4KKUA 1ENCA 4ID6A 2FJ2A 3L7ZC 4ZRZA 3M3YB 1H9MA 3DHQA 4KMUC 1J9OA 2ENBA 2H1EA 3SR1A 3BZDB 1HQMC 3NTKA 2KVMA 3S1QB 5EJWA 2AQ2B 3HOZB 4XTCS 4R8IA 2VXWA 1J8IA 1GJXA 2LMCB 4IUVA 3MXNA 2ZT9C 4PV1C 1RF2D 3A54A 1LLRD 1R4QB 1BBXC 1F2MA 2F0MA 1TY0A 1X32A 5M9OA 4C3IB 2L0CA 1LTSD 4EQNA 1B9MA 1S5DD 4CJ2C 2KA7A 2EY6A 2CQAA 2K6AA 2DY8A 3TN2A 2AUJD 3EFXD 3P75A 4B08A 1U4RA 4X3KA 5E3FA 1O7LA 2BDOA 3M85A 4RGTA 3S16B 3OOCA 1TY2A 3R3OA 1EQTA 3NTIA 1EEID 1SNQA 2PPBC 4OGQC 5NUCA 3I73A 1JOKA 5IGFA 5HGTA 4IFDI 4HCSA 3E0JA 3OWFA 1S5CD 5IGGA 2IWHA 3X3MA 3CU7A 1PFNA 1A3UA 1T5EA 2PZUA 1U9RA 2E75C 4FXDA 3QWNA 1I6VC 1SE2A 1EWHA 5IGBA 4HR7B 2O5IC 2KECA 2PZWA 4DN4M 5IT9E 5C3XA 2B2UC 2ZXRA 1CM9A 2LS01 4A3FB 5J22A 5CV5A 1EY4A 1KDBA 1OXTA 5A35A 1HUMA 3TP8A 1HPCA 3SK4A 1QCBD 2F0UA 1V1OA 2AQ3B 1TU2B 1IKMA 4WRDA 1Y69U 1PRTF 2F0PA 1PFMA 1FNWA 5JAVA 1F9RA 2F0VA 1STEA 2EYHA 1F9QA 3T16A 1GUOA 3SE0A 3D6CA 1A2TA 1CTMA 2IT1A 1Q1EA 3J7AV 1QB5D 2NN6H 4QF4A 2A6EC 3ND8A 4X3TA 1B3AA 3AB9A 1ENFA 4G7OC 3GTQB 4A3BB 2B2VC 2EXZA 2QKIC 3KLRA 4RHSA 1X3PA 2C9OA 3MXPA 1WTQA 1PTOB 5TSSA 3FEWX 3OIQA 1MI2A 1QOHA 1JICA 4KD4A 1LTAD 2CHBD 1PDQA 3P7JA 3VYUA 1STYA 3TP5A 2L5TA 5EBDA 1KNAA 3HOWB 1GUNA 3TP6A 2WAQB 1EFID 2LFNA 4NP5A 1C4QA 5K36H 5COYA 2Q8RE 2BCOA 1KLGD 1JORA 3C3LA 1TR5A 2QILA 3SK6A 1KABA 2PQEA 2KEDA 2BA1A 5IODA 2L55A 2NVQB 1QNUA 1ESFA 4ZKBB 2BA0A 2I07B 3SVMA 3HZXA 1WCMB 4RWSC 4U68A 1SNCA 3OPOA 4H44C 5G3LF 2XVSA 3HGBA 1HA6A 1EU3A 4N9TA 3NP8A 2ICIA 1SJED 1HFNA 3T4AC 2V4DA 2Q8TA 5LL6S 4QIWB 2IX1A 3S1NB 3S2HB 4G7HC 3FMCA 2EOTA 4DK0A 2JA5B 1S5BD 3MZ5A 2MUYA 2MP1A 3NQTA 2B63B 2MJ8A 1TS3A 2TMPA 3K58A 3I90A 4O1NA 2BE5C 4BS9A 1I4XA 4K2LA 2L12A 4FF2A 3JAML 3OMCA 5IIFA 3S2DB 2NVXB 1DONA 1B9NA 1EY8A 1Q8IA 5JOBA 2NN6G 1TWFB 1EIGA 1HHVA 2NWGA 3O13A 2WKDA 2AQ1B 4DK1A 1SMYD 2BE5D 2H4OA 2MGSA 4PQXA 3I3CA 4F88A 2R6GA 4PMBA 5KNDA 1IYVA 5M3FB 4G4KA 4L6TB 3OIPA 1LT4D 3I4MB 1JOQA 1EY5A 1CI3M 2EPBA 1BO0A 1V8QA 2RDFA 2R7ZB 3C46A 2PMZB 3NK9A 4HAEA 3D6WA 1EIHA 5C5LA 3J80L 4A3JB 4QMGA 1A6XA 4HTHA 2EZVA 1QG7A 3G6JB 4RA8A 1MBYA 5CYUA 3KK7A 4KTAA 1RTNA 5M5YB 3PO2B 2XWBB 3VA7A 1SNDA 1U4MA 1Z47A 2AUKA 5KGUA 2AWNA 3D4WA 2F0SA 4HSVA 3AMUA 1TWHB 3BVGA 4XT1B 5BN5A 3HOYB 3K5NA 2JE6I 1KTKA 2B2YA 2A6HC 1IKLA 1I4RA 1FR3A 1O80A 3VA5A 3WDNA 2AWOA 4ZKCB 4K6DA 2DY7A 4RCNA 3MEHA 5I2XA 4XQQA 5K5PA 2J4XA 3NBIA 1AN8A 2RSOA 1EYDA 4XQJA 1GUWA 5C4HA 1ET9A 4FVMA 2JEAI 3JAME 2F3WA 1EZ6A 5M5XB 1BNZA 3M4YA 5BN4A 1G2TA 2A6HD 1CHPD 2IW3A 1EQVA 2CVRA 1TWCB 2KUMA 1ZXTA 4BBRB 3PUWA 3KLSA 4KY6A 2EE1A 2PNRC 3RZOB 2F0FA 4OL7A 4MHEA 4RGNA 2D9UA 5ISRA 4KN7C 3QB3A 1LT6D 2VB3X 2EYPA 2JYOA 3NBHA 5EQ0A 2DNCA 4IFDJ 3MXUA 2K05A 1ZEQX 1G291 3ONAB 1YNJC 3PO3B 4IFDG 1SNMA 4KKSA 4KV6A 4J1MA 2YYZA 1Y8PB 3EROA 3FKIB 1ZKOA 3GTJB 3FRPB 1H9KA 4KJOA 1SYCA 5E4WC 2WKCA 4C2MB 4XXEA 4IQZA 3H94A 1RHPA 2DN8A 1Q90A 1F9PA 1R9TB 2WINB 1YNJD 4H7BA 1GXDC 1F77A 4BWGB 1DXMA 1GUGA 1ML0D 4TQUS 5IGDA 3SHLA 4OHJA 4CBVA 1TS5A 4CJ0B 2A68C 3QJYA 4LJZC 3F2UA 1MGSA 1DD2A 3BYYB 1MSGA 1AFPA 3M7NA 1ICWA 3MFGA 3GV6A 1M8AA 3N52A 2HUGA 2EYJA 3BS1A 2FINB 1STBA 4O42A 4K2KA 5I9PA 2JA6B 1UEAB 5EPLA 4E6IA 5EGTA 2A68D 2NB0A 2RA4A 3I4NB 5IGCA 3NUCA 3HKZB 3ZYYX 4C3HB 4C3JB 4V0BA 3K7AB 5C6AA 3P20A 4C56C 4ZUIA 3K5OA 3A56A 2EVBA 2NTTA 2K32A 4C3HG 2F0GA 3HOVB 2EYLA 1Q3LA 4BA2I 1LTID 4FXGC 4Q5VA 1DOLA 2QEJC 4ZQ3A 2F0TA 2HDMA 3HG9A 4IUNA 1I4HA 1IYUA 3D4RA 3VR2A 3R2IA 4K14A 2KOLA 1SEBD 3HOXB 3GTOB 1D6EC 1E2WA 2RBMA 3GP7A 1DM0B 1WVLA 3MFYA 4IZ8A 1D2BA 1WTWA 1B50A 5CC4A 4UAIA 1EY0A 4C3IG 1PTOH 1Y1VB 3C1FA 1SYEA 3DWPA 1TS4A 3CKIB 2SDFA 2CW0C 1H9RA 1F2LA 2FFKB 4DAPA 3AU7A 2E76C 1BXTA 5KIXA 1JCKB 2IJ0A 2F0KA 1STHA 3VYRA 3VYSA 2B2TA 2D5DA 3NWSA 3MXGA 5FOBB 2BDNA 2CW0D 4Z9CB 3EJIA 5JEAH 3PV0A 3WOFA 2KJXA 4CHTB 1OXSC 1I4QA 1ILPA 1BUVT 5JVH3 1KDCA 2SNMA 3I4LA 3RMHA 3IFTA 1SAPA 4RAUC 5J1ZA 2EYFA 3PUYA 1EU4A 2K03A 4IALA 2EYOA 3CRLC 4MN3A 1X3QA 2MPMA 2JEBI 3MTSA 1MD2D 1Z7TA 1G8ZD 3V2TA 2C5CA 3N6RA 5IOCA 3TZUA 5IGEA 1U4PA 4A3EB 5A2QL 2K1BA 4BA1I 2E2IB 3K5LA 3KLSX 1HUNA 3EVQA 3BVMA 2DNEA 4MIUA 3GTGB 3MWYW 3MHBA 1PZKD 1S4ZA 4X3UA 1H9JA 3GD7A 2F4IA 1VMCA 3A8JE 5BN3A 3HS0C 3ITPA 4EVOA 3TBIB 3D4DA 5ELBA 2A6ED 4R8NA 1QJOA 4DAVA 2K33A 5C3EB 3U9SA 5DNFA 2IX0A 2XSCA 1FGBD 5D65A 2IX3A 2NYZD 5FO9B 5DM73 1DOKA 2WP8J 2RVLA 2OXPA 3BG3A 4FF1A 1BCPF 2EJFC 1AZQA 3E5SA 5JEAJ 1Q12A 1RDPD 3DWAA 3V05A 5I2YA 1SJHD 3I8ZA 3VR5A 1BF4A 3R2TA 5JEAG 3MAQA 5E4XA 4KD3A 2ICEC 1XX8A 1CZGA 1TS2A 3WOEA 4QUCA 2FMCA 4KI0A 2B2YC 4NMZA 3IL8A 3NTHA 2F0HA 1AZPA 1RCVD 4F7XA 4DXFA 1HQRD 1BOSA 3GTPB 2EDGA 2X6LA 1EEFD 4HMJA 2X69A 4NKLA 1XTCD 1LV9A 4ME5A 4ZAIA 2Z4IA 5D3IB 3R8BA 1G2SA 1SBBB 2R61A 2GA4B 3VR3A 1UAPA 1BDOA 4ILWA 1VMPA 4DAYA 4A3IB 5FO7B 3HEJA 4DF7A 3FVQA 2JA8B 5CGKA 2F0JA 4I7ZC 2D62A 3NSWA 2WACA 1FNUA 2PCFB 4OO1I 5JVG3 2HCCA 3ERQA 4ZYSA 3R93A 3A8KE 2RKSA 3K57A 3NHHA 4OIKA 3V96A 4LAAA 4IFDH 3D8GA 4R9WA 3CHBD 1D5MC 3FPPA 5G3LD 3DMUA 2F0NA 5FK9C 1I4GA 3OSOA 3RLFA 2M2LA 1H9SA 3A8IE 3Q6SA 1HRJA 1Y8OB 2XRQD 3D3RA 3NE5B 4RKLA 1CA5A 4XIGS 1ONLA 1SXTA 3OW7A 4DU9A 3S9WA 4TSSA 1MSHA 2E74C 1WTPA 3L3OC 3SK8A 1EZ8A 2EY1A 3KUPA 2PZTA 5CORA 1WTOA 5M3MB 4K6LA 3S1RB 1LTGD 1CZWA 3J81L 1JB3A 1NR2A 3MVVA 2EY5A 3PIO3 1CFMA 1G91A 1I4PA 2L4NA 5FLXL 3U9OA 1HTLD 4KHVA 5M5WB 5JPNC 4HMIA 4RHRA 3FPUB 5FKAC 1V1PA 3PUXA 3PUVA 1ET6A 5CV4A 4HCEA 2K04A 1B2TA 2R3ZA 1PZID 4C1NK 4L63B 2XIWA 1I50B 4DA2A 5C3WA 2F0LA 4J6HA 3RUZA 1JWUD 1NCVA 1O78A 1JWSD 2O2LD 3S14B 1HFGA 1M4VA 4PMCA 3TSSA 1A3TA 4I65A 4B9WA 1I3QB 1OXXK 2RDHA 5HURA 1PTOF 3A7AB 3ND9A 4IUUA 1K8MA 4C1NI 1Q1BA 1NUCA 2NBFA 3LX0A 4B9XA 2WV6D 5ELCA 1AEXA 3BVZA 4V190 4CGYB 5CV8A 5C44B 4NW2A 2SOBA 4KHZA 4EQPA 3LNNA 1JE4A 1AW7A 2RQXA 4EGVA 3URYA 5D3DA 1A15A 2SNSA 1UUPA 3PMFA 3J80E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXZ A;  4DU9 A;  3S9W A;  3VA5 A;  2F0I A;  5DAU A;  4K5X A;  1SNQ A;  4K14 A;  3MXP A;  5CR3 A;  1F2Z A;  1F2Y A;  1JOK A;  2OEO A;  2RBM A;  4H7B A;  5NUC A;  4K6D A;  4K2L A;  4K5V A;  5DEH A;  3V2T A;  5C4Z A;  5IGF A;  5IOC A;  3MEH A;  2M00 A;  2PW5 A;  4NMZ A;  1STN A;  5K5P A;  4RKB A;  3SK8 A;  5IGE A;  5HGT A;  4IZ8 A;  1EZ8 A;  3OMC A;  2EY1 A;  5EKK A;  5IIF A;  2PZT A;  5J39 A;  1TT2 A;  2F0H A;  4KD4 A;  1A2U A;  4QB4 A;  4NDX A;  1STG A;  1EYD A;  3OWF A;  1ENA A;  3P1H A;  4EQO A;  1KDA A;  5CC4 A;  1EY8 A;  5IGD A;  3SHL A;  1EY0 A;  5C4H A;  5JOB A;  3C1F A;  1SYE A;  5EKL A;  4F7X A;  1EY7 A;  3EVQ A;  2F0O A;  5IGG A;  1STY A;  3H6M A;  1RKN A;  3TP5 A;  1EY9 A;  4ZUJ A;  2F3W A;  1A3U A;  4HMJ A;  2F0Q A;  2PZU A;  1EZ6 A;  1U9R A;  3QOL A;  3TP6 A;  3MVV A;  1EYA A;  2KHS A;  4K8J A;  3T13 A;  2EY5 A;  4K8I A;  4NKL A;  1TQO A;  1EQV A;  4MIU A;  4DFA A;  4ME5 A;  4NP5 A;  4TRD A;  3U9O A;  3MHB A;  4KHV A;  1A3V A;  4G57 A;  1JOR A;  1ENC A;  4HMI A;  4ID6 A;  5KRU A;  5IGB A;  3TME A;  1TR5 A;  4PMB A;  5C5M A;  2EYJ A;  5KYL A;  2PZW A;  4KY6 A;  3BDL A;  3DHQ A;  3SK6 A;  4ODG A;  1STB A;  1KAB A;  5C3X A;  5CV4 A;  3NXW A;  2F0F A;  5KIX A;  2NUC A;  3ITP A;  1SYD A;  1JOQ A;  4K2K A;  2ENB A;  2PQE A;  4OL7 A;  4EVO A;  1EY5 A;  5I9P A;  2F0K A;  5J22 A;  1STH A;  3D4D A;  5IOD A;  5CV5 A;  3SR1 A;  3HEJ A;  4DF7 A;  4KY7 A;  1EY4 A;  1KDB A;  4YIJ A;  4E6I A;  5I9O A;  4R8N A;  2RDF A;  5I6Y A;  3SXH A;  5ISR A;  4DGZ A;  5EGT A;  5C3W A;  1STA A;  1NSN S;  1SYG A;  2F0J A;  2F0L A;  3HZX A;  3OMG A;  3TP7 A;  4J6H A;  5CGK A;  5IGC A;  3QB3 A;  2KQ3 A;  3NUC A;  3RUZ A;  3TP8 A;  3NK9 A;  3SK4 A;  1SYF A;  2F0U A;  2WAC A;  1SNC A;  5KEE A;  2EYP A;  2LKV A;  2PYK A;  5CV6 A;  5C5L A;  5CV7 A;  3EJI A;  3ERQ A;  4QMG A;  4HTH A;  4N9P A;  4PMC A;  1A3T A;  4I65 A;  4WRD A;  4B9W A;  3BDC A;  4PNY A;  1JOO A;  4K5W A;  5C6A A;  2F0P A;  1SYB A;  2PW7 A;  2F3V A;  2RKS A;  5CV9 A;  5HUR A;  4N9T A;  3NP8 A;  3NHH A;  2QDB A;  5JAV A;  4LAA A;  4KTA A;  1F2M A;  1IHZ A;  3D8G A;  2F0M A;  4ZUI A;  4F8M A;  1NUC A;  1KDC A;  3SK5 A;  2SNM A;  2OXP A;  1EY6 A;  1SNM A;  2F0V A;  3LX0 A;  4KV6 A;  4J1M A;  5KYI A;  5M9O A;  4B9X A;  2F0G A;  2EYH A;  1SND A;  1AEX A;  1II3 A;  4EQN A;  3C1E A;  4KJN A;  3ERO A;  2EYM A;  2HQE A;  2F0W A;  3T16 A;  1SNP A;  5KGU A;  3DMU A;  2F0N A;  5CV8 A;  2EYL A;  3D6C A;  2EYF A;  1A2T A;  3D4W A;  3E5S A;  2F0S A;  3OSO A;  2EY6 A;  5J1Z A;  4WOR A;  2SOB A;  1SNO A;  4KY5 A;  4S3S A;  4EQP A;  5F2D A;  3MZ5 A;  3P75 A;  4KJO A;  2OF1 A;  4IAL A;  1SYC A;  3NQT A;  5E3F A;  1KAA A;  2EYO A;  4QF4 A;  2O4X A;  5I6W A;  4RKL A;  5E1F A;  4ZQ3 A;  2F0T A;  2EY2 A;  2F0E A;  2SNS A;  3QOJ A;  4KD3 A;  2F0D A;  4IUN A;  3PMF A;  1EYC A;  3R3O A; 
#chains in the Genus database with same CATH topology
 1EFW A;  1GUT A;  1PRT B;  3QO2 A;  4K5V A;  4JI0 L;  1B53 A;  3GDE A;  2M00 A;  2Q8I B;  2R92 B;  1VDZ A;  3CCM A;  3PO3 G;  4H13 C;  4NDX A;  4JI3 L;  3S14 B;  3HOX H;  1KDA A;  3GTO H;  2VB2 X;  4GS3 A;  3K5M A;  3K59 A;  4XYO A;  3NEL A;  3Q24 A;  4JV5 L;  1D1I A;  3DM3 A;  4IUP A;  4LFB L;  1PZJ D;  1B1Z A;  1Y1W B;  1EY9 A;  1LAB A;  2R92 G;  4JPB W;  1ROD A;  5C4X B;  4OWW B;  2G9H D;  1V43 A;  1EYG A;  3GTK B;  3CQZ B;  4P74 A;  4TRD A;  3M7G A;  4JBM A;  2SEB D;  3QG1 A;  5C5M A;  5AFW A;  4LF4 L;  5C4X G;  5KYL A;  3DUZ A;  3DM1 A;  3W3A A;  1LUZ A;  4IOC A;  1CHQ D;  4ZLT F;  4KKT A;  1EL0 A;  3RD4 A;  2F3I A;  2F4V Q;  3UDG A;  4DR6 L;  2UUB L;  4DXG A;  3M4P A;  4X65 Q;  4DGZ A;  2HD3 A;  2ZTC A;  2OTL A;  3OMG A;  4POF A;  1RD9 D;  4RFB A;  2JP1 A;  4DUZ Q;  2KQ3 A;  2V1C C;  5KEE A;  3M4O B;  2NTS A;  1NE3 A;  2LKV A;  3RZD B;  2FHT A;  1PH1 A;  4N9P A;  2ZM6 Q;  2YTX A;  4K5W A;  3U4Z A;  2UUC L;  4DV7 L;  3CCV A;  2YU9 B;  3KLW A;  1SE3 A;  5JJI A;  2MQH A;  4LFA L;  3SK5 A;  4P71 A;  5KYI A;  2YTY A;  3PIP A;  1SE4 A;  2EYM A;  1O7Y A;  2A8V A;  4HIO A;  4A3M B;  2N88 A;  1ESR A;  1VQB A;  1CUK A;  1SMX A;  1F9S A;  4P2C B;  4A93 B;  1WD0 A;  4FP5 D;  2RDG A;  2HDL A;  5IP7 H;  1RJT A;  5LMN L;  1K8O A;  2Z6K C;  1CKO A;  3I4N G;  1XJV A;  4OO1 H;  3CCE A;  4A3M G;  3T1H L;  2F0D A;  3H0G B;  4A93 G;  1YNN C;  1YEZ A;  2X6G A;  3BZK A;  4OWT B;  4IOA A;  1YHA A;  4BY1 B;  4B3M L;  3KF6 A;  4C3J G;  1DCZ A;  1YHB A;  1STN A;  5HGQ A;  3K0X A;  5EKK A;  2I46 A;  1STG A;  4BY1 G;  2L15 A;  2A74 C;  1ENA A;  3E9H A;  1S40 A;  3HOV G;  2CWP A;  1SDF A;  1JQY D;  1GHJ A;  2I5H A;  4A3E H;  4ZUJ A;  4CKB A;  3QOL A;  3KJO A;  2RSN A;  5C0X J;  2E2I H;  3NBH B;  1YNN D;  2LSS A;  1EUJ A;  1KXL A;  5IWA Q;  1GHK A;  3HRZ C;  4X3S A;  4GNX C;  5C0X G;  1X3F A;  1WTX A;  1N36 L;  4DK3 C;  1PLF A;  1UE7 A;  4FF3 A;  1UWV A;  4ZCK A;  3GTG H;  3K80 C;  3KBX A;  3HOX G;  4Q0F A;  3DXJ C;  2ES2 A;  2B39 A;  5I9O A;  4JYA L;  1U4L A;  5I6Y A;  1PH8 A;  1STA A;  1WTV A;  4DNI A;  4OXP A;  1P8L A;  3SDZ A;  4QUF A;  5I4D A;  1HH2 P;  5H1S E;  4M8A A;  3BU2 A;  1Y8N B;  2UXC Q;  1JOO A;  2XNA C;  5C3E H;  2WB1 E;  1AH9 A;  1Z6H A;  5ELF A;  3CC4 A;  1PFB A;  3TRZ A;  4QY7 A;  1EY6 A;  3T51 B;  2K14 A;  3IKJ A;  3I72 A;  3J81 c;  4LNQ A;  2E2H H;  1NJI C;  4KJN A;  4QCL A;  1AE3 A;  2B2W A;  3TZD A;  1KL9 A;  3DEP A;  3S1M B;  2A19 A;  2NVT H;  3TEH B;  2B8G A;  5CBA E;  1HNZ L;  1G51 A;  1DZ1 A;  1K73 C;  3KYH C;  4CKE A;  3PIP 3;  1PXU A;  3T53 B;  3QOJ A;  4DNT B;  5DLQ E;  2HHH Q;  1XPO A;  2VW9 A;  2PO4 A;  5DAU A;  4JI6 L;  1F2Y A;  2OEO A;  4FNF A;  3W2D A;  1ZYR C;  4R4O A;  1IBM Q;  2ZXP A;  4Y7N B;  3IAY A;  2KEE A;  2OQ0 A;  3K0Y A;  5EPJ A;  4CJ1 B;  2BOS A;  2TSS A;  4U67 3;  5JPM C;  5IP7 G;  1PYW D;  4GKJ L;  1G6Z A;  1FNV A;  3H91 A;  4OO1 G;  3MA2 B;  4PZ6 A;  3EA6 A;  1NR4 A;  3NQI A;  3X3N A;  4UDU C;  2JA7 B;  2P5Z X;  3GTP H;  1TWG B;  4ULL A;  1BKB A;  4JK1 C;  1UE1 A;  4GZY C;  1JR0 D;  1HNW L;  1TWA B;  1ZYR D;  2IL8 A;  3BDL A;  1WI5 A;  3T56 B;  5FO8 B;  2K5D A;  1IL2 A;  3GQB A;  4J15 A;  1HZ9 A;  4DR4 Q;  3M4Q A;  2JSO A;  4YIJ A;  5GRO A;  1EOT A;  4A3E G;  3GO5 A;  4KN4 C;  4A3I H;  4BY7 B;  2Q2U A;  4AH6 A;  1L0Y B;  1C8C A;  1JC7 A;  5CV7 A;  3E6Z X;  5C4J B;  4DV5 L;  2JA8 H;  3CPF A;  5EKI A;  2ID0 A;  3BDC A;  4PNY A;  1SN8 A;  2XTI A;  4DV6 Q;  3JC6 6;  2Z1C A;  4LMQ D;  2QDB A;  4BY7 G;  2VQF Q;  1YNX A;  1LM0 A;  1QE6 A;  4HSP A;  3G4S A;  1IHZ A;  1YHQ A;  2F03 A;  2K7V A;  4DV0 Q;  1PRT C;  2D0O A;  4CKC A;  1YI2 A;  1L0W A;  3C1E A;  4OIJ A;  3J81 i;  4ME3 A;  3HP3 A;  1BR9 A;  3KBG A;  3KF8 A;  4XQN A;  4S3S A;  4YHH L;  4JG2 A;  5F2D A;  1CK1 A;  2A69 C;  4OX9 L;  2O5J C;  2WB1 B;  1L0X B;  1DYQ A;  1UE5 A;  2E2H B;  1DGS A;  2EY2 A;  4A4I A;  4X64 L;  2OWO A;  1X9N A;  5J3B A;  5C0X I;  4GKK L;  2NVT B;  2F0I A;  2Z4H A;  4RH6 A;  5D14 A;  1F2Z A;  4L5S A;  4KK7 A;  4IUT A;  2A73 B;  2PMZ E;  1PRT D;  3UI2 A;  3CCU A;  1RL2 A;  4A3K B;  4MTN A;  1W6J A;  4LUZ A;  1KNE A;  3D31 A;  3OWE B;  4QB4 A;  3J81 j;  4X6A H;  4EQO A;  3P1H A;  2YV5 A;  1VQ6 A;  1QNK A;  4AQY Q;  2A69 D;  2G9D A;  4A3K G;  4JI2 L;  4O2D A;  2K01 A;  3RN5 A;  5M3M H;  1D5X C;  3H3V I;  1VQO A;  3UE0 A;  1TQO A;  2XWJ B;  4H0L C;  3H09 A;  1G6P A;  3S17 H;  4QGU A;  3S15 B;  3S1R H;  4G57 A;  2B2U A;  2J7Z A;  1B7Y B;  5CBE E;  4PMW A;  2IY5 B;  4LUV A;  1DJR D;  2N78 A;  3HOU B;  4DR5 L;  2ZJQ A;  1WTR A;  5M5W H;  5BR8 L;  3MC0 B;  4AYB E;  4TVA B;  4JCV E;  1XWE A;  1CSP A;  2DJF C;  1NY4 A;  3U58 A;  1OXU A;  1C48 A;  5A2Q E;  4A3D H;  1RTO A;  5ELN A;  4J8Q A;  1NSN S;  3HOU G;  3TS0 A;  1I6H B;  2E2D C;  4XYQ A;  1CQF A;  3F2B A;  3CCS A;  4JBW A;  1BCP C;  5CV6 A;  4ZK9 B;  1CKN A;  3LWE A;  1I50 H;  2B8F A;  2Z0S A;  3W5O A;  1V1Q A;  2EQS A;  2NVY H;  1HNW Q;  4TKO B;  1SMY C;  3PSI A;  3G7L A;  3ULP A;  1S72 A;  2VNU D;  4GN4 B;  1O7Z A;  4FF4 A;  5LL6 X;  3S14 H;  5KNC A;  2DJG C;  2JXM B;  3CRK C;  1II3 A;  1BBW A;  1LYL A;  2HQE A;  3K81 C;  3DWQ A;  4WOR A;  1S5E D;  3C2P A;  1XNQ L;  1CA6 A;  1LT3 D;  1P16 A;  4XT3 B;  4JI4 L;  4DV3 L;  4RGM A;  4NXM Q;  2B2V A;  2MHV A;  4POG A;  1BCP D;  1VQ4 A;  3W1B A;  5C44 H;  2JA8 G;  4DUY Q;  4GNX B;  4FYD A;  2VY3 A;  5CMD A;  2K5H A;  2ATW A;  2LY7 A;  4EQ5 A;  1GOZ A;  1D1K A;  2Z8L A;  1PMR A;  1OXV A;  2K5Q A;  2R93 H;  4A3G H;  3A55 A;  5CR3 A;  5ELD A;  5IYD H;  2PW5 A;  3EQL C;  3NWT A;  2EXD A;  2JK8 A;  4RKB A;  1B3Q A;  5J39 A;  1KRS A;  1TT2 A;  4DR2 Q;  4RG1 A;  1VQ8 A;  1TVX A;  2NZ1 D;  2VL6 A;  1BQQ T;  4XDX A;  3H15 A;  1I94 Q;  1VQJ A;  3Q8D A;  5DM6 3;  5EKL A;  3H3V C;  1B44 D;  1RKN A;  2N55 A;  2R92 H;  3DEO A;  2JJQ A;  3FP9 A;  4UPA A;  2RHS B;  4X64 Q;  2F0Q A;  1VF7 A;  5EPK A;  1QWY A;  2L9H A;  3IRB A;  1SE8 A;  1LAC A;  3RLO A;  1OO9 B;  2HIX A;  5JJK A;  1E2V A;  5KNB A;  1A3V A;  1UNS A;  1Y1W H;  5K36 G;  1YBY A;  1E24 A;  5KRU A;  5C4X H;  4IPC A;  1CT1 D;  2KHJ A;  2FMM A;  4ODG A;  3CQZ H;  3FDT A;  2F4V L;  4ABN A;  2B29 A;  3NXW A;  2E8G A;  3CD6 A;  1PH7 A;  3J7Y W;  1VCI A;  3S17 B;  4IUR A;  4IPG A;  4KY7 A;  2K28 A;  3SXH A;  2YTV A;  4DUZ L;  2G5D A;  4BBS B;  1SYG A;  5M3M G;  2C35 B;  1R4P B;  2NZH A;  1YIJ A;  2PYK A;  2ZM6 L;  1JWM D;  3IFD A;  2QEX A;  1ILQ A;  4F87 A;  1N32 Q;  1IL8 A;  3OTO Q;  4A3D B;  2XGT A;  4BBS G;  1SYB A;  1B4O A;  5CV9 A;  4AYB B;  1HR0 Q;  3M4O H;  4LUO A;  1LT5 D;  4F8M A;  3RZD H;  1D5Z C;  1E2Z A;  1PFS A;  3I70 A;  2Y0S B;  4DV4 Q;  4M1U B;  3GTL H;  2F0W A;  4A3D G;  1SNP A;  3VR4 A;  4AYB G;  1PH3 A;  4PZ7 A;  1IYJ B;  2NVY B;  3PCO B;  1SNO A;  4IUQ A;  4KY5 A;  1SSO A;  5EBC A;  3Q22 A;  3CMA A;  2Y0S G;  2MFI A;  3I7F A;  5I6W A;  5E1F A;  3I91 A;  4FO2 A;  5T1I A;  1FD7 D;  3PUZ A;  3FHW A;  4WFN 3;  3KOJ A;  1VF5 C;  1SRU A;  5AJ3 Q;  1A0I A;  2HCI A;  4NB3 A;  2VUM B;  1SFO B;  2K5N A;  1FJG Q;  4K5X A;  1XYI A;  1W6K A;  1NTG A;  2ZXO A;  1C0A A;  3A0J A;  5C4Z A;  3H0G H;  1K83 B;  2KCN A;  3HKZ E;  4DAY B;  2QA4 A;  2IPK D;  3GV3 A;  3SEB A;  4BY1 H;  2VUM G;  3NPP A;  5JJZ A;  2R93 B;  4A3G B;  1VQI A;  1LO5 D;  4UP7 A;  1LTT D;  2F0O A;  1TII D;  3H6M A;  4CDC C;  4HN7 A;  3KJP A;  3TDQ A;  1S5F D;  2KHS A;  4K8J A;  1WJJ A;  2R93 G;  4K8I A;  4A3G G;  4RGO S;  4WJW A;  4X62 Q;  5IWA L;  1U0L A;  3J7A F;  1CKM A;  5C0X H;  2BH2 A;  5IYD G;  2OQK A;  3TME A;  4B3R Q;  2WII B;  3S1Q H;  1JJG A;  5EAY A;  3L2P A;  3UDI A;  2F1M A;  3GTM B;  3QIA A;  2NUC A;  1SYD A;  1LTR D;  2QW7 A;  1KQS A;  1HXY D;  1HR0 W;  3OHX C;  4CDE C;  4DV1 Q;  5T1G A;  1VQM A;  1PTO C;  2E2J B;  1HZB A;  1H9S B;  1NMF A;  1KLU D;  1T5X D;  1HCZ A;  3TP7 A;  1B70 B;  2NN6 I;  4GLV B;  3Q23 A;  1HTP A;  2QF7 A;  1SYF A;  2QCP X;  4G7Z C;  1L1O A;  1FYC A;  1IW7 C;  4L8J A;  4HJ8 A;  3Q0A A;  3J81 E;  3H3V H;  2UXC L;  4FXK C;  1Y1W G;  2K5W A;  2KCT A;  4IPD A;  2Q2I A;  2PW7 A;  2F3V A;  4P75 A;  5FLX E;  4JOI C;  1QUQ B;  2I0Q A;  2J0T D;  3L9A X;  2RHQ B;  1XTD A;  3VYT A;  2D2C C;  4YWM A;  2XN9 C;  1JJ2 A;  4YCU A;  1VQE A;  5ELE A;  1PTO D;  1E0B A;  3BDO A;  3K6O A;  1PH6 A;  2B2T C;  1HA5 A;  2EJM A;  1IBL Q;  1EWC A;  2A5H A;  2OF1 A;  3I2Z A;  2VQE Q;  1KAA A;  1IW7 D;  2L11 A;  2OT2 A;  4UP9 A;  2O4X A;  2B2W C;  2Q2T A;  4IN3 A;  3LWU A;  1LTB D;  3GTL B;  4HJ7 A;  2F0E A;  2HHH L;  3S1M H;  2L1B A;  4RCO A;  1NAP A;  1EYC A;  2I5L X;  1GUS A;  4JC0 A;  2IHF A;  4HED A;  2KCC A;  3VR6 A;  1V1P B;  3TRE A;  1PH4 A;  1IBM L;  5LHY 1;  5DEH A;  2EJG C;  4NXN Q;  1CQV A;  1QIL A;  4DNR B;  1A2U A;  1DOM A;  1BCP B;  1XXG A;  2XRS D;  2PNH A;  4LF6 Q;  1K0S A;  1EY7 A;  2CWA A;  3EN2 A;  2M9V A;  3BJU A;  4Y7N H;  3EIV A;  1B8A A;  1VQ5 A;  1QZH A;  2RCN A;  3BYT B;  3A7L A;  1EYA A;  3T13 A;  4GOP A;  1TKW B;  1WD1 A;  4IPH A;  4DFA A;  5IT9 L;  1GM5 A;  4LK1 C;  4A3F H;  1AP0 A;  4KKU A;  3G71 A;  4L5R C;  1ENC A;  1RIP A;  4ID6 A;  2FJ2 A;  3L7Z C;  4HJA A;  1BBU A;  4ZRZ A;  3M3Y B;  3H0G G;  1H9M A;  2MNA A;  1LTL A;  1NBW A;  4JBK A;  3DHQ A;  1EWI A;  4GLA C;  2PQA A;  4KMU C;  2LXJ A;  2JA7 H;  1J9O A;  1TWG H;  2ENB A;  2MO1 A;  4DR4 L;  1E1T A;  1TWA H;  2H1E A;  3SR1 A;  3BZD B;  1HQM C;  3NTK A;  2KVM A;  2NZO A;  3S1Q B;  5EJW A;  2AQ2 B;  3HOZ B;  2Z6B A;  4QJF A;  4XTC S;  4IO9 A;  4R8I A;  2VXW A;  1J8I A;  1GJX A;  4DV6 L;  2LMC B;  4IUV A;  3MXN A;  2ZT9 C;  4PV1 C;  2VQF L;  1RF2 D;  2AKW B;  4BY7 H;  3A54 A;  1LLR D;  3HOZ G;  1N9W A;  1R4Q B;  4DV0 L;  1BBX C;  1F2M A;  1YJW A;  2F0M A;  4RMF A;  1TY0 A;  1X32 A;  5C4J H;  5M9O A;  3M9B A;  4C3I B;  2IHE A;  2L0C A;  1LTS D;  4EQN A;  3G6E A;  1AE2 A;  1GVP A;  1B9M A;  1S5D D;  4CJ2 C;  5GAE C;  2KA7 A;  1JJC B;  2EY6 A;  3F8T A;  2CQA A;  2K6A A;  4A3B H;  2DY8 A;  3TN2 A;  2KEN A;  2AUJ D;  3EFX D;  4DR3 Q;  3P75 A;  4B08 A;  1XMQ Q;  3CME A;  4OWX B;  1U4R A;  4JW0 A;  4X3K A;  4ALP A;  2CKZ B;  5E3F A;  1YJN A;  1O7L A;  1PV4 A;  2BDO A;  3M85 A;  4RGT A;  4DPG A;  1VQL A;  4GN5 A;  3CF5 A;  3S16 B;  1KHI A;  4HJ9 A;  3OOC A;  1TY2 A;  2HIV A;  3R3O A;  1EQT A;  3PQI A;  1C7Y A;  3NTI A;  1EEI D;  1SNQ A;  2PPB C;  1PYS B;  4OGQ C;  5NUC A;  3I73 A;  1JOK A;  2WAQ E;  1XNR Q;  5IGF A;  4B3S Q;  5HGT A;  5FLX c;  4IFD I;  4HCS A;  3E0J A;  3OWF A;  1N34 Q;  4AQY L;  1YVC A;  1X54 A;  1S5C D;  5IGG A;  1PH2 A;  4A3K H;  2IWH A;  3PF4 A;  3X3M A;  3CU7 A;  3KFU A;  2OCE A;  1PFN A;  2CH4 W;  1A3U A;  1T5E A;  2PZU A;  1U9R A;  2E75 C;  4FXD A;  4DR1 Q;  3QWN A;  3S24 A;  1I6V C;  1SE2 A;  3E3X A;  4JBJ A;  1JMC A;  1EWH A;  5IGB A;  4HR7 B;  2O5I C;  2KEC A;  2PZW A;  4DN4 M;  5IT9 E;  5C3X A;  2B2U C;  2ZXR A;  3S15 H;  1CM9 A;  2LS0 1;  3UDX A;  3W1G A;  4A3F B;  4R4Q A;  4JI8 Q;  1VQH A;  5J22 A;  5CV5 A;  1EY4 A;  1KDB A;  1OXT A;  4UHV A;  5A35 A;  3HOU H;  1HUM A;  4QIW E;  3TP8 A;  1HPC A;  3SK4 A;  1QCB D;  2F0U A;  4A3F G;  1V1O A;  2AQ3 B;  1TU2 B;  1IKM A;  4HIK A;  4WRD A;  1PH9 A;  3TS2 A;  1Y69 U;  1PRT F;  1I6H H;  2F0P A;  2N3S A;  4GOP B;  3KF6 B;  1PFM A;  1FNW A;  5JAV A;  2UU9 Q;  2JA7 G;  1A8V A;  1M1K C;  3KDF A;  2RF4 A;  1F9R A;  2F0V A;  3T1Y Q;  1STE A;  1E3P A;  2EYH A;  2ZJR A;  1F9Q A;  3T16 A;  3TQY A;  1GUO A;  3SE0 A;  3D6C A;  1A2T A;  1CTM A;  2IT1 A;  1Q1E A;  4NXM L;  1FVI A;  3ERS X;  3J7A V;  1QB5 D;  4DUY L;  2NN6 H;  3EBE A;  1Q82 C;  4QF4 A;  2A6E C;  3ND8 A;  4X3T A;  1B3A A;  1U5K A;  3AB9 A;  1ENF A;  3K8A A;  4G7O C;  2R7F A;  3GTQ B;  4A3B B;  2B2V C;  2EXZ A;  1TXY A;  3STB C;  2QKI C;  3KLR A;  4RHS A;  1V9P A;  1X3P A;  2C9O A;  3MXP A;  3SGI A;  1WTQ A;  1PTO B;  1MJE A;  5TSS A;  5JJL A;  1I5F A;  3FEW X;  2QDL A;  3OIQ A;  4DR2 L;  1MI2 A;  4A3B G;  1QOH A;  1JIC A;  4KD4 A;  1LTA D;  1QVG A;  2CHB D;  2MO0 A;  1I94 L;  1PDQ A;  3P7J A;  3VYU A;  2Z9H A;  1STY A;  3TP5 A;  2L5T A;  4H02 A;  5EBD A;  1KNA A;  3HOW B;  4JI5 Q;  1GUN A;  5M3F H;  3TP6 A;  1IBK Q;  2WAQ B;  4DK6 C;  1EFI D;  2WB1 G;  2LFN A;  4NP5 A;  1C4Q A;  5K36 H;  5COY A;  3STB D;  2Q8R E;  2BCO A;  1KLG D;  3D0F A;  1JOR A;  1EOV A;  3C3L A;  2KCM A;  1TR5 A;  1KAW A;  1ASZ A;  2R7Z H;  4UY8 C;  3RNU A;  2QIL A;  2ZTD A;  3HOW G;  3SK6 A;  3CW2 C;  5ELO A;  3AFQ A;  2WAQ G;  1KAB A;  3NEM A;  2PQE A;  2KED A;  3F2C A;  4BXX G;  2BA1 A;  5IOD A;  2L55 A;  2NVQ B;  2JQO A;  1QNU A;  1ESF A;  4ZKB B;  2BA0 A;  2I07 B;  3SVM A;  4R4T A;  3HZX A;  1WCM B;  4RWS C;  4U68 A;  3RR5 A;  1SNC A;  5M5Y H;  3OPO A;  4H44 C;  1PH5 A;  1N32 L;  3OTO L;  1KD1 C;  4BBS H;  5G3L F;  1D7Q A;  2XVS A;  1HR0 L;  3HGB A;  1HA6 A;  1EU3 A;  1WCM G;  4N9T A;  1E1O A;  3NP8 A;  2ICI A;  1SJE D;  3HOY H;  1HFN A;  4DV4 L;  3T4A C;  2V4D A;  2Q8T A;  5LL6 S;  3QR8 A;  4QIW B;  2IX1 A;  3S1N B;  1MIU A;  3S2H B;  1JB7 A;  4G7H C;  4KHP Q;  3FMC A;  2EOT A;  4DK0 A;  1XPU A;  2JA5 B;  5IT9 c;  4WJ4 A;  1S5B D;  3MZ5 A;  2MUY A;  2MP1 A;  3NQT A;  2B63 B;  2MJ8 A;  1TS3 A;  4DAM A;  2TMP A;  5AJ3 L;  3K58 A;  4GLX A;  2KBN A;  3I90 A;  4O1N A;  2BE5 C;  4QL5 A;  2JA5 G;  4BS9 A;  4YY3 Q;  1FJG L;  2ZTE A;  2B63 G;  1I4X A;  4K2L A;  1X6O A;  2L12 A;  4FF2 A;  2VUM H;  3JAM L;  3OMC A;  5IIF A;  1SFO H;  1VQ7 A;  2UUA Q;  3S2D B;  2NVX B;  2GN5 A;  1DON A;  1B9N A;  1EY8 A;  4MZ9 A;  4OEM B;  1Q8I A;  5JOB A;  3J7Z C;  2NN6 G;  1TWF B;  2HQL A;  1K83 H;  1KRT A;  2ASB A;  1EIG A;  1HHV A;  2NWG A;  3O13 A;  3CCL A;  2WKD A;  2AQ1 B;  2FXQ A;  4X62 L;  4DK1 A;  3RZO H;  3AQQ A;  1SMY D;  2BE5 D;  4GN3 B;  2H4O A;  2MGS A;  4PQX A;  4B3R L;  3I3C A;  4F88 A;  4JI1 Q;  2R6G A;  4AIM A;  4PMB A;  4N8F A;  5KND A;  1IYV A;  3L0O A;  5M3F B;  4G4K A;  4L6T B;  3OIP A;  1E22 A;  1LT4 D;  4YWL A;  3AYH B;  3I4M B;  4DV1 L;  1JOQ A;  1EY5 A;  1X55 A;  1CI3 M;  2EPB A;  3KF8 B;  1BO0 A;  1V8Q A;  2RDF A;  2ZJP A;  2R7Z B;  3MEF A;  3C46 A;  3GTM H;  2UXB Q;  2PMZ B;  5M3F G;  3NK9 A;  4DV2 L;  3I4M G;  4HAE A;  3D6W A;  1EIH A;  5C5L A;  2E2J H;  3J80 L;  4A3J B;  3VDY A;  4QMG A;  1A6X A;  4HTH A;  1X3E A;  2EZV A;  2GVB A;  4MTK A;  1QG7 A;  2R7Z G;  3G6J B;  3I55 A;  4RA8 A;  1L1O C;  4EX5 A;  1MBY A;  5CYU A;  3KK7 A;  4KTA A;  1K28 A;  1RTN A;  5M5Y B;  3PO2 B;  2XWB B;  3VA7 A;  1SND A;  3ZJY C;  1U4M A;  1Z47 A;  2AUK A;  2DGY A;  4C2M H;  5KGU A;  2AWN A;  1K8A C;  3D4W A;  2F0S A;  1IBL L;  4HSV A;  3AMU A;  1R9T H;  1TWH B;  3CC2 A;  3BVG A;  2VQE L;  4XT1 B;  5BN5 A;  3PO2 G;  3HOY B;  3K5N A;  2JE6 I;  1VQD A;  1YZ6 A;  1KTK A;  3E9I A;  4LF7 L;  1W3S A;  2B2Y A;  2A6H C;  1IKL A;  2K52 A;  1I4R A;  1FR3 A;  1O80 A;  3VA5 A;  3WDN A;  3HOY G;  2AWO A;  4PZ8 A;  4ZKC B;  4K6D A;  2DY7 A;  4RCN A;  4NXN L;  3MEH A;  5I2X A;  4XQQ A;  5K5P A;  2AHO B;  5IYC G;  2J4X A;  3NBI A;  1AN8 A;  2RSO A;  1EYD A;  1OTC A;  4LF6 L;  3HKS A;  4XQJ A;  1GUW A;  5C4H A;  1ET9 A;  4A3L H;  4FVM A;  2JEA I;  2K5V A;  3JAM E;  4UP8 A;  1Q86 C;  2F3W A;  1EZ6 A;  5M5X B;  1BNZ A;  3M4Y A;  5BN4 A;  1G2T A;  1WFQ A;  1CKN B;  2A6H D;  1CHP D;  2IW3 A;  1EQV A;  2CVR A;  1A63 A;  1TWC B;  2KUM A;  2JA6 H;  1ZXT A;  4BBR B;  1XMO Q;  3PUW A;  3BZC A;  4MNO A;  4GOP C;  3KLS A;  4KY6 A;  2EE1 A;  1FL0 A;  2PNR C;  3RZO B;  5FLM G;  2F0F A;  1PA6 A;  4C3H H;  1QZG A;  4OL7 A;  5LMU Q;  3M3Y H;  1VQN A;  4MHE A;  4RGN A;  1C9O A;  1SRO A;  2JN4 A;  2D9U A;  5ISR A;  4KN7 C;  5E7N A;  3QB3 A;  1LT6 D;  1IZ6 A;  5FJ8 G;  2VB3 X;  2EYP A;  2JYO A;  3NBH A;  4LFC Q;  3AFP A;  5EQ0 A;  2DNC A;  4IFD J;  4A75 A;  3MXU A;  2K05 A;  3HOZ H;  1ZEQ X;  4X66 Q;  1G29 1;  5IYB G;  3ONA B;  1YNJ C;  1X65 A;  3PO3 B;  4IFD G;  1SNM A;  4KKS A;  4KV6 A;  4J1M A;  2YYZ A;  5GAH C;  1Y8P B;  1JE5 A;  3ERO A;  2K4K A;  3FKI B;  4DR3 L;  1ZKO A;  5GAG C;  1XMQ L;  3GTJ B;  3FRP B;  1H9K A;  4KJO A;  4DV2 Q;  4C3I H;  1SYC A;  2N8N A;  1J6Q A;  5E4W C;  3CCJ A;  3I56 A;  2QGQ A;  2WKC A;  3FKI G;  4C2M B;  4XXE A;  4IQZ A;  3H94 A;  1RHP A;  2DN8 A;  1Q90 A;  2Q2H A;  1F9P A;  1R9T B;  3A5Z B;  1XNR L;  1Y1V H;  2WIN B;  1YNJ D;  4H7B A;  4B3S L;  4IJH A;  3E0E A;  4K0K Q;  1QVF A;  1GXD C;  1F77 A;  4BWG B;  3S16 H;  1DXM A;  1A62 A;  2AMC B;  1GUG A;  4R4C A;  1N34 L;  1ML0 D;  4B3T Q;  4TQU S;  3LGJ A;  5IGD A;  3SHL A;  4OHJ A;  4CBV A;  1TS5 A;  4CJ0 B;  2A68 C;  3QJY A;  4LJZ C;  3F2U A;  1MGS A;  1DD2 A;  4DR1 L;  3BYY B;  3CXC A;  1MSG A;  1HZC A;  1SR3 A;  4LF7 Q;  1AFP A;  3M7N A;  2OTJ A;  1ICW A;  2UXD Q;  3MFG A;  3CC7 A;  4A3C H;  3GV6 A;  1M8A A;  3N52 A;  4HJ5 A;  5HY6 A;  4LF8 Q;  2CH4 A;  2HUG A;  2EYJ A;  3BS1 A;  2FIN B;  1STB A;  4O42 A;  4JI8 L;  5L37 A;  4K2K A;  4Y52 H;  5I9P A;  2JA6 B;  1UEA B;  4A3L G;  5EPL A;  1GD7 A;  1FGU A;  2R7D A;  4E6I A;  1HNX Q;  4PG3 A;  5EGT A;  1MHW C;  2A68 D;  2NB0 A;  2RA4 A;  3I4N B;  4L5T A;  5IGC A;  5IP9 G;  3NUC A;  3HKZ B;  4DR7 Q;  4JI7 Q;  3ZYY X;  2JA6 G;  3DLL A;  4C3H B;  4HID A;  4WJ3 M;  4C3J B;  4V0B A;  3K7A B;  2F52 A;  3JAM c;  5C6A A;  1N33 Q;  2UU9 L;  3P20 A;  3UDF A;  2E5L Q;  3G48 A;  2HT1 A;  4C56 C;  3T1Y L;  3HKZ G;  4ZUI A;  3K5O A;  3A56 A;  2EVB A;  2NTT A;  2K32 A;  4C3H G;  3PF5 A;  1K3R A;  2F0G A;  3HOV B;  1VS0 A;  1J5E Q;  2WFW A;  2EYL A;  1Q3L A;  4BA2 I;  1LTI D;  4LF5 Q;  4FXG C;  1NMG A;  4LF9 L;  4Q5V A;  1DOL A;  3U50 C;  2QEJ C;  1VQ9 A;  4ZQ3 A;  3CCQ A;  2F0T A;  1VQA A;  2HDM A;  3HG9 A;  4IUN A;  1I4H A;  1Q7Y C;  1IYU A;  4APV A;  3D4R A;  3VR2 A;  3ICE A;  3WWV A;  3R2I A;  4K14 A;  2KOL A;  1SEB D;  3HOX B;  3GTO B;  1D6E C;  1E2W A;  2RBM A;  3GP7 A;  1DM0 B;  4NPS A;  1WVL A;  3MFY A;  3GTQ H;  1PHJ A;  4JI0 Q;  4IZ8 A;  1D2B A;  1CSQ A;  1WTW A;  1B50 A;  5CC4 A;  4UAI A;  3J80 c;  1EY0 A;  4C3I G;  4JI3 Q;  1PTO H;  1Y1V B;  3C1F A;  1SYE A;  4JI5 L;  3DWP A;  1TS4 A;  4JV5 Q;  3CKI B;  1IBK L;  1L1O B;  4LFB Q;  1KIX A;  2SDF A;  2CW0 C;  1Y1V G;  1H9R A;  4JOI A;  1F2L A;  1HZA A;  2FFK B;  1HJP A;  3HOW H;  1PVO A;  4DAP A;  1Y14 B;  2B3G A;  3AU7 A;  2E76 C;  4LF4 Q;  1KC8 C;  1BXT A;  5KIX A;  2LXK A;  1JCK B;  2IJ0 A;  4BXX H;  2F0K A;  1STH A;  3VYR A;  3VYS A;  2B2T A;  2D5D A;  3NWS A;  3MXG A;  4DR6 Q;  2UUB Q;  5FOB B;  2BDN A;  3CP0 A;  1EQR A;  1YIT A;  1X56 A;  2NVQ H;  4A3C G;  2CW0 D;  4Z9C B;  3EJI A;  5JEA H;  3PV0 A;  3WOF A;  3J7A 5;  2KJX A;  4CHT B;  3JAM i;  1WCM H;  1OXS C;  1EIY B;  1I4Q A;  1VQK A;  1ILP A;  2UUC Q;  1BUV T;  2D0P A;  5JVH 3;  4DV7 Q;  1KDC A;  3K7U C;  2SNM A;  3I4L A;  3F1Z A;  4LFA Q;  3HFZ B;  3RMH A;  3IFT A;  1SAP A;  5GAD C;  4KHP L;  4RAU C;  1M90 C;  5J1Z A;  2EYF A;  2Z6K A;  4FDB A;  3PUY A;  1EU4 A;  2K03 A;  4IAL A;  3S1N H;  3F2D A;  3S2H H;  2EYO A;  3CRL C;  4MN3 A;  1X3Q A;  2JA5 H;  2MPM A;  4O0A A;  4YY3 L;  5LMN Q;  2JEB I;  3T1H Q;  3MTS A;  2B63 H;  1MD2 D;  4B3M Q;  1Z7T A;  1G8Z D;  3V2T A;  2C5C A;  3N6R A;  5IOC A;  1Z9F A;  2PQA B;  3TZU A;  2UUA L;  5IGE A;  1U4P A;  1WTH A;  4A3E B;  5A2Q L;  2K1B A;  4BA1 I;  4LF9 Q;  3J80 i;  4P72 A;  2E2I B;  3K5L A;  1EQQ A;  3KLS X;  1HUN A;  3EVQ A;  1ICF B;  4IJL A;  3S2D H;  3BVM A;  2NVX H;  2DNE A;  4GNX A;  3UE1 A;  1D8L A;  5IE8 A;  2JA9 A;  4MIU A;  1TWF H;  3MXN B;  4N8X 1;  3GTG B;  3MWY W;  4JI1 L;  3MHB A;  1PZK D;  1S4Z A;  4X3U A;  1H9J A;  3GD7 A;  2BH8 A;  2F4I A;  1VMC A;  3A8J E;  5BN3 A;  1N36 Q;  3HS0 C;  3ITP A;  4OEL B;  4EVO A;  3TBI B;  3D4D A;  3ULL A;  3ER0 A;  5ELB A;  2UXB L;  2A6E D;  2CCZ A;  2A1A A;  4R8N A;  1QJO A;  1UEB A;  1JT8 A;  4DAV A;  4JYA Q;  2K33 A;  5C3E B;  3I4M H;  3U9S A;  3OYY A;  5DNF A;  1Q81 C;  1WOC A;  4QQB X;  2IX0 A;  2XSC A;  1FGB D;  5D65 A;  3PGZ A;  1SLJ A;  2IX3 A;  2RCF A;  2NYZ D;  5FO9 B;  5DM7 3;  1DOK A;  1NNX A;  5C3E G;  2WP8 J;  3CAM A;  2RVL A;  4A3J H;  5LMN W;  2OXP A;  3BG3 A;  4FF1 A;  1BCP F;  2EJF C;  1AZQ A;  3E5S A;  5JEA J;  1Q12 A;  1RDP D;  3DWA A;  3V05 A;  5I2Y A;  1SJH D;  3PO2 H;  3I8Z A;  2VZA A;  3VR5 A;  1BF4 A;  1MJC A;  2CQO A;  3R2T A;  5JEA G;  3MAQ A;  1WYD A;  1L2F A;  4JVZ A;  1HNZ Q;  1S3O A;  5E4X A;  4KD3 A;  3CCR A;  2ICE C;  1TWH H;  4I7A A;  1XX8 A;  1CZG A;  1TS2 A;  3WOE A;  4QUC A;  2FMC A;  4R1J A;  4KI0 A;  1BVS A;  2B2Y C;  5IYC H;  4JI6 Q;  4NMZ A;  1H95 A;  3IL8 A;  3NTH A;  2F0H A;  3PIO A;  1AZP A;  4CDF C;  1RCV D;  4F7X A;  4DXF A;  1HQR D;  1EIF A;  1BOS A;  3GTP B;  4GKJ Q;  2EDG A;  2X6L A;  1EEF D;  4HMJ A;  4YWK A;  4HIM A;  2X69 A;  2GVA A;  2Y0S E;  3OW2 A;  4NKL A;  1XTC D;  1LV9 A;  4ME5 A;  4ZAI A;  1PYB A;  2CFM A;  1XMO L;  1UE6 A;  2Z4I A;  5D3I B;  3R8B A;  1G2S A;  5M5X H;  1SBB B;  2R61 A;  5GQO A;  2GA4 B;  3VR3 A;  3KDF B;  1UAP A;  1BDO A;  5FLM H;  4ILW A;  1TWC H;  1VMP A;  4DAY A;  5LMU L;  4A3I B;  4BBR H;  1XPR A;  1ASY A;  5FO7 B;  1I3Q H;  3HEJ A;  4DF7 A;  3RLN A;  3NEN A;  3FVQ A;  1MKH A;  2JA8 B;  5CGK A;  2F0J A;  5FJ8 H;  2I5M X;  4I7Z C;  2D62 A;  3NSW A;  2WAC A;  1FNU A;  4A3I G;  2ALY B;  1Q8K A;  2PCF B;  4LFC L;  4OO1 I;  5JVG 3;  2HCC A;  4CDD C;  3ERQ A;  1QVC A;  4ZYS A;  3R93 A;  3A8K E;  4DV5 Q;  4X66 L;  2RKS A;  3K57 A;  3CPW A;  3A5U A;  4LW1 A;  5IYB H;  3NHH A;  4OIK A;  2VS1 A;  3V96 A;  4LAA A;  3ULJ A;  1K9M C;  3D8G A;  4R9W A;  4IFD H;  1K8G A;  1X3G A;  3CHB D;  1D5M C;  3FPP A;  5G3L D;  3DMU A;  2F0N A;  5FK9 C;  1I4G A;  3OSO A;  3RLF A;  3PO3 H;  2M2L A;  1H9S A;  3A8I E;  3I4O A;  4YHH Q;  3B6Y A;  3Q6S A;  1HRJ A;  4A76 A;  1Y8O B;  2XRQ D;  3FKI H;  3D3R A;  4YCV A;  1O7I A;  4OX9 Q;  3NE5 B;  4RKL A;  1CA5 A;  4XIG S;  3GTJ H;  2PI2 A;  1E7Z A;  1ONL A;  1SXT A;  3OW7 A;  4DU9 A;  5IY0 A;  3S9W A;  4A3J G;  2DUD A;  4TSS A;  1QUQ A;  1MSH A;  4K0K L;  4GKK Q;  2E74 C;  1WTP A;  3L3O C;  4LWC A;  3SK8 A;  4B3T L;  1EZ8 A;  2EY1 A;  3KUP A;  2PZT A;  5COR A;  1WTO A;  3GTK H;  2PI2 E;  5M3M B;  2EIF A;  4K6L A;  3U4V A;  4X65 L;  3S1R B;  1LTG D;  1CZW A;  1N8R C;  3J81 L;  4JI2 Q;  1JB3 A;  1NR2 A;  3MVV A;  2UXD L;  2EY5 A;  3PIO 3;  1CFM A;  1G91 A;  4YCW A;  1I4P A;  2L4N A;  5FLX L;  3U9O A;  1HTL D;  4LF8 L;  4KHV A;  5M5W B;  5JPN C;  2N49 A;  4HMI A;  4KLK A;  4RHR A;  1VQC A;  3FPU B;  5FKA C;  1V1P A;  2K75 A;  3PUX A;  3PUV A;  1ET6 A;  5CV4 A;  4HCE A;  4R4I A;  2K04 A;  1B2T A;  4DR5 Q;  2R3Z A;  1K3B C;  1PZI D;  5BR8 Q;  4C1N K;  1HNX L;  1W2B A;  1K0R A;  1IXR A;  4L63 B;  1GKH A;  3RN2 A;  2XIW A;  5IP9 H;  1I50 B;  4DA2 A;  5C3W A;  1VQF A;  4DR7 L;  2F0L A;  2YU9 H;  4J6H A;  4JI7 L;  3RUZ A;  1JWU D;  1NCV A;  1O78 A;  1T9H A;  2H5X A;  1JWS D;  2O2L D;  2KHI A;  1VQP A;  1HFG A;  1M4V A;  4PMC A;  3TSS A;  1A3T A;  4I65 A;  1N33 L;  4B9W A;  1I3Q B;  2E5L L;  3I4N H;  1OXX K;  2RDH A;  5HUR A;  4A3M H;  1PTO F;  3A7A B;  3ND9 A;  4IUU A;  4A93 H;  1K8M A;  4C1N I;  4OON A;  1Q1B A;  1NUC A;  2NBF A;  3LX0 A;  4C3J H;  3K7A H;  1J5E L;  4BBR G;  4B9X A;  3AEV A;  2WV6 D;  5ELC A;  1AEX A;  3BVZ A;  2K50 A;  4CGY B;  4V19 0;  5CV8 A;  4LF5 L;  5C44 B;  4NW2 A;  2SOB A;  4KHZ A;  4EQP A;  3LNN A;  1VQG A;  4L5Q A;  1JE4 A;  1AW7 A;  1XNQ Q;  3HOV H;  3A74 A;  2RQX A;  1YJ9 A;  4EGV A;  4DKA C;  4JI4 Q;  4DV3 Q;  3URY A;  5D3D A;  1Q46 A;  1A15 A;  4P73 A;  5C44 G;  2SNS A;  1UUP A;  1GO3 E;  3PMF A;  3J80 E; 
#chains in the Genus database with same CATH homology
 1GUT A;  1PRT B;  3QO2 A;  4K5V A;  1B53 A;  2M00 A;  2Q8I B;  2R92 B;  1VDZ A;  4H13 C;  4NDX A;  1KDA A;  2VB2 X;  3K5M A;  3K59 A;  4XYO A;  3Q24 A;  1D1I A;  4IUP A;  1PZJ D;  1B1Z A;  1Y1W B;  1EY9 A;  1LAB A;  1ROD A;  5C4X B;  2G9H D;  1V43 A;  3GTK B;  3CQZ B;  4TRD A;  3M7G A;  2SEB D;  3QG1 A;  5C5M A;  5AFW A;  5KYL A;  3DUZ A;  3DM1 A;  3W3A A;  1CHQ D;  4ZLT F;  4KKT A;  1EL0 A;  3RD4 A;  4DXG A;  4DGZ A;  3OMG A;  1RD9 D;  4RFB A;  2JP1 A;  2KQ3 A;  5KEE A;  3M4O B;  2NTS A;  2LKV A;  3RZD B;  2FHT A;  4N9P A;  4K5W A;  2YU9 B;  1SE3 A;  3SK5 A;  5KYI A;  1SE4 A;  2EYM A;  1O7Y A;  4A3M B;  2N88 A;  1ESR A;  1F9S A;  4P2C B;  4A93 B;  1WD0 A;  4FP5 D;  2RDG A;  2HDL A;  1RJT A;  1K8O A;  4OO1 H;  2F0D A;  3H0G B;  1YNN C;  2X6G A;  4BY1 B;  4C3J G;  1DCZ A;  1STN A;  5EKK A;  2I46 A;  1STG A;  2A74 C;  1ENA A;  1SDF A;  1JQY D;  1GHJ A;  4ZUJ A;  4CKB A;  3QOL A;  2RSN A;  5C0X J;  1YNN D;  1GHK A;  3HRZ C;  4X3S A;  5C0X G;  1WTX A;  1PLF A;  4FF3 A;  3KBX A;  4Q0F A;  3DXJ C;  2B39 A;  5I9O A;  1U4L A;  5I6Y A;  1STA A;  1WTV A;  3SDZ A;  4QUF A;  5I4D A;  4M8A A;  1Y8N B;  1JOO A;  2XNA C;  1Z6H A;  5ELF A;  1PFB A;  1EY6 A;  3T51 B;  3IKJ A;  3I72 A;  4QCL A;  4KJN A;  2B2W A;  3TZD A;  3DEP A;  3S1M B;  2B8G A;  5CBA E;  1DZ1 A;  4CKE A;  3PIP 3;  1PXU A;  3T53 B;  3QOJ A;  4DNT B;  2PO4 A;  5DAU A;  1F2Y A;  2OEO A;  4FNF A;  3W2D A;  1ZYR C;  2ZXP A;  4Y7N B;  3IAY A;  2KEE A;  3K0Y A;  5EPJ A;  4CJ1 B;  2BOS A;  2TSS A;  4U67 3;  5JPM C;  1PYW D;  1G6Z A;  1FNV A;  3H91 A;  4OO1 G;  3MA2 B;  3EA6 A;  1NR4 A;  3NQI A;  3X3N A;  4UDU C;  2JA7 B;  1TWG B;  4ULL A;  4JK1 C;  4GZY C;  1JR0 D;  1TWA B;  1ZYR D;  2IL8 A;  3BDL A;  3T56 B;  5FO8 B;  2K5D A;  3GQB A;  2JSO A;  4YIJ A;  1EOT A;  3GO5 A;  4KN4 C;  4BY7 B;  1L0Y B;  1C8C A;  1JC7 A;  5CV7 A;  3E6Z X;  5C4J B;  5EKI A;  2ID0 A;  3BDC A;  4PNY A;  2Z1C A;  4LMQ D;  2QDB A;  1QE6 A;  4HSP A;  1IHZ A;  2F03 A;  2K7V A;  1PRT C;  4CKC A;  3C1E A;  4OIJ A;  3HP3 A;  1BR9 A;  3KBG A;  3KF8 A;  4XQN A;  4S3S A;  5F2D A;  1CK1 A;  2A69 C;  2O5J C;  2WB1 B;  1L0X B;  1DYQ A;  2E2H B;  2EY2 A;  5C0X I;  2NVT B;  2F0I A;  2Z4H A;  4RH6 A;  5D14 A;  1F2Z A;  4KK7 A;  4IUT A;  2A73 B;  1PRT D;  3UI2 A;  4A3K B;  1W6J A;  1KNE A;  3D31 A;  3OWE B;  4QB4 A;  4EQO A;  3P1H A;  1QNK A;  2A69 D;  2G9D A;  2K01 A;  1D5X C;  1TQO A;  2XWJ B;  4H0L C;  3H09 A;  3S15 B;  4G57 A;  2B2U A;  2J7Z A;  5CBE E;  4PMW A;  1DJR D;  3HOU B;  1WTR A;  3MC0 B;  1XWE A;  1C48 A;  1OXU A;  5A2Q E;  1RTO A;  4J8Q A;  1NSN S;  1I6H B;  2E2D C;  4XYQ A;  1CQF A;  4JBW A;  1BCP C;  5CV6 A;  4ZK9 B;  3LWE A;  2B8F A;  4TKO B;  1SMY C;  3G7L A;  2VNU D;  1O7Z A;  4FF4 A;  5LL6 X;  5KNC A;  2JXM B;  3CRK C;  1II3 A;  2HQE A;  3DWQ A;  4WOR A;  1S5E D;  3C2P A;  1CA6 A;  1LT3 D;  4XT3 B;  4RGM A;  2B2V A;  2MHV A;  1BCP D;  4FYD A;  5CMD A;  2LY7 A;  1GOZ A;  1D1K A;  2Z8L A;  1PMR A;  1OXV A;  2K5Q A;  3A55 A;  5CR3 A;  5ELD A;  2PW5 A;  3EQL C;  3NWT A;  4RKB A;  5J39 A;  1TT2 A;  1TVX A;  2NZ1 D;  1BQQ T;  4XDX A;  5DM6 3;  5EKL A;  3H3V C;  1B44 D;  1RKN A;  2N55 A;  3DEO A;  2F0Q A;  1VF7 A;  5EPK A;  1QWY A;  2L9H A;  1LAC A;  1OO9 B;  1E2V A;  5KNB A;  1A3V A;  1UNS A;  5K36 G;  5KRU A;  1CT1 D;  2FMM A;  4ODG A;  3FDT A;  4ABN A;  3NXW A;  3J7Y W;  1VCI A;  3S17 B;  4IUR A;  4KY7 A;  2K28 A;  3SXH A;  4BBS B;  1SYG A;  1R4P B;  2PYK A;  1JWM D;  3IFD A;  1ILQ A;  4F87 A;  1IL8 A;  4A3D B;  1SYB A;  1B4O A;  5CV9 A;  4AYB B;  1LT5 D;  4F8M A;  1E2Z A;  1D5Z C;  3I70 A;  2Y0S B;  4M1U B;  2F0W A;  1SNP A;  3VR4 A;  2NVY B;  1SNO A;  4IUQ A;  4KY5 A;  1SSO A;  5EBC A;  3Q22 A;  5I6W A;  5E1F A;  3I91 A;  4FO2 A;  5T1I A;  1FD7 D;  3PUZ A;  4WFN 3;  1VF5 C;  2HCI A;  2VUM B;  1SFO B;  4K5X A;  1XYI A;  1W6K A;  2ZXO A;  5C4Z A;  1K83 B;  2KCN A;  2IPK D;  3GV3 A;  3SEB A;  3NPP A;  5JJZ A;  2R93 B;  4A3G B;  1LO5 D;  1LTT D;  2F0O A;  1TII D;  3H6M A;  4HN7 A;  3TDQ A;  1S5F D;  2KHS A;  4K8J A;  4K8I A;  4RGO S;  4WJW A;  3J7A F;  5C0X H;  3TME A;  2WII B;  2F1M A;  3GTM B;  3QIA A;  2NUC A;  1SYD A;  1LTR D;  1HXY D;  3OHX C;  5T1G A;  1PTO C;  2E2J B;  1H9S B;  1KLU D;  1T5X D;  1HCZ A;  3TP7 A;  2NN6 I;  3Q23 A;  1HTP A;  2QF7 A;  1SYF A;  2QCP X;  4G7Z C;  1FYC A;  1IW7 C;  4L8J A;  3Q0A A;  3J81 E;  4FXK C;  2K5W A;  2PW7 A;  2F3V A;  5FLX E;  2J0T D;  3L9A X;  3VYT A;  2D2C C;  2XN9 C;  5ELE A;  1PTO D;  1E0B A;  3BDO A;  3K6O A;  2B2T C;  1HA5 A;  2EJM A;  1EWC A;  2A5H A;  2OF1 A;  1KAA A;  1IW7 D;  2L11 A;  2OT2 A;  2O4X A;  2B2W C;  4IN3 A;  3LWU A;  1LTB D;  3GTL B;  2F0E A;  2L1B A;  4RCO A;  1NAP A;  1EYC A;  1GUS A;  4HED A;  2KCC A;  3VR6 A;  1V1P B;  5LHY 1;  5DEH A;  2EJG C;  1CQV A;  1QIL A;  4DNR B;  1A2U A;  1DOM A;  1BCP B;  1XXG A;  2XRS D;  1EY7 A;  2M9V A;  3BYT B;  3A7L A;  1EYA A;  3T13 A;  1TKW B;  1WD1 A;  4DFA A;  5IT9 L;  4LK1 C;  1AP0 A;  4KKU A;  1ENC A;  4ID6 A;  2FJ2 A;  3L7Z C;  4ZRZ A;  3M3Y B;  1H9M A;  3DHQ A;  4KMU C;  1J9O A;  2ENB A;  2H1E A;  3SR1 A;  3BZD B;  1HQM C;  3NTK A;  2KVM A;  3S1Q B;  5EJW A;  2AQ2 B;  3HOZ B;  4XTC S;  4R8I A;  2VXW A;  1J8I A;  1GJX A;  2LMC B;  4IUV A;  3MXN A;  2ZT9 C;  4PV1 C;  1RF2 D;  3A54 A;  1LLR D;  1R4Q B;  1BBX C;  1F2M A;  2F0M A;  1TY0 A;  1X32 A;  5M9O A;  4C3I B;  2L0C A;  1LTS D;  4EQN A;  1B9M A;  1S5D D;  4CJ2 C;  2KA7 A;  2EY6 A;  2CQA A;  2K6A A;  2DY8 A;  3TN2 A;  2AUJ D;  3EFX D;  3P75 A;  4B08 A;  1U4R A;  4X3K A;  5E3F A;  1O7L A;  2BDO A;  3M85 A;  4RGT A;  3S16 B;  3OOC A;  1TY2 A;  3R3O A;  1EQT A;  3NTI A;  1EEI D;  1SNQ A;  2PPB C;  4OGQ C;  5NUC A;  3I73 A;  1JOK A;  5IGF A;  5HGT A;  4IFD I;  4HCS A;  3E0J A;  3OWF A;  1S5C D;  5IGG A;  2IWH A;  3X3M A;  3CU7 A;  1PFN A;  1A3U A;  1T5E A;  2PZU A;  1U9R A;  2E75 C;  4FXD A;  3QWN A;  1I6V C;  1SE2 A;  1EWH A;  5IGB A;  4HR7 B;  2O5I C;  2KEC A;  2PZW A;  4DN4 M;  5IT9 E;  5C3X A;  2B2U C;  2ZXR A;  1CM9 A;  2LS0 1;  4A3F B;  5J22 A;  5CV5 A;  1EY4 A;  1KDB A;  1OXT A;  5A35 A;  1HUM A;  3TP8 A;  1HPC A;  3SK4 A;  1QCB D;  2F0U A;  1V1O A;  2AQ3 B;  1TU2 B;  1IKM A;  4WRD A;  1Y69 U;  1PRT F;  2F0P A;  1PFM A;  1FNW A;  5JAV A;  1F9R A;  2F0V A;  1STE A;  2EYH A;  1F9Q A;  3T16 A;  1GUO A;  3SE0 A;  3D6C A;  1A2T A;  1CTM A;  2IT1 A;  1Q1E A;  3J7A V;  1QB5 D;  2NN6 H;  4QF4 A;  2A6E C;  3ND8 A;  4X3T A;  1B3A A;  3AB9 A;  1ENF A;  4G7O C;  3GTQ B;  4A3B B;  2B2V C;  2EXZ A;  2QKI C;  3KLR A;  4RHS A;  1X3P A;  2C9O A;  3MXP A;  1WTQ A;  1PTO B;  5TSS A;  3FEW X;  3OIQ A;  1MI2 A;  1QOH A;  1JIC A;  4KD4 A;  1LTA D;  2CHB D;  1PDQ A;  3P7J A;  3VYU A;  1STY A;  3TP5 A;  2L5T A;  5EBD A;  1KNA A;  3HOW B;  1GUN A;  3TP6 A;  2WAQ B;  1EFI D;  2LFN A;  4NP5 A;  1C4Q A;  5K36 H;  5COY A;  2Q8R E;  2BCO A;  1KLG D;  1JOR A;  3C3L A;  1TR5 A;  2QIL A;  3SK6 A;  1KAB A;  2PQE A;  2KED A;  2BA1 A;  5IOD A;  2L55 A;  2NVQ B;  1QNU A;  1ESF A;  4ZKB B;  2BA0 A;  2I07 B;  3SVM A;  3HZX A;  1WCM B;  4RWS C;  4U68 A;  1SNC A;  3OPO A;  4H44 C;  5G3L F;  2XVS A;  3HGB A;  1HA6 A;  1EU3 A;  4N9T A;  3NP8 A;  2ICI A;  1SJE D;  1HFN A;  3T4A C;  2V4D A;  2Q8T A;  5LL6 S;  4QIW B;  2IX1 A;  3S1N B;  3S2H B;  4G7H C;  3FMC A;  2EOT A;  4DK0 A;  2JA5 B;  1S5B D;  3MZ5 A;  2MUY A;  2MP1 A;  3NQT A;  2B63 B;  2MJ8 A;  1TS3 A;  2TMP A;  3K58 A;  3I90 A;  4O1N A;  2BE5 C;  4BS9 A;  1I4X A;  4K2L A;  2L12 A;  4FF2 A;  3JAM L;  3OMC A;  5IIF A;  3S2D B;  2NVX B;  1DON A;  1B9N A;  1EY8 A;  1Q8I A;  5JOB A;  2NN6 G;  1TWF B;  1EIG A;  1HHV A;  2NWG A;  3O13 A;  2WKD A;  2AQ1 B;  4DK1 A;  1SMY D;  2BE5 D;  2H4O A;  2MGS A;  4PQX A;  3I3C A;  4F88 A;  2R6G A;  4PMB A;  5KND A;  1IYV A;  5M3F B;  4G4K A;  4L6T B;  3OIP A;  1LT4 D;  3I4M B;  1JOQ A;  1EY5 A;  1CI3 M;  2EPB A;  1BO0 A;  1V8Q A;  2RDF A;  2R7Z B;  3C46 A;  2PMZ B;  3NK9 A;  4HAE A;  3D6W A;  1EIH A;  5C5L A;  3J80 L;  4A3J B;  4QMG A;  1A6X A;  4HTH A;  2EZV A;  1QG7 A;  3G6J B;  4RA8 A;  1MBY A;  5CYU A;  3KK7 A;  4KTA A;  1RTN A;  5M5Y B;  3PO2 B;  2XWB B;  3VA7 A;  1SND A;  1U4M A;  1Z47 A;  2AUK A;  5KGU A;  2AWN A;  3D4W A;  2F0S A;  4HSV A;  3AMU A;  1TWH B;  3BVG A;  4XT1 B;  5BN5 A;  3HOY B;  3K5N A;  2JE6 I;  1KTK A;  2B2Y A;  2A6H C;  1IKL A;  1I4R A;  1FR3 A;  1O80 A;  3VA5 A;  3WDN A;  2AWO A;  4ZKC B;  4K6D A;  2DY7 A;  4RCN A;  3MEH A;  5I2X A;  4XQQ A;  5K5P A;  2J4X A;  3NBI A;  1AN8 A;  2RSO A;  1EYD A;  4XQJ A;  1GUW A;  5C4H A;  1ET9 A;  4FVM A;  2JEA I;  3JAM E;  2F3W A;  1EZ6 A;  5M5X B;  1BNZ A;  3M4Y A;  5BN4 A;  1G2T A;  2A6H D;  1CHP D;  2IW3 A;  1EQV A;  2CVR A;  1TWC B;  2KUM A;  1ZXT A;  4BBR B;  3PUW A;  3KLS A;  4KY6 A;  2EE1 A;  2PNR C;  3RZO B;  2F0F A;  4OL7 A;  4MHE A;  4RGN A;  2D9U A;  5ISR A;  4KN7 C;  3QB3 A;  1LT6 D;  2VB3 X;  2EYP A;  2JYO A;  3NBH A;  5EQ0 A;  2DNC A;  4IFD J;  3MXU A;  2K05 A;  1ZEQ X;  1G29 1;  3ONA B;  1YNJ C;  3PO3 B;  4IFD G;  1SNM A;  4KKS A;  4KV6 A;  4J1M A;  2YYZ A;  1Y8P B;  3ERO A;  3FKI B;  1ZKO A;  3GTJ B;  3FRP B;  1H9K A;  4KJO A;  1SYC A;  5E4W C;  2WKC A;  4C2M B;  4XXE A;  4IQZ A;  3H94 A;  1RHP A;  2DN8 A;  1Q90 A;  1F9P A;  1R9T B;  2WIN B;  1YNJ D;  4H7B A;  1GXD C;  1F77 A;  4BWG B;  1DXM A;  1GUG A;  1ML0 D;  4TQU S;  5IGD A;  3SHL A;  4OHJ A;  4CBV A;  1TS5 A;  4CJ0 B;  2A68 C;  3QJY A;  4LJZ C;  3F2U A;  1MGS A;  1DD2 A;  3BYY B;  1MSG A;  1AFP A;  3M7N A;  1ICW A;  3MFG A;  3GV6 A;  1M8A A;  3N52 A;  2HUG A;  2EYJ A;  3BS1 A;  2FIN B;  1STB A;  4O42 A;  4K2K A;  5I9P A;  2JA6 B;  1UEA B;  5EPL A;  4E6I A;  5EGT A;  2A68 D;  2NB0 A;  2RA4 A;  3I4N B;  5IGC A;  3NUC A;  3HKZ B;  3ZYY X;  4C3H B;  4C3J B;  4V0B A;  3K7A B;  5C6A A;  3P20 A;  4C56 C;  4ZUI A;  3K5O A;  3A56 A;  2EVB A;  2NTT A;  2K32 A;  4C3H G;  2F0G A;  3HOV B;  2EYL A;  1Q3L A;  4BA2 I;  1LTI D;  4FXG C;  4Q5V A;  1DOL A;  2QEJ C;  4ZQ3 A;  2F0T A;  2HDM A;  3HG9 A;  4IUN A;  1I4H A;  1IYU A;  3D4R A;  3VR2 A;  3R2I A;  4K14 A;  2KOL A;  1SEB D;  3HOX B;  3GTO B;  1D6E C;  1E2W A;  2RBM A;  3GP7 A;  1DM0 B;  1WVL A;  3MFY A;  4IZ8 A;  1D2B A;  1WTW A;  1B50 A;  5CC4 A;  4UAI A;  1EY0 A;  4C3I G;  1PTO H;  1Y1V B;  3C1F A;  1SYE A;  3DWP A;  1TS4 A;  3CKI B;  2SDF A;  2CW0 C;  1H9R A;  1F2L A;  2FFK B;  4DAP A;  3AU7 A;  2E76 C;  1BXT A;  5KIX A;  1JCK B;  2IJ0 A;  2F0K A;  1STH A;  3VYR A;  3VYS A;  2B2T A;  2D5D A;  3NWS A;  3MXG A;  5FOB B;  2BDN A;  2CW0 D;  4Z9C B;  3EJI A;  5JEA H;  3PV0 A;  3WOF A;  2KJX A;  4CHT B;  1OXS C;  1I4Q A;  1ILP A;  1BUV T;  5JVH 3;  1KDC A;  2SNM A;  3I4L A;  3RMH A;  3IFT A;  1SAP A;  4RAU C;  5J1Z A;  2EYF A;  3PUY A;  1EU4 A;  2K03 A;  4IAL A;  2EYO A;  3CRL C;  4MN3 A;  1X3Q A;  2MPM A;  2JEB I;  3MTS A;  1MD2 D;  1Z7T A;  1G8Z D;  3V2T A;  2C5C A;  3N6R A;  5IOC A;  3TZU A;  5IGE A;  1U4P A;  4A3E B;  5A2Q L;  2K1B A;  4BA1 I;  2E2I B;  3K5L A;  3KLS X;  1HUN A;  3EVQ A;  3BVM A;  2DNE A;  4MIU A;  3GTG B;  3MWY W;  3MHB A;  1PZK D;  1S4Z A;  4X3U A;  1H9J A;  3GD7 A;  2F4I A;  1VMC A;  3A8J E;  5BN3 A;  3HS0 C;  3ITP A;  4EVO A;  3TBI B;  3D4D A;  5ELB A;  2A6E D;  4R8N A;  1QJO A;  4DAV A;  2K33 A;  5C3E B;  3U9S A;  5DNF A;  2IX0 A;  2XSC A;  1FGB D;  5D65 A;  2IX3 A;  2NYZ D;  5FO9 B;  5DM7 3;  1DOK A;  2WP8 J;  2RVL A;  2OXP A;  3BG3 A;  4FF1 A;  1BCP F;  2EJF C;  1AZQ A;  3E5S A;  5JEA J;  1Q12 A;  1RDP D;  3DWA A;  3V05 A;  5I2Y A;  1SJH D;  3I8Z A;  3VR5 A;  1BF4 A;  3R2T A;  5JEA G;  3MAQ A;  5E4X A;  4KD3 A;  2ICE C;  1XX8 A;  1CZG A;  1TS2 A;  3WOE A;  4QUC A;  2FMC A;  4KI0 A;  2B2Y C;  4NMZ A;  3IL8 A;  3NTH A;  2F0H A;  1AZP A;  1RCV D;  4F7X A;  4DXF A;  1HQR D;  1BOS A;  3GTP B;  2EDG A;  2X6L A;  1EEF D;  4HMJ A;  2X69 A;  4NKL A;  1XTC D;  1LV9 A;  4ME5 A;  4ZAI A;  2Z4I A;  5D3I B;  3R8B A;  1G2S A;  1SBB B;  2R61 A;  2GA4 B;  3VR3 A;  1UAP A;  1BDO A;  4ILW A;  1VMP A;  4DAY A;  4A3I B;  5FO7 B;  3HEJ A;  4DF7 A;  3FVQ A;  2JA8 B;  5CGK A;  2F0J A;  4I7Z C;  2D62 A;  3NSW A;  2WAC A;  1FNU A;  2PCF B;  4OO1 I;  5JVG 3;  2HCC A;  3ERQ A;  4ZYS A;  3R93 A;  3A8K E;  2RKS A;  3K57 A;  3NHH A;  4OIK A;  3V96 A;  4LAA A;  4IFD H;  3D8G A;  4R9W A;  3CHB D;  1D5M C;  3FPP A;  5G3L D;  3DMU A;  2F0N A;  5FK9 C;  1I4G A;  3OSO A;  3RLF A;  2M2L A;  1H9S A;  3A8I E;  3Q6S A;  1HRJ A;  1Y8O B;  2XRQ D;  3D3R A;  3NE5 B;  4RKL A;  1CA5 A;  4XIG S;  1ONL A;  1SXT A;  3OW7 A;  4DU9 A;  3S9W A;  4TSS A;  1MSH A;  2E74 C;  1WTP A;  3L3O C;  3SK8 A;  1EZ8 A;  2EY1 A;  3KUP A;  2PZT A;  5COR A;  1WTO A;  5M3M B;  4K6L A;  3S1R B;  1LTG D;  1CZW A;  3J81 L;  1JB3 A;  1NR2 A;  3MVV A;  2EY5 A;  3PIO 3;  1CFM A;  1G91 A;  1I4P A;  2L4N A;  5FLX L;  3U9O A;  1HTL D;  4KHV A;  5M5W B;  5JPN C;  4HMI A;  4RHR A;  3FPU B;  5FKA C;  1V1P A;  3PUX A;  3PUV A;  1ET6 A;  5CV4 A;  4HCE A;  2K04 A;  1B2T A;  2R3Z A;  1PZI D;  4C1N K;  4L63 B;  2XIW A;  1I50 B;  4DA2 A;  5C3W A;  2F0L A;  4J6H A;  3RUZ A;  1JWU D;  1NCV A;  1O78 A;  1JWS D;  2O2L D;  3S14 B;  1HFG A;  1M4V A;  4PMC A;  3TSS A;  1A3T A;  4I65 A;  4B9W A;  1I3Q B;  1OXX K;  2RDH A;  5HUR A;  1PTO F;  3A7A B;  3ND9 A;  4IUU A;  1K8M A;  4C1N I;  1Q1B A;  1NUC A;  2NBF A;  3LX0 A;  4B9X A;  2WV6 D;  5ELC A;  1AEX A;  3BVZ A;  4V19 0;  4CGY B;  5CV8 A;  5C44 B;  4NW2 A;  2SOB A;  4KHZ A;  4EQP A;  3LNN A;  1JE4 A;  1AW7 A;  2RQX A;  4EGV A;  3URY A;  5D3D A;  1A15 A;  2SNS A;  1UUP A;  3PMF A;  3J80 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...