4CJ1B

Crystal structure of celd in complex with affitin h3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
63
Chain Sequence
SVKVKFHEKEVDTSKIKKVWRINTRLGMRVAFTYDDNGKTGRGMVPEKDAPKELLDMLARAEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE D
publication title Potent and Specific Inhibition of Glycosidases by Small Artificial Binding Proteins (Affitins)
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/de novo protein
total genus 12
structure length 63
sequence length 67
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cj1B00
1CA5A 1MI2A 1QNKA 2MGSA 4QUCA 1ICWA 5CBAE 5EPJA 4MN3A 1G91A 1IKMA 5EQ0A 1G2SA 3QO2A 1DZ1A 2J7ZA 1WTRA 3LWEA 2HUGA 1SDFA 1EIGA 1F9QA 1NR4A 1B53A 2EE1A 2NZ1D 2FMMA 1ESRA 1WTWA 3TZDA 1SSOA 1A15A 3FPUB 3DM1A 1DOKA 2L9HA 2K04A 5T1GA 2JYOA 4CJ1B 1WTVA 5E4WC 1QG7A 4ZKBB 2MP1A 3KUPA 1DONA 1U4PA 5CORA 2DY7A 2K03A 1U4LA 1AZPA 2L11A 4CJ0B 1NCVA 1DOLA 2H1EA 1AZQA 2B2YC 4HCSA 1EQTA 1HHVA 3SVMA 1NAPA 3D6WA 2CVRA 2HDMA 4CJ2C 1X3PA 2K1BA 4NW2A 1B3AA 1DOMA 1F9PA 2Q8TA 2KEDA 4IUVA 1C8CA 1QE6A 3MTSA 4LMQD 2X69A 4HEDA 1WD0A 4IUUA 4RWSC 5DNFA 4XT3B 1PDQA 5D14A 3R93A 4X3SA 1RODA 3P7JA 2SDFA 1KNAA 2K01A 3I91A 4HAEA 1WVLA 1HUNA 1MGSA 1CM9A 3GV3A 2NWGA 2RA4A 4OIJA 5JJZA 3DEPA 1B4OA 3TN2A 1KNEA 1GUWA 3H91A 3I90A 2R3ZA 3IL8A 1BBXC 2BDNA 1ML0D 5CBEE 2B2UC 2B2WA 1LV9A 2FHTA 1HFGA 2DY8A 2XIWA 2IL8A 3IFDA 5COYA 2KUMA 4R8IA 1EIHA 3GV6A 3HP3A 1O80A 4OIKA 2M2LA 3N52A 2N55A 1ILQA 1F9RA 2B2VA 3F2UA 1RTNA 1ZXTA 2RVLA 1AP0A 1F9SA 1U4RA 1HRJA 1HUMA 5EKIA 2B2TA 2EPBA 4DN4M 2EOTA 4ZKCB 1B50A 1X32A 1TVXA 2NYZD 2RSNA 2KECA 1IL8A 3MWYW 4R9WA 1J9OA 3FDTA 4X3UA 3Q6SA 2HDLA 1BF4A 1HFNA 1BO0A 4HSVA 2HCCA 1JICA 2X6GA 2KEEA 2KOLA 1ILPA 5T1IA 2L12A 5D65A 1XYIA 1BNZA 1S4ZA 1PFMA 5EJWA 2FJ2A 2HCIA 2K28A 1NR2A 3I3CA 2D9UA 1PFBA 4RA8A 1Q3LA 4ZK9B 3I8ZA 1WTXA 1G2TA 1WD1A 3G7LA 4UAIA 5EPLA 3DEOA 1PLFA 4ZAIA 4XT1B 1RJTA 1F2LA 1VMPA 2B2UA 4XDXA 1B2TA 2FFKB 4O42A 1RHPA 1JE4A 2L4NA 4X3TA 4IUQA 2MJ8A 2K05A 4MHEA 1X3QA 3UI2A 1EOTA 2VXWA 2L1BA 2KVMA 4IUPA 2B2YA 1J8IA 4RAUC 2B2WC 2JP1A 4ZLTF 2Q8RE 1U4MA 2X6LA 1CA6A 1VMCA 5E4XA 4X3KA 2N88A 2B2VC 1PFNA 5EPKA 2RSOA 2FINB 1WTPA 1HA6A 1EL0A 4QUFA 1WTOA 2MPMA 1G6ZA 1M8AA 1O7YA 4U68A 2B2TC 4IUTA 1WTQA 3KBXA 4IURA 5AFWA 1RTOA 1E0BA 1SAPA 3ONAB 1MSGA 1XX8A 1MSHA 1O7ZA 1IKLA 5CMDA
chains in the Genus database with same CATH superfamily
2ASBA 2MGSA 1B9MA 3K81C 1JOOA 1YZ6A 2PPBC 1Q90A 4XQNA 3QO2A 4A3EH 3FPPA 2K32A 1B8AA 2H4OA 3T51B 3V96A 4DV0Q 4NKLA 1V8QA 5E4WC 4KKUA 3PSIA 3NEMA 1DONA 2EQSA 4BY1G 5BR8L 1X3FA 4DR3Q 5C3WA 1ZYRD 4AYBG 2WP8J 3L3OC 3DM3A 3J7AV 4LWCA 4IUUA 3HOWH 1Y8PB 3CQZH 1XMOQ 2JA8H 1QILA 2O5IC 4DR1Q 2LFNA 3H94A 3JAML 4A3FB 2NWGA 1Q1BA 2RA4A 5KGUA 4X64Q 4LJZC 4KLKA 1TWAH 1BVSA 1JWSD 2IW3A 3ICEA 3RZOB 3PO3B 1LV9A 2XIWA 1L2FA 5G3LF 2RHSB 4BBRG 4A3BB 5CV5A 3I4MG 3S16H 4YIJA 1O80A 3A54A 4FVMA 2MO0A 4K6LA 3GTOH 5IGDA 2R92B 2I0QA 1DXMA 1FNWA 1E3PA 1KABA 3J81i 4QCLA 4YCVA 4P2CB 2ES2A 4DR4Q 3P75A 2KECA 3CMAA 4C3JG 2D0PA 4OX9Q 4N8FA 2OTJA 1VQFA 5JVH3 4NP5A 1BBWA 4R4IA 1E1TA 3W3AA 4A3DH 3STBC 3V05A 1UAPA 4HJ7A 1B7YB 1EQVA 4YY3L 2WFWA 4IFDJ 5C4XB 4QL5A 2ZT9C 4ZK9B 1WTXA 1BCPD 5C4HA 1F2ZA 1VMPA 5BN5A 2XSCA 3HOXG 3BDCA 4H7BA 1GKHA 3GQBA 2IX3A 2LXJA 2QA4A 1PH5A 3M9BA 3HOYH 4G7OC 1L0YB 1J8IA 1MHWC 2WKCA 4RAUC 1YNND 1L0WA 1IYVA 3KF6B 3L0OA 4K5WA 4ODGA 2AQ2B 4LFAL 4ZUIA 2F0VA 3M3YB 1EIYB 2F03A 4JI2Q 4H0LC 2JA5B 3CAMA 1Y1VB 2E5LL 2BH2A 2KQ3A 4DR2Q 1VQHA 2Y0SG 5DLQE 3NP8A 4I65A 4OL7A 2F0FA 3EJIA 1BCPB 1SMYC 2EE1A 4DK1A 3HKZE 2L9HA 4OO1G 4GLAC 2E2IB 4CJ1B 5EAYA 2VQEL 1QG7A 1A3TA 1EY0A 1OXUA 1YNJD 3I4NH 2NVTB 1OXSC 5IYCG 1STHA 1NAPA 3AU7A 2MHVA 3HG9A 4L6TB 2EYMA 3MTSA 1MJEA 1L1OC 4FXKC 2EYLA 2ZXRA 2WINB 3S9WA 1Q8IA 1N36Q 1R9TB 1CM9A 2VQFL 1VQ4A 2OF1A 4WFN3 4HR7B 1YHBA 3CCJA 5CBEE 1G291 2FHTA 2IL8A 4LUZA 3VYUA 1SYDA 2E74C 1HNXQ 1U0LA 3R8BA 1PTOC 1ILQA 1PH3A 3K8AA 3TBIB 2Q2TA 5LHY1 3PUXA 4JI4Q 2IX1A 3BS1A 3PCOB 4RHSA 2JA9A 1TS5A 1HUMA 4B3TL 4CDEC 2Z1CA 1MD2D 2CQOA 3FKIB 2VW9A 4N9PA 5IOCA 4BS9A 4DUYL 2P5ZX 4IFDH 1ZKOA 2ID0A 4A3FH 4WJ4A 2UUCL 2KOLA 5AJ3Q 5T1IA 3K59A 3CP0A 3PO3H 2FJ2A 3CCQA 1I4HA 3I3CA 4A3BH 4PMWA 4GKKQ 3K6OA 4K14A 3CRLC 1XTCD 5IY0A 4UAIA 4DV1Q 1QZGA 1TIID 4X3TA 1JE4A 3LWUA 2R92H 4ZYSA 1GOZA 1CKMA 1WFQA 1JR0D 1VQBA 4GOPA 3CC2A 1I4PA 1STEA 3T16A 1K8GA 3SHLA 3SK8A 1CHQD 5NUCA 4JI0L 4KI0A 5DEHA 1QZHA 4BBSG 2WIIB 5C4XH 2UXBQ 1CTMA 3HOZG 1O7ZA 1KHIA 1A0IA 1GHKA 4HIDA 4S3SA 4DUZL 1G91A 4LAAA 1WTRA 5CV7A 1JJ2A 4GS3A 4J15A 4A76A 1B53A 3D6CA 1Z9FA 3S1MB 3CF5A 2HIVA 2L15A 2JYOA 1SN8A 1KRSA 2N8NA 4DXGA 4POGA 3M3YH 1IBMQ 3NBHB 2B63B 4XQJA 4BY7B 5KNCA 5KYLA 2JA5H 1Y1VH 4JI1L 1TQOA 1GHJA 3QOJA 2F0UA 3A0JA 4J8QA 2X69A 5JJIA 3Q8DA 2CH4A 2KHSA 4G4KA 2YU9B 3CC7A 1MGSA 1I3QB 3HZXA 2NN6I 2F1MA 3M7NA 2ICIA 2QCPX 3BJUA 2E2IH 4J1MA 4DK3C 1EQRA 4F7XA 2NVTH 1I4GA 4ZQ3A 2A68D 1SNQA 4AQYQ 1JMCA 3F2UA 3FP9A 1SNOA 2F4IA 1AE3A 2EJMA 2B2TA 4ZKCB 3E9IA 2RHQB 4OWXB 2EXZA 3GP7A 5IYDH 1R9TH 5C3EB 3Q23A 4O0AA 1MKHA 2RCFA 2ATWA 2PMZB 3W1BA 1E2ZA 1LUZA 2WAQG 2F0WA 4K8JA 4DV4L 1GUTA 1G2TA 3GTGB 2UU9Q 4LF8Q 3PUVA 4XT1B 2I5MX 5E7NA 4DK6C 1JWUD 2PW5A 4DR7Q 1EZ8A 4P73A 3NSWA 1X9NA 2F4VL 1FD7D 2NN6H 1CT1D 3K57A 3FKIH 1IZ6A 1E2WA 2Q8RE 4R4OA 2CCZA 1NBWA 4A4IA 3E0EA 1EZ6A 3PIO3 2NVYB 1UEBA 5E4XA 1V1PB 3GO5A 5IT9L 4FF4A 1D5MC 2FINB 5CV8A 4QUFA 4B3SL 3BVMA 4NXNL 3J7A5 4IN3A 1SAPA 3UDFA 3H15A 5J22A 4KHVA 3PO2G 3ER0A 3J7ZC 3KLSX 4RCNA 1U9RA 1S5FD 2NBFA 1NR4A 2NZ1D 3CCVA 1N33Q 4GNXA 1A15A 2DN8A 1NTGA 3C3LA 5I6WA 3TSSA 4H44C 1Q7YC 3KUPA 3OIQA 3HOWG 1H9SB 1SE3A 2JK8A 2JEAI 4Q0FA 4ZCKA 2GVAA 2KCTA 1S40A 3ZYYX 1STBA 1D2BA 4CJ2C 1VQEA 3KFUA 3DLLA 3U9OA 1SLJA 3KOJA 4LF6Q 1R4QB 1IYUA 2JQOA 3I91A 5IIFA 1XTDA 3S1MH 2BE5C 1LTAD 3JAMi 3S24A 3K5MA 1N34L 4B3ML 3VYRA 1TWCB 3V2TA 1HZ9A 1UE6A 5IP7H 4A3KB 2PNRC 4L5TA 4X65L 4KHPQ 2GVBA 4IJHA 3TS0A 4A93G 2B63H 4IZ8A 4BY7H 1N9WA 3J81E 4HJ5A 3L7ZC 1AP0A 1F9SA 2N78A 1MIUA 4NPSA 3T1YL 2RBMA 1B50A 2ZM6L 3TP8A 1VS0A 1EIHA 2UXCL 3NQTA 4BXXG 2F3WA 2HCCA 3K0XA 1IBLQ 1I3QH 2KEEA 4ABNA 1PHJA 4KKTA 3X3MA 5JPMC 2OT2A 1D6EC 3RLOA 3M4YA 1JOKA 4POFA 2F0DA 3MXUA 4DNTB 5M9OA 4X62Q 1I94L 4E6IA 1DGSA 3A8IE 4IUQA 4K6DA 1SE4A 2V1CC 4DV5L 4JW0A 3J80i 1HJPA 5LMNW 1VQJA 2VS1A 3TRZA 3GD7A 2VY3A 4KY7A 4F87A 2QKIC 4V190 3WOEA 5C3EH 2K50A 4DU9A 3K7UC 5EPKA 3MXPA 4AH6A 5HGQA 1WCMG 1I4XA 1G6ZA 1CHPD 4PMCA 3GTGH 4RGMA 5C5LA 4HCEA 2R93B 1WOCA 2OWOA 4LFCQ 1SYGA 4JI5L 5I9OA 3UDGA 4YWMA 3U4VA 5FO7B 2BA0A 1V1OA 4R4QA 2ZXOA 3GTJB 3I4OA 4C3IB 5C44B 1PH4A 2NVYH 1A2TA 1LABA 4BA1I 1H9JA 2R7FA 2L55A 1CQFA 1TS4A 1WI5A 4JI7Q 3A5UA 3M4OB 4GKJQ 1OXXK 1STNA 4YHHL 5LMNQ 5K36G 3KBGA 3S2HB 3G6EA 1QJOA 3M85A 5CR3A 5GADC 1YNXA 4LF4Q 1YIJA 3PUZA 4ILWA 1P8LA 2CQAA 5M5WB 3ULJA 5GAHC 3BDOA 1HFGA 4YCUA 2EYPA 2K5DA 1VF7A 4JCVE 5LL6X 4DV2L 1D5ZC 1SNDA 4JVZA 2D62A 2EOTA 4RH6A 3BDLA 1FGUA 2QEXA 4IOAA 3ND9A 4HIKA 5C0XJ 4DA2A 5IGCA 2A69D 2X6GA 4RKLA 5I6YA 1RD9D 1TXYA 2L12A 5D65A 1XYIA 4QF4A 1IHZA 1EFWA 1H95A 3HOUB 5EJWA 1TWCH 1R4PB 4A3KH 4B3RL 5GROA 1T5XD 2LXKA 5C4ZA 5I2XA 1PV4A 2E2JB 1HNWL 4HJ9A 1ASYA 4YWKA 1HNZQ 1ENCA 3OTOL 4JV5L 2L1BA 1S5BD 2XTIA 2UUAL 3PQIA 3LX0A 3MEHA 2F0IA 3H09A 2IWHA 1KL9A 4X3KA 1J6QA 1VQCA 3E0JA 4FO2A 4JBMA 3QJYA 2RSOA 1H9MA 1VQMA 3NENA 1X56A 4FP5D 4YY3Q 1UNSA 1QCBD 1Y1WG 5AFWA 4A3LH 1RTOA 1J9OA 1HQMC 1CFMA 3VR6A 5F2DA 2MNAA 1JCKB 3G48A 2JJQA 2EIFA 2EJGC 4KTAA 1RCVD 2ALYB 2CWAA 5M3FG 4DV6L 2FMMA 1Y69U 1JJGA 2PI2A 1VCIA 3HRZC 2K04A 1WTVA 1AZPA 3KDFB 5G3LD 2M00A 3SDZA 4C3HB 2R93H 1X3PA 2PYKA 1B3AA 3R93A 4X3SA 3SE0A 1RODA 2PMZE 4ID6A 3GTJH 4P72A 1XNRL 3GV3A 4C3IH 5C44H 3PV0A 2CFMA 1ML0D 3PIP3 3IFDA 3DMUA 2DY8A 1SYEA 5ELNA 1BCPC 1VQIA 4DAPA 1Q82C 3HP3A 1X6OA 2H5XA 2ZTEA 3EBEA 4Y52H 2Z4IA 5C0XH 4PZ7A 3AB9A 1CK1A 4JOIA 1QVFA 3H0GG 4TSSA 3S2HH 1VQAA 1PFSA 1EYAA 1YNNC 2RKSA 3HKSA 4JG2A 4YWLA 3NXWA 4CGYB 5L37A 1PZID 3RZDB 3KJPA 4TVAB 2OEOA 2E75C 4ME3A 3MHBA 5M5WH 1Q81C 2JA6G 1STAA 2HCIA 4OWWB 2Z0SA 5FO8B 3ND8A 1WD1A 1HXYD 1A62A 2FFKB 2L4NA 2N3SA 2DUDA 2MJ8A 4HMJA 1D1KA 4JI6L 5FJ8G 4HN7A 2NZOA 3TREA 4RMFA 2I46A 3A7AB 4A3CG 5LMUQ 1M90C 1JB3A 1CA6A 4LFBL 4DUYQ 2AUJD 2R61A 4DF7A 5KYIA 1KLGD 1SR3A 3HOUH 3RUZA 2F52A 1A2UA 4JYAL 1M8AA 3NTIA 1PRTD 1KAAA 2CHBD 4A3MB 2E2JH 2IT1A 2XN9C 1XX8A 1W3SA 1LTID 1NY4A 3I70A 1MSHA 2A6ED 5FOBB 5CBAE 1ICWA 4RGTA 1EWHA 3NE5B 1TKWB 1D5XC 3AFQA 3GTKB 4L5QA 3S17B 1XMQQ 3OOCA 1SSOA 1QUQA 5IODA 3PIPA 3PMFA 4L5SA 1QVGA 1XNQL 4ZKBB 4A3GB 3CKIB 4CDFC 3F2BA 3S1NB 5CORA 2RDHA 3H6MA 3WOFA 4UPAA 3T53B 4X66L 2Q2IA 1G8ZD 2WB1B 1N8RC 4JI3Q 2XGTA 1AE2A 1GJXA 4EX5A 2F3IA 4DUZQ 3P7JA 2MUYA 2RQXA 2Z4HA 5HGTA 2E2DC 3DEPA 5IP9G 3TS2A 5IWAL 3QG1A 2Z8LA 3MVVA 2VUMB 4JBKA 1GUGA 1GO3E 1PRTF 1BQQT 2F0NA 1UEAB 3NTKA 2JA7G 4C3HH 4IO9A 4A3JB 2OCEA 1X54A 4A3IB 1PXUA 2M9VA 5ISRA 1CKNA 5IYBG 2PW7A 4X3UA 1K9MC 4DV0L 2CW0D 3GTPB 4HSVA 3K5NA 1NJIC 5M3MB 1I6VC 1LTTD 4EQNA 1D7QA 4DXFA 4K0KQ 4WRDA 2PQAA 2RDGA 1PFBA 4RA8A 1Q3LA 1VQKA 4HJ8A 1O7LA 3DHQA 2WKDA 4O42A 3J80E 3N6RA 3UI2A 3H3VI 1XMOL 2B3GA 3ULPA 2UUBQ 4DR1L 1BXTA 4BY1B 3AYHB 2B2WC 4AYBB 3RZDH 1ZEQX 3DWQA 1L1OA 5FLMG 3RZOH 4HIOA 2K5WA 2WV6D 1Y8NB 3ONAB 3NPPA 1LT5D 5D3DA 1MI2A 4DR4L 4LNQA 5EPJA 4DKAC 4RFBA 4BBRB 3I4MB 5EQ0A 4OX9L 3FVQA 5D3IB 4A75A 1F9QA 2GN5A 3RMHA 2VNUD 3DM1A 1DOKA 4PG3A 4ME5A 1CZGA 1F2MA 1D8LA 1JWMD 5FLXE 5FKAC 2YTVA 3H3VH 3TDQA 4C3JB 4DV7Q 4B3SQ 1AZQA 1VQ8A 1ASZA 4A3MH 4FF1A 4CHTB 3NWSA 4GN5A 1F9PA 3DWAA 2JSOA 4IUVA 1WD0A 3GTKH 1PDQA 3PUYA 2K75A 3S17H 2HHHQ 3QR8A 1F2YA 1TWHB 1X3EA 1S5ED 4F88A 3HOXB 5JJZA 4KJOA 4OHJA 1BBXC 4PMBA 3S1NH 1K0RA 4LF5Q 3TEHB 2UXDQ 1IW7D 2C5CA 1AFPA 1OXVA 1EUJA 1KDAA 5A2QE 3A7LA 4MTNA 1HR0W 4K2LA 2Q2HA 1D1IA 4A3KG 4KD3A 4TRDA 1K83B 1G51A 3QWNA 2O5JC 2D5DA 5EKLA 2Y0SB 4HSPA 4GLVB 4NXML 1WTHA 4R4TA 5KEEA 2PZTA 5CGKA 1B1ZA 3U4ZA 3KJOA 1N34Q 1EY9A 2VUMH 4G57A 4AIMA 1X65A 5HURA 4QY7A 3SK6A 3K58A 4A3JH 4HIMA 1HZCA 2E2HB 1JC7A 4Z9CB 3X3NA 2R7ZG 2Z6KC 4A3IH 1N36L 3J81c 4EQ5A 3HKZG 1U4MA 2ZM6Q 2EY2A 2AMCB 3GTPH 1GUOA 3CCLA 4GOPB 5M3MH 4IPHA 4OXPA 1IBKQ 1Q12A 2EY5A 4DR6Q 2V4DA 3DXJC 1HNXL 3Q22A 3KF8A 1OO9B 2FXQA 3NQIA 3E3XA 5IGBA 1O7YA 1PTOF 1HR0Q 4JI8Q 1KD1C 2XRQD 5FK9C 3E9HA 1V43A 1BDOA 3K5LA 4DR5Q 4BY1H 5E3FA 3F8TA 3J7YW 4DV5Q 4MNOA 5C5MA 5AJ3L 1WTWA 2R93G 1EOVA 2R7DA 3RR5A 2Z6KA 3PUWA 1C4QA 1WJJA 4OEMB 4GKKL 5M5XB 1U4PA 3IKJA 4DV1L 4A3EG 2K5NA 4CJ0B 3A56A 1SXTA 2NVXB 2H1EA 4UY8C 2A1AA 1TY0A 1IXRA 3J81L 1G6PA 2KENA 1QE6A 4BBRH 3K80C 1VQ9A 3I4MH 3CHBD 2SNMA 2OQKA 3HEJA 4XQQA 1PH6A 4O1NA 3M7GA 4OIJA 5C0XG 3GTQB 3PF4A 3CRKC 3I72A 2R3ZA 2BDNA 4C2MB 3GTLB 4C3JH 3UDXA 2JA8G 4YCWA 1EQQA 4Y7NB 4EQPA 1U4RA 4BBSB 4YHHQ 1N32Q 3BVGA 3T56B 3VDYA 2QW7A 2RSNA 5JEAJ 4OO1I 3FDTA 1TWHH 3I2ZA 3HOXH 3HOZB 1CKOA 2EDGA 1JB7A 3F2CA 4B9WA 2IHFA 1IBML 3GTMB 2OQ0A 2D9UA 4DFAA 4UP7A 5EPLA 3D8GA 1VF5C 1HZBA 1VQPA 4XDXA 1XPOA 4A3DG 1RHPA 3MXNA 2G5DA 2EJFC 4ZLTF 1AEXA 1K83H 2YU9H 5IGEA 3PIOA 3T13A 1TWFB 2QEJC 2B2VC 1LACA 4F8MA 4DAVA 1H9KA 2CH4W 1CI3M 3HOYG 1BBUA 2WB1E 5EBDA 5CC4A 4TQUS 4U68A 3D4WA 4AQYL 1WTQA 5GQOA 1LM0A 1S5DD 5KNBA 5EGTA 2CKZB 4OO1H 2KCCA 2TMPA 4ZRZA 2K1BA 4XIGS 1GUNA 1TS3A 1CA5A 1KIXA 2ZXPA 2LS01 1IKMA 1FGBD 2Z9HA 2BDOA 2HIXA 4JV5Q 5IYCH 4DGZA 1FJGQ 2NTTA 2ZTDA 2BOSA 3SXHA 4GNXB 4DV3Q 3CC4A 4DNIA 5DM63 2UU9L 4LF8L 3S1RB 2OTLA 3HOVB 1V1QA 2J4XA 3MEFA 2B2YC 1TT2A 1U5KA 1EU4A 4DR7L 4MTKA 5M5YB 3CXCA 4FXGC 4OONA 4QB4A 4APVA 1SFOB 2Q8TA 3SK4A 1C8CA 1K3RA 2WAQB 1J5EQ 3I4NG 2PQEA 1UE5A 1A8VA 4DV6Q 4KY5A 3TN2A 2NUCA 1GXDC 2DNEA 4CBVA 1TR5A 2SOBA 4KK7A 1ESFA 5M5XH 3RLNA 1PH2A 2NTSA 2NVXH 5JEAH 5JAVA 3A8KE 4AYBE 2ZJRA 4DAYA 2EPBA 3E5SA 1N33L 1TVXA 4HTHA 4I7AA 1BOSA 1KQSA 1BO0A 1SE8A 3PO2B 5J39A 3BZDB 3GTQH 3KK7A 1VQLA 4C2MH 2K28A 2C9OA 3GTLH 1M4VA 3I8ZA 3VYSA 3A5ZB 4MIUA 3D4RA 3G7LA 4OELB 5BR8Q 4IFDG 1K3BC 4Y7NH 1F2LA 4A3FG 1AH9A 4WJ3M 2ZTCA 4LF6L 2K05A 3CPWA 4BBSH 2A6HD 2DNCA 3HOWB 4K5VA 3PO3G 2YTYA 4IUPA 3WDNA 4A3BG 3MA2B 3QIAA 4IALA 1ENFA 2VB3X 3HS0C 1PVOA 1O78A 3I56A 3HOZH 2PZWA 2BCOA 2R92G 3KLRA 1YEZA 2FMCA 4KHPL 3GTMH 2JN4A 4ULLA 1BR9A 3EVQA 3OSOA 3PGZA 2E8GA 3I4LA 2EYFA 1E0BA 2PCFB 1NMGA 1XWEA 4CDCC 3EIVA 4MN3A 4JI6Q 3EA6A 5EBCA 1LTSD 3UE0A 5C4XG 1IBLL 3R3OA 4ZUJA 4A93B 2EY1A 1Z7TA 2RF4A 4UP9A 1EIFA 3BYTB 4HMIA 4LF7L 1TWFH 1VQGA 1KC8C 1LTLA 1Q1EA 1XPUA 4JYAQ 4X62L 1ZYRC 4HCSA 3ZJYC 2F0JA 3UDIA 1JJCB 3CCEA 5JVG3 1H9RA 3H3VC 3VR3A 5DNFA 2Y0SE 4XT3B 5H1SE 1LLRD 4L5RC 5IE8A 2F0HA 4U673 2JA5G 2QILA 1Y1VG 3T1HL 1HPCA 3QB3A 4KJNA 4BA2I 4B9XA 1S3OA 4LK1C 3P20A 3S1RH 3L9AX 3HOVH 1OTCA 2M2LA 4RGOS 4LFCL 1O7IA 1WYDA 4LFAQ 1F9RA 4H02A 2F0PA 5I2YA 1SYFA 3VA7A 1SFOH 4G7ZC 1WCMB 4GN3B 2E5LQ 2K5VA 3F2DA 1JT8A 2HT1A 4WORA 4GLXA 3TZUA 1VQ6A 5C6AA 1ENAA 3JAMc 1S4ZA 5KRUA 4LF9L 1NR2A 1VDZA 1SNPA 1L0XB 2VQEQ 1PH8A 3R2IA 4WJWA 4GKJL 3DEOA 5IYDG 5LMNL 2A6EC 3MFYA 1HA5A 3M4OH 3URYA 4EVOA 1VQDA 3AEVA 2KVMA 2ENBA 5LL6S 3S15B 4LF4L 3AFPA 3U9SA 3C1FA 3KF6A 4EGVA 3TQYA 2N88A 3PO2H 2AQ1B 3IFTA 3NK9A 2VQFQ 1PFNA 3UE1A 2NB0A 3I73A 1YJNA 1LT3D 3OMCA 2NN6G 4JC0A 1M1KC 3FKIG 5JJKA 1F77A 3KBXA 1TU2B 1CQVA 3OW2A 4R1JA 1HQRD 4LUOA 2F0SA 2F0QA 1ET9A 1NNXA 1UWVA 1G2SA 5JPNC 3LWEA 2K6AA 4B3TQ 1SDFA 3CPFA 1NMFA 3VYTA 1JORA 3J80c 2D0OA 4IOCA 2EYHA 4C1NI 2K33A 2TSSA 5T1GA 1PH7A 2UUCQ 3G6JB 1T9HA 4IQZA 3W2DA 1YNJC 2L0CA 2DY7A 1K8AC 2K03A 5EKKA 1LO5D 3Q24A 3MXGA 1QB5D 1HNZL 1EU3A 2CVRA 2LMCB 3A55A 1Z47A 2O2LD 2K4KA 4ALPA 3BZKA 3W5OA 2CW0C 4XXEA 1WVLA 4A93H 1KNAA 4CKCA 1EY5A 3P1HA 4B08A 3FEWX 4QIWB 2PZUA 2Q8IB 1GVPA 1KNEA 3H91A 3IL8A 3OYYA 2B2UC 3SK5A 3VR5A 1C48A 3GV6A 4JI0Q 3BVZA 3EN2A 3N52A 2AQ3B 1Q8KA 4BXXH 2EXDA 2B39A 1KTKA 1XXGA 2A74C 2D2CC 5FLXc 4K2KA 1QVCA 3J80L 1IYJB 2BH8A 4EQOA 3NBIA 1EY8A 5IP7G 1X32A 2NYZD 1IL8A 3JAME 1PRTB 3O13A 1Y1WB 2B63G 4BY7G 1JICA 1NUCA 4K5XA 3S14B 1PFMA 3A8JE 3RD4A 2QF7A 3L2PA 5M3FB 4IPGA 2K5HA 1RIPA 3F1ZA 3S2DB 1STGA 2EYJA 4NB3A 2AKWB 2B2UA 1B2TA 1SNCA 2IY5B 2KCMA 1TWGB 3RLFA 1WCMH 4JI1Q 2A19A 2VXWA 3ITPA 1JQYD 1MJCA 1Q86C 3D0FA 1GM5A 1P16A 1YI2A 2Z6BA 1VMCA 3CCRA 3STBD 2MFIA 4IFDI 5I9PA 1STYA 1BCPF 4NXMQ 5C4JB 1YVCA 4DR3L 1PMRA 3KLWA 1SBBB 4R4CA 1Y14B 5FLXL 2DJGC 2WAQE 1PZJD 5C3EG 1IKLA 3IRBA 1YHQA 1ICFB 4UDUC 1RL2A 3MZ5A 2J7ZA 1FVIA 3S15H 1BKBA 2MQHA 1EIGA 1BUVT 4R8NA 3W1GA 4X64L 3TP5A 5K36H 3H0GB 1QUQB 3NBHA 1A3VA 2CWPA 2L11A 4PQXA 1IW7C 3MC0B 4GOPC 4DV4Q 2JA6B 1DOMA 1PYWD 4LMQD 5A2QL 2ICEC 1S72A 5I4DA 4RHRA 5LMUL 2F4VQ 1I50B 1VQ5A 3J81j 2YTXA 5CV6A 1SMYD 1HUNA 2F0EA 1FL0A 5JEAG 4DPGA 1DJRD 1GUWA 2B2WA 2ZJPA 1PA6A 1K73C 2A68C 1GUSA 2EY6A 1CUKA 3M4QA 1SE2A 3E6ZX 3TMEA 2A8VA 3SEBA 2LKVA 2LSSA 2RDFA 5ELFA 4NXNQ 1UE1A 3BU2A 4UHVA 4KMUC 3J7AF 5JJLA 2HQLA 4DN4M 2F0GA 4P75A 4RKBA 5IGGA 1XMQL 3GDEA 4LW1A 3CCUA 1BF4A 1VQOA 4KV6A 2KCNA 1Y8OB 3BYYB 1CKNB 1LYLA 4FF2A 3C1EA 3DUZA 1EYGA 4A3GH 1PH9A 4JI2L 1SYBA 5ELCA 5ELEA 1PLFA 4JI3L 3WWVA 1PTOD 2PQAB 4DR2L 4JBJA 2JE6I 3K0YA 1CZWA 1DD2A 4MHEA 1SRUA 5HY6A 3OWEB 3SGIA 5A35A 1Z6HA 3K7AB 1V1PA 3OW7A 1Y1WH 1XPRA 4UP8A 1I5FA 3S14H 3BG3A 1HTPA 1L1OB 1YJ9A 4B3MQ 5M3FH 2B2TC 3CCMA 2K14A 3RN5A 1LT6D 3S2DH 2QDLA 4IURA 4V0BA 3VR4A 2IHEA 4X65Q 2G9DA 3S1QB 3EFXD 1IL2A 4K8IA 2AWNA 1QNKA 1TWGH 4XTCS 2O4XA 4DK0A 3RN2A 1SROA 1LTGD 2NVQB 3U50C 3T1YQ 2HUGA 2JA7B 4Q5VA 5BN4A 1ESRA 3TZDA 2XNAC 1PTOB 1II3A 4A3LG 2BA1A 2UXCQ 2F0MA 2N49A 4K0KL 1H9SA 1JOQA 5CYUA 1PH1A 1NE3A 1PYBA 5C4JH 5IT9c 2VL6A 3OHXC 4CDDC 2I5LX 3ERQA 1NCVA 4JI4L 2Q2UA 3JC66 3OMGA 3D6WA 5KNDA 2HDMA 4I7ZC 1VQNA 2UUBL 1DM0B 4IPCA 2KEDA 1I94Q 3Q0AA 4RWSC 3HOVG 4RCOA 3EROA 4N9TA 1C7YA 3OWFA 4GN4B 2HD3A 2A5HA 3H0GH 2G9HD 4R8IA 5COYA 2DGYA 2KUMA 5FO9B 1YJWA 3U58A 4OIKA 2WACA 5TSSA 4C3IG 3MFGA 5C44G 2VZAA 1HZAA 3B6YA 1VQ7A 2RVLA 4GNXC 2JA6H 3LNNA 1EWIA 2EZVA 4JI5Q 1B44D 3CW2C 2K52A 3MWYW 1I50H 1RDPD 1HFNA 3OPOA 4H13C 1B9NA 5CV4A 4C1NK 4KN4C 2AUKA 4FXDA 1BNZA 2PO4A 5FJ8H 4DV7L 1EEID 4N8X1 2UXBL 1LT4D 5ELBA 3CD6A 2LY7A 4G7HC 3CU7A 1Q46A 1I4QA 4A3CH 2KHIA 3M4PA 4P71A 4PNYA 3NTHA 1X3QA 2I07B 1RF2D 2KBNA 2HHHL 1HCZA 2B8GA 4JBWA 4O2DA 4P74A 2PI2E 4OGQC 1QWYA 1E2VA 1W6KA 3NWTA 4JK1C 2F0KA 1E22A 4LF5L 2A73B 3LGJA 4XYOA 2UXDL 3KYHC 1T5EA 2JXMB 2F0OA 3KF8B 3D3RA 1AW7A 1K0SA 4QQBX 1YBYA 1YITA 1B70B 3HFZB 4QUCA 1FNVA 1NSNS 1KDCA 4QIWE 3HOUG 1KRTA 4CKBA 4X6AH 2HQEA 4DV2Q 1HH2P 2DJFC 4M8AA 4QGUA 1E24A 3NUCA 3A74A 3K7AH 2KJXA 3T4AC 3FPUB 2MO1A 5IT9E 2R6GA 4NMZA 4DAMA 4PV1C 2XWJB 3TP7A 4FYDA 5GAEC 1W6JA 2GA4B 4B3RQ 1EQTA 2B8FA 1TS2A 1HHVA 4GZYC 3S1QH 5IP9H 1HNWQ 2E2HH 3C46A 2NVQH 3OTOQ 2JA7H 4HAEA 2SDFA 2K01A 4IJLA 1KDBA 1IBKL 1PTOH 4DR6L 2UUAQ 1K8MA 1B4OA 2NZHA 1X55A 2KA7A 4LF7Q 2R7ZB 4JPBW 3PF5A 2B29A 5IYBH 3HKZB 1HR0L 4JI8L 1ONLA 2F3VA 4KHZA 4DNRB 3C2PA 1SNMA 2B2VA 1UE7A 2SEBD 4DR5L 1ZXTA 2A6HC 1EFID 1OXTA 1MBYA 1KXLA 1LTBD 4L8JA 1FR3A 1I6HB 2EYOA 1SMXA 2ZJQA 4R9WA 2HDLA 4PZ6A 2A69C 4C3HG 1A6XA 5ELOA 4FDBA 2BE5D 2PNHA 2C35B 2L5TA 3T1HQ 3AMUA 2KHJA 3CMEA 1V9PA 4TKOB 1EYCA 4ZAIA 1RJTA 1KAWA 5FLMH 1PZKD 1DYQA 2YYZA 1EOTA 1GD7A 3FRPB 4A3EB 1UUPA 2B2YA 3BZCA 3MXNB 3QOLA 2RCNA 3D31A 3R2TA 3TP6A 1EYDA 5BN3A 1XNRQ 4PZ8A 4J6HA 1TY2A 2J0TD 5GAGC 1HA6A 1EL0A 1DCZA 1WTOA 2MPMA 3IAYA 3KLSA 4LF9Q 1EEFD 1B3QA 1A63A 5J3BA 1N32L 1LTRD 5CMDA 4RGNA 4BWGB 1XJVA 3NELA 1CSQA 2AWOA 1DZ1A 3CQZB 3FMCA 3OIPA 1KLUD 2OXPA 1JE5A 4RG1A 2JA8B 1E7ZA 4XYQA 3DWPA 4KD4A 1SEBD 2QGQA 3RNUA 1TWAB 3SR1A 2IPKD 3KDFA 2MP1A 1S5CD 3S16B 3G71A 1U4LA 3HGBA 4KY6A 2XVSA 1DOLA 1QOHA 3SVMA 2I5HA 3GTOB 4NW2A 4C56C 2JEBI 5E1FA 2K7VA 3MAQA 4HEDA 4OWTB 5D14A 2E76C 1SJED 4FNFA 2YV5A 4A3DB 4QJFA 4A3MG 4CKEA 2XWBB 1I4RA 3I90A 4LFBQ 1FNUA 1QNUA 4IPDA 3I7FA 3NHHA 1EWCA 2N55A 4IUNA 2QDBA 4KKSA 5KIXA 1RTNA 4LUVA 3CCSA 3ULLA 1C9OA 2VB2X 1HRJA 5EKIA 3HOYB 4A3GG 1EY7A 5J1ZA 1FJGL 1HTLD 4DAYB 3Q6SA 1EY4A 3ERSX 2AHOB 1YHAA 1W2BA 1ILPA 4DV3L 2WB1G 4L63B 2R7ZH 4NDXA 4FF3A 1CSPA 3AQQA 1XNQQ 5DAUA 1A3UA 3K5OA 5IGFA 3VR2A 2EVBA 4X66Q 1SJHD 2SNSA 1SYCA 1J5EL 5M5YH 1RKNA 5ELDA 1X3GA 1FYCA 5CV9A 3EQLC 5C0XI 2VUMG 2JP1A 1I6HH 3G4SA 5C3XA 1EY6A 2X6LA 2F0LA 1ET6A 2XRSD 1K28A 2IX0A 4KN7C 4A3JG 5DM73 1WTPA 4QMGA 5K5PA 2F0TA 4A3IG 3I4NB 5IWAQ 1E1OA 4JOIC 4M1UB 1K8OA 1C0AA 1AN8A 1PRTC 3FHWA 4IUTA 5JOBA 3I55A 4JI7L 4HJAA 3VA5A 1PYSB 3D4DA 1MSGA 5M3MG 2IJ0A 4MZ9A 2K5QA
chains in the Genus database with same CATH topology
2MGSA 1B9MA 1JOOA 2PPBC 1Q90A 4XQNA 3QO2A 3FPPA 2K32A 2H4OA 3T51B 3V96A 4NKLA 1V8QA 5E4WC 4KKUA 1DONA 5C3WA 1ZYRD 2WP8J 3L3OC 3J7AV 4IUUA 1Y8PB 1QILA 2O5IC 2LFNA 3H94A 3JAML 4A3FB 2NWGA 1Q1BA 2RA4A 5KGUA 4LJZC 1JWSD 2IW3A 3RZOB 3PO3B 1LV9A 2XIWA 5G3LF 4A3BB 5CV5A 4YIJA 1O80A 3A54A 4FVMA 4K6LA 5IGDA 2R92B 1DXMA 1FNWA 1KABA 4QCLA 4P2CB 3P75A 2KECA 4C3JG 5JVH3 4NP5A 3W3AA 3V05A 1UAPA 1EQVA 4IFDJ 5C4XB 2ZT9C 4ZK9B 1WTXA 1BCPD 5C4HA 1F2ZA 1VMPA 5BN5A 2XSCA 3BDCA 4H7BA 3GQBA 2IX3A 4G7OC 1L0YB 1J8IA 2WKCA 4RAUC 1YNND 1IYVA 4K5WA 4ODGA 2AQ2B 3M3YB 4ZUIA 2F0VA 2F03A 4H0LC 2JA5B 1Y1VB 2KQ3A 3NP8A 4I65A 4OL7A 2F0FA 3EJIA 1BCPB 1SMYC 2EE1A 4DK1A 2L9HA 4OO1G 2E2IB 4CJ1B 1QG7A 1A3TA 1EY0A 1OXUA 1YNJD 2NVTB 1OXSC 1STHA 1NAPA 3AU7A 2MHVA 3HG9A 4L6TB 2EYMA 3MTSA 4FXKC 2EYLA 2ZXRA 2WINB 3S9WA 1Q8IA 1R9TB 1CM9A 2OF1A 4WFN3 4HR7B 5CBEE 1G291 2FHTA 2IL8A 3VYUA 1SYDA 2E74C 3R8BA 1PTOC 1ILQA 3TBIB 5LHY1 3PUXA 2IX1A 3BS1A 4RHSA 1TS5A 1HUMA 2Z1CA 1MD2D 3FKIB 4N9PA 5IOCA 4BS9A 4IFDH 1ZKOA 2ID0A 2KOLA 5T1IA 3K59A 2FJ2A 1I4HA 3I3CA 4PMWA 3K6OA 4K14A 3CRLC 1XTCD 4UAIA 1TIID 4X3TA 1JE4A 3LWUA 4ZYSA 1GOZA 1JR0D 1I4PA 1STEA 3T16A 3SHLA 3SK8A 1CHQD 5NUCA 4KI0A 5DEHA 2WIIB 1CTMA 1O7ZA 1GHKA 4S3SA 1G91A 4LAAA 1WTRA 5CV7A 1B53A 3D6CA 3S1MB 2JYOA 4DXGA 2B63B 4XQJA 4BY7B 5KNCA 5KYLA 1TQOA 1GHJA 3QOJA 2F0UA 4J8QA 2X69A 2KHSA 2YU9B 4G4KA 1MGSA 1I3QB 3HZXA 2NN6I 2F1MA 3M7NA 2ICIA 2QCPX 4J1MA 4F7XA 1I4GA 4ZQ3A 2A68D 1SNQA 3F2UA 1SNOA 2F4IA 2EJMA 2B2TA 4ZKCB 2EXZA 3GP7A 5C3EB 3Q23A 2PMZB 1E2ZA 2F0WA 4K8JA 1GUTA 1G2TA 3GTGB 3PUVA 4XT1B 1JWUD 2PW5A 1EZ8A 3NSWA 1FD7D 2NN6H 1CT1D 3K57A 1E2WA 2Q8RE 1EZ6A 3PIO3 2NVYB 5E4XA 1V1PB 3GO5A 5IT9L 4FF4A 1D5MC 2FINB 5CV8A 4QUFA 3BVMA 4IN3A 1SAPA 5J22A 4KHVA 3KLSX 4RCNA 1U9RA 1S5FD 2NBFA 1NR4A 2NZ1D 1A15A 2DN8A 3C3LA 5I6WA 3TSSA 4H44C 3KUPA 3OIQA 1H9SB 1SE3A 2JEAI 4Q0FA 3ZYYX 1STBA 1D2BA 4CJ2C 3U9OA 1R4QB 1IYUA 3I91A 5IIFA 2BE5C 1LTAD 3K5MA 3VYRA 1TWCB 3V2TA 4A3KB 2PNRC 4IZ8A 3J81E 3L7ZC 1AP0A 1F9SA 2RBMA 1B50A 3TP8A 1EIHA 3NQTA 2F3WA 2HCCA 2KEEA 4ABNA 4KKTA 3X3MA 5JPMC 2OT2A 1D6EC 3M4YA 1JOKA 2F0DA 3MXUA 4DNTB 5M9OA 4E6IA 3A8IE 4IUQA 4K6DA 1SE4A 3GD7A 4KY7A 4F87A 2QKIC 4V190 3WOEA 4DU9A 5EPKA 3MXPA 1I4XA 1G6ZA 1CHPD 4PMCA 4RGMA 5C5LA 4HCEA 2R93B 1SYGA 5I9OA 5FO7B 2BA0A 1V1OA 2ZXOA 3GTJB 4C3IB 5C44B 1A2TA 1LABA 4BA1I 1H9JA 2L55A 1CQFA 1TS4A 3M4OB 1OXXK 1STNA 5K36G 3KBGA 3S2HB 1QJOA 3M85A 5CR3A 3PUZA 4ILWA 5M5WB 2CQAA 3BDOA 1HFGA 2EYPA 2K5DA 1VF7A 5LL6X 1D5ZC 1SNDA 2D62A 2EOTA 4RH6A 3BDLA 3ND9A 5C0XJ 4DA2A 5IGCA 2A69D 2X6GA 4RKLA 5I6YA 1RD9D 2L12A 5D65A 1XYIA 4QF4A 1IHZA 3HOUB 5EJWA 1R4PB 1T5XD 5C4ZA 5I2XA 2E2JB 1ENCA 2L1BA 1S5BD 3LX0A 3MEHA 2F0IA 3H09A 2IWHA 4X3KA 3E0JA 4FO2A 3QJYA 2RSOA 1H9MA 4FP5D 1UNSA 1QCBD 5AFWA 1RTOA 1J9OA 1HQMC 1CFMA 3VR6A 5F2DA 1JCKB 2EJGC 4KTAA 1RCVD 2FMMA 1Y69U 1VCIA 3HRZC 2K04A 1WTVA 1AZPA 5G3LD 2M00A 3SDZA 4C3HB 1X3PA 2PYKA 1B3AA 3R93A 4X3SA 3SE0A 1RODA 4ID6A 3GV3A 3PV0A 1ML0D 3PIP3 3IFDA 2DY8A 1SYEA 3DMUA 1BCPC 4DAPA 3HP3A 2Z4IA 5C0XH 3AB9A 1CK1A 4TSSA 1EYAA 1YNNC 2RKSA 3NXWA 4CGYB 1PZID 3RZDB 2OEOA 2E75C 3MHBA 1STAA 2HCIA 5FO8B 3ND8A 1WD1A 1HXYD 2FFKB 2L4NA 2MJ8A 4HMJA 1D1KA 4HN7A 2I46A 3A7AB 1JB3A 1CA6A 2AUJD 2R61A 4DF7A 5KYIA 1KLGD 3RUZA 1A2UA 1M8AA 3NTIA 1PRTD 1KAAA 2CHBD 4A3MB 2IT1A 2XN9C 1XX8A 1LTID 5FOBB 1MSHA 2A6ED 3I70A 5CBAE 1ICWA 4RGTA 1EWHA 3NE5B 1TKWB 1D5XC 3GTKB 3S17B 3OOCA 1SSOA 5IODA 3PMFA 4A3GB 4ZKBB 3CKIB 3S1NB 5CORA 2RDHA 3H6MA 3WOFA 3T53B 1G8ZD 2WB1B 1GJXA 3P7JA 2MUYA 2RQXA 2Z4HA 5HGTA 2E2DC 3DEPA 3QG1A 2Z8LA 3MVVA 2VUMB 1GUGA 1PRTF 2F0NA 1BQQT 1UEAB 3NTKA 4A3JB 4A3IB 1PXUA 2M9VA 5ISRA 2PW7A 4X3UA 2CW0D 3GTPB 4HSVA 3K5NA 5M3MB 1I6VC 1LTTD 4EQNA 4DXFA 4WRDA 2RDGA 1PFBA 4RA8A 1Q3LA 1O7LA 3DHQA 2WKDA 4O42A 3J80E 3N6RA 3UI2A 4BY1B 1BXTA 2B2WC 4AYBB 1ZEQX 3DWQA 2K5WA 2WV6D 1Y8NB 3ONAB 3NPPA 1LT5D 5D3DA 1MI2A 5EPJA 4RFBA 4BBRB 3I4MB 5EQ0A 3FVQA 5D3IB 1F9QA 3RMHA 2VNUD 3DM1A 1DOKA 4ME5A 1CZGA 1F2MA 1JWMD 5FLXE 5FKAC 3TDQA 4C3JB 1AZQA 4FF1A 4CHTB 3NWSA 1F9PA 3DWAA 2JSOA 4IUVA 1WD0A 1PDQA 3PUYA 1F2YA 1TWHB 4F88A 1S5ED 3HOXB 5JJZA 4KJOA 4OHJA 1BBXC 4PMBA 1IW7D 2C5CA 1AFPA 1OXVA 1KDAA 5A2QE 3A7LA 4K2LA 1D1IA 4KD3A 4TRDA 1K83B 3QWNA 2O5JC 2D5DA 5EKLA 2Y0SB 4HSPA 5KEEA 2PZTA 5CGKA 1B1ZA 1EY9A 4G57A 5HURA 3SK6A 3K58A 2E2HB 1JC7A 4Z9CB 3X3NA 1U4MA 2EY2A 1GUOA 1Q12A 2EY5A 2V4DA 3DXJC 3Q22A 3KF8A 1OO9B 3NQIA 5IGBA 1O7YA 1PTOF 2XRQD 5FK9C 1V43A 1BDOA 3K5LA 5E3FA 3J7YW 5C5MA 1WTWA 3PUWA 1C4QA 5M5XB 1U4PA 3IKJA 4CJ0B 3A56A 1SXTA 2NVXB 2H1EA 1TY0A 3J81L 1QE6A 3CHBD 2SNMA 4XQQA 3HEJA 4O1NA 3M7GA 4OIJA 5C0XG 3GTQB 3CRKC 3I72A 2R3ZA 2BDNA 4C2MB 3GTLB 4Y7NB 4EQPA 1U4RA 4BBSB 3BVGA 3T56B 2RSNA 5JEAJ 4OO1I 3FDTA 3HOZB 2EDGA 4B9WA 3GTMB 2D9UA 4DFAA 5EPLA 3D8GA 1VF5C 4XDXA 1RHPA 3MXNA 2EJFC 4ZLTF 1AEXA 5IGEA 3T13A 1TWFB 2QEJC 2B2VC 1LACA 4F8MA 4DAVA 1H9KA 1CI3M 5EBDA 5CC4A 4TQUS 4U68A 3D4WA 1WTQA 1S5DD 5KNBA 5EGTA 4OO1H 2KCCA 2TMPA 4ZRZA 2K1BA 4XIGS 1GUNA 1TS3A 1CA5A 2ZXPA 2LS01 1IKMA 1FGBD 2BDOA 4DGZA 2NTTA 2BOSA 3SXHA 5DM63 3S1RB 3HOVB 2J4XA 2B2YC 1TT2A 1EU4A 5M5YB 4FXGC 4QB4A 1SFOB 2Q8TA 3SK4A 1C8CA 2WAQB 2PQEA 4KY5A 3TN2A 2NUCA 1GXDC 2DNEA 4CBVA 1TR5A 2SOBA 4KK7A 1ESFA 2NTSA 5JEAH 5JAVA 3A8KE 4DAYA 2EPBA 3E5SA 1TVXA 4HTHA 1BOSA 1BO0A 3PO2B 5J39A 3BZDB 3KK7A 2K28A 2C9OA 1M4VA 3I8ZA 3VYSA 4MIUA 3D4RA 3G7LA 4IFDG 1F2LA 2K05A 2A6HD 2DNCA 3HOWB 4K5VA 4IUPA 3WDNA 3MA2B 3QIAA 4IALA 1ENFA 2VB3X 3HS0C 1O78A 2PZWA 2BCOA 3KLRA 2FMCA 4ULLA 1BR9A 3EVQA 3OSOA 3I4LA 2EYFA 1E0BA 2PCFB 1XWEA 4MN3A 3EA6A 5EBCA 1LTSD 3R3OA 4ZUJA 4A93B 2EY1A 1Z7TA 3BYTB 4HMIA 1Q1EA 1ZYRC 4HCSA 2F0JA 5JVG3 1H9RA 3H3VC 3VR3A 5DNFA 4XT3B 1LLRD 2F0HA 4U673 2QILA 1HPCA 3QB3A 4KJNA 4BA2I 4B9XA 4LK1C 3P20A 3L9AX 2M2LA 4RGOS 1F9RA 2F0PA 5I2YA 1SYFA 3VA7A 4G7ZC 1WCMB 4WORA 3TZUA 5C6AA 1ENAA 1S4ZA 5KRUA 1NR2A 1VDZA 1SNPA 1L0XB 3R2IA 4WJWA 3DEOA 2A6EC 3MFYA 1HA5A 3URYA 4EVOA 2KVMA 2ENBA 5LL6S 3S15B 3U9SA 3C1FA 4EGVA 2N88A 2AQ1B 3IFTA 3NK9A 1PFNA 2NB0A 3I73A 1LT3D 3OMCA 2NN6G 1F77A 3KBXA 1TU2B 1CQVA 1HQRD 2F0SA 2F0QA 1ET9A 5JPNC 1G2SA 3LWEA 2K6AA 1SDFA 3VYTA 1JORA 2EYHA 4C1NI 2K33A 2TSSA 5T1GA 3G6JB 4IQZA 3W2DA 1YNJC 2L0CA 2DY7A 2K03A 5EKKA 1LO5D 3Q24A 3MXGA 1QB5D 1EU3A 2CVRA 2LMCB 3A55A 1Z47A 2O2LD 2CW0C 4XXEA 1WVLA 1KNAA 4CKCA 1EY5A 3P1HA 4B08A 3FEWX 4QIWB 2PZUA 2Q8IB 1KNEA 3H91A 3IL8A 2B2UC 3SK5A 3VR5A 1C48A 3GV6A 3BVZA 3N52A 2AQ3B 2B39A 1KTKA 1XXGA 2A74C 2D2CC 4K2KA 3J80L 4EQOA 3NBIA 1EY8A 1X32A 2NYZD 1IL8A 3JAME 1PRTB 3O13A 1Y1WB 1JICA 1NUCA 4K5XA 3S14B 1PFMA 3A8JE 3RD4A 2QF7A 5M3FB 3S2DB 1STGA 2EYJA 2B2UA 1B2TA 1SNCA 1TWGB 3RLFA 2VXWA 3ITPA 1JQYD 1VMCA 4IFDI 5I9PA 1STYA 1BCPF 5C4JB 1PMRA 1SBBB 5FLXL 1PZJD 1IKLA 4UDUC 3MZ5A 2J7ZA 1EIGA 1BUVT 4R8NA 3TP5A 5K36H 3H0GB 3NBHA 1A3VA 2L11A 4PQXA 1IW7C 3MC0B 2JA6B 1DOMA 1PYWD 4LMQD 5A2QL 2ICEC 5I4DA 4RHRA 1I50B 5CV6A 1SMYD 1HUNA 2F0EA 5JEAG 1DJRD 1GUWA 2B2WA 2A68C 1GUSA 2EY6A 1SE2A 3E6ZX 3TMEA 3SEBA 2LKVA 2RDFA 5ELFA 4KMUC 3J7AF 4DN4M 2F0GA 4RKBA 5IGGA 1BF4A 4KV6A 2KCNA 1Y8OB 3BYYB 4FF2A 3C1EA 3DUZA 1SYBA 5ELCA 5ELEA 1PLFA 1PTOD 2JE6I 3K0YA 1CZWA 1DD2A 4MHEA 3OWEB 5A35A 1Z6HA 3K7AB 1V1PA 3OW7A 3BG3A 1HTPA 2B2TC 1LT6D 4IURA 4V0BA 3VR4A 2G9DA 3S1QB 3EFXD 4K8IA 2AWNA 1QNKA 4XTCS 2O4XA 4DK0A 1LTGD 2NVQB 2HUGA 2JA7B 4Q5VA 5BN4A 1ESRA 3TZDA 2XNAC 1PTOB 1II3A 2BA1A 2F0MA 1JOQA 1H9SA 5CYUA 3OHXC 3ERQA 1NCVA 3OMGA 5KNDA 3D6WA 2HDMA 4I7ZC 1DM0B 2KEDA 3Q0AA 4RWSC 4RCOA 3EROA 4N9TA 3OWFA 2A5HA 2G9HD 4R8IA 5COYA 5FO9B 2KUMA 4OIKA 2WACA 5TSSA 4C3IG 3MFGA 2RVLA 3LNNA 2EZVA 1B44D 3MWYW 1RDPD 1HFNA 3OPOA 4H13C 1B9NA 5CV4A 4C1NK 4KN4C 2AUKA 4FXDA 1BNZA 2PO4A 1EEID 1LT4D 5ELBA 2LY7A 4G7HC 3CU7A 1I4QA 4PNYA 3NTHA 1X3QA 2I07B 1RF2D 1HCZA 2B8GA 4JBWA 4OGQC 1QWYA 1E2VA 1W6KA 3NWTA 4JK1C 2F0KA 2A73B 4XYOA 1T5EA 2JXMB 2F0OA 3D3RA 1AW7A 4QUCA 1FNVA 1NSNS 1KDCA 4CKBA 2HQEA 4M8AA 3NUCA 2KJXA 3T4AC 3FPUB 5IT9E 2R6GA 4NMZA 4PV1C 2XWJB 3TP7A 4FYDA 1W6JA 2GA4B 1EQTA 2B8FA 1TS2A 1HHVA 4GZYC 3C46A 4HAEA 2SDFA 2K01A 1KDBA 1PTOH 1K8MA 1B4OA 2KA7A 2R7ZB 3HKZB 1ONLA 2F3VA 4KHZA 4DNRB 3C2PA 1SNMA 2B2VA 2SEBD 1ZXTA 2A6HC 1EFID 1OXTA 1MBYA 1LTBD 4L8JA 1FR3A 1I6HB 2EYOA 4R9WA 2HDLA 2A69C 4C3HG 1A6XA 2BE5D 2L5TA 3AMUA 4TKOB 1EYCA 4ZAIA 1RJTA 1PZKD 1DYQA 2YYZA 1EOTA 3FRPB 4A3EB 1UUPA 2B2YA 3QOLA 3D31A 3R2TA 3TP6A 1EYDA 5BN3A 4J6HA 1TY2A 2J0TD 1HA6A 1EL0A 1DCZA 1WTOA 2MPMA 3IAYA 3KLSA 1EEFD 1LTRD 5CMDA 4RGNA 4BWGB 2AWOA 1DZ1A 3CQZB 3FMCA 3OIPA 1KLUD 2OXPA 2JA8B 4XYQA 3DWPA 4KD4A 1SEBD 1TWAB 3SR1A 2IPKD 2MP1A 1S5CD 3S16B 1U4LA 3HGBA 4KY6A 2XVSA 1DOLA 1QOHA 3SVMA 3GTOB 4NW2A 4C56C 2JEBI 5E1FA 2K7VA 3MAQA 4HEDA 5D14A 2E76C 1SJED 4FNFA 4A3DB 4CKEA 2XWBB 1I4RA 3I90A 1FNUA 1QNUA 3NHHA 1EWCA 2N55A 4IUNA 2QDBA 4KKSA 5KIXA 1RTNA 2VB2X 1HRJA 5EKIA 3HOYB 1EY7A 5J1ZA 1HTLD 3Q6SA 1EY4A 1ILPA 4L63B 4NDXA 4FF3A 5DAUA 1A3UA 3K5OA 5IGFA 3VR2A 2EVBA 1SJHD 2SNSA 1SYCA 1RKNA 5ELDA 1FYCA 5CV9A 3EQLC 5C0XI 2JP1A 5C3XA 1EY6A 2X6LA 2F0LA 1ET6A 2XRSD 2IX0A 4KN7C 5DM73 1WTPA 4QMGA 5K5PA 2F0TA 3I4NB 4M1UB 1K8OA 1AN8A 1PRTC 4IUTA 5JOBA 3VA5A 3D4DA 1MSGA 2IJ0A 2K5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CA5 A;  1MI2 A;  1QNK A;  2MGS A;  4QUC A;  1ICW A;  5CBA E;  5EPJ A;  4MN3 A;  1G91 A;  1IKM A;  5EQ0 A;  1G2S A;  3QO2 A;  1DZ1 A;  2J7Z A;  1WTR A;  3LWE A;  2HUG A;  1SDF A;  1EIG A;  1F9Q A;  1NR4 A;  1B53 A;  2EE1 A;  2NZ1 D;  2FMM A;  1ESR A;  1WTW A;  3TZD A;  1SSO A;  1A15 A;  3FPU B;  3DM1 A;  1DOK A;  2L9H A;  2K04 A;  5T1G A;  2JYO A;  4CJ1 B;  1WTV A;  5E4W C;  1QG7 A;  4ZKB B;  2MP1 A;  3KUP A;  1DON A;  1U4P A;  5COR A;  2DY7 A;  2K03 A;  1U4L A;  1AZP A;  2L11 A;  4CJ0 B;  1NCV A;  1DOL A;  2H1E A;  1AZQ A;  2B2Y C;  4HCS A;  1EQT A;  1HHV A;  3SVM A;  1NAP A;  3D6W A;  2CVR A;  2HDM A;  4CJ2 C;  1X3P A;  2K1B A;  4NW2 A;  1B3A A;  1DOM A;  1F9P A;  2Q8T A;  2KED A;  4IUV A;  1C8C A;  1QE6 A;  3MTS A;  4LMQ D;  2X69 A;  4HED A;  1WD0 A;  4IUU A;  4RWS C;  5DNF A;  4XT3 B;  1PDQ A;  5D14 A;  3R93 A;  4X3S A;  1ROD A;  3P7J A;  2SDF A;  1KNA A;  2K01 A;  3I91 A;  4HAE A;  1WVL A;  1HUN A;  1MGS A;  1CM9 A;  3GV3 A;  2NWG A;  2RA4 A;  4OIJ A;  5JJZ A;  3DEP A;  1B4O A;  3TN2 A;  1KNE A;  1GUW A;  3H91 A;  3I90 A;  2R3Z A;  3IL8 A;  1BBX C;  2BDN A;  1ML0 D;  5CBE E;  2B2U C;  2B2W A;  1LV9 A;  2FHT A;  1HFG A;  2DY8 A;  2XIW A;  2IL8 A;  3IFD A;  5COY A;  2KUM A;  4R8I A;  1EIH A;  3GV6 A;  3HP3 A;  1O80 A;  4OIK A;  2M2L A;  3N52 A;  2N55 A;  1ILQ A;  1F9R A;  2B2V A;  3F2U A;  1RTN A;  1ZXT A;  2RVL A;  1AP0 A;  1F9S A;  1U4R A;  1HRJ A;  1HUM A;  5EKI A;  2B2T A;  2EPB A;  4DN4 M;  2EOT A;  4ZKC B;  1B50 A;  1X32 A;  1TVX A;  2NYZ D;  2RSN A;  2KEC A;  1IL8 A;  3MWY W;  4R9W A;  1J9O A;  3FDT A;  4X3U A;  3Q6S A;  2HDL A;  1BF4 A;  1HFN A;  1BO0 A;  4HSV A;  2HCC A;  1JIC A;  2X6G A;  2KEE A;  2KOL A;  1ILP A;  5T1I A;  2L12 A;  5D65 A;  1XYI A;  1BNZ A;  1S4Z A;  1PFM A;  5EJW A;  2FJ2 A;  2HCI A;  2K28 A;  1NR2 A;  3I3C A;  2D9U A;  1PFB A;  4RA8 A;  1Q3L A;  4ZK9 B;  3I8Z A;  1WTX A;  1G2T A;  1WD1 A;  3G7L A;  4UAI A;  5EPL A;  3DEO A;  1PLF A;  4ZAI A;  4XT1 B;  1RJT A;  1F2L A;  1VMP A;  2B2U A;  4XDX A;  1B2T A;  2FFK B;  4O42 A;  1RHP A;  1JE4 A;  2L4N A;  4X3T A;  4IUQ A;  2MJ8 A;  2K05 A;  4MHE A;  1X3Q A;  3UI2 A;  1EOT A;  2VXW A;  2L1B A;  2KVM A;  4IUP A;  2B2Y A;  1J8I A;  4RAU C;  2B2W C;  2JP1 A;  4ZLT F;  2Q8R E;  1U4M A;  2X6L A;  1CA6 A;  1VMC A;  5E4X A;  4X3K A;  2N88 A;  2B2V C;  1PFN A;  5EPK A;  2RSO A;  2FIN B;  1WTP A;  1HA6 A;  1EL0 A;  4QUF A;  1WTO A;  2MPM A;  1G6Z A;  1M8A A;  1O7Y A;  4U68 A;  2B2T C;  4IUT A;  1WTQ A;  3KBX A;  4IUR A;  5AFW A;  1RTO A;  1E0B A;  1SAP A;  3ONA B;  1MSG A;  1XX8 A;  1MSH A;  1O7Z A;  1IKL A;  5CMD A; 
#chains in the Genus database with same CATH topology
 2ASB A;  2MGS A;  1B9M A;  3K81 C;  1JOO A;  1YZ6 A;  2PPB C;  1Q90 A;  4XQN A;  3QO2 A;  4A3E H;  3FPP A;  2K32 A;  1B8A A;  2H4O A;  3T51 B;  3V96 A;  4DV0 Q;  4NKL A;  1V8Q A;  5E4W C;  4KKU A;  3PSI A;  3NEM A;  1DON A;  2EQS A;  4BY1 G;  5BR8 L;  1X3F A;  4DR3 Q;  5C3W A;  1ZYR D;  4AYB G;  2WP8 J;  3L3O C;  3DM3 A;  3J7A V;  4LWC A;  4IUU A;  3HOW H;  1Y8P B;  3CQZ H;  1XMO Q;  2JA8 H;  1QIL A;  2O5I C;  4DR1 Q;  2LFN A;  3H94 A;  3JAM L;  4A3F B;  2NWG A;  1Q1B A;  2RA4 A;  5KGU A;  4X64 Q;  4LJZ C;  4KLK A;  1TWA H;  1BVS A;  1JWS D;  2IW3 A;  3ICE A;  3RZO B;  3PO3 B;  1LV9 A;  2XIW A;  1L2F A;  5G3L F;  2RHS B;  4BBR G;  4A3B B;  5CV5 A;  3I4M G;  3S16 H;  4YIJ A;  1O80 A;  3A54 A;  4FVM A;  2MO0 A;  4K6L A;  3GTO H;  5IGD A;  2R92 B;  2I0Q A;  1DXM A;  1FNW A;  1E3P A;  1KAB A;  3J81 i;  4QCL A;  4YCV A;  4P2C B;  2ES2 A;  4DR4 Q;  3P75 A;  2KEC A;  3CMA A;  4C3J G;  2D0P A;  4OX9 Q;  4N8F A;  2OTJ A;  1VQF A;  5JVH 3;  4NP5 A;  1BBW A;  4R4I A;  1E1T A;  3W3A A;  4A3D H;  3STB C;  3V05 A;  1UAP A;  4HJ7 A;  1B7Y B;  1EQV A;  4YY3 L;  2WFW A;  4IFD J;  5C4X B;  4QL5 A;  2ZT9 C;  4ZK9 B;  1WTX A;  1BCP D;  5C4H A;  1F2Z A;  1VMP A;  5BN5 A;  2XSC A;  3HOX G;  3BDC A;  4H7B A;  1GKH A;  3GQB A;  2IX3 A;  2LXJ A;  2QA4 A;  1PH5 A;  3M9B A;  3HOY H;  4G7O C;  1L0Y B;  1J8I A;  1MHW C;  2WKC A;  4RAU C;  1YNN D;  1L0W A;  1IYV A;  3KF6 B;  3L0O A;  4K5W A;  4ODG A;  2AQ2 B;  4LFA L;  4ZUI A;  2F0V A;  3M3Y B;  1EIY B;  2F03 A;  4JI2 Q;  4H0L C;  2JA5 B;  3CAM A;  1Y1V B;  2E5L L;  2BH2 A;  2KQ3 A;  4DR2 Q;  1VQH A;  2Y0S G;  5DLQ E;  3NP8 A;  4I65 A;  4OL7 A;  2F0F A;  3EJI A;  1BCP B;  1SMY C;  2EE1 A;  4DK1 A;  3HKZ E;  2L9H A;  4OO1 G;  4GLA C;  2E2I B;  4CJ1 B;  5EAY A;  2VQE L;  1QG7 A;  1A3T A;  1EY0 A;  1OXU A;  1YNJ D;  3I4N H;  2NVT B;  1OXS C;  5IYC G;  1STH A;  1NAP A;  3AU7 A;  2MHV A;  3HG9 A;  4L6T B;  2EYM A;  3MTS A;  1MJE A;  1L1O C;  4FXK C;  2EYL A;  2ZXR A;  2WIN B;  3S9W A;  1Q8I A;  1N36 Q;  1R9T B;  1CM9 A;  2VQF L;  1VQ4 A;  2OF1 A;  4WFN 3;  4HR7 B;  1YHB A;  3CCJ A;  5CBE E;  1G29 1;  2FHT A;  2IL8 A;  4LUZ A;  3VYU A;  1SYD A;  2E74 C;  1HNX Q;  1U0L A;  3R8B A;  1PTO C;  1ILQ A;  1PH3 A;  3K8A A;  3TBI B;  2Q2T A;  5LHY 1;  3PUX A;  4JI4 Q;  2IX1 A;  3BS1 A;  3PCO B;  4RHS A;  2JA9 A;  1TS5 A;  1HUM A;  4B3T L;  4CDE C;  2Z1C A;  1MD2 D;  2CQO A;  3FKI B;  2VW9 A;  4N9P A;  5IOC A;  4BS9 A;  4DUY L;  2P5Z X;  4IFD H;  1ZKO A;  2ID0 A;  4A3F H;  4WJ4 A;  2UUC L;  2KOL A;  5AJ3 Q;  5T1I A;  3K59 A;  3CP0 A;  3PO3 H;  2FJ2 A;  3CCQ A;  1I4H A;  3I3C A;  4A3B H;  4PMW A;  4GKK Q;  3K6O A;  4K14 A;  3CRL C;  1XTC D;  5IY0 A;  4UAI A;  4DV1 Q;  1QZG A;  1TII D;  4X3T A;  1JE4 A;  3LWU A;  2R92 H;  4ZYS A;  1GOZ A;  1CKM A;  1WFQ A;  1JR0 D;  1VQB A;  4GOP A;  3CC2 A;  1I4P A;  1STE A;  3T16 A;  1K8G A;  3SHL A;  3SK8 A;  1CHQ D;  5NUC A;  4JI0 L;  4KI0 A;  5DEH A;  1QZH A;  4BBS G;  2WII B;  5C4X H;  2UXB Q;  1CTM A;  3HOZ G;  1O7Z A;  1KHI A;  1A0I A;  1GHK A;  4HID A;  4S3S A;  4DUZ L;  1G91 A;  4LAA A;  1WTR A;  5CV7 A;  1JJ2 A;  4GS3 A;  4J15 A;  4A76 A;  1B53 A;  3D6C A;  1Z9F A;  3S1M B;  3CF5 A;  2HIV A;  2L15 A;  2JYO A;  1SN8 A;  1KRS A;  2N8N A;  4DXG A;  4POG A;  3M3Y H;  1IBM Q;  3NBH B;  2B63 B;  4XQJ A;  4BY7 B;  5KNC A;  5KYL A;  2JA5 H;  1Y1V H;  4JI1 L;  1TQO A;  1GHJ A;  3QOJ A;  2F0U A;  3A0J A;  4J8Q A;  2X69 A;  5JJI A;  3Q8D A;  2CH4 A;  2KHS A;  4G4K A;  2YU9 B;  3CC7 A;  1MGS A;  1I3Q B;  3HZX A;  2NN6 I;  2F1M A;  3M7N A;  2ICI A;  2QCP X;  3BJU A;  2E2I H;  4J1M A;  4DK3 C;  1EQR A;  4F7X A;  2NVT H;  1I4G A;  4ZQ3 A;  2A68 D;  1SNQ A;  4AQY Q;  1JMC A;  3F2U A;  3FP9 A;  1SNO A;  2F4I A;  1AE3 A;  2EJM A;  2B2T A;  4ZKC B;  3E9I A;  2RHQ B;  4OWX B;  2EXZ A;  3GP7 A;  5IYD H;  1R9T H;  5C3E B;  3Q23 A;  4O0A A;  1MKH A;  2RCF A;  2ATW A;  2PMZ B;  3W1B A;  1E2Z A;  1LUZ A;  2WAQ G;  2F0W A;  4K8J A;  4DV4 L;  1GUT A;  1G2T A;  3GTG B;  2UU9 Q;  4LF8 Q;  3PUV A;  4XT1 B;  2I5M X;  5E7N A;  4DK6 C;  1JWU D;  2PW5 A;  4DR7 Q;  1EZ8 A;  4P73 A;  3NSW A;  1X9N A;  2F4V L;  1FD7 D;  2NN6 H;  1CT1 D;  3K57 A;  3FKI H;  1IZ6 A;  1E2W A;  2Q8R E;  4R4O A;  2CCZ A;  1NBW A;  4A4I A;  3E0E A;  1EZ6 A;  3PIO 3;  2NVY B;  1UEB A;  5E4X A;  1V1P B;  3GO5 A;  5IT9 L;  4FF4 A;  1D5M C;  2FIN B;  5CV8 A;  4QUF A;  4B3S L;  3BVM A;  4NXN L;  3J7A 5;  4IN3 A;  1SAP A;  3UDF A;  3H15 A;  5J22 A;  4KHV A;  3PO2 G;  3ER0 A;  3J7Z C;  3KLS X;  4RCN A;  1U9R A;  1S5F D;  2NBF A;  1NR4 A;  2NZ1 D;  3CCV A;  1N33 Q;  4GNX A;  1A15 A;  2DN8 A;  1NTG A;  3C3L A;  5I6W A;  3TSS A;  4H44 C;  1Q7Y C;  3KUP A;  3OIQ A;  3HOW G;  1H9S B;  1SE3 A;  2JK8 A;  2JEA I;  4Q0F A;  4ZCK A;  2GVA A;  2KCT A;  1S40 A;  3ZYY X;  1STB A;  1D2B A;  4CJ2 C;  1VQE A;  3KFU A;  3DLL A;  3U9O A;  1SLJ A;  3KOJ A;  4LF6 Q;  1R4Q B;  1IYU A;  2JQO A;  3I91 A;  5IIF A;  1XTD A;  3S1M H;  2BE5 C;  1LTA D;  3JAM i;  3S24 A;  3K5M A;  1N34 L;  4B3M L;  3VYR A;  1TWC B;  3V2T A;  1HZ9 A;  1UE6 A;  5IP7 H;  4A3K B;  2PNR C;  4L5T A;  4X65 L;  4KHP Q;  2GVB A;  4IJH A;  3TS0 A;  4A93 G;  2B63 H;  4IZ8 A;  4BY7 H;  1N9W A;  3J81 E;  4HJ5 A;  3L7Z C;  1AP0 A;  1F9S A;  2N78 A;  1MIU A;  4NPS A;  3T1Y L;  2RBM A;  1B50 A;  2ZM6 L;  3TP8 A;  1VS0 A;  1EIH A;  2UXC L;  3NQT A;  4BXX G;  2F3W A;  2HCC A;  3K0X A;  1IBL Q;  1I3Q H;  2KEE A;  4ABN A;  1PHJ A;  4KKT A;  3X3M A;  5JPM C;  2OT2 A;  1D6E C;  3RLO A;  3M4Y A;  1JOK A;  4POF A;  2F0D A;  3MXU A;  4DNT B;  5M9O A;  4X62 Q;  1I94 L;  4E6I A;  1DGS A;  3A8I E;  4IUQ A;  4K6D A;  1SE4 A;  2V1C C;  4DV5 L;  4JW0 A;  3J80 i;  1HJP A;  5LMN W;  1VQJ A;  2VS1 A;  3TRZ A;  3GD7 A;  2VY3 A;  4KY7 A;  4F87 A;  2QKI C;  4V19 0;  3WOE A;  5C3E H;  2K50 A;  4DU9 A;  3K7U C;  5EPK A;  3MXP A;  4AH6 A;  5HGQ A;  1WCM G;  1I4X A;  1G6Z A;  1CHP D;  4PMC A;  3GTG H;  4RGM A;  5C5L A;  4HCE A;  2R93 B;  1WOC A;  2OWO A;  4LFC Q;  1SYG A;  4JI5 L;  5I9O A;  3UDG A;  4YWM A;  3U4V A;  5FO7 B;  2BA0 A;  1V1O A;  4R4Q A;  2ZXO A;  3GTJ B;  3I4O A;  4C3I B;  5C44 B;  1PH4 A;  2NVY H;  1A2T A;  1LAB A;  4BA1 I;  1H9J A;  2R7F A;  2L55 A;  1CQF A;  1TS4 A;  1WI5 A;  4JI7 Q;  3A5U A;  3M4O B;  4GKJ Q;  1OXX K;  1STN A;  4YHH L;  5LMN Q;  5K36 G;  3KBG A;  3S2H B;  3G6E A;  1QJO A;  3M85 A;  5CR3 A;  5GAD C;  1YNX A;  4LF4 Q;  1YIJ A;  3PUZ A;  4ILW A;  1P8L A;  2CQA A;  5M5W B;  3ULJ A;  5GAH C;  3BDO A;  1HFG A;  4YCU A;  2EYP A;  2K5D A;  1VF7 A;  4JCV E;  5LL6 X;  4DV2 L;  1D5Z C;  1SND A;  4JVZ A;  2D62 A;  2EOT A;  4RH6 A;  3BDL A;  1FGU A;  2QEX A;  4IOA A;  3ND9 A;  4HIK A;  5C0X J;  4DA2 A;  5IGC A;  2A69 D;  2X6G A;  4RKL A;  5I6Y A;  1RD9 D;  1TXY A;  2L12 A;  5D65 A;  1XYI A;  4QF4 A;  1IHZ A;  1EFW A;  1H95 A;  3HOU B;  5EJW A;  1TWC H;  1R4P B;  4A3K H;  4B3R L;  5GRO A;  1T5X D;  2LXK A;  5C4Z A;  5I2X A;  1PV4 A;  2E2J B;  1HNW L;  4HJ9 A;  1ASY A;  4YWK A;  1HNZ Q;  1ENC A;  3OTO L;  4JV5 L;  2L1B A;  1S5B D;  2XTI A;  2UUA L;  3PQI A;  3LX0 A;  3MEH A;  2F0I A;  3H09 A;  2IWH A;  1KL9 A;  4X3K A;  1J6Q A;  1VQC A;  3E0J A;  4FO2 A;  4JBM A;  3QJY A;  2RSO A;  1H9M A;  1VQM A;  3NEN A;  1X56 A;  4FP5 D;  4YY3 Q;  1UNS A;  1QCB D;  1Y1W G;  5AFW A;  4A3L H;  1RTO A;  1J9O A;  1HQM C;  1CFM A;  3VR6 A;  5F2D A;  2MNA A;  1JCK B;  3G48 A;  2JJQ A;  2EIF A;  2EJG C;  4KTA A;  1RCV D;  2ALY B;  2CWA A;  5M3F G;  4DV6 L;  2FMM A;  1Y69 U;  1JJG A;  2PI2 A;  1VCI A;  3HRZ C;  2K04 A;  1WTV A;  1AZP A;  3KDF B;  5G3L D;  2M00 A;  3SDZ A;  4C3H B;  2R93 H;  1X3P A;  2PYK A;  1B3A A;  3R93 A;  4X3S A;  3SE0 A;  1ROD A;  2PMZ E;  4ID6 A;  3GTJ H;  4P72 A;  1XNR L;  3GV3 A;  4C3I H;  5C44 H;  3PV0 A;  2CFM A;  1ML0 D;  3PIP 3;  3IFD A;  3DMU A;  2DY8 A;  1SYE A;  5ELN A;  1BCP C;  1VQI A;  4DAP A;  1Q82 C;  3HP3 A;  1X6O A;  2H5X A;  2ZTE A;  3EBE A;  4Y52 H;  2Z4I A;  5C0X H;  4PZ7 A;  3AB9 A;  1CK1 A;  4JOI A;  1QVF A;  3H0G G;  4TSS A;  3S2H H;  1VQA A;  1PFS A;  1EYA A;  1YNN C;  2RKS A;  3HKS A;  4JG2 A;  4YWL A;  3NXW A;  4CGY B;  5L37 A;  1PZI D;  3RZD B;  3KJP A;  4TVA B;  2OEO A;  2E75 C;  4ME3 A;  3MHB A;  5M5W H;  1Q81 C;  2JA6 G;  1STA A;  2HCI A;  4OWW B;  2Z0S A;  5FO8 B;  3ND8 A;  1WD1 A;  1HXY D;  1A62 A;  2FFK B;  2L4N A;  2N3S A;  2DUD A;  2MJ8 A;  4HMJ A;  1D1K A;  4JI6 L;  5FJ8 G;  4HN7 A;  2NZO A;  3TRE A;  4RMF A;  2I46 A;  3A7A B;  4A3C G;  5LMU Q;  1M90 C;  1JB3 A;  1CA6 A;  4LFB L;  4DUY Q;  2AUJ D;  2R61 A;  4DF7 A;  5KYI A;  1KLG D;  1SR3 A;  3HOU H;  3RUZ A;  2F52 A;  1A2U A;  4JYA L;  1M8A A;  3NTI A;  1PRT D;  1KAA A;  2CHB D;  4A3M B;  2E2J H;  2IT1 A;  2XN9 C;  1XX8 A;  1W3S A;  1LTI D;  1NY4 A;  3I70 A;  1MSH A;  2A6E D;  5FOB B;  5CBA E;  1ICW A;  4RGT A;  1EWH A;  3NE5 B;  1TKW B;  1D5X C;  3AFQ A;  3GTK B;  4L5Q A;  3S17 B;  1XMQ Q;  3OOC A;  1SSO A;  1QUQ A;  5IOD A;  3PIP A;  3PMF A;  4L5S A;  1QVG A;  1XNQ L;  4ZKB B;  4A3G B;  3CKI B;  4CDF C;  3F2B A;  3S1N B;  5COR A;  2RDH A;  3H6M A;  3WOF A;  4UPA A;  3T53 B;  4X66 L;  2Q2I A;  1G8Z D;  2WB1 B;  1N8R C;  4JI3 Q;  2XGT A;  1AE2 A;  1GJX A;  4EX5 A;  2F3I A;  4DUZ Q;  3P7J A;  2MUY A;  2RQX A;  2Z4H A;  5HGT A;  2E2D C;  3DEP A;  5IP9 G;  3TS2 A;  5IWA L;  3QG1 A;  2Z8L A;  3MVV A;  2VUM B;  4JBK A;  1GUG A;  1GO3 E;  1PRT F;  1BQQ T;  2F0N A;  1UEA B;  3NTK A;  2JA7 G;  4C3H H;  4IO9 A;  4A3J B;  2OCE A;  1X54 A;  4A3I B;  1PXU A;  2M9V A;  5ISR A;  1CKN A;  5IYB G;  2PW7 A;  4X3U A;  1K9M C;  4DV0 L;  2CW0 D;  3GTP B;  4HSV A;  3K5N A;  1NJI C;  5M3M B;  1I6V C;  1LTT D;  4EQN A;  1D7Q A;  4DXF A;  4K0K Q;  4WRD A;  2PQA A;  2RDG A;  1PFB A;  4RA8 A;  1Q3L A;  1VQK A;  4HJ8 A;  1O7L A;  3DHQ A;  2WKD A;  4O42 A;  3J80 E;  3N6R A;  3UI2 A;  3H3V I;  1XMO L;  2B3G A;  3ULP A;  2UUB Q;  4DR1 L;  1BXT A;  4BY1 B;  3AYH B;  2B2W C;  4AYB B;  3RZD H;  1ZEQ X;  3DWQ A;  1L1O A;  5FLM G;  3RZO H;  4HIO A;  2K5W A;  2WV6 D;  1Y8N B;  3ONA B;  3NPP A;  1LT5 D;  5D3D A;  1MI2 A;  4DR4 L;  4LNQ A;  5EPJ A;  4DKA C;  4RFB A;  4BBR B;  3I4M B;  5EQ0 A;  4OX9 L;  3FVQ A;  5D3I B;  4A75 A;  1F9Q A;  2GN5 A;  3RMH A;  2VNU D;  3DM1 A;  1DOK A;  4PG3 A;  4ME5 A;  1CZG A;  1F2M A;  1D8L A;  1JWM D;  5FLX E;  5FKA C;  2YTV A;  3H3V H;  3TDQ A;  4C3J B;  4DV7 Q;  4B3S Q;  1AZQ A;  1VQ8 A;  1ASZ A;  4A3M H;  4FF1 A;  4CHT B;  3NWS A;  4GN5 A;  1F9P A;  3DWA A;  2JSO A;  4IUV A;  1WD0 A;  3GTK H;  1PDQ A;  3PUY A;  2K75 A;  3S17 H;  2HHH Q;  3QR8 A;  1F2Y A;  1TWH B;  1X3E A;  1S5E D;  4F88 A;  3HOX B;  5JJZ A;  4KJO A;  4OHJ A;  1BBX C;  4PMB A;  3S1N H;  1K0R A;  4LF5 Q;  3TEH B;  2UXD Q;  1IW7 D;  2C5C A;  1AFP A;  1OXV A;  1EUJ A;  1KDA A;  5A2Q E;  3A7L A;  4MTN A;  1HR0 W;  4K2L A;  2Q2H A;  1D1I A;  4A3K G;  4KD3 A;  4TRD A;  1K83 B;  1G51 A;  3QWN A;  2O5J C;  2D5D A;  5EKL A;  2Y0S B;  4HSP A;  4GLV B;  4NXM L;  1WTH A;  4R4T A;  5KEE A;  2PZT A;  5CGK A;  1B1Z A;  3U4Z A;  3KJO A;  1N34 Q;  1EY9 A;  2VUM H;  4G57 A;  4AIM A;  1X65 A;  5HUR A;  4QY7 A;  3SK6 A;  3K58 A;  4A3J H;  4HIM A;  1HZC A;  2E2H B;  1JC7 A;  4Z9C B;  3X3N A;  2R7Z G;  2Z6K C;  4A3I H;  1N36 L;  3J81 c;  4EQ5 A;  3HKZ G;  1U4M A;  2ZM6 Q;  2EY2 A;  2AMC B;  3GTP H;  1GUO A;  3CCL A;  4GOP B;  5M3M H;  4IPH A;  4OXP A;  1IBK Q;  1Q12 A;  2EY5 A;  4DR6 Q;  2V4D A;  3DXJ C;  1HNX L;  3Q22 A;  3KF8 A;  1OO9 B;  2FXQ A;  3NQI A;  3E3X A;  5IGB A;  1O7Y A;  1PTO F;  1HR0 Q;  4JI8 Q;  1KD1 C;  2XRQ D;  5FK9 C;  3E9H A;  1V43 A;  1BDO A;  3K5L A;  4DR5 Q;  4BY1 H;  5E3F A;  3F8T A;  3J7Y W;  4DV5 Q;  4MNO A;  5C5M A;  5AJ3 L;  1WTW A;  2R93 G;  1EOV A;  2R7D A;  3RR5 A;  2Z6K A;  3PUW A;  1C4Q A;  1WJJ A;  4OEM B;  4GKK L;  5M5X B;  1U4P A;  3IKJ A;  4DV1 L;  4A3E G;  2K5N A;  4CJ0 B;  3A56 A;  1SXT A;  2NVX B;  2H1E A;  4UY8 C;  2A1A A;  1TY0 A;  1IXR A;  3J81 L;  1G6P A;  2KEN A;  1QE6 A;  4BBR H;  3K80 C;  1VQ9 A;  3I4M H;  3CHB D;  2SNM A;  2OQK A;  3HEJ A;  4XQQ A;  1PH6 A;  4O1N A;  3M7G A;  4OIJ A;  5C0X G;  3GTQ B;  3PF4 A;  3CRK C;  3I72 A;  2R3Z A;  2BDN A;  4C2M B;  3GTL B;  4C3J H;  3UDX A;  2JA8 G;  4YCW A;  1EQQ A;  4Y7N B;  4EQP A;  1U4R A;  4BBS B;  4YHH Q;  1N32 Q;  3BVG A;  3T56 B;  3VDY A;  2QW7 A;  2RSN A;  5JEA J;  4OO1 I;  3FDT A;  1TWH H;  3I2Z A;  3HOX H;  3HOZ B;  1CKO A;  2EDG A;  1JB7 A;  3F2C A;  4B9W A;  2IHF A;  1IBM L;  3GTM B;  2OQ0 A;  2D9U A;  4DFA A;  4UP7 A;  5EPL A;  3D8G A;  1VF5 C;  1HZB A;  1VQP A;  4XDX A;  1XPO A;  4A3D G;  1RHP A;  3MXN A;  2G5D A;  2EJF C;  4ZLT F;  1AEX A;  1K83 H;  2YU9 H;  5IGE A;  3PIO A;  3T13 A;  1TWF B;  2QEJ C;  2B2V C;  1LAC A;  4F8M A;  4DAV A;  1H9K A;  2CH4 W;  1CI3 M;  3HOY G;  1BBU A;  2WB1 E;  5EBD A;  5CC4 A;  4TQU S;  4U68 A;  3D4W A;  4AQY L;  1WTQ A;  5GQO A;  1LM0 A;  1S5D D;  5KNB A;  5EGT A;  2CKZ B;  4OO1 H;  2KCC A;  2TMP A;  4ZRZ A;  2K1B A;  4XIG S;  1GUN A;  1TS3 A;  1CA5 A;  1KIX A;  2ZXP A;  2LS0 1;  1IKM A;  1FGB D;  2Z9H A;  2BDO A;  2HIX A;  4JV5 Q;  5IYC H;  4DGZ A;  1FJG Q;  2NTT A;  2ZTD A;  2BOS A;  3SXH A;  4GNX B;  4DV3 Q;  3CC4 A;  4DNI A;  5DM6 3;  2UU9 L;  4LF8 L;  3S1R B;  2OTL A;  3HOV B;  1V1Q A;  2J4X A;  3MEF A;  2B2Y C;  1TT2 A;  1U5K A;  1EU4 A;  4DR7 L;  4MTK A;  5M5Y B;  3CXC A;  4FXG C;  4OON A;  4QB4 A;  4APV A;  1SFO B;  2Q8T A;  3SK4 A;  1C8C A;  1K3R A;  2WAQ B;  1J5E Q;  3I4N G;  2PQE A;  1UE5 A;  1A8V A;  4DV6 Q;  4KY5 A;  3TN2 A;  2NUC A;  1GXD C;  2DNE A;  4CBV A;  1TR5 A;  2SOB A;  4KK7 A;  1ESF A;  5M5X H;  3RLN A;  1PH2 A;  2NTS A;  2NVX H;  5JEA H;  5JAV A;  3A8K E;  4AYB E;  2ZJR A;  4DAY A;  2EPB A;  3E5S A;  1N33 L;  1TVX A;  4HTH A;  4I7A A;  1BOS A;  1KQS A;  1BO0 A;  1SE8 A;  3PO2 B;  5J39 A;  3BZD B;  3GTQ H;  3KK7 A;  1VQL A;  4C2M H;  2K28 A;  2C9O A;  3GTL H;  1M4V A;  3I8Z A;  3VYS A;  3A5Z B;  4MIU A;  3D4R A;  3G7L A;  4OEL B;  5BR8 Q;  4IFD G;  1K3B C;  4Y7N H;  1F2L A;  4A3F G;  1AH9 A;  4WJ3 M;  2ZTC A;  4LF6 L;  2K05 A;  3CPW A;  4BBS H;  2A6H D;  2DNC A;  3HOW B;  4K5V A;  3PO3 G;  2YTY A;  4IUP A;  3WDN A;  4A3B G;  3MA2 B;  3QIA A;  4IAL A;  1ENF A;  2VB3 X;  3HS0 C;  1PVO A;  1O78 A;  3I56 A;  3HOZ H;  2PZW A;  2BCO A;  2R92 G;  3KLR A;  1YEZ A;  2FMC A;  4KHP L;  3GTM H;  2JN4 A;  4ULL A;  1BR9 A;  3EVQ A;  3OSO A;  3PGZ A;  2E8G A;  3I4L A;  2EYF A;  1E0B A;  2PCF B;  1NMG A;  1XWE A;  4CDC C;  3EIV A;  4MN3 A;  4JI6 Q;  3EA6 A;  5EBC A;  1LTS D;  3UE0 A;  5C4X G;  1IBL L;  3R3O A;  4ZUJ A;  4A93 B;  2EY1 A;  1Z7T A;  2RF4 A;  4UP9 A;  1EIF A;  3BYT B;  4HMI A;  4LF7 L;  1TWF H;  1VQG A;  1KC8 C;  1LTL A;  1Q1E A;  1XPU A;  4JYA Q;  4X62 L;  1ZYR C;  4HCS A;  3ZJY C;  2F0J A;  3UDI A;  1JJC B;  3CCE A;  5JVG 3;  1H9R A;  3H3V C;  3VR3 A;  5DNF A;  2Y0S E;  4XT3 B;  5H1S E;  1LLR D;  4L5R C;  5IE8 A;  2F0H A;  4U67 3;  2JA5 G;  2QIL A;  1Y1V G;  3T1H L;  1HPC A;  3QB3 A;  4KJN A;  4BA2 I;  4B9X A;  1S3O A;  4LK1 C;  3P20 A;  3S1R H;  3L9A X;  3HOV H;  1OTC A;  2M2L A;  4RGO S;  4LFC L;  1O7I A;  1WYD A;  4LFA Q;  1F9R A;  4H02 A;  2F0P A;  5I2Y A;  1SYF A;  3VA7 A;  1SFO H;  4G7Z C;  1WCM B;  4GN3 B;  2E5L Q;  2K5V A;  3F2D A;  1JT8 A;  2HT1 A;  4WOR A;  4GLX A;  3TZU A;  1VQ6 A;  5C6A A;  1ENA A;  3JAM c;  1S4Z A;  5KRU A;  4LF9 L;  1NR2 A;  1VDZ A;  1SNP A;  1L0X B;  2VQE Q;  1PH8 A;  3R2I A;  4WJW A;  4GKJ L;  3DEO A;  5IYD G;  5LMN L;  2A6E C;  3MFY A;  1HA5 A;  3M4O H;  3URY A;  4EVO A;  1VQD A;  3AEV A;  2KVM A;  2ENB A;  5LL6 S;  3S15 B;  4LF4 L;  3AFP A;  3U9S A;  3C1F A;  3KF6 A;  4EGV A;  3TQY A;  2N88 A;  3PO2 H;  2AQ1 B;  3IFT A;  3NK9 A;  2VQF Q;  1PFN A;  3UE1 A;  2NB0 A;  3I73 A;  1YJN A;  1LT3 D;  3OMC A;  2NN6 G;  4JC0 A;  1M1K C;  3FKI G;  5JJK A;  1F77 A;  3KBX A;  1TU2 B;  1CQV A;  3OW2 A;  4R1J A;  1HQR D;  4LUO A;  2F0S A;  2F0Q A;  1ET9 A;  1NNX A;  1UWV A;  1G2S A;  5JPN C;  3LWE A;  2K6A A;  4B3T Q;  1SDF A;  3CPF A;  1NMF A;  3VYT A;  1JOR A;  3J80 c;  2D0O A;  4IOC A;  2EYH A;  4C1N I;  2K33 A;  2TSS A;  5T1G A;  1PH7 A;  2UUC Q;  3G6J B;  1T9H A;  4IQZ A;  3W2D A;  1YNJ C;  2L0C A;  2DY7 A;  1K8A C;  2K03 A;  5EKK A;  1LO5 D;  3Q24 A;  3MXG A;  1QB5 D;  1HNZ L;  1EU3 A;  2CVR A;  2LMC B;  3A55 A;  1Z47 A;  2O2L D;  2K4K A;  4ALP A;  3BZK A;  3W5O A;  2CW0 C;  4XXE A;  1WVL A;  4A93 H;  1KNA A;  4CKC A;  1EY5 A;  3P1H A;  4B08 A;  3FEW X;  4QIW B;  2PZU A;  2Q8I B;  1GVP A;  1KNE A;  3H91 A;  3IL8 A;  3OYY A;  2B2U C;  3SK5 A;  3VR5 A;  1C48 A;  3GV6 A;  4JI0 Q;  3BVZ A;  3EN2 A;  3N52 A;  2AQ3 B;  1Q8K A;  4BXX H;  2EXD A;  2B39 A;  1KTK A;  1XXG A;  2A74 C;  2D2C C;  5FLX c;  4K2K A;  1QVC A;  3J80 L;  1IYJ B;  2BH8 A;  4EQO A;  3NBI A;  1EY8 A;  5IP7 G;  1X32 A;  2NYZ D;  1IL8 A;  3JAM E;  1PRT B;  3O13 A;  1Y1W B;  2B63 G;  4BY7 G;  1JIC A;  1NUC A;  4K5X A;  3S14 B;  1PFM A;  3A8J E;  3RD4 A;  2QF7 A;  3L2P A;  5M3F B;  4IPG A;  2K5H A;  1RIP A;  3F1Z A;  3S2D B;  1STG A;  2EYJ A;  4NB3 A;  2AKW B;  2B2U A;  1B2T A;  1SNC A;  2IY5 B;  2KCM A;  1TWG B;  3RLF A;  1WCM H;  4JI1 Q;  2A19 A;  2VXW A;  3ITP A;  1JQY D;  1MJC A;  1Q86 C;  3D0F A;  1GM5 A;  1P16 A;  1YI2 A;  2Z6B A;  1VMC A;  3CCR A;  3STB D;  2MFI A;  4IFD I;  5I9P A;  1STY A;  1BCP F;  4NXM Q;  5C4J B;  1YVC A;  4DR3 L;  1PMR A;  3KLW A;  1SBB B;  4R4C A;  1Y14 B;  5FLX L;  2DJG C;  2WAQ E;  1PZJ D;  5C3E G;  1IKL A;  3IRB A;  1YHQ A;  1ICF B;  4UDU C;  1RL2 A;  3MZ5 A;  2J7Z A;  1FVI A;  3S15 H;  1BKB A;  2MQH A;  1EIG A;  1BUV T;  4R8N A;  3W1G A;  4X64 L;  3TP5 A;  5K36 H;  3H0G B;  1QUQ B;  3NBH A;  1A3V A;  2CWP A;  2L11 A;  4PQX A;  1IW7 C;  3MC0 B;  4GOP C;  4DV4 Q;  2JA6 B;  1DOM A;  1PYW D;  4LMQ D;  5A2Q L;  2ICE C;  1S72 A;  5I4D A;  4RHR A;  5LMU L;  2F4V Q;  1I50 B;  1VQ5 A;  3J81 j;  2YTX A;  5CV6 A;  1SMY D;  1HUN A;  2F0E A;  1FL0 A;  5JEA G;  4DPG A;  1DJR D;  1GUW A;  2B2W A;  2ZJP A;  1PA6 A;  1K73 C;  2A68 C;  1GUS A;  2EY6 A;  1CUK A;  3M4Q A;  1SE2 A;  3E6Z X;  3TME A;  2A8V A;  3SEB A;  2LKV A;  2LSS A;  2RDF A;  5ELF A;  4NXN Q;  1UE1 A;  3BU2 A;  4UHV A;  4KMU C;  3J7A F;  5JJL A;  2HQL A;  4DN4 M;  2F0G A;  4P75 A;  4RKB A;  5IGG A;  1XMQ L;  3GDE A;  4LW1 A;  3CCU A;  1BF4 A;  1VQO A;  4KV6 A;  2KCN A;  1Y8O B;  3BYY B;  1CKN B;  1LYL A;  4FF2 A;  3C1E A;  3DUZ A;  1EYG A;  4A3G H;  1PH9 A;  4JI2 L;  1SYB A;  5ELC A;  5ELE A;  1PLF A;  4JI3 L;  3WWV A;  1PTO D;  2PQA B;  4DR2 L;  4JBJ A;  2JE6 I;  3K0Y A;  1CZW A;  1DD2 A;  4MHE A;  1SRU A;  5HY6 A;  3OWE B;  3SGI A;  5A35 A;  1Z6H A;  3K7A B;  1V1P A;  3OW7 A;  1Y1W H;  1XPR A;  4UP8 A;  1I5F A;  3S14 H;  3BG3 A;  1HTP A;  1L1O B;  1YJ9 A;  4B3M Q;  5M3F H;  2B2T C;  3CCM A;  2K14 A;  3RN5 A;  1LT6 D;  3S2D H;  2QDL A;  4IUR A;  4V0B A;  3VR4 A;  2IHE A;  4X65 Q;  2G9D A;  3S1Q B;  3EFX D;  1IL2 A;  4K8I A;  2AWN A;  1QNK A;  1TWG H;  4XTC S;  2O4X A;  4DK0 A;  3RN2 A;  1SRO A;  1LTG D;  2NVQ B;  3U50 C;  3T1Y Q;  2HUG A;  2JA7 B;  4Q5V A;  5BN4 A;  1ESR A;  3TZD A;  2XNA C;  1PTO B;  1II3 A;  4A3L G;  2BA1 A;  2UXC Q;  2F0M A;  2N49 A;  4K0K L;  1H9S A;  1JOQ A;  5CYU A;  1PH1 A;  1NE3 A;  1PYB A;  5C4J H;  5IT9 c;  2VL6 A;  3OHX C;  4CDD C;  2I5L X;  3ERQ A;  1NCV A;  4JI4 L;  2Q2U A;  3JC6 6;  3OMG A;  3D6W A;  5KND A;  2HDM A;  4I7Z C;  1VQN A;  2UUB L;  1DM0 B;  4IPC A;  2KED A;  1I94 Q;  3Q0A A;  4RWS C;  3HOV G;  4RCO A;  3ERO A;  4N9T A;  1C7Y A;  3OWF A;  4GN4 B;  2HD3 A;  2A5H A;  3H0G H;  2G9H D;  4R8I A;  5COY A;  2DGY A;  2KUM A;  5FO9 B;  1YJW A;  3U58 A;  4OIK A;  2WAC A;  5TSS A;  4C3I G;  3MFG A;  5C44 G;  2VZA A;  1HZA A;  3B6Y A;  1VQ7 A;  2RVL A;  4GNX C;  2JA6 H;  3LNN A;  1EWI A;  2EZV A;  4JI5 Q;  1B44 D;  3CW2 C;  2K52 A;  3MWY W;  1I50 H;  1RDP D;  1HFN A;  3OPO A;  4H13 C;  1B9N A;  5CV4 A;  4C1N K;  4KN4 C;  2AUK A;  4FXD A;  1BNZ A;  2PO4 A;  5FJ8 H;  4DV7 L;  1EEI D;  4N8X 1;  2UXB L;  1LT4 D;  5ELB A;  3CD6 A;  2LY7 A;  4G7H C;  3CU7 A;  1Q46 A;  1I4Q A;  4A3C H;  2KHI A;  3M4P A;  4P71 A;  4PNY A;  3NTH A;  1X3Q A;  2I07 B;  1RF2 D;  2KBN A;  2HHH L;  1HCZ A;  2B8G A;  4JBW A;  4O2D A;  4P74 A;  2PI2 E;  4OGQ C;  1QWY A;  1E2V A;  1W6K A;  3NWT A;  4JK1 C;  2F0K A;  1E22 A;  4LF5 L;  2A73 B;  3LGJ A;  4XYO A;  2UXD L;  3KYH C;  1T5E A;  2JXM B;  2F0O A;  3KF8 B;  3D3R A;  1AW7 A;  1K0S A;  4QQB X;  1YBY A;  1YIT A;  1B70 B;  3HFZ B;  4QUC A;  1FNV A;  1NSN S;  1KDC A;  4QIW E;  3HOU G;  1KRT A;  4CKB A;  4X6A H;  2HQE A;  4DV2 Q;  1HH2 P;  2DJF C;  4M8A A;  4QGU A;  1E24 A;  3NUC A;  3A74 A;  3K7A H;  2KJX A;  3T4A C;  3FPU B;  2MO1 A;  5IT9 E;  2R6G A;  4NMZ A;  4DAM A;  4PV1 C;  2XWJ B;  3TP7 A;  4FYD A;  5GAE C;  1W6J A;  2GA4 B;  4B3R Q;  1EQT A;  2B8F A;  1TS2 A;  1HHV A;  4GZY C;  3S1Q H;  5IP9 H;  1HNW Q;  2E2H H;  3C46 A;  2NVQ H;  3OTO Q;  2JA7 H;  4HAE A;  2SDF A;  2K01 A;  4IJL A;  1KDB A;  1IBK L;  1PTO H;  4DR6 L;  2UUA Q;  1K8M A;  1B4O A;  2NZH A;  1X55 A;  2KA7 A;  4LF7 Q;  2R7Z B;  4JPB W;  3PF5 A;  2B29 A;  5IYB H;  3HKZ B;  1HR0 L;  4JI8 L;  1ONL A;  2F3V A;  4KHZ A;  4DNR B;  3C2P A;  1SNM A;  2B2V A;  1UE7 A;  2SEB D;  4DR5 L;  1ZXT A;  2A6H C;  1EFI D;  1OXT A;  1MBY A;  1KXL A;  1LTB D;  4L8J A;  1FR3 A;  1I6H B;  2EYO A;  1SMX A;  2ZJQ A;  4R9W A;  2HDL A;  4PZ6 A;  2A69 C;  4C3H G;  1A6X A;  5ELO A;  4FDB A;  2BE5 D;  2PNH A;  2C35 B;  2L5T A;  3T1H Q;  3AMU A;  2KHJ A;  3CME A;  1V9P A;  4TKO B;  1EYC A;  4ZAI A;  1RJT A;  1KAW A;  5FLM H;  1PZK D;  1DYQ A;  2YYZ A;  1EOT A;  1GD7 A;  3FRP B;  4A3E B;  1UUP A;  2B2Y A;  3BZC A;  3MXN B;  3QOL A;  2RCN A;  3D31 A;  3R2T A;  3TP6 A;  1EYD A;  5BN3 A;  1XNR Q;  4PZ8 A;  4J6H A;  1TY2 A;  2J0T D;  5GAG C;  1HA6 A;  1EL0 A;  1DCZ A;  1WTO A;  2MPM A;  3IAY A;  3KLS A;  4LF9 Q;  1EEF D;  1B3Q A;  1A63 A;  5J3B A;  1N32 L;  1LTR D;  5CMD A;  4RGN A;  4BWG B;  1XJV A;  3NEL A;  1CSQ A;  2AWO A;  1DZ1 A;  3CQZ B;  3FMC A;  3OIP A;  1KLU D;  2OXP A;  1JE5 A;  4RG1 A;  2JA8 B;  1E7Z A;  4XYQ A;  3DWP A;  4KD4 A;  1SEB D;  2QGQ A;  3RNU A;  1TWA B;  3SR1 A;  2IPK D;  3KDF A;  2MP1 A;  1S5C D;  3S16 B;  3G71 A;  1U4L A;  3HGB A;  4KY6 A;  2XVS A;  1DOL A;  1QOH A;  3SVM A;  2I5H A;  3GTO B;  4NW2 A;  4C56 C;  2JEB I;  5E1F A;  2K7V A;  3MAQ A;  4HED A;  4OWT B;  5D14 A;  2E76 C;  1SJE D;  4FNF A;  2YV5 A;  4A3D B;  4QJF A;  4A3M G;  4CKE A;  2XWB B;  1I4R A;  3I90 A;  4LFB Q;  1FNU A;  1QNU A;  4IPD A;  3I7F A;  3NHH A;  1EWC A;  2N55 A;  4IUN A;  2QDB A;  4KKS A;  5KIX A;  1RTN A;  4LUV A;  3CCS A;  3ULL A;  1C9O A;  2VB2 X;  1HRJ A;  5EKI A;  3HOY B;  4A3G G;  1EY7 A;  5J1Z A;  1FJG L;  1HTL D;  4DAY B;  3Q6S A;  1EY4 A;  3ERS X;  2AHO B;  1YHA A;  1W2B A;  1ILP A;  4DV3 L;  2WB1 G;  4L63 B;  2R7Z H;  4NDX A;  4FF3 A;  1CSP A;  3AQQ A;  1XNQ Q;  5DAU A;  1A3U A;  3K5O A;  5IGF A;  3VR2 A;  2EVB A;  4X66 Q;  1SJH D;  2SNS A;  1SYC A;  1J5E L;  5M5Y H;  1RKN A;  5ELD A;  1X3G A;  1FYC A;  5CV9 A;  3EQL C;  5C0X I;  2VUM G;  2JP1 A;  1I6H H;  3G4S A;  5C3X A;  1EY6 A;  2X6L A;  2F0L A;  1ET6 A;  2XRS D;  1K28 A;  2IX0 A;  4KN7 C;  4A3J G;  5DM7 3;  1WTP A;  4QMG A;  5K5P A;  2F0T A;  4A3I G;  3I4N B;  5IWA Q;  1E1O A;  4JOI C;  4M1U B;  1K8O A;  1C0A A;  1AN8 A;  1PRT C;  3FHW A;  4IUT A;  5JOB A;  3I55 A;  4JI7 L;  4HJA A;  3VA5 A;  1PYS B;  3D4D A;  1MSG A;  5M3M G;  2IJ0 A;  4MZ9 A;  2K5Q A; 
#chains in the Genus database with same CATH homology
 2MGS A;  1B9M A;  1JOO A;  2PPB C;  1Q90 A;  4XQN A;  3QO2 A;  3FPP A;  2K32 A;  2H4O A;  3T51 B;  3V96 A;  4NKL A;  1V8Q A;  5E4W C;  4KKU A;  1DON A;  5C3W A;  1ZYR D;  2WP8 J;  3L3O C;  3J7A V;  4IUU A;  1Y8P B;  1QIL A;  2O5I C;  2LFN A;  3H94 A;  3JAM L;  4A3F B;  2NWG A;  1Q1B A;  2RA4 A;  5KGU A;  4LJZ C;  1JWS D;  2IW3 A;  3RZO B;  3PO3 B;  1LV9 A;  2XIW A;  5G3L F;  4A3B B;  5CV5 A;  4YIJ A;  1O80 A;  3A54 A;  4FVM A;  4K6L A;  5IGD A;  2R92 B;  1DXM A;  1FNW A;  1KAB A;  4QCL A;  4P2C B;  3P75 A;  2KEC A;  4C3J G;  5JVH 3;  4NP5 A;  3W3A A;  3V05 A;  1UAP A;  1EQV A;  4IFD J;  5C4X B;  2ZT9 C;  4ZK9 B;  1WTX A;  1BCP D;  5C4H A;  1F2Z A;  1VMP A;  5BN5 A;  2XSC A;  3BDC A;  4H7B A;  3GQB A;  2IX3 A;  4G7O C;  1L0Y B;  1J8I A;  2WKC A;  4RAU C;  1YNN D;  1IYV A;  4K5W A;  4ODG A;  2AQ2 B;  3M3Y B;  4ZUI A;  2F0V A;  2F03 A;  4H0L C;  2JA5 B;  1Y1V B;  2KQ3 A;  3NP8 A;  4I65 A;  4OL7 A;  2F0F A;  3EJI A;  1BCP B;  1SMY C;  2EE1 A;  4DK1 A;  2L9H A;  4OO1 G;  2E2I B;  4CJ1 B;  1QG7 A;  1A3T A;  1EY0 A;  1OXU A;  1YNJ D;  2NVT B;  1OXS C;  1STH A;  1NAP A;  3AU7 A;  2MHV A;  3HG9 A;  4L6T B;  2EYM A;  3MTS A;  4FXK C;  2EYL A;  2ZXR A;  2WIN B;  3S9W A;  1Q8I A;  1R9T B;  1CM9 A;  2OF1 A;  4WFN 3;  4HR7 B;  5CBE E;  1G29 1;  2FHT A;  2IL8 A;  3VYU A;  1SYD A;  2E74 C;  3R8B A;  1PTO C;  1ILQ A;  3TBI B;  5LHY 1;  3PUX A;  2IX1 A;  3BS1 A;  4RHS A;  1TS5 A;  1HUM A;  2Z1C A;  1MD2 D;  3FKI B;  4N9P A;  5IOC A;  4BS9 A;  4IFD H;  1ZKO A;  2ID0 A;  2KOL A;  5T1I A;  3K59 A;  2FJ2 A;  1I4H A;  3I3C A;  4PMW A;  3K6O A;  4K14 A;  3CRL C;  1XTC D;  4UAI A;  1TII D;  4X3T A;  1JE4 A;  3LWU A;  4ZYS A;  1GOZ A;  1JR0 D;  1I4P A;  1STE A;  3T16 A;  3SHL A;  3SK8 A;  1CHQ D;  5NUC A;  4KI0 A;  5DEH A;  2WII B;  1CTM A;  1O7Z A;  1GHK A;  4S3S A;  1G91 A;  4LAA A;  1WTR A;  5CV7 A;  1B53 A;  3D6C A;  3S1M B;  2JYO A;  4DXG A;  2B63 B;  4XQJ A;  4BY7 B;  5KNC A;  5KYL A;  1TQO A;  1GHJ A;  3QOJ A;  2F0U A;  4J8Q A;  2X69 A;  2KHS A;  2YU9 B;  4G4K A;  1MGS A;  1I3Q B;  3HZX A;  2NN6 I;  2F1M A;  3M7N A;  2ICI A;  2QCP X;  4J1M A;  4F7X A;  1I4G A;  4ZQ3 A;  2A68 D;  1SNQ A;  3F2U A;  1SNO A;  2F4I A;  2EJM A;  2B2T A;  4ZKC B;  2EXZ A;  3GP7 A;  5C3E B;  3Q23 A;  2PMZ B;  1E2Z A;  2F0W A;  4K8J A;  1GUT A;  1G2T A;  3GTG B;  3PUV A;  4XT1 B;  1JWU D;  2PW5 A;  1EZ8 A;  3NSW A;  1FD7 D;  2NN6 H;  1CT1 D;  3K57 A;  1E2W A;  2Q8R E;  1EZ6 A;  3PIO 3;  2NVY B;  5E4X A;  1V1P B;  3GO5 A;  5IT9 L;  4FF4 A;  1D5M C;  2FIN B;  5CV8 A;  4QUF A;  3BVM A;  4IN3 A;  1SAP A;  5J22 A;  4KHV A;  3KLS X;  4RCN A;  1U9R A;  1S5F D;  2NBF A;  1NR4 A;  2NZ1 D;  1A15 A;  2DN8 A;  3C3L A;  5I6W A;  3TSS A;  4H44 C;  3KUP A;  3OIQ A;  1H9S B;  1SE3 A;  2JEA I;  4Q0F A;  3ZYY X;  1STB A;  1D2B A;  4CJ2 C;  3U9O A;  1R4Q B;  1IYU A;  3I91 A;  5IIF A;  2BE5 C;  1LTA D;  3K5M A;  3VYR A;  1TWC B;  3V2T A;  4A3K B;  2PNR C;  4IZ8 A;  3J81 E;  3L7Z C;  1AP0 A;  1F9S A;  2RBM A;  1B50 A;  3TP8 A;  1EIH A;  3NQT A;  2F3W A;  2HCC A;  2KEE A;  4ABN A;  4KKT A;  3X3M A;  5JPM C;  2OT2 A;  1D6E C;  3M4Y A;  1JOK A;  2F0D A;  3MXU A;  4DNT B;  5M9O A;  4E6I A;  3A8I E;  4IUQ A;  4K6D A;  1SE4 A;  3GD7 A;  4KY7 A;  4F87 A;  2QKI C;  4V19 0;  3WOE A;  4DU9 A;  5EPK A;  3MXP A;  1I4X A;  1G6Z A;  1CHP D;  4PMC A;  4RGM A;  5C5L A;  4HCE A;  2R93 B;  1SYG A;  5I9O A;  5FO7 B;  2BA0 A;  1V1O A;  2ZXO A;  3GTJ B;  4C3I B;  5C44 B;  1A2T A;  1LAB A;  4BA1 I;  1H9J A;  2L55 A;  1CQF A;  1TS4 A;  3M4O B;  1OXX K;  1STN A;  5K36 G;  3KBG A;  3S2H B;  1QJO A;  3M85 A;  5CR3 A;  3PUZ A;  4ILW A;  5M5W B;  2CQA A;  3BDO A;  1HFG A;  2EYP A;  2K5D A;  1VF7 A;  5LL6 X;  1D5Z C;  1SND A;  2D62 A;  2EOT A;  4RH6 A;  3BDL A;  3ND9 A;  5C0X J;  4DA2 A;  5IGC A;  2A69 D;  2X6G A;  4RKL A;  5I6Y A;  1RD9 D;  2L12 A;  5D65 A;  1XYI A;  4QF4 A;  1IHZ A;  3HOU B;  5EJW A;  1R4P B;  1T5X D;  5C4Z A;  5I2X A;  2E2J B;  1ENC A;  2L1B A;  1S5B D;  3LX0 A;  3MEH A;  2F0I A;  3H09 A;  2IWH A;  4X3K A;  3E0J A;  4FO2 A;  3QJY A;  2RSO A;  1H9M A;  4FP5 D;  1UNS A;  1QCB D;  5AFW A;  1RTO A;  1J9O A;  1HQM C;  1CFM A;  3VR6 A;  5F2D A;  1JCK B;  2EJG C;  4KTA A;  1RCV D;  2FMM A;  1Y69 U;  1VCI A;  3HRZ C;  2K04 A;  1WTV A;  1AZP A;  5G3L D;  2M00 A;  3SDZ A;  4C3H B;  1X3P A;  2PYK A;  1B3A A;  3R93 A;  4X3S A;  3SE0 A;  1ROD A;  4ID6 A;  3GV3 A;  3PV0 A;  1ML0 D;  3PIP 3;  3IFD A;  2DY8 A;  1SYE A;  3DMU A;  1BCP C;  4DAP A;  3HP3 A;  2Z4I A;  5C0X H;  3AB9 A;  1CK1 A;  4TSS A;  1EYA A;  1YNN C;  2RKS A;  3NXW A;  4CGY B;  1PZI D;  3RZD B;  2OEO A;  2E75 C;  3MHB A;  1STA A;  2HCI A;  5FO8 B;  3ND8 A;  1WD1 A;  1HXY D;  2FFK B;  2L4N A;  2MJ8 A;  4HMJ A;  1D1K A;  4HN7 A;  2I46 A;  3A7A B;  1JB3 A;  1CA6 A;  2AUJ D;  2R61 A;  4DF7 A;  5KYI A;  1KLG D;  3RUZ A;  1A2U A;  1M8A A;  3NTI A;  1PRT D;  1KAA A;  2CHB D;  4A3M B;  2IT1 A;  2XN9 C;  1XX8 A;  1LTI D;  5FOB B;  1MSH A;  2A6E D;  3I70 A;  5CBA E;  1ICW A;  4RGT A;  1EWH A;  3NE5 B;  1TKW B;  1D5X C;  3GTK B;  3S17 B;  3OOC A;  1SSO A;  5IOD A;  3PMF A;  4A3G B;  4ZKB B;  3CKI B;  3S1N B;  5COR A;  2RDH A;  3H6M A;  3WOF A;  3T53 B;  1G8Z D;  2WB1 B;  1GJX A;  3P7J A;  2MUY A;  2RQX A;  2Z4H A;  5HGT A;  2E2D C;  3DEP A;  3QG1 A;  2Z8L A;  3MVV A;  2VUM B;  1GUG A;  1PRT F;  2F0N A;  1BQQ T;  1UEA B;  3NTK A;  4A3J B;  4A3I B;  1PXU A;  2M9V A;  5ISR A;  2PW7 A;  4X3U A;  2CW0 D;  3GTP B;  4HSV A;  3K5N A;  5M3M B;  1I6V C;  1LTT D;  4EQN A;  4DXF A;  4WRD A;  2RDG A;  1PFB A;  4RA8 A;  1Q3L A;  1O7L A;  3DHQ A;  2WKD A;  4O42 A;  3J80 E;  3N6R A;  3UI2 A;  4BY1 B;  1BXT A;  2B2W C;  4AYB B;  1ZEQ X;  3DWQ A;  2K5W A;  2WV6 D;  1Y8N B;  3ONA B;  3NPP A;  1LT5 D;  5D3D A;  1MI2 A;  5EPJ A;  4RFB A;  4BBR B;  3I4M B;  5EQ0 A;  3FVQ A;  5D3I B;  1F9Q A;  3RMH A;  2VNU D;  3DM1 A;  1DOK A;  4ME5 A;  1CZG A;  1F2M A;  1JWM D;  5FLX E;  5FKA C;  3TDQ A;  4C3J B;  1AZQ A;  4FF1 A;  4CHT B;  3NWS A;  1F9P A;  3DWA A;  2JSO A;  4IUV A;  1WD0 A;  1PDQ A;  3PUY A;  1F2Y A;  1TWH B;  4F88 A;  1S5E D;  3HOX B;  5JJZ A;  4KJO A;  4OHJ A;  1BBX C;  4PMB A;  1IW7 D;  2C5C A;  1AFP A;  1OXV A;  1KDA A;  5A2Q E;  3A7L A;  4K2L A;  1D1I A;  4KD3 A;  4TRD A;  1K83 B;  3QWN A;  2O5J C;  2D5D A;  5EKL A;  2Y0S B;  4HSP A;  5KEE A;  2PZT A;  5CGK A;  1B1Z A;  1EY9 A;  4G57 A;  5HUR A;  3SK6 A;  3K58 A;  2E2H B;  1JC7 A;  4Z9C B;  3X3N A;  1U4M A;  2EY2 A;  1GUO A;  1Q12 A;  2EY5 A;  2V4D A;  3DXJ C;  3Q22 A;  3KF8 A;  1OO9 B;  3NQI A;  5IGB A;  1O7Y A;  1PTO F;  2XRQ D;  5FK9 C;  1V43 A;  1BDO A;  3K5L A;  5E3F A;  3J7Y W;  5C5M A;  1WTW A;  3PUW A;  1C4Q A;  5M5X B;  1U4P A;  3IKJ A;  4CJ0 B;  3A56 A;  1SXT A;  2NVX B;  2H1E A;  1TY0 A;  3J81 L;  1QE6 A;  3CHB D;  2SNM A;  4XQQ A;  3HEJ A;  4O1N A;  3M7G A;  4OIJ A;  5C0X G;  3GTQ B;  3CRK C;  3I72 A;  2R3Z A;  2BDN A;  4C2M B;  3GTL B;  4Y7N B;  4EQP A;  1U4R A;  4BBS B;  3BVG A;  3T56 B;  2RSN A;  5JEA J;  4OO1 I;  3FDT A;  3HOZ B;  2EDG A;  4B9W A;  3GTM B;  2D9U A;  4DFA A;  5EPL A;  3D8G A;  1VF5 C;  4XDX A;  1RHP A;  3MXN A;  2EJF C;  4ZLT F;  1AEX A;  5IGE A;  3T13 A;  1TWF B;  2QEJ C;  2B2V C;  1LAC A;  4F8M A;  4DAV A;  1H9K A;  1CI3 M;  5EBD A;  5CC4 A;  4TQU S;  4U68 A;  3D4W A;  1WTQ A;  1S5D D;  5KNB A;  5EGT A;  4OO1 H;  2KCC A;  2TMP A;  4ZRZ A;  2K1B A;  4XIG S;  1GUN A;  1TS3 A;  1CA5 A;  2ZXP A;  2LS0 1;  1IKM A;  1FGB D;  2BDO A;  4DGZ A;  2NTT A;  2BOS A;  3SXH A;  5DM6 3;  3S1R B;  3HOV B;  2J4X A;  2B2Y C;  1TT2 A;  1EU4 A;  5M5Y B;  4FXG C;  4QB4 A;  1SFO B;  2Q8T A;  3SK4 A;  1C8C A;  2WAQ B;  2PQE A;  4KY5 A;  3TN2 A;  2NUC A;  1GXD C;  2DNE A;  4CBV A;  1TR5 A;  2SOB A;  4KK7 A;  1ESF A;  2NTS A;  5JEA H;  5JAV A;  3A8K E;  4DAY A;  2EPB A;  3E5S A;  1TVX A;  4HTH A;  1BOS A;  1BO0 A;  3PO2 B;  5J39 A;  3BZD B;  3KK7 A;  2K28 A;  2C9O A;  1M4V A;  3I8Z A;  3VYS A;  4MIU A;  3D4R A;  3G7L A;  4IFD G;  1F2L A;  2K05 A;  2A6H D;  2DNC A;  3HOW B;  4K5V A;  4IUP A;  3WDN A;  3MA2 B;  3QIA A;  4IAL A;  1ENF A;  2VB3 X;  3HS0 C;  1O78 A;  2PZW A;  2BCO A;  3KLR A;  2FMC A;  4ULL A;  1BR9 A;  3EVQ A;  3OSO A;  3I4L A;  2EYF A;  1E0B A;  2PCF B;  1XWE A;  4MN3 A;  3EA6 A;  5EBC A;  1LTS D;  3R3O A;  4ZUJ A;  4A93 B;  2EY1 A;  1Z7T A;  3BYT B;  4HMI A;  1Q1E A;  1ZYR C;  4HCS A;  2F0J A;  5JVG 3;  1H9R A;  3H3V C;  3VR3 A;  5DNF A;  4XT3 B;  1LLR D;  2F0H A;  4U67 3;  2QIL A;  1HPC A;  3QB3 A;  4KJN A;  4BA2 I;  4B9X A;  4LK1 C;  3P20 A;  3L9A X;  2M2L A;  4RGO S;  1F9R A;  2F0P A;  5I2Y A;  1SYF A;  3VA7 A;  4G7Z C;  1WCM B;  4WOR A;  3TZU A;  5C6A A;  1ENA A;  1S4Z A;  5KRU A;  1NR2 A;  1VDZ A;  1SNP A;  1L0X B;  3R2I A;  4WJW A;  3DEO A;  2A6E C;  3MFY A;  1HA5 A;  3URY A;  4EVO A;  2KVM A;  2ENB A;  5LL6 S;  3S15 B;  3U9S A;  3C1F A;  4EGV A;  2N88 A;  2AQ1 B;  3IFT A;  3NK9 A;  1PFN A;  2NB0 A;  3I73 A;  1LT3 D;  3OMC A;  2NN6 G;  1F77 A;  3KBX A;  1TU2 B;  1CQV A;  1HQR D;  2F0S A;  2F0Q A;  1ET9 A;  5JPN C;  1G2S A;  3LWE A;  2K6A A;  1SDF A;  3VYT A;  1JOR A;  2EYH A;  4C1N I;  2K33 A;  2TSS A;  5T1G A;  3G6J B;  4IQZ A;  3W2D A;  1YNJ C;  2L0C A;  2DY7 A;  2K03 A;  5EKK A;  1LO5 D;  3Q24 A;  3MXG A;  1QB5 D;  1EU3 A;  2CVR A;  2LMC B;  3A55 A;  1Z47 A;  2O2L D;  2CW0 C;  4XXE A;  1WVL A;  1KNA A;  4CKC A;  1EY5 A;  3P1H A;  4B08 A;  3FEW X;  4QIW B;  2PZU A;  2Q8I B;  1KNE A;  3H91 A;  3IL8 A;  2B2U C;  3SK5 A;  3VR5 A;  1C48 A;  3GV6 A;  3BVZ A;  3N52 A;  2AQ3 B;  2B39 A;  1KTK A;  1XXG A;  2A74 C;  2D2C C;  4K2K A;  3J80 L;  4EQO A;  3NBI A;  1EY8 A;  1X32 A;  2NYZ D;  1IL8 A;  3JAM E;  1PRT B;  3O13 A;  1Y1W B;  1JIC A;  1NUC A;  4K5X A;  3S14 B;  1PFM A;  3A8J E;  3RD4 A;  2QF7 A;  5M3F B;  3S2D B;  1STG A;  2EYJ A;  2B2U A;  1B2T A;  1SNC A;  1TWG B;  3RLF A;  2VXW A;  3ITP A;  1JQY D;  1VMC A;  4IFD I;  5I9P A;  1STY A;  1BCP F;  5C4J B;  1PMR A;  1SBB B;  5FLX L;  1PZJ D;  1IKL A;  4UDU C;  3MZ5 A;  2J7Z A;  1EIG A;  1BUV T;  4R8N A;  3TP5 A;  5K36 H;  3H0G B;  3NBH A;  1A3V A;  2L11 A;  4PQX A;  1IW7 C;  3MC0 B;  2JA6 B;  1DOM A;  1PYW D;  4LMQ D;  5A2Q L;  2ICE C;  5I4D A;  4RHR A;  1I50 B;  5CV6 A;  1SMY D;  1HUN A;  2F0E A;  5JEA G;  1DJR D;  1GUW A;  2B2W A;  2A68 C;  1GUS A;  2EY6 A;  1SE2 A;  3E6Z X;  3TME A;  3SEB A;  2LKV A;  2RDF A;  5ELF A;  4KMU C;  3J7A F;  4DN4 M;  2F0G A;  4RKB A;  5IGG A;  1BF4 A;  4KV6 A;  2KCN A;  1Y8O B;  3BYY B;  4FF2 A;  3C1E A;  3DUZ A;  1SYB A;  5ELC A;  5ELE A;  1PLF A;  1PTO D;  2JE6 I;  3K0Y A;  1CZW A;  1DD2 A;  4MHE A;  3OWE B;  5A35 A;  1Z6H A;  3K7A B;  1V1P A;  3OW7 A;  3BG3 A;  1HTP A;  2B2T C;  1LT6 D;  4IUR A;  4V0B A;  3VR4 A;  2G9D A;  3S1Q B;  3EFX D;  4K8I A;  2AWN A;  1QNK A;  4XTC S;  2O4X A;  4DK0 A;  1LTG D;  2NVQ B;  2HUG A;  2JA7 B;  4Q5V A;  5BN4 A;  1ESR A;  3TZD A;  2XNA C;  1PTO B;  1II3 A;  2BA1 A;  2F0M A;  1JOQ A;  1H9S A;  5CYU A;  3OHX C;  3ERQ A;  1NCV A;  3OMG A;  5KND A;  3D6W A;  2HDM A;  4I7Z C;  1DM0 B;  2KED A;  3Q0A A;  4RWS C;  4RCO A;  3ERO A;  4N9T A;  3OWF A;  2A5H A;  2G9H D;  4R8I A;  5COY A;  5FO9 B;  2KUM A;  4OIK A;  2WAC A;  5TSS A;  4C3I G;  3MFG A;  2RVL A;  3LNN A;  2EZV A;  1B44 D;  3MWY W;  1RDP D;  1HFN A;  3OPO A;  4H13 C;  1B9N A;  5CV4 A;  4C1N K;  4KN4 C;  2AUK A;  4FXD A;  1BNZ A;  2PO4 A;  1EEI D;  1LT4 D;  5ELB A;  2LY7 A;  4G7H C;  3CU7 A;  1I4Q A;  4PNY A;  3NTH A;  1X3Q A;  2I07 B;  1RF2 D;  1HCZ A;  2B8G A;  4JBW A;  4OGQ C;  1QWY A;  1E2V A;  1W6K A;  3NWT A;  4JK1 C;  2F0K A;  2A73 B;  4XYO A;  1T5E A;  2JXM B;  2F0O A;  3D3R A;  1AW7 A;  4QUC A;  1FNV A;  1NSN S;  1KDC A;  4CKB A;  2HQE A;  4M8A A;  3NUC A;  2KJX A;  3T4A C;  3FPU B;  5IT9 E;  2R6G A;  4NMZ A;  4PV1 C;  2XWJ B;  3TP7 A;  4FYD A;  1W6J A;  2GA4 B;  1EQT A;  2B8F A;  1TS2 A;  1HHV A;  4GZY C;  3C46 A;  4HAE A;  2SDF A;  2K01 A;  1KDB A;  1PTO H;  1K8M A;  1B4O A;  2KA7 A;  2R7Z B;  3HKZ B;  1ONL A;  2F3V A;  4KHZ A;  4DNR B;  3C2P A;  1SNM A;  2B2V A;  2SEB D;  1ZXT A;  2A6H C;  1EFI D;  1OXT A;  1MBY A;  1LTB D;  4L8J A;  1FR3 A;  1I6H B;  2EYO A;  4R9W A;  2HDL A;  2A69 C;  4C3H G;  1A6X A;  2BE5 D;  2L5T A;  3AMU A;  4TKO B;  1EYC A;  4ZAI A;  1RJT A;  1PZK D;  1DYQ A;  2YYZ A;  1EOT A;  3FRP B;  4A3E B;  1UUP A;  2B2Y A;  3QOL A;  3D31 A;  3R2T A;  3TP6 A;  1EYD A;  5BN3 A;  4J6H A;  1TY2 A;  2J0T D;  1HA6 A;  1EL0 A;  1DCZ A;  1WTO A;  2MPM A;  3IAY A;  3KLS A;  1EEF D;  1LTR D;  5CMD A;  4RGN A;  4BWG B;  2AWO A;  1DZ1 A;  3CQZ B;  3FMC A;  3OIP A;  1KLU D;  2OXP A;  2JA8 B;  4XYQ A;  3DWP A;  4KD4 A;  1SEB D;  1TWA B;  3SR1 A;  2IPK D;  2MP1 A;  1S5C D;  3S16 B;  1U4L A;  3HGB A;  4KY6 A;  2XVS A;  1DOL A;  1QOH A;  3SVM A;  3GTO B;  4NW2 A;  4C56 C;  2JEB I;  5E1F A;  2K7V A;  3MAQ A;  4HED A;  5D14 A;  2E76 C;  1SJE D;  4FNF A;  4A3D B;  4CKE A;  2XWB B;  1I4R A;  3I90 A;  1FNU A;  1QNU A;  3NHH A;  1EWC A;  2N55 A;  4IUN A;  2QDB A;  4KKS A;  5KIX A;  1RTN A;  2VB2 X;  1HRJ A;  5EKI A;  3HOY B;  1EY7 A;  5J1Z A;  1HTL D;  3Q6S A;  1EY4 A;  1ILP A;  4L63 B;  4NDX A;  4FF3 A;  5DAU A;  1A3U A;  3K5O A;  5IGF A;  3VR2 A;  2EVB A;  1SJH D;  2SNS A;  1SYC A;  1RKN A;  5ELD A;  1FYC A;  5CV9 A;  3EQL C;  5C0X I;  2JP1 A;  5C3X A;  1EY6 A;  2X6L A;  2F0L A;  1ET6 A;  2XRS D;  2IX0 A;  4KN7 C;  5DM7 3;  1WTP A;  4QMG A;  5K5P A;  2F0T A;  3I4N B;  4M1U B;  1K8O A;  1AN8 A;  1PRT C;  4IUT A;  5JOB A;  3VA5 A;  3D4D A;  1MSG A;  2IJ0 A;  2K5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...