4CJ1B

Crystal structure of celd in complex with affitin h3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
63
Chain Sequence
SVKVKFHEKEVDTSKIKKVWRINTRLGMRVAFTYDDNGKTGRGMVPEKDAPKELLDMLARAEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE D
publication title Potent and Specific Inhibition of Glycosidases by Small Artificial Binding Proteins (Affitins)
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/de novo protein
total genus 12
structure length 63
sequence length 67
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cj1B00
5EQ0A 1WD0A 1KNAA 1WTRA 1O80A 1SAPA 2HUGA 2KOLA 1GUWA 4OIJA 2HCIA 1WVLA 1AZQA 2MGSA 3HP3A 5E4XA 1NCVA 3P7JA 1NAPA 1O7YA 1M8AA 2EOTA 2VXWA 3I3CA 4LMQD 1ZXTA 2K05A 2RVLA 3GV3A 3I90A 4QUCA 4HCSA 3IL8A 3R93A 4ZLTF 2B2VC 1WTXA 4R8IA 2X69A 1RTNA 1C8CA 1PFBA 5CMDA 5T1GA 4MN3A 1WTVA 1WD1A 1BNZA 1IKLA 2B2UC 4IUPA 1F9RA 1QNKA 4CJ2C 4DN4M 2XIWA 1JICA 4X3KA 1J9OA 2B2VA 1F9SA 5EJWA 3Q6SA 5COYA 5T1IA 1WTWA 1F2LA 3DM1A 2N55A 1HUMA 2L9HA 4UAIA 1WTPA 1G6ZA 3MWYW 4ZKCB 4IURA 2Q8RE 4X3TA 1U4MA 2EPBA 1RODA 1U4PA 1IL8A 3ONAB 2B2UA 1NR2A 4U68A 4O42A 1DZ1A 1EQTA 1HFGA 2KVMA 1VMPA 4RAUC 4NW2A 2K03A 3KUPA 4ZKBB 4XT3B 2MPMA 1DOLA 2MP1A 2NYZD 5EKIA 2IL8A 4R9WA 1PFNA 2KEDA 5CBEE 4XDXA 1X3QA 2X6GA 2KUMA 1SDFA 2JP1A 2FINB 3F2UA 4IUVA 2Q8TA 4ZK9B 1WTOA 1MGSA 1U4LA 2NZ1D 2FHTA 1DOKA 1O7ZA 2D9UA 2R3ZA 3D6WA 2HDMA 3TZDA 3G7LA 2K04A 3IFDA 1ILPA 4X3UA 2KECA 4CJ1B 1CA5A 4X3SA 2J7ZA 1EL0A 2CVRA 1E0BA 4RA8A 1ESRA 5EPJA 1G91A 1LV9A 1VMCA 2RSOA 1JE4A 1B53A 1QE6A 3H91A 5AFWA 5D14A 3N52A 1QG7A 5EPLA 5CBAE 1AZPA 1BBXC 1XX8A 1CM9A 1X3PA 1B4OA 2HDLA 1HHVA 1ICWA 2B2TA 1PFMA 1HUNA 5DNFA 4CJ0B 5EPKA 1DONA 3MTSA 1S4ZA 4HAEA 3I8ZA 1PDQA 3FDTA 1IKMA 1BO0A 1BF4A 1F9QA 1EOTA 2HCCA 1WTQA 3QO2A 1DOMA 1RTOA 2FFKB 2N88A 2L4NA 4HEDA 1RHPA 4ZAIA 2L11A 2FJ2A 2K01A 1X32A 2DY7A 1TVXA 1KNEA 3KBXA 2B2TC 1PLFA 1HFNA 2RA4A 4XT1B 1SSOA 1G2SA 3I91A 1NR4A 5JJZA 2B2WA 4IUUA 2FMMA 2M2LA 3GV6A 4IUQA 3DEPA 2L12A 2EE1A 2KEEA 2B2YC 5E4WC 4QUFA 1ILQA 1ML0D 1HA6A 5CORA 3TN2A 1G2TA 2SDFA 1HRJA 2L1BA 2X6LA 2RSNA 1MSGA 5D65A 3LWEA 4HSVA 2K28A 4OIKA 1J8IA 1B3AA 1A15A 1MI2A 1EIGA 2BDNA 2DY8A 1U4RA 2JYOA 2NWGA 4MHEA 2B2WC 3SVMA 3DEOA 4IUTA 3FPUB 4RWSC 1Q3LA 1XYIA 2H1EA 2B2YA 2K1BA 3UI2A 1EIHA 1MSHA 1CA6A 1RJTA 1F9PA 2MJ8A 1AP0A 1B50A 1B2TA
chains in the Genus database with same CATH superfamily
1I94L 5C3EB 1KABA 1S3OA 2K5NA 4IN3A 4JI6Q 5JVG3 2SOBA 4HIOA 1EWCA 3I3CA 4B3SQ 1ONLA 1PRTC 4JI3L 3TP7A 4YWLA 2P5ZX 2A68C 1EY7A 1TWCB 4JOIC 2Q2HA 4K8JA 4DV0Q 5K36H 3RZOB 1CKNA 1N9WA 4CJ2C 2PW5A 5HGQA 1YZ6A 5TSSA 1J9OA 2WB1B 3HOWG 5EJWA 1H9JA 3K5LA 2EIFA 1TS2A 3NXWA 4X65L 4O42A 1HJPA 1EQTA 4KV6A 3VDYA 1CZWA 1GO3E 4A3DB 4A93H 1JC7A 3K5NA 1H9SB 1PFNA 3G71A 3CRLC 3MVVA 4DV5Q 1X3QA 4HMIA 4MTKA 1SMXA 2G9DA 1EWHA 3EFXD 3G7LA 5CYUA 4DV6Q 1EQQA 1IYJB 4K2LA 2Z6KA 4ME5A 4A3JG 2GN5A 3J81c 1EFWA 4YCUA 1VMCA 5EPLA 5M9OA 1G291 4JI4Q 1X3PA 2PZUA 3KJPA 5DNFA 2EQSA 4DV7L 3J81E 3CCJA 4JI5L 1MD2D 1Q86C 2HCCA 5BR8Q 1Q8IA 1EEID 1FGUA 1BCPF 2YTVA 3QO2A 2L4NA 2A6ED 1LTAD 2XVSA 3KDFB 5LMNW 2PQAB 3OIQA 2XWJB 3NELA 5IP9H 5BN5A 5M5YH 4JI2Q 2ENBA 2ZJPA 2L12A 1MJCA 4GN5A 4R4OA 1G2TA 3I55A 2SDFA 4APVA 1IW7D 3KF6B 2H4OA 2BDNA 3I73A 1MI2A 4R4IA 5J3BA 1J8IA 1SNMA 1TWFB 2IWHA 1H95A 4MHEA 3TEHB 3SVMA 4GKKL 3FPUB 3S1NB 1QJOA 4BY1B 1MSHA 2UXBL 4LF7L 2PMZE 2MJ8A 3CP0A 2G9HD 5FK9C 1B44D 2WINB 2LY7A 3CF5A 1U5KA 2AUJD 2WIIB 1JMCA 4FVMA 3K57A 3Q22A 1V9PA 1LACA 4DNTB 3E5SA 3NEMA 3L2PA 4JV5Q 4DXGA 3CCVA 3I4LA 3K80C 3MEHA 5IGGA 4N8FA 3EROA 3W3AA 3RUZA 2NTTA 3A8JE 4B3TQ 5JJKA 3M3YH 2E8GA 3Q6SA 1WTWA 4PZ6A 3KJOA 3MXUA 4O0AA 1I4RA 1IL8A 3J81L 3CPFA 3G48A 4P73A 3GTPH 1HFGA 4JPBW 3T1HQ 4JBWA 3NK9A 1ASZA 5EKIA 2OWOA 4JI1L 2Q2TA 1KTKA 1I6HH 1L2FA 3HKZE 2NZOA 1V43A 4LJZC 3C2PA 1DXMA 5C44B 1JE5A 4O2DA 3A56A 3D4RA 2ICIA 1PRTB 1B8AA 1WCMH 1QUQB 3N6RA 1UUPA 1JT8A 1K3BC 4C2MH 4YCVA 3OTOL 1IBKL 3JAMc 2M9VA 3F2DA 5C4XH 4YWKA 1UAPA 3TP6A 4DXFA 3MTSA 1Z6HA 3ERQA 4IALA 4LFBQ 5ELFA 3K5MA 2VUMH 1W2BA 1Z7TA 3JAME 3A8KE 1JJ2A 4QGUA 4X62L 2BH2A 4BBSH 2CQAA 4KHZA 3ZYYX 4NPSA 4PV1C 2ICEC 1I94Q 4B08A 2F0DA 5KNBA 4LUVA 4AYBG 5KYIA 3OW2A 1YBYA 3I4NG 4Y7NH 1L0YB 1B70B 1X54A 1NSNS 2RSNA 3CCMA 1LT5D 4KTAA 4K5VA 4KKSA 2JA8H 4OIKA 3PO2G 4JI3Q 1BCPD 2RKSA 3PQIA 4RGOS 3E0JA 1A2UA 4CGYB 5KNDA 1CUKA 3UI2A 5EBCA 3CHBD 5KIXA 1PHJA 1IBML 1R9TB 2JQOA 1F9PA 1QWYA 1Q90A 3SEBA 4KKTA 1ET6A 4RCOA 1JCKB 3PO3B 4IFDH 2HCIA 4R4QA 4EQPA 5LL6S 4X66L 2EOTA 3HG9A 4QUCA 4RMFA 1BR9A 3S9WA 2VL6A 5FLMG 3IKJA 3BDCA 2X69A 1RTNA 2ZM6Q 3UE0A 3AMUA 4TVAB 1Y1WB 3J7AF 1UEBA 2F0QA 1AE2A 5JEAH 2ZJQA 1GUTA 3KLRA 3M7GA 2YTXA 1PTOC 2RCFA 2ZT9C 4IPGA 4K2KA 1U9RA 2NN6H 3S14H 3NHHA 1HR0L 3D0FA 5C4JH 3JAML 1QZGA 2WAQE 2Y0SG 5ELCA 5IYCG 2CWAA 5CV7A 3SK8A 4DV7Q 1S5FD 4A3KG 2JEAI 4JI5Q 2EYOA 4LUZA 4DAPA 2R6GA 2E2HH 4DR6L 1JWSD 1K8MA 1X9NA 1I4PA 3D6WA 3M85A 4IJLA 1B3QA 2TSSA 1E1TA 4ZYSA 1I3QB 3T56B 3MXPA 1PH3A 4PQXA 2EYJA 4A3MH 1SXTA 2GA4B 1BVSA 3CCEA 4DPGA 5M3FH 1PH4A 1FGBD 2EDGA 1AW7A 2B63H 1S4ZA 4HAEA 1PA6A 3W2DA 2JA9A 3TREA 2HD3A 1IW7C 5FLXc 4LF7Q 3H3VI 1YNJC 1SMYC 1X32A 2KCTA 1KNEA 4FF4A 4DR4L 3WDNA 5I2XA 3HEJA 4QB4A 3NPPA 4XT1B 3GTGB 3HOWB 4TSSA 1MIUA 3RLFA 1W3SA 4KHVA 3M4OH 5FLXE 2WACA 4B3RL 4LF5L 1Y8PB 3J7AV 2L1BA 5IWAL 4A3IH 4BA1I 3GP7A 2QA4A 4A3CH 1B3AA 2F0JA 3A0JA 3PUWA 3HFZB 2VB2X 4GN4B 3DEOA 5C3EH 5BN4A 2WV6D 1VQEA 3ND8A 3BYYB 4R4CA 4EGVA 1SFOH 4HSPA 4HN7A 1Y1VG 3K7AB 4B3ML 2N78A 4A3LH 2E75C 1ENAA 4A3JB 1WVLA 1MJEA 1TR5A 1M1KC 4KY7A 3CD6A 1G51A 2E5LL 3RZOH 3STBC 2UUAL 5GAHC 3PUZA 2CKZB 4ALPA 2NVQH 1IHZA 4JI1Q 3RMHA 1WFQA 4AH6A 4L6TB 1TWHH 1N32L 2WB1E 2ZXOA 4CDFC 5EBDA 4JI7Q 1D5XC 2R7ZG 4BXXH 1U4PA 1X56A 4JI0L 3OTOQ 1IBKQ 3K81C 1DZ1A 1VMPA 4HCEA 4KD3A 4J8QA 1MBYA 1HZBA 3GTLH 1S5BD 2K5QA 4O1NA 4P75A 2NYZD 4GNXA 1HZCA 2SNSA 1SR3A 1GVPA 3HOVG 1QOHA 3I56A 1IYUA 5J1ZA 4K14A 1WTOA 2V4DA 3F2UA 3S16H 4U673 5FLXL 4DAMA 1Z47A 1E2VA 4F8MA 2R7FA 4CJ1B 4MTNA 3S1QB 1RKNA 1M4VA 3A5ZB 1ESRA 2RSOA 1JE4A 1SYEA 5C0XJ 2QEJC 3CRKC 3HOXG 3PUVA 3OWFA 1L0WA 3GTJH 2BDOA 5CC4A 1GUOA 3HOUG 2ZTCA 4CKBA 2B8GA 1D7QA 4ME3A 3U4VA 4DK6C 1FNWA 2F0KA 1CFMA 1IBMQ 5IYDG 2UU9L 3NBHA 2ZTEA 3I4MH 4JYAQ 3KLWA 4IUUA 4ZUJA 1GKHA 1TWFH 3T4AC 4DUZQ 4GLAC 2PQEA 4HSVA 1PYWD 4BY1H 5GAEC 1EU3A 2XTIA 4OWTB 2UUBL 4JVZA 2MUYA 4DGZA 1TWAH 2A69C 1V1PB 1HNZQ 3CCLA 1LLRD 1Y8NB 2ATWA 5IGFA 2F3VA 2DJGC 2L5TA 3L9AX 4QY7A 1A63A 3F2CA 1C9OA 4A3EG 4DAYA 1YNND 3VA5A 3FKIG 5KNCA 4XIGS 1LTGD 4RKLA 5E4XA 3W5OA 5CR3A 1I4QA 1KHIA 1VQ6A 2K05A 3IL8A 3S2HB 2VB3X 5T1GA 3NSWA 1SROA 5HY6A 4I7AA 4KMUC 1T5XD 2J0TD 4RGNA 3QOJA 3QJYA 3I2ZA 4DR6Q 4IPHA 4OWXB 2BA1A 1JOQA 1O7IA 3PUXA 1HUMA 2KBNA 2XSCA 2VQFL 2BH8A 4I7ZC 4AYBB 1HA5A 3I4NB 4CDEC 4C3JG 2ID0A 4OL7A 4PZ7A 5IODA 2ZXRA 3KLSX 4NW2A 1KAAA 1PH2A 3PO2B 3CU7A 1CQVA 1NUCA 1S5CD 2LS01 5CBEE 3CQZH 1WTHA 1WJJA 3Q0AA 1SNDA 2NVTB 2NB0A 1Q81C 1W6JA 4RCNA 4H13C 3TZDA 1TXYA 2K04A 4DR4Q 4RKBA 1EQVA 2HHHL 4X6AH 1HTPA 1Q46A 4A3GG 3U50C 4WORA 1LV9A 5F2DA 5D14A 4B3RQ 4JK1C 3GTQH 1SRUA 5IWAQ 2Q2UA 2GVBA 4QIWB 5IP7G 2F0SA 4IOAA 1GUSA 1QILA 5L37A 1OO9B 3NTHA 3P75A 1WTQA 1XNRQ 2K14A 1VQBA 2IJ0A 2RDFA 3MA2B 2Z8LA 3FHWA 2JEBI 4B3MQ 1NR4A 1KRSA 2R92G 1XWEA 4BBRH 4NKLA 2EE1A 2OEOA 2B2YC 1HNWL 4JW0A 5I4DA 3TN2A 5H1SE 1PH9A 2G5DA 1MSGA 1SYDA 3UDGA 1R9TH 2E5LQ 2NVYB 3VR5A 1EIGA 2Y0SB 5CGKA 3X3MA 3QB3A 4A3KB 3V2TA 4BY7G 4OONA 1SN8A 2NVXB 4A3FG 1OXXK 2B29A 4P74A 1OXSC 4Q0FA 1STBA 1KRTA 5C3XA 1N32Q 1QZHA 4N9PA 1K8OA 2JA5G 2L15A 4B9WA 4OIJA 4HJ5A 3AFQA 1NMGA 3EJIA 1AZQA 3VR2A 2F03A 1NCVA 1H9MA 2DNEA 4IPCA 4CDDC 4JI0Q 3ULJA 1QB5D 2JA7H 1TWGH 2KENA 2QDBA 2AMCB 3DUZA 4UP7A 1C8CA 2O5JC 1BCPB 1V1OA 1I5FA 1D6EC 2SEBD 4ILWA 1STNA 4K5XA 3TS2A 1F9RA 1D5ZC 1CKNB 4P71A 2B2VA 3GTKB 2JA6G 2CCZA 2Z9HA 2JXMB 2L9HA 2EYMA 3CCQA 4N9TA 1OTCA 4DR5Q 1N36Q 2FMCA 5C0XG 1W6KA 2PO4A 3F8TA 1DGSA 2Q8IB 4RAUC 1VDZA 2IHEA 4JBJA 4LF6L 3UDXA 3SK6A 4RFBA 1N34Q 3H6MA 1A0IA 2PNRC 3KFUA 4L5RC 1LO5D 1U4LA 1C7YA 4A3BH 1I3QH 1S40A 2UU9Q 2VS1A 4XQJA 2JN4A 1Y1VB 3LNNA 5K36G 1ICFB 3G4SA 3CW2C 1CA5A 3PF4A 1TQOA 2CVRA 3TS0A 1YHAA 4JCVE 1B53A 1SNPA 1FVIA 2AQ1B 1BDOA 3NQIA 3P20A 3X3NA 5DM73 3UDIA 1J5EL 3HOYB 2HQEA 5KYLA 4GOPA 3FDTA 1D8LA 2UUBQ 3GTGH 3H3VC 1KDBA 1TY0A 5LHY1 4A93G 4HJ7A 1HTLD 1FNUA 5JVH3 1S72A 4ZAIA 5HURA 3CXCA 1IYVA 1XMOL 2QW7A 1Z9FA 1SNCA 5IYBG 2VZAA 1YIJA 2OXPA 3H0GG 4QUFA 3H15A 2R7ZB 4PMCA 1HPCA 5JEAJ 2KHJA 4LUOA 3ULPA 4G7ZC 3A74A 4XQQA 1U4RA 2NWGA 4NMZA 2B2WC 2E2IH 1VQPA 2WKDA 1JWUD 2EXDA 4IUTA 3K7AH 2C35B 3HOVB 1Q3LA 3QIAA 5KRUA 5K5PA 4DAVA 1PYBA 3S17B 1AP0A 2R93H 1Q7YC 1B2TA 1SNQA 4A75A 2EYLA 1QVFA 2YV5A 5DM63 1K83B 5M3MG 3K8AA 3S1RB 2VQFQ 3KYHC 2DGYA 1VQKA 4LK1C 5A2QE 5IE8A 2WFWA 1PH5A 3HOXB 3BZCA 3LGJA 2C5CA 3I90A 4HCSA 5FKAC 1RD9D 1H9SA 3E9HA 1BQQT 4N8X1 4MN3A 5KEEA 5M5WH 3HOUB 1T5EA 1I50B 1HNXQ 3TP8A 3U58A 3KOJA 4C56C 4DKAC 1WD1A 2LSSA 1WOCA 1IKLA 1K0SA 1K9MC 4X3KA 3FVQA 3MC0B 5I2YA 3HZXA 4C3IG 1VQLA 5LMUQ 1PH1A 4OELB 2HHHQ 4ZKCB 4RH6A 1D2BA 2XRSD 3MXGA 2B2UA 3SDZA 2XNAC 2A1AA 4X64L 4XT3B 3OMGA 4UP8A 1P8LA 1DOLA 1SJHD 2UXCQ 2F4VQ 2BA0A 4LAAA 2EY1A 4XDXA 5KGUA 1A3TA 4OX9Q 1FD7D 3T13A 4LFCQ 3S1QH 2XN9C 1MGSA 2PQAA 1L1OA 1CSPA 4L5TA 4A3EB 1FJGL 3FKIB 2OT2A 1HH2P 3FP9A 2YU9B 1HNWQ 4FXDA 1K73C 3KF6A 1PTOH 1Q8KA 1B1ZA 2XWBB 4DA2A 3HS0C 1DONA 4IZ8A 1SBBB 2RHSB 4M8AA 3HKZG 3M4PA 4R4TA 5ELBA 2E2JH 1LT3D 1F2MA 4JI8L 3M4YA 3GTMH 3S15H 2DY7A 3L7ZC 5A2QL 1JWMD 1A62A 5IT9c 2RA4A 2RF4A 2Z6BA 1SSOA 3MXNB 1YI2A 4DV4L 1EIYB 1Q1BA 1RL2A 1TS4A 1GHJA 4C3JB 1UEAB 3R8BA 1WCMG 4R8NA 3SHLA 5IT9E 5FJ8H 3A55A 5E3FA 3SK5A 2CW0D 3SGIA 5C4XG 2F0HA 1EIHA 4DR1L 3TP5A 2VUMG 2F0IA 4KI0A 5EQ0A 1O80A 3D3RA 3S1MB 4BBSG 1VCIA 2UXDL 4A3GB 1M8AA 1PZID 3GV3A 4ZLTF 5C6AA 4I65A 3MAQA 1WTXA 4R8IA 5CMDA 2RDHA 3ER0A 4DV2L 1AN8A 3VA7A 3DHQA 2Q2IA 2EVBA 2JA8G 3RD4A 3DXJC 1VQMA 4YWMA 1OXTA 4HMJA 1ENCA 5A35A 1HR0W 5T1IA 5E1FA 2MQHA 5COYA 2KHSA 3VR4A 1QUQA 1F2LA 3M4QA 1XMQL 3CCSA 2R92B 4AYBE 4QMGA 3MFGA 3BZKA 1LABA 4JOIA 2AQ2B 1OXVA 4IFDG 4X65Q 1UE1A 2BE5D 3TDQA 4PMBA 1WYDA 4OO1I 1LM0A 4BY7B 3SXHA 3J80i 4A3FB 2QCPX 2LKVA 3HOZH 1O7ZA 2K4KA 2I0QA 2F0TA 5C5LA 5FO9B 2JA5B 2EXZA 1XMOQ 2I5HA 5FLMH 2YYZA 5IT9L 3RZDB 2M00A 2AUKA 2HIXA 4RGTA 1G91A 2LFNA 3H91A 3SE0A 5JEAG 4V0BA 1AZPA 1VQ8A 2DNCA 2WAQG 1CM9A 4C3HG 1QVCA 2NN6G 3S2DB 2AQ3B 3J7A5 4L5SA 1BUVT 1IBLL 2MO1A 2EY2A 4ULLA 1KDAA 2F0UA 2JA6B 3KBXA 3W1GA 4NXML 4ZUIA 2B2WA 2QF7A 1P16A 1A3UA 2V1CC 3R3OA 1E2WA 1CHQD 1CI3M 5IYCH 4GLXA 1PRTF 1ML0D 2A6EC 3LWEA 3PF5A 4C1NK 2K6AA 2BCOA 1VQCA 1QNUA 4FF3A 1WI5A 1XNQL 1QVGA 4K0KL 5CV8A 4GKKQ 1X65A 2H5XA 1CA6A 4PNYA 1G8ZD 2UXBQ 4LF8L 1PXUA 2PI2E 4P2CB 1GUWA 2KOLA 3R2TA 4KKUA 4LW1A 5IGEA 5C4ZA 4YY3L 3CCUA 3KBGA 3VR6A 1JJGA 3T53B 2OTLA 5M5XH 3OWEB 1Y8OB 3NE5B 4A3IG 2EJMA 5CV5A 1NMFA 4A93B 1HQMC 3R2IA 3ZJYC 2O5IC 5C3EG 1CK1A 3K58A 1VQNA 4QQBX 1SNOA 3H0GB 4DU9A 3EVQA 1T9HA 2A6HD 4A3LG 1A8VA 4DV1L 1TWCH 4KHPL 3RR5A 2IL8A 1HZ9A 4NB3A 1Y1VH 4HJ9A 1K8AC 1R4PB 3QR8A 2Q8TA 2EYHA 2HQLA 4JI8Q 2D9UA 1YHBA 1XPUA 3I7FA 3TMEA 1JQYD 3IFDA 1UWVA 4TRDA 4X3UA 5M3MB 3I70A 2J7ZA 3HOYH 4A3DH 4GLVB 4IO9A 5IGBA 1VQ7A 5M5YB 1F77A 1ICWA 2JE6I 4FXKC 3RNUA 4BXXG 3AB9A 4CJ0B 5EPKA 5E7NA 3T16A 1CT1D 1HZAA 4IUNA 2QKIC 5C0XI 3MEFA 4X62Q 1RHPA 3PGZA 1SE8A 4OHJA 3J81j 4JBMA 4C3IB 2KCMA 2MNAA 3E0EA 1CKOA 2ZXPA 5E4WC 3OHXC 1X3GA 1HA6A 4NDXA 4E6IA 3A5UA 1B9NA 2N49A 4LF4L 2OQ0A 2RQXA 5JPNC 4QJFA 1KAWA 3OIPA 3WOFA 4DV2Q 1FNVA 3S1RH 4RHSA 3AEVA 1LTTD 3PSIA 4RG1A 1RIPA 2KJXA 4F7XA 4KD4A 1MKHA 2PCFB 3NTKA 1O78A 1BCPC 1WD0A 1SAPA 4EX5A 3OOCA 3OPOA 3ND9A 1HXYD 3L0OA 3AU7A 3KLSA 4G57A 3I4MG 4UHVA 3HOUH 3M3YB 1NAPA 1I50H 3BJUA 1G6PA 3IAYA 5I9OA 4X66Q 3S1NH 3AQQA 5IYDH 4K6DA 1A2TA 3GTPB 3D4WA 2LMCB 3HKZB 4MZ9A 3BDLA 3H94A 1VQ4A 3UDFA 1EWIA 4ZCKA 4UY8C 1UE5A 4UAIA 3DM1A 4OO1G 1WTPA 1B9MA 2D62A 3EQLC 4X3TA 1LT6D 1EYDA 2MHVA 4OGQC 1NR2A 1EYGA 1TS3A 1HR0Q 1WCMB 1DYQA 4C2MB 3OMCA 1JJCB 2Z6KC 5C4XB 2KUMA 1SYCA 5D3IB 2CWPA 4K5WA 2VUMB 4DV6L 1H9KA 3RN5A 2I5LX 2A5HA 4NXMQ 4BBSB 1L0XB 1IZ6A 1EFID 2EY6A 4F87A 4DFAA 2IX3A 1QE6A 5ELEA 1R4QB 5ISRA 2NUCA 2JK8A 1KL9A 4Y7NB 4G4KA 2CH4A 3D31A 4KLKA 4PG3A 3I8ZA 1IKMA 5C44H 1BF4A 2JA8B 2K52A 4K0KQ 1SYGA 3DWAA 4XQNA 2KA7A 4LF8Q 4H7BA 4QF4A 1GJXA 2M2LA 4OWWB 2K5DA 1HRJA 2MO0A 5JJIA 3V05A 4LF5Q 1KXLA 3PIO3 2F0MA 3H09A 2K1BA 1EZ6A 1EEFD 1YNXA 1IXRA 1D5MC 4HR7B 1PTOF 3PIP3 5C3WA 1KNAA 3H3VH 1X3EA 3U9SA 4DK1A 3GTOB 5C5MA 1TKWB 1D1KA 2MFIA 3T1YL 2MGSA 4Q5VA 1E3PA 4LMQD 1O7YA 2B3GA 2BOSA 2WAQB 4DV1Q 3BVZA 4BBRG 1PYSB 4C3HB 1GUGA 2QDLA 3S14B 4KHPQ 3EA6A 3J80c 2YTYA 4J1MA 3T51B 2UUAQ 5C4JB 4PZ8A 1D1IA 1CSQA 3PO3H 2F0WA 2KHIA 3J80E 4DUYL 1KIXA 2NBFA 5I9PA 1JORA 3UE1A 4F88A 1ENFA 1E2ZA 4DK3C 3T1HL 1Y1WH 4OEMB 2KCCA 2KVMA 2OCEA 1VQOA 1VS0A 5EKKA 4HIDA 1PH7A 2MPMA 1LTBD 3K6OA 2K75A 1EY9A 2KEDA 1MHWC 2JA7G 3DM3A 1SDFA 4RGMA 2FINB 5NUCA 3RZDH 4HJ8A 3D4DA 2RCNA 4V190 5DEHA 1TY2A 3NBIA 2LXJA 3KF8A 2F0NA 1NTGA 1BBXC 4WRDA 4DF7A 1VQAA 3M4OB 4LF4Q 4YCWA 4AIMA 4GOPB 1VQHA 4A3IB 4G7HC 3C3LA 1EOTA 3BDOA 1DOMA 1YVCA 3NTIA 2PI2A 4HEDA 1F2YA 4K6LA 3RLOA 2A74C 4IFDI 1UNSA 1HFNA 2F3IA 2O4XA 4A3BG 1SFOB 3U4ZA 1ILQA 3SR1A 1KLUD 1NNXA 3OSOA 3PUYA 1X6OA 2JJQA 4LF9L 1BXTA 2X6LA 3VYUA 3K59A 2F0VA 2OQKA 1CKMA 3KK7A 1A15A 4L63B 4C1NI 4IFDJ 5EGTA 1KC8C 1A3VA 2N3SA 3J80L 4H44C 3Q23A 3HOWH 3MFYA 1PMRA 1EY8A 4DV3L 1E22A 2NVQB 4CHTB 1STGA 2D0OA 4KN7C 1I6VC 1TWHB 1PFSA 2NN6I 3FRPB 4OXPA 1B7YB 2IHFA 5CV9A 4KY6A 2ZM6L 2F0FA 1RF2D 1YNNC 4LFAL 1OXUA 1WTVA 1Q82C 4DR7L 4BWGB 1PTOD 3GTLB 4YHHL 5IYBH 2K7VA 3PIOA 5DLQE 3K0XA 1EY4A 4A3JH 2L55A 4NXNL 3H0GH 1KLGD 1PV4A 2Z4IA 3U9OA 3PIPA 3S16B 1VQGA 4CKEA 4XTCS 2R93G 1RODA 3E9IA 1EZ8A 1J6QA 5IP9G 2K03A 4H02A 1LUZA 3ERSX 2XRQD 2IX1A 4J15A 1AEXA 2EZVA 3OYYA 3TZUA 3GTJB 5M3MH 1CZGA 3E6ZX 1DOKA 2IW3A 2R3ZA 1UE7A 1L1OB 4DR2L 1ILPA 3L3OC 5GAGC 1Y14B 3I4MB 2K5HA 4DN4M 4HIKA 1KDCA 5C4HA 4EQOA 2HIVA 1XX8A 5FO8B 2IPKD 1HHVA 1YNJD 1PFMA 1SMYD 1TS5A 1FL0A 2I5MX 5JOBA 2ZTDA 3EBEA 4B9XA 4C3IH 2WKCA 1XTCD 1U0LA 3KDFA 1TWAB 2B2TC 3F1ZA 3EN2A 2LXKA 3GV6A 3M9BA 4IUQA 3ICEA 3T1YQ 1GOZA 1EU4A 1VQ5A 2UUCL 5CORA 5LMNL 3Q24A 3WWVA 3J7YW 2ZJRA 2B2YA 1I4XA 3A7LA 4L5QA 1VQFA 2QILA 2VNUD 1RJTA 2AWNA 1NBWA 3CMAA 4DUYQ 4JC0A 2HUGA 2K33A 3STBD 3A7AB 1V8QA 2VXWA 3P7JA 5D3DA 1PVOA 1AFPA 1PH8A 2RVLA 1DJRD 3A8IE 1K28A 1ET9A 4GS3A 3AYHB 5HGTA 3PCOB 5FJ8G 1TU2B 2F0OA 1BBUA 4CDCC 4POFA 1DM0B 4GN3B 1CQFA 3VR3A 4R1JA 3CQZB 1Q1EA 2GVAA 5BN3A 1F9SA 1PZJD 2F52A 4FP5D 4KK7A 4GNXC 2N55A 4JI7L 1G6ZA 2VW9A 3FMCA 3MWYW 2WP8J 4IURA 3S2HH 4QL5A 2EPBA 2PZTA 2R7DA 3ONAB 2Z1CA 5AJ3L 3O13A 1VF7A 4RHRA 4ZKBB 4GZYC 2ALYB 2EYPA 4LF6Q 1N33L 1S5DD 3URYA 4FF2A 4KJNA 3GTQB 2DUDA 2X6GA 2XGTA 2JP1A 5I6YA 2OTJA 1AH9A 3I4NH 3BZDB 3MXNA 2HDMA 2I46A 4ZQ3A 1Y69U 3BVMA 2CH4W 4KN4C 4XYQA 3QWNA 2CHBD 3OW7A 4X3SA 4CBVA 1EL0A 3FEWX 1SYFA 3PO2H 4H0LC 1RDPD 1JOOA 1XPRA 1VQ9A 3N52A 4LF9Q 1VQJA 2E76C 4BBRB 1X3FA 1EY6A 2NVTH 1HUNA 4PMWA 1J5EQ 1NE3A 3NENA 1PDQA 5IGCA 4ODGA 2F0EA 5G3LF 1M90C 4WJ3M 4DV3Q 4TQUS 3S24A 1JOKA 1EYAA 3D8GA 3C46A 1SJED 1TVXA 4JYAL 2C9OA 3V96A 3CC7A 1EUJA 1H9RA 5GQOA 1G2SA 1JR0D 3HOZG 4DUZL 3DEPA 2NZHA 4UP9A 3MZ5A 2A69D 2IT1A 1SEBD 4POGA 3TBIB 4QIWE 2DY8A 4LFAQ 1HNZL 4DR7Q 3GDEA 2JA7B 3NP8A 2H1EA 3GTOH 1TWGB 1EIFA 4YHHQ 2EJGC 3RLNA 1VF5C 2N8NA 1TIID 4NXNQ 1WTRA 4C3HH 2NVYH 2R61A 3DWQA 5JJLA 3TQYA 4A3KH 3R93A 4TKOB 2NVXH 1O7LA 4Z9CB 4K8IA 2Y0SE 1QCBD 3ITPA 4A3MG 1DCZA 1ZYRD 4S3SA 5M3FG 1FYCA 4IUPA 2B63G 3DWPA 1FR3A 2XIWA 2F1MA 1LYLA 4DK0A 4DR2Q 1DD2A 4A3BB 2Q8RE 1U4MA 5FO7B 2KCNA 2A19A 1PZKD 3CCRA 4DR3L 4X64Q 3M7NA 1A6XA 4IOCA 3GTKH 1SE4A 4A3CG 1XXGA 4IUVA 2E2DC 5LL6X 3DLLA 3LWUA 3NUCA 4MNOA 5I6WA 4UPAA 1EOVA 4EVOA 1BBWA 2F0PA 3VYRA 1CHPD 1FJGQ 3TRZA 4ZRZA 5AFWA 4ABNA 1LTLA 1QG7A 3J7ZC 2UUCQ 5LMNQ 1B4OA 2HDLA 2B2TA 4GNXB 1F9QA 1XNRL 5GADC 1RTOA 2IY5B 2F3WA 2N88A 2L11A 2E2IB 2WB1G 4BS9A 3I91A 2RDGA 4DV4Q 2R93B 1HCZA 1YJ9A 2Z4HA 2AHOB 4NP5A 3RN2A 3HOYG 4A3DG 4JG2A 3J81i 5G3LD 1GHKA 2VY3A 2K5VA 3G6JB 2AKWB 3IFTA 4FXGC 1C0AA 1XYIA 5IIFA 1YEZA 4KJOA 2PMZB 1AE3A 3FPPA 5M5WB 4IJHA 1XTDA 2K50A 4DR1Q 2CW0C 4AQYL 1GM5A 3EIVA 2IX0A 1YHQA 1HQRD 2R7ZH 3NBHB 2K32A 2B8FA 3D6CA 2QGQA 3HP3A 1SE2A 3I4OA 1S5ED 2UXDQ 2EY5A 1ZXTA 5JPMC 1VQDA 3HOVH 5AJ3Q 2B2VC 2D5DA 2VQEL 1KQSA 1UE6A 3S17H 4FYDA 1N33Q 1Q12A 2DJFC 2AWOA 5IOCA 1E7ZA 3MHBA 1BNZA 3CC4A 4GKJL 1NJIC 1K83H 2OF1A 2FXQA 4J6HA 1QNKA 3K7UC 3NWTA 4M1UB 4FO2A 2E74C 1CTMA 4DR5L 3HOXH 1N36L 1PRTD 2PYKA 4DAYB 4JI6L 1XMQQ 1ASYA 2HT1A 4XXEA 2A68D 2DN8A 4L8JA 4B3SL 2JSOA 3GQBA 4HIMA 1STHA 2A73B 3I72A 2L0CA 1N34L 4BA2I 3BG3A 1PTOB 2Z0SA 2I07B 4DV0L 4BY1G 2ES2A 2F0LA 1GUNA 4ZK9B 2BE5C 2FHTA 5IGDA 2QEXA 1LTSD 1YJNA 2E2JB 1I6HB 4GOPC 3GTMB 3S15B 1E0BA 1BKBA 4MIUA 5EPJA 3BVGA 1LTRD 1X55A 1LTID 1STAA 3CC2A 3CAMA 4DV5L 2RBMA 4A3EH 1BOSA 4OO1H 2PZWA 3GO5A 3WOEA 2FFKB 3FKIH 2EYFA 1EY5A 1IBLQ 2FJ2A 2K01A 2YU9H 1PH6A 3VYTA 5CV4A 3QOLA 5JJZA 5JAVA 3NQTA 1YJWA 5EKLA 3CPWA 3F2BA 4HJAA 4JI4L 3A54A 3JC66 1C48A 3CMEA 3QG1A 4IQZA 1ZKOA 1I4HA 3JAMi 4WJWA 4A76A 1SE3A 1V1PA 5BR8L 2CQOA 1JB7A 1XNQQ 4LNQA 2F4IA 1STEA 3VYSA 1EYCA 3E3XA 3HGBA 1B50A 5C44G 1VQIA 2PNHA 4C3JH 4UDUC 3HKSA 1XPOA 4JI2L 3PV0A 2RHQB 1ZYRC 3C1EA 1IL2A 4YY3Q 5EAYA 3NWSA 2PPBC 3BU2A 4CKCA 4DR3Q 5J39A 1PFBA 1HNXL 5FOBB 1I4GA 1F2ZA 2KQ3A 1GD7A 1E1OA 3P1HA 3S1MH 1K0RA 2B2UC 3K0YA 1NY4A 4FDBA 4JBKA 1E24A 1JICA 5DAUA 4A3GH 1V1QA 2B39A 1RCVD 5LMUL 4Y52H 1SYBA 1GXDC 1STYA 1TT2A 3BYTB 2TMPA 3HOZB 3BS1A 2D0PA 2O2LD 5IP7H 4QCLA 4XYOA 4U68A 1L1OC 4WFN3 3KUPA 5ELOA 2UXCL 2F4VL 2MP1A 3PMFA 3TSSA 4R9WA 4JV5L 3C1FA 4OX9L 4DNRB 4LFCL 3ULLA 2A6HC 1LT4D 5GROA 2NZ1D 3LX0A 2R92H 4B3TL 5J22A 4FF1A 4A4IA 3CKIB 3G6EA 4P72A 1EQRA 3PO3G 4ID6A 2J4XA 2KECA 1KD1C 2E2HB 1N8RC 4RA8A 3KF8B 5CBAE 2F0GA 3SK4A 1C4QA 4BY7H 2SNMA 2PW7A 4IPDA 4KY5A 4A3FH 1Y1WG 3GD7A 4A3MB 1BO0A 3DMUA 3Q8DA 1ZEQX 4LWCA 2JA5H 1YITA 5M3FB 4G7OC 1EY0A 4YIJA 2B63B 2CFMA 3HRZC 4DNIA 4AQYQ 1PLFA 2FMMA 2D2CC 2KEEA 1II3A 3AFPA 3K5OA 2EJFC 3S2DH 3IRBA 5CV6A 5ELNA 1K3RA 5D65A 3W1BA 1XJVA 4WJ4A 2K28A 2VQEQ 4EQNA 4FNFA 4LFBL 1SLJA 1K8GA 1JB3A 3B6YA 2JYOA 5ELDA 2ASBA 4RWSC 4EQ5A 2JA6H 5M5XB 2K5WA 4GKJQ 1ESFA 5IY0A 2NTSA 4HTHA 5C0XH 2A8VA
chains in the Genus database with same CATH topology
5C3EB 1KABA 4IN3A 5JVG3 2SOBA 1EWCA 3I3CA 1ONLA 1PRTC 3TP7A 2A68C 1EY7A 1TWCB 4K8JA 5K36H 3RZOB 4CJ2C 2PW5A 5TSSA 1J9OA 2WB1B 5EJWA 1H9JA 3K5LA 1TS2A 3NXWA 4O42A 1EQTA 4KV6A 4A3DB 1CZWA 1JC7A 3K5NA 1H9SB 1PFNA 3CRLC 3MVVA 1X3QA 4HMIA 2G9DA 1EWHA 3EFXD 3G7LA 5CYUA 4K2LA 4ME5A 1VMCA 5EPLA 5M9OA 1G291 1X3PA 2PZUA 5DNFA 3J81E 1MD2D 2HCCA 1Q8IA 1EEID 1BCPF 3QO2A 2L4NA 2A6ED 1LTAD 2XVSA 3OIQA 2XWJB 5BN5A 2ENBA 2L12A 1G2TA 2SDFA 1IW7D 2H4OA 2BDNA 3I73A 1MI2A 1J8IA 1SNMA 1TWFB 2IWHA 4MHEA 3SVMA 3FPUB 3S1NB 1QJOA 4BY1B 1MSHA 2MJ8A 2G9HD 5FK9C 1B44D 2WINB 2LY7A 2AUJD 2WIIB 4FVMA 3K57A 3Q22A 1LACA 4DNTB 3E5SA 4DXGA 3I4LA 3MEHA 5IGGA 3EROA 3W3AA 3RUZA 2NTTA 3A8JE 3Q6SA 1WTWA 3MXUA 1I4RA 1IL8A 3J81L 1HFGA 4JBWA 3NK9A 5EKIA 1KTKA 1V43A 4LJZC 3C2PA 1DXMA 5C44B 3A56A 3D4RA 2ICIA 1PRTB 3N6RA 1UUPA 2M9VA 1UAPA 3TP6A 4DXFA 3MTSA 1Z6HA 3ERQA 4IALA 5ELFA 3K5MA 1Z7TA 3JAME 3A8KE 2CQAA 4KHZA 3ZYYX 4PV1C 2ICEC 4B08A 2F0DA 5KNBA 5KYIA 1L0YB 1NSNS 2RSNA 1LT5D 4KTAA 4K5VA 4KKSA 4OIKA 1BCPD 2RKSA 4RGOS 3E0JA 1A2UA 4CGYB 5KNDA 3UI2A 5EBCA 3CHBD 5KIXA 1R9TB 1F9PA 1QWYA 1Q90A 3SEBA 4KKTA 1ET6A 4RCOA 1JCKB 3PO3B 4IFDH 2HCIA 4EQPA 5LL6S 2EOTA 3HG9A 4QUCA 1BR9A 3S9WA 3IKJA 3BDCA 2X69A 1RTNA 3AMUA 1Y1WB 3J7AF 2F0QA 5JEAH 1GUTA 3KLRA 3M7GA 1PTOC 2ZT9C 4K2KA 1U9RA 2NN6H 3NHHA 3JAML 5ELCA 5CV7A 3SK8A 1S5FD 2JEAI 2EYOA 4DAPA 2R6GA 1JWSD 1K8MA 1I4PA 3D6WA 3M85A 2TSSA 4ZYSA 1I3QB 3T56B 3MXPA 4PQXA 2EYJA 1SXTA 2GA4B 1FGBD 2EDGA 1AW7A 1S4ZA 4HAEA 3W2DA 1IW7C 1YNJC 1SMYC 1X32A 1KNEA 4FF4A 3WDNA 5I2XA 3HEJA 4QB4A 3NPPA 4XT1B 3GTGB 3HOWB 4TSSA 3RLFA 4KHVA 5FLXE 2WACA 1Y8PB 3J7AV 2L1BA 4BA1I 3GP7A 1B3AA 2F0JA 3PUWA 2VB2X 3DEOA 5BN4A 2WV6D 3ND8A 3BYYB 4EGVA 4HSPA 4HN7A 3K7AB 2E75C 1ENAA 4A3JB 1WVLA 1TR5A 4KY7A 3PUZA 1IHZA 3RMHA 4L6TB 2ZXOA 5EBDA 1D5XC 1U4PA 1DZ1A 1VMPA 4HCEA 4KD3A 4J8QA 1MBYA 1S5BD 2K5QA 4O1NA 2NYZD 2SNSA 1QOHA 1IYUA 5J1ZA 4K14A 1WTOA 2V4DA 3F2UA 4U673 5FLXL 1Z47A 1E2VA 4F8MA 4CJ1B 3S1QB 1RKNA 1M4VA 1ESRA 2RSOA 1JE4A 1SYEA 5C0XJ 2QEJC 3CRKC 3PUVA 3OWFA 5CC4A 2BDOA 1GUOA 4CKBA 2B8GA 1FNWA 2F0KA 1CFMA 3NBHA 4IUUA 4ZUJA 3T4AC 2PQEA 4HSVA 1PYWD 1EU3A 4DGZA 2MUYA 2A69C 1V1PB 1LLRD 1Y8NB 5IGFA 2F3VA 2L5TA 3L9AX 4DAYA 1YNND 3VA5A 5KNCA 4XIGS 1LTGD 4RKLA 5E4XA 5CR3A 1I4QA 2K05A 3IL8A 3S2HB 2VB3X 5T1GA 3NSWA 4KMUC 1T5XD 2J0TD 4RGNA 3QOJA 3QJYA 2BA1A 1JOQA 3PUXA 1HUMA 2XSCA 4I7ZC 4AYBB 1HA5A 3I4NB 4C3JG 2ID0A 4OL7A 5IODA 2ZXRA 3KLSX 4NW2A 1KAAA 3PO2B 3CU7A 1CQVA 1NUCA 1S5CD 2LS01 5CBEE 3Q0AA 1SNDA 2NVTB 2NB0A 1W6JA 4RCNA 4H13C 3TZDA 2K04A 4RKBA 1EQVA 1HTPA 4WORA 1LV9A 5F2DA 5D14A 4JK1C 4QIWB 2F0SA 1GUSA 1QILA 1OO9B 3NTHA 3P75A 1WTQA 2IJ0A 2RDFA 3MA2B 2Z8LA 2JEBI 1NR4A 1XWEA 4NKLA 2EE1A 2OEOA 2B2YC 5I4DA 3TN2A 1MSGA 1SYDA 3VR5A 2NVYB 1EIGA 2Y0SB 5CGKA 3X3MA 3QB3A 4A3KB 3V2TA 2NVXB 1OXXK 4Q0FA 1OXSC 1STBA 5C3XA 4N9PA 1K8OA 4B9WA 4OIJA 3EJIA 1AZQA 3VR2A 2F03A 1NCVA 1H9MA 2DNEA 1QB5D 2QDBA 3DUZA 1C8CA 2O5JC 1BCPB 1V1OA 1D6EC 2SEBD 4ILWA 1STNA 4K5XA 1F9RA 1D5ZC 2B2VA 3GTKB 2JXMB 2L9HA 2EYMA 4N9TA 2FMCA 5C0XG 1W6KA 2PO4A 2Q8IB 4RAUC 1VDZA 3SK6A 4RFBA 3H6MA 2PNRC 1LO5D 1U4LA 4XQJA 3LNNA 1Y1VB 5K36G 1CA5A 1TQOA 2CVRA 1B53A 1SNPA 2AQ1B 1BDOA 3NQIA 3P20A 3X3NA 5DM73 3HOYB 2HQEA 5KYLA 3FDTA 3H3VC 1KDBA 1TY0A 5LHY1 1HTLD 1FNUA 5JVH3 4ZAIA 5HURA 1IYVA 1SNCA 2OXPA 4QUFA 2R7ZB 4PMCA 1HPCA 5JEAJ 4G7ZC 4XQQA 1U4RA 2NWGA 4NMZA 2B2WC 2WKDA 1JWUD 4IUTA 3HOVB 1Q3LA 3QIAA 5KRUA 5K5PA 4DAVA 3S17B 1AP0A 1B2TA 1SNQA 2EYLA 5DM63 1K83B 3S1RB 4LK1C 5A2QE 3HOXB 2C5CA 3I90A 4HCSA 5FKAC 1RD9D 1H9SA 1BQQT 4MN3A 5KEEA 3HOUB 1T5EA 1I50B 3TP8A 4C56C 1WD1A 1IKLA 4X3KA 3FVQA 3MC0B 5I2YA 3HZXA 4C3IG 4ZKCB 4RH6A 1D2BA 2XRSD 3MXGA 2B2UA 3SDZA 2XNAC 4XT3B 3OMGA 1DOLA 1SJHD 2BA0A 4LAAA 2EY1A 4XDXA 5KGUA 1A3TA 1FD7D 3T13A 2XN9C 1MGSA 4A3EB 3FKIB 2OT2A 2YU9B 4FXDA 1PTOH 1B1ZA 2XWBB 4DA2A 3HS0C 1DONA 4IZ8A 1SBBB 4M8AA 5ELBA 1LT3D 1F2MA 3M4YA 2DY7A 3L7ZC 5A2QL 1JWMD 2RA4A 1SSOA 1Q1BA 1TS4A 4C3JB 1GHJA 1UEAB 3R8BA 4R8NA 3SHLA 5IT9E 3A55A 5E3FA 3SK5A 2CW0D 2F0HA 1EIHA 3TP5A 2F0IA 4KI0A 5EQ0A 1O80A 3D3RA 3S1MB 1VCIA 4A3GB 1M8AA 1PZID 3GV3A 4ZLTF 5C6AA 4I65A 3MAQA 1WTXA 4R8IA 5CMDA 2RDHA 1AN8A 3VA7A 3DHQA 2EVBA 3RD4A 3DXJC 1OXTA 4HMJA 1ENCA 5A35A 5T1IA 5E1FA 5COYA 2KHSA 3VR4A 1F2LA 2R92B 4QMGA 3MFGA 1LABA 2AQ2B 1OXVA 4IFDG 2BE5D 3TDQA 4PMBA 4OO1I 4BY7B 3SXHA 4A3FB 2QCPX 2LKVA 1O7ZA 2F0TA 5C5LA 5FO9B 2JA5B 2EXZA 2YYZA 5IT9L 3RZDB 2M00A 2AUKA 4RGTA 1G91A 2LFNA 3H91A 3SE0A 5JEAG 4V0BA 1AZPA 2DNCA 1CM9A 4C3HG 2NN6G 3S2DB 2AQ3B 1BUVT 2EY2A 4ULLA 1KDAA 2F0UA 2JA6B 3KBXA 4ZUIA 2B2WA 2QF7A 1A3UA 1E2WA 1CHQD 1CI3M 3R3OA 1PRTF 1ML0D 2A6EC 3LWEA 4C1NK 2K6AA 2BCOA 1QNUA 4FF3A 5CV8A 1CA6A 4PNYA 1G8ZD 1PXUA 4P2CB 1GUWA 2KOLA 3R2TA 4KKUA 5IGEA 5C4ZA 3KBGA 3VR6A 3T53B 3OWEB 1Y8OB 3NE5B 2EJMA 5CV5A 4A93B 1HQMC 3R2IA 2O5IC 1CK1A 3K58A 1SNOA 3H0GB 4DU9A 3EVQA 2A6HD 2IL8A 1R4PB 2Q8TA 2EYHA 2D9UA 3TMEA 1JQYD 3IFDA 4TRDA 4X3UA 5M3MB 3I70A 2J7ZA 5IGBA 5M5YB 1F77A 1ICWA 2JE6I 4FXKC 3AB9A 4CJ0B 5EPKA 3T16A 1CT1D 4IUNA 2QKIC 5C0XI 1RHPA 4OHJA 4C3IB 2ZXPA 5E4WC 3OHXC 1HA6A 4NDXA 4E6IA 1B9NA 2RQXA 5JPNC 3OIPA 3WOFA 1FNVA 4RHSA 1LTTD 2KJXA 4F7XA 4KD4A 2PCFB 3NTKA 1O78A 1BCPC 1WD0A 1SAPA 3OOCA 3OPOA 3ND9A 1HXYD 3AU7A 3KLSA 4G57A 3M3YB 1NAPA 3IAYA 5I9OA 4K6DA 1A2TA 3GTPB 3D4WA 2LMCB 3HKZB 3BDLA 3H94A 4UAIA 3DM1A 4OO1G 1WTPA 1B9MA 2D62A 3EQLC 4X3TA 1LT6D 1EYDA 2MHVA 4OGQC 1NR2A 1TS3A 1WCMB 1DYQA 4C2MB 3OMCA 5C4XB 2KUMA 1SYCA 5D3IB 4K5WA 2VUMB 1H9KA 2A5HA 4BBSB 1L0XB 1EFID 2EY6A 4F87A 4DFAA 2IX3A 1QE6A 5ELEA 1R4QB 5ISRA 2NUCA 4Y7NB 4G4KA 3D31A 3I8ZA 1IKMA 1BF4A 2JA8B 1SYGA 3DWAA 4XQNA 2KA7A 4H7BA 4QF4A 1GJXA 2M2LA 2K5DA 1HRJA 3V05A 3PIO3 2F0MA 3H09A 2K1BA 1EZ6A 1EEFD 1D5MC 4HR7B 1PTOF 3PIP3 5C3WA 1KNAA 3U9SA 4DK1A 3GTOB 5C5MA 1TKWB 1D1KA 2MGSA 4Q5VA 4LMQD 1O7YA 2BOSA 2WAQB 3BVZA 4C3HB 1GUGA 3S14B 3EA6A 4J1MA 3T51B 5C4JB 1D1IA 2F0WA 3J80E 2NBFA 5I9PA 1JORA 4F88A 1ENFA 1E2ZA 2KCCA 2KVMA 5EKKA 2MPMA 1LTBD 3K6OA 1EY9A 2KEDA 1SDFA 4RGMA 2FINB 5NUCA 3D4DA 4V190 5DEHA 1TY2A 3NBIA 3KF8A 2F0NA 1BBXC 4WRDA 4DF7A 3M4OB 4A3IB 4G7HC 3C3LA 1EOTA 3BDOA 1DOMA 4HEDA 3NTIA 1F2YA 4K6LA 2A74C 4IFDI 1UNSA 1HFNA 2O4XA 1SFOB 1ILQA 3SR1A 1KLUD 3OSOA 3PUYA 1BXTA 2X6LA 3VYUA 3K59A 2F0VA 3KK7A 4IFDJ 1A15A 4L63B 4C1NI 5EGTA 1A3VA 3J80L 4H44C 3Q23A 3MFYA 1PMRA 1EY8A 2NVQB 4CHTB 1STGA 4KN7C 1I6VC 1TWHB 2NN6I 3FRPB 5CV9A 4KY6A 2F0FA 1RF2D 1YNNC 1OXUA 1WTVA 4BWGB 1PTOD 3GTLB 2K7VA 1EY4A 2L55A 1KLGD 3U9OA 2Z4IA 3S16B 4CKEA 4XTCS 1RODA 1EZ8A 2K03A 2IX1A 2XRQD 1AEXA 2EZVA 3TZUA 3GTJB 1CZGA 3E6ZX 1DOKA 2IW3A 2R3ZA 1ILPA 3L3OC 3I4MB 4DN4M 1KDCA 5C4HA 4EQOA 1XX8A 5FO8B 2IPKD 1HHVA 1YNJD 1PFMA 1SMYD 1TS5A 5JOBA 4B9XA 2WKCA 1XTCD 1TWAB 2B2TC 3GV6A 4IUQA 1GOZA 1EU4A 5CORA 3Q24A 3J7YW 2B2YA 1I4XA 3A7LA 2QILA 2VNUD 1RJTA 2AWNA 2HUGA 2K33A 3A7AB 1V8QA 2VXWA 3P7JA 5D3DA 1AFPA 2RVLA 1DJRD 3A8IE 1ET9A 5HGTA 1TU2B 2F0OA 1DM0B 1CQFA 3VR3A 3CQZB 1Q1EA 5BN3A 1F9SA 1PZJD 4FP5D 4KK7A 2N55A 1G6ZA 3FMCA 3MWYW 2WP8J 4IURA 2EPBA 2PZTA 3ONAB 2Z1CA 3O13A 1VF7A 4RHRA 4ZKBB 4GZYC 2EYPA 1S5DD 3URYA 4FF2A 4KJNA 3GTQB 2X6GA 2JP1A 5I6YA 3BZDB 3MXNA 2HDMA 2I46A 4ZQ3A 1Y69U 3BVMA 4KN4C 4XYQA 3QWNA 2CHBD 3OW7A 4X3SA 4CBVA 1EL0A 3FEWX 1SYFA 4H0LC 1RDPD 1JOOA 3N52A 2E76C 4BBRB 1EY6A 1HUNA 4PMWA 1PDQA 5IGCA 4ODGA 2F0EA 5G3LF 4TQUS 1JOKA 1EYAA 3D8GA 3C46A 1SJED 1TVXA 2C9OA 3V96A 1H9RA 1G2SA 1JR0D 3DEPA 3MZ5A 2A69D 2IT1A 1SEBD 3TBIB 2DY8A 2JA7B 3NP8A 2H1EA 1TWGB 2EJGC 1VF5C 1TIID 1WTRA 2R61A 3DWQA 3R93A 4TKOB 1O7LA 4Z9CB 4K8IA 1QCBD 3ITPA 1DCZA 1ZYRD 4S3SA 1FYCA 4IUPA 3DWPA 1FR3A 2XIWA 2F1MA 4DK0A 1DD2A 4A3BB 2Q8RE 1U4MA 5FO7B 2KCNA 1PZKD 3M7NA 1A6XA 1SE4A 1XXGA 4IUVA 2E2DC 5LL6X 3LWUA 3NUCA 5I6WA 4EVOA 2F0PA 3VYRA 1CHPD 4ZRZA 5AFWA 4ABNA 1QG7A 1B4OA 2HDLA 2B2TA 1F9QA 1RTOA 2F3WA 2N88A 2L11A 2E2IB 4BS9A 3I91A 2RDGA 2R93B 1HCZA 2Z4HA 4NP5A 5G3LD 1GHKA 3G6JB 3IFTA 4FXGC 1XYIA 5IIFA 4KJOA 2PMZB 3FPPA 5M5WB 2CW0C 2IX0A 1HQRD 2K32A 2B8FA 3D6CA 3HP3A 1SE2A 1S5ED 2EY5A 1ZXTA 5JPMC 2B2VC 2D5DA 4FYDA 1Q12A 2AWOA 5IOCA 3MHBA 1BNZA 2OF1A 4J6HA 1QNKA 3NWTA 4M1UB 4FO2A 2E74C 1CTMA 1PRTD 2PYKA 4XXEA 2A68D 2DN8A 4L8JA 2JSOA 3GQBA 1STHA 2A73B 3I72A 2L0CA 4BA2I 3BG3A 1PTOB 2I07B 2F0LA 1GUNA 4ZK9B 2BE5C 2FHTA 5IGDA 1LTSD 2E2JB 1I6HB 3GTMB 3S15B 1E0BA 4MIUA 5EPJA 3BVGA 1LTRD 1LTID 1STAA 2RBMA 1BOSA 4OO1H 2PZWA 3GO5A 3WOEA 2FFKB 2EYFA 1EY5A 2FJ2A 2K01A 3VYTA 5CV4A 3QOLA 5JJZA 5JAVA 3NQTA 5EKLA 3A54A 1C48A 3QG1A 4IQZA 1ZKOA 1I4HA 4WJWA 1SE3A 1V1PA 2F4IA 1STEA 3VYSA 1EYCA 3HGBA 1B50A 4UDUC 3PV0A 1ZYRC 3C1EA 3NWSA 2PPBC 4CKCA 5J39A 1PFBA 5FOBB 1I4GA 1F2ZA 2KQ3A 3P1HA 2B2UC 3K0YA 1JICA 5DAUA 2B39A 1RCVD 1SYBA 1GXDC 1STYA 1TT2A 3BYTB 2TMPA 3HOZB 3BS1A 2O2LD 4QCLA 4XYOA 4U68A 4WFN3 3KUPA 2MP1A 3PMFA 3TSSA 4R9WA 3C1FA 4DNRB 2A6HC 1LT4D 2NZ1D 3LX0A 5J22A 4FF1A 3CKIB 4ID6A 2J4XA 2KECA 2E2HB 4RA8A 5CBAE 2F0GA 3SK4A 1C4QA 2SNMA 2PW7A 4KY5A 3GD7A 4A3MB 1BO0A 3DMUA 1ZEQX 5M3FB 4G7OC 1EY0A 4YIJA 2B63B 3HRZC 1PLFA 2FMMA 2D2CC 2KEEA 1II3A 3K5OA 2EJFC 5CV6A 5D65A 2K28A 4EQNA 4FNFA 1JB3A 2JYOA 5ELDA 4RWSC 5M5XB 2K5WA 1ESFA 2NTSA 4HTHA 5C0XH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQ0 A;  1WD0 A;  1KNA A;  1WTR A;  1O80 A;  1SAP A;  2HUG A;  2KOL A;  1GUW A;  4OIJ A;  2HCI A;  1WVL A;  1AZQ A;  2MGS A;  3HP3 A;  5E4X A;  1NCV A;  3P7J A;  1NAP A;  1O7Y A;  1M8A A;  2EOT A;  2VXW A;  3I3C A;  4LMQ D;  1ZXT A;  2K05 A;  2RVL A;  3GV3 A;  3I90 A;  4QUC A;  4HCS A;  3IL8 A;  3R93 A;  4ZLT F;  2B2V C;  1WTX A;  4R8I A;  2X69 A;  1RTN A;  1C8C A;  1PFB A;  5CMD A;  5T1G A;  4MN3 A;  1WTV A;  1WD1 A;  1BNZ A;  1IKL A;  2B2U C;  4IUP A;  1F9R A;  1QNK A;  4CJ2 C;  4DN4 M;  2XIW A;  1JIC A;  4X3K A;  1J9O A;  2B2V A;  1F9S A;  5EJW A;  3Q6S A;  5COY A;  5T1I A;  1WTW A;  1F2L A;  3DM1 A;  2N55 A;  1HUM A;  2L9H A;  4UAI A;  1WTP A;  1G6Z A;  3MWY W;  4ZKC B;  4IUR A;  2Q8R E;  4X3T A;  1U4M A;  2EPB A;  1ROD A;  1U4P A;  1IL8 A;  3ONA B;  2B2U A;  1NR2 A;  4U68 A;  4O42 A;  1DZ1 A;  1EQT A;  1HFG A;  2KVM A;  1VMP A;  4RAU C;  4NW2 A;  2K03 A;  3KUP A;  4ZKB B;  4XT3 B;  2MPM A;  1DOL A;  2MP1 A;  2NYZ D;  5EKI A;  2IL8 A;  4R9W A;  1PFN A;  2KED A;  5CBE E;  4XDX A;  1X3Q A;  2X6G A;  2KUM A;  1SDF A;  2JP1 A;  2FIN B;  3F2U A;  4IUV A;  2Q8T A;  4ZK9 B;  1WTO A;  1MGS A;  1U4L A;  2NZ1 D;  2FHT A;  1DOK A;  1O7Z A;  2D9U A;  2R3Z A;  3D6W A;  2HDM A;  3TZD A;  3G7L A;  2K04 A;  3IFD A;  1ILP A;  4X3U A;  2KEC A;  4CJ1 B;  1CA5 A;  4X3S A;  2J7Z A;  1EL0 A;  2CVR A;  1E0B A;  4RA8 A;  1ESR A;  5EPJ A;  1G91 A;  1LV9 A;  1VMC A;  2RSO A;  1JE4 A;  1B53 A;  1QE6 A;  3H91 A;  5AFW A;  5D14 A;  3N52 A;  1QG7 A;  5EPL A;  5CBA E;  1AZP A;  1BBX C;  1XX8 A;  1CM9 A;  1X3P A;  1B4O A;  2HDL A;  1HHV A;  1ICW A;  2B2T A;  1PFM A;  1HUN A;  5DNF A;  4CJ0 B;  5EPK A;  1DON A;  3MTS A;  1S4Z A;  4HAE A;  3I8Z A;  1PDQ A;  3FDT A;  1IKM A;  1BO0 A;  1BF4 A;  1F9Q A;  1EOT A;  2HCC A;  1WTQ A;  3QO2 A;  1DOM A;  1RTO A;  2FFK B;  2N88 A;  2L4N A;  4HED A;  1RHP A;  4ZAI A;  2L11 A;  2FJ2 A;  2K01 A;  1X32 A;  2DY7 A;  1TVX A;  1KNE A;  3KBX A;  2B2T C;  1PLF A;  1HFN A;  2RA4 A;  4XT1 B;  1SSO A;  1G2S A;  3I91 A;  1NR4 A;  5JJZ A;  2B2W A;  4IUU A;  2FMM A;  2M2L A;  3GV6 A;  4IUQ A;  3DEP A;  2L12 A;  2EE1 A;  2KEE A;  2B2Y C;  5E4W C;  4QUF A;  1ILQ A;  1ML0 D;  1HA6 A;  5COR A;  3TN2 A;  1G2T A;  2SDF A;  1HRJ A;  2L1B A;  2X6L A;  2RSN A;  1MSG A;  5D65 A;  3LWE A;  4HSV A;  2K28 A;  4OIK A;  1J8I A;  1B3A A;  1A15 A;  1MI2 A;  1EIG A;  2BDN A;  2DY8 A;  1U4R A;  2JYO A;  2NWG A;  4MHE A;  2B2W C;  3SVM A;  3DEO A;  4IUT A;  3FPU B;  4RWS C;  1Q3L A;  1XYI A;  2H1E A;  2B2Y A;  2K1B A;  3UI2 A;  1EIH A;  1MSH A;  1CA6 A;  1RJT A;  1F9P A;  2MJ8 A;  1AP0 A;  1B50 A;  1B2T A; 
#chains in the Genus database with same CATH topology
 1I94 L;  5C3E B;  1KAB A;  1S3O A;  2K5N A;  4IN3 A;  4JI6 Q;  5JVG 3;  2SOB A;  4HIO A;  1EWC A;  3I3C A;  4B3S Q;  1ONL A;  1PRT C;  4JI3 L;  3TP7 A;  4YWL A;  2P5Z X;  2A68 C;  1EY7 A;  1TWC B;  4JOI C;  2Q2H A;  4K8J A;  4DV0 Q;  5K36 H;  3RZO B;  1CKN A;  1N9W A;  4CJ2 C;  2PW5 A;  5HGQ A;  1YZ6 A;  5TSS A;  1J9O A;  2WB1 B;  3HOW G;  5EJW A;  1H9J A;  3K5L A;  2EIF A;  1TS2 A;  3NXW A;  4X65 L;  4O42 A;  1HJP A;  1EQT A;  4KV6 A;  3VDY A;  1CZW A;  1GO3 E;  4A3D B;  4A93 H;  1JC7 A;  3K5N A;  1H9S B;  1PFN A;  3G71 A;  3CRL C;  3MVV A;  4DV5 Q;  1X3Q A;  4HMI A;  4MTK A;  1SMX A;  2G9D A;  1EWH A;  3EFX D;  3G7L A;  5CYU A;  4DV6 Q;  1EQQ A;  1IYJ B;  4K2L A;  2Z6K A;  4ME5 A;  4A3J G;  2GN5 A;  3J81 c;  1EFW A;  4YCU A;  1VMC A;  5EPL A;  5M9O A;  1G29 1;  4JI4 Q;  1X3P A;  2PZU A;  3KJP A;  5DNF A;  2EQS A;  4DV7 L;  3J81 E;  3CCJ A;  4JI5 L;  1MD2 D;  1Q86 C;  2HCC A;  5BR8 Q;  1Q8I A;  1EEI D;  1FGU A;  1BCP F;  2YTV A;  3QO2 A;  2L4N A;  2A6E D;  1LTA D;  2XVS A;  3KDF B;  5LMN W;  2PQA B;  3OIQ A;  2XWJ B;  3NEL A;  5IP9 H;  5BN5 A;  5M5Y H;  4JI2 Q;  2ENB A;  2ZJP A;  2L12 A;  1MJC A;  4GN5 A;  4R4O A;  1G2T A;  3I55 A;  2SDF A;  4APV A;  1IW7 D;  3KF6 B;  2H4O A;  2BDN A;  3I73 A;  1MI2 A;  4R4I A;  5J3B A;  1J8I A;  1SNM A;  1TWF B;  2IWH A;  1H95 A;  4MHE A;  3TEH B;  3SVM A;  4GKK L;  3FPU B;  3S1N B;  1QJO A;  4BY1 B;  1MSH A;  2UXB L;  4LF7 L;  2PMZ E;  2MJ8 A;  3CP0 A;  2G9H D;  5FK9 C;  1B44 D;  2WIN B;  2LY7 A;  3CF5 A;  1U5K A;  2AUJ D;  2WII B;  1JMC A;  4FVM A;  3K57 A;  3Q22 A;  1V9P A;  1LAC A;  4DNT B;  3E5S A;  3NEM A;  3L2P A;  4JV5 Q;  4DXG A;  3CCV A;  3I4L A;  3K80 C;  3MEH A;  5IGG A;  4N8F A;  3ERO A;  3W3A A;  3RUZ A;  2NTT A;  3A8J E;  4B3T Q;  5JJK A;  3M3Y H;  2E8G A;  3Q6S A;  1WTW A;  4PZ6 A;  3KJO A;  3MXU A;  4O0A A;  1I4R A;  1IL8 A;  3J81 L;  3CPF A;  3G48 A;  4P73 A;  3GTP H;  1HFG A;  4JPB W;  3T1H Q;  4JBW A;  3NK9 A;  1ASZ A;  5EKI A;  2OWO A;  4JI1 L;  2Q2T A;  1KTK A;  1I6H H;  1L2F A;  3HKZ E;  2NZO A;  1V43 A;  4LJZ C;  3C2P A;  1DXM A;  5C44 B;  1JE5 A;  4O2D A;  3A56 A;  3D4R A;  2ICI A;  1PRT B;  1B8A A;  1WCM H;  1QUQ B;  3N6R A;  1UUP A;  1JT8 A;  1K3B C;  4C2M H;  4YCV A;  3OTO L;  1IBK L;  3JAM c;  2M9V A;  3F2D A;  5C4X H;  4YWK A;  1UAP A;  3TP6 A;  4DXF A;  3MTS A;  1Z6H A;  3ERQ A;  4IAL A;  4LFB Q;  5ELF A;  3K5M A;  2VUM H;  1W2B A;  1Z7T A;  3JAM E;  3A8K E;  1JJ2 A;  4QGU A;  4X62 L;  2BH2 A;  4BBS H;  2CQA A;  4KHZ A;  3ZYY X;  4NPS A;  4PV1 C;  2ICE C;  1I94 Q;  4B08 A;  2F0D A;  5KNB A;  4LUV A;  4AYB G;  5KYI A;  3OW2 A;  1YBY A;  3I4N G;  4Y7N H;  1L0Y B;  1B70 B;  1X54 A;  1NSN S;  2RSN A;  3CCM A;  1LT5 D;  4KTA A;  4K5V A;  4KKS A;  2JA8 H;  4OIK A;  3PO2 G;  4JI3 Q;  1BCP D;  2RKS A;  3PQI A;  4RGO S;  3E0J A;  1A2U A;  4CGY B;  5KND A;  1CUK A;  3UI2 A;  5EBC A;  3CHB D;  5KIX A;  1PHJ A;  1IBM L;  1R9T B;  2JQO A;  1F9P A;  1QWY A;  1Q90 A;  3SEB A;  4KKT A;  1ET6 A;  4RCO A;  1JCK B;  3PO3 B;  4IFD H;  2HCI A;  4R4Q A;  4EQP A;  5LL6 S;  4X66 L;  2EOT A;  3HG9 A;  4QUC A;  4RMF A;  1BR9 A;  3S9W A;  2VL6 A;  5FLM G;  3IKJ A;  3BDC A;  2X69 A;  1RTN A;  2ZM6 Q;  3UE0 A;  3AMU A;  4TVA B;  1Y1W B;  3J7A F;  1UEB A;  2F0Q A;  1AE2 A;  5JEA H;  2ZJQ A;  1GUT A;  3KLR A;  3M7G A;  2YTX A;  1PTO C;  2RCF A;  2ZT9 C;  4IPG A;  4K2K A;  1U9R A;  2NN6 H;  3S14 H;  3NHH A;  1HR0 L;  3D0F A;  5C4J H;  3JAM L;  1QZG A;  2WAQ E;  2Y0S G;  5ELC A;  5IYC G;  2CWA A;  5CV7 A;  3SK8 A;  4DV7 Q;  1S5F D;  4A3K G;  2JEA I;  4JI5 Q;  2EYO A;  4LUZ A;  4DAP A;  2R6G A;  2E2H H;  4DR6 L;  1JWS D;  1K8M A;  1X9N A;  1I4P A;  3D6W A;  3M85 A;  4IJL A;  1B3Q A;  2TSS A;  1E1T A;  4ZYS A;  1I3Q B;  3T56 B;  3MXP A;  1PH3 A;  4PQX A;  2EYJ A;  4A3M H;  1SXT A;  2GA4 B;  1BVS A;  3CCE A;  4DPG A;  5M3F H;  1PH4 A;  1FGB D;  2EDG A;  1AW7 A;  2B63 H;  1S4Z A;  4HAE A;  1PA6 A;  3W2D A;  2JA9 A;  3TRE A;  2HD3 A;  1IW7 C;  5FLX c;  4LF7 Q;  3H3V I;  1YNJ C;  1SMY C;  1X32 A;  2KCT A;  1KNE A;  4FF4 A;  4DR4 L;  3WDN A;  5I2X A;  3HEJ A;  4QB4 A;  3NPP A;  4XT1 B;  3GTG B;  3HOW B;  4TSS A;  1MIU A;  3RLF A;  1W3S A;  4KHV A;  3M4O H;  5FLX E;  2WAC A;  4B3R L;  4LF5 L;  1Y8P B;  3J7A V;  2L1B A;  5IWA L;  4A3I H;  4BA1 I;  3GP7 A;  2QA4 A;  4A3C H;  1B3A A;  2F0J A;  3A0J A;  3PUW A;  3HFZ B;  2VB2 X;  4GN4 B;  3DEO A;  5C3E H;  5BN4 A;  2WV6 D;  1VQE A;  3ND8 A;  3BYY B;  4R4C A;  4EGV A;  1SFO H;  4HSP A;  4HN7 A;  1Y1V G;  3K7A B;  4B3M L;  2N78 A;  4A3L H;  2E75 C;  1ENA A;  4A3J B;  1WVL A;  1MJE A;  1TR5 A;  1M1K C;  4KY7 A;  3CD6 A;  1G51 A;  2E5L L;  3RZO H;  3STB C;  2UUA L;  5GAH C;  3PUZ A;  2CKZ B;  4ALP A;  2NVQ H;  1IHZ A;  4JI1 Q;  3RMH A;  1WFQ A;  4AH6 A;  4L6T B;  1TWH H;  1N32 L;  2WB1 E;  2ZXO A;  4CDF C;  5EBD A;  4JI7 Q;  1D5X C;  2R7Z G;  4BXX H;  1U4P A;  1X56 A;  4JI0 L;  3OTO Q;  1IBK Q;  3K81 C;  1DZ1 A;  1VMP A;  4HCE A;  4KD3 A;  4J8Q A;  1MBY A;  1HZB A;  3GTL H;  1S5B D;  2K5Q A;  4O1N A;  4P75 A;  2NYZ D;  4GNX A;  1HZC A;  2SNS A;  1SR3 A;  1GVP A;  3HOV G;  1QOH A;  3I56 A;  1IYU A;  5J1Z A;  4K14 A;  1WTO A;  2V4D A;  3F2U A;  3S16 H;  4U67 3;  5FLX L;  4DAM A;  1Z47 A;  1E2V A;  4F8M A;  2R7F A;  4CJ1 B;  4MTN A;  3S1Q B;  1RKN A;  1M4V A;  3A5Z B;  1ESR A;  2RSO A;  1JE4 A;  1SYE A;  5C0X J;  2QEJ C;  3CRK C;  3HOX G;  3PUV A;  3OWF A;  1L0W A;  3GTJ H;  2BDO A;  5CC4 A;  1GUO A;  3HOU G;  2ZTC A;  4CKB A;  2B8G A;  1D7Q A;  4ME3 A;  3U4V A;  4DK6 C;  1FNW A;  2F0K A;  1CFM A;  1IBM Q;  5IYD G;  2UU9 L;  3NBH A;  2ZTE A;  3I4M H;  4JYA Q;  3KLW A;  4IUU A;  4ZUJ A;  1GKH A;  1TWF H;  3T4A C;  4DUZ Q;  4GLA C;  2PQE A;  4HSV A;  1PYW D;  4BY1 H;  5GAE C;  1EU3 A;  2XTI A;  4OWT B;  2UUB L;  4JVZ A;  2MUY A;  4DGZ A;  1TWA H;  2A69 C;  1V1P B;  1HNZ Q;  3CCL A;  1LLR D;  1Y8N B;  2ATW A;  5IGF A;  2F3V A;  2DJG C;  2L5T A;  3L9A X;  4QY7 A;  1A63 A;  3F2C A;  1C9O A;  4A3E G;  4DAY A;  1YNN D;  3VA5 A;  3FKI G;  5KNC A;  4XIG S;  1LTG D;  4RKL A;  5E4X A;  3W5O A;  5CR3 A;  1I4Q A;  1KHI A;  1VQ6 A;  2K05 A;  3IL8 A;  3S2H B;  2VB3 X;  5T1G A;  3NSW A;  1SRO A;  5HY6 A;  4I7A A;  4KMU C;  1T5X D;  2J0T D;  4RGN A;  3QOJ A;  3QJY A;  3I2Z A;  4DR6 Q;  4IPH A;  4OWX B;  2BA1 A;  1JOQ A;  1O7I A;  3PUX A;  1HUM A;  2KBN A;  2XSC A;  2VQF L;  2BH8 A;  4I7Z C;  4AYB B;  1HA5 A;  3I4N B;  4CDE C;  4C3J G;  2ID0 A;  4OL7 A;  4PZ7 A;  5IOD A;  2ZXR A;  3KLS X;  4NW2 A;  1KAA A;  1PH2 A;  3PO2 B;  3CU7 A;  1CQV A;  1NUC A;  1S5C D;  2LS0 1;  5CBE E;  3CQZ H;  1WTH A;  1WJJ A;  3Q0A A;  1SND A;  2NVT B;  2NB0 A;  1Q81 C;  1W6J A;  4RCN A;  4H13 C;  3TZD A;  1TXY A;  2K04 A;  4DR4 Q;  4RKB A;  1EQV A;  2HHH L;  4X6A H;  1HTP A;  1Q46 A;  4A3G G;  3U50 C;  4WOR A;  1LV9 A;  5F2D A;  5D14 A;  4B3R Q;  4JK1 C;  3GTQ H;  1SRU A;  5IWA Q;  2Q2U A;  2GVB A;  4QIW B;  5IP7 G;  2F0S A;  4IOA A;  1GUS A;  1QIL A;  5L37 A;  1OO9 B;  3NTH A;  3P75 A;  1WTQ A;  1XNR Q;  2K14 A;  1VQB A;  2IJ0 A;  2RDF A;  3MA2 B;  2Z8L A;  3FHW A;  2JEB I;  4B3M Q;  1NR4 A;  1KRS A;  2R92 G;  1XWE A;  4BBR H;  4NKL A;  2EE1 A;  2OEO A;  2B2Y C;  1HNW L;  4JW0 A;  5I4D A;  3TN2 A;  5H1S E;  1PH9 A;  2G5D A;  1MSG A;  1SYD A;  3UDG A;  1R9T H;  2E5L Q;  2NVY B;  3VR5 A;  1EIG A;  2Y0S B;  5CGK A;  3X3M A;  3QB3 A;  4A3K B;  3V2T A;  4BY7 G;  4OON A;  1SN8 A;  2NVX B;  4A3F G;  1OXX K;  2B29 A;  4P74 A;  1OXS C;  4Q0F A;  1STB A;  1KRT A;  5C3X A;  1N32 Q;  1QZH A;  4N9P A;  1K8O A;  2JA5 G;  2L15 A;  4B9W A;  4OIJ A;  4HJ5 A;  3AFQ A;  1NMG A;  3EJI A;  1AZQ A;  3VR2 A;  2F03 A;  1NCV A;  1H9M A;  2DNE A;  4IPC A;  4CDD C;  4JI0 Q;  3ULJ A;  1QB5 D;  2JA7 H;  1TWG H;  2KEN A;  2QDB A;  2AMC B;  3DUZ A;  4UP7 A;  1C8C A;  2O5J C;  1BCP B;  1V1O A;  1I5F A;  1D6E C;  2SEB D;  4ILW A;  1STN A;  4K5X A;  3TS2 A;  1F9R A;  1D5Z C;  1CKN B;  4P71 A;  2B2V A;  3GTK B;  2JA6 G;  2CCZ A;  2Z9H A;  2JXM B;  2L9H A;  2EYM A;  3CCQ A;  4N9T A;  1OTC A;  4DR5 Q;  1N36 Q;  2FMC A;  5C0X G;  1W6K A;  2PO4 A;  3F8T A;  1DGS A;  2Q8I B;  4RAU C;  1VDZ A;  2IHE A;  4JBJ A;  4LF6 L;  3UDX A;  3SK6 A;  4RFB A;  1N34 Q;  3H6M A;  1A0I A;  2PNR C;  3KFU A;  4L5R C;  1LO5 D;  1U4L A;  1C7Y A;  4A3B H;  1I3Q H;  1S40 A;  2UU9 Q;  2VS1 A;  4XQJ A;  2JN4 A;  1Y1V B;  3LNN A;  5K36 G;  1ICF B;  3G4S A;  3CW2 C;  1CA5 A;  3PF4 A;  1TQO A;  2CVR A;  3TS0 A;  1YHA A;  4JCV E;  1B53 A;  1SNP A;  1FVI A;  2AQ1 B;  1BDO A;  3NQI A;  3P20 A;  3X3N A;  5DM7 3;  3UDI A;  1J5E L;  3HOY B;  2HQE A;  5KYL A;  4GOP A;  3FDT A;  1D8L A;  2UUB Q;  3GTG H;  3H3V C;  1KDB A;  1TY0 A;  5LHY 1;  4A93 G;  4HJ7 A;  1HTL D;  1FNU A;  5JVH 3;  1S72 A;  4ZAI A;  5HUR A;  3CXC A;  1IYV A;  1XMO L;  2QW7 A;  1Z9F A;  1SNC A;  5IYB G;  2VZA A;  1YIJ A;  2OXP A;  3H0G G;  4QUF A;  3H15 A;  2R7Z B;  4PMC A;  1HPC A;  5JEA J;  2KHJ A;  4LUO A;  3ULP A;  4G7Z C;  3A74 A;  4XQQ A;  1U4R A;  2NWG A;  4NMZ A;  2B2W C;  2E2I H;  1VQP A;  2WKD A;  1JWU D;  2EXD A;  4IUT A;  3K7A H;  2C35 B;  3HOV B;  1Q3L A;  3QIA A;  5KRU A;  5K5P A;  4DAV A;  1PYB A;  3S17 B;  1AP0 A;  2R93 H;  1Q7Y C;  1B2T A;  1SNQ A;  4A75 A;  2EYL A;  1QVF A;  2YV5 A;  5DM6 3;  1K83 B;  5M3M G;  3K8A A;  3S1R B;  2VQF Q;  3KYH C;  2DGY A;  1VQK A;  4LK1 C;  5A2Q E;  5IE8 A;  2WFW A;  1PH5 A;  3HOX B;  3BZC A;  3LGJ A;  2C5C A;  3I90 A;  4HCS A;  5FKA C;  1RD9 D;  1H9S A;  3E9H A;  1BQQ T;  4N8X 1;  4MN3 A;  5KEE A;  5M5W H;  3HOU B;  1T5E A;  1I50 B;  1HNX Q;  3TP8 A;  3U58 A;  3KOJ A;  4C56 C;  4DKA C;  1WD1 A;  2LSS A;  1WOC A;  1IKL A;  1K0S A;  1K9M C;  4X3K A;  3FVQ A;  3MC0 B;  5I2Y A;  3HZX A;  4C3I G;  1VQL A;  5LMU Q;  1PH1 A;  4OEL B;  2HHH Q;  4ZKC B;  4RH6 A;  1D2B A;  2XRS D;  3MXG A;  2B2U A;  3SDZ A;  2XNA C;  2A1A A;  4X64 L;  4XT3 B;  3OMG A;  4UP8 A;  1P8L A;  1DOL A;  1SJH D;  2UXC Q;  2F4V Q;  2BA0 A;  4LAA A;  2EY1 A;  4XDX A;  5KGU A;  1A3T A;  4OX9 Q;  1FD7 D;  3T13 A;  4LFC Q;  3S1Q H;  2XN9 C;  1MGS A;  2PQA A;  1L1O A;  1CSP A;  4L5T A;  4A3E B;  1FJG L;  3FKI B;  2OT2 A;  1HH2 P;  3FP9 A;  2YU9 B;  1HNW Q;  4FXD A;  1K73 C;  3KF6 A;  1PTO H;  1Q8K A;  1B1Z A;  2XWB B;  4DA2 A;  3HS0 C;  1DON A;  4IZ8 A;  1SBB B;  2RHS B;  4M8A A;  3HKZ G;  3M4P A;  4R4T A;  5ELB A;  2E2J H;  1LT3 D;  1F2M A;  4JI8 L;  3M4Y A;  3GTM H;  3S15 H;  2DY7 A;  3L7Z C;  5A2Q L;  1JWM D;  1A62 A;  5IT9 c;  2RA4 A;  2RF4 A;  2Z6B A;  1SSO A;  3MXN B;  1YI2 A;  4DV4 L;  1EIY B;  1Q1B A;  1RL2 A;  1TS4 A;  1GHJ A;  4C3J B;  1UEA B;  3R8B A;  1WCM G;  4R8N A;  3SHL A;  5IT9 E;  5FJ8 H;  3A55 A;  5E3F A;  3SK5 A;  2CW0 D;  3SGI A;  5C4X G;  2F0H A;  1EIH A;  4DR1 L;  3TP5 A;  2VUM G;  2F0I A;  4KI0 A;  5EQ0 A;  1O80 A;  3D3R A;  3S1M B;  4BBS G;  1VCI A;  2UXD L;  4A3G B;  1M8A A;  1PZI D;  3GV3 A;  4ZLT F;  5C6A A;  4I65 A;  3MAQ A;  1WTX A;  4R8I A;  5CMD A;  2RDH A;  3ER0 A;  4DV2 L;  1AN8 A;  3VA7 A;  3DHQ A;  2Q2I A;  2EVB A;  2JA8 G;  3RD4 A;  3DXJ C;  1VQM A;  4YWM A;  1OXT A;  4HMJ A;  1ENC A;  5A35 A;  1HR0 W;  5T1I A;  5E1F A;  2MQH A;  5COY A;  2KHS A;  3VR4 A;  1QUQ A;  1F2L A;  3M4Q A;  1XMQ L;  3CCS A;  2R92 B;  4AYB E;  4QMG A;  3MFG A;  3BZK A;  1LAB A;  4JOI A;  2AQ2 B;  1OXV A;  4IFD G;  4X65 Q;  1UE1 A;  2BE5 D;  3TDQ A;  4PMB A;  1WYD A;  4OO1 I;  1LM0 A;  4BY7 B;  3SXH A;  3J80 i;  4A3F B;  2QCP X;  2LKV A;  3HOZ H;  1O7Z A;  2K4K A;  2I0Q A;  2F0T A;  5C5L A;  5FO9 B;  2JA5 B;  2EXZ A;  1XMO Q;  2I5H A;  5FLM H;  2YYZ A;  5IT9 L;  3RZD B;  2M00 A;  2AUK A;  2HIX A;  4RGT A;  1G91 A;  2LFN A;  3H91 A;  3SE0 A;  5JEA G;  4V0B A;  1AZP A;  1VQ8 A;  2DNC A;  2WAQ G;  1CM9 A;  4C3H G;  1QVC A;  2NN6 G;  3S2D B;  2AQ3 B;  3J7A 5;  4L5S A;  1BUV T;  1IBL L;  2MO1 A;  2EY2 A;  4ULL A;  1KDA A;  2F0U A;  2JA6 B;  3KBX A;  3W1G A;  4NXM L;  4ZUI A;  2B2W A;  2QF7 A;  1P16 A;  1A3U A;  2V1C C;  3R3O A;  1E2W A;  1CHQ D;  1CI3 M;  5IYC H;  4GLX A;  1PRT F;  1ML0 D;  2A6E C;  3LWE A;  3PF5 A;  4C1N K;  2K6A A;  2BCO A;  1VQC A;  1QNU A;  4FF3 A;  1WI5 A;  1XNQ L;  1QVG A;  4K0K L;  5CV8 A;  4GKK Q;  1X65 A;  2H5X A;  1CA6 A;  4PNY A;  1G8Z D;  2UXB Q;  4LF8 L;  1PXU A;  2PI2 E;  4P2C B;  1GUW A;  2KOL A;  3R2T A;  4KKU A;  4LW1 A;  5IGE A;  5C4Z A;  4YY3 L;  3CCU A;  3KBG A;  3VR6 A;  1JJG A;  3T53 B;  2OTL A;  5M5X H;  3OWE B;  1Y8O B;  3NE5 B;  4A3I G;  2EJM A;  5CV5 A;  1NMF A;  4A93 B;  1HQM C;  3R2I A;  3ZJY C;  2O5I C;  5C3E G;  1CK1 A;  3K58 A;  1VQN A;  4QQB X;  1SNO A;  3H0G B;  4DU9 A;  3EVQ A;  1T9H A;  2A6H D;  4A3L G;  1A8V A;  4DV1 L;  1TWC H;  4KHP L;  3RR5 A;  2IL8 A;  1HZ9 A;  4NB3 A;  1Y1V H;  4HJ9 A;  1K8A C;  1R4P B;  3QR8 A;  2Q8T A;  2EYH A;  2HQL A;  4JI8 Q;  2D9U A;  1YHB A;  1XPU A;  3I7F A;  3TME A;  1JQY D;  3IFD A;  1UWV A;  4TRD A;  4X3U A;  5M3M B;  3I70 A;  2J7Z A;  3HOY H;  4A3D H;  4GLV B;  4IO9 A;  5IGB A;  1VQ7 A;  5M5Y B;  1F77 A;  1ICW A;  2JE6 I;  4FXK C;  3RNU A;  4BXX G;  3AB9 A;  4CJ0 B;  5EPK A;  5E7N A;  3T16 A;  1CT1 D;  1HZA A;  4IUN A;  2QKI C;  5C0X I;  3MEF A;  4X62 Q;  1RHP A;  3PGZ A;  1SE8 A;  4OHJ A;  3J81 j;  4JBM A;  4C3I B;  2KCM A;  2MNA A;  3E0E A;  1CKO A;  2ZXP A;  5E4W C;  3OHX C;  1X3G A;  1HA6 A;  4NDX A;  4E6I A;  3A5U A;  1B9N A;  2N49 A;  4LF4 L;  2OQ0 A;  2RQX A;  5JPN C;  4QJF A;  1KAW A;  3OIP A;  3WOF A;  4DV2 Q;  1FNV A;  3S1R H;  4RHS A;  3AEV A;  1LTT D;  3PSI A;  4RG1 A;  1RIP A;  2KJX A;  4F7X A;  4KD4 A;  1MKH A;  2PCF B;  3NTK A;  1O78 A;  1BCP C;  1WD0 A;  1SAP A;  4EX5 A;  3OOC A;  3OPO A;  3ND9 A;  1HXY D;  3L0O A;  3AU7 A;  3KLS A;  4G57 A;  3I4M G;  4UHV A;  3HOU H;  3M3Y B;  1NAP A;  1I50 H;  3BJU A;  1G6P A;  3IAY A;  5I9O A;  4X66 Q;  3S1N H;  3AQQ A;  5IYD H;  4K6D A;  1A2T A;  3GTP B;  3D4W A;  2LMC B;  3HKZ B;  4MZ9 A;  3BDL A;  3H94 A;  1VQ4 A;  3UDF A;  1EWI A;  4ZCK A;  4UY8 C;  1UE5 A;  4UAI A;  3DM1 A;  4OO1 G;  1WTP A;  1B9M A;  2D62 A;  3EQL C;  4X3T A;  1LT6 D;  1EYD A;  2MHV A;  4OGQ C;  1NR2 A;  1EYG A;  1TS3 A;  1HR0 Q;  1WCM B;  1DYQ A;  4C2M B;  3OMC A;  1JJC B;  2Z6K C;  5C4X B;  2KUM A;  1SYC A;  5D3I B;  2CWP A;  4K5W A;  2VUM B;  4DV6 L;  1H9K A;  3RN5 A;  2I5L X;  2A5H A;  4NXM Q;  4BBS B;  1L0X B;  1IZ6 A;  1EFI D;  2EY6 A;  4F87 A;  4DFA A;  2IX3 A;  1QE6 A;  5ELE A;  1R4Q B;  5ISR A;  2NUC A;  2JK8 A;  1KL9 A;  4Y7N B;  4G4K A;  2CH4 A;  3D31 A;  4KLK A;  4PG3 A;  3I8Z A;  1IKM A;  5C44 H;  1BF4 A;  2JA8 B;  2K52 A;  4K0K Q;  1SYG A;  3DWA A;  4XQN A;  2KA7 A;  4LF8 Q;  4H7B A;  4QF4 A;  1GJX A;  2M2L A;  4OWW B;  2K5D A;  1HRJ A;  2MO0 A;  5JJI A;  3V05 A;  4LF5 Q;  1KXL A;  3PIO 3;  2F0M A;  3H09 A;  2K1B A;  1EZ6 A;  1EEF D;  1YNX A;  1IXR A;  1D5M C;  4HR7 B;  1PTO F;  3PIP 3;  5C3W A;  1KNA A;  3H3V H;  1X3E A;  3U9S A;  4DK1 A;  3GTO B;  5C5M A;  1TKW B;  1D1K A;  2MFI A;  3T1Y L;  2MGS A;  4Q5V A;  1E3P A;  4LMQ D;  1O7Y A;  2B3G A;  2BOS A;  2WAQ B;  4DV1 Q;  3BVZ A;  4BBR G;  1PYS B;  4C3H B;  1GUG A;  2QDL A;  3S14 B;  4KHP Q;  3EA6 A;  3J80 c;  2YTY A;  4J1M A;  3T51 B;  2UUA Q;  5C4J B;  4PZ8 A;  1D1I A;  1CSQ A;  3PO3 H;  2F0W A;  2KHI A;  3J80 E;  4DUY L;  1KIX A;  2NBF A;  5I9P A;  1JOR A;  3UE1 A;  4F88 A;  1ENF A;  1E2Z A;  4DK3 C;  3T1H L;  1Y1W H;  4OEM B;  2KCC A;  2KVM A;  2OCE A;  1VQO A;  1VS0 A;  5EKK A;  4HID A;  1PH7 A;  2MPM A;  1LTB D;  3K6O A;  2K75 A;  1EY9 A;  2KED A;  1MHW C;  2JA7 G;  3DM3 A;  1SDF A;  4RGM A;  2FIN B;  5NUC A;  3RZD H;  4HJ8 A;  3D4D A;  2RCN A;  4V19 0;  5DEH A;  1TY2 A;  3NBI A;  2LXJ A;  3KF8 A;  2F0N A;  1NTG A;  1BBX C;  4WRD A;  4DF7 A;  1VQA A;  3M4O B;  4LF4 Q;  4YCW A;  4AIM A;  4GOP B;  1VQH A;  4A3I B;  4G7H C;  3C3L A;  1EOT A;  3BDO A;  1DOM A;  1YVC A;  3NTI A;  2PI2 A;  4HED A;  1F2Y A;  4K6L A;  3RLO A;  2A74 C;  4IFD I;  1UNS A;  1HFN A;  2F3I A;  2O4X A;  4A3B G;  1SFO B;  3U4Z A;  1ILQ A;  3SR1 A;  1KLU D;  1NNX A;  3OSO A;  3PUY A;  1X6O A;  2JJQ A;  4LF9 L;  1BXT A;  2X6L A;  3VYU A;  3K59 A;  2F0V A;  2OQK A;  1CKM A;  3KK7 A;  1A15 A;  4L63 B;  4C1N I;  4IFD J;  5EGT A;  1KC8 C;  1A3V A;  2N3S A;  3J80 L;  4H44 C;  3Q23 A;  3HOW H;  3MFY A;  1PMR A;  1EY8 A;  4DV3 L;  1E22 A;  2NVQ B;  4CHT B;  1STG A;  2D0O A;  4KN7 C;  1I6V C;  1TWH B;  1PFS A;  2NN6 I;  3FRP B;  4OXP A;  1B7Y B;  2IHF A;  5CV9 A;  4KY6 A;  2ZM6 L;  2F0F A;  1RF2 D;  1YNN C;  4LFA L;  1OXU A;  1WTV A;  1Q82 C;  4DR7 L;  4BWG B;  1PTO D;  3GTL B;  4YHH L;  5IYB H;  2K7V A;  3PIO A;  5DLQ E;  3K0X A;  1EY4 A;  4A3J H;  2L55 A;  4NXN L;  3H0G H;  1KLG D;  1PV4 A;  2Z4I A;  3U9O A;  3PIP A;  3S16 B;  1VQG A;  4CKE A;  4XTC S;  2R93 G;  1ROD A;  3E9I A;  1EZ8 A;  1J6Q A;  5IP9 G;  2K03 A;  4H02 A;  1LUZ A;  3ERS X;  2XRQ D;  2IX1 A;  4J15 A;  1AEX A;  2EZV A;  3OYY A;  3TZU A;  3GTJ B;  5M3M H;  1CZG A;  3E6Z X;  1DOK A;  2IW3 A;  2R3Z A;  1UE7 A;  1L1O B;  4DR2 L;  1ILP A;  3L3O C;  5GAG C;  1Y14 B;  3I4M B;  2K5H A;  4DN4 M;  4HIK A;  1KDC A;  5C4H A;  4EQO A;  2HIV A;  1XX8 A;  5FO8 B;  2IPK D;  1HHV A;  1YNJ D;  1PFM A;  1SMY D;  1TS5 A;  1FL0 A;  2I5M X;  5JOB A;  2ZTD A;  3EBE A;  4B9X A;  4C3I H;  2WKC A;  1XTC D;  1U0L A;  3KDF A;  1TWA B;  2B2T C;  3F1Z A;  3EN2 A;  2LXK A;  3GV6 A;  3M9B A;  4IUQ A;  3ICE A;  3T1Y Q;  1GOZ A;  1EU4 A;  1VQ5 A;  2UUC L;  5COR A;  5LMN L;  3Q24 A;  3WWV A;  3J7Y W;  2ZJR A;  2B2Y A;  1I4X A;  3A7L A;  4L5Q A;  1VQF A;  2QIL A;  2VNU D;  1RJT A;  2AWN A;  1NBW A;  3CMA A;  4DUY Q;  4JC0 A;  2HUG A;  2K33 A;  3STB D;  3A7A B;  1V8Q A;  2VXW A;  3P7J A;  5D3D A;  1PVO A;  1AFP A;  1PH8 A;  2RVL A;  1DJR D;  3A8I E;  1K28 A;  1ET9 A;  4GS3 A;  3AYH B;  5HGT A;  3PCO B;  5FJ8 G;  1TU2 B;  2F0O A;  1BBU A;  4CDC C;  4POF A;  1DM0 B;  4GN3 B;  1CQF A;  3VR3 A;  4R1J A;  3CQZ B;  1Q1E A;  2GVA A;  5BN3 A;  1F9S A;  1PZJ D;  2F52 A;  4FP5 D;  4KK7 A;  4GNX C;  2N55 A;  4JI7 L;  1G6Z A;  2VW9 A;  3FMC A;  3MWY W;  2WP8 J;  4IUR A;  3S2H H;  4QL5 A;  2EPB A;  2PZT A;  2R7D A;  3ONA B;  2Z1C A;  5AJ3 L;  3O13 A;  1VF7 A;  4RHR A;  4ZKB B;  4GZY C;  2ALY B;  2EYP A;  4LF6 Q;  1N33 L;  1S5D D;  3URY A;  4FF2 A;  4KJN A;  3GTQ B;  2DUD A;  2X6G A;  2XGT A;  2JP1 A;  5I6Y A;  2OTJ A;  1AH9 A;  3I4N H;  3BZD B;  3MXN A;  2HDM A;  2I46 A;  4ZQ3 A;  1Y69 U;  3BVM A;  2CH4 W;  4KN4 C;  4XYQ A;  3QWN A;  2CHB D;  3OW7 A;  4X3S A;  4CBV A;  1EL0 A;  3FEW X;  1SYF A;  3PO2 H;  4H0L C;  1RDP D;  1JOO A;  1XPR A;  1VQ9 A;  3N52 A;  4LF9 Q;  1VQJ A;  2E76 C;  4BBR B;  1X3F A;  1EY6 A;  2NVT H;  1HUN A;  4PMW A;  1J5E Q;  1NE3 A;  3NEN A;  1PDQ A;  5IGC A;  4ODG A;  2F0E A;  5G3L F;  1M90 C;  4WJ3 M;  4DV3 Q;  4TQU S;  3S24 A;  1JOK A;  1EYA A;  3D8G A;  3C46 A;  1SJE D;  1TVX A;  4JYA L;  2C9O A;  3V96 A;  3CC7 A;  1EUJ A;  1H9R A;  5GQO A;  1G2S A;  1JR0 D;  3HOZ G;  4DUZ L;  3DEP A;  2NZH A;  4UP9 A;  3MZ5 A;  2A69 D;  2IT1 A;  1SEB D;  4POG A;  3TBI B;  4QIW E;  2DY8 A;  4LFA Q;  1HNZ L;  4DR7 Q;  3GDE A;  2JA7 B;  3NP8 A;  2H1E A;  3GTO H;  1TWG B;  1EIF A;  4YHH Q;  2EJG C;  3RLN A;  1VF5 C;  2N8N A;  1TII D;  4NXN Q;  1WTR A;  4C3H H;  2NVY H;  2R61 A;  3DWQ A;  5JJL A;  3TQY A;  4A3K H;  3R93 A;  4TKO B;  2NVX H;  1O7L A;  4Z9C B;  4K8I A;  2Y0S E;  1QCB D;  3ITP A;  4A3M G;  1DCZ A;  1ZYR D;  4S3S A;  5M3F G;  1FYC A;  4IUP A;  2B63 G;  3DWP A;  1FR3 A;  2XIW A;  2F1M A;  1LYL A;  4DK0 A;  4DR2 Q;  1DD2 A;  4A3B B;  2Q8R E;  1U4M A;  5FO7 B;  2KCN A;  2A19 A;  1PZK D;  3CCR A;  4DR3 L;  4X64 Q;  3M7N A;  1A6X A;  4IOC A;  3GTK H;  1SE4 A;  4A3C G;  1XXG A;  4IUV A;  2E2D C;  5LL6 X;  3DLL A;  3LWU A;  3NUC A;  4MNO A;  5I6W A;  4UPA A;  1EOV A;  4EVO A;  1BBW A;  2F0P A;  3VYR A;  1CHP D;  1FJG Q;  3TRZ A;  4ZRZ A;  5AFW A;  4ABN A;  1LTL A;  1QG7 A;  3J7Z C;  2UUC Q;  5LMN Q;  1B4O A;  2HDL A;  2B2T A;  4GNX B;  1F9Q A;  1XNR L;  5GAD C;  1RTO A;  2IY5 B;  2F3W A;  2N88 A;  2L11 A;  2E2I B;  2WB1 G;  4BS9 A;  3I91 A;  2RDG A;  4DV4 Q;  2R93 B;  1HCZ A;  1YJ9 A;  2Z4H A;  2AHO B;  4NP5 A;  3RN2 A;  3HOY G;  4A3D G;  4JG2 A;  3J81 i;  5G3L D;  1GHK A;  2VY3 A;  2K5V A;  3G6J B;  2AKW B;  3IFT A;  4FXG C;  1C0A A;  1XYI A;  5IIF A;  1YEZ A;  4KJO A;  2PMZ B;  1AE3 A;  3FPP A;  5M5W B;  4IJH A;  1XTD A;  2K50 A;  4DR1 Q;  2CW0 C;  4AQY L;  1GM5 A;  3EIV A;  2IX0 A;  1YHQ A;  1HQR D;  2R7Z H;  3NBH B;  2K32 A;  2B8F A;  3D6C A;  2QGQ A;  3HP3 A;  1SE2 A;  3I4O A;  1S5E D;  2UXD Q;  2EY5 A;  1ZXT A;  5JPM C;  1VQD A;  3HOV H;  5AJ3 Q;  2B2V C;  2D5D A;  2VQE L;  1KQS A;  1UE6 A;  3S17 H;  4FYD A;  1N33 Q;  1Q12 A;  2DJF C;  2AWO A;  5IOC A;  1E7Z A;  3MHB A;  1BNZ A;  3CC4 A;  4GKJ L;  1NJI C;  1K83 H;  2OF1 A;  2FXQ A;  4J6H A;  1QNK A;  3K7U C;  3NWT A;  4M1U B;  4FO2 A;  2E74 C;  1CTM A;  4DR5 L;  3HOX H;  1N36 L;  1PRT D;  2PYK A;  4DAY B;  4JI6 L;  1XMQ Q;  1ASY A;  2HT1 A;  4XXE A;  2A68 D;  2DN8 A;  4L8J A;  4B3S L;  2JSO A;  3GQB A;  4HIM A;  1STH A;  2A73 B;  3I72 A;  2L0C A;  1N34 L;  4BA2 I;  3BG3 A;  1PTO B;  2Z0S A;  2I07 B;  4DV0 L;  4BY1 G;  2ES2 A;  2F0L A;  1GUN A;  4ZK9 B;  2BE5 C;  2FHT A;  5IGD A;  2QEX A;  1LTS D;  1YJN A;  2E2J B;  1I6H B;  4GOP C;  3GTM B;  3S15 B;  1E0B A;  1BKB A;  4MIU A;  5EPJ A;  3BVG A;  1LTR D;  1X55 A;  1LTI D;  1STA A;  3CC2 A;  3CAM A;  4DV5 L;  2RBM A;  4A3E H;  1BOS A;  4OO1 H;  2PZW A;  3GO5 A;  3WOE A;  2FFK B;  3FKI H;  2EYF A;  1EY5 A;  1IBL Q;  2FJ2 A;  2K01 A;  2YU9 H;  1PH6 A;  3VYT A;  5CV4 A;  3QOL A;  5JJZ A;  5JAV A;  3NQT A;  1YJW A;  5EKL A;  3CPW A;  3F2B A;  4HJA A;  4JI4 L;  3A54 A;  3JC6 6;  1C48 A;  3CME A;  3QG1 A;  4IQZ A;  1ZKO A;  1I4H A;  3JAM i;  4WJW A;  4A76 A;  1SE3 A;  1V1P A;  5BR8 L;  2CQO A;  1JB7 A;  1XNQ Q;  4LNQ A;  2F4I A;  1STE A;  3VYS A;  1EYC A;  3E3X A;  3HGB A;  1B50 A;  5C44 G;  1VQI A;  2PNH A;  4C3J H;  4UDU C;  3HKS A;  1XPO A;  4JI2 L;  3PV0 A;  2RHQ B;  1ZYR C;  3C1E A;  1IL2 A;  4YY3 Q;  5EAY A;  3NWS A;  2PPB C;  3BU2 A;  4CKC A;  4DR3 Q;  5J39 A;  1PFB A;  1HNX L;  5FOB B;  1I4G A;  1F2Z A;  2KQ3 A;  1GD7 A;  1E1O A;  3P1H A;  3S1M H;  1K0R A;  2B2U C;  3K0Y A;  1NY4 A;  4FDB A;  4JBK A;  1E24 A;  1JIC A;  5DAU A;  4A3G H;  1V1Q A;  2B39 A;  1RCV D;  5LMU L;  4Y52 H;  1SYB A;  1GXD C;  1STY A;  1TT2 A;  3BYT B;  2TMP A;  3HOZ B;  3BS1 A;  2D0P A;  2O2L D;  5IP7 H;  4QCL A;  4XYO A;  4U68 A;  1L1O C;  4WFN 3;  3KUP A;  5ELO A;  2UXC L;  2F4V L;  2MP1 A;  3PMF A;  3TSS A;  4R9W A;  4JV5 L;  3C1F A;  4OX9 L;  4DNR B;  4LFC L;  3ULL A;  2A6H C;  1LT4 D;  5GRO A;  2NZ1 D;  3LX0 A;  2R92 H;  4B3T L;  5J22 A;  4FF1 A;  4A4I A;  3CKI B;  3G6E A;  4P72 A;  1EQR A;  3PO3 G;  4ID6 A;  2J4X A;  2KEC A;  1KD1 C;  2E2H B;  1N8R C;  4RA8 A;  3KF8 B;  5CBA E;  2F0G A;  3SK4 A;  1C4Q A;  4BY7 H;  2SNM A;  2PW7 A;  4IPD A;  4KY5 A;  4A3F H;  1Y1W G;  3GD7 A;  4A3M B;  1BO0 A;  3DMU A;  3Q8D A;  1ZEQ X;  4LWC A;  2JA5 H;  1YIT A;  5M3F B;  4G7O C;  1EY0 A;  4YIJ A;  2B63 B;  2CFM A;  3HRZ C;  4DNI A;  4AQY Q;  1PLF A;  2FMM A;  2D2C C;  2KEE A;  1II3 A;  3AFP A;  3K5O A;  2EJF C;  3S2D H;  3IRB A;  5CV6 A;  5ELN A;  1K3R A;  5D65 A;  3W1B A;  1XJV A;  4WJ4 A;  2K28 A;  2VQE Q;  4EQN A;  4FNF A;  4LFB L;  1SLJ A;  1K8G A;  1JB3 A;  3B6Y A;  2JYO A;  5ELD A;  2ASB A;  4RWS C;  4EQ5 A;  2JA6 H;  5M5X B;  2K5W A;  4GKJ Q;  1ESF A;  5IY0 A;  2NTS A;  4HTH A;  5C0X H;  2A8V A; 
#chains in the Genus database with same CATH homology
 5C3E B;  1KAB A;  4IN3 A;  5JVG 3;  2SOB A;  1EWC A;  3I3C A;  1ONL A;  1PRT C;  3TP7 A;  2A68 C;  1EY7 A;  1TWC B;  4K8J A;  5K36 H;  3RZO B;  4CJ2 C;  2PW5 A;  5TSS A;  1J9O A;  2WB1 B;  5EJW A;  1H9J A;  3K5L A;  1TS2 A;  3NXW A;  4O42 A;  1EQT A;  4KV6 A;  4A3D B;  1CZW A;  1JC7 A;  3K5N A;  1H9S B;  1PFN A;  3CRL C;  3MVV A;  1X3Q A;  4HMI A;  2G9D A;  1EWH A;  3EFX D;  3G7L A;  5CYU A;  4K2L A;  4ME5 A;  1VMC A;  5EPL A;  5M9O A;  1G29 1;  1X3P A;  2PZU A;  5DNF A;  3J81 E;  1MD2 D;  2HCC A;  1Q8I A;  1EEI D;  1BCP F;  3QO2 A;  2L4N A;  2A6E D;  1LTA D;  2XVS A;  3OIQ A;  2XWJ B;  5BN5 A;  2ENB A;  2L12 A;  1G2T A;  2SDF A;  1IW7 D;  2H4O A;  2BDN A;  3I73 A;  1MI2 A;  1J8I A;  1SNM A;  1TWF B;  2IWH A;  4MHE A;  3SVM A;  3FPU B;  3S1N B;  1QJO A;  4BY1 B;  1MSH A;  2MJ8 A;  2G9H D;  5FK9 C;  1B44 D;  2WIN B;  2LY7 A;  2AUJ D;  2WII B;  4FVM A;  3K57 A;  3Q22 A;  1LAC A;  4DNT B;  3E5S A;  4DXG A;  3I4L A;  3MEH A;  5IGG A;  3ERO A;  3W3A A;  3RUZ A;  2NTT A;  3A8J E;  3Q6S A;  1WTW A;  3MXU A;  1I4R A;  1IL8 A;  3J81 L;  1HFG A;  4JBW A;  3NK9 A;  5EKI A;  1KTK A;  1V43 A;  4LJZ C;  3C2P A;  1DXM A;  5C44 B;  3A56 A;  3D4R A;  2ICI A;  1PRT B;  3N6R A;  1UUP A;  2M9V A;  1UAP A;  3TP6 A;  4DXF A;  3MTS A;  1Z6H A;  3ERQ A;  4IAL A;  5ELF A;  3K5M A;  1Z7T A;  3JAM E;  3A8K E;  2CQA A;  4KHZ A;  3ZYY X;  4PV1 C;  2ICE C;  4B08 A;  2F0D A;  5KNB A;  5KYI A;  1L0Y B;  1NSN S;  2RSN A;  1LT5 D;  4KTA A;  4K5V A;  4KKS A;  4OIK A;  1BCP D;  2RKS A;  4RGO S;  3E0J A;  1A2U A;  4CGY B;  5KND A;  3UI2 A;  5EBC A;  3CHB D;  5KIX A;  1R9T B;  1F9P A;  1QWY A;  1Q90 A;  3SEB A;  4KKT A;  1ET6 A;  4RCO A;  1JCK B;  3PO3 B;  4IFD H;  2HCI A;  4EQP A;  5LL6 S;  2EOT A;  3HG9 A;  4QUC A;  1BR9 A;  3S9W A;  3IKJ A;  3BDC A;  2X69 A;  1RTN A;  3AMU A;  1Y1W B;  3J7A F;  2F0Q A;  5JEA H;  1GUT A;  3KLR A;  3M7G A;  1PTO C;  2ZT9 C;  4K2K A;  1U9R A;  2NN6 H;  3NHH A;  3JAM L;  5ELC A;  5CV7 A;  3SK8 A;  1S5F D;  2JEA I;  2EYO A;  4DAP A;  2R6G A;  1JWS D;  1K8M A;  1I4P A;  3D6W A;  3M85 A;  2TSS A;  4ZYS A;  1I3Q B;  3T56 B;  3MXP A;  4PQX A;  2EYJ A;  1SXT A;  2GA4 B;  1FGB D;  2EDG A;  1AW7 A;  1S4Z A;  4HAE A;  3W2D A;  1IW7 C;  1YNJ C;  1SMY C;  1X32 A;  1KNE A;  4FF4 A;  3WDN A;  5I2X A;  3HEJ A;  4QB4 A;  3NPP A;  4XT1 B;  3GTG B;  3HOW B;  4TSS A;  3RLF A;  4KHV A;  5FLX E;  2WAC A;  1Y8P B;  3J7A V;  2L1B A;  4BA1 I;  3GP7 A;  1B3A A;  2F0J A;  3PUW A;  2VB2 X;  3DEO A;  5BN4 A;  2WV6 D;  3ND8 A;  3BYY B;  4EGV A;  4HSP A;  4HN7 A;  3K7A B;  2E75 C;  1ENA A;  4A3J B;  1WVL A;  1TR5 A;  4KY7 A;  3PUZ A;  1IHZ A;  3RMH A;  4L6T B;  2ZXO A;  5EBD A;  1D5X C;  1U4P A;  1DZ1 A;  1VMP A;  4HCE A;  4KD3 A;  4J8Q A;  1MBY A;  1S5B D;  2K5Q A;  4O1N A;  2NYZ D;  2SNS A;  1QOH A;  1IYU A;  5J1Z A;  4K14 A;  1WTO A;  2V4D A;  3F2U A;  4U67 3;  5FLX L;  1Z47 A;  1E2V A;  4F8M A;  4CJ1 B;  3S1Q B;  1RKN A;  1M4V A;  1ESR A;  2RSO A;  1JE4 A;  1SYE A;  5C0X J;  2QEJ C;  3CRK C;  3PUV A;  3OWF A;  5CC4 A;  2BDO A;  1GUO A;  4CKB A;  2B8G A;  1FNW A;  2F0K A;  1CFM A;  3NBH A;  4IUU A;  4ZUJ A;  3T4A C;  2PQE A;  4HSV A;  1PYW D;  1EU3 A;  4DGZ A;  2MUY A;  2A69 C;  1V1P B;  1LLR D;  1Y8N B;  5IGF A;  2F3V A;  2L5T A;  3L9A X;  4DAY A;  1YNN D;  3VA5 A;  5KNC A;  4XIG S;  1LTG D;  4RKL A;  5E4X A;  5CR3 A;  1I4Q A;  2K05 A;  3IL8 A;  3S2H B;  2VB3 X;  5T1G A;  3NSW A;  4KMU C;  1T5X D;  2J0T D;  4RGN A;  3QOJ A;  3QJY A;  2BA1 A;  1JOQ A;  3PUX A;  1HUM A;  2XSC A;  4I7Z C;  4AYB B;  1HA5 A;  3I4N B;  4C3J G;  2ID0 A;  4OL7 A;  5IOD A;  2ZXR A;  3KLS X;  4NW2 A;  1KAA A;  3PO2 B;  3CU7 A;  1CQV A;  1NUC A;  1S5C D;  2LS0 1;  5CBE E;  3Q0A A;  1SND A;  2NVT B;  2NB0 A;  1W6J A;  4RCN A;  4H13 C;  3TZD A;  2K04 A;  4RKB A;  1EQV A;  1HTP A;  4WOR A;  1LV9 A;  5F2D A;  5D14 A;  4JK1 C;  4QIW B;  2F0S A;  1GUS A;  1QIL A;  1OO9 B;  3NTH A;  3P75 A;  1WTQ A;  2IJ0 A;  2RDF A;  3MA2 B;  2Z8L A;  2JEB I;  1NR4 A;  1XWE A;  4NKL A;  2EE1 A;  2OEO A;  2B2Y C;  5I4D A;  3TN2 A;  1MSG A;  1SYD A;  3VR5 A;  2NVY B;  1EIG A;  2Y0S B;  5CGK A;  3X3M A;  3QB3 A;  4A3K B;  3V2T A;  2NVX B;  1OXX K;  4Q0F A;  1OXS C;  1STB A;  5C3X A;  4N9P A;  1K8O A;  4B9W A;  4OIJ A;  3EJI A;  1AZQ A;  3VR2 A;  2F03 A;  1NCV A;  1H9M A;  2DNE A;  1QB5 D;  2QDB A;  3DUZ A;  1C8C A;  2O5J C;  1BCP B;  1V1O A;  1D6E C;  2SEB D;  4ILW A;  1STN A;  4K5X A;  1F9R A;  1D5Z C;  2B2V A;  3GTK B;  2JXM B;  2L9H A;  2EYM A;  4N9T A;  2FMC A;  5C0X G;  1W6K A;  2PO4 A;  2Q8I B;  4RAU C;  1VDZ A;  3SK6 A;  4RFB A;  3H6M A;  2PNR C;  1LO5 D;  1U4L A;  4XQJ A;  3LNN A;  1Y1V B;  5K36 G;  1CA5 A;  1TQO A;  2CVR A;  1B53 A;  1SNP A;  2AQ1 B;  1BDO A;  3NQI A;  3P20 A;  3X3N A;  5DM7 3;  3HOY B;  2HQE A;  5KYL A;  3FDT A;  3H3V C;  1KDB A;  1TY0 A;  5LHY 1;  1HTL D;  1FNU A;  5JVH 3;  4ZAI A;  5HUR A;  1IYV A;  1SNC A;  2OXP A;  4QUF A;  2R7Z B;  4PMC A;  1HPC A;  5JEA J;  4G7Z C;  4XQQ A;  1U4R A;  2NWG A;  4NMZ A;  2B2W C;  2WKD A;  1JWU D;  4IUT A;  3HOV B;  1Q3L A;  3QIA A;  5KRU A;  5K5P A;  4DAV A;  3S17 B;  1AP0 A;  1B2T A;  1SNQ A;  2EYL A;  5DM6 3;  1K83 B;  3S1R B;  4LK1 C;  5A2Q E;  3HOX B;  2C5C A;  3I90 A;  4HCS A;  5FKA C;  1RD9 D;  1H9S A;  1BQQ T;  4MN3 A;  5KEE A;  3HOU B;  1T5E A;  1I50 B;  3TP8 A;  4C56 C;  1WD1 A;  1IKL A;  4X3K A;  3FVQ A;  3MC0 B;  5I2Y A;  3HZX A;  4C3I G;  4ZKC B;  4RH6 A;  1D2B A;  2XRS D;  3MXG A;  2B2U A;  3SDZ A;  2XNA C;  4XT3 B;  3OMG A;  1DOL A;  1SJH D;  2BA0 A;  4LAA A;  2EY1 A;  4XDX A;  5KGU A;  1A3T A;  1FD7 D;  3T13 A;  2XN9 C;  1MGS A;  4A3E B;  3FKI B;  2OT2 A;  2YU9 B;  4FXD A;  1PTO H;  1B1Z A;  2XWB B;  4DA2 A;  3HS0 C;  1DON A;  4IZ8 A;  1SBB B;  4M8A A;  5ELB A;  1LT3 D;  1F2M A;  3M4Y A;  2DY7 A;  3L7Z C;  5A2Q L;  1JWM D;  2RA4 A;  1SSO A;  1Q1B A;  1TS4 A;  4C3J B;  1GHJ A;  1UEA B;  3R8B A;  4R8N A;  3SHL A;  5IT9 E;  3A55 A;  5E3F A;  3SK5 A;  2CW0 D;  2F0H A;  1EIH A;  3TP5 A;  2F0I A;  4KI0 A;  5EQ0 A;  1O80 A;  3D3R A;  3S1M B;  1VCI A;  4A3G B;  1M8A A;  1PZI D;  3GV3 A;  4ZLT F;  5C6A A;  4I65 A;  3MAQ A;  1WTX A;  4R8I A;  5CMD A;  2RDH A;  1AN8 A;  3VA7 A;  3DHQ A;  2EVB A;  3RD4 A;  3DXJ C;  1OXT A;  4HMJ A;  1ENC A;  5A35 A;  5T1I A;  5E1F A;  5COY A;  2KHS A;  3VR4 A;  1F2L A;  2R92 B;  4QMG A;  3MFG A;  1LAB A;  2AQ2 B;  1OXV A;  4IFD G;  2BE5 D;  3TDQ A;  4PMB A;  4OO1 I;  4BY7 B;  3SXH A;  4A3F B;  2QCP X;  2LKV A;  1O7Z A;  2F0T A;  5C5L A;  5FO9 B;  2JA5 B;  2EXZ A;  2YYZ A;  5IT9 L;  3RZD B;  2M00 A;  2AUK A;  4RGT A;  1G91 A;  2LFN A;  3H91 A;  3SE0 A;  5JEA G;  4V0B A;  1AZP A;  2DNC A;  1CM9 A;  4C3H G;  2NN6 G;  3S2D B;  2AQ3 B;  1BUV T;  2EY2 A;  4ULL A;  1KDA A;  2F0U A;  2JA6 B;  3KBX A;  4ZUI A;  2B2W A;  2QF7 A;  1A3U A;  1E2W A;  1CHQ D;  1CI3 M;  3R3O A;  1PRT F;  1ML0 D;  2A6E C;  3LWE A;  4C1N K;  2K6A A;  2BCO A;  1QNU A;  4FF3 A;  5CV8 A;  1CA6 A;  4PNY A;  1G8Z D;  1PXU A;  4P2C B;  1GUW A;  2KOL A;  3R2T A;  4KKU A;  5IGE A;  5C4Z A;  3KBG A;  3VR6 A;  3T53 B;  3OWE B;  1Y8O B;  3NE5 B;  2EJM A;  5CV5 A;  4A93 B;  1HQM C;  3R2I A;  2O5I C;  1CK1 A;  3K58 A;  1SNO A;  3H0G B;  4DU9 A;  3EVQ A;  2A6H D;  2IL8 A;  1R4P B;  2Q8T A;  2EYH A;  2D9U A;  3TME A;  1JQY D;  3IFD A;  4TRD A;  4X3U A;  5M3M B;  3I70 A;  2J7Z A;  5IGB A;  5M5Y B;  1F77 A;  1ICW A;  2JE6 I;  4FXK C;  3AB9 A;  4CJ0 B;  5EPK A;  3T16 A;  1CT1 D;  4IUN A;  2QKI C;  5C0X I;  1RHP A;  4OHJ A;  4C3I B;  2ZXP A;  5E4W C;  3OHX C;  1HA6 A;  4NDX A;  4E6I A;  1B9N A;  2RQX A;  5JPN C;  3OIP A;  3WOF A;  1FNV A;  4RHS A;  1LTT D;  2KJX A;  4F7X A;  4KD4 A;  2PCF B;  3NTK A;  1O78 A;  1BCP C;  1WD0 A;  1SAP A;  3OOC A;  3OPO A;  3ND9 A;  1HXY D;  3AU7 A;  3KLS A;  4G57 A;  3M3Y B;  1NAP A;  3IAY A;  5I9O A;  4K6D A;  1A2T A;  3GTP B;  3D4W A;  2LMC B;  3HKZ B;  3BDL A;  3H94 A;  4UAI A;  3DM1 A;  4OO1 G;  1WTP A;  1B9M A;  2D62 A;  3EQL C;  4X3T A;  1LT6 D;  1EYD A;  2MHV A;  4OGQ C;  1NR2 A;  1TS3 A;  1WCM B;  1DYQ A;  4C2M B;  3OMC A;  5C4X B;  2KUM A;  1SYC A;  5D3I B;  4K5W A;  2VUM B;  1H9K A;  2A5H A;  4BBS B;  1L0X B;  1EFI D;  2EY6 A;  4F87 A;  4DFA A;  2IX3 A;  1QE6 A;  5ELE A;  1R4Q B;  5ISR A;  2NUC A;  4Y7N B;  4G4K A;  3D31 A;  3I8Z A;  1IKM A;  1BF4 A;  2JA8 B;  1SYG A;  3DWA A;  4XQN A;  2KA7 A;  4H7B A;  4QF4 A;  1GJX A;  2M2L A;  2K5D A;  1HRJ A;  3V05 A;  3PIO 3;  2F0M A;  3H09 A;  2K1B A;  1EZ6 A;  1EEF D;  1D5M C;  4HR7 B;  1PTO F;  3PIP 3;  5C3W A;  1KNA A;  3U9S A;  4DK1 A;  3GTO B;  5C5M A;  1TKW B;  1D1K A;  2MGS A;  4Q5V A;  4LMQ D;  1O7Y A;  2BOS A;  2WAQ B;  3BVZ A;  4C3H B;  1GUG A;  3S14 B;  3EA6 A;  4J1M A;  3T51 B;  5C4J B;  1D1I A;  2F0W A;  3J80 E;  2NBF A;  5I9P A;  1JOR A;  4F88 A;  1ENF A;  1E2Z A;  2KCC A;  2KVM A;  5EKK A;  2MPM A;  1LTB D;  3K6O A;  1EY9 A;  2KED A;  1SDF A;  4RGM A;  2FIN B;  5NUC A;  3D4D A;  4V19 0;  5DEH A;  1TY2 A;  3NBI A;  3KF8 A;  2F0N A;  1BBX C;  4WRD A;  4DF7 A;  3M4O B;  4A3I B;  4G7H C;  3C3L A;  1EOT A;  3BDO A;  1DOM A;  4HED A;  3NTI A;  1F2Y A;  4K6L A;  2A74 C;  4IFD I;  1UNS A;  1HFN A;  2O4X A;  1SFO B;  1ILQ A;  3SR1 A;  1KLU D;  3OSO A;  3PUY A;  1BXT A;  2X6L A;  3VYU A;  3K59 A;  2F0V A;  3KK7 A;  4IFD J;  1A15 A;  4L63 B;  4C1N I;  5EGT A;  1A3V A;  3J80 L;  4H44 C;  3Q23 A;  3MFY A;  1PMR A;  1EY8 A;  2NVQ B;  4CHT B;  1STG A;  4KN7 C;  1I6V C;  1TWH B;  2NN6 I;  3FRP B;  5CV9 A;  4KY6 A;  2F0F A;  1RF2 D;  1YNN C;  1OXU A;  1WTV A;  4BWG B;  1PTO D;  3GTL B;  2K7V A;  1EY4 A;  2L55 A;  1KLG D;  3U9O A;  2Z4I A;  3S16 B;  4CKE A;  4XTC S;  1ROD A;  1EZ8 A;  2K03 A;  2IX1 A;  2XRQ D;  1AEX A;  2EZV A;  3TZU A;  3GTJ B;  1CZG A;  3E6Z X;  1DOK A;  2IW3 A;  2R3Z A;  1ILP A;  3L3O C;  3I4M B;  4DN4 M;  1KDC A;  5C4H A;  4EQO A;  1XX8 A;  5FO8 B;  2IPK D;  1HHV A;  1YNJ D;  1PFM A;  1SMY D;  1TS5 A;  5JOB A;  4B9X A;  2WKC A;  1XTC D;  1TWA B;  2B2T C;  3GV6 A;  4IUQ A;  1GOZ A;  1EU4 A;  5COR A;  3Q24 A;  3J7Y W;  2B2Y A;  1I4X A;  3A7L A;  2QIL A;  2VNU D;  1RJT A;  2AWN A;  2HUG A;  2K33 A;  3A7A B;  1V8Q A;  2VXW A;  3P7J A;  5D3D A;  1AFP A;  2RVL A;  1DJR D;  3A8I E;  1ET9 A;  5HGT A;  1TU2 B;  2F0O A;  1DM0 B;  1CQF A;  3VR3 A;  3CQZ B;  1Q1E A;  5BN3 A;  1F9S A;  1PZJ D;  4FP5 D;  4KK7 A;  2N55 A;  1G6Z A;  3FMC A;  3MWY W;  2WP8 J;  4IUR A;  2EPB A;  2PZT A;  3ONA B;  2Z1C A;  3O13 A;  1VF7 A;  4RHR A;  4ZKB B;  4GZY C;  2EYP A;  1S5D D;  3URY A;  4FF2 A;  4KJN A;  3GTQ B;  2X6G A;  2JP1 A;  5I6Y A;  3BZD B;  3MXN A;  2HDM A;  2I46 A;  4ZQ3 A;  1Y69 U;  3BVM A;  4KN4 C;  4XYQ A;  3QWN A;  2CHB D;  3OW7 A;  4X3S A;  4CBV A;  1EL0 A;  3FEW X;  1SYF A;  4H0L C;  1RDP D;  1JOO A;  3N52 A;  2E76 C;  4BBR B;  1EY6 A;  1HUN A;  4PMW A;  1PDQ A;  5IGC A;  4ODG A;  2F0E A;  5G3L F;  4TQU S;  1JOK A;  1EYA A;  3D8G A;  3C46 A;  1SJE D;  1TVX A;  2C9O A;  3V96 A;  1H9R A;  1G2S A;  1JR0 D;  3DEP A;  3MZ5 A;  2A69 D;  2IT1 A;  1SEB D;  3TBI B;  2DY8 A;  2JA7 B;  3NP8 A;  2H1E A;  1TWG B;  2EJG C;  1VF5 C;  1TII D;  1WTR A;  2R61 A;  3DWQ A;  3R93 A;  4TKO B;  1O7L A;  4Z9C B;  4K8I A;  1QCB D;  3ITP A;  1DCZ A;  1ZYR D;  4S3S A;  1FYC A;  4IUP A;  3DWP A;  1FR3 A;  2XIW A;  2F1M A;  4DK0 A;  1DD2 A;  4A3B B;  2Q8R E;  1U4M A;  5FO7 B;  2KCN A;  1PZK D;  3M7N A;  1A6X A;  1SE4 A;  1XXG A;  4IUV A;  2E2D C;  5LL6 X;  3LWU A;  3NUC A;  5I6W A;  4EVO A;  2F0P A;  3VYR A;  1CHP D;  4ZRZ A;  5AFW A;  4ABN A;  1QG7 A;  1B4O A;  2HDL A;  2B2T A;  1F9Q A;  1RTO A;  2F3W A;  2N88 A;  2L11 A;  2E2I B;  4BS9 A;  3I91 A;  2RDG A;  2R93 B;  1HCZ A;  2Z4H A;  4NP5 A;  5G3L D;  1GHK A;  3G6J B;  3IFT A;  4FXG C;  1XYI A;  5IIF A;  4KJO A;  2PMZ B;  3FPP A;  5M5W B;  2CW0 C;  2IX0 A;  1HQR D;  2K32 A;  2B8F A;  3D6C A;  3HP3 A;  1SE2 A;  1S5E D;  2EY5 A;  1ZXT A;  5JPM C;  2B2V C;  2D5D A;  4FYD A;  1Q12 A;  2AWO A;  5IOC A;  3MHB A;  1BNZ A;  2OF1 A;  4J6H A;  1QNK A;  3NWT A;  4M1U B;  4FO2 A;  2E74 C;  1CTM A;  1PRT D;  2PYK A;  4XXE A;  2A68 D;  2DN8 A;  4L8J A;  2JSO A;  3GQB A;  1STH A;  2A73 B;  3I72 A;  2L0C A;  4BA2 I;  3BG3 A;  1PTO B;  2I07 B;  2F0L A;  1GUN A;  4ZK9 B;  2BE5 C;  2FHT A;  5IGD A;  1LTS D;  2E2J B;  1I6H B;  3GTM B;  3S15 B;  1E0B A;  4MIU A;  5EPJ A;  3BVG A;  1LTR D;  1LTI D;  1STA A;  2RBM A;  1BOS A;  4OO1 H;  2PZW A;  3GO5 A;  3WOE A;  2FFK B;  2EYF A;  1EY5 A;  2FJ2 A;  2K01 A;  3VYT A;  5CV4 A;  3QOL A;  5JJZ A;  5JAV A;  3NQT A;  5EKL A;  3A54 A;  1C48 A;  3QG1 A;  4IQZ A;  1ZKO A;  1I4H A;  4WJW A;  1SE3 A;  1V1P A;  2F4I A;  1STE A;  3VYS A;  1EYC A;  3HGB A;  1B50 A;  4UDU C;  3PV0 A;  1ZYR C;  3C1E A;  3NWS A;  2PPB C;  4CKC A;  5J39 A;  1PFB A;  5FOB B;  1I4G A;  1F2Z A;  2KQ3 A;  3P1H A;  2B2U C;  3K0Y A;  1JIC A;  5DAU A;  2B39 A;  1RCV D;  1SYB A;  1GXD C;  1STY A;  1TT2 A;  3BYT B;  2TMP A;  3HOZ B;  3BS1 A;  2O2L D;  4QCL A;  4XYO A;  4U68 A;  4WFN 3;  3KUP A;  2MP1 A;  3PMF A;  3TSS A;  4R9W A;  3C1F A;  4DNR B;  2A6H C;  1LT4 D;  2NZ1 D;  3LX0 A;  5J22 A;  4FF1 A;  3CKI B;  4ID6 A;  2J4X A;  2KEC A;  2E2H B;  4RA8 A;  5CBA E;  2F0G A;  3SK4 A;  1C4Q A;  2SNM A;  2PW7 A;  4KY5 A;  3GD7 A;  4A3M B;  1BO0 A;  3DMU A;  1ZEQ X;  5M3F B;  4G7O C;  1EY0 A;  4YIJ A;  2B63 B;  3HRZ C;  1PLF A;  2FMM A;  2D2C C;  2KEE A;  1II3 A;  3K5O A;  2EJF C;  5CV6 A;  5D65 A;  2K28 A;  4EQN A;  4FNF A;  1JB3 A;  2JYO A;  5ELD A;  4RWS C;  5M5X B;  2K5W A;  1ESF A;  2NTS A;  4HTH A;  5C0X H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...