4CJ1B

Crystal structure of celd in complex with affitin h3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
63
Chain Sequence
SVKVKFHEKEVDTSKIKKVWRINTRLGMRVAFTYDDNGKTGRGMVPEKDAPKELLDMLARAEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent and Specific Inhibition of Glycosidases by Small Artificial Binding Proteins (Affitins)
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/de novo protein
molecule keywords ENDOGLUCANASE D
total genus 12
structure length 63
sequence length 67
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cj1B00
4QUFA 2J7ZA 3GV3A 5T1GA 1EL0A 1QNKA 5EJWA 3R93A 2MJ8A 3IL8A 2M2LA 4XT1B 3TZDA 4DN4M 1MSGA 3KUPA 1PLFA 2L9HA 2FINB 2NZ1D 2RA4A 4LMQD 4IUQA 4XDXA 5CORA 1HFGA 4UAIA 1AP0A 3H91A 3P7JA 4MHEA 2HCIA 4XT3B 1EIGA 4MN3A 4ZAIA 1WD1A 4ZLTF 1QE6A 5T1IA 1J8IA 4IUUA 2RSOA 3D6WA 1IKMA 2JP1A 2L1BA 1NR4A 3QO2A 1O7ZA 5D14A 1EIHA 2B2YC 2HDLA 2MPMA 1PFBA 2L12A 5DNFA 5E4XA 2VXWA 1HHVA 1RHPA 2FJ2A 2Q8RE 4HCSA 4X3KA 5JJZA 2R3ZA 1RODA 4ZK9B 4X3TA 1U4LA 1O7YA 4RA8A 5E4WC 1U4RA 3UI2A 1SAPA 1DZ1A 1SSOA 1A15A 1AZPA 2B2UC 2X6LA 4HEDA 4ZKCB 1B4OA 1LV9A 4OIKA 2X69A 1ZXTA 2BDNA 5EQ0A 3FDTA 1RTNA 2KEDA 1B50A 4IUPA 4IUVA 2DY8A 1NAPA 3IFDA 1JICA 1ILPA 1CA6A 2B2YA 1HFNA 5CBAE 1J9OA 2HCCA 3KBXA 1GUWA 1HUNA 1RJTA 2D9UA 1DOLA 2K03A 2CVRA 3Q6SA 1U4MA 1S4ZA 2FHTA 2NWGA 3ONAB 1PFMA 3I91A 1EQTA 3MTSA 4X3UA 2FMMA 2RVLA 3DM1A 2K05A 1NCVA 2B2UA 2EPBA 2H1EA 1PDQA 2EOTA 5COYA 2X6GA 1BO0A 3SVMA 2Q8TA 2KEEA 3G7LA 1ICWA 1O80A 1EOTA 1Q3LA 2NYZD 3I3CA 3GV6A 1X32A 5EPJA 2DY7A 1WTVA 2B2VA 1M8AA 4CJ1B 1WTXA 1B3AA 1ESRA 5EKIA 2EE1A 1G2TA 3HP3A 1BF4A 1WTRA 1B2TA 1DONA 1X3PA 3FPUB 2RSNA 1JE4A 1PFNA 1VMCA 2B2TC 2JYOA 1MGSA 2K04A 2KVMA 3MWYW 1G2SA 4OIJA 5AFWA 1BBXC 1DOMA 1X3QA 1HRJA 4U68A 1AZQA 2FFKB 3I90A 1C8CA 1F2LA 2B2WC 1WTWA 2MP1A 1WVLA 3F2UA 1CM9A 1F9QA 1HUMA 1XYIA 2K28A 1G6ZA 4IURA 1MI2A 2IL8A 1KNEA 5D65A 4R8IA 1F9PA 1RTOA 3I8ZA 2K1BA 1ML0D 2L11A 4NW2A 1CA5A 2B2VC 3TN2A 2L4NA 4CJ0B 5CMDA 5EPLA 4R9WA 4QUCA 1WTPA 2MGSA 1F9SA 4X3SA 1B53A 1IL8A 1NR2A 1WTOA 2XIWA 1BNZA 4ZKBB 2B2TA 1VMPA 2HDMA 3DEOA 1WD0A 1TVXA 1F9RA 1WTQA 2KECA 2K01A 1HA6A 4RWSC 4HAEA 2KOLA 1DOKA 2B2WA 3LWEA 3N52A 2KUMA 4IUTA 5EPKA 1ILQA 1U4PA 1E0BA 1IKLA 1SDFA 1KNAA 2SDFA 2N88A 2HUGA 1QG7A 1XX8A 3DEPA 5CBEE 1G91A 4CJ2C 4HSVA 1MSHA 4RAUC 4O42A 2N55A
chains in the Genus database with same CATH superfamily
4DR4Q 4C1NK 1H95A 4DN4M 2UXCL 4RFBA 2FXQA 5ELEA 1Z47A 4GZYC 5C44H 1B3QA 4HR7B 5C0XJ 4J1MA 2QDBA 1HQRD 1W6JA 4BA2I 1RL2A 5G3LD 4NP5A 3JAMi 1EUJA 1G6PA 1I6HB 3TSSA 2YTXA 4A3CG 2UXDL 3PF5A 2R3ZA 4C1NI 1EEFD 1BOSA 3E0JA 1QJOA 1IBML 2VY3A 2WAQE 1AZPA 1A0IA 4DR5Q 4PZ6A 2IY5B 5FLXE 4IUVA 4JI4Q 1PZID 3CU7A 1JJGA 1KRSA 4IALA 5IGDA 2F0JA 1W6KA 1RCVD 2WACA 3RLOA 3STBC 3J81c 1YI2A 4DXGA 2MUYA 3PUVA 4DF7A 1DXMA 2JA7B 3PIO3 1PH3A 1KIXA 4C3IG 2RHSB 1Z7TA 3KF6A 4KD3A 1J6QA 2EJFC 3H0GG 5GADC 1EOTA 1EU3A 4A3IH 1VQCA 4DAYA 2D0PA 1AN8A 3H3VH 5F2DA 2I0QA 1BBUA 1D5XC 4MTKA 3RN2A 2B63B 1W2BA 3S1QB 2A6EC 3OSOA 3X3MA 3M3YB 1HRJA 1CKNB 1E2ZA 4WRDA 1LT6D 1YVCA 1Z6HA 3I4MH 4ZUJA 3LGJA 1STBA 4A3GH 5I9PA 1GXDC 3NPPA 4KJOA 2ZTEA 3RN5A 4LF9L 3UDXA 2EXDA 1WD0A 1VMPA 1PYWD 2EYFA 1E1TA 3CC4A 3A74A 4G7OC 1VQHA 1WJJA 4CKEA 2TMPA 2Q2TA 1KNAA 4JI4L 2TSSA 5JOBA 2BH2A 4NXMQ 4KKUA 3A5ZB 1G91A 4BY7G 2WKCA 4JCVE 3U9SA 1TU2B 1GHKA 4C3HB 4LF7L 1NBWA 1TKWB 3NTIA 2NVQB 2M2LA 1PTOF 2EZVA 2NZHA 3MXNA 4HSPA 5CORA 1ET6A 1PXUA 3H91A 3HKSA 3P7JA 4MHEA 2GVBA 2WINB 1YNND 1GO3E 2D0OA 2MHVA 5T1IA 2NVXB 1STGA 4J6HA 3CHBD 2AQ2B 1GUOA 3KJPA 4ME3A 2R93B 4A93B 2Z6KC 1Q81C 1TWGB 4JI1Q 1PH7A 1VF5C 2CWAA 4AH6A 3A7AB 2DGYA 1ASZA 1A15A 4N8X1 4CGYB 1PH2A 3W2DA 5L37A 1F2ZA 3U50C 3HOXB 1GVPA 4JI8L 1L1OB 4JYAL 3DUZA 3S1NB 1VDZA 2OQKA 2JA7G 2ZXRA 3RLNA 1Q1EA 1S4ZA 2FHTA 5ELFA 1I4GA 3FKIB 1Q82C 1VQPA 3T53B 2IPKD 1N34Q 1BO0A 5C3XA 4IOCA 5IP7H 3GV6A 5M3MB 5JVG3 4K5XA 5BR8Q 5C3EH 4FF1A 2EQSA 2B2VA 3FHWA 3TP6A 3CKIB 3HKZG 5FLXL 2E2JH 4GKKL 2K5QA 4O0AA 4JI3L 3VYTA 3L3OC 3M4OB 2F0PA 2GVAA 2FFKB 3I90A 2QA4A 1SMYC 5E7NA 4FO2A 3GTKH 4BS9A 1XYIA 3VYSA 4LF5Q 1F9PA 3ICEA 2KCTA 4X65L 4A3JH 2HHHL 2E5LL 5M3MG 5K36G 5EBCA 1CI3M 1M4VA 2ZT9C 3P1HA 1B53A 1RF2D 2Z4HA 2ZJPA 4LWCA 1SNPA 1H9RA 3DMUA 4L8JA 2K5WA 4LW1A 4OONA 5M3MH 3RD4A 4B3TQ 1A2TA 1SBBB 3H94A 5M3FB 1ICFB 5CV5A 3CCRA 3HOXG 3IAYA 4JI0L 1QUQB 2IW3A 3SHLA 1PYSB 2UUAQ 2JA6H 4A3KG 1VQ8A 4IFDG 1FYCA 1HXYD 4ME5A 3RZOH 3IRBA 2KHSA 1LTTD 1GKHA 5IE8A 4K2KA 3I4MB 1D5MC 1EIGA 3HOUB 3OOCA 2PW5A 4QQBX 1IKMA 3VYRA 3CRKC 3QO2A 4LFAQ 5LL6S 2CWPA 3HZXA 2KHJA 4BBRG 4GKKQ 2VXWA 4OELB 3ULLA 4GOPA 1HZAA 1JB7A 1RODA 1TT2A 3S14H 1II3A 3G4SA 1DZ1A 3I73A 2CHBD 3RZOB 1SE2A 1LLRD 2A19A 3MZ5A 1J5EQ 1IBLL 4QY7A 1AE3A 3GDEA 4YWMA 3GTPB 3S1NH 3GP7A 1J9OA 1N33L 1DOLA 2NVQH 4R4IA 3I91A 4BY1B 4X3UA 4PNYA 1GD7A 2G9DA 4PMCA 3NELA 3NEMA 4ULLA 1Y1VH 5IYDG 3K5OA 3HOZH 5I6WA 1VQKA 3UE0A 4RG1A 4DV7Q 4A93H 1Y14B 4C3HG 3OW2A 4C3IB 3BDCA 1B2TA 3FPUB 4RGOS 1XWEA 3GTKB 3KBGA 2B2TC 2WV6D 4IOAA 5AFWA 2A8VA 3HG9A 4H7BA 5C6AA 3OIQA 4DV0Q 5LMNW 3S14B 1VQ6A 1PRTF 2IJ0A 1MI2A 3EA6A 3PUYA 5M5XB 3DWQA 1BNZA 2K32A 1LT5D 3M4PA 4ZQ3A 1F9RA 2XRQD 1I4RA 1YEZA 5HURA 4YIJA 4A3BH 4ZCKA 2GN5A 2CH4A 4JI5L 2VUMB 1NTGA 5CBEE 1X3GA 2CCZA 3ULPA 4WJWA 1MSHA 1JCKB 3GV3A 3K0XA 4K5VA 4C3JG 3CCLA 5M9OA 4J15A 2E2DC 5CYUA 2O5IC 3S2HH 2DNCA 1AP0A 3TBIB 1DCZA 4RGTA 3BZCA 2IX0A 4A3DG 3MFGA 1BCPC 1SE4A 4P75A 1WTHA 4KJNA 1VF7A 4QJFA 2JQOA 2B2UC 3M4OH 3J80i 2AQ3B 1B4OA 1E24A 3G6EA 2BDNA 3G48A 5EQ0A 3FDTA 1RTNA 3K5MA 1QOHA 2DY8A 3IFDA 3FKIG 4JC0A 1HH2P 5I6YA 2ZJRA 1C48A 1IYUA 2E8GA 2PMZE 3IFTA 1UEBA 4DK1A 3SK4A 2CVRA 2R7FA 2C35B 1PFSA 3H3VC 4IFDJ 2LFNA 1Y1WB 3ZYYX 4XQQA 1ICWA 3J81E 5BR8L 1R9TH 2A69D 2NTSA 4A3FB 1X3FA 2UXBL 1ESRA 4UHVA 1L1OC 1X3PA 3J7ZC 2CKZB 2JYOA 4LUOA 2R93G 1WOCA 1VS0A 2F0EA 2B2WC 2J0TD 2QW7A 2XSCA 4LF4L 2JN4A 1BBWA 1CM9A 1EWCA 1EYCA 4P71A 1RTOA 4WJ3M 2I5MX 4DR3L 4XQJA 1C9OA 1L1OA 3OTOQ 1NR2A 1JQYD 2SNSA 3A54A 3DEOA 1P16A 3M7NA 2UUCL 1NMGA 4LF5L 4V190 3R8BA 3S9WA 1U4PA 1R9TB 4JI0Q 1X56A 1IW7C 4S3SA 3TZUA 4IPGA 1S5FD 4RAUC 4Q5VA 5C5MA 4HJ5A 4RCNA 2KHIA 1L0YB 2XWJB 3IL8A 3FPPA 5FLXc 4DPGA 1XNQL 1EYAA 2RA4A 4LUVA 4DU9A 1D5ZC 4ZAIA 5C3EG 4LJZC 1I6HH 1LTID 1JC7A 3P20A 1I94L 1XTDA 5G3LF 4KKTA 2UXBQ 4ZK9B 1O7YA 1SFOH 1SNDA 4PG3A 1SROA 4KY7A 2AHOB 3TS0A 2C5CA 2H4OA 1ZYRC 4BXXH 4OHJA 2BE5C 2WFWA 5JEAJ 3NBHB 1EU4A 1NAPA 3D6CA 1QZHA 2XRSD 1S3OA 1PH5A 4X62L 4B3RL 2AMCB 3KBXA 2PZWA 2JXMB 2LXKA 1UE7A 1K0SA 3MTSA 1EQTA 2Y0SE 2FMMA 3TEHB 3PV0A 4IN3A 5CV9A 1OO9B 1YNNC 5IWAL 1X3EA 3NWTA 3Q23A 1WCMB 3PO3B 2YYZA 3TMEA 2EOTA 4H44C 5C44G 2UUCQ 1JJ2A 1Q3LA 3I3CA 3SXHA 3S1RB 1YJNA 3Q22A 2B8FA 1NNXA 1L2FA 1B3AA 4POGA 1EY7A 1JE5A 3VR3A 1HCZA 3CF5A 3MWYW 1YHQA 2F3VA 3NBHA 2J4XA 1OXVA 2IWHA 3HOYB 4A3EH 1T5EA 3NQTA 5FO7B 1KNEA 1ENCA 3BYTB 3C1EA 4X65Q 5BN3A 2L11A 4NW2A 3TN2A 3GTLB 1VQDA 3HFZB 5M5WH 5M5XH 3PQIA 5LMUL 1F9SA 2E5LQ 3K5LA 3JAME 5GQOA 3G71A 3TREA 2ALYB 1ENFA 4QMGA 5C44B 3J7A5 2F4VL 1A63A 3CPWA 1Y1WH 2WAQB 5EKKA 1DOKA 4DV1Q 4IUTA 4F87A 4HMIA 2VQFL 5C4XB 4JVZA 1FL0A 2K5NA 1S40A 1VQEA 4DUYL 3JC66 3HOYG 2BH8A 4EQPA 2R7ZG 3CAMA 4HCEA 4EGVA 2F0MA 3C1FA 4HSVA 3I56A 1HNWL 4HIKA 1KAWA 2E75C 4XYOA 2J7ZA 1EL0A 5EJWA 3UE1A 1EY6A 3RLFA 1BCPD 4DR2Q 4IFDI 1F2YA 2LMCB 1CTMA 1I4QA 1UEAB 3HOWG 4XIGS 5IWAQ 5JEAG 2JA8G 1WI5A 2NN6I 2UUAL 3FMCA 4UDUC 2HDLA 2DJGC 4C2MH 4IO9A 4LK1C 5LMNL 2MO1A 2KENA 2HD3A 1Y1VB 3CMAA 1BQQT 4CKBA 3QJYA 4HEDA 3MXUA 1A8VA 1PZKD 4RGNA 1I4XA 1WFQA 1D6EC 3VDYA 1T5XD 3WOFA 3M4QA 1EOVA 4A3MB 1HFNA 4L5QA 5I2YA 4YY3L 3DHQA 5CV7A 2NWGA 1N33Q 2JA6B 2ES2A 2G9HD 1H9MA 2RVLA 1NSNS 3BVMA 2EPBA 2IHFA 5IT9L 1PDQA 2F0LA 3J80E 3V05A 1N36L 3ULJA 3PCOB 5IGGA 5ELBA 1PMRA 2YTVA 4KY6A 3BG3A 4DV7L 2EY1A 5EKIA 4BBSG 5M3FG 2ZTDA 1HNXL 4KK7A 4BY7B 2F0WA 2PYKA 1VMCA 1SXTA 2KBNA 5IP7G 4Y52H 1HR0W 4MIUA 1X54A 1TWHH 4TQUS 2XTIA 2R6GA 3S2DB 1M90C 3PUZA 5EGTA 1UNSA 4CDFC 3VA7A 5GAEC 3HOWB 4OX9L 1LYLA 4GNXC 4L6TB 5C4JH 2MGSA 3NTHA 4X3SA 1ZKOA 3PIP3 5IYBG 4IPCA 4EQOA 3J81L 2UXCQ 2XGTA 4HAEA 5FO9B 3GTMB 2F0UA 2Z4IA 3HKZE 2KUMA 3I72A 1SNQA 3N6RA 4DNRB 1K3RA 3BVGA 4FXGC 1JT8A 1UAPA 1ONLA 2HUGA 2Z8LA 5IIFA 4FP5D 4Y7NB 3KOJA 2Z0SA 4QIWB 4JBKA 5FJ8H 1TR5A 4XT1B 1MSGA 2QF7A 1A6XA 3NTKA 5GROA 2Z1CA 1GUSA 4X64Q 4QF4A 3K59A 2O5JC 2Q2IA 3HOXH 3L0OA 2IX3A 4LF7Q 1OXUA 1EYDA 1LTGD 2RSOA 3HOVH 3SEBA 3ERSX 1NR4A 1U0LA 4RMFA 3A56A 2C9OA 4V0BA 2O2LD 3F2DA 3GTQB 4A3MH 1RHPA 4B3TL 3HGBA 5A2QE 1PZJD 5KNBA 5IODA 3PUWA 1B9MA 2SEBD 5CR3A 4G7ZC 1IW7D 3HKZB 1SAPA 2VB2X 1YBYA 4A3JG 1S5CD 2EY5A 4RCOA 3I4NG 4A3BB 4K8JA 2ICEC 2ENBA 5IGCA 4HTHA 1AH9A 2B2YA 2QCPX 2PQEA 1TWCB 4U673 2NVTH 2QILA 4H13C 1FNWA 4H0LC 3U4ZA 5IGEA 3Q6SA 4JYAQ 4BBSB 4JW0A 4R1JA 1O7LA 4DR7L 1GUTA 1VQGA 4BY1H 2KEEA 4Z9CB 4F8MA 2UUBQ 1UE5A 1H9KA 1OXTA 1SE8A 4X62Q 4NXML 1X9NA 3G6JB 3HRZC 5C4JB 3DWAA 1WTXA 5C0XG 4OWXB 2EE1A 1H9SB 1CQVA 3GTJH 1PH9A 5JJIA 1JE4A 1WCMG 3PO3G 5A35A 1BBXC 4RKBA 2A69C 4DV3L 2JA8B 4OWTB 3A5UA 4DV0L 4F88A 4DR1Q 1CKMA 1B9NA 4JI3Q 3C3LA 1I3QB 4TSSA 2B2VC 3PF4A 3OW7A 4A3LH 4DUZL 3A8KE 4LUZA 4KKSA 3T56B 5ISRA 3NUCA 2MNAA 5KRUA 3CMEA 1Y1WG 1PRTC 2VQEL 3HS0C 3J7AF 4R4OA 1N32L 3PO2B 1HTLD 4DR4L 5JJLA 4A3IB 2A73B 2AKWB 1PA6A 1XNRL 1FGBD 3EIVA 1SDFA 3HOYH 1JWUD 1EWHA 1KLGD 1CT1D 3AFQA 4A3IG 2CW0C 1YNXA 1HR0Q 1EQRA 1MD2D 2P5ZX 4ABNA 3GTOH 2N55A 3CCVA 2R92H 4JV5L 1RKNA 3MA2B 4QUFA 3HOZG 1BXTA 4RKLA 1IBLQ 4FF4A 5GAGC 2NZ1D 5C4HA 3S1QH 2I5HA 2R7DA 1CSQA 4B3ML 5E1FA 1WD1A 1KQSA 1E7ZA 2PMZB 1J8IA 4LFCQ 5E3FA 4BBRB 2JP1A 2L1BA 1KDCA 3JAML 1O7ZA 1LABA 4A3EG 2MPMA 4P74A 2L12A 4GNXB 4K5WA 4HJ7A 2Y0SG 4DAVA 4DV6L 4A76A 2E2IH 2A74C 2OEOA 1B70B 2B8GA 4A4IA 1LACA 1SSOA 4IZ8A 1XMOQ 4Q0FA 1STYA 1V1PB 4OIKA 2X69A 2HQEA 5FLMH 3GTGB 4IPDA 3T1YL 2Q2HA 4KMUC 4EQ5A 3J7YW 3H09A 4DV5L 1CA6A 2YTYA 2UU9L 1OTCA 1XXGA 5M5WB 2R7ZB 1VQNA 4MNOA 5KYIA 5IGBA 4WORA 5COYA 2A68D 4JV5Q 5M5YB 3G7LA 1SYCA 4QGUA 5J1ZA 1XMQQ 3Q0AA 3I7FA 3PIPA 4JBMA 1VQJA 2AUKA 3NQIA 1J5EL 2K14A 4I7ZC 4K6DA 1DONA 1X55A 2F52A 3CRLC 1GUWA 2PPBC 4HIMA 3EVQA 4H02A 3H15A 4KD4A 1FJGQ 5CV6A 4K8IA 2B63H 3UDGA 1PH6A 4A3DB 2IL8A 2NVYB 3E0EA 1JWSD 4XXEA 1PVOA 2OT2A 2VQEQ 3QWNA 1QWYA 1Y8NB 2FMCA 2WB1B 4QUCA 4UP7A 1H9SA 1LTLA 4K14A 1WTOA 1Q8IA 2XIWA 5IT9E 3CD6A 2B3GA 5IOCA 5IT9c 1LTAD 1PV4A 1HJPA 1HA5A 2ZM6Q 3R2TA 3KLWA 1XMOL 1HR0L 3N52A 2JA6G 1S72A 1STHA 1EZ8A 1WYDA 5IGFA 1K0RA 2Z6BA 1SNMA 1A3VA 2EYLA 3GQBA 3D31A 1CSPA 1E2WA 1DGSA 1EY4A 2MO0A 4BA1I 3VR6A 1XNRQ 4YCWA 4GN3B 4PMWA 2MJ8A 1E2VA 1STEA 2HT1A 3EN2A 3RR5A 1SFOB 1UE1A 3MEFA 1YZ6A 1HZCA 3D8GA 1IBMQ 2EVBA 4CHTB 3URYA 4GLAC 5C4XH 1EFID 2F0OA 1EIHA 3TP5A 3STBD 1JR0D 5BN5A 4R4QA 1JORA 2F3WA 4LF8L 2AUJD 3UI2A 3VYUA 4OWWB 1MIUA 3BDOA 4DR2L 3NBIA 1KXLA 2A68C 3KLSX 1FJGL 2AQ1B 2EDGA 1QCBD 3U9OA 5CBAE 3AFPA 3H6MA 4HJAA 3D3RA 3QOLA 4FDBA 5IYBH 1SMXA 4O1NA 3QOJA 1AW7A 1PRTD 3SE0A 4DV5Q 3RZDH 1L0WA 3S2HB 3PUXA 4AQYQ 4KTAA 4QB4A 4PV1C 1TY2A 5LHY1 2ZM6L 2RQXA 3ND8A 2A5HA 4WFN3 1YJ9A 1I5FA 1M8AA 3RNUA 2NN6G 1GM5A 1IXRA 1K8OA 1WTRA 2D2CC 4APVA 1Y1VG 2PI2E 2RSNA 1I50B 1XMQL 1QVCA 1STNA 3K5NA 2Q2UA 3OIPA 1HNXQ 1BVSA 1EWIA 1YITA 2ZXOA 1G8ZD 2F0VA 2EY6A 2MP1A 2NVXH 2K5DA 3MFYA 4IQZA 2CFMA 3S1MB 1BDOA 1TWAB 5EPLA 1YJWA 3VR4A 2K7VA 4HMJA 1B44D 3CQZH 3U4VA 4RGMA 2JA5G 2ASBA 4ZKBB 1E22A 4NDXA 4KLKA 5I2XA 2F1MA 4RWSC 1E0BA 1PHJA 2XN9C 3M7GA 2SDFA 1PH1A 3CC7A 1K73C 1QG7A 2EYHA 2Z6KA 1SR3A 5ELCA 3HOVG 1KABA 1TQOA 3A55A 3E6ZX 3TZDA 1F2MA 3FRPB 2FINB 2Y0SB 4IUQA 3ZJYC 1DJRD 4JOIA 1HNZL 4UP8A 1W3SA 3AMUA 3W3AA 4DKAC 2ZXPA 1P8LA 4A93G 3CPFA 1EQQA 1SNCA 3S1RH 4CDEC 5C0XH 4NMZA 4BBRH 2R92B 2B2YC 3VR5A 5DNFA 4HCSA 1HZBA 2JSOA 2KCCA 1U4RA 1CK1A 3SK8A 4DGZA 3PGZA 4CBVA 2OWOA 4DR3Q 4JOIC 4A3LG 1SE3A 1Y8PB 2KEDA 2PO4A 1E3PA 1IBKQ 1A2UA 2LKVA 4DV4Q 1ILPA 3QR8A 1K3BC 4JI1L 2HCCA 1JOKA 5ELOA 3A7LA 4K6LA 1RJTA 4GOPB 3KDFB 2JA7H 2K03A 1XPRA 4OO1G 3QB3A 1PFMA 3I4NH 1TWFB 4BWGB 5ELDA 1NE3A 2F0FA 1T9HA 3VR2A 1EFWA 4A3FH 3T4AC 3KLSA 4RH6A 1PH8A 3O13A 4C3IH 1Y69U 3TP8A 1YHAA 2F0DA 2I46A 3PO2H 4FXKC 2K04A 3E3XA 2EYMA 4DR7Q 1EY8A 4JG2A 1EZ6A 3S17B 4B9WA 2LY7A 1WVLA 1KHIA 5AJ3L 1NUCA 3KYHC 4XTCS 2EIFA 5KEEA 3K6OA 3OWFA 2KJXA 2NVTB 4RHSA 4JI7L 2HDMA 3GTJB 5DAUA 1SNOA 4MZ9A 3BZKA 4IJLA 1CHPD 5IY0A 1CZWA 3WDNA 3KJOA 1EY0A 2F4IA 1VQAA 1E1OA 3EQLC 5ELNA 2BOSA 1XX8A 5K5PA 3T1HQ 1FD7D 3GO5A 4GLXA 3I2ZA 2HIXA 2PQAA 1IZ6A 2VQFQ 2EYPA 4A3FG 3E9IA 1A62A 1QNKA 3D4DA 4CDDC 1OXSC 3D4WA 3EJIA 4OGQC 2NN6H 4OEMB 4N8FA 4KHZA 4LMQD 4G57A 3MXGA 1X6OA 1MHWC 3J81j 5EBDA 1G51A 2NBFA 3GTQH 1ENAA 1QILA 1I4HA 2QGQA 2Q8RE 2F03A 3S15H 4DA2A 3BU2A 1U4LA 1ESFA 4B3MQ 1DD2A 2X6LA 4X64L 1BCPB 3OMGA 1SYBA 5D3IB 4JI6Q 1B50A 1B8AA 2F0NA 3OPOA 2O4XA 1FGUA 1Q90A 3T13A 1HUNA 2D9UA 2KCNA 3ONAB 4IJHA 3OTOL 3J7AV 3FEWX 4GN5A 4HN7A 1CKNA 1BUVT 1RD9D 1CQFA 1O80A 4R4CA 2UU9Q 2UUBL 1X32A 2ICIA 5EPJA 3MVVA 1Q46A 1KC8C 3BYYB 2A6ED 4A3JB 4UY8C 1KTKA 1JB3A 1MJCA 3Q8DA 2VUMG 3L9AX 4OL7A 4BBSH 4WJ4A 3K8AA 5AJ3Q 3PIOA 3F2CA 1UE6A 5K36H 4YY3Q 1SYEA 4U68A 3CCEA 2GA4B 3KF6B 1CUKA 1EY9A 4DV3Q 1YIJA 4R8NA 2VW9A 2VL6A 1FVIA 3I8ZA 4YWKA 2VUMH 1CA5A 3NHHA 1PTOB 2K52A 5IP9H 1TS4A 3S2DH 1HQMC 2E76C 4EQNA 3QIAA 1AE2A 3CP0A 4L5RC 4A3GB 3ER0A 1WTQA 2OTJA 1SYGA 3LWEA 1TWFH 1VQFA 1N9WA 3F2BA 4PZ8A 2A1AA 1SRUA 4NB3A 1F77A 2PW7A 3TP7A 4X66Q 1BR9A 1TWAH 4HIOA 4DK0A 3S1MH 3X3NA 1ZYRD 3KDFA 5KGUA 1EIYB 4O42A 1S5DD 1ASYA 3S15B 3OYYA 3VA5A 4DFAA 2F0TA 1KDAA 1LTSD 3NSWA 3S16B 1DM0B 4G4KA 1PYBA 3I55A 1V1PA 4MN3A 3BS1A 4A3DH 4KHPL 3AU7A 2PNRC 5GAHC 2K50A 3AQQA 4XYQA 3OWEB 4M8AA 5E4WC 2A6HC 4DV6Q 3P75A 2BCOA 4ZKCB 2F0SA 4OXPA 4OX9Q 4KV6A 3FVQA 4DR6L 3HOZB 3GTPH 1S5ED 1EYGA 1GUGA 2V1CC 1JICA 2K4KA 2AWNA 3KF8A 2K75A 3NENA 3MHBA 4DXFA 3GTLH 2EY2A 1D8LA 4BXXG 2JK8A 2E2HH 4BY7H 1SJHD 3J81i 2L15A 1QNUA 3I4NB 4A3BG 3F8TA 3EFXD 1CHQD 2F4VQ 3SGIA 1Q86C 3HOVB 2RHQB 3E9HA 3ITPA 2CH4W 4CJ1B 5LMUQ 5CGKA 1G2TA 5BN4A 2M00A 3GTOB 3A8JE 4K0KL 2QEJC 2IT1A 2KVMA 4AQYL 2ZJQA 1G2SA 2L0CA 3KF8B 3GD7A 1AZQA 4LFCL 1KAAA 2ID0A 4FVMA 1I6VC 4JI2L 2N78A 5C3WA 1G6ZA 2PZUA 1GOZA 2K28A 1K8AC 1C7YA 5D65A 1XPUA 3H3VI 3HOUH 3PMFA 1WTPA 3RUZA 3GTMH 4GS3A 1JMCA 4LNQA 1A3UA 2K5VA 4TRDA 4LFBQ 2B2WA 3S24A 1GJXA 3SR1A 5JJKA 2JE6I 3WWVA 1IKLA 3KLRA 3I4OA 1SJED 5JAVA 2AWOA 1MKHA 1Q7YC 4I65A 1IYVA 1SMYD 2JEAI 2RCFA 5EAYA 1SN8A 1LTRD 1LT4D 4MTNA 3LNNA 5T1GA 1VQIA 5FO8B 4R4TA 4GOPC 2YU9H 2XWBB 3OMCA 2L9HA 2IX1A 3KK7A 1Q1BA 4QIWE 2Q8IB 1QB5D 4ZLTF 4X6AH 2RDGA 4B3SL 3D6WA 2NB0A 1QZGA 3L2PA 1XTCD 3TQYA 2XVSA 4K0KQ 1TWCH 4A3CH 5DM73 3J80c 1UUPA 4X3TA 1VQMA 1S5BD 2OQ0A 4TKOB 1KDBA 4LFBL 2WKDA 2RKSA 4K2LA 4O2DA 4LF6Q 1TWHB 4ZYSA 3TRZA 3V96A 2DN8A 2QDLA 4YWLA 4IUPA 4KN4C 4JI2Q 3CCMA 5FLMG 2E2JB 3FKIH 1AFPA 4QL5A 1U4MA 4A3EB 5TSSA 2G5DA 4UPAA 3RZDB 1B7YB 3DM3A 4AYBE 2E2IB 4P72A 2HHHQ 3CW2C 2NZOA 2NYZD 5FOBB 3U58A 5J39A 2OXPA 1WTVA 4YHHL 3K81C 3NP8A 5NUCA 1I50H 4HJ8A 2HIVA 4ZRZA 3MAQA 1SEBD 4E6IA 3NE5B 4L5SA 1X65A 2YV5A 1DOMA 3MXPA 4N9TA 4NXNQ 4OO1I 3AEVA 1NMFA 1WTWA 3F2UA 1D1IA 2MQHA 4IURA 4DV1L 1MBYA 4JBWA 1VQ7A 1TIID 2PCFB 5CMDA 4R9WA 4LF9Q 4C2MB 4ILWA 1Q12A 1IL8A 5EKLA 2H5XA 3JAMc 3DLLA 1FNUA 2QKIC 5DLQE 2VZAA 1EQVA 1VQOA 1HA6A 2K01A 4P2CB 1R4QB 2YU9B 1XPOA 3T51B 1Q8KA 1SYFA 2EJMA 4KN7C 3S17H 1ET9A 4FYDA 3DEPA 2A6HD 1XNQQ 3KFUA 4TVAB 4J8QA 4YCUA 5FK9C 5KNCA 1KD1C 2DJFC 3C46A 2PQAB 4ALPA 2K6AA 3H0GB 2NTTA 2XNAC 3KUPA 4XDXA 1B1ZA 4UAIA 3AB9A 4X66L 3CCJA 2IHEA 3EROA 2EXZA 4FF2A 2K33A 3SDZA 1O78A 4CKCA 5C4XG 4JBJA 1HHVA 2B63G 4LAAA 1FR3A 4FNFA 1PH4A 1CKOA 3HOUG 4RA8A 4B08A 3Q24A 1HTPA 1AEXA 4POFA 3CCQA 2OTLA 3BJUA 3IKJA 1LV9A 2RBMA 1EIFA 2DNEA 3A8IE 1K8GA 4DUZQ 1TS5A 5LMNQ 1O7IA 1YHBA 2M9VA 1HZ9A 3QG1A 1VQLA 2R92G 3NXWA 1V8QA 4P73A 5M5YH 3E5SA 3DM1A 4DV2L 2RF4A 3PSIA 5CV4A 2WAQG 2VNUD 3SVMA 1WCMH 2Q8TA 3PO3H 2PI2A 2NVYH 1N32Q 1V9PA 4B3RQ 4C56C 2LXJA 3FP9A 3K57A 2DY7A 4DK6C 3NK9A 4DV4L 3M4YA 1PTOH 3ND9A 2WIIB 4IUNA 2CQAA 5JVH3 3MEHA 3F1ZA 3HEJA 1BF4A 2JJQA 3A0JA 2QEXA 1EY5A 5JPNC 5H1SE 2JA8H 2EYJA 1KL9A 3D4RA 3W1GA 1F2LA 1PTOC 1HUMA 1I4PA 3CC2A 1LT3D 5DM63 1LTBD 3T16A 2F0IA 1QVFA 1YNJD 1G291 3M9BA 3GTGH 2V4DA 1FNVA 2JEBI 2SOBA 3BDLA 2CW0D 3SK5A 3CCUA 3R3OA 2B2TA 2R7ZH 4IPHA 3S16H 1D7QA 2BA1A 4I7AA 4LFAL 4RHRA 5EPKA 4LF4Q 1KLUD 4CDCC 1VQ9A 2N3SA 5C5LA 5D3DA 2L55A 1NY4A 4GNXA 4FXDA 2BA0A 1HPCA 2JA9A 3HOWH 3K58A 4NKLA 2F0GA 3W1BA 3I4LA 4YHHQ 1VQ4A 4NPSA 4AYBB 3J80L 4A3KH 4IFDH 2EYOA 3MC0B 4KHVA 4DAMA 4ODGA 1H9JA 4B3SQ 2Z9HA 2E74C 4IUUA 5D14A 4M1UB 5CV8A 3T1HL 1V1OA 5KIXA 3RMHA 4XQNA 1SLJA 2OF1A 4JK1C 3K7UC 5IYCG 4F7XA 4A3MG 4A3GG 4GKJQ 2BE5D 2VS1A 1GHJA 2ZTCA 2N49A 1QUQA 5J22A 4A3KB 2K5HA 3C2PA 1ZXTA 3CXCA 4AYBG 1N34L 2JA5H 1I3QH 4DR1L 4DV2Q 4G7HC 3BZDB 2E2HB 3R2IA 3DXJC 2KQ3A 4L63B 1VQ5A 3BVZA 2KA7A 2K05A 1BKBA 1RDPD 2B2UA 4DNTB 2H1EA 2DUDA 5I4DA 1K9MC 2X6GA 2WB1E 2PZTA 4AIMA 1CFMA 4C3JH 4JI7Q 5JEAH 5HGQA 3B6YA 1PRTB 2L5TA 4YCVA 2RDFA 5CC4A 2B39A 2D5DA 2RCNA 3UDFA 3V2TA 1X3QA 1VCIA 3I70A 1I94Q 4PQXA 1M1KC 1OXXK 1JOOA 1Y8OB 3K80C 2JA5B 5J3BA 3K7AB 2K1BA 1ML0D 5A2QL 3I4MG 3CQZB 4CJ0B 2I5LX 1K28A 1ZEQX 3TDQA 4DK3C 1V43A 5KNDA 4HJ9A 2WB1G 2HQLA 1N36Q 4JPBW 4PZ7A 3W5OA 2KOLA 1IHZA 1GUNA 1K83H 1EEID 2B29A 1MJEA 4ID6A 1XJVA 1TS2A 5C3EB 2N88A 3K7AH 2KCMA 3LX0A 4Y7NH 4EX5A 1TWGH 4CJ2C 1IL2A 1SYDA 1VQBA 5I9OA 2VB3X 3R93A 3NWSA 4JI6L 1JWMD 1PLFA 5IYDH 2F3IA 1U9RA 1HFGA 1K83B 4XT3B 1V1QA 2HCIA 4FF3A 1STAA 1L0XB 1QE6A 4QCLA 2R93H 1TXYA 1DYQA 1TY0A 2F0QA 3T1YQ 2NUCA 5HGTA 3MXNB 3PO2G 1PFBA 1LUZA 1A3TA 4GLVB 3K0YA 5E4XA 4DR5L 2FJ2A 3L7ZC 4GN4B 1UWVA 2I07B 4X3KA 5JJZA 3OHXC 4DUYQ 1Z9FA 1TS3A 5LL6X 1K8MA 5IP9G 2CQOA 4A75A 1RIPA 4C3JB 1D1KA 1QVGA 4DAPA 4GKJL 2WP8J 5HY6A 1HNWQ 4KHPQ 1U5KA 2BDOA 2ATWA 1YNJC 2R61A 4C3HH 2OCEA 5JPMC 1NCVA 2RDHA 4EVOA 3UDIA 4ZUIA 1C0AA 2MFIA 5C0XI 1C4QA 1JJCB 4LF6L 5KYLA 3SK6A 4N9PA 4OO1H 1JOQA 3D0FA 4DNIA 3HP3A 4DR6Q 3M85A 1NJIC 1CZGA 5FJ8G 2UXDQ 5C4ZA 3EBEA 1PFNA 1R4PB 4PMBA 1MGSA 2SNMA 4OIJA 4UP9A 1C8CA 3WOEA 3AYHB 4L5TA 4JI8Q 2D62A 4NXNL 1F9QA 4DAYB 5IYCH 4R8IA 2N8NA 2F0HA 5M3FH 2L4NA 3ERQA 3LWUA 2LSSA 4B9XA 3CCSA 1N8RC 3TS2A 1LO5D 4HIDA 1IYJB 1KRTA 5DEHA 3M3YH 2PNHA 1TVXA 2KECA 2LS01 2F0KA 4KY5A 4KI0A 4LF8Q 1ILQA 4BY1G 2EJGC 1D2BA 1IBKL 1LM0A 1HNZQ 3DWPA 1BCPF 4JI5Q 1PTOD 5FKAC 3H0GH
chains in the Genus database with same CATH topology
4C1NK 4DN4M 4RFBA 5ELEA 1Z47A 4GZYC 4HR7B 5C0XJ 4J1MA 2QDBA 1HQRD 1W6JA 4BA2I 5G3LD 4NP5A 1I6HB 3TSSA 2R3ZA 4C1NI 1EEFD 1BOSA 3E0JA 1QJOA 1AZPA 5FLXE 4IUVA 1PZID 3CU7A 4IALA 5IGDA 2F0JA 1W6KA 1RCVD 2WACA 4DXGA 2MUYA 3PUVA 4DF7A 1DXMA 2JA7B 3PIO3 4C3IG 1Z7TA 4KD3A 2EJFC 1EOTA 1EU3A 4DAYA 1AN8A 5F2DA 1D5XC 2B63B 3S1QB 2A6EC 3OSOA 3X3MA 3M3YB 1HRJA 1E2ZA 4WRDA 1LT6D 1Z6HA 4ZUJA 1STBA 5I9PA 1GXDC 3NPPA 4KJOA 1WD0A 1VMPA 1PYWD 2EYFA 4G7OC 4CKEA 2TMPA 1KNAA 2TSSA 5JOBA 4KKUA 1G91A 2WKCA 3U9SA 1TU2B 1GHKA 4C3HB 1TKWB 2NVQB 3NTIA 2M2LA 1PTOF 2EZVA 3MXNA 4HSPA 5CORA 1ET6A 1PXUA 3H91A 3P7JA 4MHEA 2WINB 1YNND 2MHVA 5T1IA 2NVXB 1STGA 4J6HA 3CHBD 2AQ2B 1GUOA 2R93B 4A93B 1TWGB 1VF5C 3A7AB 1A15A 4CGYB 3W2DA 1F2ZA 3HOXB 3DUZA 3S1NB 1VDZA 2ZXRA 1Q1EA 1S4ZA 2FHTA 5ELFA 1I4GA 3FKIB 3T53B 2IPKD 1BO0A 5C3XA 3GV6A 5M3MB 5JVG3 4K5XA 4FF1A 2B2VA 3TP6A 3CKIB 5FLXL 2K5QA 3VYTA 3L3OC 3M4OB 2F0PA 2FFKB 3I90A 1SMYC 4FO2A 4BS9A 1XYIA 3VYSA 1F9PA 5K36G 5EBCA 1CI3M 1M4VA 2ZT9C 3P1HA 1B53A 1RF2D 2Z4HA 1SNPA 1H9RA 3DMUA 4L8JA 2K5WA 3RD4A 1A2TA 1SBBB 3H94A 5M3FB 5CV5A 3IAYA 2IW3A 3SHLA 4IFDG 1FYCA 1HXYD 4ME5A 2KHSA 1LTTD 4K2KA 3I4MB 1D5MC 1EIGA 3HOUB 3OOCA 2PW5A 1IKMA 3VYRA 3CRKC 3QO2A 5LL6S 3HZXA 2VXWA 1RODA 1TT2A 1II3A 1DZ1A 3I73A 2CHBD 3RZOB 1SE2A 1LLRD 3MZ5A 3GTPB 3GP7A 1J9OA 1DOLA 3I91A 4BY1B 4X3UA 4PNYA 2G9DA 4PMCA 4ULLA 3K5OA 5I6WA 4C3HG 4C3IB 3BDCA 1B2TA 3FPUB 4RGOS 1XWEA 3GTKB 3KBGA 2B2TC 2WV6D 5AFWA 3HG9A 4H7BA 5C6AA 3OIQA 3S14B 1PRTF 2IJ0A 1MI2A 3EA6A 3PUYA 5M5XB 3DWQA 1BNZA 2K32A 1LT5D 4ZQ3A 1F9RA 2XRQD 1I4RA 5HURA 4YIJA 2VUMB 5CBEE 4WJWA 1MSHA 1JCKB 3GV3A 4K5VA 4C3JG 5M9OA 2E2DC 5CYUA 2O5IC 2DNCA 1AP0A 3TBIB 1DCZA 4RGTA 2IX0A 3MFGA 1BCPC 1SE4A 4KJNA 1VF7A 2B2UC 2AQ3B 1B4OA 2BDNA 5EQ0A 3FDTA 1RTNA 3K5MA 1QOHA 2DY8A 3IFDA 5I6YA 1C48A 1IYUA 3IFTA 4DK1A 3SK4A 2CVRA 3H3VC 4IFDJ 2LFNA 1Y1WB 3ZYYX 4XQQA 1ICWA 3J81E 2A69D 2NTSA 4A3FB 1ESRA 1X3PA 2JYOA 2F0EA 2B2WC 2J0TD 2XSCA 1CM9A 1EWCA 1EYCA 1RTOA 4XQJA 1NR2A 1JQYD 2SNSA 3A54A 3DEOA 3M7NA 4V190 3R8BA 3S9WA 1U4PA 1R9TB 1IW7C 4S3SA 3TZUA 1S5FD 4RAUC 4Q5VA 5C5MA 4RCNA 1L0YB 2XWJB 3IL8A 3FPPA 1EYAA 2RA4A 4DU9A 1D5ZC 4ZAIA 4LJZC 1LTID 1JC7A 3P20A 5G3LF 4KKTA 4ZK9B 1O7YA 1SNDA 4KY7A 2C5CA 2H4OA 1ZYRC 4OHJA 2BE5C 5JEAJ 1EU4A 1NAPA 3D6CA 2XRSD 3KBXA 2PZWA 2JXMB 3MTSA 1EQTA 2FMMA 3PV0A 4IN3A 5CV9A 1OO9B 1YNNC 3NWTA 3Q23A 1WCMB 3PO3B 2YYZA 3TMEA 2EOTA 4H44C 1Q3LA 3I3CA 3SXHA 3S1RB 3Q22A 2B8FA 1B3AA 1EY7A 3VR3A 1HCZA 3MWYW 2F3VA 3NBHA 2J4XA 1OXVA 2IWHA 3HOYB 1T5EA 3NQTA 5FO7B 1KNEA 1ENCA 3BYTB 3C1EA 5BN3A 2L11A 4NW2A 3TN2A 3GTLB 1F9SA 3K5LA 3JAME 1ENFA 4QMGA 5C44B 2WAQB 5EKKA 1DOKA 4IUTA 4F87A 4HMIA 5C4XB 4EQPA 4HCEA 4EGVA 2F0MA 3C1FA 4HSVA 2E75C 4XYOA 2J7ZA 1EL0A 5EJWA 1EY6A 3RLFA 1BCPD 4IFDI 1F2YA 2LMCB 1CTMA 1I4QA 1UEAB 4XIGS 5JEAG 2NN6I 3FMCA 4UDUC 2HDLA 4LK1C 1Y1VB 1BQQT 4CKBA 3QJYA 4HEDA 3MXUA 1PZKD 4RGNA 1I4XA 1D6EC 1T5XD 3WOFA 4A3MB 1HFNA 5I2YA 3DHQA 5CV7A 2NWGA 2JA6B 2G9HD 1H9MA 2RVLA 1NSNS 3BVMA 2EPBA 5IT9L 1PDQA 2F0LA 3J80E 3V05A 5IGGA 5ELBA 1PMRA 4KY6A 3BG3A 2EY1A 5EKIA 4KK7A 4BY7B 2F0WA 2PYKA 1VMCA 1SXTA 4MIUA 4TQUS 2R6GA 3S2DB 3PUZA 5EGTA 1UNSA 3VA7A 3HOWB 4L6TB 2MGSA 3NTHA 4X3SA 1ZKOA 3PIP3 4EQOA 3J81L 4HAEA 5FO9B 3GTMB 2F0UA 2Z4IA 2KUMA 3I72A 1SNQA 3N6RA 4DNRB 3BVGA 4FXGC 1UAPA 1ONLA 2HUGA 2Z8LA 5IIFA 4FP5D 4Y7NB 4QIWB 1TR5A 4XT1B 1MSGA 2QF7A 1A6XA 3NTKA 2Z1CA 1GUSA 4QF4A 3K59A 2O5JC 2IX3A 1OXUA 1EYDA 1LTGD 2RSOA 3SEBA 1NR4A 3A56A 2C9OA 4V0BA 2O2LD 3GTQB 1RHPA 3HGBA 5A2QE 1PZJD 5KNBA 5IODA 3PUWA 1B9MA 2SEBD 5CR3A 4G7ZC 1IW7D 3HKZB 1SAPA 2VB2X 1S5CD 2EY5A 4RCOA 4A3BB 4K8JA 2ICEC 2ENBA 5IGCA 4HTHA 2B2YA 2QCPX 2PQEA 1TWCB 4U673 2QILA 4H13C 1FNWA 4H0LC 5IGEA 3Q6SA 4BBSB 1O7LA 1GUTA 2KEEA 4Z9CB 4F8MA 1H9KA 1OXTA 3G6JB 3HRZC 5C4JB 3DWAA 1WTXA 5C0XG 2EE1A 1H9SB 1CQVA 1JE4A 5A35A 1BBXC 4RKBA 2A69C 2JA8B 4F88A 1B9NA 3C3LA 1I3QB 4TSSA 2B2VC 3OW7A 3A8KE 4KKSA 3T56B 5ISRA 3NUCA 5KRUA 1PRTC 3J7AF 3HS0C 3PO2B 1HTLD 4A3IB 2A73B 1FGBD 1SDFA 1JWUD 1EWHA 1KLGD 1CT1D 2CW0C 1MD2D 4ABNA 2N55A 1RKNA 3MA2B 4QUFA 1BXTA 4RKLA 4FF4A 2NZ1D 5C4HA 5E1FA 1WD1A 2PMZB 1J8IA 5E3FA 4BBRB 2JP1A 2L1BA 1KDCA 3JAML 1O7ZA 1LABA 2MPMA 2L12A 4K5WA 4DAVA 2A74C 2OEOA 2B8GA 1LACA 1SSOA 4IZ8A 4Q0FA 1STYA 1V1PB 4OIKA 2X69A 2HQEA 3GTGB 4KMUC 3J7YW 3H09A 1CA6A 1XXGA 5M5WB 2R7ZB 5KYIA 5IGBA 4WORA 5COYA 2A68D 5M5YB 3G7LA 1SYCA 5J1ZA 3Q0AA 2AUKA 3NQIA 4I7ZC 4K6DA 1DONA 3CRLC 1GUWA 2PPBC 3EVQA 4KD4A 5CV6A 4K8IA 4A3DB 2IL8A 2NVYB 1JWSD 4XXEA 2OT2A 3QWNA 1QWYA 1Y8NB 2FMCA 2WB1B 4QUCA 1H9SA 4K14A 1WTOA 1Q8IA 2XIWA 5IT9E 5IOCA 1LTAD 1HA5A 3R2TA 3N52A 1STHA 1EZ8A 5IGFA 1SNMA 1A3VA 2EYLA 3GQBA 3D31A 1E2WA 1EY4A 4BA1I 3VR6A 4PMWA 2MJ8A 1E2VA 1STEA 1SFOB 3D8GA 2EVBA 4CHTB 3URYA 1EFID 2F0OA 1EIHA 3TP5A 5BN5A 1JR0D 1JORA 2F3WA 2AUJD 3UI2A 3VYUA 3BDOA 3NBIA 2A68C 3KLSX 2AQ1B 2EDGA 1QCBD 3U9OA 5CBAE 3H6MA 3D3RA 3QOLA 4O1NA 3QOJA 1AW7A 1PRTD 3SE0A 3S2HB 3PUXA 4KTAA 4QB4A 4PV1C 1TY2A 5LHY1 2RQXA 3ND8A 2A5HA 4WFN3 1M8AA 2NN6G 1K8OA 1WTRA 2D2CC 2RSNA 1I50B 1STNA 3K5NA 3OIPA 2ZXOA 1G8ZD 2F0VA 2EY6A 2MP1A 2K5DA 3MFYA 4IQZA 3S1MB 1BDOA 1TWAB 5EPLA 3VR4A 2K7VA 4HMJA 1B44D 4RGMA 4ZKBB 4NDXA 5I2XA 2F1MA 4RWSC 1E0BA 2XN9C 3M7GA 2SDFA 1QG7A 2EYHA 5ELCA 1KABA 1TQOA 3A55A 3E6ZX 3TZDA 1F2MA 3FRPB 2FINB 2Y0SB 4IUQA 1DJRD 3AMUA 3W3AA 2ZXPA 1SNCA 5C0XH 4NMZA 2R92B 2B2YC 3VR5A 5DNFA 4HCSA 2JSOA 2KCCA 1U4RA 1CK1A 3SK8A 4DGZA 4CBVA 1SE3A 1Y8PB 2KEDA 2PO4A 1A2UA 2LKVA 1ILPA 2HCCA 1JOKA 3A7LA 4K6LA 1RJTA 2K03A 4OO1G 3QB3A 1PFMA 1TWFB 4BWGB 5ELDA 2F0FA 3VR2A 3T4AC 3KLSA 4RH6A 3O13A 1Y69U 3TP8A 2F0DA 2I46A 4FXKC 2K04A 2EYMA 1EY8A 1EZ6A 3S17B 4B9WA 2LY7A 1WVLA 1NUCA 4XTCS 5KEEA 3K6OA 3OWFA 2KJXA 2NVTB 4RHSA 2HDMA 3GTJB 5DAUA 1SNOA 1CHPD 1CZWA 3WDNA 1EY0A 2F4IA 3EQLC 5K5PA 2BOSA 1XX8A 1FD7D 3GO5A 2EYPA 1QNKA 3D4DA 1OXSC 3D4WA 3EJIA 4OGQC 2NN6H 4KHZA 4LMQD 4G57A 3MXGA 5EBDA 2NBFA 1ENAA 1QILA 1I4HA 2Q8RE 2F03A 4DA2A 1U4LA 1ESFA 1DD2A 2X6LA 1BCPB 3OMGA 1SYBA 5D3IB 1B50A 2F0NA 3OPOA 2O4XA 1Q90A 3T13A 1HUNA 2D9UA 2KCNA 3ONAB 3J7AV 3FEWX 4HN7A 1BUVT 1RD9D 1CQFA 1O80A 1X32A 2ICIA 5EPJA 3MVVA 3BYYB 2A6ED 4A3JB 1KTKA 1JB3A 3L9AX 4OL7A 5K36H 1SYEA 4U68A 2GA4B 1EY9A 4R8NA 3I8ZA 1CA5A 3NHHA 1PTOB 1TS4A 1HQMC 2E76C 4EQNA 3QIAA 4A3GB 1WTQA 1SYGA 3LWEA 1F77A 2PW7A 3TP7A 1BR9A 4DK0A 3X3NA 1ZYRD 5KGUA 4O42A 1S5DD 3S15B 3VA5A 4DFAA 2F0TA 1KDAA 1LTSD 3NSWA 3S16B 1DM0B 4G4KA 1V1PA 4MN3A 3BS1A 3AU7A 2PNRC 4XYQA 3OWEB 4M8AA 5E4WC 2A6HC 3P75A 2BCOA 4ZKCB 2F0SA 4KV6A 3FVQA 3HOZB 1S5ED 1GUGA 1JICA 2AWNA 3KF8A 3MHBA 4DXFA 2EY2A 1SJHD 1QNUA 3I4NB 3EFXD 1CHQD 3HOVB 3ITPA 4CJ1B 5CGKA 1G2TA 5BN4A 2M00A 3GTOB 3A8JE 2QEJC 2IT1A 2KVMA 1G2SA 2L0CA 3GD7A 1AZQA 1KAAA 2ID0A 4FVMA 1I6VC 5C3WA 1G6ZA 2PZUA 1GOZA 2K28A 5D65A 3PMFA 1WTPA 3RUZA 1A3UA 4TRDA 2B2WA 1GJXA 3SR1A 2JE6I 1IKLA 3KLRA 1SJED 5JAVA 2AWOA 4I65A 1IYVA 1SMYD 2JEAI 1LTRD 1LT4D 5T1GA 3LNNA 5FO8B 2XWBB 3OMCA 2L9HA 2IX1A 3KK7A 1Q1BA 2Q8IB 1QB5D 4ZLTF 2RDGA 3D6WA 2NB0A 1XTCD 2XVSA 5DM73 1UUPA 4X3TA 1S5BD 4TKOB 1KDBA 2WKDA 2RKSA 4K2LA 1TWHB 4ZYSA 3V96A 2DN8A 4IUPA 4KN4C 2E2JB 1AFPA 1U4MA 4A3EB 5TSSA 3RZDB 2E2IB 2NYZD 5FOBB 5J39A 2OXPA 1WTVA 3NP8A 5NUCA 4ZRZA 3MAQA 1SEBD 4E6IA 3NE5B 1DOMA 3MXPA 4N9TA 4OO1I 1WTWA 3F2UA 1D1IA 4IURA 1MBYA 4JBWA 1TIID 2PCFB 5CMDA 4R9WA 4C2MB 4ILWA 1Q12A 1IL8A 5EKLA 1FNUA 2QKIC 1EQVA 1HA6A 2K01A 4P2CB 1R4QB 2YU9B 3T51B 1SYFA 2EJMA 4KN7C 1ET9A 4FYDA 3DEPA 2A6HD 4J8QA 5FK9C 5KNCA 3C46A 2K6AA 3H0GB 2NTTA 2XNAC 3KUPA 4XDXA 1B1ZA 4UAIA 3AB9A 3EROA 2EXZA 4FF2A 2K33A 3SDZA 1O78A 4CKCA 1HHVA 4LAAA 1FR3A 4FNFA 4RA8A 4B08A 3Q24A 1HTPA 1AEXA 3IKJA 1LV9A 2RBMA 2DNEA 3A8IE 1TS5A 2M9VA 3QG1A 3NXWA 1V8QA 3E5SA 3DM1A 5CV4A 2VNUD 3SVMA 2Q8TA 4C56C 3K57A 2DY7A 3NK9A 3M4YA 1PTOH 3ND9A 2WIIB 4IUNA 2CQAA 5JVH3 3MEHA 1BF4A 3HEJA 1EY5A 5JPNC 2EYJA 3D4RA 1F2LA 1PTOC 1HUMA 1I4PA 1LT3D 5DM63 1LTBD 3T16A 2F0IA 1YNJD 1G291 2V4DA 1FNVA 2JEBI 2SOBA 3BDLA 2CW0D 3SK5A 3R3OA 2B2TA 2BA1A 4RHRA 5EPKA 1KLUD 5C5LA 5D3DA 2L55A 4FXDA 2BA0A 1HPCA 3K58A 4NKLA 2F0GA 3I4LA 4AYBB 3J80L 4IFDH 2EYOA 3MC0B 4KHVA 4ODGA 1H9JA 2E74C 4IUUA 5D14A 4M1UB 5CV8A 1V1OA 5KIXA 3RMHA 4XQNA 2OF1A 4JK1C 4F7XA 2BE5D 1GHJA 5J22A 4A3KB 3C2PA 1ZXTA 4G7HC 3BZDB 2E2HB 3R2IA 3DXJC 2KQ3A 4L63B 3BVZA 2KA7A 2K05A 1RDPD 2B2UA 4DNTB 2H1EA 5I4DA 2X6GA 2PZTA 1CFMA 5JEAH 1PRTB 2L5TA 2RDFA 5CC4A 2B39A 2D5DA 3V2TA 1X3QA 1VCIA 3I70A 4PQXA 1OXXK 1JOOA 1Y8OB 2JA5B 3K7AB 2K1BA 1ML0D 5A2QL 3CQZB 4CJ0B 1ZEQX 3TDQA 5KNDA 1V43A 2KOLA 1IHZA 1GUNA 1EEID 4ID6A 1TS2A 5C3EB 2N88A 3LX0A 4CJ2C 1SYDA 5I9OA 2VB3X 3R93A 3NWSA 1JWMD 1PLFA 1U9RA 1HFGA 1K83B 4XT3B 2HCIA 4FF3A 1STAA 1L0XB 1QE6A 4QCLA 1DYQA 1TY0A 2F0QA 2NUCA 5HGTA 1PFBA 1A3TA 5E4XA 3K0YA 2FJ2A 3L7ZC 4X3KA 5JJZA 2I07B 3OHXC 1TS3A 5LL6X 1K8MA 4C3JB 1D1KA 4DAPA 2WP8J 2BDOA 1YNJC 2R61A 5JPMC 1NCVA 2RDHA 4EVOA 4ZUIA 5C0XI 1C4QA 5KYLA 3SK6A 4N9PA 4OO1H 1JOQA 3HP3A 3M85A 1CZGA 5C4ZA 1PFNA 1R4PB 4PMBA 1MGSA 2SNMA 4OIJA 1C8CA 3WOEA 2D62A 1F9QA 4R8IA 2F0HA 2L4NA 3ERQA 3LWUA 4B9XA 1LO5D 5DEHA 1TVXA 2KECA 2LS01 2F0KA 4KY5A 4KI0A 1ILQA 2EJGC 1D2BA 3DWPA 1BCPF 1PTOD 5FKAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QUF A;  2J7Z A;  3GV3 A;  5T1G A;  1EL0 A;  1QNK A;  5EJW A;  3R93 A;  2MJ8 A;  3IL8 A;  2M2L A;  4XT1 B;  3TZD A;  4DN4 M;  1MSG A;  3KUP A;  1PLF A;  2L9H A;  2FIN B;  2NZ1 D;  2RA4 A;  4LMQ D;  4IUQ A;  4XDX A;  5COR A;  1HFG A;  4UAI A;  1AP0 A;  3H91 A;  3P7J A;  4MHE A;  2HCI A;  4XT3 B;  1EIG A;  4MN3 A;  4ZAI A;  1WD1 A;  4ZLT F;  1QE6 A;  5T1I A;  1J8I A;  4IUU A;  2RSO A;  3D6W A;  1IKM A;  2JP1 A;  2L1B A;  1NR4 A;  3QO2 A;  1O7Z A;  5D14 A;  1EIH A;  2B2Y C;  2HDL A;  2MPM A;  1PFB A;  2L12 A;  5DNF A;  5E4X A;  2VXW A;  1HHV A;  1RHP A;  2FJ2 A;  2Q8R E;  4HCS A;  4X3K A;  5JJZ A;  2R3Z A;  1ROD A;  4ZK9 B;  4X3T A;  1U4L A;  1O7Y A;  4RA8 A;  5E4W C;  1U4R A;  3UI2 A;  1SAP A;  1DZ1 A;  1SSO A;  1A15 A;  1AZP A;  2B2U C;  2X6L A;  4HED A;  4ZKC B;  1B4O A;  1LV9 A;  4OIK A;  2X69 A;  1ZXT A;  2BDN A;  5EQ0 A;  3FDT A;  1RTN A;  2KED A;  1B50 A;  4IUP A;  4IUV A;  2DY8 A;  1NAP A;  3IFD A;  1JIC A;  1ILP A;  1CA6 A;  2B2Y A;  1HFN A;  5CBA E;  1J9O A;  2HCC A;  3KBX A;  1GUW A;  1HUN A;  1RJT A;  2D9U A;  1DOL A;  2K03 A;  2CVR A;  3Q6S A;  1U4M A;  1S4Z A;  2FHT A;  2NWG A;  3ONA B;  1PFM A;  3I91 A;  1EQT A;  3MTS A;  4X3U A;  2FMM A;  2RVL A;  3DM1 A;  2K05 A;  1NCV A;  2B2U A;  2EPB A;  2H1E A;  1PDQ A;  2EOT A;  5COY A;  2X6G A;  1BO0 A;  3SVM A;  2Q8T A;  2KEE A;  3G7L A;  1ICW A;  1O80 A;  1EOT A;  1Q3L A;  2NYZ D;  3I3C A;  3GV6 A;  1X32 A;  5EPJ A;  2DY7 A;  1WTV A;  2B2V A;  1M8A A;  4CJ1 B;  1WTX A;  1B3A A;  1ESR A;  5EKI A;  2EE1 A;  1G2T A;  3HP3 A;  1BF4 A;  1WTR A;  1B2T A;  1DON A;  1X3P A;  3FPU B;  2RSN A;  1JE4 A;  1PFN A;  1VMC A;  2B2T C;  2JYO A;  1MGS A;  2K04 A;  2KVM A;  3MWY W;  1G2S A;  4OIJ A;  5AFW A;  1BBX C;  1DOM A;  1X3Q A;  1HRJ A;  4U68 A;  1AZQ A;  2FFK B;  3I90 A;  1C8C A;  1F2L A;  2B2W C;  1WTW A;  2MP1 A;  1WVL A;  3F2U A;  1CM9 A;  1F9Q A;  1HUM A;  1XYI A;  2K28 A;  1G6Z A;  4IUR A;  1MI2 A;  2IL8 A;  1KNE A;  5D65 A;  4R8I A;  1F9P A;  1RTO A;  3I8Z A;  2K1B A;  1ML0 D;  2L11 A;  4NW2 A;  1CA5 A;  2B2V C;  3TN2 A;  2L4N A;  4CJ0 B;  5CMD A;  5EPL A;  4R9W A;  4QUC A;  1WTP A;  2MGS A;  1F9S A;  4X3S A;  1B53 A;  1IL8 A;  1NR2 A;  1WTO A;  2XIW A;  1BNZ A;  4ZKB B;  2B2T A;  1VMP A;  2HDM A;  3DEO A;  1WD0 A;  1TVX A;  1F9R A;  1WTQ A;  2KEC A;  2K01 A;  1HA6 A;  4RWS C;  4HAE A;  2KOL A;  1DOK A;  2B2W A;  3LWE A;  3N52 A;  2KUM A;  4IUT A;  5EPK A;  1ILQ A;  1U4P A;  1E0B A;  1IKL A;  1SDF A;  1KNA A;  2SDF A;  2N88 A;  2HUG A;  1QG7 A;  1XX8 A;  3DEP A;  5CBE E;  1G91 A;  4CJ2 C;  4HSV A;  1MSH A;  4RAU C;  4O42 A;  2N55 A; 
#chains in the Genus database with same CATH topology
 4DR4 Q;  4C1N K;  1H95 A;  4DN4 M;  2UXC L;  4RFB A;  2FXQ A;  5ELE A;  1Z47 A;  4GZY C;  5C44 H;  1B3Q A;  4HR7 B;  5C0X J;  4J1M A;  2QDB A;  1HQR D;  1W6J A;  4BA2 I;  1RL2 A;  5G3L D;  4NP5 A;  3JAM i;  1EUJ A;  1G6P A;  1I6H B;  3TSS A;  2YTX A;  4A3C G;  2UXD L;  3PF5 A;  2R3Z A;  4C1N I;  1EEF D;  1BOS A;  3E0J A;  1QJO A;  1IBM L;  2VY3 A;  2WAQ E;  1AZP A;  1A0I A;  4DR5 Q;  4PZ6 A;  2IY5 B;  5FLX E;  4IUV A;  4JI4 Q;  1PZI D;  3CU7 A;  1JJG A;  1KRS A;  4IAL A;  5IGD A;  2F0J A;  1W6K A;  1RCV D;  2WAC A;  3RLO A;  3STB C;  3J81 c;  1YI2 A;  4DXG A;  2MUY A;  3PUV A;  4DF7 A;  1DXM A;  2JA7 B;  3PIO 3;  1PH3 A;  1KIX A;  4C3I G;  2RHS B;  1Z7T A;  3KF6 A;  4KD3 A;  1J6Q A;  2EJF C;  3H0G G;  5GAD C;  1EOT A;  1EU3 A;  4A3I H;  1VQC A;  4DAY A;  2D0P A;  1AN8 A;  3H3V H;  5F2D A;  2I0Q A;  1BBU A;  1D5X C;  4MTK A;  3RN2 A;  2B63 B;  1W2B A;  3S1Q B;  2A6E C;  3OSO A;  3X3M A;  3M3Y B;  1HRJ A;  1CKN B;  1E2Z A;  4WRD A;  1LT6 D;  1YVC A;  1Z6H A;  3I4M H;  4ZUJ A;  3LGJ A;  1STB A;  4A3G H;  5I9P A;  1GXD C;  3NPP A;  4KJO A;  2ZTE A;  3RN5 A;  4LF9 L;  3UDX A;  2EXD A;  1WD0 A;  1VMP A;  1PYW D;  2EYF A;  1E1T A;  3CC4 A;  3A74 A;  4G7O C;  1VQH A;  1WJJ A;  4CKE A;  2TMP A;  2Q2T A;  1KNA A;  4JI4 L;  2TSS A;  5JOB A;  2BH2 A;  4NXM Q;  4KKU A;  3A5Z B;  1G91 A;  4BY7 G;  2WKC A;  4JCV E;  3U9S A;  1TU2 B;  1GHK A;  4C3H B;  4LF7 L;  1NBW A;  1TKW B;  3NTI A;  2NVQ B;  2M2L A;  1PTO F;  2EZV A;  2NZH A;  3MXN A;  4HSP A;  5COR A;  1ET6 A;  1PXU A;  3H91 A;  3HKS A;  3P7J A;  4MHE A;  2GVB A;  2WIN B;  1YNN D;  1GO3 E;  2D0O A;  2MHV A;  5T1I A;  2NVX B;  1STG A;  4J6H A;  3CHB D;  2AQ2 B;  1GUO A;  3KJP A;  4ME3 A;  2R93 B;  4A93 B;  2Z6K C;  1Q81 C;  1TWG B;  4JI1 Q;  1PH7 A;  1VF5 C;  2CWA A;  4AH6 A;  3A7A B;  2DGY A;  1ASZ A;  1A15 A;  4N8X 1;  4CGY B;  1PH2 A;  3W2D A;  5L37 A;  1F2Z A;  3U50 C;  3HOX B;  1GVP A;  4JI8 L;  1L1O B;  4JYA L;  3DUZ A;  3S1N B;  1VDZ A;  2OQK A;  2JA7 G;  2ZXR A;  3RLN A;  1Q1E A;  1S4Z A;  2FHT A;  5ELF A;  1I4G A;  3FKI B;  1Q82 C;  1VQP A;  3T53 B;  2IPK D;  1N34 Q;  1BO0 A;  5C3X A;  4IOC A;  5IP7 H;  3GV6 A;  5M3M B;  5JVG 3;  4K5X A;  5BR8 Q;  5C3E H;  4FF1 A;  2EQS A;  2B2V A;  3FHW A;  3TP6 A;  3CKI B;  3HKZ G;  5FLX L;  2E2J H;  4GKK L;  2K5Q A;  4O0A A;  4JI3 L;  3VYT A;  3L3O C;  3M4O B;  2F0P A;  2GVA A;  2FFK B;  3I90 A;  2QA4 A;  1SMY C;  5E7N A;  4FO2 A;  3GTK H;  4BS9 A;  1XYI A;  3VYS A;  4LF5 Q;  1F9P A;  3ICE A;  2KCT A;  4X65 L;  4A3J H;  2HHH L;  2E5L L;  5M3M G;  5K36 G;  5EBC A;  1CI3 M;  1M4V A;  2ZT9 C;  3P1H A;  1B53 A;  1RF2 D;  2Z4H A;  2ZJP A;  4LWC A;  1SNP A;  1H9R A;  3DMU A;  4L8J A;  2K5W A;  4LW1 A;  4OON A;  5M3M H;  3RD4 A;  4B3T Q;  1A2T A;  1SBB B;  3H94 A;  5M3F B;  1ICF B;  5CV5 A;  3CCR A;  3HOX G;  3IAY A;  4JI0 L;  1QUQ B;  2IW3 A;  3SHL A;  1PYS B;  2UUA Q;  2JA6 H;  4A3K G;  1VQ8 A;  4IFD G;  1FYC A;  1HXY D;  4ME5 A;  3RZO H;  3IRB A;  2KHS A;  1LTT D;  1GKH A;  5IE8 A;  4K2K A;  3I4M B;  1D5M C;  1EIG A;  3HOU B;  3OOC A;  2PW5 A;  4QQB X;  1IKM A;  3VYR A;  3CRK C;  3QO2 A;  4LFA Q;  5LL6 S;  2CWP A;  3HZX A;  2KHJ A;  4BBR G;  4GKK Q;  2VXW A;  4OEL B;  3ULL A;  4GOP A;  1HZA A;  1JB7 A;  1ROD A;  1TT2 A;  3S14 H;  1II3 A;  3G4S A;  1DZ1 A;  3I73 A;  2CHB D;  3RZO B;  1SE2 A;  1LLR D;  2A19 A;  3MZ5 A;  1J5E Q;  1IBL L;  4QY7 A;  1AE3 A;  3GDE A;  4YWM A;  3GTP B;  3S1N H;  3GP7 A;  1J9O A;  1N33 L;  1DOL A;  2NVQ H;  4R4I A;  3I91 A;  4BY1 B;  4X3U A;  4PNY A;  1GD7 A;  2G9D A;  4PMC A;  3NEL A;  3NEM A;  4ULL A;  1Y1V H;  5IYD G;  3K5O A;  3HOZ H;  5I6W A;  1VQK A;  3UE0 A;  4RG1 A;  4DV7 Q;  4A93 H;  1Y14 B;  4C3H G;  3OW2 A;  4C3I B;  3BDC A;  1B2T A;  3FPU B;  4RGO S;  1XWE A;  3GTK B;  3KBG A;  2B2T C;  2WV6 D;  4IOA A;  5AFW A;  2A8V A;  3HG9 A;  4H7B A;  5C6A A;  3OIQ A;  4DV0 Q;  5LMN W;  3S14 B;  1VQ6 A;  1PRT F;  2IJ0 A;  1MI2 A;  3EA6 A;  3PUY A;  5M5X B;  3DWQ A;  1BNZ A;  2K32 A;  1LT5 D;  3M4P A;  4ZQ3 A;  1F9R A;  2XRQ D;  1I4R A;  1YEZ A;  5HUR A;  4YIJ A;  4A3B H;  4ZCK A;  2GN5 A;  2CH4 A;  4JI5 L;  2VUM B;  1NTG A;  5CBE E;  1X3G A;  2CCZ A;  3ULP A;  4WJW A;  1MSH A;  1JCK B;  3GV3 A;  3K0X A;  4K5V A;  4C3J G;  3CCL A;  5M9O A;  4J15 A;  2E2D C;  5CYU A;  2O5I C;  3S2H H;  2DNC A;  1AP0 A;  3TBI B;  1DCZ A;  4RGT A;  3BZC A;  2IX0 A;  4A3D G;  3MFG A;  1BCP C;  1SE4 A;  4P75 A;  1WTH A;  4KJN A;  1VF7 A;  4QJF A;  2JQO A;  2B2U C;  3M4O H;  3J80 i;  2AQ3 B;  1B4O A;  1E24 A;  3G6E A;  2BDN A;  3G48 A;  5EQ0 A;  3FDT A;  1RTN A;  3K5M A;  1QOH A;  2DY8 A;  3IFD A;  3FKI G;  4JC0 A;  1HH2 P;  5I6Y A;  2ZJR A;  1C48 A;  1IYU A;  2E8G A;  2PMZ E;  3IFT A;  1UEB A;  4DK1 A;  3SK4 A;  2CVR A;  2R7F A;  2C35 B;  1PFS A;  3H3V C;  4IFD J;  2LFN A;  1Y1W B;  3ZYY X;  4XQQ A;  1ICW A;  3J81 E;  5BR8 L;  1R9T H;  2A69 D;  2NTS A;  4A3F B;  1X3F A;  2UXB L;  1ESR A;  4UHV A;  1L1O C;  1X3P A;  3J7Z C;  2CKZ B;  2JYO A;  4LUO A;  2R93 G;  1WOC A;  1VS0 A;  2F0E A;  2B2W C;  2J0T D;  2QW7 A;  2XSC A;  4LF4 L;  2JN4 A;  1BBW A;  1CM9 A;  1EWC A;  1EYC A;  4P71 A;  1RTO A;  4WJ3 M;  2I5M X;  4DR3 L;  4XQJ A;  1C9O A;  1L1O A;  3OTO Q;  1NR2 A;  1JQY D;  2SNS A;  3A54 A;  3DEO A;  1P16 A;  3M7N A;  2UUC L;  1NMG A;  4LF5 L;  4V19 0;  3R8B A;  3S9W A;  1U4P A;  1R9T B;  4JI0 Q;  1X56 A;  1IW7 C;  4S3S A;  3TZU A;  4IPG A;  1S5F D;  4RAU C;  4Q5V A;  5C5M A;  4HJ5 A;  4RCN A;  2KHI A;  1L0Y B;  2XWJ B;  3IL8 A;  3FPP A;  5FLX c;  4DPG A;  1XNQ L;  1EYA A;  2RA4 A;  4LUV A;  4DU9 A;  1D5Z C;  4ZAI A;  5C3E G;  4LJZ C;  1I6H H;  1LTI D;  1JC7 A;  3P20 A;  1I94 L;  1XTD A;  5G3L F;  4KKT A;  2UXB Q;  4ZK9 B;  1O7Y A;  1SFO H;  1SND A;  4PG3 A;  1SRO A;  4KY7 A;  2AHO B;  3TS0 A;  2C5C A;  2H4O A;  1ZYR C;  4BXX H;  4OHJ A;  2BE5 C;  2WFW A;  5JEA J;  3NBH B;  1EU4 A;  1NAP A;  3D6C A;  1QZH A;  2XRS D;  1S3O A;  1PH5 A;  4X62 L;  4B3R L;  2AMC B;  3KBX A;  2PZW A;  2JXM B;  2LXK A;  1UE7 A;  1K0S A;  3MTS A;  1EQT A;  2Y0S E;  2FMM A;  3TEH B;  3PV0 A;  4IN3 A;  5CV9 A;  1OO9 B;  1YNN C;  5IWA L;  1X3E A;  3NWT A;  3Q23 A;  1WCM B;  3PO3 B;  2YYZ A;  3TME A;  2EOT A;  4H44 C;  5C44 G;  2UUC Q;  1JJ2 A;  1Q3L A;  3I3C A;  3SXH A;  3S1R B;  1YJN A;  3Q22 A;  2B8F A;  1NNX A;  1L2F A;  1B3A A;  4POG A;  1EY7 A;  1JE5 A;  3VR3 A;  1HCZ A;  3CF5 A;  3MWY W;  1YHQ A;  2F3V A;  3NBH A;  2J4X A;  1OXV A;  2IWH A;  3HOY B;  4A3E H;  1T5E A;  3NQT A;  5FO7 B;  1KNE A;  1ENC A;  3BYT B;  3C1E A;  4X65 Q;  5BN3 A;  2L11 A;  4NW2 A;  3TN2 A;  3GTL B;  1VQD A;  3HFZ B;  5M5W H;  5M5X H;  3PQI A;  5LMU L;  1F9S A;  2E5L Q;  3K5L A;  3JAM E;  5GQO A;  3G71 A;  3TRE A;  2ALY B;  1ENF A;  4QMG A;  5C44 B;  3J7A 5;  2F4V L;  1A63 A;  3CPW A;  1Y1W H;  2WAQ B;  5EKK A;  1DOK A;  4DV1 Q;  4IUT A;  4F87 A;  4HMI A;  2VQF L;  5C4X B;  4JVZ A;  1FL0 A;  2K5N A;  1S40 A;  1VQE A;  4DUY L;  3JC6 6;  3HOY G;  2BH8 A;  4EQP A;  2R7Z G;  3CAM A;  4HCE A;  4EGV A;  2F0M A;  3C1F A;  4HSV A;  3I56 A;  1HNW L;  4HIK A;  1KAW A;  2E75 C;  4XYO A;  2J7Z A;  1EL0 A;  5EJW A;  3UE1 A;  1EY6 A;  3RLF A;  1BCP D;  4DR2 Q;  4IFD I;  1F2Y A;  2LMC B;  1CTM A;  1I4Q A;  1UEA B;  3HOW G;  4XIG S;  5IWA Q;  5JEA G;  2JA8 G;  1WI5 A;  2NN6 I;  2UUA L;  3FMC A;  4UDU C;  2HDL A;  2DJG C;  4C2M H;  4IO9 A;  4LK1 C;  5LMN L;  2MO1 A;  2KEN A;  2HD3 A;  1Y1V B;  3CMA A;  1BQQ T;  4CKB A;  3QJY A;  4HED A;  3MXU A;  1A8V A;  1PZK D;  4RGN A;  1I4X A;  1WFQ A;  1D6E C;  3VDY A;  1T5X D;  3WOF A;  3M4Q A;  1EOV A;  4A3M B;  1HFN A;  4L5Q A;  5I2Y A;  4YY3 L;  3DHQ A;  5CV7 A;  2NWG A;  1N33 Q;  2JA6 B;  2ES2 A;  2G9H D;  1H9M A;  2RVL A;  1NSN S;  3BVM A;  2EPB A;  2IHF A;  5IT9 L;  1PDQ A;  2F0L A;  3J80 E;  3V05 A;  1N36 L;  3ULJ A;  3PCO B;  5IGG A;  5ELB A;  1PMR A;  2YTV A;  4KY6 A;  3BG3 A;  4DV7 L;  2EY1 A;  5EKI A;  4BBS G;  5M3F G;  2ZTD A;  1HNX L;  4KK7 A;  4BY7 B;  2F0W A;  2PYK A;  1VMC A;  1SXT A;  2KBN A;  5IP7 G;  4Y52 H;  1HR0 W;  4MIU A;  1X54 A;  1TWH H;  4TQU S;  2XTI A;  2R6G A;  3S2D B;  1M90 C;  3PUZ A;  5EGT A;  1UNS A;  4CDF C;  3VA7 A;  5GAE C;  3HOW B;  4OX9 L;  1LYL A;  4GNX C;  4L6T B;  5C4J H;  2MGS A;  3NTH A;  4X3S A;  1ZKO A;  3PIP 3;  5IYB G;  4IPC A;  4EQO A;  3J81 L;  2UXC Q;  2XGT A;  4HAE A;  5FO9 B;  3GTM B;  2F0U A;  2Z4I A;  3HKZ E;  2KUM A;  3I72 A;  1SNQ A;  3N6R A;  4DNR B;  1K3R A;  3BVG A;  4FXG C;  1JT8 A;  1UAP A;  1ONL A;  2HUG A;  2Z8L A;  5IIF A;  4FP5 D;  4Y7N B;  3KOJ A;  2Z0S A;  4QIW B;  4JBK A;  5FJ8 H;  1TR5 A;  4XT1 B;  1MSG A;  2QF7 A;  1A6X A;  3NTK A;  5GRO A;  2Z1C A;  1GUS A;  4X64 Q;  4QF4 A;  3K59 A;  2O5J C;  2Q2I A;  3HOX H;  3L0O A;  2IX3 A;  4LF7 Q;  1OXU A;  1EYD A;  1LTG D;  2RSO A;  3HOV H;  3SEB A;  3ERS X;  1NR4 A;  1U0L A;  4RMF A;  3A56 A;  2C9O A;  4V0B A;  2O2L D;  3F2D A;  3GTQ B;  4A3M H;  1RHP A;  4B3T L;  3HGB A;  5A2Q E;  1PZJ D;  5KNB A;  5IOD A;  3PUW A;  1B9M A;  2SEB D;  5CR3 A;  4G7Z C;  1IW7 D;  3HKZ B;  1SAP A;  2VB2 X;  1YBY A;  4A3J G;  1S5C D;  2EY5 A;  4RCO A;  3I4N G;  4A3B B;  4K8J A;  2ICE C;  2ENB A;  5IGC A;  4HTH A;  1AH9 A;  2B2Y A;  2QCP X;  2PQE A;  1TWC B;  4U67 3;  2NVT H;  2QIL A;  4H13 C;  1FNW A;  4H0L C;  3U4Z A;  5IGE A;  3Q6S A;  4JYA Q;  4BBS B;  4JW0 A;  4R1J A;  1O7L A;  4DR7 L;  1GUT A;  1VQG A;  4BY1 H;  2KEE A;  4Z9C B;  4F8M A;  2UUB Q;  1UE5 A;  1H9K A;  1OXT A;  1SE8 A;  4X62 Q;  4NXM L;  1X9N A;  3G6J B;  3HRZ C;  5C4J B;  3DWA A;  1WTX A;  5C0X G;  4OWX B;  2EE1 A;  1H9S B;  1CQV A;  3GTJ H;  1PH9 A;  5JJI A;  1JE4 A;  1WCM G;  3PO3 G;  5A35 A;  1BBX C;  4RKB A;  2A69 C;  4DV3 L;  2JA8 B;  4OWT B;  3A5U A;  4DV0 L;  4F88 A;  4DR1 Q;  1CKM A;  1B9N A;  4JI3 Q;  3C3L A;  1I3Q B;  4TSS A;  2B2V C;  3PF4 A;  3OW7 A;  4A3L H;  4DUZ L;  3A8K E;  4LUZ A;  4KKS A;  3T56 B;  5ISR A;  3NUC A;  2MNA A;  5KRU A;  3CME A;  1Y1W G;  1PRT C;  2VQE L;  3HS0 C;  3J7A F;  4R4O A;  1N32 L;  3PO2 B;  1HTL D;  4DR4 L;  5JJL A;  4A3I B;  2A73 B;  2AKW B;  1PA6 A;  1XNR L;  1FGB D;  3EIV A;  1SDF A;  3HOY H;  1JWU D;  1EWH A;  1KLG D;  1CT1 D;  3AFQ A;  4A3I G;  2CW0 C;  1YNX A;  1HR0 Q;  1EQR A;  1MD2 D;  2P5Z X;  4ABN A;  3GTO H;  2N55 A;  3CCV A;  2R92 H;  4JV5 L;  1RKN A;  3MA2 B;  4QUF A;  3HOZ G;  1BXT A;  4RKL A;  1IBL Q;  4FF4 A;  5GAG C;  2NZ1 D;  5C4H A;  3S1Q H;  2I5H A;  2R7D A;  1CSQ A;  4B3M L;  5E1F A;  1WD1 A;  1KQS A;  1E7Z A;  2PMZ B;  1J8I A;  4LFC Q;  5E3F A;  4BBR B;  2JP1 A;  2L1B A;  1KDC A;  3JAM L;  1O7Z A;  1LAB A;  4A3E G;  2MPM A;  4P74 A;  2L12 A;  4GNX B;  4K5W A;  4HJ7 A;  2Y0S G;  4DAV A;  4DV6 L;  4A76 A;  2E2I H;  2A74 C;  2OEO A;  1B70 B;  2B8G A;  4A4I A;  1LAC A;  1SSO A;  4IZ8 A;  1XMO Q;  4Q0F A;  1STY A;  1V1P B;  4OIK A;  2X69 A;  2HQE A;  5FLM H;  3GTG B;  4IPD A;  3T1Y L;  2Q2H A;  4KMU C;  4EQ5 A;  3J7Y W;  3H09 A;  4DV5 L;  1CA6 A;  2YTY A;  2UU9 L;  1OTC A;  1XXG A;  5M5W B;  2R7Z B;  1VQN A;  4MNO A;  5KYI A;  5IGB A;  4WOR A;  5COY A;  2A68 D;  4JV5 Q;  5M5Y B;  3G7L A;  1SYC A;  4QGU A;  5J1Z A;  1XMQ Q;  3Q0A A;  3I7F A;  3PIP A;  4JBM A;  1VQJ A;  2AUK A;  3NQI A;  1J5E L;  2K14 A;  4I7Z C;  4K6D A;  1DON A;  1X55 A;  2F52 A;  3CRL C;  1GUW A;  2PPB C;  4HIM A;  3EVQ A;  4H02 A;  3H15 A;  4KD4 A;  1FJG Q;  5CV6 A;  4K8I A;  2B63 H;  3UDG A;  1PH6 A;  4A3D B;  2IL8 A;  2NVY B;  3E0E A;  1JWS D;  4XXE A;  1PVO A;  2OT2 A;  2VQE Q;  3QWN A;  1QWY A;  1Y8N B;  2FMC A;  2WB1 B;  4QUC A;  4UP7 A;  1H9S A;  1LTL A;  4K14 A;  1WTO A;  1Q8I A;  2XIW A;  5IT9 E;  3CD6 A;  2B3G A;  5IOC A;  5IT9 c;  1LTA D;  1PV4 A;  1HJP A;  1HA5 A;  2ZM6 Q;  3R2T A;  3KLW A;  1XMO L;  1HR0 L;  3N52 A;  2JA6 G;  1S72 A;  1STH A;  1EZ8 A;  1WYD A;  5IGF A;  1K0R A;  2Z6B A;  1SNM A;  1A3V A;  2EYL A;  3GQB A;  3D31 A;  1CSP A;  1E2W A;  1DGS A;  1EY4 A;  2MO0 A;  4BA1 I;  3VR6 A;  1XNR Q;  4YCW A;  4GN3 B;  4PMW A;  2MJ8 A;  1E2V A;  1STE A;  2HT1 A;  3EN2 A;  3RR5 A;  1SFO B;  1UE1 A;  3MEF A;  1YZ6 A;  1HZC A;  3D8G A;  1IBM Q;  2EVB A;  4CHT B;  3URY A;  4GLA C;  5C4X H;  1EFI D;  2F0O A;  1EIH A;  3TP5 A;  3STB D;  1JR0 D;  5BN5 A;  4R4Q A;  1JOR A;  2F3W A;  4LF8 L;  2AUJ D;  3UI2 A;  3VYU A;  4OWW B;  1MIU A;  3BDO A;  4DR2 L;  3NBI A;  1KXL A;  2A68 C;  3KLS X;  1FJG L;  2AQ1 B;  2EDG A;  1QCB D;  3U9O A;  5CBA E;  3AFP A;  3H6M A;  4HJA A;  3D3R A;  3QOL A;  4FDB A;  5IYB H;  1SMX A;  4O1N A;  3QOJ A;  1AW7 A;  1PRT D;  3SE0 A;  4DV5 Q;  3RZD H;  1L0W A;  3S2H B;  3PUX A;  4AQY Q;  4KTA A;  4QB4 A;  4PV1 C;  1TY2 A;  5LHY 1;  2ZM6 L;  2RQX A;  3ND8 A;  2A5H A;  4WFN 3;  1YJ9 A;  1I5F A;  1M8A A;  3RNU A;  2NN6 G;  1GM5 A;  1IXR A;  1K8O A;  1WTR A;  2D2C C;  4APV A;  1Y1V G;  2PI2 E;  2RSN A;  1I50 B;  1XMQ L;  1QVC A;  1STN A;  3K5N A;  2Q2U A;  3OIP A;  1HNX Q;  1BVS A;  1EWI A;  1YIT A;  2ZXO A;  1G8Z D;  2F0V A;  2EY6 A;  2MP1 A;  2NVX H;  2K5D A;  3MFY A;  4IQZ A;  2CFM A;  3S1M B;  1BDO A;  1TWA B;  5EPL A;  1YJW A;  3VR4 A;  2K7V A;  4HMJ A;  1B44 D;  3CQZ H;  3U4V A;  4RGM A;  2JA5 G;  2ASB A;  4ZKB B;  1E22 A;  4NDX A;  4KLK A;  5I2X A;  2F1M A;  4RWS C;  1E0B A;  1PHJ A;  2XN9 C;  3M7G A;  2SDF A;  1PH1 A;  3CC7 A;  1K73 C;  1QG7 A;  2EYH A;  2Z6K A;  1SR3 A;  5ELC A;  3HOV G;  1KAB A;  1TQO A;  3A55 A;  3E6Z X;  3TZD A;  1F2M A;  3FRP B;  2FIN B;  2Y0S B;  4IUQ A;  3ZJY C;  1DJR D;  4JOI A;  1HNZ L;  4UP8 A;  1W3S A;  3AMU A;  3W3A A;  4DKA C;  2ZXP A;  1P8L A;  4A93 G;  3CPF A;  1EQQ A;  1SNC A;  3S1R H;  4CDE C;  5C0X H;  4NMZ A;  4BBR H;  2R92 B;  2B2Y C;  3VR5 A;  5DNF A;  4HCS A;  1HZB A;  2JSO A;  2KCC A;  1U4R A;  1CK1 A;  3SK8 A;  4DGZ A;  3PGZ A;  4CBV A;  2OWO A;  4DR3 Q;  4JOI C;  4A3L G;  1SE3 A;  1Y8P B;  2KED A;  2PO4 A;  1E3P A;  1IBK Q;  1A2U A;  2LKV A;  4DV4 Q;  1ILP A;  3QR8 A;  1K3B C;  4JI1 L;  2HCC A;  1JOK A;  5ELO A;  3A7L A;  4K6L A;  1RJT A;  4GOP B;  3KDF B;  2JA7 H;  2K03 A;  1XPR A;  4OO1 G;  3QB3 A;  1PFM A;  3I4N H;  1TWF B;  4BWG B;  5ELD A;  1NE3 A;  2F0F A;  1T9H A;  3VR2 A;  1EFW A;  4A3F H;  3T4A C;  3KLS A;  4RH6 A;  1PH8 A;  3O13 A;  4C3I H;  1Y69 U;  3TP8 A;  1YHA A;  2F0D A;  2I46 A;  3PO2 H;  4FXK C;  2K04 A;  3E3X A;  2EYM A;  4DR7 Q;  1EY8 A;  4JG2 A;  1EZ6 A;  3S17 B;  4B9W A;  2LY7 A;  1WVL A;  1KHI A;  5AJ3 L;  1NUC A;  3KYH C;  4XTC S;  2EIF A;  5KEE A;  3K6O A;  3OWF A;  2KJX A;  2NVT B;  4RHS A;  4JI7 L;  2HDM A;  3GTJ B;  5DAU A;  1SNO A;  4MZ9 A;  3BZK A;  4IJL A;  1CHP D;  5IY0 A;  1CZW A;  3WDN A;  3KJO A;  1EY0 A;  2F4I A;  1VQA A;  1E1O A;  3EQL C;  5ELN A;  2BOS A;  1XX8 A;  5K5P A;  3T1H Q;  1FD7 D;  3GO5 A;  4GLX A;  3I2Z A;  2HIX A;  2PQA A;  1IZ6 A;  2VQF Q;  2EYP A;  4A3F G;  3E9I A;  1A62 A;  1QNK A;  3D4D A;  4CDD C;  1OXS C;  3D4W A;  3EJI A;  4OGQ C;  2NN6 H;  4OEM B;  4N8F A;  4KHZ A;  4LMQ D;  4G57 A;  3MXG A;  1X6O A;  1MHW C;  3J81 j;  5EBD A;  1G51 A;  2NBF A;  3GTQ H;  1ENA A;  1QIL A;  1I4H A;  2QGQ A;  2Q8R E;  2F03 A;  3S15 H;  4DA2 A;  3BU2 A;  1U4L A;  1ESF A;  4B3M Q;  1DD2 A;  2X6L A;  4X64 L;  1BCP B;  3OMG A;  1SYB A;  5D3I B;  4JI6 Q;  1B50 A;  1B8A A;  2F0N A;  3OPO A;  2O4X A;  1FGU A;  1Q90 A;  3T13 A;  1HUN A;  2D9U A;  2KCN A;  3ONA B;  4IJH A;  3OTO L;  3J7A V;  3FEW X;  4GN5 A;  4HN7 A;  1CKN A;  1BUV T;  1RD9 D;  1CQF A;  1O80 A;  4R4C A;  2UU9 Q;  2UUB L;  1X32 A;  2ICI A;  5EPJ A;  3MVV A;  1Q46 A;  1KC8 C;  3BYY B;  2A6E D;  4A3J B;  4UY8 C;  1KTK A;  1JB3 A;  1MJC A;  3Q8D A;  2VUM G;  3L9A X;  4OL7 A;  4BBS H;  4WJ4 A;  3K8A A;  5AJ3 Q;  3PIO A;  3F2C A;  1UE6 A;  5K36 H;  4YY3 Q;  1SYE A;  4U68 A;  3CCE A;  2GA4 B;  3KF6 B;  1CUK A;  1EY9 A;  4DV3 Q;  1YIJ A;  4R8N A;  2VW9 A;  2VL6 A;  1FVI A;  3I8Z A;  4YWK A;  2VUM H;  1CA5 A;  3NHH A;  1PTO B;  2K52 A;  5IP9 H;  1TS4 A;  3S2D H;  1HQM C;  2E76 C;  4EQN A;  3QIA A;  1AE2 A;  3CP0 A;  4L5R C;  4A3G B;  3ER0 A;  1WTQ A;  2OTJ A;  1SYG A;  3LWE A;  1TWF H;  1VQF A;  1N9W A;  3F2B A;  4PZ8 A;  2A1A A;  1SRU A;  4NB3 A;  1F77 A;  2PW7 A;  3TP7 A;  4X66 Q;  1BR9 A;  1TWA H;  4HIO A;  4DK0 A;  3S1M H;  3X3N A;  1ZYR D;  3KDF A;  5KGU A;  1EIY B;  4O42 A;  1S5D D;  1ASY A;  3S15 B;  3OYY A;  3VA5 A;  4DFA A;  2F0T A;  1KDA A;  1LTS D;  3NSW A;  3S16 B;  1DM0 B;  4G4K A;  1PYB A;  3I55 A;  1V1P A;  4MN3 A;  3BS1 A;  4A3D H;  4KHP L;  3AU7 A;  2PNR C;  5GAH C;  2K50 A;  3AQQ A;  4XYQ A;  3OWE B;  4M8A A;  5E4W C;  2A6H C;  4DV6 Q;  3P75 A;  2BCO A;  4ZKC B;  2F0S A;  4OXP A;  4OX9 Q;  4KV6 A;  3FVQ A;  4DR6 L;  3HOZ B;  3GTP H;  1S5E D;  1EYG A;  1GUG A;  2V1C C;  1JIC A;  2K4K A;  2AWN A;  3KF8 A;  2K75 A;  3NEN A;  3MHB A;  4DXF A;  3GTL H;  2EY2 A;  1D8L A;  4BXX G;  2JK8 A;  2E2H H;  4BY7 H;  1SJH D;  3J81 i;  2L15 A;  1QNU A;  3I4N B;  4A3B G;  3F8T A;  3EFX D;  1CHQ D;  2F4V Q;  3SGI A;  1Q86 C;  3HOV B;  2RHQ B;  3E9H A;  3ITP A;  2CH4 W;  4CJ1 B;  5LMU Q;  5CGK A;  1G2T A;  5BN4 A;  2M00 A;  3GTO B;  3A8J E;  4K0K L;  2QEJ C;  2IT1 A;  2KVM A;  4AQY L;  2ZJQ A;  1G2S A;  2L0C A;  3KF8 B;  3GD7 A;  1AZQ A;  4LFC L;  1KAA A;  2ID0 A;  4FVM A;  1I6V C;  4JI2 L;  2N78 A;  5C3W A;  1G6Z A;  2PZU A;  1GOZ A;  2K28 A;  1K8A C;  1C7Y A;  5D65 A;  1XPU A;  3H3V I;  3HOU H;  3PMF A;  1WTP A;  3RUZ A;  3GTM H;  4GS3 A;  1JMC A;  4LNQ A;  1A3U A;  2K5V A;  4TRD A;  4LFB Q;  2B2W A;  3S24 A;  1GJX A;  3SR1 A;  5JJK A;  2JE6 I;  3WWV A;  1IKL A;  3KLR A;  3I4O A;  1SJE D;  5JAV A;  2AWO A;  1MKH A;  1Q7Y C;  4I65 A;  1IYV A;  1SMY D;  2JEA I;  2RCF A;  5EAY A;  1SN8 A;  1LTR D;  1LT4 D;  4MTN A;  3LNN A;  5T1G A;  1VQI A;  5FO8 B;  4R4T A;  4GOP C;  2YU9 H;  2XWB B;  3OMC A;  2L9H A;  2IX1 A;  3KK7 A;  1Q1B A;  4QIW E;  2Q8I B;  1QB5 D;  4ZLT F;  4X6A H;  2RDG A;  4B3S L;  3D6W A;  2NB0 A;  1QZG A;  3L2P A;  1XTC D;  3TQY A;  2XVS A;  4K0K Q;  1TWC H;  4A3C H;  5DM7 3;  3J80 c;  1UUP A;  4X3T A;  1VQM A;  1S5B D;  2OQ0 A;  4TKO B;  1KDB A;  4LFB L;  2WKD A;  2RKS A;  4K2L A;  4O2D A;  4LF6 Q;  1TWH B;  4ZYS A;  3TRZ A;  3V96 A;  2DN8 A;  2QDL A;  4YWL A;  4IUP A;  4KN4 C;  4JI2 Q;  3CCM A;  5FLM G;  2E2J B;  3FKI H;  1AFP A;  4QL5 A;  1U4M A;  4A3E B;  5TSS A;  2G5D A;  4UPA A;  3RZD B;  1B7Y B;  3DM3 A;  4AYB E;  2E2I B;  4P72 A;  2HHH Q;  3CW2 C;  2NZO A;  2NYZ D;  5FOB B;  3U58 A;  5J39 A;  2OXP A;  1WTV A;  4YHH L;  3K81 C;  3NP8 A;  5NUC A;  1I50 H;  4HJ8 A;  2HIV A;  4ZRZ A;  3MAQ A;  1SEB D;  4E6I A;  3NE5 B;  4L5S A;  1X65 A;  2YV5 A;  1DOM A;  3MXP A;  4N9T A;  4NXN Q;  4OO1 I;  3AEV A;  1NMF A;  1WTW A;  3F2U A;  1D1I A;  2MQH A;  4IUR A;  4DV1 L;  1MBY A;  4JBW A;  1VQ7 A;  1TII D;  2PCF B;  5CMD A;  4R9W A;  4LF9 Q;  4C2M B;  4ILW A;  1Q12 A;  1IL8 A;  5EKL A;  2H5X A;  3JAM c;  3DLL A;  1FNU A;  2QKI C;  5DLQ E;  2VZA A;  1EQV A;  1VQO A;  1HA6 A;  2K01 A;  4P2C B;  1R4Q B;  2YU9 B;  1XPO A;  3T51 B;  1Q8K A;  1SYF A;  2EJM A;  4KN7 C;  3S17 H;  1ET9 A;  4FYD A;  3DEP A;  2A6H D;  1XNQ Q;  3KFU A;  4TVA B;  4J8Q A;  4YCU A;  5FK9 C;  5KNC A;  1KD1 C;  2DJF C;  3C46 A;  2PQA B;  4ALP A;  2K6A A;  3H0G B;  2NTT A;  2XNA C;  3KUP A;  4XDX A;  1B1Z A;  4UAI A;  3AB9 A;  4X66 L;  3CCJ A;  2IHE A;  3ERO A;  2EXZ A;  4FF2 A;  2K33 A;  3SDZ A;  1O78 A;  4CKC A;  5C4X G;  4JBJ A;  1HHV A;  2B63 G;  4LAA A;  1FR3 A;  4FNF A;  1PH4 A;  1CKO A;  3HOU G;  4RA8 A;  4B08 A;  3Q24 A;  1HTP A;  1AEX A;  4POF A;  3CCQ A;  2OTL A;  3BJU A;  3IKJ A;  1LV9 A;  2RBM A;  1EIF A;  2DNE A;  3A8I E;  1K8G A;  4DUZ Q;  1TS5 A;  5LMN Q;  1O7I A;  1YHB A;  2M9V A;  1HZ9 A;  3QG1 A;  1VQL A;  2R92 G;  3NXW A;  1V8Q A;  4P73 A;  5M5Y H;  3E5S A;  3DM1 A;  4DV2 L;  2RF4 A;  3PSI A;  5CV4 A;  2WAQ G;  2VNU D;  3SVM A;  1WCM H;  2Q8T A;  3PO3 H;  2PI2 A;  2NVY H;  1N32 Q;  1V9P A;  4B3R Q;  4C56 C;  2LXJ A;  3FP9 A;  3K57 A;  2DY7 A;  4DK6 C;  3NK9 A;  4DV4 L;  3M4Y A;  1PTO H;  3ND9 A;  2WII B;  4IUN A;  2CQA A;  5JVH 3;  3MEH A;  3F1Z A;  3HEJ A;  1BF4 A;  2JJQ A;  3A0J A;  2QEX A;  1EY5 A;  5JPN C;  5H1S E;  2JA8 H;  2EYJ A;  1KL9 A;  3D4R A;  3W1G A;  1F2L A;  1PTO C;  1HUM A;  1I4P A;  3CC2 A;  1LT3 D;  5DM6 3;  1LTB D;  3T16 A;  2F0I A;  1QVF A;  1YNJ D;  1G29 1;  3M9B A;  3GTG H;  2V4D A;  1FNV A;  2JEB I;  2SOB A;  3BDL A;  2CW0 D;  3SK5 A;  3CCU A;  3R3O A;  2B2T A;  2R7Z H;  4IPH A;  3S16 H;  1D7Q A;  2BA1 A;  4I7A A;  4LFA L;  4RHR A;  5EPK A;  4LF4 Q;  1KLU D;  4CDC C;  1VQ9 A;  2N3S A;  5C5L A;  5D3D A;  2L55 A;  1NY4 A;  4GNX A;  4FXD A;  2BA0 A;  1HPC A;  2JA9 A;  3HOW H;  3K58 A;  4NKL A;  2F0G A;  3W1B A;  3I4L A;  4YHH Q;  1VQ4 A;  4NPS A;  4AYB B;  3J80 L;  4A3K H;  4IFD H;  2EYO A;  3MC0 B;  4KHV A;  4DAM A;  4ODG A;  1H9J A;  4B3S Q;  2Z9H A;  2E74 C;  4IUU A;  5D14 A;  4M1U B;  5CV8 A;  3T1H L;  1V1O A;  5KIX A;  3RMH A;  4XQN A;  1SLJ A;  2OF1 A;  4JK1 C;  3K7U C;  5IYC G;  4F7X A;  4A3M G;  4A3G G;  4GKJ Q;  2BE5 D;  2VS1 A;  1GHJ A;  2ZTC A;  2N49 A;  1QUQ A;  5J22 A;  4A3K B;  2K5H A;  3C2P A;  1ZXT A;  3CXC A;  4AYB G;  1N34 L;  2JA5 H;  1I3Q H;  4DR1 L;  4DV2 Q;  4G7H C;  3BZD B;  2E2H B;  3R2I A;  3DXJ C;  2KQ3 A;  4L63 B;  1VQ5 A;  3BVZ A;  2KA7 A;  2K05 A;  1BKB A;  1RDP D;  2B2U A;  4DNT B;  2H1E A;  2DUD A;  5I4D A;  1K9M C;  2X6G A;  2WB1 E;  2PZT A;  4AIM A;  1CFM A;  4C3J H;  4JI7 Q;  5JEA H;  5HGQ A;  3B6Y A;  1PRT B;  2L5T A;  4YCV A;  2RDF A;  5CC4 A;  2B39 A;  2D5D A;  2RCN A;  3UDF A;  3V2T A;  1X3Q A;  1VCI A;  3I70 A;  1I94 Q;  4PQX A;  1M1K C;  1OXX K;  1JOO A;  1Y8O B;  3K80 C;  2JA5 B;  5J3B A;  3K7A B;  2K1B A;  1ML0 D;  5A2Q L;  3I4M G;  3CQZ B;  4CJ0 B;  2I5L X;  1K28 A;  1ZEQ X;  3TDQ A;  4DK3 C;  1V43 A;  5KND A;  4HJ9 A;  2WB1 G;  2HQL A;  1N36 Q;  4JPB W;  4PZ7 A;  3W5O A;  2KOL A;  1IHZ A;  1GUN A;  1K83 H;  1EEI D;  2B29 A;  1MJE A;  4ID6 A;  1XJV A;  1TS2 A;  5C3E B;  2N88 A;  3K7A H;  2KCM A;  3LX0 A;  4Y7N H;  4EX5 A;  1TWG H;  4CJ2 C;  1IL2 A;  1SYD A;  1VQB A;  5I9O A;  2VB3 X;  3R93 A;  3NWS A;  4JI6 L;  1JWM D;  1PLF A;  5IYD H;  2F3I A;  1U9R A;  1HFG A;  1K83 B;  4XT3 B;  1V1Q A;  2HCI A;  4FF3 A;  1STA A;  1L0X B;  1QE6 A;  4QCL A;  2R93 H;  1TXY A;  1DYQ A;  1TY0 A;  2F0Q A;  3T1Y Q;  2NUC A;  5HGT A;  3MXN B;  3PO2 G;  1PFB A;  1LUZ A;  1A3T A;  4GLV B;  3K0Y A;  5E4X A;  4DR5 L;  2FJ2 A;  3L7Z C;  4GN4 B;  1UWV A;  2I07 B;  4X3K A;  5JJZ A;  3OHX C;  4DUY Q;  1Z9F A;  1TS3 A;  5LL6 X;  1K8M A;  5IP9 G;  2CQO A;  4A75 A;  1RIP A;  4C3J B;  1D1K A;  1QVG A;  4DAP A;  4GKJ L;  2WP8 J;  5HY6 A;  1HNW Q;  4KHP Q;  1U5K A;  2BDO A;  2ATW A;  1YNJ C;  2R61 A;  4C3H H;  2OCE A;  5JPM C;  1NCV A;  2RDH A;  4EVO A;  3UDI A;  4ZUI A;  1C0A A;  2MFI A;  5C0X I;  1C4Q A;  1JJC B;  4LF6 L;  5KYL A;  3SK6 A;  4N9P A;  4OO1 H;  1JOQ A;  3D0F A;  4DNI A;  3HP3 A;  4DR6 Q;  3M85 A;  1NJI C;  1CZG A;  5FJ8 G;  2UXD Q;  5C4Z A;  3EBE A;  1PFN A;  1R4P B;  4PMB A;  1MGS A;  2SNM A;  4OIJ A;  4UP9 A;  1C8C A;  3WOE A;  3AYH B;  4L5T A;  4JI8 Q;  2D62 A;  4NXN L;  1F9Q A;  4DAY B;  5IYC H;  4R8I A;  2N8N A;  2F0H A;  5M3F H;  2L4N A;  3ERQ A;  3LWU A;  2LSS A;  4B9X A;  3CCS A;  1N8R C;  3TS2 A;  1LO5 D;  4HID A;  1IYJ B;  1KRT A;  5DEH A;  3M3Y H;  2PNH A;  1TVX A;  2KEC A;  2LS0 1;  2F0K A;  4KY5 A;  4KI0 A;  4LF8 Q;  1ILQ A;  4BY1 G;  2EJG C;  1D2B A;  1IBK L;  1LM0 A;  1HNZ Q;  3DWP A;  1BCP F;  4JI5 Q;  1PTO D;  5FKA C;  3H0G H; 
#chains in the Genus database with same CATH homology
 4C1N K;  4DN4 M;  4RFB A;  5ELE A;  1Z47 A;  4GZY C;  4HR7 B;  5C0X J;  4J1M A;  2QDB A;  1HQR D;  1W6J A;  4BA2 I;  5G3L D;  4NP5 A;  1I6H B;  3TSS A;  2R3Z A;  4C1N I;  1EEF D;  1BOS A;  3E0J A;  1QJO A;  1AZP A;  5FLX E;  4IUV A;  1PZI D;  3CU7 A;  4IAL A;  5IGD A;  2F0J A;  1W6K A;  1RCV D;  2WAC A;  4DXG A;  2MUY A;  3PUV A;  4DF7 A;  1DXM A;  2JA7 B;  3PIO 3;  4C3I G;  1Z7T A;  4KD3 A;  2EJF C;  1EOT A;  1EU3 A;  4DAY A;  1AN8 A;  5F2D A;  1D5X C;  2B63 B;  3S1Q B;  2A6E C;  3OSO A;  3X3M A;  3M3Y B;  1HRJ A;  1E2Z A;  4WRD A;  1LT6 D;  1Z6H A;  4ZUJ A;  1STB A;  5I9P A;  1GXD C;  3NPP A;  4KJO A;  1WD0 A;  1VMP A;  1PYW D;  2EYF A;  4G7O C;  4CKE A;  2TMP A;  1KNA A;  2TSS A;  5JOB A;  4KKU A;  1G91 A;  2WKC A;  3U9S A;  1TU2 B;  1GHK A;  4C3H B;  1TKW B;  2NVQ B;  3NTI A;  2M2L A;  1PTO F;  2EZV A;  3MXN A;  4HSP A;  5COR A;  1ET6 A;  1PXU A;  3H91 A;  3P7J A;  4MHE A;  2WIN B;  1YNN D;  2MHV A;  5T1I A;  2NVX B;  1STG A;  4J6H A;  3CHB D;  2AQ2 B;  1GUO A;  2R93 B;  4A93 B;  1TWG B;  1VF5 C;  3A7A B;  1A15 A;  4CGY B;  3W2D A;  1F2Z A;  3HOX B;  3DUZ A;  3S1N B;  1VDZ A;  2ZXR A;  1Q1E A;  1S4Z A;  2FHT A;  5ELF A;  1I4G A;  3FKI B;  3T53 B;  2IPK D;  1BO0 A;  5C3X A;  3GV6 A;  5M3M B;  5JVG 3;  4K5X A;  4FF1 A;  2B2V A;  3TP6 A;  3CKI B;  5FLX L;  2K5Q A;  3VYT A;  3L3O C;  3M4O B;  2F0P A;  2FFK B;  3I90 A;  1SMY C;  4FO2 A;  4BS9 A;  1XYI A;  3VYS A;  1F9P A;  5K36 G;  5EBC A;  1CI3 M;  1M4V A;  2ZT9 C;  3P1H A;  1B53 A;  1RF2 D;  2Z4H A;  1SNP A;  1H9R A;  3DMU A;  4L8J A;  2K5W A;  3RD4 A;  1A2T A;  1SBB B;  3H94 A;  5M3F B;  5CV5 A;  3IAY A;  2IW3 A;  3SHL A;  4IFD G;  1FYC A;  1HXY D;  4ME5 A;  2KHS A;  1LTT D;  4K2K A;  3I4M B;  1D5M C;  1EIG A;  3HOU B;  3OOC A;  2PW5 A;  1IKM A;  3VYR A;  3CRK C;  3QO2 A;  5LL6 S;  3HZX A;  2VXW A;  1ROD A;  1TT2 A;  1II3 A;  1DZ1 A;  3I73 A;  2CHB D;  3RZO B;  1SE2 A;  1LLR D;  3MZ5 A;  3GTP B;  3GP7 A;  1J9O A;  1DOL A;  3I91 A;  4BY1 B;  4X3U A;  4PNY A;  2G9D A;  4PMC A;  4ULL A;  3K5O A;  5I6W A;  4C3H G;  4C3I B;  3BDC A;  1B2T A;  3FPU B;  4RGO S;  1XWE A;  3GTK B;  3KBG A;  2B2T C;  2WV6 D;  5AFW A;  3HG9 A;  4H7B A;  5C6A A;  3OIQ A;  3S14 B;  1PRT F;  2IJ0 A;  1MI2 A;  3EA6 A;  3PUY A;  5M5X B;  3DWQ A;  1BNZ A;  2K32 A;  1LT5 D;  4ZQ3 A;  1F9R A;  2XRQ D;  1I4R A;  5HUR A;  4YIJ A;  2VUM B;  5CBE E;  4WJW A;  1MSH A;  1JCK B;  3GV3 A;  4K5V A;  4C3J G;  5M9O A;  2E2D C;  5CYU A;  2O5I C;  2DNC A;  1AP0 A;  3TBI B;  1DCZ A;  4RGT A;  2IX0 A;  3MFG A;  1BCP C;  1SE4 A;  4KJN A;  1VF7 A;  2B2U C;  2AQ3 B;  1B4O A;  2BDN A;  5EQ0 A;  3FDT A;  1RTN A;  3K5M A;  1QOH A;  2DY8 A;  3IFD A;  5I6Y A;  1C48 A;  1IYU A;  3IFT A;  4DK1 A;  3SK4 A;  2CVR A;  3H3V C;  4IFD J;  2LFN A;  1Y1W B;  3ZYY X;  4XQQ A;  1ICW A;  3J81 E;  2A69 D;  2NTS A;  4A3F B;  1ESR A;  1X3P A;  2JYO A;  2F0E A;  2B2W C;  2J0T D;  2XSC A;  1CM9 A;  1EWC A;  1EYC A;  1RTO A;  4XQJ A;  1NR2 A;  1JQY D;  2SNS A;  3A54 A;  3DEO A;  3M7N A;  4V19 0;  3R8B A;  3S9W A;  1U4P A;  1R9T B;  1IW7 C;  4S3S A;  3TZU A;  1S5F D;  4RAU C;  4Q5V A;  5C5M A;  4RCN A;  1L0Y B;  2XWJ B;  3IL8 A;  3FPP A;  1EYA A;  2RA4 A;  4DU9 A;  1D5Z C;  4ZAI A;  4LJZ C;  1LTI D;  1JC7 A;  3P20 A;  5G3L F;  4KKT A;  4ZK9 B;  1O7Y A;  1SND A;  4KY7 A;  2C5C A;  2H4O A;  1ZYR C;  4OHJ A;  2BE5 C;  5JEA J;  1EU4 A;  1NAP A;  3D6C A;  2XRS D;  3KBX A;  2PZW A;  2JXM B;  3MTS A;  1EQT A;  2FMM A;  3PV0 A;  4IN3 A;  5CV9 A;  1OO9 B;  1YNN C;  3NWT A;  3Q23 A;  1WCM B;  3PO3 B;  2YYZ A;  3TME A;  2EOT A;  4H44 C;  1Q3L A;  3I3C A;  3SXH A;  3S1R B;  3Q22 A;  2B8F A;  1B3A A;  1EY7 A;  3VR3 A;  1HCZ A;  3MWY W;  2F3V A;  3NBH A;  2J4X A;  1OXV A;  2IWH A;  3HOY B;  1T5E A;  3NQT A;  5FO7 B;  1KNE A;  1ENC A;  3BYT B;  3C1E A;  5BN3 A;  2L11 A;  4NW2 A;  3TN2 A;  3GTL B;  1F9S A;  3K5L A;  3JAM E;  1ENF A;  4QMG A;  5C44 B;  2WAQ B;  5EKK A;  1DOK A;  4IUT A;  4F87 A;  4HMI A;  5C4X B;  4EQP A;  4HCE A;  4EGV A;  2F0M A;  3C1F A;  4HSV A;  2E75 C;  4XYO A;  2J7Z A;  1EL0 A;  5EJW A;  1EY6 A;  3RLF A;  1BCP D;  4IFD I;  1F2Y A;  2LMC B;  1CTM A;  1I4Q A;  1UEA B;  4XIG S;  5JEA G;  2NN6 I;  3FMC A;  4UDU C;  2HDL A;  4LK1 C;  1Y1V B;  1BQQ T;  4CKB A;  3QJY A;  4HED A;  3MXU A;  1PZK D;  4RGN A;  1I4X A;  1D6E C;  1T5X D;  3WOF A;  4A3M B;  1HFN A;  5I2Y A;  3DHQ A;  5CV7 A;  2NWG A;  2JA6 B;  2G9H D;  1H9M A;  2RVL A;  1NSN S;  3BVM A;  2EPB A;  5IT9 L;  1PDQ A;  2F0L A;  3J80 E;  3V05 A;  5IGG A;  5ELB A;  1PMR A;  4KY6 A;  3BG3 A;  2EY1 A;  5EKI A;  4KK7 A;  4BY7 B;  2F0W A;  2PYK A;  1VMC A;  1SXT A;  4MIU A;  4TQU S;  2R6G A;  3S2D B;  3PUZ A;  5EGT A;  1UNS A;  3VA7 A;  3HOW B;  4L6T B;  2MGS A;  3NTH A;  4X3S A;  1ZKO A;  3PIP 3;  4EQO A;  3J81 L;  4HAE A;  5FO9 B;  3GTM B;  2F0U A;  2Z4I A;  2KUM A;  3I72 A;  1SNQ A;  3N6R A;  4DNR B;  3BVG A;  4FXG C;  1UAP A;  1ONL A;  2HUG A;  2Z8L A;  5IIF A;  4FP5 D;  4Y7N B;  4QIW B;  1TR5 A;  4XT1 B;  1MSG A;  2QF7 A;  1A6X A;  3NTK A;  2Z1C A;  1GUS A;  4QF4 A;  3K59 A;  2O5J C;  2IX3 A;  1OXU A;  1EYD A;  1LTG D;  2RSO A;  3SEB A;  1NR4 A;  3A56 A;  2C9O A;  4V0B A;  2O2L D;  3GTQ B;  1RHP A;  3HGB A;  5A2Q E;  1PZJ D;  5KNB A;  5IOD A;  3PUW A;  1B9M A;  2SEB D;  5CR3 A;  4G7Z C;  1IW7 D;  3HKZ B;  1SAP A;  2VB2 X;  1S5C D;  2EY5 A;  4RCO A;  4A3B B;  4K8J A;  2ICE C;  2ENB A;  5IGC A;  4HTH A;  2B2Y A;  2QCP X;  2PQE A;  1TWC B;  4U67 3;  2QIL A;  4H13 C;  1FNW A;  4H0L C;  5IGE A;  3Q6S A;  4BBS B;  1O7L A;  1GUT A;  2KEE A;  4Z9C B;  4F8M A;  1H9K A;  1OXT A;  3G6J B;  3HRZ C;  5C4J B;  3DWA A;  1WTX A;  5C0X G;  2EE1 A;  1H9S B;  1CQV A;  1JE4 A;  5A35 A;  1BBX C;  4RKB A;  2A69 C;  2JA8 B;  4F88 A;  1B9N A;  3C3L A;  1I3Q B;  4TSS A;  2B2V C;  3OW7 A;  3A8K E;  4KKS A;  3T56 B;  5ISR A;  3NUC A;  5KRU A;  1PRT C;  3J7A F;  3HS0 C;  3PO2 B;  1HTL D;  4A3I B;  2A73 B;  1FGB D;  1SDF A;  1JWU D;  1EWH A;  1KLG D;  1CT1 D;  2CW0 C;  1MD2 D;  4ABN A;  2N55 A;  1RKN A;  3MA2 B;  4QUF A;  1BXT A;  4RKL A;  4FF4 A;  2NZ1 D;  5C4H A;  5E1F A;  1WD1 A;  2PMZ B;  1J8I A;  5E3F A;  4BBR B;  2JP1 A;  2L1B A;  1KDC A;  3JAM L;  1O7Z A;  1LAB A;  2MPM A;  2L12 A;  4K5W A;  4DAV A;  2A74 C;  2OEO A;  2B8G A;  1LAC A;  1SSO A;  4IZ8 A;  4Q0F A;  1STY A;  1V1P B;  4OIK A;  2X69 A;  2HQE A;  3GTG B;  4KMU C;  3J7Y W;  3H09 A;  1CA6 A;  1XXG A;  5M5W B;  2R7Z B;  5KYI A;  5IGB A;  4WOR A;  5COY A;  2A68 D;  5M5Y B;  3G7L A;  1SYC A;  5J1Z A;  3Q0A A;  2AUK A;  3NQI A;  4I7Z C;  4K6D A;  1DON A;  3CRL C;  1GUW A;  2PPB C;  3EVQ A;  4KD4 A;  5CV6 A;  4K8I A;  4A3D B;  2IL8 A;  2NVY B;  1JWS D;  4XXE A;  2OT2 A;  3QWN A;  1QWY A;  1Y8N B;  2FMC A;  2WB1 B;  4QUC A;  1H9S A;  4K14 A;  1WTO A;  1Q8I A;  2XIW A;  5IT9 E;  5IOC A;  1LTA D;  1HA5 A;  3R2T A;  3N52 A;  1STH A;  1EZ8 A;  5IGF A;  1SNM A;  1A3V A;  2EYL A;  3GQB A;  3D31 A;  1E2W A;  1EY4 A;  4BA1 I;  3VR6 A;  4PMW A;  2MJ8 A;  1E2V A;  1STE A;  1SFO B;  3D8G A;  2EVB A;  4CHT B;  3URY A;  1EFI D;  2F0O A;  1EIH A;  3TP5 A;  5BN5 A;  1JR0 D;  1JOR A;  2F3W A;  2AUJ D;  3UI2 A;  3VYU A;  3BDO A;  3NBI A;  2A68 C;  3KLS X;  2AQ1 B;  2EDG A;  1QCB D;  3U9O A;  5CBA E;  3H6M A;  3D3R A;  3QOL A;  4O1N A;  3QOJ A;  1AW7 A;  1PRT D;  3SE0 A;  3S2H B;  3PUX A;  4KTA A;  4QB4 A;  4PV1 C;  1TY2 A;  5LHY 1;  2RQX A;  3ND8 A;  2A5H A;  4WFN 3;  1M8A A;  2NN6 G;  1K8O A;  1WTR A;  2D2C C;  2RSN A;  1I50 B;  1STN A;  3K5N A;  3OIP A;  2ZXO A;  1G8Z D;  2F0V A;  2EY6 A;  2MP1 A;  2K5D A;  3MFY A;  4IQZ A;  3S1M B;  1BDO A;  1TWA B;  5EPL A;  3VR4 A;  2K7V A;  4HMJ A;  1B44 D;  4RGM A;  4ZKB B;  4NDX A;  5I2X A;  2F1M A;  4RWS C;  1E0B A;  2XN9 C;  3M7G A;  2SDF A;  1QG7 A;  2EYH A;  5ELC A;  1KAB A;  1TQO A;  3A55 A;  3E6Z X;  3TZD A;  1F2M A;  3FRP B;  2FIN B;  2Y0S B;  4IUQ A;  1DJR D;  3AMU A;  3W3A A;  2ZXP A;  1SNC A;  5C0X H;  4NMZ A;  2R92 B;  2B2Y C;  3VR5 A;  5DNF A;  4HCS A;  2JSO A;  2KCC A;  1U4R A;  1CK1 A;  3SK8 A;  4DGZ A;  4CBV A;  1SE3 A;  1Y8P B;  2KED A;  2PO4 A;  1A2U A;  2LKV A;  1ILP A;  2HCC A;  1JOK A;  3A7L A;  4K6L A;  1RJT A;  2K03 A;  4OO1 G;  3QB3 A;  1PFM A;  1TWF B;  4BWG B;  5ELD A;  2F0F A;  3VR2 A;  3T4A C;  3KLS A;  4RH6 A;  3O13 A;  1Y69 U;  3TP8 A;  2F0D A;  2I46 A;  4FXK C;  2K04 A;  2EYM A;  1EY8 A;  1EZ6 A;  3S17 B;  4B9W A;  2LY7 A;  1WVL A;  1NUC A;  4XTC S;  5KEE A;  3K6O A;  3OWF A;  2KJX A;  2NVT B;  4RHS A;  2HDM A;  3GTJ B;  5DAU A;  1SNO A;  1CHP D;  1CZW A;  3WDN A;  1EY0 A;  2F4I A;  3EQL C;  5K5P A;  2BOS A;  1XX8 A;  1FD7 D;  3GO5 A;  2EYP A;  1QNK A;  3D4D A;  1OXS C;  3D4W A;  3EJI A;  4OGQ C;  2NN6 H;  4KHZ A;  4LMQ D;  4G57 A;  3MXG A;  5EBD A;  2NBF A;  1ENA A;  1QIL A;  1I4H A;  2Q8R E;  2F03 A;  4DA2 A;  1U4L A;  1ESF A;  1DD2 A;  2X6L A;  1BCP B;  3OMG A;  1SYB A;  5D3I B;  1B50 A;  2F0N A;  3OPO A;  2O4X A;  1Q90 A;  3T13 A;  1HUN A;  2D9U A;  2KCN A;  3ONA B;  3J7A V;  3FEW X;  4HN7 A;  1BUV T;  1RD9 D;  1CQF A;  1O80 A;  1X32 A;  2ICI A;  5EPJ A;  3MVV A;  3BYY B;  2A6E D;  4A3J B;  1KTK A;  1JB3 A;  3L9A X;  4OL7 A;  5K36 H;  1SYE A;  4U68 A;  2GA4 B;  1EY9 A;  4R8N A;  3I8Z A;  1CA5 A;  3NHH A;  1PTO B;  1TS4 A;  1HQM C;  2E76 C;  4EQN A;  3QIA A;  4A3G B;  1WTQ A;  1SYG A;  3LWE A;  1F77 A;  2PW7 A;  3TP7 A;  1BR9 A;  4DK0 A;  3X3N A;  1ZYR D;  5KGU A;  4O42 A;  1S5D D;  3S15 B;  3VA5 A;  4DFA A;  2F0T A;  1KDA A;  1LTS D;  3NSW A;  3S16 B;  1DM0 B;  4G4K A;  1V1P A;  4MN3 A;  3BS1 A;  3AU7 A;  2PNR C;  4XYQ A;  3OWE B;  4M8A A;  5E4W C;  2A6H C;  3P75 A;  2BCO A;  4ZKC B;  2F0S A;  4KV6 A;  3FVQ A;  3HOZ B;  1S5E D;  1GUG A;  1JIC A;  2AWN A;  3KF8 A;  3MHB A;  4DXF A;  2EY2 A;  1SJH D;  1QNU A;  3I4N B;  3EFX D;  1CHQ D;  3HOV B;  3ITP A;  4CJ1 B;  5CGK A;  1G2T A;  5BN4 A;  2M00 A;  3GTO B;  3A8J E;  2QEJ C;  2IT1 A;  2KVM A;  1G2S A;  2L0C A;  3GD7 A;  1AZQ A;  1KAA A;  2ID0 A;  4FVM A;  1I6V C;  5C3W A;  1G6Z A;  2PZU A;  1GOZ A;  2K28 A;  5D65 A;  3PMF A;  1WTP A;  3RUZ A;  1A3U A;  4TRD A;  2B2W A;  1GJX A;  3SR1 A;  2JE6 I;  1IKL A;  3KLR A;  1SJE D;  5JAV A;  2AWO A;  4I65 A;  1IYV A;  1SMY D;  2JEA I;  1LTR D;  1LT4 D;  5T1G A;  3LNN A;  5FO8 B;  2XWB B;  3OMC A;  2L9H A;  2IX1 A;  3KK7 A;  1Q1B A;  2Q8I B;  1QB5 D;  4ZLT F;  2RDG A;  3D6W A;  2NB0 A;  1XTC D;  2XVS A;  5DM7 3;  1UUP A;  4X3T A;  1S5B D;  4TKO B;  1KDB A;  2WKD A;  2RKS A;  4K2L A;  1TWH B;  4ZYS A;  3V96 A;  2DN8 A;  4IUP A;  4KN4 C;  2E2J B;  1AFP A;  1U4M A;  4A3E B;  5TSS A;  3RZD B;  2E2I B;  2NYZ D;  5FOB B;  5J39 A;  2OXP A;  1WTV A;  3NP8 A;  5NUC A;  4ZRZ A;  3MAQ A;  1SEB D;  4E6I A;  3NE5 B;  1DOM A;  3MXP A;  4N9T A;  4OO1 I;  1WTW A;  3F2U A;  1D1I A;  4IUR A;  1MBY A;  4JBW A;  1TII D;  2PCF B;  5CMD A;  4R9W A;  4C2M B;  4ILW A;  1Q12 A;  1IL8 A;  5EKL A;  1FNU A;  2QKI C;  1EQV A;  1HA6 A;  2K01 A;  4P2C B;  1R4Q B;  2YU9 B;  3T51 B;  1SYF A;  2EJM A;  4KN7 C;  1ET9 A;  4FYD A;  3DEP A;  2A6H D;  4J8Q A;  5FK9 C;  5KNC A;  3C46 A;  2K6A A;  3H0G B;  2NTT A;  2XNA C;  3KUP A;  4XDX A;  1B1Z A;  4UAI A;  3AB9 A;  3ERO A;  2EXZ A;  4FF2 A;  2K33 A;  3SDZ A;  1O78 A;  4CKC A;  1HHV A;  4LAA A;  1FR3 A;  4FNF A;  4RA8 A;  4B08 A;  3Q24 A;  1HTP A;  1AEX A;  3IKJ A;  1LV9 A;  2RBM A;  2DNE A;  3A8I E;  1TS5 A;  2M9V A;  3QG1 A;  3NXW A;  1V8Q A;  3E5S A;  3DM1 A;  5CV4 A;  2VNU D;  3SVM A;  2Q8T A;  4C56 C;  3K57 A;  2DY7 A;  3NK9 A;  3M4Y A;  1PTO H;  3ND9 A;  2WII B;  4IUN A;  2CQA A;  5JVH 3;  3MEH A;  1BF4 A;  3HEJ A;  1EY5 A;  5JPN C;  2EYJ A;  3D4R A;  1F2L A;  1PTO C;  1HUM A;  1I4P A;  1LT3 D;  5DM6 3;  1LTB D;  3T16 A;  2F0I A;  1YNJ D;  1G29 1;  2V4D A;  1FNV A;  2JEB I;  2SOB A;  3BDL A;  2CW0 D;  3SK5 A;  3R3O A;  2B2T A;  2BA1 A;  4RHR A;  5EPK A;  1KLU D;  5C5L A;  5D3D A;  2L55 A;  4FXD A;  2BA0 A;  1HPC A;  3K58 A;  4NKL A;  2F0G A;  3I4L A;  4AYB B;  3J80 L;  4IFD H;  2EYO A;  3MC0 B;  4KHV A;  4ODG A;  1H9J A;  2E74 C;  4IUU A;  5D14 A;  4M1U B;  5CV8 A;  1V1O A;  5KIX A;  3RMH A;  4XQN A;  2OF1 A;  4JK1 C;  4F7X A;  2BE5 D;  1GHJ A;  5J22 A;  4A3K B;  3C2P A;  1ZXT A;  4G7H C;  3BZD B;  2E2H B;  3R2I A;  3DXJ C;  2KQ3 A;  4L63 B;  3BVZ A;  2KA7 A;  2K05 A;  1RDP D;  2B2U A;  4DNT B;  2H1E A;  5I4D A;  2X6G A;  2PZT A;  1CFM A;  5JEA H;  1PRT B;  2L5T A;  2RDF A;  5CC4 A;  2B39 A;  2D5D A;  3V2T A;  1X3Q A;  1VCI A;  3I70 A;  4PQX A;  1OXX K;  1JOO A;  1Y8O B;  2JA5 B;  3K7A B;  2K1B A;  1ML0 D;  5A2Q L;  3CQZ B;  4CJ0 B;  1ZEQ X;  3TDQ A;  5KND A;  1V43 A;  2KOL A;  1IHZ A;  1GUN A;  1EEI D;  4ID6 A;  1TS2 A;  5C3E B;  2N88 A;  3LX0 A;  4CJ2 C;  1SYD A;  5I9O A;  2VB3 X;  3R93 A;  3NWS A;  1JWM D;  1PLF A;  1U9R A;  1HFG A;  1K83 B;  4XT3 B;  2HCI A;  4FF3 A;  1STA A;  1L0X B;  1QE6 A;  4QCL A;  1DYQ A;  1TY0 A;  2F0Q A;  2NUC A;  5HGT A;  1PFB A;  1A3T A;  5E4X A;  3K0Y A;  2FJ2 A;  3L7Z C;  4X3K A;  5JJZ A;  2I07 B;  3OHX C;  1TS3 A;  5LL6 X;  1K8M A;  4C3J B;  1D1K A;  4DAP A;  2WP8 J;  2BDO A;  1YNJ C;  2R61 A;  5JPM C;  1NCV A;  2RDH A;  4EVO A;  4ZUI A;  5C0X I;  1C4Q A;  5KYL A;  3SK6 A;  4N9P A;  4OO1 H;  1JOQ A;  3HP3 A;  3M85 A;  1CZG A;  5C4Z A;  1PFN A;  1R4P B;  4PMB A;  1MGS A;  2SNM A;  4OIJ A;  1C8C A;  3WOE A;  2D62 A;  1F9Q A;  4R8I A;  2F0H A;  2L4N A;  3ERQ A;  3LWU A;  4B9X A;  1LO5 D;  5DEH A;  1TVX A;  2KEC A;  2LS0 1;  2F0K A;  4KY5 A;  4KI0 A;  1ILQ A;  2EJG C;  1D2B A;  3DWP A;  1BCP F;  1PTO D;  5FKA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...