4CJ1B

Crystal structure of celd in complex with affitin h3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
63
Chain Sequence
SVKVKFHEKEVDTSKIKKVWRINTRLGMRVAFTYDDNGKTGRGMVPEKDAPKELLDMLARAEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords ENDOGLUCANASE D
publication title Potent and Specific Inhibition of Glycosidases by Small Artificial Binding Proteins (Affitins)
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 12
structure length 63
sequence length 67
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cj1B00
1LV9A 4RWSC 1ESRA 2L9HA 3I8ZA 4QUFA 1HFNA 4ZK9B 1MSHA 1U4PA 2MP1A 1EOTA 1DOKA 5EPLA 2RVLA 1TVXA 2FFKB 2B2VC 1AZPA 1WTVA 1EIGA 1HUMA 2B2WA 2M2LA 2RA4A 3P7JA 1GUWA 4IUTA 1SDFA 2B2YC 1SSOA 1WTQA 1G91A 4IUUA 3DEOA 1ILPA 4R8IA 2Q8RE 4CJ0B 3DM1A 3I91A 4OIJA 2HCCA 1BBXC 3H91A 1EIHA 2Q8TA 3LWEA 1MI2A 2VXWA 3GV6A 1BF4A 2XIWA 5CBEE 2RSNA 3D6WA 1B4OA 1B2TA 1DZ1A 2NYZD 4XDXA 4ZKBB 3MWYW 1WD0A 1B53A 1NR4A 1DOLA 1QNKA 5EQ0A 1RODA 4IUVA 2JP1A 2K01A 5T1IA 2RSOA 1DOMA 3KBXA 1A15A 2HDLA 1F9RA 3GV3A 4R9WA 5EKIA 2DY8A 4X3UA 2KUMA 2L4NA 5T1GA 2L12A 1PFBA 4OIKA 1EL0A 1CM9A 4HAEA 4ZLTF 4IUPA 2B2TC 3KUPA 1J9OA 2MGSA 1WD1A 3DEPA 1O7ZA 4MN3A 4X3SA 1AZQA 1ML0D 5D65A 1RTOA 4XT1B 1U4MA 2H1EA 3N52A 4CJ1B 3R93A 2EE1A 5EPJA 4NW2A 1M8AA 4DN4M 4HCSA 4XT3B 1CA5A 4RAUC 1AP0A 1BNZA 1JE4A 2B2WC 1WTPA 1HRJA 1B50A 2X69A 1VMPA 1HA6A 2DY7A 2FJ2A 5CMDA 1HUNA 2J7ZA 1F2LA 4CJ2C 1C8CA 2D9UA 4U68A 1MGSA 3HP3A 4X3KA 1G6ZA 2HCIA 4ZKCB 3TN2A 2X6GA 2L1BA 1WTOA 1WTXA 1ZXTA 1VMCA 4RA8A 2HDMA 1XX8A 4HEDA 1XYIA 1KNEA 1HFGA 1PFMA 2IL8A 1IL8A 2JYOA 2SDFA 2KEDA 1WVLA 2MJ8A 4IUQA 1O7YA 2R3ZA 4X3TA 2B2UA 4ZAIA 1IKLA 1SAPA 3FPUB 2KOLA 2K1BA 1ICWA 2X6LA 4LMQD 2HUGA 1JICA 1X3PA 3I90A 1G2SA 5EJWA 2FHTA 2B2VA 1QG7A 1EQTA 1PDQA 2B2UC 2K03A 2KECA 3I3CA 1RTNA 5COYA 1F9SA 2B2YA 2CVRA 3ONAB 3SVMA 4QUCA 4HSVA 1F9QA 1Q3LA 1X3QA 1QE6A 2KVMA 1U4LA 2N88A 1S4ZA 1HHVA 3QO2A 2K28A 5E4WC 3IL8A 1G2TA 1DONA 5DNFA 3F2UA 1U4RA 5D14A 3MTSA 4O42A 1NCVA 2N55A 5CORA 1IKMA 5AFWA 1NR2A 2BDNA 1NAPA 1X32A 5JJZA 1PLFA 1PFNA 2EOTA 2KEEA 4UAIA 2K04A 1WTWA 1J8IA 2FINB 1BO0A 1KNAA 2EPBA 1B3AA 3FDTA 1RJTA 3Q6SA 4MHEA 1F9PA 2K05A 2MPMA 1RHPA 2B2TA 5EPKA 3TZDA 5E4XA 1O80A 2FMMA 2NWGA 1MSGA 2NZ1D 3UI2A 1E0BA 5CBAE 1WTRA 1CA6A 2L11A 3G7LA 4IURA 1ILQA 3IFDA
chains in the Genus database with same CATH superfamily
2L9HA 3I8ZA 3GTMH 1TU2B 3D6CA 1U4PA 5EPLA 4C1NI 1O7LA 1LT5D 2AWOA 2G9HD 2K14A 1RD9D 1PTOD 4KJOA 3DM3A 4V190 1EIHA 3T56B 4GNXA 3RZOH 1B53A 3HEJA 1BCPC 3CQZB 3QG1A 3DMUA 1XTCD 3HOUG 4YWLA 1CK1A 5DLQE 3STBD 1TS4A 2R93H 4ZCKA 3BG3A 1YHBA 2XWJB 4XT1B 2L0CA 5GROA 1EYCA 3ND9A 4DV7L 1DCZA 1VQGA 1I4GA 3CQZH 3A8KE 4ZYSA 5JPNC 3Q22A 1ET6A 2UXCL 4RGMA 2JA8G 2HCIA 1QJOA 5FO9B 2N8NA 4DAYA 2EJMA 3W2DA 2A68D 4IPHA 4IUQA 1PYWD 3SEBA 3S1NH 3DXJC 1TWHH 2M00A 1LTTD 1SNDA 5EBDA 2UUAL 3HOYH 4A3LG 2K5VA 2XVSA 4R4CA 3RZDB 1AFPA 5C44G 3X3MA 4HTHA 2IY5B 2VW9A 3FKIH 2J4XA 4HSVA 4F87A 3S2DB 4JBJA 2R7ZB 3S1RB 1EOVA 1Q90A 3BVGA 2MFIA 3M4PA 1QVFA 2E2DC 3OIPA 5FLMG 3RZDH 4GN5A 4OXPA 3K58A 2FINB 4IJLA 2Y0SG 3FRPB 1SFOB 4KHPL 2A6HD 2VL6A 5E4XA 2NWGA 2LFNA 3S2DH 1FVIA 2R7ZH 4C3IG 3J7YW 2XTIA 5GADC 3KLSX 1SEBD 2PYKA 1A2UA 4RGNA 1SR3A 2B2YC 1SMYD 5ELBA 4P71A 3TP8A 1LUZA 2Q8TA 3PMFA 2CH4A 3H15A 2NBFA 2P5ZX 4HMJA 4ZKBB 2WB1E 3M4OB 5T1IA 4JV5L 3S9WA 1A15A 5CV9A 4A3JB 1HCZA 2KUMA 2L4NA 2D2CC 5T1GA 4FF3A 4IOAA 2I0QA 4NMZA 4HJAA 5IYDH 2PZUA 4LFCL 1KRTA 1BCPF 3A8IE 1DM0B 4NB3A 2EE1A 2B39A 2F03A 1M8AA 1VQBA 3BU2A 2QCPX 3A7AB 2OTLA 1LABA 4KY6A 4R1JA 3WWVA 1GHKA 4APVA 4LFBQ 3RMHA 2FJ2A 2YTXA 3NELA 4V0BA 1KC8C 1VQ8A 4JK1C 2D9UA 4X3KA 3SGIA 4KHPQ 3GTJH 1WTOA 5KNDA 1B9NA 4HEDA 4C3HG 4OONA 1KNEA 4DNTB 4GNXC 5BN4A 1K8OA 4M8AA 1X3FA 2R3ZA 3H0GG 4C3JG 3NQTA 5IYBH 3HKZG 1JICA 1HTPA 1KL9A 3I90A 1PTOH 2PQAA 5EJWA 2B2VA 3UE0A 5M3FG 1YNND 2K03A 2DN8A 1RTNA 2CH4W 1F9SA 2R6GA 5HY6A 3ONAB 4UDUC 5FJ8G 4XQQA 1CT1D 2RKSA 2CQAA 3CCUA 1HNWL 3JAMi 4JV5Q 2F3IA 3G6EA 1CKNA 4JW0A 4EQPA 3K5NA 3PUWA 1PRTF 2EY6A 5KNBA 4HIDA 4LFCQ 1J8IA 3K5OA 1KNAA 3I56A 3SDZA 3VR4A 1B3QA 1H9JA 1Y1VH 3T16A 4QCLA 1DOKA 4IOCA 2NTTA 1Q7YC 1HXYD 2RQXA 4H13C 1F2MA 2E76C 1N9WA 1EYAA 5BN5A 2Z1CA 1QUQA 2LSSA 3KLSA 1I4HA 4BA1I 4JI4L 2IJ0A 3S15B 4CKBA 2R93G 4POFA 3KDFA 4A3CG 1ICFB 3I2ZA 5M5WH 2BH8A 1JJCB 4ME5A 2K4KA 3NEMA 4NP5A 1R4PB 4GS3A 1TWCH 4XDXA 1KLGD 1B8AA 1I4XA 1DOMA 4R9WA 4AIMA 4Y7NH 1N32Q 4A3BH 3HRZC 5J1ZA 1LTSD 3AU7A 5ELDA 5IT9L 1HNWQ 4MN3A 2GVAA 2BH2A 2EY1A 1JQYD 5IYCG 3F2BA 4RAUC 3HOYG 1O7IA 1L0YB 1I4PA 1STBA 1Y8PB 2JEBI 3HKSA 4HR7B 1VMPA 2A6HC 5ELNA 1HNXL 1PH5A 1BR9A 1HUNA 5C4XB 1GOZA 1F2LA 3FKIG 2E74C 2UXBL 3V96A 1K9MC 1VMCA 4RA8A 2HDMA 5IWAL 3BJUA 5CV4A 3P20A 3CCLA 4WRDA 3OW2A 3K57A 3S1MH 2LKVA 2CKZB 2EYLA 2R61A 3SK6A 1EUJA 3CCVA 4GOPA 1LTLA 3CCEA 2OQKA 3FPUB 2KOLA 4LMQD 1EY4A 1PZJD 1XWEA 1GXDC 1Y14B 3KLRA 1VQJA 4DXGA 1SNCA 1IBML 2A8VA 3T13A 2R7ZG 5IGBA 1F9QA 5A2QE 3GTQB 1UWVA 2A19A 5I6YA 1VQPA 1I50B 2IX0A 3QWNA 2QGQA 3H3VC 3X3NA 1VCIA 4DF7A 1PZKD 2K75A 3J7AV 1DJRD 2HHHL 2HD3A 5D3DA 2WFWA 1BQQT 1F9PA 1EWCA 4KMUC 3CCSA 1H9RA 1FYCA 3HOWB 1HQRD 4K8JA 3SXHA 1LV9A 1I50H 1HNXQ 2Q8IB 2HIVA 5I6WA 3VR5A 2QILA 3CC4A 1TS2A 2B2VC 2FFKB 5CC4A 5IYDG 3S17H 3NE5B 2AQ3B 2RA4A 2UXBQ 3A5ZB 1LTAD 5TSSA 3J81c 5FOBB 1GUWA 3J81i 1VQNA 2ZM6L 5IWAQ 3KF8A 2ID0A 2JA9A 2GN5A 4K2LA 1FGUA 4A93B 3T1HL 2LXJA 1OXUA 3D6WA 1B4OA 2Z4IA 4K5WA 1V1PB 2RSOA 3S1QB 1YBYA 4B08A 1A0IA 4FO2A 4XQNA 1R9TB 2KHSA 1EZ8A 2QDLA 4K0KL 1OXVA 1IBMQ 3OPOA 1CM9A 2V1CC 1H9SB 3J80i 1J5EL 4JI6Q 1J6QA 4LFAL 1F77A 4IFDJ 2PW7A 5IYBG 4DN4M 2MNAA 4JOIA 1HZCA 4K6LA 1BNZA 1EFWA 1L1OB 2R92H 4GKKL 1TWGB 1R9TH 3K81C 3DLLA 3DHQA 4YY3Q 2HHHQ 1D1KA 5I2YA 1EY9A 4I65A 1EY6A 1B9MA 5JJLA 1KDAA 1B1ZA 3NBIA 4KN4C 2MJ8A 2K7VA 2RDFA 4IUNA 4DV2L 1CZWA 3TEHB 3EFXD 3MXNB 1X65A 2ZM6Q 4WJWA 2JQOA 5J3BA 2V4DA 1ENFA 2DUDA 1Y1VG 1PH2A 1AE2A 1NJIC 3IL8A 5DNFA 4PZ7A 3KJOA 3MTSA 4K0KQ 1J5EQ 5IP9H 3A8JE 2AKWB 4WFN3 1S5ED 4LFAQ 3CCMA 3K80C 1BO0A 1VQAA 4CJ1B 4GOPC 2B2TA 3VA5A 2EZVA 2ZXPA 4BBSH 2K5DA 3G71A 1BCPD 1T5XD 2MO0A 4RWSC 4GKKQ 3PUVA 1TWFB 1NMGA 1I94Q 4BY7H 4A3BG 5C44B 2ZT9C 4YWKA 4JI1L 4DV1L 1WTQA 1MJCA 4R8IA 3DM1A 1JJGA 2KCMA 2HCCA 4OEMB 1PYSB 1BF4A 4DUYL 2XIWA 2RSNA 4DV2Q 2WIIB 1B2TA 4LUVA 2E2JB 1HR0L 3M7NA 3TP6A 2NUCA 1TWFH 1D5ZC 1G8ZD 2Y0SB 2SOBA 2PPBC 1EYGA 4NXNL 1XNRL 5CR3A 3URYA 1EL0A 4A3KH 4HSPA 1YJWA 1Q82C 2Q2IA 3I4MH 4L5SA 5GAGC 2SNMA 4BBRB 1JOOA 3L9AX 5C4XG 4ZUIA 4UP8A 1EY8A 1XTDA 4RKLA 1WTPA 4A4IA 1VQ5A 1Q12A 1TQOA 1N33Q 1JORA 2QEJC 4CJ2C 3BDCA 1RL2A 1STAA 3J7A5 1BVSA 1I4QA 2HQEA 4B3SL 3VYUA 3KF6A 4FXKC 5G3LD 4BBRH 3UDFA 2KJXA 3CCJA 4EX5A 3M4YA 3TREA 4BS9A 3VR2A 3A74A 1PH1A 1E2ZA 1I4RA 3K0XA 3HOZB 2F0PA 1LTRD 3KOJA 1VQEA 4JI1Q 1G2SA 4DV1Q 4G7HC 4J6HA 1PH8A 4XQJA 1HNZL 3FP9A 2WV6D 3OTOL 3A7LA 4DUYQ 2AQ2B 1X3EA 4G57A 4IN3A 1II3A 4JOIC 4RCOA 3JAML 5C0XG 1JWMD 1HR0Q 1X3QA 2UXDL 2NVYH 3D8GA 4QGUA 3KYHC 3BVZA 3HOZH 2EYPA 4AYBE 4NXNQ 3EA6A 4KD3A 4FXGC 1XNRQ 1EQRA 1HPCA 2AWNA 4JCVE 2VB3X 2FXQA 2AHOB 1N8RC 2ZTEA 1AEXA 4U673 1PH6A 1PV4A 2F0VA 1QVGA 5I9OA 3H0GB 3HOVH 1JOKA 1ZKOA 4KY7A 3RN5A 2MPMA 2QDBA 1CKMA 4A3EB 3SHLA 1BOSA 3DWAA 4DV3Q 2YU9B 4DR1Q 1AN8A 2EVBA 3G7LA 5C4HA 1CSQA 1KXLA 4GZYC 4QUFA 4F8MA 4DUZL 4Y52H 5M3FB 1SYFA 3C2PA 2BOSA 3GP7A 1K8AC 2NVTB 4GLAC 2E2IH 3KK7A 2WP8J 1C0AA 3NP8A 1SDFA 3NWTA 1SSOA 4IUTA 4B3SQ 1HZAA 1LT6D 1K8MA 3E0EA 4CJ0B 3BYYB 2YU9H 4A3EH 2SNSA 4DR4L 3CC2A 3T1YQ 2CFMA 3MXGA 2R92G 4QIWE 4PMBA 1VQHA 2IT1A 1WD0A 4IUVA 4DNRB 2K01A 3DUZA 1AH9A 4WJ4A 2IW3A 2NVTH 1A6XA 4RHSA 1HNZQ 2VUMH 3RZOB 4JC0A 5E7NA 5JEAH 2BE5C 4OIKA 4I7AA 2I07B 2B2TC 4NPSA 2B8FA 4DGZA 4C1NK 1WFQA 2Q2UA 3K59A 3GTOB 2R93B 1AE3A 3I72A 4OHJA 2JA5B 4GLVB 5D3IB 5C5LA 1D5XC 1OTCA 2QF7A 1VQKA 1UE6A 2IHEA 3AQQA 2NTSA 3E3XA 2WAQE 4B3TL 4A3GH 5GAHC 3D4RA 2E5LL 3PUZA 1STHA 2F0IA 1A3VA 2L5TA 4JBWA 1QCBD 1WVLA 3QIAA 4HIMA 1YNXA 4B3RQ 2C35B 2JA5H 3M3YH 3JC66 1S5BD 3A55A 4ZAIA 4HN7A 1D5MC 3ICEA 4DR3L 2F0JA 3T53B 4L6TB 2ZTCA 2FHTA 2AQ1B 4DFAA 3S1NB 1XPUA 1TWHB 2CQOA 4MTKA 2F0KA 4BBSG 4L5RC 1KRSA 3HOYB 4DR4Q 2CW0C 1JWUD 5C4JB 4KJNA 4EQNA 5H1SE 5ELCA 4BY7G 1S4ZA 1SYCA 2K28A 1Y69U 3FKIB 4DA2A 4AH6A 3CC7A 5CORA 2Z4HA 2SEBD 2K5QA 3PCOB 2YYZA 1PRTB 4P72A 1WTWA 1KAAA 1CQVA 2WKDA 1KAWA 5C4JH 1RJTA 1HZBA 5BN3A 1ILQA 2LY7A 4J1MA 3S14H 1HFNA 5IGDA 1MSHA 1EOTA 1EZ6A 3J81L 4A3IH 4A3KG 1Z9FA 1D6EC 4B3TQ 1KDCA 4N8FA 1EIGA 3VA7A 2VNUD 3VDYA 3I4MG 4RGTA 4ZUJA 2RDGA 3PUYA 5LHY1 2KHJA 2KA7A 5IT9E 2EJGC 4DR2L 1L0XB 1WTHA 4LF7L 4HMIA 3CXCA 1DZ1A 1Q8KA 2PMZE 2PZWA 4DV5L 1RF2D 4DR3Q 4DV7Q 2D0PA 3TP5A 1TKWB 1M4VA 2K52A 2DY8A 1X6OA 1IZ6A 2L12A 3S2HB 1S5CD 4IUPA 4FYDA 4K14A 4BBRG 2UXCQ 3PUXA 3VYRA 3DEPA 3RUZA 3GD7A 2WB1G 1ML0D 5BR8L 3Q23A 1JT8A 3PO3H 4POGA 3R93A 4DK3C 2D62A 3WOFA 5IOCA 2KENA 2EYJA 3D3RA 3CKIB 4G7ZC 3TBIB 2UUAQ 3S2HH 4J8QA 2F0WA 2X6GA 1XYIA 4JPBW 1HFGA 1IL8A 1XPRA 3HOZG 1IYVA 3GTJB 4UP7A 3TQYA 2XSCA 3GO5A 1EIFA 2JEAI 4Q5VA 5EBCA 5JVG3 3A56A 1ICWA 4GNXB 4HIKA 5DEHA 2RCFA 2Q2HA 4YWMA 3OMGA 1PDQA 1SJHD 3HG9A 2IX3A 4DR2Q 5C3EH 4X65L 4LF7Q 1PTOB 2CVRA 4LF4L 1D7QA 1NMFA 2F4VL 1SNPA 1EQVA 4YCUA 4X64L 5E4WC 3MAQA 1PH4A 2ZJQA 1IHZA 1G51A 2A73B 2N49A 1IKMA 2ICEC 1XJVA 4FF1A 3QOLA 1PLFA 4ME3A 1EEID 5KYLA 4A3EG 3C46A 3MA2B 3OMCA 5BR8Q 1LT4D 1TS5A 2QW7A 4OWWB 1NTGA 3FDTA 3Q6SA 5FLXc 5EPKA 1EY5A 4KLKA 3L7ZC 3IFDA 2VUMG 4NXML 2A6EC 4DV4L 2XNAC 4ZK9B 4A3MB 3MC0B 3JAMc 1Y1VB 3TRZA 1HUMA 2ALYB 2B2WA 4XYOA 3K7UC 4QY7A 1MIUA 3P7JA 1X56A 4XYQA 2B63H 2JA6B 4KN7C 3F8TA 3NBHA 3Q8DA 3U4VA 3MVVA 1BBXC 1ONLA 4A75A 1ENCA 1IBKL 5LMNL 5G3LF 4R4QA 1ASZA 3H94A 5M5WB 4CHTB 1Q86C 5EQ0A 2ATWA 4A3MH 2JP1A 2EXDA 3PGZA 2ZXRA 3R2TA 3HKZE 1TWCB 5FKAC 2OT2A 5KNCA 3U58A 4LW1A 2JA6H 1ET9A 4X65Q 1U0LA 3CCQA 4LF4Q 4KV6A 2F4VQ 1O7ZA 4Y7NB 4HJ7A 2JA5G 4X64Q 3CPWA 3K7AH 3N52A 5DM63 5FK9C 4A3BB 2IX1A 2CWAA 3M4QA 4ULLA 3PQIA 1UE7A 5LL6S 2NB0A 2VS1A 1K3BC 3U4ZA 2F0TA 3CW2C 2X69A 3V2TA 1B50A 1V1PA 5AJ3L 4DV0L 1B70B 4F7XA 1LTBD 2IL8A 1H9SA 2F0UA 1YITA 4NXMQ 4X3TA 4TSSA 1BBWA 2VQFL 1IKLA 1SAPA 4Q0FA 3S1MB 4OX9L 5CGKA 2X6LA 5LL6X 4Z9CB 3UE1A 1UE1A 4JI7L 2H5XA 2B2UC 1SRUA 1GVPA 3EIVA 5LMNQ 1XMQL 1AW7A 3BVMA 5KEEA 3ZYYX 1I6HH 4EQ5A 2Q2TA 2H4OA 2PCFB 1FNVA 4UY8C 2LS01 2N55A 1TS3A 3WDNA 2QKIC 2WINB 5AFWA 5C0XJ 2BDNA 1NAPA 1E1OA 3MXNA 5IY0A 3MFYA 4JI4Q 4HIOA 4OO1I 4UAIA 1DYQA 2EY2A 3EVQA 4I7ZC 2BA0A 4OO1H 4K2KA 3L0OA 3SE0A 1YHQA 1RHPA 2A5HA 1X55A 3ULPA 2VZAA 3ITPA 4IPCA 1PHJA 1CTMA 3HGBA 4B9XA 1ESRA 4A76A 2TMPA 3B6YA 2HQLA 3G4SA 5JJIA 5AJ3Q 1AZPA 4P73A 3M9BA 5CYUA 5HURA 3PO3G 2EY5A 3H3VI 3S17B 3I91A 3A54A 3H91A 1CQFA 3H3VH 1MI2A 2VXWA 4KY5A 1S72A 2VQFQ 4N9PA 3MXPA 1NY4A 4FF4A 4OX9Q 4O1NA 1SXTA 1RODA 4R8NA 2OF1A 1XMOL 5J22A 4OL7A 3EJIA 2HDLA 1F9RA 3GTGH 4ABNA 3MHBA 4H44C 3UDXA 5K5PA 2K5HA 2IHFA 1KIXA 1XMQQ 1CKNB 4B3ML 2M9VA 4UHVA 3EN2A 1AZQA 3Q24A 2H1EA 3NENA 1QNUA 4GN3B 4NW2A 1CA5A 1VS0A 1AP0A 4TVAB 1Z6HA 4L63B 3OOCA 3CD6A 5GAEC 1V9PA 1YHAA 2B2WC 4LUOA 3MEFA 2K5NA 2EXZA 1V1OA 5C3EG 1VQLA 1E1TA 2J7ZA 1E2WA 1G6ZA 5JPMC 2R92B 2ASBA 1CSPA 1SNQA 4FVMA 1FJGL 1LTGD 4KD4A 4EGVA 3CHBD 1TWAH 4MTNA 1VQMA 3J80c 2EIFA 3AB9A 1GUOA 3K6OA 4BA2I 1HTLD 3ER0A 3CU7A 4JG2A 4CDDC 3E9HA 5CV6A 3BDLA 2E2HH 2HUGA 4PNYA 4PQXA 1X3PA 4TQUS 2AUKA 3BYTB 1S5FD 3S24A 5JVH3 4H0LC 3KJPA 2R7DA 3RLFA 1VF7A 4KKTA 3CRLC 3F2UA 3I70A 1SMXA 3O13A 5FO7B 5HGTA 1LTID 1R4QB 4O42A 2B63G 2NN6I 2UU9L 3KFUA 3L2PA 1PFNA 3I73A 2DNEA 1TIID 3SK4A 4DAPA 1PMRA 4MHEA 3UI2A 4A3MG 2NZ1D 1I3QB 3OW7A 5JJKA 1GO3E 3T1HQ 2L11A 1LACA 1ZYRC 5M5XB 3M7GA 3I4NH 2OXPA 3MXUA 3NXWA 3OSOA 4LF8L 1JR0D 1W3SA 3ND8A 4BBSB 3I4OA 2JA6G 4G4KA 4EVOA 2BE5D 1W2BA 1K0RA 1FJGQ 4BY7B 3OWEB 3GTPB 1K8GA 2PNRC 1SN8A 4CBVA 1I3QH 1VQ4A 1NSNS 5M5XH 2NYZD 1NR4A 4IFDI 1S3OA 1HA5A 2NVQH 4IFDH 2EJFC 1Y1WH 3HOUH 3QB3A 4QB4A 1PFBA 3GTPH 3A0JA 1LLRD 1VQIA 1ASYA 4A3KB 2XN9C 4GKJL 3I4MB 3TZUA 4X62L 3PO2H 1GUGA 2KCTA 1IL2A 5CMDA 4DPGA 5ELOA 4BY1H 4YCWA 1B7YB 1E22A 1F2YA 1JWSD 2KCCA 4K8IA 2JA8H 2ZTDA 2CW0D 5KGUA 4ZKCB 2OWOA 2I46A 1SROA 3LGJA 1EY7A 3N6RA 4KKSA 2JYOA 2Z0SA 2CWPA 4LF8Q 2EYMA 1O7YA 1YJ9A 2MHVA 2JE6I 3H6MA 1K83H 2ZXOA 1KQSA 1CFMA 5I2XA 1SYDA 4OO1G 2WB1B 1OXXK 3UDGA 3GTLH 5A2QL 1H95A 2ZJPA 1E2VA 1H9MA 4IQZA 4BWGB 1XXGA 2N88A 2HIXA 1DONA 1E7ZA 4IPGA 2CCZA 3AFQA 2YTYA 3J81E 2NVYB 3E5SA 4UPAA 2FMCA 2EOTA 5HGQA 5FLXL 4JBMA 1B3AA 5ELFA 3TZDA 5CBAE 2AUJD 2F0QA 4X62Q 3HOVB 5C4ZA 1MKHA 3PIOA 2M2LA 3IRBA 4FDBA 1G91A 2MQHA 3FPPA 4QF4A 2E2IB 5DM73 2YTVA 3BZDB 4WORA 3U9SA 4GLXA 1QNKA 5NUCA 2CHBD 4DR6L 3NTIA 2C9OA 4X3UA 4R4OA 1SYEA 1XPOA 1CUKA 1PH9A 4QMGA 4HAEA 4ZLTF 1ESFA 1WCMH 3FVQA 4G7OC 1J9OA 2VUMB 4X66L 1LT3D 3E9IA 3J7AF 1D2BA 3G48A 4C2MH 1VQ9A 5J39A 1PVOA 1YJNA 1QILA 4AQYL 4FF2A 1PH7A 2K32A 1NUCA 5C5MA 5JAVA 3HP3A 1MGSA 1PZID 1FGBD 1XX8A 3IFTA 2PO4A 1PFMA 2BA1A 3OTOQ 1S40A 2WKCA 2D5DA 1HR0W 2KCNA 3C1FA 4A3GB 2PW5A 2UXDQ 2B8GA 2R7FA 1BCPB 2WAQG 1D1IA 3VR3A 3AEVA 1GUNA 2PQEA 4FXDA 4OGQC 3M3YB 1G6PA 2DGYA 1RIPA 3F1ZA 1LM0A 4JI3L 3I3CA 3CMEA 5FJ8H 3SVMA 3I4NG 4A3DB 1A8VA 2A69C 1UNSA 1STEA 4FNFA 2OCEA 3D4DA 2A6ED 1UEAB 4DR6Q 1G2TA 3W3AA 5D14A 2O5JC 1IBLL 4DUZQ 3DWPA 4YHHL 3AMUA 1JOQA 3GTKH 5IP9G 1IYJB 4DV6L 2JK8A 4X66Q 2NVXH 4LJZC 5M5YH 1DXMA 1K3RA 1KDBA 4A3DH 5I4DA 1O80A 2FMMA 1YNJC 1E0BA 4AQYQ 2B29A 2E75C 4IFDG 1X54A 4IURA 4JVZA 3U50C 1Y1WG 4H02A 3KF6B 4WJ3M 3MFGA 1EEFD 2LMCB 3S14B 1QZGA 4A3CH 1Q1BA 4MNOA 3IAYA 1A2TA 4LF6L 1FNWA 3DEOA 4A3IB 2Q8RE 2NZOA 3BDOA 1QOHA 4EQOA 1H9KA 3Q0AA 3ULLA 1KABA 3PO2G 3QR8A 4MIUA 1K0SA 3MWYW 1JCKB 2I5HA 4BY1G 2F0SA 5IGGA 1NE3A 2XRQD 4LK1C 2F3VA 2D0OA 4JI5L 1XNQL 2C5CA 4K5VA 4JI3Q 2JA7B 4DR5L 3CRKC 4X3SA 4LUZA 2ICIA 2E5LQ 4P75A 5IYCH 2Z9HA 4A3FB 1IBLQ 4YHHQ 3PO3B 4JI0L 2LXKA 4DV6Q 2F0LA 3FMCA 4U68A 2JA7H 1PRTC 2B3GA 4QQBX 3J80L 1FR3A 3CAMA 2SDFA 1W6JA 1QVCA 4PMCA 3RLOA 3BS1A 4A3FH 4B9WA 4K6DA 4NDXA 1QZHA 5I9PA 2B2UA 4LFBL 3K8AA 2K1BA 2VQEL 4DU9A 4CGYB 4LF6Q 2EYOA 3D31A 3NK9A 2ZJRA 4LAAA 1HQMC 1BKBA 2F3WA 3R2IA 1EQTA 1Q81C 1SBBB 1X9NA 1JB7A 3S1RH 3AFPA 4L5TA 3K5LA 4PG3A 1U4LA 2Y0SE 5C3EB 1WI5A 3ERSX 3TP7A 3D4WA 2F0HA 3NUCA 2O4XA 4IPDA 2F0DA 4PMWA 4JI5Q 3C3LA 1XNQQ 5K36H 3CPFA 4PZ6A 3LX0A 1SFOH 1C7YA 1SE8A 2UUCL 1X32A 4ILWA 5LMUL 5IP7H 4DR5Q 5L37A 2K04A 1F2ZA 2NZHA 4RGOS 3HOVG 2HT1A 3DWQA 4IO9A 1WTRA 4CDFC 4PZ8A 4JI0Q 1OO9B 3W1BA 3F2CA 4J15A 4DV5Q 5C3WA 1WCMG 1IW7C 2K50A 4GN4B 2OEOA 1RDPD 3I55A 1P16A 4IUUA 4ID6A 3MEHA 4RHRA 1ZEQX 3M4OH 1NNXA 2K33A 2IPKD 2B63B 3P1HA 2O5IC 3SK8A 4A3JH 2I5LX 2VQEQ 4TKOB 4LNQA 4JBKA 1E24A 5M3MB 5ELEA 5E3FA 1HH2P 2L15A 4K5XA 5EKIA 3K5MA 2N78A 4F88A 4DAYB 5JEAG 1VQ7A 2I5MX 4RH6A 4R4IA 4RCNA 4ODGA 4ZRZA 2JJQA 1PTOC 5F2DA 3TSSA 2EQSA 1B44D 2PNHA 1MJEA 3OIQA 1BBUA 1DD2A 1JE4A 2XWBB 3K7AB 5M3MH 3NPPA 2UUCQ 1N32L 5LMUQ 4NKLA 3L3OC 3UDIA 1C8CA 5IIFA 1WJJA 1PYBA 3RNUA 4A3GG 1WOCA 1MBYA 2EYFA 1QWYA 3STBC 2PI2A 4YIJA 3R3OA 1KHIA 3W5OA 3PIP3 2TSSA 1YIJA 2YV5A 3I4LA 5E1FA 1IXRA 2G5DA 3J7ZC 2F1MA 3LWUA 2Z6KA 4MZ9A 3H09A 4XIGS 1S5DD 2KBNA 4A3DG 2QEXA 1N34L 3NSWA 3G6JB 4QUCA 1ZYRD 1Q3LA 2KVMA 1Z47A 2A68C 1SYGA 1SJED 3QJYA 4RKBA 1BUVT 4DV4Q 3FHWA 1EU3A 4BXXH 1CHPD 2F0EA 1I6HB 1VDZA 2A1AA 2KEEA 1LO5D 1PXUA 2G9DA 1C9OA 3OYYA 2F0FA 1L1OA 2JXMB 4KKUA 5CV7A 4DK6C 1GJXA 1MSGA 2K5WA 4LF5L 3S15H 1IBKQ 1GHJA 3SR1A 1W6KA 3PSIA 1SLJA 1TVXA 1M1KC 2F0OA 4TRDA 3TMEA 1WTVA 4A3IG 1EWIA 2OTJA 3HS0C 5CV8A 2KHIA 1M90C 1C4QA 4L8JA 5ISRA 4LF9L 4HJ9A 1TY0A 1FL0A 4OIJA 2F0GA 3K0YA 3PF5A 2MO1A 3LWEA 3EQLC 1I6VC 2L55A 5CBEE 1HZ9A 3HZXA 2EYHA 2Z8LA 3J81j 1A62A 1DOLA 1JJ2A 3OHXC 2JA7G 3ULJA 1Z7TA 4CKEA 3M85A 4KTAA 1N34Q 2WACA 2DNCA 4AYBB 3PIO3 3GTGB 4DV0Q 1EY0A 2MGSA 4A3FG 1WD1A 1YEZA 1SMYC 4RMFA 1OXTA 5EPJA 5CV5A 5C4XH 1JC7A 3TDQA 2F4IA 4ZQ3A 2PQAB 3RR5A 1SE3A 1PTOF 1SNOA 3NTHA 1N36L 4JI6L 1ZXTA 4JI7Q 5LMNW 3MZ5A 4IZ8A 4LF5Q 3TS2A 5FO8B 5K36G 1PFSA 3NBHB 2RHQB 5IGEA 1TWAB 5IP7G 1GUSA 1U9RA 3NWSA 4QIWB 4YY3L 1UE5A 1UUPA 5IGFA 1OXSC 1PH3A 4LF9Q 1E3PA 3I7FA 1JB3A 1L0WA 5C0XI 2E2HB 3GTQH 1EYDA 5FLXE 3A5UA 5C0XH 2F0MA 5EKKA 1A3UA 4X6AH 1CZGA 1QUQB 2QA4A 3NQIA 1IYUA 1EFID 1U4RA 3JAME 1V8QA 1LYLA 3KDFB 2KQ3A 2VB2X 2BDOA 3HOXB 3S16B 3HOWH 1GD7A 1Y8OB 4A3JG 1YNNC 1FNUA 2RCNA 4DK0A 1T5EA 1STYA 2WAQB 3GDEA 1A63A 1STGA 4P2CB 4DAVA 2GA4B 3P75A 2Z6KC 1CI3M 4N8X1 3SK5A 2RVLA 3T4AC 1Q1EA 1EQQA 1XMOQ 1O78A 3HOXH 3S16H 1N36Q 4DR7L 3I4NB 4A93H 1K28A 3CCRA 3NHHA 1JMCA 3OWFA 1ILPA 3RD4A 4JI8L 2RBMA 4B3MQ 2NN6H 3GV6A 2IWHA 3S1QH 1BXTA 5M3MG 4KK7A 1RCVD 1VQCA 1I94L 3FEWX 3EBEA 1U5KA 2XRSD 3GV3A 4LWCA 2O2LD 5KRUA 1SNMA 1VF5C 3PF4A 1L1OC 3CF5A 4QJFA 1CHQD 2NVQB 3KUPA 2MUYA 4H7BA 2K6AA 4CDCC 1Y8NB 2RHSB 4S3SA 2E8GA 1Y1WB 3HOUB 1RTOA 4GOPB 1U4MA 1TWGH 4HCSA 4XT3B 5IODA 3E0JA 1EU4A 2F0NA 1C48A 1EWHA 1UEBA 4RG1A 1STNA 1HA6A 4R4TA 1TY2A 2F52A 2OQ0A 5EGTA 3TN2A 1DGSA 2L1BA 1WTXA 3PO2B 2A69D 4CKCA 4BY1B 2BCOA 4E6IA 2JA8B 5C3XA 3PIPA 4XTCS 2DJFC 1VQFA 1Q46A 4XXEA 2ES2A 2UUBL 4BXXG 1NBWA 1TXYA 4DR7Q 3PV0A 1N33L 4UP9A 3CMAA 2DJGC 5IE8A 5IGCA 1UAPA 2PMZB 3CP0A 3E6ZX 2UU9Q 1K83B 4JI8Q 2RDHA 3R8BA 3ERQA 2GVBA 3LNNA 1A3TA 1YNJD 5COYA 3KBGA 1YVCA 3GTLB 3RLNA 3QO2A 1SE2A 3QOJA 3D0FA 4KHZA 1P8LA 1I5FA 1NR2A 3KF8B 5JJZA 3TS0A 1HJPA 3WOEA 1KTKA 3HFZB 1WYDA 4A3LH 4HJ5A 2PZTA 1KD1C 1BDOA 1YI2A 5C44H 2J0TD 2AMCB 1L2FA 4CDEC 2MP1A 4OWXB 4DNIA 4IALA 4C3IB 2A74C 3KLWA 4KI0A 4DK1A 3NTKA 4JI2L 2E2JH 4DV3L 5FLMH 4DR1L 2UUBQ 4OELB 4JYAL 4QL5A 1TR5A 1SYBA 1SE4A 4GKJQ 3KBXA 4N9TA 1V43A 2N3SA 4AYBG 1VQDA 1PRTD 1T9HA 3T51B 4C3IH 1TT2A 3GQBA 3J80E 3W1GA 4FP5D 3T1YL 5D65A 5IT9c 5M9OA 1VQOA 1WCMB 4O0AA 4O2DA 4P74A 2JN4A 4PV1C 5JEAJ 1V1QA 4DXFA 1ENAA 1HRJA 3F2DA 2Z6BA 1Q8IA 4C2MB 2DY7A 1K73C 3RN2A 2EDGA 3BZKA 3V05A 1RKNA 3C1EA 3IKJA 2JSOA 4OWTB 5EAYA 1YZ6A 4M1UB 5EKLA 2KEDA 5GQOA 1PA6A 4C3HB 4RFBA 4DAMA 4YCVA 1MHWC 3HOWG 1GM5A 1EIYB 4ALPA 1X3GA 4C3JB 4HCEA 3ZJYC 2XGTA 4JI2Q 1QG7A 2KECA 5KIXA 3EROA 3HKZB 1GKHA 3U9OA 1VQ6A 1CKOA 2B2YA 4DKAC 5JOBA 4JYAQ 4B3RL 1QE6A 1HHVA 4C3HH 4KHVA 3HOXG 4A93G 3GTMB 1MD2D 1KLUD 1IW7D 5DAUA 2PI2E 1JE5A 1D8LA 1NCVA 2ENBA 3H0GH 4IJHA 4C3JH 4C56C 4HJ8A 4L5QA 3GTOH 2NN6G 3VR6A 3BZCA 5C6AA 2EPBA 3VYSA 3VYTA 5A35A 5KYIA 2RF4A 2K05A 3AYHB 3GTKB 5M3FH 1FD7D 1CA6A 1QB5D 2VY3A 2NVXB 5M5YB 1GUTA 1G291
chains in the Genus database with same CATH topology
2L9HA 3I8ZA 1TU2B 3D6CA 1U4PA 5EPLA 4C1NI 1O7LA 1LT5D 2AWOA 2G9HD 1RD9D 1PTOD 4KJOA 4V190 1EIHA 3T56B 1B53A 3HEJA 1BCPC 3CQZB 3QG1A 3DMUA 1XTCD 1CK1A 1TS4A 3BG3A 2XWJB 4XT1B 2L0CA 1EYCA 3ND9A 1DCZA 1I4GA 3A8KE 4ZYSA 5JPNC 3Q22A 1ET6A 4RGMA 2HCIA 1QJOA 5FO9B 4DAYA 2EJMA 3W2DA 2A68D 4IUQA 1PYWD 3SEBA 3DXJC 2M00A 1LTTD 1SNDA 5EBDA 2XVSA 3RZDB 1AFPA 3X3MA 4HTHA 2J4XA 4HSVA 4F87A 3S2DB 2R7ZB 3S1RB 1Q90A 3BVGA 2E2DC 3OIPA 3K58A 2FINB 3FRPB 1SFOB 2A6HD 5E4XA 2NWGA 2LFNA 4C3IG 3J7YW 3KLSX 1SEBD 2PYKA 1A2UA 4RGNA 2B2YC 1SMYD 5ELBA 3TP8A 2Q8TA 3PMFA 2NBFA 4HMJA 4ZKBB 3M4OB 5T1IA 3S9WA 1A15A 5CV9A 4A3JB 1HCZA 2KUMA 2L4NA 2D2CC 5T1GA 4FF3A 4NMZA 2PZUA 1BCPF 3A8IE 1DM0B 2EE1A 2B39A 2F03A 1M8AA 2QCPX 3A7AB 1LABA 4KY6A 1GHKA 3RMHA 2FJ2A 4V0BA 4JK1C 2D9UA 4X3KA 1WTOA 5KNDA 1B9NA 4HEDA 4C3HG 1KNEA 4DNTB 5BN4A 1K8OA 4M8AA 2R3ZA 4C3JG 3NQTA 1JICA 1HTPA 3I90A 1PTOH 5EJWA 2B2VA 1YNND 2K03A 2DN8A 1RTNA 1F9SA 2R6GA 3ONAB 4UDUC 4XQQA 1CT1D 2RKSA 2CQAA 4EQPA 3K5NA 3PUWA 1PRTF 2EY6A 5KNBA 1J8IA 3K5OA 1KNAA 3SDZA 3VR4A 1H9JA 3T16A 4QCLA 1DOKA 2NTTA 1HXYD 2RQXA 4H13C 1F2MA 2E76C 5BN5A 1EYAA 2Z1CA 3KLSA 1I4HA 4BA1I 2IJ0A 3S15B 4CKBA 4ME5A 4NP5A 1R4PB 4XDXA 1KLGD 1I4XA 1DOMA 4R9WA 3HRZC 5J1ZA 1LTSD 3AU7A 5ELDA 5IT9L 4MN3A 2EY1A 1JQYD 4RAUC 1L0YB 1I4PA 1STBA 1Y8PB 2JEBI 4HR7B 1VMPA 2A6HC 1BR9A 1HUNA 5C4XB 1GOZA 1F2LA 2E74C 3V96A 1VMCA 4RA8A 2HDMA 5CV4A 3P20A 4WRDA 3K57A 2LKVA 2EYLA 2R61A 3SK6A 3FPUB 2KOLA 4LMQD 1EY4A 1PZJD 1XWEA 1GXDC 3KLRA 4DXGA 1SNCA 3T13A 5IGBA 1F9QA 5A2QE 3GTQB 5I6YA 1I50B 2IX0A 3QWNA 3H3VC 3X3NA 1VCIA 4DF7A 1PZKD 3J7AV 1DJRD 5D3DA 1BQQT 1F9PA 1EWCA 4KMUC 1H9RA 1FYCA 3HOWB 1HQRD 4K8JA 3SXHA 1LV9A 2Q8IB 5I6WA 3VR5A 2QILA 1TS2A 2B2VC 2FFKB 5CC4A 3NE5B 2AQ3B 2RA4A 1LTAD 5TSSA 5FOBB 1GUWA 3KF8A 2ID0A 4K2LA 4A93B 1OXUA 3D6WA 1B4OA 2Z4IA 4K5WA 1V1PB 2RSOA 3S1QB 4B08A 4FO2A 4XQNA 1R9TB 2KHSA 1EZ8A 1OXVA 3OPOA 1CM9A 1H9SB 1F77A 4IFDJ 2PW7A 4DN4M 4K6LA 1BNZA 1TWGB 3DHQA 1D1KA 5I2YA 1EY9A 4I65A 1EY6A 1B9MA 1KDAA 1B1ZA 3NBIA 4KN4C 2MJ8A 2K7VA 2RDFA 4IUNA 1CZWA 3EFXD 4WJWA 2V4DA 1ENFA 3IL8A 5DNFA 3MTSA 3A8JE 4WFN3 1S5ED 1BO0A 4CJ1B 2B2TA 3VA5A 2EZVA 2ZXPA 2K5DA 1BCPD 1T5XD 4RWSC 3PUVA 1TWFB 5C44B 2ZT9C 1WTQA 4R8IA 3DM1A 2HCCA 1BF4A 2XIWA 2RSNA 2WIIB 1B2TA 2E2JB 3M7NA 3TP6A 2NUCA 1D5ZC 1G8ZD 2Y0SB 2SOBA 2PPBC 1EL0A 5CR3A 3URYA 4HSPA 2SNMA 4BBRB 1JOOA 3L9AX 4ZUIA 1EY8A 4RKLA 1WTPA 1Q12A 1TQOA 1JORA 2QEJC 4CJ2C 3BDCA 1STAA 1I4QA 2HQEA 3VYUA 4FXKC 5G3LD 2KJXA 3M4YA 4BS9A 3VR2A 1E2ZA 1I4RA 3HOZB 2F0PA 1LTRD 1G2SA 4G7HC 4J6HA 4XQJA 2WV6D 3A7LA 2AQ2B 4G57A 4IN3A 1II3A 3JAML 4RCOA 5C0XG 1JWMD 1X3QA 3D8GA 3BVZA 2EYPA 3EA6A 4KD3A 4FXGC 1HPCA 2AWNA 2VB3X 1AEXA 4U673 2F0VA 5I9OA 3H0GB 1JOKA 1ZKOA 4KY7A 3GTOB 2MPMA 2QDBA 4A3EB 2YU9B 3SHLA 1BOSA 3DWAA 1AN8A 2EVBA 3G7LA 5C4HA 4GZYC 4QUFA 4F8MA 5M3FB 1SYFA 3C2PA 2BOSA 3GP7A 2NVTB 3KK7A 2WP8J 3NP8A 1SDFA 3NWTA 1SSOA 4IUTA 1LT6D 1K8MA 4CJ0B 3BYYB 2SNSA 3MXGA 4PMBA 2IT1A 1WD0A 4IUVA 4DNRB 2K01A 3DUZA 2IW3A 1A6XA 4RHSA 3RZOB 5JEAH 2BE5C 4OIKA 2I07B 2B2TC 2B8FA 4DGZA 4C1NK 3K59A 2R93B 3I72A 4OHJA 2JA5B 5D3IB 5C5LA 1D5XC 2QF7A 2NTSA 3D4RA 3PUZA 1STHA 2F0IA 1A3VA 2L5TA 4JBWA 1QCBD 1WVLA 3QIAA 1S5BD 3A55A 4ZAIA 4HN7A 1D5MC 2F0JA 3T53B 4L6TB 2FHTA 2AQ1B 4DFAA 3S1NB 1TWHB 2F0KA 3HOYB 2CW0C 1JWUD 5C4JB 4KJNA 4EQNA 5ELCA 1S4ZA 1SYCA 2K28A 1Y69U 3FKIB 4DA2A 5CORA 2Z4HA 2SEBD 2K5QA 2YYZA 1PRTB 1WTWA 1KAAA 1CQVA 2WKDA 1RJTA 5BN3A 1ILQA 2LY7A 4J1MA 1HFNA 5IGDA 1MSHA 1EOTA 1EZ6A 3J81L 1D6EC 1KDCA 2VNUD 1EIGA 3VA7A 4RGTA 4ZUJA 2RDGA 3PUYA 5LHY1 2KA7A 5IT9E 2EJGC 1L0XB 4HMIA 1DZ1A 2PZWA 1RF2D 3TP5A 1TKWB 1M4VA 2DY8A 2L12A 3S2HB 1S5CD 4IUPA 4FYDA 4K14A 3PUXA 3VYRA 3DEPA 3RUZA 3GD7A 1ML0D 3Q23A 3R93A 2D62A 3WOFA 5IOCA 2EYJA 3D3RA 3CKIB 4G7ZC 3TBIB 4J8QA 2F0WA 2X6GA 1XYIA 1HFGA 1IL8A 1IYVA 3GTJB 2XSCA 3GO5A 2JEAI 4Q5VA 5EBCA 5JVG3 3A56A 1ICWA 5DEHA 3OMGA 1PDQA 1SJHD 3HG9A 2IX3A 1PTOB 2CVRA 1SNPA 1EQVA 5E4WC 3MAQA 1IHZA 2A73B 1IKMA 2ICEC 4FF1A 3QOLA 1PLFA 1EEID 5KYLA 3C46A 3MA2B 3OMCA 1LT4D 1TS5A 3FDTA 3Q6SA 5EPKA 1EY5A 3L7ZC 3IFDA 2A6EC 2XNAC 4ZK9B 4A3MB 3MC0B 1Y1VB 1HUMA 2B2WA 4XYOA 3P7JA 4XYQA 2JA6B 4KN7C 3NBHA 3MVVA 1BBXC 1ONLA 1ENCA 5G3LF 3H94A 5M5WB 4CHTB 5EQ0A 2JP1A 2ZXRA 3R2TA 1TWCB 5FKAC 2OT2A 5KNCA 1ET9A 4KV6A 1O7ZA 4Y7NB 3N52A 5DM63 5FK9C 4A3BB 2IX1A 4ULLA 5LL6S 2NB0A 2F0TA 1B50A 2X69A 3V2TA 1V1PA 4F7XA 1LTBD 2IL8A 1H9SA 2F0UA 4X3TA 4TSSA 1IKLA 1SAPA 4Q0FA 3S1MB 5CGKA 2X6LA 5LL6X 4Z9CB 2B2UC 1AW7A 3BVMA 5KEEA 3ZYYX 2H4OA 2PCFB 1FNVA 2LS01 2N55A 1TS3A 3WDNA 2QKIC 2WINB 5AFWA 5C0XJ 2BDNA 1NAPA 3MXNA 3MFYA 4OO1I 4UAIA 1DYQA 2EY2A 3EVQA 4I7ZC 2BA0A 4OO1H 4K2KA 3SE0A 1RHPA 2A5HA 3ITPA 1CTMA 4B9XA 3HGBA 1ESRA 2TMPA 1AZPA 5CYUA 5HURA 2EY5A 3S17B 3I91A 3A54A 3H91A 1CQFA 1MI2A 2VXWA 4KY5A 4N9PA 3MXPA 4FF4A 4O1NA 1SXTA 1RODA 4R8NA 2OF1A 5J22A 4OL7A 3EJIA 2HDLA 1F9RA 4ABNA 3MHBA 4H44C 5K5PA 2M9VA 1AZQA 3Q24A 2H1EA 1QNUA 4NW2A 1CA5A 1AP0A 1Z6HA 4L63B 3OOCA 2B2WC 2EXZA 1V1OA 2J7ZA 1E2WA 1G6ZA 5JPMC 2R92B 1SNQA 4FVMA 1LTGD 4KD4A 4EGVA 3CHBD 3AB9A 1GUOA 3K6OA 4BA2I 1HTLD 3CU7A 5CV6A 3BDLA 2HUGA 4PNYA 4PQXA 1X3PA 4TQUS 2AUKA 3BYTB 1S5FD 5JVH3 4H0LC 3RLFA 1VF7A 4KKTA 3CRLC 3F2UA 3I70A 3O13A 5FO7B 5HGTA 1LTID 1R4QB 4O42A 2NN6I 1PFNA 3I73A 2DNEA 1TIID 3SK4A 4DAPA 1PMRA 4MHEA 3UI2A 2NZ1D 1I3QB 3OW7A 2L11A 1LACA 1ZYRC 5M5XB 3M7GA 2OXPA 3MXUA 3NXWA 3OSOA 1JR0D 3ND8A 4BBSB 4G4KA 4EVOA 2BE5D 4BY7B 3OWEB 3GTPB 2PNRC 4CBVA 1NSNS 2NYZD 1NR4A 4IFDI 1HA5A 4IFDH 2EJFC 3QB3A 4QB4A 1PFBA 1LLRD 4A3KB 2XN9C 3I4MB 3TZUA 1GUGA 5CMDA 1F2YA 1JWSD 2KCCA 4K8IA 2CW0D 5KGUA 4ZKCB 2I46A 1EY7A 3N6RA 4KKSA 2JYOA 2EYMA 1O7YA 2MHVA 2JE6I 3H6MA 2ZXOA 1CFMA 5I2XA 1SYDA 4OO1G 2WB1B 1OXXK 5A2QL 1E2VA 1H9MA 4IQZA 4BWGB 1XXGA 2N88A 1DONA 3J81E 2NVYB 3E5SA 2FMCA 2EOTA 5FLXL 1B3AA 5ELFA 3TZDA 5CBAE 2AUJD 2F0QA 3HOVB 5C4ZA 2M2LA 1G91A 3FPPA 4QF4A 2E2IB 5DM73 3BZDB 4WORA 3U9SA 1QNKA 5NUCA 2CHBD 3NTIA 2C9OA 4X3UA 1SYEA 4QMGA 4HAEA 4ZLTF 1ESFA 3FVQA 4G7OC 1J9OA 2VUMB 1LT3D 3J7AF 1D2BA 5J39A 1QILA 4FF2A 2K32A 1NUCA 5C5MA 5JAVA 1MGSA 3HP3A 1PZID 1FGBD 1XX8A 3IFTA 2PO4A 1PFMA 2BA1A 2WKCA 2D5DA 2KCNA 3C1FA 4A3GB 2PW5A 2B8GA 1BCPB 1D1IA 3VR3A 1GUNA 2PQEA 4FXDA 4OGQC 3M3YB 3I3CA 3SVMA 4A3DB 2A69C 1UNSA 1STEA 4FNFA 3D4DA 2A6ED 1UEAB 1G2TA 3W3AA 5D14A 2O5JC 3DWPA 3AMUA 1JOQA 4LJZC 1DXMA 1KDBA 5I4DA 1O80A 2FMMA 1YNJC 1E0BA 2E75C 4IFDG 4IURA 3MFGA 1EEFD 2LMCB 3S14B 1Q1BA 3IAYA 1A2TA 1FNWA 3DEOA 4A3IB 2Q8RE 3BDOA 1QOHA 4EQOA 1H9KA 3Q0AA 1KABA 4MIUA 3MWYW 1JCKB 2F0SA 5IGGA 2XRQD 4LK1C 2F3VA 2C5CA 4K5VA 2JA7B 3CRKC 4X3SA 2ICIA 4A3FB 3PO3B 2F0LA 3FMCA 4U68A 1PRTC 3J80L 1FR3A 2SDFA 1W6JA 4PMCA 3BS1A 4B9WA 4K6DA 4NDXA 5I9PA 2B2UA 2K1BA 4DU9A 4CGYB 2EYOA 3D31A 3NK9A 4LAAA 1HQMC 2F3WA 3R2IA 1EQTA 1SBBB 3K5LA 1U4LA 5C3EB 3TP7A 3D4WA 2F0HA 3NUCA 2O4XA 4PMWA 2F0DA 5K36H 3C3LA 3LX0A 1X32A 4ILWA 2K04A 1F2ZA 4RGOS 3DWQA 1WTRA 1OO9B 5C3WA 1IW7C 2OEOA 1RDPD 4IUUA 4ID6A 3MEHA 4RHRA 1ZEQX 2K33A 2IPKD 2B63B 3P1HA 2O5IC 3SK8A 4TKOB 5M3MB 5ELEA 5E3FA 4K5XA 5EKIA 3K5MA 4F88A 5JEAG 4RH6A 4RCNA 4ODGA 4ZRZA 1PTOC 5F2DA 3TSSA 1B44D 3OIQA 1DD2A 1JE4A 2XWBB 3K7AB 3NPPA 4NKLA 3L3OC 1C8CA 5IIFA 1MBYA 2EYFA 1QWYA 4YIJA 3R3OA 3PIP3 2TSSA 3I4LA 5E1FA 2F1MA 3LWUA 4XIGS 3H09A 1S5DD 3NSWA 3G6JB 4QUCA 1ZYRD 1Q3LA 2KVMA 1Z47A 2A68C 1SYGA 1SJED 3QJYA 4RKBA 1BUVT 1EU3A 1CHPD 2F0EA 1I6HB 1VDZA 2KEEA 1LO5D 1PXUA 2G9DA 2F0FA 2JXMB 4KKUA 5CV7A 1GJXA 1MSGA 2K5WA 1GHJA 3SR1A 1W6KA 1TVXA 2F0OA 4TRDA 3TMEA 1WTVA 3HS0C 5CV8A 1C4QA 4L8JA 5ISRA 1TY0A 4OIJA 2F0GA 3K0YA 3LWEA 3EQLC 1I6VC 2L55A 5CBEE 3HZXA 2EYHA 2Z8LA 1DOLA 3OHXC 1Z7TA 4CKEA 3M85A 4KTAA 2WACA 2DNCA 4AYBB 3PIO3 3GTGB 1EY0A 2MGSA 1WD1A 1SMYC 1OXTA 5EPJA 5CV5A 1JC7A 3TDQA 2F4IA 4ZQ3A 1SE3A 1PTOF 1SNOA 3NTHA 1ZXTA 3MZ5A 4IZ8A 5FO8B 5K36G 5IGEA 1TWAB 1GUSA 1U9RA 3NWSA 4QIWB 1UUPA 5IGFA 1OXSC 1JB3A 5C0XI 2E2HB 1EYDA 5FLXE 5C0XH 2F0MA 5EKKA 1A3UA 1CZGA 3NQIA 1IYUA 1EFID 1U4RA 3JAME 1V8QA 2KQ3A 2VB2X 2BDOA 3HOXB 3S16B 1Y8OB 1YNNC 1FNUA 4DK0A 1T5EA 1STYA 2WAQB 1STGA 4P2CB 4DAVA 2GA4B 3P75A 1CI3M 3SK5A 2RVLA 3T4AC 1Q1EA 1O78A 3I4NB 3NHHA 3OWFA 1ILPA 3RD4A 2RBMA 2NN6H 3GV6A 2IWHA 1BXTA 4KK7A 1RCVD 3FEWX 2XRSD 3GV3A 2O2LD 5KRUA 1SNMA 1VF5C 1CHQD 2NVQB 3KUPA 2MUYA 4H7BA 2K6AA 1Y8NB 4S3SA 1Y1WB 3HOUB 1RTOA 1U4MA 4HCSA 4XT3B 5IODA 3E0JA 1EU4A 2F0NA 1C48A 1EWHA 1STNA 1HA6A 1TY2A 5EGTA 3TN2A 1WTXA 2L1BA 3PO2B 2A69D 4CKCA 4BY1B 2BCOA 4E6IA 2JA8B 5C3XA 4XTCS 4XXEA 3PV0A 5IGCA 1UAPA 2PMZB 3E6ZX 1K83B 2RDHA 3R8BA 3ERQA 3LNNA 1A3TA 1YNJD 5COYA 3KBGA 3GTLB 3QO2A 1SE2A 3QOJA 4KHZA 1NR2A 5JJZA 3WOEA 1KTKA 2PZTA 1BDOA 2J0TD 2MP1A 4IALA 4C3IB 2A74C 4KI0A 4DK1A 3NTKA 1TR5A 1SYBA 1SE4A 3KBXA 4N9TA 1V43A 1PRTD 3T51B 1TT2A 3GQBA 3J80E 4FP5D 5D65A 5M9OA 1WCMB 4PV1C 5JEAJ 4DXFA 1ENAA 1HRJA 1Q8IA 4C2MB 2DY7A 2EDGA 3V05A 1RKNA 3C1EA 3IKJA 2JSOA 4M1UB 5EKLA 2KEDA 4C3HB 4RFBA 4C3JB 4HCEA 1QG7A 2KECA 5KIXA 3EROA 3HKZB 3U9OA 2B2YA 5JOBA 1QE6A 1HHVA 4KHVA 3GTMB 1MD2D 1KLUD 1IW7D 5DAUA 1NCVA 2ENBA 4C56C 2NN6G 3VR6A 5C6AA 2EPBA 3VYSA 3VYTA 5A35A 5KYIA 3GTKB 2K05A 1FD7D 1CA6A 1QB5D 2NVXB 5M5YB 1GUTA 1G291
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LV9 A;  4RWS C;  1ESR A;  2L9H A;  3I8Z A;  4QUF A;  1HFN A;  4ZK9 B;  1MSH A;  1U4P A;  2MP1 A;  1EOT A;  1DOK A;  5EPL A;  2RVL A;  1TVX A;  2FFK B;  2B2V C;  1AZP A;  1WTV A;  1EIG A;  1HUM A;  2B2W A;  2M2L A;  2RA4 A;  3P7J A;  1GUW A;  4IUT A;  1SDF A;  2B2Y C;  1SSO A;  1WTQ A;  1G91 A;  4IUU A;  3DEO A;  1ILP A;  4R8I A;  2Q8R E;  4CJ0 B;  3DM1 A;  3I91 A;  4OIJ A;  2HCC A;  1BBX C;  3H91 A;  1EIH A;  2Q8T A;  3LWE A;  1MI2 A;  2VXW A;  3GV6 A;  1BF4 A;  2XIW A;  5CBE E;  2RSN A;  3D6W A;  1B4O A;  1B2T A;  1DZ1 A;  2NYZ D;  4XDX A;  4ZKB B;  3MWY W;  1WD0 A;  1B53 A;  1NR4 A;  1DOL A;  1QNK A;  5EQ0 A;  1ROD A;  4IUV A;  2JP1 A;  2K01 A;  5T1I A;  2RSO A;  1DOM A;  3KBX A;  1A15 A;  2HDL A;  1F9R A;  3GV3 A;  4R9W A;  5EKI A;  2DY8 A;  4X3U A;  2KUM A;  2L4N A;  5T1G A;  2L12 A;  1PFB A;  4OIK A;  1EL0 A;  1CM9 A;  4HAE A;  4ZLT F;  4IUP A;  2B2T C;  3KUP A;  1J9O A;  2MGS A;  1WD1 A;  3DEP A;  1O7Z A;  4MN3 A;  4X3S A;  1AZQ A;  1ML0 D;  5D65 A;  1RTO A;  4XT1 B;  1U4M A;  2H1E A;  3N52 A;  4CJ1 B;  3R93 A;  2EE1 A;  5EPJ A;  4NW2 A;  1M8A A;  4DN4 M;  4HCS A;  4XT3 B;  1CA5 A;  4RAU C;  1AP0 A;  1BNZ A;  1JE4 A;  2B2W C;  1WTP A;  1HRJ A;  1B50 A;  2X69 A;  1VMP A;  1HA6 A;  2DY7 A;  2FJ2 A;  5CMD A;  1HUN A;  2J7Z A;  1F2L A;  4CJ2 C;  1C8C A;  2D9U A;  4U68 A;  1MGS A;  3HP3 A;  4X3K A;  1G6Z A;  2HCI A;  4ZKC B;  3TN2 A;  2X6G A;  2L1B A;  1WTO A;  1WTX A;  1ZXT A;  1VMC A;  4RA8 A;  2HDM A;  1XX8 A;  4HED A;  1XYI A;  1KNE A;  1HFG A;  1PFM A;  2IL8 A;  1IL8 A;  2JYO A;  2SDF A;  2KED A;  1WVL A;  2MJ8 A;  4IUQ A;  1O7Y A;  2R3Z A;  4X3T A;  2B2U A;  4ZAI A;  1IKL A;  1SAP A;  3FPU B;  2KOL A;  2K1B A;  1ICW A;  2X6L A;  4LMQ D;  2HUG A;  1JIC A;  1X3P A;  3I90 A;  1G2S A;  5EJW A;  2FHT A;  2B2V A;  1QG7 A;  1EQT A;  1PDQ A;  2B2U C;  2K03 A;  2KEC A;  3I3C A;  1RTN A;  5COY A;  1F9S A;  2B2Y A;  2CVR A;  3ONA B;  3SVM A;  4QUC A;  4HSV A;  1F9Q A;  1Q3L A;  1X3Q A;  1QE6 A;  2KVM A;  1U4L A;  2N88 A;  1S4Z A;  1HHV A;  3QO2 A;  2K28 A;  5E4W C;  3IL8 A;  1G2T A;  1DON A;  5DNF A;  3F2U A;  1U4R A;  5D14 A;  3MTS A;  4O42 A;  1NCV A;  2N55 A;  5COR A;  1IKM A;  5AFW A;  1NR2 A;  2BDN A;  1NAP A;  1X32 A;  5JJZ A;  1PLF A;  1PFN A;  2EOT A;  2KEE A;  4UAI A;  2K04 A;  1WTW A;  1J8I A;  2FIN B;  1BO0 A;  1KNA A;  2EPB A;  1B3A A;  3FDT A;  1RJT A;  3Q6S A;  4MHE A;  1F9P A;  2K05 A;  2MPM A;  1RHP A;  2B2T A;  5EPK A;  3TZD A;  5E4X A;  1O80 A;  2FMM A;  2NWG A;  1MSG A;  2NZ1 D;  3UI2 A;  1E0B A;  5CBA E;  1WTR A;  1CA6 A;  2L11 A;  3G7L A;  4IUR A;  1ILQ A;  3IFD A; 
#chains in the Genus database with same CATH topology
 2L9H A;  3I8Z A;  3GTM H;  1TU2 B;  3D6C A;  1U4P A;  5EPL A;  4C1N I;  1O7L A;  1LT5 D;  2AWO A;  2G9H D;  2K14 A;  1RD9 D;  1PTO D;  4KJO A;  3DM3 A;  4V19 0;  1EIH A;  3T56 B;  4GNX A;  3RZO H;  1B53 A;  3HEJ A;  1BCP C;  3CQZ B;  3QG1 A;  3DMU A;  1XTC D;  3HOU G;  4YWL A;  1CK1 A;  5DLQ E;  3STB D;  1TS4 A;  2R93 H;  4ZCK A;  3BG3 A;  1YHB A;  2XWJ B;  4XT1 B;  2L0C A;  5GRO A;  1EYC A;  3ND9 A;  4DV7 L;  1DCZ A;  1VQG A;  1I4G A;  3CQZ H;  3A8K E;  4ZYS A;  5JPN C;  3Q22 A;  1ET6 A;  2UXC L;  4RGM A;  2JA8 G;  2HCI A;  1QJO A;  5FO9 B;  2N8N A;  4DAY A;  2EJM A;  3W2D A;  2A68 D;  4IPH A;  4IUQ A;  1PYW D;  3SEB A;  3S1N H;  3DXJ C;  1TWH H;  2M00 A;  1LTT D;  1SND A;  5EBD A;  2UUA L;  3HOY H;  4A3L G;  2K5V A;  2XVS A;  4R4C A;  3RZD B;  1AFP A;  5C44 G;  3X3M A;  4HTH A;  2IY5 B;  2VW9 A;  3FKI H;  2J4X A;  4HSV A;  4F87 A;  3S2D B;  4JBJ A;  2R7Z B;  3S1R B;  1EOV A;  1Q90 A;  3BVG A;  2MFI A;  3M4P A;  1QVF A;  2E2D C;  3OIP A;  5FLM G;  3RZD H;  4GN5 A;  4OXP A;  3K58 A;  2FIN B;  4IJL A;  2Y0S G;  3FRP B;  1SFO B;  4KHP L;  2A6H D;  2VL6 A;  5E4X A;  2NWG A;  2LFN A;  3S2D H;  1FVI A;  2R7Z H;  4C3I G;  3J7Y W;  2XTI A;  5GAD C;  3KLS X;  1SEB D;  2PYK A;  1A2U A;  4RGN A;  1SR3 A;  2B2Y C;  1SMY D;  5ELB A;  4P71 A;  3TP8 A;  1LUZ A;  2Q8T A;  3PMF A;  2CH4 A;  3H15 A;  2NBF A;  2P5Z X;  4HMJ A;  4ZKB B;  2WB1 E;  3M4O B;  5T1I A;  4JV5 L;  3S9W A;  1A15 A;  5CV9 A;  4A3J B;  1HCZ A;  2KUM A;  2L4N A;  2D2C C;  5T1G A;  4FF3 A;  4IOA A;  2I0Q A;  4NMZ A;  4HJA A;  5IYD H;  2PZU A;  4LFC L;  1KRT A;  1BCP F;  3A8I E;  1DM0 B;  4NB3 A;  2EE1 A;  2B39 A;  2F03 A;  1M8A A;  1VQB A;  3BU2 A;  2QCP X;  3A7A B;  2OTL A;  1LAB A;  4KY6 A;  4R1J A;  3WWV A;  1GHK A;  4APV A;  4LFB Q;  3RMH A;  2FJ2 A;  2YTX A;  3NEL A;  4V0B A;  1KC8 C;  1VQ8 A;  4JK1 C;  2D9U A;  4X3K A;  3SGI A;  4KHP Q;  3GTJ H;  1WTO A;  5KND A;  1B9N A;  4HED A;  4C3H G;  4OON A;  1KNE A;  4DNT B;  4GNX C;  5BN4 A;  1K8O A;  4M8A A;  1X3F A;  2R3Z A;  3H0G G;  4C3J G;  3NQT A;  5IYB H;  3HKZ G;  1JIC A;  1HTP A;  1KL9 A;  3I90 A;  1PTO H;  2PQA A;  5EJW A;  2B2V A;  3UE0 A;  5M3F G;  1YNN D;  2K03 A;  2DN8 A;  1RTN A;  2CH4 W;  1F9S A;  2R6G A;  5HY6 A;  3ONA B;  4UDU C;  5FJ8 G;  4XQQ A;  1CT1 D;  2RKS A;  2CQA A;  3CCU A;  1HNW L;  3JAM i;  4JV5 Q;  2F3I A;  3G6E A;  1CKN A;  4JW0 A;  4EQP A;  3K5N A;  3PUW A;  1PRT F;  2EY6 A;  5KNB A;  4HID A;  4LFC Q;  1J8I A;  3K5O A;  1KNA A;  3I56 A;  3SDZ A;  3VR4 A;  1B3Q A;  1H9J A;  1Y1V H;  3T16 A;  4QCL A;  1DOK A;  4IOC A;  2NTT A;  1Q7Y C;  1HXY D;  2RQX A;  4H13 C;  1F2M A;  2E76 C;  1N9W A;  1EYA A;  5BN5 A;  2Z1C A;  1QUQ A;  2LSS A;  3KLS A;  1I4H A;  4BA1 I;  4JI4 L;  2IJ0 A;  3S15 B;  4CKB A;  2R93 G;  4POF A;  3KDF A;  4A3C G;  1ICF B;  3I2Z A;  5M5W H;  2BH8 A;  1JJC B;  4ME5 A;  2K4K A;  3NEM A;  4NP5 A;  1R4P B;  4GS3 A;  1TWC H;  4XDX A;  1KLG D;  1B8A A;  1I4X A;  1DOM A;  4R9W A;  4AIM A;  4Y7N H;  1N32 Q;  4A3B H;  3HRZ C;  5J1Z A;  1LTS D;  3AU7 A;  5ELD A;  5IT9 L;  1HNW Q;  4MN3 A;  2GVA A;  2BH2 A;  2EY1 A;  1JQY D;  5IYC G;  3F2B A;  4RAU C;  3HOY G;  1O7I A;  1L0Y B;  1I4P A;  1STB A;  1Y8P B;  2JEB I;  3HKS A;  4HR7 B;  1VMP A;  2A6H C;  5ELN A;  1HNX L;  1PH5 A;  1BR9 A;  1HUN A;  5C4X B;  1GOZ A;  1F2L A;  3FKI G;  2E74 C;  2UXB L;  3V96 A;  1K9M C;  1VMC A;  4RA8 A;  2HDM A;  5IWA L;  3BJU A;  5CV4 A;  3P20 A;  3CCL A;  4WRD A;  3OW2 A;  3K57 A;  3S1M H;  2LKV A;  2CKZ B;  2EYL A;  2R61 A;  3SK6 A;  1EUJ A;  3CCV A;  4GOP A;  1LTL A;  3CCE A;  2OQK A;  3FPU B;  2KOL A;  4LMQ D;  1EY4 A;  1PZJ D;  1XWE A;  1GXD C;  1Y14 B;  3KLR A;  1VQJ A;  4DXG A;  1SNC A;  1IBM L;  2A8V A;  3T13 A;  2R7Z G;  5IGB A;  1F9Q A;  5A2Q E;  3GTQ B;  1UWV A;  2A19 A;  5I6Y A;  1VQP A;  1I50 B;  2IX0 A;  3QWN A;  2QGQ A;  3H3V C;  3X3N A;  1VCI A;  4DF7 A;  1PZK D;  2K75 A;  3J7A V;  1DJR D;  2HHH L;  2HD3 A;  5D3D A;  2WFW A;  1BQQ T;  1F9P A;  1EWC A;  4KMU C;  3CCS A;  1H9R A;  1FYC A;  3HOW B;  1HQR D;  4K8J A;  3SXH A;  1LV9 A;  1I50 H;  1HNX Q;  2Q8I B;  2HIV A;  5I6W A;  3VR5 A;  2QIL A;  3CC4 A;  1TS2 A;  2B2V C;  2FFK B;  5CC4 A;  5IYD G;  3S17 H;  3NE5 B;  2AQ3 B;  2RA4 A;  2UXB Q;  3A5Z B;  1LTA D;  5TSS A;  3J81 c;  5FOB B;  1GUW A;  3J81 i;  1VQN A;  2ZM6 L;  5IWA Q;  3KF8 A;  2ID0 A;  2JA9 A;  2GN5 A;  4K2L A;  1FGU A;  4A93 B;  3T1H L;  2LXJ A;  1OXU A;  3D6W A;  1B4O A;  2Z4I A;  4K5W A;  1V1P B;  2RSO A;  3S1Q B;  1YBY A;  4B08 A;  1A0I A;  4FO2 A;  4XQN A;  1R9T B;  2KHS A;  1EZ8 A;  2QDL A;  4K0K L;  1OXV A;  1IBM Q;  3OPO A;  1CM9 A;  2V1C C;  1H9S B;  3J80 i;  1J5E L;  4JI6 Q;  1J6Q A;  4LFA L;  1F77 A;  4IFD J;  2PW7 A;  5IYB G;  4DN4 M;  2MNA A;  4JOI A;  1HZC A;  4K6L A;  1BNZ A;  1EFW A;  1L1O B;  2R92 H;  4GKK L;  1TWG B;  1R9T H;  3K81 C;  3DLL A;  3DHQ A;  4YY3 Q;  2HHH Q;  1D1K A;  5I2Y A;  1EY9 A;  4I65 A;  1EY6 A;  1B9M A;  5JJL A;  1KDA A;  1B1Z A;  3NBI A;  4KN4 C;  2MJ8 A;  2K7V A;  2RDF A;  4IUN A;  4DV2 L;  1CZW A;  3TEH B;  3EFX D;  3MXN B;  1X65 A;  2ZM6 Q;  4WJW A;  2JQO A;  5J3B A;  2V4D A;  1ENF A;  2DUD A;  1Y1V G;  1PH2 A;  1AE2 A;  1NJI C;  3IL8 A;  5DNF A;  4PZ7 A;  3KJO A;  3MTS A;  4K0K Q;  1J5E Q;  5IP9 H;  3A8J E;  2AKW B;  4WFN 3;  1S5E D;  4LFA Q;  3CCM A;  3K80 C;  1BO0 A;  1VQA A;  4CJ1 B;  4GOP C;  2B2T A;  3VA5 A;  2EZV A;  2ZXP A;  4BBS H;  2K5D A;  3G71 A;  1BCP D;  1T5X D;  2MO0 A;  4RWS C;  4GKK Q;  3PUV A;  1TWF B;  1NMG A;  1I94 Q;  4BY7 H;  4A3B G;  5C44 B;  2ZT9 C;  4YWK A;  4JI1 L;  4DV1 L;  1WTQ A;  1MJC A;  4R8I A;  3DM1 A;  1JJG A;  2KCM A;  2HCC A;  4OEM B;  1PYS B;  1BF4 A;  4DUY L;  2XIW A;  2RSN A;  4DV2 Q;  2WII B;  1B2T A;  4LUV A;  2E2J B;  1HR0 L;  3M7N A;  3TP6 A;  2NUC A;  1TWF H;  1D5Z C;  1G8Z D;  2Y0S B;  2SOB A;  2PPB C;  1EYG A;  4NXN L;  1XNR L;  5CR3 A;  3URY A;  1EL0 A;  4A3K H;  4HSP A;  1YJW A;  1Q82 C;  2Q2I A;  3I4M H;  4L5S A;  5GAG C;  2SNM A;  4BBR B;  1JOO A;  3L9A X;  5C4X G;  4ZUI A;  4UP8 A;  1EY8 A;  1XTD A;  4RKL A;  1WTP A;  4A4I A;  1VQ5 A;  1Q12 A;  1TQO A;  1N33 Q;  1JOR A;  2QEJ C;  4CJ2 C;  3BDC A;  1RL2 A;  1STA A;  3J7A 5;  1BVS A;  1I4Q A;  2HQE A;  4B3S L;  3VYU A;  3KF6 A;  4FXK C;  5G3L D;  4BBR H;  3UDF A;  2KJX A;  3CCJ A;  4EX5 A;  3M4Y A;  3TRE A;  4BS9 A;  3VR2 A;  3A74 A;  1PH1 A;  1E2Z A;  1I4R A;  3K0X A;  3HOZ B;  2F0P A;  1LTR D;  3KOJ A;  1VQE A;  4JI1 Q;  1G2S A;  4DV1 Q;  4G7H C;  4J6H A;  1PH8 A;  4XQJ A;  1HNZ L;  3FP9 A;  2WV6 D;  3OTO L;  3A7L A;  4DUY Q;  2AQ2 B;  1X3E A;  4G57 A;  4IN3 A;  1II3 A;  4JOI C;  4RCO A;  3JAM L;  5C0X G;  1JWM D;  1HR0 Q;  1X3Q A;  2UXD L;  2NVY H;  3D8G A;  4QGU A;  3KYH C;  3BVZ A;  3HOZ H;  2EYP A;  4AYB E;  4NXN Q;  3EA6 A;  4KD3 A;  4FXG C;  1XNR Q;  1EQR A;  1HPC A;  2AWN A;  4JCV E;  2VB3 X;  2FXQ A;  2AHO B;  1N8R C;  2ZTE A;  1AEX A;  4U67 3;  1PH6 A;  1PV4 A;  2F0V A;  1QVG A;  5I9O A;  3H0G B;  3HOV H;  1JOK A;  1ZKO A;  4KY7 A;  3RN5 A;  2MPM A;  2QDB A;  1CKM A;  4A3E B;  3SHL A;  1BOS A;  3DWA A;  4DV3 Q;  2YU9 B;  4DR1 Q;  1AN8 A;  2EVB A;  3G7L A;  5C4H A;  1CSQ A;  1KXL A;  4GZY C;  4QUF A;  4F8M A;  4DUZ L;  4Y52 H;  5M3F B;  1SYF A;  3C2P A;  2BOS A;  3GP7 A;  1K8A C;  2NVT B;  4GLA C;  2E2I H;  3KK7 A;  2WP8 J;  1C0A A;  3NP8 A;  1SDF A;  3NWT A;  1SSO A;  4IUT A;  4B3S Q;  1HZA A;  1LT6 D;  1K8M A;  3E0E A;  4CJ0 B;  3BYY B;  2YU9 H;  4A3E H;  2SNS A;  4DR4 L;  3CC2 A;  3T1Y Q;  2CFM A;  3MXG A;  2R92 G;  4QIW E;  4PMB A;  1VQH A;  2IT1 A;  1WD0 A;  4IUV A;  4DNR B;  2K01 A;  3DUZ A;  1AH9 A;  4WJ4 A;  2IW3 A;  2NVT H;  1A6X A;  4RHS A;  1HNZ Q;  2VUM H;  3RZO B;  4JC0 A;  5E7N A;  5JEA H;  2BE5 C;  4OIK A;  4I7A A;  2I07 B;  2B2T C;  4NPS A;  2B8F A;  4DGZ A;  4C1N K;  1WFQ A;  2Q2U A;  3K59 A;  3GTO B;  2R93 B;  1AE3 A;  3I72 A;  4OHJ A;  2JA5 B;  4GLV B;  5D3I B;  5C5L A;  1D5X C;  1OTC A;  2QF7 A;  1VQK A;  1UE6 A;  2IHE A;  3AQQ A;  2NTS A;  3E3X A;  2WAQ E;  4B3T L;  4A3G H;  5GAH C;  3D4R A;  2E5L L;  3PUZ A;  1STH A;  2F0I A;  1A3V A;  2L5T A;  4JBW A;  1QCB D;  1WVL A;  3QIA A;  4HIM A;  1YNX A;  4B3R Q;  2C35 B;  2JA5 H;  3M3Y H;  3JC6 6;  1S5B D;  3A55 A;  4ZAI A;  4HN7 A;  1D5M C;  3ICE A;  4DR3 L;  2F0J A;  3T53 B;  4L6T B;  2ZTC A;  2FHT A;  2AQ1 B;  4DFA A;  3S1N B;  1XPU A;  1TWH B;  2CQO A;  4MTK A;  2F0K A;  4BBS G;  4L5R C;  1KRS A;  3HOY B;  4DR4 Q;  2CW0 C;  1JWU D;  5C4J B;  4KJN A;  4EQN A;  5H1S E;  5ELC A;  4BY7 G;  1S4Z A;  1SYC A;  2K28 A;  1Y69 U;  3FKI B;  4DA2 A;  4AH6 A;  3CC7 A;  5COR A;  2Z4H A;  2SEB D;  2K5Q A;  3PCO B;  2YYZ A;  1PRT B;  4P72 A;  1WTW A;  1KAA A;  1CQV A;  2WKD A;  1KAW A;  5C4J H;  1RJT A;  1HZB A;  5BN3 A;  1ILQ A;  2LY7 A;  4J1M A;  3S14 H;  1HFN A;  5IGD A;  1MSH A;  1EOT A;  1EZ6 A;  3J81 L;  4A3I H;  4A3K G;  1Z9F A;  1D6E C;  4B3T Q;  1KDC A;  4N8F A;  1EIG A;  3VA7 A;  2VNU D;  3VDY A;  3I4M G;  4RGT A;  4ZUJ A;  2RDG A;  3PUY A;  5LHY 1;  2KHJ A;  2KA7 A;  5IT9 E;  2EJG C;  4DR2 L;  1L0X B;  1WTH A;  4LF7 L;  4HMI A;  3CXC A;  1DZ1 A;  1Q8K A;  2PMZ E;  2PZW A;  4DV5 L;  1RF2 D;  4DR3 Q;  4DV7 Q;  2D0P A;  3TP5 A;  1TKW B;  1M4V A;  2K52 A;  2DY8 A;  1X6O A;  1IZ6 A;  2L12 A;  3S2H B;  1S5C D;  4IUP A;  4FYD A;  4K14 A;  4BBR G;  2UXC Q;  3PUX A;  3VYR A;  3DEP A;  3RUZ A;  3GD7 A;  2WB1 G;  1ML0 D;  5BR8 L;  3Q23 A;  1JT8 A;  3PO3 H;  4POG A;  3R93 A;  4DK3 C;  2D62 A;  3WOF A;  5IOC A;  2KEN A;  2EYJ A;  3D3R A;  3CKI B;  4G7Z C;  3TBI B;  2UUA Q;  3S2H H;  4J8Q A;  2F0W A;  2X6G A;  1XYI A;  4JPB W;  1HFG A;  1IL8 A;  1XPR A;  3HOZ G;  1IYV A;  3GTJ B;  4UP7 A;  3TQY A;  2XSC A;  3GO5 A;  1EIF A;  2JEA I;  4Q5V A;  5EBC A;  5JVG 3;  3A56 A;  1ICW A;  4GNX B;  4HIK A;  5DEH A;  2RCF A;  2Q2H A;  4YWM A;  3OMG A;  1PDQ A;  1SJH D;  3HG9 A;  2IX3 A;  4DR2 Q;  5C3E H;  4X65 L;  4LF7 Q;  1PTO B;  2CVR A;  4LF4 L;  1D7Q A;  1NMF A;  2F4V L;  1SNP A;  1EQV A;  4YCU A;  4X64 L;  5E4W C;  3MAQ A;  1PH4 A;  2ZJQ A;  1IHZ A;  1G51 A;  2A73 B;  2N49 A;  1IKM A;  2ICE C;  1XJV A;  4FF1 A;  3QOL A;  1PLF A;  4ME3 A;  1EEI D;  5KYL A;  4A3E G;  3C46 A;  3MA2 B;  3OMC A;  5BR8 Q;  1LT4 D;  1TS5 A;  2QW7 A;  4OWW B;  1NTG A;  3FDT A;  3Q6S A;  5FLX c;  5EPK A;  1EY5 A;  4KLK A;  3L7Z C;  3IFD A;  2VUM G;  4NXM L;  2A6E C;  4DV4 L;  2XNA C;  4ZK9 B;  4A3M B;  3MC0 B;  3JAM c;  1Y1V B;  3TRZ A;  1HUM A;  2ALY B;  2B2W A;  4XYO A;  3K7U C;  4QY7 A;  1MIU A;  3P7J A;  1X56 A;  4XYQ A;  2B63 H;  2JA6 B;  4KN7 C;  3F8T A;  3NBH A;  3Q8D A;  3U4V A;  3MVV A;  1BBX C;  1ONL A;  4A75 A;  1ENC A;  1IBK L;  5LMN L;  5G3L F;  4R4Q A;  1ASZ A;  3H94 A;  5M5W B;  4CHT B;  1Q86 C;  5EQ0 A;  2ATW A;  4A3M H;  2JP1 A;  2EXD A;  3PGZ A;  2ZXR A;  3R2T A;  3HKZ E;  1TWC B;  5FKA C;  2OT2 A;  5KNC A;  3U58 A;  4LW1 A;  2JA6 H;  1ET9 A;  4X65 Q;  1U0L A;  3CCQ A;  4LF4 Q;  4KV6 A;  2F4V Q;  1O7Z A;  4Y7N B;  4HJ7 A;  2JA5 G;  4X64 Q;  3CPW A;  3K7A H;  3N52 A;  5DM6 3;  5FK9 C;  4A3B B;  2IX1 A;  2CWA A;  3M4Q A;  4ULL A;  3PQI A;  1UE7 A;  5LL6 S;  2NB0 A;  2VS1 A;  1K3B C;  3U4Z A;  2F0T A;  3CW2 C;  2X69 A;  3V2T A;  1B50 A;  1V1P A;  5AJ3 L;  4DV0 L;  1B70 B;  4F7X A;  1LTB D;  2IL8 A;  1H9S A;  2F0U A;  1YIT A;  4NXM Q;  4X3T A;  4TSS A;  1BBW A;  2VQF L;  1IKL A;  1SAP A;  4Q0F A;  3S1M B;  4OX9 L;  5CGK A;  2X6L A;  5LL6 X;  4Z9C B;  3UE1 A;  1UE1 A;  4JI7 L;  2H5X A;  2B2U C;  1SRU A;  1GVP A;  3EIV A;  5LMN Q;  1XMQ L;  1AW7 A;  3BVM A;  5KEE A;  3ZYY X;  1I6H H;  4EQ5 A;  2Q2T A;  2H4O A;  2PCF B;  1FNV A;  4UY8 C;  2LS0 1;  2N55 A;  1TS3 A;  3WDN A;  2QKI C;  2WIN B;  5AFW A;  5C0X J;  2BDN A;  1NAP A;  1E1O A;  3MXN A;  5IY0 A;  3MFY A;  4JI4 Q;  4HIO A;  4OO1 I;  4UAI A;  1DYQ A;  2EY2 A;  3EVQ A;  4I7Z C;  2BA0 A;  4OO1 H;  4K2K A;  3L0O A;  3SE0 A;  1YHQ A;  1RHP A;  2A5H A;  1X55 A;  3ULP A;  2VZA A;  3ITP A;  4IPC A;  1PHJ A;  1CTM A;  3HGB A;  4B9X A;  1ESR A;  4A76 A;  2TMP A;  3B6Y A;  2HQL A;  3G4S A;  5JJI A;  5AJ3 Q;  1AZP A;  4P73 A;  3M9B A;  5CYU A;  5HUR A;  3PO3 G;  2EY5 A;  3H3V I;  3S17 B;  3I91 A;  3A54 A;  3H91 A;  1CQF A;  3H3V H;  1MI2 A;  2VXW A;  4KY5 A;  1S72 A;  2VQF Q;  4N9P A;  3MXP A;  1NY4 A;  4FF4 A;  4OX9 Q;  4O1N A;  1SXT A;  1ROD A;  4R8N A;  2OF1 A;  1XMO L;  5J22 A;  4OL7 A;  3EJI A;  2HDL A;  1F9R A;  3GTG H;  4ABN A;  3MHB A;  4H44 C;  3UDX A;  5K5P A;  2K5H A;  2IHF A;  1KIX A;  1XMQ Q;  1CKN B;  4B3M L;  2M9V A;  4UHV A;  3EN2 A;  1AZQ A;  3Q24 A;  2H1E A;  3NEN A;  1QNU A;  4GN3 B;  4NW2 A;  1CA5 A;  1VS0 A;  1AP0 A;  4TVA B;  1Z6H A;  4L63 B;  3OOC A;  3CD6 A;  5GAE C;  1V9P A;  1YHA A;  2B2W C;  4LUO A;  3MEF A;  2K5N A;  2EXZ A;  1V1O A;  5C3E G;  1VQL A;  1E1T A;  2J7Z A;  1E2W A;  1G6Z A;  5JPM C;  2R92 B;  2ASB A;  1CSP A;  1SNQ A;  4FVM A;  1FJG L;  1LTG D;  4KD4 A;  4EGV A;  3CHB D;  1TWA H;  4MTN A;  1VQM A;  3J80 c;  2EIF A;  3AB9 A;  1GUO A;  3K6O A;  4BA2 I;  1HTL D;  3ER0 A;  3CU7 A;  4JG2 A;  4CDD C;  3E9H A;  5CV6 A;  3BDL A;  2E2H H;  2HUG A;  4PNY A;  4PQX A;  1X3P A;  4TQU S;  2AUK A;  3BYT B;  1S5F D;  3S24 A;  5JVH 3;  4H0L C;  3KJP A;  2R7D A;  3RLF A;  1VF7 A;  4KKT A;  3CRL C;  3F2U A;  3I70 A;  1SMX A;  3O13 A;  5FO7 B;  5HGT A;  1LTI D;  1R4Q B;  4O42 A;  2B63 G;  2NN6 I;  2UU9 L;  3KFU A;  3L2P A;  1PFN A;  3I73 A;  2DNE A;  1TII D;  3SK4 A;  4DAP A;  1PMR A;  4MHE A;  3UI2 A;  4A3M G;  2NZ1 D;  1I3Q B;  3OW7 A;  5JJK A;  1GO3 E;  3T1H Q;  2L11 A;  1LAC A;  1ZYR C;  5M5X B;  3M7G A;  3I4N H;  2OXP A;  3MXU A;  3NXW A;  3OSO A;  4LF8 L;  1JR0 D;  1W3S A;  3ND8 A;  4BBS B;  3I4O A;  2JA6 G;  4G4K A;  4EVO A;  2BE5 D;  1W2B A;  1K0R A;  1FJG Q;  4BY7 B;  3OWE B;  3GTP B;  1K8G A;  2PNR C;  1SN8 A;  4CBV A;  1I3Q H;  1VQ4 A;  1NSN S;  5M5X H;  2NYZ D;  1NR4 A;  4IFD I;  1S3O A;  1HA5 A;  2NVQ H;  4IFD H;  2EJF C;  1Y1W H;  3HOU H;  3QB3 A;  4QB4 A;  1PFB A;  3GTP H;  3A0J A;  1LLR D;  1VQI A;  1ASY A;  4A3K B;  2XN9 C;  4GKJ L;  3I4M B;  3TZU A;  4X62 L;  3PO2 H;  1GUG A;  2KCT A;  1IL2 A;  5CMD A;  4DPG A;  5ELO A;  4BY1 H;  4YCW A;  1B7Y B;  1E22 A;  1F2Y A;  1JWS D;  2KCC A;  4K8I A;  2JA8 H;  2ZTD A;  2CW0 D;  5KGU A;  4ZKC B;  2OWO A;  2I46 A;  1SRO A;  3LGJ A;  1EY7 A;  3N6R A;  4KKS A;  2JYO A;  2Z0S A;  2CWP A;  4LF8 Q;  2EYM A;  1O7Y A;  1YJ9 A;  2MHV A;  2JE6 I;  3H6M A;  1K83 H;  2ZXO A;  1KQS A;  1CFM A;  5I2X A;  1SYD A;  4OO1 G;  2WB1 B;  1OXX K;  3UDG A;  3GTL H;  5A2Q L;  1H95 A;  2ZJP A;  1E2V A;  1H9M A;  4IQZ A;  4BWG B;  1XXG A;  2N88 A;  2HIX A;  1DON A;  1E7Z A;  4IPG A;  2CCZ A;  3AFQ A;  2YTY A;  3J81 E;  2NVY B;  3E5S A;  4UPA A;  2FMC A;  2EOT A;  5HGQ A;  5FLX L;  4JBM A;  1B3A A;  5ELF A;  3TZD A;  5CBA E;  2AUJ D;  2F0Q A;  4X62 Q;  3HOV B;  5C4Z A;  1MKH A;  3PIO A;  2M2L A;  3IRB A;  4FDB A;  1G91 A;  2MQH A;  3FPP A;  4QF4 A;  2E2I B;  5DM7 3;  2YTV A;  3BZD B;  4WOR A;  3U9S A;  4GLX A;  1QNK A;  5NUC A;  2CHB D;  4DR6 L;  3NTI A;  2C9O A;  4X3U A;  4R4O A;  1SYE A;  1XPO A;  1CUK A;  1PH9 A;  4QMG A;  4HAE A;  4ZLT F;  1ESF A;  1WCM H;  3FVQ A;  4G7O C;  1J9O A;  2VUM B;  4X66 L;  1LT3 D;  3E9I A;  3J7A F;  1D2B A;  3G48 A;  4C2M H;  1VQ9 A;  5J39 A;  1PVO A;  1YJN A;  1QIL A;  4AQY L;  4FF2 A;  1PH7 A;  2K32 A;  1NUC A;  5C5M A;  5JAV A;  3HP3 A;  1MGS A;  1PZI D;  1FGB D;  1XX8 A;  3IFT A;  2PO4 A;  1PFM A;  2BA1 A;  3OTO Q;  1S40 A;  2WKC A;  2D5D A;  1HR0 W;  2KCN A;  3C1F A;  4A3G B;  2PW5 A;  2UXD Q;  2B8G A;  2R7F A;  1BCP B;  2WAQ G;  1D1I A;  3VR3 A;  3AEV A;  1GUN A;  2PQE A;  4FXD A;  4OGQ C;  3M3Y B;  1G6P A;  2DGY A;  1RIP A;  3F1Z A;  1LM0 A;  4JI3 L;  3I3C A;  3CME A;  5FJ8 H;  3SVM A;  3I4N G;  4A3D B;  1A8V A;  2A69 C;  1UNS A;  1STE A;  4FNF A;  2OCE A;  3D4D A;  2A6E D;  1UEA B;  4DR6 Q;  1G2T A;  3W3A A;  5D14 A;  2O5J C;  1IBL L;  4DUZ Q;  3DWP A;  4YHH L;  3AMU A;  1JOQ A;  3GTK H;  5IP9 G;  1IYJ B;  4DV6 L;  2JK8 A;  4X66 Q;  2NVX H;  4LJZ C;  5M5Y H;  1DXM A;  1K3R A;  1KDB A;  4A3D H;  5I4D A;  1O80 A;  2FMM A;  1YNJ C;  1E0B A;  4AQY Q;  2B29 A;  2E75 C;  4IFD G;  1X54 A;  4IUR A;  4JVZ A;  3U50 C;  1Y1W G;  4H02 A;  3KF6 B;  4WJ3 M;  3MFG A;  1EEF D;  2LMC B;  3S14 B;  1QZG A;  4A3C H;  1Q1B A;  4MNO A;  3IAY A;  1A2T A;  4LF6 L;  1FNW A;  3DEO A;  4A3I B;  2Q8R E;  2NZO A;  3BDO A;  1QOH A;  4EQO A;  1H9K A;  3Q0A A;  3ULL A;  1KAB A;  3PO2 G;  3QR8 A;  4MIU A;  1K0S A;  3MWY W;  1JCK B;  2I5H A;  4BY1 G;  2F0S A;  5IGG A;  1NE3 A;  2XRQ D;  4LK1 C;  2F3V A;  2D0O A;  4JI5 L;  1XNQ L;  2C5C A;  4K5V A;  4JI3 Q;  2JA7 B;  4DR5 L;  3CRK C;  4X3S A;  4LUZ A;  2ICI A;  2E5L Q;  4P75 A;  5IYC H;  2Z9H A;  4A3F B;  1IBL Q;  4YHH Q;  3PO3 B;  4JI0 L;  2LXK A;  4DV6 Q;  2F0L A;  3FMC A;  4U68 A;  2JA7 H;  1PRT C;  2B3G A;  4QQB X;  3J80 L;  1FR3 A;  3CAM A;  2SDF A;  1W6J A;  1QVC A;  4PMC A;  3RLO A;  3BS1 A;  4A3F H;  4B9W A;  4K6D A;  4NDX A;  1QZH A;  5I9P A;  2B2U A;  4LFB L;  3K8A A;  2K1B A;  2VQE L;  4DU9 A;  4CGY B;  4LF6 Q;  2EYO A;  3D31 A;  3NK9 A;  2ZJR A;  4LAA A;  1HQM C;  1BKB A;  2F3W A;  3R2I A;  1EQT A;  1Q81 C;  1SBB B;  1X9N A;  1JB7 A;  3S1R H;  3AFP A;  4L5T A;  3K5L A;  4PG3 A;  1U4L A;  2Y0S E;  5C3E B;  1WI5 A;  3ERS X;  3TP7 A;  3D4W A;  2F0H A;  3NUC A;  2O4X A;  4IPD A;  2F0D A;  4PMW A;  4JI5 Q;  3C3L A;  1XNQ Q;  5K36 H;  3CPF A;  4PZ6 A;  3LX0 A;  1SFO H;  1C7Y A;  1SE8 A;  2UUC L;  1X32 A;  4ILW A;  5LMU L;  5IP7 H;  4DR5 Q;  5L37 A;  2K04 A;  1F2Z A;  2NZH A;  4RGO S;  3HOV G;  2HT1 A;  3DWQ A;  4IO9 A;  1WTR A;  4CDF C;  4PZ8 A;  4JI0 Q;  1OO9 B;  3W1B A;  3F2C A;  4J15 A;  4DV5 Q;  5C3W A;  1WCM G;  1IW7 C;  2K50 A;  4GN4 B;  2OEO A;  1RDP D;  3I55 A;  1P16 A;  4IUU A;  4ID6 A;  3MEH A;  4RHR A;  1ZEQ X;  3M4O H;  1NNX A;  2K33 A;  2IPK D;  2B63 B;  3P1H A;  2O5I C;  3SK8 A;  4A3J H;  2I5L X;  2VQE Q;  4TKO B;  4LNQ A;  4JBK A;  1E24 A;  5M3M B;  5ELE A;  5E3F A;  1HH2 P;  2L15 A;  4K5X A;  5EKI A;  3K5M A;  2N78 A;  4F88 A;  4DAY B;  5JEA G;  1VQ7 A;  2I5M X;  4RH6 A;  4R4I A;  4RCN A;  4ODG A;  4ZRZ A;  2JJQ A;  1PTO C;  5F2D A;  3TSS A;  2EQS A;  1B44 D;  2PNH A;  1MJE A;  3OIQ A;  1BBU A;  1DD2 A;  1JE4 A;  2XWB B;  3K7A B;  5M3M H;  3NPP A;  2UUC Q;  1N32 L;  5LMU Q;  4NKL A;  3L3O C;  3UDI A;  1C8C A;  5IIF A;  1WJJ A;  1PYB A;  3RNU A;  4A3G G;  1WOC A;  1MBY A;  2EYF A;  1QWY A;  3STB C;  2PI2 A;  4YIJ A;  3R3O A;  1KHI A;  3W5O A;  3PIP 3;  2TSS A;  1YIJ A;  2YV5 A;  3I4L A;  5E1F A;  1IXR A;  2G5D A;  3J7Z C;  2F1M A;  3LWU A;  2Z6K A;  4MZ9 A;  3H09 A;  4XIG S;  1S5D D;  2KBN A;  4A3D G;  2QEX A;  1N34 L;  3NSW A;  3G6J B;  4QUC A;  1ZYR D;  1Q3L A;  2KVM A;  1Z47 A;  2A68 C;  1SYG A;  1SJE D;  3QJY A;  4RKB A;  1BUV T;  4DV4 Q;  3FHW A;  1EU3 A;  4BXX H;  1CHP D;  2F0E A;  1I6H B;  1VDZ A;  2A1A A;  2KEE A;  1LO5 D;  1PXU A;  2G9D A;  1C9O A;  3OYY A;  2F0F A;  1L1O A;  2JXM B;  4KKU A;  5CV7 A;  4DK6 C;  1GJX A;  1MSG A;  2K5W A;  4LF5 L;  3S15 H;  1IBK Q;  1GHJ A;  3SR1 A;  1W6K A;  3PSI A;  1SLJ A;  1TVX A;  1M1K C;  2F0O A;  4TRD A;  3TME A;  1WTV A;  4A3I G;  1EWI A;  2OTJ A;  3HS0 C;  5CV8 A;  2KHI A;  1M90 C;  1C4Q A;  4L8J A;  5ISR A;  4LF9 L;  4HJ9 A;  1TY0 A;  1FL0 A;  4OIJ A;  2F0G A;  3K0Y A;  3PF5 A;  2MO1 A;  3LWE A;  3EQL C;  1I6V C;  2L55 A;  5CBE E;  1HZ9 A;  3HZX A;  2EYH A;  2Z8L A;  3J81 j;  1A62 A;  1DOL A;  1JJ2 A;  3OHX C;  2JA7 G;  3ULJ A;  1Z7T A;  4CKE A;  3M85 A;  4KTA A;  1N34 Q;  2WAC A;  2DNC A;  4AYB B;  3PIO 3;  3GTG B;  4DV0 Q;  1EY0 A;  2MGS A;  4A3F G;  1WD1 A;  1YEZ A;  1SMY C;  4RMF A;  1OXT A;  5EPJ A;  5CV5 A;  5C4X H;  1JC7 A;  3TDQ A;  2F4I A;  4ZQ3 A;  2PQA B;  3RR5 A;  1SE3 A;  1PTO F;  1SNO A;  3NTH A;  1N36 L;  4JI6 L;  1ZXT A;  4JI7 Q;  5LMN W;  3MZ5 A;  4IZ8 A;  4LF5 Q;  3TS2 A;  5FO8 B;  5K36 G;  1PFS A;  3NBH B;  2RHQ B;  5IGE A;  1TWA B;  5IP7 G;  1GUS A;  1U9R A;  3NWS A;  4QIW B;  4YY3 L;  1UE5 A;  1UUP A;  5IGF A;  1OXS C;  1PH3 A;  4LF9 Q;  1E3P A;  3I7F A;  1JB3 A;  1L0W A;  5C0X I;  2E2H B;  3GTQ H;  1EYD A;  5FLX E;  3A5U A;  5C0X H;  2F0M A;  5EKK A;  1A3U A;  4X6A H;  1CZG A;  1QUQ B;  2QA4 A;  3NQI A;  1IYU A;  1EFI D;  1U4R A;  3JAM E;  1V8Q A;  1LYL A;  3KDF B;  2KQ3 A;  2VB2 X;  2BDO A;  3HOX B;  3S16 B;  3HOW H;  1GD7 A;  1Y8O B;  4A3J G;  1YNN C;  1FNU A;  2RCN A;  4DK0 A;  1T5E A;  1STY A;  2WAQ B;  3GDE A;  1A63 A;  1STG A;  4P2C B;  4DAV A;  2GA4 B;  3P75 A;  2Z6K C;  1CI3 M;  4N8X 1;  3SK5 A;  2RVL A;  3T4A C;  1Q1E A;  1EQQ A;  1XMO Q;  1O78 A;  3HOX H;  3S16 H;  1N36 Q;  4DR7 L;  3I4N B;  4A93 H;  1K28 A;  3CCR A;  3NHH A;  1JMC A;  3OWF A;  1ILP A;  3RD4 A;  4JI8 L;  2RBM A;  4B3M Q;  2NN6 H;  3GV6 A;  2IWH A;  3S1Q H;  1BXT A;  5M3M G;  4KK7 A;  1RCV D;  1VQC A;  1I94 L;  3FEW X;  3EBE A;  1U5K A;  2XRS D;  3GV3 A;  4LWC A;  2O2L D;  5KRU A;  1SNM A;  1VF5 C;  3PF4 A;  1L1O C;  3CF5 A;  4QJF A;  1CHQ D;  2NVQ B;  3KUP A;  2MUY A;  4H7B A;  2K6A A;  4CDC C;  1Y8N B;  2RHS B;  4S3S A;  2E8G A;  1Y1W B;  3HOU B;  1RTO A;  4GOP B;  1U4M A;  1TWG H;  4HCS A;  4XT3 B;  5IOD A;  3E0J A;  1EU4 A;  2F0N A;  1C48 A;  1EWH A;  1UEB A;  4RG1 A;  1STN A;  1HA6 A;  4R4T A;  1TY2 A;  2F52 A;  2OQ0 A;  5EGT A;  3TN2 A;  1DGS A;  2L1B A;  1WTX A;  3PO2 B;  2A69 D;  4CKC A;  4BY1 B;  2BCO A;  4E6I A;  2JA8 B;  5C3X A;  3PIP A;  4XTC S;  2DJF C;  1VQF A;  1Q46 A;  4XXE A;  2ES2 A;  2UUB L;  4BXX G;  1NBW A;  1TXY A;  4DR7 Q;  3PV0 A;  1N33 L;  4UP9 A;  3CMA A;  2DJG C;  5IE8 A;  5IGC A;  1UAP A;  2PMZ B;  3CP0 A;  3E6Z X;  2UU9 Q;  1K83 B;  4JI8 Q;  2RDH A;  3R8B A;  3ERQ A;  2GVB A;  3LNN A;  1A3T A;  1YNJ D;  5COY A;  3KBG A;  1YVC A;  3GTL B;  3RLN A;  3QO2 A;  1SE2 A;  3QOJ A;  3D0F A;  4KHZ A;  1P8L A;  1I5F A;  1NR2 A;  3KF8 B;  5JJZ A;  3TS0 A;  1HJP A;  3WOE A;  1KTK A;  3HFZ B;  1WYD A;  4A3L H;  4HJ5 A;  2PZT A;  1KD1 C;  1BDO A;  1YI2 A;  5C44 H;  2J0T D;  2AMC B;  1L2F A;  4CDE C;  2MP1 A;  4OWX B;  4DNI A;  4IAL A;  4C3I B;  2A74 C;  3KLW A;  4KI0 A;  4DK1 A;  3NTK A;  4JI2 L;  2E2J H;  4DV3 L;  5FLM H;  4DR1 L;  2UUB Q;  4OEL B;  4JYA L;  4QL5 A;  1TR5 A;  1SYB A;  1SE4 A;  4GKJ Q;  3KBX A;  4N9T A;  1V43 A;  2N3S A;  4AYB G;  1VQD A;  1PRT D;  1T9H A;  3T51 B;  4C3I H;  1TT2 A;  3GQB A;  3J80 E;  3W1G A;  4FP5 D;  3T1Y L;  5D65 A;  5IT9 c;  5M9O A;  1VQO A;  1WCM B;  4O0A A;  4O2D A;  4P74 A;  2JN4 A;  4PV1 C;  5JEA J;  1V1Q A;  4DXF A;  1ENA A;  1HRJ A;  3F2D A;  2Z6B A;  1Q8I A;  4C2M B;  2DY7 A;  1K73 C;  3RN2 A;  2EDG A;  3BZK A;  3V05 A;  1RKN A;  3C1E A;  3IKJ A;  2JSO A;  4OWT B;  5EAY A;  1YZ6 A;  4M1U B;  5EKL A;  2KED A;  5GQO A;  1PA6 A;  4C3H B;  4RFB A;  4DAM A;  4YCV A;  1MHW C;  3HOW G;  1GM5 A;  1EIY B;  4ALP A;  1X3G A;  4C3J B;  4HCE A;  3ZJY C;  2XGT A;  4JI2 Q;  1QG7 A;  2KEC A;  5KIX A;  3ERO A;  3HKZ B;  1GKH A;  3U9O A;  1VQ6 A;  1CKO A;  2B2Y A;  4DKA C;  5JOB A;  4JYA Q;  4B3R L;  1QE6 A;  1HHV A;  4C3H H;  4KHV A;  3HOX G;  4A93 G;  3GTM B;  1MD2 D;  1KLU D;  1IW7 D;  5DAU A;  2PI2 E;  1JE5 A;  1D8L A;  1NCV A;  2ENB A;  3H0G H;  4IJH A;  4C3J H;  4C56 C;  4HJ8 A;  4L5Q A;  3GTO H;  2NN6 G;  3VR6 A;  3BZC A;  5C6A A;  2EPB A;  3VYS A;  3VYT A;  5A35 A;  5KYI A;  2RF4 A;  2K05 A;  3AYH B;  3GTK B;  5M3F H;  1FD7 D;  1CA6 A;  1QB5 D;  2VY3 A;  2NVX B;  5M5Y B;  1GUT A;  1G29 1; 
#chains in the Genus database with same CATH homology
 2L9H A;  3I8Z A;  1TU2 B;  3D6C A;  1U4P A;  5EPL A;  4C1N I;  1O7L A;  1LT5 D;  2AWO A;  2G9H D;  1RD9 D;  1PTO D;  4KJO A;  4V19 0;  1EIH A;  3T56 B;  1B53 A;  3HEJ A;  1BCP C;  3CQZ B;  3QG1 A;  3DMU A;  1XTC D;  1CK1 A;  1TS4 A;  3BG3 A;  2XWJ B;  4XT1 B;  2L0C A;  1EYC A;  3ND9 A;  1DCZ A;  1I4G A;  3A8K E;  4ZYS A;  5JPN C;  3Q22 A;  1ET6 A;  4RGM A;  2HCI A;  1QJO A;  5FO9 B;  4DAY A;  2EJM A;  3W2D A;  2A68 D;  4IUQ A;  1PYW D;  3SEB A;  3DXJ C;  2M00 A;  1LTT D;  1SND A;  5EBD A;  2XVS A;  3RZD B;  1AFP A;  3X3M A;  4HTH A;  2J4X A;  4HSV A;  4F87 A;  3S2D B;  2R7Z B;  3S1R B;  1Q90 A;  3BVG A;  2E2D C;  3OIP A;  3K58 A;  2FIN B;  3FRP B;  1SFO B;  2A6H D;  5E4X A;  2NWG A;  2LFN A;  4C3I G;  3J7Y W;  3KLS X;  1SEB D;  2PYK A;  1A2U A;  4RGN A;  2B2Y C;  1SMY D;  5ELB A;  3TP8 A;  2Q8T A;  3PMF A;  2NBF A;  4HMJ A;  4ZKB B;  3M4O B;  5T1I A;  3S9W A;  1A15 A;  5CV9 A;  4A3J B;  1HCZ A;  2KUM A;  2L4N A;  2D2C C;  5T1G A;  4FF3 A;  4NMZ A;  2PZU A;  1BCP F;  3A8I E;  1DM0 B;  2EE1 A;  2B39 A;  2F03 A;  1M8A A;  2QCP X;  3A7A B;  1LAB A;  4KY6 A;  1GHK A;  3RMH A;  2FJ2 A;  4V0B A;  4JK1 C;  2D9U A;  4X3K A;  1WTO A;  5KND A;  1B9N A;  4HED A;  4C3H G;  1KNE A;  4DNT B;  5BN4 A;  1K8O A;  4M8A A;  2R3Z A;  4C3J G;  3NQT A;  1JIC A;  1HTP A;  3I90 A;  1PTO H;  5EJW A;  2B2V A;  1YNN D;  2K03 A;  2DN8 A;  1RTN A;  1F9S A;  2R6G A;  3ONA B;  4UDU C;  4XQQ A;  1CT1 D;  2RKS A;  2CQA A;  4EQP A;  3K5N A;  3PUW A;  1PRT F;  2EY6 A;  5KNB A;  1J8I A;  3K5O A;  1KNA A;  3SDZ A;  3VR4 A;  1H9J A;  3T16 A;  4QCL A;  1DOK A;  2NTT A;  1HXY D;  2RQX A;  4H13 C;  1F2M A;  2E76 C;  5BN5 A;  1EYA A;  2Z1C A;  3KLS A;  1I4H A;  4BA1 I;  2IJ0 A;  3S15 B;  4CKB A;  4ME5 A;  4NP5 A;  1R4P B;  4XDX A;  1KLG D;  1I4X A;  1DOM A;  4R9W A;  3HRZ C;  5J1Z A;  1LTS D;  3AU7 A;  5ELD A;  5IT9 L;  4MN3 A;  2EY1 A;  1JQY D;  4RAU C;  1L0Y B;  1I4P A;  1STB A;  1Y8P B;  2JEB I;  4HR7 B;  1VMP A;  2A6H C;  1BR9 A;  1HUN A;  5C4X B;  1GOZ A;  1F2L A;  2E74 C;  3V96 A;  1VMC A;  4RA8 A;  2HDM A;  5CV4 A;  3P20 A;  4WRD A;  3K57 A;  2LKV A;  2EYL A;  2R61 A;  3SK6 A;  3FPU B;  2KOL A;  4LMQ D;  1EY4 A;  1PZJ D;  1XWE A;  1GXD C;  3KLR A;  4DXG A;  1SNC A;  3T13 A;  5IGB A;  1F9Q A;  5A2Q E;  3GTQ B;  5I6Y A;  1I50 B;  2IX0 A;  3QWN A;  3H3V C;  3X3N A;  1VCI A;  4DF7 A;  1PZK D;  3J7A V;  1DJR D;  5D3D A;  1BQQ T;  1F9P A;  1EWC A;  4KMU C;  1H9R A;  1FYC A;  3HOW B;  1HQR D;  4K8J A;  3SXH A;  1LV9 A;  2Q8I B;  5I6W A;  3VR5 A;  2QIL A;  1TS2 A;  2B2V C;  2FFK B;  5CC4 A;  3NE5 B;  2AQ3 B;  2RA4 A;  1LTA D;  5TSS A;  5FOB B;  1GUW A;  3KF8 A;  2ID0 A;  4K2L A;  4A93 B;  1OXU A;  3D6W A;  1B4O A;  2Z4I A;  4K5W A;  1V1P B;  2RSO A;  3S1Q B;  4B08 A;  4FO2 A;  4XQN A;  1R9T B;  2KHS A;  1EZ8 A;  1OXV A;  3OPO A;  1CM9 A;  1H9S B;  1F77 A;  4IFD J;  2PW7 A;  4DN4 M;  4K6L A;  1BNZ A;  1TWG B;  3DHQ A;  1D1K A;  5I2Y A;  1EY9 A;  4I65 A;  1EY6 A;  1B9M A;  1KDA A;  1B1Z A;  3NBI A;  4KN4 C;  2MJ8 A;  2K7V A;  2RDF A;  4IUN A;  1CZW A;  3EFX D;  4WJW A;  2V4D A;  1ENF A;  3IL8 A;  5DNF A;  3MTS A;  3A8J E;  4WFN 3;  1S5E D;  1BO0 A;  4CJ1 B;  2B2T A;  3VA5 A;  2EZV A;  2ZXP A;  2K5D A;  1BCP D;  1T5X D;  4RWS C;  3PUV A;  1TWF B;  5C44 B;  2ZT9 C;  1WTQ A;  4R8I A;  3DM1 A;  2HCC A;  1BF4 A;  2XIW A;  2RSN A;  2WII B;  1B2T A;  2E2J B;  3M7N A;  3TP6 A;  2NUC A;  1D5Z C;  1G8Z D;  2Y0S B;  2SOB A;  2PPB C;  1EL0 A;  5CR3 A;  3URY A;  4HSP A;  2SNM A;  4BBR B;  1JOO A;  3L9A X;  4ZUI A;  1EY8 A;  4RKL A;  1WTP A;  1Q12 A;  1TQO A;  1JOR A;  2QEJ C;  4CJ2 C;  3BDC A;  1STA A;  1I4Q A;  2HQE A;  3VYU A;  4FXK C;  5G3L D;  2KJX A;  3M4Y A;  4BS9 A;  3VR2 A;  1E2Z A;  1I4R A;  3HOZ B;  2F0P A;  1LTR D;  1G2S A;  4G7H C;  4J6H A;  4XQJ A;  2WV6 D;  3A7L A;  2AQ2 B;  4G57 A;  4IN3 A;  1II3 A;  3JAM L;  4RCO A;  5C0X G;  1JWM D;  1X3Q A;  3D8G A;  3BVZ A;  2EYP A;  3EA6 A;  4KD3 A;  4FXG C;  1HPC A;  2AWN A;  2VB3 X;  1AEX A;  4U67 3;  2F0V A;  5I9O A;  3H0G B;  1JOK A;  1ZKO A;  4KY7 A;  3GTO B;  2MPM A;  2QDB A;  4A3E B;  2YU9 B;  3SHL A;  1BOS A;  3DWA A;  1AN8 A;  2EVB A;  3G7L A;  5C4H A;  4GZY C;  4QUF A;  4F8M A;  5M3F B;  1SYF A;  3C2P A;  2BOS A;  3GP7 A;  2NVT B;  3KK7 A;  2WP8 J;  3NP8 A;  1SDF A;  3NWT A;  1SSO A;  4IUT A;  1LT6 D;  1K8M A;  4CJ0 B;  3BYY B;  2SNS A;  3MXG A;  4PMB A;  2IT1 A;  1WD0 A;  4IUV A;  4DNR B;  2K01 A;  3DUZ A;  2IW3 A;  1A6X A;  4RHS A;  3RZO B;  5JEA H;  2BE5 C;  4OIK A;  2I07 B;  2B2T C;  2B8F A;  4DGZ A;  4C1N K;  3K59 A;  2R93 B;  3I72 A;  4OHJ A;  2JA5 B;  5D3I B;  5C5L A;  1D5X C;  2QF7 A;  2NTS A;  3D4R A;  3PUZ A;  1STH A;  2F0I A;  1A3V A;  2L5T A;  4JBW A;  1QCB D;  1WVL A;  3QIA A;  1S5B D;  3A55 A;  4ZAI A;  4HN7 A;  1D5M C;  2F0J A;  3T53 B;  4L6T B;  2FHT A;  2AQ1 B;  4DFA A;  3S1N B;  1TWH B;  2F0K A;  3HOY B;  2CW0 C;  1JWU D;  5C4J B;  4KJN A;  4EQN A;  5ELC A;  1S4Z A;  1SYC A;  2K28 A;  1Y69 U;  3FKI B;  4DA2 A;  5COR A;  2Z4H A;  2SEB D;  2K5Q A;  2YYZ A;  1PRT B;  1WTW A;  1KAA A;  1CQV A;  2WKD A;  1RJT A;  5BN3 A;  1ILQ A;  2LY7 A;  4J1M A;  1HFN A;  5IGD A;  1MSH A;  1EOT A;  1EZ6 A;  3J81 L;  1D6E C;  1KDC A;  2VNU D;  1EIG A;  3VA7 A;  4RGT A;  4ZUJ A;  2RDG A;  3PUY A;  5LHY 1;  2KA7 A;  5IT9 E;  2EJG C;  1L0X B;  4HMI A;  1DZ1 A;  2PZW A;  1RF2 D;  3TP5 A;  1TKW B;  1M4V A;  2DY8 A;  2L12 A;  3S2H B;  1S5C D;  4IUP A;  4FYD A;  4K14 A;  3PUX A;  3VYR A;  3DEP A;  3RUZ A;  3GD7 A;  1ML0 D;  3Q23 A;  3R93 A;  2D62 A;  3WOF A;  5IOC A;  2EYJ A;  3D3R A;  3CKI B;  4G7Z C;  3TBI B;  4J8Q A;  2F0W A;  2X6G A;  1XYI A;  1HFG A;  1IL8 A;  1IYV A;  3GTJ B;  2XSC A;  3GO5 A;  2JEA I;  4Q5V A;  5EBC A;  5JVG 3;  3A56 A;  1ICW A;  5DEH A;  3OMG A;  1PDQ A;  1SJH D;  3HG9 A;  2IX3 A;  1PTO B;  2CVR A;  1SNP A;  1EQV A;  5E4W C;  3MAQ A;  1IHZ A;  2A73 B;  1IKM A;  2ICE C;  4FF1 A;  3QOL A;  1PLF A;  1EEI D;  5KYL A;  3C46 A;  3MA2 B;  3OMC A;  1LT4 D;  1TS5 A;  3FDT A;  3Q6S A;  5EPK A;  1EY5 A;  3L7Z C;  3IFD A;  2A6E C;  2XNA C;  4ZK9 B;  4A3M B;  3MC0 B;  1Y1V B;  1HUM A;  2B2W A;  4XYO A;  3P7J A;  4XYQ A;  2JA6 B;  4KN7 C;  3NBH A;  3MVV A;  1BBX C;  1ONL A;  1ENC A;  5G3L F;  3H94 A;  5M5W B;  4CHT B;  5EQ0 A;  2JP1 A;  2ZXR A;  3R2T A;  1TWC B;  5FKA C;  2OT2 A;  5KNC A;  1ET9 A;  4KV6 A;  1O7Z A;  4Y7N B;  3N52 A;  5DM6 3;  5FK9 C;  4A3B B;  2IX1 A;  4ULL A;  5LL6 S;  2NB0 A;  2F0T A;  1B50 A;  2X69 A;  3V2T A;  1V1P A;  4F7X A;  1LTB D;  2IL8 A;  1H9S A;  2F0U A;  4X3T A;  4TSS A;  1IKL A;  1SAP A;  4Q0F A;  3S1M B;  5CGK A;  2X6L A;  5LL6 X;  4Z9C B;  2B2U C;  1AW7 A;  3BVM A;  5KEE A;  3ZYY X;  2H4O A;  2PCF B;  1FNV A;  2LS0 1;  2N55 A;  1TS3 A;  3WDN A;  2QKI C;  2WIN B;  5AFW A;  5C0X J;  2BDN A;  1NAP A;  3MXN A;  3MFY A;  4OO1 I;  4UAI A;  1DYQ A;  2EY2 A;  3EVQ A;  4I7Z C;  2BA0 A;  4OO1 H;  4K2K A;  3SE0 A;  1RHP A;  2A5H A;  3ITP A;  1CTM A;  4B9X A;  3HGB A;  1ESR A;  2TMP A;  1AZP A;  5CYU A;  5HUR A;  2EY5 A;  3S17 B;  3I91 A;  3A54 A;  3H91 A;  1CQF A;  1MI2 A;  2VXW A;  4KY5 A;  4N9P A;  3MXP A;  4FF4 A;  4O1N A;  1SXT A;  1ROD A;  4R8N A;  2OF1 A;  5J22 A;  4OL7 A;  3EJI A;  2HDL A;  1F9R A;  4ABN A;  3MHB A;  4H44 C;  5K5P A;  2M9V A;  1AZQ A;  3Q24 A;  2H1E A;  1QNU A;  4NW2 A;  1CA5 A;  1AP0 A;  1Z6H A;  4L63 B;  3OOC A;  2B2W C;  2EXZ A;  1V1O A;  2J7Z A;  1E2W A;  1G6Z A;  5JPM C;  2R92 B;  1SNQ A;  4FVM A;  1LTG D;  4KD4 A;  4EGV A;  3CHB D;  3AB9 A;  1GUO A;  3K6O A;  4BA2 I;  1HTL D;  3CU7 A;  5CV6 A;  3BDL A;  2HUG A;  4PNY A;  4PQX A;  1X3P A;  4TQU S;  2AUK A;  3BYT B;  1S5F D;  5JVH 3;  4H0L C;  3RLF A;  1VF7 A;  4KKT A;  3CRL C;  3F2U A;  3I70 A;  3O13 A;  5FO7 B;  5HGT A;  1LTI D;  1R4Q B;  4O42 A;  2NN6 I;  1PFN A;  3I73 A;  2DNE A;  1TII D;  3SK4 A;  4DAP A;  1PMR A;  4MHE A;  3UI2 A;  2NZ1 D;  1I3Q B;  3OW7 A;  2L11 A;  1LAC A;  1ZYR C;  5M5X B;  3M7G A;  2OXP A;  3MXU A;  3NXW A;  3OSO A;  1JR0 D;  3ND8 A;  4BBS B;  4G4K A;  4EVO A;  2BE5 D;  4BY7 B;  3OWE B;  3GTP B;  2PNR C;  4CBV A;  1NSN S;  2NYZ D;  1NR4 A;  4IFD I;  1HA5 A;  4IFD H;  2EJF C;  3QB3 A;  4QB4 A;  1PFB A;  1LLR D;  4A3K B;  2XN9 C;  3I4M B;  3TZU A;  1GUG A;  5CMD A;  1F2Y A;  1JWS D;  2KCC A;  4K8I A;  2CW0 D;  5KGU A;  4ZKC B;  2I46 A;  1EY7 A;  3N6R A;  4KKS A;  2JYO A;  2EYM A;  1O7Y A;  2MHV A;  2JE6 I;  3H6M A;  2ZXO A;  1CFM A;  5I2X A;  1SYD A;  4OO1 G;  2WB1 B;  1OXX K;  5A2Q L;  1E2V A;  1H9M A;  4IQZ A;  4BWG B;  1XXG A;  2N88 A;  1DON A;  3J81 E;  2NVY B;  3E5S A;  2FMC A;  2EOT A;  5FLX L;  1B3A A;  5ELF A;  3TZD A;  5CBA E;  2AUJ D;  2F0Q A;  3HOV B;  5C4Z A;  2M2L A;  1G91 A;  3FPP A;  4QF4 A;  2E2I B;  5DM7 3;  3BZD B;  4WOR A;  3U9S A;  1QNK A;  5NUC A;  2CHB D;  3NTI A;  2C9O A;  4X3U A;  1SYE A;  4QMG A;  4HAE A;  4ZLT F;  1ESF A;  3FVQ A;  4G7O C;  1J9O A;  2VUM B;  1LT3 D;  3J7A F;  1D2B A;  5J39 A;  1QIL A;  4FF2 A;  2K32 A;  1NUC A;  5C5M A;  5JAV A;  1MGS A;  3HP3 A;  1PZI D;  1FGB D;  1XX8 A;  3IFT A;  2PO4 A;  1PFM A;  2BA1 A;  2WKC A;  2D5D A;  2KCN A;  3C1F A;  4A3G B;  2PW5 A;  2B8G A;  1BCP B;  1D1I A;  3VR3 A;  1GUN A;  2PQE A;  4FXD A;  4OGQ C;  3M3Y B;  3I3C A;  3SVM A;  4A3D B;  2A69 C;  1UNS A;  1STE A;  4FNF A;  3D4D A;  2A6E D;  1UEA B;  1G2T A;  3W3A A;  5D14 A;  2O5J C;  3DWP A;  3AMU A;  1JOQ A;  4LJZ C;  1DXM A;  1KDB A;  5I4D A;  1O80 A;  2FMM A;  1YNJ C;  1E0B A;  2E75 C;  4IFD G;  4IUR A;  3MFG A;  1EEF D;  2LMC B;  3S14 B;  1Q1B A;  3IAY A;  1A2T A;  1FNW A;  3DEO A;  4A3I B;  2Q8R E;  3BDO A;  1QOH A;  4EQO A;  1H9K A;  3Q0A A;  1KAB A;  4MIU A;  3MWY W;  1JCK B;  2F0S A;  5IGG A;  2XRQ D;  4LK1 C;  2F3V A;  2C5C A;  4K5V A;  2JA7 B;  3CRK C;  4X3S A;  2ICI A;  4A3F B;  3PO3 B;  2F0L A;  3FMC A;  4U68 A;  1PRT C;  3J80 L;  1FR3 A;  2SDF A;  1W6J A;  4PMC A;  3BS1 A;  4B9W A;  4K6D A;  4NDX A;  5I9P A;  2B2U A;  2K1B A;  4DU9 A;  4CGY B;  2EYO A;  3D31 A;  3NK9 A;  4LAA A;  1HQM C;  2F3W A;  3R2I A;  1EQT A;  1SBB B;  3K5L A;  1U4L A;  5C3E B;  3TP7 A;  3D4W A;  2F0H A;  3NUC A;  2O4X A;  4PMW A;  2F0D A;  5K36 H;  3C3L A;  3LX0 A;  1X32 A;  4ILW A;  2K04 A;  1F2Z A;  4RGO S;  3DWQ A;  1WTR A;  1OO9 B;  5C3W A;  1IW7 C;  2OEO A;  1RDP D;  4IUU A;  4ID6 A;  3MEH A;  4RHR A;  1ZEQ X;  2K33 A;  2IPK D;  2B63 B;  3P1H A;  2O5I C;  3SK8 A;  4TKO B;  5M3M B;  5ELE A;  5E3F A;  4K5X A;  5EKI A;  3K5M A;  4F88 A;  5JEA G;  4RH6 A;  4RCN A;  4ODG A;  4ZRZ A;  1PTO C;  5F2D A;  3TSS A;  1B44 D;  3OIQ A;  1DD2 A;  1JE4 A;  2XWB B;  3K7A B;  3NPP A;  4NKL A;  3L3O C;  1C8C A;  5IIF A;  1MBY A;  2EYF A;  1QWY A;  4YIJ A;  3R3O A;  3PIP 3;  2TSS A;  3I4L A;  5E1F A;  2F1M A;  3LWU A;  4XIG S;  3H09 A;  1S5D D;  3NSW A;  3G6J B;  4QUC A;  1ZYR D;  1Q3L A;  2KVM A;  1Z47 A;  2A68 C;  1SYG A;  1SJE D;  3QJY A;  4RKB A;  1BUV T;  1EU3 A;  1CHP D;  2F0E A;  1I6H B;  1VDZ A;  2KEE A;  1LO5 D;  1PXU A;  2G9D A;  2F0F A;  2JXM B;  4KKU A;  5CV7 A;  1GJX A;  1MSG A;  2K5W A;  1GHJ A;  3SR1 A;  1W6K A;  1TVX A;  2F0O A;  4TRD A;  3TME A;  1WTV A;  3HS0 C;  5CV8 A;  1C4Q A;  4L8J A;  5ISR A;  1TY0 A;  4OIJ A;  2F0G A;  3K0Y A;  3LWE A;  3EQL C;  1I6V C;  2L55 A;  5CBE E;  3HZX A;  2EYH A;  2Z8L A;  1DOL A;  3OHX C;  1Z7T A;  4CKE A;  3M85 A;  4KTA A;  2WAC A;  2DNC A;  4AYB B;  3PIO 3;  3GTG B;  1EY0 A;  2MGS A;  1WD1 A;  1SMY C;  1OXT A;  5EPJ A;  5CV5 A;  1JC7 A;  3TDQ A;  2F4I A;  4ZQ3 A;  1SE3 A;  1PTO F;  1SNO A;  3NTH A;  1ZXT A;  3MZ5 A;  4IZ8 A;  5FO8 B;  5K36 G;  5IGE A;  1TWA B;  1GUS A;  1U9R A;  3NWS A;  4QIW B;  1UUP A;  5IGF A;  1OXS C;  1JB3 A;  5C0X I;  2E2H B;  1EYD A;  5FLX E;  5C0X H;  2F0M A;  5EKK A;  1A3U A;  1CZG A;  3NQI A;  1IYU A;  1EFI D;  1U4R A;  3JAM E;  1V8Q A;  2KQ3 A;  2VB2 X;  2BDO A;  3HOX B;  3S16 B;  1Y8O B;  1YNN C;  1FNU A;  4DK0 A;  1T5E A;  1STY A;  2WAQ B;  1STG A;  4P2C B;  4DAV A;  2GA4 B;  3P75 A;  1CI3 M;  3SK5 A;  2RVL A;  3T4A C;  1Q1E A;  1O78 A;  3I4N B;  3NHH A;  3OWF A;  1ILP A;  3RD4 A;  2RBM A;  2NN6 H;  3GV6 A;  2IWH A;  1BXT A;  4KK7 A;  1RCV D;  3FEW X;  2XRS D;  3GV3 A;  2O2L D;  5KRU A;  1SNM A;  1VF5 C;  1CHQ D;  2NVQ B;  3KUP A;  2MUY A;  4H7B A;  2K6A A;  1Y8N B;  4S3S A;  1Y1W B;  3HOU B;  1RTO A;  1U4M A;  4HCS A;  4XT3 B;  5IOD A;  3E0J A;  1EU4 A;  2F0N A;  1C48 A;  1EWH A;  1STN A;  1HA6 A;  1TY2 A;  5EGT A;  3TN2 A;  1WTX A;  2L1B A;  3PO2 B;  2A69 D;  4CKC A;  4BY1 B;  2BCO A;  4E6I A;  2JA8 B;  5C3X A;  4XTC S;  4XXE A;  3PV0 A;  5IGC A;  1UAP A;  2PMZ B;  3E6Z X;  1K83 B;  2RDH A;  3R8B A;  3ERQ A;  3LNN A;  1A3T A;  1YNJ D;  5COY A;  3KBG A;  3GTL B;  3QO2 A;  1SE2 A;  3QOJ A;  4KHZ A;  1NR2 A;  5JJZ A;  3WOE A;  1KTK A;  2PZT A;  1BDO A;  2J0T D;  2MP1 A;  4IAL A;  4C3I B;  2A74 C;  4KI0 A;  4DK1 A;  3NTK A;  1TR5 A;  1SYB A;  1SE4 A;  3KBX A;  4N9T A;  1V43 A;  1PRT D;  3T51 B;  1TT2 A;  3GQB A;  3J80 E;  4FP5 D;  5D65 A;  5M9O A;  1WCM B;  4PV1 C;  5JEA J;  4DXF A;  1ENA A;  1HRJ A;  1Q8I A;  4C2M B;  2DY7 A;  2EDG A;  3V05 A;  1RKN A;  3C1E A;  3IKJ A;  2JSO A;  4M1U B;  5EKL A;  2KED A;  4C3H B;  4RFB A;  4C3J B;  4HCE A;  1QG7 A;  2KEC A;  5KIX A;  3ERO A;  3HKZ B;  3U9O A;  2B2Y A;  5JOB A;  1QE6 A;  1HHV A;  4KHV A;  3GTM B;  1MD2 D;  1KLU D;  1IW7 D;  5DAU A;  1NCV A;  2ENB A;  4C56 C;  2NN6 G;  3VR6 A;  5C6A A;  2EPB A;  3VYS A;  3VYT A;  5A35 A;  5KYI A;  3GTK B;  2K05 A;  1FD7 D;  1CA6 A;  1QB5 D;  2NVX B;  5M5Y B;  1GUT A;  1G29 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...