4QF4A

Crystal structure of staphylococcal nuclease variant v23m at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTMKLMYKGQPMTFRLLLVDTPETKHPVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 132
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qf4A00
3OMCA 3P75A 1EYCA 3MEHA 1EQVA 5CV6A 5DAUA 5I9OA 3U9OA 2EYMA 1SNDA 3PMFA 3NUCA 3TMEA 1NSNS 2PZUA 4RKLA 4PMCA 3SK4A 1A2TA 2QDBA 4EVOA 2PYKA 1STNA 2EYPA 2F0EA 5IGEA 2PZTA 1SYBA 3DMUA 4QMGA 1A3UA 3T16A 2PW7A 5C4ZA 2WACA 2F0SA 5KYLA 1A3VA 3P1HA 1EY9A 4ID6A 4WORA 2SNSA 1A2UA 4EQPA 3BDCA 1KDAA 5ISRA 2F0IA 3MZ5A 1SNOA 4G57A 1ENAA 1TT2A 3QOJA 2F3VA 4K5VA 2F0NA 4K8JA 3SHLA 4B9XA 4B9WA 4S3SA 5C3WA 3NHHA 5HURA 3T13A 5C6AA 2RDFA 5J22A 1TQOA 2SNMA 1SNCA 2LKVA 1SYEA 2EYHA 5CR3A 5C3XA 4EQOA 2EYLA 1EYAA 4J6HA 5CV5A 5IGFA 2F0GA 1EY5A 2EY1A 4LAAA 4K8IA 5HGTA 2KQ3A 4H7BA 4NP5A 3LX0A 3HZXA 5C5MA 4HTHA 3OMGA 1AEXA 2F0LA 5M9OA 1JOOA 4N9TA 4PNYA 1JOKA 4ME5A 2EYFA 5I9PA 1A3TA 4HMIA 4WRDA 4MIUA 5CV4A 2F0PA 3HEJA 2EXZA 2F0FA 4ZQ3A 4YIJA 5IODA 2O4XA 4QF4A 3OSOA 2NUCA 1F2MA 1EY4A 1STYA 2HQEA 3V2TA 2OEOA 3MHBA 3D8GA 3EROA 3TP8A 1EY6A 1SYFA 3D4WA 1NUCA 3DHQA 3OWFA 4KY5A 5CV9A 3VA5A 4DF7A 2F0UA 5I6WA 5KYIA 1F2ZA 1EYDA 3SK6A 5JAVA 4ZUIA 5KEEA 1SYDA 2F0KA 3NP8A 1RKNA 3QB3A 1IHZA 1EZ6A 3QOLA 3SXHA 1II3A 4KD3A 4TRDA 4E6IA 3SK5A 3S9WA 1JOQA 2F3WA 3MVVA 4IALA 4NMZA 1KAAA 5IOCA 2OF1A 5K5PA 4KHVA 1STAA 3TP5A 5IGGA 1EY8A 1U9RA 4ODGA 5E3FA 2F0TA 5KGUA 2EY2A 2EY6A 5I6YA 5C4HA 4KJOA 3C1FA 4K6DA 1SNPA 4R8NA 3E5SA 3EVQA 5CV7A 5EKKA 4DFAA 4DU9A 4EQNA 1STHA 2F0HA 5IGBA 1F2YA 2EYJA 4N9PA 4IZ8A 3SR1A 4IUNA 1EZ8A 4K14A 3EJIA 3NQTA 2PW5A 3RUZA 1KDCA 4NDXA 2F0DA 2SOBA 4PMBA 5EKLA 1SNMA 3TP6A 3MXPA 2M00A 4DGZA 2F0QA 2PQEA 4KTAA 4F7XA 5IIFA 3NXWA 1STGA 4K2KA 4I65A 4KY7A 4QB4A 1KDBA 2ENBA 5CGKA 4OL7A 5IGDA 3ERQA 5JOBA 4K2LA 2RBMA 3BDLA 1EY0A 2EYOA 3D4DA 2F0VA 1SNQA 4HMJA 5KRUA 5J39A 3SK8A 2PZWA 2KHSA 3H6MA 5J1ZA 5KIXA 2F0MA 2F0OA 3NK9A 4KD4A 1EY7A 1ENCA 2RKSA 4K5XA 1KABA 4ZUJA 4NKLA 4KY6A 2F0WA 5C5LA 4RKBA 4J1MA 4KJNA 5IGCA 2EY5A 4K5WA 3D6CA 4KV6A 1SYGA 5DEHA 5EGTA 5F2DA 5CC4A 3TP7A 5CV8A 5E1FA 3C1EA 3R3OA 1STBA 4F8MA 1TR5A 5NUCA 2OXPA 1JORA 3ITPA 2F0JA 1SYCA
chains in the Genus database with same CATH superfamily
5ELOA 2J4XA 1VS0A 2K28A 3I4NB 4TKOB 4LF9Q 3OW7A 4IO9A 2R7ZB 1TS5A 2HHHL 3HOUB 2RQXA 4Q0FA 4ZK9B 2PYKA 2B2UA 2K01A 3S17B 2SDFA 2B8GA 4DV4L 4LF7Q 2XSCA 2FFKB 3M4YA 3T4AC 1LTGD 4WFN3 5EPKA 2NVTH 4DK1A 1BOSA 3IFDA 4UY8C 1AFPA 4DUZL 1D7QA 2B29A 4JI0Q 1SNCA 5AJ3Q 2B8FA 1PRTC 4JG2A 3HOXB 1HCZA 4HJ7A 4A3EB 4U673 1AW7A 2ZXRA 1JOKA 4NPSA 4ILWA 4NXMQ 4B3TL 4DK0A 1JQYD 1A3TA 4HMIA 3VR5A 1LYLA 4FF3A 2XWBB 1STYA 3D4WA 5I6WA 4ZKBB 3AFQA 3RZOB 5IT9L 1SYDA 2FJ2A 2I5MX 3QB3A 2E2HH 1F9PA 1VF7A 1Z6HA 2KCCA 1IYJB 4UPAA 3RLFA 4R4TA 3LWUA 5IYCG 2F0TA 5KGUA 1SNPA 1CI3M 3M9BA 1PHJA 3GV3A 2MO1A 1I4RA 2PPBC 3KF6A 5A2QE 1SRUA 2NZHA 1VQGA 3MEFA 3S1MH 1L1OB 2MUYA 3HKZG 2PQEA 4F7XA 1PFSA 5IIFA 2K5VA 3ERQA 2RBMA 3FPUB 1HPCA 2WKDA 2WIIB 4HSVA 1PTOH 3OWEB 4DR4L 2EXDA 5T1GA 4QCLA 2JA7H 1UAPA 2O5JC 3SGIA 3MC0B 5LL6S 2QEXA 1YNXA 1JCKB 2X6GA 3OHXC 2D0OA 5F2DA 2NBFA 1SDFA 3U4ZA 2R93H 1W3SA 5NUCA 3MHBA 4HIKA 4GKJL 2E2JH 2VZAA 3MA2B 4GN3B 2ZTEA 4JYAL 5DM63 3CC4A 3PO2B 5FLMH 4DV2L 1PRTD 1X65A 4FVMA 4KN4C 1FVIA 4OONA 4R4QA 4PMCA 1I4QA 4LFBQ 4BS9A 4CKCA 4JV5Q 1YI2A 2DUDA 2JA6H 1R9TH 1RD9D 3K80C 3D4RA 4A75A 3D31A 4JBMA 3JAMc 1W6JA 3HOWG 1KDAA 4LMQD 2F0IA 2Y0SG 2BDOA 4A3DG 4YWKA 4YHHQ 5J22A 4C3JG 2VNUD 4BBRG 4DNTB 2EY1A 5C44H 3TQYA 1G2SA 3P20A 4R1JA 3OMGA 1YJ9A 1HUMA 1IW7D 1XXGA 1HZCA 1NTGA 4BWGB 4WRDA 2QGQA 1NBWA 1ICWA 2H5XA 3I4LA 4YIJA 1S5ED 2N8NA 3I55A 1VQKA 3R93A 3OTOL 4DV6L 3FKIH 1PMRA 1HQRD 1AN8A 2DNCA 3FMCA 5LMUQ 5CBEE 4A3FG 2ZXOA 2I5LX 1D5MC 1GHJA 3NBHA 1BVSA 1J9OA 4E6IA 4G7OC 4DAPA 1K83B 4AIMA 4DR2Q 2HD3A 4JI3Q 4X62L 2UUAL 1EL0A 1E7ZA 1OXXK 2LY7A 2ZT9C 1NCVA 1IBLL 5CORA 4DNRB 3M3YB 1OXSC 2QEJC 4DR7L 4GS3A 2EJMA 4DGZA 2JQOA 2FHTA 3GDEA 4IJLA 1VQ5A 4LFAL 3NXWA 2A8VA 4K2KA 5HY6A 2ENBA 2Q8IB 5CGKA 4CBVA 5KNDA 1SFOH 1EY0A 3VA7A 2C5CA 1XMQL 3KK7A 5M5XB 3GTPH 2HDLA 2DJGC 2PMZB 1GUWA 1HZ9A 2Z9HA 1Q90A 4A93H 4A3CG 1CQVA 1VQHA 4JI6Q 3AMUA 2ALYB 4G7ZC 5DEHA 1OXTA 4LNQA 3STBC 3QO2A 1E1TA 2PQAB 4L6TB 5IP9G 3ITPA 3FPPA 1AZPA 3OMCA 2CH4A 3IL8A 4BY7B 4C2MH 3E0EA 1N33Q 2HIXA 4H0LC 1Y1WH 3N52A 4LK1C 3PMFA 3PUWA 1GUOA 1N36Q 1BNZA 1Q8IA 2QDBA 1C4QA 4IUUA 5IYBG 3M4OH 2MQHA 5EPJA 3I4MB 4DAVA 3RN5A 1VQ8A 5D3DA 4XQNA 4A3BH 4AYBE 1LTRD 5EBCA 1KD1C 3BDCA 4UHVA 4LUVA 4A3IG 2MJ8A 3GD7A 4JI7L 4DR3L 2XIWA 3R8BA 4M1UB 4A3MG 4B3ML 3S1NH 4M8AA 3VYUA 4LF5L 1L0XB 4H7BA 2A1AA 4CJ1B 3D6WA 2VB3X 2BH8A 4PZ8A 5LMNQ 1WTOA 4P75A 1SR3A 4MIUA 2NVTB 1K3RA 1BR9A 2KCMA 4JOIC 1SBBB 2PI2A 5KYIA 4CHTB 3KBGA 1SLJA 1D1KA 3PQIA 2HCCA 3GTKH 4UAIA 3GTJH 2K5DA 4N8X1 1GO3E 1U4MA 1V9PA 1ONLA 3CD6A 3A8JE 3C1FA 1X3FA 1JMCA 1NE3A 1M8AA 1HNZL 2L0CA 3FVQA 3SE0A 3I4OA 2F03A 4KN7C 3STBD 2E2HB 3NTIA 5M3MH 1STEA 3H3VH 1MSGA 2FMMA 2F0QA 3MXUA 3K5OA 4PV1C 2MFIA 1KLGD 2Z6KC 4K2LA 3T51B 4HSPA 3CPFA 4DR1Q 2IL8A 1EY7A 1Q1BA 3FRPB 1X3EA 4YCVA 2A68D 3PUZA 1J8IA 1VQLA 4C3IG 2L1BA 2UXBL 1EWCA 3S1MB 3I7FA 1JB3A 1I6HH 2K7VA 3QWNA 2OXPA 1CKOA 1SYCA 2I46A 5IP7H 3A8IE 3G7LA 2WP8J 1EFID 3P75A 4DV0L 2F4VQ 4R4CA 1PTOB 1D8LA 1O7IA 2K5QA 1BBXC 2JA7B 2PZUA 4DV3Q 3I4NG 1EFWA 1A2TA 1NAPA 5ELFA 3S1RH 4H44C 1HTPA 2R7ZH 2RDHA 3HOUH 3GTOB 4GOPB 2R93B 4RFBA 2ZTDA 2E2JB 3Q0AA 3CCLA 3AEVA 4BXXH 3MZ5A 4C3HG 1K0SA 1UWVA 4B9XA 2NN6G 1V43A 3C2PA 3NHHA 1LV9A 5CMDA 4K0KL 4DXFA 2EYHA 1DCZA 1QB5D 3OOCA 4IPCA 2CQAA 2JA6B 3K7AH 3AU7A 3GP7A 1WD1A 3J80i 5JJIA 5M9OA 1F9RA 1YNNC 1JOOA 1QUQB 2H1EA 2WB1B 3TDQA 1WJJA 3AQQA 1Z7TA 2UUCL 1DOLA 1ESRA 2N55A 3NWSA 5EKIA 2KJXA 4HCEA 4A3GG 2F0UA 1T5EA 1K28A 3BVMA 4LF8L 1FNUA 2F0KA 5C44B 1EZ6A 2A19A 4OO1H 2JN4A 4C1NK 2E8GA 2VXWA 1ZEQX 3FDTA 3K7UC 4DN4M 2KUMA 2SEBD 2GVBA 4NB3A 4BY1G 3G4SA 3FKIB 2QA4A 5CV7A 4LWCA 5EBDA 5IT9E 1XJVA 3H15A 1YVCA 5I4DA 1L1OA 2CWAA 2PNHA 4A3LH 2VUMH 1QNUA 2PI2E 5G3LD 3HOZH 1X32A 2CCZA 4X66Q 1DXMA 4HMJA 1EIFA 4IJHA 3SK8A 3CMAA 2WAQG 1YJNA 3J7AF 2RVLA 4FO2A 1B44D 4O0AA 2EY5A 4RGMA 1O80A 3PO3G 3D6CA 2JK8A 1I3QH 1XNQQ 4DV7Q 5CV8A 2B2WC 2ATWA 5A35A 1JORA 1EUJA 3TZDA 2QKIC 1VQ7A 1SFOB 3BVZA 4DV5Q 2JA8G 1HNWQ 3GTPB 2E5LQ 3OW2A 4KHPL 5GQOA 2JA5H 2ZM6Q 2B2UC 4V190 4A93B 5K36H 4EVOA 3PO2G 1FYCA 1YNND 2F0EA 4QMGA 3JC66 1LT6D 2K05A 4X65Q 1KTKA 1RTOA 4C2MB 1Q8KA 1NMGA 3QOJA 5C3WA 1Y1WB 1ASZA 2OQKA 1HTLD 2SNMA 4LF7L 5CR3A 3KLWA 2A69C 5JPMC 3M4OB 5D3IB 1BBUA 3UE1A 2B63G 3R2IA 3UI2A 1RJTA 4A3BB 1NY4A 4N9TA 4PNYA 4JI0L 2KOLA 3KFUA 2NZ1D 5AJ3L 5IGGA 5ELNA 2F0PA 3HEJA 2EXZA 5LL6X 1A63A 1SJED 2LFNA 5C3EH 3M85A 3H0GH 3DHQA 3F2UA 1FNWA 3S1NB 4NXML 4GN4B 2EOTA 3A5ZB 4KD3A 3H3VI 4TRDA 3A7AB 4IURA 4BBSB 3J81i 5E3FA 4K6DA 1K83H 2F0HA 5M3FG 1YHAA 4DR5Q 4I7AA 2ICIA 1PTOC 2Z6BA 3ULJA 3PSIA 4NXNL 1WTVA 3GTKB 1K9MC 5D14A 2A5HA 5E4XA 3GTJB 3HP3A 2QDLA 4G7HC 4DAYA 2EQSA 1GOZA 4RHRA 4GOPC 3DEPA 1CKMA 1GUSA 1U4PA 5FLXE 1WFQA 1FR3A 1PFBA 5M3MB 5H1SE 3W1GA 1SYGA 2AMCB 4UP9A 2PQAA 1XYIA 1CA6A 5JEAH 1ASYA 4IFDH 1VQOA 3U9SA 1X9NA 1MHWC 1EQTA 3WOFA 1TWGH 2EJGC 1CQFA 2CW0C 1C0AA 2KHJA 2VW9A 3J81L 5I2YA 3DMUA 4EQ5A 3T16A 1I6HB 1B3AA 4LJZC 1B50A 5LMNW 2SNSA 1AP0A 2NTTA 4LFBL 3CRLC 2F0NA 4IQZA 2JXMB 2K1BA 4S3SA 2B2WA 1PRTF 3G71A 4FYDA 2KBNA 5C3XA 4KHZA 2HCIA 5IGFA 3DLLA 3S1RB 3HOVH 3DWQA 3URYA 1I4PA 2VS1A 2F0LA 3PUYA 5E4WC 4FNFA 2AUKA 4YHHL 4OO1I 1PYWD 1A8VA 3L2PA 1UE5A 1LTLA 3T1YQ 3HOYH 1TXYA 4P2CB 4X3UA 4DF7A 3M4QA 3A0JA 1PTOD 4ALPA 1EEID 3CU7A 3K7AB 1HZBA 2OTJA 1S72A 1TU2B 3TBIB 1VQ4A 1A0IA 5LMUL 4YWMA 4OWWB 1C48A 1Q1EA 5C4HA 4KJOA 3B6YA 4DFAA 2HT1A 1VQPA 2WFWA 1VQCA 1JC7A 4JI1Q 3GO5A 1XTCD 4DR2L 1SMXA 4JI3L 4JI2Q 5EKLA 4X64Q 3CCVA 4RAUC 1TWHH 3N6RA 1KDBA 1B3QA 1MKHA 2Q2HA 3KLSX 2O2LD 4YCWA 2UXCQ 5L37A 2A6HD 2CW0D 3IAYA 1ESFA 1H9SB 1IW7C 1V1QA 4ZUJA 3C3LA 2R6GA 1BUVT 4CGYB 5IGCA 2ES2A 1A15A 5IT9c 3TP7A 1XNRQ 3AYHB 3EN2A 3NSWA 1DOKA 2VUMB 5GAHC 2EPBA 3HOZB 2L4NA 5DNFA 1Q7YC 1EYCA 1X54A 3TEHB 1J6QA 5FJ8G 2LXKA 3TRZA 5IYCH 2CFMA 3SK4A 4JPBW 2GVAA 1G8ZD 2X69A 4XYQA 1SN8A 2PZTA 4GOPA 2JA7G 1IL2A 4DR6Q 1I3QB 4O42A 1N33L 3P7JA 1IZ6A 3P1HA 2PMZE 4AYBG 2K04A 1N36L 3J7A5 1A2UA 3CF5A 1SNOA 3GTOH 2RDGA 2R93G 1TT2A 3CCQA 2VQFQ 4OWTB 2EZVA 3CRKC 4YY3L 4G4KA 2JA5B 1EWHA 1EYAA 4XTCS 3T56B 3QG1A 1LT4D 3RNUA 3PF4A 2JA9A 4A4IA 4TVAB 4L5QA 5AFWA 3S1QH 2V1CC 4RG1A 1QUQA 1X56A 1GM5A 2JA6G 1G91A 3S15H 3VR6A 2NUCA 3K59A 2PO4A 2OEOA 2AKWB 2OWOA 1AE3A 1H9MA 1CT1D 3MFGA 4HCSA 2WB1G 3JAML 5LMNL 4GLXA 4ZUIA 2CQOA 5JEAJ 3K81C 1IBMQ 2RHSB 1SXTA 1GUNA 1PFNA 5C44G 2I0QA 1U9RA 1SMYD 2MNAA 1PH2A 3H3VC 1Y8NB 3E5SA 5C3EB 3H0GB 1SE3A 3HOWH 3TS2A 2ZJRA 2A6EC 4IZ8A 4IN3A 4L5RC 1E2VA 5C0XH 1HRJA 5IYDG 1ILPA 2GA4B 2RSNA 3DXJC 4PMBA 1WCMG 4RCNA 4B08A 3J81j 3BYTB 1QOHA 2TSSA 3HG9A 5JJKA 1EOVA 4QB4A 1V1PB 1T9HA 4IFDI 4DV4Q 4OIKA 5JOBA 3K0XA 3BDLA 2Q2IA 4MTKA 4IUTA 1LM0A 4HJ5A 3CMEA 4H13C 1BCPB 3FHWA 1ENCA 1A62A 4GKKQ 3X3MA 2AUJD 5DLQE 1PV4A 4NW2A 2JEAI 2AHOB 1EIHA 3QIAA 1TKWB 1ZXTA 1LT3D 4A3FH 1O78A 4DR1L 3R3OA 4J15A 4HR7B 4GZYC 1ZKOA 2D9UA 3KF8B 2F0JA 2D2CC 1YNJC 2KECA 4RHSA 1S4ZA 4R4IA 3J80E 4B3TQ 2C35B 3C46A 1XPUA 2K33A 4KMUC 2UXDL 2A74C 1XMOQ 4BA2I 4A3KH 1PVOA 4DAYB 1I4GA 2Z4IA 2F4VL 2CHBD 3NPPA 2RCFA 1JWMD 5FLXc 4FF4A 4DV3L 3NTHA 4XT3B 4Z9CB 4F87A 2N3SA 1IBKQ 2AWNA 3G6EA 4YWLA 2RDFA 1TWGB 2A73B 1BF4A 2ASBA 1DYQA 4JW0A 4NP5A 4LF6Q 1V8QA 3QJYA 4MN3A 2M9VA 4A3CH 2A68C 4MZ9A 4ZQ3A 4ZLTF 1Q3LA 3OSOA 2JE6I 1F2MA 2A6ED 1TWAH 2R7DA 1Z47A 2I07B 3EROA 3TP8A 5IP9H 2K4KA 1KAWA 1WTHA 1PFMA 4LF4Q 3HOVB 1QJOA 4KI0A 1WTPA 1E3PA 2Z8LA 1GJXA 1QCBD 5IOCA 1CTMA 2IT1A 1STAA 2ZJPA 1GVPA 4ODGA 4IOAA 3S2DH 2EY2A 4GKJQ 5M5WH 3HOYB 4BBSH 1STHA 3CCSA 3LWEA 1CFMA 3SR1A 3BG3A 1EZ8A 4DV2Q 4A3IH 5IY0A 2WB1E 1L1OC 3KBXA 4X3KA 1HR0Q 1G6ZA 1MSHA 3TP6A 4A3MH 1TS3A 1YNJD 3J7AV 1J5EQ 4KY7A 2EJFC 2L15A 4X3TA 4OL7A 3EA6A 3IRBA 1MJEA 1YEZA 3D4DA 2CVRA 5E7NA 2ICEC 2RA4A 1EIYB 1H9KA 4I7ZC 3S2HB 2LXJA 3VYRA 1N34Q 2ZTCA 4X66L 3Q22A 4LW1A 3Q6SA 2IJ0A 4IPDA 1STBA 1TWHB 1TR5A 1Q82C 5G3LF 3CC7A 5M3MG 3WWVA 1OXUA 2F3IA 3UE0A 1LTTD 1WTQA 5FKAC 4OELB 3K57A 1IYVA 3J7ZC 1O7LA 4DUYQ 2B39A 2JSOA 3U9OA 3OTOQ 1HNXL 3FP9A 4DNIA 4WJWA 5C4XG 3A56A 3ONAB 4DV5L 5IGEA 3TN2A 1AE2A 2DNEA 1WTWA 5EAYA 5KYLA 2R92H 3VR2A 1GUTA 5J3BA 3K6OA 2ZM6L 1HUNA 5BR8Q 1PH7A 1QVGA 1GUGA 1Y1VH 1S5CD 1SAPA 2DN8A 4X62Q 3PGZA 4X65L 5IP7G 3J81E 1FJGL 1K8MA 2XN9C 1YJWA 2EYLA 2K50A 1B53A 5A2QL 5HGTA 4YCUA 4FP5D 1IBLQ 4HTHA 2XVSA 1VMPA 4C3IH 4LFAQ 2R7ZG 3NBIA 1JICA 1W6KA 2Q8RE 4POFA 5IODA 3TS0A 3HOUG 4RWSC 3HKZB 4B3SQ 1TY2A 1D5ZC 2AQ3B 3K58A 1NUCA 3RN2A 3U4VA 3VA5A 1XMQQ 2EDGA 3K8AA 4AQYL 1S40A 2YYZA 1UNSA 2B2YC 3PV0A 1WI5A 4DA2A 5C0XI 1WTXA 3S1QB 1BCPC 4WJ4A 2E76C 1DONA 3A5UA 1TWCH 4UP8A 1Q86C 2UUBQ 3S15B 1CM9A 1JJGA 4KLKA 4P72A 3CC2A 1EU4A 3HOXG 4A3EG 3S24A 3RMHA 2VL6A 4C3HH 4A3JH 2NVQH 2R61A 3EJIA 3RD4A 2NN6H 1PH6A 4GN5A 2XGTA 2F0DA 2SOBA 4IPHA 2V4DA 5GAGC 3ICEA 1N8RC 4L5TA 4DR5L 3W2DA 5IGDA 3SVMA 3MFYA 1XWEA 3HGBA 1HHVA 1PDQA 1H9SA 3O13A 1B9MA 4JI7Q 1QG7A 3NK9A 3HOWB 4K5XA 1PZKD 2Y0SB 4A3DB 2MP1A 5FO7B 3A74A 4HJAA 4BBRB 2PNRC 5EGTA 4A3GH 5E1FA 1F9SA 2NVXB 1D6EC 4IPGA 3F2DA 1K0RA 2XNAC 4KTAA 4OXPA 3OIPA 4V0BA 5DAUA 4A3LG 5I9OA 2EYMA 3K5LA 3HOZG 4DK6C 1I50H 3I72A 4BY1H 1SSOA 2EYPA 1RODA 5JVH3 3MXNB 2DY8A 1L0YB 1KIXA 1SYBA 1B7YB 2N78A 2VY3A 4A3FB 2I5HA 2KHIA 5ELDA 1OO9B 1B8AA 1EY9A 4ID6A 3F2BA 2E75C 4FXGC 3DWAA 3MTSA 4G57A 4CDDC 1MD2D 2Z0SA 1LUZA 4GNXA 3S14H 3EQLC 4QJFA 4A3KB 1TQOA 1HZAA 3BZDB 1WYDA 1X55A 3E6ZX 3T1HQ 1HNZQ 4CJ0B 3J80c 5ELCA 1QVFA 5CBAE 1P16A 1BCPD 4K8IA 5FO8B 4ME3A 2LS01 1C9OA 2B3GA 4QY7A 3X3NA 1QWYA 2GN5A 4ME5A 1RCVD 1WTRA 4LF9L 1VF5C 2YTVA 4JI4Q 3HKSA 1KC8C 3V2TA 2N88A 1VQ9A 3OWFA 4FXKC 3KUPA 1U4LA 1SE2A 1UE1A 5JAVA 1GD7A 2JA8H 1FGUA 3LNNA 1DM0B 1I94Q 1I4XA 1II3A 5BN4A 1X3GA 1KAAA 4KHVA 3W3AA 4OX9Q 1BXTA 1EY8A 1RHPA 1B4OA 4DKAC 5EKKA 1TWAB 4PZ6A 3CPWA 1PTOF 4ABNA 2G5DA 1OTCA 5C3EG 2QW7A 1KDCA 4NDXA 1K73C 2BOSA 1CHQD 1V1PA 2K6AA 2MO0A 1ET9A 4JI1L 2B2YA 1PH8A 3S2DB 2B63H 2F0VA 3L7ZC 4JI2L 5J39A 4ZAIA 1PZJD 5M5WB 3M7GA 4X64L 1O7ZA 4MTNA 2OCEA 4JCVE 5C4JH 3BVGA 2IX1A 4A3IB 1SROA 4LUOA 1HXYD 4QIWB 1WD0A 2UXCL 1I6VC 1D1IA 4RCOA 4A3MB 1JR0D 2VQEQ 3KF8A 3W5OA 4F8MA 1HJPA 3H94A 4RGNA 1WVLA 4PQXA 1RDPD 2LMCB 4XT1B 4HJ9A 3IKJA 5JPNC 1SNDA 1U0LA 4MHEA 1XTDA 1VQMA 2AQ2B 1YHQA 2WV6D 5M3FH 4JBKA 3CCRA 1EU3A 2PW7A 2F0SA 1A3VA 2J0TD 1X3PA 1TY0A 1K8OA 3CW2C 3NELA 1S5FD 5JEAG 4BA1I 2IWHA 4B9WA 1HFNA 4IFDG 4GLVB 4DR6L 2G9DA 3GQBA 1LTBD 2CKZB 1SYEA 4DXGA 4EQOA 3CAMA 1JE4A 1EY5A 4QL5A 1M4VA 4BY7G 2A6HC 2VQFL 4HJ8A 4JI5Q 1ZYRD 2PCFB 2BA0A 2R92B 3H91A 1TWFH 2YU9H 1G2TA 3U50C 5FO9B 1Y1VB 2XRQD 2E2IH 2RF4A 5T1IA 3I4MG 4XQJA 3NTKA 2HIVA 3SK6A 4JV5L 1Q12A 3NE5B 1RKNA 2NN6I 1HR0W 3QOLA 1FGBD 3AB9A 3J81c 2F3WA 4NMZA 1KQSA 3VDYA 3AFPA 5K5PA 3I3CA 4C3IB 3HOVG 1MGSA 1BDOA 1XPOA 3EVQA 3TREA 1IBML 1CK1A 3CCJA 1Y14B 1H9JA 2HQLA 2JJQA 2XTIA 2R7FA 1BBWA 1E2ZA 3U58A 1WOCA 4HIDA 1E24A 3ND8A 4OIJA 4F88A 4Y52H 4DV1Q 1TWCB 1E2WA 1X3QA 2E2DC 2EIFA 3A55A 3SEBA 1QZGA 4POGA 1CHPD 1T5XD 2F0OA 5TSSA 4C3HB 4A3JB 4NKLA 1DOMA 2NVQB 4KJNA 4K5WA 3R2TA 5CC4A 1RIPA 2X6LA 3S2HH 3L3OC 2K75A 5JJZA 2JP1A 3M7NA 2AWOA 4IUQA 4L63B 3ER0A 4GKKL 1PH3A 2KENA 4MNOA 4RGTA 5CV6A 3SDZA 4B3RQ 3DM1A 3NUCA 1PA6A 3J7YW 1JT8A 1SMYC 2Q2UA 1IXRA 1IL8A 4A3GB 1XMOL 1QNKA 1CKNB 3NENA 5CYUA 4WORA 2FXQA 5ISRA 3IFTA 1FNVA 3JAMi 4LFCQ 3HRZC 3SHLA 4K5VA 3VR4A 3RLOA 4CKEA 1I50B 2NVYH 2LKVA 1PYBA 4JI6L 4P74A 4BY1B 1SE8A 3G6JB 2TMPA 1IBKL 5JVG3 4C1NI 1MJCA 3WDNA 2D5DA 2IHEA 2N49A 4CDFC 3KJPA 4NXNQ 4X6AH 2BDNA 4QF4A 4L5SA 3E3XA 2KCNA 3S14B 4LF6L 1SYFA 4PMWA 1D2BA 2E74C 2RCNA 1G51A 5IE8A 5FJ8H 3EFXD 1O7YA 4GNXB 1IHZA 5IWAQ 2WAQB 5FLMG 2B2TA 4JI8Q 3PUVA 3PO3B 3A7LA 1LT5D 3H09A 1Y8OB 3I2ZA 4LF4L 2JEBI 4DU9A 4HN7A 1NJIC 1VQFA 3MXGA 1U4RA 3UDGA 1IYUA 4KKUA 4OHJA 4IUNA 2JA8B 4WJ3M 2UU9Q 2IY5B 2QILA 1P8LA 2IW3A 3NEMA 3RUZA 2WKCA 1LTAD 1UE6A 4OWXB 5JJLA 1K3BC 1ICFB 3BU2A 5M5YH 3OPOA 4IFDJ 1N32Q 4CJ2C 1HR0L 2OTLA 3BDOA 4DK3C 3TSSA 2XWJB 3E9IA 4KD4A 4DPGA 2C9OA 2DJFC 2QF7A 3ULLA 1J5EL 2NB0A 3D3RA 1EWIA 1TS2A 2F1MA 2LSSA 1CUKA 2HHHQ 4A3DH 3FKIG 3ZYYX 5C0XG 3CP0A 5EQ0A 2L11A 4C3JH 4BBRH 4K6LA 2FINB 2B63B 1N34L 1RL2A 3ERSX 2NVXH 3PCOB 4ZCKA 1VQIA 4N8FA 1HA6A 5C4JB 1NSNS 3GTQH 5FK9C 3MXNA 3GTLH 1IKLA 1CZGA 2K14A 3A8KE 4RMFA 1I4HA 4DUZQ 3GTGB 4DUYL 2HUGA 1CSQA 1DGSA 3KDFB 1QZHA 3VYTA 1QVCA 3RZDH 5IYDH 1FD7D 1G291 1R4PB 4EQPA 2O5IC 3VYSA 1WCMH 2ZXPA 1A6XA 1B2TA 4K8JA 3I56A 2DGYA 1HA5A 5C6AA 1VQDA 1D5XC 2BCOA 3DM3A 4J6HA 2K5WA 1PH9A 2RSOA 5BR8L 4A3KG 3PUXA 2CWPA 5M3FB 3CQZH 3EIVA 1JJ2A 2H4OA 2EE1A 4X3SA 5BN5A 5CV4A 1VQBA 1SJHD 3NQIA 4A93G 1EY4A 4KY5A 3K5NA 4P71A 1B9NA 4XXEA 5FLXL 2NYZD 5EJWA 4C56C 1Z9FA 4XYOA 1JWSD 4B3SL 4JBJA 4HAEA 1SEBD 3MVVA 2L9HA 2OF1A 1Y1WG 3F2CA 2YU9B 1R4QB 1TWFB 3GTMH 1BO0A 2EY6A 5I6YA 3CKIB 4R8NA 1K8GA 2Q2TA 4EQNA 2E2IB 3G48A 4TSSA 3V96A 1F2YA 4N9PA 4A3BG 3F1ZA 2B2VC 2UUBL 3GV6A 1B1ZA 2PW5A 4IOCA 4DR4Q 3HKZE 1GKHA 1CA5A 1IKMA 2XRSD 4Q5VA 5FOBB 2BA1A 1STGA 1V1OA 2K32A 3TZUA 4JVZA 1KRTA 5KRUA 4HEDA 2NWGA 5IYBH 2F0MA 3UDFA 2P5ZX 4HIOA 2HDMA 4YY3Q 5C5LA 4BBSG 4JYAQ 1JE5A 3KLSA 4KKTA 4HIMA 2KEEA 2YTXA 2OQ0A 4FDBA 1SE4A 1M90C 1FL0A 3TMEA 4L8JA 2F4IA 4QQBX 4EX5A 2IX3A 1GXDC 3LGJA 4XQQA 3CCEA 2Y0SE 4GNXC 4J8QA 1YITA 2F3VA 4DAMA 5HURA 3I73A 2RHQB 5GAEC 1RTNA 3OIQA 3KYHC 1LABA 1XNQL 4DV6Q 4DV7L 3LX0A 1F77A 5COYA 4PZ7A 4Y7NH 4KK7A 5LHY1 3T1HL 2F0FA 1HH2P 2F52A 2VB2X 3I8ZA 1HNWL 4UDUC 2E5LL 1GHKA 2R92G 3D8GA 1EEFD 1EY6A 5CV9A 2NVYB 1KHIA 2K03A 5BN3A 1Y1VG 3KLRA 1BCPF 3NP8A 1BKBA 5C0XJ 2UUAQ 3SXHA 1PH4A 4JI4L 1TS4A 1HFGA 3CCUA 1Q81C 3S16H 1JOQA 5KNCA 3S9WA 5ELBA 5C4XH 1JB7A 1PYSB 3PIOA 1YBYA 4O2DA 1DD2A 2L55A 3HS0C 4DR7Q 3PIPA 1I94L 1HQMC 3I91A 2UXDQ 1U5KA 1PZID 4JBWA 1LO5D 3NQTA 4JC0A 4OX9L 4BXXG 3KF6B 4O1NA 1EQRA 3MXPA 1E1OA 2ID0A 3W1BA 3BS1A 2EYOA 3I4NH 2D0PA 1PLFA 5D65A 1B70B 5KIXA 4AYBB 1L0WA 4IUPA 1JWUD 4KY6A 2F0WA 4QUFA 4J1MA 3K0YA 3S17H 3D0FA 4A3JG 2L12A 1C7YA 4UP7A 1ET6A 1VDZA 1EYGA 5M5YB 1N9WA 3ULPA 4RKBA 2B2VA 3UDIA 4FXDA 2QCPX 1OXVA 1KNEA 3MEHA 3I70A 1EQVA 3L0OA 2K5HA 1VQAA 2VQEL 1CSPA 1R9TB 3ZJYC 4OO1G 4RKLA 3EBEA 4XDXA 1BQQT 3HOXH 1S3OA 1STNA 4A3EH 1PH1A 3MAQA 4DR3Q 1RF2D 2WINB 2D62A 1CKNA 1A3UA 4GLAC 2WACA 4PG3A 4B3MQ 4C3JB 4LF5Q 3RR5A 3CHBD 4QIWE 1F9QA 3T13A 1LTSD 2BE5C 5EPLA 2FMCA 2K52A 3GTQB 2AQ1B 3L9AX 3GTLB 5CV5A 3RZOH 2VUMG 1LLRD 1EQQA 2KQ3A 5C5MA 3HZXA 2KA7A 3KJOA 3BYYB 1E0BA 3RZDB 2EYFA 1KXLA 2JYOA 3K5MA 4KKSA 3CCMA 3V05A 1WCMB 1G6PA 1NMFA 5DM73 1MBYA 4JOIA 1Y69U 4JI5L 2IHFA 5KNBA 4R9WA 3E0JA 4LUZA 3F8TA 1AH9A 3CQZB 3KOJA 3NBHB 2DY7A 2YTYA 2IX0A 4OGQC 2ZJQA 3J80L 2JA5G 1PRTB 5K36G 1MIUA 2NZOA 1S5DD 3PO3H 1MI2A 1HNXQ 1I5FA 1YHBA 4ULLA 1VQEA 1YZ6A 3RLNA 4QUCA 4P73A 1SNMA 5I2XA 3Q23A 3DEOA 4H02A 3T53B 3HFZB 1CZWA 1UUPA 4I65A 1KL9A 1NR4A 5GROA 3PIO3 3GTMB 3T1YL 2UXBQ 1SNQA 3A54A 2Z6KA 3PIP3 3QR8A 2PZWA 3H6MA 5J1ZA 3PO2H 1PH5A 1ZYRC 4OEMB 4ZKCB 2RKSA 1KABA 3JAME 1ML0D 1FJGQ 2CH4W 2YV5A 1H95A 4DV1L 4DV0Q 1LACA 1TIID 1W2BA 4KV6A 2KVMA 5ELEA 1VCIA 4R8IA 3Q24A 1NNXA 1KLUD 3H0GG 1UEBA 1KNAA 2BE5D 1XPRA 3ND9A 1YIJA 3WOEA 4ZYSA 1S5BD 1DJRD 1Q46A 2K5NA 2EVBA 3KDFA 4AQYQ 1ILQA 2Z4HA 4JK1C 4U68A 4RH6A 4K0KQ 3OYYA 5C4ZA 3CXCA 2BH2A 4B3RL 1PXUA 3GTGH 1EOTA 4RGOS 4CKBA 4QGUA 3E9HA 1ENAA 2M2LA 4FF1A 1LTID 4EGVA 5GADC 1KRSA 2F0GA 4LAAA 2UUCQ 1XNRL 2L5TA 3MWYW 4LFCL 1AEXA 1JJCB 4LF8Q 5I9PA 2G9HD 1Y8PB 2O4XA 3Q8DA 3PF5A 3BJUA 2HQEA 3BZCA 3VR3A 1VMCA 4XIGS 1K8AC 2OT2A 1EYDA 1F2ZA 2R3ZA 4CDCC 3UDXA 5KEEA 2MPMA 1QILA 3I90A 3M3YH 4FF2A 1C8CA 3DWPA 3SK5A 2B2TC 4IALA 4Y7NB 3TP5A 1EIGA 3NWTA 4CDEC 1NR2A 4AH6A 1VQNA 1XX8A 2KEDA 1UEAB 4A76A 5M5XH 1TVXA 1E22A 5IGBA 5IWAL 2EYJA 4R4OA 4IUVA 3BZKA 4K14A 4JI8L 4RA8A 1H9RA 2J7ZA 3S16B 4TQUS 1F2LA 2M00A 1ENFA 5C4XB 2Z1CA 1L2FA 2KCTA 2A69D 4BY7H 2IPKD 2UU9L 2MHVA 2KHSA 1UE7A 2WAQE 2NTSA 3M4PA 4APVA 2MGSA 5HGQA 3FEWX 2Q8TA 4ZRZA 1N32L 1VQ6A 1X6OA 1M1KC 3I4MH 1VQJA 1AZQA 4KHPQ 3DUZA 1QE6A 3C1EA 1DZ1A 3HOYG
chains in the Genus database with same CATH topology
2J4XA 2K28A 3I4NB 4TKOB 3OW7A 2R7ZB 1TS5A 3HOUB 2RQXA 4Q0FA 4ZK9B 2PYKA 2B2UA 2K01A 3S17B 2SDFA 2B8GA 2XSCA 2FFKB 3M4YA 3T4AC 1LTGD 4WFN3 5EPKA 4DK1A 1BOSA 3IFDA 1AFPA 1SNCA 2B8FA 1PRTC 3HOXB 1HCZA 4A3EB 4U673 1AW7A 2ZXRA 1JOKA 4ILWA 4DK0A 1JQYD 1A3TA 4HMIA 3VR5A 4FF3A 2XWBB 1STYA 3D4WA 5I6WA 4ZKBB 3RZOB 5IT9L 1SYDA 2FJ2A 3QB3A 1F9PA 1VF7A 1Z6HA 2KCCA 3RLFA 3LWUA 2F0TA 5KGUA 1SNPA 1CI3M 3GV3A 1I4RA 2PPBC 5A2QE 2MUYA 2PQEA 4F7XA 5IIFA 3ERQA 2RBMA 3FPUB 1HPCA 2WKDA 2WIIB 4HSVA 1PTOH 3OWEB 5T1GA 4QCLA 1UAPA 2O5JC 3MC0B 5LL6S 1JCKB 2X6GA 3OHXC 5F2DA 2NBFA 1SDFA 5NUCA 3MHBA 3MA2B 5DM63 3PO2B 1PRTD 4FVMA 4KN4C 4PMCA 1I4QA 4BS9A 4CKCA 1RD9D 3D4RA 3D31A 1W6JA 1KDAA 4LMQD 2F0IA 2BDOA 5J22A 4C3JG 2VNUD 4DNTB 2EY1A 1G2SA 3P20A 3OMGA 1HUMA 1IW7D 1XXGA 4BWGB 4WRDA 1ICWA 3I4LA 4YIJA 1S5ED 3R93A 1PMRA 1HQRD 1AN8A 2DNCA 3FMCA 5CBEE 2ZXOA 1D5MC 1GHJA 3NBHA 1J9OA 4E6IA 4G7OC 4DAPA 1K83B 1EL0A 1OXXK 2LY7A 2ZT9C 1NCVA 5CORA 4DNRB 3M3YB 1OXSC 2QEJC 2EJMA 4DGZA 2FHTA 3NXWA 4K2KA 2ENBA 2Q8IB 5CGKA 4CBVA 5KNDA 1EY0A 3VA7A 2C5CA 3KK7A 5M5XB 2HDLA 2PMZB 1GUWA 1Q90A 1CQVA 3AMUA 4G7ZC 5DEHA 1OXTA 3QO2A 4L6TB 3ITPA 3FPPA 1AZPA 3OMCA 3IL8A 4BY7B 4H0LC 3N52A 4LK1C 3PMFA 3PUWA 1GUOA 1BNZA 1Q8IA 2QDBA 1C4QA 4IUUA 5EPJA 3I4MB 4DAVA 5D3DA 4XQNA 1LTRD 5EBCA 3BDCA 2MJ8A 3GD7A 2XIWA 3R8BA 4M1UB 4M8AA 3VYUA 1L0XB 4H7BA 4CJ1B 3D6WA 2VB3X 1WTOA 4MIUA 2NVTB 1BR9A 1SBBB 5KYIA 4CHTB 3KBGA 1D1KA 2HCCA 4UAIA 2K5DA 1U4MA 1ONLA 3A8JE 3C1FA 1M8AA 2L0CA 3FVQA 3SE0A 2F03A 4KN7C 2E2HB 3NTIA 1STEA 1MSGA 2FMMA 2F0QA 3MXUA 3K5OA 4PV1C 1KLGD 4K2LA 3T51B 4HSPA 2IL8A 1EY7A 1Q1BA 3FRPB 2A68D 3PUZA 1J8IA 4C3IG 2L1BA 1EWCA 3S1MB 1JB3A 2K7VA 3QWNA 2OXPA 1SYCA 2I46A 3A8IE 3G7LA 2WP8J 1EFID 3P75A 1PTOB 2K5QA 1BBXC 2JA7B 2PZUA 1A2TA 1NAPA 5ELFA 4H44C 1HTPA 2RDHA 3GTOB 2R93B 4RFBA 2E2JB 3Q0AA 3MZ5A 4C3HG 4B9XA 2NN6G 1V43A 3C2PA 3NHHA 1LV9A 5CMDA 4DXFA 2EYHA 1DCZA 1QB5D 3OOCA 2CQAA 2JA6B 3AU7A 3GP7A 1WD1A 5M9OA 1F9RA 1YNNC 1JOOA 2H1EA 2WB1B 3TDQA 1Z7TA 1DOLA 1ESRA 2N55A 3NWSA 5EKIA 2KJXA 4HCEA 2F0UA 1T5EA 3BVMA 1FNUA 2F0KA 5C44B 1EZ6A 4OO1H 4C1NK 2VXWA 1ZEQX 3FDTA 4DN4M 2KUMA 2SEBD 3FKIB 5CV7A 5EBDA 5IT9E 5I4DA 1QNUA 5G3LD 1X32A 1DXMA 4HMJA 3SK8A 3J7AF 2RVLA 4FO2A 1B44D 2EY5A 4RGMA 1O80A 3D6CA 5CV8A 2B2WC 1JORA 5A35A 3TZDA 2QKIC 1SFOB 3BVZA 3GTPB 4A93B 2B2UC 4V190 5K36H 4EVOA 1FYCA 1YNND 2F0EA 4QMGA 1LT6D 2K05A 1KTKA 1RTOA 4C2MB 3QOJA 5C3WA 1Y1WB 1HTLD 2SNMA 5CR3A 2A69C 5JPMC 3M4OB 5D3IB 3R2IA 3UI2A 1RJTA 4A3BB 4N9TA 4PNYA 2KOLA 2NZ1D 5IGGA 2F0PA 3HEJA 2EXZA 5LL6X 1SJED 2LFNA 3M85A 3DHQA 3F2UA 1FNWA 3S1NB 2EOTA 4KD3A 4TRDA 3A7AB 4IURA 4BBSB 5E3FA 4K6DA 2F0HA 2ICIA 1PTOC 1WTVA 3GTKB 5D14A 2A5HA 5E4XA 3GTJB 3HP3A 4G7HC 4DAYA 1GOZA 4RHRA 3DEPA 1GUSA 1U4PA 5FLXE 1FR3A 1PFBA 5M3MB 1SYGA 1XYIA 1CA6A 5JEAH 4IFDH 3U9SA 1EQTA 3WOFA 2EJGC 1CQFA 2CW0C 3J81L 5I2YA 3DMUA 3T16A 1I6HB 1B3AA 4LJZC 1B50A 2SNSA 1AP0A 2NTTA 3CRLC 2F0NA 4IQZA 2JXMB 2K1BA 4S3SA 2B2WA 1PRTF 4FYDA 5C3XA 4KHZA 2HCIA 5IGFA 3S1RB 3DWQA 3URYA 1I4PA 2F0LA 3PUYA 5E4WC 4FNFA 2AUKA 4OO1I 1PYWD 4DF7A 4P2CB 4X3UA 1PTOD 1EEID 3CU7A 3K7AB 1TU2B 3TBIB 1C48A 1Q1EA 5C4HA 4KJOA 4DFAA 1JC7A 3GO5A 1XTCD 5EKLA 4RAUC 3N6RA 1KDBA 3KLSX 2O2LD 2A6HD 2CW0D 3IAYA 1ESFA 1H9SB 1IW7C 4ZUJA 3C3LA 2R6GA 1BUVT 4CGYB 5IGCA 1A15A 3TP7A 3NSWA 2VUMB 1DOKA 2EPBA 3HOZB 2L4NA 5DNFA 1EYCA 3SK4A 1G8ZD 2X69A 4XYQA 2PZTA 1I3QB 4O42A 3P7JA 3P1HA 2K04A 1A2UA 1SNOA 2RDGA 1TT2A 2EZVA 3CRKC 2JA5B 4G4KA 1EWHA 1EYAA 4XTCS 3T56B 3QG1A 1LT4D 5AFWA 1G91A 3VR6A 2NUCA 3K59A 2PO4A 2OEOA 1H9MA 4HCSA 1CT1D 3MFGA 3JAML 4ZUIA 5JEAJ 1SXTA 1GUNA 1PFNA 1U9RA 1SMYD 3H3VC 1Y8NB 3E5SA 5C3EB 3H0GB 1SE3A 2A6EC 4IZ8A 4IN3A 1E2VA 5C0XH 1HRJA 1ILPA 2GA4B 2RSNA 3DXJC 4PMBA 4B08A 4RCNA 3BYTB 1QOHA 2TSSA 3HG9A 4QB4A 1V1PB 4IFDI 4OIKA 5JOBA 3BDLA 4IUTA 4H13C 1BCPB 1ENCA 3X3MA 2AUJD 4NW2A 2JEAI 1EIHA 3QIAA 1TKWB 1ZXTA 1LT3D 1O78A 3R3OA 4HR7B 4GZYC 1ZKOA 2D9UA 2F0JA 2D2CC 1YNJC 2KECA 4RHSA 1S4ZA 3J80E 3C46A 2K33A 4KMUC 2A74C 4BA2I 1I4GA 2Z4IA 2CHBD 3NPPA 1JWMD 4FF4A 3NTHA 4XT3B 4Z9CB 4F87A 2AWNA 2RDFA 1TWGB 2A73B 1BF4A 1DYQA 4NP5A 1V8QA 3QJYA 4MN3A 2M9VA 2A68C 4ZQ3A 4ZLTF 1Q3LA 3OSOA 2JE6I 1F2MA 2A6ED 3EROA 3TP8A 1Z47A 2I07B 1PFMA 3HOVB 1QJOA 4KI0A 1WTPA 2Z8LA 1GJXA 1QCBD 5IOCA 1CTMA 2IT1A 1STAA 4ODGA 2EY2A 3HOYB 1STHA 3LWEA 1CFMA 3SR1A 3BG3A 1EZ8A 3KBXA 4X3KA 1G6ZA 1MSHA 3TP6A 1TS3A 1YNJD 3J7AV 4KY7A 2EJFC 4X3TA 4OL7A 3EA6A 3D4DA 2CVRA 2ICEC 2RA4A 1H9KA 4I7ZC 3S2HB 3VYRA 3Q22A 3Q6SA 2IJ0A 1STBA 1TWHB 1TR5A 5G3LF 1OXUA 1WTQA 1LTTD 5FKAC 3K57A 1IYVA 1O7LA 2B39A 2JSOA 3U9OA 4WJWA 3A56A 3ONAB 5IGEA 3TN2A 2DNEA 1WTWA 5KYLA 3VR2A 1GUTA 1HUNA 3K6OA 1GUGA 1S5CD 1SAPA 2DN8A 3J81E 1K8MA 2XN9C 2EYLA 1B53A 5A2QL 5HGTA 4FP5D 4HTHA 2XVSA 1VMPA 3NBIA 1JICA 1W6KA 2Q8RE 5IODA 4RWSC 3HKZB 1TY2A 1D5ZC 2AQ3B 3K58A 1NUCA 3VA5A 2EDGA 2YYZA 1UNSA 2B2YC 3PV0A 4DA2A 5C0XI 1WTXA 3S1QB 1BCPC 2E76C 1DONA 3S15B 1CM9A 1EU4A 3RMHA 2R61A 3EJIA 3RD4A 2NN6H 2F0DA 2SOBA 2V4DA 3W2DA 5IGDA 3SVMA 3MFYA 1XWEA 3HGBA 1HHVA 1PDQA 1H9SA 3O13A 1B9MA 1QG7A 3NK9A 3HOWB 4K5XA 1PZKD 2Y0SB 4A3DB 2MP1A 5FO7B 4BBRB 2PNRC 5EGTA 5E1FA 1F9SA 2NVXB 1D6EC 2XNAC 4KTAA 3OIPA 4V0BA 5DAUA 5I9OA 2EYMA 3K5LA 3I72A 1SSOA 2EYPA 1RODA 5JVH3 2DY8A 1L0YB 1SYBA 4A3FB 5ELDA 1OO9B 1EY9A 4ID6A 2E75C 4FXGC 3DWAA 3MTSA 4G57A 1MD2D 3EQLC 4A3KB 1TQOA 3BZDB 3E6ZX 4CJ0B 5ELCA 5CBAE 4K8IA 1BCPD 5FO8B 2LS01 3X3NA 1QWYA 4ME5A 1RCVD 1WTRA 1VF5C 3V2TA 2N88A 3OWFA 4FXKC 3KUPA 1U4LA 1SE2A 5JAVA 3LNNA 1DM0B 1I4XA 1II3A 5BN4A 1KAAA 4KHVA 3W3AA 1BXTA 1EY8A 1RHPA 1B4OA 5EKKA 1TWAB 1PTOF 4ABNA 1KDCA 4NDXA 2BOSA 1CHQD 1V1PA 2K6AA 1ET9A 2B2YA 3S2DB 2F0VA 3L7ZC 5J39A 4ZAIA 1PZJD 5M5WB 3M7GA 1O7ZA 2IX1A 3BVGA 4A3IB 1HXYD 4QIWB 1WD0A 1I6VC 1D1IA 4RCOA 4A3MB 1JR0D 3KF8A 4F8MA 4RGNA 3H94A 1WVLA 4PQXA 1RDPD 2LMCB 4XT1B 3IKJA 5JPNC 1SNDA 4MHEA 2AQ2B 2WV6D 1EU3A 2PW7A 2F0SA 1A3VA 2J0TD 1X3PA 1TY0A 1K8OA 1S5FD 5JEAG 4BA1I 2IWHA 4B9WA 1HFNA 4IFDG 2G9DA 3GQBA 1LTBD 1SYEA 4DXGA 4EQOA 1JE4A 1EY5A 1M4VA 2A6HC 1ZYRD 2PCFB 2BA0A 2R92B 3H91A 1G2TA 5FO9B 1Y1VB 2XRQD 5T1IA 4XQJA 3NTKA 3SK6A 1Q12A 3NE5B 1RKNA 2NN6I 3QOLA 1FGBD 3AB9A 2F3WA 4NMZA 5K5PA 3I3CA 4C3IB 1MGSA 1BDOA 3EVQA 1CK1A 1H9JA 1E2ZA 3ND8A 4OIJA 4F88A 1TWCB 1E2WA 1X3QA 2E2DC 3A55A 3SEBA 1CHPD 1T5XD 2F0OA 5TSSA 4C3HB 4A3JB 4NKLA 1DOMA 2NVQB 4KJNA 4K5WA 3R2TA 5CC4A 2X6LA 3L3OC 5JJZA 3M7NA 2JP1A 2AWOA 4IUQA 4L63B 4RGTA 5CV6A 3SDZA 3DM1A 3NUCA 3J7YW 1SMYC 1IL8A 4A3GB 1QNKA 5CYUA 4WORA 5ISRA 3IFTA 1FNVA 3HRZC 3SHLA 4K5VA 3VR4A 4CKEA 1I50B 2LKVA 4BY1B 3G6JB 2TMPA 5JVG3 4C1NI 3WDNA 2D5DA 2BDNA 4QF4A 2KCNA 3S14B 1SYFA 4PMWA 1D2BA 2E74C 3EFXD 1O7YA 1IHZA 2WAQB 2B2TA 3PUVA 3PO3B 3A7LA 1LT5D 3H09A 1Y8OB 2JEBI 4DU9A 4HN7A 3MXGA 1U4RA 1IYUA 4KKUA 4OHJA 4IUNA 2JA8B 2QILA 2IW3A 3RUZA 2WKCA 1LTAD 3OPOA 4IFDJ 4CJ2C 3BDOA 3TSSA 2XWJB 4KD4A 2C9OA 2QF7A 2NB0A 3D3RA 1TS2A 2F1MA 5C0XG 3ZYYX 5EQ0A 2L11A 4K6LA 2FINB 2B63B 1HA6A 5C4JB 1NSNS 5FK9C 3MXNA 1IKLA 1CZGA 3A8KE 1I4HA 3GTGB 2HUGA 3VYTA 1FD7D 1G291 1R4PB 4EQPA 2O5IC 3VYSA 2ZXPA 1A6XA 1B2TA 4K8JA 1HA5A 5C6AA 1D5XC 2BCOA 4J6HA 2K5WA 2RSOA 3PUXA 5M3FB 2H4OA 2EE1A 4X3SA 5BN5A 5CV4A 1SJHD 3NQIA 1EY4A 4KY5A 3K5NA 1B9NA 4XXEA 5FLXL 2NYZD 5EJWA 4C56C 4XYOA 1JWSD 4HAEA 1SEBD 3MVVA 2L9HA 2OF1A 2YU9B 1R4QB 1TWFB 1BO0A 2EY6A 5I6YA 3CKIB 4R8NA 4EQNA 2E2IB 4TSSA 3V96A 1F2YA 4N9PA 2B2VC 3GV6A 1B1ZA 2PW5A 1CA5A 1IKMA 2XRSD 4Q5VA 5FOBB 2BA1A 1STGA 1V1OA 2K32A 3TZUA 5KRUA 4HEDA 2NWGA 2F0MA 2HDMA 5C5LA 3KLSA 4KKTA 2KEEA 1SE4A 3TMEA 4L8JA 2F4IA 2IX3A 1GXDC 4XQQA 4J8QA 2F3VA 5HURA 3I73A 1RTNA 3OIQA 1LABA 3LX0A 1F77A 5COYA 4KK7A 5LHY1 2F0FA 3I8ZA 2VB2X 4UDUC 1GHKA 3D8GA 1EEFD 1EY6A 5CV9A 2NVYB 2K03A 5BN3A 3KLRA 1BCPF 3NP8A 5C0XJ 3SXHA 1TS4A 1HFGA 1JOQA 5KNCA 3S9WA 5ELBA 1DD2A 2L55A 3HS0C 1HQMC 3I91A 1PZID 4JBWA 1LO5D 3NQTA 4O1NA 3MXPA 2ID0A 3BS1A 2EYOA 1PLFA 5D65A 5KIXA 4AYBB 4IUPA 1JWUD 4KY6A 2F0WA 4QUFA 4J1MA 3K0YA 2L12A 1ET6A 1VDZA 5M5YB 4RKBA 2B2VA 4FXDA 2QCPX 1OXVA 1KNEA 3MEHA 3I70A 1EQVA 1R9TB 4OO1G 4RKLA 4XDXA 1BQQT 1STNA 3MAQA 1RF2D 2WINB 2D62A 1A3UA 2WACA 4C3JB 3CHBD 1F9QA 3T13A 1LTSD 2BE5C 5EPLA 2FMCA 3GTQB 2AQ1B 3L9AX 3GTLB 5CV5A 1LLRD 2KQ3A 5C5MA 3HZXA 2KA7A 3BYYB 1E0BA 3RZDB 2EYFA 2JYOA 3K5MA 4KKSA 3V05A 1WCMB 5DM73 1MBYA 1Y69U 5KNBA 4R9WA 3E0JA 3CQZB 2DY7A 2IX0A 4OGQC 3J80L 1PRTB 5K36G 1S5DD 1MI2A 4ULLA 4QUCA 5I2XA 1SNMA 3Q23A 3DEOA 3T53B 1CZWA 1UUPA 4I65A 1NR4A 3PIO3 3GTMB 1SNQA 3A54A 3PIP3 2PZWA 3H6MA 5J1ZA 1ZYRC 4ZKCB 2RKSA 1KABA 3JAME 1ML0D 1LACA 1TIID 4KV6A 2KVMA 5ELEA 1VCIA 4R8IA 3Q24A 1KLUD 1KNAA 2BE5D 3ND9A 3WOEA 4ZYSA 1S5BD 1DJRD 2EVBA 1ILQA 2Z4HA 4JK1C 4U68A 4RH6A 5C4ZA 1PXUA 1EOTA 4RGOS 4CKBA 1ENAA 2M2LA 4FF1A 1LTID 4EGVA 2F0GA 4LAAA 2L5TA 3MWYW 1AEXA 5I9PA 2G9HD 1Y8PB 2O4XA 2HQEA 3VR3A 1VMCA 4XIGS 2OT2A 1EYDA 1F2ZA 2R3ZA 5KEEA 2MPMA 1QILA 3I90A 4FF2A 1C8CA 3DWPA 3SK5A 2B2TC 4IALA 4Y7NB 3TP5A 1EIGA 3NWTA 1NR2A 1XX8A 2KEDA 1UEAB 1TVXA 5IGBA 2EYJA 4IUVA 4K14A 4RA8A 1H9RA 2J7ZA 3S16B 4TQUS 1F2LA 2M00A 1ENFA 5C4XB 2Z1CA 2A69D 2IPKD 2MHVA 2KHSA 2NTSA 2MGSA 3FEWX 2Q8TA 4ZRZA 1AZQA 3DUZA 1QE6A 3C1EA 1DZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMC A;  3P75 A;  1EYC A;  3MEH A;  1EQV A;  5CV6 A;  5DAU A;  5I9O A;  3U9O A;  2EYM A;  1SND A;  3PMF A;  3NUC A;  3TME A;  1NSN S;  2PZU A;  4RKL A;  4PMC A;  3SK4 A;  1A2T A;  2QDB A;  4EVO A;  2PYK A;  1STN A;  2EYP A;  2F0E A;  5IGE A;  2PZT A;  1SYB A;  3DMU A;  4QMG A;  1A3U A;  3T16 A;  2PW7 A;  5C4Z A;  2WAC A;  2F0S A;  5KYL A;  1A3V A;  3P1H A;  1EY9 A;  4ID6 A;  4WOR A;  2SNS A;  1A2U A;  4EQP A;  3BDC A;  1KDA A;  5ISR A;  2F0I A;  3MZ5 A;  1SNO A;  4G57 A;  1ENA A;  1TT2 A;  3QOJ A;  2F3V A;  4K5V A;  2F0N A;  4K8J A;  3SHL A;  4B9X A;  4B9W A;  4S3S A;  5C3W A;  3NHH A;  5HUR A;  3T13 A;  5C6A A;  2RDF A;  5J22 A;  1TQO A;  2SNM A;  1SNC A;  2LKV A;  1SYE A;  2EYH A;  5CR3 A;  5C3X A;  4EQO A;  2EYL A;  1EYA A;  4J6H A;  5CV5 A;  5IGF A;  2F0G A;  1EY5 A;  2EY1 A;  4LAA A;  4K8I A;  5HGT A;  2KQ3 A;  4H7B A;  4NP5 A;  3LX0 A;  3HZX A;  5C5M A;  4HTH A;  3OMG A;  1AEX A;  2F0L A;  5M9O A;  1JOO A;  4N9T A;  4PNY A;  1JOK A;  4ME5 A;  2EYF A;  5I9P A;  1A3T A;  4HMI A;  4WRD A;  4MIU A;  5CV4 A;  2F0P A;  3HEJ A;  2EXZ A;  2F0F A;  4ZQ3 A;  4YIJ A;  5IOD A;  2O4X A;  4QF4 A;  3OSO A;  2NUC A;  1F2M A;  1EY4 A;  1STY A;  2HQE A;  3V2T A;  2OEO A;  3MHB A;  3D8G A;  3ERO A;  3TP8 A;  1EY6 A;  1SYF A;  3D4W A;  1NUC A;  3DHQ A;  3OWF A;  4KY5 A;  5CV9 A;  3VA5 A;  4DF7 A;  2F0U A;  5I6W A;  5KYI A;  1F2Z A;  1EYD A;  3SK6 A;  5JAV A;  4ZUI A;  5KEE A;  1SYD A;  2F0K A;  3NP8 A;  1RKN A;  3QB3 A;  1IHZ A;  1EZ6 A;  3QOL A;  3SXH A;  1II3 A;  4KD3 A;  4TRD A;  4E6I A;  3SK5 A;  3S9W A;  1JOQ A;  2F3W A;  3MVV A;  4IAL A;  4NMZ A;  1KAA A;  5IOC A;  2OF1 A;  5K5P A;  4KHV A;  1STA A;  3TP5 A;  5IGG A;  1EY8 A;  1U9R A;  4ODG A;  5E3F A;  2F0T A;  5KGU A;  2EY2 A;  2EY6 A;  5I6Y A;  5C4H A;  4KJO A;  3C1F A;  4K6D A;  1SNP A;  4R8N A;  3E5S A;  3EVQ A;  5CV7 A;  5EKK A;  4DFA A;  4DU9 A;  4EQN A;  1STH A;  2F0H A;  5IGB A;  1F2Y A;  2EYJ A;  4N9P A;  4IZ8 A;  3SR1 A;  4IUN A;  1EZ8 A;  4K14 A;  3EJI A;  3NQT A;  2PW5 A;  3RUZ A;  1KDC A;  4NDX A;  2F0D A;  2SOB A;  4PMB A;  5EKL A;  1SNM A;  3TP6 A;  3MXP A;  2M00 A;  4DGZ A;  2F0Q A;  2PQE A;  4KTA A;  4F7X A;  5IIF A;  3NXW A;  1STG A;  4K2K A;  4I65 A;  4KY7 A;  4QB4 A;  1KDB A;  2ENB A;  5CGK A;  4OL7 A;  5IGD A;  3ERQ A;  5JOB A;  4K2L A;  2RBM A;  3BDL A;  1EY0 A;  2EYO A;  3D4D A;  2F0V A;  1SNQ A;  4HMJ A;  5KRU A;  5J39 A;  3SK8 A;  2PZW A;  2KHS A;  3H6M A;  5J1Z A;  5KIX A;  2F0M A;  2F0O A;  3NK9 A;  4KD4 A;  1EY7 A;  1ENC A;  2RKS A;  4K5X A;  1KAB A;  4ZUJ A;  4NKL A;  4KY6 A;  2F0W A;  5C5L A;  4RKB A;  4J1M A;  4KJN A;  5IGC A;  2EY5 A;  4K5W A;  3D6C A;  4KV6 A;  1SYG A;  5DEH A;  5EGT A;  5F2D A;  5CC4 A;  3TP7 A;  5CV8 A;  5E1F A;  3C1E A;  3R3O A;  1STB A;  4F8M A;  1TR5 A;  5NUC A;  2OXP A;  1JOR A;  3ITP A;  2F0J A;  1SYC A; 
#chains in the Genus database with same CATH topology
 5ELO A;  2J4X A;  1VS0 A;  2K28 A;  3I4N B;  4TKO B;  4LF9 Q;  3OW7 A;  4IO9 A;  2R7Z B;  1TS5 A;  2HHH L;  3HOU B;  2RQX A;  4Q0F A;  4ZK9 B;  2PYK A;  2B2U A;  2K01 A;  3S17 B;  2SDF A;  2B8G A;  4DV4 L;  4LF7 Q;  2XSC A;  2FFK B;  3M4Y A;  3T4A C;  1LTG D;  4WFN 3;  5EPK A;  2NVT H;  4DK1 A;  1BOS A;  3IFD A;  4UY8 C;  1AFP A;  4DUZ L;  1D7Q A;  2B29 A;  4JI0 Q;  1SNC A;  5AJ3 Q;  2B8F A;  1PRT C;  4JG2 A;  3HOX B;  1HCZ A;  4HJ7 A;  4A3E B;  4U67 3;  1AW7 A;  2ZXR A;  1JOK A;  4NPS A;  4ILW A;  4NXM Q;  4B3T L;  4DK0 A;  1JQY D;  1A3T A;  4HMI A;  3VR5 A;  1LYL A;  4FF3 A;  2XWB B;  1STY A;  3D4W A;  5I6W A;  4ZKB B;  3AFQ A;  3RZO B;  5IT9 L;  1SYD A;  2FJ2 A;  2I5M X;  3QB3 A;  2E2H H;  1F9P A;  1VF7 A;  1Z6H A;  2KCC A;  1IYJ B;  4UPA A;  3RLF A;  4R4T A;  3LWU A;  5IYC G;  2F0T A;  5KGU A;  1SNP A;  1CI3 M;  3M9B A;  1PHJ A;  3GV3 A;  2MO1 A;  1I4R A;  2PPB C;  3KF6 A;  5A2Q E;  1SRU A;  2NZH A;  1VQG A;  3MEF A;  3S1M H;  1L1O B;  2MUY A;  3HKZ G;  2PQE A;  4F7X A;  1PFS A;  5IIF A;  2K5V A;  3ERQ A;  2RBM A;  3FPU B;  1HPC A;  2WKD A;  2WII B;  4HSV A;  1PTO H;  3OWE B;  4DR4 L;  2EXD A;  5T1G A;  4QCL A;  2JA7 H;  1UAP A;  2O5J C;  3SGI A;  3MC0 B;  5LL6 S;  2QEX A;  1YNX A;  1JCK B;  2X6G A;  3OHX C;  2D0O A;  5F2D A;  2NBF A;  1SDF A;  3U4Z A;  2R93 H;  1W3S A;  5NUC A;  3MHB A;  4HIK A;  4GKJ L;  2E2J H;  2VZA A;  3MA2 B;  4GN3 B;  2ZTE A;  4JYA L;  5DM6 3;  3CC4 A;  3PO2 B;  5FLM H;  4DV2 L;  1PRT D;  1X65 A;  4FVM A;  4KN4 C;  1FVI A;  4OON A;  4R4Q A;  4PMC A;  1I4Q A;  4LFB Q;  4BS9 A;  4CKC A;  4JV5 Q;  1YI2 A;  2DUD A;  2JA6 H;  1R9T H;  1RD9 D;  3K80 C;  3D4R A;  4A75 A;  3D31 A;  4JBM A;  3JAM c;  1W6J A;  3HOW G;  1KDA A;  4LMQ D;  2F0I A;  2Y0S G;  2BDO A;  4A3D G;  4YWK A;  4YHH Q;  5J22 A;  4C3J G;  2VNU D;  4BBR G;  4DNT B;  2EY1 A;  5C44 H;  3TQY A;  1G2S A;  3P20 A;  4R1J A;  3OMG A;  1YJ9 A;  1HUM A;  1IW7 D;  1XXG A;  1HZC A;  1NTG A;  4BWG B;  4WRD A;  2QGQ A;  1NBW A;  1ICW A;  2H5X A;  3I4L A;  4YIJ A;  1S5E D;  2N8N A;  3I55 A;  1VQK A;  3R93 A;  3OTO L;  4DV6 L;  3FKI H;  1PMR A;  1HQR D;  1AN8 A;  2DNC A;  3FMC A;  5LMU Q;  5CBE E;  4A3F G;  2ZXO A;  2I5L X;  1D5M C;  1GHJ A;  3NBH A;  1BVS A;  1J9O A;  4E6I A;  4G7O C;  4DAP A;  1K83 B;  4AIM A;  4DR2 Q;  2HD3 A;  4JI3 Q;  4X62 L;  2UUA L;  1EL0 A;  1E7Z A;  1OXX K;  2LY7 A;  2ZT9 C;  1NCV A;  1IBL L;  5COR A;  4DNR B;  3M3Y B;  1OXS C;  2QEJ C;  4DR7 L;  4GS3 A;  2EJM A;  4DGZ A;  2JQO A;  2FHT A;  3GDE A;  4IJL A;  1VQ5 A;  4LFA L;  3NXW A;  2A8V A;  4K2K A;  5HY6 A;  2ENB A;  2Q8I B;  5CGK A;  4CBV A;  5KND A;  1SFO H;  1EY0 A;  3VA7 A;  2C5C A;  1XMQ L;  3KK7 A;  5M5X B;  3GTP H;  2HDL A;  2DJG C;  2PMZ B;  1GUW A;  1HZ9 A;  2Z9H A;  1Q90 A;  4A93 H;  4A3C G;  1CQV A;  1VQH A;  4JI6 Q;  3AMU A;  2ALY B;  4G7Z C;  5DEH A;  1OXT A;  4LNQ A;  3STB C;  3QO2 A;  1E1T A;  2PQA B;  4L6T B;  5IP9 G;  3ITP A;  3FPP A;  1AZP A;  3OMC A;  2CH4 A;  3IL8 A;  4BY7 B;  4C2M H;  3E0E A;  1N33 Q;  2HIX A;  4H0L C;  1Y1W H;  3N52 A;  4LK1 C;  3PMF A;  3PUW A;  1GUO A;  1N36 Q;  1BNZ A;  1Q8I A;  2QDB A;  1C4Q A;  4IUU A;  5IYB G;  3M4O H;  2MQH A;  5EPJ A;  3I4M B;  4DAV A;  3RN5 A;  1VQ8 A;  5D3D A;  4XQN A;  4A3B H;  4AYB E;  1LTR D;  5EBC A;  1KD1 C;  3BDC A;  4UHV A;  4LUV A;  4A3I G;  2MJ8 A;  3GD7 A;  4JI7 L;  4DR3 L;  2XIW A;  3R8B A;  4M1U B;  4A3M G;  4B3M L;  3S1N H;  4M8A A;  3VYU A;  4LF5 L;  1L0X B;  4H7B A;  2A1A A;  4CJ1 B;  3D6W A;  2VB3 X;  2BH8 A;  4PZ8 A;  5LMN Q;  1WTO A;  4P75 A;  1SR3 A;  4MIU A;  2NVT B;  1K3R A;  1BR9 A;  2KCM A;  4JOI C;  1SBB B;  2PI2 A;  5KYI A;  4CHT B;  3KBG A;  1SLJ A;  1D1K A;  3PQI A;  2HCC A;  3GTK H;  4UAI A;  3GTJ H;  2K5D A;  4N8X 1;  1GO3 E;  1U4M A;  1V9P A;  1ONL A;  3CD6 A;  3A8J E;  3C1F A;  1X3F A;  1JMC A;  1NE3 A;  1M8A A;  1HNZ L;  2L0C A;  3FVQ A;  3SE0 A;  3I4O A;  2F03 A;  4KN7 C;  3STB D;  2E2H B;  3NTI A;  5M3M H;  1STE A;  3H3V H;  1MSG A;  2FMM A;  2F0Q A;  3MXU A;  3K5O A;  4PV1 C;  2MFI A;  1KLG D;  2Z6K C;  4K2L A;  3T51 B;  4HSP A;  3CPF A;  4DR1 Q;  2IL8 A;  1EY7 A;  1Q1B A;  3FRP B;  1X3E A;  4YCV A;  2A68 D;  3PUZ A;  1J8I A;  1VQL A;  4C3I G;  2L1B A;  2UXB L;  1EWC A;  3S1M B;  3I7F A;  1JB3 A;  1I6H H;  2K7V A;  3QWN A;  2OXP A;  1CKO A;  1SYC A;  2I46 A;  5IP7 H;  3A8I E;  3G7L A;  2WP8 J;  1EFI D;  3P75 A;  4DV0 L;  2F4V Q;  4R4C A;  1PTO B;  1D8L A;  1O7I A;  2K5Q A;  1BBX C;  2JA7 B;  2PZU A;  4DV3 Q;  3I4N G;  1EFW A;  1A2T A;  1NAP A;  5ELF A;  3S1R H;  4H44 C;  1HTP A;  2R7Z H;  2RDH A;  3HOU H;  3GTO B;  4GOP B;  2R93 B;  4RFB A;  2ZTD A;  2E2J B;  3Q0A A;  3CCL A;  3AEV A;  4BXX H;  3MZ5 A;  4C3H G;  1K0S A;  1UWV A;  4B9X A;  2NN6 G;  1V43 A;  3C2P A;  3NHH A;  1LV9 A;  5CMD A;  4K0K L;  4DXF A;  2EYH A;  1DCZ A;  1QB5 D;  3OOC A;  4IPC A;  2CQA A;  2JA6 B;  3K7A H;  3AU7 A;  3GP7 A;  1WD1 A;  3J80 i;  5JJI A;  5M9O A;  1F9R A;  1YNN C;  1JOO A;  1QUQ B;  2H1E A;  2WB1 B;  3TDQ A;  1WJJ A;  3AQQ A;  1Z7T A;  2UUC L;  1DOL A;  1ESR A;  2N55 A;  3NWS A;  5EKI A;  2KJX A;  4HCE A;  4A3G G;  2F0U A;  1T5E A;  1K28 A;  3BVM A;  4LF8 L;  1FNU A;  2F0K A;  5C44 B;  1EZ6 A;  2A19 A;  4OO1 H;  2JN4 A;  4C1N K;  2E8G A;  2VXW A;  1ZEQ X;  3FDT A;  3K7U C;  4DN4 M;  2KUM A;  2SEB D;  2GVB A;  4NB3 A;  4BY1 G;  3G4S A;  3FKI B;  2QA4 A;  5CV7 A;  4LWC A;  5EBD A;  5IT9 E;  1XJV A;  3H15 A;  1YVC A;  5I4D A;  1L1O A;  2CWA A;  2PNH A;  4A3L H;  2VUM H;  1QNU A;  2PI2 E;  5G3L D;  3HOZ H;  1X32 A;  2CCZ A;  4X66 Q;  1DXM A;  4HMJ A;  1EIF A;  4IJH A;  3SK8 A;  3CMA A;  2WAQ G;  1YJN A;  3J7A F;  2RVL A;  4FO2 A;  1B44 D;  4O0A A;  2EY5 A;  4RGM A;  1O80 A;  3PO3 G;  3D6C A;  2JK8 A;  1I3Q H;  1XNQ Q;  4DV7 Q;  5CV8 A;  2B2W C;  2ATW A;  5A35 A;  1JOR A;  1EUJ A;  3TZD A;  2QKI C;  1VQ7 A;  1SFO B;  3BVZ A;  4DV5 Q;  2JA8 G;  1HNW Q;  3GTP B;  2E5L Q;  3OW2 A;  4KHP L;  5GQO A;  2JA5 H;  2ZM6 Q;  2B2U C;  4V19 0;  4A93 B;  5K36 H;  4EVO A;  3PO2 G;  1FYC A;  1YNN D;  2F0E A;  4QMG A;  3JC6 6;  1LT6 D;  2K05 A;  4X65 Q;  1KTK A;  1RTO A;  4C2M B;  1Q8K A;  1NMG A;  3QOJ A;  5C3W A;  1Y1W B;  1ASZ A;  2OQK A;  1HTL D;  2SNM A;  4LF7 L;  5CR3 A;  3KLW A;  2A69 C;  5JPM C;  3M4O B;  5D3I B;  1BBU A;  3UE1 A;  2B63 G;  3R2I A;  3UI2 A;  1RJT A;  4A3B B;  1NY4 A;  4N9T A;  4PNY A;  4JI0 L;  2KOL A;  3KFU A;  2NZ1 D;  5AJ3 L;  5IGG A;  5ELN A;  2F0P A;  3HEJ A;  2EXZ A;  5LL6 X;  1A63 A;  1SJE D;  2LFN A;  5C3E H;  3M85 A;  3H0G H;  3DHQ A;  3F2U A;  1FNW A;  3S1N B;  4NXM L;  4GN4 B;  2EOT A;  3A5Z B;  4KD3 A;  3H3V I;  4TRD A;  3A7A B;  4IUR A;  4BBS B;  3J81 i;  5E3F A;  4K6D A;  1K83 H;  2F0H A;  5M3F G;  1YHA A;  4DR5 Q;  4I7A A;  2ICI A;  1PTO C;  2Z6B A;  3ULJ A;  3PSI A;  4NXN L;  1WTV A;  3GTK B;  1K9M C;  5D14 A;  2A5H A;  5E4X A;  3GTJ B;  3HP3 A;  2QDL A;  4G7H C;  4DAY A;  2EQS A;  1GOZ A;  4RHR A;  4GOP C;  3DEP A;  1CKM A;  1GUS A;  1U4P A;  5FLX E;  1WFQ A;  1FR3 A;  1PFB A;  5M3M B;  5H1S E;  3W1G A;  1SYG A;  2AMC B;  4UP9 A;  2PQA A;  1XYI A;  1CA6 A;  5JEA H;  1ASY A;  4IFD H;  1VQO A;  3U9S A;  1X9N A;  1MHW C;  1EQT A;  3WOF A;  1TWG H;  2EJG C;  1CQF A;  2CW0 C;  1C0A A;  2KHJ A;  2VW9 A;  3J81 L;  5I2Y A;  3DMU A;  4EQ5 A;  3T16 A;  1I6H B;  1B3A A;  4LJZ C;  1B50 A;  5LMN W;  2SNS A;  1AP0 A;  2NTT A;  4LFB L;  3CRL C;  2F0N A;  4IQZ A;  2JXM B;  2K1B A;  4S3S A;  2B2W A;  1PRT F;  3G71 A;  4FYD A;  2KBN A;  5C3X A;  4KHZ A;  2HCI A;  5IGF A;  3DLL A;  3S1R B;  3HOV H;  3DWQ A;  3URY A;  1I4P A;  2VS1 A;  2F0L A;  3PUY A;  5E4W C;  4FNF A;  2AUK A;  4YHH L;  4OO1 I;  1PYW D;  1A8V A;  3L2P A;  1UE5 A;  1LTL A;  3T1Y Q;  3HOY H;  1TXY A;  4P2C B;  4X3U A;  4DF7 A;  3M4Q A;  3A0J A;  1PTO D;  4ALP A;  1EEI D;  3CU7 A;  3K7A B;  1HZB A;  2OTJ A;  1S72 A;  1TU2 B;  3TBI B;  1VQ4 A;  1A0I A;  5LMU L;  4YWM A;  4OWW B;  1C48 A;  1Q1E A;  5C4H A;  4KJO A;  3B6Y A;  4DFA A;  2HT1 A;  1VQP A;  2WFW A;  1VQC A;  1JC7 A;  4JI1 Q;  3GO5 A;  1XTC D;  4DR2 L;  1SMX A;  4JI3 L;  4JI2 Q;  5EKL A;  4X64 Q;  3CCV A;  4RAU C;  1TWH H;  3N6R A;  1KDB A;  1B3Q A;  1MKH A;  2Q2H A;  3KLS X;  2O2L D;  4YCW A;  2UXC Q;  5L37 A;  2A6H D;  2CW0 D;  3IAY A;  1ESF A;  1H9S B;  1IW7 C;  1V1Q A;  4ZUJ A;  3C3L A;  2R6G A;  1BUV T;  4CGY B;  5IGC A;  2ES2 A;  1A15 A;  5IT9 c;  3TP7 A;  1XNR Q;  3AYH B;  3EN2 A;  3NSW A;  1DOK A;  2VUM B;  5GAH C;  2EPB A;  3HOZ B;  2L4N A;  5DNF A;  1Q7Y C;  1EYC A;  1X54 A;  3TEH B;  1J6Q A;  5FJ8 G;  2LXK A;  3TRZ A;  5IYC H;  2CFM A;  3SK4 A;  4JPB W;  2GVA A;  1G8Z D;  2X69 A;  4XYQ A;  1SN8 A;  2PZT A;  4GOP A;  2JA7 G;  1IL2 A;  4DR6 Q;  1I3Q B;  4O42 A;  1N33 L;  3P7J A;  1IZ6 A;  3P1H A;  2PMZ E;  4AYB G;  2K04 A;  1N36 L;  3J7A 5;  1A2U A;  3CF5 A;  1SNO A;  3GTO H;  2RDG A;  2R93 G;  1TT2 A;  3CCQ A;  2VQF Q;  4OWT B;  2EZV A;  3CRK C;  4YY3 L;  4G4K A;  2JA5 B;  1EWH A;  1EYA A;  4XTC S;  3T56 B;  3QG1 A;  1LT4 D;  3RNU A;  3PF4 A;  2JA9 A;  4A4I A;  4TVA B;  4L5Q A;  5AFW A;  3S1Q H;  2V1C C;  4RG1 A;  1QUQ A;  1X56 A;  1GM5 A;  2JA6 G;  1G91 A;  3S15 H;  3VR6 A;  2NUC A;  3K59 A;  2PO4 A;  2OEO A;  2AKW B;  2OWO A;  1AE3 A;  1H9M A;  1CT1 D;  3MFG A;  4HCS A;  2WB1 G;  3JAM L;  5LMN L;  4GLX A;  4ZUI A;  2CQO A;  5JEA J;  3K81 C;  1IBM Q;  2RHS B;  1SXT A;  1GUN A;  1PFN A;  5C44 G;  2I0Q A;  1U9R A;  1SMY D;  2MNA A;  1PH2 A;  3H3V C;  1Y8N B;  3E5S A;  5C3E B;  3H0G B;  1SE3 A;  3HOW H;  3TS2 A;  2ZJR A;  2A6E C;  4IZ8 A;  4IN3 A;  4L5R C;  1E2V A;  5C0X H;  1HRJ A;  5IYD G;  1ILP A;  2GA4 B;  2RSN A;  3DXJ C;  4PMB A;  1WCM G;  4RCN A;  4B08 A;  3J81 j;  3BYT B;  1QOH A;  2TSS A;  3HG9 A;  5JJK A;  1EOV A;  4QB4 A;  1V1P B;  1T9H A;  4IFD I;  4DV4 Q;  4OIK A;  5JOB A;  3K0X A;  3BDL A;  2Q2I A;  4MTK A;  4IUT A;  1LM0 A;  4HJ5 A;  3CME A;  4H13 C;  1BCP B;  3FHW A;  1ENC A;  1A62 A;  4GKK Q;  3X3M A;  2AUJ D;  5DLQ E;  1PV4 A;  4NW2 A;  2JEA I;  2AHO B;  1EIH A;  3QIA A;  1TKW B;  1ZXT A;  1LT3 D;  4A3F H;  1O78 A;  4DR1 L;  3R3O A;  4J15 A;  4HR7 B;  4GZY C;  1ZKO A;  2D9U A;  3KF8 B;  2F0J A;  2D2C C;  1YNJ C;  2KEC A;  4RHS A;  1S4Z A;  4R4I A;  3J80 E;  4B3T Q;  2C35 B;  3C46 A;  1XPU A;  2K33 A;  4KMU C;  2UXD L;  2A74 C;  1XMO Q;  4BA2 I;  4A3K H;  1PVO A;  4DAY B;  1I4G A;  2Z4I A;  2F4V L;  2CHB D;  3NPP A;  2RCF A;  1JWM D;  5FLX c;  4FF4 A;  4DV3 L;  3NTH A;  4XT3 B;  4Z9C B;  4F87 A;  2N3S A;  1IBK Q;  2AWN A;  3G6E A;  4YWL A;  2RDF A;  1TWG B;  2A73 B;  1BF4 A;  2ASB A;  1DYQ A;  4JW0 A;  4NP5 A;  4LF6 Q;  1V8Q A;  3QJY A;  4MN3 A;  2M9V A;  4A3C H;  2A68 C;  4MZ9 A;  4ZQ3 A;  4ZLT F;  1Q3L A;  3OSO A;  2JE6 I;  1F2M A;  2A6E D;  1TWA H;  2R7D A;  1Z47 A;  2I07 B;  3ERO A;  3TP8 A;  5IP9 H;  2K4K A;  1KAW A;  1WTH A;  1PFM A;  4LF4 Q;  3HOV B;  1QJO A;  4KI0 A;  1WTP A;  1E3P A;  2Z8L A;  1GJX A;  1QCB D;  5IOC A;  1CTM A;  2IT1 A;  1STA A;  2ZJP A;  1GVP A;  4ODG A;  4IOA A;  3S2D H;  2EY2 A;  4GKJ Q;  5M5W H;  3HOY B;  4BBS H;  1STH A;  3CCS A;  3LWE A;  1CFM A;  3SR1 A;  3BG3 A;  1EZ8 A;  4DV2 Q;  4A3I H;  5IY0 A;  2WB1 E;  1L1O C;  3KBX A;  4X3K A;  1HR0 Q;  1G6Z A;  1MSH A;  3TP6 A;  4A3M H;  1TS3 A;  1YNJ D;  3J7A V;  1J5E Q;  4KY7 A;  2EJF C;  2L15 A;  4X3T A;  4OL7 A;  3EA6 A;  3IRB A;  1MJE A;  1YEZ A;  3D4D A;  2CVR A;  5E7N A;  2ICE C;  2RA4 A;  1EIY B;  1H9K A;  4I7Z C;  3S2H B;  2LXJ A;  3VYR A;  1N34 Q;  2ZTC A;  4X66 L;  3Q22 A;  4LW1 A;  3Q6S A;  2IJ0 A;  4IPD A;  1STB A;  1TWH B;  1TR5 A;  1Q82 C;  5G3L F;  3CC7 A;  5M3M G;  3WWV A;  1OXU A;  2F3I A;  3UE0 A;  1LTT D;  1WTQ A;  5FKA C;  4OEL B;  3K57 A;  1IYV A;  3J7Z C;  1O7L A;  4DUY Q;  2B39 A;  2JSO A;  3U9O A;  3OTO Q;  1HNX L;  3FP9 A;  4DNI A;  4WJW A;  5C4X G;  3A56 A;  3ONA B;  4DV5 L;  5IGE A;  3TN2 A;  1AE2 A;  2DNE A;  1WTW A;  5EAY A;  5KYL A;  2R92 H;  3VR2 A;  1GUT A;  5J3B A;  3K6O A;  2ZM6 L;  1HUN A;  5BR8 Q;  1PH7 A;  1QVG A;  1GUG A;  1Y1V H;  1S5C D;  1SAP A;  2DN8 A;  4X62 Q;  3PGZ A;  4X65 L;  5IP7 G;  3J81 E;  1FJG L;  1K8M A;  2XN9 C;  1YJW A;  2EYL A;  2K50 A;  1B53 A;  5A2Q L;  5HGT A;  4YCU A;  4FP5 D;  1IBL Q;  4HTH A;  2XVS A;  1VMP A;  4C3I H;  4LFA Q;  2R7Z G;  3NBI A;  1JIC A;  1W6K A;  2Q8R E;  4POF A;  5IOD A;  3TS0 A;  3HOU G;  4RWS C;  3HKZ B;  4B3S Q;  1TY2 A;  1D5Z C;  2AQ3 B;  3K58 A;  1NUC A;  3RN2 A;  3U4V A;  3VA5 A;  1XMQ Q;  2EDG A;  3K8A A;  4AQY L;  1S40 A;  2YYZ A;  1UNS A;  2B2Y C;  3PV0 A;  1WI5 A;  4DA2 A;  5C0X I;  1WTX A;  3S1Q B;  1BCP C;  4WJ4 A;  2E76 C;  1DON A;  3A5U A;  1TWC H;  4UP8 A;  1Q86 C;  2UUB Q;  3S15 B;  1CM9 A;  1JJG A;  4KLK A;  4P72 A;  3CC2 A;  1EU4 A;  3HOX G;  4A3E G;  3S24 A;  3RMH A;  2VL6 A;  4C3H H;  4A3J H;  2NVQ H;  2R61 A;  3EJI A;  3RD4 A;  2NN6 H;  1PH6 A;  4GN5 A;  2XGT A;  2F0D A;  2SOB A;  4IPH A;  2V4D A;  5GAG C;  3ICE A;  1N8R C;  4L5T A;  4DR5 L;  3W2D A;  5IGD A;  3SVM A;  3MFY A;  1XWE A;  3HGB A;  1HHV A;  1PDQ A;  1H9S A;  3O13 A;  1B9M A;  4JI7 Q;  1QG7 A;  3NK9 A;  3HOW B;  4K5X A;  1PZK D;  2Y0S B;  4A3D B;  2MP1 A;  5FO7 B;  3A74 A;  4HJA A;  4BBR B;  2PNR C;  5EGT A;  4A3G H;  5E1F A;  1F9S A;  2NVX B;  1D6E C;  4IPG A;  3F2D A;  1K0R A;  2XNA C;  4KTA A;  4OXP A;  3OIP A;  4V0B A;  5DAU A;  4A3L G;  5I9O A;  2EYM A;  3K5L A;  3HOZ G;  4DK6 C;  1I50 H;  3I72 A;  4BY1 H;  1SSO A;  2EYP A;  1ROD A;  5JVH 3;  3MXN B;  2DY8 A;  1L0Y B;  1KIX A;  1SYB A;  1B7Y B;  2N78 A;  2VY3 A;  4A3F B;  2I5H A;  2KHI A;  5ELD A;  1OO9 B;  1B8A A;  1EY9 A;  4ID6 A;  3F2B A;  2E75 C;  4FXG C;  3DWA A;  3MTS A;  4G57 A;  4CDD C;  1MD2 D;  2Z0S A;  1LUZ A;  4GNX A;  3S14 H;  3EQL C;  4QJF A;  4A3K B;  1TQO A;  1HZA A;  3BZD B;  1WYD A;  1X55 A;  3E6Z X;  3T1H Q;  1HNZ Q;  4CJ0 B;  3J80 c;  5ELC A;  1QVF A;  5CBA E;  1P16 A;  1BCP D;  4K8I A;  5FO8 B;  4ME3 A;  2LS0 1;  1C9O A;  2B3G A;  4QY7 A;  3X3N A;  1QWY A;  2GN5 A;  4ME5 A;  1RCV D;  1WTR A;  4LF9 L;  1VF5 C;  2YTV A;  4JI4 Q;  3HKS A;  1KC8 C;  3V2T A;  2N88 A;  1VQ9 A;  3OWF A;  4FXK C;  3KUP A;  1U4L A;  1SE2 A;  1UE1 A;  5JAV A;  1GD7 A;  2JA8 H;  1FGU A;  3LNN A;  1DM0 B;  1I94 Q;  1I4X A;  1II3 A;  5BN4 A;  1X3G A;  1KAA A;  4KHV A;  3W3A A;  4OX9 Q;  1BXT A;  1EY8 A;  1RHP A;  1B4O A;  4DKA C;  5EKK A;  1TWA B;  4PZ6 A;  3CPW A;  1PTO F;  4ABN A;  2G5D A;  1OTC A;  5C3E G;  2QW7 A;  1KDC A;  4NDX A;  1K73 C;  2BOS A;  1CHQ D;  1V1P A;  2K6A A;  2MO0 A;  1ET9 A;  4JI1 L;  2B2Y A;  1PH8 A;  3S2D B;  2B63 H;  2F0V A;  3L7Z C;  4JI2 L;  5J39 A;  4ZAI A;  1PZJ D;  5M5W B;  3M7G A;  4X64 L;  1O7Z A;  4MTN A;  2OCE A;  4JCV E;  5C4J H;  3BVG A;  2IX1 A;  4A3I B;  1SRO A;  4LUO A;  1HXY D;  4QIW B;  1WD0 A;  2UXC L;  1I6V C;  1D1I A;  4RCO A;  4A3M B;  1JR0 D;  2VQE Q;  3KF8 A;  3W5O A;  4F8M A;  1HJP A;  3H94 A;  4RGN A;  1WVL A;  4PQX A;  1RDP D;  2LMC B;  4XT1 B;  4HJ9 A;  3IKJ A;  5JPN C;  1SND A;  1U0L A;  4MHE A;  1XTD A;  1VQM A;  2AQ2 B;  1YHQ A;  2WV6 D;  5M3F H;  4JBK A;  3CCR A;  1EU3 A;  2PW7 A;  2F0S A;  1A3V A;  2J0T D;  1X3P A;  1TY0 A;  1K8O A;  3CW2 C;  3NEL A;  1S5F D;  5JEA G;  4BA1 I;  2IWH A;  4B9W A;  1HFN A;  4IFD G;  4GLV B;  4DR6 L;  2G9D A;  3GQB A;  1LTB D;  2CKZ B;  1SYE A;  4DXG A;  4EQO A;  3CAM A;  1JE4 A;  1EY5 A;  4QL5 A;  1M4V A;  4BY7 G;  2A6H C;  2VQF L;  4HJ8 A;  4JI5 Q;  1ZYR D;  2PCF B;  2BA0 A;  2R92 B;  3H91 A;  1TWF H;  2YU9 H;  1G2T A;  3U50 C;  5FO9 B;  1Y1V B;  2XRQ D;  2E2I H;  2RF4 A;  5T1I A;  3I4M G;  4XQJ A;  3NTK A;  2HIV A;  3SK6 A;  4JV5 L;  1Q12 A;  3NE5 B;  1RKN A;  2NN6 I;  1HR0 W;  3QOL A;  1FGB D;  3AB9 A;  3J81 c;  2F3W A;  4NMZ A;  1KQS A;  3VDY A;  3AFP A;  5K5P A;  3I3C A;  4C3I B;  3HOV G;  1MGS A;  1BDO A;  1XPO A;  3EVQ A;  3TRE A;  1IBM L;  1CK1 A;  3CCJ A;  1Y14 B;  1H9J A;  2HQL A;  2JJQ A;  2XTI A;  2R7F A;  1BBW A;  1E2Z A;  3U58 A;  1WOC A;  4HID A;  1E24 A;  3ND8 A;  4OIJ A;  4F88 A;  4Y52 H;  4DV1 Q;  1TWC B;  1E2W A;  1X3Q A;  2E2D C;  2EIF A;  3A55 A;  3SEB A;  1QZG A;  4POG A;  1CHP D;  1T5X D;  2F0O A;  5TSS A;  4C3H B;  4A3J B;  4NKL A;  1DOM A;  2NVQ B;  4KJN A;  4K5W A;  3R2T A;  5CC4 A;  1RIP A;  2X6L A;  3S2H H;  3L3O C;  2K75 A;  5JJZ A;  2JP1 A;  3M7N A;  2AWO A;  4IUQ A;  4L63 B;  3ER0 A;  4GKK L;  1PH3 A;  2KEN A;  4MNO A;  4RGT A;  5CV6 A;  3SDZ A;  4B3R Q;  3DM1 A;  3NUC A;  1PA6 A;  3J7Y W;  1JT8 A;  1SMY C;  2Q2U A;  1IXR A;  1IL8 A;  4A3G B;  1XMO L;  1QNK A;  1CKN B;  3NEN A;  5CYU A;  4WOR A;  2FXQ A;  5ISR A;  3IFT A;  1FNV A;  3JAM i;  4LFC Q;  3HRZ C;  3SHL A;  4K5V A;  3VR4 A;  3RLO A;  4CKE A;  1I50 B;  2NVY H;  2LKV A;  1PYB A;  4JI6 L;  4P74 A;  4BY1 B;  1SE8 A;  3G6J B;  2TMP A;  1IBK L;  5JVG 3;  4C1N I;  1MJC A;  3WDN A;  2D5D A;  2IHE A;  2N49 A;  4CDF C;  3KJP A;  4NXN Q;  4X6A H;  2BDN A;  4QF4 A;  4L5S A;  3E3X A;  2KCN A;  3S14 B;  4LF6 L;  1SYF A;  4PMW A;  1D2B A;  2E74 C;  2RCN A;  1G51 A;  5IE8 A;  5FJ8 H;  3EFX D;  1O7Y A;  4GNX B;  1IHZ A;  5IWA Q;  2WAQ B;  5FLM G;  2B2T A;  4JI8 Q;  3PUV A;  3PO3 B;  3A7L A;  1LT5 D;  3H09 A;  1Y8O B;  3I2Z A;  4LF4 L;  2JEB I;  4DU9 A;  4HN7 A;  1NJI C;  1VQF A;  3MXG A;  1U4R A;  3UDG A;  1IYU A;  4KKU A;  4OHJ A;  4IUN A;  2JA8 B;  4WJ3 M;  2UU9 Q;  2IY5 B;  2QIL A;  1P8L A;  2IW3 A;  3NEM A;  3RUZ A;  2WKC A;  1LTA D;  1UE6 A;  4OWX B;  5JJL A;  1K3B C;  1ICF B;  3BU2 A;  5M5Y H;  3OPO A;  4IFD J;  1N32 Q;  4CJ2 C;  1HR0 L;  2OTL A;  3BDO A;  4DK3 C;  3TSS A;  2XWJ B;  3E9I A;  4KD4 A;  4DPG A;  2C9O A;  2DJF C;  2QF7 A;  3ULL A;  1J5E L;  2NB0 A;  3D3R A;  1EWI A;  1TS2 A;  2F1M A;  2LSS A;  1CUK A;  2HHH Q;  4A3D H;  3FKI G;  3ZYY X;  5C0X G;  3CP0 A;  5EQ0 A;  2L11 A;  4C3J H;  4BBR H;  4K6L A;  2FIN B;  2B63 B;  1N34 L;  1RL2 A;  3ERS X;  2NVX H;  3PCO B;  4ZCK A;  1VQI A;  4N8F A;  1HA6 A;  5C4J B;  1NSN S;  3GTQ H;  5FK9 C;  3MXN A;  3GTL H;  1IKL A;  1CZG A;  2K14 A;  3A8K E;  4RMF A;  1I4H A;  4DUZ Q;  3GTG B;  4DUY L;  2HUG A;  1CSQ A;  1DGS A;  3KDF B;  1QZH A;  3VYT A;  1QVC A;  3RZD H;  5IYD H;  1FD7 D;  1G29 1;  1R4P B;  4EQP A;  2O5I C;  3VYS A;  1WCM H;  2ZXP A;  1A6X A;  1B2T A;  4K8J A;  3I56 A;  2DGY A;  1HA5 A;  5C6A A;  1VQD A;  1D5X C;  2BCO A;  3DM3 A;  4J6H A;  2K5W A;  1PH9 A;  2RSO A;  5BR8 L;  4A3K G;  3PUX A;  2CWP A;  5M3F B;  3CQZ H;  3EIV A;  1JJ2 A;  2H4O A;  2EE1 A;  4X3S A;  5BN5 A;  5CV4 A;  1VQB A;  1SJH D;  3NQI A;  4A93 G;  1EY4 A;  4KY5 A;  3K5N A;  4P71 A;  1B9N A;  4XXE A;  5FLX L;  2NYZ D;  5EJW A;  4C56 C;  1Z9F A;  4XYO A;  1JWS D;  4B3S L;  4JBJ A;  4HAE A;  1SEB D;  3MVV A;  2L9H A;  2OF1 A;  1Y1W G;  3F2C A;  2YU9 B;  1R4Q B;  1TWF B;  3GTM H;  1BO0 A;  2EY6 A;  5I6Y A;  3CKI B;  4R8N A;  1K8G A;  2Q2T A;  4EQN A;  2E2I B;  3G48 A;  4TSS A;  3V96 A;  1F2Y A;  4N9P A;  4A3B G;  3F1Z A;  2B2V C;  2UUB L;  3GV6 A;  1B1Z A;  2PW5 A;  4IOC A;  4DR4 Q;  3HKZ E;  1GKH A;  1CA5 A;  1IKM A;  2XRS D;  4Q5V A;  5FOB B;  2BA1 A;  1STG A;  1V1O A;  2K32 A;  3TZU A;  4JVZ A;  1KRT A;  5KRU A;  4HED A;  2NWG A;  5IYB H;  2F0M A;  3UDF A;  2P5Z X;  4HIO A;  2HDM A;  4YY3 Q;  5C5L A;  4BBS G;  4JYA Q;  1JE5 A;  3KLS A;  4KKT A;  4HIM A;  2KEE A;  2YTX A;  2OQ0 A;  4FDB A;  1SE4 A;  1M90 C;  1FL0 A;  3TME A;  4L8J A;  2F4I A;  4QQB X;  4EX5 A;  2IX3 A;  1GXD C;  3LGJ A;  4XQQ A;  3CCE A;  2Y0S E;  4GNX C;  4J8Q A;  1YIT A;  2F3V A;  4DAM A;  5HUR A;  3I73 A;  2RHQ B;  5GAE C;  1RTN A;  3OIQ A;  3KYH C;  1LAB A;  1XNQ L;  4DV6 Q;  4DV7 L;  3LX0 A;  1F77 A;  5COY A;  4PZ7 A;  4Y7N H;  4KK7 A;  5LHY 1;  3T1H L;  2F0F A;  1HH2 P;  2F52 A;  2VB2 X;  3I8Z A;  1HNW L;  4UDU C;  2E5L L;  1GHK A;  2R92 G;  3D8G A;  1EEF D;  1EY6 A;  5CV9 A;  2NVY B;  1KHI A;  2K03 A;  5BN3 A;  1Y1V G;  3KLR A;  1BCP F;  3NP8 A;  1BKB A;  5C0X J;  2UUA Q;  3SXH A;  1PH4 A;  4JI4 L;  1TS4 A;  1HFG A;  3CCU A;  1Q81 C;  3S16 H;  1JOQ A;  5KNC A;  3S9W A;  5ELB A;  5C4X H;  1JB7 A;  1PYS B;  3PIO A;  1YBY A;  4O2D A;  1DD2 A;  2L55 A;  3HS0 C;  4DR7 Q;  3PIP A;  1I94 L;  1HQM C;  3I91 A;  2UXD Q;  1U5K A;  1PZI D;  4JBW A;  1LO5 D;  3NQT A;  4JC0 A;  4OX9 L;  4BXX G;  3KF6 B;  4O1N A;  1EQR A;  3MXP A;  1E1O A;  2ID0 A;  3W1B A;  3BS1 A;  2EYO A;  3I4N H;  2D0P A;  1PLF A;  5D65 A;  1B70 B;  5KIX A;  4AYB B;  1L0W A;  4IUP A;  1JWU D;  4KY6 A;  2F0W A;  4QUF A;  4J1M A;  3K0Y A;  3S17 H;  3D0F A;  4A3J G;  2L12 A;  1C7Y A;  4UP7 A;  1ET6 A;  1VDZ A;  1EYG A;  5M5Y B;  1N9W A;  3ULP A;  4RKB A;  2B2V A;  3UDI A;  4FXD A;  2QCP X;  1OXV A;  1KNE A;  3MEH A;  3I70 A;  1EQV A;  3L0O A;  2K5H A;  1VQA A;  2VQE L;  1CSP A;  1R9T B;  3ZJY C;  4OO1 G;  4RKL A;  3EBE A;  4XDX A;  1BQQ T;  3HOX H;  1S3O A;  1STN A;  4A3E H;  1PH1 A;  3MAQ A;  4DR3 Q;  1RF2 D;  2WIN B;  2D62 A;  1CKN A;  1A3U A;  4GLA C;  2WAC A;  4PG3 A;  4B3M Q;  4C3J B;  4LF5 Q;  3RR5 A;  3CHB D;  4QIW E;  1F9Q A;  3T13 A;  1LTS D;  2BE5 C;  5EPL A;  2FMC A;  2K52 A;  3GTQ B;  2AQ1 B;  3L9A X;  3GTL B;  5CV5 A;  3RZO H;  2VUM G;  1LLR D;  1EQQ A;  2KQ3 A;  5C5M A;  3HZX A;  2KA7 A;  3KJO A;  3BYY B;  1E0B A;  3RZD B;  2EYF A;  1KXL A;  2JYO A;  3K5M A;  4KKS A;  3CCM A;  3V05 A;  1WCM B;  1G6P A;  1NMF A;  5DM7 3;  1MBY A;  4JOI A;  1Y69 U;  4JI5 L;  2IHF A;  5KNB A;  4R9W A;  3E0J A;  4LUZ A;  3F8T A;  1AH9 A;  3CQZ B;  3KOJ A;  3NBH B;  2DY7 A;  2YTY A;  2IX0 A;  4OGQ C;  2ZJQ A;  3J80 L;  2JA5 G;  1PRT B;  5K36 G;  1MIU A;  2NZO A;  1S5D D;  3PO3 H;  1MI2 A;  1HNX Q;  1I5F A;  1YHB A;  4ULL A;  1VQE A;  1YZ6 A;  3RLN A;  4QUC A;  4P73 A;  1SNM A;  5I2X A;  3Q23 A;  3DEO A;  4H02 A;  3T53 B;  3HFZ B;  1CZW A;  1UUP A;  4I65 A;  1KL9 A;  1NR4 A;  5GRO A;  3PIO 3;  3GTM B;  3T1Y L;  2UXB Q;  1SNQ A;  3A54 A;  2Z6K A;  3PIP 3;  3QR8 A;  2PZW A;  3H6M A;  5J1Z A;  3PO2 H;  1PH5 A;  1ZYR C;  4OEM B;  4ZKC B;  2RKS A;  1KAB A;  3JAM E;  1ML0 D;  1FJG Q;  2CH4 W;  2YV5 A;  1H95 A;  4DV1 L;  4DV0 Q;  1LAC A;  1TII D;  1W2B A;  4KV6 A;  2KVM A;  5ELE A;  1VCI A;  4R8I A;  3Q24 A;  1NNX A;  1KLU D;  3H0G G;  1UEB A;  1KNA A;  2BE5 D;  1XPR A;  3ND9 A;  1YIJ A;  3WOE A;  4ZYS A;  1S5B D;  1DJR D;  1Q46 A;  2K5N A;  2EVB A;  3KDF A;  4AQY Q;  1ILQ A;  2Z4H A;  4JK1 C;  4U68 A;  4RH6 A;  4K0K Q;  3OYY A;  5C4Z A;  3CXC A;  2BH2 A;  4B3R L;  1PXU A;  3GTG H;  1EOT A;  4RGO S;  4CKB A;  4QGU A;  3E9H A;  1ENA A;  2M2L A;  4FF1 A;  1LTI D;  4EGV A;  5GAD C;  1KRS A;  2F0G A;  4LAA A;  2UUC Q;  1XNR L;  2L5T A;  3MWY W;  4LFC L;  1AEX A;  1JJC B;  4LF8 Q;  5I9P A;  2G9H D;  1Y8P B;  2O4X A;  3Q8D A;  3PF5 A;  3BJU A;  2HQE A;  3BZC A;  3VR3 A;  1VMC A;  4XIG S;  1K8A C;  2OT2 A;  1EYD A;  1F2Z A;  2R3Z A;  4CDC C;  3UDX A;  5KEE A;  2MPM A;  1QIL A;  3I90 A;  3M3Y H;  4FF2 A;  1C8C A;  3DWP A;  3SK5 A;  2B2T C;  4IAL A;  4Y7N B;  3TP5 A;  1EIG A;  3NWT A;  4CDE C;  1NR2 A;  4AH6 A;  1VQN A;  1XX8 A;  2KED A;  1UEA B;  4A76 A;  5M5X H;  1TVX A;  1E22 A;  5IGB A;  5IWA L;  2EYJ A;  4R4O A;  4IUV A;  3BZK A;  4K14 A;  4JI8 L;  4RA8 A;  1H9R A;  2J7Z A;  3S16 B;  4TQU S;  1F2L A;  2M00 A;  1ENF A;  5C4X B;  2Z1C A;  1L2F A;  2KCT A;  2A69 D;  4BY7 H;  2IPK D;  2UU9 L;  2MHV A;  2KHS A;  1UE7 A;  2WAQ E;  2NTS A;  3M4P A;  4APV A;  2MGS A;  5HGQ A;  3FEW X;  2Q8T A;  4ZRZ A;  1N32 L;  1VQ6 A;  1X6O A;  1M1K C;  3I4M H;  1VQJ A;  1AZQ A;  4KHP Q;  3DUZ A;  1QE6 A;  3C1E A;  1DZ1 A;  3HOY G; 
#chains in the Genus database with same CATH homology
 2J4X A;  2K28 A;  3I4N B;  4TKO B;  3OW7 A;  2R7Z B;  1TS5 A;  3HOU B;  2RQX A;  4Q0F A;  4ZK9 B;  2PYK A;  2B2U A;  2K01 A;  3S17 B;  2SDF A;  2B8G A;  2XSC A;  2FFK B;  3M4Y A;  3T4A C;  1LTG D;  4WFN 3;  5EPK A;  4DK1 A;  1BOS A;  3IFD A;  1AFP A;  1SNC A;  2B8F A;  1PRT C;  3HOX B;  1HCZ A;  4A3E B;  4U67 3;  1AW7 A;  2ZXR A;  1JOK A;  4ILW A;  4DK0 A;  1JQY D;  1A3T A;  4HMI A;  3VR5 A;  4FF3 A;  2XWB B;  1STY A;  3D4W A;  5I6W A;  4ZKB B;  3RZO B;  5IT9 L;  1SYD A;  2FJ2 A;  3QB3 A;  1F9P A;  1VF7 A;  1Z6H A;  2KCC A;  3RLF A;  3LWU A;  2F0T A;  5KGU A;  1SNP A;  1CI3 M;  3GV3 A;  1I4R A;  2PPB C;  5A2Q E;  2MUY A;  2PQE A;  4F7X A;  5IIF A;  3ERQ A;  2RBM A;  3FPU B;  1HPC A;  2WKD A;  2WII B;  4HSV A;  1PTO H;  3OWE B;  5T1G A;  4QCL A;  1UAP A;  2O5J C;  3MC0 B;  5LL6 S;  1JCK B;  2X6G A;  3OHX C;  5F2D A;  2NBF A;  1SDF A;  5NUC A;  3MHB A;  3MA2 B;  5DM6 3;  3PO2 B;  1PRT D;  4FVM A;  4KN4 C;  4PMC A;  1I4Q A;  4BS9 A;  4CKC A;  1RD9 D;  3D4R A;  3D31 A;  1W6J A;  1KDA A;  4LMQ D;  2F0I A;  2BDO A;  5J22 A;  4C3J G;  2VNU D;  4DNT B;  2EY1 A;  1G2S A;  3P20 A;  3OMG A;  1HUM A;  1IW7 D;  1XXG A;  4BWG B;  4WRD A;  1ICW A;  3I4L A;  4YIJ A;  1S5E D;  3R93 A;  1PMR A;  1HQR D;  1AN8 A;  2DNC A;  3FMC A;  5CBE E;  2ZXO A;  1D5M C;  1GHJ A;  3NBH A;  1J9O A;  4E6I A;  4G7O C;  4DAP A;  1K83 B;  1EL0 A;  1OXX K;  2LY7 A;  2ZT9 C;  1NCV A;  5COR A;  4DNR B;  3M3Y B;  1OXS C;  2QEJ C;  2EJM A;  4DGZ A;  2FHT A;  3NXW A;  4K2K A;  2ENB A;  2Q8I B;  5CGK A;  4CBV A;  5KND A;  1EY0 A;  3VA7 A;  2C5C A;  3KK7 A;  5M5X B;  2HDL A;  2PMZ B;  1GUW A;  1Q90 A;  1CQV A;  3AMU A;  4G7Z C;  5DEH A;  1OXT A;  3QO2 A;  4L6T B;  3ITP A;  3FPP A;  1AZP A;  3OMC A;  3IL8 A;  4BY7 B;  4H0L C;  3N52 A;  4LK1 C;  3PMF A;  3PUW A;  1GUO A;  1BNZ A;  1Q8I A;  2QDB A;  1C4Q A;  4IUU A;  5EPJ A;  3I4M B;  4DAV A;  5D3D A;  4XQN A;  1LTR D;  5EBC A;  3BDC A;  2MJ8 A;  3GD7 A;  2XIW A;  3R8B A;  4M1U B;  4M8A A;  3VYU A;  1L0X B;  4H7B A;  4CJ1 B;  3D6W A;  2VB3 X;  1WTO A;  4MIU A;  2NVT B;  1BR9 A;  1SBB B;  5KYI A;  4CHT B;  3KBG A;  1D1K A;  2HCC A;  4UAI A;  2K5D A;  1U4M A;  1ONL A;  3A8J E;  3C1F A;  1M8A A;  2L0C A;  3FVQ A;  3SE0 A;  2F03 A;  4KN7 C;  2E2H B;  3NTI A;  1STE A;  1MSG A;  2FMM A;  2F0Q A;  3MXU A;  3K5O A;  4PV1 C;  1KLG D;  4K2L A;  3T51 B;  4HSP A;  2IL8 A;  1EY7 A;  1Q1B A;  3FRP B;  2A68 D;  3PUZ A;  1J8I A;  4C3I G;  2L1B A;  1EWC A;  3S1M B;  1JB3 A;  2K7V A;  3QWN A;  2OXP A;  1SYC A;  2I46 A;  3A8I E;  3G7L A;  2WP8 J;  1EFI D;  3P75 A;  1PTO B;  2K5Q A;  1BBX C;  2JA7 B;  2PZU A;  1A2T A;  1NAP A;  5ELF A;  4H44 C;  1HTP A;  2RDH A;  3GTO B;  2R93 B;  4RFB A;  2E2J B;  3Q0A A;  3MZ5 A;  4C3H G;  4B9X A;  2NN6 G;  1V43 A;  3C2P A;  3NHH A;  1LV9 A;  5CMD A;  4DXF A;  2EYH A;  1DCZ A;  1QB5 D;  3OOC A;  2CQA A;  2JA6 B;  3AU7 A;  3GP7 A;  1WD1 A;  5M9O A;  1F9R A;  1YNN C;  1JOO A;  2H1E A;  2WB1 B;  3TDQ A;  1Z7T A;  1DOL A;  1ESR A;  2N55 A;  3NWS A;  5EKI A;  2KJX A;  4HCE A;  2F0U A;  1T5E A;  3BVM A;  1FNU A;  2F0K A;  5C44 B;  1EZ6 A;  4OO1 H;  4C1N K;  2VXW A;  1ZEQ X;  3FDT A;  4DN4 M;  2KUM A;  2SEB D;  3FKI B;  5CV7 A;  5EBD A;  5IT9 E;  5I4D A;  1QNU A;  5G3L D;  1X32 A;  1DXM A;  4HMJ A;  3SK8 A;  3J7A F;  2RVL A;  4FO2 A;  1B44 D;  2EY5 A;  4RGM A;  1O80 A;  3D6C A;  5CV8 A;  2B2W C;  1JOR A;  5A35 A;  3TZD A;  2QKI C;  1SFO B;  3BVZ A;  3GTP B;  4A93 B;  2B2U C;  4V19 0;  5K36 H;  4EVO A;  1FYC A;  1YNN D;  2F0E A;  4QMG A;  1LT6 D;  2K05 A;  1KTK A;  1RTO A;  4C2M B;  3QOJ A;  5C3W A;  1Y1W B;  1HTL D;  2SNM A;  5CR3 A;  2A69 C;  5JPM C;  3M4O B;  5D3I B;  3R2I A;  3UI2 A;  1RJT A;  4A3B B;  4N9T A;  4PNY A;  2KOL A;  2NZ1 D;  5IGG A;  2F0P A;  3HEJ A;  2EXZ A;  5LL6 X;  1SJE D;  2LFN A;  3M85 A;  3DHQ A;  3F2U A;  1FNW A;  3S1N B;  2EOT A;  4KD3 A;  4TRD A;  3A7A B;  4IUR A;  4BBS B;  5E3F A;  4K6D A;  2F0H A;  2ICI A;  1PTO C;  1WTV A;  3GTK B;  5D14 A;  2A5H A;  5E4X A;  3GTJ B;  3HP3 A;  4G7H C;  4DAY A;  1GOZ A;  4RHR A;  3DEP A;  1GUS A;  1U4P A;  5FLX E;  1FR3 A;  1PFB A;  5M3M B;  1SYG A;  1XYI A;  1CA6 A;  5JEA H;  4IFD H;  3U9S A;  1EQT A;  3WOF A;  2EJG C;  1CQF A;  2CW0 C;  3J81 L;  5I2Y A;  3DMU A;  3T16 A;  1I6H B;  1B3A A;  4LJZ C;  1B50 A;  2SNS A;  1AP0 A;  2NTT A;  3CRL C;  2F0N A;  4IQZ A;  2JXM B;  2K1B A;  4S3S A;  2B2W A;  1PRT F;  4FYD A;  5C3X A;  4KHZ A;  2HCI A;  5IGF A;  3S1R B;  3DWQ A;  3URY A;  1I4P A;  2F0L A;  3PUY A;  5E4W C;  4FNF A;  2AUK A;  4OO1 I;  1PYW D;  4DF7 A;  4P2C B;  4X3U A;  1PTO D;  1EEI D;  3CU7 A;  3K7A B;  1TU2 B;  3TBI B;  1C48 A;  1Q1E A;  5C4H A;  4KJO A;  4DFA A;  1JC7 A;  3GO5 A;  1XTC D;  5EKL A;  4RAU C;  3N6R A;  1KDB A;  3KLS X;  2O2L D;  2A6H D;  2CW0 D;  3IAY A;  1ESF A;  1H9S B;  1IW7 C;  4ZUJ A;  3C3L A;  2R6G A;  1BUV T;  4CGY B;  5IGC A;  1A15 A;  3TP7 A;  3NSW A;  2VUM B;  1DOK A;  2EPB A;  3HOZ B;  2L4N A;  5DNF A;  1EYC A;  3SK4 A;  1G8Z D;  2X69 A;  4XYQ A;  2PZT A;  1I3Q B;  4O42 A;  3P7J A;  3P1H A;  2K04 A;  1A2U A;  1SNO A;  2RDG A;  1TT2 A;  2EZV A;  3CRK C;  2JA5 B;  4G4K A;  1EWH A;  1EYA A;  4XTC S;  3T56 B;  3QG1 A;  1LT4 D;  5AFW A;  1G91 A;  3VR6 A;  2NUC A;  3K59 A;  2PO4 A;  2OEO A;  1H9M A;  4HCS A;  1CT1 D;  3MFG A;  3JAM L;  4ZUI A;  5JEA J;  1SXT A;  1GUN A;  1PFN A;  1U9R A;  1SMY D;  3H3V C;  1Y8N B;  3E5S A;  5C3E B;  3H0G B;  1SE3 A;  2A6E C;  4IZ8 A;  4IN3 A;  1E2V A;  5C0X H;  1HRJ A;  1ILP A;  2GA4 B;  2RSN A;  3DXJ C;  4PMB A;  4B08 A;  4RCN A;  3BYT B;  1QOH A;  2TSS A;  3HG9 A;  4QB4 A;  1V1P B;  4IFD I;  4OIK A;  5JOB A;  3BDL A;  4IUT A;  4H13 C;  1BCP B;  1ENC A;  3X3M A;  2AUJ D;  4NW2 A;  2JEA I;  1EIH A;  3QIA A;  1TKW B;  1ZXT A;  1LT3 D;  1O78 A;  3R3O A;  4HR7 B;  4GZY C;  1ZKO A;  2D9U A;  2F0J A;  2D2C C;  1YNJ C;  2KEC A;  4RHS A;  1S4Z A;  3J80 E;  3C46 A;  2K33 A;  4KMU C;  2A74 C;  4BA2 I;  1I4G A;  2Z4I A;  2CHB D;  3NPP A;  1JWM D;  4FF4 A;  3NTH A;  4XT3 B;  4Z9C B;  4F87 A;  2AWN A;  2RDF A;  1TWG B;  2A73 B;  1BF4 A;  1DYQ A;  4NP5 A;  1V8Q A;  3QJY A;  4MN3 A;  2M9V A;  2A68 C;  4ZQ3 A;  4ZLT F;  1Q3L A;  3OSO A;  2JE6 I;  1F2M A;  2A6E D;  3ERO A;  3TP8 A;  1Z47 A;  2I07 B;  1PFM A;  3HOV B;  1QJO A;  4KI0 A;  1WTP A;  2Z8L A;  1GJX A;  1QCB D;  5IOC A;  1CTM A;  2IT1 A;  1STA A;  4ODG A;  2EY2 A;  3HOY B;  1STH A;  3LWE A;  1CFM A;  3SR1 A;  3BG3 A;  1EZ8 A;  3KBX A;  4X3K A;  1G6Z A;  1MSH A;  3TP6 A;  1TS3 A;  1YNJ D;  3J7A V;  4KY7 A;  2EJF C;  4X3T A;  4OL7 A;  3EA6 A;  3D4D A;  2CVR A;  2ICE C;  2RA4 A;  1H9K A;  4I7Z C;  3S2H B;  3VYR A;  3Q22 A;  3Q6S A;  2IJ0 A;  1STB A;  1TWH B;  1TR5 A;  5G3L F;  1OXU A;  1WTQ A;  1LTT D;  5FKA C;  3K57 A;  1IYV A;  1O7L A;  2B39 A;  2JSO A;  3U9O A;  4WJW A;  3A56 A;  3ONA B;  5IGE A;  3TN2 A;  2DNE A;  1WTW A;  5KYL A;  3VR2 A;  1GUT A;  1HUN A;  3K6O A;  1GUG A;  1S5C D;  1SAP A;  2DN8 A;  3J81 E;  1K8M A;  2XN9 C;  2EYL A;  1B53 A;  5A2Q L;  5HGT A;  4FP5 D;  4HTH A;  2XVS A;  1VMP A;  3NBI A;  1JIC A;  1W6K A;  2Q8R E;  5IOD A;  4RWS C;  3HKZ B;  1TY2 A;  1D5Z C;  2AQ3 B;  3K58 A;  1NUC A;  3VA5 A;  2EDG A;  2YYZ A;  1UNS A;  2B2Y C;  3PV0 A;  4DA2 A;  5C0X I;  1WTX A;  3S1Q B;  1BCP C;  2E76 C;  1DON A;  3S15 B;  1CM9 A;  1EU4 A;  3RMH A;  2R61 A;  3EJI A;  3RD4 A;  2NN6 H;  2F0D A;  2SOB A;  2V4D A;  3W2D A;  5IGD A;  3SVM A;  3MFY A;  1XWE A;  3HGB A;  1HHV A;  1PDQ A;  1H9S A;  3O13 A;  1B9M A;  1QG7 A;  3NK9 A;  3HOW B;  4K5X A;  1PZK D;  2Y0S B;  4A3D B;  2MP1 A;  5FO7 B;  4BBR B;  2PNR C;  5EGT A;  5E1F A;  1F9S A;  2NVX B;  1D6E C;  2XNA C;  4KTA A;  3OIP A;  4V0B A;  5DAU A;  5I9O A;  2EYM A;  3K5L A;  3I72 A;  1SSO A;  2EYP A;  1ROD A;  5JVH 3;  2DY8 A;  1L0Y B;  1SYB A;  4A3F B;  5ELD A;  1OO9 B;  1EY9 A;  4ID6 A;  2E75 C;  4FXG C;  3DWA A;  3MTS A;  4G57 A;  1MD2 D;  3EQL C;  4A3K B;  1TQO A;  3BZD B;  3E6Z X;  4CJ0 B;  5ELC A;  5CBA E;  4K8I A;  1BCP D;  5FO8 B;  2LS0 1;  3X3N A;  1QWY A;  4ME5 A;  1RCV D;  1WTR A;  1VF5 C;  3V2T A;  2N88 A;  3OWF A;  4FXK C;  3KUP A;  1U4L A;  1SE2 A;  5JAV A;  3LNN A;  1DM0 B;  1I4X A;  1II3 A;  5BN4 A;  1KAA A;  4KHV A;  3W3A A;  1BXT A;  1EY8 A;  1RHP A;  1B4O A;  5EKK A;  1TWA B;  1PTO F;  4ABN A;  1KDC A;  4NDX A;  2BOS A;  1CHQ D;  1V1P A;  2K6A A;  1ET9 A;  2B2Y A;  3S2D B;  2F0V A;  3L7Z C;  5J39 A;  4ZAI A;  1PZJ D;  5M5W B;  3M7G A;  1O7Z A;  2IX1 A;  3BVG A;  4A3I B;  1HXY D;  4QIW B;  1WD0 A;  1I6V C;  1D1I A;  4RCO A;  4A3M B;  1JR0 D;  3KF8 A;  4F8M A;  4RGN A;  3H94 A;  1WVL A;  4PQX A;  1RDP D;  2LMC B;  4XT1 B;  3IKJ A;  5JPN C;  1SND A;  4MHE A;  2AQ2 B;  2WV6 D;  1EU3 A;  2PW7 A;  2F0S A;  1A3V A;  2J0T D;  1X3P A;  1TY0 A;  1K8O A;  1S5F D;  5JEA G;  4BA1 I;  2IWH A;  4B9W A;  1HFN A;  4IFD G;  2G9D A;  3GQB A;  1LTB D;  1SYE A;  4DXG A;  4EQO A;  1JE4 A;  1EY5 A;  1M4V A;  2A6H C;  1ZYR D;  2PCF B;  2BA0 A;  2R92 B;  3H91 A;  1G2T A;  5FO9 B;  1Y1V B;  2XRQ D;  5T1I A;  4XQJ A;  3NTK A;  3SK6 A;  1Q12 A;  3NE5 B;  1RKN A;  2NN6 I;  3QOL A;  1FGB D;  3AB9 A;  2F3W A;  4NMZ A;  5K5P A;  3I3C A;  4C3I B;  1MGS A;  1BDO A;  3EVQ A;  1CK1 A;  1H9J A;  1E2Z A;  3ND8 A;  4OIJ A;  4F88 A;  1TWC B;  1E2W A;  1X3Q A;  2E2D C;  3A55 A;  3SEB A;  1CHP D;  1T5X D;  2F0O A;  5TSS A;  4C3H B;  4A3J B;  4NKL A;  1DOM A;  2NVQ B;  4KJN A;  4K5W A;  3R2T A;  5CC4 A;  2X6L A;  3L3O C;  5JJZ A;  3M7N A;  2JP1 A;  2AWO A;  4IUQ A;  4L63 B;  4RGT A;  5CV6 A;  3SDZ A;  3DM1 A;  3NUC A;  3J7Y W;  1SMY C;  1IL8 A;  4A3G B;  1QNK A;  5CYU A;  4WOR A;  5ISR A;  3IFT A;  1FNV A;  3HRZ C;  3SHL A;  4K5V A;  3VR4 A;  4CKE A;  1I50 B;  2LKV A;  4BY1 B;  3G6J B;  2TMP A;  5JVG 3;  4C1N I;  3WDN A;  2D5D A;  2BDN A;  4QF4 A;  2KCN A;  3S14 B;  1SYF A;  4PMW A;  1D2B A;  2E74 C;  3EFX D;  1O7Y A;  1IHZ A;  2WAQ B;  2B2T A;  3PUV A;  3PO3 B;  3A7L A;  1LT5 D;  3H09 A;  1Y8O B;  2JEB I;  4DU9 A;  4HN7 A;  3MXG A;  1U4R A;  1IYU A;  4KKU A;  4OHJ A;  4IUN A;  2JA8 B;  2QIL A;  2IW3 A;  3RUZ A;  2WKC A;  1LTA D;  3OPO A;  4IFD J;  4CJ2 C;  3BDO A;  3TSS A;  2XWJ B;  4KD4 A;  2C9O A;  2QF7 A;  2NB0 A;  3D3R A;  1TS2 A;  2F1M A;  5C0X G;  3ZYY X;  5EQ0 A;  2L11 A;  4K6L A;  2FIN B;  2B63 B;  1HA6 A;  5C4J B;  1NSN S;  5FK9 C;  3MXN A;  1IKL A;  1CZG A;  3A8K E;  1I4H A;  3GTG B;  2HUG A;  3VYT A;  1FD7 D;  1G29 1;  1R4P B;  4EQP A;  2O5I C;  3VYS A;  2ZXP A;  1A6X A;  1B2T A;  4K8J A;  1HA5 A;  5C6A A;  1D5X C;  2BCO A;  4J6H A;  2K5W A;  2RSO A;  3PUX A;  5M3F B;  2H4O A;  2EE1 A;  4X3S A;  5BN5 A;  5CV4 A;  1SJH D;  3NQI A;  1EY4 A;  4KY5 A;  3K5N A;  1B9N A;  4XXE A;  5FLX L;  2NYZ D;  5EJW A;  4C56 C;  4XYO A;  1JWS D;  4HAE A;  1SEB D;  3MVV A;  2L9H A;  2OF1 A;  2YU9 B;  1R4Q B;  1TWF B;  1BO0 A;  2EY6 A;  5I6Y A;  3CKI B;  4R8N A;  4EQN A;  2E2I B;  4TSS A;  3V96 A;  1F2Y A;  4N9P A;  2B2V C;  3GV6 A;  1B1Z A;  2PW5 A;  1CA5 A;  1IKM A;  2XRS D;  4Q5V A;  5FOB B;  2BA1 A;  1STG A;  1V1O A;  2K32 A;  3TZU A;  5KRU A;  4HED A;  2NWG A;  2F0M A;  2HDM A;  5C5L A;  3KLS A;  4KKT A;  2KEE A;  1SE4 A;  3TME A;  4L8J A;  2F4I A;  2IX3 A;  1GXD C;  4XQQ A;  4J8Q A;  2F3V A;  5HUR A;  3I73 A;  1RTN A;  3OIQ A;  1LAB A;  3LX0 A;  1F77 A;  5COY A;  4KK7 A;  5LHY 1;  2F0F A;  3I8Z A;  2VB2 X;  4UDU C;  1GHK A;  3D8G A;  1EEF D;  1EY6 A;  5CV9 A;  2NVY B;  2K03 A;  5BN3 A;  3KLR A;  1BCP F;  3NP8 A;  5C0X J;  3SXH A;  1TS4 A;  1HFG A;  1JOQ A;  5KNC A;  3S9W A;  5ELB A;  1DD2 A;  2L55 A;  3HS0 C;  1HQM C;  3I91 A;  1PZI D;  4JBW A;  1LO5 D;  3NQT A;  4O1N A;  3MXP A;  2ID0 A;  3BS1 A;  2EYO A;  1PLF A;  5D65 A;  5KIX A;  4AYB B;  4IUP A;  1JWU D;  4KY6 A;  2F0W A;  4QUF A;  4J1M A;  3K0Y A;  2L12 A;  1ET6 A;  1VDZ A;  5M5Y B;  4RKB A;  2B2V A;  4FXD A;  2QCP X;  1OXV A;  1KNE A;  3MEH A;  3I70 A;  1EQV A;  1R9T B;  4OO1 G;  4RKL A;  4XDX A;  1BQQ T;  1STN A;  3MAQ A;  1RF2 D;  2WIN B;  2D62 A;  1A3U A;  2WAC A;  4C3J B;  3CHB D;  1F9Q A;  3T13 A;  1LTS D;  2BE5 C;  5EPL A;  2FMC A;  3GTQ B;  2AQ1 B;  3L9A X;  3GTL B;  5CV5 A;  1LLR D;  2KQ3 A;  5C5M A;  3HZX A;  2KA7 A;  3BYY B;  1E0B A;  3RZD B;  2EYF A;  2JYO A;  3K5M A;  4KKS A;  3V05 A;  1WCM B;  5DM7 3;  1MBY A;  1Y69 U;  5KNB A;  4R9W A;  3E0J A;  3CQZ B;  2DY7 A;  2IX0 A;  4OGQ C;  3J80 L;  1PRT B;  5K36 G;  1S5D D;  1MI2 A;  4ULL A;  4QUC A;  5I2X A;  1SNM A;  3Q23 A;  3DEO A;  3T53 B;  1CZW A;  1UUP A;  4I65 A;  1NR4 A;  3PIO 3;  3GTM B;  1SNQ A;  3A54 A;  3PIP 3;  2PZW A;  3H6M A;  5J1Z A;  1ZYR C;  4ZKC B;  2RKS A;  1KAB A;  3JAM E;  1ML0 D;  1LAC A;  1TII D;  4KV6 A;  2KVM A;  5ELE A;  1VCI A;  4R8I A;  3Q24 A;  1KLU D;  1KNA A;  2BE5 D;  3ND9 A;  3WOE A;  4ZYS A;  1S5B D;  1DJR D;  2EVB A;  1ILQ A;  2Z4H A;  4JK1 C;  4U68 A;  4RH6 A;  5C4Z A;  1PXU A;  1EOT A;  4RGO S;  4CKB A;  1ENA A;  2M2L A;  4FF1 A;  1LTI D;  4EGV A;  2F0G A;  4LAA A;  2L5T A;  3MWY W;  1AEX A;  5I9P A;  2G9H D;  1Y8P B;  2O4X A;  2HQE A;  3VR3 A;  1VMC A;  4XIG S;  2OT2 A;  1EYD A;  1F2Z A;  2R3Z A;  5KEE A;  2MPM A;  1QIL A;  3I90 A;  4FF2 A;  1C8C A;  3DWP A;  3SK5 A;  2B2T C;  4IAL A;  4Y7N B;  3TP5 A;  1EIG A;  3NWT A;  1NR2 A;  1XX8 A;  2KED A;  1UEA B;  1TVX A;  5IGB A;  2EYJ A;  4IUV A;  4K14 A;  4RA8 A;  1H9R A;  2J7Z A;  3S16 B;  4TQU S;  1F2L A;  2M00 A;  1ENF A;  5C4X B;  2Z1C A;  2A69 D;  2IPK D;  2MHV A;  2KHS A;  2NTS A;  2MGS A;  3FEW X;  2Q8T A;  4ZRZ A;  1AZQ A;  3DUZ A;  1QE6 A;  3C1E A;  1DZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...