4QF4A

Crystal structure of staphylococcal nuclease variant v23m at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTMKLMYKGQPMTFRLLLVDTPETKHPVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 132
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qf4A00
2SNSA 2EY1A 2F0PA 2F0GA 2F0QA 3HEJA 4PMCA 4QMGA 4R8NA 5CV7A 5EKKA 3RUZA 1EY0A 4E6IA 1EQVA 3D8GA 5IGDA 1II3A 2EYMA 4ZQ3A 1EY9A 1RKNA 4RKBA 2F0OA 4MIUA 3SK5A 4K8IA 3TMEA 5F2DA 3EJIA 3OMCA 2M00A 2EYOA 2F0UA 5CV5A 1EYDA 2EYHA 3C1EA 5IIFA 4DU9A 5DEHA 4WRDA 4B9XA 5ISRA 2PZTA 5I6WA 2F0KA 2F0JA 2PW5A 4IUNA 3BDCA 2F0EA 4KV6A 5K5PA 2WACA 1TT2A 4IALA 1A3UA 1JOQA 3TP7A 1STNA 1STGA 1IHZA 5DAUA 4DFAA 4EQNA 4QF4A 4K5VA 5CR3A 4KJNA 1JOOA 3SXHA 4HMIA 4ZUIA 3EROA 3S9WA 1SNCA 2EXZA 3U9OA 4EQOA 5HGTA 1SNPA 3DHQA 1AEXA 4WORA 2F0HA 3P1HA 5IGFA 1STAA 1SYBA 2KHSA 5IGGA 4K5XA 2EY6A 5KRUA 1F2MA 1SYGA 5KGUA 4DF7A 3VA5A 3D4WA 1EYAA 2F0VA 3MZ5A 2NUCA 1STBA 1STYA 3NUCA 4KHVA 4ZUJA 3SHLA 5C4HA 5C3WA 3SR1A 4KY7A 1EY7A 5IOCA 4I65A 1F2YA 5I9PA 5I6YA 2F0LA 2F3WA 4ME5A 5C4ZA 5C5LA 1A2UA 1SYEA 3OSOA 4KTAA 2EY2A 2F0NA 3QOLA 4J6HA 4TRDA 3SK8A 5M9OA 4IZ8A 3TP5A 1ENCA 4N9TA 2PQEA 2PYKA 1NUCA 3R3OA 2OEOA 3LX0A 5E1FA 4G57A 2PZWA 5CV4A 5NUCA 3T13A 4YIJA 3NHHA 1KDBA 4KY6A 1EYCA 4RKLA 4F7XA 1EZ6A 5CV6A 5CV8A 2F0MA 5CGKA 1KABA 3MVVA 1EY8A 2KQ3A 4KY5A 1EY6A 1ENAA 1A2TA 2RBMA 3EVQA 3HZXA 4EQPA 5JAVA 2SOBA 4OL7A 3TP8A 5J22A 4NKLA 2RKSA 1SNQA 3P75A 5J1ZA 4KD3A 1KDAA 1U9RA 4LAAA 1EY4A 5I9OA 4KD4A 1A3VA 5EKLA 4NDXA 5JOBA 5C3XA 2PZUA 1EZ8A 3SK4A 2ENBA 2F0SA 5CV9A 1EY5A 4PNYA 3C1FA 2HQEA 3MEHA 4K2LA 3D6CA 2F0DA 4K14A 4DGZA 2EYFA 4PMBA 4QB4A 5KIXA 3SK6A 5IGCA 1A3TA 2OF1A 2F3VA 3MHBA 4B9WA 4EVOA 4F8MA 3ITPA 5EGTA 1SNMA 1SYDA 1JOKA 2EY5A 2F0WA 3H6MA 3NXWA 4S3SA 5IODA 5KYIA 4ODGA 4NP5A 3E5SA 3NP8A 4K2KA 1SYFA 5HURA 5KEEA 5J39A 3OMGA 3PMFA 3BDLA 4K6DA 3DMUA 5C5MA 4K8JA 4NMZA 1TR5A 1F2ZA 1TQOA 2F0IA 2QDBA 1SNDA 2F0TA 3ERQA 4N9PA 3T16A 2EYPA 5E3FA 5IGBA 1KDCA 1STHA 4KJOA 1SYCA 2PW7A 4J1MA 5KYLA 3D4DA 2F0FA 2EYJA 4HTHA 4HMJA 4K5WA 3QOJA 5CC4A 2LKVA 2EYLA 3V2TA 5IGEA 1JORA 2SNMA 2OXPA 3OWFA 1NSNS 2RDFA 1KAAA 4ID6A 3TP6A 5C6AA 3MXPA 3QB3A 3NK9A 2O4XA 4H7BA 1SNOA 3NQTA
chains in the Genus database with same CATH superfamily
1SFOB 1SAPA 1VCIA 5FO8B 1EQVA 4L5QA 3GTJB 5LMNQ 5ELCA 1OXSC 3SK5A 5C4XB 3QG1A 5BR8L 5F2DA 1AE3A 3OMCA 4CKEA 5IIFA 4DUYQ 3G6EA 5I6WA 3LGJA 4ZCKA 4EGVA 3S1MH 4BY1G 1SSOA 3BVMA 4ZK9B 5M5YB 4JI3Q 1HFNA 2RSOA 1HQMC 4H44C 4ILWA 4DV7L 2N8NA 3STBC 4UP9A 1EQRA 3SXHA 3NWTA 1IW7D 3S9WA 1BBUA 2UXBL 1ZYRC 1TWFH 5IGFA 4IQZA 4GN4B 1HPCA 4U673 5ISRA 3VR6A 1LT4D 2IT1A 5C3WA 1A8VA 1U4LA 3VYSA 4ME5A 1QVCA 3E9HA 4LWCA 2LFNA 4OHJA 3OSOA 1SE4A 3GTPH 4M1UB 1QE6A 2BA1A 3CW2C 3CCMA 2DN8A 4A3GH 3D0FA 1G291 2I5MX 1RDPD 3ZYYX 3EQLC 1VQLA 3TSSA 3HOYG 4LF4L 5E7NA 1ASYA 4GOPB 4R4QA 3FKIH 2PCFB 1PFBA 1TVXA 4A3IB 1EY4A 1O7ZA 4JBJA 3CCRA 3A8KE 1D7QA 1SMYC 1EZ8A 1JWSD 2UUBL 3T1YL 4OO1G 3U4VA 2ES2A 3HOZG 4K14A 4PMBA 2B2VC 2UXDL 1AFPA 1B9NA 2FXQA 3CMEA 4DUZL 3EBEA 4OONA 3LNNA 2JA6H 2Y0SE 4QCLA 4G7HC 5HURA 3FMCA 4YHHQ 3S2HB 2EZVA 2LY7A 3CCEA 2WV6D 2JA8B 3KYHC 1Q1EA 5C3EB 4DV2Q 4FNFA 3I3CA 4NW2A 3WWVA 1JC7A 1Y1VH 2L9HA 4DK0A 2XRSD 1T5EA 2PI2A 1E2ZA 1HCZA 3D31A 2JK8A 2OWOA 1K73C 3CC2A 4X3UA 2Z9HA 4KKUA 1Q82C 1DYQA 3GTLB 2M9VA 4PMCA 4RGOS 1CI3M 2BA0A 4M8AA 4NXNL 3RUZA 2AKWB 4A3EB 5JJKA 4GOPC 1GOZA 1CKNB 2F0OA 2PNHA 3CCLA 2MP1A 1FNWA 1PH8A 3R2IA 4DR6L 2RCFA 2EYHA 2K5VA 3F8TA 1I6HH 4MTKA 3OIQA 3S24A 2YTYA 3J7AV 4H0LC 3BJUA 2DJFC 1MD2D 3TP7A 1KD1C 4EQNA 4PG3A 3K57A 3QJYA 1M8AA 2MQHA 3ND8A 4AQYL 1XMQQ 3EIVA 1K3RA 2MNAA 2BDNA 2KCCA 3Q24A 1BBXC 4LF8L 4PZ8A 3EFXD 3DWQA 4JK1C 1N32L 3SR1A 3I2ZA 2AUJD 1LTAD 5I6YA 2QCPX 2NVTH 1FYCA 3V05A 2NN6G 4KHPL 1SYEA 4KTAA 4PZ6A 1KNAA 2KBNA 3KFUA 1E24A 4FP5D 2PQEA 4BWGB 1PTOB 3R3OA 1RCVD 4A3CH 3PO3G 4GKKQ 2CCZA 4K0KQ 1HZBA 2A69D 4RH6A 2AQ3B 1EY6A 4IOCA 1J8IA 1SFOH 4CBVA 3O13A 2RF4A 2I5HA 5IP7G 4F87A 4HJ8A 4C56C 1IYJB 4OIJA 5C4XH 2IY5B 1A3VA 1I4GA 3AFQA 5BN3A 1BOSA 1O7IA 1DXMA 1ZXTA 2PMZB 3S1RB 4DGZA 4ZYSA 1K83H 4OWWB 4A3LG 2E75C 4HJ9A 1VF7A 5M5YH 1PXUA 2X6GA 3ITPA 1JQYD 2F0WA 3ZJYC 1E1TA 2OTLA 1O80A 5M3MG 3HOUH 1HZCA 3K7AB 3PF5A 1FJGL 4RHRA 1BKBA 2SDFA 2E2IB 5IT9c 4A3BG 3T16A 4N9PA 1KDCA 1STHA 1I4HA 2CWAA 4YWMA 5LMUL 3HOXB 1B9MA 3I90A 3QOJA 5AJ3L 4DV3L 2X6LA 5IGEA 1BR9A 1KLUD 2IX3A 5KNDA 1HNZQ 2NBFA 2DGYA 4H7BA 4C1NI 1XMOQ 1DZ1A 4E6IA 1E3PA 5M3FB 1GO3E 3I72A 1RF2D 4N8FA 4DAVA 1YJWA 4LF6Q 4JW0A 3D8GA 3H09A 3CD6A 4BA1I 2HCCA 1AZPA 4UP7A 5LMNW 2D0PA 1FGBD 5COYA 4DR2Q 1B1ZA 1L0YB 1F9RA 4HSVA 4XQQA 2WB1G 4K6LA 1YHBA 4DFAA 2N3SA 2NB0A 3AU7A 4CJ0B 1JOOA 1SMXA 4IJLA 3TN2A 3PCOB 1HA6A 1SNPA 4JVZA 2UXCQ 2MPMA 2JEBI 1VQAA 3OYYA 4P2CB 5GROA 1F9PA 1PH6A 1SYGA 3S2DB 3A74A 2WKDA 2GN5A 2NUCA 4ULLA 3PUWA 1WD1A 4IFDH 1KHIA 5JVH3 1V8QA 3HFZB 3TZUA 1I94L 1H9KA 3PIO3 2HDLA 1L2FA 4BY7H 5C5LA 2JA7B 3SK8A 1N34Q 3I4OA 2WAQB 2B63B 1EFWA 3MAQA 3M7NA 4KK7A 5NUCA 3M3YH 4DR1Q 1A15A 1SLJA 3KBGA 1LT6D 1JICA 1EQTA 2B2WA 2N49A 4DNTB 4EQPA 5JAVA 5J22A 1GUSA 4TKOB 2A19A 5I9OA 2OQKA 2OT2A 1VQOA 4DV6L 3J81c 1TS4A 4KHZA 3TREA 2CFMA 1G91A 1IL2A 2XVSA 1PLFA 1Q8IA 1CKNA 4C1NK 2H1EA 4A93G 1TIID 3I4MG 2CW0C 1YJ9A 1X3PA 4ODGA 2QF7A 4A3DH 2B2YA 1HNXQ 2JE6I 2K5HA 4NMZA 1TR5A 4HAEA 2E5LQ 2R93H 5C44G 1Z7TA 1WJJA 1CKOA 1B50A 3L2PA 1LTTD 2K04A 1X9NA 5KYLA 2ZM6L 1UE7A 1LT3D 1JWUD 3V2TA 3E0EA 2K5DA 4XTCS 1HFGA 4XYQA 2NZHA 2RCNA 3NQTA 5DM63 1PRTC 3GD7A 4R8NA 3K80C 3HS0C 3FVQA 3NBIA 3VR3A 5IP7H 2AQ2B 4B3TL 4XIGS 3A56A 3R8BA 1DM0B 1I5FA 1PH9A 2JXMB 2GVAA 4CDDC 2F4VL 2ZT9C 3S1NH 4BBRG 1LTSD 1XX8A 2ALYB 4XQNA 2PW5A 1RL2A 3I70A 1WTWA 2JA5G 1WFQA 1EIGA 3JAMc 4QIWB 3S1RH 2KECA 5EAYA 3J81i 3LWUA 4B3SQ 5DM73 4DR3Q 4A3BH 1I3QH 1CM9A 1YHAA 3VA5A 1E7ZA 1N33L 1STYA 1YEZA 4C3JB 4X65Q 1QJOA 4A3JB 1F2YA 1LTBD 2EJGC 2PQAB 2Q2IA 4A3FB 1R9TB 3GTKH 1X65A 2QILA 1GVPA 3Q23A 2B2TA 1UUPA 3K5NA 1YVCA 1HR0Q 4BXXG 4XT3B 4NB3A 1EZ6A 1C0AA 2CH4A 5CGKA 1V43A 2YTXA 4KKTA 3AQQA 1A2TA 5T1GA 4QY7A 1R4QB 4HJAA 2RKSA 5M3FH 4CKBA 2Q8RE 4LAAA 5JOBA 4JBKA 3K7UC 1Z47A 2HQEA 2NVYB 1AE2A 5BR8Q 2Y0SB 3CCQA 2VUMG 1JOKA 2K32A 4O2DA 1LTLA 3RD4A 4GKJL 1S5DD 5KYIA 2Z6KA 2KUMA 3HOVG 1G6PA 4NP5A 3TS2A 4DR4L 1SYFA 4R4OA 1SRUA 4IUVA 4DV7Q 2VB2X 1SJED 1FVIA 3S2DH 2RSNA 2KENA 3D4DA 2XRQD 5EPLA 3MC0B 1K0RA 2LMCB 2CH4W 1X3FA 1D2BA 4FXKC 1HUMA 5DNFA 3PUXA 4P74A 2B63H 1NR4A 1ILPA 1H9RA 2V1CC 4ZLTF 1EU3A 3NTIA 3H3VC 1CHQD 2CHBD 2K5WA 1CSQA 4N8X1 5A35A 4DAMA 1WVLA 4JI0L 4JV5L 4A93H 2HDMA 3BDCA 5L37A 4LF4Q 1ML0D 1TWHB 4IALA 2L15A 2CKZB 4LFBL 4X66Q 3DHQA 1BNZA 2UUBQ 3T1YQ 2F0HA 3P1HA 2IWHA 1OXTA 3X3MA 5IP9H 4A3GG 2UXDQ 4IFDJ 5KGUA 3D4WA 4DK3C 1C7YA 3CQZH 1Y1WG 1MBYA 1TS3A 2WINB 2R7ZB 3FKIG 4JOIA 1A2UA 2EY2A 2F0NA 4J6HA 3TRZA 1DJRD 4IURA 1XTDA 4PV1C 3L0OA 1XXGA 3D4RA 5JJIA 1NUCA 2Q8IB 4OELB 2EOTA 2JEAI 2K1BA 1BCPD 1TY2A 1VMPA 2QW7A 4IFDI 1GHJA 2R7FA 1TWAH 3MVVA 5K36G 4JI4L 2A73B 2I5LX 2JA6G 4BBRH 2AQ1B 2VQFL 5J1ZA 1PYWD 2QDLA 2G5DA 4NXNQ 4C3HB 1IBLL 4O1NA 5IYDH 1WTPA 3D6CA 1PZKD 2EYFA 1E2WA 2OQ0A 3ONAB 2DUDA 1Y1VG 2PO4A 3NSWA 3J80c 4DR6Q 5IWAL 1S5CD 3T51B 3UI2A 3H6MA 3K58A 4MNOA 5IODA 3NPPA 3K5OA 2K75A 5J39A 1SXTA 2B2UA 3PO2B 1QUQA 4C2MH 4K8JA 4HIOA 3CAMA 2F52A 2MFIA 3PUYA 4FVMA 2UU9Q 2I0QA 5D3DA 1ILQA 1G2TA 3MA2B 1YNNC 1N32Q 1P16A 2NN6I 4DAPA 4AYBG 3STBD 5FLXc 5EKKA 4OX9L 4GN3B 3ULJA 1EY0A 1Q8KA 2PQAA 3CHBD 4JI1L 4HJ7A 3RN5A 4KHPQ 5IGDA 1YNJC 2EDGA 3ND9A 4K8IA 1GUGA 1FL0A 5EPJA 2M00A 4IPDA 3K0XA 5A2QL 4WRDA 2MHVA 3J7AF 3I4NB 2UUAL 1RD9D 2RDHA 3S1QB 3HKZB 1ESFA 1J6QA 1EWHA 1IL8A 1YIJA 4CJ1B 4B3RL 4HSPA 2O5JC 1K8MA 1SYBA 3J80i 4A3CG 2AMCB 2LXKA 1YHQA 2ZTDA 2PPBC 3A7LA 1SEBD 4RGMA 2K01A 1KRTA 3BVGA 1SMYD 5EBCA 3E9IA 1P8LA 4LUZA 1FJGQ 1UE6A 1EWIA 5C4XG 2O2LD 4FF2A 4N9TA 4LNQA 2OEOA 5DLQE 5LMUQ 4LFCL 1T9HA 1R4PB 1A6XA 2ID0A 1JJGA 3MXGA 4DF7A 5AJ3Q 4V0BA 1HR0W 4DV3Q 2ZXPA 1NY4A 2NVQB 3KOJA 1D6EC 3BVZA 2KVMA 2L0CA 5GAHC 3HOUG 2I46A 1CZGA 1IKLA 2LSSA 1CUKA 3KF8B 5D3IB 4Y7NH 3WOEA 4I7ZC 2F3VA 3ERSX 1PH3A 1DOLA 4PMWA 3DM1A 3UDFA 1PHJA 5A2QE 3PIOA 4LF9L 5KEEA 1V1PA 3CKIB 4YCVA 3PMFA 3RLNA 2H5XA 1Y1WH 4RMFA 4K6DA 2ZJQA 1F2ZA 1TQOA 4JPBW 1U4MA 3AB9A 4IUTA 4X3TA 4MZ9A 2JQOA 1VQMA 3I73A 4CDEC 1X55A 5I2YA 2R7ZH 1Y8NB 1Q3LA 5C0XH 3HG9A 3OWFA 3QR8A 5K36H 5T1IA 1UNSA 4A3IG 2K4KA 3VR2A 4UAIA 1I94Q 1PZJD 2D5DA 2Q2UA 2F0QA 4GS3A 3HOZB 4KN4C 1IYUA 3M85A 4RCOA 4ALPA 1SE8A 1J9OA 3GTGB 1PFNA 2XIWA 2Z1CA 4QL5A 3A55A 4R4TA 4AH6A 4B9XA 1F9SA 4PZ7A 1N36L 2K50A 4X3KA 2DNCA 3CP0A 4IUNA 4IFDG 2IX1A 1UE1A 1A3UA 1E1OA 2B8FA 4C3HH 2JA8G 1LV9A 4FO2A 3N52A 3FEWX 5C3EG 4KJNA 4BY7G 4DV6Q 2DNEA 1C48A 1ASZA 1HHVA 3OWEB 5IY0A 2EY6A 1PH5A 4YWLA 3MZ5A 1VQHA 4ZUJA 3A5ZB 3M4OB 3W1GA 4KY7A 5FO9B 2ZXRA 5BN5A 1PMRA 3H0GB 1TKWB 4FF4A 1XPOA 4A3EG 3W3AA 1HZ9A 1TWGB 2Z4IA 2KJXA 3S17B 1C9OA 2XSCA 2PZWA 4MHEA 4F7XA 5CV6A 2ZM6Q 4JI2L 4NKLA 1SNQA 3P75A 1BBWA 4YY3L 1ICWA 1B3AA 4A3DG 4IPCA 1IBML 1QOHA 1VQCA 2B2WC 3WOFA 5CV9A 4YCUA 2R93G 4OGQC 4B3TQ 1VQPA 2K6AA 3OTOL 1OXUA 2X69A 1LM0A 2K7VA 4EVOA 1K28A 2F4VQ 3RR5A 2NVXB 4IJHA 4DR7L 3UE1A 3BZCA 2QEXA 1XPUA 1CT1D 2YU9B 2DJGC 3OMGA 2IW3A 4TVAB 1X54A 3DMUA 3EN2A 3RLOA 1JT8A 2F0IA 3PO3B 4QGUA 1L0WA 5IE8A 1XJVA 5E3FA 3GTJH 3UDXA 5H1SE 2B2YC 3L3OC 4HTHA 4HMJA 3Q0AA 1N33Q 4A75A 1MGSA 3Q22A 4DR5L 4Q5VA 4JC0A 2ZJPA 1BO0A 1RHPA 1PFMA 3N6RA 2PI2E 4G4KA 3FP9A 4ME3A 4KN7C 4RKBA 1U5KA 3EJIA 2NVQH 2AWOA 2A6HD 2E2DC 1JB7A 4QUFA 1DGSA 2WACA 2QEJC 1TT2A 2TSSA 4LFAL 1S5ED 1STNA 2Z8LA 3A7AB 1PTOC 4GNXA 2J4XA 1PH4A 5M5XB 2MUYA 3RNUA 3Q6SA 1Y8OB 2HIXA 2G9DA 3OPOA 1GJXA 3GTQB 1XWEA 1TU2B 4K5XA 2R3ZA 4LUOA 3KF8A 1EWCA 2AHOB 1SROA 1HTPA 5D14A 1EY7A 5IOCA 1H95A 1I50B 2K5QA 4GKJQ 1H9MA 5EBDA 4AYBE 5M3FG 4DR4Q 4WJ4A 3FHWA 4A3IH 4P73A 2N88A 5M9OA 1KC8C 3TP5A 5EKIA 1ENCA 1FR3A 1JE5A 1V9PA 2A69C 1B53A 2CW0D 1D5ZC 2F0MA 4XDXA 3EVQA 2WB1B 2B2TC 3DEPA 4YCWA 4OWXB 3I91A 1BCPF 1GM5A 1X3GA 4XQJA 3S2HH 1G6ZA 2JA8H 1GKHA 2J7ZA 3UE0A 2ZXOA 3VYTA 5C3EH 5CBAE 3H91A 4DV5L 5KIXA 4X64L 3RZDB 1DCZA 4S3SA 2LXJA 4JI0Q 4JV5Q 1PRTD 1KXLA 4HEDA 4K2KA 1FNVA 1K8OA 2RDGA 2JA7G 1VQJA 3GTLH 2VNUD 2B63G 1LLRD 1A0IA 4A3EH 4LFBQ 3K8AA 4A3KB 2Z6KC 1SYCA 1LO5D 5C0XJ 3C46A 3S14B 3GTOB 1VQIA 3NEMA 1CQFA 2VQEL 2EYLA 3H0GH 3G48A 3S16B 1JORA 1VQ9A 1TWCB 3TP6A 2JN4A 1TWGH 3AYHB 2A6EC 3WDNA 1AW7A 3BG3A 3RN2A 3S17H 3F2CA 4UY8C 1CFMA 3W5OA 2F0UA 3GV6A 2BDOA 1HRJA 1EUJA 5IP9G 2PZTA 2BE5C 2F0KA 3ER0A 4R8IA 4OEMB 4JI4Q 3K5LA 5LHY1 2F0EA 3PSIA 2Q8TA 2L4NA 4P75A 2VQFQ 5C44B 1VQNA 5AFWA 1BVSA 3U9OA 3R2TA 3FPUB 1PTOH 1QILA 4RGNA 2IPKD 1B70B 5IT9L 3A8JE 5FKAC 1SN8A 1WTHA 4QJFA 5KRUA 4CKCA 2E2JB 1EYAA 3KLWA 5IWAQ 4KHVA 3GDEA 4Z9CB 2YU9H 1H9JA 2HUGA 3G4SA 1S72A 3SGIA 4DV4L 1D1KA 2TMPA 1QUQB 4LJZC 2R7DA 4DV1L 2HCIA 1WTXA 2EPBA 1ET9A 3F2DA 5IYDG 5C4JB 1E22A 4G57A 2FFKB 3SDZA 4GLXA 1KDBA 3GP7A 4JOIC 2JA5B 3HOWB 2SOBA 1EFID 1RTOA 2N55A 4KD3A 4GN5A 4IN3A 1YJNA 3K7AH 4KD4A 4A3MB 4IO9A 4ZAIA 3F2BA 2E2IH 2Z6BA 4JI1Q 2KEDA 3MEFA 1QB5D 2V4DA 4QB4A 3HOXH 1GHKA 2HT1A 3PIP3 4C3JG 4A3JG 1EEID 3NXWA 3TS0A 1M1KC 4A3FG 3HGBA 1GUWA 2UUAQ 4J8QA 4APVA 1ONLA 3GO5A 1UEBA 4TSSA 4DN4M 2AUKA 3HP3A 1PH2A 4MN3A 4B3RQ 1A63A 2WP8J 4EX5A 1EL0A 1WCMB 2B2UC 2F0FA 3IAYA 2KHJA 2BH8A 5CC4A 3I7FA 4JI6L 4LF7L 3JC66 3R93A 1EQQA 2XTIA 5IT9E 1NSNS 2RDFA 1V1OA 1U4RA 4JI8L 3RZOB 5EPKA 3SEBA 4B3ML 4P72A 1HNWL 1RJTA 4L5RC 3JAMi 2EYMA 3DWAA 3KLSA 4X62L 4FYDA 2K03A 2QGQA 2VUMB 1QCBD 1EYDA 3J81L 2B29A 4LFCQ 1NCVA 1GUOA 3E0JA 4FF3A 3HOVB 2UXBQ 2R92B 2RA4A 2D9UA 2F0JA 2L5TA 2K33A 5K5PA 2OTJA 1NJIC 3MFGA 1WI5A 3BS1A 1VQ7A 4C3IB 2A68C 3Q8DA 2JA7H 2WKCA 3T56B 1AEXA 3RZDH 5JJZA 2Q2HA 3URYA 4HIMA 4IPHA 1I6VC 1KAWA 1HA5A 3S1MB 1E0BA 3SHLA 2D0OA 3M9BA 1DD2A 1UE5A 3A5UA 4LF9Q 2XGTA 3KBXA 4PQXA 1V1PB 4LK1C 5CYUA 1TWFB 2PYKA 1UAPA 1IXRA 2C5CA 2EIFA 1CA6A 1TWCH 2QKIC 5EQ0A 1QVGA 3M4PA 3S15B 4JYAL 2H4OA 4Y52H 5TSSA 3KF6A 4DUZQ 2PNRC 3GTPB 3I8ZA 3K6OA 3AMUA 4HJ5A 2A8VA 3PQIA 3BYTB 1IKMA 1EY5A 2ICEC 3CCVA 4A3GB 2HD3A 4K2LA 1DONA 3SK6A 1A3TA 1CKMA 1I4QA 3OHXC 3PUZA 2EY5A 3T1HL 5JJLA 2R7ZG 1L1OB 5C0XG 3J81E 1N36Q 3J7YW 2LS01 3NP8A 1TY0A 1VQDA 1HZAA 3VYRA 3D6WA 1BF4A 1C4QA 2E2JH 3TQYA 1QVFA 1Q86C 1KL9A 2LKVA 1PA6A 4LF5L 5FLMH 1KQSA 1LT5D 4HIDA 1ENFA 2CWPA 3MXPA 1AZQA 2O4XA 4L8JA 2EY1A 5CV7A 5M5WB 1B3QA 1G2SA 4C3HG 1ZEQX 4OXPA 1BXTA 3U58A 1Y1VB 4MIUA 2IHEA 4DKAC 4YWKA 1Q1BA 1WTQA 1U0LA 5IYCH 2CQAA 5HGQA 4DXGA 4AQYQ 3C3LA 4C3JH 4A4IA 4JI2Q 3UDIA 4A3JH 5GQOA 3W2DA 4A3MH 2SEBD 3LWEA 4A3FH 1R9TH 4YY3Q 4LF8Q 2N78A 3DM3A 4L6TB 1IBMQ 4V190 2EXZA 1EIHA 1SBBB 4U68A 4JI5L 5EJWA 1QWYA 2KHSA 4FXGC 3OW2A 1ZYRD 3OTOQ 1I6HB 5C4HA 1STBA 1I4RA 2JP1A 2P5ZX 2L55A 4AYBB 2WIIB 5IYBH 1AN8A 3H3VH 4DR7Q 1K0SA 1J5EL 1K9MC 2I07B 4DR3L 4X3SA 3GTMB 1W6JA 3DUZA 2HHHL 2B8GA 4BBSB 3TBIB 2NZOA 2JSOA 5I2XA 3CF5A 2NVYH 3GV3A 4YIJA 2AWNA 1EYCA 4P71A 4G7OC 2K5NA 4GLVB 1KABA 3OIPA 2NTTA 3QIAA 4DV0L 3I4NG 2NVTB 1BDOA 3HKZG 1IBKL 1KDAA 2RHSB 1HR0L 4NXML 2ASBA 3PF4A 5EKLA 4NDXA 5C3XA 1LTRD 5JPNC 1LACA 1I4XA 2CVRA 2F0DA 2F1MA 2R92H 4TQUS 4MTNA 3A54A 5JPMC 1UWVA 4C3IH 1MSGA 4BY1B 3E5SA 1OTCA 4LFAQ 1FNUA 4RHSA 5LL6X 1Z6HA 1VDZA 4GNXB 2QDBA 5GAGC 1SR3A 3M4YA 3CC7A 1PRTF 1K83B 3KJPA 1PH7A 3NWSA 2ICIA 1TS2A 3CC4A 2DY8A 5CBEE 1WTVA 3D3RA 3ICEA 4HCSA 2KOLA 5GAEC 2FJ2A 3QB3A 1TWHH 5JVG3 3KK7A 4L5SA 4QIWE 3HOUB 4QMGA 1RIPA 1X56A 4ZKBB 3E3XA 1CK1A 5ELOA 2MO0A 3S15H 4HIKA 1Z9FA 4JI7L 3NTHA 2EQSA 1EIFA 1HTLD 3J80L 4KV6A 3HOYB 1G51A 1EIYB 5DAUA 3I4LA 2K14A 1ICFB 1S3OA 4DK6C 3VDYA 2EJMA 3PUVA 1D5XC 4DV5Q 3QO2A 1F2MA 1CHPD 4GNXC 3CRKC 4X64Q 5KNCA 1HH2P 2NYZD 4CJ2C 3W1BA 1HXYD 2BCOA 4X66L 3G6JB 4ABNA 1D1IA 4O0AA 1L1OA 1K8AC 2MO1A 5FLXL 4NPSA 4X6AH 2B39A 1IW7C 3MFYA 1VQEA 1VQFA 2FMMA 4DPGA 5CV4A 1WD0A 1I4PA 5CV8A 2VQEQ 4XXEA 4OL7A 3SVMA 5JEAH 5ELEA 5M5WH 3NTKA 3NE5B 4BY7B 4RWSC 1U9RA 3PO2H 3ULPA 4DNRB 3SK4A 2ENBA 1VQ5A 4POGA 2JJQA 4PNYA 1WYDA 3KDFB 2GVBA 3M3YB 3H15A 2K52A 1GUNA 1XNRL 1SNMA 1AP0A 4RGTA 3H0GG 3PGZA 3G71A 1VQGA 4O42A 1K8GA 3MWYW 2BH2A 3J80E 4IOAA 1WTOA 5C5MA 4AIMA 3CPFA 4POFA 1B7YB 2E2HB 2E76C 2R6GA 2VW9A 1EYGA 4R1JA 2JA9A 2PW7A 3M4QA 1X6OA 1NAPA 2CQOA 2EYJA 1A62A 4RAUC 3VR5A 5CMDA 2IHFA 2SNMA 1B2TA 2OXPA 4BA2I 4A3DB 5C6AA 1VQ4A 1XNQL 3GTMH 1PTOD 3I4NH 3NK9A 3NUCA 2UU9L 2SNSA 2VB3X 2F0PA 3E6ZX 3RLFA 4BBSH 1S5FD 4DV4Q 3S1QH 2R93B 5KNBA 5GADC 4DV1Q 1F2LA 1S4ZA 2C9OA 1L0XB 1HQRD 3MXNA 3PIPA 2UUCL 5FLXE 1LTGD 3A0JA 4DU9A 2FINB 4I7AA 1MI2A 4XYOA 3U50C 3I56A 4DAYA 5G3LF 4IPGA 2FMCA 3T4AC 4L5TA 1B8AA 1KRSA 2D2CC 4K5VA 1RTNA 4J15A 2ZTEA 4ZUIA 1OXVA 5FOBB 4QUCA 1HUNA 1NBWA 5FO7B 2EJFC 1Y14B 3S1NB 3UDGA 2F0VA 2K05A 3K5MA 4BY1H 1XTCD 4JBWA 3BYYB 1X32A 3CCSA 5I9PA 1MJCA 2NZ1D 5C4ZA 3KUPA 3MTSA 5M3MB 1SDFA 3OW7A 2HIVA 5LMNL 2YYZA 4H13C 4IZ8A 4XT1B 2L12A 4A3BB 4LMQD 1I3QB 1S40A 1LUZA 3HOXG 4DUYL 1BUVT 2KQ3A 3H3VI 1IZ6A 4JI6Q 4LF7Q 3DEOA 3TP8A 5FJ8G 4JI3L 3FRPB 4JI8Q 3GTKB 2B2VA 2E74C 4B3MQ 5J3BA 3U4ZA 1M4VA 2JYOA 2NWGA 1JB3A 1HNWQ 3TZDA 1CSPA 4X62Q 4WFN3 5IGCA 2OF1A 2MJ8A 3AEVA 3HOYH 4Q0FA 5EGTA 3KLSX 5LL6S 4QQBX 2A6ED 1C8CA 2FHTA 1YI2A 5ELNA 1OO9B 3K0YA 4H02A 4OO1H 2EXDA 3VR4A 3HOZH 1LABA 2Q2TA 3KLRA 3GTGH 2VL6A 2OCEA 1QNUA 3CCJA 2M2LA 2BE5D 1LTID 4KMUC 3NBHB 1HJPA 4GOPA 4F88A 5HY6A 1Q90A 4A76A 3HKZE 1PVOA 5IGBA 1V1QA 2Z0SA 1EEFD 2L11A 2A6HC 2WAQG 1KNEA 2EYOA 1FGUA 5DEHA 2R61A 1MJEA 1YBYA 2VY3A 4JYAQ 3M4OH 3NQIA 4RCNA 1NMFA 1VQKA 4YHHL 4DXFA 3KF6B 3FDTA 1IHZA 3GQBA 1YNXA 1SJHD 4A3KG 1K3BC 3P7JA 4HMIA 4DV2L 1X3QA 1PRTB 4EQOA 1F9QA 4L63B 1M90C 1WOCA 4BS9A 5IGGA 3DLLA 2HQLA 3KDFA 3NELA 1NTGA 1RODA 4A93B 5C0XI 4IUUA 1W3SA 1G8ZD 3T1HQ 3I4MB 2XWJB 3IFDA 2F0LA 3L9AX 1UEAB 2F3WA 4HCEA 1O7YA 3VYUA 2E2HH 1D8LA 3QOLA 4FXDA 4OWTB 1F77A 3C2PA 1PDQA 3LX0A 5E1FA 3G7LA 2VS1A 5I4DA 2K28A 3V96A 1SE3A 2E8GA 1PZID 5JEAJ 1IBLQ 2B3GA 1EY8A 3CQZB 3KJOA 1ENAA 3HZXA 3AFPA 5D65A 4LF5Q 1NR2A 3RMHA 2NTSA 3BZKA 2NVXH 1VQ8A 1Q46A 2NN6H 3MXUA 1E2VA 3IL8A 1VQBA 2F0SA 3PO3H 1XMQL 3I55A 3NENA 4DNIA 3HRZC 3DWPA 1TWAB 3ULLA 3J7A5 4F8MA 4R4IA 1CA5A 4BBRB 2VXWA 4ZRZA 5FLMG 1NNXA 1JJ2A 2ZTCA 4LUVA 2QA4A 3H94A 1VMCA 3BU2A 1Q7YC 3OOCA 1PYBA 4GKKL 4A3LH 4JI5Q 4OX9Q 4J1MA 5E4XA 4K0KL 1MIUA 3HOWG 5IYCG 1CZWA 2YV5A 3J81j 5ELBA 3A8IE 4RG1A 1KAAA 4ID6A 5M3MH 1SE2A 2A68D 5FJ8H 3P20A 4C2MB 4A3MG 2F0GA 3HEJA 1J5EQ 1DOMA 1DOKA 2RHQB 2MGSA 3X3NA 1T5XD 1II3A 4ZQ3A 1H9SB 5M5XH 1QZGA 2HHHQ 1EY9A 1YITA 3CU7A 3CMAA 2WFWA 4UDUC 1ET6A 3GTQH 3C1EA 1MSHA 4B08A 4DV0Q 3FPPA 3CXCA 1NE3A 2RQXA 1I50H 5IYBG 1JOQA 1IBKQ 1STGA 4HR7B 4NXMQ 4KKSA 4QF4A 5CR3A 1PH1A 3EROA 1JCKB 5HGTA 1ZKOA 1WCMG 4RFBA 4FF1A 2KA7A 5G3LD 2Y0SG 3QWNA 1VQ6A 4I65A 1HNZL 1ESRA 1JWMD 2ATWA 2XWBB 1XMOL 4ZKCB 2F4IA 5E4WC 4LF6L 1OXXK 5ELDA 1GXDC 4G7ZC 4JCVE 4KY6A 1AH9A 4RKLA 1B4OA 4KLKA 4UPAA 4DR2L 3T53B 2R92G 2RBMA 2BOSA 4EQ5A 1O78A 2F3IA 1MKHA 3NBHA 3PV0A 3J7ZC 1Y8PB 4C3IG 2IJ0A 4CDCC 1NMGA 1EU4A 2PZUA 4R4CA 2UXCL 4UP8A 3C1FA 1B44D 2F03A 4A3KH 5ELFA 3S14H 3EA6A 3L7ZC 4JI7Q 1X3EA 1Q12A 3VA7A 2PMZE 3MHBA 3GTOH 1S5BD 3HKSA 4UHVA 3S16H 4DK1A 2IX0A 4R9WA 3BDLA 2KCNA 2Z4HA 1N34L 1IYVA 1EOVA 2F0TA 1GUTA 2EYPA 4Y7NB 1PV4A 4KJOA 1WTRA 4IUPA 1QG7A 2XNAC 4DR1L 3I4MH 3JAML 1CTMA 1YNND 1Y1WB 2XN9C 4OO1I 1W6KA 4FDBA 3FKIB 5C44H 3DXJC 3IKJA 4OIKA 4CHTB 1RKNA 3TMEA 4JBMA 1VF5C 1PTOF 5CV5A 1YNJD 1JMCA 1TS5A 2EVBA 2YTVA 1KLGD 3IRBA 1HNXL 1O7LA 2JA6B 1JR0D 3CCUA 2E5LL 1W2BA 1BCPB 2O5IC 1STEA 1SNCA 1PFSA 4GLAC 4WORA 5FK9C 2GA4B 1STAA 3CRLC 2D62A 5C4JH 2EE1A 2C35B 4KI0A 2WB1E 2KCMA 1XNRQ 2JA5H 1XPRA 1U4PA 3M7GA 2ZJRA 3HOWH 5CORA 1Q81C 2A74C 3F1ZA 5JEAG 4CGYB 2A1AA 1KTKA 4WJWA 4JG2A 3TEHB 1JE4A 4TRDA 3PO2G 1N9WA 1GD7A 2G9HD 2WAQE 1KIXA 3T13A 3BZDB 3NHHA 4GZYC 3BDOA 1Y69U 1BQQT 1L1OC 4HN7A 1D5MC 4KY5A 1LYLA 1YZ6A 3JAME 3B6YA 3TDQA 4IUQA 1XNQQ 4WJ3M 1MHWC 2VZAA 1TXYA 1N8RC 1XYIA 2IL8A 2KEEA 4B3SL 3K81C 4BXXH 3MEHA 1VS0A 1H9SA 3MXNB 1FD7D 2UUCQ 1WCMH 1BCPC 4B9WA 1SYDA 4X65L 4RA8A 3F2UA 3K59A 1QNKA 2KHIA 4DAYB 3RZOH 2RVLA 3SE0A 2KCTA 3CPWA 3ERQA 2DY7A 1SNDA 4BBSG 3U9SA 4DR5Q 1QZHA 5BN4A 2A5HA 1CQVA 2VUMH 1PYSB 4K5WA 1EOTA 1JJCB 2J0TD 2L1BA 4CDFC 3HOVH 3IFTA 4LW1A 1SNOA 4DA2A
chains in the Genus database with same CATH topology
1SFOB 1SAPA 1VCIA 5FO8B 1EQVA 3GTJB 5ELCA 1OXSC 3SK5A 5C4XB 3QG1A 5F2DA 3OMCA 4CKEA 5IIFA 5I6WA 4EGVA 1SSOA 3BVMA 4ZK9B 5M5YB 1HFNA 2RSOA 1HQMC 4H44C 4ILWA 3SXHA 3NWTA 1IW7D 3S9WA 1ZYRC 5IGFA 4IQZA 1HPCA 4U673 5ISRA 3VR6A 1LT4D 2IT1A 5C3WA 1U4LA 3VYSA 4ME5A 2LFNA 4OHJA 3OSOA 1SE4A 4M1UB 1QE6A 2BA1A 2DN8A 1G291 1RDPD 3ZYYX 3EQLC 3TSSA 2PCFB 1PFBA 1TVXA 4A3IB 1EY4A 1O7ZA 3A8KE 1SMYC 1EZ8A 1JWSD 4OO1G 4K14A 4PMBA 2B2VC 1AFPA 1B9NA 3LNNA 4QCLA 4G7HC 5HURA 3FMCA 3S2HB 2EZVA 2LY7A 2WV6D 2JA8B 1Q1EA 5C3EB 4FNFA 3I3CA 4NW2A 1JC7A 2L9HA 4DK0A 2XRSD 1T5EA 1E2ZA 1HCZA 3D31A 4X3UA 4KKUA 1DYQA 3GTLB 2M9VA 4PMCA 4RGOS 1CI3M 2BA0A 4M8AA 3RUZA 4A3EB 1GOZA 2F0OA 2MP1A 1FNWA 3R2IA 2EYHA 3OIQA 3J7AV 4H0LC 1MD2D 3TP7A 4EQNA 3K57A 3QJYA 1M8AA 3ND8A 2BDNA 2KCCA 3Q24A 1BBXC 3EFXD 3DWQA 4JK1C 3SR1A 2AUJD 1LTAD 5I6YA 2QCPX 1FYCA 3V05A 2NN6G 1SYEA 4KTAA 1KNAA 4FP5D 2PQEA 4BWGB 1PTOB 1RCVD 3R3OA 2A69D 4RH6A 2AQ3B 1EY6A 1J8IA 4CBVA 3O13A 4F87A 4C56C 4OIJA 1A3VA 1I4GA 5BN3A 1BOSA 1DXMA 1ZXTA 2PMZB 3S1RB 4DGZA 4ZYSA 2E75C 1VF7A 1PXUA 2X6GA 3ITPA 1JQYD 2F0WA 1O80A 3K7AB 4RHRA 2SDFA 2E2IB 3T16A 4N9PA 1KDCA 1STHA 1I4HA 3HOXB 1B9MA 3I90A 3QOJA 2X6LA 5IGEA 1BR9A 1KLUD 2IX3A 5KNDA 2NBFA 4H7BA 4C1NI 1DZ1A 4E6IA 5M3FB 3I72A 1RF2D 4DAVA 3D8GA 3H09A 4BA1I 2HCCA 1AZPA 1FGBD 5COYA 1B1ZA 1L0YB 1F9RA 4HSVA 4XQQA 4K6LA 4DFAA 2NB0A 3AU7A 4CJ0B 1JOOA 3TN2A 1HA6A 1SNPA 2MPMA 2JEBI 4P2CB 1F9PA 1SYGA 3S2DB 2WKDA 2NUCA 4ULLA 3PUWA 1WD1A 4IFDH 5JVH3 1V8QA 3TZUA 1H9KA 3PIO3 2HDLA 5C5LA 2JA7B 3SK8A 2WAQB 2B63B 3MAQA 3M7NA 4KK7A 5NUCA 1A15A 3KBGA 1LT6D 1JICA 1EQTA 2B2WA 4DNTB 4EQPA 5JAVA 5J22A 1GUSA 4TKOB 5I9OA 2OT2A 1TS4A 4KHZA 1G91A 2XVSA 1PLFA 1Q8IA 4C1NK 2H1EA 1TIID 2CW0C 1X3PA 4ODGA 2QF7A 2B2YA 2JE6I 4NMZA 1TR5A 4HAEA 1Z7TA 1B50A 1LTTD 2K04A 5KYLA 1LT3D 1JWUD 3V2TA 2K5DA 4XTCS 1HFGA 4XYQA 3NQTA 5DM63 1PRTC 3GD7A 4R8NA 3HS0C 3FVQA 3NBIA 3VR3A 2AQ2B 4XIGS 3A56A 3R8BA 1DM0B 2JXMB 2ZT9C 1LTSD 1XX8A 4XQNA 2PW5A 3I70A 1WTWA 1EIGA 4QIWB 2KECA 3LWUA 5DM73 1CM9A 3VA5A 1STYA 4C3JB 1QJOA 4A3JB 1F2YA 1LTBD 2EJGC 4A3FB 1R9TB 2QILA 3Q23A 2B2TA 1UUPA 3K5NA 4XT3B 1EZ6A 5CGKA 1V43A 4KKTA 5T1GA 1A2TA 1R4QB 2RKSA 4CKBA 2Q8RE 4LAAA 5JOBA 1Z47A 2HQEA 2NVYB 2Y0SB 1JOKA 2K32A 3RD4A 1S5DD 5KYIA 2KUMA 4NP5A 1SYFA 4IUVA 2VB2X 1SJED 2RSNA 2XRQD 3D4DA 5EPLA 3MC0B 2LMCB 1D2BA 4FXKC 1HUMA 5DNFA 3PUXA 1NR4A 1ILPA 1H9RA 4ZLTF 1EU3A 3NTIA 3H3VC 1CHQD 2CHBD 2K5WA 5A35A 1WVLA 2HDMA 3BDCA 1ML0D 1TWHB 4IALA 3DHQA 1BNZA 2F0HA 3P1HA 2IWHA 1OXTA 3X3MA 4IFDJ 5KGUA 3D4WA 1MBYA 1TS3A 2WINB 2R7ZB 1A2UA 2EY2A 2F0NA 4J6HA 1DJRD 4IURA 4PV1C 1XXGA 3D4RA 1NUCA 2Q8IB 2JEAI 2EOTA 2K1BA 1BCPD 1TY2A 1VMPA 4IFDI 1GHJA 3MVVA 5K36G 2A73B 2AQ1B 5J1ZA 1PYWD 4C3HB 4O1NA 1WTPA 3D6CA 1PZKD 2EYFA 1E2WA 3ONAB 3NSWA 2PO4A 1S5CD 3T51B 3UI2A 3H6MA 3K58A 5IODA 3NPPA 3K5OA 5J39A 1SXTA 2B2UA 3PO2B 4K8JA 3PUYA 4FVMA 5D3DA 1ILQA 1G2TA 3MA2B 1YNNC 4DAPA 2NN6I 5EKKA 1EY0A 3CHBD 5IGDA 1YNJC 2EDGA 3ND9A 4K8IA 1GUGA 5EPJA 2M00A 5A2QL 4WRDA 2MHVA 3J7AF 3I4NB 1RD9D 2RDHA 3S1QB 3HKZB 1ESFA 1EWHA 1IL8A 4CJ1B 4HSPA 2O5JC 1K8MA 1SYBA 2PPBC 3A7LA 1SEBD 4RGMA 2K01A 3BVGA 1SMYD 5EBCA 2O2LD 4FF2A 4N9TA 2OEOA 1R4PB 1A6XA 2ID0A 3MXGA 4DF7A 4V0BA 2ZXPA 2NVQB 1D6EC 3BVZA 2KVMA 2L0CA 2I46A 1CZGA 1IKLA 5D3IB 3WOEA 4I7ZC 2F3VA 1DOLA 4PMWA 3DM1A 5A2QE 5KEEA 1V1PA 3CKIB 3PMFA 4K6DA 1F2ZA 1TQOA 1U4MA 3AB9A 4IUTA 4X3TA 3I73A 5I2YA 1Y8NB 1Q3LA 5C0XH 3HG9A 3OWFA 5K36H 5T1IA 1UNSA 3VR2A 4UAIA 1PZJD 2D5DA 2F0QA 3HOZB 4KN4C 1IYUA 3M85A 4RCOA 1J9OA 3GTGB 1PFNA 2XIWA 2Z1CA 3A55A 4B9XA 1F9SA 4X3KA 2DNCA 4IUNA 4IFDG 2IX1A 1A3UA 2B8FA 1LV9A 4FO2A 3N52A 3FEWX 4KJNA 2DNEA 1C48A 1HHVA 3OWEB 2EY6A 3MZ5A 4ZUJA 3M4OB 4KY7A 5FO9B 2ZXRA 5BN5A 1PMRA 3H0GB 1TKWB 4FF4A 3W3AA 1TWGB 2Z4IA 2KJXA 3S17B 2XSCA 2PZWA 4MHEA 4F7XA 5CV6A 4NKLA 1SNQA 3P75A 1ICWA 1B3AA 1QOHA 2B2WC 3WOFA 5CV9A 4OGQC 2K6AA 1OXUA 2X69A 2K7VA 4EVOA 2NVXB 1CT1D 2YU9B 3OMGA 2IW3A 3DMUA 2F0IA 3PO3B 5E3FA 2B2YC 3L3OC 4HTHA 4HMJA 3Q0AA 1MGSA 3Q22A 4Q5VA 1BO0A 1RHPA 1PFMA 3N6RA 4G4KA 4RKBA 4KN7C 3EJIA 2AWOA 2A6HD 2E2DC 4QUFA 2WACA 2QEJC 1TT2A 2TSSA 1S5ED 1STNA 2Z8LA 3A7AB 1PTOC 2J4XA 5M5XB 2MUYA 3Q6SA 1Y8OB 2G9DA 3OPOA 1GJXA 3GTQB 1XWEA 1TU2B 4K5XA 2R3ZA 3KF8A 1EWCA 1HTPA 5D14A 5IOCA 1EY7A 1I50B 2K5QA 1H9MA 5EBDA 2N88A 5M9OA 3TP5A 5EKIA 1ENCA 1FR3A 2A69C 1B53A 2CW0D 1D5ZC 2F0MA 4XDXA 3EVQA 2WB1B 2B2TC 3DEPA 3I91A 1BCPF 4XQJA 1G6ZA 2J7ZA 2ZXOA 3VYTA 5CBAE 3H91A 5KIXA 3RZDB 1DCZA 4S3SA 1PRTD 4HEDA 4K2KA 1FNVA 1K8OA 2RDGA 2VNUD 1LLRD 4A3KB 1SYCA 1LO5D 5C0XJ 3C46A 3S14B 3GTOB 1CQFA 2EYLA 3S16B 1JORA 1TWCB 3TP6A 2A6EC 3WDNA 1AW7A 3BG3A 1CFMA 2F0UA 3GV6A 2BDOA 1HRJA 2PZTA 2BE5C 2F0KA 4R8IA 3K5LA 5LHY1 2F0EA 2Q8TA 2L4NA 5C44B 5AFWA 3U9OA 3R2TA 3FPUB 1PTOH 1QILA 4RGNA 2IPKD 5IT9L 3A8JE 5FKAC 5KRUA 4CKCA 2E2JB 1EYAA 4KHVA 4Z9CB 1H9JA 2HUGA 1D1KA 2TMPA 4LJZC 1WTXA 2HCIA 2EPBA 1ET9A 5C4JB 4G57A 2FFKB 3SDZA 1KDBA 3GP7A 2JA5B 3HOWB 2SOBA 1EFID 1RTOA 2N55A 4KD3A 4IN3A 4KD4A 4A3MB 4ZAIA 2KEDA 1QB5D 2V4DA 4QB4A 1GHKA 3PIP3 4C3JG 1EEID 3NXWA 3HGBA 1GUWA 4J8QA 1ONLA 3GO5A 4TSSA 4DN4M 2AUKA 3HP3A 4MN3A 2WP8J 1EL0A 1WCMB 2B2UC 2F0FA 3IAYA 5CC4A 3R93A 5IT9E 1NSNS 2RDFA 1V1OA 1U4RA 3RZOB 5EPKA 3SEBA 1RJTA 2EYMA 3DWAA 3KLSA 4FYDA 2K03A 2VUMB 1QCBD 1EYDA 3J81L 1NCVA 1GUOA 3E0JA 4FF3A 3HOVB 2R92B 2RA4A 2D9UA 2F0JA 2L5TA 2K33A 5K5PA 3MFGA 3BS1A 4C3IB 2A68C 2WKCA 3T56B 1AEXA 5JJZA 3URYA 1I6VC 1HA5A 3S1MB 1E0BA 3SHLA 1DD2A 3KBXA 4PQXA 1V1PB 4LK1C 5CYUA 1TWFB 2PYKA 1UAPA 2C5CA 1CA6A 2QKIC 5EQ0A 3S15B 2H4OA 5TSSA 2PNRC 3GTPB 3I8ZA 3K6OA 3AMUA 3BYTB 1IKMA 1EY5A 2ICEC 4A3GB 4K2LA 1DONA 3SK6A 1A3TA 1I4QA 3OHXC 3PUZA 2EY5A 5C0XG 3J81E 3J7YW 2LS01 3NP8A 1TY0A 3VYRA 3D6WA 1BF4A 1C4QA 2LKVA 1LT5D 1ENFA 3MXPA 1AZQA 2O4XA 4L8JA 2EY1A 5CV7A 5M5WB 4C3HG 1G2SA 1ZEQX 1BXTA 1Y1VB 4MIUA 1Q1BA 1WTQA 2CQAA 4DXGA 3C3LA 3W2DA 2SEBD 3LWEA 4L6TB 1EIHA 4V190 2EXZA 1SBBB 4U68A 5EJWA 1QWYA 2KHSA 4FXGC 1ZYRD 1I6HB 5C4HA 1STBA 1I4RA 2JP1A 2L55A 4AYBB 2WIIB 1AN8A 2I07B 4X3SA 3GTMB 1W6JA 3DUZA 2B8GA 4BBSB 3TBIB 2JSOA 5I2XA 3GV3A 4YIJA 2AWNA 1EYCA 4G7OC 1KABA 3OIPA 2NTTA 3QIAA 2NVTB 1BDOA 1KDAA 5EKLA 4NDXA 5C3XA 1LTRD 5JPNC 1LACA 1I4XA 2CVRA 2F0DA 2F1MA 4TQUS 3A54A 5JPMC 1MSGA 4BY1B 3E5SA 1FNUA 4RHSA 5LL6X 1Z6HA 1VDZA 2QDBA 3M4YA 1PRTF 1K83B 3NWSA 2ICIA 1TS2A 2DY8A 5CBEE 1WTVA 3D3RA 4HCSA 2KOLA 2FJ2A 3QB3A 5JVG3 3HOUB 3KK7A 4QMGA 4ZKBB 1CK1A 3NTHA 1HTLD 3J80L 4KV6A 3HOYB 5DAUA 3I4LA 2EJMA 3PUVA 1D5XC 3QO2A 1F2MA 1CHPD 3CRKC 5KNCA 2NYZD 4CJ2C 1HXYD 2BCOA 3G6JB 4ABNA 1D1IA 5FLXL 2B39A 1IW7C 3MFYA 2FMMA 5CV4A 1WD0A 1I4PA 5CV8A 4XXEA 4OL7A 3SVMA 5JEAH 5ELEA 3NTKA 3NE5B 4BY7B 4RWSC 1U9RA 4DNRB 3SK4A 2ENBA 4PNYA 3M3YB 1GUNA 1SNMA 1AP0A 4RGTA 4O42A 3MWYW 3J80E 1WTOA 5C5MA 2E2HB 2E76C 2R6GA 2PW7A 1NAPA 4RAUC 2EYJA 3VR5A 5CMDA 2SNMA 1B2TA 2OXPA 4BA2I 4A3DB 5C6AA 1PTOD 3NK9A 3NUCA 2SNSA 2VB3X 2F0PA 3E6ZX 3RLFA 1S5FD 2R93B 5KNBA 1F2LA 1S4ZA 2C9OA 1L0XB 1HQRD 3MXNA 5FLXE 1LTGD 4DU9A 2FINB 1MI2A 4XYOA 4DAYA 5G3LF 2FMCA 3T4AC 2D2CC 4K5VA 1RTNA 4ZUIA 1OXVA 5FOBB 4QUCA 1HUNA 5FO7B 2EJFC 3S1NB 2F0VA 2K05A 3K5MA 1XTCD 4JBWA 3BYYB 1X32A 5I9PA 2NZ1D 5C4ZA 3KUPA 3MTSA 5M3MB 1SDFA 3OW7A 2YYZA 4H13C 4IZ8A 4XT1B 2L12A 4A3BB 4LMQD 1I3QB 1BUVT 2KQ3A 3DEOA 3TP8A 3FRPB 3GTKB 2B2VA 2E74C 1M4VA 2JYOA 2NWGA 1JB3A 3TZDA 4WFN3 5IGCA 2OF1A 2MJ8A 4Q0FA 5EGTA 3KLSX 5LL6S 2A6ED 1C8CA 2FHTA 1OO9B 3K0YA 4OO1H 3VR4A 1LABA 3KLRA 1QNUA 2M2LA 2BE5D 1LTID 4KMUC 4F88A 1Q90A 5IGBA 1EEFD 2L11A 2A6HC 1KNEA 2EYOA 5DEHA 2R61A 3NQIA 4RCNA 4DXFA 3FDTA 1IHZA 3GQBA 1SJHD 3P7JA 4HMIA 1X3QA 1PRTB 4EQOA 1F9QA 4L63B 4BS9A 5IGGA 1RODA 4A93B 5C0XI 4IUUA 1G8ZD 3I4MB 2XWJB 3IFDA 2F0LA 3L9AX 1UEAB 2F3WA 4HCEA 1O7YA 3VYUA 3QOLA 4FXDA 1F77A 3C2PA 1PDQA 3LX0A 5E1FA 3G7LA 5I4DA 2K28A 3V96A 1SE3A 1PZID 5JEAJ 1EY8A 3CQZB 1ENAA 3HZXA 5D65A 1NR2A 3RMHA 2NTSA 2NN6H 3MXUA 1E2VA 3IL8A 2F0SA 3HRZC 3DWPA 1TWAB 4F8MA 1CA5A 4BBRB 2VXWA 4ZRZA 3H94A 1VMCA 3OOCA 4J1MA 5E4XA 1CZWA 5ELBA 3A8IE 1KAAA 4ID6A 1SE2A 2A68D 4C2MB 3P20A 2F0GA 3HEJA 1DOMA 1DOKA 2MGSA 3X3NA 1T5XD 1II3A 4ZQ3A 1H9SB 1EY9A 3CU7A 4UDUC 1ET6A 3C1EA 1MSHA 4B08A 3FPPA 2RQXA 1JOQA 1STGA 4HR7B 4KKSA 4QF4A 5CR3A 3EROA 1JCKB 5HGTA 1ZKOA 4RFBA 4FF1A 2KA7A 5G3LD 3QWNA 4I65A 1ESRA 1JWMD 2XWBB 4ZKCB 2F4IA 5E4WC 1OXXK 5ELDA 1GXDC 4G7ZC 4KY6A 4RKLA 1B4OA 3T53B 2RBMA 2BOSA 1O78A 3NBHA 3PV0A 1Y8PB 4C3IG 2IJ0A 1EU4A 2PZUA 3C1FA 1B44D 2F03A 5ELFA 3EA6A 3L7ZC 1Q12A 3VA7A 3MHBA 1S5BD 4DK1A 2IX0A 4R9WA 3BDLA 2KCNA 2Z4HA 1IYVA 2F0TA 1GUTA 2EYPA 4Y7NB 4KJOA 1WTRA 4IUPA 1QG7A 2XNAC 3JAML 1CTMA 1YNND 1Y1WB 2XN9C 4OO1I 1W6KA 3FKIB 3DXJC 3IKJA 4OIKA 4CHTB 1RKNA 3TMEA 1VF5C 1PTOF 5CV5A 1YNJD 1TS5A 2EVBA 1KLGD 1O7LA 2JA6B 1JR0D 1BCPB 2O5IC 1STEA 1SNCA 4WORA 5FK9C 2GA4B 1STAA 3CRLC 2D62A 2EE1A 4KI0A 1U4PA 3M7GA 5CORA 2A74C 5JEAG 4CGYB 1KTKA 4WJWA 1JE4A 4TRDA 2G9HD 3T13A 3BZDB 3NHHA 4GZYC 3BDOA 1Y69U 1BQQT 4HN7A 1D5MC 4KY5A 3JAME 3TDQA 4IUQA 1XYIA 2IL8A 2KEEA 3MEHA 1H9SA 1FD7D 1BCPC 4B9WA 1SYDA 4RA8A 3F2UA 3K59A 1QNKA 2RVLA 3SE0A 3ERQA 2DY7A 1SNDA 3U9SA 5BN4A 2A5HA 1CQVA 4K5WA 1EOTA 2J0TD 2L1BA 3IFTA 1SNOA 4DA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SNS A;  2EY1 A;  2F0P A;  2F0G A;  2F0Q A;  3HEJ A;  4PMC A;  4QMG A;  4R8N A;  5CV7 A;  5EKK A;  3RUZ A;  1EY0 A;  4E6I A;  1EQV A;  3D8G A;  5IGD A;  1II3 A;  2EYM A;  4ZQ3 A;  1EY9 A;  1RKN A;  4RKB A;  2F0O A;  4MIU A;  3SK5 A;  4K8I A;  3TME A;  5F2D A;  3EJI A;  3OMC A;  2M00 A;  2EYO A;  2F0U A;  5CV5 A;  1EYD A;  2EYH A;  3C1E A;  5IIF A;  4DU9 A;  5DEH A;  4WRD A;  4B9X A;  5ISR A;  2PZT A;  5I6W A;  2F0K A;  2F0J A;  2PW5 A;  4IUN A;  3BDC A;  2F0E A;  4KV6 A;  5K5P A;  2WAC A;  1TT2 A;  4IAL A;  1A3U A;  1JOQ A;  3TP7 A;  1STN A;  1STG A;  1IHZ A;  5DAU A;  4DFA A;  4EQN A;  4QF4 A;  4K5V A;  5CR3 A;  4KJN A;  1JOO A;  3SXH A;  4HMI A;  4ZUI A;  3ERO A;  3S9W A;  1SNC A;  2EXZ A;  3U9O A;  4EQO A;  5HGT A;  1SNP A;  3DHQ A;  1AEX A;  4WOR A;  2F0H A;  3P1H A;  5IGF A;  1STA A;  1SYB A;  2KHS A;  5IGG A;  4K5X A;  2EY6 A;  5KRU A;  1F2M A;  1SYG A;  5KGU A;  4DF7 A;  3VA5 A;  3D4W A;  1EYA A;  2F0V A;  3MZ5 A;  2NUC A;  1STB A;  1STY A;  3NUC A;  4KHV A;  4ZUJ A;  3SHL A;  5C4H A;  5C3W A;  3SR1 A;  4KY7 A;  1EY7 A;  5IOC A;  4I65 A;  1F2Y A;  5I9P A;  5I6Y A;  2F0L A;  2F3W A;  4ME5 A;  5C4Z A;  5C5L A;  1A2U A;  1SYE A;  3OSO A;  4KTA A;  2EY2 A;  2F0N A;  3QOL A;  4J6H A;  4TRD A;  3SK8 A;  5M9O A;  4IZ8 A;  3TP5 A;  1ENC A;  4N9T A;  2PQE A;  2PYK A;  1NUC A;  3R3O A;  2OEO A;  3LX0 A;  5E1F A;  4G57 A;  2PZW A;  5CV4 A;  5NUC A;  3T13 A;  4YIJ A;  3NHH A;  1KDB A;  4KY6 A;  1EYC A;  4RKL A;  4F7X A;  1EZ6 A;  5CV6 A;  5CV8 A;  2F0M A;  5CGK A;  1KAB A;  3MVV A;  1EY8 A;  2KQ3 A;  4KY5 A;  1EY6 A;  1ENA A;  1A2T A;  2RBM A;  3EVQ A;  3HZX A;  4EQP A;  5JAV A;  2SOB A;  4OL7 A;  3TP8 A;  5J22 A;  4NKL A;  2RKS A;  1SNQ A;  3P75 A;  5J1Z A;  4KD3 A;  1KDA A;  1U9R A;  4LAA A;  1EY4 A;  5I9O A;  4KD4 A;  1A3V A;  5EKL A;  4NDX A;  5JOB A;  5C3X A;  2PZU A;  1EZ8 A;  3SK4 A;  2ENB A;  2F0S A;  5CV9 A;  1EY5 A;  4PNY A;  3C1F A;  2HQE A;  3MEH A;  4K2L A;  3D6C A;  2F0D A;  4K14 A;  4DGZ A;  2EYF A;  4PMB A;  4QB4 A;  5KIX A;  3SK6 A;  5IGC A;  1A3T A;  2OF1 A;  2F3V A;  3MHB A;  4B9W A;  4EVO A;  4F8M A;  3ITP A;  5EGT A;  1SNM A;  1SYD A;  1JOK A;  2EY5 A;  2F0W A;  3H6M A;  3NXW A;  4S3S A;  5IOD A;  5KYI A;  4ODG A;  4NP5 A;  3E5S A;  3NP8 A;  4K2K A;  1SYF A;  5HUR A;  5KEE A;  5J39 A;  3OMG A;  3PMF A;  3BDL A;  4K6D A;  3DMU A;  5C5M A;  4K8J A;  4NMZ A;  1TR5 A;  1F2Z A;  1TQO A;  2F0I A;  2QDB A;  1SND A;  2F0T A;  3ERQ A;  4N9P A;  3T16 A;  2EYP A;  5E3F A;  5IGB A;  1KDC A;  1STH A;  4KJO A;  1SYC A;  2PW7 A;  4J1M A;  5KYL A;  3D4D A;  2F0F A;  2EYJ A;  4HTH A;  4HMJ A;  4K5W A;  3QOJ A;  5CC4 A;  2LKV A;  2EYL A;  3V2T A;  5IGE A;  1JOR A;  2SNM A;  2OXP A;  3OWF A;  1NSN S;  2RDF A;  1KAA A;  4ID6 A;  3TP6 A;  5C6A A;  3MXP A;  3QB3 A;  3NK9 A;  2O4X A;  4H7B A;  1SNO A;  3NQT A; 
#chains in the Genus database with same CATH topology
 1SFO B;  1SAP A;  1VCI A;  5FO8 B;  1EQV A;  4L5Q A;  3GTJ B;  5LMN Q;  5ELC A;  1OXS C;  3SK5 A;  5C4X B;  3QG1 A;  5BR8 L;  5F2D A;  1AE3 A;  3OMC A;  4CKE A;  5IIF A;  4DUY Q;  3G6E A;  5I6W A;  3LGJ A;  4ZCK A;  4EGV A;  3S1M H;  4BY1 G;  1SSO A;  3BVM A;  4ZK9 B;  5M5Y B;  4JI3 Q;  1HFN A;  2RSO A;  1HQM C;  4H44 C;  4ILW A;  4DV7 L;  2N8N A;  3STB C;  4UP9 A;  1EQR A;  3SXH A;  3NWT A;  1IW7 D;  3S9W A;  1BBU A;  2UXB L;  1ZYR C;  1TWF H;  5IGF A;  4IQZ A;  4GN4 B;  1HPC A;  4U67 3;  5ISR A;  3VR6 A;  1LT4 D;  2IT1 A;  5C3W A;  1A8V A;  1U4L A;  3VYS A;  4ME5 A;  1QVC A;  3E9H A;  4LWC A;  2LFN A;  4OHJ A;  3OSO A;  1SE4 A;  3GTP H;  4M1U B;  1QE6 A;  2BA1 A;  3CW2 C;  3CCM A;  2DN8 A;  4A3G H;  3D0F A;  1G29 1;  2I5M X;  1RDP D;  3ZYY X;  3EQL C;  1VQL A;  3TSS A;  3HOY G;  4LF4 L;  5E7N A;  1ASY A;  4GOP B;  4R4Q A;  3FKI H;  2PCF B;  1PFB A;  1TVX A;  4A3I B;  1EY4 A;  1O7Z A;  4JBJ A;  3CCR A;  3A8K E;  1D7Q A;  1SMY C;  1EZ8 A;  1JWS D;  2UUB L;  3T1Y L;  4OO1 G;  3U4V A;  2ES2 A;  3HOZ G;  4K14 A;  4PMB A;  2B2V C;  2UXD L;  1AFP A;  1B9N A;  2FXQ A;  3CME A;  4DUZ L;  3EBE A;  4OON A;  3LNN A;  2JA6 H;  2Y0S E;  4QCL A;  4G7H C;  5HUR A;  3FMC A;  4YHH Q;  3S2H B;  2EZV A;  2LY7 A;  3CCE A;  2WV6 D;  2JA8 B;  3KYH C;  1Q1E A;  5C3E B;  4DV2 Q;  4FNF A;  3I3C A;  4NW2 A;  3WWV A;  1JC7 A;  1Y1V H;  2L9H A;  4DK0 A;  2XRS D;  1T5E A;  2PI2 A;  1E2Z A;  1HCZ A;  3D31 A;  2JK8 A;  2OWO A;  1K73 C;  3CC2 A;  4X3U A;  2Z9H A;  4KKU A;  1Q82 C;  1DYQ A;  3GTL B;  2M9V A;  4PMC A;  4RGO S;  1CI3 M;  2BA0 A;  4M8A A;  4NXN L;  3RUZ A;  2AKW B;  4A3E B;  5JJK A;  4GOP C;  1GOZ A;  1CKN B;  2F0O A;  2PNH A;  3CCL A;  2MP1 A;  1FNW A;  1PH8 A;  3R2I A;  4DR6 L;  2RCF A;  2EYH A;  2K5V A;  3F8T A;  1I6H H;  4MTK A;  3OIQ A;  3S24 A;  2YTY A;  3J7A V;  4H0L C;  3BJU A;  2DJF C;  1MD2 D;  3TP7 A;  1KD1 C;  4EQN A;  4PG3 A;  3K57 A;  3QJY A;  1M8A A;  2MQH A;  3ND8 A;  4AQY L;  1XMQ Q;  3EIV A;  1K3R A;  2MNA A;  2BDN A;  2KCC A;  3Q24 A;  1BBX C;  4LF8 L;  4PZ8 A;  3EFX D;  3DWQ A;  4JK1 C;  1N32 L;  3SR1 A;  3I2Z A;  2AUJ D;  1LTA D;  5I6Y A;  2QCP X;  2NVT H;  1FYC A;  3V05 A;  2NN6 G;  4KHP L;  1SYE A;  4KTA A;  4PZ6 A;  1KNA A;  2KBN A;  3KFU A;  1E24 A;  4FP5 D;  2PQE A;  4BWG B;  1PTO B;  3R3O A;  1RCV D;  4A3C H;  3PO3 G;  4GKK Q;  2CCZ A;  4K0K Q;  1HZB A;  2A69 D;  4RH6 A;  2AQ3 B;  1EY6 A;  4IOC A;  1J8I A;  1SFO H;  4CBV A;  3O13 A;  2RF4 A;  2I5H A;  5IP7 G;  4F87 A;  4HJ8 A;  4C56 C;  1IYJ B;  4OIJ A;  5C4X H;  2IY5 B;  1A3V A;  1I4G A;  3AFQ A;  5BN3 A;  1BOS A;  1O7I A;  1DXM A;  1ZXT A;  2PMZ B;  3S1R B;  4DGZ A;  4ZYS A;  1K83 H;  4OWW B;  4A3L G;  2E75 C;  4HJ9 A;  1VF7 A;  5M5Y H;  1PXU A;  2X6G A;  3ITP A;  1JQY D;  2F0W A;  3ZJY C;  1E1T A;  2OTL A;  1O80 A;  5M3M G;  3HOU H;  1HZC A;  3K7A B;  3PF5 A;  1FJG L;  4RHR A;  1BKB A;  2SDF A;  2E2I B;  5IT9 c;  4A3B G;  3T16 A;  4N9P A;  1KDC A;  1STH A;  1I4H A;  2CWA A;  4YWM A;  5LMU L;  3HOX B;  1B9M A;  3I90 A;  3QOJ A;  5AJ3 L;  4DV3 L;  2X6L A;  5IGE A;  1BR9 A;  1KLU D;  2IX3 A;  5KND A;  1HNZ Q;  2NBF A;  2DGY A;  4H7B A;  4C1N I;  1XMO Q;  1DZ1 A;  4E6I A;  1E3P A;  5M3F B;  1GO3 E;  3I72 A;  1RF2 D;  4N8F A;  4DAV A;  1YJW A;  4LF6 Q;  4JW0 A;  3D8G A;  3H09 A;  3CD6 A;  4BA1 I;  2HCC A;  1AZP A;  4UP7 A;  5LMN W;  2D0P A;  1FGB D;  5COY A;  4DR2 Q;  1B1Z A;  1L0Y B;  1F9R A;  4HSV A;  4XQQ A;  2WB1 G;  4K6L A;  1YHB A;  4DFA A;  2N3S A;  2NB0 A;  3AU7 A;  4CJ0 B;  1JOO A;  1SMX A;  4IJL A;  3TN2 A;  3PCO B;  1HA6 A;  1SNP A;  4JVZ A;  2UXC Q;  2MPM A;  2JEB I;  1VQA A;  3OYY A;  4P2C B;  5GRO A;  1F9P A;  1PH6 A;  1SYG A;  3S2D B;  3A74 A;  2WKD A;  2GN5 A;  2NUC A;  4ULL A;  3PUW A;  1WD1 A;  4IFD H;  1KHI A;  5JVH 3;  1V8Q A;  3HFZ B;  3TZU A;  1I94 L;  1H9K A;  3PIO 3;  2HDL A;  1L2F A;  4BY7 H;  5C5L A;  2JA7 B;  3SK8 A;  1N34 Q;  3I4O A;  2WAQ B;  2B63 B;  1EFW A;  3MAQ A;  3M7N A;  4KK7 A;  5NUC A;  3M3Y H;  4DR1 Q;  1A15 A;  1SLJ A;  3KBG A;  1LT6 D;  1JIC A;  1EQT A;  2B2W A;  2N49 A;  4DNT B;  4EQP A;  5JAV A;  5J22 A;  1GUS A;  4TKO B;  2A19 A;  5I9O A;  2OQK A;  2OT2 A;  1VQO A;  4DV6 L;  3J81 c;  1TS4 A;  4KHZ A;  3TRE A;  2CFM A;  1G91 A;  1IL2 A;  2XVS A;  1PLF A;  1Q8I A;  1CKN A;  4C1N K;  2H1E A;  4A93 G;  1TII D;  3I4M G;  2CW0 C;  1YJ9 A;  1X3P A;  4ODG A;  2QF7 A;  4A3D H;  2B2Y A;  1HNX Q;  2JE6 I;  2K5H A;  4NMZ A;  1TR5 A;  4HAE A;  2E5L Q;  2R93 H;  5C44 G;  1Z7T A;  1WJJ A;  1CKO A;  1B50 A;  3L2P A;  1LTT D;  2K04 A;  1X9N A;  5KYL A;  2ZM6 L;  1UE7 A;  1LT3 D;  1JWU D;  3V2T A;  3E0E A;  2K5D A;  4XTC S;  1HFG A;  4XYQ A;  2NZH A;  2RCN A;  3NQT A;  5DM6 3;  1PRT C;  3GD7 A;  4R8N A;  3K80 C;  3HS0 C;  3FVQ A;  3NBI A;  3VR3 A;  5IP7 H;  2AQ2 B;  4B3T L;  4XIG S;  3A56 A;  3R8B A;  1DM0 B;  1I5F A;  1PH9 A;  2JXM B;  2GVA A;  4CDD C;  2F4V L;  2ZT9 C;  3S1N H;  4BBR G;  1LTS D;  1XX8 A;  2ALY B;  4XQN A;  2PW5 A;  1RL2 A;  3I70 A;  1WTW A;  2JA5 G;  1WFQ A;  1EIG A;  3JAM c;  4QIW B;  3S1R H;  2KEC A;  5EAY A;  3J81 i;  3LWU A;  4B3S Q;  5DM7 3;  4DR3 Q;  4A3B H;  1I3Q H;  1CM9 A;  1YHA A;  3VA5 A;  1E7Z A;  1N33 L;  1STY A;  1YEZ A;  4C3J B;  4X65 Q;  1QJO A;  4A3J B;  1F2Y A;  1LTB D;  2EJG C;  2PQA B;  2Q2I A;  4A3F B;  1R9T B;  3GTK H;  1X65 A;  2QIL A;  1GVP A;  3Q23 A;  2B2T A;  1UUP A;  3K5N A;  1YVC A;  1HR0 Q;  4BXX G;  4XT3 B;  4NB3 A;  1EZ6 A;  1C0A A;  2CH4 A;  5CGK A;  1V43 A;  2YTX A;  4KKT A;  3AQQ A;  1A2T A;  5T1G A;  4QY7 A;  1R4Q B;  4HJA A;  2RKS A;  5M3F H;  4CKB A;  2Q8R E;  4LAA A;  5JOB A;  4JBK A;  3K7U C;  1Z47 A;  2HQE A;  2NVY B;  1AE2 A;  5BR8 Q;  2Y0S B;  3CCQ A;  2VUM G;  1JOK A;  2K32 A;  4O2D A;  1LTL A;  3RD4 A;  4GKJ L;  1S5D D;  5KYI A;  2Z6K A;  2KUM A;  3HOV G;  1G6P A;  4NP5 A;  3TS2 A;  4DR4 L;  1SYF A;  4R4O A;  1SRU A;  4IUV A;  4DV7 Q;  2VB2 X;  1SJE D;  1FVI A;  3S2D H;  2RSN A;  2KEN A;  3D4D A;  2XRQ D;  5EPL A;  3MC0 B;  1K0R A;  2LMC B;  2CH4 W;  1X3F A;  1D2B A;  4FXK C;  1HUM A;  5DNF A;  3PUX A;  4P74 A;  2B63 H;  1NR4 A;  1ILP A;  1H9R A;  2V1C C;  4ZLT F;  1EU3 A;  3NTI A;  3H3V C;  1CHQ D;  2CHB D;  2K5W A;  1CSQ A;  4N8X 1;  5A35 A;  4DAM A;  1WVL A;  4JI0 L;  4JV5 L;  4A93 H;  2HDM A;  3BDC A;  5L37 A;  4LF4 Q;  1ML0 D;  1TWH B;  4IAL A;  2L15 A;  2CKZ B;  4LFB L;  4X66 Q;  3DHQ A;  1BNZ A;  2UUB Q;  3T1Y Q;  2F0H A;  3P1H A;  2IWH A;  1OXT A;  3X3M A;  5IP9 H;  4A3G G;  2UXD Q;  4IFD J;  5KGU A;  3D4W A;  4DK3 C;  1C7Y A;  3CQZ H;  1Y1W G;  1MBY A;  1TS3 A;  2WIN B;  2R7Z B;  3FKI G;  4JOI A;  1A2U A;  2EY2 A;  2F0N A;  4J6H A;  3TRZ A;  1DJR D;  4IUR A;  1XTD A;  4PV1 C;  3L0O A;  1XXG A;  3D4R A;  5JJI A;  1NUC A;  2Q8I B;  4OEL B;  2EOT A;  2JEA I;  2K1B A;  1BCP D;  1TY2 A;  1VMP A;  2QW7 A;  4IFD I;  1GHJ A;  2R7F A;  1TWA H;  3MVV A;  5K36 G;  4JI4 L;  2A73 B;  2I5L X;  2JA6 G;  4BBR H;  2AQ1 B;  2VQF L;  5J1Z A;  1PYW D;  2QDL A;  2G5D A;  4NXN Q;  4C3H B;  1IBL L;  4O1N A;  5IYD H;  1WTP A;  3D6C A;  1PZK D;  2EYF A;  1E2W A;  2OQ0 A;  3ONA B;  2DUD A;  1Y1V G;  2PO4 A;  3NSW A;  3J80 c;  4DR6 Q;  5IWA L;  1S5C D;  3T51 B;  3UI2 A;  3H6M A;  3K58 A;  4MNO A;  5IOD A;  3NPP A;  3K5O A;  2K75 A;  5J39 A;  1SXT A;  2B2U A;  3PO2 B;  1QUQ A;  4C2M H;  4K8J A;  4HIO A;  3CAM A;  2F52 A;  2MFI A;  3PUY A;  4FVM A;  2UU9 Q;  2I0Q A;  5D3D A;  1ILQ A;  1G2T A;  3MA2 B;  1YNN C;  1N32 Q;  1P16 A;  2NN6 I;  4DAP A;  4AYB G;  3STB D;  5FLX c;  5EKK A;  4OX9 L;  4GN3 B;  3ULJ A;  1EY0 A;  1Q8K A;  2PQA A;  3CHB D;  4JI1 L;  4HJ7 A;  3RN5 A;  4KHP Q;  5IGD A;  1YNJ C;  2EDG A;  3ND9 A;  4K8I A;  1GUG A;  1FL0 A;  5EPJ A;  2M00 A;  4IPD A;  3K0X A;  5A2Q L;  4WRD A;  2MHV A;  3J7A F;  3I4N B;  2UUA L;  1RD9 D;  2RDH A;  3S1Q B;  3HKZ B;  1ESF A;  1J6Q A;  1EWH A;  1IL8 A;  1YIJ A;  4CJ1 B;  4B3R L;  4HSP A;  2O5J C;  1K8M A;  1SYB A;  3J80 i;  4A3C G;  2AMC B;  2LXK A;  1YHQ A;  2ZTD A;  2PPB C;  3A7L A;  1SEB D;  4RGM A;  2K01 A;  1KRT A;  3BVG A;  1SMY D;  5EBC A;  3E9I A;  1P8L A;  4LUZ A;  1FJG Q;  1UE6 A;  1EWI A;  5C4X G;  2O2L D;  4FF2 A;  4N9T A;  4LNQ A;  2OEO A;  5DLQ E;  5LMU Q;  4LFC L;  1T9H A;  1R4P B;  1A6X A;  2ID0 A;  1JJG A;  3MXG A;  4DF7 A;  5AJ3 Q;  4V0B A;  1HR0 W;  4DV3 Q;  2ZXP A;  1NY4 A;  2NVQ B;  3KOJ A;  1D6E C;  3BVZ A;  2KVM A;  2L0C A;  5GAH C;  3HOU G;  2I46 A;  1CZG A;  1IKL A;  2LSS A;  1CUK A;  3KF8 B;  5D3I B;  4Y7N H;  3WOE A;  4I7Z C;  2F3V A;  3ERS X;  1PH3 A;  1DOL A;  4PMW A;  3DM1 A;  3UDF A;  1PHJ A;  5A2Q E;  3PIO A;  4LF9 L;  5KEE A;  1V1P A;  3CKI B;  4YCV A;  3PMF A;  3RLN A;  2H5X A;  1Y1W H;  4RMF A;  4K6D A;  2ZJQ A;  1F2Z A;  1TQO A;  4JPB W;  1U4M A;  3AB9 A;  4IUT A;  4X3T A;  4MZ9 A;  2JQO A;  1VQM A;  3I73 A;  4CDE C;  1X55 A;  5I2Y A;  2R7Z H;  1Y8N B;  1Q3L A;  5C0X H;  3HG9 A;  3OWF A;  3QR8 A;  5K36 H;  5T1I A;  1UNS A;  4A3I G;  2K4K A;  3VR2 A;  4UAI A;  1I94 Q;  1PZJ D;  2D5D A;  2Q2U A;  2F0Q A;  4GS3 A;  3HOZ B;  4KN4 C;  1IYU A;  3M85 A;  4RCO A;  4ALP A;  1SE8 A;  1J9O A;  3GTG B;  1PFN A;  2XIW A;  2Z1C A;  4QL5 A;  3A55 A;  4R4T A;  4AH6 A;  4B9X A;  1F9S A;  4PZ7 A;  1N36 L;  2K50 A;  4X3K A;  2DNC A;  3CP0 A;  4IUN A;  4IFD G;  2IX1 A;  1UE1 A;  1A3U A;  1E1O A;  2B8F A;  4C3H H;  2JA8 G;  1LV9 A;  4FO2 A;  3N52 A;  3FEW X;  5C3E G;  4KJN A;  4BY7 G;  4DV6 Q;  2DNE A;  1C48 A;  1ASZ A;  1HHV A;  3OWE B;  5IY0 A;  2EY6 A;  1PH5 A;  4YWL A;  3MZ5 A;  1VQH A;  4ZUJ A;  3A5Z B;  3M4O B;  3W1G A;  4KY7 A;  5FO9 B;  2ZXR A;  5BN5 A;  1PMR A;  3H0G B;  1TKW B;  4FF4 A;  1XPO A;  4A3E G;  3W3A A;  1HZ9 A;  1TWG B;  2Z4I A;  2KJX A;  3S17 B;  1C9O A;  2XSC A;  2PZW A;  4MHE A;  4F7X A;  5CV6 A;  2ZM6 Q;  4JI2 L;  4NKL A;  1SNQ A;  3P75 A;  1BBW A;  4YY3 L;  1ICW A;  1B3A A;  4A3D G;  4IPC A;  1IBM L;  1QOH A;  1VQC A;  2B2W C;  3WOF A;  5CV9 A;  4YCU A;  2R93 G;  4OGQ C;  4B3T Q;  1VQP A;  2K6A A;  3OTO L;  1OXU A;  2X69 A;  1LM0 A;  2K7V A;  4EVO A;  1K28 A;  2F4V Q;  3RR5 A;  2NVX B;  4IJH A;  4DR7 L;  3UE1 A;  3BZC A;  2QEX A;  1XPU A;  1CT1 D;  2YU9 B;  2DJG C;  3OMG A;  2IW3 A;  4TVA B;  1X54 A;  3DMU A;  3EN2 A;  3RLO A;  1JT8 A;  2F0I A;  3PO3 B;  4QGU A;  1L0W A;  5IE8 A;  1XJV A;  5E3F A;  3GTJ H;  3UDX A;  5H1S E;  2B2Y C;  3L3O C;  4HTH A;  4HMJ A;  3Q0A A;  1N33 Q;  4A75 A;  1MGS A;  3Q22 A;  4DR5 L;  4Q5V A;  4JC0 A;  2ZJP A;  1BO0 A;  1RHP A;  1PFM A;  3N6R A;  2PI2 E;  4G4K A;  3FP9 A;  4ME3 A;  4KN7 C;  4RKB A;  1U5K A;  3EJI A;  2NVQ H;  2AWO A;  2A6H D;  2E2D C;  1JB7 A;  4QUF A;  1DGS A;  2WAC A;  2QEJ C;  1TT2 A;  2TSS A;  4LFA L;  1S5E D;  1STN A;  2Z8L A;  3A7A B;  1PTO C;  4GNX A;  2J4X A;  1PH4 A;  5M5X B;  2MUY A;  3RNU A;  3Q6S A;  1Y8O B;  2HIX A;  2G9D A;  3OPO A;  1GJX A;  3GTQ B;  1XWE A;  1TU2 B;  4K5X A;  2R3Z A;  4LUO A;  3KF8 A;  1EWC A;  2AHO B;  1SRO A;  1HTP A;  5D14 A;  1EY7 A;  5IOC A;  1H95 A;  1I50 B;  2K5Q A;  4GKJ Q;  1H9M A;  5EBD A;  4AYB E;  5M3F G;  4DR4 Q;  4WJ4 A;  3FHW A;  4A3I H;  4P73 A;  2N88 A;  5M9O A;  1KC8 C;  3TP5 A;  5EKI A;  1ENC A;  1FR3 A;  1JE5 A;  1V9P A;  2A69 C;  1B53 A;  2CW0 D;  1D5Z C;  2F0M A;  4XDX A;  3EVQ A;  2WB1 B;  2B2T C;  3DEP A;  4YCW A;  4OWX B;  3I91 A;  1BCP F;  1GM5 A;  1X3G A;  4XQJ A;  3S2H H;  1G6Z A;  2JA8 H;  1GKH A;  2J7Z A;  3UE0 A;  2ZXO A;  3VYT A;  5C3E H;  5CBA E;  3H91 A;  4DV5 L;  5KIX A;  4X64 L;  3RZD B;  1DCZ A;  4S3S A;  2LXJ A;  4JI0 Q;  4JV5 Q;  1PRT D;  1KXL A;  4HED A;  4K2K A;  1FNV A;  1K8O A;  2RDG A;  2JA7 G;  1VQJ A;  3GTL H;  2VNU D;  2B63 G;  1LLR D;  1A0I A;  4A3E H;  4LFB Q;  3K8A A;  4A3K B;  2Z6K C;  1SYC A;  1LO5 D;  5C0X J;  3C46 A;  3S14 B;  3GTO B;  1VQI A;  3NEM A;  1CQF A;  2VQE L;  2EYL A;  3H0G H;  3G48 A;  3S16 B;  1JOR A;  1VQ9 A;  1TWC B;  3TP6 A;  2JN4 A;  1TWG H;  3AYH B;  2A6E C;  3WDN A;  1AW7 A;  3BG3 A;  3RN2 A;  3S17 H;  3F2C A;  4UY8 C;  1CFM A;  3W5O A;  2F0U A;  3GV6 A;  2BDO A;  1HRJ A;  1EUJ A;  5IP9 G;  2PZT A;  2BE5 C;  2F0K A;  3ER0 A;  4R8I A;  4OEM B;  4JI4 Q;  3K5L A;  5LHY 1;  2F0E A;  3PSI A;  2Q8T A;  2L4N A;  4P75 A;  2VQF Q;  5C44 B;  1VQN A;  5AFW A;  1BVS A;  3U9O A;  3R2T A;  3FPU B;  1PTO H;  1QIL A;  4RGN A;  2IPK D;  1B70 B;  5IT9 L;  3A8J E;  5FKA C;  1SN8 A;  1WTH A;  4QJF A;  5KRU A;  4CKC A;  2E2J B;  1EYA A;  3KLW A;  5IWA Q;  4KHV A;  3GDE A;  4Z9C B;  2YU9 H;  1H9J A;  2HUG A;  3G4S A;  1S72 A;  3SGI A;  4DV4 L;  1D1K A;  2TMP A;  1QUQ B;  4LJZ C;  2R7D A;  4DV1 L;  2HCI A;  1WTX A;  2EPB A;  1ET9 A;  3F2D A;  5IYD G;  5C4J B;  1E22 A;  4G57 A;  2FFK B;  3SDZ A;  4GLX A;  1KDB A;  3GP7 A;  4JOI C;  2JA5 B;  3HOW B;  2SOB A;  1EFI D;  1RTO A;  2N55 A;  4KD3 A;  4GN5 A;  4IN3 A;  1YJN A;  3K7A H;  4KD4 A;  4A3M B;  4IO9 A;  4ZAI A;  3F2B A;  2E2I H;  2Z6B A;  4JI1 Q;  2KED A;  3MEF A;  1QB5 D;  2V4D A;  4QB4 A;  3HOX H;  1GHK A;  2HT1 A;  3PIP 3;  4C3J G;  4A3J G;  1EEI D;  3NXW A;  3TS0 A;  1M1K C;  4A3F G;  3HGB A;  1GUW A;  2UUA Q;  4J8Q A;  4APV A;  1ONL A;  3GO5 A;  1UEB A;  4TSS A;  4DN4 M;  2AUK A;  3HP3 A;  1PH2 A;  4MN3 A;  4B3R Q;  1A63 A;  2WP8 J;  4EX5 A;  1EL0 A;  1WCM B;  2B2U C;  2F0F A;  3IAY A;  2KHJ A;  2BH8 A;  5CC4 A;  3I7F A;  4JI6 L;  4LF7 L;  3JC6 6;  3R93 A;  1EQQ A;  2XTI A;  5IT9 E;  1NSN S;  2RDF A;  1V1O A;  1U4R A;  4JI8 L;  3RZO B;  5EPK A;  3SEB A;  4B3M L;  4P72 A;  1HNW L;  1RJT A;  4L5R C;  3JAM i;  2EYM A;  3DWA A;  3KLS A;  4X62 L;  4FYD A;  2K03 A;  2QGQ A;  2VUM B;  1QCB D;  1EYD A;  3J81 L;  2B29 A;  4LFC Q;  1NCV A;  1GUO A;  3E0J A;  4FF3 A;  3HOV B;  2UXB Q;  2R92 B;  2RA4 A;  2D9U A;  2F0J A;  2L5T A;  2K33 A;  5K5P A;  2OTJ A;  1NJI C;  3MFG A;  1WI5 A;  3BS1 A;  1VQ7 A;  4C3I B;  2A68 C;  3Q8D A;  2JA7 H;  2WKC A;  3T56 B;  1AEX A;  3RZD H;  5JJZ A;  2Q2H A;  3URY A;  4HIM A;  4IPH A;  1I6V C;  1KAW A;  1HA5 A;  3S1M B;  1E0B A;  3SHL A;  2D0O A;  3M9B A;  1DD2 A;  1UE5 A;  3A5U A;  4LF9 Q;  2XGT A;  3KBX A;  4PQX A;  1V1P B;  4LK1 C;  5CYU A;  1TWF B;  2PYK A;  1UAP A;  1IXR A;  2C5C A;  2EIF A;  1CA6 A;  1TWC H;  2QKI C;  5EQ0 A;  1QVG A;  3M4P A;  3S15 B;  4JYA L;  2H4O A;  4Y52 H;  5TSS A;  3KF6 A;  4DUZ Q;  2PNR C;  3GTP B;  3I8Z A;  3K6O A;  3AMU A;  4HJ5 A;  2A8V A;  3PQI A;  3BYT B;  1IKM A;  1EY5 A;  2ICE C;  3CCV A;  4A3G B;  2HD3 A;  4K2L A;  1DON A;  3SK6 A;  1A3T A;  1CKM A;  1I4Q A;  3OHX C;  3PUZ A;  2EY5 A;  3T1H L;  5JJL A;  2R7Z G;  1L1O B;  5C0X G;  3J81 E;  1N36 Q;  3J7Y W;  2LS0 1;  3NP8 A;  1TY0 A;  1VQD A;  1HZA A;  3VYR A;  3D6W A;  1BF4 A;  1C4Q A;  2E2J H;  3TQY A;  1QVF A;  1Q86 C;  1KL9 A;  2LKV A;  1PA6 A;  4LF5 L;  5FLM H;  1KQS A;  1LT5 D;  4HID A;  1ENF A;  2CWP A;  3MXP A;  1AZQ A;  2O4X A;  4L8J A;  2EY1 A;  5CV7 A;  5M5W B;  1B3Q A;  1G2S A;  4C3H G;  1ZEQ X;  4OXP A;  1BXT A;  3U58 A;  1Y1V B;  4MIU A;  2IHE A;  4DKA C;  4YWK A;  1Q1B A;  1WTQ A;  1U0L A;  5IYC H;  2CQA A;  5HGQ A;  4DXG A;  4AQY Q;  3C3L A;  4C3J H;  4A4I A;  4JI2 Q;  3UDI A;  4A3J H;  5GQO A;  3W2D A;  4A3M H;  2SEB D;  3LWE A;  4A3F H;  1R9T H;  4YY3 Q;  4LF8 Q;  2N78 A;  3DM3 A;  4L6T B;  1IBM Q;  4V19 0;  2EXZ A;  1EIH A;  1SBB B;  4U68 A;  4JI5 L;  5EJW A;  1QWY A;  2KHS A;  4FXG C;  3OW2 A;  1ZYR D;  3OTO Q;  1I6H B;  5C4H A;  1STB A;  1I4R A;  2JP1 A;  2P5Z X;  2L55 A;  4AYB B;  2WII B;  5IYB H;  1AN8 A;  3H3V H;  4DR7 Q;  1K0S A;  1J5E L;  1K9M C;  2I07 B;  4DR3 L;  4X3S A;  3GTM B;  1W6J A;  3DUZ A;  2HHH L;  2B8G A;  4BBS B;  3TBI B;  2NZO A;  2JSO A;  5I2X A;  3CF5 A;  2NVY H;  3GV3 A;  4YIJ A;  2AWN A;  1EYC A;  4P71 A;  4G7O C;  2K5N A;  4GLV B;  1KAB A;  3OIP A;  2NTT A;  3QIA A;  4DV0 L;  3I4N G;  2NVT B;  1BDO A;  3HKZ G;  1IBK L;  1KDA A;  2RHS B;  1HR0 L;  4NXM L;  2ASB A;  3PF4 A;  5EKL A;  4NDX A;  5C3X A;  1LTR D;  5JPN C;  1LAC A;  1I4X A;  2CVR A;  2F0D A;  2F1M A;  2R92 H;  4TQU S;  4MTN A;  3A54 A;  5JPM C;  1UWV A;  4C3I H;  1MSG A;  4BY1 B;  3E5S A;  1OTC A;  4LFA Q;  1FNU A;  4RHS A;  5LL6 X;  1Z6H A;  1VDZ A;  4GNX B;  2QDB A;  5GAG C;  1SR3 A;  3M4Y A;  3CC7 A;  1PRT F;  1K83 B;  3KJP A;  1PH7 A;  3NWS A;  2ICI A;  1TS2 A;  3CC4 A;  2DY8 A;  5CBE E;  1WTV A;  3D3R A;  3ICE A;  4HCS A;  2KOL A;  5GAE C;  2FJ2 A;  3QB3 A;  1TWH H;  5JVG 3;  3KK7 A;  4L5S A;  4QIW E;  3HOU B;  4QMG A;  1RIP A;  1X56 A;  4ZKB B;  3E3X A;  1CK1 A;  5ELO A;  2MO0 A;  3S15 H;  4HIK A;  1Z9F A;  4JI7 L;  3NTH A;  2EQS A;  1EIF A;  1HTL D;  3J80 L;  4KV6 A;  3HOY B;  1G51 A;  1EIY B;  5DAU A;  3I4L A;  2K14 A;  1ICF B;  1S3O A;  4DK6 C;  3VDY A;  2EJM A;  3PUV A;  1D5X C;  4DV5 Q;  3QO2 A;  1F2M A;  1CHP D;  4GNX C;  3CRK C;  4X64 Q;  5KNC A;  1HH2 P;  2NYZ D;  4CJ2 C;  3W1B A;  1HXY D;  2BCO A;  4X66 L;  3G6J B;  4ABN A;  1D1I A;  4O0A A;  1L1O A;  1K8A C;  2MO1 A;  5FLX L;  4NPS A;  4X6A H;  2B39 A;  1IW7 C;  3MFY A;  1VQE A;  1VQF A;  2FMM A;  4DPG A;  5CV4 A;  1WD0 A;  1I4P A;  5CV8 A;  2VQE Q;  4XXE A;  4OL7 A;  3SVM A;  5JEA H;  5ELE A;  5M5W H;  3NTK A;  3NE5 B;  4BY7 B;  4RWS C;  1U9R A;  3PO2 H;  3ULP A;  4DNR B;  3SK4 A;  2ENB A;  1VQ5 A;  4POG A;  2JJQ A;  4PNY A;  1WYD A;  3KDF B;  2GVB A;  3M3Y B;  3H15 A;  2K52 A;  1GUN A;  1XNR L;  1SNM A;  1AP0 A;  4RGT A;  3H0G G;  3PGZ A;  3G71 A;  1VQG A;  4O42 A;  1K8G A;  3MWY W;  2BH2 A;  3J80 E;  4IOA A;  1WTO A;  5C5M A;  4AIM A;  3CPF A;  4POF A;  1B7Y B;  2E2H B;  2E76 C;  2R6G A;  2VW9 A;  1EYG A;  4R1J A;  2JA9 A;  2PW7 A;  3M4Q A;  1X6O A;  1NAP A;  2CQO A;  2EYJ A;  1A62 A;  4RAU C;  3VR5 A;  5CMD A;  2IHF A;  2SNM A;  1B2T A;  2OXP A;  4BA2 I;  4A3D B;  5C6A A;  1VQ4 A;  1XNQ L;  3GTM H;  1PTO D;  3I4N H;  3NK9 A;  3NUC A;  2UU9 L;  2SNS A;  2VB3 X;  2F0P A;  3E6Z X;  3RLF A;  4BBS H;  1S5F D;  4DV4 Q;  3S1Q H;  2R93 B;  5KNB A;  5GAD C;  4DV1 Q;  1F2L A;  1S4Z A;  2C9O A;  1L0X B;  1HQR D;  3MXN A;  3PIP A;  2UUC L;  5FLX E;  1LTG D;  3A0J A;  4DU9 A;  2FIN B;  4I7A A;  1MI2 A;  4XYO A;  3U50 C;  3I56 A;  4DAY A;  5G3L F;  4IPG A;  2FMC A;  3T4A C;  4L5T A;  1B8A A;  1KRS A;  2D2C C;  4K5V A;  1RTN A;  4J15 A;  2ZTE A;  4ZUI A;  1OXV A;  5FOB B;  4QUC A;  1HUN A;  1NBW A;  5FO7 B;  2EJF C;  1Y14 B;  3S1N B;  3UDG A;  2F0V A;  2K05 A;  3K5M A;  4BY1 H;  1XTC D;  4JBW A;  3BYY B;  1X32 A;  3CCS A;  5I9P A;  1MJC A;  2NZ1 D;  5C4Z A;  3KUP A;  3MTS A;  5M3M B;  1SDF A;  3OW7 A;  2HIV A;  5LMN L;  2YYZ A;  4H13 C;  4IZ8 A;  4XT1 B;  2L12 A;  4A3B B;  4LMQ D;  1I3Q B;  1S40 A;  1LUZ A;  3HOX G;  4DUY L;  1BUV T;  2KQ3 A;  3H3V I;  1IZ6 A;  4JI6 Q;  4LF7 Q;  3DEO A;  3TP8 A;  5FJ8 G;  4JI3 L;  3FRP B;  4JI8 Q;  3GTK B;  2B2V A;  2E74 C;  4B3M Q;  5J3B A;  3U4Z A;  1M4V A;  2JYO A;  2NWG A;  1JB3 A;  1HNW Q;  3TZD A;  1CSP A;  4X62 Q;  4WFN 3;  5IGC A;  2OF1 A;  2MJ8 A;  3AEV A;  3HOY H;  4Q0F A;  5EGT A;  3KLS X;  5LL6 S;  4QQB X;  2A6E D;  1C8C A;  2FHT A;  1YI2 A;  5ELN A;  1OO9 B;  3K0Y A;  4H02 A;  4OO1 H;  2EXD A;  3VR4 A;  3HOZ H;  1LAB A;  2Q2T A;  3KLR A;  3GTG H;  2VL6 A;  2OCE A;  1QNU A;  3CCJ A;  2M2L A;  2BE5 D;  1LTI D;  4KMU C;  3NBH B;  1HJP A;  4GOP A;  4F88 A;  5HY6 A;  1Q90 A;  4A76 A;  3HKZ E;  1PVO A;  5IGB A;  1V1Q A;  2Z0S A;  1EEF D;  2L11 A;  2A6H C;  2WAQ G;  1KNE A;  2EYO A;  1FGU A;  5DEH A;  2R61 A;  1MJE A;  1YBY A;  2VY3 A;  4JYA Q;  3M4O H;  3NQI A;  4RCN A;  1NMF A;  1VQK A;  4YHH L;  4DXF A;  3KF6 B;  3FDT A;  1IHZ A;  3GQB A;  1YNX A;  1SJH D;  4A3K G;  1K3B C;  3P7J A;  4HMI A;  4DV2 L;  1X3Q A;  1PRT B;  4EQO A;  1F9Q A;  4L63 B;  1M90 C;  1WOC A;  4BS9 A;  5IGG A;  3DLL A;  2HQL A;  3KDF A;  3NEL A;  1NTG A;  1ROD A;  4A93 B;  5C0X I;  4IUU A;  1W3S A;  1G8Z D;  3T1H Q;  3I4M B;  2XWJ B;  3IFD A;  2F0L A;  3L9A X;  1UEA B;  2F3W A;  4HCE A;  1O7Y A;  3VYU A;  2E2H H;  1D8L A;  3QOL A;  4FXD A;  4OWT B;  1F77 A;  3C2P A;  1PDQ A;  3LX0 A;  5E1F A;  3G7L A;  2VS1 A;  5I4D A;  2K28 A;  3V96 A;  1SE3 A;  2E8G A;  1PZI D;  5JEA J;  1IBL Q;  2B3G A;  1EY8 A;  3CQZ B;  3KJO A;  1ENA A;  3HZX A;  3AFP A;  5D65 A;  4LF5 Q;  1NR2 A;  3RMH A;  2NTS A;  3BZK A;  2NVX H;  1VQ8 A;  1Q46 A;  2NN6 H;  3MXU A;  1E2V A;  3IL8 A;  1VQB A;  2F0S A;  3PO3 H;  1XMQ L;  3I55 A;  3NEN A;  4DNI A;  3HRZ C;  3DWP A;  1TWA B;  3ULL A;  3J7A 5;  4F8M A;  4R4I A;  1CA5 A;  4BBR B;  2VXW A;  4ZRZ A;  5FLM G;  1NNX A;  1JJ2 A;  2ZTC A;  4LUV A;  2QA4 A;  3H94 A;  1VMC A;  3BU2 A;  1Q7Y C;  3OOC A;  1PYB A;  4GKK L;  4A3L H;  4JI5 Q;  4OX9 Q;  4J1M A;  5E4X A;  4K0K L;  1MIU A;  3HOW G;  5IYC G;  1CZW A;  2YV5 A;  3J81 j;  5ELB A;  3A8I E;  4RG1 A;  1KAA A;  4ID6 A;  5M3M H;  1SE2 A;  2A68 D;  5FJ8 H;  3P20 A;  4C2M B;  4A3M G;  2F0G A;  3HEJ A;  1J5E Q;  1DOM A;  1DOK A;  2RHQ B;  2MGS A;  3X3N A;  1T5X D;  1II3 A;  4ZQ3 A;  1H9S B;  5M5X H;  1QZG A;  2HHH Q;  1EY9 A;  1YIT A;  3CU7 A;  3CMA A;  2WFW A;  4UDU C;  1ET6 A;  3GTQ H;  3C1E A;  1MSH A;  4B08 A;  4DV0 Q;  3FPP A;  3CXC A;  1NE3 A;  2RQX A;  1I50 H;  5IYB G;  1JOQ A;  1IBK Q;  1STG A;  4HR7 B;  4NXM Q;  4KKS A;  4QF4 A;  5CR3 A;  1PH1 A;  3ERO A;  1JCK B;  5HGT A;  1ZKO A;  1WCM G;  4RFB A;  4FF1 A;  2KA7 A;  5G3L D;  2Y0S G;  3QWN A;  1VQ6 A;  4I65 A;  1HNZ L;  1ESR A;  1JWM D;  2ATW A;  2XWB B;  1XMO L;  4ZKC B;  2F4I A;  5E4W C;  4LF6 L;  1OXX K;  5ELD A;  1GXD C;  4G7Z C;  4JCV E;  4KY6 A;  1AH9 A;  4RKL A;  1B4O A;  4KLK A;  4UPA A;  4DR2 L;  3T53 B;  2R92 G;  2RBM A;  2BOS A;  4EQ5 A;  1O78 A;  2F3I A;  1MKH A;  3NBH A;  3PV0 A;  3J7Z C;  1Y8P B;  4C3I G;  2IJ0 A;  4CDC C;  1NMG A;  1EU4 A;  2PZU A;  4R4C A;  2UXC L;  4UP8 A;  3C1F A;  1B44 D;  2F03 A;  4A3K H;  5ELF A;  3S14 H;  3EA6 A;  3L7Z C;  4JI7 Q;  1X3E A;  1Q12 A;  3VA7 A;  2PMZ E;  3MHB A;  3GTO H;  1S5B D;  3HKS A;  4UHV A;  3S16 H;  4DK1 A;  2IX0 A;  4R9W A;  3BDL A;  2KCN A;  2Z4H A;  1N34 L;  1IYV A;  1EOV A;  2F0T A;  1GUT A;  2EYP A;  4Y7N B;  1PV4 A;  4KJO A;  1WTR A;  4IUP A;  1QG7 A;  2XNA C;  4DR1 L;  3I4M H;  3JAM L;  1CTM A;  1YNN D;  1Y1W B;  2XN9 C;  4OO1 I;  1W6K A;  4FDB A;  3FKI B;  5C44 H;  3DXJ C;  3IKJ A;  4OIK A;  4CHT B;  1RKN A;  3TME A;  4JBM A;  1VF5 C;  1PTO F;  5CV5 A;  1YNJ D;  1JMC A;  1TS5 A;  2EVB A;  2YTV A;  1KLG D;  3IRB A;  1HNX L;  1O7L A;  2JA6 B;  1JR0 D;  3CCU A;  2E5L L;  1W2B A;  1BCP B;  2O5I C;  1STE A;  1SNC A;  1PFS A;  4GLA C;  4WOR A;  5FK9 C;  2GA4 B;  1STA A;  3CRL C;  2D62 A;  5C4J H;  2EE1 A;  2C35 B;  4KI0 A;  2WB1 E;  2KCM A;  1XNR Q;  2JA5 H;  1XPR A;  1U4P A;  3M7G A;  2ZJR A;  3HOW H;  5COR A;  1Q81 C;  2A74 C;  3F1Z A;  5JEA G;  4CGY B;  2A1A A;  1KTK A;  4WJW A;  4JG2 A;  3TEH B;  1JE4 A;  4TRD A;  3PO2 G;  1N9W A;  1GD7 A;  2G9H D;  2WAQ E;  1KIX A;  3T13 A;  3BZD B;  3NHH A;  4GZY C;  3BDO A;  1Y69 U;  1BQQ T;  1L1O C;  4HN7 A;  1D5M C;  4KY5 A;  1LYL A;  1YZ6 A;  3JAM E;  3B6Y A;  3TDQ A;  4IUQ A;  1XNQ Q;  4WJ3 M;  1MHW C;  2VZA A;  1TXY A;  1N8R C;  1XYI A;  2IL8 A;  2KEE A;  4B3S L;  3K81 C;  4BXX H;  3MEH A;  1VS0 A;  1H9S A;  3MXN B;  1FD7 D;  2UUC Q;  1WCM H;  1BCP C;  4B9W A;  1SYD A;  4X65 L;  4RA8 A;  3F2U A;  3K59 A;  1QNK A;  2KHI A;  4DAY B;  3RZO H;  2RVL A;  3SE0 A;  2KCT A;  3CPW A;  3ERQ A;  2DY7 A;  1SND A;  4BBS G;  3U9S A;  4DR5 Q;  1QZH A;  5BN4 A;  2A5H A;  1CQV A;  2VUM H;  1PYS B;  4K5W A;  1EOT A;  1JJC B;  2J0T D;  2L1B A;  4CDF C;  3HOV H;  3IFT A;  4LW1 A;  1SNO A;  4DA2 A; 
#chains in the Genus database with same CATH homology
 1SFO B;  1SAP A;  1VCI A;  5FO8 B;  1EQV A;  3GTJ B;  5ELC A;  1OXS C;  3SK5 A;  5C4X B;  3QG1 A;  5F2D A;  3OMC A;  4CKE A;  5IIF A;  5I6W A;  4EGV A;  1SSO A;  3BVM A;  4ZK9 B;  5M5Y B;  1HFN A;  2RSO A;  1HQM C;  4H44 C;  4ILW A;  3SXH A;  3NWT A;  1IW7 D;  3S9W A;  1ZYR C;  5IGF A;  4IQZ A;  1HPC A;  4U67 3;  5ISR A;  3VR6 A;  1LT4 D;  2IT1 A;  5C3W A;  1U4L A;  3VYS A;  4ME5 A;  2LFN A;  4OHJ A;  3OSO A;  1SE4 A;  4M1U B;  1QE6 A;  2BA1 A;  2DN8 A;  1G29 1;  1RDP D;  3ZYY X;  3EQL C;  3TSS A;  2PCF B;  1PFB A;  1TVX A;  4A3I B;  1EY4 A;  1O7Z A;  3A8K E;  1SMY C;  1EZ8 A;  1JWS D;  4OO1 G;  4K14 A;  4PMB A;  2B2V C;  1AFP A;  1B9N A;  3LNN A;  4QCL A;  4G7H C;  5HUR A;  3FMC A;  3S2H B;  2EZV A;  2LY7 A;  2WV6 D;  2JA8 B;  1Q1E A;  5C3E B;  4FNF A;  3I3C A;  4NW2 A;  1JC7 A;  2L9H A;  4DK0 A;  2XRS D;  1T5E A;  1E2Z A;  1HCZ A;  3D31 A;  4X3U A;  4KKU A;  1DYQ A;  3GTL B;  2M9V A;  4PMC A;  4RGO S;  1CI3 M;  2BA0 A;  4M8A A;  3RUZ A;  4A3E B;  1GOZ A;  2F0O A;  2MP1 A;  1FNW A;  3R2I A;  2EYH A;  3OIQ A;  3J7A V;  4H0L C;  1MD2 D;  3TP7 A;  4EQN A;  3K57 A;  3QJY A;  1M8A A;  3ND8 A;  2BDN A;  2KCC A;  3Q24 A;  1BBX C;  3EFX D;  3DWQ A;  4JK1 C;  3SR1 A;  2AUJ D;  1LTA D;  5I6Y A;  2QCP X;  1FYC A;  3V05 A;  2NN6 G;  1SYE A;  4KTA A;  1KNA A;  4FP5 D;  2PQE A;  4BWG B;  1PTO B;  1RCV D;  3R3O A;  2A69 D;  4RH6 A;  2AQ3 B;  1EY6 A;  1J8I A;  4CBV A;  3O13 A;  4F87 A;  4C56 C;  4OIJ A;  1A3V A;  1I4G A;  5BN3 A;  1BOS A;  1DXM A;  1ZXT A;  2PMZ B;  3S1R B;  4DGZ A;  4ZYS A;  2E75 C;  1VF7 A;  1PXU A;  2X6G A;  3ITP A;  1JQY D;  2F0W A;  1O80 A;  3K7A B;  4RHR A;  2SDF A;  2E2I B;  3T16 A;  4N9P A;  1KDC A;  1STH A;  1I4H A;  3HOX B;  1B9M A;  3I90 A;  3QOJ A;  2X6L A;  5IGE A;  1BR9 A;  1KLU D;  2IX3 A;  5KND A;  2NBF A;  4H7B A;  4C1N I;  1DZ1 A;  4E6I A;  5M3F B;  3I72 A;  1RF2 D;  4DAV A;  3D8G A;  3H09 A;  4BA1 I;  2HCC A;  1AZP A;  1FGB D;  5COY A;  1B1Z A;  1L0Y B;  1F9R A;  4HSV A;  4XQQ A;  4K6L A;  4DFA A;  2NB0 A;  3AU7 A;  4CJ0 B;  1JOO A;  3TN2 A;  1HA6 A;  1SNP A;  2MPM A;  2JEB I;  4P2C B;  1F9P A;  1SYG A;  3S2D B;  2WKD A;  2NUC A;  4ULL A;  3PUW A;  1WD1 A;  4IFD H;  5JVH 3;  1V8Q A;  3TZU A;  1H9K A;  3PIO 3;  2HDL A;  5C5L A;  2JA7 B;  3SK8 A;  2WAQ B;  2B63 B;  3MAQ A;  3M7N A;  4KK7 A;  5NUC A;  1A15 A;  3KBG A;  1LT6 D;  1JIC A;  1EQT A;  2B2W A;  4DNT B;  4EQP A;  5JAV A;  5J22 A;  1GUS A;  4TKO B;  5I9O A;  2OT2 A;  1TS4 A;  4KHZ A;  1G91 A;  2XVS A;  1PLF A;  1Q8I A;  4C1N K;  2H1E A;  1TII D;  2CW0 C;  1X3P A;  4ODG A;  2QF7 A;  2B2Y A;  2JE6 I;  4NMZ A;  1TR5 A;  4HAE A;  1Z7T A;  1B50 A;  1LTT D;  2K04 A;  5KYL A;  1LT3 D;  1JWU D;  3V2T A;  2K5D A;  4XTC S;  1HFG A;  4XYQ A;  3NQT A;  5DM6 3;  1PRT C;  3GD7 A;  4R8N A;  3HS0 C;  3FVQ A;  3NBI A;  3VR3 A;  2AQ2 B;  4XIG S;  3A56 A;  3R8B A;  1DM0 B;  2JXM B;  2ZT9 C;  1LTS D;  1XX8 A;  4XQN A;  2PW5 A;  3I70 A;  1WTW A;  1EIG A;  4QIW B;  2KEC A;  3LWU A;  5DM7 3;  1CM9 A;  3VA5 A;  1STY A;  4C3J B;  1QJO A;  4A3J B;  1F2Y A;  1LTB D;  2EJG C;  4A3F B;  1R9T B;  2QIL A;  3Q23 A;  2B2T A;  1UUP A;  3K5N A;  4XT3 B;  1EZ6 A;  5CGK A;  1V43 A;  4KKT A;  5T1G A;  1A2T A;  1R4Q B;  2RKS A;  4CKB A;  2Q8R E;  4LAA A;  5JOB A;  1Z47 A;  2HQE A;  2NVY B;  2Y0S B;  1JOK A;  2K32 A;  3RD4 A;  1S5D D;  5KYI A;  2KUM A;  4NP5 A;  1SYF A;  4IUV A;  2VB2 X;  1SJE D;  2RSN A;  2XRQ D;  3D4D A;  5EPL A;  3MC0 B;  2LMC B;  1D2B A;  4FXK C;  1HUM A;  5DNF A;  3PUX A;  1NR4 A;  1ILP A;  1H9R A;  4ZLT F;  1EU3 A;  3NTI A;  3H3V C;  1CHQ D;  2CHB D;  2K5W A;  5A35 A;  1WVL A;  2HDM A;  3BDC A;  1ML0 D;  1TWH B;  4IAL A;  3DHQ A;  1BNZ A;  2F0H A;  3P1H A;  2IWH A;  1OXT A;  3X3M A;  4IFD J;  5KGU A;  3D4W A;  1MBY A;  1TS3 A;  2WIN B;  2R7Z B;  1A2U A;  2EY2 A;  2F0N A;  4J6H A;  1DJR D;  4IUR A;  4PV1 C;  1XXG A;  3D4R A;  1NUC A;  2Q8I B;  2JEA I;  2EOT A;  2K1B A;  1BCP D;  1TY2 A;  1VMP A;  4IFD I;  1GHJ A;  3MVV A;  5K36 G;  2A73 B;  2AQ1 B;  5J1Z A;  1PYW D;  4C3H B;  4O1N A;  1WTP A;  3D6C A;  1PZK D;  2EYF A;  1E2W A;  3ONA B;  3NSW A;  2PO4 A;  1S5C D;  3T51 B;  3UI2 A;  3H6M A;  3K58 A;  5IOD A;  3NPP A;  3K5O A;  5J39 A;  1SXT A;  2B2U A;  3PO2 B;  4K8J A;  3PUY A;  4FVM A;  5D3D A;  1ILQ A;  1G2T A;  3MA2 B;  1YNN C;  4DAP A;  2NN6 I;  5EKK A;  1EY0 A;  3CHB D;  5IGD A;  1YNJ C;  2EDG A;  3ND9 A;  4K8I A;  1GUG A;  5EPJ A;  2M00 A;  5A2Q L;  4WRD A;  2MHV A;  3J7A F;  3I4N B;  1RD9 D;  2RDH A;  3S1Q B;  3HKZ B;  1ESF A;  1EWH A;  1IL8 A;  4CJ1 B;  4HSP A;  2O5J C;  1K8M A;  1SYB A;  2PPB C;  3A7L A;  1SEB D;  4RGM A;  2K01 A;  3BVG A;  1SMY D;  5EBC A;  2O2L D;  4FF2 A;  4N9T A;  2OEO A;  1R4P B;  1A6X A;  2ID0 A;  3MXG A;  4DF7 A;  4V0B A;  2ZXP A;  2NVQ B;  1D6E C;  3BVZ A;  2KVM A;  2L0C A;  2I46 A;  1CZG A;  1IKL A;  5D3I B;  3WOE A;  4I7Z C;  2F3V A;  1DOL A;  4PMW A;  3DM1 A;  5A2Q E;  5KEE A;  1V1P A;  3CKI B;  3PMF A;  4K6D A;  1F2Z A;  1TQO A;  1U4M A;  3AB9 A;  4IUT A;  4X3T A;  3I73 A;  5I2Y A;  1Y8N B;  1Q3L A;  5C0X H;  3HG9 A;  3OWF A;  5K36 H;  5T1I A;  1UNS A;  3VR2 A;  4UAI A;  1PZJ D;  2D5D A;  2F0Q A;  3HOZ B;  4KN4 C;  1IYU A;  3M85 A;  4RCO A;  1J9O A;  3GTG B;  1PFN A;  2XIW A;  2Z1C A;  3A55 A;  4B9X A;  1F9S A;  4X3K A;  2DNC A;  4IUN A;  4IFD G;  2IX1 A;  1A3U A;  2B8F A;  1LV9 A;  4FO2 A;  3N52 A;  3FEW X;  4KJN A;  2DNE A;  1C48 A;  1HHV A;  3OWE B;  2EY6 A;  3MZ5 A;  4ZUJ A;  3M4O B;  4KY7 A;  5FO9 B;  2ZXR A;  5BN5 A;  1PMR A;  3H0G B;  1TKW B;  4FF4 A;  3W3A A;  1TWG B;  2Z4I A;  2KJX A;  3S17 B;  2XSC A;  2PZW A;  4MHE A;  4F7X A;  5CV6 A;  4NKL A;  1SNQ A;  3P75 A;  1ICW A;  1B3A A;  1QOH A;  2B2W C;  3WOF A;  5CV9 A;  4OGQ C;  2K6A A;  1OXU A;  2X69 A;  2K7V A;  4EVO A;  2NVX B;  1CT1 D;  2YU9 B;  3OMG A;  2IW3 A;  3DMU A;  2F0I A;  3PO3 B;  5E3F A;  2B2Y C;  3L3O C;  4HTH A;  4HMJ A;  3Q0A A;  1MGS A;  3Q22 A;  4Q5V A;  1BO0 A;  1RHP A;  1PFM A;  3N6R A;  4G4K A;  4RKB A;  4KN7 C;  3EJI A;  2AWO A;  2A6H D;  2E2D C;  4QUF A;  2WAC A;  2QEJ C;  1TT2 A;  2TSS A;  1S5E D;  1STN A;  2Z8L A;  3A7A B;  1PTO C;  2J4X A;  5M5X B;  2MUY A;  3Q6S A;  1Y8O B;  2G9D A;  3OPO A;  1GJX A;  3GTQ B;  1XWE A;  1TU2 B;  4K5X A;  2R3Z A;  3KF8 A;  1EWC A;  1HTP A;  5D14 A;  5IOC A;  1EY7 A;  1I50 B;  2K5Q A;  1H9M A;  5EBD A;  2N88 A;  5M9O A;  3TP5 A;  5EKI A;  1ENC A;  1FR3 A;  2A69 C;  1B53 A;  2CW0 D;  1D5Z C;  2F0M A;  4XDX A;  3EVQ A;  2WB1 B;  2B2T C;  3DEP A;  3I91 A;  1BCP F;  4XQJ A;  1G6Z A;  2J7Z A;  2ZXO A;  3VYT A;  5CBA E;  3H91 A;  5KIX A;  3RZD B;  1DCZ A;  4S3S A;  1PRT D;  4HED A;  4K2K A;  1FNV A;  1K8O A;  2RDG A;  2VNU D;  1LLR D;  4A3K B;  1SYC A;  1LO5 D;  5C0X J;  3C46 A;  3S14 B;  3GTO B;  1CQF A;  2EYL A;  3S16 B;  1JOR A;  1TWC B;  3TP6 A;  2A6E C;  3WDN A;  1AW7 A;  3BG3 A;  1CFM A;  2F0U A;  3GV6 A;  2BDO A;  1HRJ A;  2PZT A;  2BE5 C;  2F0K A;  4R8I A;  3K5L A;  5LHY 1;  2F0E A;  2Q8T A;  2L4N A;  5C44 B;  5AFW A;  3U9O A;  3R2T A;  3FPU B;  1PTO H;  1QIL A;  4RGN A;  2IPK D;  5IT9 L;  3A8J E;  5FKA C;  5KRU A;  4CKC A;  2E2J B;  1EYA A;  4KHV A;  4Z9C B;  1H9J A;  2HUG A;  1D1K A;  2TMP A;  4LJZ C;  1WTX A;  2HCI A;  2EPB A;  1ET9 A;  5C4J B;  4G57 A;  2FFK B;  3SDZ A;  1KDB A;  3GP7 A;  2JA5 B;  3HOW B;  2SOB A;  1EFI D;  1RTO A;  2N55 A;  4KD3 A;  4IN3 A;  4KD4 A;  4A3M B;  4ZAI A;  2KED A;  1QB5 D;  2V4D A;  4QB4 A;  1GHK A;  3PIP 3;  4C3J G;  1EEI D;  3NXW A;  3HGB A;  1GUW A;  4J8Q A;  1ONL A;  3GO5 A;  4TSS A;  4DN4 M;  2AUK A;  3HP3 A;  4MN3 A;  2WP8 J;  1EL0 A;  1WCM B;  2B2U C;  2F0F A;  3IAY A;  5CC4 A;  3R93 A;  5IT9 E;  1NSN S;  2RDF A;  1V1O A;  1U4R A;  3RZO B;  5EPK A;  3SEB A;  1RJT A;  2EYM A;  3DWA A;  3KLS A;  4FYD A;  2K03 A;  2VUM B;  1QCB D;  1EYD A;  3J81 L;  1NCV A;  1GUO A;  3E0J A;  4FF3 A;  3HOV B;  2R92 B;  2RA4 A;  2D9U A;  2F0J A;  2L5T A;  2K33 A;  5K5P A;  3MFG A;  3BS1 A;  4C3I B;  2A68 C;  2WKC A;  3T56 B;  1AEX A;  5JJZ A;  3URY A;  1I6V C;  1HA5 A;  3S1M B;  1E0B A;  3SHL A;  1DD2 A;  3KBX A;  4PQX A;  1V1P B;  4LK1 C;  5CYU A;  1TWF B;  2PYK A;  1UAP A;  2C5C A;  1CA6 A;  2QKI C;  5EQ0 A;  3S15 B;  2H4O A;  5TSS A;  2PNR C;  3GTP B;  3I8Z A;  3K6O A;  3AMU A;  3BYT B;  1IKM A;  1EY5 A;  2ICE C;  4A3G B;  4K2L A;  1DON A;  3SK6 A;  1A3T A;  1I4Q A;  3OHX C;  3PUZ A;  2EY5 A;  5C0X G;  3J81 E;  3J7Y W;  2LS0 1;  3NP8 A;  1TY0 A;  3VYR A;  3D6W A;  1BF4 A;  1C4Q A;  2LKV A;  1LT5 D;  1ENF A;  3MXP A;  1AZQ A;  2O4X A;  4L8J A;  2EY1 A;  5CV7 A;  5M5W B;  4C3H G;  1G2S A;  1ZEQ X;  1BXT A;  1Y1V B;  4MIU A;  1Q1B A;  1WTQ A;  2CQA A;  4DXG A;  3C3L A;  3W2D A;  2SEB D;  3LWE A;  4L6T B;  1EIH A;  4V19 0;  2EXZ A;  1SBB B;  4U68 A;  5EJW A;  1QWY A;  2KHS A;  4FXG C;  1ZYR D;  1I6H B;  5C4H A;  1STB A;  1I4R A;  2JP1 A;  2L55 A;  4AYB B;  2WII B;  1AN8 A;  2I07 B;  4X3S A;  3GTM B;  1W6J A;  3DUZ A;  2B8G A;  4BBS B;  3TBI B;  2JSO A;  5I2X A;  3GV3 A;  4YIJ A;  2AWN A;  1EYC A;  4G7O C;  1KAB A;  3OIP A;  2NTT A;  3QIA A;  2NVT B;  1BDO A;  1KDA A;  5EKL A;  4NDX A;  5C3X A;  1LTR D;  5JPN C;  1LAC A;  1I4X A;  2CVR A;  2F0D A;  2F1M A;  4TQU S;  3A54 A;  5JPM C;  1MSG A;  4BY1 B;  3E5S A;  1FNU A;  4RHS A;  5LL6 X;  1Z6H A;  1VDZ A;  2QDB A;  3M4Y A;  1PRT F;  1K83 B;  3NWS A;  2ICI A;  1TS2 A;  2DY8 A;  5CBE E;  1WTV A;  3D3R A;  4HCS A;  2KOL A;  2FJ2 A;  3QB3 A;  5JVG 3;  3HOU B;  3KK7 A;  4QMG A;  4ZKB B;  1CK1 A;  3NTH A;  1HTL D;  3J80 L;  4KV6 A;  3HOY B;  5DAU A;  3I4L A;  2EJM A;  3PUV A;  1D5X C;  3QO2 A;  1F2M A;  1CHP D;  3CRK C;  5KNC A;  2NYZ D;  4CJ2 C;  1HXY D;  2BCO A;  3G6J B;  4ABN A;  1D1I A;  5FLX L;  2B39 A;  1IW7 C;  3MFY A;  2FMM A;  5CV4 A;  1WD0 A;  1I4P A;  5CV8 A;  4XXE A;  4OL7 A;  3SVM A;  5JEA H;  5ELE A;  3NTK A;  3NE5 B;  4BY7 B;  4RWS C;  1U9R A;  4DNR B;  3SK4 A;  2ENB A;  4PNY A;  3M3Y B;  1GUN A;  1SNM A;  1AP0 A;  4RGT A;  4O42 A;  3MWY W;  3J80 E;  1WTO A;  5C5M A;  2E2H B;  2E76 C;  2R6G A;  2PW7 A;  1NAP A;  4RAU C;  2EYJ A;  3VR5 A;  5CMD A;  2SNM A;  1B2T A;  2OXP A;  4BA2 I;  4A3D B;  5C6A A;  1PTO D;  3NK9 A;  3NUC A;  2SNS A;  2VB3 X;  2F0P A;  3E6Z X;  3RLF A;  1S5F D;  2R93 B;  5KNB A;  1F2L A;  1S4Z A;  2C9O A;  1L0X B;  1HQR D;  3MXN A;  5FLX E;  1LTG D;  4DU9 A;  2FIN B;  1MI2 A;  4XYO A;  4DAY A;  5G3L F;  2FMC A;  3T4A C;  2D2C C;  4K5V A;  1RTN A;  4ZUI A;  1OXV A;  5FOB B;  4QUC A;  1HUN A;  5FO7 B;  2EJF C;  3S1N B;  2F0V A;  2K05 A;  3K5M A;  1XTC D;  4JBW A;  3BYY B;  1X32 A;  5I9P A;  2NZ1 D;  5C4Z A;  3KUP A;  3MTS A;  5M3M B;  1SDF A;  3OW7 A;  2YYZ A;  4H13 C;  4IZ8 A;  4XT1 B;  2L12 A;  4A3B B;  4LMQ D;  1I3Q B;  1BUV T;  2KQ3 A;  3DEO A;  3TP8 A;  3FRP B;  3GTK B;  2B2V A;  2E74 C;  1M4V A;  2JYO A;  2NWG A;  1JB3 A;  3TZD A;  4WFN 3;  5IGC A;  2OF1 A;  2MJ8 A;  4Q0F A;  5EGT A;  3KLS X;  5LL6 S;  2A6E D;  1C8C A;  2FHT A;  1OO9 B;  3K0Y A;  4OO1 H;  3VR4 A;  1LAB A;  3KLR A;  1QNU A;  2M2L A;  2BE5 D;  1LTI D;  4KMU C;  4F88 A;  1Q90 A;  5IGB A;  1EEF D;  2L11 A;  2A6H C;  1KNE A;  2EYO A;  5DEH A;  2R61 A;  3NQI A;  4RCN A;  4DXF A;  3FDT A;  1IHZ A;  3GQB A;  1SJH D;  3P7J A;  4HMI A;  1X3Q A;  1PRT B;  4EQO A;  1F9Q A;  4L63 B;  4BS9 A;  5IGG A;  1ROD A;  4A93 B;  5C0X I;  4IUU A;  1G8Z D;  3I4M B;  2XWJ B;  3IFD A;  2F0L A;  3L9A X;  1UEA B;  2F3W A;  4HCE A;  1O7Y A;  3VYU A;  3QOL A;  4FXD A;  1F77 A;  3C2P A;  1PDQ A;  3LX0 A;  5E1F A;  3G7L A;  5I4D A;  2K28 A;  3V96 A;  1SE3 A;  1PZI D;  5JEA J;  1EY8 A;  3CQZ B;  1ENA A;  3HZX A;  5D65 A;  1NR2 A;  3RMH A;  2NTS A;  2NN6 H;  3MXU A;  1E2V A;  3IL8 A;  2F0S A;  3HRZ C;  3DWP A;  1TWA B;  4F8M A;  1CA5 A;  4BBR B;  2VXW A;  4ZRZ A;  3H94 A;  1VMC A;  3OOC A;  4J1M A;  5E4X A;  1CZW A;  5ELB A;  3A8I E;  1KAA A;  4ID6 A;  1SE2 A;  2A68 D;  4C2M B;  3P20 A;  2F0G A;  3HEJ A;  1DOM A;  1DOK A;  2MGS A;  3X3N A;  1T5X D;  1II3 A;  4ZQ3 A;  1H9S B;  1EY9 A;  3CU7 A;  4UDU C;  1ET6 A;  3C1E A;  1MSH A;  4B08 A;  3FPP A;  2RQX A;  1JOQ A;  1STG A;  4HR7 B;  4KKS A;  4QF4 A;  5CR3 A;  3ERO A;  1JCK B;  5HGT A;  1ZKO A;  4RFB A;  4FF1 A;  2KA7 A;  5G3L D;  3QWN A;  4I65 A;  1ESR A;  1JWM D;  2XWB B;  4ZKC B;  2F4I A;  5E4W C;  1OXX K;  5ELD A;  1GXD C;  4G7Z C;  4KY6 A;  4RKL A;  1B4O A;  3T53 B;  2RBM A;  2BOS A;  1O78 A;  3NBH A;  3PV0 A;  1Y8P B;  4C3I G;  2IJ0 A;  1EU4 A;  2PZU A;  3C1F A;  1B44 D;  2F03 A;  5ELF A;  3EA6 A;  3L7Z C;  1Q12 A;  3VA7 A;  3MHB A;  1S5B D;  4DK1 A;  2IX0 A;  4R9W A;  3BDL A;  2KCN A;  2Z4H A;  1IYV A;  2F0T A;  1GUT A;  2EYP A;  4Y7N B;  4KJO A;  1WTR A;  4IUP A;  1QG7 A;  2XNA C;  3JAM L;  1CTM A;  1YNN D;  1Y1W B;  2XN9 C;  4OO1 I;  1W6K A;  3FKI B;  3DXJ C;  3IKJ A;  4OIK A;  4CHT B;  1RKN A;  3TME A;  1VF5 C;  1PTO F;  5CV5 A;  1YNJ D;  1TS5 A;  2EVB A;  1KLG D;  1O7L A;  2JA6 B;  1JR0 D;  1BCP B;  2O5I C;  1STE A;  1SNC A;  4WOR A;  5FK9 C;  2GA4 B;  1STA A;  3CRL C;  2D62 A;  2EE1 A;  4KI0 A;  1U4P A;  3M7G A;  5COR A;  2A74 C;  5JEA G;  4CGY B;  1KTK A;  4WJW A;  1JE4 A;  4TRD A;  2G9H D;  3T13 A;  3BZD B;  3NHH A;  4GZY C;  3BDO A;  1Y69 U;  1BQQ T;  4HN7 A;  1D5M C;  4KY5 A;  3JAM E;  3TDQ A;  4IUQ A;  1XYI A;  2IL8 A;  2KEE A;  3MEH A;  1H9S A;  1FD7 D;  1BCP C;  4B9W A;  1SYD A;  4RA8 A;  3F2U A;  3K59 A;  1QNK A;  2RVL A;  3SE0 A;  3ERQ A;  2DY7 A;  1SND A;  3U9S A;  5BN4 A;  2A5H A;  1CQV A;  4K5W A;  1EOT A;  2J0T D;  2L1B A;  3IFT A;  1SNO A;  4DA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...