4QF4A

Crystal structure of staphylococcal nuclease variant v23m at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
132
Chain Sequence
b'LHKEPATLIKAIDGDTMKLMYKGQPMTFRLLLVDTPETKHPVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 132
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qf4A00
2F0FA 5C5MA 1KDBA 2OEOA 1U9RA 4I65A 3NHHA 5IIFA 3D8GA 5IGCA 5ISRA 2PZUA 5I9OA 2F0PA 1AEXA 1KABA 1STGA 3NK9A 5JOBA 5K5PA 2EYJA 4KD3A 1STYA 2F0EA 4IALA 3T16A 1EZ8A 1SYFA 5I9PA 4HMIA 3HZXA 4G57A 4EVOA 2RKSA 3S9WA 4ME5A 3QOJA 5CV6A 5J22A 4KHVA 1A2TA 4LAAA 4QB4A 2F0WA 5CV7A 3QB3A 1KAAA 2PYKA 3EVQA 3R3OA 2EYMA 1EYAA 1EY4A 1JOOA 4N9TA 4F8MA 1A3UA 4IZ8A 2EYFA 4EQPA 1SYEA 5CV8A 5DEHA 4ZUIA 4K2KA 3P1HA 3NXWA 1EYCA 4DGZA 4J1MA 2F0VA 4K8JA 3SXHA 3C1EA 1F2MA 1EZ6A 4NMZA 2RDFA 5HGTA 2OXPA 3DHQA 4K6DA 2KQ3A 1STHA 4HMJA 4KD4A 4IUNA 5C5LA 4E6IA 5HURA 4B9XA 1TR5A 4K14A 2KHSA 4WORA 4YIJA 3TMEA 5C4HA 2EYPA 3MEHA 4J6HA 5DAUA 1SNPA 1SNMA 3D4WA 4B9WA 4EQOA 1RKNA 4HTHA 4K8IA 5J39A 2QDBA 3DMUA 3NUCA 1NSNS 4RKBA 5KRUA 2F0QA 2PZWA 4KV6A 1EQVA 1II3A 4KY6A 4PNYA 2F0GA 2F0UA 2EYHA 3PMFA 1SNCA 4KY7A 4NKLA 3EJIA 1SNQA 3C1FA 2F3VA 3ITPA 3MZ5A 4DFAA 3SHLA 1KDCA 2EY1A 5EKKA 2F0TA 1STBA 1IHZA 1EY9A 3NQTA 1ENCA 4PMCA 2PZTA 5C4ZA 2NUCA 3HEJA 2HQEA 4PMBA 4R8NA 3E5SA 2EYOA 2SOBA 4ODGA 2SNMA 5EKLA 4ZUJA 4K5WA 2F0SA 3H6MA 4OL7A 4QMGA 5KEEA 4K5VA 5KYLA 4KTAA 3D6CA 1SNOA 2OF1A 2F3WA 5CV9A 4H7BA 4NP5A 1EY7A 5CC4A 1JORA 5NUCA 3LX0A 3BDCA 5IGGA 4KJNA 1NUCA 3OSOA 1F2ZA 3OWFA 3P75A 4MIUA 3MVVA 5IGEA 2F0DA 3SK8A 2EY2A 2WACA 1JOQA 1SYBA 4ID6A 1KDAA 4K2LA 1JOKA 2F0IA 3T13A 4S3SA 1F2YA 5C3XA 2F0NA 5I6WA 3U9OA 2O4XA 3QOLA 3SK4A 1EYDA 1SYDA 4N9PA 1EY5A 3NP8A 4EQNA 5CGKA 3MHBA 3OMCA 5KYIA 3TP5A 5CR3A 2F0MA 3MXPA 1STAA 3SK5A 1ENAA 5I6YA 5EGTA 5IGBA 4DU9A 1A3TA 4KJOA 2PW5A 1SYGA 4TRDA 1TQOA 4KY5A 3ERQA 5CV4A 1STNA 4ZQ3A 3TP7A 3SR1A 3VA5A 4K5XA 2LKVA 5CV5A 5JAVA 5IODA 5IOCA 2EYLA 3TP6A 3BDLA 5IGFA 5F2DA 2F0OA 2F0JA 2EXZA 3EROA 4WRDA 5C3WA 4QF4A 5KIXA 3RUZA 1EY6A 1EY8A 2EY6A 3TP8A 4DF7A 5M9OA 1A2UA 1EY0A 5J1ZA 2M00A 5IGDA 4F7XA 1SNDA 1TT2A 2F0LA 2ENBA 2F0HA 3OMGA 4RKLA 5E1FA 2PW7A 2SNSA 5KGUA 4NDXA 5C6AA 2EY5A 1A3VA 3D4DA 3SK6A 2PQEA 5E3FA 3V2TA 2RBMA 2F0KA 1SYCA
chains in the Genus database with same CATH superfamily
3UDGA 5JEAH 1XX8A 4EVOA 3F1ZA 2HHHQ 3HOVB 4PMWA 1ILPA 3GTOB 1NR4A 3B6YA 4DAMA 5M5XB 2HD3A 3GTPB 1HNXL 1XYIA 3NXWA 1RODA 5EJWA 2A19A 3H3VI 1DOKA 2A8VA 1AP0A 5C4HA 2F4VL 1SNPA 1BKBA 4PG3A 1TS5A 3FP9A 1TWCH 3HOWH 5ELNA 3KFUA 1SNCA 4KY7A 4JI2Q 1VQEA 1LT4D 1O78A 1VQOA 2F0TA 1JE4A 2FXQA 3NQTA 4PMCA 4GKJL 3PUZA 4DK1A 3HOUH 3M4OH 3ZYYX 3CCUA 1V1PB 2JQOA 3R2TA 3L7ZC 1YNNC 4HEDA 2X69A 4O1NA 2ZJQA 3NEMA 1J6QA 2KEEA 3A74A 2JA6H 5IWAQ 3S14H 2YYZA 1Q8IA 1HR0L 2CQOA 1QOHA 2A5HA 3SK8A 1HHVA 4P71A 1VQCA 4OIKA 2F0NA 4LFBL 2O4XA 5KYIA 3HOYG 2NN6I 4H0LC 1EU3A 3ONAB 3LGJA 1FNVA 4B08A 1WOCA 1RTNA 1S4ZA 4NB3A 2XWBB 3MA2B 1PH9A 5GADC 4DV7L 3VA5A 3T1YQ 2VXWA 2LKVA 4OWXB 1M4VA 4J8QA 1D5XC 1XXGA 1HTPA 4LMQD 1N34L 2UUBQ 1GUOA 2VNUD 3CRKC 1HZAA 3BVZA 2JEBI 1I4GA 1M8AA 3A7AB 5JEAG 3BZCA 1JWMD 5E3FA 4LK1C 4IOAA 2WAQE 3KLSX 1CKOA 3HOXB 3BVMA 5IP7H 2HIXA 1UE6A 1X56A 3CW2C 3DEPA 2EYJA 2KECA 3WOEA 1QUQA 2M2LA 4LF4L 1VQ5A 1I6HH 2HIVA 3S1RB 2B29A 5CV4A 3S24A 1X65A 4N9TA 4DAYA 1VMCA 4AYBE 1HR0W 4R9WA 3TN2A 4ZUIA 1HNXQ 2F0VA 2XSCA 1F9RA 5FKAC 2A69C 1XTDA 2OXPA 2B2YC 2K4KA 2R7FA 3HOWG 1UEAB 4A3FH 2F4VQ 2EYPA 4J6HA 4POGA 5KRUA 4KV6A 1IW7D 1VQPA 3FVQA 4POFA 2BE5D 1L1OA 2B2UC 2ATWA 1K8OA 2L0CA 1ZYRD 4GLVB 2JEAI 3HOUG 1PXUA 2A68C 4UP8A 3X3MA 3E9IA 1A6XA 4GKJQ 1BCPF 3HP3A 5D65A 1NMGA 5FK9C 5M5WB 4YCWA 2JA6G 5KEEA 1S40A 2XRQD 4A3IB 3VYRA 1JORA 1GVPA 3ND8A 3A54A 1ZEQX 5C44H 3PUXA 1QILA 4H44C 1HR0Q 1Q82C 4IURA 4DKAC 2NWGA 2Y0SE 2J7ZA 3FKIB 5IT9L 2BDOA 1PRTF 3Q6SA 4ZYSA 4S3SA 1TWHH 4LF8L 4KK7A 4LFBQ 4A3EH 3IKJA 1K83H 3HRZC 1V1QA 3JAML 2N55A 1V9PA 2A1AA 1VQ9A 4P73A 2R93G 4DV6L 1DONA 4QGUA 3I55A 3KLSA 4DV7Q 2EIFA 3TS0A 1LT3D 2CQAA 1H9JA 2WB1B 3SGIA 3VA7A 1K8GA 5JVH3 3RNUA 2L5TA 4KMUC 1TT2A 3P7JA 3FMCA 4HJ5A 1A3VA 3D4DA 5EBDA 1DOLA 4JI1L 1TWGH 5IYDH 2I5MX 2NVTB 4OGQC 5C0XJ 2IHFA 2PZUA 3NK9A 3S2DB 2QCPX 1FVIA 1STYA 1PLFA 4KD3A 3T16A 3HZXA 4LF4Q 4ZQ3A 3H0GB 4F8MA 4IZ8A 1AZQA 1IYUA 3AB9A 2E2HB 3U50C 5JJKA 4C1NI 2NZHA 2UUCL 3KYHC 3KF6A 4E6IA 1K0SA 3K0XA 3EN2A 4B9XA 2DY8A 2E2HH 1CT1D 4U673 4RH6A 5FOBB 3CC7A 3M4QA 4IPCA 2RQXA 2ZJRA 2F0QA 2N88A 2QF7A 3J80L 1CTMA 2MGSA 4IFDI 2UXDL 4N8X1 3CCJA 2TSSA 4YWKA 1BF4A 2X6GA 1N33L 1B7YB 4HIDA 1B9NA 5CYUA 1ENCA 2H5XA 4GZYC 2JA7B 1S5CD 4R8NA 4YCUA 3GV3A 4RFBA 1Q90A 1OTCA 3D6CA 1HFGA 2RCNA 2D5DA 4DAPA 4DR4L 2BA1A 1BBWA 2K14A 4LF5Q 3NWTA 2JA5B 3RN5A 5C3EG 1NUCA 1F2ZA 3R8BA 4A3EG 1VF5C 3N52A 3DWQA 1AE2A 1C8CA 2AHOB 1WCMH 2CWPA 2EY2A 1QVGA 4ID6A 2VQEL 4AH6A 2JA5H 2VUMB 3NP8A 2K7VA 3VDYA 3MHBA 2A69D 4JI8L 4XTCS 2CH4W 4A3BH 3LWUA 4DV6Q 1A3TA 2VUMH 4TVAB 3L0OA 2NZOA 1ET6A 3KJOA 2JA8G 5IODA 1BQQT 1WJJA 3S1QH 1A2UA 1PFNA 1NY4A 5D3DA 5GAGC 3DEOA 4NDXA 3SK6A 2MQHA 1H9MA 5EKIA 3RR5A 2F0KA 5FJ8H 1D5MC 4JBWA 5ISRA 3URYA 1RHPA 5AJ3L 2XIWA 4QUFA 2DY7A 1JJ2A 1ESFA 1SMXA 4G57A 1PH6A 2SEBD 4C3IB 4GS3A 4HCEA 1G291 2EXDA 3ER0A 5JEAJ 3BYTB 1LTAD 5DEHA 1HNZL 3H94A 3J7AV 2DNEA 2OTLA 3DWPA 5ELCA 2EJGC 2KCTA 3CRLC 2UUCQ 4ZRZA 4LF6L 4LFCQ 2QW7A 4A3GH 1R9TH 3A56A 4OONA 4TKOB 4WORA 2ZTDA 3T56B 5CORA 4BBSG 1HQMC 1EOVA 1LTBD 3MXNB 1EOTA 1SAPA 2VW9A 2H4OA 1BO0A 2ICIA 4JC0A 1B4OA 2D0OA 2EYHA 2ZM6L 2Z6KC 1GUSA 4KI0A 1Z7TA 2B2VC 1SNQA 5E4WC 4X64Q 1GOZA 1N33Q 1QE6A 3S1MH 2B2TC 3CCSA 4HCSA 4HAEA 1SBBB 5C4ZA 1PH5A 2QILA 2CFMA 3CP0A 3E5SA 3C46A 5FO9B 1G8ZD 4XT3B 4IUUA 1Q1BA 1EY7A 2L12A 4K0KL 1WCMG 3GTJB 3KJPA 3TREA 3I2ZA 1RL2A 4BXXH 2O2LD 4GOPB 1I50B 4UY8C 5M3MH 1VQFA 4N8FA 1JOQA 2NTSA 1KDAA 2WINB 1CM9A 2WKCA 3QJYA 4C3HB 2F4IA 4IQZA 3PO2H 3OMCA 1D6EC 1I50H 4JI8Q 5TSSA 3RLNA 4CKBA 5EQ0A 3K0YA 2K05A 1YZ6A 3V05A 4B3MQ 3CF5A 2EOTA 4A3CH 4CJ1B 2WIIB 5FO8B 4RGOS 4ZCKA 1WTVA 4KY5A 3J81L 4G7ZC 1STNA 1CFMA 3I90A 1VMPA 2B2UA 1UEBA 4R4TA 5CV5A 5JAVA 1GUNA 3KLRA 3H91A 3QG1A 3NENA 3HOZG 3S1NB 1SRUA 2IW3A 1EEFD 3CPWA 1LT6D 2EXZA 5KIXA 1K8MA 4F7XA 4A3LG 5C6AA 3CXCA 4DV4L 2K52A 3M4YA 1SSOA 1XNQQ 1DYQA 1Z9FA 4YY3Q 1IBKQ 1W6JA 3MEFA 2K75A 4FF1A 5AJ3Q 3VR6A 1IL8A 4A3MB 4BY1H 1I4XA 1V1OA 1QG7A 2B8FA 4ME5A 4X3KA 4DV0L 1PZJD 4KHVA 2RCFA 3UDFA 1Z47A 5FLXL 2VS1A 2K5DA 2IPKD 2EYFA 4A3GG 4JPBW 4BY7G 1HNZQ 3GD7A 1FL0A 4K8JA 1F2MA 1STHA 2PMZB 4LF6Q 5EPLA 5HURA 3J7ZC 1WD0A 3NPPA 2WAQG 3EBEA 3UE1A 3I4MG 3MEHA 1N36Q 3D4WA 2EE1A 2B63H 1CI3M 3OOCA 1SJHD 1PYBA 2EVBA 3VR3A 3MTSA 2ZM6Q 2IX1A 2F3VA 1NCVA 2L55A 3SHLA 1D8LA 2EY1A 2AUKA 1Y1VH 3JC66 2FINB 1I3QB 4ZAIA 2SNMA 2TMPA 1OXTA 3H6MA 3BVGA 3G48A 1MD2D 1MI2A 2MJ8A 3QIAA 2K5QA 4NP5A 4HJAA 4M1UB 4K0KQ 1PTOB 3CHBD 2E2DC 4F88A 4EQ5A 3UDIA 4LUVA 2JA9A 1VQBA 5T1GA 4JI2L 3T13A 1F2YA 3VYSA 4X3TA 2Q2UA 1TXYA 2M9VA 2NB0A 1JWSD 4BS9A 2K32A 1EEID 3E0EA 5IGBA 1FD7D 3X3NA 3K57A 4DUYQ 3G6EA 2IX0A 1CZWA 3A5ZB 4K5XA 2GVAA 2I46A 1I6VC 3K59A 3TP6A 1JJCB 2RSNA 4KHZA 3OHXC 2R6GA 3EROA 3F2DA 4Y7NH 2F0HA 2L1BA 3BZDB 3ZJYC 4DR7Q 1VQ6A 1KDBA 4C3JH 1ZXTA 4I7ZC 2E76C 1KABA 2CHBD 1EIHA 3PO3H 2RDGA 3SVMA 2A74C 1WTPA 1SYFA 5M3FG 1TWFB 4HN7A 4LUOA 3A7LA 4MNOA 3WDNA 4DV0Q 1PVOA 2DN8A 1Q86C 1KNEA 2UUBL 1VQGA 2B3GA 4QB4A 5CV7A 4HJ9A 1LUZA 4RGMA 3HOYB 2B8GA 4HJ7A 4FXGC 3KK7A 1CKNA 1LYLA 4A3KH 4AQYL 1LTGD 4WJ4A 2KQ3A 2YTYA 2JYOA 4GN4B 4JG2A 3NSWA 3H3VC 2MO1A 5H1SE 2RF4A 4PNYA 1HUMA 3PMFA 3HKSA 1U5KA 2QKIC 1SR3A 4X6AH 4C2MB 4XQJA 3TEHB 1VQLA 1SEBD 2A6HC 1BUVT 3RLOA 3PIPA 5JVG3 1RD9D 2PZTA 3HOVH 1EWCA 2MPMA 1X3EA 2UXBL 3KBGA 4Y52H 2K03A 3GTOH 3ULPA 4K5VA 5M5XH 3GTPH 1V8QA 1HA5A 3FPPA 4KJNA 1MSHA 2E74C 1LO5D 4CHTB 2AKWB 4HSVA 2PQAA 4N9PA 4UPAA 2Z1CA 2KUMA 4AIMA 3NWSA 4IUQA 4RCNA 2CVRA 1VF7A 2LY7A 1S72A 2R7ZG 3OYYA 1NNXA 4UAIA 1UE5A 1FR3A 4NXML 1BBXC 4JI7L 4GNXA 1C48A 1YHBA 1AN8A 3D3RA 2B2VA 4CDEC 1HZBA 1LTSD 5HY6A 3SEBA 4QF4A 3AFQA 2D62A 3TP8A 5M9OA 4HSPA 5IGDA 1UWVA 4X65Q 3CKIB 5KGUA 4C3JG 1AH9A 1HPCA 3HG9A 4JOIC 1Y1WG 4FYDA 2N8NA 1C9OA 3W2DA 3V2TA 3PO3G 2NVQB 1SYCA 3RZDB 1K9MC 5IP9H 2E75C 3UE0A 1CQFA 1WYDA 1AEXA 3H15A 1W3SA 1WFQA 2B2WA 3BJUA 2DGYA 4M8AA 1VQ4A 2OCEA 2NZ1D 1O7IA 3I4NG 4A3KG 3QR8A 3PF5A 1FGBD 3M7NA 2VZAA 3MAQA 1SYEA 3CQZB 4CDFC 2KCMA 2Z4IA 3P1HA 5M5YB 4Q0FA 2R93B 5EBCA 2MFIA 3R2IA 1A62A 1E7ZA 4LUZA 1IKLA 4AQYQ 4APVA 4HMJA 2D9UA 2XTIA 3FHWA 2L4NA 3CQZH 1W2BA 1H9SA 3MWYW 4WJ3M 1MSGA 4FNFA 4A76A 1RJTA 1T9HA 3I70A 2WP8J 4A93B 1JB7A 3K7UC 2KEDA 4JK1C 3HOXH 4PZ7A 4QIWB 3HOVG 4G7OC 2A6EC 5D14A 3PF4A 4RGNA 4A3JB 3L3OC 4OX9L 2IWHA 4DPGA 1ILQA 1EY9A 5HGQA 1IYJB 2UXBQ 4ODGA 3S1RH 2SOBA 1GHJA 1Q12A 4FP5D 3I4LA 1FJGL 1PZID 1Y8OB 3G71A 3V96A 5LL6X 4DR3L 1H9KA 3NBHA 1XPUA 4XQNA 5ELOA 1SFOB 1W6KA 1SMYC 5CBAE 2GN5A 3ND9A 2ZXPA 1F77A 4DV5L 2JJQA 2K1BA 5CGKA 3CC2A 3ICEA 3GTMB 4DA2A 5LL6S 4GLAC 3CCRA 5IYCH 1BNZA 2Q8RE 4KJOA 1MIUA 1YVCA 4TRDA 4NXMQ 4UDUC 3AEVA 5C4XB 4JI7Q 1I4HA 2R92B 1E2WA 1VQHA 5C0XI 4LF5L 5M5WH 1E3PA 2ID0A 1JWUD 4A3IH 4DNTB 2A6HD 4P74A 1C4QA 3J80E 5DM63 4HR7B 5IP9G 1H9SB 1TY2A 1WTHA 2DNCA 3T53B 3KF8A 4Q5VA 1ICWA 3A5UA 3FKIH 1QUQB 2D2CC 1U9RA 3IFDA 2ZTEA 2E2IB 1KNAA 5C3EB 2Z8LA 4DAYB 5BN4A 4QCLA 3TBIB 1FYCA 2F03A 1YIJA 2E2JB 5IYBH 2IL8A 4RG1A 3PSIA 1JC7A 1DZ1A 2AQ3B 3AU7A 2EDGA 5IP7G 1LLRD 3BG3A 3W3AA 1YNND 2FMMA 4KD4A 1LABA 2L9HA 4K14A 1KD1C 1E1TA 1L1OB 2LXJA 3HOXG 5K36H 2CW0C 2JA8B 4K8IA 4CKEA 4DK6C 3KDFA 3DM3A 2PZWA 2RVLA 4R4CA 1L0XB 4X3SA 3Q0AA 2NVTH 1FNWA 4NKLA 2RA4A 3S16B 3MFYA 3C1FA 5CMDA 3S2DH 4OX9Q 2FMCA 1IHZA 4A3FG 3CAMA 1T5EA 4PMBA 4OO1H 1Q1EA 5EKLA 2ZJPA 3H0GH 4L63B 4LJZC 3GTQB 4LFCL 1FJGQ 2KHJA 4C56C 3M4PA 1G6PA 3GTGB 3CPFA 4DR3Q 1CZGA 2H1EA 1HFNA 1KXLA 4BBRB 3P75A 3MVVA 5GROA 1B9MA 1SDFA 1B8AA 2KJXA 1X32A 1SYBA 3TS2A 2Q8TA 4DV5Q 2RDHA 1OXXK 4V190 4QQBX 5IYCG 4X64L 5JJIA 1T5XD 4HJ8A 4FVMA 2XVSA 4O0AA 1ZKOA 4JBKA 1NAPA 1IBML 5C44G 3MFGA 1KLGD 4BBSB 4QY7A 2O5IC 1TQOA 4P75A 3ULLA 4PQXA 4A3IG 3TP7A 2JA7H 3GTLB 3VR4A 5IGFA 3T1HL 3NELA 4OWWB 5I4DA 2F3IA 3I4OA 1EY6A 1GD7A 3FKIG 1EY0A 4DAVA 1VQ7A 3QWNA 3K5LA 2PW7A 2MUYA 1IZ6A 2Q8IB 1KQSA 4B3ML 3CCQA 2K01A 3S15B 4UP9A 4LF7L 5IYBG 3HKZE 2ZT9C 1GKHA 1LTRD 1SMYD 1FNUA 2F0EA 4ULLA 2WKDA 3GO5A 5BN3A 3S15H 3S17B 1EWIA 1SE4A 2A68D 3RZOB 3QB3A 3D0FA 3KF6B 5CV8A 4K2KA 5IYDG 3S17H 4R4QA 1EZ6A 4R4IA 1EQTA 1N32Q 2R3ZA 1XNQL 3GTKB 2C9OA 4YY3L 1IBKL 5A2QL 3H3VH 2EQSA 5FLMH 1B3AA 3HOZB 3QO2A 1RKNA 1ML0D 2QDBA 3PCOB 3J81E 2BH2A 1A15A 2GA4B 5D3IB 3M3YB 1TS2A 1M90C 1X3FA 4JOIA 3MZ5A 1VQAA 5BN5A 1MJCA 1EIGA 1G2TA 2Z9HA 1LTLA 5I2YA 4C3IH 4K6LA 2HQEA 1UNSA 3DXJC 3Q24A 1N36L 3CC4A 5NUCA 5KNCA 4LWCA 5IGGA 5LMNW 4PV1C 3I56A 3JAMi 1SE3A 4BY7B 1YI2A 4R4OA 4V0BA 5ELFA 4DNIA 2DJGC 1HA6A 1EY5A 2K33A 3K6OA 3TQYA 4L5SA 1UE1A 5DLQE 1K3BC 4L5RC 2XNAC 1IBMQ 4DK3C 2JA7G 3OWEB 1F9PA 2WAQB 2CW0D 3CMAA 2FHTA 1QB5D 2NN6H 4QL5A 4DR5L 4BA2I 4JI3Q 3S2HB 3PUWA 3NQIA 3CCEA 2I5HA 1OXVA 2JA5G 1G6ZA 2QGQA 1Q7YC 1BVSA 3T1HQ 4UP7A 1C0AA 3RUZA 3I72A 2LMCB 3GTJH 3WOFA 2AMCB 4AYBB 4A3BG 2DJFC 3I73A 4RHSA 1XWEA 4I7AA 2VUMG 3OIPA 1EIYB 4XIGS 2B2YA 5LMNQ 1Y69U 4A3DB 1N9WA 4QJFA 4LF7Q 4C3HH 4DUYL 3ERSX 5I9OA 3CD6A 1J5EQ 1B2TA 5K5PA 4IALA 4OHJA 5LHY1 3A55A 1AFPA 3LNNA 1KL9A 4DK0A 2F0WA 1PFMA 2EYMA 1JOOA 3FEWX 1ENFA 2XGTA 5FJ8G 1ESRA 3S1NH 4JVZA 2IJ0A 3AFPA 1KC8C 3T51B 5FLMG 3H09A 4DXFA 2Q2IA 4DR7L 2PI2E 4DV1L 2HDLA 3J80i 2KHSA 2ZXOA 1RDPD 2LXKA 2ASBA 1YJWA 1BDOA 3K80C 1ICFB 1IXRA 3K5OA 2O5JC 4FDBA 3EA6A 2Y0SB 2ICEC 3GV6A 4C3IG 4IUPA 5C4JB 3I7FA 3ITPA 3A8KE 1A8VA 4JV5L 4A3MH 1EQRA 3MC0B 1I5FA 4JI0Q 2FJ2A 5DM73 1VQKA 4OWTB 1KRTA 1CK1A 2JP1A 1PHJA 2LSSA 3PIO3 2EJMA 3FRPB 4XXEA 1YJ9A 2PNHA 4UHVA 2RHQB 3DM1A 1PH2A 1IBLL 4MIUA 1WI5A 2NVXB 1SN8A 2I07B 1L1OC 5C3XA 5I6WA 3SK4A 5E4XA 1PFBA 2NN6G 1HUNA 1K73C 1JE5A 2ES2A 4ABNA 1GUWA 1ENAA 2KVMA 1NR2A 4XYOA 4BXXG 1MBYA 2VB2X 3ERQA 1F9SA 4DR5Q 5M3MG 1I3QH 1DD2A 1TY0A 1D2BA 2PNRC 2DUDA 3U9SA 1YJNA 1AZPA 2YU9B 3BS1A 1YBYA 3PO2G 3GP7A 2JE6I 1EY8A 2Q2HA 1U4PA 1VQ8A 2M00A 1PTOH 1SNDA 1TKWB 2ENBA 4A3CG 4ALPA 3RD4A 2RBMA 4A4IA 1V43A 1NBWA 5T1IA 4WJWA 1Q81C 5JOBA 3Q23A 4X66L 4KKUA 1WTXA 3QOJA 4P72A 1Y8PB 2OT2A 2WB1E 1A2TA 1VQJA 1RF2D 3BU2A 4TSSA 4U68A 1KAAA 2N49A 1BXTA 3NBIA 4X65L 2R7ZB 5ELEA 1PV4A 3O13A 1EIFA 1QJOA 3K5NA 4DV1Q 4BY1G 4IJLA 5DAUA 4B9WA 4EQOA 4HTHA 2KOLA 1HZCA 1GUTA 3DMUA 2D0PA 2HUGA 2I5LX 1K0RA 5AFWA 1PYWD 4EGVA 5LMUL 1JB3A 2L15A 3NTIA 1BBUA 1Y1WB 4JV5Q 4IFDH 3P20A 1JJGA 1TWFH 3CU7A 4L6TB 1RCVD 3BYYB 1CSPA 2X6LA 4DR6Q 4ZUJA 2B63G 1GUGA 4ME3A 5KYLA 3HOYH 1XNRL 4H02A 2K5NA 1M1KC 1KLUD 1V1PA 4IPHA 2HCIA 2NVYB 1TWAB 1DM0B 4JYAL 3C3LA 1IBLQ 1U4RA 1I4RA 5GAEC 1VQMA 3I4NB 1RIPA 1YEZA 4MN3A 1Y1VG 1ZYRC 2F0IA 1ASZA 1P16A 4RWSC 3J81i 1QWYA 4CJ2C 1JR0D 5IT9c 1I4PA 1QCBD 2AUJD 5BR8L 4C2MH 4C1NK 3CMEA 1WVLA 3DLLA 2E5LL 3HGBA 2XRSD 1NJIC 3JAMc 1TU2B 3BDLA 3GDEA 1K3RA 1HNWL 4LF9Q 1BCPB 4G4KA 2C35B 2EY6A 3G7LA 1KAWA 3STBC 1EL0A 2F52A 2PQEA 4YHHQ 1EQQA 1TWCB 1HTLD 1D1KA 2F0FA 3HOWB 1PH3A 4IUVA 1HRJA 5IGCA 2G9HD 1PRTB 2PI2A 2Z6KA 4R1JA 1EZ8A 5ELBA 1TIID 4X66Q 1GM5A 4JI5L 1ASYA 3KUPA 1CKNB 3HOUB 3M4OB 1X3QA 3S9WA 4LFAL 1NTGA 2B2TA 1PTOF 4LW1A 1F9QA 1QVCA 4DGZA 4J1MA 3NE5B 3SXHA 2JA6B 5JJLA 2OQKA 3S14B 4GOPC 3DHQA 4YIJA 1XMQL 4L5QA 3OTOL 5KNBA 5J39A 5DNFA 1GO3E 3HKZG 1B70B 1QVFA 2NVQH 1CHQD 4WFN3 3RZDH 4IFDG 3W5OA 4DR1Q 3EJIA 5LMUQ 3VR5A 4ZKCB 3HFZB 1KDCA 4JI6Q 1STBA 3J80c 2QA4A 5IT9E 2OTJA 2MP1A 4K5WA 4QMGA 4HIOA 4KTAA 1SNOA 2KCCA 3A0JA 3JAME 1XNRQ 4B3SL 4H7BA 1EUJA 5M5YH 1JICA 2R93H 2KCNA 3LX0A 2UU9L 2PQAB 2BH8A 1CHPD 4JYAQ 1H9RA 4NXNQ 4FXKC 1YHAA 1LTTD 4KLKA 4DNRB 2WACA 4B3TQ 5JJZA 1SE2A 4KHPL 3TZDA 1PH7A 1XJVA 2EPBA 2WV6D 1C7YA 4FF4A 4A93H 4GNXB 4B3RQ 1PDQA 5I6YA 1S5FD 5EGTA 3J7AF 5BR8Q 2BA0A 4DU9A 4A3JH 1A63A 2E5LQ 1I6HB 2PO4A 3N6RA 1B53A 4CKCA 1X3GA 4Z9CB 3SR1A 1IYVA 2YTVA 3J7A5 1PMRA 2F0JA 2IX3A 1HNWQ 3NTKA 3F2CA 2N78A 2AQ1B 1J8IA 4A3FB 1G51A 4RKLA 4DN4M 2BDNA 2BCOA 1SFOH 3Q8DA 1X55A 2L11A 1E24A 1CSQA 3IL8A 3NHHA 3DWAA 2GVBA 4DV2L 2KBNA 2NBFA 4KKSA 2VL6A 1HQRD 2ZXRA 3I8ZA 3GTMH 1O80A 1XPOA 4OXPA 4HMIA 1LT5D 1OO9B 2J0TD 5L37A 4IO9A 5CV6A 4JI5Q 5C4XH 1TS3A 4LFAQ 3UI2A 4RCOA 1F2LA 1U0LA 2R92H 1DGSA 3VYUA 4JBJA 2ZTCA 1PTOC 1L2FA 2IT1A 4IOCA 1DCZA 3OW7A 5C44B 1IL2A 5JPMC 4X3UA 4IUNA 1TR5A 4RA8A 1XMQQ 3OTOQ 2LFNA 1TWHB 3E9HA 3NUCA 4RKBA 4A3EB 1K83B 1EQVA 4KY6A 2CKZB 1SLJA 2F0GA 2K6AA 4O2DA 1VQDA 3E0JA 3EIVA 4ZKBB 2E2IH 1K8AC 1WD1A 1S5ED 1CKMA 1R4PB 5C3EH 3STBD 3CCLA 2XWJB 2KA7A 2K5WA 4DFAA 1A0IA 4JI4L 2E2JH 2NUCA 3HEJA 4KN4C 3NBHB 4KKTA 4DR2L 2VQFL 2F0SA 1N32L 4OIJA 2PMZE 1KHIA 1PH1A 4B3SQ 5CC4A 2E8GA 3T4AC 2UU9Q 2FFKB 2Q2TA 3RMHA 1N34Q 4A93G 2AWOA 4MHEA 4CDCC 1TWGB 2JA8H 2MNAA 4KHPQ 4L5TA 4O42A 3VYTA 2RHSB 3MXUA 1EYDA 4P2CB 1NE3A 3A8JE 4EQNA 4A3JG 2LS01 3EFXD 1CA6A 2K5HA 4NPSA 3S16H 2F0MA 1KTKA 2RSOA 1LACA 3BZKA 2R61A 4TQUS 3AMUA 3C2PA 2Z4HA 1X54A 1GXDC 1QNKA 3MXGA 2UXCL 5EPJA 2KENA 2V1CC 5A2QE 3GTQH 3DUZA 2F0OA 3KF8B 4PZ6A 5A35A 1O7ZA 3J81c 3GTGH 5GAHC 1D7QA 5IIFA 2F0LA 1PZKD 2JN4A 4XDXA 4BBRH 5KNDA 1LM0A 4GLXA 1PFSA 4DXGA 3F8TA 5IE8A 3I3CA 1E0BA 2YV5A 1YNJC 4XT1B 1NMFA 1EYGA 1B3QA 5ELDA 1DOMA 2V4DA 4DV2Q 1E2VA 2F0PA 1STGA 1D5ZC 5C4XG 4JI3L 2R92G 1CA5A 5I9PA 2JXMB 4YWMA 2A73B 4BBSH 2A6ED 3RLFA 5J22A 4IUTA 4MZ9A 3UDXA 4LNQA 4EQPA 3GTLH 1K28A 2N3SA 4RHRA 1YNXA 1Y8NB 1U4LA 1IKMA 5G3LF 1E1OA 3KDFB 4NMZA 1SJED 2RDFA 1BCPC 3NTHA 3F2UA 4GN5A 5FLXc 5LMNL 1WCMB 1B44D 1SNMA 1B1ZA 1EFWA 3FPUB 1J5EL 4JBMA 4XQQA 2EZVA 4BA1I 3M9BA 4A3BB 1HXYD 3W1BA 5I2XA 3MXNA 1XMOL 2WB1G 2MO0A 4HIMA 4LF8Q 2HT1A 1PRTC 4A75A 4JI4Q 3KBXA 3SDZA 5K36G 1I94L 1J9OA 3RZOH 1WTRA 3K8AA 3KLWA 3PUYA 4IPGA 2VQFQ 4DR2Q 3I91A 2KHIA 3OW2A 1PH4A 2F3WA 1L0YB 3S1QB 4IFDJ 1HJPA 3BDOA 1Q8KA 2XN9C 4IJHA 2OQ0A 2NTTA 3GTKH 2F0DA 2YTXA 3HOZH 1PTOD 4OO1G 2BOSA 1DJRD 3QOLA 3H0GG 4GOPA 2PCFB 4JI0L 1BOSA 3M3YH 4JI1Q 4ILWA 3MXPA 3KOJA 1ET9A 3SK5A 1Y14B 2K04A 1Q3LA 1SROA 4A3LH 1PA6A 4DUZL 2CH4A 4MTKA 1JMCA 4CGYB 2UXCQ 3Q22A 5IOCA 4FF2A 3IFTA 1VDZA 5CBEE 1VQNA 4BBRG 2ALYB 3WWVA 3J81j 4A3GB 2AWNA 4KN7C 4OELB 1R9TB 3K5MA 2P5ZX 3L9AX 3OMGA 5JPNC 1X9NA 2Z6BA 1I4QA 4BWGB 5IY0A 1L0WA 5FLXE 5C3WA 2QEJC 2IY5B 4BY7H 4ZLTF 1LV9A 3I4MB 2K50A 4I65A 5COYA 1XPRA 1O7YA 3G4SA 4GNXC 1G91A 3S1MB 4IPDA 2RKSA 3I4MH 4RAUC 4DV3L 2UXDQ 4CBVA 1U4MA 1EWHA 4RGTA 2PYKA 1EY4A 4L8JA 3S2HH 1XTCD 3IAYA 1WTOA 1AE3A 1RTOA 1LTID 3D4RA 2UUAL 4K6DA 5C5LA 1TS4A 5M3MB 1N8RC 1B50A 5FO7B 4DR4Q 1CUKA 2VY3A 1FGUA 3TSSA 3TZUA 2EJFC 2OWOA 1II3A 2B2WC 3PO2B 1HZ9A 2F0UA 1S3OA 3U58A 1H95A 4A3DH 1R4QB 2VQEQ 1AW7A 1KIXA 1JQYD 1QNUA 2IHEA 1XMOQ 5EKKA 2QEXA 4GKKL 1STEA 1YNJD 3K81C 3HS0C 1HCZA 4F87A 1VCIA 1I94Q 2EYOA 4OL7A 4X62L 3G6JB 4OEMB 2OF1A 3VR2A 2K5VA 3D6WA 1GHKA 3GQBA 1VQIA 1YHQA 1O7LA 3BDCA 1CQVA 3OSOA 1PH8A 2HDMA 5IGEA 1MJEA 3TDQA 3PGZA 4QIWE 4K2LA 1JOKA 3U9OA 1Z6HA 1E2ZA 4G7HC 2QDLA 1WTQA 1BCPD 3TP5A 5CR3A 4BY1B 1STAA 4DR6L 3M7GA 1WTWA 5C4JH 1PYSB 1OXUA 5EPKA 4EX5A 2PW5A 2NYZD 4YCVA 3SE0A 4DUZQ 2CCZA 2AQ2B 5M3FB 2B39A 2PPBC 3K7AB 1UE7A 3LWEA 5F2DA 2G5DA 1UAPA 3D31A 4PZ8A 5J3BA 4R8IA 1PRTD 5C0XH 1QZHA 4DF7A 4ZK9B 4CJ0B 5M3FH 3K7AH 5E1FA 1DXMA 3E3XA 4XYQA 2EY5A 3TRZA 2NVXH 2B63B 3E6ZX 1X3PA 5C5MA 4GN3B 3K58A 1MHWC 4IN3A 1HH2P 2OEOA 3D8GA 4QUCA 4FF3A 3PV0A 1G2SA 1Y1VB 5EAYA 2HHHL 1OXSC 4DV3Q 2G9DA 2JK8A 1JCKB 4LAAA 4LF9L 3R3OA 3EVQA 1EYAA 1D1IA 1ONLA 1A3UA 3AQQA 4AYBG 4RMFA 1EYCA 4YWLA 2YU9H 1UUPA 1X6OA 3C1EA 2WFWA 4C3HG 3M85A 3U4VA 3OIQA 2SDFA 4YHHL 5E7NA 3PQIA 5HGTA 4HIKA 2UUAQ 1EU4A 3PIOA 3OPOA 3TMEA 1KRSA 2J4XA 4A3DG 3CCVA 2F1MA 4JW0A 1NSNS 3EQLC 3ULJA 4OO1I 1VS0A 3W1GA 2CWAA 2K28A 4GKKQ 2JSOA 2HQLA 4FO2A 1P8LA 1EFID 4X62Q 3IRBA 5CV9A 2R7ZH 1SE8A 5IWAL 4Y7NB 1JT8A 4JCVE 3OWFA 4A3MG 2I0QA 3PUVA 4DR1L 2Y0SG 1MKHA 1TVXA 1MGSA 2MHVA 1SXTA 1BR9A 4C3JB 3RN2A 1YITA 3FDTA 1Q46A 1SYDA 4FXDA 4CDDC 2Z0SA 4JI6L 4DV4Q 3PO3B 5G3LD 4MTNA 3PIP3 4J15A 1QZGA 2HCCA 3A8IE 3AYHB 1Y1WH 1E22A 3L2PA 1SYGA 3CCMA 3HKZB 5C0XG 3T1YL 1S5DD 2EYLA 3U4ZA 4NW2A 4NXNL 4WRDA 1IW7C 4A3KB 1S5BD 4B3TL 2BE5C 2VB3X 3J7YW 5J1ZA 3R93A 2NVYH 1TWAH 2SNSA 2C5CA 4H13C 3I4NH 2R7DA 3F2BA 1GJXA 5GQOA 4B3RL
chains in the Genus database with same CATH topology
5JEAH 1XX8A 4EVOA 3HOVB 4PMWA 1ILPA 3GTOB 1NR4A 5M5XB 3GTPB 1XYIA 3NXWA 1RODA 5EJWA 1DOKA 1AP0A 5C4HA 1SNPA 1TS5A 1SNCA 4KY7A 1LT4D 1O78A 2F0TA 1JE4A 3NQTA 4PMCA 3PUZA 4DK1A 3ZYYX 1V1PB 3R2TA 3L7ZC 1YNNC 4HEDA 2X69A 4O1NA 2KEEA 2YYZA 1Q8IA 1QOHA 2A5HA 3SK8A 1HHVA 4OIKA 2F0NA 2O4XA 5KYIA 2NN6I 4H0LC 1EU3A 3ONAB 1FNVA 4B08A 1RTNA 1S4ZA 2XWBB 3MA2B 3VA5A 2VXWA 2LKVA 1M4VA 4J8QA 1D5XC 1XXGA 1HTPA 4LMQD 1GUOA 2VNUD 3CRKC 3BVZA 2JEBI 1I4GA 1M8AA 3A7AB 5JEAG 1JWMD 5E3FA 4LK1C 3KLSX 3HOXB 3BVMA 3DEPA 2EYJA 2KECA 3WOEA 2M2LA 3S1RB 5CV4A 4N9TA 4DAYA 1VMCA 4R9WA 3TN2A 4ZUIA 2F0VA 2XSCA 1F9RA 5FKAC 2A69C 2OXPA 2B2YC 1UEAB 2EYPA 4J6HA 5KRUA 4KV6A 1IW7D 3FVQA 2BE5D 2B2UC 1K8OA 2L0CA 1ZYRD 2JEAI 1PXUA 2A68C 3X3MA 1A6XA 1BCPF 3HP3A 5D65A 5FK9C 5M5WB 5KEEA 2XRQD 4A3IB 3VYRA 1JORA 3ND8A 3A54A 1ZEQX 3PUXA 1QILA 4H44C 4IURA 2NWGA 2J7ZA 3FKIB 5IT9L 2BDOA 1PRTF 3Q6SA 4ZYSA 4S3SA 4KK7A 3IKJA 3HRZC 3JAML 2N55A 1DONA 3KLSA 1LT3D 2CQAA 1H9JA 2WB1B 3VA7A 5JVH3 2L5TA 4KMUC 1TT2A 3P7JA 3FMCA 1A3VA 3D4DA 5EBDA 1DOLA 2NVTB 4OGQC 5C0XJ 2PZUA 3NK9A 3S2DB 2QCPX 4KD3A 1STYA 1PLFA 3T16A 3HZXA 4ZQ3A 3H0GB 4F8MA 4IZ8A 1AZQA 1IYUA 3AB9A 2E2HB 4C1NI 4E6IA 4B9XA 2DY8A 1CT1D 4U673 4RH6A 5FOBB 2RQXA 2F0QA 2N88A 2QF7A 3J80L 1CTMA 2MGSA 4IFDI 2TSSA 1BF4A 2X6GA 1B9NA 5CYUA 1ENCA 4GZYC 2JA7B 1S5CD 4R8NA 3GV3A 4RFBA 1Q90A 3D6CA 1HFGA 2D5DA 4DAPA 2BA1A 3NWTA 2JA5B 1NUCA 1F2ZA 3R8BA 1VF5C 3N52A 3DWQA 1C8CA 2EY2A 4ID6A 2VUMB 3NP8A 2K7VA 3MHBA 2A69D 4XTCS 3LWUA 1A3TA 1ET6A 5IODA 1BQQT 1A2UA 1PFNA 5D3DA 3DEOA 4NDXA 3SK6A 1H9MA 5EKIA 2F0KA 1D5MC 4JBWA 5ISRA 3URYA 1RHPA 2XIWA 4QUFA 2DY7A 1ESFA 4G57A 2SEBD 4C3IB 4HCEA 1G291 5JEAJ 3BYTB 1LTAD 5DEHA 3H94A 3J7AV 2DNEA 3DWPA 5ELCA 2EJGC 3CRLC 4ZRZA 3A56A 4WORA 4TKOB 3T56B 5CORA 1HQMC 1LTBD 1EOTA 1SAPA 2H4OA 1BO0A 2ICIA 1B4OA 2EYHA 1GUSA 4KI0A 1Z7TA 2B2VC 1SNQA 5E4WC 1GOZA 1QE6A 2B2TC 4HCSA 4HAEA 1SBBB 5C4ZA 2QILA 3E5SA 3C46A 5FO9B 1G8ZD 4XT3B 4IUUA 1Q1BA 1EY7A 2L12A 3GTJB 2O2LD 1I50B 1JOQA 2NTSA 1KDAA 2WINB 1CM9A 2WKCA 3QJYA 4C3HB 2F4IA 4IQZA 3OMCA 1D6EC 5TSSA 4CKBA 5EQ0A 3K0YA 2K05A 3V05A 2EOTA 4CJ1B 2WIIB 5FO8B 4RGOS 1WTVA 4KY5A 3J81L 4G7ZC 1STNA 1CFMA 3I90A 1VMPA 2B2UA 5CV5A 5JAVA 1GUNA 3KLRA 3H91A 3QG1A 3S1NB 2IW3A 1EEFD 1LT6D 2EXZA 5KIXA 1K8MA 4F7XA 5C6AA 3M4YA 1SSOA 1DYQA 1W6JA 4FF1A 3VR6A 1IL8A 4A3MB 1I4XA 1V1OA 1QG7A 2B8FA 4ME5A 4X3KA 1PZJD 4KHVA 1Z47A 5FLXL 2K5DA 2IPKD 2EYFA 3GD7A 4K8JA 1F2MA 1STHA 2PMZB 5EPLA 5HURA 1WD0A 3NPPA 3MEHA 3D4WA 2EE1A 1CI3M 3OOCA 1SJHD 2EVBA 3VR3A 3MTSA 2IX1A 2F3VA 1NCVA 2L55A 3SHLA 2EY1A 2AUKA 2FINB 1I3QB 4ZAIA 2SNMA 2TMPA 1OXTA 3H6MA 3BVGA 1MD2D 1MI2A 2MJ8A 3QIAA 2K5QA 4NP5A 4M1UB 1PTOB 3CHBD 2E2DC 4F88A 5T1GA 3T13A 1F2YA 3VYSA 4X3TA 2M9VA 2NB0A 1JWSD 4BS9A 2K32A 1EEID 5IGBA 1FD7D 3X3NA 3K57A 2IX0A 1CZWA 4K5XA 2I46A 1I6VC 3K59A 3TP6A 2RSNA 4KHZA 3OHXC 2R6GA 3EROA 2F0HA 2L1BA 3BZDB 1KDBA 1ZXTA 4I7ZC 2E76C 1KABA 2CHBD 1EIHA 2RDGA 3SVMA 2A74C 1WTPA 1SYFA 1TWFB 4HN7A 3WDNA 3A7LA 2DN8A 1KNEA 5CV7A 4QB4A 4RGMA 3HOYB 2B8GA 4FXGC 3KK7A 1LTGD 2KQ3A 2JYOA 3NSWA 3H3VC 4PNYA 1HUMA 3PMFA 2QKIC 4C2MB 4XQJA 1SEBD 2A6HC 1BUVT 5JVG3 1RD9D 2PZTA 1EWCA 2MPMA 3KBGA 2K03A 4K5VA 1V8QA 1HA5A 3FPPA 4KJNA 1MSHA 2E74C 1LO5D 4CHTB 4HSVA 4N9PA 2Z1CA 2KUMA 3NWSA 4IUQA 4RCNA 2CVRA 1VF7A 2LY7A 4UAIA 1FR3A 1BBXC 1C48A 1AN8A 3D3RA 2B2VA 1LTSD 3SEBA 4QF4A 2D62A 3TP8A 5M9OA 4HSPA 5IGDA 3CKIB 5KGUA 4C3JG 1HPCA 3HG9A 4FYDA 3W2DA 3V2TA 2NVQB 1SYCA 3RZDB 2E75C 1CQFA 1AEXA 2B2WA 4M8AA 2NZ1D 1FGBD 3M7NA 3MAQA 1SYEA 3CQZB 2Z4IA 3P1HA 5M5YB 4Q0FA 2R93B 5EBCA 3R2IA 1IKLA 4HMJA 2D9UA 2L4NA 1H9SA 3MWYW 1MSGA 4FNFA 1RJTA 3I70A 2WP8J 4A93B 2KEDA 4JK1C 4QIWB 4G7OC 2A6EC 5D14A 4RGNA 4A3JB 3L3OC 2IWHA 1ILQA 1EY9A 4ODGA 2SOBA 1GHJA 1Q12A 4FP5D 3I4LA 1PZID 1Y8OB 3V96A 5LL6X 1H9KA 3NBHA 4XQNA 1SFOB 1W6KA 1SMYC 5CBAE 3ND9A 2ZXPA 1F77A 2K1BA 5CGKA 3GTMB 4DA2A 5LL6S 1BNZA 2Q8RE 4KJOA 4TRDA 4UDUC 5C4XB 1I4HA 2R92B 1E2WA 5C0XI 2ID0A 1JWUD 4DNTB 2A6HD 1C4QA 3J80E 5DM63 4HR7B 1H9SB 1TY2A 2DNCA 3T53B 3KF8A 4Q5VA 1ICWA 2D2CC 1U9RA 3IFDA 2E2IB 1KNAA 5C3EB 2Z8LA 5BN4A 4QCLA 3TBIB 1FYCA 2F03A 2E2JB 2IL8A 1JC7A 1DZ1A 2AQ3B 3AU7A 2EDGA 1LLRD 3BG3A 3W3AA 1YNND 2FMMA 4KD4A 1LABA 2L9HA 4K14A 5K36H 2CW0C 2JA8B 4K8IA 4CKEA 2PZWA 2RVLA 4X3SA 1L0XB 3Q0AA 1FNWA 4NKLA 2RA4A 3S16B 3MFYA 3C1FA 5CMDA 2FMCA 1IHZA 1T5EA 4PMBA 4OO1H 1Q1EA 5EKLA 4LJZC 4L63B 3GTQB 4C56C 3GTGB 1CZGA 2H1EA 1HFNA 4BBRB 3P75A 3MVVA 1B9MA 1SDFA 2KJXA 1X32A 1SYBA 2Q8TA 2RDHA 1OXXK 4V190 1T5XD 4FVMA 2XVSA 1ZKOA 1NAPA 3MFGA 1KLGD 4BBSB 2O5IC 1TQOA 4PQXA 3TP7A 3GTLB 3VR4A 5IGFA 5I4DA 1EY6A 1EY0A 4DAVA 3QWNA 3K5LA 2PW7A 2MUYA 2Q8IB 2K01A 3S15B 2ZT9C 1LTRD 1SMYD 1FNUA 2F0EA 4ULLA 2WKDA 3GO5A 5BN3A 3S17B 1SE4A 2A68D 3RZOB 3QB3A 5CV8A 4K2KA 1EZ6A 1EQTA 2R3ZA 3GTKB 2C9OA 5A2QL 1B3AA 3HOZB 3QO2A 1RKNA 1ML0D 2QDBA 3J81E 1A15A 2GA4B 5D3IB 3M3YB 1TS2A 3MZ5A 5BN5A 1EIGA 1G2TA 5I2YA 4K6LA 2HQEA 1UNSA 3DXJC 3Q24A 5NUCA 5KNCA 5IGGA 4PV1C 1SE3A 4BY7B 4V0BA 5ELFA 1HA6A 1EY5A 2K33A 3K6OA 2XNAC 2WAQB 1F9PA 3OWEB 2CW0D 2FHTA 1QB5D 2NN6H 4BA2I 3S2HB 3PUWA 3NQIA 1OXVA 1G6ZA 3RUZA 3I72A 2LMCB 3WOFA 4AYBB 3I73A 4RHSA 1XWEA 3OIPA 4XIGS 2B2YA 1Y69U 4A3DB 5I9OA 1B2TA 5K5PA 4IALA 4OHJA 5LHY1 3A55A 1AFPA 3LNNA 4DK0A 2F0WA 1PFMA 2EYMA 1JOOA 3FEWX 1ENFA 1ESRA 2IJ0A 3T51B 3H09A 4DXFA 2HDLA 2KHSA 2ZXOA 1RDPD 1BDOA 3K5OA 2O5JC 3EA6A 2Y0SB 2ICEC 3GV6A 4C3IG 4IUPA 5C4JB 3ITPA 3A8KE 3MC0B 2FJ2A 5DM73 1CK1A 2JP1A 3PIO3 2EJMA 3FRPB 4XXEA 3DM1A 4MIUA 2NVXB 2I07B 5C3XA 5I6WA 3SK4A 5E4XA 1PFBA 2NN6G 1HUNA 4ABNA 1GUWA 1ENAA 2KVMA 1NR2A 4XYOA 1MBYA 2VB2X 3ERQA 1F9SA 1DD2A 1TY0A 1D2BA 2PNRC 3U9SA 1AZPA 2YU9B 3BS1A 3GP7A 2JE6I 1EY8A 1U4PA 2M00A 1PTOH 1SNDA 1TKWB 2ENBA 3RD4A 2RBMA 1V43A 5T1IA 4WJWA 5JOBA 3Q23A 4KKUA 1WTXA 3QOJA 1Y8PB 2OT2A 4TSSA 1A2TA 4U68A 1RF2D 1KAAA 1BXTA 3NBIA 2R7ZB 5ELEA 3O13A 1QJOA 3K5NA 5DAUA 4B9WA 4EQOA 4HTHA 2KOLA 1GUTA 3DMUA 2HUGA 5AFWA 1PYWD 4EGVA 1JB3A 3NTIA 1Y1WB 4IFDH 3P20A 3CU7A 4L6TB 1RCVD 3BYYB 2X6LA 4ZUJA 1GUGA 5KYLA 1KLUD 1V1PA 2HCIA 2NVYB 1TWAB 1DM0B 3C3LA 1U4RA 1I4RA 3I4NB 4MN3A 1ZYRC 2F0IA 4RWSC 1QWYA 4CJ2C 1JR0D 1I4PA 1QCBD 2AUJD 4C1NK 1WVLA 3HGBA 2XRSD 1TU2B 3BDLA 1BCPB 4G4KA 2EY6A 3G7LA 1EL0A 2PQEA 1TWCB 1HTLD 1D1KA 2F0FA 3HOWB 4IUVA 1HRJA 5IGCA 2G9HD 1PRTB 5ELBA 1EZ8A 1TIID 3KUPA 3HOUB 3M4OB 1X3QA 3S9WA 2B2TA 1PTOF 1F9QA 4DGZA 4J1MA 3NE5B 3SXHA 2JA6B 3S14B 3DHQA 4YIJA 5KNBA 5J39A 5DNFA 1CHQD 4WFN3 4IFDG 3EJIA 3VR5A 4ZKCB 1KDCA 1STBA 5IT9E 2MP1A 4K5WA 4QMGA 4KTAA 1SNOA 2KCCA 3JAME 4H7BA 1JICA 2KCNA 3LX0A 1CHPD 1H9RA 4FXKC 1LTTD 4DNRB 2WACA 5JJZA 1SE2A 3TZDA 2EPBA 2WV6D 4FF4A 1PDQA 5I6YA 1S5FD 5EGTA 3J7AF 4DU9A 2BA0A 1I6HB 2PO4A 3N6RA 1B53A 4CKCA 4Z9CB 3SR1A 1IYVA 1PMRA 2F0JA 2IX3A 3NTKA 2AQ1B 1J8IA 4A3FB 4RKLA 4DN4M 2BDNA 2BCOA 2L11A 3IL8A 3NHHA 3DWAA 2NBFA 4KKSA 1HQRD 2ZXRA 3I8ZA 1O80A 4HMIA 1LT5D 1OO9B 2J0TD 5CV6A 1TS3A 3UI2A 4RCOA 1F2LA 3VYUA 1PTOC 2IT1A 1DCZA 3OW7A 5C44B 5JPMC 4X3UA 4IUNA 1TR5A 4RA8A 2LFNA 1TWHB 3NUCA 4RKBA 4A3EB 1EQVA 1K83B 4KY6A 2F0GA 2K6AA 3E0JA 4ZKBB 1WD1A 1S5ED 1R4PB 2XWJB 2KA7A 2K5WA 4DFAA 2NUCA 3HEJA 4KN4C 4KKTA 2F0SA 4OIJA 5CC4A 3T4AC 2FFKB 3RMHA 2AWOA 4MHEA 1TWGB 4O42A 3VYTA 3MXUA 1EYDA 4P2CB 3A8JE 4EQNA 2LS01 3EFXD 1CA6A 2F0MA 1KTKA 2RSOA 1LACA 2R61A 4TQUS 3AMUA 3C2PA 2Z4HA 1GXDC 1QNKA 3MXGA 5EPJA 5A2QE 3DUZA 2F0OA 5A35A 1O7ZA 5IIFA 2F0LA 1PZKD 4XDXA 5KNDA 4DXGA 3I3CA 1E0BA 1YNJC 4XT1B 5ELDA 1DOMA 2V4DA 1E2VA 2F0PA 1STGA 1D5ZC 1CA5A 5I9PA 2JXMB 2A73B 2A6ED 3RLFA 5J22A 4IUTA 4EQPA 4RHRA 1Y8NB 1U4LA 1IKMA 5G3LF 4NMZA 1SJED 2RDFA 1BCPC 3NTHA 3F2UA 1WCMB 1B44D 1SNMA 1B1ZA 3FPUB 4XQQA 2EZVA 4BA1I 4A3BB 1HXYD 5I2XA 3MXNA 1PRTC 3KBXA 3SDZA 5K36G 1J9OA 1WTRA 3PUYA 3I91A 2F3WA 1L0YB 3S1QB 4IFDJ 3BDOA 2XN9C 2NTTA 2F0DA 1PTOD 4OO1G 2BOSA 1DJRD 3QOLA 2PCFB 1BOSA 4ILWA 3MXPA 1ET9A 3SK5A 2K04A 1Q3LA 4CGYB 3Q22A 5IOCA 4FF2A 3IFTA 1VDZA 5CBEE 4A3GB 2AWNA 4KN7C 1R9TB 3K5MA 3L9AX 3OMGA 5JPNC 1I4QA 4BWGB 5FLXE 5C3WA 2QEJC 4ZLTF 1LV9A 3I4MB 5COYA 4I65A 1O7YA 1G91A 3S1MB 2RKSA 4RAUC 4CBVA 1U4MA 1EWHA 4RGTA 2PYKA 1EY4A 4L8JA 1XTCD 3IAYA 1WTOA 1RTOA 1LTID 3D4RA 4K6DA 5C5LA 1TS4A 5M3MB 1B50A 5FO7B 3TSSA 3TZUA 2EJFC 1II3A 2B2WC 3PO2B 2F0UA 1R4QB 1AW7A 1JQYD 1QNUA 5EKKA 1STEA 1YNJD 3HS0C 1HCZA 4F87A 1VCIA 2EYOA 4OL7A 3G6JB 2OF1A 3VR2A 1GHKA 3D6WA 3GQBA 1O7LA 3BDCA 1CQVA 3OSOA 2HDMA 5IGEA 3TDQA 4K2LA 1JOKA 3U9OA 1Z6HA 1E2ZA 4G7HC 1WTQA 1BCPD 3TP5A 5CR3A 4BY1B 1STAA 3M7GA 1WTWA 1OXUA 5EPKA 2PW5A 2NYZD 3SE0A 2AQ2B 5M3FB 2B39A 2PPBC 3K7AB 3LWEA 5F2DA 1UAPA 3D31A 4R8IA 1PRTD 5C0XH 4DF7A 4ZK9B 4CJ0B 5E1FA 1DXMA 4XYQA 2EY5A 2B63B 3E6ZX 1X3PA 5C5MA 3K58A 4IN3A 2OEOA 3D8GA 4QUCA 4FF3A 3PV0A 1G2SA 1Y1VB 1OXSC 2G9DA 4LAAA 1JCKB 3R3OA 3EVQA 1EYAA 1D1IA 1ONLA 1A3UA 1EYCA 1UUPA 3C1EA 4C3HG 3M85A 3OIQA 2SDFA 5HGTA 1EU4A 3OPOA 3TMEA 2J4XA 2F1MA 1NSNS 3EQLC 4OO1I 2K28A 2JSOA 4FO2A 1EFID 5CV9A 4Y7NB 3OWFA 3PUVA 1TVXA 1MGSA 2MHVA 1SXTA 1BR9A 4C3JB 3FDTA 1SYDA 4FXDA 3PO3B 5G3LD 3PIP3 2HCCA 3A8IE 1SYGA 3HKZB 5C0XG 1S5DD 2EYLA 4NW2A 4WRDA 1IW7C 4A3KB 1S5BD 2BE5C 2VB3X 3J7YW 5J1ZA 3R93A 2SNSA 2C5CA 4H13C 1GJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0F A;  5C5M A;  1KDB A;  2OEO A;  1U9R A;  4I65 A;  3NHH A;  5IIF A;  3D8G A;  5IGC A;  5ISR A;  2PZU A;  5I9O A;  2F0P A;  1AEX A;  1KAB A;  1STG A;  3NK9 A;  5JOB A;  5K5P A;  2EYJ A;  4KD3 A;  1STY A;  2F0E A;  4IAL A;  3T16 A;  1EZ8 A;  1SYF A;  5I9P A;  4HMI A;  3HZX A;  4G57 A;  4EVO A;  2RKS A;  3S9W A;  4ME5 A;  3QOJ A;  5CV6 A;  5J22 A;  4KHV A;  1A2T A;  4LAA A;  4QB4 A;  2F0W A;  5CV7 A;  3QB3 A;  1KAA A;  2PYK A;  3EVQ A;  3R3O A;  2EYM A;  1EYA A;  1EY4 A;  1JOO A;  4N9T A;  4F8M A;  1A3U A;  4IZ8 A;  2EYF A;  4EQP A;  1SYE A;  5CV8 A;  5DEH A;  4ZUI A;  4K2K A;  3P1H A;  3NXW A;  1EYC A;  4DGZ A;  4J1M A;  2F0V A;  4K8J A;  3SXH A;  3C1E A;  1F2M A;  1EZ6 A;  4NMZ A;  2RDF A;  5HGT A;  2OXP A;  3DHQ A;  4K6D A;  2KQ3 A;  1STH A;  4HMJ A;  4KD4 A;  4IUN A;  5C5L A;  4E6I A;  5HUR A;  4B9X A;  1TR5 A;  4K14 A;  2KHS A;  4WOR A;  4YIJ A;  3TME A;  5C4H A;  2EYP A;  3MEH A;  4J6H A;  5DAU A;  1SNP A;  1SNM A;  3D4W A;  4B9W A;  4EQO A;  1RKN A;  4HTH A;  4K8I A;  5J39 A;  2QDB A;  3DMU A;  3NUC A;  1NSN S;  4RKB A;  5KRU A;  2F0Q A;  2PZW A;  4KV6 A;  1EQV A;  1II3 A;  4KY6 A;  4PNY A;  2F0G A;  2F0U A;  2EYH A;  3PMF A;  1SNC A;  4KY7 A;  4NKL A;  3EJI A;  1SNQ A;  3C1F A;  2F3V A;  3ITP A;  3MZ5 A;  4DFA A;  3SHL A;  1KDC A;  2EY1 A;  5EKK A;  2F0T A;  1STB A;  1IHZ A;  1EY9 A;  3NQT A;  1ENC A;  4PMC A;  2PZT A;  5C4Z A;  2NUC A;  3HEJ A;  2HQE A;  4PMB A;  4R8N A;  3E5S A;  2EYO A;  2SOB A;  4ODG A;  2SNM A;  5EKL A;  4ZUJ A;  4K5W A;  2F0S A;  3H6M A;  4OL7 A;  4QMG A;  5KEE A;  4K5V A;  5KYL A;  4KTA A;  3D6C A;  1SNO A;  2OF1 A;  2F3W A;  5CV9 A;  4H7B A;  4NP5 A;  1EY7 A;  5CC4 A;  1JOR A;  5NUC A;  3LX0 A;  3BDC A;  5IGG A;  4KJN A;  1NUC A;  3OSO A;  1F2Z A;  3OWF A;  3P75 A;  4MIU A;  3MVV A;  5IGE A;  2F0D A;  3SK8 A;  2EY2 A;  2WAC A;  1JOQ A;  1SYB A;  4ID6 A;  1KDA A;  4K2L A;  1JOK A;  2F0I A;  3T13 A;  4S3S A;  1F2Y A;  5C3X A;  2F0N A;  5I6W A;  3U9O A;  2O4X A;  3QOL A;  3SK4 A;  1EYD A;  1SYD A;  4N9P A;  1EY5 A;  3NP8 A;  4EQN A;  5CGK A;  3MHB A;  3OMC A;  5KYI A;  3TP5 A;  5CR3 A;  2F0M A;  3MXP A;  1STA A;  3SK5 A;  1ENA A;  5I6Y A;  5EGT A;  5IGB A;  4DU9 A;  1A3T A;  4KJO A;  2PW5 A;  1SYG A;  4TRD A;  1TQO A;  4KY5 A;  3ERQ A;  5CV4 A;  1STN A;  4ZQ3 A;  3TP7 A;  3SR1 A;  3VA5 A;  4K5X A;  2LKV A;  5CV5 A;  5JAV A;  5IOD A;  5IOC A;  2EYL A;  3TP6 A;  3BDL A;  5IGF A;  5F2D A;  2F0O A;  2F0J A;  2EXZ A;  3ERO A;  4WRD A;  5C3W A;  4QF4 A;  5KIX A;  3RUZ A;  1EY6 A;  1EY8 A;  2EY6 A;  3TP8 A;  4DF7 A;  5M9O A;  1A2U A;  1EY0 A;  5J1Z A;  2M00 A;  5IGD A;  4F7X A;  1SND A;  1TT2 A;  2F0L A;  2ENB A;  2F0H A;  3OMG A;  4RKL A;  5E1F A;  2PW7 A;  2SNS A;  5KGU A;  4NDX A;  5C6A A;  2EY5 A;  1A3V A;  3D4D A;  3SK6 A;  2PQE A;  5E3F A;  3V2T A;  2RBM A;  2F0K A;  1SYC A; 
#chains in the Genus database with same CATH topology
 3UDG A;  5JEA H;  1XX8 A;  4EVO A;  3F1Z A;  2HHH Q;  3HOV B;  4PMW A;  1ILP A;  3GTO B;  1NR4 A;  3B6Y A;  4DAM A;  5M5X B;  2HD3 A;  3GTP B;  1HNX L;  1XYI A;  3NXW A;  1ROD A;  5EJW A;  2A19 A;  3H3V I;  1DOK A;  2A8V A;  1AP0 A;  5C4H A;  2F4V L;  1SNP A;  1BKB A;  4PG3 A;  1TS5 A;  3FP9 A;  1TWC H;  3HOW H;  5ELN A;  3KFU A;  1SNC A;  4KY7 A;  4JI2 Q;  1VQE A;  1LT4 D;  1O78 A;  1VQO A;  2F0T A;  1JE4 A;  2FXQ A;  3NQT A;  4PMC A;  4GKJ L;  3PUZ A;  4DK1 A;  3HOU H;  3M4O H;  3ZYY X;  3CCU A;  1V1P B;  2JQO A;  3R2T A;  3L7Z C;  1YNN C;  4HED A;  2X69 A;  4O1N A;  2ZJQ A;  3NEM A;  1J6Q A;  2KEE A;  3A74 A;  2JA6 H;  5IWA Q;  3S14 H;  2YYZ A;  1Q8I A;  1HR0 L;  2CQO A;  1QOH A;  2A5H A;  3SK8 A;  1HHV A;  4P71 A;  1VQC A;  4OIK A;  2F0N A;  4LFB L;  2O4X A;  5KYI A;  3HOY G;  2NN6 I;  4H0L C;  1EU3 A;  3ONA B;  3LGJ A;  1FNV A;  4B08 A;  1WOC A;  1RTN A;  1S4Z A;  4NB3 A;  2XWB B;  3MA2 B;  1PH9 A;  5GAD C;  4DV7 L;  3VA5 A;  3T1Y Q;  2VXW A;  2LKV A;  4OWX B;  1M4V A;  4J8Q A;  1D5X C;  1XXG A;  1HTP A;  4LMQ D;  1N34 L;  2UUB Q;  1GUO A;  2VNU D;  3CRK C;  1HZA A;  3BVZ A;  2JEB I;  1I4G A;  1M8A A;  3A7A B;  5JEA G;  3BZC A;  1JWM D;  5E3F A;  4LK1 C;  4IOA A;  2WAQ E;  3KLS X;  1CKO A;  3HOX B;  3BVM A;  5IP7 H;  2HIX A;  1UE6 A;  1X56 A;  3CW2 C;  3DEP A;  2EYJ A;  2KEC A;  3WOE A;  1QUQ A;  2M2L A;  4LF4 L;  1VQ5 A;  1I6H H;  2HIV A;  3S1R B;  2B29 A;  5CV4 A;  3S24 A;  1X65 A;  4N9T A;  4DAY A;  1VMC A;  4AYB E;  1HR0 W;  4R9W A;  3TN2 A;  4ZUI A;  1HNX Q;  2F0V A;  2XSC A;  1F9R A;  5FKA C;  2A69 C;  1XTD A;  2OXP A;  2B2Y C;  2K4K A;  2R7F A;  3HOW G;  1UEA B;  4A3F H;  2F4V Q;  2EYP A;  4J6H A;  4POG A;  5KRU A;  4KV6 A;  1IW7 D;  1VQP A;  3FVQ A;  4POF A;  2BE5 D;  1L1O A;  2B2U C;  2ATW A;  1K8O A;  2L0C A;  1ZYR D;  4GLV B;  2JEA I;  3HOU G;  1PXU A;  2A68 C;  4UP8 A;  3X3M A;  3E9I A;  1A6X A;  4GKJ Q;  1BCP F;  3HP3 A;  5D65 A;  1NMG A;  5FK9 C;  5M5W B;  4YCW A;  2JA6 G;  5KEE A;  1S40 A;  2XRQ D;  4A3I B;  3VYR A;  1JOR A;  1GVP A;  3ND8 A;  3A54 A;  1ZEQ X;  5C44 H;  3PUX A;  1QIL A;  4H44 C;  1HR0 Q;  1Q82 C;  4IUR A;  4DKA C;  2NWG A;  2Y0S E;  2J7Z A;  3FKI B;  5IT9 L;  2BDO A;  1PRT F;  3Q6S A;  4ZYS A;  4S3S A;  1TWH H;  4LF8 L;  4KK7 A;  4LFB Q;  4A3E H;  3IKJ A;  1K83 H;  3HRZ C;  1V1Q A;  3JAM L;  2N55 A;  1V9P A;  2A1A A;  1VQ9 A;  4P73 A;  2R93 G;  4DV6 L;  1DON A;  4QGU A;  3I55 A;  3KLS A;  4DV7 Q;  2EIF A;  3TS0 A;  1LT3 D;  2CQA A;  1H9J A;  2WB1 B;  3SGI A;  3VA7 A;  1K8G A;  5JVH 3;  3RNU A;  2L5T A;  4KMU C;  1TT2 A;  3P7J A;  3FMC A;  4HJ5 A;  1A3V A;  3D4D A;  5EBD A;  1DOL A;  4JI1 L;  1TWG H;  5IYD H;  2I5M X;  2NVT B;  4OGQ C;  5C0X J;  2IHF A;  2PZU A;  3NK9 A;  3S2D B;  2QCP X;  1FVI A;  1STY A;  1PLF A;  4KD3 A;  3T16 A;  3HZX A;  4LF4 Q;  4ZQ3 A;  3H0G B;  4F8M A;  4IZ8 A;  1AZQ A;  1IYU A;  3AB9 A;  2E2H B;  3U50 C;  5JJK A;  4C1N I;  2NZH A;  2UUC L;  3KYH C;  3KF6 A;  4E6I A;  1K0S A;  3K0X A;  3EN2 A;  4B9X A;  2DY8 A;  2E2H H;  1CT1 D;  4U67 3;  4RH6 A;  5FOB B;  3CC7 A;  3M4Q A;  4IPC A;  2RQX A;  2ZJR A;  2F0Q A;  2N88 A;  2QF7 A;  3J80 L;  1CTM A;  2MGS A;  4IFD I;  2UXD L;  4N8X 1;  3CCJ A;  2TSS A;  4YWK A;  1BF4 A;  2X6G A;  1N33 L;  1B7Y B;  4HID A;  1B9N A;  5CYU A;  1ENC A;  2H5X A;  4GZY C;  2JA7 B;  1S5C D;  4R8N A;  4YCU A;  3GV3 A;  4RFB A;  1Q90 A;  1OTC A;  3D6C A;  1HFG A;  2RCN A;  2D5D A;  4DAP A;  4DR4 L;  2BA1 A;  1BBW A;  2K14 A;  4LF5 Q;  3NWT A;  2JA5 B;  3RN5 A;  5C3E G;  1NUC A;  1F2Z A;  3R8B A;  4A3E G;  1VF5 C;  3N52 A;  3DWQ A;  1AE2 A;  1C8C A;  2AHO B;  1WCM H;  2CWP A;  2EY2 A;  1QVG A;  4ID6 A;  2VQE L;  4AH6 A;  2JA5 H;  2VUM B;  3NP8 A;  2K7V A;  3VDY A;  3MHB A;  2A69 D;  4JI8 L;  4XTC S;  2CH4 W;  4A3B H;  3LWU A;  4DV6 Q;  1A3T A;  2VUM H;  4TVA B;  3L0O A;  2NZO A;  1ET6 A;  3KJO A;  2JA8 G;  5IOD A;  1BQQ T;  1WJJ A;  3S1Q H;  1A2U A;  1PFN A;  1NY4 A;  5D3D A;  5GAG C;  3DEO A;  4NDX A;  3SK6 A;  2MQH A;  1H9M A;  5EKI A;  3RR5 A;  2F0K A;  5FJ8 H;  1D5M C;  4JBW A;  5ISR A;  3URY A;  1RHP A;  5AJ3 L;  2XIW A;  4QUF A;  2DY7 A;  1JJ2 A;  1ESF A;  1SMX A;  4G57 A;  1PH6 A;  2SEB D;  4C3I B;  4GS3 A;  4HCE A;  1G29 1;  2EXD A;  3ER0 A;  5JEA J;  3BYT B;  1LTA D;  5DEH A;  1HNZ L;  3H94 A;  3J7A V;  2DNE A;  2OTL A;  3DWP A;  5ELC A;  2EJG C;  2KCT A;  3CRL C;  2UUC Q;  4ZRZ A;  4LF6 L;  4LFC Q;  2QW7 A;  4A3G H;  1R9T H;  3A56 A;  4OON A;  4TKO B;  4WOR A;  2ZTD A;  3T56 B;  5COR A;  4BBS G;  1HQM C;  1EOV A;  1LTB D;  3MXN B;  1EOT A;  1SAP A;  2VW9 A;  2H4O A;  1BO0 A;  2ICI A;  4JC0 A;  1B4O A;  2D0O A;  2EYH A;  2ZM6 L;  2Z6K C;  1GUS A;  4KI0 A;  1Z7T A;  2B2V C;  1SNQ A;  5E4W C;  4X64 Q;  1GOZ A;  1N33 Q;  1QE6 A;  3S1M H;  2B2T C;  3CCS A;  4HCS A;  4HAE A;  1SBB B;  5C4Z A;  1PH5 A;  2QIL A;  2CFM A;  3CP0 A;  3E5S A;  3C46 A;  5FO9 B;  1G8Z D;  4XT3 B;  4IUU A;  1Q1B A;  1EY7 A;  2L12 A;  4K0K L;  1WCM G;  3GTJ B;  3KJP A;  3TRE A;  3I2Z A;  1RL2 A;  4BXX H;  2O2L D;  4GOP B;  1I50 B;  4UY8 C;  5M3M H;  1VQF A;  4N8F A;  1JOQ A;  2NTS A;  1KDA A;  2WIN B;  1CM9 A;  2WKC A;  3QJY A;  4C3H B;  2F4I A;  4IQZ A;  3PO2 H;  3OMC A;  1D6E C;  1I50 H;  4JI8 Q;  5TSS A;  3RLN A;  4CKB A;  5EQ0 A;  3K0Y A;  2K05 A;  1YZ6 A;  3V05 A;  4B3M Q;  3CF5 A;  2EOT A;  4A3C H;  4CJ1 B;  2WII B;  5FO8 B;  4RGO S;  4ZCK A;  1WTV A;  4KY5 A;  3J81 L;  4G7Z C;  1STN A;  1CFM A;  3I90 A;  1VMP A;  2B2U A;  1UEB A;  4R4T A;  5CV5 A;  5JAV A;  1GUN A;  3KLR A;  3H91 A;  3QG1 A;  3NEN A;  3HOZ G;  3S1N B;  1SRU A;  2IW3 A;  1EEF D;  3CPW A;  1LT6 D;  2EXZ A;  5KIX A;  1K8M A;  4F7X A;  4A3L G;  5C6A A;  3CXC A;  4DV4 L;  2K52 A;  3M4Y A;  1SSO A;  1XNQ Q;  1DYQ A;  1Z9F A;  4YY3 Q;  1IBK Q;  1W6J A;  3MEF A;  2K75 A;  4FF1 A;  5AJ3 Q;  3VR6 A;  1IL8 A;  4A3M B;  4BY1 H;  1I4X A;  1V1O A;  1QG7 A;  2B8F A;  4ME5 A;  4X3K A;  4DV0 L;  1PZJ D;  4KHV A;  2RCF A;  3UDF A;  1Z47 A;  5FLX L;  2VS1 A;  2K5D A;  2IPK D;  2EYF A;  4A3G G;  4JPB W;  4BY7 G;  1HNZ Q;  3GD7 A;  1FL0 A;  4K8J A;  1F2M A;  1STH A;  2PMZ B;  4LF6 Q;  5EPL A;  5HUR A;  3J7Z C;  1WD0 A;  3NPP A;  2WAQ G;  3EBE A;  3UE1 A;  3I4M G;  3MEH A;  1N36 Q;  3D4W A;  2EE1 A;  2B63 H;  1CI3 M;  3OOC A;  1SJH D;  1PYB A;  2EVB A;  3VR3 A;  3MTS A;  2ZM6 Q;  2IX1 A;  2F3V A;  1NCV A;  2L55 A;  3SHL A;  1D8L A;  2EY1 A;  2AUK A;  1Y1V H;  3JC6 6;  2FIN B;  1I3Q B;  4ZAI A;  2SNM A;  2TMP A;  1OXT A;  3H6M A;  3BVG A;  3G48 A;  1MD2 D;  1MI2 A;  2MJ8 A;  3QIA A;  2K5Q A;  4NP5 A;  4HJA A;  4M1U B;  4K0K Q;  1PTO B;  3CHB D;  2E2D C;  4F88 A;  4EQ5 A;  3UDI A;  4LUV A;  2JA9 A;  1VQB A;  5T1G A;  4JI2 L;  3T13 A;  1F2Y A;  3VYS A;  4X3T A;  2Q2U A;  1TXY A;  2M9V A;  2NB0 A;  1JWS D;  4BS9 A;  2K32 A;  1EEI D;  3E0E A;  5IGB A;  1FD7 D;  3X3N A;  3K57 A;  4DUY Q;  3G6E A;  2IX0 A;  1CZW A;  3A5Z B;  4K5X A;  2GVA A;  2I46 A;  1I6V C;  3K59 A;  3TP6 A;  1JJC B;  2RSN A;  4KHZ A;  3OHX C;  2R6G A;  3ERO A;  3F2D A;  4Y7N H;  2F0H A;  2L1B A;  3BZD B;  3ZJY C;  4DR7 Q;  1VQ6 A;  1KDB A;  4C3J H;  1ZXT A;  4I7Z C;  2E76 C;  1KAB A;  2CHB D;  1EIH A;  3PO3 H;  2RDG A;  3SVM A;  2A74 C;  1WTP A;  1SYF A;  5M3F G;  1TWF B;  4HN7 A;  4LUO A;  3A7L A;  4MNO A;  3WDN A;  4DV0 Q;  1PVO A;  2DN8 A;  1Q86 C;  1KNE A;  2UUB L;  1VQG A;  2B3G A;  4QB4 A;  5CV7 A;  4HJ9 A;  1LUZ A;  4RGM A;  3HOY B;  2B8G A;  4HJ7 A;  4FXG C;  3KK7 A;  1CKN A;  1LYL A;  4A3K H;  4AQY L;  1LTG D;  4WJ4 A;  2KQ3 A;  2YTY A;  2JYO A;  4GN4 B;  4JG2 A;  3NSW A;  3H3V C;  2MO1 A;  5H1S E;  2RF4 A;  4PNY A;  1HUM A;  3PMF A;  3HKS A;  1U5K A;  2QKI C;  1SR3 A;  4X6A H;  4C2M B;  4XQJ A;  3TEH B;  1VQL A;  1SEB D;  2A6H C;  1BUV T;  3RLO A;  3PIP A;  5JVG 3;  1RD9 D;  2PZT A;  3HOV H;  1EWC A;  2MPM A;  1X3E A;  2UXB L;  3KBG A;  4Y52 H;  2K03 A;  3GTO H;  3ULP A;  4K5V A;  5M5X H;  3GTP H;  1V8Q A;  1HA5 A;  3FPP A;  4KJN A;  1MSH A;  2E74 C;  1LO5 D;  4CHT B;  2AKW B;  4HSV A;  2PQA A;  4N9P A;  4UPA A;  2Z1C A;  2KUM A;  4AIM A;  3NWS A;  4IUQ A;  4RCN A;  2CVR A;  1VF7 A;  2LY7 A;  1S72 A;  2R7Z G;  3OYY A;  1NNX A;  4UAI A;  1UE5 A;  1FR3 A;  4NXM L;  1BBX C;  4JI7 L;  4GNX A;  1C48 A;  1YHB A;  1AN8 A;  3D3R A;  2B2V A;  4CDE C;  1HZB A;  1LTS D;  5HY6 A;  3SEB A;  4QF4 A;  3AFQ A;  2D62 A;  3TP8 A;  5M9O A;  4HSP A;  5IGD A;  1UWV A;  4X65 Q;  3CKI B;  5KGU A;  4C3J G;  1AH9 A;  1HPC A;  3HG9 A;  4JOI C;  1Y1W G;  4FYD A;  2N8N A;  1C9O A;  3W2D A;  3V2T A;  3PO3 G;  2NVQ B;  1SYC A;  3RZD B;  1K9M C;  5IP9 H;  2E75 C;  3UE0 A;  1CQF A;  1WYD A;  1AEX A;  3H15 A;  1W3S A;  1WFQ A;  2B2W A;  3BJU A;  2DGY A;  4M8A A;  1VQ4 A;  2OCE A;  2NZ1 D;  1O7I A;  3I4N G;  4A3K G;  3QR8 A;  3PF5 A;  1FGB D;  3M7N A;  2VZA A;  3MAQ A;  1SYE A;  3CQZ B;  4CDF C;  2KCM A;  2Z4I A;  3P1H A;  5M5Y B;  4Q0F A;  2R93 B;  5EBC A;  2MFI A;  3R2I A;  1A62 A;  1E7Z A;  4LUZ A;  1IKL A;  4AQY Q;  4APV A;  4HMJ A;  2D9U A;  2XTI A;  3FHW A;  2L4N A;  3CQZ H;  1W2B A;  1H9S A;  3MWY W;  4WJ3 M;  1MSG A;  4FNF A;  4A76 A;  1RJT A;  1T9H A;  3I70 A;  2WP8 J;  4A93 B;  1JB7 A;  3K7U C;  2KED A;  4JK1 C;  3HOX H;  4PZ7 A;  4QIW B;  3HOV G;  4G7O C;  2A6E C;  5D14 A;  3PF4 A;  4RGN A;  4A3J B;  3L3O C;  4OX9 L;  2IWH A;  4DPG A;  1ILQ A;  1EY9 A;  5HGQ A;  1IYJ B;  2UXB Q;  4ODG A;  3S1R H;  2SOB A;  1GHJ A;  1Q12 A;  4FP5 D;  3I4L A;  1FJG L;  1PZI D;  1Y8O B;  3G71 A;  3V96 A;  5LL6 X;  4DR3 L;  1H9K A;  3NBH A;  1XPU A;  4XQN A;  5ELO A;  1SFO B;  1W6K A;  1SMY C;  5CBA E;  2GN5 A;  3ND9 A;  2ZXP A;  1F77 A;  4DV5 L;  2JJQ A;  2K1B A;  5CGK A;  3CC2 A;  3ICE A;  3GTM B;  4DA2 A;  5LL6 S;  4GLA C;  3CCR A;  5IYC H;  1BNZ A;  2Q8R E;  4KJO A;  1MIU A;  1YVC A;  4TRD A;  4NXM Q;  4UDU C;  3AEV A;  5C4X B;  4JI7 Q;  1I4H A;  2R92 B;  1E2W A;  1VQH A;  5C0X I;  4LF5 L;  5M5W H;  1E3P A;  2ID0 A;  1JWU D;  4A3I H;  4DNT B;  2A6H D;  4P74 A;  1C4Q A;  3J80 E;  5DM6 3;  4HR7 B;  5IP9 G;  1H9S B;  1TY2 A;  1WTH A;  2DNC A;  3T53 B;  3KF8 A;  4Q5V A;  1ICW A;  3A5U A;  3FKI H;  1QUQ B;  2D2C C;  1U9R A;  3IFD A;  2ZTE A;  2E2I B;  1KNA A;  5C3E B;  2Z8L A;  4DAY B;  5BN4 A;  4QCL A;  3TBI B;  1FYC A;  2F03 A;  1YIJ A;  2E2J B;  5IYB H;  2IL8 A;  4RG1 A;  3PSI A;  1JC7 A;  1DZ1 A;  2AQ3 B;  3AU7 A;  2EDG A;  5IP7 G;  1LLR D;  3BG3 A;  3W3A A;  1YNN D;  2FMM A;  4KD4 A;  1LAB A;  2L9H A;  4K14 A;  1KD1 C;  1E1T A;  1L1O B;  2LXJ A;  3HOX G;  5K36 H;  2CW0 C;  2JA8 B;  4K8I A;  4CKE A;  4DK6 C;  3KDF A;  3DM3 A;  2PZW A;  2RVL A;  4R4C A;  1L0X B;  4X3S A;  3Q0A A;  2NVT H;  1FNW A;  4NKL A;  2RA4 A;  3S16 B;  3MFY A;  3C1F A;  5CMD A;  3S2D H;  4OX9 Q;  2FMC A;  1IHZ A;  4A3F G;  3CAM A;  1T5E A;  4PMB A;  4OO1 H;  1Q1E A;  5EKL A;  2ZJP A;  3H0G H;  4L63 B;  4LJZ C;  3GTQ B;  4LFC L;  1FJG Q;  2KHJ A;  4C56 C;  3M4P A;  1G6P A;  3GTG B;  3CPF A;  4DR3 Q;  1CZG A;  2H1E A;  1HFN A;  1KXL A;  4BBR B;  3P75 A;  3MVV A;  5GRO A;  1B9M A;  1SDF A;  1B8A A;  2KJX A;  1X32 A;  1SYB A;  3TS2 A;  2Q8T A;  4DV5 Q;  2RDH A;  1OXX K;  4V19 0;  4QQB X;  5IYC G;  4X64 L;  5JJI A;  1T5X D;  4HJ8 A;  4FVM A;  2XVS A;  4O0A A;  1ZKO A;  4JBK A;  1NAP A;  1IBM L;  5C44 G;  3MFG A;  1KLG D;  4BBS B;  4QY7 A;  2O5I C;  1TQO A;  4P75 A;  3ULL A;  4PQX A;  4A3I G;  3TP7 A;  2JA7 H;  3GTL B;  3VR4 A;  5IGF A;  3T1H L;  3NEL A;  4OWW B;  5I4D A;  2F3I A;  3I4O A;  1EY6 A;  1GD7 A;  3FKI G;  1EY0 A;  4DAV A;  1VQ7 A;  3QWN A;  3K5L A;  2PW7 A;  2MUY A;  1IZ6 A;  2Q8I B;  1KQS A;  4B3M L;  3CCQ A;  2K01 A;  3S15 B;  4UP9 A;  4LF7 L;  5IYB G;  3HKZ E;  2ZT9 C;  1GKH A;  1LTR D;  1SMY D;  1FNU A;  2F0E A;  4ULL A;  2WKD A;  3GO5 A;  5BN3 A;  3S15 H;  3S17 B;  1EWI A;  1SE4 A;  2A68 D;  3RZO B;  3QB3 A;  3D0F A;  3KF6 B;  5CV8 A;  4K2K A;  5IYD G;  3S17 H;  4R4Q A;  1EZ6 A;  4R4I A;  1EQT A;  1N32 Q;  2R3Z A;  1XNQ L;  3GTK B;  2C9O A;  4YY3 L;  1IBK L;  5A2Q L;  3H3V H;  2EQS A;  5FLM H;  1B3A A;  3HOZ B;  3QO2 A;  1RKN A;  1ML0 D;  2QDB A;  3PCO B;  3J81 E;  2BH2 A;  1A15 A;  2GA4 B;  5D3I B;  3M3Y B;  1TS2 A;  1M90 C;  1X3F A;  4JOI A;  3MZ5 A;  1VQA A;  5BN5 A;  1MJC A;  1EIG A;  1G2T A;  2Z9H A;  1LTL A;  5I2Y A;  4C3I H;  4K6L A;  2HQE A;  1UNS A;  3DXJ C;  3Q24 A;  1N36 L;  3CC4 A;  5NUC A;  5KNC A;  4LWC A;  5IGG A;  5LMN W;  4PV1 C;  3I56 A;  3JAM i;  1SE3 A;  4BY7 B;  1YI2 A;  4R4O A;  4V0B A;  5ELF A;  4DNI A;  2DJG C;  1HA6 A;  1EY5 A;  2K33 A;  3K6O A;  3TQY A;  4L5S A;  1UE1 A;  5DLQ E;  1K3B C;  4L5R C;  2XNA C;  1IBM Q;  4DK3 C;  2JA7 G;  3OWE B;  1F9P A;  2WAQ B;  2CW0 D;  3CMA A;  2FHT A;  1QB5 D;  2NN6 H;  4QL5 A;  4DR5 L;  4BA2 I;  4JI3 Q;  3S2H B;  3PUW A;  3NQI A;  3CCE A;  2I5H A;  1OXV A;  2JA5 G;  1G6Z A;  2QGQ A;  1Q7Y C;  1BVS A;  3T1H Q;  4UP7 A;  1C0A A;  3RUZ A;  3I72 A;  2LMC B;  3GTJ H;  3WOF A;  2AMC B;  4AYB B;  4A3B G;  2DJF C;  3I73 A;  4RHS A;  1XWE A;  4I7A A;  2VUM G;  3OIP A;  1EIY B;  4XIG S;  2B2Y A;  5LMN Q;  1Y69 U;  4A3D B;  1N9W A;  4QJF A;  4LF7 Q;  4C3H H;  4DUY L;  3ERS X;  5I9O A;  3CD6 A;  1J5E Q;  1B2T A;  5K5P A;  4IAL A;  4OHJ A;  5LHY 1;  3A55 A;  1AFP A;  3LNN A;  1KL9 A;  4DK0 A;  2F0W A;  1PFM A;  2EYM A;  1JOO A;  3FEW X;  1ENF A;  2XGT A;  5FJ8 G;  1ESR A;  3S1N H;  4JVZ A;  2IJ0 A;  3AFP A;  1KC8 C;  3T51 B;  5FLM G;  3H09 A;  4DXF A;  2Q2I A;  4DR7 L;  2PI2 E;  4DV1 L;  2HDL A;  3J80 i;  2KHS A;  2ZXO A;  1RDP D;  2LXK A;  2ASB A;  1YJW A;  1BDO A;  3K80 C;  1ICF B;  1IXR A;  3K5O A;  2O5J C;  4FDB A;  3EA6 A;  2Y0S B;  2ICE C;  3GV6 A;  4C3I G;  4IUP A;  5C4J B;  3I7F A;  3ITP A;  3A8K E;  1A8V A;  4JV5 L;  4A3M H;  1EQR A;  3MC0 B;  1I5F A;  4JI0 Q;  2FJ2 A;  5DM7 3;  1VQK A;  4OWT B;  1KRT A;  1CK1 A;  2JP1 A;  1PHJ A;  2LSS A;  3PIO 3;  2EJM A;  3FRP B;  4XXE A;  1YJ9 A;  2PNH A;  4UHV A;  2RHQ B;  3DM1 A;  1PH2 A;  1IBL L;  4MIU A;  1WI5 A;  2NVX B;  1SN8 A;  2I07 B;  1L1O C;  5C3X A;  5I6W A;  3SK4 A;  5E4X A;  1PFB A;  2NN6 G;  1HUN A;  1K73 C;  1JE5 A;  2ES2 A;  4ABN A;  1GUW A;  1ENA A;  2KVM A;  1NR2 A;  4XYO A;  4BXX G;  1MBY A;  2VB2 X;  3ERQ A;  1F9S A;  4DR5 Q;  5M3M G;  1I3Q H;  1DD2 A;  1TY0 A;  1D2B A;  2PNR C;  2DUD A;  3U9S A;  1YJN A;  1AZP A;  2YU9 B;  3BS1 A;  1YBY A;  3PO2 G;  3GP7 A;  2JE6 I;  1EY8 A;  2Q2H A;  1U4P A;  1VQ8 A;  2M00 A;  1PTO H;  1SND A;  1TKW B;  2ENB A;  4A3C G;  4ALP A;  3RD4 A;  2RBM A;  4A4I A;  1V43 A;  1NBW A;  5T1I A;  4WJW A;  1Q81 C;  5JOB A;  3Q23 A;  4X66 L;  4KKU A;  1WTX A;  3QOJ A;  4P72 A;  1Y8P B;  2OT2 A;  2WB1 E;  1A2T A;  1VQJ A;  1RF2 D;  3BU2 A;  4TSS A;  4U68 A;  1KAA A;  2N49 A;  1BXT A;  3NBI A;  4X65 L;  2R7Z B;  5ELE A;  1PV4 A;  3O13 A;  1EIF A;  1QJO A;  3K5N A;  4DV1 Q;  4BY1 G;  4IJL A;  5DAU A;  4B9W A;  4EQO A;  4HTH A;  2KOL A;  1HZC A;  1GUT A;  3DMU A;  2D0P A;  2HUG A;  2I5L X;  1K0R A;  5AFW A;  1PYW D;  4EGV A;  5LMU L;  1JB3 A;  2L15 A;  3NTI A;  1BBU A;  1Y1W B;  4JV5 Q;  4IFD H;  3P20 A;  1JJG A;  1TWF H;  3CU7 A;  4L6T B;  1RCV D;  3BYY B;  1CSP A;  2X6L A;  4DR6 Q;  4ZUJ A;  2B63 G;  1GUG A;  4ME3 A;  5KYL A;  3HOY H;  1XNR L;  4H02 A;  2K5N A;  1M1K C;  1KLU D;  1V1P A;  4IPH A;  2HCI A;  2NVY B;  1TWA B;  1DM0 B;  4JYA L;  3C3L A;  1IBL Q;  1U4R A;  1I4R A;  5GAE C;  1VQM A;  3I4N B;  1RIP A;  1YEZ A;  4MN3 A;  1Y1V G;  1ZYR C;  2F0I A;  1ASZ A;  1P16 A;  4RWS C;  3J81 i;  1QWY A;  4CJ2 C;  1JR0 D;  5IT9 c;  1I4P A;  1QCB D;  2AUJ D;  5BR8 L;  4C2M H;  4C1N K;  3CME A;  1WVL A;  3DLL A;  2E5L L;  3HGB A;  2XRS D;  1NJI C;  3JAM c;  1TU2 B;  3BDL A;  3GDE A;  1K3R A;  1HNW L;  4LF9 Q;  1BCP B;  4G4K A;  2C35 B;  2EY6 A;  3G7L A;  1KAW A;  3STB C;  1EL0 A;  2F52 A;  2PQE A;  4YHH Q;  1EQQ A;  1TWC B;  1HTL D;  1D1K A;  2F0F A;  3HOW B;  1PH3 A;  4IUV A;  1HRJ A;  5IGC A;  2G9H D;  1PRT B;  2PI2 A;  2Z6K A;  4R1J A;  1EZ8 A;  5ELB A;  1TII D;  4X66 Q;  1GM5 A;  4JI5 L;  1ASY A;  3KUP A;  1CKN B;  3HOU B;  3M4O B;  1X3Q A;  3S9W A;  4LFA L;  1NTG A;  2B2T A;  1PTO F;  4LW1 A;  1F9Q A;  1QVC A;  4DGZ A;  4J1M A;  3NE5 B;  3SXH A;  2JA6 B;  5JJL A;  2OQK A;  3S14 B;  4GOP C;  3DHQ A;  4YIJ A;  1XMQ L;  4L5Q A;  3OTO L;  5KNB A;  5J39 A;  5DNF A;  1GO3 E;  3HKZ G;  1B70 B;  1QVF A;  2NVQ H;  1CHQ D;  4WFN 3;  3RZD H;  4IFD G;  3W5O A;  4DR1 Q;  3EJI A;  5LMU Q;  3VR5 A;  4ZKC B;  3HFZ B;  1KDC A;  4JI6 Q;  1STB A;  3J80 c;  2QA4 A;  5IT9 E;  2OTJ A;  2MP1 A;  4K5W A;  4QMG A;  4HIO A;  4KTA A;  1SNO A;  2KCC A;  3A0J A;  3JAM E;  1XNR Q;  4B3S L;  4H7B A;  1EUJ A;  5M5Y H;  1JIC A;  2R93 H;  2KCN A;  3LX0 A;  2UU9 L;  2PQA B;  2BH8 A;  1CHP D;  4JYA Q;  1H9R A;  4NXN Q;  4FXK C;  1YHA A;  1LTT D;  4KLK A;  4DNR B;  2WAC A;  4B3T Q;  5JJZ A;  1SE2 A;  4KHP L;  3TZD A;  1PH7 A;  1XJV A;  2EPB A;  2WV6 D;  1C7Y A;  4FF4 A;  4A93 H;  4GNX B;  4B3R Q;  1PDQ A;  5I6Y A;  1S5F D;  5EGT A;  3J7A F;  5BR8 Q;  2BA0 A;  4DU9 A;  4A3J H;  1A63 A;  2E5L Q;  1I6H B;  2PO4 A;  3N6R A;  1B53 A;  4CKC A;  1X3G A;  4Z9C B;  3SR1 A;  1IYV A;  2YTV A;  3J7A 5;  1PMR A;  2F0J A;  2IX3 A;  1HNW Q;  3NTK A;  3F2C A;  2N78 A;  2AQ1 B;  1J8I A;  4A3F B;  1G51 A;  4RKL A;  4DN4 M;  2BDN A;  2BCO A;  1SFO H;  3Q8D A;  1X55 A;  2L11 A;  1E24 A;  1CSQ A;  3IL8 A;  3NHH A;  3DWA A;  2GVB A;  4DV2 L;  2KBN A;  2NBF A;  4KKS A;  2VL6 A;  1HQR D;  2ZXR A;  3I8Z A;  3GTM H;  1O80 A;  1XPO A;  4OXP A;  4HMI A;  1LT5 D;  1OO9 B;  2J0T D;  5L37 A;  4IO9 A;  5CV6 A;  4JI5 Q;  5C4X H;  1TS3 A;  4LFA Q;  3UI2 A;  4RCO A;  1F2L A;  1U0L A;  2R92 H;  1DGS A;  3VYU A;  4JBJ A;  2ZTC A;  1PTO C;  1L2F A;  2IT1 A;  4IOC A;  1DCZ A;  3OW7 A;  5C44 B;  1IL2 A;  5JPM C;  4X3U A;  4IUN A;  1TR5 A;  4RA8 A;  1XMQ Q;  3OTO Q;  2LFN A;  1TWH B;  3E9H A;  3NUC A;  4RKB A;  4A3E B;  1K83 B;  1EQV A;  4KY6 A;  2CKZ B;  1SLJ A;  2F0G A;  2K6A A;  4O2D A;  1VQD A;  3E0J A;  3EIV A;  4ZKB B;  2E2I H;  1K8A C;  1WD1 A;  1S5E D;  1CKM A;  1R4P B;  5C3E H;  3STB D;  3CCL A;  2XWJ B;  2KA7 A;  2K5W A;  4DFA A;  1A0I A;  4JI4 L;  2E2J H;  2NUC A;  3HEJ A;  4KN4 C;  3NBH B;  4KKT A;  4DR2 L;  2VQF L;  2F0S A;  1N32 L;  4OIJ A;  2PMZ E;  1KHI A;  1PH1 A;  4B3S Q;  5CC4 A;  2E8G A;  3T4A C;  2UU9 Q;  2FFK B;  2Q2T A;  3RMH A;  1N34 Q;  4A93 G;  2AWO A;  4MHE A;  4CDC C;  1TWG B;  2JA8 H;  2MNA A;  4KHP Q;  4L5T A;  4O42 A;  3VYT A;  2RHS B;  3MXU A;  1EYD A;  4P2C B;  1NE3 A;  3A8J E;  4EQN A;  4A3J G;  2LS0 1;  3EFX D;  1CA6 A;  2K5H A;  4NPS A;  3S16 H;  2F0M A;  1KTK A;  2RSO A;  1LAC A;  3BZK A;  2R61 A;  4TQU S;  3AMU A;  3C2P A;  2Z4H A;  1X54 A;  1GXD C;  1QNK A;  3MXG A;  2UXC L;  5EPJ A;  2KEN A;  2V1C C;  5A2Q E;  3GTQ H;  3DUZ A;  2F0O A;  3KF8 B;  4PZ6 A;  5A35 A;  1O7Z A;  3J81 c;  3GTG H;  5GAH C;  1D7Q A;  5IIF A;  2F0L A;  1PZK D;  2JN4 A;  4XDX A;  4BBR H;  5KND A;  1LM0 A;  4GLX A;  1PFS A;  4DXG A;  3F8T A;  5IE8 A;  3I3C A;  1E0B A;  2YV5 A;  1YNJ C;  4XT1 B;  1NMF A;  1EYG A;  1B3Q A;  5ELD A;  1DOM A;  2V4D A;  4DV2 Q;  1E2V A;  2F0P A;  1STG A;  1D5Z C;  5C4X G;  4JI3 L;  2R92 G;  1CA5 A;  5I9P A;  2JXM B;  4YWM A;  2A73 B;  4BBS H;  2A6E D;  3RLF A;  5J22 A;  4IUT A;  4MZ9 A;  3UDX A;  4LNQ A;  4EQP A;  3GTL H;  1K28 A;  2N3S A;  4RHR A;  1YNX A;  1Y8N B;  1U4L A;  1IKM A;  5G3L F;  1E1O A;  3KDF B;  4NMZ A;  1SJE D;  2RDF A;  1BCP C;  3NTH A;  3F2U A;  4GN5 A;  5FLX c;  5LMN L;  1WCM B;  1B44 D;  1SNM A;  1B1Z A;  1EFW A;  3FPU B;  1J5E L;  4JBM A;  4XQQ A;  2EZV A;  4BA1 I;  3M9B A;  4A3B B;  1HXY D;  3W1B A;  5I2X A;  3MXN A;  1XMO L;  2WB1 G;  2MO0 A;  4HIM A;  4LF8 Q;  2HT1 A;  1PRT C;  4A75 A;  4JI4 Q;  3KBX A;  3SDZ A;  5K36 G;  1I94 L;  1J9O A;  3RZO H;  1WTR A;  3K8A A;  3KLW A;  3PUY A;  4IPG A;  2VQF Q;  4DR2 Q;  3I91 A;  2KHI A;  3OW2 A;  1PH4 A;  2F3W A;  1L0Y B;  3S1Q B;  4IFD J;  1HJP A;  3BDO A;  1Q8K A;  2XN9 C;  4IJH A;  2OQ0 A;  2NTT A;  3GTK H;  2F0D A;  2YTX A;  3HOZ H;  1PTO D;  4OO1 G;  2BOS A;  1DJR D;  3QOL A;  3H0G G;  4GOP A;  2PCF B;  4JI0 L;  1BOS A;  3M3Y H;  4JI1 Q;  4ILW A;  3MXP A;  3KOJ A;  1ET9 A;  3SK5 A;  1Y14 B;  2K04 A;  1Q3L A;  1SRO A;  4A3L H;  1PA6 A;  4DUZ L;  2CH4 A;  4MTK A;  1JMC A;  4CGY B;  2UXC Q;  3Q22 A;  5IOC A;  4FF2 A;  3IFT A;  1VDZ A;  5CBE E;  1VQN A;  4BBR G;  2ALY B;  3WWV A;  3J81 j;  4A3G B;  2AWN A;  4KN7 C;  4OEL B;  1R9T B;  3K5M A;  2P5Z X;  3L9A X;  3OMG A;  5JPN C;  1X9N A;  2Z6B A;  1I4Q A;  4BWG B;  5IY0 A;  1L0W A;  5FLX E;  5C3W A;  2QEJ C;  2IY5 B;  4BY7 H;  4ZLT F;  1LV9 A;  3I4M B;  2K50 A;  4I65 A;  5COY A;  1XPR A;  1O7Y A;  3G4S A;  4GNX C;  1G91 A;  3S1M B;  4IPD A;  2RKS A;  3I4M H;  4RAU C;  4DV3 L;  2UXD Q;  4CBV A;  1U4M A;  1EWH A;  4RGT A;  2PYK A;  1EY4 A;  4L8J A;  3S2H H;  1XTC D;  3IAY A;  1WTO A;  1AE3 A;  1RTO A;  1LTI D;  3D4R A;  2UUA L;  4K6D A;  5C5L A;  1TS4 A;  5M3M B;  1N8R C;  1B50 A;  5FO7 B;  4DR4 Q;  1CUK A;  2VY3 A;  1FGU A;  3TSS A;  3TZU A;  2EJF C;  2OWO A;  1II3 A;  2B2W C;  3PO2 B;  1HZ9 A;  2F0U A;  1S3O A;  3U58 A;  1H95 A;  4A3D H;  1R4Q B;  2VQE Q;  1AW7 A;  1KIX A;  1JQY D;  1QNU A;  2IHE A;  1XMO Q;  5EKK A;  2QEX A;  4GKK L;  1STE A;  1YNJ D;  3K81 C;  3HS0 C;  1HCZ A;  4F87 A;  1VCI A;  1I94 Q;  2EYO A;  4OL7 A;  4X62 L;  3G6J B;  4OEM B;  2OF1 A;  3VR2 A;  2K5V A;  3D6W A;  1GHK A;  3GQB A;  1VQI A;  1YHQ A;  1O7L A;  3BDC A;  1CQV A;  3OSO A;  1PH8 A;  2HDM A;  5IGE A;  1MJE A;  3TDQ A;  3PGZ A;  4QIW E;  4K2L A;  1JOK A;  3U9O A;  1Z6H A;  1E2Z A;  4G7H C;  2QDL A;  1WTQ A;  1BCP D;  3TP5 A;  5CR3 A;  4BY1 B;  1STA A;  4DR6 L;  3M7G A;  1WTW A;  5C4J H;  1PYS B;  1OXU A;  5EPK A;  4EX5 A;  2PW5 A;  2NYZ D;  4YCV A;  3SE0 A;  4DUZ Q;  2CCZ A;  2AQ2 B;  5M3F B;  2B39 A;  2PPB C;  3K7A B;  1UE7 A;  3LWE A;  5F2D A;  2G5D A;  1UAP A;  3D31 A;  4PZ8 A;  5J3B A;  4R8I A;  1PRT D;  5C0X H;  1QZH A;  4DF7 A;  4ZK9 B;  4CJ0 B;  5M3F H;  3K7A H;  5E1F A;  1DXM A;  3E3X A;  4XYQ A;  2EY5 A;  3TRZ A;  2NVX H;  2B63 B;  3E6Z X;  1X3P A;  5C5M A;  4GN3 B;  3K58 A;  1MHW C;  4IN3 A;  1HH2 P;  2OEO A;  3D8G A;  4QUC A;  4FF3 A;  3PV0 A;  1G2S A;  1Y1V B;  5EAY A;  2HHH L;  1OXS C;  4DV3 Q;  2G9D A;  2JK8 A;  1JCK B;  4LAA A;  4LF9 L;  3R3O A;  3EVQ A;  1EYA A;  1D1I A;  1ONL A;  1A3U A;  3AQQ A;  4AYB G;  4RMF A;  1EYC A;  4YWL A;  2YU9 H;  1UUP A;  1X6O A;  3C1E A;  2WFW A;  4C3H G;  3M85 A;  3U4V A;  3OIQ A;  2SDF A;  4YHH L;  5E7N A;  3PQI A;  5HGT A;  4HIK A;  2UUA Q;  1EU4 A;  3PIO A;  3OPO A;  3TME A;  1KRS A;  2J4X A;  4A3D G;  3CCV A;  2F1M A;  4JW0 A;  1NSN S;  3EQL C;  3ULJ A;  4OO1 I;  1VS0 A;  3W1G A;  2CWA A;  2K28 A;  4GKK Q;  2JSO A;  2HQL A;  4FO2 A;  1P8L A;  1EFI D;  4X62 Q;  3IRB A;  5CV9 A;  2R7Z H;  1SE8 A;  5IWA L;  4Y7N B;  1JT8 A;  4JCV E;  3OWF A;  4A3M G;  2I0Q A;  3PUV A;  4DR1 L;  2Y0S G;  1MKH A;  1TVX A;  1MGS A;  2MHV A;  1SXT A;  1BR9 A;  4C3J B;  3RN2 A;  1YIT A;  3FDT A;  1Q46 A;  1SYD A;  4FXD A;  4CDD C;  2Z0S A;  4JI6 L;  4DV4 Q;  3PO3 B;  5G3L D;  4MTN A;  3PIP 3;  4J15 A;  1QZG A;  2HCC A;  3A8I E;  3AYH B;  1Y1W H;  1E22 A;  3L2P A;  1SYG A;  3CCM A;  3HKZ B;  5C0X G;  3T1Y L;  1S5D D;  2EYL A;  3U4Z A;  4NW2 A;  4NXN L;  4WRD A;  1IW7 C;  4A3K B;  1S5B D;  4B3T L;  2BE5 C;  2VB3 X;  3J7Y W;  5J1Z A;  3R93 A;  2NVY H;  1TWA H;  2SNS A;  2C5C A;  4H13 C;  3I4N H;  2R7D A;  3F2B A;  1GJX A;  5GQO A;  4B3R L; 
#chains in the Genus database with same CATH homology
 5JEA H;  1XX8 A;  4EVO A;  3HOV B;  4PMW A;  1ILP A;  3GTO B;  1NR4 A;  5M5X B;  3GTP B;  1XYI A;  3NXW A;  1ROD A;  5EJW A;  1DOK A;  1AP0 A;  5C4H A;  1SNP A;  1TS5 A;  1SNC A;  4KY7 A;  1LT4 D;  1O78 A;  2F0T A;  1JE4 A;  3NQT A;  4PMC A;  3PUZ A;  4DK1 A;  3ZYY X;  1V1P B;  3R2T A;  3L7Z C;  1YNN C;  4HED A;  2X69 A;  4O1N A;  2KEE A;  2YYZ A;  1Q8I A;  1QOH A;  2A5H A;  3SK8 A;  1HHV A;  4OIK A;  2F0N A;  2O4X A;  5KYI A;  2NN6 I;  4H0L C;  1EU3 A;  3ONA B;  1FNV A;  4B08 A;  1RTN A;  1S4Z A;  2XWB B;  3MA2 B;  3VA5 A;  2VXW A;  2LKV A;  1M4V A;  4J8Q A;  1D5X C;  1XXG A;  1HTP A;  4LMQ D;  1GUO A;  2VNU D;  3CRK C;  3BVZ A;  2JEB I;  1I4G A;  1M8A A;  3A7A B;  5JEA G;  1JWM D;  5E3F A;  4LK1 C;  3KLS X;  3HOX B;  3BVM A;  3DEP A;  2EYJ A;  2KEC A;  3WOE A;  2M2L A;  3S1R B;  5CV4 A;  4N9T A;  4DAY A;  1VMC A;  4R9W A;  3TN2 A;  4ZUI A;  2F0V A;  2XSC A;  1F9R A;  5FKA C;  2A69 C;  2OXP A;  2B2Y C;  1UEA B;  2EYP A;  4J6H A;  5KRU A;  4KV6 A;  1IW7 D;  3FVQ A;  2BE5 D;  2B2U C;  1K8O A;  2L0C A;  1ZYR D;  2JEA I;  1PXU A;  2A68 C;  3X3M A;  1A6X A;  1BCP F;  3HP3 A;  5D65 A;  5FK9 C;  5M5W B;  5KEE A;  2XRQ D;  4A3I B;  3VYR A;  1JOR A;  3ND8 A;  3A54 A;  1ZEQ X;  3PUX A;  1QIL A;  4H44 C;  4IUR A;  2NWG A;  2J7Z A;  3FKI B;  5IT9 L;  2BDO A;  1PRT F;  3Q6S A;  4ZYS A;  4S3S A;  4KK7 A;  3IKJ A;  3HRZ C;  3JAM L;  2N55 A;  1DON A;  3KLS A;  1LT3 D;  2CQA A;  1H9J A;  2WB1 B;  3VA7 A;  5JVH 3;  2L5T A;  4KMU C;  1TT2 A;  3P7J A;  3FMC A;  1A3V A;  3D4D A;  5EBD A;  1DOL A;  2NVT B;  4OGQ C;  5C0X J;  2PZU A;  3NK9 A;  3S2D B;  2QCP X;  4KD3 A;  1STY A;  1PLF A;  3T16 A;  3HZX A;  4ZQ3 A;  3H0G B;  4F8M A;  4IZ8 A;  1AZQ A;  1IYU A;  3AB9 A;  2E2H B;  4C1N I;  4E6I A;  4B9X A;  2DY8 A;  1CT1 D;  4U67 3;  4RH6 A;  5FOB B;  2RQX A;  2F0Q A;  2N88 A;  2QF7 A;  3J80 L;  1CTM A;  2MGS A;  4IFD I;  2TSS A;  1BF4 A;  2X6G A;  1B9N A;  5CYU A;  1ENC A;  4GZY C;  2JA7 B;  1S5C D;  4R8N A;  3GV3 A;  4RFB A;  1Q90 A;  3D6C A;  1HFG A;  2D5D A;  4DAP A;  2BA1 A;  3NWT A;  2JA5 B;  1NUC A;  1F2Z A;  3R8B A;  1VF5 C;  3N52 A;  3DWQ A;  1C8C A;  2EY2 A;  4ID6 A;  2VUM B;  3NP8 A;  2K7V A;  3MHB A;  2A69 D;  4XTC S;  3LWU A;  1A3T A;  1ET6 A;  5IOD A;  1BQQ T;  1A2U A;  1PFN A;  5D3D A;  3DEO A;  4NDX A;  3SK6 A;  1H9M A;  5EKI A;  2F0K A;  1D5M C;  4JBW A;  5ISR A;  3URY A;  1RHP A;  2XIW A;  4QUF A;  2DY7 A;  1ESF A;  4G57 A;  2SEB D;  4C3I B;  4HCE A;  1G29 1;  5JEA J;  3BYT B;  1LTA D;  5DEH A;  3H94 A;  3J7A V;  2DNE A;  3DWP A;  5ELC A;  2EJG C;  3CRL C;  4ZRZ A;  3A56 A;  4WOR A;  4TKO B;  3T56 B;  5COR A;  1HQM C;  1LTB D;  1EOT A;  1SAP A;  2H4O A;  1BO0 A;  2ICI A;  1B4O A;  2EYH A;  1GUS A;  4KI0 A;  1Z7T A;  2B2V C;  1SNQ A;  5E4W C;  1GOZ A;  1QE6 A;  2B2T C;  4HCS A;  4HAE A;  1SBB B;  5C4Z A;  2QIL A;  3E5S A;  3C46 A;  5FO9 B;  1G8Z D;  4XT3 B;  4IUU A;  1Q1B A;  1EY7 A;  2L12 A;  3GTJ B;  2O2L D;  1I50 B;  1JOQ A;  2NTS A;  1KDA A;  2WIN B;  1CM9 A;  2WKC A;  3QJY A;  4C3H B;  2F4I A;  4IQZ A;  3OMC A;  1D6E C;  5TSS A;  4CKB A;  5EQ0 A;  3K0Y A;  2K05 A;  3V05 A;  2EOT A;  4CJ1 B;  2WII B;  5FO8 B;  4RGO S;  1WTV A;  4KY5 A;  3J81 L;  4G7Z C;  1STN A;  1CFM A;  3I90 A;  1VMP A;  2B2U A;  5CV5 A;  5JAV A;  1GUN A;  3KLR A;  3H91 A;  3QG1 A;  3S1N B;  2IW3 A;  1EEF D;  1LT6 D;  2EXZ A;  5KIX A;  1K8M A;  4F7X A;  5C6A A;  3M4Y A;  1SSO A;  1DYQ A;  1W6J A;  4FF1 A;  3VR6 A;  1IL8 A;  4A3M B;  1I4X A;  1V1O A;  1QG7 A;  2B8F A;  4ME5 A;  4X3K A;  1PZJ D;  4KHV A;  1Z47 A;  5FLX L;  2K5D A;  2IPK D;  2EYF A;  3GD7 A;  4K8J A;  1F2M A;  1STH A;  2PMZ B;  5EPL A;  5HUR A;  1WD0 A;  3NPP A;  3MEH A;  3D4W A;  2EE1 A;  1CI3 M;  3OOC A;  1SJH D;  2EVB A;  3VR3 A;  3MTS A;  2IX1 A;  2F3V A;  1NCV A;  2L55 A;  3SHL A;  2EY1 A;  2AUK A;  2FIN B;  1I3Q B;  4ZAI A;  2SNM A;  2TMP A;  1OXT A;  3H6M A;  3BVG A;  1MD2 D;  1MI2 A;  2MJ8 A;  3QIA A;  2K5Q A;  4NP5 A;  4M1U B;  1PTO B;  3CHB D;  2E2D C;  4F88 A;  5T1G A;  3T13 A;  1F2Y A;  3VYS A;  4X3T A;  2M9V A;  2NB0 A;  1JWS D;  4BS9 A;  2K32 A;  1EEI D;  5IGB A;  1FD7 D;  3X3N A;  3K57 A;  2IX0 A;  1CZW A;  4K5X A;  2I46 A;  1I6V C;  3K59 A;  3TP6 A;  2RSN A;  4KHZ A;  3OHX C;  2R6G A;  3ERO A;  2F0H A;  2L1B A;  3BZD B;  1KDB A;  1ZXT A;  4I7Z C;  2E76 C;  1KAB A;  2CHB D;  1EIH A;  2RDG A;  3SVM A;  2A74 C;  1WTP A;  1SYF A;  1TWF B;  4HN7 A;  3WDN A;  3A7L A;  2DN8 A;  1KNE A;  5CV7 A;  4QB4 A;  4RGM A;  3HOY B;  2B8G A;  4FXG C;  3KK7 A;  1LTG D;  2KQ3 A;  2JYO A;  3NSW A;  3H3V C;  4PNY A;  1HUM A;  3PMF A;  2QKI C;  4C2M B;  4XQJ A;  1SEB D;  2A6H C;  1BUV T;  5JVG 3;  1RD9 D;  2PZT A;  1EWC A;  2MPM A;  3KBG A;  2K03 A;  4K5V A;  1V8Q A;  1HA5 A;  3FPP A;  4KJN A;  1MSH A;  2E74 C;  1LO5 D;  4CHT B;  4HSV A;  4N9P A;  2Z1C A;  2KUM A;  3NWS A;  4IUQ A;  4RCN A;  2CVR A;  1VF7 A;  2LY7 A;  4UAI A;  1FR3 A;  1BBX C;  1C48 A;  1AN8 A;  3D3R A;  2B2V A;  1LTS D;  3SEB A;  4QF4 A;  2D62 A;  3TP8 A;  5M9O A;  4HSP A;  5IGD A;  3CKI B;  5KGU A;  4C3J G;  1HPC A;  3HG9 A;  4FYD A;  3W2D A;  3V2T A;  2NVQ B;  1SYC A;  3RZD B;  2E75 C;  1CQF A;  1AEX A;  2B2W A;  4M8A A;  2NZ1 D;  1FGB D;  3M7N A;  3MAQ A;  1SYE A;  3CQZ B;  2Z4I A;  3P1H A;  5M5Y B;  4Q0F A;  2R93 B;  5EBC A;  3R2I A;  1IKL A;  4HMJ A;  2D9U A;  2L4N A;  1H9S A;  3MWY W;  1MSG A;  4FNF A;  1RJT A;  3I70 A;  2WP8 J;  4A93 B;  2KED A;  4JK1 C;  4QIW B;  4G7O C;  2A6E C;  5D14 A;  4RGN A;  4A3J B;  3L3O C;  2IWH A;  1ILQ A;  1EY9 A;  4ODG A;  2SOB A;  1GHJ A;  1Q12 A;  4FP5 D;  3I4L A;  1PZI D;  1Y8O B;  3V96 A;  5LL6 X;  1H9K A;  3NBH A;  4XQN A;  1SFO B;  1W6K A;  1SMY C;  5CBA E;  3ND9 A;  2ZXP A;  1F77 A;  2K1B A;  5CGK A;  3GTM B;  4DA2 A;  5LL6 S;  1BNZ A;  2Q8R E;  4KJO A;  4TRD A;  4UDU C;  5C4X B;  1I4H A;  2R92 B;  1E2W A;  5C0X I;  2ID0 A;  1JWU D;  4DNT B;  2A6H D;  1C4Q A;  3J80 E;  5DM6 3;  4HR7 B;  1H9S B;  1TY2 A;  2DNC A;  3T53 B;  3KF8 A;  4Q5V A;  1ICW A;  2D2C C;  1U9R A;  3IFD A;  2E2I B;  1KNA A;  5C3E B;  2Z8L A;  5BN4 A;  4QCL A;  3TBI B;  1FYC A;  2F03 A;  2E2J B;  2IL8 A;  1JC7 A;  1DZ1 A;  2AQ3 B;  3AU7 A;  2EDG A;  1LLR D;  3BG3 A;  3W3A A;  1YNN D;  2FMM A;  4KD4 A;  1LAB A;  2L9H A;  4K14 A;  5K36 H;  2CW0 C;  2JA8 B;  4K8I A;  4CKE A;  2PZW A;  2RVL A;  4X3S A;  1L0X B;  3Q0A A;  1FNW A;  4NKL A;  2RA4 A;  3S16 B;  3MFY A;  3C1F A;  5CMD A;  2FMC A;  1IHZ A;  1T5E A;  4PMB A;  4OO1 H;  1Q1E A;  5EKL A;  4LJZ C;  4L63 B;  3GTQ B;  4C56 C;  3GTG B;  1CZG A;  2H1E A;  1HFN A;  4BBR B;  3P75 A;  3MVV A;  1B9M A;  1SDF A;  2KJX A;  1X32 A;  1SYB A;  2Q8T A;  2RDH A;  1OXX K;  4V19 0;  1T5X D;  4FVM A;  2XVS A;  1ZKO A;  1NAP A;  3MFG A;  1KLG D;  4BBS B;  2O5I C;  1TQO A;  4PQX A;  3TP7 A;  3GTL B;  3VR4 A;  5IGF A;  5I4D A;  1EY6 A;  1EY0 A;  4DAV A;  3QWN A;  3K5L A;  2PW7 A;  2MUY A;  2Q8I B;  2K01 A;  3S15 B;  2ZT9 C;  1LTR D;  1SMY D;  1FNU A;  2F0E A;  4ULL A;  2WKD A;  3GO5 A;  5BN3 A;  3S17 B;  1SE4 A;  2A68 D;  3RZO B;  3QB3 A;  5CV8 A;  4K2K A;  1EZ6 A;  1EQT A;  2R3Z A;  3GTK B;  2C9O A;  5A2Q L;  1B3A A;  3HOZ B;  3QO2 A;  1RKN A;  1ML0 D;  2QDB A;  3J81 E;  1A15 A;  2GA4 B;  5D3I B;  3M3Y B;  1TS2 A;  3MZ5 A;  5BN5 A;  1EIG A;  1G2T A;  5I2Y A;  4K6L A;  2HQE A;  1UNS A;  3DXJ C;  3Q24 A;  5NUC A;  5KNC A;  5IGG A;  4PV1 C;  1SE3 A;  4BY7 B;  4V0B A;  5ELF A;  1HA6 A;  1EY5 A;  2K33 A;  3K6O A;  2XNA C;  2WAQ B;  1F9P A;  3OWE B;  2CW0 D;  2FHT A;  1QB5 D;  2NN6 H;  4BA2 I;  3S2H B;  3PUW A;  3NQI A;  1OXV A;  1G6Z A;  3RUZ A;  3I72 A;  2LMC B;  3WOF A;  4AYB B;  3I73 A;  4RHS A;  1XWE A;  3OIP A;  4XIG S;  2B2Y A;  1Y69 U;  4A3D B;  5I9O A;  1B2T A;  5K5P A;  4IAL A;  4OHJ A;  5LHY 1;  3A55 A;  1AFP A;  3LNN A;  4DK0 A;  2F0W A;  1PFM A;  2EYM A;  1JOO A;  3FEW X;  1ENF A;  1ESR A;  2IJ0 A;  3T51 B;  3H09 A;  4DXF A;  2HDL A;  2KHS A;  2ZXO A;  1RDP D;  1BDO A;  3K5O A;  2O5J C;  3EA6 A;  2Y0S B;  2ICE C;  3GV6 A;  4C3I G;  4IUP A;  5C4J B;  3ITP A;  3A8K E;  3MC0 B;  2FJ2 A;  5DM7 3;  1CK1 A;  2JP1 A;  3PIO 3;  2EJM A;  3FRP B;  4XXE A;  3DM1 A;  4MIU A;  2NVX B;  2I07 B;  5C3X A;  5I6W A;  3SK4 A;  5E4X A;  1PFB A;  2NN6 G;  1HUN A;  4ABN A;  1GUW A;  1ENA A;  2KVM A;  1NR2 A;  4XYO A;  1MBY A;  2VB2 X;  3ERQ A;  1F9S A;  1DD2 A;  1TY0 A;  1D2B A;  2PNR C;  3U9S A;  1AZP A;  2YU9 B;  3BS1 A;  3GP7 A;  2JE6 I;  1EY8 A;  1U4P A;  2M00 A;  1PTO H;  1SND A;  1TKW B;  2ENB A;  3RD4 A;  2RBM A;  1V43 A;  5T1I A;  4WJW A;  5JOB A;  3Q23 A;  4KKU A;  1WTX A;  3QOJ A;  1Y8P B;  2OT2 A;  4TSS A;  1A2T A;  4U68 A;  1RF2 D;  1KAA A;  1BXT A;  3NBI A;  2R7Z B;  5ELE A;  3O13 A;  1QJO A;  3K5N A;  5DAU A;  4B9W A;  4EQO A;  4HTH A;  2KOL A;  1GUT A;  3DMU A;  2HUG A;  5AFW A;  1PYW D;  4EGV A;  1JB3 A;  3NTI A;  1Y1W B;  4IFD H;  3P20 A;  3CU7 A;  4L6T B;  1RCV D;  3BYY B;  2X6L A;  4ZUJ A;  1GUG A;  5KYL A;  1KLU D;  1V1P A;  2HCI A;  2NVY B;  1TWA B;  1DM0 B;  3C3L A;  1U4R A;  1I4R A;  3I4N B;  4MN3 A;  1ZYR C;  2F0I A;  4RWS C;  1QWY A;  4CJ2 C;  1JR0 D;  1I4P A;  1QCB D;  2AUJ D;  4C1N K;  1WVL A;  3HGB A;  2XRS D;  1TU2 B;  3BDL A;  1BCP B;  4G4K A;  2EY6 A;  3G7L A;  1EL0 A;  2PQE A;  1TWC B;  1HTL D;  1D1K A;  2F0F A;  3HOW B;  4IUV A;  1HRJ A;  5IGC A;  2G9H D;  1PRT B;  5ELB A;  1EZ8 A;  1TII D;  3KUP A;  3HOU B;  3M4O B;  1X3Q A;  3S9W A;  2B2T A;  1PTO F;  1F9Q A;  4DGZ A;  4J1M A;  3NE5 B;  3SXH A;  2JA6 B;  3S14 B;  3DHQ A;  4YIJ A;  5KNB A;  5J39 A;  5DNF A;  1CHQ D;  4WFN 3;  4IFD G;  3EJI A;  3VR5 A;  4ZKC B;  1KDC A;  1STB A;  5IT9 E;  2MP1 A;  4K5W A;  4QMG A;  4KTA A;  1SNO A;  2KCC A;  3JAM E;  4H7B A;  1JIC A;  2KCN A;  3LX0 A;  1CHP D;  1H9R A;  4FXK C;  1LTT D;  4DNR B;  2WAC A;  5JJZ A;  1SE2 A;  3TZD A;  2EPB A;  2WV6 D;  4FF4 A;  1PDQ A;  5I6Y A;  1S5F D;  5EGT A;  3J7A F;  4DU9 A;  2BA0 A;  1I6H B;  2PO4 A;  3N6R A;  1B53 A;  4CKC A;  4Z9C B;  3SR1 A;  1IYV A;  1PMR A;  2F0J A;  2IX3 A;  3NTK A;  2AQ1 B;  1J8I A;  4A3F B;  4RKL A;  4DN4 M;  2BDN A;  2BCO A;  2L11 A;  3IL8 A;  3NHH A;  3DWA A;  2NBF A;  4KKS A;  1HQR D;  2ZXR A;  3I8Z A;  1O80 A;  4HMI A;  1LT5 D;  1OO9 B;  2J0T D;  5CV6 A;  1TS3 A;  3UI2 A;  4RCO A;  1F2L A;  3VYU A;  1PTO C;  2IT1 A;  1DCZ A;  3OW7 A;  5C44 B;  5JPM C;  4X3U A;  4IUN A;  1TR5 A;  4RA8 A;  2LFN A;  1TWH B;  3NUC A;  4RKB A;  4A3E B;  1EQV A;  1K83 B;  4KY6 A;  2F0G A;  2K6A A;  3E0J A;  4ZKB B;  1WD1 A;  1S5E D;  1R4P B;  2XWJ B;  2KA7 A;  2K5W A;  4DFA A;  2NUC A;  3HEJ A;  4KN4 C;  4KKT A;  2F0S A;  4OIJ A;  5CC4 A;  3T4A C;  2FFK B;  3RMH A;  2AWO A;  4MHE A;  1TWG B;  4O42 A;  3VYT A;  3MXU A;  1EYD A;  4P2C B;  3A8J E;  4EQN A;  2LS0 1;  3EFX D;  1CA6 A;  2F0M A;  1KTK A;  2RSO A;  1LAC A;  2R61 A;  4TQU S;  3AMU A;  3C2P A;  2Z4H A;  1GXD C;  1QNK A;  3MXG A;  5EPJ A;  5A2Q E;  3DUZ A;  2F0O A;  5A35 A;  1O7Z A;  5IIF A;  2F0L A;  1PZK D;  4XDX A;  5KND A;  4DXG A;  3I3C A;  1E0B A;  1YNJ C;  4XT1 B;  5ELD A;  1DOM A;  2V4D A;  1E2V A;  2F0P A;  1STG A;  1D5Z C;  1CA5 A;  5I9P A;  2JXM B;  2A73 B;  2A6E D;  3RLF A;  5J22 A;  4IUT A;  4EQP A;  4RHR A;  1Y8N B;  1U4L A;  1IKM A;  5G3L F;  4NMZ A;  1SJE D;  2RDF A;  1BCP C;  3NTH A;  3F2U A;  1WCM B;  1B44 D;  1SNM A;  1B1Z A;  3FPU B;  4XQQ A;  2EZV A;  4BA1 I;  4A3B B;  1HXY D;  5I2X A;  3MXN A;  1PRT C;  3KBX A;  3SDZ A;  5K36 G;  1J9O A;  1WTR A;  3PUY A;  3I91 A;  2F3W A;  1L0Y B;  3S1Q B;  4IFD J;  3BDO A;  2XN9 C;  2NTT A;  2F0D A;  1PTO D;  4OO1 G;  2BOS A;  1DJR D;  3QOL A;  2PCF B;  1BOS A;  4ILW A;  3MXP A;  1ET9 A;  3SK5 A;  2K04 A;  1Q3L A;  4CGY B;  3Q22 A;  5IOC A;  4FF2 A;  3IFT A;  1VDZ A;  5CBE E;  4A3G B;  2AWN A;  4KN7 C;  1R9T B;  3K5M A;  3L9A X;  3OMG A;  5JPN C;  1I4Q A;  4BWG B;  5FLX E;  5C3W A;  2QEJ C;  4ZLT F;  1LV9 A;  3I4M B;  5COY A;  4I65 A;  1O7Y A;  1G91 A;  3S1M B;  2RKS A;  4RAU C;  4CBV A;  1U4M A;  1EWH A;  4RGT A;  2PYK A;  1EY4 A;  4L8J A;  1XTC D;  3IAY A;  1WTO A;  1RTO A;  1LTI D;  3D4R A;  4K6D A;  5C5L A;  1TS4 A;  5M3M B;  1B50 A;  5FO7 B;  3TSS A;  3TZU A;  2EJF C;  1II3 A;  2B2W C;  3PO2 B;  2F0U A;  1R4Q B;  1AW7 A;  1JQY D;  1QNU A;  5EKK A;  1STE A;  1YNJ D;  3HS0 C;  1HCZ A;  4F87 A;  1VCI A;  2EYO A;  4OL7 A;  3G6J B;  2OF1 A;  3VR2 A;  1GHK A;  3D6W A;  3GQB A;  1O7L A;  3BDC A;  1CQV A;  3OSO A;  2HDM A;  5IGE A;  3TDQ A;  4K2L A;  1JOK A;  3U9O A;  1Z6H A;  1E2Z A;  4G7H C;  1WTQ A;  1BCP D;  3TP5 A;  5CR3 A;  4BY1 B;  1STA A;  3M7G A;  1WTW A;  1OXU A;  5EPK A;  2PW5 A;  2NYZ D;  3SE0 A;  2AQ2 B;  5M3F B;  2B39 A;  2PPB C;  3K7A B;  3LWE A;  5F2D A;  1UAP A;  3D31 A;  4R8I A;  1PRT D;  5C0X H;  4DF7 A;  4ZK9 B;  4CJ0 B;  5E1F A;  1DXM A;  4XYQ A;  2EY5 A;  2B63 B;  3E6Z X;  1X3P A;  5C5M A;  3K58 A;  4IN3 A;  2OEO A;  3D8G A;  4QUC A;  4FF3 A;  3PV0 A;  1G2S A;  1Y1V B;  1OXS C;  2G9D A;  4LAA A;  1JCK B;  3R3O A;  3EVQ A;  1EYA A;  1D1I A;  1ONL A;  1A3U A;  1EYC A;  1UUP A;  3C1E A;  4C3H G;  3M85 A;  3OIQ A;  2SDF A;  5HGT A;  1EU4 A;  3OPO A;  3TME A;  2J4X A;  2F1M A;  1NSN S;  3EQL C;  4OO1 I;  2K28 A;  2JSO A;  4FO2 A;  1EFI D;  5CV9 A;  4Y7N B;  3OWF A;  3PUV A;  1TVX A;  1MGS A;  2MHV A;  1SXT A;  1BR9 A;  4C3J B;  3FDT A;  1SYD A;  4FXD A;  3PO3 B;  5G3L D;  3PIP 3;  2HCC A;  3A8I E;  1SYG A;  3HKZ B;  5C0X G;  1S5D D;  2EYL A;  4NW2 A;  4WRD A;  1IW7 C;  4A3K B;  1S5B D;  2BE5 C;  2VB3 X;  3J7Y W;  5J1Z A;  3R93 A;  2SNS A;  2C5C A;  4H13 C;  1GJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...