5BR8L

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5br8L00
1X3EA 4A93H 3CAMA 4IOAA 5IYDH 4LF5L 1OXTA 2ES2A 1JJ2A 4MNOA 4LF4L 3RR5A 1BKBA 3MXNB 5FJ8G 1VQ5A 3J81i 4BBSH 4DUZL 2ZJRA 1NBWA 3K80C 1N34L 4K0KL 3GTKH 2UUCQ 1VQNA 4GN4B 4XTCS 4JI1L 3T1HL 2JA8H 5HY6A 4JI8Q 5IYDG 1KAWA 1V1QA 4JI2Q 3FKIH 4DR3L 3J7A5 3HFZB 4BBSG 5BR8L 1IBKL 3H0GH 1PYSB 2GVBA 1G51A 4YCVA 1XMOL 2YTVA 4LF8Q 1A62A 2VW9A 3GTOH 4DAMA 2CKZB 4JCVE 2VQEL 2JA8G 3CW2C 5C4JH 4LF6Q 4K0KQ 5M3MH 4A3CH 3FKIG 4AYBE 3W1GA 4C3HH 2JJQA 3AFQA 3HKZE 3H0GG 3I4OA 4JI3L 2H5XA 1WI5A 5IWAQ 2ZTEA 4YWLA 1TWHH 4DV4Q 2NVQH 2Q2IA 2JA7H 2LXKA 4A3KH 3A0JA 2CQOA 2I5HA 2R6GA 1CKMA 4DR1Q 3MEFA 4IO9A 2I5MX 4GNXA 1PH4A 5M3MG 2R93G 4A3CG 2UXDL 4B3ML 2WAQE 3CPWA 1HR0W 4OO1I 3J80c 2ATWA 3ER0A 3CC7A 1AH9A 2JA7G 5ELNA 5C3EH 1I6HH 4A3KG 3H3VH 3S1MH 1OXUA 4OO1G 4PZ6A 2JA5H 1LYLA 2UU9Q 4NXMQ 3H3VI 1JMCA 4HIMA 1S72A 3TS2A 5K36G 4DV1Q 1A0IA 4YCUA 2PNHA 4DV7L 3D0FA 1M90C 1K83H 5IT9c 5C3EG 4B3TL 3PF4A 3M3YH 3AYHB 4HIOA 1EOVA 2IT1A 1PH1A 2UUCL 1YIJA 4JI4L 1EWIA 4DR2Q 1HZAA 2JA5G 4DUYL 2K5VA 2AWNA 4LNQA 2F4VL 2YTXA 4GOPA 1PYBA 2EXDA 4P75A 3PUWA 1U5KA 4AYBG 5M3FH 4L5SA 1K73C 1TWCH 3HKZG 5DLQE 3CC2A 1C0AA 1VQCA 4MZ9A 2RHSB 4YHHQ 4DV6L 5JEAG 1PH6A 1SR3A 1KRTA 1EFWA 2N8NA 3F2DA 3S16H 1HNWQ 3I7FA 1VQEA 2CFMA 5IWAL 1RIPA 4LUOA 1UE1A 1IXRA 4B3SL 4AQYQ 3T1YL 5IP7H 2WAQG 2JK8A 1N33Q 2F3IA 4BY7H 4R4CA 4A3MH 1KXLA 1D7QA 4IPHA 1IBLQ 2Q2HA 1QUQB 4JBWA 4RG1A 3AQQA 3W1BA 4DR1L 1XPRA 3S15H 1CUKA 4JI7Q 1OXSC 4JG2A 3EIVA 1JT8A 4R4QA 4BXXH 3PIOA 1TWGH 4GLAC 1KHIA 4DPGA 4XIGS 5IP7G 4POFA 4BY7G 4B3RQ 4JV5Q 4DV3L 1A63A 4A3MG 1J6QA 2KBNA 4P73A 2R7ZH 1GO3E 1N32L 2E8GA 3CCLA 2JEAI 1HJPA 1VQ4A 1XMQL 2BA1A 3BU2A 3CD6A 4DR6L 2UU9L 1JJGA 2E2JH 4NXML 4UP7A 4BXXG 1BBWA 2V1CC 2UUAQ 1LM0A 2HIVA 2VL6A 2VS1A 1XNQL 2Y0SE 3TQYA 2KCMA 1E3PA 2UXBQ 4QIWE 1PH3A 4KHPQ 1CKOA 2IY5B 4X65Q 1EIFA 3RZDH 3A5ZB 4OX9Q 2UXCQ 3PO2H 3PUVA 4X64Q 3CCMA 3K7UC 1OTCA 1HR0Q 4DR7L 4BBRH 3RLFA 2JA9A 4R1JA 1HNZQ 2PMZE 1K0RA 4JI0Q 4KLKA 3DLLA 3HOUH 1KL9A 4HJ9A 4APVA 1L1OC 2QGQA 3GTJH 2Z6KA 3CCRA 3L7ZC 3PO2G 1HZ9A 1B70B 3D31A 4YWKA 2VQFQ 3HOYH 4BBRG 1VQ9A 1IBML 1FL0A 1YHBA 3K8AA 4BY1H 1JE5A 4HIKA 3HOUG 1Z47A 2DUDA 4X66L 3J81j 3G4SA 3HOZH 3K7AH 1VQJA 1V9PA 4IJLA 2RF4A 2MFIA 2XGTA 1GD7A 1W3SA 4JI5Q 3KDFB 5C0XJ 4JI7L 3KF8B 1X54A 3H15A 4BY1G 1XNRL 1GM5A 2D0OA 1J5EQ 1PH5A 3HOZG 1K3RA 1VQFA 2AKWB 3PF5A 1YHAA 3NBHB 4GOPB 3CXCA 1BVSA 2Y0SG 3OW2A 4GKJL 2PI2A 3M9BA 4LF9Q 3LGJA 3W5OA 1Q46A 5LMUQ 3CCVA 1HH2P 4GS3A 1QUQA 3OTOQ 1EQQA 4IFDI 4DV0L 2JQOA 3B6YA 1NJIC 2UXBL 4KHPL 2K4KA 4A3IH 1E1OA 1DGSA 4X65L 1CKNB 4EQ5A 5J3BA 4AH6A 5H1SE 2K5HA 2ID0A 5IP9H 5LMNQ 1A8VA 1VQBA 3STBC 4IFDG 3J7ZC 4HJ7A 4X62L 2EIFA 1G6PA 3HKSA 3G71A 1PH9A 1GKHA 3EBEA 5M5XH 2PI2E 3EN2A 2FXQA 4A3IG 3ICEA 5HGQA 5IYBH 4O2DA 1K8AC 4A3DH 3S17H 2R93H 1M1KC 5IP9G 3E0EA 1YEZA 2HHHL 4JI6L 1VQLA 1AE3A 3CCJA 2VUMH 3NENA 3J81c 1YZ6A 4DR4Q 1GVPA 1UE7A 1Y14B 1PHJA 2MO1A 5IYBG 1Q1BA 4A3DG 4P71A 4HJ8A 1NMGA 4FDBA 3RN2A 1I50H 3J80i 5M5YH 4DV5Q 2HT1A 1WCMH 3BZKA 2IHEA 3L2PA 2VUMG 4NPSA 3M85A 1UWVA 2CCZA 3E9IA 3CQZH 3L0OA 3JAMi 3KJOA 1YITA 5GQOA 2NVTH 3FHWA 3RN5A 1U0LA 4QQBX 1B7YB 3G48A 2AWOA 1X9NA 4JYAQ 1VS0A 1X56A 2AMCB 1YJ9A 1WCMG 2NVYH 2MO0A 1S40A 3IRBA 4JOIC 1QVGA 2I5LX 3CF5A 1KQSA 4TVAB 4OWXB 2OTLA 3PO3H 4LFBQ 3KDFA 1EYGA 1NY4A 5M5WH 2WFWA 4Y52H 2IX1A 2VZAA 4JBMA 2OQ0A 1WJJA 3S2DH 4JI8L 1B8AA 4JI2L 1YVCA 4UPAA 5LMNL 4A75A 1VQMA 1QZHA 2UXCL 2L15A 5GAHC 4LF8L 1IYJB 3PO3G 4DAYB 5C44H 3S14H 1MJCA 1SN8A 3G6EA 3I4MH 4OONA 4LF6L 2XTIA 4DKAC 4DK3C 3F1ZA 2NN6G 4OX9L 4OWTB 2E5LL 2D0PA 4IPDA 5C44G 4DV4L 1YI2A 1CKNA 4R4OA 2OWOA 4DR4L 3UDGA 4A3GH 1KC8C 3UDXA 3A5UA 4J15A 3STBD 1HNXQ 2NZOA 2K75A 5JJKA 4LUZA 1WYDA 4DV2Q 2D62A 4L5RC 1Z9FA 1MKHA 1VCIA 1TWFH 3AFPA 4DR5Q 4A3GG 3KYHC 1YBYA 1WOCA 2N78A 1N36Q 1P8LA 5FLXc 4A3EH 3KF6B 3RZOH 4DV1L 4RMFA 4JBKA 4HIDA 2ALYB 1E22A 3GTQH 2EQSA 3PSIA 4MTNA 4DR2L 4PMWA 1IL2A 4A4IA 4A3EG 1PVOA 1Q12A 1PH8A 4TQUS 3HOVH 2UUBQ 1JJCB 2QEXA 2LXJA 3TREA 1V43A 4GN5A 4ALPA 2CWPA 2E5LQ 4IOCA 2NVXH 2RCNA 3M4PA 2A1AA 4P72A 2ZJQA 1CSPA 4YHHL 4QGUA 3UDIA 1EIYB 2GN5A 1VQKA 4LF4Q 1Y1VH 1X6OA 4LF5Q 5FLMH 3CP0A 2K5NA 2F52A 4UP9A 2PQAA 3HOVG 1HNWL 4C2MH 5E7NA 3F2CA 3HOWH 1L2FA 2GVAA 4C3IH 2R7FA 3ULJA 1NTGA 3U4ZA 4AQYL 1N34Q 1C7YA 3E9HA 1N33L 2B63H 3AEVA 4JI1Q 1Y1WH 2ZTDA 3OYYA 3T1HQ 1QVCA 1NMFA 1YHQA 1IBLL 1FJGQ 4DR3Q 2R7ZG 1Y1VG 5FLMG 5BR8Q 1IBKQ 2ASBA 3HOXH 3U58A 1XMOQ 4A76A 1L1OA 3I4MG 3HOWG 4WJ3M 4DV2L 2B63G 4B3RL 4JV5L 1Y1WG 4BA2I 4YWMA 2AHOB 4L5QA 1N36L 1E1TA 1EQRA 3HOXG 4JI3Q 3UE0A 4LFCQ 1HZBA 4WJ4A 2UUAL 3PCOB 2WB1E 5GADC 1E24A 3M4OH 2YU9H 5C4XH 2A8VA 2UXDQ 1MIUA 4LWCA 4B3MQ 1XTDA 4GN3B 4LFAQ 4X64L 2Z0SA 4JC0A 3I55A 1HR0L 1HNZL 1MJEA 4C3JH 4JI0L 1SLJA 1EUJA 3RLOA 1X55A 4IPCA 4DNIA 2DGYA 5C4XG 3KF6A 4UY8C 3S2HH 2N3SA 2OCEA 3NEMA 1TXYA 3CCSA 3GDEA 5GROA 2VQFL 2ZTCA 3KLWA 4QL5A 4DV7Q 4B3TQ 1SROA 1VQIA 2MQHA 1Q81C 1VQOA 2KENA 1R9TH 4JI4Q 3CMEA 5C0XI 1VQPA 1K8GA 1FJGL 4DUYQ 4A93G 4JI5L 1VQDA 2E2IH 2F4VQ 4GNXC 3GTPH 3TRZA 4GKKQ 5AJ3Q 3A74A 3FP9A 5C0XG 1J5EL 3TS0A 5JEAJ 1D8LA 3DM3A 2QA4A 1Q86C 5JJIA 1I94Q 4DV6Q 1W2BA 2WB1G 4LUVA 4GLXA 1VQ8A 3WWVA 1Q7YC 1S3OA 3CC4A 4LF9L 4LFCL 1XPOA 3GTLH 2B3GA 5LMUL 4B3SQ 3T1YQ 4LF7Q 4POGA 5EAYA 3OTOL 2R7DA 2PQAB 1G291 1RL2A 2KHJA 3GTGH 2HQLA 2WP8J 1LTLA 2HIXA 3S1NH 1OXXK 1VQGA 3PUXA 4A3JH 4LFAL 2BH2A 2OTJA 3U50C 3CCUA 4X6AH 3PIPA 3U4VA 4DV3Q 1N9WA 2NN6I 1VQ6A 1C9OA 1L0WA 3NELA 1L1OB 4P74A 2N49A 4GOPC 1N32Q 5GAGC 1XMQQ 3JAMc 4DR6Q 4JOIA 4A3JG 1YJNA 1FGUA 1XNQQ 1TWAH 2BA0A 3PUZA 2OQKA 3ERSX 2YYZA 2K52A 4IPGA 5GAEC 1KRSA 3PGZA 3F2BA 1SMXA 1X3FA 1K9MC 1PV4A 4O0AA 4DR7Q 4OWWB 4DK6C 1WFQA 4L5TA 1UE6A 2B29A 2ZM6Q 4DV5L 2E2HH 4H02A 3I4NH 4PZ8A 5IE8A 5AJ3L 2KCTA 4GKKL 4YY3Q 3CCQA 4NXNQ 2R92H 3I56A 4R4TA 4AIMA 5JJLA 2LSSA 1I94L 3BJUA 2YTYA 1SE8A 3GD7A 3RNUA 2K50A 1IBMQ 2IX0A 4JYAL 4OXPA 3I4NG 2YV5A 5M3FG 4X66Q 2K14A 3TEHB 1VQ7A 2R92G 4LF7L 4JBJA 4LFBL 5IYCH 3ULLA 1PH7A 2Q2TA 4A3BH 1O7IA 4UP8A 1CSQA 3ULPA 1XPUA 3GTMH 1Q8KA 3M4QA 3BZCA 1XNRQ 3KOJA 3ZJYC 2VNUD 1UEBA 5LMNW 1LUZA 2BH8A 1N8RC 1Q82C 3K0XA 1JB7A 1QVFA 5IYCG 1ASZA 1AE2A 4A3BG 3RLNA 1T9HA 4GKJQ 2KHIA 4KI0A 1X65A 3K81C 3SGIA 1FVIA 1KIXA 1NE3A 1UE5A 3GO5A 1QZGA 1I3QH 2Z6KC 4DUZQ 4QJFA 3S1RH 2I0QA 3CMAA 4A3FH 4QY7A 5IY0A 3PUYA 4EX5A 3KJPA 2NZHA 4DV0Q 2MNAA 3VDYA 3UDFA 2JA6H 3M7NA 1OXVA 3JC66 4BA1I 1YNXA 4IFDJ 4NB3A 1X3GA 2A19A 1VQAA 4ME3A 1SRUA 4GNXB 1HNXL 3S1QH 4LW1A 2Q2UA 4X62Q 2ZM6L 4A3FG 4GLVB 4YCWA 2JA6G 3F8TA 1BBUA 4NXNL 4YY3L 2VQEQ 4DR5L 1KD1C 1I5FA 1ASYA 3I2ZA 3Q8DA 1PH2A 1IZ6A 5ELOA 2HHHQ 2VY3A 3S24A 4JI6Q 1PFSA 1HZCA 4HJ5A 3UE1A 2C35B 2RHQB 4A3LH 1E7ZA 1XJVA 1P16A 2JE6I 3CCEA 4KHZA 4IJHA 3KFUA 2CWAA 2ZJPA 3HOYG 4Y7NH 4R4IA 2JEBI 4PG3A 4PZ7A 5FJ8H 2UUBL 4A3LG 1VQHA 2IHFA 3CPFA 1PA6A 3PV0A 1H95A 1Q1EA 1SFOH 1YJWA 4HJAA
chains in the Genus database with same CATH superfamily
2Z9HA 4IOAA 4MNOA 3K80C 1N34L 4K0KL 4C2MB 2UUCQ 4F8MA 2JA8H 3J7A5 1V1QA 3AU7A 1PYSB 2GVBA 2IW3A 4YCVA 2F0UA 1MGSA 1MD2D 1LABA 2JA8G 2PMZB 3HRZC 1TY2A 1SMYD 4AYBE 4C3HH 2JJQA 3AFQA 1B3QA 2NVQH 2JA7H 1Z6HA 2CQOA 2I5HA 1DD2A 4IO9A 5M9OA 4OO1H 2UXDL 2L0CA 1Q3LA 2WAQE 3CPWA 4OO1I 4ZYSA 4TRDA 5T1IA 2KHSA 2JA7G 4ABNA 1AH9A 2EDGA 5CMDA 3H3VH 4HSVA 5CORA 4OO1G 4NXMQ 1RHPA 5IGBA 3H3VI 4HIMA 1S72A 5BN4A 1E2ZA 1A0IA 3D0FA 3KLRA 2A74C 3PF4A 3M3YH 3VR2A 2JN4A 1K8OA 1EOVA 2UUCL 4JI4L 1YIJA 1YNNC 1LT3D 5JEAH 2SOBA 2AWNA 2ZXRA 4LNQA 4GOPA 2F4VL 2EXDA 2NBFA 2F0OA 5M3FH 1BR9A 5M5YB 3MA2B 1K73C 1H9SA 5C5LA 2SNSA 4YHHQ 4IUNA 5JEAG 4WRDA 4DV6L 1PH6A 1EFWA 1HUMA 2N8NA 3R2TA 1EU4A 4LUOA 4AQYQ 1N33Q 2JK8A 3GTLB 1MSGA 1QUQB 3S15H 1CUKA 4JG2A 3EIVA 3S9WA 1STNA 2JYOA 4BXXH 1KLGD 4RGMA 4JV5Q 4KTAA 1XYIA 4P73A 4YIJA 2HUGA 2K5WA 1DYQA 2JEAI 1AN8A 2BA1A 3BU2A 5J39A 1UUPA 4NXML 4BXXG 5CV7A 2KOLA 1BBWA 1XNQL 2VS1A 2RBMA 2Y0SE 3EQLC 4QIWE 3ZYYX 1CKOA 2IY5B 2O5JC 4K6LA 2WKDA 3PO2H 1LTBD 4X64Q 5G3LF 3CCMA 3SK5A 3TP6A 2PZWA 1HNZQ 4IQZA 3HOUH 3I8ZA 4V0BA 1STEA 4APVA 3PO2G 1STBA 1SE3A 3K8AA 4LMQD 1JE5A 5FO7B 4HIKA 3HOUG 2E2DC 1HFNA 1YNND 2XRSD 1TY0A 1S5FD 4JI5Q 4K14A 4FF4A 4CBVA 1X54A 1XNRL 2BCOA 4FXKC 1QG7A 1K3RA 1YHAA 1BVSA 1M4VA 3OW2A 3NPPA 4CKCA 2PI2A 3M9BA 3EROA 3H3VC 5DM63 2EY1A 2AQ1B 3MXGA 3W5OA 1Q46A 1ZEQX 1I3QB 4X3UA 3MXPA 3GP7A 1E1OA 2LFNA 1CKNB 2IL8A 5J3BA 5IP9H 3STBC 2EIFA 1G6PA 2XWJB 4IUQA 1PH9A 3EBEA 4CDEC 3EN2A 2FXQA 5HGQA 3S17H 2R93H 1M1KC 5IP9G 3E0EA 5I9PA 1YEZA 4H0LC 2VUMH 5CV9A 2GA4B 1GVPA 5ELFA 1JORA 2MO1A 4F7XA 1NMGA 5NUCA 2K5DA 5K36H 2EJGC 3HG9A 4DFAA 1WCMH 2IHEA 5KYLA 5C4HA 3SXHA 2VUMG 4NPSA 3M85A 3L0OA 1YITA 2IJ0A 1AEXA 5JJKA 4JYAQ 1VS0A 4KJOA 3S2HB 1WCMG 2NVYH 2MO0A 1QVGA 4TVAB 4PQXA 1K8MA 4Y52H 2IX1A 1SBBB 1WJJA 4JI8L 1QZHA 4IALA 2L15A 4LF8L 3DWPA 3GTPB 2RDFA 4DAYB 5C44H 1CZGA 5FO9B 1RKNA 4LF6L 4DKAC 1JWUD 3E3XA 2H1EA 2NN6G 2PO4A 4C3HB 5DM73 5C44G 1YI2A 4Z9CB 3CRKC 3GTGB 3STBD 1O7LA 3S1NB 4DV2Q 4G4KA 5KYIA 4ID6A 1A15A 1MKHA 3K58A 1TWFH 1D5MC 3KYHC 1I4XA 3LNNA 1YBYA 1WOCA 1RF2D 1N36Q 1P8LA 5C3XA 5D65A 2FHTA 2ZXPA 3MHBA 4NP5A 4DR2L 4RAUC 3URYA 1IL2A 2Z8LA 1ML0D 1FNVA 3OW7A 3KLSA 2QW7A 1JJCB 4DK0A 5M3FB 2NVXH 3M4PA 1E0BA 4LF4Q 1Y1VH 1X6OA 3CP0A 5EBCA 1G2SA 1KDCA 3IFDA 5E7NA 3VR5A 3J80L 1C7YA 1NTGA 1SYBA 3U4ZA 1HTPA 5LHY1 4ZRZA 1RDPD 4KY7A 3T1HQ 2EYLA 1NMFA 2F0QA 3Q22A 4A3BB 1Y1VG 3S15B 2ASBA 5G3LD 1L1OA 3I4MG 4V190 5I6YA 4DV2L 4B3RL 2XSCA 4OEMB 4KN7C 4BA2I 4FF3A 2RKSA 1N36L 1JICA 2Z6BA 4KJNA 4WJWA 2A8VA 3I90A 4B3MQ 1XTDA 3R3OA 2K33A 4JC0A 3I55A 1SYGA 4C3JH 2RDGA 2CVRA 4IPCA 2DGYA 4JVZA 4UY8C 2RQXA 2KECA 3H94A 2VQFL 3SE0A 4B3TQ 4C3JG 1R9TH 1VDZA 2OEOA 1VQPA 4DUYQ 4A93G 3TSSA 5AFWA 4GKKQ 3K5MA 3A8JE 4DK1A 3C46A 4DXFA 1W2BA 2WB1G 2KA7A 2DY7A 5FO8B 4IUUA 3WWVA 1Q7YC 1QE6A 3DUZA 1TS2A 5LMUL 1PYWD 4LF7Q 2LKVA 4BBSB 2PQAB 2HQLA 1KLUD 1LTLA 2HIXA 3GTKB 3T16A 2WV6D 2EY6A 1LLRD 4I7AA 3TDQA 4A3JH 5KIXA 2BH2A 2F0HA 5CR3A 5EPLA 2B2YA 3A54A 1BO0A 2P5ZX 3U50C 3U4VA 1N9WA 1VQ6A 4K5XA 1N32Q 1F2YA 4IUVA 4RGOS 1LT5D 4A3JG 4FF1A 1FGUA 1CQFA 2R93B 5EPKA 2OQKA 2K52A 5GAEC 1U4MA 3BVZA 1SE2A 1X3FA 4O0AA 1STYA 4DR7Q 4Q5VA 3OWEB 2OXPA 3NTKA 2ZM6Q 1A2UA 3EFXD 1V1PA 4H02A 4GKKL 2RA4A 1PTOH 2B39A 2DNEA 1WCMB 4YY3Q 5KGUA 4R4TA 1BCPF 3MFGA 1SE8A 3DWQA 1ESRA 1F9SA 2K50A 2EOTA 4OXPA 5KEEA 5I2XA 1RJTA 1EZ6A 4E6IA 1CA6A 2L55A 2NVYB 3NK9A 1Y8NB 4EGVA 4LF7L 1SEBD 4JBJA 1AZQA 1GUNA 1Q8KA 3M4QA 3BZCA 3BVMA 3KOJA 3ZJYC 5TSSA 5HGTA 3BDLA 2BH8A 1N8RC 3L9AX 1AE2A 5C44B 3RLNA 3PIP3 1T9HA 2VB3X 4KI0A 4FXGC 1KIXA 3MAQA 1FVIA 1WTWA 2Q8IB 3BYTB 2B2UA 4A3FH 4QY7A 5IGEA 2DJGC 3PUYA 3LWEA 3VDYA 3M7NA 1OXVA 3Q24A 4IFDJ 4NB3A 3SDZA 3K5LA 1JC7A 3U9OA 4LW1A 2Q2UA 4X62Q 2ZM6L 4A3FG 4GLVB 4YCWA 3OMCA 2OF1A 4YY3L 3F2UA 1TWFB 5EPJA 4XQQA 5E4XA 1PFSA 3QB3A 2RHQB 1IYVA 1XJVA 2J7ZA 1P16A 4KKTA 4OL7A 4C1NK 3KFUA 3BG3A 3HOYG 1CI3M 4Y7NH 2JEBI 4PG3A 4QUFA 3CPFA 1L0YB 1Q1EA 1R4QB 2NVXB 1SE4A 2ES2A 1A2TA 2ZT9C 4MTKA 1C48A 1NBWA 1KDBA 4GN4B 4JI1L 5ELDA 5CV4A 1QOHA 5HY6A 4DR3L 1KAWA 1C8CA 3HFZB 1XMOL 1A62A 1SDFA 2ICEC 4DAMA 3VYRA 1B44D 1PTOC 4DN4M 3CW2C 2RCFA 4JI3L 2K32A 1WI5A 4JK1C 4DV4Q 2Q2IA 3P1HA 3DWAA 2LXKA 1JWMD 4A3KH 3A0JA 3MEFA 1TVXA 2I5MX 3ERQA 2L12A 1II3A 3J80c 4A3KG 5K5PA 3ITPA 1TS3A 1OXUA 4PZ6A 5IGFA 5EGTA 3S1MH 4YCUA 1K83H 4HIOA 1EIGA 3X3MA 3N52A 1R9TB 1EWIA 2J4XA 1HZAA 4ZAIA 4K5WA 2WB1B 4P75A 3PUWA 1U5KA 4AYBG 4L5SA 5DLQE 2F0KA 1V8QA 2NTTA 3MXNA 1SR3A 2F0NA 1SNOA 3F2DA 3S16H 2NVTB 1HNWQ 2CFMA 1RIPA 2RDHA 1LTRD 4BY7H 3T1YL 2WAQG 2F3IA 4ZUIA 1SYCA 4R4CA 4A3MH 4R8IA 2G9HD 2KEEA 3J80E 1SYFA 4H7BA 3V96A 4A3JB 4BY7G 4XIGS 2VB2X 4M8AA 1PTOD 1H9JA 4A3MG 2KBNA 1JJGA 1HJPA 1XMQL 2JSOA 5T1GA 2E2JH 4UP7A 1SXTA 1LM0A 4ODGA 1LTAD 2UXBQ 4X65Q 1EIFA 3A5ZB 3R8BA 1S5CD 4OGQC 4ZKCB 1OTCA 3RLFA 2JA9A 2SNMA 2PMZE 4KLKA 1K3BC 2KCNA 1PTOB 3I4LA 3VYTA 3I91A 1IBML 1YHBA 1A3UA 4A3EB 2K7VA 3RZOB 2DUDA 3HOZH 3G4SA 1BQQT 3K7AH 2HCCA 1V9PA 4IJLA 2RF4A 1PDQA 2EYMA 5C0XJ 3KF8B 4DAYA 3H15A 1DONA 3DEPA 3HOZG 3PF5A 1B9NA 3SEBA 5IT9L 1U4RA 3NBHB 5JOBA 3HOVB 3J7YW 1YNJC 3PIO3 1D5ZC 2Y0SG 4NKLA 4ZUJA 1FNUA 1J8IA 3N6RA 3LGJA 3CCVA 1G2TA 1CQVA 3BZDB 1EQQA 4DV0L 3B6YA 2RSOA 2UXBL 4A3FB 2K4KA 4A3IH 4X65L 2B63B 4AH6A 3K0YA 1A8VA 4K8JA 3NUCA 4A3IG 1QCBD 3SR1A 4A3DH 5IYBH 4O2DA 1DCZA 4U68A 2D9UA 3NTIA 2Q8TA 3BVGA 3T56B 4JI6L 1GUTA 1AE3A 2EVBA 3CCJA 3NENA 4O42A 1YZ6A 5I2YA 1SNQA 1UE7A 1PHJA 4A3DG 5IYBG 3L3OC 1TS5A 4HJ8A 4FDBA 1PFNA 3RN2A 5C4XB 1I50H 4FNFA 1CA5A 4Y7NB 1VF5C 3L2PA 2CCZA 3CQZH 5IGGA 3FHWA 3G48A 1X9NA 1SYEA 1X56A 4KY6A 2R61A 4JOIC 2XIWA 5CC4A 1KQSA 3PO3H 2OTLA 4LFBQ 4FP5D 3KDFA 4DGZA 1OO9B 1X32A 2OQ0A 1SAPA 1VQMA 4K8IA 5GAHC 3PO3G 1YNJD 3S14H 2WIIB 1ZYRC 4KKSA 4CJ1B 1JR0D 2XTIA 4DK3C 4IPDA 4P2CB 3WDNA 1CK1A 2LMCB 3VYSA 3A7AB 3UDXA 1QNKA 4FVMA 3QG1A 1HNXQ 1B50A 4O1NA 1WYDA 3WOEA 2B2WC 4F87A 4DR5Q 3MTSA 2N78A 3A8IE 3ND9A 4RGTA 1VMCA 2PNRC 5JVH3 4JBKA 3S1MB 1E22A 3NBIA 1K83B 1Y69U 1WTHA 3K6OA 1JOOA 2EQSA 2KUMA 3OHXC 4HCSA 4MTNA 4DNRB 3NWSA 1Q12A 1LT6D 1ET9A 1FNWA 2ZXOA 2QEXA 1HFGA 1CT1D 3I4NB 4ALPA 4YHHL 4LF5Q 4XT1B 2R7ZH 2GN5A 2K5NA 2PQAA 1EYDA 3HOWH 1L2FA 1JOKA 2GVAA 5ELCA 4AQYL 1N33L 3D8GA 3M4OH 5KNCA 1Y1WH 2ZTDA 2EYOA 3OYYA 1QVCA 1YHQA 1FJGQ 2AUKA 4BY7B 2R7ZG 2K01A 1U9RA 5BR8Q 1IBKQ 3GTMB 3HOXH 4A76A 4WJ3M 3HOWG 1VF7A 4JV5L 1Y1WG 1ZYRD 2EY2A 3HP3A 3T4AC 4YWMA 4L5QA 5KNBA 3TP5A 1FYCA 1H9MA 3HOXG 4LFCQ 5DAUA 2PQEA 1SJED 2E2JB 5GADC 3FDTA 4GZYC 2FFKB 3VR4A 4EQOA 4GN3B 4X64L 1B4OA 2NWGA 5C5MA 1HNZL 2B2TA 2A68C 4OIJA 2N55A 1SLJA 1X55A 3KF6A 2N3SA 4TKOB 3NEMA 3GDEA 5GROA 3KLWA 4DV7Q 2F0MA 1SROA 3A8KE 4ZLTF 4BS9A 3CMEA 4LJZC 1FJGL 3K7AB 1MI2A 4JI5L 2NZ1D 2KEDA 2B8GA 2DN8A 4QIWB 1EQVA 3TS0A 1Q86C 1QB5D 2QA4A 3CRLC 5EKKA 4GLXA 4LUVA 5FOBB 4X3KA 1S3OA 3CC4A 1MHWC 1PFMA 4LFCL 4B3SQ 2EYFA 5EAYA 4FO2A 1RL2A 1D1KA 1I4GA 2KHJA 2IWHA 5LL6X 3V05A 4A3IB 3HEJA 2JA8B 1XXGA 2NN6H 1A3VA 4CKBA 4DV3Q 2G9DA 2NN6I 4HR7B 5IGCA 1C9OA 4GOPC 2L5TA 1IKLA 4P74A 1XWEA 3X3NA 4CJ0B 1Y8OB 4DR6Q 1I4PA 2F4IA 4A3DB 1EY8A 1YJNA 1SYDA 4H13C 1TWAH 3OPOA 4RFBA 2NVQB 1FD7D 3PGZA 2JA7B 3TBIB 4CJ2C 3NP8A 4MHEA 3H6MA 4DK6C 3EJIA 1GUSA 2E2HH 2A68D 2CHBD 1I50B 4U673 2KCTA 3MZ5A 5JPMC 1K0SA 4AIMA 2LSSA 3CQZB 3BJUA 3RNUA 3GD7A 4JYAL 1B1ZA 4X66Q 2K14A 3TEHB 3M3YB 5IYCH 3ULLA 1PH7A 3PO3B 1O7IA 1CSQA 1WD0A 4XXEA 4K2LA 1UEBA 1EOTA 1LUZA 5LMNW 1GHKA 4XDXA 3LX0A 3K0XA 5IYCG 3J81L 2FINB 4GKJQ 5IT9E 2C5CA 1QZGA 4FF2A 4PV1C 5CGKA 4X3TA 2SDFA 4K2KA 4DUZQ 1SNDA 4MN3A 3I4MH 2JA6H 1WTXA 3UDFA 1BBXC 3JC66 1TQOA 5CBAE 4IUPA 5I4DA 1JWSD 2PCFB 4I65A 3S1QH 4M1UB 2AQ2B 4R8NA 1PFBA 2JA6G 2X6GA 3F8TA 2K1BA 2VQEQ 2JP1A 2PW5A 3MVVA 2A69C 5ELOA 2HHHQ 2VY3A 3S24A 3UE1A 1E7ZA 3NQTA 4KHZA 4ZCKA 2DY8A 4PMBA 4WORA 5KNDA 1CHQD 4HMIA 3PO2B 1NAPA 1VQHA 4XT3B 4B08A 3T13A 2F0FA 1SFOH 3HOUB 3P75A 4RKBA 1YJWA 4J8QA 3V2TA 3OOCA 1PVOA 1H9SB 2O2LD 4A93H 5IYDH 2KQ3A 1JJ2A 4LF4L 1GUWA 3RR5A 1BKBA 1VQ5A 3J81i 2WACA 5D3DA 4DUZL 1JE4A 1EL0A 1LV9A 1VQNA 4XTCS 3M4OB 3T1HL 5IYDG 4JI2Q 3NTHA 4H44C 2UXCQ 5BN3A 2VW9A 3PMFA 5IODA 1PZJD 2CKZB 2MHVA 2VQEL 5C4JH 5M3MH 4A3CH 2LS01 5FKAC 4OX9Q 3HKZE 5IWAQ 2ZTEA 4YWLA 1JQYD 1SJHD 2K28A 1F9QA 2R6GA 1RCVD 3C3LA 4GNXA 4XQNA 5M3MG 1J9OA 1GXDC 4A3CG 4B3ML 1HR0W 2ATWA 3CC7A 4C56C 2A69D 1H9RA 1LYLA 2XNAC 2JA5H 1HHVA 2DNCA 4DV1Q 3S17B 4B3TL 1ICFB 2X6LA 3AYHB 4CKEA 3MC0B 2VUMB 1HQMC 3KBXA 2JA5G 4L8JA 3EA6A 4DUYL 1RTNA 1BOSA 2YTXA 1PYBA 5A35A 2F0SA 1C0AA 1TWCH 4HCEA 2RVLA 1UNSA 3D4WA 3I7FA 1VQEA 1PRTF 1MBYA 5IWAL 2B2VA 3K5NA 5IP7H 1RODA 1KXLA 4K6DA 1IBLQ 2XVSA 3NHHA 4RG1A 3AQQA 4FXDA 4JI7Q 1OXSC 3M7GA 1JT8A 2A6HC 4R4QA 3GQBA 4DPGA 5IP7G 4POFA 1A63A 5HURA 1J6QA 1GO3E 1EQTA 1N32L 1VQ4A 3CD6A 1IHZA 2RSNA 2UUAQ 2VL6A 2XN9C 3TQYA 1TWAB 4HSPA 1UAPA 2WKCA 3PUVA 4JW0A 1EY9A 3K7UC 1HR0Q 4DR7L 4BBRH 4NW2A 4R1JA 4J6HA 4RCOA 5JPNC 4N8FA 4JI0Q 3DLLA 5IOCA 4XYQA 4EQPA 2IPKD 3QO2A 3SK4A 1L1OC 2QGQA 2Z6KA 3CCRA 3L7ZC 1WTPA 1B70B 3D31A 4IN3A 2ICIA 4YWKA 3HOYH 4BBRG 1VQ9A 3A56A 3QWNA 4WFN3 2D5DA 2E76C 1VQJA 1W3SA 1U4PA 4ZKBB 1SNCA 4JI7L 1CM9A 1GM5A 2D0OA 1J5EQ 1VQFA 1NNXA 1NCVA 3HS0C 3CXCA 4LK1C 4DNTB 1H9KA 4LF9Q 2SEBD 4IFDH 1HH2P 1Y1VB 1QUQA 5A2QL 3OTOQ 4IFDI 3TMEA 3I4MB 1E2VA 2JA6B 3FMCA 3MXUA 3R93A 4EQ5A 2A6HD 2K5HA 3DM1A 4IFDG 1VQBA 1Q90A 3J7ZC 4QF4A 4X62L 1GKHA 4PNYA 4R9WA 5M5XH 4KMUC 2PW7A 1K8AC 1AW7A 3QOJA 1KTKA 3IL8A 5D14A 5ELEA 3D6CA 4RH6A 4RCNA 4IZ8A 1BCPC 1M8AA 2KCCA 4DAPA 1VQLA 3PQIA 4KN4C 1EYCA 3J81c 1Y14B 4L6TB 4C1NI 1Q1BA 1PRTC 4P71A 1CZWA 1PXUA 5M5YH 4DV5Q 2EY5A 4XYOA 1UWVA 3E9IA 2B2YC 3KJOA 4C3JB 5GQOA 1SNMA 3KUPA 2L1BA 1SFOB 4QQBX 2AWOA 4HMJA 1YJ9A 4A93B 3HGBA 2I5LX 4CDFC 1NY4A 5M5WH 1EIHA 2VZAA 2N88A 4JBMA 1TS4A 1B8AA 1YVCA 3LWUA 4UPAA 2R3ZA 5EQ0A 2QF7A 2C9OA 2F0VA 4OONA 1I6VC 4KK7A 3F1ZA 3J81E 5C4JB 1S4ZA 4OWTB 5C4ZA 2D0PA 1W6KA 4DV4L 1CKNA 4R4OA 3CHBD 4A3GH 1KC8C 4J15A 1ICWA 1PLFA 4UDUC 1LACA 2K75A 4LUZA 3Q23A 5D3IB 4L5RC 1Z9FA 1VCIA 2EZVA 3AFPA 4A3GG 1DXMA 4XQJA 2A5HA 4FYDA 1BCPD 1DOMA 1DJRD 5CBEE 2HQEA 4RMFA 2FJ2A 1D2BA 2ALYB 1SSOA 3GTQH 1PRTD 2B2UC 3PSIA 2NB0A 4PMWA 3E5SA 4TQUS 2UUBQ 3SK8A 5EKLA 2LXJA 1GUOA 4GN5A 2E5LQ 2RCNA 1HA5A 2A1AA 4IUTA 3P20A 4QGUA 3UDIA 1VQKA 1LO5D 1BCPB 4UP9A 1HNWL 4N9PA 3F2CA 4C3IH 3ULJA 1N34Q 4K0KQ 5E3FA 3U9SA 1I4QA 4MIUA 5ELBA 4C3IG 2L9HA 3MWYW 2AHOB 2EYJA 1EQRA 1ENFA 2QKIC 2YU9H 2UXDQ 1MIUA 4LFAQ 2OT2A 3OMGA 3AB9A 3RLOA 1LTTD 3S2HH 2PZUA 3G7LA 1G8ZD 1O80A 1TU2B 2EYPA 4QCLA 2ZTCA 4QL5A 1ILPA 5C6AA 2M9VA 2F0WA 1XX8A 3HOYB 3E6ZX 5C0XH 1VQOA 1Q81C 3OIQA 2KENA 4JI4Q 5C0XI 3T53B 3KK7A 2EJFC 2E2IH 1RTOA 2F4VQ 3GTPH 4OHJA 5AJ3Q 2MUYA 3A74A 3FP9A 5C0XG 3P7JA 5JEAJ 1D8LA 3DM3A 1ILQA 1HTLD 3VA5A 5JJIA 4DV6Q 4RGNA 1XPOA 1B2TA 4POGA 1B9MA 1WTOA 2R7DA 4TSSA 3GTGH 2WP8J 4NDXA 3S1NH 1OXXK 1VQGA 4C3HG 2D2CC 1IW7C 1BNZA 4N9TA 4LFAL 2WINB 3PIPA 3DEOA 5CV5A 1U4LA 2I07B 3NE5B 1L0WA 3NELA 3I3CA 5I9OA 5GAGC 4DA2A 3BDOA 2PYKA 5M5XB 3A7LA 4ILWA 1WTVA 1XNQQ 2BA0A 3PUZA 1BDOA 3ERSX 2YYZA 4B9WA 3G6JB 1PZKD 2TSSA 4IPGA 1Z7TA 3IKJA 1D1IA 1JB3A 1SMXA 1GOZA 2F0GA 5BN5A 5C3WA 1K28A 3F2BA 4A3KB 1PV4A 1QJOA 4OWWB 1WFQA 1DZ1A 1UE6A 2B29A 4PZ8A 5IE8A 5AJ3L 4RHSA 2R92H 3I56A 1A3TA 2K03A 2F0LA 1X3QA 2IX0A 3ND8A 3DHQA 2QDBA 3K57A 5M3FG 1VQ7A 3TZUA 4DXGA 2R92G 2MJ8A 5ISRA 4LFBL 4AYBB 4A3BH 3ULPA 5M5WB 3BYYB 1XNRQ 2F03A 2BDNA 2VNUD 3BS1A 1HRJA 1Q82C 4ZQ3A 1JB7A 1QVFA 1ASZA 4A3BG 3D4RA 2WAQB 2PPBC 1JOQA 1X65A 3K81C 3H09A 3HZXA 1WTRA 1EY5A 4QJFA 3S1RH 3S16B 2MNAA 1D6EC 3CU7A 4BA1I 2EYHA 5A2QE 4A3MB 1IW7D 2A19A 4A3GB 1VQAA 4ME3A 1HNXL 2KJXA 4DR5L 1I5FA 1TT2A 2F0IA 1HZCA 3IFTA 4HJ5A 2C35B 4A3LH 5F2DA 3CKIB 3CCEA 4IJHA 3GTQB 1PZID 2CH4A 2M00A 1EY7A 2CWAA 2ZJPA 4CGYB 4A3LG 5FJ8H 4HAEA 1PA6A 1Y8PB 3PV0A 1BUVT 5DNFA 5JVG3 1PH4A 4HJAA 1X3EA 1QNUA 1EWCA 1S5ED 3CAMA 4LF5L 1OXTA 4X3SA 4CHTB 3MXNB 5FJ8G 4BBSH 2ZJRA 1EU3A 3A55A 3K5OA 1C4QA 4L63B 5CV6A 3GTKH 4C3IB 3HOZB 3TP8A 3SVMA 4JI8Q 2HDMA 3FKIH 2Y0SB 4BBSG 5BR8L 2G5DA 3H0GH 3SK6A 5FLXL 1G51A 1IBKL 4LF8Q 2YTVA 3GTOH 5E1FA 4JCVE 1O7ZA 3TN2A 4LF6Q 2I46A 3FVQA 4KD4A 4QUCA 3FKIG 3W1GA 3H0GG 3I4OA 2H5XA 1TWHH 1HPCA 1CKMA 4DR1Q 2R93G 1VMPA 1GHJA 2YU9B 3BDCA 2E75C 2L11A 3ER0A 4HN7A 5ELNA 2F0EA 5C3EH 1I6HH 4PMCA 2MPMA 1DOLA 1GUGA 2UU9Q 1X3PA 2F0PA 1JMCA 5K36G 2MGSA 3TS2A 1B53A 4DV7L 2PNHA 1M90C 5L37A 5IT9c 5C3EG 5J1ZA 4DF7A 2IT1A 1WD1A 1PH1A 4DR2Q 1LTID 2K5VA 2E2IB 1V1OA 2K05A 3HKZG 3CC2A 1VQCA 4MZ9A 2RHSB 3M4YA 1KRTA 3C1EA 1B3AA 1UE1A 1IXRA 4B3SL 3SHLA 1EY6A 1WTQA 3ONAB 1D7QA 4IPHA 1R4PB 2Q2HA 4JBWA 3W1BA 4DR1L 1XPRA 1KAAA 4OELB 1ZKOA 2F1MA 3I72A 3PIOA 1TWGH 4GLAC 1KHIA 4JPBW 4B3RQ 4DV3L 3S14B 1G6ZA 3DXJC 3GV3A 2E8GA 3CCLA 4DR6L 4KKUA 2UU9L 2FMMA 4G7HC 2V1CC 1STHA 1LTGD 2HIVA 3R2IA 2KCMA 1E3PA 2Z1CA 1PH3A 4KHPQ 1EY0A 5LL6S 3RZDH 2EJMA 1STAA 1K0RA 1KL9A 1XTCD 4BWGB 3IAYA 4HJ9A 3GTJH 4RA8A 4OIKA 2R92B 3D6WA 1HZ9A 2VQFQ 2PZTA 2VXWA 4UAIA 1FL0A 4BY1H 1TIID 1F77A 1Z47A 4X66L 3J81j 1ESFA 3NQIA 5IGDA 2MFIA 2XGTA 1GD7A 4KV6A 3KDFB 3JAML 5JAVA 5JJZA 4BY1G 3QR8A 1ONLA 1PH5A 2AKWB 1BF4A 4GOPB 2XRQD 1PMRA 2B2TC 4GKJL 4F88A 1DOKA 3WOFA 5LMUQ 1HCZA 1T5XD 2R7ZB 4LAAA 3VR6A 2JXMB 4GS3A 2AUJD 3QOLA 2JQOA 3S1RB 3D4DA 1NJIC 2E74C 3HOWB 4KHPL 1DGSA 2F0DA 4G7OC 1HA6A 1Y1WB 5H1SE 2ID0A 5LMNQ 2KVMA 4Q0FA 4HJ7A 3HKSA 3HOXB 1FR3A 3G71A 3QJYA 2O4XA 2PI2E 3I70A 3ICEA 3AMUA 2HHHL 4DR4Q 3EVQA 2B8FA 3J80i 1Q8IA 2M2LA 2HT1A 2QCPX 3BZKA 4DAVA 1JCKB 3D3RA 4UHVA 4ULLA 3JAMi 3GV6A 4EQNA 2NVTH 2QILA 2BE5C 3RN5A 1U0LA 1B7YB 5FK9C 2AMCB 1NUCA 1S40A 3IRBA 3CF5A 4OWXB 1G91A 1EYGA 2WFWA 2K04A 2MP1A 3KF8A 1CHPD 2J0TD 1AFPA 2V4DA 4KHVA 3S2DH 4JI2L 1L0XB 1O78A 3NBHA 5LMNL 4A75A 2UXCL 3FKIB 1IYJB 1AZPA 1UEAB 3H0GB 1MJCA 1NR2A 1SN8A 3G6EA 2F3VA 4B9XA 3GTOB 1F2MA 1AP0A 1D5XC 2Z4HA 1RD9D 1MSHA 5I6WA 2BDOA 3NXWA 2EXZA 4EVOA 4OX9L 1LT4D 2OWOA 1TWHB 4DR4L 2CQAA 3UDGA 3A5UA 3I73A 2NZOA 3H91A 1PTOF 2D62A 5DEHA 1ENAA 5C3EB 2NYZD 1I6HB 1GJXA 2A73B 5FLXc 1ZXTA 5COYA 4A3EH 1I4HA 3KF6B 3RZOH 4DV1L 4HIDA 1ET6A 4CDDC 3HKZB 3QIAA 3DMUA 4IURA 4A4IA 4A3EG 1IYUA 1PH8A 4CDCC 3HOVH 3UI2A 5EJWA 2E2HB 3TREA 1CFMA 1V43A 1NSNS 2CWPA 4IOCA 2BE5D 2AQ3B 4ME5A 4P72A 2ZJQA 1CSPA 2NTSA 1EIYB 2H4OA 3E0JA 5FLMH 2F52A 2IX3A 3HOVG 3FPPA 4C2MH 1FGBD 3OWFA 2R7FA 2DJFC 2L4NA 3E9HA 5CV8A 2B63H 3AEVA 4JI1Q 3MFYA 1NR4A 1IBLL 4DR3Q 1CTMA 2XWBB 3NWTA 5FLMG 1KNEA 5EKIA 3U58A 1XMOQ 1F2LA 2HD3A 1EY4A 4N8X1 1ENCA 2B63G 1TWGB 1E2WA 5FLXE 4QB4A 1WVLA 3OIPA 4JI3Q 1E1TA 2X69A 3UE0A 4HTHA 1HZBA 2CW0C 2EPBA 4WJ4A 1W6JA 2UUAL 3PCOB 2WB1E 3W3AA 4ZK9B 3TP7A 1E24A 1EEID 3KLSX 2BOSA 1T5EA 5C4XH 4LWCA 3RZDB 3FPUB 2Z0SA 1HR0L 3S1QB 1MJEA 4JI0L 3J7AV 1EUJA 3K59A 1STGA 4DNIA 2Q8RE 5C4XG 4KY5A 5CYUA 2OCEA 4K5VA 1IL8A 1TXYA 3CCSA 3GTJB 3FRPB 3RUZA 1VQIA 3C2PA 2MQHA 4S3SA 3T51B 4BY1B 3W2DA 2F3WA 3VA7A 4RWSC 1K8GA 3Q6SA 1HUNA 3VYUA 4G57A 1VQDA 4GNXC 3TRZA 1J5EL 3NSWA 3KBGA 5J22A 5IIFA 3TZDA 1I94Q 4I7ZC 1VQ8A 2TMPA 2F0JA 2HDLA 4RHRA 1QILA 4LF9L 3GTLH 2B3GA 3T1YQ 1A6XA 3OTOL 3C1FA 2HCIA 1G291 2A6EC 1O7YA 3Q0AA 3MEHA 1IKMA 3PUXA 1TR5A 4G7ZC 2OTJA 3CCUA 4X6AH 1KABA 1L1OB 2N49A 1TKWB 1XMQQ 3JAMc 5EBDA 4JOIA 2CW0D 5M3MB 1F9PA 1EZ8A 3O13A 1KRSA 2K5QA 2B2VC 2LY7A 1K9MC 1HQRD 4L5TA 2O5IC 4DV5L 2Z4IA 5E4WC 3I4NH 4NXNQ 1QWYA 3CCQA 2F0TA 5JJLA 1I94L 2YTYA 2ENBA 1IBMQ 2CH4W 2JA5B 3I4NG 2YV5A 3J7AF 1SNPA 2FMCA 2Q2TA 4UP8A 1XPUA 3GTMH 1EYAA 1S5BD 2B2WA 3S2DB 3OSOA 3JAME 1EWHA 1EEFD 1TWCB 2KHIA 3SGIA 1NE3A 1UE5A 2K6AA 3GO5A 1S5DD 1I3QH 1LTSD 1SMYC 2Z6KC 2QEJC 3RD4A 3CMAA 2I0QA 3KJPA 3VR3A 5IY0A 1KNAA 2A6ED 2NZHA 4EX5A 4DV0Q 1PRTB 1YNXA 4RKLA 1X3GA 4J1MA 1SRUA 4GNXB 4NMZA 1HXYD 4KD3A 1BBUA 4NXNL 1KD1C 2QDLA 1ASYA 3I2ZA 3Q8DA 1PH2A 1BXTA 4DU9A 3RMHA 1IZ6A 4JI6Q 4QMGA 5KRUA 2JE6I 1KDAA 1EFID 4HEDA 4R4IA 1F9RA 1DM0B 4PZ7A 1F2ZA 2UUBL 4BBRB 2IHFA 1I4RA 1H95A 1V1PB 2NUCA 2EE1A 3FEWX 2E5LL
chains in the Genus database with same CATH topology
1X3EA 4A93H 3CAMA 4IOAA 5IYDH 4LF5L 1OXTA 2ES2A 1JJ2A 4MNOA 4LF4L 3RR5A 1BKBA 3MXNB 5FJ8G 1VQ5A 3J81i 4BBSH 4DUZL 2ZJRA 1NBWA 3K80C 1N34L 4K0KL 3GTKH 2UUCQ 1VQNA 4GN4B 4XTCS 4JI1L 3T1HL 2JA8H 5HY6A 4JI8Q 5IYDG 1KAWA 1V1QA 4JI2Q 3FKIH 4DR3L 3J7A5 3HFZB 4BBSG 5BR8L 1IBKL 3H0GH 1PYSB 2GVBA 1G51A 4YCVA 1XMOL 2YTVA 4LF8Q 1A62A 2VW9A 3GTOH 4DAMA 2CKZB 4JCVE 2VQEL 2JA8G 3CW2C 5C4JH 4LF6Q 4K0KQ 5M3MH 4A3CH 3FKIG 4AYBE 3W1GA 4C3HH 2JJQA 3AFQA 3HKZE 3H0GG 3I4OA 4JI3L 2H5XA 1WI5A 5IWAQ 2ZTEA 4YWLA 1TWHH 4DV4Q 2NVQH 2Q2IA 2JA7H 2LXKA 4A3KH 3A0JA 2CQOA 2I5HA 2R6GA 1CKMA 4DR1Q 3MEFA 4IO9A 2I5MX 4GNXA 1PH4A 5M3MG 2R93G 4A3CG 2UXDL 4B3ML 2WAQE 3CPWA 1HR0W 4OO1I 3J80c 2ATWA 3ER0A 3CC7A 1AH9A 2JA7G 5ELNA 5C3EH 1I6HH 4A3KG 3H3VH 3S1MH 1OXUA 4OO1G 4PZ6A 2JA5H 1LYLA 2UU9Q 4NXMQ 3H3VI 1JMCA 4HIMA 1S72A 3TS2A 5K36G 4DV1Q 1A0IA 4YCUA 2PNHA 4DV7L 3D0FA 1M90C 1K83H 5IT9c 5C3EG 4B3TL 3PF4A 3M3YH 3AYHB 4HIOA 1EOVA 2IT1A 1PH1A 2UUCL 1YIJA 4JI4L 1EWIA 4DR2Q 1HZAA 2JA5G 4DUYL 2K5VA 2AWNA 4LNQA 2F4VL 2YTXA 4GOPA 1PYBA 2EXDA 4P75A 3PUWA 1U5KA 4AYBG 5M3FH 4L5SA 1K73C 1TWCH 3HKZG 5DLQE 3CC2A 1C0AA 1VQCA 4MZ9A 2RHSB 4YHHQ 4DV6L 5JEAG 1PH6A 1SR3A 1KRTA 1EFWA 2N8NA 3F2DA 3S16H 1HNWQ 3I7FA 1VQEA 2CFMA 5IWAL 1RIPA 4LUOA 1UE1A 1IXRA 4B3SL 4AQYQ 3T1YL 5IP7H 2WAQG 2JK8A 1N33Q 2F3IA 4BY7H 4R4CA 4A3MH 1KXLA 1D7QA 4IPHA 1IBLQ 2Q2HA 1QUQB 4JBWA 4RG1A 3AQQA 3W1BA 4DR1L 1XPRA 3S15H 1CUKA 4JI7Q 1OXSC 4JG2A 3EIVA 1JT8A 4R4QA 4BXXH 3PIOA 1TWGH 4GLAC 1KHIA 4DPGA 4XIGS 5IP7G 4POFA 4BY7G 4B3RQ 4JV5Q 4DV3L 1A63A 4A3MG 1J6QA 2KBNA 4P73A 2R7ZH 1GO3E 1N32L 2E8GA 3CCLA 2JEAI 1HJPA 1VQ4A 1XMQL 2BA1A 3BU2A 3CD6A 4DR6L 2UU9L 1JJGA 2E2JH 4NXML 4UP7A 4BXXG 1BBWA 2V1CC 2UUAQ 1LM0A 2HIVA 2VL6A 2VS1A 1XNQL 2Y0SE 3TQYA 2KCMA 1E3PA 2UXBQ 4QIWE 1PH3A 4KHPQ 1CKOA 2IY5B 4X65Q 1EIFA 3RZDH 3A5ZB 4OX9Q 2UXCQ 3PO2H 3PUVA 4X64Q 3CCMA 3K7UC 1OTCA 1HR0Q 4DR7L 4BBRH 3RLFA 2JA9A 4R1JA 1HNZQ 2PMZE 1K0RA 4JI0Q 4KLKA 3DLLA 3HOUH 1KL9A 4HJ9A 4APVA 1L1OC 2QGQA 3GTJH 2Z6KA 3CCRA 3L7ZC 3PO2G 1HZ9A 1B70B 3D31A 4YWKA 2VQFQ 3HOYH 4BBRG 1VQ9A 1IBML 1FL0A 1YHBA 3K8AA 4BY1H 1JE5A 4HIKA 3HOUG 1Z47A 2DUDA 4X66L 3J81j 3G4SA 3HOZH 3K7AH 1VQJA 1V9PA 4IJLA 2RF4A 2MFIA 2XGTA 1GD7A 1W3SA 4JI5Q 3KDFB 5C0XJ 4JI7L 3KF8B 1X54A 3H15A 4BY1G 1XNRL 1GM5A 2D0OA 1J5EQ 1PH5A 3HOZG 1K3RA 1VQFA 2AKWB 3PF5A 1YHAA 3NBHB 4GOPB 3CXCA 1BVSA 2Y0SG 3OW2A 4GKJL 2PI2A 3M9BA 4LF9Q 3LGJA 3W5OA 1Q46A 5LMUQ 3CCVA 1HH2P 4GS3A 1QUQA 3OTOQ 1EQQA 4IFDI 4DV0L 2JQOA 3B6YA 1NJIC 2UXBL 4KHPL 2K4KA 4A3IH 1E1OA 1DGSA 4X65L 1CKNB 4EQ5A 5J3BA 4AH6A 5H1SE 2K5HA 2ID0A 5IP9H 5LMNQ 1A8VA 1VQBA 3STBC 4IFDG 3J7ZC 4HJ7A 4X62L 2EIFA 1G6PA 3HKSA 3G71A 1PH9A 1GKHA 3EBEA 5M5XH 2PI2E 3EN2A 2FXQA 4A3IG 3ICEA 5HGQA 5IYBH 4O2DA 1K8AC 4A3DH 3S17H 2R93H 1M1KC 5IP9G 3E0EA 1YEZA 2HHHL 4JI6L 1VQLA 1AE3A 3CCJA 2VUMH 3NENA 3J81c 1YZ6A 4DR4Q 1GVPA 1UE7A 1Y14B 1PHJA 2MO1A 5IYBG 1Q1BA 4A3DG 4P71A 4HJ8A 1NMGA 4FDBA 3RN2A 1I50H 3J80i 5M5YH 4DV5Q 2HT1A 1WCMH 3BZKA 2IHEA 3L2PA 2VUMG 4NPSA 3M85A 1UWVA 2CCZA 3E9IA 3CQZH 3L0OA 3JAMi 3KJOA 1YITA 5GQOA 2NVTH 3FHWA 3RN5A 1U0LA 4QQBX 1B7YB 3G48A 2AWOA 1X9NA 4JYAQ 1VS0A 1X56A 2AMCB 1YJ9A 1WCMG 2NVYH 2MO0A 1S40A 3IRBA 4JOIC 1QVGA 2I5LX 3CF5A 1KQSA 4TVAB 4OWXB 2OTLA 3PO3H 4LFBQ 3KDFA 1EYGA 1NY4A 5M5WH 2WFWA 4Y52H 2IX1A 2VZAA 4JBMA 2OQ0A 1WJJA 3S2DH 4JI8L 1B8AA 4JI2L 1YVCA 4UPAA 5LMNL 4A75A 1VQMA 1QZHA 2UXCL 2L15A 5GAHC 4LF8L 1IYJB 3PO3G 4DAYB 5C44H 3S14H 1MJCA 1SN8A 3G6EA 3I4MH 4OONA 4LF6L 2XTIA 4DKAC 4DK3C 3F1ZA 2NN6G 4OX9L 4OWTB 2E5LL 2D0PA 4IPDA 5C44G 4DV4L 1YI2A 1CKNA 4R4OA 2OWOA 4DR4L 3UDGA 4A3GH 1KC8C 3UDXA 3A5UA 4J15A 3STBD 1HNXQ 2NZOA 2K75A 5JJKA 4LUZA 1WYDA 4DV2Q 2D62A 4L5RC 1Z9FA 1MKHA 1VCIA 1TWFH 3AFPA 4DR5Q 4A3GG 3KYHC 1YBYA 1WOCA 2N78A 1N36Q 1P8LA 5FLXc 4A3EH 3KF6B 3RZOH 4DV1L 4RMFA 4JBKA 4HIDA 2ALYB 1E22A 3GTQH 2EQSA 3PSIA 4MTNA 4DR2L 4PMWA 1IL2A 4A4IA 4A3EG 1PVOA 1Q12A 1PH8A 4TQUS 3HOVH 2UUBQ 1JJCB 2QEXA 2LXJA 3TREA 1V43A 4GN5A 4ALPA 2CWPA 2E5LQ 4IOCA 2NVXH 2RCNA 3M4PA 2A1AA 4P72A 2ZJQA 1CSPA 4YHHL 4QGUA 3UDIA 1EIYB 2GN5A 1VQKA 4LF4Q 1Y1VH 1X6OA 4LF5Q 5FLMH 3CP0A 2K5NA 2F52A 4UP9A 2PQAA 3HOVG 1HNWL 4C2MH 5E7NA 3F2CA 3HOWH 1L2FA 2GVAA 4C3IH 2R7FA 3ULJA 1NTGA 3U4ZA 4AQYL 1N34Q 1C7YA 3E9HA 1N33L 2B63H 3AEVA 4JI1Q 1Y1WH 2ZTDA 3OYYA 3T1HQ 1QVCA 1NMFA 1YHQA 1IBLL 1FJGQ 4DR3Q 2R7ZG 1Y1VG 5FLMG 5BR8Q 1IBKQ 2ASBA 3HOXH 3U58A 1XMOQ 4A76A 1L1OA 3I4MG 3HOWG 4WJ3M 4DV2L 2B63G 4B3RL 4JV5L 1Y1WG 4BA2I 4YWMA 2AHOB 4L5QA 1N36L 1E1TA 1EQRA 3HOXG 4JI3Q 3UE0A 4LFCQ 1HZBA 4WJ4A 2UUAL 3PCOB 2WB1E 5GADC 1E24A 3M4OH 2YU9H 5C4XH 2A8VA 2UXDQ 1MIUA 4LWCA 4B3MQ 1XTDA 4GN3B 4LFAQ 4X64L 2Z0SA 4JC0A 3I55A 1HR0L 1HNZL 1MJEA 4C3JH 4JI0L 1SLJA 1EUJA 3RLOA 1X55A 4IPCA 4DNIA 2DGYA 5C4XG 3KF6A 4UY8C 3S2HH 2N3SA 2OCEA 3NEMA 1TXYA 3CCSA 3GDEA 5GROA 2VQFL 2ZTCA 3KLWA 4QL5A 4DV7Q 4B3TQ 1SROA 1VQIA 2MQHA 1Q81C 1VQOA 2KENA 1R9TH 4JI4Q 3CMEA 5C0XI 1VQPA 1K8GA 1FJGL 4DUYQ 4A93G 4JI5L 1VQDA 2E2IH 2F4VQ 4GNXC 3GTPH 3TRZA 4GKKQ 5AJ3Q 3A74A 3FP9A 5C0XG 1J5EL 3TS0A 5JEAJ 1D8LA 3DM3A 2QA4A 1Q86C 5JJIA 1I94Q 4DV6Q 1W2BA 2WB1G 4LUVA 4GLXA 1VQ8A 3WWVA 1Q7YC 1S3OA 3CC4A 4LF9L 4LFCL 1XPOA 3GTLH 2B3GA 5LMUL 4B3SQ 3T1YQ 4LF7Q 4POGA 5EAYA 3OTOL 2R7DA 2PQAB 1G291 1RL2A 2KHJA 3GTGH 2HQLA 2WP8J 1LTLA 2HIXA 3S1NH 1OXXK 1VQGA 3PUXA 4A3JH 4LFAL 2BH2A 2OTJA 3U50C 3CCUA 4X6AH 3PIPA 3U4VA 4DV3Q 1N9WA 2NN6I 1VQ6A 1C9OA 1L0WA 3NELA 1L1OB 4P74A 2N49A 4GOPC 1N32Q 5GAGC 1XMQQ 3JAMc 4DR6Q 4JOIA 4A3JG 1YJNA 1FGUA 1XNQQ 1TWAH 2BA0A 3PUZA 2OQKA 3ERSX 2YYZA 2K52A 4IPGA 5GAEC 1KRSA 3PGZA 3F2BA 1SMXA 1X3FA 1K9MC 1PV4A 4O0AA 4DR7Q 4OWWB 4DK6C 1WFQA 4L5TA 1UE6A 2B29A 2ZM6Q 4DV5L 2E2HH 4H02A 3I4NH 4PZ8A 5IE8A 5AJ3L 2KCTA 4GKKL 4YY3Q 3CCQA 4NXNQ 2R92H 3I56A 4R4TA 4AIMA 5JJLA 2LSSA 1I94L 3BJUA 2YTYA 1SE8A 3GD7A 3RNUA 2K50A 1IBMQ 2IX0A 4JYAL 4OXPA 3I4NG 2YV5A 5M3FG 4X66Q 2K14A 3TEHB 1VQ7A 2R92G 4LF7L 4JBJA 4LFBL 5IYCH 3ULLA 1PH7A 2Q2TA 4A3BH 1O7IA 4UP8A 1CSQA 3ULPA 1XPUA 3GTMH 1Q8KA 3M4QA 3BZCA 1XNRQ 3KOJA 3ZJYC 2VNUD 1UEBA 5LMNW 1LUZA 2BH8A 1N8RC 1Q82C 3K0XA 1JB7A 1QVFA 5IYCG 1ASZA 1AE2A 4A3BG 3RLNA 1T9HA 4GKJQ 2KHIA 4KI0A 1X65A 3K81C 3SGIA 1FVIA 1KIXA 1NE3A 1UE5A 3GO5A 1QZGA 1I3QH 2Z6KC 4DUZQ 4QJFA 3S1RH 2I0QA 3CMAA 4A3FH 4QY7A 5IY0A 3PUYA 4EX5A 3KJPA 2NZHA 4DV0Q 2MNAA 3VDYA 3UDFA 2JA6H 3M7NA 1OXVA 3JC66 4BA1I 1YNXA 4IFDJ 4NB3A 1X3GA 2A19A 1VQAA 4ME3A 1SRUA 4GNXB 1HNXL 3S1QH 4LW1A 2Q2UA 4X62Q 2ZM6L 4A3FG 4GLVB 4YCWA 2JA6G 3F8TA 1BBUA 4NXNL 4YY3L 2VQEQ 4DR5L 1KD1C 1I5FA 1ASYA 3I2ZA 3Q8DA 1PH2A 1IZ6A 5ELOA 2HHHQ 2VY3A 3S24A 4JI6Q 1PFSA 1HZCA 4HJ5A 3UE1A 2C35B 2RHQB 4A3LH 1E7ZA 1XJVA 1P16A 2JE6I 3CCEA 4KHZA 4IJHA 3KFUA 2CWAA 2ZJPA 3HOYG 4Y7NH 4R4IA 2JEBI 4PG3A 4PZ7A 5FJ8H 2UUBL 4A3LG 1VQHA 2IHFA 3CPFA 1PA6A 3PV0A 1H95A 1Q1EA 1SFOH 1YJWA 4HJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3E A;  4A93 H;  3CAM A;  4IOA A;  5IYD H;  4LF5 L;  1OXT A;  2ES2 A;  1JJ2 A;  4MNO A;  4LF4 L;  3RR5 A;  1BKB A;  3MXN B;  5FJ8 G;  1VQ5 A;  3J81 i;  4BBS H;  4DUZ L;  2ZJR A;  1NBW A;  3K80 C;  1N34 L;  4K0K L;  3GTK H;  2UUC Q;  1VQN A;  4GN4 B;  4XTC S;  4JI1 L;  3T1H L;  2JA8 H;  5HY6 A;  4JI8 Q;  5IYD G;  1KAW A;  1V1Q A;  4JI2 Q;  3FKI H;  4DR3 L;  3J7A 5;  3HFZ B;  4BBS G;  5BR8 L;  1IBK L;  3H0G H;  1PYS B;  2GVB A;  1G51 A;  4YCV A;  1XMO L;  2YTV A;  4LF8 Q;  1A62 A;  2VW9 A;  3GTO H;  4DAM A;  2CKZ B;  4JCV E;  2VQE L;  2JA8 G;  3CW2 C;  5C4J H;  4LF6 Q;  4K0K Q;  5M3M H;  4A3C H;  3FKI G;  4AYB E;  3W1G A;  4C3H H;  2JJQ A;  3AFQ A;  3HKZ E;  3H0G G;  3I4O A;  4JI3 L;  2H5X A;  1WI5 A;  5IWA Q;  2ZTE A;  4YWL A;  1TWH H;  4DV4 Q;  2NVQ H;  2Q2I A;  2JA7 H;  2LXK A;  4A3K H;  3A0J A;  2CQO A;  2I5H A;  2R6G A;  1CKM A;  4DR1 Q;  3MEF A;  4IO9 A;  2I5M X;  4GNX A;  1PH4 A;  5M3M G;  2R93 G;  4A3C G;  2UXD L;  4B3M L;  2WAQ E;  3CPW A;  1HR0 W;  4OO1 I;  3J80 c;  2ATW A;  3ER0 A;  3CC7 A;  1AH9 A;  2JA7 G;  5ELN A;  5C3E H;  1I6H H;  4A3K G;  3H3V H;  3S1M H;  1OXU A;  4OO1 G;  4PZ6 A;  2JA5 H;  1LYL A;  2UU9 Q;  4NXM Q;  3H3V I;  1JMC A;  4HIM A;  1S72 A;  3TS2 A;  5K36 G;  4DV1 Q;  1A0I A;  4YCU A;  2PNH A;  4DV7 L;  3D0F A;  1M90 C;  1K83 H;  5IT9 c;  5C3E G;  4B3T L;  3PF4 A;  3M3Y H;  3AYH B;  4HIO A;  1EOV A;  2IT1 A;  1PH1 A;  2UUC L;  1YIJ A;  4JI4 L;  1EWI A;  4DR2 Q;  1HZA A;  2JA5 G;  4DUY L;  2K5V A;  2AWN A;  4LNQ A;  2F4V L;  2YTX A;  4GOP A;  1PYB A;  2EXD A;  4P75 A;  3PUW A;  1U5K A;  4AYB G;  5M3F H;  4L5S A;  1K73 C;  1TWC H;  3HKZ G;  5DLQ E;  3CC2 A;  1C0A A;  1VQC A;  4MZ9 A;  2RHS B;  4YHH Q;  4DV6 L;  5JEA G;  1PH6 A;  1SR3 A;  1KRT A;  1EFW A;  2N8N A;  3F2D A;  3S16 H;  1HNW Q;  3I7F A;  1VQE A;  2CFM A;  5IWA L;  1RIP A;  4LUO A;  1UE1 A;  1IXR A;  4B3S L;  4AQY Q;  3T1Y L;  5IP7 H;  2WAQ G;  2JK8 A;  1N33 Q;  2F3I A;  4BY7 H;  4R4C A;  4A3M H;  1KXL A;  1D7Q A;  4IPH A;  1IBL Q;  2Q2H A;  1QUQ B;  4JBW A;  4RG1 A;  3AQQ A;  3W1B A;  4DR1 L;  1XPR A;  3S15 H;  1CUK A;  4JI7 Q;  1OXS C;  4JG2 A;  3EIV A;  1JT8 A;  4R4Q A;  4BXX H;  3PIO A;  1TWG H;  4GLA C;  1KHI A;  4DPG A;  4XIG S;  5IP7 G;  4POF A;  4BY7 G;  4B3R Q;  4JV5 Q;  4DV3 L;  1A63 A;  4A3M G;  1J6Q A;  2KBN A;  4P73 A;  2R7Z H;  1GO3 E;  1N32 L;  2E8G A;  3CCL A;  2JEA I;  1HJP A;  1VQ4 A;  1XMQ L;  2BA1 A;  3BU2 A;  3CD6 A;  4DR6 L;  2UU9 L;  1JJG A;  2E2J H;  4NXM L;  4UP7 A;  4BXX G;  1BBW A;  2V1C C;  2UUA Q;  1LM0 A;  2HIV A;  2VL6 A;  2VS1 A;  1XNQ L;  2Y0S E;  3TQY A;  2KCM A;  1E3P A;  2UXB Q;  4QIW E;  1PH3 A;  4KHP Q;  1CKO A;  2IY5 B;  4X65 Q;  1EIF A;  3RZD H;  3A5Z B;  4OX9 Q;  2UXC Q;  3PO2 H;  3PUV A;  4X64 Q;  3CCM A;  3K7U C;  1OTC A;  1HR0 Q;  4DR7 L;  4BBR H;  3RLF A;  2JA9 A;  4R1J A;  1HNZ Q;  2PMZ E;  1K0R A;  4JI0 Q;  4KLK A;  3DLL A;  3HOU H;  1KL9 A;  4HJ9 A;  4APV A;  1L1O C;  2QGQ A;  3GTJ H;  2Z6K A;  3CCR A;  3L7Z C;  3PO2 G;  1HZ9 A;  1B70 B;  3D31 A;  4YWK A;  2VQF Q;  3HOY H;  4BBR G;  1VQ9 A;  1IBM L;  1FL0 A;  1YHB A;  3K8A A;  4BY1 H;  1JE5 A;  4HIK A;  3HOU G;  1Z47 A;  2DUD A;  4X66 L;  3J81 j;  3G4S A;  3HOZ H;  3K7A H;  1VQJ A;  1V9P A;  4IJL A;  2RF4 A;  2MFI A;  2XGT A;  1GD7 A;  1W3S A;  4JI5 Q;  3KDF B;  5C0X J;  4JI7 L;  3KF8 B;  1X54 A;  3H15 A;  4BY1 G;  1XNR L;  1GM5 A;  2D0O A;  1J5E Q;  1PH5 A;  3HOZ G;  1K3R A;  1VQF A;  2AKW B;  3PF5 A;  1YHA A;  3NBH B;  4GOP B;  3CXC A;  1BVS A;  2Y0S G;  3OW2 A;  4GKJ L;  2PI2 A;  3M9B A;  4LF9 Q;  3LGJ A;  3W5O A;  1Q46 A;  5LMU Q;  3CCV A;  1HH2 P;  4GS3 A;  1QUQ A;  3OTO Q;  1EQQ A;  4IFD I;  4DV0 L;  2JQO A;  3B6Y A;  1NJI C;  2UXB L;  4KHP L;  2K4K A;  4A3I H;  1E1O A;  1DGS A;  4X65 L;  1CKN B;  4EQ5 A;  5J3B A;  4AH6 A;  5H1S E;  2K5H A;  2ID0 A;  5IP9 H;  5LMN Q;  1A8V A;  1VQB A;  3STB C;  4IFD G;  3J7Z C;  4HJ7 A;  4X62 L;  2EIF A;  1G6P A;  3HKS A;  3G71 A;  1PH9 A;  1GKH A;  3EBE A;  5M5X H;  2PI2 E;  3EN2 A;  2FXQ A;  4A3I G;  3ICE A;  5HGQ A;  5IYB H;  4O2D A;  1K8A C;  4A3D H;  3S17 H;  2R93 H;  1M1K C;  5IP9 G;  3E0E A;  1YEZ A;  2HHH L;  4JI6 L;  1VQL A;  1AE3 A;  3CCJ A;  2VUM H;  3NEN A;  3J81 c;  1YZ6 A;  4DR4 Q;  1GVP A;  1UE7 A;  1Y14 B;  1PHJ A;  2MO1 A;  5IYB G;  1Q1B A;  4A3D G;  4P71 A;  4HJ8 A;  1NMG A;  4FDB A;  3RN2 A;  1I50 H;  3J80 i;  5M5Y H;  4DV5 Q;  2HT1 A;  1WCM H;  3BZK A;  2IHE A;  3L2P A;  2VUM G;  4NPS A;  3M85 A;  1UWV A;  2CCZ A;  3E9I A;  3CQZ H;  3L0O A;  3JAM i;  3KJO A;  1YIT A;  5GQO A;  2NVT H;  3FHW A;  3RN5 A;  1U0L A;  4QQB X;  1B7Y B;  3G48 A;  2AWO A;  1X9N A;  4JYA Q;  1VS0 A;  1X56 A;  2AMC B;  1YJ9 A;  1WCM G;  2NVY H;  2MO0 A;  1S40 A;  3IRB A;  4JOI C;  1QVG A;  2I5L X;  3CF5 A;  1KQS A;  4TVA B;  4OWX B;  2OTL A;  3PO3 H;  4LFB Q;  3KDF A;  1EYG A;  1NY4 A;  5M5W H;  2WFW A;  4Y52 H;  2IX1 A;  2VZA A;  4JBM A;  2OQ0 A;  1WJJ A;  3S2D H;  4JI8 L;  1B8A A;  4JI2 L;  1YVC A;  4UPA A;  5LMN L;  4A75 A;  1VQM A;  1QZH A;  2UXC L;  2L15 A;  5GAH C;  4LF8 L;  1IYJ B;  3PO3 G;  4DAY B;  5C44 H;  3S14 H;  1MJC A;  1SN8 A;  3G6E A;  3I4M H;  4OON A;  4LF6 L;  2XTI A;  4DKA C;  4DK3 C;  3F1Z A;  2NN6 G;  4OX9 L;  4OWT B;  2E5L L;  2D0P A;  4IPD A;  5C44 G;  4DV4 L;  1YI2 A;  1CKN A;  4R4O A;  2OWO A;  4DR4 L;  3UDG A;  4A3G H;  1KC8 C;  3UDX A;  3A5U A;  4J15 A;  3STB D;  1HNX Q;  2NZO A;  2K75 A;  5JJK A;  4LUZ A;  1WYD A;  4DV2 Q;  2D62 A;  4L5R C;  1Z9F A;  1MKH A;  1VCI A;  1TWF H;  3AFP A;  4DR5 Q;  4A3G G;  3KYH C;  1YBY A;  1WOC A;  2N78 A;  1N36 Q;  1P8L A;  5FLX c;  4A3E H;  3KF6 B;  3RZO H;  4DV1 L;  4RMF A;  4JBK A;  4HID A;  2ALY B;  1E22 A;  3GTQ H;  2EQS A;  3PSI A;  4MTN A;  4DR2 L;  4PMW A;  1IL2 A;  4A4I A;  4A3E G;  1PVO A;  1Q12 A;  1PH8 A;  4TQU S;  3HOV H;  2UUB Q;  1JJC B;  2QEX A;  2LXJ A;  3TRE A;  1V43 A;  4GN5 A;  4ALP A;  2CWP A;  2E5L Q;  4IOC A;  2NVX H;  2RCN A;  3M4P A;  2A1A A;  4P72 A;  2ZJQ A;  1CSP A;  4YHH L;  4QGU A;  3UDI A;  1EIY B;  2GN5 A;  1VQK A;  4LF4 Q;  1Y1V H;  1X6O A;  4LF5 Q;  5FLM H;  3CP0 A;  2K5N A;  2F52 A;  4UP9 A;  2PQA A;  3HOV G;  1HNW L;  4C2M H;  5E7N A;  3F2C A;  3HOW H;  1L2F A;  2GVA A;  4C3I H;  2R7F A;  3ULJ A;  1NTG A;  3U4Z A;  4AQY L;  1N34 Q;  1C7Y A;  3E9H A;  1N33 L;  2B63 H;  3AEV A;  4JI1 Q;  1Y1W H;  2ZTD A;  3OYY A;  3T1H Q;  1QVC A;  1NMF A;  1YHQ A;  1IBL L;  1FJG Q;  4DR3 Q;  2R7Z G;  1Y1V G;  5FLM G;  5BR8 Q;  1IBK Q;  2ASB A;  3HOX H;  3U58 A;  1XMO Q;  4A76 A;  1L1O A;  3I4M G;  3HOW G;  4WJ3 M;  4DV2 L;  2B63 G;  4B3R L;  4JV5 L;  1Y1W G;  4BA2 I;  4YWM A;  2AHO B;  4L5Q A;  1N36 L;  1E1T A;  1EQR A;  3HOX G;  4JI3 Q;  3UE0 A;  4LFC Q;  1HZB A;  4WJ4 A;  2UUA L;  3PCO B;  2WB1 E;  5GAD C;  1E24 A;  3M4O H;  2YU9 H;  5C4X H;  2A8V A;  2UXD Q;  1MIU A;  4LWC A;  4B3M Q;  1XTD A;  4GN3 B;  4LFA Q;  4X64 L;  2Z0S A;  4JC0 A;  3I55 A;  1HR0 L;  1HNZ L;  1MJE A;  4C3J H;  4JI0 L;  1SLJ A;  1EUJ A;  3RLO A;  1X55 A;  4IPC A;  4DNI A;  2DGY A;  5C4X G;  3KF6 A;  4UY8 C;  3S2H H;  2N3S A;  2OCE A;  3NEM A;  1TXY A;  3CCS A;  3GDE A;  5GRO A;  2VQF L;  2ZTC A;  3KLW A;  4QL5 A;  4DV7 Q;  4B3T Q;  1SRO A;  1VQI A;  2MQH A;  1Q81 C;  1VQO A;  2KEN A;  1R9T H;  4JI4 Q;  3CME A;  5C0X I;  1VQP A;  1K8G A;  1FJG L;  4DUY Q;  4A93 G;  4JI5 L;  1VQD A;  2E2I H;  2F4V Q;  4GNX C;  3GTP H;  3TRZ A;  4GKK Q;  5AJ3 Q;  3A74 A;  3FP9 A;  5C0X G;  1J5E L;  3TS0 A;  5JEA J;  1D8L A;  3DM3 A;  2QA4 A;  1Q86 C;  5JJI A;  1I94 Q;  4DV6 Q;  1W2B A;  2WB1 G;  4LUV A;  4GLX A;  1VQ8 A;  3WWV A;  1Q7Y C;  1S3O A;  3CC4 A;  4LF9 L;  4LFC L;  1XPO A;  3GTL H;  2B3G A;  5LMU L;  4B3S Q;  3T1Y Q;  4LF7 Q;  4POG A;  5EAY A;  3OTO L;  2R7D A;  2PQA B;  1G29 1;  1RL2 A;  2KHJ A;  3GTG H;  2HQL A;  2WP8 J;  1LTL A;  2HIX A;  3S1N H;  1OXX K;  1VQG A;  3PUX A;  4A3J H;  4LFA L;  2BH2 A;  2OTJ A;  3U50 C;  3CCU A;  4X6A H;  3PIP A;  3U4V A;  4DV3 Q;  1N9W A;  2NN6 I;  1VQ6 A;  1C9O A;  1L0W A;  3NEL A;  1L1O B;  4P74 A;  2N49 A;  4GOP C;  1N32 Q;  5GAG C;  1XMQ Q;  3JAM c;  4DR6 Q;  4JOI A;  4A3J G;  1YJN A;  1FGU A;  1XNQ Q;  1TWA H;  2BA0 A;  3PUZ A;  2OQK A;  3ERS X;  2YYZ A;  2K52 A;  4IPG A;  5GAE C;  1KRS A;  3PGZ A;  3F2B A;  1SMX A;  1X3F A;  1K9M C;  1PV4 A;  4O0A A;  4DR7 Q;  4OWW B;  4DK6 C;  1WFQ A;  4L5T A;  1UE6 A;  2B29 A;  2ZM6 Q;  4DV5 L;  2E2H H;  4H02 A;  3I4N H;  4PZ8 A;  5IE8 A;  5AJ3 L;  2KCT A;  4GKK L;  4YY3 Q;  3CCQ A;  4NXN Q;  2R92 H;  3I56 A;  4R4T A;  4AIM A;  5JJL A;  2LSS A;  1I94 L;  3BJU A;  2YTY A;  1SE8 A;  3GD7 A;  3RNU A;  2K50 A;  1IBM Q;  2IX0 A;  4JYA L;  4OXP A;  3I4N G;  2YV5 A;  5M3F G;  4X66 Q;  2K14 A;  3TEH B;  1VQ7 A;  2R92 G;  4LF7 L;  4JBJ A;  4LFB L;  5IYC H;  3ULL A;  1PH7 A;  2Q2T A;  4A3B H;  1O7I A;  4UP8 A;  1CSQ A;  3ULP A;  1XPU A;  3GTM H;  1Q8K A;  3M4Q A;  3BZC A;  1XNR Q;  3KOJ A;  3ZJY C;  2VNU D;  1UEB A;  5LMN W;  1LUZ A;  2BH8 A;  1N8R C;  1Q82 C;  3K0X A;  1JB7 A;  1QVF A;  5IYC G;  1ASZ A;  1AE2 A;  4A3B G;  3RLN A;  1T9H A;  4GKJ Q;  2KHI A;  4KI0 A;  1X65 A;  3K81 C;  3SGI A;  1FVI A;  1KIX A;  1NE3 A;  1UE5 A;  3GO5 A;  1QZG A;  1I3Q H;  2Z6K C;  4DUZ Q;  4QJF A;  3S1R H;  2I0Q A;  3CMA A;  4A3F H;  4QY7 A;  5IY0 A;  3PUY A;  4EX5 A;  3KJP A;  2NZH A;  4DV0 Q;  2MNA A;  3VDY A;  3UDF A;  2JA6 H;  3M7N A;  1OXV A;  3JC6 6;  4BA1 I;  1YNX A;  4IFD J;  4NB3 A;  1X3G A;  2A19 A;  1VQA A;  4ME3 A;  1SRU A;  4GNX B;  1HNX L;  3S1Q H;  4LW1 A;  2Q2U A;  4X62 Q;  2ZM6 L;  4A3F G;  4GLV B;  4YCW A;  2JA6 G;  3F8T A;  1BBU A;  4NXN L;  4YY3 L;  2VQE Q;  4DR5 L;  1KD1 C;  1I5F A;  1ASY A;  3I2Z A;  3Q8D A;  1PH2 A;  1IZ6 A;  5ELO A;  2HHH Q;  2VY3 A;  3S24 A;  4JI6 Q;  1PFS A;  1HZC A;  4HJ5 A;  3UE1 A;  2C35 B;  2RHQ B;  4A3L H;  1E7Z A;  1XJV A;  1P16 A;  2JE6 I;  3CCE A;  4KHZ A;  4IJH A;  3KFU A;  2CWA A;  2ZJP A;  3HOY G;  4Y7N H;  4R4I A;  2JEB I;  4PG3 A;  4PZ7 A;  5FJ8 H;  2UUB L;  4A3L G;  1VQH A;  2IHF A;  3CPF A;  1PA6 A;  3PV0 A;  1H95 A;  1Q1E A;  1SFO H;  1YJW A;  4HJA A; 
#chains in the Genus database with same CATH topology
 2Z9H A;  4IOA A;  4MNO A;  3K80 C;  1N34 L;  4K0K L;  4C2M B;  2UUC Q;  4F8M A;  2JA8 H;  3J7A 5;  1V1Q A;  3AU7 A;  1PYS B;  2GVB A;  2IW3 A;  4YCV A;  2F0U A;  1MGS A;  1MD2 D;  1LAB A;  2JA8 G;  2PMZ B;  3HRZ C;  1TY2 A;  1SMY D;  4AYB E;  4C3H H;  2JJQ A;  3AFQ A;  1B3Q A;  2NVQ H;  2JA7 H;  1Z6H A;  2CQO A;  2I5H A;  1DD2 A;  4IO9 A;  5M9O A;  4OO1 H;  2UXD L;  2L0C A;  1Q3L A;  2WAQ E;  3CPW A;  4OO1 I;  4ZYS A;  4TRD A;  5T1I A;  2KHS A;  2JA7 G;  4ABN A;  1AH9 A;  2EDG A;  5CMD A;  3H3V H;  4HSV A;  5COR A;  4OO1 G;  4NXM Q;  1RHP A;  5IGB A;  3H3V I;  4HIM A;  1S72 A;  5BN4 A;  1E2Z A;  1A0I A;  3D0F A;  3KLR A;  2A74 C;  3PF4 A;  3M3Y H;  3VR2 A;  2JN4 A;  1K8O A;  1EOV A;  2UUC L;  4JI4 L;  1YIJ A;  1YNN C;  1LT3 D;  5JEA H;  2SOB A;  2AWN A;  2ZXR A;  4LNQ A;  4GOP A;  2F4V L;  2EXD A;  2NBF A;  2F0O A;  5M3F H;  1BR9 A;  5M5Y B;  3MA2 B;  1K73 C;  1H9S A;  5C5L A;  2SNS A;  4YHH Q;  4IUN A;  5JEA G;  4WRD A;  4DV6 L;  1PH6 A;  1EFW A;  1HUM A;  2N8N A;  3R2T A;  1EU4 A;  4LUO A;  4AQY Q;  1N33 Q;  2JK8 A;  3GTL B;  1MSG A;  1QUQ B;  3S15 H;  1CUK A;  4JG2 A;  3EIV A;  3S9W A;  1STN A;  2JYO A;  4BXX H;  1KLG D;  4RGM A;  4JV5 Q;  4KTA A;  1XYI A;  4P73 A;  4YIJ A;  2HUG A;  2K5W A;  1DYQ A;  2JEA I;  1AN8 A;  2BA1 A;  3BU2 A;  5J39 A;  1UUP A;  4NXM L;  4BXX G;  5CV7 A;  2KOL A;  1BBW A;  1XNQ L;  2VS1 A;  2RBM A;  2Y0S E;  3EQL C;  4QIW E;  3ZYY X;  1CKO A;  2IY5 B;  2O5J C;  4K6L A;  2WKD A;  3PO2 H;  1LTB D;  4X64 Q;  5G3L F;  3CCM A;  3SK5 A;  3TP6 A;  2PZW A;  1HNZ Q;  4IQZ A;  3HOU H;  3I8Z A;  4V0B A;  1STE A;  4APV A;  3PO2 G;  1STB A;  1SE3 A;  3K8A A;  4LMQ D;  1JE5 A;  5FO7 B;  4HIK A;  3HOU G;  2E2D C;  1HFN A;  1YNN D;  2XRS D;  1TY0 A;  1S5F D;  4JI5 Q;  4K14 A;  4FF4 A;  4CBV A;  1X54 A;  1XNR L;  2BCO A;  4FXK C;  1QG7 A;  1K3R A;  1YHA A;  1BVS A;  1M4V A;  3OW2 A;  3NPP A;  4CKC A;  2PI2 A;  3M9B A;  3ERO A;  3H3V C;  5DM6 3;  2EY1 A;  2AQ1 B;  3MXG A;  3W5O A;  1Q46 A;  1ZEQ X;  1I3Q B;  4X3U A;  3MXP A;  3GP7 A;  1E1O A;  2LFN A;  1CKN B;  2IL8 A;  5J3B A;  5IP9 H;  3STB C;  2EIF A;  1G6P A;  2XWJ B;  4IUQ A;  1PH9 A;  3EBE A;  4CDE C;  3EN2 A;  2FXQ A;  5HGQ A;  3S17 H;  2R93 H;  1M1K C;  5IP9 G;  3E0E A;  5I9P A;  1YEZ A;  4H0L C;  2VUM H;  5CV9 A;  2GA4 B;  1GVP A;  5ELF A;  1JOR A;  2MO1 A;  4F7X A;  1NMG A;  5NUC A;  2K5D A;  5K36 H;  2EJG C;  3HG9 A;  4DFA A;  1WCM H;  2IHE A;  5KYL A;  5C4H A;  3SXH A;  2VUM G;  4NPS A;  3M85 A;  3L0O A;  1YIT A;  2IJ0 A;  1AEX A;  5JJK A;  4JYA Q;  1VS0 A;  4KJO A;  3S2H B;  1WCM G;  2NVY H;  2MO0 A;  1QVG A;  4TVA B;  4PQX A;  1K8M A;  4Y52 H;  2IX1 A;  1SBB B;  1WJJ A;  4JI8 L;  1QZH A;  4IAL A;  2L15 A;  4LF8 L;  3DWP A;  3GTP B;  2RDF A;  4DAY B;  5C44 H;  1CZG A;  5FO9 B;  1RKN A;  4LF6 L;  4DKA C;  1JWU D;  3E3X A;  2H1E A;  2NN6 G;  2PO4 A;  4C3H B;  5DM7 3;  5C44 G;  1YI2 A;  4Z9C B;  3CRK C;  3GTG B;  3STB D;  1O7L A;  3S1N B;  4DV2 Q;  4G4K A;  5KYI A;  4ID6 A;  1A15 A;  1MKH A;  3K58 A;  1TWF H;  1D5M C;  3KYH C;  1I4X A;  3LNN A;  1YBY A;  1WOC A;  1RF2 D;  1N36 Q;  1P8L A;  5C3X A;  5D65 A;  2FHT A;  2ZXP A;  3MHB A;  4NP5 A;  4DR2 L;  4RAU C;  3URY A;  1IL2 A;  2Z8L A;  1ML0 D;  1FNV A;  3OW7 A;  3KLS A;  2QW7 A;  1JJC B;  4DK0 A;  5M3F B;  2NVX H;  3M4P A;  1E0B A;  4LF4 Q;  1Y1V H;  1X6O A;  3CP0 A;  5EBC A;  1G2S A;  1KDC A;  3IFD A;  5E7N A;  3VR5 A;  3J80 L;  1C7Y A;  1NTG A;  1SYB A;  3U4Z A;  1HTP A;  5LHY 1;  4ZRZ A;  1RDP D;  4KY7 A;  3T1H Q;  2EYL A;  1NMF A;  2F0Q A;  3Q22 A;  4A3B B;  1Y1V G;  3S15 B;  2ASB A;  5G3L D;  1L1O A;  3I4M G;  4V19 0;  5I6Y A;  4DV2 L;  4B3R L;  2XSC A;  4OEM B;  4KN7 C;  4BA2 I;  4FF3 A;  2RKS A;  1N36 L;  1JIC A;  2Z6B A;  4KJN A;  4WJW A;  2A8V A;  3I90 A;  4B3M Q;  1XTD A;  3R3O A;  2K33 A;  4JC0 A;  3I55 A;  1SYG A;  4C3J H;  2RDG A;  2CVR A;  4IPC A;  2DGY A;  4JVZ A;  4UY8 C;  2RQX A;  2KEC A;  3H94 A;  2VQF L;  3SE0 A;  4B3T Q;  4C3J G;  1R9T H;  1VDZ A;  2OEO A;  1VQP A;  4DUY Q;  4A93 G;  3TSS A;  5AFW A;  4GKK Q;  3K5M A;  3A8J E;  4DK1 A;  3C46 A;  4DXF A;  1W2B A;  2WB1 G;  2KA7 A;  2DY7 A;  5FO8 B;  4IUU A;  3WWV A;  1Q7Y C;  1QE6 A;  3DUZ A;  1TS2 A;  5LMU L;  1PYW D;  4LF7 Q;  2LKV A;  4BBS B;  2PQA B;  2HQL A;  1KLU D;  1LTL A;  2HIX A;  3GTK B;  3T16 A;  2WV6 D;  2EY6 A;  1LLR D;  4I7A A;  3TDQ A;  4A3J H;  5KIX A;  2BH2 A;  2F0H A;  5CR3 A;  5EPL A;  2B2Y A;  3A54 A;  1BO0 A;  2P5Z X;  3U50 C;  3U4V A;  1N9W A;  1VQ6 A;  4K5X A;  1N32 Q;  1F2Y A;  4IUV A;  4RGO S;  1LT5 D;  4A3J G;  4FF1 A;  1FGU A;  1CQF A;  2R93 B;  5EPK A;  2OQK A;  2K52 A;  5GAE C;  1U4M A;  3BVZ A;  1SE2 A;  1X3F A;  4O0A A;  1STY A;  4DR7 Q;  4Q5V A;  3OWE B;  2OXP A;  3NTK A;  2ZM6 Q;  1A2U A;  3EFX D;  1V1P A;  4H02 A;  4GKK L;  2RA4 A;  1PTO H;  2B39 A;  2DNE A;  1WCM B;  4YY3 Q;  5KGU A;  4R4T A;  1BCP F;  3MFG A;  1SE8 A;  3DWQ A;  1ESR A;  1F9S A;  2K50 A;  2EOT A;  4OXP A;  5KEE A;  5I2X A;  1RJT A;  1EZ6 A;  4E6I A;  1CA6 A;  2L55 A;  2NVY B;  3NK9 A;  1Y8N B;  4EGV A;  4LF7 L;  1SEB D;  4JBJ A;  1AZQ A;  1GUN A;  1Q8K A;  3M4Q A;  3BZC A;  3BVM A;  3KOJ A;  3ZJY C;  5TSS A;  5HGT A;  3BDL A;  2BH8 A;  1N8R C;  3L9A X;  1AE2 A;  5C44 B;  3RLN A;  3PIP 3;  1T9H A;  2VB3 X;  4KI0 A;  4FXG C;  1KIX A;  3MAQ A;  1FVI A;  1WTW A;  2Q8I B;  3BYT B;  2B2U A;  4A3F H;  4QY7 A;  5IGE A;  2DJG C;  3PUY A;  3LWE A;  3VDY A;  3M7N A;  1OXV A;  3Q24 A;  4IFD J;  4NB3 A;  3SDZ A;  3K5L A;  1JC7 A;  3U9O A;  4LW1 A;  2Q2U A;  4X62 Q;  2ZM6 L;  4A3F G;  4GLV B;  4YCW A;  3OMC A;  2OF1 A;  4YY3 L;  3F2U A;  1TWF B;  5EPJ A;  4XQQ A;  5E4X A;  1PFS A;  3QB3 A;  2RHQ B;  1IYV A;  1XJV A;  2J7Z A;  1P16 A;  4KKT A;  4OL7 A;  4C1N K;  3KFU A;  3BG3 A;  3HOY G;  1CI3 M;  4Y7N H;  2JEB I;  4PG3 A;  4QUF A;  3CPF A;  1L0Y B;  1Q1E A;  1R4Q B;  2NVX B;  1SE4 A;  2ES2 A;  1A2T A;  2ZT9 C;  4MTK A;  1C48 A;  1NBW A;  1KDB A;  4GN4 B;  4JI1 L;  5ELD A;  5CV4 A;  1QOH A;  5HY6 A;  4DR3 L;  1KAW A;  1C8C A;  3HFZ B;  1XMO L;  1A62 A;  1SDF A;  2ICE C;  4DAM A;  3VYR A;  1B44 D;  1PTO C;  4DN4 M;  3CW2 C;  2RCF A;  4JI3 L;  2K32 A;  1WI5 A;  4JK1 C;  4DV4 Q;  2Q2I A;  3P1H A;  3DWA A;  2LXK A;  1JWM D;  4A3K H;  3A0J A;  3MEF A;  1TVX A;  2I5M X;  3ERQ A;  2L12 A;  1II3 A;  3J80 c;  4A3K G;  5K5P A;  3ITP A;  1TS3 A;  1OXU A;  4PZ6 A;  5IGF A;  5EGT A;  3S1M H;  4YCU A;  1K83 H;  4HIO A;  1EIG A;  3X3M A;  3N52 A;  1R9T B;  1EWI A;  2J4X A;  1HZA A;  4ZAI A;  4K5W A;  2WB1 B;  4P75 A;  3PUW A;  1U5K A;  4AYB G;  4L5S A;  5DLQ E;  2F0K A;  1V8Q A;  2NTT A;  3MXN A;  1SR3 A;  2F0N A;  1SNO A;  3F2D A;  3S16 H;  2NVT B;  1HNW Q;  2CFM A;  1RIP A;  2RDH A;  1LTR D;  4BY7 H;  3T1Y L;  2WAQ G;  2F3I A;  4ZUI A;  1SYC A;  4R4C A;  4A3M H;  4R8I A;  2G9H D;  2KEE A;  3J80 E;  1SYF A;  4H7B A;  3V96 A;  4A3J B;  4BY7 G;  4XIG S;  2VB2 X;  4M8A A;  1PTO D;  1H9J A;  4A3M G;  2KBN A;  1JJG A;  1HJP A;  1XMQ L;  2JSO A;  5T1G A;  2E2J H;  4UP7 A;  1SXT A;  1LM0 A;  4ODG A;  1LTA D;  2UXB Q;  4X65 Q;  1EIF A;  3A5Z B;  3R8B A;  1S5C D;  4OGQ C;  4ZKC B;  1OTC A;  3RLF A;  2JA9 A;  2SNM A;  2PMZ E;  4KLK A;  1K3B C;  2KCN A;  1PTO B;  3I4L A;  3VYT A;  3I91 A;  1IBM L;  1YHB A;  1A3U A;  4A3E B;  2K7V A;  3RZO B;  2DUD A;  3HOZ H;  3G4S A;  1BQQ T;  3K7A H;  2HCC A;  1V9P A;  4IJL A;  2RF4 A;  1PDQ A;  2EYM A;  5C0X J;  3KF8 B;  4DAY A;  3H15 A;  1DON A;  3DEP A;  3HOZ G;  3PF5 A;  1B9N A;  3SEB A;  5IT9 L;  1U4R A;  3NBH B;  5JOB A;  3HOV B;  3J7Y W;  1YNJ C;  3PIO 3;  1D5Z C;  2Y0S G;  4NKL A;  4ZUJ A;  1FNU A;  1J8I A;  3N6R A;  3LGJ A;  3CCV A;  1G2T A;  1CQV A;  3BZD B;  1EQQ A;  4DV0 L;  3B6Y A;  2RSO A;  2UXB L;  4A3F B;  2K4K A;  4A3I H;  4X65 L;  2B63 B;  4AH6 A;  3K0Y A;  1A8V A;  4K8J A;  3NUC A;  4A3I G;  1QCB D;  3SR1 A;  4A3D H;  5IYB H;  4O2D A;  1DCZ A;  4U68 A;  2D9U A;  3NTI A;  2Q8T A;  3BVG A;  3T56 B;  4JI6 L;  1GUT A;  1AE3 A;  2EVB A;  3CCJ A;  3NEN A;  4O42 A;  1YZ6 A;  5I2Y A;  1SNQ A;  1UE7 A;  1PHJ A;  4A3D G;  5IYB G;  3L3O C;  1TS5 A;  4HJ8 A;  4FDB A;  1PFN A;  3RN2 A;  5C4X B;  1I50 H;  4FNF A;  1CA5 A;  4Y7N B;  1VF5 C;  3L2P A;  2CCZ A;  3CQZ H;  5IGG A;  3FHW A;  3G48 A;  1X9N A;  1SYE A;  1X56 A;  4KY6 A;  2R61 A;  4JOI C;  2XIW A;  5CC4 A;  1KQS A;  3PO3 H;  2OTL A;  4LFB Q;  4FP5 D;  3KDF A;  4DGZ A;  1OO9 B;  1X32 A;  2OQ0 A;  1SAP A;  1VQM A;  4K8I A;  5GAH C;  3PO3 G;  1YNJ D;  3S14 H;  2WII B;  1ZYR C;  4KKS A;  4CJ1 B;  1JR0 D;  2XTI A;  4DK3 C;  4IPD A;  4P2C B;  3WDN A;  1CK1 A;  2LMC B;  3VYS A;  3A7A B;  3UDX A;  1QNK A;  4FVM A;  3QG1 A;  1HNX Q;  1B50 A;  4O1N A;  1WYD A;  3WOE A;  2B2W C;  4F87 A;  4DR5 Q;  3MTS A;  2N78 A;  3A8I E;  3ND9 A;  4RGT A;  1VMC A;  2PNR C;  5JVH 3;  4JBK A;  3S1M B;  1E22 A;  3NBI A;  1K83 B;  1Y69 U;  1WTH A;  3K6O A;  1JOO A;  2EQS A;  2KUM A;  3OHX C;  4HCS A;  4MTN A;  4DNR B;  3NWS A;  1Q12 A;  1LT6 D;  1ET9 A;  1FNW A;  2ZXO A;  2QEX A;  1HFG A;  1CT1 D;  3I4N B;  4ALP A;  4YHH L;  4LF5 Q;  4XT1 B;  2R7Z H;  2GN5 A;  2K5N A;  2PQA A;  1EYD A;  3HOW H;  1L2F A;  1JOK A;  2GVA A;  5ELC A;  4AQY L;  1N33 L;  3D8G A;  3M4O H;  5KNC A;  1Y1W H;  2ZTD A;  2EYO A;  3OYY A;  1QVC A;  1YHQ A;  1FJG Q;  2AUK A;  4BY7 B;  2R7Z G;  2K01 A;  1U9R A;  5BR8 Q;  1IBK Q;  3GTM B;  3HOX H;  4A76 A;  4WJ3 M;  3HOW G;  1VF7 A;  4JV5 L;  1Y1W G;  1ZYR D;  2EY2 A;  3HP3 A;  3T4A C;  4YWM A;  4L5Q A;  5KNB A;  3TP5 A;  1FYC A;  1H9M A;  3HOX G;  4LFC Q;  5DAU A;  2PQE A;  1SJE D;  2E2J B;  5GAD C;  3FDT A;  4GZY C;  2FFK B;  3VR4 A;  4EQO A;  4GN3 B;  4X64 L;  1B4O A;  2NWG A;  5C5M A;  1HNZ L;  2B2T A;  2A68 C;  4OIJ A;  2N55 A;  1SLJ A;  1X55 A;  3KF6 A;  2N3S A;  4TKO B;  3NEM A;  3GDE A;  5GRO A;  3KLW A;  4DV7 Q;  2F0M A;  1SRO A;  3A8K E;  4ZLT F;  4BS9 A;  3CME A;  4LJZ C;  1FJG L;  3K7A B;  1MI2 A;  4JI5 L;  2NZ1 D;  2KED A;  2B8G A;  2DN8 A;  4QIW B;  1EQV A;  3TS0 A;  1Q86 C;  1QB5 D;  2QA4 A;  3CRL C;  5EKK A;  4GLX A;  4LUV A;  5FOB B;  4X3K A;  1S3O A;  3CC4 A;  1MHW C;  1PFM A;  4LFC L;  4B3S Q;  2EYF A;  5EAY A;  4FO2 A;  1RL2 A;  1D1K A;  1I4G A;  2KHJ A;  2IWH A;  5LL6 X;  3V05 A;  4A3I B;  3HEJ A;  2JA8 B;  1XXG A;  2NN6 H;  1A3V A;  4CKB A;  4DV3 Q;  2G9D A;  2NN6 I;  4HR7 B;  5IGC A;  1C9O A;  4GOP C;  2L5T A;  1IKL A;  4P74 A;  1XWE A;  3X3N A;  4CJ0 B;  1Y8O B;  4DR6 Q;  1I4P A;  2F4I A;  4A3D B;  1EY8 A;  1YJN A;  1SYD A;  4H13 C;  1TWA H;  3OPO A;  4RFB A;  2NVQ B;  1FD7 D;  3PGZ A;  2JA7 B;  3TBI B;  4CJ2 C;  3NP8 A;  4MHE A;  3H6M A;  4DK6 C;  3EJI A;  1GUS A;  2E2H H;  2A68 D;  2CHB D;  1I50 B;  4U67 3;  2KCT A;  3MZ5 A;  5JPM C;  1K0S A;  4AIM A;  2LSS A;  3CQZ B;  3BJU A;  3RNU A;  3GD7 A;  4JYA L;  1B1Z A;  4X66 Q;  2K14 A;  3TEH B;  3M3Y B;  5IYC H;  3ULL A;  1PH7 A;  3PO3 B;  1O7I A;  1CSQ A;  1WD0 A;  4XXE A;  4K2L A;  1UEB A;  1EOT A;  1LUZ A;  5LMN W;  1GHK A;  4XDX A;  3LX0 A;  3K0X A;  5IYC G;  3J81 L;  2FIN B;  4GKJ Q;  5IT9 E;  2C5C A;  1QZG A;  4FF2 A;  4PV1 C;  5CGK A;  4X3T A;  2SDF A;  4K2K A;  4DUZ Q;  1SND A;  4MN3 A;  3I4M H;  2JA6 H;  1WTX A;  3UDF A;  1BBX C;  3JC6 6;  1TQO A;  5CBA E;  4IUP A;  5I4D A;  1JWS D;  2PCF B;  4I65 A;  3S1Q H;  4M1U B;  2AQ2 B;  4R8N A;  1PFB A;  2JA6 G;  2X6G A;  3F8T A;  2K1B A;  2VQE Q;  2JP1 A;  2PW5 A;  3MVV A;  2A69 C;  5ELO A;  2HHH Q;  2VY3 A;  3S24 A;  3UE1 A;  1E7Z A;  3NQT A;  4KHZ A;  4ZCK A;  2DY8 A;  4PMB A;  4WOR A;  5KND A;  1CHQ D;  4HMI A;  3PO2 B;  1NAP A;  1VQH A;  4XT3 B;  4B08 A;  3T13 A;  2F0F A;  1SFO H;  3HOU B;  3P75 A;  4RKB A;  1YJW A;  4J8Q A;  3V2T A;  3OOC A;  1PVO A;  1H9S B;  2O2L D;  4A93 H;  5IYD H;  2KQ3 A;  1JJ2 A;  4LF4 L;  1GUW A;  3RR5 A;  1BKB A;  1VQ5 A;  3J81 i;  2WAC A;  5D3D A;  4DUZ L;  1JE4 A;  1EL0 A;  1LV9 A;  1VQN A;  4XTC S;  3M4O B;  3T1H L;  5IYD G;  4JI2 Q;  3NTH A;  4H44 C;  2UXC Q;  5BN3 A;  2VW9 A;  3PMF A;  5IOD A;  1PZJ D;  2CKZ B;  2MHV A;  2VQE L;  5C4J H;  5M3M H;  4A3C H;  2LS0 1;  5FKA C;  4OX9 Q;  3HKZ E;  5IWA Q;  2ZTE A;  4YWL A;  1JQY D;  1SJH D;  2K28 A;  1F9Q A;  2R6G A;  1RCV D;  3C3L A;  4GNX A;  4XQN A;  5M3M G;  1J9O A;  1GXD C;  4A3C G;  4B3M L;  1HR0 W;  2ATW A;  3CC7 A;  4C56 C;  2A69 D;  1H9R A;  1LYL A;  2XNA C;  2JA5 H;  1HHV A;  2DNC A;  4DV1 Q;  3S17 B;  4B3T L;  1ICF B;  2X6L A;  3AYH B;  4CKE A;  3MC0 B;  2VUM B;  1HQM C;  3KBX A;  2JA5 G;  4L8J A;  3EA6 A;  4DUY L;  1RTN A;  1BOS A;  2YTX A;  1PYB A;  5A35 A;  2F0S A;  1C0A A;  1TWC H;  4HCE A;  2RVL A;  1UNS A;  3D4W A;  3I7F A;  1VQE A;  1PRT F;  1MBY A;  5IWA L;  2B2V A;  3K5N A;  5IP7 H;  1ROD A;  1KXL A;  4K6D A;  1IBL Q;  2XVS A;  3NHH A;  4RG1 A;  3AQQ A;  4FXD A;  4JI7 Q;  1OXS C;  3M7G A;  1JT8 A;  2A6H C;  4R4Q A;  3GQB A;  4DPG A;  5IP7 G;  4POF A;  1A63 A;  5HUR A;  1J6Q A;  1GO3 E;  1EQT A;  1N32 L;  1VQ4 A;  3CD6 A;  1IHZ A;  2RSN A;  2UUA Q;  2VL6 A;  2XN9 C;  3TQY A;  1TWA B;  4HSP A;  1UAP A;  2WKC A;  3PUV A;  4JW0 A;  1EY9 A;  3K7U C;  1HR0 Q;  4DR7 L;  4BBR H;  4NW2 A;  4R1J A;  4J6H A;  4RCO A;  5JPN C;  4N8F A;  4JI0 Q;  3DLL A;  5IOC A;  4XYQ A;  4EQP A;  2IPK D;  3QO2 A;  3SK4 A;  1L1O C;  2QGQ A;  2Z6K A;  3CCR A;  3L7Z C;  1WTP A;  1B70 B;  3D31 A;  4IN3 A;  2ICI A;  4YWK A;  3HOY H;  4BBR G;  1VQ9 A;  3A56 A;  3QWN A;  4WFN 3;  2D5D A;  2E76 C;  1VQJ A;  1W3S A;  1U4P A;  4ZKB B;  1SNC A;  4JI7 L;  1CM9 A;  1GM5 A;  2D0O A;  1J5E Q;  1VQF A;  1NNX A;  1NCV A;  3HS0 C;  3CXC A;  4LK1 C;  4DNT B;  1H9K A;  4LF9 Q;  2SEB D;  4IFD H;  1HH2 P;  1Y1V B;  1QUQ A;  5A2Q L;  3OTO Q;  4IFD I;  3TME A;  3I4M B;  1E2V A;  2JA6 B;  3FMC A;  3MXU A;  3R93 A;  4EQ5 A;  2A6H D;  2K5H A;  3DM1 A;  4IFD G;  1VQB A;  1Q90 A;  3J7Z C;  4QF4 A;  4X62 L;  1GKH A;  4PNY A;  4R9W A;  5M5X H;  4KMU C;  2PW7 A;  1K8A C;  1AW7 A;  3QOJ A;  1KTK A;  3IL8 A;  5D14 A;  5ELE A;  3D6C A;  4RH6 A;  4RCN A;  4IZ8 A;  1BCP C;  1M8A A;  2KCC A;  4DAP A;  1VQL A;  3PQI A;  4KN4 C;  1EYC A;  3J81 c;  1Y14 B;  4L6T B;  4C1N I;  1Q1B A;  1PRT C;  4P71 A;  1CZW A;  1PXU A;  5M5Y H;  4DV5 Q;  2EY5 A;  4XYO A;  1UWV A;  3E9I A;  2B2Y C;  3KJO A;  4C3J B;  5GQO A;  1SNM A;  3KUP A;  2L1B A;  1SFO B;  4QQB X;  2AWO A;  4HMJ A;  1YJ9 A;  4A93 B;  3HGB A;  2I5L X;  4CDF C;  1NY4 A;  5M5W H;  1EIH A;  2VZA A;  2N88 A;  4JBM A;  1TS4 A;  1B8A A;  1YVC A;  3LWU A;  4UPA A;  2R3Z A;  5EQ0 A;  2QF7 A;  2C9O A;  2F0V A;  4OON A;  1I6V C;  4KK7 A;  3F1Z A;  3J81 E;  5C4J B;  1S4Z A;  4OWT B;  5C4Z A;  2D0P A;  1W6K A;  4DV4 L;  1CKN A;  4R4O A;  3CHB D;  4A3G H;  1KC8 C;  4J15 A;  1ICW A;  1PLF A;  4UDU C;  1LAC A;  2K75 A;  4LUZ A;  3Q23 A;  5D3I B;  4L5R C;  1Z9F A;  1VCI A;  2EZV A;  3AFP A;  4A3G G;  1DXM A;  4XQJ A;  2A5H A;  4FYD A;  1BCP D;  1DOM A;  1DJR D;  5CBE E;  2HQE A;  4RMF A;  2FJ2 A;  1D2B A;  2ALY B;  1SSO A;  3GTQ H;  1PRT D;  2B2U C;  3PSI A;  2NB0 A;  4PMW A;  3E5S A;  4TQU S;  2UUB Q;  3SK8 A;  5EKL A;  2LXJ A;  1GUO A;  4GN5 A;  2E5L Q;  2RCN A;  1HA5 A;  2A1A A;  4IUT A;  3P20 A;  4QGU A;  3UDI A;  1VQK A;  1LO5 D;  1BCP B;  4UP9 A;  1HNW L;  4N9P A;  3F2C A;  4C3I H;  3ULJ A;  1N34 Q;  4K0K Q;  5E3F A;  3U9S A;  1I4Q A;  4MIU A;  5ELB A;  4C3I G;  2L9H A;  3MWY W;  2AHO B;  2EYJ A;  1EQR A;  1ENF A;  2QKI C;  2YU9 H;  2UXD Q;  1MIU A;  4LFA Q;  2OT2 A;  3OMG A;  3AB9 A;  3RLO A;  1LTT D;  3S2H H;  2PZU A;  3G7L A;  1G8Z D;  1O80 A;  1TU2 B;  2EYP A;  4QCL A;  2ZTC A;  4QL5 A;  1ILP A;  5C6A A;  2M9V A;  2F0W A;  1XX8 A;  3HOY B;  3E6Z X;  5C0X H;  1VQO A;  1Q81 C;  3OIQ A;  2KEN A;  4JI4 Q;  5C0X I;  3T53 B;  3KK7 A;  2EJF C;  2E2I H;  1RTO A;  2F4V Q;  3GTP H;  4OHJ A;  5AJ3 Q;  2MUY A;  3A74 A;  3FP9 A;  5C0X G;  3P7J A;  5JEA J;  1D8L A;  3DM3 A;  1ILQ A;  1HTL D;  3VA5 A;  5JJI A;  4DV6 Q;  4RGN A;  1XPO A;  1B2T A;  4POG A;  1B9M A;  1WTO A;  2R7D A;  4TSS A;  3GTG H;  2WP8 J;  4NDX A;  3S1N H;  1OXX K;  1VQG A;  4C3H G;  2D2C C;  1IW7 C;  1BNZ A;  4N9T A;  4LFA L;  2WIN B;  3PIP A;  3DEO A;  5CV5 A;  1U4L A;  2I07 B;  3NE5 B;  1L0W A;  3NEL A;  3I3C A;  5I9O A;  5GAG C;  4DA2 A;  3BDO A;  2PYK A;  5M5X B;  3A7L A;  4ILW A;  1WTV A;  1XNQ Q;  2BA0 A;  3PUZ A;  1BDO A;  3ERS X;  2YYZ A;  4B9W A;  3G6J B;  1PZK D;  2TSS A;  4IPG A;  1Z7T A;  3IKJ A;  1D1I A;  1JB3 A;  1SMX A;  1GOZ A;  2F0G A;  5BN5 A;  5C3W A;  1K28 A;  3F2B A;  4A3K B;  1PV4 A;  1QJO A;  4OWW B;  1WFQ A;  1DZ1 A;  1UE6 A;  2B29 A;  4PZ8 A;  5IE8 A;  5AJ3 L;  4RHS A;  2R92 H;  3I56 A;  1A3T A;  2K03 A;  2F0L A;  1X3Q A;  2IX0 A;  3ND8 A;  3DHQ A;  2QDB A;  3K57 A;  5M3F G;  1VQ7 A;  3TZU A;  4DXG A;  2R92 G;  2MJ8 A;  5ISR A;  4LFB L;  4AYB B;  4A3B H;  3ULP A;  5M5W B;  3BYY B;  1XNR Q;  2F03 A;  2BDN A;  2VNU D;  3BS1 A;  1HRJ A;  1Q82 C;  4ZQ3 A;  1JB7 A;  1QVF A;  1ASZ A;  4A3B G;  3D4R A;  2WAQ B;  2PPB C;  1JOQ A;  1X65 A;  3K81 C;  3H09 A;  3HZX A;  1WTR A;  1EY5 A;  4QJF A;  3S1R H;  3S16 B;  2MNA A;  1D6E C;  3CU7 A;  4BA1 I;  2EYH A;  5A2Q E;  4A3M B;  1IW7 D;  2A19 A;  4A3G B;  1VQA A;  4ME3 A;  1HNX L;  2KJX A;  4DR5 L;  1I5F A;  1TT2 A;  2F0I A;  1HZC A;  3IFT A;  4HJ5 A;  2C35 B;  4A3L H;  5F2D A;  3CKI B;  3CCE A;  4IJH A;  3GTQ B;  1PZI D;  2CH4 A;  2M00 A;  1EY7 A;  2CWA A;  2ZJP A;  4CGY B;  4A3L G;  5FJ8 H;  4HAE A;  1PA6 A;  1Y8P B;  3PV0 A;  1BUV T;  5DNF A;  5JVG 3;  1PH4 A;  4HJA A;  1X3E A;  1QNU A;  1EWC A;  1S5E D;  3CAM A;  4LF5 L;  1OXT A;  4X3S A;  4CHT B;  3MXN B;  5FJ8 G;  4BBS H;  2ZJR A;  1EU3 A;  3A55 A;  3K5O A;  1C4Q A;  4L63 B;  5CV6 A;  3GTK H;  4C3I B;  3HOZ B;  3TP8 A;  3SVM A;  4JI8 Q;  2HDM A;  3FKI H;  2Y0S B;  4BBS G;  5BR8 L;  2G5D A;  3H0G H;  3SK6 A;  5FLX L;  1G51 A;  1IBK L;  4LF8 Q;  2YTV A;  3GTO H;  5E1F A;  4JCV E;  1O7Z A;  3TN2 A;  4LF6 Q;  2I46 A;  3FVQ A;  4KD4 A;  4QUC A;  3FKI G;  3W1G A;  3H0G G;  3I4O A;  2H5X A;  1TWH H;  1HPC A;  1CKM A;  4DR1 Q;  2R93 G;  1VMP A;  1GHJ A;  2YU9 B;  3BDC A;  2E75 C;  2L11 A;  3ER0 A;  4HN7 A;  5ELN A;  2F0E A;  5C3E H;  1I6H H;  4PMC A;  2MPM A;  1DOL A;  1GUG A;  2UU9 Q;  1X3P A;  2F0P A;  1JMC A;  5K36 G;  2MGS A;  3TS2 A;  1B53 A;  4DV7 L;  2PNH A;  1M90 C;  5L37 A;  5IT9 c;  5C3E G;  5J1Z A;  4DF7 A;  2IT1 A;  1WD1 A;  1PH1 A;  4DR2 Q;  1LTI D;  2K5V A;  2E2I B;  1V1O A;  2K05 A;  3HKZ G;  3CC2 A;  1VQC A;  4MZ9 A;  2RHS B;  3M4Y A;  1KRT A;  3C1E A;  1B3A A;  1UE1 A;  1IXR A;  4B3S L;  3SHL A;  1EY6 A;  1WTQ A;  3ONA B;  1D7Q A;  4IPH A;  1R4P B;  2Q2H A;  4JBW A;  3W1B A;  4DR1 L;  1XPR A;  1KAA A;  4OEL B;  1ZKO A;  2F1M A;  3I72 A;  3PIO A;  1TWG H;  4GLA C;  1KHI A;  4JPB W;  4B3R Q;  4DV3 L;  3S14 B;  1G6Z A;  3DXJ C;  3GV3 A;  2E8G A;  3CCL A;  4DR6 L;  4KKU A;  2UU9 L;  2FMM A;  4G7H C;  2V1C C;  1STH A;  1LTG D;  2HIV A;  3R2I A;  2KCM A;  1E3P A;  2Z1C A;  1PH3 A;  4KHP Q;  1EY0 A;  5LL6 S;  3RZD H;  2EJM A;  1STA A;  1K0R A;  1KL9 A;  1XTC D;  4BWG B;  3IAY A;  4HJ9 A;  3GTJ H;  4RA8 A;  4OIK A;  2R92 B;  3D6W A;  1HZ9 A;  2VQF Q;  2PZT A;  2VXW A;  4UAI A;  1FL0 A;  4BY1 H;  1TII D;  1F77 A;  1Z47 A;  4X66 L;  3J81 j;  1ESF A;  3NQI A;  5IGD A;  2MFI A;  2XGT A;  1GD7 A;  4KV6 A;  3KDF B;  3JAM L;  5JAV A;  5JJZ A;  4BY1 G;  3QR8 A;  1ONL A;  1PH5 A;  2AKW B;  1BF4 A;  4GOP B;  2XRQ D;  1PMR A;  2B2T C;  4GKJ L;  4F88 A;  1DOK A;  3WOF A;  5LMU Q;  1HCZ A;  1T5X D;  2R7Z B;  4LAA A;  3VR6 A;  2JXM B;  4GS3 A;  2AUJ D;  3QOL A;  2JQO A;  3S1R B;  3D4D A;  1NJI C;  2E74 C;  3HOW B;  4KHP L;  1DGS A;  2F0D A;  4G7O C;  1HA6 A;  1Y1W B;  5H1S E;  2ID0 A;  5LMN Q;  2KVM A;  4Q0F A;  4HJ7 A;  3HKS A;  3HOX B;  1FR3 A;  3G71 A;  3QJY A;  2O4X A;  2PI2 E;  3I70 A;  3ICE A;  3AMU A;  2HHH L;  4DR4 Q;  3EVQ A;  2B8F A;  3J80 i;  1Q8I A;  2M2L A;  2HT1 A;  2QCP X;  3BZK A;  4DAV A;  1JCK B;  3D3R A;  4UHV A;  4ULL A;  3JAM i;  3GV6 A;  4EQN A;  2NVT H;  2QIL A;  2BE5 C;  3RN5 A;  1U0L A;  1B7Y B;  5FK9 C;  2AMC B;  1NUC A;  1S40 A;  3IRB A;  3CF5 A;  4OWX B;  1G91 A;  1EYG A;  2WFW A;  2K04 A;  2MP1 A;  3KF8 A;  1CHP D;  2J0T D;  1AFP A;  2V4D A;  4KHV A;  3S2D H;  4JI2 L;  1L0X B;  1O78 A;  3NBH A;  5LMN L;  4A75 A;  2UXC L;  3FKI B;  1IYJ B;  1AZP A;  1UEA B;  3H0G B;  1MJC A;  1NR2 A;  1SN8 A;  3G6E A;  2F3V A;  4B9X A;  3GTO B;  1F2M A;  1AP0 A;  1D5X C;  2Z4H A;  1RD9 D;  1MSH A;  5I6W A;  2BDO A;  3NXW A;  2EXZ A;  4EVO A;  4OX9 L;  1LT4 D;  2OWO A;  1TWH B;  4DR4 L;  2CQA A;  3UDG A;  3A5U A;  3I73 A;  2NZO A;  3H91 A;  1PTO F;  2D62 A;  5DEH A;  1ENA A;  5C3E B;  2NYZ D;  1I6H B;  1GJX A;  2A73 B;  5FLX c;  1ZXT A;  5COY A;  4A3E H;  1I4H A;  3KF6 B;  3RZO H;  4DV1 L;  4HID A;  1ET6 A;  4CDD C;  3HKZ B;  3QIA A;  3DMU A;  4IUR A;  4A4I A;  4A3E G;  1IYU A;  1PH8 A;  4CDC C;  3HOV H;  3UI2 A;  5EJW A;  2E2H B;  3TRE A;  1CFM A;  1V43 A;  1NSN S;  2CWP A;  4IOC A;  2BE5 D;  2AQ3 B;  4ME5 A;  4P72 A;  2ZJQ A;  1CSP A;  2NTS A;  1EIY B;  2H4O A;  3E0J A;  5FLM H;  2F52 A;  2IX3 A;  3HOV G;  3FPP A;  4C2M H;  1FGB D;  3OWF A;  2R7F A;  2DJF C;  2L4N A;  3E9H A;  5CV8 A;  2B63 H;  3AEV A;  4JI1 Q;  3MFY A;  1NR4 A;  1IBL L;  4DR3 Q;  1CTM A;  2XWB B;  3NWT A;  5FLM G;  1KNE A;  5EKI A;  3U58 A;  1XMO Q;  1F2L A;  2HD3 A;  1EY4 A;  4N8X 1;  1ENC A;  2B63 G;  1TWG B;  1E2W A;  5FLX E;  4QB4 A;  1WVL A;  3OIP A;  4JI3 Q;  1E1T A;  2X69 A;  3UE0 A;  4HTH A;  1HZB A;  2CW0 C;  2EPB A;  4WJ4 A;  1W6J A;  2UUA L;  3PCO B;  2WB1 E;  3W3A A;  4ZK9 B;  3TP7 A;  1E24 A;  1EEI D;  3KLS X;  2BOS A;  1T5E A;  5C4X H;  4LWC A;  3RZD B;  3FPU B;  2Z0S A;  1HR0 L;  3S1Q B;  1MJE A;  4JI0 L;  3J7A V;  1EUJ A;  3K59 A;  1STG A;  4DNI A;  2Q8R E;  5C4X G;  4KY5 A;  5CYU A;  2OCE A;  4K5V A;  1IL8 A;  1TXY A;  3CCS A;  3GTJ B;  3FRP B;  3RUZ A;  1VQI A;  3C2P A;  2MQH A;  4S3S A;  3T51 B;  4BY1 B;  3W2D A;  2F3W A;  3VA7 A;  4RWS C;  1K8G A;  3Q6S A;  1HUN A;  3VYU A;  4G57 A;  1VQD A;  4GNX C;  3TRZ A;  1J5E L;  3NSW A;  3KBG A;  5J22 A;  5IIF A;  3TZD A;  1I94 Q;  4I7Z C;  1VQ8 A;  2TMP A;  2F0J A;  2HDL A;  4RHR A;  1QIL A;  4LF9 L;  3GTL H;  2B3G A;  3T1Y Q;  1A6X A;  3OTO L;  3C1F A;  2HCI A;  1G29 1;  2A6E C;  1O7Y A;  3Q0A A;  3MEH A;  1IKM A;  3PUX A;  1TR5 A;  4G7Z C;  2OTJ A;  3CCU A;  4X6A H;  1KAB A;  1L1O B;  2N49 A;  1TKW B;  1XMQ Q;  3JAM c;  5EBD A;  4JOI A;  2CW0 D;  5M3M B;  1F9P A;  1EZ8 A;  3O13 A;  1KRS A;  2K5Q A;  2B2V C;  2LY7 A;  1K9M C;  1HQR D;  4L5T A;  2O5I C;  4DV5 L;  2Z4I A;  5E4W C;  3I4N H;  4NXN Q;  1QWY A;  3CCQ A;  2F0T A;  5JJL A;  1I94 L;  2YTY A;  2ENB A;  1IBM Q;  2CH4 W;  2JA5 B;  3I4N G;  2YV5 A;  3J7A F;  1SNP A;  2FMC A;  2Q2T A;  4UP8 A;  1XPU A;  3GTM H;  1EYA A;  1S5B D;  2B2W A;  3S2D B;  3OSO A;  3JAM E;  1EWH A;  1EEF D;  1TWC B;  2KHI A;  3SGI A;  1NE3 A;  1UE5 A;  2K6A A;  3GO5 A;  1S5D D;  1I3Q H;  1LTS D;  1SMY C;  2Z6K C;  2QEJ C;  3RD4 A;  3CMA A;  2I0Q A;  3KJP A;  3VR3 A;  5IY0 A;  1KNA A;  2A6E D;  2NZH A;  4EX5 A;  4DV0 Q;  1PRT B;  1YNX A;  4RKL A;  1X3G A;  4J1M A;  1SRU A;  4GNX B;  4NMZ A;  1HXY D;  4KD3 A;  1BBU A;  4NXN L;  1KD1 C;  2QDL A;  1ASY A;  3I2Z A;  3Q8D A;  1PH2 A;  1BXT A;  4DU9 A;  3RMH A;  1IZ6 A;  4JI6 Q;  4QMG A;  5KRU A;  2JE6 I;  1KDA A;  1EFI D;  4HED A;  4R4I A;  1F9R A;  1DM0 B;  4PZ7 A;  1F2Z A;  2UUB L;  4BBR B;  2IHF A;  1I4R A;  1H95 A;  1V1P B;  2NUC A;  2EE1 A;  3FEW X;  2E5L L; 
#chains in the Genus database with same CATH homology
 1X3E A;  4A93 H;  3CAM A;  4IOA A;  5IYD H;  4LF5 L;  1OXT A;  2ES2 A;  1JJ2 A;  4MNO A;  4LF4 L;  3RR5 A;  1BKB A;  3MXN B;  5FJ8 G;  1VQ5 A;  3J81 i;  4BBS H;  4DUZ L;  2ZJR A;  1NBW A;  3K80 C;  1N34 L;  4K0K L;  3GTK H;  2UUC Q;  1VQN A;  4GN4 B;  4XTC S;  4JI1 L;  3T1H L;  2JA8 H;  5HY6 A;  4JI8 Q;  5IYD G;  1KAW A;  1V1Q A;  4JI2 Q;  3FKI H;  4DR3 L;  3J7A 5;  3HFZ B;  4BBS G;  5BR8 L;  1IBK L;  3H0G H;  1PYS B;  2GVB A;  1G51 A;  4YCV A;  1XMO L;  2YTV A;  4LF8 Q;  1A62 A;  2VW9 A;  3GTO H;  4DAM A;  2CKZ B;  4JCV E;  2VQE L;  2JA8 G;  3CW2 C;  5C4J H;  4LF6 Q;  4K0K Q;  5M3M H;  4A3C H;  3FKI G;  4AYB E;  3W1G A;  4C3H H;  2JJQ A;  3AFQ A;  3HKZ E;  3H0G G;  3I4O A;  4JI3 L;  2H5X A;  1WI5 A;  5IWA Q;  2ZTE A;  4YWL A;  1TWH H;  4DV4 Q;  2NVQ H;  2Q2I A;  2JA7 H;  2LXK A;  4A3K H;  3A0J A;  2CQO A;  2I5H A;  2R6G A;  1CKM A;  4DR1 Q;  3MEF A;  4IO9 A;  2I5M X;  4GNX A;  1PH4 A;  5M3M G;  2R93 G;  4A3C G;  2UXD L;  4B3M L;  2WAQ E;  3CPW A;  1HR0 W;  4OO1 I;  3J80 c;  2ATW A;  3ER0 A;  3CC7 A;  1AH9 A;  2JA7 G;  5ELN A;  5C3E H;  1I6H H;  4A3K G;  3H3V H;  3S1M H;  1OXU A;  4OO1 G;  4PZ6 A;  2JA5 H;  1LYL A;  2UU9 Q;  4NXM Q;  3H3V I;  1JMC A;  4HIM A;  1S72 A;  3TS2 A;  5K36 G;  4DV1 Q;  1A0I A;  4YCU A;  2PNH A;  4DV7 L;  3D0F A;  1M90 C;  1K83 H;  5IT9 c;  5C3E G;  4B3T L;  3PF4 A;  3M3Y H;  3AYH B;  4HIO A;  1EOV A;  2IT1 A;  1PH1 A;  2UUC L;  1YIJ A;  4JI4 L;  1EWI A;  4DR2 Q;  1HZA A;  2JA5 G;  4DUY L;  2K5V A;  2AWN A;  4LNQ A;  2F4V L;  2YTX A;  4GOP A;  1PYB A;  2EXD A;  4P75 A;  3PUW A;  1U5K A;  4AYB G;  5M3F H;  4L5S A;  1K73 C;  1TWC H;  3HKZ G;  5DLQ E;  3CC2 A;  1C0A A;  1VQC A;  4MZ9 A;  2RHS B;  4YHH Q;  4DV6 L;  5JEA G;  1PH6 A;  1SR3 A;  1KRT A;  1EFW A;  2N8N A;  3F2D A;  3S16 H;  1HNW Q;  3I7F A;  1VQE A;  2CFM A;  5IWA L;  1RIP A;  4LUO A;  1UE1 A;  1IXR A;  4B3S L;  4AQY Q;  3T1Y L;  5IP7 H;  2WAQ G;  2JK8 A;  1N33 Q;  2F3I A;  4BY7 H;  4R4C A;  4A3M H;  1KXL A;  1D7Q A;  4IPH A;  1IBL Q;  2Q2H A;  1QUQ B;  4JBW A;  4RG1 A;  3AQQ A;  3W1B A;  4DR1 L;  1XPR A;  3S15 H;  1CUK A;  4JI7 Q;  1OXS C;  4JG2 A;  3EIV A;  1JT8 A;  4R4Q A;  4BXX H;  3PIO A;  1TWG H;  4GLA C;  1KHI A;  4DPG A;  4XIG S;  5IP7 G;  4POF A;  4BY7 G;  4B3R Q;  4JV5 Q;  4DV3 L;  1A63 A;  4A3M G;  1J6Q A;  2KBN A;  4P73 A;  2R7Z H;  1GO3 E;  1N32 L;  2E8G A;  3CCL A;  2JEA I;  1HJP A;  1VQ4 A;  1XMQ L;  2BA1 A;  3BU2 A;  3CD6 A;  4DR6 L;  2UU9 L;  1JJG A;  2E2J H;  4NXM L;  4UP7 A;  4BXX G;  1BBW A;  2V1C C;  2UUA Q;  1LM0 A;  2HIV A;  2VL6 A;  2VS1 A;  1XNQ L;  2Y0S E;  3TQY A;  2KCM A;  1E3P A;  2UXB Q;  4QIW E;  1PH3 A;  4KHP Q;  1CKO A;  2IY5 B;  4X65 Q;  1EIF A;  3RZD H;  3A5Z B;  4OX9 Q;  2UXC Q;  3PO2 H;  3PUV A;  4X64 Q;  3CCM A;  3K7U C;  1OTC A;  1HR0 Q;  4DR7 L;  4BBR H;  3RLF A;  2JA9 A;  4R1J A;  1HNZ Q;  2PMZ E;  1K0R A;  4JI0 Q;  4KLK A;  3DLL A;  3HOU H;  1KL9 A;  4HJ9 A;  4APV A;  1L1O C;  2QGQ A;  3GTJ H;  2Z6K A;  3CCR A;  3L7Z C;  3PO2 G;  1HZ9 A;  1B70 B;  3D31 A;  4YWK A;  2VQF Q;  3HOY H;  4BBR G;  1VQ9 A;  1IBM L;  1FL0 A;  1YHB A;  3K8A A;  4BY1 H;  1JE5 A;  4HIK A;  3HOU G;  1Z47 A;  2DUD A;  4X66 L;  3J81 j;  3G4S A;  3HOZ H;  3K7A H;  1VQJ A;  1V9P A;  4IJL A;  2RF4 A;  2MFI A;  2XGT A;  1GD7 A;  1W3S A;  4JI5 Q;  3KDF B;  5C0X J;  4JI7 L;  3KF8 B;  1X54 A;  3H15 A;  4BY1 G;  1XNR L;  1GM5 A;  2D0O A;  1J5E Q;  1PH5 A;  3HOZ G;  1K3R A;  1VQF A;  2AKW B;  3PF5 A;  1YHA A;  3NBH B;  4GOP B;  3CXC A;  1BVS A;  2Y0S G;  3OW2 A;  4GKJ L;  2PI2 A;  3M9B A;  4LF9 Q;  3LGJ A;  3W5O A;  1Q46 A;  5LMU Q;  3CCV A;  1HH2 P;  4GS3 A;  1QUQ A;  3OTO Q;  1EQQ A;  4IFD I;  4DV0 L;  2JQO A;  3B6Y A;  1NJI C;  2UXB L;  4KHP L;  2K4K A;  4A3I H;  1E1O A;  1DGS A;  4X65 L;  1CKN B;  4EQ5 A;  5J3B A;  4AH6 A;  5H1S E;  2K5H A;  2ID0 A;  5IP9 H;  5LMN Q;  1A8V A;  1VQB A;  3STB C;  4IFD G;  3J7Z C;  4HJ7 A;  4X62 L;  2EIF A;  1G6P A;  3HKS A;  3G71 A;  1PH9 A;  1GKH A;  3EBE A;  5M5X H;  2PI2 E;  3EN2 A;  2FXQ A;  4A3I G;  3ICE A;  5HGQ A;  5IYB H;  4O2D A;  1K8A C;  4A3D H;  3S17 H;  2R93 H;  1M1K C;  5IP9 G;  3E0E A;  1YEZ A;  2HHH L;  4JI6 L;  1VQL A;  1AE3 A;  3CCJ A;  2VUM H;  3NEN A;  3J81 c;  1YZ6 A;  4DR4 Q;  1GVP A;  1UE7 A;  1Y14 B;  1PHJ A;  2MO1 A;  5IYB G;  1Q1B A;  4A3D G;  4P71 A;  4HJ8 A;  1NMG A;  4FDB A;  3RN2 A;  1I50 H;  3J80 i;  5M5Y H;  4DV5 Q;  2HT1 A;  1WCM H;  3BZK A;  2IHE A;  3L2P A;  2VUM G;  4NPS A;  3M85 A;  1UWV A;  2CCZ A;  3E9I A;  3CQZ H;  3L0O A;  3JAM i;  3KJO A;  1YIT A;  5GQO A;  2NVT H;  3FHW A;  3RN5 A;  1U0L A;  4QQB X;  1B7Y B;  3G48 A;  2AWO A;  1X9N A;  4JYA Q;  1VS0 A;  1X56 A;  2AMC B;  1YJ9 A;  1WCM G;  2NVY H;  2MO0 A;  1S40 A;  3IRB A;  4JOI C;  1QVG A;  2I5L X;  3CF5 A;  1KQS A;  4TVA B;  4OWX B;  2OTL A;  3PO3 H;  4LFB Q;  3KDF A;  1EYG A;  1NY4 A;  5M5W H;  2WFW A;  4Y52 H;  2IX1 A;  2VZA A;  4JBM A;  2OQ0 A;  1WJJ A;  3S2D H;  4JI8 L;  1B8A A;  4JI2 L;  1YVC A;  4UPA A;  5LMN L;  4A75 A;  1VQM A;  1QZH A;  2UXC L;  2L15 A;  5GAH C;  4LF8 L;  1IYJ B;  3PO3 G;  4DAY B;  5C44 H;  3S14 H;  1MJC A;  1SN8 A;  3G6E A;  3I4M H;  4OON A;  4LF6 L;  2XTI A;  4DKA C;  4DK3 C;  3F1Z A;  2NN6 G;  4OX9 L;  4OWT B;  2E5L L;  2D0P A;  4IPD A;  5C44 G;  4DV4 L;  1YI2 A;  1CKN A;  4R4O A;  2OWO A;  4DR4 L;  3UDG A;  4A3G H;  1KC8 C;  3UDX A;  3A5U A;  4J15 A;  3STB D;  1HNX Q;  2NZO A;  2K75 A;  5JJK A;  4LUZ A;  1WYD A;  4DV2 Q;  2D62 A;  4L5R C;  1Z9F A;  1MKH A;  1VCI A;  1TWF H;  3AFP A;  4DR5 Q;  4A3G G;  3KYH C;  1YBY A;  1WOC A;  2N78 A;  1N36 Q;  1P8L A;  5FLX c;  4A3E H;  3KF6 B;  3RZO H;  4DV1 L;  4RMF A;  4JBK A;  4HID A;  2ALY B;  1E22 A;  3GTQ H;  2EQS A;  3PSI A;  4MTN A;  4DR2 L;  4PMW A;  1IL2 A;  4A4I A;  4A3E G;  1PVO A;  1Q12 A;  1PH8 A;  4TQU S;  3HOV H;  2UUB Q;  1JJC B;  2QEX A;  2LXJ A;  3TRE A;  1V43 A;  4GN5 A;  4ALP A;  2CWP A;  2E5L Q;  4IOC A;  2NVX H;  2RCN A;  3M4P A;  2A1A A;  4P72 A;  2ZJQ A;  1CSP A;  4YHH L;  4QGU A;  3UDI A;  1EIY B;  2GN5 A;  1VQK A;  4LF4 Q;  1Y1V H;  1X6O A;  4LF5 Q;  5FLM H;  3CP0 A;  2K5N A;  2F52 A;  4UP9 A;  2PQA A;  3HOV G;  1HNW L;  4C2M H;  5E7N A;  3F2C A;  3HOW H;  1L2F A;  2GVA A;  4C3I H;  2R7F A;  3ULJ A;  1NTG A;  3U4Z A;  4AQY L;  1N34 Q;  1C7Y A;  3E9H A;  1N33 L;  2B63 H;  3AEV A;  4JI1 Q;  1Y1W H;  2ZTD A;  3OYY A;  3T1H Q;  1QVC A;  1NMF A;  1YHQ A;  1IBL L;  1FJG Q;  4DR3 Q;  2R7Z G;  1Y1V G;  5FLM G;  5BR8 Q;  1IBK Q;  2ASB A;  3HOX H;  3U58 A;  1XMO Q;  4A76 A;  1L1O A;  3I4M G;  3HOW G;  4WJ3 M;  4DV2 L;  2B63 G;  4B3R L;  4JV5 L;  1Y1W G;  4BA2 I;  4YWM A;  2AHO B;  4L5Q A;  1N36 L;  1E1T A;  1EQR A;  3HOX G;  4JI3 Q;  3UE0 A;  4LFC Q;  1HZB A;  4WJ4 A;  2UUA L;  3PCO B;  2WB1 E;  5GAD C;  1E24 A;  3M4O H;  2YU9 H;  5C4X H;  2A8V A;  2UXD Q;  1MIU A;  4LWC A;  4B3M Q;  1XTD A;  4GN3 B;  4LFA Q;  4X64 L;  2Z0S A;  4JC0 A;  3I55 A;  1HR0 L;  1HNZ L;  1MJE A;  4C3J H;  4JI0 L;  1SLJ A;  1EUJ A;  3RLO A;  1X55 A;  4IPC A;  4DNI A;  2DGY A;  5C4X G;  3KF6 A;  4UY8 C;  3S2H H;  2N3S A;  2OCE A;  3NEM A;  1TXY A;  3CCS A;  3GDE A;  5GRO A;  2VQF L;  2ZTC A;  3KLW A;  4QL5 A;  4DV7 Q;  4B3T Q;  1SRO A;  1VQI A;  2MQH A;  1Q81 C;  1VQO A;  2KEN A;  1R9T H;  4JI4 Q;  3CME A;  5C0X I;  1VQP A;  1K8G A;  1FJG L;  4DUY Q;  4A93 G;  4JI5 L;  1VQD A;  2E2I H;  2F4V Q;  4GNX C;  3GTP H;  3TRZ A;  4GKK Q;  5AJ3 Q;  3A74 A;  3FP9 A;  5C0X G;  1J5E L;  3TS0 A;  5JEA J;  1D8L A;  3DM3 A;  2QA4 A;  1Q86 C;  5JJI A;  1I94 Q;  4DV6 Q;  1W2B A;  2WB1 G;  4LUV A;  4GLX A;  1VQ8 A;  3WWV A;  1Q7Y C;  1S3O A;  3CC4 A;  4LF9 L;  4LFC L;  1XPO A;  3GTL H;  2B3G A;  5LMU L;  4B3S Q;  3T1Y Q;  4LF7 Q;  4POG A;  5EAY A;  3OTO L;  2R7D A;  2PQA B;  1G29 1;  1RL2 A;  2KHJ A;  3GTG H;  2HQL A;  2WP8 J;  1LTL A;  2HIX A;  3S1N H;  1OXX K;  1VQG A;  3PUX A;  4A3J H;  4LFA L;  2BH2 A;  2OTJ A;  3U50 C;  3CCU A;  4X6A H;  3PIP A;  3U4V A;  4DV3 Q;  1N9W A;  2NN6 I;  1VQ6 A;  1C9O A;  1L0W A;  3NEL A;  1L1O B;  4P74 A;  2N49 A;  4GOP C;  1N32 Q;  5GAG C;  1XMQ Q;  3JAM c;  4DR6 Q;  4JOI A;  4A3J G;  1YJN A;  1FGU A;  1XNQ Q;  1TWA H;  2BA0 A;  3PUZ A;  2OQK A;  3ERS X;  2YYZ A;  2K52 A;  4IPG A;  5GAE C;  1KRS A;  3PGZ A;  3F2B A;  1SMX A;  1X3F A;  1K9M C;  1PV4 A;  4O0A A;  4DR7 Q;  4OWW B;  4DK6 C;  1WFQ A;  4L5T A;  1UE6 A;  2B29 A;  2ZM6 Q;  4DV5 L;  2E2H H;  4H02 A;  3I4N H;  4PZ8 A;  5IE8 A;  5AJ3 L;  2KCT A;  4GKK L;  4YY3 Q;  3CCQ A;  4NXN Q;  2R92 H;  3I56 A;  4R4T A;  4AIM A;  5JJL A;  2LSS A;  1I94 L;  3BJU A;  2YTY A;  1SE8 A;  3GD7 A;  3RNU A;  2K50 A;  1IBM Q;  2IX0 A;  4JYA L;  4OXP A;  3I4N G;  2YV5 A;  5M3F G;  4X66 Q;  2K14 A;  3TEH B;  1VQ7 A;  2R92 G;  4LF7 L;  4JBJ A;  4LFB L;  5IYC H;  3ULL A;  1PH7 A;  2Q2T A;  4A3B H;  1O7I A;  4UP8 A;  1CSQ A;  3ULP A;  1XPU A;  3GTM H;  1Q8K A;  3M4Q A;  3BZC A;  1XNR Q;  3KOJ A;  3ZJY C;  2VNU D;  1UEB A;  5LMN W;  1LUZ A;  2BH8 A;  1N8R C;  1Q82 C;  3K0X A;  1JB7 A;  1QVF A;  5IYC G;  1ASZ A;  1AE2 A;  4A3B G;  3RLN A;  1T9H A;  4GKJ Q;  2KHI A;  4KI0 A;  1X65 A;  3K81 C;  3SGI A;  1FVI A;  1KIX A;  1NE3 A;  1UE5 A;  3GO5 A;  1QZG A;  1I3Q H;  2Z6K C;  4DUZ Q;  4QJF A;  3S1R H;  2I0Q A;  3CMA A;  4A3F H;  4QY7 A;  5IY0 A;  3PUY A;  4EX5 A;  3KJP A;  2NZH A;  4DV0 Q;  2MNA A;  3VDY A;  3UDF A;  2JA6 H;  3M7N A;  1OXV A;  3JC6 6;  4BA1 I;  1YNX A;  4IFD J;  4NB3 A;  1X3G A;  2A19 A;  1VQA A;  4ME3 A;  1SRU A;  4GNX B;  1HNX L;  3S1Q H;  4LW1 A;  2Q2U A;  4X62 Q;  2ZM6 L;  4A3F G;  4GLV B;  4YCW A;  2JA6 G;  3F8T A;  1BBU A;  4NXN L;  4YY3 L;  2VQE Q;  4DR5 L;  1KD1 C;  1I5F A;  1ASY A;  3I2Z A;  3Q8D A;  1PH2 A;  1IZ6 A;  5ELO A;  2HHH Q;  2VY3 A;  3S24 A;  4JI6 Q;  1PFS A;  1HZC A;  4HJ5 A;  3UE1 A;  2C35 B;  2RHQ B;  4A3L H;  1E7Z A;  1XJV A;  1P16 A;  2JE6 I;  3CCE A;  4KHZ A;  4IJH A;  3KFU A;  2CWA A;  2ZJP A;  3HOY G;  4Y7N H;  4R4I A;  2JEB I;  4PG3 A;  4PZ7 A;  5FJ8 H;  2UUB L;  4A3L G;  1VQH A;  2IHF A;  3CPF A;  1PA6 A;  3PV0 A;  1H95 A;  1Q1E A;  1SFO H;  1YJW A;  4HJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...