5BR8L

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5br8L00
4DV1Q 5C44H 4DR5L 2LXJA 3NEMA 1YEZA 3A74A 3BZCA 5LMNL 1HNXQ 4DV6L 4JBWA 4JI1L 1R9TH 3PUWA 4UP8A 1UE6A 1X3GA 1IXRA 5DLQE 3CC7A 3RZDH 1PA6A 4YCVA 2AHOB 4GKKQ 4EQ5A 1L1OA 3HKZG 2KBNA 4IPDA 4OWTB 4DR3Q 3E0EA 5J3BA 1CSQA 3KDFB 3H0GH 2MNAA 3F2DA 1I94L 4A3DH 1K73C 1K8GA 5GROA 4JBMA 2UXDQ 1SFOH 3PIOA 4YWMA 4BY1G 3J80i 3J80c 4GLAC 2MFIA 4R1JA 3DM3A 2ZTCA 4DR4Q 2VUMG 1O7IA 2UUAQ 4R4QA 3ULJA 3F2BA 3FKIG 5GQOA 5EAYA 4LF9L 2R93G 2F3IA 4JYAQ 3PUVA 3OTOL 4NXMQ 1TWHH 2R92H 1Z47A 5M5XH 1KRTA 2HIVA 4HJ7A 2VQFQ 1H95A 1QUQB 2VL6A 4GN4B 3PO3H 2K5VA 3CCJA 4Y7NH 2UUBQ 3S16H 1K8AC 1UE7A 2H5XA 2XGTA 4IPCA 1C0AA 4XTCS 1X65A 3CCRA 5IP9G 1Q12A 2E8GA 2N49A 3TEHB 1XMOQ 1YJ9A 4BXXH 1WYDA 1NE3A 5AJ3Q 1XMQQ 1J5EL 4LF8L 3NBHB 4HIOA 2ID0A 5FLMH 1E1TA 1EQQA 1N34Q 1Y1VG 1KQSA 4B3TL 4LF4L 1AH9A 2UU9Q 3AFPA 2NN6I 3S24A 1XTDA 2RCNA 2I5HA 4X66L 1KD1C 4DUZL 4OWWB 4R4CA 1EWIA 1XPUA 5C0XJ 4IJLA 2JA8H 4A3BG 2I5MX 2PNHA 4DR2Q 2HHHQ 1DGSA 2VNUD 3RNUA 3S15H 1YNXA 1HZBA 3ICEA 2BA1A 3F8TA 1K3RA 3RR5A 1SRUA 4P73A 3HOXH 4LF6L 2B3GA 2HIXA 1GO3E 3CCLA 2CWPA 1TXYA 2NZHA 2IX0A 4O2DA 1OTCA 5M3FH 2ZTDA 4DR7Q 5IYBH 1SR3A 1B8AA 4NXNQ 1VQHA 4IPGA 1G6PA 1Y1WG 1PH6A 2IHEA 1UEBA 1OXSC 3I4MH 3HOUH 4DV0L 1U5KA 2Z0SA 1HR0W 2IY5B 2WP8J 3CAMA 4LF7L 2K52A 4IPHA 1NMFA 3A5ZB 3Q8DA 4JI5Q 4JI6Q 2YTXA 3W1GA 5LMUL 4BBSH 1FJGL 1A0IA 4A3JH 4JC0A 1UE1A 2YTVA 2ES2A 3HOWG 5K36G 3L2PA 4TVAB 4DUYQ 2UUCQ 4JI2L 4DV3L 4AQYQ 2NVQH 4K0KL 3PF5A 4C3HH 3HKSA 2JQOA 1N33L 1X6OA 2JA5G 3PO2H 1XPRA 1VQEA 4BA1I 3HOZH 1HR0L 4LFCQ 1PH5A 5GAHC 4A3KG 2FXQA 1NBWA 2L15A 1PH3A 1VQPA 1S40A 2JEAI 4B3RQ 4A3CH 1IZ6A 1PYSB 1WJJA 1J6QA 2NN6G 3RLFA 3M85A 2ZTEA 4GOPC 1VQ5A 4A3IH 1GVPA 4DV1L 1NY4A 1FGUA 2VW9A 2JA9A 4AH6A 1VQIA 5GADC 4A76A 1PH8A 1HNXL 4GN3B 2JA6G 3JC66 2N78A 1JT8A 5JJIA 1E24A 1Y14B 1EFWA 2K4KA 2RF4A 4GKKL 3MXNB 1UWVA 5FJ8H 1ASYA 3KF6A 4LF5Q 2CQOA 5IYDH 1IBMQ 1HNZQ 1CKNB 2MO0A 1VQKA 1N8RC 2ZJPA 4DR3L 1SMXA 3AQQA 5C3EH 2JA7H 3HOVH 1YI2A 1VQAA 1KHIA 1TWGH 1VQDA 4OWXB 4BA2I 2R6GA 2UXDL 4OO1G 1VQ4A 1PH2A 2B29A 1NMGA 2D62A 3G71A 3M3YH 4A3DG 4HIMA 1XJVA 2F52A 1XNQQ 2LSSA 1EUJA 3J81c 4DR4L 2VY3A 3I7FA 1QVFA 4O0AA 2UUAL 2K50A 4JI0Q 3ERSX 3I55A 4GS3A 2VS1A 4AIMA 1OXTA 1I5FA 4BBRH 2IHFA 3EN2A 4JYAL 4X65Q 3S1RH 1CSPA 3NENA 4NXML 2B63G 5HY6A 1Q7YC 3STBD 3GTKH 2RHSB 3M9BA 3K80C 4FDBA 4A4IA 3GTQH 2VQFL 4QQBX 1MIUA 2R92G 4DV4Q 4A3GH 2F4VQ 2EQSA 4DNIA 2UUBL 1QZGA 4XIGS 2JEBI 3HOYH 4JI4Q 4A3MH 3EBEA 2EIFA 2PQAA 4DPGA 1LM0A 5M5WH 4ALPA 4APVA 4JOIA 4LFBQ 5ELNA 4JI3Q 3S1NH 1VQ6A 3T1YQ 4QIWE 2UXCQ 1XMOL 4C2MH 5AJ3L 3CCSA 2JJQA 1XMQL 4OX9Q 2KCTA 4HJ8A 4WJ4A 2WB1E 1P8LA 1N34L 4BXXG 3I56A 1E7ZA 2UU9L 4L5TA 3BZKA 5FLMG 2IT1A 1OXVA 1Q86C 4RMFA 4DV5Q 1HZ9A 4DR2L 2GVBA 5IYCH 3ZJYC 1PHJA 2HHHL 1XNRQ 2JA8G 2Y0SE 1JJ2A 1N9WA 3S17H 4AYBE 4GLVB 2KHIA 3CD6A 1KXLA 1L1OB 1S3OA 5ELOA 2DGYA 3E9IA 4RG1A 3HOXG 4KHPQ 2KCMA 4A3FG 4DR7L 1K9MC 3CF5A 2WAQE 5M5YH 3CC4A 1OXUA 4IFDJ 3MEFA 4NXNL 1X54A 5M3FG 5IYBG 4JOIC 1NJIC 1PH4A 2ZM6Q 2GVAA 3H3VH 1D7QA 4C3JH 5IE8A 4C3IH 1HH2P 3L7ZC 3I4MG 4DR6Q 4JI5L 1Q81C 3HOUG 4JI7Q 3PSIA 4JI6L 3TS2A 1MKHA 5JEAG 4DV2Q 1A62A 2Z6KA 4HIDA 1HZAA 2E2IH 1S72A 4GN5A 4DUYL 2UUCL 2WB1G 2Q2TA 4BBSG 4AQYL 4YCUA 2XTIA 1BVSA 1VCIA 1QVCA 1VQCA 3KJPA 2A19A 1MJEA 4JI8Q 2QA4A 3CCUA 4LFCL 1N36Q 2Y0SG 3RLNA 3PO2G 1LUZA 3UE0A 5C4XG 4R4OA 4LUZA 3PIPA 4GOPA 1VQNA 3HOZG 1VQGA 4B3RL 1VQLA 4IJHA 3SGIA 1X55A 2QEXA 4A93G 2CFMA 4A3CG 4A3LG 5M3MG 3WWVA 4X64Q 3RN5A 2K5HA 1M1KC 3GTPH 5JJLA 1JJGA 3FP9A 4A3IG 4X6AH 3TREA 3CMEA 3GO5A 2AWNA 2K14A 3ULLA 4YHHQ 3A5UA 1D8LA 3GTLH 3EIVA 5C0XI 1X3FA 1HNWQ 1I6HH 1CKOA 4KLKA 4WJ3M 2Z6KC 1PH1A 4LF5L 4PZ6A 2YTYA 1IBML 3CW2C 1HNZL 4LFAQ 5FJ8G 1W3SA 1Q8KA 1K0RA 1Z9FA 3NELA 5IYDG 2UXBQ 2AWOA 4GNXA 2D0OA 1N32Q 3K7AH 3K7UC 2JK8A 4POFA 2E5LQ 1BBUA 5C3EG 2JA7G 3HOVG 3M7NA 3PV0A 1VQJA 1VQ9A 2HT1A 2OTLA 4JV5Q 1V9PA 2K75A 1A8VA 1XNQL 3CPWA 3RN2A 3ULPA 4P72A 2VQEQ 4JI0L 1JE5A 2HQLA 3FHWA 1CKNA 4NPSA 3T1HQ 5C44G 1GKHA 3W5OA 2DUDA 4BY7H 3UE1A 4X65L 1VS0A 1SN8A 4YY3Q 5HGQA 2BA0A 2IX1A 3CC2A 4IO9A 1VQFA 3PUYA 4UP7A 4BBRG 1VQ8A 3H3VI 1MJCA 4DV4L 4NB3A 3F1ZA 2F4VL 1IBKQ 2JE6I 3HFZB 2Q2UA 2D0PA 2R7ZH 4GKJQ 3S1QH 4JI4L 1EYGA 4UP9A 2CCZA 3HKZE 3HOYG 3H0GG 4LFBL 4A3MG 3CCMA 2ASBA 4DKAC 4GNXC 4JI3L 3VDYA 2CKZB 3D31A 3KOJA 3T1YL 1M90C 3GTOH 2UXCL 1E1OA 1AE2A 1YHBA 2EXDA 1LTLA 1B70B 2Q2IA 3TQYA 1YJNA 4JCVE 4B3SQ 1LYLA 4B3MQ 4OX9L 1I50H 2OCEA 3KDFA 3UDXA 5LMNW 5IWAQ 3TS0A 4YCWA 4PZ8A 1A63A 4DV5L 1YZ6A 5BR8Q 1XNRL 1PVOA 1IBLQ 5IP7H 5IYCG 3G48A 1RL2A 2BH2A 2LXKA 3PO3G 3GDEA 2MQHA 1VQ7A 3KF6B 2AKWB 1Q1EA 1KC8C 3ER0A 3KFUA 4KHPL 1WCMH 4KI0A 3W1BA 3U50C 4YWLA 3CCVA 1G291 2GN5A 2NZOA 2JA6H 3I4NH 1EOVA 3GTGH 3CXCA 3PCOB 3PUXA 1QUQA 4GLXA 1PV4A 2VZAA 2ZM6L 4A3EH 1TWCH 2KHJA 1IL2A 4MNOA 4QL5A 1TWFH 5IY0A 1PH7A 5IT9c 2E2JH 4P75A 1EIYB 3LGJA 4UPAA 4DK3C 1JMCA 3S14H 4JI7L 4DR6L 4Y52H 4H02A 4DV2L 3S2HH 1EIFA 1AE3A 1EQRA 3KYHC 4UY8C 4DV7Q 4X62Q 1K83H 1YHAA 2KENA 1JB7A 2ZJQA 5IP9H 1NTGA 4DR1Q 1CUKA 2ALYB 4MZ9A 1E22A 4JBKA 1P16A 2CWAA 2N8NA 4JG2A 2E2HH 4JI8L 5GAEC 4DR5Q 2MO1A 1WFQA 2Q2HA 5LMNQ 1N36L 3PGZA 4LUOA 2YYZA 3GTJH 4DV6Q 2NVXH 4JI1Q 2B63H 4QY7A 2PQAB 1GD7A 1Q46A 4EX5A 2WFWA 5GAGC 1WI5A 2A8VA 1XPOA 1WOCA 1JJCB 2PI2A 3UDIA 3DLLA 3JAMc 3JAMi 3IRBA 4OONA 4X64L 2R7FA 4DK6C 4PG3A 1L1OC 1BBWA 1OXXK 1YBYA 1I94Q 4BY1H 4YHHL 3K81C 2ATWA 4A3JG 1RIPA 2I0QA 1HNWL 3BU2A 1L0WA 2VUMH 2OWOA 3KF8B 3J81j 1SE8A 2OQKA 3BJUA 1X3EA 3FKIH 3OYYA 4KHZA 4LFAL 2R93H 4YWKA 2I5LX 2UXBL 1N32L 4LW1A 3G4SA 4AYBG 4IOCA 4LF9Q 2E5LL 1FVIA 1Q1BA 4TQUS 3OTOQ 2PMZE 2K5NA 3GD7A 4JV5L 1FL0A 4IFDI 3F2CA 1SLJA 3M4QA 3PUZA 1YVCA 1C9OA 2VQEL 1YITA 4PZ7A 3AFQA 4DAYB 2WAQG 5C4JH 2ZJRA 3OW2A 2PI2E 3T1HL 3CMAA 1C7YA 1U0LA 3U4VA 3UDFA 4QGUA 4A3FH 3AEVA 3L0OA 4YY3L 2NVYH 1YJWA 3S2DH 2YU9H 1Q82C 4BY7G 1I3QH 1PFSA 1T9HA 1X56A 3J81i 3U58A 1Y1VH 1IBKL 4L5QA 2YV5A 1KIXA 1J5EQ 4GKJL 3CQZH 4LF8Q 3H15A 4OO1I 1V1QA 4A3BH 3A0JA 4B3TQ 4LF4Q 1ASZA 3CCQA 2R7DA 2R7ZG 1KRSA 4X66Q 3U4ZA 3I4OA 3K0XA 4DUZQ 1QZHA 4QJFA 1VQOA 3TRZA 2NVTH 1HJPA 1UE5A 1L2FA 4GOPB 1HZCA 4B3SL 3M4PA 4L5RC 4B3ML 2BH8A 1VQBA 4PMWA 4LF6Q 3CCEA 1E3PA 3KJOA 1PYBA 1TWAH 3AYHB 5IWAL 1W2BA 1GM5A 1G51A 1VQMA 3CP0A 5C4XH 5BR8L 1Y1WH 5H1SE 1IBLL 5JJKA 1BKBA 4P74A 1CKMA 3B6YA 4A93H 3RZOH 5E7NA 5IP7G 4POGA 2V1CC 4A3GG 5M3MH 3M4OH 4A3LH 1X9NA 4J15A 2AMCB 4DV0Q 3E9HA 3STBC 4LNQA 1YHQA 4LF7Q 2A1AA 2OQ0A 4A75A 3D0FA 1QVGA 2QGQA 3HOWH 3J7A5 3CPFA 4HIKA 4IFDG 4GNXB 5LMUQ 4IOAA 1FJGQ 1WCMG 2C35B 3I4NG 5JEAJ 4HJAA 4LUVA 1V43A 3PF4A 4JI2Q 1KL9A 3S1MH 4DV3Q 2JA5H 2OTJA 1IYJB 4ME3A 4P71A 3J7ZC 3UDGA 3GTMH 4K0KQ 5C0XG 1N33Q 1KAWA 4A3EG 1YIJA 4MTNA 4L5SA 4A3KH 1HR0Q 4LWCA 3I2ZA 1PH9A 4R4TA 4DV7L 4X62L 1SROA 4R4IA 3RLOA 4DR1L 4HJ9A 3G6EA 2N3SA 2RHQB 4HJ5A 4OXPA 3K8AA 4DAMA 4JBJA 5FLXc 3KLWA 1B7YB
chains in the Genus database with same CATH superfamily
4DV1Q 2L0CA 3NEMA 1YEZA 5G3LF 4RHSA 2G9DA 1X3GA 5KEEA 1Z6HA 3CC7A 1PA6A 3JAME 4GKKQ 4FXDA 1L1OA 3SEBA 3HKZG 2BDOA 1R4PB 1K0SA 2KBNA 4HCSA 4IPDA 4C3JG 4DR3Q 3W3AA 1SYFA 2KEEA 4CHTB 2MUYA 4DAVA 2UXDQ 1H9JA 3PIOA 2KQ3A 4DR4Q 1PTOH 3L9AX 1QG7A 3FKIG 5GQOA 4JYAQ 3PUVA 1JOQA 1EY9A 2EY2A 5M5XH 4RKLA 1HCZA 2HIVA 1H95A 1BCPC 4BY7B 1AN8A 1QUQB 2DJGC 3AB9A 2K6AA 5CV7A 4G57A 4FNFA 1SE2A 4QCLA 4XTCS 2IW3A 3VA7A 1SYDA 2N49A 3CRKC 2HUGA 1X3PA 1WYDA 1NE3A 4IQZA 1CFMA 2EYLA 3NBHB 2ID0A 2PZTA 5JPMC 4B3TL 2ZXRA 2NN6I 3S24A 3SXHA 2I5HA 2JA8H 4DUZL 3PIO3 1HQRD 3F8TA 1PDQA 1K3RA 5EGTA 3RR5A 3G6JB 4RH6A 4LF6L 2HIXA 2DY7A 1GO3E 3CCLA 4FF2A 1STAA 4O2DA 2R61A 2A5HA 2B2TA 3BVZA 2A68D 4J8QA 4DFAA 1G6PA 1WCMB 2IHEA 4QUFA 1UEBA 3HOUH 2WP8J 4LF7L 1GUGA 5JAVA 4IPHA 2F0WA 4JI5Q 4KKSA 4XXEA 2YTXA 2GA4B 4LMQD 1MHWC 4KTAA 4DNTB 4AQYQ 1X6OA 2JA5G 1XPRA 4KK7A 3HOZH 2M2LA 5AFWA 5GAHC 2EYJA 4A3KG 1NBWA 1PH3A 1PTOB 4KKUA 3OHXC 5FLXE 3J81E 2EPBA 1WJJA 1J6QA 2NN6G 1VQ5A 1GVPA 2M00A 4DV1L 2JA9A 4AH6A 1VQIA 3SVMA 1PH8A 1EFWA 1M4VA 2RF4A 4GKKL 3MXNB 5FJ8H 1ESRA 1PZID 4OEMB 1N8RC 2ZJPA 4DR3L 5C3EH 3HGBA 1YI2A 1VQAA 1TWGH 4RA8A 2UXDL 2WACA 1VQ4A 2NZ1D 1NMGA 2D62A 4A3DG 4RGOS 4Q5VA 1XNQQ 1Q8IA 4DR4L 1HUMA 4E6IA 4GS3A 5EKLA 3GP7A 2IHFA 4JYAL 1CSPA 3NENA 2B63G 5C4JB 3STBD 2RHSB 3AU7A 2XWBB 1MIUA 2R92G 4A3GH 2NVYB 4DNIA 3NTKA 5I9PA 3NE5B 1QZGA 2JXMB 2SOBA 3DEPA 4RGMA 4DK1A 3S1NH 4KN4C 3HOUB 2KCTA 5IGDA 4HAEA 1B1ZA 4FF3A 5F2DA 1F2YA 2XRSD 1PHJA 3DM1A 1XNRQ 3ZJYC 3Q22A 4FF1A 3S17H 3X3MA 1ENCA 1GUSA 2LY7A 1ET9A 2SEBD 1KXLA 1L1OB 3E9IA 4A3FG 2EJFC 3CF5A 2WAQE 5M5YH 3RZOB 3NPPA 3R2TA 5M3MB 1NJIC 4KMUC 1CQVA 1RTNA 1SJED 3HOWB 2FHTA 4KJNA 5IE8A 2HDLA 2KUMA 4B9XA 4C3IH 1B3AA 1EL0A 4JI5L 4ZUJA 4DV2Q 1C4QA 1HZAA 3JAML 4BBSG 3QOJA 4AQYL 4B9WA 3CCUA 2Y0SG 1D5MC 3UE0A 3PIPA 4ABNA 1VQGA 3MEHA 4XT3B 2PYKA 2CFMA 3T51B 2CVRA 4A3LG 3WWVA 3RN5A 3RZDB 3GTPH 4X6AH 4U673 3NUCA 1WTPA 4YHHQ 4Q0FA 4FVMA 1I6HH 1GJXA 4PZ6A 1Z9FA 1SFOB 2UXBQ 2AWOA 1XWEA 3P75A 5CGKA 3KUPA 2OTLA 2EY1A 1XNQL 3RN2A 3UI2A 1WTOA 1PYWD 3TSSA 2B2VC 1CKNA 4HEDA 1O80A 5HGQA 2BA0A 3PIP3 1UUPA 3QG1A 1VQFA 4BBRG 4OGQC 1MJCA 1H9SA 5BN3A 4FF4A 1CHQD 2A69C 3BG3A 1EYGA 2CCZA 5EKKA 5EQ0A 3SDZA 1QE6A 2K28A 3CCMA 4DKAC 3GTOH 2CKZB 1ILQA 1AE2A 1YHBA 4X3KA 1BNZA 3LWEA 1HUNA 1GHJA 3CRLC 2JSOA 1EQTA 3S15B 3EVQA 1SJHD 4YCWA 5BR8Q 1XNRL 1IBLQ 2J0TD 2XRQD 5IP7H 3I3CA 1VQ7A 4XT1B 3BYTB 4IUPA 4IFDH 3KFUA 2A73B 4K6LA 4UAIA 1G2TA 2PW5A 3TDQA 3I4MB 3CXCA 5FK9C 2E2DC 2I46A 4GLXA 1PV4A 5FLXL 2VZAA 1TWCH 3DXJC 3F2UA 1EIGA 2WB1B 1C8CA 3IFTA 4DV2L 1EIFA 1AE3A 1EQRA 4TRDA 2F3WA 4X62Q 1K83H 1YHAA 2PQEA 4ME5A 5IP9H 1CUKA 4HSPA 1EEID 1NR2A 1P16A 2N8NA 1G91A 5GAEC 1SDFA 4DR5Q 1WFQA 2G9HD 3A8IE 2D9UA 1KNAA 4JI1Q 4QY7A 4EX5A 2D5DA 4A3IB 4X3UA 2HDMA 1KDBA 1JJCB 2QCPX 1MSHA 4PG3A 4JW0A 1OXXK 4YHHL 3K81C 2F0LA 3K0YA 4L6TB 1L0WA 2BDNA 5E1FA 2O5IC 1BR9A 3A55A 3J81j 3FKIH 1SAPA 2UXBL 3G4SA 5JPNC 4AYBG 4LF9Q 3GTOB 4KHVA 4TQUS 2PMZE 3OMGA 2K5DA 1FL0A 3M4QA 3PUZA 2XNAC 1YVCA 1YITA 3S1RB 1LT5D 1IKMA 3OMCA 1C7YA 1D2BA 3SK4A 4CJ2C 4A3MB 1T9HA 1PFBA 1JC7A 5M5WB 4L5QA 2YV5A 1KIXA 1ESFA 2ZXOA 2F0EA 4OO1I 1SYBA 2R7DA 4C2MB 2R7ZG 1KRSA 4X66Q 1JR0D 3I4OA 3K0XA 2SDFA 2F0JA 4CDDC 1VQOA 4IUVA 1TWCB 2NVTH 4IUTA 3VA5A 3GV3A 1I4HA 1TWAH 2F0SA 1EU3A 3OPOA 5D3DA 1G51A 2A74C 1PXUA 4K2KA 5C4XH 5BR8L 1WTVA 5H1SE 1IBLL 4P74A 1AZQA 1PTOC 3P20A 1O78A 4A3GG 1DONA 3M4OH 2NTSA 3M7GA 1QVGA 3LX0A 2WINB 3HKZB 2MHVA 5CORA 4IOAA 3S9WA 3PQIA 4C3JB 1W6KA 4LUVA 1V43A 4V0BA 3BDCA 3S1MH 5J22A 4DV3Q 2JA5H 1IYUA 2OTJA 3J7ZC 2B2UC 4K5VA 1N33Q 4A3EG 4ZKBB 4MTNA 5C4ZA 1YIJA 4A3KH 1HR0Q 1SSOA 2F0VA 3HRZC 4X62L 2OF1A 3VYRA 2NN6H 2F1MA 2N3SA 2RHQB 2HD3A 1EEFD 1H9SB 3EQLC 2KCNA 3KLWA 2EVBA 3LNNA 5FKAC 5C44H 4DR5L 2LXJA 3A74A 1HNXQ 4JBWA 4JI1L 4UP8A 2L9HA 2CH4A 2KCCA 4YCVA 3SK6A 4F87A 2EZVA 4OWTB 3E0EA 1AW7A 1TIID 3F2DA 3H0GH 4A3DH 1K73C 1K8GA 2A6ED 4YWMA 3J80i 3J80c 1PZKD 3C3LA 1CZGA 4R1JA 2ZTCA 1FNUA 4R4QA 3F2BA 1WD1A 5C3WA 1Y8PB 4LF9L 4MN3A 5EAYA 3BS1A 3EROA 1JORA 4ULLA 1HPCA 1CZWA 2R92H 1KRTA 1ILPA 4KD3A 1A3TA 2K5VA 4Y7NH 3S16H 1A3VA 3QIAA 1LTID 1X65A 1XXGA 1CI3M 1Q12A 2IJ0A 3KLSX 3TEHB 2RDHA 3T13A 3M4OB 2L5TA 1PLFA 5IGEA 4DNRB 2QDLA 4NMZA 1EQQA 4HMIA 1N34Q 1Y1VG 1AH9A 2UU9Q 1XTDA 4X66L 1KD1C 4R4CA 4EQOA 5C0XJ 1GUNA 4DR2Q 3NHHA 3S1MB 2CHBD 2VNUD 2JYOA 2RSOA 3RNUA 3N52A 4GZYC 5C4HA 4WJWA 2BA1A 1YNNC 4JK1C 4XQNA 2NZHA 3DWPA 4K8JA 1H9MA 1SYEA 1U4RA 2CW0D 3A8JE 4ZRZA 1VQHA 4NXNQ 3NSWA 2RQXA 3I4NB 3QJYA 3KLSA 1OXSC 1SBBB 1U5KA 2Z0SA 3CAMA 1EWCA 2F0MA 2K52A 3E3XA 4JI6Q 4BBSH 1VMPA 1A0IA 1TWFB 2YTVA 4WFN3 3HEJA 5IGCA 3S14B 1EYDA 4DV3L 1PRTB 3PF5A 4KN7C 3HKSA 1LT3D 1N33L 4A3DB 4K5XA 3ITPA 1HR0L 2F0IA 4PMCA 1SYGA 3DUZA 1KTKA 3H91A 1S40A 2B2TC 2E2HB 1GUWA 3TP7A 2B63B 1FGUA 5GADC 1HNXL 4GN3B 4F7XA 4HR7B 4N8X1 4NP5A 5JJIA 5JVG3 1Y14B 4DXGA 2Z1CA 3GQBA 1Q3LA 1ASYA 2CQOA 3MFYA 1IW7D 1IBMQ 1VQKA 2ICIA 4KY7A 4BA2I 3J80E 1Q90A 3NP8A 2B29A 3G71A 3M3YH 4HIMA 2LSSA 1EUJA 5ELBA 3J81c 3I7FA 2EYMA 2X6LA 3I55A 3V2TA 1OXTA 4BBRH 1HQMC 1IHZA 3M9BA 3GTQH 1SMYC 1CHPD 1HFGA 4A3FB 3QWNA 1SNCA 1LTAD 4XIGS 1I3QB 4RCOA 4JI4Q 1STNA 2PQAA 4PV1C 1D5ZC 4LFBQ 1WVLA 2FFKB 1VQ6A 3T1YQ 2UXCQ 4A3BB 5D65A 1MSGA 3CCSA 2Z9HA 2WB1E 1B9MA 1N34L 3WDNA 4BXXG 4IUNA 4ID6A 2UU9L 3BZKA 5T1IA 4H13C 4R8NA 5FLMG 1OXVA 1Q86C 4RMFA 4DR2L 2GVBA 1N9WA 3KF8A 3IFDA 2KJXA 3U9OA 1YNJC 4RG1A 3HOXG 2KCMA 3OSOA 5DM63 3CC4A 2AQ3B 2Z4HA 4NXNL 1X54A 5M3FG 3D4RA 3BVGA 1PH4A 2ZM6Q 3ND9A 3D6CA 1EY8A 1LTSD 2DN8A 1ICFB 1HH2P 3L7ZC 2PO4A 4ODGA 3TS2A 4JI6L 2PMZB 1MKHA 2RA4A 2K32A 2RDFA 5JEAG 1WTWA 2Z6KA 4XQQA 1AZPA 1S72A 2KOLA 2BE5C 5D3IB 1VQCA 3R8BA 2NUCA 3KJPA 1F9SA 1TS4A 2DNCA 4JI8Q 4C3HG 1NSNS 3QR8A 1N36Q 3PO2G 4ZK9B 5C4XG 4WRDA 1X55A 3WOEA 1JB3A 2K5HA 4ILWA 3GTQB 3GO5A 3A5UA 3EIVA 1DZ1A 3D4WA 4KLKA 4IZ8A 1PH1A 4K5WA 1TR5A 1IBML 4G7OC 5IYDG 1Q8KA 1TS5A 5BN4A 4GNXA 3K7AH 2JK8A 2J7ZA 1F9RA 2JA7G 3HOVG 3M7NA 2K7VA 2TMPA 1A8VA 2IPKD 2F03A 1B50A 4S3SA 4EVOA 2VQEQ 1O7ZA 1JE5A 2PW7A 4LK1C 2PZWA 1K8MA 5C44G 3T1HQ 5M5XB 2EE1A 1PFMA 2DUDA 3WOFA 1WTQA 3NWSA 3FPUB 5EJWA 3VYUA 2IX1A 3CC2A 4KJOA 3VYTA 1B9NA 3H3VI 2K04A 1IBKQ 2Q8TA 1WD0A 2R7ZH 3S1QH 4JI4L 4G7HC 3HKZE 3HOYG 3H0GG 4LFBL 4MIUA 3T1YL 2UXCL 1D1KA 1E1OA 2F0HA 1D6EC 2EXDA 3T16A 1B70B 4B3SQ 2JA8B 4B3MQ 1I50H 2OCEA 1HA5A 4PZ8A 1A63A 3D4DA 1PVOA 4LAAA 1S5CD 5CBEE 1DYQA 3G48A 4ZKCB 2LXKA 1LT4D 2MQHA 1CTMA 1SNQA 3MWYW 1KC8C 1AEXA 3ER0A 3W1BA 3U50C 3CCVA 1G291 2JA6H 3K5OA 1TVXA 1EOVA 3GTGH 3PCOB 2BOSA 1CM9A 3SR1A 2LFNA 2ZM6L 3OW7A 3T4AC 1K3BC 2KHJA 4IUQA 3IL8A 4MNOA 4QL5A 2E74C 4A3EH 3CU7A 3QOLA 4RKBA 1LTRD 4P75A 1EIYB 4CJ1B 5T1GA 4H02A 4OO1H 4UY8C 2EY6A 2ZJQA 3NWTA 3HOZB 3DWQA 2ALYB 4F8MA 2L55A 4JBKA 5CV9A 1SMYD 1SE4A 4JI8L 2B2WA 1N36L 4LUOA 4OELB 3J80L 5I9OA 3GTJH 2NVXH 1PFNA 2PQAB 1GD7A 3I90A 2EXZA 3DWAA 3VYSA 1I4QA 2PI2A 2K03A 2R7FA 3VR2A 1G2SA 1HTPA 1B4OA 1I94Q 2I0QA 4I7ZC 2K5QA 5C3EB 2R7ZB 1E2ZA 1TWGB 2WV6D 3KF8B 1BCPD 1X3EA 2B8GA 3OYYA 4KHZA 1K28A 5DM73 4YWKA 3NQTA 3MZ5A 1BCPF 4LW1A 4IOCA 1ZEQX 1FVIA 3OTOQ 2K5NA 3GD7A 4HMJA 1S5BD 3BDOA 4C1NK 3F2CA 1SLJA 1EWHA 5D14A 2VQEL 2ZJRA 1RD9D 4RCNA 5ELDA 3T1HL 3A8KE 1U0LA 1SNOA 1VF5C 4NW2A 3UDFA 2EYFA 3AEVA 3L0OA 1YJWA 3S2DH 4A3GB 2YU9H 1BDOA 4BY7G 3NK9A 1A2UA 2ENBA 1JE4A 1GOZA 1Y1VH 5J1ZA 1IBKL 3K6OA 3CQZH 3S1NB 4LF4Q 4CJ0B 3CCQA 5KGUA 1KNEA 1TKWB 1MGSA 1BF4A 5ELFA 4QJFA 1QCBD 1D1IA 3X3NA 3HZXA 1UE5A 1HZCA 2L1BA 1EQVA 4B3SL 4B3ML 3D6WA 1PRTC 2SNSA 2BH8A 3AYHB 5BN5A 3S17B 1GHKA 1CKMA 1ZYRC 3NTHA 1CQFA 4A93H 5E7NA 5M5YB 1HFNA 1X9NA 4J15A 4DV0Q 1STGA 3J7A5 3CPFA 4HIKA 4GNXB 1QJOA 4HSVA 5LMUQ 1WCMG 2C35B 4C3IB 2B8FA 2AQ1B 1CK1A 5J39A 3UDGA 3SE0A 4K0KQ 5CMDA 4QF4A 5C5MA 4L5SA 5DAUA 4R4TA 5FOBB 4HJ9A 3G6EA 1DM0B 4OXPA 4JBJA 5I2YA 1UEAB 3ERQA 2KEDA 4MTKA 3PUWA 1UE6A 3J81L 1IXRA 5DNFA 5FO9B 2O4XA 3GTPB 1KAAA 4EQ5A 4HTHA 5I4DA 3FPPA 2YU9B 1I6HB 1CSQA 3Q0AA 1I94L 2RVLA 5GROA 4JBMA 3A54A 2XVSA 3CHBD 4GLAC 2MFIA 3DM3A 1SNPA 5EBDA 2MJ8A 5KNDA 2JP1A 2R93G 2F3IA 4RGNA 4CKCA 3TP6A 3OTOL 1TWHH 1BQQT 4JVZA 3I8ZA 3FRPB 4HJ7A 2VQFQ 3D8GA 2VL6A 5KYIA 3PO3H 2UUBQ 1KDAA 1UE7A 2H5XA 2XGTA 1E0BA 4UHVA 3CCRA 2E8GA 2V4DA 3FVQA 1YJ9A 4BXXH 1HRJA 1QB5D 1ICWA 1OO9B 5FLMH 1E1TA 4RAUC 1KQSA 4LF4L 1DOLA 3AFPA 5JOBA 5JJZA 1NR4A 4OWWB 4IJLA 2I5MX 3C1FA 1PZJD 3E0JA 2RBMA 3HOXH 2IWHA 2B3GA 2QEJC 1FR3A 5M3FH 1SR3A 1B8AA 2WKCA 4IPGA 5EKIA 1Y1WG 1EZ8A 3W2DA 4DV0L 5JEAH 3V05A 5CC4A 3A5ZB 3URYA 3W1GA 2A6HC 5LMUL 5A35A 4A3JH 4JC0A 1UE1A 2ES2A 3HOWG 5K36G 3L2PA 4TVAB 4DUYQ 2UUCQ 1GUOA 1V1PA 3I70A 2NVQH 4K0KL 4C3HH 2JQOA 4XYOA 4DU9A 1HXYD 1K83B 3PO2H 2IL8A 3OWEB 5E3FA 1ONLA 2FXQA 2JEAI 1VQPA 1G6ZA 2RDGA 3PMFA 3RLFA 3M85A 2MPMA 1S5ED 2ZTEA 4QUCA 4K6DA 1JCKB 1W6JA 2XSCA 2JA6G 2N78A 1JT8A 1E24A 1AFPA 2PPBC 5IYDH 5C6AA 1CKNB 2HQEA 4J6HA 1SMXA 1VDZA 2JA7H 3HOVH 1U4PA 1KHIA 1VQDA 1FYCA 4OWXB 2I07B 2K01A 1JQYD 3FKIB 4OO1G 2XN9C 1PH2A 1T5EA 1EY4A 2F52A 1XJVA 3R3OA 2VY3A 4O0AA 4DGZA 3IAYA 1ZYRD 2A69D 4AIMA 1I5FA 1H9KA 5E4WC 1V8QA 3A7AB 3IKJA 2G5DA 4X65Q 2F0PA 1I4XA 3GTKH 1FNVA 2VQFL 4QQBX 1ENAA 2HCIA 3BYYB 4OHJA 2UUBL 2JEBI 3HOYH 2EY5A 2EIFA 4FP5D 4DPGA 4ALPA 4APVA 5I6WA 4JOIA 1AP0A 5ELNA 1IL8A 2JJQA 2EDGA 4ZAIA 4OX9Q 3T56B 4WJ4A 1E2WA 1E7ZA 4KY6A 2NVTB 4L5TA 1B44D 2B2YC 1F77A 2IT1A 3K5LA 4DV5Q 3G7LA 3VR3A 1TWAB 4C3HB 4IUUA 1JJ2A 4AYBE 1LLRD 3PO2B 5C4XB 1QOHA 3OOCA 5ELOA 2DGYA 4KHPQ 1XTCD 1K9MC 1KABA 4IFDJ 3MEFA 5EPLA 3I72A 5IYBG 2QW7A 2GVAA 3H3VH 1D7QA 1JOKA 3I4MG 4DR6Q 3TP8A 4JI7Q 3PSIA 2JA5B 4FXGC 2A68C 1ET6A 3FEWX 1A62A 4HIDA 2E2IH 4DUYL 2UUCL 2WB1G 2Q2TA 4A3KB 1VF7A 2NYZD 1BVSA 1QVCA 1RF2D 5KYLA 1MJEA 5ELEA 2QA4A 3VR5A 3RLNA 4R4OA 5C44B 1VQLA 2QEXA 4A93G 4A3CG 2DJFC 2VB2X 1M1KC 1JJGA 3FP9A 4U68A 4A3IG 3ULLA 5C0XI 1X3FA 1HNWQ 1B2TA 3C2PA 1CKOA 2Q8RE 2Z6KC 2F0GA 3H0GB 2DNEA 2YTYA 3CW2C 2OT2A 1V1OA 3TZUA 1K0RA 3NELA 1N32Q 5CBAE 4POFA 2NBFA 2L12A 3R2IA 1VQJA 2DY8A 1VQ9A 2HT1A 1V9PA 2K75A 3ULPA 2LMCB 4F88A 2HQLA 5KNBA 2R92B 4Z9CB 4NPSA 1KLUD 3W5OA 4BY7H 3U9SA 4X65L 1VS0A 4YY3Q 4Y7NB 1VQ8A 3S16B 4NB3A 2A6HD 3F1ZA 2Q2UA 5LL6X 4GKJQ 4ZYSA 1CA6A 5JVH3 2FMMA 5K5PA 4A3MG 2ASBA 4GNXC 5IOCA 1M90C 1FGBD 3TQYA 2B2YA 4K8IA 4OX9L 4JCVE 4RFBA 1LYLA 1PTOD 4OIKA 2Z6BA 4CDEC 2FJ2A 1PTOF 3KDFA 5E4XA 5IWAQ 3TS0A 2EYPA 2E2IB 4DV5L 2FINB 1YZ6A 4OIJA 5CV4A 2E76C 3NBIA 2X6GA 5IYCG 3PO3G 3GDEA 1TS2A 3MAQA 4M1UB 4KHPL 5G3LD 1WCMH 4KI0A 3MTSA 2C5CA 3PUXA 4QIWB 4N9PA 1EZ6A 2OXPA 1TQOA 1PH7A 4BBSB 5I2XA 5IT9c 1LTTD 4DR6L 4UPAA 1JMCA 4FO2A 4JI7L 4DN4M 4Y52H 3S2HH 2KENA 1LTBD 1JB7A 2Y0SB 5LHY1 4R9WA 4MZ9A 1E22A 2WIIB 5EBCA 1U4MA 2MO1A 5LMNQ 3PGZA 4DV6Q 2L11A 2RCFA 1Q46A 3J7YW 3KLRA 4FXKC 3DHQA 2A8VA 1WI5A 2PCFB 4G4KA 3UDIA 3IRBA 4OONA 1F2MA 3O13A 4O42A 1KDCA 5HGTA 2ATWA 4A3JG 1HNWL 3BU2A 1BUVT 1EU4A 1G8ZD 1BXTA 1EYAA 4HCEA 2B39A 1RDPD 2R93H 4B08A 3M3YB 1N32L 1SEBD 4V190 2B2WC 1Q1BA 3E5SA 4CKBA 5ELCA 1SYCA 1I4RA 2EYHA 1ZXTA 4BBRB 1C9OA 1RJTA 2WAQG 5C4JH 3CKIB 3OW2A 2PI2E 3TMEA 3U4VA 5NUCA 4YY3L 2NVYH 4C56C 1PFSA 1JWMD 3J81i 1IYVA 1J5EQ 4GKJL 3MA2B 4LF8Q 3H15A 1YNND 3A0JA 3U4ZA 2CQAA 1XYIA 3K59A 2LKVA 5KNCA 3GV6A 1EFID 1L2FA 1U4LA 1A15A 2O2LD 3E6ZX 1HHVA 1EOTA 1VQBA 1F9PA 2F0UA 3CCEA 3S2HB 1E3PA 3KJOA 1PYBA 5IWAL 4QMGA 2M9VA 1VQMA 1UAPA 1Y1WH 1BOSA 2R3ZA 5JJKA 3B6YA 1STHA 2C9OA 3Q6SA 3RZOH 3RD4A 2V1CC 5M3MH 1JWUD 1UNSA 2AMCB 3BVMA 3H09A 1YHQA 4A75A 2F0TA 1LO5D 3HOWH 3OWFA 5K36H 1I6VC 1FJGQ 3I4NG 5IT9E 4JI2Q 3A7LA 1L0XB 3GTMH 5CV8A 3DMUA 1KAWA 1SXTA 2J4XA 3OIPA 2F0FA 4LWCA 1ML0D 1B3QA 4DK0A 1KLGD 1SROA 4NDXA 2EOTA 1Y8OB 3ND8A 3RLOA 2SNMA 1QWYA 4HJ5A 2R93B 4N8FA 3K8AA 3FMCA 1SE3A 3K57A 5LMNL 3BZCA 1BBXC 1LV9A 4DV6L 1R9TH 4CGYB 3KK7A 5DLQE 3RZDH 2L4NA 2AHOB 4RWSC 2QDBA 3RMHA 5J3BA 3KDFB 2MNAA 4JPBW 2N55A 4NKLA 4AYBB 1SFOH 4BY1G 1Y69U 2F0QA 5M9OA 3K7AB 2QKIC 5ISRA 2VUMG 1O7IA 2UUAQ 3ULJA 2K1BA 2ZXPA 3C1EA 3K58A 4NXMQ 1SNMA 4KKTA 1NNXA 1Z47A 4LJZC 4WORA 4GN4B 3CCJA 3Q23A 1K8AC 1Y1WB 1J9OA 3NXWA 1RKNA 4IPCA 5LL6S 1C0AA 2O5JC 5IP9G 3S1QB 1XMOQ 1GXDC 4ZUIA 5AJ3Q 1XMQQ 3C46A 1J5EL 4LF8L 3QB3A 4HIOA 4PQXA 1O7YA 2RCNA 1YNJD 1S4ZA 2JN4A 4DXFA 1EWIA 1XPUA 4A3BG 1IKLA 2PNHA 1I50B 5IIFA 2HHHQ 1DGSA 3GTMB 3S15H 1YNXA 1HZBA 3ICEA 3N6RA 1JOOA 1SRUA 4P73A 1O7LA 5COYA 1PMRA 2CWPA 1TXYA 2IX0A 1OTCA 2ZTDA 4DR7Q 5IYBH 1CT1D 1LTGD 3MVVA 5KIXA 3QO2A 2CH4W 3H6MA 4DF7A 1PH6A 2JA6B 1RODA 3I4MH 1BO0A 2BE5D 2IY5B 3GTGB 4IN3A 1R9TB 1HR0W 2KA7A 2P5ZX 1NMFA 1JICA 3Q8DA 2K33A 1T5XD 4A3EB 1EY7A 1QILA 2PNRC 1FJGL 4CDFC 2TSSA 1DCZA 4JI2L 2Z4IA 4K14A 1TS3A 1RHPA 4FYDA 1VQEA 4BA1I 4LFCQ 1PH5A 3J7AV 1A2TA 3VR4A 2L15A 4B3RQ 4A3CH 1IZ6A 3EJIA 2Z8LA 1PYSB 3OIQA 3GTJB 2NVXB 4GOPC 4A3IH 4R8IA 1NY4A 2VW9A 4A76A 4O1NA 5IODA 3JC66 4BS9A 2K4KA 2EYOA 1JWSD 2K5WA 2D2CC 3LWUA 1UWVA 1B53A 1S5DD 1EYCA 3KF6A 4LF5Q 2NWGA 1HNZQ 2MO0A 2RSNA 3AQQA 2F0NA 1LACA 2R6GA 3HP3A 3H3VC 1F9QA 1QVFA 2XIWA 2UUAL 2K50A 4JI0Q 3ERSX 2VS1A 5TSSA 3MXPA 2A6EC 2KHSA 3EN2A 1MI2A 3S1RH 2AUKA 4NXML 5HY6A 3MFGA 1Q7YC 1TT2A 3K80C 4FDBA 4A4IA 2XWJB 3M4YA 4DV4Q 4C1NI 2F4VQ 2EQSA 5A2QE 3S2DB 4H7BA 1J8IA 4A3MH 3EBEA 3J7AF 5M5WH 1LM0A 4BWGB 1Y1VB 3CQZB 2RKSA 4JI3Q 4QIWE 4XDXA 1XMOL 4C2MH 2MGSA 5AJ3L 1XMQL 2OEOA 4HJ8A 5C0XH 1Y8NB 4XQJA 1P8LA 1CA5A 3I56A 3SHLA 3R93A 1WTXA 3NQIA 3A56A 1S5FD 1HZ9A 2NTTA 5IYCH 1XX8A 2HHHL 2JA8G 5EPJA 2Y0SE 5IT9L 1BCPB 2WKDA 4GLVB 2KHIA 2H1EA 3CD6A 3AMUA 1S3OA 1ENFA 3HG9A 5C3XA 4DR7L 4A93B 3I73A 3MXUA 1OXUA 4JOIC 4DAYA 4UDUC 1LT6D 1QNUA 1NCVA 3TZDA 4C3JH 4ZQ3A 3P7JA 1EY0A 1Q81C 3HOUG 5DEHA 2CW0C 1E2VA 4GN5A 4MHEA 4YCUA 2XTIA 2F0DA 1VCIA 5I6YA 2A19A 3DEOA 1I4GA 2X69A 4QB4A 5FO7B 1GUTA 4LFCL 1QNKA 3SK5A 3TBIB 1LUZA 4LUZA 1VQNA 4GOPA 3HOZG 4B3RL 2B2VA 4IJHA 3SGIA 1HTLD 3EA6A 5M3MG 4X64Q 1WTRA 5JJLA 1X32A 3TREA 1TY2A 3ZYYX 2AWNA 2K14A 3CMEA 3GTLH 5CV6A 1D8LA 2E75C 4PMBA 4EGVA 4WJ3M 3HS0C 1TY0A 4LF5L 1FD7D 1HNZL 4LFAQ 1DOKA 1TU2B 1W3SA 5FJ8G 3K5MA 3NTIA 2D0OA 3K7UC 2QILA 4DA2A 2E5LQ 2N88A 1BBUA 5C3EG 4X3TA 3PV0A 3SK8A 1STEA 4JV5Q 1IW7C 1STBA 3CPWA 4P72A 4JI0L 3FHWA 3VR6A 1TWHB 1GKHA 3UE1A 1SN8A 3PO3B 4RGTA 4IO9A 1MBYA 3PUYA 4UP7A 2MP1A 3ONAB 2EJMA 4H44C 3KBGA 4DV4L 2F4VL 2JE6I 3HFZB 2D0PA 4L8JA 3I91A 1F2ZA 1PRTD 1Z7TA 4CDCC 3H94A 4UP9A 1PRTF 4JI3L 3VDYA 3D31A 3KOJA 5CYUA 4X3SA 4KD4A 2Q2IA 1LTLA 1YJNA 3P1HA 2K05A 4IURA 3UDXA 5LMNW 3FDTA 4I65A 4N9TA 4M8AA 3HOXB 1C48A 5FO8B 4ZCKA 3BDLA 1RL2A 5M3FB 2BH2A 3KF6B 2AKWB 2FMCA 1Q1EA 3I4NH 2F3VA 4YWLA 2NZOA 2GN5A 5EPKA 4TSSA 1QUQA 1NUCA 1IL2A 5IY0A 1TWFH 2HCCA 4A3JB 5C5LA 2E2JH 3LGJA 4DK3C 3K5NA 3GTLB 3MHBA 3S14H 2PZUA 3T53B 4C3IG 3KYHC 2NVQB 5L37A 2EJGC 2IX3A 4DV7Q 2ZT9C 5IGFA 4ZLTF 1NTGA 4DR1Q 3NBHA 1A3UA 4CBVA 4G7ZC 2CWAA 4JG2A 2E2HH 2Q2HA 4HN7A 2YYZA 2VXWA 3L3OC 1LABA 4PNYA 2B63H 1F2LA 2WAQB 4CKEA 5CV5A 2WFWA 1SNDA 1HA6A 5GAGC 1L0YB 1XPOA 1WOCA 3I4LA 4OL7A 3DLLA 3JAMc 3JAMi 2AQ2B 4X64L 1A6XA 4DK6C 1L1OC 4I7AA 1BBWA 2LS01 3MC0B 1YBYA 4BY1H 3BZDB 1RIPA 1FNWA 2QF7A 2VUMH 1EIHA 2JA7B 3HOVB 3TP5A 5A2QL 2OWOA 4XYQA 1SE8A 2OQKA 3BJUA 4LFAL 1DXMA 1K8OA 2I5LX 5HURA 2E5LL 2Q8IB 1EY5A 4JV5L 4J1MA 4IFDI 2NB0A 2AUJD 4PZ7A 3AFQA 4DAYB 3D3RA 3GTKB 4K2LA 4EQNA 2KVMA 3CMAA 1MD2D 4QGUA 4IALA 4A3FH 4YIJA 1Q82C 1DJRD 1I3QH 3HOYB 1X56A 2VB3X 1DOMA 2F4IA 3U58A 1VMCA 1II3A 1H9RA 1V1QA 4A3BH 1R4QB 4B3TQ 1ASZA 1ZKOA 3Q24A 1STYA 4DUZQ 3V96A 1QZHA 3TRZA 3MXNA 1HJPA 4GOPB 2B2UA 3M4PA 4L5RC 2E2JB 1X3QA 4KY5A 4PMWA 4LF6Q 4TKOB 5IGGA 1GM5A 1I4PA 1W2BA 5CR3A 3CP0A 1U9RA 1BKBA 1NAPA 1V1PB 2H4OA 1EY6A 2BCOA 1M8AA 5IP7G 4POGA 2ICEC 4A3LH 3KBXA 2KECA 3E9HA 3STBC 4RHRA 4KV6A 4LNQA 4LF7Q 5KRUA 2A1AA 2OQ0A 3D0FA 3EFXD 1WTHA 2QGQA 4IFDG 2F0KA 5IGBA 4L63B 5JEAJ 3RUZA 4HJAA 3TN2A 3PF4A 1RTOA 1KL9A 1IYJB 4ME3A 4P2CB 4P71A 5C0XG 4BY1B 3I2ZA 1PH9A 4H0LC 1D5XC 2VUMB 4DV7L 2F0OA 4R4IA 1RCVD 4EQPA 4DR1L 1DD2A 3MXGA 4DAPA 4DAMA 5FLXc 1B7YB
chains in the Genus database with same CATH topology
4DV1Q 5C44H 4DR5L 2LXJA 3NEMA 1YEZA 3A74A 3BZCA 5LMNL 1HNXQ 4DV6L 4JBWA 4JI1L 1R9TH 3PUWA 4UP8A 1UE6A 1X3GA 1IXRA 5DLQE 3CC7A 3RZDH 1PA6A 4YCVA 2AHOB 4GKKQ 4EQ5A 1L1OA 3HKZG 2KBNA 4IPDA 4OWTB 4DR3Q 3E0EA 5J3BA 1CSQA 3KDFB 3H0GH 2MNAA 3F2DA 1I94L 4A3DH 1K73C 1K8GA 5GROA 4JBMA 2UXDQ 1SFOH 3PIOA 4YWMA 4BY1G 3J80i 3J80c 4GLAC 2MFIA 4R1JA 3DM3A 2ZTCA 4DR4Q 2VUMG 1O7IA 2UUAQ 4R4QA 3ULJA 3F2BA 3FKIG 5GQOA 5EAYA 4LF9L 2R93G 2F3IA 4JYAQ 3PUVA 3OTOL 4NXMQ 1TWHH 2R92H 1Z47A 5M5XH 1KRTA 2HIVA 4HJ7A 2VQFQ 1H95A 1QUQB 2VL6A 4GN4B 3PO3H 2K5VA 3CCJA 4Y7NH 2UUBQ 3S16H 1K8AC 1UE7A 2H5XA 2XGTA 4IPCA 1C0AA 4XTCS 1X65A 3CCRA 5IP9G 1Q12A 2E8GA 2N49A 3TEHB 1XMOQ 1YJ9A 4BXXH 1WYDA 1NE3A 5AJ3Q 1XMQQ 1J5EL 4LF8L 3NBHB 4HIOA 2ID0A 5FLMH 1E1TA 1EQQA 1N34Q 1Y1VG 1KQSA 4B3TL 4LF4L 1AH9A 2UU9Q 3AFPA 2NN6I 3S24A 1XTDA 2RCNA 2I5HA 4X66L 1KD1C 4DUZL 4OWWB 4R4CA 1EWIA 1XPUA 5C0XJ 4IJLA 2JA8H 4A3BG 2I5MX 2PNHA 4DR2Q 2HHHQ 1DGSA 2VNUD 3RNUA 3S15H 1YNXA 1HZBA 3ICEA 2BA1A 3F8TA 1K3RA 3RR5A 1SRUA 4P73A 3HOXH 4LF6L 2B3GA 2HIXA 1GO3E 3CCLA 2CWPA 1TXYA 2NZHA 2IX0A 4O2DA 1OTCA 5M3FH 2ZTDA 4DR7Q 5IYBH 1SR3A 1B8AA 4NXNQ 1VQHA 4IPGA 1G6PA 1Y1WG 1PH6A 2IHEA 1UEBA 1OXSC 3I4MH 3HOUH 4DV0L 1U5KA 2Z0SA 1HR0W 2IY5B 2WP8J 3CAMA 4LF7L 2K52A 4IPHA 1NMFA 3A5ZB 3Q8DA 4JI5Q 4JI6Q 2YTXA 3W1GA 5LMUL 4BBSH 1FJGL 1A0IA 4A3JH 4JC0A 1UE1A 2YTVA 2ES2A 3HOWG 5K36G 3L2PA 4TVAB 4DUYQ 2UUCQ 4JI2L 4DV3L 4AQYQ 2NVQH 4K0KL 3PF5A 4C3HH 3HKSA 2JQOA 1N33L 1X6OA 2JA5G 3PO2H 1XPRA 1VQEA 4BA1I 3HOZH 1HR0L 4LFCQ 1PH5A 5GAHC 4A3KG 2FXQA 1NBWA 2L15A 1PH3A 1VQPA 1S40A 2JEAI 4B3RQ 4A3CH 1IZ6A 1PYSB 1WJJA 1J6QA 2NN6G 3RLFA 3M85A 2ZTEA 4GOPC 1VQ5A 4A3IH 1GVPA 4DV1L 1NY4A 1FGUA 2VW9A 2JA9A 4AH6A 1VQIA 5GADC 4A76A 1PH8A 1HNXL 4GN3B 2JA6G 3JC66 2N78A 1JT8A 5JJIA 1E24A 1Y14B 1EFWA 2K4KA 2RF4A 4GKKL 3MXNB 1UWVA 5FJ8H 1ASYA 3KF6A 4LF5Q 2CQOA 5IYDH 1IBMQ 1HNZQ 1CKNB 2MO0A 1VQKA 1N8RC 2ZJPA 4DR3L 1SMXA 3AQQA 5C3EH 2JA7H 3HOVH 1YI2A 1VQAA 1KHIA 1TWGH 1VQDA 4OWXB 4BA2I 2R6GA 2UXDL 4OO1G 1VQ4A 1PH2A 2B29A 1NMGA 2D62A 3G71A 3M3YH 4A3DG 4HIMA 1XJVA 2F52A 1XNQQ 2LSSA 1EUJA 3J81c 4DR4L 2VY3A 3I7FA 1QVFA 4O0AA 2UUAL 2K50A 4JI0Q 3ERSX 3I55A 4GS3A 2VS1A 4AIMA 1OXTA 1I5FA 4BBRH 2IHFA 3EN2A 4JYAL 4X65Q 3S1RH 1CSPA 3NENA 4NXML 2B63G 5HY6A 1Q7YC 3STBD 3GTKH 2RHSB 3M9BA 3K80C 4FDBA 4A4IA 3GTQH 2VQFL 4QQBX 1MIUA 2R92G 4DV4Q 4A3GH 2F4VQ 2EQSA 4DNIA 2UUBL 1QZGA 4XIGS 2JEBI 3HOYH 4JI4Q 4A3MH 3EBEA 2EIFA 2PQAA 4DPGA 1LM0A 5M5WH 4ALPA 4APVA 4JOIA 4LFBQ 5ELNA 4JI3Q 3S1NH 1VQ6A 3T1YQ 4QIWE 2UXCQ 1XMOL 4C2MH 5AJ3L 3CCSA 2JJQA 1XMQL 4OX9Q 2KCTA 4HJ8A 4WJ4A 2WB1E 1P8LA 1N34L 4BXXG 3I56A 1E7ZA 2UU9L 4L5TA 3BZKA 5FLMG 2IT1A 1OXVA 1Q86C 4RMFA 4DV5Q 1HZ9A 4DR2L 2GVBA 5IYCH 3ZJYC 1PHJA 2HHHL 1XNRQ 2JA8G 2Y0SE 1JJ2A 1N9WA 3S17H 4AYBE 4GLVB 2KHIA 3CD6A 1KXLA 1L1OB 1S3OA 5ELOA 2DGYA 3E9IA 4RG1A 3HOXG 4KHPQ 2KCMA 4A3FG 4DR7L 1K9MC 3CF5A 2WAQE 5M5YH 3CC4A 1OXUA 4IFDJ 3MEFA 4NXNL 1X54A 5M3FG 5IYBG 4JOIC 1NJIC 1PH4A 2ZM6Q 2GVAA 3H3VH 1D7QA 4C3JH 5IE8A 4C3IH 1HH2P 3L7ZC 3I4MG 4DR6Q 4JI5L 1Q81C 3HOUG 4JI7Q 3PSIA 4JI6L 3TS2A 1MKHA 5JEAG 4DV2Q 1A62A 2Z6KA 4HIDA 1HZAA 2E2IH 1S72A 4GN5A 4DUYL 2UUCL 2WB1G 2Q2TA 4BBSG 4AQYL 4YCUA 2XTIA 1BVSA 1VCIA 1QVCA 1VQCA 3KJPA 2A19A 1MJEA 4JI8Q 2QA4A 3CCUA 4LFCL 1N36Q 2Y0SG 3RLNA 3PO2G 1LUZA 3UE0A 5C4XG 4R4OA 4LUZA 3PIPA 4GOPA 1VQNA 3HOZG 1VQGA 4B3RL 1VQLA 4IJHA 3SGIA 1X55A 2QEXA 4A93G 2CFMA 4A3CG 4A3LG 5M3MG 3WWVA 4X64Q 3RN5A 2K5HA 1M1KC 3GTPH 5JJLA 1JJGA 3FP9A 4A3IG 4X6AH 3TREA 3CMEA 3GO5A 2AWNA 2K14A 3ULLA 4YHHQ 3A5UA 1D8LA 3GTLH 3EIVA 5C0XI 1X3FA 1HNWQ 1I6HH 1CKOA 4KLKA 4WJ3M 2Z6KC 1PH1A 4LF5L 4PZ6A 2YTYA 1IBML 3CW2C 1HNZL 4LFAQ 5FJ8G 1W3SA 1Q8KA 1K0RA 1Z9FA 3NELA 5IYDG 2UXBQ 2AWOA 4GNXA 2D0OA 1N32Q 3K7AH 3K7UC 2JK8A 4POFA 2E5LQ 1BBUA 5C3EG 2JA7G 3HOVG 3M7NA 3PV0A 1VQJA 1VQ9A 2HT1A 2OTLA 4JV5Q 1V9PA 2K75A 1A8VA 1XNQL 3CPWA 3RN2A 3ULPA 4P72A 2VQEQ 4JI0L 1JE5A 2HQLA 3FHWA 1CKNA 4NPSA 3T1HQ 5C44G 1GKHA 3W5OA 2DUDA 4BY7H 3UE1A 4X65L 1VS0A 1SN8A 4YY3Q 5HGQA 2BA0A 2IX1A 3CC2A 4IO9A 1VQFA 3PUYA 4UP7A 4BBRG 1VQ8A 3H3VI 1MJCA 4DV4L 4NB3A 3F1ZA 2F4VL 1IBKQ 2JE6I 3HFZB 2Q2UA 2D0PA 2R7ZH 4GKJQ 3S1QH 4JI4L 1EYGA 4UP9A 2CCZA 3HKZE 3HOYG 3H0GG 4LFBL 4A3MG 3CCMA 2ASBA 4DKAC 4GNXC 4JI3L 3VDYA 2CKZB 3D31A 3KOJA 3T1YL 1M90C 3GTOH 2UXCL 1E1OA 1AE2A 1YHBA 2EXDA 1LTLA 1B70B 2Q2IA 3TQYA 1YJNA 4JCVE 4B3SQ 1LYLA 4B3MQ 4OX9L 1I50H 2OCEA 3KDFA 3UDXA 5LMNW 5IWAQ 3TS0A 4YCWA 4PZ8A 1A63A 4DV5L 1YZ6A 5BR8Q 1XNRL 1PVOA 1IBLQ 5IP7H 5IYCG 3G48A 1RL2A 2BH2A 2LXKA 3PO3G 3GDEA 2MQHA 1VQ7A 3KF6B 2AKWB 1Q1EA 1KC8C 3ER0A 3KFUA 4KHPL 1WCMH 4KI0A 3W1BA 3U50C 4YWLA 3CCVA 1G291 2GN5A 2NZOA 2JA6H 3I4NH 1EOVA 3GTGH 3CXCA 3PCOB 3PUXA 1QUQA 4GLXA 1PV4A 2VZAA 2ZM6L 4A3EH 1TWCH 2KHJA 1IL2A 4MNOA 4QL5A 1TWFH 5IY0A 1PH7A 5IT9c 2E2JH 4P75A 1EIYB 3LGJA 4UPAA 4DK3C 1JMCA 3S14H 4JI7L 4DR6L 4Y52H 4H02A 4DV2L 3S2HH 1EIFA 1AE3A 1EQRA 3KYHC 4UY8C 4DV7Q 4X62Q 1K83H 1YHAA 2KENA 1JB7A 2ZJQA 5IP9H 1NTGA 4DR1Q 1CUKA 2ALYB 4MZ9A 1E22A 4JBKA 1P16A 2CWAA 2N8NA 4JG2A 2E2HH 4JI8L 5GAEC 4DR5Q 2MO1A 1WFQA 2Q2HA 5LMNQ 1N36L 3PGZA 4LUOA 2YYZA 3GTJH 4DV6Q 2NVXH 4JI1Q 2B63H 4QY7A 2PQAB 1GD7A 1Q46A 4EX5A 2WFWA 5GAGC 1WI5A 2A8VA 1XPOA 1WOCA 1JJCB 2PI2A 3UDIA 3DLLA 3JAMc 3JAMi 3IRBA 4OONA 4X64L 2R7FA 4DK6C 4PG3A 1L1OC 1BBWA 1OXXK 1YBYA 1I94Q 4BY1H 4YHHL 3K81C 2ATWA 4A3JG 1RIPA 2I0QA 1HNWL 3BU2A 1L0WA 2VUMH 2OWOA 3KF8B 3J81j 1SE8A 2OQKA 3BJUA 1X3EA 3FKIH 3OYYA 4KHZA 4LFAL 2R93H 4YWKA 2I5LX 2UXBL 1N32L 4LW1A 3G4SA 4AYBG 4IOCA 4LF9Q 2E5LL 1FVIA 1Q1BA 4TQUS 3OTOQ 2PMZE 2K5NA 3GD7A 4JV5L 1FL0A 4IFDI 3F2CA 1SLJA 3M4QA 3PUZA 1YVCA 1C9OA 2VQEL 1YITA 4PZ7A 3AFQA 4DAYB 2WAQG 5C4JH 2ZJRA 3OW2A 2PI2E 3T1HL 3CMAA 1C7YA 1U0LA 3U4VA 3UDFA 4QGUA 4A3FH 3AEVA 3L0OA 4YY3L 2NVYH 1YJWA 3S2DH 2YU9H 1Q82C 4BY7G 1I3QH 1PFSA 1T9HA 1X56A 3J81i 3U58A 1Y1VH 1IBKL 4L5QA 2YV5A 1KIXA 1J5EQ 4GKJL 3CQZH 4LF8Q 3H15A 4OO1I 1V1QA 4A3BH 3A0JA 4B3TQ 4LF4Q 1ASZA 3CCQA 2R7DA 2R7ZG 1KRSA 4X66Q 3U4ZA 3I4OA 3K0XA 4DUZQ 1QZHA 4QJFA 1VQOA 3TRZA 2NVTH 1HJPA 1UE5A 1L2FA 4GOPB 1HZCA 4B3SL 3M4PA 4L5RC 4B3ML 2BH8A 1VQBA 4PMWA 4LF6Q 3CCEA 1E3PA 3KJOA 1PYBA 1TWAH 3AYHB 5IWAL 1W2BA 1GM5A 1G51A 1VQMA 3CP0A 5C4XH 5BR8L 1Y1WH 5H1SE 1IBLL 5JJKA 1BKBA 4P74A 1CKMA 3B6YA 4A93H 3RZOH 5E7NA 5IP7G 4POGA 2V1CC 4A3GG 5M3MH 3M4OH 4A3LH 1X9NA 4J15A 2AMCB 4DV0Q 3E9HA 3STBC 4LNQA 1YHQA 4LF7Q 2A1AA 2OQ0A 4A75A 3D0FA 1QVGA 2QGQA 3HOWH 3J7A5 3CPFA 4HIKA 4IFDG 4GNXB 5LMUQ 4IOAA 1FJGQ 1WCMG 2C35B 3I4NG 5JEAJ 4HJAA 4LUVA 1V43A 3PF4A 4JI2Q 1KL9A 3S1MH 4DV3Q 2JA5H 2OTJA 1IYJB 4ME3A 4P71A 3J7ZC 3UDGA 3GTMH 4K0KQ 5C0XG 1N33Q 1KAWA 4A3EG 1YIJA 4MTNA 4L5SA 4A3KH 1HR0Q 4LWCA 3I2ZA 1PH9A 4R4TA 4DV7L 4X62L 1SROA 4R4IA 3RLOA 4DR1L 4HJ9A 3G6EA 2N3SA 2RHQB 4HJ5A 4OXPA 3K8AA 4DAMA 4JBJA 5FLXc 3KLWA 1B7YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 Q;  5C44 H;  4DR5 L;  2LXJ A;  3NEM A;  1YEZ A;  3A74 A;  3BZC A;  5LMN L;  1HNX Q;  4DV6 L;  4JBW A;  4JI1 L;  1R9T H;  3PUW A;  4UP8 A;  1UE6 A;  1X3G A;  1IXR A;  5DLQ E;  3CC7 A;  3RZD H;  1PA6 A;  4YCV A;  2AHO B;  4GKK Q;  4EQ5 A;  1L1O A;  3HKZ G;  2KBN A;  4IPD A;  4OWT B;  4DR3 Q;  3E0E A;  5J3B A;  1CSQ A;  3KDF B;  3H0G H;  2MNA A;  3F2D A;  1I94 L;  4A3D H;  1K73 C;  1K8G A;  5GRO A;  4JBM A;  2UXD Q;  1SFO H;  3PIO A;  4YWM A;  4BY1 G;  3J80 i;  3J80 c;  4GLA C;  2MFI A;  4R1J A;  3DM3 A;  2ZTC A;  4DR4 Q;  2VUM G;  1O7I A;  2UUA Q;  4R4Q A;  3ULJ A;  3F2B A;  3FKI G;  5GQO A;  5EAY A;  4LF9 L;  2R93 G;  2F3I A;  4JYA Q;  3PUV A;  3OTO L;  4NXM Q;  1TWH H;  2R92 H;  1Z47 A;  5M5X H;  1KRT A;  2HIV A;  4HJ7 A;  2VQF Q;  1H95 A;  1QUQ B;  2VL6 A;  4GN4 B;  3PO3 H;  2K5V A;  3CCJ A;  4Y7N H;  2UUB Q;  3S16 H;  1K8A C;  1UE7 A;  2H5X A;  2XGT A;  4IPC A;  1C0A A;  4XTC S;  1X65 A;  3CCR A;  5IP9 G;  1Q12 A;  2E8G A;  2N49 A;  3TEH B;  1XMO Q;  1YJ9 A;  4BXX H;  1WYD A;  1NE3 A;  5AJ3 Q;  1XMQ Q;  1J5E L;  4LF8 L;  3NBH B;  4HIO A;  2ID0 A;  5FLM H;  1E1T A;  1EQQ A;  1N34 Q;  1Y1V G;  1KQS A;  4B3T L;  4LF4 L;  1AH9 A;  2UU9 Q;  3AFP A;  2NN6 I;  3S24 A;  1XTD A;  2RCN A;  2I5H A;  4X66 L;  1KD1 C;  4DUZ L;  4OWW B;  4R4C A;  1EWI A;  1XPU A;  5C0X J;  4IJL A;  2JA8 H;  4A3B G;  2I5M X;  2PNH A;  4DR2 Q;  2HHH Q;  1DGS A;  2VNU D;  3RNU A;  3S15 H;  1YNX A;  1HZB A;  3ICE A;  2BA1 A;  3F8T A;  1K3R A;  3RR5 A;  1SRU A;  4P73 A;  3HOX H;  4LF6 L;  2B3G A;  2HIX A;  1GO3 E;  3CCL A;  2CWP A;  1TXY A;  2NZH A;  2IX0 A;  4O2D A;  1OTC A;  5M3F H;  2ZTD A;  4DR7 Q;  5IYB H;  1SR3 A;  1B8A A;  4NXN Q;  1VQH A;  4IPG A;  1G6P A;  1Y1W G;  1PH6 A;  2IHE A;  1UEB A;  1OXS C;  3I4M H;  3HOU H;  4DV0 L;  1U5K A;  2Z0S A;  1HR0 W;  2IY5 B;  2WP8 J;  3CAM A;  4LF7 L;  2K52 A;  4IPH A;  1NMF A;  3A5Z B;  3Q8D A;  4JI5 Q;  4JI6 Q;  2YTX A;  3W1G A;  5LMU L;  4BBS H;  1FJG L;  1A0I A;  4A3J H;  4JC0 A;  1UE1 A;  2YTV A;  2ES2 A;  3HOW G;  5K36 G;  3L2P A;  4TVA B;  4DUY Q;  2UUC Q;  4JI2 L;  4DV3 L;  4AQY Q;  2NVQ H;  4K0K L;  3PF5 A;  4C3H H;  3HKS A;  2JQO A;  1N33 L;  1X6O A;  2JA5 G;  3PO2 H;  1XPR A;  1VQE A;  4BA1 I;  3HOZ H;  1HR0 L;  4LFC Q;  1PH5 A;  5GAH C;  4A3K G;  2FXQ A;  1NBW A;  2L15 A;  1PH3 A;  1VQP A;  1S40 A;  2JEA I;  4B3R Q;  4A3C H;  1IZ6 A;  1PYS B;  1WJJ A;  1J6Q A;  2NN6 G;  3RLF A;  3M85 A;  2ZTE A;  4GOP C;  1VQ5 A;  4A3I H;  1GVP A;  4DV1 L;  1NY4 A;  1FGU A;  2VW9 A;  2JA9 A;  4AH6 A;  1VQI A;  5GAD C;  4A76 A;  1PH8 A;  1HNX L;  4GN3 B;  2JA6 G;  3JC6 6;  2N78 A;  1JT8 A;  5JJI A;  1E24 A;  1Y14 B;  1EFW A;  2K4K A;  2RF4 A;  4GKK L;  3MXN B;  1UWV A;  5FJ8 H;  1ASY A;  3KF6 A;  4LF5 Q;  2CQO A;  5IYD H;  1IBM Q;  1HNZ Q;  1CKN B;  2MO0 A;  1VQK A;  1N8R C;  2ZJP A;  4DR3 L;  1SMX A;  3AQQ A;  5C3E H;  2JA7 H;  3HOV H;  1YI2 A;  1VQA A;  1KHI A;  1TWG H;  1VQD A;  4OWX B;  4BA2 I;  2R6G A;  2UXD L;  4OO1 G;  1VQ4 A;  1PH2 A;  2B29 A;  1NMG A;  2D62 A;  3G71 A;  3M3Y H;  4A3D G;  4HIM A;  1XJV A;  2F52 A;  1XNQ Q;  2LSS A;  1EUJ A;  3J81 c;  4DR4 L;  2VY3 A;  3I7F A;  1QVF A;  4O0A A;  2UUA L;  2K50 A;  4JI0 Q;  3ERS X;  3I55 A;  4GS3 A;  2VS1 A;  4AIM A;  1OXT A;  1I5F A;  4BBR H;  2IHF A;  3EN2 A;  4JYA L;  4X65 Q;  3S1R H;  1CSP A;  3NEN A;  4NXM L;  2B63 G;  5HY6 A;  1Q7Y C;  3STB D;  3GTK H;  2RHS B;  3M9B A;  3K80 C;  4FDB A;  4A4I A;  3GTQ H;  2VQF L;  4QQB X;  1MIU A;  2R92 G;  4DV4 Q;  4A3G H;  2F4V Q;  2EQS A;  4DNI A;  2UUB L;  1QZG A;  4XIG S;  2JEB I;  3HOY H;  4JI4 Q;  4A3M H;  3EBE A;  2EIF A;  2PQA A;  4DPG A;  1LM0 A;  5M5W H;  4ALP A;  4APV A;  4JOI A;  4LFB Q;  5ELN A;  4JI3 Q;  3S1N H;  1VQ6 A;  3T1Y Q;  4QIW E;  2UXC Q;  1XMO L;  4C2M H;  5AJ3 L;  3CCS A;  2JJQ A;  1XMQ L;  4OX9 Q;  2KCT A;  4HJ8 A;  4WJ4 A;  2WB1 E;  1P8L A;  1N34 L;  4BXX G;  3I56 A;  1E7Z A;  2UU9 L;  4L5T A;  3BZK A;  5FLM G;  2IT1 A;  1OXV A;  1Q86 C;  4RMF A;  4DV5 Q;  1HZ9 A;  4DR2 L;  2GVB A;  5IYC H;  3ZJY C;  1PHJ A;  2HHH L;  1XNR Q;  2JA8 G;  2Y0S E;  1JJ2 A;  1N9W A;  3S17 H;  4AYB E;  4GLV B;  2KHI A;  3CD6 A;  1KXL A;  1L1O B;  1S3O A;  5ELO A;  2DGY A;  3E9I A;  4RG1 A;  3HOX G;  4KHP Q;  2KCM A;  4A3F G;  4DR7 L;  1K9M C;  3CF5 A;  2WAQ E;  5M5Y H;  3CC4 A;  1OXU A;  4IFD J;  3MEF A;  4NXN L;  1X54 A;  5M3F G;  5IYB G;  4JOI C;  1NJI C;  1PH4 A;  2ZM6 Q;  2GVA A;  3H3V H;  1D7Q A;  4C3J H;  5IE8 A;  4C3I H;  1HH2 P;  3L7Z C;  3I4M G;  4DR6 Q;  4JI5 L;  1Q81 C;  3HOU G;  4JI7 Q;  3PSI A;  4JI6 L;  3TS2 A;  1MKH A;  5JEA G;  4DV2 Q;  1A62 A;  2Z6K A;  4HID A;  1HZA A;  2E2I H;  1S72 A;  4GN5 A;  4DUY L;  2UUC L;  2WB1 G;  2Q2T A;  4BBS G;  4AQY L;  4YCU A;  2XTI A;  1BVS A;  1VCI A;  1QVC A;  1VQC A;  3KJP A;  2A19 A;  1MJE A;  4JI8 Q;  2QA4 A;  3CCU A;  4LFC L;  1N36 Q;  2Y0S G;  3RLN A;  3PO2 G;  1LUZ A;  3UE0 A;  5C4X G;  4R4O A;  4LUZ A;  3PIP A;  4GOP A;  1VQN A;  3HOZ G;  1VQG A;  4B3R L;  1VQL A;  4IJH A;  3SGI A;  1X55 A;  2QEX A;  4A93 G;  2CFM A;  4A3C G;  4A3L G;  5M3M G;  3WWV A;  4X64 Q;  3RN5 A;  2K5H A;  1M1K C;  3GTP H;  5JJL A;  1JJG A;  3FP9 A;  4A3I G;  4X6A H;  3TRE A;  3CME A;  3GO5 A;  2AWN A;  2K14 A;  3ULL A;  4YHH Q;  3A5U A;  1D8L A;  3GTL H;  3EIV A;  5C0X I;  1X3F A;  1HNW Q;  1I6H H;  1CKO A;  4KLK A;  4WJ3 M;  2Z6K C;  1PH1 A;  4LF5 L;  4PZ6 A;  2YTY A;  1IBM L;  3CW2 C;  1HNZ L;  4LFA Q;  5FJ8 G;  1W3S A;  1Q8K A;  1K0R A;  1Z9F A;  3NEL A;  5IYD G;  2UXB Q;  2AWO A;  4GNX A;  2D0O A;  1N32 Q;  3K7A H;  3K7U C;  2JK8 A;  4POF A;  2E5L Q;  1BBU A;  5C3E G;  2JA7 G;  3HOV G;  3M7N A;  3PV0 A;  1VQJ A;  1VQ9 A;  2HT1 A;  2OTL A;  4JV5 Q;  1V9P A;  2K75 A;  1A8V A;  1XNQ L;  3CPW A;  3RN2 A;  3ULP A;  4P72 A;  2VQE Q;  4JI0 L;  1JE5 A;  2HQL A;  3FHW A;  1CKN A;  4NPS A;  3T1H Q;  5C44 G;  1GKH A;  3W5O A;  2DUD A;  4BY7 H;  3UE1 A;  4X65 L;  1VS0 A;  1SN8 A;  4YY3 Q;  5HGQ A;  2BA0 A;  2IX1 A;  3CC2 A;  4IO9 A;  1VQF A;  3PUY A;  4UP7 A;  4BBR G;  1VQ8 A;  3H3V I;  1MJC A;  4DV4 L;  4NB3 A;  3F1Z A;  2F4V L;  1IBK Q;  2JE6 I;  3HFZ B;  2Q2U A;  2D0P A;  2R7Z H;  4GKJ Q;  3S1Q H;  4JI4 L;  1EYG A;  4UP9 A;  2CCZ A;  3HKZ E;  3HOY G;  3H0G G;  4LFB L;  4A3M G;  3CCM A;  2ASB A;  4DKA C;  4GNX C;  4JI3 L;  3VDY A;  2CKZ B;  3D31 A;  3KOJ A;  3T1Y L;  1M90 C;  3GTO H;  2UXC L;  1E1O A;  1AE2 A;  1YHB A;  2EXD A;  1LTL A;  1B70 B;  2Q2I A;  3TQY A;  1YJN A;  4JCV E;  4B3S Q;  1LYL A;  4B3M Q;  4OX9 L;  1I50 H;  2OCE A;  3KDF A;  3UDX A;  5LMN W;  5IWA Q;  3TS0 A;  4YCW A;  4PZ8 A;  1A63 A;  4DV5 L;  1YZ6 A;  5BR8 Q;  1XNR L;  1PVO A;  1IBL Q;  5IP7 H;  5IYC G;  3G48 A;  1RL2 A;  2BH2 A;  2LXK A;  3PO3 G;  3GDE A;  2MQH A;  1VQ7 A;  3KF6 B;  2AKW B;  1Q1E A;  1KC8 C;  3ER0 A;  3KFU A;  4KHP L;  1WCM H;  4KI0 A;  3W1B A;  3U50 C;  4YWL A;  3CCV A;  1G29 1;  2GN5 A;  2NZO A;  2JA6 H;  3I4N H;  1EOV A;  3GTG H;  3CXC A;  3PCO B;  3PUX A;  1QUQ A;  4GLX A;  1PV4 A;  2VZA A;  2ZM6 L;  4A3E H;  1TWC H;  2KHJ A;  1IL2 A;  4MNO A;  4QL5 A;  1TWF H;  5IY0 A;  1PH7 A;  5IT9 c;  2E2J H;  4P75 A;  1EIY B;  3LGJ A;  4UPA A;  4DK3 C;  1JMC A;  3S14 H;  4JI7 L;  4DR6 L;  4Y52 H;  4H02 A;  4DV2 L;  3S2H H;  1EIF A;  1AE3 A;  1EQR A;  3KYH C;  4UY8 C;  4DV7 Q;  4X62 Q;  1K83 H;  1YHA A;  2KEN A;  1JB7 A;  2ZJQ A;  5IP9 H;  1NTG A;  4DR1 Q;  1CUK A;  2ALY B;  4MZ9 A;  1E22 A;  4JBK A;  1P16 A;  2CWA A;  2N8N A;  4JG2 A;  2E2H H;  4JI8 L;  5GAE C;  4DR5 Q;  2MO1 A;  1WFQ A;  2Q2H A;  5LMN Q;  1N36 L;  3PGZ A;  4LUO A;  2YYZ A;  3GTJ H;  4DV6 Q;  2NVX H;  4JI1 Q;  2B63 H;  4QY7 A;  2PQA B;  1GD7 A;  1Q46 A;  4EX5 A;  2WFW A;  5GAG C;  1WI5 A;  2A8V A;  1XPO A;  1WOC A;  1JJC B;  2PI2 A;  3UDI A;  3DLL A;  3JAM c;  3JAM i;  3IRB A;  4OON A;  4X64 L;  2R7F A;  4DK6 C;  4PG3 A;  1L1O C;  1BBW A;  1OXX K;  1YBY A;  1I94 Q;  4BY1 H;  4YHH L;  3K81 C;  2ATW A;  4A3J G;  1RIP A;  2I0Q A;  1HNW L;  3BU2 A;  1L0W A;  2VUM H;  2OWO A;  3KF8 B;  3J81 j;  1SE8 A;  2OQK A;  3BJU A;  1X3E A;  3FKI H;  3OYY A;  4KHZ A;  4LFA L;  2R93 H;  4YWK A;  2I5L X;  2UXB L;  1N32 L;  4LW1 A;  3G4S A;  4AYB G;  4IOC A;  4LF9 Q;  2E5L L;  1FVI A;  1Q1B A;  4TQU S;  3OTO Q;  2PMZ E;  2K5N A;  3GD7 A;  4JV5 L;  1FL0 A;  4IFD I;  3F2C A;  1SLJ A;  3M4Q A;  3PUZ A;  1YVC A;  1C9O A;  2VQE L;  1YIT A;  4PZ7 A;  3AFQ A;  4DAY B;  2WAQ G;  5C4J H;  2ZJR A;  3OW2 A;  2PI2 E;  3T1H L;  3CMA A;  1C7Y A;  1U0L A;  3U4V A;  3UDF A;  4QGU A;  4A3F H;  3AEV A;  3L0O A;  4YY3 L;  2NVY H;  1YJW A;  3S2D H;  2YU9 H;  1Q82 C;  4BY7 G;  1I3Q H;  1PFS A;  1T9H A;  1X56 A;  3J81 i;  3U58 A;  1Y1V H;  1IBK L;  4L5Q A;  2YV5 A;  1KIX A;  1J5E Q;  4GKJ L;  3CQZ H;  4LF8 Q;  3H15 A;  4OO1 I;  1V1Q A;  4A3B H;  3A0J A;  4B3T Q;  4LF4 Q;  1ASZ A;  3CCQ A;  2R7D A;  2R7Z G;  1KRS A;  4X66 Q;  3U4Z A;  3I4O A;  3K0X A;  4DUZ Q;  1QZH A;  4QJF A;  1VQO A;  3TRZ A;  2NVT H;  1HJP A;  1UE5 A;  1L2F A;  4GOP B;  1HZC A;  4B3S L;  3M4P A;  4L5R C;  4B3M L;  2BH8 A;  1VQB A;  4PMW A;  4LF6 Q;  3CCE A;  1E3P A;  3KJO A;  1PYB A;  1TWA H;  3AYH B;  5IWA L;  1W2B A;  1GM5 A;  1G51 A;  1VQM A;  3CP0 A;  5C4X H;  5BR8 L;  1Y1W H;  5H1S E;  1IBL L;  5JJK A;  1BKB A;  4P74 A;  1CKM A;  3B6Y A;  4A93 H;  3RZO H;  5E7N A;  5IP7 G;  4POG A;  2V1C C;  4A3G G;  5M3M H;  3M4O H;  4A3L H;  1X9N A;  4J15 A;  2AMC B;  4DV0 Q;  3E9H A;  3STB C;  4LNQ A;  1YHQ A;  4LF7 Q;  2A1A A;  2OQ0 A;  4A75 A;  3D0F A;  1QVG A;  2QGQ A;  3HOW H;  3J7A 5;  3CPF A;  4HIK A;  4IFD G;  4GNX B;  5LMU Q;  4IOA A;  1FJG Q;  1WCM G;  2C35 B;  3I4N G;  5JEA J;  4HJA A;  4LUV A;  1V43 A;  3PF4 A;  4JI2 Q;  1KL9 A;  3S1M H;  4DV3 Q;  2JA5 H;  2OTJ A;  1IYJ B;  4ME3 A;  4P71 A;  3J7Z C;  3UDG A;  3GTM H;  4K0K Q;  5C0X G;  1N33 Q;  1KAW A;  4A3E G;  1YIJ A;  4MTN A;  4L5S A;  4A3K H;  1HR0 Q;  4LWC A;  3I2Z A;  1PH9 A;  4R4T A;  4DV7 L;  4X62 L;  1SRO A;  4R4I A;  3RLO A;  4DR1 L;  4HJ9 A;  3G6E A;  2N3S A;  2RHQ B;  4HJ5 A;  4OXP A;  3K8A A;  4DAM A;  4JBJ A;  5FLX c;  3KLW A;  1B7Y B; 
#chains in the Genus database with same CATH topology
 4DV1 Q;  2L0C A;  3NEM A;  1YEZ A;  5G3L F;  4RHS A;  2G9D A;  1X3G A;  5KEE A;  1Z6H A;  3CC7 A;  1PA6 A;  3JAM E;  4GKK Q;  4FXD A;  1L1O A;  3SEB A;  3HKZ G;  2BDO A;  1R4P B;  1K0S A;  2KBN A;  4HCS A;  4IPD A;  4C3J G;  4DR3 Q;  3W3A A;  1SYF A;  2KEE A;  4CHT B;  2MUY A;  4DAV A;  2UXD Q;  1H9J A;  3PIO A;  2KQ3 A;  4DR4 Q;  1PTO H;  3L9A X;  1QG7 A;  3FKI G;  5GQO A;  4JYA Q;  3PUV A;  1JOQ A;  1EY9 A;  2EY2 A;  5M5X H;  4RKL A;  1HCZ A;  2HIV A;  1H95 A;  1BCP C;  4BY7 B;  1AN8 A;  1QUQ B;  2DJG C;  3AB9 A;  2K6A A;  5CV7 A;  4G57 A;  4FNF A;  1SE2 A;  4QCL A;  4XTC S;  2IW3 A;  3VA7 A;  1SYD A;  2N49 A;  3CRK C;  2HUG A;  1X3P A;  1WYD A;  1NE3 A;  4IQZ A;  1CFM A;  2EYL A;  3NBH B;  2ID0 A;  2PZT A;  5JPM C;  4B3T L;  2ZXR A;  2NN6 I;  3S24 A;  3SXH A;  2I5H A;  2JA8 H;  4DUZ L;  3PIO 3;  1HQR D;  3F8T A;  1PDQ A;  1K3R A;  5EGT A;  3RR5 A;  3G6J B;  4RH6 A;  4LF6 L;  2HIX A;  2DY7 A;  1GO3 E;  3CCL A;  4FF2 A;  1STA A;  4O2D A;  2R61 A;  2A5H A;  2B2T A;  3BVZ A;  2A68 D;  4J8Q A;  4DFA A;  1G6P A;  1WCM B;  2IHE A;  4QUF A;  1UEB A;  3HOU H;  2WP8 J;  4LF7 L;  1GUG A;  5JAV A;  4IPH A;  2F0W A;  4JI5 Q;  4KKS A;  4XXE A;  2YTX A;  2GA4 B;  4LMQ D;  1MHW C;  4KTA A;  4DNT B;  4AQY Q;  1X6O A;  2JA5 G;  1XPR A;  4KK7 A;  3HOZ H;  2M2L A;  5AFW A;  5GAH C;  2EYJ A;  4A3K G;  1NBW A;  1PH3 A;  1PTO B;  4KKU A;  3OHX C;  5FLX E;  3J81 E;  2EPB A;  1WJJ A;  1J6Q A;  2NN6 G;  1VQ5 A;  1GVP A;  2M00 A;  4DV1 L;  2JA9 A;  4AH6 A;  1VQI A;  3SVM A;  1PH8 A;  1EFW A;  1M4V A;  2RF4 A;  4GKK L;  3MXN B;  5FJ8 H;  1ESR A;  1PZI D;  4OEM B;  1N8R C;  2ZJP A;  4DR3 L;  5C3E H;  3HGB A;  1YI2 A;  1VQA A;  1TWG H;  4RA8 A;  2UXD L;  2WAC A;  1VQ4 A;  2NZ1 D;  1NMG A;  2D62 A;  4A3D G;  4RGO S;  4Q5V A;  1XNQ Q;  1Q8I A;  4DR4 L;  1HUM A;  4E6I A;  4GS3 A;  5EKL A;  3GP7 A;  2IHF A;  4JYA L;  1CSP A;  3NEN A;  2B63 G;  5C4J B;  3STB D;  2RHS B;  3AU7 A;  2XWB B;  1MIU A;  2R92 G;  4A3G H;  2NVY B;  4DNI A;  3NTK A;  5I9P A;  3NE5 B;  1QZG A;  2JXM B;  2SOB A;  3DEP A;  4RGM A;  4DK1 A;  3S1N H;  4KN4 C;  3HOU B;  2KCT A;  5IGD A;  4HAE A;  1B1Z A;  4FF3 A;  5F2D A;  1F2Y A;  2XRS D;  1PHJ A;  3DM1 A;  1XNR Q;  3ZJY C;  3Q22 A;  4FF1 A;  3S17 H;  3X3M A;  1ENC A;  1GUS A;  2LY7 A;  1ET9 A;  2SEB D;  1KXL A;  1L1O B;  3E9I A;  4A3F G;  2EJF C;  3CF5 A;  2WAQ E;  5M5Y H;  3RZO B;  3NPP A;  3R2T A;  5M3M B;  1NJI C;  4KMU C;  1CQV A;  1RTN A;  1SJE D;  3HOW B;  2FHT A;  4KJN A;  5IE8 A;  2HDL A;  2KUM A;  4B9X A;  4C3I H;  1B3A A;  1EL0 A;  4JI5 L;  4ZUJ A;  4DV2 Q;  1C4Q A;  1HZA A;  3JAM L;  4BBS G;  3QOJ A;  4AQY L;  4B9W A;  3CCU A;  2Y0S G;  1D5M C;  3UE0 A;  3PIP A;  4ABN A;  1VQG A;  3MEH A;  4XT3 B;  2PYK A;  2CFM A;  3T51 B;  2CVR A;  4A3L G;  3WWV A;  3RN5 A;  3RZD B;  3GTP H;  4X6A H;  4U67 3;  3NUC A;  1WTP A;  4YHH Q;  4Q0F A;  4FVM A;  1I6H H;  1GJX A;  4PZ6 A;  1Z9F A;  1SFO B;  2UXB Q;  2AWO A;  1XWE A;  3P75 A;  5CGK A;  3KUP A;  2OTL A;  2EY1 A;  1XNQ L;  3RN2 A;  3UI2 A;  1WTO A;  1PYW D;  3TSS A;  2B2V C;  1CKN A;  4HED A;  1O80 A;  5HGQ A;  2BA0 A;  3PIP 3;  1UUP A;  3QG1 A;  1VQF A;  4BBR G;  4OGQ C;  1MJC A;  1H9S A;  5BN3 A;  4FF4 A;  1CHQ D;  2A69 C;  3BG3 A;  1EYG A;  2CCZ A;  5EKK A;  5EQ0 A;  3SDZ A;  1QE6 A;  2K28 A;  3CCM A;  4DKA C;  3GTO H;  2CKZ B;  1ILQ A;  1AE2 A;  1YHB A;  4X3K A;  1BNZ A;  3LWE A;  1HUN A;  1GHJ A;  3CRL C;  2JSO A;  1EQT A;  3S15 B;  3EVQ A;  1SJH D;  4YCW A;  5BR8 Q;  1XNR L;  1IBL Q;  2J0T D;  2XRQ D;  5IP7 H;  3I3C A;  1VQ7 A;  4XT1 B;  3BYT B;  4IUP A;  4IFD H;  3KFU A;  2A73 B;  4K6L A;  4UAI A;  1G2T A;  2PW5 A;  3TDQ A;  3I4M B;  3CXC A;  5FK9 C;  2E2D C;  2I46 A;  4GLX A;  1PV4 A;  5FLX L;  2VZA A;  1TWC H;  3DXJ C;  3F2U A;  1EIG A;  2WB1 B;  1C8C A;  3IFT A;  4DV2 L;  1EIF A;  1AE3 A;  1EQR A;  4TRD A;  2F3W A;  4X62 Q;  1K83 H;  1YHA A;  2PQE A;  4ME5 A;  5IP9 H;  1CUK A;  4HSP A;  1EEI D;  1NR2 A;  1P16 A;  2N8N A;  1G91 A;  5GAE C;  1SDF A;  4DR5 Q;  1WFQ A;  2G9H D;  3A8I E;  2D9U A;  1KNA A;  4JI1 Q;  4QY7 A;  4EX5 A;  2D5D A;  4A3I B;  4X3U A;  2HDM A;  1KDB A;  1JJC B;  2QCP X;  1MSH A;  4PG3 A;  4JW0 A;  1OXX K;  4YHH L;  3K81 C;  2F0L A;  3K0Y A;  4L6T B;  1L0W A;  2BDN A;  5E1F A;  2O5I C;  1BR9 A;  3A55 A;  3J81 j;  3FKI H;  1SAP A;  2UXB L;  3G4S A;  5JPN C;  4AYB G;  4LF9 Q;  3GTO B;  4KHV A;  4TQU S;  2PMZ E;  3OMG A;  2K5D A;  1FL0 A;  3M4Q A;  3PUZ A;  2XNA C;  1YVC A;  1YIT A;  3S1R B;  1LT5 D;  1IKM A;  3OMC A;  1C7Y A;  1D2B A;  3SK4 A;  4CJ2 C;  4A3M B;  1T9H A;  1PFB A;  1JC7 A;  5M5W B;  4L5Q A;  2YV5 A;  1KIX A;  1ESF A;  2ZXO A;  2F0E A;  4OO1 I;  1SYB A;  2R7D A;  4C2M B;  2R7Z G;  1KRS A;  4X66 Q;  1JR0 D;  3I4O A;  3K0X A;  2SDF A;  2F0J A;  4CDD C;  1VQO A;  4IUV A;  1TWC B;  2NVT H;  4IUT A;  3VA5 A;  3GV3 A;  1I4H A;  1TWA H;  2F0S A;  1EU3 A;  3OPO A;  5D3D A;  1G51 A;  2A74 C;  1PXU A;  4K2K A;  5C4X H;  5BR8 L;  1WTV A;  5H1S E;  1IBL L;  4P74 A;  1AZQ A;  1PTO C;  3P20 A;  1O78 A;  4A3G G;  1DON A;  3M4O H;  2NTS A;  3M7G A;  1QVG A;  3LX0 A;  2WIN B;  3HKZ B;  2MHV A;  5COR A;  4IOA A;  3S9W A;  3PQI A;  4C3J B;  1W6K A;  4LUV A;  1V43 A;  4V0B A;  3BDC A;  3S1M H;  5J22 A;  4DV3 Q;  2JA5 H;  1IYU A;  2OTJ A;  3J7Z C;  2B2U C;  4K5V A;  1N33 Q;  4A3E G;  4ZKB B;  4MTN A;  5C4Z A;  1YIJ A;  4A3K H;  1HR0 Q;  1SSO A;  2F0V A;  3HRZ C;  4X62 L;  2OF1 A;  3VYR A;  2NN6 H;  2F1M A;  2N3S A;  2RHQ B;  2HD3 A;  1EEF D;  1H9S B;  3EQL C;  2KCN A;  3KLW A;  2EVB A;  3LNN A;  5FKA C;  5C44 H;  4DR5 L;  2LXJ A;  3A74 A;  1HNX Q;  4JBW A;  4JI1 L;  4UP8 A;  2L9H A;  2CH4 A;  2KCC A;  4YCV A;  3SK6 A;  4F87 A;  2EZV A;  4OWT B;  3E0E A;  1AW7 A;  1TII D;  3F2D A;  3H0G H;  4A3D H;  1K73 C;  1K8G A;  2A6E D;  4YWM A;  3J80 i;  3J80 c;  1PZK D;  3C3L A;  1CZG A;  4R1J A;  2ZTC A;  1FNU A;  4R4Q A;  3F2B A;  1WD1 A;  5C3W A;  1Y8P B;  4LF9 L;  4MN3 A;  5EAY A;  3BS1 A;  3ERO A;  1JOR A;  4ULL A;  1HPC A;  1CZW A;  2R92 H;  1KRT A;  1ILP A;  4KD3 A;  1A3T A;  2K5V A;  4Y7N H;  3S16 H;  1A3V A;  3QIA A;  1LTI D;  1X65 A;  1XXG A;  1CI3 M;  1Q12 A;  2IJ0 A;  3KLS X;  3TEH B;  2RDH A;  3T13 A;  3M4O B;  2L5T A;  1PLF A;  5IGE A;  4DNR B;  2QDL A;  4NMZ A;  1EQQ A;  4HMI A;  1N34 Q;  1Y1V G;  1AH9 A;  2UU9 Q;  1XTD A;  4X66 L;  1KD1 C;  4R4C A;  4EQO A;  5C0X J;  1GUN A;  4DR2 Q;  3NHH A;  3S1M B;  2CHB D;  2VNU D;  2JYO A;  2RSO A;  3RNU A;  3N52 A;  4GZY C;  5C4H A;  4WJW A;  2BA1 A;  1YNN C;  4JK1 C;  4XQN A;  2NZH A;  3DWP A;  4K8J A;  1H9M A;  1SYE A;  1U4R A;  2CW0 D;  3A8J E;  4ZRZ A;  1VQH A;  4NXN Q;  3NSW A;  2RQX A;  3I4N B;  3QJY A;  3KLS A;  1OXS C;  1SBB B;  1U5K A;  2Z0S A;  3CAM A;  1EWC A;  2F0M A;  2K52 A;  3E3X A;  4JI6 Q;  4BBS H;  1VMP A;  1A0I A;  1TWF B;  2YTV A;  4WFN 3;  3HEJ A;  5IGC A;  3S14 B;  1EYD A;  4DV3 L;  1PRT B;  3PF5 A;  4KN7 C;  3HKS A;  1LT3 D;  1N33 L;  4A3D B;  4K5X A;  3ITP A;  1HR0 L;  2F0I A;  4PMC A;  1SYG A;  3DUZ A;  1KTK A;  3H91 A;  1S40 A;  2B2T C;  2E2H B;  1GUW A;  3TP7 A;  2B63 B;  1FGU A;  5GAD C;  1HNX L;  4GN3 B;  4F7X A;  4HR7 B;  4N8X 1;  4NP5 A;  5JJI A;  5JVG 3;  1Y14 B;  4DXG A;  2Z1C A;  3GQB A;  1Q3L A;  1ASY A;  2CQO A;  3MFY A;  1IW7 D;  1IBM Q;  1VQK A;  2ICI A;  4KY7 A;  4BA2 I;  3J80 E;  1Q90 A;  3NP8 A;  2B29 A;  3G71 A;  3M3Y H;  4HIM A;  2LSS A;  1EUJ A;  5ELB A;  3J81 c;  3I7F A;  2EYM A;  2X6L A;  3I55 A;  3V2T A;  1OXT A;  4BBR H;  1HQM C;  1IHZ A;  3M9B A;  3GTQ H;  1SMY C;  1CHP D;  1HFG A;  4A3F B;  3QWN A;  1SNC A;  1LTA D;  4XIG S;  1I3Q B;  4RCO A;  4JI4 Q;  1STN A;  2PQA A;  4PV1 C;  1D5Z C;  4LFB Q;  1WVL A;  2FFK B;  1VQ6 A;  3T1Y Q;  2UXC Q;  4A3B B;  5D65 A;  1MSG A;  3CCS A;  2Z9H A;  2WB1 E;  1B9M A;  1N34 L;  3WDN A;  4BXX G;  4IUN A;  4ID6 A;  2UU9 L;  3BZK A;  5T1I A;  4H13 C;  4R8N A;  5FLM G;  1OXV A;  1Q86 C;  4RMF A;  4DR2 L;  2GVB A;  1N9W A;  3KF8 A;  3IFD A;  2KJX A;  3U9O A;  1YNJ C;  4RG1 A;  3HOX G;  2KCM A;  3OSO A;  5DM6 3;  3CC4 A;  2AQ3 B;  2Z4H A;  4NXN L;  1X54 A;  5M3F G;  3D4R A;  3BVG A;  1PH4 A;  2ZM6 Q;  3ND9 A;  3D6C A;  1EY8 A;  1LTS D;  2DN8 A;  1ICF B;  1HH2 P;  3L7Z C;  2PO4 A;  4ODG A;  3TS2 A;  4JI6 L;  2PMZ B;  1MKH A;  2RA4 A;  2K32 A;  2RDF A;  5JEA G;  1WTW A;  2Z6K A;  4XQQ A;  1AZP A;  1S72 A;  2KOL A;  2BE5 C;  5D3I B;  1VQC A;  3R8B A;  2NUC A;  3KJP A;  1F9S A;  1TS4 A;  2DNC A;  4JI8 Q;  4C3H G;  1NSN S;  3QR8 A;  1N36 Q;  3PO2 G;  4ZK9 B;  5C4X G;  4WRD A;  1X55 A;  3WOE A;  1JB3 A;  2K5H A;  4ILW A;  3GTQ B;  3GO5 A;  3A5U A;  3EIV A;  1DZ1 A;  3D4W A;  4KLK A;  4IZ8 A;  1PH1 A;  4K5W A;  1TR5 A;  1IBM L;  4G7O C;  5IYD G;  1Q8K A;  1TS5 A;  5BN4 A;  4GNX A;  3K7A H;  2JK8 A;  2J7Z A;  1F9R A;  2JA7 G;  3HOV G;  3M7N A;  2K7V A;  2TMP A;  1A8V A;  2IPK D;  2F03 A;  1B50 A;  4S3S A;  4EVO A;  2VQE Q;  1O7Z A;  1JE5 A;  2PW7 A;  4LK1 C;  2PZW A;  1K8M A;  5C44 G;  3T1H Q;  5M5X B;  2EE1 A;  1PFM A;  2DUD A;  3WOF A;  1WTQ A;  3NWS A;  3FPU B;  5EJW A;  3VYU A;  2IX1 A;  3CC2 A;  4KJO A;  3VYT A;  1B9N A;  3H3V I;  2K04 A;  1IBK Q;  2Q8T A;  1WD0 A;  2R7Z H;  3S1Q H;  4JI4 L;  4G7H C;  3HKZ E;  3HOY G;  3H0G G;  4LFB L;  4MIU A;  3T1Y L;  2UXC L;  1D1K A;  1E1O A;  2F0H A;  1D6E C;  2EXD A;  3T16 A;  1B70 B;  4B3S Q;  2JA8 B;  4B3M Q;  1I50 H;  2OCE A;  1HA5 A;  4PZ8 A;  1A63 A;  3D4D A;  1PVO A;  4LAA A;  1S5C D;  5CBE E;  1DYQ A;  3G48 A;  4ZKC B;  2LXK A;  1LT4 D;  2MQH A;  1CTM A;  1SNQ A;  3MWY W;  1KC8 C;  1AEX A;  3ER0 A;  3W1B A;  3U50 C;  3CCV A;  1G29 1;  2JA6 H;  3K5O A;  1TVX A;  1EOV A;  3GTG H;  3PCO B;  2BOS A;  1CM9 A;  3SR1 A;  2LFN A;  2ZM6 L;  3OW7 A;  3T4A C;  1K3B C;  2KHJ A;  4IUQ A;  3IL8 A;  4MNO A;  4QL5 A;  2E74 C;  4A3E H;  3CU7 A;  3QOL A;  4RKB A;  1LTR D;  4P75 A;  1EIY B;  4CJ1 B;  5T1G A;  4H02 A;  4OO1 H;  4UY8 C;  2EY6 A;  2ZJQ A;  3NWT A;  3HOZ B;  3DWQ A;  2ALY B;  4F8M A;  2L55 A;  4JBK A;  5CV9 A;  1SMY D;  1SE4 A;  4JI8 L;  2B2W A;  1N36 L;  4LUO A;  4OEL B;  3J80 L;  5I9O A;  3GTJ H;  2NVX H;  1PFN A;  2PQA B;  1GD7 A;  3I90 A;  2EXZ A;  3DWA A;  3VYS A;  1I4Q A;  2PI2 A;  2K03 A;  2R7F A;  3VR2 A;  1G2S A;  1HTP A;  1B4O A;  1I94 Q;  2I0Q A;  4I7Z C;  2K5Q A;  5C3E B;  2R7Z B;  1E2Z A;  1TWG B;  2WV6 D;  3KF8 B;  1BCP D;  1X3E A;  2B8G A;  3OYY A;  4KHZ A;  1K28 A;  5DM7 3;  4YWK A;  3NQT A;  3MZ5 A;  1BCP F;  4LW1 A;  4IOC A;  1ZEQ X;  1FVI A;  3OTO Q;  2K5N A;  3GD7 A;  4HMJ A;  1S5B D;  3BDO A;  4C1N K;  3F2C A;  1SLJ A;  1EWH A;  5D14 A;  2VQE L;  2ZJR A;  1RD9 D;  4RCN A;  5ELD A;  3T1H L;  3A8K E;  1U0L A;  1SNO A;  1VF5 C;  4NW2 A;  3UDF A;  2EYF A;  3AEV A;  3L0O A;  1YJW A;  3S2D H;  4A3G B;  2YU9 H;  1BDO A;  4BY7 G;  3NK9 A;  1A2U A;  2ENB A;  1JE4 A;  1GOZ A;  1Y1V H;  5J1Z A;  1IBK L;  3K6O A;  3CQZ H;  3S1N B;  4LF4 Q;  4CJ0 B;  3CCQ A;  5KGU A;  1KNE A;  1TKW B;  1MGS A;  1BF4 A;  5ELF A;  4QJF A;  1QCB D;  1D1I A;  3X3N A;  3HZX A;  1UE5 A;  1HZC A;  2L1B A;  1EQV A;  4B3S L;  4B3M L;  3D6W A;  1PRT C;  2SNS A;  2BH8 A;  3AYH B;  5BN5 A;  3S17 B;  1GHK A;  1CKM A;  1ZYR C;  3NTH A;  1CQF A;  4A93 H;  5E7N A;  5M5Y B;  1HFN A;  1X9N A;  4J15 A;  4DV0 Q;  1STG A;  3J7A 5;  3CPF A;  4HIK A;  4GNX B;  1QJO A;  4HSV A;  5LMU Q;  1WCM G;  2C35 B;  4C3I B;  2B8F A;  2AQ1 B;  1CK1 A;  5J39 A;  3UDG A;  3SE0 A;  4K0K Q;  5CMD A;  4QF4 A;  5C5M A;  4L5S A;  5DAU A;  4R4T A;  5FOB B;  4HJ9 A;  3G6E A;  1DM0 B;  4OXP A;  4JBJ A;  5I2Y A;  1UEA B;  3ERQ A;  2KED A;  4MTK A;  3PUW A;  1UE6 A;  3J81 L;  1IXR A;  5DNF A;  5FO9 B;  2O4X A;  3GTP B;  1KAA A;  4EQ5 A;  4HTH A;  5I4D A;  3FPP A;  2YU9 B;  1I6H B;  1CSQ A;  3Q0A A;  1I94 L;  2RVL A;  5GRO A;  4JBM A;  3A54 A;  2XVS A;  3CHB D;  4GLA C;  2MFI A;  3DM3 A;  1SNP A;  5EBD A;  2MJ8 A;  5KND A;  2JP1 A;  2R93 G;  2F3I A;  4RGN A;  4CKC A;  3TP6 A;  3OTO L;  1TWH H;  1BQQ T;  4JVZ A;  3I8Z A;  3FRP B;  4HJ7 A;  2VQF Q;  3D8G A;  2VL6 A;  5KYI A;  3PO3 H;  2UUB Q;  1KDA A;  1UE7 A;  2H5X A;  2XGT A;  1E0B A;  4UHV A;  3CCR A;  2E8G A;  2V4D A;  3FVQ A;  1YJ9 A;  4BXX H;  1HRJ A;  1QB5 D;  1ICW A;  1OO9 B;  5FLM H;  1E1T A;  4RAU C;  1KQS A;  4LF4 L;  1DOL A;  3AFP A;  5JOB A;  5JJZ A;  1NR4 A;  4OWW B;  4IJL A;  2I5M X;  3C1F A;  1PZJ D;  3E0J A;  2RBM A;  3HOX H;  2IWH A;  2B3G A;  2QEJ C;  1FR3 A;  5M3F H;  1SR3 A;  1B8A A;  2WKC A;  4IPG A;  5EKI A;  1Y1W G;  1EZ8 A;  3W2D A;  4DV0 L;  5JEA H;  3V05 A;  5CC4 A;  3A5Z B;  3URY A;  3W1G A;  2A6H C;  5LMU L;  5A35 A;  4A3J H;  4JC0 A;  1UE1 A;  2ES2 A;  3HOW G;  5K36 G;  3L2P A;  4TVA B;  4DUY Q;  2UUC Q;  1GUO A;  1V1P A;  3I70 A;  2NVQ H;  4K0K L;  4C3H H;  2JQO A;  4XYO A;  4DU9 A;  1HXY D;  1K83 B;  3PO2 H;  2IL8 A;  3OWE B;  5E3F A;  1ONL A;  2FXQ A;  2JEA I;  1VQP A;  1G6Z A;  2RDG A;  3PMF A;  3RLF A;  3M85 A;  2MPM A;  1S5E D;  2ZTE A;  4QUC A;  4K6D A;  1JCK B;  1W6J A;  2XSC A;  2JA6 G;  2N78 A;  1JT8 A;  1E24 A;  1AFP A;  2PPB C;  5IYD H;  5C6A A;  1CKN B;  2HQE A;  4J6H A;  1SMX A;  1VDZ A;  2JA7 H;  3HOV H;  1U4P A;  1KHI A;  1VQD A;  1FYC A;  4OWX B;  2I07 B;  2K01 A;  1JQY D;  3FKI B;  4OO1 G;  2XN9 C;  1PH2 A;  1T5E A;  1EY4 A;  2F52 A;  1XJV A;  3R3O A;  2VY3 A;  4O0A A;  4DGZ A;  3IAY A;  1ZYR D;  2A69 D;  4AIM A;  1I5F A;  1H9K A;  5E4W C;  1V8Q A;  3A7A B;  3IKJ A;  2G5D A;  4X65 Q;  2F0P A;  1I4X A;  3GTK H;  1FNV A;  2VQF L;  4QQB X;  1ENA A;  2HCI A;  3BYY B;  4OHJ A;  2UUB L;  2JEB I;  3HOY H;  2EY5 A;  2EIF A;  4FP5 D;  4DPG A;  4ALP A;  4APV A;  5I6W A;  4JOI A;  1AP0 A;  5ELN A;  1IL8 A;  2JJQ A;  2EDG A;  4ZAI A;  4OX9 Q;  3T56 B;  4WJ4 A;  1E2W A;  1E7Z A;  4KY6 A;  2NVT B;  4L5T A;  1B44 D;  2B2Y C;  1F77 A;  2IT1 A;  3K5L A;  4DV5 Q;  3G7L A;  3VR3 A;  1TWA B;  4C3H B;  4IUU A;  1JJ2 A;  4AYB E;  1LLR D;  3PO2 B;  5C4X B;  1QOH A;  3OOC A;  5ELO A;  2DGY A;  4KHP Q;  1XTC D;  1K9M C;  1KAB A;  4IFD J;  3MEF A;  5EPL A;  3I72 A;  5IYB G;  2QW7 A;  2GVA A;  3H3V H;  1D7Q A;  1JOK A;  3I4M G;  4DR6 Q;  3TP8 A;  4JI7 Q;  3PSI A;  2JA5 B;  4FXG C;  2A68 C;  1ET6 A;  3FEW X;  1A62 A;  4HID A;  2E2I H;  4DUY L;  2UUC L;  2WB1 G;  2Q2T A;  4A3K B;  1VF7 A;  2NYZ D;  1BVS A;  1QVC A;  1RF2 D;  5KYL A;  1MJE A;  5ELE A;  2QA4 A;  3VR5 A;  3RLN A;  4R4O A;  5C44 B;  1VQL A;  2QEX A;  4A93 G;  4A3C G;  2DJF C;  2VB2 X;  1M1K C;  1JJG A;  3FP9 A;  4U68 A;  4A3I G;  3ULL A;  5C0X I;  1X3F A;  1HNW Q;  1B2T A;  3C2P A;  1CKO A;  2Q8R E;  2Z6K C;  2F0G A;  3H0G B;  2DNE A;  2YTY A;  3CW2 C;  2OT2 A;  1V1O A;  3TZU A;  1K0R A;  3NEL A;  1N32 Q;  5CBA E;  4POF A;  2NBF A;  2L12 A;  3R2I A;  1VQJ A;  2DY8 A;  1VQ9 A;  2HT1 A;  1V9P A;  2K75 A;  3ULP A;  2LMC B;  4F88 A;  2HQL A;  5KNB A;  2R92 B;  4Z9C B;  4NPS A;  1KLU D;  3W5O A;  4BY7 H;  3U9S A;  4X65 L;  1VS0 A;  4YY3 Q;  4Y7N B;  1VQ8 A;  3S16 B;  4NB3 A;  2A6H D;  3F1Z A;  2Q2U A;  5LL6 X;  4GKJ Q;  4ZYS A;  1CA6 A;  5JVH 3;  2FMM A;  5K5P A;  4A3M G;  2ASB A;  4GNX C;  5IOC A;  1M90 C;  1FGB D;  3TQY A;  2B2Y A;  4K8I A;  4OX9 L;  4JCV E;  4RFB A;  1LYL A;  1PTO D;  4OIK A;  2Z6B A;  4CDE C;  2FJ2 A;  1PTO F;  3KDF A;  5E4X A;  5IWA Q;  3TS0 A;  2EYP A;  2E2I B;  4DV5 L;  2FIN B;  1YZ6 A;  4OIJ A;  5CV4 A;  2E76 C;  3NBI A;  2X6G A;  5IYC G;  3PO3 G;  3GDE A;  1TS2 A;  3MAQ A;  4M1U B;  4KHP L;  5G3L D;  1WCM H;  4KI0 A;  3MTS A;  2C5C A;  3PUX A;  4QIW B;  4N9P A;  1EZ6 A;  2OXP A;  1TQO A;  1PH7 A;  4BBS B;  5I2X A;  5IT9 c;  1LTT D;  4DR6 L;  4UPA A;  1JMC A;  4FO2 A;  4JI7 L;  4DN4 M;  4Y52 H;  3S2H H;  2KEN A;  1LTB D;  1JB7 A;  2Y0S B;  5LHY 1;  4R9W A;  4MZ9 A;  1E22 A;  2WII B;  5EBC A;  1U4M A;  2MO1 A;  5LMN Q;  3PGZ A;  4DV6 Q;  2L11 A;  2RCF A;  1Q46 A;  3J7Y W;  3KLR A;  4FXK C;  3DHQ A;  2A8V A;  1WI5 A;  2PCF B;  4G4K A;  3UDI A;  3IRB A;  4OON A;  1F2M A;  3O13 A;  4O42 A;  1KDC A;  5HGT A;  2ATW A;  4A3J G;  1HNW L;  3BU2 A;  1BUV T;  1EU4 A;  1G8Z D;  1BXT A;  1EYA A;  4HCE A;  2B39 A;  1RDP D;  2R93 H;  4B08 A;  3M3Y B;  1N32 L;  1SEB D;  4V19 0;  2B2W C;  1Q1B A;  3E5S A;  4CKB A;  5ELC A;  1SYC A;  1I4R A;  2EYH A;  1ZXT A;  4BBR B;  1C9O A;  1RJT A;  2WAQ G;  5C4J H;  3CKI B;  3OW2 A;  2PI2 E;  3TME A;  3U4V A;  5NUC A;  4YY3 L;  2NVY H;  4C56 C;  1PFS A;  1JWM D;  3J81 i;  1IYV A;  1J5E Q;  4GKJ L;  3MA2 B;  4LF8 Q;  3H15 A;  1YNN D;  3A0J A;  3U4Z A;  2CQA A;  1XYI A;  3K59 A;  2LKV A;  5KNC A;  3GV6 A;  1EFI D;  1L2F A;  1U4L A;  1A15 A;  2O2L D;  3E6Z X;  1HHV A;  1EOT A;  1VQB A;  1F9P A;  2F0U A;  3CCE A;  3S2H B;  1E3P A;  3KJO A;  1PYB A;  5IWA L;  4QMG A;  2M9V A;  1VQM A;  1UAP A;  1Y1W H;  1BOS A;  2R3Z A;  5JJK A;  3B6Y A;  1STH A;  2C9O A;  3Q6S A;  3RZO H;  3RD4 A;  2V1C C;  5M3M H;  1JWU D;  1UNS A;  2AMC B;  3BVM A;  3H09 A;  1YHQ A;  4A75 A;  2F0T A;  1LO5 D;  3HOW H;  3OWF A;  5K36 H;  1I6V C;  1FJG Q;  3I4N G;  5IT9 E;  4JI2 Q;  3A7L A;  1L0X B;  3GTM H;  5CV8 A;  3DMU A;  1KAW A;  1SXT A;  2J4X A;  3OIP A;  2F0F A;  4LWC A;  1ML0 D;  1B3Q A;  4DK0 A;  1KLG D;  1SRO A;  4NDX A;  2EOT A;  1Y8O B;  3ND8 A;  3RLO A;  2SNM A;  1QWY A;  4HJ5 A;  2R93 B;  4N8F A;  3K8A A;  3FMC A;  1SE3 A;  3K57 A;  5LMN L;  3BZC A;  1BBX C;  1LV9 A;  4DV6 L;  1R9T H;  4CGY B;  3KK7 A;  5DLQ E;  3RZD H;  2L4N A;  2AHO B;  4RWS C;  2QDB A;  3RMH A;  5J3B A;  3KDF B;  2MNA A;  4JPB W;  2N55 A;  4NKL A;  4AYB B;  1SFO H;  4BY1 G;  1Y69 U;  2F0Q A;  5M9O A;  3K7A B;  2QKI C;  5ISR A;  2VUM G;  1O7I A;  2UUA Q;  3ULJ A;  2K1B A;  2ZXP A;  3C1E A;  3K58 A;  4NXM Q;  1SNM A;  4KKT A;  1NNX A;  1Z47 A;  4LJZ C;  4WOR A;  4GN4 B;  3CCJ A;  3Q23 A;  1K8A C;  1Y1W B;  1J9O A;  3NXW A;  1RKN A;  4IPC A;  5LL6 S;  1C0A A;  2O5J C;  5IP9 G;  3S1Q B;  1XMO Q;  1GXD C;  4ZUI A;  5AJ3 Q;  1XMQ Q;  3C46 A;  1J5E L;  4LF8 L;  3QB3 A;  4HIO A;  4PQX A;  1O7Y A;  2RCN A;  1YNJ D;  1S4Z A;  2JN4 A;  4DXF A;  1EWI A;  1XPU A;  4A3B G;  1IKL A;  2PNH A;  1I50 B;  5IIF A;  2HHH Q;  1DGS A;  3GTM B;  3S15 H;  1YNX A;  1HZB A;  3ICE A;  3N6R A;  1JOO A;  1SRU A;  4P73 A;  1O7L A;  5COY A;  1PMR A;  2CWP A;  1TXY A;  2IX0 A;  1OTC A;  2ZTD A;  4DR7 Q;  5IYB H;  1CT1 D;  1LTG D;  3MVV A;  5KIX A;  3QO2 A;  2CH4 W;  3H6M A;  4DF7 A;  1PH6 A;  2JA6 B;  1ROD A;  3I4M H;  1BO0 A;  2BE5 D;  2IY5 B;  3GTG B;  4IN3 A;  1R9T B;  1HR0 W;  2KA7 A;  2P5Z X;  1NMF A;  1JIC A;  3Q8D A;  2K33 A;  1T5X D;  4A3E B;  1EY7 A;  1QIL A;  2PNR C;  1FJG L;  4CDF C;  2TSS A;  1DCZ A;  4JI2 L;  2Z4I A;  4K14 A;  1TS3 A;  1RHP A;  4FYD A;  1VQE A;  4BA1 I;  4LFC Q;  1PH5 A;  3J7A V;  1A2T A;  3VR4 A;  2L15 A;  4B3R Q;  4A3C H;  1IZ6 A;  3EJI A;  2Z8L A;  1PYS B;  3OIQ A;  3GTJ B;  2NVX B;  4GOP C;  4A3I H;  4R8I A;  1NY4 A;  2VW9 A;  4A76 A;  4O1N A;  5IOD A;  3JC6 6;  4BS9 A;  2K4K A;  2EYO A;  1JWS D;  2K5W A;  2D2C C;  3LWU A;  1UWV A;  1B53 A;  1S5D D;  1EYC A;  3KF6 A;  4LF5 Q;  2NWG A;  1HNZ Q;  2MO0 A;  2RSN A;  3AQQ A;  2F0N A;  1LAC A;  2R6G A;  3HP3 A;  3H3V C;  1F9Q A;  1QVF A;  2XIW A;  2UUA L;  2K50 A;  4JI0 Q;  3ERS X;  2VS1 A;  5TSS A;  3MXP A;  2A6E C;  2KHS A;  3EN2 A;  1MI2 A;  3S1R H;  2AUK A;  4NXM L;  5HY6 A;  3MFG A;  1Q7Y C;  1TT2 A;  3K80 C;  4FDB A;  4A4I A;  2XWJ B;  3M4Y A;  4DV4 Q;  4C1N I;  2F4V Q;  2EQS A;  5A2Q E;  3S2D B;  4H7B A;  1J8I A;  4A3M H;  3EBE A;  3J7A F;  5M5W H;  1LM0 A;  4BWG B;  1Y1V B;  3CQZ B;  2RKS A;  4JI3 Q;  4QIW E;  4XDX A;  1XMO L;  4C2M H;  2MGS A;  5AJ3 L;  1XMQ L;  2OEO A;  4HJ8 A;  5C0X H;  1Y8N B;  4XQJ A;  1P8L A;  1CA5 A;  3I56 A;  3SHL A;  3R93 A;  1WTX A;  3NQI A;  3A56 A;  1S5F D;  1HZ9 A;  2NTT A;  5IYC H;  1XX8 A;  2HHH L;  2JA8 G;  5EPJ A;  2Y0S E;  5IT9 L;  1BCP B;  2WKD A;  4GLV B;  2KHI A;  2H1E A;  3CD6 A;  3AMU A;  1S3O A;  1ENF A;  3HG9 A;  5C3X A;  4DR7 L;  4A93 B;  3I73 A;  3MXU A;  1OXU A;  4JOI C;  4DAY A;  4UDU C;  1LT6 D;  1QNU A;  1NCV A;  3TZD A;  4C3J H;  4ZQ3 A;  3P7J A;  1EY0 A;  1Q81 C;  3HOU G;  5DEH A;  2CW0 C;  1E2V A;  4GN5 A;  4MHE A;  4YCU A;  2XTI A;  2F0D A;  1VCI A;  5I6Y A;  2A19 A;  3DEO A;  1I4G A;  2X69 A;  4QB4 A;  5FO7 B;  1GUT A;  4LFC L;  1QNK A;  3SK5 A;  3TBI B;  1LUZ A;  4LUZ A;  1VQN A;  4GOP A;  3HOZ G;  4B3R L;  2B2V A;  4IJH A;  3SGI A;  1HTL D;  3EA6 A;  5M3M G;  4X64 Q;  1WTR A;  5JJL A;  1X32 A;  3TRE A;  1TY2 A;  3ZYY X;  2AWN A;  2K14 A;  3CME A;  3GTL H;  5CV6 A;  1D8L A;  2E75 C;  4PMB A;  4EGV A;  4WJ3 M;  3HS0 C;  1TY0 A;  4LF5 L;  1FD7 D;  1HNZ L;  4LFA Q;  1DOK A;  1TU2 B;  1W3S A;  5FJ8 G;  3K5M A;  3NTI A;  2D0O A;  3K7U C;  2QIL A;  4DA2 A;  2E5L Q;  2N88 A;  1BBU A;  5C3E G;  4X3T A;  3PV0 A;  3SK8 A;  1STE A;  4JV5 Q;  1IW7 C;  1STB A;  3CPW A;  4P72 A;  4JI0 L;  3FHW A;  3VR6 A;  1TWH B;  1GKH A;  3UE1 A;  1SN8 A;  3PO3 B;  4RGT A;  4IO9 A;  1MBY A;  3PUY A;  4UP7 A;  2MP1 A;  3ONA B;  2EJM A;  4H44 C;  3KBG A;  4DV4 L;  2F4V L;  2JE6 I;  3HFZ B;  2D0P A;  4L8J A;  3I91 A;  1F2Z A;  1PRT D;  1Z7T A;  4CDC C;  3H94 A;  4UP9 A;  1PRT F;  4JI3 L;  3VDY A;  3D31 A;  3KOJ A;  5CYU A;  4X3S A;  4KD4 A;  2Q2I A;  1LTL A;  1YJN A;  3P1H A;  2K05 A;  4IUR A;  3UDX A;  5LMN W;  3FDT A;  4I65 A;  4N9T A;  4M8A A;  3HOX B;  1C48 A;  5FO8 B;  4ZCK A;  3BDL A;  1RL2 A;  5M3F B;  2BH2 A;  3KF6 B;  2AKW B;  2FMC A;  1Q1E A;  3I4N H;  2F3V A;  4YWL A;  2NZO A;  2GN5 A;  5EPK A;  4TSS A;  1QUQ A;  1NUC A;  1IL2 A;  5IY0 A;  1TWF H;  2HCC A;  4A3J B;  5C5L A;  2E2J H;  3LGJ A;  4DK3 C;  3K5N A;  3GTL B;  3MHB A;  3S14 H;  2PZU A;  3T53 B;  4C3I G;  3KYH C;  2NVQ B;  5L37 A;  2EJG C;  2IX3 A;  4DV7 Q;  2ZT9 C;  5IGF A;  4ZLT F;  1NTG A;  4DR1 Q;  3NBH A;  1A3U A;  4CBV A;  4G7Z C;  2CWA A;  4JG2 A;  2E2H H;  2Q2H A;  4HN7 A;  2YYZ A;  2VXW A;  3L3O C;  1LAB A;  4PNY A;  2B63 H;  1F2L A;  2WAQ B;  4CKE A;  5CV5 A;  2WFW A;  1SND A;  1HA6 A;  5GAG C;  1L0Y B;  1XPO A;  1WOC A;  3I4L A;  4OL7 A;  3DLL A;  3JAM c;  3JAM i;  2AQ2 B;  4X64 L;  1A6X A;  4DK6 C;  1L1O C;  4I7A A;  1BBW A;  2LS0 1;  3MC0 B;  1YBY A;  4BY1 H;  3BZD B;  1RIP A;  1FNW A;  2QF7 A;  2VUM H;  1EIH A;  2JA7 B;  3HOV B;  3TP5 A;  5A2Q L;  2OWO A;  4XYQ A;  1SE8 A;  2OQK A;  3BJU A;  4LFA L;  1DXM A;  1K8O A;  2I5L X;  5HUR A;  2E5L L;  2Q8I B;  1EY5 A;  4JV5 L;  4J1M A;  4IFD I;  2NB0 A;  2AUJ D;  4PZ7 A;  3AFQ A;  4DAY B;  3D3R A;  3GTK B;  4K2L A;  4EQN A;  2KVM A;  3CMA A;  1MD2 D;  4QGU A;  4IAL A;  4A3F H;  4YIJ A;  1Q82 C;  1DJR D;  1I3Q H;  3HOY B;  1X56 A;  2VB3 X;  1DOM A;  2F4I A;  3U58 A;  1VMC A;  1II3 A;  1H9R A;  1V1Q A;  4A3B H;  1R4Q B;  4B3T Q;  1ASZ A;  1ZKO A;  3Q24 A;  1STY A;  4DUZ Q;  3V96 A;  1QZH A;  3TRZ A;  3MXN A;  1HJP A;  4GOP B;  2B2U A;  3M4P A;  4L5R C;  2E2J B;  1X3Q A;  4KY5 A;  4PMW A;  4LF6 Q;  4TKO B;  5IGG A;  1GM5 A;  1I4P A;  1W2B A;  5CR3 A;  3CP0 A;  1U9R A;  1BKB A;  1NAP A;  1V1P B;  2H4O A;  1EY6 A;  2BCO A;  1M8A A;  5IP7 G;  4POG A;  2ICE C;  4A3L H;  3KBX A;  2KEC A;  3E9H A;  3STB C;  4RHR A;  4KV6 A;  4LNQ A;  4LF7 Q;  5KRU A;  2A1A A;  2OQ0 A;  3D0F A;  3EFX D;  1WTH A;  2QGQ A;  4IFD G;  2F0K A;  5IGB A;  4L63 B;  5JEA J;  3RUZ A;  4HJA A;  3TN2 A;  3PF4 A;  1RTO A;  1KL9 A;  1IYJ B;  4ME3 A;  4P2C B;  4P71 A;  5C0X G;  4BY1 B;  3I2Z A;  1PH9 A;  4H0L C;  1D5X C;  2VUM B;  4DV7 L;  2F0O A;  4R4I A;  1RCV D;  4EQP A;  4DR1 L;  1DD2 A;  3MXG A;  4DAP A;  4DAM A;  5FLX c;  1B7Y B; 
#chains in the Genus database with same CATH homology
 4DV1 Q;  5C44 H;  4DR5 L;  2LXJ A;  3NEM A;  1YEZ A;  3A74 A;  3BZC A;  5LMN L;  1HNX Q;  4DV6 L;  4JBW A;  4JI1 L;  1R9T H;  3PUW A;  4UP8 A;  1UE6 A;  1X3G A;  1IXR A;  5DLQ E;  3CC7 A;  3RZD H;  1PA6 A;  4YCV A;  2AHO B;  4GKK Q;  4EQ5 A;  1L1O A;  3HKZ G;  2KBN A;  4IPD A;  4OWT B;  4DR3 Q;  3E0E A;  5J3B A;  1CSQ A;  3KDF B;  3H0G H;  2MNA A;  3F2D A;  1I94 L;  4A3D H;  1K73 C;  1K8G A;  5GRO A;  4JBM A;  2UXD Q;  1SFO H;  3PIO A;  4YWM A;  4BY1 G;  3J80 i;  3J80 c;  4GLA C;  2MFI A;  4R1J A;  3DM3 A;  2ZTC A;  4DR4 Q;  2VUM G;  1O7I A;  2UUA Q;  4R4Q A;  3ULJ A;  3F2B A;  3FKI G;  5GQO A;  5EAY A;  4LF9 L;  2R93 G;  2F3I A;  4JYA Q;  3PUV A;  3OTO L;  4NXM Q;  1TWH H;  2R92 H;  1Z47 A;  5M5X H;  1KRT A;  2HIV A;  4HJ7 A;  2VQF Q;  1H95 A;  1QUQ B;  2VL6 A;  4GN4 B;  3PO3 H;  2K5V A;  3CCJ A;  4Y7N H;  2UUB Q;  3S16 H;  1K8A C;  1UE7 A;  2H5X A;  2XGT A;  4IPC A;  1C0A A;  4XTC S;  1X65 A;  3CCR A;  5IP9 G;  1Q12 A;  2E8G A;  2N49 A;  3TEH B;  1XMO Q;  1YJ9 A;  4BXX H;  1WYD A;  1NE3 A;  5AJ3 Q;  1XMQ Q;  1J5E L;  4LF8 L;  3NBH B;  4HIO A;  2ID0 A;  5FLM H;  1E1T A;  1EQQ A;  1N34 Q;  1Y1V G;  1KQS A;  4B3T L;  4LF4 L;  1AH9 A;  2UU9 Q;  3AFP A;  2NN6 I;  3S24 A;  1XTD A;  2RCN A;  2I5H A;  4X66 L;  1KD1 C;  4DUZ L;  4OWW B;  4R4C A;  1EWI A;  1XPU A;  5C0X J;  4IJL A;  2JA8 H;  4A3B G;  2I5M X;  2PNH A;  4DR2 Q;  2HHH Q;  1DGS A;  2VNU D;  3RNU A;  3S15 H;  1YNX A;  1HZB A;  3ICE A;  2BA1 A;  3F8T A;  1K3R A;  3RR5 A;  1SRU A;  4P73 A;  3HOX H;  4LF6 L;  2B3G A;  2HIX A;  1GO3 E;  3CCL A;  2CWP A;  1TXY A;  2NZH A;  2IX0 A;  4O2D A;  1OTC A;  5M3F H;  2ZTD A;  4DR7 Q;  5IYB H;  1SR3 A;  1B8A A;  4NXN Q;  1VQH A;  4IPG A;  1G6P A;  1Y1W G;  1PH6 A;  2IHE A;  1UEB A;  1OXS C;  3I4M H;  3HOU H;  4DV0 L;  1U5K A;  2Z0S A;  1HR0 W;  2IY5 B;  2WP8 J;  3CAM A;  4LF7 L;  2K52 A;  4IPH A;  1NMF A;  3A5Z B;  3Q8D A;  4JI5 Q;  4JI6 Q;  2YTX A;  3W1G A;  5LMU L;  4BBS H;  1FJG L;  1A0I A;  4A3J H;  4JC0 A;  1UE1 A;  2YTV A;  2ES2 A;  3HOW G;  5K36 G;  3L2P A;  4TVA B;  4DUY Q;  2UUC Q;  4JI2 L;  4DV3 L;  4AQY Q;  2NVQ H;  4K0K L;  3PF5 A;  4C3H H;  3HKS A;  2JQO A;  1N33 L;  1X6O A;  2JA5 G;  3PO2 H;  1XPR A;  1VQE A;  4BA1 I;  3HOZ H;  1HR0 L;  4LFC Q;  1PH5 A;  5GAH C;  4A3K G;  2FXQ A;  1NBW A;  2L15 A;  1PH3 A;  1VQP A;  1S40 A;  2JEA I;  4B3R Q;  4A3C H;  1IZ6 A;  1PYS B;  1WJJ A;  1J6Q A;  2NN6 G;  3RLF A;  3M85 A;  2ZTE A;  4GOP C;  1VQ5 A;  4A3I H;  1GVP A;  4DV1 L;  1NY4 A;  1FGU A;  2VW9 A;  2JA9 A;  4AH6 A;  1VQI A;  5GAD C;  4A76 A;  1PH8 A;  1HNX L;  4GN3 B;  2JA6 G;  3JC6 6;  2N78 A;  1JT8 A;  5JJI A;  1E24 A;  1Y14 B;  1EFW A;  2K4K A;  2RF4 A;  4GKK L;  3MXN B;  1UWV A;  5FJ8 H;  1ASY A;  3KF6 A;  4LF5 Q;  2CQO A;  5IYD H;  1IBM Q;  1HNZ Q;  1CKN B;  2MO0 A;  1VQK A;  1N8R C;  2ZJP A;  4DR3 L;  1SMX A;  3AQQ A;  5C3E H;  2JA7 H;  3HOV H;  1YI2 A;  1VQA A;  1KHI A;  1TWG H;  1VQD A;  4OWX B;  4BA2 I;  2R6G A;  2UXD L;  4OO1 G;  1VQ4 A;  1PH2 A;  2B29 A;  1NMG A;  2D62 A;  3G71 A;  3M3Y H;  4A3D G;  4HIM A;  1XJV A;  2F52 A;  1XNQ Q;  2LSS A;  1EUJ A;  3J81 c;  4DR4 L;  2VY3 A;  3I7F A;  1QVF A;  4O0A A;  2UUA L;  2K50 A;  4JI0 Q;  3ERS X;  3I55 A;  4GS3 A;  2VS1 A;  4AIM A;  1OXT A;  1I5F A;  4BBR H;  2IHF A;  3EN2 A;  4JYA L;  4X65 Q;  3S1R H;  1CSP A;  3NEN A;  4NXM L;  2B63 G;  5HY6 A;  1Q7Y C;  3STB D;  3GTK H;  2RHS B;  3M9B A;  3K80 C;  4FDB A;  4A4I A;  3GTQ H;  2VQF L;  4QQB X;  1MIU A;  2R92 G;  4DV4 Q;  4A3G H;  2F4V Q;  2EQS A;  4DNI A;  2UUB L;  1QZG A;  4XIG S;  2JEB I;  3HOY H;  4JI4 Q;  4A3M H;  3EBE A;  2EIF A;  2PQA A;  4DPG A;  1LM0 A;  5M5W H;  4ALP A;  4APV A;  4JOI A;  4LFB Q;  5ELN A;  4JI3 Q;  3S1N H;  1VQ6 A;  3T1Y Q;  4QIW E;  2UXC Q;  1XMO L;  4C2M H;  5AJ3 L;  3CCS A;  2JJQ A;  1XMQ L;  4OX9 Q;  2KCT A;  4HJ8 A;  4WJ4 A;  2WB1 E;  1P8L A;  1N34 L;  4BXX G;  3I56 A;  1E7Z A;  2UU9 L;  4L5T A;  3BZK A;  5FLM G;  2IT1 A;  1OXV A;  1Q86 C;  4RMF A;  4DV5 Q;  1HZ9 A;  4DR2 L;  2GVB A;  5IYC H;  3ZJY C;  1PHJ A;  2HHH L;  1XNR Q;  2JA8 G;  2Y0S E;  1JJ2 A;  1N9W A;  3S17 H;  4AYB E;  4GLV B;  2KHI A;  3CD6 A;  1KXL A;  1L1O B;  1S3O A;  5ELO A;  2DGY A;  3E9I A;  4RG1 A;  3HOX G;  4KHP Q;  2KCM A;  4A3F G;  4DR7 L;  1K9M C;  3CF5 A;  2WAQ E;  5M5Y H;  3CC4 A;  1OXU A;  4IFD J;  3MEF A;  4NXN L;  1X54 A;  5M3F G;  5IYB G;  4JOI C;  1NJI C;  1PH4 A;  2ZM6 Q;  2GVA A;  3H3V H;  1D7Q A;  4C3J H;  5IE8 A;  4C3I H;  1HH2 P;  3L7Z C;  3I4M G;  4DR6 Q;  4JI5 L;  1Q81 C;  3HOU G;  4JI7 Q;  3PSI A;  4JI6 L;  3TS2 A;  1MKH A;  5JEA G;  4DV2 Q;  1A62 A;  2Z6K A;  4HID A;  1HZA A;  2E2I H;  1S72 A;  4GN5 A;  4DUY L;  2UUC L;  2WB1 G;  2Q2T A;  4BBS G;  4AQY L;  4YCU A;  2XTI A;  1BVS A;  1VCI A;  1QVC A;  1VQC A;  3KJP A;  2A19 A;  1MJE A;  4JI8 Q;  2QA4 A;  3CCU A;  4LFC L;  1N36 Q;  2Y0S G;  3RLN A;  3PO2 G;  1LUZ A;  3UE0 A;  5C4X G;  4R4O A;  4LUZ A;  3PIP A;  4GOP A;  1VQN A;  3HOZ G;  1VQG A;  4B3R L;  1VQL A;  4IJH A;  3SGI A;  1X55 A;  2QEX A;  4A93 G;  2CFM A;  4A3C G;  4A3L G;  5M3M G;  3WWV A;  4X64 Q;  3RN5 A;  2K5H A;  1M1K C;  3GTP H;  5JJL A;  1JJG A;  3FP9 A;  4A3I G;  4X6A H;  3TRE A;  3CME A;  3GO5 A;  2AWN A;  2K14 A;  3ULL A;  4YHH Q;  3A5U A;  1D8L A;  3GTL H;  3EIV A;  5C0X I;  1X3F A;  1HNW Q;  1I6H H;  1CKO A;  4KLK A;  4WJ3 M;  2Z6K C;  1PH1 A;  4LF5 L;  4PZ6 A;  2YTY A;  1IBM L;  3CW2 C;  1HNZ L;  4LFA Q;  5FJ8 G;  1W3S A;  1Q8K A;  1K0R A;  1Z9F A;  3NEL A;  5IYD G;  2UXB Q;  2AWO A;  4GNX A;  2D0O A;  1N32 Q;  3K7A H;  3K7U C;  2JK8 A;  4POF A;  2E5L Q;  1BBU A;  5C3E G;  2JA7 G;  3HOV G;  3M7N A;  3PV0 A;  1VQJ A;  1VQ9 A;  2HT1 A;  2OTL A;  4JV5 Q;  1V9P A;  2K75 A;  1A8V A;  1XNQ L;  3CPW A;  3RN2 A;  3ULP A;  4P72 A;  2VQE Q;  4JI0 L;  1JE5 A;  2HQL A;  3FHW A;  1CKN A;  4NPS A;  3T1H Q;  5C44 G;  1GKH A;  3W5O A;  2DUD A;  4BY7 H;  3UE1 A;  4X65 L;  1VS0 A;  1SN8 A;  4YY3 Q;  5HGQ A;  2BA0 A;  2IX1 A;  3CC2 A;  4IO9 A;  1VQF A;  3PUY A;  4UP7 A;  4BBR G;  1VQ8 A;  3H3V I;  1MJC A;  4DV4 L;  4NB3 A;  3F1Z A;  2F4V L;  1IBK Q;  2JE6 I;  3HFZ B;  2Q2U A;  2D0P A;  2R7Z H;  4GKJ Q;  3S1Q H;  4JI4 L;  1EYG A;  4UP9 A;  2CCZ A;  3HKZ E;  3HOY G;  3H0G G;  4LFB L;  4A3M G;  3CCM A;  2ASB A;  4DKA C;  4GNX C;  4JI3 L;  3VDY A;  2CKZ B;  3D31 A;  3KOJ A;  3T1Y L;  1M90 C;  3GTO H;  2UXC L;  1E1O A;  1AE2 A;  1YHB A;  2EXD A;  1LTL A;  1B70 B;  2Q2I A;  3TQY A;  1YJN A;  4JCV E;  4B3S Q;  1LYL A;  4B3M Q;  4OX9 L;  1I50 H;  2OCE A;  3KDF A;  3UDX A;  5LMN W;  5IWA Q;  3TS0 A;  4YCW A;  4PZ8 A;  1A63 A;  4DV5 L;  1YZ6 A;  5BR8 Q;  1XNR L;  1PVO A;  1IBL Q;  5IP7 H;  5IYC G;  3G48 A;  1RL2 A;  2BH2 A;  2LXK A;  3PO3 G;  3GDE A;  2MQH A;  1VQ7 A;  3KF6 B;  2AKW B;  1Q1E A;  1KC8 C;  3ER0 A;  3KFU A;  4KHP L;  1WCM H;  4KI0 A;  3W1B A;  3U50 C;  4YWL A;  3CCV A;  1G29 1;  2GN5 A;  2NZO A;  2JA6 H;  3I4N H;  1EOV A;  3GTG H;  3CXC A;  3PCO B;  3PUX A;  1QUQ A;  4GLX A;  1PV4 A;  2VZA A;  2ZM6 L;  4A3E H;  1TWC H;  2KHJ A;  1IL2 A;  4MNO A;  4QL5 A;  1TWF H;  5IY0 A;  1PH7 A;  5IT9 c;  2E2J H;  4P75 A;  1EIY B;  3LGJ A;  4UPA A;  4DK3 C;  1JMC A;  3S14 H;  4JI7 L;  4DR6 L;  4Y52 H;  4H02 A;  4DV2 L;  3S2H H;  1EIF A;  1AE3 A;  1EQR A;  3KYH C;  4UY8 C;  4DV7 Q;  4X62 Q;  1K83 H;  1YHA A;  2KEN A;  1JB7 A;  2ZJQ A;  5IP9 H;  1NTG A;  4DR1 Q;  1CUK A;  2ALY B;  4MZ9 A;  1E22 A;  4JBK A;  1P16 A;  2CWA A;  2N8N A;  4JG2 A;  2E2H H;  4JI8 L;  5GAE C;  4DR5 Q;  2MO1 A;  1WFQ A;  2Q2H A;  5LMN Q;  1N36 L;  3PGZ A;  4LUO A;  2YYZ A;  3GTJ H;  4DV6 Q;  2NVX H;  4JI1 Q;  2B63 H;  4QY7 A;  2PQA B;  1GD7 A;  1Q46 A;  4EX5 A;  2WFW A;  5GAG C;  1WI5 A;  2A8V A;  1XPO A;  1WOC A;  1JJC B;  2PI2 A;  3UDI A;  3DLL A;  3JAM c;  3JAM i;  3IRB A;  4OON A;  4X64 L;  2R7F A;  4DK6 C;  4PG3 A;  1L1O C;  1BBW A;  1OXX K;  1YBY A;  1I94 Q;  4BY1 H;  4YHH L;  3K81 C;  2ATW A;  4A3J G;  1RIP A;  2I0Q A;  1HNW L;  3BU2 A;  1L0W A;  2VUM H;  2OWO A;  3KF8 B;  3J81 j;  1SE8 A;  2OQK A;  3BJU A;  1X3E A;  3FKI H;  3OYY A;  4KHZ A;  4LFA L;  2R93 H;  4YWK A;  2I5L X;  2UXB L;  1N32 L;  4LW1 A;  3G4S A;  4AYB G;  4IOC A;  4LF9 Q;  2E5L L;  1FVI A;  1Q1B A;  4TQU S;  3OTO Q;  2PMZ E;  2K5N A;  3GD7 A;  4JV5 L;  1FL0 A;  4IFD I;  3F2C A;  1SLJ A;  3M4Q A;  3PUZ A;  1YVC A;  1C9O A;  2VQE L;  1YIT A;  4PZ7 A;  3AFQ A;  4DAY B;  2WAQ G;  5C4J H;  2ZJR A;  3OW2 A;  2PI2 E;  3T1H L;  3CMA A;  1C7Y A;  1U0L A;  3U4V A;  3UDF A;  4QGU A;  4A3F H;  3AEV A;  3L0O A;  4YY3 L;  2NVY H;  1YJW A;  3S2D H;  2YU9 H;  1Q82 C;  4BY7 G;  1I3Q H;  1PFS A;  1T9H A;  1X56 A;  3J81 i;  3U58 A;  1Y1V H;  1IBK L;  4L5Q A;  2YV5 A;  1KIX A;  1J5E Q;  4GKJ L;  3CQZ H;  4LF8 Q;  3H15 A;  4OO1 I;  1V1Q A;  4A3B H;  3A0J A;  4B3T Q;  4LF4 Q;  1ASZ A;  3CCQ A;  2R7D A;  2R7Z G;  1KRS A;  4X66 Q;  3U4Z A;  3I4O A;  3K0X A;  4DUZ Q;  1QZH A;  4QJF A;  1VQO A;  3TRZ A;  2NVT H;  1HJP A;  1UE5 A;  1L2F A;  4GOP B;  1HZC A;  4B3S L;  3M4P A;  4L5R C;  4B3M L;  2BH8 A;  1VQB A;  4PMW A;  4LF6 Q;  3CCE A;  1E3P A;  3KJO A;  1PYB A;  1TWA H;  3AYH B;  5IWA L;  1W2B A;  1GM5 A;  1G51 A;  1VQM A;  3CP0 A;  5C4X H;  5BR8 L;  1Y1W H;  5H1S E;  1IBL L;  5JJK A;  1BKB A;  4P74 A;  1CKM A;  3B6Y A;  4A93 H;  3RZO H;  5E7N A;  5IP7 G;  4POG A;  2V1C C;  4A3G G;  5M3M H;  3M4O H;  4A3L H;  1X9N A;  4J15 A;  2AMC B;  4DV0 Q;  3E9H A;  3STB C;  4LNQ A;  1YHQ A;  4LF7 Q;  2A1A A;  2OQ0 A;  4A75 A;  3D0F A;  1QVG A;  2QGQ A;  3HOW H;  3J7A 5;  3CPF A;  4HIK A;  4IFD G;  4GNX B;  5LMU Q;  4IOA A;  1FJG Q;  1WCM G;  2C35 B;  3I4N G;  5JEA J;  4HJA A;  4LUV A;  1V43 A;  3PF4 A;  4JI2 Q;  1KL9 A;  3S1M H;  4DV3 Q;  2JA5 H;  2OTJ A;  1IYJ B;  4ME3 A;  4P71 A;  3J7Z C;  3UDG A;  3GTM H;  4K0K Q;  5C0X G;  1N33 Q;  1KAW A;  4A3E G;  1YIJ A;  4MTN A;  4L5S A;  4A3K H;  1HR0 Q;  4LWC A;  3I2Z A;  1PH9 A;  4R4T A;  4DV7 L;  4X62 L;  1SRO A;  4R4I A;  3RLO A;  4DR1 L;  4HJ9 A;  3G6E A;  2N3S A;  2RHQ B;  4HJ5 A;  4OXP A;  3K8A A;  4DAM A;  4JBJ A;  5FLX c;  3KLW A;  1B7Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...