5BR8L

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5br8L00
1A0IA 3U4VA 1C0AA 3A0JA 1X55A 1BBWA 3BU2A 1VQEA 3E0EA 3G6EA 1Q7YC 2R7ZG 4A3GG 3STBC 3CF5A 3F8TA 4DR4Q 1V1QA 2N3SA 2IHFA 2WFWA 1FJGQ 3HOZH 1JJGA 3HOWG 3M4OH 4JI7L 4IFDG 2CFMA 1QUQA 4R4QA 1R9TH 3RN2A 3FKIH 4QY7A 1J6QA 4DAYB 4IPDA 2VS1A 1XMOQ 4XTCS 1GD7A 4AH6A 5C4XH 3HFZB 5C4JH 5JJLA 2VQEL 3CMEA 2UXDL 2ASBA 1HNZL 4IFDI 2LXJA 3L2PA 4LUZA 5IYBG 1Z47A 1VQ8A 4QL5A 2CWPA 2ES2A 2UUAL 2WB1G 4HIDA 3HOUH 4QQBX 4A3EH 4POGA 4GKKL 4PZ7A 2JK8A 1TWCH 1PHJA 1VQFA 4QIWE 1FVIA 4DV7L 4GS3A 4UPAA 1O7IA 1W3SA 4YCVA 5LMUQ 1IBKL 1YEZA 2R7ZH 4GLXA 1XJVA 2D0OA 2PI2E 3M7NA 3S17H 4Y7NH 1VQPA 4A3GH 3HKZE 4MZ9A 3NBHB 2VZAA 4OWXB 5FLXc 3J81j 3F2BA 1HH2P 3CCSA 4B3TQ 3STBD 1Y1WG 5H1SE 1PH6A 2ATWA 1EIYB 3GTPH 2EQSA 2IT1A 1YVCA 1LTLA 3HOWH 1SE8A 4EQ5A 4A93G 4APVA 4AIMA 1B7YB 2BA1A 2V1CC 3AQQA 3GTOH 4GKJQ 4LF4Q 1TWHH 4AYBG 1KQSA 3Q8DA 5GADC 1HJPA 2XTIA 5JJKA 1TWAH 1JJCB 3M4PA 1GM5A 3CD6A 4L5TA 4DR1L 2JEAI 4UY8C 1NTGA 5IYBH 4B3SL 3UDFA 1HNXL 2ID0A 1YJ9A 2NVTH 3TS2A 1V43A 2OQ0A 5IYCH 1HR0L 4LF9Q 1I6HH 3CCUA 2UUCQ 2MO1A 2Y0SE 1Q1BA 1WI5A 1WJJA 2AHOB 2K52A 3PF5A 3CXCA 3BJUA 2MFIA 4DR3L 1PH5A 3IRBA 1VQIA 1VQGA 4HJAA 4JI1Q 1NY4A 3VDYA 3D31A 4X66Q 1XTDA 5JJIA 2N49A 3GTLH 4BA1I 1YJNA 1UE7A 3S16H 2UU9L 4L5SA 4OWTB 1L1OA 4X65L 1Q82C 4A93H 1WOCA 2Z6KA 2BA0A 3HKSA 4IPHA 4LFBL 3JC66 2A8VA 4OONA 1X6OA 4DK6C 2VQEQ 3CQZH 1GKHA 1VQMA 2UXDQ 2YU9H 1VQHA 3EIVA 1UEBA 2WAQE 2OWOA 1Q1EA 4DK3C 1VQAA 2VL6A 4A3MG 2GVAA 2RF4A 1PYSB 1QVFA 4GKKQ 4DV0L 2C35B 4DPGA 4UP9A 3CP0A 4JCVE 1IBKQ 4JI2L 4K0KL 4BY1G 1B70B 3G48A 3GTGH 3S1NH 5FJ8G 1X65A 3A74A 5GROA 3CCJA 1CKNB 1NBWA 1N9WA 1U0LA 1EFWA 3H0GG 4JBWA 4H02A 1BBUA 4HJ5A 4Y52H 1Q12A 2K5VA 4DR6Q 1CUKA 4L5QA 4JOIC 2AMCB 1WCMH 4R4IA 3NEMA 4IJLA 4DAMA 1KL9A 2HQLA 4LF8L 3ER0A 4DV1Q 1E22A 3HOVG 3I4OA 3CMAA 3CC4A 1S40A 1VQ9A 2KHJA 4DR1Q 3PO2G 3KOJA 4B3SQ 2QGQA 1PH2A 2JQOA 1I94L 1HNXQ 3KFUA 4L5RC 3BZCA 3FHWA 4DUZL 1J5EQ 1HR0Q 4JYAQ 4IFDJ 4A3MH 4GNXA 1PV4A 1OXSC 4YY3Q 3ERSX 4DR3Q 1PH3A 5AJ3L 3TEHB 4BY1H 1VS0A 3S24A 5FJ8H 3UE0A 1YNXA 1NMFA 4LF6L 1Q46A 3S1MH 1A8VA 2ZM6Q 3H0GH 3I56A 4DV6L 1L2FA 4KHPL 2UUBL 3DM3A 2ZJRA 3F2DA 4AQYL 1QVGA 4KLKA 4IJHA 1X56A 2NVXH 1T9HA 2N8NA 4QGUA 4A3BG 4DNIA 4BY7G 1XMQL 4LWCA 1A63A 2QEXA 1JJ2A 1N36L 2WAQG 3H15A 3HOVH 3OTOL 3CC7A 1EYGA 1JT8A 4GN3B 1VQNA 1K9MC 4DV4Q 1EQRA 4JI5Q 3PO2H 3RZOH 1YHQA 1RL2A 3J81c 2E8GA 3H3VI 4DKAC 1SRUA 3S2DH 1EOVA 2UXCQ 4K0KQ 3J81i 4XIGS 5J3BA 1VQDA 3PV0A 4X64L 1VQOA 1PH4A 4JG2A 4TQUS 1HNWL 1AE3A 3PSIA 2ALYB 5M3FG 2JJQA 2PQAB 4P73A 2VQFQ 5C44G 1HZAA 3CCEA 2E2HH 4X6AH 4LFAL 1KIXA 4PZ8A 1OXVA 2DUDA 2KENA 4GOPC 1KC8C 3AFPA 5HGQA 5LMNW 4DV2Q 4A3LG 4JV5Q 4GN4B 3U4ZA 4DR5Q 4QJFA 1B8AA 2K75A 4JI3L 3K80C 2GN5A 3KDFA 4LF8Q 1AH9A 4A3BH 2A1AA 3H3VH 4BY7H 4YHHL 1PA6A 1CSQA 3A5UA 4B3RQ 4GOPB 2YTYA 1AE2A 2NZOA 4C2MH 1FL0A 4HJ7A 1HZCA 4DUZQ 3AEVA 2OQKA 5BR8L 1E7ZA 2AWOA 4DV3L 1L1OC 4PZ6A 2A19A 1EIFA 1HZBA 5AJ3Q 5GAEC 3G71A 1W2BA 4LF7Q 1KRTA 3FP9A 2K14A 4R4CA 1XNQL 1C9OA 5M3FH 1LUZA 1P8LA 1VQ5A 4DR7L 4LF5L 4KHPQ 2UUBQ 1RIPA 3CCQA 3UDXA 5C44H 4A3FG 4JI0L 2BH2A 1CKOA 4LFCL 4A3LH 1VQBA 2PI2A 5IT9c 4HJ8A 3L7ZC 1D8LA 4WJ3M 1E1TA 4RG1A 1P16A 3ZJYC 1NJIC 2F4VL 1N36Q 1TXYA 3RN5A 1S72A 2MNAA 2MQHA 3RLFA 5GAGC 3OTOQ 4A3KG 1Y14B 4JI6L 4NXNL 1N8RC 4WJ4A 1NMGA 3U58A 1Y1WH 3GTQH 1D7QA 4KI0A 4TVAB 4JI7Q 1MIUA 1TWFH 1N34L 4A4IA 1UWVA 2RHSB 4FDBA 1KHIA 4OXPA 4JI8L 2B63G 2E2IH 1OXTA 2NZHA 1I50H 4X64Q 5ELNA 1Z9FA 2F52A 4P71A 1HNZQ 1HNWQ 3K8AA 3S14H 2DGYA 2FXQA 3MXNB 1IXRA 4RMFA 1SFOH 2CCZA 2KBNA 2UUAQ 3GTMH 2N78A 3CPFA 1SR3A 4LFAQ 3F1ZA 2F3IA 3PUXA 4A3FH 4DV7Q 4BBRG 1I5FA 2YV5A 3HKZG 2Q2UA 1XNRL 4JI3Q 5JEAJ 4ME3A 3UDIA 4OX9L 2WP8J 4YHHQ 4IO9A 4A76A 2UXBL 1YITA 2LSSA 2K5NA 2JA7G 3BZKA 4C3IH 4A3KH 3S2HH 2IY5B 3PCOB 3LGJA 3RR5A 4BBSG 5IP9G 4DR4L 3K0XA 2JA8G 1EWIA 2JA9A 1GVPA 2NVYH 1DGSA 1Q8KA 2B3GA 4DV3Q 3CPWA 3CCRA 3HOYG 3ICEA 2B63H 2CWAA 3PGZA 4HIOA 3S15H 4JBMA 5LMNL 1CKMA 3E9IA 1MKHA 2BH8A 2D62A 3CAMA 1LYLA 3MEFA 5K36G 3PUZA 1XMOL 3K81C 1YHAA 4DR7Q 4A75A 4OWWB 4LF5Q 1JE5A 1H95A 2Y0SG 2R92G 3D0FA 2VY3A 4LFCQ 3PUVA 4DR2L 2B29A 2H5XA 4BBRH 4POFA 5JEAG 1Y1VG 3WWVA 1PH7A 4UP7A 3NENA 4JI6Q 2WB1E 1OXXK 3TQYA 3UE1A 4NXNQ 1G51A 1VQJA 2I5MX 2NN6G 2JA7H 4OO1G 1QUQB 4NPSA 2I0QA 1IBML 1N34Q 5IY0A 4BBSH 5IP9H 3I2ZA 2UU9Q 2JA8H 4X65Q 4B3TL 1PH9A 1X3FA 2I5HA 4IOCA 1EQQA 1M90C 3HOXG 4LFBQ 2OCEA 2Q2IA 4YCWA 1PYBA 4OO1I 2HHHL 1N32L 1I3QH 2CQOA 3TREA 3CW2C 5M5WH 5C3EG 1TWGH 1EUJA 5C0XJ 1G291 3T1YL 2XGTA 4LF4L 4IPGA 4UP8A 1HZ9A 2PMZE 1JMCA 2JEBI 1S3OA 4DV0Q 2RHQB 3RLOA 2R92H 3KDFB 4JI2Q 4MNOA 4C3JH 1LM0A 5IYDG 3K7UC 3OW2A 3RNUA 1A62A 1X3EA 1Y1VH 1ASYA 4B3ML 4LNQA 3KYHC 3J80c 3PUYA 3U50C 2UUCL 2UXBQ 1SROA 5HY6A 1IYJB 1YJWA 1MJCA 1PVOA 1SLJA 4IOAA 3AFQA 4P72A 3J80i 3CCVA 2OTLA 4MTNA 1VQ7A 3G4SA 4P74A 2Q2HA 2ZTCA 4O0AA 4YWMA 1BVSA 4JI1L 3KF6A 4YCUA 4X66L 4A3JG 1M1KC 4KHZA 3HOXH 1U5KA 2L15A 5LMNQ 2I5LX 4A3DG 5GQOA 5C0XG 1E3PA 3DLLA 2E2JH 5C3EH 4DUYL 1I94Q 4ALPA 3E9HA 4LUOA 4LUVA 3NELA 4NB3A 4R4TA 3M85A 2IX0A 2HT1A 1K8AC 2HIVA 1MJEA 4DR2Q 1E1OA 1KAWA 5IP7G 2Z6KC 5C0XI 4HJ9A 1Q86C 4BA2I 5IYDH 5IYCG 5ELOA 1K0RA 3ULPA 1YZ6A 4J15A 4LF6Q 3GD7A 4X62L 3ULJA 1YBYA 2AWNA 4DV6Q 2JA5G 1VQ6A 1PH8A 1IBMQ 3W5OA 2R93G 1L1OB 3GDEA 1IL2A 1K73C 1XPUA 2OTJA 4GN5A 2D0PA 1VQCA 4AQYQ 3EBEA 1VCIA 5IE8A 3GTKH 5DLQE 2VNUD 2JA6G 1XMQQ 3M4QA 4A3JH 2YYZA 2HHHQ 4DR6L 1N32Q 1OXUA 2PQAA 5M5XH 2E5LL 3W1GA 3T1YQ 4A3DH 2VW9A 2RCNA 4PMWA 5IWAL 4DV1L 1X9NA 1ASZA 3PO3G 1YI2A 4BXXG 1VQKA 1QVCA 2EIFA 4JC0A 4R1JA 2KCTA 1X54A 3L0OA 5IP7H 1SN8A 1JB7A 3KLWA 4GOPA 4GLVB 1IBLL 4R4OA 1J5EL 4B3MQ 3PF4A 4JYAL 3K7AH 1UE6A 4YY3L 4HIKA 1XPOA 4JI4L 3RLNA 5GAHC 3KJOA 4NXML 3PIPA 2JA5H 1N33L 4DV5L 3B6YA 2VUMG 2R93H 2CKZB 1X3GA 3F2CA 2K5HA 4GNXC 2KCMA 1UE5A 3T1HL 2ZM6L 1KXLA 1XPRA 5FLMG 2GVBA 2JA6H 4A3CG 2QA4A 1WCMG 2MO0A 1FGUA 3W1BA 1YIJA 1PH1A 3CC2A 2ZTEA 2LXKA 5M3MG 3JAMc 4DUYQ 3J7ZC 1E24A 3TS0A 4A3IG 5EAYA 2YTXA 4JBJA 4GLAC 4GNXB 1L0WA 3PO3H 3JAMi 5BR8Q 4BXXH 2R7DA 1K83H 3S1QH 3M3YH 4C3HH 1FJGL 4JI5L 4DV4L 2IHEA 3OYYA 1K3RA 3I4MG 1GO3E 1VQLA 1XNQQ 2UXCL 3GTJH 4X62Q 1WFQA 2HIXA 4O2DA 3ULLA 1VQ4A 1QZGA 2ZJPA 3GO5A 3I4NG 4YWLA 4JI0Q 4EX5A 2VUMH 2YTVA 2Z0SA 5E7NA 3RZDH 2VQFL 2F4VQ 1V9PA 2EXDA 3SGIA 4LW1A 5FLMH 1C7YA 2E5LQ 4A3CH 4JV5L 2PNHA 2ZTDA 4DV2L 1Q81C 1BKBA 5M3MH 4DR5L 3AYHB 4IPCA 5LMUL 1QZHA 3CCLA 1SMXA 5IWAQ 4A3IH 1KD1C 4P75A 2IX1A 3M9BA 1HR0W 1UE1A 4JI8Q 1CSPA 3J7A5 1CKNA 3EN2A 3HOZG 3PUWA 2K50A 2JE6I 3HOYH 4B3RL 2Q2TA 5M5YH 4HIMA 2NN6I 3CCMA 3UDGA 2R7FA 3FKIG 1IBLQ 2NVQH 3KF8B 2K4KA 1IZ6A 4GKJL 4JI4Q 2AKWB 3I4MH 1NE3A 5C4XG 1KRSA 4NXMQ 4LF7L 1N33Q 4DV5Q 1YHBA 1WYDA 4AYBE 3I7FA 2ZJQA 3KF6B 4JBKA 3I4NH 3HOUG 2KHIA 3I55A 3TRZA 4PG3A 3T1HQ 1PFSA 1XNRQ 4A3EG 3S1RH 3KJPA 1OTCA 4JOIA 1G6PA 4OX9Q 2R6GA 1K8GA 4LF9L 3PIOA 3A5ZB 4YWKA
chains in the Genus database with same CATH superfamily
3Q6SA 1B3AA 1Q7YC 3G6EA 3STBC 2KEEA 2X6LA 5CR3A 1MD2D 5T1IA 4KN4C 4E6IA 5C4ZA 2O5IC 3I3CA 1QUQA 4IZ8A 3RN2A 1J6QA 4G57A 1A15A 4WRDA 1WTPA 2E74C 2DY7A 2IJ0A 3Q24A 1ET9A 4LUZA 5IYBG 1VQ8A 2CWPA 1TIID 3BVMA 2WB1G 4PZ7A 4DGZA 1STGA 4DV7L 2R7ZH 1XJVA 4A3GH 2WACA 4Y7NH 1BO0A 1HH2P 3STBD 5C3XA 2IT1A 3T13A 3VR3A 4GKJQ 3AQQA 3GTOH 4LF4Q 2KCCA 1TWHH 4FF2A 2WIIB 3R3OA 3WDNA 1PTOC 2XTIA 5JJKA 1TWAH 4IUPA 1CQVA 4DR1L 4UY8C 5D65A 1JCKB 1STEA 4DK1A 2OQ0A 1HR0L 1PTOB 4ODGA 2EXZA 1WJJA 4KMUC 5FKAC 3BJUA 2XWJB 3H09A 1VQIA 2PNRC 1D1IA 3FDTA 3MXPA 4LJZC 4JI1Q 3HOXB 4DA2A 1SYCA 4DNTB 4ILWA 5JJIA 4BA1I 5EGTA 1CA5A 5C3EB 3S16H 2UU9L 4A93H 4B9WA 2CVRA 3HKSA 4IPHA 4LFBL 2I07B 1MSGA 1X6OA 2VQEQ 4B08A 1GKHA 3R93A 2YU9H 4PMCA 1PTOD 1UEBA 2OWOA 2EYMA 4LMQD 1Y8PB 4A3MG 4KY7A 2B8GA 1QNKA 2F0QA 2C35B 4UP9A 4JCVE 4JI2L 4K2KA 4K0KL 1EEID 2XRSD 1STBA 3A8IE 5FJ8G 2EOTA 3DWPA 4N8X1 4H02A 1SNPA 4HJ5A 2K5VA 4QCLA 1VDZA 5FO9B 1ZXTA 4DAMA 1O78A 3A55A 1KL9A 3J81E 3HOVG 2NB0A 1LTGD 1S40A 1VQ9A 5DAUA 3PO2G 4RH6A 1HNXQ 1GUOA 3KFUA 3BZCA 5ELCA 2PO4A 1OXSC 1JWSD 3ERSX 3RUZA 2XIWA 3S24A 4FXDA 3UE0A 5TSSA 3W2DA 2F0VA 3N52A 4DV6L 1E2ZA 1L2FA 2G5DA 2F0IA 1UAPA 2ZJRA 3OMCA 2P5ZX 4OIJA 3F2DA 4AQYL 1T9HA 3PO3B 4DNIA 1XMQL 2X6GA 4LWCA 3H15A 3CC7A 1EYGA 1PMRA 5EQ0A 1ILPA 5J22A 3CHBD 3H3VI 3GTJB 1Z6HA 1SRUA 5ELBA 5A2QE 4XIGS 1AEXA 5J3BA 4X64L 4OIKA 4JG2A 4RGMA 1AE3A 1S5DD 3RZDB 3PSIA 2EVBA 2JJQA 2PQAB 4X6AH 1HZAA 3FEWX 1KIXA 5M3MB 2DUDA 2KENA 3MHBA 4K5VA 2DY8A 2FHTA 3U4ZA 5FLXL 4QJFA 5C5LA 4JI3L 4OHJA 3K80C 1KABA 1S4ZA 4A3BH 3H3VH 4YHHL 2IW3A 3HOYB 4B3RQ 2NVQB 4C2MH 2F0TA 1GUWA 1E7ZA 4DV3L 1L1OC 4KD3A 4RHRA 5FK9C 2A19A 1EIFA 1Q90A 5AJ3Q 5GAEC 3G71A 4LF7Q 3FP9A 2K14A 1XNQL 1SYGA 2F0MA 5C3WA 4LF5L 4KHPQ 1RIPA 4JPBW 4KKUA 4LFCL 2H4OA 2VB3X 3L7ZC 3J7AF 1P16A 1FNUA 3NQIA 3D6CA 1NJIC 1TXYA 1S72A 1DYQA 3OTOQ 5GAGC 4C3IG 4M8AA 2Z4HA 4WJ4A 1TR5A 1R9TB 3U58A 4ZYSA 1D7QA 4TVAB 1LACA 4KK7A 3L9AX 2RHSB 1KHIA 5C4XB 1OXTA 2NZHA 5ELNA 4F7XA 1Z9FA 2A6HD 4P71A 4G7OC 2KA7A 2DGYA 4A3EB 1IXRA 5CGKA 3GTMH 1HHVA 1BOSA 1UUPA 4KJNA 5FOBB 4BBRG 1XNRL 1XWEA 5JEAJ 2G9DA 2BOSA 2LSSA 3NP8A 2JA7G 3BZKA 3KBXA 2IY5B 4EQOA 3PCOB 4IUNA 5IP9G 5DM63 4DR4L 2JA8G 3SK8A 1V8QA 1GUTA 5D14A 4CKCA 4I65A 4KN7C 2B63H 3S15H 2M00A 1CKMA 2A69C 1MKHA 3CAMA 1LYLA 3PUZA 2NUCA 5IGDA 1JE5A 1H95A 2R92G 3M4YA 2VY3A 3PUVA 4O42A 2JA5B 2B29A 4POFA 2F0NA 3D3RA 5G3LD 4L6TB 2WKDA 3NENA 2EYLA 1VQJA 3HGBA 2G9HD 4X3UA 4ABNA 3T53B 3URYA 2MHVA 4B3TL 1F2ZA 1DM0B 4IOCA 1JWUD 3CQZB 1QNUA 1I3QH 3A54A 1WTOA 1KDCA 3J81L 1EY7A 4IPGA 4K5XA 2B2VC 2JEBI 1S3OA 1LTRD 4DV0Q 1QJOA 4C3JH 3S1NB 4MNOA 1QE6A 4K8JA 2C5CA 5JEAH 1EY8A 4B3ML 3IFDA 5CV4A 3OIPA 3D6WA 1PVOA 1MJCA 2NN6H 1A6XA 1WCMB 2Q2HA 4O0AA 4WJWA 3KF6A 4A3JG 4FNFA 2L15A 4A3DG 1E3PA 1I94Q 4ALPA 4FXGC 4G7ZC 4NB3A 4RAUC 1O7LA 1MJEA 1DOLA 1PRTC 1E1OA 2Z6KC 3X3NA 3MA2B 4BA2I 5IYDH 1JORA 5ELOA 3BYTB 1WTVA 2AWNA 2D0PA 5JAVA 3NUCA 2VNUD 3TZDA 3M4QA 4F88A 4DR6L 4LAAA 1FYCA 2PQAA 5M5XH 2D2CC 2F1MA 2KHSA 2RCNA 3OWFA 4DV1L 3S2DB 2EJMA 4C3HG 4G7HC 4JC0A 1YNJC 3VYTA 1X54A 1SN8A 2CH4W 2BE5D 3PF4A 1J5EL 4HIKA 1SE4A 4X3KA 5HGTA 5FO8B 3NK9A 1TWCB 3PIPA 2JA5H 1X3GA 2K5HA 1F2LA 2KCMA 2ZM6L 2K1BA 1LO5D 3CC2A 3OWEB 1E24A 1XTCD 4GLAC 2RKSA 5BN5A 3JAMi 4BXXH 2R7DA 2F0LA 3I90A 3M3YH 1FJGL 4MIUA 4TSSA 4DAPA 3I4MG 1G8ZD 2UXCL 4X62Q 1EY0A 5C44B 2EJFC 3I4NG 4YWLA 4JI0Q 1GOZA 2Z0SA 2EY5A 3I72A 2VQFL 4LW1A 3DEOA 5LL6X 4JV5L 2ZTDA 1XXGA 2L12A 1BKBA 1TWFB 1QZHA 2MP1A 1SMXA 4A3IH 1KD1C 4P75A 1SE2A 4JI8Q 1CSPA 1CKNA 3PUWA 1LT3D 2JE6I 4WFN3 5M5YH 3CCMA 1QOHA 3S14B 1U9RA 2K4KA 4EVOA 4G4KA 2AKWB 2A6EC 1KRSA 1IW7C 1CK1A 4DV5Q 2K32A 4A3FB 4AYBE 2ZXPA 4JBKA 2IL8A 2KHIA 2H1EA 4OX9Q 3GD7A 3E5SA 1A3TA 5A35A 4A3KB 1A0IA 1M8AA 3D8GA 1ENCA 3A0JA 2R7ZG 1BNZA 2K04A 4A3GG 2NVYB 1F9QA 3F8TA 4QMGA 1V1QA 4HCEA 3HOZH 1KAAA 2PQEA 4FF1A 4JI7L 1SAPA 4DAYB 2RVLA 4IPDA 1XMOQ 4XTCS 1YNNC 5EPLA 3HFZB 3V96A 5JJLA 3CMEA 4UHVA 2ASBA 2LXJA 3L2PA 3GV3A 1IW7D 2UUAL 5K5PA 4GKKL 3S1MB 1TWCH 1VQFA 3H0GB 1FVIA 4GS3A 4UPAA 1W3SA 4YCVA 4BBSB 1YEZA 1AFPA 2D0OA 1VQPA 1STHA 3NBHB 4MZ9A 5FLXc 1Y1WG 3BVZA 2EJGC 3EA6A 1EIYB 2ATWA 2B2VA 2EQSA 5KEEA 3HOWH 1LTLA 4A93G 2PW7A 3O13A 4K2LA 4N9TA 4HCSA 4OELB 4HTHA 1HJPA 2Y0SB 3PMFA 5JVH3 1JJCB 3M4PA 1GM5A 3CD6A 1YNND 4L5TA 1WVLA 1NTGA 3Q23A 1Y1VB 3MTSA 4B3SL 2KJXA 4QF4A 2ID0A 1YJ9A 2NVTH 4LF9Q 4KTAA 3CCUA 2UUCQ 2Y0SE 1TS5A 2AHOB 3PF5A 1QG7A 4DR3L 3K58A 3SE0A 1PH5A 2FMMA 3VYUA 1VQGA 1NY4A 3VDYA 3D31A 1EEFD 1XTDA 3T4AC 3DHQA 2Z6KA 4C1NK 2QKIC 2OEOA 3G7LA 2A8VA 1K8OA 4KKSA 1VQMA 2WAQE 1SYBA 2VL6A 1VQAA 5KYLA 1K28A 2L55A 3CP0A 1BCPF 2F3WA 3GTGH 1HQRD 5GROA 3CCJA 3GTKB 2FJ2A 1NBWA 4U673 1N9WA 1U0LA 2B2YC 1BBUA 5CV5A 2J4XA 1GJXA 1NR4A 2B2TC 3DXJC 4IJLA 1IYUA 5EKIA 4LF8L 2Z8LA 1TQOA 4OL7A 3I4OA 1WTRA 3CMAA 2F03A 2KHJA 4DR1Q 2N88A 1SDFA 1I4XA 2OF1A 1PH2A 3KLRA 2JQOA 3K7AB 3FHWA 4DUZL 1HR0Q 5IODA 4YY3Q 1PV4A 4CJ0B 4OEMB 3TEHB 4BY1H 1YNXA 4LF6L 5CBAE 3S1MH 2JA6B 1A8VA 3H0GH 3VYRA 4ID6A 2IWHA 3WOEA 2QW7A 5I6WA 1SYFA 3S2HB 1QVGA 3E0JA 1ZEQX 4KLKA 2NVXH 2N8NA 4A3BG 1FNWA 1JJ2A 5IIFA 4Q0FA 1JT8A 1HTLD 3A7AB 1PXUA 3C46A 1VQNA 3NQTA 3RZOH 2R3ZA 3J81c 1JWMD 1NSNS 1I4PA 4ZUIA 4K0KQ 1VQDA 1MI2A 2VUMB 1IKLA 2K5DA 1STNA 3MWYW 4CDCC 4P73A 3R8BA 3CCEA 3OW7A 1VMPA 1TS4A 1KTKA 1PRTF 4PZ8A 1KC8C 4GN4B 1B9NA 3TP8A 3ONAB 4BY7H 1K8MA 2ICEC 3A5UA 4WORA 2YTYA 1AE2A 4FF3A 3SEBA 1CQFA 4HJ7A 1TWGB 2OQKA 5BR8L 3N6RA 3I8ZA 2CW0C 4K8IA 5I2XA 3V2TA 4R4CA 3S1RB 4DAYA 5M3FH 2K5QA 1V1OA 1VQ5A 3CCQA 2F0FA 3V05A 2BH2A 4V190 4A3LH 1E1TA 3G6JB 4FXKC 2F4VL 4JI6L 2AQ2B 2MQHA 4FO2A 1NUCA 1M4VA 5LHY1 1N8RC 1NCVA 1Y1WH 5I4DA 4KI0A 1MIUA 1N34L 2WKCA 1UWVA 1SSOA 2D5DA 3BG3A 3NWSA 2B63G 5C4JB 3NBHA 2GA4B 4X64Q 1I50H 2J7ZA 3E3XA 1EZ8A 1HNZQ 3HOUB 5ELDA 4QB4A 3K0YA 1SFOH 2CCZA 2N78A 3CPFA 4CJ2C 2F3IA 1XYIA 3PUXA 3CU7A 3HKZG 4JI3Q 1QB5D 4YHHQ 1EWHA 1DJRD 3IFTA 4UDUC 2K5NA 3GTPB 3S2HH 4IURA 3RR5A 1ICFB 4HN7A 1H9SB 3K0XA 3ND8A 1D2BA 4QUFA 4DV3Q 3CCRA 3HOYG 1HFGA 1H9KA 4HIOA 5LMNL 4XQQA 2BH8A 2D62A 5E4XA 1I6HB 2WB1B 3K81C 2F0HA 1YHAA 4NW2A 2E2DC 4OWWB 4CBVA 4LF5Q 1CT1D 5COYA 1GHKA 3D0FA 4C3JG 4LFCQ 4DR2L 3U9SA 2R93B 5JEAG 2H5XA 1AN8A 2B2WC 4UP7A 1O7YA 2WB1E 1OXXK 1IKMA 3MEHA 2I5MX 2NN6G 5CC4A 2I0QA 1IBML 2ICIA 4J8QA 4X65Q 1PH9A 2B8FA 2KQ3A 2OCEA 3EFXD 1PYBA 1JOOA 4OO1I 2HHHL 4NKLA 3TREA 3CW2C 1TWGH 4C56C 5C0XJ 3T1YL 1G291 4LF4L 2QDLA 5K36H 5BN3A 2B2YA 3RLOA 3KDFB 1HUMA 1LM0A 3K7UC 5IYDG 1SJHD 1X3EA 5I2YA 3KYHC 3PUYA 3U50C 1SROA 5HY6A 1YJWA 1PTOH 4OO1H 4IOAA 3AFQA 3J80i 2K33A 3CCVA 1HCZA 4MTNA 1VQ7A 4P74A 3NXWA 4YWMA 1BVSA 4JI1L 3QJYA 2NZ1D 3HOXH 4C1NI 1S5ED 1RTOA 2B2UC 1FNVA 5C3EH 4DUYL 1CA6A 1J9OA 4HR7B 4A3MB 2HT1A 3R2TA 1K8AC 2HIVA 2MUYA 4ZQ3A 5C0XI 1Q86C 1RDPD 1K0RA 3ULPA 4HAEA 3VR5A 3U9OA 4IUTA 3C2PA 1G91A 3ULJA 2JA5G 1VQ6A 2WV6D 2QILA 1L1OB 1IL2A 1K73C 1GHJA 1ML0D 3JAME 1VQCA 5IE8A 2HQEA 2ZXOA 2XRQD 3HOVB 3BVGA 2YYZA 2CQAA 1OXUA 4XYQA 2E5LL 3PO2B 2RCFA 2XN9C 5M9OA 3M4OB 2F0GA 5C0XH 4F87A 5IGEA 1EU4A 5IWAL 1ASZA 4BXXG 3VYSA 5ISRA 1VQKA 3DWAA 4XDXA 1QVCA 2EIFA 3OOCA 4ME5A 4V0BA 5IP7H 2O2LD 3KLWA 3T16A 1IBLL 4B3MQ 2NTSA 2HCIA 1LT6D 1XPOA 2L9HA 3RLNA 3TP7A 2E2HB 3HG9A 5GAHC 4NXML 1C48A 3PIO3 2R93H 3A7LA 5DM73 2CKZB 3GQBA 4GNXC 3S17B 1UE5A 3T1HL 1XPRA 3NHHA 2RDFA 1WCMG 3W1BA 1FGUA 1EWCA 1YIJA 1D1KA 2LXKA 1STYA 3TS0A 1II3A 4FVMA 4A3IG 1VF5C 2YTXA 4GNXB 1L0WA 3PO3H 2EY2A 1GUSA 3OSOA 1EQTA 3OMGA 2IHEA 1BCPC 2M9VA 3TZUA 3GTJH 3KLSA 4XT1B 1A2UA 5KNDA 1QZGA 5IOCA 2IPKD 4EX5A 2YTVA 1BCPB 1HUNA 3RZDH 4A3CH 1ILQA 3GTQB 1PZJD 3GP7A 1G6ZA 5M3MH 5LMUL 4B9XA 1TT2A 2IX1A 2E2IB 1S5BD 1HR0W 3HOZG 3EN2A 1BF4A 4B3RL 1VF7A 3HOYH 4HIMA 2IX3A 2NN6I 2NVQH 1H9SA 2FFKB 3RD4A 1BXTA 2R61A 4LF7L 4IUVA 1LV9A 1WD0A 2A69D 4PG3A 1AZPA 1A2TA 1VMCA 1OTCA 3HZXA 5JJZA 3PIOA 3A5ZB 4C3IB 2HDLA 3U4VA 3AMUA 1C0AA 1X55A 3BU2A 3E0EA 3C3LA 3LWEA 4CKBA 4CGYB 2N3SA 2NWGA 1K0SA 3BYYB 2IHFA 2WFWA 1FJGQ 3HOWG 4S3SA 3M4OH 1AP0A 2ZT9C 4R4QA 1R9TH 2PCFB 3EVQA 3FPUB 1TKWB 1GD7A 4QIWB 2B2WA 5C4XH 5JPMC 5I6YA 2UXDL 4IFDI 3I4LA 4BBRB 3PQIA 3HRZC 4N9PA 3QG1A 2F0DA 4HIDA 4QQBX 1SNOA 4A3EH 4POGA 2KEDA 2JK8A 2JA7B 4QIWE 3K5NA 1C8CA 1IBKL 3P7JA 5EKKA 5F2DA 2JA8B 1PRTB 1SYEA 3S17H 4DU9A 2VZAA 3CCSA 4EGVA 1J8IA 1HTPA 3SK6A 5M5WB 1YVCA 1I4RA 2RSNA 1SE8A 4HEDA 4EQ5A 2EYOA 3IAYA 4APVA 4IFDH 3C1FA 2XNAC 3QO2A 4AYBG 1B53A 1MGSA 2R92B 1RKNA 5CYUA 1LTID 2QCPX 2K01A 1CFMA 2K05A 1PRTD 2SEBD 4DAVA 2MO1A 1Q1BA 2B39A 1W2BA 2K52A 3CXCA 2B2UA 4X66Q 3CRKC 3OPOA 3JAML 5EKLA 3IKJA 1IHZA 1YJNA 1UE7A 4OWTB 1L1OA 4M1UB 1WOCA 2BA0A 3JC66 5J1ZA 2PYKA 1EFID 4OONA 5FO7B 3CQZH 3OIQA 1VQHA 1RCVD 4TKOB 3F2UA 5JOBA 1Q1EA 1QVFA 1I4GA 2GVAA 1PYSB 3R2IA 4GKKQ 1KDBA 2OT2A 4DV0L 4ZUJA 1YNJD 4DPGA 4BY1G 4KV6A 3P20A 1B70B 3S1NH 1S5CD 4RFBA 1X3QA 4A3JB 3H0GG 4JBWA 1Q12A 4I7ZC 4KHVA 4L5QA 2VB2X 4A3DB 4JOIC 2AMCB 1GXDC 1WCMH 2JSOA 4R4IA 3NEMA 1EZ6A 1DOKA 2HQLA 3ER0A 2ZXRA 1S5FD 1EIHA 2A68C 5D3IB 3KOJA 4K6DA 4Q5VA 4B3SQ 1NR2A 1I94L 5L37A 2VXWA 4JYAQ 1H9JA 4GNXA 4FF4A 2FINB 4DR3Q 1JOKA 1VS0A 1MBYA 2RQXA 2KCNA 3MFGA 4JK1C 5E4WC 3I56A 2UUBL 3DM3A 1R4PB 1PZID 4QGUA 4BY7G 1A63A 2QEXA 1K83B 1N36L 2WAQG 2L4NA 3WOFA 4C3HB 1RODA 1K9MC 4DV4Q 1EQRA 4JI5Q 5I9PA 2E8GA 2A68D 4DKAC 2EYFA 3S2DH 3CKIB 2Q8TA 5E1FA 2DJFC 2CHBD 5C5MA 5IT9E 4TQUS 1HNWL 2A6ED 2ALYB 3UI2A 5M3FG 1JICA 4RCOA 1GUNA 4LFAL 4A3LG 2QDBA 4DV2Q 5CV8A 4DR5Q 4CDEC 4LF8Q 1KDAA 2A1AA 1EY9A 1A3VA 2NZOA 1FL0A 1HZCA 4DUZQ 3I4MB 4IQZA 4MTKA 2E75C 2AWOA 4H7BA 4PZ6A 3QOLA 1SJED 1HZBA 1HA6A 3I4NB 1XX8A 2L5TA 3SDZA 4JW0A 4DR7L 4RCNA 3UDXA 5C44H 2JP1A 4JI0L 1CKOA 1VQBA 3SVMA 4MHEA 4RG1A 2EE1A 4RGOS 5BN4A 4KY5A 2MNAA 3RLFA 1Y14B 4NXNL 2EDGA 2PW5A 1TWFH 2E2JB 3KBGA 4FDBA 4JI8L 3ITPA 4R8IA 2A74C 3S14H 3MXNB 4RMFA 1RHPA 2KBNA 1SR3A 3F1ZA 3NTIA 1QCBD 2R7ZB 4A3FH 4DV7Q 4A3GB 1I5FA 3KLSX 3HEJA 2Q2UA 5G3LF 3MVVA 1UEAB 3UDIA 4OX9L 2UXBL 1YITA 4XYOA 4RKLA 2E76C 4A3KH 4DFAA 3LGJA 1SNMA 3GTOB 1EWIA 1IYVA 1GVPA 2BDOA 2NVYH 3D4DA 1DGSA 5ELEA 1EY6A 1I6VC 1STAA 3CPWA 3ICEA 1E2VA 4OGQC 1TWAB 4K5WA 4JBMA 3E9IA 1X32A 5K36G 1XMOL 3NWTA 2SNSA 4K14A 3SHLA 4A75A 3J80E 1QILA 3ND9A 3TN2A 1BDOA 2A73B 3BDCA 2N55A 3WWVA 1PH7A 4JI6Q 1JQYD 3UE1A 1G51A 4OO1G 4NPSA 3S16B 4A93B 1N34Q 5IY0A 4BBSH 2UU9Q 2PMZB 1FR3A 1EQQA 1M90C 4LFBQ 3HOXG 1MHWC 2Q2IA 4BWGB 2BCOA 2YU9B 1N32L 5C3EG 3J7AV 5DNFA 1LTAD 1I4HA 3I73A 1F2YA 3AB9A 4X3TA 4PMBA 2PMZE 2X69A 5IGFA 1V1PB 4IALA 4JI2Q 1TU2B 3H94A 1Y1VH 2UUCL 5EBCA 1HFNA 4XXEA 2RDGA 1SLJA 4P72A 2OTLA 3G4SA 1B9MA 5CV7A 1TS2A 4LK1C 4YCUA 2V4DA 4RGTA 5LMNQ 3BZDB 1B4OA 2K5WA 5C0XG 3EROA 2E2JH 3DLLA 2BDNA 1C4QA 1KNAA 3E9HA 4LUOA 4LUVA 1T5XD 1A3UA 4DR2Q 4KJOA 5IP7G 2LKVA 5IYCG 2MGSA 4IUUA 1LTTD 1YBYA 4DV6Q 2R93G 5IT9L 3OHXC 1PH8A 3W5OA 1IBMQ 3GDEA 1XPUA 4GN5A 4AQYQ 4RGNA 1VCIA 3GTKH 1PZKD 5DLQE 1XMQQ 2HHHQ 3W1GA 3T1YQ 1Y8NB 1ESRA 3K5LA 3FKIB 3PO3G 1X9NA 1YI2A 2Z6BA 3D4WA 5KNCA 4IUQA 1OO9B 4R1JA 4DK0A 3FMCA 2CW0D 3H3VC 3K7AH 1SEBD 4YY3L 4P2CB 2F0EA 1PFNA 4JI4L 1CM9A 1NAPA 4FYDA 3C1EA 1U4MA 1N33L 3B6YA 4KKTA 3F2CA 5T1GA 1Q8IA 2L1BA 4A3BB 1KXLA 4A3CG 2GVBA 2JA6H 2MO0A 5J39A 1PH1A 1E2WA 2ZTEA 5M3MG 4C2MB 3JAMc 4DUYQ 1BQQT 5EAYA 2EZVA 5EPKA 4KY6A 1CHQD 2Q8IB 1PFBA 1D5XC 4CKEA 1VQLA 1XNQQ 1TS3A 4XT3B 2HIXA 1IL8A 2Z1CA 1VQ4A 3EQLC 2ZJPA 3FVQA 2EY1A 3GO5A 2VUMH 2AUKA 5KIXA 2F0KA 3AU7A 4DXFA 1V9PA 2EXDA 3MXNA 5FLMH 2E5LQ 4DF7A 2PNHA 3GTLB 3CCLA 4IPCA 5IWAQ 3BDOA 3QR8A 4XQNA 3J7A5 4RHSA 2K50A 3NPPA 2Q2TA 1IBLQ 5JPNC 2R7FA 3KF8B 1IZ6A 1TY2A 4GKJL 3T51B 1HA5A 3GTMB 1NE3A 5C4XG 2KOLA 5EPJA 4NXMQ 3A8KE 2PZTA 1YHBA 5KRUA 2LMCB 1SBBB 3KF6B 2KVMA 3J80L 3TRZA 3T1HQ 1PFSA 2JN4A 2CH4A 1XNRQ 4A3EG 3S1RH 2R6GA 2HD3A 1K8GA 2A5HA 2B2TA 1EYDA 2F0UA 1BBWA 1VQEA 2DJGC 2RDHA 2XSCA 3CF5A 3SXHA 4DR4Q 2HDMA 3VR4A 1EL0A 4DN4M 2B63B 3KUPA 3S15B 1JJGA 4IFDG 2CFMA 2DNCA 4PV1C 1FD7D 2MPMA 1LT5D 3FKIH 4QY7A 3TP5A 2VS1A 1B3QA 4AH6A 3TBIB 4L8JA 2L11A 5C4JH 4NDXA 1ENAA 2VQEL 3LX0A 1JB3A 1HNZL 1DZ1A 3HKZB 1Z47A 3HOUH 4QL5A 2ES2A 4RA8A 5DEHA 1PHJA 2WINB 1F2MA 1O7IA 1V1PA 5LMUQ 4GLXA 3LNNA 2PI2E 3M7NA 3BDLA 1CTMA 3HKZE 2JXMB 4B3TQ 4OWXB 3J81j 3F2BA 5H1SE 1PH6A 3GTPH 1I3QB 2F0WA 4AIMA 1B7YB 2BA1A 2V1CC 2A6HC 1AZQA 1KQSA 5I9OA 3Q8DA 5GADC 2PPBC 2QEJC 2RBMA 3FRPB 2K03A 4NMZA 2M2LA 4C3JB 2O4XA 2JEAI 5IYBH 1EIGA 3UDFA 1HNXL 1I6HH 1PDQA 1V43A 5IYCH 3E6ZX 3Q0AA 3TS2A 2NTTA 3MFYA 2PZUA 2TMPA 1WI5A 3ZYYX 2MFIA 3HS0C 3IRBA 4EQNA 3S9WA 2O5JC 4HJAA 4DNRB 2HUGA 1JR0D 3M7GA 1W6JA 4RKBA 2N49A 3GTLH 2F0OA 1O80A 4L5SA 5CBEE 4X65L 1WD1A 1Q82C 2F0JA 4ZKCB 1ET6A 5D3DA 3A56A 4F8MA 4DK6C 3SR1A 2UXDQ 3W3AA 1ESFA 3EIVA 2L0CA 4DK3C 2RF4A 3NTHA 3TP6A 2SOBA 1CI3M 3BS1A 1Z7TA 1IBKQ 2NBFA 1HQMC 2F0SA 3G48A 1X65A 3A74A 1PFMA 1CKNB 5KNBA 1EFWA 3IL8A 4Y52H 4Z9CB 5M5XB 4DR6Q 4MN3A 1CUKA 1L0XB 1I4QA 5LL6S 1HXYD 3KK7A 3VA5A 3K57A 2JYOA 4DV1Q 1E22A 4CHTB 3CC4A 3K59A 2QGQA 5JVG3 4IN3A 4L5RC 4IFDJ 1J5EQ 2XVSA 4A3MH 1GUGA 5EBDA 3DEPA 3TDQA 1FGBD 1PH3A 1BCPD 5AJ3L 1B1ZA 2HCCA 5FJ8H 1NMFA 1F77A 1EYAA 4QUCA 1Q46A 1B2TA 4ZLTF 2ZM6Q 2DNEA 4KHPL 3DMUA 2F3VA 4IJHA 3DUZA 3VR2A 1X56A 2KUMA 1B44D 2MJ8A 2K6AA 3M3YB 3HOVH 3OTOL 4GN3B 1BUVT 3PO2H 1WTWA 1EYCA 3LWUA 1DD2A 1YHQA 1RL2A 3MAQA 1EOVA 2UXCQ 3J81i 3PIP3 1E0BA 1BBXC 3PV0A 1VQOA 1MSHA 1F9SA 1PH4A 2EY6A 2LS01 3KF8A 2AUJD 2VQFQ 3QIAA 5C44G 2E2HH 1OXVA 4GOPC 4JV5Q 3AFPA 5HGQA 5LMNW 4A3IB 1EY4A 3D4RA 1B8AA 2K75A 2K28A 3KDFA 2GN5A 4I7AA 1AH9A 4NP5A 3NBIA 1PA6A 2KECA 1SNQA 1F9RA 1CSQA 5M5YB 4GOPB 2OXPA 2DN8A 2BE5C 3AEVA 4ZAIA 5NUCA 1O7ZA 1LTSD 3QB3A 1KRTA 5A2QL 1SMYC 4J1MA 1WTQA 1PTOF 4O1NA 1C9OA 3VA7A 1LUZA 1P8LA 1LT4D 2UUBQ 1EY5A 4A3FG 4WJ3M 2PI2A 5IT9c 4HJ8A 1D8LA 1H9RA 2TSSA 3ZJYC 1RF2D 1ONLA 1N36Q 4XQJA 3RN5A 1LABA 1CHPD 1X3PA 4A3KG 3HOZB 4H0LC 5EJWA 3H6MA 4X3SA 1NMGA 3GTQH 4PNYA 4JI7Q 4ZK9B 1T5EA 1JE4A 4A4IA 1U4PA 4OXPA 4U68A 1WTHA 3MC0B 2E2IH 1AW7A 5C4HA 3NE5B 2F52A 2AQ1B 2C9OA 1Y69U 1HNWQ 3K8AA 4J6HA 2FXQA 4N8FA 2UUAQ 2Z4IA 1SMYD 4LFAQ 1DONA 2YV5A 3ERQA 4L63B 4CDFC 4ME3A 2WP8J 4IO9A 4A76A 1KLUD 4C3IH 1G2TA 3HOWB 1CZGA 3NSWA 4HMJA 4CDDC 4EQPA 4BBSG 3CRLC 2JA9A 4R9WA 1F9PA 4ULLA 1Q8KA 2B3GA 3K5OA 4PQXA 4GZYC 3P1HA 3DM1A 2CWAA 3PGZA 3L3OC 1D5ZC 3MEFA 2NVTB 1PLFA 4HMIA 4DR7Q 1SE3A 2Y0SG 4H13C 2K7VA 1DCZA 4ZCKA 4BBRH 1Y1VG 3TMEA 5CORA 3X3MA 1SNCA 4YIJA 3TQYA 5KGUA 4NXNQ 5C6AA 2JA7H 1QUQB 1B50A 3QWNA 3NTKA 3HP3A 5IP9H 3I2ZA 2JA8H 2LY7A 4AYBB 4BS9A 1X3FA 2EYJA 2I5HA 4HSPA 4YCWA 3J7YW 2CQOA 3P75A 3S1QB 5IGBA 5M5WH 1EQVA 1EUJA 2XGTA 2I46A 3MZ5A 4UP8A 1H9MA 1HZ9A 1JMCA 1ZKOA 4ZRZA 2RHQB 2R92H 1QWYA 1Y8OB 2SNMA 5E3FA 3OW2A 3GTGB 3K6OA 4K6LA 3RNUA 1W6KA 1A62A 1ASYA 2UXBQ 4LNQA 1RJTA 3J80c 1IYJB 2SDFA 1SNDA 4FP5D 3T56B 1D5MC 2ZTCA 4X66L 1M1KC 4KHZA 1U5KA 2I5LX 5GQOA 1TY0A 3FPPA 3NELA 4R4TA 5IGGA 3M85A 2IX0A 1SXTA 5CMDA 1BR9A 1KAWA 1LTBD 4BY1B 1ZYRC 4HJ9A 1ENFA 1DXMA 4RWSC 1YZ6A 2RSOA 1K3BC 2F4IA 4J15A 4LF6Q 1EU3A 4KD4A 4DXGA 4X62L 3QOJA 2RA4A 1U4RA 2OTJA 2NVXB 3EBEA 1LLRD 2JA6G 1G2SA 4A3JH 3I70A 1N32Q 2LFNA 2NYZD 3RZOB 4A3DH 2VW9A 4PMWA 1UNSA 2EPBA 3Q22A 5IGCA 3SK5A 2KCTA 3L0OA 1JB7A 1RTNA 4GLVB 2EYPA 2Z9HA 3A8JE 1Q3LA 3DWQA 4R4OA 4GOPA 4JYAL 1ICWA 1UE6A 1ZYRD 3GV6A 3MXUA 3RMHA 3KJOA 3I91A 4DV5L 1D6EC 4H44C 2VUMG 1CZWA 3MXGA 4Y7NB 4BY7B 5FLMG 1JC7A 2WAQB 4JVZA 2QA4A 1RD9D 3J7ZC 1R4QB 4JBJA 2QF7A 1NNXA 1TWHB 5BR8Q 1K83H 4UAIA 5CV9A 3S1QH 4C3HH 1EOTA 4JI5L 2PZWA 3H91A 4DV4L 1TVXA 3OYYA 1L0YB 5HURA 1K3RA 1GO3E 5M3FB 1HPCA 5AFWA 1WFQA 2FMCA 4O2DA 3ULLA 1DOMA 3VR6A 1SYDA 2Q8RE 1KLGD 2EYHA 5E7NA 2F4VQ 3SGIA 1HRJA 1C7YA 3SK4A 5ELFA 4R8NA 4DV2L 1Q81C 1Y1WB 1U4LA 4DR5L 3AYHB 4HSVA 3M9BA 1UE1A 1JOQA 1I50B 4CJ1B 3K5MA 3UDGA 3FKIG 2AQ3B 1WTXA 1SFOB 4JI4Q 3I4MH 5KYIA 1N33Q 4ZKBB 1WYDA 1PYWD 1KNEA 3I7FA 3I4NH 2F0PA 2J0TD 3EJIA 2D9UA 3TSSA 3HOUG 3I55A 2XWBB 2ENBA 5CV6A 1G6PA 3KJPA 4JOIA 4TRDA 5FLXE 2ZJQA 4LF9L 4YWKA
chains in the Genus database with same CATH topology
1A0IA 3U4VA 1C0AA 3A0JA 1X55A 1BBWA 3BU2A 1VQEA 3E0EA 3G6EA 1Q7YC 2R7ZG 4A3GG 3STBC 3CF5A 3F8TA 4DR4Q 1V1QA 2N3SA 2IHFA 2WFWA 1FJGQ 3HOZH 1JJGA 3HOWG 3M4OH 4JI7L 4IFDG 2CFMA 1QUQA 4R4QA 1R9TH 3RN2A 3FKIH 4QY7A 1J6QA 4DAYB 4IPDA 2VS1A 1XMOQ 4XTCS 1GD7A 4AH6A 5C4XH 3HFZB 5C4JH 5JJLA 2VQEL 3CMEA 2UXDL 2ASBA 1HNZL 4IFDI 2LXJA 3L2PA 4LUZA 5IYBG 1Z47A 1VQ8A 4QL5A 2CWPA 2ES2A 2UUAL 2WB1G 4HIDA 3HOUH 4QQBX 4A3EH 4POGA 4GKKL 4PZ7A 2JK8A 1TWCH 1PHJA 1VQFA 4QIWE 1FVIA 4DV7L 4GS3A 4UPAA 1O7IA 1W3SA 4YCVA 5LMUQ 1IBKL 1YEZA 2R7ZH 4GLXA 1XJVA 2D0OA 2PI2E 3M7NA 3S17H 4Y7NH 1VQPA 4A3GH 3HKZE 4MZ9A 3NBHB 2VZAA 4OWXB 5FLXc 3J81j 3F2BA 1HH2P 3CCSA 4B3TQ 3STBD 1Y1WG 5H1SE 1PH6A 2ATWA 1EIYB 3GTPH 2EQSA 2IT1A 1YVCA 1LTLA 3HOWH 1SE8A 4EQ5A 4A93G 4APVA 4AIMA 1B7YB 2BA1A 2V1CC 3AQQA 3GTOH 4GKJQ 4LF4Q 1TWHH 4AYBG 1KQSA 3Q8DA 5GADC 1HJPA 2XTIA 5JJKA 1TWAH 1JJCB 3M4PA 1GM5A 3CD6A 4L5TA 4DR1L 2JEAI 4UY8C 1NTGA 5IYBH 4B3SL 3UDFA 1HNXL 2ID0A 1YJ9A 2NVTH 3TS2A 1V43A 2OQ0A 5IYCH 1HR0L 4LF9Q 1I6HH 3CCUA 2UUCQ 2MO1A 2Y0SE 1Q1BA 1WI5A 1WJJA 2AHOB 2K52A 3PF5A 3CXCA 3BJUA 2MFIA 4DR3L 1PH5A 3IRBA 1VQIA 1VQGA 4HJAA 4JI1Q 1NY4A 3VDYA 3D31A 4X66Q 1XTDA 5JJIA 2N49A 3GTLH 4BA1I 1YJNA 1UE7A 3S16H 2UU9L 4L5SA 4OWTB 1L1OA 4X65L 1Q82C 4A93H 1WOCA 2Z6KA 2BA0A 3HKSA 4IPHA 4LFBL 3JC66 2A8VA 4OONA 1X6OA 4DK6C 2VQEQ 3CQZH 1GKHA 1VQMA 2UXDQ 2YU9H 1VQHA 3EIVA 1UEBA 2WAQE 2OWOA 1Q1EA 4DK3C 1VQAA 2VL6A 4A3MG 2GVAA 2RF4A 1PYSB 1QVFA 4GKKQ 4DV0L 2C35B 4DPGA 4UP9A 3CP0A 4JCVE 1IBKQ 4JI2L 4K0KL 4BY1G 1B70B 3G48A 3GTGH 3S1NH 5FJ8G 1X65A 3A74A 5GROA 3CCJA 1CKNB 1NBWA 1N9WA 1U0LA 1EFWA 3H0GG 4JBWA 4H02A 1BBUA 4HJ5A 4Y52H 1Q12A 2K5VA 4DR6Q 1CUKA 4L5QA 4JOIC 2AMCB 1WCMH 4R4IA 3NEMA 4IJLA 4DAMA 1KL9A 2HQLA 4LF8L 3ER0A 4DV1Q 1E22A 3HOVG 3I4OA 3CMAA 3CC4A 1S40A 1VQ9A 2KHJA 4DR1Q 3PO2G 3KOJA 4B3SQ 2QGQA 1PH2A 2JQOA 1I94L 1HNXQ 3KFUA 4L5RC 3BZCA 3FHWA 4DUZL 1J5EQ 1HR0Q 4JYAQ 4IFDJ 4A3MH 4GNXA 1PV4A 1OXSC 4YY3Q 3ERSX 4DR3Q 1PH3A 5AJ3L 3TEHB 4BY1H 1VS0A 3S24A 5FJ8H 3UE0A 1YNXA 1NMFA 4LF6L 1Q46A 3S1MH 1A8VA 2ZM6Q 3H0GH 3I56A 4DV6L 1L2FA 4KHPL 2UUBL 3DM3A 2ZJRA 3F2DA 4AQYL 1QVGA 4KLKA 4IJHA 1X56A 2NVXH 1T9HA 2N8NA 4QGUA 4A3BG 4DNIA 4BY7G 1XMQL 4LWCA 1A63A 2QEXA 1JJ2A 1N36L 2WAQG 3H15A 3HOVH 3OTOL 3CC7A 1EYGA 1JT8A 4GN3B 1VQNA 1K9MC 4DV4Q 1EQRA 4JI5Q 3PO2H 3RZOH 1YHQA 1RL2A 3J81c 2E8GA 3H3VI 4DKAC 1SRUA 3S2DH 1EOVA 2UXCQ 4K0KQ 3J81i 4XIGS 5J3BA 1VQDA 3PV0A 4X64L 1VQOA 1PH4A 4JG2A 4TQUS 1HNWL 1AE3A 3PSIA 2ALYB 5M3FG 2JJQA 2PQAB 4P73A 2VQFQ 5C44G 1HZAA 3CCEA 2E2HH 4X6AH 4LFAL 1KIXA 4PZ8A 1OXVA 2DUDA 2KENA 4GOPC 1KC8C 3AFPA 5HGQA 5LMNW 4DV2Q 4A3LG 4JV5Q 4GN4B 3U4ZA 4DR5Q 4QJFA 1B8AA 2K75A 4JI3L 3K80C 2GN5A 3KDFA 4LF8Q 1AH9A 4A3BH 2A1AA 3H3VH 4BY7H 4YHHL 1PA6A 1CSQA 3A5UA 4B3RQ 4GOPB 2YTYA 1AE2A 2NZOA 4C2MH 1FL0A 4HJ7A 1HZCA 4DUZQ 3AEVA 2OQKA 5BR8L 1E7ZA 2AWOA 4DV3L 1L1OC 4PZ6A 2A19A 1EIFA 1HZBA 5AJ3Q 5GAEC 3G71A 1W2BA 4LF7Q 1KRTA 3FP9A 2K14A 4R4CA 1XNQL 1C9OA 5M3FH 1LUZA 1P8LA 1VQ5A 4DR7L 4LF5L 4KHPQ 2UUBQ 1RIPA 3CCQA 3UDXA 5C44H 4A3FG 4JI0L 2BH2A 1CKOA 4LFCL 4A3LH 1VQBA 2PI2A 5IT9c 4HJ8A 3L7ZC 1D8LA 4WJ3M 1E1TA 4RG1A 1P16A 3ZJYC 1NJIC 2F4VL 1N36Q 1TXYA 3RN5A 1S72A 2MNAA 2MQHA 3RLFA 5GAGC 3OTOQ 4A3KG 1Y14B 4JI6L 4NXNL 1N8RC 4WJ4A 1NMGA 3U58A 1Y1WH 3GTQH 1D7QA 4KI0A 4TVAB 4JI7Q 1MIUA 1TWFH 1N34L 4A4IA 1UWVA 2RHSB 4FDBA 1KHIA 4OXPA 4JI8L 2B63G 2E2IH 1OXTA 2NZHA 1I50H 4X64Q 5ELNA 1Z9FA 2F52A 4P71A 1HNZQ 1HNWQ 3K8AA 3S14H 2DGYA 2FXQA 3MXNB 1IXRA 4RMFA 1SFOH 2CCZA 2KBNA 2UUAQ 3GTMH 2N78A 3CPFA 1SR3A 4LFAQ 3F1ZA 2F3IA 3PUXA 4A3FH 4DV7Q 4BBRG 1I5FA 2YV5A 3HKZG 2Q2UA 1XNRL 4JI3Q 5JEAJ 4ME3A 3UDIA 4OX9L 2WP8J 4YHHQ 4IO9A 4A76A 2UXBL 1YITA 2LSSA 2K5NA 2JA7G 3BZKA 4C3IH 4A3KH 3S2HH 2IY5B 3PCOB 3LGJA 3RR5A 4BBSG 5IP9G 4DR4L 3K0XA 2JA8G 1EWIA 2JA9A 1GVPA 2NVYH 1DGSA 1Q8KA 2B3GA 4DV3Q 3CPWA 3CCRA 3HOYG 3ICEA 2B63H 2CWAA 3PGZA 4HIOA 3S15H 4JBMA 5LMNL 1CKMA 3E9IA 1MKHA 2BH8A 2D62A 3CAMA 1LYLA 3MEFA 5K36G 3PUZA 1XMOL 3K81C 1YHAA 4DR7Q 4A75A 4OWWB 4LF5Q 1JE5A 1H95A 2Y0SG 2R92G 3D0FA 2VY3A 4LFCQ 3PUVA 4DR2L 2B29A 2H5XA 4BBRH 4POFA 5JEAG 1Y1VG 3WWVA 1PH7A 4UP7A 3NENA 4JI6Q 2WB1E 1OXXK 3TQYA 3UE1A 4NXNQ 1G51A 1VQJA 2I5MX 2NN6G 2JA7H 4OO1G 1QUQB 4NPSA 2I0QA 1IBML 1N34Q 5IY0A 4BBSH 5IP9H 3I2ZA 2UU9Q 2JA8H 4X65Q 4B3TL 1PH9A 1X3FA 2I5HA 4IOCA 1EQQA 1M90C 3HOXG 4LFBQ 2OCEA 2Q2IA 4YCWA 1PYBA 4OO1I 2HHHL 1N32L 1I3QH 2CQOA 3TREA 3CW2C 5M5WH 5C3EG 1TWGH 1EUJA 5C0XJ 1G291 3T1YL 2XGTA 4LF4L 4IPGA 4UP8A 1HZ9A 2PMZE 1JMCA 2JEBI 1S3OA 4DV0Q 2RHQB 3RLOA 2R92H 3KDFB 4JI2Q 4MNOA 4C3JH 1LM0A 5IYDG 3K7UC 3OW2A 3RNUA 1A62A 1X3EA 1Y1VH 1ASYA 4B3ML 4LNQA 3KYHC 3J80c 3PUYA 3U50C 2UUCL 2UXBQ 1SROA 5HY6A 1IYJB 1YJWA 1MJCA 1PVOA 1SLJA 4IOAA 3AFQA 4P72A 3J80i 3CCVA 2OTLA 4MTNA 1VQ7A 3G4SA 4P74A 2Q2HA 2ZTCA 4O0AA 4YWMA 1BVSA 4JI1L 3KF6A 4YCUA 4X66L 4A3JG 1M1KC 4KHZA 3HOXH 1U5KA 2L15A 5LMNQ 2I5LX 4A3DG 5GQOA 5C0XG 1E3PA 3DLLA 2E2JH 5C3EH 4DUYL 1I94Q 4ALPA 3E9HA 4LUOA 4LUVA 3NELA 4NB3A 4R4TA 3M85A 2IX0A 2HT1A 1K8AC 2HIVA 1MJEA 4DR2Q 1E1OA 1KAWA 5IP7G 2Z6KC 5C0XI 4HJ9A 1Q86C 4BA2I 5IYDH 5IYCG 5ELOA 1K0RA 3ULPA 1YZ6A 4J15A 4LF6Q 3GD7A 4X62L 3ULJA 1YBYA 2AWNA 4DV6Q 2JA5G 1VQ6A 1PH8A 1IBMQ 3W5OA 2R93G 1L1OB 3GDEA 1IL2A 1K73C 1XPUA 2OTJA 4GN5A 2D0PA 1VQCA 4AQYQ 3EBEA 1VCIA 5IE8A 3GTKH 5DLQE 2VNUD 2JA6G 1XMQQ 3M4QA 4A3JH 2YYZA 2HHHQ 4DR6L 1N32Q 1OXUA 2PQAA 5M5XH 2E5LL 3W1GA 3T1YQ 4A3DH 2VW9A 2RCNA 4PMWA 5IWAL 4DV1L 1X9NA 1ASZA 3PO3G 1YI2A 4BXXG 1VQKA 1QVCA 2EIFA 4JC0A 4R1JA 2KCTA 1X54A 3L0OA 5IP7H 1SN8A 1JB7A 3KLWA 4GOPA 4GLVB 1IBLL 4R4OA 1J5EL 4B3MQ 3PF4A 4JYAL 3K7AH 1UE6A 4YY3L 4HIKA 1XPOA 4JI4L 3RLNA 5GAHC 3KJOA 4NXML 3PIPA 2JA5H 1N33L 4DV5L 3B6YA 2VUMG 2R93H 2CKZB 1X3GA 3F2CA 2K5HA 4GNXC 2KCMA 1UE5A 3T1HL 2ZM6L 1KXLA 1XPRA 5FLMG 2GVBA 2JA6H 4A3CG 2QA4A 1WCMG 2MO0A 1FGUA 3W1BA 1YIJA 1PH1A 3CC2A 2ZTEA 2LXKA 5M3MG 3JAMc 4DUYQ 3J7ZC 1E24A 3TS0A 4A3IG 5EAYA 2YTXA 4JBJA 4GLAC 4GNXB 1L0WA 3PO3H 3JAMi 5BR8Q 4BXXH 2R7DA 1K83H 3S1QH 3M3YH 4C3HH 1FJGL 4JI5L 4DV4L 2IHEA 3OYYA 1K3RA 3I4MG 1GO3E 1VQLA 1XNQQ 2UXCL 3GTJH 4X62Q 1WFQA 2HIXA 4O2DA 3ULLA 1VQ4A 1QZGA 2ZJPA 3GO5A 3I4NG 4YWLA 4JI0Q 4EX5A 2VUMH 2YTVA 2Z0SA 5E7NA 3RZDH 2VQFL 2F4VQ 1V9PA 2EXDA 3SGIA 4LW1A 5FLMH 1C7YA 2E5LQ 4A3CH 4JV5L 2PNHA 2ZTDA 4DV2L 1Q81C 1BKBA 5M3MH 4DR5L 3AYHB 4IPCA 5LMUL 1QZHA 3CCLA 1SMXA 5IWAQ 4A3IH 1KD1C 4P75A 2IX1A 3M9BA 1HR0W 1UE1A 4JI8Q 1CSPA 3J7A5 1CKNA 3EN2A 3HOZG 3PUWA 2K50A 2JE6I 3HOYH 4B3RL 2Q2TA 5M5YH 4HIMA 2NN6I 3CCMA 3UDGA 2R7FA 3FKIG 1IBLQ 2NVQH 3KF8B 2K4KA 1IZ6A 4GKJL 4JI4Q 2AKWB 3I4MH 1NE3A 5C4XG 1KRSA 4NXMQ 4LF7L 1N33Q 4DV5Q 1YHBA 1WYDA 4AYBE 3I7FA 2ZJQA 3KF6B 4JBKA 3I4NH 3HOUG 2KHIA 3I55A 3TRZA 4PG3A 3T1HQ 1PFSA 1XNRQ 4A3EG 3S1RH 3KJPA 1OTCA 4JOIA 1G6PA 4OX9Q 2R6GA 1K8GA 4LF9L 3PIOA 3A5ZB 4YWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0I A;  3U4V A;  1C0A A;  3A0J A;  1X55 A;  1BBW A;  3BU2 A;  1VQE A;  3E0E A;  3G6E A;  1Q7Y C;  2R7Z G;  4A3G G;  3STB C;  3CF5 A;  3F8T A;  4DR4 Q;  1V1Q A;  2N3S A;  2IHF A;  2WFW A;  1FJG Q;  3HOZ H;  1JJG A;  3HOW G;  3M4O H;  4JI7 L;  4IFD G;  2CFM A;  1QUQ A;  4R4Q A;  1R9T H;  3RN2 A;  3FKI H;  4QY7 A;  1J6Q A;  4DAY B;  4IPD A;  2VS1 A;  1XMO Q;  4XTC S;  1GD7 A;  4AH6 A;  5C4X H;  3HFZ B;  5C4J H;  5JJL A;  2VQE L;  3CME A;  2UXD L;  2ASB A;  1HNZ L;  4IFD I;  2LXJ A;  3L2P A;  4LUZ A;  5IYB G;  1Z47 A;  1VQ8 A;  4QL5 A;  2CWP A;  2ES2 A;  2UUA L;  2WB1 G;  4HID A;  3HOU H;  4QQB X;  4A3E H;  4POG A;  4GKK L;  4PZ7 A;  2JK8 A;  1TWC H;  1PHJ A;  1VQF A;  4QIW E;  1FVI A;  4DV7 L;  4GS3 A;  4UPA A;  1O7I A;  1W3S A;  4YCV A;  5LMU Q;  1IBK L;  1YEZ A;  2R7Z H;  4GLX A;  1XJV A;  2D0O A;  2PI2 E;  3M7N A;  3S17 H;  4Y7N H;  1VQP A;  4A3G H;  3HKZ E;  4MZ9 A;  3NBH B;  2VZA A;  4OWX B;  5FLX c;  3J81 j;  3F2B A;  1HH2 P;  3CCS A;  4B3T Q;  3STB D;  1Y1W G;  5H1S E;  1PH6 A;  2ATW A;  1EIY B;  3GTP H;  2EQS A;  2IT1 A;  1YVC A;  1LTL A;  3HOW H;  1SE8 A;  4EQ5 A;  4A93 G;  4APV A;  4AIM A;  1B7Y B;  2BA1 A;  2V1C C;  3AQQ A;  3GTO H;  4GKJ Q;  4LF4 Q;  1TWH H;  4AYB G;  1KQS A;  3Q8D A;  5GAD C;  1HJP A;  2XTI A;  5JJK A;  1TWA H;  1JJC B;  3M4P A;  1GM5 A;  3CD6 A;  4L5T A;  4DR1 L;  2JEA I;  4UY8 C;  1NTG A;  5IYB H;  4B3S L;  3UDF A;  1HNX L;  2ID0 A;  1YJ9 A;  2NVT H;  3TS2 A;  1V43 A;  2OQ0 A;  5IYC H;  1HR0 L;  4LF9 Q;  1I6H H;  3CCU A;  2UUC Q;  2MO1 A;  2Y0S E;  1Q1B A;  1WI5 A;  1WJJ A;  2AHO B;  2K52 A;  3PF5 A;  3CXC A;  3BJU A;  2MFI A;  4DR3 L;  1PH5 A;  3IRB A;  1VQI A;  1VQG A;  4HJA A;  4JI1 Q;  1NY4 A;  3VDY A;  3D31 A;  4X66 Q;  1XTD A;  5JJI A;  2N49 A;  3GTL H;  4BA1 I;  1YJN A;  1UE7 A;  3S16 H;  2UU9 L;  4L5S A;  4OWT B;  1L1O A;  4X65 L;  1Q82 C;  4A93 H;  1WOC A;  2Z6K A;  2BA0 A;  3HKS A;  4IPH A;  4LFB L;  3JC6 6;  2A8V A;  4OON A;  1X6O A;  4DK6 C;  2VQE Q;  3CQZ H;  1GKH A;  1VQM A;  2UXD Q;  2YU9 H;  1VQH A;  3EIV A;  1UEB A;  2WAQ E;  2OWO A;  1Q1E A;  4DK3 C;  1VQA A;  2VL6 A;  4A3M G;  2GVA A;  2RF4 A;  1PYS B;  1QVF A;  4GKK Q;  4DV0 L;  2C35 B;  4DPG A;  4UP9 A;  3CP0 A;  4JCV E;  1IBK Q;  4JI2 L;  4K0K L;  4BY1 G;  1B70 B;  3G48 A;  3GTG H;  3S1N H;  5FJ8 G;  1X65 A;  3A74 A;  5GRO A;  3CCJ A;  1CKN B;  1NBW A;  1N9W A;  1U0L A;  1EFW A;  3H0G G;  4JBW A;  4H02 A;  1BBU A;  4HJ5 A;  4Y52 H;  1Q12 A;  2K5V A;  4DR6 Q;  1CUK A;  4L5Q A;  4JOI C;  2AMC B;  1WCM H;  4R4I A;  3NEM A;  4IJL A;  4DAM A;  1KL9 A;  2HQL A;  4LF8 L;  3ER0 A;  4DV1 Q;  1E22 A;  3HOV G;  3I4O A;  3CMA A;  3CC4 A;  1S40 A;  1VQ9 A;  2KHJ A;  4DR1 Q;  3PO2 G;  3KOJ A;  4B3S Q;  2QGQ A;  1PH2 A;  2JQO A;  1I94 L;  1HNX Q;  3KFU A;  4L5R C;  3BZC A;  3FHW A;  4DUZ L;  1J5E Q;  1HR0 Q;  4JYA Q;  4IFD J;  4A3M H;  4GNX A;  1PV4 A;  1OXS C;  4YY3 Q;  3ERS X;  4DR3 Q;  1PH3 A;  5AJ3 L;  3TEH B;  4BY1 H;  1VS0 A;  3S24 A;  5FJ8 H;  3UE0 A;  1YNX A;  1NMF A;  4LF6 L;  1Q46 A;  3S1M H;  1A8V A;  2ZM6 Q;  3H0G H;  3I56 A;  4DV6 L;  1L2F A;  4KHP L;  2UUB L;  3DM3 A;  2ZJR A;  3F2D A;  4AQY L;  1QVG A;  4KLK A;  4IJH A;  1X56 A;  2NVX H;  1T9H A;  2N8N A;  4QGU A;  4A3B G;  4DNI A;  4BY7 G;  1XMQ L;  4LWC A;  1A63 A;  2QEX A;  1JJ2 A;  1N36 L;  2WAQ G;  3H15 A;  3HOV H;  3OTO L;  3CC7 A;  1EYG A;  1JT8 A;  4GN3 B;  1VQN A;  1K9M C;  4DV4 Q;  1EQR A;  4JI5 Q;  3PO2 H;  3RZO H;  1YHQ A;  1RL2 A;  3J81 c;  2E8G A;  3H3V I;  4DKA C;  1SRU A;  3S2D H;  1EOV A;  2UXC Q;  4K0K Q;  3J81 i;  4XIG S;  5J3B A;  1VQD A;  3PV0 A;  4X64 L;  1VQO A;  1PH4 A;  4JG2 A;  4TQU S;  1HNW L;  1AE3 A;  3PSI A;  2ALY B;  5M3F G;  2JJQ A;  2PQA B;  4P73 A;  2VQF Q;  5C44 G;  1HZA A;  3CCE A;  2E2H H;  4X6A H;  4LFA L;  1KIX A;  4PZ8 A;  1OXV A;  2DUD A;  2KEN A;  4GOP C;  1KC8 C;  3AFP A;  5HGQ A;  5LMN W;  4DV2 Q;  4A3L G;  4JV5 Q;  4GN4 B;  3U4Z A;  4DR5 Q;  4QJF A;  1B8A A;  2K75 A;  4JI3 L;  3K80 C;  2GN5 A;  3KDF A;  4LF8 Q;  1AH9 A;  4A3B H;  2A1A A;  3H3V H;  4BY7 H;  4YHH L;  1PA6 A;  1CSQ A;  3A5U A;  4B3R Q;  4GOP B;  2YTY A;  1AE2 A;  2NZO A;  4C2M H;  1FL0 A;  4HJ7 A;  1HZC A;  4DUZ Q;  3AEV A;  2OQK A;  5BR8 L;  1E7Z A;  2AWO A;  4DV3 L;  1L1O C;  4PZ6 A;  2A19 A;  1EIF A;  1HZB A;  5AJ3 Q;  5GAE C;  3G71 A;  1W2B A;  4LF7 Q;  1KRT A;  3FP9 A;  2K14 A;  4R4C A;  1XNQ L;  1C9O A;  5M3F H;  1LUZ A;  1P8L A;  1VQ5 A;  4DR7 L;  4LF5 L;  4KHP Q;  2UUB Q;  1RIP A;  3CCQ A;  3UDX A;  5C44 H;  4A3F G;  4JI0 L;  2BH2 A;  1CKO A;  4LFC L;  4A3L H;  1VQB A;  2PI2 A;  5IT9 c;  4HJ8 A;  3L7Z C;  1D8L A;  4WJ3 M;  1E1T A;  4RG1 A;  1P16 A;  3ZJY C;  1NJI C;  2F4V L;  1N36 Q;  1TXY A;  3RN5 A;  1S72 A;  2MNA A;  2MQH A;  3RLF A;  5GAG C;  3OTO Q;  4A3K G;  1Y14 B;  4JI6 L;  4NXN L;  1N8R C;  4WJ4 A;  1NMG A;  3U58 A;  1Y1W H;  3GTQ H;  1D7Q A;  4KI0 A;  4TVA B;  4JI7 Q;  1MIU A;  1TWF H;  1N34 L;  4A4I A;  1UWV A;  2RHS B;  4FDB A;  1KHI A;  4OXP A;  4JI8 L;  2B63 G;  2E2I H;  1OXT A;  2NZH A;  1I50 H;  4X64 Q;  5ELN A;  1Z9F A;  2F52 A;  4P71 A;  1HNZ Q;  1HNW Q;  3K8A A;  3S14 H;  2DGY A;  2FXQ A;  3MXN B;  1IXR A;  4RMF A;  1SFO H;  2CCZ A;  2KBN A;  2UUA Q;  3GTM H;  2N78 A;  3CPF A;  1SR3 A;  4LFA Q;  3F1Z A;  2F3I A;  3PUX A;  4A3F H;  4DV7 Q;  4BBR G;  1I5F A;  2YV5 A;  3HKZ G;  2Q2U A;  1XNR L;  4JI3 Q;  5JEA J;  4ME3 A;  3UDI A;  4OX9 L;  2WP8 J;  4YHH Q;  4IO9 A;  4A76 A;  2UXB L;  1YIT A;  2LSS A;  2K5N A;  2JA7 G;  3BZK A;  4C3I H;  4A3K H;  3S2H H;  2IY5 B;  3PCO B;  3LGJ A;  3RR5 A;  4BBS G;  5IP9 G;  4DR4 L;  3K0X A;  2JA8 G;  1EWI A;  2JA9 A;  1GVP A;  2NVY H;  1DGS A;  1Q8K A;  2B3G A;  4DV3 Q;  3CPW A;  3CCR A;  3HOY G;  3ICE A;  2B63 H;  2CWA A;  3PGZ A;  4HIO A;  3S15 H;  4JBM A;  5LMN L;  1CKM A;  3E9I A;  1MKH A;  2BH8 A;  2D62 A;  3CAM A;  1LYL A;  3MEF A;  5K36 G;  3PUZ A;  1XMO L;  3K81 C;  1YHA A;  4DR7 Q;  4A75 A;  4OWW B;  4LF5 Q;  1JE5 A;  1H95 A;  2Y0S G;  2R92 G;  3D0F A;  2VY3 A;  4LFC Q;  3PUV A;  4DR2 L;  2B29 A;  2H5X A;  4BBR H;  4POF A;  5JEA G;  1Y1V G;  3WWV A;  1PH7 A;  4UP7 A;  3NEN A;  4JI6 Q;  2WB1 E;  1OXX K;  3TQY A;  3UE1 A;  4NXN Q;  1G51 A;  1VQJ A;  2I5M X;  2NN6 G;  2JA7 H;  4OO1 G;  1QUQ B;  4NPS A;  2I0Q A;  1IBM L;  1N34 Q;  5IY0 A;  4BBS H;  5IP9 H;  3I2Z A;  2UU9 Q;  2JA8 H;  4X65 Q;  4B3T L;  1PH9 A;  1X3F A;  2I5H A;  4IOC A;  1EQQ A;  1M90 C;  3HOX G;  4LFB Q;  2OCE A;  2Q2I A;  4YCW A;  1PYB A;  4OO1 I;  2HHH L;  1N32 L;  1I3Q H;  2CQO A;  3TRE A;  3CW2 C;  5M5W H;  5C3E G;  1TWG H;  1EUJ A;  5C0X J;  1G29 1;  3T1Y L;  2XGT A;  4LF4 L;  4IPG A;  4UP8 A;  1HZ9 A;  2PMZ E;  1JMC A;  2JEB I;  1S3O A;  4DV0 Q;  2RHQ B;  3RLO A;  2R92 H;  3KDF B;  4JI2 Q;  4MNO A;  4C3J H;  1LM0 A;  5IYD G;  3K7U C;  3OW2 A;  3RNU A;  1A62 A;  1X3E A;  1Y1V H;  1ASY A;  4B3M L;  4LNQ A;  3KYH C;  3J80 c;  3PUY A;  3U50 C;  2UUC L;  2UXB Q;  1SRO A;  5HY6 A;  1IYJ B;  1YJW A;  1MJC A;  1PVO A;  1SLJ A;  4IOA A;  3AFQ A;  4P72 A;  3J80 i;  3CCV A;  2OTL A;  4MTN A;  1VQ7 A;  3G4S A;  4P74 A;  2Q2H A;  2ZTC A;  4O0A A;  4YWM A;  1BVS A;  4JI1 L;  3KF6 A;  4YCU A;  4X66 L;  4A3J G;  1M1K C;  4KHZ A;  3HOX H;  1U5K A;  2L15 A;  5LMN Q;  2I5L X;  4A3D G;  5GQO A;  5C0X G;  1E3P A;  3DLL A;  2E2J H;  5C3E H;  4DUY L;  1I94 Q;  4ALP A;  3E9H A;  4LUO A;  4LUV A;  3NEL A;  4NB3 A;  4R4T A;  3M85 A;  2IX0 A;  2HT1 A;  1K8A C;  2HIV A;  1MJE A;  4DR2 Q;  1E1O A;  1KAW A;  5IP7 G;  2Z6K C;  5C0X I;  4HJ9 A;  1Q86 C;  4BA2 I;  5IYD H;  5IYC G;  5ELO A;  1K0R A;  3ULP A;  1YZ6 A;  4J15 A;  4LF6 Q;  3GD7 A;  4X62 L;  3ULJ A;  1YBY A;  2AWN A;  4DV6 Q;  2JA5 G;  1VQ6 A;  1PH8 A;  1IBM Q;  3W5O A;  2R93 G;  1L1O B;  3GDE A;  1IL2 A;  1K73 C;  1XPU A;  2OTJ A;  4GN5 A;  2D0P A;  1VQC A;  4AQY Q;  3EBE A;  1VCI A;  5IE8 A;  3GTK H;  5DLQ E;  2VNU D;  2JA6 G;  1XMQ Q;  3M4Q A;  4A3J H;  2YYZ A;  2HHH Q;  4DR6 L;  1N32 Q;  1OXU A;  2PQA A;  5M5X H;  2E5L L;  3W1G A;  3T1Y Q;  4A3D H;  2VW9 A;  2RCN A;  4PMW A;  5IWA L;  4DV1 L;  1X9N A;  1ASZ A;  3PO3 G;  1YI2 A;  4BXX G;  1VQK A;  1QVC A;  2EIF A;  4JC0 A;  4R1J A;  2KCT A;  1X54 A;  3L0O A;  5IP7 H;  1SN8 A;  1JB7 A;  3KLW A;  4GOP A;  4GLV B;  1IBL L;  4R4O A;  1J5E L;  4B3M Q;  3PF4 A;  4JYA L;  3K7A H;  1UE6 A;  4YY3 L;  4HIK A;  1XPO A;  4JI4 L;  3RLN A;  5GAH C;  3KJO A;  4NXM L;  3PIP A;  2JA5 H;  1N33 L;  4DV5 L;  3B6Y A;  2VUM G;  2R93 H;  2CKZ B;  1X3G A;  3F2C A;  2K5H A;  4GNX C;  2KCM A;  1UE5 A;  3T1H L;  2ZM6 L;  1KXL A;  1XPR A;  5FLM G;  2GVB A;  2JA6 H;  4A3C G;  2QA4 A;  1WCM G;  2MO0 A;  1FGU A;  3W1B A;  1YIJ A;  1PH1 A;  3CC2 A;  2ZTE A;  2LXK A;  5M3M G;  3JAM c;  4DUY Q;  3J7Z C;  1E24 A;  3TS0 A;  4A3I G;  5EAY A;  2YTX A;  4JBJ A;  4GLA C;  4GNX B;  1L0W A;  3PO3 H;  3JAM i;  5BR8 Q;  4BXX H;  2R7D A;  1K83 H;  3S1Q H;  3M3Y H;  4C3H H;  1FJG L;  4JI5 L;  4DV4 L;  2IHE A;  3OYY A;  1K3R A;  3I4M G;  1GO3 E;  1VQL A;  1XNQ Q;  2UXC L;  3GTJ H;  4X62 Q;  1WFQ A;  2HIX A;  4O2D A;  3ULL A;  1VQ4 A;  1QZG A;  2ZJP A;  3GO5 A;  3I4N G;  4YWL A;  4JI0 Q;  4EX5 A;  2VUM H;  2YTV A;  2Z0S A;  5E7N A;  3RZD H;  2VQF L;  2F4V Q;  1V9P A;  2EXD A;  3SGI A;  4LW1 A;  5FLM H;  1C7Y A;  2E5L Q;  4A3C H;  4JV5 L;  2PNH A;  2ZTD A;  4DV2 L;  1Q81 C;  1BKB A;  5M3M H;  4DR5 L;  3AYH B;  4IPC A;  5LMU L;  1QZH A;  3CCL A;  1SMX A;  5IWA Q;  4A3I H;  1KD1 C;  4P75 A;  2IX1 A;  3M9B A;  1HR0 W;  1UE1 A;  4JI8 Q;  1CSP A;  3J7A 5;  1CKN A;  3EN2 A;  3HOZ G;  3PUW A;  2K50 A;  2JE6 I;  3HOY H;  4B3R L;  2Q2T A;  5M5Y H;  4HIM A;  2NN6 I;  3CCM A;  3UDG A;  2R7F A;  3FKI G;  1IBL Q;  2NVQ H;  3KF8 B;  2K4K A;  1IZ6 A;  4GKJ L;  4JI4 Q;  2AKW B;  3I4M H;  1NE3 A;  5C4X G;  1KRS A;  4NXM Q;  4LF7 L;  1N33 Q;  4DV5 Q;  1YHB A;  1WYD A;  4AYB E;  3I7F A;  2ZJQ A;  3KF6 B;  4JBK A;  3I4N H;  3HOU G;  2KHI A;  3I55 A;  3TRZ A;  4PG3 A;  3T1H Q;  1PFS A;  1XNR Q;  4A3E G;  3S1R H;  3KJP A;  1OTC A;  4JOI A;  1G6P A;  4OX9 Q;  2R6G A;  1K8G A;  4LF9 L;  3PIO A;  3A5Z B;  4YWK A; 
#chains in the Genus database with same CATH topology
 3Q6S A;  1B3A A;  1Q7Y C;  3G6E A;  3STB C;  2KEE A;  2X6L A;  5CR3 A;  1MD2 D;  5T1I A;  4KN4 C;  4E6I A;  5C4Z A;  2O5I C;  3I3C A;  1QUQ A;  4IZ8 A;  3RN2 A;  1J6Q A;  4G57 A;  1A15 A;  4WRD A;  1WTP A;  2E74 C;  2DY7 A;  2IJ0 A;  3Q24 A;  1ET9 A;  4LUZ A;  5IYB G;  1VQ8 A;  2CWP A;  1TII D;  3BVM A;  2WB1 G;  4PZ7 A;  4DGZ A;  1STG A;  4DV7 L;  2R7Z H;  1XJV A;  4A3G H;  2WAC A;  4Y7N H;  1BO0 A;  1HH2 P;  3STB D;  5C3X A;  2IT1 A;  3T13 A;  3VR3 A;  4GKJ Q;  3AQQ A;  3GTO H;  4LF4 Q;  2KCC A;  1TWH H;  4FF2 A;  2WII B;  3R3O A;  3WDN A;  1PTO C;  2XTI A;  5JJK A;  1TWA H;  4IUP A;  1CQV A;  4DR1 L;  4UY8 C;  5D65 A;  1JCK B;  1STE A;  4DK1 A;  2OQ0 A;  1HR0 L;  1PTO B;  4ODG A;  2EXZ A;  1WJJ A;  4KMU C;  5FKA C;  3BJU A;  2XWJ B;  3H09 A;  1VQI A;  2PNR C;  1D1I A;  3FDT A;  3MXP A;  4LJZ C;  4JI1 Q;  3HOX B;  4DA2 A;  1SYC A;  4DNT B;  4ILW A;  5JJI A;  4BA1 I;  5EGT A;  1CA5 A;  5C3E B;  3S16 H;  2UU9 L;  4A93 H;  4B9W A;  2CVR A;  3HKS A;  4IPH A;  4LFB L;  2I07 B;  1MSG A;  1X6O A;  2VQE Q;  4B08 A;  1GKH A;  3R93 A;  2YU9 H;  4PMC A;  1PTO D;  1UEB A;  2OWO A;  2EYM A;  4LMQ D;  1Y8P B;  4A3M G;  4KY7 A;  2B8G A;  1QNK A;  2F0Q A;  2C35 B;  4UP9 A;  4JCV E;  4JI2 L;  4K2K A;  4K0K L;  1EEI D;  2XRS D;  1STB A;  3A8I E;  5FJ8 G;  2EOT A;  3DWP A;  4N8X 1;  4H02 A;  1SNP A;  4HJ5 A;  2K5V A;  4QCL A;  1VDZ A;  5FO9 B;  1ZXT A;  4DAM A;  1O78 A;  3A55 A;  1KL9 A;  3J81 E;  3HOV G;  2NB0 A;  1LTG D;  1S40 A;  1VQ9 A;  5DAU A;  3PO2 G;  4RH6 A;  1HNX Q;  1GUO A;  3KFU A;  3BZC A;  5ELC A;  2PO4 A;  1OXS C;  1JWS D;  3ERS X;  3RUZ A;  2XIW A;  3S24 A;  4FXD A;  3UE0 A;  5TSS A;  3W2D A;  2F0V A;  3N52 A;  4DV6 L;  1E2Z A;  1L2F A;  2G5D A;  2F0I A;  1UAP A;  2ZJR A;  3OMC A;  2P5Z X;  4OIJ A;  3F2D A;  4AQY L;  1T9H A;  3PO3 B;  4DNI A;  1XMQ L;  2X6G A;  4LWC A;  3H15 A;  3CC7 A;  1EYG A;  1PMR A;  5EQ0 A;  1ILP A;  5J22 A;  3CHB D;  3H3V I;  3GTJ B;  1Z6H A;  1SRU A;  5ELB A;  5A2Q E;  4XIG S;  1AEX A;  5J3B A;  4X64 L;  4OIK A;  4JG2 A;  4RGM A;  1AE3 A;  1S5D D;  3RZD B;  3PSI A;  2EVB A;  2JJQ A;  2PQA B;  4X6A H;  1HZA A;  3FEW X;  1KIX A;  5M3M B;  2DUD A;  2KEN A;  3MHB A;  4K5V A;  2DY8 A;  2FHT A;  3U4Z A;  5FLX L;  4QJF A;  5C5L A;  4JI3 L;  4OHJ A;  3K80 C;  1KAB A;  1S4Z A;  4A3B H;  3H3V H;  4YHH L;  2IW3 A;  3HOY B;  4B3R Q;  2NVQ B;  4C2M H;  2F0T A;  1GUW A;  1E7Z A;  4DV3 L;  1L1O C;  4KD3 A;  4RHR A;  5FK9 C;  2A19 A;  1EIF A;  1Q90 A;  5AJ3 Q;  5GAE C;  3G71 A;  4LF7 Q;  3FP9 A;  2K14 A;  1XNQ L;  1SYG A;  2F0M A;  5C3W A;  4LF5 L;  4KHP Q;  1RIP A;  4JPB W;  4KKU A;  4LFC L;  2H4O A;  2VB3 X;  3L7Z C;  3J7A F;  1P16 A;  1FNU A;  3NQI A;  3D6C A;  1NJI C;  1TXY A;  1S72 A;  1DYQ A;  3OTO Q;  5GAG C;  4C3I G;  4M8A A;  2Z4H A;  4WJ4 A;  1TR5 A;  1R9T B;  3U58 A;  4ZYS A;  1D7Q A;  4TVA B;  1LAC A;  4KK7 A;  3L9A X;  2RHS B;  1KHI A;  5C4X B;  1OXT A;  2NZH A;  5ELN A;  4F7X A;  1Z9F A;  2A6H D;  4P71 A;  4G7O C;  2KA7 A;  2DGY A;  4A3E B;  1IXR A;  5CGK A;  3GTM H;  1HHV A;  1BOS A;  1UUP A;  4KJN A;  5FOB B;  4BBR G;  1XNR L;  1XWE A;  5JEA J;  2G9D A;  2BOS A;  2LSS A;  3NP8 A;  2JA7 G;  3BZK A;  3KBX A;  2IY5 B;  4EQO A;  3PCO B;  4IUN A;  5IP9 G;  5DM6 3;  4DR4 L;  2JA8 G;  3SK8 A;  1V8Q A;  1GUT A;  5D14 A;  4CKC A;  4I65 A;  4KN7 C;  2B63 H;  3S15 H;  2M00 A;  1CKM A;  2A69 C;  1MKH A;  3CAM A;  1LYL A;  3PUZ A;  2NUC A;  5IGD A;  1JE5 A;  1H95 A;  2R92 G;  3M4Y A;  2VY3 A;  3PUV A;  4O42 A;  2JA5 B;  2B29 A;  4POF A;  2F0N A;  3D3R A;  5G3L D;  4L6T B;  2WKD A;  3NEN A;  2EYL A;  1VQJ A;  3HGB A;  2G9H D;  4X3U A;  4ABN A;  3T53 B;  3URY A;  2MHV A;  4B3T L;  1F2Z A;  1DM0 B;  4IOC A;  1JWU D;  3CQZ B;  1QNU A;  1I3Q H;  3A54 A;  1WTO A;  1KDC A;  3J81 L;  1EY7 A;  4IPG A;  4K5X A;  2B2V C;  2JEB I;  1S3O A;  1LTR D;  4DV0 Q;  1QJO A;  4C3J H;  3S1N B;  4MNO A;  1QE6 A;  4K8J A;  2C5C A;  5JEA H;  1EY8 A;  4B3M L;  3IFD A;  5CV4 A;  3OIP A;  3D6W A;  1PVO A;  1MJC A;  2NN6 H;  1A6X A;  1WCM B;  2Q2H A;  4O0A A;  4WJW A;  3KF6 A;  4A3J G;  4FNF A;  2L15 A;  4A3D G;  1E3P A;  1I94 Q;  4ALP A;  4FXG C;  4G7Z C;  4NB3 A;  4RAU C;  1O7L A;  1MJE A;  1DOL A;  1PRT C;  1E1O A;  2Z6K C;  3X3N A;  3MA2 B;  4BA2 I;  5IYD H;  1JOR A;  5ELO A;  3BYT B;  1WTV A;  2AWN A;  2D0P A;  5JAV A;  3NUC A;  2VNU D;  3TZD A;  3M4Q A;  4F88 A;  4DR6 L;  4LAA A;  1FYC A;  2PQA A;  5M5X H;  2D2C C;  2F1M A;  2KHS A;  2RCN A;  3OWF A;  4DV1 L;  3S2D B;  2EJM A;  4C3H G;  4G7H C;  4JC0 A;  1YNJ C;  3VYT A;  1X54 A;  1SN8 A;  2CH4 W;  2BE5 D;  3PF4 A;  1J5E L;  4HIK A;  1SE4 A;  4X3K A;  5HGT A;  5FO8 B;  3NK9 A;  1TWC B;  3PIP A;  2JA5 H;  1X3G A;  2K5H A;  1F2L A;  2KCM A;  2ZM6 L;  2K1B A;  1LO5 D;  3CC2 A;  3OWE B;  1E24 A;  1XTC D;  4GLA C;  2RKS A;  5BN5 A;  3JAM i;  4BXX H;  2R7D A;  2F0L A;  3I90 A;  3M3Y H;  1FJG L;  4MIU A;  4TSS A;  4DAP A;  3I4M G;  1G8Z D;  2UXC L;  4X62 Q;  1EY0 A;  5C44 B;  2EJF C;  3I4N G;  4YWL A;  4JI0 Q;  1GOZ A;  2Z0S A;  2EY5 A;  3I72 A;  2VQF L;  4LW1 A;  3DEO A;  5LL6 X;  4JV5 L;  2ZTD A;  1XXG A;  2L12 A;  1BKB A;  1TWF B;  1QZH A;  2MP1 A;  1SMX A;  4A3I H;  1KD1 C;  4P75 A;  1SE2 A;  4JI8 Q;  1CSP A;  1CKN A;  3PUW A;  1LT3 D;  2JE6 I;  4WFN 3;  5M5Y H;  3CCM A;  1QOH A;  3S14 B;  1U9R A;  2K4K A;  4EVO A;  4G4K A;  2AKW B;  2A6E C;  1KRS A;  1IW7 C;  1CK1 A;  4DV5 Q;  2K32 A;  4A3F B;  4AYB E;  2ZXP A;  4JBK A;  2IL8 A;  2KHI A;  2H1E A;  4OX9 Q;  3GD7 A;  3E5S A;  1A3T A;  5A35 A;  4A3K B;  1A0I A;  1M8A A;  3D8G A;  1ENC A;  3A0J A;  2R7Z G;  1BNZ A;  2K04 A;  4A3G G;  2NVY B;  1F9Q A;  3F8T A;  4QMG A;  1V1Q A;  4HCE A;  3HOZ H;  1KAA A;  2PQE A;  4FF1 A;  4JI7 L;  1SAP A;  4DAY B;  2RVL A;  4IPD A;  1XMO Q;  4XTC S;  1YNN C;  5EPL A;  3HFZ B;  3V96 A;  5JJL A;  3CME A;  4UHV A;  2ASB A;  2LXJ A;  3L2P A;  3GV3 A;  1IW7 D;  2UUA L;  5K5P A;  4GKK L;  3S1M B;  1TWC H;  1VQF A;  3H0G B;  1FVI A;  4GS3 A;  4UPA A;  1W3S A;  4YCV A;  4BBS B;  1YEZ A;  1AFP A;  2D0O A;  1VQP A;  1STH A;  3NBH B;  4MZ9 A;  5FLX c;  1Y1W G;  3BVZ A;  2EJG C;  3EA6 A;  1EIY B;  2ATW A;  2B2V A;  2EQS A;  5KEE A;  3HOW H;  1LTL A;  4A93 G;  2PW7 A;  3O13 A;  4K2L A;  4N9T A;  4HCS A;  4OEL B;  4HTH A;  1HJP A;  2Y0S B;  3PMF A;  5JVH 3;  1JJC B;  3M4P A;  1GM5 A;  3CD6 A;  1YNN D;  4L5T A;  1WVL A;  1NTG A;  3Q23 A;  1Y1V B;  3MTS A;  4B3S L;  2KJX A;  4QF4 A;  2ID0 A;  1YJ9 A;  2NVT H;  4LF9 Q;  4KTA A;  3CCU A;  2UUC Q;  2Y0S E;  1TS5 A;  2AHO B;  3PF5 A;  1QG7 A;  4DR3 L;  3K58 A;  3SE0 A;  1PH5 A;  2FMM A;  3VYU A;  1VQG A;  1NY4 A;  3VDY A;  3D31 A;  1EEF D;  1XTD A;  3T4A C;  3DHQ A;  2Z6K A;  4C1N K;  2QKI C;  2OEO A;  3G7L A;  2A8V A;  1K8O A;  4KKS A;  1VQM A;  2WAQ E;  1SYB A;  2VL6 A;  1VQA A;  5KYL A;  1K28 A;  2L55 A;  3CP0 A;  1BCP F;  2F3W A;  3GTG H;  1HQR D;  5GRO A;  3CCJ A;  3GTK B;  2FJ2 A;  1NBW A;  4U67 3;  1N9W A;  1U0L A;  2B2Y C;  1BBU A;  5CV5 A;  2J4X A;  1GJX A;  1NR4 A;  2B2T C;  3DXJ C;  4IJL A;  1IYU A;  5EKI A;  4LF8 L;  2Z8L A;  1TQO A;  4OL7 A;  3I4O A;  1WTR A;  3CMA A;  2F03 A;  2KHJ A;  4DR1 Q;  2N88 A;  1SDF A;  1I4X A;  2OF1 A;  1PH2 A;  3KLR A;  2JQO A;  3K7A B;  3FHW A;  4DUZ L;  1HR0 Q;  5IOD A;  4YY3 Q;  1PV4 A;  4CJ0 B;  4OEM B;  3TEH B;  4BY1 H;  1YNX A;  4LF6 L;  5CBA E;  3S1M H;  2JA6 B;  1A8V A;  3H0G H;  3VYR A;  4ID6 A;  2IWH A;  3WOE A;  2QW7 A;  5I6W A;  1SYF A;  3S2H B;  1QVG A;  3E0J A;  1ZEQ X;  4KLK A;  2NVX H;  2N8N A;  4A3B G;  1FNW A;  1JJ2 A;  5IIF A;  4Q0F A;  1JT8 A;  1HTL D;  3A7A B;  1PXU A;  3C46 A;  1VQN A;  3NQT A;  3RZO H;  2R3Z A;  3J81 c;  1JWM D;  1NSN S;  1I4P A;  4ZUI A;  4K0K Q;  1VQD A;  1MI2 A;  2VUM B;  1IKL A;  2K5D A;  1STN A;  3MWY W;  4CDC C;  4P73 A;  3R8B A;  3CCE A;  3OW7 A;  1VMP A;  1TS4 A;  1KTK A;  1PRT F;  4PZ8 A;  1KC8 C;  4GN4 B;  1B9N A;  3TP8 A;  3ONA B;  4BY7 H;  1K8M A;  2ICE C;  3A5U A;  4WOR A;  2YTY A;  1AE2 A;  4FF3 A;  3SEB A;  1CQF A;  4HJ7 A;  1TWG B;  2OQK A;  5BR8 L;  3N6R A;  3I8Z A;  2CW0 C;  4K8I A;  5I2X A;  3V2T A;  4R4C A;  3S1R B;  4DAY A;  5M3F H;  2K5Q A;  1V1O A;  1VQ5 A;  3CCQ A;  2F0F A;  3V05 A;  2BH2 A;  4V19 0;  4A3L H;  1E1T A;  3G6J B;  4FXK C;  2F4V L;  4JI6 L;  2AQ2 B;  2MQH A;  4FO2 A;  1NUC A;  1M4V A;  5LHY 1;  1N8R C;  1NCV A;  1Y1W H;  5I4D A;  4KI0 A;  1MIU A;  1N34 L;  2WKC A;  1UWV A;  1SSO A;  2D5D A;  3BG3 A;  3NWS A;  2B63 G;  5C4J B;  3NBH A;  2GA4 B;  4X64 Q;  1I50 H;  2J7Z A;  3E3X A;  1EZ8 A;  1HNZ Q;  3HOU B;  5ELD A;  4QB4 A;  3K0Y A;  1SFO H;  2CCZ A;  2N78 A;  3CPF A;  4CJ2 C;  2F3I A;  1XYI A;  3PUX A;  3CU7 A;  3HKZ G;  4JI3 Q;  1QB5 D;  4YHH Q;  1EWH A;  1DJR D;  3IFT A;  4UDU C;  2K5N A;  3GTP B;  3S2H H;  4IUR A;  3RR5 A;  1ICF B;  4HN7 A;  1H9S B;  3K0X A;  3ND8 A;  1D2B A;  4QUF A;  4DV3 Q;  3CCR A;  3HOY G;  1HFG A;  1H9K A;  4HIO A;  5LMN L;  4XQQ A;  2BH8 A;  2D62 A;  5E4X A;  1I6H B;  2WB1 B;  3K81 C;  2F0H A;  1YHA A;  4NW2 A;  2E2D C;  4OWW B;  4CBV A;  4LF5 Q;  1CT1 D;  5COY A;  1GHK A;  3D0F A;  4C3J G;  4LFC Q;  4DR2 L;  3U9S A;  2R93 B;  5JEA G;  2H5X A;  1AN8 A;  2B2W C;  4UP7 A;  1O7Y A;  2WB1 E;  1OXX K;  1IKM A;  3MEH A;  2I5M X;  2NN6 G;  5CC4 A;  2I0Q A;  1IBM L;  2ICI A;  4J8Q A;  4X65 Q;  1PH9 A;  2B8F A;  2KQ3 A;  2OCE A;  3EFX D;  1PYB A;  1JOO A;  4OO1 I;  2HHH L;  4NKL A;  3TRE A;  3CW2 C;  1TWG H;  4C56 C;  5C0X J;  3T1Y L;  1G29 1;  4LF4 L;  2QDL A;  5K36 H;  5BN3 A;  2B2Y A;  3RLO A;  3KDF B;  1HUM A;  1LM0 A;  3K7U C;  5IYD G;  1SJH D;  1X3E A;  5I2Y A;  3KYH C;  3PUY A;  3U50 C;  1SRO A;  5HY6 A;  1YJW A;  1PTO H;  4OO1 H;  4IOA A;  3AFQ A;  3J80 i;  2K33 A;  3CCV A;  1HCZ A;  4MTN A;  1VQ7 A;  4P74 A;  3NXW A;  4YWM A;  1BVS A;  4JI1 L;  3QJY A;  2NZ1 D;  3HOX H;  4C1N I;  1S5E D;  1RTO A;  2B2U C;  1FNV A;  5C3E H;  4DUY L;  1CA6 A;  1J9O A;  4HR7 B;  4A3M B;  2HT1 A;  3R2T A;  1K8A C;  2HIV A;  2MUY A;  4ZQ3 A;  5C0X I;  1Q86 C;  1RDP D;  1K0R A;  3ULP A;  4HAE A;  3VR5 A;  3U9O A;  4IUT A;  3C2P A;  1G91 A;  3ULJ A;  2JA5 G;  1VQ6 A;  2WV6 D;  2QIL A;  1L1O B;  1IL2 A;  1K73 C;  1GHJ A;  1ML0 D;  3JAM E;  1VQC A;  5IE8 A;  2HQE A;  2ZXO A;  2XRQ D;  3HOV B;  3BVG A;  2YYZ A;  2CQA A;  1OXU A;  4XYQ A;  2E5L L;  3PO2 B;  2RCF A;  2XN9 C;  5M9O A;  3M4O B;  2F0G A;  5C0X H;  4F87 A;  5IGE A;  1EU4 A;  5IWA L;  1ASZ A;  4BXX G;  3VYS A;  5ISR A;  1VQK A;  3DWA A;  4XDX A;  1QVC A;  2EIF A;  3OOC A;  4ME5 A;  4V0B A;  5IP7 H;  2O2L D;  3KLW A;  3T16 A;  1IBL L;  4B3M Q;  2NTS A;  2HCI A;  1LT6 D;  1XPO A;  2L9H A;  3RLN A;  3TP7 A;  2E2H B;  3HG9 A;  5GAH C;  4NXM L;  1C48 A;  3PIO 3;  2R93 H;  3A7L A;  5DM7 3;  2CKZ B;  3GQB A;  4GNX C;  3S17 B;  1UE5 A;  3T1H L;  1XPR A;  3NHH A;  2RDF A;  1WCM G;  3W1B A;  1FGU A;  1EWC A;  1YIJ A;  1D1K A;  2LXK A;  1STY A;  3TS0 A;  1II3 A;  4FVM A;  4A3I G;  1VF5 C;  2YTX A;  4GNX B;  1L0W A;  3PO3 H;  2EY2 A;  1GUS A;  3OSO A;  1EQT A;  3OMG A;  2IHE A;  1BCP C;  2M9V A;  3TZU A;  3GTJ H;  3KLS A;  4XT1 B;  1A2U A;  5KND A;  1QZG A;  5IOC A;  2IPK D;  4EX5 A;  2YTV A;  1BCP B;  1HUN A;  3RZD H;  4A3C H;  1ILQ A;  3GTQ B;  1PZJ D;  3GP7 A;  1G6Z A;  5M3M H;  5LMU L;  4B9X A;  1TT2 A;  2IX1 A;  2E2I B;  1S5B D;  1HR0 W;  3HOZ G;  3EN2 A;  1BF4 A;  4B3R L;  1VF7 A;  3HOY H;  4HIM A;  2IX3 A;  2NN6 I;  2NVQ H;  1H9S A;  2FFK B;  3RD4 A;  1BXT A;  2R61 A;  4LF7 L;  4IUV A;  1LV9 A;  1WD0 A;  2A69 D;  4PG3 A;  1AZP A;  1A2T A;  1VMC A;  1OTC A;  3HZX A;  5JJZ A;  3PIO A;  3A5Z B;  4C3I B;  2HDL A;  3U4V A;  3AMU A;  1C0A A;  1X55 A;  3BU2 A;  3E0E A;  3C3L A;  3LWE A;  4CKB A;  4CGY B;  2N3S A;  2NWG A;  1K0S A;  3BYY B;  2IHF A;  2WFW A;  1FJG Q;  3HOW G;  4S3S A;  3M4O H;  1AP0 A;  2ZT9 C;  4R4Q A;  1R9T H;  2PCF B;  3EVQ A;  3FPU B;  1TKW B;  1GD7 A;  4QIW B;  2B2W A;  5C4X H;  5JPM C;  5I6Y A;  2UXD L;  4IFD I;  3I4L A;  4BBR B;  3PQI A;  3HRZ C;  4N9P A;  3QG1 A;  2F0D A;  4HID A;  4QQB X;  1SNO A;  4A3E H;  4POG A;  2KED A;  2JK8 A;  2JA7 B;  4QIW E;  3K5N A;  1C8C A;  1IBK L;  3P7J A;  5EKK A;  5F2D A;  2JA8 B;  1PRT B;  1SYE A;  3S17 H;  4DU9 A;  2VZA A;  3CCS A;  4EGV A;  1J8I A;  1HTP A;  3SK6 A;  5M5W B;  1YVC A;  1I4R A;  2RSN A;  1SE8 A;  4HED A;  4EQ5 A;  2EYO A;  3IAY A;  4APV A;  4IFD H;  3C1F A;  2XNA C;  3QO2 A;  4AYB G;  1B53 A;  1MGS A;  2R92 B;  1RKN A;  5CYU A;  1LTI D;  2QCP X;  2K01 A;  1CFM A;  2K05 A;  1PRT D;  2SEB D;  4DAV A;  2MO1 A;  1Q1B A;  2B39 A;  1W2B A;  2K52 A;  3CXC A;  2B2U A;  4X66 Q;  3CRK C;  3OPO A;  3JAM L;  5EKL A;  3IKJ A;  1IHZ A;  1YJN A;  1UE7 A;  4OWT B;  1L1O A;  4M1U B;  1WOC A;  2BA0 A;  3JC6 6;  5J1Z A;  2PYK A;  1EFI D;  4OON A;  5FO7 B;  3CQZ H;  3OIQ A;  1VQH A;  1RCV D;  4TKO B;  3F2U A;  5JOB A;  1Q1E A;  1QVF A;  1I4G A;  2GVA A;  1PYS B;  3R2I A;  4GKK Q;  1KDB A;  2OT2 A;  4DV0 L;  4ZUJ A;  1YNJ D;  4DPG A;  4BY1 G;  4KV6 A;  3P20 A;  1B70 B;  3S1N H;  1S5C D;  4RFB A;  1X3Q A;  4A3J B;  3H0G G;  4JBW A;  1Q12 A;  4I7Z C;  4KHV A;  4L5Q A;  2VB2 X;  4A3D B;  4JOI C;  2AMC B;  1GXD C;  1WCM H;  2JSO A;  4R4I A;  3NEM A;  1EZ6 A;  1DOK A;  2HQL A;  3ER0 A;  2ZXR A;  1S5F D;  1EIH A;  2A68 C;  5D3I B;  3KOJ A;  4K6D A;  4Q5V A;  4B3S Q;  1NR2 A;  1I94 L;  5L37 A;  2VXW A;  4JYA Q;  1H9J A;  4GNX A;  4FF4 A;  2FIN B;  4DR3 Q;  1JOK A;  1VS0 A;  1MBY A;  2RQX A;  2KCN A;  3MFG A;  4JK1 C;  5E4W C;  3I56 A;  2UUB L;  3DM3 A;  1R4P B;  1PZI D;  4QGU A;  4BY7 G;  1A63 A;  2QEX A;  1K83 B;  1N36 L;  2WAQ G;  2L4N A;  3WOF A;  4C3H B;  1ROD A;  1K9M C;  4DV4 Q;  1EQR A;  4JI5 Q;  5I9P A;  2E8G A;  2A68 D;  4DKA C;  2EYF A;  3S2D H;  3CKI B;  2Q8T A;  5E1F A;  2DJF C;  2CHB D;  5C5M A;  5IT9 E;  4TQU S;  1HNW L;  2A6E D;  2ALY B;  3UI2 A;  5M3F G;  1JIC A;  4RCO A;  1GUN A;  4LFA L;  4A3L G;  2QDB A;  4DV2 Q;  5CV8 A;  4DR5 Q;  4CDE C;  4LF8 Q;  1KDA A;  2A1A A;  1EY9 A;  1A3V A;  2NZO A;  1FL0 A;  1HZC A;  4DUZ Q;  3I4M B;  4IQZ A;  4MTK A;  2E75 C;  2AWO A;  4H7B A;  4PZ6 A;  3QOL A;  1SJE D;  1HZB A;  1HA6 A;  3I4N B;  1XX8 A;  2L5T A;  3SDZ A;  4JW0 A;  4DR7 L;  4RCN A;  3UDX A;  5C44 H;  2JP1 A;  4JI0 L;  1CKO A;  1VQB A;  3SVM A;  4MHE A;  4RG1 A;  2EE1 A;  4RGO S;  5BN4 A;  4KY5 A;  2MNA A;  3RLF A;  1Y14 B;  4NXN L;  2EDG A;  2PW5 A;  1TWF H;  2E2J B;  3KBG A;  4FDB A;  4JI8 L;  3ITP A;  4R8I A;  2A74 C;  3S14 H;  3MXN B;  4RMF A;  1RHP A;  2KBN A;  1SR3 A;  3F1Z A;  3NTI A;  1QCB D;  2R7Z B;  4A3F H;  4DV7 Q;  4A3G B;  1I5F A;  3KLS X;  3HEJ A;  2Q2U A;  5G3L F;  3MVV A;  1UEA B;  3UDI A;  4OX9 L;  2UXB L;  1YIT A;  4XYO A;  4RKL A;  2E76 C;  4A3K H;  4DFA A;  3LGJ A;  1SNM A;  3GTO B;  1EWI A;  1IYV A;  1GVP A;  2BDO A;  2NVY H;  3D4D A;  1DGS A;  5ELE A;  1EY6 A;  1I6V C;  1STA A;  3CPW A;  3ICE A;  1E2V A;  4OGQ C;  1TWA B;  4K5W A;  4JBM A;  3E9I A;  1X32 A;  5K36 G;  1XMO L;  3NWT A;  2SNS A;  4K14 A;  3SHL A;  4A75 A;  3J80 E;  1QIL A;  3ND9 A;  3TN2 A;  1BDO A;  2A73 B;  3BDC A;  2N55 A;  3WWV A;  1PH7 A;  4JI6 Q;  1JQY D;  3UE1 A;  1G51 A;  4OO1 G;  4NPS A;  3S16 B;  4A93 B;  1N34 Q;  5IY0 A;  4BBS H;  2UU9 Q;  2PMZ B;  1FR3 A;  1EQQ A;  1M90 C;  4LFB Q;  3HOX G;  1MHW C;  2Q2I A;  4BWG B;  2BCO A;  2YU9 B;  1N32 L;  5C3E G;  3J7A V;  5DNF A;  1LTA D;  1I4H A;  3I73 A;  1F2Y A;  3AB9 A;  4X3T A;  4PMB A;  2PMZ E;  2X69 A;  5IGF A;  1V1P B;  4IAL A;  4JI2 Q;  1TU2 B;  3H94 A;  1Y1V H;  2UUC L;  5EBC A;  1HFN A;  4XXE A;  2RDG A;  1SLJ A;  4P72 A;  2OTL A;  3G4S A;  1B9M A;  5CV7 A;  1TS2 A;  4LK1 C;  4YCU A;  2V4D A;  4RGT A;  5LMN Q;  3BZD B;  1B4O A;  2K5W A;  5C0X G;  3ERO A;  2E2J H;  3DLL A;  2BDN A;  1C4Q A;  1KNA A;  3E9H A;  4LUO A;  4LUV A;  1T5X D;  1A3U A;  4DR2 Q;  4KJO A;  5IP7 G;  2LKV A;  5IYC G;  2MGS A;  4IUU A;  1LTT D;  1YBY A;  4DV6 Q;  2R93 G;  5IT9 L;  3OHX C;  1PH8 A;  3W5O A;  1IBM Q;  3GDE A;  1XPU A;  4GN5 A;  4AQY Q;  4RGN A;  1VCI A;  3GTK H;  1PZK D;  5DLQ E;  1XMQ Q;  2HHH Q;  3W1G A;  3T1Y Q;  1Y8N B;  1ESR A;  3K5L A;  3FKI B;  3PO3 G;  1X9N A;  1YI2 A;  2Z6B A;  3D4W A;  5KNC A;  4IUQ A;  1OO9 B;  4R1J A;  4DK0 A;  3FMC A;  2CW0 D;  3H3V C;  3K7A H;  1SEB D;  4YY3 L;  4P2C B;  2F0E A;  1PFN A;  4JI4 L;  1CM9 A;  1NAP A;  4FYD A;  3C1E A;  1U4M A;  1N33 L;  3B6Y A;  4KKT A;  3F2C A;  5T1G A;  1Q8I A;  2L1B A;  4A3B B;  1KXL A;  4A3C G;  2GVB A;  2JA6 H;  2MO0 A;  5J39 A;  1PH1 A;  1E2W A;  2ZTE A;  5M3M G;  4C2M B;  3JAM c;  4DUY Q;  1BQQ T;  5EAY A;  2EZV A;  5EPK A;  4KY6 A;  1CHQ D;  2Q8I B;  1PFB A;  1D5X C;  4CKE A;  1VQL A;  1XNQ Q;  1TS3 A;  4XT3 B;  2HIX A;  1IL8 A;  2Z1C A;  1VQ4 A;  3EQL C;  2ZJP A;  3FVQ A;  2EY1 A;  3GO5 A;  2VUM H;  2AUK A;  5KIX A;  2F0K A;  3AU7 A;  4DXF A;  1V9P A;  2EXD A;  3MXN A;  5FLM H;  2E5L Q;  4DF7 A;  2PNH A;  3GTL B;  3CCL A;  4IPC A;  5IWA Q;  3BDO A;  3QR8 A;  4XQN A;  3J7A 5;  4RHS A;  2K50 A;  3NPP A;  2Q2T A;  1IBL Q;  5JPN C;  2R7F A;  3KF8 B;  1IZ6 A;  1TY2 A;  4GKJ L;  3T51 B;  1HA5 A;  3GTM B;  1NE3 A;  5C4X G;  2KOL A;  5EPJ A;  4NXM Q;  3A8K E;  2PZT A;  1YHB A;  5KRU A;  2LMC B;  1SBB B;  3KF6 B;  2KVM A;  3J80 L;  3TRZ A;  3T1H Q;  1PFS A;  2JN4 A;  2CH4 A;  1XNR Q;  4A3E G;  3S1R H;  2R6G A;  2HD3 A;  1K8G A;  2A5H A;  2B2T A;  1EYD A;  2F0U A;  1BBW A;  1VQE A;  2DJG C;  2RDH A;  2XSC A;  3CF5 A;  3SXH A;  4DR4 Q;  2HDM A;  3VR4 A;  1EL0 A;  4DN4 M;  2B63 B;  3KUP A;  3S15 B;  1JJG A;  4IFD G;  2CFM A;  2DNC A;  4PV1 C;  1FD7 D;  2MPM A;  1LT5 D;  3FKI H;  4QY7 A;  3TP5 A;  2VS1 A;  1B3Q A;  4AH6 A;  3TBI B;  4L8J A;  2L11 A;  5C4J H;  4NDX A;  1ENA A;  2VQE L;  3LX0 A;  1JB3 A;  1HNZ L;  1DZ1 A;  3HKZ B;  1Z47 A;  3HOU H;  4QL5 A;  2ES2 A;  4RA8 A;  5DEH A;  1PHJ A;  2WIN B;  1F2M A;  1O7I A;  1V1P A;  5LMU Q;  4GLX A;  3LNN A;  2PI2 E;  3M7N A;  3BDL A;  1CTM A;  3HKZ E;  2JXM B;  4B3T Q;  4OWX B;  3J81 j;  3F2B A;  5H1S E;  1PH6 A;  3GTP H;  1I3Q B;  2F0W A;  4AIM A;  1B7Y B;  2BA1 A;  2V1C C;  2A6H C;  1AZQ A;  1KQS A;  5I9O A;  3Q8D A;  5GAD C;  2PPB C;  2QEJ C;  2RBM A;  3FRP B;  2K03 A;  4NMZ A;  2M2L A;  4C3J B;  2O4X A;  2JEA I;  5IYB H;  1EIG A;  3UDF A;  1HNX L;  1I6H H;  1PDQ A;  1V43 A;  5IYC H;  3E6Z X;  3Q0A A;  3TS2 A;  2NTT A;  3MFY A;  2PZU A;  2TMP A;  1WI5 A;  3ZYY X;  2MFI A;  3HS0 C;  3IRB A;  4EQN A;  3S9W A;  2O5J C;  4HJA A;  4DNR B;  2HUG A;  1JR0 D;  3M7G A;  1W6J A;  4RKB A;  2N49 A;  3GTL H;  2F0O A;  1O80 A;  4L5S A;  5CBE E;  4X65 L;  1WD1 A;  1Q82 C;  2F0J A;  4ZKC B;  1ET6 A;  5D3D A;  3A56 A;  4F8M A;  4DK6 C;  3SR1 A;  2UXD Q;  3W3A A;  1ESF A;  3EIV A;  2L0C A;  4DK3 C;  2RF4 A;  3NTH A;  3TP6 A;  2SOB A;  1CI3 M;  3BS1 A;  1Z7T A;  1IBK Q;  2NBF A;  1HQM C;  2F0S A;  3G48 A;  1X65 A;  3A74 A;  1PFM A;  1CKN B;  5KNB A;  1EFW A;  3IL8 A;  4Y52 H;  4Z9C B;  5M5X B;  4DR6 Q;  4MN3 A;  1CUK A;  1L0X B;  1I4Q A;  5LL6 S;  1HXY D;  3KK7 A;  3VA5 A;  3K57 A;  2JYO A;  4DV1 Q;  1E22 A;  4CHT B;  3CC4 A;  3K59 A;  2QGQ A;  5JVG 3;  4IN3 A;  4L5R C;  4IFD J;  1J5E Q;  2XVS A;  4A3M H;  1GUG A;  5EBD A;  3DEP A;  3TDQ A;  1FGB D;  1PH3 A;  1BCP D;  5AJ3 L;  1B1Z A;  2HCC A;  5FJ8 H;  1NMF A;  1F77 A;  1EYA A;  4QUC A;  1Q46 A;  1B2T A;  4ZLT F;  2ZM6 Q;  2DNE A;  4KHP L;  3DMU A;  2F3V A;  4IJH A;  3DUZ A;  3VR2 A;  1X56 A;  2KUM A;  1B44 D;  2MJ8 A;  2K6A A;  3M3Y B;  3HOV H;  3OTO L;  4GN3 B;  1BUV T;  3PO2 H;  1WTW A;  1EYC A;  3LWU A;  1DD2 A;  1YHQ A;  1RL2 A;  3MAQ A;  1EOV A;  2UXC Q;  3J81 i;  3PIP 3;  1E0B A;  1BBX C;  3PV0 A;  1VQO A;  1MSH A;  1F9S A;  1PH4 A;  2EY6 A;  2LS0 1;  3KF8 A;  2AUJ D;  2VQF Q;  3QIA A;  5C44 G;  2E2H H;  1OXV A;  4GOP C;  4JV5 Q;  3AFP A;  5HGQ A;  5LMN W;  4A3I B;  1EY4 A;  3D4R A;  1B8A A;  2K75 A;  2K28 A;  3KDF A;  2GN5 A;  4I7A A;  1AH9 A;  4NP5 A;  3NBI A;  1PA6 A;  2KEC A;  1SNQ A;  1F9R A;  1CSQ A;  5M5Y B;  4GOP B;  2OXP A;  2DN8 A;  2BE5 C;  3AEV A;  4ZAI A;  5NUC A;  1O7Z A;  1LTS D;  3QB3 A;  1KRT A;  5A2Q L;  1SMY C;  4J1M A;  1WTQ A;  1PTO F;  4O1N A;  1C9O A;  3VA7 A;  1LUZ A;  1P8L A;  1LT4 D;  2UUB Q;  1EY5 A;  4A3F G;  4WJ3 M;  2PI2 A;  5IT9 c;  4HJ8 A;  1D8L A;  1H9R A;  2TSS A;  3ZJY C;  1RF2 D;  1ONL A;  1N36 Q;  4XQJ A;  3RN5 A;  1LAB A;  1CHP D;  1X3P A;  4A3K G;  3HOZ B;  4H0L C;  5EJW A;  3H6M A;  4X3S A;  1NMG A;  3GTQ H;  4PNY A;  4JI7 Q;  4ZK9 B;  1T5E A;  1JE4 A;  4A4I A;  1U4P A;  4OXP A;  4U68 A;  1WTH A;  3MC0 B;  2E2I H;  1AW7 A;  5C4H A;  3NE5 B;  2F52 A;  2AQ1 B;  2C9O A;  1Y69 U;  1HNW Q;  3K8A A;  4J6H A;  2FXQ A;  4N8F A;  2UUA Q;  2Z4I A;  1SMY D;  4LFA Q;  1DON A;  2YV5 A;  3ERQ A;  4L63 B;  4CDF C;  4ME3 A;  2WP8 J;  4IO9 A;  4A76 A;  1KLU D;  4C3I H;  1G2T A;  3HOW B;  1CZG A;  3NSW A;  4HMJ A;  4CDD C;  4EQP A;  4BBS G;  3CRL C;  2JA9 A;  4R9W A;  1F9P A;  4ULL A;  1Q8K A;  2B3G A;  3K5O A;  4PQX A;  4GZY C;  3P1H A;  3DM1 A;  2CWA A;  3PGZ A;  3L3O C;  1D5Z C;  3MEF A;  2NVT B;  1PLF A;  4HMI A;  4DR7 Q;  1SE3 A;  2Y0S G;  4H13 C;  2K7V A;  1DCZ A;  4ZCK A;  4BBR H;  1Y1V G;  3TME A;  5COR A;  3X3M A;  1SNC A;  4YIJ A;  3TQY A;  5KGU A;  4NXN Q;  5C6A A;  2JA7 H;  1QUQ B;  1B50 A;  3QWN A;  3NTK A;  3HP3 A;  5IP9 H;  3I2Z A;  2JA8 H;  2LY7 A;  4AYB B;  4BS9 A;  1X3F A;  2EYJ A;  2I5H A;  4HSP A;  4YCW A;  3J7Y W;  2CQO A;  3P75 A;  3S1Q B;  5IGB A;  5M5W H;  1EQV A;  1EUJ A;  2XGT A;  2I46 A;  3MZ5 A;  4UP8 A;  1H9M A;  1HZ9 A;  1JMC A;  1ZKO A;  4ZRZ A;  2RHQ B;  2R92 H;  1QWY A;  1Y8O B;  2SNM A;  5E3F A;  3OW2 A;  3GTG B;  3K6O A;  4K6L A;  3RNU A;  1W6K A;  1A62 A;  1ASY A;  2UXB Q;  4LNQ A;  1RJT A;  3J80 c;  1IYJ B;  2SDF A;  1SND A;  4FP5 D;  3T56 B;  1D5M C;  2ZTC A;  4X66 L;  1M1K C;  4KHZ A;  1U5K A;  2I5L X;  5GQO A;  1TY0 A;  3FPP A;  3NEL A;  4R4T A;  5IGG A;  3M85 A;  2IX0 A;  1SXT A;  5CMD A;  1BR9 A;  1KAW A;  1LTB D;  4BY1 B;  1ZYR C;  4HJ9 A;  1ENF A;  1DXM A;  4RWS C;  1YZ6 A;  2RSO A;  1K3B C;  2F4I A;  4J15 A;  4LF6 Q;  1EU3 A;  4KD4 A;  4DXG A;  4X62 L;  3QOJ A;  2RA4 A;  1U4R A;  2OTJ A;  2NVX B;  3EBE A;  1LLR D;  2JA6 G;  1G2S A;  4A3J H;  3I70 A;  1N32 Q;  2LFN A;  2NYZ D;  3RZO B;  4A3D H;  2VW9 A;  4PMW A;  1UNS A;  2EPB A;  3Q22 A;  5IGC A;  3SK5 A;  2KCT A;  3L0O A;  1JB7 A;  1RTN A;  4GLV B;  2EYP A;  2Z9H A;  3A8J E;  1Q3L A;  3DWQ A;  4R4O A;  4GOP A;  4JYA L;  1ICW A;  1UE6 A;  1ZYR D;  3GV6 A;  3MXU A;  3RMH A;  3KJO A;  3I91 A;  4DV5 L;  1D6E C;  4H44 C;  2VUM G;  1CZW A;  3MXG A;  4Y7N B;  4BY7 B;  5FLM G;  1JC7 A;  2WAQ B;  4JVZ A;  2QA4 A;  1RD9 D;  3J7Z C;  1R4Q B;  4JBJ A;  2QF7 A;  1NNX A;  1TWH B;  5BR8 Q;  1K83 H;  4UAI A;  5CV9 A;  3S1Q H;  4C3H H;  1EOT A;  4JI5 L;  2PZW A;  3H91 A;  4DV4 L;  1TVX A;  3OYY A;  1L0Y B;  5HUR A;  1K3R A;  1GO3 E;  5M3F B;  1HPC A;  5AFW A;  1WFQ A;  2FMC A;  4O2D A;  3ULL A;  1DOM A;  3VR6 A;  1SYD A;  2Q8R E;  1KLG D;  2EYH A;  5E7N A;  2F4V Q;  3SGI A;  1HRJ A;  1C7Y A;  3SK4 A;  5ELF A;  4R8N A;  4DV2 L;  1Q81 C;  1Y1W B;  1U4L A;  4DR5 L;  3AYH B;  4HSV A;  3M9B A;  1UE1 A;  1JOQ A;  1I50 B;  4CJ1 B;  3K5M A;  3UDG A;  3FKI G;  2AQ3 B;  1WTX A;  1SFO B;  4JI4 Q;  3I4M H;  5KYI A;  1N33 Q;  4ZKB B;  1WYD A;  1PYW D;  1KNE A;  3I7F A;  3I4N H;  2F0P A;  2J0T D;  3EJI A;  2D9U A;  3TSS A;  3HOU G;  3I55 A;  2XWB B;  2ENB A;  5CV6 A;  1G6P A;  3KJP A;  4JOI A;  4TRD A;  5FLX E;  2ZJQ A;  4LF9 L;  4YWK A; 
#chains in the Genus database with same CATH homology
 1A0I A;  3U4V A;  1C0A A;  3A0J A;  1X55 A;  1BBW A;  3BU2 A;  1VQE A;  3E0E A;  3G6E A;  1Q7Y C;  2R7Z G;  4A3G G;  3STB C;  3CF5 A;  3F8T A;  4DR4 Q;  1V1Q A;  2N3S A;  2IHF A;  2WFW A;  1FJG Q;  3HOZ H;  1JJG A;  3HOW G;  3M4O H;  4JI7 L;  4IFD G;  2CFM A;  1QUQ A;  4R4Q A;  1R9T H;  3RN2 A;  3FKI H;  4QY7 A;  1J6Q A;  4DAY B;  4IPD A;  2VS1 A;  1XMO Q;  4XTC S;  1GD7 A;  4AH6 A;  5C4X H;  3HFZ B;  5C4J H;  5JJL A;  2VQE L;  3CME A;  2UXD L;  2ASB A;  1HNZ L;  4IFD I;  2LXJ A;  3L2P A;  4LUZ A;  5IYB G;  1Z47 A;  1VQ8 A;  4QL5 A;  2CWP A;  2ES2 A;  2UUA L;  2WB1 G;  4HID A;  3HOU H;  4QQB X;  4A3E H;  4POG A;  4GKK L;  4PZ7 A;  2JK8 A;  1TWC H;  1PHJ A;  1VQF A;  4QIW E;  1FVI A;  4DV7 L;  4GS3 A;  4UPA A;  1O7I A;  1W3S A;  4YCV A;  5LMU Q;  1IBK L;  1YEZ A;  2R7Z H;  4GLX A;  1XJV A;  2D0O A;  2PI2 E;  3M7N A;  3S17 H;  4Y7N H;  1VQP A;  4A3G H;  3HKZ E;  4MZ9 A;  3NBH B;  2VZA A;  4OWX B;  5FLX c;  3J81 j;  3F2B A;  1HH2 P;  3CCS A;  4B3T Q;  3STB D;  1Y1W G;  5H1S E;  1PH6 A;  2ATW A;  1EIY B;  3GTP H;  2EQS A;  2IT1 A;  1YVC A;  1LTL A;  3HOW H;  1SE8 A;  4EQ5 A;  4A93 G;  4APV A;  4AIM A;  1B7Y B;  2BA1 A;  2V1C C;  3AQQ A;  3GTO H;  4GKJ Q;  4LF4 Q;  1TWH H;  4AYB G;  1KQS A;  3Q8D A;  5GAD C;  1HJP A;  2XTI A;  5JJK A;  1TWA H;  1JJC B;  3M4P A;  1GM5 A;  3CD6 A;  4L5T A;  4DR1 L;  2JEA I;  4UY8 C;  1NTG A;  5IYB H;  4B3S L;  3UDF A;  1HNX L;  2ID0 A;  1YJ9 A;  2NVT H;  3TS2 A;  1V43 A;  2OQ0 A;  5IYC H;  1HR0 L;  4LF9 Q;  1I6H H;  3CCU A;  2UUC Q;  2MO1 A;  2Y0S E;  1Q1B A;  1WI5 A;  1WJJ A;  2AHO B;  2K52 A;  3PF5 A;  3CXC A;  3BJU A;  2MFI A;  4DR3 L;  1PH5 A;  3IRB A;  1VQI A;  1VQG A;  4HJA A;  4JI1 Q;  1NY4 A;  3VDY A;  3D31 A;  4X66 Q;  1XTD A;  5JJI A;  2N49 A;  3GTL H;  4BA1 I;  1YJN A;  1UE7 A;  3S16 H;  2UU9 L;  4L5S A;  4OWT B;  1L1O A;  4X65 L;  1Q82 C;  4A93 H;  1WOC A;  2Z6K A;  2BA0 A;  3HKS A;  4IPH A;  4LFB L;  3JC6 6;  2A8V A;  4OON A;  1X6O A;  4DK6 C;  2VQE Q;  3CQZ H;  1GKH A;  1VQM A;  2UXD Q;  2YU9 H;  1VQH A;  3EIV A;  1UEB A;  2WAQ E;  2OWO A;  1Q1E A;  4DK3 C;  1VQA A;  2VL6 A;  4A3M G;  2GVA A;  2RF4 A;  1PYS B;  1QVF A;  4GKK Q;  4DV0 L;  2C35 B;  4DPG A;  4UP9 A;  3CP0 A;  4JCV E;  1IBK Q;  4JI2 L;  4K0K L;  4BY1 G;  1B70 B;  3G48 A;  3GTG H;  3S1N H;  5FJ8 G;  1X65 A;  3A74 A;  5GRO A;  3CCJ A;  1CKN B;  1NBW A;  1N9W A;  1U0L A;  1EFW A;  3H0G G;  4JBW A;  4H02 A;  1BBU A;  4HJ5 A;  4Y52 H;  1Q12 A;  2K5V A;  4DR6 Q;  1CUK A;  4L5Q A;  4JOI C;  2AMC B;  1WCM H;  4R4I A;  3NEM A;  4IJL A;  4DAM A;  1KL9 A;  2HQL A;  4LF8 L;  3ER0 A;  4DV1 Q;  1E22 A;  3HOV G;  3I4O A;  3CMA A;  3CC4 A;  1S40 A;  1VQ9 A;  2KHJ A;  4DR1 Q;  3PO2 G;  3KOJ A;  4B3S Q;  2QGQ A;  1PH2 A;  2JQO A;  1I94 L;  1HNX Q;  3KFU A;  4L5R C;  3BZC A;  3FHW A;  4DUZ L;  1J5E Q;  1HR0 Q;  4JYA Q;  4IFD J;  4A3M H;  4GNX A;  1PV4 A;  1OXS C;  4YY3 Q;  3ERS X;  4DR3 Q;  1PH3 A;  5AJ3 L;  3TEH B;  4BY1 H;  1VS0 A;  3S24 A;  5FJ8 H;  3UE0 A;  1YNX A;  1NMF A;  4LF6 L;  1Q46 A;  3S1M H;  1A8V A;  2ZM6 Q;  3H0G H;  3I56 A;  4DV6 L;  1L2F A;  4KHP L;  2UUB L;  3DM3 A;  2ZJR A;  3F2D A;  4AQY L;  1QVG A;  4KLK A;  4IJH A;  1X56 A;  2NVX H;  1T9H A;  2N8N A;  4QGU A;  4A3B G;  4DNI A;  4BY7 G;  1XMQ L;  4LWC A;  1A63 A;  2QEX A;  1JJ2 A;  1N36 L;  2WAQ G;  3H15 A;  3HOV H;  3OTO L;  3CC7 A;  1EYG A;  1JT8 A;  4GN3 B;  1VQN A;  1K9M C;  4DV4 Q;  1EQR A;  4JI5 Q;  3PO2 H;  3RZO H;  1YHQ A;  1RL2 A;  3J81 c;  2E8G A;  3H3V I;  4DKA C;  1SRU A;  3S2D H;  1EOV A;  2UXC Q;  4K0K Q;  3J81 i;  4XIG S;  5J3B A;  1VQD A;  3PV0 A;  4X64 L;  1VQO A;  1PH4 A;  4JG2 A;  4TQU S;  1HNW L;  1AE3 A;  3PSI A;  2ALY B;  5M3F G;  2JJQ A;  2PQA B;  4P73 A;  2VQF Q;  5C44 G;  1HZA A;  3CCE A;  2E2H H;  4X6A H;  4LFA L;  1KIX A;  4PZ8 A;  1OXV A;  2DUD A;  2KEN A;  4GOP C;  1KC8 C;  3AFP A;  5HGQ A;  5LMN W;  4DV2 Q;  4A3L G;  4JV5 Q;  4GN4 B;  3U4Z A;  4DR5 Q;  4QJF A;  1B8A A;  2K75 A;  4JI3 L;  3K80 C;  2GN5 A;  3KDF A;  4LF8 Q;  1AH9 A;  4A3B H;  2A1A A;  3H3V H;  4BY7 H;  4YHH L;  1PA6 A;  1CSQ A;  3A5U A;  4B3R Q;  4GOP B;  2YTY A;  1AE2 A;  2NZO A;  4C2M H;  1FL0 A;  4HJ7 A;  1HZC A;  4DUZ Q;  3AEV A;  2OQK A;  5BR8 L;  1E7Z A;  2AWO A;  4DV3 L;  1L1O C;  4PZ6 A;  2A19 A;  1EIF A;  1HZB A;  5AJ3 Q;  5GAE C;  3G71 A;  1W2B A;  4LF7 Q;  1KRT A;  3FP9 A;  2K14 A;  4R4C A;  1XNQ L;  1C9O A;  5M3F H;  1LUZ A;  1P8L A;  1VQ5 A;  4DR7 L;  4LF5 L;  4KHP Q;  2UUB Q;  1RIP A;  3CCQ A;  3UDX A;  5C44 H;  4A3F G;  4JI0 L;  2BH2 A;  1CKO A;  4LFC L;  4A3L H;  1VQB A;  2PI2 A;  5IT9 c;  4HJ8 A;  3L7Z C;  1D8L A;  4WJ3 M;  1E1T A;  4RG1 A;  1P16 A;  3ZJY C;  1NJI C;  2F4V L;  1N36 Q;  1TXY A;  3RN5 A;  1S72 A;  2MNA A;  2MQH A;  3RLF A;  5GAG C;  3OTO Q;  4A3K G;  1Y14 B;  4JI6 L;  4NXN L;  1N8R C;  4WJ4 A;  1NMG A;  3U58 A;  1Y1W H;  3GTQ H;  1D7Q A;  4KI0 A;  4TVA B;  4JI7 Q;  1MIU A;  1TWF H;  1N34 L;  4A4I A;  1UWV A;  2RHS B;  4FDB A;  1KHI A;  4OXP A;  4JI8 L;  2B63 G;  2E2I H;  1OXT A;  2NZH A;  1I50 H;  4X64 Q;  5ELN A;  1Z9F A;  2F52 A;  4P71 A;  1HNZ Q;  1HNW Q;  3K8A A;  3S14 H;  2DGY A;  2FXQ A;  3MXN B;  1IXR A;  4RMF A;  1SFO H;  2CCZ A;  2KBN A;  2UUA Q;  3GTM H;  2N78 A;  3CPF A;  1SR3 A;  4LFA Q;  3F1Z A;  2F3I A;  3PUX A;  4A3F H;  4DV7 Q;  4BBR G;  1I5F A;  2YV5 A;  3HKZ G;  2Q2U A;  1XNR L;  4JI3 Q;  5JEA J;  4ME3 A;  3UDI A;  4OX9 L;  2WP8 J;  4YHH Q;  4IO9 A;  4A76 A;  2UXB L;  1YIT A;  2LSS A;  2K5N A;  2JA7 G;  3BZK A;  4C3I H;  4A3K H;  3S2H H;  2IY5 B;  3PCO B;  3LGJ A;  3RR5 A;  4BBS G;  5IP9 G;  4DR4 L;  3K0X A;  2JA8 G;  1EWI A;  2JA9 A;  1GVP A;  2NVY H;  1DGS A;  1Q8K A;  2B3G A;  4DV3 Q;  3CPW A;  3CCR A;  3HOY G;  3ICE A;  2B63 H;  2CWA A;  3PGZ A;  4HIO A;  3S15 H;  4JBM A;  5LMN L;  1CKM A;  3E9I A;  1MKH A;  2BH8 A;  2D62 A;  3CAM A;  1LYL A;  3MEF A;  5K36 G;  3PUZ A;  1XMO L;  3K81 C;  1YHA A;  4DR7 Q;  4A75 A;  4OWW B;  4LF5 Q;  1JE5 A;  1H95 A;  2Y0S G;  2R92 G;  3D0F A;  2VY3 A;  4LFC Q;  3PUV A;  4DR2 L;  2B29 A;  2H5X A;  4BBR H;  4POF A;  5JEA G;  1Y1V G;  3WWV A;  1PH7 A;  4UP7 A;  3NEN A;  4JI6 Q;  2WB1 E;  1OXX K;  3TQY A;  3UE1 A;  4NXN Q;  1G51 A;  1VQJ A;  2I5M X;  2NN6 G;  2JA7 H;  4OO1 G;  1QUQ B;  4NPS A;  2I0Q A;  1IBM L;  1N34 Q;  5IY0 A;  4BBS H;  5IP9 H;  3I2Z A;  2UU9 Q;  2JA8 H;  4X65 Q;  4B3T L;  1PH9 A;  1X3F A;  2I5H A;  4IOC A;  1EQQ A;  1M90 C;  3HOX G;  4LFB Q;  2OCE A;  2Q2I A;  4YCW A;  1PYB A;  4OO1 I;  2HHH L;  1N32 L;  1I3Q H;  2CQO A;  3TRE A;  3CW2 C;  5M5W H;  5C3E G;  1TWG H;  1EUJ A;  5C0X J;  1G29 1;  3T1Y L;  2XGT A;  4LF4 L;  4IPG A;  4UP8 A;  1HZ9 A;  2PMZ E;  1JMC A;  2JEB I;  1S3O A;  4DV0 Q;  2RHQ B;  3RLO A;  2R92 H;  3KDF B;  4JI2 Q;  4MNO A;  4C3J H;  1LM0 A;  5IYD G;  3K7U C;  3OW2 A;  3RNU A;  1A62 A;  1X3E A;  1Y1V H;  1ASY A;  4B3M L;  4LNQ A;  3KYH C;  3J80 c;  3PUY A;  3U50 C;  2UUC L;  2UXB Q;  1SRO A;  5HY6 A;  1IYJ B;  1YJW A;  1MJC A;  1PVO A;  1SLJ A;  4IOA A;  3AFQ A;  4P72 A;  3J80 i;  3CCV A;  2OTL A;  4MTN A;  1VQ7 A;  3G4S A;  4P74 A;  2Q2H A;  2ZTC A;  4O0A A;  4YWM A;  1BVS A;  4JI1 L;  3KF6 A;  4YCU A;  4X66 L;  4A3J G;  1M1K C;  4KHZ A;  3HOX H;  1U5K A;  2L15 A;  5LMN Q;  2I5L X;  4A3D G;  5GQO A;  5C0X G;  1E3P A;  3DLL A;  2E2J H;  5C3E H;  4DUY L;  1I94 Q;  4ALP A;  3E9H A;  4LUO A;  4LUV A;  3NEL A;  4NB3 A;  4R4T A;  3M85 A;  2IX0 A;  2HT1 A;  1K8A C;  2HIV A;  1MJE A;  4DR2 Q;  1E1O A;  1KAW A;  5IP7 G;  2Z6K C;  5C0X I;  4HJ9 A;  1Q86 C;  4BA2 I;  5IYD H;  5IYC G;  5ELO A;  1K0R A;  3ULP A;  1YZ6 A;  4J15 A;  4LF6 Q;  3GD7 A;  4X62 L;  3ULJ A;  1YBY A;  2AWN A;  4DV6 Q;  2JA5 G;  1VQ6 A;  1PH8 A;  1IBM Q;  3W5O A;  2R93 G;  1L1O B;  3GDE A;  1IL2 A;  1K73 C;  1XPU A;  2OTJ A;  4GN5 A;  2D0P A;  1VQC A;  4AQY Q;  3EBE A;  1VCI A;  5IE8 A;  3GTK H;  5DLQ E;  2VNU D;  2JA6 G;  1XMQ Q;  3M4Q A;  4A3J H;  2YYZ A;  2HHH Q;  4DR6 L;  1N32 Q;  1OXU A;  2PQA A;  5M5X H;  2E5L L;  3W1G A;  3T1Y Q;  4A3D H;  2VW9 A;  2RCN A;  4PMW A;  5IWA L;  4DV1 L;  1X9N A;  1ASZ A;  3PO3 G;  1YI2 A;  4BXX G;  1VQK A;  1QVC A;  2EIF A;  4JC0 A;  4R1J A;  2KCT A;  1X54 A;  3L0O A;  5IP7 H;  1SN8 A;  1JB7 A;  3KLW A;  4GOP A;  4GLV B;  1IBL L;  4R4O A;  1J5E L;  4B3M Q;  3PF4 A;  4JYA L;  3K7A H;  1UE6 A;  4YY3 L;  4HIK A;  1XPO A;  4JI4 L;  3RLN A;  5GAH C;  3KJO A;  4NXM L;  3PIP A;  2JA5 H;  1N33 L;  4DV5 L;  3B6Y A;  2VUM G;  2R93 H;  2CKZ B;  1X3G A;  3F2C A;  2K5H A;  4GNX C;  2KCM A;  1UE5 A;  3T1H L;  2ZM6 L;  1KXL A;  1XPR A;  5FLM G;  2GVB A;  2JA6 H;  4A3C G;  2QA4 A;  1WCM G;  2MO0 A;  1FGU A;  3W1B A;  1YIJ A;  1PH1 A;  3CC2 A;  2ZTE A;  2LXK A;  5M3M G;  3JAM c;  4DUY Q;  3J7Z C;  1E24 A;  3TS0 A;  4A3I G;  5EAY A;  2YTX A;  4JBJ A;  4GLA C;  4GNX B;  1L0W A;  3PO3 H;  3JAM i;  5BR8 Q;  4BXX H;  2R7D A;  1K83 H;  3S1Q H;  3M3Y H;  4C3H H;  1FJG L;  4JI5 L;  4DV4 L;  2IHE A;  3OYY A;  1K3R A;  3I4M G;  1GO3 E;  1VQL A;  1XNQ Q;  2UXC L;  3GTJ H;  4X62 Q;  1WFQ A;  2HIX A;  4O2D A;  3ULL A;  1VQ4 A;  1QZG A;  2ZJP A;  3GO5 A;  3I4N G;  4YWL A;  4JI0 Q;  4EX5 A;  2VUM H;  2YTV A;  2Z0S A;  5E7N A;  3RZD H;  2VQF L;  2F4V Q;  1V9P A;  2EXD A;  3SGI A;  4LW1 A;  5FLM H;  1C7Y A;  2E5L Q;  4A3C H;  4JV5 L;  2PNH A;  2ZTD A;  4DV2 L;  1Q81 C;  1BKB A;  5M3M H;  4DR5 L;  3AYH B;  4IPC A;  5LMU L;  1QZH A;  3CCL A;  1SMX A;  5IWA Q;  4A3I H;  1KD1 C;  4P75 A;  2IX1 A;  3M9B A;  1HR0 W;  1UE1 A;  4JI8 Q;  1CSP A;  3J7A 5;  1CKN A;  3EN2 A;  3HOZ G;  3PUW A;  2K50 A;  2JE6 I;  3HOY H;  4B3R L;  2Q2T A;  5M5Y H;  4HIM A;  2NN6 I;  3CCM A;  3UDG A;  2R7F A;  3FKI G;  1IBL Q;  2NVQ H;  3KF8 B;  2K4K A;  1IZ6 A;  4GKJ L;  4JI4 Q;  2AKW B;  3I4M H;  1NE3 A;  5C4X G;  1KRS A;  4NXM Q;  4LF7 L;  1N33 Q;  4DV5 Q;  1YHB A;  1WYD A;  4AYB E;  3I7F A;  2ZJQ A;  3KF6 B;  4JBK A;  3I4N H;  3HOU G;  2KHI A;  3I55 A;  3TRZ A;  4PG3 A;  3T1H Q;  1PFS A;  1XNR Q;  4A3E G;  3S1R H;  3KJP A;  1OTC A;  4JOI A;  1G6P A;  4OX9 Q;  2R6G A;  1K8G A;  4LF9 L;  3PIO A;  3A5Z B;  4YWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...