5IGBA

Crystal structure of staphylococcal nuclease variant delta+phs l36d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igbA00
1EY6A 4KD4A 4ODGA 3NUCA 4DF7A 4E6IA 4PNYA 3SR1A 4IALA 5I9PA 3EJIA 3OMCA 5J1ZA 1EZ6A 3DHQA 2F0TA 2F0QA 3HEJA 4QB4A 1SNMA 5IOCA 4OL7A 1A2TA 4PMBA 1JOOA 4ZQ3A 5C5LA 5JOBA 4B9WA 2NUCA 2EYPA 5C3WA 5J39A 4B9XA 2EYHA 1STAA 2F0NA 2O4XA 2EY2A 3SK6A 1A3VA 2F0KA 5CV7A 3BDLA 3MVVA 3LX0A 1EY0A 4KY6A 4F7XA 4KJOA 1JOKA 1IHZA 1SNQA 3ERQA 3MZ5A 2F0UA 4EQPA 1EYAA 3SK5A 5JAVA 2F0FA 3PMFA 4J1MA 4K6DA 1STNA 1SNPA 4EVOA 2EYJA 4EQNA 4K5VA 5E3FA 5ISRA 5EKLA 5C3XA 2SOBA 2ENBA 4N9TA 2F0WA 1U9RA 4KTAA 5DAUA 3TP5A 3TP8A 2F3VA 4DU9A 4MIUA 5HURA 5K5PA 1A3TA 5C4HA 4RKBA 1STBA 2OXPA 2F0GA 4EQOA 4I65A 5I9OA 1KDCA 1SYFA 4QF4A 4WORA 5C6AA 3C1EA 2HQEA 5IGGA 5CC4A 3NK9A 1SYEA 3P1HA 5IODA 4IUNA 4LAAA 3SXHA 1KAAA 1F2YA 1SNOA 1F2MA 1SYGA 2PZUA 4NP5A 4KV6A 5CV9A 3T16A 4ZUIA 1TR5A 1RKNA 2PQEA 4K5WA 1SYDA 1EQVA 2SNSA 5IGBA 2PW5A 4ME5A 3SK4A 5KEEA 5M9OA 2EYFA 5KGUA 1KABA 3S9WA 1STHA 2EYLA 1EZ8A 2RDFA 5DEHA 4HMJA 1SNDA 2F0MA 3D6CA 3MEHA 1TT2A 5IGDA 5EKKA 3D4DA 5F2DA 3QOLA 3U9OA 2KQ3A 4J6HA 5IGEA 3ITPA 4K2KA 1EY7A 3HZXA 1F2ZA 4QMGA 1A2UA 3C1FA 3DMUA 4KJNA 1II3A 2PW7A 4KY7A 2F0IA 2RKSA 3R3OA 4ID6A 5CV5A 4K8JA 4DGZA 2F0JA 3SHLA 5IIFA 5IGCA 2F0DA 4NDXA 4TRDA 3T13A 3OMGA 3OWFA 1NUCA 5CV6A 2OEOA 2QDBA 1EY8A 3P75A 1EY5A 2F0LA 2RBMA 4K14A 4K2LA 2F0PA 3NHHA 3MHBA 2PZWA 3MXPA 5IGFA 2EXZA 3VA5A 1STYA 2EYMA 2F0VA 1ENCA 3NXWA 1AEXA 4HMIA 4HTHA 5CV8A 2EY6A 5CV4A 4KD3A 5EGTA 3QOJA 5C4ZA 1JORA 3E5SA 4H7BA 3TMEA 5HGTA 4K5XA 1SYCA 1KDBA 2KHSA 3EROA 4NMZA 4S3SA 3RUZA 1JOQA 5J22A 1EY9A 1EY4A 2M00A 4KHVA 5NUCA 2F0EA 3V2TA 1EYDA 3D8GA 4RKLA 3NP8A 4R8NA 3SK8A 2F3WA 3H6MA 5CGKA 4IZ8A 4DFAA 1ENAA 2F0HA 1SNCA 4K8IA 5C5MA 2EY5A 3BDCA 1A3UA 5CR3A 1NSNS 2WACA 5KIXA 2SNMA 1EYCA 4WRDA 3D4WA 4G57A 1STGA 2F0SA 3OSOA 3TP6A 2F0OA 5I6WA 1SYBA 3NQTA 3EVQA 3QB3A 3TP7A 1TQOA 4NKLA 5I6YA 2EYOA 2PYKA 2OF1A 4YIJA 4N9PA 5E1FA 4ZUJA 2LKVA 2PZTA 1KDAA 4F8MA 5KRUA 5KYLA 5KYIA 2EY1A 4KY5A 4PMCA
chains in the Genus database with same CATH superfamily
1RCVD 4LFAQ 3CCJA 1WVLA 4G7HC 3EQLC 1F2LA 2R92G 1XTCD 1VQ5A 1VMPA 1CHQD 3OYYA 3G6EA 5DM73 1VDZA 5C0XJ 3E9HA 3S2DB 3E6ZX 1K83B 1QNKA 3VR4A 4LF5L 4GKJL 1K8MA 2TMPA 1NJIC 1EYAA 2AQ3B 1QZGA 4KLKA 4GOPC 4BY1G 3PO3G 4JYAL 1DJRD 3HP3A 4IJLA 1U9RA 1PH3A 4M1UB 3PUWA 3F2BA 2B2TC 4RKBA 3OIQA 4P71A 1ASYA 2O5IC 1RHPA 3NK9A 1VQBA 2RA4A 3D31A 1X3GA 1IBLL 3CCLA 2V4DA 5FK9C 4BS9A 4O42A 3HOYH 3SK4A 1DYQA 1KLUD 4DV5Q 4IO9A 1VQFA 3G6JB 3S2HB 4DNRB 2BCOA 3DM3A 4BBRH 3J81E 3B6YA 2KUMA 3RLFA 1K3RA 1CT1D 2RF4A 1I6HB 5M5YB 1V1OA 3VDYA 1HCZA 2C9OA 1PTOB 4N8FA 3PIP3 4A3DH 3X3MA 4KHPL 2N78A 5JJLA 3NELA 4B3ML 2ICIA 5ELOA 4FVMA 1VQAA 1XNQQ 1I4GA 1ENCA 1MI2A 2RSOA 4BA1I 2CKZB 5D14A 4BY7G 5AJ3L 1QJOA 3KDFB 1HNWL 1JJCB 4OWTB 2NVTB 2K5QA 1HA6A 3S1MB 2PNHA 3D8GA 1PRTC 4DFAA 1GM5A 2AMCB 3NTKA 4X6AH 4HJ7A 3JC66 4MN3A 1L1OC 2EQSA 2HD3A 1PYWD 4O0AA 3D3RA 2VQFL 2EYOA 3MXNA 1A6XA 4F8MA 1D5ZC 3DEOA 2HHHL 1XMOQ 4JI5Q 3GTPB 4H02A 3DLLA 3BDOA 2CFMA 1PH5A 2A69D 3MTSA 4ME3A 1HNZL 5M3MB 3NEMA 2L15A 4R9WA 3R2TA 1NCVA 2XRSD 5BN4A 3K5OA 4ZQ3A 4IOAA 1Q46A 2NUCA 3IRBA 3BDLA 2C35B 1Y14B 3RZDH 1MJCA 1AZQA 2NTSA 2CH4A 1CHPD 4DR1L 4IFDI 2KEEA 1WFQA 4OONA 2EYJA 4DAVA 3BVZA 4N9TA 1MIUA 2F0WA 3M4QA 4C3HB 2F1MA 4DV3L 3HS0C 3CAMA 2UUBQ 4V0BA 2OXPA 3CP0A 3EIVA 2G5DA 3SGIA 1KC8C 2XWBB 3GTMH 5M3MG 4LAAA 2A69C 2D0OA 2A6HD 5CV9A 4ZLTF 1NR2A 3LWUA 2LS01 1STHA 3MEHA 1JWSD 3KBGA 4PMWA 1TY0A 1Q8KA 5C44B 5F2DA 5IGEA 2B2WA 2EJFC 4L6TB 4K2KA 4QMGA 1UAPA 4RG1A 5CV5A 4BWGB 2A68D 4AQYL 4C3HG 1D1KA 3J7ZC 4LF8L 1ENFA 1VMCA 3HOUH 4LFBQ 1G2SA 1SFOB 1EL0A 1HZCA 4EQ5A 1TWFB 4J8QA 1EY5A 4WJ3M 2A73B 3MHBA 4FF1A 3BG3A 4IPHA 3STBD 1E2WA 2K7VA 4APVA 3GTJB 4HTHA 2AQ1B 1Q12A 3A8KE 1KHIA 1QUQB 5BR8L 2E2HH 1E1TA 3L3OC 1HQMC 2DUDA 2F0EA 5C44G 3M3YH 1CQVA 1RD9D 2CHBD 4R8NA 2JA6H 1GD7A 1LT5D 2LSSA 4NXNL 1Q8IA 4B3TQ 1QB5D 5KIXA 1CKMA 3OSOA 2ZTEA 3KFUA 1EEFD 1L0WA 1YHQA 1PTOF 2YU9H 1ICWA 1V9PA 1PV4A 4CDFC 3CD6A 4GN5A 5IT9c 1WTHA 4A3JG 4RCOA 4ODGA 1KNEA 4K0KQ 1FNWA 2M2LA 4BBSH 1T5XD 2F0TA 4P2CB 4A3EG 5A35A 1IL8A 3J80c 1I4RA 3NWTA 4B9WA 3PIPA 2Q2TA 3NBIA 2EYPA 3MFYA 3WWVA 3T1YQ 1F9SA 3PUZA 1D5XC 4B3SQ 4FNFA 1F9PA 1TKWB 2NVQH 4RGOS 2YTXA 2ZJPA 1FNUA 4EVOA 2JA5G 3FKIB 1DONA 4U673 5E3FA 1GUWA 4FXKC 5C3XA 1K8AC 2F3VA 3K7UC 2JA7B 1XMQQ 1N36L 2RCNA 3CCMA 3S1RH 1AN8A 3HOVB 1DCZA 4WORA 5C6AA 3HG9A 5CC4A 3S1QB 1Y1VB 4IFDH 1LTAD 4A4IA 1F2MA 4ZUIA 3I55A 2E2JB 3QG1A 4RAUC 1K28A 3NE5B 5KEEA 2GVAA 4YCVA 5M9OA 2K28A 2EYLA 3SVMA 3FP9A 2HIXA 5CMDA 4X64L 2C5CA 2VL6A 4MHEA 2QEJC 5M3FH 4JI6L 4GKKQ 3QOLA 3M4OB 4JBMA 2BDNA 3FKIG 2JK8A 2Z1CA 3FDTA 2PW7A 2UUCQ 4ID6A 2ES2A 3TZDA 2PPBC 2KCNA 3S1NB 4XT1B 2F0LA 2ICEC 1FD7D 1FVIA 2L5TA 4LFAL 3WOFA 2D2CC 4HMIA 1RIPA 3S16H 2I5HA 1XX8A 2CQAA 2EY6A 2J7ZA 1HXYD 4GOPB 1IBKQ 5JJIA 1RF2D 2Z6KC 1HTPA 1B4OA 2ASBA 3I70A 3VR3A 2JA8H 5KNBA 5CGKA 5JEAJ 4JOIA 2NVYB 2X6LA 2CWAA 4C56C 3GTGH 4AYBE 3R93A 1D2BA 1E0BA 4C3JB 3IFTA 1WJJA 3W2DA 5E1FA 5M5WB 4I7ZC 4Y7NB 4AYBG 1OXXK 1TIID 4CBVA 1IBLQ 4KY5A 3T1HQ 4FF2A 3F8TA 1Z6HA 4IALA 1T9HA 3EJIA 3QWNA 1KAWA 2XTIA 5E7NA 1LO5D 5HY6A 4X65L 4R4IA 1N32Q 3M4YA 4DV5L 2O4XA 4YCWA 3SK6A 1WYDA 2RQXA 1UE6A 3T51B 4A3GB 4KHPQ 1C4QA 3I4MH 2JA9A 4G7ZC 1H9MA 3U50C 4K5VA 4TKOB 4X3TA 2ZJQA 4HJ8A 1K3BC 1X3QA 3WDNA 2JQOA 5C4HA 1KL9A 5AJ3Q 2IX0A 4EQOA 5C4XH 1H95A 1XNQL 4RWSC 3J81j 3P1HA 2Z4HA 3MXGA 1JT8A 1LT3D 4DV6Q 1F2YA 1L1OB 2WKCA 3K58A 4CKBA 3U58A 4A3KB 1XPOA 1Q81C 4UY8C 3KF6B 1KABA 1A15A 1CA5A 4KKUA 1JCKB 1MD2D 1V1PB 1YJ9A 3CMEA 2VQFQ 2WV6D 1XNRQ 2K75A 2R92H 1EY7A 1JC7A 2B2YA 1V43A 4OO1G 1S40A 1B70B 3OIPA 3VYSA 2O2LD 2WAQE 1SDFA 1GO3E 4OELB 3C2PA 2BH8A 1XMOL 4JI5L 4RCNA 1GHKA 2PZWA 2EXZA 2PI2E 1EIFA 2GVBA 2WKDA 3KF8A 1KD1C 2WAQG 1VQHA 4BY1H 4KD3A 3PO3H 1JICA 3BZDB 5HGTA 1SYCA 3RUZA 4IOCA 1X56A 4KHVA 1NAPA 3FMCA 4H44C 3A74A 5H1SE 4GNXA 1MKHA 1WOCA 1PFBA 4CDCC 5LHY1 4Y52H 3GV6A 2PMZE 2L55A 5D3IB 3S2DH 5I6WA 2B63B 2B2UA 4UP7A 1K83H 5IWAQ 2AWNA 4IUTA 5EPKA 4DR5Q 1QUQA 3M4PA 5KYIA 5FKAC 4X3SA 4FP5D 4A93B 1EY6A 3GTKB 3H15A 3PCOB 4R4OA 2VS1A 1PA6A 1CZWA 3HOZB 2BDOA 4LUOA 2MQHA 1EIYB 3A5ZB 3CCEA 3PGZA 5C5LA 2L0CA 5IYDG 3UI2A 4NB3A 1G8ZD 1Y8NB 4EX5A 2K01A 1I4HA 2BA1A 5KNDA 4KJOA 1VQJA 4A3IB 3F1ZA 4CKEA 4BY7H 3LNNA 2B63G 1YEZA 4XQNA 4C1NI 1BVSA 5JPMC 3C3LA 3TN2A 2KBNA 1G2TA 2K50A 2L1BA 3S2HH 4MIUA 2LY7A 5K5PA 4XDXA 1LABA 4JVZA 3HOZG 5IODA 1C48A 1SNOA 1OO9B 4NP5A 1PTOH 1JE5A 1R4PB 1GVPA 4Q0FA 2MJ8A 2OWOA 4LF6L 3GTOH 4A3IG 4B3TL 4X3KA 1L0YB 1IKLA 4A3BB 1PXUA 4ZYSA 2NVTH 3HZXA 5ELCA 2R3ZA 4FF3A 2ZXPA 5M5XB 2OTLA 3AEVA 3DWAA 4YCUA 4JBJA 1PRTF 1LTRD 1JB3A 4ZKBB 1IBML 2XSCA 1GXDC 3IAYA 2B3GA 1J8IA 1GHJA 1I3QB 1C0AA 2IHFA 1UNSA 2R6GA 2BE5D 1XWEA 1KNAA 4RA8A 4UP9A 1ZKOA 2Z9HA 3S15B 2UXCL 2Q2HA 3H6MA 4TQUS 1XPRA 3RLNA 3BZCA 5M3MH 5GQOA 1JE4A 1YI2A 2WB1E 1Q86C 1EYCA 1J5EQ 4A3LG 2NN6G 1ZYRC 1CKNB 1TWCB 1DOLA 1I5FA 3TP7A 1QVFA 1GUTA 1TQOA 2KCMA 3O13A 4IUQA 3ULPA 1XMQL 2E2DC 2WB1G 3BVGA 1JWMD 4DV0L 4DXFA 2NTTA 2WINB 4KD4A 4E6IA 4DV1Q 4UDUC 3I4MG 3KJPA 1B9MA 5FO7B 2B2TA 1CA6A 4DR3L 4H13C 4LF9Q 4C3HH 4QB4A 4ALPA 1PH2A 5C4XG 4JBWA 1BDOA 1PH9A 1C7YA 1STAA 2AWOA 3RN5A 4GKKL 1GOZA 2RSNA 3SK5A 1HTLD 1P8LA 1B9NA 1GUOA 2HT1A 3TP5A 4KTAA 1VF7A 2MO1A 3CRLC 5C44H 1B7YB 1VQ6A 2R7ZB 3BU2A 3MA2B 2CQOA 1IBKL 2NVXB 1TWFH 4K5WA 4RHSA 3E0JA 5GAGC 3VYTA 1PDQA 1SE2A 4A3JH 1HPCA 3OTOQ 5FLXc 3QJYA 5IYCG 3GTJH 2KQ3A 2RVLA 5EKKA 3R3OA 4A3EH 1HJPA 2F0DA 3T56B 1GUSA 3GQBA 2QDBA 3P75A 3C46A 2R7ZG 5IT9L 4HIDA 3T1HL 2KHJA 3KF6A 4C3IB 3UDIA 3RR5A 4X66L 3DEPA 2F0VA 2K5VA 1SEBD 2PI2A 4X65Q 1VQ4A 1G291 3M85A 2VQEL 2UUAQ 1PRTD 1EEID 2JA5H 3J80L 3TMEA 3AYHB 3CHBD 1JOQA 1KDBA 2XGTA 4S3SA 3G4SA 3PF4A 1EY9A 1SRUA 1N32L 3KK7A 2EE1A 4ZCKA 1SE4A 2E8GA 3PIO3 3CXCA 2UXDQ 5A2QL 3VYRA 4QGUA 5IYBG 4LNQA 2XRQD 2A8VA 4OO1I 3NQTA 4BA2I 2DNCA 5KRUA 1UEAB 4XIGS 3HOXB 1X65A 2PNRC 2EY1A 4O1NA 4DF7A 1MBYA 1S3OA 4YWKA 4DV6L 3FKIH 2ZTDA 2SEBD 4V190 4OL7A 1IZ6A 1UE5A 5JOBA 3FVQA 1NY4A 4QIWB 2VW9A 1PVOA 2PO4A 1I50B 3HOVH 2J0TD 3D0FA 4IN3A 3KLSA 4LF7Q 2JJQA 4X3UA 3ICEA 1IHZA 1XNRL 5IY0A 1S5DD 2K32A 3HOXG 2SOBA 1YNNC 1Q7YC 1HRJA 4PZ8A 4QIWE 4DAYB 5DM63 3TS0A 1TS5A 3HKSA 4QF4A 4IUPA 4XQJA 1QOHA 4IUNA 1XYIA 4F87A 1SYGA 1JWUD 4RGTA 4GZYC 3S1NH 3ONAB 2SNSA 2VB2X 3KLWA 4IQZA 5HGQA 3D6CA 1SAPA 1TT2A 3K6OA 1B3AA 3Q6SA 2JEAI 4IUUA 5ELEA 5FLMG 4AIMA 4ZRZA 4KHZA 4DV2L 4DA2A 2H4OA 3GTLB 1N34Q 1SBBB 1TWHB 1ICFB 3K5LA 5JPNC 1Y1WB 5IWAL 4XYOA 4JW0A 4DR5L 2JP1A 4TRDA 3CQZH 1HFGA 1G51A 2E74C 5EPLA 2EJGC 4K2LA 5IP7G 5DNFA 2QCPX 1X54A 3MEFA 1BXTA 3H0GB 4C3JH 2K1BA 4C2MH 5EBDA 2H5XA 4K5XA 4Y7NH 3J7A5 1E24A 4YY3L 2VUMB 2IHEA 2FFKB 1B3QA 4OEMB 2QILA 5C0XG 3BDCA 4HSVA 1AFPA 2WACA 4DKAC 5ELNA 5GAHC 1A0IA 3EVQA 4RFBA 1SMYC 1C9OA 1NTGA 4DV7L 4YWLA 1NMGA 1NBWA 1A63A 5JVG3 1AZPA 1TWAB 3NUCA 3H0GG 1ILQA 4DR2L 2DN8A 4OO1H 3CC7A 3DHQA 3H91A 3BJUA 2F0QA 4LF6Q 4B3RL 2HCCA 5IOCA 1CKNA 1FGBD 2VUMG 4B9XA 3K59A 4UPAA 2NWGA 4K6LA 3ULJA 3RLOA 1SXTA 1TWGB 4R4TA 1YNJC 3H3VC 3GTQB 4A3KH 3A7LA 2L4NA 5EJWA 2NN6I 1WCMB 2EOTA 1IBMQ 5T1IA 3RZOB 4EQNA 2JN4A 3URYA 3TP8A 4DU9A 5GAEC 5FO9B 1BKBA 5CBAE 4ZK9B 2F0GA 5IT9E 2FMMA 4CDDC 3TRZA 1VCIA 1QNUA 3BZKA 1SYEA 1Y69U 4TSSA 3JAMi 2PZUA 3ERSX 1OXTA 1SJHD 2N55A 2P5ZX 4DUZL 2UXCQ 2PQEA 3J80E 5I4DA 4BBRB 1CFMA 1GUNA 2ZXRA 2UU9L 2J4XA 4XXEA 1SR3A 4DNIA 1ML0D 1WCMG 2B2WC 3HKZB 1UE1A 1J5EL 2E2IB 5A2QE 4DGZA 2F0IA 1CI3M 4A3DB 2HUGA 3A55A 4DV0Q 5IYDH 3BYTB 4DV1L 3CMAA 4DR3Q 4AH6A 4RGMA 1HZ9A 1ET6A 2Y0SB 2B63H 1S5FD 1CTMA 1TS2A 2WIIB 4LF9L 2SDFA 1Q90A 3S24A 5NUCA 1SE3A 2VY3A 3V2TA 1DOKA 3GTKH 1LLRD 1NE3A 4J15A 4RKLA 2F3WA 5E4XA 4IZ8A 3UE0A 3HOZH 2DJFC 2IW3A 2JA7G 4WRDA 3BS1A 2Y0SE 3IFDA 3K5NA 1UEBA 3HOVG 1WD1A 4ABNA 2R93B 3K0YA 3NENA 1FYCA 1EU3A 1Y1VG 3V96A 2K05A 3Q0AA 3FRPB 1WTVA 4PMCA 3OOCA 4A3IH 3MFGA 1P16A 2MUYA 2Y0SG 4IJHA 5LL6S 3KOJA 1CSPA 4JI3L 4JI7Q 3I8ZA 2JXMB 1XPUA 1X3EA 5C3WA 3J81i 3RZDB 1S5CD 5J39A 4IFDJ 1IXRA 3OTOL 4BXXG 2WP8J 1QVGA 1SNQA 1YJWA 3FPUB 3KDFA 1YBYA 2XNAC 4DN4M 2IX3A 1EYGA 2R93G 4J1MA 4G7OC 1DXMA 1YHBA 1B53A 5ISRA 3NWSA 4LMQD 2I46A 4X66Q 4IUVA 3GTMB 3CCQA 1PH6A 1EOTA 4DK3C 1A3TA 1BCPC 1TS3A 5D65A 1HZAA 5I9OA 2VQEQ 4OHJA 1R4QB 2E76C 3I4NB 4A3LH 2NN6H 2K03A 2UUAL 5M5XH 2BH2A 2PQAB 4RGNA 5FO8B 5BN5A 2ZM6L 4JV5Q 2PW5A 1U4RA 2EYFA 1WTWA 1EZ8A 4HMJA 3FHWA 4C3JG 4A75A 2UXDL 4CGYB 2GA4B 1I3QH 1H9SB 4P74A 4JI2Q 3F2CA 5C3EB 2B2VC 4GLVB 3HOUB 1U4LA 1IYUA 3C1FA 3DMUA 1II3A 1PRTB 3RD4A 3S15H 3T13A 3D4RA 4HR7B 1PZJD 1B50A 1D8LA 4QY7A 1Y8PB 1I4QA 5GROA 4GLXA 3I4NG 4A3CG 3VR2A 1STYA 1O78A 2E2HB 1TWCH 3W1GA 2A1AA 1W6JA 2BOSA 4JBKA 3WOEA 1I94Q 1IYJB 3KLRA 1FNVA 5CYUA 5J22A 1HFNA 3GDEA 4A3GG 4DR6L 4P73A 1J9OA 3UE1A 4LF7L 4LWCA 1ENAA 1OXVA 5C3EG 3KUPA 3A0JA 2KENA 1JJGA 3RMHA 3FPPA 2LXJA 3TP6A 4YWMA 1VQPA 3M7NA 1EFWA 4L5RC 2JE6I 3U4ZA 3GP7A 2PYKA 1TY2A 1S4ZA 4N9PA 4P75A 2K5NA 4ZUJA 1KTKA 3S17B 1OXUA 1SE8A 4H0LC 2VXWA 4A3KG 1MJEA 3N6RA 1H9KA 5IYCH 4QJFA 2B39A 4ILWA 2X69A 2EXDA 1D6EC 1EZ6A 4L5QA 1V1QA 4KN7C 1A2TA 3Q22A 2HIVA 5IE8A 4DV2Q 2R7ZH 1RODA 1ESFA 3PUVA 2FMCA 2EY2A 3RN2A 1AH9A 4NW2A 5FLXL 1U0LA 2Z8LA 5EPJA 1W2BA 3I72A 1N34L 5C0XI 2NVXH 1X3PA 4N8X1 1STNA 1ESRA 5IP9H 1D1IA 1FL0A 1DM0B 2Z0SA 2E75C 1Y8OB 1N33L 4OGQC 2YV5A 1IYVA 5IYBH 1QE6A 4YY3Q 3K80C 4PG3A 1R9TB 3KLSX 3AQQA 2NZ1D 5I2YA 1YJNA 2MFIA 1MGSA 3Q24A 3S9WA 3EA6A 2ZXOA 3A56A 4C3IH 3MXNB 2F0MA 2TSSA 5FOBB 4DUYL 1TXYA 1CM9A 2QW7A 1U4PA 2RDGA 1GJXA 3VA7A 3CRKC 1B2TA 1X3FA 3CKIB 5I2XA 1EUJA 4LK1C 4A93G 1F2ZA 2B2YC 4KJNA 4IPGA 4DV7Q 4PQXA 5JEAG 4QUFA 2Q2UA 1EWCA 1Z7TA 2A6EC 1NUCA 4KKSA 4DR2Q 5M5YH 1I6HH 3AU7A 2WFWA 4B3RQ 5CBEE 1PHJA 2JA8B 4JG2A 4NPSA 3LWEA 4A3FB 1S72A 4DPGA 1YITA 1PLFA 3HOXH 4Z9CB 5LMNW 2M00A 1RTNA 1BF4A 2B8GA 1ZYRD 4GNXC 1VQLA 5JJKA 2D62A 1O7IA 4K8IA 1SNCA 5TSSA 5C5MA 1BBWA 4YHHL 3S1MH 2AKWB 2I07B 5CR3A 3M7GA 2F0SA 1F77A 1KRSA 3GD7A 4HJ9A 4HJAA 1HNXL 2D0PA 4FO2A 3A8JE 2B2UC 2NZHA 5FJ8G 2R7FA 4HEDA 1RL2A 5AFWA 4CHTB 5EKLA 1D7QA 3I91A 5FLMH 1KIXA 3VR5A 4KMUC 2OTJA 4DUZQ 1W6KA 4NXML 5LMUL 4A3FG 3GTPH 3AMUA 1SSOA 1E22A 1LUZA 2CCZA 2VB3X 3HEJA 2UU9Q 4A3BG 3MAQA 1CSQA 2KCCA 2XVSA 2E5LQ 3CF5A 4X62Q 5CV7A 5IP7H 3CW2C 1A8VA 1BBUA 3ERQA 3HOWB 4GOPA 3A5UA 1A62A 3CPFA 4WJWA 2K52A 3N52A 3PO2B 1G6PA 2OT2A 4L8JA 2K4KA 3GTLH 4I65A 1KDCA 1TWHH 3MXUA 5C0XH 5T1GA 4DV4L 1WTOA 3DWQA 4KKTA 3TZUA 1WTXA 2KEDA 4FF4A 5D3DA 1JQYD 3K7AB 2OQ0A 1UWVA 2MNAA 2K33A 1MSGA 3JAMc 3A54A 5E4WC 1U4MA 2L9HA 1TVXA 3QO2A 3DXJC 4DK6C 3HOWG 1SN8A 2L11A 3H0GH 4HIOA 1RJTA 4MZ9A 1N9WA 3ITPA 3NTHA 3M9BA 2I5LX 1PFMA 3IL8A 3PO2G 3A8IE 1BR9A 3ND9A 4L5SA 4LW1A 2VUMH 3OMGA 2PQAA 1PYBA 1XJVA 1M90C 3S14B 1EWHA 4QQBX 4K14A 2CW0C 2M9VA 2ALYB 3I7FA 4JI3Q 3R8BA 4CJ2C 1SFOH 1BUVT 4A3MB 2K04A 1U5KA 4JI7L 4KI0A 4MTNA 1H9SA 4FYDA 3QOJA 5JVH3 3AFPA 1TWAH 4JI4Q 2OCEA 1PFNA 1BCPB 1VQDA 4PV1C 4CJ1B 2K6AA 2AUJD 5FLXE 1A3UA 2EZVA 1QWYA 1NSNS 1L1OA 1STGA 2IY5B 1RDPD 2N3SA 4LF4L 4NKLA 2D5DA 2OF1A 3ND8A 4YIJA 2LKVA 1TWGH 4JI8Q 1V1PA 3I4OA 5C4JB 4A3MG 3H09A 3GTQH 4HCSA 1JMCA 3QIAA 2QGQA 2ZM6Q 1WCMH 3NPPA 5IP9G 4R8IA 3CCSA 1ILPA 4LUZA 3OMCA 3RZOH 3CCRA 5G3LF 3PF5A 2AHOB 4PMBA 1JOOA 4JV5L 2JEBI 3E9IA 2KHIA 4BY7B 3MVVA 4KY6A 4POFA 2MHVA 2F4IA 2H1EA 1F9QA 4JI2L 3J81c 4EQPA 1YNND 4FXGC 1L2FA 3X3NA 1X55A 5JAVA 2UXBQ 3CCUA 4C3IG 3PMFA 1LTBD 1SNPA 1PFSA 1NMFA 3PQIA 1O7ZA 4XYQA 5DAUA 3PUXA 4DAPA 3KJOA 3NSWA 2ZJRA 1SYFA 3CU7A 2E2IH 4UP8A 4HJ5A 3J7AF 2JA7H 1AW7A 4JK1C 2FXQA 4DR6Q 1I94L 3ULLA 3K8AA 1O7LA 3GTOB 3S1QH 1SYDA 1Y1VH 1EQVA 2HDLA 2A5HA 2ZTCA 5DEHA 2E2JH 4JCVE 4HSPA 1JJ2A 1S5BD 1Z9FA 3D6WA 3GO5A 2OQKA 3EN2A 2Z6BA 2DNEA 2DGYA 4C1NK 5LMNL 3I90A 2Q8IB 2RKSA 2LFNA 3M4OH 2FHTA 4OIJA 4PZ6A 1L0XB 4DAMA 2OEOA 5K36G 1STEA 4ZAIA 2F0PA 2ZT9C 2K5HA 2NZOA 5LL6X 5IGFA 4BXXH 4OWWB 3NBHB 2QF7A 2IJ0A 2CH4W 4UHVA 4HCEA 4B08A 3OW2A 2R93H 2N88A 1YHAA 3T4AC 4H7BA 1PZID 2VNUD 1E3PA 1EYDA 2G9HD 3SK8A 2EPBA 1N8RC 1H9RA 3SE0A 3U4VA 3DUZA 1SMYD 1LYLA 3CCVA 4G57A 4JI1Q 3PUYA 1HR0Q 2NVYH 4L63B 3I3CA 1FGUA 5EBCA 3BVMA 1N33Q 2PZTA 1KDAA 2B29A 3F2UA 3TQYA 1EQQA 2EJMA 1QZHA 4DR4Q 1PYSB 5BN3A 3E0EA 5M5WH 2HCIA 1E7ZA 2K5WA 2MP1A 3CC2A 3CC4A 2KJXA 5I9PA 3Q8DA 2IWHA 4OIKA 4F88A 1VQ9A 4DUYQ 4R4QA 1YNJD 2A19A 3GV3A 1BCPF 3HFZB 5ELBA 2EYHA 2LMCB 1Y1WG 3LX0A 3I4NH 2XIWA 4A3CH 5G3LD 3NTIA 1VQ8A 2F0UA 4EGVA 2LXKA 4HIMA 3KF8B 1WTRA 1LTLA 2EVBA 2AUKA 3V05A 1K0RA 4A3GH 3K0XA 1Q1EA 3UDFA 3I56A 4GNXB 1STBA 5C3EH 1PH8A 3H3VI 3IKJA 1KAAA 3OPOA 5EKIA 1BNZA 1X32A 1HZBA 1DGSA 4A3JB 2IT1A 4YHHQ 1VQNA 3MWYW 1FJGL 2A6HC 1WTPA 4LFCQ 1HNXQ 1XXGA 3PIOA 4J6HA 3TREA 4A3EB 2F4VQ 1QCBD 3UDXA 1LT4D 3SEBA 1PZKD 4NDXA 1WD0A 2IX1A 1CKOA 3TBIB 3HOYB 4NXMQ 2MPMA 5LMUQ 3NHHA 2A68C 3G48A 4DXGA 3OW7A 2JA5B 2YTYA 4MNOA 5CV8A 4DR7Q 2JSOA 3S17H 2Z6KA 2HQLA 2KHSA 3STBC 1HR0W 2ID0A 2E5LL 1C8CA 4X62L 1EWIA 2VZAA 1TU2B 4QUCA 2F0HA 1K9MC 3J7YW 2KVMA 2I5MX 4POGA 2EY5A 1V8QA 2MO0A 2CWPA 1B8AA 3ER0A 3TSSA 4JC0A 3AFQA 4M8AA 2YYZA 5I6YA 3HOYG 1O80A 4DV4Q 1CUKA 1VF5C 2YTVA 3HKZE 1SJED 4BBRG 4DK1A 3SR1A 4DK0A 3OHXC 4A93H 1ONLA 5J1ZA 1Q1BA 5JEAH 3K5MA 4CDEC 1CZGA 3HKZG 4XQQA 1GKHA 1G6ZA 4A3DG 5JJZA 2K5DA 2PCFB 4LJZC 3W1BA 1R9TH 2KOLA 2NYZD 1BCPD 1HHVA 4JI0L 4OX9L 2B2VA 3VR6A 3E3XA 5HURA 1QVCA 1YNXA 4O2DA 1WTQA 3C1EA 3A7AB 1E1OA 3SXHA 3G71A 4UAIA 3K57A 1HQRD 3J7AV 1DOMA 2XN9C 1KRTA 4AYBB 2B8FA 5FJ8H 1K73C 2QDLA 4LUVA 5ELDA 5KGUA 4JI4L 4LF5Q 1SNDA 4GKJQ 5GADC 3H3VH 1E2ZA 1VQKA 4LF4Q 4RHRA 4A3FH 3CQZB 1GUGA 1KQSA 2XWJB 4KY7A 4R1JA 2F0JA 4A3BH 1G91A 4JYAQ 1I4XA 1ZEQX 5CV6A 5EAYA 4JI8L 4FXDA 1IW7D 1YVCA 1LACA 2EYMA 5ELFA 4C2MB 2I0QA 1SLJA 1MHWC 1VQOA 3TDQA 5COYA 2F52A 3ZJYC 2EIFA 1NR4A 4GN4B 4NMZA 1PTOD 2BA0A 2Z4IA 3P7JA 3EBEA 4DAYA 4FDBA 3NP8A 1Z47A 4GS3A 3I4LA 2RHSB 3DM1A 2IL8A 2DJGC 2UXBL 1HUNA 4OWXB 3NBHA 1SYBA 2F3IA 3QB3A 3QR8A 2CVRA 3R2IA 1EIHA 4JPBW 2QA4A 1Q3LA 1F9RA 3NQIA 4QCLA 1LTSD 1HA5A 1EU4A 3K81C 1IW7C 4B3MQ 3HOWH 3L0OA 3M3YB 4PNYA 2JA6B 1D5MC 3HRZC 3PO2H 3ZYYX 1HNWQ 1EQTA 2HDMA 1K0SA 2IPKD 4JOIC 5L37A 3HOUG 1PTOC 2YU9B 4CKCA 2K14A 3JAML 4TVAB 4PZ7A 1A3VA 3RNUA 2KA7A 1ET9A 2WAQB 1BO0A 4F7XA 5LMNQ 2QEXA 1AP0A 2QKIC 1X6OA 1LTID 3K7AH 3Q23A 1VS0A 2F0FA 3L2PA 2FINB 4BBSB 1BQQT 4ULLA 1I6VC 1FR3A 2ENBA 1DD2A 4G4KA 1VQ7A 2HHHQ 2JA6G 3UDGA 1AE3A 2HQEA 3EFXD 1BOSA 1HNZQ 1EOVA 2NVQB 4I7AA 2A74C 4KV6A 1TR5A 1RKNA 2PMZB 3S14H 2L12A 5IGBA 2DY8A 5IGDA 4A3MH 4XT3B 3D4DA 3U9OA 2A6ED 3TEHB 1WI5A 3S1RB 4OXPA 4JI1L 1HR0L 2ATWA 2RHQB 4BBSG 1JORA 1VQGA 4DR1Q 5IIFA 4K8JA 1CK1A 3SHLA 1IKMA 1W3SA 1VQCA 2V1CC 4DV3Q 4DR4L 5J3BA 3MXPA 3MC0B 3NXWA 5M3FB 3OWEB 2UUBL 1YIJA 3L7ZC 2FJ2A 2R61A 1EFID 5CV4A 5EGTA 5C4ZA 1SMXA 1VQEA 1E2VA 1S5ED 4RMFA 1IL2A 1EY4A 1LTGD 2R7DA 4MTKA 5C4JH 1CQFA 4QL5A 2RDHA 1PH1A 2AQ2B 3J81L 1ZXTA 3DWPA 2SNMA 4L5TA 4IFDG 3D4WA 3S16B 4AQYQ 4IPDA 4U68A 1OTCA 2F03A 4LF8Q 1MSHA 4DNTB 2O5JC 3P20A 5M3FG 3J80i 4LFBL 3W3AA 2N49A 1VQMA 1UUPA 1JB7A 3GTGB 1FJGQ 2NBFA 1HUMA 1OXSC 1H9JA 1KLGD 1SNMA 5BR8Q 1O7YA 4Q5VA 1PH4A 1ASZA 1T5EA 2Q8TA 4XTCS 2F0NA 1M8AA 2GN5A 5K36H 2F0KA 3PV0A 1NNXA 1EY0A 4P72A 3AB9A 4LFCL 1LTTD 1JOKA 4NXNQ 2F4VL 3FEWX 3MZ5A 1I50H 1HH2P 3CPWA 1TS4A 3H94A 1B1ZA 4K6DA 5EQ0A 1M1KC 1LV9A 4R4CA 3VYUA 2NB0A 1K8GA 3BYYB 1J6QA 3T53B 2JA8G 4RH6A 1JR0D 4KN4C 1B44D 5IGGA 3SDZA 4ZKCB 3TS2A 4GLAC 4DR7L 2X6GA 3I73A 4K0KL 3T16A 2WB1B 1UE7A 1K8OA 4KK7A 4ME5A 3I4MB 1DZ1A 1LT6D 2Q8RE 2RDFA 1PH7A 2KECA 4IURA 3LGJA 3T1YL 5C4XB 1Q82C 1A2UA 2CW0D 1QG7A 4B3SL 1BBXC 1EQRA 3HGBA 5IGCA 1VQIA 4HIKA 3OWFA 1SROA 1AE2A 1EY8A 1EIGA 2G9DA 1Y1WH 3KBXA 2RBMA 1N36Q 2EDGA 1X9NA 3U9SA 3VA5A 4A76A 1KXLA 1AEXA 3W5OA 4IPCA 2RCFA 3F2DA 3PSIA 3E5SA 4GN3B 2R92B 1YZ6A 3EROA 1M4VA 5DLQE 3L9AX 2KCTA 3I2ZA 2MGSA 4X64Q 1I4PA 3JAME 3G7LA 2BE5C 4HN7A 4JI6Q 1PMRA 2DY7A 2Q2IA 4CJ0B 2N8NA 4JI0Q 4WJ4A 4OX9Q 1QILA 2D9UA 5CORA 2F0OA 1XTDA 4BY1B 1LM0A 1RTOA 5KNCA 3KYHC 2JYOA 4HAEA 5KYLA 3PO3B 2UUCL 4WFN3
chains in the Genus database with same CATH topology
1RCVD 1WVLA 4G7HC 3EQLC 1F2LA 1XTCD 1VMPA 1CHQD 5DM73 1VDZA 5C0XJ 3S2DB 3E6ZX 1K83B 1QNKA 3VR4A 1K8MA 2TMPA 1EYAA 2AQ3B 1DJRD 3HP3A 1U9RA 4M1UB 3PUWA 2B2TC 4RKBA 3OIQA 2O5IC 1RHPA 3NK9A 2RA4A 3D31A 2V4DA 5FK9C 4BS9A 4O42A 3SK4A 1DYQA 1KLUD 3G6JB 3S2HB 4DNRB 2BCOA 3J81E 2KUMA 3RLFA 1CT1D 1I6HB 5M5YB 1V1OA 1HCZA 2C9OA 1PTOB 3PIP3 3X3MA 2ICIA 4FVMA 1I4GA 1ENCA 1MI2A 2RSOA 4BA1I 5D14A 1QJOA 2NVTB 2K5QA 1HA6A 3S1MB 3D8GA 1PRTC 4DFAA 3NTKA 4MN3A 1PYWD 3D3RA 2EYOA 3MXNA 1A6XA 4F8MA 1D5ZC 3DEOA 3GTPB 3BDOA 2A69D 3MTSA 5M3MB 4R9WA 3R2TA 1NCVA 2XRSD 5BN4A 3K5OA 4ZQ3A 2NUCA 3BDLA 1AZQA 2NTSA 1CHPD 4IFDI 2KEEA 2EYJA 4DAVA 3BVZA 4N9TA 2F0WA 4C3HB 2F1MA 3HS0C 4V0BA 2OXPA 2XWBB 4LAAA 2A69C 2A6HD 5CV9A 4ZLTF 1NR2A 3LWUA 2LS01 1STHA 3MEHA 1JWSD 3KBGA 4PMWA 1TY0A 5C44B 5F2DA 5IGEA 2B2WA 2EJFC 4L6TB 4K2KA 4QMGA 1UAPA 5CV5A 4BWGB 2A68D 4C3HG 1D1KA 1ENFA 1VMCA 1G2SA 1SFOB 1EL0A 1TWFB 4J8QA 1EY5A 2A73B 3MHBA 4FF1A 3BG3A 1E2WA 2K7VA 3GTJB 4HTHA 2AQ1B 1Q12A 3A8KE 3L3OC 1HQMC 2F0EA 1CQVA 1RD9D 2CHBD 4R8NA 1LT5D 1Q8IA 1QB5D 5KIXA 3OSOA 1EEFD 1PTOF 1ICWA 4RCOA 4ODGA 1KNEA 1FNWA 2M2LA 1T5XD 2F0TA 4P2CB 5A35A 1IL8A 1I4RA 3NWTA 4B9WA 3NBIA 2EYPA 3MFYA 1F9SA 3PUZA 1D5XC 4FNFA 1F9PA 1TKWB 4RGOS 1FNUA 4EVOA 3FKIB 1DONA 4U673 5E3FA 1GUWA 4FXKC 5C3XA 2F3VA 2JA7B 1AN8A 3HOVB 1DCZA 4WORA 5C6AA 3HG9A 5CC4A 3S1QB 1Y1VB 4IFDH 1LTAD 1F2MA 4ZUIA 2E2JB 3QG1A 4RAUC 3NE5B 5KEEA 5M9OA 2K28A 2EYLA 3SVMA 5CMDA 2C5CA 4MHEA 2QEJC 3QOLA 3M4OB 2BDNA 2Z1CA 3FDTA 2PW7A 4ID6A 3TZDA 2PPBC 2KCNA 3S1NB 4XT1B 2F0LA 2ICEC 1FD7D 2L5TA 3WOFA 2D2CC 4HMIA 1XX8A 2CQAA 2EY6A 2J7ZA 1HXYD 1RF2D 1HTPA 1B4OA 3I70A 3VR3A 5KNBA 5CGKA 5JEAJ 2NVYB 2X6LA 4C56C 3R93A 1D2BA 1E0BA 4C3JB 3IFTA 3W2DA 5E1FA 5M5WB 4I7ZC 4Y7NB 4CBVA 1TIID 1OXXK 4KY5A 4FF2A 1Z6HA 4IALA 3EJIA 3QWNA 1LO5D 3M4YA 2O4XA 3SK6A 2RQXA 3T51B 4A3GB 1C4QA 4G7ZC 1H9MA 4K5VA 4TKOB 4X3TA 1X3QA 3WDNA 5C4HA 2IX0A 4EQOA 4RWSC 3P1HA 2Z4HA 3MXGA 1LT3D 1F2YA 2WKCA 3K58A 4CKBA 4A3KB 1KABA 1A15A 1CA5A 4KKUA 1JCKB 1MD2D 1V1PB 2WV6D 1EY7A 1JC7A 2B2YA 1V43A 4OO1G 3OIPA 3VYSA 2O2LD 1SDFA 3C2PA 4RCNA 1GHKA 2PZWA 2EXZA 2WKDA 3KF8A 4KD3A 1JICA 3BZDB 5HGTA 1SYCA 3RUZA 4KHVA 1NAPA 3FMCA 4H44C 1PFBA 5LHY1 3GV6A 2L55A 5D3IB 5I6WA 2B63B 2B2UA 2AWNA 4IUTA 5EPKA 5KYIA 5FKAC 4X3SA 4FP5D 4A93B 1EY6A 3GTKB 1CZWA 3HOZB 2BDOA 5C5LA 2L0CA 3UI2A 1G8ZD 1Y8NB 2K01A 1I4HA 2BA1A 5KNDA 4KJOA 4A3IB 4CKEA 3LNNA 4XQNA 4C1NI 5JPMC 3C3LA 3TN2A 1G2TA 2L1BA 4MIUA 2LY7A 5K5PA 4XDXA 1LABA 5IODA 1C48A 1SNOA 1OO9B 4NP5A 1PTOH 1R4PB 4Q0FA 2MJ8A 4X3KA 1L0YB 1IKLA 4A3BB 1PXUA 4ZYSA 3HZXA 5ELCA 2R3ZA 4FF3A 2ZXPA 5M5XB 3DWAA 1PRTF 1LTRD 1JB3A 4ZKBB 2XSCA 1GXDC 3IAYA 1J8IA 1GHJA 1I3QB 1UNSA 2R6GA 2BE5D 1XWEA 1KNAA 4RA8A 1ZKOA 3S15B 3H6MA 4TQUS 1JE4A 1EYCA 2NN6G 1ZYRC 1TWCB 1DOLA 3TP7A 1GUTA 1TQOA 3O13A 4IUQA 2E2DC 3BVGA 1JWMD 4DXFA 2NTTA 2WINB 4KD4A 4E6IA 4UDUC 1B9MA 5FO7B 2B2TA 1CA6A 4H13C 4QB4A 4JBWA 1BDOA 1STAA 2AWOA 1GOZA 2RSNA 3SK5A 1HTLD 1B9NA 1GUOA 3TP5A 4KTAA 1VF7A 3CRLC 2R7ZB 3MA2B 2NVXB 4K5WA 4RHSA 3E0JA 3VYTA 1PDQA 1SE2A 1HPCA 3QJYA 2KQ3A 2RVLA 5EKKA 3R3OA 2F0DA 3T56B 1GUSA 3GQBA 2QDBA 3P75A 3C46A 5IT9L 4C3IB 3DEPA 2F0VA 1SEBD 1G291 3M85A 1PRTD 1EEID 3J80L 3TMEA 3CHBD 1JOQA 1KDBA 4S3SA 1EY9A 3KK7A 2EE1A 1SE4A 3PIO3 5A2QL 3VYRA 2XRQD 4OO1I 3NQTA 4BA2I 2DNCA 5KRUA 1UEAB 4XIGS 3HOXB 2PNRC 2EY1A 4O1NA 4DF7A 1MBYA 2SEBD 4V190 4OL7A 5JOBA 3FVQA 4QIWB 2PO4A 1I50B 2J0TD 4IN3A 3KLSA 4X3UA 1IHZA 1S5DD 2K32A 2SOBA 1YNNC 1HRJA 5DM63 1TS5A 4QF4A 4IUPA 4XQJA 1QOHA 4IUNA 1XYIA 4F87A 1SYGA 1JWUD 4RGTA 4GZYC 3ONAB 2SNSA 2VB2X 4IQZA 3D6CA 1SAPA 1TT2A 3K6OA 1B3AA 3Q6SA 2JEAI 4IUUA 5ELEA 4ZRZA 4KHZA 4DA2A 2H4OA 3GTLB 1SBBB 1TWHB 3K5LA 5JPNC 1Y1WB 4XYOA 2JP1A 4TRDA 1HFGA 2E74C 5EPLA 2EJGC 4K2LA 5DNFA 2QCPX 1BXTA 3H0GB 2K1BA 5EBDA 4K5XA 2VUMB 2FFKB 2QILA 5C0XG 3BDCA 4HSVA 1AFPA 2WACA 3EVQA 4RFBA 1SMYC 5JVG3 1AZPA 1TWAB 3NUCA 1ILQA 2DN8A 4OO1H 3DHQA 3H91A 2F0QA 2HCCA 5IOCA 1FGBD 4B9XA 3K59A 2NWGA 4K6LA 1SXTA 1TWGB 1YNJC 3H3VC 3GTQB 3A7LA 2L4NA 5EJWA 2NN6I 1WCMB 2EOTA 5T1IA 3RZOB 4EQNA 3URYA 3TP8A 4DU9A 5FO9B 5CBAE 4ZK9B 2F0GA 5IT9E 2FMMA 1VCIA 1QNUA 1SYEA 1Y69U 4TSSA 2PZUA 1OXTA 1SJHD 2N55A 2PQEA 3J80E 5I4DA 4BBRB 1CFMA 1GUNA 2ZXRA 2J4XA 4XXEA 1ML0D 2B2WC 3HKZB 2E2IB 5A2QE 4DGZA 2F0IA 1CI3M 4A3DB 2HUGA 3A55A 3BYTB 4RGMA 1ET6A 2Y0SB 1S5FD 1CTMA 1TS2A 2WIIB 2SDFA 1Q90A 5NUCA 1SE3A 3V2TA 1DOKA 1LLRD 4RKLA 2F3WA 5E4XA 4IZ8A 2IW3A 4WRDA 3BS1A 3IFDA 3K5NA 1WD1A 4ABNA 2R93B 3K0YA 1FYCA 1EU3A 3V96A 2K05A 3Q0AA 3FRPB 1WTVA 4PMCA 3OOCA 3MFGA 2MUYA 5LL6S 3I8ZA 2JXMB 5C3WA 3RZDB 1S5CD 5J39A 4IFDJ 2WP8J 1SNQA 3FPUB 2IX3A 2XNAC 4DN4M 4J1MA 4G7OC 1DXMA 1B53A 5ISRA 3NWSA 4LMQD 2I46A 3GTMB 4IUVA 1EOTA 1A3TA 1BCPC 1TS3A 5D65A 5I9OA 4OHJA 1R4QB 2E76C 3I4NB 2NN6H 2K03A 4RGNA 5FO8B 5BN5A 2PW5A 1U4RA 2EYFA 1WTWA 1EZ8A 4HMJA 4C3JG 4CGYB 2GA4B 1H9SB 5C3EB 2B2VC 3HOUB 1U4LA 1IYUA 3C1FA 3DMUA 1II3A 1PRTB 3RD4A 3T13A 3D4RA 4HR7B 1PZJD 1B50A 1Y8PB 1I4QA 3VR2A 1STYA 1O78A 2E2HB 1W6JA 2BOSA 3WOEA 3KLRA 1FNVA 5CYUA 5J22A 1HFNA 1J9OA 1ENAA 1OXVA 3KUPA 3RMHA 3FPPA 3TP6A 3M7NA 2JE6I 3GP7A 2PYKA 1TY2A 1S4ZA 4N9PA 4ZUJA 3S17B 1KTKA 1OXUA 4H0LC 2VXWA 3N6RA 1H9KA 2B39A 4ILWA 2X69A 1D6EC 1EZ6A 4KN7C 1A2TA 3Q22A 1RODA 1ESFA 3PUVA 2FMCA 2EY2A 4NW2A 5FLXL 2Z8LA 5EPJA 3I72A 5C0XI 1X3PA 1STNA 1ESRA 1D1IA 1DM0B 2E75C 1Y8OB 4OGQC 1IYVA 1QE6A 1R9TB 3KLSX 2NZ1D 5I2YA 3Q24A 1MGSA 3S9WA 3EA6A 2ZXOA 3A56A 2F0MA 2TSSA 5FOBB 1CM9A 2RDGA 1U4PA 1GJXA 3VA7A 3CRKC 1B2TA 3CKIB 5I2XA 4LK1C 1F2ZA 2B2YC 4KJNA 4PQXA 5JEAG 4QUFA 1EWCA 1Z7TA 2A6EC 1NUCA 4KKSA 3AU7A 5CBEE 2JA8B 3LWEA 4A3FB 1PLFA 4Z9CB 2M00A 1RTNA 1BF4A 2B8GA 1ZYRD 2D62A 4K8IA 1SNCA 5TSSA 5C5MA 2I07B 5CR3A 3M7GA 2F0SA 1F77A 3GD7A 4FO2A 3A8JE 2B2UC 4HEDA 5AFWA 4CHTB 5EKLA 3I91A 3VR5A 4KMUC 1W6KA 3AMUA 1SSOA 2VB3X 3HEJA 3MAQA 2KCCA 2XVSA 5CV7A 3ERQA 3HOWB 4WJWA 3PO2B 3N52A 2OT2A 4L8JA 4I65A 1KDCA 3MXUA 5C0XH 5T1GA 1WTOA 3DWQA 4KKTA 3TZUA 1WTXA 2KEDA 4FF4A 5D3DA 1JQYD 3K7AB 2K33A 1MSGA 3A54A 5E4WC 1U4MA 2L9HA 1TVXA 3QO2A 3DXJC 2L11A 1RJTA 3ITPA 3NTHA 1PFMA 3IL8A 3A8IE 1BR9A 3ND9A 3OMGA 3S14B 1EWHA 4K14A 2CW0C 2M9VA 3R8BA 4CJ2C 1BUVT 4A3MB 2K04A 4KI0A 1H9SA 4FYDA 3QOJA 5JVH3 1PFNA 1BCPB 4PV1C 4CJ1B 2K6AA 2AUJD 5FLXE 1A3UA 2EZVA 1QWYA 1NSNS 1STGA 1RDPD 4NKLA 2D5DA 2OF1A 3ND8A 4YIJA 2LKVA 1V1PA 5C4JB 3H09A 4HCSA 3QIAA 3NPPA 4R8IA 1ILPA 3OMCA 5G3LF 4PMBA 1JOOA 2JEBI 4BY7B 3MVVA 4KY6A 2MHVA 2F4IA 2H1EA 1F9QA 4EQPA 1YNND 4FXGC 3X3NA 5JAVA 4C3IG 3PMFA 1LTBD 1SNPA 1O7ZA 4XYQA 5DAUA 3PUXA 4DAPA 3NSWA 1SYFA 3CU7A 3J7AF 1AW7A 4JK1C 1O7LA 3GTOB 1SYDA 1EQVA 2HDLA 2A5HA 5DEHA 4HSPA 1S5BD 3D6WA 3GO5A 2DNEA 4C1NK 3I90A 2Q8IB 2RKSA 2LFNA 2FHTA 4OIJA 1L0XB 2OEOA 5K36G 1STEA 4ZAIA 2F0PA 2ZT9C 5LL6X 5IGFA 2QF7A 2IJ0A 4HCEA 4B08A 2N88A 3T4AC 4H7BA 1PZID 2VNUD 1EYDA 2G9HD 3SK8A 2EPBA 1H9RA 3SE0A 3DUZA 1SMYD 4G57A 3PUYA 4L63B 3I3CA 5EBCA 3BVMA 2PZTA 1KDAA 3F2UA 2EJMA 5BN3A 2HCIA 2K5WA 2MP1A 2KJXA 5I9PA 2IWHA 4OIKA 4F88A 1YNJD 3GV3A 1BCPF 5ELBA 2EYHA 2LMCB 3LX0A 2XIWA 5G3LD 3NTIA 2F0UA 4EGVA 1WTRA 2EVBA 2AUKA 3V05A 1Q1EA 1STBA 3IKJA 1KAAA 3OPOA 5EKIA 1BNZA 1X32A 4A3JB 2IT1A 3MWYW 2A6HC 1WTPA 1XXGA 4A3EB 4J6HA 1QCBD 1LT4D 3SEBA 1PZKD 4NDXA 1WD0A 2IX1A 3TBIB 3HOYB 2MPMA 3NHHA 2A68C 4DXGA 3OW7A 2JA5B 5CV8A 2JSOA 2KHSA 2ID0A 1C8CA 1TU2B 4QUCA 2F0HA 3J7YW 2KVMA 2EY5A 1V8QA 3TSSA 4M8AA 2YYZA 5I6YA 1O80A 1VF5C 1SJED 4DK1A 3SR1A 4DK0A 3OHXC 1ONLA 5J1ZA 1Q1BA 5JEAH 3K5MA 1CZGA 4XQQA 1G6ZA 5JJZA 2K5DA 2PCFB 4LJZC 2KOLA 2NYZD 1BCPD 1HHVA 2B2VA 3VR6A 5HURA 1WTQA 3C1EA 3A7AB 3SXHA 4UAIA 3K57A 1HQRD 3J7AV 1DOMA 2XN9C 4AYBB 2B8FA 5ELDA 5KGUA 1SNDA 1E2ZA 4RHRA 3CQZB 1GUGA 2XWJB 4KY7A 2F0JA 1G91A 1I4XA 1ZEQX 5CV6A 4FXDA 1IW7D 1LACA 2EYMA 5ELFA 4C2MB 3TDQA 5COYA 1NR4A 4NMZA 1PTOD 2BA0A 2Z4IA 3P7JA 4DAYA 3NP8A 1Z47A 3I4LA 3DM1A 2IL8A 1HUNA 3NBHA 1SYBA 3QB3A 2CVRA 3R2IA 1EIHA 1Q3LA 1F9RA 3NQIA 4QCLA 1LTSD 1HA5A 1EU4A 1IW7C 3M3YB 4PNYA 2JA6B 1D5MC 3HRZC 3ZYYX 1EQTA 2HDMA 2IPKD 1PTOC 2YU9B 4CKCA 3JAML 1A3VA 2KA7A 1ET9A 2WAQB 1BO0A 4F7XA 1AP0A 2QKIC 1LTID 3Q23A 2F0FA 2FINB 4BBSB 1BQQT 4ULLA 1I6VC 1FR3A 2ENBA 1DD2A 4G4KA 2HQEA 3EFXD 1BOSA 2NVQB 2A74C 4KV6A 1TR5A 1RKNA 2PMZB 2L12A 5IGBA 2DY8A 5IGDA 4XT3B 3D4DA 3U9OA 2A6ED 3S1RB 1JORA 5IIFA 4K8JA 1CK1A 3SHLA 1IKMA 3MXPA 3MC0B 3NXWA 5M3FB 3OWEB 5CV4A 3L7ZC 2FJ2A 5C4ZA 2R61A 1EFID 5EGTA 1E2VA 1S5ED 1EY4A 1LTGD 1CQFA 2RDHA 2AQ2B 3J81L 1ZXTA 3DWPA 2SNMA 4IFDG 3D4WA 3S16B 4U68A 2F03A 1MSHA 4DNTB 2O5JC 3P20A 3W3AA 1UUPA 3GTGB 2NBFA 1HUMA 1OXSC 1H9JA 1KLGD 1SNMA 1O7YA 4Q5VA 1T5EA 2Q8TA 4XTCS 2F0NA 1M8AA 5K36H 2F0KA 3PV0A 1EY0A 3AB9A 1LTTD 1JOKA 3FEWX 3MZ5A 1TS4A 3H94A 1B1ZA 4K6DA 5EQ0A 1LV9A 3VYUA 2NB0A 3BYYB 3T53B 4RH6A 1JR0D 4KN4C 1B44D 5IGGA 3SDZA 4ZKCB 2X6GA 3I73A 3T16A 2WB1B 1K8OA 4KK7A 4ME5A 3I4MB 1DZ1A 1LT6D 2Q8RE 2RDFA 2KECA 4IURA 5C4XB 1A2UA 2CW0D 1QG7A 1BBXC 3HGBA 5IGCA 3OWFA 1EY8A 1EIGA 2G9DA 3KBXA 2RBMA 2EDGA 3U9SA 3VA5A 1AEXA 3E5SA 2R92B 3EROA 1M4VA 3L9AX 2MGSA 1I4PA 3JAME 3G7LA 2BE5C 4HN7A 1PMRA 2DY7A 4CJ0B 1QILA 2D9UA 5CORA 2F0OA 4BY1B 1RTOA 5KNCA 4HAEA 2JYOA 5KYLA 3PO3B 4WFN3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY6 A;  4KD4 A;  4ODG A;  3NUC A;  4DF7 A;  4E6I A;  4PNY A;  3SR1 A;  4IAL A;  5I9P A;  3EJI A;  3OMC A;  5J1Z A;  1EZ6 A;  3DHQ A;  2F0T A;  2F0Q A;  3HEJ A;  4QB4 A;  1SNM A;  5IOC A;  4OL7 A;  1A2T A;  4PMB A;  1JOO A;  4ZQ3 A;  5C5L A;  5JOB A;  4B9W A;  2NUC A;  2EYP A;  5C3W A;  5J39 A;  4B9X A;  2EYH A;  1STA A;  2F0N A;  2O4X A;  2EY2 A;  3SK6 A;  1A3V A;  2F0K A;  5CV7 A;  3BDL A;  3MVV A;  3LX0 A;  1EY0 A;  4KY6 A;  4F7X A;  4KJO A;  1JOK A;  1IHZ A;  1SNQ A;  3ERQ A;  3MZ5 A;  2F0U A;  4EQP A;  1EYA A;  3SK5 A;  5JAV A;  2F0F A;  3PMF A;  4J1M A;  4K6D A;  1STN A;  1SNP A;  4EVO A;  2EYJ A;  4EQN A;  4K5V A;  5E3F A;  5ISR A;  5EKL A;  5C3X A;  2SOB A;  2ENB A;  4N9T A;  2F0W A;  1U9R A;  4KTA A;  5DAU A;  3TP5 A;  3TP8 A;  2F3V A;  4DU9 A;  4MIU A;  5HUR A;  5K5P A;  1A3T A;  5C4H A;  4RKB A;  1STB A;  2OXP A;  2F0G A;  4EQO A;  4I65 A;  5I9O A;  1KDC A;  1SYF A;  4QF4 A;  4WOR A;  5C6A A;  3C1E A;  2HQE A;  5IGG A;  5CC4 A;  3NK9 A;  1SYE A;  3P1H A;  5IOD A;  4IUN A;  4LAA A;  3SXH A;  1KAA A;  1F2Y A;  1SNO A;  1F2M A;  1SYG A;  2PZU A;  4NP5 A;  4KV6 A;  5CV9 A;  3T16 A;  4ZUI A;  1TR5 A;  1RKN A;  2PQE A;  4K5W A;  1SYD A;  1EQV A;  2SNS A;  5IGB A;  2PW5 A;  4ME5 A;  3SK4 A;  5KEE A;  5M9O A;  2EYF A;  5KGU A;  1KAB A;  3S9W A;  1STH A;  2EYL A;  1EZ8 A;  2RDF A;  5DEH A;  4HMJ A;  1SND A;  2F0M A;  3D6C A;  3MEH A;  1TT2 A;  5IGD A;  5EKK A;  3D4D A;  5F2D A;  3QOL A;  3U9O A;  2KQ3 A;  4J6H A;  5IGE A;  3ITP A;  4K2K A;  1EY7 A;  3HZX A;  1F2Z A;  4QMG A;  1A2U A;  3C1F A;  3DMU A;  4KJN A;  1II3 A;  2PW7 A;  4KY7 A;  2F0I A;  2RKS A;  3R3O A;  4ID6 A;  5CV5 A;  4K8J A;  4DGZ A;  2F0J A;  3SHL A;  5IIF A;  5IGC A;  2F0D A;  4NDX A;  4TRD A;  3T13 A;  3OMG A;  3OWF A;  1NUC A;  5CV6 A;  2OEO A;  2QDB A;  1EY8 A;  3P75 A;  1EY5 A;  2F0L A;  2RBM A;  4K14 A;  4K2L A;  2F0P A;  3NHH A;  3MHB A;  2PZW A;  3MXP A;  5IGF A;  2EXZ A;  3VA5 A;  1STY A;  2EYM A;  2F0V A;  1ENC A;  3NXW A;  1AEX A;  4HMI A;  4HTH A;  5CV8 A;  2EY6 A;  5CV4 A;  4KD3 A;  5EGT A;  3QOJ A;  5C4Z A;  1JOR A;  3E5S A;  4H7B A;  3TME A;  5HGT A;  4K5X A;  1SYC A;  1KDB A;  2KHS A;  3ERO A;  4NMZ A;  4S3S A;  3RUZ A;  1JOQ A;  5J22 A;  1EY9 A;  1EY4 A;  2M00 A;  4KHV A;  5NUC A;  2F0E A;  3V2T A;  1EYD A;  3D8G A;  4RKL A;  3NP8 A;  4R8N A;  3SK8 A;  2F3W A;  3H6M A;  5CGK A;  4IZ8 A;  4DFA A;  1ENA A;  2F0H A;  1SNC A;  4K8I A;  5C5M A;  2EY5 A;  3BDC A;  1A3U A;  5CR3 A;  1NSN S;  2WAC A;  5KIX A;  2SNM A;  1EYC A;  4WRD A;  3D4W A;  4G57 A;  1STG A;  2F0S A;  3OSO A;  3TP6 A;  2F0O A;  5I6W A;  1SYB A;  3NQT A;  3EVQ A;  3QB3 A;  3TP7 A;  1TQO A;  4NKL A;  5I6Y A;  2EYO A;  2PYK A;  2OF1 A;  4YIJ A;  4N9P A;  5E1F A;  4ZUJ A;  2LKV A;  2PZT A;  1KDA A;  4F8M A;  5KRU A;  5KYL A;  5KYI A;  2EY1 A;  4KY5 A;  4PMC A; 
#chains in the Genus database with same CATH topology
 1RCV D;  4LFA Q;  3CCJ A;  1WVL A;  4G7H C;  3EQL C;  1F2L A;  2R92 G;  1XTC D;  1VQ5 A;  1VMP A;  1CHQ D;  3OYY A;  3G6E A;  5DM7 3;  1VDZ A;  5C0X J;  3E9H A;  3S2D B;  3E6Z X;  1K83 B;  1QNK A;  3VR4 A;  4LF5 L;  4GKJ L;  1K8M A;  2TMP A;  1NJI C;  1EYA A;  2AQ3 B;  1QZG A;  4KLK A;  4GOP C;  4BY1 G;  3PO3 G;  4JYA L;  1DJR D;  3HP3 A;  4IJL A;  1U9R A;  1PH3 A;  4M1U B;  3PUW A;  3F2B A;  2B2T C;  4RKB A;  3OIQ A;  4P71 A;  1ASY A;  2O5I C;  1RHP A;  3NK9 A;  1VQB A;  2RA4 A;  3D31 A;  1X3G A;  1IBL L;  3CCL A;  2V4D A;  5FK9 C;  4BS9 A;  4O42 A;  3HOY H;  3SK4 A;  1DYQ A;  1KLU D;  4DV5 Q;  4IO9 A;  1VQF A;  3G6J B;  3S2H B;  4DNR B;  2BCO A;  3DM3 A;  4BBR H;  3J81 E;  3B6Y A;  2KUM A;  3RLF A;  1K3R A;  1CT1 D;  2RF4 A;  1I6H B;  5M5Y B;  1V1O A;  3VDY A;  1HCZ A;  2C9O A;  1PTO B;  4N8F A;  3PIP 3;  4A3D H;  3X3M A;  4KHP L;  2N78 A;  5JJL A;  3NEL A;  4B3M L;  2ICI A;  5ELO A;  4FVM A;  1VQA A;  1XNQ Q;  1I4G A;  1ENC A;  1MI2 A;  2RSO A;  4BA1 I;  2CKZ B;  5D14 A;  4BY7 G;  5AJ3 L;  1QJO A;  3KDF B;  1HNW L;  1JJC B;  4OWT B;  2NVT B;  2K5Q A;  1HA6 A;  3S1M B;  2PNH A;  3D8G A;  1PRT C;  4DFA A;  1GM5 A;  2AMC B;  3NTK A;  4X6A H;  4HJ7 A;  3JC6 6;  4MN3 A;  1L1O C;  2EQS A;  2HD3 A;  1PYW D;  4O0A A;  3D3R A;  2VQF L;  2EYO A;  3MXN A;  1A6X A;  4F8M A;  1D5Z C;  3DEO A;  2HHH L;  1XMO Q;  4JI5 Q;  3GTP B;  4H02 A;  3DLL A;  3BDO A;  2CFM A;  1PH5 A;  2A69 D;  3MTS A;  4ME3 A;  1HNZ L;  5M3M B;  3NEM A;  2L15 A;  4R9W A;  3R2T A;  1NCV A;  2XRS D;  5BN4 A;  3K5O A;  4ZQ3 A;  4IOA A;  1Q46 A;  2NUC A;  3IRB A;  3BDL A;  2C35 B;  1Y14 B;  3RZD H;  1MJC A;  1AZQ A;  2NTS A;  2CH4 A;  1CHP D;  4DR1 L;  4IFD I;  2KEE A;  1WFQ A;  4OON A;  2EYJ A;  4DAV A;  3BVZ A;  4N9T A;  1MIU A;  2F0W A;  3M4Q A;  4C3H B;  2F1M A;  4DV3 L;  3HS0 C;  3CAM A;  2UUB Q;  4V0B A;  2OXP A;  3CP0 A;  3EIV A;  2G5D A;  3SGI A;  1KC8 C;  2XWB B;  3GTM H;  5M3M G;  4LAA A;  2A69 C;  2D0O A;  2A6H D;  5CV9 A;  4ZLT F;  1NR2 A;  3LWU A;  2LS0 1;  1STH A;  3MEH A;  1JWS D;  3KBG A;  4PMW A;  1TY0 A;  1Q8K A;  5C44 B;  5F2D A;  5IGE A;  2B2W A;  2EJF C;  4L6T B;  4K2K A;  4QMG A;  1UAP A;  4RG1 A;  5CV5 A;  4BWG B;  2A68 D;  4AQY L;  4C3H G;  1D1K A;  3J7Z C;  4LF8 L;  1ENF A;  1VMC A;  3HOU H;  4LFB Q;  1G2S A;  1SFO B;  1EL0 A;  1HZC A;  4EQ5 A;  1TWF B;  4J8Q A;  1EY5 A;  4WJ3 M;  2A73 B;  3MHB A;  4FF1 A;  3BG3 A;  4IPH A;  3STB D;  1E2W A;  2K7V A;  4APV A;  3GTJ B;  4HTH A;  2AQ1 B;  1Q12 A;  3A8K E;  1KHI A;  1QUQ B;  5BR8 L;  2E2H H;  1E1T A;  3L3O C;  1HQM C;  2DUD A;  2F0E A;  5C44 G;  3M3Y H;  1CQV A;  1RD9 D;  2CHB D;  4R8N A;  2JA6 H;  1GD7 A;  1LT5 D;  2LSS A;  4NXN L;  1Q8I A;  4B3T Q;  1QB5 D;  5KIX A;  1CKM A;  3OSO A;  2ZTE A;  3KFU A;  1EEF D;  1L0W A;  1YHQ A;  1PTO F;  2YU9 H;  1ICW A;  1V9P A;  1PV4 A;  4CDF C;  3CD6 A;  4GN5 A;  5IT9 c;  1WTH A;  4A3J G;  4RCO A;  4ODG A;  1KNE A;  4K0K Q;  1FNW A;  2M2L A;  4BBS H;  1T5X D;  2F0T A;  4P2C B;  4A3E G;  5A35 A;  1IL8 A;  3J80 c;  1I4R A;  3NWT A;  4B9W A;  3PIP A;  2Q2T A;  3NBI A;  2EYP A;  3MFY A;  3WWV A;  3T1Y Q;  1F9S A;  3PUZ A;  1D5X C;  4B3S Q;  4FNF A;  1F9P A;  1TKW B;  2NVQ H;  4RGO S;  2YTX A;  2ZJP A;  1FNU A;  4EVO A;  2JA5 G;  3FKI B;  1DON A;  4U67 3;  5E3F A;  1GUW A;  4FXK C;  5C3X A;  1K8A C;  2F3V A;  3K7U C;  2JA7 B;  1XMQ Q;  1N36 L;  2RCN A;  3CCM A;  3S1R H;  1AN8 A;  3HOV B;  1DCZ A;  4WOR A;  5C6A A;  3HG9 A;  5CC4 A;  3S1Q B;  1Y1V B;  4IFD H;  1LTA D;  4A4I A;  1F2M A;  4ZUI A;  3I55 A;  2E2J B;  3QG1 A;  4RAU C;  1K28 A;  3NE5 B;  5KEE A;  2GVA A;  4YCV A;  5M9O A;  2K28 A;  2EYL A;  3SVM A;  3FP9 A;  2HIX A;  5CMD A;  4X64 L;  2C5C A;  2VL6 A;  4MHE A;  2QEJ C;  5M3F H;  4JI6 L;  4GKK Q;  3QOL A;  3M4O B;  4JBM A;  2BDN A;  3FKI G;  2JK8 A;  2Z1C A;  3FDT A;  2PW7 A;  2UUC Q;  4ID6 A;  2ES2 A;  3TZD A;  2PPB C;  2KCN A;  3S1N B;  4XT1 B;  2F0L A;  2ICE C;  1FD7 D;  1FVI A;  2L5T A;  4LFA L;  3WOF A;  2D2C C;  4HMI A;  1RIP A;  3S16 H;  2I5H A;  1XX8 A;  2CQA A;  2EY6 A;  2J7Z A;  1HXY D;  4GOP B;  1IBK Q;  5JJI A;  1RF2 D;  2Z6K C;  1HTP A;  1B4O A;  2ASB A;  3I70 A;  3VR3 A;  2JA8 H;  5KNB A;  5CGK A;  5JEA J;  4JOI A;  2NVY B;  2X6L A;  2CWA A;  4C56 C;  3GTG H;  4AYB E;  3R93 A;  1D2B A;  1E0B A;  4C3J B;  3IFT A;  1WJJ A;  3W2D A;  5E1F A;  5M5W B;  4I7Z C;  4Y7N B;  4AYB G;  1OXX K;  1TII D;  4CBV A;  1IBL Q;  4KY5 A;  3T1H Q;  4FF2 A;  3F8T A;  1Z6H A;  4IAL A;  1T9H A;  3EJI A;  3QWN A;  1KAW A;  2XTI A;  5E7N A;  1LO5 D;  5HY6 A;  4X65 L;  4R4I A;  1N32 Q;  3M4Y A;  4DV5 L;  2O4X A;  4YCW A;  3SK6 A;  1WYD A;  2RQX A;  1UE6 A;  3T51 B;  4A3G B;  4KHP Q;  1C4Q A;  3I4M H;  2JA9 A;  4G7Z C;  1H9M A;  3U50 C;  4K5V A;  4TKO B;  4X3T A;  2ZJQ A;  4HJ8 A;  1K3B C;  1X3Q A;  3WDN A;  2JQO A;  5C4H A;  1KL9 A;  5AJ3 Q;  2IX0 A;  4EQO A;  5C4X H;  1H95 A;  1XNQ L;  4RWS C;  3J81 j;  3P1H A;  2Z4H A;  3MXG A;  1JT8 A;  1LT3 D;  4DV6 Q;  1F2Y A;  1L1O B;  2WKC A;  3K58 A;  4CKB A;  3U58 A;  4A3K B;  1XPO A;  1Q81 C;  4UY8 C;  3KF6 B;  1KAB A;  1A15 A;  1CA5 A;  4KKU A;  1JCK B;  1MD2 D;  1V1P B;  1YJ9 A;  3CME A;  2VQF Q;  2WV6 D;  1XNR Q;  2K75 A;  2R92 H;  1EY7 A;  1JC7 A;  2B2Y A;  1V43 A;  4OO1 G;  1S40 A;  1B70 B;  3OIP A;  3VYS A;  2O2L D;  2WAQ E;  1SDF A;  1GO3 E;  4OEL B;  3C2P A;  2BH8 A;  1XMO L;  4JI5 L;  4RCN A;  1GHK A;  2PZW A;  2EXZ A;  2PI2 E;  1EIF A;  2GVB A;  2WKD A;  3KF8 A;  1KD1 C;  2WAQ G;  1VQH A;  4BY1 H;  4KD3 A;  3PO3 H;  1JIC A;  3BZD B;  5HGT A;  1SYC A;  3RUZ A;  4IOC A;  1X56 A;  4KHV A;  1NAP A;  3FMC A;  4H44 C;  3A74 A;  5H1S E;  4GNX A;  1MKH A;  1WOC A;  1PFB A;  4CDC C;  5LHY 1;  4Y52 H;  3GV6 A;  2PMZ E;  2L55 A;  5D3I B;  3S2D H;  5I6W A;  2B63 B;  2B2U A;  4UP7 A;  1K83 H;  5IWA Q;  2AWN A;  4IUT A;  5EPK A;  4DR5 Q;  1QUQ A;  3M4P A;  5KYI A;  5FKA C;  4X3S A;  4FP5 D;  4A93 B;  1EY6 A;  3GTK B;  3H15 A;  3PCO B;  4R4O A;  2VS1 A;  1PA6 A;  1CZW A;  3HOZ B;  2BDO A;  4LUO A;  2MQH A;  1EIY B;  3A5Z B;  3CCE A;  3PGZ A;  5C5L A;  2L0C A;  5IYD G;  3UI2 A;  4NB3 A;  1G8Z D;  1Y8N B;  4EX5 A;  2K01 A;  1I4H A;  2BA1 A;  5KND A;  4KJO A;  1VQJ A;  4A3I B;  3F1Z A;  4CKE A;  4BY7 H;  3LNN A;  2B63 G;  1YEZ A;  4XQN A;  4C1N I;  1BVS A;  5JPM C;  3C3L A;  3TN2 A;  2KBN A;  1G2T A;  2K50 A;  2L1B A;  3S2H H;  4MIU A;  2LY7 A;  5K5P A;  4XDX A;  1LAB A;  4JVZ A;  3HOZ G;  5IOD A;  1C48 A;  1SNO A;  1OO9 B;  4NP5 A;  1PTO H;  1JE5 A;  1R4P B;  1GVP A;  4Q0F A;  2MJ8 A;  2OWO A;  4LF6 L;  3GTO H;  4A3I G;  4B3T L;  4X3K A;  1L0Y B;  1IKL A;  4A3B B;  1PXU A;  4ZYS A;  2NVT H;  3HZX A;  5ELC A;  2R3Z A;  4FF3 A;  2ZXP A;  5M5X B;  2OTL A;  3AEV A;  3DWA A;  4YCU A;  4JBJ A;  1PRT F;  1LTR D;  1JB3 A;  4ZKB B;  1IBM L;  2XSC A;  1GXD C;  3IAY A;  2B3G A;  1J8I A;  1GHJ A;  1I3Q B;  1C0A A;  2IHF A;  1UNS A;  2R6G A;  2BE5 D;  1XWE A;  1KNA A;  4RA8 A;  4UP9 A;  1ZKO A;  2Z9H A;  3S15 B;  2UXC L;  2Q2H A;  3H6M A;  4TQU S;  1XPR A;  3RLN A;  3BZC A;  5M3M H;  5GQO A;  1JE4 A;  1YI2 A;  2WB1 E;  1Q86 C;  1EYC A;  1J5E Q;  4A3L G;  2NN6 G;  1ZYR C;  1CKN B;  1TWC B;  1DOL A;  1I5F A;  3TP7 A;  1QVF A;  1GUT A;  1TQO A;  2KCM A;  3O13 A;  4IUQ A;  3ULP A;  1XMQ L;  2E2D C;  2WB1 G;  3BVG A;  1JWM D;  4DV0 L;  4DXF A;  2NTT A;  2WIN B;  4KD4 A;  4E6I A;  4DV1 Q;  4UDU C;  3I4M G;  3KJP A;  1B9M A;  5FO7 B;  2B2T A;  1CA6 A;  4DR3 L;  4H13 C;  4LF9 Q;  4C3H H;  4QB4 A;  4ALP A;  1PH2 A;  5C4X G;  4JBW A;  1BDO A;  1PH9 A;  1C7Y A;  1STA A;  2AWO A;  3RN5 A;  4GKK L;  1GOZ A;  2RSN A;  3SK5 A;  1HTL D;  1P8L A;  1B9N A;  1GUO A;  2HT1 A;  3TP5 A;  4KTA A;  1VF7 A;  2MO1 A;  3CRL C;  5C44 H;  1B7Y B;  1VQ6 A;  2R7Z B;  3BU2 A;  3MA2 B;  2CQO A;  1IBK L;  2NVX B;  1TWF H;  4K5W A;  4RHS A;  3E0J A;  5GAG C;  3VYT A;  1PDQ A;  1SE2 A;  4A3J H;  1HPC A;  3OTO Q;  5FLX c;  3QJY A;  5IYC G;  3GTJ H;  2KQ3 A;  2RVL A;  5EKK A;  3R3O A;  4A3E H;  1HJP A;  2F0D A;  3T56 B;  1GUS A;  3GQB A;  2QDB A;  3P75 A;  3C46 A;  2R7Z G;  5IT9 L;  4HID A;  3T1H L;  2KHJ A;  3KF6 A;  4C3I B;  3UDI A;  3RR5 A;  4X66 L;  3DEP A;  2F0V A;  2K5V A;  1SEB D;  2PI2 A;  4X65 Q;  1VQ4 A;  1G29 1;  3M85 A;  2VQE L;  2UUA Q;  1PRT D;  1EEI D;  2JA5 H;  3J80 L;  3TME A;  3AYH B;  3CHB D;  1JOQ A;  1KDB A;  2XGT A;  4S3S A;  3G4S A;  3PF4 A;  1EY9 A;  1SRU A;  1N32 L;  3KK7 A;  2EE1 A;  4ZCK A;  1SE4 A;  2E8G A;  3PIO 3;  3CXC A;  2UXD Q;  5A2Q L;  3VYR A;  4QGU A;  5IYB G;  4LNQ A;  2XRQ D;  2A8V A;  4OO1 I;  3NQT A;  4BA2 I;  2DNC A;  5KRU A;  1UEA B;  4XIG S;  3HOX B;  1X65 A;  2PNR C;  2EY1 A;  4O1N A;  4DF7 A;  1MBY A;  1S3O A;  4YWK A;  4DV6 L;  3FKI H;  2ZTD A;  2SEB D;  4V19 0;  4OL7 A;  1IZ6 A;  1UE5 A;  5JOB A;  3FVQ A;  1NY4 A;  4QIW B;  2VW9 A;  1PVO A;  2PO4 A;  1I50 B;  3HOV H;  2J0T D;  3D0F A;  4IN3 A;  3KLS A;  4LF7 Q;  2JJQ A;  4X3U A;  3ICE A;  1IHZ A;  1XNR L;  5IY0 A;  1S5D D;  2K32 A;  3HOX G;  2SOB A;  1YNN C;  1Q7Y C;  1HRJ A;  4PZ8 A;  4QIW E;  4DAY B;  5DM6 3;  3TS0 A;  1TS5 A;  3HKS A;  4QF4 A;  4IUP A;  4XQJ A;  1QOH A;  4IUN A;  1XYI A;  4F87 A;  1SYG A;  1JWU D;  4RGT A;  4GZY C;  3S1N H;  3ONA B;  2SNS A;  2VB2 X;  3KLW A;  4IQZ A;  5HGQ A;  3D6C A;  1SAP A;  1TT2 A;  3K6O A;  1B3A A;  3Q6S A;  2JEA I;  4IUU A;  5ELE A;  5FLM G;  4AIM A;  4ZRZ A;  4KHZ A;  4DV2 L;  4DA2 A;  2H4O A;  3GTL B;  1N34 Q;  1SBB B;  1TWH B;  1ICF B;  3K5L A;  5JPN C;  1Y1W B;  5IWA L;  4XYO A;  4JW0 A;  4DR5 L;  2JP1 A;  4TRD A;  3CQZ H;  1HFG A;  1G51 A;  2E74 C;  5EPL A;  2EJG C;  4K2L A;  5IP7 G;  5DNF A;  2QCP X;  1X54 A;  3MEF A;  1BXT A;  3H0G B;  4C3J H;  2K1B A;  4C2M H;  5EBD A;  2H5X A;  4K5X A;  4Y7N H;  3J7A 5;  1E24 A;  4YY3 L;  2VUM B;  2IHE A;  2FFK B;  1B3Q A;  4OEM B;  2QIL A;  5C0X G;  3BDC A;  4HSV A;  1AFP A;  2WAC A;  4DKA C;  5ELN A;  5GAH C;  1A0I A;  3EVQ A;  4RFB A;  1SMY C;  1C9O A;  1NTG A;  4DV7 L;  4YWL A;  1NMG A;  1NBW A;  1A63 A;  5JVG 3;  1AZP A;  1TWA B;  3NUC A;  3H0G G;  1ILQ A;  4DR2 L;  2DN8 A;  4OO1 H;  3CC7 A;  3DHQ A;  3H91 A;  3BJU A;  2F0Q A;  4LF6 Q;  4B3R L;  2HCC A;  5IOC A;  1CKN A;  1FGB D;  2VUM G;  4B9X A;  3K59 A;  4UPA A;  2NWG A;  4K6L A;  3ULJ A;  3RLO A;  1SXT A;  1TWG B;  4R4T A;  1YNJ C;  3H3V C;  3GTQ B;  4A3K H;  3A7L A;  2L4N A;  5EJW A;  2NN6 I;  1WCM B;  2EOT A;  1IBM Q;  5T1I A;  3RZO B;  4EQN A;  2JN4 A;  3URY A;  3TP8 A;  4DU9 A;  5GAE C;  5FO9 B;  1BKB A;  5CBA E;  4ZK9 B;  2F0G A;  5IT9 E;  2FMM A;  4CDD C;  3TRZ A;  1VCI A;  1QNU A;  3BZK A;  1SYE A;  1Y69 U;  4TSS A;  3JAM i;  2PZU A;  3ERS X;  1OXT A;  1SJH D;  2N55 A;  2P5Z X;  4DUZ L;  2UXC Q;  2PQE A;  3J80 E;  5I4D A;  4BBR B;  1CFM A;  1GUN A;  2ZXR A;  2UU9 L;  2J4X A;  4XXE A;  1SR3 A;  4DNI A;  1ML0 D;  1WCM G;  2B2W C;  3HKZ B;  1UE1 A;  1J5E L;  2E2I B;  5A2Q E;  4DGZ A;  2F0I A;  1CI3 M;  4A3D B;  2HUG A;  3A55 A;  4DV0 Q;  5IYD H;  3BYT B;  4DV1 L;  3CMA A;  4DR3 Q;  4AH6 A;  4RGM A;  1HZ9 A;  1ET6 A;  2Y0S B;  2B63 H;  1S5F D;  1CTM A;  1TS2 A;  2WII B;  4LF9 L;  2SDF A;  1Q90 A;  3S24 A;  5NUC A;  1SE3 A;  2VY3 A;  3V2T A;  1DOK A;  3GTK H;  1LLR D;  1NE3 A;  4J15 A;  4RKL A;  2F3W A;  5E4X A;  4IZ8 A;  3UE0 A;  3HOZ H;  2DJF C;  2IW3 A;  2JA7 G;  4WRD A;  3BS1 A;  2Y0S E;  3IFD A;  3K5N A;  1UEB A;  3HOV G;  1WD1 A;  4ABN A;  2R93 B;  3K0Y A;  3NEN A;  1FYC A;  1EU3 A;  1Y1V G;  3V96 A;  2K05 A;  3Q0A A;  3FRP B;  1WTV A;  4PMC A;  3OOC A;  4A3I H;  3MFG A;  1P16 A;  2MUY A;  2Y0S G;  4IJH A;  5LL6 S;  3KOJ A;  1CSP A;  4JI3 L;  4JI7 Q;  3I8Z A;  2JXM B;  1XPU A;  1X3E A;  5C3W A;  3J81 i;  3RZD B;  1S5C D;  5J39 A;  4IFD J;  1IXR A;  3OTO L;  4BXX G;  2WP8 J;  1QVG A;  1SNQ A;  1YJW A;  3FPU B;  3KDF A;  1YBY A;  2XNA C;  4DN4 M;  2IX3 A;  1EYG A;  2R93 G;  4J1M A;  4G7O C;  1DXM A;  1YHB A;  1B53 A;  5ISR A;  3NWS A;  4LMQ D;  2I46 A;  4X66 Q;  4IUV A;  3GTM B;  3CCQ A;  1PH6 A;  1EOT A;  4DK3 C;  1A3T A;  1BCP C;  1TS3 A;  5D65 A;  1HZA A;  5I9O A;  2VQE Q;  4OHJ A;  1R4Q B;  2E76 C;  3I4N B;  4A3L H;  2NN6 H;  2K03 A;  2UUA L;  5M5X H;  2BH2 A;  2PQA B;  4RGN A;  5FO8 B;  5BN5 A;  2ZM6 L;  4JV5 Q;  2PW5 A;  1U4R A;  2EYF A;  1WTW A;  1EZ8 A;  4HMJ A;  3FHW A;  4C3J G;  4A75 A;  2UXD L;  4CGY B;  2GA4 B;  1I3Q H;  1H9S B;  4P74 A;  4JI2 Q;  3F2C A;  5C3E B;  2B2V C;  4GLV B;  3HOU B;  1U4L A;  1IYU A;  3C1F A;  3DMU A;  1II3 A;  1PRT B;  3RD4 A;  3S15 H;  3T13 A;  3D4R A;  4HR7 B;  1PZJ D;  1B50 A;  1D8L A;  4QY7 A;  1Y8P B;  1I4Q A;  5GRO A;  4GLX A;  3I4N G;  4A3C G;  3VR2 A;  1STY A;  1O78 A;  2E2H B;  1TWC H;  3W1G A;  2A1A A;  1W6J A;  2BOS A;  4JBK A;  3WOE A;  1I94 Q;  1IYJ B;  3KLR A;  1FNV A;  5CYU A;  5J22 A;  1HFN A;  3GDE A;  4A3G G;  4DR6 L;  4P73 A;  1J9O A;  3UE1 A;  4LF7 L;  4LWC A;  1ENA A;  1OXV A;  5C3E G;  3KUP A;  3A0J A;  2KEN A;  1JJG A;  3RMH A;  3FPP A;  2LXJ A;  3TP6 A;  4YWM A;  1VQP A;  3M7N A;  1EFW A;  4L5R C;  2JE6 I;  3U4Z A;  3GP7 A;  2PYK A;  1TY2 A;  1S4Z A;  4N9P A;  4P75 A;  2K5N A;  4ZUJ A;  1KTK A;  3S17 B;  1OXU A;  1SE8 A;  4H0L C;  2VXW A;  4A3K G;  1MJE A;  3N6R A;  1H9K A;  5IYC H;  4QJF A;  2B39 A;  4ILW A;  2X69 A;  2EXD A;  1D6E C;  1EZ6 A;  4L5Q A;  1V1Q A;  4KN7 C;  1A2T A;  3Q22 A;  2HIV A;  5IE8 A;  4DV2 Q;  2R7Z H;  1ROD A;  1ESF A;  3PUV A;  2FMC A;  2EY2 A;  3RN2 A;  1AH9 A;  4NW2 A;  5FLX L;  1U0L A;  2Z8L A;  5EPJ A;  1W2B A;  3I72 A;  1N34 L;  5C0X I;  2NVX H;  1X3P A;  4N8X 1;  1STN A;  1ESR A;  5IP9 H;  1D1I A;  1FL0 A;  1DM0 B;  2Z0S A;  2E75 C;  1Y8O B;  1N33 L;  4OGQ C;  2YV5 A;  1IYV A;  5IYB H;  1QE6 A;  4YY3 Q;  3K80 C;  4PG3 A;  1R9T B;  3KLS X;  3AQQ A;  2NZ1 D;  5I2Y A;  1YJN A;  2MFI A;  1MGS A;  3Q24 A;  3S9W A;  3EA6 A;  2ZXO A;  3A56 A;  4C3I H;  3MXN B;  2F0M A;  2TSS A;  5FOB B;  4DUY L;  1TXY A;  1CM9 A;  2QW7 A;  1U4P A;  2RDG A;  1GJX A;  3VA7 A;  3CRK C;  1B2T A;  1X3F A;  3CKI B;  5I2X A;  1EUJ A;  4LK1 C;  4A93 G;  1F2Z A;  2B2Y C;  4KJN A;  4IPG A;  4DV7 Q;  4PQX A;  5JEA G;  4QUF A;  2Q2U A;  1EWC A;  1Z7T A;  2A6E C;  1NUC A;  4KKS A;  4DR2 Q;  5M5Y H;  1I6H H;  3AU7 A;  2WFW A;  4B3R Q;  5CBE E;  1PHJ A;  2JA8 B;  4JG2 A;  4NPS A;  3LWE A;  4A3F B;  1S72 A;  4DPG A;  1YIT A;  1PLF A;  3HOX H;  4Z9C B;  5LMN W;  2M00 A;  1RTN A;  1BF4 A;  2B8G A;  1ZYR D;  4GNX C;  1VQL A;  5JJK A;  2D62 A;  1O7I A;  4K8I A;  1SNC A;  5TSS A;  5C5M A;  1BBW A;  4YHH L;  3S1M H;  2AKW B;  2I07 B;  5CR3 A;  3M7G A;  2F0S A;  1F77 A;  1KRS A;  3GD7 A;  4HJ9 A;  4HJA A;  1HNX L;  2D0P A;  4FO2 A;  3A8J E;  2B2U C;  2NZH A;  5FJ8 G;  2R7F A;  4HED A;  1RL2 A;  5AFW A;  4CHT B;  5EKL A;  1D7Q A;  3I91 A;  5FLM H;  1KIX A;  3VR5 A;  4KMU C;  2OTJ A;  4DUZ Q;  1W6K A;  4NXM L;  5LMU L;  4A3F G;  3GTP H;  3AMU A;  1SSO A;  1E22 A;  1LUZ A;  2CCZ A;  2VB3 X;  3HEJ A;  2UU9 Q;  4A3B G;  3MAQ A;  1CSQ A;  2KCC A;  2XVS A;  2E5L Q;  3CF5 A;  4X62 Q;  5CV7 A;  5IP7 H;  3CW2 C;  1A8V A;  1BBU A;  3ERQ A;  3HOW B;  4GOP A;  3A5U A;  1A62 A;  3CPF A;  4WJW A;  2K52 A;  3N52 A;  3PO2 B;  1G6P A;  2OT2 A;  4L8J A;  2K4K A;  3GTL H;  4I65 A;  1KDC A;  1TWH H;  3MXU A;  5C0X H;  5T1G A;  4DV4 L;  1WTO A;  3DWQ A;  4KKT A;  3TZU A;  1WTX A;  2KED A;  4FF4 A;  5D3D A;  1JQY D;  3K7A B;  2OQ0 A;  1UWV A;  2MNA A;  2K33 A;  1MSG A;  3JAM c;  3A54 A;  5E4W C;  1U4M A;  2L9H A;  1TVX A;  3QO2 A;  3DXJ C;  4DK6 C;  3HOW G;  1SN8 A;  2L11 A;  3H0G H;  4HIO A;  1RJT A;  4MZ9 A;  1N9W A;  3ITP A;  3NTH A;  3M9B A;  2I5L X;  1PFM A;  3IL8 A;  3PO2 G;  3A8I E;  1BR9 A;  3ND9 A;  4L5S A;  4LW1 A;  2VUM H;  3OMG A;  2PQA A;  1PYB A;  1XJV A;  1M90 C;  3S14 B;  1EWH A;  4QQB X;  4K14 A;  2CW0 C;  2M9V A;  2ALY B;  3I7F A;  4JI3 Q;  3R8B A;  4CJ2 C;  1SFO H;  1BUV T;  4A3M B;  2K04 A;  1U5K A;  4JI7 L;  4KI0 A;  4MTN A;  1H9S A;  4FYD A;  3QOJ A;  5JVH 3;  3AFP A;  1TWA H;  4JI4 Q;  2OCE A;  1PFN A;  1BCP B;  1VQD A;  4PV1 C;  4CJ1 B;  2K6A A;  2AUJ D;  5FLX E;  1A3U A;  2EZV A;  1QWY A;  1NSN S;  1L1O A;  1STG A;  2IY5 B;  1RDP D;  2N3S A;  4LF4 L;  4NKL A;  2D5D A;  2OF1 A;  3ND8 A;  4YIJ A;  2LKV A;  1TWG H;  4JI8 Q;  1V1P A;  3I4O A;  5C4J B;  4A3M G;  3H09 A;  3GTQ H;  4HCS A;  1JMC A;  3QIA A;  2QGQ A;  2ZM6 Q;  1WCM H;  3NPP A;  5IP9 G;  4R8I A;  3CCS A;  1ILP A;  4LUZ A;  3OMC A;  3RZO H;  3CCR A;  5G3L F;  3PF5 A;  2AHO B;  4PMB A;  1JOO A;  4JV5 L;  2JEB I;  3E9I A;  2KHI A;  4BY7 B;  3MVV A;  4KY6 A;  4POF A;  2MHV A;  2F4I A;  2H1E A;  1F9Q A;  4JI2 L;  3J81 c;  4EQP A;  1YNN D;  4FXG C;  1L2F A;  3X3N A;  1X55 A;  5JAV A;  2UXB Q;  3CCU A;  4C3I G;  3PMF A;  1LTB D;  1SNP A;  1PFS A;  1NMF A;  3PQI A;  1O7Z A;  4XYQ A;  5DAU A;  3PUX A;  4DAP A;  3KJO A;  3NSW A;  2ZJR A;  1SYF A;  3CU7 A;  2E2I H;  4UP8 A;  4HJ5 A;  3J7A F;  2JA7 H;  1AW7 A;  4JK1 C;  2FXQ A;  4DR6 Q;  1I94 L;  3ULL A;  3K8A A;  1O7L A;  3GTO B;  3S1Q H;  1SYD A;  1Y1V H;  1EQV A;  2HDL A;  2A5H A;  2ZTC A;  5DEH A;  2E2J H;  4JCV E;  4HSP A;  1JJ2 A;  1S5B D;  1Z9F A;  3D6W A;  3GO5 A;  2OQK A;  3EN2 A;  2Z6B A;  2DNE A;  2DGY A;  4C1N K;  5LMN L;  3I90 A;  2Q8I B;  2RKS A;  2LFN A;  3M4O H;  2FHT A;  4OIJ A;  4PZ6 A;  1L0X B;  4DAM A;  2OEO A;  5K36 G;  1STE A;  4ZAI A;  2F0P A;  2ZT9 C;  2K5H A;  2NZO A;  5LL6 X;  5IGF A;  4BXX H;  4OWW B;  3NBH B;  2QF7 A;  2IJ0 A;  2CH4 W;  4UHV A;  4HCE A;  4B08 A;  3OW2 A;  2R93 H;  2N88 A;  1YHA A;  3T4A C;  4H7B A;  1PZI D;  2VNU D;  1E3P A;  1EYD A;  2G9H D;  3SK8 A;  2EPB A;  1N8R C;  1H9R A;  3SE0 A;  3U4V A;  3DUZ A;  1SMY D;  1LYL A;  3CCV A;  4G57 A;  4JI1 Q;  3PUY A;  1HR0 Q;  2NVY H;  4L63 B;  3I3C A;  1FGU A;  5EBC A;  3BVM A;  1N33 Q;  2PZT A;  1KDA A;  2B29 A;  3F2U A;  3TQY A;  1EQQ A;  2EJM A;  1QZH A;  4DR4 Q;  1PYS B;  5BN3 A;  3E0E A;  5M5W H;  2HCI A;  1E7Z A;  2K5W A;  2MP1 A;  3CC2 A;  3CC4 A;  2KJX A;  5I9P A;  3Q8D A;  2IWH A;  4OIK A;  4F88 A;  1VQ9 A;  4DUY Q;  4R4Q A;  1YNJ D;  2A19 A;  3GV3 A;  1BCP F;  3HFZ B;  5ELB A;  2EYH A;  2LMC B;  1Y1W G;  3LX0 A;  3I4N H;  2XIW A;  4A3C H;  5G3L D;  3NTI A;  1VQ8 A;  2F0U A;  4EGV A;  2LXK A;  4HIM A;  3KF8 B;  1WTR A;  1LTL A;  2EVB A;  2AUK A;  3V05 A;  1K0R A;  4A3G H;  3K0X A;  1Q1E A;  3UDF A;  3I56 A;  4GNX B;  1STB A;  5C3E H;  1PH8 A;  3H3V I;  3IKJ A;  1KAA A;  3OPO A;  5EKI A;  1BNZ A;  1X32 A;  1HZB A;  1DGS A;  4A3J B;  2IT1 A;  4YHH Q;  1VQN A;  3MWY W;  1FJG L;  2A6H C;  1WTP A;  4LFC Q;  1HNX Q;  1XXG A;  3PIO A;  4J6H A;  3TRE A;  4A3E B;  2F4V Q;  1QCB D;  3UDX A;  1LT4 D;  3SEB A;  1PZK D;  4NDX A;  1WD0 A;  2IX1 A;  1CKO A;  3TBI B;  3HOY B;  4NXM Q;  2MPM A;  5LMU Q;  3NHH A;  2A68 C;  3G48 A;  4DXG A;  3OW7 A;  2JA5 B;  2YTY A;  4MNO A;  5CV8 A;  4DR7 Q;  2JSO A;  3S17 H;  2Z6K A;  2HQL A;  2KHS A;  3STB C;  1HR0 W;  2ID0 A;  2E5L L;  1C8C A;  4X62 L;  1EWI A;  2VZA A;  1TU2 B;  4QUC A;  2F0H A;  1K9M C;  3J7Y W;  2KVM A;  2I5M X;  4POG A;  2EY5 A;  1V8Q A;  2MO0 A;  2CWP A;  1B8A A;  3ER0 A;  3TSS A;  4JC0 A;  3AFQ A;  4M8A A;  2YYZ A;  5I6Y A;  3HOY G;  1O80 A;  4DV4 Q;  1CUK A;  1VF5 C;  2YTV A;  3HKZ E;  1SJE D;  4BBR G;  4DK1 A;  3SR1 A;  4DK0 A;  3OHX C;  4A93 H;  1ONL A;  5J1Z A;  1Q1B A;  5JEA H;  3K5M A;  4CDE C;  1CZG A;  3HKZ G;  4XQQ A;  1GKH A;  1G6Z A;  4A3D G;  5JJZ A;  2K5D A;  2PCF B;  4LJZ C;  3W1B A;  1R9T H;  2KOL A;  2NYZ D;  1BCP D;  1HHV A;  4JI0 L;  4OX9 L;  2B2V A;  3VR6 A;  3E3X A;  5HUR A;  1QVC A;  1YNX A;  4O2D A;  1WTQ A;  3C1E A;  3A7A B;  1E1O A;  3SXH A;  3G71 A;  4UAI A;  3K57 A;  1HQR D;  3J7A V;  1DOM A;  2XN9 C;  1KRT A;  4AYB B;  2B8F A;  5FJ8 H;  1K73 C;  2QDL A;  4LUV A;  5ELD A;  5KGU A;  4JI4 L;  4LF5 Q;  1SND A;  4GKJ Q;  5GAD C;  3H3V H;  1E2Z A;  1VQK A;  4LF4 Q;  4RHR A;  4A3F H;  3CQZ B;  1GUG A;  1KQS A;  2XWJ B;  4KY7 A;  4R1J A;  2F0J A;  4A3B H;  1G91 A;  4JYA Q;  1I4X A;  1ZEQ X;  5CV6 A;  5EAY A;  4JI8 L;  4FXD A;  1IW7 D;  1YVC A;  1LAC A;  2EYM A;  5ELF A;  4C2M B;  2I0Q A;  1SLJ A;  1MHW C;  1VQO A;  3TDQ A;  5COY A;  2F52 A;  3ZJY C;  2EIF A;  1NR4 A;  4GN4 B;  4NMZ A;  1PTO D;  2BA0 A;  2Z4I A;  3P7J A;  3EBE A;  4DAY A;  4FDB A;  3NP8 A;  1Z47 A;  4GS3 A;  3I4L A;  2RHS B;  3DM1 A;  2IL8 A;  2DJG C;  2UXB L;  1HUN A;  4OWX B;  3NBH A;  1SYB A;  2F3I A;  3QB3 A;  3QR8 A;  2CVR A;  3R2I A;  1EIH A;  4JPB W;  2QA4 A;  1Q3L A;  1F9R A;  3NQI A;  4QCL A;  1LTS D;  1HA5 A;  1EU4 A;  3K81 C;  1IW7 C;  4B3M Q;  3HOW H;  3L0O A;  3M3Y B;  4PNY A;  2JA6 B;  1D5M C;  3HRZ C;  3PO2 H;  3ZYY X;  1HNW Q;  1EQT A;  2HDM A;  1K0S A;  2IPK D;  4JOI C;  5L37 A;  3HOU G;  1PTO C;  2YU9 B;  4CKC A;  2K14 A;  3JAM L;  4TVA B;  4PZ7 A;  1A3V A;  3RNU A;  2KA7 A;  1ET9 A;  2WAQ B;  1BO0 A;  4F7X A;  5LMN Q;  2QEX A;  1AP0 A;  2QKI C;  1X6O A;  1LTI D;  3K7A H;  3Q23 A;  1VS0 A;  2F0F A;  3L2P A;  2FIN B;  4BBS B;  1BQQ T;  4ULL A;  1I6V C;  1FR3 A;  2ENB A;  1DD2 A;  4G4K A;  1VQ7 A;  2HHH Q;  2JA6 G;  3UDG A;  1AE3 A;  2HQE A;  3EFX D;  1BOS A;  1HNZ Q;  1EOV A;  2NVQ B;  4I7A A;  2A74 C;  4KV6 A;  1TR5 A;  1RKN A;  2PMZ B;  3S14 H;  2L12 A;  5IGB A;  2DY8 A;  5IGD A;  4A3M H;  4XT3 B;  3D4D A;  3U9O A;  2A6E D;  3TEH B;  1WI5 A;  3S1R B;  4OXP A;  4JI1 L;  1HR0 L;  2ATW A;  2RHQ B;  4BBS G;  1JOR A;  1VQG A;  4DR1 Q;  5IIF A;  4K8J A;  1CK1 A;  3SHL A;  1IKM A;  1W3S A;  1VQC A;  2V1C C;  4DV3 Q;  4DR4 L;  5J3B A;  3MXP A;  3MC0 B;  3NXW A;  5M3F B;  3OWE B;  2UUB L;  1YIJ A;  3L7Z C;  2FJ2 A;  2R61 A;  1EFI D;  5CV4 A;  5EGT A;  5C4Z A;  1SMX A;  1VQE A;  1E2V A;  1S5E D;  4RMF A;  1IL2 A;  1EY4 A;  1LTG D;  2R7D A;  4MTK A;  5C4J H;  1CQF A;  4QL5 A;  2RDH A;  1PH1 A;  2AQ2 B;  3J81 L;  1ZXT A;  3DWP A;  2SNM A;  4L5T A;  4IFD G;  3D4W A;  3S16 B;  4AQY Q;  4IPD A;  4U68 A;  1OTC A;  2F03 A;  4LF8 Q;  1MSH A;  4DNT B;  2O5J C;  3P20 A;  5M3F G;  3J80 i;  4LFB L;  3W3A A;  2N49 A;  1VQM A;  1UUP A;  1JB7 A;  3GTG B;  1FJG Q;  2NBF A;  1HUM A;  1OXS C;  1H9J A;  1KLG D;  1SNM A;  5BR8 Q;  1O7Y A;  4Q5V A;  1PH4 A;  1ASZ A;  1T5E A;  2Q8T A;  4XTC S;  2F0N A;  1M8A A;  2GN5 A;  5K36 H;  2F0K A;  3PV0 A;  1NNX A;  1EY0 A;  4P72 A;  3AB9 A;  4LFC L;  1LTT D;  1JOK A;  4NXN Q;  2F4V L;  3FEW X;  3MZ5 A;  1I50 H;  1HH2 P;  3CPW A;  1TS4 A;  3H94 A;  1B1Z A;  4K6D A;  5EQ0 A;  1M1K C;  1LV9 A;  4R4C A;  3VYU A;  2NB0 A;  1K8G A;  3BYY B;  1J6Q A;  3T53 B;  2JA8 G;  4RH6 A;  1JR0 D;  4KN4 C;  1B44 D;  5IGG A;  3SDZ A;  4ZKC B;  3TS2 A;  4GLA C;  4DR7 L;  2X6G A;  3I73 A;  4K0K L;  3T16 A;  2WB1 B;  1UE7 A;  1K8O A;  4KK7 A;  4ME5 A;  3I4M B;  1DZ1 A;  1LT6 D;  2Q8R E;  2RDF A;  1PH7 A;  2KEC A;  4IUR A;  3LGJ A;  3T1Y L;  5C4X B;  1Q82 C;  1A2U A;  2CW0 D;  1QG7 A;  4B3S L;  1BBX C;  1EQR A;  3HGB A;  5IGC A;  1VQI A;  4HIK A;  3OWF A;  1SRO A;  1AE2 A;  1EY8 A;  1EIG A;  2G9D A;  1Y1W H;  3KBX A;  2RBM A;  1N36 Q;  2EDG A;  1X9N A;  3U9S A;  3VA5 A;  4A76 A;  1KXL A;  1AEX A;  3W5O A;  4IPC A;  2RCF A;  3F2D A;  3PSI A;  3E5S A;  4GN3 B;  2R92 B;  1YZ6 A;  3ERO A;  1M4V A;  5DLQ E;  3L9A X;  2KCT A;  3I2Z A;  2MGS A;  4X64 Q;  1I4P A;  3JAM E;  3G7L A;  2BE5 C;  4HN7 A;  4JI6 Q;  1PMR A;  2DY7 A;  2Q2I A;  4CJ0 B;  2N8N A;  4JI0 Q;  4WJ4 A;  4OX9 Q;  1QIL A;  2D9U A;  5COR A;  2F0O A;  1XTD A;  4BY1 B;  1LM0 A;  1RTO A;  5KNC A;  3KYH C;  2JYO A;  4HAE A;  5KYL A;  3PO3 B;  2UUC L;  4WFN 3; 
#chains in the Genus database with same CATH homology
 1RCV D;  1WVL A;  4G7H C;  3EQL C;  1F2L A;  1XTC D;  1VMP A;  1CHQ D;  5DM7 3;  1VDZ A;  5C0X J;  3S2D B;  3E6Z X;  1K83 B;  1QNK A;  3VR4 A;  1K8M A;  2TMP A;  1EYA A;  2AQ3 B;  1DJR D;  3HP3 A;  1U9R A;  4M1U B;  3PUW A;  2B2T C;  4RKB A;  3OIQ A;  2O5I C;  1RHP A;  3NK9 A;  2RA4 A;  3D31 A;  2V4D A;  5FK9 C;  4BS9 A;  4O42 A;  3SK4 A;  1DYQ A;  1KLU D;  3G6J B;  3S2H B;  4DNR B;  2BCO A;  3J81 E;  2KUM A;  3RLF A;  1CT1 D;  1I6H B;  5M5Y B;  1V1O A;  1HCZ A;  2C9O A;  1PTO B;  3PIP 3;  3X3M A;  2ICI A;  4FVM A;  1I4G A;  1ENC A;  1MI2 A;  2RSO A;  4BA1 I;  5D14 A;  1QJO A;  2NVT B;  2K5Q A;  1HA6 A;  3S1M B;  3D8G A;  1PRT C;  4DFA A;  3NTK A;  4MN3 A;  1PYW D;  3D3R A;  2EYO A;  3MXN A;  1A6X A;  4F8M A;  1D5Z C;  3DEO A;  3GTP B;  3BDO A;  2A69 D;  3MTS A;  5M3M B;  4R9W A;  3R2T A;  1NCV A;  2XRS D;  5BN4 A;  3K5O A;  4ZQ3 A;  2NUC A;  3BDL A;  1AZQ A;  2NTS A;  1CHP D;  4IFD I;  2KEE A;  2EYJ A;  4DAV A;  3BVZ A;  4N9T A;  2F0W A;  4C3H B;  2F1M A;  3HS0 C;  4V0B A;  2OXP A;  2XWB B;  4LAA A;  2A69 C;  2A6H D;  5CV9 A;  4ZLT F;  1NR2 A;  3LWU A;  2LS0 1;  1STH A;  3MEH A;  1JWS D;  3KBG A;  4PMW A;  1TY0 A;  5C44 B;  5F2D A;  5IGE A;  2B2W A;  2EJF C;  4L6T B;  4K2K A;  4QMG A;  1UAP A;  5CV5 A;  4BWG B;  2A68 D;  4C3H G;  1D1K A;  1ENF A;  1VMC A;  1G2S A;  1SFO B;  1EL0 A;  1TWF B;  4J8Q A;  1EY5 A;  2A73 B;  3MHB A;  4FF1 A;  3BG3 A;  1E2W A;  2K7V A;  3GTJ B;  4HTH A;  2AQ1 B;  1Q12 A;  3A8K E;  3L3O C;  1HQM C;  2F0E A;  1CQV A;  1RD9 D;  2CHB D;  4R8N A;  1LT5 D;  1Q8I A;  1QB5 D;  5KIX A;  3OSO A;  1EEF D;  1PTO F;  1ICW A;  4RCO A;  4ODG A;  1KNE A;  1FNW A;  2M2L A;  1T5X D;  2F0T A;  4P2C B;  5A35 A;  1IL8 A;  1I4R A;  3NWT A;  4B9W A;  3NBI A;  2EYP A;  3MFY A;  1F9S A;  3PUZ A;  1D5X C;  4FNF A;  1F9P A;  1TKW B;  4RGO S;  1FNU A;  4EVO A;  3FKI B;  1DON A;  4U67 3;  5E3F A;  1GUW A;  4FXK C;  5C3X A;  2F3V A;  2JA7 B;  1AN8 A;  3HOV B;  1DCZ A;  4WOR A;  5C6A A;  3HG9 A;  5CC4 A;  3S1Q B;  1Y1V B;  4IFD H;  1LTA D;  1F2M A;  4ZUI A;  2E2J B;  3QG1 A;  4RAU C;  3NE5 B;  5KEE A;  5M9O A;  2K28 A;  2EYL A;  3SVM A;  5CMD A;  2C5C A;  4MHE A;  2QEJ C;  3QOL A;  3M4O B;  2BDN A;  2Z1C A;  3FDT A;  2PW7 A;  4ID6 A;  3TZD A;  2PPB C;  2KCN A;  3S1N B;  4XT1 B;  2F0L A;  2ICE C;  1FD7 D;  2L5T A;  3WOF A;  2D2C C;  4HMI A;  1XX8 A;  2CQA A;  2EY6 A;  2J7Z A;  1HXY D;  1RF2 D;  1HTP A;  1B4O A;  3I70 A;  3VR3 A;  5KNB A;  5CGK A;  5JEA J;  2NVY B;  2X6L A;  4C56 C;  3R93 A;  1D2B A;  1E0B A;  4C3J B;  3IFT A;  3W2D A;  5E1F A;  5M5W B;  4I7Z C;  4Y7N B;  4CBV A;  1TII D;  1OXX K;  4KY5 A;  4FF2 A;  1Z6H A;  4IAL A;  3EJI A;  3QWN A;  1LO5 D;  3M4Y A;  2O4X A;  3SK6 A;  2RQX A;  3T51 B;  4A3G B;  1C4Q A;  4G7Z C;  1H9M A;  4K5V A;  4TKO B;  4X3T A;  1X3Q A;  3WDN A;  5C4H A;  2IX0 A;  4EQO A;  4RWS C;  3P1H A;  2Z4H A;  3MXG A;  1LT3 D;  1F2Y A;  2WKC A;  3K58 A;  4CKB A;  4A3K B;  1KAB A;  1A15 A;  1CA5 A;  4KKU A;  1JCK B;  1MD2 D;  1V1P B;  2WV6 D;  1EY7 A;  1JC7 A;  2B2Y A;  1V43 A;  4OO1 G;  3OIP A;  3VYS A;  2O2L D;  1SDF A;  3C2P A;  4RCN A;  1GHK A;  2PZW A;  2EXZ A;  2WKD A;  3KF8 A;  4KD3 A;  1JIC A;  3BZD B;  5HGT A;  1SYC A;  3RUZ A;  4KHV A;  1NAP A;  3FMC A;  4H44 C;  1PFB A;  5LHY 1;  3GV6 A;  2L55 A;  5D3I B;  5I6W A;  2B63 B;  2B2U A;  2AWN A;  4IUT A;  5EPK A;  5KYI A;  5FKA C;  4X3S A;  4FP5 D;  4A93 B;  1EY6 A;  3GTK B;  1CZW A;  3HOZ B;  2BDO A;  5C5L A;  2L0C A;  3UI2 A;  1G8Z D;  1Y8N B;  2K01 A;  1I4H A;  2BA1 A;  5KND A;  4KJO A;  4A3I B;  4CKE A;  3LNN A;  4XQN A;  4C1N I;  5JPM C;  3C3L A;  3TN2 A;  1G2T A;  2L1B A;  4MIU A;  2LY7 A;  5K5P A;  4XDX A;  1LAB A;  5IOD A;  1C48 A;  1SNO A;  1OO9 B;  4NP5 A;  1PTO H;  1R4P B;  4Q0F A;  2MJ8 A;  4X3K A;  1L0Y B;  1IKL A;  4A3B B;  1PXU A;  4ZYS A;  3HZX A;  5ELC A;  2R3Z A;  4FF3 A;  2ZXP A;  5M5X B;  3DWA A;  1PRT F;  1LTR D;  1JB3 A;  4ZKB B;  2XSC A;  1GXD C;  3IAY A;  1J8I A;  1GHJ A;  1I3Q B;  1UNS A;  2R6G A;  2BE5 D;  1XWE A;  1KNA A;  4RA8 A;  1ZKO A;  3S15 B;  3H6M A;  4TQU S;  1JE4 A;  1EYC A;  2NN6 G;  1ZYR C;  1TWC B;  1DOL A;  3TP7 A;  1GUT A;  1TQO A;  3O13 A;  4IUQ A;  2E2D C;  3BVG A;  1JWM D;  4DXF A;  2NTT A;  2WIN B;  4KD4 A;  4E6I A;  4UDU C;  1B9M A;  5FO7 B;  2B2T A;  1CA6 A;  4H13 C;  4QB4 A;  4JBW A;  1BDO A;  1STA A;  2AWO A;  1GOZ A;  2RSN A;  3SK5 A;  1HTL D;  1B9N A;  1GUO A;  3TP5 A;  4KTA A;  1VF7 A;  3CRL C;  2R7Z B;  3MA2 B;  2NVX B;  4K5W A;  4RHS A;  3E0J A;  3VYT A;  1PDQ A;  1SE2 A;  1HPC A;  3QJY A;  2KQ3 A;  2RVL A;  5EKK A;  3R3O A;  2F0D A;  3T56 B;  1GUS A;  3GQB A;  2QDB A;  3P75 A;  3C46 A;  5IT9 L;  4C3I B;  3DEP A;  2F0V A;  1SEB D;  1G29 1;  3M85 A;  1PRT D;  1EEI D;  3J80 L;  3TME A;  3CHB D;  1JOQ A;  1KDB A;  4S3S A;  1EY9 A;  3KK7 A;  2EE1 A;  1SE4 A;  3PIO 3;  5A2Q L;  3VYR A;  2XRQ D;  4OO1 I;  3NQT A;  4BA2 I;  2DNC A;  5KRU A;  1UEA B;  4XIG S;  3HOX B;  2PNR C;  2EY1 A;  4O1N A;  4DF7 A;  1MBY A;  2SEB D;  4V19 0;  4OL7 A;  5JOB A;  3FVQ A;  4QIW B;  2PO4 A;  1I50 B;  2J0T D;  4IN3 A;  3KLS A;  4X3U A;  1IHZ A;  1S5D D;  2K32 A;  2SOB A;  1YNN C;  1HRJ A;  5DM6 3;  1TS5 A;  4QF4 A;  4IUP A;  4XQJ A;  1QOH A;  4IUN A;  1XYI A;  4F87 A;  1SYG A;  1JWU D;  4RGT A;  4GZY C;  3ONA B;  2SNS A;  2VB2 X;  4IQZ A;  3D6C A;  1SAP A;  1TT2 A;  3K6O A;  1B3A A;  3Q6S A;  2JEA I;  4IUU A;  5ELE A;  4ZRZ A;  4KHZ A;  4DA2 A;  2H4O A;  3GTL B;  1SBB B;  1TWH B;  3K5L A;  5JPN C;  1Y1W B;  4XYO A;  2JP1 A;  4TRD A;  1HFG A;  2E74 C;  5EPL A;  2EJG C;  4K2L A;  5DNF A;  2QCP X;  1BXT A;  3H0G B;  2K1B A;  5EBD A;  4K5X A;  2VUM B;  2FFK B;  2QIL A;  5C0X G;  3BDC A;  4HSV A;  1AFP A;  2WAC A;  3EVQ A;  4RFB A;  1SMY C;  5JVG 3;  1AZP A;  1TWA B;  3NUC A;  1ILQ A;  2DN8 A;  4OO1 H;  3DHQ A;  3H91 A;  2F0Q A;  2HCC A;  5IOC A;  1FGB D;  4B9X A;  3K59 A;  2NWG A;  4K6L A;  1SXT A;  1TWG B;  1YNJ C;  3H3V C;  3GTQ B;  3A7L A;  2L4N A;  5EJW A;  2NN6 I;  1WCM B;  2EOT A;  5T1I A;  3RZO B;  4EQN A;  3URY A;  3TP8 A;  4DU9 A;  5FO9 B;  5CBA E;  4ZK9 B;  2F0G A;  5IT9 E;  2FMM A;  1VCI A;  1QNU A;  1SYE A;  1Y69 U;  4TSS A;  2PZU A;  1OXT A;  1SJH D;  2N55 A;  2PQE A;  3J80 E;  5I4D A;  4BBR B;  1CFM A;  1GUN A;  2ZXR A;  2J4X A;  4XXE A;  1ML0 D;  2B2W C;  3HKZ B;  2E2I B;  5A2Q E;  4DGZ A;  2F0I A;  1CI3 M;  4A3D B;  2HUG A;  3A55 A;  3BYT B;  4RGM A;  1ET6 A;  2Y0S B;  1S5F D;  1CTM A;  1TS2 A;  2WII B;  2SDF A;  1Q90 A;  5NUC A;  1SE3 A;  3V2T A;  1DOK A;  1LLR D;  4RKL A;  2F3W A;  5E4X A;  4IZ8 A;  2IW3 A;  4WRD A;  3BS1 A;  3IFD A;  3K5N A;  1WD1 A;  4ABN A;  2R93 B;  3K0Y A;  1FYC A;  1EU3 A;  3V96 A;  2K05 A;  3Q0A A;  3FRP B;  1WTV A;  4PMC A;  3OOC A;  3MFG A;  2MUY A;  5LL6 S;  3I8Z A;  2JXM B;  5C3W A;  3RZD B;  1S5C D;  5J39 A;  4IFD J;  2WP8 J;  1SNQ A;  3FPU B;  2IX3 A;  2XNA C;  4DN4 M;  4J1M A;  4G7O C;  1DXM A;  1B53 A;  5ISR A;  3NWS A;  4LMQ D;  2I46 A;  3GTM B;  4IUV A;  1EOT A;  1A3T A;  1BCP C;  1TS3 A;  5D65 A;  5I9O A;  4OHJ A;  1R4Q B;  2E76 C;  3I4N B;  2NN6 H;  2K03 A;  4RGN A;  5FO8 B;  5BN5 A;  2PW5 A;  1U4R A;  2EYF A;  1WTW A;  1EZ8 A;  4HMJ A;  4C3J G;  4CGY B;  2GA4 B;  1H9S B;  5C3E B;  2B2V C;  3HOU B;  1U4L A;  1IYU A;  3C1F A;  3DMU A;  1II3 A;  1PRT B;  3RD4 A;  3T13 A;  3D4R A;  4HR7 B;  1PZJ D;  1B50 A;  1Y8P B;  1I4Q A;  3VR2 A;  1STY A;  1O78 A;  2E2H B;  1W6J A;  2BOS A;  3WOE A;  3KLR A;  1FNV A;  5CYU A;  5J22 A;  1HFN A;  1J9O A;  1ENA A;  1OXV A;  3KUP A;  3RMH A;  3FPP A;  3TP6 A;  3M7N A;  2JE6 I;  3GP7 A;  2PYK A;  1TY2 A;  1S4Z A;  4N9P A;  4ZUJ A;  3S17 B;  1KTK A;  1OXU A;  4H0L C;  2VXW A;  3N6R A;  1H9K A;  2B39 A;  4ILW A;  2X69 A;  1D6E C;  1EZ6 A;  4KN7 C;  1A2T A;  3Q22 A;  1ROD A;  1ESF A;  3PUV A;  2FMC A;  2EY2 A;  4NW2 A;  5FLX L;  2Z8L A;  5EPJ A;  3I72 A;  5C0X I;  1X3P A;  1STN A;  1ESR A;  1D1I A;  1DM0 B;  2E75 C;  1Y8O B;  4OGQ C;  1IYV A;  1QE6 A;  1R9T B;  3KLS X;  2NZ1 D;  5I2Y A;  3Q24 A;  1MGS A;  3S9W A;  3EA6 A;  2ZXO A;  3A56 A;  2F0M A;  2TSS A;  5FOB B;  1CM9 A;  2RDG A;  1U4P A;  1GJX A;  3VA7 A;  3CRK C;  1B2T A;  3CKI B;  5I2X A;  4LK1 C;  1F2Z A;  2B2Y C;  4KJN A;  4PQX A;  5JEA G;  4QUF A;  1EWC A;  1Z7T A;  2A6E C;  1NUC A;  4KKS A;  3AU7 A;  5CBE E;  2JA8 B;  3LWE A;  4A3F B;  1PLF A;  4Z9C B;  2M00 A;  1RTN A;  1BF4 A;  2B8G A;  1ZYR D;  2D62 A;  4K8I A;  1SNC A;  5TSS A;  5C5M A;  2I07 B;  5CR3 A;  3M7G A;  2F0S A;  1F77 A;  3GD7 A;  4FO2 A;  3A8J E;  2B2U C;  4HED A;  5AFW A;  4CHT B;  5EKL A;  3I91 A;  3VR5 A;  4KMU C;  1W6K A;  3AMU A;  1SSO A;  2VB3 X;  3HEJ A;  3MAQ A;  2KCC A;  2XVS A;  5CV7 A;  3ERQ A;  3HOW B;  4WJW A;  3PO2 B;  3N52 A;  2OT2 A;  4L8J A;  4I65 A;  1KDC A;  3MXU A;  5C0X H;  5T1G A;  1WTO A;  3DWQ A;  4KKT A;  3TZU A;  1WTX A;  2KED A;  4FF4 A;  5D3D A;  1JQY D;  3K7A B;  2K33 A;  1MSG A;  3A54 A;  5E4W C;  1U4M A;  2L9H A;  1TVX A;  3QO2 A;  3DXJ C;  2L11 A;  1RJT A;  3ITP A;  3NTH A;  1PFM A;  3IL8 A;  3A8I E;  1BR9 A;  3ND9 A;  3OMG A;  3S14 B;  1EWH A;  4K14 A;  2CW0 C;  2M9V A;  3R8B A;  4CJ2 C;  1BUV T;  4A3M B;  2K04 A;  4KI0 A;  1H9S A;  4FYD A;  3QOJ A;  5JVH 3;  1PFN A;  1BCP B;  4PV1 C;  4CJ1 B;  2K6A A;  2AUJ D;  5FLX E;  1A3U A;  2EZV A;  1QWY A;  1NSN S;  1STG A;  1RDP D;  4NKL A;  2D5D A;  2OF1 A;  3ND8 A;  4YIJ A;  2LKV A;  1V1P A;  5C4J B;  3H09 A;  4HCS A;  3QIA A;  3NPP A;  4R8I A;  1ILP A;  3OMC A;  5G3L F;  4PMB A;  1JOO A;  2JEB I;  4BY7 B;  3MVV A;  4KY6 A;  2MHV A;  2F4I A;  2H1E A;  1F9Q A;  4EQP A;  1YNN D;  4FXG C;  3X3N A;  5JAV A;  4C3I G;  3PMF A;  1LTB D;  1SNP A;  1O7Z A;  4XYQ A;  5DAU A;  3PUX A;  4DAP A;  3NSW A;  1SYF A;  3CU7 A;  3J7A F;  1AW7 A;  4JK1 C;  1O7L A;  3GTO B;  1SYD A;  1EQV A;  2HDL A;  2A5H A;  5DEH A;  4HSP A;  1S5B D;  3D6W A;  3GO5 A;  2DNE A;  4C1N K;  3I90 A;  2Q8I B;  2RKS A;  2LFN A;  2FHT A;  4OIJ A;  1L0X B;  2OEO A;  5K36 G;  1STE A;  4ZAI A;  2F0P A;  2ZT9 C;  5LL6 X;  5IGF A;  2QF7 A;  2IJ0 A;  4HCE A;  4B08 A;  2N88 A;  3T4A C;  4H7B A;  1PZI D;  2VNU D;  1EYD A;  2G9H D;  3SK8 A;  2EPB A;  1H9R A;  3SE0 A;  3DUZ A;  1SMY D;  4G57 A;  3PUY A;  4L63 B;  3I3C A;  5EBC A;  3BVM A;  2PZT A;  1KDA A;  3F2U A;  2EJM A;  5BN3 A;  2HCI A;  2K5W A;  2MP1 A;  2KJX A;  5I9P A;  2IWH A;  4OIK A;  4F88 A;  1YNJ D;  3GV3 A;  1BCP F;  5ELB A;  2EYH A;  2LMC B;  3LX0 A;  2XIW A;  5G3L D;  3NTI A;  2F0U A;  4EGV A;  1WTR A;  2EVB A;  2AUK A;  3V05 A;  1Q1E A;  1STB A;  3IKJ A;  1KAA A;  3OPO A;  5EKI A;  1BNZ A;  1X32 A;  4A3J B;  2IT1 A;  3MWY W;  2A6H C;  1WTP A;  1XXG A;  4A3E B;  4J6H A;  1QCB D;  1LT4 D;  3SEB A;  1PZK D;  4NDX A;  1WD0 A;  2IX1 A;  3TBI B;  3HOY B;  2MPM A;  3NHH A;  2A68 C;  4DXG A;  3OW7 A;  2JA5 B;  5CV8 A;  2JSO A;  2KHS A;  2ID0 A;  1C8C A;  1TU2 B;  4QUC A;  2F0H A;  3J7Y W;  2KVM A;  2EY5 A;  1V8Q A;  3TSS A;  4M8A A;  2YYZ A;  5I6Y A;  1O80 A;  1VF5 C;  1SJE D;  4DK1 A;  3SR1 A;  4DK0 A;  3OHX C;  1ONL A;  5J1Z A;  1Q1B A;  5JEA H;  3K5M A;  1CZG A;  4XQQ A;  1G6Z A;  5JJZ A;  2K5D A;  2PCF B;  4LJZ C;  2KOL A;  2NYZ D;  1BCP D;  1HHV A;  2B2V A;  3VR6 A;  5HUR A;  1WTQ A;  3C1E A;  3A7A B;  3SXH A;  4UAI A;  3K57 A;  1HQR D;  3J7A V;  1DOM A;  2XN9 C;  4AYB B;  2B8F A;  5ELD A;  5KGU A;  1SND A;  1E2Z A;  4RHR A;  3CQZ B;  1GUG A;  2XWJ B;  4KY7 A;  2F0J A;  1G91 A;  1I4X A;  1ZEQ X;  5CV6 A;  4FXD A;  1IW7 D;  1LAC A;  2EYM A;  5ELF A;  4C2M B;  3TDQ A;  5COY A;  1NR4 A;  4NMZ A;  1PTO D;  2BA0 A;  2Z4I A;  3P7J A;  4DAY A;  3NP8 A;  1Z47 A;  3I4L A;  3DM1 A;  2IL8 A;  1HUN A;  3NBH A;  1SYB A;  3QB3 A;  2CVR A;  3R2I A;  1EIH A;  1Q3L A;  1F9R A;  3NQI A;  4QCL A;  1LTS D;  1HA5 A;  1EU4 A;  1IW7 C;  3M3Y B;  4PNY A;  2JA6 B;  1D5M C;  3HRZ C;  3ZYY X;  1EQT A;  2HDM A;  2IPK D;  1PTO C;  2YU9 B;  4CKC A;  3JAM L;  1A3V A;  2KA7 A;  1ET9 A;  2WAQ B;  1BO0 A;  4F7X A;  1AP0 A;  2QKI C;  1LTI D;  3Q23 A;  2F0F A;  2FIN B;  4BBS B;  1BQQ T;  4ULL A;  1I6V C;  1FR3 A;  2ENB A;  1DD2 A;  4G4K A;  2HQE A;  3EFX D;  1BOS A;  2NVQ B;  2A74 C;  4KV6 A;  1TR5 A;  1RKN A;  2PMZ B;  2L12 A;  5IGB A;  2DY8 A;  5IGD A;  4XT3 B;  3D4D A;  3U9O A;  2A6E D;  3S1R B;  1JOR A;  5IIF A;  4K8J A;  1CK1 A;  3SHL A;  1IKM A;  3MXP A;  3MC0 B;  3NXW A;  5M3F B;  3OWE B;  5CV4 A;  3L7Z C;  2FJ2 A;  5C4Z A;  2R61 A;  1EFI D;  5EGT A;  1E2V A;  1S5E D;  1EY4 A;  1LTG D;  1CQF A;  2RDH A;  2AQ2 B;  3J81 L;  1ZXT A;  3DWP A;  2SNM A;  4IFD G;  3D4W A;  3S16 B;  4U68 A;  2F03 A;  1MSH A;  4DNT B;  2O5J C;  3P20 A;  3W3A A;  1UUP A;  3GTG B;  2NBF A;  1HUM A;  1OXS C;  1H9J A;  1KLG D;  1SNM A;  1O7Y A;  4Q5V A;  1T5E A;  2Q8T A;  4XTC S;  2F0N A;  1M8A A;  5K36 H;  2F0K A;  3PV0 A;  1EY0 A;  3AB9 A;  1LTT D;  1JOK A;  3FEW X;  3MZ5 A;  1TS4 A;  3H94 A;  1B1Z A;  4K6D A;  5EQ0 A;  1LV9 A;  3VYU A;  2NB0 A;  3BYY B;  3T53 B;  4RH6 A;  1JR0 D;  4KN4 C;  1B44 D;  5IGG A;  3SDZ A;  4ZKC B;  2X6G A;  3I73 A;  3T16 A;  2WB1 B;  1K8O A;  4KK7 A;  4ME5 A;  3I4M B;  1DZ1 A;  1LT6 D;  2Q8R E;  2RDF A;  2KEC A;  4IUR A;  5C4X B;  1A2U A;  2CW0 D;  1QG7 A;  1BBX C;  3HGB A;  5IGC A;  3OWF A;  1EY8 A;  1EIG A;  2G9D A;  3KBX A;  2RBM A;  2EDG A;  3U9S A;  3VA5 A;  1AEX A;  3E5S A;  2R92 B;  3ERO A;  1M4V A;  3L9A X;  2MGS A;  1I4P A;  3JAM E;  3G7L A;  2BE5 C;  4HN7 A;  1PMR A;  2DY7 A;  4CJ0 B;  1QIL A;  2D9U A;  5COR A;  2F0O A;  4BY1 B;  1RTO A;  5KNC A;  4HAE A;  2JYO A;  5KYL A;  3PO3 B;  4WFN 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...