5IGBA

Crystal structure of staphylococcal nuclease variant delta+phs l36d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D/V66H at cryogenic temperature
rcsb
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igbA00
2F0SA 1TR5A 2F0VA 2EYLA 2RDFA 2EY1A 3NP8A 4N9TA 4TRDA 3RUZA 5IIFA 2EYFA 4KD4A 2WACA 3PMFA 3D6CA 2F3VA 4HMIA 1EY9A 4ID6A 3ITPA 3DHQA 1EYAA 3P75A 3BDCA 5KEEA 1KDAA 4J1MA 4PNYA 5J22A 4R8NA 5JAVA 3SK4A 1EZ8A 3QB3A 3EVQA 2EYPA 3NUCA 4RKBA 4ZUJA 1U9RA 4KHVA 3R3OA 4K2KA 3HEJA 4KY6A 4K8JA 3SR1A 1SNCA 5KYLA 5CR3A 3V2TA 4N9PA 2SNMA 1STYA 2F0IA 3QOLA 5JOBA 2F0DA 3NK9A 5KGUA 3VA5A 2PYKA 5M9OA 5C5MA 4PMCA 5J39A 2PW5A 1RKNA 4HTHA 3MHBA 5ISRA 1F2YA 4K5WA 1TQOA 4WRDA 3P1HA 2OF1A 4EQNA 1KDBA 2RBMA 3ERQA 4NP5A 4G57A 5C4ZA 1IHZA 2F0UA 2OXPA 2EYOA 3DMUA 4K6DA 4ME5A 3TMEA 3MXPA 3OWFA 4S3SA 5IOCA 4YIJA 2EY6A 5I6YA 4IALA 2F0GA 3C1EA 4KY7A 5CV6A 3NHHA 4ZQ3A 5F2DA 1A2TA 1SNPA 1SNMA 2PZUA 4QMGA 4KJOA 3SK8A 1NSNS 1STNA 1TT2A 4K8IA 4B9WA 5J1ZA 1NUCA 4IZ8A 5EKLA 4NKLA 1A2UA 2F0EA 2F0JA 4K2LA 5K5PA 1EY8A 2EYHA 2O4XA 4RKLA 3TP6A 3C1FA 1ENAA 2F0OA 3OMCA 4IUNA 4DU9A 3EJIA 3QOJA 2EY5A 2F0KA 4PMBA 5I9OA 4EQPA 5EKKA 1II3A 5KIXA 5IODA 4H7BA 3T16A 3MVVA 2NUCA 1EQVA 1JOOA 2SNSA 3U9OA 4EQOA 1SYFA 4F7XA 1AEXA 1STBA 2KQ3A 1EYDA 2PZWA 5DAUA 5CGKA 5IGDA 2F0WA 1EY7A 4EVOA 5IGCA 1EY4A 5KYIA 4KJNA 3E5SA 4ZUIA 1SNQA 1STGA 5C6AA 2F0FA 5CV9A 4QF4A 1SYEA 5I6WA 1KABA 3NQTA 3OSOA 4KY5A 2ENBA 3TP5A 2EYMA 3S9WA 4DF7A 1JORA 2PQEA 4HMJA 5EGTA 5CV4A 5CV5A 1F2ZA 2F3WA 3SHLA 5IGFA 2OEOA 5I9PA 2F0TA 3D4DA 2EYJA 4B9XA 3SK5A 2F0PA 4DGZA 2F0MA 1EYCA 2QDBA 4K5VA 5KRUA 2HQEA 3HZXA 3OMGA 1EY5A 4K5XA 4NDXA 5C3WA 5IGEA 2PZTA 4LAAA 3MZ5A 1SYDA 4KTAA 4I65A 4KD3A 4MIUA 2F0LA 1SNDA 4KV6A 3EROA 3LX0A 4ODGA 1STAA 1EY6A 2F0HA 3H6MA 5NUCA 2EY2A 3SK6A 5HURA 5IGBA 2EXZA 1JOKA 1KDCA 3D8GA 2F0NA 3SXHA 4NMZA 1SYBA 3BDLA 4QB4A 4DFAA 5C4HA 2F0QA 4OL7A 1SYGA 5HGTA 3MEHA 1EY0A 1A3VA 4K14A 5E3FA 1A3TA 5CC4A 5CV8A 1SYCA 3TP7A 5C5LA 1JOQA 3NXWA 2M00A 1SNOA 5DEHA 4F8MA 1KAAA 5C3XA 1EZ6A 1A3UA 1STHA 2RKSA 5IGGA 2PW7A 4WORA 5CV7A 2KHSA 1F2MA 3T13A 1ENCA 5E1FA 4E6IA 2SOBA 4J6HA 2LKVA 3TP8A 3D4WA
chains in the Genus database with same CATH superfamily
3RN5A 4JPBW 4XQNA 2R93H 2A73B 4QIWB 2N3SA 4IUPA 2B2YC 4A3EH 2SDFA 5CYUA 2A6HC 3NUCA 2R93G 4KY6A 1DCZA 3T1YL 1ICWA 2CWAA 4LUZA 3NEMA 2BA0A 5M3MB 1SFOH 2XWBB 4CKCA 1O7YA 4X66Q 4XT1B 1PTOC 3LWEA 2WAQE 5GAHC 5LMNQ 1ZXTA 5M5XH 1ASYA 1PRTD 4ME3A 1Z7TA 1G6PA 2IY5B 5IT9L 3PO3B 2K04A 2WV6D 1HNZL 1NMFA 2EXDA 1QILA 4L5RC 3B6YA 4OO1G 3EJIA 2EY5A 3EBEA 2X6LA 3MVVA 4AQYQ 4V0BA 5M3MG 1MHWC 3J80c 3SDZA 4LF7L 5CBEE 2CH4A 3EA6A 3FKIB 1BCPF 2E2JB 5HGQA 3K5OA 2UXDL 1QNKA 4C1NI 2Z4IA 2Q8TA 1FNUA 2PQEA 1FGBD 1E3PA 4GOPC 3F2DA 2Q8IB 2DJGC 3UDXA 4DGZA 1HUNA 2IW3A 1TWFH 5C3EG 1Z47A 4KKTA 1CT1D 3UDGA 3I4NH 4NDXA 4PZ7A 1HCZA 1BR9A 4NXNQ 2OTLA 1BCPB 4DV5Q 4YHHQ 3CRLC 1EEID 2NVYB 4UP7A 5HGTA 3GTKB 2JJQA 3NXWA 1PH3A 3A55A 1VQLA 5ELBA 1Q1BA 1TS5A 4H02A 2XGTA 4QCLA 4LF6L 1WJJA 4N8X1 1LM0A 4DR6L 1EFWA 3MWYW 4KD4A 2LS01 2JA8B 2B2WC 1U0LA 4KHPQ 3GO5A 1BCPC 1PH8A 2B2TC 4HN7A 3ND9A 5M5XB 1P16A 1TWHH 3M9BA 3GTPH 1TWGB 1A8VA 2UUAL 4LUVA 1JR0D 1K8MA 1EUJA 2PYKA 3V05A 3JAML 3HOZB 1YNNC 3KF6B 3KOJA 3N6RA 4IPDA 2NVQH 2HCCA 4WRDA 3KLWA 4OX9Q 1M8AA 1S4ZA 1K83B 1CUKA 4HJ7A 1KRSA 3P7JA 3VR3A 1AN8A 3K80C 5CV6A 3I4MG 3CQZB 1FL0A 3J80i 3A7LA 1CSQA 3CCVA 1WOCA 4XDXA 1QVCA 3T53B 3VA7A 3T4AC 1YJWA 1V1PB 2WKCA 4LF6Q 5M3FH 2R3ZA 3J81L 1I6HH 4IOAA 3AEVA 2HHHL 2UU9L 3Q23A 5C0XH 4EQOA 1EWCA 1LACA 3T1HL 4JI0Q 3FDTA 1AE2A 1N8RC 5FLXE 1SE2A 2EQSA 1E2ZA 4RMFA 1NBWA 1V1QA 3PO3G 3E5SA 1SNQA 3GTQH 4B3RQ 1Y69U 1CZGA 2I5MX 2CHBD 3U58A 4B3RL 4YY3Q 2R92G 3N52A 4MTKA 4DNIA 3HOUG 3ONAB 1I6HB 4PQXA 4RG1A 1L2FA 1CKNA 3D4DA 3D3RA 5M5WH 4A3CG 2JQOA 3NTHA 5D65A 1TY0A 2G5DA 3K7AB 4ZRZA 5FOBB 1FNVA 2EDGA 1STAA 1I4QA 2M9VA 2IT1A 3U4VA 2MO0A 2NBFA 3W3AA 4HSVA 3A74A 2K33A 2L11A 3HOXH 5C4JH 4LFCL 3U50C 1PXUA 3PO2H 3A7AB 1BDOA 4JI2L 2RVLA 1OTCA 1ENCA 2P5ZX 1PZID 1TWHB 1ET6A 4OIKA 2N49A 5FKAC 5GAGC 5AJ3L 4Y7NB 4N9TA 1PTOF 2Z6KA 3NELA 4LFAL 1MI2A 1ICFB 1IKMA 3VYRA 2B2VC 2A5HA 1EYAA 2YTXA 4OO1I 2CCZA 5EBDA 1I50B 2B39A 3KDFA 2JA6B 1C7YA 4NPSA 2BE5C 4I7ZC 3T1YQ 2NVXH 5E4WC 4K2KA 2B3GA 3ULPA 4HJ9A 1SN8A 1HZAA 5C4XB 3KF6A 2F4VQ 2FMMA 4IUUA 3UDFA 3I8ZA 1NR4A 2EIFA 3K7UC 3CPFA 1NJIC 4H13C 3U9SA 3RZDB 4JI3Q 3SK8A 1WCMH 2XSCA 3TP6A 3A8IE 2RHSB 3BG3A 1WFQA 2XN9C 1JOOA 5CBAE 3K81C 3Q8DA 1HFGA 1JJGA 3KFUA 1Q81C 4NW2A 4ZYSA 1SDFA 2L12A 1SBBB 3S9WA 1AFPA 4JV5Q 1JORA 1ZKOA 1PYBA 2RDHA 4BY1B 1FNWA 4HIKA 3M4OH 4B9XA 4LNQA 1YNXA 3EIVA 1B53A 1QZGA 1VDZA 3HOWG 2EJFC 5KRUA 2N8NA 1DZ1A 4A3KG 5BR8L 4A3FH 2KUMA 3EROA 3F2BA 4OWTB 1HR0Q 2NVXB 2AHOB 3TEHB 1I3QH 3SXHA 2K6AA 4QB4A 1HUMA 4DAMA 1F9SA 1BOSA 5DEHA 3HOVB 1LT6D 3J7ZC 4J8QA 5E1FA 1GM5A 1GUOA 1VQ6A 1P8LA 2RSOA 3PF5A 3D31A 5IIFA 4DKAC 1L1OA 4P74A 4XXEA 4X64L 5IP7H 1IBKL 2H5XA 2QGQA 3HOXB 1JB7A 1HH2P 4RGNA 4A3KB 3S2HH 3DHQA 4J1MA 1N34Q 4PNYA 5EPJA 5ELNA 1Y1WG 4A4IA 1E0BA 3J80E 3BYYB 1Q90A 3KLSX 1B4OA 2XTIA 4OIJA 3STBD 1ESFA 1SLJA 1A62A 2F0DA 2FMCA 3UE0A 4JI4Q 2UXCQ 1B50A 3W1GA 2UXBL 1TIID 2OQKA 3MHBA 2L1BA 3HOXG 4DR7L 1I50H 1C4QA 1H9RA 4CJ1B 1K0RA 4ME5A 4Q0FA 3OTOQ 1WCMB 5IOCA 2QF7A 3NTKA 4WJ3M 1EQQA 2IX3A 1ET9A 1IZ6A 1SNMA 1LLRD 4K8IA 2AQ2B 1NUCA 2DJFC 3VYTA 1FR3A 3OMCA 3UI2A 1XNQQ 3H3VC 1FJGQ 2A19A 3Q22A 1DXMA 2RDGA 1XNQL 1BKBA 2NUCA 4A3GH 2JSOA 4LW1A 3U9OA 1X3PA 2B2YA 2K50A 1AEXA 2JP1A 5DM63 1IKLA 5C0XJ 2QKIC 1VQAA 2K1BA 4KJNA 2Q8RE 2MJ8A 3K59A 2BH8A 1WTWA 4PZ8A 4V190 4K0KL 1RD9D 1SYEA 5IE8A 1FJGL 1BBWA 1VQ8A 3CHBD 1ASZA 2IPKD 5FK9C 4QY7A 1LTLA 1QZHA 1O7ZA 1LTID 1YIJA 3VR6A 2CVRA 3BVZA 3SK5A 4HSPA 5IYDG 5CORA 4A3GB 2UUAQ 3BZCA 3OMGA 4K0KQ 1CQVA 3CU7A 5D3DA 3LNNA 3MXNA 4IUVA 3LX0A 4RA8A 3SK6A 4WJ4A 1IYJB 4XYOA 4YWLA 4IPGA 3R8BA 1WTOA 2CW0C 1BNZA 1GUWA 2B2UC 1I5FA 3IRBA 3K6OA 1UWVA 4LF4Q 3GTJB 1XPOA 1A3UA 2CQOA 4BY7H 2ZXRA 4BA2I 4DUZL 4B08A 2MP1A 2J4XA 4BBRG 4DAYA 2GVAA 2ZM6Q 4DR1L 3VR2A 1GHKA 5K36H 4PG3A 3CQZH 3S1RH 2ID0A 1AH9A 2WACA 3HG9A 5C44G 1R9TB 3HOWH 1QOHA 2KHJA 4UAIA 3C46A 1EQTA 5C4XG 4MN3A 2Z6BA 4L6TB 2K28A 3K0YA 2PCFB 2YTVA 2ZJQA 1TWCB 4G7ZC 1E22A 3QOLA 1K3BC 5IYDH 4BXXH 4WJWA 2HIXA 3GTPB 2F4IA 4QIWE 5IP7G 3A8KE 3P1HA 1PYWD 1UEAB 2ALYB 3HOWB 4G57A 2EYOA 1WTXA 1KNEA 4PZ6A 3HOYB 2PMZE 1ZYRD 3C1EA 3U4ZA 1A2TA 2E5LQ 1UE5A 2K14A 4XTCS 5BN4A 4IFDG 2FINB 1A2UA 5J3BA 4RKLA 5LHY1 3CAMA 5JVH3 4X3UA 2L9HA 1VMPA 3M4PA 1E24A 5FO7B 5K36G 2V4DA 3JAMc 4A3EB 3OW7A 3ERSX 4FNFA 3PIOA 2Z8LA 3I72A 3NQTA 3CCLA 3DEOA 1WD0A 2IX1A 1O7IA 1T5EA 1ZYRC 5IP9G 2MQHA 1IW7D 2XVSA 4JI1Q 4OELB 3E0EA 3FHWA 2VZAA 4IFDJ 1S5BD 2LMCB 3TDQA 1GJXA 3K0XA 1Q46A 1XTCD 2EJGC 2H4OA 2GA4B 3FP9A 3I3CA 1SYDA 4KD3A 2F0LA 1UE6A 1KL9A 3H6MA 1N33L 4A3CH 1HNWL 4DV3Q 3QJYA 1JQYD 1SYGA 3KF8B 1QWYA 5FLMH 1SJED 1A3VA 3BZDB 1E1OA 1WCMG 1KAAA 5C3XA 2Q2HA 1F9RA 4WORA 1VQFA 4QUFA 1IW7C 2MUYA 4ZK9B 2N78A 2Q2TA 4TRDA 4X3KA 5FLXL 1LTAD 3S1MB 2VUMH 2A68C 4A75A 1B7YB 2ZTEA 3E6ZX 4JI2Q 5C44H 2J0TD 1F77A 2AKWB 3NBHB 3QB3A 4GLVB 2EYPA 4HEDA 1SE4A 4CJ0B 4JBJA 3DWQA 4ALPA 3HEJA 4ABNA 3E9HA 5KYLA 2ZT9C 1PTOB 1QCBD 4IUTA 1K0SA 3NK9A 1PA6A 5DNFA 1D2BA 1QVGA 3RZOH 1AP0A 2K01A 3ICEA 2FHTA 1E2WA 3PUVA 3S1NB 3H0GH 1L1OB 3TS2A 2OXPA 3SE0A 4AYBE 2A6EC 3VR5A 4CHTB 1S40A 1X3EA 4NXML 3DM1A 4YIJA 4A3LG 3O13A 1HFNA 3I70A 2WB1E 3I4OA 2E2IH 2HDLA 5A35A 2VNUD 2J7ZA 3E9IA 2MO1A 1PTOD 3C1FA 1VS0A 3TZUA 2DY7A 1XWEA 4UP8A 4A93H 5COYA 1VQDA 2SNSA 2B2VA 5JPMC 4F7XA 1VQ4A 5CGKA 5IGCA 1GXDC 2NN6G 2PQAA 4BY1G 1MD2D 2VQFL 2O5JC 3BYTB 3S2HB 4JI8Q 5EGTA 3HOZH 4A93B 2MFIA 3BVMA 3PIP3 2OTJA 3H3VH 3M4OB 1SMYD 1NR2A 3J7YW 2JA5B 3CC4A 4FXKC 2A69C 1HNXL 2EXZA 1JOKA 2OT2A 3ULLA 3NSWA 1SYBA 4KHZA 3HOUB 2D5DA 1W6JA 5E3FA 2N88A 4DK6C 1PZKD 5JEAJ 4DXGA 1XPUA 1ONLA 4FF4A 4JOIA 2L55A 3LGJA 3TP8A 4DR1Q 1N36L 2A6ED 4ZCKA 5ELOA 4OXPA 1VQGA 1TS3A 2EYFA 2VXWA 3PMFA 5E4XA 1Y8PB 2QW7A 2MPMA 3P75A 1LYLA 5LMUL 3I55A 2KOLA 3NPPA 2K05A 4R8NA 5EQ0A 2VUMG 5BR8Q 3K5NA 5FLXc 3I4LA 1LTGD 4LMQD 4LF5L 2EJMA 1XNRQ 1CA5A 5JOBA 1VF5C 2DGYA 4KK7A 3HRZC 4CDEC 3RLNA 4EQ5A 3L9AX 1C48A 1PVOA 1RKNA 4HTHA 4LF9Q 4K5WA 3W2DA 5GQOA 2CH4W 4RCNA 1IYUA 1VQMA 2B8GA 1Y1WB 3L3OC 1WD1A 5F2DA 4R1JA 4KJOA 3OWEB 4GNXC 3D4RA 3H09A 1I4GA 1LTRD 3I4NG 5KNCA 1C8CA 2A69D 4DNRB 2JA8G 5LMNL 1G2TA 3QOJA 4DV4L 1TWGH 1ILQA 4EQPA 1II3A 4C3JB 3TS0A 4DV3L 3GTLB 4DN4M 3A8JE 1EYDA 2Z4HA 4AH6A 1JE4A 4L8JA 1K8GA 4BBRH 2ATWA 2IHEA 4FDBA 1OXVA 1VQBA 5CV9A 2JA6H 3OSOA 1HZBA 2MGSA 2Z0SA 4DV7L 1PH6A 3EQLC 2NN6H 4DR2Q 4X6AH 4XQQA 3OTOL 4A3JB 1F2LA 3M7NA 1HNWQ 3CCMA 1SR3A 3PV0A 1EYCA 1Q86C 1DGSA 4K5VA 4GS3A 1R4PB 1HR0W 4LAAA 1IXRA 4KTAA 4I65A 2JYOA 3WDNA 2NZHA 1XXGA 2BH2A 5HURA 1S5ED 5GROA 3QR8A 2A68D 1A63A 1CK1A 3STBC 2LXKA 2R61A 4LFAQ 3MC0B 1JOQA 1ML0D 3HKZB 1RL2A 1Y8OB 3PF4A 1Q7YC 2JA5H 4OWXB 2F3IA 2OQ0A 3GV6A 2WAQG 3QWNA 3BU2A 3T13A 4LWCA 2L0CA 4O0AA 4J6HA 3FPUB 2LKVA 4ZKBB 3CCRA 3T56B 1X56A 1Q82C 4LF7Q 1HA6A 1IBMQ 1OXXK 5CMDA 1BF4A 3GTMH 1B44D 4HJAA 1U4MA 4DUZQ 1HPCA 1HTLD 2VQEQ 4AQYL 5IYCH 1AZPA 1PMRA 2I46A 1LTTD 2R7ZB 3MFYA 1TWAB 1HTPA 1V1PA 5J39A 2PI2E 3AMUA 1F2YA 1HRJA 2IJ0A 1SMXA 2VQEL 3HGBA 1IHZA 3VDYA 2ZM6L 2AMCB 1SE8A 4FVMA 1D6EC 1STNA 1X6OA 5J1ZA 2K7VA 4EX5A 2UUCQ 1EFID 4G4KA 2WB1B 1YEZA 1Q1EA 1EIHA 1D5MC 3F8TA 5IT9c 4IUNA 1IL2A 2NVQB 3AFPA 4DAVA 4PMBA 4JYAQ 2VY3A 3MA2B 3OYYA 4C2MH 4FF3A 1OO9B 2RA4A 1NTGA 3C3LA 3VYUA 3GD7A 1B1ZA 3JAME 1PHJA 2HD3A 2CKZB 2ENBA 5LMUQ 1VQHA 1GVPA 3BJUA 1UAPA 3Q6SA 4C3JH 1G291 4DR2L 2FJ2A 4BXXG 4RFBA 3RLOA 3RNUA 4B3SL 3DEPA 4TKOB 4CKBA 1KD1C 4C3JG 1SNDA 4DR5L 3MEFA 4TSSA 2MNAA 1XNRL 2PQAB 4A3DB 1KDCA 2JN4A 4DFAA 4IOCA 3S1RB 4OL7A 4OONA 3T1HQ 4JI4L 3A0JA 4YCWA 1PH5A 1QUQB 1JE5A 1EZ6A 3GP7A 4BWGB 4IFDI 1F2MA 3EFXD 1NE3A 5JEAH 2L15A 2G9DA 3AQQA 1G51A 4JI0L 3CKIB 2O5IC 4H0LC 2XWJB 3D6CA 2ICEC 3S17H 1MGSA 1QVFA 2D62A 1M4VA 2O2LD 2PI2A 4DAYB 4KLKA 2KCNA 1B9MA 4BY7G 3TN2A 1LUZA 2TMPA 3X3MA 2ZJRA 4IUQA 4LJZC 1A6XA 3V2TA 4N9PA 4NXMQ 1STYA 1Q8IA 1HHVA 5KGUA 1XMOL 3KF8A 1TU2B 3MFGA 1J8IA 4PMCA 3HOZG 4IPHA 3M85A 2B63B 5D3IB 3GQBA 1SE3A 5IYCG 1VQNA 1FYCA 1X32A 1V1OA 1WTQA 4F87A 4GN5A 4JBWA 4L63B 4X3SA 2E2HH 1B9NA 3OWFA 3TSSA 1D1IA 4IALA 4FXGC 2NN6I 4A3FB 1SNPA 3S1MH 4A3FG 1XMOQ 3RN2A 1RIPA 1TT2A 3H0GB 4NB3A 5K5PA 1HJPA 4A3DG 2M2LA 1TVXA 5EKIA 3K8AA 2F0KA 1HQRD 3PGZA 1SYFA 4DV1Q 4JK1C 4TVAB 3MAQA 2JA5G 2F0WA 4LFBQ 3WOEA 4EVOA 1CTMA 4DXFA 1M90C 1EY4A 3GTMB 4JI7Q 3DUZA 3PIO3 2Y0SB 4A3IH 1SAPA 5M5YB 2DUDA 3PO2G 2UXDQ 1PRTC 4DR3L 4DF7A 1GKHA 4HMJA 2ZJPA 4JI8L 3CMEA 2OEOA 1U5KA 2EE1A 2EYJA 1XTDA 4UPAA 1Y8NB 3GTJH 1TWAH 5M3FG 2HUGA 5M3FB 2Z1CA 3HOYG 1C9OA 3KK7A 4X3TA 2K03A 4QQBX 5EBCA 1CQFA 4DK1A 5IYBH 1MSGA 5IGBA 4BBSH 1B70B 3K5LA 1WTVA 3DXJC 4NMZA 1HR0L 2IX0A 1RODA 1RDPD 2JA7H 2XRQD 4RHSA 1R9TH 2FFKB 3MXNB 3PUWA 1KLGD 3GV3A 1N32Q 4L5TA 2JXMB 1XMQL 4R9WA 2QILA 2ASBA 1S5CD 4JYAL 3D4WA 1KC8C 4JI3L 3NP8A 1AZQA 2EY1A 4JVZA 3RUZA 5C44B 4CBVA 2UUCL 1I94Q 1CSPA 3OIPA 2R92B 4OEMB 1BO0A 3BDCA 4R4IA 5KEEA 4R4OA 3BDOA 4Z9CB 5FO9B 2I0QA 2RCFA 1E2VA 1STEA 4K8JA 1N33Q 1D7QA 4C3IH 3OOCA 2B63H 5EPLA 4BY1H 2CFMA 2XRSD 5C3EB 4Q5VA 3I73A 1NY4A 3M4YA 5IYBG 1PFNA 4DV0Q 2AQ3B 4EQNA 1GUTA 3TQYA 2BCOA 1K73C 1RTNA 2JA6G 4FP5D 2YV5A 5HY6A 1VQOA 3FEWX 5JEAG 4KN4C 2E5LL 3G4SA 2A6HD 5I6YA 2QDLA 1QUQA 1N32L 2L4NA 4BBSB 2G9HD 4JOIC 4QGUA 1VQEA 1VQ9A 1S5DD 3EN2A 4DA2A 4X62L 5M5WB 1WTHA 3D6WA 4GN4B 3CRKC 5EAYA 3TRZA 4IO9A 1SXTA 5GADC 4YCVA 2E76C 4IURA 4LF5Q 3A54A 2C35B 3F2CA 1XJVA 3ULJA 1LO5D 2KHIA 5LL6X 4Y52H 3H94A 1MJEA 5C6AA 3VYSA 1IBLL 1G91A 1L1OC 4QF4A 5I6WA 3TP5A 3CC7A 2WP8J 1LTSD 4U68A 1EU4A 1X9NA 1CA6A 5GAEC 1F2ZA 1TS2A 3QG1A 1JCKB 3PIPA 3CXCA 1BBUA 3Q24A 5I9PA 3URYA 2HQLA 1ZEQX 3GTGB 4JI5Q 2F0MA 4FF1A 2YTYA 2QDBA 3W5OA 5JJLA 2F4VL 4K5XA 3A5ZB 1VQCA 4PV1C 1YNJC 3P20A 3HOUH 4L5SA 4A3BG 1EY6A 4L5QA 4DNTB 2F0NA 3KDFB 5C4HA 2F0QA 3OIQA 2ZTCA 3C2PA 2RSNA 1I4RA 3VR4A 1U4RA 4AYBG 3TP7A 3KJOA 5AFWA 1SNOA 1UE1A 1YBYA 2KHSA 1XX8A 3QO2A 1Y14B 2Z6KC 4AYBB 1PH4A 5JJIA 3HP3A 4IQZA 4BBSG 1Z9FA 1PTOH 1A0IA 2EYLA 1DD2A 3KJPA 2E75C 1QG7A 1G2SA 1IBML 4LFCQ 3ITPA 1NCVA 1M1KC 1EU3A 2JA8H 1KDAA 3DM3A 3I4MH 5TSSA 2KCMA 1I3QB 2KJXA 3G7LA 5ELCA 3EVQA 5AJ3Q 4ULLA 1LT5D 3S24A 4JI6Q 2SNMA 1JICA 3KLRA 4LFBL 2K5QA 4GOPB 4KKUA 4A3IG 1EYGA 1B3AA 4A3MH 2D2CC 1D5ZC 2AWNA 4C3IG 3GTOH 2DN8A 3M7GA 1RTOA 4NXNL 2KVMA 2WINB 3MXPA 5L37A 2C5CA 1LTBD 2F0GA 3H91A 4HAEA 4G7HC 2LXJA 1RHPA 4A3DH 2BDOA 1FVIA 2RCNA 4A3MB 1RF2D 1X3FA 3CD6A 4H7BA 4GZYC 2NB0A 3J81E 4IJHA 1CFMA 1EIGA 1YI2A 3L7ZC 4BY7B 1S72A 3UDIA 1D5XC 1KQSA 4CDFC 5D14A 5M5YH 2K5HA 4CKEA 2IWHA 4DR4Q 2PNHA 1W6KA 4GKKQ 2X69A 4DV6Q 4QJFA 2VUMB 4C3HB 2VB2X 1EWHA 1KAWA 5I2YA 4DUYQ 5CV5A 3J80L 3MXGA 4RGMA 4KMUC 5JPNC 3L2PA 1SJHD 4B3MQ 1GUGA 5T1IA 2AQ1B 2JEBI 1J6QA 2JA9A 1KRTA 3J81c 2NVTH 2EOTA 2QCPX 1DYQA 3RZOB 4DV2L 3SGIA 5FJ8H 1OXUA 1YJ9A 3GDEA 4LF9L 2F0HA 5NUCA 4G7OC 4A3BB 4DR5Q 4YWMA 1D1KA 4KN7C 3KYHC 3D8GA 1GUSA 2A8VA 1ENFA 2XNAC 1FGUA 1T9HA 4K14A 3PQIA 3S14B 3WOFA 2L5TA 1WVLA 3QIAA 2UUBQ 5M3MH 2AUJD 4MTNA 1EWIA 2K32A 1HXYD 1U4LA 1JWUD 5KNBA 2F0VA 1O80A 2RF4A 2ZTDA 4CDCC 1K8AC 2I07B 4A93G 1NAPA 4DV6L 4ID6A 1PRTB 1KTKA 5JAVA 3W1BA 1EZ8A 3G71A 1AE3A 3J7AV 3NE5B 3PSIA 1VCIA 4LF8L 5JJKA 2I5HA 5ELEA 3VA5A 4PMWA 1S3OA 2UXCL 1J9OA 2KECA 1DONA 2Q2UA 1LV9A 1HNXQ 1X3GA 2OF1A 3ZYYX 2Y0SG 4JBMA 3IKJA 3ERQA 3HOYH 4K6DA 2K52A 4A3GG 3TMEA 4HCSA 2EZVA 4I7AA 1UNSA 2ICIA 4S3SA 4KY7A 4B9WA 4X66L 4HJ8A 2E74C 5BN5A 1H9SB 1EY8A 1S5FD 2EYHA 2KEDA 4UY8C 1HNZQ 1X65A 5JJZA 2VL6A 4DK0A 1I4PA 1EIYB 5DAUA 4HR7B 1EIFA 2A74C 1JJCB 1DOMA 1SMYC 1YNJD 2Z9HA 3J81i 3S14H 5KYIA 1DJRD 4GLXA 5ELFA 3CP0A 1CM9A 4OO1H 4JBKA 4XYQA 4JV5L 4IFDH 2D9UA 2JK8A 2DNEA 4C3HG 1KIXA 3JAMi 1T5XD 2OCEA 3A56A 3TZDA 1EY5A 4LF4L 4GN3B 1HZCA 1NNXA 4MIUA 3G6EA 4DV7Q 1PZJD 1PYSB 3S16B 4JCVE 3HKZG 2B2UA 3S15B 3RMHA 2EPBA 3BDLA 4DPGA 4HIOA 3HKZE 1QJOA 4J15A 2HIVA 5CC4A 1QB5D 5IP9H 4DK3C 4P71A 2K5WA 1STHA 1TKWB 5C4XH 1X54A 1IYVA 3A5UA 4E6IA 2HDMA 2DY8A 3BS1A 2E8GA 3FMCA 1XYIA 1KXLA 1V43A 1YVCA 5DLQE 3CCSA 2LFNA 2UU9Q 3PUZA 4AIMA 5H1SE 2F3VA 2VS1A 1WTPA 1VQ7A 3GTKH 1VQJA 2HT1A 1K83H 1WYDA 3NENA 2E2DC 5J22A 5I2XA 1CHQD 5KNDA 2GN5A 5JVG3 4FXDA 3AU7A 2EVBA 1O78A 2F0IA 4LF8Q 3G6JB 1XPRA 3I4NB 1ILPA 2YU9B 1GO3E 3E3XA 5IT9E 1LT3D 1SEBD 4DR3Q 4M8AA 5A2QL 5C4ZA 4X65Q 3RLFA 2OWOA 4POGA 1OXSC 3F2UA 2V1CC 2MHVA 4CDDC 4U673 1NSNS 1OXTA 4EGVA 1E1TA 4A3BH 3Q0AA 3UE1A 4DU9A 1JWSD 3AYHB 5I9OA 5EKKA 5KIXA 4IN3A 3CPWA 1VQ5A 1STBA 1TWCH 2KQ3A 5IGDA 4B3ML 3CCJA 3DLLA 3RZDH 1K9MC 3IL8A 2QEXA 4A3LH 4LK1C 4TQUS 4ZUIA 3S16H 1KABA 4KY5A 4O2DA 1X3QA 3X3NA 2HHHQ 1KNAA 4R8IA 2F03A 2NTTA 1PRTF 1FD7D 2F0TA 1BUVT 4XT3B 4ZKCB 4KHPL 3HZXA 1ESRA 1VMCA 5I4DA 5IGEA 3RD4A 2K75A 4YY3L 4A3IB 1PLFA 1K3RA 3H15A 1W3SA 2VW9A 2B63G 3GTQB 5E7NA 1CHPD 2NTSA 4OGQC 1MJCA 2RQXA 3WWVA 3GTOB 2PW7A 5CV7A 1N36Q 4ILWA 4RH6A 3R2IA 3DWAA 1HQMC 4R4TA 1B3QA 2RDFA 3HOVH 4HIMA 4JI5L 2JA7G 2ZXOA 5FO8B 4HMIA 1R4QB 4JI7L 4QUCA 2I5LX 2WFWA 1X55A 1U9RA 4KHVA 2X6GA 3J81j 1SNCA 2KCCA 2K4KA 5CR3A 4CJ2C 2NZ1D 2WB1G 2IHFA 1EL0A 1SSOA 4DAPA 1YHQA 2PW5A 5ISRA 1IL8A 2BDNA 1KDBA 4NP5A 5C0XG 2F0UA 3IFDA 5A2QE 3S17B 2EY6A 1HZ9A 4JG2A 3R2TA 5M9OA 1MBYA 3IFTA 3JC66 4A3EG 3NBHA 1YITA 1I94L 4RGOS 2NYZD 4K2LA 2R7ZG 1B8AA 1KLUD 1MIUA 2IL8A 2GVBA 3S1QB 4FYDA 1ENAA 2PMZB 1AW7A 5FJ8G 4N8FA 5IODA 4RCOA 3T16A 4GNXB 1EQVA 3GTGH 1JWMD 1PH1A 1GOZA 2K5NA 1F9PA 3L0OA 3AFQA 1CI3M 1EY7A 1BBXC 2SEBD 3I2ZA 3LWUA 4BS9A 1N9WA 3RR5A 3K5MA 1STGA 2PPBC 4UP9A 3FPPA 1GUNA 2B2WA 2EYMA 3DWPA 2CW0D 2YYZA 2B2TA 1DOLA 2R7FA 1H9SA 5G3LD 3SHLA 2F0PA 4ZLTF 3PO2B 1YHAA 1L0YB 3KBGA 1UEBA 2B29A 2KBNA 2HQEA 5C3WA 4H44C 3FKIG 3SEBA 1CZWA 4X62Q 4P72A 4JC0A 4C56C 4DV0L 4DR7Q 1CKOA 4RWSC 4BA1I 3M3YH 1QNUA 5G3LF 3S1NH 4ZAIA 4P73A 4DR6Q 2A1AA 4K6LA 4XQJA 1Q12A 3MEHA 3K58A 1VQKA 1A3TA 3ER0A 3PUYA 3NQIA 4LUOA 5EJWA 1V8QA 4KI0A 1C0AA 3ND8A 1JJ2A 1K8OA 2DNCA 1TS4A 3E0JA 1NMGA 1B2TA 3AB9A 1D8LA 2BA1A 1V9PA 5IWAQ 2LSSA 2D0OA 1U4PA 3J7A5 1EY9A 2KCTA 1TXYA 4OHJA 3TREA 3SVMA 4A76A 1XMQQ 1HA5A 3SK4A 3I56A 1W2BA 4RKBA 4FF2A 2E2HB 2JEAI 1H9KA 3R3OA 1H9MA 3H3VI 4MNOA 3HFZB 2RHQB 4OWWB 3J7AF 1JC7A 5C5MA 3I91A 4B3TQ 1QE6A 1CKNB 4UHVA 1TQOA 4MHEA 3I90A 2CQAA 5T1GA 1WTRA 3T51B 1O7LA 1H95A 4A3MG 2LY7A 1DM0B 3PCOB 4P2CB 4JI1L 2JA7B 2KEEA 1A15A 1BVSA 1Q3LA 1PFSA 3S15H 3HKSA 1PH9A 5EKLA 4NKLA 1YNND 2F0JA 5BN3A 3CCUA 4C3IB 4GNXA 3G48A 4M1UB 2CWPA 2R7ZH 1G8ZD 2E2IB 1MSHA 3NWSA 3NTIA 5DM73 4DV1L 3MXUA 3KUPA 3D0FA 5FLMG 4POFA 2UUBL 2F0FA 1EOVA 4MZ9A 5IY0A 3H0GG 1I4XA 4GKJQ 3S2DH 2B8FA 3K7AH 2FXQA 2NWGA 2QA4A 1PH7A 1UUPA 4Y7NH 4RAUC 5LL6S 2H1EA 2KA7A 3FVQA 2N55A 1EEFD 2R7DA 4A3JH 5C3EH 1VQIA 3PUXA 2ES2A 4GOPA 2PNRC 1PV4A 1I4HA 3K57A 1Y1VH 1JMCA 2PZTA 1L0WA 3MZ5A 4KV6A 1JB3A 4ODGA 4C3HH 1JT8A 4YHHL 2R93B 1YZ6A 3I7FA 2R6GA 2UXBQ 1EQRA 5C5LA 2YU9H 2M00A 3CF5A 2F1MA 2VB3X 1GHJA 1PFMA 1TWFB 2RKSA 4O42A 4GKKL 1YHBA 4RHRA 4C1NK 2AWOA 1J5EQ 3R93A 1LT4D 1TY2A 1TR5A 2F0SA 2Y0SE 4QL5A 4KKSA 3HOVG 5C0XI 3F1ZA 4FO2A 1PH2A 1Y1WH 1UE7A 4DV2Q 1CKMA 4R4QA 2NVYH 1PFBA 4DR4L 3M3YB 4ZUJA 4A3KH 1SROA 4DV5L 3SR1A 1Q8KA 2K5DA 4DUYL 3BVGA 4A3JG 3KBXA 4YCUA 3S1QH 4APVA 2BOSA 1SRUA 4RGTA 2WIIB 4GLAC 5ELDA 1DOKA 1Z6HA 2RBMA 4WFN3 3FRPB 4OX9L 1F9QA 1BCPD 3DMUA 2WAQB 3OW2A 4X65L 1I6VC 3MTSA 4XIGS 4JW0A 3NHHA 4ZQ3A 4QMGA 2PZUA 3I4MB 4F88A 2C9OA 3HS0C 1YJNA 3FKIH 2E2JH 4IZ8A 1L0XB 2F0EA 1VF7A 3CCEA 2O4XA 1RCVD 4HCEA 1SFOB 2TSSA 2F0OA 1J5EL 1E7ZA 1EOTA 1KHIA 2WKDA 2JE6I 2NVTB 3IAYA 3S2DB 3OPOA 4UDUC 3V96A 3TBIB 2PZWA 4O1NA 2D0PA 5C4JB 1BQQT 4B3TL 3PO3H 2VQFQ 1PDQA 1WI5A 4P75A 4B3SQ 3KLSA 1LABA 4IJLA 1K28A 2HCIA 4JI6L 2R92H 3CW2C 5CV4A 2ZXPA 2K5VA 2PO4A 4GKJL 3CCQA 2F3WA 3ZJYC 5IGFA 4X64Q 1Y1VB 2AUKA 4C2MB 2Q2IA 3CC2A 2NZOA 4YWKA 1MKHA 5LMNW 4IPCA 1VQPA 1Y1VG 1RJTA 2EY2A 2XIWA 1BXTA 5EPKA 3NBIA 3M4QA 4HJ5A 2F52A 1EY0A 3NWTA 1IBKQ 5CV8A 1SYCA 1H9JA 2QEJC 4BBRB 3OHXC 3BZKA 2KENA 4F8MA 1IBLQ 5IGGA 1N34L 4R4CA 1G6ZA 4CGYB 3GTLH 4HIDA 2BE5D 2SOBA 3CMAA 5IWAL 4DV4Q 1GD7A
chains in the Genus database with same CATH topology
4XQNA 2A73B 4QIWB 4IUPA 2B2YC 2SDFA 5CYUA 2A6HC 3NUCA 4KY6A 1DCZA 1ICWA 2BA0A 5M3MB 2XWBB 4CKCA 1O7YA 4XT1B 1PTOC 3LWEA 1ZXTA 1PRTD 1Z7TA 5IT9L 3PO3B 2K04A 2WV6D 1QILA 4OO1G 3EJIA 2EY5A 2X6LA 3MVVA 4V0BA 3SDZA 5CBEE 3EA6A 3FKIB 1BCPF 2E2JB 3K5OA 1QNKA 4C1NI 2Z4IA 2Q8TA 1FNUA 2PQEA 1FGBD 2Q8IB 1HUNA 4DGZA 2IW3A 1Z47A 4KKTA 1CT1D 4NDXA 1HCZA 1BR9A 1BCPB 3CRLC 1EEID 2NVYB 5HGTA 3GTKB 3NXWA 3A55A 5ELBA 1Q1BA 1TS5A 4QCLA 3MWYW 4KD4A 2LS01 2JA8B 2B2WC 3GO5A 1BCPC 2B2TC 4HN7A 3ND9A 5M5XB 1TWGB 1JR0D 1K8MA 2PYKA 3V05A 3JAML 3HOZB 1YNNC 3N6RA 2HCCA 4WRDA 1M8AA 1S4ZA 1K83B 3P7JA 3VR3A 1AN8A 5CV6A 3CQZB 3A7LA 4XDXA 3T53B 3VA7A 3T4AC 1V1PB 2WKCA 2R3ZA 3J81L 3Q23A 5C0XH 4EQOA 1EWCA 1LACA 3FDTA 5FLXE 1SE2A 1E2ZA 3E5SA 1SNQA 1Y69U 1CZGA 2CHBD 3N52A 3ONAB 1I6HB 4PQXA 3D4DA 3D3RA 3NTHA 5D65A 1TY0A 3K7AB 4ZRZA 5FOBB 1FNVA 2EDGA 1STAA 1I4QA 2M9VA 2IT1A 2NBFA 3W3AA 4HSVA 2K33A 2L11A 1PXUA 3A7AB 1BDOA 2RVLA 1ENCA 1PZID 1TWHB 1ET6A 4OIKA 5FKAC 4Y7NB 4N9TA 1PTOF 1MI2A 1IKMA 3VYRA 2B2VC 2A5HA 1EYAA 4OO1I 5EBDA 1I50B 2B39A 2JA6B 2BE5C 4I7ZC 5E4WC 4K2KA 5C4XB 2FMMA 4IUUA 3I8ZA 1NR4A 4H13C 3U9SA 3RZDB 3SK8A 2XSCA 3TP6A 3A8IE 3BG3A 2XN9C 1JOOA 5CBAE 1HFGA 4NW2A 4ZYSA 1SDFA 2L12A 1SBBB 3S9WA 1AFPA 1JORA 1ZKOA 2RDHA 4BY1B 1FNWA 4B9XA 1B53A 1VDZA 2EJFC 5KRUA 1DZ1A 2KUMA 3EROA 2NVXB 3SXHA 2K6AA 4QB4A 1HUMA 1F9SA 1BOSA 5DEHA 3HOVB 1LT6D 4J8QA 5E1FA 1GUOA 2RSOA 3D31A 5IIFA 4XXEA 3HOXB 4RGNA 4A3KB 3DHQA 4J1MA 4PNYA 5EPJA 1E0BA 3J80E 3BYYB 1Q90A 3KLSX 1B4OA 4OIJA 1ESFA 2F0DA 2FMCA 1B50A 1TIID 3MHBA 2L1BA 4CJ1B 1C4QA 1H9RA 4ME5A 4Q0FA 1WCMB 5IOCA 2QF7A 3NTKA 2IX3A 1ET9A 1SNMA 1LLRD 4K8IA 2AQ2B 1NUCA 3VYTA 1FR3A 3OMCA 3UI2A 3H3VC 3Q22A 1DXMA 2RDGA 2NUCA 2JSOA 3U9OA 1X3PA 2B2YA 1AEXA 2JP1A 5DM63 1IKLA 5C0XJ 2QKIC 2K1BA 4KJNA 2Q8RE 2MJ8A 3K59A 1WTWA 4V190 1RD9D 1SYEA 3CHBD 2IPKD 5FK9C 1O7ZA 1LTID 3VR6A 2CVRA 3BVZA 3SK5A 4HSPA 5CORA 4A3GB 3OMGA 1CQVA 3CU7A 5D3DA 3LNNA 3MXNA 4IUVA 3LX0A 4RA8A 3SK6A 4XYOA 3R8BA 1WTOA 2CW0C 1BNZA 1GUWA 2B2UC 3K6OA 3GTJB 1A3UA 2ZXRA 4BA2I 4B08A 2MP1A 2J4XA 4DAYA 3VR2A 1GHKA 5K36H 2ID0A 2WACA 3HG9A 1R9TB 1QOHA 4UAIA 3C46A 1EQTA 4MN3A 4L6TB 2K28A 3K0YA 2PCFB 1TWCB 4G7ZC 3QOLA 4WJWA 3GTPB 2F4IA 3A8KE 3P1HA 1PYWD 1UEAB 3HOWB 4G57A 2EYOA 1WTXA 1KNEA 3HOYB 3C1EA 1ZYRD 1A2TA 4XTCS 5BN4A 4IFDG 2FINB 1A2UA 4RKLA 5LHY1 5JVH3 4X3UA 2L9HA 1VMPA 5FO7B 5K36G 2V4DA 4A3EB 3OW7A 4FNFA 2Z8LA 3I72A 3NQTA 3DEOA 1WD0A 2IX1A 1T5EA 1ZYRC 1IW7D 2XVSA 4IFDJ 1S5BD 2LMCB 3TDQA 1GJXA 1XTCD 2EJGC 2H4OA 2GA4B 3I3CA 1SYDA 4KD3A 2F0LA 3H6MA 3QJYA 1JQYD 1SYGA 1QWYA 1SJED 1A3VA 3BZDB 1KAAA 5C3XA 1F9RA 4WORA 4QUFA 1IW7C 2MUYA 4ZK9B 4TRDA 4X3KA 5FLXL 1LTAD 3S1MB 2A68C 3E6ZX 2J0TD 1F77A 3QB3A 2EYPA 4HEDA 1SE4A 4CJ0B 3DWQA 3HEJA 4ABNA 5KYLA 2ZT9C 1PTOB 1QCBD 4IUTA 3NK9A 5DNFA 1D2BA 1AP0A 2K01A 2FHTA 1E2WA 3PUVA 3S1NB 2OXPA 3SE0A 2A6EC 3VR5A 4CHTB 3DM1A 4YIJA 3O13A 1HFNA 3I70A 2HDLA 5A35A 2VNUD 2J7ZA 1PTOD 3C1FA 3TZUA 2DY7A 1XWEA 5COYA 2SNSA 2B2VA 5JPMC 4F7XA 5CGKA 5IGCA 1GXDC 2NN6G 1MD2D 2O5JC 3BYTB 3S2HB 5EGTA 4A93B 3BVMA 3PIP3 3M4OB 1SMYD 1NR2A 3J7YW 2JA5B 4FXKC 2A69C 2EXZA 1JOKA 2OT2A 3NSWA 1SYBA 4KHZA 3HOUB 2D5DA 1W6JA 5E3FA 2N88A 1PZKD 5JEAJ 4DXGA 1ONLA 4FF4A 2L55A 3TP8A 2A6ED 2EYFA 1TS3A 2VXWA 3PMFA 5E4XA 1Y8PB 2MPMA 3P75A 2KOLA 3NPPA 2K05A 4R8NA 5EQ0A 3K5NA 3I4LA 1LTGD 4LMQD 2EJMA 1CA5A 5JOBA 1VF5C 4KK7A 3HRZC 3L9AX 1C48A 1RKNA 4HTHA 4K5WA 3W2DA 4RCNA 1IYUA 2B8GA 1Y1WB 3L3OC 1WD1A 5F2DA 4KJOA 3OWEB 3D4RA 3H09A 1I4GA 1LTRD 5KNCA 1C8CA 2A69D 4DNRB 1G2TA 3QOJA 1ILQA 4EQPA 1II3A 4C3JB 3GTLB 4DN4M 3A8JE 1EYDA 2Z4HA 1JE4A 4L8JA 1OXVA 5CV9A 3OSOA 2MGSA 3EQLC 2NN6H 4XQQA 4A3JB 1F2LA 3M7NA 3PV0A 1EYCA 4K5VA 1R4PB 4LAAA 4KTAA 4I65A 2JYOA 3WDNA 1XXGA 5HURA 1S5ED 2A68D 1CK1A 2R61A 3MC0B 1JOQA 1ML0D 3HKZB 1Y8OB 3GV6A 3QWNA 3T13A 2L0CA 4J6HA 3FPUB 2LKVA 4ZKBB 3T56B 1HA6A 1OXXK 5CMDA 1BF4A 1B44D 1U4MA 1HPCA 1HTLD 1AZPA 1PMRA 2I46A 1LTTD 2R7ZB 3MFYA 1TWAB 1HTPA 1V1PA 5J39A 3AMUA 1F2YA 1HRJA 2IJ0A 3HGBA 1IHZA 4FVMA 1D6EC 1STNA 5J1ZA 2K7VA 1EFID 4G4KA 2WB1B 1Q1EA 1EIHA 1D5MC 4IUNA 2NVQB 4DAVA 4PMBA 3MA2B 4FF3A 1OO9B 2RA4A 3C3LA 3VYUA 3GD7A 1B1ZA 3JAME 2ENBA 1UAPA 3Q6SA 1G291 2FJ2A 4RFBA 3DEPA 4TKOB 4CKBA 4C3JG 1SNDA 4TSSA 4A3DB 1KDCA 4DFAA 3S1RB 4OL7A 1EZ6A 3GP7A 4BWGB 4IFDI 1F2MA 3EFXD 5JEAH 2G9DA 3CKIB 2O5IC 4H0LC 2XWJB 3D6CA 2ICEC 1MGSA 2D62A 1M4VA 2O2LD 2KCNA 1B9MA 3TN2A 2TMPA 3X3MA 4IUQA 4LJZC 1A6XA 3V2TA 4N9PA 1STYA 1Q8IA 1HHVA 5KGUA 3KF8A 1TU2B 3MFGA 1J8IA 4PMCA 3M85A 2B63B 5D3IB 3GQBA 1SE3A 1FYCA 1X32A 1V1OA 1WTQA 4F87A 4JBWA 4L63B 4X3SA 1B9NA 3OWFA 3TSSA 1D1IA 4IALA 4FXGC 2NN6I 4A3FB 1SNPA 1TT2A 3H0GB 5K5PA 2M2LA 1TVXA 5EKIA 2F0KA 1HQRD 1SYFA 4JK1C 3MAQA 2F0WA 3WOEA 4EVOA 1CTMA 4DXFA 1EY4A 3GTMB 3DUZA 3PIO3 2Y0SB 1SAPA 5M5YB 1PRTC 4DF7A 4HMJA 2OEOA 2EE1A 2EYJA 1Y8NB 2HUGA 5M3FB 2Z1CA 3KK7A 4X3TA 2K03A 5EBCA 1CQFA 4DK1A 1MSGA 5IGBA 1WTVA 3K5LA 3DXJC 4NMZA 2IX0A 1RODA 1RDPD 2XRQD 4RHSA 2FFKB 3PUWA 1KLGD 3GV3A 2JXMB 4R9WA 2QILA 1S5CD 3D4WA 3NP8A 1AZQA 2EY1A 3RUZA 5C44B 4CBVA 3OIPA 2R92B 1BO0A 3BDCA 5KEEA 3BDOA 4Z9CB 5FO9B 1E2VA 1STEA 4K8JA 3OOCA 5EPLA 2XRSD 5C3EB 4Q5VA 3I73A 3M4YA 1PFNA 2AQ3B 4EQNA 1GUTA 2BCOA 1RTNA 4FP5D 3FEWX 5JEAG 4KN4C 2A6HD 5I6YA 2L4NA 4BBSB 2G9HD 1S5DD 4DA2A 5M5WB 3D6WA 3CRKC 1SXTA 2E76C 4IURA 3A54A 1LO5D 5LL6X 3H94A 5C6AA 3VYSA 1G91A 4QF4A 5I6WA 3TP5A 2WP8J 1LTSD 4U68A 1EU4A 1CA6A 1F2ZA 1TS2A 3QG1A 1JCKB 3Q24A 5I9PA 3URYA 1ZEQX 3GTGB 2F0MA 4FF1A 2QDBA 4K5XA 4PV1C 1YNJC 3P20A 1EY6A 4DNTB 2F0NA 5C4HA 2F0QA 3OIQA 3C2PA 2RSNA 1I4RA 3VR4A 1U4RA 3TP7A 5AFWA 1SNOA 2KHSA 1XX8A 3QO2A 4AYBB 3HP3A 4IQZA 1PTOH 2EYLA 1DD2A 2E75C 1QG7A 1G2SA 3ITPA 1NCVA 1EU3A 1KDAA 5TSSA 1I3QB 2KJXA 3G7LA 5ELCA 3EVQA 4ULLA 1LT5D 2SNMA 1JICA 3KLRA 2K5QA 4KKUA 1B3AA 2D2CC 1D5ZC 2AWNA 4C3IG 2DN8A 3M7GA 1RTOA 2KVMA 2WINB 3MXPA 2C5CA 1LTBD 2F0GA 3H91A 4HAEA 4G7HC 1RHPA 2BDOA 4A3MB 1RF2D 4H7BA 4GZYC 2NB0A 3J81E 1CFMA 1EIGA 3L7ZC 4BY7B 1D5XC 5D14A 4CKEA 2IWHA 1W6KA 2X69A 2VUMB 4C3HB 2VB2X 1EWHA 5I2YA 5CV5A 3J80L 3MXGA 4RGMA 4KMUC 5JPNC 1SJHD 1GUGA 5T1IA 2AQ1B 2JEBI 2EOTA 2QCPX 1DYQA 3RZOB 1OXUA 2F0HA 5NUCA 4G7OC 4A3BB 1D1KA 4KN7C 3D8GA 1GUSA 1ENFA 2XNAC 4K14A 3S14B 3WOFA 2L5TA 1WVLA 3QIAA 2AUJD 2K32A 1HXYD 1U4LA 1JWUD 5KNBA 2F0VA 1O80A 2I07B 1NAPA 4ID6A 1PRTB 1KTKA 5JAVA 1EZ8A 3J7AV 3NE5B 1VCIA 5ELEA 3VA5A 4PMWA 1J9OA 2KECA 1DONA 1LV9A 2OF1A 3ZYYX 3IKJA 3ERQA 4K6DA 2EZVA 3TMEA 4HCSA 1UNSA 2ICIA 4S3SA 4KY7A 4B9WA 2E74C 5BN5A 1H9SB 1EY8A 1S5FD 2EYHA 2KEDA 5JJZA 4DK0A 1I4PA 5DAUA 4HR7B 2A74C 1DOMA 1SMYC 1YNJD 5KYIA 1DJRD 5ELFA 1CM9A 4OO1H 4XYQA 4IFDH 2D9UA 2DNEA 4C3HG 1T5XD 3A56A 3TZDA 1EY5A 4MIUA 1PZJD 3S16B 2B2UA 3S15B 3RMHA 2EPBA 3BDLA 1QJOA 5CC4A 1QB5D 2K5WA 1STHA 1TKWB 1IYVA 4E6IA 2HDMA 2DY8A 3BS1A 3FMCA 1XYIA 1V43A 2LFNA 3PUZA 2F3VA 1WTPA 5J22A 2E2DC 5I2XA 1CHQD 5KNDA 5JVG3 4FXDA 3AU7A 2EVBA 1O78A 2F0IA 3G6JB 3I4NB 1ILPA 2YU9B 5IT9E 1LT3D 1SEBD 4M8AA 5A2QL 5C4ZA 3RLFA 1OXSC 3F2UA 2MHVA 4U673 1NSNS 1OXTA 4EGVA 3Q0AA 4DU9A 1JWSD 5I9OA 5EKKA 5KIXA 4IN3A 1STBA 2KQ3A 5IGDA 3IL8A 4LK1C 4TQUS 4ZUIA 1KABA 4KY5A 1X3QA 3X3NA 1KNAA 4R8IA 2F03A 2NTTA 1PRTF 1FD7D 2F0TA 1BUVT 4XT3B 4ZKCB 3HZXA 5I4DA 1ESRA 1VMCA 5IGEA 3RD4A 4A3IB 1PLFA 3GTQB 1CHPD 2NTSA 4OGQC 2RQXA 3GTOB 2PW7A 5CV7A 4ILWA 4RH6A 3R2IA 3DWAA 1HQMC 2RDFA 2ZXOA 5FO8B 4HMIA 1R4QB 4QUCA 1U9RA 4KHVA 2X6GA 1SNCA 2KCCA 5CR3A 4CJ2C 2NZ1D 1EL0A 1SSOA 4DAPA 2PW5A 5ISRA 1IL8A 2BDNA 1KDBA 4NP5A 5C0XG 2F0UA 3IFDA 5A2QE 3S17B 2EY6A 3R2TA 5M9OA 1MBYA 3IFTA 3NBHA 4RGOS 2NYZD 4K2LA 1KLUD 2IL8A 3S1QB 4FYDA 1ENAA 2PMZB 1AW7A 5IODA 4RCOA 3T16A 1EQVA 1JWMD 1GOZA 1F9PA 1CI3M 1EY7A 1BBXC 2SEBD 4BS9A 3LWUA 3K5MA 1STGA 2PPBC 3FPPA 1GUNA 2B2WA 2EYMA 3DWPA 2CW0D 2YYZA 2B2TA 1DOLA 5G3LD 1H9SA 3SHLA 2F0PA 4ZLTF 3PO2B 1L0YB 3KBGA 2HQEA 5C3WA 4H44C 3SEBA 1CZWA 4C56C 4RWSC 4BA1I 1QNUA 5G3LF 4ZAIA 4K6LA 3K58A 4XQJA 1Q12A 3MEHA 1A3TA 5EJWA 3PUYA 3NQIA 1V8QA 4KI0A 3ND8A 1K8OA 2DNCA 1TS4A 3E0JA 1B2TA 3AB9A 2BA1A 1U4PA 1EY9A 4OHJA 3SVMA 1HA5A 3SK4A 4RKBA 4FF2A 2E2HB 2JEAI 1H9KA 3R3OA 1H9MA 3J7AF 1JC7A 5C5MA 3I91A 1QE6A 1TQOA 4MHEA 3I90A 2CQAA 5T1GA 1WTRA 3T51B 1O7LA 2LY7A 1DM0B 4P2CB 2JA7B 2KEEA 1A15A 1Q3LA 5EKLA 4NKLA 1YNND 2F0JA 5BN3A 4C3IB 4M1UB 1G8ZD 2E2IB 1MSHA 3NWSA 3NTIA 5DM73 3MXUA 3KUPA 2F0FA 1I4XA 2B8FA 2NWGA 1UUPA 4RAUC 5LL6S 2H1EA 2KA7A 3FVQA 2N55A 1EEFD 3PUXA 2PNRC 1I4HA 3K57A 2PZTA 3MZ5A 4KV6A 1JB3A 4ODGA 2R93B 2R6GA 5C5LA 2M00A 2F1MA 2VB3X 4O42A 1GHJA 1PFMA 1TWFB 2RKSA 4RHRA 4C1NK 2AWOA 3R93A 1LT4D 1TY2A 1TR5A 2F0SA 4KKSA 5C0XI 4FO2A 1PFBA 3M3YB 4ZUJA 3SR1A 2K5DA 3BVGA 3KBXA 2BOSA 4RGTA 2WIIB 5ELDA 1DOKA 4WFN3 1Z6HA 2RBMA 3FRPB 1F9QA 1BCPD 3DMUA 2WAQB 1I6VC 3MTSA 4XIGS 3NHHA 4ZQ3A 4QMGA 2PZUA 3I4MB 4F88A 2C9OA 3HS0C 4IZ8A 1L0XB 2F0EA 1VF7A 1SFOB 1RCVD 2O4XA 4HCEA 2TSSA 2F0OA 1EOTA 2WKDA 2JE6I 2NVTB 3IAYA 3S2DB 3OPOA 4UDUC 3V96A 3TBIB 2PZWA 4O1NA 5C4JB 1BQQT 1PDQA 3KLSA 1LABA 2HCIA 5CV4A 2ZXPA 2PO4A 2F3WA 5IGFA 1Y1VB 2AUKA 4C2MB 1RJTA 2EY2A 2XIWA 1BXTA 5EPKA 3NBIA 1EY0A 3NWTA 5CV8A 1SYCA 1H9JA 2QEJC 4BBRB 3OHXC 4F8MA 5IGGA 1G6ZA 4CGYB 2BE5D 2SOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0S A;  1TR5 A;  2F0V A;  2EYL A;  2RDF A;  2EY1 A;  3NP8 A;  4N9T A;  4TRD A;  3RUZ A;  5IIF A;  2EYF A;  4KD4 A;  2WAC A;  3PMF A;  3D6C A;  2F3V A;  4HMI A;  1EY9 A;  4ID6 A;  3ITP A;  3DHQ A;  1EYA A;  3P75 A;  3BDC A;  5KEE A;  1KDA A;  4J1M A;  4PNY A;  5J22 A;  4R8N A;  5JAV A;  3SK4 A;  1EZ8 A;  3QB3 A;  3EVQ A;  2EYP A;  3NUC A;  4RKB A;  4ZUJ A;  1U9R A;  4KHV A;  3R3O A;  4K2K A;  3HEJ A;  4KY6 A;  4K8J A;  3SR1 A;  1SNC A;  5KYL A;  5CR3 A;  3V2T A;  4N9P A;  2SNM A;  1STY A;  2F0I A;  3QOL A;  5JOB A;  2F0D A;  3NK9 A;  5KGU A;  3VA5 A;  2PYK A;  5M9O A;  5C5M A;  4PMC A;  5J39 A;  2PW5 A;  1RKN A;  4HTH A;  3MHB A;  5ISR A;  1F2Y A;  4K5W A;  1TQO A;  4WRD A;  3P1H A;  2OF1 A;  4EQN A;  1KDB A;  2RBM A;  3ERQ A;  4NP5 A;  4G57 A;  5C4Z A;  1IHZ A;  2F0U A;  2OXP A;  2EYO A;  3DMU A;  4K6D A;  4ME5 A;  3TME A;  3MXP A;  3OWF A;  4S3S A;  5IOC A;  4YIJ A;  2EY6 A;  5I6Y A;  4IAL A;  2F0G A;  3C1E A;  4KY7 A;  5CV6 A;  3NHH A;  4ZQ3 A;  5F2D A;  1A2T A;  1SNP A;  1SNM A;  2PZU A;  4QMG A;  4KJO A;  3SK8 A;  1NSN S;  1STN A;  1TT2 A;  4K8I A;  4B9W A;  5J1Z A;  1NUC A;  4IZ8 A;  5EKL A;  4NKL A;  1A2U A;  2F0E A;  2F0J A;  4K2L A;  5K5P A;  1EY8 A;  2EYH A;  2O4X A;  4RKL A;  3TP6 A;  3C1F A;  1ENA A;  2F0O A;  3OMC A;  4IUN A;  4DU9 A;  3EJI A;  3QOJ A;  2EY5 A;  2F0K A;  4PMB A;  5I9O A;  4EQP A;  5EKK A;  1II3 A;  5KIX A;  5IOD A;  4H7B A;  3T16 A;  3MVV A;  2NUC A;  1EQV A;  1JOO A;  2SNS A;  3U9O A;  4EQO A;  1SYF A;  4F7X A;  1AEX A;  1STB A;  2KQ3 A;  1EYD A;  2PZW A;  5DAU A;  5CGK A;  5IGD A;  2F0W A;  1EY7 A;  4EVO A;  5IGC A;  1EY4 A;  5KYI A;  4KJN A;  3E5S A;  4ZUI A;  1SNQ A;  1STG A;  5C6A A;  2F0F A;  5CV9 A;  4QF4 A;  1SYE A;  5I6W A;  1KAB A;  3NQT A;  3OSO A;  4KY5 A;  2ENB A;  3TP5 A;  2EYM A;  3S9W A;  4DF7 A;  1JOR A;  2PQE A;  4HMJ A;  5EGT A;  5CV4 A;  5CV5 A;  1F2Z A;  2F3W A;  3SHL A;  5IGF A;  2OEO A;  5I9P A;  2F0T A;  3D4D A;  2EYJ A;  4B9X A;  3SK5 A;  2F0P A;  4DGZ A;  2F0M A;  1EYC A;  2QDB A;  4K5V A;  5KRU A;  2HQE A;  3HZX A;  3OMG A;  1EY5 A;  4K5X A;  4NDX A;  5C3W A;  5IGE A;  2PZT A;  4LAA A;  3MZ5 A;  1SYD A;  4KTA A;  4I65 A;  4KD3 A;  4MIU A;  2F0L A;  1SND A;  4KV6 A;  3ERO A;  3LX0 A;  4ODG A;  1STA A;  1EY6 A;  2F0H A;  3H6M A;  5NUC A;  2EY2 A;  3SK6 A;  5HUR A;  5IGB A;  2EXZ A;  1JOK A;  1KDC A;  3D8G A;  2F0N A;  3SXH A;  4NMZ A;  1SYB A;  3BDL A;  4QB4 A;  4DFA A;  5C4H A;  2F0Q A;  4OL7 A;  1SYG A;  5HGT A;  3MEH A;  1EY0 A;  1A3V A;  4K14 A;  5E3F A;  1A3T A;  5CC4 A;  5CV8 A;  1SYC A;  3TP7 A;  5C5L A;  1JOQ A;  3NXW A;  2M00 A;  1SNO A;  5DEH A;  4F8M A;  1KAA A;  5C3X A;  1EZ6 A;  1A3U A;  1STH A;  2RKS A;  5IGG A;  2PW7 A;  4WOR A;  5CV7 A;  2KHS A;  1F2M A;  3T13 A;  1ENC A;  5E1F A;  4E6I A;  2SOB A;  4J6H A;  2LKV A;  3TP8 A;  3D4W A; 
#chains in the Genus database with same CATH topology
 3RN5 A;  4JPB W;  4XQN A;  2R93 H;  2A73 B;  4QIW B;  2N3S A;  4IUP A;  2B2Y C;  4A3E H;  2SDF A;  5CYU A;  2A6H C;  3NUC A;  2R93 G;  4KY6 A;  1DCZ A;  3T1Y L;  1ICW A;  2CWA A;  4LUZ A;  3NEM A;  2BA0 A;  5M3M B;  1SFO H;  2XWB B;  4CKC A;  1O7Y A;  4X66 Q;  4XT1 B;  1PTO C;  3LWE A;  2WAQ E;  5GAH C;  5LMN Q;  1ZXT A;  5M5X H;  1ASY A;  1PRT D;  4ME3 A;  1Z7T A;  1G6P A;  2IY5 B;  5IT9 L;  3PO3 B;  2K04 A;  2WV6 D;  1HNZ L;  1NMF A;  2EXD A;  1QIL A;  4L5R C;  3B6Y A;  4OO1 G;  3EJI A;  2EY5 A;  3EBE A;  2X6L A;  3MVV A;  4AQY Q;  4V0B A;  5M3M G;  1MHW C;  3J80 c;  3SDZ A;  4LF7 L;  5CBE E;  2CH4 A;  3EA6 A;  3FKI B;  1BCP F;  2E2J B;  5HGQ A;  3K5O A;  2UXD L;  1QNK A;  4C1N I;  2Z4I A;  2Q8T A;  1FNU A;  2PQE A;  1FGB D;  1E3P A;  4GOP C;  3F2D A;  2Q8I B;  2DJG C;  3UDX A;  4DGZ A;  1HUN A;  2IW3 A;  1TWF H;  5C3E G;  1Z47 A;  4KKT A;  1CT1 D;  3UDG A;  3I4N H;  4NDX A;  4PZ7 A;  1HCZ A;  1BR9 A;  4NXN Q;  2OTL A;  1BCP B;  4DV5 Q;  4YHH Q;  3CRL C;  1EEI D;  2NVY B;  4UP7 A;  5HGT A;  3GTK B;  2JJQ A;  3NXW A;  1PH3 A;  3A55 A;  1VQL A;  5ELB A;  1Q1B A;  1TS5 A;  4H02 A;  2XGT A;  4QCL A;  4LF6 L;  1WJJ A;  4N8X 1;  1LM0 A;  4DR6 L;  1EFW A;  3MWY W;  4KD4 A;  2LS0 1;  2JA8 B;  2B2W C;  1U0L A;  4KHP Q;  3GO5 A;  1BCP C;  1PH8 A;  2B2T C;  4HN7 A;  3ND9 A;  5M5X B;  1P16 A;  1TWH H;  3M9B A;  3GTP H;  1TWG B;  1A8V A;  2UUA L;  4LUV A;  1JR0 D;  1K8M A;  1EUJ A;  2PYK A;  3V05 A;  3JAM L;  3HOZ B;  1YNN C;  3KF6 B;  3KOJ A;  3N6R A;  4IPD A;  2NVQ H;  2HCC A;  4WRD A;  3KLW A;  4OX9 Q;  1M8A A;  1S4Z A;  1K83 B;  1CUK A;  4HJ7 A;  1KRS A;  3P7J A;  3VR3 A;  1AN8 A;  3K80 C;  5CV6 A;  3I4M G;  3CQZ B;  1FL0 A;  3J80 i;  3A7L A;  1CSQ A;  3CCV A;  1WOC A;  4XDX A;  1QVC A;  3T53 B;  3VA7 A;  3T4A C;  1YJW A;  1V1P B;  2WKC A;  4LF6 Q;  5M3F H;  2R3Z A;  3J81 L;  1I6H H;  4IOA A;  3AEV A;  2HHH L;  2UU9 L;  3Q23 A;  5C0X H;  4EQO A;  1EWC A;  1LAC A;  3T1H L;  4JI0 Q;  3FDT A;  1AE2 A;  1N8R C;  5FLX E;  1SE2 A;  2EQS A;  1E2Z A;  4RMF A;  1NBW A;  1V1Q A;  3PO3 G;  3E5S A;  1SNQ A;  3GTQ H;  4B3R Q;  1Y69 U;  1CZG A;  2I5M X;  2CHB D;  3U58 A;  4B3R L;  4YY3 Q;  2R92 G;  3N52 A;  4MTK A;  4DNI A;  3HOU G;  3ONA B;  1I6H B;  4PQX A;  4RG1 A;  1L2F A;  1CKN A;  3D4D A;  3D3R A;  5M5W H;  4A3C G;  2JQO A;  3NTH A;  5D65 A;  1TY0 A;  2G5D A;  3K7A B;  4ZRZ A;  5FOB B;  1FNV A;  2EDG A;  1STA A;  1I4Q A;  2M9V A;  2IT1 A;  3U4V A;  2MO0 A;  2NBF A;  3W3A A;  4HSV A;  3A74 A;  2K33 A;  2L11 A;  3HOX H;  5C4J H;  4LFC L;  3U50 C;  1PXU A;  3PO2 H;  3A7A B;  1BDO A;  4JI2 L;  2RVL A;  1OTC A;  1ENC A;  2P5Z X;  1PZI D;  1TWH B;  1ET6 A;  4OIK A;  2N49 A;  5FKA C;  5GAG C;  5AJ3 L;  4Y7N B;  4N9T A;  1PTO F;  2Z6K A;  3NEL A;  4LFA L;  1MI2 A;  1ICF B;  1IKM A;  3VYR A;  2B2V C;  2A5H A;  1EYA A;  2YTX A;  4OO1 I;  2CCZ A;  5EBD A;  1I50 B;  2B39 A;  3KDF A;  2JA6 B;  1C7Y A;  4NPS A;  2BE5 C;  4I7Z C;  3T1Y Q;  2NVX H;  5E4W C;  4K2K A;  2B3G A;  3ULP A;  4HJ9 A;  1SN8 A;  1HZA A;  5C4X B;  3KF6 A;  2F4V Q;  2FMM A;  4IUU A;  3UDF A;  3I8Z A;  1NR4 A;  2EIF A;  3K7U C;  3CPF A;  1NJI C;  4H13 C;  3U9S A;  3RZD B;  4JI3 Q;  3SK8 A;  1WCM H;  2XSC A;  3TP6 A;  3A8I E;  2RHS B;  3BG3 A;  1WFQ A;  2XN9 C;  1JOO A;  5CBA E;  3K81 C;  3Q8D A;  1HFG A;  1JJG A;  3KFU A;  1Q81 C;  4NW2 A;  4ZYS A;  1SDF A;  2L12 A;  1SBB B;  3S9W A;  1AFP A;  4JV5 Q;  1JOR A;  1ZKO A;  1PYB A;  2RDH A;  4BY1 B;  1FNW A;  4HIK A;  3M4O H;  4B9X A;  4LNQ A;  1YNX A;  3EIV A;  1B53 A;  1QZG A;  1VDZ A;  3HOW G;  2EJF C;  5KRU A;  2N8N A;  1DZ1 A;  4A3K G;  5BR8 L;  4A3F H;  2KUM A;  3ERO A;  3F2B A;  4OWT B;  1HR0 Q;  2NVX B;  2AHO B;  3TEH B;  1I3Q H;  3SXH A;  2K6A A;  4QB4 A;  1HUM A;  4DAM A;  1F9S A;  1BOS A;  5DEH A;  3HOV B;  1LT6 D;  3J7Z C;  4J8Q A;  5E1F A;  1GM5 A;  1GUO A;  1VQ6 A;  1P8L A;  2RSO A;  3PF5 A;  3D31 A;  5IIF A;  4DKA C;  1L1O A;  4P74 A;  4XXE A;  4X64 L;  5IP7 H;  1IBK L;  2H5X A;  2QGQ A;  3HOX B;  1JB7 A;  1HH2 P;  4RGN A;  4A3K B;  3S2H H;  3DHQ A;  4J1M A;  1N34 Q;  4PNY A;  5EPJ A;  5ELN A;  1Y1W G;  4A4I A;  1E0B A;  3J80 E;  3BYY B;  1Q90 A;  3KLS X;  1B4O A;  2XTI A;  4OIJ A;  3STB D;  1ESF A;  1SLJ A;  1A62 A;  2F0D A;  2FMC A;  3UE0 A;  4JI4 Q;  2UXC Q;  1B50 A;  3W1G A;  2UXB L;  1TII D;  2OQK A;  3MHB A;  2L1B A;  3HOX G;  4DR7 L;  1I50 H;  1C4Q A;  1H9R A;  4CJ1 B;  1K0R A;  4ME5 A;  4Q0F A;  3OTO Q;  1WCM B;  5IOC A;  2QF7 A;  3NTK A;  4WJ3 M;  1EQQ A;  2IX3 A;  1ET9 A;  1IZ6 A;  1SNM A;  1LLR D;  4K8I A;  2AQ2 B;  1NUC A;  2DJF C;  3VYT A;  1FR3 A;  3OMC A;  3UI2 A;  1XNQ Q;  3H3V C;  1FJG Q;  2A19 A;  3Q22 A;  1DXM A;  2RDG A;  1XNQ L;  1BKB A;  2NUC A;  4A3G H;  2JSO A;  4LW1 A;  3U9O A;  1X3P A;  2B2Y A;  2K50 A;  1AEX A;  2JP1 A;  5DM6 3;  1IKL A;  5C0X J;  2QKI C;  1VQA A;  2K1B A;  4KJN A;  2Q8R E;  2MJ8 A;  3K59 A;  2BH8 A;  1WTW A;  4PZ8 A;  4V19 0;  4K0K L;  1RD9 D;  1SYE A;  5IE8 A;  1FJG L;  1BBW A;  1VQ8 A;  3CHB D;  1ASZ A;  2IPK D;  5FK9 C;  4QY7 A;  1LTL A;  1QZH A;  1O7Z A;  1LTI D;  1YIJ A;  3VR6 A;  2CVR A;  3BVZ A;  3SK5 A;  4HSP A;  5IYD G;  5COR A;  4A3G B;  2UUA Q;  3BZC A;  3OMG A;  4K0K Q;  1CQV A;  3CU7 A;  5D3D A;  3LNN A;  3MXN A;  4IUV A;  3LX0 A;  4RA8 A;  3SK6 A;  4WJ4 A;  1IYJ B;  4XYO A;  4YWL A;  4IPG A;  3R8B A;  1WTO A;  2CW0 C;  1BNZ A;  1GUW A;  2B2U C;  1I5F A;  3IRB A;  3K6O A;  1UWV A;  4LF4 Q;  3GTJ B;  1XPO A;  1A3U A;  2CQO A;  4BY7 H;  2ZXR A;  4BA2 I;  4DUZ L;  4B08 A;  2MP1 A;  2J4X A;  4BBR G;  4DAY A;  2GVA A;  2ZM6 Q;  4DR1 L;  3VR2 A;  1GHK A;  5K36 H;  4PG3 A;  3CQZ H;  3S1R H;  2ID0 A;  1AH9 A;  2WAC A;  3HG9 A;  5C44 G;  1R9T B;  3HOW H;  1QOH A;  2KHJ A;  4UAI A;  3C46 A;  1EQT A;  5C4X G;  4MN3 A;  2Z6B A;  4L6T B;  2K28 A;  3K0Y A;  2PCF B;  2YTV A;  2ZJQ A;  1TWC B;  4G7Z C;  1E22 A;  3QOL A;  1K3B C;  5IYD H;  4BXX H;  4WJW A;  2HIX A;  3GTP B;  2F4I A;  4QIW E;  5IP7 G;  3A8K E;  3P1H A;  1PYW D;  1UEA B;  2ALY B;  3HOW B;  4G57 A;  2EYO A;  1WTX A;  1KNE A;  4PZ6 A;  3HOY B;  2PMZ E;  1ZYR D;  3C1E A;  3U4Z A;  1A2T A;  2E5L Q;  1UE5 A;  2K14 A;  4XTC S;  5BN4 A;  4IFD G;  2FIN B;  1A2U A;  5J3B A;  4RKL A;  5LHY 1;  3CAM A;  5JVH 3;  4X3U A;  2L9H A;  1VMP A;  3M4P A;  1E24 A;  5FO7 B;  5K36 G;  2V4D A;  3JAM c;  4A3E B;  3OW7 A;  3ERS X;  4FNF A;  3PIO A;  2Z8L A;  3I72 A;  3NQT A;  3CCL A;  3DEO A;  1WD0 A;  2IX1 A;  1O7I A;  1T5E A;  1ZYR C;  5IP9 G;  2MQH A;  1IW7 D;  2XVS A;  4JI1 Q;  4OEL B;  3E0E A;  3FHW A;  2VZA A;  4IFD J;  1S5B D;  2LMC B;  3TDQ A;  1GJX A;  3K0X A;  1Q46 A;  1XTC D;  2EJG C;  2H4O A;  2GA4 B;  3FP9 A;  3I3C A;  1SYD A;  4KD3 A;  2F0L A;  1UE6 A;  1KL9 A;  3H6M A;  1N33 L;  4A3C H;  1HNW L;  4DV3 Q;  3QJY A;  1JQY D;  1SYG A;  3KF8 B;  1QWY A;  5FLM H;  1SJE D;  1A3V A;  3BZD B;  1E1O A;  1WCM G;  1KAA A;  5C3X A;  2Q2H A;  1F9R A;  4WOR A;  1VQF A;  4QUF A;  1IW7 C;  2MUY A;  4ZK9 B;  2N78 A;  2Q2T A;  4TRD A;  4X3K A;  5FLX L;  1LTA D;  3S1M B;  2VUM H;  2A68 C;  4A75 A;  1B7Y B;  2ZTE A;  3E6Z X;  4JI2 Q;  5C44 H;  2J0T D;  1F77 A;  2AKW B;  3NBH B;  3QB3 A;  4GLV B;  2EYP A;  4HED A;  1SE4 A;  4CJ0 B;  4JBJ A;  3DWQ A;  4ALP A;  3HEJ A;  4ABN A;  3E9H A;  5KYL A;  2ZT9 C;  1PTO B;  1QCB D;  4IUT A;  1K0S A;  3NK9 A;  1PA6 A;  5DNF A;  1D2B A;  1QVG A;  3RZO H;  1AP0 A;  2K01 A;  3ICE A;  2FHT A;  1E2W A;  3PUV A;  3S1N B;  3H0G H;  1L1O B;  3TS2 A;  2OXP A;  3SE0 A;  4AYB E;  2A6E C;  3VR5 A;  4CHT B;  1S40 A;  1X3E A;  4NXM L;  3DM1 A;  4YIJ A;  4A3L G;  3O13 A;  1HFN A;  3I70 A;  2WB1 E;  3I4O A;  2E2I H;  2HDL A;  5A35 A;  2VNU D;  2J7Z A;  3E9I A;  2MO1 A;  1PTO D;  3C1F A;  1VS0 A;  3TZU A;  2DY7 A;  1XWE A;  4UP8 A;  4A93 H;  5COY A;  1VQD A;  2SNS A;  2B2V A;  5JPM C;  4F7X A;  1VQ4 A;  5CGK A;  5IGC A;  1GXD C;  2NN6 G;  2PQA A;  4BY1 G;  1MD2 D;  2VQF L;  2O5J C;  3BYT B;  3S2H B;  4JI8 Q;  5EGT A;  3HOZ H;  4A93 B;  2MFI A;  3BVM A;  3PIP 3;  2OTJ A;  3H3V H;  3M4O B;  1SMY D;  1NR2 A;  3J7Y W;  2JA5 B;  3CC4 A;  4FXK C;  2A69 C;  1HNX L;  2EXZ A;  1JOK A;  2OT2 A;  3ULL A;  3NSW A;  1SYB A;  4KHZ A;  3HOU B;  2D5D A;  1W6J A;  5E3F A;  2N88 A;  4DK6 C;  1PZK D;  5JEA J;  4DXG A;  1XPU A;  1ONL A;  4FF4 A;  4JOI A;  2L55 A;  3LGJ A;  3TP8 A;  4DR1 Q;  1N36 L;  2A6E D;  4ZCK A;  5ELO A;  4OXP A;  1VQG A;  1TS3 A;  2EYF A;  2VXW A;  3PMF A;  5E4X A;  1Y8P B;  2QW7 A;  2MPM A;  3P75 A;  1LYL A;  5LMU L;  3I55 A;  2KOL A;  3NPP A;  2K05 A;  4R8N A;  5EQ0 A;  2VUM G;  5BR8 Q;  3K5N A;  5FLX c;  3I4L A;  1LTG D;  4LMQ D;  4LF5 L;  2EJM A;  1XNR Q;  1CA5 A;  5JOB A;  1VF5 C;  2DGY A;  4KK7 A;  3HRZ C;  4CDE C;  3RLN A;  4EQ5 A;  3L9A X;  1C48 A;  1PVO A;  1RKN A;  4HTH A;  4LF9 Q;  4K5W A;  3W2D A;  5GQO A;  2CH4 W;  4RCN A;  1IYU A;  1VQM A;  2B8G A;  1Y1W B;  3L3O C;  1WD1 A;  5F2D A;  4R1J A;  4KJO A;  3OWE B;  4GNX C;  3D4R A;  3H09 A;  1I4G A;  1LTR D;  3I4N G;  5KNC A;  1C8C A;  2A69 D;  4DNR B;  2JA8 G;  5LMN L;  1G2T A;  3QOJ A;  4DV4 L;  1TWG H;  1ILQ A;  4EQP A;  1II3 A;  4C3J B;  3TS0 A;  4DV3 L;  3GTL B;  4DN4 M;  3A8J E;  1EYD A;  2Z4H A;  4AH6 A;  1JE4 A;  4L8J A;  1K8G A;  4BBR H;  2ATW A;  2IHE A;  4FDB A;  1OXV A;  1VQB A;  5CV9 A;  2JA6 H;  3OSO A;  1HZB A;  2MGS A;  2Z0S A;  4DV7 L;  1PH6 A;  3EQL C;  2NN6 H;  4DR2 Q;  4X6A H;  4XQQ A;  3OTO L;  4A3J B;  1F2L A;  3M7N A;  1HNW Q;  3CCM A;  1SR3 A;  3PV0 A;  1EYC A;  1Q86 C;  1DGS A;  4K5V A;  4GS3 A;  1R4P B;  1HR0 W;  4LAA A;  1IXR A;  4KTA A;  4I65 A;  2JYO A;  3WDN A;  2NZH A;  1XXG A;  2BH2 A;  5HUR A;  1S5E D;  5GRO A;  3QR8 A;  2A68 D;  1A63 A;  1CK1 A;  3STB C;  2LXK A;  2R61 A;  4LFA Q;  3MC0 B;  1JOQ A;  1ML0 D;  3HKZ B;  1RL2 A;  1Y8O B;  3PF4 A;  1Q7Y C;  2JA5 H;  4OWX B;  2F3I A;  2OQ0 A;  3GV6 A;  2WAQ G;  3QWN A;  3BU2 A;  3T13 A;  4LWC A;  2L0C A;  4O0A A;  4J6H A;  3FPU B;  2LKV A;  4ZKB B;  3CCR A;  3T56 B;  1X56 A;  1Q82 C;  4LF7 Q;  1HA6 A;  1IBM Q;  1OXX K;  5CMD A;  1BF4 A;  3GTM H;  1B44 D;  4HJA A;  1U4M A;  4DUZ Q;  1HPC A;  1HTL D;  2VQE Q;  4AQY L;  5IYC H;  1AZP A;  1PMR A;  2I46 A;  1LTT D;  2R7Z B;  3MFY A;  1TWA B;  1HTP A;  1V1P A;  5J39 A;  2PI2 E;  3AMU A;  1F2Y A;  1HRJ A;  2IJ0 A;  1SMX A;  2VQE L;  3HGB A;  1IHZ A;  3VDY A;  2ZM6 L;  2AMC B;  1SE8 A;  4FVM A;  1D6E C;  1STN A;  1X6O A;  5J1Z A;  2K7V A;  4EX5 A;  2UUC Q;  1EFI D;  4G4K A;  2WB1 B;  1YEZ A;  1Q1E A;  1EIH A;  1D5M C;  3F8T A;  5IT9 c;  4IUN A;  1IL2 A;  2NVQ B;  3AFP A;  4DAV A;  4PMB A;  4JYA Q;  2VY3 A;  3MA2 B;  3OYY A;  4C2M H;  4FF3 A;  1OO9 B;  2RA4 A;  1NTG A;  3C3L A;  3VYU A;  3GD7 A;  1B1Z A;  3JAM E;  1PHJ A;  2HD3 A;  2CKZ B;  2ENB A;  5LMU Q;  1VQH A;  1GVP A;  3BJU A;  1UAP A;  3Q6S A;  4C3J H;  1G29 1;  4DR2 L;  2FJ2 A;  4BXX G;  4RFB A;  3RLO A;  3RNU A;  4B3S L;  3DEP A;  4TKO B;  4CKB A;  1KD1 C;  4C3J G;  1SND A;  4DR5 L;  3MEF A;  4TSS A;  2MNA A;  1XNR L;  2PQA B;  4A3D B;  1KDC A;  2JN4 A;  4DFA A;  4IOC A;  3S1R B;  4OL7 A;  4OON A;  3T1H Q;  4JI4 L;  3A0J A;  4YCW A;  1PH5 A;  1QUQ B;  1JE5 A;  1EZ6 A;  3GP7 A;  4BWG B;  4IFD I;  1F2M A;  3EFX D;  1NE3 A;  5JEA H;  2L15 A;  2G9D A;  3AQQ A;  1G51 A;  4JI0 L;  3CKI B;  2O5I C;  4H0L C;  2XWJ B;  3D6C A;  2ICE C;  3S17 H;  1MGS A;  1QVF A;  2D62 A;  1M4V A;  2O2L D;  2PI2 A;  4DAY B;  4KLK A;  2KCN A;  1B9M A;  4BY7 G;  3TN2 A;  1LUZ A;  2TMP A;  3X3M A;  2ZJR A;  4IUQ A;  4LJZ C;  1A6X A;  3V2T A;  4N9P A;  4NXM Q;  1STY A;  1Q8I A;  1HHV A;  5KGU A;  1XMO L;  3KF8 A;  1TU2 B;  3MFG A;  1J8I A;  4PMC A;  3HOZ G;  4IPH A;  3M85 A;  2B63 B;  5D3I B;  3GQB A;  1SE3 A;  5IYC G;  1VQN A;  1FYC A;  1X32 A;  1V1O A;  1WTQ A;  4F87 A;  4GN5 A;  4JBW A;  4L63 B;  4X3S A;  2E2H H;  1B9N A;  3OWF A;  3TSS A;  1D1I A;  4IAL A;  4FXG C;  2NN6 I;  4A3F B;  1SNP A;  3S1M H;  4A3F G;  1XMO Q;  3RN2 A;  1RIP A;  1TT2 A;  3H0G B;  4NB3 A;  5K5P A;  1HJP A;  4A3D G;  2M2L A;  1TVX A;  5EKI A;  3K8A A;  2F0K A;  1HQR D;  3PGZ A;  1SYF A;  4DV1 Q;  4JK1 C;  4TVA B;  3MAQ A;  2JA5 G;  2F0W A;  4LFB Q;  3WOE A;  4EVO A;  1CTM A;  4DXF A;  1M90 C;  1EY4 A;  3GTM B;  4JI7 Q;  3DUZ A;  3PIO 3;  2Y0S B;  4A3I H;  1SAP A;  5M5Y B;  2DUD A;  3PO2 G;  2UXD Q;  1PRT C;  4DR3 L;  4DF7 A;  1GKH A;  4HMJ A;  2ZJP A;  4JI8 L;  3CME A;  2OEO A;  1U5K A;  2EE1 A;  2EYJ A;  1XTD A;  4UPA A;  1Y8N B;  3GTJ H;  1TWA H;  5M3F G;  2HUG A;  5M3F B;  2Z1C A;  3HOY G;  1C9O A;  3KK7 A;  4X3T A;  2K03 A;  4QQB X;  5EBC A;  1CQF A;  4DK1 A;  5IYB H;  1MSG A;  5IGB A;  4BBS H;  1B70 B;  3K5L A;  1WTV A;  3DXJ C;  4NMZ A;  1HR0 L;  2IX0 A;  1ROD A;  1RDP D;  2JA7 H;  2XRQ D;  4RHS A;  1R9T H;  2FFK B;  3MXN B;  3PUW A;  1KLG D;  3GV3 A;  1N32 Q;  4L5T A;  2JXM B;  1XMQ L;  4R9W A;  2QIL A;  2ASB A;  1S5C D;  4JYA L;  3D4W A;  1KC8 C;  4JI3 L;  3NP8 A;  1AZQ A;  2EY1 A;  4JVZ A;  3RUZ A;  5C44 B;  4CBV A;  2UUC L;  1I94 Q;  1CSP A;  3OIP A;  2R92 B;  4OEM B;  1BO0 A;  3BDC A;  4R4I A;  5KEE A;  4R4O A;  3BDO A;  4Z9C B;  5FO9 B;  2I0Q A;  2RCF A;  1E2V A;  1STE A;  4K8J A;  1N33 Q;  1D7Q A;  4C3I H;  3OOC A;  2B63 H;  5EPL A;  4BY1 H;  2CFM A;  2XRS D;  5C3E B;  4Q5V A;  3I73 A;  1NY4 A;  3M4Y A;  5IYB G;  1PFN A;  4DV0 Q;  2AQ3 B;  4EQN A;  1GUT A;  3TQY A;  2BCO A;  1K73 C;  1RTN A;  2JA6 G;  4FP5 D;  2YV5 A;  5HY6 A;  1VQO A;  3FEW X;  5JEA G;  4KN4 C;  2E5L L;  3G4S A;  2A6H D;  5I6Y A;  2QDL A;  1QUQ A;  1N32 L;  2L4N A;  4BBS B;  2G9H D;  4JOI C;  4QGU A;  1VQE A;  1VQ9 A;  1S5D D;  3EN2 A;  4DA2 A;  4X62 L;  5M5W B;  1WTH A;  3D6W A;  4GN4 B;  3CRK C;  5EAY A;  3TRZ A;  4IO9 A;  1SXT A;  5GAD C;  4YCV A;  2E76 C;  4IUR A;  4LF5 Q;  3A54 A;  2C35 B;  3F2C A;  1XJV A;  3ULJ A;  1LO5 D;  2KHI A;  5LL6 X;  4Y52 H;  3H94 A;  1MJE A;  5C6A A;  3VYS A;  1IBL L;  1G91 A;  1L1O C;  4QF4 A;  5I6W A;  3TP5 A;  3CC7 A;  2WP8 J;  1LTS D;  4U68 A;  1EU4 A;  1X9N A;  1CA6 A;  5GAE C;  1F2Z A;  1TS2 A;  3QG1 A;  1JCK B;  3PIP A;  3CXC A;  1BBU A;  3Q24 A;  5I9P A;  3URY A;  2HQL A;  1ZEQ X;  3GTG B;  4JI5 Q;  2F0M A;  4FF1 A;  2YTY A;  2QDB A;  3W5O A;  5JJL A;  2F4V L;  4K5X A;  3A5Z B;  1VQC A;  4PV1 C;  1YNJ C;  3P20 A;  3HOU H;  4L5S A;  4A3B G;  1EY6 A;  4L5Q A;  4DNT B;  2F0N A;  3KDF B;  5C4H A;  2F0Q A;  3OIQ A;  2ZTC A;  3C2P A;  2RSN A;  1I4R A;  3VR4 A;  1U4R A;  4AYB G;  3TP7 A;  3KJO A;  5AFW A;  1SNO A;  1UE1 A;  1YBY A;  2KHS A;  1XX8 A;  3QO2 A;  1Y14 B;  2Z6K C;  4AYB B;  1PH4 A;  5JJI A;  3HP3 A;  4IQZ A;  4BBS G;  1Z9F A;  1PTO H;  1A0I A;  2EYL A;  1DD2 A;  3KJP A;  2E75 C;  1QG7 A;  1G2S A;  1IBM L;  4LFC Q;  3ITP A;  1NCV A;  1M1K C;  1EU3 A;  2JA8 H;  1KDA A;  3DM3 A;  3I4M H;  5TSS A;  2KCM A;  1I3Q B;  2KJX A;  3G7L A;  5ELC A;  3EVQ A;  5AJ3 Q;  4ULL A;  1LT5 D;  3S24 A;  4JI6 Q;  2SNM A;  1JIC A;  3KLR A;  4LFB L;  2K5Q A;  4GOP B;  4KKU A;  4A3I G;  1EYG A;  1B3A A;  4A3M H;  2D2C C;  1D5Z C;  2AWN A;  4C3I G;  3GTO H;  2DN8 A;  3M7G A;  1RTO A;  4NXN L;  2KVM A;  2WIN B;  3MXP A;  5L37 A;  2C5C A;  1LTB D;  2F0G A;  3H91 A;  4HAE A;  4G7H C;  2LXJ A;  1RHP A;  4A3D H;  2BDO A;  1FVI A;  2RCN A;  4A3M B;  1RF2 D;  1X3F A;  3CD6 A;  4H7B A;  4GZY C;  2NB0 A;  3J81 E;  4IJH A;  1CFM A;  1EIG A;  1YI2 A;  3L7Z C;  4BY7 B;  1S72 A;  3UDI A;  1D5X C;  1KQS A;  4CDF C;  5D14 A;  5M5Y H;  2K5H A;  4CKE A;  2IWH A;  4DR4 Q;  2PNH A;  1W6K A;  4GKK Q;  2X69 A;  4DV6 Q;  4QJF A;  2VUM B;  4C3H B;  2VB2 X;  1EWH A;  1KAW A;  5I2Y A;  4DUY Q;  5CV5 A;  3J80 L;  3MXG A;  4RGM A;  4KMU C;  5JPN C;  3L2P A;  1SJH D;  4B3M Q;  1GUG A;  5T1I A;  2AQ1 B;  2JEB I;  1J6Q A;  2JA9 A;  1KRT A;  3J81 c;  2NVT H;  2EOT A;  2QCP X;  1DYQ A;  3RZO B;  4DV2 L;  3SGI A;  5FJ8 H;  1OXU A;  1YJ9 A;  3GDE A;  4LF9 L;  2F0H A;  5NUC A;  4G7O C;  4A3B B;  4DR5 Q;  4YWM A;  1D1K A;  4KN7 C;  3KYH C;  3D8G A;  1GUS A;  2A8V A;  1ENF A;  2XNA C;  1FGU A;  1T9H A;  4K14 A;  3PQI A;  3S14 B;  3WOF A;  2L5T A;  1WVL A;  3QIA A;  2UUB Q;  5M3M H;  2AUJ D;  4MTN A;  1EWI A;  2K32 A;  1HXY D;  1U4L A;  1JWU D;  5KNB A;  2F0V A;  1O80 A;  2RF4 A;  2ZTD A;  4CDC C;  1K8A C;  2I07 B;  4A93 G;  1NAP A;  4DV6 L;  4ID6 A;  1PRT B;  1KTK A;  5JAV A;  3W1B A;  1EZ8 A;  3G71 A;  1AE3 A;  3J7A V;  3NE5 B;  3PSI A;  1VCI A;  4LF8 L;  5JJK A;  2I5H A;  5ELE A;  3VA5 A;  4PMW A;  1S3O A;  2UXC L;  1J9O A;  2KEC A;  1DON A;  2Q2U A;  1LV9 A;  1HNX Q;  1X3G A;  2OF1 A;  3ZYY X;  2Y0S G;  4JBM A;  3IKJ A;  3ERQ A;  3HOY H;  4K6D A;  2K52 A;  4A3G G;  3TME A;  4HCS A;  2EZV A;  4I7A A;  1UNS A;  2ICI A;  4S3S A;  4KY7 A;  4B9W A;  4X66 L;  4HJ8 A;  2E74 C;  5BN5 A;  1H9S B;  1EY8 A;  1S5F D;  2EYH A;  2KED A;  4UY8 C;  1HNZ Q;  1X65 A;  5JJZ A;  2VL6 A;  4DK0 A;  1I4P A;  1EIY B;  5DAU A;  4HR7 B;  1EIF A;  2A74 C;  1JJC B;  1DOM A;  1SMY C;  1YNJ D;  2Z9H A;  3J81 i;  3S14 H;  5KYI A;  1DJR D;  4GLX A;  5ELF A;  3CP0 A;  1CM9 A;  4OO1 H;  4JBK A;  4XYQ A;  4JV5 L;  4IFD H;  2D9U A;  2JK8 A;  2DNE A;  4C3H G;  1KIX A;  3JAM i;  1T5X D;  2OCE A;  3A56 A;  3TZD A;  1EY5 A;  4LF4 L;  4GN3 B;  1HZC A;  1NNX A;  4MIU A;  3G6E A;  4DV7 Q;  1PZJ D;  1PYS B;  3S16 B;  4JCV E;  3HKZ G;  2B2U A;  3S15 B;  3RMH A;  2EPB A;  3BDL A;  4DPG A;  4HIO A;  3HKZ E;  1QJO A;  4J15 A;  2HIV A;  5CC4 A;  1QB5 D;  5IP9 H;  4DK3 C;  4P71 A;  2K5W A;  1STH A;  1TKW B;  5C4X H;  1X54 A;  1IYV A;  3A5U A;  4E6I A;  2HDM A;  2DY8 A;  3BS1 A;  2E8G A;  3FMC A;  1XYI A;  1KXL A;  1V43 A;  1YVC A;  5DLQ E;  3CCS A;  2LFN A;  2UU9 Q;  3PUZ A;  4AIM A;  5H1S E;  2F3V A;  2VS1 A;  1WTP A;  1VQ7 A;  3GTK H;  1VQJ A;  2HT1 A;  1K83 H;  1WYD A;  3NEN A;  2E2D C;  5J22 A;  5I2X A;  1CHQ D;  5KND A;  2GN5 A;  5JVG 3;  4FXD A;  3AU7 A;  2EVB A;  1O78 A;  2F0I A;  4LF8 Q;  3G6J B;  1XPR A;  3I4N B;  1ILP A;  2YU9 B;  1GO3 E;  3E3X A;  5IT9 E;  1LT3 D;  1SEB D;  4DR3 Q;  4M8A A;  5A2Q L;  5C4Z A;  4X65 Q;  3RLF A;  2OWO A;  4POG A;  1OXS C;  3F2U A;  2V1C C;  2MHV A;  4CDD C;  4U67 3;  1NSN S;  1OXT A;  4EGV A;  1E1T A;  4A3B H;  3Q0A A;  3UE1 A;  4DU9 A;  1JWS D;  3AYH B;  5I9O A;  5EKK A;  5KIX A;  4IN3 A;  3CPW A;  1VQ5 A;  1STB A;  1TWC H;  2KQ3 A;  5IGD A;  4B3M L;  3CCJ A;  3DLL A;  3RZD H;  1K9M C;  3IL8 A;  2QEX A;  4A3L H;  4LK1 C;  4TQU S;  4ZUI A;  3S16 H;  1KAB A;  4KY5 A;  4O2D A;  1X3Q A;  3X3N A;  2HHH Q;  1KNA A;  4R8I A;  2F03 A;  2NTT A;  1PRT F;  1FD7 D;  2F0T A;  1BUV T;  4XT3 B;  4ZKC B;  4KHP L;  3HZX A;  1ESR A;  1VMC A;  5I4D A;  5IGE A;  3RD4 A;  2K75 A;  4YY3 L;  4A3I B;  1PLF A;  1K3R A;  3H15 A;  1W3S A;  2VW9 A;  2B63 G;  3GTQ B;  5E7N A;  1CHP D;  2NTS A;  4OGQ C;  1MJC A;  2RQX A;  3WWV A;  3GTO B;  2PW7 A;  5CV7 A;  1N36 Q;  4ILW A;  4RH6 A;  3R2I A;  3DWA A;  1HQM C;  4R4T A;  1B3Q A;  2RDF A;  3HOV H;  4HIM A;  4JI5 L;  2JA7 G;  2ZXO A;  5FO8 B;  4HMI A;  1R4Q B;  4JI7 L;  4QUC A;  2I5L X;  2WFW A;  1X55 A;  1U9R A;  4KHV A;  2X6G A;  3J81 j;  1SNC A;  2KCC A;  2K4K A;  5CR3 A;  4CJ2 C;  2NZ1 D;  2WB1 G;  2IHF A;  1EL0 A;  1SSO A;  4DAP A;  1YHQ A;  2PW5 A;  5ISR A;  1IL8 A;  2BDN A;  1KDB A;  4NP5 A;  5C0X G;  2F0U A;  3IFD A;  5A2Q E;  3S17 B;  2EY6 A;  1HZ9 A;  4JG2 A;  3R2T A;  5M9O A;  1MBY A;  3IFT A;  3JC6 6;  4A3E G;  3NBH A;  1YIT A;  1I94 L;  4RGO S;  2NYZ D;  4K2L A;  2R7Z G;  1B8A A;  1KLU D;  1MIU A;  2IL8 A;  2GVB A;  3S1Q B;  4FYD A;  1ENA A;  2PMZ B;  1AW7 A;  5FJ8 G;  4N8F A;  5IOD A;  4RCO A;  3T16 A;  4GNX B;  1EQV A;  3GTG H;  1JWM D;  1PH1 A;  1GOZ A;  2K5N A;  1F9P A;  3L0O A;  3AFQ A;  1CI3 M;  1EY7 A;  1BBX C;  2SEB D;  3I2Z A;  3LWU A;  4BS9 A;  1N9W A;  3RR5 A;  3K5M A;  1STG A;  2PPB C;  4UP9 A;  3FPP A;  1GUN A;  2B2W A;  2EYM A;  3DWP A;  2CW0 D;  2YYZ A;  2B2T A;  1DOL A;  2R7F A;  1H9S A;  5G3L D;  3SHL A;  2F0P A;  4ZLT F;  3PO2 B;  1YHA A;  1L0Y B;  3KBG A;  1UEB A;  2B29 A;  2KBN A;  2HQE A;  5C3W A;  4H44 C;  3FKI G;  3SEB A;  1CZW A;  4X62 Q;  4P72 A;  4JC0 A;  4C56 C;  4DV0 L;  4DR7 Q;  1CKO A;  4RWS C;  4BA1 I;  3M3Y H;  1QNU A;  5G3L F;  3S1N H;  4ZAI A;  4P73 A;  4DR6 Q;  2A1A A;  4K6L A;  4XQJ A;  1Q12 A;  3MEH A;  3K58 A;  1VQK A;  1A3T A;  3ER0 A;  3PUY A;  3NQI A;  4LUO A;  5EJW A;  1V8Q A;  4KI0 A;  1C0A A;  3ND8 A;  1JJ2 A;  1K8O A;  2DNC A;  1TS4 A;  3E0J A;  1NMG A;  1B2T A;  3AB9 A;  1D8L A;  2BA1 A;  1V9P A;  5IWA Q;  2LSS A;  2D0O A;  1U4P A;  3J7A 5;  1EY9 A;  2KCT A;  1TXY A;  4OHJ A;  3TRE A;  3SVM A;  4A76 A;  1XMQ Q;  1HA5 A;  3SK4 A;  3I56 A;  1W2B A;  4RKB A;  4FF2 A;  2E2H B;  2JEA I;  1H9K A;  3R3O A;  1H9M A;  3H3V I;  4MNO A;  3HFZ B;  2RHQ B;  4OWW B;  3J7A F;  1JC7 A;  5C5M A;  3I91 A;  4B3T Q;  1QE6 A;  1CKN B;  4UHV A;  1TQO A;  4MHE A;  3I90 A;  2CQA A;  5T1G A;  1WTR A;  3T51 B;  1O7L A;  1H95 A;  4A3M G;  2LY7 A;  1DM0 B;  3PCO B;  4P2C B;  4JI1 L;  2JA7 B;  2KEE A;  1A15 A;  1BVS A;  1Q3L A;  1PFS A;  3S15 H;  3HKS A;  1PH9 A;  5EKL A;  4NKL A;  1YNN D;  2F0J A;  5BN3 A;  3CCU A;  4C3I B;  4GNX A;  3G48 A;  4M1U B;  2CWP A;  2R7Z H;  1G8Z D;  2E2I B;  1MSH A;  3NWS A;  3NTI A;  5DM7 3;  4DV1 L;  3MXU A;  3KUP A;  3D0F A;  5FLM G;  4POF A;  2UUB L;  2F0F A;  1EOV A;  4MZ9 A;  5IY0 A;  3H0G G;  1I4X A;  4GKJ Q;  3S2D H;  2B8F A;  3K7A H;  2FXQ A;  2NWG A;  2QA4 A;  1PH7 A;  1UUP A;  4Y7N H;  4RAU C;  5LL6 S;  2H1E A;  2KA7 A;  3FVQ A;  2N55 A;  1EEF D;  2R7D A;  4A3J H;  5C3E H;  1VQI A;  3PUX A;  2ES2 A;  4GOP A;  2PNR C;  1PV4 A;  1I4H A;  3K57 A;  1Y1V H;  1JMC A;  2PZT A;  1L0W A;  3MZ5 A;  4KV6 A;  1JB3 A;  4ODG A;  4C3H H;  1JT8 A;  4YHH L;  2R93 B;  1YZ6 A;  3I7F A;  2R6G A;  2UXB Q;  1EQR A;  5C5L A;  2YU9 H;  2M00 A;  3CF5 A;  2F1M A;  2VB3 X;  1GHJ A;  1PFM A;  1TWF B;  2RKS A;  4O42 A;  4GKK L;  1YHB A;  4RHR A;  4C1N K;  2AWO A;  1J5E Q;  3R93 A;  1LT4 D;  1TY2 A;  1TR5 A;  2F0S A;  2Y0S E;  4QL5 A;  4KKS A;  3HOV G;  5C0X I;  3F1Z A;  4FO2 A;  1PH2 A;  1Y1W H;  1UE7 A;  4DV2 Q;  1CKM A;  4R4Q A;  2NVY H;  1PFB A;  4DR4 L;  3M3Y B;  4ZUJ A;  4A3K H;  1SRO A;  4DV5 L;  3SR1 A;  1Q8K A;  2K5D A;  4DUY L;  3BVG A;  4A3J G;  3KBX A;  4YCU A;  3S1Q H;  4APV A;  2BOS A;  1SRU A;  4RGT A;  2WII B;  4GLA C;  5ELD A;  1DOK A;  1Z6H A;  2RBM A;  4WFN 3;  3FRP B;  4OX9 L;  1F9Q A;  1BCP D;  3DMU A;  2WAQ B;  3OW2 A;  4X65 L;  1I6V C;  3MTS A;  4XIG S;  4JW0 A;  3NHH A;  4ZQ3 A;  4QMG A;  2PZU A;  3I4M B;  4F88 A;  2C9O A;  3HS0 C;  1YJN A;  3FKI H;  2E2J H;  4IZ8 A;  1L0X B;  2F0E A;  1VF7 A;  3CCE A;  2O4X A;  1RCV D;  4HCE A;  1SFO B;  2TSS A;  2F0O A;  1J5E L;  1E7Z A;  1EOT A;  1KHI A;  2WKD A;  2JE6 I;  2NVT B;  3IAY A;  3S2D B;  3OPO A;  4UDU C;  3V96 A;  3TBI B;  2PZW A;  4O1N A;  2D0P A;  5C4J B;  1BQQ T;  4B3T L;  3PO3 H;  2VQF Q;  1PDQ A;  1WI5 A;  4P75 A;  4B3S Q;  3KLS A;  1LAB A;  4IJL A;  1K28 A;  2HCI A;  4JI6 L;  2R92 H;  3CW2 C;  5CV4 A;  2ZXP A;  2K5V A;  2PO4 A;  4GKJ L;  3CCQ A;  2F3W A;  3ZJY C;  5IGF A;  4X64 Q;  1Y1V B;  2AUK A;  4C2M B;  2Q2I A;  3CC2 A;  2NZO A;  4YWK A;  1MKH A;  5LMN W;  4IPC A;  1VQP A;  1Y1V G;  1RJT A;  2EY2 A;  2XIW A;  1BXT A;  5EPK A;  3NBI A;  3M4Q A;  4HJ5 A;  2F52 A;  1EY0 A;  3NWT A;  1IBK Q;  5CV8 A;  1SYC A;  1H9J A;  2QEJ C;  4BBR B;  3OHX C;  3BZK A;  2KEN A;  4F8M A;  1IBL Q;  5IGG A;  1N34 L;  4R4C A;  1G6Z A;  4CGY B;  3GTL H;  4HID A;  2BE5 D;  2SOB A;  3CMA A;  5IWA L;  4DV4 Q;  1GD7 A; 
#chains in the Genus database with same CATH homology
 4XQN A;  2A73 B;  4QIW B;  4IUP A;  2B2Y C;  2SDF A;  5CYU A;  2A6H C;  3NUC A;  4KY6 A;  1DCZ A;  1ICW A;  2BA0 A;  5M3M B;  2XWB B;  4CKC A;  1O7Y A;  4XT1 B;  1PTO C;  3LWE A;  1ZXT A;  1PRT D;  1Z7T A;  5IT9 L;  3PO3 B;  2K04 A;  2WV6 D;  1QIL A;  4OO1 G;  3EJI A;  2EY5 A;  2X6L A;  3MVV A;  4V0B A;  3SDZ A;  5CBE E;  3EA6 A;  3FKI B;  1BCP F;  2E2J B;  3K5O A;  1QNK A;  4C1N I;  2Z4I A;  2Q8T A;  1FNU A;  2PQE A;  1FGB D;  2Q8I B;  1HUN A;  4DGZ A;  2IW3 A;  1Z47 A;  4KKT A;  1CT1 D;  4NDX A;  1HCZ A;  1BR9 A;  1BCP B;  3CRL C;  1EEI D;  2NVY B;  5HGT A;  3GTK B;  3NXW A;  3A55 A;  5ELB A;  1Q1B A;  1TS5 A;  4QCL A;  3MWY W;  4KD4 A;  2LS0 1;  2JA8 B;  2B2W C;  3GO5 A;  1BCP C;  2B2T C;  4HN7 A;  3ND9 A;  5M5X B;  1TWG B;  1JR0 D;  1K8M A;  2PYK A;  3V05 A;  3JAM L;  3HOZ B;  1YNN C;  3N6R A;  2HCC A;  4WRD A;  1M8A A;  1S4Z A;  1K83 B;  3P7J A;  3VR3 A;  1AN8 A;  5CV6 A;  3CQZ B;  3A7L A;  4XDX A;  3T53 B;  3VA7 A;  3T4A C;  1V1P B;  2WKC A;  2R3Z A;  3J81 L;  3Q23 A;  5C0X H;  4EQO A;  1EWC A;  1LAC A;  3FDT A;  5FLX E;  1SE2 A;  1E2Z A;  3E5S A;  1SNQ A;  1Y69 U;  1CZG A;  2CHB D;  3N52 A;  3ONA B;  1I6H B;  4PQX A;  3D4D A;  3D3R A;  3NTH A;  5D65 A;  1TY0 A;  3K7A B;  4ZRZ A;  5FOB B;  1FNV A;  2EDG A;  1STA A;  1I4Q A;  2M9V A;  2IT1 A;  2NBF A;  3W3A A;  4HSV A;  2K33 A;  2L11 A;  1PXU A;  3A7A B;  1BDO A;  2RVL A;  1ENC A;  1PZI D;  1TWH B;  1ET6 A;  4OIK A;  5FKA C;  4Y7N B;  4N9T A;  1PTO F;  1MI2 A;  1IKM A;  3VYR A;  2B2V C;  2A5H A;  1EYA A;  4OO1 I;  5EBD A;  1I50 B;  2B39 A;  2JA6 B;  2BE5 C;  4I7Z C;  5E4W C;  4K2K A;  5C4X B;  2FMM A;  4IUU A;  3I8Z A;  1NR4 A;  4H13 C;  3U9S A;  3RZD B;  3SK8 A;  2XSC A;  3TP6 A;  3A8I E;  3BG3 A;  2XN9 C;  1JOO A;  5CBA E;  1HFG A;  4NW2 A;  4ZYS A;  1SDF A;  2L12 A;  1SBB B;  3S9W A;  1AFP A;  1JOR A;  1ZKO A;  2RDH A;  4BY1 B;  1FNW A;  4B9X A;  1B53 A;  1VDZ A;  2EJF C;  5KRU A;  1DZ1 A;  2KUM A;  3ERO A;  2NVX B;  3SXH A;  2K6A A;  4QB4 A;  1HUM A;  1F9S A;  1BOS A;  5DEH A;  3HOV B;  1LT6 D;  4J8Q A;  5E1F A;  1GUO A;  2RSO A;  3D31 A;  5IIF A;  4XXE A;  3HOX B;  4RGN A;  4A3K B;  3DHQ A;  4J1M A;  4PNY A;  5EPJ A;  1E0B A;  3J80 E;  3BYY B;  1Q90 A;  3KLS X;  1B4O A;  4OIJ A;  1ESF A;  2F0D A;  2FMC A;  1B50 A;  1TII D;  3MHB A;  2L1B A;  4CJ1 B;  1C4Q A;  1H9R A;  4ME5 A;  4Q0F A;  1WCM B;  5IOC A;  2QF7 A;  3NTK A;  2IX3 A;  1ET9 A;  1SNM A;  1LLR D;  4K8I A;  2AQ2 B;  1NUC A;  3VYT A;  1FR3 A;  3OMC A;  3UI2 A;  3H3V C;  3Q22 A;  1DXM A;  2RDG A;  2NUC A;  2JSO A;  3U9O A;  1X3P A;  2B2Y A;  1AEX A;  2JP1 A;  5DM6 3;  1IKL A;  5C0X J;  2QKI C;  2K1B A;  4KJN A;  2Q8R E;  2MJ8 A;  3K59 A;  1WTW A;  4V19 0;  1RD9 D;  1SYE A;  3CHB D;  2IPK D;  5FK9 C;  1O7Z A;  1LTI D;  3VR6 A;  2CVR A;  3BVZ A;  3SK5 A;  4HSP A;  5COR A;  4A3G B;  3OMG A;  1CQV A;  3CU7 A;  5D3D A;  3LNN A;  3MXN A;  4IUV A;  3LX0 A;  4RA8 A;  3SK6 A;  4XYO A;  3R8B A;  1WTO A;  2CW0 C;  1BNZ A;  1GUW A;  2B2U C;  3K6O A;  3GTJ B;  1A3U A;  2ZXR A;  4BA2 I;  4B08 A;  2MP1 A;  2J4X A;  4DAY A;  3VR2 A;  1GHK A;  5K36 H;  2ID0 A;  2WAC A;  3HG9 A;  1R9T B;  1QOH A;  4UAI A;  3C46 A;  1EQT A;  4MN3 A;  4L6T B;  2K28 A;  3K0Y A;  2PCF B;  1TWC B;  4G7Z C;  3QOL A;  4WJW A;  3GTP B;  2F4I A;  3A8K E;  3P1H A;  1PYW D;  1UEA B;  3HOW B;  4G57 A;  2EYO A;  1WTX A;  1KNE A;  3HOY B;  3C1E A;  1ZYR D;  1A2T A;  4XTC S;  5BN4 A;  4IFD G;  2FIN B;  1A2U A;  4RKL A;  5LHY 1;  5JVH 3;  4X3U A;  2L9H A;  1VMP A;  5FO7 B;  5K36 G;  2V4D A;  4A3E B;  3OW7 A;  4FNF A;  2Z8L A;  3I72 A;  3NQT A;  3DEO A;  1WD0 A;  2IX1 A;  1T5E A;  1ZYR C;  1IW7 D;  2XVS A;  4IFD J;  1S5B D;  2LMC B;  3TDQ A;  1GJX A;  1XTC D;  2EJG C;  2H4O A;  2GA4 B;  3I3C A;  1SYD A;  4KD3 A;  2F0L A;  3H6M A;  3QJY A;  1JQY D;  1SYG A;  1QWY A;  1SJE D;  1A3V A;  3BZD B;  1KAA A;  5C3X A;  1F9R A;  4WOR A;  4QUF A;  1IW7 C;  2MUY A;  4ZK9 B;  4TRD A;  4X3K A;  5FLX L;  1LTA D;  3S1M B;  2A68 C;  3E6Z X;  2J0T D;  1F77 A;  3QB3 A;  2EYP A;  4HED A;  1SE4 A;  4CJ0 B;  3DWQ A;  3HEJ A;  4ABN A;  5KYL A;  2ZT9 C;  1PTO B;  1QCB D;  4IUT A;  3NK9 A;  5DNF A;  1D2B A;  1AP0 A;  2K01 A;  2FHT A;  1E2W A;  3PUV A;  3S1N B;  2OXP A;  3SE0 A;  2A6E C;  3VR5 A;  4CHT B;  3DM1 A;  4YIJ A;  3O13 A;  1HFN A;  3I70 A;  2HDL A;  5A35 A;  2VNU D;  2J7Z A;  1PTO D;  3C1F A;  3TZU A;  2DY7 A;  1XWE A;  5COY A;  2SNS A;  2B2V A;  5JPM C;  4F7X A;  5CGK A;  5IGC A;  1GXD C;  2NN6 G;  1MD2 D;  2O5J C;  3BYT B;  3S2H B;  5EGT A;  4A93 B;  3BVM A;  3PIP 3;  3M4O B;  1SMY D;  1NR2 A;  3J7Y W;  2JA5 B;  4FXK C;  2A69 C;  2EXZ A;  1JOK A;  2OT2 A;  3NSW A;  1SYB A;  4KHZ A;  3HOU B;  2D5D A;  1W6J A;  5E3F A;  2N88 A;  1PZK D;  5JEA J;  4DXG A;  1ONL A;  4FF4 A;  2L55 A;  3TP8 A;  2A6E D;  2EYF A;  1TS3 A;  2VXW A;  3PMF A;  5E4X A;  1Y8P B;  2MPM A;  3P75 A;  2KOL A;  3NPP A;  2K05 A;  4R8N A;  5EQ0 A;  3K5N A;  3I4L A;  1LTG D;  4LMQ D;  2EJM A;  1CA5 A;  5JOB A;  1VF5 C;  4KK7 A;  3HRZ C;  3L9A X;  1C48 A;  1RKN A;  4HTH A;  4K5W A;  3W2D A;  4RCN A;  1IYU A;  2B8G A;  1Y1W B;  3L3O C;  1WD1 A;  5F2D A;  4KJO A;  3OWE B;  3D4R A;  3H09 A;  1I4G A;  1LTR D;  5KNC A;  1C8C A;  2A69 D;  4DNR B;  1G2T A;  3QOJ A;  1ILQ A;  4EQP A;  1II3 A;  4C3J B;  3GTL B;  4DN4 M;  3A8J E;  1EYD A;  2Z4H A;  1JE4 A;  4L8J A;  1OXV A;  5CV9 A;  3OSO A;  2MGS A;  3EQL C;  2NN6 H;  4XQQ A;  4A3J B;  1F2L A;  3M7N A;  3PV0 A;  1EYC A;  4K5V A;  1R4P B;  4LAA A;  4KTA A;  4I65 A;  2JYO A;  3WDN A;  1XXG A;  5HUR A;  1S5E D;  2A68 D;  1CK1 A;  2R61 A;  3MC0 B;  1JOQ A;  1ML0 D;  3HKZ B;  1Y8O B;  3GV6 A;  3QWN A;  3T13 A;  2L0C A;  4J6H A;  3FPU B;  2LKV A;  4ZKB B;  3T56 B;  1HA6 A;  1OXX K;  5CMD A;  1BF4 A;  1B44 D;  1U4M A;  1HPC A;  1HTL D;  1AZP A;  1PMR A;  2I46 A;  1LTT D;  2R7Z B;  3MFY A;  1TWA B;  1HTP A;  1V1P A;  5J39 A;  3AMU A;  1F2Y A;  1HRJ A;  2IJ0 A;  3HGB A;  1IHZ A;  4FVM A;  1D6E C;  1STN A;  5J1Z A;  2K7V A;  1EFI D;  4G4K A;  2WB1 B;  1Q1E A;  1EIH A;  1D5M C;  4IUN A;  2NVQ B;  4DAV A;  4PMB A;  3MA2 B;  4FF3 A;  1OO9 B;  2RA4 A;  3C3L A;  3VYU A;  3GD7 A;  1B1Z A;  3JAM E;  2ENB A;  1UAP A;  3Q6S A;  1G29 1;  2FJ2 A;  4RFB A;  3DEP A;  4TKO B;  4CKB A;  4C3J G;  1SND A;  4TSS A;  4A3D B;  1KDC A;  4DFA A;  3S1R B;  4OL7 A;  1EZ6 A;  3GP7 A;  4BWG B;  4IFD I;  1F2M A;  3EFX D;  5JEA H;  2G9D A;  3CKI B;  2O5I C;  4H0L C;  2XWJ B;  3D6C A;  2ICE C;  1MGS A;  2D62 A;  1M4V A;  2O2L D;  2KCN A;  1B9M A;  3TN2 A;  2TMP A;  3X3M A;  4IUQ A;  4LJZ C;  1A6X A;  3V2T A;  4N9P A;  1STY A;  1Q8I A;  1HHV A;  5KGU A;  3KF8 A;  1TU2 B;  3MFG A;  1J8I A;  4PMC A;  3M85 A;  2B63 B;  5D3I B;  3GQB A;  1SE3 A;  1FYC A;  1X32 A;  1V1O A;  1WTQ A;  4F87 A;  4JBW A;  4L63 B;  4X3S A;  1B9N A;  3OWF A;  3TSS A;  1D1I A;  4IAL A;  4FXG C;  2NN6 I;  4A3F B;  1SNP A;  1TT2 A;  3H0G B;  5K5P A;  2M2L A;  1TVX A;  5EKI A;  2F0K A;  1HQR D;  1SYF A;  4JK1 C;  3MAQ A;  2F0W A;  3WOE A;  4EVO A;  1CTM A;  4DXF A;  1EY4 A;  3GTM B;  3DUZ A;  3PIO 3;  2Y0S B;  1SAP A;  5M5Y B;  1PRT C;  4DF7 A;  4HMJ A;  2OEO A;  2EE1 A;  2EYJ A;  1Y8N B;  2HUG A;  5M3F B;  2Z1C A;  3KK7 A;  4X3T A;  2K03 A;  5EBC A;  1CQF A;  4DK1 A;  1MSG A;  5IGB A;  1WTV A;  3K5L A;  3DXJ C;  4NMZ A;  2IX0 A;  1ROD A;  1RDP D;  2XRQ D;  4RHS A;  2FFK B;  3PUW A;  1KLG D;  3GV3 A;  2JXM B;  4R9W A;  2QIL A;  1S5C D;  3D4W A;  3NP8 A;  1AZQ A;  2EY1 A;  3RUZ A;  5C44 B;  4CBV A;  3OIP A;  2R92 B;  1BO0 A;  3BDC A;  5KEE A;  3BDO A;  4Z9C B;  5FO9 B;  1E2V A;  1STE A;  4K8J A;  3OOC A;  5EPL A;  2XRS D;  5C3E B;  4Q5V A;  3I73 A;  3M4Y A;  1PFN A;  2AQ3 B;  4EQN A;  1GUT A;  2BCO A;  1RTN A;  4FP5 D;  3FEW X;  5JEA G;  4KN4 C;  2A6H D;  5I6Y A;  2L4N A;  4BBS B;  2G9H D;  1S5D D;  4DA2 A;  5M5W B;  3D6W A;  3CRK C;  1SXT A;  2E76 C;  4IUR A;  3A54 A;  1LO5 D;  5LL6 X;  3H94 A;  5C6A A;  3VYS A;  1G91 A;  4QF4 A;  5I6W A;  3TP5 A;  2WP8 J;  1LTS D;  4U68 A;  1EU4 A;  1CA6 A;  1F2Z A;  1TS2 A;  3QG1 A;  1JCK B;  3Q24 A;  5I9P A;  3URY A;  1ZEQ X;  3GTG B;  2F0M A;  4FF1 A;  2QDB A;  4K5X A;  4PV1 C;  1YNJ C;  3P20 A;  1EY6 A;  4DNT B;  2F0N A;  5C4H A;  2F0Q A;  3OIQ A;  3C2P A;  2RSN A;  1I4R A;  3VR4 A;  1U4R A;  3TP7 A;  5AFW A;  1SNO A;  2KHS A;  1XX8 A;  3QO2 A;  4AYB B;  3HP3 A;  4IQZ A;  1PTO H;  2EYL A;  1DD2 A;  2E75 C;  1QG7 A;  1G2S A;  3ITP A;  1NCV A;  1EU3 A;  1KDA A;  5TSS A;  1I3Q B;  2KJX A;  3G7L A;  5ELC A;  3EVQ A;  4ULL A;  1LT5 D;  2SNM A;  1JIC A;  3KLR A;  2K5Q A;  4KKU A;  1B3A A;  2D2C C;  1D5Z C;  2AWN A;  4C3I G;  2DN8 A;  3M7G A;  1RTO A;  2KVM A;  2WIN B;  3MXP A;  2C5C A;  1LTB D;  2F0G A;  3H91 A;  4HAE A;  4G7H C;  1RHP A;  2BDO A;  4A3M B;  1RF2 D;  4H7B A;  4GZY C;  2NB0 A;  3J81 E;  1CFM A;  1EIG A;  3L7Z C;  4BY7 B;  1D5X C;  5D14 A;  4CKE A;  2IWH A;  1W6K A;  2X69 A;  2VUM B;  4C3H B;  2VB2 X;  1EWH A;  5I2Y A;  5CV5 A;  3J80 L;  3MXG A;  4RGM A;  4KMU C;  5JPN C;  1SJH D;  1GUG A;  5T1I A;  2AQ1 B;  2JEB I;  2EOT A;  2QCP X;  1DYQ A;  3RZO B;  1OXU A;  2F0H A;  5NUC A;  4G7O C;  4A3B B;  1D1K A;  4KN7 C;  3D8G A;  1GUS A;  1ENF A;  2XNA C;  4K14 A;  3S14 B;  3WOF A;  2L5T A;  1WVL A;  3QIA A;  2AUJ D;  2K32 A;  1HXY D;  1U4L A;  1JWU D;  5KNB A;  2F0V A;  1O80 A;  2I07 B;  1NAP A;  4ID6 A;  1PRT B;  1KTK A;  5JAV A;  1EZ8 A;  3J7A V;  3NE5 B;  1VCI A;  5ELE A;  3VA5 A;  4PMW A;  1J9O A;  2KEC A;  1DON A;  1LV9 A;  2OF1 A;  3ZYY X;  3IKJ A;  3ERQ A;  4K6D A;  2EZV A;  3TME A;  4HCS A;  1UNS A;  2ICI A;  4S3S A;  4KY7 A;  4B9W A;  2E74 C;  5BN5 A;  1H9S B;  1EY8 A;  1S5F D;  2EYH A;  2KED A;  5JJZ A;  4DK0 A;  1I4P A;  5DAU A;  4HR7 B;  2A74 C;  1DOM A;  1SMY C;  1YNJ D;  5KYI A;  1DJR D;  5ELF A;  1CM9 A;  4OO1 H;  4XYQ A;  4IFD H;  2D9U A;  2DNE A;  4C3H G;  1T5X D;  3A56 A;  3TZD A;  1EY5 A;  4MIU A;  1PZJ D;  3S16 B;  2B2U A;  3S15 B;  3RMH A;  2EPB A;  3BDL A;  1QJO A;  5CC4 A;  1QB5 D;  2K5W A;  1STH A;  1TKW B;  1IYV A;  4E6I A;  2HDM A;  2DY8 A;  3BS1 A;  3FMC A;  1XYI A;  1V43 A;  2LFN A;  3PUZ A;  2F3V A;  1WTP A;  5J22 A;  2E2D C;  5I2X A;  1CHQ D;  5KND A;  5JVG 3;  4FXD A;  3AU7 A;  2EVB A;  1O78 A;  2F0I A;  3G6J B;  3I4N B;  1ILP A;  2YU9 B;  5IT9 E;  1LT3 D;  1SEB D;  4M8A A;  5A2Q L;  5C4Z A;  3RLF A;  1OXS C;  3F2U A;  2MHV A;  4U67 3;  1NSN S;  1OXT A;  4EGV A;  3Q0A A;  4DU9 A;  1JWS D;  5I9O A;  5EKK A;  5KIX A;  4IN3 A;  1STB A;  2KQ3 A;  5IGD A;  3IL8 A;  4LK1 C;  4TQU S;  4ZUI A;  1KAB A;  4KY5 A;  1X3Q A;  3X3N A;  1KNA A;  4R8I A;  2F03 A;  2NTT A;  1PRT F;  1FD7 D;  2F0T A;  1BUV T;  4XT3 B;  4ZKC B;  3HZX A;  5I4D A;  1ESR A;  1VMC A;  5IGE A;  3RD4 A;  4A3I B;  1PLF A;  3GTQ B;  1CHP D;  2NTS A;  4OGQ C;  2RQX A;  3GTO B;  2PW7 A;  5CV7 A;  4ILW A;  4RH6 A;  3R2I A;  3DWA A;  1HQM C;  2RDF A;  2ZXO A;  5FO8 B;  4HMI A;  1R4Q B;  4QUC A;  1U9R A;  4KHV A;  2X6G A;  1SNC A;  2KCC A;  5CR3 A;  4CJ2 C;  2NZ1 D;  1EL0 A;  1SSO A;  4DAP A;  2PW5 A;  5ISR A;  1IL8 A;  2BDN A;  1KDB A;  4NP5 A;  5C0X G;  2F0U A;  3IFD A;  5A2Q E;  3S17 B;  2EY6 A;  3R2T A;  5M9O A;  1MBY A;  3IFT A;  3NBH A;  4RGO S;  2NYZ D;  4K2L A;  1KLU D;  2IL8 A;  3S1Q B;  4FYD A;  1ENA A;  2PMZ B;  1AW7 A;  5IOD A;  4RCO A;  3T16 A;  1EQV A;  1JWM D;  1GOZ A;  1F9P A;  1CI3 M;  1EY7 A;  1BBX C;  2SEB D;  4BS9 A;  3LWU A;  3K5M A;  1STG A;  2PPB C;  3FPP A;  1GUN A;  2B2W A;  2EYM A;  3DWP A;  2CW0 D;  2YYZ A;  2B2T A;  1DOL A;  5G3L D;  1H9S A;  3SHL A;  2F0P A;  4ZLT F;  3PO2 B;  1L0Y B;  3KBG A;  2HQE A;  5C3W A;  4H44 C;  3SEB A;  1CZW A;  4C56 C;  4RWS C;  4BA1 I;  1QNU A;  5G3L F;  4ZAI A;  4K6L A;  3K58 A;  4XQJ A;  1Q12 A;  3MEH A;  1A3T A;  5EJW A;  3PUY A;  3NQI A;  1V8Q A;  4KI0 A;  3ND8 A;  1K8O A;  2DNC A;  1TS4 A;  3E0J A;  1B2T A;  3AB9 A;  2BA1 A;  1U4P A;  1EY9 A;  4OHJ A;  3SVM A;  1HA5 A;  3SK4 A;  4RKB A;  4FF2 A;  2E2H B;  2JEA I;  1H9K A;  3R3O A;  1H9M A;  3J7A F;  1JC7 A;  5C5M A;  3I91 A;  1QE6 A;  1TQO A;  4MHE A;  3I90 A;  2CQA A;  5T1G A;  1WTR A;  3T51 B;  1O7L A;  2LY7 A;  1DM0 B;  4P2C B;  2JA7 B;  2KEE A;  1A15 A;  1Q3L A;  5EKL A;  4NKL A;  1YNN D;  2F0J A;  5BN3 A;  4C3I B;  4M1U B;  1G8Z D;  2E2I B;  1MSH A;  3NWS A;  3NTI A;  5DM7 3;  3MXU A;  3KUP A;  2F0F A;  1I4X A;  2B8F A;  2NWG A;  1UUP A;  4RAU C;  5LL6 S;  2H1E A;  2KA7 A;  3FVQ A;  2N55 A;  1EEF D;  3PUX A;  2PNR C;  1I4H A;  3K57 A;  2PZT A;  3MZ5 A;  4KV6 A;  1JB3 A;  4ODG A;  2R93 B;  2R6G A;  5C5L A;  2M00 A;  2F1M A;  2VB3 X;  4O42 A;  1GHJ A;  1PFM A;  1TWF B;  2RKS A;  4RHR A;  4C1N K;  2AWO A;  3R93 A;  1LT4 D;  1TY2 A;  1TR5 A;  2F0S A;  4KKS A;  5C0X I;  4FO2 A;  1PFB A;  3M3Y B;  4ZUJ A;  3SR1 A;  2K5D A;  3BVG A;  3KBX A;  2BOS A;  4RGT A;  2WII B;  5ELD A;  1DOK A;  4WFN 3;  1Z6H A;  2RBM A;  3FRP B;  1F9Q A;  1BCP D;  3DMU A;  2WAQ B;  1I6V C;  3MTS A;  4XIG S;  3NHH A;  4ZQ3 A;  4QMG A;  2PZU A;  3I4M B;  4F88 A;  2C9O A;  3HS0 C;  4IZ8 A;  1L0X B;  2F0E A;  1VF7 A;  1SFO B;  1RCV D;  2O4X A;  4HCE A;  2TSS A;  2F0O A;  1EOT A;  2WKD A;  2JE6 I;  2NVT B;  3IAY A;  3S2D B;  3OPO A;  4UDU C;  3V96 A;  3TBI B;  2PZW A;  4O1N A;  5C4J B;  1BQQ T;  1PDQ A;  3KLS A;  1LAB A;  2HCI A;  5CV4 A;  2ZXP A;  2PO4 A;  2F3W A;  5IGF A;  1Y1V B;  2AUK A;  4C2M B;  1RJT A;  2EY2 A;  2XIW A;  1BXT A;  5EPK A;  3NBI A;  1EY0 A;  3NWT A;  5CV8 A;  1SYC A;  1H9J A;  2QEJ C;  4BBR B;  3OHX C;  4F8M A;  5IGG A;  1G6Z A;  4CGY B;  2BE5 D;  2SOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...