5IGBA

Crystal structure of staphylococcal nuclease variant delta+phs l36d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igbA00
4ID6A 1EY0A 3SK4A 5C4HA 1EY8A 2F0KA 2F0EA 2F0LA 4IZ8A 3C1FA 5C3XA 1SNMA 1AEXA 4QB4A 5I6WA 5IGBA 2KQ3A 4EQPA 4DGZA 5IIFA 1KDBA 3MXPA 4RKLA 4K2KA 3VA5A 4TRDA 5CV4A 2F0IA 4J6HA 4H7BA 4KY7A 1SYFA 3EVQA 4HMIA 3OSOA 2RKSA 5IGCA 4K6DA 5J1ZA 4KJNA 4N9TA 3TP8A 3BDCA 5F2DA 4ZUJA 2RBMA 2F0NA 4S3SA 4DFAA 1EZ6A 1SNDA 1SNCA 2F0MA 2SNSA 3C1EA 3ERQA 4KD4A 1SYGA 5IOCA 5KRUA 4K14A 4PMBA 5C5LA 4KTAA 3OMCA 2F0DA 4K5XA 1EYCA 1EYDA 1SYDA 3SK8A 5I6YA 4KV6A 5KEEA 3DMUA 4IUNA 4PNYA 4R8NA 3HEJA 3R3OA 5DEHA 2F0PA 2O4XA 1EY7A 1EYAA 1SNPA 1STNA 3QOJA 4N9PA 1NSNS 5EKKA 3SHLA 3V2TA 1II3A 1STHA 5KIXA 5I9OA 2EYHA 2EYFA 4G57A 1ENAA 3NUCA 5CV5A 1EZ8A 3H6MA 1A3TA 1KDCA 2EYMA 3HZXA 2F0FA 2F0TA 2QDBA 3NP8A 4HTHA 3SK5A 4E6IA 5K5PA 1JOOA 4I65A 3T16A 1STAA 4NDXA 4KY5A 5KGUA 1TQOA 5KYIA 1F2MA 1A2TA 2F0QA 2OXPA 5IGGA 5M9OA 5J22A 1A2UA 2F0SA 5CV8A 4K2LA 1STBA 1EY9A 4QF4A 1SNQA 4QMGA 3SK6A 1SNOA 3MZ5A 1KAAA 3NK9A 3D4WA 3TP6A 2HQEA 5C5MA 1EQVA 2PW7A 3P75A 4ME5A 5CC4A 2OF1A 3NXWA 4KD3A 1A3UA 2PZTA 5IGDA 2F0GA 3MVVA 5CR3A 5CV7A 5HGTA 3ITPA 4KY6A 1JOKA 3EROA 4B9WA 2EYPA 3PMFA 4PMCA 3NHHA 4KHVA 4ZQ3A 5IODA 2PYKA 4HMJA 4LAAA 4OL7A 1EY6A 1SYCA 2M00A 2PZWA 3OMGA 4K8JA 4YIJA 2EY6A 5JOBA 5IGEA 5E3FA 4WORA 4DF7A 4DU9A 2WACA 3EJIA 3SXHA 4F8MA 1ENCA 1NUCA 1EY5A 3DHQA 3MEHA 3SR1A 5CGKA 1KABA 2EY2A 3D6CA 4KJOA 4NMZA 4ODGA 2F0WA 3TP5A 1TT2A 3D4DA 4EQOA 3TP7A 1EY4A 5HURA 5EKLA 2EYJA 5J39A 4B9XA 1STYA 3BDLA 4J1MA 4K5VA 5KYLA 2EXZA 2F0HA 2KHSA 2SNMA 2PQEA 2F3WA 1A3VA 1JORA 2F0OA 5C3WA 2NUCA 5CV9A 3MHBA 2PW5A 1RKNA 5EGTA 4NKLA 3RUZA 5E1FA 2F3VA 1IHZA 1KDAA 1U9RA 2F0JA 5JAVA 3LX0A 5I9PA 2PZUA 3NQTA 4EVOA 4MIUA 2EYOA 3T13A 4K5WA 1STGA 2EY5A 5ISRA 3QOLA 4ZUIA 4NP5A 1F2YA 2OEOA 4WRDA 5C6AA 2EYLA 3TMEA 1TR5A 1F2ZA 5NUCA 5CV6A 4RKBA 3U9OA 2F0UA 3D8GA 3P1HA 2LKVA 3QB3A 4K8IA 5DAUA 1SYEA 2ENBA 4IALA 5IGFA 3E5SA 1JOQA 2SOBA 4EQNA 4F7XA 5C4ZA 3S9WA 1SYBA 2EY1A 2RDFA 2F0VA 3OWFA
chains in the Genus database with same CATH superfamily
1RTOA 4A3EH 4JI2L 1VQJA 4P72A 4IN3A 4EQPA 3J80L 1LTID 2F0IA 4BS9A 4H7BA 4BBSH 5LMNL 3S1QB 1OXVA 3KOJA 2NTTA 4IJHA 2K03A 4JOIC 3TP8A 1PRTC 2Q8IB 4ZUJA 1I3QB 2F0NA 3C1EA 4KD4A 2ALYB 2AQ2B 2KCMA 5AJ3Q 4CDDC 5CBEE 3NWSA 4UP9A 1NR4A 1YNND 3BVMA 3H3VH 3N6RA 2K14A 1XMOL 1TWHH 3K0YA 2RSNA 4R8NA 4LFBL 2VQFQ 4A3IH 2JEBI 3A8IE 2BDNA 4A3MH 4JI4L 1STHA 3QJYA 2ZJRA 5L37A 4CKCA 1EZ8A 1WTXA 2EOTA 3K59A 1X65A 1I4XA 3T16A 2D5DA 2OTLA 1FNUA 5JPNC 1I6VC 3KLRA 3P20A 4QF4A 5C0XG 1K3RA 1YBYA 3KUPA 4IOCA 2MP1A 1HR0Q 3SK6A 1G6ZA 4BY1G 1TIID 2JK8A 5DLQE 1EQVA 3GDEA 5IWAL 3BU2A 4DAYA 3T4AC 3AU7A 3PO2G 5M5YH 5IYBG 1QNKA 4UAIA 3EROA 2JA9A 4JI5L 3H15A 3NHHA 4NXNL 1GD7A 4DUZQ 1GUGA 5E4WC 4DV0Q 2WACA 4HJ5A 5DNFA 3MEHA 3SR1A 1KABA 1NMGA 4NMZA 1WTWA 4XT3B 1A63A 3D4DA 4R4QA 4JPBW 3T56B 3TSSA 4BA1I 1CA6A 3QIAA 3H3VC 5IYDH 1HPCA 2NWGA 3HOVB 4LUVA 1BDOA 4IUVA 1O7YA 3MFGA 3AYHB 1SBBB 1BBXC 2X6LA 4NKLA 2MQHA 2I5MX 1KL9A 4N8FA 1IHZA 1YI2A 1TWFH 4Q5VA 1WCMB 4P2CB 1SROA 4EVOA 2PI2E 2HT1A 1QUQA 2KENA 4DV3L 1IBLL 1DOLA 1HQMC 2WB1G 4GOPC 4BA2I 4C2MH 1DYQA 4BWGB 1B8AA 3Q8DA 4YWMA 1S40A 1MHWC 4LFBQ 2ZJPA 1EQRA 3FKIB 1D1KA 4H0LC 3J81i 2JA5H 3DWQA 5FO9B 3I55A 2F0KA 1MI2A 2MPMA 4P75A 3KJPA 1PA6A 4QY7A 4IPGA 5G3LD 1QOHA 2XRSD 3TN2A 1PH1A 4KY7A 1Q8IA 2UUAL 1EIGA 1EU4A 5LL6X 4YWKA 3H09A 3I72A 4CJ1B 5KGUA 2SNSA 2HCIA 1A6XA 4X64Q 2CWAA 1SFOH 1GO3E 4DR6Q 1CT1D 2FJ2A 4UHVA 3PO3B 1WTPA 1YITA 4Z9CB 2A69D 4HSVA 3U4ZA 5C3EH 1SJHD 3BYYB 4XXEA 1STAA 1Z9FA 1BCPF 4CJ0B 1L1OB 5JVG3 3K7AB 1WJJA 1N34Q 1SNQA 1LYLA 3L2PA 4QMGA 2HUGA 3D4WA 3HOZB 2B2UA 4ME5A 4HIOA 5EPLA 3TREA 1HNZL 2PZTA 4JI3L 3MVVA 5CR3A 3S14H 5D3IB 1SRUA 1NBWA 1LTGD 2A74C 4A76A 2K32A 5K36G 3MTSA 1SYCA 3F2UA 5IGEA 1Z47A 4N8X1 4BXXG 3HOXB 4QQBX 2L12A 1NUCA 1TWAH 4A3KH 3JC66 3A54A 4MHEA 3CCSA 5J39A 1VQFA 2JA8B 4IQZA 3E6ZX 2KHSA 3E9HA 3DUZA 1R4QB 5JEAH 3Q0AA 1UE7A 3RZOH 4X65L 2PNHA 2R7DA 3MHBA 3I73A 2B2WC 1CUKA 2L0CA 1Y1VG 2FXQA 5FKAC 2PZUA 5IYCH 4NB3A 1B53A 2KEEA 5FLXE 1D2BA 2A6HD 1E2VA 1STGA 1D5XC 3HOUB 3NENA 1VQ5A 4KMUC 3S2DB 3D8GA 4ZAIA 5DAUA 4WFN3 4LF9L 1Y69U 1IYJB 2VB2X 1EFWA 4A3CG 1SYBA 2B63G 5D14A 1K0SA 1I94L 4C3JG 5M5WH 2NVXH 2K4KA 4X62L 3PIOA 4JI0L 5IGBA 4C56C 2Q2UA 4NPSA 1B3AA 1IBKL 2X6GA 4B3ML 4ME3A 1X9NA 5F2DA 1HNZQ 1WCMG 4JI3Q 3VR6A 1VCIA 2E8GA 3CCUA 3TS0A 1HJPA 4A3JH 1JWUD 4A93B 4BY7B 3RZDB 2O4XA 1MKHA 3NBIA 5GQOA 3IRBA 3GTKB 3I91A 2A5HA 2EVBA 3ND8A 2H4OA 2QDBA 3NP8A 2LY7A 2DNCA 4IUTA 4KY5A 2MUYA 1LTBD 2WB1E 1G6PA 1PFSA 4X65Q 1CHQD 2HQLA 4C3HH 4RHSA 2QW7A 1LT4D 1RHPA 1F9QA 4CJ2C 1AZPA 1QJOA 3GTLH 3GTOH 1UNSA 4JI7L 1EOVA 1JJ2A 5J3BA 1RIPA 4RGTA 5LHY1 4IFDH 1Y1WB 1U5KA 2A6ED 3WOEA 5E3FA 4DU9A 1BCPB 2ZXOA 3RLOA 4HAEA 1QVGA 1C8CA 5EPJA 5IP9H 1TT2A 1C4QA 3V96A 1Y8OB 4OHJA 4JOIA 1JORA 2CHBD 2HCCA 1BOSA 1T5XD 3CCEA 2UXCL 4RCNA 3GTJH 3K57A 1PFBA 1AE3A 3BJUA 4H02A 4IPCA 4XTCS 3WOFA 1QVFA 1S3OA 4ZKBB 4ZUIA 4MZ9A 4A3FH 1XNQL 2J7ZA 4WJ4A 4JW0A 3CCLA 3NPPA 5C4JB 3MXGA 5ELBA 2KHIA 1SDFA 5M3FG 1N32L 1S5FD 3C1FA 1C9OA 2K01A 2ZT9C 2RF4A 1K9MC 5M5XB 1AEXA 3HKZG 1BKBA 3UDXA 4DGZA 3GTPB 4EQ5A 1X55A 2NVYB 2IHFA 1LTLA 4IPDA 4A3KG 5J22A 4S3SA 1QUQB 1WTVA 5I2YA 1U4LA 2A1AA 5EKIA 4TVAB 1SMYD 4CBVA 3HOUG 4IUNA 1PYSB 1J5EQ 2F4VQ 1F9SA 3R2TA 1ESRA 5IY0A 3S1MB 1HNWL 2XVSA 5IYCG 2YTVA 5CV5A 1E0BA 5GAGC 1DZ1A 3G4SA 4E6IA 4HTHA 5FLXL 4RHRA 2R93H 2PNRC 1K8MA 4AQYQ 3TZDA 5M9OA 1QILA 1XMQQ 1CTMA 2K05A 3C46A 4DR3Q 4GOPA 2HQEA 3P75A 1EFID 4B08A 1N33L 1VQ8A 1J8IA 2R92B 3G7LA 1LO5D 4APVA 4C3IB 2UUBQ 3I4OA 4DR7L 3NEMA 2JXMB 4KKTA 4LAAA 1ASYA 4K8JA 2V1CC 1QZGA 3BDOA 2JE6I 3EJIA 3F8TA 4MNOA 3PIPA 1N32Q 2F0WA 2UXDQ 4G7ZC 1ML0D 1PV4A 1HZAA 4PMWA 4IJLA 4FP5D 3KBGA 2B2VC 2IJ0A 1IZ6A 2PW5A 1RKNA 1I6HH 3RN2A 1H9JA 2G9DA 4H44C 4GN4B 2K5DA 1KIXA 3AMUA 3GTGB 1YJ9A 5H1SE 3OHXC 2LMCB 2X69A 2WV6D 4FO2A 3GTMH 1K83H 2D0PA 3QOLA 4Y7NH 1K73C 1KXLA 2MJ8A 3SGIA 5C6AA 1TY2A 1GM5A 5M3MB 1F2ZA 1R9TB 4DR5Q 2TMPA 4LFCL 3QB3A 3S1NB 2ASBA 2F52A 1ZKOA 1I50B 1D1IA 2KJXA 2SOBA 4JCVE 2F0VA 1KRSA 4FVMA 5C4HA 1RJTA 5CYUA 4IZ8A 2PCFB 1DJRD 3BZKA 5LMUL 4Q0FA 1WTHA 1ET9A 4L8JA 1JJCB 2XWJB 3BZDB 2E74C 1XX8A 4KHZA 4L5QA 2K5HA 3B6YA 1AN8A 4QIWB 3SDZA 3T1HQ 1PTOH 3RLNA 1IXRA 1ZEQX 2Q8RE 1NE3A 1OXXK 4O1NA 2BH8A 3A7LA 4HN7A 3I7FA 2OCEA 4DKAC 4DAMA 4BBRH 5A35A 5CBAE 1IW7D 2B2WA 2EYMA 4BY1B 5K5PA 4NDXA 3CKIB 5FJ8G 1YHQA 2N88A 3X3NA 3MZ5A 5KNBA 3K58A 2L1BA 3FRPB 5C44H 2VUMH 4U68A 3J80i 3S2HH 2NVQH 4DUYL 1V1PA 3M3YH 2CH4A 1AE2A 3RR5A 1DOKA 4B3SL 1JOKA 1F2LA 3CC2A 2JSOA 4ZYSA 3HOYH 5IODA 2XN9C 3BVGA 2EY6A 1EIYB 4LF4Q 5G3LF 2HDLA 1D7QA 2EYJA 1PTOC 4FDBA 1YZ6A 4NW2A 4UY8C 4DV5Q 2KVMA 1LT5D 2WB1B 2F0OA 5C4XH 3A0JA 3E3XA 5EGTA 3S15B 3H0GG 1PH9A 2B3GA 5COYA 3CP0A 1VQBA 4LFAL 1ET6A 1H9SA 4RGMA 5ISRA 2E2IB 1B3QA 1CQVA 3HS0C 2R92G 3U9OA 2F0UA 1JICA 4ILWA 3FP9A 1CM9A 4WJWA 4OELB 1K3BC 4IALA 3VR2A 3O13A 4LW1A 3NE5B 3NTIA 2KECA 2IT1A 1PH4A 2P5ZX 4DNIA 3OWFA 2IY5B 4XDXA 3VR3A 2F0EA 1YJNA 4A3GH 4B3RQ 2KCTA 1XXGA 1IYVA 4QB4A 1JC7A 4DK3C 4WJ3M 4TRDA 1KNEA 4J6HA 3M85A 2R7ZG 3KDFA 5J1ZA 2I5LX 3I70A 3OPOA 1KLGD 4JI6L 1EWHA 2C9OA 1LTTD 3S1RB 4G7HC 1CK1A 1ICWA 3CAMA 5JPMC 4X66L 3SHLA 1HQRD 1H95A 1F77A 2I0QA 4LF5L 1II3A 2BE5C 1SAPA 2BA1A 5FK9C 2EYHA 3G6JB 3H6MA 3GQBA 4JVZA 1JOOA 3CC7A 3ZYYX 1UEAB 1OO9B 4YCWA 2MNAA 3D6WA 5CV8A 2EJGC 3IFTA 1KLUD 1GXDC 1EQTA 1KAAA 3S1QH 4LFAQ 5CC4A 1G8ZD 2JN4A 3P7JA 2K5QA 2RCFA 2ZM6Q 4XYOA 4DA2A 1I3QH 1GHJA 3JAME 3E9IA 3E0EA 1ENFA 5FO8B 3ITPA 4KY6A 2OQ0A 1IBML 1PRTD 3L3OC 4DV1L 1LTAD 5KIXA 4CKEA 3MXNB 4PG3A 1K8OA 1RD9D 2ZXRA 2EY2A 1K0RA 2NTSA 1Y1VB 3L7ZC 1FR3A 1D5MC 2EE1A 1X3PA 4R4OA 4B9XA 3BDLA 1HFNA 1TVXA 1RF2D 2ZTEA 4R1JA 3J81E 4HJ9A 4GOPB 4DV2L 1KDAA 1NNXA 3LX0A 3CPFA 1K28A 1ZXTA 1I4HA 4JBKA 4WRDA 1QNUA 2JA7G 2B63B 3HGBA 3KJOA 5T1IA 4C3JB 5NUCA 1BNZA 1HA5A 2I46A 3PUXA 2I5HA 4JI2Q 5M5YB 1SYEA 1VMCA 3DM1A 2NZHA 4ABNA 4F7XA 2HDMA 1V8QA 2IX0A 2RDFA 1Q46A 4YHHL 1TWGH 1K8AC 2BDOA 3PV0A 3CCJA 5LMNQ 4PZ6A 2EXDA 3HOVH 2KQ3A 4K6LA 3C3LA 4HR7B 3HRZC 1SE3A 4K2KA 4ZRZA 1MD2D 4DK1A 3MFYA 2DGYA 3R2IA 2WAQG 4R8IA 1XMOQ 2IWHA 4O2DA 3AB9A 5I2XA 1OXUA 4CDCC 4FXDA 1TWFB 5C5LA 1EYCA 4ZK9B 4JI4Q 1LLRD 2XIWA 3HEJA 1V9PA 3FKIH 1O78A 4C2MB 5C0XJ 3D4RA 2B2VA 2BH2A 4LNQA 1XNRL 3V05A 1WTOA 2JA5B 3A56A 1EEFD 1UUPA 5IWAQ 4A3DG 2RHSB 1B9NA 5JVH3 1W6JA 3J7AV 1E2ZA 1NR2A 2B39A 1AW7A 4DN4M 1G2TA 1NCVA 1UE5A 3UDGA 4JI5Q 3NXWA 4NXNQ 5IE8A 2L15A 2K04A 4A3BG 5IP7H 2EYPA 1D8LA 1MIUA 3I4MG 5GROA 3QR8A 2YTXA 3PO3H 2O2LD 4DV4L 5A2QE 1BBUA 4HEDA 3KF6B 4J1MA 1KC8C 3CC4A 2F0HA 3K7AH 5C3EB 1YHBA 4DV3Q 1IBLQ 1W3SA 3HOZH 4A3EG 1U9RA 3I8ZA 2EYOA 4DR2L 3HOWH 3GD7A 1M1KC 1V1PB 5D65A 1QE6A 5M3FB 3NSWA 1D5ZC 3TMEA 4A4IA 4HIDA 4BBSG 2C35B 3VYRA 4A3LH 1EIHA 3HKZB 3HOXH 4DXFA 5FOBB 2E5LL 1D6EC 3I90A 4HIMA 2IW3A 5FO7B 3NBHA 3M4PA 2JA8H 2PMZB 3CU7A 4R4IA 4A3IG 4A3KB 2UUAQ 4FXGC 4A3MG 1A0IA 1P16A 5CV4A 4QIWE 1N8RC 3EA6A 1J9OA 2J4XA 4B3TL 4J8QA 2WINB 4N9TA 4UPAA 1H9SB 1P8LA 4DFAA 1DD2A 2F0MA 3ERQA 1X3GA 3PUVA 2L5TA 3OMCA 3CHBD 1PYWD 3HP3A 4KV6A 3S2DH 3DMUA 3URYA 2CQAA 3CMAA 3R3OA 5IGFA 3V2TA 1NSNS 5EKKA 3S16B 3OYYA 4FF4A 4YCUA 4P74A 4PZ7A 1VQ9A 2KCCA 1A3TA 1NJIC 4DR4L 3QG1A 3M7GA 1VF5C 1PH2A 1B2TA 1R4PB 2NVXB 4M1UB 2CKZB 4X3TA 4KN4C 4DR2Q 1CA5A 3KDFB 2PO4A 5IYDG 2N55A 4QUFA 1A8VA 1LTRD 4JBMA 1XJVA 3NQIA 3DWPA 3BYTB 5T1GA 4A93H 4BY7H 3RZDH 2E2HH 1F9PA 5JOBA 1VDZA 2NN6H 4RA8A 4WORA 2K5WA 2L4NA 2E5LQ 2DJGC 4KJOA 3K81C 3GTKH 4YWLA 1BXTA 2F1MA 2MGSA 3DEOA 1NY4A 2WAQE 2RSOA 1VQEA 3LGJA 5KYLA 1ESFA 5JJLA 3A8KE 3T1YL 1EYGA 2JA5G 4ZLTF 1O7IA 1O80A 4LJZC 4GS3A 4C3HB 5BN3A 2K50A 3A74A 4NP5A 2ID0A 2R7FA 4LF9Q 1L0YB 4PV1C 1LM0A 2B29A 4OWXB 4X3UA 1QVCA 5CV6A 1KAWA 1Y1WH 3H94A 3OTOL 2VZAA 3GTOB 3D3RA 3A7AB 2DY7A 3ER0A 1I94Q 1UE1A 2ENBA 4QCLA 3U4VA 2KOLA 4X62Q 4JI0Q 2L9HA 5C4ZA 3PSIA 3FVQA 3EIVA 4QL5A 5BN5A 2J0TD 2K6AA 4DR4Q 2DJFC 5FLMH 4L5TA 1IBKQ 1YNJC 4ZKCB 4OWWB 4B3MQ 1HUMA 1TWCH 1FNWA 4RKLA 4DV7L 3K6OA 1IL8A 4DAYB 3F2CA 5C3EG 2O5JC 5ELDA 4GKJL 1XTDA 3JAMc 5DM63 2Q2TA 1VQ6A 1YNJD 5KRUA 5HGQA 1RTNA 4PMBA 2CFMA 5A2QL 1PFNA 1N36L 3CCVA 2Q2IA 3QOJA 2B8GA 3PUZA 4I7ZC 1SE8A 2D0OA 4DNTB 3CQZB 4XIGS 1KHIA 1PMRA 2F0TA 1HZBA 5M5XH 3CMEA 2ZJQA 3T1YQ 1ZYRC 5IT9E 2B2YC 3GTPH 1CFMA 3I4NH 1BCPC 4OEMB 3J81c 2NVYH 4JI7Q 4OGQC 3OW7A 4UDUC 3AEVA 4OO1I 4ULLA 2EJFC 5JEAG 1HXYD 2F0GA 1ZYRD 3PMFA 3K5MA 1BBWA 4KHVA 2YU9B 3BVZA 3W5OA 1SMXA 4OL7A 3OOCA 1DGSA 3CPWA 4OWTB 1LV9A 1JE4A 1E2WA 1TXYA 1QCBD 1Y14B 2FMMA 1Z6HA 1QB5D 4Y52H 3TP5A 4TKOB 3S1MH 2QEXA 3H0GB 4EQOA 4DXGA 3ZJYC 1SE2A 1Q1EA 3RD4A 1Q90A 2WKCA 2UXCQ 3IAYA 3Q22A 4O0AA 3K80C 4AYBG 2QEJC 4DV7Q 3U50C 3GTQB 1XYIA 1ONLA 1X32A 1XNQQ 2KA7A 4RFBA 1HR0W 1VQNA 2Z4IA 2MHVA 4GNXC 1O7ZA 1YHAA 2HHHL 4C3IH 2CW0C 1YNXA 2QF7A 1EWCA 4AH6A 2UXBL 1TR5A 2RQXA 1X3FA 2DUDA 2Q8TA 4IO9A 3S17B 1M4VA 4R4CA 4OX9L 2H1EA 2NN6I 4LF8L 3S9WA 2ZXPA 4A3JG 1VQOA 3UE1A 2Z6BA 2KEDA 4HJ8A 2R7ZB 1WVLA 1WD1A 1GUSA 1GHKA 2WP8J 2VQEL 4JBWA 1FVIA 3L0OA 4V190 2HIVA 1EU3A 1PRTF 3EVQA 4LF7L 2R3ZA 3Q24A 1EWIA 3GTGH 2AKWB 4DV6L 1C0AA 1EZ6A 1CI3M 1HFGA 4EGVA 4C3HG 2XGTA 3SK8A 5M3MH 1R9TH 1HNWQ 3ERSX 3GV3A 1QG7A 3GTMB 2F0PA 3S1NH 1K83B 1EYAA 1STNA 1YJWA 3M7NA 2XSCA 3J80E 3I3CA 1TU2B 2EYFA 3SE0A 3CRKC 4IFDG 1B9MA 2XTIA 4JYAL 2F0QA 1N9WA 1E1TA 1N33Q 4K2LA 1STBA 3MAQA 1LACA 1SEBD 3ULLA 4RH6A 3ULJA 5IP9G 1EL0A 2QILA 4DR7Q 2O5IC 3CCQA 3J7A5 2HHHQ 3T51B 2E75C 4GLAC 2UXBQ 2A68C 4L5RC 4CKBA 4RG1A 4PMCA 4GKKL 1GKHA 1IKMA 1CHPD 1V43A 3OMGA 2Z1CA 2NVTH 2CH4W 4YY3L 5BR8L 3K5LA 4CHTB 1PTOB 3ULPA 4OX9Q 1UE6A 5CGKA 5ELNA 4LF8Q 3D6CA 4A3FG 4XT1B 3W1GA 3TP7A 4BY1H 2VW9A 1V1OA 2XRQD 5AFWA 4ALPA 1XTCD 1FYCA 2OTJA 3PO2H 3GP7A 2FMCA 5IYBH 2AMCB 2JA7B 2EQSA 4O42A 5JAVA 1S5ED 4HCSA 1NTGA 3T13A 1HCZA 1CQFA 4CDFC 4LFCQ 3HKZE 4R4TA 4LMQD 3CCRA 2L55A 4JI1L 1KNAA 1Q8KA 1OTCA 2NVQB 4GLVB 3U58A 4X6AH 3I4NG 4IFDJ 2K1BA 2PMZE 1BO0A 2KBNA 2Z0SA 5LMUQ 4EQNA 1H9KA 5E1FA 2RDHA 1PFMA 3PUWA 2WAQB 1SNMA 3M4OH 1FGUA 5I4DA 1Y8NB 4DK6C 3S15H 1I5FA 4TQUS 1PTOD 3RMHA 1SYFA 1L0XB 4HMIA 1RCVD 3ND9A 4POGA 2R93G 1WFQA 5C4XB 4DK0A 1YIJA 3EN2A 5DEHA 4UP8A 1EY7A 4YY3Q 3NTHA 4AYBE 1MJCA 2RA4A 2QGQA 1LTSD 1PZKD 4A3DB 4OIKA 4G57A 4F87A 3J81j 4JG2A 3NUCA 5EJWA 1B1ZA 1PRTB 2E2JH 2F0FA 1WOCA 1PH5A 2JA6H 2Z8LA 4LF6L 1SLJA 4V0BA 2IL8A 3NWTA 4DUYQ 1OXTA 3R93A 4A3BB 3NK9A 2QCPX 4B3SQ 1VQHA 3I4MB 2Y0SG 1A3UA 2NYZD 3VDYA 1SXTA 3RLFA 1ASZA 1H9MA 3CXCA 1Q81C 3S1RH 1WD0A 2G9HD 2ICEC 3K5OA 4YCVA 1Q82C 4YIJA 3FPPA 4DF7A 3SXHA 3DHQA 3MA2B 2XNAC 3CRLC 1PH8A 2YV5A 3K0XA 4DV0L 5HURA 4A3EB 2ATWA 1GJXA 2NBFA 1GUWA 2BE5D 3AFPA 2SNMA 2F3WA 1A3VA 3CD6A 4RWSC 4PZ8A 4BBSB 3AQQA 5K36H 2F3VA 1Z7TA 2Z6KC 2AWOA 1YNNC 2N8NA 2QA4A 3CF5A 4BXXH 1JR0D 1MSGA 2VXWA 2VY3A 3NTKA 3PF4A 3KLSA 3HG9A 3CW2C 3IL8A 1V1QA 1KQSA 3SEBA 3TQYA 2MO0A 1B50A 1TWHB 3P1HA 4K8IA 3T53B 1TS4A 2EZVA 2KHJA 4A3IB 3GO5A 4A3MB 2K33A 1BUVT 2B2YA 1Y1VH 4QUCA 5ELCA 5C0XI 2I07B 3PIO3 4KHPL 1DXMA 4LF6Q 3VYSA 3Q23A 5IT9c 3QO2A 1F9RA 3EBEA 1S72A 5ELFA 3C2PA 3VA5A 1E7ZA 4BBRG 2EIFA 3KF8A 2RKSA 1JB7A 4JI6Q 2QDLA 3TDQA 2RVLA 1HA6A 2AWNA 4X66Q 1SNCA 1FJGL 3FPUB 3Q6SA 4K14A 3G71A 4LF5Q 1VQGA 3R8BA 4LWCA 2B63H 2JEAI 4A3CH 1SYDA 5I6YA 3FMCA 1VQ4A 4C3JH 4RGOS 5C44G 2VUMG 2L11A 1NMFA 3A8JE 3KFUA 4X64L 3WWVA 4DR6L 4M8AA 3HOYG 3VR4A 1X3EA 1VQLA 3PF5A 3IKJA 1WTRA 4GNXA 1WCMH 4XQQA 2F0SA 1PHJA 1TWGB 3JAMi 1VF7A 1AFPA 3L9AX 2HIXA 2PW7A 2YTYA 1N34L 1VS0A 2B2TC 2GN5A 1IBMQ 2M9VA 4DV1Q 2BA0A 1EQQA 5C4XG 5CV7A 5HGTA 1I4PA 2AUJD 2DNEA 2LS01 2PI2A 4HJ7A 1EY6A 1BF4A 2PZWA 4F8MA 1T9HA 4OXPA 4OIJA 4JK1C 2PPBC 5CORA 4GN3B 2UUCL 2FHTA 4KHPQ 5GADC 5EKLA 2AUKA 3AFQA 3LWUA 3UDIA 4PQXA 4DV2Q 2G5DA 5ELEA 4UP7A 2NUCA 3FDTA 3OIPA 1SN8A 1W2BA 3RUZA 1B70B 1FNVA 4A3GG 2K75A 1TS2A 3NQTA 4A75A 4IOAA 2MFIA 2GVAA 3RNUA 1FJGQ 3VYUA 1Q86C 1SFOB 4IUQA 4EX5A 2JA6G 2A69C 2SDFA 1U4MA 3BG3A 2WKDA 3I4LA 2WFWA 4YHHQ 1JB3A 3J80c 1AZQA 4FF2A 1ICFB 1KRTA 1WI5A 3SK5A 4MTNA 1PZJD 1DOMA 3K5NA 1Q7YC 2Y0SE 4P73A 4QJFA 1G51A 4KN7C 1HNXL 4JV5L 1C7YA 2N78A 4KKUA 4L5SA 1XWEA 3TEHB 1JQYD 5IGCA 3A5ZB 2RBMA 5EPKA 1VQ7A 1A62A 5M3FH 4C1NI 3S14B 4H13C 3HOWB 1HTLD 4IURA 1BVSA 2E76C 1XNRQ 1PXUA 3MC0B 5EQ0A 1C48A 3HKSA 1J6QA 1W6KA 5ELOA 3S24A 1TWAB 3JAML 1M90C 2UUCQ 3H3VI 5JJKA 2MO1A 1TS5A 3HZXA 4DPGA 5EBCA 1G91A 2RHQB 2EJMA 4OO1H 1F2MA 1A2TA 1JWSD 3G48A 2NZ1D 1UAPA 2LXJA 1A2UA 4AIMA 1U0LA 3DM3A 2A6HC 1EY9A 3RZOB 3I56A 2A73B 1FD7D 3MEFA 1MSHA 3TP6A 3HOUH 1L1OC 1WYDA 1FL0A 2OF1A 5CMDA 1CSQA 1E22A 4TSSA 1HH2P 3A5UA 1PZID 4B9WA 3VA7A 4RMFA 4ZQ3A 1XPRA 3HFZB 3J81L 1E3PA 1RODA 2AQ1B 1O7LA 4DV4Q 3E0JA 3PIP3 2LXKA 1Q3LA 4AYBB 3H91A 3S16H 2C5CA 2HD3A 2N3SA 1RL2A 4C1NK 4MTKA 2IX3A 1EY4A 3FHWA 5M5WB 1E24A 1STYA 4K5VA 5TSSA 2UU9L 4HJAA 4X3SA 1HNXQ 3TBIB 4JV5Q 2PQEA 4I7AA 4LUZA 3RN5A 1G2SA 3BS1A 2CWPA 1VMPA 3EFXD 1LUZA 4K0KL 2Q2HA 3HOVG 1CKNA 3TRZA 4CGYB 1MJEA 1MGSA 2KUMA 2EYLA 4A3JB 3DEPA 1S4ZA 1DONA 1OXSC 2LKVA 4RCOA 3M9BA 2JQOA 1CZGA 2GVBA 1JOQA 2E2HB 3DXJC 2TSSA 3UDFA 2LFNA 4ID6A 3SK4A 2R61A 2F0LA 1HRJA 3FKIG 1U4PA 1ILPA 1QWYA 4POFA 4B3TQ 4U673 3MXPA 3K7UC 1X3QA 2CQOA 2QKIC 2PQAA 3KBXA 3BDCA 3GTLB 5JJIA 2A6EC 2NB0A 1JCKB 1SYGA 2D2CC 4DAPA 2F0DA 2GA4B 3UI2A 3VYTA 4NXML 2XWBB 5DM73 4PNYA 1LT3D 1X54A 1BQQT 1SR3A 1B7YB 4IUUA 1HHVA 2B8FA 4QGUA 1ENAA 5IP7G 1MBYA 2D9UA 1J5EL 2F4VL 2LSSA 3IFDA 2Z6KA 2UU9Q 1U4RA 5HY6A 1Q12A 3GV6A 1TQOA 4GN5A 2OXPA 1WTQA 1B44D 2ZTCA 4JBJA 3PO3G 3MWYW 1SNOA 4FYDA 3GTJB 2K52A 4AQYL 4DR1L 2AHOB 3DWAA 3KF8B 1XMQL 1TWCB 4K0KQ 1I4RA 4DR3L 1CKOA 5C4JH 2NZOA 3OWEB 1GOZA 4A3FB 3N52A 2Z9HA 3TZUA 3HOZG 1EUJA 2V4DA 2UUBL 3HOWG 5FJ8H 1ENCA 5EAYA 3CQZH 1PTOF 1AP0A 1IKLA 3MXUA 2FINB 1VQCA 4A3LG 2BCOA 3HOXG 2UXDL 3F1ZA 4GNXB 2Z4HA 3PCOB 4G4KA 5GAHC 2F0JA 1S5BD 3W3AA 5I9PA 3I2ZA 1JMCA 1SMYC 2JA8G 3STBC 3I4NB 4K5WA 2K5VA 3OTOQ 1BCPD 1VQKA 1F2YA 4NXMQ 4R9WA 5GAEC 2F4IA 2YU9H 4OO1G 2D62A 2VS1A 2E2DC 3X3MA 3STBD 2K7VA 4DR5L 3H0GH 4F88A 1Y8PB 2EY1A 3MXNA 3W2DA 1EY0A 3WDNA 5KNCA 3BZCA 2R93B 2F3IA 1PH7A 5C3XA 4GKJQ 2B2TA 2A19A 5IIFA 1KDBA 1G291 2R92H 4J15A 3GTQH 3J7ZC 4DR1Q 3OSOA 5LL6S 1PLFA 1N36Q 4RAUC 1SNDA 3J7AF 2YYZA 2ES2A 2JYOA 2OWOA 4K5XA 3KK7A 5EBDA 1CZWA 1NAPA 1JWMD 4N9PA 3S17H 1GUTA 2CW0D 2OT2A 1I4GA 3T1HL 2EDGA 5E7NA 3LNNA 5I9OA 4IUPA 4BY7G 4A93G 2R7ZH 3G6EA 4I65A 2NN6G 2Y0SB 4HCEA 5JEAJ 5IGGA 2IX1A 1JJGA 5LMNW 3OIQA 1H9RA 1T5EA 3PUYA 1I6HB 3EQLC 2R6GA 3LWEA 2DY8A 3PQIA 1XPOA 4XQNA 2SEBD 4KD3A 1STEA 3ONAB 2CCZA 3NELA 1I50H 4Y7NB 2BOSA 1PH3A 1B4OA 1YVCA 1KD1C 3F2BA 2PYKA 2F03A 1CSPA 4JI8L 4MN3A 3DLLA 1PH6A 4OONA 1EY5A 3NBHB 2RCNA 4GLXA 4RGNA 4IFDI 1Y1WG 2K28A 4FNFA 4LF4L 2FFKB 1PDQA 2ICIA 1SSOA 4DNRB 1DM0B 1SE4A 5CV9A 2WIIB 5JJZA 4XYQA 3OW2A 4DV5L 1EEID 5FLMG 2M2LA 1RDPD 4MIUA 1LT6D 1SJED 2EY5A 3J7YW 2OEOA 2B2UC 1K8GA 5C0XH 1TS3A 2OQKA 4RKBA 2K5NA 3M4QA 2KCNA 1IW7C 1UWVA 2A68D 1DCZA 4DAVA 1JE5A 1TKWB 2VQEQ 3M4YA 1FGBD 4BBRB 2A8VA 2NVTB 1EY8A 2H5XA 4X3KA 2ZTDA 1L1OA 2CVRA 4LF7Q 5I6WA 4IPHA 1YEZA 5E4XA 2IPKD 1XPUA 4DV6Q 1GUNA 3KF6A 4B3RL 2JA7H 3K8AA 5C44B 2VUMB 2AQ3B 3KLSX 3PO2B 3S2HB 4KJNA 1IL2A 1UEBA 4GZYC 3M3YB 3UE0A 1Q1BA 1TY0A 1GVPA 5IOCA 3W1BA 1E1OA 1CKNB 1QZHA 5IT9L 4KTAA 3KLWA 5FLXc 1EYDA 5BN4A 4JC0A 4FF3A 3HOYB 3FEWX 2EPBA 1HUNA 4JI8Q 5KEEA 1SNPA 3F2DA 4HSPA 4JYAQ 1KTKA 3D31A 4LUOA 2JJQA 3ICEA 4KKSA 4K6DA 1KDCA 1VQIA 4P71A 1VQAA 1EIFA 1GUOA 4XQJA 1VQMA 1HTPA 1AH9A 1I4QA 2E2IH 3M4OB 1PVOA 4HIKA 5C5MA 1A15A 5KNDA 4GKKQ 2PQAB 5IGDA 5BR8Q 1VQPA 3VR5A 5AJ3L 2ZM6L 4KI0A 3CCMA 4HMJA 2VNUD 1EOTA 5KYIA 2M00A 2VQFL 1HZ9A 1X56A 1S5DD 4FF1A 4A3DH 2N49A 2IHEA 4C3IG 1VQDA 4ODGA 1CKMA 1L2FA 3TS2A 1BR9A 4FXKC 4A3GB 3KYHC 1PYBA 1L0WA 1IYUA 3PGZA 2EXZA 1ILQA 3SVMA 2E2JB 5C3WA 3D0FA 5D3DA 2RDGA 4A3BH 1HR0L 4ZCKA 2JA6B 4JI1Q 4KK7A 3I4MH 1HZCA 4L63B 3A55A 1M8AA 2DN8A 2JP1A 2VB3X 4KLKA 1LABA 3QWNA 1S5CD 3U9SA 4DUZL 1X6OA 2VL6A 4L6TB 4CDEC 3E5SA 1JT8A 4LK1C 4G7OC 5M3MG
chains in the Genus database with same CATH topology
1RTOA 4IN3A 4EQPA 3J80L 1LTID 2F0IA 4BS9A 4H7BA 3S1QB 1OXVA 2NTTA 2K03A 3TP8A 1PRTC 2Q8IB 4ZUJA 1I3QB 2F0NA 3C1EA 4KD4A 2AQ2B 5CBEE 3NWSA 1NR4A 1YNND 3BVMA 3N6RA 3K0YA 2RSNA 4R8NA 2JEBI 3A8IE 2BDNA 1STHA 3QJYA 4CKCA 1EZ8A 1WTXA 2EOTA 3K59A 1I4XA 3T16A 2D5DA 1FNUA 5JPNC 1I6VC 3KLRA 3P20A 4QF4A 5C0XG 3KUPA 2MP1A 3SK6A 1G6ZA 1TIID 1EQVA 4DAYA 3T4AC 3AU7A 1QNKA 4UAIA 3EROA 3NHHA 1GUGA 5E4WC 2WACA 5DNFA 3MEHA 3SR1A 1KABA 4NMZA 1WTWA 4XT3B 3D4DA 3T56B 3TSSA 4BA1I 1CA6A 3QIAA 3H3VC 1HPCA 2NWGA 3HOVB 1BDOA 4IUVA 1O7YA 3MFGA 1SBBB 1BBXC 2X6LA 4NKLA 1IHZA 4Q5VA 1WCMB 4P2CB 4EVOA 1DOLA 1HQMC 4BA2I 1DYQA 4BWGB 3FKIB 1D1KA 4H0LC 3DWQA 5FO9B 2F0KA 1MI2A 2MPMA 5G3LD 1QOHA 2XRSD 3TN2A 4KY7A 1Q8IA 1EIGA 1EU4A 5LL6X 3H09A 3I72A 5KGUA 4CJ1B 2SNSA 2HCIA 1A6XA 1CT1D 2FJ2A 3PO3B 1WTPA 4Z9CB 2A69D 4HSVA 1SJHD 3BYYB 4XXEA 1STAA 1BCPF 4CJ0B 5JVG3 3K7AB 1SNQA 4QMGA 2HUGA 3D4WA 3HOZB 2B2UA 4ME5A 5EPLA 2PZTA 3MVVA 5CR3A 5D3IB 1LTGD 2A74C 2K32A 5K36G 3MTSA 1SYCA 3F2UA 5IGEA 1Z47A 3HOXB 2L12A 1NUCA 3A54A 4MHEA 5J39A 2JA8B 4IQZA 3E6ZX 2KHSA 3DUZA 1R4QB 5JEAH 3Q0AA 3MHBA 3I73A 2B2WC 2L0CA 5FKAC 2PZUA 1B53A 2KEEA 5FLXE 1D2BA 2A6HD 1E2VA 1STGA 1D5XC 3HOUB 4KMUC 3S2DB 3D8GA 4ZAIA 5DAUA 4WFN3 1Y69U 2VB2X 1SYBA 5D14A 4C3JG 5IGBA 4C56C 1B3AA 2X6GA 5F2DA 3VR6A 1VCIA 1JWUD 4A93B 4BY7B 3RZDB 2O4XA 3NBIA 3GTKB 3I91A 2A5HA 2EVBA 3ND8A 2H4OA 2QDBA 3NP8A 2LY7A 2DNCA 4IUTA 4KY5A 2MUYA 1LTBD 1CHQD 4RHSA 1LT4D 1RHPA 1F9QA 4CJ2C 1AZPA 1QJOA 1UNSA 4RGTA 5LHY1 4IFDH 1Y1WB 2A6ED 3WOEA 5E3FA 4DU9A 1BCPB 2ZXOA 4HAEA 1C8CA 5EPJA 1TT2A 1C4QA 3V96A 1Y8OB 4OHJA 1JORA 2CHBD 2HCCA 1BOSA 1T5XD 4RCNA 3K57A 1PFBA 3WOFA 4XTCS 4ZKBB 4ZUIA 2J7ZA 3NPPA 5C4JB 3MXGA 5ELBA 1SDFA 1S5FD 3C1FA 2K01A 2ZT9C 5M5XB 1AEXA 4DGZA 3GTPB 2NVYB 5J22A 4S3SA 1WTVA 5I2YA 1U4LA 5EKIA 1SMYD 4CBVA 4IUNA 1F9SA 3R2TA 1ESRA 3S1MB 2XVSA 5CV5A 1E0BA 1DZ1A 4E6IA 4HTHA 5FLXL 4RHRA 2PNRC 1K8MA 3TZDA 5M9OA 1QILA 1CTMA 2K05A 3C46A 2HQEA 3P75A 1EFID 4B08A 1J8IA 2R92B 3G7LA 1LO5D 4C3IB 2JXMB 4KKTA 4LAAA 4K8JA 3BDOA 2JE6I 3EJIA 2F0WA 4G7ZC 1ML0D 4PMWA 4FP5D 3KBGA 2B2VC 2IJ0A 2PW5A 1RKNA 1H9JA 2G9DA 4H44C 2K5DA 3AMUA 3GTGB 3OHXC 2LMCB 2X69A 2WV6D 4FO2A 3QOLA 2MJ8A 5C6AA 1TY2A 5M3MB 1F2ZA 1R9TB 2TMPA 3QB3A 3S1NB 1ZKOA 1I50B 1D1IA 2KJXA 2SOBA 2F0VA 4FVMA 5C4HA 1RJTA 5CYUA 4IZ8A 2PCFB 1DJRD 4Q0FA 1ET9A 4L8JA 2XWJB 3BZDB 2E74C 1XX8A 4KHZA 1AN8A 4QIWB 3SDZA 1PTOH 1ZEQX 2Q8RE 1OXXK 4O1NA 3A7LA 4HN7A 5CBAE 5A35A 1IW7D 2B2WA 2EYMA 4BY1B 5K5PA 4NDXA 3CKIB 2N88A 3X3NA 3MZ5A 5KNBA 3K58A 2L1BA 3FRPB 4U68A 1V1PA 1DOKA 1JOKA 1F2LA 2JSOA 4ZYSA 5IODA 2XN9C 3BVGA 2EY6A 5G3LF 2HDLA 2EYJA 1PTOC 4NW2A 2KVMA 1LT5D 2WB1B 2F0OA 3S15B 5EGTA 5COYA 1ET6A 1H9SA 4RGMA 5ISRA 2E2IB 1CQVA 3HS0C 3U9OA 2F0UA 1JICA 4ILWA 1CM9A 4WJWA 4IALA 3VR2A 3O13A 3NE5B 3NTIA 2KECA 2IT1A 3OWFA 4XDXA 3VR3A 2F0EA 1XXGA 1IYVA 4QB4A 1JC7A 4TRDA 1KNEA 4J6HA 3M85A 5J1ZA 3I70A 3OPOA 1KLGD 1EWHA 2C9OA 1LTTD 3S1RB 4G7HC 1CK1A 1ICWA 5JPMC 3SHLA 1HQRD 1F77A 1II3A 2BE5C 1SAPA 2BA1A 5FK9C 2EYHA 3G6JB 3H6MA 3GQBA 1JOOA 3ZYYX 1UEAB 1OO9B 3D6WA 5CV8A 2EJGC 3IFTA 1KLUD 1GXDC 1EQTA 1KAAA 5CC4A 1G8ZD 3P7JA 2K5QA 4XYOA 4DA2A 1GHJA 3JAME 1ENFA 5FO8B 3ITPA 4KY6A 1PRTD 3L3OC 1LTAD 5KIXA 4CKEA 1K8OA 1RD9D 2ZXRA 2EY2A 2NTSA 1Y1VB 3L7ZC 1FR3A 1D5MC 2EE1A 1X3PA 4B9XA 3BDLA 1HFNA 1TVXA 1RF2D 3J81E 1KDAA 3LX0A 1ZXTA 1I4HA 4WRDA 1QNUA 2B63B 3HGBA 5T1IA 4C3JB 5NUCA 1BNZA 1HA5A 2I46A 3PUXA 5M5YB 1SYEA 1VMCA 3DM1A 4ABNA 4F7XA 2HDMA 1V8QA 2IX0A 2RDFA 2BDOA 3PV0A 2KQ3A 4K6LA 3C3LA 4HR7B 3HRZC 1SE3A 4K2KA 4ZRZA 1MD2D 4DK1A 3MFYA 3R2IA 4R8IA 2IWHA 3AB9A 5I2XA 1OXUA 4FXDA 1TWFB 5C5LA 1EYCA 4ZK9B 1LLRD 2XIWA 3HEJA 1O78A 4C2MB 5C0XJ 3D4RA 2B2VA 3V05A 1WTOA 2JA5B 3A56A 1EEFD 1UUPA 1B9NA 5JVH3 1W6JA 3J7AV 1E2ZA 1NR2A 2B39A 1AW7A 4DN4M 1G2TA 1NCVA 3NXWA 2K04A 2EYPA 2O2LD 5A2QE 4HEDA 4J1MA 2F0HA 5C3EB 1U9RA 3I8ZA 2EYOA 3GD7A 1V1PB 5D65A 1QE6A 5M3FB 3NSWA 1D5ZC 3TMEA 3VYRA 1EIHA 3HKZB 4DXFA 5FOBB 1D6EC 3I90A 2IW3A 5FO7B 3NBHA 2PMZB 3CU7A 4A3KB 4FXGC 5CV4A 3EA6A 1J9OA 2J4XA 4J8QA 2WINB 4N9TA 1H9SB 4DFAA 1DD2A 2F0MA 3ERQA 3PUVA 2L5TA 3OMCA 3CHBD 1PYWD 3HP3A 4KV6A 3DMUA 3URYA 2CQAA 3R3OA 5IGFA 3V2TA 1NSNS 5EKKA 3S16B 4FF4A 2KCCA 1A3TA 3QG1A 3M7GA 1VF5C 1B2TA 1R4PB 2NVXB 4M1UB 4X3TA 4KN4C 1CA5A 2PO4A 2N55A 4QUFA 1LTRD 3NQIA 3DWPA 3BYTB 5T1GA 1F9PA 5JOBA 1VDZA 2NN6H 4RA8A 4WORA 2K5WA 2L4NA 4KJOA 1BXTA 2F1MA 2MGSA 3DEOA 2RSOA 5KYLA 1ESFA 3A8KE 4ZLTF 1O80A 4LJZC 4C3HB 5BN3A 4NP5A 2ID0A 1L0YB 4PV1C 4X3UA 5CV6A 3H94A 3GTOB 3D3RA 3A7AB 2DY7A 2ENBA 4QCLA 2KOLA 2L9HA 5C4ZA 3FVQA 5BN5A 2J0TD 2K6AA 1YNJC 4ZKCB 1HUMA 1FNWA 4RKLA 3K6OA 1IL8A 2O5JC 5ELDA 5DM63 1YNJD 5KRUA 1RTNA 4PMBA 5A2QL 1PFNA 3QOJA 2B8GA 3PUZA 4I7ZC 4DNTB 3CQZB 4XIGS 1PMRA 2F0TA 1ZYRC 5IT9E 2B2YC 1CFMA 1BCPC 4OGQC 3OW7A 4UDUC 4OO1I 4ULLA 2EJFC 5JEAG 1HXYD 2F0GA 1ZYRD 3PMFA 3K5MA 4KHVA 2YU9B 3BVZA 4OL7A 3OOCA 1LV9A 1JE4A 1E2WA 1QCBD 2FMMA 1Z6HA 1QB5D 3TP5A 4TKOB 3H0GB 4EQOA 4DXGA 1SE2A 1Q1EA 3RD4A 1Q90A 2WKCA 3IAYA 3Q22A 2QEJC 3GTQB 1XYIA 1ONLA 1X32A 2KA7A 4RFBA 2Z4IA 2MHVA 1O7ZA 2CW0C 2QF7A 1EWCA 1TR5A 2RQXA 2Q8TA 3S17B 1M4VA 2H1EA 2NN6I 3S9WA 2ZXPA 2KEDA 2R7ZB 1WVLA 1WD1A 1GUSA 1GHKA 2WP8J 4JBWA 4V190 1EU3A 1PRTF 3EVQA 2R3ZA 3Q24A 1EZ6A 1CI3M 1HFGA 4EGVA 4C3HG 3SK8A 3GV3A 1QG7A 3GTMB 2F0PA 1K83B 1EYAA 1STNA 3M7NA 2XSCA 3J80E 3I3CA 1TU2B 2EYFA 3SE0A 3CRKC 4IFDG 1B9MA 2F0QA 4K2LA 1STBA 3MAQA 1LACA 1SEBD 4RH6A 1EL0A 2QILA 2O5IC 3T51B 2E75C 2A68C 4CKBA 4PMCA 1IKMA 1CHPD 1V43A 3OMGA 2Z1CA 3K5LA 4CHTB 1PTOB 5CGKA 3D6CA 4XT1B 3TP7A 1V1OA 2XRQD 5AFWA 1XTCD 1FYCA 3GP7A 2FMCA 2JA7B 5JAVA 4O42A 1S5ED 4HCSA 3T13A 1HCZA 1CQFA 4LMQD 2L55A 1KNAA 2NVQB 4IFDJ 2K1BA 1BO0A 4EQNA 1H9KA 5E1FA 2RDHA 1PFMA 3PUWA 2WAQB 1SNMA 5I4DA 1Y8NB 4TQUS 1PTOD 3RMHA 1SYFA 1L0XB 4HMIA 1RCVD 3ND9A 5C4XB 4DK0A 5DEHA 1EY7A 3NTHA 2RA4A 1LTSD 1PZKD 4A3DB 4OIKA 4G57A 4F87A 3NUCA 5EJWA 1B1ZA 1PRTB 2F0FA 2Z8LA 4V0BA 2IL8A 3NWTA 1OXTA 3R93A 4A3BB 3NK9A 2QCPX 3I4MB 1A3UA 2NYZD 1SXTA 3RLFA 1H9MA 1WD0A 2G9HD 2ICEC 3K5OA 4YIJA 3FPPA 4DF7A 3SXHA 3DHQA 3MA2B 2XNAC 3CRLC 4A3EB 5HURA 1GJXA 2NBFA 1GUWA 2BE5D 2SNMA 2F3WA 1A3VA 4RWSC 4BBSB 5K36H 2F3VA 1Z7TA 2AWOA 1YNNC 1JR0D 1MSGA 2VXWA 3NTKA 3KLSA 3HG9A 3IL8A 3SEBA 1B50A 1TWHB 3P1HA 4K8IA 3T53B 1TS4A 2EZVA 4A3IB 3GO5A 4A3MB 2K33A 1BUVT 2B2YA 4QUCA 5ELCA 5C0XI 2I07B 3PIO3 1DXMA 3VYSA 3Q23A 3QO2A 1F9RA 5ELFA 3C2PA 3VA5A 3KF8A 2RKSA 3TDQA 2RVLA 1HA6A 2AWNA 1SNCA 3FPUB 3Q6SA 4K14A 2JEAI 3R8BA 1SYDA 5I6YA 3FMCA 4RGOS 2L11A 3A8JE 4M8AA 3VR4A 3IKJA 1WTRA 4XQQA 2F0SA 1TWGB 1VF7A 1AFPA 3L9AX 2PW7A 2B2TC 2M9VA 2BA0A 5CV7A 5HGTA 1I4PA 2AUJD 2DNEA 2LS01 1EY6A 1BF4A 2PZWA 4F8MA 4OIJA 4JK1C 2PPBC 5CORA 2FHTA 5EKLA 2AUKA 3LWUA 4PQXA 5ELEA 2NUCA 3FDTA 3OIPA 3RUZA 1FNVA 3NQTA 1TS2A 3VYUA 1SFOB 4IUQA 2A69C 2SDFA 1U4MA 3BG3A 2WKDA 3I4LA 1JB3A 1AZQA 4FF2A 3SK5A 1PZJD 1DOMA 3K5NA 4KN7C 4KKUA 1XWEA 1JQYD 5IGCA 2RBMA 5EPKA 4C1NI 3S14B 4H13C 3HOWB 1HTLD 4IURA 2E76C 1PXUA 3MC0B 5EQ0A 1C48A 1W6KA 1TWAB 3JAML 1TS5A 3HZXA 5EBCA 1G91A 2EJMA 4OO1H 1F2MA 1A2TA 1JWSD 2NZ1D 1UAPA 1A2UA 2A6HC 1EY9A 3RZOB 2A73B 1FD7D 1MSHA 3TP6A 2OF1A 5CMDA 4TSSA 1PZID 4B9WA 3VA7A 4ZQ3A 3J81L 1RODA 2AQ1B 1O7LA 3E0JA 3PIP3 4AYBB 1Q3LA 3H91A 2C5CA 4C1NK 2IX3A 1EY4A 5M5WB 1STYA 4K5VA 5TSSA 4X3SA 3TBIB 2PQEA 1G2SA 3BS1A 1VMPA 3EFXD 4CGYB 1MGSA 2KUMA 2EYLA 4A3JB 3DEPA 1S4ZA 1DONA 1OXSC 2LKVA 4RCOA 1CZGA 1JOQA 2E2HB 3DXJC 2TSSA 2LFNA 4ID6A 3SK4A 2R61A 2F0LA 1HRJA 1U4PA 1ILPA 1QWYA 4U673 3MXPA 1X3QA 2QKIC 3KBXA 3BDCA 3GTLB 2A6EC 2NB0A 1JCKB 1SYGA 2D2CC 4DAPA 2F0DA 2GA4B 3UI2A 3VYTA 2XWBB 5DM73 4PNYA 1LT3D 1BQQT 4IUUA 1HHVA 2B8FA 1ENAA 1MBYA 2D9UA 3IFDA 1U4RA 1Q12A 3GV6A 1TQOA 2OXPA 1WTQA 1B44D 3MWYW 1SNOA 4FYDA 3GTJB 3DWAA 1TWCB 1I4RA 3OWEB 1GOZA 4A3FB 3N52A 3TZUA 2V4DA 1ENCA 1PTOF 1AP0A 1IKLA 3MXUA 2FINB 2BCOA 2Z4HA 4G4KA 2F0JA 1S5BD 3W3AA 5I9PA 1SMYC 3I4NB 4K5WA 1BCPD 1F2YA 4R9WA 2F4IA 4OO1G 2D62A 2E2DC 3X3MA 2K7VA 4F88A 1Y8PB 2EY1A 3MXNA 3W2DA 1EY0A 3WDNA 5KNCA 2R93B 5C3XA 2B2TA 5IIFA 1KDBA 1G291 3OSOA 5LL6S 1PLFA 4RAUC 1SNDA 3J7AF 2YYZA 2JYOA 4K5XA 3KK7A 5EBDA 1CZWA 1NAPA 1JWMD 4N9PA 1GUTA 2CW0D 2OT2A 1I4GA 2EDGA 3LNNA 5I9OA 4IUPA 4I65A 2NN6G 2Y0SB 4HCEA 5JEAJ 5IGGA 2IX1A 3OIQA 1H9RA 1T5EA 3PUYA 1I6HB 3EQLC 2R6GA 3LWEA 2DY8A 4XQNA 2SEBD 4KD3A 1STEA 3ONAB 4Y7NB 2BOSA 1B4OA 2PYKA 2F03A 4MN3A 1EY5A 4RGNA 4IFDI 2K28A 4FNFA 2FFKB 1PDQA 2ICIA 1SSOA 4DNRB 1DM0B 1SE4A 5CV9A 2WIIB 5JJZA 4XYQA 1EEID 2M2LA 1RDPD 4MIUA 1LT6D 1SJED 2EY5A 3J7YW 2OEOA 2B2UC 5C0XH 1TS3A 4RKBA 2KCNA 1IW7C 2A68D 1DCZA 4DAVA 1TKWB 3M4YA 1FGBD 4BBRB 2NVTB 1EY8A 4X3KA 2CVRA 5I6WA 5E4XA 2IPKD 1GUNA 5C44B 2VUMB 2AQ3B 3KLSX 3PO2B 3S2HB 4KJNA 4GZYC 3M3YB 1Q1BA 1TY0A 5IOCA 5IT9L 4KTAA 1EYDA 5BN4A 4FF3A 3HOYB 3FEWX 2EPBA 1HUNA 5KEEA 1SNPA 4HSPA 1KTKA 3D31A 4KKSA 4K6DA 1KDCA 1GUOA 4XQJA 1HTPA 1I4QA 3M4OB 5C5MA 1A15A 5KNDA 5IGDA 3VR5A 4KI0A 4HMJA 2VNUD 1EOTA 5KYIA 2M00A 1S5DD 4FF1A 4C3IG 4ODGA 1BR9A 4FXKC 4A3GB 1IYUA 2EXZA 1ILQA 3SVMA 2E2JB 5C3WA 5D3DA 2RDGA 2JA6B 4KK7A 4L63B 3A55A 1M8AA 2DN8A 2JP1A 2VB3X 1LABA 3QWNA 1S5CD 3U9SA 4L6TB 3E5SA 4LK1C 4G7OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ID6 A;  1EY0 A;  3SK4 A;  5C4H A;  1EY8 A;  2F0K A;  2F0E A;  2F0L A;  4IZ8 A;  3C1F A;  5C3X A;  1SNM A;  1AEX A;  4QB4 A;  5I6W A;  5IGB A;  2KQ3 A;  4EQP A;  4DGZ A;  5IIF A;  1KDB A;  3MXP A;  4RKL A;  4K2K A;  3VA5 A;  4TRD A;  5CV4 A;  2F0I A;  4J6H A;  4H7B A;  4KY7 A;  1SYF A;  3EVQ A;  4HMI A;  3OSO A;  2RKS A;  5IGC A;  4K6D A;  5J1Z A;  4KJN A;  4N9T A;  3TP8 A;  3BDC A;  5F2D A;  4ZUJ A;  2RBM A;  2F0N A;  4S3S A;  4DFA A;  1EZ6 A;  1SND A;  1SNC A;  2F0M A;  2SNS A;  3C1E A;  3ERQ A;  4KD4 A;  1SYG A;  5IOC A;  5KRU A;  4K14 A;  4PMB A;  5C5L A;  4KTA A;  3OMC A;  2F0D A;  4K5X A;  1EYC A;  1EYD A;  1SYD A;  3SK8 A;  5I6Y A;  4KV6 A;  5KEE A;  3DMU A;  4IUN A;  4PNY A;  4R8N A;  3HEJ A;  3R3O A;  5DEH A;  2F0P A;  2O4X A;  1EY7 A;  1EYA A;  1SNP A;  1STN A;  3QOJ A;  4N9P A;  1NSN S;  5EKK A;  3SHL A;  3V2T A;  1II3 A;  1STH A;  5KIX A;  5I9O A;  2EYH A;  2EYF A;  4G57 A;  1ENA A;  3NUC A;  5CV5 A;  1EZ8 A;  3H6M A;  1A3T A;  1KDC A;  2EYM A;  3HZX A;  2F0F A;  2F0T A;  2QDB A;  3NP8 A;  4HTH A;  3SK5 A;  4E6I A;  5K5P A;  1JOO A;  4I65 A;  3T16 A;  1STA A;  4NDX A;  4KY5 A;  5KGU A;  1TQO A;  5KYI A;  1F2M A;  1A2T A;  2F0Q A;  2OXP A;  5IGG A;  5M9O A;  5J22 A;  1A2U A;  2F0S A;  5CV8 A;  4K2L A;  1STB A;  1EY9 A;  4QF4 A;  1SNQ A;  4QMG A;  3SK6 A;  1SNO A;  3MZ5 A;  1KAA A;  3NK9 A;  3D4W A;  3TP6 A;  2HQE A;  5C5M A;  1EQV A;  2PW7 A;  3P75 A;  4ME5 A;  5CC4 A;  2OF1 A;  3NXW A;  4KD3 A;  1A3U A;  2PZT A;  5IGD A;  2F0G A;  3MVV A;  5CR3 A;  5CV7 A;  5HGT A;  3ITP A;  4KY6 A;  1JOK A;  3ERO A;  4B9W A;  2EYP A;  3PMF A;  4PMC A;  3NHH A;  4KHV A;  4ZQ3 A;  5IOD A;  2PYK A;  4HMJ A;  4LAA A;  4OL7 A;  1EY6 A;  1SYC A;  2M00 A;  2PZW A;  3OMG A;  4K8J A;  4YIJ A;  2EY6 A;  5JOB A;  5IGE A;  5E3F A;  4WOR A;  4DF7 A;  4DU9 A;  2WAC A;  3EJI A;  3SXH A;  4F8M A;  1ENC A;  1NUC A;  1EY5 A;  3DHQ A;  3MEH A;  3SR1 A;  5CGK A;  1KAB A;  2EY2 A;  3D6C A;  4KJO A;  4NMZ A;  4ODG A;  2F0W A;  3TP5 A;  1TT2 A;  3D4D A;  4EQO A;  3TP7 A;  1EY4 A;  5HUR A;  5EKL A;  2EYJ A;  5J39 A;  4B9X A;  1STY A;  3BDL A;  4J1M A;  4K5V A;  5KYL A;  2EXZ A;  2F0H A;  2KHS A;  2SNM A;  2PQE A;  2F3W A;  1A3V A;  1JOR A;  2F0O A;  5C3W A;  2NUC A;  5CV9 A;  3MHB A;  2PW5 A;  1RKN A;  5EGT A;  4NKL A;  3RUZ A;  5E1F A;  2F3V A;  1IHZ A;  1KDA A;  1U9R A;  2F0J A;  5JAV A;  3LX0 A;  5I9P A;  2PZU A;  3NQT A;  4EVO A;  4MIU A;  2EYO A;  3T13 A;  4K5W A;  1STG A;  2EY5 A;  5ISR A;  3QOL A;  4ZUI A;  4NP5 A;  1F2Y A;  2OEO A;  4WRD A;  5C6A A;  2EYL A;  3TME A;  1TR5 A;  1F2Z A;  5NUC A;  5CV6 A;  4RKB A;  3U9O A;  2F0U A;  3D8G A;  3P1H A;  2LKV A;  3QB3 A;  4K8I A;  5DAU A;  1SYE A;  2ENB A;  4IAL A;  5IGF A;  3E5S A;  1JOQ A;  2SOB A;  4EQN A;  4F7X A;  5C4Z A;  3S9W A;  1SYB A;  2EY1 A;  2RDF A;  2F0V A;  3OWF A; 
#chains in the Genus database with same CATH topology
 1RTO A;  4A3E H;  4JI2 L;  1VQJ A;  4P72 A;  4IN3 A;  4EQP A;  3J80 L;  1LTI D;  2F0I A;  4BS9 A;  4H7B A;  4BBS H;  5LMN L;  3S1Q B;  1OXV A;  3KOJ A;  2NTT A;  4IJH A;  2K03 A;  4JOI C;  3TP8 A;  1PRT C;  2Q8I B;  4ZUJ A;  1I3Q B;  2F0N A;  3C1E A;  4KD4 A;  2ALY B;  2AQ2 B;  2KCM A;  5AJ3 Q;  4CDD C;  5CBE E;  3NWS A;  4UP9 A;  1NR4 A;  1YNN D;  3BVM A;  3H3V H;  3N6R A;  2K14 A;  1XMO L;  1TWH H;  3K0Y A;  2RSN A;  4R8N A;  4LFB L;  2VQF Q;  4A3I H;  2JEB I;  3A8I E;  2BDN A;  4A3M H;  4JI4 L;  1STH A;  3QJY A;  2ZJR A;  5L37 A;  4CKC A;  1EZ8 A;  1WTX A;  2EOT A;  3K59 A;  1X65 A;  1I4X A;  3T16 A;  2D5D A;  2OTL A;  1FNU A;  5JPN C;  1I6V C;  3KLR A;  3P20 A;  4QF4 A;  5C0X G;  1K3R A;  1YBY A;  3KUP A;  4IOC A;  2MP1 A;  1HR0 Q;  3SK6 A;  1G6Z A;  4BY1 G;  1TII D;  2JK8 A;  5DLQ E;  1EQV A;  3GDE A;  5IWA L;  3BU2 A;  4DAY A;  3T4A C;  3AU7 A;  3PO2 G;  5M5Y H;  5IYB G;  1QNK A;  4UAI A;  3ERO A;  2JA9 A;  4JI5 L;  3H15 A;  3NHH A;  4NXN L;  1GD7 A;  4DUZ Q;  1GUG A;  5E4W C;  4DV0 Q;  2WAC A;  4HJ5 A;  5DNF A;  3MEH A;  3SR1 A;  1KAB A;  1NMG A;  4NMZ A;  1WTW A;  4XT3 B;  1A63 A;  3D4D A;  4R4Q A;  4JPB W;  3T56 B;  3TSS A;  4BA1 I;  1CA6 A;  3QIA A;  3H3V C;  5IYD H;  1HPC A;  2NWG A;  3HOV B;  4LUV A;  1BDO A;  4IUV A;  1O7Y A;  3MFG A;  3AYH B;  1SBB B;  1BBX C;  2X6L A;  4NKL A;  2MQH A;  2I5M X;  1KL9 A;  4N8F A;  1IHZ A;  1YI2 A;  1TWF H;  4Q5V A;  1WCM B;  4P2C B;  1SRO A;  4EVO A;  2PI2 E;  2HT1 A;  1QUQ A;  2KEN A;  4DV3 L;  1IBL L;  1DOL A;  1HQM C;  2WB1 G;  4GOP C;  4BA2 I;  4C2M H;  1DYQ A;  4BWG B;  1B8A A;  3Q8D A;  4YWM A;  1S40 A;  1MHW C;  4LFB Q;  2ZJP A;  1EQR A;  3FKI B;  1D1K A;  4H0L C;  3J81 i;  2JA5 H;  3DWQ A;  5FO9 B;  3I55 A;  2F0K A;  1MI2 A;  2MPM A;  4P75 A;  3KJP A;  1PA6 A;  4QY7 A;  4IPG A;  5G3L D;  1QOH A;  2XRS D;  3TN2 A;  1PH1 A;  4KY7 A;  1Q8I A;  2UUA L;  1EIG A;  1EU4 A;  5LL6 X;  4YWK A;  3H09 A;  3I72 A;  4CJ1 B;  5KGU A;  2SNS A;  2HCI A;  1A6X A;  4X64 Q;  2CWA A;  1SFO H;  1GO3 E;  4DR6 Q;  1CT1 D;  2FJ2 A;  4UHV A;  3PO3 B;  1WTP A;  1YIT A;  4Z9C B;  2A69 D;  4HSV A;  3U4Z A;  5C3E H;  1SJH D;  3BYY B;  4XXE A;  1STA A;  1Z9F A;  1BCP F;  4CJ0 B;  1L1O B;  5JVG 3;  3K7A B;  1WJJ A;  1N34 Q;  1SNQ A;  1LYL A;  3L2P A;  4QMG A;  2HUG A;  3D4W A;  3HOZ B;  2B2U A;  4ME5 A;  4HIO A;  5EPL A;  3TRE A;  1HNZ L;  2PZT A;  4JI3 L;  3MVV A;  5CR3 A;  3S14 H;  5D3I B;  1SRU A;  1NBW A;  1LTG D;  2A74 C;  4A76 A;  2K32 A;  5K36 G;  3MTS A;  1SYC A;  3F2U A;  5IGE A;  1Z47 A;  4N8X 1;  4BXX G;  3HOX B;  4QQB X;  2L12 A;  1NUC A;  1TWA H;  4A3K H;  3JC6 6;  3A54 A;  4MHE A;  3CCS A;  5J39 A;  1VQF A;  2JA8 B;  4IQZ A;  3E6Z X;  2KHS A;  3E9H A;  3DUZ A;  1R4Q B;  5JEA H;  3Q0A A;  1UE7 A;  3RZO H;  4X65 L;  2PNH A;  2R7D A;  3MHB A;  3I73 A;  2B2W C;  1CUK A;  2L0C A;  1Y1V G;  2FXQ A;  5FKA C;  2PZU A;  5IYC H;  4NB3 A;  1B53 A;  2KEE A;  5FLX E;  1D2B A;  2A6H D;  1E2V A;  1STG A;  1D5X C;  3HOU B;  3NEN A;  1VQ5 A;  4KMU C;  3S2D B;  3D8G A;  4ZAI A;  5DAU A;  4WFN 3;  4LF9 L;  1Y69 U;  1IYJ B;  2VB2 X;  1EFW A;  4A3C G;  1SYB A;  2B63 G;  5D14 A;  1K0S A;  1I94 L;  4C3J G;  5M5W H;  2NVX H;  2K4K A;  4X62 L;  3PIO A;  4JI0 L;  5IGB A;  4C56 C;  2Q2U A;  4NPS A;  1B3A A;  1IBK L;  2X6G A;  4B3M L;  4ME3 A;  1X9N A;  5F2D A;  1HNZ Q;  1WCM G;  4JI3 Q;  3VR6 A;  1VCI A;  2E8G A;  3CCU A;  3TS0 A;  1HJP A;  4A3J H;  1JWU D;  4A93 B;  4BY7 B;  3RZD B;  2O4X A;  1MKH A;  3NBI A;  5GQO A;  3IRB A;  3GTK B;  3I91 A;  2A5H A;  2EVB A;  3ND8 A;  2H4O A;  2QDB A;  3NP8 A;  2LY7 A;  2DNC A;  4IUT A;  4KY5 A;  2MUY A;  1LTB D;  2WB1 E;  1G6P A;  1PFS A;  4X65 Q;  1CHQ D;  2HQL A;  4C3H H;  4RHS A;  2QW7 A;  1LT4 D;  1RHP A;  1F9Q A;  4CJ2 C;  1AZP A;  1QJO A;  3GTL H;  3GTO H;  1UNS A;  4JI7 L;  1EOV A;  1JJ2 A;  5J3B A;  1RIP A;  4RGT A;  5LHY 1;  4IFD H;  1Y1W B;  1U5K A;  2A6E D;  3WOE A;  5E3F A;  4DU9 A;  1BCP B;  2ZXO A;  3RLO A;  4HAE A;  1QVG A;  1C8C A;  5EPJ A;  5IP9 H;  1TT2 A;  1C4Q A;  3V96 A;  1Y8O B;  4OHJ A;  4JOI A;  1JOR A;  2CHB D;  2HCC A;  1BOS A;  1T5X D;  3CCE A;  2UXC L;  4RCN A;  3GTJ H;  3K57 A;  1PFB A;  1AE3 A;  3BJU A;  4H02 A;  4IPC A;  4XTC S;  3WOF A;  1QVF A;  1S3O A;  4ZKB B;  4ZUI A;  4MZ9 A;  4A3F H;  1XNQ L;  2J7Z A;  4WJ4 A;  4JW0 A;  3CCL A;  3NPP A;  5C4J B;  3MXG A;  5ELB A;  2KHI A;  1SDF A;  5M3F G;  1N32 L;  1S5F D;  3C1F A;  1C9O A;  2K01 A;  2ZT9 C;  2RF4 A;  1K9M C;  5M5X B;  1AEX A;  3HKZ G;  1BKB A;  3UDX A;  4DGZ A;  3GTP B;  4EQ5 A;  1X55 A;  2NVY B;  2IHF A;  1LTL A;  4IPD A;  4A3K G;  5J22 A;  4S3S A;  1QUQ B;  1WTV A;  5I2Y A;  1U4L A;  2A1A A;  5EKI A;  4TVA B;  1SMY D;  4CBV A;  3HOU G;  4IUN A;  1PYS B;  1J5E Q;  2F4V Q;  1F9S A;  3R2T A;  1ESR A;  5IY0 A;  3S1M B;  1HNW L;  2XVS A;  5IYC G;  2YTV A;  5CV5 A;  1E0B A;  5GAG C;  1DZ1 A;  3G4S A;  4E6I A;  4HTH A;  5FLX L;  4RHR A;  2R93 H;  2PNR C;  1K8M A;  4AQY Q;  3TZD A;  5M9O A;  1QIL A;  1XMQ Q;  1CTM A;  2K05 A;  3C46 A;  4DR3 Q;  4GOP A;  2HQE A;  3P75 A;  1EFI D;  4B08 A;  1N33 L;  1VQ8 A;  1J8I A;  2R92 B;  3G7L A;  1LO5 D;  4APV A;  4C3I B;  2UUB Q;  3I4O A;  4DR7 L;  3NEM A;  2JXM B;  4KKT A;  4LAA A;  1ASY A;  4K8J A;  2V1C C;  1QZG A;  3BDO A;  2JE6 I;  3EJI A;  3F8T A;  4MNO A;  3PIP A;  1N32 Q;  2F0W A;  2UXD Q;  4G7Z C;  1ML0 D;  1PV4 A;  1HZA A;  4PMW A;  4IJL A;  4FP5 D;  3KBG A;  2B2V C;  2IJ0 A;  1IZ6 A;  2PW5 A;  1RKN A;  1I6H H;  3RN2 A;  1H9J A;  2G9D A;  4H44 C;  4GN4 B;  2K5D A;  1KIX A;  3AMU A;  3GTG B;  1YJ9 A;  5H1S E;  3OHX C;  2LMC B;  2X69 A;  2WV6 D;  4FO2 A;  3GTM H;  1K83 H;  2D0P A;  3QOL A;  4Y7N H;  1K73 C;  1KXL A;  2MJ8 A;  3SGI A;  5C6A A;  1TY2 A;  1GM5 A;  5M3M B;  1F2Z A;  1R9T B;  4DR5 Q;  2TMP A;  4LFC L;  3QB3 A;  3S1N B;  2ASB A;  2F52 A;  1ZKO A;  1I50 B;  1D1I A;  2KJX A;  2SOB A;  4JCV E;  2F0V A;  1KRS A;  4FVM A;  5C4H A;  1RJT A;  5CYU A;  4IZ8 A;  2PCF B;  1DJR D;  3BZK A;  5LMU L;  4Q0F A;  1WTH A;  1ET9 A;  4L8J A;  1JJC B;  2XWJ B;  3BZD B;  2E74 C;  1XX8 A;  4KHZ A;  4L5Q A;  2K5H A;  3B6Y A;  1AN8 A;  4QIW B;  3SDZ A;  3T1H Q;  1PTO H;  3RLN A;  1IXR A;  1ZEQ X;  2Q8R E;  1NE3 A;  1OXX K;  4O1N A;  2BH8 A;  3A7L A;  4HN7 A;  3I7F A;  2OCE A;  4DKA C;  4DAM A;  4BBR H;  5A35 A;  5CBA E;  1IW7 D;  2B2W A;  2EYM A;  4BY1 B;  5K5P A;  4NDX A;  3CKI B;  5FJ8 G;  1YHQ A;  2N88 A;  3X3N A;  3MZ5 A;  5KNB A;  3K58 A;  2L1B A;  3FRP B;  5C44 H;  2VUM H;  4U68 A;  3J80 i;  3S2H H;  2NVQ H;  4DUY L;  1V1P A;  3M3Y H;  2CH4 A;  1AE2 A;  3RR5 A;  1DOK A;  4B3S L;  1JOK A;  1F2L A;  3CC2 A;  2JSO A;  4ZYS A;  3HOY H;  5IOD A;  2XN9 C;  3BVG A;  2EY6 A;  1EIY B;  4LF4 Q;  5G3L F;  2HDL A;  1D7Q A;  2EYJ A;  1PTO C;  4FDB A;  1YZ6 A;  4NW2 A;  4UY8 C;  4DV5 Q;  2KVM A;  1LT5 D;  2WB1 B;  2F0O A;  5C4X H;  3A0J A;  3E3X A;  5EGT A;  3S15 B;  3H0G G;  1PH9 A;  2B3G A;  5COY A;  3CP0 A;  1VQB A;  4LFA L;  1ET6 A;  1H9S A;  4RGM A;  5ISR A;  2E2I B;  1B3Q A;  1CQV A;  3HS0 C;  2R92 G;  3U9O A;  2F0U A;  1JIC A;  4ILW A;  3FP9 A;  1CM9 A;  4WJW A;  4OEL B;  1K3B C;  4IAL A;  3VR2 A;  3O13 A;  4LW1 A;  3NE5 B;  3NTI A;  2KEC A;  2IT1 A;  1PH4 A;  2P5Z X;  4DNI A;  3OWF A;  2IY5 B;  4XDX A;  3VR3 A;  2F0E A;  1YJN A;  4A3G H;  4B3R Q;  2KCT A;  1XXG A;  1IYV A;  4QB4 A;  1JC7 A;  4DK3 C;  4WJ3 M;  4TRD A;  1KNE A;  4J6H A;  3M85 A;  2R7Z G;  3KDF A;  5J1Z A;  2I5L X;  3I70 A;  3OPO A;  1KLG D;  4JI6 L;  1EWH A;  2C9O A;  1LTT D;  3S1R B;  4G7H C;  1CK1 A;  1ICW A;  3CAM A;  5JPM C;  4X66 L;  3SHL A;  1HQR D;  1H95 A;  1F77 A;  2I0Q A;  4LF5 L;  1II3 A;  2BE5 C;  1SAP A;  2BA1 A;  5FK9 C;  2EYH A;  3G6J B;  3H6M A;  3GQB A;  4JVZ A;  1JOO A;  3CC7 A;  3ZYY X;  1UEA B;  1OO9 B;  4YCW A;  2MNA A;  3D6W A;  5CV8 A;  2EJG C;  3IFT A;  1KLU D;  1GXD C;  1EQT A;  1KAA A;  3S1Q H;  4LFA Q;  5CC4 A;  1G8Z D;  2JN4 A;  3P7J A;  2K5Q A;  2RCF A;  2ZM6 Q;  4XYO A;  4DA2 A;  1I3Q H;  1GHJ A;  3JAM E;  3E9I A;  3E0E A;  1ENF A;  5FO8 B;  3ITP A;  4KY6 A;  2OQ0 A;  1IBM L;  1PRT D;  3L3O C;  4DV1 L;  1LTA D;  5KIX A;  4CKE A;  3MXN B;  4PG3 A;  1K8O A;  1RD9 D;  2ZXR A;  2EY2 A;  1K0R A;  2NTS A;  1Y1V B;  3L7Z C;  1FR3 A;  1D5M C;  2EE1 A;  1X3P A;  4R4O A;  4B9X A;  3BDL A;  1HFN A;  1TVX A;  1RF2 D;  2ZTE A;  4R1J A;  3J81 E;  4HJ9 A;  4GOP B;  4DV2 L;  1KDA A;  1NNX A;  3LX0 A;  3CPF A;  1K28 A;  1ZXT A;  1I4H A;  4JBK A;  4WRD A;  1QNU A;  2JA7 G;  2B63 B;  3HGB A;  3KJO A;  5T1I A;  4C3J B;  5NUC A;  1BNZ A;  1HA5 A;  2I46 A;  3PUX A;  2I5H A;  4JI2 Q;  5M5Y B;  1SYE A;  1VMC A;  3DM1 A;  2NZH A;  4ABN A;  4F7X A;  2HDM A;  1V8Q A;  2IX0 A;  2RDF A;  1Q46 A;  4YHH L;  1TWG H;  1K8A C;  2BDO A;  3PV0 A;  3CCJ A;  5LMN Q;  4PZ6 A;  2EXD A;  3HOV H;  2KQ3 A;  4K6L A;  3C3L A;  4HR7 B;  3HRZ C;  1SE3 A;  4K2K A;  4ZRZ A;  1MD2 D;  4DK1 A;  3MFY A;  2DGY A;  3R2I A;  2WAQ G;  4R8I A;  1XMO Q;  2IWH A;  4O2D A;  3AB9 A;  5I2X A;  1OXU A;  4CDC C;  4FXD A;  1TWF B;  5C5L A;  1EYC A;  4ZK9 B;  4JI4 Q;  1LLR D;  2XIW A;  3HEJ A;  1V9P A;  3FKI H;  1O78 A;  4C2M B;  5C0X J;  3D4R A;  2B2V A;  2BH2 A;  4LNQ A;  1XNR L;  3V05 A;  1WTO A;  2JA5 B;  3A56 A;  1EEF D;  1UUP A;  5IWA Q;  4A3D G;  2RHS B;  1B9N A;  5JVH 3;  1W6J A;  3J7A V;  1E2Z A;  1NR2 A;  2B39 A;  1AW7 A;  4DN4 M;  1G2T A;  1NCV A;  1UE5 A;  3UDG A;  4JI5 Q;  3NXW A;  4NXN Q;  5IE8 A;  2L15 A;  2K04 A;  4A3B G;  5IP7 H;  2EYP A;  1D8L A;  1MIU A;  3I4M G;  5GRO A;  3QR8 A;  2YTX A;  3PO3 H;  2O2L D;  4DV4 L;  5A2Q E;  1BBU A;  4HED A;  3KF6 B;  4J1M A;  1KC8 C;  3CC4 A;  2F0H A;  3K7A H;  5C3E B;  1YHB A;  4DV3 Q;  1IBL Q;  1W3S A;  3HOZ H;  4A3E G;  1U9R A;  3I8Z A;  2EYO A;  4DR2 L;  3HOW H;  3GD7 A;  1M1K C;  1V1P B;  5D65 A;  1QE6 A;  5M3F B;  3NSW A;  1D5Z C;  3TME A;  4A4I A;  4HID A;  4BBS G;  2C35 B;  3VYR A;  4A3L H;  1EIH A;  3HKZ B;  3HOX H;  4DXF A;  5FOB B;  2E5L L;  1D6E C;  3I90 A;  4HIM A;  2IW3 A;  5FO7 B;  3NBH A;  3M4P A;  2JA8 H;  2PMZ B;  3CU7 A;  4R4I A;  4A3I G;  4A3K B;  2UUA Q;  4FXG C;  4A3M G;  1A0I A;  1P16 A;  5CV4 A;  4QIW E;  1N8R C;  3EA6 A;  1J9O A;  2J4X A;  4B3T L;  4J8Q A;  2WIN B;  4N9T A;  4UPA A;  1H9S B;  1P8L A;  4DFA A;  1DD2 A;  2F0M A;  3ERQ A;  1X3G A;  3PUV A;  2L5T A;  3OMC A;  3CHB D;  1PYW D;  3HP3 A;  4KV6 A;  3S2D H;  3DMU A;  3URY A;  2CQA A;  3CMA A;  3R3O A;  5IGF A;  3V2T A;  1NSN S;  5EKK A;  3S16 B;  3OYY A;  4FF4 A;  4YCU A;  4P74 A;  4PZ7 A;  1VQ9 A;  2KCC A;  1A3T A;  1NJI C;  4DR4 L;  3QG1 A;  3M7G A;  1VF5 C;  1PH2 A;  1B2T A;  1R4P B;  2NVX B;  4M1U B;  2CKZ B;  4X3T A;  4KN4 C;  4DR2 Q;  1CA5 A;  3KDF B;  2PO4 A;  5IYD G;  2N55 A;  4QUF A;  1A8V A;  1LTR D;  4JBM A;  1XJV A;  3NQI A;  3DWP A;  3BYT B;  5T1G A;  4A93 H;  4BY7 H;  3RZD H;  2E2H H;  1F9P A;  5JOB A;  1VDZ A;  2NN6 H;  4RA8 A;  4WOR A;  2K5W A;  2L4N A;  2E5L Q;  2DJG C;  4KJO A;  3K81 C;  3GTK H;  4YWL A;  1BXT A;  2F1M A;  2MGS A;  3DEO A;  1NY4 A;  2WAQ E;  2RSO A;  1VQE A;  3LGJ A;  5KYL A;  1ESF A;  5JJL A;  3A8K E;  3T1Y L;  1EYG A;  2JA5 G;  4ZLT F;  1O7I A;  1O80 A;  4LJZ C;  4GS3 A;  4C3H B;  5BN3 A;  2K50 A;  3A74 A;  4NP5 A;  2ID0 A;  2R7F A;  4LF9 Q;  1L0Y B;  4PV1 C;  1LM0 A;  2B29 A;  4OWX B;  4X3U A;  1QVC A;  5CV6 A;  1KAW A;  1Y1W H;  3H94 A;  3OTO L;  2VZA A;  3GTO B;  3D3R A;  3A7A B;  2DY7 A;  3ER0 A;  1I94 Q;  1UE1 A;  2ENB A;  4QCL A;  3U4V A;  2KOL A;  4X62 Q;  4JI0 Q;  2L9H A;  5C4Z A;  3PSI A;  3FVQ A;  3EIV A;  4QL5 A;  5BN5 A;  2J0T D;  2K6A A;  4DR4 Q;  2DJF C;  5FLM H;  4L5T A;  1IBK Q;  1YNJ C;  4ZKC B;  4OWW B;  4B3M Q;  1HUM A;  1TWC H;  1FNW A;  4RKL A;  4DV7 L;  3K6O A;  1IL8 A;  4DAY B;  3F2C A;  5C3E G;  2O5J C;  5ELD A;  4GKJ L;  1XTD A;  3JAM c;  5DM6 3;  2Q2T A;  1VQ6 A;  1YNJ D;  5KRU A;  5HGQ A;  1RTN A;  4PMB A;  2CFM A;  5A2Q L;  1PFN A;  1N36 L;  3CCV A;  2Q2I A;  3QOJ A;  2B8G A;  3PUZ A;  4I7Z C;  1SE8 A;  2D0O A;  4DNT B;  3CQZ B;  4XIG S;  1KHI A;  1PMR A;  2F0T A;  1HZB A;  5M5X H;  3CME A;  2ZJQ A;  3T1Y Q;  1ZYR C;  5IT9 E;  2B2Y C;  3GTP H;  1CFM A;  3I4N H;  1BCP C;  4OEM B;  3J81 c;  2NVY H;  4JI7 Q;  4OGQ C;  3OW7 A;  4UDU C;  3AEV A;  4OO1 I;  4ULL A;  2EJF C;  5JEA G;  1HXY D;  2F0G A;  1ZYR D;  3PMF A;  3K5M A;  1BBW A;  4KHV A;  2YU9 B;  3BVZ A;  3W5O A;  1SMX A;  4OL7 A;  3OOC A;  1DGS A;  3CPW A;  4OWT B;  1LV9 A;  1JE4 A;  1E2W A;  1TXY A;  1QCB D;  1Y14 B;  2FMM A;  1Z6H A;  1QB5 D;  4Y52 H;  3TP5 A;  4TKO B;  3S1M H;  2QEX A;  3H0G B;  4EQO A;  4DXG A;  3ZJY C;  1SE2 A;  1Q1E A;  3RD4 A;  1Q90 A;  2WKC A;  2UXC Q;  3IAY A;  3Q22 A;  4O0A A;  3K80 C;  4AYB G;  2QEJ C;  4DV7 Q;  3U50 C;  3GTQ B;  1XYI A;  1ONL A;  1X32 A;  1XNQ Q;  2KA7 A;  4RFB A;  1HR0 W;  1VQN A;  2Z4I A;  2MHV A;  4GNX C;  1O7Z A;  1YHA A;  2HHH L;  4C3I H;  2CW0 C;  1YNX A;  2QF7 A;  1EWC A;  4AH6 A;  2UXB L;  1TR5 A;  2RQX A;  1X3F A;  2DUD A;  2Q8T A;  4IO9 A;  3S17 B;  1M4V A;  4R4C A;  4OX9 L;  2H1E A;  2NN6 I;  4LF8 L;  3S9W A;  2ZXP A;  4A3J G;  1VQO A;  3UE1 A;  2Z6B A;  2KED A;  4HJ8 A;  2R7Z B;  1WVL A;  1WD1 A;  1GUS A;  1GHK A;  2WP8 J;  2VQE L;  4JBW A;  1FVI A;  3L0O A;  4V19 0;  2HIV A;  1EU3 A;  1PRT F;  3EVQ A;  4LF7 L;  2R3Z A;  3Q24 A;  1EWI A;  3GTG H;  2AKW B;  4DV6 L;  1C0A A;  1EZ6 A;  1CI3 M;  1HFG A;  4EGV A;  4C3H G;  2XGT A;  3SK8 A;  5M3M H;  1R9T H;  1HNW Q;  3ERS X;  3GV3 A;  1QG7 A;  3GTM B;  2F0P A;  3S1N H;  1K83 B;  1EYA A;  1STN A;  1YJW A;  3M7N A;  2XSC A;  3J80 E;  3I3C A;  1TU2 B;  2EYF A;  3SE0 A;  3CRK C;  4IFD G;  1B9M A;  2XTI A;  4JYA L;  2F0Q A;  1N9W A;  1E1T A;  1N33 Q;  4K2L A;  1STB A;  3MAQ A;  1LAC A;  1SEB D;  3ULL A;  4RH6 A;  3ULJ A;  5IP9 G;  1EL0 A;  2QIL A;  4DR7 Q;  2O5I C;  3CCQ A;  3J7A 5;  2HHH Q;  3T51 B;  2E75 C;  4GLA C;  2UXB Q;  2A68 C;  4L5R C;  4CKB A;  4RG1 A;  4PMC A;  4GKK L;  1GKH A;  1IKM A;  1CHP D;  1V43 A;  3OMG A;  2Z1C A;  2NVT H;  2CH4 W;  4YY3 L;  5BR8 L;  3K5L A;  4CHT B;  1PTO B;  3ULP A;  4OX9 Q;  1UE6 A;  5CGK A;  5ELN A;  4LF8 Q;  3D6C A;  4A3F G;  4XT1 B;  3W1G A;  3TP7 A;  4BY1 H;  2VW9 A;  1V1O A;  2XRQ D;  5AFW A;  4ALP A;  1XTC D;  1FYC A;  2OTJ A;  3PO2 H;  3GP7 A;  2FMC A;  5IYB H;  2AMC B;  2JA7 B;  2EQS A;  4O42 A;  5JAV A;  1S5E D;  4HCS A;  1NTG A;  3T13 A;  1HCZ A;  1CQF A;  4CDF C;  4LFC Q;  3HKZ E;  4R4T A;  4LMQ D;  3CCR A;  2L55 A;  4JI1 L;  1KNA A;  1Q8K A;  1OTC A;  2NVQ B;  4GLV B;  3U58 A;  4X6A H;  3I4N G;  4IFD J;  2K1B A;  2PMZ E;  1BO0 A;  2KBN A;  2Z0S A;  5LMU Q;  4EQN A;  1H9K A;  5E1F A;  2RDH A;  1PFM A;  3PUW A;  2WAQ B;  1SNM A;  3M4O H;  1FGU A;  5I4D A;  1Y8N B;  4DK6 C;  3S15 H;  1I5F A;  4TQU S;  1PTO D;  3RMH A;  1SYF A;  1L0X B;  4HMI A;  1RCV D;  3ND9 A;  4POG A;  2R93 G;  1WFQ A;  5C4X B;  4DK0 A;  1YIJ A;  3EN2 A;  5DEH A;  4UP8 A;  1EY7 A;  4YY3 Q;  3NTH A;  4AYB E;  1MJC A;  2RA4 A;  2QGQ A;  1LTS D;  1PZK D;  4A3D B;  4OIK A;  4G57 A;  4F87 A;  3J81 j;  4JG2 A;  3NUC A;  5EJW A;  1B1Z A;  1PRT B;  2E2J H;  2F0F A;  1WOC A;  1PH5 A;  2JA6 H;  2Z8L A;  4LF6 L;  1SLJ A;  4V0B A;  2IL8 A;  3NWT A;  4DUY Q;  1OXT A;  3R93 A;  4A3B B;  3NK9 A;  2QCP X;  4B3S Q;  1VQH A;  3I4M B;  2Y0S G;  1A3U A;  2NYZ D;  3VDY A;  1SXT A;  3RLF A;  1ASZ A;  1H9M A;  3CXC A;  1Q81 C;  3S1R H;  1WD0 A;  2G9H D;  2ICE C;  3K5O A;  4YCV A;  1Q82 C;  4YIJ A;  3FPP A;  4DF7 A;  3SXH A;  3DHQ A;  3MA2 B;  2XNA C;  3CRL C;  1PH8 A;  2YV5 A;  3K0X A;  4DV0 L;  5HUR A;  4A3E B;  2ATW A;  1GJX A;  2NBF A;  1GUW A;  2BE5 D;  3AFP A;  2SNM A;  2F3W A;  1A3V A;  3CD6 A;  4RWS C;  4PZ8 A;  4BBS B;  3AQQ A;  5K36 H;  2F3V A;  1Z7T A;  2Z6K C;  2AWO A;  1YNN C;  2N8N A;  2QA4 A;  3CF5 A;  4BXX H;  1JR0 D;  1MSG A;  2VXW A;  2VY3 A;  3NTK A;  3PF4 A;  3KLS A;  3HG9 A;  3CW2 C;  3IL8 A;  1V1Q A;  1KQS A;  3SEB A;  3TQY A;  2MO0 A;  1B50 A;  1TWH B;  3P1H A;  4K8I A;  3T53 B;  1TS4 A;  2EZV A;  2KHJ A;  4A3I B;  3GO5 A;  4A3M B;  2K33 A;  1BUV T;  2B2Y A;  1Y1V H;  4QUC A;  5ELC A;  5C0X I;  2I07 B;  3PIO 3;  4KHP L;  1DXM A;  4LF6 Q;  3VYS A;  3Q23 A;  5IT9 c;  3QO2 A;  1F9R A;  3EBE A;  1S72 A;  5ELF A;  3C2P A;  3VA5 A;  1E7Z A;  4BBR G;  2EIF A;  3KF8 A;  2RKS A;  1JB7 A;  4JI6 Q;  2QDL A;  3TDQ A;  2RVL A;  1HA6 A;  2AWN A;  4X66 Q;  1SNC A;  1FJG L;  3FPU B;  3Q6S A;  4K14 A;  3G71 A;  4LF5 Q;  1VQG A;  3R8B A;  4LWC A;  2B63 H;  2JEA I;  4A3C H;  1SYD A;  5I6Y A;  3FMC A;  1VQ4 A;  4C3J H;  4RGO S;  5C44 G;  2VUM G;  2L11 A;  1NMF A;  3A8J E;  3KFU A;  4X64 L;  3WWV A;  4DR6 L;  4M8A A;  3HOY G;  3VR4 A;  1X3E A;  1VQL A;  3PF5 A;  3IKJ A;  1WTR A;  4GNX A;  1WCM H;  4XQQ A;  2F0S A;  1PHJ A;  1TWG B;  3JAM i;  1VF7 A;  1AFP A;  3L9A X;  2HIX A;  2PW7 A;  2YTY A;  1N34 L;  1VS0 A;  2B2T C;  2GN5 A;  1IBM Q;  2M9V A;  4DV1 Q;  2BA0 A;  1EQQ A;  5C4X G;  5CV7 A;  5HGT A;  1I4P A;  2AUJ D;  2DNE A;  2LS0 1;  2PI2 A;  4HJ7 A;  1EY6 A;  1BF4 A;  2PZW A;  4F8M A;  1T9H A;  4OXP A;  4OIJ A;  4JK1 C;  2PPB C;  5COR A;  4GN3 B;  2UUC L;  2FHT A;  4KHP Q;  5GAD C;  5EKL A;  2AUK A;  3AFQ A;  3LWU A;  3UDI A;  4PQX A;  4DV2 Q;  2G5D A;  5ELE A;  4UP7 A;  2NUC A;  3FDT A;  3OIP A;  1SN8 A;  1W2B A;  3RUZ A;  1B70 B;  1FNV A;  4A3G G;  2K75 A;  1TS2 A;  3NQT A;  4A75 A;  4IOA A;  2MFI A;  2GVA A;  3RNU A;  1FJG Q;  3VYU A;  1Q86 C;  1SFO B;  4IUQ A;  4EX5 A;  2JA6 G;  2A69 C;  2SDF A;  1U4M A;  3BG3 A;  2WKD A;  3I4L A;  2WFW A;  4YHH Q;  1JB3 A;  3J80 c;  1AZQ A;  4FF2 A;  1ICF B;  1KRT A;  1WI5 A;  3SK5 A;  4MTN A;  1PZJ D;  1DOM A;  3K5N A;  1Q7Y C;  2Y0S E;  4P73 A;  4QJF A;  1G51 A;  4KN7 C;  1HNX L;  4JV5 L;  1C7Y A;  2N78 A;  4KKU A;  4L5S A;  1XWE A;  3TEH B;  1JQY D;  5IGC A;  3A5Z B;  2RBM A;  5EPK A;  1VQ7 A;  1A62 A;  5M3F H;  4C1N I;  3S14 B;  4H13 C;  3HOW B;  1HTL D;  4IUR A;  1BVS A;  2E76 C;  1XNR Q;  1PXU A;  3MC0 B;  5EQ0 A;  1C48 A;  3HKS A;  1J6Q A;  1W6K A;  5ELO A;  3S24 A;  1TWA B;  3JAM L;  1M90 C;  2UUC Q;  3H3V I;  5JJK A;  2MO1 A;  1TS5 A;  3HZX A;  4DPG A;  5EBC A;  1G91 A;  2RHQ B;  2EJM A;  4OO1 H;  1F2M A;  1A2T A;  1JWS D;  3G48 A;  2NZ1 D;  1UAP A;  2LXJ A;  1A2U A;  4AIM A;  1U0L A;  3DM3 A;  2A6H C;  1EY9 A;  3RZO B;  3I56 A;  2A73 B;  1FD7 D;  3MEF A;  1MSH A;  3TP6 A;  3HOU H;  1L1O C;  1WYD A;  1FL0 A;  2OF1 A;  5CMD A;  1CSQ A;  1E22 A;  4TSS A;  1HH2 P;  3A5U A;  1PZI D;  4B9W A;  3VA7 A;  4RMF A;  4ZQ3 A;  1XPR A;  3HFZ B;  3J81 L;  1E3P A;  1ROD A;  2AQ1 B;  1O7L A;  4DV4 Q;  3E0J A;  3PIP 3;  2LXK A;  1Q3L A;  4AYB B;  3H91 A;  3S16 H;  2C5C A;  2HD3 A;  2N3S A;  1RL2 A;  4C1N K;  4MTK A;  2IX3 A;  1EY4 A;  3FHW A;  5M5W B;  1E24 A;  1STY A;  4K5V A;  5TSS A;  2UU9 L;  4HJA A;  4X3S A;  1HNX Q;  3TBI B;  4JV5 Q;  2PQE A;  4I7A A;  4LUZ A;  3RN5 A;  1G2S A;  3BS1 A;  2CWP A;  1VMP A;  3EFX D;  1LUZ A;  4K0K L;  2Q2H A;  3HOV G;  1CKN A;  3TRZ A;  4CGY B;  1MJE A;  1MGS A;  2KUM A;  2EYL A;  4A3J B;  3DEP A;  1S4Z A;  1DON A;  1OXS C;  2LKV A;  4RCO A;  3M9B A;  2JQO A;  1CZG A;  2GVB A;  1JOQ A;  2E2H B;  3DXJ C;  2TSS A;  3UDF A;  2LFN A;  4ID6 A;  3SK4 A;  2R61 A;  2F0L A;  1HRJ A;  3FKI G;  1U4P A;  1ILP A;  1QWY A;  4POF A;  4B3T Q;  4U67 3;  3MXP A;  3K7U C;  1X3Q A;  2CQO A;  2QKI C;  2PQA A;  3KBX A;  3BDC A;  3GTL B;  5JJI A;  2A6E C;  2NB0 A;  1JCK B;  1SYG A;  2D2C C;  4DAP A;  2F0D A;  2GA4 B;  3UI2 A;  3VYT A;  4NXM L;  2XWB B;  5DM7 3;  4PNY A;  1LT3 D;  1X54 A;  1BQQ T;  1SR3 A;  1B7Y B;  4IUU A;  1HHV A;  2B8F A;  4QGU A;  1ENA A;  5IP7 G;  1MBY A;  2D9U A;  1J5E L;  2F4V L;  2LSS A;  3IFD A;  2Z6K A;  2UU9 Q;  1U4R A;  5HY6 A;  1Q12 A;  3GV6 A;  1TQO A;  4GN5 A;  2OXP A;  1WTQ A;  1B44 D;  2ZTC A;  4JBJ A;  3PO3 G;  3MWY W;  1SNO A;  4FYD A;  3GTJ B;  2K52 A;  4AQY L;  4DR1 L;  2AHO B;  3DWA A;  3KF8 B;  1XMQ L;  1TWC B;  4K0K Q;  1I4R A;  4DR3 L;  1CKO A;  5C4J H;  2NZO A;  3OWE B;  1GOZ A;  4A3F B;  3N52 A;  2Z9H A;  3TZU A;  3HOZ G;  1EUJ A;  2V4D A;  2UUB L;  3HOW G;  5FJ8 H;  1ENC A;  5EAY A;  3CQZ H;  1PTO F;  1AP0 A;  1IKL A;  3MXU A;  2FIN B;  1VQC A;  4A3L G;  2BCO A;  3HOX G;  2UXD L;  3F1Z A;  4GNX B;  2Z4H A;  3PCO B;  4G4K A;  5GAH C;  2F0J A;  1S5B D;  3W3A A;  5I9P A;  3I2Z A;  1JMC A;  1SMY C;  2JA8 G;  3STB C;  3I4N B;  4K5W A;  2K5V A;  3OTO Q;  1BCP D;  1VQK A;  1F2Y A;  4NXM Q;  4R9W A;  5GAE C;  2F4I A;  2YU9 H;  4OO1 G;  2D62 A;  2VS1 A;  2E2D C;  3X3M A;  3STB D;  2K7V A;  4DR5 L;  3H0G H;  4F88 A;  1Y8P B;  2EY1 A;  3MXN A;  3W2D A;  1EY0 A;  3WDN A;  5KNC A;  3BZC A;  2R93 B;  2F3I A;  1PH7 A;  5C3X A;  4GKJ Q;  2B2T A;  2A19 A;  5IIF A;  1KDB A;  1G29 1;  2R92 H;  4J15 A;  3GTQ H;  3J7Z C;  4DR1 Q;  3OSO A;  5LL6 S;  1PLF A;  1N36 Q;  4RAU C;  1SND A;  3J7A F;  2YYZ A;  2ES2 A;  2JYO A;  2OWO A;  4K5X A;  3KK7 A;  5EBD A;  1CZW A;  1NAP A;  1JWM D;  4N9P A;  3S17 H;  1GUT A;  2CW0 D;  2OT2 A;  1I4G A;  3T1H L;  2EDG A;  5E7N A;  3LNN A;  5I9O A;  4IUP A;  4BY7 G;  4A93 G;  2R7Z H;  3G6E A;  4I65 A;  2NN6 G;  2Y0S B;  4HCE A;  5JEA J;  5IGG A;  2IX1 A;  1JJG A;  5LMN W;  3OIQ A;  1H9R A;  1T5E A;  3PUY A;  1I6H B;  3EQL C;  2R6G A;  3LWE A;  2DY8 A;  3PQI A;  1XPO A;  4XQN A;  2SEB D;  4KD3 A;  1STE A;  3ONA B;  2CCZ A;  3NEL A;  1I50 H;  4Y7N B;  2BOS A;  1PH3 A;  1B4O A;  1YVC A;  1KD1 C;  3F2B A;  2PYK A;  2F03 A;  1CSP A;  4JI8 L;  4MN3 A;  3DLL A;  1PH6 A;  4OON A;  1EY5 A;  3NBH B;  2RCN A;  4GLX A;  4RGN A;  4IFD I;  1Y1W G;  2K28 A;  4FNF A;  4LF4 L;  2FFK B;  1PDQ A;  2ICI A;  1SSO A;  4DNR B;  1DM0 B;  1SE4 A;  5CV9 A;  2WII B;  5JJZ A;  4XYQ A;  3OW2 A;  4DV5 L;  1EEI D;  5FLM G;  2M2L A;  1RDP D;  4MIU A;  1LT6 D;  1SJE D;  2EY5 A;  3J7Y W;  2OEO A;  2B2U C;  1K8G A;  5C0X H;  1TS3 A;  2OQK A;  4RKB A;  2K5N A;  3M4Q A;  2KCN A;  1IW7 C;  1UWV A;  2A68 D;  1DCZ A;  4DAV A;  1JE5 A;  1TKW B;  2VQE Q;  3M4Y A;  1FGB D;  4BBR B;  2A8V A;  2NVT B;  1EY8 A;  2H5X A;  4X3K A;  2ZTD A;  1L1O A;  2CVR A;  4LF7 Q;  5I6W A;  4IPH A;  1YEZ A;  5E4X A;  2IPK D;  1XPU A;  4DV6 Q;  1GUN A;  3KF6 A;  4B3R L;  2JA7 H;  3K8A A;  5C44 B;  2VUM B;  2AQ3 B;  3KLS X;  3PO2 B;  3S2H B;  4KJN A;  1IL2 A;  1UEB A;  4GZY C;  3M3Y B;  3UE0 A;  1Q1B A;  1TY0 A;  1GVP A;  5IOC A;  3W1B A;  1E1O A;  1CKN B;  1QZH A;  5IT9 L;  4KTA A;  3KLW A;  5FLX c;  1EYD A;  5BN4 A;  4JC0 A;  4FF3 A;  3HOY B;  3FEW X;  2EPB A;  1HUN A;  4JI8 Q;  5KEE A;  1SNP A;  3F2D A;  4HSP A;  4JYA Q;  1KTK A;  3D31 A;  4LUO A;  2JJQ A;  3ICE A;  4KKS A;  4K6D A;  1KDC A;  1VQI A;  4P71 A;  1VQA A;  1EIF A;  1GUO A;  4XQJ A;  1VQM A;  1HTP A;  1AH9 A;  1I4Q A;  2E2I H;  3M4O B;  1PVO A;  4HIK A;  5C5M A;  1A15 A;  5KND A;  4GKK Q;  2PQA B;  5IGD A;  5BR8 Q;  1VQP A;  3VR5 A;  5AJ3 L;  2ZM6 L;  4KI0 A;  3CCM A;  4HMJ A;  2VNU D;  1EOT A;  5KYI A;  2M00 A;  2VQF L;  1HZ9 A;  1X56 A;  1S5D D;  4FF1 A;  4A3D H;  2N49 A;  2IHE A;  4C3I G;  1VQD A;  4ODG A;  1CKM A;  1L2F A;  3TS2 A;  1BR9 A;  4FXK C;  4A3G B;  3KYH C;  1PYB A;  1L0W A;  1IYU A;  3PGZ A;  2EXZ A;  1ILQ A;  3SVM A;  2E2J B;  5C3W A;  3D0F A;  5D3D A;  2RDG A;  4A3B H;  1HR0 L;  4ZCK A;  2JA6 B;  4JI1 Q;  4KK7 A;  3I4M H;  1HZC A;  4L63 B;  3A55 A;  1M8A A;  2DN8 A;  2JP1 A;  2VB3 X;  4KLK A;  1LAB A;  3QWN A;  1S5C D;  3U9S A;  4DUZ L;  1X6O A;  2VL6 A;  4L6T B;  4CDE C;  3E5S A;  1JT8 A;  4LK1 C;  4G7O C;  5M3M G; 
#chains in the Genus database with same CATH homology
 1RTO A;  4IN3 A;  4EQP A;  3J80 L;  1LTI D;  2F0I A;  4BS9 A;  4H7B A;  3S1Q B;  1OXV A;  2NTT A;  2K03 A;  3TP8 A;  1PRT C;  2Q8I B;  4ZUJ A;  1I3Q B;  2F0N A;  3C1E A;  4KD4 A;  2AQ2 B;  5CBE E;  3NWS A;  1NR4 A;  1YNN D;  3BVM A;  3N6R A;  3K0Y A;  2RSN A;  4R8N A;  2JEB I;  3A8I E;  2BDN A;  1STH A;  3QJY A;  4CKC A;  1EZ8 A;  1WTX A;  2EOT A;  3K59 A;  1I4X A;  3T16 A;  2D5D A;  1FNU A;  5JPN C;  1I6V C;  3KLR A;  3P20 A;  4QF4 A;  5C0X G;  3KUP A;  2MP1 A;  3SK6 A;  1G6Z A;  1TII D;  1EQV A;  4DAY A;  3T4A C;  3AU7 A;  1QNK A;  4UAI A;  3ERO A;  3NHH A;  1GUG A;  5E4W C;  2WAC A;  5DNF A;  3MEH A;  3SR1 A;  1KAB A;  4NMZ A;  1WTW A;  4XT3 B;  3D4D A;  3T56 B;  3TSS A;  4BA1 I;  1CA6 A;  3QIA A;  3H3V C;  1HPC A;  2NWG A;  3HOV B;  1BDO A;  4IUV A;  1O7Y A;  3MFG A;  1SBB B;  1BBX C;  2X6L A;  4NKL A;  1IHZ A;  4Q5V A;  1WCM B;  4P2C B;  4EVO A;  1DOL A;  1HQM C;  4BA2 I;  1DYQ A;  4BWG B;  3FKI B;  1D1K A;  4H0L C;  3DWQ A;  5FO9 B;  2F0K A;  1MI2 A;  2MPM A;  5G3L D;  1QOH A;  2XRS D;  3TN2 A;  4KY7 A;  1Q8I A;  1EIG A;  1EU4 A;  5LL6 X;  3H09 A;  3I72 A;  5KGU A;  4CJ1 B;  2SNS A;  2HCI A;  1A6X A;  1CT1 D;  2FJ2 A;  3PO3 B;  1WTP A;  4Z9C B;  2A69 D;  4HSV A;  1SJH D;  3BYY B;  4XXE A;  1STA A;  1BCP F;  4CJ0 B;  5JVG 3;  3K7A B;  1SNQ A;  4QMG A;  2HUG A;  3D4W A;  3HOZ B;  2B2U A;  4ME5 A;  5EPL A;  2PZT A;  3MVV A;  5CR3 A;  5D3I B;  1LTG D;  2A74 C;  2K32 A;  5K36 G;  3MTS A;  1SYC A;  3F2U A;  5IGE A;  1Z47 A;  3HOX B;  2L12 A;  1NUC A;  3A54 A;  4MHE A;  5J39 A;  2JA8 B;  4IQZ A;  3E6Z X;  2KHS A;  3DUZ A;  1R4Q B;  5JEA H;  3Q0A A;  3MHB A;  3I73 A;  2B2W C;  2L0C A;  5FKA C;  2PZU A;  1B53 A;  2KEE A;  5FLX E;  1D2B A;  2A6H D;  1E2V A;  1STG A;  1D5X C;  3HOU B;  4KMU C;  3S2D B;  3D8G A;  4ZAI A;  5DAU A;  4WFN 3;  1Y69 U;  2VB2 X;  1SYB A;  5D14 A;  4C3J G;  5IGB A;  4C56 C;  1B3A A;  2X6G A;  5F2D A;  3VR6 A;  1VCI A;  1JWU D;  4A93 B;  4BY7 B;  3RZD B;  2O4X A;  3NBI A;  3GTK B;  3I91 A;  2A5H A;  2EVB A;  3ND8 A;  2H4O A;  2QDB A;  3NP8 A;  2LY7 A;  2DNC A;  4IUT A;  4KY5 A;  2MUY A;  1LTB D;  1CHQ D;  4RHS A;  1LT4 D;  1RHP A;  1F9Q A;  4CJ2 C;  1AZP A;  1QJO A;  1UNS A;  4RGT A;  5LHY 1;  4IFD H;  1Y1W B;  2A6E D;  3WOE A;  5E3F A;  4DU9 A;  1BCP B;  2ZXO A;  4HAE A;  1C8C A;  5EPJ A;  1TT2 A;  1C4Q A;  3V96 A;  1Y8O B;  4OHJ A;  1JOR A;  2CHB D;  2HCC A;  1BOS A;  1T5X D;  4RCN A;  3K57 A;  1PFB A;  3WOF A;  4XTC S;  4ZKB B;  4ZUI A;  2J7Z A;  3NPP A;  5C4J B;  3MXG A;  5ELB A;  1SDF A;  1S5F D;  3C1F A;  2K01 A;  2ZT9 C;  5M5X B;  1AEX A;  4DGZ A;  3GTP B;  2NVY B;  5J22 A;  4S3S A;  1WTV A;  5I2Y A;  1U4L A;  5EKI A;  1SMY D;  4CBV A;  4IUN A;  1F9S A;  3R2T A;  1ESR A;  3S1M B;  2XVS A;  5CV5 A;  1E0B A;  1DZ1 A;  4E6I A;  4HTH A;  5FLX L;  4RHR A;  2PNR C;  1K8M A;  3TZD A;  5M9O A;  1QIL A;  1CTM A;  2K05 A;  3C46 A;  2HQE A;  3P75 A;  1EFI D;  4B08 A;  1J8I A;  2R92 B;  3G7L A;  1LO5 D;  4C3I B;  2JXM B;  4KKT A;  4LAA A;  4K8J A;  3BDO A;  2JE6 I;  3EJI A;  2F0W A;  4G7Z C;  1ML0 D;  4PMW A;  4FP5 D;  3KBG A;  2B2V C;  2IJ0 A;  2PW5 A;  1RKN A;  1H9J A;  2G9D A;  4H44 C;  2K5D A;  3AMU A;  3GTG B;  3OHX C;  2LMC B;  2X69 A;  2WV6 D;  4FO2 A;  3QOL A;  2MJ8 A;  5C6A A;  1TY2 A;  5M3M B;  1F2Z A;  1R9T B;  2TMP A;  3QB3 A;  3S1N B;  1ZKO A;  1I50 B;  1D1I A;  2KJX A;  2SOB A;  2F0V A;  4FVM A;  5C4H A;  1RJT A;  5CYU A;  4IZ8 A;  2PCF B;  1DJR D;  4Q0F A;  1ET9 A;  4L8J A;  2XWJ B;  3BZD B;  2E74 C;  1XX8 A;  4KHZ A;  1AN8 A;  4QIW B;  3SDZ A;  1PTO H;  1ZEQ X;  2Q8R E;  1OXX K;  4O1N A;  3A7L A;  4HN7 A;  5CBA E;  5A35 A;  1IW7 D;  2B2W A;  2EYM A;  4BY1 B;  5K5P A;  4NDX A;  3CKI B;  2N88 A;  3X3N A;  3MZ5 A;  5KNB A;  3K58 A;  2L1B A;  3FRP B;  4U68 A;  1V1P A;  1DOK A;  1JOK A;  1F2L A;  2JSO A;  4ZYS A;  5IOD A;  2XN9 C;  3BVG A;  2EY6 A;  5G3L F;  2HDL A;  2EYJ A;  1PTO C;  4NW2 A;  2KVM A;  1LT5 D;  2WB1 B;  2F0O A;  3S15 B;  5EGT A;  5COY A;  1ET6 A;  1H9S A;  4RGM A;  5ISR A;  2E2I B;  1CQV A;  3HS0 C;  3U9O A;  2F0U A;  1JIC A;  4ILW A;  1CM9 A;  4WJW A;  4IAL A;  3VR2 A;  3O13 A;  3NE5 B;  3NTI A;  2KEC A;  2IT1 A;  3OWF A;  4XDX A;  3VR3 A;  2F0E A;  1XXG A;  1IYV A;  4QB4 A;  1JC7 A;  4TRD A;  1KNE A;  4J6H A;  3M85 A;  5J1Z A;  3I70 A;  3OPO A;  1KLG D;  1EWH A;  2C9O A;  1LTT D;  3S1R B;  4G7H C;  1CK1 A;  1ICW A;  5JPM C;  3SHL A;  1HQR D;  1F77 A;  1II3 A;  2BE5 C;  1SAP A;  2BA1 A;  5FK9 C;  2EYH A;  3G6J B;  3H6M A;  3GQB A;  1JOO A;  3ZYY X;  1UEA B;  1OO9 B;  3D6W A;  5CV8 A;  2EJG C;  3IFT A;  1KLU D;  1GXD C;  1EQT A;  1KAA A;  5CC4 A;  1G8Z D;  3P7J A;  2K5Q A;  4XYO A;  4DA2 A;  1GHJ A;  3JAM E;  1ENF A;  5FO8 B;  3ITP A;  4KY6 A;  1PRT D;  3L3O C;  1LTA D;  5KIX A;  4CKE A;  1K8O A;  1RD9 D;  2ZXR A;  2EY2 A;  2NTS A;  1Y1V B;  3L7Z C;  1FR3 A;  1D5M C;  2EE1 A;  1X3P A;  4B9X A;  3BDL A;  1HFN A;  1TVX A;  1RF2 D;  3J81 E;  1KDA A;  3LX0 A;  1ZXT A;  1I4H A;  4WRD A;  1QNU A;  2B63 B;  3HGB A;  5T1I A;  4C3J B;  5NUC A;  1BNZ A;  1HA5 A;  2I46 A;  3PUX A;  5M5Y B;  1SYE A;  1VMC A;  3DM1 A;  4ABN A;  4F7X A;  2HDM A;  1V8Q A;  2IX0 A;  2RDF A;  2BDO A;  3PV0 A;  2KQ3 A;  4K6L A;  3C3L A;  4HR7 B;  3HRZ C;  1SE3 A;  4K2K A;  4ZRZ A;  1MD2 D;  4DK1 A;  3MFY A;  3R2I A;  4R8I A;  2IWH A;  3AB9 A;  5I2X A;  1OXU A;  4FXD A;  1TWF B;  5C5L A;  1EYC A;  4ZK9 B;  1LLR D;  2XIW A;  3HEJ A;  1O78 A;  4C2M B;  5C0X J;  3D4R A;  2B2V A;  3V05 A;  1WTO A;  2JA5 B;  3A56 A;  1EEF D;  1UUP A;  1B9N A;  5JVH 3;  1W6J A;  3J7A V;  1E2Z A;  1NR2 A;  2B39 A;  1AW7 A;  4DN4 M;  1G2T A;  1NCV A;  3NXW A;  2K04 A;  2EYP A;  2O2L D;  5A2Q E;  4HED A;  4J1M A;  2F0H A;  5C3E B;  1U9R A;  3I8Z A;  2EYO A;  3GD7 A;  1V1P B;  5D65 A;  1QE6 A;  5M3F B;  3NSW A;  1D5Z C;  3TME A;  3VYR A;  1EIH A;  3HKZ B;  4DXF A;  5FOB B;  1D6E C;  3I90 A;  2IW3 A;  5FO7 B;  3NBH A;  2PMZ B;  3CU7 A;  4A3K B;  4FXG C;  5CV4 A;  3EA6 A;  1J9O A;  2J4X A;  4J8Q A;  2WIN B;  4N9T A;  1H9S B;  4DFA A;  1DD2 A;  2F0M A;  3ERQ A;  3PUV A;  2L5T A;  3OMC A;  3CHB D;  1PYW D;  3HP3 A;  4KV6 A;  3DMU A;  3URY A;  2CQA A;  3R3O A;  5IGF A;  3V2T A;  1NSN S;  5EKK A;  3S16 B;  4FF4 A;  2KCC A;  1A3T A;  3QG1 A;  3M7G A;  1VF5 C;  1B2T A;  1R4P B;  2NVX B;  4M1U B;  4X3T A;  4KN4 C;  1CA5 A;  2PO4 A;  2N55 A;  4QUF A;  1LTR D;  3NQI A;  3DWP A;  3BYT B;  5T1G A;  1F9P A;  5JOB A;  1VDZ A;  2NN6 H;  4RA8 A;  4WOR A;  2K5W A;  2L4N A;  4KJO A;  1BXT A;  2F1M A;  2MGS A;  3DEO A;  2RSO A;  5KYL A;  1ESF A;  3A8K E;  4ZLT F;  1O80 A;  4LJZ C;  4C3H B;  5BN3 A;  4NP5 A;  2ID0 A;  1L0Y B;  4PV1 C;  4X3U A;  5CV6 A;  3H94 A;  3GTO B;  3D3R A;  3A7A B;  2DY7 A;  2ENB A;  4QCL A;  2KOL A;  2L9H A;  5C4Z A;  3FVQ A;  5BN5 A;  2J0T D;  2K6A A;  1YNJ C;  4ZKC B;  1HUM A;  1FNW A;  4RKL A;  3K6O A;  1IL8 A;  2O5J C;  5ELD A;  5DM6 3;  1YNJ D;  5KRU A;  1RTN A;  4PMB A;  5A2Q L;  1PFN A;  3QOJ A;  2B8G A;  3PUZ A;  4I7Z C;  4DNT B;  3CQZ B;  4XIG S;  1PMR A;  2F0T A;  1ZYR C;  5IT9 E;  2B2Y C;  1CFM A;  1BCP C;  4OGQ C;  3OW7 A;  4UDU C;  4OO1 I;  4ULL A;  2EJF C;  5JEA G;  1HXY D;  2F0G A;  1ZYR D;  3PMF A;  3K5M A;  4KHV A;  2YU9 B;  3BVZ A;  4OL7 A;  3OOC A;  1LV9 A;  1JE4 A;  1E2W A;  1QCB D;  2FMM A;  1Z6H A;  1QB5 D;  3TP5 A;  4TKO B;  3H0G B;  4EQO A;  4DXG A;  1SE2 A;  1Q1E A;  3RD4 A;  1Q90 A;  2WKC A;  3IAY A;  3Q22 A;  2QEJ C;  3GTQ B;  1XYI A;  1ONL A;  1X32 A;  2KA7 A;  4RFB A;  2Z4I A;  2MHV A;  1O7Z A;  2CW0 C;  2QF7 A;  1EWC A;  1TR5 A;  2RQX A;  2Q8T A;  3S17 B;  1M4V A;  2H1E A;  2NN6 I;  3S9W A;  2ZXP A;  2KED A;  2R7Z B;  1WVL A;  1WD1 A;  1GUS A;  1GHK A;  2WP8 J;  4JBW A;  4V19 0;  1EU3 A;  1PRT F;  3EVQ A;  2R3Z A;  3Q24 A;  1EZ6 A;  1CI3 M;  1HFG A;  4EGV A;  4C3H G;  3SK8 A;  3GV3 A;  1QG7 A;  3GTM B;  2F0P A;  1K83 B;  1EYA A;  1STN A;  3M7N A;  2XSC A;  3J80 E;  3I3C A;  1TU2 B;  2EYF A;  3SE0 A;  3CRK C;  4IFD G;  1B9M A;  2F0Q A;  4K2L A;  1STB A;  3MAQ A;  1LAC A;  1SEB D;  4RH6 A;  1EL0 A;  2QIL A;  2O5I C;  3T51 B;  2E75 C;  2A68 C;  4CKB A;  4PMC A;  1IKM A;  1CHP D;  1V43 A;  3OMG A;  2Z1C A;  3K5L A;  4CHT B;  1PTO B;  5CGK A;  3D6C A;  4XT1 B;  3TP7 A;  1V1O A;  2XRQ D;  5AFW A;  1XTC D;  1FYC A;  3GP7 A;  2FMC A;  2JA7 B;  5JAV A;  4O42 A;  1S5E D;  4HCS A;  3T13 A;  1HCZ A;  1CQF A;  4LMQ D;  2L55 A;  1KNA A;  2NVQ B;  4IFD J;  2K1B A;  1BO0 A;  4EQN A;  1H9K A;  5E1F A;  2RDH A;  1PFM A;  3PUW A;  2WAQ B;  1SNM A;  5I4D A;  1Y8N B;  4TQU S;  1PTO D;  3RMH A;  1SYF A;  1L0X B;  4HMI A;  1RCV D;  3ND9 A;  5C4X B;  4DK0 A;  5DEH A;  1EY7 A;  3NTH A;  2RA4 A;  1LTS D;  1PZK D;  4A3D B;  4OIK A;  4G57 A;  4F87 A;  3NUC A;  5EJW A;  1B1Z A;  1PRT B;  2F0F A;  2Z8L A;  4V0B A;  2IL8 A;  3NWT A;  1OXT A;  3R93 A;  4A3B B;  3NK9 A;  2QCP X;  3I4M B;  1A3U A;  2NYZ D;  1SXT A;  3RLF A;  1H9M A;  1WD0 A;  2G9H D;  2ICE C;  3K5O A;  4YIJ A;  3FPP A;  4DF7 A;  3SXH A;  3DHQ A;  3MA2 B;  2XNA C;  3CRL C;  4A3E B;  5HUR A;  1GJX A;  2NBF A;  1GUW A;  2BE5 D;  2SNM A;  2F3W A;  1A3V A;  4RWS C;  4BBS B;  5K36 H;  2F3V A;  1Z7T A;  2AWO A;  1YNN C;  1JR0 D;  1MSG A;  2VXW A;  3NTK A;  3KLS A;  3HG9 A;  3IL8 A;  3SEB A;  1B50 A;  1TWH B;  3P1H A;  4K8I A;  3T53 B;  1TS4 A;  2EZV A;  4A3I B;  3GO5 A;  4A3M B;  2K33 A;  1BUV T;  2B2Y A;  4QUC A;  5ELC A;  5C0X I;  2I07 B;  3PIO 3;  1DXM A;  3VYS A;  3Q23 A;  3QO2 A;  1F9R A;  5ELF A;  3C2P A;  3VA5 A;  3KF8 A;  2RKS A;  3TDQ A;  2RVL A;  1HA6 A;  2AWN A;  1SNC A;  3FPU B;  3Q6S A;  4K14 A;  2JEA I;  3R8B A;  1SYD A;  5I6Y A;  3FMC A;  4RGO S;  2L11 A;  3A8J E;  4M8A A;  3VR4 A;  3IKJ A;  1WTR A;  4XQQ A;  2F0S A;  1TWG B;  1VF7 A;  1AFP A;  3L9A X;  2PW7 A;  2B2T C;  2M9V A;  2BA0 A;  5CV7 A;  5HGT A;  1I4P A;  2AUJ D;  2DNE A;  2LS0 1;  1EY6 A;  1BF4 A;  2PZW A;  4F8M A;  4OIJ A;  4JK1 C;  2PPB C;  5COR A;  2FHT A;  5EKL A;  2AUK A;  3LWU A;  4PQX A;  5ELE A;  2NUC A;  3FDT A;  3OIP A;  3RUZ A;  1FNV A;  3NQT A;  1TS2 A;  3VYU A;  1SFO B;  4IUQ A;  2A69 C;  2SDF A;  1U4M A;  3BG3 A;  2WKD A;  3I4L A;  1JB3 A;  1AZQ A;  4FF2 A;  3SK5 A;  1PZJ D;  1DOM A;  3K5N A;  4KN7 C;  4KKU A;  1XWE A;  1JQY D;  5IGC A;  2RBM A;  5EPK A;  4C1N I;  3S14 B;  4H13 C;  3HOW B;  1HTL D;  4IUR A;  2E76 C;  1PXU A;  3MC0 B;  5EQ0 A;  1C48 A;  1W6K A;  1TWA B;  3JAM L;  1TS5 A;  3HZX A;  5EBC A;  1G91 A;  2EJM A;  4OO1 H;  1F2M A;  1A2T A;  1JWS D;  2NZ1 D;  1UAP A;  1A2U A;  2A6H C;  1EY9 A;  3RZO B;  2A73 B;  1FD7 D;  1MSH A;  3TP6 A;  2OF1 A;  5CMD A;  4TSS A;  1PZI D;  4B9W A;  3VA7 A;  4ZQ3 A;  3J81 L;  1ROD A;  2AQ1 B;  1O7L A;  3E0J A;  3PIP 3;  4AYB B;  1Q3L A;  3H91 A;  2C5C A;  4C1N K;  2IX3 A;  1EY4 A;  5M5W B;  1STY A;  4K5V A;  5TSS A;  4X3S A;  3TBI B;  2PQE A;  1G2S A;  3BS1 A;  1VMP A;  3EFX D;  4CGY B;  1MGS A;  2KUM A;  2EYL A;  4A3J B;  3DEP A;  1S4Z A;  1DON A;  1OXS C;  2LKV A;  4RCO A;  1CZG A;  1JOQ A;  2E2H B;  3DXJ C;  2TSS A;  2LFN A;  4ID6 A;  3SK4 A;  2R61 A;  2F0L A;  1HRJ A;  1U4P A;  1ILP A;  1QWY A;  4U67 3;  3MXP A;  1X3Q A;  2QKI C;  3KBX A;  3BDC A;  3GTL B;  2A6E C;  2NB0 A;  1JCK B;  1SYG A;  2D2C C;  4DAP A;  2F0D A;  2GA4 B;  3UI2 A;  3VYT A;  2XWB B;  5DM7 3;  4PNY A;  1LT3 D;  1BQQ T;  4IUU A;  1HHV A;  2B8F A;  1ENA A;  1MBY A;  2D9U A;  3IFD A;  1U4R A;  1Q12 A;  3GV6 A;  1TQO A;  2OXP A;  1WTQ A;  1B44 D;  3MWY W;  1SNO A;  4FYD A;  3GTJ B;  3DWA A;  1TWC B;  1I4R A;  3OWE B;  1GOZ A;  4A3F B;  3N52 A;  3TZU A;  2V4D A;  1ENC A;  1PTO F;  1AP0 A;  1IKL A;  3MXU A;  2FIN B;  2BCO A;  2Z4H A;  4G4K A;  2F0J A;  1S5B D;  3W3A A;  5I9P A;  1SMY C;  3I4N B;  4K5W A;  1BCP D;  1F2Y A;  4R9W A;  2F4I A;  4OO1 G;  2D62 A;  2E2D C;  3X3M A;  2K7V A;  4F88 A;  1Y8P B;  2EY1 A;  3MXN A;  3W2D A;  1EY0 A;  3WDN A;  5KNC A;  2R93 B;  5C3X A;  2B2T A;  5IIF A;  1KDB A;  1G29 1;  3OSO A;  5LL6 S;  1PLF A;  4RAU C;  1SND A;  3J7A F;  2YYZ A;  2JYO A;  4K5X A;  3KK7 A;  5EBD A;  1CZW A;  1NAP A;  1JWM D;  4N9P A;  1GUT A;  2CW0 D;  2OT2 A;  1I4G A;  2EDG A;  3LNN A;  5I9O A;  4IUP A;  4I65 A;  2NN6 G;  2Y0S B;  4HCE A;  5JEA J;  5IGG A;  2IX1 A;  3OIQ A;  1H9R A;  1T5E A;  3PUY A;  1I6H B;  3EQL C;  2R6G A;  3LWE A;  2DY8 A;  4XQN A;  2SEB D;  4KD3 A;  1STE A;  3ONA B;  4Y7N B;  2BOS A;  1B4O A;  2PYK A;  2F03 A;  4MN3 A;  1EY5 A;  4RGN A;  4IFD I;  2K28 A;  4FNF A;  2FFK B;  1PDQ A;  2ICI A;  1SSO A;  4DNR B;  1DM0 B;  1SE4 A;  5CV9 A;  2WII B;  5JJZ A;  4XYQ A;  1EEI D;  2M2L A;  1RDP D;  4MIU A;  1LT6 D;  1SJE D;  2EY5 A;  3J7Y W;  2OEO A;  2B2U C;  5C0X H;  1TS3 A;  4RKB A;  2KCN A;  1IW7 C;  2A68 D;  1DCZ A;  4DAV A;  1TKW B;  3M4Y A;  1FGB D;  4BBR B;  2NVT B;  1EY8 A;  4X3K A;  2CVR A;  5I6W A;  5E4X A;  2IPK D;  1GUN A;  5C44 B;  2VUM B;  2AQ3 B;  3KLS X;  3PO2 B;  3S2H B;  4KJN A;  4GZY C;  3M3Y B;  1Q1B A;  1TY0 A;  5IOC A;  5IT9 L;  4KTA A;  1EYD A;  5BN4 A;  4FF3 A;  3HOY B;  3FEW X;  2EPB A;  1HUN A;  5KEE A;  1SNP A;  4HSP A;  1KTK A;  3D31 A;  4KKS A;  4K6D A;  1KDC A;  1GUO A;  4XQJ A;  1HTP A;  1I4Q A;  3M4O B;  5C5M A;  1A15 A;  5KND A;  5IGD A;  3VR5 A;  4KI0 A;  4HMJ A;  2VNU D;  1EOT A;  5KYI A;  2M00 A;  1S5D D;  4FF1 A;  4C3I G;  4ODG A;  1BR9 A;  4FXK C;  4A3G B;  1IYU A;  2EXZ A;  1ILQ A;  3SVM A;  2E2J B;  5C3W A;  5D3D A;  2RDG A;  2JA6 B;  4KK7 A;  4L63 B;  3A55 A;  1M8A A;  2DN8 A;  2JP1 A;  2VB3 X;  1LAB A;  3QWN A;  1S5C D;  3U9S A;  4L6T B;  3E5S A;  4LK1 C;  4G7O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...