5IGBA

Crystal structure of staphylococcal nuclease variant delta+phs l36d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igbA00
1TQOA 4ID6A 5C4ZA 1STNA 5EKLA 4NMZA 5F2DA 5KYIA 2SNMA 5KYLA 2OF1A 3T16A 3TP6A 5CV6A 4K8IA 4S3SA 4KY7A 1EY8A 3RUZA 4KD4A 1II3A 2EYLA 3ERQA 4H7BA 1JOKA 2EY5A 3MZ5A 4N9TA 4PMCA 5J1ZA 1A2TA 2F0MA 4KD3A 1SYEA 4G57A 3D8GA 5C3XA 1STHA 2F0HA 3PMFA 5CV4A 5NUCA 2F0VA 1EY9A 3E5SA 4I65A 4ODGA 2NUCA 4WRDA 5JOBA 4DU9A 5IGDA 5CV8A 4IZ8A 3MEHA 1A3TA 1EY4A 1EYCA 2PZUA 3EJIA 5CV7A 4F7XA 1NSNS 3NP8A 5I6WA 2WACA 4KV6A 1ENCA 3C1FA 4YIJA 4DFAA 3HZXA 4K6DA 4KJNA 2F0KA 4QMGA 5C5LA 2F0QA 3VA5A 5HURA 5IGEA 1STYA 5KGUA 1A2UA 4EQNA 4TRDA 2SOBA 4F8MA 1IHZA 4B9WA 2EY2A 4KY6A 2O4XA 2ENBA 5J22A 3SK5A 3DMUA 1SNMA 1SYFA 3OSOA 4EVOA 4K8JA 1KDAA 5I9PA 2F0UA 2RBMA 3MHBA 1EY5A 1SYGA 5ISRA 4J6HA 2KHSA 3P1HA 4N9PA 5C5MA 1KABA 2F0OA 4R8NA 5IODA 5I9OA 2EY1A 2EYJA 3HEJA 5IIFA 1EY0A 5KRUA 5J39A 1EQVA 5IGGA 5JAVA 2PZTA 3H6MA 1SYBA 1SNOA 3P75A 2F3WA 5IGCA 2PYKA 3D4DA 1SNDA 2QDBA 4NP5A 5K5PA 2SNSA 2F0SA 2EYHA 3D4WA 2PW7A 2F0DA 1EZ6A 3S9WA 2HQEA 4RKBA 1EYDA 1EYAA 1NUCA 1SYCA 2F0TA 3NK9A 3OMCA 4KY5A 4OL7A 1STGA 3NXWA 1KDCA 4KTAA 4LAAA 3D6CA 5DEHA 4EQPA 1JOOA 2EXZA 1SNPA 1SNQA 2F0WA 4KJOA 5CV5A 2F0GA 1AEXA 3DHQA 4WORA 3TP7A 2F0EA 3NQTA 5IGBA 5KIXA 1SNCA 2EYOA 3EVQA 4K14A 3QOLA 4MIUA 4ZUIA 5C4HA 3BDLA 4HTHA 4NKLA 1TR5A 4DGZA 5C3WA 2F0PA 2OEOA 2PQEA 3SXHA 2F0IA 5E1FA 1EZ8A 4QF4A 4ZUJA 1JOQA 2F0FA 4E6IA 1RKNA 2PW5A 3EROA 5EKKA 5CV9A 2PZWA 5EGTA 3V2TA 5IOCA 2M00A 1A3UA 1KAAA 4HMJA 4ZQ3A 5DAUA 3NHHA 3U9OA 1STAA 4ME5A 5CC4A 5KEEA 4IUNA 2OXPA 4EQOA 2F3VA 4K5WA 3NUCA 2EYMA 3R3OA 5HGTA 3C1EA 4K2LA 4K5VA 2EYPA 3SHLA 2RKSA 5CGKA 1SYDA 2KQ3A 4QB4A 3MXPA 3ITPA 3T13A 4DF7A 3TP8A 3MVVA 3OMGA 4HMIA 2F0LA 5C6AA 5E3FA 3SK6A 1A3VA 2EYFA 4K5XA 3SK4A 3SR1A 4K2KA 1F2YA 5M9OA 4J1MA 4RKLA 2F0NA 3SK8A 1EY6A 1U9RA 2EY6A 3QB3A 4B9XA 1TT2A 1F2ZA 3BDCA 4PNYA 3TMEA 1EY7A 3LX0A 4PMBA 1F2MA 1ENAA 2F0JA 3TP5A 5I6YA 1STBA 4IALA 3OWFA 2RDFA 5CR3A 5IGFA 4KHVA 1JORA 1KDBA 2LKVA 3QOJA 4NDXA
chains in the Genus database with same CATH superfamily
3C46A 2E2HH 1KL9A 3SEBA 1TWAB 2L12A 3I4MB 1GVPA 5JJLA 1HZ9A 2UUAL 1K8OA 4GN3B 3HKZE 4KD4A 1K83B 1K3RA 5M5WB 5GQOA 3HOWB 1I4QA 4KD3A 4X6AH 1STHA 4OX9Q 3S15B 1W6JA 5JOBA 3E0EA 3IFTA 3S14H 4AQYQ 3TN2A 4JI2Q 3I72A 2B63H 4HSPA 4LUVA 5FKAC 3CCSA 5LMNL 2OQ0A 5EJWA 1J6QA 1Y1VH 4A3JG 3K7AB 1IKLA 2PQAA 1O80A 3N6RA 4A3LH 1BDOA 1H9KA 1QVGA 3OOCA 5FLXE 2V1CC 3BYTB 3URYA 2JA6G 5ISRA 5IP7H 1CM9A 3RZDH 1I6HH 4DV4Q 1ML0D 5IGGA 3KUPA 3H6MA 2H4OA 2NVQH 2F3WA 1C48A 1I3QH 2IX3A 1IBKL 1CKOA 2K75A 3BZDB 4MTKA 4JOIC 5IP9G 1G8ZD 3GTLB 3NK9A 4FVMA 4ZLTF 4JOIA 5LL6S 1FL0A 5M5XH 2CW0C 1CTMA 1AEXA 4BY7H 3C2PA 4HIDA 3EVQA 1BXTA 3DWQA 3BDLA 4DXGA 1TR5A 1E1TA 1E2VA 2RCFA 4B3TQ 4IJLA 4JI6L 1G291 3HOWH 3ULPA 1WJJA 1EU4A 3QJYA 1KAAA 4GLAC 2A6HC 4A3BG 3AFQA 3S15H 1TY2A 1FJGQ 2DNEA 2QDLA 2QILA 3CCJA 4DR2L 3SHLA 5AJ3L 1W6KA 4QUCA 4GNXA 3FEWX 3ND8A 4B3ML 2XRSD 1H9MA 1IKMA 1SJHD 1JR0D 2CW0D 5HY6A 2WB1G 1MSGA 2VB2X 4OO1H 1PH9A 3H91A 4TVAB 1K73C 4Z9CB 3MXNA 3KLSX 3PUYA 2AUKA 1ET6A 1JORA 1KXLA 4DKAC 1ENFA 3QOJA 2A6HD 5F2DA 3PUWA 1EOTA 1MGSA 3CMEA 4IOCA 2VQFL 4ZK9B 1O7LA 3JAML 3RUZA 4N9TA 2R93G 2EY5A 2YTVA 1HFGA 1WD1A 2SEBD 4B08A 1SYEA 2MPMA 4CKCA 4MHEA 5LMUQ 2VL6A 3KFUA 4ZRZA 2DY7A 3EJIA 4AYBG 3A5UA 2R61A 4KV6A 3MWYW 1QZGA 2PO4A 3HZXA 1LTBD 1EU3A 4A3CG 4TRDA 2Z0SA 4DNTB 4X66Q 4L5QA 3M3YB 2JA8G 1LT6D 1L0XB 4JPBW 4A3MB 2F4VL 1Z47A 1ONLA 3DUZA 2MNAA 3HEJA 4O1NA 4YHHQ 2DJGC 1EIYB 3JAME 2BE5C 4NXML 4L63B 5M3MG 1Q1EA 2PI2A 1S5FD 2HQEA 1NUCA 1Q8IA 1ZEQX 2L55A 2M9VA 3NBHB 2K14A 4CJ1B 4KN7C 2CKZB 1RDPD 4DGZA 2XTIA 3TRZA 5E1FA 1LTGD 2FHTA 3VR5A 5C0XI 2B2YC 4DAYB 2BE5D 2B2YA 1RTOA 2RKSA 4QB4A 3OTOQ 1CQFA 2F0LA 4YY3Q 4JI3Q 3SK4A 1WYDA 3H0GB 3HOYB 4NXNQ 4RKLA 5IT9L 2HIXA 3T1HQ 3PO2B 1U9RA 4P72A 3I8ZA 2OCEA 4GLVB 1ILQA 2NVTB 4A3MH 4RHSA 2GN5A 3TDQA 4B3SL 3T56B 1NY4A 2UXDQ 1F9SA 4HEDA 2O5IC 1VQJA 3GDEA 1SE4A 5I2XA 2JA5B 2JA6H 2I5MX 2FFKB 1VQOA 1HR0L 3ZJYC 4X65L 4C3HG 5BN5A 4DV0Q 1JE4A 3GO5A 3EFXD 3ERQA 4PZ7A 1JWSD 2F0MA 5FLMG 2EVBA 1CI3M 3CC4A 2F0VA 3KLSA 1OXVA 1IYVA 4HJAA 2JJQA 5I6WA 5IP9H 1OXTA 3S2HH 4YIJA 1PRTB 1ASYA 4QMGA 5IT9E 2IHEA 4JCVE 3CRKC 1F9QA 4A3KG 2YTYA 3GV3A 5GADC 5GAHC 2E76C 2K05A 2O4XA 1TU2B 4DPGA 3A7LA 4R4TA 3A55A 1KABA 3KJOA 4HIOA 1VQKA 2Q8TA 3H3VC 1EQVA 2B2TC 3PUXA 4AQYL 4OWTB 1CA6A 3J81L 3BVGA 2B2TA 1VQ7A 1Y69U 4BA1I 3W3AA 1SYCA 2GA4B 2B8FA 4FXGC 3KLRA 4KTAA 5DEHA 4L8JA 3KF8B 1SNPA 2F0WA 2F0GA 2PI2E 4BY1G 3S16B 3MC0B 2R6GA 1FNWA 2F1MA 2K52A 1M1KC 2F0PA 1U4LA 3I2ZA 4APVA 5GAEC 5IY0A 2I5HA 4GKJQ 3CCRA 4DV4L 2AWNA 4PZ8A 2R93H 4WJ3M 2F3VA 4QIWE 3NUCA 3UDFA 1X9NA 2VY3A 1BR9A 2D0PA 4UAIA 2PMZB 5C4XG 3W2DA 4DR3Q 1MBYA 3M4OH 3S2DB 1I50B 1TXYA 3OMGA 1IBLQ 1B1ZA 5EBDA 2B2WC 1TWHB 1NNXA 1EY6A 4PG3A 4DAPA 4X64Q 2WIIB 2V4DA 3U4VA 4A3CH 4RMFA 5IYCG 2L9HA 1T5XD 4JBJA 4B3TL 1S72A 1AZPA 5LHY1 4NDXA 3MXUA 1EQRA 1FJGL 3W1GA 2RA4A 1CSQA 1HTLD 4UY8C 1E2ZA 1TIID 4K8IA 2XWBB 4QQBX 4A3IG 2MO0A 2RQXA 4M1UB 1LT5D 1B3QA 2RCNA 1N34Q 4HR7B 5M3FG 1YITA 2Z1CA 1EFID 1GJXA 1Y8OB 5M3MH 1YNXA 5IYBG 1GXDC 3MEHA 5E4WC 1EYCA 4L5RC 3TQYA 1NSNS 1PTOF 1TWGH 1N33Q 3MEFA 4K6DA 4KJNA 1PH2A 2B29A 1C4QA 4C3IG 1XMQQ 4DK3C 2SOBA 1Y1WG 3H3VH 3SDZA 2Z8LA 3UDIA 2QCPX 4GN4B 2EY2A 2C35B 1JJGA 1PFNA 3HOZB 1X65A 1X56A 2MJ8A 4G7OC 1U4RA 3TS0A 2KHSA 3WOEA 2VNUD 3CPFA 5DLQE 2PZTA 3A8JE 1NTGA 5LMUL 2ALYB 1UE1A 3WDNA 3W5OA 1B53A 4A3DB 1D5ZC 2R7ZB 3VR6A 1IBMQ 2CH4W 2F0TA 1HUMA 3NXWA 1GUWA 1UE5A 1E24A 1QJOA 4NPSA 1EWIA 1S4ZA 1UUPA 1HA6A 1DM0B 2ICIA 4IPCA 3PIOA 1XPRA 4JBMA 3RZOB 5ELEA 3PV0A 3NWSA 2NVXH 4YHHL 4YCVA 1DOLA 4KHZA 3ULJA 3V2TA 1VF5C 3V96A 4C3HH 1CFMA 4U68A 1JB3A 3DXJC 2AHOB 3K5MA 4FP5D 3TP8A 3LWUA 2Q8RE 1EWCA 2AQ2B 3IFDA 4K2KA 5IE8A 1GUSA 1CHPD 3A7AB 2IX0A 5T1GA 3R8BA 1BCPB 3R2TA 3HOZH 4A3KH 4MN3A 4G7ZC 2L15A 1C9OA 3T53B 4IALA 4YWKA 1A62A 2KEEA 1UAPA 4OO1I 3PIO3 2N3SA 1SXTA 1D7QA 1EOVA 3TP6A 1V1PB 4RGOS 1B7YB 4S3SA 3I4NB 3PO3G 3OTOL 2KENA 2KJXA 3CU7A 2HUGA 4YY3L 3K80C 4JI3L 3BS1A 4NXNL 3T1HL 2LXKA 1CHQD 2UUBQ 4EGVA 1L1OC 4FDBA 2OTLA 5CV7A 4HAEA 2JP1A 2NWGA 5L37A 1L1OA 5IYDG 4CJ2C 3GTKH 3DM1A 5GROA 1AH9A 2OT2A 3CPWA 4BY1H 2UXDL 2LMCB 2D9UA 1PLFA 1WCMB 3EA6A 3DEOA 1D5MC 1R4QB 1SROA 2EXDA 4DV0L 1DONA 1Q7YC 2CHBD 1SYGA 3L3OC 3CCVA 4BXXG 4BBSB 5FK9C 5C5MA 3TZDA 3HOVG 1JJCB 3A74A 5J39A 1C8CA 4DV2Q 1KNAA 3SGIA 1PYSB 1YJ9A 4NXMQ 2QDBA 5FOBB 5K5PA 2X6GA 2EYHA 3HKZB 2R92B 1LTTD 4K0KQ 2ICEC 3RR5A 3J80c 3VR3A 3KBGA 1BBWA 4LWCA 4XQNA 2A69C 3GTQH 3EIVA 2EXZA 4XXEA 5IYCH 4RGMA 1AP0A 3GQBA 3L0OA 2AUJD 3TREA 1RKNA 1O7IA 2B8GA 5EGTA 2E2HB 2RHSB 4A3IH 5CC4A 4R4OA 1L0WA 5M3FH 4DUZL 1OXXK 4RA8A 3T13A 2K32A 1K0RA 3VA7A 3M9BA 4R4CA 4ZKCB 2A69D 1XNQQ 1TS5A 1LACA 3S14B 4DV1Q 4HJ9A 4C3IH 1D1KA 3LX0A 1XPUA 1E0BA 1ENAA 4FF1A 1Y1VB 4CDEC 2MFIA 2N8NA 4GKJL 4I7ZC 4ABNA 1U0LA 4JBWA 1TQOA 2Z6KC 3GV6A 1VQPA 4CKEA 2Z6KA 3FKIG 1YEZA 1H9SA 2K5DA 4DR3L 3RZDB 1GUOA 4HCEA 1VQBA 5J1ZA 1HUNA 5KNCA 2JEAI 2UXCQ 4IUPA 3RD4A 4RCOA 2F0HA 2WKDA 3V05A 2NVQB 1I3QB 3G6EA 2K03A 2TMPA 1SN8A 2PZUA 1SR3A 1X54A 1E2WA 1I4RA 1O78A 2A73B 3C1FA 3J80i 2JA7G 5HURA 1IYJB 3KLWA 3CP0A 2NN6G 5M5XB 3M4YA 1YNNC 3HKSA 4BY7B 4OGQC 1FGBD 3AFPA 1MHWC 4X62Q 3PIPA 4KKSA 4ZAIA 1HQMC 3MHBA 1N34L 2NB0A 3KBXA 2R7FA 2Z9HA 1BO0A 3RN2A 3TS2A 3CCLA 1SBBB 1TS3A 3K5NA 4L6TB 1SNDA 3D31A 2F0SA 1N33L 4JK1C 4A3GG 1CQVA 1EUJA 1AE2A 1YJWA 2HDMA 1XMQL 2J7ZA 1EYAA 1PH1A 4KY5A 1JQYD 2LXJA 4R8IA 4C1NI 1UEAB 4LAAA 3J7AF 4FF2A 4KJOA 1KHIA 3F8TA 5EPKA 1Z6HA 4XT1B 5C4HA 3M85A 2B3GA 4A93G 4A4IA 3SXHA 1HZCA 3S24A 2AQ1B 2GVAA 3J7A5 3I91A 1QUQB 1Q8KA 4V190 2NBFA 1W2BA 1YNJC 1XYIA 4DK0A 2EIFA 1XTCD 4EQOA 5FJ8H 2EOTA 5IGFA 1VQLA 4H13C 1SYDA 3I3CA 3ITPA 3PF4A 4HMIA 1IBML 3SK6A 1JJ2A 4MTNA 1F2YA 3PSIA 1G51A 2BH8A 2YYZA 1KRTA 3HOXG 1ICFB 1RTNA 5IYDH 3U58A 3I7FA 1I94Q 4DAVA 4B9XA 4FNFA 4JG2A 2Q8IB 4P71A 2G9HD 2RDFA 3T4AC 2FMCA 1VQCA 3NBIA 2F3IA 3D4RA 2CQOA 1YNJD 4ID6A 4DAMA 4G4KA 1QOHA 3S1NB 3F2UA 4CJ0B 4GNXC 2A6EC 4A3FB 1RF2D 4BXXH 1K8GA 2K01A 4GLXA 2PCFB 2I0QA 3WOFA 1KD1C 4AIMA 3X3NA 2ID0A 4OIJA 1B8AA 3I4OA 4G57A 1VQFA 1NAPA 2E2DC 3PCOB 5NUCA 4WRDA 4ODGA 3VYUA 3NP8A 2I07B 1G2TA 1LTRD 2JA9A 4KI0A 1VQMA 2K28A 2P5ZX 4JW0A 4ZKBB 5C3EG 1GHKA 5M5YH 2A6ED 4FXDA 1HHVA 3NELA 1XNRQ 5D3DA 3W1BA 4RFBA 3H3VI 4J6HA 1F77A 1QE6A 1VQ5A 1V1QA 2N88A 1B9MA 4BS9A 2UUBL 1N8RC 2NVYH 5IGCA 3S1MB 2Y0SG 3CRLC 1Z9FA 3D4WA 1EIGA 1Q46A 4RG1A 4QCLA 4IUUA 1IZ6A 1KTKA 3QWNA 4EQPA 3E3XA 3S1NH 1FNVA 4HCSA 4A3FH 1VQGA 1VQAA 2R3ZA 3TEHB 4XT3B 4HTHA 3GTPH 1DYQA 1JOQA 1BKBA 1EQTA 2VS1A 3AEVA 1WTPA 1A3UA 2JA6B 4DV2L 3FKIH 1AE3A 1VQHA 4IUNA 1SMYC 4XTCS 4K0KL 2KQ3A 4DF7A 3ZYYX 1HCZA 3G6JB 1D2BA 2EYFA 1FVIA 2NTSA 3GTOH 2N49A 1B70B 1VS0A 1ESFA 1CT1D 5D65A 1RD9D 5KNBA 3BVMA 1HPCA 2IT1A 3KDFB 4RWSC 2EY6A 2VUMG 3S2HB 2WINB 3HOUG 2NN6H 1F2MA 1TWCH 2F0JA 2WAQG 5G3LF 4DK6C 4DAYA 1V8QA 1GO3E 4KK7A 3J81j 3BYYB 2BCOA 1Q12A 2DJFC 1STNA 1Y8NB 2L1BA 2SNMA 2IWHA 3S1MH 1HQRD 2Z4IA 1SMYD 2B2VC 1A8VA 1CK1A 3I70A 5G3LD 4A3BB 4P75A 4A76A 2B2VA 3NEMA 3KF6A 5CMDA 1HFNA 1XNQL 4I7AA 3I56A 3OWEB 4QIWB 1QB5D 4DR1Q 2IJ0A 4DV1L 4A3GH 4A3JH 4IZ8A 1ESRA 5KNDA 1R9TH 1ENCA 1RJTA 2WB1B 1STYA 4F8MA 2VXWA 1HZBA 2H1EA 4A93H 1UNSA 2K5HA 4JV5Q 5J22A 4IPHA 4K6LA 3P7JA 4K8JA 4P74A 4UP8A 3AU7A 1G6ZA 1HJPA 1SMXA 2KVMA 5IIFA 2UXCL 3VYRA 1MD2D 1YVCA 2OQKA 3R93A 2R93B 2FMMA 3M4OB 2M2LA 4GKKQ 4KLKA 3HOXH 3PGZA 4RKBA 3VDYA 4OL7A 1KDCA 1LT3D 4AYBB 3DWAA 1QZHA 4IURA 2PNRC 5CV5A 3TP7A 3FVQA 1NJIC 4X62L 4A3BH 4ZUJA 3RN5A 1J5EL 3UDXA 4IQZA 3EROA 3LGJA 1D1IA 5DAUA 1X32A 4JYAQ 1STAA 4DUZQ 1EIHA 3F2CA 3FDTA 3R3OA 3TBIB 4ALPA 3QIAA 3MXPA 1PFMA 1DJRD 3KF8A 3H15A 5M3MB 2K4KA 3K5LA 4MNOA 2ZTEA 4LF9Q 2JXMB 1TWGB 4LUZA 1TVXA 4PNYA 1A0IA 3TMEA 3GD7A 1SFOH 2ZJQA 1B3AA 5I6YA 3CF5A 4JI7L 1RIPA 5C3EH 5CR3A 3I55A 3PUZA 1MJCA 1NMFA 1JICA 4JI1Q 2WFWA 2F03A 4NMZA 5LMNW 4PV1C 4KMUC 2XSCA 5JJKA 5CV6A 1XTDA 1EY8A 1V9PA 3OIPA 1DOMA 2PNHA 1PVOA 2HQLA 4DV3Q 4A3EG 3BVZA 4N8X1 5CV4A 2QW7A 5JVG3 4R4IA 1I94L 1PH3A 3J7ZC 4DN4M 2HT1A 2BA1A 1YHAA 3CD6A 1QILA 2Z6BA 4QY7A 1HA5A 5KGUA 4C3JG 2JA8H 4EQNA 2K5QA 4IPGA 2EE1A 1YHQA 3E9HA 1VQDA 4QJFA 4YWLA 2KCMA 1CA5A 4LFCQ 1K3BC 1PTOC 1VQEA 1R4PB 1DD2A 3S1RH 3PQIA 3OSOA 4EVOA 4BBRG 4R9WA 4O2DA 2Q2TA 2NVXB 1I4PA 3A8KE 5I9OA 2EY1A 3OPOA 4FF4A 4C3HB 2EJFC 2GVBA 2Y0SE 4L5SA 1U4MA 1PFBA 4AH6A 3OYYA 4IFDG 2EQSA 4UDUC 1LABA 1JE5A 2F0DA 4WJWA 1G2SA 1EFWA 1VQ4A 2VUMH 2QA4A 1E7ZA 1K0SA 5EBCA 3HOUH 1PTOD 4P73A 4XYOA 5IGBA 1SNCA 1PH7A 1LT4D 3QOLA 4A3KB 1XNRL 4NKLA 3JAMi 1O7ZA 3NPPA 3HGBA 2HDLA 4Q0FA 4UPAA 4YCUA 1XPOA 4F88A 2IL8A 2UUCL 3EQLC 5IOCA 2EZVA 2RHQB 2JE6I 2DGYA 5DM73 5HGTA 3J80E 1TS2A 1MSHA 5IGDA 2KCTA 5EPJA 3S1QH 2RDHA 2VZAA 1EEFD 1I4XA 3QR8A 5BN3A 2BH2A 1A15A 1A63A 3HS0C 4DV5Q 4CDDC 2WAQE 5A2QL 2A68C 1MKHA 4DV7Q 2KCNA 5C44G 3GTKB 3TP5A 2AWOA 1STBA 1PZJD 4BY1B 4R4QA 4IJHA 4ILWA 1JCKB 4GN5A 2K1BA 1QVCA 2MP1A 5FLMH 1Q1BA 5JPNC 1II3A 2EYLA 4H7BA 3E6ZX 4HIMA 4LMQD 3A54A 3M7GA 2LS01 5C4XB 3D8GA 1CSPA 1AN8A 2E2JB 3CXCA 5COYA 5IWAQ 2IX1A 1EY9A 3E5SA 1EL0A 1PTOH 3FHWA 2X69A 1CZGA 4IFDJ 2BA0A 1MI2A 3CCQA 1FNUA 4IOAA 5C5LA 4DR5Q 5JVH3 1A2UA 4JC0A 4X3KA 3GTQB 3ERSX 2B39A 1V1PA 2B63G 5A2QE 2BOSA 3AQQA 3M7NA 2IPKD 1WTXA 3DMUA 1SYFA 4A3LG 3J81c 3AB9A 4R8NA 1GUNA 5FO8B 4U673 1K8MA 5KRUA 1L2FA 1SE8A 3GTGH 4A3IB 1KRSA 3NENA 4DR1L 1BVSA 2FJ2A 2ZM6Q 5M3FB 3ULLA 1IYUA 1Y14B 1VQIA 3T1YQ 3OHXC 4Y7NH 2EJGC 2ZJRA 1JOOA 2VB3X 1SNQA 3RLFA 3DHQA 3D3RA 4WORA 1FYCA 3BDOA 4XQQA 4JV5L 4C3IB 1PYWD 4MIUA 4K14A 1KQSA 2ES2A 1Y1WB 2YU9H 1S40A 3CQZB 5C3WA 3A0JA 2PQEA 1KC8C 3I4MG 2K5WA 5CV9A 1VQ9A 1A6XA 1PH8A 5C4XH 1VDZA 2NZOA 4UP7A 3CC7A 2E2JH 3NHHA 4OWXB 1L1OB 1F9RA 4G7HC 4FF3A 3HOWG 4FXKC 1AFPA 5CGKA 1QWYA 1FGUA 3AMUA 2JEBI 4HIKA 4A3EH 4GKKL 3MVVA 3C3LA 1HR0W 2MGSA 2KUMA 3Q8DA 3F2BA 2CFMA 5H1SE 3QB3A 2F52A 4C3JH 1JWUD 2Z4HA 4RHRA 1GUGA 1KIXA 3NWTA 4GS3A 4XIGS 1ZXTA 5ELOA 1YIJA 4A75A 1CZWA 4JVZA 4JYAL 2NN6I 2ASBA 3G4SA 1PV4A 1I4HA 3J81i 3GTJH 3A5ZB 4MZ9A 1QVFA 5IYBH 1SLJA 3E0JA 4IFDH 2KOLA 4CBVA 4LF9L 3OIQA 4C2MH 3NE5B 4F7XA 1A3TA 1CKNA 4C1NK 4JI0Q 2WACA 5FO7B 1Y1WH 3CQZH 3K7UC 3NTIA 1K28A 3NQIA 2LSSA 3L7ZC 1VQ8A 3QO2A 4JI1L 1WTOA 2RSNA 1ICWA 4KY6A 5BR8Q 2ZXOA 4GOPC 5D3IB 1TY0A 4ZCKA 2RBMA 1EY5A 2E2IH 3OW2A 1FR3A 1B9NA 4IPDA 4GOPA 3DEPA 4DV3L 3MFYA 2DNCA 3PO3B 3K0XA 4RCNA 4TQUS 3D4DA 1YBYA 4NP5A 1S3OA 2SNSA 2VQEQ 3VR4A 1WFQA 1I5FA 2E8GA 3S9WA 1C7YA 1PXUA 2HHHQ 1H9SB 3UE1A 1SE2A 4LFCL 5KIXA 1YI2A 1EWHA 4CDFC 2E5LQ 2EYOA 1WTQA 2IY5B 4HJ5A 3NSWA 2OEOA 1PH5A 2IHFA 1J5EQ 1NE3A 5A35A 5C4JH 1UE6A 3H09A 4OHJA 4HJ7A 4X3UA 1OXUA 4XDXA 1HNZQ 3P20A 2ZXPA 2ZT9C 2Q2IA 1GOZA 1GKHA 1HZAA 4K5WA 4OWWB 4LJZC 3HOVB 4BWGB 1LO5D 1UEBA 4LNQA 4CKBA 5C6AA 1YNND 5M9OA 4OELB 2X6LA 4IUVA 3S17B 3H94A 4KKUA 1WTVA 1F2ZA 3VR2A 5EQ0A 1EY7A 1QUQA 4JI7Q 3PUVA 1V1OA 2DY8A 2XRQD 1X6OA 1BNZA 4FYDA 1BBXC 3PIP3 3PO3H 5M5YB 2DUDA 1HNWQ 4A3MG 2CH4A 3GTMH 2OF1A 2PQAB 4DR4Q 4KY7A 3VYSA 3HRZC 5JJZA 3FPPA 1XJVA 1J8IA 1TWFH 1X3GA 3LNNA 1LV9A 3IRBA 1S5CD 4DV5L 2QEXA 2NVYB 2KECA 2NUCA 3TSSA 3QG1A 1NCVA 4X3SA 4UHVA 4JI5Q 5DNFA 4DV7L 3SE0A 1B2TA 3MA2B 4LFAQ 2UU9Q 4LK1C 1PYBA 4J8QA 4HJ8A 3ONAB 1ASZA 3GTPB 1PH6A 2L4NA 1LTID 4IUQA 1TWAH 1Q3LA 3HOVH 3I4MH 2F0UA 1K83H 1TS4A 5M5WH 4DV6Q 3RLNA 5BN4A 3CAMA 3FKIB 1IXRA 4POFA 3K59A 3S17H 4OEMB 5IWAL 3BU2A 4DUYQ 4CHTB 2D2CC 3H0GG 3HOYG 3PO2G 2DN8A 4DR6Q 1EZ6A 2O2LD 1XXGA 4EQ5A 2ZJPA 4DR5L 1GUTA 3GTOB 3A8IE 3DLLA 1SEBD 4RH6A 2HD3A 4KN4C 3K7AH 4GNXB 2JA7B 1AZQA 3NQTA 1ILPA 4V0BA 4OXPA 1X3FA 1TWCB 3U4ZA 2JA5G 4QF4A 4LF4Q 3RLOA 2UUCQ 2CWAA 2J4XA 4JI4Q 3MXNB 3Q6SA 3G71A 1EEID 2QF7A 1WOCA 3HG9A 4ME5A 2ZM6L 4K2LA 4F87A 1QCBD 3T1YL 5CBEE 2I5LX 1RCVD 3E9IA 1Y8PB 1X3EA 3L9AX 3GTLH 4A3GB 4A3JB 2ZTDA 1R9TB 3F1ZA 1TT2A 2K33A 4HN7A 3HP3A 5J3BA 2KHIA 2NTTA 5K36G 2HCCA 1N32Q 1WI5A 1HTPA 4A93B 1STEA 3F2DA 4XQJA 2ZXRA 3M4PA 2RF4A 2YV5A 2BDOA 4POGA 5FLXc 3Q23A 3NBHA 4B9WA 1XX8A 3IL8A 3KDFA 2D62A 1VF7A 2BDNA 1A2TA 2EPBA 2UXBQ 3I4LA 4IN3A 5C3XA 3CKIB 3KJPA 4P2CB 2JA7H 4DU9A 1ET9A 4L5TA 3MFGA 3K58A 3FP9A 2OTJA 2I46A 3HOXB 3K57A 3VA5A 2F0QA 4LF5Q 4KHPQ 3BJUA 1YZ6A 4LF7Q 3X3MA 1HNXQ 4OONA 4WJ4A 5EPLA 1YJNA 2B2UC 2ENBA 3KYHC 2G5DA 1Q90A 3K5OA 2K50A 2CQAA 5I9PA 2A8VA 1K9MC 1D6EC 2B2UA 3KK7A 1YHBA 2A5HA 1EY0A 1VMPA 3J7AV 3JC66 1V43A 4DK1A 3MTSA 1SNOA 4TSSA 2AMCB 4JI0L 1SRUA 2KHJA 1U4PA 1PFSA 1P8LA 2RDGA 3D0FA 1EYDA 5JEAG 3OMCA 2MO1A 5ELFA 1STGA 1Q86C 1PMRA 3NTKA 1BUVT 3MXGA 4JI8Q 1K8AC 5BR8L 1VQNA 3M3YH 1PH4A 3KF6B 3CMAA 1SFOB 3L2PA 5C3EB 1PRTC 4E6IA 2NZ1D 2M00A 1S5DD 4FO2A 4ZQ3A 2JYOA 1Z7TA 2HIVA 2G9DA 2VQEL 2EYMA 1HXYD 4RGNA 1E1OA 1PRTF 2N55A 4R1JA 3CCUA 3CHBD 4LF6Q 1ZYRC 1G91A 1CKMA 2Y0SB 4RGTA 2HHHL 3EBEA 4LF8Q 4LUOA 3T51B 2E5LL 5ELBA 1LM0A 3TZUA 1KLUD 4Y52H 1G6PA 2HCIA 4DXFA 1E22A 4PMBA 2JA8B 1PRTD 1H95A 5C0XG 4UP9A 2WV6D 1I4GA 3R2IA 3HOZG 1HNZL 1WD0A 1BF4A 4H44C 1H9RA 5KYIA 1VQ6A 4ULLA 3S1RB 1IW7C 3HFZB 4NW2A 3FPUB 1JB7A 3T16A 1IL8A 2AQ3B 4YWMA 1JOKA 3MZ5A 1GHJA 1ZYRD 3DM3A 4X3TA 1P16A 2RVLA 1N36Q 3OW7A 1XMOQ 3H0GH 4A3DG 3HOYH 2R7DA 2R7ZG 4WFN3 4OX9L 3PO2H 2XGTA 1SSOA 3JAMc 2MQHA 1DGSA 1DXMA 4JI2L 2NVTH 2Q2HA 5TSSA 3U50C 4IFDI 1UWVA 1OO9B 2VUMB 4Q5VA 5JEAJ 1IHZA 3HOUB 1HNWL 2D0OA 1VCIA 2WAQB 1IW7D 3GP7A 4B3RQ 2JA5H 3SK5A 4DR4L 2L5TA 5CBAE 2PPBC 3P1HA 5IODA 3AYHB 4O0AA 2EYJA 1F9PA 2K5NA 1O7YA 4GZYC 5JAVA 1SYBA 1HH2P 3BZKA 5HGQA 2K6AA 4JI5L 4DNIA 3S1QB 2PW7A 3U9SA 2MHVA 2UU9L 2JQOA 1QNKA 3VYTA 4LFAL 1OTCA 4DR7Q 4PZ6A 1E3PA 2FXQA 4BA2I 2KA7A 2WB1E 1PZID 3CW2C 1IL2A 2F0EA 3G7LA 1WTWA 5K36H 3J81E 1U5KA 4LFBQ 2KEDA 1DZ1A 2B2WA 3IKJA 2JN4A 3J80L 4PMWA 1JC7A 5C0XJ 2F0FA 1NBWA 2PW5A 4DV6L 3I4NG 3STBC 3J7YW 1LTLA 3N52A 4QGUA 1KLGD 1OXSC 1HRJA 4YCWA 1D5XC 1M4VA 2XVSA 3U9OA 4DUYL 2EYPA 1W3SA 2UUAQ 3FRPB 4DR6L 2RSOA 1JWMD 4TKOB 2ATWA 1QNUA 1XWEA 1FD7D 2WKCA 1PTOB 3DWPA 2JSOA 4AYBE 3BG3A 1TKWB 3BDCA 3S16H 5LMNQ 1WCMG 3Q24A 2E74C 4LF4L 3OWFA 3STBD 1B44D 5IT9c 1KDBA 2LFNA 4JI4L 1PDQA 5EKLA 5KYLA 4BBSG 2A19A 3PF5A 1GM5A 1D8LA 3ER0A 4PMCA 3A56A 3S2DH 2JK8A 1I50H 1WTHA 1CUKA 1JMCA 3HKZG 3GTGB 2R92G 4ZYSA 5ELDA 3PMFA 4DFAA 1TWHH 1H9JA 1EQQA 1WVLA 5CV8A 1IBKQ 1EY4A 1MJEA 5JEAH 1SE3A 3RNUA 2F0KA 4Y7NB 1N32L 4DNRB 2CWPA 4C56C 5I4DA 4X66L 2YU9B 2CCZA 1BCPC 3EN2A 1Q81C 2AKWB 5D14A 2NZHA 2PMZE 2EDGA 4N9PA 4JI6Q 3FMCA 2F0OA 3B6YA 1KAWA 2UXBL 4H0LC 3SVMA 1PHJA 1X55A 2A68D 1S5ED 2PYKA 4DR2Q 1KNEA 4A3EB 3K6OA 5AJ3Q 5DM63 1BCPF 1NR2A 5E7NA 2O5JC 4LF5L 4KHPL 2IW3A 2QGQA 4RAUC 1LTSD 2Q2UA 3Q0AA 3IAYA 1AW7A 4LF7L 4B3MQ 3CCEA 3KOJA 3M4QA 1HNXL 3NTHA 2J0TD 1GD7A 1Y1VG 3CCMA 4C3JB 2TSSA 5C0XH 4ZUIA 1BCPD 2YTXA 1LYLA 2XN9C 3I90A 4DA2A 1EZ8A 2SDFA 5EKKA 1DCZA 2PZWA 3WWVA 5IP7G 4HMJA 4BBRB 2K7VA 4IO9A 2A74C 5KEEA 2VW9A 1PA6A 3CC2A 5T1IA 3GTJB 2VQFQ 1B4OA 2XWJB 2FINB 2N78A 2XNAC 1B50A 1JT8A 1PZKD 1VMCA 4QUFA 4A3DH 2R7ZH 5E3FA 3SR1A 1A3VA 4K5XA 5FJ8G 4JI8L 1LUZA 4C2MB 4H02A 1I6VC 2H5XA 1EIFA 4CDCC 2QKIC 4BY7G 2C5CA 2WP8J 5ELCA 3G48A 3RZOH 2EJMA 2K04A 5JPMC 4KHVA 4CGYB 5C4ZA 2C9OA 2L11A 2LY7A 4LW1A 5I2YA 1ZKOA 1M8AA 2L0CA 2E2IB 2F4VQ 4IUTA 2OWOA 4LF6L 1RHPA 1EYGA 2KBNA 2CVRA 4I65A 4LF8L 2MUYA 1F2LA 1DOKA 3Q22A 1S5BD 5IGEA 4OO1G 5EAYA 3UDGA 4PQXA 3ICEA 5ELNA 4HSVA 4BBRH 4J15A 2D5DA 5C44B 3BZCA 1SNMA 1KDAA 1MIUA 3I4NH 5C4JB 2K5VA 1BBUA 2XIWA 2F4IA 5FO9B 1N36L 1XMOL 1SJED 1WTRA 1T9HA 3P75A 1T5EA 2NYZD 1BQQT 1BOSA 3LWEA 5JJIA 1NR4A 1L0YB 3MAQA 3D6CA 2KCCA 1LTAD 4B3RL 2ZTCA 3UI2A 1QG7A 4N8FA 5AFWA 1WCMH 2E75C 2B63B 5CORA 5E4XA 2F0IA 3D6WA 5CYUA 4A3FG 4B3SQ 4BBSH 1J9OA 4XYQA 1CKNB 1SDFA 3I73A 3GTMB 1M90C 2OXPA 4ME3A 5LL6X 1HR0Q 3C1EA 4K5VA 1Q82C 4X65Q 4EX5A 1TWFB 2R92H 4DR7L 4M8AA 1I6HB 1X3PA 1UE7A 1X3QA 3ND9A 4KKTA 1IBLL 4J1MA 2A1AA 1NMGA 5EKIA 1RODA 4OIKA 2F0NA 3SK8A 1LLRD 3K0YA 5C44H 4X64L 1C0AA 3UE0A 4GOPB 4LFBL 3RMHA 1RL2A 5GAGC 1SAPA 4NB3A 5FLXL 3K81C 4O42A 4QL5A 1N9WA 2LKVA 3O13A 3K8AA 2QEJC 4JBKA
chains in the Genus database with same CATH topology
3C46A 3SEBA 1TWAB 2L12A 3I4MB 1K8OA 4KD4A 1K83B 5M5WB 3HOWB 1I4QA 4KD3A 1STHA 3S15B 1W6JA 5JOBA 3IFTA 3TN2A 3I72A 4HSPA 5FKAC 5EJWA 3K7AB 1IKLA 1O80A 3N6RA 1BDOA 1H9KA 3OOCA 5FLXE 3BYTB 3URYA 5ISRA 1CM9A 1ML0D 5IGGA 3KUPA 3H6MA 2H4OA 2F3WA 1C48A 2IX3A 3BZDB 1G8ZD 3GTLB 3NK9A 4FVMA 4ZLTF 5LL6S 2CW0C 1CTMA 1AEXA 3C2PA 3EVQA 1BXTA 3DWQA 3BDLA 4DXGA 1TR5A 1E2VA 1G291 1EU4A 3QJYA 1KAAA 2A6HC 1TY2A 2DNEA 2QILA 3SHLA 1W6KA 4QUCA 3FEWX 3ND8A 2XRSD 1H9MA 1IKMA 1SJHD 1JR0D 2CW0D 1MSGA 2VB2X 4OO1H 3H91A 4Z9CB 3MXNA 3KLSX 3PUYA 2AUKA 1ET6A 1JORA 1ENFA 3QOJA 2A6HD 5F2DA 3PUWA 1EOTA 1MGSA 4ZK9B 1O7LA 3JAML 3RUZA 4N9TA 2EY5A 1HFGA 1WD1A 2SEBD 4B08A 1SYEA 2MPMA 4CKCA 4MHEA 4ZRZA 2DY7A 3EJIA 2R61A 4KV6A 3MWYW 2PO4A 3HZXA 1LTBD 1EU3A 4TRDA 4DNTB 3M3YB 1LT6D 1L0XB 4A3MB 1Z47A 1ONLA 3DUZA 3HEJA 4O1NA 3JAME 2BE5C 4L63B 1Q1EA 1S5FD 2HQEA 1NUCA 1Q8IA 1ZEQX 2L55A 2M9VA 4CJ1B 4KN7C 4DGZA 1RDPD 5E1FA 1LTGD 2FHTA 3VR5A 5C0XI 2B2YC 2BE5D 2B2YA 1RTOA 2RKSA 4QB4A 1CQFA 2F0LA 3SK4A 3H0GB 3HOYB 4RKLA 5IT9L 3PO2B 1U9RA 3I8ZA 1ILQA 2NVTB 4RHSA 3TDQA 3T56B 1F9SA 4HEDA 2O5IC 1SE4A 5I2XA 2JA5B 2FFKB 4C3HG 5BN5A 1JE4A 3GO5A 3EFXD 3ERQA 1JWSD 2F0MA 2EVBA 1CI3M 2F0VA 3KLSA 1OXVA 1IYVA 5I6WA 1OXTA 4YIJA 1PRTB 4QMGA 5IT9E 3CRKC 1F9QA 3GV3A 2E76C 2K05A 2O4XA 1TU2B 3A7LA 3A55A 1KABA 3H3VC 2Q8TA 1EQVA 2B2TC 3PUXA 1CA6A 3J81L 3BVGA 2B2TA 1Y69U 4BA1I 3W3AA 1SYCA 2GA4B 2B8FA 4FXGC 3KLRA 4KTAA 5DEHA 4L8JA 1SNPA 2F0WA 2F0GA 3S16B 3MC0B 2R6GA 1FNWA 2F1MA 2F0PA 1U4LA 2AWNA 2F3VA 3NUCA 1BR9A 4UAIA 2PMZB 3W2DA 1MBYA 3S2DB 1I50B 3OMGA 1B1ZA 5EBDA 2B2WC 1TWHB 1EY6A 4DAPA 2WIIB 2V4DA 2L9HA 1T5XD 1AZPA 5LHY1 4NDXA 3MXUA 2RA4A 1HTLD 1E2ZA 1TIID 4K8IA 2XWBB 2RQXA 4M1UB 1LT5D 4HR7B 2Z1CA 1EFID 1GJXA 1Y8OB 1GXDC 3MEHA 5E4WC 1EYCA 1NSNS 1PTOF 4K6DA 4KJNA 1C4QA 4C3IG 2SOBA 3SDZA 2Z8LA 2QCPX 2EY2A 1PFNA 3HOZB 2MJ8A 4G7OC 1U4RA 2KHSA 3WOEA 2VNUD 2PZTA 3A8JE 3WDNA 1B53A 4A3DB 1D5ZC 2R7ZB 3VR6A 2F0TA 1HUMA 3NXWA 1GUWA 1QJOA 1S4ZA 1UUPA 1HA6A 1DM0B 2ICIA 3RZOB 5ELEA 3PV0A 3NWSA 1DOLA 4KHZA 3V2TA 1VF5C 3V96A 1CFMA 4U68A 1JB3A 3DXJC 3K5MA 4FP5D 3TP8A 3LWUA 2Q8RE 1EWCA 2AQ2B 3IFDA 4K2KA 1GUSA 1CHPD 3A7AB 2IX0A 5T1GA 3R8BA 1BCPB 3R2TA 4MN3A 4G7ZC 3T53B 4IALA 2KEEA 1UAPA 4OO1I 3PIO3 1SXTA 3TP6A 1V1PB 4RGOS 4S3SA 3I4NB 2KJXA 3CU7A 2HUGA 3BS1A 1CHQD 4EGVA 5CV7A 4HAEA 2JP1A 2NWGA 4CJ2C 3DM1A 2OT2A 2LMCB 2D9UA 1PLFA 1WCMB 3EA6A 3DEOA 1D5MC 1R4QB 1DONA 2CHBD 1SYGA 3L3OC 4BBSB 5FK9C 5C5MA 3TZDA 5J39A 1C8CA 1KNAA 2QDBA 5FOBB 5K5PA 2X6GA 2EYHA 3HKZB 2R92B 1LTTD 2ICEC 3VR3A 3KBGA 4XQNA 2A69C 2EXZA 4XXEA 4RGMA 1AP0A 3GQBA 2AUJD 1RKNA 2B8GA 5EGTA 2E2HB 5CC4A 1OXXK 4RA8A 3T13A 2K32A 3VA7A 4ZKCB 2A69D 1TS5A 1LACA 3S14B 1D1KA 3LX0A 1E0BA 1ENAA 4FF1A 1Y1VB 4I7ZC 4ABNA 4JBWA 1TQOA 3GV6A 4CKEA 1H9SA 2K5DA 3RZDB 1GUOA 4HCEA 5J1ZA 1HUNA 5KNCA 2JEAI 4IUPA 3RD4A 4RCOA 2F0HA 2WKDA 3V05A 2NVQB 1I3QB 2K03A 2TMPA 2PZUA 1E2WA 1I4RA 1O78A 2A73B 3C1FA 5HURA 2NN6G 5M5XB 3M4YA 1YNNC 4BY7B 4OGQC 1FGBD 4KKSA 4ZAIA 1HQMC 3MHBA 2NB0A 3KBXA 1BO0A 1SBBB 1TS3A 3K5NA 4L6TB 1SNDA 3D31A 2F0SA 4JK1C 1CQVA 2HDMA 2J7ZA 1EYAA 4KY5A 1JQYD 4R8IA 4C1NI 1UEAB 4LAAA 3J7AF 4FF2A 4KJOA 5EPKA 1Z6HA 4XT1B 5C4HA 3M85A 3SXHA 2AQ1B 3I91A 4V190 2NBFA 1YNJC 1XYIA 4DK0A 1XTCD 4EQOA 5IGFA 2EOTA 4H13C 1SYDA 3I3CA 3ITPA 4HMIA 3SK6A 1F2YA 2YYZA 1RTNA 4DAVA 4B9XA 4FNFA 2Q8IB 2G9HD 2RDFA 3T4AC 2FMCA 3NBIA 3D4RA 1YNJD 4ID6A 4G4KA 1QOHA 3S1NB 3F2UA 4CJ0B 2A6EC 4A3FB 1RF2D 2K01A 2PCFB 3WOFA 3X3NA 2ID0A 4OIJA 4G57A 1NAPA 2E2DC 5NUCA 4WRDA 4ODGA 3VYUA 3NP8A 2I07B 1G2TA 1LTRD 4KI0A 2K28A 4ZKBB 1GHKA 2A6ED 4FXDA 1HHVA 5D3DA 4RFBA 4J6HA 1F77A 1QE6A 2N88A 1B9MA 4BS9A 5IGCA 3S1MB 3CRLC 3D4WA 1EIGA 4QCLA 4IUUA 1KTKA 3QWNA 4EQPA 1FNVA 4HCSA 2R3ZA 4XT3B 4HTHA 1DYQA 1JOQA 1EQTA 1WTPA 1A3UA 2JA6B 4IUNA 1SMYC 4XTCS 2KQ3A 4DF7A 3ZYYX 1HCZA 3G6JB 1D2BA 2EYFA 2NTSA 1ESFA 1CT1D 5D65A 1RD9D 5KNBA 3BVMA 1HPCA 2IT1A 4RWSC 2EY6A 3S2HB 2WINB 2NN6H 1F2MA 5G3LF 2F0JA 4DAYA 1V8QA 4KK7A 3BYYB 2BCOA 1Q12A 1STNA 1Y8NB 2L1BA 2SNMA 2IWHA 1HQRD 2Z4IA 1SMYD 2B2VC 1CK1A 3I70A 5G3LD 4A3BB 2B2VA 5CMDA 1HFNA 3OWEB 4QIWB 1QB5D 2IJ0A 4IZ8A 5KNDA 1ESRA 1ENCA 1RJTA 2WB1B 1STYA 4F8MA 2VXWA 2H1EA 1UNSA 5J22A 4K6LA 3P7JA 4K8JA 3AU7A 1G6ZA 2KVMA 5IIFA 3VYRA 1MD2D 3R93A 2R93B 2FMMA 3M4OB 2M2LA 4RKBA 4OL7A 1KDCA 4AYBB 1LT3D 3DWAA 4IURA 2PNRC 5CV5A 3TP7A 3FVQA 4ZUJA 4IQZA 3EROA 1D1IA 5DAUA 1X32A 1STAA 1EIHA 3FDTA 3R3OA 3TBIB 3QIAA 3MXPA 1PFMA 1DJRD 3KF8A 5M3MB 3K5LA 2JXMB 1TWGB 1TVXA 4PNYA 3TMEA 3GD7A 1B3AA 5I6YA 5CR3A 3PUZA 1JICA 2F03A 4NMZA 4PV1C 4KMUC 2XSCA 5CV6A 1EY8A 3OIPA 1DOMA 3BVZA 5CV4A 5JVG3 4DN4M 2BA1A 1QILA 1HA5A 5KGUA 4C3JG 4EQNA 2K5QA 2EE1A 1CA5A 1PTOC 1DD2A 1R4PB 3OSOA 4EVOA 4R9WA 2NVXB 1I4PA 3A8KE 5I9OA 2EY1A 3OPOA 4FF4A 4C3HB 2EJFC 1U4MA 1PFBA 4IFDG 4UDUC 1LABA 2F0DA 4WJWA 1G2SA 5EBCA 1PTOD 4XYOA 5IGBA 1SNCA 1LT4D 3QOLA 4A3KB 4NKLA 1O7ZA 3NPPA 3HGBA 2HDLA 4Q0FA 4F88A 2IL8A 3EQLC 5IOCA 2EZVA 2JE6I 5DM73 5HGTA 3J80E 1TS2A 5IGDA 1MSHA 5EPJA 2RDHA 1EEFD 1I4XA 5BN3A 1A15A 3HS0C 5A2QL 2A68C 2KCNA 3GTKB 3TP5A 2AWOA 1STBA 1PZJD 4BY1B 4ILWA 1JCKB 2K1BA 2MP1A 1Q1BA 5JPNC 1II3A 2EYLA 4H7BA 3E6ZX 4LMQD 3A54A 3M7GA 2LS01 5C4XB 3D8GA 1AN8A 2E2JB 5COYA 2IX1A 1EY9A 3E5SA 1EL0A 1PTOH 2X69A 1CZGA 4IFDJ 2BA0A 1MI2A 1FNUA 5C5LA 5JVH3 1A2UA 3GTQB 4X3KA 2B39A 1V1PA 5A2QE 2BOSA 3M7NA 2IPKD 1WTXA 3DMUA 1SYFA 3AB9A 4R8NA 1GUNA 5FO8B 4U673 1K8MA 5KRUA 4A3IB 2FJ2A 5M3FB 1IYUA 3OHXC 2EJGC 1JOOA 2VB3X 1SNQA 3RLFA 3DHQA 3D3RA 4WORA 1FYCA 3BDOA 4XQQA 4C3IB 1PYWD 4MIUA 4K14A 1Y1WB 3CQZB 5C3WA 2PQEA 2K5WA 5CV9A 1A6XA 1VDZA 3NHHA 1F9RA 4G7HC 4FF3A 4FXKC 1AFPA 5CGKA 1QWYA 3AMUA 2JEBI 3MVVA 3C3LA 2MGSA 2KUMA 3QB3A 1JWUD 2Z4HA 4RHRA 1GUGA 3NWTA 4XIGS 1ZXTA 1CZWA 2NN6I 1I4HA 3E0JA 4IFDH 2KOLA 4CBVA 3OIQA 3NE5B 4F7XA 1A3TA 4C1NK 2WACA 5FO7B 3NTIA 3NQIA 3L7ZC 3QO2A 1WTOA 2RSNA 1ICWA 4KY6A 2ZXOA 5D3IB 1TY0A 2RBMA 1EY5A 1FR3A 1B9NA 3DEPA 3MFYA 2DNCA 3PO3B 4RCNA 4TQUS 3D4DA 4NP5A 2SNSA 3VR4A 3S9WA 1PXUA 1H9SB 1SE2A 5KIXA 1EWHA 2EYOA 1WTQA 3NSWA 2OEOA 5A35A 4OHJA 3H09A 4X3UA 1OXUA 4XDXA 3P20A 2ZXPA 2ZT9C 1GOZA 4K5WA 4LJZC 3HOVB 4BWGB 1LO5D 4CKBA 5C6AA 1YNND 5M9OA 2X6LA 4IUVA 3S17B 3H94A 4KKUA 1WTVA 1F2ZA 3VR2A 5EQ0A 1EY7A 3PUVA 1V1OA 2DY8A 2XRQD 1BNZA 4FYDA 1BBXC 3PIP3 5M5YB 2OF1A 4KY7A 3VYSA 3HRZC 5JJZA 3FPPA 1J8IA 3LNNA 1LV9A 1S5CD 2NVYB 2KECA 2NUCA 3TSSA 3QG1A 1NCVA 4X3SA 5DNFA 3SE0A 1B2TA 3MA2B 4LK1C 4J8QA 3ONAB 3GTPB 2L4NA 1LTID 4IUQA 1Q3LA 2F0UA 1TS4A 5BN4A 3FKIB 3K59A 4CHTB 2D2CC 2DN8A 1EZ6A 2O2LD 1XXGA 1GUTA 3GTOB 3A8IE 1SEBD 4RH6A 4KN4C 2JA7B 1AZQA 3NQTA 1ILPA 4V0BA 1TWCB 4QF4A 2J4XA 3Q6SA 1EEID 2QF7A 3HG9A 4ME5A 4K2LA 4F87A 1QCBD 5CBEE 1RCVD 1Y8PB 3L9AX 4A3GB 4A3JB 1R9TB 1TT2A 2K33A 4HN7A 3HP3A 2NTTA 5K36G 2HCCA 1HTPA 4A93B 1STEA 4XQJA 2ZXRA 2BDOA 3Q23A 3NBHA 4B9WA 1XX8A 3IL8A 2D62A 1VF7A 2BDNA 1A2TA 2EPBA 3I4LA 4IN3A 5C3XA 3CKIB 4P2CB 4DU9A 1ET9A 3MFGA 3K58A 2I46A 3HOXB 3K57A 3VA5A 2F0QA 3X3MA 5EPLA 2B2UC 2ENBA 1Q90A 3K5OA 5I9PA 2CQAA 1D6EC 2B2UA 3KK7A 2A5HA 1EY0A 1VMPA 3J7AV 1V43A 4DK1A 3MTSA 1SNOA 4TSSA 1U4PA 2RDGA 1EYDA 5JEAG 3OMCA 5ELFA 1STGA 1PMRA 3NTKA 1BUVT 3MXGA 1SFOB 5C3EB 1PRTC 4E6IA 2NZ1D 2M00A 1S5DD 4FO2A 4ZQ3A 2JYOA 1Z7TA 2G9DA 2EYMA 1HXYD 4RGNA 1PRTF 2N55A 1G91A 3CHBD 1ZYRC 2Y0SB 4RGTA 3T51B 5ELBA 3TZUA 1KLUD 2HCIA 4DXFA 4PMBA 2JA8B 1PRTD 5C0XG 2WV6D 1I4GA 3R2IA 1WD0A 1BF4A 4H44C 1H9RA 5KYIA 4ULLA 3S1RB 1IW7C 4NW2A 3FPUB 3T16A 1IL8A 2AQ3B 1JOKA 3MZ5A 1GHJA 1ZYRD 4X3TA 2RVLA 3OW7A 4WFN3 1SSOA 1DXMA 5TSSA 4IFDI 1OO9B 2VUMB 4Q5VA 5JEAJ 1IHZA 3HOUB 1VCIA 2WAQB 1IW7D 3GP7A 3SK5A 2L5TA 5CBAE 2PPBC 3P1HA 5IODA 2EYJA 1F9PA 4GZYC 1O7YA 5JAVA 1SYBA 2K6AA 3S1QB 2PW7A 3U9SA 2MHVA 1QNKA 3VYTA 4BA2I 2KA7A 1PZID 2F0EA 3G7LA 1WTWA 5K36H 3J81E 2KEDA 1DZ1A 2B2WA 3IKJA 3J80L 4PMWA 1JC7A 5C0XJ 2F0FA 2PW5A 3J7YW 3N52A 1KLGD 1OXSC 1HRJA 3U9OA 1D5XC 1M4VA 2XVSA 2EYPA 3FRPB 2RSOA 1JWMD 4TKOB 1QNUA 1XWEA 1FD7D 2WKCA 1PTOB 3DWPA 2JSOA 3BG3A 1TKWB 3BDCA 3Q24A 2E74C 3OWFA 1B44D 1KDBA 2LFNA 1PDQA 5EKLA 5KYLA 4PMCA 3A56A 3GTGB 4ZYSA 5ELDA 3PMFA 4DFAA 1H9JA 1WVLA 5CV8A 1EY4A 5JEAH 1SE3A 2F0KA 4Y7NB 4DNRB 4C56C 5I4DA 2YU9B 1BCPC 5D14A 2EDGA 4N9PA 3FMCA 2F0OA 4H0LC 3SVMA 2A68D 1S5ED 2PYKA 1KNEA 4A3EB 3K6OA 5DM63 1BCPF 1NR2A 2O5JC 2IW3A 4RAUC 1LTSD 3Q0AA 3IAYA 1AW7A 3NTHA 2J0TD 4C3JB 2TSSA 5C0XH 4ZUIA 1BCPD 2XN9C 3I90A 4DA2A 1EZ8A 2SDFA 5EKKA 1DCZA 2PZWA 4HMJA 4BBRB 2K7VA 2A74C 5KEEA 5T1IA 3GTJB 1B4OA 2XWJB 2FINB 1B50A 2XNAC 1PZKD 1VMCA 4QUFA 5E3FA 3SR1A 1A3VA 4K5XA 4C2MB 1I6VC 2QKIC 2C5CA 2WP8J 5ELCA 2EJMA 2K04A 5JPMC 4KHVA 4CGYB 5C4ZA 2C9OA 2L11A 2LY7A 5I2YA 1ZKOA 1M8AA 2L0CA 2E2IB 4IUTA 1RHPA 2CVRA 4I65A 2MUYA 1F2LA 1DOKA 3Q22A 1S5BD 5IGEA 4OO1G 4PQXA 4HSVA 2D5DA 5C44B 1SNMA 1KDAA 5C4JB 2XIWA 2F4IA 5FO9B 1SJED 1WTRA 3P75A 1T5EA 2NYZD 1BQQT 1BOSA 3LWEA 1NR4A 1L0YB 3MAQA 3D6CA 2KCCA 1LTAD 3UI2A 1QG7A 5AFWA 2E75C 2B63B 5CORA 5E4XA 2F0IA 3D6WA 5CYUA 1J9OA 4XYQA 1SDFA 3I73A 3GTMB 2OXPA 5LL6X 3C1EA 4K5VA 1TWFB 4M8AA 1I6HB 1X3PA 1X3QA 3ND9A 4KKTA 4J1MA 5EKIA 1RODA 4OIKA 2F0NA 3SK8A 1LLRD 3K0YA 3RMHA 1SAPA 5FLXL 4O42A 2LKVA 3O13A 2QEJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TQO A;  4ID6 A;  5C4Z A;  1STN A;  5EKL A;  4NMZ A;  5F2D A;  5KYI A;  2SNM A;  5KYL A;  2OF1 A;  3T16 A;  3TP6 A;  5CV6 A;  4K8I A;  4S3S A;  4KY7 A;  1EY8 A;  3RUZ A;  4KD4 A;  1II3 A;  2EYL A;  3ERQ A;  4H7B A;  1JOK A;  2EY5 A;  3MZ5 A;  4N9T A;  4PMC A;  5J1Z A;  1A2T A;  2F0M A;  4KD3 A;  1SYE A;  4G57 A;  3D8G A;  5C3X A;  1STH A;  2F0H A;  3PMF A;  5CV4 A;  5NUC A;  2F0V A;  1EY9 A;  3E5S A;  4I65 A;  4ODG A;  2NUC A;  4WRD A;  5JOB A;  4DU9 A;  5IGD A;  5CV8 A;  4IZ8 A;  3MEH A;  1A3T A;  1EY4 A;  1EYC A;  2PZU A;  3EJI A;  5CV7 A;  4F7X A;  1NSN S;  3NP8 A;  5I6W A;  2WAC A;  4KV6 A;  1ENC A;  3C1F A;  4YIJ A;  4DFA A;  3HZX A;  4K6D A;  4KJN A;  2F0K A;  4QMG A;  5C5L A;  2F0Q A;  3VA5 A;  5HUR A;  5IGE A;  1STY A;  5KGU A;  1A2U A;  4EQN A;  4TRD A;  2SOB A;  4F8M A;  1IHZ A;  4B9W A;  2EY2 A;  4KY6 A;  2O4X A;  2ENB A;  5J22 A;  3SK5 A;  3DMU A;  1SNM A;  1SYF A;  3OSO A;  4EVO A;  4K8J A;  1KDA A;  5I9P A;  2F0U A;  2RBM A;  3MHB A;  1EY5 A;  1SYG A;  5ISR A;  4J6H A;  2KHS A;  3P1H A;  4N9P A;  5C5M A;  1KAB A;  2F0O A;  4R8N A;  5IOD A;  5I9O A;  2EY1 A;  2EYJ A;  3HEJ A;  5IIF A;  1EY0 A;  5KRU A;  5J39 A;  1EQV A;  5IGG A;  5JAV A;  2PZT A;  3H6M A;  1SYB A;  1SNO A;  3P75 A;  2F3W A;  5IGC A;  2PYK A;  3D4D A;  1SND A;  2QDB A;  4NP5 A;  5K5P A;  2SNS A;  2F0S A;  2EYH A;  3D4W A;  2PW7 A;  2F0D A;  1EZ6 A;  3S9W A;  2HQE A;  4RKB A;  1EYD A;  1EYA A;  1NUC A;  1SYC A;  2F0T A;  3NK9 A;  3OMC A;  4KY5 A;  4OL7 A;  1STG A;  3NXW A;  1KDC A;  4KTA A;  4LAA A;  3D6C A;  5DEH A;  4EQP A;  1JOO A;  2EXZ A;  1SNP A;  1SNQ A;  2F0W A;  4KJO A;  5CV5 A;  2F0G A;  1AEX A;  3DHQ A;  4WOR A;  3TP7 A;  2F0E A;  3NQT A;  5IGB A;  5KIX A;  1SNC A;  2EYO A;  3EVQ A;  4K14 A;  3QOL A;  4MIU A;  4ZUI A;  5C4H A;  3BDL A;  4HTH A;  4NKL A;  1TR5 A;  4DGZ A;  5C3W A;  2F0P A;  2OEO A;  2PQE A;  3SXH A;  2F0I A;  5E1F A;  1EZ8 A;  4QF4 A;  4ZUJ A;  1JOQ A;  2F0F A;  4E6I A;  1RKN A;  2PW5 A;  3ERO A;  5EKK A;  5CV9 A;  2PZW A;  5EGT A;  3V2T A;  5IOC A;  2M00 A;  1A3U A;  1KAA A;  4HMJ A;  4ZQ3 A;  5DAU A;  3NHH A;  3U9O A;  1STA A;  4ME5 A;  5CC4 A;  5KEE A;  4IUN A;  2OXP A;  4EQO A;  2F3V A;  4K5W A;  3NUC A;  2EYM A;  3R3O A;  5HGT A;  3C1E A;  4K2L A;  4K5V A;  2EYP A;  3SHL A;  2RKS A;  5CGK A;  1SYD A;  2KQ3 A;  4QB4 A;  3MXP A;  3ITP A;  3T13 A;  4DF7 A;  3TP8 A;  3MVV A;  3OMG A;  4HMI A;  2F0L A;  5C6A A;  5E3F A;  3SK6 A;  1A3V A;  2EYF A;  4K5X A;  3SK4 A;  3SR1 A;  4K2K A;  1F2Y A;  5M9O A;  4J1M A;  4RKL A;  2F0N A;  3SK8 A;  1EY6 A;  1U9R A;  2EY6 A;  3QB3 A;  4B9X A;  1TT2 A;  1F2Z A;  3BDC A;  4PNY A;  3TME A;  1EY7 A;  3LX0 A;  4PMB A;  1F2M A;  1ENA A;  2F0J A;  3TP5 A;  5I6Y A;  1STB A;  4IAL A;  3OWF A;  2RDF A;  5CR3 A;  5IGF A;  4KHV A;  1JOR A;  1KDB A;  2LKV A;  3QOJ A;  4NDX A; 
#chains in the Genus database with same CATH topology
 3C46 A;  2E2H H;  1KL9 A;  3SEB A;  1TWA B;  2L12 A;  3I4M B;  1GVP A;  5JJL A;  1HZ9 A;  2UUA L;  1K8O A;  4GN3 B;  3HKZ E;  4KD4 A;  1K83 B;  1K3R A;  5M5W B;  5GQO A;  3HOW B;  1I4Q A;  4KD3 A;  4X6A H;  1STH A;  4OX9 Q;  3S15 B;  1W6J A;  5JOB A;  3E0E A;  3IFT A;  3S14 H;  4AQY Q;  3TN2 A;  4JI2 Q;  3I72 A;  2B63 H;  4HSP A;  4LUV A;  5FKA C;  3CCS A;  5LMN L;  2OQ0 A;  5EJW A;  1J6Q A;  1Y1V H;  4A3J G;  3K7A B;  1IKL A;  2PQA A;  1O80 A;  3N6R A;  4A3L H;  1BDO A;  1H9K A;  1QVG A;  3OOC A;  5FLX E;  2V1C C;  3BYT B;  3URY A;  2JA6 G;  5ISR A;  5IP7 H;  1CM9 A;  3RZD H;  1I6H H;  4DV4 Q;  1ML0 D;  5IGG A;  3KUP A;  3H6M A;  2H4O A;  2NVQ H;  2F3W A;  1C48 A;  1I3Q H;  2IX3 A;  1IBK L;  1CKO A;  2K75 A;  3BZD B;  4MTK A;  4JOI C;  5IP9 G;  1G8Z D;  3GTL B;  3NK9 A;  4FVM A;  4ZLT F;  4JOI A;  5LL6 S;  1FL0 A;  5M5X H;  2CW0 C;  1CTM A;  1AEX A;  4BY7 H;  3C2P A;  4HID A;  3EVQ A;  1BXT A;  3DWQ A;  3BDL A;  4DXG A;  1TR5 A;  1E1T A;  1E2V A;  2RCF A;  4B3T Q;  4IJL A;  4JI6 L;  1G29 1;  3HOW H;  3ULP A;  1WJJ A;  1EU4 A;  3QJY A;  1KAA A;  4GLA C;  2A6H C;  4A3B G;  3AFQ A;  3S15 H;  1TY2 A;  1FJG Q;  2DNE A;  2QDL A;  2QIL A;  3CCJ A;  4DR2 L;  3SHL A;  5AJ3 L;  1W6K A;  4QUC A;  4GNX A;  3FEW X;  3ND8 A;  4B3M L;  2XRS D;  1H9M A;  1IKM A;  1SJH D;  1JR0 D;  2CW0 D;  5HY6 A;  2WB1 G;  1MSG A;  2VB2 X;  4OO1 H;  1PH9 A;  3H91 A;  4TVA B;  1K73 C;  4Z9C B;  3MXN A;  3KLS X;  3PUY A;  2AUK A;  1ET6 A;  1JOR A;  1KXL A;  4DKA C;  1ENF A;  3QOJ A;  2A6H D;  5F2D A;  3PUW A;  1EOT A;  1MGS A;  3CME A;  4IOC A;  2VQF L;  4ZK9 B;  1O7L A;  3JAM L;  3RUZ A;  4N9T A;  2R93 G;  2EY5 A;  2YTV A;  1HFG A;  1WD1 A;  2SEB D;  4B08 A;  1SYE A;  2MPM A;  4CKC A;  4MHE A;  5LMU Q;  2VL6 A;  3KFU A;  4ZRZ A;  2DY7 A;  3EJI A;  4AYB G;  3A5U A;  2R61 A;  4KV6 A;  3MWY W;  1QZG A;  2PO4 A;  3HZX A;  1LTB D;  1EU3 A;  4A3C G;  4TRD A;  2Z0S A;  4DNT B;  4X66 Q;  4L5Q A;  3M3Y B;  2JA8 G;  1LT6 D;  1L0X B;  4JPB W;  4A3M B;  2F4V L;  1Z47 A;  1ONL A;  3DUZ A;  2MNA A;  3HEJ A;  4O1N A;  4YHH Q;  2DJG C;  1EIY B;  3JAM E;  2BE5 C;  4NXM L;  4L63 B;  5M3M G;  1Q1E A;  2PI2 A;  1S5F D;  2HQE A;  1NUC A;  1Q8I A;  1ZEQ X;  2L55 A;  2M9V A;  3NBH B;  2K14 A;  4CJ1 B;  4KN7 C;  2CKZ B;  1RDP D;  4DGZ A;  2XTI A;  3TRZ A;  5E1F A;  1LTG D;  2FHT A;  3VR5 A;  5C0X I;  2B2Y C;  4DAY B;  2BE5 D;  2B2Y A;  1RTO A;  2RKS A;  4QB4 A;  3OTO Q;  1CQF A;  2F0L A;  4YY3 Q;  4JI3 Q;  3SK4 A;  1WYD A;  3H0G B;  3HOY B;  4NXN Q;  4RKL A;  5IT9 L;  2HIX A;  3T1H Q;  3PO2 B;  1U9R A;  4P72 A;  3I8Z A;  2OCE A;  4GLV B;  1ILQ A;  2NVT B;  4A3M H;  4RHS A;  2GN5 A;  3TDQ A;  4B3S L;  3T56 B;  1NY4 A;  2UXD Q;  1F9S A;  4HED A;  2O5I C;  1VQJ A;  3GDE A;  1SE4 A;  5I2X A;  2JA5 B;  2JA6 H;  2I5M X;  2FFK B;  1VQO A;  1HR0 L;  3ZJY C;  4X65 L;  4C3H G;  5BN5 A;  4DV0 Q;  1JE4 A;  3GO5 A;  3EFX D;  3ERQ A;  4PZ7 A;  1JWS D;  2F0M A;  5FLM G;  2EVB A;  1CI3 M;  3CC4 A;  2F0V A;  3KLS A;  1OXV A;  1IYV A;  4HJA A;  2JJQ A;  5I6W A;  5IP9 H;  1OXT A;  3S2H H;  4YIJ A;  1PRT B;  1ASY A;  4QMG A;  5IT9 E;  2IHE A;  4JCV E;  3CRK C;  1F9Q A;  4A3K G;  2YTY A;  3GV3 A;  5GAD C;  5GAH C;  2E76 C;  2K05 A;  2O4X A;  1TU2 B;  4DPG A;  3A7L A;  4R4T A;  3A55 A;  1KAB A;  3KJO A;  4HIO A;  1VQK A;  2Q8T A;  3H3V C;  1EQV A;  2B2T C;  3PUX A;  4AQY L;  4OWT B;  1CA6 A;  3J81 L;  3BVG A;  2B2T A;  1VQ7 A;  1Y69 U;  4BA1 I;  3W3A A;  1SYC A;  2GA4 B;  2B8F A;  4FXG C;  3KLR A;  4KTA A;  5DEH A;  4L8J A;  3KF8 B;  1SNP A;  2F0W A;  2F0G A;  2PI2 E;  4BY1 G;  3S16 B;  3MC0 B;  2R6G A;  1FNW A;  2F1M A;  2K52 A;  1M1K C;  2F0P A;  1U4L A;  3I2Z A;  4APV A;  5GAE C;  5IY0 A;  2I5H A;  4GKJ Q;  3CCR A;  4DV4 L;  2AWN A;  4PZ8 A;  2R93 H;  4WJ3 M;  2F3V A;  4QIW E;  3NUC A;  3UDF A;  1X9N A;  2VY3 A;  1BR9 A;  2D0P A;  4UAI A;  2PMZ B;  5C4X G;  3W2D A;  4DR3 Q;  1MBY A;  3M4O H;  3S2D B;  1I50 B;  1TXY A;  3OMG A;  1IBL Q;  1B1Z A;  5EBD A;  2B2W C;  1TWH B;  1NNX A;  1EY6 A;  4PG3 A;  4DAP A;  4X64 Q;  2WII B;  2V4D A;  3U4V A;  4A3C H;  4RMF A;  5IYC G;  2L9H A;  1T5X D;  4JBJ A;  4B3T L;  1S72 A;  1AZP A;  5LHY 1;  4NDX A;  3MXU A;  1EQR A;  1FJG L;  3W1G A;  2RA4 A;  1CSQ A;  1HTL D;  4UY8 C;  1E2Z A;  1TII D;  4K8I A;  2XWB B;  4QQB X;  4A3I G;  2MO0 A;  2RQX A;  4M1U B;  1LT5 D;  1B3Q A;  2RCN A;  1N34 Q;  4HR7 B;  5M3F G;  1YIT A;  2Z1C A;  1EFI D;  1GJX A;  1Y8O B;  5M3M H;  1YNX A;  5IYB G;  1GXD C;  3MEH A;  5E4W C;  1EYC A;  4L5R C;  3TQY A;  1NSN S;  1PTO F;  1TWG H;  1N33 Q;  3MEF A;  4K6D A;  4KJN A;  1PH2 A;  2B29 A;  1C4Q A;  4C3I G;  1XMQ Q;  4DK3 C;  2SOB A;  1Y1W G;  3H3V H;  3SDZ A;  2Z8L A;  3UDI A;  2QCP X;  4GN4 B;  2EY2 A;  2C35 B;  1JJG A;  1PFN A;  3HOZ B;  1X65 A;  1X56 A;  2MJ8 A;  4G7O C;  1U4R A;  3TS0 A;  2KHS A;  3WOE A;  2VNU D;  3CPF A;  5DLQ E;  2PZT A;  3A8J E;  1NTG A;  5LMU L;  2ALY B;  1UE1 A;  3WDN A;  3W5O A;  1B53 A;  4A3D B;  1D5Z C;  2R7Z B;  3VR6 A;  1IBM Q;  2CH4 W;  2F0T A;  1HUM A;  3NXW A;  1GUW A;  1UE5 A;  1E24 A;  1QJO A;  4NPS A;  1EWI A;  1S4Z A;  1UUP A;  1HA6 A;  1DM0 B;  2ICI A;  4IPC A;  3PIO A;  1XPR A;  4JBM A;  3RZO B;  5ELE A;  3PV0 A;  3NWS A;  2NVX H;  4YHH L;  4YCV A;  1DOL A;  4KHZ A;  3ULJ A;  3V2T A;  1VF5 C;  3V96 A;  4C3H H;  1CFM A;  4U68 A;  1JB3 A;  3DXJ C;  2AHO B;  3K5M A;  4FP5 D;  3TP8 A;  3LWU A;  2Q8R E;  1EWC A;  2AQ2 B;  3IFD A;  4K2K A;  5IE8 A;  1GUS A;  1CHP D;  3A7A B;  2IX0 A;  5T1G A;  3R8B A;  1BCP B;  3R2T A;  3HOZ H;  4A3K H;  4MN3 A;  4G7Z C;  2L15 A;  1C9O A;  3T53 B;  4IAL A;  4YWK A;  1A62 A;  2KEE A;  1UAP A;  4OO1 I;  3PIO 3;  2N3S A;  1SXT A;  1D7Q A;  1EOV A;  3TP6 A;  1V1P B;  4RGO S;  1B7Y B;  4S3S A;  3I4N B;  3PO3 G;  3OTO L;  2KEN A;  2KJX A;  3CU7 A;  2HUG A;  4YY3 L;  3K80 C;  4JI3 L;  3BS1 A;  4NXN L;  3T1H L;  2LXK A;  1CHQ D;  2UUB Q;  4EGV A;  1L1O C;  4FDB A;  2OTL A;  5CV7 A;  4HAE A;  2JP1 A;  2NWG A;  5L37 A;  1L1O A;  5IYD G;  4CJ2 C;  3GTK H;  3DM1 A;  5GRO A;  1AH9 A;  2OT2 A;  3CPW A;  4BY1 H;  2UXD L;  2LMC B;  2D9U A;  1PLF A;  1WCM B;  3EA6 A;  3DEO A;  1D5M C;  1R4Q B;  1SRO A;  2EXD A;  4DV0 L;  1DON A;  1Q7Y C;  2CHB D;  1SYG A;  3L3O C;  3CCV A;  4BXX G;  4BBS B;  5FK9 C;  5C5M A;  3TZD A;  3HOV G;  1JJC B;  3A74 A;  5J39 A;  1C8C A;  4DV2 Q;  1KNA A;  3SGI A;  1PYS B;  1YJ9 A;  4NXM Q;  2QDB A;  5FOB B;  5K5P A;  2X6G A;  2EYH A;  3HKZ B;  2R92 B;  1LTT D;  4K0K Q;  2ICE C;  3RR5 A;  3J80 c;  3VR3 A;  3KBG A;  1BBW A;  4LWC A;  4XQN A;  2A69 C;  3GTQ H;  3EIV A;  2EXZ A;  4XXE A;  5IYC H;  4RGM A;  1AP0 A;  3GQB A;  3L0O A;  2AUJ D;  3TRE A;  1RKN A;  1O7I A;  2B8G A;  5EGT A;  2E2H B;  2RHS B;  4A3I H;  5CC4 A;  4R4O A;  1L0W A;  5M3F H;  4DUZ L;  1OXX K;  4RA8 A;  3T13 A;  2K32 A;  1K0R A;  3VA7 A;  3M9B A;  4R4C A;  4ZKC B;  2A69 D;  1XNQ Q;  1TS5 A;  1LAC A;  3S14 B;  4DV1 Q;  4HJ9 A;  4C3I H;  1D1K A;  3LX0 A;  1XPU A;  1E0B A;  1ENA A;  4FF1 A;  1Y1V B;  4CDE C;  2MFI A;  2N8N A;  4GKJ L;  4I7Z C;  4ABN A;  1U0L A;  4JBW A;  1TQO A;  2Z6K C;  3GV6 A;  1VQP A;  4CKE A;  2Z6K A;  3FKI G;  1YEZ A;  1H9S A;  2K5D A;  4DR3 L;  3RZD B;  1GUO A;  4HCE A;  1VQB A;  5J1Z A;  1HUN A;  5KNC A;  2JEA I;  2UXC Q;  4IUP A;  3RD4 A;  4RCO A;  2F0H A;  2WKD A;  3V05 A;  2NVQ B;  1I3Q B;  3G6E A;  2K03 A;  2TMP A;  1SN8 A;  2PZU A;  1SR3 A;  1X54 A;  1E2W A;  1I4R A;  1O78 A;  2A73 B;  3C1F A;  3J80 i;  2JA7 G;  5HUR A;  1IYJ B;  3KLW A;  3CP0 A;  2NN6 G;  5M5X B;  3M4Y A;  1YNN C;  3HKS A;  4BY7 B;  4OGQ C;  1FGB D;  3AFP A;  1MHW C;  4X62 Q;  3PIP A;  4KKS A;  4ZAI A;  1HQM C;  3MHB A;  1N34 L;  2NB0 A;  3KBX A;  2R7F A;  2Z9H A;  1BO0 A;  3RN2 A;  3TS2 A;  3CCL A;  1SBB B;  1TS3 A;  3K5N A;  4L6T B;  1SND A;  3D31 A;  2F0S A;  1N33 L;  4JK1 C;  4A3G G;  1CQV A;  1EUJ A;  1AE2 A;  1YJW A;  2HDM A;  1XMQ L;  2J7Z A;  1EYA A;  1PH1 A;  4KY5 A;  1JQY D;  2LXJ A;  4R8I A;  4C1N I;  1UEA B;  4LAA A;  3J7A F;  4FF2 A;  4KJO A;  1KHI A;  3F8T A;  5EPK A;  1Z6H A;  4XT1 B;  5C4H A;  3M85 A;  2B3G A;  4A93 G;  4A4I A;  3SXH A;  1HZC A;  3S24 A;  2AQ1 B;  2GVA A;  3J7A 5;  3I91 A;  1QUQ B;  1Q8K A;  4V19 0;  2NBF A;  1W2B A;  1YNJ C;  1XYI A;  4DK0 A;  2EIF A;  1XTC D;  4EQO A;  5FJ8 H;  2EOT A;  5IGF A;  1VQL A;  4H13 C;  1SYD A;  3I3C A;  3ITP A;  3PF4 A;  4HMI A;  1IBM L;  3SK6 A;  1JJ2 A;  4MTN A;  1F2Y A;  3PSI A;  1G51 A;  2BH8 A;  2YYZ A;  1KRT A;  3HOX G;  1ICF B;  1RTN A;  5IYD H;  3U58 A;  3I7F A;  1I94 Q;  4DAV A;  4B9X A;  4FNF A;  4JG2 A;  2Q8I B;  4P71 A;  2G9H D;  2RDF A;  3T4A C;  2FMC A;  1VQC A;  3NBI A;  2F3I A;  3D4R A;  2CQO A;  1YNJ D;  4ID6 A;  4DAM A;  4G4K A;  1QOH A;  3S1N B;  3F2U A;  4CJ0 B;  4GNX C;  2A6E C;  4A3F B;  1RF2 D;  4BXX H;  1K8G A;  2K01 A;  4GLX A;  2PCF B;  2I0Q A;  3WOF A;  1KD1 C;  4AIM A;  3X3N A;  2ID0 A;  4OIJ A;  1B8A A;  3I4O A;  4G57 A;  1VQF A;  1NAP A;  2E2D C;  3PCO B;  5NUC A;  4WRD A;  4ODG A;  3VYU A;  3NP8 A;  2I07 B;  1G2T A;  1LTR D;  2JA9 A;  4KI0 A;  1VQM A;  2K28 A;  2P5Z X;  4JW0 A;  4ZKB B;  5C3E G;  1GHK A;  5M5Y H;  2A6E D;  4FXD A;  1HHV A;  3NEL A;  1XNR Q;  5D3D A;  3W1B A;  4RFB A;  3H3V I;  4J6H A;  1F77 A;  1QE6 A;  1VQ5 A;  1V1Q A;  2N88 A;  1B9M A;  4BS9 A;  2UUB L;  1N8R C;  2NVY H;  5IGC A;  3S1M B;  2Y0S G;  3CRL C;  1Z9F A;  3D4W A;  1EIG A;  1Q46 A;  4RG1 A;  4QCL A;  4IUU A;  1IZ6 A;  1KTK A;  3QWN A;  4EQP A;  3E3X A;  3S1N H;  1FNV A;  4HCS A;  4A3F H;  1VQG A;  1VQA A;  2R3Z A;  3TEH B;  4XT3 B;  4HTH A;  3GTP H;  1DYQ A;  1JOQ A;  1BKB A;  1EQT A;  2VS1 A;  3AEV A;  1WTP A;  1A3U A;  2JA6 B;  4DV2 L;  3FKI H;  1AE3 A;  1VQH A;  4IUN A;  1SMY C;  4XTC S;  4K0K L;  2KQ3 A;  4DF7 A;  3ZYY X;  1HCZ A;  3G6J B;  1D2B A;  2EYF A;  1FVI A;  2NTS A;  3GTO H;  2N49 A;  1B70 B;  1VS0 A;  1ESF A;  1CT1 D;  5D65 A;  1RD9 D;  5KNB A;  3BVM A;  1HPC A;  2IT1 A;  3KDF B;  4RWS C;  2EY6 A;  2VUM G;  3S2H B;  2WIN B;  3HOU G;  2NN6 H;  1F2M A;  1TWC H;  2F0J A;  2WAQ G;  5G3L F;  4DK6 C;  4DAY A;  1V8Q A;  1GO3 E;  4KK7 A;  3J81 j;  3BYY B;  2BCO A;  1Q12 A;  2DJF C;  1STN A;  1Y8N B;  2L1B A;  2SNM A;  2IWH A;  3S1M H;  1HQR D;  2Z4I A;  1SMY D;  2B2V C;  1A8V A;  1CK1 A;  3I70 A;  5G3L D;  4A3B B;  4P75 A;  4A76 A;  2B2V A;  3NEM A;  3KF6 A;  5CMD A;  1HFN A;  1XNQ L;  4I7A A;  3I56 A;  3OWE B;  4QIW B;  1QB5 D;  4DR1 Q;  2IJ0 A;  4DV1 L;  4A3G H;  4A3J H;  4IZ8 A;  1ESR A;  5KND A;  1R9T H;  1ENC A;  1RJT A;  2WB1 B;  1STY A;  4F8M A;  2VXW A;  1HZB A;  2H1E A;  4A93 H;  1UNS A;  2K5H A;  4JV5 Q;  5J22 A;  4IPH A;  4K6L A;  3P7J A;  4K8J A;  4P74 A;  4UP8 A;  3AU7 A;  1G6Z A;  1HJP A;  1SMX A;  2KVM A;  5IIF A;  2UXC L;  3VYR A;  1MD2 D;  1YVC A;  2OQK A;  3R93 A;  2R93 B;  2FMM A;  3M4O B;  2M2L A;  4GKK Q;  4KLK A;  3HOX H;  3PGZ A;  4RKB A;  3VDY A;  4OL7 A;  1KDC A;  1LT3 D;  4AYB B;  3DWA A;  1QZH A;  4IUR A;  2PNR C;  5CV5 A;  3TP7 A;  3FVQ A;  1NJI C;  4X62 L;  4A3B H;  4ZUJ A;  3RN5 A;  1J5E L;  3UDX A;  4IQZ A;  3ERO A;  3LGJ A;  1D1I A;  5DAU A;  1X32 A;  4JYA Q;  1STA A;  4DUZ Q;  1EIH A;  3F2C A;  3FDT A;  3R3O A;  3TBI B;  4ALP A;  3QIA A;  3MXP A;  1PFM A;  1DJR D;  3KF8 A;  3H15 A;  5M3M B;  2K4K A;  3K5L A;  4MNO A;  2ZTE A;  4LF9 Q;  2JXM B;  1TWG B;  4LUZ A;  1TVX A;  4PNY A;  1A0I A;  3TME A;  3GD7 A;  1SFO H;  2ZJQ A;  1B3A A;  5I6Y A;  3CF5 A;  4JI7 L;  1RIP A;  5C3E H;  5CR3 A;  3I55 A;  3PUZ A;  1MJC A;  1NMF A;  1JIC A;  4JI1 Q;  2WFW A;  2F03 A;  4NMZ A;  5LMN W;  4PV1 C;  4KMU C;  2XSC A;  5JJK A;  5CV6 A;  1XTD A;  1EY8 A;  1V9P A;  3OIP A;  1DOM A;  2PNH A;  1PVO A;  2HQL A;  4DV3 Q;  4A3E G;  3BVZ A;  4N8X 1;  5CV4 A;  2QW7 A;  5JVG 3;  4R4I A;  1I94 L;  1PH3 A;  3J7Z C;  4DN4 M;  2HT1 A;  2BA1 A;  1YHA A;  3CD6 A;  1QIL A;  2Z6B A;  4QY7 A;  1HA5 A;  5KGU A;  4C3J G;  2JA8 H;  4EQN A;  2K5Q A;  4IPG A;  2EE1 A;  1YHQ A;  3E9H A;  1VQD A;  4QJF A;  4YWL A;  2KCM A;  1CA5 A;  4LFC Q;  1K3B C;  1PTO C;  1VQE A;  1R4P B;  1DD2 A;  3S1R H;  3PQI A;  3OSO A;  4EVO A;  4BBR G;  4R9W A;  4O2D A;  2Q2T A;  2NVX B;  1I4P A;  3A8K E;  5I9O A;  2EY1 A;  3OPO A;  4FF4 A;  4C3H B;  2EJF C;  2GVB A;  2Y0S E;  4L5S A;  1U4M A;  1PFB A;  4AH6 A;  3OYY A;  4IFD G;  2EQS A;  4UDU C;  1LAB A;  1JE5 A;  2F0D A;  4WJW A;  1G2S A;  1EFW A;  1VQ4 A;  2VUM H;  2QA4 A;  1E7Z A;  1K0S A;  5EBC A;  3HOU H;  1PTO D;  4P73 A;  4XYO A;  5IGB A;  1SNC A;  1PH7 A;  1LT4 D;  3QOL A;  4A3K B;  1XNR L;  4NKL A;  3JAM i;  1O7Z A;  3NPP A;  3HGB A;  2HDL A;  4Q0F A;  4UPA A;  4YCU A;  1XPO A;  4F88 A;  2IL8 A;  2UUC L;  3EQL C;  5IOC A;  2EZV A;  2RHQ B;  2JE6 I;  2DGY A;  5DM7 3;  5HGT A;  3J80 E;  1TS2 A;  1MSH A;  5IGD A;  2KCT A;  5EPJ A;  3S1Q H;  2RDH A;  2VZA A;  1EEF D;  1I4X A;  3QR8 A;  5BN3 A;  2BH2 A;  1A15 A;  1A63 A;  3HS0 C;  4DV5 Q;  4CDD C;  2WAQ E;  5A2Q L;  2A68 C;  1MKH A;  4DV7 Q;  2KCN A;  5C44 G;  3GTK B;  3TP5 A;  2AWO A;  1STB A;  1PZJ D;  4BY1 B;  4R4Q A;  4IJH A;  4ILW A;  1JCK B;  4GN5 A;  2K1B A;  1QVC A;  2MP1 A;  5FLM H;  1Q1B A;  5JPN C;  1II3 A;  2EYL A;  4H7B A;  3E6Z X;  4HIM A;  4LMQ D;  3A54 A;  3M7G A;  2LS0 1;  5C4X B;  3D8G A;  1CSP A;  1AN8 A;  2E2J B;  3CXC A;  5COY A;  5IWA Q;  2IX1 A;  1EY9 A;  3E5S A;  1EL0 A;  1PTO H;  3FHW A;  2X69 A;  1CZG A;  4IFD J;  2BA0 A;  1MI2 A;  3CCQ A;  1FNU A;  4IOA A;  5C5L A;  4DR5 Q;  5JVH 3;  1A2U A;  4JC0 A;  4X3K A;  3GTQ B;  3ERS X;  2B39 A;  1V1P A;  2B63 G;  5A2Q E;  2BOS A;  3AQQ A;  3M7N A;  2IPK D;  1WTX A;  3DMU A;  1SYF A;  4A3L G;  3J81 c;  3AB9 A;  4R8N A;  1GUN A;  5FO8 B;  4U67 3;  1K8M A;  5KRU A;  1L2F A;  1SE8 A;  3GTG H;  4A3I B;  1KRS A;  3NEN A;  4DR1 L;  1BVS A;  2FJ2 A;  2ZM6 Q;  5M3F B;  3ULL A;  1IYU A;  1Y14 B;  1VQI A;  3T1Y Q;  3OHX C;  4Y7N H;  2EJG C;  2ZJR A;  1JOO A;  2VB3 X;  1SNQ A;  3RLF A;  3DHQ A;  3D3R A;  4WOR A;  1FYC A;  3BDO A;  4XQQ A;  4JV5 L;  4C3I B;  1PYW D;  4MIU A;  4K14 A;  1KQS A;  2ES2 A;  1Y1W B;  2YU9 H;  1S40 A;  3CQZ B;  5C3W A;  3A0J A;  2PQE A;  1KC8 C;  3I4M G;  2K5W A;  5CV9 A;  1VQ9 A;  1A6X A;  1PH8 A;  5C4X H;  1VDZ A;  2NZO A;  4UP7 A;  3CC7 A;  2E2J H;  3NHH A;  4OWX B;  1L1O B;  1F9R A;  4G7H C;  4FF3 A;  3HOW G;  4FXK C;  1AFP A;  5CGK A;  1QWY A;  1FGU A;  3AMU A;  2JEB I;  4HIK A;  4A3E H;  4GKK L;  3MVV A;  3C3L A;  1HR0 W;  2MGS A;  2KUM A;  3Q8D A;  3F2B A;  2CFM A;  5H1S E;  3QB3 A;  2F52 A;  4C3J H;  1JWU D;  2Z4H A;  4RHR A;  1GUG A;  1KIX A;  3NWT A;  4GS3 A;  4XIG S;  1ZXT A;  5ELO A;  1YIJ A;  4A75 A;  1CZW A;  4JVZ A;  4JYA L;  2NN6 I;  2ASB A;  3G4S A;  1PV4 A;  1I4H A;  3J81 i;  3GTJ H;  3A5Z B;  4MZ9 A;  1QVF A;  5IYB H;  1SLJ A;  3E0J A;  4IFD H;  2KOL A;  4CBV A;  4LF9 L;  3OIQ A;  4C2M H;  3NE5 B;  4F7X A;  1A3T A;  1CKN A;  4C1N K;  4JI0 Q;  2WAC A;  5FO7 B;  1Y1W H;  3CQZ H;  3K7U C;  3NTI A;  1K28 A;  3NQI A;  2LSS A;  3L7Z C;  1VQ8 A;  3QO2 A;  4JI1 L;  1WTO A;  2RSN A;  1ICW A;  4KY6 A;  5BR8 Q;  2ZXO A;  4GOP C;  5D3I B;  1TY0 A;  4ZCK A;  2RBM A;  1EY5 A;  2E2I H;  3OW2 A;  1FR3 A;  1B9N A;  4IPD A;  4GOP A;  3DEP A;  4DV3 L;  3MFY A;  2DNC A;  3PO3 B;  3K0X A;  4RCN A;  4TQU S;  3D4D A;  1YBY A;  4NP5 A;  1S3O A;  2SNS A;  2VQE Q;  3VR4 A;  1WFQ A;  1I5F A;  2E8G A;  3S9W A;  1C7Y A;  1PXU A;  2HHH Q;  1H9S B;  3UE1 A;  1SE2 A;  4LFC L;  5KIX A;  1YI2 A;  1EWH A;  4CDF C;  2E5L Q;  2EYO A;  1WTQ A;  2IY5 B;  4HJ5 A;  3NSW A;  2OEO A;  1PH5 A;  2IHF A;  1J5E Q;  1NE3 A;  5A35 A;  5C4J H;  1UE6 A;  3H09 A;  4OHJ A;  4HJ7 A;  4X3U A;  1OXU A;  4XDX A;  1HNZ Q;  3P20 A;  2ZXP A;  2ZT9 C;  2Q2I A;  1GOZ A;  1GKH A;  1HZA A;  4K5W A;  4OWW B;  4LJZ C;  3HOV B;  4BWG B;  1LO5 D;  1UEB A;  4LNQ A;  4CKB A;  5C6A A;  1YNN D;  5M9O A;  4OEL B;  2X6L A;  4IUV A;  3S17 B;  3H94 A;  4KKU A;  1WTV A;  1F2Z A;  3VR2 A;  5EQ0 A;  1EY7 A;  1QUQ A;  4JI7 Q;  3PUV A;  1V1O A;  2DY8 A;  2XRQ D;  1X6O A;  1BNZ A;  4FYD A;  1BBX C;  3PIP 3;  3PO3 H;  5M5Y B;  2DUD A;  1HNW Q;  4A3M G;  2CH4 A;  3GTM H;  2OF1 A;  2PQA B;  4DR4 Q;  4KY7 A;  3VYS A;  3HRZ C;  5JJZ A;  3FPP A;  1XJV A;  1J8I A;  1TWF H;  1X3G A;  3LNN A;  1LV9 A;  3IRB A;  1S5C D;  4DV5 L;  2QEX A;  2NVY B;  2KEC A;  2NUC A;  3TSS A;  3QG1 A;  1NCV A;  4X3S A;  4UHV A;  4JI5 Q;  5DNF A;  4DV7 L;  3SE0 A;  1B2T A;  3MA2 B;  4LFA Q;  2UU9 Q;  4LK1 C;  1PYB A;  4J8Q A;  4HJ8 A;  3ONA B;  1ASZ A;  3GTP B;  1PH6 A;  2L4N A;  1LTI D;  4IUQ A;  1TWA H;  1Q3L A;  3HOV H;  3I4M H;  2F0U A;  1K83 H;  1TS4 A;  5M5W H;  4DV6 Q;  3RLN A;  5BN4 A;  3CAM A;  3FKI B;  1IXR A;  4POF A;  3K59 A;  3S17 H;  4OEM B;  5IWA L;  3BU2 A;  4DUY Q;  4CHT B;  2D2C C;  3H0G G;  3HOY G;  3PO2 G;  2DN8 A;  4DR6 Q;  1EZ6 A;  2O2L D;  1XXG A;  4EQ5 A;  2ZJP A;  4DR5 L;  1GUT A;  3GTO B;  3A8I E;  3DLL A;  1SEB D;  4RH6 A;  2HD3 A;  4KN4 C;  3K7A H;  4GNX B;  2JA7 B;  1AZQ A;  3NQT A;  1ILP A;  4V0B A;  4OXP A;  1X3F A;  1TWC B;  3U4Z A;  2JA5 G;  4QF4 A;  4LF4 Q;  3RLO A;  2UUC Q;  2CWA A;  2J4X A;  4JI4 Q;  3MXN B;  3Q6S A;  3G71 A;  1EEI D;  2QF7 A;  1WOC A;  3HG9 A;  4ME5 A;  2ZM6 L;  4K2L A;  4F87 A;  1QCB D;  3T1Y L;  5CBE E;  2I5L X;  1RCV D;  3E9I A;  1Y8P B;  1X3E A;  3L9A X;  3GTL H;  4A3G B;  4A3J B;  2ZTD A;  1R9T B;  3F1Z A;  1TT2 A;  2K33 A;  4HN7 A;  3HP3 A;  5J3B A;  2KHI A;  2NTT A;  5K36 G;  2HCC A;  1N32 Q;  1WI5 A;  1HTP A;  4A93 B;  1STE A;  3F2D A;  4XQJ A;  2ZXR A;  3M4P A;  2RF4 A;  2YV5 A;  2BDO A;  4POG A;  5FLX c;  3Q23 A;  3NBH A;  4B9W A;  1XX8 A;  3IL8 A;  3KDF A;  2D62 A;  1VF7 A;  2BDN A;  1A2T A;  2EPB A;  2UXB Q;  3I4L A;  4IN3 A;  5C3X A;  3CKI B;  3KJP A;  4P2C B;  2JA7 H;  4DU9 A;  1ET9 A;  4L5T A;  3MFG A;  3K58 A;  3FP9 A;  2OTJ A;  2I46 A;  3HOX B;  3K57 A;  3VA5 A;  2F0Q A;  4LF5 Q;  4KHP Q;  3BJU A;  1YZ6 A;  4LF7 Q;  3X3M A;  1HNX Q;  4OON A;  4WJ4 A;  5EPL A;  1YJN A;  2B2U C;  2ENB A;  3KYH C;  2G5D A;  1Q90 A;  3K5O A;  2K50 A;  2CQA A;  5I9P A;  2A8V A;  1K9M C;  1D6E C;  2B2U A;  3KK7 A;  1YHB A;  2A5H A;  1EY0 A;  1VMP A;  3J7A V;  3JC6 6;  1V43 A;  4DK1 A;  3MTS A;  1SNO A;  4TSS A;  2AMC B;  4JI0 L;  1SRU A;  2KHJ A;  1U4P A;  1PFS A;  1P8L A;  2RDG A;  3D0F A;  1EYD A;  5JEA G;  3OMC A;  2MO1 A;  5ELF A;  1STG A;  1Q86 C;  1PMR A;  3NTK A;  1BUV T;  3MXG A;  4JI8 Q;  1K8A C;  5BR8 L;  1VQN A;  3M3Y H;  1PH4 A;  3KF6 B;  3CMA A;  1SFO B;  3L2P A;  5C3E B;  1PRT C;  4E6I A;  2NZ1 D;  2M00 A;  1S5D D;  4FO2 A;  4ZQ3 A;  2JYO A;  1Z7T A;  2HIV A;  2G9D A;  2VQE L;  2EYM A;  1HXY D;  4RGN A;  1E1O A;  1PRT F;  2N55 A;  4R1J A;  3CCU A;  3CHB D;  4LF6 Q;  1ZYR C;  1G91 A;  1CKM A;  2Y0S B;  4RGT A;  2HHH L;  3EBE A;  4LF8 Q;  4LUO A;  3T51 B;  2E5L L;  5ELB A;  1LM0 A;  3TZU A;  1KLU D;  4Y52 H;  1G6P A;  2HCI A;  4DXF A;  1E22 A;  4PMB A;  2JA8 B;  1PRT D;  1H95 A;  5C0X G;  4UP9 A;  2WV6 D;  1I4G A;  3R2I A;  3HOZ G;  1HNZ L;  1WD0 A;  1BF4 A;  4H44 C;  1H9R A;  5KYI A;  1VQ6 A;  4ULL A;  3S1R B;  1IW7 C;  3HFZ B;  4NW2 A;  3FPU B;  1JB7 A;  3T16 A;  1IL8 A;  2AQ3 B;  4YWM A;  1JOK A;  3MZ5 A;  1GHJ A;  1ZYR D;  3DM3 A;  4X3T A;  1P16 A;  2RVL A;  1N36 Q;  3OW7 A;  1XMO Q;  3H0G H;  4A3D G;  3HOY H;  2R7D A;  2R7Z G;  4WFN 3;  4OX9 L;  3PO2 H;  2XGT A;  1SSO A;  3JAM c;  2MQH A;  1DGS A;  1DXM A;  4JI2 L;  2NVT H;  2Q2H A;  5TSS A;  3U50 C;  4IFD I;  1UWV A;  1OO9 B;  2VUM B;  4Q5V A;  5JEA J;  1IHZ A;  3HOU B;  1HNW L;  2D0O A;  1VCI A;  2WAQ B;  1IW7 D;  3GP7 A;  4B3R Q;  2JA5 H;  3SK5 A;  4DR4 L;  2L5T A;  5CBA E;  2PPB C;  3P1H A;  5IOD A;  3AYH B;  4O0A A;  2EYJ A;  1F9P A;  2K5N A;  1O7Y A;  4GZY C;  5JAV A;  1SYB A;  1HH2 P;  3BZK A;  5HGQ A;  2K6A A;  4JI5 L;  4DNI A;  3S1Q B;  2PW7 A;  3U9S A;  2MHV A;  2UU9 L;  2JQO A;  1QNK A;  3VYT A;  4LFA L;  1OTC A;  4DR7 Q;  4PZ6 A;  1E3P A;  2FXQ A;  4BA2 I;  2KA7 A;  2WB1 E;  1PZI D;  3CW2 C;  1IL2 A;  2F0E A;  3G7L A;  1WTW A;  5K36 H;  3J81 E;  1U5K A;  4LFB Q;  2KED A;  1DZ1 A;  2B2W A;  3IKJ A;  2JN4 A;  3J80 L;  4PMW A;  1JC7 A;  5C0X J;  2F0F A;  1NBW A;  2PW5 A;  4DV6 L;  3I4N G;  3STB C;  3J7Y W;  1LTL A;  3N52 A;  4QGU A;  1KLG D;  1OXS C;  1HRJ A;  4YCW A;  1D5X C;  1M4V A;  2XVS A;  3U9O A;  4DUY L;  2EYP A;  1W3S A;  2UUA Q;  3FRP B;  4DR6 L;  2RSO A;  1JWM D;  4TKO B;  2ATW A;  1QNU A;  1XWE A;  1FD7 D;  2WKC A;  1PTO B;  3DWP A;  2JSO A;  4AYB E;  3BG3 A;  1TKW B;  3BDC A;  3S16 H;  5LMN Q;  1WCM G;  3Q24 A;  2E74 C;  4LF4 L;  3OWF A;  3STB D;  1B44 D;  5IT9 c;  1KDB A;  2LFN A;  4JI4 L;  1PDQ A;  5EKL A;  5KYL A;  4BBS G;  2A19 A;  3PF5 A;  1GM5 A;  1D8L A;  3ER0 A;  4PMC A;  3A56 A;  3S2D H;  2JK8 A;  1I50 H;  1WTH A;  1CUK A;  1JMC A;  3HKZ G;  3GTG B;  2R92 G;  4ZYS A;  5ELD A;  3PMF A;  4DFA A;  1TWH H;  1H9J A;  1EQQ A;  1WVL A;  5CV8 A;  1IBK Q;  1EY4 A;  1MJE A;  5JEA H;  1SE3 A;  3RNU A;  2F0K A;  4Y7N B;  1N32 L;  4DNR B;  2CWP A;  4C56 C;  5I4D A;  4X66 L;  2YU9 B;  2CCZ A;  1BCP C;  3EN2 A;  1Q81 C;  2AKW B;  5D14 A;  2NZH A;  2PMZ E;  2EDG A;  4N9P A;  4JI6 Q;  3FMC A;  2F0O A;  3B6Y A;  1KAW A;  2UXB L;  4H0L C;  3SVM A;  1PHJ A;  1X55 A;  2A68 D;  1S5E D;  2PYK A;  4DR2 Q;  1KNE A;  4A3E B;  3K6O A;  5AJ3 Q;  5DM6 3;  1BCP F;  1NR2 A;  5E7N A;  2O5J C;  4LF5 L;  4KHP L;  2IW3 A;  2QGQ A;  4RAU C;  1LTS D;  2Q2U A;  3Q0A A;  3IAY A;  1AW7 A;  4LF7 L;  4B3M Q;  3CCE A;  3KOJ A;  3M4Q A;  1HNX L;  3NTH A;  2J0T D;  1GD7 A;  1Y1V G;  3CCM A;  4C3J B;  2TSS A;  5C0X H;  4ZUI A;  1BCP D;  2YTX A;  1LYL A;  2XN9 C;  3I90 A;  4DA2 A;  1EZ8 A;  2SDF A;  5EKK A;  1DCZ A;  2PZW A;  3WWV A;  5IP7 G;  4HMJ A;  4BBR B;  2K7V A;  4IO9 A;  2A74 C;  5KEE A;  2VW9 A;  1PA6 A;  3CC2 A;  5T1I A;  3GTJ B;  2VQF Q;  1B4O A;  2XWJ B;  2FIN B;  2N78 A;  2XNA C;  1B50 A;  1JT8 A;  1PZK D;  1VMC A;  4QUF A;  4A3D H;  2R7Z H;  5E3F A;  3SR1 A;  1A3V A;  4K5X A;  5FJ8 G;  4JI8 L;  1LUZ A;  4C2M B;  4H02 A;  1I6V C;  2H5X A;  1EIF A;  4CDC C;  2QKI C;  4BY7 G;  2C5C A;  2WP8 J;  5ELC A;  3G48 A;  3RZO H;  2EJM A;  2K04 A;  5JPM C;  4KHV A;  4CGY B;  5C4Z A;  2C9O A;  2L11 A;  2LY7 A;  4LW1 A;  5I2Y A;  1ZKO A;  1M8A A;  2L0C A;  2E2I B;  2F4V Q;  4IUT A;  2OWO A;  4LF6 L;  1RHP A;  1EYG A;  2KBN A;  2CVR A;  4I65 A;  4LF8 L;  2MUY A;  1F2L A;  1DOK A;  3Q22 A;  1S5B D;  5IGE A;  4OO1 G;  5EAY A;  3UDG A;  4PQX A;  3ICE A;  5ELN A;  4HSV A;  4BBR H;  4J15 A;  2D5D A;  5C44 B;  3BZC A;  1SNM A;  1KDA A;  1MIU A;  3I4N H;  5C4J B;  2K5V A;  1BBU A;  2XIW A;  2F4I A;  5FO9 B;  1N36 L;  1XMO L;  1SJE D;  1WTR A;  1T9H A;  3P75 A;  1T5E A;  2NYZ D;  1BQQ T;  1BOS A;  3LWE A;  5JJI A;  1NR4 A;  1L0Y B;  3MAQ A;  3D6C A;  2KCC A;  1LTA D;  4B3R L;  2ZTC A;  3UI2 A;  1QG7 A;  4N8F A;  5AFW A;  1WCM H;  2E75 C;  2B63 B;  5COR A;  5E4X A;  2F0I A;  3D6W A;  5CYU A;  4A3F G;  4B3S Q;  4BBS H;  1J9O A;  4XYQ A;  1CKN B;  1SDF A;  3I73 A;  3GTM B;  1M90 C;  2OXP A;  4ME3 A;  5LL6 X;  1HR0 Q;  3C1E A;  4K5V A;  1Q82 C;  4X65 Q;  4EX5 A;  1TWF B;  2R92 H;  4DR7 L;  4M8A A;  1I6H B;  1X3P A;  1UE7 A;  1X3Q A;  3ND9 A;  4KKT A;  1IBL L;  4J1M A;  2A1A A;  1NMG A;  5EKI A;  1ROD A;  4OIK A;  2F0N A;  3SK8 A;  1LLR D;  3K0Y A;  5C44 H;  4X64 L;  1C0A A;  3UE0 A;  4GOP B;  4LFB L;  3RMH A;  1RL2 A;  5GAG C;  1SAP A;  4NB3 A;  5FLX L;  3K81 C;  4O42 A;  4QL5 A;  1N9W A;  2LKV A;  3O13 A;  3K8A A;  2QEJ C;  4JBK A; 
#chains in the Genus database with same CATH homology
 3C46 A;  3SEB A;  1TWA B;  2L12 A;  3I4M B;  1K8O A;  4KD4 A;  1K83 B;  5M5W B;  3HOW B;  1I4Q A;  4KD3 A;  1STH A;  3S15 B;  1W6J A;  5JOB A;  3IFT A;  3TN2 A;  3I72 A;  4HSP A;  5FKA C;  5EJW A;  3K7A B;  1IKL A;  1O80 A;  3N6R A;  1BDO A;  1H9K A;  3OOC A;  5FLX E;  3BYT B;  3URY A;  5ISR A;  1CM9 A;  1ML0 D;  5IGG A;  3KUP A;  3H6M A;  2H4O A;  2F3W A;  1C48 A;  2IX3 A;  3BZD B;  1G8Z D;  3GTL B;  3NK9 A;  4FVM A;  4ZLT F;  5LL6 S;  2CW0 C;  1CTM A;  1AEX A;  3C2P A;  3EVQ A;  1BXT A;  3DWQ A;  3BDL A;  4DXG A;  1TR5 A;  1E2V A;  1G29 1;  1EU4 A;  3QJY A;  1KAA A;  2A6H C;  1TY2 A;  2DNE A;  2QIL A;  3SHL A;  1W6K A;  4QUC A;  3FEW X;  3ND8 A;  2XRS D;  1H9M A;  1IKM A;  1SJH D;  1JR0 D;  2CW0 D;  1MSG A;  2VB2 X;  4OO1 H;  3H91 A;  4Z9C B;  3MXN A;  3KLS X;  3PUY A;  2AUK A;  1ET6 A;  1JOR A;  1ENF A;  3QOJ A;  2A6H D;  5F2D A;  3PUW A;  1EOT A;  1MGS A;  4ZK9 B;  1O7L A;  3JAM L;  3RUZ A;  4N9T A;  2EY5 A;  1HFG A;  1WD1 A;  2SEB D;  4B08 A;  1SYE A;  2MPM A;  4CKC A;  4MHE A;  4ZRZ A;  2DY7 A;  3EJI A;  2R61 A;  4KV6 A;  3MWY W;  2PO4 A;  3HZX A;  1LTB D;  1EU3 A;  4TRD A;  4DNT B;  3M3Y B;  1LT6 D;  1L0X B;  4A3M B;  1Z47 A;  1ONL A;  3DUZ A;  3HEJ A;  4O1N A;  3JAM E;  2BE5 C;  4L63 B;  1Q1E A;  1S5F D;  2HQE A;  1NUC A;  1Q8I A;  1ZEQ X;  2L55 A;  2M9V A;  4CJ1 B;  4KN7 C;  4DGZ A;  1RDP D;  5E1F A;  1LTG D;  2FHT A;  3VR5 A;  5C0X I;  2B2Y C;  2BE5 D;  2B2Y A;  1RTO A;  2RKS A;  4QB4 A;  1CQF A;  2F0L A;  3SK4 A;  3H0G B;  3HOY B;  4RKL A;  5IT9 L;  3PO2 B;  1U9R A;  3I8Z A;  1ILQ A;  2NVT B;  4RHS A;  3TDQ A;  3T56 B;  1F9S A;  4HED A;  2O5I C;  1SE4 A;  5I2X A;  2JA5 B;  2FFK B;  4C3H G;  5BN5 A;  1JE4 A;  3GO5 A;  3EFX D;  3ERQ A;  1JWS D;  2F0M A;  2EVB A;  1CI3 M;  2F0V A;  3KLS A;  1OXV A;  1IYV A;  5I6W A;  1OXT A;  4YIJ A;  1PRT B;  4QMG A;  5IT9 E;  3CRK C;  1F9Q A;  3GV3 A;  2E76 C;  2K05 A;  2O4X A;  1TU2 B;  3A7L A;  3A55 A;  1KAB A;  3H3V C;  2Q8T A;  1EQV A;  2B2T C;  3PUX A;  1CA6 A;  3J81 L;  3BVG A;  2B2T A;  1Y69 U;  4BA1 I;  3W3A A;  1SYC A;  2GA4 B;  2B8F A;  4FXG C;  3KLR A;  4KTA A;  5DEH A;  4L8J A;  1SNP A;  2F0W A;  2F0G A;  3S16 B;  3MC0 B;  2R6G A;  1FNW A;  2F1M A;  2F0P A;  1U4L A;  2AWN A;  2F3V A;  3NUC A;  1BR9 A;  4UAI A;  2PMZ B;  3W2D A;  1MBY A;  3S2D B;  1I50 B;  3OMG A;  1B1Z A;  5EBD A;  2B2W C;  1TWH B;  1EY6 A;  4DAP A;  2WII B;  2V4D A;  2L9H A;  1T5X D;  1AZP A;  5LHY 1;  4NDX A;  3MXU A;  2RA4 A;  1HTL D;  1E2Z A;  1TII D;  4K8I A;  2XWB B;  2RQX A;  4M1U B;  1LT5 D;  4HR7 B;  2Z1C A;  1EFI D;  1GJX A;  1Y8O B;  1GXD C;  3MEH A;  5E4W C;  1EYC A;  1NSN S;  1PTO F;  4K6D A;  4KJN A;  1C4Q A;  4C3I G;  2SOB A;  3SDZ A;  2Z8L A;  2QCP X;  2EY2 A;  1PFN A;  3HOZ B;  2MJ8 A;  4G7O C;  1U4R A;  2KHS A;  3WOE A;  2VNU D;  2PZT A;  3A8J E;  3WDN A;  1B53 A;  4A3D B;  1D5Z C;  2R7Z B;  3VR6 A;  2F0T A;  1HUM A;  3NXW A;  1GUW A;  1QJO A;  1S4Z A;  1UUP A;  1HA6 A;  1DM0 B;  2ICI A;  3RZO B;  5ELE A;  3PV0 A;  3NWS A;  1DOL A;  4KHZ A;  3V2T A;  1VF5 C;  3V96 A;  1CFM A;  4U68 A;  1JB3 A;  3DXJ C;  3K5M A;  4FP5 D;  3TP8 A;  3LWU A;  2Q8R E;  1EWC A;  2AQ2 B;  3IFD A;  4K2K A;  1GUS A;  1CHP D;  3A7A B;  2IX0 A;  5T1G A;  3R8B A;  1BCP B;  3R2T A;  4MN3 A;  4G7Z C;  3T53 B;  4IAL A;  2KEE A;  1UAP A;  4OO1 I;  3PIO 3;  1SXT A;  3TP6 A;  1V1P B;  4RGO S;  4S3S A;  3I4N B;  2KJX A;  3CU7 A;  2HUG A;  3BS1 A;  1CHQ D;  4EGV A;  5CV7 A;  4HAE A;  2JP1 A;  2NWG A;  4CJ2 C;  3DM1 A;  2OT2 A;  2LMC B;  2D9U A;  1PLF A;  1WCM B;  3EA6 A;  3DEO A;  1D5M C;  1R4Q B;  1DON A;  2CHB D;  1SYG A;  3L3O C;  4BBS B;  5FK9 C;  5C5M A;  3TZD A;  5J39 A;  1C8C A;  1KNA A;  2QDB A;  5FOB B;  5K5P A;  2X6G A;  2EYH A;  3HKZ B;  2R92 B;  1LTT D;  2ICE C;  3VR3 A;  3KBG A;  4XQN A;  2A69 C;  2EXZ A;  4XXE A;  4RGM A;  1AP0 A;  3GQB A;  2AUJ D;  1RKN A;  2B8G A;  5EGT A;  2E2H B;  5CC4 A;  1OXX K;  4RA8 A;  3T13 A;  2K32 A;  3VA7 A;  4ZKC B;  2A69 D;  1TS5 A;  1LAC A;  3S14 B;  1D1K A;  3LX0 A;  1E0B A;  1ENA A;  4FF1 A;  1Y1V B;  4I7Z C;  4ABN A;  4JBW A;  1TQO A;  3GV6 A;  4CKE A;  1H9S A;  2K5D A;  3RZD B;  1GUO A;  4HCE A;  5J1Z A;  1HUN A;  5KNC A;  2JEA I;  4IUP A;  3RD4 A;  4RCO A;  2F0H A;  2WKD A;  3V05 A;  2NVQ B;  1I3Q B;  2K03 A;  2TMP A;  2PZU A;  1E2W A;  1I4R A;  1O78 A;  2A73 B;  3C1F A;  5HUR A;  2NN6 G;  5M5X B;  3M4Y A;  1YNN C;  4BY7 B;  4OGQ C;  1FGB D;  4KKS A;  4ZAI A;  1HQM C;  3MHB A;  2NB0 A;  3KBX A;  1BO0 A;  1SBB B;  1TS3 A;  3K5N A;  4L6T B;  1SND A;  3D31 A;  2F0S A;  4JK1 C;  1CQV A;  2HDM A;  2J7Z A;  1EYA A;  4KY5 A;  1JQY D;  4R8I A;  4C1N I;  1UEA B;  4LAA A;  3J7A F;  4FF2 A;  4KJO A;  5EPK A;  1Z6H A;  4XT1 B;  5C4H A;  3M85 A;  3SXH A;  2AQ1 B;  3I91 A;  4V19 0;  2NBF A;  1YNJ C;  1XYI A;  4DK0 A;  1XTC D;  4EQO A;  5IGF A;  2EOT A;  4H13 C;  1SYD A;  3I3C A;  3ITP A;  4HMI A;  3SK6 A;  1F2Y A;  2YYZ A;  1RTN A;  4DAV A;  4B9X A;  4FNF A;  2Q8I B;  2G9H D;  2RDF A;  3T4A C;  2FMC A;  3NBI A;  3D4R A;  1YNJ D;  4ID6 A;  4G4K A;  1QOH A;  3S1N B;  3F2U A;  4CJ0 B;  2A6E C;  4A3F B;  1RF2 D;  2K01 A;  2PCF B;  3WOF A;  3X3N A;  2ID0 A;  4OIJ A;  4G57 A;  1NAP A;  2E2D C;  5NUC A;  4WRD A;  4ODG A;  3VYU A;  3NP8 A;  2I07 B;  1G2T A;  1LTR D;  4KI0 A;  2K28 A;  4ZKB B;  1GHK A;  2A6E D;  4FXD A;  1HHV A;  5D3D A;  4RFB A;  4J6H A;  1F77 A;  1QE6 A;  2N88 A;  1B9M A;  4BS9 A;  5IGC A;  3S1M B;  3CRL C;  3D4W A;  1EIG A;  4QCL A;  4IUU A;  1KTK A;  3QWN A;  4EQP A;  1FNV A;  4HCS A;  2R3Z A;  4XT3 B;  4HTH A;  1DYQ A;  1JOQ A;  1EQT A;  1WTP A;  1A3U A;  2JA6 B;  4IUN A;  1SMY C;  4XTC S;  2KQ3 A;  4DF7 A;  3ZYY X;  1HCZ A;  3G6J B;  1D2B A;  2EYF A;  2NTS A;  1ESF A;  1CT1 D;  5D65 A;  1RD9 D;  5KNB A;  3BVM A;  1HPC A;  2IT1 A;  4RWS C;  2EY6 A;  3S2H B;  2WIN B;  2NN6 H;  1F2M A;  5G3L F;  2F0J A;  4DAY A;  1V8Q A;  4KK7 A;  3BYY B;  2BCO A;  1Q12 A;  1STN A;  1Y8N B;  2L1B A;  2SNM A;  2IWH A;  1HQR D;  2Z4I A;  1SMY D;  2B2V C;  1CK1 A;  3I70 A;  5G3L D;  4A3B B;  2B2V A;  5CMD A;  1HFN A;  3OWE B;  4QIW B;  1QB5 D;  2IJ0 A;  4IZ8 A;  5KND A;  1ESR A;  1ENC A;  1RJT A;  2WB1 B;  1STY A;  4F8M A;  2VXW A;  2H1E A;  1UNS A;  5J22 A;  4K6L A;  3P7J A;  4K8J A;  3AU7 A;  1G6Z A;  2KVM A;  5IIF A;  3VYR A;  1MD2 D;  3R93 A;  2R93 B;  2FMM A;  3M4O B;  2M2L A;  4RKB A;  4OL7 A;  1KDC A;  4AYB B;  1LT3 D;  3DWA A;  4IUR A;  2PNR C;  5CV5 A;  3TP7 A;  3FVQ A;  4ZUJ A;  4IQZ A;  3ERO A;  1D1I A;  5DAU A;  1X32 A;  1STA A;  1EIH A;  3FDT A;  3R3O A;  3TBI B;  3QIA A;  3MXP A;  1PFM A;  1DJR D;  3KF8 A;  5M3M B;  3K5L A;  2JXM B;  1TWG B;  1TVX A;  4PNY A;  3TME A;  3GD7 A;  1B3A A;  5I6Y A;  5CR3 A;  3PUZ A;  1JIC A;  2F03 A;  4NMZ A;  4PV1 C;  4KMU C;  2XSC A;  5CV6 A;  1EY8 A;  3OIP A;  1DOM A;  3BVZ A;  5CV4 A;  5JVG 3;  4DN4 M;  2BA1 A;  1QIL A;  1HA5 A;  5KGU A;  4C3J G;  4EQN A;  2K5Q A;  2EE1 A;  1CA5 A;  1PTO C;  1DD2 A;  1R4P B;  3OSO A;  4EVO A;  4R9W A;  2NVX B;  1I4P A;  3A8K E;  5I9O A;  2EY1 A;  3OPO A;  4FF4 A;  4C3H B;  2EJF C;  1U4M A;  1PFB A;  4IFD G;  4UDU C;  1LAB A;  2F0D A;  4WJW A;  1G2S A;  5EBC A;  1PTO D;  4XYO A;  5IGB A;  1SNC A;  1LT4 D;  3QOL A;  4A3K B;  4NKL A;  1O7Z A;  3NPP A;  3HGB A;  2HDL A;  4Q0F A;  4F88 A;  2IL8 A;  3EQL C;  5IOC A;  2EZV A;  2JE6 I;  5DM7 3;  5HGT A;  3J80 E;  1TS2 A;  5IGD A;  1MSH A;  5EPJ A;  2RDH A;  1EEF D;  1I4X A;  5BN3 A;  1A15 A;  3HS0 C;  5A2Q L;  2A68 C;  2KCN A;  3GTK B;  3TP5 A;  2AWO A;  1STB A;  1PZJ D;  4BY1 B;  4ILW A;  1JCK B;  2K1B A;  2MP1 A;  1Q1B A;  5JPN C;  1II3 A;  2EYL A;  4H7B A;  3E6Z X;  4LMQ D;  3A54 A;  3M7G A;  2LS0 1;  5C4X B;  3D8G A;  1AN8 A;  2E2J B;  5COY A;  2IX1 A;  1EY9 A;  3E5S A;  1EL0 A;  1PTO H;  2X69 A;  1CZG A;  4IFD J;  2BA0 A;  1MI2 A;  1FNU A;  5C5L A;  5JVH 3;  1A2U A;  3GTQ B;  4X3K A;  2B39 A;  1V1P A;  5A2Q E;  2BOS A;  3M7N A;  2IPK D;  1WTX A;  3DMU A;  1SYF A;  3AB9 A;  4R8N A;  1GUN A;  5FO8 B;  4U67 3;  1K8M A;  5KRU A;  4A3I B;  2FJ2 A;  5M3F B;  1IYU A;  3OHX C;  2EJG C;  1JOO A;  2VB3 X;  1SNQ A;  3RLF A;  3DHQ A;  3D3R A;  4WOR A;  1FYC A;  3BDO A;  4XQQ A;  4C3I B;  1PYW D;  4MIU A;  4K14 A;  1Y1W B;  3CQZ B;  5C3W A;  2PQE A;  2K5W A;  5CV9 A;  1A6X A;  1VDZ A;  3NHH A;  1F9R A;  4G7H C;  4FF3 A;  4FXK C;  1AFP A;  5CGK A;  1QWY A;  3AMU A;  2JEB I;  3MVV A;  3C3L A;  2MGS A;  2KUM A;  3QB3 A;  1JWU D;  2Z4H A;  4RHR A;  1GUG A;  3NWT A;  4XIG S;  1ZXT A;  1CZW A;  2NN6 I;  1I4H A;  3E0J A;  4IFD H;  2KOL A;  4CBV A;  3OIQ A;  3NE5 B;  4F7X A;  1A3T A;  4C1N K;  2WAC A;  5FO7 B;  3NTI A;  3NQI A;  3L7Z C;  3QO2 A;  1WTO A;  2RSN A;  1ICW A;  4KY6 A;  2ZXO A;  5D3I B;  1TY0 A;  2RBM A;  1EY5 A;  1FR3 A;  1B9N A;  3DEP A;  3MFY A;  2DNC A;  3PO3 B;  4RCN A;  4TQU S;  3D4D A;  4NP5 A;  2SNS A;  3VR4 A;  3S9W A;  1PXU A;  1H9S B;  1SE2 A;  5KIX A;  1EWH A;  2EYO A;  1WTQ A;  3NSW A;  2OEO A;  5A35 A;  4OHJ A;  3H09 A;  4X3U A;  1OXU A;  4XDX A;  3P20 A;  2ZXP A;  2ZT9 C;  1GOZ A;  4K5W A;  4LJZ C;  3HOV B;  4BWG B;  1LO5 D;  4CKB A;  5C6A A;  1YNN D;  5M9O A;  2X6L A;  4IUV A;  3S17 B;  3H94 A;  4KKU A;  1WTV A;  1F2Z A;  3VR2 A;  5EQ0 A;  1EY7 A;  3PUV A;  1V1O A;  2DY8 A;  2XRQ D;  1BNZ A;  4FYD A;  1BBX C;  3PIP 3;  5M5Y B;  2OF1 A;  4KY7 A;  3VYS A;  3HRZ C;  5JJZ A;  3FPP A;  1J8I A;  3LNN A;  1LV9 A;  1S5C D;  2NVY B;  2KEC A;  2NUC A;  3TSS A;  3QG1 A;  1NCV A;  4X3S A;  5DNF A;  3SE0 A;  1B2T A;  3MA2 B;  4LK1 C;  4J8Q A;  3ONA B;  3GTP B;  2L4N A;  1LTI D;  4IUQ A;  1Q3L A;  2F0U A;  1TS4 A;  5BN4 A;  3FKI B;  3K59 A;  4CHT B;  2D2C C;  2DN8 A;  1EZ6 A;  2O2L D;  1XXG A;  1GUT A;  3GTO B;  3A8I E;  1SEB D;  4RH6 A;  4KN4 C;  2JA7 B;  1AZQ A;  3NQT A;  1ILP A;  4V0B A;  1TWC B;  4QF4 A;  2J4X A;  3Q6S A;  1EEI D;  2QF7 A;  3HG9 A;  4ME5 A;  4K2L A;  4F87 A;  1QCB D;  5CBE E;  1RCV D;  1Y8P B;  3L9A X;  4A3G B;  4A3J B;  1R9T B;  1TT2 A;  2K33 A;  4HN7 A;  3HP3 A;  2NTT A;  5K36 G;  2HCC A;  1HTP A;  4A93 B;  1STE A;  4XQJ A;  2ZXR A;  2BDO A;  3Q23 A;  3NBH A;  4B9W A;  1XX8 A;  3IL8 A;  2D62 A;  1VF7 A;  2BDN A;  1A2T A;  2EPB A;  3I4L A;  4IN3 A;  5C3X A;  3CKI B;  4P2C B;  4DU9 A;  1ET9 A;  3MFG A;  3K58 A;  2I46 A;  3HOX B;  3K57 A;  3VA5 A;  2F0Q A;  3X3M A;  5EPL A;  2B2U C;  2ENB A;  1Q90 A;  3K5O A;  5I9P A;  2CQA A;  1D6E C;  2B2U A;  3KK7 A;  2A5H A;  1EY0 A;  1VMP A;  3J7A V;  1V43 A;  4DK1 A;  3MTS A;  1SNO A;  4TSS A;  1U4P A;  2RDG A;  1EYD A;  5JEA G;  3OMC A;  5ELF A;  1STG A;  1PMR A;  3NTK A;  1BUV T;  3MXG A;  1SFO B;  5C3E B;  1PRT C;  4E6I A;  2NZ1 D;  2M00 A;  1S5D D;  4FO2 A;  4ZQ3 A;  2JYO A;  1Z7T A;  2G9D A;  2EYM A;  1HXY D;  4RGN A;  1PRT F;  2N55 A;  1G91 A;  3CHB D;  1ZYR C;  2Y0S B;  4RGT A;  3T51 B;  5ELB A;  3TZU A;  1KLU D;  2HCI A;  4DXF A;  4PMB A;  2JA8 B;  1PRT D;  5C0X G;  2WV6 D;  1I4G A;  3R2I A;  1WD0 A;  1BF4 A;  4H44 C;  1H9R A;  5KYI A;  4ULL A;  3S1R B;  1IW7 C;  4NW2 A;  3FPU B;  3T16 A;  1IL8 A;  2AQ3 B;  1JOK A;  3MZ5 A;  1GHJ A;  1ZYR D;  4X3T A;  2RVL A;  3OW7 A;  4WFN 3;  1SSO A;  1DXM A;  5TSS A;  4IFD I;  1OO9 B;  2VUM B;  4Q5V A;  5JEA J;  1IHZ A;  3HOU B;  1VCI A;  2WAQ B;  1IW7 D;  3GP7 A;  3SK5 A;  2L5T A;  5CBA E;  2PPB C;  3P1H A;  5IOD A;  2EYJ A;  1F9P A;  4GZY C;  1O7Y A;  5JAV A;  1SYB A;  2K6A A;  3S1Q B;  2PW7 A;  3U9S A;  2MHV A;  1QNK A;  3VYT A;  4BA2 I;  2KA7 A;  1PZI D;  2F0E A;  3G7L A;  1WTW A;  5K36 H;  3J81 E;  2KED A;  1DZ1 A;  2B2W A;  3IKJ A;  3J80 L;  4PMW A;  1JC7 A;  5C0X J;  2F0F A;  2PW5 A;  3J7Y W;  3N52 A;  1KLG D;  1OXS C;  1HRJ A;  3U9O A;  1D5X C;  1M4V A;  2XVS A;  2EYP A;  3FRP B;  2RSO A;  1JWM D;  4TKO B;  1QNU A;  1XWE A;  1FD7 D;  2WKC A;  1PTO B;  3DWP A;  2JSO A;  3BG3 A;  1TKW B;  3BDC A;  3Q24 A;  2E74 C;  3OWF A;  1B44 D;  1KDB A;  2LFN A;  1PDQ A;  5EKL A;  5KYL A;  4PMC A;  3A56 A;  3GTG B;  4ZYS A;  5ELD A;  3PMF A;  4DFA A;  1H9J A;  1WVL A;  5CV8 A;  1EY4 A;  5JEA H;  1SE3 A;  2F0K A;  4Y7N B;  4DNR B;  4C56 C;  5I4D A;  2YU9 B;  1BCP C;  5D14 A;  2EDG A;  4N9P A;  3FMC A;  2F0O A;  4H0L C;  3SVM A;  2A68 D;  1S5E D;  2PYK A;  1KNE A;  4A3E B;  3K6O A;  5DM6 3;  1BCP F;  1NR2 A;  2O5J C;  2IW3 A;  4RAU C;  1LTS D;  3Q0A A;  3IAY A;  1AW7 A;  3NTH A;  2J0T D;  4C3J B;  2TSS A;  5C0X H;  4ZUI A;  1BCP D;  2XN9 C;  3I90 A;  4DA2 A;  1EZ8 A;  2SDF A;  5EKK A;  1DCZ A;  2PZW A;  4HMJ A;  4BBR B;  2K7V A;  2A74 C;  5KEE A;  5T1I A;  3GTJ B;  1B4O A;  2XWJ B;  2FIN B;  1B50 A;  2XNA C;  1PZK D;  1VMC A;  4QUF A;  5E3F A;  3SR1 A;  1A3V A;  4K5X A;  4C2M B;  1I6V C;  2QKI C;  2C5C A;  2WP8 J;  5ELC A;  2EJM A;  2K04 A;  5JPM C;  4KHV A;  4CGY B;  5C4Z A;  2C9O A;  2L11 A;  2LY7 A;  5I2Y A;  1ZKO A;  1M8A A;  2L0C A;  2E2I B;  4IUT A;  1RHP A;  2CVR A;  4I65 A;  2MUY A;  1F2L A;  1DOK A;  3Q22 A;  1S5B D;  5IGE A;  4OO1 G;  4PQX A;  4HSV A;  2D5D A;  5C44 B;  1SNM A;  1KDA A;  5C4J B;  2XIW A;  2F4I A;  5FO9 B;  1SJE D;  1WTR A;  3P75 A;  1T5E A;  2NYZ D;  1BQQ T;  1BOS A;  3LWE A;  1NR4 A;  1L0Y B;  3MAQ A;  3D6C A;  2KCC A;  1LTA D;  3UI2 A;  1QG7 A;  5AFW A;  2E75 C;  2B63 B;  5COR A;  5E4X A;  2F0I A;  3D6W A;  5CYU A;  1J9O A;  4XYQ A;  1SDF A;  3I73 A;  3GTM B;  2OXP A;  5LL6 X;  3C1E A;  4K5V A;  1TWF B;  4M8A A;  1I6H B;  1X3P A;  1X3Q A;  3ND9 A;  4KKT A;  4J1M A;  5EKI A;  1ROD A;  4OIK A;  2F0N A;  3SK8 A;  1LLR D;  3K0Y A;  3RMH A;  1SAP A;  5FLX L;  4O42 A;  2LKV A;  3O13 A;  2QEJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...