5IGBA

Crystal structure of staphylococcal nuclease variant delta+phs l36d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igbA00
1JOKA 4KJOA 4ZQ3A 2SNMA 1II3A 1KDBA 4NKLA 3D4DA 4K14A 1EY8A 4I65A 2F0MA 3NXWA 3QOJA 5F2DA 3D4WA 1ENCA 1TT2A 2PYKA 5IOCA 2EYPA 5ISRA 4K8IA 4KY5A 1STAA 2F0WA 4K6DA 3MHBA 2PW7A 2F3WA 1SNMA 2EY5A 1EYAA 4ZUJA 5NUCA 1EY5A 5IODA 1AEXA 1SYDA 1STBA 1JORA 5C3WA 2F0QA 1KAAA 1SYFA 2F0FA 3MEHA 5C5LA 3MXPA 4QMGA 4EQNA 1F2ZA 5CV5A 2NUCA 2SOBA 1EYDA 2F0GA 5EKLA 3EROA 4K5VA 3SK8A 5J22A 3SK6A 1SYGA 4E6IA 1SNCA 3HZXA 2OF1A 3HEJA 4DFAA 4QF4A 5KRUA 1U9RA 3EJIA 2F0VA 1STHA 3EVQA 5IIFA 1EY0A 1SNOA 2PZUA 3BDLA 4R8NA 5C4ZA 2O4XA 4KD3A 2EYFA 4F8MA 4EVOA 5J1ZA 5IGCA 3SK4A 3T13A 4J1MA 3R3OA 4KTAA 1TQOA 3P1HA 3SXHA 2EYOA 2OXPA 4IUNA 5C3XA 4HMJA 2LKVA 5I6WA 1A3UA 3P75A 5I9PA 3TP6A 2RDFA 1A3TA 3VA5A 4EQPA 5K5PA 3ITPA 1JOQA 3DHQA 3C1FA 2KHSA 3NHHA 3C1EA 3NQTA 3E5SA 1STGA 3T16A 2PZTA 4NP5A 3DMUA 5IGFA 4WRDA 1KDCA 2F0LA 3OMGA 4NDXA 5E1FA 4K2LA 3H6MA 2EY2A 4KV6A 1SYCA 2M00A 5I9OA 3V2TA 1EY6A 1A3VA 2F0KA 3OWFA 4YIJA 3D8GA 1EYCA 2EY1A 3NUCA 4HTHA 3OSOA 4TRDA 5CR3A 1STNA 5CC4A 5KGUA 5KYLA 1F2YA 5HGTA 4ME5A 2HQEA 4KJNA 5HURA 2EY6A 1F2MA 5C6AA 5C5MA 4K5XA 2SNSA 5EGTA 4J6HA 3TP8A 5EKKA 4N9TA 4DGZA 5CGKA 3QOLA 2ENBA 4ZUIA 4G57A 4KY7A 5KIXA 5CV6A 3BDCA 1JOOA 4IALA 4WORA 3TP7A 2F0SA 4ODGA 2RBMA 4K2KA 4KD4A 2F0IA 3LX0A 1SYBA 4OL7A 1ENAA 5JAVA 4HMIA 5KEEA 5KYIA 1KABA 2F0EA 5CV9A 5IGGA 2F0OA 2F0JA 3ERQA 4PMCA 3MZ5A 2F0UA 5DAUA 2F3VA 2EXZA 4NMZA 4S3SA 4B9XA 4DF7A 5M9OA 4RKLA 4B9WA 4K8JA 3OMCA 3NK9A 5CV4A 5J39A 2F0TA 2F0DA 2PW5A 1A2TA 3PMFA 3RUZA 4QB4A 5IGBA 4N9PA 3NP8A 4H7BA 5CV8A 4KHVA 4KY6A 2F0NA 5E3FA 3TP5A 1EZ8A 1NSNS 2QDBA 1EY9A 2RKSA 2EYJA 3U9OA 1EZ6A 2WACA 4PMBA 3TMEA 1TR5A 4ID6A 1KDAA 3QB3A 1EY7A 2EYMA 1STYA 2PZWA 5CV7A 5DEHA 5IGDA 4MIUA 1SYEA 2PQEA 1IHZA 1NUCA 4K5WA 1SNQA 2F0HA 2KQ3A 2EYLA 2OEOA 2F0PA 1RKNA 2EYHA 4LAAA 4RKBA 1EY4A 3D6CA 4F7XA 5C4HA 1EQVA 3SHLA 5I6YA 4IZ8A 5IGEA 4EQOA 3S9WA 1SNDA 4DU9A 3MVVA 1A2UA 1SNPA 3SK5A 5JOBA 3SR1A 4PNYA
chains in the Genus database with same CATH superfamily
2SNMA 1PYWD 4H44C 5F2DA 4IFDI 1CA6A 4A3EB 3KF8A 3U50C 1FJGL 4PG3A 4LUVA 1XNQQ 2WAQE 4A3KH 3GTGB 1TWGB 3M3YH 3OPOA 1KAAA 1UEBA 1F2ZA 1LV9A 2FMCA 2ZT9C 5CV5A 1NJIC 2NUCA 1W3SA 2K1BA 4B3MQ 3TS0A 2AQ1B 4EX5A 3A5UA 4L6TB 2ZTEA 1GUOA 3J81c 4ME3A 3CPWA 1VQEA 1O7YA 2Z0SA 2Y0SB 2B63G 1QB5D 1R4QB 3PO2H 3S14B 4P74A 4LF5L 4CBVA 1BCPC 3ND9A 1J9OA 3P1HA 3MAQA 4OIJA 1PXUA 3K80C 4WFN3 4C3IH 4X66Q 1B44D 3S24A 1KRTA 4EQPA 5K5PA 4TQUS 2Q2UA 4CDDC 2ZJPA 1STGA 4KKUA 2XRSD 4WRDA 4LNQA 2GA4B 3TREA 3CCVA 1LACA 2CWAA 2XTIA 2AQ2B 3A56A 1TWAB 3H91A 1XPUA 1N32Q 4HTHA 3OSOA 2O5IC 3S2DH 4KJNA 2NVTH 1A63A 3NBHB 4DV7L 1B2TA 1AZQA 1G2SA 3F2BA 4FF1A 2KEDA 5M5XB 1H9JA 4DPGA 1QVGA 1VCIA 4G57A 3PO2G 4HIKA 2LFNA 3K58A 3AMUA 4A3DB 1JOOA 2F0SA 5FKAC 5M3FB 2A6ED 1YJWA 1HRJA 1IL2A 3PIO3 3RNUA 1KABA 3M4OH 2F0JA 5DAUA 2EXDA 5IGCA 4DF7A 3E0EA 3EBEA 2PI2E 3HOWG 3CRKC 1L2FA 3I4LA 5C0XJ 4L5RC 2PW5A 3NP8A 5C0XG 2JQOA 3W2DA 1SMXA 3KLSX 1QNKA 3I4MG 5IP9G 3GTOB 4C3HB 4NXMQ 1Q86C 3ICEA 2ASBA 1SNQA 2R7FA 1RF2D 3H15A 4UP9A 4EQOA 1YEZA 1YNXA 2BE5C 5EBDA 1SNPA 1YNJD 4A3JB 4OWTB 4A3IG 4NXML 4N8FA 4P73A 3HOUH 4A93B 3NXWA 3I70A 1VDZA 3PCOB 1UE5A 2I5LX 4G7HC 3SE0A 4IUVA 1N33Q 3HGBA 2IL8A 3S1RH 2IX3A 2V4DA 4DR7Q 1ENFA 3HOUB 4A93H 2F0FA 4GOPB 4QMGA 3FKIH 2ZJQA 2I46A 1JC7A 1LT6D 4GNXA 1P8LA 1CM9A 5D65A 4JBMA 2PNRC 4QUFA 3CC7A 1ET9A 3CMEA 3GTOH 2EYFA 1YNJC 2DUDA 5J1ZA 1HR0L 2QA4A 3DWPA 4A3GB 2EYOA 4HMJA 2LKVA 5I6WA 1YBYA 1VQMA 3NE5B 3L9AX 2K01A 4HJ9A 3HKZE 1W6KA 1G91A 3Q22A 2J0TD 1J8IA 1XNRQ 5BR8L 2XWJB 2PZTA 4DK0A 3GTLH 3OMGA 1JWSD 4NDXA 4GKKL 3KF8B 2CKZB 3H6MA 2EY2A 5ELCA 3T53B 1L1OA 5I9OA 3H3VI 2L5TA 3M9BA 4YY3Q 1YJ9A 3PF4A 4GKJL 1CZWA 4DAPA 2NVTB 5EPKA 2KCNA 4NXNL 1A62A 1KLGD 1Y14B 2L12A 3CC4A 3GTMH 2BH8A 1NMGA 4JI2Q 1SDFA 1GVPA 3KF6A 4GKJQ 2PPBC 1VQLA 4A3DG 2K32A 1V43A 4UHVA 1VQDA 3ULJA 1QNUA 5G3LD 1LLRD 1TXYA 5M5WB 2M9VA 1FGBD 2XN9C 1IBKQ 1CKOA 3GTKH 3PUVA 3KJPA 2YTYA 3E9HA 4IN3A 2L0CA 4A3FH 1A0IA 3I4OA 3I56A 4OEMB 4X64L 1EZ6A 1X3GA 3TMEA 4ID6A 1QE6A 3BG3A 1KDAA 4MIUA 4DV6L 4C3JG 3NWSA 3MWYW 1VQBA 2HCIA 3T51B 1K8GA 4XIGS 4LF4Q 2R93G 4GLAC 2B2YA 4PNYA 2NN6G 1VMCA 4A3JG 1DGSA 4JK1C 4IPDA 5IOCA 3J80E 3N52A 5T1GA 2KHIA 4HIMA 3HOYB 2E8GA 3VR3A 3CCQA 2RSOA 3MHBA 4YCWA 3S2HH 1HTPA 3KK7A 1MI2A 2L15A 1B3AA 3I8ZA 1HA5A 4X3KA 1I4GA 4DV4Q 2UUCQ 3K5MA 1VQFA 1SNCA 3GTJB 4DFAA 5KRUA 3JAML 1STHA 1IW7D 4O1NA 3PUXA 5GQOA 2KOLA 3KDFA 2L9HA 2O4XA 3M4PA 4F8MA 4EVOA 3CXCA 4X65L 4GS3A 2N3SA 2WB1B 5IP9H 1QWYA 2MNAA 4V190 3J7AV 4AIMA 3L7ZC 2A68C 1E1OA 2MJ8A 5C3EB 3H0GG 4DAMA 1PMRA 1HZBA 1Y8NB 2A1AA 4BXXG 4QCLA 1B3QA 4UPAA 1T5EA 3HRZC 2VUMH 2ICEC 4TRDA 5CR3A 5KGUA 3K5LA 1IYVA 1GHKA 5HURA 4GOPA 3HKZB 2SNSA 3CQZB 1PH9A 4X6AH 5EGTA 2UXDQ 5ELFA 4A3MB 1FYCA 4O0AA 1JJCB 3OTOQ 4A3JH 4UY8C 2F0IA 3LX0A 3S17H 1A6XA 1WTXA 4OL7A 1ENAA 1WD0A 1GHJA 1TWFH 3D4RA 2F0EA 3GTQB 3J7A5 3MFGA 1PTOH 3SDZA 4TSSA 2QGQA 1IZ6A 1Y1VH 1U4LA 3S1MH 4DR5Q 3OMCA 2B63H 2F0DA 2E5LQ 2NVXH 4PMWA 4QB4A 1CSQA 4H7BA 3EFXD 4IJLA 1EY9A 1G6ZA 5EJWA 2R61A 2BE5D 1YI2A 4OO1I 5C4XB 4QQBX 1BNZA 1G51A 1FL0A 3AQQA 4JC0A 3MXGA 4KJOA 2XNAC 1JOKA 4ZQ3A 1EU4A 1KDBA 1TS3A 1WCMG 4DR4Q 1EFID 1F9SA 1TT2A 1V1PB 3GTQH 2E2JH 4K8IA 1TY0A 1STAA 1VQ6A 1PZKD 2Q2IA 3S2DB 3S16H 3T4AC 2ZTCA 1YIJA 2QEXA 3FEWX 1WJJA 4DR3L 2Q8RE 1K0SA 1TWAH 4K0KQ 4A3CH 2A6EC 2SOBA 2TSSA 2PO4A 1KRSA 2DJGC 2YU9H 4ZCKA 2O5JC 3M7NA 2K5WA 4IUTA 1JB7A 1IYUA 5EBCA 2K5QA 2TMPA 3K57A 3SXHA 1F9QA 1HUNA 4Y52H 3H09A 3UE1A 1PRTB 1N36Q 1KLUD 1G291 1NCVA 4DAYB 1CI3M 4X62L 1SXTA 3CCLA 5GAGC 4AYBG 3KFUA 2UXDL 4K2LA 2MPMA 5BN4A 4ILWA 3E6ZX 1D1KA 3NUCA 3HOZH 1K83H 5CC4A 3DM3A 1O80A 1FGUA 3D6WA 4ZRZA 4DUYQ 1CTMA 3MEFA 1MJCA 1Z7TA 1H9MA 1E24A 1DJRD 1AN8A 4L5SA 1H9KA 5CV6A 5D3DA 3M85A 3NELA 3KDFB 5JAVA 3I4MH 3URYA 4GLVB 1R9TH 2JA7B 2Z9HA 4PMCA 1KNAA 5M5YH 4XXEA 4JPBW 2MUYA 4F87A 2C5CA 3OW2A 3M4QA 5CV4A 2R6GA 3ZYYX 3VR4A 5CV8A 3TP5A 1YZ6A 1LTID 1DM0B 2HHHQ 5D3IB 5IT9E 3QB3A 1WD1A 4HEDA 1XYIA 2OEOA 2CVRA 1JJGA 5C4HA 1K8MA 1Z9FA 4IZ8A 4B3ML 4QUCA 1SNDA 4JI4Q 4C3JH 5C4XG 1A2UA 3SK5A 2VNUD 4ABNA 2NB0A 3PQIA 4LF6L 3HKZG 1RHPA 2VW9A 4DR3Q 1WTPA 4K0KL 1MSHA 3NWTA 1YVCA 1GUGA 1M4VA 3QR8A 2EYPA 4K6DA 2B2VA 2PW7A 3GV3A 1RL2A 2F3WA 3JAMc 4KN4C 2K04A 1IXRA 1AP0A 3VR2A 2DJFC 4P2CB 5C5LA 3RN2A 1UE6A 5IT9L 3V05A 3F2UA 3F2DA 1PFMA 2E2IH 5C4JB 3NENA 5IIFA 4HSVA 3PIOA 4X62Q 2HCCA 2BOSA 3FP9A 3TZUA 4QIWE 4J1MA 3C46A 1H95A 4JVZA 5IP7H 1EL0A 2RF4A 5CYUA 2WKCA 4I7ZC 2UXBQ 2NVYB 2VB3X 2UUBL 1U0LA 2XVSA 3AU7A 2BA1A 1GKHA 4IOCA 1CK1A 4JI6Q 3M4YA 4ZKBB 1QVFA 3H0GB 3NQTA 5JPMC 3C1EA 4A3GH 1I94Q 3P20A 1X3EA 4JI0Q 3AFPA 4JI7L 1ML0D 4IFDG 4Q5VA 3CKIB 1VQGA 4ME5A 4LF5Q 2ID0A 5C5MA 1JE4A 3S17B 1SE2A 4POFA 1DYQA 3A5ZB 4JI0L 3CF5A 1OXTA 3S2HB 4LFCL 4KY7A 4JOIA 4DN4M 3L0OA 3NEMA 3UDXA 4KHPL 2L11A 4K2KA 3RD4A 3BZKA 4TKOB 1WVLA 4IUQA 5KYIA 1SRUA 2VUMB 2EXZA 1KC8C 3RZOH 2NVQB 1EFWA 1HQRD 5J39A 4LFBQ 2UUAQ 4IUUA 4B3SL 2F0NA 3WOEA 2EYJA 2B2WA 1VQOA 2N8NA 4RGOS 1WTVA 4DNIA 1IYJB 2Z4HA 2PQEA 1NUCA 1G2TA 2RHSB 4Y7NB 3S1QH 2JA5G 1VF7A 1NE3A 4L5TA 4DU9A 3K81C 3H0GH 4NKLA 1VQNA 1ONLA 1EY8A 3BDOA 2D2CC 3JAME 1HR0Q 1B50A 3PUWA 4CJ1B 4DV7Q 4O42A 1LTGD 1HR0W 4BS9A 1V8QA 4YCUA 5C3WA 4DR6Q 4A3LG 1EIGA 2EDGA 1GXDC 1XNRL 2HT1A 3EROA 1E7ZA 2CWPA 2QW7A 3VA7A 2RCNA 2UUBQ 4QF4A 3K7AB 3RLOA 4FF3A 2A6HD 3RLFA 2WV6D 4C3HG 4POGA 1F2LA 3PO3B 1GO3E 1HNZL 1MGSA 1H9RA 4IUNA 2N78A 1PH7A 1G6PA 2R7ZG 1A3UA 3QO2A 1EYGA 4FVMA 1C7YA 1BOSA 2JK8A 4NP5A 3DMUA 1R4PB 4R4CA 1K8OA 2IX0A 2CW0D 2GVAA 2KVMA 4QJFA 3LWEA 1ZYRC 3H3VC 1Q81C 4H13C 3EIVA 1STNA 1N33L 2ZTDA 4KN7C 1BCPB 4FXKC 2B2UC 2HQEA 2IT1A 1WCMH 3OHXC 2V1CC 4JV5L 1OXVA 5CGKA 3H3VH 4A3MH 4ZUIA 3TSSA 1TWGH 1CKNB 3LNNA 1ASZA 4KD4A 4UP7A 3MXNB 1D5XC 3K0YA 1UE1A 4XT1B 5IWAQ 5IGGA 4DR2L 2Z6BA 4QL5A 3FMCA 3G6JB 1JMCA 2M2LA 1DOMA 4K8JA 4N8X1 2NZ1D 3K5NA 1WYDA 2A73B 2NZOA 5FJ8G 3BS1A 1I4HA 4AH6A 5CORA 4KHVA 1LT4D 3MC0B 4MN3A 5C0XI 5AJ3L 1S5BD 2EZVA 3CU7A 3MXUA 4JI2L 1H9SA 1LT3D 1Z6HA 2BDOA 2N55A 2K5DA 2K75A 4PZ7A 5AJ3Q 3J7AF 3PUYA 1VQHA 2EOTA 4J15A 2NVYH 1W6JA 1ZYRD 2PYKA 4RCOA 1PYSB 2C35B 1G8ZD 1K0RA 1MJEA 2OQKA 3AFQA 2D5DA 1CHPD 2YTXA 2QKIC 1GD7A 1SYDA 3GO5A 2JN4A 3BJUA 3C3LA 3HOVG 1SYFA 4AYBE 2JE6I 2CH4A 2F0GA 5LHY1 4XQNA 2E75C 3PIP3 1SE3A 2ZM6L 4JG2A 2B29A 1Q8KA 2AUKA 2WB1E 2YTVA 4YHHL 2PZUA 1FD7D 3BDLA 2E74C 5E7NA 4FF2A 4R4TA 3PO3G 3JC66 2A5HA 3CD6A 4YHHQ 4V0BA 2RDFA 2JA8B 3DUZA 3CCJA 4BXXH 3T16A 1K73C 5GADC 1C48A 1OXUA 3GTKB 1S4ZA 2AUJD 4LWCA 5C4XH 1RCVD 4IPHA 1PFNA 5JJKA 2K5NA 1HZCA 4PZ6A 5M5WH 1A3VA 1FNVA 1PTOD 3OWFA 4YIJA 1K9MC 3R93A 4A76A 4ALPA 3K6OA 5KYLA 5ELEA 2K5VA 1QZGA 1I4XA 4JI3Q 3IFDA 4IFDJ 1HNXL 1TKWB 1PZID 2ENBA 3A8KE 5M5XH 5IYBH 1DXMA 1SJHD 1P16A 2HIVA 5JEAG 4HIOA 2KEEA 3HOXG 1VQ4A 4HMIA 2ZXPA 3PF5A 2J7ZA 2B2TC 5E4WC 4GN5A 3FPPA 3VYUA 1EUJA 2VY3A 2FINB 5L37A 3EA6A 4BWGB 2LY7A 2UU9L 1QUQA 2Z6KC 3HOZB 1B4OA 3I72A 1AFPA 5LMNW 2YV5A 2EYMA 1XPRA 4HJ5A 2IHFA 2GN5A 3NBHA 2EYLA 1C0AA 2JA5B 4C3IB 4LF7L 3SHLA 3NTKA 2OQ0A 4CJ2C 3K0XA 1VQ5A 2E2DC 4DV3L 3SR1A 3T1YQ 1RDPD 4OXPA 1HQMC 3E0JA 3D4WA 4AYBB 3CW2C 1Q12A 3BYTB 1KL9A 1ILQA 2XWBB 1PRTC 2EE1A 4JCVE 1JORA 2E2HH 1T5XD 4EQNA 1SJED 1SMYD 3M7GA 2SEBD 1KQSA 1SROA 4K5VA 4KKSA 2OF1A 1U9RA 3PSIA 3KUPA 3LGJA 1KXLA 1RODA 3HS0C 4KD3A 3UE0A 1C9OA 4BY7G 5DM63 1I4QA 4XT3B 1TQOA 1H9SB 3U58A 1LTBD 4Z9CB 5E4XA 4X3SA 3VA5A 3DHQA 4PZ8A 5IE8A 1I50B 5IYDH 1KDCA 5LL6S 4G4KA 5K36G 2QCPX 1ZXTA 1WTHA 2F0KA 4LJZC 4JI1L 1O7IA 2IHEA 1BQQT 2EY6A 2FMMA 5ELNA 1CQFA 3HOVH 2JA5H 3GQBA 1XMOQ 2IY5B 4FXGC 3I55A 5CMDA 5JPNC 1NAPA 1LM0A 4ODGA 3STBC 4JI4L 4A3CG 3OOCA 1IKLA 4BBRH 5KEEA 3EQLC 1ZEQX 3MZ5A 1HFGA 3T1HL 4FYDA 4IURA 5FO9B 2VXWA 2F4IA 3S16B 2DY8A 4LFAQ 4DUYL 3J81j 5IGBA 1V9PA 3I4NG 1KNEA 3J80L 4CGYB 1EZ8A 4JBWA 2E2JB 4P71A 3T1YL 2IX1A 4GLXA 2WACA 5FO7B 2B8FA 4UP8A 3T1HQ 5DEHA 2K05A 4XQJA 1X56A 4LAAA 3NPPA 3KLSA 4AQYL 1EQVA 1JICA 4C3JB 1PLFA 4MTKA 1JQYD 5FLXL 5JOBA 4OWWB 5LMUQ 1Q7YC 2MO0A 5KNBA 5FJ8H 4EQ5A 3Q24A 1VQPA 3V96A 3HOYG 1PDQA 2MQHA 1AEXA 3PGZA 4B08A 2QF7A 1STEA 5LMUL 1GUSA 3BU2A 2EJFC 4R8IA 4IFDH 2JA7H 2G5DA 4R4OA 4XTCS 5EKLA 2LSSA 4XQQA 5LMNQ 2PQAB 4XYQA 1U4RA 2PNHA 2F0VA 4LMQD 1XJVA 3HOZG 2AMCB 4P75A 1ZKOA 3FKIG 3T13A 1PH5A 3CRLC 1I6HB 2WB1G 1M1KC 1Y8OB 3OIQA 2OCEA 1HH2P 2E2HB 3TP6A 2AQ3B 1O78A 4L8JA 3J7YW 4CKEA 1DOLA 3QWNA 4X66L 1PH6A 3I4NH 1EEID 2I5HA 2GVBA 1HJPA 3GP7A 3CCEA 1EQQA 1N8RC 1X3QA 2ICIA 2K4KA 1YNNC 2A19A 4R4IA 2Q2TA 2F52A 1F2MA 1SEBD 2Q2HA 2JEAI 2NN6I 2XGTA 3CHBD 2LXJA 2L1BA 1V1OA 2JA9A 1HZ9A 5KIXA 4YY3L 2VQFL 4LF8L 2JA6G 5EPJA 4NPSA 2RBMA 2YU9B 3ULLA 2O2LD 4DR1L 1SAPA 3GTMB 4YCVA 2JXMB 3S15B 4G7OC 2ATWA 1U4PA 1D1IA 2EIFA 1SFOH 3QJYA 1N34Q 3VR5A 1SFOB 2BH2A 1HUMA 2WP8J 3BZCA 2PCFB 3FHWA 2K14A 1K8AC 2CQOA 3O13A 4F88A 5IYBG 4RKBA 2KQ3A 3L2PA 2EVBA 1HTLD 3A7LA 1YJNA 4MHEA 5ELBA 2H5XA 1HHVA 1I94L 1D6EC 5EKIA 4DA2A 1ESFA 2F0MA 4DV6Q 4XDXA 1GUTA 3IKJA 5ELOA 2BDNA 5ISRA 2EJGC 2NYZD 2F0WA 1BR9A 5C44B 4HCSA 3ND8A 4B3SQ 1UWVA 3D3RA 4MZ9A 5IODA 3S1MB 1I4PA 3F1ZA 2I0QA 2MO1A 1BKBA 2QILA 1EIFA 3PO3H 5KNCA 5GAHC 3HZXA 2XRQD 4KHZA 1QCBD 2H4OA 2N88A 1EY0A 4IO9A 3KOJA 1ESRA 4LFBL 1QOHA 1X65A 2UUAL 1Y69U 2WKDA 5C3XA 2OXPA 3OWEB 3RLNA 1TVXA 4DV2Q 3KBGA 2NWGA 2Z1CA 4X3UA 1E2VA 4CDEC 1J6QA 3C1FA 1NR4A 1LTLA 2K28A 4KV6A 3R2IA 2CQAA 2M00A 1Y1WB 4YWMA 2RCFA 4RHRA 1DZ1A 3AEVA 4R4QA 4C3HH 2AWNA 1SE4A 5HGQA 1F2YA 2VS1A 4HR7B 4C1NK 4JYAQ 3CCRA 1HNZQ 4A3MG 4XYOA 5EKKA 4HJ8A 3KLWA 3S1NH 4H02A 1KIXA 1RTNA 4KLKA 3BDCA 1SBBB 1PZJD 1B9MA 1SYBA 3E3XA 4ZAIA 1LYLA 3FKIB 1S5FD 3Q6SA 2F3VA 2NVQH 1CZGA 2DGYA 2BCOA 1C4QA 3OTOL 3TQYA 1K28A 2F0TA 1GUNA 1SMYC 5D14A 1PV4A 5E3FA 4OX9Q 4R1JA 1QILA 1YHQA 5CV7A 1STYA 1XTDA 3VYSA 1M90C 1JCKB 2HQLA 4LF9L 2EYHA 3GTPH 3A54A 2NN6H 5IGEA 4DXGA 1JB3A 3S9WA 4X64Q 4DUZQ 1QG7A 2WIIB 3S1NB 4H0LC 4WJ4A 5K36H 1UE7A 3D4DA 1NBWA 3HOXH 1EIYB 3KLRA 3QIAA 4DV4L 5C44H 2UUCL 2R7ZH 1B9NA 1WTWA 2AWOA 2B2TA 2ALYB 1SNMA 2EY5A 1EYAA 2F4VQ 1RTOA 4BY1B 1HFNA 3MEHA 1Y1WH 3HOUG 3M4OB 4CDFC 3SK8A 1QZHA 5M3MG 4P72A 1Y1VG 4FDBA 1A15A 2RQXA 5M3FH 4BBSH 2Y0SG 3HEJA 2B63B 4A3DH 1YITA 1Q46A 4KI0A 3W1GA 2R92G 2A68D 5M5YB 5J3BA 5C4ZA 1XTCD 1I3QH 3UDGA 3DXJC 1ICWA 2A8VA 1KHIA 5A35A 4BBRG 1KD1C 2PMZE 5DLQE 1JWMD 2CCZA 2KHSA 1I6VC 3NQIA 4NXNQ 1GUWA 4U673 3K8AA 2CH4W 1MD2D 2SDFA 1VQ8A 2IWHA 1D2BA 1Y1WG 3LWUA 4QGUA 1MSGA 4CHTB 2UXCL 4MNOA 4K5XA 4X3TA 4DNTB 4J6HA 2VZAA 2JP1A 1TWCH 3PO2B 1PRTD 4N9TA 2D0OA 1IBKL 3MTSA 3TP7A 4IALA 2J4XA 4C56C 1LTRD 2L4NA 2JA7G 2ZM6Q 4DV3Q 2RA4A 2F3IA 2B3GA 3HOWB 3RZOB 1CSPA 4NMZA 1OXSC 4S3SA 1EWCA 2VUMG 1E22A 4RG1A 4LF9Q 1BDOA 1VQAA 1PVOA 3OIPA 4FF4A 3GTGH 5IT9c 2KUMA 3FPUB 3I4MB 4N9PA 2XSCA 4A75A 2KENA 3NSWA 4L5QA 3U9OA 1IL8A 1PH3A 5IYCH 3S15H 3R2TA 1JT8A 5IP7G 1IHZA 3FVQA 4IQZA 2G9HD 1EY4A 3A74A 4GN4B 4J8QA 1BCPF 3A0JA 2HDMA 3HOYH 4A3IB 1V1QA 1FNUA 1K83B 2F4VL 2P5ZX 2DNCA 3WDNA 3AB9A 4HJ7A 4A3BH 3GD7A 2HIXA 1RD9D 3G4SA 1OXXK 1U4MA 4GN3B 1CUKA 3IFTA 4GNXB 1PA6A 1MKHA 2OTJA 3G48A 1MHWC 4LF7Q 1TWHH 1ICFB 5BN5A 4DKAC 1J5EL 1L0XB 4DV5Q 1Y1VB 2KCTA 1Y8PB 2B2UA 1SNOA 2BA0A 3CAMA 1WTRA 2E2IB 1PH2A 3KF6B 2JEBI 4DV5L 4O2DA 3P75A 1PH4A 1PTOC 5I9PA 1JOQA 5IYDG 4M1UB 3ITPA 3I90A 4LK1C 4BBRB 2IPKD 2AHOB 2I07B 1S72A 5IGFA 1L1OB 5E1FA 5G3LF 4YWKA 1D5MC 1B7YB 1Z47A 1SYCA 5FLMG 4DNRB 3H94A 3UI2A 1EY6A 2PI2A 4RAUC 1HA6A 4YWLA 2PMZB 1X9NA 3IAYA 3FDTA 4RH6A 4BY1G 5HGTA 4BBSB 5C6AA 1NY4A 4APVA 5HY6A 1E2WA 1X54A 2C9OA 2ZXRA 1BUVT 1VQJA 4A3EG 1XMQQ 5FOBB 2RVLA 4IUPA 4JI7Q 4AQYQ 5GAEC 1EIHA 2R92B 4JI8L 1ASYA 2D0PA 2F1MA 4B3RL 2HD3A 3MXNA 4C2MH 4RWSC 2F03A 2XIWA 3OYYA 3GTJH 3T56B 3RUZA 2VQEL 1S5DD 1HPCA 4JI8Q 1GOZA 1ILPA 4KY6A 2RSNA 1S5CD 2QDBA 4A3KG 4U68A 4DK6C 2IJ0A 5C3EG 2A69D 1TR5A 1GJXA 3F2CA 1Q3LA 1BBWA 3SVMA 3A8IE 2F0PA 3BVGA 1VQ7A 1PH8A 1SR3A 2HDLA 1WOCA 2G9DA 5LMNL 1EU3A 1QJOA 1HNWQ 2B2WC 1HXYD 1NTGA 4FO2A 1WCMB 1FVIA 1MBYA 1WI5A 1YNND 1OTCA 3IL8A 3RN5A 3BYYB 1JJ2A 4ZUJA 5NUCA 1EOTA 1EY5A 1XMOL 1XPOA 2Q8IB 4OIKA 2K52A 4JW0A 4IPCA 3EN2A 5EQ0A 2DY7A 3NBIA 3VYRA 5M3MB 4JI5Q 4JOIC 1PFBA 4A3FB 1ET6A 2N49A 2K33A 4QY7A 2MHVA 1S3OA 3SGIA 4DR1Q 4A3BB 2UXBL 1LTAD 1N36L 1N9WA 5M3FG 3W1BA 4JI5L 3SK4A 3K59A 2KBNA 1N34L 3R3OA 5JJIA 4NW2A 2I5MX 4ZYSA 1KTKA 5JJZA 3MFYA 3K5OA 2A69C 4IPGA 1A3TA 3G71A 1PHJA 3E5SA 1TS4A 4DV1L 2R3ZA 1VQ9A 1RJTA 5IY0A 1XMQL 4JI6L 4HJAA 3D8GA 4M8AA 4LFCQ 3HOWH 3BVMA 3I73A 1NNXA 2X6LA 1EOVA 3OW7A 3GTLB 4DV1Q 5EPLA 4BBSG 2K5HA 4A93G 2KA7A 1TIID 3Q0AA 1CQVA 3JAMi 4DR7L 3ONAB 4DK1A 4HIDA 3ZJYC 3PUZA 4G7ZC 1UAPA 1TS5A 1WTOA 2NVXB 5JVG3 1TU2B 2D62A 2RDGA 3CCSA 2JA8H 3S14H 2HHHL 3HOXB 2DNEA 4R9WA 2CHBD 3ERQA 2B2VC 2K50A 1PYBA 2NTTA 3HG9A 1UUPA 3TEHB 4B9WA 2KCCA 2CW0C 3DLLA 3STBD 3WOFA 1BF4A 4OELB 1DCZA 1TY2A 1EY7A 1PRTF 3DWAA 2Y0SE 3CQZH 1C8CA 1VS0A 5BR8Q 3HFZB 1Q90A 4MTNA 3HKSA 2IW3A 2B39A 4K14A 4QIWB 1VMPA 4HAEA 3D31A 5GROA 1CT1D 1E2ZA 3DWQA 3U4VA 1EWIA 1UEAB 3CCMA 4A3LH 3J81i 1F9RA 2FXQA 4OHJA 2WAQB 1CA5A 1GM5A 3FRPB 2D9UA 3HP3A 3PV0A 1MIUA 2F0QA 5LL6X 1E1TA 1VQKA 1I5FA 3J81E 1QUQB 1D5ZC 4DXFA 3SK6A 4JBJA 2VB2X 2A74C 1SYGA 3BVZA 1FR3A 1JE5A 2EQSA 3EJIA 4OO1H 4ZKCB 4A3BG 3RZDB 2K6AA 3P7JA 4LW1A 1NR2A 3UDIA 1XWEA 4HSPA 3A7AB 4HCEA 4OX9L 1B53A 3GTPB 2Q8TA 1EEFD 2A6HC 2JA8G 2JA6H 3N6RA 4A4IA 2LS01 4BA2I 1AE2A 4IOAA 5TSSA 1OO9B 1RIPA 1VQCA 4ULLA 2YYZA 3DEOA 1DD2A 2B8GA 5JEAJ 4FP5D 5C44G 3V2TA 4C3IG 1VQIA 1A8VA 1HCZA 1BBUA 1EYCA 2EY1A 5AFWA 2K03A 2R93B 4KHPQ 4C1NI 1AE3A 1E0BA 1UNSA 3TZDA 3B6YA 1PFSA 4RGMA 4A3FG 2Z6KA 1X6OA 1YHAA 4KKTA 1TWCB 4WJWA 2OT2A 4HN7A 3WWVA 3ULPA 3NTHA 5EAYA 3DM1A 3X3MA 2R92H 4DUZL 4GKKQ 2R7DA 1B70B 3ER0A 3G6EA 4JV5Q 1HNXQ 3ERSX 5FLXc 4UDUC 5JJLA 3CMAA 3KJOA 4JYAL 2LMCB 1SSOA 1S40A 3KYHC 4DV2L 4GZYC 1T9HA 1BBXC 4KMUC 1SE8A 5A2QE 4DR2Q 5FLMH 2PZWA 1BO0A 1WFQA 1SYEA 2QDLA 3K7AH 4K5WA 4DK3C 2F0HA 1I3QB 3AYHB 3J7ZC 5C4JH 5I6YA 1X55A 4K6LA 2AKWB 4RGTA 2RDHA 5C0XH 4NB3A 1M8AA 1V1PA 3SEBA 3TS2A 1II3A 4WJ3M 4DR6L 4LUZA 4RGNA 1E3PA 2KHJA 1QVCA 1VF5C 1KAWA 4KY5A 5DNFA 3U9SA 2UXCQ 4PV1C 5FLXE 2DN8A 3CP0A 2CFMA 1XX8A 4BY1H 1STBA 4KK7A 1YHBA 5A2QL 2WINB 2KECA 1LTTD 1S5ED 3GV6A 3R8BA 3A55A 5J22A 1XXGA 4RHSA 2FHTA 5COYA 2H1EA 1CFMA 3TBIB 4GOPC 4Q0FA 4PQXA 2PQAA 4BY7B 3U4ZA 2MFIA 3W3AA 3UDFA 2R93H 3GDEA 3I2ZA 4DAYA 2ZJRA 1HZAA 4ZK9B 3VYTA 3G7LA 1R9TB 3S1RB 3D0FA 5JVH3 1B8AA 1O7ZA 4A3IH 1EQTA 4LF4L 4ZLTF 2QEJC 2NBFA 4A3EH 5DM73 3F8TA 3IRBA 4DR4L 1AW7A 5I4DA 2JYOA 2E5LL 3VR6A 3J80i 3RZDH 5IWAL 2FJ2A 3TP8A 3TN2A 4C2MB 2OTLA 1F77A 4JI1Q 1LABA 1NMFA 4JI3L 4Y7NH 3S1QB 3J80c 5M3MH 1L0YB 1IBML 1IW7C 2F0OA 4JBKA 5M9OA 2F0UA 4B9XA 2FFKB 3I7FA 4BY7H 1U5KA 5I2YA 3PIPA 4RFBA 2Z8LA 3I4NB 3NK9A 2L55A 4CDCC 4X65Q 5CBEE 2EJMA 1D8LA 1A2TA 1WTQA 5IYCG 4CJ0B 2E76C 2K7VA 1W2BA 2RKSA 1O7LA 4LUOA 1JR0D 2B2YC 4PMBA 1IBMQ 1LUZA 1D7QA 4TVAB 1IBLL 4RA8A 3D6CA 4FNFA 1JWUD 4L63B 1BVSA 3DEPA 1TS2A 1X3PA 3MVVA 2MP1A 2Z4IA 5KNDA 4OONA 4I65A 1IBLQ 3QOJA 1ENCA 3RMHA 2JSOA 2WAQG 2WFWA 3I3CA 4I7AA 1LT5D 2NTSA 3L3OC 1IKMA 3A8JE 1K3BC 1Q82C 3MXPA 2VL6A 3W5OA 3HOVB 1EYDA 1FJGQ 5C3EH 2ZXOA 1TWHB 2EPBA 3X3NA 4E6IA 1XNQL 5T1IA 2KJXA 3EVQA 4DR5L 3I91A 4R8NA 3K7UC 4OO1G 3J81L 1I4RA 4KTAA 1I50H 2R7ZB 1EWHA 1L1OC 3MA2B 4RMFA 1CKNA 1X3FA 2X69A 1DOKA 3Q8DA 1F9PA 1LTSD 4CKBA 3M3YB 3CCUA 1EQRA 1PTOB 1CHQD 3NHHA 5ELDA 1TWFB 4A3KB 2LXKA 2NZHA 3NTIA 4BA1I 5I2XA 2F0LA 2KCMA 4B3TL 2RHQB 3E9IA 4DAVA 3VDYA 2X6GA 2VQEQ 4RCNA 4FXDA 3RR5A 4DV0L 4OGQC 1AH9A 5FK9C 4B3TQ 3CC2A 3TDQA 4DGZA 2JA6B 3QG1A 3QOLA 1N32L 4GNXC 1FNWA 3KBXA 3TRZA 1DONA 2JJQA 4WORA 3BZDB 1CKMA 1HNWL 1AZPA 4DV0Q 4IJHA 5FO8B 2UU9Q 1J5EQ 5CV9A 1B1ZA 1Q8IA 4LF6Q 4OWXB 3CPFA 1Q1EA 2HUGA 4RKLA 4UAIA 2VQFQ 1LO5D 2OWOA 4LF8Q 3PMFA 5H1SE 1BCPD 5JEAH 4EGVA 1K3RA 1NSNS 1SLJA 5CBAE 1Q1BA 5IGDA 1PTOF 1BXTA 1SN8A 4CKCA 5BN3A 1X32A 1L0WA 4A3GG 1I6HH 1RKNA 4F7XA 2ES2A 4LFAL 1PH1A 2MGSA 4B3RQ 3C2PA 3Q23A
chains in the Genus database with same CATH topology
2SNMA 1PYWD 4H44C 5F2DA 4IFDI 1CA6A 4A3EB 3KF8A 3GTGB 1TWGB 3OPOA 1KAAA 1F2ZA 1LV9A 2FMCA 2ZT9C 5CV5A 2NUCA 2K1BA 2AQ1B 4L6TB 1GUOA 1O7YA 2Y0SB 1QB5D 1R4QB 3S14B 4CBVA 1BCPC 3ND9A 1J9OA 3P1HA 3MAQA 4OIJA 1PXUA 4WFN3 1B44D 4EQPA 5K5PA 4TQUS 1STGA 4KKUA 2XRSD 4WRDA 2GA4B 1LACA 3A56A 2AQ2B 3H91A 1TWAB 4HTHA 3OSOA 2O5IC 4KJNA 1B2TA 1AZQA 1G2SA 4FF1A 2KEDA 5M5XB 1H9JA 1VCIA 4G57A 2LFNA 3K58A 3AMUA 4A3DB 1JOOA 2F0SA 5M3FB 5FKAC 2A6ED 1HRJA 3PIO3 1KABA 2F0JA 5DAUA 5IGCA 4DF7A 3CRKC 3I4LA 5C0XJ 2PW5A 3NP8A 5C0XG 3W2DA 3KLSX 1QNKA 3GTOB 4C3HB 1SNQA 1RF2D 4EQOA 2BE5C 5EBDA 1SNPA 1YNJD 4A3JB 4A93B 3NXWA 3I70A 1VDZA 4G7HC 3SE0A 4IUVA 3HGBA 2IL8A 2IX3A 2V4DA 1ENFA 3HOUB 2F0FA 4QMGA 2I46A 1JC7A 1LT6D 1CM9A 5D65A 2PNRC 4QUFA 1ET9A 2EYFA 1YNJC 5J1ZA 3DWPA 4A3GB 2EYOA 4HMJA 2LKVA 5I6WA 3NE5B 3L9AX 2K01A 1W6KA 1G91A 3Q22A 2J0TD 1J8IA 2XWJB 2PZTA 4DK0A 3OMGA 1JWSD 4NDXA 3H6MA 2EY2A 5ELCA 3T53B 5I9OA 2L5TA 1CZWA 4DAPA 2NVTB 5EPKA 2KCNA 1KLGD 2L12A 1SDFA 2PPBC 2K32A 1V43A 1QNUA 5G3LD 1LLRD 5M5WB 2M9VA 1FGBD 2XN9C 3PUVA 4IN3A 2L0CA 1EZ6A 3TMEA 4ID6A 1QE6A 3BG3A 1KDAA 4MIUA 4C3JG 3NWSA 3MWYW 2HCIA 3T51B 4XIGS 2B2YA 4PNYA 2NN6G 1VMCA 4JK1C 5IOCA 3J80E 3N52A 5T1GA 3HOYB 3VR3A 2RSOA 3MHBA 1HTPA 3KK7A 1MI2A 1B3AA 3I8ZA 1HA5A 4X3KA 1I4GA 3K5MA 1SNCA 3GTJB 4DFAA 5KRUA 3JAML 1STHA 1IW7D 4O1NA 3PUXA 2KOLA 2L9HA 2O4XA 4F8MA 4EVOA 2WB1B 1QWYA 4V190 3J7AV 3L7ZC 2A68C 2MJ8A 5C3EB 1PMRA 1Y8NB 4QCLA 1T5EA 3HRZC 2ICEC 4TRDA 5CR3A 5KGUA 3K5LA 1IYVA 1GHKA 5HURA 3HKZB 2SNSA 3CQZB 5EGTA 5ELFA 4A3MB 1FYCA 2F0IA 3LX0A 1A6XA 1WTXA 4OL7A 1ENAA 1WD0A 1GHJA 3D4RA 2F0EA 3GTQB 3MFGA 1PTOH 3SDZA 4TSSA 1U4LA 3OMCA 2F0DA 4PMWA 4QB4A 4H7BA 3EFXD 1EY9A 1G6ZA 5EJWA 2R61A 2BE5D 4OO1I 5C4XB 1BNZA 3MXGA 4KJOA 2XNAC 1JOKA 4ZQ3A 1EU4A 1KDBA 1TS3A 1EFID 1F9SA 1TT2A 1V1PB 4K8IA 1TY0A 1STAA 1PZKD 3S2DB 3T4AC 3FEWX 2Q8RE 2A6EC 2SOBA 2TSSA 2PO4A 2O5JC 3M7NA 2K5WA 4IUTA 1IYUA 5EBCA 2K5QA 2TMPA 3K57A 3SXHA 1F9QA 1HUNA 3H09A 1PRTB 1KLUD 1G291 1NCVA 1CI3M 1SXTA 4K2LA 2MPMA 5BN4A 4ILWA 3E6ZX 1D1KA 3NUCA 5CC4A 4ZRZA 1O80A 3D6WA 1CTMA 1Z7TA 1H9MA 1DJRD 1AN8A 1H9KA 5CV6A 5D3DA 3M85A 5JAVA 3URYA 2JA7B 4PMCA 1KNAA 4XXEA 2MUYA 4F87A 2C5CA 5CV4A 2R6GA 3ZYYX 3VR4A 5CV8A 3TP5A 1LTID 1DM0B 5D3IB 5IT9E 3QB3A 1WD1A 4HEDA 1XYIA 2OEOA 2CVRA 5C4HA 1K8MA 4IZ8A 4QUCA 1SNDA 1A2UA 3SK5A 2VNUD 4ABNA 2NB0A 1RHPA 1WTPA 1MSHA 3NWTA 1GUGA 1M4VA 2EYPA 4K6DA 2B2VA 2PW7A 3GV3A 2F3WA 4KN4C 2K04A 1AP0A 3VR2A 4P2CB 5C5LA 5IT9L 3V05A 3F2UA 1PFMA 5C4JB 5IIFA 4HSVA 2HCCA 2BOSA 3TZUA 4J1MA 3C46A 1EL0A 5CYUA 2WKCA 4I7ZC 2NVYB 2VB3X 2XVSA 3AU7A 2BA1A 1CK1A 3M4YA 4ZKBB 3H0GB 3NQTA 5JPMC 3C1EA 3P20A 4IFDG 1ML0D 4Q5VA 3CKIB 4ME5A 2ID0A 5C5MA 1JE4A 3S17B 1SE2A 1DYQA 1OXTA 3S2HB 4KY7A 4DN4M 2L11A 4K2KA 3RD4A 4TKOB 1WVLA 4IUQA 5KYIA 2VUMB 2EXZA 2NVQB 1HQRD 5J39A 4IUUA 2F0NA 3WOEA 2EYJA 2B2WA 4RGOS 1WTVA 2Z4HA 2PQEA 1NUCA 1G2TA 4Y7NB 1VF7A 4DU9A 4NKLA 1ONLA 1EY8A 3BDOA 3JAME 2D2CC 1B50A 3PUWA 4CJ1B 4O42A 1LTGD 4BS9A 1V8QA 5C3WA 1EIGA 2EDGA 1GXDC 3EROA 3VA7A 4QF4A 3K7AB 4FF3A 2A6HD 3RLFA 2WV6D 4C3HG 1F2LA 3PO3B 1MGSA 1H9RA 4IUNA 1A3UA 3QO2A 4FVMA 1BOSA 4NP5A 3DMUA 1R4PB 1K8OA 2IX0A 2CW0D 2KVMA 3LWEA 1ZYRC 3H3VC 4H13C 1STNA 4KN7C 1BCPB 4FXKC 2B2UC 2HQEA 2IT1A 3OHXC 1OXVA 5CGKA 4ZUIA 3TSSA 3LNNA 4KD4A 1D5XC 3K0YA 4XT1B 5IGGA 3FMCA 3G6JB 2M2LA 1DOMA 4K8JA 2NZ1D 3K5NA 2A73B 3BS1A 1I4HA 5CORA 4KHVA 1LT4D 3MC0B 4MN3A 5C0XI 1S5BD 2EZVA 3CU7A 3MXUA 1H9SA 1LT3D 1Z6HA 2BDOA 2N55A 2K5DA 3J7AF 3PUYA 2EOTA 1W6JA 1ZYRD 2PYKA 4RCOA 1G8ZD 2D5DA 1CHPD 2QKIC 1SYDA 3GO5A 3C3LA 1SYFA 2JE6I 2F0GA 5LHY1 4XQNA 2E75C 3PIP3 1SE3A 2AUKA 2PZUA 1FD7D 3BDLA 2E74C 4FF2A 2A5HA 4V0BA 2RDFA 2JA8B 3DUZA 3T16A 1C48A 1OXUA 3GTKB 1S4ZA 2AUJD 1RCVD 1PFNA 1A3VA 1FNVA 1PTOD 3OWFA 4YIJA 3R93A 3K6OA 5KYLA 5ELEA 1I4XA 3IFDA 4IFDJ 1TKWB 1PZID 2ENBA 3A8KE 1DXMA 1SJHD 5JEAG 2KEEA 4HMIA 2ZXPA 2J7ZA 2B2TC 5E4WC 3FPPA 3VYUA 2FINB 3EA6A 4BWGB 2LY7A 3HOZB 1B4OA 3I72A 1AFPA 2EYMA 3NBHA 2EYLA 2JA5B 4C3IB 3SHLA 3NTKA 4CJ2C 2E2DC 3SR1A 1RDPD 1HQMC 3E0JA 3D4WA 4AYBB 1Q12A 3BYTB 1ILQA 2XWBB 1PRTC 2EE1A 1JORA 1T5XD 4EQNA 1SJED 1SMYD 3M7GA 2SEBD 4K5VA 4KKSA 2OF1A 1U9RA 3KUPA 1RODA 3HS0C 4KD3A 5DM63 1I4QA 4XT3B 1TQOA 1H9SB 1LTBD 4Z9CB 5E4XA 4X3SA 3VA5A 3DHQA 1I50B 1KDCA 5LL6S 4G4KA 5K36G 2QCPX 1ZXTA 2F0KA 4LJZC 1BQQT 2EY6A 2FMMA 1CQFA 3GQBA 4FXGC 5CMDA 5JPNC 1NAPA 4ODGA 3OOCA 1IKLA 5KEEA 3EQLC 1ZEQX 3MZ5A 1HFGA 4FYDA 4IURA 5FO9B 2VXWA 2F4IA 3S16B 2DY8A 5IGBA 3J80L 1KNEA 4CGYB 1EZ8A 4JBWA 2E2JB 2IX1A 2WACA 5FO7B 2B8FA 5DEHA 2K05A 4XQJA 4LAAA 3NPPA 3KLSA 1EQVA 1JICA 4C3JB 1PLFA 1JQYD 5FLXL 5JOBA 5KNBA 3Q24A 3V96A 1PDQA 1AEXA 4B08A 2QF7A 1STEA 1GUSA 2EJFC 4R8IA 4IFDH 4XTCS 5EKLA 4XQQA 4XYQA 1U4RA 2F0VA 4LMQD 1ZKOA 3T13A 3CRLC 1I6HB 1Y8OB 3OIQA 2E2HB 3TP6A 2AQ3B 1O78A 4L8JA 3J7YW 4CKEA 1DOLA 3QWNA 1EEID 3GP7A 1X3QA 2ICIA 1YNNC 1F2MA 1SEBD 2JEAI 2NN6I 3CHBD 2L1BA 1V1OA 5KIXA 5EPJA 2RBMA 2YU9B 2O2LD 1SAPA 3GTMB 2JXMB 3S15B 4G7OC 1U4PA 1D1IA 3QJYA 3VR5A 1SFOB 1HUMA 2WP8J 2PCFB 3O13A 4F88A 4RKBA 2KQ3A 2EVBA 1HTLD 3A7LA 4MHEA 5ELBA 1HHVA 1D6EC 5EKIA 4DA2A 1ESFA 2F0MA 4XDXA 1GUTA 3IKJA 2BDNA 5ISRA 2EJGC 2NYZD 2F0WA 1BR9A 5C44B 4HCSA 3ND8A 3D3RA 5IODA 3S1MB 1I4PA 2QILA 5KNCA 3HZXA 2XRQD 4KHZA 1QCBD 2H4OA 2N88A 1EY0A 1ESRA 1QOHA 1Y69U 2WKDA 5C3XA 2OXPA 3OWEB 1TVXA 3KBGA 2NWGA 2Z1CA 4X3UA 1E2VA 3C1FA 1NR4A 2K28A 4KV6A 3R2IA 2CQAA 1Y1WB 2M00A 4RHRA 1DZ1A 2AWNA 1SE4A 1F2YA 4HR7B 4C1NK 4XYOA 5EKKA 1RTNA 3BDCA 1SBBB 1PZJD 1B9MA 1SYBA 4ZAIA 3FKIB 1S5FD 3Q6SA 2F3VA 1CZGA 2BCOA 1C4QA 2F0TA 1GUNA 1SMYC 5D14A 5E3FA 1QILA 5CV7A 1STYA 3VYSA 1JCKB 2EYHA 3A54A 2NN6H 5IGEA 4DXGA 1JB3A 3S9WA 1QG7A 2WIIB 3S1NB 4H0LC 5K36H 3D4DA 3KLRA 3QIAA 1WTWA 1B9NA 2AWOA 2B2TA 1SNMA 2EY5A 1EYAA 1RTOA 4BY1B 1HFNA 3MEHA 3M4OB 3SK8A 1A15A 2RQXA 2B63B 3HEJA 4KI0A 5M5YB 2A68D 5C4ZA 1XTCD 3DXJC 1ICWA 5A35A 1JWMD 2KHSA 1I6VC 3NQIA 1GUWA 4U673 2SDFA 1MD2D 2IWHA 1D2BA 3LWUA 1MSGA 4CHTB 4K5XA 4X3TA 4DNTB 4J6HA 2JP1A 3PO2B 1PRTD 4N9TA 3MTSA 3TP7A 4IALA 2J4XA 4C56C 1LTRD 2L4NA 2RA4A 3HOWB 3RZOB 4NMZA 1OXSC 4S3SA 1EWCA 1BDOA 3OIPA 4FF4A 2KUMA 3FPUB 3I4MB 4N9PA 2XSCA 3NSWA 3U9OA 1IL8A 3R2TA 1IHZA 3FVQA 4IQZA 2G9HD 1EY4A 4J8QA 1BCPF 2HDMA 4A3IB 1FNUA 1K83B 2DNCA 3WDNA 3AB9A 3GD7A 1RD9D 1OXXK 1U4MA 3IFTA 5BN5A 1L0XB 1Y1VB 1Y8PB 2B2UA 1SNOA 2BA0A 1WTRA 2E2IB 2JEBI 3P75A 1PTOC 5I9PA 1JOQA 4M1UB 3ITPA 3I90A 4LK1C 4BBRB 2IPKD 2I07B 5IGFA 5E1FA 5G3LF 1D5MC 1Z47A 1SYCA 4DNRB 3H94A 3UI2A 1EY6A 4RAUC 1HA6A 2PMZB 3IAYA 3FDTA 4RH6A 5HGTA 4BBSB 5C6AA 1E2WA 2C9OA 2ZXRA 1BUVT 5FOBB 2RVLA 4IUPA 1EIHA 2R92B 2F1MA 3MXNA 4RWSC 2F03A 2XIWA 3T56B 3RUZA 1S5DD 1HPCA 1GOZA 1ILPA 4KY6A 2RSNA 1S5CD 2QDBA 4U68A 2IJ0A 2A69D 1TR5A 1GJXA 1Q3LA 3SVMA 3A8IE 2F0PA 3BVGA 2HDLA 2G9DA 1EU3A 1QJOA 2B2WC 1HXYD 4FO2A 1WCMB 1MBYA 1YNND 3IL8A 3BYYB 4ZUJA 5NUCA 1EOTA 1EY5A 2Q8IB 4OIKA 5EQ0A 2DY7A 3NBIA 3VYRA 5M3MB 1PFBA 4A3FB 1ET6A 2K33A 2MHVA 4A3BB 1LTAD 3SK4A 3K59A 3R3OA 4NW2A 4ZYSA 1KTKA 5JJZA 3MFYA 3K5OA 2A69C 1A3TA 3E5SA 1TS4A 2R3ZA 1RJTA 3D8GA 4M8AA 3BVMA 3I73A 2X6LA 3GTLB 3OW7A 5EPLA 2KA7A 1TIID 3Q0AA 1CQVA 3ONAB 4DK1A 3PUZA 4G7ZC 1UAPA 1TS5A 1WTOA 2NVXB 5JVG3 1TU2B 2D62A 2RDGA 3HOXB 2DNEA 4R9WA 2CHBD 3ERQA 2B2VC 2NTTA 3HG9A 1UUPA 4B9WA 2KCCA 2CW0C 3WOFA 1BF4A 1DCZA 1TY2A 1EY7A 1PRTF 3DWAA 1C8CA 1Q90A 2IW3A 2B39A 4K14A 4QIWB 1VMPA 4HAEA 3D31A 1CT1D 1E2ZA 3DWQA 1UEAB 1F9RA 4OHJA 2WAQB 1CA5A 3FRPB 2D9UA 3HP3A 3PV0A 2F0QA 5LL6X 3J81E 1D5ZC 4DXFA 3SK6A 2VB2X 2A74C 1SYGA 3BVZA 1FR3A 3EJIA 4OO1H 4ZKCB 3RZDB 2K6AA 3P7JA 1NR2A 1XWEA 4HSPA 3A7AB 4HCEA 1B53A 3GTPB 2Q8TA 1EEFD 2A6HC 3N6RA 2LS01 4BA2I 5TSSA 1OO9B 4ULLA 2YYZA 3DEOA 1DD2A 2B8GA 5JEAJ 4FP5D 3V2TA 4C3IG 1HCZA 1EYCA 2EY1A 5AFWA 2K03A 2R93B 4C1NI 1E0BA 1UNSA 3TZDA 4RGMA 4KKTA 1TWCB 4WJWA 2OT2A 4HN7A 3NTHA 3DM1A 3X3MA 4UDUC 2LMCB 1SSOA 4GZYC 1BBXC 4KMUC 5A2QE 2PZWA 1BO0A 1SYEA 4K5WA 2F0HA 1I3QB 5I6YA 4K6LA 4RGTA 2RDHA 5C0XH 1M8AA 1V1PA 3SEBA 1II3A 4RGNA 1VF5C 4KY5A 5DNFA 3U9SA 4PV1C 5FLXE 2DN8A 1XX8A 1STBA 4KK7A 5A2QL 2WINB 2KECA 1LTTD 1S5ED 3GV6A 3R8BA 3A55A 5J22A 1XXGA 4RHSA 2FHTA 5COYA 2H1EA 1CFMA 3TBIB 4Q0FA 4PQXA 4BY7B 3W3AA 4DAYA 4ZK9B 3VYTA 3G7LA 1R9TB 3S1RB 5JVH3 1O7ZA 1EQTA 4ZLTF 2QEJC 2NBFA 5DM73 1AW7A 5I4DA 2JYOA 3VR6A 2FJ2A 3TP8A 3TN2A 4C2MB 1F77A 1LABA 3S1QB 1L0YB 1IW7C 2F0OA 5M9OA 2F0UA 4B9XA 2FFKB 5I2YA 4RFBA 2Z8LA 3I4NB 3NK9A 2L55A 5CBEE 2EJMA 1A2TA 1WTQA 4CJ0B 2E76C 2K7VA 2RKSA 1O7LA 1JR0D 2B2YC 4PMBA 4RA8A 3D6CA 4FNFA 1JWUD 4L63B 3DEPA 1TS2A 1X3PA 3MVVA 2MP1A 2Z4IA 5KNDA 4I65A 3QOJA 1ENCA 3RMHA 2JSOA 3I3CA 1LT5D 2NTSA 3L3OC 1IKMA 3A8JE 3MXPA 3HOVB 1EYDA 2ZXOA 1TWHB 2EPBA 3X3NA 4E6IA 5T1IA 2KJXA 3EVQA 3I91A 4R8NA 4OO1G 3J81L 1I4RA 4KTAA 2R7ZB 1EWHA 3MA2B 2X69A 1DOKA 1F9PA 1LTSD 4CKBA 3M3YB 1PTOB 1CHQD 3NHHA 5ELDA 1TWFB 4A3KB 3NTIA 4BA1I 5I2XA 2F0LA 4DAVA 2X6GA 4RCNA 4FXDA 4OGQC 5FK9C 3TDQA 4DGZA 2JA6B 3QG1A 3QOLA 1FNWA 3KBXA 1DONA 4WORA 3BZDB 1AZPA 5FO8B 5CV9A 1B1ZA 1Q8IA 1Q1EA 2HUGA 4RKLA 4UAIA 1LO5D 3PMFA 1BCPD 5JEAH 4EGVA 1NSNS 5CBAE 1Q1BA 5IGDA 1PTOF 1BXTA 4CKCA 5BN3A 1X32A 1RKNA 4F7XA 2MGSA 3C2PA 3Q23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOK A;  4KJO A;  4ZQ3 A;  2SNM A;  1II3 A;  1KDB A;  4NKL A;  3D4D A;  4K14 A;  1EY8 A;  4I65 A;  2F0M A;  3NXW A;  3QOJ A;  5F2D A;  3D4W A;  1ENC A;  1TT2 A;  2PYK A;  5IOC A;  2EYP A;  5ISR A;  4K8I A;  4KY5 A;  1STA A;  2F0W A;  4K6D A;  3MHB A;  2PW7 A;  2F3W A;  1SNM A;  2EY5 A;  1EYA A;  4ZUJ A;  5NUC A;  1EY5 A;  5IOD A;  1AEX A;  1SYD A;  1STB A;  1JOR A;  5C3W A;  2F0Q A;  1KAA A;  1SYF A;  2F0F A;  3MEH A;  5C5L A;  3MXP A;  4QMG A;  4EQN A;  1F2Z A;  5CV5 A;  2NUC A;  2SOB A;  1EYD A;  2F0G A;  5EKL A;  3ERO A;  4K5V A;  3SK8 A;  5J22 A;  3SK6 A;  1SYG A;  4E6I A;  1SNC A;  3HZX A;  2OF1 A;  3HEJ A;  4DFA A;  4QF4 A;  5KRU A;  1U9R A;  3EJI A;  2F0V A;  1STH A;  3EVQ A;  5IIF A;  1EY0 A;  1SNO A;  2PZU A;  3BDL A;  4R8N A;  5C4Z A;  2O4X A;  4KD3 A;  2EYF A;  4F8M A;  4EVO A;  5J1Z A;  5IGC A;  3SK4 A;  3T13 A;  4J1M A;  3R3O A;  4KTA A;  1TQO A;  3P1H A;  3SXH A;  2EYO A;  2OXP A;  4IUN A;  5C3X A;  4HMJ A;  2LKV A;  5I6W A;  1A3U A;  3P75 A;  5I9P A;  3TP6 A;  2RDF A;  1A3T A;  3VA5 A;  4EQP A;  5K5P A;  3ITP A;  1JOQ A;  3DHQ A;  3C1F A;  2KHS A;  3NHH A;  3C1E A;  3NQT A;  3E5S A;  1STG A;  3T16 A;  2PZT A;  4NP5 A;  3DMU A;  5IGF A;  4WRD A;  1KDC A;  2F0L A;  3OMG A;  4NDX A;  5E1F A;  4K2L A;  3H6M A;  2EY2 A;  4KV6 A;  1SYC A;  2M00 A;  5I9O A;  3V2T A;  1EY6 A;  1A3V A;  2F0K A;  3OWF A;  4YIJ A;  3D8G A;  1EYC A;  2EY1 A;  3NUC A;  4HTH A;  3OSO A;  4TRD A;  5CR3 A;  1STN A;  5CC4 A;  5KGU A;  5KYL A;  1F2Y A;  5HGT A;  4ME5 A;  2HQE A;  4KJN A;  5HUR A;  2EY6 A;  1F2M A;  5C6A A;  5C5M A;  4K5X A;  2SNS A;  5EGT A;  4J6H A;  3TP8 A;  5EKK A;  4N9T A;  4DGZ A;  5CGK A;  3QOL A;  2ENB A;  4ZUI A;  4G57 A;  4KY7 A;  5KIX A;  5CV6 A;  3BDC A;  1JOO A;  4IAL A;  4WOR A;  3TP7 A;  2F0S A;  4ODG A;  2RBM A;  4K2K A;  4KD4 A;  2F0I A;  3LX0 A;  1SYB A;  4OL7 A;  1ENA A;  5JAV A;  4HMI A;  5KEE A;  5KYI A;  1KAB A;  2F0E A;  5CV9 A;  5IGG A;  2F0O A;  2F0J A;  3ERQ A;  4PMC A;  3MZ5 A;  2F0U A;  5DAU A;  2F3V A;  2EXZ A;  4NMZ A;  4S3S A;  4B9X A;  4DF7 A;  5M9O A;  4RKL A;  4B9W A;  4K8J A;  3OMC A;  3NK9 A;  5CV4 A;  5J39 A;  2F0T A;  2F0D A;  2PW5 A;  1A2T A;  3PMF A;  3RUZ A;  4QB4 A;  5IGB A;  4N9P A;  3NP8 A;  4H7B A;  5CV8 A;  4KHV A;  4KY6 A;  2F0N A;  5E3F A;  3TP5 A;  1EZ8 A;  1NSN S;  2QDB A;  1EY9 A;  2RKS A;  2EYJ A;  3U9O A;  1EZ6 A;  2WAC A;  4PMB A;  3TME A;  1TR5 A;  4ID6 A;  1KDA A;  3QB3 A;  1EY7 A;  2EYM A;  1STY A;  2PZW A;  5CV7 A;  5DEH A;  5IGD A;  4MIU A;  1SYE A;  2PQE A;  1IHZ A;  1NUC A;  4K5W A;  1SNQ A;  2F0H A;  2KQ3 A;  2EYL A;  2OEO A;  2F0P A;  1RKN A;  2EYH A;  4LAA A;  4RKB A;  1EY4 A;  3D6C A;  4F7X A;  5C4H A;  1EQV A;  3SHL A;  5I6Y A;  4IZ8 A;  5IGE A;  4EQO A;  3S9W A;  1SND A;  4DU9 A;  3MVV A;  1A2U A;  1SNP A;  3SK5 A;  5JOB A;  3SR1 A;  4PNY A; 
#chains in the Genus database with same CATH topology
 2SNM A;  1PYW D;  4H44 C;  5F2D A;  4IFD I;  1CA6 A;  4A3E B;  3KF8 A;  3U50 C;  1FJG L;  4PG3 A;  4LUV A;  1XNQ Q;  2WAQ E;  4A3K H;  3GTG B;  1TWG B;  3M3Y H;  3OPO A;  1KAA A;  1UEB A;  1F2Z A;  1LV9 A;  2FMC A;  2ZT9 C;  5CV5 A;  1NJI C;  2NUC A;  1W3S A;  2K1B A;  4B3M Q;  3TS0 A;  2AQ1 B;  4EX5 A;  3A5U A;  4L6T B;  2ZTE A;  1GUO A;  3J81 c;  4ME3 A;  3CPW A;  1VQE A;  1O7Y A;  2Z0S A;  2Y0S B;  2B63 G;  1QB5 D;  1R4Q B;  3PO2 H;  3S14 B;  4P74 A;  4LF5 L;  4CBV A;  1BCP C;  3ND9 A;  1J9O A;  3P1H A;  3MAQ A;  4OIJ A;  1PXU A;  3K80 C;  4WFN 3;  4C3I H;  4X66 Q;  1B44 D;  3S24 A;  1KRT A;  4EQP A;  5K5P A;  4TQU S;  2Q2U A;  4CDD C;  2ZJP A;  1STG A;  4KKU A;  2XRS D;  4WRD A;  4LNQ A;  2GA4 B;  3TRE A;  3CCV A;  1LAC A;  2CWA A;  2XTI A;  2AQ2 B;  3A56 A;  1TWA B;  3H91 A;  1XPU A;  1N32 Q;  4HTH A;  3OSO A;  2O5I C;  3S2D H;  4KJN A;  2NVT H;  1A63 A;  3NBH B;  4DV7 L;  1B2T A;  1AZQ A;  1G2S A;  3F2B A;  4FF1 A;  2KED A;  5M5X B;  1H9J A;  4DPG A;  1QVG A;  1VCI A;  4G57 A;  3PO2 G;  4HIK A;  2LFN A;  3K58 A;  3AMU A;  4A3D B;  1JOO A;  2F0S A;  5FKA C;  5M3F B;  2A6E D;  1YJW A;  1HRJ A;  1IL2 A;  3PIO 3;  3RNU A;  1KAB A;  3M4O H;  2F0J A;  5DAU A;  2EXD A;  5IGC A;  4DF7 A;  3E0E A;  3EBE A;  2PI2 E;  3HOW G;  3CRK C;  1L2F A;  3I4L A;  5C0X J;  4L5R C;  2PW5 A;  3NP8 A;  5C0X G;  2JQO A;  3W2D A;  1SMX A;  3KLS X;  1QNK A;  3I4M G;  5IP9 G;  3GTO B;  4C3H B;  4NXM Q;  1Q86 C;  3ICE A;  2ASB A;  1SNQ A;  2R7F A;  1RF2 D;  3H15 A;  4UP9 A;  4EQO A;  1YEZ A;  1YNX A;  2BE5 C;  5EBD A;  1SNP A;  1YNJ D;  4A3J B;  4OWT B;  4A3I G;  4NXM L;  4N8F A;  4P73 A;  3HOU H;  4A93 B;  3NXW A;  3I70 A;  1VDZ A;  3PCO B;  1UE5 A;  2I5L X;  4G7H C;  3SE0 A;  4IUV A;  1N33 Q;  3HGB A;  2IL8 A;  3S1R H;  2IX3 A;  2V4D A;  4DR7 Q;  1ENF A;  3HOU B;  4A93 H;  2F0F A;  4GOP B;  4QMG A;  3FKI H;  2ZJQ A;  2I46 A;  1JC7 A;  1LT6 D;  4GNX A;  1P8L A;  1CM9 A;  5D65 A;  4JBM A;  2PNR C;  4QUF A;  3CC7 A;  1ET9 A;  3CME A;  3GTO H;  2EYF A;  1YNJ C;  2DUD A;  5J1Z A;  1HR0 L;  2QA4 A;  3DWP A;  4A3G B;  2EYO A;  4HMJ A;  2LKV A;  5I6W A;  1YBY A;  1VQM A;  3NE5 B;  3L9A X;  2K01 A;  4HJ9 A;  3HKZ E;  1W6K A;  1G91 A;  3Q22 A;  2J0T D;  1J8I A;  1XNR Q;  5BR8 L;  2XWJ B;  2PZT A;  4DK0 A;  3GTL H;  3OMG A;  1JWS D;  4NDX A;  4GKK L;  3KF8 B;  2CKZ B;  3H6M A;  2EY2 A;  5ELC A;  3T53 B;  1L1O A;  5I9O A;  3H3V I;  2L5T A;  3M9B A;  4YY3 Q;  1YJ9 A;  3PF4 A;  4GKJ L;  1CZW A;  4DAP A;  2NVT B;  5EPK A;  2KCN A;  4NXN L;  1A62 A;  1KLG D;  1Y14 B;  2L12 A;  3CC4 A;  3GTM H;  2BH8 A;  1NMG A;  4JI2 Q;  1SDF A;  1GVP A;  3KF6 A;  4GKJ Q;  2PPB C;  1VQL A;  4A3D G;  2K32 A;  1V43 A;  4UHV A;  1VQD A;  3ULJ A;  1QNU A;  5G3L D;  1LLR D;  1TXY A;  5M5W B;  2M9V A;  1FGB D;  2XN9 C;  1IBK Q;  1CKO A;  3GTK H;  3PUV A;  3KJP A;  2YTY A;  3E9H A;  4IN3 A;  2L0C A;  4A3F H;  1A0I A;  3I4O A;  3I56 A;  4OEM B;  4X64 L;  1EZ6 A;  1X3G A;  3TME A;  4ID6 A;  1QE6 A;  3BG3 A;  1KDA A;  4MIU A;  4DV6 L;  4C3J G;  3NWS A;  3MWY W;  1VQB A;  2HCI A;  3T51 B;  1K8G A;  4XIG S;  4LF4 Q;  2R93 G;  4GLA C;  2B2Y A;  4PNY A;  2NN6 G;  1VMC A;  4A3J G;  1DGS A;  4JK1 C;  4IPD A;  5IOC A;  3J80 E;  3N52 A;  5T1G A;  2KHI A;  4HIM A;  3HOY B;  2E8G A;  3VR3 A;  3CCQ A;  2RSO A;  3MHB A;  4YCW A;  3S2H H;  1HTP A;  3KK7 A;  1MI2 A;  2L15 A;  1B3A A;  3I8Z A;  1HA5 A;  4X3K A;  1I4G A;  4DV4 Q;  2UUC Q;  3K5M A;  1VQF A;  1SNC A;  3GTJ B;  4DFA A;  5KRU A;  3JAM L;  1STH A;  1IW7 D;  4O1N A;  3PUX A;  5GQO A;  2KOL A;  3KDF A;  2L9H A;  2O4X A;  3M4P A;  4F8M A;  4EVO A;  3CXC A;  4X65 L;  4GS3 A;  2N3S A;  2WB1 B;  5IP9 H;  1QWY A;  2MNA A;  4V19 0;  3J7A V;  4AIM A;  3L7Z C;  2A68 C;  1E1O A;  2MJ8 A;  5C3E B;  3H0G G;  4DAM A;  1PMR A;  1HZB A;  1Y8N B;  2A1A A;  4BXX G;  4QCL A;  1B3Q A;  4UPA A;  1T5E A;  3HRZ C;  2VUM H;  2ICE C;  4TRD A;  5CR3 A;  5KGU A;  3K5L A;  1IYV A;  1GHK A;  5HUR A;  4GOP A;  3HKZ B;  2SNS A;  3CQZ B;  1PH9 A;  4X6A H;  5EGT A;  2UXD Q;  5ELF A;  4A3M B;  1FYC A;  4O0A A;  1JJC B;  3OTO Q;  4A3J H;  4UY8 C;  2F0I A;  3LX0 A;  3S17 H;  1A6X A;  1WTX A;  4OL7 A;  1ENA A;  1WD0 A;  1GHJ A;  1TWF H;  3D4R A;  2F0E A;  3GTQ B;  3J7A 5;  3MFG A;  1PTO H;  3SDZ A;  4TSS A;  2QGQ A;  1IZ6 A;  1Y1V H;  1U4L A;  3S1M H;  4DR5 Q;  3OMC A;  2B63 H;  2F0D A;  2E5L Q;  2NVX H;  4PMW A;  4QB4 A;  1CSQ A;  4H7B A;  3EFX D;  4IJL A;  1EY9 A;  1G6Z A;  5EJW A;  2R61 A;  2BE5 D;  1YI2 A;  4OO1 I;  5C4X B;  4QQB X;  1BNZ A;  1G51 A;  1FL0 A;  3AQQ A;  4JC0 A;  3MXG A;  4KJO A;  2XNA C;  1JOK A;  4ZQ3 A;  1EU4 A;  1KDB A;  1TS3 A;  1WCM G;  4DR4 Q;  1EFI D;  1F9S A;  1TT2 A;  1V1P B;  3GTQ H;  2E2J H;  4K8I A;  1TY0 A;  1STA A;  1VQ6 A;  1PZK D;  2Q2I A;  3S2D B;  3S16 H;  3T4A C;  2ZTC A;  1YIJ A;  2QEX A;  3FEW X;  1WJJ A;  4DR3 L;  2Q8R E;  1K0S A;  1TWA H;  4K0K Q;  4A3C H;  2A6E C;  2SOB A;  2TSS A;  2PO4 A;  1KRS A;  2DJG C;  2YU9 H;  4ZCK A;  2O5J C;  3M7N A;  2K5W A;  4IUT A;  1JB7 A;  1IYU A;  5EBC A;  2K5Q A;  2TMP A;  3K57 A;  3SXH A;  1F9Q A;  1HUN A;  4Y52 H;  3H09 A;  3UE1 A;  1PRT B;  1N36 Q;  1KLU D;  1G29 1;  1NCV A;  4DAY B;  1CI3 M;  4X62 L;  1SXT A;  3CCL A;  5GAG C;  4AYB G;  3KFU A;  2UXD L;  4K2L A;  2MPM A;  5BN4 A;  4ILW A;  3E6Z X;  1D1K A;  3NUC A;  3HOZ H;  1K83 H;  5CC4 A;  3DM3 A;  1O80 A;  1FGU A;  3D6W A;  4ZRZ A;  4DUY Q;  1CTM A;  3MEF A;  1MJC A;  1Z7T A;  1H9M A;  1E24 A;  1DJR D;  1AN8 A;  4L5S A;  1H9K A;  5CV6 A;  5D3D A;  3M85 A;  3NEL A;  3KDF B;  5JAV A;  3I4M H;  3URY A;  4GLV B;  1R9T H;  2JA7 B;  2Z9H A;  4PMC A;  1KNA A;  5M5Y H;  4XXE A;  4JPB W;  2MUY A;  4F87 A;  2C5C A;  3OW2 A;  3M4Q A;  5CV4 A;  2R6G A;  3ZYY X;  3VR4 A;  5CV8 A;  3TP5 A;  1YZ6 A;  1LTI D;  1DM0 B;  2HHH Q;  5D3I B;  5IT9 E;  3QB3 A;  1WD1 A;  4HED A;  1XYI A;  2OEO A;  2CVR A;  1JJG A;  5C4H A;  1K8M A;  1Z9F A;  4IZ8 A;  4B3M L;  4QUC A;  1SND A;  4JI4 Q;  4C3J H;  5C4X G;  1A2U A;  3SK5 A;  2VNU D;  4ABN A;  2NB0 A;  3PQI A;  4LF6 L;  3HKZ G;  1RHP A;  2VW9 A;  4DR3 Q;  1WTP A;  4K0K L;  1MSH A;  3NWT A;  1YVC A;  1GUG A;  1M4V A;  3QR8 A;  2EYP A;  4K6D A;  2B2V A;  2PW7 A;  3GV3 A;  1RL2 A;  2F3W A;  3JAM c;  4KN4 C;  2K04 A;  1IXR A;  1AP0 A;  3VR2 A;  2DJF C;  4P2C B;  5C5L A;  3RN2 A;  1UE6 A;  5IT9 L;  3V05 A;  3F2U A;  3F2D A;  1PFM A;  2E2I H;  5C4J B;  3NEN A;  5IIF A;  4HSV A;  3PIO A;  4X62 Q;  2HCC A;  2BOS A;  3FP9 A;  3TZU A;  4QIW E;  4J1M A;  3C46 A;  1H95 A;  4JVZ A;  5IP7 H;  1EL0 A;  2RF4 A;  5CYU A;  2WKC A;  4I7Z C;  2UXB Q;  2NVY B;  2VB3 X;  2UUB L;  1U0L A;  2XVS A;  3AU7 A;  2BA1 A;  1GKH A;  4IOC A;  1CK1 A;  4JI6 Q;  3M4Y A;  4ZKB B;  1QVF A;  3H0G B;  3NQT A;  5JPM C;  3C1E A;  4A3G H;  1I94 Q;  3P20 A;  1X3E A;  4JI0 Q;  3AFP A;  4JI7 L;  1ML0 D;  4IFD G;  4Q5V A;  3CKI B;  1VQG A;  4ME5 A;  4LF5 Q;  2ID0 A;  5C5M A;  1JE4 A;  3S17 B;  1SE2 A;  4POF A;  1DYQ A;  3A5Z B;  4JI0 L;  3CF5 A;  1OXT A;  3S2H B;  4LFC L;  4KY7 A;  4JOI A;  4DN4 M;  3L0O A;  3NEM A;  3UDX A;  4KHP L;  2L11 A;  4K2K A;  3RD4 A;  3BZK A;  4TKO B;  1WVL A;  4IUQ A;  5KYI A;  1SRU A;  2VUM B;  2EXZ A;  1KC8 C;  3RZO H;  2NVQ B;  1EFW A;  1HQR D;  5J39 A;  4LFB Q;  2UUA Q;  4IUU A;  4B3S L;  2F0N A;  3WOE A;  2EYJ A;  2B2W A;  1VQO A;  2N8N A;  4RGO S;  1WTV A;  4DNI A;  1IYJ B;  2Z4H A;  2PQE A;  1NUC A;  1G2T A;  2RHS B;  4Y7N B;  3S1Q H;  2JA5 G;  1VF7 A;  1NE3 A;  4L5T A;  4DU9 A;  3K81 C;  3H0G H;  4NKL A;  1VQN A;  1ONL A;  1EY8 A;  3BDO A;  2D2C C;  3JAM E;  1HR0 Q;  1B50 A;  3PUW A;  4CJ1 B;  4DV7 Q;  4O42 A;  1LTG D;  1HR0 W;  4BS9 A;  1V8Q A;  4YCU A;  5C3W A;  4DR6 Q;  4A3L G;  1EIG A;  2EDG A;  1GXD C;  1XNR L;  2HT1 A;  3ERO A;  1E7Z A;  2CWP A;  2QW7 A;  3VA7 A;  2RCN A;  2UUB Q;  4QF4 A;  3K7A B;  3RLO A;  4FF3 A;  2A6H D;  3RLF A;  2WV6 D;  4C3H G;  4POG A;  1F2L A;  3PO3 B;  1GO3 E;  1HNZ L;  1MGS A;  1H9R A;  4IUN A;  2N78 A;  1PH7 A;  1G6P A;  2R7Z G;  1A3U A;  3QO2 A;  1EYG A;  4FVM A;  1C7Y A;  1BOS A;  2JK8 A;  4NP5 A;  3DMU A;  1R4P B;  4R4C A;  1K8O A;  2IX0 A;  2CW0 D;  2GVA A;  2KVM A;  4QJF A;  3LWE A;  1ZYR C;  3H3V C;  1Q81 C;  4H13 C;  3EIV A;  1STN A;  1N33 L;  2ZTD A;  4KN7 C;  1BCP B;  4FXK C;  2B2U C;  2HQE A;  2IT1 A;  1WCM H;  3OHX C;  2V1C C;  4JV5 L;  1OXV A;  5CGK A;  3H3V H;  4A3M H;  4ZUI A;  3TSS A;  1TWG H;  1CKN B;  3LNN A;  1ASZ A;  4KD4 A;  4UP7 A;  3MXN B;  1D5X C;  3K0Y A;  1UE1 A;  4XT1 B;  5IWA Q;  5IGG A;  4DR2 L;  2Z6B A;  4QL5 A;  3FMC A;  3G6J B;  1JMC A;  2M2L A;  1DOM A;  4K8J A;  4N8X 1;  2NZ1 D;  3K5N A;  1WYD A;  2A73 B;  2NZO A;  5FJ8 G;  3BS1 A;  1I4H A;  4AH6 A;  5COR A;  4KHV A;  1LT4 D;  3MC0 B;  4MN3 A;  5C0X I;  5AJ3 L;  1S5B D;  2EZV A;  3CU7 A;  3MXU A;  4JI2 L;  1H9S A;  1LT3 D;  1Z6H A;  2BDO A;  2N55 A;  2K5D A;  2K75 A;  4PZ7 A;  5AJ3 Q;  3J7A F;  3PUY A;  1VQH A;  2EOT A;  4J15 A;  2NVY H;  1W6J A;  1ZYR D;  2PYK A;  4RCO A;  1PYS B;  2C35 B;  1G8Z D;  1K0R A;  1MJE A;  2OQK A;  3AFQ A;  2D5D A;  1CHP D;  2YTX A;  2QKI C;  1GD7 A;  1SYD A;  3GO5 A;  2JN4 A;  3BJU A;  3C3L A;  3HOV G;  1SYF A;  4AYB E;  2JE6 I;  2CH4 A;  2F0G A;  5LHY 1;  4XQN A;  2E75 C;  3PIP 3;  1SE3 A;  2ZM6 L;  4JG2 A;  2B29 A;  1Q8K A;  2AUK A;  2WB1 E;  2YTV A;  4YHH L;  2PZU A;  1FD7 D;  3BDL A;  2E74 C;  5E7N A;  4FF2 A;  4R4T A;  3PO3 G;  3JC6 6;  2A5H A;  3CD6 A;  4YHH Q;  4V0B A;  2RDF A;  2JA8 B;  3DUZ A;  3CCJ A;  4BXX H;  3T16 A;  1K73 C;  5GAD C;  1C48 A;  1OXU A;  3GTK B;  1S4Z A;  2AUJ D;  4LWC A;  5C4X H;  1RCV D;  4IPH A;  1PFN A;  5JJK A;  2K5N A;  1HZC A;  4PZ6 A;  5M5W H;  1A3V A;  1FNV A;  1PTO D;  3OWF A;  4YIJ A;  1K9M C;  3R93 A;  4A76 A;  4ALP A;  3K6O A;  5KYL A;  5ELE A;  2K5V A;  1QZG A;  1I4X A;  4JI3 Q;  3IFD A;  4IFD J;  1HNX L;  1TKW B;  1PZI D;  2ENB A;  3A8K E;  5M5X H;  5IYB H;  1DXM A;  1SJH D;  1P16 A;  2HIV A;  5JEA G;  4HIO A;  2KEE A;  3HOX G;  1VQ4 A;  4HMI A;  2ZXP A;  3PF5 A;  2J7Z A;  2B2T C;  5E4W C;  4GN5 A;  3FPP A;  3VYU A;  1EUJ A;  2VY3 A;  2FIN B;  5L37 A;  3EA6 A;  4BWG B;  2LY7 A;  2UU9 L;  1QUQ A;  2Z6K C;  3HOZ B;  1B4O A;  3I72 A;  1AFP A;  5LMN W;  2YV5 A;  2EYM A;  1XPR A;  4HJ5 A;  2IHF A;  2GN5 A;  3NBH A;  2EYL A;  1C0A A;  2JA5 B;  4C3I B;  4LF7 L;  3SHL A;  3NTK A;  2OQ0 A;  4CJ2 C;  3K0X A;  1VQ5 A;  2E2D C;  4DV3 L;  3SR1 A;  3T1Y Q;  1RDP D;  4OXP A;  1HQM C;  3E0J A;  3D4W A;  4AYB B;  3CW2 C;  1Q12 A;  3BYT B;  1KL9 A;  1ILQ A;  2XWB B;  1PRT C;  2EE1 A;  4JCV E;  1JOR A;  2E2H H;  1T5X D;  4EQN A;  1SJE D;  1SMY D;  3M7G A;  2SEB D;  1KQS A;  1SRO A;  4K5V A;  4KKS A;  2OF1 A;  1U9R A;  3PSI A;  3KUP A;  3LGJ A;  1KXL A;  1ROD A;  3HS0 C;  4KD3 A;  3UE0 A;  1C9O A;  4BY7 G;  5DM6 3;  1I4Q A;  4XT3 B;  1TQO A;  1H9S B;  3U58 A;  1LTB D;  4Z9C B;  5E4X A;  4X3S A;  3VA5 A;  3DHQ A;  4PZ8 A;  5IE8 A;  1I50 B;  5IYD H;  1KDC A;  5LL6 S;  4G4K A;  5K36 G;  2QCP X;  1ZXT A;  1WTH A;  2F0K A;  4LJZ C;  4JI1 L;  1O7I A;  2IHE A;  1BQQ T;  2EY6 A;  2FMM A;  5ELN A;  1CQF A;  3HOV H;  2JA5 H;  3GQB A;  1XMO Q;  2IY5 B;  4FXG C;  3I55 A;  5CMD A;  5JPN C;  1NAP A;  1LM0 A;  4ODG A;  3STB C;  4JI4 L;  4A3C G;  3OOC A;  1IKL A;  4BBR H;  5KEE A;  3EQL C;  1ZEQ X;  3MZ5 A;  1HFG A;  3T1H L;  4FYD A;  4IUR A;  5FO9 B;  2VXW A;  2F4I A;  3S16 B;  2DY8 A;  4LFA Q;  4DUY L;  3J81 j;  5IGB A;  1V9P A;  3I4N G;  1KNE A;  3J80 L;  4CGY B;  1EZ8 A;  4JBW A;  2E2J B;  4P71 A;  3T1Y L;  2IX1 A;  4GLX A;  2WAC A;  5FO7 B;  2B8F A;  4UP8 A;  3T1H Q;  5DEH A;  2K05 A;  4XQJ A;  1X56 A;  4LAA A;  3NPP A;  3KLS A;  4AQY L;  1EQV A;  1JIC A;  4C3J B;  1PLF A;  4MTK A;  1JQY D;  5FLX L;  5JOB A;  4OWW B;  5LMU Q;  1Q7Y C;  2MO0 A;  5KNB A;  5FJ8 H;  4EQ5 A;  3Q24 A;  1VQP A;  3V96 A;  3HOY G;  1PDQ A;  2MQH A;  1AEX A;  3PGZ A;  4B08 A;  2QF7 A;  1STE A;  5LMU L;  1GUS A;  3BU2 A;  2EJF C;  4R8I A;  4IFD H;  2JA7 H;  2G5D A;  4R4O A;  4XTC S;  5EKL A;  2LSS A;  4XQQ A;  5LMN Q;  2PQA B;  4XYQ A;  1U4R A;  2PNH A;  2F0V A;  4LMQ D;  1XJV A;  3HOZ G;  2AMC B;  4P75 A;  1ZKO A;  3FKI G;  3T13 A;  1PH5 A;  3CRL C;  1I6H B;  2WB1 G;  1M1K C;  1Y8O B;  3OIQ A;  2OCE A;  1HH2 P;  2E2H B;  3TP6 A;  2AQ3 B;  1O78 A;  4L8J A;  3J7Y W;  4CKE A;  1DOL A;  3QWN A;  4X66 L;  1PH6 A;  3I4N H;  1EEI D;  2I5H A;  2GVB A;  1HJP A;  3GP7 A;  3CCE A;  1EQQ A;  1N8R C;  1X3Q A;  2ICI A;  2K4K A;  1YNN C;  2A19 A;  4R4I A;  2Q2T A;  2F52 A;  1F2M A;  1SEB D;  2Q2H A;  2JEA I;  2NN6 I;  2XGT A;  3CHB D;  2LXJ A;  2L1B A;  1V1O A;  2JA9 A;  1HZ9 A;  5KIX A;  4YY3 L;  2VQF L;  4LF8 L;  2JA6 G;  5EPJ A;  4NPS A;  2RBM A;  2YU9 B;  3ULL A;  2O2L D;  4DR1 L;  1SAP A;  3GTM B;  4YCV A;  2JXM B;  3S15 B;  4G7O C;  2ATW A;  1U4P A;  1D1I A;  2EIF A;  1SFO H;  3QJY A;  1N34 Q;  3VR5 A;  1SFO B;  2BH2 A;  1HUM A;  2WP8 J;  3BZC A;  2PCF B;  3FHW A;  2K14 A;  1K8A C;  2CQO A;  3O13 A;  4F88 A;  5IYB G;  4RKB A;  2KQ3 A;  3L2P A;  2EVB A;  1HTL D;  3A7L A;  1YJN A;  4MHE A;  5ELB A;  2H5X A;  1HHV A;  1I94 L;  1D6E C;  5EKI A;  4DA2 A;  1ESF A;  2F0M A;  4DV6 Q;  4XDX A;  1GUT A;  3IKJ A;  5ELO A;  2BDN A;  5ISR A;  2EJG C;  2NYZ D;  2F0W A;  1BR9 A;  5C44 B;  4HCS A;  3ND8 A;  4B3S Q;  1UWV A;  3D3R A;  4MZ9 A;  5IOD A;  3S1M B;  1I4P A;  3F1Z A;  2I0Q A;  2MO1 A;  1BKB A;  2QIL A;  1EIF A;  3PO3 H;  5KNC A;  5GAH C;  3HZX A;  2XRQ D;  4KHZ A;  1QCB D;  2H4O A;  2N88 A;  1EY0 A;  4IO9 A;  3KOJ A;  1ESR A;  4LFB L;  1QOH A;  1X65 A;  2UUA L;  1Y69 U;  2WKD A;  5C3X A;  2OXP A;  3OWE B;  3RLN A;  1TVX A;  4DV2 Q;  3KBG A;  2NWG A;  2Z1C A;  4X3U A;  1E2V A;  4CDE C;  1J6Q A;  3C1F A;  1NR4 A;  1LTL A;  2K28 A;  4KV6 A;  3R2I A;  2CQA A;  2M00 A;  1Y1W B;  4YWM A;  2RCF A;  4RHR A;  1DZ1 A;  3AEV A;  4R4Q A;  4C3H H;  2AWN A;  1SE4 A;  5HGQ A;  1F2Y A;  2VS1 A;  4HR7 B;  4C1N K;  4JYA Q;  3CCR A;  1HNZ Q;  4A3M G;  4XYO A;  5EKK A;  4HJ8 A;  3KLW A;  3S1N H;  4H02 A;  1KIX A;  1RTN A;  4KLK A;  3BDC A;  1SBB B;  1PZJ D;  1B9M A;  1SYB A;  3E3X A;  4ZAI A;  1LYL A;  3FKI B;  1S5F D;  3Q6S A;  2F3V A;  2NVQ H;  1CZG A;  2DGY A;  2BCO A;  1C4Q A;  3OTO L;  3TQY A;  1K28 A;  2F0T A;  1GUN A;  1SMY C;  5D14 A;  1PV4 A;  5E3F A;  4OX9 Q;  4R1J A;  1QIL A;  1YHQ A;  5CV7 A;  1STY A;  1XTD A;  3VYS A;  1M90 C;  1JCK B;  2HQL A;  4LF9 L;  2EYH A;  3GTP H;  3A54 A;  2NN6 H;  5IGE A;  4DXG A;  1JB3 A;  3S9W A;  4X64 Q;  4DUZ Q;  1QG7 A;  2WII B;  3S1N B;  4H0L C;  4WJ4 A;  5K36 H;  1UE7 A;  3D4D A;  1NBW A;  3HOX H;  1EIY B;  3KLR A;  3QIA A;  4DV4 L;  5C44 H;  2UUC L;  2R7Z H;  1B9N A;  1WTW A;  2AWO A;  2B2T A;  2ALY B;  1SNM A;  2EY5 A;  1EYA A;  2F4V Q;  1RTO A;  4BY1 B;  1HFN A;  3MEH A;  1Y1W H;  3HOU G;  3M4O B;  4CDF C;  3SK8 A;  1QZH A;  5M3M G;  4P72 A;  1Y1V G;  4FDB A;  1A15 A;  2RQX A;  5M3F H;  4BBS H;  2Y0S G;  3HEJ A;  2B63 B;  4A3D H;  1YIT A;  1Q46 A;  4KI0 A;  3W1G A;  2R92 G;  2A68 D;  5M5Y B;  5J3B A;  5C4Z A;  1XTC D;  1I3Q H;  3UDG A;  3DXJ C;  1ICW A;  2A8V A;  1KHI A;  5A35 A;  4BBR G;  1KD1 C;  2PMZ E;  5DLQ E;  1JWM D;  2CCZ A;  2KHS A;  1I6V C;  3NQI A;  4NXN Q;  1GUW A;  4U67 3;  3K8A A;  2CH4 W;  1MD2 D;  2SDF A;  1VQ8 A;  2IWH A;  1D2B A;  1Y1W G;  3LWU A;  4QGU A;  1MSG A;  4CHT B;  2UXC L;  4MNO A;  4K5X A;  4X3T A;  4DNT B;  4J6H A;  2VZA A;  2JP1 A;  1TWC H;  3PO2 B;  1PRT D;  4N9T A;  2D0O A;  1IBK L;  3MTS A;  3TP7 A;  4IAL A;  2J4X A;  4C56 C;  1LTR D;  2L4N A;  2JA7 G;  2ZM6 Q;  4DV3 Q;  2RA4 A;  2F3I A;  2B3G A;  3HOW B;  3RZO B;  1CSP A;  4NMZ A;  1OXS C;  4S3S A;  1EWC A;  2VUM G;  1E22 A;  4RG1 A;  4LF9 Q;  1BDO A;  1VQA A;  1PVO A;  3OIP A;  4FF4 A;  3GTG H;  5IT9 c;  2KUM A;  3FPU B;  3I4M B;  4N9P A;  2XSC A;  4A75 A;  2KEN A;  3NSW A;  4L5Q A;  3U9O A;  1IL8 A;  1PH3 A;  5IYC H;  3S15 H;  3R2T A;  1JT8 A;  5IP7 G;  1IHZ A;  3FVQ A;  4IQZ A;  2G9H D;  1EY4 A;  3A74 A;  4GN4 B;  4J8Q A;  1BCP F;  3A0J A;  2HDM A;  3HOY H;  4A3I B;  1V1Q A;  1FNU A;  1K83 B;  2F4V L;  2P5Z X;  2DNC A;  3WDN A;  3AB9 A;  4HJ7 A;  4A3B H;  3GD7 A;  2HIX A;  1RD9 D;  3G4S A;  1OXX K;  1U4M A;  4GN3 B;  1CUK A;  3IFT A;  4GNX B;  1PA6 A;  1MKH A;  2OTJ A;  3G48 A;  1MHW C;  4LF7 Q;  1TWH H;  1ICF B;  5BN5 A;  4DKA C;  1J5E L;  1L0X B;  4DV5 Q;  1Y1V B;  2KCT A;  1Y8P B;  2B2U A;  1SNO A;  2BA0 A;  3CAM A;  1WTR A;  2E2I B;  1PH2 A;  3KF6 B;  2JEB I;  4DV5 L;  4O2D A;  3P75 A;  1PH4 A;  1PTO C;  5I9P A;  1JOQ A;  5IYD G;  4M1U B;  3ITP A;  3I90 A;  4LK1 C;  4BBR B;  2IPK D;  2AHO B;  2I07 B;  1S72 A;  5IGF A;  1L1O B;  5E1F A;  5G3L F;  4YWK A;  1D5M C;  1B7Y B;  1Z47 A;  1SYC A;  5FLM G;  4DNR B;  3H94 A;  3UI2 A;  1EY6 A;  2PI2 A;  4RAU C;  1HA6 A;  4YWL A;  2PMZ B;  1X9N A;  3IAY A;  3FDT A;  4RH6 A;  4BY1 G;  5HGT A;  4BBS B;  5C6A A;  1NY4 A;  4APV A;  5HY6 A;  1E2W A;  1X54 A;  2C9O A;  2ZXR A;  1BUV T;  1VQJ A;  4A3E G;  1XMQ Q;  5FOB B;  2RVL A;  4IUP A;  4JI7 Q;  4AQY Q;  5GAE C;  1EIH A;  2R92 B;  4JI8 L;  1ASY A;  2D0P A;  2F1M A;  4B3R L;  2HD3 A;  3MXN A;  4C2M H;  4RWS C;  2F03 A;  2XIW A;  3OYY A;  3GTJ H;  3T56 B;  3RUZ A;  2VQE L;  1S5D D;  1HPC A;  4JI8 Q;  1GOZ A;  1ILP A;  4KY6 A;  2RSN A;  1S5C D;  2QDB A;  4A3K G;  4U68 A;  4DK6 C;  2IJ0 A;  5C3E G;  2A69 D;  1TR5 A;  1GJX A;  3F2C A;  1Q3L A;  1BBW A;  3SVM A;  3A8I E;  2F0P A;  3BVG A;  1VQ7 A;  1PH8 A;  1SR3 A;  2HDL A;  1WOC A;  2G9D A;  5LMN L;  1EU3 A;  1QJO A;  1HNW Q;  2B2W C;  1HXY D;  1NTG A;  4FO2 A;  1WCM B;  1FVI A;  1MBY A;  1WI5 A;  1YNN D;  1OTC A;  3IL8 A;  3RN5 A;  3BYY B;  1JJ2 A;  4ZUJ A;  5NUC A;  1EOT A;  1EY5 A;  1XMO L;  1XPO A;  2Q8I B;  4OIK A;  2K52 A;  4JW0 A;  4IPC A;  3EN2 A;  5EQ0 A;  2DY7 A;  3NBI A;  3VYR A;  5M3M B;  4JI5 Q;  4JOI C;  1PFB A;  4A3F B;  1ET6 A;  2N49 A;  2K33 A;  4QY7 A;  2MHV A;  1S3O A;  3SGI A;  4DR1 Q;  4A3B B;  2UXB L;  1LTA D;  1N36 L;  1N9W A;  5M3F G;  3W1B A;  4JI5 L;  3SK4 A;  3K59 A;  2KBN A;  1N34 L;  3R3O A;  5JJI A;  4NW2 A;  2I5M X;  4ZYS A;  1KTK A;  5JJZ A;  3MFY A;  3K5O A;  2A69 C;  4IPG A;  1A3T A;  3G71 A;  1PHJ A;  3E5S A;  1TS4 A;  4DV1 L;  2R3Z A;  1VQ9 A;  1RJT A;  5IY0 A;  1XMQ L;  4JI6 L;  4HJA A;  3D8G A;  4M8A A;  4LFC Q;  3HOW H;  3BVM A;  3I73 A;  1NNX A;  2X6L A;  1EOV A;  3OW7 A;  3GTL B;  4DV1 Q;  5EPL A;  4BBS G;  2K5H A;  4A93 G;  2KA7 A;  1TII D;  3Q0A A;  1CQV A;  3JAM i;  4DR7 L;  3ONA B;  4DK1 A;  4HID A;  3ZJY C;  3PUZ A;  4G7Z C;  1UAP A;  1TS5 A;  1WTO A;  2NVX B;  5JVG 3;  1TU2 B;  2D62 A;  2RDG A;  3CCS A;  2JA8 H;  3S14 H;  2HHH L;  3HOX B;  2DNE A;  4R9W A;  2CHB D;  3ERQ A;  2B2V C;  2K50 A;  1PYB A;  2NTT A;  3HG9 A;  1UUP A;  3TEH B;  4B9W A;  2KCC A;  2CW0 C;  3DLL A;  3STB D;  3WOF A;  1BF4 A;  4OEL B;  1DCZ A;  1TY2 A;  1EY7 A;  1PRT F;  3DWA A;  2Y0S E;  3CQZ H;  1C8C A;  1VS0 A;  5BR8 Q;  3HFZ B;  1Q90 A;  4MTN A;  3HKS A;  2IW3 A;  2B39 A;  4K14 A;  4QIW B;  1VMP A;  4HAE A;  3D31 A;  5GRO A;  1CT1 D;  1E2Z A;  3DWQ A;  3U4V A;  1EWI A;  1UEA B;  3CCM A;  4A3L H;  3J81 i;  1F9R A;  2FXQ A;  4OHJ A;  2WAQ B;  1CA5 A;  1GM5 A;  3FRP B;  2D9U A;  3HP3 A;  3PV0 A;  1MIU A;  2F0Q A;  5LL6 X;  1E1T A;  1VQK A;  1I5F A;  3J81 E;  1QUQ B;  1D5Z C;  4DXF A;  3SK6 A;  4JBJ A;  2VB2 X;  2A74 C;  1SYG A;  3BVZ A;  1FR3 A;  1JE5 A;  2EQS A;  3EJI A;  4OO1 H;  4ZKC B;  4A3B G;  3RZD B;  2K6A A;  3P7J A;  4LW1 A;  1NR2 A;  3UDI A;  1XWE A;  4HSP A;  3A7A B;  4HCE A;  4OX9 L;  1B53 A;  3GTP B;  2Q8T A;  1EEF D;  2A6H C;  2JA8 G;  2JA6 H;  3N6R A;  4A4I A;  2LS0 1;  4BA2 I;  1AE2 A;  4IOA A;  5TSS A;  1OO9 B;  1RIP A;  1VQC A;  4ULL A;  2YYZ A;  3DEO A;  1DD2 A;  2B8G A;  5JEA J;  4FP5 D;  5C44 G;  3V2T A;  4C3I G;  1VQI A;  1A8V A;  1HCZ A;  1BBU A;  1EYC A;  2EY1 A;  5AFW A;  2K03 A;  2R93 B;  4KHP Q;  4C1N I;  1AE3 A;  1E0B A;  1UNS A;  3TZD A;  3B6Y A;  1PFS A;  4RGM A;  4A3F G;  2Z6K A;  1X6O A;  1YHA A;  4KKT A;  1TWC B;  4WJW A;  2OT2 A;  4HN7 A;  3WWV A;  3ULP A;  3NTH A;  5EAY A;  3DM1 A;  3X3M A;  2R92 H;  4DUZ L;  4GKK Q;  2R7D A;  1B70 B;  3ER0 A;  3G6E A;  4JV5 Q;  1HNX Q;  3ERS X;  5FLX c;  4UDU C;  5JJL A;  3CMA A;  3KJO A;  4JYA L;  2LMC B;  1SSO A;  1S40 A;  3KYH C;  4DV2 L;  4GZY C;  1T9H A;  1BBX C;  4KMU C;  1SE8 A;  5A2Q E;  4DR2 Q;  5FLM H;  2PZW A;  1BO0 A;  1WFQ A;  1SYE A;  2QDL A;  3K7A H;  4K5W A;  4DK3 C;  2F0H A;  1I3Q B;  3AYH B;  3J7Z C;  5C4J H;  5I6Y A;  1X55 A;  4K6L A;  2AKW B;  4RGT A;  2RDH A;  5C0X H;  4NB3 A;  1M8A A;  1V1P A;  3SEB A;  3TS2 A;  1II3 A;  4WJ3 M;  4DR6 L;  4LUZ A;  4RGN A;  1E3P A;  2KHJ A;  1QVC A;  1VF5 C;  1KAW A;  4KY5 A;  5DNF A;  3U9S A;  2UXC Q;  4PV1 C;  5FLX E;  2DN8 A;  3CP0 A;  2CFM A;  1XX8 A;  4BY1 H;  1STB A;  4KK7 A;  1YHB A;  5A2Q L;  2WIN B;  2KEC A;  1LTT D;  1S5E D;  3GV6 A;  3R8B A;  3A55 A;  5J22 A;  1XXG A;  4RHS A;  2FHT A;  5COY A;  2H1E A;  1CFM A;  3TBI B;  4GOP C;  4Q0F A;  4PQX A;  2PQA A;  4BY7 B;  3U4Z A;  2MFI A;  3W3A A;  3UDF A;  2R93 H;  3GDE A;  3I2Z A;  4DAY A;  2ZJR A;  1HZA A;  4ZK9 B;  3VYT A;  3G7L A;  1R9T B;  3S1R B;  3D0F A;  5JVH 3;  1B8A A;  1O7Z A;  4A3I H;  1EQT A;  4LF4 L;  4ZLT F;  2QEJ C;  2NBF A;  4A3E H;  5DM7 3;  3F8T A;  3IRB A;  4DR4 L;  1AW7 A;  5I4D A;  2JYO A;  2E5L L;  3VR6 A;  3J80 i;  3RZD H;  5IWA L;  2FJ2 A;  3TP8 A;  3TN2 A;  4C2M B;  2OTL A;  1F77 A;  4JI1 Q;  1LAB A;  1NMF A;  4JI3 L;  4Y7N H;  3S1Q B;  3J80 c;  5M3M H;  1L0Y B;  1IBM L;  1IW7 C;  2F0O A;  4JBK A;  5M9O A;  2F0U A;  4B9X A;  2FFK B;  3I7F A;  4BY7 H;  1U5K A;  5I2Y A;  3PIP A;  4RFB A;  2Z8L A;  3I4N B;  3NK9 A;  2L55 A;  4CDC C;  4X65 Q;  5CBE E;  2EJM A;  1D8L A;  1A2T A;  1WTQ A;  5IYC G;  4CJ0 B;  2E76 C;  2K7V A;  1W2B A;  2RKS A;  1O7L A;  4LUO A;  1JR0 D;  2B2Y C;  4PMB A;  1IBM Q;  1LUZ A;  1D7Q A;  4TVA B;  1IBL L;  4RA8 A;  3D6C A;  4FNF A;  1JWU D;  4L63 B;  1BVS A;  3DEP A;  1TS2 A;  1X3P A;  3MVV A;  2MP1 A;  2Z4I A;  5KND A;  4OON A;  4I65 A;  1IBL Q;  3QOJ A;  1ENC A;  3RMH A;  2JSO A;  2WAQ G;  2WFW A;  3I3C A;  4I7A A;  1LT5 D;  2NTS A;  3L3O C;  1IKM A;  3A8J E;  1K3B C;  1Q82 C;  3MXP A;  2VL6 A;  3W5O A;  3HOV B;  1EYD A;  1FJG Q;  5C3E H;  2ZXO A;  1TWH B;  2EPB A;  3X3N A;  4E6I A;  1XNQ L;  5T1I A;  2KJX A;  3EVQ A;  4DR5 L;  3I91 A;  4R8N A;  3K7U C;  4OO1 G;  3J81 L;  1I4R A;  4KTA A;  1I50 H;  2R7Z B;  1EWH A;  1L1O C;  3MA2 B;  4RMF A;  1CKN A;  1X3F A;  2X69 A;  1DOK A;  3Q8D A;  1F9P A;  1LTS D;  4CKB A;  3M3Y B;  3CCU A;  1EQR A;  1PTO B;  1CHQ D;  3NHH A;  5ELD A;  1TWF B;  4A3K B;  2LXK A;  2NZH A;  3NTI A;  4BA1 I;  5I2X A;  2F0L A;  2KCM A;  4B3T L;  2RHQ B;  3E9I A;  4DAV A;  3VDY A;  2X6G A;  2VQE Q;  4RCN A;  4FXD A;  3RR5 A;  4DV0 L;  4OGQ C;  1AH9 A;  5FK9 C;  4B3T Q;  3CC2 A;  3TDQ A;  4DGZ A;  2JA6 B;  3QG1 A;  3QOL A;  1N32 L;  4GNX C;  1FNW A;  3KBX A;  3TRZ A;  1DON A;  2JJQ A;  4WOR A;  3BZD B;  1CKM A;  1HNW L;  1AZP A;  4DV0 Q;  4IJH A;  5FO8 B;  2UU9 Q;  1J5E Q;  5CV9 A;  1B1Z A;  1Q8I A;  4LF6 Q;  4OWX B;  3CPF A;  1Q1E A;  2HUG A;  4RKL A;  4UAI A;  2VQF Q;  1LO5 D;  2OWO A;  4LF8 Q;  3PMF A;  5H1S E;  1BCP D;  5JEA H;  4EGV A;  1K3R A;  1NSN S;  1SLJ A;  5CBA E;  1Q1B A;  5IGD A;  1PTO F;  1BXT A;  1SN8 A;  4CKC A;  5BN3 A;  1X32 A;  1L0W A;  4A3G G;  1I6H H;  1RKN A;  4F7X A;  2ES2 A;  4LFA L;  1PH1 A;  2MGS A;  4B3R Q;  3C2P A;  3Q23 A; 
#chains in the Genus database with same CATH homology
 2SNM A;  1PYW D;  4H44 C;  5F2D A;  4IFD I;  1CA6 A;  4A3E B;  3KF8 A;  3GTG B;  1TWG B;  3OPO A;  1KAA A;  1F2Z A;  1LV9 A;  2FMC A;  2ZT9 C;  5CV5 A;  2NUC A;  2K1B A;  2AQ1 B;  4L6T B;  1GUO A;  1O7Y A;  2Y0S B;  1QB5 D;  1R4Q B;  3S14 B;  4CBV A;  1BCP C;  3ND9 A;  1J9O A;  3P1H A;  3MAQ A;  4OIJ A;  1PXU A;  4WFN 3;  1B44 D;  4EQP A;  5K5P A;  4TQU S;  1STG A;  4KKU A;  2XRS D;  4WRD A;  2GA4 B;  1LAC A;  3A56 A;  2AQ2 B;  3H91 A;  1TWA B;  4HTH A;  3OSO A;  2O5I C;  4KJN A;  1B2T A;  1AZQ A;  1G2S A;  4FF1 A;  2KED A;  5M5X B;  1H9J A;  1VCI A;  4G57 A;  2LFN A;  3K58 A;  3AMU A;  4A3D B;  1JOO A;  2F0S A;  5M3F B;  5FKA C;  2A6E D;  1HRJ A;  3PIO 3;  1KAB A;  2F0J A;  5DAU A;  5IGC A;  4DF7 A;  3CRK C;  3I4L A;  5C0X J;  2PW5 A;  3NP8 A;  5C0X G;  3W2D A;  3KLS X;  1QNK A;  3GTO B;  4C3H B;  1SNQ A;  1RF2 D;  4EQO A;  2BE5 C;  5EBD A;  1SNP A;  1YNJ D;  4A3J B;  4A93 B;  3NXW A;  3I70 A;  1VDZ A;  4G7H C;  3SE0 A;  4IUV A;  3HGB A;  2IL8 A;  2IX3 A;  2V4D A;  1ENF A;  3HOU B;  2F0F A;  4QMG A;  2I46 A;  1JC7 A;  1LT6 D;  1CM9 A;  5D65 A;  2PNR C;  4QUF A;  1ET9 A;  2EYF A;  1YNJ C;  5J1Z A;  3DWP A;  4A3G B;  2EYO A;  4HMJ A;  2LKV A;  5I6W A;  3NE5 B;  3L9A X;  2K01 A;  1W6K A;  1G91 A;  3Q22 A;  2J0T D;  1J8I A;  2XWJ B;  2PZT A;  4DK0 A;  3OMG A;  1JWS D;  4NDX A;  3H6M A;  2EY2 A;  5ELC A;  3T53 B;  5I9O A;  2L5T A;  1CZW A;  4DAP A;  2NVT B;  5EPK A;  2KCN A;  1KLG D;  2L12 A;  1SDF A;  2PPB C;  2K32 A;  1V43 A;  1QNU A;  5G3L D;  1LLR D;  5M5W B;  2M9V A;  1FGB D;  2XN9 C;  3PUV A;  4IN3 A;  2L0C A;  1EZ6 A;  3TME A;  4ID6 A;  1QE6 A;  3BG3 A;  1KDA A;  4MIU A;  4C3J G;  3NWS A;  3MWY W;  2HCI A;  3T51 B;  4XIG S;  2B2Y A;  4PNY A;  2NN6 G;  1VMC A;  4JK1 C;  5IOC A;  3J80 E;  3N52 A;  5T1G A;  3HOY B;  3VR3 A;  2RSO A;  3MHB A;  1HTP A;  3KK7 A;  1MI2 A;  1B3A A;  3I8Z A;  1HA5 A;  4X3K A;  1I4G A;  3K5M A;  1SNC A;  3GTJ B;  4DFA A;  5KRU A;  3JAM L;  1STH A;  1IW7 D;  4O1N A;  3PUX A;  2KOL A;  2L9H A;  2O4X A;  4F8M A;  4EVO A;  2WB1 B;  1QWY A;  4V19 0;  3J7A V;  3L7Z C;  2A68 C;  2MJ8 A;  5C3E B;  1PMR A;  1Y8N B;  4QCL A;  1T5E A;  3HRZ C;  2ICE C;  4TRD A;  5CR3 A;  5KGU A;  3K5L A;  1IYV A;  1GHK A;  5HUR A;  3HKZ B;  2SNS A;  3CQZ B;  5EGT A;  5ELF A;  4A3M B;  1FYC A;  2F0I A;  3LX0 A;  1A6X A;  1WTX A;  4OL7 A;  1ENA A;  1WD0 A;  1GHJ A;  3D4R A;  2F0E A;  3GTQ B;  3MFG A;  1PTO H;  3SDZ A;  4TSS A;  1U4L A;  3OMC A;  2F0D A;  4PMW A;  4QB4 A;  4H7B A;  3EFX D;  1EY9 A;  1G6Z A;  5EJW A;  2R61 A;  2BE5 D;  4OO1 I;  5C4X B;  1BNZ A;  3MXG A;  4KJO A;  2XNA C;  1JOK A;  4ZQ3 A;  1EU4 A;  1KDB A;  1TS3 A;  1EFI D;  1F9S A;  1TT2 A;  1V1P B;  4K8I A;  1TY0 A;  1STA A;  1PZK D;  3S2D B;  3T4A C;  3FEW X;  2Q8R E;  2A6E C;  2SOB A;  2TSS A;  2PO4 A;  2O5J C;  3M7N A;  2K5W A;  4IUT A;  1IYU A;  5EBC A;  2K5Q A;  2TMP A;  3K57 A;  3SXH A;  1F9Q A;  1HUN A;  3H09 A;  1PRT B;  1KLU D;  1G29 1;  1NCV A;  1CI3 M;  1SXT A;  4K2L A;  2MPM A;  5BN4 A;  4ILW A;  3E6Z X;  1D1K A;  3NUC A;  5CC4 A;  4ZRZ A;  1O80 A;  3D6W A;  1CTM A;  1Z7T A;  1H9M A;  1DJR D;  1AN8 A;  1H9K A;  5CV6 A;  5D3D A;  3M85 A;  5JAV A;  3URY A;  2JA7 B;  4PMC A;  1KNA A;  4XXE A;  2MUY A;  4F87 A;  2C5C A;  5CV4 A;  2R6G A;  3ZYY X;  3VR4 A;  5CV8 A;  3TP5 A;  1LTI D;  1DM0 B;  5D3I B;  5IT9 E;  3QB3 A;  1WD1 A;  4HED A;  1XYI A;  2OEO A;  2CVR A;  5C4H A;  1K8M A;  4IZ8 A;  4QUC A;  1SND A;  1A2U A;  3SK5 A;  2VNU D;  4ABN A;  2NB0 A;  1RHP A;  1WTP A;  1MSH A;  3NWT A;  1GUG A;  1M4V A;  2EYP A;  4K6D A;  2B2V A;  2PW7 A;  3GV3 A;  2F3W A;  4KN4 C;  2K04 A;  1AP0 A;  3VR2 A;  4P2C B;  5C5L A;  5IT9 L;  3V05 A;  3F2U A;  1PFM A;  5C4J B;  5IIF A;  4HSV A;  2HCC A;  2BOS A;  3TZU A;  4J1M A;  3C46 A;  1EL0 A;  5CYU A;  2WKC A;  4I7Z C;  2NVY B;  2VB3 X;  2XVS A;  3AU7 A;  2BA1 A;  1CK1 A;  3M4Y A;  4ZKB B;  3H0G B;  3NQT A;  5JPM C;  3C1E A;  3P20 A;  4IFD G;  1ML0 D;  4Q5V A;  3CKI B;  4ME5 A;  2ID0 A;  5C5M A;  1JE4 A;  3S17 B;  1SE2 A;  1DYQ A;  1OXT A;  3S2H B;  4KY7 A;  4DN4 M;  2L11 A;  4K2K A;  3RD4 A;  4TKO B;  1WVL A;  4IUQ A;  5KYI A;  2VUM B;  2EXZ A;  2NVQ B;  1HQR D;  5J39 A;  4IUU A;  2F0N A;  3WOE A;  2EYJ A;  2B2W A;  4RGO S;  1WTV A;  2Z4H A;  2PQE A;  1NUC A;  1G2T A;  4Y7N B;  1VF7 A;  4DU9 A;  4NKL A;  1ONL A;  1EY8 A;  3BDO A;  3JAM E;  2D2C C;  1B50 A;  3PUW A;  4CJ1 B;  4O42 A;  1LTG D;  4BS9 A;  1V8Q A;  5C3W A;  1EIG A;  2EDG A;  1GXD C;  3ERO A;  3VA7 A;  4QF4 A;  3K7A B;  4FF3 A;  2A6H D;  3RLF A;  2WV6 D;  4C3H G;  1F2L A;  3PO3 B;  1MGS A;  1H9R A;  4IUN A;  1A3U A;  3QO2 A;  4FVM A;  1BOS A;  4NP5 A;  3DMU A;  1R4P B;  1K8O A;  2IX0 A;  2CW0 D;  2KVM A;  3LWE A;  1ZYR C;  3H3V C;  4H13 C;  1STN A;  4KN7 C;  1BCP B;  4FXK C;  2B2U C;  2HQE A;  2IT1 A;  3OHX C;  1OXV A;  5CGK A;  4ZUI A;  3TSS A;  3LNN A;  4KD4 A;  1D5X C;  3K0Y A;  4XT1 B;  5IGG A;  3FMC A;  3G6J B;  2M2L A;  1DOM A;  4K8J A;  2NZ1 D;  3K5N A;  2A73 B;  3BS1 A;  1I4H A;  5COR A;  4KHV A;  1LT4 D;  3MC0 B;  4MN3 A;  5C0X I;  1S5B D;  2EZV A;  3CU7 A;  3MXU A;  1H9S A;  1LT3 D;  1Z6H A;  2BDO A;  2N55 A;  2K5D A;  3J7A F;  3PUY A;  2EOT A;  1W6J A;  1ZYR D;  2PYK A;  4RCO A;  1G8Z D;  2D5D A;  1CHP D;  2QKI C;  1SYD A;  3GO5 A;  3C3L A;  1SYF A;  2JE6 I;  2F0G A;  5LHY 1;  4XQN A;  2E75 C;  3PIP 3;  1SE3 A;  2AUK A;  2PZU A;  1FD7 D;  3BDL A;  2E74 C;  4FF2 A;  2A5H A;  4V0B A;  2RDF A;  2JA8 B;  3DUZ A;  3T16 A;  1C48 A;  1OXU A;  3GTK B;  1S4Z A;  2AUJ D;  1RCV D;  1PFN A;  1A3V A;  1FNV A;  1PTO D;  3OWF A;  4YIJ A;  3R93 A;  3K6O A;  5KYL A;  5ELE A;  1I4X A;  3IFD A;  4IFD J;  1TKW B;  1PZI D;  2ENB A;  3A8K E;  1DXM A;  1SJH D;  5JEA G;  2KEE A;  4HMI A;  2ZXP A;  2J7Z A;  2B2T C;  5E4W C;  3FPP A;  3VYU A;  2FIN B;  3EA6 A;  4BWG B;  2LY7 A;  3HOZ B;  1B4O A;  3I72 A;  1AFP A;  2EYM A;  3NBH A;  2EYL A;  2JA5 B;  4C3I B;  3SHL A;  3NTK A;  4CJ2 C;  2E2D C;  3SR1 A;  1RDP D;  1HQM C;  3E0J A;  3D4W A;  4AYB B;  1Q12 A;  3BYT B;  1ILQ A;  2XWB B;  1PRT C;  2EE1 A;  1JOR A;  1T5X D;  4EQN A;  1SJE D;  1SMY D;  3M7G A;  2SEB D;  4K5V A;  4KKS A;  2OF1 A;  1U9R A;  3KUP A;  1ROD A;  3HS0 C;  4KD3 A;  5DM6 3;  1I4Q A;  4XT3 B;  1TQO A;  1H9S B;  1LTB D;  4Z9C B;  5E4X A;  4X3S A;  3VA5 A;  3DHQ A;  1I50 B;  1KDC A;  5LL6 S;  4G4K A;  5K36 G;  2QCP X;  1ZXT A;  2F0K A;  4LJZ C;  1BQQ T;  2EY6 A;  2FMM A;  1CQF A;  3GQB A;  4FXG C;  5CMD A;  5JPN C;  1NAP A;  4ODG A;  3OOC A;  1IKL A;  5KEE A;  3EQL C;  1ZEQ X;  3MZ5 A;  1HFG A;  4FYD A;  4IUR A;  5FO9 B;  2VXW A;  2F4I A;  3S16 B;  2DY8 A;  5IGB A;  3J80 L;  1KNE A;  4CGY B;  1EZ8 A;  4JBW A;  2E2J B;  2IX1 A;  2WAC A;  5FO7 B;  2B8F A;  5DEH A;  2K05 A;  4XQJ A;  4LAA A;  3NPP A;  3KLS A;  1EQV A;  1JIC A;  4C3J B;  1PLF A;  1JQY D;  5FLX L;  5JOB A;  5KNB A;  3Q24 A;  3V96 A;  1PDQ A;  1AEX A;  4B08 A;  2QF7 A;  1STE A;  1GUS A;  2EJF C;  4R8I A;  4IFD H;  4XTC S;  5EKL A;  4XQQ A;  4XYQ A;  1U4R A;  2F0V A;  4LMQ D;  1ZKO A;  3T13 A;  3CRL C;  1I6H B;  1Y8O B;  3OIQ A;  2E2H B;  3TP6 A;  2AQ3 B;  1O78 A;  4L8J A;  3J7Y W;  4CKE A;  1DOL A;  3QWN A;  1EEI D;  3GP7 A;  1X3Q A;  2ICI A;  1YNN C;  1F2M A;  1SEB D;  2JEA I;  2NN6 I;  3CHB D;  2L1B A;  1V1O A;  5KIX A;  5EPJ A;  2RBM A;  2YU9 B;  2O2L D;  1SAP A;  3GTM B;  2JXM B;  3S15 B;  4G7O C;  1U4P A;  1D1I A;  3QJY A;  3VR5 A;  1SFO B;  1HUM A;  2WP8 J;  2PCF B;  3O13 A;  4F88 A;  4RKB A;  2KQ3 A;  2EVB A;  1HTL D;  3A7L A;  4MHE A;  5ELB A;  1HHV A;  1D6E C;  5EKI A;  4DA2 A;  1ESF A;  2F0M A;  4XDX A;  1GUT A;  3IKJ A;  2BDN A;  5ISR A;  2EJG C;  2NYZ D;  2F0W A;  1BR9 A;  5C44 B;  4HCS A;  3ND8 A;  3D3R A;  5IOD A;  3S1M B;  1I4P A;  2QIL A;  5KNC A;  3HZX A;  2XRQ D;  4KHZ A;  1QCB D;  2H4O A;  2N88 A;  1EY0 A;  1ESR A;  1QOH A;  1Y69 U;  2WKD A;  5C3X A;  2OXP A;  3OWE B;  1TVX A;  3KBG A;  2NWG A;  2Z1C A;  4X3U A;  1E2V A;  3C1F A;  1NR4 A;  2K28 A;  4KV6 A;  3R2I A;  2CQA A;  1Y1W B;  2M00 A;  4RHR A;  1DZ1 A;  2AWN A;  1SE4 A;  1F2Y A;  4HR7 B;  4C1N K;  4XYO A;  5EKK A;  1RTN A;  3BDC A;  1SBB B;  1PZJ D;  1B9M A;  1SYB A;  4ZAI A;  3FKI B;  1S5F D;  3Q6S A;  2F3V A;  1CZG A;  2BCO A;  1C4Q A;  2F0T A;  1GUN A;  1SMY C;  5D14 A;  5E3F A;  1QIL A;  5CV7 A;  1STY A;  3VYS A;  1JCK B;  2EYH A;  3A54 A;  2NN6 H;  5IGE A;  4DXG A;  1JB3 A;  3S9W A;  1QG7 A;  2WII B;  3S1N B;  4H0L C;  5K36 H;  3D4D A;  3KLR A;  3QIA A;  1WTW A;  1B9N A;  2AWO A;  2B2T A;  1SNM A;  2EY5 A;  1EYA A;  1RTO A;  4BY1 B;  1HFN A;  3MEH A;  3M4O B;  3SK8 A;  1A15 A;  2RQX A;  2B63 B;  3HEJ A;  4KI0 A;  5M5Y B;  2A68 D;  5C4Z A;  1XTC D;  3DXJ C;  1ICW A;  5A35 A;  1JWM D;  2KHS A;  1I6V C;  3NQI A;  1GUW A;  4U67 3;  2SDF A;  1MD2 D;  2IWH A;  1D2B A;  3LWU A;  1MSG A;  4CHT B;  4K5X A;  4X3T A;  4DNT B;  4J6H A;  2JP1 A;  3PO2 B;  1PRT D;  4N9T A;  3MTS A;  3TP7 A;  4IAL A;  2J4X A;  4C56 C;  1LTR D;  2L4N A;  2RA4 A;  3HOW B;  3RZO B;  4NMZ A;  1OXS C;  4S3S A;  1EWC A;  1BDO A;  3OIP A;  4FF4 A;  2KUM A;  3FPU B;  3I4M B;  4N9P A;  2XSC A;  3NSW A;  3U9O A;  1IL8 A;  3R2T A;  1IHZ A;  3FVQ A;  4IQZ A;  2G9H D;  1EY4 A;  4J8Q A;  1BCP F;  2HDM A;  4A3I B;  1FNU A;  1K83 B;  2DNC A;  3WDN A;  3AB9 A;  3GD7 A;  1RD9 D;  1OXX K;  1U4M A;  3IFT A;  5BN5 A;  1L0X B;  1Y1V B;  1Y8P B;  2B2U A;  1SNO A;  2BA0 A;  1WTR A;  2E2I B;  2JEB I;  3P75 A;  1PTO C;  5I9P A;  1JOQ A;  4M1U B;  3ITP A;  3I90 A;  4LK1 C;  4BBR B;  2IPK D;  2I07 B;  5IGF A;  5E1F A;  5G3L F;  1D5M C;  1Z47 A;  1SYC A;  4DNR B;  3H94 A;  3UI2 A;  1EY6 A;  4RAU C;  1HA6 A;  2PMZ B;  3IAY A;  3FDT A;  4RH6 A;  5HGT A;  4BBS B;  5C6A A;  1E2W A;  2C9O A;  2ZXR A;  1BUV T;  5FOB B;  2RVL A;  4IUP A;  1EIH A;  2R92 B;  2F1M A;  3MXN A;  4RWS C;  2F03 A;  2XIW A;  3T56 B;  3RUZ A;  1S5D D;  1HPC A;  1GOZ A;  1ILP A;  4KY6 A;  2RSN A;  1S5C D;  2QDB A;  4U68 A;  2IJ0 A;  2A69 D;  1TR5 A;  1GJX A;  1Q3L A;  3SVM A;  3A8I E;  2F0P A;  3BVG A;  2HDL A;  2G9D A;  1EU3 A;  1QJO A;  2B2W C;  1HXY D;  4FO2 A;  1WCM B;  1MBY A;  1YNN D;  3IL8 A;  3BYY B;  4ZUJ A;  5NUC A;  1EOT A;  1EY5 A;  2Q8I B;  4OIK A;  5EQ0 A;  2DY7 A;  3NBI A;  3VYR A;  5M3M B;  1PFB A;  4A3F B;  1ET6 A;  2K33 A;  2MHV A;  4A3B B;  1LTA D;  3SK4 A;  3K59 A;  3R3O A;  4NW2 A;  4ZYS A;  1KTK A;  5JJZ A;  3MFY A;  3K5O A;  2A69 C;  1A3T A;  3E5S A;  1TS4 A;  2R3Z A;  1RJT A;  3D8G A;  4M8A A;  3BVM A;  3I73 A;  2X6L A;  3GTL B;  3OW7 A;  5EPL A;  2KA7 A;  1TII D;  3Q0A A;  1CQV A;  3ONA B;  4DK1 A;  3PUZ A;  4G7Z C;  1UAP A;  1TS5 A;  1WTO A;  2NVX B;  5JVG 3;  1TU2 B;  2D62 A;  2RDG A;  3HOX B;  2DNE A;  4R9W A;  2CHB D;  3ERQ A;  2B2V C;  2NTT A;  3HG9 A;  1UUP A;  4B9W A;  2KCC A;  2CW0 C;  3WOF A;  1BF4 A;  1DCZ A;  1TY2 A;  1EY7 A;  1PRT F;  3DWA A;  1C8C A;  1Q90 A;  2IW3 A;  2B39 A;  4K14 A;  4QIW B;  1VMP A;  4HAE A;  3D31 A;  1CT1 D;  1E2Z A;  3DWQ A;  1UEA B;  1F9R A;  4OHJ A;  2WAQ B;  1CA5 A;  3FRP B;  2D9U A;  3HP3 A;  3PV0 A;  2F0Q A;  5LL6 X;  3J81 E;  1D5Z C;  4DXF A;  3SK6 A;  2VB2 X;  2A74 C;  1SYG A;  3BVZ A;  1FR3 A;  3EJI A;  4OO1 H;  4ZKC B;  3RZD B;  2K6A A;  3P7J A;  1NR2 A;  1XWE A;  4HSP A;  3A7A B;  4HCE A;  1B53 A;  3GTP B;  2Q8T A;  1EEF D;  2A6H C;  3N6R A;  2LS0 1;  4BA2 I;  5TSS A;  1OO9 B;  4ULL A;  2YYZ A;  3DEO A;  1DD2 A;  2B8G A;  5JEA J;  4FP5 D;  3V2T A;  4C3I G;  1HCZ A;  1EYC A;  2EY1 A;  5AFW A;  2K03 A;  2R93 B;  4C1N I;  1E0B A;  1UNS A;  3TZD A;  4RGM A;  4KKT A;  1TWC B;  4WJW A;  2OT2 A;  4HN7 A;  3NTH A;  3DM1 A;  3X3M A;  4UDU C;  2LMC B;  1SSO A;  4GZY C;  1BBX C;  4KMU C;  5A2Q E;  2PZW A;  1BO0 A;  1SYE A;  4K5W A;  2F0H A;  1I3Q B;  5I6Y A;  4K6L A;  4RGT A;  2RDH A;  5C0X H;  1M8A A;  1V1P A;  3SEB A;  1II3 A;  4RGN A;  1VF5 C;  4KY5 A;  5DNF A;  3U9S A;  4PV1 C;  5FLX E;  2DN8 A;  1XX8 A;  1STB A;  4KK7 A;  5A2Q L;  2WIN B;  2KEC A;  1LTT D;  1S5E D;  3GV6 A;  3R8B A;  3A55 A;  5J22 A;  1XXG A;  4RHS A;  2FHT A;  5COY A;  2H1E A;  1CFM A;  3TBI B;  4Q0F A;  4PQX A;  4BY7 B;  3W3A A;  4DAY A;  4ZK9 B;  3VYT A;  3G7L A;  1R9T B;  3S1R B;  5JVH 3;  1O7Z A;  1EQT A;  4ZLT F;  2QEJ C;  2NBF A;  5DM7 3;  1AW7 A;  5I4D A;  2JYO A;  3VR6 A;  2FJ2 A;  3TP8 A;  3TN2 A;  4C2M B;  1F77 A;  1LAB A;  3S1Q B;  1L0Y B;  1IW7 C;  2F0O A;  5M9O A;  2F0U A;  4B9X A;  2FFK B;  5I2Y A;  4RFB A;  2Z8L A;  3I4N B;  3NK9 A;  2L55 A;  5CBE E;  2EJM A;  1A2T A;  1WTQ A;  4CJ0 B;  2E76 C;  2K7V A;  2RKS A;  1O7L A;  1JR0 D;  2B2Y C;  4PMB A;  4RA8 A;  3D6C A;  4FNF A;  1JWU D;  4L63 B;  3DEP A;  1TS2 A;  1X3P A;  3MVV A;  2MP1 A;  2Z4I A;  5KND A;  4I65 A;  3QOJ A;  1ENC A;  3RMH A;  2JSO A;  3I3C A;  1LT5 D;  2NTS A;  3L3O C;  1IKM A;  3A8J E;  3MXP A;  3HOV B;  1EYD A;  2ZXO A;  1TWH B;  2EPB A;  3X3N A;  4E6I A;  5T1I A;  2KJX A;  3EVQ A;  3I91 A;  4R8N A;  4OO1 G;  3J81 L;  1I4R A;  4KTA A;  2R7Z B;  1EWH A;  3MA2 B;  2X69 A;  1DOK A;  1F9P A;  1LTS D;  4CKB A;  3M3Y B;  1PTO B;  1CHQ D;  3NHH A;  5ELD A;  1TWF B;  4A3K B;  3NTI A;  4BA1 I;  5I2X A;  2F0L A;  4DAV A;  2X6G A;  4RCN A;  4FXD A;  4OGQ C;  5FK9 C;  3TDQ A;  4DGZ A;  2JA6 B;  3QG1 A;  3QOL A;  1FNW A;  3KBX A;  1DON A;  4WOR A;  3BZD B;  1AZP A;  5FO8 B;  5CV9 A;  1B1Z A;  1Q8I A;  1Q1E A;  2HUG A;  4RKL A;  4UAI A;  1LO5 D;  3PMF A;  1BCP D;  5JEA H;  4EGV A;  1NSN S;  5CBA E;  1Q1B A;  5IGD A;  1PTO F;  1BXT A;  4CKC A;  5BN3 A;  1X32 A;  1RKN A;  4F7X A;  2MGS A;  3C2P A;  3Q23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...