5IGBA

Crystal structure of staphylococcal nuclease variant delta+phs l36d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igbA00
1A3UA 1SNMA 5CV4A 2EY6A 1SNQA 4K2KA 4RKBA 5CV9A 3TP5A 4KD3A 4DU9A 5I9OA 1IHZA 5IGDA 4HMJA 5I6WA 4LAAA 2PZUA 5IGEA 4NP5A 1JORA 4K5XA 3D4DA 3T16A 2HQEA 1STGA 3NQTA 1JOKA 5KYIA 1SYEA 4NMZA 1KDAA 4PMCA 5NUCA 1KAAA 3TP7A 3MEHA 5EKKA 3E5SA 3D6CA 3DMUA 3EJIA 4K8IA 1STAA 3OMCA 4IZ8A 2F0GA 2F0NA 5JOBA 1SYBA 3BDLA 5I9PA 4OL7A 5J39A 4R8NA 4ZUJA 2PZWA 2F0LA 2F0UA 2F0WA 3NK9A 3HZXA 3SK5A 3TP6A 4TRDA 2SNMA 1EYDA 1SYDA 1ENAA 4KD4A 4EQPA 3P1HA 2F0DA 2PZTA 5C5LA 4KY5A 4N9PA 3C1FA 4YIJA 1EYCA 4QB4A 5EGTA 1SYFA 3NXWA 3EROA 2EYPA 2RDFA 1F2ZA 4NKLA 2SNSA 1A3VA 3BDCA 5J1ZA 4J6HA 4J1MA 2F0TA 5CV7A 1TR5A 3DHQA 1SNPA 3MZ5A 3P75A 4KHVA 4DF7A 2LKVA 5ISRA 2F0MA 2OF1A 4B9XA 1JOQA 1A2UA 2F0SA 1EQVA 4ME5A 3OMGA 2PW7A 4ZQ3A 2KQ3A 4G57A 5IGBA 5K5PA 3NP8A 5C3WA 1KDBA 3SK8A 3QB3A 4ZUIA 4MIUA 3ITPA 1EZ8A 1EY9A 3V2TA 5CV6A 5C6AA 1AEXA 4HTHA 2EXZA 4WORA 2F0IA 3D4WA 3NUCA 1EY5A 1EYAA 3R3OA 4KV6A 4NDXA 3QOJA 4K8JA 2EYJA 4EVOA 1EZ6A 4F8MA 5HGTA 3LX0A 1SNOA 4IUNA 5KGUA 1EY6A 2F0OA 2SOBA 4HMIA 4KY6A 1II3A 1NUCA 2OXPA 2RBMA 1STNA 3QOLA 4KY7A 3SK6A 1A2TA 2OEOA 1SYGA 2PYKA 5DEHA 2F3VA 3TMEA 2EYFA 5C4ZA 4EQNA 3C1EA 1KDCA 4K5WA 2NUCA 2WACA 1EY8A 5C5MA 3ERQA 4EQOA 5J22A 1RKNA 2EY1A 5IOCA 1STBA 3MXPA 4PMBA 5KRUA 2ENBA 2EY2A 3SXHA 2EYMA 1EY0A 2M00A 3D8GA 5CV8A 5E3FA 4DGZA 4E6IA 3TP8A 5M9OA 1NSNS 2PW5A 3MHBA 5IODA 4N9TA 3MVVA 3VA5A 4ODGA 4ID6A 5C4HA 3EVQA 5CV5A 4KJOA 5F2DA 3H6MA 5I6YA 1SNDA 1SYCA 2F3WA 4QMGA 5JAVA 2PQEA 3S9WA 1KABA 2F0VA 4PNYA 5CC4A 5IGFA 2EYHA 2F0KA 4I65A 5CGKA 4KJNA 2KHSA 3NHHA 3RUZA 3OWFA 4F7XA 1JOOA 5IGCA 2F0FA 3PMFA 4B9WA 2EY5A 5KYLA 5CR3A 1A3TA 1ENCA 3T13A 1F2MA 1F2YA 2EYOA 3SHLA 4K14A 3SK4A 3U9OA 2F0JA 4DFAA 2F0EA 3HEJA 4QF4A 5KEEA 2O4XA 4WRDA 1STHA 4RKLA 5KIXA 2RKSA 2F0HA 4S3SA 1SNCA 4K5VA 1TT2A 5IIFA 1EY4A 3SR1A 5DAUA 4H7BA 5IGGA 2QDBA 4IALA 5HURA 4K6DA 2F0PA 4KTAA 1TQOA 1STYA 5C3XA 2F0QA 4K2LA 2EYLA 1U9RA 5EKLA 5E1FA 1EY7A 3OSOA
chains in the Genus database with same CATH superfamily
4RKBA 1JORA 4K2KA 1VCIA 3E0JA 4UHVA 5IGEA 1GD7A 1NE3A 1EEFD 1SBBB 2DJFC 4DR2Q 2C9OA 5NUCA 4P75A 1YEZA 2Q8RE 5EKKA 1ONLA 5IYDH 3D6CA 1EU3A 1ZYRD 2ZJQA 2VQEQ 4R8NA 4C3JH 1Y69U 2F0LA 2F0UA 4OELB 3STBC 2JSOA 1G51A 1L1OA 1FNVA 2BDOA 1VQNA 3VYRA 1S5FD 2EJFC 5C0XJ 2XRSD 4J15A 2OTLA 3ERSX 4P2CB 3HOUH 4NKLA 2SNSA 1PZKD 1BR9A 4BBRG 4DR1L 1H9RA 4J1MA 5ISRA 3M7GA 4Y7NB 2JA6H 2F0MA 2A69C 1V1QA 4BBRH 5K5PA 3G4SA 4DR7Q 3LNNA 3OHXC 2R93H 1MGSA 4QL5A 3J80c 2JA8B 3PQIA 4JBMA 3GV6A 2WV6D 3R3OA 2XTIA 2WB1G 4DV1L 3P20A 2SOBA 1B3AA 2LS01 2RBMA 1BBWA 5E7NA 4B3ML 1VMPA 1A2TA 4H44C 3TBIB 4OGQC 3Q22A 5M3FB 2ES2A 2RDHA 3ULPA 1CK1A 1DZ1A 1EY8A 3PSIA 3ERQA 3I2ZA 5J22A 1RKNA 5A35A 2EYMA 3OW7A 2JA7B 1G2SA 5IODA 4C56C 2A6HD 1ILPA 3HG9A 2IPKD 1SMXA 3F2UA 4LK1C 3GTGH 4OO1I 3C3LA 2E76C 1GM5A 5LHY1 1PZID 3H0GG 5M3FH 4R4TA 1JC7A 5CR3A 2I5HA 4A93B 1ESRA 4PMWA 2ZTCA 4YWMA 1HZAA 1CQFA 1B9MA 1VQIA 2F0HA 4XQQA 2NTSA 2QA4A 3MA2B 3CCLA 4ZAIA 4QGUA 4OWWB 2UU9Q 3BJUA 1VQAA 4JI2Q 2YTYA 4A3JG 1A63A 3OSOA 4A3FG 1LM0A 4FF4A 1PTOD 1HH2P 4DV5Q 4HJ7A 1VF7A 3T16A 2ID0A 1PH6A 4JK1C 4FF2A 2R6GA 3HGBA 2MJ8A 4A3MB 5M3MH 5C4XB 4A3GG 1VQLA 3NK9A 4CJ2C 1QZHA 1CZGA 4YWKA 4A3IH 3PUVA 2E2JB 1SYDA 1FYCA 3OIQA 5K36H 2AUJD 2F0DA 1E3PA 1CKNA 4GLAC 3I4NG 1LTSD 3M4OH 2NZ1D 3BDCA 1OXXK 4J6HA 3L3OC 3OW2A 2KA7A 4MTNA 1XMQL 5FJ8G 1HHVA 2IY5B 3RZOB 2CWAA 1CM9A 1KDBA 3TREA 3I55A 3MAQA 1BO0A 2K5NA 4GNXC 1B2TA 3A55A 3ICEA 3ITPA 3V2TA 3K7AB 2N8NA 1LACA 1GHJA 1V9PA 1X9NA 1I4XA 2BA1A 2K4KA 1MJEA 1QWYA 5HGTA 2NVXH 1HZ9A 1AE2A 3EIVA 1DJRD 1K83B 2ALYB 4JI6L 2Q2UA 2R92H 4C3HH 4A3JB 4GOPA 1I6HB 4GN5A 2PNHA 5C5MA 4EQOA 3HOYG 2IHFA 3VYSA 3D6WA 2B2UC 5E3FA 2MO0A 1KQSA 5M5XH 3VA5A 3EVQA 3KLSX 2JE6I 2A6ED 1B1ZA 2M2LA 4DV3L 3EN2A 4IPHA 3K59A 1D1KA 1K28A 4RGMA 1WCMG 4IFDI 1G291 4IJLA 2PI2A 3DUZA 4QQBX 2VW9A 2CQAA 3BVGA 3KK7A 1K9MC 3G48A 4G7HC 4A93G 4S3SA 3I4LA 3RLFA 5C0XG 4RCOA 5HURA 1VQEA 5C3XA 2Z6KC 1XNQL 1U9RA 2LXJA 4DN4M 1EQQA 3S24A 3J81L 3IFTA 4O1NA 4HIDA 2ZM6Q 3G71A 1WTRA 3K5LA 2D9UA 4R1JA 4K5XA 4EX5A 2DY8A 3R93A 2JA8H 2YTVA 4WFN3 1FGBD 1Z6HA 3CXCA 5CYUA 1XMOQ 1TWCH 4NXNL 3FPPA 3GTMH 3HS0C 2EZVA 4KKTA 4OWXB 4CKBA 1PRTC 4DV6L 1HNZL 1E2WA 2PZWA 2UUCQ 2AQ1B 1LUZA 1BDOA 2ICIA 5COYA 1HUMA 4EQ5A 1V1PA 4POGA 1K0SA 1B4OA 3A8IE 2IW3A 2F4IA 3C1FA 3J81j 2JA8G 1IL8A 5JVG3 4N8X1 3S2DB 5I4DA 5JPMC 3VR3A 4F88A 3P75A 3DHQA 1SNPA 2KOLA 1LT5D 2D5DA 3E6ZX 1UUPA 4ME5A 1VQ7A 1JB3A 4HIMA 2K5WA 2MQHA 4ZLTF 4A3CH 4PQXA 3NP8A 1KIXA 3S17B 3IFDA 1UEBA 5IP9G 1X32A 4DV4Q 3HOUB 1PYBA 1EY5A 3I4MB 2I5LX 1EQRA 3CAMA 4DV7Q 4LMQD 3WOEA 5IP9H 3DWAA 4CKCA 3DEPA 1ZXTA 1DOKA 2OEOA 3TMEA 1WD0A 4BY1B 2FMCA 2F52A 1ZYRC 2Z9HA 1V8QA 2CW0D 1QCBD 4IQZA 4FYDA 1KTKA 2EY1A 2VB2X 3KF6A 4HR7B 1UE5A 2K5QA 2ZM6L 2ZJRA 3JAML 4XIGS 5JVH3 2V1CC 3BZKA 3R2IA 5ELEA 4X64Q 4KKUA 3J80E 3SEBA 5M3MB 1PFBA 3NBIA 2K52A 5IGCA 5KYLA 1XXGA 1QNUA 2E2JH 4A3DG 1DXMA 4B08A 3HEJA 2BH8A 4AQYQ 3CHBD 2QCPX 5C3EH 2XWBB 3CRLC 2QDLA 1W6JA 2BE5D 5IP7G 1WTQA 4A3BB 1QUQA 3KJPA 5DAUA 2K75A 1B44D 4GOPB 3FDTA 1JICA 1STEA 1XTCD 2B63G 2CKZB 1S5CD 5C44G 5ELNA 3A8JE 1RF2D 4A3EB 1IHZA 4B3SL 5D3DA 4NP5A 1GJXA 1IYVA 3K7AH 1SYEA 2VQFQ 1KDAA 3I90A 1J5EL 3TRZA 2JYOA 4C3HB 1TWAH 3W3AA 4OO1H 2KHJA 2F0GA 1DD2A 1VDZA 2A1AA 4YCUA 2A6EC 2CHBD 2QW7A 4X64L 5FO8B 3AMUA 4LF9L 2NVQH 4U673 5FLXc 1EQTA 1Q90A 2KCTA 2JA5H 1FNWA 1NR4A 4N9PA 4HCEA 3ZJYC 1SRUA 1EFID 1VS0A 5JEAG 3UDGA 1Z9FA 1PFNA 3L9AX 5BR8L 3D31A 3OYYA 4LFCL 1X3GA 4YWLA 1K8GA 3T4AC 4IFDG 3J7AF 4G57A 3ND9A 1M90C 5C3WA 4CDDC 4HSVA 3GTJH 4UP7A 4XQNA 2BH2A 2NVQB 1BBXC 2XN9C 3BZDB 1M1KC 5LMNQ 2OCEA 4XXEA 1PRTF 4R4CA 4KY6A 5AJ3Q 4R4QA 2XGTA 4YCVA 1ET9A 1UAPA 1HCZA 2NVTB 1SFOH 2R7ZH 5C4ZA 4IFDH 4EQNA 1HNWL 1PMRA 3S1RB 3HOVB 5KNCA 3C2PA 3AQQA 2O5JC 2QKIC 4G7ZC 2KUMA 2ZXPA 5DLQE 2KJXA 2I46A 3F2BA 5DNFA 2LY7A 3MHBA 4DV6Q 4ODGA 1VMCA 4O42A 4IO9A 2EYHA 4RMFA 2EOTA 3RUZA 4F7XA 1SFOB 1IYJB 2R7ZB 4EGVA 3U58A 1U4LA 4K0KL 3HOVG 1SAPA 5LMNL 4H7BA 3J7ZC 4IPCA 3FPUB 4X3TA 1STYA 2NN6G 2B8GA 1PA6A 3KF6B 3RZDB 1EY7A 5CV4A 1QVFA 1SNQA 1D5XC 5I9OA 2FINB 2K50A 1SE4A 2GA4B 3OWEB 4X65L 3A8KE 3OOCA 1BF4A 4BY1H 1JOKA 1G6ZA 1YNND 4PMCA 3CCJA 1Q82C 1PH5A 2NB0A 1IBLL 4KHPL 2R7FA 4IUPA 4JI8L 3K80C 3WOFA 5CBEE 1I4GA 4HJ5A 1YIJA 4NXML 1ASZA 2R93G 2PQAA 3KLWA 4KK7A 4TRDA 4TKOB 4KMUC 1Q3LA 1K8AC 1KNAA 2AKWB 1E22A 2PZTA 2WINB 1SXTA 1EEID 4GLVB 1QG7A 4YIJA 5EBCA 2EJGC 3J81i 4KI0A 3FRPB 3I3CA 1H9MA 1O80A 2E74C 2O2LD 2MGSA 2A6HC 3D0FA 4RHSA 5EQ0A 1W3SA 1Q12A 2R7DA 4L5QA 2PW7A 4HN7A 4ZQ3A 4LW1A 4NW2A 3CPFA 1Y8PB 4IURA 2R92B 1TU2B 4WORA 4PZ8A 2C5CA 1NJIC 4NDXA 1PFMA 2N55A 3A7AB 2DY7A 1XPUA 2KEDA 1HNZQ 4UAIA 2OT2A 4H13C 1WD1A 2D62A 1PTOH 3NE5B 5M5YH 3ULLA 3ONAB 4QCLA 1NTGA 2X6GA 3PO3G 4C1NK 2I5MX 4E6IA 1RD9D 5LMUL 3S14H 2B2VA 3TP8A 3VR2A 2RSNA 2F1MA 1GXDC 1VQ4A 4BBSB 3GTPB 2N88A 4PG3A 3BVZA 4DNIA 2NN6I 5JAVA 1KABA 3NBHB 4XT1B 3NEMA 4I65A 5EBDA 3RMHA 3HOZH 1BVSA 3K8AA 4X66L 1I50H 4LFBQ 3EBEA 1NMGA 4DV5L 1DCZA 2BOSA 3CCMA 3S16H 2O4XA 3IL8A 5FLMH 2NVYB 4A75A 2E8GA 1D6EC 1EY4A 1PFSA 4DUZQ 1EWHA 3HOYB 1XNRL 1VQDA 4QIWE 2ZXOA 3R2TA 1QJOA 2CH4A 4ILWA 4ALPA 5JOBA 3JAMi 3HKZB 3UDFA 3S1QH 1PDQA 5M5WB 5HGQA 1I50B 2FMMA 1SLJA 1PHJA 2OQ0A 3K0XA 5IYBH 1I5FA 4XYOA 2NN6H 2IT1A 1U5KA 1WCMH 3S2DH 2XWJB 1QILA 3TP6A 1KL9A 3T53B 2JN4A 2Z8LA 3S1RH 2IHEA 4CBVA 3HOVH 5EPJA 3AEVA 2K01A 1TWHH 3MWYW 1CQVA 3PF5A 4X62L 1EYCA 1Z7TA 2BDNA 4QB4A 1SYFA 1BCPF 1RTOA 4DNTB 4JBJA 1TS5A 2EYPA 3CC4A 5ELOA 1Y8NB 1SE8A 1F2LA 1P16A 4DF7A 1SMYD 1WTXA 4H02A 1I94Q 4AH6A 2R92G 2ATWA 1AP0A 1YVCA 4TQUS 3HOXG 4IFDJ 1EZ8A 4A3MG 3V05A 4KHZA 1GO3E 3X3NA 2AQ2B 2DGYA 4FP5D 2F0IA 1YJNA 4G7OC 1TWCB 3CQZH 2PQAB 3GTOH 4A3DH 2OWOA 4HMIA 3KDFA 3TS0A 1XWEA 2L5TA 2EYFA 3S15B 4DV3Q 3EQLC 2HCIA 1G8ZD 2A19A 1JCKB 1K3RA 3KJOA 2R93B 1Y14B 3SE0A 5L37A 4DR5Q 4C3IB 2PMZB 4LF5L 5EAYA 5LL6S 4DK1A 1IBLQ 2IX0A 3DWQA 2CFMA 4K6LA 1VQGA 4C3IG 4O0AA 1TS3A 2Z4IA 1SE2A 2LSSA 1LO5D 3A0JA 4B9WA 3SHLA 3MXNA 5ELCA 2EXDA 4YY3Q 2EJMA 2NZHA 3N6RA 2XSCA 4FF3A 1TT2A 5JEAH 4K6DA 2F0PA 4KTAA 1CTMA 2SDFA 3K7UC 2BCOA 3QR8A 1V1PB 4LF7Q 3ZYYX 2AHOB 3U9SA 3CCSA 1OXSC 5A2QE 3URYA 3EJIA 1Q8IA 1STAA 1F9QA 4BA2I 1NCVA 2EE1A 3QJYA 5BR8Q 2JEBI 2OTJA 2A69D 1CKNB 4HIOA 4V0BA 2L1BA 3KOJA 3P1HA 4I7ZC 1LYLA 2E75C 4BBRB 1HR0L 4DR5L 3GTPH 1CZWA 1G91A 3EROA 4QY7A 2R3ZA 1CKMA 4CKEA 2L15A 4JI4Q 3K5MA 3S16B 2LKVA 3KUPA 3DLLA 3W5OA 3OMGA 1Q7YC 1N36L 1PH4A 3F1ZA 4B3TL 1G2TA 3HOZB 3QB3A 2VQFL 4FVMA 4OO1G 4HIKA 3HOYH 5ELDA 3FKIB 3N52A 3ULJA 1EZ6A 2UXDQ 2NVYH 4A3IG 1SEBD 5FKAC 3QOLA 4L8JA 4APVA 1SYGA 1MD2D 3NWTA 1AFPA 1TY2A 1E24A 4DK3C 1CT1D 2WAQG 3RZOH 1GVPA 1H95A 3SXHA 1K3BC 3H0GB 1L0WA 3GTQB 4ZKBB 3NELA 1I6VC 3WDNA 2IJ0A 1AW7A 1PH2A 1IBML 2ZJPA 2UUAQ 3UDXA 1BUVT 2PPBC 4DUYQ 5I6YA 1EUJA 1F9SA 2L0CA 3S9WA 1R9TB 2P5ZX 2F0KA 1O7YA 1N32Q 1GOZA 2EY5A 5C44B 1U0LA 2F0JA 4DV7L 1PYWD 3PO3B 1I6HH 2LMCB 5EJWA 4BBSH 4JI7Q 1EWIA 3KDFB 2RKSA 3FVQA 5M3FG 2MFIA 4K5VA 4DV4L 1K8MA 4A3BG 1HQRD 4QIWB 1Q81C 3DWPA 4PV1C 4IALA 1L0XB 1IBKQ 4RGTA 4OEMB 2VZAA 4RCNA 1E7ZA 4X66Q 3JAMc 3BS1A 1SNMA 2KBNA 2ZXRA 5J3BA 5IGDA 3BG3A 1YI2A 3GP7A 3KLSA 2PZUA 5KNDA 1N36Q 3GTLH 2PI2E 1STGA 2K7VA 3PUZA 4X3SA 4L5TA 4LF4L 2SEBD 2K05A 3HP3A 3QWNA 3DMUA 4YY3L 5C0XI 2R61A 3OMCA 3KF8A 1VQPA 3M7NA 1ICWA 3GD7A 1RTNA 3PO2G 3IKJA 2HCCA 3SK5A 4P74A 2UXBQ 1YJ9A 4OX9L 2AWOA 3CD6A 3TZUA 1YNJC 3GO5A 1T5EA 1MJCA 3S1MB 4FO2A 3GTGB 3I7FA 2Q2HA 3K0YA 4HSPA 1RJTA 4G4KA 1BQQT 2VNUD 2RCFA 2ZT9C 4RH6A 2G5DA 3I4NH 4FNFA 1C9OA 1EOTA 2LFNA 4XDXA 2CW0C 4NXNQ 5FOBB 1HTLD 4JI5L 4UP8A 2YV5A 2JEAI 1TWHB 1S5BD 3AB9A 4C2MH 4A3GH 4BY7B 1E2VA 2QEJC 2G9DA 1Y1WB 2EXZA 3D4RA 1YNJD 3S1MH 5GQOA 2BE5C 3J81c 1FL0A 3Q6SA 2KEEA 1EIHA 4JW0A 1UWVA 4IN3A 3PUXA 5IT9E 3TN2A 3H09A 1I94L 4RFBA 2RF4A 1A6XA 1IZ6A 1L1OB 1PH1A 1SN8A 1P8LA 3GTOB 5CV8A 2MUYA 3RD4A 1QOHA 2FHTA 3CRKC 1UNSA 4DPGA 2CWPA 3NWSA 3PUYA 3BYYB 1M4VA 4DK0A 4X62Q 1HFNA 4L6TB 2GN5A 4FXDA 4KJOA 5C4JH 3NTKA 2WIIB 4CHTB 2Y0SE 2F0VA 5CGKA 3QG1A 3HFZB 4CJ1B 4LF9Q 5I2XA 5G3LD 5KNBA 1ICFB 1NNXA 2MHVA 1YNXA 5KEEA 1STHA 2K14A 1VQCA 3HOWB 3Q23A 1KXLA 4DXFA 3RR5A 1Z47A 5IGGA 1VQFA 5M5YB 4ZRZA 1FGUA 5GAGC 4GOPC 3U50C 1GUWA 1WCMB 3TP5A 1AN8A 2B2TC 5D65A 3PIPA 3L0OA 2NYZD 1LTLA 1TS2A 1WTWA 2M9VA 3LWEA 4ZYSA 4K8IA 2EDGA 4A3JH 2QILA 4JOIA 1U4RA 5I9PA 3H91A 1JR0D 3LWUA 2F4VQ 2E2HH 1XPOA 1Q86C 4QUCA 5M5XB 4BXXH 2SNMA 4XQJA 1HFGA 4JI7L 4UPAA 1ZKOA 5E4WC 4IOCA 1B70B 3H3VI 1LT4D 3H0GH 3SVMA 4DAVA 1PH8A 3TQYA 1F2ZA 2MPMA 5LMUQ 3A5UA 2PNRC 5IE8A 3S1NB 1BCPD 4A76A 4UY8C 3O13A 2K6AA 5IGBA 5EPKA 1TIID 2L9HA 5C6AA 3T51B 3J80L 4K8JA 4DAYB 4FDBA 1KNEA 1QB5D 2UU9L 2B63B 1NUCA 2OXPA 4KN7C 3J80i 4A3CG 3CP0A 5FLXL 3DEOA 4K5WA 4AQYL 2K04A 1TS4A 5IYDG 1LTRD 2ENBA 2EY2A 4AIMA 3IRBA 3J7AV 1MI2A 5FLMG 1EIYB 1O7ZA 4N9TA 1FVIA 4TVAB 1OO9B 2D2CC 4JI6Q 4JI5Q 5CV5A 3QO2A 1V43A 2JA6G 5JJZA 4PNYA 5IGFA 3CKIB 3HKZG 4C3JG 1SSOA 2KHSA 4B3MQ 4A4IA 5I2YA 1B9NA 2YYZA 4ULLA 2KENA 3VYUA 2RVLA 4DFAA 1BOSA 3E9IA 1PH9A 5D14A 4KLKA 1MHWC 4P71A 1WFQA 4BY1G 2ZTEA 4C1NI 3SR1A 1U4PA 4IJHA 5GAEC 2EVBA 3H15A 3QIAA 1ENAA 4KD4A 3T1YL 4R8IA 4OWTB 4ZCKA 2EY6A 4RG1A 4KD3A 3CCRA 3HOUG 3KBXA 1A15A 2KCCA 1WOCA 2Q8TA 2HD3A 1NAPA 1EFWA 3D4DA 2K03A 4OIKA 4BA1I 1T5XD 3CU7A 1Y1VB 1TVXA 4DXGA 4BBSG 2Z6KA 4K0KQ 1HRJA 2JA7G 4LUVA 4X6AH 3CPWA 2HUGA 1ZEQX 2AUKA 4DNRB 1U4MA 1BNZA 1DOMA 3RLNA 5C5LA 2RHQB 3PUWA 3Q0AA 3FEWX 1VQ9A 3CC2A 2WB1E 2JP1A 4MNOA 2K1BA 1GUTA 1S3OA 3G6JB 5J1ZA 2A68C 4JI2L 4DV1Q 2WB1B 4KHPQ 2ASBA 2E2IH 3R8BA 1TWGB 1D2BA 1PTOC 1KAWA 3UDIA 5LMNW 3PO2H 2B2UA 1C4QA 1RODA 2QEXA 4MIUA 4A3BH 5E4XA 2EIFA 1A8VA 2E5LL 3NUCA 3I56A 1I4QA 4IUNA 1SNOA 3BZCA 4LF4Q 4LUOA 5JJKA 4P72A 1STNA 5ELFA 3SK6A 2HHHQ 1K0RA 1PYSB 4DR3L 3HKZE 5BN4A 4JV5Q 2I07B 2RA4A 1HQMC 1TWAB 4GNXA 3S1QB 2WKDA 2QF7A 1G6PA 3T1HL 4DR4L 4FF1A 4DR6Q 3I8ZA 1H9SA 4B3RL 3M3YH 3NBHA 3K5NA 1LV9A 3A74A 2F3WA 2Y0SG 5DM73 1X3FA 1RIPA 4JI4L 4NXMQ 3W1BA 1Q1BA 2JA6B 1X54A 4LUZA 1W2BA 1AZPA 2HDMA 1F2MA 1GKHA 1EIGA 3FKIH 1JMCA 4Y7NH 4OX9Q 2FJ2A 1CA5A 1ILQA 5KIXA 1J8IA 5IIFA 1I3QB 1TWFB 1EL0A 4FXKC 3JAME 1N33Q 1V1OA 4GN4B 1RCVD 3A54A 4H0LC 5JJLA 1VQJA 1YJWA 1A3UA 2K32A 1L1OC 4GS3A 1PRTD 1JE4A 4GN3B 1MBYA 1YZ6A 5IP7H 1VQ5A 1D1IA 3TDQA 2I0QA 1OXUA 2HT1A 3E5SA 3V96A 1IBKL 1YHAA 2CVRA 3C46A 1SYBA 4M8AA 1I3QH 3D3RA 4C2MB 4DUZL 1EYGA 1AE3A 2J7ZA 2TSSA 3STBD 3U4ZA 4DR2L 5IYBG 3S2HB 2RHSB 1JWUD 5IYCH 4JI0Q 2B8FA 2RDFA 1SJED 2A68D 3I4OA 1N34Q 4KHVA 3MZ5A 1IXRA 2OF1A 4PZ6A 1J6QA 1BCPC 3M4QA 1AZQA 2UXCL 2VUMB 1TKWB 2VL6A 2JA9A 4J8QA 1W6KA 2Z6BA 2GVBA 3SK8A 1TY0A 2BA0A 2WFWA 1EY9A 1XPRA 5C3EG 1E1OA 4OIJA 4U68A 3I73A 4EVOA 4CDEC 1D5MC 3U4VA 2Q2TA 2B3GA 3H94A 2B2WC 5FO7B 1SJHD 1X3PA 1S40A 4LFCQ 5C4JB 3OTOQ 5JJIA 2X69A 4OXPA 5KRUA 3K57A 4DGZA 5GROA 1BBUA 4CJ0B 4DK6C 1PVOA 1WTPA 1EIFA 4ID6A 1CI3M 4JPBW 1HA5A 5F2DA 3J7YW 3HOWH 1SNDA 4QMGA 4LFAQ 3TSSA 4ABNA 4R4OA 4YHHQ 1PV4A 3MXNB 4KJNA 2UUCL 5EPLA 3EA6A 3GTKH 3HOWG 1A3TA 1J5EQ 1F2YA 1C7YA 4K14A 4JVZA 1SMYC 1SNCA 4O2DA 1Q8KA 1A62A 4JCVE 1D5ZC 1JJCB 2GVAA 3I91A 3CMAA 1XTDA 1H9JA 2PCFB 1QVCA 4B3RQ 4OONA 2AQ3B 2N49A 1MSGA 1LT6D 4LAAA 2JQOA 1H9SB 1CFMA 3NQTA 5M3MG 1EWCA 5AJ3L 3MEHA 4KN4C 4A3KH 4DAMA 3I72A 2JXMB 1JE5A 1R4QB 1D8LA 4P73A 4ZUJA 2DUDA 2VS1A 2F0WA 1X65A 1B7YB 4QJFA 2H4OA 5FJ8H 4A3FH 3M3YB 4RA8A 3HRZC 1Y1VH 3NXWA 2F3IA 4BY7G 3L7ZC 1B8AA 4N8FA 4AYBE 2NWGA 1A2UA 3RNUA 2B63H 2AMCB 1HJPA 4RAUC 3AYHB 1Y8OB 2VXWA 1AEXA 5JEAJ 4HJ8A 2IL8A 4KV6A 3QOJA 1F77A 3VDYA 1F9RA 1JB7A 5D3IB 3NTIA 2PYKA 1KRTA 4C3IH 2F03A 1DM0B 4LF8Q 4JBKA 3RN5A 3PO2B 1I4PA 5GAHC 1X56A 3E0EA 3C1EA 3HKSA 1KDCA 3E9HA 4C3HG 2FXQA 1MSHA 2NUCA 5BN3A 4V190 5IOCA 2YU9B 3MXPA 2PMZE 1WJJA 1IKMA 1CHPD 3HOXH 2NBFA 4A93H 3CF5A 3VYTA 3T1YQ 4OHJA 2WAQE 4JG2A 3S1NH 5CBAE 4Y52H 3CCEA 2MO1A 3S2HH 1O78A 5CC4A 1KLUD 3VR4A 2A8VA 1IKLA 4CGYB 4LF8L 2F0FA 2NVTH 1FR3A 3WWVA 1FNUA 3M9BA 3GV3A 1HZCA 2DN8A 4A3DB 4JOIC 1HPCA 1J9OA 4XT3B 2L11A 3GDEA 3CQZB 2EYLA 4GKJL 5C4XH 4BXXG 1ENFA 2B2TA 1R9TH 5I6WA 4JC0A 1ESFA 3K6OA 3TEHB 1JWSD 1LTAD 1QVGA 4A3IB 1Q1EA 5KYIA 4NMZA 4LF6L 2J4XA 1WI5A 1FD7D 2KCMA 2WAQB 3FKIG 3PO3H 4X3UA 1X3QA 2ZTDA 1NR2A 1OXVA 4IPDA 1C0AA 2N3SA 1UE7A 3M4OB 3HOZG 3K58A 4DR6L 1BCPB 1IYUA 2K28A 2RDGA 1S5DD 3HZXA 1CA6A 2VUMG 5HY6A 1SR3A 1N9WA 4XTCS 2IX3A 2FFKB 2Z1CA 1EOVA 1PTOF 4RGOS 2H1EA 3I4MG 1N32L 3J81E 2H5XA 3NQIA 2UUBQ 1K8OA 2NZOA 4WJ4A 3M4YA 1YNNC 5CV7A 2F0TA 3RN2A 3NENA 4NPSA 2F0SA 3CCQA 3DXJC 3UE0A 2G9HD 3B6YA 3W1GA 2HQLA 3NSWA 1UE6A 3BDOA 1RHPA 3GTKB 2K5VA 4HJAA 2KCNA 1C48A 2Z0SA 4DV0Q 1NBWA 1KD1C 5LL6X 3LX0A 5KGUA 1EY6A 1NMFA 1HR0W 1KC8C 4R9WA 2V4DA 4KY7A 1XMQQ 2UXBL 5IT9c 4DR7L 4DKAC 3PIP3 3I4NB 2KHIA 1FJGQ 2D0OA 1BKBA 3PV0A 1VQ6A 2EQSA 4DV2L 1RL2A 5EKIA 3MFGA 3SGIA 4BY7H 4A3GB 1NSNS 2PW5A 1DOLA 1S72A 3DM1A 1VQ8A 1SYCA 2D0PA 2XIWA 3OTOL 2E2HB 2JK8A 5M5WH 1DGSA 1K73C 1HR0Q 3OWFA 4IUQA 3F2CA 1JOOA 3A5ZB 3JC66 3PMFA 1PTOB 1UE1A 1HNXQ 4A3FB 1OTCA 1ENCA 1HUNA 3ND8A 1D7QA 4DAPA 4QF4A 2TMPA 1H9KA 4XYQA 1S5ED 1VQKA 4FXGC 3KBGA 1VQHA 1UEAB 2B2VC 3ER0A 4Q5VA 1CHQD 2QDBA 1KHIA 1TQOA 4I7AA 4DR4Q 4JI1Q 3PGZA 4X3KA 3PIO3 3VR5A 4RGNA 4LF5Q 3AU7A 2B2YA 1CSQA 4HMJA 1Q46A 4JBWA 5C3EB 1LLRD 4YHHL 2HQEA 2QGQA 2CCZA 5IY0A 3Q24A 2O5IC 4A3LH 2K5HA 5IWAQ 1L0YB 2XNAC 4IZ8A 3BDLA 2N78A 4GKKQ 3HOXB 1WTHA 1EU4A 3Q8DA 1GUOA 3CCUA 1C8CA 3I70A 4MTKA 1EYDA 5C44H 5FK9C 2MNAA 2UXDL 1ET6A 1MIUA 2VQEL 2WKCA 4JI1L 5IT9L 2A5HA 2VY3A 1JOQA 1LABA 2RQXA 2JA5B 3W2DA 1L2FA 1T9HA 1BXTA 3MFYA 4LF6Q 3KYHC 1S4ZA 3DM3A 4GZYC 4IUUA 4DAYA 1JJGA 5CMDA 1EYAA 1Y1VG 4DUYL 4MN3A 2EYJA 1F9PA 4HCSA 2PO4A 1I4HA 4GKJQ 2IWHA 1X6OA 1E1TA 3BYTB 1KLGD 1KRSA 4B3SQ 5C4XG 4RWSC 4IUVA 1PH7A 3RZDH 3J7A5 1N8RC 2Q2IA 4A3KG 1E2ZA 1VF5C 2KVMA 1STBA 1QZGA 1EY0A 5G3LF 3FMCA 3PF4A 4KKSA 2Y0SB 1HTPA 2Q8IB 4F87A 5GADC 1PZJD 1ML0D 2PQEA 4JV5L 2KECA 3MC0B 1DYQA 4DR3Q 4GLXA 1WTVA 4DV0L 3T13A 1Y1WH 2CQOA 3U9OA 3S15H 3NTHA 1XX8A 4A3KB 4M1UB 2JJQA 3BVMA 4WRDA 3UE1A 1PH3A 1VQOA 4JYAL 3PIOA 5T1IA 3TS2A 1QUQB 1HNWQ 4K2LA 1X3EA 2NTTA 2E2IB 3K5OA 3EFXD 1QE6A 1YBYA 1KAAA 3TP7A 2X6LA 3BU2A 2YTXA 2JA5G 4IPGA 1XNRQ 3M85A 4HJ9A 4ZK9B 4LJZC 5J39A 4OL7A 5CORA 3T1HQ 5BN5A 3GTJB 1PRTB 3FP9A 1A0IA 1YITA 3KFUA 1O7LA 3CC7A 2HIXA 4MHEA 2IX1A 3S14B 3IAYA 2HHHL 5IYCG 1A3VA 3VR6A 5FLXE 2B39A 1EQVA 5IWAL 1LTTD 4DV2Q 4WJ3M 2K5DA 4A3EH 2KQ3A 4YCWA 2YU9H 1LTBD 4AYBB 1FJGL 4ZUIA 1XJVA 3G6EA 1WVLA 2J0TD 4HTHA 2UUAL 1B50A 5JPNC 1GUNA 1IW7D 1LT3D 2A74C 3TZDA 4F8MA 1RDPD 1PXUA 1TXYA 2F4VL 1XMOL 3KF8B 1TWFH 1JJ2A 1YHQA 2F3VA 2XRQD 1LTID 4BWGB 4LFAL 4GNXB 1XNQQ 4L5SA 4HAEA 1TWGH 4MZ9A 4PMBA 1PLFA 2M00A 3AFPA 1VQBA 3CMEA 4C3JB 4X65Q 1QNKA 4L63B 2B2WA 3MVVA 2DNCA 3AFQA 2R7ZG 4UDUC 4B3TQ 1B3QA 2L55A 4DR1Q 1JQYD 2K33A 1K83H 3RLOA 4GKKL 5H1SE 3K81C 5A2QL 4L5RC 3MXUA 2ICEC 3UI2A 1NY4A 4QUFA 2F0EA 1CUKA 3OIPA 1XYIA 4RHRA 1ASYA 4CDCC 1M8AA 3GTQH 4WJWA 4JI8Q 1GUSA 1JT8A 1SE3A 3CCVA 5EKLA 5K36G 1HNXL 2DJGC 1CKOA 5CV9A 2HIVA 1OXTA 2L4NA 4DU9A 2B2YC 4IUTA 5AFWA 3S17H 3P7JA 4HEDA 4LNQA 4JYAQ 2LXKA 3KLRA 2MP1A 3A7LA 3NPPA 3I4MH 3FHWA 2Z4HA 4BS9A 2E2DC 1Y1WG 5TSSA 2F0NA 4Z9CB 3MEFA 1DONA 1X55A 4Q0FA 3F2DA 3LGJA 1B53A 2JA7H 4EQPA 4JI3Q 4KY5A 3H3VH 2HDLA 5EGTA 3GTMB 2CH4W 3GTLB 1R4PB 1IW7C 1LTGD 1TR5A 4ZKCB 2RSOA 4B9XA 2L12A 1VQMA 3E3XA 1GUGA 1WTOA 4LFBL 5FO9B 1I4RA 1N33L 1AH9A 3MXGA 4POFA 4AYBG 3X3MA 5CV6A 3SDZA 3M4PA 2OQKA 3D4WA 1N34L 3A56A 2C35B 2A73B 2F0OA 5DM63 2VUMH 2UUBL 1II3A 4JI0L 3PCOB 5DEHA 4A3EG 1YHBA 4DA2A 3T56B 1CSPA 2WACA 2VB3X 4A3LG 4R4IA 1E0BA 1GHKA 1IL2A 3CW2C 1MKHA 3D8GA 3F8TA 5M9OA 4A3MH 5C0XH 2B29A 3VA7A 2XVSA 4NB3A 5C4HA 1HZBA 3GQBA 3H6MA 2DNEA 1WYDA 2WP8J 4PZ7A 3OPOA 3H3VC 3MTSA 3NHHA 1HA6A 1O7IA 4CDFC 2RCNA 2EYOA 3SK4A 4LF7L 4JI3L 2AWNA 5T1GA 4RKLA 1SDFA 2NVXB 2E5LQ 1SROA 3L2PA 1JWMD 4TSSA 2EPBA 4LWCA 2UXCQ 5ELBA 4IOAA 1HXYD 4UP9A 2F0QA 1IBMQ 4ME3A 5E1FA 3G7LA
chains in the Genus database with same CATH topology
4RKBA 1JORA 4K2KA 1VCIA 3E0JA 5IGEA 1EEFD 1SBBB 2C9OA 5NUCA 2Q8RE 5EKKA 1ONLA 3D6CA 1EU3A 1ZYRD 4R8NA 1Y69U 2F0LA 2F0UA 2JSOA 1FNVA 2BDOA 3VYRA 1S5FD 2EJFC 5C0XJ 2XRSD 4P2CB 4NKLA 2SNSA 1PZKD 1BR9A 1H9RA 4J1MA 5ISRA 3M7GA 4Y7NB 2F0MA 2A69C 5K5PA 3LNNA 3OHXC 1MGSA 2JA8B 3GV6A 2WV6D 3R3OA 3P20A 2SOBA 1B3AA 2LS01 2RBMA 1VMPA 1A2TA 4H44C 3TBIB 4OGQC 3Q22A 5M3FB 2RDHA 1CK1A 1DZ1A 1EY8A 3ERQA 5J22A 1RKNA 5A35A 2EYMA 3OW7A 2JA7B 1G2SA 5IODA 4C56C 2A6HD 1ILPA 3HG9A 2IPKD 3F2UA 4LK1C 4OO1I 3C3LA 2E76C 5LHY1 1PZID 1JC7A 5CR3A 4A93B 1ESRA 4PMWA 1CQFA 1B9MA 2F0HA 4XQQA 2NTSA 3MA2B 4ZAIA 3OSOA 4FF4A 1PTOD 1VF7A 3T16A 2ID0A 4JK1C 4FF2A 2R6GA 3HGBA 2MJ8A 4A3MB 5C4XB 3NK9A 4CJ2C 1CZGA 3PUVA 2E2JB 1SYDA 1FYCA 3OIQA 5K36H 2AUJD 2F0DA 1LTSD 2NZ1D 3BDCA 1OXXK 4J6HA 3L3OC 2KA7A 1HHVA 3RZOB 1CM9A 1KDBA 3MAQA 1B2TA 1BO0A 3A55A 3ITPA 3V2TA 3K7AB 1LACA 1GHJA 1I4XA 2BA1A 1QWYA 5HGTA 1DJRD 1K83B 4A3JB 1I6HB 5C5MA 4EQOA 3VYSA 3D6WA 2B2UC 5E3FA 3VA5A 3EVQA 3KLSX 2JE6I 2A6ED 1B1ZA 2M2LA 3K59A 1D1KA 4RGMA 4IFDI 1G291 3DUZA 2CQAA 3BVGA 3KK7A 4G7HC 4S3SA 3I4LA 3RLFA 5C0XG 4RCOA 5HURA 5C3XA 1U9RA 4DN4M 3J81L 3IFTA 4O1NA 1WTRA 3K5LA 2D9UA 4K5XA 2DY8A 3R93A 4WFN3 1FGBD 1Z6HA 5CYUA 3FPPA 3HS0C 2EZVA 4KKTA 4CKBA 1PRTC 1E2WA 2PZWA 2AQ1B 1BDOA 2ICIA 5COYA 1HUMA 1V1PA 1B4OA 3A8IE 2IW3A 2F4IA 3C1FA 1IL8A 5JVG3 3S2DB 5I4DA 5JPMC 3VR3A 4F88A 3P75A 3DHQA 1SNPA 2KOLA 1LT5D 2D5DA 3E6ZX 1UUPA 4ME5A 1JB3A 2K5WA 4ZLTF 4PQXA 3NP8A 3S17B 3IFDA 1X32A 3HOUB 1EY5A 3I4MB 4LMQD 3WOEA 3DWAA 4CKCA 3DEPA 1ZXTA 1DOKA 2OEOA 3TMEA 1WD0A 4BY1B 2FMCA 1ZYRC 1V8QA 2CW0D 1QCBD 4IQZA 4FYDA 1KTKA 2EY1A 2VB2X 4HR7B 2K5QA 3JAML 4XIGS 5JVH3 3R2IA 5ELEA 4KKUA 3J80E 3SEBA 5M3MB 1PFBA 3NBIA 5IGCA 5KYLA 1XXGA 1QNUA 1DXMA 4B08A 3HEJA 3CHBD 2QCPX 2XWBB 3CRLC 1W6JA 2BE5D 1WTQA 4A3BB 5DAUA 1B44D 3FDTA 1JICA 1STEA 1XTCD 1S5CD 3A8JE 1RF2D 4A3EB 1IHZA 5D3DA 4NP5A 1GJXA 1IYVA 1SYEA 1KDAA 3I90A 2JYOA 4C3HB 3W3AA 4OO1H 2F0GA 1DD2A 1VDZA 2A6EC 2CHBD 5FO8B 3AMUA 4U673 1EQTA 1Q90A 1FNWA 1NR4A 4N9PA 4HCEA 1EFID 5JEAG 1PFNA 3L9AX 3D31A 3T4AC 4IFDG 3J7AF 4G57A 3ND9A 5C3WA 4HSVA 4XQNA 2NVQB 1BBXC 2XN9C 3BZDB 4XXEA 1PRTF 4KY6A 1ET9A 1UAPA 1HCZA 2NVTB 5C4ZA 4IFDH 4EQNA 1PMRA 3HOVB 3S1RB 5KNCA 3C2PA 2O5JC 2QKIC 4G7ZC 2KUMA 2ZXPA 2KJXA 2I46A 5DNFA 2LY7A 3MHBA 4ODGA 1VMCA 4O42A 2EYHA 2EOTA 3RUZA 4F7XA 1SFOB 2R7ZB 4EGVA 1U4LA 1SAPA 4H7BA 3FPUB 4X3TA 1STYA 2NN6G 2B8GA 3RZDB 1EY7A 5CV4A 1SNQA 1D5XC 5I9OA 2FINB 1SE4A 2GA4B 3OWEB 3A8KE 3OOCA 1BF4A 1JOKA 1G6ZA 1YNND 4PMCA 2NB0A 4IUPA 3WOFA 5CBEE 1I4GA 4KK7A 4TRDA 4TKOB 4KMUC 1Q3LA 1KNAA 2PZTA 2WINB 1SXTA 1EEID 4YIJA 1QG7A 5EBCA 2EJGC 4KI0A 3FRPB 3I3CA 1H9MA 1O80A 2E74C 2O2LD 2MGSA 2A6HC 4RHSA 5EQ0A 1Q12A 2PW7A 4HN7A 4ZQ3A 4NW2A 1Y8PB 4IURA 2R92B 1TU2B 4WORA 2C5CA 4NDXA 1PFMA 2N55A 3A7AB 2DY7A 2KEDA 4UAIA 2OT2A 4H13C 1WD1A 2D62A 1PTOH 3NE5B 3ONAB 4QCLA 2X6GA 4C1NK 4E6IA 1RD9D 2B2VA 3TP8A 3VR2A 2RSNA 2F1MA 1GXDC 4BBSB 3GTPB 2N88A 3BVZA 2NN6I 5JAVA 1KABA 4XT1B 5EBDA 4I65A 3RMHA 1DCZA 2BOSA 2O4XA 3IL8A 2NVYB 1D6EC 1EY4A 1EWHA 3HOYB 2ZXOA 3R2TA 1QJOA 4ILWA 5JOBA 3HKZB 1PDQA 5M5WB 1I50B 2FMMA 4XYOA 2NN6H 2IT1A 2XWJB 1QILA 3TP6A 3T53B 2Z8LA 4CBVA 5EPJA 2K01A 3MWYW 1CQVA 1EYCA 1Z7TA 2BDNA 4QB4A 1SYFA 1BCPF 1RTOA 4DNTB 1TS5A 2EYPA 1Y8NB 1F2LA 4DF7A 1SMYD 1WTXA 1AP0A 4TQUS 4IFDJ 1EZ8A 3V05A 4KHZA 3X3NA 2AQ2B 4FP5D 2F0IA 4G7OC 1TWCB 4HMIA 1XWEA 2L5TA 2EYFA 3S15B 3EQLC 2HCIA 1G8ZD 1JCKB 2R93B 3SE0A 4C3IB 2PMZB 5LL6S 4DK1A 2IX0A 3DWQA 4K6LA 4C3IG 1TS3A 2Z4IA 1SE2A 1LO5D 4B9WA 3SHLA 3MXNA 5ELCA 2EJMA 3N6RA 2XSCA 4FF3A 1TT2A 5JEAH 4K6DA 2F0PA 4KTAA 1CTMA 2SDFA 2BCOA 1V1PB 3ZYYX 3U9SA 1OXSC 5A2QE 3URYA 3EJIA 1Q8IA 1STAA 1F9QA 4BA2I 1NCVA 2EE1A 3QJYA 2JEBI 2A69D 4V0BA 2L1BA 3P1HA 4I7ZC 2E75C 4BBRB 1CZWA 1G91A 3EROA 2R3ZA 4CKEA 3K5MA 3S16B 2LKVA 3KUPA 3OMGA 1G2TA 3HOZB 3QB3A 4FVMA 4OO1G 5ELDA 3FKIB 3N52A 1EZ6A 1SEBD 5FKAC 3QOLA 4L8JA 1SYGA 1MD2D 3NWTA 1AFPA 1TY2A 1CT1D 3SXHA 3H0GB 3GTQB 4ZKBB 1I6VC 3WDNA 2IJ0A 1AW7A 1BUVT 2PPBC 5I6YA 1F9SA 2L0CA 3S9WA 1R9TB 2F0KA 1O7YA 1GOZA 2EY5A 5C44B 2F0JA 3PO3B 1PYWD 2LMCB 5EJWA 2RKSA 3FVQA 4K5VA 1K8MA 1HQRD 4QIWB 3DWPA 4PV1C 1L0XB 4IALA 4RGTA 4RCNA 3BS1A 1SNMA 2ZXRA 5IGDA 3BG3A 3GP7A 3KLSA 2PZUA 5KNDA 1STGA 2K7VA 3PUZA 4X3SA 2SEBD 2K05A 3HP3A 3QWNA 3DMUA 5C0XI 2R61A 3KF8A 3OMCA 3M7NA 1ICWA 3GD7A 1RTNA 3IKJA 2HCCA 3SK5A 2AWOA 3TZUA 1YNJC 3GO5A 1T5EA 3S1MB 4FO2A 3GTGB 3K0YA 4HSPA 1RJTA 4G4KA 1BQQT 2VNUD 2ZT9C 4RH6A 4FNFA 1EOTA 2LFNA 4XDXA 2CW0C 5FOBB 1HTLD 2JEAI 1TWHB 1S5BD 3AB9A 4BY7B 1E2VA 2QEJC 2G9DA 1Y1WB 2EXZA 3D4RA 1YNJD 2BE5C 3Q6SA 2KEEA 1EIHA 4IN3A 3PUXA 5IT9E 3TN2A 3H09A 4RFBA 1A6XA 3GTOB 5CV8A 2MUYA 3RD4A 1QOHA 2FHTA 3CRKC 1UNSA 3NWSA 3PUYA 3BYYB 1M4VA 4DK0A 1HFNA 4L6TB 4FXDA 4KJOA 3NTKA 2WIIB 4CHTB 2F0VA 5CGKA 3QG1A 4CJ1B 5I2XA 5G3LD 5KNBA 2MHVA 5KEEA 1STHA 3HOWB 3Q23A 4DXFA 1Z47A 5IGGA 5M5YB 4ZRZA 1GUWA 1WCMB 3TP5A 1AN8A 2B2TC 5D65A 2NYZD 1TS2A 1WTWA 2M9VA 3LWEA 4ZYSA 4K8IA 2EDGA 2QILA 1U4RA 5I9PA 3H91A 1JR0D 3LWUA 4QUCA 5M5XB 2SNMA 4XQJA 1HFGA 1ZKOA 5E4WC 1LT4D 3SVMA 4DAVA 1F2ZA 2MPMA 2PNRC 3S1NB 1BCPD 3O13A 2K6AA 5IGBA 5EPKA 1TIID 2L9HA 5C6AA 3T51B 3J80L 4K8JA 1KNEA 1QB5D 2B63B 1NUCA 2OXPA 4KN7C 5FLXL 3DEOA 4K5WA 2K04A 1TS4A 1LTRD 2ENBA 2EY2A 3J7AV 1MI2A 1O7ZA 4N9TA 1OO9B 2D2CC 5CV5A 3QO2A 1V43A 5JJZA 4PNYA 5IGFA 3CKIB 4C3JG 1SSOA 2KHSA 5I2YA 1B9NA 2YYZA 4ULLA 3VYUA 2RVLA 4DFAA 1BOSA 5D14A 4C1NI 3SR1A 1U4PA 2EVBA 3QIAA 1ENAA 4KD4A 4R8IA 2EY6A 4KD3A 3KBXA 1A15A 2KCCA 2Q8TA 1NAPA 3D4DA 2K03A 4OIKA 4BA1I 1T5XD 3CU7A 1Y1VB 1TVXA 4DXGA 1HRJA 2HUGA 1ZEQX 2AUKA 4DNRB 1U4MA 1BNZA 1DOMA 5C5LA 3PUWA 3Q0AA 3FEWX 2JP1A 2K1BA 1GUTA 3G6JB 5J1ZA 2A68C 2WB1B 3R8BA 1TWGB 1D2BA 1PTOC 2B2UA 1C4QA 1RODA 4MIUA 5E4XA 3NUCA 1I4QA 4IUNA 1SNOA 1STNA 5ELFA 3SK6A 5BN4A 2I07B 2RA4A 1HQMC 1TWAB 3S1QB 2WKDA 2QF7A 4FF1A 3I8ZA 1H9SA 3NBHA 3K5NA 1LV9A 2F3WA 5DM73 1Q1BA 2JA6B 1AZPA 2HDMA 1F2MA 1EIGA 2FJ2A 1CA5A 1ILQA 5KIXA 1J8IA 5IIFA 1I3QB 1TWFB 1EL0A 4FXKC 3JAME 1V1OA 1RCVD 3A54A 4H0LC 1A3UA 2K32A 1PRTD 1JE4A 1MBYA 1D1IA 3TDQA 1OXUA 3E5SA 3V96A 2CVRA 3C46A 1SYBA 4M8AA 3D3RA 4C2MB 2J7ZA 2TSSA 3S2HB 1JWUD 2B8FA 2RDFA 1SJED 2A68D 4KHVA 3MZ5A 2OF1A 1BCPC 1AZQA 2VUMB 1TKWB 4J8QA 1W6KA 3SK8A 1TY0A 2BA0A 1EY9A 4OIJA 4U68A 3I73A 4EVOA 1D5MC 3H94A 2B2WC 5FO7B 1SJHD 1X3PA 5C4JB 2X69A 5KRUA 3K57A 4DGZA 4CJ0B 1WTPA 4ID6A 1CI3M 5F2DA 1HA5A 3J7YW 1SNDA 4QMGA 3TSSA 4ABNA 4KJNA 5EPLA 3EA6A 1A3TA 1F2YA 4K14A 1SMYC 1SNCA 1D5ZC 3I91A 1H9JA 2PCFB 2AQ3B 1MSGA 1LT6D 4LAAA 1H9SB 1CFMA 3NQTA 1EWCA 3MEHA 4KN4C 3I72A 2JXMB 1R4QB 4ZUJA 2F0WA 2H4OA 3M3YB 4RA8A 3HRZC 3NXWA 3L7ZC 2NWGA 1A2UA 4RAUC 1Y8OB 2VXWA 1AEXA 5JEAJ 2IL8A 4KV6A 3QOJA 1F77A 1F9RA 5D3IB 3NTIA 2PYKA 3PO2B 2F03A 1DM0B 1I4PA 3C1EA 1KDCA 4C3HG 2NUCA 1MSHA 5BN3A 4V190 5IOCA 2YU9B 3MXPA 1IKMA 1CHPD 2NBFA 3VYTA 4OHJA 5CBAE 1O78A 5CC4A 1KLUD 3VR4A 1IKLA 4CGYB 2F0FA 1FR3A 1FNUA 3GV3A 2DN8A 4A3DB 1HPCA 1J9OA 4XT3B 2L11A 3CQZB 2EYLA 1ENFA 2B2TA 5I6WA 1ESFA 3K6OA 1JWSD 1LTAD 4A3IB 1Q1EA 5KYIA 4NMZA 2J4XA 1FD7D 2WAQB 4X3UA 1X3QA 1NR2A 1OXVA 3M4OB 3K58A 1BCPB 1IYUA 2K28A 2RDGA 1S5DD 3HZXA 1CA6A 4XTCS 2IX3A 2FFKB 2Z1CA 4RGOS 1PTOF 2H1EA 3J81E 3NQIA 1K8OA 3M4YA 1YNNC 5CV7A 2F0TA 2F0SA 3DXJC 2G9HD 3NSWA 3BDOA 1RHPA 3GTKB 2KCNA 1C48A 5LL6X 3LX0A 5KGUA 1EY6A 4R9WA 2V4DA 4KY7A 3I4NB 3PIP3 3PV0A 5EKIA 3MFGA 4A3GB 1NSNS 2PW5A 1DOLA 3DM1A 1SYCA 2XIWA 2E2HB 3OWFA 4IUQA 1JOOA 3PMFA 1PTOB 4A3FB 1HUNA 1ENCA 3ND8A 4DAPA 4QF4A 2TMPA 1H9KA 4XYQA 1S5ED 4FXGC 3KBGA 1UEAB 2B2VC 4Q5VA 1CHQD 2QDBA 1TQOA 4X3KA 3PIO3 3VR5A 4RGNA 3AU7A 2B2YA 4HMJA 4JBWA 5C3EB 1LLRD 2HQEA 3Q24A 2O5IC 1L0YB 2XNAC 4IZ8A 3BDLA 3HOXB 1EU4A 1GUOA 1C8CA 3I70A 1EYDA 5FK9C 1ET6A 2WKCA 5IT9L 2A5HA 1JOQA 1LABA 2RQXA 2JA5B 3W2DA 1BXTA 3MFYA 1S4ZA 4GZYC 4IUUA 4DAYA 5CMDA 1EYAA 4MN3A 2EYJA 1F9PA 4HCSA 2PO4A 1I4HA 2IWHA 3BYTB 1KLGD 4RWSC 4IUVA 1E2ZA 1VF5C 2KVMA 1STBA 1EY0A 5G3LF 3FMCA 4KKSA 2Y0SB 1HTPA 2Q8IB 4F87A 1PZJD 1ML0D 2PQEA 2KECA 3MC0B 1DYQA 1WTVA 3T13A 3U9OA 3NTHA 1XX8A 4A3KB 4M1UB 3BVMA 4WRDA 5T1IA 4K2LA 2NTTA 2E2IB 3K5OA 3EFXD 1QE6A 1KAAA 3TP7A 2X6LA 3M85A 4ZK9B 4LJZC 5J39A 4OL7A 5CORA 5BN5A 3GTJB 1PRTB 1O7LA 4MHEA 2IX1A 3S14B 3IAYA 1A3VA 3VR6A 5FLXE 2B39A 1EQVA 1LTTD 2K5DA 2KQ3A 1LTBD 4AYBB 4ZUIA 1WVLA 2J0TD 4HTHA 1B50A 5JPNC 1GUNA 1IW7D 1LT3D 2A74C 3TZDA 4F8MA 1RDPD 1PXUA 2F3VA 2XRQD 1LTID 4BWGB 4HAEA 4PMBA 1PLFA 2M00A 4C3JB 1QNKA 4L63B 2B2WA 3MVVA 2DNCA 4UDUC 2L55A 1JQYD 2K33A 5A2QL 3MXUA 2ICEC 3UI2A 4QUFA 2F0EA 3OIPA 1XYIA 4RHRA 1M8AA 4WJWA 1GUSA 1SE3A 5EKLA 5K36G 5CV9A 1OXTA 2L4NA 4DU9A 2B2YC 4IUTA 5AFWA 3P7JA 4HEDA 3KLRA 2MP1A 3A7LA 3NPPA 2Z4HA 4BS9A 2E2DC 5TSSA 2F0NA 4Z9CB 1DONA 4Q0FA 1B53A 4EQPA 4KY5A 2HDLA 5EGTA 3GTMB 3GTLB 1R4PB 1IW7C 1LTGD 1TR5A 4ZKCB 2RSOA 4B9XA 2L12A 1GUGA 1WTOA 5FO9B 1I4RA 3MXGA 3X3MA 5CV6A 3SDZA 3D4WA 3A56A 2A73B 2F0OA 5DM63 1II3A 5DEHA 4DA2A 3T56B 2WACA 2VB3X 1E0BA 1GHKA 3D8GA 5M9OA 5C0XH 3VA7A 2XVSA 5C4HA 3H6MA 3GQBA 2DNEA 2WP8J 3OPOA 3H3VC 3MTSA 3NHHA 1HA6A 2EYOA 3SK4A 2AWNA 5T1GA 4RKLA 1SDFA 2NVXB 1JWMD 4TSSA 2EPBA 5ELBA 1HXYD 2F0QA 5E1FA 3G7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A3U A;  1SNM A;  5CV4 A;  2EY6 A;  1SNQ A;  4K2K A;  4RKB A;  5CV9 A;  3TP5 A;  4KD3 A;  4DU9 A;  5I9O A;  1IHZ A;  5IGD A;  4HMJ A;  5I6W A;  4LAA A;  2PZU A;  5IGE A;  4NP5 A;  1JOR A;  4K5X A;  3D4D A;  3T16 A;  2HQE A;  1STG A;  3NQT A;  1JOK A;  5KYI A;  1SYE A;  4NMZ A;  1KDA A;  4PMC A;  5NUC A;  1KAA A;  3TP7 A;  3MEH A;  5EKK A;  3E5S A;  3D6C A;  3DMU A;  3EJI A;  4K8I A;  1STA A;  3OMC A;  4IZ8 A;  2F0G A;  2F0N A;  5JOB A;  1SYB A;  3BDL A;  5I9P A;  4OL7 A;  5J39 A;  4R8N A;  4ZUJ A;  2PZW A;  2F0L A;  2F0U A;  2F0W A;  3NK9 A;  3HZX A;  3SK5 A;  3TP6 A;  4TRD A;  2SNM A;  1EYD A;  1SYD A;  1ENA A;  4KD4 A;  4EQP A;  3P1H A;  2F0D A;  2PZT A;  5C5L A;  4KY5 A;  4N9P A;  3C1F A;  4YIJ A;  1EYC A;  4QB4 A;  5EGT A;  1SYF A;  3NXW A;  3ERO A;  2EYP A;  2RDF A;  1F2Z A;  4NKL A;  2SNS A;  1A3V A;  3BDC A;  5J1Z A;  4J6H A;  4J1M A;  2F0T A;  5CV7 A;  1TR5 A;  3DHQ A;  1SNP A;  3MZ5 A;  3P75 A;  4KHV A;  4DF7 A;  2LKV A;  5ISR A;  2F0M A;  2OF1 A;  4B9X A;  1JOQ A;  1A2U A;  2F0S A;  1EQV A;  4ME5 A;  3OMG A;  2PW7 A;  4ZQ3 A;  2KQ3 A;  4G57 A;  5IGB A;  5K5P A;  3NP8 A;  5C3W A;  1KDB A;  3SK8 A;  3QB3 A;  4ZUI A;  4MIU A;  3ITP A;  1EZ8 A;  1EY9 A;  3V2T A;  5CV6 A;  5C6A A;  1AEX A;  4HTH A;  2EXZ A;  4WOR A;  2F0I A;  3D4W A;  3NUC A;  1EY5 A;  1EYA A;  3R3O A;  4KV6 A;  4NDX A;  3QOJ A;  4K8J A;  2EYJ A;  4EVO A;  1EZ6 A;  4F8M A;  5HGT A;  3LX0 A;  1SNO A;  4IUN A;  5KGU A;  1EY6 A;  2F0O A;  2SOB A;  4HMI A;  4KY6 A;  1II3 A;  1NUC A;  2OXP A;  2RBM A;  1STN A;  3QOL A;  4KY7 A;  3SK6 A;  1A2T A;  2OEO A;  1SYG A;  2PYK A;  5DEH A;  2F3V A;  3TME A;  2EYF A;  5C4Z A;  4EQN A;  3C1E A;  1KDC A;  4K5W A;  2NUC A;  2WAC A;  1EY8 A;  5C5M A;  3ERQ A;  4EQO A;  5J22 A;  1RKN A;  2EY1 A;  5IOC A;  1STB A;  3MXP A;  4PMB A;  5KRU A;  2ENB A;  2EY2 A;  3SXH A;  2EYM A;  1EY0 A;  2M00 A;  3D8G A;  5CV8 A;  5E3F A;  4DGZ A;  4E6I A;  3TP8 A;  5M9O A;  1NSN S;  2PW5 A;  3MHB A;  5IOD A;  4N9T A;  3MVV A;  3VA5 A;  4ODG A;  4ID6 A;  5C4H A;  3EVQ A;  5CV5 A;  4KJO A;  5F2D A;  3H6M A;  5I6Y A;  1SND A;  1SYC A;  2F3W A;  4QMG A;  5JAV A;  2PQE A;  3S9W A;  1KAB A;  2F0V A;  4PNY A;  5CC4 A;  5IGF A;  2EYH A;  2F0K A;  4I65 A;  5CGK A;  4KJN A;  2KHS A;  3NHH A;  3RUZ A;  3OWF A;  4F7X A;  1JOO A;  5IGC A;  2F0F A;  3PMF A;  4B9W A;  2EY5 A;  5KYL A;  5CR3 A;  1A3T A;  1ENC A;  3T13 A;  1F2M A;  1F2Y A;  2EYO A;  3SHL A;  4K14 A;  3SK4 A;  3U9O A;  2F0J A;  4DFA A;  2F0E A;  3HEJ A;  4QF4 A;  5KEE A;  2O4X A;  4WRD A;  1STH A;  4RKL A;  5KIX A;  2RKS A;  2F0H A;  4S3S A;  1SNC A;  4K5V A;  1TT2 A;  5IIF A;  1EY4 A;  3SR1 A;  5DAU A;  4H7B A;  5IGG A;  2QDB A;  4IAL A;  5HUR A;  4K6D A;  2F0P A;  4KTA A;  1TQO A;  1STY A;  5C3X A;  2F0Q A;  4K2L A;  2EYL A;  1U9R A;  5EKL A;  5E1F A;  1EY7 A;  3OSO A; 
#chains in the Genus database with same CATH topology
 4RKB A;  1JOR A;  4K2K A;  1VCI A;  3E0J A;  4UHV A;  5IGE A;  1GD7 A;  1NE3 A;  1EEF D;  1SBB B;  2DJF C;  4DR2 Q;  2C9O A;  5NUC A;  4P75 A;  1YEZ A;  2Q8R E;  5EKK A;  1ONL A;  5IYD H;  3D6C A;  1EU3 A;  1ZYR D;  2ZJQ A;  2VQE Q;  4R8N A;  4C3J H;  1Y69 U;  2F0L A;  2F0U A;  4OEL B;  3STB C;  2JSO A;  1G51 A;  1L1O A;  1FNV A;  2BDO A;  1VQN A;  3VYR A;  1S5F D;  2EJF C;  5C0X J;  2XRS D;  4J15 A;  2OTL A;  3ERS X;  4P2C B;  3HOU H;  4NKL A;  2SNS A;  1PZK D;  1BR9 A;  4BBR G;  4DR1 L;  1H9R A;  4J1M A;  5ISR A;  3M7G A;  4Y7N B;  2JA6 H;  2F0M A;  2A69 C;  1V1Q A;  4BBR H;  5K5P A;  3G4S A;  4DR7 Q;  3LNN A;  3OHX C;  2R93 H;  1MGS A;  4QL5 A;  3J80 c;  2JA8 B;  3PQI A;  4JBM A;  3GV6 A;  2WV6 D;  3R3O A;  2XTI A;  2WB1 G;  4DV1 L;  3P20 A;  2SOB A;  1B3A A;  2LS0 1;  2RBM A;  1BBW A;  5E7N A;  4B3M L;  1VMP A;  1A2T A;  4H44 C;  3TBI B;  4OGQ C;  3Q22 A;  5M3F B;  2ES2 A;  2RDH A;  3ULP A;  1CK1 A;  1DZ1 A;  1EY8 A;  3PSI A;  3ERQ A;  3I2Z A;  5J22 A;  1RKN A;  5A35 A;  2EYM A;  3OW7 A;  2JA7 B;  1G2S A;  5IOD A;  4C56 C;  2A6H D;  1ILP A;  3HG9 A;  2IPK D;  1SMX A;  3F2U A;  4LK1 C;  3GTG H;  4OO1 I;  3C3L A;  2E76 C;  1GM5 A;  5LHY 1;  1PZI D;  3H0G G;  5M3F H;  4R4T A;  1JC7 A;  5CR3 A;  2I5H A;  4A93 B;  1ESR A;  4PMW A;  2ZTC A;  4YWM A;  1HZA A;  1CQF A;  1B9M A;  1VQI A;  2F0H A;  4XQQ A;  2NTS A;  2QA4 A;  3MA2 B;  3CCL A;  4ZAI A;  4QGU A;  4OWW B;  2UU9 Q;  3BJU A;  1VQA A;  4JI2 Q;  2YTY A;  4A3J G;  1A63 A;  3OSO A;  4A3F G;  1LM0 A;  4FF4 A;  1PTO D;  1HH2 P;  4DV5 Q;  4HJ7 A;  1VF7 A;  3T16 A;  2ID0 A;  1PH6 A;  4JK1 C;  4FF2 A;  2R6G A;  3HGB A;  2MJ8 A;  4A3M B;  5M3M H;  5C4X B;  4A3G G;  1VQL A;  3NK9 A;  4CJ2 C;  1QZH A;  1CZG A;  4YWK A;  4A3I H;  3PUV A;  2E2J B;  1SYD A;  1FYC A;  3OIQ A;  5K36 H;  2AUJ D;  2F0D A;  1E3P A;  1CKN A;  4GLA C;  3I4N G;  1LTS D;  3M4O H;  2NZ1 D;  3BDC A;  1OXX K;  4J6H A;  3L3O C;  3OW2 A;  2KA7 A;  4MTN A;  1XMQ L;  5FJ8 G;  1HHV A;  2IY5 B;  3RZO B;  2CWA A;  1CM9 A;  1KDB A;  3TRE A;  3I55 A;  3MAQ A;  1BO0 A;  2K5N A;  4GNX C;  1B2T A;  3A55 A;  3ICE A;  3ITP A;  3V2T A;  3K7A B;  2N8N A;  1LAC A;  1GHJ A;  1V9P A;  1X9N A;  1I4X A;  2BA1 A;  2K4K A;  1MJE A;  1QWY A;  5HGT A;  2NVX H;  1HZ9 A;  1AE2 A;  3EIV A;  1DJR D;  1K83 B;  2ALY B;  4JI6 L;  2Q2U A;  2R92 H;  4C3H H;  4A3J B;  4GOP A;  1I6H B;  4GN5 A;  2PNH A;  5C5M A;  4EQO A;  3HOY G;  2IHF A;  3VYS A;  3D6W A;  2B2U C;  5E3F A;  2MO0 A;  1KQS A;  5M5X H;  3VA5 A;  3EVQ A;  3KLS X;  2JE6 I;  2A6E D;  1B1Z A;  2M2L A;  4DV3 L;  3EN2 A;  4IPH A;  3K59 A;  1D1K A;  1K28 A;  4RGM A;  1WCM G;  4IFD I;  1G29 1;  4IJL A;  2PI2 A;  3DUZ A;  4QQB X;  2VW9 A;  2CQA A;  3BVG A;  3KK7 A;  1K9M C;  3G48 A;  4G7H C;  4A93 G;  4S3S A;  3I4L A;  3RLF A;  5C0X G;  4RCO A;  5HUR A;  1VQE A;  5C3X A;  2Z6K C;  1XNQ L;  1U9R A;  2LXJ A;  4DN4 M;  1EQQ A;  3S24 A;  3J81 L;  3IFT A;  4O1N A;  4HID A;  2ZM6 Q;  3G71 A;  1WTR A;  3K5L A;  2D9U A;  4R1J A;  4K5X A;  4EX5 A;  2DY8 A;  3R93 A;  2JA8 H;  2YTV A;  4WFN 3;  1FGB D;  1Z6H A;  3CXC A;  5CYU A;  1XMO Q;  1TWC H;  4NXN L;  3FPP A;  3GTM H;  3HS0 C;  2EZV A;  4KKT A;  4OWX B;  4CKB A;  1PRT C;  4DV6 L;  1HNZ L;  1E2W A;  2PZW A;  2UUC Q;  2AQ1 B;  1LUZ A;  1BDO A;  2ICI A;  5COY A;  1HUM A;  4EQ5 A;  1V1P A;  4POG A;  1K0S A;  1B4O A;  3A8I E;  2IW3 A;  2F4I A;  3C1F A;  3J81 j;  2JA8 G;  1IL8 A;  5JVG 3;  4N8X 1;  3S2D B;  5I4D A;  5JPM C;  3VR3 A;  4F88 A;  3P75 A;  3DHQ A;  1SNP A;  2KOL A;  1LT5 D;  2D5D A;  3E6Z X;  1UUP A;  4ME5 A;  1VQ7 A;  1JB3 A;  4HIM A;  2K5W A;  2MQH A;  4ZLT F;  4A3C H;  4PQX A;  3NP8 A;  1KIX A;  3S17 B;  3IFD A;  1UEB A;  5IP9 G;  1X32 A;  4DV4 Q;  3HOU B;  1PYB A;  1EY5 A;  3I4M B;  2I5L X;  1EQR A;  3CAM A;  4DV7 Q;  4LMQ D;  3WOE A;  5IP9 H;  3DWA A;  4CKC A;  3DEP A;  1ZXT A;  1DOK A;  2OEO A;  3TME A;  1WD0 A;  4BY1 B;  2FMC A;  2F52 A;  1ZYR C;  2Z9H A;  1V8Q A;  2CW0 D;  1QCB D;  4IQZ A;  4FYD A;  1KTK A;  2EY1 A;  2VB2 X;  3KF6 A;  4HR7 B;  1UE5 A;  2K5Q A;  2ZM6 L;  2ZJR A;  3JAM L;  4XIG S;  5JVH 3;  2V1C C;  3BZK A;  3R2I A;  5ELE A;  4X64 Q;  4KKU A;  3J80 E;  3SEB A;  5M3M B;  1PFB A;  3NBI A;  2K52 A;  5IGC A;  5KYL A;  1XXG A;  1QNU A;  2E2J H;  4A3D G;  1DXM A;  4B08 A;  3HEJ A;  2BH8 A;  4AQY Q;  3CHB D;  2QCP X;  5C3E H;  2XWB B;  3CRL C;  2QDL A;  1W6J A;  2BE5 D;  5IP7 G;  1WTQ A;  4A3B B;  1QUQ A;  3KJP A;  5DAU A;  2K75 A;  1B44 D;  4GOP B;  3FDT A;  1JIC A;  1STE A;  1XTC D;  2B63 G;  2CKZ B;  1S5C D;  5C44 G;  5ELN A;  3A8J E;  1RF2 D;  4A3E B;  1IHZ A;  4B3S L;  5D3D A;  4NP5 A;  1GJX A;  1IYV A;  3K7A H;  1SYE A;  2VQF Q;  1KDA A;  3I90 A;  1J5E L;  3TRZ A;  2JYO A;  4C3H B;  1TWA H;  3W3A A;  4OO1 H;  2KHJ A;  2F0G A;  1DD2 A;  1VDZ A;  2A1A A;  4YCU A;  2A6E C;  2CHB D;  2QW7 A;  4X64 L;  5FO8 B;  3AMU A;  4LF9 L;  2NVQ H;  4U67 3;  5FLX c;  1EQT A;  1Q90 A;  2KCT A;  2JA5 H;  1FNW A;  1NR4 A;  4N9P A;  4HCE A;  3ZJY C;  1SRU A;  1EFI D;  1VS0 A;  5JEA G;  3UDG A;  1Z9F A;  1PFN A;  3L9A X;  5BR8 L;  3D31 A;  3OYY A;  4LFC L;  1X3G A;  4YWL A;  1K8G A;  3T4A C;  4IFD G;  3J7A F;  4G57 A;  3ND9 A;  1M90 C;  5C3W A;  4CDD C;  4HSV A;  3GTJ H;  4UP7 A;  4XQN A;  2BH2 A;  2NVQ B;  1BBX C;  2XN9 C;  3BZD B;  1M1K C;  5LMN Q;  2OCE A;  4XXE A;  1PRT F;  4R4C A;  4KY6 A;  5AJ3 Q;  4R4Q A;  2XGT A;  4YCV A;  1ET9 A;  1UAP A;  1HCZ A;  2NVT B;  1SFO H;  2R7Z H;  5C4Z A;  4IFD H;  4EQN A;  1HNW L;  1PMR A;  3S1R B;  3HOV B;  5KNC A;  3C2P A;  3AQQ A;  2O5J C;  2QKI C;  4G7Z C;  2KUM A;  2ZXP A;  5DLQ E;  2KJX A;  2I46 A;  3F2B A;  5DNF A;  2LY7 A;  3MHB A;  4DV6 Q;  4ODG A;  1VMC A;  4O42 A;  4IO9 A;  2EYH A;  4RMF A;  2EOT A;  3RUZ A;  4F7X A;  1SFO B;  1IYJ B;  2R7Z B;  4EGV A;  3U58 A;  1U4L A;  4K0K L;  3HOV G;  1SAP A;  5LMN L;  4H7B A;  3J7Z C;  4IPC A;  3FPU B;  4X3T A;  1STY A;  2NN6 G;  2B8G A;  1PA6 A;  3KF6 B;  3RZD B;  1EY7 A;  5CV4 A;  1QVF A;  1SNQ A;  1D5X C;  5I9O A;  2FIN B;  2K50 A;  1SE4 A;  2GA4 B;  3OWE B;  4X65 L;  3A8K E;  3OOC A;  1BF4 A;  4BY1 H;  1JOK A;  1G6Z A;  1YNN D;  4PMC A;  3CCJ A;  1Q82 C;  1PH5 A;  2NB0 A;  1IBL L;  4KHP L;  2R7F A;  4IUP A;  4JI8 L;  3K80 C;  3WOF A;  5CBE E;  1I4G A;  4HJ5 A;  1YIJ A;  4NXM L;  1ASZ A;  2R93 G;  2PQA A;  3KLW A;  4KK7 A;  4TRD A;  4TKO B;  4KMU C;  1Q3L A;  1K8A C;  1KNA A;  2AKW B;  1E22 A;  2PZT A;  2WIN B;  1SXT A;  1EEI D;  4GLV B;  1QG7 A;  4YIJ A;  5EBC A;  2EJG C;  3J81 i;  4KI0 A;  3FRP B;  3I3C A;  1H9M A;  1O80 A;  2E74 C;  2O2L D;  2MGS A;  2A6H C;  3D0F A;  4RHS A;  5EQ0 A;  1W3S A;  1Q12 A;  2R7D A;  4L5Q A;  2PW7 A;  4HN7 A;  4ZQ3 A;  4LW1 A;  4NW2 A;  3CPF A;  1Y8P B;  4IUR A;  2R92 B;  1TU2 B;  4WOR A;  4PZ8 A;  2C5C A;  1NJI C;  4NDX A;  1PFM A;  2N55 A;  3A7A B;  2DY7 A;  1XPU A;  2KED A;  1HNZ Q;  4UAI A;  2OT2 A;  4H13 C;  1WD1 A;  2D62 A;  1PTO H;  3NE5 B;  5M5Y H;  3ULL A;  3ONA B;  4QCL A;  1NTG A;  2X6G A;  3PO3 G;  4C1N K;  2I5M X;  4E6I A;  1RD9 D;  5LMU L;  3S14 H;  2B2V A;  3TP8 A;  3VR2 A;  2RSN A;  2F1M A;  1GXD C;  1VQ4 A;  4BBS B;  3GTP B;  2N88 A;  4PG3 A;  3BVZ A;  4DNI A;  2NN6 I;  5JAV A;  1KAB A;  3NBH B;  4XT1 B;  3NEM A;  4I65 A;  5EBD A;  3RMH A;  3HOZ H;  1BVS A;  3K8A A;  4X66 L;  1I50 H;  4LFB Q;  3EBE A;  1NMG A;  4DV5 L;  1DCZ A;  2BOS A;  3CCM A;  3S16 H;  2O4X A;  3IL8 A;  5FLM H;  2NVY B;  4A75 A;  2E8G A;  1D6E C;  1EY4 A;  1PFS A;  4DUZ Q;  1EWH A;  3HOY B;  1XNR L;  1VQD A;  4QIW E;  2ZXO A;  3R2T A;  1QJO A;  2CH4 A;  4ILW A;  4ALP A;  5JOB A;  3JAM i;  3HKZ B;  3UDF A;  3S1Q H;  1PDQ A;  5M5W B;  5HGQ A;  1I50 B;  2FMM A;  1SLJ A;  1PHJ A;  2OQ0 A;  3K0X A;  5IYB H;  1I5F A;  4XYO A;  2NN6 H;  2IT1 A;  1U5K A;  1WCM H;  3S2D H;  2XWJ B;  1QIL A;  3TP6 A;  1KL9 A;  3T53 B;  2JN4 A;  2Z8L A;  3S1R H;  2IHE A;  4CBV A;  3HOV H;  5EPJ A;  3AEV A;  2K01 A;  1TWH H;  3MWY W;  1CQV A;  3PF5 A;  4X62 L;  1EYC A;  1Z7T A;  2BDN A;  4QB4 A;  1SYF A;  1BCP F;  1RTO A;  4DNT B;  4JBJ A;  1TS5 A;  2EYP A;  3CC4 A;  5ELO A;  1Y8N B;  1SE8 A;  1F2L A;  1P16 A;  4DF7 A;  1SMY D;  1WTX A;  4H02 A;  1I94 Q;  4AH6 A;  2R92 G;  2ATW A;  1AP0 A;  1YVC A;  4TQU S;  3HOX G;  4IFD J;  1EZ8 A;  4A3M G;  3V05 A;  4KHZ A;  1GO3 E;  3X3N A;  2AQ2 B;  2DGY A;  4FP5 D;  2F0I A;  1YJN A;  4G7O C;  1TWC B;  3CQZ H;  2PQA B;  3GTO H;  4A3D H;  2OWO A;  4HMI A;  3KDF A;  3TS0 A;  1XWE A;  2L5T A;  2EYF A;  3S15 B;  4DV3 Q;  3EQL C;  2HCI A;  1G8Z D;  2A19 A;  1JCK B;  1K3R A;  3KJO A;  2R93 B;  1Y14 B;  3SE0 A;  5L37 A;  4DR5 Q;  4C3I B;  2PMZ B;  4LF5 L;  5EAY A;  5LL6 S;  4DK1 A;  1IBL Q;  2IX0 A;  3DWQ A;  2CFM A;  4K6L A;  1VQG A;  4C3I G;  4O0A A;  1TS3 A;  2Z4I A;  1SE2 A;  2LSS A;  1LO5 D;  3A0J A;  4B9W A;  3SHL A;  3MXN A;  5ELC A;  2EXD A;  4YY3 Q;  2EJM A;  2NZH A;  3N6R A;  2XSC A;  4FF3 A;  1TT2 A;  5JEA H;  4K6D A;  2F0P A;  4KTA A;  1CTM A;  2SDF A;  3K7U C;  2BCO A;  3QR8 A;  1V1P B;  4LF7 Q;  3ZYY X;  2AHO B;  3U9S A;  3CCS A;  1OXS C;  5A2Q E;  3URY A;  3EJI A;  1Q8I A;  1STA A;  1F9Q A;  4BA2 I;  1NCV A;  2EE1 A;  3QJY A;  5BR8 Q;  2JEB I;  2OTJ A;  2A69 D;  1CKN B;  4HIO A;  4V0B A;  2L1B A;  3KOJ A;  3P1H A;  4I7Z C;  1LYL A;  2E75 C;  4BBR B;  1HR0 L;  4DR5 L;  3GTP H;  1CZW A;  1G91 A;  3ERO A;  4QY7 A;  2R3Z A;  1CKM A;  4CKE A;  2L15 A;  4JI4 Q;  3K5M A;  3S16 B;  2LKV A;  3KUP A;  3DLL A;  3W5O A;  3OMG A;  1Q7Y C;  1N36 L;  1PH4 A;  3F1Z A;  4B3T L;  1G2T A;  3HOZ B;  3QB3 A;  2VQF L;  4FVM A;  4OO1 G;  4HIK A;  3HOY H;  5ELD A;  3FKI B;  3N52 A;  3ULJ A;  1EZ6 A;  2UXD Q;  2NVY H;  4A3I G;  1SEB D;  5FKA C;  3QOL A;  4L8J A;  4APV A;  1SYG A;  1MD2 D;  3NWT A;  1AFP A;  1TY2 A;  1E24 A;  4DK3 C;  1CT1 D;  2WAQ G;  3RZO H;  1GVP A;  1H95 A;  3SXH A;  1K3B C;  3H0G B;  1L0W A;  3GTQ B;  4ZKB B;  3NEL A;  1I6V C;  3WDN A;  2IJ0 A;  1AW7 A;  1PH2 A;  1IBM L;  2ZJP A;  2UUA Q;  3UDX A;  1BUV T;  2PPB C;  4DUY Q;  5I6Y A;  1EUJ A;  1F9S A;  2L0C A;  3S9W A;  1R9T B;  2P5Z X;  2F0K A;  1O7Y A;  1N32 Q;  1GOZ A;  2EY5 A;  5C44 B;  1U0L A;  2F0J A;  4DV7 L;  1PYW D;  3PO3 B;  1I6H H;  2LMC B;  5EJW A;  4BBS H;  4JI7 Q;  1EWI A;  3KDF B;  2RKS A;  3FVQ A;  5M3F G;  2MFI A;  4K5V A;  4DV4 L;  1K8M A;  4A3B G;  1HQR D;  4QIW B;  1Q81 C;  3DWP A;  4PV1 C;  4IAL A;  1L0X B;  1IBK Q;  4RGT A;  4OEM B;  2VZA A;  4RCN A;  1E7Z A;  4X66 Q;  3JAM c;  3BS1 A;  1SNM A;  2KBN A;  2ZXR A;  5J3B A;  5IGD A;  3BG3 A;  1YI2 A;  3GP7 A;  3KLS A;  2PZU A;  5KND A;  1N36 Q;  3GTL H;  2PI2 E;  1STG A;  2K7V A;  3PUZ A;  4X3S A;  4L5T A;  4LF4 L;  2SEB D;  2K05 A;  3HP3 A;  3QWN A;  3DMU A;  4YY3 L;  5C0X I;  2R61 A;  3OMC A;  3KF8 A;  1VQP A;  3M7N A;  1ICW A;  3GD7 A;  1RTN A;  3PO2 G;  3IKJ A;  2HCC A;  3SK5 A;  4P74 A;  2UXB Q;  1YJ9 A;  4OX9 L;  2AWO A;  3CD6 A;  3TZU A;  1YNJ C;  3GO5 A;  1T5E A;  1MJC A;  3S1M B;  4FO2 A;  3GTG B;  3I7F A;  2Q2H A;  3K0Y A;  4HSP A;  1RJT A;  4G4K A;  1BQQ T;  2VNU D;  2RCF A;  2ZT9 C;  4RH6 A;  2G5D A;  3I4N H;  4FNF A;  1C9O A;  1EOT A;  2LFN A;  4XDX A;  2CW0 C;  4NXN Q;  5FOB B;  1HTL D;  4JI5 L;  4UP8 A;  2YV5 A;  2JEA I;  1TWH B;  1S5B D;  3AB9 A;  4C2M H;  4A3G H;  4BY7 B;  1E2V A;  2QEJ C;  2G9D A;  1Y1W B;  2EXZ A;  3D4R A;  1YNJ D;  3S1M H;  5GQO A;  2BE5 C;  3J81 c;  1FL0 A;  3Q6S A;  2KEE A;  1EIH A;  4JW0 A;  1UWV A;  4IN3 A;  3PUX A;  5IT9 E;  3TN2 A;  3H09 A;  1I94 L;  4RFB A;  2RF4 A;  1A6X A;  1IZ6 A;  1L1O B;  1PH1 A;  1SN8 A;  1P8L A;  3GTO B;  5CV8 A;  2MUY A;  3RD4 A;  1QOH A;  2FHT A;  3CRK C;  1UNS A;  4DPG A;  2CWP A;  3NWS A;  3PUY A;  3BYY B;  1M4V A;  4DK0 A;  4X62 Q;  1HFN A;  4L6T B;  2GN5 A;  4FXD A;  4KJO A;  5C4J H;  3NTK A;  2WII B;  4CHT B;  2Y0S E;  2F0V A;  5CGK A;  3QG1 A;  3HFZ B;  4CJ1 B;  4LF9 Q;  5I2X A;  5G3L D;  5KNB A;  1ICF B;  1NNX A;  2MHV A;  1YNX A;  5KEE A;  1STH A;  2K14 A;  1VQC A;  3HOW B;  3Q23 A;  1KXL A;  4DXF A;  3RR5 A;  1Z47 A;  5IGG A;  1VQF A;  5M5Y B;  4ZRZ A;  1FGU A;  5GAG C;  4GOP C;  3U50 C;  1GUW A;  1WCM B;  3TP5 A;  1AN8 A;  2B2T C;  5D65 A;  3PIP A;  3L0O A;  2NYZ D;  1LTL A;  1TS2 A;  1WTW A;  2M9V A;  3LWE A;  4ZYS A;  4K8I A;  2EDG A;  4A3J H;  2QIL A;  4JOI A;  1U4R A;  5I9P A;  3H91 A;  1JR0 D;  3LWU A;  2F4V Q;  2E2H H;  1XPO A;  1Q86 C;  4QUC A;  5M5X B;  4BXX H;  2SNM A;  4XQJ A;  1HFG A;  4JI7 L;  4UPA A;  1ZKO A;  5E4W C;  4IOC A;  1B70 B;  3H3V I;  1LT4 D;  3H0G H;  3SVM A;  4DAV A;  1PH8 A;  3TQY A;  1F2Z A;  2MPM A;  5LMU Q;  3A5U A;  2PNR C;  5IE8 A;  3S1N B;  1BCP D;  4A76 A;  4UY8 C;  3O13 A;  2K6A A;  5IGB A;  5EPK A;  1TII D;  2L9H A;  5C6A A;  3T51 B;  3J80 L;  4K8J A;  4DAY B;  4FDB A;  1KNE A;  1QB5 D;  2UU9 L;  2B63 B;  1NUC A;  2OXP A;  4KN7 C;  3J80 i;  4A3C G;  3CP0 A;  5FLX L;  3DEO A;  4K5W A;  4AQY L;  2K04 A;  1TS4 A;  5IYD G;  1LTR D;  2ENB A;  2EY2 A;  4AIM A;  3IRB A;  3J7A V;  1MI2 A;  5FLM G;  1EIY B;  1O7Z A;  4N9T A;  1FVI A;  4TVA B;  1OO9 B;  2D2C C;  4JI6 Q;  4JI5 Q;  5CV5 A;  3QO2 A;  1V43 A;  2JA6 G;  5JJZ A;  4PNY A;  5IGF A;  3CKI B;  3HKZ G;  4C3J G;  1SSO A;  2KHS A;  4B3M Q;  4A4I A;  5I2Y A;  1B9N A;  2YYZ A;  4ULL A;  2KEN A;  3VYU A;  2RVL A;  4DFA A;  1BOS A;  3E9I A;  1PH9 A;  5D14 A;  4KLK A;  1MHW C;  4P71 A;  1WFQ A;  4BY1 G;  2ZTE A;  4C1N I;  3SR1 A;  1U4P A;  4IJH A;  5GAE C;  2EVB A;  3H15 A;  3QIA A;  1ENA A;  4KD4 A;  3T1Y L;  4R8I A;  4OWT B;  4ZCK A;  2EY6 A;  4RG1 A;  4KD3 A;  3CCR A;  3HOU G;  3KBX A;  1A15 A;  2KCC A;  1WOC A;  2Q8T A;  2HD3 A;  1NAP A;  1EFW A;  3D4D A;  2K03 A;  4OIK A;  4BA1 I;  1T5X D;  3CU7 A;  1Y1V B;  1TVX A;  4DXG A;  4BBS G;  2Z6K A;  4K0K Q;  1HRJ A;  2JA7 G;  4LUV A;  4X6A H;  3CPW A;  2HUG A;  1ZEQ X;  2AUK A;  4DNR B;  1U4M A;  1BNZ A;  1DOM A;  3RLN A;  5C5L A;  2RHQ B;  3PUW A;  3Q0A A;  3FEW X;  1VQ9 A;  3CC2 A;  2WB1 E;  2JP1 A;  4MNO A;  2K1B A;  1GUT A;  1S3O A;  3G6J B;  5J1Z A;  2A68 C;  4JI2 L;  4DV1 Q;  2WB1 B;  4KHP Q;  2ASB A;  2E2I H;  3R8B A;  1TWG B;  1D2B A;  1PTO C;  1KAW A;  3UDI A;  5LMN W;  3PO2 H;  2B2U A;  1C4Q A;  1ROD A;  2QEX A;  4MIU A;  4A3B H;  5E4X A;  2EIF A;  1A8V A;  2E5L L;  3NUC A;  3I56 A;  1I4Q A;  4IUN A;  1SNO A;  3BZC A;  4LF4 Q;  4LUO A;  5JJK A;  4P72 A;  1STN A;  5ELF A;  3SK6 A;  2HHH Q;  1K0R A;  1PYS B;  4DR3 L;  3HKZ E;  5BN4 A;  4JV5 Q;  2I07 B;  2RA4 A;  1HQM C;  1TWA B;  4GNX A;  3S1Q B;  2WKD A;  2QF7 A;  1G6P A;  3T1H L;  4DR4 L;  4FF1 A;  4DR6 Q;  3I8Z A;  1H9S A;  4B3R L;  3M3Y H;  3NBH A;  3K5N A;  1LV9 A;  3A74 A;  2F3W A;  2Y0S G;  5DM7 3;  1X3F A;  1RIP A;  4JI4 L;  4NXM Q;  3W1B A;  1Q1B A;  2JA6 B;  1X54 A;  4LUZ A;  1W2B A;  1AZP A;  2HDM A;  1F2M A;  1GKH A;  1EIG A;  3FKI H;  1JMC A;  4Y7N H;  4OX9 Q;  2FJ2 A;  1CA5 A;  1ILQ A;  5KIX A;  1J8I A;  5IIF A;  1I3Q B;  1TWF B;  1EL0 A;  4FXK C;  3JAM E;  1N33 Q;  1V1O A;  4GN4 B;  1RCV D;  3A54 A;  4H0L C;  5JJL A;  1VQJ A;  1YJW A;  1A3U A;  2K32 A;  1L1O C;  4GS3 A;  1PRT D;  1JE4 A;  4GN3 B;  1MBY A;  1YZ6 A;  5IP7 H;  1VQ5 A;  1D1I A;  3TDQ A;  2I0Q A;  1OXU A;  2HT1 A;  3E5S A;  3V96 A;  1IBK L;  1YHA A;  2CVR A;  3C46 A;  1SYB A;  4M8A A;  1I3Q H;  3D3R A;  4C2M B;  4DUZ L;  1EYG A;  1AE3 A;  2J7Z A;  2TSS A;  3STB D;  3U4Z A;  4DR2 L;  5IYB G;  3S2H B;  2RHS B;  1JWU D;  5IYC H;  4JI0 Q;  2B8F A;  2RDF A;  1SJE D;  2A68 D;  3I4O A;  1N34 Q;  4KHV A;  3MZ5 A;  1IXR A;  2OF1 A;  4PZ6 A;  1J6Q A;  1BCP C;  3M4Q A;  1AZQ A;  2UXC L;  2VUM B;  1TKW B;  2VL6 A;  2JA9 A;  4J8Q A;  1W6K A;  2Z6B A;  2GVB A;  3SK8 A;  1TY0 A;  2BA0 A;  2WFW A;  1EY9 A;  1XPR A;  5C3E G;  1E1O A;  4OIJ A;  4U68 A;  3I73 A;  4EVO A;  4CDE C;  1D5M C;  3U4V A;  2Q2T A;  2B3G A;  3H94 A;  2B2W C;  5FO7 B;  1SJH D;  1X3P A;  1S40 A;  4LFC Q;  5C4J B;  3OTO Q;  5JJI A;  2X69 A;  4OXP A;  5KRU A;  3K57 A;  4DGZ A;  5GRO A;  1BBU A;  4CJ0 B;  4DK6 C;  1PVO A;  1WTP A;  1EIF A;  4ID6 A;  1CI3 M;  4JPB W;  1HA5 A;  5F2D A;  3J7Y W;  3HOW H;  1SND A;  4QMG A;  4LFA Q;  3TSS A;  4ABN A;  4R4O A;  4YHH Q;  1PV4 A;  3MXN B;  4KJN A;  2UUC L;  5EPL A;  3EA6 A;  3GTK H;  3HOW G;  1A3T A;  1J5E Q;  1F2Y A;  1C7Y A;  4K14 A;  4JVZ A;  1SMY C;  1SNC A;  4O2D A;  1Q8K A;  1A62 A;  4JCV E;  1D5Z C;  1JJC B;  2GVA A;  3I91 A;  3CMA A;  1XTD A;  1H9J A;  2PCF B;  1QVC A;  4B3R Q;  4OON A;  2AQ3 B;  2N49 A;  1MSG A;  1LT6 D;  4LAA A;  2JQO A;  1H9S B;  1CFM A;  3NQT A;  5M3M G;  1EWC A;  5AJ3 L;  3MEH A;  4KN4 C;  4A3K H;  4DAM A;  3I72 A;  2JXM B;  1JE5 A;  1R4Q B;  1D8L A;  4P73 A;  4ZUJ A;  2DUD A;  2VS1 A;  2F0W A;  1X65 A;  1B7Y B;  4QJF A;  2H4O A;  5FJ8 H;  4A3F H;  3M3Y B;  4RA8 A;  3HRZ C;  1Y1V H;  3NXW A;  2F3I A;  4BY7 G;  3L7Z C;  1B8A A;  4N8F A;  4AYB E;  2NWG A;  1A2U A;  3RNU A;  2B63 H;  2AMC B;  1HJP A;  4RAU C;  3AYH B;  1Y8O B;  2VXW A;  1AEX A;  5JEA J;  4HJ8 A;  2IL8 A;  4KV6 A;  3QOJ A;  1F77 A;  3VDY A;  1F9R A;  1JB7 A;  5D3I B;  3NTI A;  2PYK A;  1KRT A;  4C3I H;  2F03 A;  1DM0 B;  4LF8 Q;  4JBK A;  3RN5 A;  3PO2 B;  1I4P A;  5GAH C;  1X56 A;  3E0E A;  3C1E A;  3HKS A;  1KDC A;  3E9H A;  4C3H G;  2FXQ A;  1MSH A;  2NUC A;  5BN3 A;  4V19 0;  5IOC A;  2YU9 B;  3MXP A;  2PMZ E;  1WJJ A;  1IKM A;  1CHP D;  3HOX H;  2NBF A;  4A93 H;  3CF5 A;  3VYT A;  3T1Y Q;  4OHJ A;  2WAQ E;  4JG2 A;  3S1N H;  5CBA E;  4Y52 H;  3CCE A;  2MO1 A;  3S2H H;  1O78 A;  5CC4 A;  1KLU D;  3VR4 A;  2A8V A;  1IKL A;  4CGY B;  4LF8 L;  2F0F A;  2NVT H;  1FR3 A;  3WWV A;  1FNU A;  3M9B A;  3GV3 A;  1HZC A;  2DN8 A;  4A3D B;  4JOI C;  1HPC A;  1J9O A;  4XT3 B;  2L11 A;  3GDE A;  3CQZ B;  2EYL A;  4GKJ L;  5C4X H;  4BXX G;  1ENF A;  2B2T A;  1R9T H;  5I6W A;  4JC0 A;  1ESF A;  3K6O A;  3TEH B;  1JWS D;  1LTA D;  1QVG A;  4A3I B;  1Q1E A;  5KYI A;  4NMZ A;  4LF6 L;  2J4X A;  1WI5 A;  1FD7 D;  2KCM A;  2WAQ B;  3FKI G;  3PO3 H;  4X3U A;  1X3Q A;  2ZTD A;  1NR2 A;  1OXV A;  4IPD A;  1C0A A;  2N3S A;  1UE7 A;  3M4O B;  3HOZ G;  3K58 A;  4DR6 L;  1BCP B;  1IYU A;  2K28 A;  2RDG A;  1S5D D;  3HZX A;  1CA6 A;  2VUM G;  5HY6 A;  1SR3 A;  1N9W A;  4XTC S;  2IX3 A;  2FFK B;  2Z1C A;  1EOV A;  1PTO F;  4RGO S;  2H1E A;  3I4M G;  1N32 L;  3J81 E;  2H5X A;  3NQI A;  2UUB Q;  1K8O A;  2NZO A;  4WJ4 A;  3M4Y A;  1YNN C;  5CV7 A;  2F0T A;  3RN2 A;  3NEN A;  4NPS A;  2F0S A;  3CCQ A;  3DXJ C;  3UE0 A;  2G9H D;  3B6Y A;  3W1G A;  2HQL A;  3NSW A;  1UE6 A;  3BDO A;  1RHP A;  3GTK B;  2K5V A;  4HJA A;  2KCN A;  1C48 A;  2Z0S A;  4DV0 Q;  1NBW A;  1KD1 C;  5LL6 X;  3LX0 A;  5KGU A;  1EY6 A;  1NMF A;  1HR0 W;  1KC8 C;  4R9W A;  2V4D A;  4KY7 A;  1XMQ Q;  2UXB L;  5IT9 c;  4DR7 L;  4DKA C;  3PIP 3;  3I4N B;  2KHI A;  1FJG Q;  2D0O A;  1BKB A;  3PV0 A;  1VQ6 A;  2EQS A;  4DV2 L;  1RL2 A;  5EKI A;  3MFG A;  3SGI A;  4BY7 H;  4A3G B;  1NSN S;  2PW5 A;  1DOL A;  1S72 A;  3DM1 A;  1VQ8 A;  1SYC A;  2D0P A;  2XIW A;  3OTO L;  2E2H B;  2JK8 A;  5M5W H;  1DGS A;  1K73 C;  1HR0 Q;  3OWF A;  4IUQ A;  3F2C A;  1JOO A;  3A5Z B;  3JC6 6;  3PMF A;  1PTO B;  1UE1 A;  1HNX Q;  4A3F B;  1OTC A;  1ENC A;  1HUN A;  3ND8 A;  1D7Q A;  4DAP A;  4QF4 A;  2TMP A;  1H9K A;  4XYQ A;  1S5E D;  1VQK A;  4FXG C;  3KBG A;  1VQH A;  1UEA B;  2B2V C;  3ER0 A;  4Q5V A;  1CHQ D;  2QDB A;  1KHI A;  1TQO A;  4I7A A;  4DR4 Q;  4JI1 Q;  3PGZ A;  4X3K A;  3PIO 3;  3VR5 A;  4RGN A;  4LF5 Q;  3AU7 A;  2B2Y A;  1CSQ A;  4HMJ A;  1Q46 A;  4JBW A;  5C3E B;  1LLR D;  4YHH L;  2HQE A;  2QGQ A;  2CCZ A;  5IY0 A;  3Q24 A;  2O5I C;  4A3L H;  2K5H A;  5IWA Q;  1L0Y B;  2XNA C;  4IZ8 A;  3BDL A;  2N78 A;  4GKK Q;  3HOX B;  1WTH A;  1EU4 A;  3Q8D A;  1GUO A;  3CCU A;  1C8C A;  3I70 A;  4MTK A;  1EYD A;  5C44 H;  5FK9 C;  2MNA A;  2UXD L;  1ET6 A;  1MIU A;  2VQE L;  2WKC A;  4JI1 L;  5IT9 L;  2A5H A;  2VY3 A;  1JOQ A;  1LAB A;  2RQX A;  2JA5 B;  3W2D A;  1L2F A;  1T9H A;  1BXT A;  3MFY A;  4LF6 Q;  3KYH C;  1S4Z A;  3DM3 A;  4GZY C;  4IUU A;  4DAY A;  1JJG A;  5CMD A;  1EYA A;  1Y1V G;  4DUY L;  4MN3 A;  2EYJ A;  1F9P A;  4HCS A;  2PO4 A;  1I4H A;  4GKJ Q;  2IWH A;  1X6O A;  1E1T A;  3BYT B;  1KLG D;  1KRS A;  4B3S Q;  5C4X G;  4RWS C;  4IUV A;  1PH7 A;  3RZD H;  3J7A 5;  1N8R C;  2Q2I A;  4A3K G;  1E2Z A;  1VF5 C;  2KVM A;  1STB A;  1QZG A;  1EY0 A;  5G3L F;  3FMC A;  3PF4 A;  4KKS A;  2Y0S B;  1HTP A;  2Q8I B;  4F87 A;  5GAD C;  1PZJ D;  1ML0 D;  2PQE A;  4JV5 L;  2KEC A;  3MC0 B;  1DYQ A;  4DR3 Q;  4GLX A;  1WTV A;  4DV0 L;  3T13 A;  1Y1W H;  2CQO A;  3U9O A;  3S15 H;  3NTH A;  1XX8 A;  4A3K B;  4M1U B;  2JJQ A;  3BVM A;  4WRD A;  3UE1 A;  1PH3 A;  1VQO A;  4JYA L;  3PIO A;  5T1I A;  3TS2 A;  1QUQ B;  1HNW Q;  4K2L A;  1X3E A;  2NTT A;  2E2I B;  3K5O A;  3EFX D;  1QE6 A;  1YBY A;  1KAA A;  3TP7 A;  2X6L A;  3BU2 A;  2YTX A;  2JA5 G;  4IPG A;  1XNR Q;  3M85 A;  4HJ9 A;  4ZK9 B;  4LJZ C;  5J39 A;  4OL7 A;  5COR A;  3T1H Q;  5BN5 A;  3GTJ B;  1PRT B;  3FP9 A;  1A0I A;  1YIT A;  3KFU A;  1O7L A;  3CC7 A;  2HIX A;  4MHE A;  2IX1 A;  3S14 B;  3IAY A;  2HHH L;  5IYC G;  1A3V A;  3VR6 A;  5FLX E;  2B39 A;  1EQV A;  5IWA L;  1LTT D;  4DV2 Q;  4WJ3 M;  2K5D A;  4A3E H;  2KQ3 A;  4YCW A;  2YU9 H;  1LTB D;  4AYB B;  1FJG L;  4ZUI A;  1XJV A;  3G6E A;  1WVL A;  2J0T D;  4HTH A;  2UUA L;  1B50 A;  5JPN C;  1GUN A;  1IW7 D;  1LT3 D;  2A74 C;  3TZD A;  4F8M A;  1RDP D;  1PXU A;  1TXY A;  2F4V L;  1XMO L;  3KF8 B;  1TWF H;  1JJ2 A;  1YHQ A;  2F3V A;  2XRQ D;  1LTI D;  4BWG B;  4LFA L;  4GNX B;  1XNQ Q;  4L5S A;  4HAE A;  1TWG H;  4MZ9 A;  4PMB A;  1PLF A;  2M00 A;  3AFP A;  1VQB A;  3CME A;  4C3J B;  4X65 Q;  1QNK A;  4L63 B;  2B2W A;  3MVV A;  2DNC A;  3AFQ A;  2R7Z G;  4UDU C;  4B3T Q;  1B3Q A;  2L55 A;  4DR1 Q;  1JQY D;  2K33 A;  1K83 H;  3RLO A;  4GKK L;  5H1S E;  3K81 C;  5A2Q L;  4L5R C;  3MXU A;  2ICE C;  3UI2 A;  1NY4 A;  4QUF A;  2F0E A;  1CUK A;  3OIP A;  1XYI A;  4RHR A;  1ASY A;  4CDC C;  1M8A A;  3GTQ H;  4WJW A;  4JI8 Q;  1GUS A;  1JT8 A;  1SE3 A;  3CCV A;  5EKL A;  5K36 G;  1HNX L;  2DJG C;  1CKO A;  5CV9 A;  2HIV A;  1OXT A;  2L4N A;  4DU9 A;  2B2Y C;  4IUT A;  5AFW A;  3S17 H;  3P7J A;  4HED A;  4LNQ A;  4JYA Q;  2LXK A;  3KLR A;  2MP1 A;  3A7L A;  3NPP A;  3I4M H;  3FHW A;  2Z4H A;  4BS9 A;  2E2D C;  1Y1W G;  5TSS A;  2F0N A;  4Z9C B;  3MEF A;  1DON A;  1X55 A;  4Q0F A;  3F2D A;  3LGJ A;  1B53 A;  2JA7 H;  4EQP A;  4JI3 Q;  4KY5 A;  3H3V H;  2HDL A;  5EGT A;  3GTM B;  2CH4 W;  3GTL B;  1R4P B;  1IW7 C;  1LTG D;  1TR5 A;  4ZKC B;  2RSO A;  4B9X A;  2L12 A;  1VQM A;  3E3X A;  1GUG A;  1WTO A;  4LFB L;  5FO9 B;  1I4R A;  1N33 L;  1AH9 A;  3MXG A;  4POF A;  4AYB G;  3X3M A;  5CV6 A;  3SDZ A;  3M4P A;  2OQK A;  3D4W A;  1N34 L;  3A56 A;  2C35 B;  2A73 B;  2F0O A;  5DM6 3;  2VUM H;  2UUB L;  1II3 A;  4JI0 L;  3PCO B;  5DEH A;  4A3E G;  1YHB A;  4DA2 A;  3T56 B;  1CSP A;  2WAC A;  2VB3 X;  4A3L G;  4R4I A;  1E0B A;  1GHK A;  1IL2 A;  3CW2 C;  1MKH A;  3D8G A;  3F8T A;  5M9O A;  4A3M H;  5C0X H;  2B29 A;  3VA7 A;  2XVS A;  4NB3 A;  5C4H A;  1HZB A;  3GQB A;  3H6M A;  2DNE A;  1WYD A;  2WP8 J;  4PZ7 A;  3OPO A;  3H3V C;  3MTS A;  3NHH A;  1HA6 A;  1O7I A;  4CDF C;  2RCN A;  2EYO A;  3SK4 A;  4LF7 L;  4JI3 L;  2AWN A;  5T1G A;  4RKL A;  1SDF A;  2NVX B;  2E5L Q;  1SRO A;  3L2P A;  1JWM D;  4TSS A;  2EPB A;  4LWC A;  2UXC Q;  5ELB A;  4IOA A;  1HXY D;  4UP9 A;  2F0Q A;  1IBM Q;  4ME3 A;  5E1F A;  3G7L A; 
#chains in the Genus database with same CATH homology
 4RKB A;  1JOR A;  4K2K A;  1VCI A;  3E0J A;  5IGE A;  1EEF D;  1SBB B;  2C9O A;  5NUC A;  2Q8R E;  5EKK A;  1ONL A;  3D6C A;  1EU3 A;  1ZYR D;  4R8N A;  1Y69 U;  2F0L A;  2F0U A;  2JSO A;  1FNV A;  2BDO A;  3VYR A;  1S5F D;  2EJF C;  5C0X J;  2XRS D;  4P2C B;  4NKL A;  2SNS A;  1PZK D;  1BR9 A;  1H9R A;  4J1M A;  5ISR A;  3M7G A;  4Y7N B;  2F0M A;  2A69 C;  5K5P A;  3LNN A;  3OHX C;  1MGS A;  2JA8 B;  3GV6 A;  2WV6 D;  3R3O A;  3P20 A;  2SOB A;  1B3A A;  2LS0 1;  2RBM A;  1VMP A;  1A2T A;  4H44 C;  3TBI B;  4OGQ C;  3Q22 A;  5M3F B;  2RDH A;  1CK1 A;  1DZ1 A;  1EY8 A;  3ERQ A;  5J22 A;  1RKN A;  5A35 A;  2EYM A;  3OW7 A;  2JA7 B;  1G2S A;  5IOD A;  4C56 C;  2A6H D;  1ILP A;  3HG9 A;  2IPK D;  3F2U A;  4LK1 C;  4OO1 I;  3C3L A;  2E76 C;  5LHY 1;  1PZI D;  1JC7 A;  5CR3 A;  4A93 B;  1ESR A;  4PMW A;  1CQF A;  1B9M A;  2F0H A;  4XQQ A;  2NTS A;  3MA2 B;  4ZAI A;  3OSO A;  4FF4 A;  1PTO D;  1VF7 A;  3T16 A;  2ID0 A;  4JK1 C;  4FF2 A;  2R6G A;  3HGB A;  2MJ8 A;  4A3M B;  5C4X B;  3NK9 A;  4CJ2 C;  1CZG A;  3PUV A;  2E2J B;  1SYD A;  1FYC A;  3OIQ A;  5K36 H;  2AUJ D;  2F0D A;  1LTS D;  2NZ1 D;  3BDC A;  1OXX K;  4J6H A;  3L3O C;  2KA7 A;  1HHV A;  3RZO B;  1CM9 A;  1KDB A;  3MAQ A;  1B2T A;  1BO0 A;  3A55 A;  3ITP A;  3V2T A;  3K7A B;  1LAC A;  1GHJ A;  1I4X A;  2BA1 A;  1QWY A;  5HGT A;  1DJR D;  1K83 B;  4A3J B;  1I6H B;  5C5M A;  4EQO A;  3VYS A;  3D6W A;  2B2U C;  5E3F A;  3VA5 A;  3EVQ A;  3KLS X;  2JE6 I;  2A6E D;  1B1Z A;  2M2L A;  3K59 A;  1D1K A;  4RGM A;  4IFD I;  1G29 1;  3DUZ A;  2CQA A;  3BVG A;  3KK7 A;  4G7H C;  4S3S A;  3I4L A;  3RLF A;  5C0X G;  4RCO A;  5HUR A;  5C3X A;  1U9R A;  4DN4 M;  3J81 L;  3IFT A;  4O1N A;  1WTR A;  3K5L A;  2D9U A;  4K5X A;  2DY8 A;  3R93 A;  4WFN 3;  1FGB D;  1Z6H A;  5CYU A;  3FPP A;  3HS0 C;  2EZV A;  4KKT A;  4CKB A;  1PRT C;  1E2W A;  2PZW A;  2AQ1 B;  1BDO A;  2ICI A;  5COY A;  1HUM A;  1V1P A;  1B4O A;  3A8I E;  2IW3 A;  2F4I A;  3C1F A;  1IL8 A;  5JVG 3;  3S2D B;  5I4D A;  5JPM C;  3VR3 A;  4F88 A;  3P75 A;  3DHQ A;  1SNP A;  2KOL A;  1LT5 D;  2D5D A;  3E6Z X;  1UUP A;  4ME5 A;  1JB3 A;  2K5W A;  4ZLT F;  4PQX A;  3NP8 A;  3S17 B;  3IFD A;  1X32 A;  3HOU B;  1EY5 A;  3I4M B;  4LMQ D;  3WOE A;  3DWA A;  4CKC A;  3DEP A;  1ZXT A;  1DOK A;  2OEO A;  3TME A;  1WD0 A;  4BY1 B;  2FMC A;  1ZYR C;  1V8Q A;  2CW0 D;  1QCB D;  4IQZ A;  4FYD A;  1KTK A;  2EY1 A;  2VB2 X;  4HR7 B;  2K5Q A;  3JAM L;  4XIG S;  5JVH 3;  3R2I A;  5ELE A;  4KKU A;  3J80 E;  3SEB A;  5M3M B;  1PFB A;  3NBI A;  5IGC A;  5KYL A;  1XXG A;  1QNU A;  1DXM A;  4B08 A;  3HEJ A;  3CHB D;  2QCP X;  2XWB B;  3CRL C;  1W6J A;  2BE5 D;  1WTQ A;  4A3B B;  5DAU A;  1B44 D;  3FDT A;  1JIC A;  1STE A;  1XTC D;  1S5C D;  3A8J E;  1RF2 D;  4A3E B;  1IHZ A;  5D3D A;  4NP5 A;  1GJX A;  1IYV A;  1SYE A;  1KDA A;  3I90 A;  2JYO A;  4C3H B;  3W3A A;  4OO1 H;  2F0G A;  1DD2 A;  1VDZ A;  2A6E C;  2CHB D;  5FO8 B;  3AMU A;  4U67 3;  1EQT A;  1Q90 A;  1FNW A;  1NR4 A;  4N9P A;  4HCE A;  1EFI D;  5JEA G;  1PFN A;  3L9A X;  3D31 A;  3T4A C;  4IFD G;  3J7A F;  4G57 A;  3ND9 A;  5C3W A;  4HSV A;  4XQN A;  2NVQ B;  1BBX C;  2XN9 C;  3BZD B;  4XXE A;  1PRT F;  4KY6 A;  1ET9 A;  1UAP A;  1HCZ A;  2NVT B;  5C4Z A;  4IFD H;  4EQN A;  1PMR A;  3HOV B;  3S1R B;  5KNC A;  3C2P A;  2O5J C;  2QKI C;  4G7Z C;  2KUM A;  2ZXP A;  2KJX A;  2I46 A;  5DNF A;  2LY7 A;  3MHB A;  4ODG A;  1VMC A;  4O42 A;  2EYH A;  2EOT A;  3RUZ A;  4F7X A;  1SFO B;  2R7Z B;  4EGV A;  1U4L A;  1SAP A;  4H7B A;  3FPU B;  4X3T A;  1STY A;  2NN6 G;  2B8G A;  3RZD B;  1EY7 A;  5CV4 A;  1SNQ A;  1D5X C;  5I9O A;  2FIN B;  1SE4 A;  2GA4 B;  3OWE B;  3A8K E;  3OOC A;  1BF4 A;  1JOK A;  1G6Z A;  1YNN D;  4PMC A;  2NB0 A;  4IUP A;  3WOF A;  5CBE E;  1I4G A;  4KK7 A;  4TRD A;  4TKO B;  4KMU C;  1Q3L A;  1KNA A;  2PZT A;  2WIN B;  1SXT A;  1EEI D;  4YIJ A;  1QG7 A;  5EBC A;  2EJG C;  4KI0 A;  3FRP B;  3I3C A;  1H9M A;  1O80 A;  2E74 C;  2O2L D;  2MGS A;  2A6H C;  4RHS A;  5EQ0 A;  1Q12 A;  2PW7 A;  4HN7 A;  4ZQ3 A;  4NW2 A;  1Y8P B;  4IUR A;  2R92 B;  1TU2 B;  4WOR A;  2C5C A;  4NDX A;  1PFM A;  2N55 A;  3A7A B;  2DY7 A;  2KED A;  4UAI A;  2OT2 A;  4H13 C;  1WD1 A;  2D62 A;  1PTO H;  3NE5 B;  3ONA B;  4QCL A;  2X6G A;  4C1N K;  4E6I A;  1RD9 D;  2B2V A;  3TP8 A;  3VR2 A;  2RSN A;  2F1M A;  1GXD C;  4BBS B;  3GTP B;  2N88 A;  3BVZ A;  2NN6 I;  5JAV A;  1KAB A;  4XT1 B;  5EBD A;  4I65 A;  3RMH A;  1DCZ A;  2BOS A;  2O4X A;  3IL8 A;  2NVY B;  1D6E C;  1EY4 A;  1EWH A;  3HOY B;  2ZXO A;  3R2T A;  1QJO A;  4ILW A;  5JOB A;  3HKZ B;  1PDQ A;  5M5W B;  1I50 B;  2FMM A;  4XYO A;  2NN6 H;  2IT1 A;  2XWJ B;  1QIL A;  3TP6 A;  3T53 B;  2Z8L A;  4CBV A;  5EPJ A;  2K01 A;  3MWY W;  1CQV A;  1EYC A;  1Z7T A;  2BDN A;  4QB4 A;  1SYF A;  1BCP F;  1RTO A;  4DNT B;  1TS5 A;  2EYP A;  1Y8N B;  1F2L A;  4DF7 A;  1SMY D;  1WTX A;  1AP0 A;  4TQU S;  4IFD J;  1EZ8 A;  3V05 A;  4KHZ A;  3X3N A;  2AQ2 B;  4FP5 D;  2F0I A;  4G7O C;  1TWC B;  4HMI A;  1XWE A;  2L5T A;  2EYF A;  3S15 B;  3EQL C;  2HCI A;  1G8Z D;  1JCK B;  2R93 B;  3SE0 A;  4C3I B;  2PMZ B;  5LL6 S;  4DK1 A;  2IX0 A;  3DWQ A;  4K6L A;  4C3I G;  1TS3 A;  2Z4I A;  1SE2 A;  1LO5 D;  4B9W A;  3SHL A;  3MXN A;  5ELC A;  2EJM A;  3N6R A;  2XSC A;  4FF3 A;  1TT2 A;  5JEA H;  4K6D A;  2F0P A;  4KTA A;  1CTM A;  2SDF A;  2BCO A;  1V1P B;  3ZYY X;  3U9S A;  1OXS C;  5A2Q E;  3URY A;  3EJI A;  1Q8I A;  1STA A;  1F9Q A;  4BA2 I;  1NCV A;  2EE1 A;  3QJY A;  2JEB I;  2A69 D;  4V0B A;  2L1B A;  3P1H A;  4I7Z C;  2E75 C;  4BBR B;  1CZW A;  1G91 A;  3ERO A;  2R3Z A;  4CKE A;  3K5M A;  3S16 B;  2LKV A;  3KUP A;  3OMG A;  1G2T A;  3HOZ B;  3QB3 A;  4FVM A;  4OO1 G;  5ELD A;  3FKI B;  3N52 A;  1EZ6 A;  1SEB D;  5FKA C;  3QOL A;  4L8J A;  1SYG A;  1MD2 D;  3NWT A;  1AFP A;  1TY2 A;  1CT1 D;  3SXH A;  3H0G B;  3GTQ B;  4ZKB B;  1I6V C;  3WDN A;  2IJ0 A;  1AW7 A;  1BUV T;  2PPB C;  5I6Y A;  1F9S A;  2L0C A;  3S9W A;  1R9T B;  2F0K A;  1O7Y A;  1GOZ A;  2EY5 A;  5C44 B;  2F0J A;  3PO3 B;  1PYW D;  2LMC B;  5EJW A;  2RKS A;  3FVQ A;  4K5V A;  1K8M A;  1HQR D;  4QIW B;  3DWP A;  4PV1 C;  1L0X B;  4IAL A;  4RGT A;  4RCN A;  3BS1 A;  1SNM A;  2ZXR A;  5IGD A;  3BG3 A;  3GP7 A;  3KLS A;  2PZU A;  5KND A;  1STG A;  2K7V A;  3PUZ A;  4X3S A;  2SEB D;  2K05 A;  3HP3 A;  3QWN A;  3DMU A;  5C0X I;  2R61 A;  3KF8 A;  3OMC A;  3M7N A;  1ICW A;  3GD7 A;  1RTN A;  3IKJ A;  2HCC A;  3SK5 A;  2AWO A;  3TZU A;  1YNJ C;  3GO5 A;  1T5E A;  3S1M B;  4FO2 A;  3GTG B;  3K0Y A;  4HSP A;  1RJT A;  4G4K A;  1BQQ T;  2VNU D;  2ZT9 C;  4RH6 A;  4FNF A;  1EOT A;  2LFN A;  4XDX A;  2CW0 C;  5FOB B;  1HTL D;  2JEA I;  1TWH B;  1S5B D;  3AB9 A;  4BY7 B;  1E2V A;  2QEJ C;  2G9D A;  1Y1W B;  2EXZ A;  3D4R A;  1YNJ D;  2BE5 C;  3Q6S A;  2KEE A;  1EIH A;  4IN3 A;  3PUX A;  5IT9 E;  3TN2 A;  3H09 A;  4RFB A;  1A6X A;  3GTO B;  5CV8 A;  2MUY A;  3RD4 A;  1QOH A;  2FHT A;  3CRK C;  1UNS A;  3NWS A;  3PUY A;  3BYY B;  1M4V A;  4DK0 A;  1HFN A;  4L6T B;  4FXD A;  4KJO A;  3NTK A;  2WII B;  4CHT B;  2F0V A;  5CGK A;  3QG1 A;  4CJ1 B;  5I2X A;  5G3L D;  5KNB A;  2MHV A;  5KEE A;  1STH A;  3HOW B;  3Q23 A;  4DXF A;  1Z47 A;  5IGG A;  5M5Y B;  4ZRZ A;  1GUW A;  1WCM B;  3TP5 A;  1AN8 A;  2B2T C;  5D65 A;  2NYZ D;  1TS2 A;  1WTW A;  2M9V A;  3LWE A;  4ZYS A;  4K8I A;  2EDG A;  2QIL A;  1U4R A;  5I9P A;  3H91 A;  1JR0 D;  3LWU A;  4QUC A;  5M5X B;  2SNM A;  4XQJ A;  1HFG A;  1ZKO A;  5E4W C;  1LT4 D;  3SVM A;  4DAV A;  1F2Z A;  2MPM A;  2PNR C;  3S1N B;  1BCP D;  3O13 A;  2K6A A;  5IGB A;  5EPK A;  1TII D;  2L9H A;  5C6A A;  3T51 B;  3J80 L;  4K8J A;  1KNE A;  1QB5 D;  2B63 B;  1NUC A;  2OXP A;  4KN7 C;  5FLX L;  3DEO A;  4K5W A;  2K04 A;  1TS4 A;  1LTR D;  2ENB A;  2EY2 A;  3J7A V;  1MI2 A;  1O7Z A;  4N9T A;  1OO9 B;  2D2C C;  5CV5 A;  3QO2 A;  1V43 A;  5JJZ A;  4PNY A;  5IGF A;  3CKI B;  4C3J G;  1SSO A;  2KHS A;  5I2Y A;  1B9N A;  2YYZ A;  4ULL A;  3VYU A;  2RVL A;  4DFA A;  1BOS A;  5D14 A;  4C1N I;  3SR1 A;  1U4P A;  2EVB A;  3QIA A;  1ENA A;  4KD4 A;  4R8I A;  2EY6 A;  4KD3 A;  3KBX A;  1A15 A;  2KCC A;  2Q8T A;  1NAP A;  3D4D A;  2K03 A;  4OIK A;  4BA1 I;  1T5X D;  3CU7 A;  1Y1V B;  1TVX A;  4DXG A;  1HRJ A;  2HUG A;  1ZEQ X;  2AUK A;  4DNR B;  1U4M A;  1BNZ A;  1DOM A;  5C5L A;  3PUW A;  3Q0A A;  3FEW X;  2JP1 A;  2K1B A;  1GUT A;  3G6J B;  5J1Z A;  2A68 C;  2WB1 B;  3R8B A;  1TWG B;  1D2B A;  1PTO C;  2B2U A;  1C4Q A;  1ROD A;  4MIU A;  5E4X A;  3NUC A;  1I4Q A;  4IUN A;  1SNO A;  1STN A;  5ELF A;  3SK6 A;  5BN4 A;  2I07 B;  2RA4 A;  1HQM C;  1TWA B;  3S1Q B;  2WKD A;  2QF7 A;  4FF1 A;  3I8Z A;  1H9S A;  3NBH A;  3K5N A;  1LV9 A;  2F3W A;  5DM7 3;  1Q1B A;  2JA6 B;  1AZP A;  2HDM A;  1F2M A;  1EIG A;  2FJ2 A;  1CA5 A;  1ILQ A;  5KIX A;  1J8I A;  5IIF A;  1I3Q B;  1TWF B;  1EL0 A;  4FXK C;  3JAM E;  1V1O A;  1RCV D;  3A54 A;  4H0L C;  1A3U A;  2K32 A;  1PRT D;  1JE4 A;  1MBY A;  1D1I A;  3TDQ A;  1OXU A;  3E5S A;  3V96 A;  2CVR A;  3C46 A;  1SYB A;  4M8A A;  3D3R A;  4C2M B;  2J7Z A;  2TSS A;  3S2H B;  1JWU D;  2B8F A;  2RDF A;  1SJE D;  2A68 D;  4KHV A;  3MZ5 A;  2OF1 A;  1BCP C;  1AZQ A;  2VUM B;  1TKW B;  4J8Q A;  1W6K A;  3SK8 A;  1TY0 A;  2BA0 A;  1EY9 A;  4OIJ A;  4U68 A;  3I73 A;  4EVO A;  1D5M C;  3H94 A;  2B2W C;  5FO7 B;  1SJH D;  1X3P A;  5C4J B;  2X69 A;  5KRU A;  3K57 A;  4DGZ A;  4CJ0 B;  1WTP A;  4ID6 A;  1CI3 M;  5F2D A;  1HA5 A;  3J7Y W;  1SND A;  4QMG A;  3TSS A;  4ABN A;  4KJN A;  5EPL A;  3EA6 A;  1A3T A;  1F2Y A;  4K14 A;  1SMY C;  1SNC A;  1D5Z C;  3I91 A;  1H9J A;  2PCF B;  2AQ3 B;  1MSG A;  1LT6 D;  4LAA A;  1H9S B;  1CFM A;  3NQT A;  1EWC A;  3MEH A;  4KN4 C;  3I72 A;  2JXM B;  1R4Q B;  4ZUJ A;  2F0W A;  2H4O A;  3M3Y B;  4RA8 A;  3HRZ C;  3NXW A;  3L7Z C;  2NWG A;  1A2U A;  4RAU C;  1Y8O B;  2VXW A;  1AEX A;  5JEA J;  2IL8 A;  4KV6 A;  3QOJ A;  1F77 A;  1F9R A;  5D3I B;  3NTI A;  2PYK A;  3PO2 B;  2F03 A;  1DM0 B;  1I4P A;  3C1E A;  1KDC A;  4C3H G;  2NUC A;  1MSH A;  5BN3 A;  4V19 0;  5IOC A;  2YU9 B;  3MXP A;  1IKM A;  1CHP D;  2NBF A;  3VYT A;  4OHJ A;  5CBA E;  1O78 A;  5CC4 A;  1KLU D;  3VR4 A;  1IKL A;  4CGY B;  2F0F A;  1FR3 A;  1FNU A;  3GV3 A;  2DN8 A;  4A3D B;  1HPC A;  1J9O A;  4XT3 B;  2L11 A;  3CQZ B;  2EYL A;  1ENF A;  2B2T A;  5I6W A;  1ESF A;  3K6O A;  1JWS D;  1LTA D;  4A3I B;  1Q1E A;  5KYI A;  4NMZ A;  2J4X A;  1FD7 D;  2WAQ B;  4X3U A;  1X3Q A;  1NR2 A;  1OXV A;  3M4O B;  3K58 A;  1BCP B;  1IYU A;  2K28 A;  2RDG A;  1S5D D;  3HZX A;  1CA6 A;  4XTC S;  2IX3 A;  2FFK B;  2Z1C A;  4RGO S;  1PTO F;  2H1E A;  3J81 E;  3NQI A;  1K8O A;  3M4Y A;  1YNN C;  5CV7 A;  2F0T A;  2F0S A;  3DXJ C;  2G9H D;  3NSW A;  3BDO A;  1RHP A;  3GTK B;  2KCN A;  1C48 A;  5LL6 X;  3LX0 A;  5KGU A;  1EY6 A;  4R9W A;  2V4D A;  4KY7 A;  3I4N B;  3PIP 3;  3PV0 A;  5EKI A;  3MFG A;  4A3G B;  1NSN S;  2PW5 A;  1DOL A;  3DM1 A;  1SYC A;  2XIW A;  2E2H B;  3OWF A;  4IUQ A;  1JOO A;  3PMF A;  1PTO B;  4A3F B;  1HUN A;  1ENC A;  3ND8 A;  4DAP A;  4QF4 A;  2TMP A;  1H9K A;  4XYQ A;  1S5E D;  4FXG C;  3KBG A;  1UEA B;  2B2V C;  4Q5V A;  1CHQ D;  2QDB A;  1TQO A;  4X3K A;  3PIO 3;  3VR5 A;  4RGN A;  3AU7 A;  2B2Y A;  4HMJ A;  4JBW A;  5C3E B;  1LLR D;  2HQE A;  3Q24 A;  2O5I C;  1L0Y B;  2XNA C;  4IZ8 A;  3BDL A;  3HOX B;  1EU4 A;  1GUO A;  1C8C A;  3I70 A;  1EYD A;  5FK9 C;  1ET6 A;  2WKC A;  5IT9 L;  2A5H A;  1JOQ A;  1LAB A;  2RQX A;  2JA5 B;  3W2D A;  1BXT A;  3MFY A;  1S4Z A;  4GZY C;  4IUU A;  4DAY A;  5CMD A;  1EYA A;  4MN3 A;  2EYJ A;  1F9P A;  4HCS A;  2PO4 A;  1I4H A;  2IWH A;  3BYT B;  1KLG D;  4RWS C;  4IUV A;  1E2Z A;  1VF5 C;  2KVM A;  1STB A;  1EY0 A;  5G3L F;  3FMC A;  4KKS A;  2Y0S B;  1HTP A;  2Q8I B;  4F87 A;  1PZJ D;  1ML0 D;  2PQE A;  2KEC A;  3MC0 B;  1DYQ A;  1WTV A;  3T13 A;  3U9O A;  3NTH A;  1XX8 A;  4A3K B;  4M1U B;  3BVM A;  4WRD A;  5T1I A;  4K2L A;  2NTT A;  2E2I B;  3K5O A;  3EFX D;  1QE6 A;  1KAA A;  3TP7 A;  2X6L A;  3M85 A;  4ZK9 B;  4LJZ C;  5J39 A;  4OL7 A;  5COR A;  5BN5 A;  3GTJ B;  1PRT B;  1O7L A;  4MHE A;  2IX1 A;  3S14 B;  3IAY A;  1A3V A;  3VR6 A;  5FLX E;  2B39 A;  1EQV A;  1LTT D;  2K5D A;  2KQ3 A;  1LTB D;  4AYB B;  4ZUI A;  1WVL A;  2J0T D;  4HTH A;  1B50 A;  5JPN C;  1GUN A;  1IW7 D;  1LT3 D;  2A74 C;  3TZD A;  4F8M A;  1RDP D;  1PXU A;  2F3V A;  2XRQ D;  1LTI D;  4BWG B;  4HAE A;  4PMB A;  1PLF A;  2M00 A;  4C3J B;  1QNK A;  4L63 B;  2B2W A;  3MVV A;  2DNC A;  4UDU C;  2L55 A;  1JQY D;  2K33 A;  5A2Q L;  3MXU A;  2ICE C;  3UI2 A;  4QUF A;  2F0E A;  3OIP A;  1XYI A;  4RHR A;  1M8A A;  4WJW A;  1GUS A;  1SE3 A;  5EKL A;  5K36 G;  5CV9 A;  1OXT A;  2L4N A;  4DU9 A;  2B2Y C;  4IUT A;  5AFW A;  3P7J A;  4HED A;  3KLR A;  2MP1 A;  3A7L A;  3NPP A;  2Z4H A;  4BS9 A;  2E2D C;  5TSS A;  2F0N A;  4Z9C B;  1DON A;  4Q0F A;  1B53 A;  4EQP A;  4KY5 A;  2HDL A;  5EGT A;  3GTM B;  3GTL B;  1R4P B;  1IW7 C;  1LTG D;  1TR5 A;  4ZKC B;  2RSO A;  4B9X A;  2L12 A;  1GUG A;  1WTO A;  5FO9 B;  1I4R A;  3MXG A;  3X3M A;  5CV6 A;  3SDZ A;  3D4W A;  3A56 A;  2A73 B;  2F0O A;  5DM6 3;  1II3 A;  5DEH A;  4DA2 A;  3T56 B;  2WAC A;  2VB3 X;  1E0B A;  1GHK A;  3D8G A;  5M9O A;  5C0X H;  3VA7 A;  2XVS A;  5C4H A;  3H6M A;  3GQB A;  2DNE A;  2WP8 J;  3OPO A;  3H3V C;  3MTS A;  3NHH A;  1HA6 A;  2EYO A;  3SK4 A;  2AWN A;  5T1G A;  4RKL A;  1SDF A;  2NVX B;  1JWM D;  4TSS A;  2EPB A;  5ELB A;  1HXY D;  2F0Q A;  5E1F A;  3G7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...