3CHBD

Cholera toxin b-pentamer complexed with gm1 pentasaccharide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPRAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords CHOLERA TOXIN
publication title The 1.25 A resolution refinement of the cholera toxin B-pentamer: evidence of peptide backbone strain at the receptor-binding site.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 25
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1998-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3chbD00
1BXTA 1SJED 4DXGA 1G8ZD 1AW7A 2ICIA 2AQ3B 1GOZA 3DWQA 1SE3A 2XNAC 3TSSA 1BCPF 1LTSD 2TSSA 5ELEA 4Z9CB 1EU4A 1S5DD 1LTAD 1LT4D 2Z8LA 1JR0D 3R2IA 1DJRD 1LTGD 1QILA 5I4DA 2NTTA 1PZID 3R2TA 1PRTC 1SE2A 2RDGA 1JCKB 5TSSA 3BZDB 4C56C 2J4XA 2XRQD 1PTOD 3R8BA 1PRTB 2IPKD 1HQRD 1JQYD 4L63B 1PYWD 3SEBA 1ET6A 1I4HA 1LTRD 1LTID 3DWPA 1S5BD 1CT1D 2R61A 1LLRD 1PTOF 1V1PB 3O13A 4OHJA 1EEID 1S5ED 1I4PA 2XN9C 1LTTD 2SEBD 2RDHA 1F77A 1XXGA 1D5MC 1TS3A 1SEBD 4RGTA 1MD2D 2G9HD 1TY2A 4TSSA 1FNUA 3DWAA 1BCPC 3W2DA 3V05A 1B44D 2QILA 1CK1A 5ELDA 1KLGD 1BCPB 1S5FD 1V1OA 1TS5A 2CHBD 2XRSD 1D5XC 1CQVA 1ESFA 1HA5A 5FKAC 4RH6A 1SE4A 3URYA 2IJ0A 4RFBA 1KTKA 5D3DA 1L0YB 3KLSX 3EFXD 4DXFA 4RGMA 1FNVA 1HXYD 2NTSA 1V1PA 1AN8A 1D6EC 1EFID 1RD9D 5D3IB 1TY0A 1RCVD 1D5ZC 3EA6A 3BVGA 1LT6D 4RCOA 1RDPD 1M4VA 1PTOC 1TS2A 5ELCA 4K6LA 1SXTA 1CHQD 1FD7D 1FGBD 1PZJD 4ZYSA 1PTOB 3GP7A 1CHPD 1ET9A 1SBBB 4L6TB 1STEA 4RGNA 1PZKD 3MC0B 3BYYB 1PRTD 1LTBD 5FK9C 1B1ZA 1T5XD 1DYQA 2WV6D 1FNWA 4RHSA 1PRTF 2O2LD 4RGOS 1I4XA 1TS4A 3CHBD 1RF2D 1UNSA 1JWSD 1EEFD 1LT3D 3BYTB 4O1NA 1ENFA 1EU3A 1HTLD 1I4GA 1JWUD 1EWCA 1PTOH 4BWGB 1I4RA 1JWMD 1S5CD 1LT5D 4RHRA 5ELBA 1SJHD 2AQ1B 1KLUD 3BVZA 1L0XB 1UUPA 5ELFA 1XTCD 3OWEB 1LO5D 3MFGA 4UDUC 2QEJC 3BVMA 1I4QA 1BCPD 2AQ2B
chains in the Genus database with same CATH superfamily
5EGTA 3HOWH 4C1NK 3MXUA 4DXGA 4IPCA 2O4XA 1C4QA 2HT1A 2TSSA 2ZXPA 1VDZA 2IHFA 1N34L 2ENBA 1UE6A 1D2BA 3KLSA 2PQAA 2WKDA 1CA6A 2BH2A 4E6IA 3TP7A 4K14A 4L5SA 3PIPA 4J15A 2R3ZA 2B2WC 3KYHC 2AHOB 1EY9A 4IPHA 3TP5A 1B70B 3R8BA 2F0HA 2JA5B 2EY5A 1LTRD 5T1IA 4P72A 4R8IA 2F0IA 1WOCA 2EYJA 1UAPA 4UY8C 5J39A 1PH6A 5D65A 1VQHA 3RR5A 1JB7A 1VQ9A 1Z9FA 4LNQA 4JI1Q 2KJXA 4A3FG 2VQFL 4WRDA 1D5MC 3PF5A 4NPSA 1IHZA 4H44C 1PH1A 4YHHL 4Y7NB 3A56A 2ZTCA 3E9IA 1YNJD 4UP7A 2ZTDA 3S14B 5DM73 1SMYD 3MVVA 2RSOA 4TVAB 4LF6Q 1YNND 4A3MG 5C4ZA 3I55A 4DV7Q 4ABNA 3T4AC 3UI2A 3NWSA 3I4NG 3BU2A 5IODA 3A7LA 4P71A 3SE0A 3SK6A 3CCMA 3E5SA 1F2LA 4LK1C 1G2SA 4K6LA 4UP8A 4DR1Q 1YITA 2Q2TA 4DR6Q 3HOVH 3T16A 4ZYSA 1MJEA 2R7ZH 5IGGA 3NEMA 4G57A 1BBXC 5GQOA 4GOPC 5FK9C 1J5EL 5I2XA 1P16A 5IOCA 2HDLA 1FNWA 2I07B 4ZUIA 4PMWA 4MN3A 4CDFC 1ENFA 1PTOH 4A76A 3TS0A 1A62A 1VQDA 1I6HB 3U50C 1IYJB 4NW2A 2IHEA 2VXWA 4BA1I 1LUZA 2F0VA 1G8ZD 2Z6KA 3VYTA 2HIXA 2NYZD 3MEHA 3CRLC 1HR0W 3WWVA 1QE6A 2B8GA 4HMJA 2JA8H 4DAMA 1LTAD 5M5YH 1QILA 2FFKB 1IBKL 3PUYA 5I9OA 2UXCQ 2XRQD 1VCIA 2VL6A 4QJFA 2NBFA 4JOIA 4KKTA 3CF5A 5C0XH 1PVOA 4OHJA 1VQ7A 3N6RA 1Q82C 1N34Q 4IUVA 4HTHA 5JJZA 1GHKA 5C6AA 2RDHA 4U68A 1DCZA 2RBMA 4OL7A 1O78A 1GUNA 1VQKA 1TY2A 1STAA 4YIJA 3V05A 2KHJA 4I7AA 1XWEA 1KLGD 1SNMA 4ZKCB 4H13C 4HJ8A 3PIOA 1GM5A 4IJHA 1DZ1A 1Q1EA 1VQEA 5A2QE 1ICFB 1E0BA 2HUGA 1QCBD 4YY3Q 4N9TA 2VQFQ 4LUOA 4HJ5A 4B9XA 3L7ZC 1EFID 4R4TA 4YHHQ 1M4VA 3LGJA 3QG1A 4DKAC 3U58A 3NTIA 4KN7C 3HS0C 4JI5L 1ET9A 1KAAA 2HCIA 4JI7Q 2UUCQ 4KKUA 2F4VL 2K52A 2D62A 3A5UA 1ILPA 2Z0SA 2ZXRA 3MWYW 3R93A 4B3ML 1HFGA 2CW0D 2OEOA 4R8NA 1RKNA 2AKWB 5CR3A 5BN3A 1IW7C 2K5VA 1L1OA 1S5CD 1U0LA 1KQSA 4A3JH 3Q8DA 4C3JG 1NNXA 4DV4L 3I90A 4A93G 2L1BA 1OXUA 1J5EQ 3E3XA 1CKNB 1DM0B 1QVGA 3GDEA 4BBSB 3MXNB 4DR5L 1Q3LA 4M8AA 2G9DA 2Q8RE 2E5LQ 4GLXA 2EZVA 2GN5A 5IYCG 4Z9CB 4QL5A 4YCWA 1ZYRD 2BOSA 4BBRH 4QIWB 1PYSB 2QF7A 1E1TA 2HQLA 1JCKB 1MJCA 4R4QA 4JI8L 1F9QA 3DEPA 4RAUC 3P7JA 2X6LA 1JQYD 3CRKC 3TREA 2F0NA 3KF8A 2A8VA 2MO0A 3PMFA 2FJ2A 2XSCA 4OGQC 4DK6C 1MKHA 2CH4W 4JVZA 4DA2A 2KVMA 3OW2A 4JBKA 4UPAA 2GA4B 1KNEA 3VA5A 4OONA 4KKSA 1SFOH 4EQOA 1I3QB 3H3VH 1PLFA 4WORA 5G3LF 2EJGC 3WOEA 2MQHA 1YHBA 1WI5A 3UDGA 3TQYA 4I65A 4O0AA 3RLOA 3HKSA 1CZWA 1K8OA 1K9MC 2NWGA 4A3EH 2DNEA 2FHTA 3F2BA 1C8CA 4LF5L 1R4PB 4A75A 5DAUA 2B2WA 4IUNA 4A3FH 1HCZA 1JC7A 1TWAB 2KENA 3OPOA 1BNZA 3CC2A 3KLWA 2H5XA 3EA6A 3FKIB 3C3LA 4U673 3GV6A 2Z4HA 1TWFH 3U9OA 1VQ8A 3T53B 5C4HA 1STHA 3V96A 3Q22A 4L6TB 1P8LA 2NB0A 3KOJA 5KYLA 4IUTA 2L15A 3J80i 2YTVA 3I4NH 3RLNA 2L9HA 3RMHA 1C48A 4OWWB 1WCMH 1EU3A 1ZKOA 3JAML 4JPBW 1SMXA 1HZCA 3CMEA 4JI5Q 4BY7G 1CQFA 1SJHD 1OXVA 1K28A 2N3SA 1U4LA 2JA7H 3S15B 2F4VQ 4V0BA 2HHHL 1GUGA 3G48A 1E22A 4BBSG 1EYAA 4YCUA 2R7DA 3E0EA 2RKSA 5EBCA 3G6EA 1B8AA 4B3MQ 1XYIA 3H6MA 2A68D 1VQPA 1QB5D 1VQ5A 4NB3A 3A8KE 2BA1A 4GOPA 4DK0A 1NJIC 1DJRD 4J8QA 1LTGD 2MNAA 1X65A 2F0TA 1QG7A 3H91A 2JA8B 4BS9A 4AQYL 2DY8A 1G51A 5M5YB 4K8JA 1PHJA 2F0EA 1JOKA 1EZ6A 4DR5Q 1YI2A 2P5ZX 2VY3A 4LMQD 2ID0A 2RDFA 3Q23A 2PQEA 4GN3B 4DV3L 1O7LA 3M85A 2JA6B 1PH3A 2K5QA 3F1ZA 4A3GB 1X3GA 1TS3A 2ATWA 5IY0A 1EOVA 2R6GA 4EQPA 2PI2E 4JV5Q 4JI8Q 2JA5H 1B44D 3A0JA 1IXRA 3NP8A 3W5OA 4HJ9A 3VR2A 1PFSA 1AP0A 5JEAJ 4GKJQ 4APVA 4RMFA 1EY7A 2A5HA 4HIKA 3PGZA 5JVG3 4F8MA 4MNOA 4RGMA 5IYDG 3FKIG 3A54A 2EYOA 5IP7H 1BDOA 4Y7NH 2EE1A 2TMPA 4HCSA 2F03A 1Y69U 3SR1A 5IGFA 1SE8A 1TVXA 3S14H 1RDPD 4L5TA 2IY5B 1B3QA 1PH9A 1H9RA 2RA4A 3M4QA 3GP7A 1B53A 2RQXA 1WTRA 1NY4A 5FO7B 4QCLA 1OXXK 3I2ZA 4LF5Q 1PRTD 5FLXE 1HNZL 3ERQA 3M3YB 3RNUA 4DR4Q 1JJCB 3BS1A 2O2LD 3K6OA 4O1NA 1GJXA 3MTSA 3G6JB 5K36G 3GO5A 2MO1A 2E2DC 2E2JB 2LS01 3NELA 5CV6A 5FJ8G 3HOZG 3PIP3 4X66L 1N9WA 3S1RB 3VYUA 1WTOA 2B8FA 1X9NA 4K2LA 1SNDA 3MA2B 2N49A 4ZK9B 1TWCB 1ZEQX 3H0GG 1RODA 3M4OB 1I6HH 1RIPA 5A35A 3L2PA 1ICWA 3HKZB 1JR0D 3GV3A 2IX0A 1CKMA 1S3OA 4XQJA 3RZDB 3VYRA 3PUZA 2B2TC 3T1YL 1NMFA 3EVQA 4L8JA 1Z6HA 2C5CA 4DV5L 1EIGA 1LTLA 3UDXA 4N9PA 5C44B 1VQCA 1EQVA 1H9JA 3CAMA 3VR5A 5IYCH 1CSQA 3B6YA 1KRSA 4HEDA 4HIDA 3JAMi 5JAVA 5DM63 5J3BA 4AQYQ 2K28A 1FNUA 5K5PA 2M00A 5ELDA 5EPLA 4BY1G 2NVYH 1FJGL 1E2WA 1YVCA 4FXGC 4KD4A 4RH6A 2EYHA 1SE4A 1I94L 4DV3Q 5CC4A 3NBHB 4PNYA 5IT9E 4QF4A 4NXMQ 2DJFC 2JEAI 1STNA 3NTKA 1VMPA 1HHVA 5CMDA 3BVGA 1CHQD 2F3IA 2B2YA 2Z6BA 5LL6X 4R4IA 1J8IA 1Y1VG 5EKIA 4KY6A 5GAGC 5C4JH 1DOLA 1UE5A 2N55A 3CCVA 3D4DA 1R9TH 1BBUA 4OIKA 4A3MB 2B63B 1EQTA 2K5DA 1BBWA 4LF8L 3PO3G 1YNJC 4RGOS 1MIUA 3DEOA 2MPMA 1SMYC 3P1HA 3HEJA 5CBEE 1YNNC 3M9BA 4CKBA 4Q5VA 5I9PA 1A3UA 1STBA 1A0IA 3W1BA 4CJ2C 3S24A 3CU7A 3GQBA 5GAHC 1YJNA 4IN3A 1YHAA 4X62Q 2H1EA 3VR4A 4DV0L 2PYKA 3N52A 1GUTA 1SE3A 1LTSD 2HIVA 3HKZG 4A4IA 2ZM6Q 4AYBB 1SNOA 3BJUA 5LMUL 3HRZC 1EY4A 5KIXA 4IALA 1IBLL 1OTCA 4OWTB 4KHZA 2C9OA 2RDGA 4K6DA 3X3MA 4X66Q 1QNUA 3EIVA 4K0KQ 2QDLA 1DGSA 1Q90A 2DJGC 1WTHA 2PNHA 4BBSH 3J81E 4A3DB 3ONAB 4CJ0B 5KGUA 3UDFA 2WKCA 3PIO3 1LTID 4LFAQ 4IFDJ 3C2PA 1CKNA 2Z9HA 2VB3X 1UEAB 3MXNA 3FRPB 1PYBA 1XXGA 4NKLA 3T1HL 2B39A 4TSSA 3IAYA 3H3VC 3ZJYC 3MHBA 4GNXB 3TN2A 3PO2G 4JCVE 3K80C 1T9HA 4G4KA 4DV5Q 3S9WA 1HPCA 1K0SA 5M3MB 3E0JA 1S5FD 4R9WA 4QY7A 4X6AH 5CV4A 1AEXA 3I73A 3OYYA 1JJGA 1V43A 4DU9A 3NPPA 1SYEA 5D3DA 3KUPA 1RTNA 3EFXD 5DEHA 1FNVA 4ME3A 1I3QH 5JOBA 5C3XA 4BXXG 4HN7A 5D3IB 3DUZA 1TY0A 1RCVD 2F0SA 1TS2A 4XYOA 5EAYA 1V8QA 3PUXA 3D8GA 1YJWA 2GVBA 1AZPA 2VB2X 1F9SA 1NAPA 2DY7A 4KK7A 2B63G 1GXDC 5LL6S 1TWAH 3FKIH 5FO9B 1XMOL 2A6HD 4HAEA 1WD1A 2UUBL 1JWMD 2YTYA 2LSSA 2A73B 1PV4A 4Y52H 4DV1L 2UXDL 3BVZA 1W6JA 3NQTA 1CA5A 3GTKB 2AUJD 2VS1A 1LM0A 2I46A 3KDFB 3DM3A 2CH4A 2ICIA 3NQIA 1GOZA 3TSSA 1CSPA 2EOTA 4AYBG 1UE7A 5K36H 1SRUA 1S5DD 3HGBA 1QWYA 1HNXL 2O5IC 3G7LA 4PMBA 3S15H 2D0PA 1XMQQ 3K5MA 1IBML 5FJ8H 5J22A 2E74C 1X55A 1EQQA 4A3DG 5CV5A 3IRBA 4G7ZC 3MEFA 1Q81C 1HTPA 4C3JB 1XNRL 2Q8TA 4DV0Q 3SEBA 3OHXC 4A93B 1EUJA 2CW0C 1JICA 3H0GH 1O7YA 1S5ED 4IPGA 4JBWA 3A55A 4ZRZA 2A1AA 3ULLA 3VR6A 2D9UA 5M3FG 1AE3A 1CZGA 1HNWQ 5JJKA 4GNXC 3PF4A 1NCVA 1CFMA 2JK8A 3EROA 1CM9A 3Q6SA 4HIMA 1V1QA 1II3A 3NHHA 5M3MG 1B2TA 4LFCQ 1R4QB 3J7A5 1UE1A 1X56A 5JEAG 1XNQQ 2K01A 3DXJC 1TS5A 5EJWA 1U5KA 1D5XC 2KHIA 2KUMA 4G7HC 5LMNL 2OF1A 3ULJA 2JA6H 2NVYB 3BDCA 2B2TA 3J80L 5HY6A 4A3GH 1ZYRC 1A8VA 3F2UA 3D6WA 1TXYA 1AN8A 4DR2L 2IT1A 4C3IG 2LFNA 1YIJA 1TWGB 1HA6A 4PG3A 2WB1E 5FOBB 4B3TL 2WAQE 4XQNA 1STEA 3VYSA 4DGZA 3CPFA 3G71A 2B2UC 5C4JB 2VW9A 4DAPA 5EPJA 2FMMA 3ND8A 3T51B 5FLMG 5ELNA 2IWHA 4O42A 1R9TB 1VQJA 2K04A 4DV2L 4ME5A 5IP9G 3ER0A 4A3LG 1I4GA 4H0LC 1KXLA 1Y1VH 4IUUA 1LT5D 3QIAA 4HSVA 2QGQA 2F0GA 2MHVA 1X3PA 3PV0A 1NBWA 1YBYA 4A3BB 1BCPD 3M3YH 2D0OA 4DAVA 4C1NI 2VQEL 4GLAC 1XMOQ 3PO3H 3CCJA 1O7IA 4FP5D 5KNCA 2BCOA 3OTOL 2BA0A 2E2JH 1HJPA 4O2DA 5KRUA 1EU4A 4DK3C 3SXHA 4N8FA 3OMCA 1KD1C 2F4IA 1SYBA 4P73A 4DV1Q 2UXDQ 1QVFA 2MFIA 4KJNA 5I2YA 2EPBA 5M9OA 5GAEC 3S1RH 1VQMA 3BZDB 3T56B 1PH5A 2FXQA 5E7NA 2J4XA 4EVOA 4BY7B 4DUZL 1PRTB 1TWCH 2F1MA 3TMEA 1JOOA 1U9RA 2Q2UA 3M4OH 3S1NH 4IZ8A 3EN2A 4LAAA 4PZ7A 3H15A 4A3CG 3H09A 1HNXQ 4C2MB 3RZDH 1HRJA 2EXDA 1RTOA 3U4VA 2F0FA 2Y0SE 1CK1A 1VQIA 1N32L 4JW0A 5C44H 1K0RA 4JBJA 3CQZB 3I7FA 4JI4L 1Y1WB 2A68C 1UEBA 4MTNA 1QNKA 4HMIA 3K5LA 1GHJA 4GS3A 2R93G 1C9OA 3RLFA 2RVLA 3OMGA 1DONA 1A3TA 4ZUJA 1F2YA 1L2FA 1Y8OB 2XWBB 1IBKQ 1O7ZA 2O5JC 3PO2H 2PNRC 2OQ0A 4OWXB 3A7AB 4ZLTF 4DR3L 1SBBB 2F0JA 5LMNQ 1JOQA 2YU9B 2RF4A 4RA8A 1A3VA 2HD3A 3AFPA 4IJLA 1SYFA 4RKBA 1JB3A 3M4YA 3F8TA 4BXXH 1H95A 3I56A 1N36L 4FYDA 3S17B 1PRTF 1UNSA 4K5WA 1C7YA 1HTLD 3STBD 2OQKA 1EL0A 3R3OA 2ASBA 4B3TQ 5KNDA 4Q0FA 1XPUA 1VF7A 2SNSA 2K5WA 4A3BG 2KOLA 2EYPA 4A3MH 1XPRA 2QEJC 5JPNC 1HQMC 4LW1A 2B63H 1DD2A 3A8IE 4LWCA 3K58A 3I72A 2XGTA 3A5ZB 4GKKL 3S2HB 2F0UA 1Q86C 5IIFA 1KHIA 3KLRA 4DV2Q 2D2CC 4NXNL 2KECA 1Q7YC 4X3SA 1SNPA 3PCOB 4ODGA 4KMUC 3K5NA 2NVTB 1SR3A 4IUQA 3PUWA 1YHQA 1W2BA 1PRTC 3QO2A 5C3WA 1G291 2PO4A 4LF4L 5BR8L 3HOZB 1OXTA 4JI6L 4AH6A 2VQEQ 3ND9A 1CT1D 1UWVA 1V1PB 3RN5A 1TR5A 1MI2A 1Y8PB 4KLKA 4OEMB 4POGA 1U4RA 5E1FA 3OTOQ 1EIHA 2XN9C 1XPOA 3AEVA 3FP9A 4YWMA 3GTPB 1F77A 3H0GB 4B3SL 1AH9A 3CCEA 2B2VC 1WTXA 1EYDA 4ZKBB 4F87A 4FO2A 2K4KA 2F0LA 3NUCA 3U9SA 5M5WH 4A3DH 4DV4Q 1V9PA 1E1OA 3KBXA 1Y1WG 2JP1A 4OELB 2FINB 1I5FA 3S2DB 3OW7A 5E3FA 4DNRB 5C5LA 1CQVA 3K0YA 3KJOA 4KD3A 3URYA 3S16B 2YYZA 2AWOA 3DLLA 5JPMC 1ENCA 1HH2P 2PW5A 1EWIA 1HXYD 2A6ED 4YCVA 4IOAA 4F7XA 2UU9L 2PMZE 4PV1C 2RHQB 5M3MH 3D4WA 1PZJD 2WB1B 5JEAH 3J81i 1K73C 4GNXA 2EYMA 1GUWA 1LABA 4IURA 1H9SB 3BYYB 4BY1B 1PH7A 1HZBA 3CCLA 2PPBC 4MIUA 4X65L 5A2QL 4LF7L 2PZTA 4A3IG 3AU7A 3J81j 2A69D 4CBVA 2HCCA 2I5LX 3NBIA 1JT8A 4WJ4A 1LV9A 1F2MA 4MTKA 1E24A 4K5XA 1NMGA 1Y1VB 1KAWA 1PA6A 3J7AF 4OXPA 3BG3A 1KC8C 4RWSC 2N8NA 4XXEA 1N36Q 5FLMH 2CKZB 5IGBA 1WTVA 1E3PA 1MSHA 2J0TD 2DNCA 2E2HB 4IOCA 5IP9H 2XIWA 5KEEA 4A3LH 4M1UB 2B2UA 3D6CA 4S3SA 2KCTA 4B3RL 3ITPA 3PO3B 4R4OA 2DN8A 2EDGA 4ULLA 3GTKH 3OWFA 5J1ZA 3HOVG 1PZID 1TT2A 4K5VA 3H94A 2WP8J 1FVIA 2A19A 4QGUA 1HQRD 1ET6A 1I4HA 3JAMc 2AWNA 2QEXA 4NXNQ 3BZKA 2R7FA 3Q0AA 2K05A 4QB4A 4KHPL 2NUCA 2ZT9C 3QJYA 2K33A 1ESRA 3I4MB 3P20A 3U4ZA 3S1NB 2RHSB 2GVAA 1G6PA 2L0CA 2LY7A 4TKOB 2A74C 3W2DA 4C3JH 5EQ0A 4ILWA 1A2TA 4LF4Q 4A93H 5BR8Q 4J1MA 2HHHQ 1EFWA 2F3VA 4GLVB 1V1OA 4XT1B 3F2CA 1PH2A 3UDIA 1TQOA 2BE5D 2OTLA 4A3CH 4X3UA 4DXFA 4WFN3 3NK9A 4B3SQ 5C5MA 3TRZA 1NUCA 2F0DA 4XDXA 2WB1G 1FGBD 4XQQA 5M5XB 1WTWA 1KL9A 4P2CB 2F0OA 3HG9A 3UE1A 3PO2B 4KY5A 3GTMB 3HP3A 2OCEA 1TKWB 3D0FA 3S1MB 1B1ZA 1NR4A 2VUMB 3EJIA 4QUCA 1IZ6A 1D1IA 3CPWA 4ALPA 1EIFA 2L5TA 2UU9Q 1A6XA 1TWGH 3I91A 1TS4A 1STGA 4JI1L 4HCEA 2ES2A 1SROA 2E2IB 4IUPA 4CDCC 2C35B 1VQNA 3W1GA 4KV6A 4UDUC 4R1JA 1TIID 3HOUB 3K7UC 5DNFA 1I4QA 3DHQA 3O13A 1LACA 4X65Q 4LF7Q 2CCZA 3SDZA 2M2LA 2AQ3B 3HFZB 3UE0A 4KJOA 4AIMA 3RZOB 3OIPA 5JVH3 1N33L 5EKLA 5EKKA 3EBEA 1VQAA 2NTTA 4DR6L 3R2TA 4IQZA 5C3EB 4FF2A 4A3BH 1EY6A 3FMCA 5TSSA 4OO1I 2MJ8A 4QUFA 1PTOD 3SGIA 5BN4A 4J6HA 4PZ6A 1HNZQ 1K3BC 2MGSA 2A6HC 4CKCA 1Z7TA 4LFBL 3QR8A 4QQBX 1X6OA 4CKEA 2ZJRA 3I4MG 1BR9A 1X3EA 3TP8A 1IYVA 1PH4A 1VQLA 1A2UA 1SNCA 2Y0SG 4PZ8A 2G9HD 3GTOB 4BY7H 1XJVA 2K50A 3LWUA 2F0WA 3NSWA 3J7AV 1VQ4A 1QUQB 2YTXA 1BCPB 1E2ZA 3BZCA 5M5WB 1B3AA 1F2ZA 1VQOA 1AE2A 1CI3M 1ASYA 4KHPQ 4C2MH 2QCPX 2EYFA 3KLSX 2WFWA 1KABA 5CGKA 4LJZC 1RD9D 4WJ3M 1VF5C 4RCOA 2FMCA 1HFNA 1MGSA 3QWNA 2EXZA 3CQZH 5M3FB 3T1YQ 4NDXA 2CQAA 1Y1WH 1XX8A 3TS2A 2EY2A 4JK1C 3J7YW 2B2VA 2VUMG 3V2TA 3K0XA 3LWEA 2NVXB 3EQLC 3OIQA 2F3WA 1PH8A 2OWOA 3FPPA 4RHSA 3HOYB 1EY5A 2VNUD 3KBGA 1BO0A 2NN6I 3RN2A 3I8ZA 2JXMB 1CTMA 4QIWE 3SK4A 4C3IB 5ELBA 3CMAA 1Y14B 2YU9H 1FJGQ 3HOUG 3QOJA 3OWEB 2AUKA 5E4XA 2KCCA 1G91A 3A74A 3ZYYX 4UHVA 2QW7A 1X3QA 2EQSA 1I94Q 2E75C 3S17H 5FLXL 4KTAA 4A3EG 4A3IH 1BCPF 5IYDH 4XIGS 4YY3L 4JI2L 3CP0A 2Z8LA 1IKMA 1ONLA 5C3EG 2CFMA 3F2DA 1K3RA 3S1QH 4C56C 1BF4A 1ILQA 4JI7L 3S2HH 1B7YB 1CKOA 1NR2A 4L63B 5L37A 2UUCL 1W3SA 4WJWA 3DWPA 2R61A 1ML0D 1BOSA 3QB3A 4LF8Q 3G4SA 4DFAA 3AB9A 2JEBI 4MHEA 2NVTH 1N33Q 1KNAA 1SEBD 3FEWX 1WCMG 5T1GA 5LMNW 1EYCA 4LUVA 1BCPC 1F9PA 2JA9A 3HOZH 3OSOA 1U4MA 4TQUS 2KQ3A 2X69A 2JA7G 3KF6B 1J9OA 1VQGA 1HUMA 1CUKA 2PZUA 2XRSD 1MSGA 1GKHA 4LFBQ 4KI0A 3VA7A 2IJ0A 3GTPH 3CC7A 1G2TA 2BH8A 4CDEC 1EOTA 2E5LL 2NTSA 4OO1G 3PQIA 1GUOA 1V1PA 5LMUQ 1EWHA 1NSNS 3JAME 1IBLQ 5ELCA 5C4XB 5JJLA 2UXBL 2WACA 3S2DH 2MUYA 4JG2A 3L3OC 3S16H 5HGQA 3GTQB 2H4OA 1IKLA 1K83B 1Q12A 3HOYG 2JJQA 2BDOA 4TRDA 3CCRA 5IT9L 2R93B 1YJ9A 1I4XA 3CHBD 3BYTB 3T1HQ 2JN4A 3ICEA 2LXJA 3LX0A 3JC66 2NVQB 1JJ2A 2AQ1B 2JA5G 4BY1H 2R92B 2DUDA 2I0QA 1A63A 5AJ3L 4FNFA 1SSOA 4HJAA 3HOXB 2Z1CA 5C0XJ 1AW7A 2HDMA 1H9SA 3DWQA 1A15A 2K5HA 5ELEA 4DUYL 1D8LA 4XYQA 5IP7G 4DNIA 5FLXc 1QOHA 3D31A 1EZ8A 2B29A 3IFDA 3MAQA 4IFDI 3C46A 1TWHB 1ZXTA 1HR0L 3BDLA 2IPKD 2KCNA 4RG1A 1EIYB 3GTLB 2YV5A 2K32A 2NN6G 3TEHB 2E2HH 2NZ1D 1LLRD 1GUSA 1YNXA 1EEID 3STBC 1I4PA 5KYIA 4JI2Q 3NXWA 4XT3B 2SEBD 3K8AA 4DAYB 1E2VA 5GADC 2UUBQ 4L5QA 4RGTA 4X64L 2CWAA 1NE3A 3TBIB 4K8IA 5IGEA 1JE4A 4RCNA 1VMCA 3L0OA 2L4NA 2Z4IA 2CVRA 2CHBD 1Q8IA 1BVSA 4C3HB 5IGDA 1E7ZA 3J81L 1ESFA 2JSOA 4EGVA 1K8GA 1SNQA 3I4MH 3FPUB 1HZAA 1EY8A 2PCFB 2ZTEA 3M4PA 5C4XG 3ERSX 4POFA 3GTJB 4MZ9A 3X3NA 1WVLA 1IBMQ 5H1SE 4OX9L 2JQOA 1X32A 4P74A 2K14A 1RHPA 1FD7D 4A3KB 4G7OC 1KDCA 4DNTB 1CHPD 5HGTA 2SOBA 1XNRQ 4HJ7A 2F0KA 2RCFA 2WINB 4OIJA 2RSNA 3MFYA 3I3CA 3GTGH 1O80A 1KDBA 1I50B 1DYQA 1YEZA 1S72A 4JI0L 3HOWB 2PQAB 1JORA 1PDQA 3TZUA 5M5XH 1WJJA 1H9KA 3HKZE 2UXBQ 1BKBA 1EWCA 5CV7A 5ISRA 2R92G 1FYCA 3J80c 5IYBG 4JI3L 2XVSA 1Y8NB 5IT9c 3GTMH 4JV5L 4H7BA 1KLUD 1L0XB 1XTCD 3HOXG 3S1MH 2VUMH 2OT2A 1Q46A 2CWPA 2AQ2B 2A6EC 4GKJL 1BXTA 1RL2A 1SJED 5CORA 4CJ1B 4FF1A 5ELOA 3D3RA 5FO8B 2E76C 2B2YC 1EYGA 3W3AA 2J7ZA 1M8AA 2XNAC 2LXKA 4DR2Q 1ASZA 1PFBA 2E2IH 3NBHA 1LT4D 1YZ6A 4A3IB 3R2IA 2Q8IB 4DPGA 5IWAL 1U4PA 2QKIC 3HOUH 1MBYA 1SE2A 4EX5A 5AJ3Q 1B4OA 3T13A 5NUCA 4FF3A 1B50A 1PMRA 2PZWA 3WOFA 4X3KA 1PYWD 2ICEC 2LKVA 3CC4A 1VQFA 2A69C 3S1QB 1S5BD 3E6ZX 5IGCA 3I70A 1WTPA 3RD4A 2IX3A 2SNMA 4DUYQ 3RZOH 5GROA 2DGYA 3K81C 4LF9L 4FXKC 3FVQA 4DR4L 4DV6L 3CXCA 4UAIA 5C3EH 1JE5A 1X54A 3K7AH 3DWAA 1HR0Q 1MHWC 1VQBA 4R4CA 2QILA 5COYA 5CV8A 4C3HG 3HOVB 1IW7D 2KEDA 2EY1A 4JYAL 1B9NA 3P75A 4CGYB 2R7ZB 2BDNA 1M1KC 3GD7A 2VZAA 3CW2C 2EJMA 1KTKA 2EJFC 4DR7L 4IFDG 3SHLA 3GTOH 2L11A 3J81c 4X64Q 3MXPA 2MP1A 3MZ5A 1SLJA 1IL8A 3FHWA 4A3KG 5C0XI 2HQEA 1FR3A 1PTOB 2K75A 4RKLA 4DUZQ 1OO9B 4YWKA 4RGNA 3NENA 1PZKD 1H9MA 3MC0B 1QUQA 3HOWG 3KJPA 4OO1H 1G6ZA 2WV6D 4GZYC 2KCMA 4AYBE 5M3FH 4OX9Q 2Q2IA 1SN8A 1QZGA 3TDQA 4UP9A 4FXDA 1EQRA 1N32Q 2M9VA 4FDBA 2LMCB 2F52A 2BE5C 1UUPA 2K6AA 1Q8KA 2NVXH 4CDDC 2PI2A 4JI4Q 2WAQB 4L5RC 3NE5B 1IL2A 3HOYH 2N88A 5DLQE 3I4LA 4F88A 4JI0Q 5IE8A 4GN4B 1STYA 2OXPA 2EVBA 1N8RC 1AFPA 3CCUA 1SYCA 1KIXA 3M7NA 2QDBA 4NXML 4EQ5A 3SK8A 1PXUA 4C3IH 2ZJQA 1F9RA 4KY7A 4JI3Q 1X3FA 2K03A 3PSIA 5I4DA 4X3TA 4DR3Q 2CQOA 1VQ6A 1PFMA 3CCQA 1WYDA 5EBDA 2IL8A 5F2DA 2IW3A 2G5DA 2X6GA 1PTOF 4BA2I 2EIFA 5G3LD 1KDAA 5IWAQ 1GD7A 2SDFA 2F0PA 3CCSA 5AFWA 1LYLA 4ID6A 3ULPA 1JMCA 2R7ZG 3C1FA 1OXSC 2I5HA 3OOCA 4FF4A 1SYDA 2NN6H 1QZHA 3DM1A 5FKAC 4GKKQ 2EYLA 1SDFA 4RFBA 4X62L 2N78A 2UUAL 1L0YB 1GVPA 4LF9Q 1I6VC 3KDFA 4DV6Q 4HIOA 1L1OB 5CYUA 5JJIA 2ZM6L 1PTOC 4ZQ3A 1FGUA 1SXTA 4ZAIA 2Z6KC 1IYUA 2Y0SB 2D5DA 1SAPA 4YWLA 4JYAQ 1BUVT 4K0KL 3E9HA 3FDTA 4A3JB 4JI6Q 4IO9A 3L9AX 1LTBD 3KF6A 1QVCA 4K2KA 4NMZA 1DOMA 4PQXA 5CBAE 3VDYA 4CHTB 4DR7Q 4I7ZC 3H3VI 3AYHB 4LFAL 3VR3A 2K1BA 3LNNA 3CD6A 4JBMA 1D7QA 2B3GA 2KEEA 5C4XH 3GTGB 4DN4M 1RF2D 1JWSD 1EEFD 2JA8G 3IL8A 1SYGA 2ALYB 2V4DA 3TZDA 2KA7A 1JWUD 1T5EA 4JOIC 1C0AA 2WIIB 4BWGB 1XTDA 2V1CC 5I6WA 1HUNA 3GTQH 1W6KA 2IX1A 2WAQG 4JC0A 2ZXOA 1DXMA 3KF8B 5ELFA 4BBRB 1LO5D 3SVMA 1K83H 3IKJA 3SK5A 1M90C 4FVMA 2K7VA 2JE6I 3AFQA 3AQQA 4XTCS 1HZ9A 3NWTA 2KHSA 5C0XG 2R93H 2JA6G 2L55A 4A3GG 4ZCKA 2KBNA 5KNBA 4PMCA 2NVQH 1FL0A 5I6YA 4H02A 2R92H 4LUZA 5IYBH 1Z47A 3MXGA 4B9WA 4EQNA 1B9MA 1EY0A 3HOXH 1SFOB 2XWJB 1Q1BA 2NZHA 1AZQA 4KN4C 4N8X1 4LF6L 2OTJA 3J80E 4DV7L 3KFUA 1K8AC 5CV9A 3DMUA 4B08A 1LTTD 5BN5A 4A3EB 4HR7B 1ENAA 1KRTA 3Q24A 4QMGA 3AMUA 2RCNA 3WDNA 1RJTA 4A3FB 1MD2D 1S4ZA 1TWHH 2EY6A 2F0QA 4NP5A 3HZXA 1WFQA 1BQQT 1D1KA 1L0WA 4DR1L 3GTLH 5HURA 2I5MX 1TU2B 1TWFB 3K7AB 1J6QA 3IFTA 1HA5A 3A8JE 5LHY1 1L1OC 2PW7A 5EPKA 1DOKA 3I4NB 3K59A 4IPDA 1D6EC 4B3RQ 2K5NA 4DF7A 1K8MA 3M7GA 1D5ZC 1LT6D 4KHVA 4DAYA 3KK7A 2NZOA 5E4WC 1WCMB 3CKIB 1S40A 1XMQL 1WD0A 4GN5A 3I4OA 4C3HH 3J7ZC 4A3JG 3K5OA 2XTIA 3C1EA 3D4RA 2AMCB 3TP6A 5D14A 2JA7B 2UUAQ 1QJOA 1GO3E 3K57A 4IFDH 1T5XD 1PFNA 1NTGA 3NTHA 3GTJH 4GOPB 3PUVA 3QOLA 3BDOA 2Q2HA 1LT3D 2L12A 4A3KH 1VS0A 2QA4A 1WTQA 2PMZB 1HNWL 1I4RA 4BBRG 4RHRA 2JYOA 4HSPA 4LFCL 5C44G 3MFGA 2F0MA 1I50H 4DK1A 3BVMA 1XNQL 2UXCL 2ZJPA 3RUZA 4V190 4P75A 2E8GA
chains in the Genus database with same CATH topology
5EGTA 4C1NK 3MXUA 4DXGA 2O4XA 1C4QA 2TSSA 2ZXPA 1VDZA 2ENBA 1D2BA 3KLSA 2WKDA 1CA6A 4E6IA 3TP7A 4K14A 2R3ZA 2B2WC 1EY9A 3TP5A 3R8BA 2F0HA 2JA5B 2EY5A 1LTRD 5T1IA 4R8IA 2F0IA 2EYJA 1UAPA 5J39A 5D65A 2KJXA 4WRDA 1D5MC 1IHZA 4H44C 4Y7NB 3A56A 1YNJD 3S14B 5DM73 1SMYD 3MVVA 2RSOA 1YNND 5C4ZA 4ABNA 3T4AC 3UI2A 3NWSA 5IODA 3A7LA 3SK6A 3SE0A 3E5SA 1F2LA 4LK1C 1G2SA 4K6LA 3T16A 4ZYSA 5IGGA 4G57A 1BBXC 5FK9C 5I2XA 5IOCA 2HDLA 1FNWA 2I07B 4ZUIA 4PMWA 4MN3A 1ENFA 1PTOH 1I6HB 4NW2A 2VXWA 4BA1I 2F0VA 1G8ZD 3VYTA 2NYZD 3MEHA 3CRLC 1QE6A 2B8GA 4HMJA 1LTAD 1QILA 2FFKB 3PUYA 5I9OA 2XRQD 1VCIA 2NBFA 4KKTA 5C0XH 4OHJA 3N6RA 4IUVA 4HTHA 5JJZA 1GHKA 5C6AA 2RDHA 4U68A 1DCZA 2RBMA 4OL7A 1O78A 1GUNA 1TY2A 1STAA 4YIJA 3V05A 1XWEA 1KLGD 1SNMA 4ZKCB 4H13C 1DZ1A 1Q1EA 5A2QE 1E0BA 2HUGA 1QCBD 4N9TA 4B9XA 3L7ZC 1EFID 1M4VA 3QG1A 3NTIA 4KN7C 3HS0C 1ET9A 1KAAA 2HCIA 4KKUA 2D62A 1ILPA 2ZXRA 3MWYW 3R93A 1HFGA 2CW0D 2OEOA 4R8NA 1RKNA 5CR3A 5BN3A 1IW7C 1S5CD 4C3JG 3I90A 2L1BA 1OXUA 1DM0B 4BBSB 1Q3LA 4M8AA 2G9DA 2Q8RE 2EZVA 4Z9CB 1ZYRD 2BOSA 4QIWB 2QF7A 1JCKB 1F9QA 3DEPA 4RAUC 3P7JA 2X6LA 1JQYD 3CRKC 2F0NA 3KF8A 3PMFA 2FJ2A 2XSCA 4OGQC 4DA2A 2KVMA 2GA4B 1KNEA 3VA5A 4KKSA 4EQOA 1I3QB 1PLFA 4WORA 5G3LF 2EJGC 3WOEA 4I65A 1CZWA 1K8OA 2NWGA 2DNEA 2FHTA 1C8CA 1R4PB 5DAUA 2B2WA 4IUNA 1HCZA 1JC7A 1TWAB 3OPOA 1BNZA 3EA6A 3FKIB 3C3LA 4U673 3GV6A 2Z4HA 3U9OA 3T53B 5C4HA 1STHA 3V96A 3Q22A 4L6TB 2NB0A 5KYLA 4IUTA 2L9HA 3RMHA 1C48A 1EU3A 1ZKOA 3JAML 1CQFA 1SJHD 1OXVA 1U4LA 3S15B 4V0BA 1GUGA 1EYAA 2RKSA 5EBCA 1XYIA 3H6MA 2A68D 1QB5D 3A8KE 2BA1A 4DK0A 1DJRD 4J8QA 1LTGD 2F0TA 1QG7A 3H91A 2JA8B 4BS9A 2DY8A 5M5YB 4K8JA 2F0EA 1JOKA 1EZ6A 4LMQD 2ID0A 2RDFA 3Q23A 2PQEA 1O7LA 3M85A 2JA6B 2K5QA 4A3GB 1TS3A 2R6GA 4EQPA 1B44D 3NP8A 3VR2A 1AP0A 5JEAJ 1EY7A 2A5HA 5JVG3 4F8MA 4RGMA 3A54A 2EYOA 1BDOA 2EE1A 2TMPA 4HCSA 2F03A 1Y69U 5IGFA 3SR1A 1TVXA 1RDPD 1H9RA 2RA4A 3GP7A 1B53A 2RQXA 1WTRA 5FO7B 4QCLA 1OXXK 1PRTD 5FLXE 3ERQA 3M3YB 3BS1A 2O2LD 3K6OA 4O1NA 1GJXA 3MTSA 3G6JB 5K36G 3GO5A 2E2DC 2E2JB 2LS01 5CV6A 3PIP3 3S1RB 3VYUA 1WTOA 2B8FA 4K2LA 1SNDA 3MA2B 4ZK9B 1TWCB 1ZEQX 1RODA 3M4OB 5A35A 1ICWA 3HKZB 1JR0D 3GV3A 2IX0A 4XQJA 3RZDB 3VYRA 3PUZA 2B2TC 3EVQA 4L8JA 1Z6HA 2C5CA 1EIGA 4N9PA 5C44B 1EQVA 1H9JA 3VR5A 4HEDA 5JAVA 5DM63 2K28A 1FNUA 5K5PA 2M00A 5ELDA 5EPLA 1E2WA 4FXGC 4KD4A 4RH6A 2EYHA 1SE4A 5CC4A 4PNYA 5IT9E 4QF4A 2JEAI 1STNA 3NTKA 1VMPA 1HHVA 5CMDA 3BVGA 1CHQD 2B2YA 5LL6X 1J8IA 5EKIA 4KY6A 1DOLA 2N55A 3D4DA 4OIKA 4A3MB 2B63B 1EQTA 2K5DA 1YNJC 4RGOS 3DEOA 2MPMA 1SMYC 3P1HA 3HEJA 5CBEE 1YNNC 4CKBA 4Q5VA 5I9PA 1A3UA 1STBA 4CJ2C 3CU7A 3GQBA 4IN3A 2H1EA 3VR4A 2PYKA 3N52A 1GUTA 1SE3A 1LTSD 4AYBB 1SNOA 3HRZC 1EY4A 5KIXA 4IALA 4KHZA 2C9OA 2RDGA 4K6DA 3X3MA 1QNUA 1Q90A 4A3DB 3J81E 3ONAB 4CJ0B 5KGUA 2WKCA 3PIO3 1LTID 4IFDJ 3C2PA 2VB3X 1UEAB 3MXNA 3FRPB 1XXGA 4NKLA 2B39A 4TSSA 3IAYA 3H3VC 3MHBA 3TN2A 4G4KA 3S9WA 1HPCA 5M3MB 3E0JA 1S5FD 4R9WA 5CV4A 1AEXA 3I73A 1V43A 4DU9A 3NPPA 1SYEA 5D3DA 3KUPA 1RTNA 3EFXD 5DEHA 1FNVA 5JOBA 5C3XA 4HN7A 5D3IB 3DUZA 1TY0A 1RCVD 2F0SA 1TS2A 4XYOA 1V8QA 3PUXA 3D8GA 1AZPA 2VB2X 1F9SA 1NAPA 2DY7A 4KK7A 1GXDC 5LL6S 5FO9B 2A6HD 4HAEA 1WD1A 1JWMD 2A73B 3BVZA 1W6JA 3NQTA 1CA5A 3GTKB 2AUJD 2I46A 2ICIA 3NQIA 1GOZA 3TSSA 2EOTA 5K36H 1S5DD 3HGBA 1QWYA 2O5IC 3G7LA 4PMBA 3K5MA 5J22A 2E74C 5CV5A 4G7ZC 1HTPA 4C3JB 2Q8TA 3SEBA 3OHXC 4A93B 2CW0C 1JICA 1O7YA 1S5ED 4JBWA 3A55A 4ZRZA 3VR6A 2D9UA 1CZGA 1NCVA 1CFMA 3EROA 1CM9A 3Q6SA 1II3A 3NHHA 1B2TA 1R4QB 5JEAG 2K01A 3DXJC 1TS5A 5EJWA 1D5XC 2KUMA 4G7HC 2OF1A 2NVYB 3BDCA 2B2TA 3J80L 1ZYRC 3F2UA 3D6WA 1AN8A 2IT1A 4C3IG 2LFNA 1TWGB 1HA6A 5FOBB 4XQNA 1STEA 3VYSA 4DGZA 2B2UC 5C4JB 4DAPA 5EPJA 2FMMA 3ND8A 3T51B 2IWHA 4O42A 1R9TB 2K04A 4ME5A 1I4GA 4H0LC 4IUUA 1LT5D 3QIAA 4HSVA 2F0GA 2MHVA 1X3PA 3PV0A 4A3BB 1BCPD 4DAVA 4C1NI 4FP5D 5KNCA 2BCOA 2BA0A 5KRUA 1EU4A 3SXHA 3OMCA 2F4IA 1SYBA 4KJNA 5I2YA 5M9OA 2EPBA 3BZDB 3T56B 2J4XA 4EVOA 4BY7B 1PRTB 2F1MA 3TMEA 1JOOA 1U9RA 4IZ8A 4LAAA 3H09A 4C2MB 1HRJA 1RTOA 2F0FA 1CK1A 3CQZB 1Y1WB 2A68C 3K5LA 1QNKA 4HMIA 1GHJA 3RLFA 2RVLA 3OMGA 1DONA 1A3TA 4ZUJA 1F2YA 1Y8OB 2XWBB 1O7ZA 2O5JC 2PNRC 3A7AB 4ZLTF 1SBBB 2F0JA 1JOQA 2YU9B 4RA8A 1A3VA 1SYFA 4RKBA 1JB3A 3M4YA 4FYDA 3S17B 1PRTF 1UNSA 4K5WA 1HTLD 1EL0A 3R3OA 5KNDA 4Q0FA 1VF7A 2SNSA 2K5WA 2KOLA 2EYPA 2QEJC 5JPNC 1HQMC 1DD2A 3A8IE 3K58A 3I72A 3S2HB 2F0UA 5IIFA 3KLRA 2D2CC 2KECA 4X3SA 1SNPA 4ODGA 4KMUC 3K5NA 2NVTB 4IUQA 3PUWA 1PRTC 3QO2A 5C3WA 1G291 2PO4A 3HOZB 1OXTA 3ND9A 1CT1D 1V1PB 1TR5A 1MI2A 1Y8PB 1EIHA 1U4RA 5E1FA 2XN9C 3GTPB 1F77A 3H0GB 2B2VC 1WTXA 1EYDA 4ZKBB 4F87A 4FO2A 3NUCA 2F0LA 3U9SA 3KBXA 2JP1A 2FINB 3S2DB 3OW7A 5E3FA 4DNRB 5C5LA 1CQVA 3K0YA 4KD3A 3URYA 3S16B 2YYZA 2AWOA 5JPMC 1ENCA 2PW5A 1HXYD 2A6ED 4F7XA 4PV1C 3D4WA 1PZJD 2WB1B 5JEAH 1GUWA 2EYMA 1LABA 4IURA 1H9SB 3BYYB 4BY1B 2PPBC 4MIUA 5A2QL 2PZTA 3AU7A 2A69D 4CBVA 2HCCA 3NBIA 1LV9A 1F2MA 4K5XA 1Y1VB 3J7AF 3BG3A 4RWSC 4XXEA 5IGBA 1WTVA 1MSHA 2J0TD 2DNCA 2E2HB 2XIWA 5KEEA 4M1UB 2B2UA 3D6CA 4S3SA 3ITPA 3PO3B 2DN8A 2EDGA 4ULLA 3OWFA 5J1ZA 1PZID 1TT2A 4K5VA 3H94A 2WP8J 1HQRD 1ET6A 1I4HA 2AWNA 3Q0AA 2K05A 4QB4A 2NUCA 2ZT9C 3QJYA 2K33A 1ESRA 3I4MB 3P20A 3S1NB 2L0CA 2LY7A 4TKOB 2A74C 3W2DA 5EQ0A 4ILWA 1A2TA 4J1MA 4XT1B 2F3VA 1V1OA 1TQOA 2BE5D 4DXFA 4X3UA 4WFN3 3NK9A 5C5MA 1NUCA 2F0DA 4XDXA 1FGBD 4XQQA 5M5XB 1WTWA 4P2CB 2F0OA 3HG9A 3PO2B 4KY5A 3GTMB 3HP3A 1TKWB 3S1MB 1B1ZA 1NR4A 2VUMB 3EJIA 4QUCA 1D1IA 2L5TA 1A6XA 3I91A 1TS4A 1STGA 4HCEA 2E2IB 4IUPA 4KV6A 4UDUC 1TIID 3HOUB 5DNFA 1I4QA 3DHQA 3O13A 1LACA 3SDZA 2M2LA 2AQ3B 4KJOA 3RZOB 3OIPA 5JVH3 5EKLA 5EKKA 2NTTA 3R2TA 4IQZA 5C3EB 4FF2A 1EY6A 3FMCA 5TSSA 4OO1I 2MJ8A 4QUFA 1PTOD 5BN4A 4J6HA 2MGSA 2A6HC 4CKCA 1Z7TA 4CKEA 1BR9A 3TP8A 1IYVA 1A2UA 1SNCA 3GTOB 2G9HD 3LWUA 2F0WA 3NSWA 3J7AV 1BCPB 1E2ZA 5M5WB 1B3AA 1F2ZA 1CI3M 2QCPX 2EYFA 3KLSX 5CGKA 1KABA 4LJZC 1RD9D 1VF5C 4RCOA 2FMCA 1HFNA 1MGSA 3QWNA 2EXZA 5M3FB 4NDXA 2CQAA 1XX8A 2EY2A 4JK1C 3J7YW 2B2VA 3V2TA 3LWEA 2NVXB 3EQLC 3OIQA 2F3WA 3FPPA 4RHSA 3HOYB 1EY5A 2VNUD 3KBGA 1BO0A 2NN6I 3I8ZA 2JXMB 1CTMA 3SK4A 4C3IB 5ELBA 3QOJA 3OWEB 2AUKA 5E4XA 2KCCA 1G91A 3ZYYX 1X3QA 2E75C 5FLXL 4KTAA 1BCPF 4XIGS 2Z8LA 1IKMA 1ONLA 4C56C 1BF4A 1ILQA 4L63B 1NR2A 4WJWA 3DWPA 2R61A 1ML0D 1BOSA 3QB3A 4DFAA 3AB9A 2JEBI 4MHEA 1KNAA 1SEBD 3FEWX 5T1GA 1EYCA 1BCPC 1F9PA 1U4MA 3OSOA 4TQUS 2KQ3A 2X69A 1J9OA 1HUMA 2PZUA 2XRSD 1MSGA 4KI0A 3VA7A 2IJ0A 1G2TA 1EOTA 4OO1G 2NTSA 1GUOA 1V1PA 1EWHA 1NSNS 3JAME 5ELCA 5C4XB 2WACA 2MUYA 3L3OC 3GTQB 2H4OA 1IKLA 1K83B 1Q12A 2BDOA 4TRDA 5IT9L 2R93B 1I4XA 3CHBD 3BYTB 3LX0A 2NVQB 2AQ1B 2R92B 4FNFA 1SSOA 3HOXB 2Z1CA 5C0XJ 1AW7A 2HDMA 1H9SA 3DWQA 1A15A 5ELEA 4XYQA 1QOHA 3D31A 1EZ8A 3IFDA 3MAQA 4IFDI 3C46A 1TWHB 1ZXTA 3BDLA 2IPKD 2KCNA 3GTLB 2K32A 2NN6G 2NZ1D 1LLRD 1GUSA 1EEID 1I4PA 5KYIA 3NXWA 4XT3B 2SEBD 1E2VA 4RGTA 5IGEA 3TBIB 4K8IA 1JE4A 4RCNA 1VMCA 2L4NA 2Z4IA 2CVRA 2CHBD 1Q8IA 5IGDA 4C3HB 3J81L 1ESFA 2JSOA 4EGVA 1SNQA 3FPUB 1EY8A 2PCFB 3GTJB 3X3NA 1WVLA 1X32A 1RHPA 1FD7D 4A3KB 4G7OC 1KDCA 4DNTB 1CHPD 5HGTA 2SOBA 2F0KA 2WINB 4OIJA 2RSNA 3MFYA 3I3CA 1O80A 1KDBA 1I50B 1DYQA 3HOWB 1JORA 1PDQA 3TZUA 1H9KA 1EWCA 5CV7A 5ISRA 1FYCA 2XVSA 1Y8NB 4H7BA 1KLUD 1L0XB 1XTCD 2OT2A 2AQ2B 2A6EC 1BXTA 1SJED 4CJ1B 5CORA 4FF1A 3D3RA 5FO8B 2E76C 2B2YC 3W3AA 2J7ZA 1M8AA 2XNAC 1PFBA 3NBHA 1LT4D 4A3IB 3R2IA 2Q8IB 1U4PA 2QKIC 1MBYA 1SE2A 1B4OA 3T13A 5NUCA 4FF3A 1B50A 1PMRA 2PZWA 3WOFA 4X3KA 1PYWD 2ICEC 2LKVA 2A69C 3S1QB 1S5BD 3E6ZX 5IGCA 3I70A 1WTPA 3RD4A 2IX3A 2SNMA 4FXKC 3FVQA 4UAIA 3DWAA 2QILA 5COYA 5CV8A 4C3HG 3HOVB 1IW7D 2KEDA 2EY1A 2R7ZB 1B9NA 3P75A 4CGYB 2BDNA 3GD7A 2EJMA 1KTKA 2EJFC 4IFDG 3SHLA 2L11A 3MXPA 2MP1A 3MZ5A 1IL8A 5C0XI 2HQEA 1FR3A 1PTOB 4RKLA 1OO9B 4RGNA 1PZKD 1H9MA 3MC0B 4OO1H 1G6ZA 2WV6D 4GZYC 3TDQA 4FXDA 2M9VA 2LMCB 2BE5C 1UUPA 2K6AA 2WAQB 3NE5B 2N88A 3I4LA 4F88A 1STYA 2OXPA 2EVBA 1AFPA 1SYCA 3M7NA 2QDBA 3SK8A 1PXUA 1F9RA 4KY7A 2K03A 5I4DA 4X3TA 1PFMA 5EBDA 2IL8A 5F2DA 2IW3A 2X6GA 1PTOF 4BA2I 5G3LD 1KDAA 2SDFA 2F0PA 5AFWA 4ID6A 3C1FA 1OXSC 3OOCA 4FF4A 1SYDA 2NN6H 3DM1A 5FKAC 2EYLA 1SDFA 4RFBA 1L0YB 1I6VC 5CYUA 1PTOC 4ZQ3A 1SXTA 4ZAIA 1IYUA 2Y0SB 2D5DA 1SAPA 1BUVT 3FDTA 4A3JB 3L9AX 1LTBD 4K2KA 4NMZA 1DOMA 4PQXA 5CBAE 4CHTB 4I7ZC 3VR3A 2K1BA 3LNNA 2KEEA 3GTGB 4DN4M 1RF2D 1JWSD 1EEFD 3IL8A 1SYGA 3TZDA 2V4DA 2KA7A 1JWUD 1T5EA 2WIIB 4BWGB 5I6WA 1HUNA 1W6KA 2IX1A 2ZXOA 1DXMA 5ELFA 4BBRB 1LO5D 3SVMA 3IKJA 3SK5A 4FVMA 2K7VA 2JE6I 4XTCS 5C0XG 3NWTA 2KHSA 2L55A 5KNBA 4PMCA 5I6YA 1Z47A 3MXGA 4B9WA 4EQNA 1B9MA 1EY0A 1SFOB 2XWJB 1Q1BA 1AZQA 4KN4C 3J80E 5CV9A 3DMUA 4B08A 1LTTD 5BN5A 4A3EB 4HR7B 1ENAA 3AMUA 3Q24A 4QMGA 3WDNA 1RJTA 4A3FB 1MD2D 1S4ZA 2EY6A 2F0QA 4NP5A 3HZXA 1BQQT 1D1KA 5HURA 1TU2B 1TWFB 3K7AB 3IFTA 1HA5A 3A8JE 5LHY1 2PW7A 5EPKA 1DOKA 3I4NB 3K59A 1D6EC 4DF7A 1K8MA 3M7GA 1D5ZC 1LT6D 4KHVA 4DAYA 3KK7A 5E4WC 1WCMB 3CKIB 1WD0A 3K5OA 3C1EA 3D4RA 3TP6A 5D14A 2JA7B 1QJOA 3K57A 4IFDH 1T5XD 1PFNA 3NTHA 3PUVA 3QOLA 3BDOA 1LT3D 2L12A 1WTQA 2PMZB 1I4RA 4RHRA 2JYOA 4HSPA 3MFGA 2F0MA 4DK1A 3BVMA 3RUZA 4V190
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXT A;  1SJE D;  4DXG A;  1G8Z D;  1AW7 A;  2ICI A;  2AQ3 B;  1GOZ A;  3DWQ A;  1SE3 A;  2XNA C;  3TSS A;  1BCP F;  1LTS D;  2TSS A;  5ELE A;  4Z9C B;  1EU4 A;  1S5D D;  1LTA D;  1LT4 D;  2Z8L A;  1JR0 D;  3R2I A;  1DJR D;  1LTG D;  1QIL A;  5I4D A;  2NTT A;  1PZI D;  3R2T A;  1PRT C;  1SE2 A;  2RDG A;  1JCK B;  5TSS A;  3BZD B;  4C56 C;  2J4X A;  2XRQ D;  1PTO D;  3R8B A;  1PRT B;  2IPK D;  1HQR D;  1JQY D;  4L63 B;  1PYW D;  3SEB A;  1ET6 A;  1I4H A;  1LTR D;  1LTI D;  3DWP A;  1S5B D;  1CT1 D;  2R61 A;  1LLR D;  1PTO F;  1V1P B;  3O13 A;  4OHJ A;  1EEI D;  1S5E D;  1I4P A;  2XN9 C;  1LTT D;  2SEB D;  2RDH A;  1F77 A;  1XXG A;  1D5M C;  1TS3 A;  1SEB D;  4RGT A;  1MD2 D;  2G9H D;  1TY2 A;  4TSS A;  1FNU A;  3DWA A;  1BCP C;  3W2D A;  3V05 A;  1B44 D;  2QIL A;  1CK1 A;  5ELD A;  1KLG D;  1BCP B;  1S5F D;  1V1O A;  1TS5 A;  2CHB D;  2XRS D;  1D5X C;  1CQV A;  1ESF A;  1HA5 A;  5FKA C;  4RH6 A;  1SE4 A;  3URY A;  2IJ0 A;  4RFB A;  1KTK A;  5D3D A;  1L0Y B;  3KLS X;  3EFX D;  4DXF A;  4RGM A;  1FNV A;  1HXY D;  2NTS A;  1V1P A;  1AN8 A;  1D6E C;  1EFI D;  1RD9 D;  5D3I B;  1TY0 A;  1RCV D;  1D5Z C;  3EA6 A;  3BVG A;  1LT6 D;  4RCO A;  1RDP D;  1M4V A;  1PTO C;  1TS2 A;  5ELC A;  4K6L A;  1SXT A;  1CHQ D;  1FD7 D;  1FGB D;  1PZJ D;  4ZYS A;  1PTO B;  3GP7 A;  1CHP D;  1ET9 A;  1SBB B;  4L6T B;  1STE A;  4RGN A;  1PZK D;  3MC0 B;  3BYY B;  1PRT D;  1LTB D;  5FK9 C;  1B1Z A;  1T5X D;  1DYQ A;  2WV6 D;  1FNW A;  4RHS A;  1PRT F;  2O2L D;  4RGO S;  1I4X A;  1TS4 A;  3CHB D;  1RF2 D;  1UNS A;  1JWS D;  1EEF D;  1LT3 D;  3BYT B;  4O1N A;  1ENF A;  1EU3 A;  1HTL D;  1I4G A;  1JWU D;  1EWC A;  1PTO H;  4BWG B;  1I4R A;  1JWM D;  1S5C D;  1LT5 D;  4RHR A;  5ELB A;  1SJH D;  2AQ1 B;  1KLU D;  3BVZ A;  1L0X B;  1UUP A;  5ELF A;  1XTC D;  3OWE B;  1LO5 D;  3MFG A;  4UDU C;  2QEJ C;  3BVM A;  1I4Q A;  1BCP D;  2AQ2 B; 
#chains in the Genus database with same CATH topology
 5EGT A;  3HOW H;  4C1N K;  3MXU A;  4DXG A;  4IPC A;  2O4X A;  1C4Q A;  2HT1 A;  2TSS A;  2ZXP A;  1VDZ A;  2IHF A;  1N34 L;  2ENB A;  1UE6 A;  1D2B A;  3KLS A;  2PQA A;  2WKD A;  1CA6 A;  2BH2 A;  4E6I A;  3TP7 A;  4K14 A;  4L5S A;  3PIP A;  4J15 A;  2R3Z A;  2B2W C;  3KYH C;  2AHO B;  1EY9 A;  4IPH A;  3TP5 A;  1B70 B;  3R8B A;  2F0H A;  2JA5 B;  2EY5 A;  1LTR D;  5T1I A;  4P72 A;  4R8I A;  2F0I A;  1WOC A;  2EYJ A;  1UAP A;  4UY8 C;  5J39 A;  1PH6 A;  5D65 A;  1VQH A;  3RR5 A;  1JB7 A;  1VQ9 A;  1Z9F A;  4LNQ A;  4JI1 Q;  2KJX A;  4A3F G;  2VQF L;  4WRD A;  1D5M C;  3PF5 A;  4NPS A;  1IHZ A;  4H44 C;  1PH1 A;  4YHH L;  4Y7N B;  3A56 A;  2ZTC A;  3E9I A;  1YNJ D;  4UP7 A;  2ZTD A;  3S14 B;  5DM7 3;  1SMY D;  3MVV A;  2RSO A;  4TVA B;  4LF6 Q;  1YNN D;  4A3M G;  5C4Z A;  3I55 A;  4DV7 Q;  4ABN A;  3T4A C;  3UI2 A;  3NWS A;  3I4N G;  3BU2 A;  5IOD A;  3A7L A;  4P71 A;  3SE0 A;  3SK6 A;  3CCM A;  3E5S A;  1F2L A;  4LK1 C;  1G2S A;  4K6L A;  4UP8 A;  4DR1 Q;  1YIT A;  2Q2T A;  4DR6 Q;  3HOV H;  3T16 A;  4ZYS A;  1MJE A;  2R7Z H;  5IGG A;  3NEM A;  4G57 A;  1BBX C;  5GQO A;  4GOP C;  5FK9 C;  1J5E L;  5I2X A;  1P16 A;  5IOC A;  2HDL A;  1FNW A;  2I07 B;  4ZUI A;  4PMW A;  4MN3 A;  4CDF C;  1ENF A;  1PTO H;  4A76 A;  3TS0 A;  1A62 A;  1VQD A;  1I6H B;  3U50 C;  1IYJ B;  4NW2 A;  2IHE A;  2VXW A;  4BA1 I;  1LUZ A;  2F0V A;  1G8Z D;  2Z6K A;  3VYT A;  2HIX A;  2NYZ D;  3MEH A;  3CRL C;  1HR0 W;  3WWV A;  1QE6 A;  2B8G A;  4HMJ A;  2JA8 H;  4DAM A;  1LTA D;  5M5Y H;  1QIL A;  2FFK B;  1IBK L;  3PUY A;  5I9O A;  2UXC Q;  2XRQ D;  1VCI A;  2VL6 A;  4QJF A;  2NBF A;  4JOI A;  4KKT A;  3CF5 A;  5C0X H;  1PVO A;  4OHJ A;  1VQ7 A;  3N6R A;  1Q82 C;  1N34 Q;  4IUV A;  4HTH A;  5JJZ A;  1GHK A;  5C6A A;  2RDH A;  4U68 A;  1DCZ A;  2RBM A;  4OL7 A;  1O78 A;  1GUN A;  1VQK A;  1TY2 A;  1STA A;  4YIJ A;  3V05 A;  2KHJ A;  4I7A A;  1XWE A;  1KLG D;  1SNM A;  4ZKC B;  4H13 C;  4HJ8 A;  3PIO A;  1GM5 A;  4IJH A;  1DZ1 A;  1Q1E A;  1VQE A;  5A2Q E;  1ICF B;  1E0B A;  2HUG A;  1QCB D;  4YY3 Q;  4N9T A;  2VQF Q;  4LUO A;  4HJ5 A;  4B9X A;  3L7Z C;  1EFI D;  4R4T A;  4YHH Q;  1M4V A;  3LGJ A;  3QG1 A;  4DKA C;  3U58 A;  3NTI A;  4KN7 C;  3HS0 C;  4JI5 L;  1ET9 A;  1KAA A;  2HCI A;  4JI7 Q;  2UUC Q;  4KKU A;  2F4V L;  2K52 A;  2D62 A;  3A5U A;  1ILP A;  2Z0S A;  2ZXR A;  3MWY W;  3R93 A;  4B3M L;  1HFG A;  2CW0 D;  2OEO A;  4R8N A;  1RKN A;  2AKW B;  5CR3 A;  5BN3 A;  1IW7 C;  2K5V A;  1L1O A;  1S5C D;  1U0L A;  1KQS A;  4A3J H;  3Q8D A;  4C3J G;  1NNX A;  4DV4 L;  3I90 A;  4A93 G;  2L1B A;  1OXU A;  1J5E Q;  3E3X A;  1CKN B;  1DM0 B;  1QVG A;  3GDE A;  4BBS B;  3MXN B;  4DR5 L;  1Q3L A;  4M8A A;  2G9D A;  2Q8R E;  2E5L Q;  4GLX A;  2EZV A;  2GN5 A;  5IYC G;  4Z9C B;  4QL5 A;  4YCW A;  1ZYR D;  2BOS A;  4BBR H;  4QIW B;  1PYS B;  2QF7 A;  1E1T A;  2HQL A;  1JCK B;  1MJC A;  4R4Q A;  4JI8 L;  1F9Q A;  3DEP A;  4RAU C;  3P7J A;  2X6L A;  1JQY D;  3CRK C;  3TRE A;  2F0N A;  3KF8 A;  2A8V A;  2MO0 A;  3PMF A;  2FJ2 A;  2XSC A;  4OGQ C;  4DK6 C;  1MKH A;  2CH4 W;  4JVZ A;  4DA2 A;  2KVM A;  3OW2 A;  4JBK A;  4UPA A;  2GA4 B;  1KNE A;  3VA5 A;  4OON A;  4KKS A;  1SFO H;  4EQO A;  1I3Q B;  3H3V H;  1PLF A;  4WOR A;  5G3L F;  2EJG C;  3WOE A;  2MQH A;  1YHB A;  1WI5 A;  3UDG A;  3TQY A;  4I65 A;  4O0A A;  3RLO A;  3HKS A;  1CZW A;  1K8O A;  1K9M C;  2NWG A;  4A3E H;  2DNE A;  2FHT A;  3F2B A;  1C8C A;  4LF5 L;  1R4P B;  4A75 A;  5DAU A;  2B2W A;  4IUN A;  4A3F H;  1HCZ A;  1JC7 A;  1TWA B;  2KEN A;  3OPO A;  1BNZ A;  3CC2 A;  3KLW A;  2H5X A;  3EA6 A;  3FKI B;  3C3L A;  4U67 3;  3GV6 A;  2Z4H A;  1TWF H;  3U9O A;  1VQ8 A;  3T53 B;  5C4H A;  1STH A;  3V96 A;  3Q22 A;  4L6T B;  1P8L A;  2NB0 A;  3KOJ A;  5KYL A;  4IUT A;  2L15 A;  3J80 i;  2YTV A;  3I4N H;  3RLN A;  2L9H A;  3RMH A;  1C48 A;  4OWW B;  1WCM H;  1EU3 A;  1ZKO A;  3JAM L;  4JPB W;  1SMX A;  1HZC A;  3CME A;  4JI5 Q;  4BY7 G;  1CQF A;  1SJH D;  1OXV A;  1K28 A;  2N3S A;  1U4L A;  2JA7 H;  3S15 B;  2F4V Q;  4V0B A;  2HHH L;  1GUG A;  3G48 A;  1E22 A;  4BBS G;  1EYA A;  4YCU A;  2R7D A;  3E0E A;  2RKS A;  5EBC A;  3G6E A;  1B8A A;  4B3M Q;  1XYI A;  3H6M A;  2A68 D;  1VQP A;  1QB5 D;  1VQ5 A;  4NB3 A;  3A8K E;  2BA1 A;  4GOP A;  4DK0 A;  1NJI C;  1DJR D;  4J8Q A;  1LTG D;  2MNA A;  1X65 A;  2F0T A;  1QG7 A;  3H91 A;  2JA8 B;  4BS9 A;  4AQY L;  2DY8 A;  1G51 A;  5M5Y B;  4K8J A;  1PHJ A;  2F0E A;  1JOK A;  1EZ6 A;  4DR5 Q;  1YI2 A;  2P5Z X;  2VY3 A;  4LMQ D;  2ID0 A;  2RDF A;  3Q23 A;  2PQE A;  4GN3 B;  4DV3 L;  1O7L A;  3M85 A;  2JA6 B;  1PH3 A;  2K5Q A;  3F1Z A;  4A3G B;  1X3G A;  1TS3 A;  2ATW A;  5IY0 A;  1EOV A;  2R6G A;  4EQP A;  2PI2 E;  4JV5 Q;  4JI8 Q;  2JA5 H;  1B44 D;  3A0J A;  1IXR A;  3NP8 A;  3W5O A;  4HJ9 A;  3VR2 A;  1PFS A;  1AP0 A;  5JEA J;  4GKJ Q;  4APV A;  4RMF A;  1EY7 A;  2A5H A;  4HIK A;  3PGZ A;  5JVG 3;  4F8M A;  4MNO A;  4RGM A;  5IYD G;  3FKI G;  3A54 A;  2EYO A;  5IP7 H;  1BDO A;  4Y7N H;  2EE1 A;  2TMP A;  4HCS A;  2F03 A;  1Y69 U;  3SR1 A;  5IGF A;  1SE8 A;  1TVX A;  3S14 H;  1RDP D;  4L5T A;  2IY5 B;  1B3Q A;  1PH9 A;  1H9R A;  2RA4 A;  3M4Q A;  3GP7 A;  1B53 A;  2RQX A;  1WTR A;  1NY4 A;  5FO7 B;  4QCL A;  1OXX K;  3I2Z A;  4LF5 Q;  1PRT D;  5FLX E;  1HNZ L;  3ERQ A;  3M3Y B;  3RNU A;  4DR4 Q;  1JJC B;  3BS1 A;  2O2L D;  3K6O A;  4O1N A;  1GJX A;  3MTS A;  3G6J B;  5K36 G;  3GO5 A;  2MO1 A;  2E2D C;  2E2J B;  2LS0 1;  3NEL A;  5CV6 A;  5FJ8 G;  3HOZ G;  3PIP 3;  4X66 L;  1N9W A;  3S1R B;  3VYU A;  1WTO A;  2B8F A;  1X9N A;  4K2L A;  1SND A;  3MA2 B;  2N49 A;  4ZK9 B;  1TWC B;  1ZEQ X;  3H0G G;  1ROD A;  3M4O B;  1I6H H;  1RIP A;  5A35 A;  3L2P A;  1ICW A;  3HKZ B;  1JR0 D;  3GV3 A;  2IX0 A;  1CKM A;  1S3O A;  4XQJ A;  3RZD B;  3VYR A;  3PUZ A;  2B2T C;  3T1Y L;  1NMF A;  3EVQ A;  4L8J A;  1Z6H A;  2C5C A;  4DV5 L;  1EIG A;  1LTL A;  3UDX A;  4N9P A;  5C44 B;  1VQC A;  1EQV A;  1H9J A;  3CAM A;  3VR5 A;  5IYC H;  1CSQ A;  3B6Y A;  1KRS A;  4HED A;  4HID A;  3JAM i;  5JAV A;  5DM6 3;  5J3B A;  4AQY Q;  2K28 A;  1FNU A;  5K5P A;  2M00 A;  5ELD A;  5EPL A;  4BY1 G;  2NVY H;  1FJG L;  1E2W A;  1YVC A;  4FXG C;  4KD4 A;  4RH6 A;  2EYH A;  1SE4 A;  1I94 L;  4DV3 Q;  5CC4 A;  3NBH B;  4PNY A;  5IT9 E;  4QF4 A;  4NXM Q;  2DJF C;  2JEA I;  1STN A;  3NTK A;  1VMP A;  1HHV A;  5CMD A;  3BVG A;  1CHQ D;  2F3I A;  2B2Y A;  2Z6B A;  5LL6 X;  4R4I A;  1J8I A;  1Y1V G;  5EKI A;  4KY6 A;  5GAG C;  5C4J H;  1DOL A;  1UE5 A;  2N55 A;  3CCV A;  3D4D A;  1R9T H;  1BBU A;  4OIK A;  4A3M B;  2B63 B;  1EQT A;  2K5D A;  1BBW A;  4LF8 L;  3PO3 G;  1YNJ C;  4RGO S;  1MIU A;  3DEO A;  2MPM A;  1SMY C;  3P1H A;  3HEJ A;  5CBE E;  1YNN C;  3M9B A;  4CKB A;  4Q5V A;  5I9P A;  1A3U A;  1STB A;  1A0I A;  3W1B A;  4CJ2 C;  3S24 A;  3CU7 A;  3GQB A;  5GAH C;  1YJN A;  4IN3 A;  1YHA A;  4X62 Q;  2H1E A;  3VR4 A;  4DV0 L;  2PYK A;  3N52 A;  1GUT A;  1SE3 A;  1LTS D;  2HIV A;  3HKZ G;  4A4I A;  2ZM6 Q;  4AYB B;  1SNO A;  3BJU A;  5LMU L;  3HRZ C;  1EY4 A;  5KIX A;  4IAL A;  1IBL L;  1OTC A;  4OWT B;  4KHZ A;  2C9O A;  2RDG A;  4K6D A;  3X3M A;  4X66 Q;  1QNU A;  3EIV A;  4K0K Q;  2QDL A;  1DGS A;  1Q90 A;  2DJG C;  1WTH A;  2PNH A;  4BBS H;  3J81 E;  4A3D B;  3ONA B;  4CJ0 B;  5KGU A;  3UDF A;  2WKC A;  3PIO 3;  1LTI D;  4LFA Q;  4IFD J;  3C2P A;  1CKN A;  2Z9H A;  2VB3 X;  1UEA B;  3MXN A;  3FRP B;  1PYB A;  1XXG A;  4NKL A;  3T1H L;  2B39 A;  4TSS A;  3IAY A;  3H3V C;  3ZJY C;  3MHB A;  4GNX B;  3TN2 A;  3PO2 G;  4JCV E;  3K80 C;  1T9H A;  4G4K A;  4DV5 Q;  3S9W A;  1HPC A;  1K0S A;  5M3M B;  3E0J A;  1S5F D;  4R9W A;  4QY7 A;  4X6A H;  5CV4 A;  1AEX A;  3I73 A;  3OYY A;  1JJG A;  1V43 A;  4DU9 A;  3NPP A;  1SYE A;  5D3D A;  3KUP A;  1RTN A;  3EFX D;  5DEH A;  1FNV A;  4ME3 A;  1I3Q H;  5JOB A;  5C3X A;  4BXX G;  4HN7 A;  5D3I B;  3DUZ A;  1TY0 A;  1RCV D;  2F0S A;  1TS2 A;  4XYO A;  5EAY A;  1V8Q A;  3PUX A;  3D8G A;  1YJW A;  2GVB A;  1AZP A;  2VB2 X;  1F9S A;  1NAP A;  2DY7 A;  4KK7 A;  2B63 G;  1GXD C;  5LL6 S;  1TWA H;  3FKI H;  5FO9 B;  1XMO L;  2A6H D;  4HAE A;  1WD1 A;  2UUB L;  1JWM D;  2YTY A;  2LSS A;  2A73 B;  1PV4 A;  4Y52 H;  4DV1 L;  2UXD L;  3BVZ A;  1W6J A;  3NQT A;  1CA5 A;  3GTK B;  2AUJ D;  2VS1 A;  1LM0 A;  2I46 A;  3KDF B;  3DM3 A;  2CH4 A;  2ICI A;  3NQI A;  1GOZ A;  3TSS A;  1CSP A;  2EOT A;  4AYB G;  1UE7 A;  5K36 H;  1SRU A;  1S5D D;  3HGB A;  1QWY A;  1HNX L;  2O5I C;  3G7L A;  4PMB A;  3S15 H;  2D0P A;  1XMQ Q;  3K5M A;  1IBM L;  5FJ8 H;  5J22 A;  2E74 C;  1X55 A;  1EQQ A;  4A3D G;  5CV5 A;  3IRB A;  4G7Z C;  3MEF A;  1Q81 C;  1HTP A;  4C3J B;  1XNR L;  2Q8T A;  4DV0 Q;  3SEB A;  3OHX C;  4A93 B;  1EUJ A;  2CW0 C;  1JIC A;  3H0G H;  1O7Y A;  1S5E D;  4IPG A;  4JBW A;  3A55 A;  4ZRZ A;  2A1A A;  3ULL A;  3VR6 A;  2D9U A;  5M3F G;  1AE3 A;  1CZG A;  1HNW Q;  5JJK A;  4GNX C;  3PF4 A;  1NCV A;  1CFM A;  2JK8 A;  3ERO A;  1CM9 A;  3Q6S A;  4HIM A;  1V1Q A;  1II3 A;  3NHH A;  5M3M G;  1B2T A;  4LFC Q;  1R4Q B;  3J7A 5;  1UE1 A;  1X56 A;  5JEA G;  1XNQ Q;  2K01 A;  3DXJ C;  1TS5 A;  5EJW A;  1U5K A;  1D5X C;  2KHI A;  2KUM A;  4G7H C;  5LMN L;  2OF1 A;  3ULJ A;  2JA6 H;  2NVY B;  3BDC A;  2B2T A;  3J80 L;  5HY6 A;  4A3G H;  1ZYR C;  1A8V A;  3F2U A;  3D6W A;  1TXY A;  1AN8 A;  4DR2 L;  2IT1 A;  4C3I G;  2LFN A;  1YIJ A;  1TWG B;  1HA6 A;  4PG3 A;  2WB1 E;  5FOB B;  4B3T L;  2WAQ E;  4XQN A;  1STE A;  3VYS A;  4DGZ A;  3CPF A;  3G71 A;  2B2U C;  5C4J B;  2VW9 A;  4DAP A;  5EPJ A;  2FMM A;  3ND8 A;  3T51 B;  5FLM G;  5ELN A;  2IWH A;  4O42 A;  1R9T B;  1VQJ A;  2K04 A;  4DV2 L;  4ME5 A;  5IP9 G;  3ER0 A;  4A3L G;  1I4G A;  4H0L C;  1KXL A;  1Y1V H;  4IUU A;  1LT5 D;  3QIA A;  4HSV A;  2QGQ A;  2F0G A;  2MHV A;  1X3P A;  3PV0 A;  1NBW A;  1YBY A;  4A3B B;  1BCP D;  3M3Y H;  2D0O A;  4DAV A;  4C1N I;  2VQE L;  4GLA C;  1XMO Q;  3PO3 H;  3CCJ A;  1O7I A;  4FP5 D;  5KNC A;  2BCO A;  3OTO L;  2BA0 A;  2E2J H;  1HJP A;  4O2D A;  5KRU A;  1EU4 A;  4DK3 C;  3SXH A;  4N8F A;  3OMC A;  1KD1 C;  2F4I A;  1SYB A;  4P73 A;  4DV1 Q;  2UXD Q;  1QVF A;  2MFI A;  4KJN A;  5I2Y A;  2EPB A;  5M9O A;  5GAE C;  3S1R H;  1VQM A;  3BZD B;  3T56 B;  1PH5 A;  2FXQ A;  5E7N A;  2J4X A;  4EVO A;  4BY7 B;  4DUZ L;  1PRT B;  1TWC H;  2F1M A;  3TME A;  1JOO A;  1U9R A;  2Q2U A;  3M4O H;  3S1N H;  4IZ8 A;  3EN2 A;  4LAA A;  4PZ7 A;  3H15 A;  4A3C G;  3H09 A;  1HNX Q;  4C2M B;  3RZD H;  1HRJ A;  2EXD A;  1RTO A;  3U4V A;  2F0F A;  2Y0S E;  1CK1 A;  1VQI A;  1N32 L;  4JW0 A;  5C44 H;  1K0R A;  4JBJ A;  3CQZ B;  3I7F A;  4JI4 L;  1Y1W B;  2A68 C;  1UEB A;  4MTN A;  1QNK A;  4HMI A;  3K5L A;  1GHJ A;  4GS3 A;  2R93 G;  1C9O A;  3RLF A;  2RVL A;  3OMG A;  1DON A;  1A3T A;  4ZUJ A;  1F2Y A;  1L2F A;  1Y8O B;  2XWB B;  1IBK Q;  1O7Z A;  2O5J C;  3PO2 H;  2PNR C;  2OQ0 A;  4OWX B;  3A7A B;  4ZLT F;  4DR3 L;  1SBB B;  2F0J A;  5LMN Q;  1JOQ A;  2YU9 B;  2RF4 A;  4RA8 A;  1A3V A;  2HD3 A;  3AFP A;  4IJL A;  1SYF A;  4RKB A;  1JB3 A;  3M4Y A;  3F8T A;  4BXX H;  1H95 A;  3I56 A;  1N36 L;  4FYD A;  3S17 B;  1PRT F;  1UNS A;  4K5W A;  1C7Y A;  1HTL D;  3STB D;  2OQK A;  1EL0 A;  3R3O A;  2ASB A;  4B3T Q;  5KND A;  4Q0F A;  1XPU A;  1VF7 A;  2SNS A;  2K5W A;  4A3B G;  2KOL A;  2EYP A;  4A3M H;  1XPR A;  2QEJ C;  5JPN C;  1HQM C;  4LW1 A;  2B63 H;  1DD2 A;  3A8I E;  4LWC A;  3K58 A;  3I72 A;  2XGT A;  3A5Z B;  4GKK L;  3S2H B;  2F0U A;  1Q86 C;  5IIF A;  1KHI A;  3KLR A;  4DV2 Q;  2D2C C;  4NXN L;  2KEC A;  1Q7Y C;  4X3S A;  1SNP A;  3PCO B;  4ODG A;  4KMU C;  3K5N A;  2NVT B;  1SR3 A;  4IUQ A;  3PUW A;  1YHQ A;  1W2B A;  1PRT C;  3QO2 A;  5C3W A;  1G29 1;  2PO4 A;  4LF4 L;  5BR8 L;  3HOZ B;  1OXT A;  4JI6 L;  4AH6 A;  2VQE Q;  3ND9 A;  1CT1 D;  1UWV A;  1V1P B;  3RN5 A;  1TR5 A;  1MI2 A;  1Y8P B;  4KLK A;  4OEM B;  4POG A;  1U4R A;  5E1F A;  3OTO Q;  1EIH A;  2XN9 C;  1XPO A;  3AEV A;  3FP9 A;  4YWM A;  3GTP B;  1F77 A;  3H0G B;  4B3S L;  1AH9 A;  3CCE A;  2B2V C;  1WTX A;  1EYD A;  4ZKB B;  4F87 A;  4FO2 A;  2K4K A;  2F0L A;  3NUC A;  3U9S A;  5M5W H;  4A3D H;  4DV4 Q;  1V9P A;  1E1O A;  3KBX A;  1Y1W G;  2JP1 A;  4OEL B;  2FIN B;  1I5F A;  3S2D B;  3OW7 A;  5E3F A;  4DNR B;  5C5L A;  1CQV A;  3K0Y A;  3KJO A;  4KD3 A;  3URY A;  3S16 B;  2YYZ A;  2AWO A;  3DLL A;  5JPM C;  1ENC A;  1HH2 P;  2PW5 A;  1EWI A;  1HXY D;  2A6E D;  4YCV A;  4IOA A;  4F7X A;  2UU9 L;  2PMZ E;  4PV1 C;  2RHQ B;  5M3M H;  3D4W A;  1PZJ D;  2WB1 B;  5JEA H;  3J81 i;  1K73 C;  4GNX A;  2EYM A;  1GUW A;  1LAB A;  4IUR A;  1H9S B;  3BYY B;  4BY1 B;  1PH7 A;  1HZB A;  3CCL A;  2PPB C;  4MIU A;  4X65 L;  5A2Q L;  4LF7 L;  2PZT A;  4A3I G;  3AU7 A;  3J81 j;  2A69 D;  4CBV A;  2HCC A;  2I5L X;  3NBI A;  1JT8 A;  4WJ4 A;  1LV9 A;  1F2M A;  4MTK A;  1E24 A;  4K5X A;  1NMG A;  1Y1V B;  1KAW A;  1PA6 A;  3J7A F;  4OXP A;  3BG3 A;  1KC8 C;  4RWS C;  2N8N A;  4XXE A;  1N36 Q;  5FLM H;  2CKZ B;  5IGB A;  1WTV A;  1E3P A;  1MSH A;  2J0T D;  2DNC A;  2E2H B;  4IOC A;  5IP9 H;  2XIW A;  5KEE A;  4A3L H;  4M1U B;  2B2U A;  3D6C A;  4S3S A;  2KCT A;  4B3R L;  3ITP A;  3PO3 B;  4R4O A;  2DN8 A;  2EDG A;  4ULL A;  3GTK H;  3OWF A;  5J1Z A;  3HOV G;  1PZI D;  1TT2 A;  4K5V A;  3H94 A;  2WP8 J;  1FVI A;  2A19 A;  4QGU A;  1HQR D;  1ET6 A;  1I4H A;  3JAM c;  2AWN A;  2QEX A;  4NXN Q;  3BZK A;  2R7F A;  3Q0A A;  2K05 A;  4QB4 A;  4KHP L;  2NUC A;  2ZT9 C;  3QJY A;  2K33 A;  1ESR A;  3I4M B;  3P20 A;  3U4Z A;  3S1N B;  2RHS B;  2GVA A;  1G6P A;  2L0C A;  2LY7 A;  4TKO B;  2A74 C;  3W2D A;  4C3J H;  5EQ0 A;  4ILW A;  1A2T A;  4LF4 Q;  4A93 H;  5BR8 Q;  4J1M A;  2HHH Q;  1EFW A;  2F3V A;  4GLV B;  1V1O A;  4XT1 B;  3F2C A;  1PH2 A;  3UDI A;  1TQO A;  2BE5 D;  2OTL A;  4A3C H;  4X3U A;  4DXF A;  4WFN 3;  3NK9 A;  4B3S Q;  5C5M A;  3TRZ A;  1NUC A;  2F0D A;  4XDX A;  2WB1 G;  1FGB D;  4XQQ A;  5M5X B;  1WTW A;  1KL9 A;  4P2C B;  2F0O A;  3HG9 A;  3UE1 A;  3PO2 B;  4KY5 A;  3GTM B;  3HP3 A;  2OCE A;  1TKW B;  3D0F A;  3S1M B;  1B1Z A;  1NR4 A;  2VUM B;  3EJI A;  4QUC A;  1IZ6 A;  1D1I A;  3CPW A;  4ALP A;  1EIF A;  2L5T A;  2UU9 Q;  1A6X A;  1TWG H;  3I91 A;  1TS4 A;  1STG A;  4JI1 L;  4HCE A;  2ES2 A;  1SRO A;  2E2I B;  4IUP A;  4CDC C;  2C35 B;  1VQN A;  3W1G A;  4KV6 A;  4UDU C;  4R1J A;  1TII D;  3HOU B;  3K7U C;  5DNF A;  1I4Q A;  3DHQ A;  3O13 A;  1LAC A;  4X65 Q;  4LF7 Q;  2CCZ A;  3SDZ A;  2M2L A;  2AQ3 B;  3HFZ B;  3UE0 A;  4KJO A;  4AIM A;  3RZO B;  3OIP A;  5JVH 3;  1N33 L;  5EKL A;  5EKK A;  3EBE A;  1VQA A;  2NTT A;  4DR6 L;  3R2T A;  4IQZ A;  5C3E B;  4FF2 A;  4A3B H;  1EY6 A;  3FMC A;  5TSS A;  4OO1 I;  2MJ8 A;  4QUF A;  1PTO D;  3SGI A;  5BN4 A;  4J6H A;  4PZ6 A;  1HNZ Q;  1K3B C;  2MGS A;  2A6H C;  4CKC A;  1Z7T A;  4LFB L;  3QR8 A;  4QQB X;  1X6O A;  4CKE A;  2ZJR A;  3I4M G;  1BR9 A;  1X3E A;  3TP8 A;  1IYV A;  1PH4 A;  1VQL A;  1A2U A;  1SNC A;  2Y0S G;  4PZ8 A;  2G9H D;  3GTO B;  4BY7 H;  1XJV A;  2K50 A;  3LWU A;  2F0W A;  3NSW A;  3J7A V;  1VQ4 A;  1QUQ B;  2YTX A;  1BCP B;  1E2Z A;  3BZC A;  5M5W B;  1B3A A;  1F2Z A;  1VQO A;  1AE2 A;  1CI3 M;  1ASY A;  4KHP Q;  4C2M H;  2QCP X;  2EYF A;  3KLS X;  2WFW A;  1KAB A;  5CGK A;  4LJZ C;  1RD9 D;  4WJ3 M;  1VF5 C;  4RCO A;  2FMC A;  1HFN A;  1MGS A;  3QWN A;  2EXZ A;  3CQZ H;  5M3F B;  3T1Y Q;  4NDX A;  2CQA A;  1Y1W H;  1XX8 A;  3TS2 A;  2EY2 A;  4JK1 C;  3J7Y W;  2B2V A;  2VUM G;  3V2T A;  3K0X A;  3LWE A;  2NVX B;  3EQL C;  3OIQ A;  2F3W A;  1PH8 A;  2OWO A;  3FPP A;  4RHS A;  3HOY B;  1EY5 A;  2VNU D;  3KBG A;  1BO0 A;  2NN6 I;  3RN2 A;  3I8Z A;  2JXM B;  1CTM A;  4QIW E;  3SK4 A;  4C3I B;  5ELB A;  3CMA A;  1Y14 B;  2YU9 H;  1FJG Q;  3HOU G;  3QOJ A;  3OWE B;  2AUK A;  5E4X A;  2KCC A;  1G91 A;  3A74 A;  3ZYY X;  4UHV A;  2QW7 A;  1X3Q A;  2EQS A;  1I94 Q;  2E75 C;  3S17 H;  5FLX L;  4KTA A;  4A3E G;  4A3I H;  1BCP F;  5IYD H;  4XIG S;  4YY3 L;  4JI2 L;  3CP0 A;  2Z8L A;  1IKM A;  1ONL A;  5C3E G;  2CFM A;  3F2D A;  1K3R A;  3S1Q H;  4C56 C;  1BF4 A;  1ILQ A;  4JI7 L;  3S2H H;  1B7Y B;  1CKO A;  1NR2 A;  4L63 B;  5L37 A;  2UUC L;  1W3S A;  4WJW A;  3DWP A;  2R61 A;  1ML0 D;  1BOS A;  3QB3 A;  4LF8 Q;  3G4S A;  4DFA A;  3AB9 A;  2JEB I;  4MHE A;  2NVT H;  1N33 Q;  1KNA A;  1SEB D;  3FEW X;  1WCM G;  5T1G A;  5LMN W;  1EYC A;  4LUV A;  1BCP C;  1F9P A;  2JA9 A;  3HOZ H;  3OSO A;  1U4M A;  4TQU S;  2KQ3 A;  2X69 A;  2JA7 G;  3KF6 B;  1J9O A;  1VQG A;  1HUM A;  1CUK A;  2PZU A;  2XRS D;  1MSG A;  1GKH A;  4LFB Q;  4KI0 A;  3VA7 A;  2IJ0 A;  3GTP H;  3CC7 A;  1G2T A;  2BH8 A;  4CDE C;  1EOT A;  2E5L L;  2NTS A;  4OO1 G;  3PQI A;  1GUO A;  1V1P A;  5LMU Q;  1EWH A;  1NSN S;  3JAM E;  1IBL Q;  5ELC A;  5C4X B;  5JJL A;  2UXB L;  2WAC A;  3S2D H;  2MUY A;  4JG2 A;  3L3O C;  3S16 H;  5HGQ A;  3GTQ B;  2H4O A;  1IKL A;  1K83 B;  1Q12 A;  3HOY G;  2JJQ A;  2BDO A;  4TRD A;  3CCR A;  5IT9 L;  2R93 B;  1YJ9 A;  1I4X A;  3CHB D;  3BYT B;  3T1H Q;  2JN4 A;  3ICE A;  2LXJ A;  3LX0 A;  3JC6 6;  2NVQ B;  1JJ2 A;  2AQ1 B;  2JA5 G;  4BY1 H;  2R92 B;  2DUD A;  2I0Q A;  1A63 A;  5AJ3 L;  4FNF A;  1SSO A;  4HJA A;  3HOX B;  2Z1C A;  5C0X J;  1AW7 A;  2HDM A;  1H9S A;  3DWQ A;  1A15 A;  2K5H A;  5ELE A;  4DUY L;  1D8L A;  4XYQ A;  5IP7 G;  4DNI A;  5FLX c;  1QOH A;  3D31 A;  1EZ8 A;  2B29 A;  3IFD A;  3MAQ A;  4IFD I;  3C46 A;  1TWH B;  1ZXT A;  1HR0 L;  3BDL A;  2IPK D;  2KCN A;  4RG1 A;  1EIY B;  3GTL B;  2YV5 A;  2K32 A;  2NN6 G;  3TEH B;  2E2H H;  2NZ1 D;  1LLR D;  1GUS A;  1YNX A;  1EEI D;  3STB C;  1I4P A;  5KYI A;  4JI2 Q;  3NXW A;  4XT3 B;  2SEB D;  3K8A A;  4DAY B;  1E2V A;  5GAD C;  2UUB Q;  4L5Q A;  4RGT A;  4X64 L;  2CWA A;  1NE3 A;  3TBI B;  4K8I A;  5IGE A;  1JE4 A;  4RCN A;  1VMC A;  3L0O A;  2L4N A;  2Z4I A;  2CVR A;  2CHB D;  1Q8I A;  1BVS A;  4C3H B;  5IGD A;  1E7Z A;  3J81 L;  1ESF A;  2JSO A;  4EGV A;  1K8G A;  1SNQ A;  3I4M H;  3FPU B;  1HZA A;  1EY8 A;  2PCF B;  2ZTE A;  3M4P A;  5C4X G;  3ERS X;  4POF A;  3GTJ B;  4MZ9 A;  3X3N A;  1WVL A;  1IBM Q;  5H1S E;  4OX9 L;  2JQO A;  1X32 A;  4P74 A;  2K14 A;  1RHP A;  1FD7 D;  4A3K B;  4G7O C;  1KDC A;  4DNT B;  1CHP D;  5HGT A;  2SOB A;  1XNR Q;  4HJ7 A;  2F0K A;  2RCF A;  2WIN B;  4OIJ A;  2RSN A;  3MFY A;  3I3C A;  3GTG H;  1O80 A;  1KDB A;  1I50 B;  1DYQ A;  1YEZ A;  1S72 A;  4JI0 L;  3HOW B;  2PQA B;  1JOR A;  1PDQ A;  3TZU A;  5M5X H;  1WJJ A;  1H9K A;  3HKZ E;  2UXB Q;  1BKB A;  1EWC A;  5CV7 A;  5ISR A;  2R92 G;  1FYC A;  3J80 c;  5IYB G;  4JI3 L;  2XVS A;  1Y8N B;  5IT9 c;  3GTM H;  4JV5 L;  4H7B A;  1KLU D;  1L0X B;  1XTC D;  3HOX G;  3S1M H;  2VUM H;  2OT2 A;  1Q46 A;  2CWP A;  2AQ2 B;  2A6E C;  4GKJ L;  1BXT A;  1RL2 A;  1SJE D;  5COR A;  4CJ1 B;  4FF1 A;  5ELO A;  3D3R A;  5FO8 B;  2E76 C;  2B2Y C;  1EYG A;  3W3A A;  2J7Z A;  1M8A A;  2XNA C;  2LXK A;  4DR2 Q;  1ASZ A;  1PFB A;  2E2I H;  3NBH A;  1LT4 D;  1YZ6 A;  4A3I B;  3R2I A;  2Q8I B;  4DPG A;  5IWA L;  1U4P A;  2QKI C;  3HOU H;  1MBY A;  1SE2 A;  4EX5 A;  5AJ3 Q;  1B4O A;  3T13 A;  5NUC A;  4FF3 A;  1B50 A;  1PMR A;  2PZW A;  3WOF A;  4X3K A;  1PYW D;  2ICE C;  2LKV A;  3CC4 A;  1VQF A;  2A69 C;  3S1Q B;  1S5B D;  3E6Z X;  5IGC A;  3I70 A;  1WTP A;  3RD4 A;  2IX3 A;  2SNM A;  4DUY Q;  3RZO H;  5GRO A;  2DGY A;  3K81 C;  4LF9 L;  4FXK C;  3FVQ A;  4DR4 L;  4DV6 L;  3CXC A;  4UAI A;  5C3E H;  1JE5 A;  1X54 A;  3K7A H;  3DWA A;  1HR0 Q;  1MHW C;  1VQB A;  4R4C A;  2QIL A;  5COY A;  5CV8 A;  4C3H G;  3HOV B;  1IW7 D;  2KED A;  2EY1 A;  4JYA L;  1B9N A;  3P75 A;  4CGY B;  2R7Z B;  2BDN A;  1M1K C;  3GD7 A;  2VZA A;  3CW2 C;  2EJM A;  1KTK A;  2EJF C;  4DR7 L;  4IFD G;  3SHL A;  3GTO H;  2L11 A;  3J81 c;  4X64 Q;  3MXP A;  2MP1 A;  3MZ5 A;  1SLJ A;  1IL8 A;  3FHW A;  4A3K G;  5C0X I;  2HQE A;  1FR3 A;  1PTO B;  2K75 A;  4RKL A;  4DUZ Q;  1OO9 B;  4YWK A;  4RGN A;  3NEN A;  1PZK D;  1H9M A;  3MC0 B;  1QUQ A;  3HOW G;  3KJP A;  4OO1 H;  1G6Z A;  2WV6 D;  4GZY C;  2KCM A;  4AYB E;  5M3F H;  4OX9 Q;  2Q2I A;  1SN8 A;  1QZG A;  3TDQ A;  4UP9 A;  4FXD A;  1EQR A;  1N32 Q;  2M9V A;  4FDB A;  2LMC B;  2F52 A;  2BE5 C;  1UUP A;  2K6A A;  1Q8K A;  2NVX H;  4CDD C;  2PI2 A;  4JI4 Q;  2WAQ B;  4L5R C;  3NE5 B;  1IL2 A;  3HOY H;  2N88 A;  5DLQ E;  3I4L A;  4F88 A;  4JI0 Q;  5IE8 A;  4GN4 B;  1STY A;  2OXP A;  2EVB A;  1N8R C;  1AFP A;  3CCU A;  1SYC A;  1KIX A;  3M7N A;  2QDB A;  4NXM L;  4EQ5 A;  3SK8 A;  1PXU A;  4C3I H;  2ZJQ A;  1F9R A;  4KY7 A;  4JI3 Q;  1X3F A;  2K03 A;  3PSI A;  5I4D A;  4X3T A;  4DR3 Q;  2CQO A;  1VQ6 A;  1PFM A;  3CCQ A;  1WYD A;  5EBD A;  2IL8 A;  5F2D A;  2IW3 A;  2G5D A;  2X6G A;  1PTO F;  4BA2 I;  2EIF A;  5G3L D;  1KDA A;  5IWA Q;  1GD7 A;  2SDF A;  2F0P A;  3CCS A;  5AFW A;  1LYL A;  4ID6 A;  3ULP A;  1JMC A;  2R7Z G;  3C1F A;  1OXS C;  2I5H A;  3OOC A;  4FF4 A;  1SYD A;  2NN6 H;  1QZH A;  3DM1 A;  5FKA C;  4GKK Q;  2EYL A;  1SDF A;  4RFB A;  4X62 L;  2N78 A;  2UUA L;  1L0Y B;  1GVP A;  4LF9 Q;  1I6V C;  3KDF A;  4DV6 Q;  4HIO A;  1L1O B;  5CYU A;  5JJI A;  2ZM6 L;  1PTO C;  4ZQ3 A;  1FGU A;  1SXT A;  4ZAI A;  2Z6K C;  1IYU A;  2Y0S B;  2D5D A;  1SAP A;  4YWL A;  4JYA Q;  1BUV T;  4K0K L;  3E9H A;  3FDT A;  4A3J B;  4JI6 Q;  4IO9 A;  3L9A X;  1LTB D;  3KF6 A;  1QVC A;  4K2K A;  4NMZ A;  1DOM A;  4PQX A;  5CBA E;  3VDY A;  4CHT B;  4DR7 Q;  4I7Z C;  3H3V I;  3AYH B;  4LFA L;  3VR3 A;  2K1B A;  3LNN A;  3CD6 A;  4JBM A;  1D7Q A;  2B3G A;  2KEE A;  5C4X H;  3GTG B;  4DN4 M;  1RF2 D;  1JWS D;  1EEF D;  2JA8 G;  3IL8 A;  1SYG A;  2ALY B;  2V4D A;  3TZD A;  2KA7 A;  1JWU D;  1T5E A;  4JOI C;  1C0A A;  2WII B;  4BWG B;  1XTD A;  2V1C C;  5I6W A;  1HUN A;  3GTQ H;  1W6K A;  2IX1 A;  2WAQ G;  4JC0 A;  2ZXO A;  1DXM A;  3KF8 B;  5ELF A;  4BBR B;  1LO5 D;  3SVM A;  1K83 H;  3IKJ A;  3SK5 A;  1M90 C;  4FVM A;  2K7V A;  2JE6 I;  3AFQ A;  3AQQ A;  4XTC S;  1HZ9 A;  3NWT A;  2KHS A;  5C0X G;  2R93 H;  2JA6 G;  2L55 A;  4A3G G;  4ZCK A;  2KBN A;  5KNB A;  4PMC A;  2NVQ H;  1FL0 A;  5I6Y A;  4H02 A;  2R92 H;  4LUZ A;  5IYB H;  1Z47 A;  3MXG A;  4B9W A;  4EQN A;  1B9M A;  1EY0 A;  3HOX H;  1SFO B;  2XWJ B;  1Q1B A;  2NZH A;  1AZQ A;  4KN4 C;  4N8X 1;  4LF6 L;  2OTJ A;  3J80 E;  4DV7 L;  3KFU A;  1K8A C;  5CV9 A;  3DMU A;  4B08 A;  1LTT D;  5BN5 A;  4A3E B;  4HR7 B;  1ENA A;  1KRT A;  3Q24 A;  4QMG A;  3AMU A;  2RCN A;  3WDN A;  1RJT A;  4A3F B;  1MD2 D;  1S4Z A;  1TWH H;  2EY6 A;  2F0Q A;  4NP5 A;  3HZX A;  1WFQ A;  1BQQ T;  1D1K A;  1L0W A;  4DR1 L;  3GTL H;  5HUR A;  2I5M X;  1TU2 B;  1TWF B;  3K7A B;  1J6Q A;  3IFT A;  1HA5 A;  3A8J E;  5LHY 1;  1L1O C;  2PW7 A;  5EPK A;  1DOK A;  3I4N B;  3K59 A;  4IPD A;  1D6E C;  4B3R Q;  2K5N A;  4DF7 A;  1K8M A;  3M7G A;  1D5Z C;  1LT6 D;  4KHV A;  4DAY A;  3KK7 A;  2NZO A;  5E4W C;  1WCM B;  3CKI B;  1S40 A;  1XMQ L;  1WD0 A;  4GN5 A;  3I4O A;  4C3H H;  3J7Z C;  4A3J G;  3K5O A;  2XTI A;  3C1E A;  3D4R A;  2AMC B;  3TP6 A;  5D14 A;  2JA7 B;  2UUA Q;  1QJO A;  1GO3 E;  3K57 A;  4IFD H;  1T5X D;  1PFN A;  1NTG A;  3NTH A;  3GTJ H;  4GOP B;  3PUV A;  3QOL A;  3BDO A;  2Q2H A;  1LT3 D;  2L12 A;  4A3K H;  1VS0 A;  2QA4 A;  1WTQ A;  2PMZ B;  1HNW L;  1I4R A;  4BBR G;  4RHR A;  2JYO A;  4HSP A;  4LFC L;  5C44 G;  3MFG A;  2F0M A;  1I50 H;  4DK1 A;  3BVM A;  1XNQ L;  2UXC L;  2ZJP A;  3RUZ A;  4V19 0;  4P75 A;  2E8G A; 
#chains in the Genus database with same CATH homology
 5EGT A;  4C1N K;  3MXU A;  4DXG A;  2O4X A;  1C4Q A;  2TSS A;  2ZXP A;  1VDZ A;  2ENB A;  1D2B A;  3KLS A;  2WKD A;  1CA6 A;  4E6I A;  3TP7 A;  4K14 A;  2R3Z A;  2B2W C;  1EY9 A;  3TP5 A;  3R8B A;  2F0H A;  2JA5 B;  2EY5 A;  1LTR D;  5T1I A;  4R8I A;  2F0I A;  2EYJ A;  1UAP A;  5J39 A;  5D65 A;  2KJX A;  4WRD A;  1D5M C;  1IHZ A;  4H44 C;  4Y7N B;  3A56 A;  1YNJ D;  3S14 B;  5DM7 3;  1SMY D;  3MVV A;  2RSO A;  1YNN D;  5C4Z A;  4ABN A;  3T4A C;  3UI2 A;  3NWS A;  5IOD A;  3A7L A;  3SK6 A;  3SE0 A;  3E5S A;  1F2L A;  4LK1 C;  1G2S A;  4K6L A;  3T16 A;  4ZYS A;  5IGG A;  4G57 A;  1BBX C;  5FK9 C;  5I2X A;  5IOC A;  2HDL A;  1FNW A;  2I07 B;  4ZUI A;  4PMW A;  4MN3 A;  1ENF A;  1PTO H;  1I6H B;  4NW2 A;  2VXW A;  4BA1 I;  2F0V A;  1G8Z D;  3VYT A;  2NYZ D;  3MEH A;  3CRL C;  1QE6 A;  2B8G A;  4HMJ A;  1LTA D;  1QIL A;  2FFK B;  3PUY A;  5I9O A;  2XRQ D;  1VCI A;  2NBF A;  4KKT A;  5C0X H;  4OHJ A;  3N6R A;  4IUV A;  4HTH A;  5JJZ A;  1GHK A;  5C6A A;  2RDH A;  4U68 A;  1DCZ A;  2RBM A;  4OL7 A;  1O78 A;  1GUN A;  1TY2 A;  1STA A;  4YIJ A;  3V05 A;  1XWE A;  1KLG D;  1SNM A;  4ZKC B;  4H13 C;  1DZ1 A;  1Q1E A;  5A2Q E;  1E0B A;  2HUG A;  1QCB D;  4N9T A;  4B9X A;  3L7Z C;  1EFI D;  1M4V A;  3QG1 A;  3NTI A;  4KN7 C;  3HS0 C;  1ET9 A;  1KAA A;  2HCI A;  4KKU A;  2D62 A;  1ILP A;  2ZXR A;  3MWY W;  3R93 A;  1HFG A;  2CW0 D;  2OEO A;  4R8N A;  1RKN A;  5CR3 A;  5BN3 A;  1IW7 C;  1S5C D;  4C3J G;  3I90 A;  2L1B A;  1OXU A;  1DM0 B;  4BBS B;  1Q3L A;  4M8A A;  2G9D A;  2Q8R E;  2EZV A;  4Z9C B;  1ZYR D;  2BOS A;  4QIW B;  2QF7 A;  1JCK B;  1F9Q A;  3DEP A;  4RAU C;  3P7J A;  2X6L A;  1JQY D;  3CRK C;  2F0N A;  3KF8 A;  3PMF A;  2FJ2 A;  2XSC A;  4OGQ C;  4DA2 A;  2KVM A;  2GA4 B;  1KNE A;  3VA5 A;  4KKS A;  4EQO A;  1I3Q B;  1PLF A;  4WOR A;  5G3L F;  2EJG C;  3WOE A;  4I65 A;  1CZW A;  1K8O A;  2NWG A;  2DNE A;  2FHT A;  1C8C A;  1R4P B;  5DAU A;  2B2W A;  4IUN A;  1HCZ A;  1JC7 A;  1TWA B;  3OPO A;  1BNZ A;  3EA6 A;  3FKI B;  3C3L A;  4U67 3;  3GV6 A;  2Z4H A;  3U9O A;  3T53 B;  5C4H A;  1STH A;  3V96 A;  3Q22 A;  4L6T B;  2NB0 A;  5KYL A;  4IUT A;  2L9H A;  3RMH A;  1C48 A;  1EU3 A;  1ZKO A;  3JAM L;  1CQF A;  1SJH D;  1OXV A;  1U4L A;  3S15 B;  4V0B A;  1GUG A;  1EYA A;  2RKS A;  5EBC A;  1XYI A;  3H6M A;  2A68 D;  1QB5 D;  3A8K E;  2BA1 A;  4DK0 A;  1DJR D;  4J8Q A;  1LTG D;  2F0T A;  1QG7 A;  3H91 A;  2JA8 B;  4BS9 A;  2DY8 A;  5M5Y B;  4K8J A;  2F0E A;  1JOK A;  1EZ6 A;  4LMQ D;  2ID0 A;  2RDF A;  3Q23 A;  2PQE A;  1O7L A;  3M85 A;  2JA6 B;  2K5Q A;  4A3G B;  1TS3 A;  2R6G A;  4EQP A;  1B44 D;  3NP8 A;  3VR2 A;  1AP0 A;  5JEA J;  1EY7 A;  2A5H A;  5JVG 3;  4F8M A;  4RGM A;  3A54 A;  2EYO A;  1BDO A;  2EE1 A;  2TMP A;  4HCS A;  2F03 A;  1Y69 U;  5IGF A;  3SR1 A;  1TVX A;  1RDP D;  1H9R A;  2RA4 A;  3GP7 A;  1B53 A;  2RQX A;  1WTR A;  5FO7 B;  4QCL A;  1OXX K;  1PRT D;  5FLX E;  3ERQ A;  3M3Y B;  3BS1 A;  2O2L D;  3K6O A;  4O1N A;  1GJX A;  3MTS A;  3G6J B;  5K36 G;  3GO5 A;  2E2D C;  2E2J B;  2LS0 1;  5CV6 A;  3PIP 3;  3S1R B;  3VYU A;  1WTO A;  2B8F A;  4K2L A;  1SND A;  3MA2 B;  4ZK9 B;  1TWC B;  1ZEQ X;  1ROD A;  3M4O B;  5A35 A;  1ICW A;  3HKZ B;  1JR0 D;  3GV3 A;  2IX0 A;  4XQJ A;  3RZD B;  3VYR A;  3PUZ A;  2B2T C;  3EVQ A;  4L8J A;  1Z6H A;  2C5C A;  1EIG A;  4N9P A;  5C44 B;  1EQV A;  1H9J A;  3VR5 A;  4HED A;  5JAV A;  5DM6 3;  2K28 A;  1FNU A;  5K5P A;  2M00 A;  5ELD A;  5EPL A;  1E2W A;  4FXG C;  4KD4 A;  4RH6 A;  2EYH A;  1SE4 A;  5CC4 A;  4PNY A;  5IT9 E;  4QF4 A;  2JEA I;  1STN A;  3NTK A;  1VMP A;  1HHV A;  5CMD A;  3BVG A;  1CHQ D;  2B2Y A;  5LL6 X;  1J8I A;  5EKI A;  4KY6 A;  1DOL A;  2N55 A;  3D4D A;  4OIK A;  4A3M B;  2B63 B;  1EQT A;  2K5D A;  1YNJ C;  4RGO S;  3DEO A;  2MPM A;  1SMY C;  3P1H A;  3HEJ A;  5CBE E;  1YNN C;  4CKB A;  4Q5V A;  5I9P A;  1A3U A;  1STB A;  4CJ2 C;  3CU7 A;  3GQB A;  4IN3 A;  2H1E A;  3VR4 A;  2PYK A;  3N52 A;  1GUT A;  1SE3 A;  1LTS D;  4AYB B;  1SNO A;  3HRZ C;  1EY4 A;  5KIX A;  4IAL A;  4KHZ A;  2C9O A;  2RDG A;  4K6D A;  3X3M A;  1QNU A;  1Q90 A;  4A3D B;  3J81 E;  3ONA B;  4CJ0 B;  5KGU A;  2WKC A;  3PIO 3;  1LTI D;  4IFD J;  3C2P A;  2VB3 X;  1UEA B;  3MXN A;  3FRP B;  1XXG A;  4NKL A;  2B39 A;  4TSS A;  3IAY A;  3H3V C;  3MHB A;  3TN2 A;  4G4K A;  3S9W A;  1HPC A;  5M3M B;  3E0J A;  1S5F D;  4R9W A;  5CV4 A;  1AEX A;  3I73 A;  1V43 A;  4DU9 A;  3NPP A;  1SYE A;  5D3D A;  3KUP A;  1RTN A;  3EFX D;  5DEH A;  1FNV A;  5JOB A;  5C3X A;  4HN7 A;  5D3I B;  3DUZ A;  1TY0 A;  1RCV D;  2F0S A;  1TS2 A;  4XYO A;  1V8Q A;  3PUX A;  3D8G A;  1AZP A;  2VB2 X;  1F9S A;  1NAP A;  2DY7 A;  4KK7 A;  1GXD C;  5LL6 S;  5FO9 B;  2A6H D;  4HAE A;  1WD1 A;  1JWM D;  2A73 B;  3BVZ A;  1W6J A;  3NQT A;  1CA5 A;  3GTK B;  2AUJ D;  2I46 A;  2ICI A;  3NQI A;  1GOZ A;  3TSS A;  2EOT A;  5K36 H;  1S5D D;  3HGB A;  1QWY A;  2O5I C;  3G7L A;  4PMB A;  3K5M A;  5J22 A;  2E74 C;  5CV5 A;  4G7Z C;  1HTP A;  4C3J B;  2Q8T A;  3SEB A;  3OHX C;  4A93 B;  2CW0 C;  1JIC A;  1O7Y A;  1S5E D;  4JBW A;  3A55 A;  4ZRZ A;  3VR6 A;  2D9U A;  1CZG A;  1NCV A;  1CFM A;  3ERO A;  1CM9 A;  3Q6S A;  1II3 A;  3NHH A;  1B2T A;  1R4Q B;  5JEA G;  2K01 A;  3DXJ C;  1TS5 A;  5EJW A;  1D5X C;  2KUM A;  4G7H C;  2OF1 A;  2NVY B;  3BDC A;  2B2T A;  3J80 L;  1ZYR C;  3F2U A;  3D6W A;  1AN8 A;  2IT1 A;  4C3I G;  2LFN A;  1TWG B;  1HA6 A;  5FOB B;  4XQN A;  1STE A;  3VYS A;  4DGZ A;  2B2U C;  5C4J B;  4DAP A;  5EPJ A;  2FMM A;  3ND8 A;  3T51 B;  2IWH A;  4O42 A;  1R9T B;  2K04 A;  4ME5 A;  1I4G A;  4H0L C;  4IUU A;  1LT5 D;  3QIA A;  4HSV A;  2F0G A;  2MHV A;  1X3P A;  3PV0 A;  4A3B B;  1BCP D;  4DAV A;  4C1N I;  4FP5 D;  5KNC A;  2BCO A;  2BA0 A;  5KRU A;  1EU4 A;  3SXH A;  3OMC A;  2F4I A;  1SYB A;  4KJN A;  5I2Y A;  5M9O A;  2EPB A;  3BZD B;  3T56 B;  2J4X A;  4EVO A;  4BY7 B;  1PRT B;  2F1M A;  3TME A;  1JOO A;  1U9R A;  4IZ8 A;  4LAA A;  3H09 A;  4C2M B;  1HRJ A;  1RTO A;  2F0F A;  1CK1 A;  3CQZ B;  1Y1W B;  2A68 C;  3K5L A;  1QNK A;  4HMI A;  1GHJ A;  3RLF A;  2RVL A;  3OMG A;  1DON A;  1A3T A;  4ZUJ A;  1F2Y A;  1Y8O B;  2XWB B;  1O7Z A;  2O5J C;  2PNR C;  3A7A B;  4ZLT F;  1SBB B;  2F0J A;  1JOQ A;  2YU9 B;  4RA8 A;  1A3V A;  1SYF A;  4RKB A;  1JB3 A;  3M4Y A;  4FYD A;  3S17 B;  1PRT F;  1UNS A;  4K5W A;  1HTL D;  1EL0 A;  3R3O A;  5KND A;  4Q0F A;  1VF7 A;  2SNS A;  2K5W A;  2KOL A;  2EYP A;  2QEJ C;  5JPN C;  1HQM C;  1DD2 A;  3A8I E;  3K58 A;  3I72 A;  3S2H B;  2F0U A;  5IIF A;  3KLR A;  2D2C C;  2KEC A;  4X3S A;  1SNP A;  4ODG A;  4KMU C;  3K5N A;  2NVT B;  4IUQ A;  3PUW A;  1PRT C;  3QO2 A;  5C3W A;  1G29 1;  2PO4 A;  3HOZ B;  1OXT A;  3ND9 A;  1CT1 D;  1V1P B;  1TR5 A;  1MI2 A;  1Y8P B;  1EIH A;  1U4R A;  5E1F A;  2XN9 C;  3GTP B;  1F77 A;  3H0G B;  2B2V C;  1WTX A;  1EYD A;  4ZKB B;  4F87 A;  4FO2 A;  3NUC A;  2F0L A;  3U9S A;  3KBX A;  2JP1 A;  2FIN B;  3S2D B;  3OW7 A;  5E3F A;  4DNR B;  5C5L A;  1CQV A;  3K0Y A;  4KD3 A;  3URY A;  3S16 B;  2YYZ A;  2AWO A;  5JPM C;  1ENC A;  2PW5 A;  1HXY D;  2A6E D;  4F7X A;  4PV1 C;  3D4W A;  1PZJ D;  2WB1 B;  5JEA H;  1GUW A;  2EYM A;  1LAB A;  4IUR A;  1H9S B;  3BYY B;  4BY1 B;  2PPB C;  4MIU A;  5A2Q L;  2PZT A;  3AU7 A;  2A69 D;  4CBV A;  2HCC A;  3NBI A;  1LV9 A;  1F2M A;  4K5X A;  1Y1V B;  3J7A F;  3BG3 A;  4RWS C;  4XXE A;  5IGB A;  1WTV A;  1MSH A;  2J0T D;  2DNC A;  2E2H B;  2XIW A;  5KEE A;  4M1U B;  2B2U A;  3D6C A;  4S3S A;  3ITP A;  3PO3 B;  2DN8 A;  2EDG A;  4ULL A;  3OWF A;  5J1Z A;  1PZI D;  1TT2 A;  4K5V A;  3H94 A;  2WP8 J;  1HQR D;  1ET6 A;  1I4H A;  2AWN A;  3Q0A A;  2K05 A;  4QB4 A;  2NUC A;  2ZT9 C;  3QJY A;  2K33 A;  1ESR A;  3I4M B;  3P20 A;  3S1N B;  2L0C A;  2LY7 A;  4TKO B;  2A74 C;  3W2D A;  5EQ0 A;  4ILW A;  1A2T A;  4J1M A;  4XT1 B;  2F3V A;  1V1O A;  1TQO A;  2BE5 D;  4DXF A;  4X3U A;  4WFN 3;  3NK9 A;  5C5M A;  1NUC A;  2F0D A;  4XDX A;  1FGB D;  4XQQ A;  5M5X B;  1WTW A;  4P2C B;  2F0O A;  3HG9 A;  3PO2 B;  4KY5 A;  3GTM B;  3HP3 A;  1TKW B;  3S1M B;  1B1Z A;  1NR4 A;  2VUM B;  3EJI A;  4QUC A;  1D1I A;  2L5T A;  1A6X A;  3I91 A;  1TS4 A;  1STG A;  4HCE A;  2E2I B;  4IUP A;  4KV6 A;  4UDU C;  1TII D;  3HOU B;  5DNF A;  1I4Q A;  3DHQ A;  3O13 A;  1LAC A;  3SDZ A;  2M2L A;  2AQ3 B;  4KJO A;  3RZO B;  3OIP A;  5JVH 3;  5EKL A;  5EKK A;  2NTT A;  3R2T A;  4IQZ A;  5C3E B;  4FF2 A;  1EY6 A;  3FMC A;  5TSS A;  4OO1 I;  2MJ8 A;  4QUF A;  1PTO D;  5BN4 A;  4J6H A;  2MGS A;  2A6H C;  4CKC A;  1Z7T A;  4CKE A;  1BR9 A;  3TP8 A;  1IYV A;  1A2U A;  1SNC A;  3GTO B;  2G9H D;  3LWU A;  2F0W A;  3NSW A;  3J7A V;  1BCP B;  1E2Z A;  5M5W B;  1B3A A;  1F2Z A;  1CI3 M;  2QCP X;  2EYF A;  3KLS X;  5CGK A;  1KAB A;  4LJZ C;  1RD9 D;  1VF5 C;  4RCO A;  2FMC A;  1HFN A;  1MGS A;  3QWN A;  2EXZ A;  5M3F B;  4NDX A;  2CQA A;  1XX8 A;  2EY2 A;  4JK1 C;  3J7Y W;  2B2V A;  3V2T A;  3LWE A;  2NVX B;  3EQL C;  3OIQ A;  2F3W A;  3FPP A;  4RHS A;  3HOY B;  1EY5 A;  2VNU D;  3KBG A;  1BO0 A;  2NN6 I;  3I8Z A;  2JXM B;  1CTM A;  3SK4 A;  4C3I B;  5ELB A;  3QOJ A;  3OWE B;  2AUK A;  5E4X A;  2KCC A;  1G91 A;  3ZYY X;  1X3Q A;  2E75 C;  5FLX L;  4KTA A;  1BCP F;  4XIG S;  2Z8L A;  1IKM A;  1ONL A;  4C56 C;  1BF4 A;  1ILQ A;  4L63 B;  1NR2 A;  4WJW A;  3DWP A;  2R61 A;  1ML0 D;  1BOS A;  3QB3 A;  4DFA A;  3AB9 A;  2JEB I;  4MHE A;  1KNA A;  1SEB D;  3FEW X;  5T1G A;  1EYC A;  1BCP C;  1F9P A;  1U4M A;  3OSO A;  4TQU S;  2KQ3 A;  2X69 A;  1J9O A;  1HUM A;  2PZU A;  2XRS D;  1MSG A;  4KI0 A;  3VA7 A;  2IJ0 A;  1G2T A;  1EOT A;  4OO1 G;  2NTS A;  1GUO A;  1V1P A;  1EWH A;  1NSN S;  3JAM E;  5ELC A;  5C4X B;  2WAC A;  2MUY A;  3L3O C;  3GTQ B;  2H4O A;  1IKL A;  1K83 B;  1Q12 A;  2BDO A;  4TRD A;  5IT9 L;  2R93 B;  1I4X A;  3CHB D;  3BYT B;  3LX0 A;  2NVQ B;  2AQ1 B;  2R92 B;  4FNF A;  1SSO A;  3HOX B;  2Z1C A;  5C0X J;  1AW7 A;  2HDM A;  1H9S A;  3DWQ A;  1A15 A;  5ELE A;  4XYQ A;  1QOH A;  3D31 A;  1EZ8 A;  3IFD A;  3MAQ A;  4IFD I;  3C46 A;  1TWH B;  1ZXT A;  3BDL A;  2IPK D;  2KCN A;  3GTL B;  2K32 A;  2NN6 G;  2NZ1 D;  1LLR D;  1GUS A;  1EEI D;  1I4P A;  5KYI A;  3NXW A;  4XT3 B;  2SEB D;  1E2V A;  4RGT A;  5IGE A;  3TBI B;  4K8I A;  1JE4 A;  4RCN A;  1VMC A;  2L4N A;  2Z4I A;  2CVR A;  2CHB D;  1Q8I A;  5IGD A;  4C3H B;  3J81 L;  1ESF A;  2JSO A;  4EGV A;  1SNQ A;  3FPU B;  1EY8 A;  2PCF B;  3GTJ B;  3X3N A;  1WVL A;  1X32 A;  1RHP A;  1FD7 D;  4A3K B;  4G7O C;  1KDC A;  4DNT B;  1CHP D;  5HGT A;  2SOB A;  2F0K A;  2WIN B;  4OIJ A;  2RSN A;  3MFY A;  3I3C A;  1O80 A;  1KDB A;  1I50 B;  1DYQ A;  3HOW B;  1JOR A;  1PDQ A;  3TZU A;  1H9K A;  1EWC A;  5CV7 A;  5ISR A;  1FYC A;  2XVS A;  1Y8N B;  4H7B A;  1KLU D;  1L0X B;  1XTC D;  2OT2 A;  2AQ2 B;  2A6E C;  1BXT A;  1SJE D;  4CJ1 B;  5COR A;  4FF1 A;  3D3R A;  5FO8 B;  2E76 C;  2B2Y C;  3W3A A;  2J7Z A;  1M8A A;  2XNA C;  1PFB A;  3NBH A;  1LT4 D;  4A3I B;  3R2I A;  2Q8I B;  1U4P A;  2QKI C;  1MBY A;  1SE2 A;  1B4O A;  3T13 A;  5NUC A;  4FF3 A;  1B50 A;  1PMR A;  2PZW A;  3WOF A;  4X3K A;  1PYW D;  2ICE C;  2LKV A;  2A69 C;  3S1Q B;  1S5B D;  3E6Z X;  5IGC A;  3I70 A;  1WTP A;  3RD4 A;  2IX3 A;  2SNM A;  4FXK C;  3FVQ A;  4UAI A;  3DWA A;  2QIL A;  5COY A;  5CV8 A;  4C3H G;  3HOV B;  1IW7 D;  2KED A;  2EY1 A;  2R7Z B;  1B9N A;  3P75 A;  4CGY B;  2BDN A;  3GD7 A;  2EJM A;  1KTK A;  2EJF C;  4IFD G;  3SHL A;  2L11 A;  3MXP A;  2MP1 A;  3MZ5 A;  1IL8 A;  5C0X I;  2HQE A;  1FR3 A;  1PTO B;  4RKL A;  1OO9 B;  4RGN A;  1PZK D;  1H9M A;  3MC0 B;  4OO1 H;  1G6Z A;  2WV6 D;  4GZY C;  3TDQ A;  4FXD A;  2M9V A;  2LMC B;  2BE5 C;  1UUP A;  2K6A A;  2WAQ B;  3NE5 B;  2N88 A;  3I4L A;  4F88 A;  1STY A;  2OXP A;  2EVB A;  1AFP A;  1SYC A;  3M7N A;  2QDB A;  3SK8 A;  1PXU A;  1F9R A;  4KY7 A;  2K03 A;  5I4D A;  4X3T A;  1PFM A;  5EBD A;  2IL8 A;  5F2D A;  2IW3 A;  2X6G A;  1PTO F;  4BA2 I;  5G3L D;  1KDA A;  2SDF A;  2F0P A;  5AFW A;  4ID6 A;  3C1F A;  1OXS C;  3OOC A;  4FF4 A;  1SYD A;  2NN6 H;  3DM1 A;  5FKA C;  2EYL A;  1SDF A;  4RFB A;  1L0Y B;  1I6V C;  5CYU A;  1PTO C;  4ZQ3 A;  1SXT A;  4ZAI A;  1IYU A;  2Y0S B;  2D5D A;  1SAP A;  1BUV T;  3FDT A;  4A3J B;  3L9A X;  1LTB D;  4K2K A;  4NMZ A;  1DOM A;  4PQX A;  5CBA E;  4CHT B;  4I7Z C;  3VR3 A;  2K1B A;  3LNN A;  2KEE A;  3GTG B;  4DN4 M;  1RF2 D;  1JWS D;  1EEF D;  3IL8 A;  1SYG A;  3TZD A;  2V4D A;  2KA7 A;  1JWU D;  1T5E A;  2WII B;  4BWG B;  5I6W A;  1HUN A;  1W6K A;  2IX1 A;  2ZXO A;  1DXM A;  5ELF A;  4BBR B;  1LO5 D;  3SVM A;  3IKJ A;  3SK5 A;  4FVM A;  2K7V A;  2JE6 I;  4XTC S;  5C0X G;  3NWT A;  2KHS A;  2L55 A;  5KNB A;  4PMC A;  5I6Y A;  1Z47 A;  3MXG A;  4B9W A;  4EQN A;  1B9M A;  1EY0 A;  1SFO B;  2XWJ B;  1Q1B A;  1AZQ A;  4KN4 C;  3J80 E;  5CV9 A;  3DMU A;  4B08 A;  1LTT D;  5BN5 A;  4A3E B;  4HR7 B;  1ENA A;  3AMU A;  3Q24 A;  4QMG A;  3WDN A;  1RJT A;  4A3F B;  1MD2 D;  1S4Z A;  2EY6 A;  2F0Q A;  4NP5 A;  3HZX A;  1BQQ T;  1D1K A;  5HUR A;  1TU2 B;  1TWF B;  3K7A B;  3IFT A;  1HA5 A;  3A8J E;  5LHY 1;  2PW7 A;  5EPK A;  1DOK A;  3I4N B;  3K59 A;  1D6E C;  4DF7 A;  1K8M A;  3M7G A;  1D5Z C;  1LT6 D;  4KHV A;  4DAY A;  3KK7 A;  5E4W C;  1WCM B;  3CKI B;  1WD0 A;  3K5O A;  3C1E A;  3D4R A;  3TP6 A;  5D14 A;  2JA7 B;  1QJO A;  3K57 A;  4IFD H;  1T5X D;  1PFN A;  3NTH A;  3PUV A;  3QOL A;  3BDO A;  1LT3 D;  2L12 A;  1WTQ A;  2PMZ B;  1I4R A;  4RHR A;  2JYO A;  4HSP A;  3MFG A;  2F0M A;  4DK1 A;  3BVM A;  3RUZ A;  4V19 0; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...