3EJIA

Crystal structure of staphylococcal nuclease variant delta+phs l36k at cryogenic temperature
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
130
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRKLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Structural Consequences of the Ionization of Lysines at 25 Internal Positions in a Protein
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ejiA00
3NK9A 2EYJA 2SNMA 4KJOA 5KEEA 5KRUA 5JOBA 4HMJA 3T13A 2PZUA 3C1FA 1SNOA 2F0FA 2PYKA 3NHHA 3MVVA 3QOLA 5CV8A 3SK5A 5IGDA 5JAVA 2ENBA 2EYMA 1JOQA 5F2DA 1TQOA 2F0GA 3E5SA 4K5WA 1KDAA 4ZQ3A 4WORA 3TMEA 3EVQA 2EYOA 2F0SA 1ENCA 3BDCA 1EY8A 2EY5A 4NKLA 5EKLA 3RUZA 4K5VA 2EY6A 3TP5A 4N9PA 4G57A 1A2UA 3H6MA 4WRDA 4YIJA 5C6AA 5KIXA 2F0JA 4MIUA 1EY0A 1A2TA 2RDFA 5J39A 3VA5A 5ISRA 1AEXA 2F0TA 2F0WA 3EJIA 5CV4A 2QDBA 5CV6A 3U9OA 2RKSA 1SYCA 2PW5A 3QOJA 1EYAA 5J1ZA 2PQEA 4PMCA 1F2ZA 3OMGA 4ME5A 2F0OA 2RBMA 1STYA 1STGA 2F0DA 3MZ5A 5HURA 5KGUA 4EQNA 3S9WA 1SYEA 5I9PA 5KYLA 1JORA 2NUCA 2PZTA 4TRDA 4DGZA 4EQOA 4F8MA 4B9XA 4KD4A 1RKNA 3D8GA 3BDLA 1STBA 2KQ3A 2F0PA 3R3OA 4RKBA 5EGTA 3C1EA 2PZWA 3OWFA 5KYIA 1SNQA 2F0VA 2F0LA 3OSOA 5C5LA 1EQVA 4KHVA 4KY6A 5CGKA 5IGFA 5CC4A 5DEHA 1EY6A 1STNA 4PNYA 2EXZA 4K8IA 5IGCA 2F3WA 3SR1A 2F0NA 2LKVA 2F0UA 1TT2A 2EYHA 5EKKA 4E6IA 4ZUJA 4KY7A 4IUNA 2F0QA 4ODGA 5IIFA 2EYLA 5IGBA 5M9OA 2OEOA 3NQTA 1EY7A 1STHA 3D4DA 4PMBA 4IALA 5CR3A 5E3FA 5I6WA 3ERQA 3HEJA 2F0HA 5C4HA 5J22A 1IHZA 3SK4A 5HGTA 3PMFA 5E1FA 1KDBA 5IODA 2OXPA 3OMCA 4H7BA 2WACA 5K5PA 5C3XA 1EZ8A 4B9WA 4N9TA 4K2LA 3D4WA 4NMZA 1SYDA 2PW7A 3SK6A 1A3VA 2F3VA 2M00A 3D6CA 2O4XA 4S3SA 3TP7A 5I6YA 2EY1A 1II3A 5NUCA 2F0MA 4K14A 3TP6A 4HMIA 4NP5A 3ITPA 4K8JA 1JOOA 1EY4A 1NSNS 1EYCA 2SNSA 4KY5A 2HQEA 3DHQA 3DMUA 4DU9A 2EYFA 4EQPA 1EY5A 4KJNA 5I9OA 3HZXA 4QF4A 1KAAA 4J1MA 4OL7A 3EROA 1EY9A 5IGEA 1U9RA 2F0IA 4LAAA 2EY2A 1EYDA 5CV5A 1F2YA 3MHBA 4ID6A 3SXHA 1SNCA 4EVOA 1EZ6A 4K5XA 4F7XA 1SNMA 5CV7A 4QB4A 1TR5A 1KABA 4HTHA 5C4ZA 5C5MA 4DF7A 2EYPA 1F2MA 4K2KA 3NP8A 3SK8A 1A3UA 4I65A 3NUCA 4RKLA 4IZ8A 4J6HA 4ZUIA 3TP8A 1SYFA 5DAUA 2F0KA 4NDXA 1NUCA 1A3TA 1SYBA 3P1HA 3NXWA 3P75A 3LX0A 4KD3A 3QB3A 4R8NA 3T16A 4DFAA 4KTAA 1ENAA 5IGGA 2OF1A 5CV9A 4K6DA 4KV6A 1STAA 4QMGA 1KDCA 5C3WA 1SYGA 2F0EA 3MEHA 1JOKA 1SNDA 1SNPA 2SOBA 3MXPA 3SHLA 2KHSA 5IOCA 3V2TA
chains in the Genus database with same CATH superfamily
1IKMA 4HCEA 3X3MA 4DXGA 2PQAB 2F0FA 1S72A 4ZQ3A 1ASZA 3ICEA 5M3MG 4A3MH 2PMZB 4DV5L 1WTHA 2QEJC 4IUPA 4DR6L 4N9PA 1A2UA 2BDNA 1QE6A 1TWFH 3BJUA 3TS2A 2VUMH 2NTSA 4KN4C 2WP8J 2GA4B 1YNND 2PNRC 3I55A 1RTNA 1MHWC 2MQHA 4UP9A 4A3DB 4PMCA 2K6AA 1WYDA 3KYHC 3RN5A 1L0YB 4FXGC 5FJ8H 4GKJL 3MXUA 1WTXA 3U58A 4B3ML 1LTAD 3VR4A 2LFNA 2F0LA 1N34L 4R1JA 1E2ZA 3J7AV 5EPJA 2LMCB 1DONA 5T1GA 5I4DA 5EKKA 1LTLA 2VY3A 4O42A 3H15A 1E3PA 1XTDA 1TWCB 2K14A 5J22A 3GTLB 4IJHA 2B63B 2ASBA 4V190 2WV6D 1XPUA 2JN4A 3TEHB 1Q81C 2YTYA 1TS2A 4HIOA 2KECA 3TZDA 4IURA 1MD2D 3HS0C 4CJ0B 4DNTB 2PI2E 2AUKA 4DV4L 1G6PA 2B2TC 1IZ6A 3S1RB 1VQ9A 2EDGA 5LL6X 3KF6B 2KHIA 2QKIC 3SXHA 4ZRZA 1YI2A 1F2YA 1A8VA 4K5XA 5JVH3 1H9SA 1PDQA 5DM73 1TWCH 4OGQC 3GTLH 3AFPA 2B63H 4YWLA 4XIGS 1K83H 3GTPB 2GN5A 3H3VC 4XQQA 3H3VH 2KEEA 2LSSA 2AWNA 3K7AH 4RHRA 1EEID 1HZBA 1C4QA 1B1ZA 2YTXA 1B50A 1OTCA 4ZUIA 4C2MB 1NUCA 1KRTA 1WTVA 3P75A 3S1RH 2KJXA 1IBKL 2OF1A 3I3CA 2A6EC 1GD7A 5A2QL 1E0BA 1V43A 1KDCA 1B3AA 1SYGA 2CW0C 2E75C 2F0EA 5IP7G 2HHHQ 3RLOA 2E2JB 2DN8A 3MXPA 5CYUA 3R93A 3MTSA 3NK9A 4QGUA 4P74A 1JQYD 5JJIA 4AYBE 5KEEA 3HOXG 3CCRA 5IGDA 3QOLA 5JAVA 2ID0A 1TQOA 1TS3A 4JI3L 3PIO3 2R6GA 1DXMA 1K73C 3BZDB 2AHOB 3GTOB 2NTTA 2L15A 4C2MH 1RD9D 5E4XA 2NZHA 5ELFA 1G291 3CHBD 3GV3A 1MI2A 1LTGD 2E2JH 1SYCA 2AKWB 2HIVA 4R4QA 2D0PA 1G51A 4A3KB 1SN8A 1VDZA 3M4PA 5IT9c 3F1ZA 1ET6A 3KJPA 3T51B 4X66Q 2RA4A 3C1EA 3NQIA 2R7ZG 1SLJA 2LS01 2Z1CA 2XWBB 3FPPA 2I5HA 4K8IA 4HIDA 3G71A 1NMGA 2F0UA 3OTOL 1ENFA 4KY7A 3ERSX 4IJLA 3U50C 4IPCA 4U673 1DD2A 5CR3A 2FHTA 1BKBA 4C3JB 3A55A 4NXNQ 1TXYA 2FFKB 3PMFA 5K5PA 2MNAA 4H7BA 1HHVA 1KNAA 4HIKA 1SR3A 1X3PA 4BY7G 2NBFA 4JI5Q 2EY1A 4DK6C 1HNZQ 2LXKA 1PYWD 3T53B 2KENA 4KY5A 2R7DA 4ABNA 3CC2A 2K01A 3HZXA 1QVGA 1JR0D 4WJ3M 4A3IB 4KMUC 3H0GB 3FEWX 4LWCA 1RHPA 2RDGA 2CWAA 3HFZB 3J81i 3SGIA 4AYBB 4A3JH 2E2HH 3F2UA 3CC4A 4BA2I 3HP3A 4DK0A 5T1IA 1A3UA 3HOWB 1L1OC 3PIP3 2K7VA 3HOUH 4IFDJ 2QILA 5EBDA 1PHJA 4HCSA 3GO5A 3J80E 3CCLA 4L5QA 4BBRH 1I4XA 5M3FB 5C4JB 1ILQA 2I07B 4DUYL 2SOBA 4O2DA 1QUQA 2H4OA 4A3IH 3H0GH 1KNEA 2SNMA 3L9AX 4GLAC 2PYKA 5CV8A 3MVVA 5HY6A 1T5EA 4LF5Q 4K5WA 3F8TA 4JPBW 3R8BA 4X62L 4LF7Q 5KNCA 4A3BB 3RLNA 4LUZA 2WB1G 1I4GA 1Q90A 2X6GA 1JE5A 4LNQA 1Q1BA 3VR5A 2KUMA 1D5XC 5FJ8G 5M3FH 5C4JH 2XIWA 3QOJA 2KCNA 2F0OA 5EKIA 2KCTA 1XMQQ 4O1NA 4U68A 4OWTB 4TVAB 1V1PA 4JI7L 2EOTA 1XNQL 1NAPA 1STBA 5EGTA 4A3BH 4FP5D 1BVSA 4L63B 3NTHA 4QJFA 1VQNA 5CGKA 1V9PA 4L8JA 2V1CC 4A3DG 3CCJA 4I7AA 4RHSA 4CKCA 1N32L 1VQPA 2ICIA 3O13A 2UUAQ 3S17H 2WFWA 4CDFC 1PRTF 5FO8B 5C0XJ 1N33L 2B2YA 1RF2D 2AQ2B 2OEOA 3FDTA 1STHA 3GQBA 4UP8A 2YV5A 1K8OA 3T1YL 4G4KA 4DA2A 1YHBA 1HZAA 1C9OA 3OMCA 1YZ6A 4GN4B 3OW2A 2HT1A 4FF4A 4K14A 1D5MC 3VR2A 1P8LA 4C3HB 1V8QA 1B3QA 4DU9A 4LF8L 4A76A 5I9OA 2ZM6L 4EVOA 3SE0A 1BR9A 4C1NK 3DWQA 1EZ6A 1FNUA 4NXMQ 1L0WA 1SNMA 5CORA 4OWXB 1I4PA 5G3LF 3FHWA 1VCIA 1ZYRD 1LTRD 1X3QA 1Q7YC 3SEBA 1N36Q 2E74C 1WD0A 4KHPQ 2XNAC 2BDOA 4DV3Q 4J6HA 3UE1A 1PYSB 1FGUA 4DR2Q 3NXWA 3S1MB 4H13C 4YCWA 1O7LA 5FLMH 3QJYA 2Z4HA 1OXTA 1GUOA 1F9SA 3NBIA 3ULLA 2UXBQ 4QMGA 3J81c 1CK1A 4BXXG 1WOCA 3RZOH 2MHVA 4JI1Q 2ZJRA 4X3KA 4IO9A 3V2TA 4XTCS 3T1HL 4QQBX 4LJZC 1HA5A 1MSHA 2EYMA 4FNFA 3P20A 4LUVA 3FKIH 2CHBD 4WORA 1LT6D 3I4OA 4JI2L 3OW7A 2I5LX 1YIJA 5C6AA 3Q22A 1IYJB 3HRZC 1KLGD 1EY0A 1E7ZA 3S1MH 2N55A 1SJED 2DJFC 4WJ4A 1H9SB 2B2TA 2QW7A 1B9NA 3UDFA 1OXXK 1J5EL 5J1ZA 1F2ZA 4DR4L 5L37A 5FO7B 1VQIA 3PO3H 1IBLQ 2KOLA 5E7NA 2K52A 4LFAQ 1EQTA 3BDLA 3M9BA 3CD6A 1SNQA 1VQ7A 4DAYA 2OQ0A 4OO1H 2EZVA 1AE3A 4A3KG 4K0KQ 4ODGA 4DV2L 1HQRD 3D4DA 3CQZB 1F9QA 4I7ZC 4XYQA 3CCUA 1G6ZA 1CHQD 1ZXTA 1PRTC 3HOYB 3HOVB 2FMCA 2LY7A 2A8VA 2XRQD 3I91A 5JEAH 2O4XA 1A15A 1J9OA 2NZ1D 4MHEA 1BCPD 1ZKOA 4X65Q 3K8AA 1EY4A 3IKJA 3DUZA 3DHQA 2F4VL 2BA1A 4DN4M 1EY5A 3KJOA 1HH2P 4C3JG 3S16B 1EYGA 2C5CA 1H9MA 4QUFA 1O7IA 2UUCL 1C0AA 2F52A 4DV7Q 2YTVA 1PA6A 4QB4A 4X6AH 4HN7A 3HOYH 2ZJPA 3DM1A 1VQ8A 2NN6H 4A75A 1N9WA 2RHSB 4JCVE 2DGYA 2BOSA 3J80L 5JPMC 3NUCA 4XQNA 4JBMA 1QCBD 3HGBA 4M8AA 4NDXA 1PYBA 3OYYA 4A3IG 1A6XA 3H0GG 1PH7A 4KD3A 5LMNQ 2N3SA 1YNJC 1X3EA 3BG3A 3CCMA 2QGQA 4DR3L 3FVQA 3GDEA 4AYBG 4A3FB 1JOKA 3AQQA 1STEA 4GKKL 5LMNW 4JYAL 3HOWG 3PO2H 3G48A 1R4PB 5EQ0A 2A74C 2K05A 3UDIA 1IW7C 1SMYD 3H09A 3CW2C 5M3FG 5JJLA 1RTOA 4P75A 2RDFA 1A2TA 1CUKA 3GTJB 3PIOA 3L7ZC 2F0TA 1W2BA 1BBWA 1JB3A 3DXJC 2RKSA 4A3FH 3E0EA 1LYLA 2DJGC 2IX0A 3BVZA 4A3BG 2A68C 2VQFQ 2OTLA 3J81j 4TRDA 2B8GA 1KIXA 4OHJA 2QCPX 2CWPA 4H0LC 1NBWA 3KK7A 1VS0A 3PQIA 1LM0A 1AW7A 3D31A 1L1OA 3GTJH 1I94L 1QUQB 1TT2A 2WB1E 1ESFA 3HG9A 4IUNA 1IKLA 1GVPA 3CPWA 1IHZA 3SK4A 3QWNA 1CA6A 2K04A 4B9WA 1Y69U 3CRLC 3E6ZX 3S15B 2M00A 4S3SA 1NR2A 1IXRA 5KNBA 5ELEA 1BDOA 1NJIC 3M4OB 1FR3A 4HR7B 3TS0A 1X6OA 1PH2A 1B70B 2N49A 1O80A 3MHBA 3H3VI 4QIWB 3K0XA 3BYTB 4X64L 1WJJA 3J7ZC 2A69C 1TS5A 5FLXE 4DV6L 1KRSA 3Q0AA 2AWOA 2JEBI 4C3HG 2R93B 2KVMA 4K2KA 4BWGB 3BVGA 4CJ2C 4YWKA 3CCSA 1PH3A 1HRJA 2ICEC 3S15H 1B7YB 2JXMB 4Y7NB 4B3SQ 1BXTA 1CKOA 4OIJA 4P73A 2JA8B 3T16A 2A73B 1QNKA 3GTMH 3PIPA 2N8NA 4ZAIA 4XXEA 4ZK9B 5BR8Q 1FL0A 5D65A 2VQEL 5IYCG 4DGZA 1NY4A 1VMPA 4B3TL 1EQQA 1LTTD 1QVFA 4BS9A 5IP9H 1VF7A 4A3MB 3KOJA 1GM5A 1CFMA 1ML0D 3CMAA 4L5TA 1E1OA 4DR5L 2VUMB 3M7GA 5COYA 1FGBD 2MJ8A 4RG1A 4ZKBB 1M8AA 3OPOA 4QY7A 4ME5A 3RNUA 1PXUA 2IJ0A 4OO1G 2JK8A 1D2BA 1E2WA 4B9XA 1EOVA 5A35A 3PUZA 2J7ZA 2IHFA 4CGYB 4AQYL 1PH1A 4OX9L 2K5HA 1G91A 1KQSA 2SEBD 1RL2A 1YEZA 4NW2A 1EIYB 2EYHA 3EQLC 1UE6A 4B3RQ 1ESRA 3VYRA 5M5XB 3T56B 1R4QB 5JEAG 3CCEA 2R92H 3I4NB 1F77A 1CTMA 1Y8PB 4DV5Q 4DR6Q 3I4MH 4TSSA 1A3VA 1C7YA 2EXDA 5NUCA 2VL6A 3CAMA 3TP6A 1LUZA 4DUZL 3M4YA 2RSOA 3HOYG 1BO0A 4EGVA 3MAQA 3HOVG 5KYLA 4GN5A 5M5XH 2IT1A 1H9KA 4B3MQ 4AIMA 1CZWA 3DWPA 3I4NH 1K83B 2BCOA 1TWHB 1Y8NB 2O5IC 1Z7TA 1N34Q 2K32A 3K7AB 4DAYB 4DV0L 3ND9A 3KFUA 1EOTA 1X54A 2IL8A 5H1SE 4X3UA 2K1BA 3QB3A 4O0AA 4PV1C 5K36G 5CV9A 4P71A 5ELDA 1J6QA 2A6HC 1BBUA 4GLXA 4BY1B 3VYTA 2ZT9C 2L12A 5AFWA 1D7QA 1O7YA 1V1QA 3SK5A 1SNOA 3TBIB 4IPDA 1TWHH 4B08A 4KK7A 1E24A 1DYQA 3A0JA 4DV4Q 1O7ZA 1D1KA 1XX8A 3HKSA 1JB7A 1Z6HA 4A3FG 1AN8A 4J8QA 1JWMD 3RN2A 4A3EB 1NMFA 4JV5L 4OWWB 2JQOA 4MZ9A 1YITA 4BY1H 3FRPB 1PH4A 4HJ7A 2RBMA 1UE1A 1JE4A 1CKNA 2J0TD 5C3EH 2PPBC 2OT2A 1WTRA 1G2TA 4HAEA 2BH8A 1RKNA 2DY8A 5LHY1 3EFXD 2VB3X 1CSQA 1VQCA 1IBKQ 1DGSA 1EQVA 4KI0A 4KY6A 5DEHA 1STNA 4PNYA 4A3EH 3A7LA 2DNCA 3T4AC 1QOHA 3GTGB 2IPKD 5FO9B 3BDOA 2HDMA 1XPOA 2IY5B 5E3FA 1VQEA 5C4HA 4JI3Q 3PF5A 5IODA 2ZXPA 3IAYA 1Q3LA 3S1QB 2UXCQ 2WAQE 1VQOA 2F0MA 2CW0D 4NP5A 4PZ8A 1PTOF 1S3OA 3QO2A 4KLKA 3GTGH 4ID6A 2X69A 3EIVA 5FLXL 1SXTA 1GHJA 4JBWA 5CV7A 1TR5A 4HTHA 2JA7B 4A3JB 4P2CB 4DXFA 4DAMA 3WOEA 3AMUA 4DF7A 3GTQB 2E2HB 1F2MA 3S2DB 1HR0L 2ZJQA 4A3LH 1Q82C 4JI0L 1FNWA 4RKLA 3S1QH 1L1OB 3HOUB 1LTSD 3HKZE 3OTOQ 3HOZB 3LGJA 1G2SA 1M4VA 4JI5L 1Y1VB 2MP1A 1HNZL 4GZYC 4BBRB 3KF8A 4PQXA 3G6EA 2CVRA 2R93G 3SHLA 1U0LA 4ULLA 5IOCA 1QB5D 4JI6Q 3NPPA 3C1FA 2GVBA 4JW0A 2JA7H 2JJQA 1Z9FA 3E0JA 3I2ZA 1A0IA 3MXNA 4FXKC 2JA6H 2JA8G 3GTQH 3EVQA 5BN3A 3S2DH 5J3BA 1DOMA 4YIJA 5IE8A 3HOZH 1PZKD 1EEFD 5JPNC 1Y1VH 2F3IA 1DM0B 4HEDA 1VQKA 2F0WA 2E76C 2CQAA 2EQSA 3A56A 2PQEA 1FJGQ 3S9WA 2XRSD 4A3MG 3DEPA 2Z0SA 2J4XA 1PH8A 1QVCA 1HZCA 1MKHA 5M5YH 2NUCA 3K80C 4OO1I 4F8MA 1GO3E 4IQZA 2VUMG 1PFBA 4LF5L 1I3QH 5C5LA 2WAQB 3L3OC 3URYA 2C9OA 2F3WA 1SMXA 4ZKCB 1SE4A 5FOBB 2ATWA 1UWVA 3S17B 4RCOA 1A62A 5IIFA 5IGBA 3L2PA 1RIPA 2HDLA 5ELBA 1B9MA 1XMQL 1EZ8A 4K2LA 1SROA 1BCPF 3KDFA 2QF7A 3HKZB 3ER0A 3I4NG 2NVYB 4R4OA 1KL9A 2EVBA 3EROA 3RR5A 4POFA 4R8IA 2NN6I 1PLFA 2UUAL 1PTOC 3JAME 1PTOH 5DLQE 2VS1A 2NVXH 1XNQQ 1VQGA 1KABA 4C3IH 2EYPA 4DAVA 4GOPA 2Z8LA 1PV4A 5GADC 2K03A 2XSCA 4G7OC 2E2IH 1N32Q 2F0KA 2XN9C 1QJOA 3I70A 2R7FA 2Z6BA 1U4LA 3KBGA 3RZDB 4MTNA 2B63G 2NVYH 3T1YQ 1PFNA 1NR4A 3RZOB 2KHSA 1HPCA 1XTCD 1XYIA 4OIKA 2MGSA 2YYZA 1TY0A 1VQJA 4YY3Q 1HZ9A 4XDXA 3NBHA 4DR7L 1RCVD 2OCEA 1TVXA 4NXML 1C48A 4RGOS 5F2DA 1B44D 2EYOA 3FKIB 1ENCA 4RA8A 1IBML 4NKLA 4K5VA 1JMCA 3BVMA 1KLUD 4LF8Q 4BY1G 2ZM6Q 2UXDL 2F0JA 4MIUA 4KHPL 3RZDH 1Y1WH 5IYBH 3EJIA 5CV4A 4DNIA 2YU9B 1XMOL 3K58A 1K3RA 3E9IA 2VW9A 3OMGA 4R4IA 3GTKB 4DNRB 4JI1L 2FXQA 3PO3B 1I4QA 4LFCQ 1EWCA 4A3EG 4Z9CB 1KC8C 3PUXA 2RCNA 4RKBA 1S5ED 1BUVT 4H44C 4JI4L 3K59A 4LFBQ 2Z9HA 1KTKA 3K7UC 3TZUA 5DNFA 4E6IA 4HJAA 4A3GH 4BBSB 2L1BA 2YU9H 2N88A 5M9OA 3C46A 4A3CH 1GUTA 1HUMA 3HEJA 3G4SA 3GTKH 1LLRD 3CCVA 3KLSA 1DOKA 5E1FA 1PRTB 1XPRA 2WACA 4AH6A 1IBLL 1CHPD 2EJFC 2E5LL 1X3FA 2FJ2A 1ILPA 2CCZA 4LFAL 4OELB 4MTKA 1LT4D 3ULPA 3OWEB 2BE5C 1UEBA 2SNSA 5JJKA 5M3MB 2HQEA 4JBJA 1J5EQ 1I6VC 1MJCA 3J7A5 1BCPC 1WVLA 4BBSH 4J1MA 1JJ2A 3DWAA 1U9RA 2F0IA 4LAAA 3M3YB 5CV5A 4LF6Q 4OXPA 1X65A 4K0KL 1CKNB 1EU3A 1VQLA 1ICWA 1ASYA 1JT8A 4JVZA 2WINB 3Q6SA 1I4RA 3OOCA 3P7JA 2M2LA 4PMWA 3NP8A 2NB0A 3RD4A 1IL8A 3TDQA 3PCOB 3MC0B 4FDBA 1U5KA 3G6JB 4DR1L 2KCMA 2IW3A 5CBAE 4DV2Q 4HSPA 3R2TA 4KTAA 1ENAA 3I72A 3J80i 5M3MH 1XNRQ 4ALPA 4RAUC 3DM3A 4X65L 2JA7G 2FINB 4ME3A 4A3JG 5FKAC 3M3YH 3W2DA 1UE7A 4KN7C 3PO2B 3HOUG 2SDFA 4MN3A 3S24A 5BN4A 5IY0A 5IT9E 3HOZG 4DV7L 4DV1Q 1Y1VG 1EU4A 2EY5A 2NVQH 4BBRG 2QA4A 1IL2A 4IUVA 4EQ5A 5KIXA 4WJWA 2AQ3B 2ZTDA 2UUCQ 4FF2A 1EWHA 5E4WC 2MO0A 2QDBA 5LMNL 2UUBQ 3U4VA 1PRTD 4QIWE 2JP1A 1I50H 1WTOA 2VZAA 4JI8L 2F0DA 4XYOA 1MGSA 1JORA 4HJ5A 4HSVA 1QZHA 1O78A 2VNUD 3D8GA 3VR6A 4LF9L 3CRKC 4JC0A 4KHZA 1WFQA 2PZWA 5HGQA 3OSOA 1XJVA 4DR3Q 1SRUA 5C44B 3KF8B 3KLSX 2NVTH 1E22A 4GKKQ 2QDLA 1FVIA 1VQAA 4ZUJA 1T9HA 2EYLA 2O2LD 5IWAQ 4IALA 3ERQA 1HNWL 2DUDA 3MXNB 3F2BA 2EE1A 4NB3A 1F2LA 2Y0SB 1KDBA 2XVSA 2WAQG 4YHHL 3D4WA 3I73A 1SYDA 1BNZA 3HOXB 3BS1A 1VQ4A 3BZCA 1LT3D 3H91A 2NWGA 3ITPA 5C44H 1QILA 2PI2A 2EYFA 4NPSA 3JAML 1EY9A 2KCCA 3VYUA 1L2FA 5EBCA 3SVMA 1F9RA 4RMFA 3K5LA 2N78A 1B4OA 5IP7H 2JA5B 1IW7D 4FXDA 3I8ZA 3HKZG 2UU9L 3TN2A 3HOXH 1HNXQ 3A74A 1I94Q 4Q5VA 1SYBA 1W6KA 2MUYA 3LWEA 2JYOA 3GTMB 1S5FD 1X32A 2A68D 2E8GA 1NTGA 1LO5D 2HIXA 3K5MA 1V1PB 1Z47A 1SFOH 5BN5A 1ET9A 2DNEA 2JA5H 1PZJD 3E5SA 1R9TH 1KDAA 4JK1C 3STBC 5EKLA 4YCUA 1OXUA 5FLMG 3J7YW 2L11A 1CZGA 3KDFB 3DEOA 3J80c 2ZTCA 4LF4L 4HJ9A 1AEXA 1WI5A 4CJ1B 4P72A 4EX5A 4X64Q 2R7ZH 1SEBD 1B53A 2PW5A 1TWAB 4DV6Q 5AJ3Q 3FKIG 2DY7A 1STYA 1STGA 1GUGA 1L0XB 2PCFB 4JOIA 5KGUA 3MXGA 3K57A 5I9PA 5LL6S 5BR8L 3ZYYX 3NTIA 2M9VA 4LK1C 1D1IA 4IOAA 2FMMA 3MFYA 4XT3B 5JEAJ 2Q2IA 1PFMA 2B3GA 2TMPA 1TY2A 5EPLA 4A3CG 1CSPA 3NE5B 1EIHA 4G7ZC 2K5VA 4BY7H 4HIMA 1EQRA 2KHJA 1SJHD 3W1BA 3NTKA 4KKSA 3PO3G 4IUUA 2VQEQ 2A69D 5LMUQ 2F0QA 1HCZA 1GHKA 1TWAH 1EY7A 2JA9A 5ELCA 1YNNC 2F0HA 4ILWA 2RDHA 4GOPC 2R92B 1RODA 3JC66 1WD1A 4F88A 5HGTA 1EIGA 2MFIA 1K0RA 1UAPA 1IYVA 3I4MB 4NMZA 1VQFA 2PW7A 1PH6A 4BBSG 1DOLA 2D5DA 2EJGC 1EUJA 4DR5Q 1AP0A 1II3A 1YJ9A 5D3DA 1NSNS 2X6LA 3DMUA 4C56C 2Z6KC 2RHQB 1SNCA 3J81E 3MWYW 3S2HH 5DM63 4B3RL 3LWUA 4F7XA 3H94A 4DAPA 3Q8DA 4GNXC 4AQYQ 4OX9Q 5IYDH 3FMCA 1ICFB 4IZ8A 1HTLD 3E9HA 4FF1A 3J7AF 3KLWA 1GKHA 4QUCA 1D5ZC 4QL5A 3NEMA 1JICA 5C3WA 1C8CA 3CXCA 3M4QA 4L5SA 1H95A 3B6YA 1KD1C 2D2CC 2NN6G 2WIIB 1JJCB 1S5BD 4CBVA 2EYJA 3PUWA 4GKJQ 4GN3B 1LTID 4HMJA 3T13A 5IT9L 2RVLA 5C4XB 4X3SA 3CPFA 4DUZQ 3D3RA 1ONLA 2EY6A 1Y14B 3TP5A 2R3ZA 4RGTA 3DLLA 4IFDH 3H6MA 2F1MA 4ZCKA 2EIFA 1K28A 4UHVA 1HJPA 1PH5A 3VA5A 5ISRA 1MSGA 4OONA 3CU7A 1JWUD 3PO2G 3I7FA 1K8MA 3D6WA 3QG1A 4R4TA 1W3SA 3AB9A 2Q8RE 4A3DH 5ELNA 3KUPA 2G5DA 3VR3A 5HURA 4DV0Q 2RCFA 1SYEA 1JC7A 4N8X1 5C4XH 5C3EB 2NYZD 2KQ3A 1XWEA 2TSSA 3A5UA 1PFSA 1EY6A 3K81C 4L5RC 1TKWB 1HFGA 4V0BA 1HFNA 3CMEA 1X55A 1SBBB 1VMCA 1BOSA 1RDPD 2RSNA 2HHHL 5M5WB 2JE6I 2G9HD 3A5ZB 2OXPA 3CF5A 3AU7A 5C44G 4JBKA 2PNHA 1YNXA 3D6CA 3TP7A 3S14B 4JV5Q 1B8AA 2A6HD 5TSSA 3PGZA 3IRBA 1E2VA 3ONAB 5JVG3 2HD3A 2Y0SG 4R4CA 5I2XA 5C0XH 1EYDA 4FF3A 1CQFA 1YHQA 2EJMA 5M5WH 3GTPH 2IX1A 4BXXH 1CQVA 3TREA 3OHXC 4KKTA 2AUJD 1SSOA 1CI3M 1X3GA 1OO9B 1X9NA 4BA1I 4K6LA 3S14H 2A6ED 4X66L 3CKIB 4N8FA 5GROA 2UXCL 2D9UA 5IGGA 1KAWA 4K6DA 4DK3C 2JA5G 4UY8C 3MEHA 1WTWA 1SNDA 3F2CA 3A8KE 3NENA 2ZXOA 4CKEA 1YBYA 3N6RA 4DK1A 2F0GA 5GQOA 2JA6B 2F0SA 4NXNL 1EY8A 4KKUA 4YCVA 4G57A 4WRDA 3GTOH 1LACA 3IFDA 3PSIA 2RF4A 2ZXRA 4FVMA 2NZOA 1S4ZA 5CV6A 2F03A 1WTPA 3Q24A 3ZJYC 3K6OA 4A3KH 5IP9G 1HR0Q 4JI0Q 1N8RC 5M5YB 1XXGA 4EQOA 4JI6L 4XQJA 4RGMA 2K5WA 4H02A 5KYIA 1HR0W 5IGFA 2L0CA 1I3QB 1FYCA 2CKZB 1EFWA 4RCNA 3V05A 2D0OA 1GUNA 1VQMA 1B2TA 1MIUA 2ZTEA 2L9HA 3BU2A 2BA0A 1FD7D 2A5HA 2HCCA 2K50A 1EL0A 1HA6A 5EAYA 4UAIA 1CA5A 1YVCA 1GOZA 4C3JH 1EWIA 1J8IA 1FJGL 4IN3A 1S5CD 5C3XA 4N9TA 2B2VC 1Q8KA 2H1EA 2L5TA 2IHEA 2F3VA 4LF7L 1K3BC 5D3IB 1P16A 1VF5C 4DUYQ 3A54A 3J81L 2R92G 5IGEA 1KAAA 1UEAB 1G8ZD 4PZ7A 5IYDG 3I4MG 2VB2X 1PTOB 3U9SA 2NVXB 3CCQA 2XGTA 5JJZA 1AH9A 4X62Q 3MA2B 5C5MA 3MEFA 4C3IB 2KBNA 1QWYA 4F87A 3SK8A 3HOWH 2B2WA 3KLRA 1DZ1A 2E2IB 3R2IA 1MJEA 1CM9A 1TWGB 5DAUA 4CKBA 2E2DC 3LX0A 1GJXA 2K5NA 3PF4A 4HJ8A 4KV6A 1Q8IA 4JOIC 3MFGA 5FLXc 4JI7Q 3NHHA 4IFDG 2HCIA 1OXSC 2B2UC 2CQOA 2ENBA 1BF4A 3WOFA 3BDCA 3EBEA 1KHIA 3TQYA 1ZYRC 1HXYD 4IPGA 1TWGH 3A7AB 1D6EC 1N33Q 3I4LA 1Y1WB 5C4XG 5CBEE 1U4MA 2WKCA 2O5JC 2K5DA 3GV6A 3MZ5A 4LUOA 4EQNA 2Z6KA 2PZTA 4L6TB 4YY3L 4GLVB 4WFN3 3UDXA 1WCMB 3UI2A 2K33A 1S5DD 3OWFA 4GNXA 1Y8OB 4Y52H 2K75A 3BYYB 2V4DA 3NELA 1N36L 1GUSA 2EXZA 5IGCA 3SR1A 1PH9A 4DV3L 2LKVA 1PTOD 4A3GB 4DR2L 5C3EG 1H9JA 4IOCA 4DR7Q 1M1KC 2UXBL 4TKOB 2I46A 3M7NA 1IBMQ 5EJWA 4XT1B 1Q12A 2XWJB 1A63A 3EA6A 3OIPA 2PQAA 2UXDQ 1BBXC 4LFCL 1WCMH 2B29A 2LXJA 1LABA 3EN2A 3NSWA 4CHTB 3WDNA 5I6YA 5C0XG 1QG7A 1BQQT 3FP9A 4C3HH 1CKMA 1XMOQ 1EYCA 1T5XD 3NWTA 4TQUS 4EQPA 2K4KA 2F4IA 3LNNA 1HQMC 4LFBL 2GVAA 4QF4A 1BCPB 3T1HQ 5KRUA 2EY2A 1NCVA 2ES2A 1HTPA 3D4RA 4A4IA 2A19A 4A93B 3CP0A 1K8GA 1I5FA 4JI2Q 2I0QA 3A8JE 2VXWA 4JI4Q 1TIID 1Q46A 3I56A 2OQKA 3X3NA 5IYCH 3ULJA 5EPKA 1A3TA 4DFAA 1UNSA 4POGA 1EIFA 2JEAI 1U4PA 1STAA 4DR4Q 1K9MC 3PV0A 2EPBA 4UDUC 3VA7A 4A93H 2C35B 3Q23A 4A3LG 5JOBA 4LF6L 2PZUA 2E5LQ 1YHAA 2Y0SE 1VQDA 1JOQA 1GXDC 1QNUA 4QCLA 3K5OA 3RUZA 2NVQB 2D62A 1JJGA 2AMCB 3UDGA 5GAGC 1PVOA 1S40A 3PUVA 1U4RA 5J39A 3RLFA 1WTQA 1VQ6A 2Q2UA 4M1UB 3U9OA 4DPGA 1XNRL 2ALYB 1V1OA 2CH4W 3KF6A 2Q8IB 2JA6G 1I50B 1K8AC 3S1NB 1F9PA 1FNVA 4KD4A 2WKDA 3I90A 2BE5D 2F0PA 3R3OA 4DR1Q 1X56A 2F0VA 4DV1L 4KHVA 2F4VQ 4GS3A 2K5QA 2Q8TA 1SMYC 2NVTB 4J15A 4RGNA 2QEXA 4YWMA 3CC7A 3GD7A 1HUNA 3CQZH 5I6WA 2I5MX 2UUBL 3AEVA 3V96A 3WWVA 3S1NH 3HOVH 1GUWA 5D14A 2L55A 2IWHA 4Q0FA 3K0YA 1VQ5A 3KBXA 3NWSA 3K5NA 1I6HB 3UE0A 3VYSA 4HMIA 1JOOA 4CDDC 3F2DA 1SAPA 3SDZA 3S16H 3FPUB 4JI8Q 3AYHB 4X3TA 2B39A 3RMHA 4JYAQ 5FK9C 1SE8A 3N52A 4LMQD 1CT1D 2RQXA 3C2PA 2KEDA 5K36H 1UE5A 2G9DA 5IWAL 3JAMi 4LF9Q 1SDFA 5C4ZA 3BZKA 1DCZA 5G3LD 2VQFL 1AZPA 2Q2TA 4UP7A 1LV9A 3AFQA 1YNJD 1SYFA 3C3LA 1I6HH 3P1HA 1SE3A 1KXLA 2OWOA 4ZLTF 3M85A 2L4NA 3QR8A 1QZGA 1EFID 2A1AA 1HNWQ 1VQBA 2PO4A 3W3AA 3W1GA 4C3IG 5A2QE 4CDCC 4R9WA 4YHHQ 4FYDA 4KJOA 3IL8A 3OIQA 4CDEC 1SFOB 4IFDI 2JSOA 3GP7A 1AFPA 1M90C 3TMEA 1PMRA 1R9TB 4PZ6A 2AQ1B 4APVA 1W6JA 1I4HA 1OXVA 3E3XA 2B2VA 2MPMA 1HNXL 5I2YA 3D0FA 4RH6A 2R7ZB 4MNOA 5GAEC 2R61A 1EYAA 1NE3A 2OTJA 2MO1A 2B8FA 3PUYA 2UU9Q 1H9RA 1JWSD 3VDYA 5ELOA 2PMZE 1AZQA 4OEMB 1Y1WG 5IYBG 2K28A 1UUPA 2XTIA 2Z4IA 5CC4A 1TS4A 1E1TA 1NNXA 4JG2A 1IYUA 3A8IE 2F0NA 3TRZA 4UPAA 4B3SL 4LW1A 4BY7B 2BH2A 1VQHA 4RFBA 3NQTA 1WCMG 4PMBA 1LT5D 1RJTA 5CMDA 5GAHC 1PZID 5AJ3L 3TSSA 4GOPB 2H5XA 2B2WC 2CFMA 4LF4Q 3SK6A 1MBYA 2B2UA 4A3GG 1K0SA 1YJNA 1DJRD 3QIAA 5C0XI 3M4OH 3L0OA 4K8JA 4ZYSA 2HUGA 2HQLA 1SE2A 4KJNA 4IUTA 4OL7A 4B3TQ 3NBHB 3S2HB 5LMUL 4PG3A 3STBD 4DKAC 2CH4A 3ND8A 2P5ZX 1TU2B 2R93H 4GNXB 1JCKB 1D8LA 4RWSC 2IX3A 4FO2A 3G7LA 4I65A 3TP8A 4Y7NH 2KA7A 4IUQA 1TWFB 2Q2HA 4C1NI 2JA8H 4A93G 3IFTA 5KNDA 1YJWA 2B2YC 1Q1EA 1LTBD 1AE2A 2WB1B 3W5OA 1ZEQX 4IPHA 1Q86C 3U4ZA 3JAMc 1SNPA 4R8NA 4G7HC
chains in the Genus database with same CATH topology
1IKMA 4HCEA 3X3MA 4DXGA 2F0FA 4ZQ3A 2PMZB 2QEJC 4IUPA 4N9PA 1A2UA 2BDNA 1QE6A 2NTSA 4KN4C 2WP8J 2GA4B 1YNND 2PNRC 1RTNA 4A3DB 4PMCA 2K6AA 1L0YB 4FXGC 3MXUA 1WTXA 1LTAD 3VR4A 2LFNA 2F0LA 3J7AV 1E2ZA 5EPJA 2LMCB 1DONA 5T1GA 5I4DA 5EKKA 4O42A 1TWCB 5J22A 3GTLB 2B63B 4V190 2WV6D 1TS2A 2KECA 3TZDA 4IURA 1MD2D 3HS0C 4CJ0B 4DNTB 2AUKA 2B2TC 3S1RB 2EDGA 5LL6X 2QKIC 3SXHA 4ZRZA 1F2YA 4K5XA 5JVH3 1H9SA 1PDQA 5DM73 4OGQC 4XIGS 3GTPB 3H3VC 4XQQA 2KEEA 2AWNA 4RHRA 1EEID 1C4QA 1B1ZA 1B50A 4ZUIA 4C2MB 1NUCA 1WTVA 3P75A 2KJXA 2OF1A 3I3CA 2A6EC 5A2QL 1E0BA 1V43A 1KDCA 1B3AA 1SYGA 2CW0C 2E75C 2F0EA 2E2JB 2DN8A 3MXPA 5CYUA 3R93A 3MTSA 3NK9A 1JQYD 5KEEA 5IGDA 3QOLA 5JAVA 2ID0A 1TQOA 1TS3A 3PIO3 2R6GA 1DXMA 3BZDB 3GTOB 2NTTA 1RD9D 5E4XA 5ELFA 1G291 3CHBD 3GV3A 1MI2A 1LTGD 1SYCA 4A3KB 1VDZA 1ET6A 3T51B 2RA4A 3C1EA 3NQIA 2LS01 2Z1CA 2XWBB 3FPPA 4K8IA 2F0UA 1ENFA 4KY7A 4U673 1DD2A 5CR3A 2FHTA 4C3JB 3A55A 2FFKB 5K5PA 3PMFA 4H7BA 1HHVA 1KNAA 1X3PA 2NBFA 2EY1A 1PYWD 3T53B 4KY5A 4ABNA 2K01A 3HZXA 1JR0D 4A3IB 4KMUC 3H0GB 3FEWX 1RHPA 2RDGA 4AYBB 3F2UA 4BA2I 3HP3A 4DK0A 5T1IA 1A3UA 3HOWB 3PIP3 2K7VA 4IFDJ 2QILA 5EBDA 4HCSA 3GO5A 3J80E 1I4XA 5M3FB 5C4JB 1ILQA 2I07B 2SOBA 2H4OA 1KNEA 2SNMA 3L9AX 2PYKA 5CV8A 3MVVA 1T5EA 4K5WA 3R8BA 5KNCA 4A3BB 1I4GA 1Q90A 2X6GA 1Q1BA 3VR5A 2KUMA 1D5XC 2XIWA 3QOJA 2KCNA 2F0OA 5EKIA 4O1NA 4U68A 1V1PA 2EOTA 1NAPA 1STBA 5EGTA 4FP5D 4L63B 3NTHA 5CGKA 4L8JA 4RHSA 4CKCA 2ICIA 3O13A 1PRTF 5FO8B 5C0XJ 2B2YA 1RF2D 2AQ2B 2OEOA 3FDTA 1STHA 3GQBA 1K8OA 4G4KA 4DA2A 3OMCA 4FF4A 4K14A 1D5MC 3VR2A 4C3HB 1V8QA 4DU9A 5I9OA 4EVOA 3SE0A 1BR9A 4C1NK 3DWQA 1EZ6A 1FNUA 1SNMA 5CORA 1I4PA 5G3LF 1VCIA 1ZYRD 1LTRD 1X3QA 3SEBA 2E74C 1WD0A 2XNAC 2BDOA 4J6HA 3NXWA 3S1MB 4H13C 1O7LA 3QJYA 2Z4HA 1OXTA 1GUOA 1F9SA 3NBIA 4QMGA 1CK1A 2MHVA 4X3KA 3V2TA 4XTCS 4LJZC 1HA5A 1MSHA 2EYMA 4FNFA 3P20A 2CHBD 4WORA 1LT6D 3OW7A 5C6AA 3Q22A 3HRZC 1KLGD 1EY0A 2N55A 1SJED 1H9SB 2B2TA 1B9NA 1OXXK 5J1ZA 1F2ZA 5FO7B 2KOLA 1EQTA 3BDLA 1SNQA 4DAYA 4OO1H 2EZVA 4ODGA 1HQRD 3D4DA 3CQZB 1F9QA 4I7ZC 4XYQA 1G6ZA 1CHQD 1ZXTA 1PRTC 3HOYB 3HOVB 2FMCA 2LY7A 2XRQD 3I91A 5JEAH 2O4XA 1A15A 1J9OA 2NZ1D 4MHEA 1BCPD 1ZKOA 1EY4A 3IKJA 3DUZA 3DHQA 2BA1A 4DN4M 1EY5A 4C3JG 3S16B 2C5CA 1H9MA 4QUFA 4QB4A 4HN7A 3DM1A 2NN6H 2BOSA 3J80L 5JPMC 3NUCA 4XQNA 1QCBD 3HGBA 4M8AA 4NDXA 1A6XA 4KD3A 1YNJC 3BG3A 3FVQA 4A3FB 1JOKA 1STEA 1R4PB 5EQ0A 2A74C 2K05A 1IW7C 1SMYD 3H09A 1RTOA 2RDFA 1A2TA 3GTJB 3L7ZC 2F0TA 1JB3A 3DXJC 2RKSA 2IX0A 3BVZA 2A68C 4TRDA 2B8GA 4OHJA 2QCPX 4H0LC 3KK7A 1AW7A 3D31A 1TT2A 1ESFA 3HG9A 4IUNA 1IKLA 1IHZA 3SK4A 3QWNA 1CA6A 2K04A 4B9WA 1Y69U 3CRLC 3E6ZX 3S15B 2M00A 4S3SA 1NR2A 5KNBA 5ELEA 1BDOA 3M4OB 1FR3A 4HR7B 1O80A 3MHBA 4QIWB 3BYTB 2A69C 1TS5A 5FLXE 3Q0AA 2AWOA 2JEBI 4C3HG 2R93B 2KVMA 4K2KA 4BWGB 3BVGA 4CJ2C 1HRJA 2ICEC 2JXMB 4Y7NB 1BXTA 4OIJA 2JA8B 3T16A 2A73B 1QNKA 4ZAIA 4XXEA 4ZK9B 5D65A 4DGZA 1VMPA 1LTTD 4BS9A 1VF7A 4A3MB 1CFMA 1ML0D 2VUMB 3M7GA 5COYA 1FGBD 2MJ8A 4ZKBB 1M8AA 3OPOA 4ME5A 1PXUA 2IJ0A 4OO1G 1D2BA 1E2WA 4B9XA 5A35A 3PUZA 2J7ZA 4CGYB 1G91A 2SEBD 4NW2A 2EYHA 3EQLC 1ESRA 3VYRA 5M5XB 3T56B 1R4QB 5JEAG 3I4NB 1F77A 1CTMA 1Y8PB 4TSSA 1A3VA 5NUCA 3TP6A 3M4YA 2RSOA 1BO0A 4EGVA 3MAQA 5KYLA 2IT1A 1H9KA 1CZWA 3DWPA 1K83B 2BCOA 1TWHB 1Y8NB 2O5IC 1Z7TA 2K32A 3K7AB 3ND9A 1EOTA 2IL8A 4X3UA 2K1BA 3QB3A 5K36G 4PV1C 5CV9A 5ELDA 2A6HC 4BY1B 3VYTA 2ZT9C 2L12A 5AFWA 1O7YA 3SK5A 1SNOA 3TBIB 4B08A 4KK7A 1DYQA 1O7ZA 1D1KA 1XX8A 1Z6HA 1AN8A 4J8QA 1JWMD 4A3EB 3FRPB 2RBMA 1JE4A 2J0TD 2PPBC 2OT2A 1WTRA 1G2TA 4HAEA 1RKNA 2DY8A 5LHY1 3EFXD 2VB3X 1EQVA 4KI0A 4KY6A 5DEHA 1STNA 4PNYA 3A7LA 2DNCA 3T4AC 1QOHA 3GTGB 2IPKD 5FO9B 3BDOA 2HDMA 5E3FA 5C4HA 5IODA 2ZXPA 3IAYA 1Q3LA 3S1QB 2F0MA 2CW0D 4NP5A 1PTOF 3QO2A 4ID6A 2X69A 5FLXL 1SXTA 1GHJA 4JBWA 5CV7A 1TR5A 4HTHA 2JA7B 4A3JB 4P2CB 4DXFA 3AMUA 3WOEA 2E2HB 4DF7A 3GTQB 1F2MA 3S2DB 1FNWA 4RKLA 3HOUB 1LTSD 3HOZB 1G2SA 1M4VA 1Y1VB 2MP1A 4GZYC 4BBRB 3KF8A 4PQXA 2CVRA 3SHLA 4ULLA 5IOCA 1QB5D 3NPPA 3C1FA 3E0JA 4FXKC 3MXNA 3EVQA 5BN3A 1DOMA 4YIJA 1PZKD 1EEFD 5JPNC 1DM0B 4HEDA 2F0WA 2E76C 2CQAA 3A56A 2PQEA 3S9WA 2XRSD 3DEPA 2J4XA 2NUCA 4OO1I 4F8MA 4IQZA 1PFBA 5C5LA 2WAQB 3L3OC 3URYA 2C9OA 2F3WA 4ZKCB 1SE4A 5FOBB 3S17B 4RCOA 5IIFA 5IGBA 2HDLA 5ELBA 1B9MA 1EZ8A 4K2LA 1BCPF 2QF7A 3HKZB 2NVYB 2EVBA 3EROA 4R8IA 2NN6I 1PLFA 1PTOC 3JAME 1PTOH 1KABA 2EYPA 4DAVA 2Z8LA 2K03A 2XSCA 4G7OC 2F0KA 2XN9C 1QJOA 3I70A 1U4LA 3KBGA 3RZDB 1NR4A 1PFNA 3RZOB 2KHSA 1HPCA 1XTCD 1XYIA 4OIKA 2MGSA 2YYZA 1TY0A 4XDXA 3NBHA 1RCVD 1TVXA 1C48A 4RGOS 5F2DA 1B44D 2EYOA 3FKIB 1ENCA 4RA8A 4NKLA 4K5VA 3BVMA 1KLUD 2F0JA 4MIUA 3EJIA 5CV4A 2YU9B 3K58A 3OMGA 3GTKB 4DNRB 3PO3B 1I4QA 1EWCA 4Z9CB 3PUXA 4RKBA 1S5ED 1BUVT 4H44C 3K59A 1KTKA 3TZUA 5DNFA 4E6IA 4BBSB 2L1BA 2N88A 5M9OA 3C46A 1GUTA 1HUMA 3HEJA 1LLRD 3KLSA 1DOKA 5E1FA 1PRTB 2WACA 1CHPD 2EJFC 2FJ2A 1ILPA 1LT4D 3OWEB 2BE5C 2SNSA 5M3MB 2HQEA 1I6VC 1BCPC 1WVLA 4J1MA 3DWAA 1U9RA 2F0IA 4LAAA 3M3YB 5CV5A 1EU3A 1ICWA 2WINB 3Q6SA 1I4RA 3OOCA 3P7JA 2M2LA 4PMWA 3NP8A 2NB0A 3RD4A 1IL8A 3TDQA 3MC0B 3G6JB 2IW3A 5CBAE 4HSPA 3R2TA 4KTAA 1ENAA 3I72A 4RAUC 2FINB 5FKAC 3W2DA 4KN7C 3PO2B 2SDFA 4MN3A 5BN4A 5IT9E 1EU4A 2EY5A 4IUVA 5KIXA 4WJWA 2AQ3B 4FF2A 1EWHA 5E4WC 2QDBA 1PRTD 2JP1A 1WTOA 2F0DA 4XYOA 1MGSA 1JORA 4HSVA 1O78A 2VNUD 3D8GA 3VR6A 3CRKC 4KHZA 2PZWA 3OSOA 5C44B 3KLSX 4ZUJA 2EYLA 2O2LD 4IALA 3ERQA 2EE1A 1F2LA 2Y0SB 1KDBA 2XVSA 3D4WA 3I73A 1SYDA 1BNZA 3HOXB 3BS1A 1LT3D 3H91A 2NWGA 3ITPA 1QILA 2EYFA 3JAML 1EY9A 2KCCA 3VYUA 5EBCA 3SVMA 1F9RA 3K5LA 1B4OA 2JA5B 1IW7D 4FXDA 3I8ZA 3TN2A 4Q5VA 1SYBA 1W6KA 2MUYA 3LWEA 2JYOA 3GTMB 1S5FD 1X32A 2A68D 1LO5D 3K5MA 1V1PB 1Z47A 5BN5A 1ET9A 2DNEA 1PZJD 3E5SA 1KDAA 4JK1C 5EKLA 1OXUA 3J7YW 2L11A 1CZGA 3DEOA 1AEXA 4CJ1B 1SEBD 1B53A 2PW5A 1TWAB 2DY7A 1STYA 1STGA 1GUGA 1L0XB 2PCFB 5KGUA 3K57A 3MXGA 5I9PA 5LL6S 3ZYYX 3NTIA 2M9VA 4LK1C 1D1IA 2FMMA 3MFYA 4XT3B 5JEAJ 1PFMA 2TMPA 1TY2A 5EPLA 3NE5B 1EIHA 4G7ZC 1SJHD 3NTKA 4KKSA 4IUUA 2A69D 2F0QA 1HCZA 1GHKA 1EY7A 5ELCA 1YNNC 2F0HA 4ILWA 2RDHA 2R92B 1RODA 1WD1A 4F88A 5HGTA 1EIGA 1UAPA 1IYVA 3I4MB 4NMZA 2PW7A 1DOLA 2D5DA 2EJGC 1AP0A 1II3A 5D3DA 1NSNS 2X6LA 3DMUA 4C56C 1SNCA 3J81E 3MWYW 5DM63 3LWUA 4F7XA 3H94A 4DAPA 3FMCA 4IZ8A 1HTLD 4FF1A 3J7AF 4QUCA 1D5ZC 1JICA 5C3WA 1C8CA 2D2CC 2NN6G 2WIIB 1S5BD 4CBVA 2EYJA 3PUWA 5IT9L 1LTID 4HMJA 3T13A 2RVLA 5C4XB 4X3SA 3D3RA 1ONLA 2EY6A 3TP5A 2R3ZA 4RGTA 4IFDH 3H6MA 2F1MA 3VA5A 5ISRA 1MSGA 3CU7A 1JWUD 1K8MA 3D6WA 3QG1A 3AB9A 2Q8RE 3KUPA 3VR3A 5HURA 1SYEA 1JC7A 5C3EB 2NYZD 2KQ3A 1XWEA 2TSSA 1EY6A 1TKWB 1HFGA 4V0BA 1HFNA 1SBBB 1VMCA 1BOSA 1RDPD 2RSNA 5M5WB 2JE6I 2G9HD 2OXPA 3AU7A 3D6CA 3TP7A 3S14B 2A6HD 5TSSA 1E2VA 3ONAB 5JVG3 5C0XH 5I2XA 1EYDA 4FF3A 1CQFA 2EJMA 2IX1A 1CQVA 3OHXC 4KKTA 2AUJD 1SSOA 1CI3M 1OO9B 4BA1I 4K6LA 2A6ED 3CKIB 2D9UA 5IGGA 4K6DA 3MEHA 1WTWA 1SNDA 3A8KE 2ZXOA 4CKEA 3N6RA 4DK1A 2F0GA 2JA6B 2F0SA 1EY8A 4KKUA 4G57A 4WRDA 1LACA 3IFDA 2ZXRA 4FVMA 1S4ZA 5CV6A 2F03A 1WTPA 3Q24A 3K6OA 5M5YB 1XXGA 4EQOA 4XQJA 4RGMA 2K5WA 5KYIA 5IGFA 2L0CA 1I3QB 1FYCA 4RCNA 3V05A 1GUNA 1B2TA 2L9HA 2BA0A 1FD7D 2A5HA 2HCCA 1EL0A 1HA6A 4UAIA 1CA5A 1GOZA 1J8IA 4IN3A 1S5CD 5C3XA 4N9TA 2B2VC 2H1EA 2L5TA 2F3VA 5D3IB 1VF5C 3A54A 3J81L 5IGEA 1KAAA 1UEAB 1G8ZD 2VB2X 1PTOB 3U9SA 2NVXB 5JJZA 3MA2B 5C5MA 4C3IB 1QWYA 4F87A 3SK8A 2B2WA 3KLRA 1DZ1A 2E2IB 3R2IA 1CM9A 1TWGB 5DAUA 4CKBA 2E2DC 3LX0A 1GJXA 4KV6A 1Q8IA 3MFGA 3NHHA 4IFDG 2HCIA 1OXSC 2B2UC 2ENBA 1BF4A 3WOFA 3BDCA 1ZYRC 1HXYD 3A7AB 1D6EC 3I4LA 1Y1WB 5CBEE 1U4MA 2WKCA 2O5JC 2K5DA 3GV6A 3MZ5A 4EQNA 2PZTA 4L6TB 4WFN3 1WCMB 3UI2A 2K33A 1S5DD 3OWFA 1Y8OB 3BYYB 2V4DA 1GUSA 2EXZA 5IGCA 3SR1A 2LKVA 1PTOD 4A3GB 1H9JA 4TKOB 2I46A 3M7NA 5EJWA 4XT1B 1Q12A 2XWJB 3EA6A 3OIPA 1BBXC 1LABA 3NSWA 4CHTB 3WDNA 5I6YA 5C0XG 1QG7A 1BQQT 1EYCA 1T5XD 3NWTA 4TQUS 4EQPA 2F4IA 3LNNA 1HQMC 4QF4A 1BCPB 5KRUA 2EY2A 1NCVA 1HTPA 3D4RA 4A93B 3A8JE 2VXWA 1TIID 3X3NA 5EPKA 1A3TA 4DFAA 1UNSA 2JEAI 1U4PA 1STAA 3PV0A 2EPBA 4UDUC 3VA7A 3Q23A 5JOBA 2PZUA 1JOQA 1GXDC 1QNUA 4QCLA 3K5OA 3RUZA 2NVQB 2D62A 3PUVA 1U4RA 5J39A 3RLFA 1WTQA 4M1UB 3U9OA 1V1OA 2Q8IB 1I50B 3S1NB 1F9PA 1FNVA 4KD4A 2WKDA 3I90A 2BE5D 2F0PA 3R3OA 2F0VA 4KHVA 2K5QA 2Q8TA 1SMYC 2NVTB 4RGNA 3GD7A 1HUNA 5I6WA 3V96A 1GUWA 5D14A 2L55A 2IWHA 4Q0FA 3K0YA 3KBXA 3NWSA 3K5NA 1I6HB 3VYSA 4HMIA 1JOOA 1SAPA 3SDZA 3FPUB 4X3TA 2B39A 3RMHA 5FK9C 3N52A 4LMQD 1CT1D 2RQXA 3C2PA 2KEDA 5K36H 2G9DA 1SDFA 5C4ZA 1DCZA 5G3LD 1AZPA 1LV9A 1YNJD 1SYFA 3C3LA 3P1HA 1SE3A 4ZLTF 3M85A 2L4NA 1EFID 2PO4A 3W3AA 4C3IG 5A2QE 4R9WA 4FYDA 4KJOA 3IL8A 3OIQA 1SFOB 4IFDI 2JSOA 3GP7A 1AFPA 3TMEA 1PMRA 1R9TB 2AQ1B 1W6JA 1I4HA 1OXVA 2B2VA 2MPMA 5I2YA 4RH6A 2R7ZB 2R61A 1EYAA 2B8FA 3PUYA 1H9RA 1JWSD 1AZQA 2K28A 1UUPA 2Z4IA 5CC4A 1TS4A 1IYUA 3A8IE 2F0NA 4BY7B 4RFBA 3NQTA 4PMBA 1LT5D 1RJTA 5CMDA 1PZID 3TSSA 2B2WC 3SK6A 1MBYA 2B2UA 1DJRD 3QIAA 5C0XI 4K8JA 4ZYSA 2HUGA 1SE2A 4KJNA 4IUTA 4OL7A 3S2HB 3ND8A 1TU2B 1JCKB 4RWSC 2IX3A 4FO2A 3G7LA 4I65A 3TP8A 2KA7A 4IUQA 1TWFB 4C1NI 3IFTA 5KNDA 2B2YC 1Q1EA 1LTBD 2WB1B 1ZEQX 1SNPA 4R8NA 4G7HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK9 A;  2EYJ A;  2SNM A;  4KJO A;  5KEE A;  5KRU A;  5JOB A;  4HMJ A;  3T13 A;  2PZU A;  3C1F A;  1SNO A;  2F0F A;  2PYK A;  3NHH A;  3MVV A;  3QOL A;  5CV8 A;  3SK5 A;  5IGD A;  5JAV A;  2ENB A;  2EYM A;  1JOQ A;  5F2D A;  1TQO A;  2F0G A;  3E5S A;  4K5W A;  1KDA A;  4ZQ3 A;  4WOR A;  3TME A;  3EVQ A;  2EYO A;  2F0S A;  1ENC A;  3BDC A;  1EY8 A;  2EY5 A;  4NKL A;  5EKL A;  3RUZ A;  4K5V A;  2EY6 A;  3TP5 A;  4N9P A;  4G57 A;  1A2U A;  3H6M A;  4WRD A;  4YIJ A;  5C6A A;  5KIX A;  2F0J A;  4MIU A;  1EY0 A;  1A2T A;  2RDF A;  5J39 A;  3VA5 A;  5ISR A;  1AEX A;  2F0T A;  2F0W A;  3EJI A;  5CV4 A;  2QDB A;  5CV6 A;  3U9O A;  2RKS A;  1SYC A;  2PW5 A;  3QOJ A;  1EYA A;  5J1Z A;  2PQE A;  4PMC A;  1F2Z A;  3OMG A;  4ME5 A;  2F0O A;  2RBM A;  1STY A;  1STG A;  2F0D A;  3MZ5 A;  5HUR A;  5KGU A;  4EQN A;  3S9W A;  1SYE A;  5I9P A;  5KYL A;  1JOR A;  2NUC A;  2PZT A;  4TRD A;  4DGZ A;  4EQO A;  4F8M A;  4B9X A;  4KD4 A;  1RKN A;  3D8G A;  3BDL A;  1STB A;  2KQ3 A;  2F0P A;  3R3O A;  4RKB A;  5EGT A;  3C1E A;  2PZW A;  3OWF A;  5KYI A;  1SNQ A;  2F0V A;  2F0L A;  3OSO A;  5C5L A;  1EQV A;  4KHV A;  4KY6 A;  5CGK A;  5IGF A;  5CC4 A;  5DEH A;  1EY6 A;  1STN A;  4PNY A;  2EXZ A;  4K8I A;  5IGC A;  2F3W A;  3SR1 A;  2F0N A;  2LKV A;  2F0U A;  1TT2 A;  2EYH A;  5EKK A;  4E6I A;  4ZUJ A;  4KY7 A;  4IUN A;  2F0Q A;  4ODG A;  5IIF A;  2EYL A;  5IGB A;  5M9O A;  2OEO A;  3NQT A;  1EY7 A;  1STH A;  3D4D A;  4PMB A;  4IAL A;  5CR3 A;  5E3F A;  5I6W A;  3ERQ A;  3HEJ A;  2F0H A;  5C4H A;  5J22 A;  1IHZ A;  3SK4 A;  5HGT A;  3PMF A;  5E1F A;  1KDB A;  5IOD A;  2OXP A;  3OMC A;  4H7B A;  2WAC A;  5K5P A;  5C3X A;  1EZ8 A;  4B9W A;  4N9T A;  4K2L A;  3D4W A;  4NMZ A;  1SYD A;  2PW7 A;  3SK6 A;  1A3V A;  2F3V A;  2M00 A;  3D6C A;  2O4X A;  4S3S A;  3TP7 A;  5I6Y A;  2EY1 A;  1II3 A;  5NUC A;  2F0M A;  4K14 A;  3TP6 A;  4HMI A;  4NP5 A;  3ITP A;  4K8J A;  1JOO A;  1EY4 A;  1NSN S;  1EYC A;  2SNS A;  4KY5 A;  2HQE A;  3DHQ A;  3DMU A;  4DU9 A;  2EYF A;  4EQP A;  1EY5 A;  4KJN A;  5I9O A;  3HZX A;  4QF4 A;  1KAA A;  4J1M A;  4OL7 A;  3ERO A;  1EY9 A;  5IGE A;  1U9R A;  2F0I A;  4LAA A;  2EY2 A;  1EYD A;  5CV5 A;  1F2Y A;  3MHB A;  4ID6 A;  3SXH A;  1SNC A;  4EVO A;  1EZ6 A;  4K5X A;  4F7X A;  1SNM A;  5CV7 A;  4QB4 A;  1TR5 A;  1KAB A;  4HTH A;  5C4Z A;  5C5M A;  4DF7 A;  2EYP A;  1F2M A;  4K2K A;  3NP8 A;  3SK8 A;  1A3U A;  4I65 A;  3NUC A;  4RKL A;  4IZ8 A;  4J6H A;  4ZUI A;  3TP8 A;  1SYF A;  5DAU A;  2F0K A;  4NDX A;  1NUC A;  1A3T A;  1SYB A;  3P1H A;  3NXW A;  3P75 A;  3LX0 A;  4KD3 A;  3QB3 A;  4R8N A;  3T16 A;  4DFA A;  4KTA A;  1ENA A;  5IGG A;  2OF1 A;  5CV9 A;  4K6D A;  4KV6 A;  1STA A;  4QMG A;  1KDC A;  5C3W A;  1SYG A;  2F0E A;  3MEH A;  1JOK A;  1SND A;  1SNP A;  2SOB A;  3MXP A;  3SHL A;  2KHS A;  5IOC A;  3V2T A; 
#chains in the Genus database with same CATH topology
 1IKM A;  4HCE A;  3X3M A;  4DXG A;  2PQA B;  2F0F A;  1S72 A;  4ZQ3 A;  1ASZ A;  3ICE A;  5M3M G;  4A3M H;  2PMZ B;  4DV5 L;  1WTH A;  2QEJ C;  4IUP A;  4DR6 L;  4N9P A;  1A2U A;  2BDN A;  1QE6 A;  1TWF H;  3BJU A;  3TS2 A;  2VUM H;  2NTS A;  4KN4 C;  2WP8 J;  2GA4 B;  1YNN D;  2PNR C;  3I55 A;  1RTN A;  1MHW C;  2MQH A;  4UP9 A;  4A3D B;  4PMC A;  2K6A A;  1WYD A;  3KYH C;  3RN5 A;  1L0Y B;  4FXG C;  5FJ8 H;  4GKJ L;  3MXU A;  1WTX A;  3U58 A;  4B3M L;  1LTA D;  3VR4 A;  2LFN A;  2F0L A;  1N34 L;  4R1J A;  1E2Z A;  3J7A V;  5EPJ A;  2LMC B;  1DON A;  5T1G A;  5I4D A;  5EKK A;  1LTL A;  2VY3 A;  4O42 A;  3H15 A;  1E3P A;  1XTD A;  1TWC B;  2K14 A;  5J22 A;  3GTL B;  4IJH A;  2B63 B;  2ASB A;  4V19 0;  2WV6 D;  1XPU A;  2JN4 A;  3TEH B;  1Q81 C;  2YTY A;  1TS2 A;  4HIO A;  2KEC A;  3TZD A;  4IUR A;  1MD2 D;  3HS0 C;  4CJ0 B;  4DNT B;  2PI2 E;  2AUK A;  4DV4 L;  1G6P A;  2B2T C;  1IZ6 A;  3S1R B;  1VQ9 A;  2EDG A;  5LL6 X;  3KF6 B;  2KHI A;  2QKI C;  3SXH A;  4ZRZ A;  1YI2 A;  1F2Y A;  1A8V A;  4K5X A;  5JVH 3;  1H9S A;  1PDQ A;  5DM7 3;  1TWC H;  4OGQ C;  3GTL H;  3AFP A;  2B63 H;  4YWL A;  4XIG S;  1K83 H;  3GTP B;  2GN5 A;  3H3V C;  4XQQ A;  3H3V H;  2KEE A;  2LSS A;  2AWN A;  3K7A H;  4RHR A;  1EEI D;  1HZB A;  1C4Q A;  1B1Z A;  2YTX A;  1B50 A;  1OTC A;  4ZUI A;  4C2M B;  1NUC A;  1KRT A;  1WTV A;  3P75 A;  3S1R H;  2KJX A;  1IBK L;  2OF1 A;  3I3C A;  2A6E C;  1GD7 A;  5A2Q L;  1E0B A;  1V43 A;  1KDC A;  1B3A A;  1SYG A;  2CW0 C;  2E75 C;  2F0E A;  5IP7 G;  2HHH Q;  3RLO A;  2E2J B;  2DN8 A;  3MXP A;  5CYU A;  3R93 A;  3MTS A;  3NK9 A;  4QGU A;  4P74 A;  1JQY D;  5JJI A;  4AYB E;  5KEE A;  3HOX G;  3CCR A;  5IGD A;  3QOL A;  5JAV A;  2ID0 A;  1TQO A;  1TS3 A;  4JI3 L;  3PIO 3;  2R6G A;  1DXM A;  1K73 C;  3BZD B;  2AHO B;  3GTO B;  2NTT A;  2L15 A;  4C2M H;  1RD9 D;  5E4X A;  2NZH A;  5ELF A;  1G29 1;  3CHB D;  3GV3 A;  1MI2 A;  1LTG D;  2E2J H;  1SYC A;  2AKW B;  2HIV A;  4R4Q A;  2D0P A;  1G51 A;  4A3K B;  1SN8 A;  1VDZ A;  3M4P A;  5IT9 c;  3F1Z A;  1ET6 A;  3KJP A;  3T51 B;  4X66 Q;  2RA4 A;  3C1E A;  3NQI A;  2R7Z G;  1SLJ A;  2LS0 1;  2Z1C A;  2XWB B;  3FPP A;  2I5H A;  4K8I A;  4HID A;  3G71 A;  1NMG A;  2F0U A;  3OTO L;  1ENF A;  4KY7 A;  3ERS X;  4IJL A;  3U50 C;  4IPC A;  4U67 3;  1DD2 A;  5CR3 A;  2FHT A;  1BKB A;  4C3J B;  3A55 A;  4NXN Q;  1TXY A;  2FFK B;  3PMF A;  5K5P A;  2MNA A;  4H7B A;  1HHV A;  1KNA A;  4HIK A;  1SR3 A;  1X3P A;  4BY7 G;  2NBF A;  4JI5 Q;  2EY1 A;  4DK6 C;  1HNZ Q;  2LXK A;  1PYW D;  3T53 B;  2KEN A;  4KY5 A;  2R7D A;  4ABN A;  3CC2 A;  2K01 A;  3HZX A;  1QVG A;  1JR0 D;  4WJ3 M;  4A3I B;  4KMU C;  3H0G B;  3FEW X;  4LWC A;  1RHP A;  2RDG A;  2CWA A;  3HFZ B;  3J81 i;  3SGI A;  4AYB B;  4A3J H;  2E2H H;  3F2U A;  3CC4 A;  4BA2 I;  3HP3 A;  4DK0 A;  5T1I A;  1A3U A;  3HOW B;  1L1O C;  3PIP 3;  2K7V A;  3HOU H;  4IFD J;  2QIL A;  5EBD A;  1PHJ A;  4HCS A;  3GO5 A;  3J80 E;  3CCL A;  4L5Q A;  4BBR H;  1I4X A;  5M3F B;  5C4J B;  1ILQ A;  2I07 B;  4DUY L;  2SOB A;  4O2D A;  1QUQ A;  2H4O A;  4A3I H;  3H0G H;  1KNE A;  2SNM A;  3L9A X;  4GLA C;  2PYK A;  5CV8 A;  3MVV A;  5HY6 A;  1T5E A;  4LF5 Q;  4K5W A;  3F8T A;  4JPB W;  3R8B A;  4X62 L;  4LF7 Q;  5KNC A;  4A3B B;  3RLN A;  4LUZ A;  2WB1 G;  1I4G A;  1Q90 A;  2X6G A;  1JE5 A;  4LNQ A;  1Q1B A;  3VR5 A;  2KUM A;  1D5X C;  5FJ8 G;  5M3F H;  5C4J H;  2XIW A;  3QOJ A;  2KCN A;  2F0O A;  5EKI A;  2KCT A;  1XMQ Q;  4O1N A;  4U68 A;  4OWT B;  4TVA B;  1V1P A;  4JI7 L;  2EOT A;  1XNQ L;  1NAP A;  1STB A;  5EGT A;  4A3B H;  4FP5 D;  1BVS A;  4L63 B;  3NTH A;  4QJF A;  1VQN A;  5CGK A;  1V9P A;  4L8J A;  2V1C C;  4A3D G;  3CCJ A;  4I7A A;  4RHS A;  4CKC A;  1N32 L;  1VQP A;  2ICI A;  3O13 A;  2UUA Q;  3S17 H;  2WFW A;  4CDF C;  1PRT F;  5FO8 B;  5C0X J;  1N33 L;  2B2Y A;  1RF2 D;  2AQ2 B;  2OEO A;  3FDT A;  1STH A;  3GQB A;  4UP8 A;  2YV5 A;  1K8O A;  3T1Y L;  4G4K A;  4DA2 A;  1YHB A;  1HZA A;  1C9O A;  3OMC A;  1YZ6 A;  4GN4 B;  3OW2 A;  2HT1 A;  4FF4 A;  4K14 A;  1D5M C;  3VR2 A;  1P8L A;  4C3H B;  1V8Q A;  1B3Q A;  4DU9 A;  4LF8 L;  4A76 A;  5I9O A;  2ZM6 L;  4EVO A;  3SE0 A;  1BR9 A;  4C1N K;  3DWQ A;  1EZ6 A;  1FNU A;  4NXM Q;  1L0W A;  1SNM A;  5COR A;  4OWX B;  1I4P A;  5G3L F;  3FHW A;  1VCI A;  1ZYR D;  1LTR D;  1X3Q A;  1Q7Y C;  3SEB A;  1N36 Q;  2E74 C;  1WD0 A;  4KHP Q;  2XNA C;  2BDO A;  4DV3 Q;  4J6H A;  3UE1 A;  1PYS B;  1FGU A;  4DR2 Q;  3NXW A;  3S1M B;  4H13 C;  4YCW A;  1O7L A;  5FLM H;  3QJY A;  2Z4H A;  1OXT A;  1GUO A;  1F9S A;  3NBI A;  3ULL A;  2UXB Q;  4QMG A;  3J81 c;  1CK1 A;  4BXX G;  1WOC A;  3RZO H;  2MHV A;  4JI1 Q;  2ZJR A;  4X3K A;  4IO9 A;  3V2T A;  4XTC S;  3T1H L;  4QQB X;  4LJZ C;  1HA5 A;  1MSH A;  2EYM A;  4FNF A;  3P20 A;  4LUV A;  3FKI H;  2CHB D;  4WOR A;  1LT6 D;  3I4O A;  4JI2 L;  3OW7 A;  2I5L X;  1YIJ A;  5C6A A;  3Q22 A;  1IYJ B;  3HRZ C;  1KLG D;  1EY0 A;  1E7Z A;  3S1M H;  2N55 A;  1SJE D;  2DJF C;  4WJ4 A;  1H9S B;  2B2T A;  2QW7 A;  1B9N A;  3UDF A;  1OXX K;  1J5E L;  5J1Z A;  1F2Z A;  4DR4 L;  5L37 A;  5FO7 B;  1VQI A;  3PO3 H;  1IBL Q;  2KOL A;  5E7N A;  2K52 A;  4LFA Q;  1EQT A;  3BDL A;  3M9B A;  3CD6 A;  1SNQ A;  1VQ7 A;  4DAY A;  2OQ0 A;  4OO1 H;  2EZV A;  1AE3 A;  4A3K G;  4K0K Q;  4ODG A;  4DV2 L;  1HQR D;  3D4D A;  3CQZ B;  1F9Q A;  4I7Z C;  4XYQ A;  3CCU A;  1G6Z A;  1CHQ D;  1ZXT A;  1PRT C;  3HOY B;  3HOV B;  2FMC A;  2LY7 A;  2A8V A;  2XRQ D;  3I91 A;  5JEA H;  2O4X A;  1A15 A;  1J9O A;  2NZ1 D;  4MHE A;  1BCP D;  1ZKO A;  4X65 Q;  3K8A A;  1EY4 A;  3IKJ A;  3DUZ A;  3DHQ A;  2F4V L;  2BA1 A;  4DN4 M;  1EY5 A;  3KJO A;  1HH2 P;  4C3J G;  3S16 B;  1EYG A;  2C5C A;  1H9M A;  4QUF A;  1O7I A;  2UUC L;  1C0A A;  2F52 A;  4DV7 Q;  2YTV A;  1PA6 A;  4QB4 A;  4X6A H;  4HN7 A;  3HOY H;  2ZJP A;  3DM1 A;  1VQ8 A;  2NN6 H;  4A75 A;  1N9W A;  2RHS B;  4JCV E;  2DGY A;  2BOS A;  3J80 L;  5JPM C;  3NUC A;  4XQN A;  4JBM A;  1QCB D;  3HGB A;  4M8A A;  4NDX A;  1PYB A;  3OYY A;  4A3I G;  1A6X A;  3H0G G;  1PH7 A;  4KD3 A;  5LMN Q;  2N3S A;  1YNJ C;  1X3E A;  3BG3 A;  3CCM A;  2QGQ A;  4DR3 L;  3FVQ A;  3GDE A;  4AYB G;  4A3F B;  1JOK A;  3AQQ A;  1STE A;  4GKK L;  5LMN W;  4JYA L;  3HOW G;  3PO2 H;  3G48 A;  1R4P B;  5EQ0 A;  2A74 C;  2K05 A;  3UDI A;  1IW7 C;  1SMY D;  3H09 A;  3CW2 C;  5M3F G;  5JJL A;  1RTO A;  4P75 A;  2RDF A;  1A2T A;  1CUK A;  3GTJ B;  3PIO A;  3L7Z C;  2F0T A;  1W2B A;  1BBW A;  1JB3 A;  3DXJ C;  2RKS A;  4A3F H;  3E0E A;  1LYL A;  2DJG C;  2IX0 A;  3BVZ A;  4A3B G;  2A68 C;  2VQF Q;  2OTL A;  3J81 j;  4TRD A;  2B8G A;  1KIX A;  4OHJ A;  2QCP X;  2CWP A;  4H0L C;  1NBW A;  3KK7 A;  1VS0 A;  3PQI A;  1LM0 A;  1AW7 A;  3D31 A;  1L1O A;  3GTJ H;  1I94 L;  1QUQ B;  1TT2 A;  2WB1 E;  1ESF A;  3HG9 A;  4IUN A;  1IKL A;  1GVP A;  3CPW A;  1IHZ A;  3SK4 A;  3QWN A;  1CA6 A;  2K04 A;  4B9W A;  1Y69 U;  3CRL C;  3E6Z X;  3S15 B;  2M00 A;  4S3S A;  1NR2 A;  1IXR A;  5KNB A;  5ELE A;  1BDO A;  1NJI C;  3M4O B;  1FR3 A;  4HR7 B;  3TS0 A;  1X6O A;  1PH2 A;  1B70 B;  2N49 A;  1O80 A;  3MHB A;  3H3V I;  4QIW B;  3K0X A;  3BYT B;  4X64 L;  1WJJ A;  3J7Z C;  2A69 C;  1TS5 A;  5FLX E;  4DV6 L;  1KRS A;  3Q0A A;  2AWO A;  2JEB I;  4C3H G;  2R93 B;  2KVM A;  4K2K A;  4BWG B;  3BVG A;  4CJ2 C;  4YWK A;  3CCS A;  1PH3 A;  1HRJ A;  2ICE C;  3S15 H;  1B7Y B;  2JXM B;  4Y7N B;  4B3S Q;  1BXT A;  1CKO A;  4OIJ A;  4P73 A;  2JA8 B;  3T16 A;  2A73 B;  1QNK A;  3GTM H;  3PIP A;  2N8N A;  4ZAI A;  4XXE A;  4ZK9 B;  5BR8 Q;  1FL0 A;  5D65 A;  2VQE L;  5IYC G;  4DGZ A;  1NY4 A;  1VMP A;  4B3T L;  1EQQ A;  1LTT D;  1QVF A;  4BS9 A;  5IP9 H;  1VF7 A;  4A3M B;  3KOJ A;  1GM5 A;  1CFM A;  1ML0 D;  3CMA A;  4L5T A;  1E1O A;  4DR5 L;  2VUM B;  3M7G A;  5COY A;  1FGB D;  2MJ8 A;  4RG1 A;  4ZKB B;  1M8A A;  3OPO A;  4QY7 A;  4ME5 A;  3RNU A;  1PXU A;  2IJ0 A;  4OO1 G;  2JK8 A;  1D2B A;  1E2W A;  4B9X A;  1EOV A;  5A35 A;  3PUZ A;  2J7Z A;  2IHF A;  4CGY B;  4AQY L;  1PH1 A;  4OX9 L;  2K5H A;  1G91 A;  1KQS A;  2SEB D;  1RL2 A;  1YEZ A;  4NW2 A;  1EIY B;  2EYH A;  3EQL C;  1UE6 A;  4B3R Q;  1ESR A;  3VYR A;  5M5X B;  3T56 B;  1R4Q B;  5JEA G;  3CCE A;  2R92 H;  3I4N B;  1F77 A;  1CTM A;  1Y8P B;  4DV5 Q;  4DR6 Q;  3I4M H;  4TSS A;  1A3V A;  1C7Y A;  2EXD A;  5NUC A;  2VL6 A;  3CAM A;  3TP6 A;  1LUZ A;  4DUZ L;  3M4Y A;  2RSO A;  3HOY G;  1BO0 A;  4EGV A;  3MAQ A;  3HOV G;  5KYL A;  4GN5 A;  5M5X H;  2IT1 A;  1H9K A;  4B3M Q;  4AIM A;  1CZW A;  3DWP A;  3I4N H;  1K83 B;  2BCO A;  1TWH B;  1Y8N B;  2O5I C;  1Z7T A;  1N34 Q;  2K32 A;  3K7A B;  4DAY B;  4DV0 L;  3ND9 A;  3KFU A;  1EOT A;  1X54 A;  2IL8 A;  5H1S E;  4X3U A;  2K1B A;  3QB3 A;  4O0A A;  4PV1 C;  5K36 G;  5CV9 A;  4P71 A;  5ELD A;  1J6Q A;  2A6H C;  1BBU A;  4GLX A;  4BY1 B;  3VYT A;  2ZT9 C;  2L12 A;  5AFW A;  1D7Q A;  1O7Y A;  1V1Q A;  3SK5 A;  1SNO A;  3TBI B;  4IPD A;  1TWH H;  4B08 A;  4KK7 A;  1E24 A;  1DYQ A;  3A0J A;  4DV4 Q;  1O7Z A;  1D1K A;  1XX8 A;  3HKS A;  1JB7 A;  1Z6H A;  4A3F G;  1AN8 A;  4J8Q A;  1JWM D;  3RN2 A;  4A3E B;  1NMF A;  4JV5 L;  4OWW B;  2JQO A;  4MZ9 A;  1YIT A;  4BY1 H;  3FRP B;  1PH4 A;  4HJ7 A;  2RBM A;  1UE1 A;  1JE4 A;  1CKN A;  2J0T D;  5C3E H;  2PPB C;  2OT2 A;  1WTR A;  1G2T A;  4HAE A;  2BH8 A;  1RKN A;  2DY8 A;  5LHY 1;  3EFX D;  2VB3 X;  1CSQ A;  1VQC A;  1IBK Q;  1DGS A;  1EQV A;  4KI0 A;  4KY6 A;  5DEH A;  1STN A;  4PNY A;  4A3E H;  3A7L A;  2DNC A;  3T4A C;  1QOH A;  3GTG B;  2IPK D;  5FO9 B;  3BDO A;  2HDM A;  1XPO A;  2IY5 B;  5E3F A;  1VQE A;  5C4H A;  4JI3 Q;  3PF5 A;  5IOD A;  2ZXP A;  3IAY A;  1Q3L A;  3S1Q B;  2UXC Q;  2WAQ E;  1VQO A;  2F0M A;  2CW0 D;  4NP5 A;  4PZ8 A;  1PTO F;  1S3O A;  3QO2 A;  4KLK A;  3GTG H;  4ID6 A;  2X69 A;  3EIV A;  5FLX L;  1SXT A;  1GHJ A;  4JBW A;  5CV7 A;  1TR5 A;  4HTH A;  2JA7 B;  4A3J B;  4P2C B;  4DXF A;  4DAM A;  3WOE A;  3AMU A;  4DF7 A;  3GTQ B;  2E2H B;  1F2M A;  3S2D B;  1HR0 L;  2ZJQ A;  4A3L H;  1Q82 C;  4JI0 L;  1FNW A;  4RKL A;  3S1Q H;  1L1O B;  3HOU B;  1LTS D;  3HKZ E;  3OTO Q;  3HOZ B;  3LGJ A;  1G2S A;  1M4V A;  4JI5 L;  1Y1V B;  2MP1 A;  1HNZ L;  4GZY C;  4BBR B;  3KF8 A;  4PQX A;  3G6E A;  2CVR A;  2R93 G;  3SHL A;  1U0L A;  4ULL A;  5IOC A;  1QB5 D;  4JI6 Q;  3NPP A;  3C1F A;  2GVB A;  4JW0 A;  2JA7 H;  2JJQ A;  1Z9F A;  3E0J A;  3I2Z A;  1A0I A;  3MXN A;  4FXK C;  2JA6 H;  2JA8 G;  3GTQ H;  3EVQ A;  5BN3 A;  3S2D H;  5J3B A;  1DOM A;  4YIJ A;  5IE8 A;  3HOZ H;  1PZK D;  1EEF D;  5JPN C;  1Y1V H;  2F3I A;  1DM0 B;  4HED A;  1VQK A;  2F0W A;  2E76 C;  2CQA A;  2EQS A;  3A56 A;  2PQE A;  1FJG Q;  3S9W A;  2XRS D;  4A3M G;  3DEP A;  2Z0S A;  2J4X A;  1PH8 A;  1QVC A;  1HZC A;  1MKH A;  5M5Y H;  2NUC A;  3K80 C;  4OO1 I;  4F8M A;  1GO3 E;  4IQZ A;  2VUM G;  1PFB A;  4LF5 L;  1I3Q H;  5C5L A;  2WAQ B;  3L3O C;  3URY A;  2C9O A;  2F3W A;  1SMX A;  4ZKC B;  1SE4 A;  5FOB B;  2ATW A;  1UWV A;  3S17 B;  4RCO A;  1A62 A;  5IIF A;  5IGB A;  3L2P A;  1RIP A;  2HDL A;  5ELB A;  1B9M A;  1XMQ L;  1EZ8 A;  4K2L A;  1SRO A;  1BCP F;  3KDF A;  2QF7 A;  3HKZ B;  3ER0 A;  3I4N G;  2NVY B;  4R4O A;  1KL9 A;  2EVB A;  3ERO A;  3RR5 A;  4POF A;  4R8I A;  2NN6 I;  1PLF A;  2UUA L;  1PTO C;  3JAM E;  1PTO H;  5DLQ E;  2VS1 A;  2NVX H;  1XNQ Q;  1VQG A;  1KAB A;  4C3I H;  2EYP A;  4DAV A;  4GOP A;  2Z8L A;  1PV4 A;  5GAD C;  2K03 A;  2XSC A;  4G7O C;  2E2I H;  1N32 Q;  2F0K A;  2XN9 C;  1QJO A;  3I70 A;  2R7F A;  2Z6B A;  1U4L A;  3KBG A;  3RZD B;  4MTN A;  2B63 G;  2NVY H;  3T1Y Q;  1PFN A;  1NR4 A;  3RZO B;  2KHS A;  1HPC A;  1XTC D;  1XYI A;  4OIK A;  2MGS A;  2YYZ A;  1TY0 A;  1VQJ A;  4YY3 Q;  1HZ9 A;  4XDX A;  3NBH A;  4DR7 L;  1RCV D;  2OCE A;  1TVX A;  4NXM L;  1C48 A;  4RGO S;  5F2D A;  1B44 D;  2EYO A;  3FKI B;  1ENC A;  4RA8 A;  1IBM L;  4NKL A;  4K5V A;  1JMC A;  3BVM A;  1KLU D;  4LF8 Q;  4BY1 G;  2ZM6 Q;  2UXD L;  2F0J A;  4MIU A;  4KHP L;  3RZD H;  1Y1W H;  5IYB H;  3EJI A;  5CV4 A;  4DNI A;  2YU9 B;  1XMO L;  3K58 A;  1K3R A;  3E9I A;  2VW9 A;  3OMG A;  4R4I A;  3GTK B;  4DNR B;  4JI1 L;  2FXQ A;  3PO3 B;  1I4Q A;  4LFC Q;  1EWC A;  4A3E G;  4Z9C B;  1KC8 C;  3PUX A;  2RCN A;  4RKB A;  1S5E D;  1BUV T;  4H44 C;  4JI4 L;  3K59 A;  4LFB Q;  2Z9H A;  1KTK A;  3K7U C;  3TZU A;  5DNF A;  4E6I A;  4HJA A;  4A3G H;  4BBS B;  2L1B A;  2YU9 H;  2N88 A;  5M9O A;  3C46 A;  4A3C H;  1GUT A;  1HUM A;  3HEJ A;  3G4S A;  3GTK H;  1LLR D;  3CCV A;  3KLS A;  1DOK A;  5E1F A;  1PRT B;  1XPR A;  2WAC A;  4AH6 A;  1IBL L;  1CHP D;  2EJF C;  2E5L L;  1X3F A;  2FJ2 A;  1ILP A;  2CCZ A;  4LFA L;  4OEL B;  4MTK A;  1LT4 D;  3ULP A;  3OWE B;  2BE5 C;  1UEB A;  2SNS A;  5JJK A;  5M3M B;  2HQE A;  4JBJ A;  1J5E Q;  1I6V C;  1MJC A;  3J7A 5;  1BCP C;  1WVL A;  4BBS H;  4J1M A;  1JJ2 A;  3DWA A;  1U9R A;  2F0I A;  4LAA A;  3M3Y B;  5CV5 A;  4LF6 Q;  4OXP A;  1X65 A;  4K0K L;  1CKN B;  1EU3 A;  1VQL A;  1ICW A;  1ASY A;  1JT8 A;  4JVZ A;  2WIN B;  3Q6S A;  1I4R A;  3OOC A;  3P7J A;  2M2L A;  4PMW A;  3NP8 A;  2NB0 A;  3RD4 A;  1IL8 A;  3TDQ A;  3PCO B;  3MC0 B;  4FDB A;  1U5K A;  3G6J B;  4DR1 L;  2KCM A;  2IW3 A;  5CBA E;  4DV2 Q;  4HSP A;  3R2T A;  4KTA A;  1ENA A;  3I72 A;  3J80 i;  5M3M H;  1XNR Q;  4ALP A;  4RAU C;  3DM3 A;  4X65 L;  2JA7 G;  2FIN B;  4ME3 A;  4A3J G;  5FKA C;  3M3Y H;  3W2D A;  1UE7 A;  4KN7 C;  3PO2 B;  3HOU G;  2SDF A;  4MN3 A;  3S24 A;  5BN4 A;  5IY0 A;  5IT9 E;  3HOZ G;  4DV7 L;  4DV1 Q;  1Y1V G;  1EU4 A;  2EY5 A;  2NVQ H;  4BBR G;  2QA4 A;  1IL2 A;  4IUV A;  4EQ5 A;  5KIX A;  4WJW A;  2AQ3 B;  2ZTD A;  2UUC Q;  4FF2 A;  1EWH A;  5E4W C;  2MO0 A;  2QDB A;  5LMN L;  2UUB Q;  3U4V A;  1PRT D;  4QIW E;  2JP1 A;  1I50 H;  1WTO A;  2VZA A;  4JI8 L;  2F0D A;  4XYO A;  1MGS A;  1JOR A;  4HJ5 A;  4HSV A;  1QZH A;  1O78 A;  2VNU D;  3D8G A;  3VR6 A;  4LF9 L;  3CRK C;  4JC0 A;  4KHZ A;  1WFQ A;  2PZW A;  5HGQ A;  3OSO A;  1XJV A;  4DR3 Q;  1SRU A;  5C44 B;  3KF8 B;  3KLS X;  2NVT H;  1E22 A;  4GKK Q;  2QDL A;  1FVI A;  1VQA A;  4ZUJ A;  1T9H A;  2EYL A;  2O2L D;  5IWA Q;  4IAL A;  3ERQ A;  1HNW L;  2DUD A;  3MXN B;  3F2B A;  2EE1 A;  4NB3 A;  1F2L A;  2Y0S B;  1KDB A;  2XVS A;  2WAQ G;  4YHH L;  3D4W A;  3I73 A;  1SYD A;  1BNZ A;  3HOX B;  3BS1 A;  1VQ4 A;  3BZC A;  1LT3 D;  3H91 A;  2NWG A;  3ITP A;  5C44 H;  1QIL A;  2PI2 A;  2EYF A;  4NPS A;  3JAM L;  1EY9 A;  2KCC A;  3VYU A;  1L2F A;  5EBC A;  3SVM A;  1F9R A;  4RMF A;  3K5L A;  2N78 A;  1B4O A;  5IP7 H;  2JA5 B;  1IW7 D;  4FXD A;  3I8Z A;  3HKZ G;  2UU9 L;  3TN2 A;  3HOX H;  1HNX Q;  3A74 A;  1I94 Q;  4Q5V A;  1SYB A;  1W6K A;  2MUY A;  3LWE A;  2JYO A;  3GTM B;  1S5F D;  1X32 A;  2A68 D;  2E8G A;  1NTG A;  1LO5 D;  2HIX A;  3K5M A;  1V1P B;  1Z47 A;  1SFO H;  5BN5 A;  1ET9 A;  2DNE A;  2JA5 H;  1PZJ D;  3E5S A;  1R9T H;  1KDA A;  4JK1 C;  3STB C;  5EKL A;  4YCU A;  1OXU A;  5FLM G;  3J7Y W;  2L11 A;  1CZG A;  3KDF B;  3DEO A;  3J80 c;  2ZTC A;  4LF4 L;  4HJ9 A;  1AEX A;  1WI5 A;  4CJ1 B;  4P72 A;  4EX5 A;  4X64 Q;  2R7Z H;  1SEB D;  1B53 A;  2PW5 A;  1TWA B;  4DV6 Q;  5AJ3 Q;  3FKI G;  2DY7 A;  1STY A;  1STG A;  1GUG A;  1L0X B;  2PCF B;  4JOI A;  5KGU A;  3MXG A;  3K57 A;  5I9P A;  5LL6 S;  5BR8 L;  3ZYY X;  3NTI A;  2M9V A;  4LK1 C;  1D1I A;  4IOA A;  2FMM A;  3MFY A;  4XT3 B;  5JEA J;  2Q2I A;  1PFM A;  2B3G A;  2TMP A;  1TY2 A;  5EPL A;  4A3C G;  1CSP A;  3NE5 B;  1EIH A;  4G7Z C;  2K5V A;  4BY7 H;  4HIM A;  1EQR A;  2KHJ A;  1SJH D;  3W1B A;  3NTK A;  4KKS A;  3PO3 G;  4IUU A;  2VQE Q;  2A69 D;  5LMU Q;  2F0Q A;  1HCZ A;  1GHK A;  1TWA H;  1EY7 A;  2JA9 A;  5ELC A;  1YNN C;  2F0H A;  4ILW A;  2RDH A;  4GOP C;  2R92 B;  1ROD A;  3JC6 6;  1WD1 A;  4F88 A;  5HGT A;  1EIG A;  2MFI A;  1K0R A;  1UAP A;  1IYV A;  3I4M B;  4NMZ A;  1VQF A;  2PW7 A;  1PH6 A;  4BBS G;  1DOL A;  2D5D A;  2EJG C;  1EUJ A;  4DR5 Q;  1AP0 A;  1II3 A;  1YJ9 A;  5D3D A;  1NSN S;  2X6L A;  3DMU A;  4C56 C;  2Z6K C;  2RHQ B;  1SNC A;  3J81 E;  3MWY W;  3S2H H;  5DM6 3;  4B3R L;  3LWU A;  4F7X A;  3H94 A;  4DAP A;  3Q8D A;  4GNX C;  4AQY Q;  4OX9 Q;  5IYD H;  3FMC A;  1ICF B;  4IZ8 A;  1HTL D;  3E9H A;  4FF1 A;  3J7A F;  3KLW A;  1GKH A;  4QUC A;  1D5Z C;  4QL5 A;  3NEM A;  1JIC A;  5C3W A;  1C8C A;  3CXC A;  3M4Q A;  4L5S A;  1H95 A;  3B6Y A;  1KD1 C;  2D2C C;  2NN6 G;  2WII B;  1JJC B;  1S5B D;  4CBV A;  2EYJ A;  3PUW A;  4GKJ Q;  4GN3 B;  1LTI D;  4HMJ A;  3T13 A;  5IT9 L;  2RVL A;  5C4X B;  4X3S A;  3CPF A;  4DUZ Q;  3D3R A;  1ONL A;  2EY6 A;  1Y14 B;  3TP5 A;  2R3Z A;  4RGT A;  3DLL A;  4IFD H;  3H6M A;  2F1M A;  4ZCK A;  2EIF A;  1K28 A;  4UHV A;  1HJP A;  1PH5 A;  3VA5 A;  5ISR A;  1MSG A;  4OON A;  3CU7 A;  1JWU D;  3PO2 G;  3I7F A;  1K8M A;  3D6W A;  3QG1 A;  4R4T A;  1W3S A;  3AB9 A;  2Q8R E;  4A3D H;  5ELN A;  3KUP A;  2G5D A;  3VR3 A;  5HUR A;  4DV0 Q;  2RCF A;  1SYE A;  1JC7 A;  4N8X 1;  5C4X H;  5C3E B;  2NYZ D;  2KQ3 A;  1XWE A;  2TSS A;  3A5U A;  1PFS A;  1EY6 A;  3K81 C;  4L5R C;  1TKW B;  1HFG A;  4V0B A;  1HFN A;  3CME A;  1X55 A;  1SBB B;  1VMC A;  1BOS A;  1RDP D;  2RSN A;  2HHH L;  5M5W B;  2JE6 I;  2G9H D;  3A5Z B;  2OXP A;  3CF5 A;  3AU7 A;  5C44 G;  4JBK A;  2PNH A;  1YNX A;  3D6C A;  3TP7 A;  3S14 B;  4JV5 Q;  1B8A A;  2A6H D;  5TSS A;  3PGZ A;  3IRB A;  1E2V A;  3ONA B;  5JVG 3;  2HD3 A;  2Y0S G;  4R4C A;  5I2X A;  5C0X H;  1EYD A;  4FF3 A;  1CQF A;  1YHQ A;  2EJM A;  5M5W H;  3GTP H;  2IX1 A;  4BXX H;  1CQV A;  3TRE A;  3OHX C;  4KKT A;  2AUJ D;  1SSO A;  1CI3 M;  1X3G A;  1OO9 B;  1X9N A;  4BA1 I;  4K6L A;  3S14 H;  2A6E D;  4X66 L;  3CKI B;  4N8F A;  5GRO A;  2UXC L;  2D9U A;  5IGG A;  1KAW A;  4K6D A;  4DK3 C;  2JA5 G;  4UY8 C;  3MEH A;  1WTW A;  1SND A;  3F2C A;  3A8K E;  3NEN A;  2ZXO A;  4CKE A;  1YBY A;  3N6R A;  4DK1 A;  2F0G A;  5GQO A;  2JA6 B;  2F0S A;  4NXN L;  1EY8 A;  4KKU A;  4YCV A;  4G57 A;  4WRD A;  3GTO H;  1LAC A;  3IFD A;  3PSI A;  2RF4 A;  2ZXR A;  4FVM A;  2NZO A;  1S4Z A;  5CV6 A;  2F03 A;  1WTP A;  3Q24 A;  3ZJY C;  3K6O A;  4A3K H;  5IP9 G;  1HR0 Q;  4JI0 Q;  1N8R C;  5M5Y B;  1XXG A;  4EQO A;  4JI6 L;  4XQJ A;  4RGM A;  2K5W A;  4H02 A;  5KYI A;  1HR0 W;  5IGF A;  2L0C A;  1I3Q B;  1FYC A;  2CKZ B;  1EFW A;  4RCN A;  3V05 A;  2D0O A;  1GUN A;  1VQM A;  1B2T A;  1MIU A;  2ZTE A;  2L9H A;  3BU2 A;  2BA0 A;  1FD7 D;  2A5H A;  2HCC A;  2K50 A;  1EL0 A;  1HA6 A;  5EAY A;  4UAI A;  1CA5 A;  1YVC A;  1GOZ A;  4C3J H;  1EWI A;  1J8I A;  1FJG L;  4IN3 A;  1S5C D;  5C3X A;  4N9T A;  2B2V C;  1Q8K A;  2H1E A;  2L5T A;  2IHE A;  2F3V A;  4LF7 L;  1K3B C;  5D3I B;  1P16 A;  1VF5 C;  4DUY Q;  3A54 A;  3J81 L;  2R92 G;  5IGE A;  1KAA A;  1UEA B;  1G8Z D;  4PZ7 A;  5IYD G;  3I4M G;  2VB2 X;  1PTO B;  3U9S A;  2NVX B;  3CCQ A;  2XGT A;  5JJZ A;  1AH9 A;  4X62 Q;  3MA2 B;  5C5M A;  3MEF A;  4C3I B;  2KBN A;  1QWY A;  4F87 A;  3SK8 A;  3HOW H;  2B2W A;  3KLR A;  1DZ1 A;  2E2I B;  3R2I A;  1MJE A;  1CM9 A;  1TWG B;  5DAU A;  4CKB A;  2E2D C;  3LX0 A;  1GJX A;  2K5N A;  3PF4 A;  4HJ8 A;  4KV6 A;  1Q8I A;  4JOI C;  3MFG A;  5FLX c;  4JI7 Q;  3NHH A;  4IFD G;  2HCI A;  1OXS C;  2B2U C;  2CQO A;  2ENB A;  1BF4 A;  3WOF A;  3BDC A;  3EBE A;  1KHI A;  3TQY A;  1ZYR C;  1HXY D;  4IPG A;  1TWG H;  3A7A B;  1D6E C;  1N33 Q;  3I4L A;  1Y1W B;  5C4X G;  5CBE E;  1U4M A;  2WKC A;  2O5J C;  2K5D A;  3GV6 A;  3MZ5 A;  4LUO A;  4EQN A;  2Z6K A;  2PZT A;  4L6T B;  4YY3 L;  4GLV B;  4WFN 3;  3UDX A;  1WCM B;  3UI2 A;  2K33 A;  1S5D D;  3OWF A;  4GNX A;  1Y8O B;  4Y52 H;  2K75 A;  3BYY B;  2V4D A;  3NEL A;  1N36 L;  1GUS A;  2EXZ A;  5IGC A;  3SR1 A;  1PH9 A;  4DV3 L;  2LKV A;  1PTO D;  4A3G B;  4DR2 L;  5C3E G;  1H9J A;  4IOC A;  4DR7 Q;  1M1K C;  2UXB L;  4TKO B;  2I46 A;  3M7N A;  1IBM Q;  5EJW A;  4XT1 B;  1Q12 A;  2XWJ B;  1A63 A;  3EA6 A;  3OIP A;  2PQA A;  2UXD Q;  1BBX C;  4LFC L;  1WCM H;  2B29 A;  2LXJ A;  1LAB A;  3EN2 A;  3NSW A;  4CHT B;  3WDN A;  5I6Y A;  5C0X G;  1QG7 A;  1BQQ T;  3FP9 A;  4C3H H;  1CKM A;  1XMO Q;  1EYC A;  1T5X D;  3NWT A;  4TQU S;  4EQP A;  2K4K A;  2F4I A;  3LNN A;  1HQM C;  4LFB L;  2GVA A;  4QF4 A;  1BCP B;  3T1H Q;  5KRU A;  2EY2 A;  1NCV A;  2ES2 A;  1HTP A;  3D4R A;  4A4I A;  2A19 A;  4A93 B;  3CP0 A;  1K8G A;  1I5F A;  4JI2 Q;  2I0Q A;  3A8J E;  2VXW A;  4JI4 Q;  1TII D;  1Q46 A;  3I56 A;  2OQK A;  3X3N A;  5IYC H;  3ULJ A;  5EPK A;  1A3T A;  4DFA A;  1UNS A;  4POG A;  1EIF A;  2JEA I;  1U4P A;  1STA A;  4DR4 Q;  1K9M C;  3PV0 A;  2EPB A;  4UDU C;  3VA7 A;  4A93 H;  2C35 B;  3Q23 A;  4A3L G;  5JOB A;  4LF6 L;  2PZU A;  2E5L Q;  1YHA A;  2Y0S E;  1VQD A;  1JOQ A;  1GXD C;  1QNU A;  4QCL A;  3K5O A;  3RUZ A;  2NVQ B;  2D62 A;  1JJG A;  2AMC B;  3UDG A;  5GAG C;  1PVO A;  1S40 A;  3PUV A;  1U4R A;  5J39 A;  3RLF A;  1WTQ A;  1VQ6 A;  2Q2U A;  4M1U B;  3U9O A;  4DPG A;  1XNR L;  2ALY B;  1V1O A;  2CH4 W;  3KF6 A;  2Q8I B;  2JA6 G;  1I50 B;  1K8A C;  3S1N B;  1F9P A;  1FNV A;  4KD4 A;  2WKD A;  3I90 A;  2BE5 D;  2F0P A;  3R3O A;  4DR1 Q;  1X56 A;  2F0V A;  4DV1 L;  4KHV A;  2F4V Q;  4GS3 A;  2K5Q A;  2Q8T A;  1SMY C;  2NVT B;  4J15 A;  4RGN A;  2QEX A;  4YWM A;  3CC7 A;  3GD7 A;  1HUN A;  3CQZ H;  5I6W A;  2I5M X;  2UUB L;  3AEV A;  3V96 A;  3WWV A;  3S1N H;  3HOV H;  1GUW A;  5D14 A;  2L55 A;  2IWH A;  4Q0F A;  3K0Y A;  1VQ5 A;  3KBX A;  3NWS A;  3K5N A;  1I6H B;  3UE0 A;  3VYS A;  4HMI A;  1JOO A;  4CDD C;  3F2D A;  1SAP A;  3SDZ A;  3S16 H;  3FPU B;  4JI8 Q;  3AYH B;  4X3T A;  2B39 A;  3RMH A;  4JYA Q;  5FK9 C;  1SE8 A;  3N52 A;  4LMQ D;  1CT1 D;  2RQX A;  3C2P A;  2KED A;  5K36 H;  1UE5 A;  2G9D A;  5IWA L;  3JAM i;  4LF9 Q;  1SDF A;  5C4Z A;  3BZK A;  1DCZ A;  5G3L D;  2VQF L;  1AZP A;  2Q2T A;  4UP7 A;  1LV9 A;  3AFQ A;  1YNJ D;  1SYF A;  3C3L A;  1I6H H;  3P1H A;  1SE3 A;  1KXL A;  2OWO A;  4ZLT F;  3M85 A;  2L4N A;  3QR8 A;  1QZG A;  1EFI D;  2A1A A;  1HNW Q;  1VQB A;  2PO4 A;  3W3A A;  3W1G A;  4C3I G;  5A2Q E;  4CDC C;  4R9W A;  4YHH Q;  4FYD A;  4KJO A;  3IL8 A;  3OIQ A;  4CDE C;  1SFO B;  4IFD I;  2JSO A;  3GP7 A;  1AFP A;  1M90 C;  3TME A;  1PMR A;  1R9T B;  4PZ6 A;  2AQ1 B;  4APV A;  1W6J A;  1I4H A;  1OXV A;  3E3X A;  2B2V A;  2MPM A;  1HNX L;  5I2Y A;  3D0F A;  4RH6 A;  2R7Z B;  4MNO A;  5GAE C;  2R61 A;  1EYA A;  1NE3 A;  2OTJ A;  2MO1 A;  2B8F A;  3PUY A;  2UU9 Q;  1H9R A;  1JWS D;  3VDY A;  5ELO A;  2PMZ E;  1AZQ A;  4OEM B;  1Y1W G;  5IYB G;  2K28 A;  1UUP A;  2XTI A;  2Z4I A;  5CC4 A;  1TS4 A;  1E1T A;  1NNX A;  4JG2 A;  1IYU A;  3A8I E;  2F0N A;  3TRZ A;  4UPA A;  4B3S L;  4LW1 A;  4BY7 B;  2BH2 A;  1VQH A;  4RFB A;  3NQT A;  1WCM G;  4PMB A;  1LT5 D;  1RJT A;  5CMD A;  5GAH C;  1PZI D;  5AJ3 L;  3TSS A;  4GOP B;  2H5X A;  2B2W C;  2CFM A;  4LF4 Q;  3SK6 A;  1MBY A;  2B2U A;  4A3G G;  1K0S A;  1YJN A;  1DJR D;  3QIA A;  5C0X I;  3M4O H;  3L0O A;  4K8J A;  4ZYS A;  2HUG A;  2HQL A;  1SE2 A;  4KJN A;  4IUT A;  4OL7 A;  4B3T Q;  3NBH B;  3S2H B;  5LMU L;  4PG3 A;  3STB D;  4DKA C;  2CH4 A;  3ND8 A;  2P5Z X;  1TU2 B;  2R93 H;  4GNX B;  1JCK B;  1D8L A;  4RWS C;  2IX3 A;  4FO2 A;  3G7L A;  4I65 A;  3TP8 A;  4Y7N H;  2KA7 A;  4IUQ A;  1TWF B;  2Q2H A;  4C1N I;  2JA8 H;  4A93 G;  3IFT A;  5KND A;  1YJW A;  2B2Y C;  1Q1E A;  1LTB D;  1AE2 A;  2WB1 B;  3W5O A;  1ZEQ X;  4IPH A;  1Q86 C;  3U4Z A;  3JAM c;  1SNP A;  4R8N A;  4G7H C; 
#chains in the Genus database with same CATH homology
 1IKM A;  4HCE A;  3X3M A;  4DXG A;  2F0F A;  4ZQ3 A;  2PMZ B;  2QEJ C;  4IUP A;  4N9P A;  1A2U A;  2BDN A;  1QE6 A;  2NTS A;  4KN4 C;  2WP8 J;  2GA4 B;  1YNN D;  2PNR C;  1RTN A;  4A3D B;  4PMC A;  2K6A A;  1L0Y B;  4FXG C;  3MXU A;  1WTX A;  1LTA D;  3VR4 A;  2LFN A;  2F0L A;  3J7A V;  1E2Z A;  5EPJ A;  2LMC B;  1DON A;  5T1G A;  5I4D A;  5EKK A;  4O42 A;  1TWC B;  5J22 A;  3GTL B;  2B63 B;  4V19 0;  2WV6 D;  1TS2 A;  2KEC A;  3TZD A;  4IUR A;  1MD2 D;  3HS0 C;  4CJ0 B;  4DNT B;  2AUK A;  2B2T C;  3S1R B;  2EDG A;  5LL6 X;  2QKI C;  3SXH A;  4ZRZ A;  1F2Y A;  4K5X A;  5JVH 3;  1H9S A;  1PDQ A;  5DM7 3;  4OGQ C;  4XIG S;  3GTP B;  3H3V C;  4XQQ A;  2KEE A;  2AWN A;  4RHR A;  1EEI D;  1C4Q A;  1B1Z A;  1B50 A;  4ZUI A;  4C2M B;  1NUC A;  1WTV A;  3P75 A;  2KJX A;  2OF1 A;  3I3C A;  2A6E C;  5A2Q L;  1E0B A;  1V43 A;  1KDC A;  1B3A A;  1SYG A;  2CW0 C;  2E75 C;  2F0E A;  2E2J B;  2DN8 A;  3MXP A;  5CYU A;  3R93 A;  3MTS A;  3NK9 A;  1JQY D;  5KEE A;  5IGD A;  3QOL A;  5JAV A;  2ID0 A;  1TQO A;  1TS3 A;  3PIO 3;  2R6G A;  1DXM A;  3BZD B;  3GTO B;  2NTT A;  1RD9 D;  5E4X A;  5ELF A;  1G29 1;  3CHB D;  3GV3 A;  1MI2 A;  1LTG D;  1SYC A;  4A3K B;  1VDZ A;  1ET6 A;  3T51 B;  2RA4 A;  3C1E A;  3NQI A;  2LS0 1;  2Z1C A;  2XWB B;  3FPP A;  4K8I A;  2F0U A;  1ENF A;  4KY7 A;  4U67 3;  1DD2 A;  5CR3 A;  2FHT A;  4C3J B;  3A55 A;  2FFK B;  5K5P A;  3PMF A;  4H7B A;  1HHV A;  1KNA A;  1X3P A;  2NBF A;  2EY1 A;  1PYW D;  3T53 B;  4KY5 A;  4ABN A;  2K01 A;  3HZX A;  1JR0 D;  4A3I B;  4KMU C;  3H0G B;  3FEW X;  1RHP A;  2RDG A;  4AYB B;  3F2U A;  4BA2 I;  3HP3 A;  4DK0 A;  5T1I A;  1A3U A;  3HOW B;  3PIP 3;  2K7V A;  4IFD J;  2QIL A;  5EBD A;  4HCS A;  3GO5 A;  3J80 E;  1I4X A;  5M3F B;  5C4J B;  1ILQ A;  2I07 B;  2SOB A;  2H4O A;  1KNE A;  2SNM A;  3L9A X;  2PYK A;  5CV8 A;  3MVV A;  1T5E A;  4K5W A;  3R8B A;  5KNC A;  4A3B B;  1I4G A;  1Q90 A;  2X6G A;  1Q1B A;  3VR5 A;  2KUM A;  1D5X C;  2XIW A;  3QOJ A;  2KCN A;  2F0O A;  5EKI A;  4O1N A;  4U68 A;  1V1P A;  2EOT A;  1NAP A;  1STB A;  5EGT A;  4FP5 D;  4L63 B;  3NTH A;  5CGK A;  4L8J A;  4RHS A;  4CKC A;  2ICI A;  3O13 A;  1PRT F;  5FO8 B;  5C0X J;  2B2Y A;  1RF2 D;  2AQ2 B;  2OEO A;  3FDT A;  1STH A;  3GQB A;  1K8O A;  4G4K A;  4DA2 A;  3OMC A;  4FF4 A;  4K14 A;  1D5M C;  3VR2 A;  4C3H B;  1V8Q A;  4DU9 A;  5I9O A;  4EVO A;  3SE0 A;  1BR9 A;  4C1N K;  3DWQ A;  1EZ6 A;  1FNU A;  1SNM A;  5COR A;  1I4P A;  5G3L F;  1VCI A;  1ZYR D;  1LTR D;  1X3Q A;  3SEB A;  2E74 C;  1WD0 A;  2XNA C;  2BDO A;  4J6H A;  3NXW A;  3S1M B;  4H13 C;  1O7L A;  3QJY A;  2Z4H A;  1OXT A;  1GUO A;  1F9S A;  3NBI A;  4QMG A;  1CK1 A;  2MHV A;  4X3K A;  3V2T A;  4XTC S;  4LJZ C;  1HA5 A;  1MSH A;  2EYM A;  4FNF A;  3P20 A;  2CHB D;  4WOR A;  1LT6 D;  3OW7 A;  5C6A A;  3Q22 A;  3HRZ C;  1KLG D;  1EY0 A;  2N55 A;  1SJE D;  1H9S B;  2B2T A;  1B9N A;  1OXX K;  5J1Z A;  1F2Z A;  5FO7 B;  2KOL A;  1EQT A;  3BDL A;  1SNQ A;  4DAY A;  4OO1 H;  2EZV A;  4ODG A;  1HQR D;  3D4D A;  3CQZ B;  1F9Q A;  4I7Z C;  4XYQ A;  1G6Z A;  1CHQ D;  1ZXT A;  1PRT C;  3HOY B;  3HOV B;  2FMC A;  2LY7 A;  2XRQ D;  3I91 A;  5JEA H;  2O4X A;  1A15 A;  1J9O A;  2NZ1 D;  4MHE A;  1BCP D;  1ZKO A;  1EY4 A;  3IKJ A;  3DUZ A;  3DHQ A;  2BA1 A;  4DN4 M;  1EY5 A;  4C3J G;  3S16 B;  2C5C A;  1H9M A;  4QUF A;  4QB4 A;  4HN7 A;  3DM1 A;  2NN6 H;  2BOS A;  3J80 L;  5JPM C;  3NUC A;  4XQN A;  1QCB D;  3HGB A;  4M8A A;  4NDX A;  1A6X A;  4KD3 A;  1YNJ C;  3BG3 A;  3FVQ A;  4A3F B;  1JOK A;  1STE A;  1R4P B;  5EQ0 A;  2A74 C;  2K05 A;  1IW7 C;  1SMY D;  3H09 A;  1RTO A;  2RDF A;  1A2T A;  3GTJ B;  3L7Z C;  2F0T A;  1JB3 A;  3DXJ C;  2RKS A;  2IX0 A;  3BVZ A;  2A68 C;  4TRD A;  2B8G A;  4OHJ A;  2QCP X;  4H0L C;  3KK7 A;  1AW7 A;  3D31 A;  1TT2 A;  1ESF A;  3HG9 A;  4IUN A;  1IKL A;  1IHZ A;  3SK4 A;  3QWN A;  1CA6 A;  2K04 A;  4B9W A;  1Y69 U;  3CRL C;  3E6Z X;  3S15 B;  2M00 A;  4S3S A;  1NR2 A;  5KNB A;  5ELE A;  1BDO A;  3M4O B;  1FR3 A;  4HR7 B;  1O80 A;  3MHB A;  4QIW B;  3BYT B;  2A69 C;  1TS5 A;  5FLX E;  3Q0A A;  2AWO A;  2JEB I;  4C3H G;  2R93 B;  2KVM A;  4K2K A;  4BWG B;  3BVG A;  4CJ2 C;  1HRJ A;  2ICE C;  2JXM B;  4Y7N B;  1BXT A;  4OIJ A;  2JA8 B;  3T16 A;  2A73 B;  1QNK A;  4ZAI A;  4XXE A;  4ZK9 B;  5D65 A;  4DGZ A;  1VMP A;  1LTT D;  4BS9 A;  1VF7 A;  4A3M B;  1CFM A;  1ML0 D;  2VUM B;  3M7G A;  5COY A;  1FGB D;  2MJ8 A;  4ZKB B;  1M8A A;  3OPO A;  4ME5 A;  1PXU A;  2IJ0 A;  4OO1 G;  1D2B A;  1E2W A;  4B9X A;  5A35 A;  3PUZ A;  2J7Z A;  4CGY B;  1G91 A;  2SEB D;  4NW2 A;  2EYH A;  3EQL C;  1ESR A;  3VYR A;  5M5X B;  3T56 B;  1R4Q B;  5JEA G;  3I4N B;  1F77 A;  1CTM A;  1Y8P B;  4TSS A;  1A3V A;  5NUC A;  3TP6 A;  3M4Y A;  2RSO A;  1BO0 A;  4EGV A;  3MAQ A;  5KYL A;  2IT1 A;  1H9K A;  1CZW A;  3DWP A;  1K83 B;  2BCO A;  1TWH B;  1Y8N B;  2O5I C;  1Z7T A;  2K32 A;  3K7A B;  3ND9 A;  1EOT A;  2IL8 A;  4X3U A;  2K1B A;  3QB3 A;  5K36 G;  4PV1 C;  5CV9 A;  5ELD A;  2A6H C;  4BY1 B;  3VYT A;  2ZT9 C;  2L12 A;  5AFW A;  1O7Y A;  3SK5 A;  1SNO A;  3TBI B;  4B08 A;  4KK7 A;  1DYQ A;  1O7Z A;  1D1K A;  1XX8 A;  1Z6H A;  1AN8 A;  4J8Q A;  1JWM D;  4A3E B;  3FRP B;  2RBM A;  1JE4 A;  2J0T D;  2PPB C;  2OT2 A;  1WTR A;  1G2T A;  4HAE A;  1RKN A;  2DY8 A;  5LHY 1;  3EFX D;  2VB3 X;  1EQV A;  4KI0 A;  4KY6 A;  5DEH A;  1STN A;  4PNY A;  3A7L A;  2DNC A;  3T4A C;  1QOH A;  3GTG B;  2IPK D;  5FO9 B;  3BDO A;  2HDM A;  5E3F A;  5C4H A;  5IOD A;  2ZXP A;  3IAY A;  1Q3L A;  3S1Q B;  2F0M A;  2CW0 D;  4NP5 A;  1PTO F;  3QO2 A;  4ID6 A;  2X69 A;  5FLX L;  1SXT A;  1GHJ A;  4JBW A;  5CV7 A;  1TR5 A;  4HTH A;  2JA7 B;  4A3J B;  4P2C B;  4DXF A;  3AMU A;  3WOE A;  2E2H B;  4DF7 A;  3GTQ B;  1F2M A;  3S2D B;  1FNW A;  4RKL A;  3HOU B;  1LTS D;  3HOZ B;  1G2S A;  1M4V A;  1Y1V B;  2MP1 A;  4GZY C;  4BBR B;  3KF8 A;  4PQX A;  2CVR A;  3SHL A;  4ULL A;  5IOC A;  1QB5 D;  3NPP A;  3C1F A;  3E0J A;  4FXK C;  3MXN A;  3EVQ A;  5BN3 A;  1DOM A;  4YIJ A;  1PZK D;  1EEF D;  5JPN C;  1DM0 B;  4HED A;  2F0W A;  2E76 C;  2CQA A;  3A56 A;  2PQE A;  3S9W A;  2XRS D;  3DEP A;  2J4X A;  2NUC A;  4OO1 I;  4F8M A;  4IQZ A;  1PFB A;  5C5L A;  2WAQ B;  3L3O C;  3URY A;  2C9O A;  2F3W A;  4ZKC B;  1SE4 A;  5FOB B;  3S17 B;  4RCO A;  5IIF A;  5IGB A;  2HDL A;  5ELB A;  1B9M A;  1EZ8 A;  4K2L A;  1BCP F;  2QF7 A;  3HKZ B;  2NVY B;  2EVB A;  3ERO A;  4R8I A;  2NN6 I;  1PLF A;  1PTO C;  3JAM E;  1PTO H;  1KAB A;  2EYP A;  4DAV A;  2Z8L A;  2K03 A;  2XSC A;  4G7O C;  2F0K A;  2XN9 C;  1QJO A;  3I70 A;  1U4L A;  3KBG A;  3RZD B;  1NR4 A;  1PFN A;  3RZO B;  2KHS A;  1HPC A;  1XTC D;  1XYI A;  4OIK A;  2MGS A;  2YYZ A;  1TY0 A;  4XDX A;  3NBH A;  1RCV D;  1TVX A;  1C48 A;  4RGO S;  5F2D A;  1B44 D;  2EYO A;  3FKI B;  1ENC A;  4RA8 A;  4NKL A;  4K5V A;  3BVM A;  1KLU D;  2F0J A;  4MIU A;  3EJI A;  5CV4 A;  2YU9 B;  3K58 A;  3OMG A;  3GTK B;  4DNR B;  3PO3 B;  1I4Q A;  1EWC A;  4Z9C B;  3PUX A;  4RKB A;  1S5E D;  1BUV T;  4H44 C;  3K59 A;  1KTK A;  3TZU A;  5DNF A;  4E6I A;  4BBS B;  2L1B A;  2N88 A;  5M9O A;  3C46 A;  1GUT A;  1HUM A;  3HEJ A;  1LLR D;  3KLS A;  1DOK A;  5E1F A;  1PRT B;  2WAC A;  1CHP D;  2EJF C;  2FJ2 A;  1ILP A;  1LT4 D;  3OWE B;  2BE5 C;  2SNS A;  5M3M B;  2HQE A;  1I6V C;  1BCP C;  1WVL A;  4J1M A;  3DWA A;  1U9R A;  2F0I A;  4LAA A;  3M3Y B;  5CV5 A;  1EU3 A;  1ICW A;  2WIN B;  3Q6S A;  1I4R A;  3OOC A;  3P7J A;  2M2L A;  4PMW A;  3NP8 A;  2NB0 A;  3RD4 A;  1IL8 A;  3TDQ A;  3MC0 B;  3G6J B;  2IW3 A;  5CBA E;  4HSP A;  3R2T A;  4KTA A;  1ENA A;  3I72 A;  4RAU C;  2FIN B;  5FKA C;  3W2D A;  4KN7 C;  3PO2 B;  2SDF A;  4MN3 A;  5BN4 A;  5IT9 E;  1EU4 A;  2EY5 A;  4IUV A;  5KIX A;  4WJW A;  2AQ3 B;  4FF2 A;  1EWH A;  5E4W C;  2QDB A;  1PRT D;  2JP1 A;  1WTO A;  2F0D A;  4XYO A;  1MGS A;  1JOR A;  4HSV A;  1O78 A;  2VNU D;  3D8G A;  3VR6 A;  3CRK C;  4KHZ A;  2PZW A;  3OSO A;  5C44 B;  3KLS X;  4ZUJ A;  2EYL A;  2O2L D;  4IAL A;  3ERQ A;  2EE1 A;  1F2L A;  2Y0S B;  1KDB A;  2XVS A;  3D4W A;  3I73 A;  1SYD A;  1BNZ A;  3HOX B;  3BS1 A;  1LT3 D;  3H91 A;  2NWG A;  3ITP A;  1QIL A;  2EYF A;  3JAM L;  1EY9 A;  2KCC A;  3VYU A;  5EBC A;  3SVM A;  1F9R A;  3K5L A;  1B4O A;  2JA5 B;  1IW7 D;  4FXD A;  3I8Z A;  3TN2 A;  4Q5V A;  1SYB A;  1W6K A;  2MUY A;  3LWE A;  2JYO A;  3GTM B;  1S5F D;  1X32 A;  2A68 D;  1LO5 D;  3K5M A;  1V1P B;  1Z47 A;  5BN5 A;  1ET9 A;  2DNE A;  1PZJ D;  3E5S A;  1KDA A;  4JK1 C;  5EKL A;  1OXU A;  3J7Y W;  2L11 A;  1CZG A;  3DEO A;  1AEX A;  4CJ1 B;  1SEB D;  1B53 A;  2PW5 A;  1TWA B;  2DY7 A;  1STY A;  1STG A;  1GUG A;  1L0X B;  2PCF B;  5KGU A;  3K57 A;  3MXG A;  5I9P A;  5LL6 S;  3ZYY X;  3NTI A;  2M9V A;  4LK1 C;  1D1I A;  2FMM A;  3MFY A;  4XT3 B;  5JEA J;  1PFM A;  2TMP A;  1TY2 A;  5EPL A;  3NE5 B;  1EIH A;  4G7Z C;  1SJH D;  3NTK A;  4KKS A;  4IUU A;  2A69 D;  2F0Q A;  1HCZ A;  1GHK A;  1EY7 A;  5ELC A;  1YNN C;  2F0H A;  4ILW A;  2RDH A;  2R92 B;  1ROD A;  1WD1 A;  4F88 A;  5HGT A;  1EIG A;  1UAP A;  1IYV A;  3I4M B;  4NMZ A;  2PW7 A;  1DOL A;  2D5D A;  2EJG C;  1AP0 A;  1II3 A;  5D3D A;  1NSN S;  2X6L A;  3DMU A;  4C56 C;  1SNC A;  3J81 E;  3MWY W;  5DM6 3;  3LWU A;  4F7X A;  3H94 A;  4DAP A;  3FMC A;  4IZ8 A;  1HTL D;  4FF1 A;  3J7A F;  4QUC A;  1D5Z C;  1JIC A;  5C3W A;  1C8C A;  2D2C C;  2NN6 G;  2WII B;  1S5B D;  4CBV A;  2EYJ A;  3PUW A;  5IT9 L;  1LTI D;  4HMJ A;  3T13 A;  2RVL A;  5C4X B;  4X3S A;  3D3R A;  1ONL A;  2EY6 A;  3TP5 A;  2R3Z A;  4RGT A;  4IFD H;  3H6M A;  2F1M A;  3VA5 A;  5ISR A;  1MSG A;  3CU7 A;  1JWU D;  1K8M A;  3D6W A;  3QG1 A;  3AB9 A;  2Q8R E;  3KUP A;  3VR3 A;  5HUR A;  1SYE A;  1JC7 A;  5C3E B;  2NYZ D;  2KQ3 A;  1XWE A;  2TSS A;  1EY6 A;  1TKW B;  1HFG A;  4V0B A;  1HFN A;  1SBB B;  1VMC A;  1BOS A;  1RDP D;  2RSN A;  5M5W B;  2JE6 I;  2G9H D;  2OXP A;  3AU7 A;  3D6C A;  3TP7 A;  3S14 B;  2A6H D;  5TSS A;  1E2V A;  3ONA B;  5JVG 3;  5C0X H;  5I2X A;  1EYD A;  4FF3 A;  1CQF A;  2EJM A;  2IX1 A;  1CQV A;  3OHX C;  4KKT A;  2AUJ D;  1SSO A;  1CI3 M;  1OO9 B;  4BA1 I;  4K6L A;  2A6E D;  3CKI B;  2D9U A;  5IGG A;  4K6D A;  3MEH A;  1WTW A;  1SND A;  3A8K E;  2ZXO A;  4CKE A;  3N6R A;  4DK1 A;  2F0G A;  2JA6 B;  2F0S A;  1EY8 A;  4KKU A;  4G57 A;  4WRD A;  1LAC A;  3IFD A;  2ZXR A;  4FVM A;  1S4Z A;  5CV6 A;  2F03 A;  1WTP A;  3Q24 A;  3K6O A;  5M5Y B;  1XXG A;  4EQO A;  4XQJ A;  4RGM A;  2K5W A;  5KYI A;  5IGF A;  2L0C A;  1I3Q B;  1FYC A;  4RCN A;  3V05 A;  1GUN A;  1B2T A;  2L9H A;  2BA0 A;  1FD7 D;  2A5H A;  2HCC A;  1EL0 A;  1HA6 A;  4UAI A;  1CA5 A;  1GOZ A;  1J8I A;  4IN3 A;  1S5C D;  5C3X A;  4N9T A;  2B2V C;  2H1E A;  2L5T A;  2F3V A;  5D3I B;  1VF5 C;  3A54 A;  3J81 L;  5IGE A;  1KAA A;  1UEA B;  1G8Z D;  2VB2 X;  1PTO B;  3U9S A;  2NVX B;  5JJZ A;  3MA2 B;  5C5M A;  4C3I B;  1QWY A;  4F87 A;  3SK8 A;  2B2W A;  3KLR A;  1DZ1 A;  2E2I B;  3R2I A;  1CM9 A;  1TWG B;  5DAU A;  4CKB A;  2E2D C;  3LX0 A;  1GJX A;  4KV6 A;  1Q8I A;  3MFG A;  3NHH A;  4IFD G;  2HCI A;  1OXS C;  2B2U C;  2ENB A;  1BF4 A;  3WOF A;  3BDC A;  1ZYR C;  1HXY D;  3A7A B;  1D6E C;  3I4L A;  1Y1W B;  5CBE E;  1U4M A;  2WKC A;  2O5J C;  2K5D A;  3GV6 A;  3MZ5 A;  4EQN A;  2PZT A;  4L6T B;  4WFN 3;  1WCM B;  3UI2 A;  2K33 A;  1S5D D;  3OWF A;  1Y8O B;  3BYY B;  2V4D A;  1GUS A;  2EXZ A;  5IGC A;  3SR1 A;  2LKV A;  1PTO D;  4A3G B;  1H9J A;  4TKO B;  2I46 A;  3M7N A;  5EJW A;  4XT1 B;  1Q12 A;  2XWJ B;  3EA6 A;  3OIP A;  1BBX C;  1LAB A;  3NSW A;  4CHT B;  3WDN A;  5I6Y A;  5C0X G;  1QG7 A;  1BQQ T;  1EYC A;  1T5X D;  3NWT A;  4TQU S;  4EQP A;  2F4I A;  3LNN A;  1HQM C;  4QF4 A;  1BCP B;  5KRU A;  2EY2 A;  1NCV A;  1HTP A;  3D4R A;  4A93 B;  3A8J E;  2VXW A;  1TII D;  3X3N A;  5EPK A;  1A3T A;  4DFA A;  1UNS A;  2JEA I;  1U4P A;  1STA A;  3PV0 A;  2EPB A;  4UDU C;  3VA7 A;  3Q23 A;  5JOB A;  2PZU A;  1JOQ A;  1GXD C;  1QNU A;  4QCL A;  3K5O A;  3RUZ A;  2NVQ B;  2D62 A;  3PUV A;  1U4R A;  5J39 A;  3RLF A;  1WTQ A;  4M1U B;  3U9O A;  1V1O A;  2Q8I B;  1I50 B;  3S1N B;  1F9P A;  1FNV A;  4KD4 A;  2WKD A;  3I90 A;  2BE5 D;  2F0P A;  3R3O A;  2F0V A;  4KHV A;  2K5Q A;  2Q8T A;  1SMY C;  2NVT B;  4RGN A;  3GD7 A;  1HUN A;  5I6W A;  3V96 A;  1GUW A;  5D14 A;  2L55 A;  2IWH A;  4Q0F A;  3K0Y A;  3KBX A;  3NWS A;  3K5N A;  1I6H B;  3VYS A;  4HMI A;  1JOO A;  1SAP A;  3SDZ A;  3FPU B;  4X3T A;  2B39 A;  3RMH A;  5FK9 C;  3N52 A;  4LMQ D;  1CT1 D;  2RQX A;  3C2P A;  2KED A;  5K36 H;  2G9D A;  1SDF A;  5C4Z A;  1DCZ A;  5G3L D;  1AZP A;  1LV9 A;  1YNJ D;  1SYF A;  3C3L A;  3P1H A;  1SE3 A;  4ZLT F;  3M85 A;  2L4N A;  1EFI D;  2PO4 A;  3W3A A;  4C3I G;  5A2Q E;  4R9W A;  4FYD A;  4KJO A;  3IL8 A;  3OIQ A;  1SFO B;  4IFD I;  2JSO A;  3GP7 A;  1AFP A;  3TME A;  1PMR A;  1R9T B;  2AQ1 B;  1W6J A;  1I4H A;  1OXV A;  2B2V A;  2MPM A;  5I2Y A;  4RH6 A;  2R7Z B;  2R61 A;  1EYA A;  2B8F A;  3PUY A;  1H9R A;  1JWS D;  1AZQ A;  2K28 A;  1UUP A;  2Z4I A;  5CC4 A;  1TS4 A;  1IYU A;  3A8I E;  2F0N A;  4BY7 B;  4RFB A;  3NQT A;  4PMB A;  1LT5 D;  1RJT A;  5CMD A;  1PZI D;  3TSS A;  2B2W C;  3SK6 A;  1MBY A;  2B2U A;  1DJR D;  3QIA A;  5C0X I;  4K8J A;  4ZYS A;  2HUG A;  1SE2 A;  4KJN A;  4IUT A;  4OL7 A;  3S2H B;  3ND8 A;  1TU2 B;  1JCK B;  4RWS C;  2IX3 A;  4FO2 A;  3G7L A;  4I65 A;  3TP8 A;  2KA7 A;  4IUQ A;  1TWF B;  4C1N I;  3IFT A;  5KND A;  2B2Y C;  1Q1E A;  1LTB D;  2WB1 B;  1ZEQ X;  1SNP A;  4R8N A;  4G7H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...