3EJIA

Crystal structure of staphylococcal nuclease variant delta+phs l36k at cryogenic temperature
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRKLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Consequences of the Ionization of Lysines at 25 Internal Positions in a Protein
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 39
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ejiA00
1A2UA 4S3SA 1STBA 5K5PA 1F2MA 1STHA 3OMGA 3SK8A 3ERQA 3OWFA 2RDFA 4ZUIA 4E6IA 2F3WA 1STNA 2SOBA 4K5WA 4OL7A 4QB4A 3SR1A 1KDBA 3H6MA 4DFAA 4ME5A 2F0JA 2F0MA 5IOCA 1EY7A 1F2YA 3NXWA 3V2TA 2F0OA 4K8IA 4KJOA 3S9WA 4EQNA 1ENCA 4NDXA 5JAVA 1KDAA 1SYDA 4KY7A 1A2TA 1STYA 3NHHA 2F0UA 3TP7A 5HGTA 5KYIA 4K2LA 1KABA 2EY6A 3MEHA 3P75A 4YIJA 1EZ6A 2F0HA 1A3UA 3C1EA 2F0PA 3NUCA 2F0FA 3QB3A 5DEHA 3DHQA 2KQ3A 3TP8A 4DU9A 1NSNS 5EKKA 2PZTA 5IIFA 3QOJA 2SNSA 4ZQ3A 5EGTA 1EYAA 5IGFA 2F0NA 1EY8A 2NUCA 4G57A 3EJIA 3NQTA 2EYMA 4J6HA 5IODA 5CR3A 1EZ8A 3BDLA 2F0DA 2F0SA 1II3A 5C3XA 4PMCA 4NMZA 3T16A 2F0QA 3MHBA 1EY5A 1SNDA 2HQEA 4H7BA 2EY5A 2F3VA 3MXPA 5I6YA 2PZWA 4QF4A 1JOQA 5KGUA 3MZ5A 2EY2A 5CC4A 5EKLA 4KHVA 2F0VA 5C6AA 4MIUA 4WRDA 5J39A 3NP8A 5I9PA 3C1FA 2M00A 1EY6A 3NK9A 2PW7A 1EYDA 4IZ8A 3PMFA 5CV9A 3OMCA 4QMGA 1RKNA 2EYHA 2PZUA 3E5SA 4DF7A 4B9WA 4RKLA 4K5XA 2WACA 3DMUA 5F2DA 2EXZA 1SNCA 5J1ZA 1JORA 1EY9A 2PYKA 5IGEA 4R8NA 2F0EA 4DGZA 5CV8A 4ZUJA 4N9TA 2EYFA 3RUZA 5JOBA 5CV6A 5CV7A 5IGCA 4EQOA 4N9PA 5J22A 2QDBA 2F0LA 5I9OA 1KDCA 3SK5A 3QOLA 1EY4A 3D6CA 4K6DA 4ID6A 4NP5A 1SNQA 3ITPA 1JOOA 2OF1A 1STGA 3D4DA 3P1HA 5DAUA 5E3FA 1SYCA 4EVOA 3HEJA 4K8JA 5ISRA 3SXHA 4EQPA 4HMIA 4RKBA 4KTAA 3EROA 4NKLA 1U9RA 3SHLA 4K5VA 4HTHA 4B9XA 1EQVA 4F7XA 4PNYA 2SNMA 4ODGA 1EYCA 1TT2A 3R3OA 5HURA 5KIXA 2PQEA 5KRUA 3BDCA 1STAA 1IHZA 3D8GA 5NUCA 5IGDA 1ENAA 1F2ZA 5I6WA 1JOKA 1KAAA 5KEEA 2EYJA 1TQOA 4LAAA 1TR5A 5E1FA 4F8MA 1A3TA 2RBMA 3VA5A 3OSOA 4I65A 4K14A 2OXPA 1SYBA 3HZXA 5IGBA 3T13A 3TP6A 2EYOA 2RKSA 4IALA 4KY5A 4KD3A 4IUNA 4J1MA 2OEOA 4KV6A 3SK6A 5CGKA 5M9OA 2KHSA 5IGGA 2F0WA 1SYGA 2ENBA 2PW5A 2F0GA 3LX0A 1A3VA 1EY0A 1SNPA 3D4WA 1AEXA 4KJNA 2F0KA 2EYLA 4KY6A 4PMBA 1SYEA 2O4XA 5C3WA 2EYPA 4K2KA 3U9OA 4TRDA 5KYLA 1SNOA 4KD4A 3TMEA 1NUCA 3MVVA 4HMJA 2F0IA 5CV4A 5C4HA 2LKVA 1SYFA 2F0TA 1SNMA 5C4ZA 4WORA 5CV5A 3SK4A 3EVQA 2EY1A 5C5LA 5C5MA 3TP5A
chains in the Genus database with same CATH superfamily
4DV0L 1A62A 2E74C 1ICWA 2JA5H 4ZUIA 3VYTA 4ZLTF 3JAMc 2ZTDA 1EY7A 4DR4Q 4EQNA 3CXCA 3ULJA 3EQLC 4V190 2UXCQ 1PFBA 1QVFA 4GNXC 4JI3L 2UXDL 1STYA 3TQYA 4DV2L 1I50B 4K2LA 2B63B 2KA7A 2L11A 3S1NH 2LFNA 1E22A 3EIVA 1N34L 4FF3A 3URYA 2K28A 1KC8C 4X3UA 2DNEA 1MIUA 3T56B 2QEXA 2N49A 4OONA 4NMZA 2RCNA 1K8AC 2A73B 3QO2A 2VW9A 1Y1VG 2IPKD 1ZEQX 4J8QA 1ZYRC 2K4KA 3HOYB 1U0LA 3G71A 3CD6A 4OGQC 4HIDA 1H9MA 4YWMA 2ZJQA 5FJ8G 2JEBI 3DEPA 4Y7NH 4L5RC 1KDCA 2C35B 2BH8A 1CT1D 1Q46A 2K33A 4CKEA 5C0XJ 3C46A 3FPUB 4HR7B 1RJTA 5EPJA 3N52A 1C0AA 4XTCS 4C56C 3K5LA 2B2VA 1BDOA 1ASZA 3J81L 3L0OA 4HTHA 3U4VA 4PNYA 5HY6A 4XYQA 1EYCA 1TT2A 5IYCG 4IOAA 3G6EA 1IKMA 1J5EL 3A56A 3S1MH 1H9KA 1SE4A 1PZKD 1NMGA 5EBDA 3M9BA 2K03A 1MKHA 1T5XD 1N33Q 1NBWA 5I4DA 3NPPA 3K5MA 4IJHA 1E7ZA 1KTKA 2RHSB 1ICFB 2VXWA 1VQCA 1PH5A 4YCVA 3GTOH 4BBSG 1VQNA 1GD7A 3G7LA 5IY0A 1WD0A 2Z4IA 4TRDA 4KD4A 3TMEA 2GA4B 5CV4A 1CSQA 2F4VQ 3GTGH 2Q2TA 3FP9A 3M85A 4HJ8A 3G6JB 1Q1EA 5K5PA 3GDEA 4C3IB 3HKZB 1STBA 3BG3A 1EWHA 1D5ZC 4DPGA 3SK8A 1Q3LA 4IN3A 1HZCA 3DUZA 2XN9C 1K8OA 3DWQA 2SOBA 1EFID 4OL7A 5LL6X 2WKDA 4FF2A 3FVQA 4R9WA 3N6RA 3KLSX 4RG1A 2D0OA 5KNCA 5C44B 3PUZA 1XNRL 4DV4Q 5HGTA 5KYIA 2NTTA 4BY1G 4A3KB 1PTOB 2ZXOA 2D2CC 1I3QH 1J6QA 1NSNS 1IBMQ 2I5HA 2PPBC 2LY7A 3U9SA 4CKCA 2NUCA 2ZM6Q 4DR5L 4JC0A 4A3MB 2F0SA 2VUMH 3T16A 4O2DA 5A2QE 2O5IC 3A8IE 3S2DH 3CF5A 2O2LD 2B2UC 5JJLA 2BDOA 2KCTA 4KKUA 3W1GA 2R7ZH 1EY6A 2PI2A 3C2PA 4JI1Q 4RCNA 1B53A 1TS5A 2IWHA 1OTCA 3S17B 4RKLA 4XQNA 3CCVA 1TVXA 1HHVA 1N9WA 2BCOA 2RDGA 3K5NA 4DGZA 4OHJA 4LK1C 2F0LA 1VQGA 3PUXA 2F1MA 3A5ZB 4IUPA 1HNXL 1K0SA 1O7LA 2KENA 4M8AA 3NTHA 4A93B 1QUQA 3H91A 1SYCA 2N88A 2CQOA 5EAYA 3FKIG 4B9XA 1EQVA 5FLXc 1XWEA 1D5XC 1H9SB 3UI2A 1G2SA 3VR2A 3BVZA 4LAAA 1E1OA 1EU3A 3MXUA 2SDFA 4A76A 4A3EH 2ZM6L 3M4QA 4PG3A 4A75A 4IUNA 5LHY1 2QKIC 1XNQQ 3CCEA 1FL0A 3LWEA 1I4RA 4X62L 1FNUA 3RZOB 3M7NA 1UE1A 2KHJA 3S2DB 1JWUD 4DR1Q 1JICA 3OWEB 3PCOB 1SE2A 2OTLA 1G91A 1SNMA 3DM3A 5CV5A 1MHWC 3HOZH 5IYBH 4JBWA 1F2MA 1PZJD 1STHA 1DJRD 1UE7A 2F0JA 3NXWA 1TY0A 3I56A 2A68D 1HR0Q 4A93H 2XSCA 5E4WC 1KABA 3JAME 1C9OA 4A3DH 2H5XA 2EJGC 2PZTA 5EKKA 5IIFA 2J7ZA 2MJ8A 4GN4B 1UE6A 4DR6Q 3M4OB 4JI5Q 1F9RA 4ME3A 2PCFB 1HFNA 5I6YA 5M5XH 1IBKL 4DV0Q 4GNXA 3M3YH 2LS01 4MTNA 1BBXC 3F2UA 3OHXC 3PO2B 3NP8A 3BZCA 3NK9A 1L1OB 4FF1A 2PZUA 1PMRA 3IFTA 4UP7A 1TWAH 1I6VC 3NELA 4FO2A 3L3OC 4DA2A 2VQFQ 2E2HB 4A3IH 1NMFA 2J4XA 3I4MH 4QIWB 1S72A 2MP1A 2B2TC 1BCPD 2CW0C 1QG7A 2K5VA 3BVGA 1RF2D 2D5DA 1K83H 4PMWA 3R8BA 3PF4A 1QOHA 4B3RL 3S1RB 1E1TA 1SSOA 3Q23A 2UUAQ 2DUDA 2GVBA 3KK7A 3D4DA 3NEMA 3C3LA 1AP0A 4K8JA 4EQPA 2EIFA 2OT2A 3GTKB 1UE5A 1HZ9A 4U673 1KAWA 2L9HA 4NPSA 1STAA 2G9DA 1B1ZA 3AYHB 1R4PB 3KF6A 1VQHA 1WCMG 3NBHA 2MNAA 1TKWB 5L37A 2E5LL 1D7QA 1YJ9A 1TIID 1HNXQ 3AQQA 1LM0A 1PYWD 4AIMA 1SJED 1D5MC 2AKWB 3D4WA 3GTMH 4CGYB 2MUYA 1PH9A 3L2PA 3I4NB 4PZ7A 4X62Q 1EOVA 1L2FA 1C7YA 4Y7NB 3GQBA 5JEAJ 1UAPA 2HT1A 4ILWA 1TWFH 3HS0C 3OW2A 5BN3A 4R4TA 2L55A 2HCCA 2XWBB 1NY4A 2JA6H 4RAUC 4APVA 1JWMD 1YEZA 2NVXB 1C48A 4ZKCB 1Z6HA 1ZKOA 2X6GA 2F0UA 4CDCC 2PNRC 5JEAH 3P7JA 3NQIA 3AFPA 4O1NA 1GOZA 4BXXG 2WB1E 2MO0A 2PI2E 5IP9H 4LWCA 3PIP3 4A3CG 1EZ8A 1N32Q 4BY7B 3HOXG 4UAIA 4ZK9B 4IO9A 2L12A 1GUWA 4ZAIA 2R92H 1PH2A 5KGUA 3S2HH 1Q1BA 1RDPD 5K36G 3K57A 1RKNA 3E5SA 5HGQA 1S40A 3GTMB 5F2DA 2EXZA 1PYSB 4OO1G 1WYDA 1XNRQ 1E24A 3T1YL 1CKOA 2L5TA 1GVPA 4QQBX 2SEBD 4N9PA 4HJ5A 4RHSA 4HCSA 4L8JA 4YWKA 1EUJA 1LABA 2HCIA 4IJLA 2JEAI 4K6LA 1PTOH 1V1QA 1TWHH 4QUCA 2QW7A 4FDBA 3OYYA 4RCOA 1PTOF 4ODGA 4DXGA 2Q2IA 1CM9A 3CQZH 4GKJQ 1Y14B 1K3RA 4A3LH 2VUMB 1SMXA 4OO1I 3I2ZA 1GUTA 2PMZE 3TP6A 4R4IA 1IYVA 2UU9Q 3KF6B 5M9OA 1JJCB 4BY7H 2E75C 1PTOC 3E9HA 4XYOA 1JQYD 1VMCA 3E9IA 1LTAD 2K5NA 3E3XA 4HEDA 3L9AX 2HDMA 3SK5A 2F4IA 2FMCA 2CW0D 3HOVH 4OIKA 5DM73 5IOCA 1X9NA 3BDOA 1CK1A 1H9RA 5C4XH 2JK8A 1X6OA 2EOTA 1DOLA 5FLXL 1AE2A 4DUZQ 1PHJA 4A3BG 3NUCA 5EGTA 3PO3H 3TDQA 1EY8A 2AQ3B 4B3ML 3ZJYC 3GTJH 2CKZB 3KLWA 4DNRB 2ZT9C 4DR7Q 1LT6D 1B8AA 4MIUA 2Y0SB 2JA5B 3C1FA 2PW7A 5ELCA 5CV9A 3HOZB 3H0GB 1LTTD 4X64Q 4ZRZA 3K59A 4JV5L 1VQLA 1OXVA 4DV2Q 4UY8C 1AH9A 2QDBA 4CDFC 3DWPA 5I9OA 1PRTB 5FKAC 3QOLA 4DK6C 3Q6SA 5ELOA 3GV6A 4L5QA 3B6YA 5LMNL 4HMIA 1AZQA 3EROA 4LFBQ 1A0IA 4YY3L 1EQRA 4ULLA 4FXDA 1JT8A 4K0KL 2PQEA 1CA5A 3OOCA 3UDXA 3D8GA 4A3JH 2VB3X 3M4OH 1NR2A 3BZKA 1IZ6A 1NJIC 4P75A 2B63G 1EL0A 3PIO3 4KV6A 5C4JH 3U50C 1TWAB 1Y1WH 4KY6A 2NWGA 3I4LA 4B3RQ 2JA8H 4LF5Q 1IBML 5IE8A 3M4PA 3I4MB 2DGYA 2ZTEA 4OX9Q 3UE0A 1HA5A 1RODA 1K83B 3RNUA 2EY1A 2R6GA 2WAQE 2RDFA 4GZYC 3PUWA 4JI4Q 3RD4A 4JI1L 2L0CA 1EEID 3GTKH 4YCUA 1CHPD 1EQQA 3J7ZC 1VQOA 1SYDA 3HG9A 4KY7A 4DV6Q 3M7GA 4XXEA 1KNEA 2EY6A 1DONA 4KKTA 1VQDA 1BCPF 1X3EA 4LF4Q 5A35A 1GUNA 1X56A 4XT1B 4OELB 4JCVE 1EWIA 3K7AB 2EXDA 2VB2X 2F0DA 3LGJA 1YNJC 5IP7H 4WJ3M 3SDZA 4P73A 1IBLL 5GAGC 1JOQA 4O0AA 4OXPA 3I4NH 5I9PA 4KKSA 1ZXTA 2R93G 2PO4A 1EYDA 1BCPC 3DLLA 4LF8L 3OMCA 4LF5L 5FO7B 3CCRA 3S14H 4AYBE 2R7ZG 4X65L 2WACA 1AW7A 1CHQD 1DCZA 1I4HA 1TWFB 1WOCA 3MA2B 1SRUA 2JA6B 5J22A 4X3TA 1Y8PB 1EY4A 2Q2HA 3U58A 2UUBQ 1LTID 4ID6A 5M5WH 4KHPQ 2OQKA 3ITPA 3CKIB 1BKBA 2LXKA 4A3MH 3PGZA 1A63A 4C3IG 4RKBA 2BE5D 3HKZG 2ICIA 1WTVA 3CU7A 1ESRA 4UP9A 4TSSA 5JVH3 4DAMA 5NUCA 1F2ZA 3KFUA 1OXXK 5DNFA 1B50A 4F8MA 3Q8DA 4C3JG 3KBGA 3HZXA 3CMEA 4A3KG 3T1YQ 2WAQB 2N3SA 3K7AH 1SBBB 4HJ7A 1B9MA 4WFN3 1HTLD 1YI2A 4IPDA 4BBRH 3U9OA 4O42A 3HOWH 4UP8A 5D65A 3MFGA 2K50A 4DUYQ 2LKVA 2B2TA 4DV7Q 2JYOA 2UUCL 4IUUA 1WFQA 1VQBA 1YITA 2QA4A 4RWSC 2ALYB 5BN4A 1STNA 5IYBG 1XMQL 1MBYA 1TWHB 1KDBA 4DAVA 3CPWA 1MI2A 2RQXA 4CDDC 4DNTB 2KEDA 2OWOA 2FINB 3J80c 4MZ9A 3GP7A 3MC0B 4JBMA 1JB3A 4GNXB 4JK1C 4A93G 3P75A 3D4RA 2IHEA 5JPNC 2A5HA 4YHHQ 3IKJA 4HSPA 1HXYD 4AYBB 4ZQ3A 1IXRA 3FKIB 4OWXB 3W2DA 4G7ZC 1II3A 4U68A 2A6ED 2F0QA 4J15A 1I6HH 2K5QA 1DOMA 4QF4A 2EY2A 4GOPC 2K1BA 3TRZA 4KHVA 4R4QA 1RTNA 1E0BA 4AQYQ 1QNKA 4QMGA 2R7DA 2C5CA 4LFCQ 4B9WA 2RA4A 3NENA 4LF7L 2K6AA 4Q0FA 1B4OA 2CWPA 2JXMB 4A3IG 2R61A 3FEWX 4N8X1 4A3DB 4JG2A 4KN4C 3OPOA 4ZCKA 3P1HA 5CBAE 1WTHA 4QY7A 3U4ZA 5ISRA 5IT9L 1RIPA 4C3HH 1IBLQ 3CC7A 2MPMA 4JI5L 3ZYYX 2OTJA 5M5XB 1N36L 1M1KC 5T1GA 1SMYC 2QF7A 4A4IA 4CHTB 2ASBA 3GTJB 1F9QA 3K80C 3P20A 4BWGB 2TMPA 3OIQA 5EQ0A 1UUPA 1XTDA 3CC2A 1N8RC 1GUGA 4X66Q 3J7AF 1I4XA 1WCMH 1W2BA 1BBWA 3H0GH 3RLFA 1SEBD 2EYLA 2UXBQ 4QUFA 3Q24A 2KEEA 2UUAL 2A6HD 5KYLA 4HMJA 3J80L 1WTXA 3RZDH 4YY3Q 3PO2G 1W6KA 3E0JA 4JBJA 1YNXA 1H95A 1HA6A 1EQTA 2AMCB 4K5WA 3I91A 5COYA 5EPLA 1KLGD 1X3FA 3QJYA 1A6XA 1DYQA 2F0OA 1EYGA 2HDLA 3FPPA 1O7YA 4CBVA 1B3QA 5IWAQ 2B2UA 1I94L 1CZWA 4A3FH 3W5OA 5BN5A 1A3UA 4K0KQ 1CKNA 1VMPA 3A8JE 2JA7B 3S1QB 2E2JB 1HUNA 1HPCA 4MHEA 4PMCA 2ES2A 1HH2P 3EA6A 3PSIA 3T1HL 1Y1WB 3A54A 3HOXH 1PDQA 1U4RA 2R92G 1KRSA 2OQ0A 1Y1VH 4RFBA 2UXBL 3BYTB 2G5DA 3RLNA 4K5XA 2NZHA 4LFAQ 1YIJA 5J1ZA 1LYLA 5IGEA 1GXDC 2I5LX 3CHBD 5FLMG 1NE3A 1YBYA 5FJ8H 2KJXA 4JOIC 1PH3A 5E3FA 1QJOA 3CCQA 1R9TH 2ZXPA 3HEJA 5IT9c 2NB0A 4DR2Q 3SXHA 1G51A 2AUKA 1PFMA 4CJ2C 1BXTA 5FOBB 3S2HB 3E0EA 2D9UA 1IYUA 1JOKA 4JI6L 2CCZA 1TQOA 5DM63 1HJPA 1SE3A 1QNUA 1Y8OB 5IYDH 1Z7TA 3SVMA 3FMCA 3J81E 3IL8A 1X3PA 1YHQA 1IBKQ 2JA7H 4KD3A 3SK6A 2AWNA 2J0TD 4IOCA 2F4VL 2JA9A 3OTOL 5D3IB 3V2TA 3UDIA 1AEXA 2YV5A 3CCUA 4BY7G 3I90A 2Z6KC 3GO5A 1P8LA 2K04A 2Q8IB 2DY8A 3HOXB 2IX1A 1WJJA 3ULPA 3MVVA 2KUMA 2LSSA 3STBD 2N78A 2E2IH 4L5SA 1SYFA 3UE1A 1JE4A 1VQ8A 5J3BA 2CFMA 3TSSA 4DV5Q 1GJXA 1JC7A 5EBCA 1PA6A 4S3SA 4IUQA 1G2TA 1L1OC 3CQZB 3OWFA 2WB1B 4KLKA 2F3WA 4QB4A 1Z47A 5G3LD 1ET9A 4FVMA 4DR3L 1NNXA 4JPBW 4X66L 1HCZA 3NE5B 1KDAA 5C4XG 4ABNA 1C4QA 1P16A 5GAEC 3MEHA 5IT9E 1T5EA 3QB3A 1EIHA 2NBFA 1UEAB 3HP3A 3GTOB 1EYAA 3J81i 3PIOA 1J9OA 1F77A 2E76C 3PV0A 1PLFA 3NQTA 4J6HA 2M2LA 1KXLA 3BDLA 3PO3G 3GTGB 5GQOA 1CQFA 2KBNA 5DLQE 4HSVA 2VUMG 1X3QA 1A8VA 1JCKB 4DKAC 1XJVA 3HOVB 1B7YB 5J39A 4GS3A 2M00A 1PH4A 5A2QL 5JJKA 5M3MG 1EFWA 3TN2A 2ID0A 1KLUD 3ER0A 1SNCA 4I7ZC 4PZ6A 4DNIA 3Q0AA 5C44H 5CV7A 1HZBA 3NWSA 1SN8A 3O13A 2XRSD 4H44C 2A6EC 4B3TL 2HQLA 3S15H 4NXNQ 3D6CA 4NP5A 3HKZE 4LF9Q 4DR3Q 1VDZA 4F7XA 2UUBL 3HOUG 1YJWA 4A3GH 2ICEC 1ONLA 2I07B 5I6WA 5M5YH 2EYJA 4YHHL 5M3FG 1IW7C 1A3TA 5C0XH 3S17H 4X3KA 2Y0SE 5AJ3Q 4KN7C 1Q7YC 1E2ZA 2B63H 1LTBD 3BJUA 3GD7A 1SYGA 2ENBA 2PW5A 5I2XA 3IFDA 1SNPA 2IL8A 4LF4L 1F2LA 4GKKQ 1VF5C 1FYCA 3K0XA 1BCPB 3CCJA 3TZDA 4UDUC 2FXQA 1SR3A 1WTQA 1NUCA 2JE6I 2JA8G 3HFZB 1D8LA 5LMNQ 2EQSA 3I72A 2F0TA 4TQUS 2Z8LA 4MTKA 2JA5G 3WDNA 2B29A 1S5FD 1TS4A 2IHFA 2X6LA 4R8IA 1RTOA 3OMGA 4A3JB 3HOZG 2D62A 2RDHA 2UUCQ 3ERSX 1GO3E 4V0BA 4A3EB 3PUVA 4HIOA 2K5WA 3S15B 4JYAL 5JAVA 2QCPX 4OIJA 3BYYB 4NB3A 1N36Q 2OCEA 2B8FA 2NZOA 2HUGA 3RZOH 1FVIA 2ZTCA 4DR4L 5JJZA 4GN5A 1QE6A 1EU4A 1VQ5A 4G7OC 2QGQA 5CR3A 3KLRA 2G9HD 1HFGA 4DAYB 4OX9L 1DXMA 3BU2A 3K81C 4PQXA 2NVTH 1ZYRD 5IP7G 4XT3B 2Z9HA 3S1MB 3H09A 4IZ8A 4L63B 1S5BD 2UXCL 1B3AA 2R93H 1SAPA 3QR8A 1GUSA 4FP5D 2K01A 2PNHA 1HUMA 2F0EA 2E2DC 3MEFA 2JJQA 1N34Q 5FO8B 4POFA 1LT4D 1PZID 3I4MG 1QVCA 1M8AA 1SMYD 1D2BA 1S5ED 1XX8A 1STGA 4LF7Q 1YJNA 2K7VA 4ZYSA 5BR8L 5IYCH 4B3TQ 2YTXA 4XDXA 1Y8NB 4C3IH 5KRUA 3ICEA 3J7AV 1KAAA 2JP1A 2XVSA 4DK3C 2AQ2B 3VA5A 1VQKA 4I65A 5C3EG 4HIKA 1LT3D 4DR5Q 1GHKA 4H13C 5GROA 2VQEQ 1YNND 4IQZA 4DV1Q 4C3JH 3J81c 4WJ4A 2Q8RE 3F1ZA 1XPUA 4CJ0B 1SLJA 4NXML 1I3QB 2F0GA 2KECA 4EX5A 1EY0A 2I5MX 5E7NA 4LF9L 1Q86C 3PUYA 3V96A 5CBEE 1PFNA 3ONAB 4IFDG 1SXTA 5M5WB 4QJFA 5GAHC 5CMDA 1XMOQ 2A69D 3I55A 5C4ZA 1MD2D 1V8QA 3EVQA 5C5MA 4KHZA 2R93B 4RA8A 4L5TA 4LUVA 3OIPA 1V1PB 2K5DA 5TSSA 1R9TB 4C1NI 2R7ZB 1LTLA 1PRTF 3SR1A 1Q82C 3ULLA 4ME5A 3RMHA 1YVCA 1AN8A 4GOPB 3NBIA 1N33L 1O7IA 2JA6G 1ILPA 4IPHA 2XNAC 2A69C 1N32L 1KRTA 3D6WA 5H1SE 1V1PA 4YIJA 4H0LC 3AEVA 3VYSA 1WI5A 4BBRB 1TWCH 5JEAG 4G57A 4TVAB 3NTKA 3EJIA 1YHAA 3HOWB 1PXUA 1Z9FA 1TS3A 2ZJPA 3RR5A 5FO9B 4LFBL 2RCFA 2EY5A 2F3VA 1I4PA 1O78A 4DAYA 3A7LA 5BR8Q 3G48A 2IJ0A 2L15A 4WRDA 1K0RA 2RF4A 4FNFA 4C3JB 4YCWA 4JW0A 1YNJD 3QG1A 1GM5A 4FF4A 4LUOA 2A74C 2WAQG 2F03A 5K36H 1JORA 1JB7A 2Z6BA 1QB5D 1HRJA 4OEMB 1WD1A 5CV8A 4R4OA 5IGCA 1EOTA 5FK9C 2Q8TA 2VZAA 2HD3A 1PRTC 1F9SA 1PVOA 1X32A 2UU9L 3OW7A 4LW1A 4LJZC 4G7HC 2O5JC 1K9MC 3F2DA 3GTLB 2L1BA 3FKIH 1Q81C 4LMQD 5ELFA 3I70A 3AU7A 4DR1L 3FRPB 3I73A 3JAMi 1QUQB 1U9RA 3SHLA 1G6PA 3BVMA 1B44D 3K8AA 1IHZA 2FMMA 5KEEA 3HRZC 3K6OA 3AMUA 2MGSA 2RHQB 1CKNB 1WTWA 2M9VA 2OXPA 5IWAL 1YHBA 4MN3A 4DK1A 1LTRD 1EEFD 1E2VA 3H3VC 2LMCB 1Q12A 4P71A 4AYBG 2NVYH 4DUYL 4F87A 4FYDA 1I5FA 4UPAA 1IW7D 4BA1I 5C3WA 4XQJA 3G4SA 1CA6A 1E3PA 4C3HB 2IW3A 3S24A 1JJGA 2YU9B 2Z0SA 3TP5A 2WKCA 1Y69U 5D3DA 3TS2A 1SE8A 3H3VH 1TY2A 1IKLA 2KHIA 3CP0A 3L7ZC 4KJOA 4HCEA 4A3GB 2E2HH 1BO0A 4A3IB 5M5YB 2MQHA 4Q5VA 4A3DG 3KOJA 3GTQH 4GKJL 4TKOB 1HNWL 5DEHA 4DU9A 2CWAA 1HR0L 1TWGB 2LXJA 4A3FG 1J5EQ 4PZ8A 1XMOL 4A3BH 1A15A 1PFSA 1CQVA 1UNSA 3KF8A 4IFDI 2NN6I 4XQQA 1V43A 4H7BA 2XGTA 3RZDB 3K58A 1G291 3MZ5A 1WTOA 1PH7A 5EKLA 4JV5Q 1KIXA 2XTIA 4HJ9A 5C0XI 4DR6L 3CAMA 1X55A 1D1KA 2NVYB 3UDFA 3CRLC 4GLVB 4XIGS 2FFKB 3A0JA 4M1UB 4L6TB 1EY9A 3I3CA 1BNZA 3J80E 1KNAA 4HAEA 4N9TA 2A6HC 5CV6A 2JSOA 1NAPA 2E5LQ 3GV3A 2MFIA 1SROA 4IUTA 2I46A 4LNQA 2D0PA 3DM1A 2YU9H 1HQRD 4KI0A 3FDTA 2FHTA 2AUJD 3DWAA 4X6AH 1EIGA 2EJMA 2MO1A 1BVSA 1CUKA 2E8GA 1CZGA 3JC66 3NTIA 4LF6L 4QCLA 4JI7Q 1CFMA 1Y1VB 5LMUL 1BBUA 3F2CA 4B3MQ 4GOPA 3MTSA 2VQFL 1HNZL 1VS0A 3NWTA 1TWGH 3HOYG 2NVXH 2Z4HA 2EYOA 4IALA 1NCVA 4C2MB 5EJWA 5CGKA 1XPOA 4KK7A 2KHSA 4DV6L 4I7AA 3JAML 3S1NB 2B2VC 2JA7G 3RN2A 2NTSA 3CPFA 5LL6S 2NN6G 2QDLA 1HNWQ 1CKMA 2A8VA 1B2TA 2HIXA 1Y1WG 3J80i 1NR4A 4X64L 1M90C 4POGA 4R1JA 3VR5A 1DD2A 1MJCA 2X69A 4CKBA 5C5LA 2R92B 2RVLA 1A2UA 3EN2A 2JN4A 1HQMC 4JBKA 1I94Q 2N55A 1AFPA 4E6IA 2IX0A 1FGBD 3D3RA 3H6MA 4AQYL 3LWUA 4UHVA 1K3BC 5AFWA 1K28A 2RSOA 3K0YA 4K8IA 3S9WA 1ENCA 1W3SA 4LF8Q 4Y52H 1VF7A 2VY3A 1A2TA 3TREA 2WV6D 3AB9A 5C4JB 1KD1C 4BXXH 2F0PA 1W6JA 1XYIA 2KQ3A 2PMZB 1QZHA 5IP9G 4JYAQ 4JI7L 2SNSA 3S16B 5LMUQ 2A1AA 2QILA 1S5DD 2WINB 1HNZQ 5CORA 3PIPA 4BBSB 4IURA 1PH8A 5GADC 1AE3A 3HGBA 4DV1L 4CDEC 1WVLA 2NVQB 3KBXA 1T9HA 3CCMA 1VQ4A 3SGIA 1FJGL 1M4VA 2AHOB 4KMUC 4OO1H 3PMFA 3RLOA 3I4OA 1O80A 5I2YA 3DMUA 3KDFA 5M3MH 2PYKA 4JI0Q 3TEHB 3BS1A 2BA0A 5C44G 4BY1B 1K73C 1SNQA 1U4PA 2OF1A 1DGSA 5DAUA 2AWOA 3H15A 1LV9A 3F2BA 2EZVA 4K5VA 3BZDB 4A3MG 5KNBA 2WB1G 3X3NA 2SNMA 1PV4A 3I7FA 1VQEA 3HOUH 2BOSA 1TR5A 3LNNA 1QZGA 3WOEA 2XIWA 1PRTD 5C4XB 1J8IA 5M3FH 4BA2I 3PQIA 4RH6A 2ATWA 2GN5A 2TSSA 1IYJB 4MNOA 1BOSA 4BBSH 4DV7L 3KDFB 1QVGA 1SYEA 3PO3B 2EYPA 1DOKA 4JI8Q 4K2KA 2WIIB 4BS9A 2JQOA 2VS1A 2BDNA 1QWYA 3HOVG 1MSHA 1I4GA 2ZXRA 1MJEA 3T51B 3D31A 1JMCA 1FGUA 5ELNA 4Z9CB 5M3MB 4IPGA 3VYRA 4DR7L 3VYUA 4DFAA 1SFOB 4P2CB 5KNDA 3H3VI 1BUVT 1QCBD 1TU2B 1NTGA 4DR2L 3GTPH 3K5OA 1EWCA 1VQIA 3F8TA 4BY1H 2BA1A 3TZUA 3NHHA 1FNWA 2K75A 3KYHC 3RN5A 2K14A 2EPBA 1OO9B 1LLRD 1KQSA 2F0NA 2DJGC 2IY5B 1CTMA 2Z1CA 3VR6A 5IODA 2R7FA 3HOUB 1EY5A 2IT1A 1KL9A 3R2TA 1OXSC 3ND8A 2IX3A 3OTOQ 5M3FB 3I8ZA 5CC4A 1PTOD 5C6AA 2R3ZA 1RD9D 3M4YA 2L4NA 4JVZA 1B70B 1ML0D 1TXYA 2EYHA 1G8ZD 4JI8L 1WTPA 4IUVA 2NYZD 2VQEL 4FXKC 2EYFA 4HN7A 1BF4A 3QWNA 4EQOA 2V4DA 1VQPA 2B2WC 1H9SA 2WFWA 1HTPA 2KCMA 2V1CC 4QL5A 2JA8B 3A74A 2QEJC 4K6DA 1PH1A 1ASYA 4RGMA 1PH6A 1JOOA 3CW2C 1L0WA 5T1IA 4EVOA 3T53B 4CJ1B 1SFOH 4KTAA 4NKLA 5JJIA 4A3JG 1GHJA 1K8GA 5JVG3 2NVTB 3X3MA 1WTRA 4EQ5A 3BDCA 2B3GA 2EE1A 2PQAB 4QIWE 1E2WA 2BH2A 4A3EG 4B3SQ 2Q2UA 3NSWA 2EDGA 3W1BA 2RBMA 3OSOA 1V1OA 4JI4L 4K14A 1SYBA 1LTGD 2FJ2A 3E6ZX 2K05A 5IGBA 2RKSA 4KY5A 3STBC 5C3EH 4DV3L 2OEOA 1YZ6A 2H4OA 2NZ1D 4AH6A 4ALPA 1U4MA 4G4KA 4PMBA 2F0KA 4DN4M 2O4XA 3CMAA 1BQQT 1SNOA 2KCNA 1CI3M 1U5KA 4IFDH 2I0QA 5ELBA 2YTVA 4P72A 2A19A 3T1HQ 4LF6Q 3ERQA 1SDFA 3TS0A 2HIVA 4DV4L 4OWTB 4LUZA 4RGTA 3S14B 3K7UC 4RGNA 1RHPA 4R4CA 4IFDJ 3FHWA 4LFAL 2C9OA 1XTCD 4H02A 2DY7A 3TP7A 1WCMB 1HZAA 2KCCA 2CVRA 3C1EA 4F88A 1LTSD 3DHQA 1LT5D 3DXJC 3CRKC 1FR3A 3S1RH 2F52A 4JI2L 3WWVA 1TS2A 4C2MH 3A55A 1LUZA 1JR0D 4KHPL 5AJ3L 3D0FA 2CHBD 1OXTA 2H1EA 3MHBA 2HQEA 1MSGA 2EJFC 3MXPA 3I4NG 2PZWA 1EIFA 3DEOA 1SJHD 5C3EB 1I4QA 2KVMA 1IL2A 2K52A 2B8GA 1XPRA 4JI6Q 4DF7A 1OXUA 1L0YB 3CCLA 1JWSD 4P74A 4R8NA 2DN8A 3RUZA 5JOBA 3HKSA 5D14A 5EKIA 4RMFA 1VQMA 1FNVA 4X65Q 1X65A 4GKKL 1TWCB 3MXGA 1XMQQ 1JJ2A 5FLMH 1JE5A 3KJPA 1MGSA 2BE5C 1VQ9A 4OWWB 5JPMC 2P5ZX 4WJWA 1R4QB 4DK0A 3QIAA 3A5UA 3S16H 5KIXA 1DZ1A 1UEBA 5IGDA 4DUZL 1ENAA 1X3GA 4PV1C 1X54A 1EIYB 2B2YA 1KHIA 3MWYW 1C8CA 5G3LF 4A3KH 4RGOS 1GUOA 2NVQH 3T13A 3A8KE 5IYDG 2EVBA 4J1MA 4B3SL 2DNCA 2RSNA 3J7A5 1L1OA 4BBRG 4GLXA 3EFXD 3J7YW 1LO5D 3LX0A 1A3VA 3HOWG 1RL2A 2AQ1B 1FJGQ 2K5HA 3GTLH 4DV3Q 2N8NA 3J81j 2F0IA 1D6EC 5C4HA 3ND9A 1VQAA 2B2WA 3NBHB 3UDGA 2GVAA 3KLSA 4DXFA 1I6HB 2Z6KA 3WOFA 1K8MA 1UWVA 1V9PA 4FXGC 1VQJA 1U4LA 3VA7A 4JI3Q 2WP8J 3R93A 2UXDQ 1S4ZA 1B9NA 3CC4A 2F0MA 1F2YA 4IPCA 2ZJRA 1D1IA 1FD7D 3KF8B 2YTYA 3MXNA 2HHHL 4NDXA 1YNNC 2CH4W 2VL6A 2MHVA 1EZ6A 2F0HA 2F0FA 3TP8A 4A3CH 2A68C 1Q8IA 3QOJA 3IAYA 4ZKBB 5IGFA 2VNUD 3IRBA 1HR0W 2EYMA 1ENFA 4NXNL 3R2IA 5C3XA 1VCIA 4DV5L 2E2IB 3VR4A 1SNDA 4JOIA 4DAPA 2XRQD 3A7AB 4N8FA 4NXMQ 3PF5A 4JI2Q 2YYZA 4EGVA 2F0VA 1XXGA 2PQAA 1GKHA 1BR9A 4YWLA 1L0XB 2CQAA 3SE0A 3V05A 1H9JA 1CSPA 4C1NK 4HJAA 1Q90A 4NW2A 4HIMA 4ZUJA 1S3OA 1XNQL 3GTQB 1G6ZA 5EPKA 4RHRA 1QILA 3GTPB 4B08A 4GLAC 2CH4A 3MXNB 4C3HG 1VQ7A 3AFQA 3MFYA 3Q22A 4A3BB 1I50H 2B39A 2KOLA 4JI0L 3TBIB 1O7ZA 3H94A 1RCVD 2K32A 5LMNW 4A3LG 1IL8A 3R3OA 5HURA 1AZPA 3VDYA 5CYUA 4LFCL 5E1FA 4A3GG 3KJOA 2B2YC 2Y0SG 3SEBA 4GN3B 5ELDA 1LACA 1DM0B 5C0XG 3KUPA 1VQ6A 1ESFA 2HHHQ 2F3IA 1F9PA 3EBEA 3H0GG 5E4XA 4A3FB 3VR3A 3HOYH 2F0WA 2DJFC 4KJNA 5IGGA 1STEA 1S5CD 1ILQA 4QGUA 3S1QH 3M3YB 2E2JH 1Q8KA 3PO2H 2NN6H 5FLXE 3CCSA 1ET6A 1VQFA 2XWJB 3W3AA 5ELEA 4X3SA 1PYBA 3T4AC 4WORA 3SK4A 3MAQA
chains in the Genus database with same CATH topology
2E74C 1ICWA 4ZUIA 3VYTA 4ZLTF 1EY7A 4EQNA 3EQLC 4V190 1PFBA 1STYA 1I50B 4K2LA 2B63B 2KA7A 2L11A 2LFNA 4FF3A 3URYA 2K28A 4X3UA 2DNEA 3T56B 4NMZA 2A73B 3QO2A 2IPKD 1ZEQX 4J8QA 1ZYRC 3HOYB 4OGQC 1H9MA 2JEBI 3DEPA 1KDCA 2K33A 1CT1D 4CKEA 3C46A 5C0XJ 3FPUB 4HR7B 1RJTA 5EPJA 3N52A 4XTCS 4C56C 3K5LA 2B2VA 1BDOA 3J81L 4HTHA 4PNYA 4XYQA 1EYCA 1TT2A 1IKMA 3A56A 1H9KA 1SE4A 1PZKD 5EBDA 2K03A 1T5XD 5I4DA 3NPPA 3K5MA 1KTKA 2VXWA 3G7LA 1WD0A 2Z4IA 4TRDA 4KD4A 3TMEA 2GA4B 5CV4A 3M85A 3G6JB 1Q1EA 5K5PA 4C3IB 3HKZB 1STBA 3BG3A 1EWHA 1D5ZC 3SK8A 1Q3LA 4IN3A 1K8OA 3DUZA 2XN9C 3DWQA 2SOBA 1EFID 4OL7A 5LL6X 2WKDA 4FF2A 3FVQA 4R9WA 3N6RA 3KLSX 5KNCA 5C44B 3PUZA 5HGTA 5KYIA 2NTTA 4A3KB 1PTOB 2ZXOA 2D2CC 1NSNS 2PPBC 2LY7A 3U9SA 4CKCA 2NUCA 4A3MB 2F0SA 3T16A 5A2QE 2O5IC 3A8IE 2O2LD 2B2UC 2BDOA 4KKUA 1EY6A 3C2PA 4RCNA 1B53A 1TS5A 2IWHA 3S17B 4RKLA 4XQNA 1TVXA 1HHVA 2BCOA 2RDGA 3K5NA 4DGZA 4OHJA 4LK1C 2F0LA 3PUXA 2F1MA 4IUPA 1O7LA 3NTHA 4M8AA 4A93B 3H91A 1SYCA 2N88A 4B9XA 1EQVA 1XWEA 1D5XC 1H9SB 3UI2A 1G2SA 3VR2A 3BVZA 4LAAA 1EU3A 3MXUA 2SDFA 4IUNA 5LHY1 2QKIC 1I4RA 3LWEA 1FNUA 3RZOB 3M7NA 3S2DB 1JWUD 1JICA 3OWEB 1SE2A 1G91A 1SNMA 5CV5A 4JBWA 1F2MA 1PZJD 1STHA 1DJRD 2F0JA 3NXWA 1TY0A 2A68D 2XSCA 5E4WC 1KABA 3JAME 2EJGC 2PZTA 5EKKA 5IIFA 2J7ZA 2MJ8A 3M4OB 1F9RA 2PCFB 1HFNA 5I6YA 2LS01 1BBXC 3F2UA 3OHXC 3PO2B 3NP8A 3NK9A 4FF1A 2PZUA 1PMRA 3IFTA 1I6VC 4FO2A 3L3OC 4DA2A 2E2HB 2J4XA 4QIWB 2MP1A 2B2TC 1BCPD 2CW0C 1QG7A 3BVGA 1RF2D 2D5DA 3R8BA 4PMWA 1QOHA 3S1RB 1SSOA 3Q23A 3KK7A 3C3LA 3D4DA 1AP0A 4K8JA 4EQPA 2OT2A 3GTKB 4U673 2L9HA 1STAA 2G9DA 1B1ZA 1R4PB 3NBHA 1TKWB 1TIID 1PYWD 1SJED 1D5MC 3D4WA 4CGYB 2MUYA 3I4NB 4Y7NB 3GQBA 5JEAJ 1UAPA 4ILWA 3HS0C 5BN3A 2L55A 2HCCA 2XWBB 4RAUC 1JWMD 2NVXB 1C48A 4ZKCB 1Z6HA 1ZKOA 2X6GA 2F0UA 2PNRC 5JEAH 3P7JA 3NQIA 4O1NA 1GOZA 3PIP3 4BY7B 1EZ8A 4UAIA 4ZK9B 2L12A 1GUWA 4ZAIA 5KGUA 1Q1BA 1RDPD 5K36G 3K57A 1RKNA 3E5SA 3GTMB 5F2DA 2EXZA 4OO1G 2L5TA 2SEBD 4N9PA 4RHSA 4HCSA 4L8JA 1LABA 2HCIA 2JEAI 4K6LA 1PTOH 4QUCA 4DXGA 4RCOA 1PTOF 4ODGA 1CM9A 2VUMB 4OO1I 1GUTA 3TP6A 1IYVA 5M9OA 2E75C 1PTOC 4XYOA 1JQYD 1VMCA 1LTAD 4HEDA 3L9AX 2HDMA 3SK5A 2F4IA 2FMCA 2CW0D 4OIKA 5DM73 5IOCA 3BDOA 1CK1A 1H9RA 2EOTA 1DOLA 5FLXL 3NUCA 5EGTA 3TDQA 1EY8A 2AQ3B 4DNRB 2ZT9C 1LT6D 4MIUA 2Y0SB 2JA5B 3C1FA 2PW7A 5ELCA 5CV9A 3HOZB 3H0GB 1LTTD 4ZRZA 3K59A 1OXVA 2QDBA 3DWPA 5I9OA 1PRTB 5FKAC 3QOLA 3Q6SA 3GV6A 4HMIA 1AZQA 3EROA 4ULLA 4FXDA 2PQEA 1CA5A 3OOCA 3D8GA 2VB3X 1NR2A 1EL0A 3PIO3 4KV6A 1TWAB 4KY6A 2NWGA 3I4LA 3I4MB 1HA5A 1RODA 1K83B 2EY1A 2R6GA 2RDFA 4GZYC 3PUWA 3RD4A 2L0CA 1EEID 1CHPD 1SYDA 3HG9A 4KY7A 3M7GA 4XXEA 1KNEA 2EY6A 1DONA 4KKTA 1BCPF 5A35A 1GUNA 4XT1B 3K7AB 2VB2X 2F0DA 1YNJC 3SDZA 1JOQA 5I9PA 4KKSA 1ZXTA 2PO4A 1EYDA 1BCPC 3OMCA 5FO7B 2WACA 1AW7A 1CHQD 1DCZA 1I4HA 1TWFB 3MA2B 2JA6B 5J22A 4X3TA 1Y8PB 1EY4A 1LTID 4ID6A 3ITPA 3CKIB 4C3IG 4RKBA 2BE5D 2ICIA 1WTVA 3CU7A 1ESRA 4TSSA 5JVH3 5NUCA 1F2ZA 1OXXK 5DNFA 1B50A 4F8MA 4C3JG 3KBGA 3HZXA 2WAQB 1SBBB 1B9MA 4WFN3 1HTLD 3U9OA 4O42A 5D65A 3MFGA 2LKVA 2B2TA 2JYOA 4IUUA 4RWSC 5BN4A 1STNA 1MBYA 1TWHB 4DAVA 1KDBA 1MI2A 2RQXA 4DNTB 2KEDA 2FINB 3GP7A 3MC0B 1JB3A 4JK1C 3P75A 3D4RA 5JPNC 2A5HA 3IKJA 4HSPA 1HXYD 4AYBB 4ZQ3A 3FKIB 3W2DA 4G7ZC 1II3A 4U68A 2A6ED 2F0QA 2K5QA 1DOMA 4QF4A 2EY2A 2K1BA 4KHVA 1RTNA 1E0BA 1QNKA 4QMGA 2C5CA 4B9WA 2RA4A 2K6AA 4Q0FA 1B4OA 2JXMB 2R61A 3FEWX 4A3DB 3OPOA 4KN4C 5CBAE 3P1HA 5ISRA 5IT9L 2MPMA 3ZYYX 5M5XB 5T1GA 1SMYC 2QF7A 4CHTB 3GTJB 1F9QA 3P20A 4BWGB 2TMPA 3OIQA 5EQ0A 1UUPA 1GUGA 3J7AF 1I4XA 3RLFA 1SEBD 2EYLA 4QUFA 3Q24A 2KEEA 2A6HD 5KYLA 4HMJA 3J80L 1WTXA 1W6KA 3E0JA 1HA6A 1EQTA 4K5WA 5COYA 3I91A 5EPLA 1KLGD 3QJYA 1A6XA 1DYQA 2F0OA 2HDLA 3FPPA 1O7YA 4CBVA 2B2UA 1CZWA 5BN5A 1A3UA 1VMPA 3A8JE 2JA7B 3S1QB 2E2JB 1HUNA 1HPCA 4MHEA 4PMCA 3EA6A 1Y1WB 3A54A 1PDQA 1U4RA 4RFBA 3BYTB 4K5XA 5J1ZA 5IGEA 1GXDC 3CHBD 2KJXA 5E3FA 1QJOA 2ZXPA 3HEJA 2NB0A 3SXHA 2AUKA 1PFMA 4CJ2C 1BXTA 5FOBB 3S2HB 2D9UA 1IYUA 1JOKA 1TQOA 5DM63 1SE3A 1QNUA 1Y8OB 1Z7TA 3SVMA 3FMCA 3J81E 3IL8A 1X3PA 4KD3A 3SK6A 2AWNA 2J0TD 5D3IB 3V2TA 1AEXA 3I90A 3GO5A 2K04A 2Q8IB 2DY8A 3HOXB 2IX1A 3MVVA 2KUMA 1SYFA 1JE4A 3TSSA 1GJXA 1JC7A 5EBCA 4S3SA 4IUQA 1G2TA 3CQZB 3OWFA 2WB1B 2F3WA 4QB4A 1Z47A 5G3LD 1ET9A 4FVMA 1HCZA 3NE5B 1KDAA 4ABNA 1C4QA 3MEHA 5IT9E 1T5EA 3QB3A 1EIHA 2NBFA 1UEAB 3HP3A 3GTOB 1EYAA 1J9OA 1F77A 2E76C 3PV0A 1PLFA 3NQTA 4J6HA 2M2LA 3BDLA 3GTGB 1CQFA 4HSVA 1X3QA 1JCKB 3HOVB 5J39A 2M00A 5A2QL 3TN2A 2ID0A 1KLUD 1SNCA 4I7ZC 3Q0AA 5CV7A 3NWSA 3O13A 2XRSD 4H44C 2A6EC 3D6CA 4NP5A 1VDZA 4F7XA 2ICEC 1ONLA 2I07B 5I6WA 2EYJA 1IW7C 1A3TA 5C0XH 4X3KA 4KN7C 1E2ZA 1LTBD 3GD7A 1SYGA 2ENBA 2PW5A 5I2XA 3IFDA 1SNPA 2IL8A 1F2LA 1VF5C 1FYCA 1BCPB 3TZDA 4UDUC 1WTQA 1NUCA 2JE6I 3I72A 2F0TA 4TQUS 2Z8LA 3WDNA 1S5FD 1TS4A 2X6LA 4R8IA 1RTOA 3OMGA 4A3JB 2D62A 2RDHA 4V0BA 4A3EB 3PUVA 2K5WA 3S15B 5JAVA 2QCPX 4OIJA 3BYYB 2B8FA 2HUGA 5JJZA 1QE6A 1EU4A 4G7OC 5CR3A 3KLRA 2G9HD 1HFGA 1DXMA 4PQXA 1ZYRD 4XT3B 3S1MB 3H09A 4IZ8A 4L63B 1S5BD 1B3AA 1SAPA 1GUSA 4FP5D 2K01A 1HUMA 2F0EA 2E2DC 5FO8B 1LT4D 1PZID 1M8AA 1SMYD 1D2BA 1S5ED 1XX8A 1STGA 2K7VA 4ZYSA 4XDXA 1Y8NB 5KRUA 3J7AV 1KAAA 2JP1A 2XVSA 2AQ2B 3VA5A 4I65A 1LT3D 1GHKA 4H13C 1YNND 4IQZA 2Q8RE 4CJ0B 1I3QB 2F0GA 2KECA 1EY0A 3PUYA 3V96A 5CBEE 1PFNA 3ONAB 4IFDG 1SXTA 5M5WB 5CMDA 2A69D 5C4ZA 1MD2D 1V8QA 3EVQA 5C5MA 4KHZA 2R93B 4RA8A 3OIPA 1V1PB 2K5DA 5TSSA 1R9TB 4C1NI 2R7ZB 1PRTF 3SR1A 4ME5A 3RMHA 1AN8A 3NBIA 1ILPA 2XNAC 2A69C 3D6WA 1V1PA 4YIJA 4H0LC 3VYSA 4BBRB 5JEAG 4G57A 3NTKA 3EJIA 3HOWB 1PXUA 1TS3A 5FO9B 2EY5A 2F3VA 1I4PA 1O78A 4DAYA 3A7LA 2IJ0A 4WRDA 4FNFA 4C3JB 1YNJD 3QG1A 4FF4A 2A74C 2F03A 5K36H 1JORA 1QB5D 1HRJA 1WD1A 5CV8A 5IGCA 1EOTA 5FK9C 2Q8TA 1PRTC 1F9SA 1X32A 3OW7A 4LJZC 4G7HC 2O5JC 3GTLB 2L1BA 4LMQD 5ELFA 3I70A 3AU7A 3FRPB 3I73A 1U9RA 3SHLA 3BVMA 1B44D 1IHZA 2FMMA 5KEEA 3HRZC 3K6OA 3AMUA 2MGSA 1WTWA 2M9VA 2OXPA 4MN3A 4DK1A 1LTRD 1EEFD 3H3VC 1E2VA 2LMCB 1Q12A 4F87A 4FYDA 1IW7D 4BA1I 5C3WA 4XQJA 1CA6A 4C3HB 2IW3A 2YU9B 3TP5A 2WKCA 1Y69U 5D3DA 1TY2A 1IKLA 3L7ZC 4KJOA 4HCEA 4A3GB 1BO0A 4A3IB 5M5YB 4Q5VA 4TKOB 5DEHA 4DU9A 1TWGB 1A15A 4IFDI 1CQVA 1UNSA 3KF8A 2NN6I 4XQQA 1V43A 4H7BA 3RZDB 3K58A 1G291 3MZ5A 1WTOA 5EKLA 5C0XI 1D1KA 2NVYB 3CRLC 4XIGS 2FFKB 4M1UB 4L6TB 1EY9A 3I3CA 1BNZA 3J80E 1KNAA 4HAEA 4N9TA 2A6HC 5CV6A 2JSOA 1NAPA 3GV3A 4IUTA 2I46A 3DM1A 1HQRD 4KI0A 3FDTA 2FHTA 2AUJD 3DWAA 1EIGA 2EJMA 1CZGA 3NTIA 4QCLA 1CFMA 1Y1VB 3MTSA 3NWTA 2Z4HA 2EYOA 4IALA 1NCVA 4C2MB 5EJWA 5CGKA 4KK7A 2KHSA 3JAML 3S1NB 2B2VC 2NTSA 5LL6S 2NN6G 1B2TA 1NR4A 3VR5A 1DD2A 2X69A 4CKBA 5C5LA 2R92B 2RVLA 1A2UA 1HQMC 2N55A 1AFPA 4E6IA 2IX0A 1FGBD 3D3RA 3H6MA 3LWUA 5AFWA 2RSOA 3K0YA 4K8IA 3S9WA 1ENCA 1VF7A 1A2TA 2WV6D 3AB9A 5C4JB 2F0PA 1W6JA 1XYIA 2KQ3A 2PMZB 2SNSA 3S16B 2QILA 1S5DD 2WINB 5CORA 4BBSB 4IURA 3HGBA 1WVLA 2NVQB 3KBXA 1M4VA 4KMUC 4OO1H 3PMFA 1O80A 5I2YA 3DMUA 2PYKA 3BS1A 2BA0A 4BY1B 1SNQA 1U4PA 2OF1A 5DAUA 2AWOA 1LV9A 2EZVA 4K5VA 3BZDB 5KNBA 3X3NA 2SNMA 2BOSA 1TR5A 3LNNA 3WOEA 2XIWA 1PRTD 5C4XB 1J8IA 4BA2I 4RH6A 2TSSA 1BOSA 1SYEA 3PO3B 2EYPA 1DOKA 4K2KA 2WIIB 4BS9A 2BDNA 1QWYA 1MSHA 1I4GA 2ZXRA 3T51B 3D31A 5M3MB 4Z9CB 3VYRA 3VYUA 4DFAA 1SFOB 4P2CB 5KNDA 1BUVT 1QCBD 1TU2B 3K5OA 1EWCA 2BA1A 3TZUA 3NHHA 1FNWA 2EPBA 1OO9B 1LLRD 2F0NA 1CTMA 2Z1CA 3VR6A 5IODA 3HOUB 1EY5A 2IT1A 3R2TA 1OXSC 3ND8A 2IX3A 5M3FB 3I8ZA 5CC4A 1PTOD 5C6AA 2R3ZA 1RD9D 3M4YA 2L4NA 1ML0D 2EYHA 1G8ZD 1WTPA 4IUVA 2NYZD 4FXKC 2EYFA 4HN7A 1BF4A 3QWNA 4EQOA 2V4DA 2B2WC 1H9SA 1HTPA 2JA8B 2QEJC 4K6DA 4RGMA 1JOOA 5T1IA 4EVOA 3T53B 4CJ1B 4KTAA 4NKLA 1GHJA 5JVG3 2NVTB 3X3MA 1WTRA 3BDCA 2EE1A 1E2WA 3NSWA 2EDGA 2RBMA 3OSOA 1V1OA 4K14A 1SYBA 1LTGD 2FJ2A 3E6ZX 2K05A 5IGBA 2RKSA 4KY5A 2OEOA 2H4OA 2NZ1D 1U4MA 4G4KA 4PMBA 2F0KA 4DN4M 2O4XA 1BQQT 1SNOA 2KCNA 1CI3M 4IFDH 5ELBA 3ERQA 1SDFA 4RGTA 3S14B 4RGNA 1RHPA 4IFDJ 2C9OA 1XTCD 2DY7A 3TP7A 1WCMB 2KCCA 2CVRA 3C1EA 4F88A 1LTSD 3DHQA 1LT5D 3DXJC 3CRKC 1FR3A 1TS2A 3A55A 1JR0D 2CHBD 1OXTA 2H1EA 3MHBA 2HQEA 1MSGA 2EJFC 3MXPA 2PZWA 3DEOA 1SJHD 5C3EB 1I4QA 2KVMA 2B8GA 4DF7A 1OXUA 1L0YB 1JWSD 4R8NA 2DN8A 3RUZA 5JOBA 5D14A 5EKIA 1FNVA 1TWCB 3MXGA 1MGSA 2BE5C 5JPMC 4WJWA 1R4QB 4DK0A 3QIAA 5KIXA 1DZ1A 5IGDA 1ENAA 4PV1C 2B2YA 3MWYW 1C8CA 5G3LF 4RGOS 1GUOA 3T13A 3A8KE 2EVBA 4J1MA 2DNCA 2RSNA 3EFXD 3J7YW 1LO5D 3LX0A 1A3VA 2AQ1B 2F0IA 1D6EC 5C4HA 3ND9A 2B2WA 3KLSA 4DXFA 1I6HB 3WOFA 1K8MA 4FXGC 1U4LA 3VA7A 2WP8J 3R93A 1S4ZA 1B9NA 2F0MA 1F2YA 1D1IA 1FD7D 3MXNA 4NDXA 1YNNC 2MHVA 1EZ6A 2F0HA 2F0FA 3TP8A 2A68C 1Q8IA 3QOJA 3IAYA 4ZKBB 5IGFA 2VNUD 2EYMA 1ENFA 3R2IA 5C3XA 1VCIA 2E2IB 3VR4A 1SNDA 4DAPA 2XRQD 3A7AB 2YYZA 4EGVA 2F0VA 1XXGA 1BR9A 1L0XB 2CQAA 3SE0A 3V05A 1H9JA 4C1NK 1Q90A 4NW2A 4ZUJA 3GTQB 1G6ZA 5EPKA 4RHRA 1QILA 3GTPB 4B08A 4C3HG 3MFYA 3Q22A 4A3BB 2B39A 2KOLA 3TBIB 1O7ZA 3H94A 1RCVD 2K32A 1IL8A 3R3OA 5HURA 1AZPA 5CYUA 5E1FA 2B2YC 3SEBA 5ELDA 1LACA 1DM0B 5C0XG 3KUPA 1ESFA 1F9PA 5E4XA 4A3FB 3VR3A 2F0WA 4KJNA 5IGGA 1STEA 1S5CD 1ILQA 3M3YB 2NN6H 5FLXE 1ET6A 2XWJB 3W3AA 5ELEA 4X3SA 3T4AC 4WORA 3SK4A 3MAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2U A;  4S3S A;  1STB A;  5K5P A;  1F2M A;  1STH A;  3OMG A;  3SK8 A;  3ERQ A;  3OWF A;  2RDF A;  4ZUI A;  4E6I A;  2F3W A;  1STN A;  2SOB A;  4K5W A;  4OL7 A;  4QB4 A;  3SR1 A;  1KDB A;  3H6M A;  4DFA A;  4ME5 A;  2F0J A;  2F0M A;  5IOC A;  1EY7 A;  1F2Y A;  3NXW A;  3V2T A;  2F0O A;  4K8I A;  4KJO A;  3S9W A;  4EQN A;  1ENC A;  4NDX A;  5JAV A;  1KDA A;  1SYD A;  4KY7 A;  1A2T A;  1STY A;  3NHH A;  2F0U A;  3TP7 A;  5HGT A;  5KYI A;  4K2L A;  1KAB A;  2EY6 A;  3MEH A;  3P75 A;  4YIJ A;  1EZ6 A;  2F0H A;  1A3U A;  3C1E A;  2F0P A;  3NUC A;  2F0F A;  3QB3 A;  5DEH A;  3DHQ A;  2KQ3 A;  3TP8 A;  4DU9 A;  1NSN S;  5EKK A;  2PZT A;  5IIF A;  3QOJ A;  2SNS A;  4ZQ3 A;  5EGT A;  1EYA A;  5IGF A;  2F0N A;  1EY8 A;  2NUC A;  4G57 A;  3EJI A;  3NQT A;  2EYM A;  4J6H A;  5IOD A;  5CR3 A;  1EZ8 A;  3BDL A;  2F0D A;  2F0S A;  1II3 A;  5C3X A;  4PMC A;  4NMZ A;  3T16 A;  2F0Q A;  3MHB A;  1EY5 A;  1SND A;  2HQE A;  4H7B A;  2EY5 A;  2F3V A;  3MXP A;  5I6Y A;  2PZW A;  4QF4 A;  1JOQ A;  5KGU A;  3MZ5 A;  2EY2 A;  5CC4 A;  5EKL A;  4KHV A;  2F0V A;  5C6A A;  4MIU A;  4WRD A;  5J39 A;  3NP8 A;  5I9P A;  3C1F A;  2M00 A;  1EY6 A;  3NK9 A;  2PW7 A;  1EYD A;  4IZ8 A;  3PMF A;  5CV9 A;  3OMC A;  4QMG A;  1RKN A;  2EYH A;  2PZU A;  3E5S A;  4DF7 A;  4B9W A;  4RKL A;  4K5X A;  2WAC A;  3DMU A;  5F2D A;  2EXZ A;  1SNC A;  5J1Z A;  1JOR A;  1EY9 A;  2PYK A;  5IGE A;  4R8N A;  2F0E A;  4DGZ A;  5CV8 A;  4ZUJ A;  4N9T A;  2EYF A;  3RUZ A;  5JOB A;  5CV6 A;  5CV7 A;  5IGC A;  4EQO A;  4N9P A;  5J22 A;  2QDB A;  2F0L A;  5I9O A;  1KDC A;  3SK5 A;  3QOL A;  1EY4 A;  3D6C A;  4K6D A;  4ID6 A;  4NP5 A;  1SNQ A;  3ITP A;  1JOO A;  2OF1 A;  1STG A;  3D4D A;  3P1H A;  5DAU A;  5E3F A;  1SYC A;  4EVO A;  3HEJ A;  4K8J A;  5ISR A;  3SXH A;  4EQP A;  4HMI A;  4RKB A;  4KTA A;  3ERO A;  4NKL A;  1U9R A;  3SHL A;  4K5V A;  4HTH A;  4B9X A;  1EQV A;  4F7X A;  4PNY A;  2SNM A;  4ODG A;  1EYC A;  1TT2 A;  3R3O A;  5HUR A;  5KIX A;  2PQE A;  5KRU A;  3BDC A;  1STA A;  1IHZ A;  3D8G A;  5NUC A;  5IGD A;  1ENA A;  1F2Z A;  5I6W A;  1JOK A;  1KAA A;  5KEE A;  2EYJ A;  1TQO A;  4LAA A;  1TR5 A;  5E1F A;  4F8M A;  1A3T A;  2RBM A;  3VA5 A;  3OSO A;  4I65 A;  4K14 A;  2OXP A;  1SYB A;  3HZX A;  5IGB A;  3T13 A;  3TP6 A;  2EYO A;  2RKS A;  4IAL A;  4KY5 A;  4KD3 A;  4IUN A;  4J1M A;  2OEO A;  4KV6 A;  3SK6 A;  5CGK A;  5M9O A;  2KHS A;  5IGG A;  2F0W A;  1SYG A;  2ENB A;  2PW5 A;  2F0G A;  3LX0 A;  1A3V A;  1EY0 A;  1SNP A;  3D4W A;  1AEX A;  4KJN A;  2F0K A;  2EYL A;  4KY6 A;  4PMB A;  1SYE A;  2O4X A;  5C3W A;  2EYP A;  4K2K A;  3U9O A;  4TRD A;  5KYL A;  1SNO A;  4KD4 A;  3TME A;  1NUC A;  3MVV A;  4HMJ A;  2F0I A;  5CV4 A;  5C4H A;  2LKV A;  1SYF A;  2F0T A;  1SNM A;  5C4Z A;  4WOR A;  5CV5 A;  3SK4 A;  3EVQ A;  2EY1 A;  5C5L A;  5C5M A;  3TP5 A; 
#chains in the Genus database with same CATH topology
 4DV0 L;  1A62 A;  2E74 C;  1ICW A;  2JA5 H;  4ZUI A;  3VYT A;  4ZLT F;  3JAM c;  2ZTD A;  1EY7 A;  4DR4 Q;  4EQN A;  3CXC A;  3ULJ A;  3EQL C;  4V19 0;  2UXC Q;  1PFB A;  1QVF A;  4GNX C;  4JI3 L;  2UXD L;  1STY A;  3TQY A;  4DV2 L;  1I50 B;  4K2L A;  2B63 B;  2KA7 A;  2L11 A;  3S1N H;  2LFN A;  1E22 A;  3EIV A;  1N34 L;  4FF3 A;  3URY A;  2K28 A;  1KC8 C;  4X3U A;  2DNE A;  1MIU A;  3T56 B;  2QEX A;  2N49 A;  4OON A;  4NMZ A;  2RCN A;  1K8A C;  2A73 B;  3QO2 A;  2VW9 A;  1Y1V G;  2IPK D;  1ZEQ X;  4J8Q A;  1ZYR C;  2K4K A;  3HOY B;  1U0L A;  3G71 A;  3CD6 A;  4OGQ C;  4HID A;  1H9M A;  4YWM A;  2ZJQ A;  5FJ8 G;  2JEB I;  3DEP A;  4Y7N H;  4L5R C;  1KDC A;  2C35 B;  2BH8 A;  1CT1 D;  1Q46 A;  2K33 A;  4CKE A;  5C0X J;  3C46 A;  3FPU B;  4HR7 B;  1RJT A;  5EPJ A;  3N52 A;  1C0A A;  4XTC S;  4C56 C;  3K5L A;  2B2V A;  1BDO A;  1ASZ A;  3J81 L;  3L0O A;  4HTH A;  3U4V A;  4PNY A;  5HY6 A;  4XYQ A;  1EYC A;  1TT2 A;  5IYC G;  4IOA A;  3G6E A;  1IKM A;  1J5E L;  3A56 A;  3S1M H;  1H9K A;  1SE4 A;  1PZK D;  1NMG A;  5EBD A;  3M9B A;  2K03 A;  1MKH A;  1T5X D;  1N33 Q;  1NBW A;  5I4D A;  3NPP A;  3K5M A;  4IJH A;  1E7Z A;  1KTK A;  2RHS B;  1ICF B;  2VXW A;  1VQC A;  1PH5 A;  4YCV A;  3GTO H;  4BBS G;  1VQN A;  1GD7 A;  3G7L A;  5IY0 A;  1WD0 A;  2Z4I A;  4TRD A;  4KD4 A;  3TME A;  2GA4 B;  5CV4 A;  1CSQ A;  2F4V Q;  3GTG H;  2Q2T A;  3FP9 A;  3M85 A;  4HJ8 A;  3G6J B;  1Q1E A;  5K5P A;  3GDE A;  4C3I B;  3HKZ B;  1STB A;  3BG3 A;  1EWH A;  1D5Z C;  4DPG A;  3SK8 A;  1Q3L A;  4IN3 A;  1HZC A;  3DUZ A;  2XN9 C;  1K8O A;  3DWQ A;  2SOB A;  1EFI D;  4OL7 A;  5LL6 X;  2WKD A;  4FF2 A;  3FVQ A;  4R9W A;  3N6R A;  3KLS X;  4RG1 A;  2D0O A;  5KNC A;  5C44 B;  3PUZ A;  1XNR L;  4DV4 Q;  5HGT A;  5KYI A;  2NTT A;  4BY1 G;  4A3K B;  1PTO B;  2ZXO A;  2D2C C;  1I3Q H;  1J6Q A;  1NSN S;  1IBM Q;  2I5H A;  2PPB C;  2LY7 A;  3U9S A;  4CKC A;  2NUC A;  2ZM6 Q;  4DR5 L;  4JC0 A;  4A3M B;  2F0S A;  2VUM H;  3T16 A;  4O2D A;  5A2Q E;  2O5I C;  3A8I E;  3S2D H;  3CF5 A;  2O2L D;  2B2U C;  5JJL A;  2BDO A;  2KCT A;  4KKU A;  3W1G A;  2R7Z H;  1EY6 A;  2PI2 A;  3C2P A;  4JI1 Q;  4RCN A;  1B53 A;  1TS5 A;  2IWH A;  1OTC A;  3S17 B;  4RKL A;  4XQN A;  3CCV A;  1TVX A;  1HHV A;  1N9W A;  2BCO A;  2RDG A;  3K5N A;  4DGZ A;  4OHJ A;  4LK1 C;  2F0L A;  1VQG A;  3PUX A;  2F1M A;  3A5Z B;  4IUP A;  1HNX L;  1K0S A;  1O7L A;  2KEN A;  4M8A A;  3NTH A;  4A93 B;  1QUQ A;  3H91 A;  1SYC A;  2N88 A;  2CQO A;  5EAY A;  3FKI G;  4B9X A;  1EQV A;  5FLX c;  1XWE A;  1D5X C;  1H9S B;  3UI2 A;  1G2S A;  3VR2 A;  3BVZ A;  4LAA A;  1E1O A;  1EU3 A;  3MXU A;  2SDF A;  4A76 A;  4A3E H;  2ZM6 L;  3M4Q A;  4PG3 A;  4A75 A;  4IUN A;  5LHY 1;  2QKI C;  1XNQ Q;  3CCE A;  1FL0 A;  3LWE A;  1I4R A;  4X62 L;  1FNU A;  3RZO B;  3M7N A;  1UE1 A;  2KHJ A;  3S2D B;  1JWU D;  4DR1 Q;  1JIC A;  3OWE B;  3PCO B;  1SE2 A;  2OTL A;  1G91 A;  1SNM A;  3DM3 A;  5CV5 A;  1MHW C;  3HOZ H;  5IYB H;  4JBW A;  1F2M A;  1PZJ D;  1STH A;  1DJR D;  1UE7 A;  2F0J A;  3NXW A;  1TY0 A;  3I56 A;  2A68 D;  1HR0 Q;  4A93 H;  2XSC A;  5E4W C;  1KAB A;  3JAM E;  1C9O A;  4A3D H;  2H5X A;  2EJG C;  2PZT A;  5EKK A;  5IIF A;  2J7Z A;  2MJ8 A;  4GN4 B;  1UE6 A;  4DR6 Q;  3M4O B;  4JI5 Q;  1F9R A;  4ME3 A;  2PCF B;  1HFN A;  5I6Y A;  5M5X H;  1IBK L;  4DV0 Q;  4GNX A;  3M3Y H;  2LS0 1;  4MTN A;  1BBX C;  3F2U A;  3OHX C;  3PO2 B;  3NP8 A;  3BZC A;  3NK9 A;  1L1O B;  4FF1 A;  2PZU A;  1PMR A;  3IFT A;  4UP7 A;  1TWA H;  1I6V C;  3NEL A;  4FO2 A;  3L3O C;  4DA2 A;  2VQF Q;  2E2H B;  4A3I H;  1NMF A;  2J4X A;  3I4M H;  4QIW B;  1S72 A;  2MP1 A;  2B2T C;  1BCP D;  2CW0 C;  1QG7 A;  2K5V A;  3BVG A;  1RF2 D;  2D5D A;  1K83 H;  4PMW A;  3R8B A;  3PF4 A;  1QOH A;  4B3R L;  3S1R B;  1E1T A;  1SSO A;  3Q23 A;  2UUA Q;  2DUD A;  2GVB A;  3KK7 A;  3D4D A;  3NEM A;  3C3L A;  1AP0 A;  4K8J A;  4EQP A;  2EIF A;  2OT2 A;  3GTK B;  1UE5 A;  1HZ9 A;  4U67 3;  1KAW A;  2L9H A;  4NPS A;  1STA A;  2G9D A;  1B1Z A;  3AYH B;  1R4P B;  3KF6 A;  1VQH A;  1WCM G;  3NBH A;  2MNA A;  1TKW B;  5L37 A;  2E5L L;  1D7Q A;  1YJ9 A;  1TII D;  1HNX Q;  3AQQ A;  1LM0 A;  1PYW D;  4AIM A;  1SJE D;  1D5M C;  2AKW B;  3D4W A;  3GTM H;  4CGY B;  2MUY A;  1PH9 A;  3L2P A;  3I4N B;  4PZ7 A;  4X62 Q;  1EOV A;  1L2F A;  1C7Y A;  4Y7N B;  3GQB A;  5JEA J;  1UAP A;  2HT1 A;  4ILW A;  1TWF H;  3HS0 C;  3OW2 A;  5BN3 A;  4R4T A;  2L55 A;  2HCC A;  2XWB B;  1NY4 A;  2JA6 H;  4RAU C;  4APV A;  1JWM D;  1YEZ A;  2NVX B;  1C48 A;  4ZKC B;  1Z6H A;  1ZKO A;  2X6G A;  2F0U A;  4CDC C;  2PNR C;  5JEA H;  3P7J A;  3NQI A;  3AFP A;  4O1N A;  1GOZ A;  4BXX G;  2WB1 E;  2MO0 A;  2PI2 E;  5IP9 H;  4LWC A;  3PIP 3;  4A3C G;  1EZ8 A;  1N32 Q;  4BY7 B;  3HOX G;  4UAI A;  4ZK9 B;  4IO9 A;  2L12 A;  1GUW A;  4ZAI A;  2R92 H;  1PH2 A;  5KGU A;  3S2H H;  1Q1B A;  1RDP D;  5K36 G;  3K57 A;  1RKN A;  3E5S A;  5HGQ A;  1S40 A;  3GTM B;  5F2D A;  2EXZ A;  1PYS B;  4OO1 G;  1WYD A;  1XNR Q;  1E24 A;  3T1Y L;  1CKO A;  2L5T A;  1GVP A;  4QQB X;  2SEB D;  4N9P A;  4HJ5 A;  4RHS A;  4HCS A;  4L8J A;  4YWK A;  1EUJ A;  1LAB A;  2HCI A;  4IJL A;  2JEA I;  4K6L A;  1PTO H;  1V1Q A;  1TWH H;  4QUC A;  2QW7 A;  4FDB A;  3OYY A;  4RCO A;  1PTO F;  4ODG A;  4DXG A;  2Q2I A;  1CM9 A;  3CQZ H;  4GKJ Q;  1Y14 B;  1K3R A;  4A3L H;  2VUM B;  1SMX A;  4OO1 I;  3I2Z A;  1GUT A;  2PMZ E;  3TP6 A;  4R4I A;  1IYV A;  2UU9 Q;  3KF6 B;  5M9O A;  1JJC B;  4BY7 H;  2E75 C;  1PTO C;  3E9H A;  4XYO A;  1JQY D;  1VMC A;  3E9I A;  1LTA D;  2K5N A;  3E3X A;  4HED A;  3L9A X;  2HDM A;  3SK5 A;  2F4I A;  2FMC A;  2CW0 D;  3HOV H;  4OIK A;  5DM7 3;  5IOC A;  1X9N A;  3BDO A;  1CK1 A;  1H9R A;  5C4X H;  2JK8 A;  1X6O A;  2EOT A;  1DOL A;  5FLX L;  1AE2 A;  4DUZ Q;  1PHJ A;  4A3B G;  3NUC A;  5EGT A;  3PO3 H;  3TDQ A;  1EY8 A;  2AQ3 B;  4B3M L;  3ZJY C;  3GTJ H;  2CKZ B;  3KLW A;  4DNR B;  2ZT9 C;  4DR7 Q;  1LT6 D;  1B8A A;  4MIU A;  2Y0S B;  2JA5 B;  3C1F A;  2PW7 A;  5ELC A;  5CV9 A;  3HOZ B;  3H0G B;  1LTT D;  4X64 Q;  4ZRZ A;  3K59 A;  4JV5 L;  1VQL A;  1OXV A;  4DV2 Q;  4UY8 C;  1AH9 A;  2QDB A;  4CDF C;  3DWP A;  5I9O A;  1PRT B;  5FKA C;  3QOL A;  4DK6 C;  3Q6S A;  5ELO A;  3GV6 A;  4L5Q A;  3B6Y A;  5LMN L;  4HMI A;  1AZQ A;  3ERO A;  4LFB Q;  1A0I A;  4YY3 L;  1EQR A;  4ULL A;  4FXD A;  1JT8 A;  4K0K L;  2PQE A;  1CA5 A;  3OOC A;  3UDX A;  3D8G A;  4A3J H;  2VB3 X;  3M4O H;  1NR2 A;  3BZK A;  1IZ6 A;  1NJI C;  4P75 A;  2B63 G;  1EL0 A;  3PIO 3;  4KV6 A;  5C4J H;  3U50 C;  1TWA B;  1Y1W H;  4KY6 A;  2NWG A;  3I4L A;  4B3R Q;  2JA8 H;  4LF5 Q;  1IBM L;  5IE8 A;  3M4P A;  3I4M B;  2DGY A;  2ZTE A;  4OX9 Q;  3UE0 A;  1HA5 A;  1ROD A;  1K83 B;  3RNU A;  2EY1 A;  2R6G A;  2WAQ E;  2RDF A;  4GZY C;  3PUW A;  4JI4 Q;  3RD4 A;  4JI1 L;  2L0C A;  1EEI D;  3GTK H;  4YCU A;  1CHP D;  1EQQ A;  3J7Z C;  1VQO A;  1SYD A;  3HG9 A;  4KY7 A;  4DV6 Q;  3M7G A;  4XXE A;  1KNE A;  2EY6 A;  1DON A;  4KKT A;  1VQD A;  1BCP F;  1X3E A;  4LF4 Q;  5A35 A;  1GUN A;  1X56 A;  4XT1 B;  4OEL B;  4JCV E;  1EWI A;  3K7A B;  2EXD A;  2VB2 X;  2F0D A;  3LGJ A;  1YNJ C;  5IP7 H;  4WJ3 M;  3SDZ A;  4P73 A;  1IBL L;  5GAG C;  1JOQ A;  4O0A A;  4OXP A;  3I4N H;  5I9P A;  4KKS A;  1ZXT A;  2R93 G;  2PO4 A;  1EYD A;  1BCP C;  3DLL A;  4LF8 L;  3OMC A;  4LF5 L;  5FO7 B;  3CCR A;  3S14 H;  4AYB E;  2R7Z G;  4X65 L;  2WAC A;  1AW7 A;  1CHQ D;  1DCZ A;  1I4H A;  1TWF B;  1WOC A;  3MA2 B;  1SRU A;  2JA6 B;  5J22 A;  4X3T A;  1Y8P B;  1EY4 A;  2Q2H A;  3U58 A;  2UUB Q;  1LTI D;  4ID6 A;  5M5W H;  4KHP Q;  2OQK A;  3ITP A;  3CKI B;  1BKB A;  2LXK A;  4A3M H;  3PGZ A;  1A63 A;  4C3I G;  4RKB A;  2BE5 D;  3HKZ G;  2ICI A;  1WTV A;  3CU7 A;  1ESR A;  4UP9 A;  4TSS A;  5JVH 3;  4DAM A;  5NUC A;  1F2Z A;  3KFU A;  1OXX K;  5DNF A;  1B50 A;  4F8M A;  3Q8D A;  4C3J G;  3KBG A;  3HZX A;  3CME A;  4A3K G;  3T1Y Q;  2WAQ B;  2N3S A;  3K7A H;  1SBB B;  4HJ7 A;  1B9M A;  4WFN 3;  1HTL D;  1YI2 A;  4IPD A;  4BBR H;  3U9O A;  4O42 A;  3HOW H;  4UP8 A;  5D65 A;  3MFG A;  2K50 A;  4DUY Q;  2LKV A;  2B2T A;  4DV7 Q;  2JYO A;  2UUC L;  4IUU A;  1WFQ A;  1VQB A;  1YIT A;  2QA4 A;  4RWS C;  2ALY B;  5BN4 A;  1STN A;  5IYB G;  1XMQ L;  1MBY A;  1TWH B;  1KDB A;  4DAV A;  3CPW A;  1MI2 A;  2RQX A;  4CDD C;  4DNT B;  2KED A;  2OWO A;  2FIN B;  3J80 c;  4MZ9 A;  3GP7 A;  3MC0 B;  4JBM A;  1JB3 A;  4GNX B;  4JK1 C;  4A93 G;  3P75 A;  3D4R A;  2IHE A;  5JPN C;  2A5H A;  4YHH Q;  3IKJ A;  4HSP A;  1HXY D;  4AYB B;  4ZQ3 A;  1IXR A;  3FKI B;  4OWX B;  3W2D A;  4G7Z C;  1II3 A;  4U68 A;  2A6E D;  2F0Q A;  4J15 A;  1I6H H;  2K5Q A;  1DOM A;  4QF4 A;  2EY2 A;  4GOP C;  2K1B A;  3TRZ A;  4KHV A;  4R4Q A;  1RTN A;  1E0B A;  4AQY Q;  1QNK A;  4QMG A;  2R7D A;  2C5C A;  4LFC Q;  4B9W A;  2RA4 A;  3NEN A;  4LF7 L;  2K6A A;  4Q0F A;  1B4O A;  2CWP A;  2JXM B;  4A3I G;  2R61 A;  3FEW X;  4N8X 1;  4A3D B;  4JG2 A;  4KN4 C;  3OPO A;  4ZCK A;  3P1H A;  5CBA E;  1WTH A;  4QY7 A;  3U4Z A;  5ISR A;  5IT9 L;  1RIP A;  4C3H H;  1IBL Q;  3CC7 A;  2MPM A;  4JI5 L;  3ZYY X;  2OTJ A;  5M5X B;  1N36 L;  1M1K C;  5T1G A;  1SMY C;  2QF7 A;  4A4I A;  4CHT B;  2ASB A;  3GTJ B;  1F9Q A;  3K80 C;  3P20 A;  4BWG B;  2TMP A;  3OIQ A;  5EQ0 A;  1UUP A;  1XTD A;  3CC2 A;  1N8R C;  1GUG A;  4X66 Q;  3J7A F;  1I4X A;  1WCM H;  1W2B A;  1BBW A;  3H0G H;  3RLF A;  1SEB D;  2EYL A;  2UXB Q;  4QUF A;  3Q24 A;  2KEE A;  2UUA L;  2A6H D;  5KYL A;  4HMJ A;  3J80 L;  1WTX A;  3RZD H;  4YY3 Q;  3PO2 G;  1W6K A;  3E0J A;  4JBJ A;  1YNX A;  1H95 A;  1HA6 A;  1EQT A;  2AMC B;  4K5W A;  3I91 A;  5COY A;  5EPL A;  1KLG D;  1X3F A;  3QJY A;  1A6X A;  1DYQ A;  2F0O A;  1EYG A;  2HDL A;  3FPP A;  1O7Y A;  4CBV A;  1B3Q A;  5IWA Q;  2B2U A;  1I94 L;  1CZW A;  4A3F H;  3W5O A;  5BN5 A;  1A3U A;  4K0K Q;  1CKN A;  1VMP A;  3A8J E;  2JA7 B;  3S1Q B;  2E2J B;  1HUN A;  1HPC A;  4MHE A;  4PMC A;  2ES2 A;  1HH2 P;  3EA6 A;  3PSI A;  3T1H L;  1Y1W B;  3A54 A;  3HOX H;  1PDQ A;  1U4R A;  2R92 G;  1KRS A;  2OQ0 A;  1Y1V H;  4RFB A;  2UXB L;  3BYT B;  2G5D A;  3RLN A;  4K5X A;  2NZH A;  4LFA Q;  1YIJ A;  5J1Z A;  1LYL A;  5IGE A;  1GXD C;  2I5L X;  3CHB D;  5FLM G;  1NE3 A;  1YBY A;  5FJ8 H;  2KJX A;  4JOI C;  1PH3 A;  5E3F A;  1QJO A;  3CCQ A;  1R9T H;  2ZXP A;  3HEJ A;  5IT9 c;  2NB0 A;  4DR2 Q;  3SXH A;  1G51 A;  2AUK A;  1PFM A;  4CJ2 C;  1BXT A;  5FOB B;  3S2H B;  3E0E A;  2D9U A;  1IYU A;  1JOK A;  4JI6 L;  2CCZ A;  1TQO A;  5DM6 3;  1HJP A;  1SE3 A;  1QNU A;  1Y8O B;  5IYD H;  1Z7T A;  3SVM A;  3FMC A;  3J81 E;  3IL8 A;  1X3P A;  1YHQ A;  1IBK Q;  2JA7 H;  4KD3 A;  3SK6 A;  2AWN A;  2J0T D;  4IOC A;  2F4V L;  2JA9 A;  3OTO L;  5D3I B;  3V2T A;  3UDI A;  1AEX A;  2YV5 A;  3CCU A;  4BY7 G;  3I90 A;  2Z6K C;  3GO5 A;  1P8L A;  2K04 A;  2Q8I B;  2DY8 A;  3HOX B;  2IX1 A;  1WJJ A;  3ULP A;  3MVV A;  2KUM A;  2LSS A;  3STB D;  2N78 A;  2E2I H;  4L5S A;  1SYF A;  3UE1 A;  1JE4 A;  1VQ8 A;  5J3B A;  2CFM A;  3TSS A;  4DV5 Q;  1GJX A;  1JC7 A;  5EBC A;  1PA6 A;  4S3S A;  4IUQ A;  1G2T A;  1L1O C;  3CQZ B;  3OWF A;  2WB1 B;  4KLK A;  2F3W A;  4QB4 A;  1Z47 A;  5G3L D;  1ET9 A;  4FVM A;  4DR3 L;  1NNX A;  4JPB W;  4X66 L;  1HCZ A;  3NE5 B;  1KDA A;  5C4X G;  4ABN A;  1C4Q A;  1P16 A;  5GAE C;  3MEH A;  5IT9 E;  1T5E A;  3QB3 A;  1EIH A;  2NBF A;  1UEA B;  3HP3 A;  3GTO B;  1EYA A;  3J81 i;  3PIO A;  1J9O A;  1F77 A;  2E76 C;  3PV0 A;  1PLF A;  3NQT A;  4J6H A;  2M2L A;  1KXL A;  3BDL A;  3PO3 G;  3GTG B;  5GQO A;  1CQF A;  2KBN A;  5DLQ E;  4HSV A;  2VUM G;  1X3Q A;  1A8V A;  1JCK B;  4DKA C;  1XJV A;  3HOV B;  1B7Y B;  5J39 A;  4GS3 A;  2M00 A;  1PH4 A;  5A2Q L;  5JJK A;  5M3M G;  1EFW A;  3TN2 A;  2ID0 A;  1KLU D;  3ER0 A;  1SNC A;  4I7Z C;  4PZ6 A;  4DNI A;  3Q0A A;  5C44 H;  5CV7 A;  1HZB A;  3NWS A;  1SN8 A;  3O13 A;  2XRS D;  4H44 C;  2A6E C;  4B3T L;  2HQL A;  3S15 H;  4NXN Q;  3D6C A;  4NP5 A;  3HKZ E;  4LF9 Q;  4DR3 Q;  1VDZ A;  4F7X A;  2UUB L;  3HOU G;  1YJW A;  4A3G H;  2ICE C;  1ONL A;  2I07 B;  5I6W A;  5M5Y H;  2EYJ A;  4YHH L;  5M3F G;  1IW7 C;  1A3T A;  5C0X H;  3S17 H;  4X3K A;  2Y0S E;  5AJ3 Q;  4KN7 C;  1Q7Y C;  1E2Z A;  2B63 H;  1LTB D;  3BJU A;  3GD7 A;  1SYG A;  2ENB A;  2PW5 A;  5I2X A;  3IFD A;  1SNP A;  2IL8 A;  4LF4 L;  1F2L A;  4GKK Q;  1VF5 C;  1FYC A;  3K0X A;  1BCP B;  3CCJ A;  3TZD A;  4UDU C;  2FXQ A;  1SR3 A;  1WTQ A;  1NUC A;  2JE6 I;  2JA8 G;  3HFZ B;  1D8L A;  5LMN Q;  2EQS A;  3I72 A;  2F0T A;  4TQU S;  2Z8L A;  4MTK A;  2JA5 G;  3WDN A;  2B29 A;  1S5F D;  1TS4 A;  2IHF A;  2X6L A;  4R8I A;  1RTO A;  3OMG A;  4A3J B;  3HOZ G;  2D62 A;  2RDH A;  2UUC Q;  3ERS X;  1GO3 E;  4V0B A;  4A3E B;  3PUV A;  4HIO A;  2K5W A;  3S15 B;  4JYA L;  5JAV A;  2QCP X;  4OIJ A;  3BYY B;  4NB3 A;  1N36 Q;  2OCE A;  2B8F A;  2NZO A;  2HUG A;  3RZO H;  1FVI A;  2ZTC A;  4DR4 L;  5JJZ A;  4GN5 A;  1QE6 A;  1EU4 A;  1VQ5 A;  4G7O C;  2QGQ A;  5CR3 A;  3KLR A;  2G9H D;  1HFG A;  4DAY B;  4OX9 L;  1DXM A;  3BU2 A;  3K81 C;  4PQX A;  2NVT H;  1ZYR D;  5IP7 G;  4XT3 B;  2Z9H A;  3S1M B;  3H09 A;  4IZ8 A;  4L63 B;  1S5B D;  2UXC L;  1B3A A;  2R93 H;  1SAP A;  3QR8 A;  1GUS A;  4FP5 D;  2K01 A;  2PNH A;  1HUM A;  2F0E A;  2E2D C;  3MEF A;  2JJQ A;  1N34 Q;  5FO8 B;  4POF A;  1LT4 D;  1PZI D;  3I4M G;  1QVC A;  1M8A A;  1SMY D;  1D2B A;  1S5E D;  1XX8 A;  1STG A;  4LF7 Q;  1YJN A;  2K7V A;  4ZYS A;  5BR8 L;  5IYC H;  4B3T Q;  2YTX A;  4XDX A;  1Y8N B;  4C3I H;  5KRU A;  3ICE A;  3J7A V;  1KAA A;  2JP1 A;  2XVS A;  4DK3 C;  2AQ2 B;  3VA5 A;  1VQK A;  4I65 A;  5C3E G;  4HIK A;  1LT3 D;  4DR5 Q;  1GHK A;  4H13 C;  5GRO A;  2VQE Q;  1YNN D;  4IQZ A;  4DV1 Q;  4C3J H;  3J81 c;  4WJ4 A;  2Q8R E;  3F1Z A;  1XPU A;  4CJ0 B;  1SLJ A;  4NXM L;  1I3Q B;  2F0G A;  2KEC A;  4EX5 A;  1EY0 A;  2I5M X;  5E7N A;  4LF9 L;  1Q86 C;  3PUY A;  3V96 A;  5CBE E;  1PFN A;  3ONA B;  4IFD G;  1SXT A;  5M5W B;  4QJF A;  5GAH C;  5CMD A;  1XMO Q;  2A69 D;  3I55 A;  5C4Z A;  1MD2 D;  1V8Q A;  3EVQ A;  5C5M A;  4KHZ A;  2R93 B;  4RA8 A;  4L5T A;  4LUV A;  3OIP A;  1V1P B;  2K5D A;  5TSS A;  1R9T B;  4C1N I;  2R7Z B;  1LTL A;  1PRT F;  3SR1 A;  1Q82 C;  3ULL A;  4ME5 A;  3RMH A;  1YVC A;  1AN8 A;  4GOP B;  3NBI A;  1N33 L;  1O7I A;  2JA6 G;  1ILP A;  4IPH A;  2XNA C;  2A69 C;  1N32 L;  1KRT A;  3D6W A;  5H1S E;  1V1P A;  4YIJ A;  4H0L C;  3AEV A;  3VYS A;  1WI5 A;  4BBR B;  1TWC H;  5JEA G;  4G57 A;  4TVA B;  3NTK A;  3EJI A;  1YHA A;  3HOW B;  1PXU A;  1Z9F A;  1TS3 A;  2ZJP A;  3RR5 A;  5FO9 B;  4LFB L;  2RCF A;  2EY5 A;  2F3V A;  1I4P A;  1O78 A;  4DAY A;  3A7L A;  5BR8 Q;  3G48 A;  2IJ0 A;  2L15 A;  4WRD A;  1K0R A;  2RF4 A;  4FNF A;  4C3J B;  4YCW A;  4JW0 A;  1YNJ D;  3QG1 A;  1GM5 A;  4FF4 A;  4LUO A;  2A74 C;  2WAQ G;  2F03 A;  5K36 H;  1JOR A;  1JB7 A;  2Z6B A;  1QB5 D;  1HRJ A;  4OEM B;  1WD1 A;  5CV8 A;  4R4O A;  5IGC A;  1EOT A;  5FK9 C;  2Q8T A;  2VZA A;  2HD3 A;  1PRT C;  1F9S A;  1PVO A;  1X32 A;  2UU9 L;  3OW7 A;  4LW1 A;  4LJZ C;  4G7H C;  2O5J C;  1K9M C;  3F2D A;  3GTL B;  2L1B A;  3FKI H;  1Q81 C;  4LMQ D;  5ELF A;  3I70 A;  3AU7 A;  4DR1 L;  3FRP B;  3I73 A;  3JAM i;  1QUQ B;  1U9R A;  3SHL A;  1G6P A;  3BVM A;  1B44 D;  3K8A A;  1IHZ A;  2FMM A;  5KEE A;  3HRZ C;  3K6O A;  3AMU A;  2MGS A;  2RHQ B;  1CKN B;  1WTW A;  2M9V A;  2OXP A;  5IWA L;  1YHB A;  4MN3 A;  4DK1 A;  1LTR D;  1EEF D;  1E2V A;  3H3V C;  2LMC B;  1Q12 A;  4P71 A;  4AYB G;  2NVY H;  4DUY L;  4F87 A;  4FYD A;  1I5F A;  4UPA A;  1IW7 D;  4BA1 I;  5C3W A;  4XQJ A;  3G4S A;  1CA6 A;  1E3P A;  4C3H B;  2IW3 A;  3S24 A;  1JJG A;  2YU9 B;  2Z0S A;  3TP5 A;  2WKC A;  1Y69 U;  5D3D A;  3TS2 A;  1SE8 A;  3H3V H;  1TY2 A;  1IKL A;  2KHI A;  3CP0 A;  3L7Z C;  4KJO A;  4HCE A;  4A3G B;  2E2H H;  1BO0 A;  4A3I B;  5M5Y B;  2MQH A;  4Q5V A;  4A3D G;  3KOJ A;  3GTQ H;  4GKJ L;  4TKO B;  1HNW L;  5DEH A;  4DU9 A;  2CWA A;  1HR0 L;  1TWG B;  2LXJ A;  4A3F G;  1J5E Q;  4PZ8 A;  1XMO L;  4A3B H;  1A15 A;  1PFS A;  1CQV A;  1UNS A;  3KF8 A;  4IFD I;  2NN6 I;  4XQQ A;  1V43 A;  4H7B A;  2XGT A;  3RZD B;  3K58 A;  1G29 1;  3MZ5 A;  1WTO A;  1PH7 A;  5EKL A;  4JV5 Q;  1KIX A;  2XTI A;  4HJ9 A;  5C0X I;  4DR6 L;  3CAM A;  1X55 A;  1D1K A;  2NVY B;  3UDF A;  3CRL C;  4GLV B;  4XIG S;  2FFK B;  3A0J A;  4M1U B;  4L6T B;  1EY9 A;  3I3C A;  1BNZ A;  3J80 E;  1KNA A;  4HAE A;  4N9T A;  2A6H C;  5CV6 A;  2JSO A;  1NAP A;  2E5L Q;  3GV3 A;  2MFI A;  1SRO A;  4IUT A;  2I46 A;  4LNQ A;  2D0P A;  3DM1 A;  2YU9 H;  1HQR D;  4KI0 A;  3FDT A;  2FHT A;  2AUJ D;  3DWA A;  4X6A H;  1EIG A;  2EJM A;  2MO1 A;  1BVS A;  1CUK A;  2E8G A;  1CZG A;  3JC6 6;  3NTI A;  4LF6 L;  4QCL A;  4JI7 Q;  1CFM A;  1Y1V B;  5LMU L;  1BBU A;  3F2C A;  4B3M Q;  4GOP A;  3MTS A;  2VQF L;  1HNZ L;  1VS0 A;  3NWT A;  1TWG H;  3HOY G;  2NVX H;  2Z4H A;  2EYO A;  4IAL A;  1NCV A;  4C2M B;  5EJW A;  5CGK A;  1XPO A;  4KK7 A;  2KHS A;  4DV6 L;  4I7A A;  3JAM L;  3S1N B;  2B2V C;  2JA7 G;  3RN2 A;  2NTS A;  3CPF A;  5LL6 S;  2NN6 G;  2QDL A;  1HNW Q;  1CKM A;  2A8V A;  1B2T A;  2HIX A;  1Y1W G;  3J80 i;  1NR4 A;  4X64 L;  1M90 C;  4POG A;  4R1J A;  3VR5 A;  1DD2 A;  1MJC A;  2X69 A;  4CKB A;  5C5L A;  2R92 B;  2RVL A;  1A2U A;  3EN2 A;  2JN4 A;  1HQM C;  4JBK A;  1I94 Q;  2N55 A;  1AFP A;  4E6I A;  2IX0 A;  1FGB D;  3D3R A;  3H6M A;  4AQY L;  3LWU A;  4UHV A;  1K3B C;  5AFW A;  1K28 A;  2RSO A;  3K0Y A;  4K8I A;  3S9W A;  1ENC A;  1W3S A;  4LF8 Q;  4Y52 H;  1VF7 A;  2VY3 A;  1A2T A;  3TRE A;  2WV6 D;  3AB9 A;  5C4J B;  1KD1 C;  4BXX H;  2F0P A;  1W6J A;  1XYI A;  2KQ3 A;  2PMZ B;  1QZH A;  5IP9 G;  4JYA Q;  4JI7 L;  2SNS A;  3S16 B;  5LMU Q;  2A1A A;  2QIL A;  1S5D D;  2WIN B;  1HNZ Q;  5COR A;  3PIP A;  4BBS B;  4IUR A;  1PH8 A;  5GAD C;  1AE3 A;  3HGB A;  4DV1 L;  4CDE C;  1WVL A;  2NVQ B;  3KBX A;  1T9H A;  3CCM A;  1VQ4 A;  3SGI A;  1FJG L;  1M4V A;  2AHO B;  4KMU C;  4OO1 H;  3PMF A;  3RLO A;  3I4O A;  1O80 A;  5I2Y A;  3DMU A;  3KDF A;  5M3M H;  2PYK A;  4JI0 Q;  3TEH B;  3BS1 A;  2BA0 A;  5C44 G;  4BY1 B;  1K73 C;  1SNQ A;  1U4P A;  2OF1 A;  1DGS A;  5DAU A;  2AWO A;  3H15 A;  1LV9 A;  3F2B A;  2EZV A;  4K5V A;  3BZD B;  4A3M G;  5KNB A;  2WB1 G;  3X3N A;  2SNM A;  1PV4 A;  3I7F A;  1VQE A;  3HOU H;  2BOS A;  1TR5 A;  3LNN A;  1QZG A;  3WOE A;  2XIW A;  1PRT D;  5C4X B;  1J8I A;  5M3F H;  4BA2 I;  3PQI A;  4RH6 A;  2ATW A;  2GN5 A;  2TSS A;  1IYJ B;  4MNO A;  1BOS A;  4BBS H;  4DV7 L;  3KDF B;  1QVG A;  1SYE A;  3PO3 B;  2EYP A;  1DOK A;  4JI8 Q;  4K2K A;  2WII B;  4BS9 A;  2JQO A;  2VS1 A;  2BDN A;  1QWY A;  3HOV G;  1MSH A;  1I4G A;  2ZXR A;  1MJE A;  3T51 B;  3D31 A;  1JMC A;  1FGU A;  5ELN A;  4Z9C B;  5M3M B;  4IPG A;  3VYR A;  4DR7 L;  3VYU A;  4DFA A;  1SFO B;  4P2C B;  5KND A;  3H3V I;  1BUV T;  1QCB D;  1TU2 B;  1NTG A;  4DR2 L;  3GTP H;  3K5O A;  1EWC A;  1VQI A;  3F8T A;  4BY1 H;  2BA1 A;  3TZU A;  3NHH A;  1FNW A;  2K75 A;  3KYH C;  3RN5 A;  2K14 A;  2EPB A;  1OO9 B;  1LLR D;  1KQS A;  2F0N A;  2DJG C;  2IY5 B;  1CTM A;  2Z1C A;  3VR6 A;  5IOD A;  2R7F A;  3HOU B;  1EY5 A;  2IT1 A;  1KL9 A;  3R2T A;  1OXS C;  3ND8 A;  2IX3 A;  3OTO Q;  5M3F B;  3I8Z A;  5CC4 A;  1PTO D;  5C6A A;  2R3Z A;  1RD9 D;  3M4Y A;  2L4N A;  4JVZ A;  1B70 B;  1ML0 D;  1TXY A;  2EYH A;  1G8Z D;  4JI8 L;  1WTP A;  4IUV A;  2NYZ D;  2VQE L;  4FXK C;  2EYF A;  4HN7 A;  1BF4 A;  3QWN A;  4EQO A;  2V4D A;  1VQP A;  2B2W C;  1H9S A;  2WFW A;  1HTP A;  2KCM A;  2V1C C;  4QL5 A;  2JA8 B;  3A74 A;  2QEJ C;  4K6D A;  1PH1 A;  1ASY A;  4RGM A;  1PH6 A;  1JOO A;  3CW2 C;  1L0W A;  5T1I A;  4EVO A;  3T53 B;  4CJ1 B;  1SFO H;  4KTA A;  4NKL A;  5JJI A;  4A3J G;  1GHJ A;  1K8G A;  5JVG 3;  2NVT B;  3X3M A;  1WTR A;  4EQ5 A;  3BDC A;  2B3G A;  2EE1 A;  2PQA B;  4QIW E;  1E2W A;  2BH2 A;  4A3E G;  4B3S Q;  2Q2U A;  3NSW A;  2EDG A;  3W1B A;  2RBM A;  3OSO A;  1V1O A;  4JI4 L;  4K14 A;  1SYB A;  1LTG D;  2FJ2 A;  3E6Z X;  2K05 A;  5IGB A;  2RKS A;  4KY5 A;  3STB C;  5C3E H;  4DV3 L;  2OEO A;  1YZ6 A;  2H4O A;  2NZ1 D;  4AH6 A;  4ALP A;  1U4M A;  4G4K A;  4PMB A;  2F0K A;  4DN4 M;  2O4X A;  3CMA A;  1BQQ T;  1SNO A;  2KCN A;  1CI3 M;  1U5K A;  4IFD H;  2I0Q A;  5ELB A;  2YTV A;  4P72 A;  2A19 A;  3T1H Q;  4LF6 Q;  3ERQ A;  1SDF A;  3TS0 A;  2HIV A;  4DV4 L;  4OWT B;  4LUZ A;  4RGT A;  3S14 B;  3K7U C;  4RGN A;  1RHP A;  4R4C A;  4IFD J;  3FHW A;  4LFA L;  2C9O A;  1XTC D;  4H02 A;  2DY7 A;  3TP7 A;  1WCM B;  1HZA A;  2KCC A;  2CVR A;  3C1E A;  4F88 A;  1LTS D;  3DHQ A;  1LT5 D;  3DXJ C;  3CRK C;  1FR3 A;  3S1R H;  2F52 A;  4JI2 L;  3WWV A;  1TS2 A;  4C2M H;  3A55 A;  1LUZ A;  1JR0 D;  4KHP L;  5AJ3 L;  3D0F A;  2CHB D;  1OXT A;  2H1E A;  3MHB A;  2HQE A;  1MSG A;  2EJF C;  3MXP A;  3I4N G;  2PZW A;  1EIF A;  3DEO A;  1SJH D;  5C3E B;  1I4Q A;  2KVM A;  1IL2 A;  2K52 A;  2B8G A;  1XPR A;  4JI6 Q;  4DF7 A;  1OXU A;  1L0Y B;  3CCL A;  1JWS D;  4P74 A;  4R8N A;  2DN8 A;  3RUZ A;  5JOB A;  3HKS A;  5D14 A;  5EKI A;  4RMF A;  1VQM A;  1FNV A;  4X65 Q;  1X65 A;  4GKK L;  1TWC B;  3MXG A;  1XMQ Q;  1JJ2 A;  5FLM H;  1JE5 A;  3KJP A;  1MGS A;  2BE5 C;  1VQ9 A;  4OWW B;  5JPM C;  2P5Z X;  4WJW A;  1R4Q B;  4DK0 A;  3QIA A;  3A5U A;  3S16 H;  5KIX A;  1DZ1 A;  1UEB A;  5IGD A;  4DUZ L;  1ENA A;  1X3G A;  4PV1 C;  1X54 A;  1EIY B;  2B2Y A;  1KHI A;  3MWY W;  1C8C A;  5G3L F;  4A3K H;  4RGO S;  1GUO A;  2NVQ H;  3T13 A;  3A8K E;  5IYD G;  2EVB A;  4J1M A;  4B3S L;  2DNC A;  2RSN A;  3J7A 5;  1L1O A;  4BBR G;  4GLX A;  3EFX D;  3J7Y W;  1LO5 D;  3LX0 A;  1A3V A;  3HOW G;  1RL2 A;  2AQ1 B;  1FJG Q;  2K5H A;  3GTL H;  4DV3 Q;  2N8N A;  3J81 j;  2F0I A;  1D6E C;  5C4H A;  3ND9 A;  1VQA A;  2B2W A;  3NBH B;  3UDG A;  2GVA A;  3KLS A;  4DXF A;  1I6H B;  2Z6K A;  3WOF A;  1K8M A;  1UWV A;  1V9P A;  4FXG C;  1VQJ A;  1U4L A;  3VA7 A;  4JI3 Q;  2WP8 J;  3R93 A;  2UXD Q;  1S4Z A;  1B9N A;  3CC4 A;  2F0M A;  1F2Y A;  4IPC A;  2ZJR A;  1D1I A;  1FD7 D;  3KF8 B;  2YTY A;  3MXN A;  2HHH L;  4NDX A;  1YNN C;  2CH4 W;  2VL6 A;  2MHV A;  1EZ6 A;  2F0H A;  2F0F A;  3TP8 A;  4A3C H;  2A68 C;  1Q8I A;  3QOJ A;  3IAY A;  4ZKB B;  5IGF A;  2VNU D;  3IRB A;  1HR0 W;  2EYM A;  1ENF A;  4NXN L;  3R2I A;  5C3X A;  1VCI A;  4DV5 L;  2E2I B;  3VR4 A;  1SND A;  4JOI A;  4DAP A;  2XRQ D;  3A7A B;  4N8F A;  4NXM Q;  3PF5 A;  4JI2 Q;  2YYZ A;  4EGV A;  2F0V A;  1XXG A;  2PQA A;  1GKH A;  1BR9 A;  4YWL A;  1L0X B;  2CQA A;  3SE0 A;  3V05 A;  1H9J A;  1CSP A;  4C1N K;  4HJA A;  1Q90 A;  4NW2 A;  4HIM A;  4ZUJ A;  1S3O A;  1XNQ L;  3GTQ B;  1G6Z A;  5EPK A;  4RHR A;  1QIL A;  3GTP B;  4B08 A;  4GLA C;  2CH4 A;  3MXN B;  4C3H G;  1VQ7 A;  3AFQ A;  3MFY A;  3Q22 A;  4A3B B;  1I50 H;  2B39 A;  2KOL A;  4JI0 L;  3TBI B;  1O7Z A;  3H94 A;  1RCV D;  2K32 A;  5LMN W;  4A3L G;  1IL8 A;  3R3O A;  5HUR A;  1AZP A;  3VDY A;  5CYU A;  4LFC L;  5E1F A;  4A3G G;  3KJO A;  2B2Y C;  2Y0S G;  3SEB A;  4GN3 B;  5ELD A;  1LAC A;  1DM0 B;  5C0X G;  3KUP A;  1VQ6 A;  1ESF A;  2HHH Q;  2F3I A;  1F9P A;  3EBE A;  3H0G G;  5E4X A;  4A3F B;  3VR3 A;  3HOY H;  2F0W A;  2DJF C;  4KJN A;  5IGG A;  1STE A;  1S5C D;  1ILQ A;  4QGU A;  3S1Q H;  3M3Y B;  2E2J H;  1Q8K A;  3PO2 H;  2NN6 H;  5FLX E;  3CCS A;  1ET6 A;  1VQF A;  2XWJ B;  3W3A A;  5ELE A;  4X3S A;  1PYB A;  3T4A C;  4WOR A;  3SK4 A;  3MAQ A; 
#chains in the Genus database with same CATH homology
 2E74 C;  1ICW A;  4ZUI A;  3VYT A;  4ZLT F;  1EY7 A;  4EQN A;  3EQL C;  4V19 0;  1PFB A;  1STY A;  1I50 B;  4K2L A;  2B63 B;  2KA7 A;  2L11 A;  2LFN A;  4FF3 A;  3URY A;  2K28 A;  4X3U A;  2DNE A;  3T56 B;  4NMZ A;  2A73 B;  3QO2 A;  2IPK D;  1ZEQ X;  4J8Q A;  1ZYR C;  3HOY B;  4OGQ C;  1H9M A;  2JEB I;  3DEP A;  1KDC A;  2K33 A;  1CT1 D;  4CKE A;  3C46 A;  5C0X J;  3FPU B;  4HR7 B;  1RJT A;  5EPJ A;  3N52 A;  4XTC S;  4C56 C;  3K5L A;  2B2V A;  1BDO A;  3J81 L;  4HTH A;  4PNY A;  4XYQ A;  1EYC A;  1TT2 A;  1IKM A;  3A56 A;  1H9K A;  1SE4 A;  1PZK D;  5EBD A;  2K03 A;  1T5X D;  5I4D A;  3NPP A;  3K5M A;  1KTK A;  2VXW A;  3G7L A;  1WD0 A;  2Z4I A;  4TRD A;  4KD4 A;  3TME A;  2GA4 B;  5CV4 A;  3M85 A;  3G6J B;  1Q1E A;  5K5P A;  4C3I B;  3HKZ B;  1STB A;  3BG3 A;  1EWH A;  1D5Z C;  3SK8 A;  1Q3L A;  4IN3 A;  1K8O A;  3DUZ A;  2XN9 C;  3DWQ A;  2SOB A;  1EFI D;  4OL7 A;  5LL6 X;  2WKD A;  4FF2 A;  3FVQ A;  4R9W A;  3N6R A;  3KLS X;  5KNC A;  5C44 B;  3PUZ A;  5HGT A;  5KYI A;  2NTT A;  4A3K B;  1PTO B;  2ZXO A;  2D2C C;  1NSN S;  2PPB C;  2LY7 A;  3U9S A;  4CKC A;  2NUC A;  4A3M B;  2F0S A;  3T16 A;  5A2Q E;  2O5I C;  3A8I E;  2O2L D;  2B2U C;  2BDO A;  4KKU A;  1EY6 A;  3C2P A;  4RCN A;  1B53 A;  1TS5 A;  2IWH A;  3S17 B;  4RKL A;  4XQN A;  1TVX A;  1HHV A;  2BCO A;  2RDG A;  3K5N A;  4DGZ A;  4OHJ A;  4LK1 C;  2F0L A;  3PUX A;  2F1M A;  4IUP A;  1O7L A;  3NTH A;  4M8A A;  4A93 B;  3H91 A;  1SYC A;  2N88 A;  4B9X A;  1EQV A;  1XWE A;  1D5X C;  1H9S B;  3UI2 A;  1G2S A;  3VR2 A;  3BVZ A;  4LAA A;  1EU3 A;  3MXU A;  2SDF A;  4IUN A;  5LHY 1;  2QKI C;  1I4R A;  3LWE A;  1FNU A;  3RZO B;  3M7N A;  3S2D B;  1JWU D;  1JIC A;  3OWE B;  1SE2 A;  1G91 A;  1SNM A;  5CV5 A;  4JBW A;  1F2M A;  1PZJ D;  1STH A;  1DJR D;  2F0J A;  3NXW A;  1TY0 A;  2A68 D;  2XSC A;  5E4W C;  1KAB A;  3JAM E;  2EJG C;  2PZT A;  5EKK A;  5IIF A;  2J7Z A;  2MJ8 A;  3M4O B;  1F9R A;  2PCF B;  1HFN A;  5I6Y A;  2LS0 1;  1BBX C;  3F2U A;  3OHX C;  3PO2 B;  3NP8 A;  3NK9 A;  4FF1 A;  2PZU A;  1PMR A;  3IFT A;  1I6V C;  4FO2 A;  3L3O C;  4DA2 A;  2E2H B;  2J4X A;  4QIW B;  2MP1 A;  2B2T C;  1BCP D;  2CW0 C;  1QG7 A;  3BVG A;  1RF2 D;  2D5D A;  3R8B A;  4PMW A;  1QOH A;  3S1R B;  1SSO A;  3Q23 A;  3KK7 A;  3C3L A;  3D4D A;  1AP0 A;  4K8J A;  4EQP A;  2OT2 A;  3GTK B;  4U67 3;  2L9H A;  1STA A;  2G9D A;  1B1Z A;  1R4P B;  3NBH A;  1TKW B;  1TII D;  1PYW D;  1SJE D;  1D5M C;  3D4W A;  4CGY B;  2MUY A;  3I4N B;  4Y7N B;  3GQB A;  5JEA J;  1UAP A;  4ILW A;  3HS0 C;  5BN3 A;  2L55 A;  2HCC A;  2XWB B;  4RAU C;  1JWM D;  2NVX B;  1C48 A;  4ZKC B;  1Z6H A;  1ZKO A;  2X6G A;  2F0U A;  2PNR C;  5JEA H;  3P7J A;  3NQI A;  4O1N A;  1GOZ A;  3PIP 3;  4BY7 B;  1EZ8 A;  4UAI A;  4ZK9 B;  2L12 A;  1GUW A;  4ZAI A;  5KGU A;  1Q1B A;  1RDP D;  5K36 G;  3K57 A;  1RKN A;  3E5S A;  3GTM B;  5F2D A;  2EXZ A;  4OO1 G;  2L5T A;  2SEB D;  4N9P A;  4RHS A;  4HCS A;  4L8J A;  1LAB A;  2HCI A;  2JEA I;  4K6L A;  1PTO H;  4QUC A;  4DXG A;  4RCO A;  1PTO F;  4ODG A;  1CM9 A;  2VUM B;  4OO1 I;  1GUT A;  3TP6 A;  1IYV A;  5M9O A;  2E75 C;  1PTO C;  4XYO A;  1JQY D;  1VMC A;  1LTA D;  4HED A;  3L9A X;  2HDM A;  3SK5 A;  2F4I A;  2FMC A;  2CW0 D;  4OIK A;  5DM7 3;  5IOC A;  3BDO A;  1CK1 A;  1H9R A;  2EOT A;  1DOL A;  5FLX L;  3NUC A;  5EGT A;  3TDQ A;  1EY8 A;  2AQ3 B;  4DNR B;  2ZT9 C;  1LT6 D;  4MIU A;  2Y0S B;  2JA5 B;  3C1F A;  2PW7 A;  5ELC A;  5CV9 A;  3HOZ B;  3H0G B;  1LTT D;  4ZRZ A;  3K59 A;  1OXV A;  2QDB A;  3DWP A;  5I9O A;  1PRT B;  5FKA C;  3QOL A;  3Q6S A;  3GV6 A;  4HMI A;  1AZQ A;  3ERO A;  4ULL A;  4FXD A;  2PQE A;  1CA5 A;  3OOC A;  3D8G A;  2VB3 X;  1NR2 A;  1EL0 A;  3PIO 3;  4KV6 A;  1TWA B;  4KY6 A;  2NWG A;  3I4L A;  3I4M B;  1HA5 A;  1ROD A;  1K83 B;  2EY1 A;  2R6G A;  2RDF A;  4GZY C;  3PUW A;  3RD4 A;  2L0C A;  1EEI D;  1CHP D;  1SYD A;  3HG9 A;  4KY7 A;  3M7G A;  4XXE A;  1KNE A;  2EY6 A;  1DON A;  4KKT A;  1BCP F;  5A35 A;  1GUN A;  4XT1 B;  3K7A B;  2VB2 X;  2F0D A;  1YNJ C;  3SDZ A;  1JOQ A;  5I9P A;  4KKS A;  1ZXT A;  2PO4 A;  1EYD A;  1BCP C;  3OMC A;  5FO7 B;  2WAC A;  1AW7 A;  1CHQ D;  1DCZ A;  1I4H A;  1TWF B;  3MA2 B;  2JA6 B;  5J22 A;  4X3T A;  1Y8P B;  1EY4 A;  1LTI D;  4ID6 A;  3ITP A;  3CKI B;  4C3I G;  4RKB A;  2BE5 D;  2ICI A;  1WTV A;  3CU7 A;  1ESR A;  4TSS A;  5JVH 3;  5NUC A;  1F2Z A;  1OXX K;  5DNF A;  1B50 A;  4F8M A;  4C3J G;  3KBG A;  3HZX A;  2WAQ B;  1SBB B;  1B9M A;  4WFN 3;  1HTL D;  3U9O A;  4O42 A;  5D65 A;  3MFG A;  2LKV A;  2B2T A;  2JYO A;  4IUU A;  4RWS C;  5BN4 A;  1STN A;  1MBY A;  1TWH B;  4DAV A;  1KDB A;  1MI2 A;  2RQX A;  4DNT B;  2KED A;  2FIN B;  3GP7 A;  3MC0 B;  1JB3 A;  4JK1 C;  3P75 A;  3D4R A;  5JPN C;  2A5H A;  3IKJ A;  4HSP A;  1HXY D;  4AYB B;  4ZQ3 A;  3FKI B;  3W2D A;  4G7Z C;  1II3 A;  4U68 A;  2A6E D;  2F0Q A;  2K5Q A;  1DOM A;  4QF4 A;  2EY2 A;  2K1B A;  4KHV A;  1RTN A;  1E0B A;  1QNK A;  4QMG A;  2C5C A;  4B9W A;  2RA4 A;  2K6A A;  4Q0F A;  1B4O A;  2JXM B;  2R61 A;  3FEW X;  4A3D B;  3OPO A;  4KN4 C;  5CBA E;  3P1H A;  5ISR A;  5IT9 L;  2MPM A;  3ZYY X;  5M5X B;  5T1G A;  1SMY C;  2QF7 A;  4CHT B;  3GTJ B;  1F9Q A;  3P20 A;  4BWG B;  2TMP A;  3OIQ A;  5EQ0 A;  1UUP A;  1GUG A;  3J7A F;  1I4X A;  3RLF A;  1SEB D;  2EYL A;  4QUF A;  3Q24 A;  2KEE A;  2A6H D;  5KYL A;  4HMJ A;  3J80 L;  1WTX A;  1W6K A;  3E0J A;  1HA6 A;  1EQT A;  4K5W A;  5COY A;  3I91 A;  5EPL A;  1KLG D;  3QJY A;  1A6X A;  1DYQ A;  2F0O A;  2HDL A;  3FPP A;  1O7Y A;  4CBV A;  2B2U A;  1CZW A;  5BN5 A;  1A3U A;  1VMP A;  3A8J E;  2JA7 B;  3S1Q B;  2E2J B;  1HUN A;  1HPC A;  4MHE A;  4PMC A;  3EA6 A;  1Y1W B;  3A54 A;  1PDQ A;  1U4R A;  4RFB A;  3BYT B;  4K5X A;  5J1Z A;  5IGE A;  1GXD C;  3CHB D;  2KJX A;  5E3F A;  1QJO A;  2ZXP A;  3HEJ A;  2NB0 A;  3SXH A;  2AUK A;  1PFM A;  4CJ2 C;  1BXT A;  5FOB B;  3S2H B;  2D9U A;  1IYU A;  1JOK A;  1TQO A;  5DM6 3;  1SE3 A;  1QNU A;  1Y8O B;  1Z7T A;  3SVM A;  3FMC A;  3J81 E;  3IL8 A;  1X3P A;  4KD3 A;  3SK6 A;  2AWN A;  2J0T D;  5D3I B;  3V2T A;  1AEX A;  3I90 A;  3GO5 A;  2K04 A;  2Q8I B;  2DY8 A;  3HOX B;  2IX1 A;  3MVV A;  2KUM A;  1SYF A;  1JE4 A;  3TSS A;  1GJX A;  1JC7 A;  5EBC A;  4S3S A;  4IUQ A;  1G2T A;  3CQZ B;  3OWF A;  2WB1 B;  2F3W A;  4QB4 A;  1Z47 A;  5G3L D;  1ET9 A;  4FVM A;  1HCZ A;  3NE5 B;  1KDA A;  4ABN A;  1C4Q A;  3MEH A;  5IT9 E;  1T5E A;  3QB3 A;  1EIH A;  2NBF A;  1UEA B;  3HP3 A;  3GTO B;  1EYA A;  1J9O A;  1F77 A;  2E76 C;  3PV0 A;  1PLF A;  3NQT A;  4J6H A;  2M2L A;  3BDL A;  3GTG B;  1CQF A;  4HSV A;  1X3Q A;  1JCK B;  3HOV B;  5J39 A;  2M00 A;  5A2Q L;  3TN2 A;  2ID0 A;  1KLU D;  1SNC A;  4I7Z C;  3Q0A A;  5CV7 A;  3NWS A;  3O13 A;  2XRS D;  4H44 C;  2A6E C;  3D6C A;  4NP5 A;  1VDZ A;  4F7X A;  2ICE C;  1ONL A;  2I07 B;  5I6W A;  2EYJ A;  1IW7 C;  1A3T A;  5C0X H;  4X3K A;  4KN7 C;  1E2Z A;  1LTB D;  3GD7 A;  1SYG A;  2ENB A;  2PW5 A;  5I2X A;  3IFD A;  1SNP A;  2IL8 A;  1F2L A;  1VF5 C;  1FYC A;  1BCP B;  3TZD A;  4UDU C;  1WTQ A;  1NUC A;  2JE6 I;  3I72 A;  2F0T A;  4TQU S;  2Z8L A;  3WDN A;  1S5F D;  1TS4 A;  2X6L A;  4R8I A;  1RTO A;  3OMG A;  4A3J B;  2D62 A;  2RDH A;  4V0B A;  4A3E B;  3PUV A;  2K5W A;  3S15 B;  5JAV A;  2QCP X;  4OIJ A;  3BYY B;  2B8F A;  2HUG A;  5JJZ A;  1QE6 A;  1EU4 A;  4G7O C;  5CR3 A;  3KLR A;  2G9H D;  1HFG A;  1DXM A;  4PQX A;  1ZYR D;  4XT3 B;  3S1M B;  3H09 A;  4IZ8 A;  4L63 B;  1S5B D;  1B3A A;  1SAP A;  1GUS A;  4FP5 D;  2K01 A;  1HUM A;  2F0E A;  2E2D C;  5FO8 B;  1LT4 D;  1PZI D;  1M8A A;  1SMY D;  1D2B A;  1S5E D;  1XX8 A;  1STG A;  2K7V A;  4ZYS A;  4XDX A;  1Y8N B;  5KRU A;  3J7A V;  1KAA A;  2JP1 A;  2XVS A;  2AQ2 B;  3VA5 A;  4I65 A;  1LT3 D;  1GHK A;  4H13 C;  1YNN D;  4IQZ A;  2Q8R E;  4CJ0 B;  1I3Q B;  2F0G A;  2KEC A;  1EY0 A;  3PUY A;  3V96 A;  5CBE E;  1PFN A;  3ONA B;  4IFD G;  1SXT A;  5M5W B;  5CMD A;  2A69 D;  5C4Z A;  1MD2 D;  1V8Q A;  3EVQ A;  5C5M A;  4KHZ A;  2R93 B;  4RA8 A;  3OIP A;  1V1P B;  2K5D A;  5TSS A;  1R9T B;  4C1N I;  2R7Z B;  1PRT F;  3SR1 A;  4ME5 A;  3RMH A;  1AN8 A;  3NBI A;  1ILP A;  2XNA C;  2A69 C;  3D6W A;  1V1P A;  4YIJ A;  4H0L C;  3VYS A;  4BBR B;  5JEA G;  4G57 A;  3NTK A;  3EJI A;  3HOW B;  1PXU A;  1TS3 A;  5FO9 B;  2EY5 A;  2F3V A;  1I4P A;  1O78 A;  4DAY A;  3A7L A;  2IJ0 A;  4WRD A;  4FNF A;  4C3J B;  1YNJ D;  3QG1 A;  4FF4 A;  2A74 C;  2F03 A;  5K36 H;  1JOR A;  1QB5 D;  1HRJ A;  1WD1 A;  5CV8 A;  5IGC A;  1EOT A;  5FK9 C;  2Q8T A;  1PRT C;  1F9S A;  1X32 A;  3OW7 A;  4LJZ C;  4G7H C;  2O5J C;  3GTL B;  2L1B A;  4LMQ D;  5ELF A;  3I70 A;  3AU7 A;  3FRP B;  3I73 A;  1U9R A;  3SHL A;  3BVM A;  1B44 D;  1IHZ A;  2FMM A;  5KEE A;  3HRZ C;  3K6O A;  3AMU A;  2MGS A;  1WTW A;  2M9V A;  2OXP A;  4MN3 A;  4DK1 A;  1LTR D;  1EEF D;  3H3V C;  1E2V A;  2LMC B;  1Q12 A;  4F87 A;  4FYD A;  1IW7 D;  4BA1 I;  5C3W A;  4XQJ A;  1CA6 A;  4C3H B;  2IW3 A;  2YU9 B;  3TP5 A;  2WKC A;  1Y69 U;  5D3D A;  1TY2 A;  1IKL A;  3L7Z C;  4KJO A;  4HCE A;  4A3G B;  1BO0 A;  4A3I B;  5M5Y B;  4Q5V A;  4TKO B;  5DEH A;  4DU9 A;  1TWG B;  1A15 A;  4IFD I;  1CQV A;  1UNS A;  3KF8 A;  2NN6 I;  4XQQ A;  1V43 A;  4H7B A;  3RZD B;  3K58 A;  1G29 1;  3MZ5 A;  1WTO A;  5EKL A;  5C0X I;  1D1K A;  2NVY B;  3CRL C;  4XIG S;  2FFK B;  4M1U B;  4L6T B;  1EY9 A;  3I3C A;  1BNZ A;  3J80 E;  1KNA A;  4HAE A;  4N9T A;  2A6H C;  5CV6 A;  2JSO A;  1NAP A;  3GV3 A;  4IUT A;  2I46 A;  3DM1 A;  1HQR D;  4KI0 A;  3FDT A;  2FHT A;  2AUJ D;  3DWA A;  1EIG A;  2EJM A;  1CZG A;  3NTI A;  4QCL A;  1CFM A;  1Y1V B;  3MTS A;  3NWT A;  2Z4H A;  2EYO A;  4IAL A;  1NCV A;  4C2M B;  5EJW A;  5CGK A;  4KK7 A;  2KHS A;  3JAM L;  3S1N B;  2B2V C;  2NTS A;  5LL6 S;  2NN6 G;  1B2T A;  1NR4 A;  3VR5 A;  1DD2 A;  2X69 A;  4CKB A;  5C5L A;  2R92 B;  2RVL A;  1A2U A;  1HQM C;  2N55 A;  1AFP A;  4E6I A;  2IX0 A;  1FGB D;  3D3R A;  3H6M A;  3LWU A;  5AFW A;  2RSO A;  3K0Y A;  4K8I A;  3S9W A;  1ENC A;  1VF7 A;  1A2T A;  2WV6 D;  3AB9 A;  5C4J B;  2F0P A;  1W6J A;  1XYI A;  2KQ3 A;  2PMZ B;  2SNS A;  3S16 B;  2QIL A;  1S5D D;  2WIN B;  5COR A;  4BBS B;  4IUR A;  3HGB A;  1WVL A;  2NVQ B;  3KBX A;  1M4V A;  4KMU C;  4OO1 H;  3PMF A;  1O80 A;  5I2Y A;  3DMU A;  2PYK A;  3BS1 A;  2BA0 A;  4BY1 B;  1SNQ A;  1U4P A;  2OF1 A;  5DAU A;  2AWO A;  1LV9 A;  2EZV A;  4K5V A;  3BZD B;  5KNB A;  3X3N A;  2SNM A;  2BOS A;  1TR5 A;  3LNN A;  3WOE A;  2XIW A;  1PRT D;  5C4X B;  1J8I A;  4BA2 I;  4RH6 A;  2TSS A;  1BOS A;  1SYE A;  3PO3 B;  2EYP A;  1DOK A;  4K2K A;  2WII B;  4BS9 A;  2BDN A;  1QWY A;  1MSH A;  1I4G A;  2ZXR A;  3T51 B;  3D31 A;  5M3M B;  4Z9C B;  3VYR A;  3VYU A;  4DFA A;  1SFO B;  4P2C B;  5KND A;  1BUV T;  1QCB D;  1TU2 B;  3K5O A;  1EWC A;  2BA1 A;  3TZU A;  3NHH A;  1FNW A;  2EPB A;  1OO9 B;  1LLR D;  2F0N A;  1CTM A;  2Z1C A;  3VR6 A;  5IOD A;  3HOU B;  1EY5 A;  2IT1 A;  3R2T A;  1OXS C;  3ND8 A;  2IX3 A;  5M3F B;  3I8Z A;  5CC4 A;  1PTO D;  5C6A A;  2R3Z A;  1RD9 D;  3M4Y A;  2L4N A;  1ML0 D;  2EYH A;  1G8Z D;  1WTP A;  4IUV A;  2NYZ D;  4FXK C;  2EYF A;  4HN7 A;  1BF4 A;  3QWN A;  4EQO A;  2V4D A;  2B2W C;  1H9S A;  1HTP A;  2JA8 B;  2QEJ C;  4K6D A;  4RGM A;  1JOO A;  5T1I A;  4EVO A;  3T53 B;  4CJ1 B;  4KTA A;  4NKL A;  1GHJ A;  5JVG 3;  2NVT B;  3X3M A;  1WTR A;  3BDC A;  2EE1 A;  1E2W A;  3NSW A;  2EDG A;  2RBM A;  3OSO A;  1V1O A;  4K14 A;  1SYB A;  1LTG D;  2FJ2 A;  3E6Z X;  2K05 A;  5IGB A;  2RKS A;  4KY5 A;  2OEO A;  2H4O A;  2NZ1 D;  1U4M A;  4G4K A;  4PMB A;  2F0K A;  4DN4 M;  2O4X A;  1BQQ T;  1SNO A;  2KCN A;  1CI3 M;  4IFD H;  5ELB A;  3ERQ A;  1SDF A;  4RGT A;  3S14 B;  4RGN A;  1RHP A;  4IFD J;  2C9O A;  1XTC D;  2DY7 A;  3TP7 A;  1WCM B;  2KCC A;  2CVR A;  3C1E A;  4F88 A;  1LTS D;  3DHQ A;  1LT5 D;  3DXJ C;  3CRK C;  1FR3 A;  1TS2 A;  3A55 A;  1JR0 D;  2CHB D;  1OXT A;  2H1E A;  3MHB A;  2HQE A;  1MSG A;  2EJF C;  3MXP A;  2PZW A;  3DEO A;  1SJH D;  5C3E B;  1I4Q A;  2KVM A;  2B8G A;  4DF7 A;  1OXU A;  1L0Y B;  1JWS D;  4R8N A;  2DN8 A;  3RUZ A;  5JOB A;  5D14 A;  5EKI A;  1FNV A;  1TWC B;  3MXG A;  1MGS A;  2BE5 C;  5JPM C;  4WJW A;  1R4Q B;  4DK0 A;  3QIA A;  5KIX A;  1DZ1 A;  5IGD A;  1ENA A;  4PV1 C;  2B2Y A;  3MWY W;  1C8C A;  5G3L F;  4RGO S;  1GUO A;  3T13 A;  3A8K E;  2EVB A;  4J1M A;  2DNC A;  2RSN A;  3EFX D;  3J7Y W;  1LO5 D;  3LX0 A;  1A3V A;  2AQ1 B;  2F0I A;  1D6E C;  5C4H A;  3ND9 A;  2B2W A;  3KLS A;  4DXF A;  1I6H B;  3WOF A;  1K8M A;  4FXG C;  1U4L A;  3VA7 A;  2WP8 J;  3R93 A;  1S4Z A;  1B9N A;  2F0M A;  1F2Y A;  1D1I A;  1FD7 D;  3MXN A;  4NDX A;  1YNN C;  2MHV A;  1EZ6 A;  2F0H A;  2F0F A;  3TP8 A;  2A68 C;  1Q8I A;  3QOJ A;  3IAY A;  4ZKB B;  5IGF A;  2VNU D;  2EYM A;  1ENF A;  3R2I A;  5C3X A;  1VCI A;  2E2I B;  3VR4 A;  1SND A;  4DAP A;  2XRQ D;  3A7A B;  2YYZ A;  4EGV A;  2F0V A;  1XXG A;  1BR9 A;  1L0X B;  2CQA A;  3SE0 A;  3V05 A;  1H9J A;  4C1N K;  1Q90 A;  4NW2 A;  4ZUJ A;  3GTQ B;  1G6Z A;  5EPK A;  4RHR A;  1QIL A;  3GTP B;  4B08 A;  4C3H G;  3MFY A;  3Q22 A;  4A3B B;  2B39 A;  2KOL A;  3TBI B;  1O7Z A;  3H94 A;  1RCV D;  2K32 A;  1IL8 A;  3R3O A;  5HUR A;  1AZP A;  5CYU A;  5E1F A;  2B2Y C;  3SEB A;  5ELD A;  1LAC A;  1DM0 B;  5C0X G;  3KUP A;  1ESF A;  1F9P A;  5E4X A;  4A3F B;  3VR3 A;  2F0W A;  4KJN A;  5IGG A;  1STE A;  1S5C D;  1ILQ A;  3M3Y B;  2NN6 H;  5FLX E;  1ET6 A;  2XWJ B;  3W3A A;  5ELE A;  4X3S A;  3T4A C;  4WOR A;  3SK4 A;  3MAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...