3EJIA

Crystal structure of staphylococcal nuclease variant delta+phs l36k at cryogenic temperature
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRKLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Structural Consequences of the Ionization of Lysines at 25 Internal Positions in a Protein
rcsb
source organism Staphylococcus aureus
total genus 39
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ejiA00
1EYCA 2F0DA 2F0EA 5IODA 5I6WA 3EROA 3QOLA 4J6HA 5J22A 1JOKA 3NK9A 1EYDA 3NP8A 5KEEA 4ZQ3A 4NP5A 5CR3A 1KDAA 1ENCA 3R3OA 2F3VA 1A3UA 3U9OA 1SYDA 2QDBA 4K5XA 2F0OA 1SNMA 1STAA 4I65A 1SNOA 4K2KA 4WORA 4ZUIA 1JOOA 2PW5A 4IALA 4B9WA 5IIFA 3NXWA 1KABA 3E5SA 3C1FA 5C3WA 1NUCA 1EZ6A 3ERQA 1EY5A 5C4ZA 5I9PA 3QB3A 5IGBA 1JOQA 4KY5A 4KD4A 4PMCA 3SK5A 2OXPA 3NHHA 5CC4A 2PQEA 3LX0A 3D4DA 4PNYA 1RKNA 4NDXA 3MVVA 1SNDA 1EY8A 4KY6A 2F0TA 3OMCA 5CV5A 2EYMA 5IGDA 3OWFA 1STBA 5CV4A 4OL7A 4RKLA 3HEJA 3EVQA 1JORA 2EXZA 2HQEA 1IHZA 4MIUA 2KHSA 4F8MA 3DHQA 3T13A 5J1ZA 4K2LA 4K6DA 4PMBA 1SYEA 4HTHA 3SK4A 4G57A 1STGA 1KDBA 5CV9A 3SXHA 5HGTA 2SNMA 5IGEA 3P1HA 2F0UA 2PYKA 5E3FA 2RDFA 1EY4A 4K5VA 4K8IA 2F0SA 3EJIA 5DEHA 4B9XA 4WRDA 2EY1A 1EYAA 2F0IA 1U9RA 3SR1A 1A3VA 2EYHA 3OMGA 1EY9A 4QB4A 5EKLA 4IZ8A 5F2DA 1SYCA 5C3XA 5CGKA 1EY0A 5IGFA 2PZWA 5KRUA 4HMJA 2EYJA 4ME5A 1STHA 1F2ZA 2WACA 3RUZA 3SK6A 3DMUA 1STNA 4N9PA 5CV7A 3TP6A 4K14A 2F0MA 4LAAA 2F0JA 3H6MA 3MHBA 3MXPA 3MZ5A 3TP8A 3T16A 1EQVA 5CV6A 5KYIA 2F0VA 3MEHA 3TP7A 3V2TA 1AEXA 3SK8A 1F2YA 1EY7A 2EY6A 2EYPA 2O4XA 4R8NA 4DGZA 4EQOA 2F0LA 3BDLA 2F0KA 5C5LA 5HURA 5E1FA 2RBMA 3C1EA 4K8JA 4KJNA 2EY2A 1TR5A 2OF1A 3QOJA 4H7BA 5M9OA 1STYA 3NQTA 1A2UA 4NMZA 1EZ8A 2EYLA 1A3TA 5JAVA 4ODGA 1SNPA 2ENBA 1SNCA 4DF7A 2EYOA 2NUCA 5JOBA 3S9WA 5EKKA 4F7XA 1NSNS 5DAUA 1SYFA 3ITPA 5KGUA 4KV6A 4ZUJA 5J39A 2EYFA 4RKBA 2EY5A 3D8GA 1TT2A 5IGGA 4KTAA 4QMGA 4EQPA 5C6AA 3BDCA 3NUCA 1SYBA 4K5WA 4KHVA 4TRDA 5EGTA 1ENAA 2F0HA 5I9OA 5C4HA 2RKSA 4KY7A 2F3WA 3D6CA 2M00A 4DFAA 1SNQA 4J1MA 3TP5A 4N9TA 1EY6A 2LKVA 2PZUA 4ID6A 1TQOA 2KQ3A 1KAAA 4S3SA 3D4WA 1II3A 5ISRA 3OSOA 3VA5A 3PMFA 1F2MA 5KYLA 2SNSA 3HZXA 3SHLA 2F0QA 4EVOA 4HMIA 5CV8A 4DU9A 5KIXA 4IUNA 3TMEA 2SOBA 4QF4A 2OEOA 2F0PA 5IGCA 4E6IA 1A2TA 1KDCA 2F0GA 2F0NA 3P75A 4KD3A 4KJOA 4NKLA 2F0WA 4YIJA 5C5MA 5NUCA 4EQNA 5I6YA 5K5PA 1SYGA 2F0FA 2PW7A 2PZTA 5IOCA
chains in the Genus database with same CATH superfamily
3FVQA 4IPDA 2JJQA 4KKUA 4JI3Q 1G2TA 4DR6L 1DOKA 2NN6H 1Q82C 1DJRD 1ENCA 3J7A5 2F0OA 4BWGB 2JSOA 1JOOA 2PW5A 4IALA 3BYYB 3GTKH 3EN2A 1IXRA 1BOSA 2D2CC 1SLJA 1MD2D 3QR8A 1AE2A 3SK5A 1DCZA 3F2CA 2XWBB 1IYJB 3LX0A 2MO0A 4XYOA 3KUPA 2F0TA 2A73B 4RKLA 4C3IH 2NVYB 4A3DH 1HNXQ 1HQRD 5JJZA 4LF6L 3PUVA 1EWCA 4K6DA 4PMBA 1UE1A 2KHIA 5HGTA 3HRZC 4V190 2CW0D 4NW2A 4FO2A 2F0IA 3CC7A 1A3VA 3GTQB 1ZKOA 4POGA 1LYLA 2WFWA 5C3XA 5CGKA 1VQ7A 2E74C 3W1GA 4LF7L 3S15B 4HMJA 1QVCA 1VQ9A 4AQYL 4DV2Q 3J80i 1SN8A 1WI5A 4K14A 4HJ9A 5JPNC 1LM0A 1VQBA 3MZ5A 1JICA 1B44D 1LTRD 4TSSA 3SGIA 2EOTA 3DWPA 4UAIA 2EYPA 5D3DA 2F0LA 4A3MH 4DR7Q 2RBMA 3OIQA 3I73A 1H9RA 1BF4A 2Z0SA 2QA4A 5IP7H 1MJEA 3HKSA 2K52A 3TEHB 5KGUA 4KV6A 4IOCA 2A74C 4CDEC 5IWAL 5JJKA 3PIP3 1F9RA 4IPCA 2F3IA 4BA1I 4KTAA 5IGGA 3VA7A 3NUCA 1I6HB 1V8QA 2E5LL 3M3YH 3F2DA 4FP5D 1GM5A 2RKSA 4TKOB 1N9WA 2LXJA 1I3QB 1ET9A 1GVPA 2WB1B 2L9HA 1BCPD 1EY6A 2WB1G 3G6JB 4DNTB 5EPJA 1TWHH 1E2WA 1XNQQ 4Q0FA 1EYGA 1RTOA 1HNWL 4X64Q 2HHHQ 2JA8H 1VQDA 5TSSA 4DUZQ 4PG3A 4DV7L 2VS1A 2L4NA 5C5MA 4XXEA 1HUMA 2K50A 1RDPD 3KLSX 2F0EA 4BBSB 4C2MB 1XMOL 4GLXA 3JAML 1X54A 1QWYA 1PYBA 2AUJD 3AEVA 4OGQC 1KLGD 2EVBA 1YNNC 3DEOA 3PF5A 2DUDA 1HNWQ 1WOCA 4DV3L 4JPBW 4AIMA 1SDFA 4KY5A 1SR3A 4DV7Q 3KF8B 2FHTA 1M90C 4C3HH 2I0QA 4A3KB 4JV5Q 1CKOA 3TSSA 4A3KG 4BBRH 1PH2A 1O80A 1XWEA 2K01A 4LFCL 3RZDH 2K14A 1V1PA 2AMCB 3QO2A 3AMUA 4DR3Q 2QDLA 2R7FA 4DR4L 4QJFA 2RDFA 3S2DH 1RL2A 4KHZA 3K5NA 4CJ2C 5BN3A 4X62Q 3PSIA 1I4RA 4XIGS 4FNFA 4XQJA 3HOYG 3SK6A 1F2ZA 2RSNA 3D31A 3DMUA 1NBWA 3TREA 1TVXA 2X6LA 2F0JA 1A0IA 2WAQE 4Y52H 1XXGA 3BDLA 4YWKA 3CMEA 4RAUC 3A5ZB 2XWJB 5FLXE 5IE8A 3HGBA 2Q2IA 4R4OA 3PO3H 3KDFA 1BNZA 3NWTA 3O13A 4F7XA 1NSNS 5GAEC 2MUYA 3K5LA 5D14A 2K5VA 1IBMQ 1Q81C 1PH3A 4L6TB 1TT2A 2VQFL 3RLFA 4DAPA 5JPMC 3MAQA 5C0XH 1A62A 1ENAA 2JQOA 4CJ0B 4KI0A 1I94L 3RNUA 3W1BA 3FKIB 2ZTDA 1KHIA 2D0PA 1NCVA 1SJHD 2NN6I 4B08A 3L0OA 1U4RA 2KQ3A 1U4LA 3NE5B 1L1OB 3PMFA 3TZUA 2SNSA 2MNAA 4M1UB 5CV8A 2KCNA 4HAEA 3BU2A 1VQPA 1QZGA 4IJLA 1S4ZA 4KD3A 4HSVA 4JI1L 1UE6A 4KHPQ 5M5YH 3E0EA 2B2WC 2VB3X 1JJGA 1EYCA 1ZXTA 5J22A 4JI7Q 3GTOH 4OIKA 2BE5D 4HIKA 3HOWB 5M5WB 2QDBA 1SE4A 2J0TD 5IIFA 1FNUA 3E5SA 1WTQA 3S1NB 2NYZD 2UU9Q 3PCOB 4OONA 4PMCA 5EAYA 5DM63 4OO1G 2IX3A 3GTLB 2RF4A 1BDOA 1C8CA 1D6EC 4RH6A 3CCMA 4RCNA 2KHSA 4X3UA 1QCBD 3CHBD 5JVH3 5IYCG 2IWHA 4O1NA 2SNMA 3HKZE 1PDQA 4BXXH 3H91A 2B3GA 2E2HH 1JJCB 2K32A 3UDIA 1STEA 2K05A 4OWTB 3KFUA 3J80E 4POFA 2MQHA 1A6XA 2IW3A 3HOVH 3MXPA 3GQBA 4OWWB 3FPUB 3GDEA 1F2YA 5AJ3L 5M5XB 2FXQA 4KN4C 4NXNL 4A3LH 1M4VA 1GOZA 2NZOA 1J5EQ 3GTMB 5E7NA 2NZ1D 4ODGA 4A3GH 4DF7A 1N32L 3BJUA 3S9WA 3CCEA 1A63A 5DAUA 3ITPA 3EBEA 1XPOA 4RMFA 4GKKQ 4DR1Q 3UDFA 2Z6KA 1E0BA 1X3FA 3X3NA 1GUTA 1X32A 4GKJL 2RCNA 2VQEL 4DR2L 1OTCA 2QCPX 1TQOA 2RHQB 5JEAG 1K83B 1TWCH 1WD1A 1N32Q 1E22A 4H13C 5C4XB 3W2DA 2C5CA 5E4XA 1F9PA 3GTJH 1SE8A 4YIJA 1C0AA 2YU9B 4G7HC 2C35B 5KNCA 4A3FH 2NWGA 4DNRB 1SEBD 2XIWA 1JOKA 2MJ8A 1VMCA 4L5QA 2BH2A 1TWAB 1VQMA 2DN8A 1W2BA 4IJHA 1XTDA 3IFDA 1TWFH 1L0XB 3QB3A 4LJZC 4RHSA 5C44B 2KBNA 2VL6A 5C44G 1LTAD 3HOXB 4LK1C 3HOXG 3GP7A 1FD7D 5CV4A 4DV0L 4TVAB 1X55A 1MGSA 3KLRA 3DHQA 4A3CG 4QIWE 1YVCA 1VQ8A 4LFBQ 1XJVA 2PMZB 1A15A 4KMUC 2AUKA 1TWGB 2OQKA 3CCLA 2ZM6L 1JB3A 2K03A 1EU4A 5H1SE 4L5SA 1FJGL 1O78A 4A93B 4DV0Q 3HOUH 1XYIA 1SJED 1S5BD 5LL6X 3TP8A 5C0XI 5KYIA 1EQVA 3NBHA 4EQOA 1LTLA 5C5LA 4BY7B 4K8JA 3CAMA 4BY7G 2EY2A 2MHVA 1JMCA 2K5WA 1LABA 1U4MA 3AFPA 4LFAQ 2XGTA 1ILPA 1LACA 2NVXB 3OW2A 2R92B 3J7ZC 1HQMC 2R92G 5FKAC 5DM73 4IPHA 3S24A 5COYA 5HGQA 4A3BB 5ELCA 1B3AA 3A5UA 4EGVA 4HJ5A 4DFAA 2A6ED 1VQ6A 3ULJA 1JE4A 4G7OC 1G2SA 1QUQA 3CRKC 3HS0C 4S3SA 2EQSA 3VA5A 3NQIA 4DV6L 4JI0L 2AKWB 1I4GA 4IUNA 2E76C 1XNRL 4QF4A 1TY0A 3M9BA 1HFNA 1K8MA 4NKLA 3H3VC 1HNZL 2DJFC 3L2PA 5BR8L 1E7ZA 2A69C 2H1EA 1D8LA 2M9VA 1G8ZD 3F8TA 1LLRD 2O2LD 5IT9c 1SYDA 3R2TA 1HR0Q 1SSOA 4UP9A 3A8JE 1EEFD 2JP1A 3NXWA 3H0GH 2R93B 3M7NA 1O7ZA 1JCKB 2F03A 1EY5A 2L11A 3IKJA 1CKNA 5ELOA 2JE6I 3BZDB 3F2BA 3UDXA 4DUYQ 1SBBB 3CCRA 1D1KA 1V1PB 4CKBA 3BVZA 4X65Q 1VQKA 4IUVA 3F2UA 3T13A 3J81E 3K0XA 3RMHA 3H3VH 2VXWA 4DKAC 3J7YW 2F0SA 4O0AA 1K8AC 2ZJPA 1EYAA 5IP9H 2D62A 2I46A 3MC0B 2HQLA 2YTVA 3OMGA 1D5ZC 1J8IA 3A55A 2B2YC 3GTPB 3S1QH 1SYCA 1X3PA 3OOCA 1QVFA 4O42A 3PO2H 3OYYA 4V0BA 1XPUA 1UE7A 2WACA 1X3QA 4N9PA 5C3EB 4PZ7A 1V1QA 1LUZA 3ND8A 5I2XA 4H02A 5C3EG 3DUZA 1K8GA 1Y1VB 1Y1WB 4A3EH 1Y1VG 1Y1WG 1I4QA 1K9MC 3NELA 4LF9Q 2KEDA 4CKCA 4IUPA 4RFBA 4U673 5HURA 4XTCS 3KDFB 3QG1A 3Q24A 5LMNW 3K0YA 1WTXA 3E3XA 4UY8C 2BDOA 4RG1A 4IPGA 1NAPA 2Y0SE 3K7AH 4CJ1B 1EIGA 1ESRA 3J80L 2EYFA 1RODA 1IBLL 4TRDA 1VQEA 3TN2A 4JYAQ 2E2JB 1LT5D 5J3BA 2UXDQ 4X3KA 1PTOB 3CQZH 3OIPA 4J1MA 1XMQL 1GUWA 5K36G 1IBKQ 5ELFA 4MZ9A 3RZOH 5C0XJ 1N34L 1E1OA 4BS9A 4YCUA 3CD6A 1S5DD 2YTXA 3LGJA 1QILA 2E2IH 3A8IE 2F0WA 3A8KE 4NXML 3S16B 5IOCA 2LS01 3FPPA 3V96A 1BBWA 4FDBA 5KNDA 4MTNA 4CKEA 4MNOA 1M1KC 4A76A 2B29A 2FINB 3HG9A 1E2ZA 2EE1A 1K3RA 3BZCA 1H95A 4FF4A 2CH4A 1KABA 3KOJA 4R4TA 5IGBA 1K8OA 1YIJA 4B3SQ 1HA5A 1CHPD 2AWNA 4AYBE 4JI8Q 4BY1H 4NDXA 1ZYRC 1Q3LA 3I4NH 3HOZH 3OMCA 4GOPA 3CCVA 3S1RB 5A2QE 1PRTD 2NTTA 1JORA 1S5ED 3MFGA 3FDTA 2X69A 2HT1A 1WTPA 1Q90A 4C3IB 5T1IA 4C3IG 2R7ZH 3ICEA 4A3DG 3BS1A 2B8GA 2F0UA 1CHQD 2RCFA 1VQLA 4LF4L 4YWLA 4OWXB 3EJIA 3ER0A 2D9UA 3BZKA 4P72A 3RN5A 2BCOA 1NMFA 1FNWA 1D2BA 4GN4B 2QEXA 2B2VA 2A68D 1Q1EA 1C48A 4JI4L 1VQNA 4XDXA 3MHBA 1WYDA 2MGSA 4C1NI 4DR5L 1Y8NB 4R8NA 3WDNA 4DR6Q 2VY3A 1AW7A 2ZJRA 2B8FA 2E2DC 2UXBL 2DNEA 2WINB 1TR5A 1WCMH 2E8GA 2ICIA 4KN7C 3UI2A 1EQRA 4A3MG 1D5MC 3KYHC 3IL8A 2K1BA 4JOIC 4JVZA 1KC8C 1SMYC 4MN3A 3PIOA 4NB3A 1ICFB 1ESFA 2FFKB 1BXTA 4JG2A 5L37A 1YITA 5GQOA 1BCPB 4LF6Q 3CC4A 4RCOA 4DR5Q 1KQSA 1VS0A 1UE5A 4ABNA 1I6VC 4APVA 3Q0AA 4LF5L 3PQIA 1TS2A 4EVOA 2P5ZX 2JYOA 2NVYH 2PI2E 4LF7Q 4R4QA 4YHHL 4PQXA 4AQYQ 2HIVA 2JA8G 1VMPA 2QILA 5D3IB 3SDZA 1BUVT 1TKWB 3NSWA 1S5FD 1KDAA 2KUMA 3GTQH 2F3VA 3AFQA 3H3VI 1Q7YC 1PVOA 2QW7A 1P16A 4N8FA 3JAMc 4H0LC 1B70B 1PHJA 3S1MB 3T56B 4JC0A 4DK3C 4L63B 1SMYD 2ID0A 1VQJA 3T51B 3D4DA 4PNYA 5IWAQ 4WFN3 2E5LQ 1IHZA 1SRUA 2YV5A 3M7GA 1UAPA 1CFMA 4HTHA 4G57A 3SXHA 1KDBA 2RHSB 5M3MB 2IHFA 5M3MG 4G4KA 2B2UC 1G6ZA 1OXTA 2OQ0A 1R9TB 2IHEA 1ASYA 1I6HH 4N8X1 3LWUA 1OO9B 4DV4L 2RSOA 1VQIA 1Z6HA 1I3QH 4OXPA 2ZXPA 1NTGA 3NBHB 3K5MA 2TMPA 3NTIA 1XMOQ 2ZT9C 1SROA 4LUOA 2G9DA 2A19A 1PA6A 4RHRA 3QOJA 1L0YB 2EYLA 4LF8L 3Q8DA 2NVTH 1SNPA 4QUCA 3STBC 1BBUA 2L1BA 3I56A 4DV3Q 1Z47A 3HOYB 2Q2UA 4C2MH 4ZUJA 3U58A 4BBSH 4RKBA 2YYZA 3T1YL 4R4IA 4HR7B 1KNEA 1TY2A 2MP1A 5EPLA 3PUZA 4LFCQ 5EJWA 1QUQB 2WV6D 2X6GA 4CBVA 4ID6A 5C0XG 1YNND 3QIAA 3NTHA 4DR4Q 2K5NA 2CFMA 5C4JB 1MIUA 4ME3A 4HIMA 2O5IC 3K81C 1GUNA 4A3KH 2HDMA 3DM3A 2AQ1B 1VQ5A 1PH6A 1YZ6A 3N6RA 1SYGA 3TDQA 2KJXA 4YCWA 2SDFA 3J7AV 4HJ8A 4PZ6A 5JJIA 3OTOL 2FMMA 4TQUS 5FO8B 2KOLA 2JEAI 4K2KA 3ZJYC 3URYA 4MTKA 1CKNB 1NUCA 2FJ2A 3M4OB 1L1OC 5CC4A 3UE0A 1L2FA 1SNDA 1HH2P 2I07B 2VQFQ 2HQEA 3DWQA 3KLWA 2TSSA 1I94Q 1MHWC 1DD2A 5FOBB 2UUCL 4IUUA 4LWCA 1C7YA 1YHAA 4QCLA 2EJGC 2UXCL 4JBMA 2JN4A 3S14B 1RIPA 1DOLA 2KEEA 2A8VA 1GHJA 4HIOA 2BA1A 1X9NA 1PH4A 1CQFA 5M3FB 2XTIA 2IX1A 4JI1Q 1HCZA 2B2TC 5M3FG 2L5TA 1STNA 3FKIH 1Q8KA 1H9MA 5CV7A 2F0MA 1B4OA 2CHBD 2EJMA 1XTCD 3L9AX 1AFPA 1HA6A 3HOVB 2O4XA 3HOVG 1U4PA 5LMUL 3JC66 3J81i 5M9OA 4JCVE 4B3ML 5FK9C 2KECA 2ENBA 1HTPA 1NR2A 2NUCA 5FJ8G 5IYBH 2JA9A 3AYHB 4A3GG 2WP8J 2ATWA 3CKIB 4B3RL 3HOWH 5M5WH 3VR6A 4X3SA 4L5RC 2J7ZA 4C3JB 1UUPA 4C3JG 3S1NH 2N78A 2N8NA 1I4PA 2QGQA 1TIID 4XQQA 4ULLA 3GTLH 2XRSD 5KIXA 3CCUA 2IX0A 2A1AA 2SOBA 2F0PA 1VQCA 1UEAB 1O7IA 4YCVA 2NTSA 5CBAE 1YJ9A 1QVGA 3PUYA 2PW7A 2PZTA 4B3RQ 4DV1L 1SFOB 4IFDH 1OXXK 2OTLA 5JJLA 5IYDH 5AJ3Q 4NXNQ 1A3UA 1MKHA 2JXMB 1ASZA 4IOAA 4I65A 1MSGA 1WTOA 1O7YA 1T9HA 5I9PA 2CH4W 1PTOF 4UPAA 3WWVA 4DXFA 1Q1BA 2KCMA 1B8AA 1Z7TA 2RQXA 2OXPA 4GOPB 2PQEA 4FF1A 1PH1A 3MXGA 3K6OA 1KRSA 3I72A 5M5XH 2F52A 3M4QA 1STBA 1UNSA 3TRZA 1FNVA 4GOPC 1CA5A 1KLUD 2EXZA 5ELEA 3S17H 3GTMH 1W6KA 4GKJQ 3KJOA 1B3QA 2VQEQ 4QY7A 4DR2Q 4K0KL 1EUJA 3J81j 4HJAA 4JBKA 3MEFA 3FMCA 4ME5A 3WOEA 4R4CA 3E6ZX 3I4OA 4LAAA 1W6JA 5JEAH 4ZKBB 1J6QA 3T53B 3TP7A 3V2TA 1EU3A 1K83H 2EPBA 3I4MB 5GADC 3I4MG 1SXTA 5C4XH 3V05A 1STYA 2MPMA 1CA6A 2DGYA 2VW9A 3D4RA 2YU9H 3I2ZA 1PH9A 2JA5H 2N49A 2GVBA 4QQBX 5J39A 3D3RA 3VR2A 4OX9L 1I50B 4Y7NB 2OT2A 1SAPA 2I5MX 1TWAH 2E75C 4K5WA 2KCTA 2PQAA 3E0JA 4GNXA 3F1ZA 3IRBA 1FR3A 1KAAA 1II3A 1PLFA 1F9SA 5ISRA 5GROA 4IQZA 3E9HA 1OXVA 2NBFA 2CVRA 5EPKA 3SHLA 3U50C 1S5CD 4DK0A 2WAQB 2ZM6Q 2WAQG 3SEBA 3TMEA 4A3JH 5IGCA 1WTWA 1FJGQ 4A3CH 3K57A 2A5HA 1AZPA 3GTGH 3I91A 2Q8IB 1MBYA 3QOLA 3MA2B 2B63B 1PFNA 4A3IB 4DA2A 1TWGH 1HR0W 2B63G 3TZDA 2EJFC 4A3IG 3MXNA 2K5QA 3U9OA 1G51A 1U0LA 4UDUC 1BCPF 4L5TA 4U68A 2CQOA 4Q5VA 3C1FA 2KA7A 4UHVA 5FLXL 1WJJA 4A93H 4UP8A 2RDGA 3P20A 3H0GB 3H94A 5JVG3 1QB5D 1PZID 2WIIB 3PIO3 3H0GG 1BVSA 1RKNA 1EY8A 3L3OC 5LL6S 2PCFB 1N36L 1UWVA 4CDCC 4BY7H 2V4DA 1CTMA 3I4LA 4MIUA 2EXDA 4IN3A 3IAYA 1H9SA 1IW7C 3RR5A 4HSPA 2F4VL 3P1HA 5E3FA 1EY4A 4K8IA 4YWMA 4LMQD 1PH8A 4YY3L 2K04A 2NVXH 2R92H 3NEMA 4EX5A 4DV6Q 4JI0Q 2RA4A 1KD1C 3DWAA 2WB1E 5CBEE 1XNRQ 5IGFA 4B3TL 2B39A 1DGSA 4A3BH 1VF5C 5EBCA 2L15A 1K73C 1HNZQ 1OXSC 3JAME 4QGUA 2BOSA 2J4XA 5BR8Q 3ERSX 5CV6A 5HY6A 3OWEB 3A7AB 3MEHA 3SK8A 1B1ZA 3CCQA 3VR5A 3ULPA 2F0KA 5FLMG 4H7BA 4A3EG 1A2UA 1X3EA 2GN5A 2PPBC 2ASBA 4J8QA 3ULLA 3PF4A 2EYOA 3EIVA 2VNUD 2B2WA 3HKZB 1Q46A 1GJXA 3ND9A 3HKZG 4QUFA 4QMGA 3A0JA 5KNBA 3Q22A 2A69D 4IFDI 1EOVA 4KHVA 4DK1A 2F0HA 1IW7D 3A7LA 3KK7A 1HZAA 3J80c 4DAYA 4WJ3M 2A6HC 1PYSB 1TXYA 4GS3A 3I70A 2R93H 1RJTA 1N33L 1B53A 3CF5A 1VQOA 4RWSC 1KNAA 5EKIA 2Q8TA 3RLOA 1CUKA 3CCSA 3K58A 3RZOB 2VUMB 5CMDA 1HZBA 1EOTA 2OEOA 2VUMG 2D0OA 1ONLA 3HP3A 3K59A 2GA4B 1GO3E 3N52A 3UDGA 5I6WA 2ZJQA 4J6HA 1LO5D 1EYDA 1DM0B 1TS5A 2IPKD 4ZQ3A 4HCEA 2C9OA 1N33Q 1CK1A 3SVMA 1H9KA 1EWHA 1E2VA 3K8AA 1K0SA 5C3WA 1PTOC 2JA6B 1HHVA 5C4ZA 2HIXA 2JA6G 5LMNL 2EIFA 5C3EH 4IURA 1EIHA 5BN4A 1PRTB 1RD9D 4XT3B 5IGDA 1IL2A 3KBGA 1K0RA 2Q8RE 3DM1A 1IYVA 3EVQA 1IBLQ 4BY1G 3HOZB 3R8BA 5ELNA 1AE3A 3HOZG 1PFBA 4K2LA 4JI6L 3I4NG 4X3TA 3FRPB 2XNAC 2V1CC 1XMQQ 2XSCA 5GAHC 3I3CA 1HTLD 2PI2A 2NVQH 3I90A 1Y14B 1GUGA 2R7ZG 1N34Q 2NN6G 4L8JA 2ZTEA 2AQ2B 1WD0A 1EY0A 1VDZA 2E2JH 3GTKB 5FO9B 1EIFA 1YI2A 2Z8LA 4NXMQ 2D5DA 1V9PA 2UUBL 3M85A 1PTOH 4KKSA 4CGYB 3ZYYX 3K80C 4JI3L 1I4XA 4JI6Q 3H09A 4A3DB 1AP0A 1I5FA 4GN5A 4ZYSA 2OF1A 1AN8A 2CW0C 1B7YB 1A3TA 2BDNA 4FYDA 4WJWA 1WVLA 1PZJD 4JI2L 1PXUA 5EKKA 1WCMG 1HXYD 1SYFA 1NY4A 2JA7H 4CDDC 2EY5A 2F1MA 3TS0A 4EQPA 3BDCA 1HNXL 1SYBA 2G9HD 4KY7A 1EQQA 2H5XA 4RGNA 4LF4Q 1JWUD 3OSOA 1UEBA 5DLQE 1F2MA 3S2HH 4A3MB 2F0QA 4DU9A 4JI2Q 3FEWX 1VQGA 1E3PA 3VR4A 2VZAA 1JWMD 1ZYRD 1MI2A 2EDGA 4HEDA 3S1RH 3P75A 2F0NA 4DV2L 4X66L 1VQFA 4C1NK 5IP7G 4JI4Q 3MTSA 2Z6KC 3NTKA 5T1GA 3NP8A 1Q86C 1FL0A 2K5HA 4DR7L 3M3YB 4K5XA 2UXBQ 1NJIC 1BCPC 5AFWA 4IFDJ 3CC2A 4LW1A 1TWHB 5FO7B 2XN9C 1U5KA 3NHHA 4X66Q 1PMRA 3K7UC 2JA8B 3MFYA 2LY7A 1NR4A 1IZ6A 2Z6BA 3SE0A 2H4OA 1MSHA 4F8MA 3M4PA 4R1JA 5J1ZA 2M2LA 3GD7A 1B9NA 2KHJA 3CXCA 3A54A 3LNNA 1JWSD 4FF2A 1X3GA 1XNQL 4LF5Q 4WRDA 4FF3A 3S15H 1U9RA 3CP0A 4X64L 3T1HL 2HHHL 2EYHA 3TBIB 2G5DA 2Z9HA 5EKLA 4IZ8A 4DUZL 2K6AA 4R9WA 1KIXA 3VYUA 4YHHQ 1G91A 1AH9A 4EQ5A 4C3HB 1B2TA 4ZCKA 2BH8A 4C3HG 2ALYB 1YBYA 2K75A 4BBRB 1SE2A 1T5EA 4BBRG 2MFIA 5E1FA 3RZDB 4KJNA 5GAGC 4AH6A 3H15A 1GHKA 1J9OA 3T1HQ 5JEAJ 3J81c 1X65A 3S2DB 1LT3D 3G4SA 1RHPA 2IJ0A 4H44C 2NVTB 3PGZA 4JV5L 2PQAB 1CM9A 4ZRZA 4GNXB 4PMWA 1FYCA 4BBSG 1QOHA 2RDHA 1P8LA 4A4IA 4GNXC 3TP5A 4DR3L 2K7VA 1LTTD 3J81L 1VQ4A 1ZEQX 3S1MH 2YTYA 3C46A 1TS3A 1LT4D 4X62L 2PMZE 1CSPA 2F0GA 4DV4Q 3PO3B 4ZLTF 5I6YA 3PO3G 3KF6A 1JC7A 4ZK9B 5M3MH 5IODA 3EROA 3MXNB 1T5XD 5CR3A 1QE6A 2Y0SB 1R9TH 2Y0SG 1SNOA 4ZUIA 1FGBD 2B2YA 4ILWA 1D7QA 4LF8Q 3ERQA 1TU2B 1XX8A 1LT6D 5D65A 3EFXD 1IBML 2AHOB 1V1OA 3MVVA 1N8RC 4KY6A 2OWOA 1FGUA 3T1YQ 1GUSA 2EYMA 2FMCA 1H9SB 2KVMA 4GZYC 3MWYW 5M5YB 1PH5A 3SK4A 1QJOA 2BE5C 2LXKA 4XYQA 3GTOB 1JR0D 5DEHA 4B9XA 3STBD 3FP9A 3HOYH 1EIYB 2ZXRA 4RGOS 5ELBA 2K5DA 5F2DA 2N3SA 2MO1A 1F2LA 2PZWA 5KRUA 1YJNA 1BBXC 2CCZA 3QWNA 4KHPL 1CKMA 1CI3M 3RUZA 1Q12A 3IFTA 3D0FA 4I7AA 1D5XC 4RGMA 4LUZA 4JI7L 3R93A 5C4JH 2CWAA 3FKIG 3OTOQ 1IL8A 4AYBB 1LTBD 3G6EA 4RA8A 1QNUA 2KENA 4AYBG 1CSQA 4DPGA 2UU9L 2L55A 4BXXG 2E2HB 1KAWA 1NNXA 3U9SA 2K4KA 1F9QA 3NPPA 5IT9E 1DYQA 1G6PA 1VF7A 4DAYB 5IYBG 5A2QL 4DK6C 4OIJA 3JAMi 2RVLA 5I2YA 5I4DA 4N9TA 2UUCQ 3HOWG 1RF2D 3L7ZC 4Z9CB 4LNQA 2O5JC 2UXCQ 3D4WA 3D6WA 2Q2TA 3M4OH 2Z4IA 3NWSA 4HMIA 4A3LG 5LHY1 2HCCA 1XPRA 3GV3A 1A2TA 4A3GB 3VYTA 1PFSA 4P2CB 1EQTA 3NK9A 3AU7A 3S14H 4NP5A 4IFDG 1CZGA 1DOMA 4JBWA 1J5EL 4GLVB 3CCJA 5LMUQ 3DXJC 4JK1C 2OCEA 4KK7A 3U4ZA 2JEBI 2UUAL 1IKLA 1NE3A 1JT8A 3NBIA 4B9WA 2AQ3B 5IYDG 5M3FH 4B3MQ 4OO1H 3G7LA 1E24A 5G3LF 2CQAA 2WKDA 1TWCB 1YJWA 4R8IA 3EA6A 4GKKL 3A56A 4DXGA 4DR1L 1W3SA 5IYCH 1A8VA 3T4AC 3VR3A 3HEJA 3GTJB 3TS2A 3PIPA 2ES2A 1JE5A 4A3FB 1STGA 5IGEA 4A3FG 3S17B 5FJ8H 4DV5L 4K5VA 3G48A 2UUAQ 1HRJA 4CDFC 1PFMA 1EY9A 3OHXC 4QB4A 1X56A 5BN5A 4ALPA 4JOIA 3RD4A 1TWFB 3P7JA 2EYJA 1EFID 2PNRC 2VB2X 2WKCA 1ML0D 3A74A 3TP6A 4C3JH 5E4WC 4DV1Q 2R61A 4RGTA 5EBDA 3EQLC 4I7ZC 1WTHA 2F4IA 3W3AA 1AEXA 1PRTF 2EY6A 4DV5Q 3LWEA 4NPSA 1M8AA 3VYSA 1R4PB 4PZ8A 3Q23A 1PH7A 5C4XG 3AB9A 2ZXOA 1SFOH 3FHWA 2JA5B 2K33A 5EQ0A 2JA5G 3C2PA 1HJPA 3ONAB 2XRQD 2B2VC 3KLSA 3BVMA 3D6CA 4LFBL 2M00A 3HOUB 1WTRA 3HOUG 3PUWA 5A35A 2IT1A 4K0KQ 4DAVA 4FXKC 1Z9FA 1JJ2A 4E6IA 1E1TA 2HD3A 4KKTA 1JOQA 2EZVA 4KJOA 5NUCA 1CQVA 4DNIA 4A3JB 4A3JG 2L12A 1G291 1BR9A 3GTGB 1DZ1A 4WJ4A 3R3OA 1EWIA 2B2UA 1HFGA 2A6EC 4JI5L 1STAA 1R4QB 5C44H 1QG7A 2PNHA 2L0CA 4F88A 2BA0A 1B9MA 2DJGC 3HOXH 4LFAL 4JW0A 4IUTA 1RTNA 1YEZA 3RLNA 2N88A 4A93G 5FLXc 1C9OA 3KF8A 4OX9Q 2ZTCA 3MXUA 4OL7A 1Y69U 3I4MH 5CYUA 4HJ7A 4P75A 3PV0A 4OELB 3C3LA 2SEBD 5DNFA 1LTID 1SYEA 5CV9A 1JB7A 2QKIC 1LTSD 4JI5Q 5IY0A 2DNCA 3DEPA 3SR1A 1S72A 2IL8A 1WFQA 1I50H 4Y7NH 4LUVA 4F87A 1S3OA 3B6YA 3M4YA 1H9JA 1HZCA 2DY8A 1GD7A 1STHA 2CKZB 3HFZB 1X6OA 3H6MA 2LMCB 1OXUA 3R2IA 4HN7A 3T16A 1KL9A 4ZKCB 4A3BG 4QL5A 1KRTA 2I5HA 1EY7A 4DGZA 3GV6A 2ICEC 3DLLA 1HR0L 3CU7A 4NMZA 1EZ8A 2PO4A 4FXDA 5JAVA 1EFWA 1SE3A 5ELDA 1SNCA 1RCVD 1DONA 1LTGD 5JOBA 1BO0A 2HDLA 4CHTB 1PV4A 1CZWA 1BQQT 1V43A 3OPOA 5IP9G 4C56C 1FVIA 1PYWD 1PZKD 2R6GA 4DUYL 2B63H 3W5OA 4A3IH 3S1QB 1GXDC 4BA2I 1KXLA 2DY7A 1B50A 1N36Q 1F77A 4G7ZC 5EGTA 5I9OA 4X65L 4ZAIA 5C4HA 3PO2B 2F3WA 4A75A 3PO2G 3BG3A 3K5OA 2PZUA 1S40A 2F4VQ 1I4HA 3I7FA 1L0WA 3BDOA 3GO5A 4A3EB 1WTVA 5KYLA 3WOFA 4YY3Q 2R93G 2JK8A 1K3BC 4OO1I 1YNXA 1L1OA 2IY5B 3OW7A 3NENA 1C4QA 1KDCA 4B3TQ 3KF6B 1ICWA 4EQNA 2QEJC 4JBJA 2OTJA 4GN3B 1ENFA 2GVAA 5K5PA 4HCSA 5IT9L 2R7DA 3K7AB 2F0DA 4OHJA 2Q2HA 1BKBA 1EL0A 3X3MA 4LF9L 5KEEA 1IKMA 2N55A 3KJPA 1GUOA 1SNMA 4WORA 3BYTB 3BVGA 4P73A 1VQHA 2NZHA 1JQYD 3CRLC 3CQZB 1QZHA 1EZ6A 4UP7A 4KD4A 3QJYA 2B2TA 3CPWA 1NMGA 1QNKA 3VYRA 4M8AA 5CV5A 3OWFA 2HUGA 5FLMH 2E2IB 4MHEA 1VCIA 4JYAL 1AZQA 3RN2A 2UXDL 3Q6SA 1HUNA 4GLAC 2PYKA 1IBKL 1KTKA 3GTPH 2EY1A 1D1IA 1YNJC 1YHBA 2QF7A 2Z1CA 4OEMB 2NVQB 4DN4M 1K28A 3TQYA 1TS4A 2AWOA 2I5LX 2KCCA 3CW2C 4FVMA 3J7AF 1Y1VH 1Y1WH 1SMXA 2XVSA 2CWPA 4P71A 5CORA 4BY1B 2A6HD 1PRTC 3I8ZA 3G71A 2F0VA 3I4NB 4XQNA 1ILQA 2LSSA 1CT1D 3VDYA 1DXMA 3C1EA 4X6AH 5G3LD 2VUMH 1HZ9A 3CPFA 3NQTA 1Y8PB 3I55A 2R7ZB 1IYUA 1VQAA 1O7LA 5LMNQ 4B3SL 3PUXA 4P74A 3U4VA 4JI8L 4FXGC 3D8GA 2LFNA 4J15A 1EEID 4KLKA 2JA7B 4HIDA 2A68C 2JA7G 1HPCA 5K36H 4O2DA 2NB0A 1GKHA 1SNQA 4DAMA 4K6LA 2LKVA 2K28A 4IUQA 2JA6H 2Z4HA 1YNJD 1PTOD 1ET6A 3CMAA 1Y8OB 1Q8IA 3HZXA 1LV9A 4XT1B 3AQQA 3E9IA 3S16H 3UE1A 3S2HB 1WCMB 1YHQA 4QIWB 5C6AA 4IO9A 3KBXA 4PV1C 2F0FA 2HCIA 1MJCA 2R3ZA 2UUBQ
chains in the Genus database with same CATH topology
3FVQA 4KKUA 1G2TA 1DOKA 2NN6H 1DJRD 1ENCA 2F0OA 4BWGB 2JSOA 1JOOA 2PW5A 4IALA 3BYYB 1BOSA 2D2CC 1MD2D 3SK5A 1DCZA 2XWBB 3LX0A 4XYOA 3KUPA 2F0TA 2A73B 4RKLA 2NVYB 1HQRD 5JJZA 3PUVA 1EWCA 4K6DA 4PMBA 5HGTA 3HRZC 4V190 2CW0D 4NW2A 4FO2A 2F0IA 1A3VA 3GTQB 1ZKOA 5C3XA 5CGKA 2E74C 3S15B 4HMJA 4K14A 5JPNC 3MZ5A 1JICA 1B44D 1LTRD 4TSSA 2EOTA 3DWPA 4UAIA 2EYPA 5D3DA 2F0LA 2RBMA 3OIQA 3I73A 1H9RA 1BF4A 5KGUA 4KV6A 2A74C 3PIP3 1F9RA 4BA1I 5IGGA 4KTAA 3VA7A 3NUCA 1I6HB 1V8QA 4FP5D 2RKSA 4TKOB 1I3QB 1ET9A 2WB1B 2L9HA 1BCPD 1EY6A 3G6JB 4DNTB 5EPJA 1E2WA 4Q0FA 1RTOA 5TSSA 2L4NA 5C5MA 4XXEA 1HUMA 1RDPD 3KLSX 2F0EA 4BBSB 4C2MB 3JAML 1QWYA 2AUJD 4OGQC 1KLGD 2EVBA 1YNNC 3DEOA 1SDFA 4KY5A 2FHTA 4A3KB 3TSSA 1O80A 1XWEA 2K01A 1V1PA 3QO2A 3AMUA 2RDFA 4KHZA 3K5NA 4CJ2C 5BN3A 1I4RA 4XIGS 4FNFA 4XQJA 3SK6A 1F2ZA 2RSNA 3D31A 3DMUA 1TVXA 2X6LA 2F0JA 1XXGA 3BDLA 4RAUC 2XWJB 5FLXE 3HGBA 1BNZA 3NWTA 3O13A 4F7XA 1NSNS 2MUYA 3K5LA 5D14A 4L6TB 1TT2A 3RLFA 4DAPA 5JPMC 3MAQA 5C0XH 1ENAA 4CJ0B 4KI0A 3FKIB 1SJHD 1NCVA 2NN6I 4B08A 1U4RA 2KQ3A 1U4LA 3NE5B 3PMFA 3TZUA 2SNSA 4M1UB 5CV8A 2KCNA 4HAEA 1S4ZA 4KD3A 4HSVA 2B2WC 2VB3X 1EYCA 1ZXTA 5J22A 4OIKA 2BE5D 3HOWB 5M5WB 2QDBA 1SE4A 2J0TD 5IIFA 1FNUA 3E5SA 1WTQA 3S1NB 2NYZD 4PMCA 5DM63 4OO1G 2IX3A 3GTLB 1BDOA 1C8CA 1D6EC 4RH6A 4RCNA 2KHSA 4X3UA 1QCBD 3CHBD 5JVH3 2IWHA 4O1NA 2SNMA 1PDQA 3H91A 2K32A 1STEA 2K05A 3J80E 1A6XA 2IW3A 3MXPA 3GQBA 3FPUB 1F2YA 5M5XB 4KN4C 1M4VA 1GOZA 3GTMB 2NZ1D 4ODGA 4DF7A 3S9WA 5DAUA 3ITPA 1E0BA 3X3NA 1GUTA 1X32A 2QCPX 1TQOA 5JEAG 1K83B 1WD1A 4H13C 5C4XB 3W2DA 2C5CA 5E4XA 1F9PA 4YIJA 2YU9B 4G7HC 5KNCA 2NWGA 4DNRB 1SEBD 2XIWA 1JOKA 2MJ8A 1VMCA 1TWAB 2DN8A 3IFDA 1L0XB 3QB3A 4LJZC 4RHSA 5C44B 1LTAD 3HOXB 4LK1C 3GP7A 1FD7D 5CV4A 1MGSA 3KLRA 3DHQA 2PMZB 1A15A 4KMUC 2AUKA 1TWGB 1JB3A 2K03A 1EU4A 1O78A 4A93B 1XYIA 1SJED 1S5BD 5LL6X 3TP8A 5C0XI 5KYIA 1EQVA 3NBHA 4EQOA 5C5LA 4BY7B 4K8JA 2EY2A 2MHVA 2K5WA 1LABA 1U4MA 1ILPA 1LACA 2NVXB 2R92B 1HQMC 5FKAC 5DM73 5COYA 4A3BB 5ELCA 1B3AA 4EGVA 4DFAA 2A6ED 1JE4A 4G7OC 1G2SA 3CRKC 3HS0C 4S3SA 3VA5A 3NQIA 1I4GA 4IUNA 2E76C 4QF4A 1TY0A 1HFNA 1K8MA 4NKLA 3H3VC 2H1EA 2A69C 2M9VA 1G8ZD 1LLRD 2O2LD 1SYDA 3R2TA 1SSOA 3A8JE 1EEFD 2JP1A 3NXWA 2R93B 3M7NA 1O7ZA 1JCKB 2F03A 1EY5A 2L11A 3IKJA 2JE6I 3BZDB 1SBBB 1D1KA 1V1PB 4CKBA 3BVZA 4IUVA 3F2UA 3T13A 3J81E 3RMHA 2VXWA 3J7YW 2F0SA 1EYAA 2D62A 2I46A 3MC0B 3OMGA 1D5ZC 1J8IA 3A55A 2B2YC 3GTPB 1SYCA 1X3PA 3OOCA 4O42A 4V0BA 2WACA 1X3QA 4N9PA 5C3EB 3ND8A 5I2XA 3DUZA 1Y1VB 1Y1WB 1I4QA 2KEDA 4CKCA 4IUPA 4RFBA 4U673 5HURA 4XTCS 3QG1A 3Q24A 3K0YA 1WTXA 2BDOA 1NAPA 4CJ1B 1EIGA 1ESRA 3J80L 2EYFA 1RODA 4TRDA 3TN2A 2E2JB 1LT5D 4X3KA 1PTOB 3OIPA 4J1MA 1GUWA 5K36G 5ELFA 5C0XJ 4BS9A 1S5DD 1QILA 3A8IE 2F0WA 3A8KE 3S16B 5IOCA 2LS01 3FPPA 3V96A 5KNDA 4CKEA 2FINB 3HG9A 1E2ZA 2EE1A 4FF4A 1KABA 5IGBA 1K8OA 1HA5A 1CHPD 2AWNA 4NDXA 1ZYRC 1Q3LA 3OMCA 3S1RB 5A2QE 1PRTD 2NTTA 1JORA 1S5ED 3MFGA 3FDTA 2X69A 1WTPA 1Q90A 4C3IB 5T1IA 4C3IG 3BS1A 2B8GA 2F0UA 1CHQD 3EJIA 2D9UA 2BCOA 1FNWA 1D2BA 2B2VA 2A68D 1Q1EA 1C48A 4XDXA 3MHBA 2MGSA 4C1NI 1Y8NB 4R8NA 3WDNA 1AW7A 2B8FA 2E2DC 2DNEA 2WINB 1TR5A 2ICIA 4KN7C 3UI2A 1D5MC 3IL8A 2K1BA 1SMYC 4MN3A 1ESFA 2FFKB 1BXTA 1BCPB 4RCOA 4ABNA 1I6VC 3Q0AA 1TS2A 4EVOA 2JYOA 4PQXA 1VMPA 2QILA 5D3IB 3SDZA 1BUVT 1TKWB 3NSWA 1S5FD 1KDAA 2KUMA 2F3VA 4H0LC 3S1MB 3T56B 4L63B 1SMYD 2ID0A 3T51B 3D4DA 4PNYA 4WFN3 1IHZA 3M7GA 1UAPA 1CFMA 4HTHA 4G57A 3SXHA 1KDBA 5M3MB 4G4KA 2B2UC 1G6ZA 1OXTA 1R9TB 3LWUA 1OO9B 2RSOA 1Z6HA 2ZXPA 3K5MA 2TMPA 3NTIA 2ZT9C 2G9DA 4RHRA 3QOJA 1L0YB 2EYLA 1SNPA 4QUCA 2L1BA 1Z47A 3HOYB 4ZUJA 4RKBA 2YYZA 4HR7B 1KNEA 1TY2A 2MP1A 5EPLA 3PUZA 5EJWA 2WV6D 2X6GA 4CBVA 4ID6A 5C0XG 1YNND 3QIAA 3NTHA 5C4JB 2O5IC 1GUNA 2HDMA 2AQ1B 3N6RA 1SYGA 3TDQA 2KJXA 2SDFA 3J7AV 2FMMA 4TQUS 5FO8B 2KOLA 2JEAI 4K2KA 3URYA 1NUCA 2FJ2A 3M4OB 5CC4A 1SNDA 2I07B 2HQEA 3DWQA 2TSSA 1DD2A 5FOBB 4IUUA 4QCLA 2EJGC 3S14B 1DOLA 2KEEA 1GHJA 2BA1A 1CQFA 5M3FB 2IX1A 1HCZA 2B2TC 2L5TA 1STNA 5CV7A 1H9MA 2F0MA 1B4OA 2CHBD 2EJMA 1XTCD 3L9AX 1AFPA 1HA6A 3HOVB 2O4XA 1U4PA 5M9OA 5FK9C 2KECA 2ENBA 1HTPA 1NR2A 2NUCA 2WP8J 3CKIB 3VR6A 4X3SA 2J7ZA 4C3JB 1UUPA 4C3JG 1I4PA 1TIID 4XQQA 4ULLA 2XRSD 5KIXA 2IX0A 2SOBA 2F0PA 1UEAB 2NTSA 5CBAE 3PUYA 2PW7A 2PZTA 4IFDH 1SFOB 1OXXK 1A3UA 2JXMB 4I65A 1MSGA 1WTOA 1O7YA 5I9PA 1PTOF 4DXFA 1Q1BA 1Z7TA 2RQXA 2OXPA 2PQEA 4FF1A 3MXGA 3K6OA 3I72A 1STBA 1UNSA 1FNVA 1CA5A 1KLUD 2EXZA 5ELEA 1W6KA 3FMCA 4ME5A 3WOEA 3E6ZX 4LAAA 1W6JA 5JEAH 4ZKBB 3T53B 3TP7A 3V2TA 1EU3A 2EPBA 3I4MB 1SXTA 3V05A 1STYA 2MPMA 1CA6A 3D4RA 5J39A 3D3RA 3VR2A 1I50B 4Y7NB 2OT2A 1SAPA 2E75C 4K5WA 3E0JA 1FR3A 1KAAA 1II3A 1PLFA 1F9SA 5ISRA 4IQZA 1OXVA 2NBFA 2CVRA 5EPKA 3SHLA 1S5CD 4DK0A 2WAQB 3SEBA 3TMEA 5IGCA 1WTWA 3K57A 2A5HA 1AZPA 3I91A 2Q8IB 1MBYA 3QOLA 3MA2B 2B63B 1PFNA 4A3IB 4DA2A 3TZDA 2EJFC 3MXNA 2K5QA 3U9OA 4UDUC 1BCPF 4U68A 4Q5VA 3C1FA 2KA7A 5FLXL 2RDGA 3P20A 3H0GB 3H94A 5JVG3 1QB5D 1PZID 2WIIB 3PIO3 1RKNA 1EY8A 3L3OC 5LL6S 2PCFB 2V4DA 1CTMA 3I4LA 4MIUA 4IN3A 3IAYA 1H9SA 1IW7C 4HSPA 3P1HA 5E3FA 1EY4A 4K8IA 4LMQD 2K04A 2RA4A 3DWAA 5CBEE 5IGFA 2B39A 1VF5C 5EBCA 1OXSC 3JAME 2BOSA 2J4XA 5CV6A 3OWEB 3A7AB 3MEHA 3SK8A 1B1ZA 3VR5A 2F0KA 4H7BA 1A2UA 2PPBC 4J8QA 2EYOA 2VNUD 2B2WA 3HKZB 1GJXA 3ND9A 4QUFA 4QMGA 5KNBA 3Q22A 2A69D 4IFDI 4KHVA 4DK1A 2F0HA 1IW7D 3A7LA 3KK7A 4DAYA 2A6HC 3I70A 1RJTA 1B53A 4RWSC 1KNAA 5EKIA 2Q8TA 3RZOB 3K58A 2VUMB 5CMDA 1EOTA 2OEOA 1ONLA 3HP3A 3K59A 2GA4B 3N52A 5I6WA 4J6HA 1LO5D 1EYDA 1DM0B 1TS5A 2IPKD 4ZQ3A 4HCEA 2C9OA 1CK1A 3SVMA 1H9KA 1EWHA 1E2VA 5C3WA 1PTOC 2JA6B 1HHVA 5C4ZA 4IURA 1EIHA 5BN4A 1PRTB 1RD9D 4XT3B 5IGDA 3KBGA 2Q8RE 3DM1A 1IYVA 3EVQA 3HOZB 3R8BA 1PFBA 4K2LA 4X3TA 3FRPB 2XNAC 2XSCA 3I3CA 1HTLD 3I90A 1GUGA 2NN6G 4L8JA 2AQ2B 1WD0A 1EY0A 1VDZA 3GTKB 5FO9B 2Z8LA 2D5DA 3M85A 1PTOH 4KKSA 4CGYB 3ZYYX 1I4XA 3H09A 4A3DB 1AP0A 4ZYSA 2OF1A 1AN8A 2CW0C 1A3TA 2BDNA 4FYDA 4WJWA 1WVLA 1PZJD 1PXUA 5EKKA 1HXYD 1SYFA 2EY5A 2F1MA 4EQPA 3BDCA 1SYBA 2G9HD 4KY7A 4RGNA 1JWUD 3OSOA 1F2MA 4A3MB 2F0QA 4DU9A 3FEWX 3VR4A 1JWMD 2EDGA 1ZYRD 1MI2A 4HEDA 3P75A 2F0NA 4C1NK 3MTSA 3NTKA 5T1GA 3NP8A 3M3YB 4K5XA 1BCPC 5AFWA 4IFDJ 1TWHB 5FO7B 2XN9C 3NHHA 1PMRA 2JA8B 3MFYA 2LY7A 1NR4A 3SE0A 2H4OA 1MSHA 4F8MA 5J1ZA 2M2LA 3GD7A 1B9NA 3A54A 3LNNA 1JWSD 4FF2A 4WRDA 4FF3A 1U9RA 2EYHA 3TBIB 5EKLA 4IZ8A 2K6AA 4R9WA 3VYUA 1G91A 4C3HB 1B2TA 4C3HG 4BBRB 1SE2A 1T5EA 5E1FA 3RZDB 4KJNA 1GHKA 1J9OA 5JEAJ 3S2DB 1LT3D 1RHPA 2IJ0A 4H44C 2NVTB 1CM9A 4ZRZA 4PMWA 1FYCA 1QOHA 2RDHA 3TP5A 2K7VA 1LTTD 3J81L 1ZEQX 3C46A 1TS3A 1LT4D 2F0GA 3PO3B 4ZLTF 5I6YA 1JC7A 4ZK9B 5IODA 3EROA 1T5XD 5CR3A 1QE6A 2Y0SB 1SNOA 4ZUIA 1FGBD 2B2YA 4ILWA 3ERQA 1TU2B 1XX8A 1LT6D 5D65A 3EFXD 1V1OA 3MVVA 4KY6A 1GUSA 2EYMA 2FMCA 1H9SB 2KVMA 4GZYC 3MWYW 5M5YB 3SK4A 1QJOA 2BE5C 4XYQA 3GTOB 1JR0D 5DEHA 4B9XA 2ZXRA 4RGOS 5ELBA 2K5DA 5F2DA 1F2LA 2PZWA 5KRUA 1BBXC 3QWNA 1CI3M 3RUZA 1Q12A 3IFTA 1D5XC 4RGMA 3R93A 1IL8A 4AYBB 1LTBD 4RA8A 1QNUA 2L55A 2E2HB 3U9SA 1F9QA 3NPPA 5IT9E 1DYQA 1VF7A 5A2QL 4OIJA 2RVLA 5I2YA 5I4DA 4N9TA 1RF2D 3L7ZC 4Z9CB 2O5JC 3D4WA 3D6WA 2Z4IA 3NWSA 4HMIA 5LHY1 2HCCA 3GV3A 1A2TA 4A3GB 3VYTA 4P2CB 1EQTA 3NK9A 3AU7A 4NP5A 4IFDG 1CZGA 1DOMA 4JBWA 3DXJC 4JK1C 4KK7A 2JEBI 1IKLA 3NBIA 4B9WA 2AQ3B 4OO1H 3G7LA 5G3LF 2CQAA 2WKDA 1TWCB 4R8IA 3EA6A 3A56A 4DXGA 3T4AC 3VR3A 3HEJA 3GTJB 4A3FB 1STGA 5IGEA 3S17B 4K5VA 1HRJA 1PFMA 1EY9A 3OHXC 4QB4A 5BN5A 3RD4A 1TWFB 3P7JA 2EYJA 1EFID 2PNRC 2VB2X 2WKCA 1ML0D 3TP6A 5E4WC 2R61A 4RGTA 5EBDA 3EQLC 4I7ZC 2F4IA 3W3AA 1AEXA 1PRTF 2EY6A 3LWEA 1M8AA 3VYSA 1R4PB 3Q23A 3AB9A 2ZXOA 2JA5B 2K33A 5EQ0A 3C2PA 3ONAB 2XRQD 2B2VC 3KLSA 3BVMA 3D6CA 2M00A 3HOUB 1WTRA 3PUWA 5A35A 2IT1A 4DAVA 4FXKC 4E6IA 1JOQA 4KKTA 2EZVA 4KJOA 5NUCA 1CQVA 4A3JB 2L12A 1G291 1BR9A 3GTGB 1DZ1A 3R3OA 2B2UA 1HFGA 2A6EC 1STAA 1R4QB 1QG7A 2L0CA 4F88A 2BA0A 1B9MA 4IUTA 1RTNA 2N88A 3KF8A 3MXUA 4OL7A 1Y69U 5CYUA 3PV0A 3C3LA 2SEBD 5DNFA 1LTID 1SYEA 5CV9A 2QKIC 1LTSD 2DNCA 3DEPA 3SR1A 2IL8A 4F87A 3M4YA 1H9JA 2DY8A 1STHA 3H6MA 2LMCB 1OXUA 3R2IA 4HN7A 3T16A 4ZKCB 1EY7A 4DGZA 3GV6A 2ICEC 3CU7A 4NMZA 1EZ8A 2PO4A 4FXDA 5JAVA 1SE3A 5ELDA 1SNCA 1RCVD 1DONA 1LTGD 5JOBA 1BO0A 2HDLA 4CHTB 1CZWA 1BQQT 1V43A 3OPOA 4C56C 1PYWD 1PZKD 2R6GA 3S1QB 1GXDC 4BA2I 2DY7A 1B50A 1F77A 4G7ZC 5EGTA 5I9OA 4ZAIA 5C4HA 3PO2B 2F3WA 3BG3A 3K5OA 2PZUA 1I4HA 3BDOA 3GO5A 4A3EB 1WTVA 5KYLA 3WOFA 4OO1I 3OW7A 1C4QA 1KDCA 1ICWA 4EQNA 2QEJC 5K5PA 1ENFA 4HCSA 5IT9L 3K7AB 2F0DA 4OHJA 1EL0A 3X3MA 5KEEA 1IKMA 2N55A 1GUOA 1SNMA 4WORA 3BYTB 3BVGA 3CRLC 1JQYD 3CQZB 1EZ6A 4KD4A 3QJYA 2B2TA 1QNKA 3VYRA 4M8AA 5CV5A 3OWFA 2HUGA 2E2IB 4MHEA 1VCIA 1AZQA 3Q6SA 1HUNA 2PYKA 1KTKA 2EY1A 1D1IA 1YNJC 2QF7A 2Z1CA 2NVQB 4DN4M 1TS4A 2AWOA 2KCCA 4FVMA 3J7AF 2XVSA 5CORA 4BY1B 2A6HD 1PRTC 3I8ZA 2F0VA 3I4NB 4XQNA 1ILQA 1CT1D 1DXMA 3C1EA 5G3LD 3NQTA 1Y8PB 2R7ZB 1IYUA 1O7LA 3PUXA 4FXGC 3D8GA 2LFNA 1EEID 2JA7B 2A68C 1HPCA 5K36H 2NB0A 1SNQA 4K6LA 2LKVA 2K28A 4IUQA 2Z4HA 1YNJD 1PTOD 1ET6A 1Y8OB 1Q8IA 3HZXA 1LV9A 4XT1B 3S2HB 1WCMB 4QIWB 5C6AA 3KBXA 4PV1C 2F0FA 2HCIA 2R3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYC A;  2F0D A;  2F0E A;  5IOD A;  5I6W A;  3ERO A;  3QOL A;  4J6H A;  5J22 A;  1JOK A;  3NK9 A;  1EYD A;  3NP8 A;  5KEE A;  4ZQ3 A;  4NP5 A;  5CR3 A;  1KDA A;  1ENC A;  3R3O A;  2F3V A;  1A3U A;  3U9O A;  1SYD A;  2QDB A;  4K5X A;  2F0O A;  1SNM A;  1STA A;  4I65 A;  1SNO A;  4K2K A;  4WOR A;  4ZUI A;  1JOO A;  2PW5 A;  4IAL A;  4B9W A;  5IIF A;  3NXW A;  1KAB A;  3E5S A;  3C1F A;  5C3W A;  1NUC A;  1EZ6 A;  3ERQ A;  1EY5 A;  5C4Z A;  5I9P A;  3QB3 A;  5IGB A;  1JOQ A;  4KY5 A;  4KD4 A;  4PMC A;  3SK5 A;  2OXP A;  3NHH A;  5CC4 A;  2PQE A;  3LX0 A;  3D4D A;  4PNY A;  1RKN A;  4NDX A;  3MVV A;  1SND A;  1EY8 A;  4KY6 A;  2F0T A;  3OMC A;  5CV5 A;  2EYM A;  5IGD A;  3OWF A;  1STB A;  5CV4 A;  4OL7 A;  4RKL A;  3HEJ A;  3EVQ A;  1JOR A;  2EXZ A;  2HQE A;  1IHZ A;  4MIU A;  2KHS A;  4F8M A;  3DHQ A;  3T13 A;  5J1Z A;  4K2L A;  4K6D A;  4PMB A;  1SYE A;  4HTH A;  3SK4 A;  4G57 A;  1STG A;  1KDB A;  5CV9 A;  3SXH A;  5HGT A;  2SNM A;  5IGE A;  3P1H A;  2F0U A;  2PYK A;  5E3F A;  2RDF A;  1EY4 A;  4K5V A;  4K8I A;  2F0S A;  3EJI A;  5DEH A;  4B9X A;  4WRD A;  2EY1 A;  1EYA A;  2F0I A;  1U9R A;  3SR1 A;  1A3V A;  2EYH A;  3OMG A;  1EY9 A;  4QB4 A;  5EKL A;  4IZ8 A;  5F2D A;  1SYC A;  5C3X A;  5CGK A;  1EY0 A;  5IGF A;  2PZW A;  5KRU A;  4HMJ A;  2EYJ A;  4ME5 A;  1STH A;  1F2Z A;  2WAC A;  3RUZ A;  3SK6 A;  3DMU A;  1STN A;  4N9P A;  5CV7 A;  3TP6 A;  4K14 A;  2F0M A;  4LAA A;  2F0J A;  3H6M A;  3MHB A;  3MXP A;  3MZ5 A;  3TP8 A;  3T16 A;  1EQV A;  5CV6 A;  5KYI A;  2F0V A;  3MEH A;  3TP7 A;  3V2T A;  1AEX A;  3SK8 A;  1F2Y A;  1EY7 A;  2EY6 A;  2EYP A;  2O4X A;  4R8N A;  4DGZ A;  4EQO A;  2F0L A;  3BDL A;  2F0K A;  5C5L A;  5HUR A;  5E1F A;  2RBM A;  3C1E A;  4K8J A;  4KJN A;  2EY2 A;  1TR5 A;  2OF1 A;  3QOJ A;  4H7B A;  5M9O A;  1STY A;  3NQT A;  1A2U A;  4NMZ A;  1EZ8 A;  2EYL A;  1A3T A;  5JAV A;  4ODG A;  1SNP A;  2ENB A;  1SNC A;  4DF7 A;  2EYO A;  2NUC A;  5JOB A;  3S9W A;  5EKK A;  4F7X A;  1NSN S;  5DAU A;  1SYF A;  3ITP A;  5KGU A;  4KV6 A;  4ZUJ A;  5J39 A;  2EYF A;  4RKB A;  2EY5 A;  3D8G A;  1TT2 A;  5IGG A;  4KTA A;  4QMG A;  4EQP A;  5C6A A;  3BDC A;  3NUC A;  1SYB A;  4K5W A;  4KHV A;  4TRD A;  5EGT A;  1ENA A;  2F0H A;  5I9O A;  5C4H A;  2RKS A;  4KY7 A;  2F3W A;  3D6C A;  2M00 A;  4DFA A;  1SNQ A;  4J1M A;  3TP5 A;  4N9T A;  1EY6 A;  2LKV A;  2PZU A;  4ID6 A;  1TQO A;  2KQ3 A;  1KAA A;  4S3S A;  3D4W A;  1II3 A;  5ISR A;  3OSO A;  3VA5 A;  3PMF A;  1F2M A;  5KYL A;  2SNS A;  3HZX A;  3SHL A;  2F0Q A;  4EVO A;  4HMI A;  5CV8 A;  4DU9 A;  5KIX A;  4IUN A;  3TME A;  2SOB A;  4QF4 A;  2OEO A;  2F0P A;  5IGC A;  4E6I A;  1A2T A;  1KDC A;  2F0G A;  2F0N A;  3P75 A;  4KD3 A;  4KJO A;  4NKL A;  2F0W A;  4YIJ A;  5C5M A;  5NUC A;  4EQN A;  5I6Y A;  5K5P A;  1SYG A;  2F0F A;  2PW7 A;  2PZT A;  5IOC A; 
#chains in the Genus database with same CATH topology
 3FVQ A;  4IPD A;  2JJQ A;  4KKU A;  4JI3 Q;  1G2T A;  4DR6 L;  1DOK A;  2NN6 H;  1Q82 C;  1DJR D;  1ENC A;  3J7A 5;  2F0O A;  4BWG B;  2JSO A;  1JOO A;  2PW5 A;  4IAL A;  3BYY B;  3GTK H;  3EN2 A;  1IXR A;  1BOS A;  2D2C C;  1SLJ A;  1MD2 D;  3QR8 A;  1AE2 A;  3SK5 A;  1DCZ A;  3F2C A;  2XWB B;  1IYJ B;  3LX0 A;  2MO0 A;  4XYO A;  3KUP A;  2F0T A;  2A73 B;  4RKL A;  4C3I H;  2NVY B;  4A3D H;  1HNX Q;  1HQR D;  5JJZ A;  4LF6 L;  3PUV A;  1EWC A;  4K6D A;  4PMB A;  1UE1 A;  2KHI A;  5HGT A;  3HRZ C;  4V19 0;  2CW0 D;  4NW2 A;  4FO2 A;  2F0I A;  3CC7 A;  1A3V A;  3GTQ B;  1ZKO A;  4POG A;  1LYL A;  2WFW A;  5C3X A;  5CGK A;  1VQ7 A;  2E74 C;  3W1G A;  4LF7 L;  3S15 B;  4HMJ A;  1QVC A;  1VQ9 A;  4AQY L;  4DV2 Q;  3J80 i;  1SN8 A;  1WI5 A;  4K14 A;  4HJ9 A;  5JPN C;  1LM0 A;  1VQB A;  3MZ5 A;  1JIC A;  1B44 D;  1LTR D;  4TSS A;  3SGI A;  2EOT A;  3DWP A;  4UAI A;  2EYP A;  5D3D A;  2F0L A;  4A3M H;  4DR7 Q;  2RBM A;  3OIQ A;  3I73 A;  1H9R A;  1BF4 A;  2Z0S A;  2QA4 A;  5IP7 H;  1MJE A;  3HKS A;  2K52 A;  3TEH B;  5KGU A;  4KV6 A;  4IOC A;  2A74 C;  4CDE C;  5IWA L;  5JJK A;  3PIP 3;  1F9R A;  4IPC A;  2F3I A;  4BA1 I;  4KTA A;  5IGG A;  3VA7 A;  3NUC A;  1I6H B;  1V8Q A;  2E5L L;  3M3Y H;  3F2D A;  4FP5 D;  1GM5 A;  2RKS A;  4TKO B;  1N9W A;  2LXJ A;  1I3Q B;  1ET9 A;  1GVP A;  2WB1 B;  2L9H A;  1BCP D;  1EY6 A;  2WB1 G;  3G6J B;  4DNT B;  5EPJ A;  1TWH H;  1E2W A;  1XNQ Q;  4Q0F A;  1EYG A;  1RTO A;  1HNW L;  4X64 Q;  2HHH Q;  2JA8 H;  1VQD A;  5TSS A;  4DUZ Q;  4PG3 A;  4DV7 L;  2VS1 A;  2L4N A;  5C5M A;  4XXE A;  1HUM A;  2K50 A;  1RDP D;  3KLS X;  2F0E A;  4BBS B;  4C2M B;  1XMO L;  4GLX A;  3JAM L;  1X54 A;  1QWY A;  1PYB A;  2AUJ D;  3AEV A;  4OGQ C;  1KLG D;  2EVB A;  1YNN C;  3DEO A;  3PF5 A;  2DUD A;  1HNW Q;  1WOC A;  4DV3 L;  4JPB W;  4AIM A;  1SDF A;  4KY5 A;  1SR3 A;  4DV7 Q;  3KF8 B;  2FHT A;  1M90 C;  4C3H H;  2I0Q A;  4A3K B;  4JV5 Q;  1CKO A;  3TSS A;  4A3K G;  4BBR H;  1PH2 A;  1O80 A;  1XWE A;  2K01 A;  4LFC L;  3RZD H;  2K14 A;  1V1P A;  2AMC B;  3QO2 A;  3AMU A;  4DR3 Q;  2QDL A;  2R7F A;  4DR4 L;  4QJF A;  2RDF A;  3S2D H;  1RL2 A;  4KHZ A;  3K5N A;  4CJ2 C;  5BN3 A;  4X62 Q;  3PSI A;  1I4R A;  4XIG S;  4FNF A;  4XQJ A;  3HOY G;  3SK6 A;  1F2Z A;  2RSN A;  3D31 A;  3DMU A;  1NBW A;  3TRE A;  1TVX A;  2X6L A;  2F0J A;  1A0I A;  2WAQ E;  4Y52 H;  1XXG A;  3BDL A;  4YWK A;  3CME A;  4RAU C;  3A5Z B;  2XWJ B;  5FLX E;  5IE8 A;  3HGB A;  2Q2I A;  4R4O A;  3PO3 H;  3KDF A;  1BNZ A;  3NWT A;  3O13 A;  4F7X A;  1NSN S;  5GAE C;  2MUY A;  3K5L A;  5D14 A;  2K5V A;  1IBM Q;  1Q81 C;  1PH3 A;  4L6T B;  1TT2 A;  2VQF L;  3RLF A;  4DAP A;  5JPM C;  3MAQ A;  5C0X H;  1A62 A;  1ENA A;  2JQO A;  4CJ0 B;  4KI0 A;  1I94 L;  3RNU A;  3W1B A;  3FKI B;  2ZTD A;  1KHI A;  2D0P A;  1NCV A;  1SJH D;  2NN6 I;  4B08 A;  3L0O A;  1U4R A;  2KQ3 A;  1U4L A;  3NE5 B;  1L1O B;  3PMF A;  3TZU A;  2SNS A;  2MNA A;  4M1U B;  5CV8 A;  2KCN A;  4HAE A;  3BU2 A;  1VQP A;  1QZG A;  4IJL A;  1S4Z A;  4KD3 A;  4HSV A;  4JI1 L;  1UE6 A;  4KHP Q;  5M5Y H;  3E0E A;  2B2W C;  2VB3 X;  1JJG A;  1EYC A;  1ZXT A;  5J22 A;  4JI7 Q;  3GTO H;  4OIK A;  2BE5 D;  4HIK A;  3HOW B;  5M5W B;  2QDB A;  1SE4 A;  2J0T D;  5IIF A;  1FNU A;  3E5S A;  1WTQ A;  3S1N B;  2NYZ D;  2UU9 Q;  3PCO B;  4OON A;  4PMC A;  5EAY A;  5DM6 3;  4OO1 G;  2IX3 A;  3GTL B;  2RF4 A;  1BDO A;  1C8C A;  1D6E C;  4RH6 A;  3CCM A;  4RCN A;  2KHS A;  4X3U A;  1QCB D;  3CHB D;  5JVH 3;  5IYC G;  2IWH A;  4O1N A;  2SNM A;  3HKZ E;  1PDQ A;  4BXX H;  3H91 A;  2B3G A;  2E2H H;  1JJC B;  2K32 A;  3UDI A;  1STE A;  2K05 A;  4OWT B;  3KFU A;  3J80 E;  4POF A;  2MQH A;  1A6X A;  2IW3 A;  3HOV H;  3MXP A;  3GQB A;  4OWW B;  3FPU B;  3GDE A;  1F2Y A;  5AJ3 L;  5M5X B;  2FXQ A;  4KN4 C;  4NXN L;  4A3L H;  1M4V A;  1GOZ A;  2NZO A;  1J5E Q;  3GTM B;  5E7N A;  2NZ1 D;  4ODG A;  4A3G H;  4DF7 A;  1N32 L;  3BJU A;  3S9W A;  3CCE A;  1A63 A;  5DAU A;  3ITP A;  3EBE A;  1XPO A;  4RMF A;  4GKK Q;  4DR1 Q;  3UDF A;  2Z6K A;  1E0B A;  1X3F A;  3X3N A;  1GUT A;  1X32 A;  4GKJ L;  2RCN A;  2VQE L;  4DR2 L;  1OTC A;  2QCP X;  1TQO A;  2RHQ B;  5JEA G;  1K83 B;  1TWC H;  1WD1 A;  1N32 Q;  1E22 A;  4H13 C;  5C4X B;  3W2D A;  2C5C A;  5E4X A;  1F9P A;  3GTJ H;  1SE8 A;  4YIJ A;  1C0A A;  2YU9 B;  4G7H C;  2C35 B;  5KNC A;  4A3F H;  2NWG A;  4DNR B;  1SEB D;  2XIW A;  1JOK A;  2MJ8 A;  1VMC A;  4L5Q A;  2BH2 A;  1TWA B;  1VQM A;  2DN8 A;  1W2B A;  4IJH A;  1XTD A;  3IFD A;  1TWF H;  1L0X B;  3QB3 A;  4LJZ C;  4RHS A;  5C44 B;  2KBN A;  2VL6 A;  5C44 G;  1LTA D;  3HOX B;  4LK1 C;  3HOX G;  3GP7 A;  1FD7 D;  5CV4 A;  4DV0 L;  4TVA B;  1X55 A;  1MGS A;  3KLR A;  3DHQ A;  4A3C G;  4QIW E;  1YVC A;  1VQ8 A;  4LFB Q;  1XJV A;  2PMZ B;  1A15 A;  4KMU C;  2AUK A;  1TWG B;  2OQK A;  3CCL A;  2ZM6 L;  1JB3 A;  2K03 A;  1EU4 A;  5H1S E;  4L5S A;  1FJG L;  1O78 A;  4A93 B;  4DV0 Q;  3HOU H;  1XYI A;  1SJE D;  1S5B D;  5LL6 X;  3TP8 A;  5C0X I;  5KYI A;  1EQV A;  3NBH A;  4EQO A;  1LTL A;  5C5L A;  4BY7 B;  4K8J A;  3CAM A;  4BY7 G;  2EY2 A;  2MHV A;  1JMC A;  2K5W A;  1LAB A;  1U4M A;  3AFP A;  4LFA Q;  2XGT A;  1ILP A;  1LAC A;  2NVX B;  3OW2 A;  2R92 B;  3J7Z C;  1HQM C;  2R92 G;  5FKA C;  5DM7 3;  4IPH A;  3S24 A;  5COY A;  5HGQ A;  4A3B B;  5ELC A;  1B3A A;  3A5U A;  4EGV A;  4HJ5 A;  4DFA A;  2A6E D;  1VQ6 A;  3ULJ A;  1JE4 A;  4G7O C;  1G2S A;  1QUQ A;  3CRK C;  3HS0 C;  4S3S A;  2EQS A;  3VA5 A;  3NQI A;  4DV6 L;  4JI0 L;  2AKW B;  1I4G A;  4IUN A;  2E76 C;  1XNR L;  4QF4 A;  1TY0 A;  3M9B A;  1HFN A;  1K8M A;  4NKL A;  3H3V C;  1HNZ L;  2DJF C;  3L2P A;  5BR8 L;  1E7Z A;  2A69 C;  2H1E A;  1D8L A;  2M9V A;  1G8Z D;  3F8T A;  1LLR D;  2O2L D;  5IT9 c;  1SYD A;  3R2T A;  1HR0 Q;  1SSO A;  4UP9 A;  3A8J E;  1EEF D;  2JP1 A;  3NXW A;  3H0G H;  2R93 B;  3M7N A;  1O7Z A;  1JCK B;  2F03 A;  1EY5 A;  2L11 A;  3IKJ A;  1CKN A;  5ELO A;  2JE6 I;  3BZD B;  3F2B A;  3UDX A;  4DUY Q;  1SBB B;  3CCR A;  1D1K A;  1V1P B;  4CKB A;  3BVZ A;  4X65 Q;  1VQK A;  4IUV A;  3F2U A;  3T13 A;  3J81 E;  3K0X A;  3RMH A;  3H3V H;  2VXW A;  4DKA C;  3J7Y W;  2F0S A;  4O0A A;  1K8A C;  2ZJP A;  1EYA A;  5IP9 H;  2D62 A;  2I46 A;  3MC0 B;  2HQL A;  2YTV A;  3OMG A;  1D5Z C;  1J8I A;  3A55 A;  2B2Y C;  3GTP B;  3S1Q H;  1SYC A;  1X3P A;  3OOC A;  1QVF A;  4O42 A;  3PO2 H;  3OYY A;  4V0B A;  1XPU A;  1UE7 A;  2WAC A;  1X3Q A;  4N9P A;  5C3E B;  4PZ7 A;  1V1Q A;  1LUZ A;  3ND8 A;  5I2X A;  4H02 A;  5C3E G;  3DUZ A;  1K8G A;  1Y1V B;  1Y1W B;  4A3E H;  1Y1V G;  1Y1W G;  1I4Q A;  1K9M C;  3NEL A;  4LF9 Q;  2KED A;  4CKC A;  4IUP A;  4RFB A;  4U67 3;  5HUR A;  4XTC S;  3KDF B;  3QG1 A;  3Q24 A;  5LMN W;  3K0Y A;  1WTX A;  3E3X A;  4UY8 C;  2BDO A;  4RG1 A;  4IPG A;  1NAP A;  2Y0S E;  3K7A H;  4CJ1 B;  1EIG A;  1ESR A;  3J80 L;  2EYF A;  1ROD A;  1IBL L;  4TRD A;  1VQE A;  3TN2 A;  4JYA Q;  2E2J B;  1LT5 D;  5J3B A;  2UXD Q;  4X3K A;  1PTO B;  3CQZ H;  3OIP A;  4J1M A;  1XMQ L;  1GUW A;  5K36 G;  1IBK Q;  5ELF A;  4MZ9 A;  3RZO H;  5C0X J;  1N34 L;  1E1O A;  4BS9 A;  4YCU A;  3CD6 A;  1S5D D;  2YTX A;  3LGJ A;  1QIL A;  2E2I H;  3A8I E;  2F0W A;  3A8K E;  4NXM L;  3S16 B;  5IOC A;  2LS0 1;  3FPP A;  3V96 A;  1BBW A;  4FDB A;  5KND A;  4MTN A;  4CKE A;  4MNO A;  1M1K C;  4A76 A;  2B29 A;  2FIN B;  3HG9 A;  1E2Z A;  2EE1 A;  1K3R A;  3BZC A;  1H95 A;  4FF4 A;  2CH4 A;  1KAB A;  3KOJ A;  4R4T A;  5IGB A;  1K8O A;  1YIJ A;  4B3S Q;  1HA5 A;  1CHP D;  2AWN A;  4AYB E;  4JI8 Q;  4BY1 H;  4NDX A;  1ZYR C;  1Q3L A;  3I4N H;  3HOZ H;  3OMC A;  4GOP A;  3CCV A;  3S1R B;  5A2Q E;  1PRT D;  2NTT A;  1JOR A;  1S5E D;  3MFG A;  3FDT A;  2X69 A;  2HT1 A;  1WTP A;  1Q90 A;  4C3I B;  5T1I A;  4C3I G;  2R7Z H;  3ICE A;  4A3D G;  3BS1 A;  2B8G A;  2F0U A;  1CHQ D;  2RCF A;  1VQL A;  4LF4 L;  4YWL A;  4OWX B;  3EJI A;  3ER0 A;  2D9U A;  3BZK A;  4P72 A;  3RN5 A;  2BCO A;  1NMF A;  1FNW A;  1D2B A;  4GN4 B;  2QEX A;  2B2V A;  2A68 D;  1Q1E A;  1C48 A;  4JI4 L;  1VQN A;  4XDX A;  3MHB A;  1WYD A;  2MGS A;  4C1N I;  4DR5 L;  1Y8N B;  4R8N A;  3WDN A;  4DR6 Q;  2VY3 A;  1AW7 A;  2ZJR A;  2B8F A;  2E2D C;  2UXB L;  2DNE A;  2WIN B;  1TR5 A;  1WCM H;  2E8G A;  2ICI A;  4KN7 C;  3UI2 A;  1EQR A;  4A3M G;  1D5M C;  3KYH C;  3IL8 A;  2K1B A;  4JOI C;  4JVZ A;  1KC8 C;  1SMY C;  4MN3 A;  3PIO A;  4NB3 A;  1ICF B;  1ESF A;  2FFK B;  1BXT A;  4JG2 A;  5L37 A;  1YIT A;  5GQO A;  1BCP B;  4LF6 Q;  3CC4 A;  4RCO A;  4DR5 Q;  1KQS A;  1VS0 A;  1UE5 A;  4ABN A;  1I6V C;  4APV A;  3Q0A A;  4LF5 L;  3PQI A;  1TS2 A;  4EVO A;  2P5Z X;  2JYO A;  2NVY H;  2PI2 E;  4LF7 Q;  4R4Q A;  4YHH L;  4PQX A;  4AQY Q;  2HIV A;  2JA8 G;  1VMP A;  2QIL A;  5D3I B;  3SDZ A;  1BUV T;  1TKW B;  3NSW A;  1S5F D;  1KDA A;  2KUM A;  3GTQ H;  2F3V A;  3AFQ A;  3H3V I;  1Q7Y C;  1PVO A;  2QW7 A;  1P16 A;  4N8F A;  3JAM c;  4H0L C;  1B70 B;  1PHJ A;  3S1M B;  3T56 B;  4JC0 A;  4DK3 C;  4L63 B;  1SMY D;  2ID0 A;  1VQJ A;  3T51 B;  3D4D A;  4PNY A;  5IWA Q;  4WFN 3;  2E5L Q;  1IHZ A;  1SRU A;  2YV5 A;  3M7G A;  1UAP A;  1CFM A;  4HTH A;  4G57 A;  3SXH A;  1KDB A;  2RHS B;  5M3M B;  2IHF A;  5M3M G;  4G4K A;  2B2U C;  1G6Z A;  1OXT A;  2OQ0 A;  1R9T B;  2IHE A;  1ASY A;  1I6H H;  4N8X 1;  3LWU A;  1OO9 B;  4DV4 L;  2RSO A;  1VQI A;  1Z6H A;  1I3Q H;  4OXP A;  2ZXP A;  1NTG A;  3NBH B;  3K5M A;  2TMP A;  3NTI A;  1XMO Q;  2ZT9 C;  1SRO A;  4LUO A;  2G9D A;  2A19 A;  1PA6 A;  4RHR A;  3QOJ A;  1L0Y B;  2EYL A;  4LF8 L;  3Q8D A;  2NVT H;  1SNP A;  4QUC A;  3STB C;  1BBU A;  2L1B A;  3I56 A;  4DV3 Q;  1Z47 A;  3HOY B;  2Q2U A;  4C2M H;  4ZUJ A;  3U58 A;  4BBS H;  4RKB A;  2YYZ A;  3T1Y L;  4R4I A;  4HR7 B;  1KNE A;  1TY2 A;  2MP1 A;  5EPL A;  3PUZ A;  4LFC Q;  5EJW A;  1QUQ B;  2WV6 D;  2X6G A;  4CBV A;  4ID6 A;  5C0X G;  1YNN D;  3QIA A;  3NTH A;  4DR4 Q;  2K5N A;  2CFM A;  5C4J B;  1MIU A;  4ME3 A;  4HIM A;  2O5I C;  3K81 C;  1GUN A;  4A3K H;  2HDM A;  3DM3 A;  2AQ1 B;  1VQ5 A;  1PH6 A;  1YZ6 A;  3N6R A;  1SYG A;  3TDQ A;  2KJX A;  4YCW A;  2SDF A;  3J7A V;  4HJ8 A;  4PZ6 A;  5JJI A;  3OTO L;  2FMM A;  4TQU S;  5FO8 B;  2KOL A;  2JEA I;  4K2K A;  3ZJY C;  3URY A;  4MTK A;  1CKN B;  1NUC A;  2FJ2 A;  3M4O B;  1L1O C;  5CC4 A;  3UE0 A;  1L2F A;  1SND A;  1HH2 P;  2I07 B;  2VQF Q;  2HQE A;  3DWQ A;  3KLW A;  2TSS A;  1I94 Q;  1MHW C;  1DD2 A;  5FOB B;  2UUC L;  4IUU A;  4LWC A;  1C7Y A;  1YHA A;  4QCL A;  2EJG C;  2UXC L;  4JBM A;  2JN4 A;  3S14 B;  1RIP A;  1DOL A;  2KEE A;  2A8V A;  1GHJ A;  4HIO A;  2BA1 A;  1X9N A;  1PH4 A;  1CQF A;  5M3F B;  2XTI A;  2IX1 A;  4JI1 Q;  1HCZ A;  2B2T C;  5M3F G;  2L5T A;  1STN A;  3FKI H;  1Q8K A;  1H9M A;  5CV7 A;  2F0M A;  1B4O A;  2CHB D;  2EJM A;  1XTC D;  3L9A X;  1AFP A;  1HA6 A;  3HOV B;  2O4X A;  3HOV G;  1U4P A;  5LMU L;  3JC6 6;  3J81 i;  5M9O A;  4JCV E;  4B3M L;  5FK9 C;  2KEC A;  2ENB A;  1HTP A;  1NR2 A;  2NUC A;  5FJ8 G;  5IYB H;  2JA9 A;  3AYH B;  4A3G G;  2WP8 J;  2ATW A;  3CKI B;  4B3R L;  3HOW H;  5M5W H;  3VR6 A;  4X3S A;  4L5R C;  2J7Z A;  4C3J B;  1UUP A;  4C3J G;  3S1N H;  2N78 A;  2N8N A;  1I4P A;  2QGQ A;  1TII D;  4XQQ A;  4ULL A;  3GTL H;  2XRS D;  5KIX A;  3CCU A;  2IX0 A;  2A1A A;  2SOB A;  2F0P A;  1VQC A;  1UEA B;  1O7I A;  4YCV A;  2NTS A;  5CBA E;  1YJ9 A;  1QVG A;  3PUY A;  2PW7 A;  2PZT A;  4B3R Q;  4DV1 L;  1SFO B;  4IFD H;  1OXX K;  2OTL A;  5JJL A;  5IYD H;  5AJ3 Q;  4NXN Q;  1A3U A;  1MKH A;  2JXM B;  1ASZ A;  4IOA A;  4I65 A;  1MSG A;  1WTO A;  1O7Y A;  1T9H A;  5I9P A;  2CH4 W;  1PTO F;  4UPA A;  3WWV A;  4DXF A;  1Q1B A;  2KCM A;  1B8A A;  1Z7T A;  2RQX A;  2OXP A;  4GOP B;  2PQE A;  4FF1 A;  1PH1 A;  3MXG A;  3K6O A;  1KRS A;  3I72 A;  5M5X H;  2F52 A;  3M4Q A;  1STB A;  1UNS A;  3TRZ A;  1FNV A;  4GOP C;  1CA5 A;  1KLU D;  2EXZ A;  5ELE A;  3S17 H;  3GTM H;  1W6K A;  4GKJ Q;  3KJO A;  1B3Q A;  2VQE Q;  4QY7 A;  4DR2 Q;  4K0K L;  1EUJ A;  3J81 j;  4HJA A;  4JBK A;  3MEF A;  3FMC A;  4ME5 A;  3WOE A;  4R4C A;  3E6Z X;  3I4O A;  4LAA A;  1W6J A;  5JEA H;  4ZKB B;  1J6Q A;  3T53 B;  3TP7 A;  3V2T A;  1EU3 A;  1K83 H;  2EPB A;  3I4M B;  5GAD C;  3I4M G;  1SXT A;  5C4X H;  3V05 A;  1STY A;  2MPM A;  1CA6 A;  2DGY A;  2VW9 A;  3D4R A;  2YU9 H;  3I2Z A;  1PH9 A;  2JA5 H;  2N49 A;  2GVB A;  4QQB X;  5J39 A;  3D3R A;  3VR2 A;  4OX9 L;  1I50 B;  4Y7N B;  2OT2 A;  1SAP A;  2I5M X;  1TWA H;  2E75 C;  4K5W A;  2KCT A;  2PQA A;  3E0J A;  4GNX A;  3F1Z A;  3IRB A;  1FR3 A;  1KAA A;  1II3 A;  1PLF A;  1F9S A;  5ISR A;  5GRO A;  4IQZ A;  3E9H A;  1OXV A;  2NBF A;  2CVR A;  5EPK A;  3SHL A;  3U50 C;  1S5C D;  4DK0 A;  2WAQ B;  2ZM6 Q;  2WAQ G;  3SEB A;  3TME A;  4A3J H;  5IGC A;  1WTW A;  1FJG Q;  4A3C H;  3K57 A;  2A5H A;  1AZP A;  3GTG H;  3I91 A;  2Q8I B;  1MBY A;  3QOL A;  3MA2 B;  2B63 B;  1PFN A;  4A3I B;  4DA2 A;  1TWG H;  1HR0 W;  2B63 G;  3TZD A;  2EJF C;  4A3I G;  3MXN A;  2K5Q A;  3U9O A;  1G51 A;  1U0L A;  4UDU C;  1BCP F;  4L5T A;  4U68 A;  2CQO A;  4Q5V A;  3C1F A;  2KA7 A;  4UHV A;  5FLX L;  1WJJ A;  4A93 H;  4UP8 A;  2RDG A;  3P20 A;  3H0G B;  3H94 A;  5JVG 3;  1QB5 D;  1PZI D;  2WII B;  3PIO 3;  3H0G G;  1BVS A;  1RKN A;  1EY8 A;  3L3O C;  5LL6 S;  2PCF B;  1N36 L;  1UWV A;  4CDC C;  4BY7 H;  2V4D A;  1CTM A;  3I4L A;  4MIU A;  2EXD A;  4IN3 A;  3IAY A;  1H9S A;  1IW7 C;  3RR5 A;  4HSP A;  2F4V L;  3P1H A;  5E3F A;  1EY4 A;  4K8I A;  4YWM A;  4LMQ D;  1PH8 A;  4YY3 L;  2K04 A;  2NVX H;  2R92 H;  3NEM A;  4EX5 A;  4DV6 Q;  4JI0 Q;  2RA4 A;  1KD1 C;  3DWA A;  2WB1 E;  5CBE E;  1XNR Q;  5IGF A;  4B3T L;  2B39 A;  1DGS A;  4A3B H;  1VF5 C;  5EBC A;  2L15 A;  1K73 C;  1HNZ Q;  1OXS C;  3JAM E;  4QGU A;  2BOS A;  2J4X A;  5BR8 Q;  3ERS X;  5CV6 A;  5HY6 A;  3OWE B;  3A7A B;  3MEH A;  3SK8 A;  1B1Z A;  3CCQ A;  3VR5 A;  3ULP A;  2F0K A;  5FLM G;  4H7B A;  4A3E G;  1A2U A;  1X3E A;  2GN5 A;  2PPB C;  2ASB A;  4J8Q A;  3ULL A;  3PF4 A;  2EYO A;  3EIV A;  2VNU D;  2B2W A;  3HKZ B;  1Q46 A;  1GJX A;  3ND9 A;  3HKZ G;  4QUF A;  4QMG A;  3A0J A;  5KNB A;  3Q22 A;  2A69 D;  4IFD I;  1EOV A;  4KHV A;  4DK1 A;  2F0H A;  1IW7 D;  3A7L A;  3KK7 A;  1HZA A;  3J80 c;  4DAY A;  4WJ3 M;  2A6H C;  1PYS B;  1TXY A;  4GS3 A;  3I70 A;  2R93 H;  1RJT A;  1N33 L;  1B53 A;  3CF5 A;  1VQO A;  4RWS C;  1KNA A;  5EKI A;  2Q8T A;  3RLO A;  1CUK A;  3CCS A;  3K58 A;  3RZO B;  2VUM B;  5CMD A;  1HZB A;  1EOT A;  2OEO A;  2VUM G;  2D0O A;  1ONL A;  3HP3 A;  3K59 A;  2GA4 B;  1GO3 E;  3N52 A;  3UDG A;  5I6W A;  2ZJQ A;  4J6H A;  1LO5 D;  1EYD A;  1DM0 B;  1TS5 A;  2IPK D;  4ZQ3 A;  4HCE A;  2C9O A;  1N33 Q;  1CK1 A;  3SVM A;  1H9K A;  1EWH A;  1E2V A;  3K8A A;  1K0S A;  5C3W A;  1PTO C;  2JA6 B;  1HHV A;  5C4Z A;  2HIX A;  2JA6 G;  5LMN L;  2EIF A;  5C3E H;  4IUR A;  1EIH A;  5BN4 A;  1PRT B;  1RD9 D;  4XT3 B;  5IGD A;  1IL2 A;  3KBG A;  1K0R A;  2Q8R E;  3DM1 A;  1IYV A;  3EVQ A;  1IBL Q;  4BY1 G;  3HOZ B;  3R8B A;  5ELN A;  1AE3 A;  3HOZ G;  1PFB A;  4K2L A;  4JI6 L;  3I4N G;  4X3T A;  3FRP B;  2XNA C;  2V1C C;  1XMQ Q;  2XSC A;  5GAH C;  3I3C A;  1HTL D;  2PI2 A;  2NVQ H;  3I90 A;  1Y14 B;  1GUG A;  2R7Z G;  1N34 Q;  2NN6 G;  4L8J A;  2ZTE A;  2AQ2 B;  1WD0 A;  1EY0 A;  1VDZ A;  2E2J H;  3GTK B;  5FO9 B;  1EIF A;  1YI2 A;  2Z8L A;  4NXM Q;  2D5D A;  1V9P A;  2UUB L;  3M85 A;  1PTO H;  4KKS A;  4CGY B;  3ZYY X;  3K80 C;  4JI3 L;  1I4X A;  4JI6 Q;  3H09 A;  4A3D B;  1AP0 A;  1I5F A;  4GN5 A;  4ZYS A;  2OF1 A;  1AN8 A;  2CW0 C;  1B7Y B;  1A3T A;  2BDN A;  4FYD A;  4WJW A;  1WVL A;  1PZJ D;  4JI2 L;  1PXU A;  5EKK A;  1WCM G;  1HXY D;  1SYF A;  1NY4 A;  2JA7 H;  4CDD C;  2EY5 A;  2F1M A;  3TS0 A;  4EQP A;  3BDC A;  1HNX L;  1SYB A;  2G9H D;  4KY7 A;  1EQQ A;  2H5X A;  4RGN A;  4LF4 Q;  1JWU D;  3OSO A;  1UEB A;  5DLQ E;  1F2M A;  3S2H H;  4A3M B;  2F0Q A;  4DU9 A;  4JI2 Q;  3FEW X;  1VQG A;  1E3P A;  3VR4 A;  2VZA A;  1JWM D;  1ZYR D;  1MI2 A;  2EDG A;  4HED A;  3S1R H;  3P75 A;  2F0N A;  4DV2 L;  4X66 L;  1VQF A;  4C1N K;  5IP7 G;  4JI4 Q;  3MTS A;  2Z6K C;  3NTK A;  5T1G A;  3NP8 A;  1Q86 C;  1FL0 A;  2K5H A;  4DR7 L;  3M3Y B;  4K5X A;  2UXB Q;  1NJI C;  1BCP C;  5AFW A;  4IFD J;  3CC2 A;  4LW1 A;  1TWH B;  5FO7 B;  2XN9 C;  1U5K A;  3NHH A;  4X66 Q;  1PMR A;  3K7U C;  2JA8 B;  3MFY A;  2LY7 A;  1NR4 A;  1IZ6 A;  2Z6B A;  3SE0 A;  2H4O A;  1MSH A;  4F8M A;  3M4P A;  4R1J A;  5J1Z A;  2M2L A;  3GD7 A;  1B9N A;  2KHJ A;  3CXC A;  3A54 A;  3LNN A;  1JWS D;  4FF2 A;  1X3G A;  1XNQ L;  4LF5 Q;  4WRD A;  4FF3 A;  3S15 H;  1U9R A;  3CP0 A;  4X64 L;  3T1H L;  2HHH L;  2EYH A;  3TBI B;  2G5D A;  2Z9H A;  5EKL A;  4IZ8 A;  4DUZ L;  2K6A A;  4R9W A;  1KIX A;  3VYU A;  4YHH Q;  1G91 A;  1AH9 A;  4EQ5 A;  4C3H B;  1B2T A;  4ZCK A;  2BH8 A;  4C3H G;  2ALY B;  1YBY A;  2K75 A;  4BBR B;  1SE2 A;  1T5E A;  4BBR G;  2MFI A;  5E1F A;  3RZD B;  4KJN A;  5GAG C;  4AH6 A;  3H15 A;  1GHK A;  1J9O A;  3T1H Q;  5JEA J;  3J81 c;  1X65 A;  3S2D B;  1LT3 D;  3G4S A;  1RHP A;  2IJ0 A;  4H44 C;  2NVT B;  3PGZ A;  4JV5 L;  2PQA B;  1CM9 A;  4ZRZ A;  4GNX B;  4PMW A;  1FYC A;  4BBS G;  1QOH A;  2RDH A;  1P8L A;  4A4I A;  4GNX C;  3TP5 A;  4DR3 L;  2K7V A;  1LTT D;  3J81 L;  1VQ4 A;  1ZEQ X;  3S1M H;  2YTY A;  3C46 A;  1TS3 A;  1LT4 D;  4X62 L;  2PMZ E;  1CSP A;  2F0G A;  4DV4 Q;  3PO3 B;  4ZLT F;  5I6Y A;  3PO3 G;  3KF6 A;  1JC7 A;  4ZK9 B;  5M3M H;  5IOD A;  3ERO A;  3MXN B;  1T5X D;  5CR3 A;  1QE6 A;  2Y0S B;  1R9T H;  2Y0S G;  1SNO A;  4ZUI A;  1FGB D;  2B2Y A;  4ILW A;  1D7Q A;  4LF8 Q;  3ERQ A;  1TU2 B;  1XX8 A;  1LT6 D;  5D65 A;  3EFX D;  1IBM L;  2AHO B;  1V1O A;  3MVV A;  1N8R C;  4KY6 A;  2OWO A;  1FGU A;  3T1Y Q;  1GUS A;  2EYM A;  2FMC A;  1H9S B;  2KVM A;  4GZY C;  3MWY W;  5M5Y B;  1PH5 A;  3SK4 A;  1QJO A;  2BE5 C;  2LXK A;  4XYQ A;  3GTO B;  1JR0 D;  5DEH A;  4B9X A;  3STB D;  3FP9 A;  3HOY H;  1EIY B;  2ZXR A;  4RGO S;  5ELB A;  2K5D A;  5F2D A;  2N3S A;  2MO1 A;  1F2L A;  2PZW A;  5KRU A;  1YJN A;  1BBX C;  2CCZ A;  3QWN A;  4KHP L;  1CKM A;  1CI3 M;  3RUZ A;  1Q12 A;  3IFT A;  3D0F A;  4I7A A;  1D5X C;  4RGM A;  4LUZ A;  4JI7 L;  3R93 A;  5C4J H;  2CWA A;  3FKI G;  3OTO Q;  1IL8 A;  4AYB B;  1LTB D;  3G6E A;  4RA8 A;  1QNU A;  2KEN A;  4AYB G;  1CSQ A;  4DPG A;  2UU9 L;  2L55 A;  4BXX G;  2E2H B;  1KAW A;  1NNX A;  3U9S A;  2K4K A;  1F9Q A;  3NPP A;  5IT9 E;  1DYQ A;  1G6P A;  1VF7 A;  4DAY B;  5IYB G;  5A2Q L;  4DK6 C;  4OIJ A;  3JAM i;  2RVL A;  5I2Y A;  5I4D A;  4N9T A;  2UUC Q;  3HOW G;  1RF2 D;  3L7Z C;  4Z9C B;  4LNQ A;  2O5J C;  2UXC Q;  3D4W A;  3D6W A;  2Q2T A;  3M4O H;  2Z4I A;  3NWS A;  4HMI A;  4A3L G;  5LHY 1;  2HCC A;  1XPR A;  3GV3 A;  1A2T A;  4A3G B;  3VYT A;  1PFS A;  4P2C B;  1EQT A;  3NK9 A;  3AU7 A;  3S14 H;  4NP5 A;  4IFD G;  1CZG A;  1DOM A;  4JBW A;  1J5E L;  4GLV B;  3CCJ A;  5LMU Q;  3DXJ C;  4JK1 C;  2OCE A;  4KK7 A;  3U4Z A;  2JEB I;  2UUA L;  1IKL A;  1NE3 A;  1JT8 A;  3NBI A;  4B9W A;  2AQ3 B;  5IYD G;  5M3F H;  4B3M Q;  4OO1 H;  3G7L A;  1E24 A;  5G3L F;  2CQA A;  2WKD A;  1TWC B;  1YJW A;  4R8I A;  3EA6 A;  4GKK L;  3A56 A;  4DXG A;  4DR1 L;  1W3S A;  5IYC H;  1A8V A;  3T4A C;  3VR3 A;  3HEJ A;  3GTJ B;  3TS2 A;  3PIP A;  2ES2 A;  1JE5 A;  4A3F B;  1STG A;  5IGE A;  4A3F G;  3S17 B;  5FJ8 H;  4DV5 L;  4K5V A;  3G48 A;  2UUA Q;  1HRJ A;  4CDF C;  1PFM A;  1EY9 A;  3OHX C;  4QB4 A;  1X56 A;  5BN5 A;  4ALP A;  4JOI A;  3RD4 A;  1TWF B;  3P7J A;  2EYJ A;  1EFI D;  2PNR C;  2VB2 X;  2WKC A;  1ML0 D;  3A74 A;  3TP6 A;  4C3J H;  5E4W C;  4DV1 Q;  2R61 A;  4RGT A;  5EBD A;  3EQL C;  4I7Z C;  1WTH A;  2F4I A;  3W3A A;  1AEX A;  1PRT F;  2EY6 A;  4DV5 Q;  3LWE A;  4NPS A;  1M8A A;  3VYS A;  1R4P B;  4PZ8 A;  3Q23 A;  1PH7 A;  5C4X G;  3AB9 A;  2ZXO A;  1SFO H;  3FHW A;  2JA5 B;  2K33 A;  5EQ0 A;  2JA5 G;  3C2P A;  1HJP A;  3ONA B;  2XRQ D;  2B2V C;  3KLS A;  3BVM A;  3D6C A;  4LFB L;  2M00 A;  3HOU B;  1WTR A;  3HOU G;  3PUW A;  5A35 A;  2IT1 A;  4K0K Q;  4DAV A;  4FXK C;  1Z9F A;  1JJ2 A;  4E6I A;  1E1T A;  2HD3 A;  4KKT A;  1JOQ A;  2EZV A;  4KJO A;  5NUC A;  1CQV A;  4DNI A;  4A3J B;  4A3J G;  2L12 A;  1G29 1;  1BR9 A;  3GTG B;  1DZ1 A;  4WJ4 A;  3R3O A;  1EWI A;  2B2U A;  1HFG A;  2A6E C;  4JI5 L;  1STA A;  1R4Q B;  5C44 H;  1QG7 A;  2PNH A;  2L0C A;  4F88 A;  2BA0 A;  1B9M A;  2DJG C;  3HOX H;  4LFA L;  4JW0 A;  4IUT A;  1RTN A;  1YEZ A;  3RLN A;  2N88 A;  4A93 G;  5FLX c;  1C9O A;  3KF8 A;  4OX9 Q;  2ZTC A;  3MXU A;  4OL7 A;  1Y69 U;  3I4M H;  5CYU A;  4HJ7 A;  4P75 A;  3PV0 A;  4OEL B;  3C3L A;  2SEB D;  5DNF A;  1LTI D;  1SYE A;  5CV9 A;  1JB7 A;  2QKI C;  1LTS D;  4JI5 Q;  5IY0 A;  2DNC A;  3DEP A;  3SR1 A;  1S72 A;  2IL8 A;  1WFQ A;  1I50 H;  4Y7N H;  4LUV A;  4F87 A;  1S3O A;  3B6Y A;  3M4Y A;  1H9J A;  1HZC A;  2DY8 A;  1GD7 A;  1STH A;  2CKZ B;  3HFZ B;  1X6O A;  3H6M A;  2LMC B;  1OXU A;  3R2I A;  4HN7 A;  3T16 A;  1KL9 A;  4ZKC B;  4A3B G;  4QL5 A;  1KRT A;  2I5H A;  1EY7 A;  4DGZ A;  3GV6 A;  2ICE C;  3DLL A;  1HR0 L;  3CU7 A;  4NMZ A;  1EZ8 A;  2PO4 A;  4FXD A;  5JAV A;  1EFW A;  1SE3 A;  5ELD A;  1SNC A;  1RCV D;  1DON A;  1LTG D;  5JOB A;  1BO0 A;  2HDL A;  4CHT B;  1PV4 A;  1CZW A;  1BQQ T;  1V43 A;  3OPO A;  5IP9 G;  4C56 C;  1FVI A;  1PYW D;  1PZK D;  2R6G A;  4DUY L;  2B63 H;  3W5O A;  4A3I H;  3S1Q B;  1GXD C;  4BA2 I;  1KXL A;  2DY7 A;  1B50 A;  1N36 Q;  1F77 A;  4G7Z C;  5EGT A;  5I9O A;  4X65 L;  4ZAI A;  5C4H A;  3PO2 B;  2F3W A;  4A75 A;  3PO2 G;  3BG3 A;  3K5O A;  2PZU A;  1S40 A;  2F4V Q;  1I4H A;  3I7F A;  1L0W A;  3BDO A;  3GO5 A;  4A3E B;  1WTV A;  5KYL A;  3WOF A;  4YY3 Q;  2R93 G;  2JK8 A;  1K3B C;  4OO1 I;  1YNX A;  1L1O A;  2IY5 B;  3OW7 A;  3NEN A;  1C4Q A;  1KDC A;  4B3T Q;  3KF6 B;  1ICW A;  4EQN A;  2QEJ C;  4JBJ A;  2OTJ A;  4GN3 B;  1ENF A;  2GVA A;  5K5P A;  4HCS A;  5IT9 L;  2R7D A;  3K7A B;  2F0D A;  4OHJ A;  2Q2H A;  1BKB A;  1EL0 A;  3X3M A;  4LF9 L;  5KEE A;  1IKM A;  2N55 A;  3KJP A;  1GUO A;  1SNM A;  4WOR A;  3BYT B;  3BVG A;  4P73 A;  1VQH A;  2NZH A;  1JQY D;  3CRL C;  3CQZ B;  1QZH A;  1EZ6 A;  4UP7 A;  4KD4 A;  3QJY A;  2B2T A;  3CPW A;  1NMG A;  1QNK A;  3VYR A;  4M8A A;  5CV5 A;  3OWF A;  2HUG A;  5FLM H;  2E2I B;  4MHE A;  1VCI A;  4JYA L;  1AZQ A;  3RN2 A;  2UXD L;  3Q6S A;  1HUN A;  4GLA C;  2PYK A;  1IBK L;  1KTK A;  3GTP H;  2EY1 A;  1D1I A;  1YNJ C;  1YHB A;  2QF7 A;  2Z1C A;  4OEM B;  2NVQ B;  4DN4 M;  1K28 A;  3TQY A;  1TS4 A;  2AWO A;  2I5L X;  2KCC A;  3CW2 C;  4FVM A;  3J7A F;  1Y1V H;  1Y1W H;  1SMX A;  2XVS A;  2CWP A;  4P71 A;  5COR A;  4BY1 B;  2A6H D;  1PRT C;  3I8Z A;  3G71 A;  2F0V A;  3I4N B;  4XQN A;  1ILQ A;  2LSS A;  1CT1 D;  3VDY A;  1DXM A;  3C1E A;  4X6A H;  5G3L D;  2VUM H;  1HZ9 A;  3CPF A;  3NQT A;  1Y8P B;  3I55 A;  2R7Z B;  1IYU A;  1VQA A;  1O7L A;  5LMN Q;  4B3S L;  3PUX A;  4P74 A;  3U4V A;  4JI8 L;  4FXG C;  3D8G A;  2LFN A;  4J15 A;  1EEI D;  4KLK A;  2JA7 B;  4HID A;  2A68 C;  2JA7 G;  1HPC A;  5K36 H;  4O2D A;  2NB0 A;  1GKH A;  1SNQ A;  4DAM A;  4K6L A;  2LKV A;  2K28 A;  4IUQ A;  2JA6 H;  2Z4H A;  1YNJ D;  1PTO D;  1ET6 A;  3CMA A;  1Y8O B;  1Q8I A;  3HZX A;  1LV9 A;  4XT1 B;  3AQQ A;  3E9I A;  3S16 H;  3UE1 A;  3S2H B;  1WCM B;  1YHQ A;  4QIW B;  5C6A A;  4IO9 A;  3KBX A;  4PV1 C;  2F0F A;  2HCI A;  1MJC A;  2R3Z A;  2UUB Q; 
#chains in the Genus database with same CATH homology
 3FVQ A;  4KKU A;  1G2T A;  1DOK A;  2NN6 H;  1DJR D;  1ENC A;  2F0O A;  4BWG B;  2JSO A;  1JOO A;  2PW5 A;  4IAL A;  3BYY B;  1BOS A;  2D2C C;  1MD2 D;  3SK5 A;  1DCZ A;  2XWB B;  3LX0 A;  4XYO A;  3KUP A;  2F0T A;  2A73 B;  4RKL A;  2NVY B;  1HQR D;  5JJZ A;  3PUV A;  1EWC A;  4K6D A;  4PMB A;  5HGT A;  3HRZ C;  4V19 0;  2CW0 D;  4NW2 A;  4FO2 A;  2F0I A;  1A3V A;  3GTQ B;  1ZKO A;  5C3X A;  5CGK A;  2E74 C;  3S15 B;  4HMJ A;  4K14 A;  5JPN C;  3MZ5 A;  1JIC A;  1B44 D;  1LTR D;  4TSS A;  2EOT A;  3DWP A;  4UAI A;  2EYP A;  5D3D A;  2F0L A;  2RBM A;  3OIQ A;  3I73 A;  1H9R A;  1BF4 A;  5KGU A;  4KV6 A;  2A74 C;  3PIP 3;  1F9R A;  4BA1 I;  5IGG A;  4KTA A;  3VA7 A;  3NUC A;  1I6H B;  1V8Q A;  4FP5 D;  2RKS A;  4TKO B;  1I3Q B;  1ET9 A;  2WB1 B;  2L9H A;  1BCP D;  1EY6 A;  3G6J B;  4DNT B;  5EPJ A;  1E2W A;  4Q0F A;  1RTO A;  5TSS A;  2L4N A;  5C5M A;  4XXE A;  1HUM A;  1RDP D;  3KLS X;  2F0E A;  4BBS B;  4C2M B;  3JAM L;  1QWY A;  2AUJ D;  4OGQ C;  1KLG D;  2EVB A;  1YNN C;  3DEO A;  1SDF A;  4KY5 A;  2FHT A;  4A3K B;  3TSS A;  1O80 A;  1XWE A;  2K01 A;  1V1P A;  3QO2 A;  3AMU A;  2RDF A;  4KHZ A;  3K5N A;  4CJ2 C;  5BN3 A;  1I4R A;  4XIG S;  4FNF A;  4XQJ A;  3SK6 A;  1F2Z A;  2RSN A;  3D31 A;  3DMU A;  1TVX A;  2X6L A;  2F0J A;  1XXG A;  3BDL A;  4RAU C;  2XWJ B;  5FLX E;  3HGB A;  1BNZ A;  3NWT A;  3O13 A;  4F7X A;  1NSN S;  2MUY A;  3K5L A;  5D14 A;  4L6T B;  1TT2 A;  3RLF A;  4DAP A;  5JPM C;  3MAQ A;  5C0X H;  1ENA A;  4CJ0 B;  4KI0 A;  3FKI B;  1SJH D;  1NCV A;  2NN6 I;  4B08 A;  1U4R A;  2KQ3 A;  1U4L A;  3NE5 B;  3PMF A;  3TZU A;  2SNS A;  4M1U B;  5CV8 A;  2KCN A;  4HAE A;  1S4Z A;  4KD3 A;  4HSV A;  2B2W C;  2VB3 X;  1EYC A;  1ZXT A;  5J22 A;  4OIK A;  2BE5 D;  3HOW B;  5M5W B;  2QDB A;  1SE4 A;  2J0T D;  5IIF A;  1FNU A;  3E5S A;  1WTQ A;  3S1N B;  2NYZ D;  4PMC A;  5DM6 3;  4OO1 G;  2IX3 A;  3GTL B;  1BDO A;  1C8C A;  1D6E C;  4RH6 A;  4RCN A;  2KHS A;  4X3U A;  1QCB D;  3CHB D;  5JVH 3;  2IWH A;  4O1N A;  2SNM A;  1PDQ A;  3H91 A;  2K32 A;  1STE A;  2K05 A;  3J80 E;  1A6X A;  2IW3 A;  3MXP A;  3GQB A;  3FPU B;  1F2Y A;  5M5X B;  4KN4 C;  1M4V A;  1GOZ A;  3GTM B;  2NZ1 D;  4ODG A;  4DF7 A;  3S9W A;  5DAU A;  3ITP A;  1E0B A;  3X3N A;  1GUT A;  1X32 A;  2QCP X;  1TQO A;  5JEA G;  1K83 B;  1WD1 A;  4H13 C;  5C4X B;  3W2D A;  2C5C A;  5E4X A;  1F9P A;  4YIJ A;  2YU9 B;  4G7H C;  5KNC A;  2NWG A;  4DNR B;  1SEB D;  2XIW A;  1JOK A;  2MJ8 A;  1VMC A;  1TWA B;  2DN8 A;  3IFD A;  1L0X B;  3QB3 A;  4LJZ C;  4RHS A;  5C44 B;  1LTA D;  3HOX B;  4LK1 C;  3GP7 A;  1FD7 D;  5CV4 A;  1MGS A;  3KLR A;  3DHQ A;  2PMZ B;  1A15 A;  4KMU C;  2AUK A;  1TWG B;  1JB3 A;  2K03 A;  1EU4 A;  1O78 A;  4A93 B;  1XYI A;  1SJE D;  1S5B D;  5LL6 X;  3TP8 A;  5C0X I;  5KYI A;  1EQV A;  3NBH A;  4EQO A;  5C5L A;  4BY7 B;  4K8J A;  2EY2 A;  2MHV A;  2K5W A;  1LAB A;  1U4M A;  1ILP A;  1LAC A;  2NVX B;  2R92 B;  1HQM C;  5FKA C;  5DM7 3;  5COY A;  4A3B B;  5ELC A;  1B3A A;  4EGV A;  4DFA A;  2A6E D;  1JE4 A;  4G7O C;  1G2S A;  3CRK C;  3HS0 C;  4S3S A;  3VA5 A;  3NQI A;  1I4G A;  4IUN A;  2E76 C;  4QF4 A;  1TY0 A;  1HFN A;  1K8M A;  4NKL A;  3H3V C;  2H1E A;  2A69 C;  2M9V A;  1G8Z D;  1LLR D;  2O2L D;  1SYD A;  3R2T A;  1SSO A;  3A8J E;  1EEF D;  2JP1 A;  3NXW A;  2R93 B;  3M7N A;  1O7Z A;  1JCK B;  2F03 A;  1EY5 A;  2L11 A;  3IKJ A;  2JE6 I;  3BZD B;  1SBB B;  1D1K A;  1V1P B;  4CKB A;  3BVZ A;  4IUV A;  3F2U A;  3T13 A;  3J81 E;  3RMH A;  2VXW A;  3J7Y W;  2F0S A;  1EYA A;  2D62 A;  2I46 A;  3MC0 B;  3OMG A;  1D5Z C;  1J8I A;  3A55 A;  2B2Y C;  3GTP B;  1SYC A;  1X3P A;  3OOC A;  4O42 A;  4V0B A;  2WAC A;  1X3Q A;  4N9P A;  5C3E B;  3ND8 A;  5I2X A;  3DUZ A;  1Y1V B;  1Y1W B;  1I4Q A;  2KED A;  4CKC A;  4IUP A;  4RFB A;  4U67 3;  5HUR A;  4XTC S;  3QG1 A;  3Q24 A;  3K0Y A;  1WTX A;  2BDO A;  1NAP A;  4CJ1 B;  1EIG A;  1ESR A;  3J80 L;  2EYF A;  1ROD A;  4TRD A;  3TN2 A;  2E2J B;  1LT5 D;  4X3K A;  1PTO B;  3OIP A;  4J1M A;  1GUW A;  5K36 G;  5ELF A;  5C0X J;  4BS9 A;  1S5D D;  1QIL A;  3A8I E;  2F0W A;  3A8K E;  3S16 B;  5IOC A;  2LS0 1;  3FPP A;  3V96 A;  5KND A;  4CKE A;  2FIN B;  3HG9 A;  1E2Z A;  2EE1 A;  4FF4 A;  1KAB A;  5IGB A;  1K8O A;  1HA5 A;  1CHP D;  2AWN A;  4NDX A;  1ZYR C;  1Q3L A;  3OMC A;  3S1R B;  5A2Q E;  1PRT D;  2NTT A;  1JOR A;  1S5E D;  3MFG A;  3FDT A;  2X69 A;  1WTP A;  1Q90 A;  4C3I B;  5T1I A;  4C3I G;  3BS1 A;  2B8G A;  2F0U A;  1CHQ D;  3EJI A;  2D9U A;  2BCO A;  1FNW A;  1D2B A;  2B2V A;  2A68 D;  1Q1E A;  1C48 A;  4XDX A;  3MHB A;  2MGS A;  4C1N I;  1Y8N B;  4R8N A;  3WDN A;  1AW7 A;  2B8F A;  2E2D C;  2DNE A;  2WIN B;  1TR5 A;  2ICI A;  4KN7 C;  3UI2 A;  1D5M C;  3IL8 A;  2K1B A;  1SMY C;  4MN3 A;  1ESF A;  2FFK B;  1BXT A;  1BCP B;  4RCO A;  4ABN A;  1I6V C;  3Q0A A;  1TS2 A;  4EVO A;  2JYO A;  4PQX A;  1VMP A;  2QIL A;  5D3I B;  3SDZ A;  1BUV T;  1TKW B;  3NSW A;  1S5F D;  1KDA A;  2KUM A;  2F3V A;  4H0L C;  3S1M B;  3T56 B;  4L63 B;  1SMY D;  2ID0 A;  3T51 B;  3D4D A;  4PNY A;  4WFN 3;  1IHZ A;  3M7G A;  1UAP A;  1CFM A;  4HTH A;  4G57 A;  3SXH A;  1KDB A;  5M3M B;  4G4K A;  2B2U C;  1G6Z A;  1OXT A;  1R9T B;  3LWU A;  1OO9 B;  2RSO A;  1Z6H A;  2ZXP A;  3K5M A;  2TMP A;  3NTI A;  2ZT9 C;  2G9D A;  4RHR A;  3QOJ A;  1L0Y B;  2EYL A;  1SNP A;  4QUC A;  2L1B A;  1Z47 A;  3HOY B;  4ZUJ A;  4RKB A;  2YYZ A;  4HR7 B;  1KNE A;  1TY2 A;  2MP1 A;  5EPL A;  3PUZ A;  5EJW A;  2WV6 D;  2X6G A;  4CBV A;  4ID6 A;  5C0X G;  1YNN D;  3QIA A;  3NTH A;  5C4J B;  2O5I C;  1GUN A;  2HDM A;  2AQ1 B;  3N6R A;  1SYG A;  3TDQ A;  2KJX A;  2SDF A;  3J7A V;  2FMM A;  4TQU S;  5FO8 B;  2KOL A;  2JEA I;  4K2K A;  3URY A;  1NUC A;  2FJ2 A;  3M4O B;  5CC4 A;  1SND A;  2I07 B;  2HQE A;  3DWQ A;  2TSS A;  1DD2 A;  5FOB B;  4IUU A;  4QCL A;  2EJG C;  3S14 B;  1DOL A;  2KEE A;  1GHJ A;  2BA1 A;  1CQF A;  5M3F B;  2IX1 A;  1HCZ A;  2B2T C;  2L5T A;  1STN A;  5CV7 A;  1H9M A;  2F0M A;  1B4O A;  2CHB D;  2EJM A;  1XTC D;  3L9A X;  1AFP A;  1HA6 A;  3HOV B;  2O4X A;  1U4P A;  5M9O A;  5FK9 C;  2KEC A;  2ENB A;  1HTP A;  1NR2 A;  2NUC A;  2WP8 J;  3CKI B;  3VR6 A;  4X3S A;  2J7Z A;  4C3J B;  1UUP A;  4C3J G;  1I4P A;  1TII D;  4XQQ A;  4ULL A;  2XRS D;  5KIX A;  2IX0 A;  2SOB A;  2F0P A;  1UEA B;  2NTS A;  5CBA E;  3PUY A;  2PW7 A;  2PZT A;  4IFD H;  1SFO B;  1OXX K;  1A3U A;  2JXM B;  4I65 A;  1MSG A;  1WTO A;  1O7Y A;  5I9P A;  1PTO F;  4DXF A;  1Q1B A;  1Z7T A;  2RQX A;  2OXP A;  2PQE A;  4FF1 A;  3MXG A;  3K6O A;  3I72 A;  1STB A;  1UNS A;  1FNV A;  1CA5 A;  1KLU D;  2EXZ A;  5ELE A;  1W6K A;  3FMC A;  4ME5 A;  3WOE A;  3E6Z X;  4LAA A;  1W6J A;  5JEA H;  4ZKB B;  3T53 B;  3TP7 A;  3V2T A;  1EU3 A;  2EPB A;  3I4M B;  1SXT A;  3V05 A;  1STY A;  2MPM A;  1CA6 A;  3D4R A;  5J39 A;  3D3R A;  3VR2 A;  1I50 B;  4Y7N B;  2OT2 A;  1SAP A;  2E75 C;  4K5W A;  3E0J A;  1FR3 A;  1KAA A;  1II3 A;  1PLF A;  1F9S A;  5ISR A;  4IQZ A;  1OXV A;  2NBF A;  2CVR A;  5EPK A;  3SHL A;  1S5C D;  4DK0 A;  2WAQ B;  3SEB A;  3TME A;  5IGC A;  1WTW A;  3K57 A;  2A5H A;  1AZP A;  3I91 A;  2Q8I B;  1MBY A;  3QOL A;  3MA2 B;  2B63 B;  1PFN A;  4A3I B;  4DA2 A;  3TZD A;  2EJF C;  3MXN A;  2K5Q A;  3U9O A;  4UDU C;  1BCP F;  4U68 A;  4Q5V A;  3C1F A;  2KA7 A;  5FLX L;  2RDG A;  3P20 A;  3H0G B;  3H94 A;  5JVG 3;  1QB5 D;  1PZI D;  2WII B;  3PIO 3;  1RKN A;  1EY8 A;  3L3O C;  5LL6 S;  2PCF B;  2V4D A;  1CTM A;  3I4L A;  4MIU A;  4IN3 A;  3IAY A;  1H9S A;  1IW7 C;  4HSP A;  3P1H A;  5E3F A;  1EY4 A;  4K8I A;  4LMQ D;  2K04 A;  2RA4 A;  3DWA A;  5CBE E;  5IGF A;  2B39 A;  1VF5 C;  5EBC A;  1OXS C;  3JAM E;  2BOS A;  2J4X A;  5CV6 A;  3OWE B;  3A7A B;  3MEH A;  3SK8 A;  1B1Z A;  3VR5 A;  2F0K A;  4H7B A;  1A2U A;  2PPB C;  4J8Q A;  2EYO A;  2VNU D;  2B2W A;  3HKZ B;  1GJX A;  3ND9 A;  4QUF A;  4QMG A;  5KNB A;  3Q22 A;  2A69 D;  4IFD I;  4KHV A;  4DK1 A;  2F0H A;  1IW7 D;  3A7L A;  3KK7 A;  4DAY A;  2A6H C;  3I70 A;  1RJT A;  1B53 A;  4RWS C;  1KNA A;  5EKI A;  2Q8T A;  3RZO B;  3K58 A;  2VUM B;  5CMD A;  1EOT A;  2OEO A;  1ONL A;  3HP3 A;  3K59 A;  2GA4 B;  3N52 A;  5I6W A;  4J6H A;  1LO5 D;  1EYD A;  1DM0 B;  1TS5 A;  2IPK D;  4ZQ3 A;  4HCE A;  2C9O A;  1CK1 A;  3SVM A;  1H9K A;  1EWH A;  1E2V A;  5C3W A;  1PTO C;  2JA6 B;  1HHV A;  5C4Z A;  4IUR A;  1EIH A;  5BN4 A;  1PRT B;  1RD9 D;  4XT3 B;  5IGD A;  3KBG A;  2Q8R E;  3DM1 A;  1IYV A;  3EVQ A;  3HOZ B;  3R8B A;  1PFB A;  4K2L A;  4X3T A;  3FRP B;  2XNA C;  2XSC A;  3I3C A;  1HTL D;  3I90 A;  1GUG A;  2NN6 G;  4L8J A;  2AQ2 B;  1WD0 A;  1EY0 A;  1VDZ A;  3GTK B;  5FO9 B;  2Z8L A;  2D5D A;  3M85 A;  1PTO H;  4KKS A;  4CGY B;  3ZYY X;  1I4X A;  3H09 A;  4A3D B;  1AP0 A;  4ZYS A;  2OF1 A;  1AN8 A;  2CW0 C;  1A3T A;  2BDN A;  4FYD A;  4WJW A;  1WVL A;  1PZJ D;  1PXU A;  5EKK A;  1HXY D;  1SYF A;  2EY5 A;  2F1M A;  4EQP A;  3BDC A;  1SYB A;  2G9H D;  4KY7 A;  4RGN A;  1JWU D;  3OSO A;  1F2M A;  4A3M B;  2F0Q A;  4DU9 A;  3FEW X;  3VR4 A;  1JWM D;  2EDG A;  1ZYR D;  1MI2 A;  4HED A;  3P75 A;  2F0N A;  4C1N K;  3MTS A;  3NTK A;  5T1G A;  3NP8 A;  3M3Y B;  4K5X A;  1BCP C;  5AFW A;  4IFD J;  1TWH B;  5FO7 B;  2XN9 C;  3NHH A;  1PMR A;  2JA8 B;  3MFY A;  2LY7 A;  1NR4 A;  3SE0 A;  2H4O A;  1MSH A;  4F8M A;  5J1Z A;  2M2L A;  3GD7 A;  1B9N A;  3A54 A;  3LNN A;  1JWS D;  4FF2 A;  4WRD A;  4FF3 A;  1U9R A;  2EYH A;  3TBI B;  5EKL A;  4IZ8 A;  2K6A A;  4R9W A;  3VYU A;  1G91 A;  4C3H B;  1B2T A;  4C3H G;  4BBR B;  1SE2 A;  1T5E A;  5E1F A;  3RZD B;  4KJN A;  1GHK A;  1J9O A;  5JEA J;  3S2D B;  1LT3 D;  1RHP A;  2IJ0 A;  4H44 C;  2NVT B;  1CM9 A;  4ZRZ A;  4PMW A;  1FYC A;  1QOH A;  2RDH A;  3TP5 A;  2K7V A;  1LTT D;  3J81 L;  1ZEQ X;  3C46 A;  1TS3 A;  1LT4 D;  2F0G A;  3PO3 B;  4ZLT F;  5I6Y A;  1JC7 A;  4ZK9 B;  5IOD A;  3ERO A;  1T5X D;  5CR3 A;  1QE6 A;  2Y0S B;  1SNO A;  4ZUI A;  1FGB D;  2B2Y A;  4ILW A;  3ERQ A;  1TU2 B;  1XX8 A;  1LT6 D;  5D65 A;  3EFX D;  1V1O A;  3MVV A;  4KY6 A;  1GUS A;  2EYM A;  2FMC A;  1H9S B;  2KVM A;  4GZY C;  3MWY W;  5M5Y B;  3SK4 A;  1QJO A;  2BE5 C;  4XYQ A;  3GTO B;  1JR0 D;  5DEH A;  4B9X A;  2ZXR A;  4RGO S;  5ELB A;  2K5D A;  5F2D A;  1F2L A;  2PZW A;  5KRU A;  1BBX C;  3QWN A;  1CI3 M;  3RUZ A;  1Q12 A;  3IFT A;  1D5X C;  4RGM A;  3R93 A;  1IL8 A;  4AYB B;  1LTB D;  4RA8 A;  1QNU A;  2L55 A;  2E2H B;  3U9S A;  1F9Q A;  3NPP A;  5IT9 E;  1DYQ A;  1VF7 A;  5A2Q L;  4OIJ A;  2RVL A;  5I2Y A;  5I4D A;  4N9T A;  1RF2 D;  3L7Z C;  4Z9C B;  2O5J C;  3D4W A;  3D6W A;  2Z4I A;  3NWS A;  4HMI A;  5LHY 1;  2HCC A;  3GV3 A;  1A2T A;  4A3G B;  3VYT A;  4P2C B;  1EQT A;  3NK9 A;  3AU7 A;  4NP5 A;  4IFD G;  1CZG A;  1DOM A;  4JBW A;  3DXJ C;  4JK1 C;  4KK7 A;  2JEB I;  1IKL A;  3NBI A;  4B9W A;  2AQ3 B;  4OO1 H;  3G7L A;  5G3L F;  2CQA A;  2WKD A;  1TWC B;  4R8I A;  3EA6 A;  3A56 A;  4DXG A;  3T4A C;  3VR3 A;  3HEJ A;  3GTJ B;  4A3F B;  1STG A;  5IGE A;  3S17 B;  4K5V A;  1HRJ A;  1PFM A;  1EY9 A;  3OHX C;  4QB4 A;  5BN5 A;  3RD4 A;  1TWF B;  3P7J A;  2EYJ A;  1EFI D;  2PNR C;  2VB2 X;  2WKC A;  1ML0 D;  3TP6 A;  5E4W C;  2R61 A;  4RGT A;  5EBD A;  3EQL C;  4I7Z C;  2F4I A;  3W3A A;  1AEX A;  1PRT F;  2EY6 A;  3LWE A;  1M8A A;  3VYS A;  1R4P B;  3Q23 A;  3AB9 A;  2ZXO A;  2JA5 B;  2K33 A;  5EQ0 A;  3C2P A;  3ONA B;  2XRQ D;  2B2V C;  3KLS A;  3BVM A;  3D6C A;  2M00 A;  3HOU B;  1WTR A;  3PUW A;  5A35 A;  2IT1 A;  4DAV A;  4FXK C;  4E6I A;  1JOQ A;  4KKT A;  2EZV A;  4KJO A;  5NUC A;  1CQV A;  4A3J B;  2L12 A;  1G29 1;  1BR9 A;  3GTG B;  1DZ1 A;  3R3O A;  2B2U A;  1HFG A;  2A6E C;  1STA A;  1R4Q B;  1QG7 A;  2L0C A;  4F88 A;  2BA0 A;  1B9M A;  4IUT A;  1RTN A;  2N88 A;  3KF8 A;  3MXU A;  4OL7 A;  1Y69 U;  5CYU A;  3PV0 A;  3C3L A;  2SEB D;  5DNF A;  1LTI D;  1SYE A;  5CV9 A;  2QKI C;  1LTS D;  2DNC A;  3DEP A;  3SR1 A;  2IL8 A;  4F87 A;  3M4Y A;  1H9J A;  2DY8 A;  1STH A;  3H6M A;  2LMC B;  1OXU A;  3R2I A;  4HN7 A;  3T16 A;  4ZKC B;  1EY7 A;  4DGZ A;  3GV6 A;  2ICE C;  3CU7 A;  4NMZ A;  1EZ8 A;  2PO4 A;  4FXD A;  5JAV A;  1SE3 A;  5ELD A;  1SNC A;  1RCV D;  1DON A;  1LTG D;  5JOB A;  1BO0 A;  2HDL A;  4CHT B;  1CZW A;  1BQQ T;  1V43 A;  3OPO A;  4C56 C;  1PYW D;  1PZK D;  2R6G A;  3S1Q B;  1GXD C;  4BA2 I;  2DY7 A;  1B50 A;  1F77 A;  4G7Z C;  5EGT A;  5I9O A;  4ZAI A;  5C4H A;  3PO2 B;  2F3W A;  3BG3 A;  3K5O A;  2PZU A;  1I4H A;  3BDO A;  3GO5 A;  4A3E B;  1WTV A;  5KYL A;  3WOF A;  4OO1 I;  3OW7 A;  1C4Q A;  1KDC A;  1ICW A;  4EQN A;  2QEJ C;  5K5P A;  1ENF A;  4HCS A;  5IT9 L;  3K7A B;  2F0D A;  4OHJ A;  1EL0 A;  3X3M A;  5KEE A;  1IKM A;  2N55 A;  1GUO A;  1SNM A;  4WOR A;  3BYT B;  3BVG A;  3CRL C;  1JQY D;  3CQZ B;  1EZ6 A;  4KD4 A;  3QJY A;  2B2T A;  1QNK A;  3VYR A;  4M8A A;  5CV5 A;  3OWF A;  2HUG A;  2E2I B;  4MHE A;  1VCI A;  1AZQ A;  3Q6S A;  1HUN A;  2PYK A;  1KTK A;  2EY1 A;  1D1I A;  1YNJ C;  2QF7 A;  2Z1C A;  2NVQ B;  4DN4 M;  1TS4 A;  2AWO A;  2KCC A;  4FVM A;  3J7A F;  2XVS A;  5COR A;  4BY1 B;  2A6H D;  1PRT C;  3I8Z A;  2F0V A;  3I4N B;  4XQN A;  1ILQ A;  1CT1 D;  1DXM A;  3C1E A;  5G3L D;  3NQT A;  1Y8P B;  2R7Z B;  1IYU A;  1O7L A;  3PUX A;  4FXG C;  3D8G A;  2LFN A;  1EEI D;  2JA7 B;  2A68 C;  1HPC A;  5K36 H;  2NB0 A;  1SNQ A;  4K6L A;  2LKV A;  2K28 A;  4IUQ A;  2Z4H A;  1YNJ D;  1PTO D;  1ET6 A;  1Y8O B;  1Q8I A;  3HZX A;  1LV9 A;  4XT1 B;  3S2H B;  1WCM B;  4QIW B;  5C6A A;  3KBX A;  4PV1 C;  2F0F A;  2HCI A;  2R3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...