4V190

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
114
structure length
114
Chain Sequence
TGGSSKNLGGKSPGKRFGIKKMEGHYVHAGNILATQRHFRWHPGAHVGLGKNKCLYALEEGVVRYTKEVYVPNPSNSEAVDLVTRLPQGAVLYKTFVHVVPAKPEGTFKLVAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1030 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4v19000
3J7YW 4V190
chains in the Genus database with same CATH superfamily
1VS0A 5IT9L 4JI0L 2UU9L 4WJWA 1PYBA 1IBKQ 4IQZA 4JI4L 1KLUD 1PH8A 1LTGD 4R8NA 1W6JA 1KL9A 4HJ5A 4A3LG 3QJYA 4H13C 2OWOA 1ONLA 1X3FA 3VR4A 4L63B 3S17H 3S14B 4A3EB 1STYA 1A15A 3PIOA 1PH4A 5C6AA 2I5MX 4LF6Q 4LW1A 4C1NK 3B6YA 3AMUA 3UI2A 1G2TA 3A7AB 2B2YA 1CM9A 3G7LA 3X3MA 1C8CA 3PSIA 4C1NI 1B9NA 2R3ZA 3I2ZA 3BYYB 1ZXTA 4AYBB 4GNXB 4NB3A 2A74C 1QOHA 3GTOH 1VMPA 2EY1A 2F4IA 4KHPQ 3NEMA 4OO1I 1NUCA 4PZ6A 3W2DA 5T1GA 3OIPA 2K14A 2E5LQ 1VQGA 3KBXA 2ZTDA 3PO3B 2R92G 4OGQC 3GTGH 2RCFA 1HFNA 3MXNB 2RDFA 1SYCA 4G57A 2D9UA 5C44G 4X64L 2K5VA 1Q1EA 2MPMA 4DV0L 4DR3L 4A75A 2I5HA 2EY5A 4C3IB 4QJFA 1Y14B 1I50H 3M4PA 4LUOA 4HJAA 1X65A 3BJUA 2QDLA 3GV6A 4GN5A 4DAYA 4EQ5A 3MC0B 4YIJA 1VQDA 1CKNB 2K5NA 2IWHA 1IXRA 1ASZA 1GKHA 1JOOA 4KKTA 4QMGA 4JBWA 3T1HQ 3R93A 2E2IH 3HG9A 5D3IB 4KKUA 3OMCA 4LF8Q 3FKIB 1RCVD 1PZJD 4IUPA 4HTHA 4KN4C 4LMQD 4LWCA 1BCPB 1U4LA 4TRDA 3V05A 2EIFA 1Y1VB 1TQOA 5I9OA 2B63G 3F2BA 2Q2IA 2F0KA 3RLNA 3HOVB 2Q2UA 4EGVA 2KEEA 2RSNA 2YU9B 1S5DD 3H15A 1UWVA 3ITPA 4GOPC 2E8GA 3BZDB 1X3QA 2IX0A 4YCWA 3I90A 3SE0A 4RKLA 2CQAA 3G6EA 3TP7A 4AIMA 1IBMQ 4LNQA 2AUJD 3C3LA 1GHKA 3CQZH 5JEAJ 2LFNA 3HOWB 1STHA 4P72A 1I4QA 2CHBD 1JE4A 4TSSA 1B3AA 1VQBA 2Y0SB 3PMFA 1KRSA 1YHAA 3H3VH 1BNZA 1YNJC 1KNAA 5JJIA 4B3RL 3LNNA 4TQUS 4YWMA 3H09A 2O5JC 4C3HH 4CBVA 3PGZA 2AQ2B 3HOZH 4ZRZA 2X69A 4C3IG 2PNHA 4HJ8A 1HZAA 2WACA 5GAEC 4DV1L 3SXHA 4OWTB 4IPHA 4ZK9B 2BOSA 4IFDH 4UPAA 2XIWA 4R1JA 3G48A 2M2LA 5LL6S 1LABA 4R4QA 3M3YB 1TY2A 2F0VA 2KECA 4WFN3 1G91A 1SNDA 1FD7D 1RD9D 1MKHA 3OYYA 1JWSD 2ZJQA 1PDQA 3PQIA 1IBLL 3DXJC 2UUCL 3CKIB 2B3GA 4V190 3URYA 2J4XA 1EY0A 1XMOL 2KBNA 1EWIA 2RF4A 2Z1CA 2WINB 3MXGA 2RCNA 3FKIG 1JJ2A 1U0LA 2A6ED 3RZDB 3CHBD 1DGSA 1Y1VG 1QZHA 1U4PA 4P74A 1NAPA 1PTOB 1WTRA 2K5HA 3J80c 5JOBA 3CCSA 1VQ8A 3HOVG 4A3CH 4R9WA 3MAQA 3AEVA 1BCPF 5FLXE 3QG1A 3Q24A 1Y69U 3QOJA 3EFXD 4XQNA 2LKVA 4DUYL 3GTKH 4A3GH 1J5EL 4B3MQ 3VR6A 4O1NA 4POGA 5CV9A 3HOXH 1EIYB 2JSOA 2Y0SG 1DZ1A 3J81E 4KI0A 1TS5A 1SN8A 4GNXC 2NN6H 3TREA 1KAWA 1IBKL 2PPBC 3BVZA 1K8AC 3AFPA 3I7FA 1EOTA 1R4PB 4K8IA 4JI5Q 4Z9CB 4I7ZC 2Q8IB 4MZ9A 3L7ZC 1T9HA 2B8GA 1JCKB 4HCEA 5CYUA 3TZDA 1SRUA 2A1AA 1HA5A 4LF6L 1VCIA 1CUKA 2EYHA 1CKOA 1SAPA 1X6OA 2PQEA 5GADC 3BDLA 2JA5H 1QJOA 4JI6Q 2J0TD 3HP3A 2EYLA 5FO8B 4DAPA 4UDUC 1KQSA 2IPKD 1SMYD 2B2UC 2PO4A 3Q6SA 5K5PA 4KHPL 4M8AA 2HIXA 1OXUA 2R7ZH 1FGUA 3Q8DA 4K0KQ 3GQBA 1WCMB 4YWLA 5HURA 4DKAC 1XX8A 3CC4A 4RA8A 2E5LL 1V43A 3GTJB 2L55A 5BR8Q 2UXCQ 3NQTA 1KDBA 4N8FA 1S5BD 2XGTA 4V0BA 5GQOA 3SR1A 1I4RA 5DAUA 2FJ2A 1NCVA 2H1EA 1I4PA 5M9OA 1BCPC 3VYTA 3I4NH 1VQ4A 5IYBH 3N52A 1PTOF 1VQJA 4JG2A 2ZXOA 1ENAA 1A63A 5FO7B 4J1MA 1H95A 1R9TH 2WFWA 2KCTA 1LTBD 5C3EH 1AZQA 1Q8IA 3D3RA 5IYCH 2OTJA 3SK8A 1E3PA 5I6WA 2HDMA 1I6HB 1IKMA 1L0XB 4DK6C 3H3VC 3SGIA 3CMEA 2L4NA 1SYBA 3T1HL 4IALA 1BVSA 4KKSA 4O42A 3A8JE 2GN5A 3K5OA 1EQRA 4GS3A 4XXEA 4BBRH 5IY0A 3PUYA 5EJWA 2R7DA 5NUCA 3VR5A 1A3UA 2F0WA 2LXKA 3GP7A 4DN4M 1XPUA 4K5XA 4ALPA 3HGBA 4C3JH 3ULJA 2CFMA 4DV4Q 1Q82C 2FINB 1DXMA 2F1MA 3KLRA 4QQBX 1EZ6A 1FNUA 4HMJA 2DJGC 2IHEA 5CV4A 2UU9Q 5E4XA 1IYUA 1H9MA 3HS0C 1IBML 4RHRA 5M5WB 1HUMA 1YVCA 3HFZB 2I46A 1WCMG 4K6LA 1W2BA 3VYUA 1SYGA 1KD1C 3EBEA 5IGCA 5EKIA 2FHTA 5M3MG 4ZLTF 3QB3A 5C5MA 5EBDA 1XTCD 2K04A 1BQQT 3C2PA 2EJMA 2FMCA 2CKZB 2DN8A 3EIVA 1T5XD 1F2MA 3I4OA 3F1ZA 3F2CA 3PUWA 4L5TA 3A0JA 1AP0A 4A3FB 2XNAC 3V2TA 2GVAA 2EZVA 1F9SA 1AZPA 1HTLD 4NP5A 2EYOA 4IURA 3S24A 4ODGA 1S5CD 1SROA 3K0YA 4JV5Q 3M4YA 4Q0FA 5ELBA 1Y8OB 3FVQA 1NMGA 1FR3A 1X3GA 5CC4A 2UXBL 1NR2A 2Q8TA 1PZID 1GM5A 3J7AV 4JBKA 1KIXA 4X3KA 1VMCA 1L1OB 3UE1A 1M4VA 3K7AH 1LTAD 4CHTB 5GAGC 2DUDA 4KHZA 2VY3A 2F0OA 3F8TA 3I4MH 3S1NH 3S16B 2B2WC 1E22A 3MEFA 1D5ZC 1PRTF 5EKLA 4WRDA 2KHSA 1LV9A 1DM0B 1SYEA 2ZTEA 1D8LA 4OIKA 1HJPA 1DYQA 3NQIA 2EYMA 4G4KA 2QILA 1STNA 1RKNA 1N32Q 1Q86C 3E0EA 2NB0A 1HUNA 5J22A 5I4DA 1AE3A 2Z8LA 4X66Q 2HUGA 3PUXA 4A3IH 3HOUH 3NK9A 4B3ML 1JMCA 2PQAB 4JI8Q 2B2VC 4IUQA 4DU9A 3RD4A 2EJFC 2VS1A 1GVPA 5ELEA 1B50A 3PV0A 4CKCA 4ZUIA 4LUZA 1V8QA 2RA4A 3OIQA 1DOKA 1O7LA 3F2DA 3M85A 4QL5A 1SE2A 1LTRD 3NTKA 1ILQA 1TWFB 1GXDC 2EYJA 5E1FA 1UE1A 2LXJA 4DAMA 4IFDJ 2F0NA 3L2PA 4BY1B 1GHJA 4JI5L 1VQ7A 1YNND 5EPJA 5F2DA 3T1YQ 3IFTA 2BA0A 3K7UC 1HR0W 2K05A 2NZHA 3K59A 5KNCA 1HR0Q 4KTAA 3G4SA 4RHSA 1OXSC 1SXTA 2PI2A 1TS4A 2PMZE 2ZJPA 1O78A 1L0WA 4L5RC 1Z6HA 3SHLA 3K5NA 4JI6L 3S2HH 2JA7B 1QVCA 1STGA 5C0XG 3KLWA 3KF6B 5M3FG 3WOEA 2KEDA 3CCEA 4X6AH 2FXQA 3GTPB 4K0KL 2KQ3A 3IRBA 4OX9Q 2F03A 4GOPB 4APVA 5BR8L 5FLXL 2UXCL 4BBSB 5C4XB 1PRTC 5M5YB 1QB5D 1ESRA 2BH8A 2F0QA 2WP8J 1JORA 4R4IA 1EYGA 1PFMA 3J80E 3IL8A 5E3FA 2F52A 1HNWQ 4IOAA 2OEOA 4JOIA 2I0QA 4DF7A 3PO2H 3J81L 1HQMC 2CW0C 4HMIA 1E24A 2NVQH 2PYKA 3OMGA 2ICIA 1GJXA 5DM73 4A3LH 4LF5Q 4S3SA 1VQFA 3DWAA 1Q1BA 3S2DB 4A3MH 2XWJB 4PG3A 4CDDC 4H44C 4POFA 4F87A 3E9IA 4HCSA 4KLKA 4KY5A 5I6YA 3MA2B 1RIPA 1JE5A 2XVSA 1F9QA 4KD4A 1TIID 1EY7A 1FJGQ 1STEA 4HR7B 1ENCA 3DEPA 1VQCA 4JI7L 4B9WA 5J1ZA 4QGUA 3HKZB 1F77A 1KNEA 5IT9c 2IY5B 5IGFA 4CGYB 3MXUA 4DUZQ 4DV4L 1JB7A 5CV7A 2F0IA 2NTTA 3SK4A 2JA7G 1ET9A 3C1FA 2R92H 1YZ6A 1Y1WH 2PW5A 3I8ZA 4KJNA 3P1HA 5C0XI 1ASYA 2JA8G 3S17B 1S72A 1FL0A 5C44H 1WI5A 1SDFA 1PTOD 4Y7NH 2L15A 2Q2HA 3TQYA 2AMCB 4OXPA 2MQHA 3H0GH 3G6JB 1EFID 1JICA 1QWYA 3I72A 4BBSG 1B2TA 1JT8A 4BY7G 2K4KA 4X3TA 2Z6BA 1L1OC 1HA6A 3GTOB 2D5DA 4HSPA 4JVZA 3KJOA 5IYDG 4B9XA 4A3BB 1A2TA 1EY5A 3ND9A 1D7QA 2QGQA 1IYJB 2MJ8A 1VQNA 1GUGA 3DM1A 1XNQL 3M4OH 3S1QH 2JA6B 2DNCA 2KENA 1ESFA 1SNQA 4DK3C 5HY6A 1AFPA 3GTGB 4HSVA 3HOYB 2PNRC 3ZJYC 4JV5L 4WJ3M 4ZYSA 1Q8KA 4JYAL 5IE8A 4LK1C 1TWGH 2B63H 2F4VL 4RCNA 3J7AF 4UP9A 3R2TA 4L5QA 2RSOA 2ZM6Q 2PCFB 1G51A 1SNOA 1KDCA 4IPGA 4KK7A 5KNDA 1I50B 4HIOA 5FJ8G 1IZ6A 4NDXA 4LF7Q 2PQAA 1K3RA 3GD7A 3HKZG 1HFGA 4OWXB 1MD2D 3FPUB 2EQSA 1J8IA 3UE0A 2JEAI 1N32L 2VUMB 2QF7A 4HIKA 1I6VC 4B3SQ 3TS2A 4X62Q 4X66L 3OWEB 4JI8L 5C5LA 5KGUA 3RLFA 4DXFA 2BCOA 5G3LF 4C3IH 3D6WA 2HCIA 4A3EG 3L9AX 2K75A 4JI1Q 3NWTA 5CR3A 3BZCA 1JC7A 4X3UA 3CCVA 2P5ZX 2WKDA 3PF4A 4GLVB 1ET6A 1I94Q 1PFBA 1F2YA 3CQZB 3KF6A 3JAME 1I3QH 3T1YL 1CZGA 4RAUC 1BBUA 4K6DA 1HR0L 4A3BG 4K8JA 1G8ZD 2OXPA 4HIDA 4AYBG 4QIWE 2XRSD 4BS9A 2A8VA 1KDAA 2JA6G 4JI3L 1JQYD 1L2FA 1B9MA 2K5QA 3S1MH 2JEBI 4GOPA 3S1RH 3HOYG 3CF5A 3ONAB 3CU7A 1SR3A 2K7VA 1HXYD 4XYOA 4C3HB 1QNUA 2OCEA 3PO3G 4G7OC 3PUVA 4EVOA 2NVYB 4DV5Q 1W3SA 3HOZB 2BE5D 1QILA 2RVLA 2MHVA 2SNMA 3HOVH 3ERQA 4LFCQ 2VQFQ 1H9SB 1Y8NB 2NWGA 4OX9L 1UAPA 2YU9H 3W1GA 3TEHB 1DD2A 1WOCA 5COYA 2F0TA 1TU2B 1PZKD 1SNCA 4ULLA 1C0AA 1KXLA 1YJNA 4CJ1B 4A3KB 2K01A 1Q3LA 3T13A 1LLRD 4EQOA 2OQKA 1VQPA 2VUMG 3RZOB 3NBHB 2B39A 1S5ED 1HNWL 2MGSA 1JOQA 1ZYRD 4JBMA 2AWNA 2HQEA 4H0LC 1CA6A 2A73B 1GUWA 2MUYA 2Z6KC 4DV2Q 1PYSB 3EQLC 4UP8A 1WJJA 3W1BA 4IUUA 1HTPA 3HRZC 3TN2A 4LF5L 2UXBQ 1EUJA 4A3DH 4HIMA 4NXML 1RODA 1QE6A 3E9HA 4F7XA 4MTNA 3A5UA 4DR2Q 2QCPX 1HPCA 1D2BA 3L3OC 5EPKA 3CCUA 2RKSA 1KRTA 4CJ0B 3CC2A 2Y0SE 4C2MH 1FJGL 2HQLA 1RTNA 3E0JA 3GTKB 4A3GB 4PNYA 2ZTCA 2VW9A 1JJCB 5CORA 1LTID 5D65A 1PYWD 3KF8B 3HOXB 3X3NA 1WTQA 3GV3A 4R4OA 1AE2A 5M5XH 4GLAC 4KHVA 4DUZL 3HOWG 1EEFD 1X9NA 1S5FD 2E2JB 1SJHD 5FK9C 4PZ7A 5IP7G 5AJ3L 4PV1C 5IGEA 2DNEA 2AWOA 5JVH3 1V1QA 2F0JA 2IW3A 1B4OA 3DHQA 2JXMB 1C4QA 3O13A 2EY6A 2K6AA 3J80L 4GNXA 1JWUD 1U5KA 2D62A 4FF3A 1MI2A 2JA5B 2EY2A 2K1BA 2UUAQ 5CBEE 3KLSX 2IX3A 1TVXA 2AQ1B 5DEHA 4MHEA 4A3KG 3P20A 1UNSA 1SE8A 1SFOB 3EA6A 3QOLA 3S9WA 5C3XA 2UUBQ 3MXNA 1YITA 2EVBA 1LTTD 2NZ1D 5ELDA 3RR5A 4L6TB 1YEZA 2KHIA 1DOMA 1RDPD 1I4HA 2HIVA 3ND8A 5L37A 4U68A 1Y8PB 2X6GA 3QR8A 5EQ0A 3W5OA 1JR0D 3OPOA 2CWAA 3CP0A 1A3TA 1F2ZA 1HNZL 5JJLA 3AQQA 4ZKBB 1WTWA 4KJOA 2B2UA 4K2LA 2OT2A 2CH4A 1BBXC 1KTKA 1WFQA 1E2ZA 4BXXG 2B2TC 1X55A 2ZM6L 1CSQA 3I4NB 1TWHH 3EROA 3WWVA 1SYFA 5CV8A 1VQKA 3NHHA 4A3GG 1CKNA 1PFNA 1R9TB 4LF7L 1F9PA 1TT2A 3ER0A 4ABNA 5C3EB 4GLXA 1EYAA 3M4QA 4XQJA 2N8NA 1E1TA 2KHJA 3UDXA 4JPBW 1S40A 5DLQE 1WCMH 3D4WA 2N78A 3H3VI 2ATWA 5IOCA 5E4WC 3W3AA 5M3MH 4B3SL 4IO9A 4LFAL 1HZCA 2A6HD 3NTIA 5EKKA 4X62L 1EIGA 3EVQA 5ISRA 1K8GA 1JWMD 2A69D 1K3BC 3K5LA 1EEID 2XN9C 5KRUA 5CBAE 2JP1A 4BBRB 1UEAB 1O7ZA 1LYLA 1PRTB 1YBYA 2BDNA 4QB4A 4YHHQ 1O7YA 1CQFA 1IW7C 5KYLA 2E76C 1CSPA 4JI7Q 2N55A 3F2UA 4ZCKA 1AH9A 4N8X1 4JI1L 1ENFA 1YNJD 2KOLA 2MFIA 1N36Q 4KY7A 1BXTA 3AFQA 2IL8A 3A74A 3J81i 2R93B 2DGYA 1VQEA 3H91A 1I94L 2A19A 3L0OA 3CPFA 2HD3A 3KDFB 4I65A 1H9SA 2F0GA 4DR4Q 3GTLH 1VQ6A 4DR6Q 3KLSA 2EYPA 4OEMB 1K73C 2VB2X 2NVTB 1JB3A 2HDLA 1QZGA 5KEEA 2EXZA 4PMCA 4RCOA 2K5WA 4IJLA 4DV5L 2LY7A 3MVVA 3NBHA 4LFCL 1PH2A 2VQFL 5EGTA 5FLMG 3SK6A 5D3DA 3J7YW 3WOFA 2A68C 4FXDA 5LMUQ 5C3EG 2ZXPA 1K28A 3TSSA 4NPSA 1XNQQ 1MJCA 1PH9A 3NTHA 4OELB 5IODA 2OTLA 3MTSA 3I55A 1K83H 1PH5A 4ZQ3A 5J39A 3OW7A 4K2KA 5IGBA 3S15H 4JYAQ 1EIHA 3K7AB 3PCOB 1XPRA 3D6CA 2F4VQ 4DV2L 5C4JB 2ASBA 3S1NB 4BBRG 3MWYW 5CMDA 1QNKA 1EY8A 2NVXB 1SSOA 4J6HA 3KF8A 2F0PA 4DFAA 4ZKCB 2E2HB 3FPPA 4IUVA 4F88A 4YY3Q 1YIJA 4DR2L 3JAML 5A2QE 3E3XA 1ICWA 3TDQA 1D5XC 4GZYC 2ID0A 3E5SA 2DY8A 4A3IB 1N33L 4NKLA 2WB1E 2R93G 3KJPA 3AB9A 3HOUB 2B2WA 1BDOA 1L0YB 1QCBD 4P2CB 4RKBA 3BYTB 5C0XH 3CCLA 3M7GA 2BA1A 1ML0D 1Z9FA 1EQQA 5M3FH 2QW7A 3UDFA 2J7ZA 4TVAB 1GUOA 2PMZB 2YTXA 1TWCH 4DPGA 2QEJC 4ZAIA 2DY7A 4C56C 1BO0A 2ZJRA 5K36H 5JJKA 2B2VA 2DJFC 4A3JH 2NUCA 1XXGA 5JPMC 4QCLA 1OO9B 1HQRD 2KCMA 3DLLA 3TP6A 1N9WA 2MP1A 3HEJA 2F0FA 1ILPA 4OO1H 2H5XA 2UUAL 1WD1A 2F0LA 4A3FG 2D0PA 2EDGA 1FYCA 3S2HB 2K5DA 3H94A 4GKJQ 5JPNC 4JI3Q 4DAYB 4R4CA 1JOKA 1EQVA 2AUKA 2F0MA 2FMMA 5JEAG 1T5EA 4N9TA 1G6PA 4X65Q 5E7NA 2UUBL 1EY6A 2YV5A 3MZ5A 1I4XA 5FLXc 1BCPD 1UEBA 3BU2A 4ME5A 1DJRD 2PZTA 3GTQH 3D4DA 4OHJA 2K33A 3BG3A 2BH2A 2R7FA 4CDCC 2VQEQ 1C48A 2WAQE 2ZXRA 1NE3A 3C46A 3D8GA 4FDBA 1LUZA 1A0IA 2F0DA 1U9RA 1E1OA 3U9SA 3J81c 4DR1L 3CC7A 1MBYA 1TWAH 4NMZA 3PO2B 2PW7A 3TP5A 1CFMA 1HCZA 4A3IG 4FP5D 4DV6L 2NVQB 3CAMA 2JA7H 4J15A 2WV6D 4N9PA 2F0SA 4P73A 4A3MB 1HZ9A 2FFKB 5LMNW 3GTMB 4LFBQ 2JA8H 5LMNQ 1M8AA 1MGSA 2KA7A 4OIJA 1LO5D 2L0CA 3D31A 4JCVE 4DR7Q 4IUTA 3PF5A 1EOVA 1SE3A 5AFWA 4NXMQ 3NUCA 4FNFA 2YTVA 3CCQA 1NNXA 4BA1I 1SJED 2D0OA 4BBSH 3I73A 2EE1A 4BY7H 4YHHL 1C7YA 1J6QA 3KDFA 4AQYQ 3J7A5 4A93B 1P8LA 4IZ8A 4BY1G 4DK1A 1K9MC 3DUZA 3MFYA 1H9KA 3MFGA 3MEHA 2MNAA 3RUZA 3K5MA 4MTKA 1EU4A 1N36L 2R92B 1QUQB 2YTYA 1Y1WB 4RGTA 4EQNA 2QA4A 3OSOA 1GOZA 1W6KA 2VB3X 5C44B 2EYFA 2CVRA 4QF4A 1HRJA 4Y7NB 1NTGA 4FF1A 1NMFA 2F0UA 5AJ3Q 4DR4L 4IN3A 3U4ZA 1SNMA 3H0GB 5BN4A 1DCZA 4DR6L 2KUMA 2HCCA 3CD6A 3DEOA 5FJ8H 1BUVT 1LT3D 1N34Q 1QG7A 1UE5A 1E7ZA 1GD7A 2LSSA 1CZWA 3I70A 2B29A 2NZOA 5IP9G 1SEBD 2A6EC 2IJ0A 1XMQQ 3OOCA 5C4XG 3K6OA 3PO2G 2G5DA 1YNXA 1CT1D 2KCNA 1K0RA 3ERSX 3STBD 3VA5A 3S1QB 3M4OB 4ID6A 3D0FA 3MXPA 1TKWB 2L12A 5JAVA 5LMUL 3AYHB 4A3MG 1CI3M 3FEWX 1L1OA 2B2YC 3VYRA 5T1IA 3BDCA 1HNXQ 1TWGB 2C9OA 1M1KC 4RGOS 2NYZD 2B63B 3ICEA 5GAHC 3HKZE 1HNZQ 1C9OA 3S14H 1BKBA 5J3BA 4XDXA 1EWCA 3RN2A 4A3EH 1EY9A 3J80i 3NELA 4DR5Q 3K8AA 1VQAA 3AU7A 1G2SA 1GO3E 5DNFA 3CPWA 5C4HA 4L8JA 1XYIA 4A93G 1VQHA 2JYOA 2M00A 4A4IA 1VQ5A 1LT5D 1V1PB 4A3BH 4YY3L 1X3PA 4KD3A 4TKOB 1IL2A 4FYDA 4L5SA 4DV3Q 2JA6H 3OW2A 1CK1A 1A62A 4J8QA 1Y1WG 2AKWB 4XYQA 3HOYH 4LFAQ 3T16A 3PO3H 4QIWB 3H6MA 2E2IB 1GUTA 4PQXA 2RBMA 4DV7Q 1SMYC 2VNUD 1SLJA 1U4MA 4JC0A 1TS3A 2L1BA 3P75A 3H0GG 1VQ9A 1FGBD 4AYBE 3DWQA 3SEBA 4LF4Q 1A6XA 2SEBD 1PV4A 1I3QB 3A55A 4BWGB 2VUMH 1G291 1J9OA 4RFBA 1LTLA 3JC66 3CCJA 1BF4A 2E74C 2O5IC 1IHZA 2OF1A 3S1MB 3GO5A 4MIUA 3S1RB 2LS01 4CDEC 1TS2A 3TP8A 1MIUA 4OONA 4GKJL 1QVGA 1PHJA 3NWSA 1PRTD 3I3CA 5D14A 3FKIH 1B3QA 1WTHA 3KYHC 1AEXA 2F0EA 2JA9A 1B1ZA 2A6HC 4X65L 4JI2L 1VQIA 5BN3A 1SMXA 3TS0A 5A2QL 4KV6A 2A69C 1Y1VH 3M7NA 1Q90A 4GKKQ 1VDZA 2CW0D 1B8AA 3RLOA 1PVOA 2ENBA 1VQOA 4LUVA 2G9DA 3FRPB 4CKEA 4DGZA 5C0XJ 2VQEL 2IX1A 2MO0A 5IGGA 1V1OA 1V9PA 2V4DA 3SDZA 4WJ4A 4GN4B 3HOWH 2Z0SA 1E2WA 1MJEA 1CQVA 5ELOA 1M90C 2KCCA 2R6GA 4NW2A 1EWHA 3FMCA 1DONA 1STBA 1YHQA 4LF9Q 1D1IA 2VL6A 4DNIA 2RDGA 5IP7H 2CCZA 3K57A 4LFBL 2NVYH 4A3DB 3R2IA 3K80C 5LMNL 1NBWA 2E75C 5IGDA 1WVLA 4G7ZC 1B70B 1RF2D 1AN8A 3VYSA 4DR7L 4HAEA 4C2MB 3VA7A 2Z6KA 1QUQA 1R4QB 1TY0A 5IIFA 3EN2A 3OTOL 1EZ8A 4PZ8A 3NSWA 4A3KH 2L5TA 4BA2I 2XTIA 5ELNA 2K03A 4AQYL 1D5MC 1K8MA 1N33Q 2JN4A 4JW0A 3RZOH 4NXNQ 5CV6A 3M3YH 3RNUA 5M5XB 5DM63 1JJGA 1EYDA 1QVFA 1WTVA 4DNTB 1OXXK 2CH4W 4XT1B 3KBGA 1XJVA 3T4AC 4GN3B 1RHPA 4P71A 1UUPA 4QUFA 1EU3A 2VZAA 2Q2TA 3I91A 1STAA 4C3HG 4FF2A 1KLGD 3KOJA 3RZDH 4P75A 4BXXH 2RDHA 1Z7TA 2I5LX 3CCRA 3JAMi 1PTOH 1OTCA 3HOZG 4MNOA 2F3VA 3BDOA 4HN7A 2PZUA 1N34L 1F2LA 4IFDG 4DXGA 4OL7A 3Q23A 1YJWA 4KY6A 3D4RA 5KIXA 1XMQL 1PLFA 2X6LA 3M9BA 1EFWA 3DMUA 3T53B 1PXUA 2E2DC 2R7ZB 2E2JH 3FP9A 2N3SA 4UAIA 5KYIA 1VF5C 5I2XA 3RN5A 5IWAQ 1KAAA 4A3DG 3RMHA 2G9HD 3PIP3 4RH6A 1HZBA 1V1PA 2Q8RE 4DK0A 1X3EA 2OQ0A 3NP8A 1HNXL 1MSHA 2QDBA 2SNSA 1XWEA 3CCMA 1TWHB 3Q22A 1LT6D 1X56A 4A3CG 4HJ7A 4DR5L 4DR1Q 3LWUA 3UDIA 4DV6Q 1SFOH 1F9RA 4U673 1YNNC 2KVMA 4ZUJA 2LMCB 1CTMA 2EPBA 2B2TA 1D1KA 1H9JA 5M3MB 4B3TQ 4DV3L 4ME3A 4R4TA 2R61A 3HOXG 1NR4A 5IT9E 1S4ZA 2NN6G 4H02A 2O4XA 5KNBA 3SVMA 3TRZA 4LJZC 4CDFC 3NENA 1K8OA 3GTJH 1MSGA 3EJIA 1WTPA 1D6EC 4B08A 4DV7L 1A8VA 5H1SE 4EX5A 5HGQA 1BOSA 4I7AA 3ULPA 3J81j 1YI2A 1EL0A 2JK8A 1EY4A 2WIIB 1KC8C 5FLMH 2TMPA 3A5ZB 1XNRQ 4RGNA 4C3JB 4LF4L 1EYCA 1Q81C 4DAVA 2JA5G 1E2VA 3IAYA 4HEDA 3OHXC 4IFDI 3DWPA 2Z4IA 1VQMA 3LX0A 3VR2A 2PI2E 1UE7A 4FXKC 5ELCA 4H7BA 2UXDQ 3NBIA 3V96A 2F0HA 2WKCA 4OWWB 2D2CC 4DA2A 3GTLB 2XRQD 4LAAA 2R7ZG 1I6HH 4WORA 1KABA 4LF8L 2ZT9C 1S3OA 3BS1A 5JJZA 2CQOA 2KJXA 3OWFA 3T51B 5CV5A 2HHHQ 1WYDA 2AHOB 4IPDA 1IKLA 5I2YA 2XWBB 4IPCA 3ULLA 1FNVA 2SOBA 4GKKL 3A8IE 1GUSA 2B8FA 4RGMA 2R93H 4JI0Q 2M9VA 4PMWA 2JQOA 1PH1A 1BBWA 4X3SA 2N88A 3I4NG 4JI4Q 4UP7A 5IYBG 2QEXA 5HGTA 1K0SA 3BVGA 4KMUC 1K83B 2JE6I 5FOBB 1PFSA 2WB1B 5G3LD 2NTSA 5M5WH 3QWNA 1O80A 4FXGC 5IYCG 3S15B 4O0AA 3BVMA 4K5WA 1SNPA 2BDOA 1VF7A 1NJIC 2JJQA 5C4ZA 2NVTH 2NN6I 4LF9L 2A5HA 1YHBA 2GVBA 4XT3B 3JAMc 3U4VA 1X54A 4RWSC 1B7YB 4FVMA 1CA5A 2C5CA 2QKIC 1YJ9A 3I4MB 2L9HA 2PZWA 1IL8A 1LACA 3A7LA 1B53A 3E6ZX 2EJGC 1ICFB 1PTOC 1RJTA 1A3VA 1O7IA 2K32A 5EAYA 4C3JG 4A3FH 5EBCA 3K0XA 3KK7A 4FO2A 1LT4D 2YYZA 3CRKC 5M3FB 1EIFA 5FO9B 1SBBB 3I4LA 4RG1A 1NY4A 4NXNL 3STBC 5JEAH 3PIPA 2F3WA 2H4OA 1TWCB 4CKBA 4X64Q 3LGJA 1TXYA 5C4JH 4DV0Q 4DR3Q 1X32A 2CWPA 3P7JA 1LTSD 3N6RA 3PUZA 2NVXH 1PMRA 1P16A 2E2HH 3K81C 4A3JB 1Z47A 3WDNA 3FDTA 3T56B 1NSNS 1UE6A 2TSSA 5C3WA 4UY8C 3S16H 3HZXA 3SK5A 2N49A 4K5VA 3PIO3 3U50C 5BN5A 5JVG3 1U4RA 5GROA 3IFDA 2IT1A 3A8KE 4G7HC 3FHWA 1RL2A 1CHQD 1PH3A 4RMFA 2ICEC 2WAQB 2L11A 5ELFA 3TBIB 1EQTA 3IKJA 3CXCA 1WTXA 1FNWA 4CJ2C 2I07B 2RQXA 2WB1G 4ILWA 1GUNA 2ES2A 3NXWA 1TR5A 1G6ZA 5A35A 2K50A 1PH7A 2XSCA 1WD0A 1ZEQX 5I9PA 4FF4A 4JI2Q 5LL6X 1BR9A 2ALYB 1II3A 3GTQB 1TWFH 4M1UB 5IWAL 4F8MA 2AQ3B 3I4MG 2Z9HA 4JK1C 1ZKOA 3Q0AA 1RTOA 4BY1H 4IJHA 1XPOA 4IUNA 3U9OA 1TWAB 3G71A 1Q7YC 1Q12A 1OXTA 3TZUA 5LHY1 2MO1A 1FVIA 1PH6A 5FKAC 1H9RA 4YCUA 4XTCS 3KFUA 1AW7A 4B3RQ 2RHSB 2JA8B 2Z4HA 1XTDA 3HOUG 3I56A 4IOCA 1LM0A 3A54A 3GDEA 3VDYA 4MN3A 3R8BA 1DOLA 1IW7D 4QY7A 4Y52H 4XIGS 4JBJA 4B3TL 1KHIA 4K14A 5K36G 3CW2C 3QIAA 2K52A 3GTPH 1IYVA 3HKSA 1Q46A 2GA4B 4JOIC 3CRLC 3NE5B 4DV1Q 1WTOA 4BY7B 4A3JG 4DNRB 1HHVA 4UHVA 5IP9H 3BZKA 2C35B 2IHFA 2K28A 3NPPA 5C4XH 1B44D 5M5YH 4YCVA 3CMAA 3OTOQ 1N8RC 2BE5C 1VQLA 1MHWC 4OO1G 2SDFA 3LWEA 3VR3A 3A56A 1IBLQ 2O2LD 2WAQG 5IYDH 2UUCQ 2EOTA 1XNRL 3J7ZC 4R8IA 3K58A 1XMOQ 4AH6A 3GTMH 1I4GA 3U58A 2F3IA 3UDGA 2HT1A 3R3OA 1HH2P 5TSSA 3C1EA 1PA6A 1CKMA 2UXDL 3S2DH 4KN7C 5EPLA 2VXWA 4HJ9A 4PMBA 4EQPA 1ZYRC 4QUCA 3TMEA 2NBFA 1I5FA 4E6IA 3ZYYX 2A68D 2RHQB 3QO2A 5CGKA 4A93H 4DUYQ 1J5EQ 4YWKA 1OXVA 1SYDA 3MHBA 2HHHL 4Q5VA 4O2DA 3DM3A 1E0BA 1A2UA 1SE4A 3KUPA 4A76A 1CHPD 4XQQA 2EXDA 2V1CC
chains in the Genus database with same CATH topology
5IT9L 4WJWA 4IQZA 1KLUD 1LTGD 4R8NA 1W6JA 3QJYA 4H13C 1ONLA 3VR4A 4L63B 3S14B 4A3EB 1STYA 1A15A 5C6AA 4C1NK 3AMUA 3UI2A 1G2TA 3A7AB 2B2YA 1CM9A 3G7LA 3X3MA 1C8CA 4C1NI 1B9NA 2R3ZA 3BYYB 1ZXTA 4AYBB 2A74C 1QOHA 1VMPA 2EY1A 2F4IA 4OO1I 1NUCA 3W2DA 5T1GA 3OIPA 3KBXA 3PO3B 4OGQC 1HFNA 2RDFA 1SYCA 4G57A 2D9UA 1Q1EA 2MPMA 2EY5A 4C3IB 3GV6A 4DAYA 3MC0B 4YIJA 2IWHA 1JOOA 4KKTA 4QMGA 4JBWA 3R93A 3HG9A 5D3IB 4KKUA 3OMCA 3FKIB 1RCVD 1PZJD 4IUPA 4HTHA 4KN4C 4LMQD 4TRDA 1BCPB 1U4LA 3V05A 1Y1VB 1TQOA 5I9OA 2F0KA 3HOVB 4EGVA 2KEEA 2RSNA 2YU9B 1S5DD 3ITPA 3BZDB 1X3QA 2IX0A 3I90A 3SE0A 4RKLA 2CQAA 3TP7A 2AUJD 3C3LA 1GHKA 5JEAJ 2LFNA 3HOWB 1STHA 1I4QA 2CHBD 1JE4A 4TSSA 1B3AA 2Y0SB 3PMFA 1BNZA 1YNJC 1KNAA 3LNNA 4TQUS 3H09A 2O5JC 4CBVA 2AQ2B 4ZRZA 2X69A 4C3IG 2WACA 3SXHA 4ZK9B 4IFDH 2BOSA 2XIWA 2M2LA 5LL6S 1LABA 3M3YB 1TY2A 2F0VA 2KECA 4WFN3 1G91A 1SNDA 1FD7D 1RD9D 1JWSD 1PDQA 3DXJC 3CKIB 4V190 3URYA 2J4XA 1EY0A 2Z1CA 2WINB 3MXGA 2A6ED 3RZDB 3CHBD 1U4PA 1NAPA 1PTOB 1WTRA 5JOBA 4R9WA 3MAQA 1BCPF 5FLXE 3QG1A 3Q24A 1Y69U 3QOJA 3EFXD 4XQNA 2LKVA 3VR6A 4O1NA 5CV9A 2JSOA 1DZ1A 3J81E 4KI0A 1TS5A 2NN6H 2PPBC 3BVZA 1EOTA 1R4PB 4K8IA 4Z9CB 4I7ZC 2Q8IB 3L7ZC 2B8GA 1JCKB 4HCEA 5CYUA 3TZDA 1HA5A 1VCIA 2EYHA 1SAPA 2PQEA 3BDLA 1QJOA 2J0TD 3HP3A 2EYLA 5FO8B 4DAPA 4UDUC 2IPKD 1SMYD 2B2UC 2PO4A 3Q6SA 5K5PA 4M8AA 1OXUA 3GQBA 1WCMB 5HURA 1XX8A 4RA8A 1V43A 3GTJB 2L55A 3NQTA 1KDBA 1S5BD 4V0BA 3SR1A 1I4RA 5DAUA 2FJ2A 1NCVA 2H1EA 1I4PA 5M9OA 1BCPC 3VYTA 3N52A 1PTOF 2ZXOA 1ENAA 5FO7B 4J1MA 1LTBD 1AZQA 1Q8IA 3D3RA 3SK8A 5I6WA 2HDMA 1I6HB 1IKMA 1L0XB 3H3VC 2L4NA 1SYBA 4IALA 4KKSA 4O42A 3A8JE 3K5OA 4XXEA 3PUYA 5EJWA 5NUCA 3VR5A 1A3UA 2F0WA 3GP7A 4DN4M 4K5XA 3HGBA 2FINB 1DXMA 2F1MA 3KLRA 1EZ6A 1FNUA 4HMJA 5CV4A 5E4XA 1IYUA 1H9MA 3HS0C 4RHRA 5M5WB 1HUMA 2I46A 4K6LA 3VYUA 1SYGA 5IGCA 5EKIA 2FHTA 4ZLTF 3QB3A 5C5MA 5EBDA 1XTCD 2K04A 1BQQT 3C2PA 2EJMA 2FMCA 2DN8A 1T5XD 1F2MA 3PUWA 1AP0A 4A3FB 2XNAC 3V2TA 2EZVA 1F9SA 1AZPA 1HTLD 4NP5A 2EYOA 4IURA 4ODGA 1S5CD 3K0YA 3M4YA 4Q0FA 5ELBA 1Y8OB 3FVQA 1FR3A 5CC4A 1NR2A 2Q8TA 1PZID 3J7AV 4X3KA 1VMCA 1M4VA 1LTAD 4CHTB 4KHZA 2F0OA 3S16B 2B2WC 1D5ZC 1PRTF 5EKLA 4WRDA 2KHSA 1LV9A 1DM0B 1SYEA 4OIKA 1DYQA 3NQIA 2EYMA 4G4KA 2QILA 1STNA 1RKNA 2NB0A 1HUNA 5J22A 5I4DA 2Z8LA 2HUGA 3PUXA 3NK9A 2B2VC 4IUQA 4DU9A 3RD4A 2EJFC 5ELEA 1B50A 3PV0A 4CKCA 4ZUIA 1V8QA 2RA4A 3OIQA 1DOKA 1O7LA 3M85A 1SE2A 1LTRD 3NTKA 1ILQA 1TWFB 1GXDC 2EYJA 5E1FA 4IFDJ 2F0NA 4BY1B 1GHJA 1YNND 5EPJA 5F2DA 3IFTA 2BA0A 2K05A 3K59A 5KNCA 4KTAA 4RHSA 1OXSC 1SXTA 1TS4A 1O78A 1Z6HA 3SHLA 3K5NA 2JA7B 1STGA 5C0XG 3WOEA 2KEDA 3GTPB 2KQ3A 2F03A 5FLXL 4BBSB 5C4XB 1PRTC 5M5YB 1QB5D 1ESRA 2F0QA 2WP8J 1JORA 1PFMA 3J80E 3IL8A 5E3FA 2OEOA 4DF7A 3J81L 1HQMC 2CW0C 4HMIA 2PYKA 3OMGA 2ICIA 1GJXA 5DM73 4S3SA 3DWAA 1Q1BA 3S2DB 2XWJB 4H44C 4F87A 4HCSA 4KY5A 5I6YA 3MA2B 2XVSA 1F9QA 4KD4A 1TIID 1EY7A 1STEA 4HR7B 1ENCA 3DEPA 4B9WA 5J1ZA 3HKZB 1F77A 1KNEA 5IGFA 4CGYB 3MXUA 5CV7A 2F0IA 2NTTA 3SK4A 1ET9A 3C1FA 2PW5A 3I8ZA 4KJNA 3P1HA 5C0XI 3S17B 1SDFA 1PTOD 3G6JB 1EFID 1JICA 1QWYA 3I72A 1B2TA 4X3TA 1HA6A 3GTOB 2D5DA 4HSPA 4B9XA 4A3BB 1A2TA 1EY5A 3ND9A 2MJ8A 1GUGA 3DM1A 2JA6B 2DNCA 1ESFA 1SNQA 1AFPA 3GTGB 4HSVA 3HOYB 2PNRC 4ZYSA 4LK1C 4RCNA 3J7AF 3R2TA 2RSOA 2PCFB 1SNOA 1KDCA 4KK7A 5KNDA 1I50B 4NDXA 3GD7A 1HFGA 1MD2D 3FPUB 1J8IA 2JEAI 2VUMB 2QF7A 1I6VC 3OWEB 5C5LA 5KGUA 3RLFA 4DXFA 2BCOA 5G3LF 3D6WA 2HCIA 3L9AX 3NWTA 5CR3A 1JC7A 4X3UA 2WKDA 1ET6A 1PFBA 1F2YA 3CQZB 3JAME 1CZGA 4RAUC 4K6DA 4K8JA 1G8ZD 2OXPA 2XRSD 4BS9A 1KDAA 1JQYD 1B9MA 2K5QA 2JEBI 3ONAB 3CU7A 2K7VA 1HXYD 4XYOA 4C3HB 1QNUA 4G7OC 3PUVA 4EVOA 2NVYB 3HOZB 2BE5D 1QILA 2RVLA 2MHVA 2SNMA 3ERQA 1H9SB 1Y8NB 2NWGA 1UAPA 1DD2A 5COYA 2F0TA 1TU2B 1PZKD 1SNCA 4ULLA 4CJ1B 4A3KB 2K01A 1Q3LA 3T13A 1LLRD 4EQOA 3RZOB 1JOQA 2B39A 1S5ED 2MGSA 1ZYRD 2AWNA 2HQEA 4H0LC 1CA6A 2A73B 1GUWA 2MUYA 3EQLC 4IUUA 1HTPA 3HRZC 3TN2A 1RODA 1QE6A 4F7XA 2QCPX 1HPCA 1D2BA 3L3OC 5EPKA 2RKSA 4CJ0B 1RTNA 3E0JA 3GTKB 4A3GB 4PNYA 5CORA 1LTID 5D65A 1PYWD 3HOXB 3X3NA 1WTQA 3GV3A 4KHVA 1EEFD 1S5FD 2E2JB 1SJHD 5FK9C 4PV1C 5IGEA 2DNEA 2AWOA 5JVH3 2F0JA 2IW3A 1B4OA 3DHQA 2JXMB 1C4QA 3O13A 2EY6A 2K6AA 3J80L 1JWUD 2D62A 4FF3A 1MI2A 2JA5B 2EY2A 2K1BA 5CBEE 3KLSX 2IX3A 1TVXA 2AQ1B 5DEHA 4MHEA 3P20A 1UNSA 1SFOB 3EA6A 3QOLA 3S9WA 5C3XA 3MXNA 2EVBA 1LTTD 2NZ1D 5ELDA 4L6TB 1DOMA 1RDPD 1I4HA 3ND8A 4U68A 1Y8PB 2X6GA 5EQ0A 1JR0D 3OPOA 1A3TA 1F2ZA 4ZKBB 1WTWA 4KJOA 2B2UA 4K2LA 2OT2A 1BBXC 1KTKA 1E2ZA 2B2TC 3I4NB 3EROA 1SYFA 5CV8A 3NHHA 1PFNA 1R9TB 1F9PA 1TT2A 4ABNA 5C3EB 1EYAA 4XQJA 3D4WA 5IOCA 5E4WC 3W3AA 2A6HD 3NTIA 5EKKA 1EIGA 3EVQA 5ISRA 1JWMD 2A69D 3K5LA 1EEID 2XN9C 5KRUA 5CBAE 2JP1A 4BBRB 1UEAB 1O7ZA 4QB4A 1PRTB 2BDNA 1O7YA 1CQFA 1IW7C 5KYLA 2E76C 2N55A 3F2UA 1ENFA 1YNJD 2KOLA 4KY7A 1BXTA 2IL8A 2R93B 3H91A 4I65A 1H9SA 2F0GA 3KLSA 2EYPA 2VB2X 2NVTB 1JB3A 2HDLA 5KEEA 2EXZA 4PMCA 4RCOA 2K5WA 2LY7A 3MVVA 3NBHA 5EGTA 3SK6A 5D3DA 3J7YW 3WOFA 2A68C 4FXDA 2ZXPA 3TSSA 3NTHA 5IODA 3MTSA 4ZQ3A 5J39A 3OW7A 4K2KA 5IGBA 1EIHA 3K7AB 3D6CA 5C4JB 3S1NB 3MWYW 5CMDA 1QNKA 1EY8A 2NVXB 1SSOA 4J6HA 3KF8A 2F0PA 4DFAA 4ZKCB 2E2HB 3FPPA 4IUVA 4F88A 3JAML 5A2QE 1ICWA 3TDQA 1D5XC 4GZYC 2ID0A 3E5SA 2DY8A 4A3IB 4NKLA 3HOUB 3AB9A 2B2WA 1BDOA 1L0YB 1QCBD 4P2CB 4RKBA 3BYTB 5C0XH 3M7GA 2BA1A 1ML0D 2J7ZA 1GUOA 2PMZB 2QEJC 4ZAIA 2DY7A 4C56C 1BO0A 5K36H 2B2VA 2NUCA 1XXGA 5JPMC 4QCLA 1OO9B 1HQRD 3TP6A 2MP1A 3HEJA 2F0FA 1ILPA 4OO1H 1WD1A 2F0LA 3S2HB 2EDGA 1FYCA 2K5DA 3H94A 5JPNC 1JOKA 1EQVA 2AUKA 2F0MA 2FMMA 5JEAG 1T5EA 4N9TA 1EY6A 3MZ5A 1I4XA 1BCPD 4ME5A 1DJRD 2PZTA 3D4DA 4OHJA 2K33A 3BG3A 1C48A 2ZXRA 3C46A 3D8GA 2F0DA 3U9SA 1U9RA 1MBYA 4NMZA 3PO2B 2PW7A 3TP5A 1CFMA 1HCZA 4FP5D 2NVQB 2WV6D 4N9PA 2F0SA 4A3MB 2FFKB 3GTMB 1M8AA 1MGSA 2KA7A 4OIJA 1LO5D 2L0CA 3D31A 4IUTA 1SE3A 5AFWA 3NUCA 4FNFA 4BA1I 1SJED 3I73A 2EE1A 4A93B 4IZ8A 4DK1A 3DUZA 3MFYA 1H9KA 3MFGA 3MEHA 3RUZA 3K5MA 1EU4A 2R92B 1Y1WB 4RGTA 4EQNA 3OSOA 1GOZA 1W6KA 2VB3X 5C44B 2EYFA 2CVRA 4QF4A 1HRJA 4Y7NB 4FF1A 2F0UA 4IN3A 1SNMA 5BN4A 3H0GB 1DCZA 2KUMA 2HCCA 3DEOA 1BUVT 1LT3D 1QG7A 1CZWA 3I70A 1SEBD 2A6EC 2IJ0A 3OOCA 3K6OA 1CT1D 2KCNA 3VA5A 3S1QB 3M4OB 4ID6A 3MXPA 1TKWB 2L12A 5JAVA 1CI3M 3FEWX 2B2YC 3VYRA 5T1IA 3BDCA 1TWGB 2C9OA 2B63B 4RGOS 2NYZD 4XDXA 1EWCA 1EY9A 3AU7A 1G2SA 5DNFA 5C4HA 4L8JA 1XYIA 2JYOA 2M00A 1LT5D 1V1PB 1X3PA 4KD3A 4TKOB 4FYDA 1CK1A 4J8QA 4XYQA 3T16A 4QIWB 3H6MA 2E2IB 1GUTA 4PQXA 2RBMA 1SMYC 2VNUD 1U4MA 1TS3A 2L1BA 3P75A 1FGBD 3DWQA 3SEBA 1A6XA 2SEBD 1I3QB 3A55A 4BWGB 1G291 1J9OA 4RFBA 1BF4A 2E74C 2O5IC 1IHZA 2OF1A 3S1MB 3GO5A 4MIUA 3S1RB 2LS01 1TS2A 3TP8A 3NWSA 1PRTD 3I3CA 5D14A 1AEXA 2F0EA 1B1ZA 2A6HC 5BN3A 5A2QL 4KV6A 2A69C 3M7NA 1Q90A 1VDZA 2CW0D 2ENBA 2G9DA 3FRPB 4CKEA 4DGZA 5C0XJ 2IX1A 5IGGA 1V1OA 2V4DA 3SDZA 1E2WA 1CQVA 2KCCA 2R6GA 4NW2A 1EWHA 3FMCA 1DONA 1STBA 1D1IA 2RDGA 3K57A 4A3DB 3R2IA 2E75C 5IGDA 1WVLA 4G7ZC 1RF2D 1AN8A 3VYSA 4HAEA 4C2MB 3VA7A 1R4QB 1TY0A 5IIFA 1EZ8A 3NSWA 2L5TA 4BA2I 2K03A 1D5MC 1K8MA 5CV6A 5M5XB 5DM63 1EYDA 1WTVA 4DNTB 1OXXK 4XT1B 3KBGA 3T4AC 1RHPA 1UUPA 4QUFA 1EU3A 3I91A 1STAA 4C3HG 4FF2A 1KLGD 2RDHA 1Z7TA 1PTOH 2F3VA 3BDOA 4HN7A 2PZUA 1F2LA 4IFDG 4DXGA 4OL7A 3Q23A 4KY6A 3D4RA 5KIXA 1PLFA 2X6LA 3DMUA 3T53B 1PXUA 2E2DC 2R7ZB 4UAIA 5KYIA 1VF5C 5I2XA 1KAAA 3RMHA 2G9HD 3PIP3 4RH6A 1V1PA 2Q8RE 4DK0A 3NP8A 1MSHA 2QDBA 2SNSA 1XWEA 1TWHB 3Q22A 1LT6D 3LWUA 1F9RA 4U673 1YNNC 2KVMA 4ZUJA 2LMCB 1CTMA 2EPBA 2B2TA 1D1KA 1H9JA 5M3MB 2R61A 5IT9E 1NR4A 1S4ZA 2NN6G 5KNBA 2O4XA 3SVMA 4LJZC 1K8OA 1MSGA 3EJIA 1WTPA 1D6EC 4B08A 1BOSA 1EL0A 1EY4A 2WIIB 2TMPA 4RGNA 4C3JB 1EYCA 4DAVA 1E2VA 3IAYA 4HEDA 3OHXC 4IFDI 3DWPA 2Z4IA 3LX0A 3VR2A 4FXKC 5ELCA 4H7BA 3NBIA 3V96A 2F0HA 2WKCA 2D2CC 4DA2A 3GTLB 2XRQD 4LAAA 4WORA 1KABA 2ZT9C 3BS1A 5JJZA 2KJXA 3OWFA 3T51B 5CV5A 1IKLA 5I2YA 2XWBB 1FNVA 2SOBA 3A8IE 1GUSA 2B8FA 4RGMA 2M9VA 4PMWA 4X3SA 2N88A 5HGTA 3BVGA 4KMUC 1K83B 2JE6I 5FOBB 2WB1B 5G3LD 2NTSA 3QWNA 1O80A 4FXGC 3S15B 3BVMA 4K5WA 1SNPA 2BDOA 1VF7A 5C4ZA 2NN6I 2A5HA 4XT3B 1CA5A 4RWSC 4FVMA 2C5CA 2QKIC 3I4MB 2L9HA 2PZWA 1IL8A 1LACA 3A7LA 1B53A 3E6ZX 2EJGC 1PTOC 1RJTA 1A3VA 2K32A 4C3JG 5EBCA 3KK7A 4FO2A 1LT4D 2YYZA 3CRKC 5M3FB 5FO9B 1SBBB 3I4LA 5JEAH 2F3WA 2H4OA 1TWCB 4CKBA 1X32A 3P7JA 1LTSD 3N6RA 3PUZA 1PMRA 4A3JB 1Z47A 3WDNA 3FDTA 3T56B 1NSNS 5C3WA 2TSSA 3HZXA 3SK5A 4K5VA 3PIO3 5BN5A 5JVG3 1U4RA 3IFDA 2IT1A 3A8KE 4G7HC 1CHQD 2ICEC 2WAQB 2L11A 5ELFA 3TBIB 1EQTA 3IKJA 1WTXA 1FNWA 4CJ2C 2I07B 2RQXA 4ILWA 1GUNA 3NXWA 1TR5A 1G6ZA 5A35A 2XSCA 1WD0A 1ZEQX 5I9PA 4FF4A 5LL6X 1BR9A 1II3A 3GTQB 4M1UB 4F8MA 2AQ3B 4JK1C 1ZKOA 3Q0AA 1RTOA 4IUNA 3U9OA 1TWAB 3TZUA 1OXTA 1Q12A 5LHY1 5FKAC 1H9RA 4XTCS 1AW7A 2JA8B 2Z4HA 3A54A 4MN3A 3R8BA 1DOLA 1IW7D 4XIGS 4K14A 5K36G 3QIAA 1IYVA 2GA4B 3CRLC 3NE5B 1WTOA 4BY7B 4DNRB 1HHVA 2K28A 3NPPA 1B44D 2BE5C 4OO1G 2SDFA 3LWEA 3VR3A 3A56A 2O2LD 2EOTA 4R8IA 3K58A 1I4GA 3R3OA 5TSSA 3C1EA 4KN7C 5EPLA 2VXWA 4PMBA 4EQPA 1ZYRC 4QUCA 3TMEA 2NBFA 4E6IA 3ZYYX 2A68D 3QO2A 5CGKA 1OXVA 1SYDA 3MHBA 4Q5VA 1E0BA 1A2UA 1SE4A 3KUPA 1CHPD 4XQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y W;  4V19 0; 
#chains in the Genus database with same CATH topology
 1VS0 A;  5IT9 L;  4JI0 L;  2UU9 L;  4WJW A;  1PYB A;  1IBK Q;  4IQZ A;  4JI4 L;  1KLU D;  1PH8 A;  1LTG D;  4R8N A;  1W6J A;  1KL9 A;  4HJ5 A;  4A3L G;  3QJY A;  4H13 C;  2OWO A;  1ONL A;  1X3F A;  3VR4 A;  4L63 B;  3S17 H;  3S14 B;  4A3E B;  1STY A;  1A15 A;  3PIO A;  1PH4 A;  5C6A A;  2I5M X;  4LF6 Q;  4LW1 A;  4C1N K;  3B6Y A;  3AMU A;  3UI2 A;  1G2T A;  3A7A B;  2B2Y A;  1CM9 A;  3G7L A;  3X3M A;  1C8C A;  3PSI A;  4C1N I;  1B9N A;  2R3Z A;  3I2Z A;  3BYY B;  1ZXT A;  4AYB B;  4GNX B;  4NB3 A;  2A74 C;  1QOH A;  3GTO H;  1VMP A;  2EY1 A;  2F4I A;  4KHP Q;  3NEM A;  4OO1 I;  1NUC A;  4PZ6 A;  3W2D A;  5T1G A;  3OIP A;  2K14 A;  2E5L Q;  1VQG A;  3KBX A;  2ZTD A;  3PO3 B;  2R92 G;  4OGQ C;  3GTG H;  2RCF A;  1HFN A;  3MXN B;  2RDF A;  1SYC A;  4G57 A;  2D9U A;  5C44 G;  4X64 L;  2K5V A;  1Q1E A;  2MPM A;  4DV0 L;  4DR3 L;  4A75 A;  2I5H A;  2EY5 A;  4C3I B;  4QJF A;  1Y14 B;  1I50 H;  3M4P A;  4LUO A;  4HJA A;  1X65 A;  3BJU A;  2QDL A;  3GV6 A;  4GN5 A;  4DAY A;  4EQ5 A;  3MC0 B;  4YIJ A;  1VQD A;  1CKN B;  2K5N A;  2IWH A;  1IXR A;  1ASZ A;  1GKH A;  1JOO A;  4KKT A;  4QMG A;  4JBW A;  3T1H Q;  3R93 A;  2E2I H;  3HG9 A;  5D3I B;  4KKU A;  3OMC A;  4LF8 Q;  3FKI B;  1RCV D;  1PZJ D;  4IUP A;  4HTH A;  4KN4 C;  4LMQ D;  4LWC A;  1BCP B;  1U4L A;  4TRD A;  3V05 A;  2EIF A;  1Y1V B;  1TQO A;  5I9O A;  2B63 G;  3F2B A;  2Q2I A;  2F0K A;  3RLN A;  3HOV B;  2Q2U A;  4EGV A;  2KEE A;  2RSN A;  2YU9 B;  1S5D D;  3H15 A;  1UWV A;  3ITP A;  4GOP C;  2E8G A;  3BZD B;  1X3Q A;  2IX0 A;  4YCW A;  3I90 A;  3SE0 A;  4RKL A;  2CQA A;  3G6E A;  3TP7 A;  4AIM A;  1IBM Q;  4LNQ A;  2AUJ D;  3C3L A;  1GHK A;  3CQZ H;  5JEA J;  2LFN A;  3HOW B;  1STH A;  4P72 A;  1I4Q A;  2CHB D;  1JE4 A;  4TSS A;  1B3A A;  1VQB A;  2Y0S B;  3PMF A;  1KRS A;  1YHA A;  3H3V H;  1BNZ A;  1YNJ C;  1KNA A;  5JJI A;  4B3R L;  3LNN A;  4TQU S;  4YWM A;  3H09 A;  2O5J C;  4C3H H;  4CBV A;  3PGZ A;  2AQ2 B;  3HOZ H;  4ZRZ A;  2X69 A;  4C3I G;  2PNH A;  4HJ8 A;  1HZA A;  2WAC A;  5GAE C;  4DV1 L;  3SXH A;  4OWT B;  4IPH A;  4ZK9 B;  2BOS A;  4IFD H;  4UPA A;  2XIW A;  4R1J A;  3G48 A;  2M2L A;  5LL6 S;  1LAB A;  4R4Q A;  3M3Y B;  1TY2 A;  2F0V A;  2KEC A;  4WFN 3;  1G91 A;  1SND A;  1FD7 D;  1RD9 D;  1MKH A;  3OYY A;  1JWS D;  2ZJQ A;  1PDQ A;  3PQI A;  1IBL L;  3DXJ C;  2UUC L;  3CKI B;  2B3G A;  4V19 0;  3URY A;  2J4X A;  1EY0 A;  1XMO L;  2KBN A;  1EWI A;  2RF4 A;  2Z1C A;  2WIN B;  3MXG A;  2RCN A;  3FKI G;  1JJ2 A;  1U0L A;  2A6E D;  3RZD B;  3CHB D;  1DGS A;  1Y1V G;  1QZH A;  1U4P A;  4P74 A;  1NAP A;  1PTO B;  1WTR A;  2K5H A;  3J80 c;  5JOB A;  3CCS A;  1VQ8 A;  3HOV G;  4A3C H;  4R9W A;  3MAQ A;  3AEV A;  1BCP F;  5FLX E;  3QG1 A;  3Q24 A;  1Y69 U;  3QOJ A;  3EFX D;  4XQN A;  2LKV A;  4DUY L;  3GTK H;  4A3G H;  1J5E L;  4B3M Q;  3VR6 A;  4O1N A;  4POG A;  5CV9 A;  3HOX H;  1EIY B;  2JSO A;  2Y0S G;  1DZ1 A;  3J81 E;  4KI0 A;  1TS5 A;  1SN8 A;  4GNX C;  2NN6 H;  3TRE A;  1KAW A;  1IBK L;  2PPB C;  3BVZ A;  1K8A C;  3AFP A;  3I7F A;  1EOT A;  1R4P B;  4K8I A;  4JI5 Q;  4Z9C B;  4I7Z C;  2Q8I B;  4MZ9 A;  3L7Z C;  1T9H A;  2B8G A;  1JCK B;  4HCE A;  5CYU A;  3TZD A;  1SRU A;  2A1A A;  1HA5 A;  4LF6 L;  1VCI A;  1CUK A;  2EYH A;  1CKO A;  1SAP A;  1X6O A;  2PQE A;  5GAD C;  3BDL A;  2JA5 H;  1QJO A;  4JI6 Q;  2J0T D;  3HP3 A;  2EYL A;  5FO8 B;  4DAP A;  4UDU C;  1KQS A;  2IPK D;  1SMY D;  2B2U C;  2PO4 A;  3Q6S A;  5K5P A;  4KHP L;  4M8A A;  2HIX A;  1OXU A;  2R7Z H;  1FGU A;  3Q8D A;  4K0K Q;  3GQB A;  1WCM B;  4YWL A;  5HUR A;  4DKA C;  1XX8 A;  3CC4 A;  4RA8 A;  2E5L L;  1V43 A;  3GTJ B;  2L55 A;  5BR8 Q;  2UXC Q;  3NQT A;  1KDB A;  4N8F A;  1S5B D;  2XGT A;  4V0B A;  5GQO A;  3SR1 A;  1I4R A;  5DAU A;  2FJ2 A;  1NCV A;  2H1E A;  1I4P A;  5M9O A;  1BCP C;  3VYT A;  3I4N H;  1VQ4 A;  5IYB H;  3N52 A;  1PTO F;  1VQJ A;  4JG2 A;  2ZXO A;  1ENA A;  1A63 A;  5FO7 B;  4J1M A;  1H95 A;  1R9T H;  2WFW A;  2KCT A;  1LTB D;  5C3E H;  1AZQ A;  1Q8I A;  3D3R A;  5IYC H;  2OTJ A;  3SK8 A;  1E3P A;  5I6W A;  2HDM A;  1I6H B;  1IKM A;  1L0X B;  4DK6 C;  3H3V C;  3SGI A;  3CME A;  2L4N A;  1SYB A;  3T1H L;  4IAL A;  1BVS A;  4KKS A;  4O42 A;  3A8J E;  2GN5 A;  3K5O A;  1EQR A;  4GS3 A;  4XXE A;  4BBR H;  5IY0 A;  3PUY A;  5EJW A;  2R7D A;  5NUC A;  3VR5 A;  1A3U A;  2F0W A;  2LXK A;  3GP7 A;  4DN4 M;  1XPU A;  4K5X A;  4ALP A;  3HGB A;  4C3J H;  3ULJ A;  2CFM A;  4DV4 Q;  1Q82 C;  2FIN B;  1DXM A;  2F1M A;  3KLR A;  4QQB X;  1EZ6 A;  1FNU A;  4HMJ A;  2DJG C;  2IHE A;  5CV4 A;  2UU9 Q;  5E4X A;  1IYU A;  1H9M A;  3HS0 C;  1IBM L;  4RHR A;  5M5W B;  1HUM A;  1YVC A;  3HFZ B;  2I46 A;  1WCM G;  4K6L A;  1W2B A;  3VYU A;  1SYG A;  1KD1 C;  3EBE A;  5IGC A;  5EKI A;  2FHT A;  5M3M G;  4ZLT F;  3QB3 A;  5C5M A;  5EBD A;  1XTC D;  2K04 A;  1BQQ T;  3C2P A;  2EJM A;  2FMC A;  2CKZ B;  2DN8 A;  3EIV A;  1T5X D;  1F2M A;  3I4O A;  3F1Z A;  3F2C A;  3PUW A;  4L5T A;  3A0J A;  1AP0 A;  4A3F B;  2XNA C;  3V2T A;  2GVA A;  2EZV A;  1F9S A;  1AZP A;  1HTL D;  4NP5 A;  2EYO A;  4IUR A;  3S24 A;  4ODG A;  1S5C D;  1SRO A;  3K0Y A;  4JV5 Q;  3M4Y A;  4Q0F A;  5ELB A;  1Y8O B;  3FVQ A;  1NMG A;  1FR3 A;  1X3G A;  5CC4 A;  2UXB L;  1NR2 A;  2Q8T A;  1PZI D;  1GM5 A;  3J7A V;  4JBK A;  1KIX A;  4X3K A;  1VMC A;  1L1O B;  3UE1 A;  1M4V A;  3K7A H;  1LTA D;  4CHT B;  5GAG C;  2DUD A;  4KHZ A;  2VY3 A;  2F0O A;  3F8T A;  3I4M H;  3S1N H;  3S16 B;  2B2W C;  1E22 A;  3MEF A;  1D5Z C;  1PRT F;  5EKL A;  4WRD A;  2KHS A;  1LV9 A;  1DM0 B;  1SYE A;  2ZTE A;  1D8L A;  4OIK A;  1HJP A;  1DYQ A;  3NQI A;  2EYM A;  4G4K A;  2QIL A;  1STN A;  1RKN A;  1N32 Q;  1Q86 C;  3E0E A;  2NB0 A;  1HUN A;  5J22 A;  5I4D A;  1AE3 A;  2Z8L A;  4X66 Q;  2HUG A;  3PUX A;  4A3I H;  3HOU H;  3NK9 A;  4B3M L;  1JMC A;  2PQA B;  4JI8 Q;  2B2V C;  4IUQ A;  4DU9 A;  3RD4 A;  2EJF C;  2VS1 A;  1GVP A;  5ELE A;  1B50 A;  3PV0 A;  4CKC A;  4ZUI A;  4LUZ A;  1V8Q A;  2RA4 A;  3OIQ A;  1DOK A;  1O7L A;  3F2D A;  3M85 A;  4QL5 A;  1SE2 A;  1LTR D;  3NTK A;  1ILQ A;  1TWF B;  1GXD C;  2EYJ A;  5E1F A;  1UE1 A;  2LXJ A;  4DAM A;  4IFD J;  2F0N A;  3L2P A;  4BY1 B;  1GHJ A;  4JI5 L;  1VQ7 A;  1YNN D;  5EPJ A;  5F2D A;  3T1Y Q;  3IFT A;  2BA0 A;  3K7U C;  1HR0 W;  2K05 A;  2NZH A;  3K59 A;  5KNC A;  1HR0 Q;  4KTA A;  3G4S A;  4RHS A;  1OXS C;  1SXT A;  2PI2 A;  1TS4 A;  2PMZ E;  2ZJP A;  1O78 A;  1L0W A;  4L5R C;  1Z6H A;  3SHL A;  3K5N A;  4JI6 L;  3S2H H;  2JA7 B;  1QVC A;  1STG A;  5C0X G;  3KLW A;  3KF6 B;  5M3F G;  3WOE A;  2KED A;  3CCE A;  4X6A H;  2FXQ A;  3GTP B;  4K0K L;  2KQ3 A;  3IRB A;  4OX9 Q;  2F03 A;  4GOP B;  4APV A;  5BR8 L;  5FLX L;  2UXC L;  4BBS B;  5C4X B;  1PRT C;  5M5Y B;  1QB5 D;  1ESR A;  2BH8 A;  2F0Q A;  2WP8 J;  1JOR A;  4R4I A;  1EYG A;  1PFM A;  3J80 E;  3IL8 A;  5E3F A;  2F52 A;  1HNW Q;  4IOA A;  2OEO A;  4JOI A;  2I0Q A;  4DF7 A;  3PO2 H;  3J81 L;  1HQM C;  2CW0 C;  4HMI A;  1E24 A;  2NVQ H;  2PYK A;  3OMG A;  2ICI A;  1GJX A;  5DM7 3;  4A3L H;  4LF5 Q;  4S3S A;  1VQF A;  3DWA A;  1Q1B A;  3S2D B;  4A3M H;  2XWJ B;  4PG3 A;  4CDD C;  4H44 C;  4POF A;  4F87 A;  3E9I A;  4HCS A;  4KLK A;  4KY5 A;  5I6Y A;  3MA2 B;  1RIP A;  1JE5 A;  2XVS A;  1F9Q A;  4KD4 A;  1TII D;  1EY7 A;  1FJG Q;  1STE A;  4HR7 B;  1ENC A;  3DEP A;  1VQC A;  4JI7 L;  4B9W A;  5J1Z A;  4QGU A;  3HKZ B;  1F77 A;  1KNE A;  5IT9 c;  2IY5 B;  5IGF A;  4CGY B;  3MXU A;  4DUZ Q;  4DV4 L;  1JB7 A;  5CV7 A;  2F0I A;  2NTT A;  3SK4 A;  2JA7 G;  1ET9 A;  3C1F A;  2R92 H;  1YZ6 A;  1Y1W H;  2PW5 A;  3I8Z A;  4KJN A;  3P1H A;  5C0X I;  1ASY A;  2JA8 G;  3S17 B;  1S72 A;  1FL0 A;  5C44 H;  1WI5 A;  1SDF A;  1PTO D;  4Y7N H;  2L15 A;  2Q2H A;  3TQY A;  2AMC B;  4OXP A;  2MQH A;  3H0G H;  3G6J B;  1EFI D;  1JIC A;  1QWY A;  3I72 A;  4BBS G;  1B2T A;  1JT8 A;  4BY7 G;  2K4K A;  4X3T A;  2Z6B A;  1L1O C;  1HA6 A;  3GTO B;  2D5D A;  4HSP A;  4JVZ A;  3KJO A;  5IYD G;  4B9X A;  4A3B B;  1A2T A;  1EY5 A;  3ND9 A;  1D7Q A;  2QGQ A;  1IYJ B;  2MJ8 A;  1VQN A;  1GUG A;  3DM1 A;  1XNQ L;  3M4O H;  3S1Q H;  2JA6 B;  2DNC A;  2KEN A;  1ESF A;  1SNQ A;  4DK3 C;  5HY6 A;  1AFP A;  3GTG B;  4HSV A;  3HOY B;  2PNR C;  3ZJY C;  4JV5 L;  4WJ3 M;  4ZYS A;  1Q8K A;  4JYA L;  5IE8 A;  4LK1 C;  1TWG H;  2B63 H;  2F4V L;  4RCN A;  3J7A F;  4UP9 A;  3R2T A;  4L5Q A;  2RSO A;  2ZM6 Q;  2PCF B;  1G51 A;  1SNO A;  1KDC A;  4IPG A;  4KK7 A;  5KND A;  1I50 B;  4HIO A;  5FJ8 G;  1IZ6 A;  4NDX A;  4LF7 Q;  2PQA A;  1K3R A;  3GD7 A;  3HKZ G;  1HFG A;  4OWX B;  1MD2 D;  3FPU B;  2EQS A;  1J8I A;  3UE0 A;  2JEA I;  1N32 L;  2VUM B;  2QF7 A;  4HIK A;  1I6V C;  4B3S Q;  3TS2 A;  4X62 Q;  4X66 L;  3OWE B;  4JI8 L;  5C5L A;  5KGU A;  3RLF A;  4DXF A;  2BCO A;  5G3L F;  4C3I H;  3D6W A;  2HCI A;  4A3E G;  3L9A X;  2K75 A;  4JI1 Q;  3NWT A;  5CR3 A;  3BZC A;  1JC7 A;  4X3U A;  3CCV A;  2P5Z X;  2WKD A;  3PF4 A;  4GLV B;  1ET6 A;  1I94 Q;  1PFB A;  1F2Y A;  3CQZ B;  3KF6 A;  3JAM E;  1I3Q H;  3T1Y L;  1CZG A;  4RAU C;  1BBU A;  4K6D A;  1HR0 L;  4A3B G;  4K8J A;  1G8Z D;  2OXP A;  4HID A;  4AYB G;  4QIW E;  2XRS D;  4BS9 A;  2A8V A;  1KDA A;  2JA6 G;  4JI3 L;  1JQY D;  1L2F A;  1B9M A;  2K5Q A;  3S1M H;  2JEB I;  4GOP A;  3S1R H;  3HOY G;  3CF5 A;  3ONA B;  3CU7 A;  1SR3 A;  2K7V A;  1HXY D;  4XYO A;  4C3H B;  1QNU A;  2OCE A;  3PO3 G;  4G7O C;  3PUV A;  4EVO A;  2NVY B;  4DV5 Q;  1W3S A;  3HOZ B;  2BE5 D;  1QIL A;  2RVL A;  2MHV A;  2SNM A;  3HOV H;  3ERQ A;  4LFC Q;  2VQF Q;  1H9S B;  1Y8N B;  2NWG A;  4OX9 L;  1UAP A;  2YU9 H;  3W1G A;  3TEH B;  1DD2 A;  1WOC A;  5COY A;  2F0T A;  1TU2 B;  1PZK D;  1SNC A;  4ULL A;  1C0A A;  1KXL A;  1YJN A;  4CJ1 B;  4A3K B;  2K01 A;  1Q3L A;  3T13 A;  1LLR D;  4EQO A;  2OQK A;  1VQP A;  2VUM G;  3RZO B;  3NBH B;  2B39 A;  1S5E D;  1HNW L;  2MGS A;  1JOQ A;  1ZYR D;  4JBM A;  2AWN A;  2HQE A;  4H0L C;  1CA6 A;  2A73 B;  1GUW A;  2MUY A;  2Z6K C;  4DV2 Q;  1PYS B;  3EQL C;  4UP8 A;  1WJJ A;  3W1B A;  4IUU A;  1HTP A;  3HRZ C;  3TN2 A;  4LF5 L;  2UXB Q;  1EUJ A;  4A3D H;  4HIM A;  4NXM L;  1ROD A;  1QE6 A;  3E9H A;  4F7X A;  4MTN A;  3A5U A;  4DR2 Q;  2QCP X;  1HPC A;  1D2B A;  3L3O C;  5EPK A;  3CCU A;  2RKS A;  1KRT A;  4CJ0 B;  3CC2 A;  2Y0S E;  4C2M H;  1FJG L;  2HQL A;  1RTN A;  3E0J A;  3GTK B;  4A3G B;  4PNY A;  2ZTC A;  2VW9 A;  1JJC B;  5COR A;  1LTI D;  5D65 A;  1PYW D;  3KF8 B;  3HOX B;  3X3N A;  1WTQ A;  3GV3 A;  4R4O A;  1AE2 A;  5M5X H;  4GLA C;  4KHV A;  4DUZ L;  3HOW G;  1EEF D;  1X9N A;  1S5F D;  2E2J B;  1SJH D;  5FK9 C;  4PZ7 A;  5IP7 G;  5AJ3 L;  4PV1 C;  5IGE A;  2DNE A;  2AWO A;  5JVH 3;  1V1Q A;  2F0J A;  2IW3 A;  1B4O A;  3DHQ A;  2JXM B;  1C4Q A;  3O13 A;  2EY6 A;  2K6A A;  3J80 L;  4GNX A;  1JWU D;  1U5K A;  2D62 A;  4FF3 A;  1MI2 A;  2JA5 B;  2EY2 A;  2K1B A;  2UUA Q;  5CBE E;  3KLS X;  2IX3 A;  1TVX A;  2AQ1 B;  5DEH A;  4MHE A;  4A3K G;  3P20 A;  1UNS A;  1SE8 A;  1SFO B;  3EA6 A;  3QOL A;  3S9W A;  5C3X A;  2UUB Q;  3MXN A;  1YIT A;  2EVB A;  1LTT D;  2NZ1 D;  5ELD A;  3RR5 A;  4L6T B;  1YEZ A;  2KHI A;  1DOM A;  1RDP D;  1I4H A;  2HIV A;  3ND8 A;  5L37 A;  4U68 A;  1Y8P B;  2X6G A;  3QR8 A;  5EQ0 A;  3W5O A;  1JR0 D;  3OPO A;  2CWA A;  3CP0 A;  1A3T A;  1F2Z A;  1HNZ L;  5JJL A;  3AQQ A;  4ZKB B;  1WTW A;  4KJO A;  2B2U A;  4K2L A;  2OT2 A;  2CH4 A;  1BBX C;  1KTK A;  1WFQ A;  1E2Z A;  4BXX G;  2B2T C;  1X55 A;  2ZM6 L;  1CSQ A;  3I4N B;  1TWH H;  3ERO A;  3WWV A;  1SYF A;  5CV8 A;  1VQK A;  3NHH A;  4A3G G;  1CKN A;  1PFN A;  1R9T B;  4LF7 L;  1F9P A;  1TT2 A;  3ER0 A;  4ABN A;  5C3E B;  4GLX A;  1EYA A;  3M4Q A;  4XQJ A;  2N8N A;  1E1T A;  2KHJ A;  3UDX A;  4JPB W;  1S40 A;  5DLQ E;  1WCM H;  3D4W A;  2N78 A;  3H3V I;  2ATW A;  5IOC A;  5E4W C;  3W3A A;  5M3M H;  4B3S L;  4IO9 A;  4LFA L;  1HZC A;  2A6H D;  3NTI A;  5EKK A;  4X62 L;  1EIG A;  3EVQ A;  5ISR A;  1K8G A;  1JWM D;  2A69 D;  1K3B C;  3K5L A;  1EEI D;  2XN9 C;  5KRU A;  5CBA E;  2JP1 A;  4BBR B;  1UEA B;  1O7Z A;  1LYL A;  1PRT B;  1YBY A;  2BDN A;  4QB4 A;  4YHH Q;  1O7Y A;  1CQF A;  1IW7 C;  5KYL A;  2E76 C;  1CSP A;  4JI7 Q;  2N55 A;  3F2U A;  4ZCK A;  1AH9 A;  4N8X 1;  4JI1 L;  1ENF A;  1YNJ D;  2KOL A;  2MFI A;  1N36 Q;  4KY7 A;  1BXT A;  3AFQ A;  2IL8 A;  3A74 A;  3J81 i;  2R93 B;  2DGY A;  1VQE A;  3H91 A;  1I94 L;  2A19 A;  3L0O A;  3CPF A;  2HD3 A;  3KDF B;  4I65 A;  1H9S A;  2F0G A;  4DR4 Q;  3GTL H;  1VQ6 A;  4DR6 Q;  3KLS A;  2EYP A;  4OEM B;  1K73 C;  2VB2 X;  2NVT B;  1JB3 A;  2HDL A;  1QZG A;  5KEE A;  2EXZ A;  4PMC A;  4RCO A;  2K5W A;  4IJL A;  4DV5 L;  2LY7 A;  3MVV A;  3NBH A;  4LFC L;  1PH2 A;  2VQF L;  5EGT A;  5FLM G;  3SK6 A;  5D3D A;  3J7Y W;  3WOF A;  2A68 C;  4FXD A;  5LMU Q;  5C3E G;  2ZXP A;  1K28 A;  3TSS A;  4NPS A;  1XNQ Q;  1MJC A;  1PH9 A;  3NTH A;  4OEL B;  5IOD A;  2OTL A;  3MTS A;  3I55 A;  1K83 H;  1PH5 A;  4ZQ3 A;  5J39 A;  3OW7 A;  4K2K A;  5IGB A;  3S15 H;  4JYA Q;  1EIH A;  3K7A B;  3PCO B;  1XPR A;  3D6C A;  2F4V Q;  4DV2 L;  5C4J B;  2ASB A;  3S1N B;  4BBR G;  3MWY W;  5CMD A;  1QNK A;  1EY8 A;  2NVX B;  1SSO A;  4J6H A;  3KF8 A;  2F0P A;  4DFA A;  4ZKC B;  2E2H B;  3FPP A;  4IUV A;  4F88 A;  4YY3 Q;  1YIJ A;  4DR2 L;  3JAM L;  5A2Q E;  3E3X A;  1ICW A;  3TDQ A;  1D5X C;  4GZY C;  2ID0 A;  3E5S A;  2DY8 A;  4A3I B;  1N33 L;  4NKL A;  2WB1 E;  2R93 G;  3KJP A;  3AB9 A;  3HOU B;  2B2W A;  1BDO A;  1L0Y B;  1QCB D;  4P2C B;  4RKB A;  3BYT B;  5C0X H;  3CCL A;  3M7G A;  2BA1 A;  1ML0 D;  1Z9F A;  1EQQ A;  5M3F H;  2QW7 A;  3UDF A;  2J7Z A;  4TVA B;  1GUO A;  2PMZ B;  2YTX A;  1TWC H;  4DPG A;  2QEJ C;  4ZAI A;  2DY7 A;  4C56 C;  1BO0 A;  2ZJR A;  5K36 H;  5JJK A;  2B2V A;  2DJF C;  4A3J H;  2NUC A;  1XXG A;  5JPM C;  4QCL A;  1OO9 B;  1HQR D;  2KCM A;  3DLL A;  3TP6 A;  1N9W A;  2MP1 A;  3HEJ A;  2F0F A;  1ILP A;  4OO1 H;  2H5X A;  2UUA L;  1WD1 A;  2F0L A;  4A3F G;  2D0P A;  2EDG A;  1FYC A;  3S2H B;  2K5D A;  3H94 A;  4GKJ Q;  5JPN C;  4JI3 Q;  4DAY B;  4R4C A;  1JOK A;  1EQV A;  2AUK A;  2F0M A;  2FMM A;  5JEA G;  1T5E A;  4N9T A;  1G6P A;  4X65 Q;  5E7N A;  2UUB L;  1EY6 A;  2YV5 A;  3MZ5 A;  1I4X A;  5FLX c;  1BCP D;  1UEB A;  3BU2 A;  4ME5 A;  1DJR D;  2PZT A;  3GTQ H;  3D4D A;  4OHJ A;  2K33 A;  3BG3 A;  2BH2 A;  2R7F A;  4CDC C;  2VQE Q;  1C48 A;  2WAQ E;  2ZXR A;  1NE3 A;  3C46 A;  3D8G A;  4FDB A;  1LUZ A;  1A0I A;  2F0D A;  1U9R A;  1E1O A;  3U9S A;  3J81 c;  4DR1 L;  3CC7 A;  1MBY A;  1TWA H;  4NMZ A;  3PO2 B;  2PW7 A;  3TP5 A;  1CFM A;  1HCZ A;  4A3I G;  4FP5 D;  4DV6 L;  2NVQ B;  3CAM A;  2JA7 H;  4J15 A;  2WV6 D;  4N9P A;  2F0S A;  4P73 A;  4A3M B;  1HZ9 A;  2FFK B;  5LMN W;  3GTM B;  4LFB Q;  2JA8 H;  5LMN Q;  1M8A A;  1MGS A;  2KA7 A;  4OIJ A;  1LO5 D;  2L0C A;  3D31 A;  4JCV E;  4DR7 Q;  4IUT A;  3PF5 A;  1EOV A;  1SE3 A;  5AFW A;  4NXM Q;  3NUC A;  4FNF A;  2YTV A;  3CCQ A;  1NNX A;  4BA1 I;  1SJE D;  2D0O A;  4BBS H;  3I73 A;  2EE1 A;  4BY7 H;  4YHH L;  1C7Y A;  1J6Q A;  3KDF A;  4AQY Q;  3J7A 5;  4A93 B;  1P8L A;  4IZ8 A;  4BY1 G;  4DK1 A;  1K9M C;  3DUZ A;  3MFY A;  1H9K A;  3MFG A;  3MEH A;  2MNA A;  3RUZ A;  3K5M A;  4MTK A;  1EU4 A;  1N36 L;  2R92 B;  1QUQ B;  2YTY A;  1Y1W B;  4RGT A;  4EQN A;  2QA4 A;  3OSO A;  1GOZ A;  1W6K A;  2VB3 X;  5C44 B;  2EYF A;  2CVR A;  4QF4 A;  1HRJ A;  4Y7N B;  1NTG A;  4FF1 A;  1NMF A;  2F0U A;  5AJ3 Q;  4DR4 L;  4IN3 A;  3U4Z A;  1SNM A;  3H0G B;  5BN4 A;  1DCZ A;  4DR6 L;  2KUM A;  2HCC A;  3CD6 A;  3DEO A;  5FJ8 H;  1BUV T;  1LT3 D;  1N34 Q;  1QG7 A;  1UE5 A;  1E7Z A;  1GD7 A;  2LSS A;  1CZW A;  3I70 A;  2B29 A;  2NZO A;  5IP9 G;  1SEB D;  2A6E C;  2IJ0 A;  1XMQ Q;  3OOC A;  5C4X G;  3K6O A;  3PO2 G;  2G5D A;  1YNX A;  1CT1 D;  2KCN A;  1K0R A;  3ERS X;  3STB D;  3VA5 A;  3S1Q B;  3M4O B;  4ID6 A;  3D0F A;  3MXP A;  1TKW B;  2L12 A;  5JAV A;  5LMU L;  3AYH B;  4A3M G;  1CI3 M;  3FEW X;  1L1O A;  2B2Y C;  3VYR A;  5T1I A;  3BDC A;  1HNX Q;  1TWG B;  2C9O A;  1M1K C;  4RGO S;  2NYZ D;  2B63 B;  3ICE A;  5GAH C;  3HKZ E;  1HNZ Q;  1C9O A;  3S14 H;  1BKB A;  5J3B A;  4XDX A;  1EWC A;  3RN2 A;  4A3E H;  1EY9 A;  3J80 i;  3NEL A;  4DR5 Q;  3K8A A;  1VQA A;  3AU7 A;  1G2S A;  1GO3 E;  5DNF A;  3CPW A;  5C4H A;  4L8J A;  1XYI A;  4A93 G;  1VQH A;  2JYO A;  2M00 A;  4A4I A;  1VQ5 A;  1LT5 D;  1V1P B;  4A3B H;  4YY3 L;  1X3P A;  4KD3 A;  4TKO B;  1IL2 A;  4FYD A;  4L5S A;  4DV3 Q;  2JA6 H;  3OW2 A;  1CK1 A;  1A62 A;  4J8Q A;  1Y1W G;  2AKW B;  4XYQ A;  3HOY H;  4LFA Q;  3T16 A;  3PO3 H;  4QIW B;  3H6M A;  2E2I B;  1GUT A;  4PQX A;  2RBM A;  4DV7 Q;  1SMY C;  2VNU D;  1SLJ A;  1U4M A;  4JC0 A;  1TS3 A;  2L1B A;  3P75 A;  3H0G G;  1VQ9 A;  1FGB D;  4AYB E;  3DWQ A;  3SEB A;  4LF4 Q;  1A6X A;  2SEB D;  1PV4 A;  1I3Q B;  3A55 A;  4BWG B;  2VUM H;  1G29 1;  1J9O A;  4RFB A;  1LTL A;  3JC6 6;  3CCJ A;  1BF4 A;  2E74 C;  2O5I C;  1IHZ A;  2OF1 A;  3S1M B;  3GO5 A;  4MIU A;  3S1R B;  2LS0 1;  4CDE C;  1TS2 A;  3TP8 A;  1MIU A;  4OON A;  4GKJ L;  1QVG A;  1PHJ A;  3NWS A;  1PRT D;  3I3C A;  5D14 A;  3FKI H;  1B3Q A;  1WTH A;  3KYH C;  1AEX A;  2F0E A;  2JA9 A;  1B1Z A;  2A6H C;  4X65 L;  4JI2 L;  1VQI A;  5BN3 A;  1SMX A;  3TS0 A;  5A2Q L;  4KV6 A;  2A69 C;  1Y1V H;  3M7N A;  1Q90 A;  4GKK Q;  1VDZ A;  2CW0 D;  1B8A A;  3RLO A;  1PVO A;  2ENB A;  1VQO A;  4LUV A;  2G9D A;  3FRP B;  4CKE A;  4DGZ A;  5C0X J;  2VQE L;  2IX1 A;  2MO0 A;  5IGG A;  1V1O A;  1V9P A;  2V4D A;  3SDZ A;  4WJ4 A;  4GN4 B;  3HOW H;  2Z0S A;  1E2W A;  1MJE A;  1CQV A;  5ELO A;  1M90 C;  2KCC A;  2R6G A;  4NW2 A;  1EWH A;  3FMC A;  1DON A;  1STB A;  1YHQ A;  4LF9 Q;  1D1I A;  2VL6 A;  4DNI A;  2RDG A;  5IP7 H;  2CCZ A;  3K57 A;  4LFB L;  2NVY H;  4A3D B;  3R2I A;  3K80 C;  5LMN L;  1NBW A;  2E75 C;  5IGD A;  1WVL A;  4G7Z C;  1B70 B;  1RF2 D;  1AN8 A;  3VYS A;  4DR7 L;  4HAE A;  4C2M B;  3VA7 A;  2Z6K A;  1QUQ A;  1R4Q B;  1TY0 A;  5IIF A;  3EN2 A;  3OTO L;  1EZ8 A;  4PZ8 A;  3NSW A;  4A3K H;  2L5T A;  4BA2 I;  2XTI A;  5ELN A;  2K03 A;  4AQY L;  1D5M C;  1K8M A;  1N33 Q;  2JN4 A;  4JW0 A;  3RZO H;  4NXN Q;  5CV6 A;  3M3Y H;  3RNU A;  5M5X B;  5DM6 3;  1JJG A;  1EYD A;  1QVF A;  1WTV A;  4DNT B;  1OXX K;  2CH4 W;  4XT1 B;  3KBG A;  1XJV A;  3T4A C;  4GN3 B;  1RHP A;  4P71 A;  1UUP A;  4QUF A;  1EU3 A;  2VZA A;  2Q2T A;  3I91 A;  1STA A;  4C3H G;  4FF2 A;  1KLG D;  3KOJ A;  3RZD H;  4P75 A;  4BXX H;  2RDH A;  1Z7T A;  2I5L X;  3CCR A;  3JAM i;  1PTO H;  1OTC A;  3HOZ G;  4MNO A;  2F3V A;  3BDO A;  4HN7 A;  2PZU A;  1N34 L;  1F2L A;  4IFD G;  4DXG A;  4OL7 A;  3Q23 A;  1YJW A;  4KY6 A;  3D4R A;  5KIX A;  1XMQ L;  1PLF A;  2X6L A;  3M9B A;  1EFW A;  3DMU A;  3T53 B;  1PXU A;  2E2D C;  2R7Z B;  2E2J H;  3FP9 A;  2N3S A;  4UAI A;  5KYI A;  1VF5 C;  5I2X A;  3RN5 A;  5IWA Q;  1KAA A;  4A3D G;  3RMH A;  2G9H D;  3PIP 3;  4RH6 A;  1HZB A;  1V1P A;  2Q8R E;  4DK0 A;  1X3E A;  2OQ0 A;  3NP8 A;  1HNX L;  1MSH A;  2QDB A;  2SNS A;  1XWE A;  3CCM A;  1TWH B;  3Q22 A;  1LT6 D;  1X56 A;  4A3C G;  4HJ7 A;  4DR5 L;  4DR1 Q;  3LWU A;  3UDI A;  4DV6 Q;  1SFO H;  1F9R A;  4U67 3;  1YNN C;  2KVM A;  4ZUJ A;  2LMC B;  1CTM A;  2EPB A;  2B2T A;  1D1K A;  1H9J A;  5M3M B;  4B3T Q;  4DV3 L;  4ME3 A;  4R4T A;  2R61 A;  3HOX G;  1NR4 A;  5IT9 E;  1S4Z A;  2NN6 G;  4H02 A;  2O4X A;  5KNB A;  3SVM A;  3TRZ A;  4LJZ C;  4CDF C;  3NEN A;  1K8O A;  3GTJ H;  1MSG A;  3EJI A;  1WTP A;  1D6E C;  4B08 A;  4DV7 L;  1A8V A;  5H1S E;  4EX5 A;  5HGQ A;  1BOS A;  4I7A A;  3ULP A;  3J81 j;  1YI2 A;  1EL0 A;  2JK8 A;  1EY4 A;  2WII B;  1KC8 C;  5FLM H;  2TMP A;  3A5Z B;  1XNR Q;  4RGN A;  4C3J B;  4LF4 L;  1EYC A;  1Q81 C;  4DAV A;  2JA5 G;  1E2V A;  3IAY A;  4HED A;  3OHX C;  4IFD I;  3DWP A;  2Z4I A;  1VQM A;  3LX0 A;  3VR2 A;  2PI2 E;  1UE7 A;  4FXK C;  5ELC A;  4H7B A;  2UXD Q;  3NBI A;  3V96 A;  2F0H A;  2WKC A;  4OWW B;  2D2C C;  4DA2 A;  3GTL B;  2XRQ D;  4LAA A;  2R7Z G;  1I6H H;  4WOR A;  1KAB A;  4LF8 L;  2ZT9 C;  1S3O A;  3BS1 A;  5JJZ A;  2CQO A;  2KJX A;  3OWF A;  3T51 B;  5CV5 A;  2HHH Q;  1WYD A;  2AHO B;  4IPD A;  1IKL A;  5I2Y A;  2XWB B;  4IPC A;  3ULL A;  1FNV A;  2SOB A;  4GKK L;  3A8I E;  1GUS A;  2B8F A;  4RGM A;  2R93 H;  4JI0 Q;  2M9V A;  4PMW A;  2JQO A;  1PH1 A;  1BBW A;  4X3S A;  2N88 A;  3I4N G;  4JI4 Q;  4UP7 A;  5IYB G;  2QEX A;  5HGT A;  1K0S A;  3BVG A;  4KMU C;  1K83 B;  2JE6 I;  5FOB B;  1PFS A;  2WB1 B;  5G3L D;  2NTS A;  5M5W H;  3QWN A;  1O80 A;  4FXG C;  5IYC G;  3S15 B;  4O0A A;  3BVM A;  4K5W A;  1SNP A;  2BDO A;  1VF7 A;  1NJI C;  2JJQ A;  5C4Z A;  2NVT H;  2NN6 I;  4LF9 L;  2A5H A;  1YHB A;  2GVB A;  4XT3 B;  3JAM c;  3U4V A;  1X54 A;  4RWS C;  1B7Y B;  4FVM A;  1CA5 A;  2C5C A;  2QKI C;  1YJ9 A;  3I4M B;  2L9H A;  2PZW A;  1IL8 A;  1LAC A;  3A7L A;  1B53 A;  3E6Z X;  2EJG C;  1ICF B;  1PTO C;  1RJT A;  1A3V A;  1O7I A;  2K32 A;  5EAY A;  4C3J G;  4A3F H;  5EBC A;  3K0X A;  3KK7 A;  4FO2 A;  1LT4 D;  2YYZ A;  3CRK C;  5M3F B;  1EIF A;  5FO9 B;  1SBB B;  3I4L A;  4RG1 A;  1NY4 A;  4NXN L;  3STB C;  5JEA H;  3PIP A;  2F3W A;  2H4O A;  1TWC B;  4CKB A;  4X64 Q;  3LGJ A;  1TXY A;  5C4J H;  4DV0 Q;  4DR3 Q;  1X32 A;  2CWP A;  3P7J A;  1LTS D;  3N6R A;  3PUZ A;  2NVX H;  1PMR A;  1P16 A;  2E2H H;  3K81 C;  4A3J B;  1Z47 A;  3WDN A;  3FDT A;  3T56 B;  1NSN S;  1UE6 A;  2TSS A;  5C3W A;  4UY8 C;  3S16 H;  3HZX A;  3SK5 A;  2N49 A;  4K5V A;  3PIO 3;  3U50 C;  5BN5 A;  5JVG 3;  1U4R A;  5GRO A;  3IFD A;  2IT1 A;  3A8K E;  4G7H C;  3FHW A;  1RL2 A;  1CHQ D;  1PH3 A;  4RMF A;  2ICE C;  2WAQ B;  2L11 A;  5ELF A;  3TBI B;  1EQT A;  3IKJ A;  3CXC A;  1WTX A;  1FNW A;  4CJ2 C;  2I07 B;  2RQX A;  2WB1 G;  4ILW A;  1GUN A;  2ES2 A;  3NXW A;  1TR5 A;  1G6Z A;  5A35 A;  2K50 A;  1PH7 A;  2XSC A;  1WD0 A;  1ZEQ X;  5I9P A;  4FF4 A;  4JI2 Q;  5LL6 X;  1BR9 A;  2ALY B;  1II3 A;  3GTQ B;  1TWF H;  4M1U B;  5IWA L;  4F8M A;  2AQ3 B;  3I4M G;  2Z9H A;  4JK1 C;  1ZKO A;  3Q0A A;  1RTO A;  4BY1 H;  4IJH A;  1XPO A;  4IUN A;  3U9O A;  1TWA B;  3G71 A;  1Q7Y C;  1Q12 A;  1OXT A;  3TZU A;  5LHY 1;  2MO1 A;  1FVI A;  1PH6 A;  5FKA C;  1H9R A;  4YCU A;  4XTC S;  3KFU A;  1AW7 A;  4B3R Q;  2RHS B;  2JA8 B;  2Z4H A;  1XTD A;  3HOU G;  3I56 A;  4IOC A;  1LM0 A;  3A54 A;  3GDE A;  3VDY A;  4MN3 A;  3R8B A;  1DOL A;  1IW7 D;  4QY7 A;  4Y52 H;  4XIG S;  4JBJ A;  4B3T L;  1KHI A;  4K14 A;  5K36 G;  3CW2 C;  3QIA A;  2K52 A;  3GTP H;  1IYV A;  3HKS A;  1Q46 A;  2GA4 B;  4JOI C;  3CRL C;  3NE5 B;  4DV1 Q;  1WTO A;  4BY7 B;  4A3J G;  4DNR B;  1HHV A;  4UHV A;  5IP9 H;  3BZK A;  2C35 B;  2IHF A;  2K28 A;  3NPP A;  5C4X H;  1B44 D;  5M5Y H;  4YCV A;  3CMA A;  3OTO Q;  1N8R C;  2BE5 C;  1VQL A;  1MHW C;  4OO1 G;  2SDF A;  3LWE A;  3VR3 A;  3A56 A;  1IBL Q;  2O2L D;  2WAQ G;  5IYD H;  2UUC Q;  2EOT A;  1XNR L;  3J7Z C;  4R8I A;  3K58 A;  1XMO Q;  4AH6 A;  3GTM H;  1I4G A;  3U58 A;  2F3I A;  3UDG A;  2HT1 A;  3R3O A;  1HH2 P;  5TSS A;  3C1E A;  1PA6 A;  1CKM A;  2UXD L;  3S2D H;  4KN7 C;  5EPL A;  2VXW A;  4HJ9 A;  4PMB A;  4EQP A;  1ZYR C;  4QUC A;  3TME A;  2NBF A;  1I5F A;  4E6I A;  3ZYY X;  2A68 D;  2RHQ B;  3QO2 A;  5CGK A;  4A93 H;  4DUY Q;  1J5E Q;  4YWK A;  1OXV A;  1SYD A;  3MHB A;  2HHH L;  4Q5V A;  4O2D A;  3DM3 A;  1E0B A;  1A2U A;  1SE4 A;  3KUP A;  4A76 A;  1CHP D;  4XQQ A;  2EXD A;  2V1C C; 
#chains in the Genus database with same CATH homology
 5IT9 L;  4WJW A;  4IQZ A;  1KLU D;  1LTG D;  4R8N A;  1W6J A;  3QJY A;  4H13 C;  1ONL A;  3VR4 A;  4L63 B;  3S14 B;  4A3E B;  1STY A;  1A15 A;  5C6A A;  4C1N K;  3AMU A;  3UI2 A;  1G2T A;  3A7A B;  2B2Y A;  1CM9 A;  3G7L A;  3X3M A;  1C8C A;  4C1N I;  1B9N A;  2R3Z A;  3BYY B;  1ZXT A;  4AYB B;  2A74 C;  1QOH A;  1VMP A;  2EY1 A;  2F4I A;  4OO1 I;  1NUC A;  3W2D A;  5T1G A;  3OIP A;  3KBX A;  3PO3 B;  4OGQ C;  1HFN A;  2RDF A;  1SYC A;  4G57 A;  2D9U A;  1Q1E A;  2MPM A;  2EY5 A;  4C3I B;  3GV6 A;  4DAY A;  3MC0 B;  4YIJ A;  2IWH A;  1JOO A;  4KKT A;  4QMG A;  4JBW A;  3R93 A;  3HG9 A;  5D3I B;  4KKU A;  3OMC A;  3FKI B;  1RCV D;  1PZJ D;  4IUP A;  4HTH A;  4KN4 C;  4LMQ D;  4TRD A;  1BCP B;  1U4L A;  3V05 A;  1Y1V B;  1TQO A;  5I9O A;  2F0K A;  3HOV B;  4EGV A;  2KEE A;  2RSN A;  2YU9 B;  1S5D D;  3ITP A;  3BZD B;  1X3Q A;  2IX0 A;  3I90 A;  3SE0 A;  4RKL A;  2CQA A;  3TP7 A;  2AUJ D;  3C3L A;  1GHK A;  5JEA J;  2LFN A;  3HOW B;  1STH A;  1I4Q A;  2CHB D;  1JE4 A;  4TSS A;  1B3A A;  2Y0S B;  3PMF A;  1BNZ A;  1YNJ C;  1KNA A;  3LNN A;  4TQU S;  3H09 A;  2O5J C;  4CBV A;  2AQ2 B;  4ZRZ A;  2X69 A;  4C3I G;  2WAC A;  3SXH A;  4ZK9 B;  4IFD H;  2BOS A;  2XIW A;  2M2L A;  5LL6 S;  1LAB A;  3M3Y B;  1TY2 A;  2F0V A;  2KEC A;  4WFN 3;  1G91 A;  1SND A;  1FD7 D;  1RD9 D;  1JWS D;  1PDQ A;  3DXJ C;  3CKI B;  4V19 0;  3URY A;  2J4X A;  1EY0 A;  2Z1C A;  2WIN B;  3MXG A;  2A6E D;  3RZD B;  3CHB D;  1U4P A;  1NAP A;  1PTO B;  1WTR A;  5JOB A;  4R9W A;  3MAQ A;  1BCP F;  5FLX E;  3QG1 A;  3Q24 A;  1Y69 U;  3QOJ A;  3EFX D;  4XQN A;  2LKV A;  3VR6 A;  4O1N A;  5CV9 A;  2JSO A;  1DZ1 A;  3J81 E;  4KI0 A;  1TS5 A;  2NN6 H;  2PPB C;  3BVZ A;  1EOT A;  1R4P B;  4K8I A;  4Z9C B;  4I7Z C;  2Q8I B;  3L7Z C;  2B8G A;  1JCK B;  4HCE A;  5CYU A;  3TZD A;  1HA5 A;  1VCI A;  2EYH A;  1SAP A;  2PQE A;  3BDL A;  1QJO A;  2J0T D;  3HP3 A;  2EYL A;  5FO8 B;  4DAP A;  4UDU C;  2IPK D;  1SMY D;  2B2U C;  2PO4 A;  3Q6S A;  5K5P A;  4M8A A;  1OXU A;  3GQB A;  1WCM B;  5HUR A;  1XX8 A;  4RA8 A;  1V43 A;  3GTJ B;  2L55 A;  3NQT A;  1KDB A;  1S5B D;  4V0B A;  3SR1 A;  1I4R A;  5DAU A;  2FJ2 A;  1NCV A;  2H1E A;  1I4P A;  5M9O A;  1BCP C;  3VYT A;  3N52 A;  1PTO F;  2ZXO A;  1ENA A;  5FO7 B;  4J1M A;  1LTB D;  1AZQ A;  1Q8I A;  3D3R A;  3SK8 A;  5I6W A;  2HDM A;  1I6H B;  1IKM A;  1L0X B;  3H3V C;  2L4N A;  1SYB A;  4IAL A;  4KKS A;  4O42 A;  3A8J E;  3K5O A;  4XXE A;  3PUY A;  5EJW A;  5NUC A;  3VR5 A;  1A3U A;  2F0W A;  3GP7 A;  4DN4 M;  4K5X A;  3HGB A;  2FIN B;  1DXM A;  2F1M A;  3KLR A;  1EZ6 A;  1FNU A;  4HMJ A;  5CV4 A;  5E4X A;  1IYU A;  1H9M A;  3HS0 C;  4RHR A;  5M5W B;  1HUM A;  2I46 A;  4K6L A;  3VYU A;  1SYG A;  5IGC A;  5EKI A;  2FHT A;  4ZLT F;  3QB3 A;  5C5M A;  5EBD A;  1XTC D;  2K04 A;  1BQQ T;  3C2P A;  2EJM A;  2FMC A;  2DN8 A;  1T5X D;  1F2M A;  3PUW A;  1AP0 A;  4A3F B;  2XNA C;  3V2T A;  2EZV A;  1F9S A;  1AZP A;  1HTL D;  4NP5 A;  2EYO A;  4IUR A;  4ODG A;  1S5C D;  3K0Y A;  3M4Y A;  4Q0F A;  5ELB A;  1Y8O B;  3FVQ A;  1FR3 A;  5CC4 A;  1NR2 A;  2Q8T A;  1PZI D;  3J7A V;  4X3K A;  1VMC A;  1M4V A;  1LTA D;  4CHT B;  4KHZ A;  2F0O A;  3S16 B;  2B2W C;  1D5Z C;  1PRT F;  5EKL A;  4WRD A;  2KHS A;  1LV9 A;  1DM0 B;  1SYE A;  4OIK A;  1DYQ A;  3NQI A;  2EYM A;  4G4K A;  2QIL A;  1STN A;  1RKN A;  2NB0 A;  1HUN A;  5J22 A;  5I4D A;  2Z8L A;  2HUG A;  3PUX A;  3NK9 A;  2B2V C;  4IUQ A;  4DU9 A;  3RD4 A;  2EJF C;  5ELE A;  1B50 A;  3PV0 A;  4CKC A;  4ZUI A;  1V8Q A;  2RA4 A;  3OIQ A;  1DOK A;  1O7L A;  3M85 A;  1SE2 A;  1LTR D;  3NTK A;  1ILQ A;  1TWF B;  1GXD C;  2EYJ A;  5E1F A;  4IFD J;  2F0N A;  4BY1 B;  1GHJ A;  1YNN D;  5EPJ A;  5F2D A;  3IFT A;  2BA0 A;  2K05 A;  3K59 A;  5KNC A;  4KTA A;  4RHS A;  1OXS C;  1SXT A;  1TS4 A;  1O78 A;  1Z6H A;  3SHL A;  3K5N A;  2JA7 B;  1STG A;  5C0X G;  3WOE A;  2KED A;  3GTP B;  2KQ3 A;  2F03 A;  5FLX L;  4BBS B;  5C4X B;  1PRT C;  5M5Y B;  1QB5 D;  1ESR A;  2F0Q A;  2WP8 J;  1JOR A;  1PFM A;  3J80 E;  3IL8 A;  5E3F A;  2OEO A;  4DF7 A;  3J81 L;  1HQM C;  2CW0 C;  4HMI A;  2PYK A;  3OMG A;  2ICI A;  1GJX A;  5DM7 3;  4S3S A;  3DWA A;  1Q1B A;  3S2D B;  2XWJ B;  4H44 C;  4F87 A;  4HCS A;  4KY5 A;  5I6Y A;  3MA2 B;  2XVS A;  1F9Q A;  4KD4 A;  1TII D;  1EY7 A;  1STE A;  4HR7 B;  1ENC A;  3DEP A;  4B9W A;  5J1Z A;  3HKZ B;  1F77 A;  1KNE A;  5IGF A;  4CGY B;  3MXU A;  5CV7 A;  2F0I A;  2NTT A;  3SK4 A;  1ET9 A;  3C1F A;  2PW5 A;  3I8Z A;  4KJN A;  3P1H A;  5C0X I;  3S17 B;  1SDF A;  1PTO D;  3G6J B;  1EFI D;  1JIC A;  1QWY A;  3I72 A;  1B2T A;  4X3T A;  1HA6 A;  3GTO B;  2D5D A;  4HSP A;  4B9X A;  4A3B B;  1A2T A;  1EY5 A;  3ND9 A;  2MJ8 A;  1GUG A;  3DM1 A;  2JA6 B;  2DNC A;  1ESF A;  1SNQ A;  1AFP A;  3GTG B;  4HSV A;  3HOY B;  2PNR C;  4ZYS A;  4LK1 C;  4RCN A;  3J7A F;  3R2T A;  2RSO A;  2PCF B;  1SNO A;  1KDC A;  4KK7 A;  5KND A;  1I50 B;  4NDX A;  3GD7 A;  1HFG A;  1MD2 D;  3FPU B;  1J8I A;  2JEA I;  2VUM B;  2QF7 A;  1I6V C;  3OWE B;  5C5L A;  5KGU A;  3RLF A;  4DXF A;  2BCO A;  5G3L F;  3D6W A;  2HCI A;  3L9A X;  3NWT A;  5CR3 A;  1JC7 A;  4X3U A;  2WKD A;  1ET6 A;  1PFB A;  1F2Y A;  3CQZ B;  3JAM E;  1CZG A;  4RAU C;  4K6D A;  4K8J A;  1G8Z D;  2OXP A;  2XRS D;  4BS9 A;  1KDA A;  1JQY D;  1B9M A;  2K5Q A;  2JEB I;  3ONA B;  3CU7 A;  2K7V A;  1HXY D;  4XYO A;  4C3H B;  1QNU A;  4G7O C;  3PUV A;  4EVO A;  2NVY B;  3HOZ B;  2BE5 D;  1QIL A;  2RVL A;  2MHV A;  2SNM A;  3ERQ A;  1H9S B;  1Y8N B;  2NWG A;  1UAP A;  1DD2 A;  5COY A;  2F0T A;  1TU2 B;  1PZK D;  1SNC A;  4ULL A;  4CJ1 B;  4A3K B;  2K01 A;  1Q3L A;  3T13 A;  1LLR D;  4EQO A;  3RZO B;  1JOQ A;  2B39 A;  1S5E D;  2MGS A;  1ZYR D;  2AWN A;  2HQE A;  4H0L C;  1CA6 A;  2A73 B;  1GUW A;  2MUY A;  3EQL C;  4IUU A;  1HTP A;  3HRZ C;  3TN2 A;  1ROD A;  1QE6 A;  4F7X A;  2QCP X;  1HPC A;  1D2B A;  3L3O C;  5EPK A;  2RKS A;  4CJ0 B;  1RTN A;  3E0J A;  3GTK B;  4A3G B;  4PNY A;  5COR A;  1LTI D;  5D65 A;  1PYW D;  3HOX B;  3X3N A;  1WTQ A;  3GV3 A;  4KHV A;  1EEF D;  1S5F D;  2E2J B;  1SJH D;  5FK9 C;  4PV1 C;  5IGE A;  2DNE A;  2AWO A;  5JVH 3;  2F0J A;  2IW3 A;  1B4O A;  3DHQ A;  2JXM B;  1C4Q A;  3O13 A;  2EY6 A;  2K6A A;  3J80 L;  1JWU D;  2D62 A;  4FF3 A;  1MI2 A;  2JA5 B;  2EY2 A;  2K1B A;  5CBE E;  3KLS X;  2IX3 A;  1TVX A;  2AQ1 B;  5DEH A;  4MHE A;  3P20 A;  1UNS A;  1SFO B;  3EA6 A;  3QOL A;  3S9W A;  5C3X A;  3MXN A;  2EVB A;  1LTT D;  2NZ1 D;  5ELD A;  4L6T B;  1DOM A;  1RDP D;  1I4H A;  3ND8 A;  4U68 A;  1Y8P B;  2X6G A;  5EQ0 A;  1JR0 D;  3OPO A;  1A3T A;  1F2Z A;  4ZKB B;  1WTW A;  4KJO A;  2B2U A;  4K2L A;  2OT2 A;  1BBX C;  1KTK A;  1E2Z A;  2B2T C;  3I4N B;  3ERO A;  1SYF A;  5CV8 A;  3NHH A;  1PFN A;  1R9T B;  1F9P A;  1TT2 A;  4ABN A;  5C3E B;  1EYA A;  4XQJ A;  3D4W A;  5IOC A;  5E4W C;  3W3A A;  2A6H D;  3NTI A;  5EKK A;  1EIG A;  3EVQ A;  5ISR A;  1JWM D;  2A69 D;  3K5L A;  1EEI D;  2XN9 C;  5KRU A;  5CBA E;  2JP1 A;  4BBR B;  1UEA B;  1O7Z A;  4QB4 A;  1PRT B;  2BDN A;  1O7Y A;  1CQF A;  1IW7 C;  5KYL A;  2E76 C;  2N55 A;  3F2U A;  1ENF A;  1YNJ D;  2KOL A;  4KY7 A;  1BXT A;  2IL8 A;  2R93 B;  3H91 A;  4I65 A;  1H9S A;  2F0G A;  3KLS A;  2EYP A;  2VB2 X;  2NVT B;  1JB3 A;  2HDL A;  5KEE A;  2EXZ A;  4PMC A;  4RCO A;  2K5W A;  2LY7 A;  3MVV A;  3NBH A;  5EGT A;  3SK6 A;  5D3D A;  3J7Y W;  3WOF A;  2A68 C;  4FXD A;  2ZXP A;  3TSS A;  3NTH A;  5IOD A;  3MTS A;  4ZQ3 A;  5J39 A;  3OW7 A;  4K2K A;  5IGB A;  1EIH A;  3K7A B;  3D6C A;  5C4J B;  3S1N B;  3MWY W;  5CMD A;  1QNK A;  1EY8 A;  2NVX B;  1SSO A;  4J6H A;  3KF8 A;  2F0P A;  4DFA A;  4ZKC B;  2E2H B;  3FPP A;  4IUV A;  4F88 A;  3JAM L;  5A2Q E;  1ICW A;  3TDQ A;  1D5X C;  4GZY C;  2ID0 A;  3E5S A;  2DY8 A;  4A3I B;  4NKL A;  3HOU B;  3AB9 A;  2B2W A;  1BDO A;  1L0Y B;  1QCB D;  4P2C B;  4RKB A;  3BYT B;  5C0X H;  3M7G A;  2BA1 A;  1ML0 D;  2J7Z A;  1GUO A;  2PMZ B;  2QEJ C;  4ZAI A;  2DY7 A;  4C56 C;  1BO0 A;  5K36 H;  2B2V A;  2NUC A;  1XXG A;  5JPM C;  4QCL A;  1OO9 B;  1HQR D;  3TP6 A;  2MP1 A;  3HEJ A;  2F0F A;  1ILP A;  4OO1 H;  1WD1 A;  2F0L A;  3S2H B;  2EDG A;  1FYC A;  2K5D A;  3H94 A;  5JPN C;  1JOK A;  1EQV A;  2AUK A;  2F0M A;  2FMM A;  5JEA G;  1T5E A;  4N9T A;  1EY6 A;  3MZ5 A;  1I4X A;  1BCP D;  4ME5 A;  1DJR D;  2PZT A;  3D4D A;  4OHJ A;  2K33 A;  3BG3 A;  1C48 A;  2ZXR A;  3C46 A;  3D8G A;  2F0D A;  3U9S A;  1U9R A;  1MBY A;  4NMZ A;  3PO2 B;  2PW7 A;  3TP5 A;  1CFM A;  1HCZ A;  4FP5 D;  2NVQ B;  2WV6 D;  4N9P A;  2F0S A;  4A3M B;  2FFK B;  3GTM B;  1M8A A;  1MGS A;  2KA7 A;  4OIJ A;  1LO5 D;  2L0C A;  3D31 A;  4IUT A;  1SE3 A;  5AFW A;  3NUC A;  4FNF A;  4BA1 I;  1SJE D;  3I73 A;  2EE1 A;  4A93 B;  4IZ8 A;  4DK1 A;  3DUZ A;  3MFY A;  1H9K A;  3MFG A;  3MEH A;  3RUZ A;  3K5M A;  1EU4 A;  2R92 B;  1Y1W B;  4RGT A;  4EQN A;  3OSO A;  1GOZ A;  1W6K A;  2VB3 X;  5C44 B;  2EYF A;  2CVR A;  4QF4 A;  1HRJ A;  4Y7N B;  4FF1 A;  2F0U A;  4IN3 A;  1SNM A;  5BN4 A;  3H0G B;  1DCZ A;  2KUM A;  2HCC A;  3DEO A;  1BUV T;  1LT3 D;  1QG7 A;  1CZW A;  3I70 A;  1SEB D;  2A6E C;  2IJ0 A;  3OOC A;  3K6O A;  1CT1 D;  2KCN A;  3VA5 A;  3S1Q B;  3M4O B;  4ID6 A;  3MXP A;  1TKW B;  2L12 A;  5JAV A;  1CI3 M;  3FEW X;  2B2Y C;  3VYR A;  5T1I A;  3BDC A;  1TWG B;  2C9O A;  2B63 B;  4RGO S;  2NYZ D;  4XDX A;  1EWC A;  1EY9 A;  3AU7 A;  1G2S A;  5DNF A;  5C4H A;  4L8J A;  1XYI A;  2JYO A;  2M00 A;  1LT5 D;  1V1P B;  1X3P A;  4KD3 A;  4TKO B;  4FYD A;  1CK1 A;  4J8Q A;  4XYQ A;  3T16 A;  4QIW B;  3H6M A;  2E2I B;  1GUT A;  4PQX A;  2RBM A;  1SMY C;  2VNU D;  1U4M A;  1TS3 A;  2L1B A;  3P75 A;  1FGB D;  3DWQ A;  3SEB A;  1A6X A;  2SEB D;  1I3Q B;  3A55 A;  4BWG B;  1G29 1;  1J9O A;  4RFB A;  1BF4 A;  2E74 C;  2O5I C;  1IHZ A;  2OF1 A;  3S1M B;  3GO5 A;  4MIU A;  3S1R B;  2LS0 1;  1TS2 A;  3TP8 A;  3NWS A;  1PRT D;  3I3C A;  5D14 A;  1AEX A;  2F0E A;  1B1Z A;  2A6H C;  5BN3 A;  5A2Q L;  4KV6 A;  2A69 C;  3M7N A;  1Q90 A;  1VDZ A;  2CW0 D;  2ENB A;  2G9D A;  3FRP B;  4CKE A;  4DGZ A;  5C0X J;  2IX1 A;  5IGG A;  1V1O A;  2V4D A;  3SDZ A;  1E2W A;  1CQV A;  2KCC A;  2R6G A;  4NW2 A;  1EWH A;  3FMC A;  1DON A;  1STB A;  1D1I A;  2RDG A;  3K57 A;  4A3D B;  3R2I A;  2E75 C;  5IGD A;  1WVL A;  4G7Z C;  1RF2 D;  1AN8 A;  3VYS A;  4HAE A;  4C2M B;  3VA7 A;  1R4Q B;  1TY0 A;  5IIF A;  1EZ8 A;  3NSW A;  2L5T A;  4BA2 I;  2K03 A;  1D5M C;  1K8M A;  5CV6 A;  5M5X B;  5DM6 3;  1EYD A;  1WTV A;  4DNT B;  1OXX K;  4XT1 B;  3KBG A;  3T4A C;  1RHP A;  1UUP A;  4QUF A;  1EU3 A;  3I91 A;  1STA A;  4C3H G;  4FF2 A;  1KLG D;  2RDH A;  1Z7T A;  1PTO H;  2F3V A;  3BDO A;  4HN7 A;  2PZU A;  1F2L A;  4IFD G;  4DXG A;  4OL7 A;  3Q23 A;  4KY6 A;  3D4R A;  5KIX A;  1PLF A;  2X6L A;  3DMU A;  3T53 B;  1PXU A;  2E2D C;  2R7Z B;  4UAI A;  5KYI A;  1VF5 C;  5I2X A;  1KAA A;  3RMH A;  2G9H D;  3PIP 3;  4RH6 A;  1V1P A;  2Q8R E;  4DK0 A;  3NP8 A;  1MSH A;  2QDB A;  2SNS A;  1XWE A;  1TWH B;  3Q22 A;  1LT6 D;  3LWU A;  1F9R A;  4U67 3;  1YNN C;  2KVM A;  4ZUJ A;  2LMC B;  1CTM A;  2EPB A;  2B2T A;  1D1K A;  1H9J A;  5M3M B;  2R61 A;  5IT9 E;  1NR4 A;  1S4Z A;  2NN6 G;  5KNB A;  2O4X A;  3SVM A;  4LJZ C;  1K8O A;  1MSG A;  3EJI A;  1WTP A;  1D6E C;  4B08 A;  1BOS A;  1EL0 A;  1EY4 A;  2WII B;  2TMP A;  4RGN A;  4C3J B;  1EYC A;  4DAV A;  1E2V A;  3IAY A;  4HED A;  3OHX C;  4IFD I;  3DWP A;  2Z4I A;  3LX0 A;  3VR2 A;  4FXK C;  5ELC A;  4H7B A;  3NBI A;  3V96 A;  2F0H A;  2WKC A;  2D2C C;  4DA2 A;  3GTL B;  2XRQ D;  4LAA A;  4WOR A;  1KAB A;  2ZT9 C;  3BS1 A;  5JJZ A;  2KJX A;  3OWF A;  3T51 B;  5CV5 A;  1IKL A;  5I2Y A;  2XWB B;  1FNV A;  2SOB A;  3A8I E;  1GUS A;  2B8F A;  4RGM A;  2M9V A;  4PMW A;  4X3S A;  2N88 A;  5HGT A;  3BVG A;  4KMU C;  1K83 B;  2JE6 I;  5FOB B;  2WB1 B;  5G3L D;  2NTS A;  3QWN A;  1O80 A;  4FXG C;  3S15 B;  3BVM A;  4K5W A;  1SNP A;  2BDO A;  1VF7 A;  5C4Z A;  2NN6 I;  2A5H A;  4XT3 B;  1CA5 A;  4RWS C;  4FVM A;  2C5C A;  2QKI C;  3I4M B;  2L9H A;  2PZW A;  1IL8 A;  1LAC A;  3A7L A;  1B53 A;  3E6Z X;  2EJG C;  1PTO C;  1RJT A;  1A3V A;  2K32 A;  4C3J G;  5EBC A;  3KK7 A;  4FO2 A;  1LT4 D;  2YYZ A;  3CRK C;  5M3F B;  5FO9 B;  1SBB B;  3I4L A;  5JEA H;  2F3W A;  2H4O A;  1TWC B;  4CKB A;  1X32 A;  3P7J A;  1LTS D;  3N6R A;  3PUZ A;  1PMR A;  4A3J B;  1Z47 A;  3WDN A;  3FDT A;  3T56 B;  1NSN S;  5C3W A;  2TSS A;  3HZX A;  3SK5 A;  4K5V A;  3PIO 3;  5BN5 A;  5JVG 3;  1U4R A;  3IFD A;  2IT1 A;  3A8K E;  4G7H C;  1CHQ D;  2ICE C;  2WAQ B;  2L11 A;  5ELF A;  3TBI B;  1EQT A;  3IKJ A;  1WTX A;  1FNW A;  4CJ2 C;  2I07 B;  2RQX A;  4ILW A;  1GUN A;  3NXW A;  1TR5 A;  1G6Z A;  5A35 A;  2XSC A;  1WD0 A;  1ZEQ X;  5I9P A;  4FF4 A;  5LL6 X;  1BR9 A;  1II3 A;  3GTQ B;  4M1U B;  4F8M A;  2AQ3 B;  4JK1 C;  1ZKO A;  3Q0A A;  1RTO A;  4IUN A;  3U9O A;  1TWA B;  3TZU A;  1OXT A;  1Q12 A;  5LHY 1;  5FKA C;  1H9R A;  4XTC S;  1AW7 A;  2JA8 B;  2Z4H A;  3A54 A;  4MN3 A;  3R8B A;  1DOL A;  1IW7 D;  4XIG S;  4K14 A;  5K36 G;  3QIA A;  1IYV A;  2GA4 B;  3CRL C;  3NE5 B;  1WTO A;  4BY7 B;  4DNR B;  1HHV A;  2K28 A;  3NPP A;  1B44 D;  2BE5 C;  4OO1 G;  2SDF A;  3LWE A;  3VR3 A;  3A56 A;  2O2L D;  2EOT A;  4R8I A;  3K58 A;  1I4G A;  3R3O A;  5TSS A;  3C1E A;  4KN7 C;  5EPL A;  2VXW A;  4PMB A;  4EQP A;  1ZYR C;  4QUC A;  3TME A;  2NBF A;  4E6I A;  3ZYY X;  2A68 D;  3QO2 A;  5CGK A;  1OXV A;  1SYD A;  3MHB A;  4Q5V A;  1E0B A;  1A2U A;  1SE4 A;  3KUP A;  1CHP D;  4XQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...