4V190

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
114
structure length
114
Chain Sequence
TGGSSKNLGGKSPGKRFGIKKMEGHYVHAGNILATQRHFRWHPGAHVGLGKNKCLYALEEGVVRYTKEVYVPNPSNSEAVDLVTRLPQGAVLYKTFVHVVPAKPEGTFKLVAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
molecule tags Ribosome
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
total genus 16
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1030 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4v19000
3J7YW 4V190
chains in the Genus database with same CATH superfamily
4YCVA 4KKSA 2F1MA 5C4HA 3M4PA 1MBYA 2F0LA 1PYSB 2UUCL 1ILQA 5EKKA 2B2UC 2B2UA 1LM0A 2AKWB 4JVZA 1D5ZC 2P5ZX 4RHRA 3HOZH 2VQEL 4FP5D 1L1OB 5KYIA 3RZDH 1TS5A 1JWMD 1GM5A 4X65Q 1IL8A 3ND8A 3SK6A 3I72A 4PQXA 3W3AA 4A3BB 5CV8A 3S1MB 4UY8C 1NNXA 3PIO3 1I4GA 4BXXG 2L11A 1KNAA 4DR2L 5M3FH 1LT4D 3A74A 1JE4A 1HZCA 1NTGA 2F0FA 4JC0A 4C3IB 3DWAA 1K3BC 4ZRZA 1EZ8A 5DAUA 4XTCS 4CJ1B 4RMFA 1SYGA 4JI7Q 4DV5Q 2RCNA 5L37A 1T5EA 1AZQA 1XPUA 1L1OC 3BG3A 5D65A 3GD7A 5CV4A 1GKHA 5JEAG 3J7ZC 3M3YB 3P75A 1VQMA 5GAGC 1L0WA 2K5VA 4I7AA 1K8MA 4TVAB 1F9SA 1TVXA 2KBNA 3S16B 4A3DG 1I4RA 3LGJA 3T1YQ 5J3BA 1J5EL 2M00A 1S3OA 2B39A 3J80i 3TREA 4DKAC 4TKOB 3CCSA 1JOKA 1SJED 3EQLC 1SYBA 2KCNA 5KNCA 2CVRA 4AIMA 1HR0Q 4A93G 1JJGA 1E2ZA 1N9WA 1LTLA 2DUDA 3G71A 3K6OA 2RKSA 5CBEE 2ZTDA 1UEBA 1EIGA 4N8FA 1X6OA 2NWGA 3RNUA 3MXNB 3FP9A 3QIAA 1KAAA 3S14B 1EYAA 3CCJA 5HURA 1F9QA 1F2ZA 1S72A 2RSOA 4QB4A 3T13A 1XPRA 2A6EC 3UI2A 3H6MA 1CQFA 1N33Q 1WTRA 3HKZG 4R4TA 3GTGH 2A6HC 4K6DA 1FVIA 5LMNQ 3G4SA 4NB3A 4ME3A 3J81L 2F52A 2E5LQ 1UEAB 3TS2A 1PH2A 4LF9L 1UE5A 1ZXTA 3EVQA 4KK7A 4BBRB 5IYCH 3OW2A 4EX5A 1HA6A 1X65A 5FLXE 1SNMA 3KDFB 4A3DH 2IX3A 4JI8Q 1WTXA 3KDFA 5IYBG 4GNXB 1UWVA 1WD1A 4ZAIA 4OELB 4B3RL 1NAPA 5IGEA 3HG9A 2NN6H 2VL6A 1CI3M 1PFSA 3TEHB 1WTQA 3PO2G 1NSNS 3E9HA 4DNTB 2PZTA 1WD0A 1PZID 3KK7A 4IJHA 1TWAH 3BVMA 1K0SA 2NZHA 3KJOA 1IBLQ 3QO2A 1S5ED 1JC7A 1TWFB 1EUJA 3PF4A 4O42A 2DGYA 4PV1C 5G3LD 3PUXA 2R3ZA 2K03A 4TRDA 2Q2IA 1JQYD 3QG1A 2F4IA 4L8JA 1NE3A 3OHXC 1HNZQ 3RUZA 1HCZA 3I4OA 1I50B 3K5MA 3JAME 3MVVA 4R4IA 3TS0A 3M7NA 1TWCB 3U58A 1W3SA 1EIFA 3BS1A 1XJVA 2UUAL 5D3IB 2EVBA 2A69C 5EAYA 3CCMA 3TP5A 1HNWL 1STAA 2B2VC 4CKBA 4GKJQ 1D7QA 5EGTA 1MJEA 2AUKA 2HHHQ 1D6EC 2R93B 1R4QB 3SHLA 2NVQH 4PZ8A 2CW0C 5FLXL 4K0KQ 3AYHB 4LW1A 1CKNB 2BCOA 5C3EB 2K28A 1F2LA 2R93G 2VS1A 3SEBA 2AWOA 1D5MC 4B9XA 1YBYA 3MAQA 5JEAJ 4LF4Q 1FNVA 2Q2TA 5E7NA 3NTIA 5IT9L 2NZ1D 3QOLA 4R4CA 3U4VA 2TSSA 3CW2C 1K3RA 4IUPA 1XMQL 2EYFA 5DLQE 5M5YB 3NXWA 1SNOA 4LUVA 2F3IA 4UPAA 4YCUA 4KI0A 4G7OC 1GUTA 1WOCA 2D0OA 3A5ZB 3S15H 1KDCA 2TMPA 1PH7A 1DM0B 1QNKA 4B3SQ 1Q90A 1TKWB 4DR1Q 2CW0D 5FK9C 2X6LA 1XMOQ 4CJ2C 1ZKOA 2F0MA 2IHEA 5T1GA 1Z9FA 4K6LA 1E2VA 2PW7A 3VR2A 2JA5H 3E0JA 4HJ9A 5CMDA 5IT9c 1HFGA 3S2DH 1JJCB 1AP0A 1TWAB 1BF4A 4AQYL 5AFWA 1CHQD 2IX1A 3K81C 2IX0A 1GVPA 4KHZA 1EY5A 3A7AB 1FD7D 1SXTA 4CDFC 4ZK9B 4X64L 2B63B 2VUMH 1G2TA 2FINB 5KYLA 1CHPD 2OF1A 2PQAA 5IYBH 4A3FB 5FLXc 2QW7A 2EJGC 3F2CA 2K5QA 3IRBA 3IKJA 1PLFA 2YTYA 1EYCA 2ASBA 3HOXH 3P1HA 4MTKA 1ONLA 2KCMA 1PYBA 1VQ4A 1SN8A 4FXDA 1HUNA 3SDZA 4QUCA 3ICEA 5IODA 3NWTA 1EEID 2NTSA 3GP7A 1SE8A 4CHTB 3U50C 2EQSA 4IALA 5DNFA 2DNEA 3M9BA 3ONAB 1HNZL 1KRSA 1Z6HA 1CA5A 3J81j 1JR0D 4X62L 4B3TL 2ALYB 4Z9CB 3J7AF 4LK1C 2UUBQ 2AQ3B 3S2HB 3HEJA 4J6HA 3T56B 2D62A 5CC4A 1Q8IA 1V1PB 2EZVA 1VQ9A 1G51A 3BZKA 4JI5L 3DWQA 2R92G 2A73B 3GTLH 2JA8H 2YYZA 4BA2I 5C4XB 4P74A 4NXML 1DCZA 1MHWC 4JK1C 4F88A 5M9OA 3K7AB 3CMEA 1ESFA 1RF2D 2EJMA 1M90C 4AH6A 3CU7A 2O5JC 3I56A 2BA0A 3UDGA 4NW2A 3MZ5A 1XNRL 3MC0B 4EQOA 2N55A 4A3MG 3ER0A 5C4XH 5M5WH 4A3DB 2QKIC 4NPSA 2IWHA 2EYMA 1H9JA 2EYLA 4XIGS 1I3QB 4A4IA 5C5LA 4A3MB 2UU9L 1ESRA 1NCVA 3UDFA 3PGZA 2UUBL 4A3KB 2QILA 2EY2A 4BBSH 1X3FA 1X56A 2B8FA 2F0HA 1YI2A 1HZAA 1EFID 3I2ZA 4DR5Q 1TS4A 3QOJA 2Z6KA 3HP3A 3MWYW 1A2TA 1RTNA 4AYBE 3CC7A 3ZYYX 5CYUA 1FL0A 1QCBD 3C46A 2BH2A 3ULLA 3PCOB 3EN2A 3S14H 1JB7A 2DJGC 5C44B 1DOKA 2E2JH 1JOOA 1QOHA 5ELCA 1S40A 1TWCH 4I65A 3IFTA 3PUWA 4RGNA 3NENA 1VDZA 2QEJC 3TZDA 4LF8Q 4JBJA 4KY5A 3J80c 5M3MG 5ELDA 4DV2L 3T1HL 1KIXA 2PQEA 1OXXK 5FKAC 3TDQA 3GDEA 2SNMA 5F2DA 2LKVA 1SMYC 4J8QA 2D9UA 5HY6A 1YNXA 1JE5A 3H15A 2KHIA 1STEA 1TIID 4TSSA 4C3HH 3ERSX 2L0CA 4JW0A 3AFQA 1WTPA 4LF7L 1I94L 1DOLA 1EIYB 1I4HA 2K14A 4ABNA 4PZ6A 2CQOA 3PUZA 4HIMA 2Q2UA 1DONA 3KBXA 3STBD 4JI5Q 1PYWD 2L1BA 4DUYQ 4LAAA 1I4XA 3DEOA 1DD2A 2F0NA 1QILA 2C5CA 1KD1C 2I5MX 1GO3E 2RHQB 4K0KL 3D3RA 2UXCQ 3R2IA 3KF6B 2DN8A 3J7YW 3HOUH 1QJOA 2NVTB 3SVMA 3HOVG 1CSPA 3I91A 2E74C 1HQRD 1T9HA 1BUVT 3K5NA 4YHHQ 1TQOA 5C3WA 4C2MH 1SE4A 4DPGA 1IBLL 1WCMH 3VR6A 5DM63 2I46A 2IW3A 4RH6A 1EQTA 5FJ8H 4DV3L 3I73A 2VXWA 1XXGA 1HR0W 2RA4A 4FXKC 1QG7A 3OIQA 4DV6L 2LSSA 2R92B 3VA7A 1NMFA 5HGQA 1E22A 3A8JE 2K04A 2BA1A 1IZ6A 2IT1A 1LACA 3HS0C 3I70A 5ELFA 2F0EA 2EY5A 3ITPA 3BJUA 3HOVH 4H02A 3M4QA 2ZTEA 5E3FA 1N34Q 4A76A 3FKIH 3NELA 4DR2Q 2MO1A 4Y52H 4JI8L 1IYUA 2B2WC 1I94Q 2B2WA 4B3RQ 5J22A 2EXDA 4DV4Q 4K2LA 4HMIA 2KOLA 2E2DC 4K14A 1PZKD 5IYCG 2KHJA 4YCWA 1XNQL 4PMWA 3CQZH 1JCKB 1SBBB 3OOCA 4LF6L 3O13A 3I55A 5EBDA 3VR3A 3SR1A 1KC8C 3A5UA 4A3BG 3MEFA 3TRZA 4R1JA 3PSIA 4DNRB 1VQPA 1NJIC 1E24A 3CHBD 1R9TH 1A3TA 3D6WA 2N49A 1X55A 2F03A 1PTOB 3G6JB 3L0OA 3DUZA 2EY6A 3CCRA 1I6HB 1Y1WG 3NPPA 1KRTA 3JC66 4X6AH 4C56C 3R93A 4LF5L 3PV0A 1G2SA 4S3SA 2A69D 3JAMi 1HNXQ 1ICFB 3BYTB 1EQQA 3LWEA 3F2DA 2A68C 1R4PB 3HOZB 4JV5Q 3QR8A 2BE5C 4BS9A 1SE2A 4FO2A 5I2YA 1X54A 2JSOA 4F7XA 3HOWH 1SNDA 4LFBQ 4YIJA 1I3QH 1UE1A 3TZUA 3NQIA 4QGUA 1KTKA 1DXMA 5IIFA 2I0QA 3OYYA 1D8LA 1BVSA 3PUVA 4H0LC 3J80L 1B2TA 2KCCA 1HRJA 4AQYQ 1GHJA 1V9PA 1SNPA 2PMZE 2HCIA 4MNOA 4GN3B 3AB9A 1ZYRD 4DV6Q 1NBWA 2R93H 3Q6SA 2ID0A 3S1NB 2WAQB 3GTMB 1IW7D 1CM9A 1KDAA 1DOMA 1TWHH 2PPBC 2CH4W 4DAPA 4HSPA 1VQLA 1EWHA 4GNXA 1SROA 4NDXA 1ENCA 2PO4A 3D0FA 1PA6A 4OO1I 1EY8A 4PMCA 1AW7A 3CMAA 2FMMA 1EWCA 4OGQC 4A93B 1HJPA 5GROA 5LHY1 5KNDA 4L5RC 1RJTA 4WJ4A 3ULPA 1LTSD 2XVSA 1ASYA 4DR4Q 2JA7B 4IFDG 4R4QA 3C3LA 3GTLB 4C3IH 2OTLA 3OMGA 1LO5D 2IHFA 4A75A 1K8AC 2HT1A 2F0IA 4OX9Q 1VQCA 3CRKC 3GO5A 2F0DA 4V190 4G4KA 3FDTA 2KQ3A 3L2PA 2VQFL 1MD2D 5KEEA 1VF7A 2F0UA 4X65L 2NVXH 3ULJA 4JBKA 1Q12A 2JA6H 5CR3A 2QA4A 3T53B 5JPMC 4A3LH 3VR5A 1ET9A 1MSGA 3L3OC 3G7LA 3SGIA 1E0BA 4LFAQ 2CWPA 5HGTA 2D0PA 3FRPB 5EQ0A 4OWWB 4C3IG 5ELBA 3H3VI 2L4NA 5IOCA 1M8AA 1IYVA 1G6ZA 1PH3A 2YV5A 2K5NA 1BCPC 4A3KH 3S15B 2PI2A 4LF7Q 3OPOA 2L5TA 1VQAA 1EU3A 2FHTA 5IGDA 4EVOA 4JI0L 4DXGA 3A56A 3WWVA 1K83B 4WFN3 2HD3A 5EPJA 5IP7H 5M3MH 4JI6L 1MI2A 4GKKL 5T1IA 4A3CG 2MUYA 3MXPA 1BNZA 2JEBI 1RL2A 2Q8TA 4LNQA 1YVCA 1MGSA 2EOTA 3GTGB 3V05A 1PH8A 1Z7TA 2MHVA 2VB2X 5FO7B 4LF8L 1EQVA 1CQVA 4BBSB 5AJ3Q 1QNUA 2QEXA 1RTOA 4J1MA 4JI3Q 1A2UA 1EU4A 2B29A 1BCPB 2MGSA 3X3MA 4CGYB 2F3WA 5IWAL 3HRZC 2R92H 5DM73 1ASZA 5G3LF 1D1KA 1LLRD 2PZWA 4GNXC 4IOAA 4RA8A 4BBSG 3GTJH 3NSWA 3VA5A 3KLRA 1G91A 2RF4A 4RCOA 4R4OA 1STBA 4BA1I 4IPDA 4HIOA 2G9HD 2JA8G 3RN5A 1SFOB 5C3EH 2HCCA 4EQNA 5E1FA 1KNEA 2SNSA 4RKLA 1YJNA 2J4XA 4P71A 3BDCA 1M1KC 2Q8RE 3MA2B 2MP1A 2N88A 4ZYSA 3OWEB 1BKBA 2NBFA 4ZKCB 3NE5B 3LNNA 4HAEA 4DAMA 4BBRG 5IE8A 1O7ZA 4DV2Q 3T1HQ 4PG3A 1Q81C 5M3FG 3KLWA 3NP8A 3R2TA 2VZAA 1PHJA 2KEEA 4K5WA 3Q22A 3F8TA 3HOWB 1B70B 4RWSC 1Q7YC 1X3PA 1X3GA 4G7HC 3CCEA 1ENFA 4A3GB 1N8RC 1E1OA 4FVMA 4KHPQ 2NVYB 2H5XA 1U4LA 4YWLA 5C3XA 1NR4A 2UUCQ 3HGBA 4ME5A 1XNQQ 3FHWA 1NUCA 4QUFA 5EBCA 3VR4A 2WACA 4FF3A 4CKEA 1SE3A 3KBGA 4QF4A 4JI1L 4C3HG 2K50A 4KLKA 1IBML 2YTVA 5BR8Q 4DUZQ 1HA5A 2KJXA 4JI2L 2JA7G 2F0TA 2OXPA 4DR7L 3H3VH 1ZEQX 2C9OA 2RDFA 1AE3A 1CSQA 3FPUB 5BR8L 4QL5A 1P16A 2XNAC 3W1GA 3RZOH 1PVOA 3J81i 4IUVA 2K32A 1TWFH 3EJIA 5C4XG 1P8LA 1PH6A 3RLNA 1GUNA 3PIP3 2VQEQ 2NYZD 1S5DD 1B1ZA 2VW9A 4A3IG 3N6RA 2CKZB 3CXCA 1YZ6A 5M5YH 1EY9A 5KGUA 3S2DB 4M1UB 2Z4IA 2DNCA 5ELOA 4IPCA 5A2QL 2F0KA 1PH5A 4RFBA 2PQAB 3K8AA 2K75A 5I9OA 4HR7B 3A0JA 1PRTB 3I4LA 4NMZA 4HSVA 3D4DA 3FKIB 4IO9A 2OTJA 1E3PA 2N3SA 1PRTC 4GN5A 1RKNA 5GAEC 1Q86C 4GLXA 3NQTA 2HDMA 3D6CA 4O2DA 1LABA 1LT3D 4CDCC 2ZM6L 4OO1H 2NVQB 1VQNA 5EKIA 3J81c 4DAVA 2A1AA 5CORA 4JI2Q 4JBMA 2K05A 3GTPB 1TR5A 2ZXRA 1STHA 4YHHL 2LS01 1VMCA 1EOVA 1WVLA 3J7AV 3PO3H 5JAVA 5H1SE 3PO3B 1I6HH 4F8MA 1GJXA 1CTMA 3OW7A 4MTNA 3D4RA 4QIWE 5I2XA 3HOUG 1K73C 3A55A 5EPKA 1S5CD 1C9OA 3FKIG 3A8IE 3E9IA 3SK4A 3PUYA 5JEAH 1QUQA 4NP5A 4EQPA 1XTCD 4PNYA 4DGZA 4OO1G 2MQHA 2UU9Q 1XWEA 1VF5C 2VY3A 1RD9D 3RLFA 5C5MA 5IGBA 3I4MH 3CCLA 4C1NK 2ATWA 3VYTA 3NUCA 1ET6A 3RLOA 1EY6A 4A3JB 5JPNC 4HCEA 4Y7NH 3S1RB 4K8IA 2F0VA 1STNA 1HXYD 4HTHA 2Q8IB 4KKTA 1SYEA 4Q0FA 5AJ3L 5LMUQ 1EL0A 2XN9C 1A0IA 4N9PA 4A3BH 2MJ8A 2OT2A 2H4OA 5ELNA 4DV4L 5IP9H 3H3VC 3BYYB 1HZ9A 4GN4B 1SR3A 1W6JA 4LF6Q 4H44C 2XIWA 1TXYA 4C3HB 1N36Q 1BBWA 1B9MA 5C6AA 3R8BA 2O2LD 1Q8KA 4NKLA 4XQQA 2LFNA 2KEDA 3I4NB 1MJCA 1SSOA 3H09A 3TQYA 1HH2P 2SOBA 4OL7A 3M3YH 2F0JA 1YNNC 2CFMA 4JCVE 3TMEA 4A3JG 2YU9H 5GQOA 1IHZA 4FF4A 3OIPA 1CFMA 5K5PA 2NVYH 4IJLA 2JJQA 2XWBB 5A2QE 1Q1BA 5FJ8G 3GV6A 5NUCA 4GKJL 3DMUA 1LT6D 1H9KA 3KYHC 1M4VA 3LX0A 2K33A 4XQJA 4IQZA 2E2JB 2JP1A 1L2FA 3S17H 2K1BA 3WOFA 4C3JB 1X3QA 2OWOA 2EXZA 4DR4L 4K5VA 2UXDQ 4IUTA 4X62Q 4JI7L 3KF6A 4B3ML 1B3AA 1JB3A 2GN5A 1YHBA 3S1MH 4IPGA 2Y0SE 1YHQA 1YHAA 1KLUD 3W2DA 1KQSA 3IFDA 3CCVA 1VQ8A 4DAYB 2CHBD 4GLAC 1WCMB 1V1PA 4H13C 4KY7A 1SAPA 3RZOB 3BDLA 1HPCA 1VQGA 1BCPF 1WI5A 3EIVA 4L5SA 1A62A 3MXGA 1RDPD 5EPLA 1KAWA 2Z6BA 4KY6A 5M3MB 2I07B 4DR3L 1B8AA 4HJAA 1JWSD 3P7JA 1GHKA 1GUGA 1SYCA 3HZXA 4MIUA 2OEOA 3STBC 4BY1B 1PFBA 4XYOA 1SMXA 4QCLA 5BN3A 1ILPA 4A3CH 1QVGA 4ODGA 4R8NA 2PW5A 3K59A 4DA2A 4H7BA 5D3DA 1SJHD 1PFMA 4P72A 1N32L 4WJ3M 3UE0A 4JOIC 4OWTB 1JT8A 2RHSB 1EEFD 2B2TC 1WTHA 1RCVD 5K36H 4A3EG 4BY7B 2VB3X 1NR2A 1N33L 2HDLA 3UDIA 4N8X1 2RDHA 3PQIA 4G57A 3RMHA 3NHHA 4LF9Q 1PTOD 2LXJA 2OQ0A 1IBKQ 5J39A 3EA6A 1G291 2JA5B 4A3LG 4JI4Q 4G7ZC 3EROA 1IL2A 1CK1A 1VQJA 4POGA 1JORA 1SEBD 1A3UA 5I6WA 1EFWA 3HKZB 1F2YA 1IBKL 4P75A 4ZUIA 3D8GA 3UE1A 4A3GH 2C35B 2A74C 2PCFB 1O78A 1Q82C 3NWSA 4UHVA 1DZ1A 5K36G 2CQAA 2Y0SG 2Z0SA 4ILWA 1VS0A 2MNAA 1FGBD 3HOWG 1B53A 5FLMG 4E6IA 2K5HA 1HTPA 1W2BA 4OIKA 2VNUD 2JN4A 3HOYB 1A15A 2HIVA 2K52A 2Y0SB 3U9OA 1Y1VB 3IAYA 4X3KA 4UP8A 1WTWA 1PH9A 2M9VA 5C4ZA 4ZLTF 5JOBA 3GTKH 3J81E 4HEDA 5CV6A 4X66Q 2WP8J 1QWYA 3TN2A 4A93H 2F0PA 1Y8PB 1Y1VG 2HHHL 2R6GA 5LMNW 2EY1A 1OXTA 4A3KG 3Q8DA 4A3GG 4CJ0B 4GKKQ 1IKLA 4OHJA 1LV9A 1FR3A 3E5SA 1KDBA 5LL6S 1Q1EA 4DV7L 3HOYH 5FLMH 3OTOL 1UNSA 4LUOA 4M8AA 4C1NI 1SNCA 1SYFA 4DNIA 3ND9A 3U4ZA 5M5WB 2OQKA 3K57A 1F77A 2V4DA 4F87A 2H1EA 2KENA 2L9HA 4FDBA 4DK3C 1Y69U 1L0YB 2A68D 1XMQQ 1STGA 3DM3A 1YJ9A 2BE5D 2RQXA 1G6PA 3VYSA 1TS3A 2AQ2B 1UUPA 3RN2A 3I90A 1SYDA 2BDOA 1EOTA 4MZ9A 3URYA 4KJOA 2YTXA 1A8VA 3PMFA 2D2CC 4R9WA 2JA8B 4YY3L 3Q23A 3F2BA 4B3TQ 1QE6A 1V43A 2ICIA 3FEWX 4CDEC 2EIFA 4EQ5A 2R7FA 1SMYD 1CT1D 4OXPA 1K8OA 3H0GB 3S1QB 4KHPL 1VQ7A 4RKBA 1YNJD 5JJKA 4PZ7A 4UP7A 4HIKA 3M85A 2Z8LA 3M7GA 2WIIB 2LMCB 1RODA 2EYHA 4HMJA 4IUQA 1IBMQ 4AYBG 2XTIA 5A35A 4L63B 2A19A 4DR7Q 4TQUS 5EJWA 2UXCL 1E7ZA 1PTOF 2LY7A 1QUQB 1XX8A 2QDBA 3K7UC 4MN3A 1ZYRC 3M4OB 4KD3A 1SRUA 5C44G 1F9PA 2K6AA 2UXBQ 4BY7G 4WORA 4C3JG 1F2MA 1YEZA 4DAYA 3MHBA 1OXUA 5C0XI 2O4XA 2JA6G 1MIUA 1LTGD 2ZT9C 2RCFA 4A3FG 3QB3A 1RHPA 1FJGL 2XSCA 1V1OA 4BY1G 3Q24A 1V1QA 4L5TA 4KN7C 2PMZB 3FVQA 1D2BA 2VUMB 4JI6Q 4BXXH 2N78A 1GOZA 4CKCA 3CF5A 1QZGA 2HQLA 2F0WA 3S1NH 4DV0Q 4IFDI 1FNUA 2E5LL 2WAQG 2AQ1B 2EPBA 4IZ8A 2MFIA 4KV6A 1AH9A 4YWKA 3GTOH 4HJ5A 1WCMG 2R61A 4ZKBB 1XPOA 1KL9A 2NZOA 2UXBL 3E6ZX 3PIOA 4HN7A 1KABA 1HFNA 2F4VL 2AWNA 5IT9E 2RSNA 1I5FA 2CWAA 1N32Q 3GTMH 1DYQA 2E8GA 4P2CB 3JAMc 4POFA 5LL6X 2EE1A 2M2LA 2SEBD 3AEVA 1GUSA 4DF7A 2CH4A 4KJNA 2XRSD 2L12A 2BOSA 4UAIA 5IYDH 1AE2A 5BN5A 3DLLA 1EIHA 4QJFA 3F1ZA 3HKZE 5IGFA 1TS2A 1O80A 3N52A 3MXNA 3HOUB 1U0LA 1BO0A 3GTQB 2L15A 3A54A 3BZDB 5JVH3 1U9RA 3F2UA 1A6XA 1WYDA 3DWPA 4PMBA 3S16H 1B50A 5J1ZA 3PO3G 1PH4A 2ZJQA 1PMRA 1MKHA 4JOIA 1I50H 2BH8A 4XT1B 4B9WA 1IXRA 1EYGA 2F0SA 4RHSA 2GVAA 5CGKA 3HOXB 3M4YA 4DUYL 3WDNA 5JJLA 2RVLA 3GV3A 5EKLA 4LFCQ 1WTVA 2QCPX 1S4ZA 3MTSA 1VQBA 3KLSA 4GS3A 3HOXG 3BVGA 3SXHA 2A8VA 2Z6KC 2NVXB 2ES2A 4IN3A 1VQDA 1BDOA 1EY4A 3T4AC 4DU9A 2B63G 2F0GA 1CZGA 1KLGD 4A3IH 1Y1WB 1CA6A 1OXVA 1PXUA 1A63A 2BDNA 4ZCKA 5CV7A 5IP9G 2WKCA 1O7LA 4IFDJ 4JI1Q 5E4XA 2E76C 1ENAA 3OTOQ 1YNND 2X69A 4LJZC 1AEXA 1C48A 4HCSA 3SE0A 3LWUA 4B3MQ 1LTTD 4KN4C 4EGVA 2IPKD 3D4WA 1O7IA 3CC4A 3EFXD 5LMUL 4BY1H 1CKMA 2NVTH 4GOPC 3AMUA 1XMOL 1TWGB 1DJRD 4DN4M 4X3SA 3MEHA 4B3SL 3A7LA 4O1NA 2AMCB 4BBRH 1ML0D 5FOBB 1EQRA 1LUZA 4A3JH 3MXUA 4KKUA 4OONA 5I4DA 4JI3L 3SK8A 1C8CA 3V96A 2B2YA 4IOCA 4I7ZC 3CPFA 4L5QA 2K7VA 5DEHA 2B2YC 4IURA 1H9RA 1UE7A 2NN6I 4ZUJA 4QIWB 1VQ6A 1N36L 4B08A 3K5LA 3IL8A 5C0XH 3K7AH 2E2IH 4X64Q 2NTTA 2YU9B 3GTJB 1Q46A 3ERQA 2XRQD 2NUCA 4A3MH 1CKNA 2XWJB 1VCIA 4GOPB 4JV5L 1Y8NB 1BR9A 2IL8A 4IUUA 3H94A 4DR1L 3GTPH 1X32A 3MFYA 4KMUC 2PYKA 3PF5A 3T16A 1PRTD 4QQBX 1F9RA 3BVZA 1EYDA 3KJPA 4FF2A 3J80E 3ZJYC 3C1EA 4O0AA 1BCPD 2IJ0A 2KHSA 2LXKA 3GTOB 4HJ7A 4FNFA 1TY0A 1PRTF 3KLSX 4A3EH 2D5DA 1W6KA 5GAHC 4V0BA 1AFPA 2FXQA 2JA6B 2JXMB 1EY0A 1B3QA 2QF7A 5FO9B 3TBIB 2MPMA 4DV5L 1Y1WH 1MSHA 5C0XJ 5JJZA 4IPHA 4R8IA 2PI2E 1B4OA 3W5OA 4RGOS 4WJWA 3R3OA 2QDLA 1VQOA 2Z1CA 5TSSA 3SK5A 4Q5VA 3CP0A 3KF8B 4U68A 4HJ8A 1CZWA 1U5KA 2J7ZA 2WINB 5KNBA 3QWNA 2Z9HA 1OTCA 3L9AX 1U4MA 4AYBB 1B7YB 1VQFA 2B3GA 1II3A 4LMQD 4XQNA 2R7ZB 4BWGB 3BDOA 3OSOA 4JG2A 5M3FB 4GLVB 4P73A 1N34L 3OWFA 2EJFC 3TSSA 2WB1G 4JYAL 1VQKA 2WFWA 2WKDA 3WOEA 2VUMG 4DR3Q 3H0GG 1VQHA 1CKOA 4YY3Q 2WB1B 4OIJA 3W1BA 3NBHA 4OX9L 5IGGA 1JOQA 1FGUA 1HHVA 4CBVA 3K5OA 2UXDL 2E2HB 5JJIA 4GOPA 2DJFC 3KOJA 1I6VC 1UE6A 2L55A 1D5XC 4DV1L 2B2TA 2FMCA 4DFAA 2FFKB 1EZ6A 2X6GA 1TU2B 4HIDA 3I4MG 1WFQA 1WJJA 1J8IA 1B9NA 1HTLD 3H0GH 3S1QH 2HIXA 2A6ED 1YJWA 2O5IC 1CUKA 3G48A 4C3JH 1TWGH 4J15A 2R7ZG 4UP9A 2JE6I 2ZJRA 1H95A 4DR6Q 2IY5B 5E4WC 3DEPA 1PFNA 2SDFA 2PNRC 4DXFA 1HQMC 3V2TA 3CC2A 2G9DA 4RGMA 2ZTCA 1QVCA 3L7ZC 4FF1A 5C0XG 1D1IA 1K8GA 1BBUA 1PZJD 3BU2A 2A5HA 4XYQA 2HQEA 3PO2H 2AUJD 1H9MA 4FYDA 4K2KA 3UDXA 1SNQA 2K5WA 2R7DA 1GUWA 1IYJB 2B2VA 3NBIA 3K80C 1PTOH 5CV5A 4NXNL 1SDFA 4DK6C 2PNHA 2CCZA 1XYIA 1KXLA 1R9TB 1EWIA 1HZBA 1PDQA 2ZM6Q 4JPBW 5IWAQ 4OEMB 1LTID 1VQ5A 2MO0A 1H9SA 1YIJA 2F3VA 1X9NA 3P20A 1T5XD 1S5FD 2ENBA 3GTKB 1FYCA 4XT3B 1C7YA 2WB1E 2EYJA 4KHVA 4RCNA 4QMGA 3RD4A 1NMGA 5M5XH 5ISRA 1LYLA 5GADC 4X3TA 1L1OA 4IUNA 3I4NG 4XXEA 3H91A 2EYOA 2F0QA 2KVMA 3OMCA 5ELEA 2V1CC 1OXSC 4DV1Q 3NTHA 2JYOA 2DY7A 3GTQH 3VYRA 3EBEA 2FJ2A 2R7ZH 1ICWA 2NB0A 3RR5A 3J7A5 4A3EB 3KFUA 5BN4A 4X3UA 4ID6A 4K8JA 1JICA 5I6YA 1I4PA 4ULLA 2G5DA 1PV4A 1Y8OB 2E75C 1O7YA 3HOYG 4NXNQ 5KRUA 3AFPA 1HR0L 3K0YA 3C1FA 1JMCA 3CAMA 5JVG3 4DR5L 1GUOA 1VQIA 1PTOC 2I5LX 5IY0A 2HUGA 3PIPA 4DR6L 4LUZA 4YWMA 5C44H 3M4OH 5CV9A 3C2PA 1QVFA 3PO2B 1XNRQ 4Y7NB 3S1RH 1GXDC 3HFZB 3DXJC 1V8QA 2Z4HA 2OCEA 5M5XB 3D31A 3CD6A 1U4PA 4KTAA 5COYA 1E2WA 2VQFQ 5C4JB 3TP7A 3RZDB 4N9TA 3CCUA 1SFOH 1DGSA 3X3NA 5C4JH 1HNWQ 4QY7A 1JJ2A 3K58A 2K4KA 2JA5G 1LTRD 1TY2A 2NN6G 3I3CA 4IFDH 2N8NA 4MHEA 3E3XA 1S5BD 3CRLC 5FO8B 1H9SB 2ZJPA 3Q0AA 1NY4A 5IP7G 1SLJA 4LFAL 3FPPA 2XGTA 2K5DA 4LF4L 2RBMA 1JWUD 3AU7A 3VDYA 2J0TD 4DV7Q 4L6TB 1VQEA 2JQOA 3A8KE 1BOSA 3KF8A 4XDXA 3JAML 1VMPA 3S2HH 2KUMA 4RG1A 4DV3Q 2KECA 4APVA 1K28A 4C2MB 1J9OA 4RGTA 2KA7A 2AHOB 1GD7A 3TP8A 1X3EA 1K0RA 1KHIA 1B44D 1C4QA 1HNXL 2GA4B 4CDDC 2DY8A 2ICEC 4LFCL 1K9MC 4A3IB 5D14A 5LMNL 4RAUC 1TT2A 1LT5D 3E0EA 3NBHB 4FXGC 4BY7H 4JYAQ 1BXTA 3U9SA 2RDGA 2JA7H 5IYDG 2F4VQ 2EDGA 1A3VA 3NK9A 1UAPA 3KUPA 5CBAE 2WV6D 5C3EG 1Y1VH 3CCQA 1J6QA 1HUMA 3G6EA 3GQBA 5KIXA 4LF5Q 4GZYC 1STYA 4A3FH 4U673 3VYUA 1G8ZD 1EY7A 2B63H 1OO9B 3S9WA 2ZXPA 3S24A 1U4RA 2JK8A 1RIPA 3BZCA 3I4NH 3HKSA 4WRDA 2EYPA 3CKIB 3NTKA 1LTBD 1YNJC 1IW7C 1Q3LA 2K01A 3MFGA 2ZXOA 2KCTA 3I4MB 2E2IB 3I8ZA 4LWCA 4JBWA 4UDUC 1BBXC 4LFBL 3I7FA 3TP6A 4DV0L 3HOVB 5I9PA 3AQQA 2Q2HA 3CPWA 4JI0Q 3NEMA 1QZHA 3CQZB 2F0OA 1E1TA 4X66L 4JI4L 4K5XA 2GVBA 4KD4A 3T51B 1I4QA 2PZUA 1TWHB 1LTAD 3FMCA 4DK0A 2WAQE 3QJYA 3K0XA 4DK1A 3S17B 1IKMA 4OWXB 1XTDA 3DHQA 4ALPA 2UUAQ 1FJGQ 3T1YL 2QGQA 1FNWA 1PH1A 2I5HA 1AZPA 3HOZG 3B6YA 1Y14B 2B8GA 5IGCA 2E2HH 1AN8A 1L0XB 1Z47A 1J5EQ 2JA9A 3DM1A 1QB5D 1BQQT 2A6HD 4DUZL 1YITA 1K83H 4ZQ3A 2JEAI 4NXMQ 1C0AA 1WTOA
chains in the Genus database with same CATH topology
4KKSA 2F1MA 5C4HA 1MBYA 2F0LA 1ILQA 5EKKA 2B2UC 2B2UA 1D5ZC 4RHRA 4FP5D 5KYIA 1TS5A 1JWMD 1IL8A 3ND8A 3SK6A 3I72A 4PQXA 3W3AA 4A3BB 5CV8A 3S1MB 3PIO3 1I4GA 2L11A 1KNAA 1LT4D 1JE4A 2F0FA 4C3IB 3DWAA 4ZRZA 1EZ8A 5DAUA 4XTCS 4CJ1B 1SYGA 1T5EA 1AZQA 3BG3A 5D65A 3GD7A 5CV4A 5JEAG 3M3YB 3P75A 1K8MA 1F9SA 1TVXA 3S16B 1I4RA 2M00A 2B39A 4TKOB 1JOKA 1SJED 3EQLC 1SYBA 2KCNA 5KNCA 2CVRA 1E2ZA 3K6OA 2RKSA 5CBEE 1EIGA 2NWGA 3QIAA 1KAAA 3S14B 1EYAA 5HURA 1F9QA 1F2ZA 2RSOA 4QB4A 3T13A 2A6EC 3UI2A 3H6MA 1CQFA 1WTRA 2A6HC 4K6DA 3J81L 1UEAB 1ZXTA 3EVQA 4KK7A 4BBRB 1HA6A 5FLXE 1SNMA 2IX3A 1WTXA 1WD1A 4ZAIA 1NAPA 5IGEA 3HG9A 2NN6H 1CI3M 1WTQA 1NSNS 4DNTB 2PZTA 1WD0A 1PZID 3KK7A 3BVMA 3QO2A 1S5ED 1JC7A 1TWFB 4O42A 4PV1C 5G3LD 3PUXA 2R3ZA 2K03A 4TRDA 1JQYD 3QG1A 2F4IA 4L8JA 3OHXC 3RUZA 1HCZA 1I50B 3K5MA 3JAME 3MVVA 3M7NA 1TWCB 3BS1A 5D3IB 2EVBA 2A69C 3TP5A 1STAA 2B2VC 4CKBA 5EGTA 2AUKA 2R93B 1D6EC 1R4QB 3SHLA 2CW0C 5FLXL 2BCOA 5C3EB 2K28A 1F2LA 3SEBA 2AWOA 1D5MC 4B9XA 3MAQA 5JEAJ 1FNVA 3NTIA 5IT9L 2NZ1D 3QOLA 2TSSA 4IUPA 2EYFA 5M5YB 3NXWA 1SNOA 4KI0A 4G7OC 1GUTA 1KDCA 2TMPA 1DM0B 1QNKA 1Q90A 1TKWB 2CW0D 5FK9C 2X6LA 4CJ2C 1ZKOA 2F0MA 5T1GA 4K6LA 1E2VA 2PW7A 3VR2A 3E0JA 5CMDA 1HFGA 1AP0A 1TWAB 1BF4A 5AFWA 1CHQD 2IX1A 2IX0A 4KHZA 1EY5A 3A7AB 1FD7D 2B63B 1SXTA 4ZK9B 1G2TA 2FINB 5KYLA 1CHPD 2OF1A 4A3FB 2EJGC 2K5QA 3IKJA 1PLFA 1EYCA 3P1HA 1ONLA 4FXDA 1HUNA 3SDZA 4QUCA 5IODA 3NWTA 1EEID 2NTSA 3GP7A 4CHTB 4IALA 5DNFA 2DNEA 3ONAB 1Z6HA 1CA5A 1JR0D 4Z9CB 3J7AF 4LK1C 2AQ3B 3S2HB 3HEJA 4J6HA 3T56B 2D62A 5CC4A 1Q8IA 1V1PB 2EZVA 3DWQA 2A73B 4BA2I 5C4XB 2YYZA 1DCZA 4JK1C 4F88A 5M9OA 3K7AB 1ESFA 1RF2D 2EJMA 3CU7A 2O5JC 2BA0A 4NW2A 3MZ5A 3MC0B 4EQOA 2N55A 4A3DB 2QKIC 2IWHA 2EYMA 1H9JA 2EYLA 4XIGS 1I3QB 4A3MB 5C5LA 1ESRA 1NCVA 4A3KB 2QILA 2EY2A 2B8FA 2F0HA 1EFID 1TS4A 3QOJA 3HP3A 3MWYW 1A2TA 1RTNA 3ZYYX 5CYUA 1QCBD 3C46A 5C44B 1DOKA 1JOOA 1QOHA 5ELCA 4RGNA 4I65A 3IFTA 3PUWA 1VDZA 2QEJC 3TZDA 4KY5A 5ELDA 2PQEA 1OXXK 5FKAC 3TDQA 2SNMA 5F2DA 2LKVA 1SMYC 4J8QA 2D9UA 1STEA 1TIID 4TSSA 2L0CA 1WTPA 1DOLA 1I4HA 4ABNA 3PUZA 1DONA 3KBXA 1PYWD 2L1BA 4LAAA 1I4XA 3DEOA 1DD2A 2F0NA 1QILA 2C5CA 3D3RA 3R2IA 3J7YW 2DN8A 1QJOA 2NVTB 3SVMA 3I91A 2E74C 1HQRD 1BUVT 3K5NA 1TQOA 5C3WA 1SE4A 3VR6A 5DM63 2I46A 2IW3A 4RH6A 1EQTA 3I73A 2VXWA 1XXGA 2RA4A 4FXKC 1QG7A 3OIQA 2R92B 3VA7A 3A8JE 2K04A 2BA1A 2IT1A 1LACA 3HS0C 3I70A 5ELFA 2F0EA 2EY5A 3ITPA 5E3FA 1IYUA 2B2WC 2B2WA 5J22A 4K2LA 4HMIA 2KOLA 2E2DC 4K14A 1PZKD 4PMWA 1JCKB 1SBBB 3OOCA 3O13A 5EBDA 3VR3A 3SR1A 4DNRB 3CHBD 1A3TA 3D6WA 2F03A 1PTOB 3G6JB 3DUZA 2EY6A 1I6HB 3NPPA 4C56C 3R93A 3PV0A 1G2SA 4S3SA 2A69D 3BYTB 3LWEA 2A68C 1R4PB 3HOZB 2BE5C 4BS9A 1SE2A 4FO2A 5I2YA 2JSOA 4F7XA 1SNDA 4YIJA 3TZUA 3NQIA 1KTKA 1DXMA 5IIFA 3PUVA 4H0LC 3J80L 1B2TA 2KCCA 1HRJA 1GHJA 1SNPA 2HCIA 3AB9A 1ZYRD 3Q6SA 2ID0A 3S1NB 2WAQB 3GTMB 1IW7D 1CM9A 1KDAA 1DOMA 2PPBC 4DAPA 4HSPA 1EWHA 4NDXA 1ENCA 2PO4A 4OO1I 1EY8A 4PMCA 1AW7A 2FMMA 1EWCA 4OGQC 4A93B 5LHY1 5KNDA 1RJTA 1LTSD 2XVSA 2JA7B 4IFDG 3C3LA 3GTLB 3OMGA 1LO5D 2F0IA 3CRKC 3GO5A 2F0DA 4V190 4G4KA 3FDTA 2KQ3A 1MD2D 5KEEA 1VF7A 2F0UA 1Q12A 5CR3A 3T53B 5JPMC 3VR5A 1ET9A 1MSGA 3L3OC 3G7LA 1E0BA 5HGTA 3FRPB 5EQ0A 4C3IG 5ELBA 2L4NA 5IOCA 1M8AA 1IYVA 1G6ZA 1BCPC 3S15B 3OPOA 2L5TA 1EU3A 2FHTA 5IGDA 4EVOA 4DXGA 3A56A 1K83B 4WFN3 5EPJA 1MI2A 5T1IA 2MUYA 3MXPA 1BNZA 2JEBI 2Q8TA 1MGSA 2EOTA 3GTGB 3V05A 1Z7TA 2MHVA 2VB2X 5FO7B 1EQVA 1CQVA 4BBSB 1QNUA 1RTOA 4J1MA 1A2UA 1EU4A 4CGYB 2MGSA 1BCPB 3X3MA 2F3WA 3HRZC 5DM73 5G3LF 1D1KA 1LLRD 2PZWA 4RA8A 3NSWA 3VA5A 3KLRA 1G91A 4RCOA 1STBA 4BA1I 2G9HD 1SFOB 2HCCA 4EQNA 5E1FA 1KNEA 2SNSA 4RKLA 2J4XA 3BDCA 2Q8RE 3MA2B 2MP1A 2N88A 4ZYSA 3OWEB 2NBFA 4ZKCB 3NE5B 3LNNA 4HAEA 1O7ZA 3NP8A 3R2TA 2KEEA 4K5WA 3Q22A 3HOWB 4RWSC 1X3PA 4G7HC 1ENFA 4A3GB 4FVMA 2NVYB 1U4LA 5C3XA 1NR4A 3HGBA 4ME5A 1NUCA 4QUFA 5EBCA 3VR4A 2WACA 4FF3A 4CKEA 1SE3A 3KBGA 4QF4A 4C3HG 1HA5A 2KJXA 2F0TA 2OXPA 1ZEQX 2C9OA 2RDFA 3FPUB 2XNAC 4IUVA 2K32A 3EJIA 1GUNA 3PIP3 2NYZD 1S5DD 1B1ZA 3N6RA 1EY9A 5KGUA 3S2DB 4M1UB 2Z4IA 2DNCA 5A2QL 2F0KA 4RFBA 5I9OA 4HR7B 1PRTB 3I4LA 4NMZA 4HSVA 3D4DA 3FKIB 1PRTC 1RKNA 2HDMA 3D6CA 3NQTA 1LABA 1LT3D 4OO1H 2NVQB 5EKIA 4DAVA 5CORA 2K05A 3GTPB 1TR5A 2ZXRA 1STHA 2LS01 1VMCA 1WVLA 3J7AV 5JAVA 3PO3B 4F8MA 1GJXA 1CTMA 3OW7A 3D4RA 5I2XA 3A55A 5EPKA 1S5CD 3A8IE 3SK4A 5JEAH 3PUYA 4EQPA 4NP5A 1XTCD 4PNYA 4DGZA 4OO1G 1XWEA 1VF5C 1RD9D 3RLFA 5C5MA 5IGBA 4C1NK 3VYTA 3NUCA 1ET6A 1EY6A 4A3JB 5JPNC 4HCEA 3S1RB 4K8IA 2F0VA 1STNA 1HXYD 4HTHA 2Q8IB 4KKTA 1SYEA 4Q0FA 1EL0A 2XN9C 4N9PA 2MJ8A 2OT2A 2H4OA 3H3VC 3BYYB 1W6JA 4H44C 2XIWA 4C3HB 1B9MA 5C6AA 3R8BA 2O2LD 4NKLA 4XQQA 2LFNA 2KEDA 3I4NB 1SSOA 3H09A 2SOBA 4OL7A 2F0JA 1YNNC 3TMEA 1IHZA 4FF4A 3OIPA 1CFMA 5K5PA 2XWBB 5A2QE 1Q1BA 3GV6A 5NUCA 3DMUA 1LT6D 1H9KA 1M4VA 3LX0A 2K33A 4XQJA 4IQZA 2E2JB 2JP1A 2K1BA 3WOFA 4C3JB 1X3QA 2EXZA 4K5VA 4IUTA 1B3AA 1JB3A 1KLUD 3W2DA 3IFDA 2CHBD 1WCMB 1V1PA 4H13C 4KY7A 1SAPA 3RZOB 3BDLA 1HPCA 1BCPF 3MXGA 1RDPD 5EPLA 4KY6A 5M3MB 2I07B 1JWSD 3P7JA 1GHKA 1GUGA 1SYCA 3HZXA 4MIUA 2OEOA 4BY1B 1PFBA 4XYOA 4QCLA 5BN3A 1ILPA 4ODGA 4R8NA 2PW5A 3K59A 4DA2A 4H7BA 5D3DA 1SJHD 1PFMA 1EEFD 2B2TC 1RCVD 5K36H 4BY7B 2VB3X 1NR2A 2HDLA 2RDHA 4G57A 3RMHA 3NHHA 1PTOD 5J39A 3EA6A 1G291 2JA5B 4G7ZC 3EROA 1CK1A 1JORA 1SEBD 1A3UA 5I6WA 3HKZB 1F2YA 4ZUIA 3D8GA 2A74C 2PCFB 1O78A 3NWSA 1DZ1A 5K36G 2CQAA 4ILWA 1FGBD 1B53A 4E6IA 1HTPA 4OIKA 2VNUD 3HOYB 1A15A 2Y0SB 3U9OA 1Y1VB 3IAYA 4X3KA 1WTWA 2M9VA 5C4ZA 4ZLTF 5JOBA 3J81E 4HEDA 5CV6A 2WP8J 1QWYA 3TN2A 2F0PA 1Y8PB 2R6GA 2EY1A 1OXTA 4CJ0B 1IKLA 4OHJA 1LV9A 1FR3A 3E5SA 1KDBA 5LL6S 1Q1EA 1UNSA 4M8AA 4C1NI 1SNCA 1SYFA 3ND9A 5M5WB 3K57A 1F77A 2V4DA 4F87A 2H1EA 2L9HA 1Y69U 1L0YB 2A68D 1STGA 2BE5D 2RQXA 3VYSA 1TS3A 2AQ2B 1UUPA 3I90A 1SYDA 2BDOA 1EOTA 3URYA 4KJOA 3PMFA 2D2CC 4R9WA 2JA8B 3Q23A 1QE6A 1V43A 2ICIA 3FEWX 1SMYD 1CT1D 1K8OA 3H0GB 3S1QB 4RKBA 1YNJD 3M85A 2Z8LA 3M7GA 2WIIB 2LMCB 1RODA 2EYHA 4HMJA 4IUQA 5A35A 4L63B 4TQUS 5EJWA 1PTOF 2LY7A 1XX8A 4MN3A 2QDBA 1ZYRC 3M4OB 4KD3A 1F9PA 2K6AA 4C3JG 4WORA 1F2MA 4DAYA 3MHBA 1OXUA 5C0XI 2O4XA 1LTGD 2ZT9C 3QB3A 1RHPA 2XSCA 1V1OA 3Q24A 4KN7C 2PMZB 3FVQA 1D2BA 2VUMB 1GOZA 4CKCA 2F0WA 4IFDI 1FNUA 2AQ1B 2EPBA 4IZ8A 4KV6A 2R61A 4ZKBB 3E6ZX 4HN7A 1KABA 1HFNA 2AWNA 5IT9E 2RSNA 1DYQA 4P2CB 5LL6X 2EE1A 2M2LA 2SEBD 1GUSA 4DF7A 4KJNA 2XRSD 2L12A 2BOSA 4UAIA 5BN5A 1EIHA 5IGFA 1TS2A 1O80A 3N52A 3MXNA 3HOUB 1BO0A 3GTQB 3A54A 3BZDB 5JVH3 1U9RA 3F2UA 1A6XA 3DWPA 4PMBA 1B50A 5J1ZA 1PMRA 4XT1B 4B9WA 2F0SA 4RHSA 5CGKA 3HOXB 3M4YA 3WDNA 2RVLA 3GV3A 5EKLA 1WTVA 2QCPX 1S4ZA 3MTSA 3KLSA 3BVGA 3SXHA 2NVXB 4IN3A 1BDOA 1EY4A 3T4AC 4DU9A 2F0GA 1CZGA 1KLGD 1Y1WB 1CA6A 1OXVA 1PXUA 2BDNA 5CV7A 2WKCA 1O7LA 4IFDJ 5E4XA 2E76C 1ENAA 1YNND 2X69A 4LJZC 1AEXA 1C48A 4HCSA 3SE0A 3LWUA 1LTTD 4KN4C 4EGVA 2IPKD 3D4WA 3EFXD 3AMUA 1TWGB 1DJRD 4DN4M 4X3SA 3MEHA 3A7LA 4O1NA 1ML0D 5FOBB 3MXUA 4KKUA 5I4DA 3SK8A 1C8CA 3V96A 2B2YA 4I7ZC 5DEHA 2K7VA 2B2YC 4IURA 1H9RA 4ZUJA 2NN6I 4QIWB 4B08A 3K5LA 3IL8A 5C0XH 2NTTA 2YU9B 3GTJB 3ERQA 2XRQD 2NUCA 2XWJB 1VCIA 1Y8NB 1BR9A 2IL8A 4IUUA 3H94A 1X32A 3MFYA 4KMUC 2PYKA 3T16A 1PRTD 1F9RA 3BVZA 1EYDA 4FF2A 3J80E 3C1EA 1BCPD 2IJ0A 2KHSA 3GTOB 4FNFA 1TY0A 1PRTF 3KLSX 2D5DA 1W6KA 4V0BA 1AFPA 2JA6B 2JXMB 1EY0A 2QF7A 5FO9B 3TBIB 2MPMA 1MSHA 5C0XJ 5JJZA 4R8IA 1B4OA 4RGOS 4WJWA 3R3OA 2Z1CA 5TSSA 3SK5A 4Q5VA 4U68A 1CZWA 2J7ZA 2WINB 5KNBA 3QWNA 3L9AX 1U4MA 4AYBB 1II3A 4LMQD 4XQNA 2R7ZB 4BWGB 3BDOA 3OSOA 5M3FB 3OWFA 2EJFC 3TSSA 2WKDA 3WOEA 2WB1B 4OIJA 3NBHA 5IGGA 1JOQA 1HHVA 4CBVA 3K5OA 2E2HB 1I6VC 2L55A 1D5XC 2B2TA 2FMCA 4DFAA 2FFKB 1EZ6A 2X6GA 1TU2B 1J8IA 1B9NA 1HTLD 2A6ED 2O5IC 2JE6I 5E4WC 3DEPA 1PFNA 2SDFA 2PNRC 4DXFA 1HQMC 3V2TA 2G9DA 4RGMA 3L7ZC 4FF1A 5C0XG 1D1IA 1PZJD 2A5HA 4XYQA 2HQEA 2AUJD 1H9MA 4FYDA 4K2KA 1SNQA 2K5WA 1GUWA 2B2VA 3NBIA 5CV5A 1PTOH 1SDFA 1XYIA 1R9TB 1PDQA 1LTID 1H9SA 2F3VA 3P20A 1T5XD 1S5FD 2ENBA 3GTKB 1FYCA 4XT3B 2EYJA 4KHVA 4RCNA 4QMGA 3RD4A 5ISRA 4X3TA 4IUNA 4XXEA 3H91A 2EYOA 2F0QA 2KVMA 3OMCA 5ELEA 1OXSC 3NTHA 2JYOA 2DY7A 3VYRA 2FJ2A 1ICWA 2NB0A 4A3EB 5BN4A 4X3UA 4ID6A 4K8JA 1JICA 5I6YA 1I4PA 4ULLA 1Y8OB 2E75C 1O7YA 5KRUA 3K0YA 3C1FA 5JVG3 1GUOA 1PTOC 2HUGA 5CV9A 3C2PA 3PO2B 4Y7NB 1GXDC 3DXJC 1V8QA 2Z4HA 5M5XB 3D31A 1U4PA 4KTAA 5COYA 1E2WA 5C4JB 3TP7A 3RZDB 4N9TA 3X3NA 3K58A 1LTRD 1TY2A 2NN6G 3I3CA 4IFDH 4MHEA 1S5BD 3CRLC 5FO8B 1H9SB 3Q0AA 3FPPA 2K5DA 2RBMA 1JWUD 3AU7A 2J0TD 4L6TB 3A8KE 1BOSA 3KF8A 4XDXA 3JAML 1VMPA 2KUMA 2KECA 4C2MB 1J9OA 4RGTA 2KA7A 3TP8A 1B44D 1C4QA 2GA4B 2DY8A 2ICEC 4A3IB 5D14A 4RAUC 1TT2A 1LT5D 4FXGC 1BXTA 3U9SA 2RDGA 2EDGA 1A3VA 3NK9A 1UAPA 3KUPA 5CBAE 2WV6D 1HUMA 3GQBA 5KIXA 4GZYC 1STYA 4U673 3VYUA 1G8ZD 1EY7A 1OO9B 3S9WA 2ZXPA 1U4RA 4WRDA 2EYPA 3CKIB 3NTKA 1LTBD 1YNJC 1IW7C 1Q3LA 2K01A 2ZXOA 3MFGA 3I4MB 2E2IB 3I8ZA 4JBWA 4UDUC 1BBXC 3TP6A 3HOVB 5I9PA 3CQZB 2F0OA 4K5XA 4KD4A 3T51B 1I4QA 2PZUA 1TWHB 1LTAD 3FMCA 4DK0A 3QJYA 4DK1A 3S17B 1IKMA 3DHQA 1FNWA 1AZPA 2B8GA 5IGCA 1AN8A 1L0XB 1Z47A 3DM1A 1QB5D 1BQQT 2A6HD 4ZQ3A 2JEAI 1WTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y W;  4V19 0; 
#chains in the Genus database with same CATH topology
 4YCV A;  4KKS A;  2F1M A;  5C4H A;  3M4P A;  1MBY A;  2F0L A;  1PYS B;  2UUC L;  1ILQ A;  5EKK A;  2B2U C;  2B2U A;  1LM0 A;  2AKW B;  4JVZ A;  1D5Z C;  2P5Z X;  4RHR A;  3HOZ H;  2VQE L;  4FP5 D;  1L1O B;  5KYI A;  3RZD H;  1TS5 A;  1JWM D;  1GM5 A;  4X65 Q;  1IL8 A;  3ND8 A;  3SK6 A;  3I72 A;  4PQX A;  3W3A A;  4A3B B;  5CV8 A;  3S1M B;  4UY8 C;  1NNX A;  3PIO 3;  1I4G A;  4BXX G;  2L11 A;  1KNA A;  4DR2 L;  5M3F H;  1LT4 D;  3A74 A;  1JE4 A;  1HZC A;  1NTG A;  2F0F A;  4JC0 A;  4C3I B;  3DWA A;  1K3B C;  4ZRZ A;  1EZ8 A;  5DAU A;  4XTC S;  4CJ1 B;  4RMF A;  1SYG A;  4JI7 Q;  4DV5 Q;  2RCN A;  5L37 A;  1T5E A;  1AZQ A;  1XPU A;  1L1O C;  3BG3 A;  5D65 A;  3GD7 A;  5CV4 A;  1GKH A;  5JEA G;  3J7Z C;  3M3Y B;  3P75 A;  1VQM A;  5GAG C;  1L0W A;  2K5V A;  4I7A A;  1K8M A;  4TVA B;  1F9S A;  1TVX A;  2KBN A;  3S16 B;  4A3D G;  1I4R A;  3LGJ A;  3T1Y Q;  5J3B A;  1J5E L;  2M00 A;  1S3O A;  2B39 A;  3J80 i;  3TRE A;  4DKA C;  4TKO B;  3CCS A;  1JOK A;  1SJE D;  3EQL C;  1SYB A;  2KCN A;  5KNC A;  2CVR A;  4AIM A;  1HR0 Q;  4A93 G;  1JJG A;  1E2Z A;  1N9W A;  1LTL A;  2DUD A;  3G71 A;  3K6O A;  2RKS A;  5CBE E;  2ZTD A;  1UEB A;  1EIG A;  4N8F A;  1X6O A;  2NWG A;  3RNU A;  3MXN B;  3FP9 A;  3QIA A;  1KAA A;  3S14 B;  1EYA A;  3CCJ A;  5HUR A;  1F9Q A;  1F2Z A;  1S72 A;  2RSO A;  4QB4 A;  3T13 A;  1XPR A;  2A6E C;  3UI2 A;  3H6M A;  1CQF A;  1N33 Q;  1WTR A;  3HKZ G;  4R4T A;  3GTG H;  2A6H C;  4K6D A;  1FVI A;  5LMN Q;  3G4S A;  4NB3 A;  4ME3 A;  3J81 L;  2F52 A;  2E5L Q;  1UEA B;  3TS2 A;  1PH2 A;  4LF9 L;  1UE5 A;  1ZXT A;  3EVQ A;  4KK7 A;  4BBR B;  5IYC H;  3OW2 A;  4EX5 A;  1HA6 A;  1X65 A;  5FLX E;  1SNM A;  3KDF B;  4A3D H;  2IX3 A;  4JI8 Q;  1WTX A;  3KDF A;  5IYB G;  4GNX B;  1UWV A;  1WD1 A;  4ZAI A;  4OEL B;  4B3R L;  1NAP A;  5IGE A;  3HG9 A;  2NN6 H;  2VL6 A;  1CI3 M;  1PFS A;  3TEH B;  1WTQ A;  3PO2 G;  1NSN S;  3E9H A;  4DNT B;  2PZT A;  1WD0 A;  1PZI D;  3KK7 A;  4IJH A;  1TWA H;  3BVM A;  1K0S A;  2NZH A;  3KJO A;  1IBL Q;  3QO2 A;  1S5E D;  1JC7 A;  1TWF B;  1EUJ A;  3PF4 A;  4O42 A;  2DGY A;  4PV1 C;  5G3L D;  3PUX A;  2R3Z A;  2K03 A;  4TRD A;  2Q2I A;  1JQY D;  3QG1 A;  2F4I A;  4L8J A;  1NE3 A;  3OHX C;  1HNZ Q;  3RUZ A;  1HCZ A;  3I4O A;  1I50 B;  3K5M A;  3JAM E;  3MVV A;  4R4I A;  3TS0 A;  3M7N A;  1TWC B;  3U58 A;  1W3S A;  1EIF A;  3BS1 A;  1XJV A;  2UUA L;  5D3I B;  2EVB A;  2A69 C;  5EAY A;  3CCM A;  3TP5 A;  1HNW L;  1STA A;  2B2V C;  4CKB A;  4GKJ Q;  1D7Q A;  5EGT A;  1MJE A;  2AUK A;  2HHH Q;  1D6E C;  2R93 B;  1R4Q B;  3SHL A;  2NVQ H;  4PZ8 A;  2CW0 C;  5FLX L;  4K0K Q;  3AYH B;  4LW1 A;  1CKN B;  2BCO A;  5C3E B;  2K28 A;  1F2L A;  2R93 G;  2VS1 A;  3SEB A;  2AWO A;  1D5M C;  4B9X A;  1YBY A;  3MAQ A;  5JEA J;  4LF4 Q;  1FNV A;  2Q2T A;  5E7N A;  3NTI A;  5IT9 L;  2NZ1 D;  3QOL A;  4R4C A;  3U4V A;  2TSS A;  3CW2 C;  1K3R A;  4IUP A;  1XMQ L;  2EYF A;  5DLQ E;  5M5Y B;  3NXW A;  1SNO A;  4LUV A;  2F3I A;  4UPA A;  4YCU A;  4KI0 A;  4G7O C;  1GUT A;  1WOC A;  2D0O A;  3A5Z B;  3S15 H;  1KDC A;  2TMP A;  1PH7 A;  1DM0 B;  1QNK A;  4B3S Q;  1Q90 A;  1TKW B;  4DR1 Q;  2CW0 D;  5FK9 C;  2X6L A;  1XMO Q;  4CJ2 C;  1ZKO A;  2F0M A;  2IHE A;  5T1G A;  1Z9F A;  4K6L A;  1E2V A;  2PW7 A;  3VR2 A;  2JA5 H;  3E0J A;  4HJ9 A;  5CMD A;  5IT9 c;  1HFG A;  3S2D H;  1JJC B;  1AP0 A;  1TWA B;  1BF4 A;  4AQY L;  5AFW A;  1CHQ D;  2IX1 A;  3K81 C;  2IX0 A;  1GVP A;  4KHZ A;  1EY5 A;  3A7A B;  1FD7 D;  1SXT A;  4CDF C;  4ZK9 B;  4X64 L;  2B63 B;  2VUM H;  1G2T A;  2FIN B;  5KYL A;  1CHP D;  2OF1 A;  2PQA A;  5IYB H;  4A3F B;  5FLX c;  2QW7 A;  2EJG C;  3F2C A;  2K5Q A;  3IRB A;  3IKJ A;  1PLF A;  2YTY A;  1EYC A;  2ASB A;  3HOX H;  3P1H A;  4MTK A;  1ONL A;  2KCM A;  1PYB A;  1VQ4 A;  1SN8 A;  4FXD A;  1HUN A;  3SDZ A;  4QUC A;  3ICE A;  5IOD A;  3NWT A;  1EEI D;  2NTS A;  3GP7 A;  1SE8 A;  4CHT B;  3U50 C;  2EQS A;  4IAL A;  5DNF A;  2DNE A;  3M9B A;  3ONA B;  1HNZ L;  1KRS A;  1Z6H A;  1CA5 A;  3J81 j;  1JR0 D;  4X62 L;  4B3T L;  2ALY B;  4Z9C B;  3J7A F;  4LK1 C;  2UUB Q;  2AQ3 B;  3S2H B;  3HEJ A;  4J6H A;  3T56 B;  2D62 A;  5CC4 A;  1Q8I A;  1V1P B;  2EZV A;  1VQ9 A;  1G51 A;  3BZK A;  4JI5 L;  3DWQ A;  2R92 G;  2A73 B;  3GTL H;  2JA8 H;  2YYZ A;  4BA2 I;  5C4X B;  4P74 A;  4NXM L;  1DCZ A;  1MHW C;  4JK1 C;  4F88 A;  5M9O A;  3K7A B;  3CME A;  1ESF A;  1RF2 D;  2EJM A;  1M90 C;  4AH6 A;  3CU7 A;  2O5J C;  3I56 A;  2BA0 A;  3UDG A;  4NW2 A;  3MZ5 A;  1XNR L;  3MC0 B;  4EQO A;  2N55 A;  4A3M G;  3ER0 A;  5C4X H;  5M5W H;  4A3D B;  2QKI C;  4NPS A;  2IWH A;  2EYM A;  1H9J A;  2EYL A;  4XIG S;  1I3Q B;  4A4I A;  5C5L A;  4A3M B;  2UU9 L;  1ESR A;  1NCV A;  3UDF A;  3PGZ A;  2UUB L;  4A3K B;  2QIL A;  2EY2 A;  4BBS H;  1X3F A;  1X56 A;  2B8F A;  2F0H A;  1YI2 A;  1HZA A;  1EFI D;  3I2Z A;  4DR5 Q;  1TS4 A;  3QOJ A;  2Z6K A;  3HP3 A;  3MWY W;  1A2T A;  1RTN A;  4AYB E;  3CC7 A;  3ZYY X;  5CYU A;  1FL0 A;  1QCB D;  3C46 A;  2BH2 A;  3ULL A;  3PCO B;  3EN2 A;  3S14 H;  1JB7 A;  2DJG C;  5C44 B;  1DOK A;  2E2J H;  1JOO A;  1QOH A;  5ELC A;  1S40 A;  1TWC H;  4I65 A;  3IFT A;  3PUW A;  4RGN A;  3NEN A;  1VDZ A;  2QEJ C;  3TZD A;  4LF8 Q;  4JBJ A;  4KY5 A;  3J80 c;  5M3M G;  5ELD A;  4DV2 L;  3T1H L;  1KIX A;  2PQE A;  1OXX K;  5FKA C;  3TDQ A;  3GDE A;  2SNM A;  5F2D A;  2LKV A;  1SMY C;  4J8Q A;  2D9U A;  5HY6 A;  1YNX A;  1JE5 A;  3H15 A;  2KHI A;  1STE A;  1TII D;  4TSS A;  4C3H H;  3ERS X;  2L0C A;  4JW0 A;  3AFQ A;  1WTP A;  4LF7 L;  1I94 L;  1DOL A;  1EIY B;  1I4H A;  2K14 A;  4ABN A;  4PZ6 A;  2CQO A;  3PUZ A;  4HIM A;  2Q2U A;  1DON A;  3KBX A;  3STB D;  4JI5 Q;  1PYW D;  2L1B A;  4DUY Q;  4LAA A;  1I4X A;  3DEO A;  1DD2 A;  2F0N A;  1QIL A;  2C5C A;  1KD1 C;  2I5M X;  1GO3 E;  2RHQ B;  4K0K L;  3D3R A;  2UXC Q;  3R2I A;  3KF6 B;  2DN8 A;  3J7Y W;  3HOU H;  1QJO A;  2NVT B;  3SVM A;  3HOV G;  1CSP A;  3I91 A;  2E74 C;  1HQR D;  1T9H A;  1BUV T;  3K5N A;  4YHH Q;  1TQO A;  5C3W A;  4C2M H;  1SE4 A;  4DPG A;  1IBL L;  1WCM H;  3VR6 A;  5DM6 3;  2I46 A;  2IW3 A;  4RH6 A;  1EQT A;  5FJ8 H;  4DV3 L;  3I73 A;  2VXW A;  1XXG A;  1HR0 W;  2RA4 A;  4FXK C;  1QG7 A;  3OIQ A;  4DV6 L;  2LSS A;  2R92 B;  3VA7 A;  1NMF A;  5HGQ A;  1E22 A;  3A8J E;  2K04 A;  2BA1 A;  1IZ6 A;  2IT1 A;  1LAC A;  3HS0 C;  3I70 A;  5ELF A;  2F0E A;  2EY5 A;  3ITP A;  3BJU A;  3HOV H;  4H02 A;  3M4Q A;  2ZTE A;  5E3F A;  1N34 Q;  4A76 A;  3FKI H;  3NEL A;  4DR2 Q;  2MO1 A;  4Y52 H;  4JI8 L;  1IYU A;  2B2W C;  1I94 Q;  2B2W A;  4B3R Q;  5J22 A;  2EXD A;  4DV4 Q;  4K2L A;  4HMI A;  2KOL A;  2E2D C;  4K14 A;  1PZK D;  5IYC G;  2KHJ A;  4YCW A;  1XNQ L;  4PMW A;  3CQZ H;  1JCK B;  1SBB B;  3OOC A;  4LF6 L;  3O13 A;  3I55 A;  5EBD A;  3VR3 A;  3SR1 A;  1KC8 C;  3A5U A;  4A3B G;  3MEF A;  3TRZ A;  4R1J A;  3PSI A;  4DNR B;  1VQP A;  1NJI C;  1E24 A;  3CHB D;  1R9T H;  1A3T A;  3D6W A;  2N49 A;  1X55 A;  2F03 A;  1PTO B;  3G6J B;  3L0O A;  3DUZ A;  2EY6 A;  3CCR A;  1I6H B;  1Y1W G;  3NPP A;  1KRT A;  3JC6 6;  4X6A H;  4C56 C;  3R93 A;  4LF5 L;  3PV0 A;  1G2S A;  4S3S A;  2A69 D;  3JAM i;  1HNX Q;  1ICF B;  3BYT B;  1EQQ A;  3LWE A;  3F2D A;  2A68 C;  1R4P B;  3HOZ B;  4JV5 Q;  3QR8 A;  2BE5 C;  4BS9 A;  1SE2 A;  4FO2 A;  5I2Y A;  1X54 A;  2JSO A;  4F7X A;  3HOW H;  1SND A;  4LFB Q;  4YIJ A;  1I3Q H;  1UE1 A;  3TZU A;  3NQI A;  4QGU A;  1KTK A;  1DXM A;  5IIF A;  2I0Q A;  3OYY A;  1D8L A;  1BVS A;  3PUV A;  4H0L C;  3J80 L;  1B2T A;  2KCC A;  1HRJ A;  4AQY Q;  1GHJ A;  1V9P A;  1SNP A;  2PMZ E;  2HCI A;  4MNO A;  4GN3 B;  3AB9 A;  1ZYR D;  4DV6 Q;  1NBW A;  2R93 H;  3Q6S A;  2ID0 A;  3S1N B;  2WAQ B;  3GTM B;  1IW7 D;  1CM9 A;  1KDA A;  1DOM A;  1TWH H;  2PPB C;  2CH4 W;  4DAP A;  4HSP A;  1VQL A;  1EWH A;  4GNX A;  1SRO A;  4NDX A;  1ENC A;  2PO4 A;  3D0F A;  1PA6 A;  4OO1 I;  1EY8 A;  4PMC A;  1AW7 A;  3CMA A;  2FMM A;  1EWC A;  4OGQ C;  4A93 B;  1HJP A;  5GRO A;  5LHY 1;  5KND A;  4L5R C;  1RJT A;  4WJ4 A;  3ULP A;  1LTS D;  2XVS A;  1ASY A;  4DR4 Q;  2JA7 B;  4IFD G;  4R4Q A;  3C3L A;  3GTL B;  4C3I H;  2OTL A;  3OMG A;  1LO5 D;  2IHF A;  4A75 A;  1K8A C;  2HT1 A;  2F0I A;  4OX9 Q;  1VQC A;  3CRK C;  3GO5 A;  2F0D A;  4V19 0;  4G4K A;  3FDT A;  2KQ3 A;  3L2P A;  2VQF L;  1MD2 D;  5KEE A;  1VF7 A;  2F0U A;  4X65 L;  2NVX H;  3ULJ A;  4JBK A;  1Q12 A;  2JA6 H;  5CR3 A;  2QA4 A;  3T53 B;  5JPM C;  4A3L H;  3VR5 A;  1ET9 A;  1MSG A;  3L3O C;  3G7L A;  3SGI A;  1E0B A;  4LFA Q;  2CWP A;  5HGT A;  2D0P A;  3FRP B;  5EQ0 A;  4OWW B;  4C3I G;  5ELB A;  3H3V I;  2L4N A;  5IOC A;  1M8A A;  1IYV A;  1G6Z A;  1PH3 A;  2YV5 A;  2K5N A;  1BCP C;  4A3K H;  3S15 B;  2PI2 A;  4LF7 Q;  3OPO A;  2L5T A;  1VQA A;  1EU3 A;  2FHT A;  5IGD A;  4EVO A;  4JI0 L;  4DXG A;  3A56 A;  3WWV A;  1K83 B;  4WFN 3;  2HD3 A;  5EPJ A;  5IP7 H;  5M3M H;  4JI6 L;  1MI2 A;  4GKK L;  5T1I A;  4A3C G;  2MUY A;  3MXP A;  1BNZ A;  2JEB I;  1RL2 A;  2Q8T A;  4LNQ A;  1YVC A;  1MGS A;  2EOT A;  3GTG B;  3V05 A;  1PH8 A;  1Z7T A;  2MHV A;  2VB2 X;  5FO7 B;  4LF8 L;  1EQV A;  1CQV A;  4BBS B;  5AJ3 Q;  1QNU A;  2QEX A;  1RTO A;  4J1M A;  4JI3 Q;  1A2U A;  1EU4 A;  2B29 A;  1BCP B;  2MGS A;  3X3M A;  4CGY B;  2F3W A;  5IWA L;  3HRZ C;  2R92 H;  5DM7 3;  1ASZ A;  5G3L F;  1D1K A;  1LLR D;  2PZW A;  4GNX C;  4IOA A;  4RA8 A;  4BBS G;  3GTJ H;  3NSW A;  3VA5 A;  3KLR A;  1G91 A;  2RF4 A;  4RCO A;  4R4O A;  1STB A;  4BA1 I;  4IPD A;  4HIO A;  2G9H D;  2JA8 G;  3RN5 A;  1SFO B;  5C3E H;  2HCC A;  4EQN A;  5E1F A;  1KNE A;  2SNS A;  4RKL A;  1YJN A;  2J4X A;  4P71 A;  3BDC A;  1M1K C;  2Q8R E;  3MA2 B;  2MP1 A;  2N88 A;  4ZYS A;  3OWE B;  1BKB A;  2NBF A;  4ZKC B;  3NE5 B;  3LNN A;  4HAE A;  4DAM A;  4BBR G;  5IE8 A;  1O7Z A;  4DV2 Q;  3T1H Q;  4PG3 A;  1Q81 C;  5M3F G;  3KLW A;  3NP8 A;  3R2T A;  2VZA A;  1PHJ A;  2KEE A;  4K5W A;  3Q22 A;  3F8T A;  3HOW B;  1B70 B;  4RWS C;  1Q7Y C;  1X3P A;  1X3G A;  4G7H C;  3CCE A;  1ENF A;  4A3G B;  1N8R C;  1E1O A;  4FVM A;  4KHP Q;  2NVY B;  2H5X A;  1U4L A;  4YWL A;  5C3X A;  1NR4 A;  2UUC Q;  3HGB A;  4ME5 A;  1XNQ Q;  3FHW A;  1NUC A;  4QUF A;  5EBC A;  3VR4 A;  2WAC A;  4FF3 A;  4CKE A;  1SE3 A;  3KBG A;  4QF4 A;  4JI1 L;  4C3H G;  2K50 A;  4KLK A;  1IBM L;  2YTV A;  5BR8 Q;  4DUZ Q;  1HA5 A;  2KJX A;  4JI2 L;  2JA7 G;  2F0T A;  2OXP A;  4DR7 L;  3H3V H;  1ZEQ X;  2C9O A;  2RDF A;  1AE3 A;  1CSQ A;  3FPU B;  5BR8 L;  4QL5 A;  1P16 A;  2XNA C;  3W1G A;  3RZO H;  1PVO A;  3J81 i;  4IUV A;  2K32 A;  1TWF H;  3EJI A;  5C4X G;  1P8L A;  1PH6 A;  3RLN A;  1GUN A;  3PIP 3;  2VQE Q;  2NYZ D;  1S5D D;  1B1Z A;  2VW9 A;  4A3I G;  3N6R A;  2CKZ B;  3CXC A;  1YZ6 A;  5M5Y H;  1EY9 A;  5KGU A;  3S2D B;  4M1U B;  2Z4I A;  2DNC A;  5ELO A;  4IPC A;  5A2Q L;  2F0K A;  1PH5 A;  4RFB A;  2PQA B;  3K8A A;  2K75 A;  5I9O A;  4HR7 B;  3A0J A;  1PRT B;  3I4L A;  4NMZ A;  4HSV A;  3D4D A;  3FKI B;  4IO9 A;  2OTJ A;  1E3P A;  2N3S A;  1PRT C;  4GN5 A;  1RKN A;  5GAE C;  1Q86 C;  4GLX A;  3NQT A;  2HDM A;  3D6C A;  4O2D A;  1LAB A;  1LT3 D;  4CDC C;  2ZM6 L;  4OO1 H;  2NVQ B;  1VQN A;  5EKI A;  3J81 c;  4DAV A;  2A1A A;  5COR A;  4JI2 Q;  4JBM A;  2K05 A;  3GTP B;  1TR5 A;  2ZXR A;  1STH A;  4YHH L;  2LS0 1;  1VMC A;  1EOV A;  1WVL A;  3J7A V;  3PO3 H;  5JAV A;  5H1S E;  3PO3 B;  1I6H H;  4F8M A;  1GJX A;  1CTM A;  3OW7 A;  4MTN A;  3D4R A;  4QIW E;  5I2X A;  3HOU G;  1K73 C;  3A55 A;  5EPK A;  1S5C D;  1C9O A;  3FKI G;  3A8I E;  3E9I A;  3SK4 A;  3PUY A;  5JEA H;  1QUQ A;  4NP5 A;  4EQP A;  1XTC D;  4PNY A;  4DGZ A;  4OO1 G;  2MQH A;  2UU9 Q;  1XWE A;  1VF5 C;  2VY3 A;  1RD9 D;  3RLF A;  5C5M A;  5IGB A;  3I4M H;  3CCL A;  4C1N K;  2ATW A;  3VYT A;  3NUC A;  1ET6 A;  3RLO A;  1EY6 A;  4A3J B;  5JPN C;  4HCE A;  4Y7N H;  3S1R B;  4K8I A;  2F0V A;  1STN A;  1HXY D;  4HTH A;  2Q8I B;  4KKT A;  1SYE A;  4Q0F A;  5AJ3 L;  5LMU Q;  1EL0 A;  2XN9 C;  1A0I A;  4N9P A;  4A3B H;  2MJ8 A;  2OT2 A;  2H4O A;  5ELN A;  4DV4 L;  5IP9 H;  3H3V C;  3BYY B;  1HZ9 A;  4GN4 B;  1SR3 A;  1W6J A;  4LF6 Q;  4H44 C;  2XIW A;  1TXY A;  4C3H B;  1N36 Q;  1BBW A;  1B9M A;  5C6A A;  3R8B A;  2O2L D;  1Q8K A;  4NKL A;  4XQQ A;  2LFN A;  2KED A;  3I4N B;  1MJC A;  1SSO A;  3H09 A;  3TQY A;  1HH2 P;  2SOB A;  4OL7 A;  3M3Y H;  2F0J A;  1YNN C;  2CFM A;  4JCV E;  3TME A;  4A3J G;  2YU9 H;  5GQO A;  1IHZ A;  4FF4 A;  3OIP A;  1CFM A;  5K5P A;  2NVY H;  4IJL A;  2JJQ A;  2XWB B;  5A2Q E;  1Q1B A;  5FJ8 G;  3GV6 A;  5NUC A;  4GKJ L;  3DMU A;  1LT6 D;  1H9K A;  3KYH C;  1M4V A;  3LX0 A;  2K33 A;  4XQJ A;  4IQZ A;  2E2J B;  2JP1 A;  1L2F A;  3S17 H;  2K1B A;  3WOF A;  4C3J B;  1X3Q A;  2OWO A;  2EXZ A;  4DR4 L;  4K5V A;  2UXD Q;  4IUT A;  4X62 Q;  4JI7 L;  3KF6 A;  4B3M L;  1B3A A;  1JB3 A;  2GN5 A;  1YHB A;  3S1M H;  4IPG A;  2Y0S E;  1YHQ A;  1YHA A;  1KLU D;  3W2D A;  1KQS A;  3IFD A;  3CCV A;  1VQ8 A;  4DAY B;  2CHB D;  4GLA C;  1WCM B;  1V1P A;  4H13 C;  4KY7 A;  1SAP A;  3RZO B;  3BDL A;  1HPC A;  1VQG A;  1BCP F;  1WI5 A;  3EIV A;  4L5S A;  1A62 A;  3MXG A;  1RDP D;  5EPL A;  1KAW A;  2Z6B A;  4KY6 A;  5M3M B;  2I07 B;  4DR3 L;  1B8A A;  4HJA A;  1JWS D;  3P7J A;  1GHK A;  1GUG A;  1SYC A;  3HZX A;  4MIU A;  2OEO A;  3STB C;  4BY1 B;  1PFB A;  4XYO A;  1SMX A;  4QCL A;  5BN3 A;  1ILP A;  4A3C H;  1QVG A;  4ODG A;  4R8N A;  2PW5 A;  3K59 A;  4DA2 A;  4H7B A;  5D3D A;  1SJH D;  1PFM A;  4P72 A;  1N32 L;  4WJ3 M;  3UE0 A;  4JOI C;  4OWT B;  1JT8 A;  2RHS B;  1EEF D;  2B2T C;  1WTH A;  1RCV D;  5K36 H;  4A3E G;  4BY7 B;  2VB3 X;  1NR2 A;  1N33 L;  2HDL A;  3UDI A;  4N8X 1;  2RDH A;  3PQI A;  4G57 A;  3RMH A;  3NHH A;  4LF9 Q;  1PTO D;  2LXJ A;  2OQ0 A;  1IBK Q;  5J39 A;  3EA6 A;  1G29 1;  2JA5 B;  4A3L G;  4JI4 Q;  4G7Z C;  3ERO A;  1IL2 A;  1CK1 A;  1VQJ A;  4POG A;  1JOR A;  1SEB D;  1A3U A;  5I6W A;  1EFW A;  3HKZ B;  1F2Y A;  1IBK L;  4P75 A;  4ZUI A;  3D8G A;  3UE1 A;  4A3G H;  2C35 B;  2A74 C;  2PCF B;  1O78 A;  1Q82 C;  3NWS A;  4UHV A;  1DZ1 A;  5K36 G;  2CQA A;  2Y0S G;  2Z0S A;  4ILW A;  1VS0 A;  2MNA A;  1FGB D;  3HOW G;  1B53 A;  5FLM G;  4E6I A;  2K5H A;  1HTP A;  1W2B A;  4OIK A;  2VNU D;  2JN4 A;  3HOY B;  1A15 A;  2HIV A;  2K52 A;  2Y0S B;  3U9O A;  1Y1V B;  3IAY A;  4X3K A;  4UP8 A;  1WTW A;  1PH9 A;  2M9V A;  5C4Z A;  4ZLT F;  5JOB A;  3GTK H;  3J81 E;  4HED A;  5CV6 A;  4X66 Q;  2WP8 J;  1QWY A;  3TN2 A;  4A93 H;  2F0P A;  1Y8P B;  1Y1V G;  2HHH L;  2R6G A;  5LMN W;  2EY1 A;  1OXT A;  4A3K G;  3Q8D A;  4A3G G;  4CJ0 B;  4GKK Q;  1IKL A;  4OHJ A;  1LV9 A;  1FR3 A;  3E5S A;  1KDB A;  5LL6 S;  1Q1E A;  4DV7 L;  3HOY H;  5FLM H;  3OTO L;  1UNS A;  4LUO A;  4M8A A;  4C1N I;  1SNC A;  1SYF A;  4DNI A;  3ND9 A;  3U4Z A;  5M5W B;  2OQK A;  3K57 A;  1F77 A;  2V4D A;  4F87 A;  2H1E A;  2KEN A;  2L9H A;  4FDB A;  4DK3 C;  1Y69 U;  1L0Y B;  2A68 D;  1XMQ Q;  1STG A;  3DM3 A;  1YJ9 A;  2BE5 D;  2RQX A;  1G6P A;  3VYS A;  1TS3 A;  2AQ2 B;  1UUP A;  3RN2 A;  3I90 A;  1SYD A;  2BDO A;  1EOT A;  4MZ9 A;  3URY A;  4KJO A;  2YTX A;  1A8V A;  3PMF A;  2D2C C;  4R9W A;  2JA8 B;  4YY3 L;  3Q23 A;  3F2B A;  4B3T Q;  1QE6 A;  1V43 A;  2ICI A;  3FEW X;  4CDE C;  2EIF A;  4EQ5 A;  2R7F A;  1SMY D;  1CT1 D;  4OXP A;  1K8O A;  3H0G B;  3S1Q B;  4KHP L;  1VQ7 A;  4RKB A;  1YNJ D;  5JJK A;  4PZ7 A;  4UP7 A;  4HIK A;  3M85 A;  2Z8L A;  3M7G A;  2WII B;  2LMC B;  1ROD A;  2EYH A;  4HMJ A;  4IUQ A;  1IBM Q;  4AYB G;  2XTI A;  5A35 A;  4L63 B;  2A19 A;  4DR7 Q;  4TQU S;  5EJW A;  2UXC L;  1E7Z A;  1PTO F;  2LY7 A;  1QUQ B;  1XX8 A;  2QDB A;  3K7U C;  4MN3 A;  1ZYR C;  3M4O B;  4KD3 A;  1SRU A;  5C44 G;  1F9P A;  2K6A A;  2UXB Q;  4BY7 G;  4WOR A;  4C3J G;  1F2M A;  1YEZ A;  4DAY A;  3MHB A;  1OXU A;  5C0X I;  2O4X A;  2JA6 G;  1MIU A;  1LTG D;  2ZT9 C;  2RCF A;  4A3F G;  3QB3 A;  1RHP A;  1FJG L;  2XSC A;  1V1O A;  4BY1 G;  3Q24 A;  1V1Q A;  4L5T A;  4KN7 C;  2PMZ B;  3FVQ A;  1D2B A;  2VUM B;  4JI6 Q;  4BXX H;  2N78 A;  1GOZ A;  4CKC A;  3CF5 A;  1QZG A;  2HQL A;  2F0W A;  3S1N H;  4DV0 Q;  4IFD I;  1FNU A;  2E5L L;  2WAQ G;  2AQ1 B;  2EPB A;  4IZ8 A;  2MFI A;  4KV6 A;  1AH9 A;  4YWK A;  3GTO H;  4HJ5 A;  1WCM G;  2R61 A;  4ZKB B;  1XPO A;  1KL9 A;  2NZO A;  2UXB L;  3E6Z X;  3PIO A;  4HN7 A;  1KAB A;  1HFN A;  2F4V L;  2AWN A;  5IT9 E;  2RSN A;  1I5F A;  2CWA A;  1N32 Q;  3GTM H;  1DYQ A;  2E8G A;  4P2C B;  3JAM c;  4POF A;  5LL6 X;  2EE1 A;  2M2L A;  2SEB D;  3AEV A;  1GUS A;  4DF7 A;  2CH4 A;  4KJN A;  2XRS D;  2L12 A;  2BOS A;  4UAI A;  5IYD H;  1AE2 A;  5BN5 A;  3DLL A;  1EIH A;  4QJF A;  3F1Z A;  3HKZ E;  5IGF A;  1TS2 A;  1O80 A;  3N52 A;  3MXN A;  3HOU B;  1U0L A;  1BO0 A;  3GTQ B;  2L15 A;  3A54 A;  3BZD B;  5JVH 3;  1U9R A;  3F2U A;  1A6X A;  1WYD A;  3DWP A;  4PMB A;  3S16 H;  1B50 A;  5J1Z A;  3PO3 G;  1PH4 A;  2ZJQ A;  1PMR A;  1MKH A;  4JOI A;  1I50 H;  2BH8 A;  4XT1 B;  4B9W A;  1IXR A;  1EYG A;  2F0S A;  4RHS A;  2GVA A;  5CGK A;  3HOX B;  3M4Y A;  4DUY L;  3WDN A;  5JJL A;  2RVL A;  3GV3 A;  5EKL A;  4LFC Q;  1WTV A;  2QCP X;  1S4Z A;  3MTS A;  1VQB A;  3KLS A;  4GS3 A;  3HOX G;  3BVG A;  3SXH A;  2A8V A;  2Z6K C;  2NVX B;  2ES2 A;  4IN3 A;  1VQD A;  1BDO A;  1EY4 A;  3T4A C;  4DU9 A;  2B63 G;  2F0G A;  1CZG A;  1KLG D;  4A3I H;  1Y1W B;  1CA6 A;  1OXV A;  1PXU A;  1A63 A;  2BDN A;  4ZCK A;  5CV7 A;  5IP9 G;  2WKC A;  1O7L A;  4IFD J;  4JI1 Q;  5E4X A;  2E76 C;  1ENA A;  3OTO Q;  1YNN D;  2X69 A;  4LJZ C;  1AEX A;  1C48 A;  4HCS A;  3SE0 A;  3LWU A;  4B3M Q;  1LTT D;  4KN4 C;  4EGV A;  2IPK D;  3D4W A;  1O7I A;  3CC4 A;  3EFX D;  5LMU L;  4BY1 H;  1CKM A;  2NVT H;  4GOP C;  3AMU A;  1XMO L;  1TWG B;  1DJR D;  4DN4 M;  4X3S A;  3MEH A;  4B3S L;  3A7L A;  4O1N A;  2AMC B;  4BBR H;  1ML0 D;  5FOB B;  1EQR A;  1LUZ A;  4A3J H;  3MXU A;  4KKU A;  4OON A;  5I4D A;  4JI3 L;  3SK8 A;  1C8C A;  3V96 A;  2B2Y A;  4IOC A;  4I7Z C;  3CPF A;  4L5Q A;  2K7V A;  5DEH A;  2B2Y C;  4IUR A;  1H9R A;  1UE7 A;  2NN6 I;  4ZUJ A;  4QIW B;  1VQ6 A;  1N36 L;  4B08 A;  3K5L A;  3IL8 A;  5C0X H;  3K7A H;  2E2I H;  4X64 Q;  2NTT A;  2YU9 B;  3GTJ B;  1Q46 A;  3ERQ A;  2XRQ D;  2NUC A;  4A3M H;  1CKN A;  2XWJ B;  1VCI A;  4GOP B;  4JV5 L;  1Y8N B;  1BR9 A;  2IL8 A;  4IUU A;  3H94 A;  4DR1 L;  3GTP H;  1X32 A;  3MFY A;  4KMU C;  2PYK A;  3PF5 A;  3T16 A;  1PRT D;  4QQB X;  1F9R A;  3BVZ A;  1EYD A;  3KJP A;  4FF2 A;  3J80 E;  3ZJY C;  3C1E A;  4O0A A;  1BCP D;  2IJ0 A;  2KHS A;  2LXK A;  3GTO B;  4HJ7 A;  4FNF A;  1TY0 A;  1PRT F;  3KLS X;  4A3E H;  2D5D A;  1W6K A;  5GAH C;  4V0B A;  1AFP A;  2FXQ A;  2JA6 B;  2JXM B;  1EY0 A;  1B3Q A;  2QF7 A;  5FO9 B;  3TBI B;  2MPM A;  4DV5 L;  1Y1W H;  1MSH A;  5C0X J;  5JJZ A;  4IPH A;  4R8I A;  2PI2 E;  1B4O A;  3W5O A;  4RGO S;  4WJW A;  3R3O A;  2QDL A;  1VQO A;  2Z1C A;  5TSS A;  3SK5 A;  4Q5V A;  3CP0 A;  3KF8 B;  4U68 A;  4HJ8 A;  1CZW A;  1U5K A;  2J7Z A;  2WIN B;  5KNB A;  3QWN A;  2Z9H A;  1OTC A;  3L9A X;  1U4M A;  4AYB B;  1B7Y B;  1VQF A;  2B3G A;  1II3 A;  4LMQ D;  4XQN A;  2R7Z B;  4BWG B;  3BDO A;  3OSO A;  4JG2 A;  5M3F B;  4GLV B;  4P73 A;  1N34 L;  3OWF A;  2EJF C;  3TSS A;  2WB1 G;  4JYA L;  1VQK A;  2WFW A;  2WKD A;  3WOE A;  2VUM G;  4DR3 Q;  3H0G G;  1VQH A;  1CKO A;  4YY3 Q;  2WB1 B;  4OIJ A;  3W1B A;  3NBH A;  4OX9 L;  5IGG A;  1JOQ A;  1FGU A;  1HHV A;  4CBV A;  3K5O A;  2UXD L;  2E2H B;  5JJI A;  4GOP A;  2DJF C;  3KOJ A;  1I6V C;  1UE6 A;  2L55 A;  1D5X C;  4DV1 L;  2B2T A;  2FMC A;  4DFA A;  2FFK B;  1EZ6 A;  2X6G A;  1TU2 B;  4HID A;  3I4M G;  1WFQ A;  1WJJ A;  1J8I A;  1B9N A;  1HTL D;  3H0G H;  3S1Q H;  2HIX A;  2A6E D;  1YJW A;  2O5I C;  1CUK A;  3G48 A;  4C3J H;  1TWG H;  4J15 A;  2R7Z G;  4UP9 A;  2JE6 I;  2ZJR A;  1H95 A;  4DR6 Q;  2IY5 B;  5E4W C;  3DEP A;  1PFN A;  2SDF A;  2PNR C;  4DXF A;  1HQM C;  3V2T A;  3CC2 A;  2G9D A;  4RGM A;  2ZTC A;  1QVC A;  3L7Z C;  4FF1 A;  5C0X G;  1D1I A;  1K8G A;  1BBU A;  1PZJ D;  3BU2 A;  2A5H A;  4XYQ A;  2HQE A;  3PO2 H;  2AUJ D;  1H9M A;  4FYD A;  4K2K A;  3UDX A;  1SNQ A;  2K5W A;  2R7D A;  1GUW A;  1IYJ B;  2B2V A;  3NBI A;  3K80 C;  1PTO H;  5CV5 A;  4NXN L;  1SDF A;  4DK6 C;  2PNH A;  2CCZ A;  1XYI A;  1KXL A;  1R9T B;  1EWI A;  1HZB A;  1PDQ A;  2ZM6 Q;  4JPB W;  5IWA Q;  4OEM B;  1LTI D;  1VQ5 A;  2MO0 A;  1H9S A;  1YIJ A;  2F3V A;  1X9N A;  3P20 A;  1T5X D;  1S5F D;  2ENB A;  3GTK B;  1FYC A;  4XT3 B;  1C7Y A;  2WB1 E;  2EYJ A;  4KHV A;  4RCN A;  4QMG A;  3RD4 A;  1NMG A;  5M5X H;  5ISR A;  1LYL A;  5GAD C;  4X3T A;  1L1O A;  4IUN A;  3I4N G;  4XXE A;  3H91 A;  2EYO A;  2F0Q A;  2KVM A;  3OMC A;  5ELE A;  2V1C C;  1OXS C;  4DV1 Q;  3NTH A;  2JYO A;  2DY7 A;  3GTQ H;  3VYR A;  3EBE A;  2FJ2 A;  2R7Z H;  1ICW A;  2NB0 A;  3RR5 A;  3J7A 5;  4A3E B;  3KFU A;  5BN4 A;  4X3U A;  4ID6 A;  4K8J A;  1JIC A;  5I6Y A;  1I4P A;  4ULL A;  2G5D A;  1PV4 A;  1Y8O B;  2E75 C;  1O7Y A;  3HOY G;  4NXN Q;  5KRU A;  3AFP A;  1HR0 L;  3K0Y A;  3C1F A;  1JMC A;  3CAM A;  5JVG 3;  4DR5 L;  1GUO A;  1VQI A;  1PTO C;  2I5L X;  5IY0 A;  2HUG A;  3PIP A;  4DR6 L;  4LUZ A;  4YWM A;  5C44 H;  3M4O H;  5CV9 A;  3C2P A;  1QVF A;  3PO2 B;  1XNR Q;  4Y7N B;  3S1R H;  1GXD C;  3HFZ B;  3DXJ C;  1V8Q A;  2Z4H A;  2OCE A;  5M5X B;  3D31 A;  3CD6 A;  1U4P A;  4KTA A;  5COY A;  1E2W A;  2VQF Q;  5C4J B;  3TP7 A;  3RZD B;  4N9T A;  3CCU A;  1SFO H;  1DGS A;  3X3N A;  5C4J H;  1HNW Q;  4QY7 A;  1JJ2 A;  3K58 A;  2K4K A;  2JA5 G;  1LTR D;  1TY2 A;  2NN6 G;  3I3C A;  4IFD H;  2N8N A;  4MHE A;  3E3X A;  1S5B D;  3CRL C;  5FO8 B;  1H9S B;  2ZJP A;  3Q0A A;  1NY4 A;  5IP7 G;  1SLJ A;  4LFA L;  3FPP A;  2XGT A;  2K5D A;  4LF4 L;  2RBM A;  1JWU D;  3AU7 A;  3VDY A;  2J0T D;  4DV7 Q;  4L6T B;  1VQE A;  2JQO A;  3A8K E;  1BOS A;  3KF8 A;  4XDX A;  3JAM L;  1VMP A;  3S2H H;  2KUM A;  4RG1 A;  4DV3 Q;  2KEC A;  4APV A;  1K28 A;  4C2M B;  1J9O A;  4RGT A;  2KA7 A;  2AHO B;  1GD7 A;  3TP8 A;  1X3E A;  1K0R A;  1KHI A;  1B44 D;  1C4Q A;  1HNX L;  2GA4 B;  4CDD C;  2DY8 A;  2ICE C;  4LFC L;  1K9M C;  4A3I B;  5D14 A;  5LMN L;  4RAU C;  1TT2 A;  1LT5 D;  3E0E A;  3NBH B;  4FXG C;  4BY7 H;  4JYA Q;  1BXT A;  3U9S A;  2RDG A;  2JA7 H;  5IYD G;  2F4V Q;  2EDG A;  1A3V A;  3NK9 A;  1UAP A;  3KUP A;  5CBA E;  2WV6 D;  5C3E G;  1Y1V H;  3CCQ A;  1J6Q A;  1HUM A;  3G6E A;  3GQB A;  5KIX A;  4LF5 Q;  4GZY C;  1STY A;  4A3F H;  4U67 3;  3VYU A;  1G8Z D;  1EY7 A;  2B63 H;  1OO9 B;  3S9W A;  2ZXP A;  3S24 A;  1U4R A;  2JK8 A;  1RIP A;  3BZC A;  3I4N H;  3HKS A;  4WRD A;  2EYP A;  3CKI B;  3NTK A;  1LTB D;  1YNJ C;  1IW7 C;  1Q3L A;  2K01 A;  3MFG A;  2ZXO A;  2KCT A;  3I4M B;  2E2I B;  3I8Z A;  4LWC A;  4JBW A;  4UDU C;  1BBX C;  4LFB L;  3I7F A;  3TP6 A;  4DV0 L;  3HOV B;  5I9P A;  3AQQ A;  2Q2H A;  3CPW A;  4JI0 Q;  3NEM A;  1QZH A;  3CQZ B;  2F0O A;  1E1T A;  4X66 L;  4JI4 L;  4K5X A;  2GVB A;  4KD4 A;  3T51 B;  1I4Q A;  2PZU A;  1TWH B;  1LTA D;  3FMC A;  4DK0 A;  2WAQ E;  3QJY A;  3K0X A;  4DK1 A;  3S17 B;  1IKM A;  4OWX B;  1XTD A;  3DHQ A;  4ALP A;  2UUA Q;  1FJG Q;  3T1Y L;  2QGQ A;  1FNW A;  1PH1 A;  2I5H A;  1AZP A;  3HOZ G;  3B6Y A;  1Y14 B;  2B8G A;  5IGC A;  2E2H H;  1AN8 A;  1L0X B;  1Z47 A;  1J5E Q;  2JA9 A;  3DM1 A;  1QB5 D;  1BQQ T;  2A6H D;  4DUZ L;  1YIT A;  1K83 H;  4ZQ3 A;  2JEA I;  4NXM Q;  1C0A A;  1WTO A; 
#chains in the Genus database with same CATH homology
 4KKS A;  2F1M A;  5C4H A;  1MBY A;  2F0L A;  1ILQ A;  5EKK A;  2B2U C;  2B2U A;  1D5Z C;  4RHR A;  4FP5 D;  5KYI A;  1TS5 A;  1JWM D;  1IL8 A;  3ND8 A;  3SK6 A;  3I72 A;  4PQX A;  3W3A A;  4A3B B;  5CV8 A;  3S1M B;  3PIO 3;  1I4G A;  2L11 A;  1KNA A;  1LT4 D;  1JE4 A;  2F0F A;  4C3I B;  3DWA A;  4ZRZ A;  1EZ8 A;  5DAU A;  4XTC S;  4CJ1 B;  1SYG A;  1T5E A;  1AZQ A;  3BG3 A;  5D65 A;  3GD7 A;  5CV4 A;  5JEA G;  3M3Y B;  3P75 A;  1K8M A;  1F9S A;  1TVX A;  3S16 B;  1I4R A;  2M00 A;  2B39 A;  4TKO B;  1JOK A;  1SJE D;  3EQL C;  1SYB A;  2KCN A;  5KNC A;  2CVR A;  1E2Z A;  3K6O A;  2RKS A;  5CBE E;  1EIG A;  2NWG A;  3QIA A;  1KAA A;  3S14 B;  1EYA A;  5HUR A;  1F9Q A;  1F2Z A;  2RSO A;  4QB4 A;  3T13 A;  2A6E C;  3UI2 A;  3H6M A;  1CQF A;  1WTR A;  2A6H C;  4K6D A;  3J81 L;  1UEA B;  1ZXT A;  3EVQ A;  4KK7 A;  4BBR B;  1HA6 A;  5FLX E;  1SNM A;  2IX3 A;  1WTX A;  1WD1 A;  4ZAI A;  1NAP A;  5IGE A;  3HG9 A;  2NN6 H;  1CI3 M;  1WTQ A;  1NSN S;  4DNT B;  2PZT A;  1WD0 A;  1PZI D;  3KK7 A;  3BVM A;  3QO2 A;  1S5E D;  1JC7 A;  1TWF B;  4O42 A;  4PV1 C;  5G3L D;  3PUX A;  2R3Z A;  2K03 A;  4TRD A;  1JQY D;  3QG1 A;  2F4I A;  4L8J A;  3OHX C;  3RUZ A;  1HCZ A;  1I50 B;  3K5M A;  3JAM E;  3MVV A;  3M7N A;  1TWC B;  3BS1 A;  5D3I B;  2EVB A;  2A69 C;  3TP5 A;  1STA A;  2B2V C;  4CKB A;  5EGT A;  2AUK A;  2R93 B;  1D6E C;  1R4Q B;  3SHL A;  2CW0 C;  5FLX L;  2BCO A;  5C3E B;  2K28 A;  1F2L A;  3SEB A;  2AWO A;  1D5M C;  4B9X A;  3MAQ A;  5JEA J;  1FNV A;  3NTI A;  5IT9 L;  2NZ1 D;  3QOL A;  2TSS A;  4IUP A;  2EYF A;  5M5Y B;  3NXW A;  1SNO A;  4KI0 A;  4G7O C;  1GUT A;  1KDC A;  2TMP A;  1DM0 B;  1QNK A;  1Q90 A;  1TKW B;  2CW0 D;  5FK9 C;  2X6L A;  4CJ2 C;  1ZKO A;  2F0M A;  5T1G A;  4K6L A;  1E2V A;  2PW7 A;  3VR2 A;  3E0J A;  5CMD A;  1HFG A;  1AP0 A;  1TWA B;  1BF4 A;  5AFW A;  1CHQ D;  2IX1 A;  2IX0 A;  4KHZ A;  1EY5 A;  3A7A B;  1FD7 D;  2B63 B;  1SXT A;  4ZK9 B;  1G2T A;  2FIN B;  5KYL A;  1CHP D;  2OF1 A;  4A3F B;  2EJG C;  2K5Q A;  3IKJ A;  1PLF A;  1EYC A;  3P1H A;  1ONL A;  4FXD A;  1HUN A;  3SDZ A;  4QUC A;  5IOD A;  3NWT A;  1EEI D;  2NTS A;  3GP7 A;  4CHT B;  4IAL A;  5DNF A;  2DNE A;  3ONA B;  1Z6H A;  1CA5 A;  1JR0 D;  4Z9C B;  3J7A F;  4LK1 C;  2AQ3 B;  3S2H B;  3HEJ A;  4J6H A;  3T56 B;  2D62 A;  5CC4 A;  1Q8I A;  1V1P B;  2EZV A;  3DWQ A;  2A73 B;  4BA2 I;  5C4X B;  2YYZ A;  1DCZ A;  4JK1 C;  4F88 A;  5M9O A;  3K7A B;  1ESF A;  1RF2 D;  2EJM A;  3CU7 A;  2O5J C;  2BA0 A;  4NW2 A;  3MZ5 A;  3MC0 B;  4EQO A;  2N55 A;  4A3D B;  2QKI C;  2IWH A;  2EYM A;  1H9J A;  2EYL A;  4XIG S;  1I3Q B;  4A3M B;  5C5L A;  1ESR A;  1NCV A;  4A3K B;  2QIL A;  2EY2 A;  2B8F A;  2F0H A;  1EFI D;  1TS4 A;  3QOJ A;  3HP3 A;  3MWY W;  1A2T A;  1RTN A;  3ZYY X;  5CYU A;  1QCB D;  3C46 A;  5C44 B;  1DOK A;  1JOO A;  1QOH A;  5ELC A;  4RGN A;  4I65 A;  3IFT A;  3PUW A;  1VDZ A;  2QEJ C;  3TZD A;  4KY5 A;  5ELD A;  2PQE A;  1OXX K;  5FKA C;  3TDQ A;  2SNM A;  5F2D A;  2LKV A;  1SMY C;  4J8Q A;  2D9U A;  1STE A;  1TII D;  4TSS A;  2L0C A;  1WTP A;  1DOL A;  1I4H A;  4ABN A;  3PUZ A;  1DON A;  3KBX A;  1PYW D;  2L1B A;  4LAA A;  1I4X A;  3DEO A;  1DD2 A;  2F0N A;  1QIL A;  2C5C A;  3D3R A;  3R2I A;  3J7Y W;  2DN8 A;  1QJO A;  2NVT B;  3SVM A;  3I91 A;  2E74 C;  1HQR D;  1BUV T;  3K5N A;  1TQO A;  5C3W A;  1SE4 A;  3VR6 A;  5DM6 3;  2I46 A;  2IW3 A;  4RH6 A;  1EQT A;  3I73 A;  2VXW A;  1XXG A;  2RA4 A;  4FXK C;  1QG7 A;  3OIQ A;  2R92 B;  3VA7 A;  3A8J E;  2K04 A;  2BA1 A;  2IT1 A;  1LAC A;  3HS0 C;  3I70 A;  5ELF A;  2F0E A;  2EY5 A;  3ITP A;  5E3F A;  1IYU A;  2B2W C;  2B2W A;  5J22 A;  4K2L A;  4HMI A;  2KOL A;  2E2D C;  4K14 A;  1PZK D;  4PMW A;  1JCK B;  1SBB B;  3OOC A;  3O13 A;  5EBD A;  3VR3 A;  3SR1 A;  4DNR B;  3CHB D;  1A3T A;  3D6W A;  2F03 A;  1PTO B;  3G6J B;  3DUZ A;  2EY6 A;  1I6H B;  3NPP A;  4C56 C;  3R93 A;  3PV0 A;  1G2S A;  4S3S A;  2A69 D;  3BYT B;  3LWE A;  2A68 C;  1R4P B;  3HOZ B;  2BE5 C;  4BS9 A;  1SE2 A;  4FO2 A;  5I2Y A;  2JSO A;  4F7X A;  1SND A;  4YIJ A;  3TZU A;  3NQI A;  1KTK A;  1DXM A;  5IIF A;  3PUV A;  4H0L C;  3J80 L;  1B2T A;  2KCC A;  1HRJ A;  1GHJ A;  1SNP A;  2HCI A;  3AB9 A;  1ZYR D;  3Q6S A;  2ID0 A;  3S1N B;  2WAQ B;  3GTM B;  1IW7 D;  1CM9 A;  1KDA A;  1DOM A;  2PPB C;  4DAP A;  4HSP A;  1EWH A;  4NDX A;  1ENC A;  2PO4 A;  4OO1 I;  1EY8 A;  4PMC A;  1AW7 A;  2FMM A;  1EWC A;  4OGQ C;  4A93 B;  5LHY 1;  5KND A;  1RJT A;  1LTS D;  2XVS A;  2JA7 B;  4IFD G;  3C3L A;  3GTL B;  3OMG A;  1LO5 D;  2F0I A;  3CRK C;  3GO5 A;  2F0D A;  4V19 0;  4G4K A;  3FDT A;  2KQ3 A;  1MD2 D;  5KEE A;  1VF7 A;  2F0U A;  1Q12 A;  5CR3 A;  3T53 B;  5JPM C;  3VR5 A;  1ET9 A;  1MSG A;  3L3O C;  3G7L A;  1E0B A;  5HGT A;  3FRP B;  5EQ0 A;  4C3I G;  5ELB A;  2L4N A;  5IOC A;  1M8A A;  1IYV A;  1G6Z A;  1BCP C;  3S15 B;  3OPO A;  2L5T A;  1EU3 A;  2FHT A;  5IGD A;  4EVO A;  4DXG A;  3A56 A;  1K83 B;  4WFN 3;  5EPJ A;  1MI2 A;  5T1I A;  2MUY A;  3MXP A;  1BNZ A;  2JEB I;  2Q8T A;  1MGS A;  2EOT A;  3GTG B;  3V05 A;  1Z7T A;  2MHV A;  2VB2 X;  5FO7 B;  1EQV A;  1CQV A;  4BBS B;  1QNU A;  1RTO A;  4J1M A;  1A2U A;  1EU4 A;  4CGY B;  2MGS A;  1BCP B;  3X3M A;  2F3W A;  3HRZ C;  5DM7 3;  5G3L F;  1D1K A;  1LLR D;  2PZW A;  4RA8 A;  3NSW A;  3VA5 A;  3KLR A;  1G91 A;  4RCO A;  1STB A;  4BA1 I;  2G9H D;  1SFO B;  2HCC A;  4EQN A;  5E1F A;  1KNE A;  2SNS A;  4RKL A;  2J4X A;  3BDC A;  2Q8R E;  3MA2 B;  2MP1 A;  2N88 A;  4ZYS A;  3OWE B;  2NBF A;  4ZKC B;  3NE5 B;  3LNN A;  4HAE A;  1O7Z A;  3NP8 A;  3R2T A;  2KEE A;  4K5W A;  3Q22 A;  3HOW B;  4RWS C;  1X3P A;  4G7H C;  1ENF A;  4A3G B;  4FVM A;  2NVY B;  1U4L A;  5C3X A;  1NR4 A;  3HGB A;  4ME5 A;  1NUC A;  4QUF A;  5EBC A;  3VR4 A;  2WAC A;  4FF3 A;  4CKE A;  1SE3 A;  3KBG A;  4QF4 A;  4C3H G;  1HA5 A;  2KJX A;  2F0T A;  2OXP A;  1ZEQ X;  2C9O A;  2RDF A;  3FPU B;  2XNA C;  4IUV A;  2K32 A;  3EJI A;  1GUN A;  3PIP 3;  2NYZ D;  1S5D D;  1B1Z A;  3N6R A;  1EY9 A;  5KGU A;  3S2D B;  4M1U B;  2Z4I A;  2DNC A;  5A2Q L;  2F0K A;  4RFB A;  5I9O A;  4HR7 B;  1PRT B;  3I4L A;  4NMZ A;  4HSV A;  3D4D A;  3FKI B;  1PRT C;  1RKN A;  2HDM A;  3D6C A;  3NQT A;  1LAB A;  1LT3 D;  4OO1 H;  2NVQ B;  5EKI A;  4DAV A;  5COR A;  2K05 A;  3GTP B;  1TR5 A;  2ZXR A;  1STH A;  2LS0 1;  1VMC A;  1WVL A;  3J7A V;  5JAV A;  3PO3 B;  4F8M A;  1GJX A;  1CTM A;  3OW7 A;  3D4R A;  5I2X A;  3A55 A;  5EPK A;  1S5C D;  3A8I E;  3SK4 A;  5JEA H;  3PUY A;  4EQP A;  4NP5 A;  1XTC D;  4PNY A;  4DGZ A;  4OO1 G;  1XWE A;  1VF5 C;  1RD9 D;  3RLF A;  5C5M A;  5IGB A;  4C1N K;  3VYT A;  3NUC A;  1ET6 A;  1EY6 A;  4A3J B;  5JPN C;  4HCE A;  3S1R B;  4K8I A;  2F0V A;  1STN A;  1HXY D;  4HTH A;  2Q8I B;  4KKT A;  1SYE A;  4Q0F A;  1EL0 A;  2XN9 C;  4N9P A;  2MJ8 A;  2OT2 A;  2H4O A;  3H3V C;  3BYY B;  1W6J A;  4H44 C;  2XIW A;  4C3H B;  1B9M A;  5C6A A;  3R8B A;  2O2L D;  4NKL A;  4XQQ A;  2LFN A;  2KED A;  3I4N B;  1SSO A;  3H09 A;  2SOB A;  4OL7 A;  2F0J A;  1YNN C;  3TME A;  1IHZ A;  4FF4 A;  3OIP A;  1CFM A;  5K5P A;  2XWB B;  5A2Q E;  1Q1B A;  3GV6 A;  5NUC A;  3DMU A;  1LT6 D;  1H9K A;  1M4V A;  3LX0 A;  2K33 A;  4XQJ A;  4IQZ A;  2E2J B;  2JP1 A;  2K1B A;  3WOF A;  4C3J B;  1X3Q A;  2EXZ A;  4K5V A;  4IUT A;  1B3A A;  1JB3 A;  1KLU D;  3W2D A;  3IFD A;  2CHB D;  1WCM B;  1V1P A;  4H13 C;  4KY7 A;  1SAP A;  3RZO B;  3BDL A;  1HPC A;  1BCP F;  3MXG A;  1RDP D;  5EPL A;  4KY6 A;  5M3M B;  2I07 B;  1JWS D;  3P7J A;  1GHK A;  1GUG A;  1SYC A;  3HZX A;  4MIU A;  2OEO A;  4BY1 B;  1PFB A;  4XYO A;  4QCL A;  5BN3 A;  1ILP A;  4ODG A;  4R8N A;  2PW5 A;  3K59 A;  4DA2 A;  4H7B A;  5D3D A;  1SJH D;  1PFM A;  1EEF D;  2B2T C;  1RCV D;  5K36 H;  4BY7 B;  2VB3 X;  1NR2 A;  2HDL A;  2RDH A;  4G57 A;  3RMH A;  3NHH A;  1PTO D;  5J39 A;  3EA6 A;  1G29 1;  2JA5 B;  4G7Z C;  3ERO A;  1CK1 A;  1JOR A;  1SEB D;  1A3U A;  5I6W A;  3HKZ B;  1F2Y A;  4ZUI A;  3D8G A;  2A74 C;  2PCF B;  1O78 A;  3NWS A;  1DZ1 A;  5K36 G;  2CQA A;  4ILW A;  1FGB D;  1B53 A;  4E6I A;  1HTP A;  4OIK A;  2VNU D;  3HOY B;  1A15 A;  2Y0S B;  3U9O A;  1Y1V B;  3IAY A;  4X3K A;  1WTW A;  2M9V A;  5C4Z A;  4ZLT F;  5JOB A;  3J81 E;  4HED A;  5CV6 A;  2WP8 J;  1QWY A;  3TN2 A;  2F0P A;  1Y8P B;  2R6G A;  2EY1 A;  1OXT A;  4CJ0 B;  1IKL A;  4OHJ A;  1LV9 A;  1FR3 A;  3E5S A;  1KDB A;  5LL6 S;  1Q1E A;  1UNS A;  4M8A A;  4C1N I;  1SNC A;  1SYF A;  3ND9 A;  5M5W B;  3K57 A;  1F77 A;  2V4D A;  4F87 A;  2H1E A;  2L9H A;  1Y69 U;  1L0Y B;  2A68 D;  1STG A;  2BE5 D;  2RQX A;  3VYS A;  1TS3 A;  2AQ2 B;  1UUP A;  3I90 A;  1SYD A;  2BDO A;  1EOT A;  3URY A;  4KJO A;  3PMF A;  2D2C C;  4R9W A;  2JA8 B;  3Q23 A;  1QE6 A;  1V43 A;  2ICI A;  3FEW X;  1SMY D;  1CT1 D;  1K8O A;  3H0G B;  3S1Q B;  4RKB A;  1YNJ D;  3M85 A;  2Z8L A;  3M7G A;  2WII B;  2LMC B;  1ROD A;  2EYH A;  4HMJ A;  4IUQ A;  5A35 A;  4L63 B;  4TQU S;  5EJW A;  1PTO F;  2LY7 A;  1XX8 A;  4MN3 A;  2QDB A;  1ZYR C;  3M4O B;  4KD3 A;  1F9P A;  2K6A A;  4C3J G;  4WOR A;  1F2M A;  4DAY A;  3MHB A;  1OXU A;  5C0X I;  2O4X A;  1LTG D;  2ZT9 C;  3QB3 A;  1RHP A;  2XSC A;  1V1O A;  3Q24 A;  4KN7 C;  2PMZ B;  3FVQ A;  1D2B A;  2VUM B;  1GOZ A;  4CKC A;  2F0W A;  4IFD I;  1FNU A;  2AQ1 B;  2EPB A;  4IZ8 A;  4KV6 A;  2R61 A;  4ZKB B;  3E6Z X;  4HN7 A;  1KAB A;  1HFN A;  2AWN A;  5IT9 E;  2RSN A;  1DYQ A;  4P2C B;  5LL6 X;  2EE1 A;  2M2L A;  2SEB D;  1GUS A;  4DF7 A;  4KJN A;  2XRS D;  2L12 A;  2BOS A;  4UAI A;  5BN5 A;  1EIH A;  5IGF A;  1TS2 A;  1O80 A;  3N52 A;  3MXN A;  3HOU B;  1BO0 A;  3GTQ B;  3A54 A;  3BZD B;  5JVH 3;  1U9R A;  3F2U A;  1A6X A;  3DWP A;  4PMB A;  1B50 A;  5J1Z A;  1PMR A;  4XT1 B;  4B9W A;  2F0S A;  4RHS A;  5CGK A;  3HOX B;  3M4Y A;  3WDN A;  2RVL A;  3GV3 A;  5EKL A;  1WTV A;  2QCP X;  1S4Z A;  3MTS A;  3KLS A;  3BVG A;  3SXH A;  2NVX B;  4IN3 A;  1BDO A;  1EY4 A;  3T4A C;  4DU9 A;  2F0G A;  1CZG A;  1KLG D;  1Y1W B;  1CA6 A;  1OXV A;  1PXU A;  2BDN A;  5CV7 A;  2WKC A;  1O7L A;  4IFD J;  5E4X A;  2E76 C;  1ENA A;  1YNN D;  2X69 A;  4LJZ C;  1AEX A;  1C48 A;  4HCS A;  3SE0 A;  3LWU A;  1LTT D;  4KN4 C;  4EGV A;  2IPK D;  3D4W A;  3EFX D;  3AMU A;  1TWG B;  1DJR D;  4DN4 M;  4X3S A;  3MEH A;  3A7L A;  4O1N A;  1ML0 D;  5FOB B;  3MXU A;  4KKU A;  5I4D A;  3SK8 A;  1C8C A;  3V96 A;  2B2Y A;  4I7Z C;  5DEH A;  2K7V A;  2B2Y C;  4IUR A;  1H9R A;  4ZUJ A;  2NN6 I;  4QIW B;  4B08 A;  3K5L A;  3IL8 A;  5C0X H;  2NTT A;  2YU9 B;  3GTJ B;  3ERQ A;  2XRQ D;  2NUC A;  2XWJ B;  1VCI A;  1Y8N B;  1BR9 A;  2IL8 A;  4IUU A;  3H94 A;  1X32 A;  3MFY A;  4KMU C;  2PYK A;  3T16 A;  1PRT D;  1F9R A;  3BVZ A;  1EYD A;  4FF2 A;  3J80 E;  3C1E A;  1BCP D;  2IJ0 A;  2KHS A;  3GTO B;  4FNF A;  1TY0 A;  1PRT F;  3KLS X;  2D5D A;  1W6K A;  4V0B A;  1AFP A;  2JA6 B;  2JXM B;  1EY0 A;  2QF7 A;  5FO9 B;  3TBI B;  2MPM A;  1MSH A;  5C0X J;  5JJZ A;  4R8I A;  1B4O A;  4RGO S;  4WJW A;  3R3O A;  2Z1C A;  5TSS A;  3SK5 A;  4Q5V A;  4U68 A;  1CZW A;  2J7Z A;  2WIN B;  5KNB A;  3QWN A;  3L9A X;  1U4M A;  4AYB B;  1II3 A;  4LMQ D;  4XQN A;  2R7Z B;  4BWG B;  3BDO A;  3OSO A;  5M3F B;  3OWF A;  2EJF C;  3TSS A;  2WKD A;  3WOE A;  2WB1 B;  4OIJ A;  3NBH A;  5IGG A;  1JOQ A;  1HHV A;  4CBV A;  3K5O A;  2E2H B;  1I6V C;  2L55 A;  1D5X C;  2B2T A;  2FMC A;  4DFA A;  2FFK B;  1EZ6 A;  2X6G A;  1TU2 B;  1J8I A;  1B9N A;  1HTL D;  2A6E D;  2O5I C;  2JE6 I;  5E4W C;  3DEP A;  1PFN A;  2SDF A;  2PNR C;  4DXF A;  1HQM C;  3V2T A;  2G9D A;  4RGM A;  3L7Z C;  4FF1 A;  5C0X G;  1D1I A;  1PZJ D;  2A5H A;  4XYQ A;  2HQE A;  2AUJ D;  1H9M A;  4FYD A;  4K2K A;  1SNQ A;  2K5W A;  1GUW A;  2B2V A;  3NBI A;  5CV5 A;  1PTO H;  1SDF A;  1XYI A;  1R9T B;  1PDQ A;  1LTI D;  1H9S A;  2F3V A;  3P20 A;  1T5X D;  1S5F D;  2ENB A;  3GTK B;  1FYC A;  4XT3 B;  2EYJ A;  4KHV A;  4RCN A;  4QMG A;  3RD4 A;  5ISR A;  4X3T A;  4IUN A;  4XXE A;  3H91 A;  2EYO A;  2F0Q A;  2KVM A;  3OMC A;  5ELE A;  1OXS C;  3NTH A;  2JYO A;  2DY7 A;  3VYR A;  2FJ2 A;  1ICW A;  2NB0 A;  4A3E B;  5BN4 A;  4X3U A;  4ID6 A;  4K8J A;  1JIC A;  5I6Y A;  1I4P A;  4ULL A;  1Y8O B;  2E75 C;  1O7Y A;  5KRU A;  3K0Y A;  3C1F A;  5JVG 3;  1GUO A;  1PTO C;  2HUG A;  5CV9 A;  3C2P A;  3PO2 B;  4Y7N B;  1GXD C;  3DXJ C;  1V8Q A;  2Z4H A;  5M5X B;  3D31 A;  1U4P A;  4KTA A;  5COY A;  1E2W A;  5C4J B;  3TP7 A;  3RZD B;  4N9T A;  3X3N A;  3K58 A;  1LTR D;  1TY2 A;  2NN6 G;  3I3C A;  4IFD H;  4MHE A;  1S5B D;  3CRL C;  5FO8 B;  1H9S B;  3Q0A A;  3FPP A;  2K5D A;  2RBM A;  1JWU D;  3AU7 A;  2J0T D;  4L6T B;  3A8K E;  1BOS A;  3KF8 A;  4XDX A;  3JAM L;  1VMP A;  2KUM A;  2KEC A;  4C2M B;  1J9O A;  4RGT A;  2KA7 A;  3TP8 A;  1B44 D;  1C4Q A;  2GA4 B;  2DY8 A;  2ICE C;  4A3I B;  5D14 A;  4RAU C;  1TT2 A;  1LT5 D;  4FXG C;  1BXT A;  3U9S A;  2RDG A;  2EDG A;  1A3V A;  3NK9 A;  1UAP A;  3KUP A;  5CBA E;  2WV6 D;  1HUM A;  3GQB A;  5KIX A;  4GZY C;  1STY A;  4U67 3;  3VYU A;  1G8Z D;  1EY7 A;  1OO9 B;  3S9W A;  2ZXP A;  1U4R A;  4WRD A;  2EYP A;  3CKI B;  3NTK A;  1LTB D;  1YNJ C;  1IW7 C;  1Q3L A;  2K01 A;  2ZXO A;  3MFG A;  3I4M B;  2E2I B;  3I8Z A;  4JBW A;  4UDU C;  1BBX C;  3TP6 A;  3HOV B;  5I9P A;  3CQZ B;  2F0O A;  4K5X A;  4KD4 A;  3T51 B;  1I4Q A;  2PZU A;  1TWH B;  1LTA D;  3FMC A;  4DK0 A;  3QJY A;  4DK1 A;  3S17 B;  1IKM A;  3DHQ A;  1FNW A;  1AZP A;  2B8G A;  5IGC A;  1AN8 A;  1L0X B;  1Z47 A;  3DM1 A;  1QB5 D;  1BQQ T;  2A6H D;  4ZQ3 A;  2JEA I;  1WTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...