4V190

Structure of the large subunit of the mammalian mitoribosome, part 1 of 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
114
structure length
114
Chain Sequence
TGGSSKNLGGKSPGKRFGIKKMEGHYVHAGNILATQRHFRWHPGAHVGLGKNKCLYALEEGVVRYTKEVYVPNPSNSEAVDLVTRLPQGAVLYKTFVHVVPAKPEGTFKLVAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords MITORIBOSOMAL PROTEIN BL27M, MRPL27
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
total genus 16
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1030 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4v19000
3J7YW 4V190
chains in the Genus database with same CATH superfamily
1Y1VH 1CHPD 3WOFA 4OIKA 3QO2A 4XQNA 2KOLA 1QVCA 1ENAA 5IGDA 4IFDI 2D9UA 4OIJA 3CQZH 1IBML 1VQ8A 5IT9E 4UPAA 3GTQB 1JC7A 5AJ3L 1QZHA 3CCSA 4JYAL 1IYVA 3OIPA 4JOIA 1LACA 1XXGA 3T13A 3P20A 2KQ3A 5EGTA 5EJWA 3I4NG 2KJXA 3TP7A 2F0IA 2CHBD 3CCLA 4EQNA 1MKHA 4CJ2C 4KD4A 4BY1G 3T51B 1FJGL 2OQ0A 4J15A 1WCMB 4PZ8A 4L8JA 5IT9c 3IFDA 1BCPF 4DFAA 1JWSD 4C3IG 1TS3A 2UXDL 1EWHA 3BDCA 1Y1WB 4JI4Q 1NSNS 1Q86C 1GJXA 1CT1D 2K4KA 5EPJA 1WD1A 3K7UC 4YY3L 2EJFC 1PDQA 3RD4A 5IGGA 2GA4B 1VQJA 3MFYA 4DU9A 5M3FB 2CQOA 1WOCA 4H44C 4KHVA 4OO1H 1IW7D 4K8JA 2XWJB 2LSSA 1KNAA 4I65A 3KFUA 1ZYRD 3KLWA 5CC4A 5JJKA 4PQXA 2PO4A 1GUOA 3VR5A 3CKIB 1QNUA 4I7ZC 3S9WA 1PRTB 1R4QB 2UUBQ 1Q7YC 1I50H 3P7JA 4NP5A 1QVGA 3GTLB 2C9OA 4EGVA 4FXDA 2VZAA 2L9HA 2EJGC 1VMCA 2LFNA 1YNJD 3BDLA 4KMUC 5C0XJ 4APVA 4HAEA 1OXSC 1I4PA 4O0AA 3M4OH 3F1ZA 3G6JB 3G4SA 5COYA 4X3TA 4FF3A 1VQPA 4IUNA 1YNNC 4L5QA 5CV7A 2LS01 4X3UA 5NUCA 1YHQA 1CA6A 1YZ6A 2DJGC 4ALPA 3D6CA 3GP7A 3TP8A 1G6PA 3C1EA 2FINB 2RDFA 1J5EL 4RHSA 3EROA 1UWVA 4L5SA 2EDGA 3HOXB 3GTGB 3H3VH 3A8IE 4Q5VA 2A8VA 2EE1A 4K0KL 5BN3A 5ELFA 2AUJD 2UUCQ 3SK5A 1B3QA 4OXPA 1NR4A 4DR1L 3CQZB 2MNAA 1HNXL 3QWNA 5C0XG 2MHVA 1CSPA 2JYOA 1RKNA 2IX1A 3S1QH 3U4ZA 3V2TA 1JB3A 4BBSG 1HCZA 2A5HA 3F2CA 1EIGA 1VQNA 3PCOB 4XTCS 1TWFH 1C48A 1STEA 2B2UA 2J4XA 1CHQD 1PH1A 1V1QA 4A3DG 4R4CA 1KAWA 3K5MA 4H02A 2A69C 3MC0B 3SDZA 2F0MA 1Q12A 3M7GA 3VR2A 4A76A 1RCVD 1PTOD 1DJRD 3DEPA 5IYDG 3S1NB 3CRLC 3VYRA 2C35B 1XPOA 3SGIA 3PO3H 1X3QA 4AYBB 2BH8A 2B63G 1OTCA 5AJ3Q 3LNNA 1AP0A 4JYAQ 2NBFA 1ENFA 1YEZA 3D8GA 2E8GA 3U9OA 3BVGA 4XYOA 4X65L 3ULPA 2IHEA 1SNDA 2WINB 2NVTH 1BO0A 2N78A 3K0YA 2F4VL 4JG2A 2F0JA 2F0KA 3CRKC 4JI6L 2JA9A 1HR0Q 1KABA 5DEHA 1VQ4A 3OW7A 4IUPA 1S5CD 4RAUC 4QUFA 5CBAE 2VB3X 3ULLA 4TVAB 4NDXA 4PG3A 1PHJA 1WTQA 3CCMA 2UXDQ 4NPSA 3BS1A 2NN6I 4A3FH 4YY3Q 1PZKD 1FGUA 5D3DA 2ENBA 2VXWA 2ZTDA 4DV0L 1JMCA 3W1BA 2NVYH 1DYQA 2RCNA 4FF2A 5BR8L 5I9OA 4RKLA 5DM63 3J7AF 4AYBE 3HKZG 5FLXc 3K5LA 4DNRB 3GTMB 1UE6A 1A3TA 3S15B 1Y8NB 2EQSA 4IJLA 2LY7A 1TR5A 1FR3A 1D7QA 3QJYA 4QF4A 3ER0A 4KKSA 3AB9A 1KLUD 3U4VA 1PZJD 1EY9A 1TS4A 2MFIA 3LX0A 1K73C 3FP9A 3N6RA 3I2ZA 2ZM6L 4DK0A 4F87A 1PH9A 2B63B 3MVVA 1SE3A 3NHHA 1FL0A 2L11A 3NTHA 3CCRA 3S1RB 3PQIA 4ZK9B 3PUVA 1X32A 1XMQL 1SNCA 1B44D 3KLSX 1A8VA 4UY8C 3NWTA 4F7XA 3DWAA 1JOKA 2DY7A 5EBCA 4O2DA 4FO2A 3H3VI 3X3NA 2K33A 4A4IA 4A3CG 4Z9CB 4CDCC 5CMDA 4RFBA 3I4OA 1SYCA 1PRTD 2QILA 1F9QA 1NBWA 1N34L 4HIDA 2JA7H 1J5EQ 4J8QA 3B6YA 3NBHA 1EWIA 2QDLA 3SE0A 5A35A 3RMHA 1D6EC 1K3RA 1HZ9A 1TS5A 2HCCA 1GXDC 2R7FA 3TZDA 3E5SA 5JVH3 4NXNL 1HNXQ 1QG7A 1V1PB 4O1NA 2PZUA 2K50A 2ZJRA 3MZ5A 2RVLA 5DNFA 2IJ0A 1GM5A 3GTPH 2LMCB 5LHY1 2R7ZB 5E4XA 4IPGA 3I4MH 2B2YC 2Z6KC 2WAQG 2ZJPA 4KN4C 3A55A 1A0IA 1GUSA 3KK7A 4P73A 1DZ1A 2XWBB 1IKLA 3URYA 5IP9H 3A56A 1UNSA 1LTSD 2JE6I 4JI5Q 4HCSA 3A0JA 1T5EA 4RCOA 4HJAA 1WTWA 4R4OA 2KHSA 3HGBA 1X9NA 3HOZB 3NENA 1FD7D 3KF8B 4A3IG 4A3MH 3HOYG 4X65Q 1X65A 3A8JE 3KF8A 1EYGA 2I5LX 2AQ1B 2UUAL 4MN3A 2F4VQ 1R9TH 5EKKA 4JI6Q 3HKZE 3M4YA 3D3RA 5LL6X 2EVBA 3U50C 1XMOL 1EY8A 4A75A 2XN9C 2B2WC 1W3SA 1FNUA 2K5QA 2WKDA 5GQOA 2K5WA 1R4PB 4IQZA 2VUMB 2O2LD 4R4QA 5EPLA 1OO9B 1YVCA 4F88A 2YU9B 3CF5A 4OL7A 4DV0Q 3AMUA 4LFBL 1SFOB 4LF8L 4GLVB 5ELDA 5BR8Q 2ICIA 2M9VA 1ZEQX 2F0QA 3TQYA 2E5LL 3RZDB 1A2UA 4NXML 5K36H 2WAQB 3Q0AA 3J7ZC 2EYOA 3H0GH 4YCUA 1V9PA 1SNOA 2RQXA 2Z6BA 4GNXC 3NBIA 1YNND 2F0HA 4X6AH 4HIMA 1IW7C 2A6EC 2WP8J 2ZM6Q 5M3MH 2JA7B 5H1SE 3J81L 3C2PA 4PZ6A 3DEOA 3W1GA 5CV5A 3VA7A 2Z6KA 3ZJYC 4A3IB 3WOEA 1XMQQ 3HOYB 1H9SB 5CGKA 1XYIA 1EOVA 3VYSA 5I4DA 4LUVA 5KYIA 4GN5A 1HA6A 3H09A 1EY7A 1DOLA 2NUCA 3BZDB 3S2HH 5IODA 3D0FA 5JPNC 2E2DC 5IGBA 2N3SA 1QVFA 4MTKA 1YNJC 1H9MA 4YCVA 1CTMA 1N34Q 5FO7B 1Q1EA 1K28A 5BN4A 4J1MA 1KDCA 1WJJA 2Q2HA 3RN5A 3T1YL 2YTYA 1QE6A 1JE4A 2LXKA 2HIXA 4DNTB 2WAQE 1HTPA 3NEMA 4LWCA 2I07B 1DM0B 1GKHA 1N36L 3FKIG 3D31A 5I6YA 1QNKA 3I91A 4KTAA 1LTLA 2ICEC 3SK4A 1KHIA 1DONA 3L7ZC 1BNZA 4JI1L 5ELNA 1HFNA 1P8LA 3AYHB 4AIMA 1D8LA 1JQYD 2E76C 3OWFA 2B39A 1SMXA 4DV5L 5JJIA 1O7LA 3EFXD 1PTOH 1ICFB 2JA5H 1C4QA 3C46A 1V1OA 4PMWA 4HTHA 2E2HH 1STBA 4TKOB 4MTNA 4A3BH 2BCOA 1OXVA 1RODA 3O13A 1D1IA 1F9PA 4ZLTF 5E7NA 2JEBI 1LUZA 2C5CA 1VQKA 1PH6A 2F4IA 2PYKA 1I6VC 1ICWA 1PTOC 4JC0A 4KLKA 3GTKH 4GKJQ 1ESFA 1CFMA 4UP8A 1HNZL 1LT5D 3EA6A 1VQLA 4A3LH 2UUAQ 2WACA 3LGJA 3CPWA 3N52A 3KDFA 4FNFA 3J81i 5M5YB 1SNPA 1VQGA 4XQJA 3GTQH 1XMOQ 4KKUA 3GO5A 3FKIB 4IFDJ 1SE2A 1MJCA 3GV3A 1I4RA 1PLFA 1ZKOA 3TSSA 2UU9L 1BXTA 4G7OC 1VQ5A 5CV8A 2CH4A 4BBRG 4LFBQ 5D3IB 2BOSA 1XNRL 5C4XG 4LF8Q 1WCMH 1I6HB 1SYBA 4JOIC 5C3EB 3T56B 3PF5A 4IJHA 2E5LQ 1WFQA 4NXMQ 3UE0A 2EXDA 2UUBL 3SR1A 4GOPB 2JK8A 3RLFA 1Y1WH 2PPBC 3A5ZB 1PYWD 3OWEB 2CFMA 5IYBG 4GOPA 2KBNA 1SYEA 3S14B 2KA7A 4A93G 2H5XA 2RF4A 4R8IA 4AH6A 4G57A 5M3FH 3TBIB 3PUXA 1HNWL 5TSSA 2Y0SG 5LMNW 2SNMA 3NXWA 1C0AA 3QIAA 1I4XA 4IFDG 4GZYC 1S4ZA 3PO2G 2QKIC 4DAPA 1SJHD 2Q2TA 4EQOA 3VYTA 1NCVA 3I90A 5IWAQ 1LO5D 2KHJA 3RLNA 2JN4A 1A3UA 1SYGA 2NZHA 4RCNA 3CMEA 2F0SA 2AQ3B 4R1JA 3CC4A 1H9RA 1SLJA 1TKWB 2ZXRA 4KN7C 1V43A 3GTLH 1G2SA 4WORA 5FLMH 5FO9B 4QGUA 2M00A 3EVQA 4XIGS 3I4NH 5ISRA 4UP9A 1PH4A 1PRTC 3K8AA 3U9SA 4BBRB 3EJIA 1GOZA 5C4XB 1G91A 2ZTCA 1KDBA 3FPPA 1NY4A 4J6HA 4JI1Q 1E2VA 2YYZA 4KD3A 1VQBA 4OHJA 3QOJA 5A2QE 1PMRA 4H7BA 4OELB 4KY7A 4DV5Q 3HOXH 3S17B 3GTGH 1VQHA 3DUZA 1VQ7A 4CDEC 2K5NA 2CWAA 1G6ZA 2A74C 4A93B 1NUCA 4C3JG 1D2BA 4DR4L 4DV4L 1Q3LA 4A3JB 2IT1A 4H0LC 2KEDA 5EBDA 1D5MC 3CPFA 2Y0SB 1KD1C 2F3VA 4M8AA 1PFSA 1S72A 2ZTEA 2F0OA 3PO2B 2NVQB 4A3EG 1N32L 1B53A 5LMNL 1K83B 4EQ5A 2R7DA 4FXGC 1MJEA 3AU7A 2F0WA 1JE5A 4O42A 2JSOA 4DAYB 1EYAA 2X6LA 1GD7A 3M3YB 1LTGD 1HR0L 1B8AA 1HNZQ 4DAYA 1YJWA 1GVPA 3S1NH 2R92B 4HMIA 2RDGA 4C3HG 1VQFA 2L12A 4JBKA 4UHVA 2B2UC 5DLQE 1KNEA 1NMGA 1S3OA 1QWYA 4ZQ3A 2AWOA 1EL0A 1P16A 2VS1A 2K14A 3ITPA 3OHXC 3R93A 5IE8A 4I7AA 4DV7L 3DWQA 3BDOA 1VQAA 3K5OA 4C1NI 2A6ED 1Q81C 1DOMA 2L5TA 2NTTA 5IP7G 2UU9Q 1G8ZD 2Y0SE 2Z4HA 1KC8C 2HHHL 4QL5A 2KCNA 4DXGA 5JJZA 2G5DA 3NTIA 4A3KG 1VQOA 1XNRQ 4ZUJA 2HCIA 1Y1VG 1HQMC 1OXTA 1NR2A 2PNHA 3L0OA 4X62L 3FEWX 5C4HA 5KEEA 4C3JB 2F1MA 2F0VA 1NE3A 5C0XH 2FXQA 4RA8A 1QZGA 1BF4A 1HQRD 5M5WB 3K5NA 4CHTB 2JXMB 4BA2I 3I4NB 1HNWQ 3OTOQ 1WD0A 1CKMA 4P75A 2F0TA 1PA6A 2HIVA 3GTMH 1OXXK 5ELEA 3S15H 2TMPA 4BY1B 3G6EA 4LF4L 4YWLA 2HQEA 3CC7A 4JCVE 4LF9L 1TS2A 1VF5C 5IYDH 1SNMA 4MNOA 3MTSA 4C3HB 1UEBA 4DR3L 3KLRA 4C3IB 5K5PA 1JWUD 4FXKC 2F0EA 1IZ6A 2B63H 1DOKA 1Z6HA 3FDTA 5KNBA 5KYLA 5EQ0A 3S1RH 2VNUD 1LTID 1EEID 2X6GA 4RGNA 3G48A 3J80L 4WJ4A 4DK6C 1BDOA 2EY1A 1C8CA 1S40A 1B7YB 2NN6G 1NMFA 2F0UA 2HDLA 4LNQA 5J22A 4QCLA 1L1OB 2Z4IA 3CCEA 4TRDA 1Y8OB 2UXCQ 1LT6D 5IY0A 1L1OA 1WTRA 2RDHA 3R2TA 4K6DA 4QB4A 1PTOF 4X66L 2VY3A 4JBWA 1EY5A 4N8X1 1A2TA 1IL2A 3F8TA 4DR4Q 1SMYC 4JI5L 4DV4Q 1ILPA 4GLAC 4R4TA 1ZXTA 4CJ1B 3J81E 1CQFA 4KHPQ 2EIFA 1BR9A 3RZOB 2HUGA 3ULJA 4L5TA 1N32Q 5CV6A 3G71A 3MXNB 5LMNQ 3MFGA 2R7ZH 3MXNA 3TP6A 3MXGA 4MIUA 2DY8A 4IURA 2E2IB 4BY7G 2IHFA 1EFID 2E75C 3KUPA 2MO1A 3J81c 3H15A 1VS0A 1CQVA 1RD9D 3DM3A 2A73B 2WIIB 5FLXE 2VQEL 4OO1I 5J39A 5FKAC 5FJ8G 3H6MA 2OTJA 1SSOA 1L0WA 5CV4A 2BDNA 2IX3A 4JBJA 4P74A 3SK8A 4DPGA 1B9MA 3HOZH 1MIUA 3CAMA 2KCMA 4DV7Q 5IYCG 4BBSB 2M2LA 2F0GA 4CJ0B 4A3CH 3OMGA 1LTAD 3Q23A 2E2JB 2EYHA 4XT1B 2KENA 2HHHQ 2F03A 4XYQA 4JI7L 4A3DB 3MXPA 4K6LA 1I4QA 1YBYA 1LABA 3L2PA 1HJPA 4X62Q 4LUOA 1EOTA 4XQQA 2RA4A 1Z47A 3J7A5 3J80i 4HR7B 1NTGA 4IPCA 2VUMH 2BH2A 4R8NA 3ND8A 3RN2A 2OCEA 1K0SA 2EY2A 2YU9H 1CKOA 1BQQT 1SFOH 4YWMA 4LF6L 2MP1A 3S16B 3RZDH 2EYJA 4RGTA 4DXFA 1KIXA 1Y14B 3JAML 3NE5B 1AE2A 1PRTF 4LF4Q 4BY7B 2PZTA 2D5DA 3J7AV 2CW0C 4DF7A 4LF9Q 2QA4A 1T9HA 2A19A 1O7ZA 3UDIA 1A63A 3NBHB 4DR3Q 1JICA 4DR2L 2G9DA 4K2KA 1KLGD 3K7AB 5IGCA 2K04A 5D65A 3Q22A 2F0PA 3EQLC 5C3XA 5L37A 3HOVG 2Q8IB 1VF7A 3T16A 2Q8RE 4WJWA 4BXXH 4A3IH 1SRUA 1Q82C 4GN3B 3HOYH 1Q8IA 4JI0L 3CC2A 3FRPB 4C2MB 4OEMB 3HKZB 3E9HA 3BYTB 2IPKD 1TWAB 1DCZA 3E3XA 3PV0A 3ZYYX 1ASZA 2AQ2B 3QOLA 1K8GA 3BZKA 1VQCA 1KXLA 4X66Q 1DGSA 2VL6A 1M4VA 3I73A 1LTBD 1F9SA 3A5UA 1BBUA 1EIFA 1SYFA 2R93G 1AH9A 3DMUA 1ET9A 4M1UB 2CCZA 1X6OA 2ZXPA 2PW5A 2Z9HA 1VQ9A 1GHKA 2FHTA 1U4LA 1E24A 2MQHA 5GROA 4JK1C 4IUVA 4GKJL 2EPBA 3D4DA 5EKLA 4LK1C 5GAHC 4ULLA 4CKEA 4EX5A 3Q6SA 4DR5L 1GUWA 1U0LA 3PUZA 5IGEA 3DXJC 4DR7L 1F77A 4CDFC 1I3QB 1O80A 2DNEA 2IWHA 2VQEQ 3HOVB 1YHAA 5GADC 1HFGA 5JEAH 2OQKA 3K57A 5E1FA 1CSQA 2Z8LA 4DN4M 4JI2L 1EQQA 4X64L 1F2YA 2OEOA 1M1KC 3JAMi 1F2LA 1X3GA 3BZCA 1EIHA 1EZ8A 4ODGA 1EY4A 3G7LA 4JI8Q 1K8OA 2F0FA 4JI7Q 3K59A 3A7LA 1JJGA 1Y8PB 2NYZD 1B4OA 5M5YH 3QG1A 1Q46A 1PYSB 2LKVA 4YCWA 4UP7A 4X3KA 2R93B 5IP9G 1WTXA 5CYUA 1TY2A 3HS0C 3HZXA 1RIPA 5C5LA 3BU2A 2OWOA 3FKIH 4WRDA 4HIOA 1BCPC 1CZGA 4BS9A 2AHOB 4LF5L 4RWSC 2NB0A 3H91A 4RGMA 2VW9A 1NJIC 5EPKA 2KUMA 4LF6Q 3I7FA 5IWAL 3F2BA 1I6HH 1O7YA 1STHA 1KRTA 3SEBA 5C3EH 2K28A 4LW1A 2DGYA 1J8IA 1JOOA 1Q8KA 1TWCB 3MHBA 4LFCQ 1VQMA 2O4XA 1QB5D 2F3WA 3KBGA 2JA6G 3JC66 1N33L 3S14H 4DR2Q 3I72A 5EKIA 1KDAA 1GUNA 4DV6L 1K8AC 1BKBA 4N9PA 4QUCA 1WTOA 2KCTA 2RBMA 1QCBD 1ML0D 2MUYA 4ME3A 4JI0Q 4HSVA 4GOPC 3RLOA 5CR3A 1SMYD 1B50A 1SNQA 4RKBA 1XJVA 4JPBW 3EBEA 1CA5A 4B9XA 1BVSA 4AQYL 2O5JC 5HY6A 3MEHA 3BJUA 3V05A 2NWGA 3C1FA 2UXBL 1E2WA 1EZ6A 3V96A 4JI3L 1SXTA 2YTXA 1O78A 4R9WA 3NTKA 1STYA 5M3MG 1LV9A 1II3A 3VYUA 1G291 4ILWA 1EYCA 3TZUA 3CCQA 5DM73 4Q0FA 2PCFB 1SJED 4BBRH 5I9PA 2R61A 5C4XH 4DV2L 1EWCA 4POGA 3CD6A 3NELA 1PH5A 4HJ5A 1IHZA 2Z0SA 4S3SA 4IALA 1WTHA 1BCPB 2PMZE 1HPCA 4DR5Q 3KDFB 1TWHB 5LL6S 3S17H 2FMMA 1JT8A 2JA6B 1VQDA 4A93H 5C4JB 2N8NA 1CKNB 3TREA 4DR7Q 4A3JH 4JV5L 3ICEA 1E2ZA 2V1CC 2Q2IA 4KY5A 5G3LF 2O5IC 4G7HC 1CKNA 3M7NA 4IFDH 1RF2D 3SXHA 2GVBA 2WB1G 2X69A 2NVQH 4K5XA 4R4IA 3PO2H 1W6JA 5G3LD 3J81j 1B9NA 1VCIA 3HG9A 4JI2Q 2L0CA 3K58A 5T1IA 4X64Q 1K83H 5CBEE 3KF6B 3D4RA 1IBLL 4GN4B 3MEFA 2I5HA 3M3YH 2KHIA 3KF6A 1CI3M 1D1KA 4ME5A 1L0XB 2JA5G 4MZ9A 3RUZA 1ONLA 1TWGB 2R92H 1LTRD 5F2DA 5KNDA 3HOUG 3HOWG 2BA1A 3J80c 4A3BG 1HHVA 3VR3A 2RSOA 4DUYL 3R8BA 2AUKA 4A3GG 3PIPA 2CW0D 4FF4A 3K6OA 1J6QA 4ZUIA 2K5VA 2QEJC 3A74A 2K6AA 1B3AA 4PV1C 3OTOL 4P2CB 4LF5Q 1M90C 1VQ6A 3GTOB 2FFKB 1H95A 2EXZA 2Q2UA 4EQPA 4IPHA 1UEAB 2F3IA 2AWNA 2EYPA 2OT2A 4JW0A 2N49A 4IN3A 2JA8G 2RCFA 4L5RC 3GV6A 1IYUA 3HEJA 1EU4A 2ASBA 3BYYB 1SE4A 1AW7A 4C3JH 1V8QA 5JPMC 3UI2A 2XVSA 4IZ8A 2YV5A 2NTSA 4PMCA 5J3BA 1N9WA 4Y7NB 3GQBA 1G51A 1N33Q 4ZKBB 1Y69U 1EY6A 5M5WH 5IOCA 3EN2A 1LYLA 4DV6Q 2QF7A 1PFMA 1TY0A 3HKSA 2GN5A 1AZQA 1HTLD 3W2DA 1O7IA 4HJ7A 4BY1H 1XPRA 3F2DA 4Y52H 2G9HD 1WCMG 2UXCL 1DD2A 1WI5A 3STBD 2P5ZX 5E3FA 4N8FA 1IKMA 4AQYQ 4C3HH 3HOUB 2BE5C 5M5XB 3HOWB 4C3IH 1EYDA 3RR5A 4ZKCB 1MGSA 2XRQD 4B3TL 2UXBQ 2NZ1D 4JI3Q 1I4GA 1GUGA 4DR6L 3I70A 4F8MA 4A3GB 4GS3A 3RNUA 3IAYA 1F2ZA 2CQAA 1IXRA 1HUMA 1PVOA 2DUDA 1OXUA 2XSCA 4V190 3S1MB 4LMQD 4KHPL 5LMUL 5IP7H 1H9KA 5KGUA 1SN8A 2WB1E 4A3KH 4U68A 4DV2Q 2JA8B 3SHLA 3JAME 1RJTA 1FNWA 1STNA 3MXUA 5KRUA 4K2LA 2R3ZA 4QIWE 4DA2A 4JVZA 5GAEC 3D4WA 3M4PA 1ILQA 1CZWA 5HURA 5FLMG 3TDQA 1L1OC 4JV5Q 2ALYB 1E22A 2B2VC 4L63B 4RH6A 1UE7A 4EVOA 3MAQA 1SDFA 1BBXC 3SK6A 3JAMc 3RZOH 4NMZA 1MHWC 3L3OC 2A6HD 1C7YA 5AFWA 4CBVA 3S24A 1VMPA 5C44G 1J9OA 1PFNA 1TQOA 4OWTB 1IBLQ 2E2IH 1K9MC 3I55A 5FOBB 1XNQL 1BCPD 3NPPA 4LFAQ 1X3EA 2B2TA 3HOXG 3VR4A 1D5XC 2SOBA 2NVXB 3GTJB 1E7ZA 3PIOA 2RSNA 3FMCA 2A68C 4WJ3M 1EY0A 4K5VA 4DUYQ 2ZXOA 1TVXA 4L6TB 5ELBA 3UE1A 1Z9FA 4ZAIA 4IUTA 2NN6H 1WTVA 4A3EB 1EUJA 4BBSH 2N88A 2I5MX 4BWGB 2E2JH 4G7ZC 3HP3A 1PH7A 1BBWA 3S2DB 3OYYA 4A3DH 3BVZA 2BDOA 3HFZB 5EAYA 1TT2A 2EZVA 1U5KA 1RL2A 1HA5A 3R2IA 2HDMA 3FHWA 2GVAA 3IKJA 2CVRA 4AYBG 1RTOA 2MJ8A 4HMJA 4KV6A 2PQAB 1XTDA 4P72A 1L0YB 1LM0A 5C5MA 2QGQA 2PQAA 5GAGC 2CH4W 2FJ2A 4XT3B 4YIJA 3OW2A 4OO1G 3VA5A 5C44B 4DUZL 3PF4A 3S16H 4B3RL 1S5ED 4U673 4BY7H 3A8KE 2D0PA 2KVMA 4A3KB 1Y1VB 1K0RA 2B2VA 1K3BC 4IUQA 4KKTA 4GKKL 5T1GA 3OOCA 1EQTA 5FJ8H 5IGFA 4B3TQ 3K7AH 3NK9A 2HT1A 5CORA 4DR6Q 3C3LA 4OWWB 2D2CC 4K5WA 4FP5D 5IYCH 4UDUC 3NSWA 4C56C 5LMUQ 4C2MH 3WWVA 2K52A 3H3VC 1GO3E 4DK1A 4IOAA 1TWAH 4K8IA 1WYDA 2EJMA 3QB3A 3DLLA 4ZYSA 5M9OA 3H94A 4FF1A 5JOBA 3PIP3 1PFBA 1TIID 2OF1A 2EYLA 4YHHL 4C1NK 1IBMQ 3QR8A 1PYBA 1PZID 2PNRC 3NWSA 4LJZC 2EYMA 3EIVA 1JCKB 4G4KA 3A7AB 4ABNA 1WVLA 4XXEA 1IBKL 2L55A 1W2BA 3T53B 2B29A 3D6WA 1AFPA 4IPDA 2D0OA 2Z1CA 1QUQB 2K5DA 3M85A 3TS2A 3SVMA 4B9WA 3ERQA 3OSOA 1FJGQ 1QUQA 3GD7A 1F9RA 1AEXA 1F2MA 2EY6A 1EQVA 2DJFC 3IRBA 4JI8L 5C0XI 1XNQQ 1I50B 3J7YW 1JJCB 1MSHA 1PV4A 5JVG3 5JJLA 4DGZA 1I3QH 3HOVH 2BA0A 4ZCKA 3TS0A 4PMBA 4XDXA 4UAIA 3PO3G 4QMGA 1HUNA 3NQTA 3M4OB 1HH2P 1X54A 4NW2A 4H13C 1HZCA 3MWYW 3T1HL 1I5FA 3PUWA 4B3SL 2R7ZG 5A2QL 3W5OA 4MHEA 1VQEA 4GLXA 3TP5A 3I56A 2EYFA 1YHBA 4HSPA 4FDBA 2WV6D 4LFCL 5BN5A 1SEBD 1JORA 5IT9L 2R93H 1GUTA 3TN2A 5ELOA 2SDFA 4HIKA 4WFN3 4KY6A 2SNSA 5HGQA 3P1HA 4A3FG 3M9BA 3VDYA 1YJ9A 3CHBD 2BE5D 3LWEA 1M8AA 3HOZG 3S1QB 2YTVA 4FYDA 3I4LA 2IW3A 2DN8A 2ID0A 2K32A 5KNCA 1YJNA 1TWFB 3MA2B 4DUZQ 1BUVT 4DKAC 1YITA 4B3RQ 4N9TA 1CK1A 4NB3A 3UDGA 1TWCH 1FYCA 2QCPX 2JJQA 2TSSA 5IIFA 1B2TA 2JP1A 1IYJB 2PQEA 4K0KQ 1CM9A 4LF7L 4GKKQ 1U4RA 3PO3B 4CKBA 4DR1Q 1MBYA 1JJ2A 5C4ZA 2VUMG 1DXMA 1UAPA 2L4NA 3ND9A 1V1PA 4TSSA 2QDBA 2AKWB 2IL8A 3STBC 2F0NA 2K7VA 1STAA 2NVTB 3CP0A 1XX8A 2MPMA 1QOHA 3PIO3 1AZPA 5KIXA 1ASYA 2KECA 3GDEA 2K1BA 2I46A 1H9JA 2ZJQA 2JA7G 3P75A 1RDPD 4YHHQ 1E1TA 3NP8A 3OPOA 4IOCA 2MGSA 3CCUA 3CCJA 3CW2C 4A3FB 4BA1I 1L2FA 3UDXA 2B8GA 2MO0A 4BXXG 1IBKQ 2KCCA 4QJFA 3KOJA 2NVYB 2H1EA 3Q24A 1STGA 1A6XA 4QQBX 1RHPA 2WKCA 2FMCA 4K14A 1SR3A 4YWKA 4DV3L 2A68D 3E0EA 3M4QA 1E3PA 1HZBA 2VQFL 2AMCB 3PMFA 1TWHH 3I4MG 2JA6H 2JEAI 4RGOS 3KLSA 5C4JH 4X3SA 3NQIA 1XWEA 4NKLA 3UDFA 1A15A 2A6HC 1I4HA 2XGTA 5JEAJ 1EU3A 1ESRA 3U58A 1S5FD 3LWUA 1E1OA 4RMFA 3FVQA 1C9OA 2RKSA 1HXYD 2E74C 2JQOA 3T1HQ 3BVMA 3PSIA 4TQUS 4IUUA 3TEHB 1X3PA 5HGTA 4A3MG 2RHSB 4B3SQ 1Z7TA 1AE3A 3ONAB 1UUPA 1KQSA 1JR0D 5C3WA 1E0BA 1NAPA 1MSGA 4OX9L 1TWGH 4B3ML 1LLRD 4ZRZA 1JWMD 1LT4D 1ZYRC 1QILA 5DAUA 1PH2A 3CMAA 1EFWA 1A62A 1G2TA 2B2YA 5JEAG 3CCVA 2WFWA 2K01A 3AFPA 3TMEA 1SAPA 1EQRA 1HZAA 1H9SA 2L1BA 3GTOH 4P71A 5J1ZA 3GTPB 3X3MA 2PMZB 5FO8B 4HJ8A 1X55A 2LXJA 4DV1L 1MD2D 3I4MB 4DAVA 5FLXL 5K36G 5JAVA 1PH3A 2XRSD 2HD3A 3H0GG 4OONA 2EOTA 3CXCA 4KI0A 2J7ZA 1T5XD 3E9IA 4Y7NH 1YIJA 4RG1A 3E6ZX 1TU2B 2A69D 1YI2A 4LF7Q 4CKCA 4HJ9A 4PNYA 4NXNQ 3ERSX 1S5BD 3OMCA 1RTNA 1PH8A 3KYHC 3E0JA 2ATWA 2HQLA 4A3MB 5I2YA 2B2WA 4KJOA 1XPUA 1I94L 4CDDC 5C3EG 2CKZB 3DM1A 4LAAA 2F0DA 3Q8DA 2F52A 2OXPA 2J0TD 1R9TB 2I0QA 1SYDA 1B70B 3HOUH 2QEXA 5M5XH 1N8RC 3HOWH 3PGZA 2K5HA 2N55A 4HCEA 4POFA 5C6AA 5IYBH 1JOQA 4A3GH 2PI2A 1VQIA 4GNXB 1PXUA 3K0XA 2K03A 4OGQC 3S1MH 2V4DA 2H4OA 1B1ZA 2NZOA 4GNXA 1HRJA 3L9AX 1AN8A 3WDNA 3J80E 1TXYA 3HRZC 4V0BA 1MI2A 1JB7A 5FK9C 2JA8H 4DNIA 1WTPA 2F0LA 4DV3Q 2L15A 1UE5A 5ELCA 1X3FA 1FVIA 4CGYB 3H0GB 4B08A 2VQFQ 4LFAL 4KHZA 4JI4L 3TRZA 1LT3D 1FNVA 4DAMA 5I6WA 3PUYA 1W6KA 3IL8A 4HN7A 5M3MB 1K8MA 1EIYB 3KJPA 2RHQB 4DK3C 2B8FA 1IL8A 2PI2E 4RHRA 1KL9A 1NNXA 4JBMA 1YNXA 2K05A 1ENCA 2VB2X 4OWXB 2R6GA 4FVMA 1UE1A 3KJOA 2XIWA 3DWPA 2EY5A 3I3CA 3S2HB 3AQQA 1BOSA 1EEFD 1XTCD 1SBBB 1U9RA 4A3LG 4OX9Q 2IX0A 1LTTD 4HEDA 2NVXH 3K81C 3GTJH 4B3MQ 4LUZA 4KJNA 3W3AA 4A3JG 1U4MA 1S5DD 2A1AA 2K75A 5I2XA 5CV9A 1KRSA 1KAAA 1CUKA 1KTKA 1ET6A 2ZT9C 1Q90A 3DHQA 3NUCA 2D62A 1VDZA 2WB1B 2XTIA 2B2TC 3R3OA 4A3EH 2PW7A 1HR0W 3A54A 1SE8A 2KEEA 1X56A 3KBXA 4QIWB 4IO9A 3S2DH 4QY7A 1D5ZC 1GHJA 2XNAC 4KK7A 4DV1Q 4PZ7A 1PTOB 2JA5B 2R92G 3K80C 1QJOA 3CU7A 2UUCL 2E2HB 3T1YQ 3T4AC 1U4PA 3AEVA 2CWPA 1Y1WG 4A3BB 2PZWA 3IFTA 2Q8TA 1N36Q 3F2UA 3I8ZA 5D14A 2B3GA 5M3FG 4E6IA 2DNCA 2OTLA 1A3VA 1FGBD 3VR6A 5C44H 3OIQA 4ID6A 2QW7A 1SROA 3GTKB 3AFQA 2IY5B 2SEBD 3BG3A 5E4WC 3FPUB 2ES2A 1I94Q 1Q1BA
chains in the Genus database with same CATH topology
1CHPD 3WOFA 4OIKA 3QO2A 4XQNA 2KOLA 1ENAA 5IGDA 4IFDI 2D9UA 4OIJA 5IT9E 3GTQB 1IYVA 1JC7A 3OIPA 1LACA 1XXGA 3T13A 3P20A 2KQ3A 5EGTA 5EJWA 2KJXA 3TP7A 2F0IA 2CHBD 4EQNA 4CJ2C 4KD4A 3T51B 1WCMB 4L8JA 3IFDA 1BCPF 4DFAA 1JWSD 4C3IG 1TS3A 1EWHA 3BDCA 1Y1WB 1NSNS 1GJXA 1CT1D 5EPJA 1WD1A 2EJFC 1PDQA 3RD4A 5IGGA 2GA4B 3MFYA 4DU9A 5M3FB 4KHVA 4H44C 4OO1H 1IW7D 4K8JA 2XWJB 1KNAA 4I65A 1ZYRD 5CC4A 4PQXA 2PO4A 1GUOA 3VR5A 3CKIB 1QNUA 4I7ZC 3S9WA 1PRTB 1R4QB 3P7JA 4NP5A 3GTLB 2C9OA 4EGVA 4FXDA 2L9HA 2EJGC 1VMCA 2LFNA 1YNJD 3BDLA 4KMUC 5C0XJ 4HAEA 1OXSC 1I4PA 3G6JB 5COYA 4X3TA 4FF3A 4IUNA 1YNNC 5CV7A 2LS01 4X3UA 5NUCA 1CA6A 3D6CA 3GP7A 3TP8A 3C1EA 2FINB 2RDFA 4RHSA 3EROA 2EDGA 3HOXB 3GTGB 3A8IE 4Q5VA 2EE1A 5BN3A 5ELFA 2AUJD 3SK5A 1NR4A 3CQZB 3QWNA 5C0XG 2MHVA 2JYOA 1RKNA 2IX1A 3V2TA 1JB3A 1HCZA 2A5HA 1EIGA 4XTCS 1C48A 1STEA 2B2UA 2J4XA 1CHQD 3K5MA 2A69C 3MC0B 3SDZA 2F0MA 1Q12A 3M7GA 3VR2A 1RCVD 1PTOD 1DJRD 3DEPA 3S1NB 3CRLC 3VYRA 1X3QA 4AYBB 3LNNA 1AP0A 2NBFA 1ENFA 3D8GA 3U9OA 3BVGA 4XYOA 1SNDA 2WINB 1BO0A 3K0YA 2F0JA 2F0KA 3CRKC 1KABA 5DEHA 3OW7A 4IUPA 1S5CD 4RAUC 5CBAE 4QUFA 2VB3X 4NDXA 1WTQA 3BS1A 2NN6I 1PZKD 5D3DA 2ENBA 2VXWA 1DYQA 4FF2A 3J7AF 5I9OA 4RKLA 5DM63 3K5LA 4DNRB 3GTMB 1A3TA 3S15B 1Y8NB 2LY7A 1TR5A 1FR3A 3QJYA 4QF4A 4KKSA 3AB9A 1KLUD 1PZJD 1EY9A 1TS4A 3LX0A 3N6RA 4DK0A 4F87A 2B63B 3MVVA 1SE3A 3NHHA 2L11A 3NTHA 3S1RB 4ZK9B 3PUVA 1X32A 1SNCA 1B44D 3KLSX 3NWTA 4F7XA 3DWAA 1JOKA 2DY7A 5EBCA 4FO2A 3X3NA 2K33A 4Z9CB 5CMDA 4RFBA 1SYCA 1PRTD 2QILA 1F9QA 4J8QA 3NBHA 3SE0A 5A35A 3RMHA 1D6EC 1TS5A 2HCCA 1GXDC 3TZDA 3E5SA 5JVH3 1QG7A 1V1PB 4O1NA 2PZUA 3MZ5A 2RVLA 5DNFA 2IJ0A 2LMCB 5LHY1 2R7ZB 5E4XA 2B2YC 4KN4C 3A55A 1GUSA 3KK7A 1DZ1A 2XWBB 1IKLA 3URYA 3A56A 1UNSA 1LTSD 2JE6I 4HCSA 1T5EA 4RCOA 1WTWA 2KHSA 3HGBA 3HOZB 1FD7D 3A8JE 3KF8A 2AQ1B 4MN3A 5EKKA 3M4YA 3D3RA 5LL6X 2EVBA 1EY8A 2XN9C 2B2WC 1FNUA 2K5QA 2WKDA 2K5WA 1R4PB 4IQZA 2VUMB 2O2LD 5EPLA 1OO9B 4F88A 2YU9B 4OL7A 3AMUA 1SFOB 5ELDA 2ICIA 2M9VA 1ZEQX 2F0QA 3RZDB 1A2UA 5K36H 2WAQB 3Q0AA 2EYOA 1SNOA 2RQXA 3NBIA 1YNND 2F0HA 1IW7C 2A6EC 2WP8J 2JA7B 3J81L 3C2PA 3DEOA 5CV5A 3VA7A 4A3IB 3WOEA 3HOYB 1H9SB 5CGKA 1XYIA 3VYSA 5I4DA 5KYIA 1HA6A 3H09A 1EY7A 1DOLA 2NUCA 3BZDB 5IODA 5JPNC 2E2DC 5IGBA 1YNJC 1H9MA 1CTMA 5BN4A 1Q1EA 5FO7B 4J1MA 1KDCA 1QE6A 1JE4A 4DNTB 1HTPA 2I07B 1DM0B 3D31A 5I6YA 1QNKA 3I91A 4KTAA 2ICEC 3SK4A 1DONA 3L7ZC 1BNZA 1HFNA 1JQYD 2E76C 3OWFA 2B39A 1O7LA 3EFXD 1PTOH 1C4QA 3C46A 1V1OA 4PMWA 4HTHA 1STBA 4TKOB 2BCOA 1OXVA 1RODA 3O13A 1D1IA 1F9PA 4ZLTF 2JEBI 2C5CA 2F4IA 2PYKA 1I6VC 1ICWA 1PTOC 1ESFA 1CFMA 1LT5D 3EA6A 2WACA 3N52A 4FNFA 5M5YB 1SNPA 4XQJA 4KKUA 3GO5A 3FKIB 4IFDJ 1SE2A 3GV3A 1I4RA 1PLFA 1ZKOA 3TSSA 1BXTA 4G7OC 5CV8A 5D3IB 2BOSA 1I6HB 1SYBA 5C3EB 3T56B 3SR1A 3RLFA 2PPBC 3OWEB 1PYWD 1SYEA 3S14B 2KA7A 4R8IA 4G57A 3TBIB 3PUXA 5TSSA 2SNMA 3NXWA 3QIAA 1I4XA 4IFDG 4GZYC 1S4ZA 2QKIC 4DAPA 1SJHD 4EQOA 3VYTA 1NCVA 3I90A 1LO5D 1A3UA 1SYGA 4RCNA 2F0SA 2AQ3B 1H9RA 1TKWB 2ZXRA 4KN7C 1V43A 1G2SA 4WORA 5FO9B 2M00A 3EVQA 4XIGS 5ISRA 1PRTC 3U9SA 4BBRB 3EJIA 1GOZA 5C4XB 1G91A 1KDBA 3FPPA 4J6HA 1E2VA 2YYZA 4KD3A 4OHJA 3QOJA 5A2QE 1PMRA 4H7BA 4KY7A 3S17B 3DUZA 1G6ZA 2A74C 4A93B 1NUCA 4C3JG 1D2BA 1Q3LA 4A3JB 2IT1A 4H0LC 2KEDA 5EBDA 1D5MC 2Y0SB 2F3VA 4M8AA 2F0OA 3PO2B 2NVQB 1B53A 1K83B 4FXGC 3AU7A 2F0WA 4O42A 2JSOA 1EYAA 2X6LA 3M3YB 1LTGD 4DAYA 2R92B 4HMIA 2RDGA 4C3HG 2L12A 2B2UC 1KNEA 1QWYA 4ZQ3A 2AWOA 1EL0A 3OHXC 3ITPA 3R93A 3DWQA 3BDOA 3K5OA 4C1NI 2A6ED 1DOMA 2L5TA 2NTTA 1G8ZD 2Z4HA 2KCNA 4DXGA 5JJZA 3NTIA 4ZUJA 2HCIA 1HQMC 1OXTA 1NR2A 3FEWX 5C4HA 5KEEA 4C3JB 2F1MA 2F0VA 5C0XH 4RA8A 1BF4A 1HQRD 5M5WB 3K5NA 4CHTB 2JXMB 4BA2I 3I4NB 1WD0A 2F0TA 1OXXK 5ELEA 2TMPA 4BY1B 2HQEA 1TS2A 1VF5C 1SNMA 3MTSA 4C3HB 3KLRA 4C3IB 5K5PA 1JWUD 4FXKC 2F0EA 1DOKA 1Z6HA 3FDTA 5KNBA 5KYLA 5EQ0A 2VNUD 1LTID 1EEID 2X6GA 4RGNA 3J80L 1BDOA 2EY1A 1C8CA 2NN6G 2F0UA 2HDLA 5J22A 4QCLA 2Z4IA 4TRDA 1Y8OB 1LT6D 1WTRA 2RDHA 3R2TA 4K6DA 4QB4A 1PTOF 4JBWA 1EY5A 1A2TA 1ILPA 1SMYC 1ZXTA 4CJ1B 3J81E 1CQFA 1BR9A 3RZOB 2HUGA 5CV6A 3MFGA 3MXNA 3TP6A 3MXGA 4MIUA 2DY8A 4IURA 2E2IB 1EFID 2E75C 3KUPA 1CQVA 1RD9D 2A73B 2WIIB 5FLXE 4OO1I 5J39A 5FKAC 3H6MA 1SSOA 5CV4A 2BDNA 2IX3A 3SK8A 1B9MA 4BBSB 2M2LA 2F0GA 4CJ0B 3OMGA 1LTAD 3Q23A 2E2JB 2EYHA 4XT1B 2F03A 4XYQA 4A3DB 3MXPA 4K6LA 1I4QA 1LABA 4XQQA 1EOTA 2RA4A 1Z47A 4HR7B 4R8NA 3ND8A 2EY2A 1BQQT 2MP1A 3S16B 2EYJA 4RGTA 4DXFA 3JAML 4BY7B 3NE5B 1PRTF 2PZTA 2D5DA 3J7AV 2CW0C 4DF7A 1O7ZA 1JICA 2G9DA 4K2KA 1KLGD 3K7AB 5IGCA 2K04A 5D65A 3Q22A 2F0PA 3EQLC 5C3XA 2Q8IB 1VF7A 3T16A 2Q8RE 4WJWA 1Q8IA 3FRPB 4C2MB 3HKZB 3BYTB 2IPKD 1TWAB 1DCZA 3PV0A 3ZYYX 2AQ2B 3QOLA 1M4VA 3I73A 1LTBD 1F9SA 1SYFA 3DMUA 1ET9A 4M1UB 2ZXPA 2PW5A 1GHKA 2FHTA 1U4LA 4JK1C 4IUVA 2EPBA 3D4DA 5EKLA 4LK1C 4ULLA 4CKEA 3Q6SA 1GUWA 3PUZA 5IGEA 3DXJC 1F77A 1I3QB 1O80A 2DNEA 2IWHA 3HOVB 1HFGA 5JEAH 3K57A 5E1FA 2Z8LA 4DN4M 1F2YA 2OEOA 1F2LA 1EIHA 1EZ8A 4ODGA 1EY4A 3G7LA 1K8OA 2F0FA 3K59A 3A7LA 1Y8PB 2NYZD 1B4OA 3QG1A 2LKVA 4X3KA 2R93B 1WTXA 5CYUA 1TY2A 3HS0C 3HZXA 5C5LA 4WRDA 1BCPC 1CZGA 4BS9A 4RWSC 2NB0A 3H91A 4RGMA 5EPKA 2KUMA 1O7YA 1STHA 3SEBA 2K28A 1J8IA 1JOOA 1TWCB 3MHBA 2O4XA 1QB5D 2F3WA 3KBGA 3I72A 5EKIA 1KDAA 1GUNA 4N9PA 4QUCA 1WTOA 2RBMA 1QCBD 1ML0D 2MUYA 4HSVA 5CR3A 1SMYD 1B50A 1SNQA 4RKBA 1CA5A 4B9XA 2O5JC 3MEHA 3V05A 2NWGA 3C1FA 1E2WA 1EZ6A 3V96A 1SXTA 1O78A 4R9WA 3NTKA 1STYA 1LV9A 1II3A 3VYUA 1G291 4ILWA 1EYCA 3TZUA 5DM73 4Q0FA 2PCFB 1SJED 5I9PA 2R61A 1EWCA 1IHZA 4S3SA 4IALA 1BCPB 1HPCA 1TWHB 5LL6S 2FMMA 2JA6B 5C4JB 1E2ZA 4KY5A 5G3LF 2O5IC 4G7HC 3M7NA 4IFDH 1RF2D 3SXHA 2X69A 4K5XA 1W6JA 5G3LD 1B9NA 1VCIA 3HG9A 2L0CA 3K58A 5T1IA 5CBEE 3D4RA 1CI3M 1D1KA 4ME5A 1L0XB 3RUZA 1ONLA 1TWGB 1LTRD 5F2DA 5KNDA 2BA1A 1HHVA 3VR3A 2RSOA 3R8BA 2AUKA 2CW0D 4FF4A 3K6OA 4ZUIA 2QEJC 2K6AA 1B3AA 4PV1C 4P2CB 3GTOB 2FFKB 2EXZA 4EQPA 1UEAB 2AWNA 2EYPA 2OT2A 4IN3A 3GV6A 1IYUA 3HEJA 1EU4A 3BYYB 1SE4A 1AW7A 1V8QA 5JPMC 3UI2A 2XVSA 4IZ8A 4PMCA 2NTSA 4Y7NB 3GQBA 4ZKBB 1Y69U 1EY6A 5IOCA 2QF7A 1PFMA 1TY0A 1AZQA 1HTLD 3W2DA 2G9HD 1DD2A 5E3FA 1IKMA 3HOUB 2BE5C 5M5XB 3HOWB 1EYDA 4ZKCB 1MGSA 2XRQD 2NZ1D 1I4GA 1GUGA 3I70A 4F8MA 4A3GB 3IAYA 1F2ZA 2CQAA 1HUMA 1OXUA 2XSCA 4V190 3S1MB 4LMQD 1H9KA 5KGUA 4U68A 2JA8B 3SHLA 3JAME 1RJTA 1FNWA 1STNA 3MXUA 5KRUA 4K2LA 2R3ZA 4DA2A 3D4WA 1ILQA 1CZWA 5HURA 3TDQA 2B2VC 4L63B 4RH6A 4EVOA 3MAQA 1SDFA 1BBXC 3SK6A 4NMZA 3L3OC 2A6HD 5AFWA 4CBVA 1VMPA 1J9OA 1PFNA 1TQOA 5FOBB 1BCPD 3NPPA 2B2TA 3VR4A 1D5XC 2SOBA 2NVXB 3GTJB 2RSNA 3FMCA 2A68C 1EY0A 4K5VA 2ZXOA 1TVXA 4L6TB 5ELBA 1WTVA 4ZAIA 4IUTA 2NN6H 4A3EB 2N88A 4BWGB 4G7ZC 3HP3A 3S2DB 3BVZA 2BDOA 1TT2A 2EZVA 1HA5A 3R2IA 2HDMA 3IKJA 2CVRA 1RTOA 2MJ8A 4HMJA 4KV6A 1L0YB 5C5MA 2FJ2A 4XT3B 4YIJA 4OO1G 3VA5A 5C44B 1S5ED 4U673 3A8KE 2KVMA 4A3KB 1Y1VB 2B2VA 4IUQA 4KKTA 5T1GA 3OOCA 1EQTA 5IGFA 3NK9A 5CORA 3C3LA 2D2CC 4K5WA 4FP5D 4UDUC 3NSWA 4C56C 3H3VC 4DK1A 4K8IA 2EJMA 3QB3A 4ZYSA 5M9OA 3H94A 4FF1A 5JOBA 3PIP3 1PFBA 1TIID 2OF1A 2EYLA 4C1NK 1PZID 2PNRC 3NWSA 4LJZC 2EYMA 1JCKB 4G4KA 3A7AB 4ABNA 1WVLA 4XXEA 2L55A 3T53B 3D6WA 1AFPA 2Z1CA 3M85A 2K5DA 3SVMA 4B9WA 3ERQA 3OSOA 3GD7A 1F9RA 1AEXA 1F2MA 2EY6A 1EQVA 5C0XI 1I50B 3J7YW 1MSHA 5JVG3 4DGZA 2BA0A 4PMBA 4XDXA 4UAIA 4QMGA 1HUNA 3NQTA 3M4OB 4NW2A 4H13C 3MWYW 3PUWA 5A2QL 4MHEA 3TP5A 2EYFA 4HSPA 2WV6D 5BN5A 1SEBD 1JORA 5IT9L 1GUTA 3TN2A 2SDFA 4WFN3 4KY6A 2SNSA 3P1HA 3CHBD 2BE5D 3LWEA 1M8AA 4FYDA 3S1QB 3I4LA 2IW3A 2DN8A 2ID0A 2K32A 5KNCA 1TWFB 3MA2B 1BUVT 4N9TA 1CK1A 1FYCA 2QCPX 2TSSA 5IIFA 1B2TA 2JP1A 2PQEA 1CM9A 1U4RA 3PO3B 4CKBA 1MBYA 5C4ZA 1DXMA 1UAPA 2L4NA 3ND9A 1V1PA 4TSSA 2QDBA 2IL8A 2F0NA 2K7VA 1STAA 2NVTB 1XX8A 2MPMA 1QOHA 3PIO3 1AZPA 5KIXA 2KECA 2K1BA 2I46A 1H9JA 3P75A 1RDPD 3OPOA 3NP8A 2MGSA 4A3FB 4BA1I 2B8GA 2KCCA 2NVYB 2H1EA 3Q24A 1STGA 1A6XA 1RHPA 2WKCA 2FMCA 4K14A 2A68D 3PMFA 2JEAI 4RGOS 3KLSA 4X3SA 3NQIA 1XWEA 4NKLA 1A15A 2A6HC 1I4HA 5JEAJ 1EU3A 1ESRA 1S5FD 3LWUA 3FVQA 2RKSA 1HXYD 2E74C 3BVMA 4TQUS 4IUUA 1X3PA 5HGTA 1Z7TA 3ONAB 1UUPA 1JR0D 5C3WA 1E0BA 1NAPA 1MSGA 1LLRD 4ZRZA 1JWMD 1LT4D 1ZYRC 1QILA 5DAUA 1G2TA 2B2YA 5JEAG 2K01A 3TMEA 1SAPA 1H9SA 2L1BA 5J1ZA 3GTPB 3X3MA 2PMZB 5FO8B 1MD2D 3I4MB 4DAVA 5FLXL 5K36G 5JAVA 2XRSD 2EOTA 4KI0A 2J7ZA 1T5XD 3E6ZX 1TU2B 2A69D 4CKCA 4PNYA 1S5BD 3OMCA 1RTNA 3E0JA 4A3MB 5I2YA 2B2WA 4KJOA 3DM1A 4LAAA 2F0DA 2OXPA 2J0TD 1R9TB 1SYDA 2N55A 4HCEA 5C6AA 1JOQA 1PXUA 2K03A 4OGQC 2V4DA 2H4OA 1B1ZA 1HRJA 3L9AX 1AN8A 3WDNA 3J80E 3HRZC 4V0BA 1MI2A 5FK9C 1WTPA 2F0LA 5ELCA 4CGYB 3H0GB 4B08A 4KHZA 1LT3D 1FNVA 5I6WA 3PUYA 1W6KA 3IL8A 4HN7A 5M3MB 1K8MA 2B8FA 1IL8A 4RHRA 2K05A 1ENCA 2VB2X 2R6GA 4FVMA 2XIWA 3DWPA 2EY5A 3I3CA 3S2HB 1BOSA 1EEFD 1XTCD 1SBBB 1U9RA 2IX0A 1LTTD 4HEDA 4KJNA 3W3AA 1U4MA 1S5DD 5I2XA 5CV9A 1KAAA 1KTKA 1ET6A 2ZT9C 1Q90A 3DHQA 3NUCA 2D62A 1VDZA 2WB1B 2B2TC 3R3OA 2PW7A 3A54A 2KEEA 3KBXA 4QIWB 1D5ZC 1GHJA 2XNAC 4KK7A 1PTOB 2JA5B 1QJOA 3CU7A 2E2HB 3T4AC 1U4PA 4A3BB 2PZWA 3IFTA 2Q8TA 3F2UA 3I8ZA 5D14A 4E6IA 2DNCA 1A3VA 1FGBD 3VR6A 3OIQA 4ID6A 3GTKB 2SEBD 3BG3A 5E4WC 3FPUB 1Q1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Y W;  4V19 0; 
#chains in the Genus database with same CATH topology
 1Y1V H;  1CHP D;  3WOF A;  4OIK A;  3QO2 A;  4XQN A;  2KOL A;  1QVC A;  1ENA A;  5IGD A;  4IFD I;  2D9U A;  4OIJ A;  3CQZ H;  1IBM L;  1VQ8 A;  5IT9 E;  4UPA A;  3GTQ B;  1JC7 A;  5AJ3 L;  1QZH A;  3CCS A;  4JYA L;  1IYV A;  3OIP A;  4JOI A;  1LAC A;  1XXG A;  3T13 A;  3P20 A;  2KQ3 A;  5EGT A;  5EJW A;  3I4N G;  2KJX A;  3TP7 A;  2F0I A;  2CHB D;  3CCL A;  4EQN A;  1MKH A;  4CJ2 C;  4KD4 A;  4BY1 G;  3T51 B;  1FJG L;  2OQ0 A;  4J15 A;  1WCM B;  4PZ8 A;  4L8J A;  5IT9 c;  3IFD A;  1BCP F;  4DFA A;  1JWS D;  4C3I G;  1TS3 A;  2UXD L;  1EWH A;  3BDC A;  1Y1W B;  4JI4 Q;  1NSN S;  1Q86 C;  1GJX A;  1CT1 D;  2K4K A;  5EPJ A;  1WD1 A;  3K7U C;  4YY3 L;  2EJF C;  1PDQ A;  3RD4 A;  5IGG A;  2GA4 B;  1VQJ A;  3MFY A;  4DU9 A;  5M3F B;  2CQO A;  1WOC A;  4H44 C;  4KHV A;  4OO1 H;  1IW7 D;  4K8J A;  2XWJ B;  2LSS A;  1KNA A;  4I65 A;  3KFU A;  1ZYR D;  3KLW A;  5CC4 A;  5JJK A;  4PQX A;  2PO4 A;  1GUO A;  3VR5 A;  3CKI B;  1QNU A;  4I7Z C;  3S9W A;  1PRT B;  1R4Q B;  2UUB Q;  1Q7Y C;  1I50 H;  3P7J A;  4NP5 A;  1QVG A;  3GTL B;  2C9O A;  4EGV A;  4FXD A;  2VZA A;  2L9H A;  2EJG C;  1VMC A;  2LFN A;  1YNJ D;  3BDL A;  4KMU C;  5C0X J;  4APV A;  4HAE A;  1OXS C;  1I4P A;  4O0A A;  3M4O H;  3F1Z A;  3G6J B;  3G4S A;  5COY A;  4X3T A;  4FF3 A;  1VQP A;  4IUN A;  1YNN C;  4L5Q A;  5CV7 A;  2LS0 1;  4X3U A;  5NUC A;  1YHQ A;  1CA6 A;  1YZ6 A;  2DJG C;  4ALP A;  3D6C A;  3GP7 A;  3TP8 A;  1G6P A;  3C1E A;  2FIN B;  2RDF A;  1J5E L;  4RHS A;  3ERO A;  1UWV A;  4L5S A;  2EDG A;  3HOX B;  3GTG B;  3H3V H;  3A8I E;  4Q5V A;  2A8V A;  2EE1 A;  4K0K L;  5BN3 A;  5ELF A;  2AUJ D;  2UUC Q;  3SK5 A;  1B3Q A;  4OXP A;  1NR4 A;  4DR1 L;  3CQZ B;  2MNA A;  1HNX L;  3QWN A;  5C0X G;  2MHV A;  1CSP A;  2JYO A;  1RKN A;  2IX1 A;  3S1Q H;  3U4Z A;  3V2T A;  1JB3 A;  4BBS G;  1HCZ A;  2A5H A;  3F2C A;  1EIG A;  1VQN A;  3PCO B;  4XTC S;  1TWF H;  1C48 A;  1STE A;  2B2U A;  2J4X A;  1CHQ D;  1PH1 A;  1V1Q A;  4A3D G;  4R4C A;  1KAW A;  3K5M A;  4H02 A;  2A69 C;  3MC0 B;  3SDZ A;  2F0M A;  1Q12 A;  3M7G A;  3VR2 A;  4A76 A;  1RCV D;  1PTO D;  1DJR D;  3DEP A;  5IYD G;  3S1N B;  3CRL C;  3VYR A;  2C35 B;  1XPO A;  3SGI A;  3PO3 H;  1X3Q A;  4AYB B;  2BH8 A;  2B63 G;  1OTC A;  5AJ3 Q;  3LNN A;  1AP0 A;  4JYA Q;  2NBF A;  1ENF A;  1YEZ A;  3D8G A;  2E8G A;  3U9O A;  3BVG A;  4XYO A;  4X65 L;  3ULP A;  2IHE A;  1SND A;  2WIN B;  2NVT H;  1BO0 A;  2N78 A;  3K0Y A;  2F4V L;  4JG2 A;  2F0J A;  2F0K A;  3CRK C;  4JI6 L;  2JA9 A;  1HR0 Q;  1KAB A;  5DEH A;  1VQ4 A;  3OW7 A;  4IUP A;  1S5C D;  4RAU C;  4QUF A;  5CBA E;  2VB3 X;  3ULL A;  4TVA B;  4NDX A;  4PG3 A;  1PHJ A;  1WTQ A;  3CCM A;  2UXD Q;  4NPS A;  3BS1 A;  2NN6 I;  4A3F H;  4YY3 Q;  1PZK D;  1FGU A;  5D3D A;  2ENB A;  2VXW A;  2ZTD A;  4DV0 L;  1JMC A;  3W1B A;  2NVY H;  1DYQ A;  2RCN A;  4FF2 A;  5BR8 L;  5I9O A;  4RKL A;  5DM6 3;  3J7A F;  4AYB E;  3HKZ G;  5FLX c;  3K5L A;  4DNR B;  3GTM B;  1UE6 A;  1A3T A;  3S15 B;  1Y8N B;  2EQS A;  4IJL A;  2LY7 A;  1TR5 A;  1FR3 A;  1D7Q A;  3QJY A;  4QF4 A;  3ER0 A;  4KKS A;  3AB9 A;  1KLU D;  3U4V A;  1PZJ D;  1EY9 A;  1TS4 A;  2MFI A;  3LX0 A;  1K73 C;  3FP9 A;  3N6R A;  3I2Z A;  2ZM6 L;  4DK0 A;  4F87 A;  1PH9 A;  2B63 B;  3MVV A;  1SE3 A;  3NHH A;  1FL0 A;  2L11 A;  3NTH A;  3CCR A;  3S1R B;  3PQI A;  4ZK9 B;  3PUV A;  1X32 A;  1XMQ L;  1SNC A;  1B44 D;  3KLS X;  1A8V A;  4UY8 C;  3NWT A;  4F7X A;  3DWA A;  1JOK A;  2DY7 A;  5EBC A;  4O2D A;  4FO2 A;  3H3V I;  3X3N A;  2K33 A;  4A4I A;  4A3C G;  4Z9C B;  4CDC C;  5CMD A;  4RFB A;  3I4O A;  1SYC A;  1PRT D;  2QIL A;  1F9Q A;  1NBW A;  1N34 L;  4HID A;  2JA7 H;  1J5E Q;  4J8Q A;  3B6Y A;  3NBH A;  1EWI A;  2QDL A;  3SE0 A;  5A35 A;  3RMH A;  1D6E C;  1K3R A;  1HZ9 A;  1TS5 A;  2HCC A;  1GXD C;  2R7F A;  3TZD A;  3E5S A;  5JVH 3;  4NXN L;  1HNX Q;  1QG7 A;  1V1P B;  4O1N A;  2PZU A;  2K50 A;  2ZJR A;  3MZ5 A;  2RVL A;  5DNF A;  2IJ0 A;  1GM5 A;  3GTP H;  2LMC B;  5LHY 1;  2R7Z B;  5E4X A;  4IPG A;  3I4M H;  2B2Y C;  2Z6K C;  2WAQ G;  2ZJP A;  4KN4 C;  3A55 A;  1A0I A;  1GUS A;  3KK7 A;  4P73 A;  1DZ1 A;  2XWB B;  1IKL A;  3URY A;  5IP9 H;  3A56 A;  1UNS A;  1LTS D;  2JE6 I;  4JI5 Q;  4HCS A;  3A0J A;  1T5E A;  4RCO A;  4HJA A;  1WTW A;  4R4O A;  2KHS A;  3HGB A;  1X9N A;  3HOZ B;  3NEN A;  1FD7 D;  3KF8 B;  4A3I G;  4A3M H;  3HOY G;  4X65 Q;  1X65 A;  3A8J E;  3KF8 A;  1EYG A;  2I5L X;  2AQ1 B;  2UUA L;  4MN3 A;  2F4V Q;  1R9T H;  5EKK A;  4JI6 Q;  3HKZ E;  3M4Y A;  3D3R A;  5LL6 X;  2EVB A;  3U50 C;  1XMO L;  1EY8 A;  4A75 A;  2XN9 C;  2B2W C;  1W3S A;  1FNU A;  2K5Q A;  2WKD A;  5GQO A;  2K5W A;  1R4P B;  4IQZ A;  2VUM B;  2O2L D;  4R4Q A;  5EPL A;  1OO9 B;  1YVC A;  4F88 A;  2YU9 B;  3CF5 A;  4OL7 A;  4DV0 Q;  3AMU A;  4LFB L;  1SFO B;  4LF8 L;  4GLV B;  5ELD A;  5BR8 Q;  2ICI A;  2M9V A;  1ZEQ X;  2F0Q A;  3TQY A;  2E5L L;  3RZD B;  1A2U A;  4NXM L;  5K36 H;  2WAQ B;  3Q0A A;  3J7Z C;  2EYO A;  3H0G H;  4YCU A;  1V9P A;  1SNO A;  2RQX A;  2Z6B A;  4GNX C;  3NBI A;  1YNN D;  2F0H A;  4X6A H;  4HIM A;  1IW7 C;  2A6E C;  2WP8 J;  2ZM6 Q;  5M3M H;  2JA7 B;  5H1S E;  3J81 L;  3C2P A;  4PZ6 A;  3DEO A;  3W1G A;  5CV5 A;  3VA7 A;  2Z6K A;  3ZJY C;  4A3I B;  3WOE A;  1XMQ Q;  3HOY B;  1H9S B;  5CGK A;  1XYI A;  1EOV A;  3VYS A;  5I4D A;  4LUV A;  5KYI A;  4GN5 A;  1HA6 A;  3H09 A;  1EY7 A;  1DOL A;  2NUC A;  3BZD B;  3S2H H;  5IOD A;  3D0F A;  5JPN C;  2E2D C;  5IGB A;  2N3S A;  1QVF A;  4MTK A;  1YNJ C;  1H9M A;  4YCV A;  1CTM A;  1N34 Q;  5FO7 B;  1Q1E A;  1K28 A;  5BN4 A;  4J1M A;  1KDC A;  1WJJ A;  2Q2H A;  3RN5 A;  3T1Y L;  2YTY A;  1QE6 A;  1JE4 A;  2LXK A;  2HIX A;  4DNT B;  2WAQ E;  1HTP A;  3NEM A;  4LWC A;  2I07 B;  1DM0 B;  1GKH A;  1N36 L;  3FKI G;  3D31 A;  5I6Y A;  1QNK A;  3I91 A;  4KTA A;  1LTL A;  2ICE C;  3SK4 A;  1KHI A;  1DON A;  3L7Z C;  1BNZ A;  4JI1 L;  5ELN A;  1HFN A;  1P8L A;  3AYH B;  4AIM A;  1D8L A;  1JQY D;  2E76 C;  3OWF A;  2B39 A;  1SMX A;  4DV5 L;  5JJI A;  1O7L A;  3EFX D;  1PTO H;  1ICF B;  2JA5 H;  1C4Q A;  3C46 A;  1V1O A;  4PMW A;  4HTH A;  2E2H H;  1STB A;  4TKO B;  4MTN A;  4A3B H;  2BCO A;  1OXV A;  1ROD A;  3O13 A;  1D1I A;  1F9P A;  4ZLT F;  5E7N A;  2JEB I;  1LUZ A;  2C5C A;  1VQK A;  1PH6 A;  2F4I A;  2PYK A;  1I6V C;  1ICW A;  1PTO C;  4JC0 A;  4KLK A;  3GTK H;  4GKJ Q;  1ESF A;  1CFM A;  4UP8 A;  1HNZ L;  1LT5 D;  3EA6 A;  1VQL A;  4A3L H;  2UUA Q;  2WAC A;  3LGJ A;  3CPW A;  3N52 A;  3KDF A;  4FNF A;  3J81 i;  5M5Y B;  1SNP A;  1VQG A;  4XQJ A;  3GTQ H;  1XMO Q;  4KKU A;  3GO5 A;  3FKI B;  4IFD J;  1SE2 A;  1MJC A;  3GV3 A;  1I4R A;  1PLF A;  1ZKO A;  3TSS A;  2UU9 L;  1BXT A;  4G7O C;  1VQ5 A;  5CV8 A;  2CH4 A;  4BBR G;  4LFB Q;  5D3I B;  2BOS A;  1XNR L;  5C4X G;  4LF8 Q;  1WCM H;  1I6H B;  1SYB A;  4JOI C;  5C3E B;  3T56 B;  3PF5 A;  4IJH A;  2E5L Q;  1WFQ A;  4NXM Q;  3UE0 A;  2EXD A;  2UUB L;  3SR1 A;  4GOP B;  2JK8 A;  3RLF A;  1Y1W H;  2PPB C;  3A5Z B;  1PYW D;  3OWE B;  2CFM A;  5IYB G;  4GOP A;  2KBN A;  1SYE A;  3S14 B;  2KA7 A;  4A93 G;  2H5X A;  2RF4 A;  4R8I A;  4AH6 A;  4G57 A;  5M3F H;  3TBI B;  3PUX A;  1HNW L;  5TSS A;  2Y0S G;  5LMN W;  2SNM A;  3NXW A;  1C0A A;  3QIA A;  1I4X A;  4IFD G;  4GZY C;  1S4Z A;  3PO2 G;  2QKI C;  4DAP A;  1SJH D;  2Q2T A;  4EQO A;  3VYT A;  1NCV A;  3I90 A;  5IWA Q;  1LO5 D;  2KHJ A;  3RLN A;  2JN4 A;  1A3U A;  1SYG A;  2NZH A;  4RCN A;  3CME A;  2F0S A;  2AQ3 B;  4R1J A;  3CC4 A;  1H9R A;  1SLJ A;  1TKW B;  2ZXR A;  4KN7 C;  1V43 A;  3GTL H;  1G2S A;  4WOR A;  5FLM H;  5FO9 B;  4QGU A;  2M00 A;  3EVQ A;  4XIG S;  3I4N H;  5ISR A;  4UP9 A;  1PH4 A;  1PRT C;  3K8A A;  3U9S A;  4BBR B;  3EJI A;  1GOZ A;  5C4X B;  1G91 A;  2ZTC A;  1KDB A;  3FPP A;  1NY4 A;  4J6H A;  4JI1 Q;  1E2V A;  2YYZ A;  4KD3 A;  1VQB A;  4OHJ A;  3QOJ A;  5A2Q E;  1PMR A;  4H7B A;  4OEL B;  4KY7 A;  4DV5 Q;  3HOX H;  3S17 B;  3GTG H;  1VQH A;  3DUZ A;  1VQ7 A;  4CDE C;  2K5N A;  2CWA A;  1G6Z A;  2A74 C;  4A93 B;  1NUC A;  4C3J G;  1D2B A;  4DR4 L;  4DV4 L;  1Q3L A;  4A3J B;  2IT1 A;  4H0L C;  2KED A;  5EBD A;  1D5M C;  3CPF A;  2Y0S B;  1KD1 C;  2F3V A;  4M8A A;  1PFS A;  1S72 A;  2ZTE A;  2F0O A;  3PO2 B;  2NVQ B;  4A3E G;  1N32 L;  1B53 A;  5LMN L;  1K83 B;  4EQ5 A;  2R7D A;  4FXG C;  1MJE A;  3AU7 A;  2F0W A;  1JE5 A;  4O42 A;  2JSO A;  4DAY B;  1EYA A;  2X6L A;  1GD7 A;  3M3Y B;  1LTG D;  1HR0 L;  1B8A A;  1HNZ Q;  4DAY A;  1YJW A;  1GVP A;  3S1N H;  2R92 B;  4HMI A;  2RDG A;  4C3H G;  1VQF A;  2L12 A;  4JBK A;  4UHV A;  2B2U C;  5DLQ E;  1KNE A;  1NMG A;  1S3O A;  1QWY A;  4ZQ3 A;  2AWO A;  1EL0 A;  1P16 A;  2VS1 A;  2K14 A;  3ITP A;  3OHX C;  3R93 A;  5IE8 A;  4I7A A;  4DV7 L;  3DWQ A;  3BDO A;  1VQA A;  3K5O A;  4C1N I;  2A6E D;  1Q81 C;  1DOM A;  2L5T A;  2NTT A;  5IP7 G;  2UU9 Q;  1G8Z D;  2Y0S E;  2Z4H A;  1KC8 C;  2HHH L;  4QL5 A;  2KCN A;  4DXG A;  5JJZ A;  2G5D A;  3NTI A;  4A3K G;  1VQO A;  1XNR Q;  4ZUJ A;  2HCI A;  1Y1V G;  1HQM C;  1OXT A;  1NR2 A;  2PNH A;  3L0O A;  4X62 L;  3FEW X;  5C4H A;  5KEE A;  4C3J B;  2F1M A;  2F0V A;  1NE3 A;  5C0X H;  2FXQ A;  4RA8 A;  1QZG A;  1BF4 A;  1HQR D;  5M5W B;  3K5N A;  4CHT B;  2JXM B;  4BA2 I;  3I4N B;  1HNW Q;  3OTO Q;  1WD0 A;  1CKM A;  4P75 A;  2F0T A;  1PA6 A;  2HIV A;  3GTM H;  1OXX K;  5ELE A;  3S15 H;  2TMP A;  4BY1 B;  3G6E A;  4LF4 L;  4YWL A;  2HQE A;  3CC7 A;  4JCV E;  4LF9 L;  1TS2 A;  1VF5 C;  5IYD H;  1SNM A;  4MNO A;  3MTS A;  4C3H B;  1UEB A;  4DR3 L;  3KLR A;  4C3I B;  5K5P A;  1JWU D;  4FXK C;  2F0E A;  1IZ6 A;  2B63 H;  1DOK A;  1Z6H A;  3FDT A;  5KNB A;  5KYL A;  5EQ0 A;  3S1R H;  2VNU D;  1LTI D;  1EEI D;  2X6G A;  4RGN A;  3G48 A;  3J80 L;  4WJ4 A;  4DK6 C;  1BDO A;  2EY1 A;  1C8C A;  1S40 A;  1B7Y B;  2NN6 G;  1NMF A;  2F0U A;  2HDL A;  4LNQ A;  5J22 A;  4QCL A;  1L1O B;  2Z4I A;  3CCE A;  4TRD A;  1Y8O B;  2UXC Q;  1LT6 D;  5IY0 A;  1L1O A;  1WTR A;  2RDH A;  3R2T A;  4K6D A;  4QB4 A;  1PTO F;  4X66 L;  2VY3 A;  4JBW A;  1EY5 A;  4N8X 1;  1A2T A;  1IL2 A;  3F8T A;  4DR4 Q;  1SMY C;  4JI5 L;  4DV4 Q;  1ILP A;  4GLA C;  4R4T A;  1ZXT A;  4CJ1 B;  3J81 E;  1CQF A;  4KHP Q;  2EIF A;  1BR9 A;  3RZO B;  2HUG A;  3ULJ A;  4L5T A;  1N32 Q;  5CV6 A;  3G71 A;  3MXN B;  5LMN Q;  3MFG A;  2R7Z H;  3MXN A;  3TP6 A;  3MXG A;  4MIU A;  2DY8 A;  4IUR A;  2E2I B;  4BY7 G;  2IHF A;  1EFI D;  2E75 C;  3KUP A;  2MO1 A;  3J81 c;  3H15 A;  1VS0 A;  1CQV A;  1RD9 D;  3DM3 A;  2A73 B;  2WII B;  5FLX E;  2VQE L;  4OO1 I;  5J39 A;  5FKA C;  5FJ8 G;  3H6M A;  2OTJ A;  1SSO A;  1L0W A;  5CV4 A;  2BDN A;  2IX3 A;  4JBJ A;  4P74 A;  3SK8 A;  4DPG A;  1B9M A;  3HOZ H;  1MIU A;  3CAM A;  2KCM A;  4DV7 Q;  5IYC G;  4BBS B;  2M2L A;  2F0G A;  4CJ0 B;  4A3C H;  3OMG A;  1LTA D;  3Q23 A;  2E2J B;  2EYH A;  4XT1 B;  2KEN A;  2HHH Q;  2F03 A;  4XYQ A;  4JI7 L;  4A3D B;  3MXP A;  4K6L A;  1I4Q A;  1YBY A;  1LAB A;  3L2P A;  1HJP A;  4X62 Q;  4LUO A;  1EOT A;  4XQQ A;  2RA4 A;  1Z47 A;  3J7A 5;  3J80 i;  4HR7 B;  1NTG A;  4IPC A;  2VUM H;  2BH2 A;  4R8N A;  3ND8 A;  3RN2 A;  2OCE A;  1K0S A;  2EY2 A;  2YU9 H;  1CKO A;  1BQQ T;  1SFO H;  4YWM A;  4LF6 L;  2MP1 A;  3S16 B;  3RZD H;  2EYJ A;  4RGT A;  4DXF A;  1KIX A;  1Y14 B;  3JAM L;  3NE5 B;  1AE2 A;  1PRT F;  4LF4 Q;  4BY7 B;  2PZT A;  2D5D A;  3J7A V;  2CW0 C;  4DF7 A;  4LF9 Q;  2QA4 A;  1T9H A;  2A19 A;  1O7Z A;  3UDI A;  1A63 A;  3NBH B;  4DR3 Q;  1JIC A;  4DR2 L;  2G9D A;  4K2K A;  1KLG D;  3K7A B;  5IGC A;  2K04 A;  5D65 A;  3Q22 A;  2F0P A;  3EQL C;  5C3X A;  5L37 A;  3HOV G;  2Q8I B;  1VF7 A;  3T16 A;  2Q8R E;  4WJW A;  4BXX H;  4A3I H;  1SRU A;  1Q82 C;  4GN3 B;  3HOY H;  1Q8I A;  4JI0 L;  3CC2 A;  3FRP B;  4C2M B;  4OEM B;  3HKZ B;  3E9H A;  3BYT B;  2IPK D;  1TWA B;  1DCZ A;  3E3X A;  3PV0 A;  3ZYY X;  1ASZ A;  2AQ2 B;  3QOL A;  1K8G A;  3BZK A;  1VQC A;  1KXL A;  4X66 Q;  1DGS A;  2VL6 A;  1M4V A;  3I73 A;  1LTB D;  1F9S A;  3A5U A;  1BBU A;  1EIF A;  1SYF A;  2R93 G;  1AH9 A;  3DMU A;  1ET9 A;  4M1U B;  2CCZ A;  1X6O A;  2ZXP A;  2PW5 A;  2Z9H A;  1VQ9 A;  1GHK A;  2FHT A;  1U4L A;  1E24 A;  2MQH A;  5GRO A;  4JK1 C;  4IUV A;  4GKJ L;  2EPB A;  3D4D A;  5EKL A;  4LK1 C;  5GAH C;  4ULL A;  4CKE A;  4EX5 A;  3Q6S A;  4DR5 L;  1GUW A;  1U0L A;  3PUZ A;  5IGE A;  3DXJ C;  4DR7 L;  1F77 A;  4CDF C;  1I3Q B;  1O80 A;  2DNE A;  2IWH A;  2VQE Q;  3HOV B;  1YHA A;  5GAD C;  1HFG A;  5JEA H;  2OQK A;  3K57 A;  5E1F A;  1CSQ A;  2Z8L A;  4DN4 M;  4JI2 L;  1EQQ A;  4X64 L;  1F2Y A;  2OEO A;  1M1K C;  3JAM i;  1F2L A;  1X3G A;  3BZC A;  1EIH A;  1EZ8 A;  4ODG A;  1EY4 A;  3G7L A;  4JI8 Q;  1K8O A;  2F0F A;  4JI7 Q;  3K59 A;  3A7L A;  1JJG A;  1Y8P B;  2NYZ D;  1B4O A;  5M5Y H;  3QG1 A;  1Q46 A;  1PYS B;  2LKV A;  4YCW A;  4UP7 A;  4X3K A;  2R93 B;  5IP9 G;  1WTX A;  5CYU A;  1TY2 A;  3HS0 C;  3HZX A;  1RIP A;  5C5L A;  3BU2 A;  2OWO A;  3FKI H;  4WRD A;  4HIO A;  1BCP C;  1CZG A;  4BS9 A;  2AHO B;  4LF5 L;  4RWS C;  2NB0 A;  3H91 A;  4RGM A;  2VW9 A;  1NJI C;  5EPK A;  2KUM A;  4LF6 Q;  3I7F A;  5IWA L;  3F2B A;  1I6H H;  1O7Y A;  1STH A;  1KRT A;  3SEB A;  5C3E H;  2K28 A;  4LW1 A;  2DGY A;  1J8I A;  1JOO A;  1Q8K A;  1TWC B;  3MHB A;  4LFC Q;  1VQM A;  2O4X A;  1QB5 D;  2F3W A;  3KBG A;  2JA6 G;  3JC6 6;  1N33 L;  3S14 H;  4DR2 Q;  3I72 A;  5EKI A;  1KDA A;  1GUN A;  4DV6 L;  1K8A C;  1BKB A;  4N9P A;  4QUC A;  1WTO A;  2KCT A;  2RBM A;  1QCB D;  1ML0 D;  2MUY A;  4ME3 A;  4JI0 Q;  4HSV A;  4GOP C;  3RLO A;  5CR3 A;  1SMY D;  1B50 A;  1SNQ A;  4RKB A;  1XJV A;  4JPB W;  3EBE A;  1CA5 A;  4B9X A;  1BVS A;  4AQY L;  2O5J C;  5HY6 A;  3MEH A;  3BJU A;  3V05 A;  2NWG A;  3C1F A;  2UXB L;  1E2W A;  1EZ6 A;  3V96 A;  4JI3 L;  1SXT A;  2YTX A;  1O78 A;  4R9W A;  3NTK A;  1STY A;  5M3M G;  1LV9 A;  1II3 A;  3VYU A;  1G29 1;  4ILW A;  1EYC A;  3TZU A;  3CCQ A;  5DM7 3;  4Q0F A;  2PCF B;  1SJE D;  4BBR H;  5I9P A;  2R61 A;  5C4X H;  4DV2 L;  1EWC A;  4POG A;  3CD6 A;  3NEL A;  1PH5 A;  4HJ5 A;  1IHZ A;  2Z0S A;  4S3S A;  4IAL A;  1WTH A;  1BCP B;  2PMZ E;  1HPC A;  4DR5 Q;  3KDF B;  1TWH B;  5LL6 S;  3S17 H;  2FMM A;  1JT8 A;  2JA6 B;  1VQD A;  4A93 H;  5C4J B;  2N8N A;  1CKN B;  3TRE A;  4DR7 Q;  4A3J H;  4JV5 L;  3ICE A;  1E2Z A;  2V1C C;  2Q2I A;  4KY5 A;  5G3L F;  2O5I C;  4G7H C;  1CKN A;  3M7N A;  4IFD H;  1RF2 D;  3SXH A;  2GVB A;  2WB1 G;  2X69 A;  2NVQ H;  4K5X A;  4R4I A;  3PO2 H;  1W6J A;  5G3L D;  3J81 j;  1B9N A;  1VCI A;  3HG9 A;  4JI2 Q;  2L0C A;  3K58 A;  5T1I A;  4X64 Q;  1K83 H;  5CBE E;  3KF6 B;  3D4R A;  1IBL L;  4GN4 B;  3MEF A;  2I5H A;  3M3Y H;  2KHI A;  3KF6 A;  1CI3 M;  1D1K A;  4ME5 A;  1L0X B;  2JA5 G;  4MZ9 A;  3RUZ A;  1ONL A;  1TWG B;  2R92 H;  1LTR D;  5F2D A;  5KND A;  3HOU G;  3HOW G;  2BA1 A;  3J80 c;  4A3B G;  1HHV A;  3VR3 A;  2RSO A;  4DUY L;  3R8B A;  2AUK A;  4A3G G;  3PIP A;  2CW0 D;  4FF4 A;  3K6O A;  1J6Q A;  4ZUI A;  2K5V A;  2QEJ C;  3A74 A;  2K6A A;  1B3A A;  4PV1 C;  3OTO L;  4P2C B;  4LF5 Q;  1M90 C;  1VQ6 A;  3GTO B;  2FFK B;  1H95 A;  2EXZ A;  2Q2U A;  4EQP A;  4IPH A;  1UEA B;  2F3I A;  2AWN A;  2EYP A;  2OT2 A;  4JW0 A;  2N49 A;  4IN3 A;  2JA8 G;  2RCF A;  4L5R C;  3GV6 A;  1IYU A;  3HEJ A;  1EU4 A;  2ASB A;  3BYY B;  1SE4 A;  1AW7 A;  4C3J H;  1V8Q A;  5JPM C;  3UI2 A;  2XVS A;  4IZ8 A;  2YV5 A;  2NTS A;  4PMC A;  5J3B A;  1N9W A;  4Y7N B;  3GQB A;  1G51 A;  1N33 Q;  4ZKB B;  1Y69 U;  1EY6 A;  5M5W H;  5IOC A;  3EN2 A;  1LYL A;  4DV6 Q;  2QF7 A;  1PFM A;  1TY0 A;  3HKS A;  2GN5 A;  1AZQ A;  1HTL D;  3W2D A;  1O7I A;  4HJ7 A;  4BY1 H;  1XPR A;  3F2D A;  4Y52 H;  2G9H D;  1WCM G;  2UXC L;  1DD2 A;  1WI5 A;  3STB D;  2P5Z X;  5E3F A;  4N8F A;  1IKM A;  4AQY Q;  4C3H H;  3HOU B;  2BE5 C;  5M5X B;  3HOW B;  4C3I H;  1EYD A;  3RR5 A;  4ZKC B;  1MGS A;  2XRQ D;  4B3T L;  2UXB Q;  2NZ1 D;  4JI3 Q;  1I4G A;  1GUG A;  4DR6 L;  3I70 A;  4F8M A;  4A3G B;  4GS3 A;  3RNU A;  3IAY A;  1F2Z A;  2CQA A;  1IXR A;  1HUM A;  1PVO A;  2DUD A;  1OXU A;  2XSC A;  4V19 0;  3S1M B;  4LMQ D;  4KHP L;  5LMU L;  5IP7 H;  1H9K A;  5KGU A;  1SN8 A;  2WB1 E;  4A3K H;  4U68 A;  4DV2 Q;  2JA8 B;  3SHL A;  3JAM E;  1RJT A;  1FNW A;  1STN A;  3MXU A;  5KRU A;  4K2L A;  2R3Z A;  4QIW E;  4DA2 A;  4JVZ A;  5GAE C;  3D4W A;  3M4P A;  1ILQ A;  1CZW A;  5HUR A;  5FLM G;  3TDQ A;  1L1O C;  4JV5 Q;  2ALY B;  1E22 A;  2B2V C;  4L63 B;  4RH6 A;  1UE7 A;  4EVO A;  3MAQ A;  1SDF A;  1BBX C;  3SK6 A;  3JAM c;  3RZO H;  4NMZ A;  1MHW C;  3L3O C;  2A6H D;  1C7Y A;  5AFW A;  4CBV A;  3S24 A;  1VMP A;  5C44 G;  1J9O A;  1PFN A;  1TQO A;  4OWT B;  1IBL Q;  2E2I H;  1K9M C;  3I55 A;  5FOB B;  1XNQ L;  1BCP D;  3NPP A;  4LFA Q;  1X3E A;  2B2T A;  3HOX G;  3VR4 A;  1D5X C;  2SOB A;  2NVX B;  3GTJ B;  1E7Z A;  3PIO A;  2RSN A;  3FMC A;  2A68 C;  4WJ3 M;  1EY0 A;  4K5V A;  4DUY Q;  2ZXO A;  1TVX A;  4L6T B;  5ELB A;  3UE1 A;  1Z9F A;  4ZAI A;  4IUT A;  2NN6 H;  1WTV A;  4A3E B;  1EUJ A;  4BBS H;  2N88 A;  2I5M X;  4BWG B;  2E2J H;  4G7Z C;  3HP3 A;  1PH7 A;  1BBW A;  3S2D B;  3OYY A;  4A3D H;  3BVZ A;  2BDO A;  3HFZ B;  5EAY A;  1TT2 A;  2EZV A;  1U5K A;  1RL2 A;  1HA5 A;  3R2I A;  2HDM A;  3FHW A;  2GVA A;  3IKJ A;  2CVR A;  4AYB G;  1RTO A;  2MJ8 A;  4HMJ A;  4KV6 A;  2PQA B;  1XTD A;  4P72 A;  1L0Y B;  1LM0 A;  5C5M A;  2QGQ A;  2PQA A;  5GAG C;  2CH4 W;  2FJ2 A;  4XT3 B;  4YIJ A;  3OW2 A;  4OO1 G;  3VA5 A;  5C44 B;  4DUZ L;  3PF4 A;  3S16 H;  4B3R L;  1S5E D;  4U67 3;  4BY7 H;  3A8K E;  2D0P A;  2KVM A;  4A3K B;  1Y1V B;  1K0R A;  2B2V A;  1K3B C;  4IUQ A;  4KKT A;  4GKK L;  5T1G A;  3OOC A;  1EQT A;  5FJ8 H;  5IGF A;  4B3T Q;  3K7A H;  3NK9 A;  2HT1 A;  5COR A;  4DR6 Q;  3C3L A;  4OWW B;  2D2C C;  4K5W A;  4FP5 D;  5IYC H;  4UDU C;  3NSW A;  4C56 C;  5LMU Q;  4C2M H;  3WWV A;  2K52 A;  3H3V C;  1GO3 E;  4DK1 A;  4IOA A;  1TWA H;  4K8I A;  1WYD A;  2EJM A;  3QB3 A;  3DLL A;  4ZYS A;  5M9O A;  3H94 A;  4FF1 A;  5JOB A;  3PIP 3;  1PFB A;  1TII D;  2OF1 A;  2EYL A;  4YHH L;  4C1N K;  1IBM Q;  3QR8 A;  1PYB A;  1PZI D;  2PNR C;  3NWS A;  4LJZ C;  2EYM A;  3EIV A;  1JCK B;  4G4K A;  3A7A B;  4ABN A;  1WVL A;  4XXE A;  1IBK L;  2L55 A;  1W2B A;  3T53 B;  2B29 A;  3D6W A;  1AFP A;  4IPD A;  2D0O A;  2Z1C A;  1QUQ B;  2K5D A;  3M85 A;  3TS2 A;  3SVM A;  4B9W A;  3ERQ A;  3OSO A;  1FJG Q;  1QUQ A;  3GD7 A;  1F9R A;  1AEX A;  1F2M A;  2EY6 A;  1EQV A;  2DJF C;  3IRB A;  4JI8 L;  5C0X I;  1XNQ Q;  1I50 B;  3J7Y W;  1JJC B;  1MSH A;  1PV4 A;  5JVG 3;  5JJL A;  4DGZ A;  1I3Q H;  3HOV H;  2BA0 A;  4ZCK A;  3TS0 A;  4PMB A;  4XDX A;  4UAI A;  3PO3 G;  4QMG A;  1HUN A;  3NQT A;  3M4O B;  1HH2 P;  1X54 A;  4NW2 A;  4H13 C;  1HZC A;  3MWY W;  3T1H L;  1I5F A;  3PUW A;  4B3S L;  2R7Z G;  5A2Q L;  3W5O A;  4MHE A;  1VQE A;  4GLX A;  3TP5 A;  3I56 A;  2EYF A;  1YHB A;  4HSP A;  4FDB A;  2WV6 D;  4LFC L;  5BN5 A;  1SEB D;  1JOR A;  5IT9 L;  2R93 H;  1GUT A;  3TN2 A;  5ELO A;  2SDF A;  4HIK A;  4WFN 3;  4KY6 A;  2SNS A;  5HGQ A;  3P1H A;  4A3F G;  3M9B A;  3VDY A;  1YJ9 A;  3CHB D;  2BE5 D;  3LWE A;  1M8A A;  3HOZ G;  3S1Q B;  2YTV A;  4FYD A;  3I4L A;  2IW3 A;  2DN8 A;  2ID0 A;  2K32 A;  5KNC A;  1YJN A;  1TWF B;  3MA2 B;  4DUZ Q;  1BUV T;  4DKA C;  1YIT A;  4B3R Q;  4N9T A;  1CK1 A;  4NB3 A;  3UDG A;  1TWC H;  1FYC A;  2QCP X;  2JJQ A;  2TSS A;  5IIF A;  1B2T A;  2JP1 A;  1IYJ B;  2PQE A;  4K0K Q;  1CM9 A;  4LF7 L;  4GKK Q;  1U4R A;  3PO3 B;  4CKB A;  4DR1 Q;  1MBY A;  1JJ2 A;  5C4Z A;  2VUM G;  1DXM A;  1UAP A;  2L4N A;  3ND9 A;  1V1P A;  4TSS A;  2QDB A;  2AKW B;  2IL8 A;  3STB C;  2F0N A;  2K7V A;  1STA A;  2NVT B;  3CP0 A;  1XX8 A;  2MPM A;  1QOH A;  3PIO 3;  1AZP A;  5KIX A;  1ASY A;  2KEC A;  3GDE A;  2K1B A;  2I46 A;  1H9J A;  2ZJQ A;  2JA7 G;  3P75 A;  1RDP D;  4YHH Q;  1E1T A;  3NP8 A;  3OPO A;  4IOC A;  2MGS A;  3CCU A;  3CCJ A;  3CW2 C;  4A3F B;  4BA1 I;  1L2F A;  3UDX A;  2B8G A;  2MO0 A;  4BXX G;  1IBK Q;  2KCC A;  4QJF A;  3KOJ A;  2NVY B;  2H1E A;  3Q24 A;  1STG A;  1A6X A;  4QQB X;  1RHP A;  2WKC A;  2FMC A;  4K14 A;  1SR3 A;  4YWK A;  4DV3 L;  2A68 D;  3E0E A;  3M4Q A;  1E3P A;  1HZB A;  2VQF L;  2AMC B;  3PMF A;  1TWH H;  3I4M G;  2JA6 H;  2JEA I;  4RGO S;  3KLS A;  5C4J H;  4X3S A;  3NQI A;  1XWE A;  4NKL A;  3UDF A;  1A15 A;  2A6H C;  1I4H A;  2XGT A;  5JEA J;  1EU3 A;  1ESR A;  3U58 A;  1S5F D;  3LWU A;  1E1O A;  4RMF A;  3FVQ A;  1C9O A;  2RKS A;  1HXY D;  2E74 C;  2JQO A;  3T1H Q;  3BVM A;  3PSI A;  4TQU S;  4IUU A;  3TEH B;  1X3P A;  5HGT A;  4A3M G;  2RHS B;  4B3S Q;  1Z7T A;  1AE3 A;  3ONA B;  1UUP A;  1KQS A;  1JR0 D;  5C3W A;  1E0B A;  1NAP A;  1MSG A;  4OX9 L;  1TWG H;  4B3M L;  1LLR D;  4ZRZ A;  1JWM D;  1LT4 D;  1ZYR C;  1QIL A;  5DAU A;  1PH2 A;  3CMA A;  1EFW A;  1A62 A;  1G2T A;  2B2Y A;  5JEA G;  3CCV A;  2WFW A;  2K01 A;  3AFP A;  3TME A;  1SAP A;  1EQR A;  1HZA A;  1H9S A;  2L1B A;  3GTO H;  4P71 A;  5J1Z A;  3GTP B;  3X3M A;  2PMZ B;  5FO8 B;  4HJ8 A;  1X55 A;  2LXJ A;  4DV1 L;  1MD2 D;  3I4M B;  4DAV A;  5FLX L;  5K36 G;  5JAV A;  1PH3 A;  2XRS D;  2HD3 A;  3H0G G;  4OON A;  2EOT A;  3CXC A;  4KI0 A;  2J7Z A;  1T5X D;  3E9I A;  4Y7N H;  1YIJ A;  4RG1 A;  3E6Z X;  1TU2 B;  2A69 D;  1YI2 A;  4LF7 Q;  4CKC A;  4HJ9 A;  4PNY A;  4NXN Q;  3ERS X;  1S5B D;  3OMC A;  1RTN A;  1PH8 A;  3KYH C;  3E0J A;  2ATW A;  2HQL A;  4A3M B;  5I2Y A;  2B2W A;  4KJO A;  1XPU A;  1I94 L;  4CDD C;  5C3E G;  2CKZ B;  3DM1 A;  4LAA A;  2F0D A;  3Q8D A;  2F52 A;  2OXP A;  2J0T D;  1R9T B;  2I0Q A;  1SYD A;  1B70 B;  3HOU H;  2QEX A;  5M5X H;  1N8R C;  3HOW H;  3PGZ A;  2K5H A;  2N55 A;  4HCE A;  4POF A;  5C6A A;  5IYB H;  1JOQ A;  4A3G H;  2PI2 A;  1VQI A;  4GNX B;  1PXU A;  3K0X A;  2K03 A;  4OGQ C;  3S1M H;  2V4D A;  2H4O A;  1B1Z A;  2NZO A;  4GNX A;  1HRJ A;  3L9A X;  1AN8 A;  3WDN A;  3J80 E;  1TXY A;  3HRZ C;  4V0B A;  1MI2 A;  1JB7 A;  5FK9 C;  2JA8 H;  4DNI A;  1WTP A;  2F0L A;  4DV3 Q;  2L15 A;  1UE5 A;  5ELC A;  1X3F A;  1FVI A;  4CGY B;  3H0G B;  4B08 A;  2VQF Q;  4LFA L;  4KHZ A;  4JI4 L;  3TRZ A;  1LT3 D;  1FNV A;  4DAM A;  5I6W A;  3PUY A;  1W6K A;  3IL8 A;  4HN7 A;  5M3M B;  1K8M A;  1EIY B;  3KJP A;  2RHQ B;  4DK3 C;  2B8F A;  1IL8 A;  2PI2 E;  4RHR A;  1KL9 A;  1NNX A;  4JBM A;  1YNX A;  2K05 A;  1ENC A;  2VB2 X;  4OWX B;  2R6G A;  4FVM A;  1UE1 A;  3KJO A;  2XIW A;  3DWP A;  2EY5 A;  3I3C A;  3S2H B;  3AQQ A;  1BOS A;  1EEF D;  1XTC D;  1SBB B;  1U9R A;  4A3L G;  4OX9 Q;  2IX0 A;  1LTT D;  4HED A;  2NVX H;  3K81 C;  3GTJ H;  4B3M Q;  4LUZ A;  4KJN A;  3W3A A;  4A3J G;  1U4M A;  1S5D D;  2A1A A;  2K75 A;  5I2X A;  5CV9 A;  1KRS A;  1KAA A;  1CUK A;  1KTK A;  1ET6 A;  2ZT9 C;  1Q90 A;  3DHQ A;  3NUC A;  2D62 A;  1VDZ A;  2WB1 B;  2XTI A;  2B2T C;  3R3O A;  4A3E H;  2PW7 A;  1HR0 W;  3A54 A;  1SE8 A;  2KEE A;  1X56 A;  3KBX A;  4QIW B;  4IO9 A;  3S2D H;  4QY7 A;  1D5Z C;  1GHJ A;  2XNA C;  4KK7 A;  4DV1 Q;  4PZ7 A;  1PTO B;  2JA5 B;  2R92 G;  3K80 C;  1QJO A;  3CU7 A;  2UUC L;  2E2H B;  3T1Y Q;  3T4A C;  1U4P A;  3AEV A;  2CWP A;  1Y1W G;  4A3B B;  2PZW A;  3IFT A;  2Q8T A;  1N36 Q;  3F2U A;  3I8Z A;  5D14 A;  2B3G A;  5M3F G;  4E6I A;  2DNC A;  2OTL A;  1A3V A;  1FGB D;  3VR6 A;  5C44 H;  3OIQ A;  4ID6 A;  2QW7 A;  1SRO A;  3GTK B;  3AFQ A;  2IY5 B;  2SEB D;  3BG3 A;  5E4W C;  3FPU B;  2ES2 A;  1I94 Q;  1Q1B A; 
#chains in the Genus database with same CATH homology
 1CHP D;  3WOF A;  4OIK A;  3QO2 A;  4XQN A;  2KOL A;  1ENA A;  5IGD A;  4IFD I;  2D9U A;  4OIJ A;  5IT9 E;  3GTQ B;  1IYV A;  1JC7 A;  3OIP A;  1LAC A;  1XXG A;  3T13 A;  3P20 A;  2KQ3 A;  5EGT A;  5EJW A;  2KJX A;  3TP7 A;  2F0I A;  2CHB D;  4EQN A;  4CJ2 C;  4KD4 A;  3T51 B;  1WCM B;  4L8J A;  3IFD A;  1BCP F;  4DFA A;  1JWS D;  4C3I G;  1TS3 A;  1EWH A;  3BDC A;  1Y1W B;  1NSN S;  1GJX A;  1CT1 D;  5EPJ A;  1WD1 A;  2EJF C;  1PDQ A;  3RD4 A;  5IGG A;  2GA4 B;  3MFY A;  4DU9 A;  5M3F B;  4KHV A;  4H44 C;  4OO1 H;  1IW7 D;  4K8J A;  2XWJ B;  1KNA A;  4I65 A;  1ZYR D;  5CC4 A;  4PQX A;  2PO4 A;  1GUO A;  3VR5 A;  3CKI B;  1QNU A;  4I7Z C;  3S9W A;  1PRT B;  1R4Q B;  3P7J A;  4NP5 A;  3GTL B;  2C9O A;  4EGV A;  4FXD A;  2L9H A;  2EJG C;  1VMC A;  2LFN A;  1YNJ D;  3BDL A;  4KMU C;  5C0X J;  4HAE A;  1OXS C;  1I4P A;  3G6J B;  5COY A;  4X3T A;  4FF3 A;  4IUN A;  1YNN C;  5CV7 A;  2LS0 1;  4X3U A;  5NUC A;  1CA6 A;  3D6C A;  3GP7 A;  3TP8 A;  3C1E A;  2FIN B;  2RDF A;  4RHS A;  3ERO A;  2EDG A;  3HOX B;  3GTG B;  3A8I E;  4Q5V A;  2EE1 A;  5BN3 A;  5ELF A;  2AUJ D;  3SK5 A;  1NR4 A;  3CQZ B;  3QWN A;  5C0X G;  2MHV A;  2JYO A;  1RKN A;  2IX1 A;  3V2T A;  1JB3 A;  1HCZ A;  2A5H A;  1EIG A;  4XTC S;  1C48 A;  1STE A;  2B2U A;  2J4X A;  1CHQ D;  3K5M A;  2A69 C;  3MC0 B;  3SDZ A;  2F0M A;  1Q12 A;  3M7G A;  3VR2 A;  1RCV D;  1PTO D;  1DJR D;  3DEP A;  3S1N B;  3CRL C;  3VYR A;  1X3Q A;  4AYB B;  3LNN A;  1AP0 A;  2NBF A;  1ENF A;  3D8G A;  3U9O A;  3BVG A;  4XYO A;  1SND A;  2WIN B;  1BO0 A;  3K0Y A;  2F0J A;  2F0K A;  3CRK C;  1KAB A;  5DEH A;  3OW7 A;  4IUP A;  1S5C D;  4RAU C;  5CBA E;  4QUF A;  2VB3 X;  4NDX A;  1WTQ A;  3BS1 A;  2NN6 I;  1PZK D;  5D3D A;  2ENB A;  2VXW A;  1DYQ A;  4FF2 A;  3J7A F;  5I9O A;  4RKL A;  5DM6 3;  3K5L A;  4DNR B;  3GTM B;  1A3T A;  3S15 B;  1Y8N B;  2LY7 A;  1TR5 A;  1FR3 A;  3QJY A;  4QF4 A;  4KKS A;  3AB9 A;  1KLU D;  1PZJ D;  1EY9 A;  1TS4 A;  3LX0 A;  3N6R A;  4DK0 A;  4F87 A;  2B63 B;  3MVV A;  1SE3 A;  3NHH A;  2L11 A;  3NTH A;  3S1R B;  4ZK9 B;  3PUV A;  1X32 A;  1SNC A;  1B44 D;  3KLS X;  3NWT A;  4F7X A;  3DWA A;  1JOK A;  2DY7 A;  5EBC A;  4FO2 A;  3X3N A;  2K33 A;  4Z9C B;  5CMD A;  4RFB A;  1SYC A;  1PRT D;  2QIL A;  1F9Q A;  4J8Q A;  3NBH A;  3SE0 A;  5A35 A;  3RMH A;  1D6E C;  1TS5 A;  2HCC A;  1GXD C;  3TZD A;  3E5S A;  5JVH 3;  1QG7 A;  1V1P B;  4O1N A;  2PZU A;  3MZ5 A;  2RVL A;  5DNF A;  2IJ0 A;  2LMC B;  5LHY 1;  2R7Z B;  5E4X A;  2B2Y C;  4KN4 C;  3A55 A;  1GUS A;  3KK7 A;  1DZ1 A;  2XWB B;  1IKL A;  3URY A;  3A56 A;  1UNS A;  1LTS D;  2JE6 I;  4HCS A;  1T5E A;  4RCO A;  1WTW A;  2KHS A;  3HGB A;  3HOZ B;  1FD7 D;  3A8J E;  3KF8 A;  2AQ1 B;  4MN3 A;  5EKK A;  3M4Y A;  3D3R A;  5LL6 X;  2EVB A;  1EY8 A;  2XN9 C;  2B2W C;  1FNU A;  2K5Q A;  2WKD A;  2K5W A;  1R4P B;  4IQZ A;  2VUM B;  2O2L D;  5EPL A;  1OO9 B;  4F88 A;  2YU9 B;  4OL7 A;  3AMU A;  1SFO B;  5ELD A;  2ICI A;  2M9V A;  1ZEQ X;  2F0Q A;  3RZD B;  1A2U A;  5K36 H;  2WAQ B;  3Q0A A;  2EYO A;  1SNO A;  2RQX A;  3NBI A;  1YNN D;  2F0H A;  1IW7 C;  2A6E C;  2WP8 J;  2JA7 B;  3J81 L;  3C2P A;  3DEO A;  5CV5 A;  3VA7 A;  4A3I B;  3WOE A;  3HOY B;  1H9S B;  5CGK A;  1XYI A;  3VYS A;  5I4D A;  5KYI A;  1HA6 A;  3H09 A;  1EY7 A;  1DOL A;  2NUC A;  3BZD B;  5IOD A;  5JPN C;  2E2D C;  5IGB A;  1YNJ C;  1H9M A;  1CTM A;  5BN4 A;  1Q1E A;  5FO7 B;  4J1M A;  1KDC A;  1QE6 A;  1JE4 A;  4DNT B;  1HTP A;  2I07 B;  1DM0 B;  3D31 A;  5I6Y A;  1QNK A;  3I91 A;  4KTA A;  2ICE C;  3SK4 A;  1DON A;  3L7Z C;  1BNZ A;  1HFN A;  1JQY D;  2E76 C;  3OWF A;  2B39 A;  1O7L A;  3EFX D;  1PTO H;  1C4Q A;  3C46 A;  1V1O A;  4PMW A;  4HTH A;  1STB A;  4TKO B;  2BCO A;  1OXV A;  1ROD A;  3O13 A;  1D1I A;  1F9P A;  4ZLT F;  2JEB I;  2C5C A;  2F4I A;  2PYK A;  1I6V C;  1ICW A;  1PTO C;  1ESF A;  1CFM A;  1LT5 D;  3EA6 A;  2WAC A;  3N52 A;  4FNF A;  5M5Y B;  1SNP A;  4XQJ A;  4KKU A;  3GO5 A;  3FKI B;  4IFD J;  1SE2 A;  3GV3 A;  1I4R A;  1PLF A;  1ZKO A;  3TSS A;  1BXT A;  4G7O C;  5CV8 A;  5D3I B;  2BOS A;  1I6H B;  1SYB A;  5C3E B;  3T56 B;  3SR1 A;  3RLF A;  2PPB C;  3OWE B;  1PYW D;  1SYE A;  3S14 B;  2KA7 A;  4R8I A;  4G57 A;  3TBI B;  3PUX A;  5TSS A;  2SNM A;  3NXW A;  3QIA A;  1I4X A;  4IFD G;  4GZY C;  1S4Z A;  2QKI C;  4DAP A;  1SJH D;  4EQO A;  3VYT A;  1NCV A;  3I90 A;  1LO5 D;  1A3U A;  1SYG A;  4RCN A;  2F0S A;  2AQ3 B;  1H9R A;  1TKW B;  2ZXR A;  4KN7 C;  1V43 A;  1G2S A;  4WOR A;  5FO9 B;  2M00 A;  3EVQ A;  4XIG S;  5ISR A;  1PRT C;  3U9S A;  4BBR B;  3EJI A;  1GOZ A;  5C4X B;  1G91 A;  1KDB A;  3FPP A;  4J6H A;  1E2V A;  2YYZ A;  4KD3 A;  4OHJ A;  3QOJ A;  5A2Q E;  1PMR A;  4H7B A;  4KY7 A;  3S17 B;  3DUZ A;  1G6Z A;  2A74 C;  4A93 B;  1NUC A;  4C3J G;  1D2B A;  1Q3L A;  4A3J B;  2IT1 A;  4H0L C;  2KED A;  5EBD A;  1D5M C;  2Y0S B;  2F3V A;  4M8A A;  2F0O A;  3PO2 B;  2NVQ B;  1B53 A;  1K83 B;  4FXG C;  3AU7 A;  2F0W A;  4O42 A;  2JSO A;  1EYA A;  2X6L A;  3M3Y B;  1LTG D;  4DAY A;  2R92 B;  4HMI A;  2RDG A;  4C3H G;  2L12 A;  2B2U C;  1KNE A;  1QWY A;  4ZQ3 A;  2AWO A;  1EL0 A;  3OHX C;  3ITP A;  3R93 A;  3DWQ A;  3BDO A;  3K5O A;  4C1N I;  2A6E D;  1DOM A;  2L5T A;  2NTT A;  1G8Z D;  2Z4H A;  2KCN A;  4DXG A;  5JJZ A;  3NTI A;  4ZUJ A;  2HCI A;  1HQM C;  1OXT A;  1NR2 A;  3FEW X;  5C4H A;  5KEE A;  4C3J B;  2F1M A;  2F0V A;  5C0X H;  4RA8 A;  1BF4 A;  1HQR D;  5M5W B;  3K5N A;  4CHT B;  2JXM B;  4BA2 I;  3I4N B;  1WD0 A;  2F0T A;  1OXX K;  5ELE A;  2TMP A;  4BY1 B;  2HQE A;  1TS2 A;  1VF5 C;  1SNM A;  3MTS A;  4C3H B;  3KLR A;  4C3I B;  5K5P A;  1JWU D;  4FXK C;  2F0E A;  1DOK A;  1Z6H A;  3FDT A;  5KNB A;  5KYL A;  5EQ0 A;  2VNU D;  1LTI D;  1EEI D;  2X6G A;  4RGN A;  3J80 L;  1BDO A;  2EY1 A;  1C8C A;  2NN6 G;  2F0U A;  2HDL A;  5J22 A;  4QCL A;  2Z4I A;  4TRD A;  1Y8O B;  1LT6 D;  1WTR A;  2RDH A;  3R2T A;  4K6D A;  4QB4 A;  1PTO F;  4JBW A;  1EY5 A;  1A2T A;  1ILP A;  1SMY C;  1ZXT A;  4CJ1 B;  3J81 E;  1CQF A;  1BR9 A;  3RZO B;  2HUG A;  5CV6 A;  3MFG A;  3MXN A;  3TP6 A;  3MXG A;  4MIU A;  2DY8 A;  4IUR A;  2E2I B;  1EFI D;  2E75 C;  3KUP A;  1CQV A;  1RD9 D;  2A73 B;  2WII B;  5FLX E;  4OO1 I;  5J39 A;  5FKA C;  3H6M A;  1SSO A;  5CV4 A;  2BDN A;  2IX3 A;  3SK8 A;  1B9M A;  4BBS B;  2M2L A;  2F0G A;  4CJ0 B;  3OMG A;  1LTA D;  3Q23 A;  2E2J B;  2EYH A;  4XT1 B;  2F03 A;  4XYQ A;  4A3D B;  3MXP A;  4K6L A;  1I4Q A;  1LAB A;  4XQQ A;  1EOT A;  2RA4 A;  1Z47 A;  4HR7 B;  4R8N A;  3ND8 A;  2EY2 A;  1BQQ T;  2MP1 A;  3S16 B;  2EYJ A;  4RGT A;  4DXF A;  3JAM L;  4BY7 B;  3NE5 B;  1PRT F;  2PZT A;  2D5D A;  3J7A V;  2CW0 C;  4DF7 A;  1O7Z A;  1JIC A;  2G9D A;  4K2K A;  1KLG D;  3K7A B;  5IGC A;  2K04 A;  5D65 A;  3Q22 A;  2F0P A;  3EQL C;  5C3X A;  2Q8I B;  1VF7 A;  3T16 A;  2Q8R E;  4WJW A;  1Q8I A;  3FRP B;  4C2M B;  3HKZ B;  3BYT B;  2IPK D;  1TWA B;  1DCZ A;  3PV0 A;  3ZYY X;  2AQ2 B;  3QOL A;  1M4V A;  3I73 A;  1LTB D;  1F9S A;  1SYF A;  3DMU A;  1ET9 A;  4M1U B;  2ZXP A;  2PW5 A;  1GHK A;  2FHT A;  1U4L A;  4JK1 C;  4IUV A;  2EPB A;  3D4D A;  5EKL A;  4LK1 C;  4ULL A;  4CKE A;  3Q6S A;  1GUW A;  3PUZ A;  5IGE A;  3DXJ C;  1F77 A;  1I3Q B;  1O80 A;  2DNE A;  2IWH A;  3HOV B;  1HFG A;  5JEA H;  3K57 A;  5E1F A;  2Z8L A;  4DN4 M;  1F2Y A;  2OEO A;  1F2L A;  1EIH A;  1EZ8 A;  4ODG A;  1EY4 A;  3G7L A;  1K8O A;  2F0F A;  3K59 A;  3A7L A;  1Y8P B;  2NYZ D;  1B4O A;  3QG1 A;  2LKV A;  4X3K A;  2R93 B;  1WTX A;  5CYU A;  1TY2 A;  3HS0 C;  3HZX A;  5C5L A;  4WRD A;  1BCP C;  1CZG A;  4BS9 A;  4RWS C;  2NB0 A;  3H91 A;  4RGM A;  5EPK A;  2KUM A;  1O7Y A;  1STH A;  3SEB A;  2K28 A;  1J8I A;  1JOO A;  1TWC B;  3MHB A;  2O4X A;  1QB5 D;  2F3W A;  3KBG A;  3I72 A;  5EKI A;  1KDA A;  1GUN A;  4N9P A;  4QUC A;  1WTO A;  2RBM A;  1QCB D;  1ML0 D;  2MUY A;  4HSV A;  5CR3 A;  1SMY D;  1B50 A;  1SNQ A;  4RKB A;  1CA5 A;  4B9X A;  2O5J C;  3MEH A;  3V05 A;  2NWG A;  3C1F A;  1E2W A;  1EZ6 A;  3V96 A;  1SXT A;  1O78 A;  4R9W A;  3NTK A;  1STY A;  1LV9 A;  1II3 A;  3VYU A;  1G29 1;  4ILW A;  1EYC A;  3TZU A;  5DM7 3;  4Q0F A;  2PCF B;  1SJE D;  5I9P A;  2R61 A;  1EWC A;  1IHZ A;  4S3S A;  4IAL A;  1BCP B;  1HPC A;  1TWH B;  5LL6 S;  2FMM A;  2JA6 B;  5C4J B;  1E2Z A;  4KY5 A;  5G3L F;  2O5I C;  4G7H C;  3M7N A;  4IFD H;  1RF2 D;  3SXH A;  2X69 A;  4K5X A;  1W6J A;  5G3L D;  1B9N A;  1VCI A;  3HG9 A;  2L0C A;  3K58 A;  5T1I A;  5CBE E;  3D4R A;  1CI3 M;  1D1K A;  4ME5 A;  1L0X B;  3RUZ A;  1ONL A;  1TWG B;  1LTR D;  5F2D A;  5KND A;  2BA1 A;  1HHV A;  3VR3 A;  2RSO A;  3R8B A;  2AUK A;  2CW0 D;  4FF4 A;  3K6O A;  4ZUI A;  2QEJ C;  2K6A A;  1B3A A;  4PV1 C;  4P2C B;  3GTO B;  2FFK B;  2EXZ A;  4EQP A;  1UEA B;  2AWN A;  2EYP A;  2OT2 A;  4IN3 A;  3GV6 A;  1IYU A;  3HEJ A;  1EU4 A;  3BYY B;  1SE4 A;  1AW7 A;  1V8Q A;  5JPM C;  3UI2 A;  2XVS A;  4IZ8 A;  4PMC A;  2NTS A;  4Y7N B;  3GQB A;  4ZKB B;  1Y69 U;  1EY6 A;  5IOC A;  2QF7 A;  1PFM A;  1TY0 A;  1AZQ A;  1HTL D;  3W2D A;  2G9H D;  1DD2 A;  5E3F A;  1IKM A;  3HOU B;  2BE5 C;  5M5X B;  3HOW B;  1EYD A;  4ZKC B;  1MGS A;  2XRQ D;  2NZ1 D;  1I4G A;  1GUG A;  3I70 A;  4F8M A;  4A3G B;  3IAY A;  1F2Z A;  2CQA A;  1HUM A;  1OXU A;  2XSC A;  4V19 0;  3S1M B;  4LMQ D;  1H9K A;  5KGU A;  4U68 A;  2JA8 B;  3SHL A;  3JAM E;  1RJT A;  1FNW A;  1STN A;  3MXU A;  5KRU A;  4K2L A;  2R3Z A;  4DA2 A;  3D4W A;  1ILQ A;  1CZW A;  5HUR A;  3TDQ A;  2B2V C;  4L63 B;  4RH6 A;  4EVO A;  3MAQ A;  1SDF A;  1BBX C;  3SK6 A;  4NMZ A;  3L3O C;  2A6H D;  5AFW A;  4CBV A;  1VMP A;  1J9O A;  1PFN A;  1TQO A;  5FOB B;  1BCP D;  3NPP A;  2B2T A;  3VR4 A;  1D5X C;  2SOB A;  2NVX B;  3GTJ B;  2RSN A;  3FMC A;  2A68 C;  1EY0 A;  4K5V A;  2ZXO A;  1TVX A;  4L6T B;  5ELB A;  1WTV A;  4ZAI A;  4IUT A;  2NN6 H;  4A3E B;  2N88 A;  4BWG B;  4G7Z C;  3HP3 A;  3S2D B;  3BVZ A;  2BDO A;  1TT2 A;  2EZV A;  1HA5 A;  3R2I A;  2HDM A;  3IKJ A;  2CVR A;  1RTO A;  2MJ8 A;  4HMJ A;  4KV6 A;  1L0Y B;  5C5M A;  2FJ2 A;  4XT3 B;  4YIJ A;  4OO1 G;  3VA5 A;  5C44 B;  1S5E D;  4U67 3;  3A8K E;  2KVM A;  4A3K B;  1Y1V B;  2B2V A;  4IUQ A;  4KKT A;  5T1G A;  3OOC A;  1EQT A;  5IGF A;  3NK9 A;  5COR A;  3C3L A;  2D2C C;  4K5W A;  4FP5 D;  4UDU C;  3NSW A;  4C56 C;  3H3V C;  4DK1 A;  4K8I A;  2EJM A;  3QB3 A;  4ZYS A;  5M9O A;  3H94 A;  4FF1 A;  5JOB A;  3PIP 3;  1PFB A;  1TII D;  2OF1 A;  2EYL A;  4C1N K;  1PZI D;  2PNR C;  3NWS A;  4LJZ C;  2EYM A;  1JCK B;  4G4K A;  3A7A B;  4ABN A;  1WVL A;  4XXE A;  2L55 A;  3T53 B;  3D6W A;  1AFP A;  2Z1C A;  3M85 A;  2K5D A;  3SVM A;  4B9W A;  3ERQ A;  3OSO A;  3GD7 A;  1F9R A;  1AEX A;  1F2M A;  2EY6 A;  1EQV A;  5C0X I;  1I50 B;  3J7Y W;  1MSH A;  5JVG 3;  4DGZ A;  2BA0 A;  4PMB A;  4XDX A;  4UAI A;  4QMG A;  1HUN A;  3NQT A;  3M4O B;  4NW2 A;  4H13 C;  3MWY W;  3PUW A;  5A2Q L;  4MHE A;  3TP5 A;  2EYF A;  4HSP A;  2WV6 D;  5BN5 A;  1SEB D;  1JOR A;  5IT9 L;  1GUT A;  3TN2 A;  2SDF A;  4WFN 3;  4KY6 A;  2SNS A;  3P1H A;  3CHB D;  2BE5 D;  3LWE A;  1M8A A;  4FYD A;  3S1Q B;  3I4L A;  2IW3 A;  2DN8 A;  2ID0 A;  2K32 A;  5KNC A;  1TWF B;  3MA2 B;  1BUV T;  4N9T A;  1CK1 A;  1FYC A;  2QCP X;  2TSS A;  5IIF A;  1B2T A;  2JP1 A;  2PQE A;  1CM9 A;  1U4R A;  3PO3 B;  4CKB A;  1MBY A;  5C4Z A;  1DXM A;  1UAP A;  2L4N A;  3ND9 A;  1V1P A;  4TSS A;  2QDB A;  2IL8 A;  2F0N A;  2K7V A;  1STA A;  2NVT B;  1XX8 A;  2MPM A;  1QOH A;  3PIO 3;  1AZP A;  5KIX A;  2KEC A;  2K1B A;  2I46 A;  1H9J A;  3P75 A;  1RDP D;  3OPO A;  3NP8 A;  2MGS A;  4A3F B;  4BA1 I;  2B8G A;  2KCC A;  2NVY B;  2H1E A;  3Q24 A;  1STG A;  1A6X A;  1RHP A;  2WKC A;  2FMC A;  4K14 A;  2A68 D;  3PMF A;  2JEA I;  4RGO S;  3KLS A;  4X3S A;  3NQI A;  1XWE A;  4NKL A;  1A15 A;  2A6H C;  1I4H A;  5JEA J;  1EU3 A;  1ESR A;  1S5F D;  3LWU A;  3FVQ A;  2RKS A;  1HXY D;  2E74 C;  3BVM A;  4TQU S;  4IUU A;  1X3P A;  5HGT A;  1Z7T A;  3ONA B;  1UUP A;  1JR0 D;  5C3W A;  1E0B A;  1NAP A;  1MSG A;  1LLR D;  4ZRZ A;  1JWM D;  1LT4 D;  1ZYR C;  1QIL A;  5DAU A;  1G2T A;  2B2Y A;  5JEA G;  2K01 A;  3TME A;  1SAP A;  1H9S A;  2L1B A;  5J1Z A;  3GTP B;  3X3M A;  2PMZ B;  5FO8 B;  1MD2 D;  3I4M B;  4DAV A;  5FLX L;  5K36 G;  5JAV A;  2XRS D;  2EOT A;  4KI0 A;  2J7Z A;  1T5X D;  3E6Z X;  1TU2 B;  2A69 D;  4CKC A;  4PNY A;  1S5B D;  3OMC A;  1RTN A;  3E0J A;  4A3M B;  5I2Y A;  2B2W A;  4KJO A;  3DM1 A;  4LAA A;  2F0D A;  2OXP A;  2J0T D;  1R9T B;  1SYD A;  2N55 A;  4HCE A;  5C6A A;  1JOQ A;  1PXU A;  2K03 A;  4OGQ C;  2V4D A;  2H4O A;  1B1Z A;  1HRJ A;  3L9A X;  1AN8 A;  3WDN A;  3J80 E;  3HRZ C;  4V0B A;  1MI2 A;  5FK9 C;  1WTP A;  2F0L A;  5ELC A;  4CGY B;  3H0G B;  4B08 A;  4KHZ A;  1LT3 D;  1FNV A;  5I6W A;  3PUY A;  1W6K A;  3IL8 A;  4HN7 A;  5M3M B;  1K8M A;  2B8F A;  1IL8 A;  4RHR A;  2K05 A;  1ENC A;  2VB2 X;  2R6G A;  4FVM A;  2XIW A;  3DWP A;  2EY5 A;  3I3C A;  3S2H B;  1BOS A;  1EEF D;  1XTC D;  1SBB B;  1U9R A;  2IX0 A;  1LTT D;  4HED A;  4KJN A;  3W3A A;  1U4M A;  1S5D D;  5I2X A;  5CV9 A;  1KAA A;  1KTK A;  1ET6 A;  2ZT9 C;  1Q90 A;  3DHQ A;  3NUC A;  2D62 A;  1VDZ A;  2WB1 B;  2B2T C;  3R3O A;  2PW7 A;  3A54 A;  2KEE A;  3KBX A;  4QIW B;  1D5Z C;  1GHJ A;  2XNA C;  4KK7 A;  1PTO B;  2JA5 B;  1QJO A;  3CU7 A;  2E2H B;  3T4A C;  1U4P A;  4A3B B;  2PZW A;  3IFT A;  2Q8T A;  3F2U A;  3I8Z A;  5D14 A;  4E6I A;  2DNC A;  1A3V A;  1FGB D;  3VR6 A;  3OIQ A;  4ID6 A;  3GTK B;  2SEB D;  3BG3 A;  5E4W C;  3FPU B;  1Q1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...