4DR6Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 20
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr6Q00
4B3RQ 4GNXA 4LF7Q 2UUAL 2BA1A 1W3SA 5LMNQ 1JE5A 2PQAA 4A3KH 1WCMG 3GD7A 5LMNL 1S40A 5EAYA 1SMXA 1SFOH 1IL2A 1K3RA 4KI0A 4IPDA 1SN8A 1VQEA 1V43A 2Y0SG 4DV3Q 3GTPH 1ASZA 5IYDG 2FXQA 1VQ8A 3DM3A 3TS0A 1CSQA 1B8AA 4RMFA 3HKZE 2A1AA 1QVFA 3TQYA 2R7FA 4GN4B 1AE2A 4Y52H 2PNHA 1I5FA 3VDYA 2KBNA 4JOIA 4GLXA 1LTLA 3D0FA 4JI4L 1CKNA 3PV0A 4OXPA 3PO3G 1YJ9A 3NENA 5GADC 1YITA 5JJLA 3NEMA 4P73A 3ZJYC 1VQ6A 4LFAL 3W1GA 3GTGH 3TS2A 1JMCA 3AYHB 4O0AA 3HOXH 4FDBA 2R7DA 4PMWA 4LFAQ 4DR1Q 3F2DA 1PH8A 5JJKA 3NBHB 4A3IH 4R4TA 5C0XI 3S17H 4LF6Q 4DR1L 1PH6A 5C4XH 3S1NH 4RG1A 1SRUA 5ELOA 5M3MG 4JI0L 1Q7YC 1GVPA 1UWVA 4YWLA 2R92G 1OXVA 3FKIG 1LM0A 2ZJPA 4DV1L 2KHJA 1FVIA 4DR7Q 1XPUA 4X66L 3HOVG 3CCJA 3A0JA 1E1TA 2AKWB 4DV6Q 1QVCA 4GNXC 3RN5A 2HIVA 3ULPA 2VQFL 1IBLQ 4IFDG 1Q82C 3K0XA 4QJFA 1BVSA 1MJEA 2YTYA 1N32L 2UUCL 2IX0A 1LYLA 5C4XG 1L2FA 1TWHH 1Z9FA 1N32Q 1Y14B 2LSSA 3PUYA 3BJUA 2JQOA 2V1CC 1HJPA 5C0XJ 2BH2A 4C3HH 4LUOA 1IYJB 5C3EG 3G6EA 4GOPA 1YIJA 1PH1A 2KHIA 2R7ZG 1VQOA 3OTOL 1JB7A 3UE0A 4B3MQ 3RZDH 4A4IA 1NY4A 3EBEA 1EQQA 1VQ9A 2CQOA 3OTOQ 2WP8J 2F52A 4IOCA 1EUJA 1I94L 2HHHQ 4JOIC 3JAMi 4OWTB 4LF8Q 4JG2A 4ALPA 1XNQL 4B3RL 4LF7L 1YBYA 3G71A 1PH9A 3J7ZC 1J5EL 4A93G 4BXXH 1AE3A 1CKMA 3OYYA 3CP0A 3TEHB 2ZM6L 2B63H 1LUZA 5GAEC 3GO5A 3KJPA 1FL0A 1PHJA 1ASYA 4LWCA 1UE6A 1NJIC 2YV5A 2JA6H 4P72A 4TVAB 1E7ZA 5FLMH 4JI3L 1QVGA 2DUDA 3CQZH 2LXJA 5DLQE 5M5WH 2B3GA 4HJAA 3I4NG 1AH9A 2OCEA 1MJCA 3GTJH 1TWCH 3GTMH 4B3TL 4JC0A 2NZOA 1OXSC 1M90C 3H3VH 2JEBI 4IFDJ 1HNZL 4JYAQ 4A3CG 2E2IH 1OXXK 3A5ZB 1RIPA 1L1OC 3H15A 3GTQH 4LFBL 2JA7G 1PVOA 2I5MX 4LF5Q 3F8TA 5C3EH 4DV2Q 2R93G 4JYAL 4YY3L 3GTOH 2KENA 3S1RH 4J15A 3HKSA 2JA8H 3PSIA 5M3FG 5IYBH 4LF5L 4A3EG 1SROA 1TWAH 3RN2A 3KFUA 1Y1WH 4GN3B 4IO9A 4GKJQ 4DK6C 1VQMA 2ZTEA 4A3JG 1I50H 4GOPC 3PF4A 1A63A 1C9OA 4LUZA 2I5HA 3U4VA 1GD7A 1Q46A 2WB1E 1Q1EA 1WJJA 3CCMA 5C44G 2WB1G 1HNWQ 1PH2A 3F2CA 3FKIH 4YCWA 2VW9A 2F4VL 1QZGA 1A0IA 1SLJA 1CKOA 2EIFA 2XGTA 4A75A 1PA6A 3FP9A 3K7UC 1KXLA 2UXCL 4LF4Q 4ME3A 5IP7G 3UDXA 2XTIA 4GN5A 3RLNA 2VUMG 1EOVA 2UUBL 5IYBG 1V1QA 1N36Q 4PZ8A 5K36G 4QGUA 1PYSB 2K4KA 2OQKA 3FHWA 3AQQA 5LMUQ 3CXCA 3I4MH 4DR4L 1UE7A 3M4OH 5IP9G 1Q12A 1YHBA 2VL6A 4AYBG 2JE6I 4L5SA 4A3CH 2UXBQ 5H1SE 4A3FH 4DR4Q 1K8AC 1HR0W 1VQKA 2YYZA 3E0EA 3IRBA 3HOWH 3S16H 1HNXL 4OX9Q 3I7FA 3KDFB 1TXYA 1KRSA 4NXNL 2AMCB 1Q81C 1PYBA 2VS1A 1B70B 3KF6A 1I6HH 4JBJA 4OX9L 2JA6G 4DV7L 2HIXA 2NVQH 2MO1A 3PO2G 3KJOA 1UE5A 2PMZE 5J3BA 1X6OA 2QA4A 1C0AA 4X6AH 3CCRA 2QEXA 3HOYG 2JK8A 4HIOA 4JV5Q 1PH5A 4JI7Q 3F2BA 3I4OA 2ID0A 4L5RC 3PIOA 3PF5A 1VQDA 1K73C 4X64Q 1T9HA 1SR3A 2CCZA 1I3QH 4A3FG 2DGYA 4JI3Q 4IFDI 4JBWA 1YJNA 2N3SA 4R4IA 1YHAA 4DR6L 1FGUA 3Q8DA 4DR2Q 4BY1G 1NTGA 2R7ZH 4JI2Q 4JI1L 1WYDA 3T1HL 1PH3A 1HNZQ 4C3JH 4JI2L 4LW1A 4WJ3M 4QQBX 2A8VA 4BBRH 5JEAJ 3H0GG 2K5VA 2CWPA 4DV2L 1M1KC 4A3BH 4YCVA 1BBUA 1EWIA 4DR5Q 3H3VI 2ZJRA 3PCOB 1CUKA 2NVYH 3KOJA 3KYHC 1IBMQ 3K7AH 4GLAC 2RCNA 4P74A 3RR5A 4JI5Q 1XJVA 2Y0SE 5JJIA 4BY7H 2K75A 4JI5L 4DUZQ 1L1OA 4PZ7A 3DLLA 4EX5A 1JJGA 3PUVA 4IJLA 3D31A 2EQSA 5HGQA 1VQIA 4NB3A 4B3SQ 4A3EH 5IT9c 1VQAA 1SE8A 1Y1WG 3JAMc 2CWAA 5M3FH 2AWNA 4YHHQ 1VQCA 5AJ3Q 4NXMQ 1X3EA 3UDFA 2JA7H 1N34Q 4JI6Q 4X65Q 3HOZH 3CPWA 4IPGA 2OQ0A 4POGA 2BA0A 1N34L 4JI6L 1XNRL 1Q86C 1K0RA 2IT1A 4MTNA 1XMQL 3PO3H 3CC4A 2D0PA 2ZTCA 3RZOH 3CD6A 1JJCB 4DAYB 3J81c 5GROA 2UU9Q 3KLWA 4GLVB 2Z6KC 2Z0SA 1VQGA 4OWXB 2NN6I 5IYDH 2CKZB 4BBSH 2K14A 3G48A 4KLKA 3BZKA 3J81i 3K80C 2BH8A 4APVA 3U58A 4BXXG 4GKKQ 2PQAB 1WCMH 4X62L 2R6GA 5IY0A 2VQFQ 4A3DG 1EFWA 4X62Q 3M7NA 4BA2I 2E8GA 2VY3A 3S2DH 3T1YL 2K50A 1WFQA 4JI8L 1E1OA 4HJ5A 4HIDA 1W2BA 2OTJA 3CAMA 4KHPQ 3M85A 4AYBE 4DK3C 4B3ML 1UEBA 3HOUH 3RNUA 4JBMA 1N8RC 2WFWA 2VQEL 1GKHA 4QL5A 2AHOB 1YI2A 1WI5A 4DUYL 4LFCQ 4BY7G 1VQFA 1J5EQ 4DUYQ 2VNUD 4DV1Q 1JT8A 2ALYB 1S72A 3HOVH 1HZCA 2R92H 1IBML 1EYGA 4R4QA 1S3OA 1WOCA 2ES2A 1DGSA 3CCVA 4NPSA 3WWVA 4QY7A 2K5HA 4AH6A 2GVBA 4AQYL 1RL2A 1N9WA 4LF8L 1E3PA 3H0GH 2MO0A 3RLFA 3GDEA 4DKAC 3HOUG 1A8VA 2YTXA 4A3IG 1XPRA 5IYCH 1BKBA 2N8NA 3HOXG 3CF5A 1XMOQ 5ELNA 1EQRA 4MZ9A 3UE1A 4OWWB 1H95A 4POFA 1OXUA 4LF9L 5C4JH 4DV5Q 1GO3E 1HZBA 4YY3Q 3I56A 5FJ8G 1XNRQ 3I4NH 2I0QA 1L0WA 5JEAG 2RF4A 1XMQQ 4GKJL 5FLMG 2UUAQ 1N33Q 2HHHL 1U5KA 2E5LL 3CCSA 2B29A 1VQBA 2KCMA 3K8AA 1IXRA 2RHQB 4A76A 4JI0Q 1QZHA 1N33L 4EQ5A 2UU9L 4XIGS 4DR3Q 2B63G 4DR7L 2NVTH 1G6PA 2JA9A 4A3GG 5HY6A 2K5NA 4DV6L 4DR3L 3KDFA 2Q2TA 2F4VQ 5GAGC 2N78A 3CPFA 4PZ6A 3S1MH 4DV0Q 4DNIA 4GKKL 1VQHA 4R4CA 1QUQA 2Q2IA 4IPHA 3HOWG 4QIWE 1KL9A 4A3MG 1E22A 3S1QH 1VS0A 4HJ8A 4PG3A 1IZ6A 3S2HH 1X9NA 1YNXA 1HZAA 2ATWA 3E9IA 4C2MH 3HOZG 3CCUA 2Z6KA 3T1YQ 1D8LA 2JA5G 5LMUL 2VZAA 2CFMA 2JA5H 1J6QA 1VQLA 4BA1I 3CMAA 1KIXA 3JC66 1X3FA 4L5TA 3AFQA 5IP7H 4L5QA 4HIMA 1YHQA 1CKNB 1X56A 1VQ7A 4KHPL 3EN2A 1I94Q 1XNQQ 2C35B 2KCTA 3BU2A 1HNXQ 1G51A 1TWGH 4K0KQ 3M9BA 4GS3A 5C44H 4YCUA 4LNQA 1CSPA 3BZCA 4K0KL 4LFCL 2ZM6Q 5E7NA 5C0XG 3GTKH 1VQJA 4BBSG 3PUZA 3I2ZA 1K8GA 2I5LX 2HT1A 5M3MH 4JV5L 1C7YA 2EXDA 5FLXc 1VQPA 1IBLL 4JCVE 1VQ5A 1B7YB 2ZJQA 1X55A 4X64L 3UDIA 1VQNA 4A3BG 1EIYB 4BBRG 1P16A 1YJWA 4LF4L 3ULLA 4AIMA 2IHEA 1HZ9A 2UUBQ 2R93H 3HFZB 2Q2UA 2Q2HA 5FJ8H 2QGQA 3CMEA 1HR0Q 1FJGQ 1OTCA 4WJ4A 2AWOA 1VQ4A 4LFBQ 3PUXA 1JJ2A 1P8LA 2IHFA 3CCLA 5IE8A 3T1HQ 2OTLA 4MNOA 3MXNB 3M4QA 4LF9Q 2F3IA 3S15H 1Z47A 3CW2C 4Y7NH 1K9MC 1HH2P 3AEVA 1K83H 2N49A 3LGJA 3CCEA 1YEZA 2LXKA 2JEAI 1KRTA 2E5LQ 2WAQG 3J81j 4A3LH 3KF8B 4R4OA 1KD1C 3CC7A 1D7QA 2MFIA 3PO2H 4A3KG 4YWMA 3CC2A 2D0OA 4DPGA 1Y1VH 4O2DA 4P75A 3W1BA 5IWAL 4B3SL 3HKZG 3MEFA 2NZHA 4DV0L 2UXDQ 1BBWA 5IP9H 5IWAQ 1N36L 2A19A 4B3TQ 5LMNW 4NXML 5GQOA 4GNXB 3S24A 3M4PA 1PFSA 4X65L 3EIVA 1QUQB 1EIFA 2D62A 3ER0A 3KF6B 1O7IA 5M5YH 4BY1H 1NBWA 2UXBL 1GM5A 2MNAA 2IY5B 1U0LA 1MKHA 2NN6G 1KAWA 4A3MH 1Q1BA 3J80c 3ICEA 3M3YH 4A3DH 1UE1A 3J7A5 3GTLH 3AFPA 4HJ7A 4DV7Q 1A62A 1Y1VG 1G291 1VCIA 4DV3L 2ZTDA 4DV4L 3F1ZA 4UPAA 3HOYH 4UP8A 3G4SA 2IX1A 4A3LG 4A3GH 3OW2A 3B6YA 5GAHC 4DV4Q 1HNWL 3J80i 3SGIA 4DUZL 4JI7L 3PUWA 2YTVA 4UP7A 1X65A 1PH4A 1KQSA 1R9TH 2E2HH 1V9PA 1X54A 2UXCQ 4UP9A 2PI2E 2JA8G 4JI4Q 4UY8C 3NELA 3PIPA 3UDGA 1OXTA 2JJQA 2L15A 4JI1Q 1HR0L 2RHSB 4OONA 1FJGL 3I4MG 1KC8C 4IJHA 3TRZA 2PI2A 1Q8KA 4IOAA 3E9HA 1YVCA 2ASBA 4LF6L 4XTCS 5IYCG 2GVAA 2VUMH 2VQEQ 3A5UA 2E2JH 2OWOA 1TWFH 3K81C 4DR5L 4LUVA 1XPOA 1PH7A 3U4ZA 4NXNQ 1L1OB 3STBC 2YU9H 1NE3A 4JBKA 3TREA 3CCQA 1KHIA 3I55A 4C3IH 4X66Q 4OO1I 4HIKA 2WAQE 4YWKA 4TQUS 3L7ZC 1E24A 3U50C 3ULJA 4OO1G 4A93H 2MQHA 1NMFA 3ERSX 2K52A 3L0OA 2UUCQ 4AQYQ 3STBD 2HQLA 4GOPB 4A3JH 4R1JA 4HJ9A 4DAMA 1YZ6A 3PGZA 1XTDA 4YHHL 5AJ3L 4P71A 1XMOL 4DR6Q 4JI8Q 3RLOA 3S14H 3W5OA 5BR8L 1IBKQ 2UXDL 1NMGA 2H5XA 4DV5L 4DR2L 4H02A 1MIUA 3L2PA 1PV4A 1X3GA 5BR8Q 4KHZA 1IBKL 2NVXH 3A74A 4IPCA 5M5XH 2GN5A
chains in the Genus database with same CATH superfamily
1S5ED 4CDCC 5DM63 4EQOA 5BN4A 3K57A 1D5MC 3S1QB 2F0SA 1PMRA 2XVSA 1SN8A 4HN7A 3VR6A 5IYDG 2FXQA 2L55A 4UHVA 5FO8B 1I50B 1CSQA 2NVXB 2A1AA 5KGUA 1I5FA 3VDYA 1S4ZA 2KBNA 4JOIA 3VR3A 1LTLA 1CKNA 1BR9A 5GADC 2MP1A 3EROA 3NEMA 3GTGH 1KABA 3P20A 5FOBB 3K59A 1JB3A 5CMDA 3NBHB 4A3IH 2WAQB 3T13A 5T1IA 3BVZA 3S17H 4RG1A 2IWHA 5M3MG 1Q7YC 5M5WB 1J8IA 1PTOB 2KHJA 1FVIA 4RA8A 1EZ8A 1STYA 3S16B 2AKWB 4DV6Q 1QVCA 3RN5A 3ULPA 1IBLQ 3A7AB 4IFDG 2QILA 3K0XA 1MJEA 4IUVA 3HS0C 4DNRB 3Q22A 5C4XG 1Z9FA 2EY6A 1U4LA 1T5XD 1B2TA 2LSSA 3K58A 3PUYA 2JQOA 4B08A 2KOLA 3G6EA 5CBAE 1PH1A 3OTOL 4B3MQ 1NY4A 1VQ9A 2A6HC 2CQOA 5CORA 3OTOQ 1C48A 2LY7A 4ZQ3A 4IOCA 1EUJA 4JG2A 1HQRD 4LF7L 1PH9A 4EGVA 2QCPX 3K5LA 2EPBA 4A93G 2A5HA 4I7AA 5M3MB 1PHJA 1ASYA 2A74C 1F9QA 4ZYSA 3GTJH 1G8ZD 1TWCH 1SE3A 1EOTA 1H9SA 2K6AA 1TWGB 4QCLA 2JEBI 4IFDJ 4A3CG 4LFBL 1OXXK 1L1OC 1S5DD 5CR3A 3F8TA 4DV2Q 2R93G 5EKIA 2JA8H 4A3EB 3OOCA 2JA6B 1SROA 1B9NA 2F0PA 1LTGD 3I4LA 1B3AA 1KAAA 4DK6C 2ZTEA 2ZXPA 2PCFB 4H7BA 1A63A 4LUZA 4MIUA 2HDLA 1Q46A 3OIPA 2F0NA 1F2ZA 1CKOA 2EIFA 2XGTA 1SFOB 2F3WA 1KXLA 3BDLA 2MJ8A 4GN5A 1TS2A 2B8GA 1V1QA 3MA2B 4PZ8A 1PYSB 2OQKA 3V2TA 4K8IA 1QE6A 2B2YA 2L11A 4AYBG 3R2IA 3L3OC 1K8AC 3E0EA 1HNXL 1BXTA 3I7FA 4NXNL 1PYBA 2VS1A 2Z1CA 3PO2G 4DV7L 2F0JA 1K8MA 2MO1A 1QNKA 1PRTF 1X6OA 2QA4A 4HIOA 1GHJA 4JI7Q 1LTBD 3F2BA 4K2KA 3PIOA 3A56A 1I6VC 2RDGA 1T9HA 1SR3A 2CCZA 1TR5A 4JBWA 3TMEA 5CV6A 3SHLA 1FGUA 4DK0A 4DR2Q 2K03A 4JI2Q 4K5WA 3T1HL 3HOUB 1PH3A 2NZ1D 4JI2L 4LW1A 4QQBX 2CQAA 4BBRH 4BS9A 4ABNA 3H91A 1BOSA 3PCOB 1MSHA 3KOJA 2B2YC 3R3OA 2RCNA 4K6DA 4L8JA 1FGBD 2Y0SE 2VB2X 4KY7A 4BY7H 1EY7A 4HMIA 4DXFA 3S1RB 4IJLA 3D31A 5HGQA 4A3EH 1SE8A 1Y1WG 3JAMc 2CWAA 5M3FH 1QWYA 4NXMQ 4MTKA 4JI6Q 5C4JB 3HOZH 3CPWA 2OQ0A 3TP5A 2BA0A 1VF5C 5I9PA 4JI6L 1Q86C 3RZOH 2OEOA 1SNMA 1JJCB 3T53B 1O7ZA 1I4HA 1SYBA 4F7XA 5CV8A 1UAPA 2MUYA 5HURA 4KLKA 3U58A 5G3LF 1YNJD 5IY0A 4V0BA 4A3DG 3DM1A 3U9SA 2WINB 2VY3A 3S2DH 5IGCA 1WFQA 4JI8L 5E1FA 1F9RA 3CAMA 3TDQA 4ZLTF 1RF2D 4C3HB 3MAQA 4B3ML 4XYQA 2ICEC 5FLXE 3NE5B 2KA7A 1N8RC 3BG3A 2WFWA 2JYOA 1LO5D 2AHOB 2BDOA 1QG7A 1JWUD 1PTOH 3GQBA 4TSSA 1JR0D 1JT8A 1IYUA 2ALYB 3EQLC 1IBML 1EYGA 1S3OA 2ES2A 1DGSA 3WWVA 5C6AA 2NVQB 2GVBA 1Y69U 1FYCA 1HTPA 4KY6A 3WOEA 1EY6A 4RGOS 3OW7A 3RLFA 3HOUG 5IYCH 4OWWB 1LTSD 5C4JH 3HOZB 3MXGA 1HZBA 1NR2A 1STAA 2I0QA 5IGBA 2RF4A 1XMQQ 2X6GA 4X3SA 2UUAQ 4J1MA 1YNJC 3K8AA 3J81L 1QZHA 4EQ5A 4XIGS 2B63G 4DR7L 1Z6HA 2NVTH 4H0LC 1GUSA 1O80A 2P5ZX 4DNIA 2F0TA 4UDUC 3HOWG 1F77A 2FHTA 3VA5A 2B2UC 4PG3A 3S2HH 1X9NA 1HZAA 4XQQA 4C2MH 1WTRA 3HOZG 3T1YQ 1D8LA 1JC7A 2JA5H 2K5WA 1J6QA 1VQLA 3JC66 5M5XB 1VQ7A 4L5QA 1XNQQ 1HTLD 2KCTA 1HNXQ 1G51A 2B2VA 5D65A 2M00A 1SMYD 2SEBD 1RTOA 4IQZA 1K8GA 2HT1A 1E2ZA 2AQ3B 4JCVE 2E2JB 1SEBD 1ZXTA 4A3BG 4V190 2J0TD 4AIMA 1HZ9A 2UUBQ 2R93H 4XQJA 2Q2UA 3CMEA 5FJ8H 2QGQA 2AWOA 3VA7A 3CCLA 1F2MA 2RDFA 3A8JE 3T1HQ 3M4QA 4LF9Q 1BCPF 4PQXA 2OXPA 1SYDA 2AQ1B 3S2DB 2DN8A 1Z47A 4J8QA 1K83H 5KNCA 2RSNA 2JEAI 1CZGA 3K0YA 2G5DA 1KD1C 1Y8OB 2C5CA 2MFIA 4C1NI 4RGNA 4KD3A 2D9UA 2VXWA 1TY0A 2IPKD 3FPUB 5IWAL 1TU2B 4RKLA 3F2UA 4DV0L 2NZHA 1BBWA 2BE5D 5IWAQ 2PO4A 1N36L 2RVLA 4NXML 5GQOA 3S24A 3JAME 2DNEA 1QUQB 3KF6B 5M5YH 4FF4A 2IY5B 3Q23A 1KAWA 4O42A 4A3MH 3J80c 2PPBC 3ICEA 4OEMB 2SOBA 1BNZA 1I4QA 4HJ7A 1A62A 3EA6A 2ZTDA 4UPAA 3HOYH 2F0WA 1HNWL 3SGIA 1Z7TA 1KQSA 3NQTA 1AEXA 4IALA 2L9HA 2NVYB 1X32A 4HMJA 3FMCA 2JJQA 2L15A 1HR0L 1FJGL 1KNEA 2R7ZB 4DK1A 1K3BC 1A3UA 3I3CA 2OWOA 2E2JH 1JICA 1PH7A 2K05A 4FVMA 3STBC 3U4ZA 1NE3A 3TREA 2F0DA 2I46A 4TQUS 3ULJA 4CKBA 1UEAB 2EY2A 2MQHA 2K52A 4OELB 5I6WA 2UUCQ 1NUCA 2RKSA 3STBD 4PNYA 4R1JA 4DGZA 3PGZA 1XTDA 2I07B 5EKKA 5HGTA 3S14H 1IBKQ 1NMGA 2H5XA 4H02A 4QUCA 1IBKL 3A74A 3DHQA 2RBMA 2Q8RE 4BY7B 2UUAL 1DD2A 2BA1A 1Q8IA 1MGSA 5BN5A 5FLXL 1K3RA 4KI0A 4XT1B 2LMCB 1EU3A 2IJ0A 1V43A 2Y0SG 1H9SB 4N9TA 4BBRB 1VQ8A 3TS0A 1LTAD 2E74C 1W6JA 3HKZE 1EY5A 4RMFA 3TQYA 2R7FA 2OF1A 1DXMA 4GN4B 4A3DB 1QB5D 2PNHA 4L63B 4GLXA 3RUZA 4JI4L 2CW0C 3PV0A 1YJ9A 1FD7D 1PZJD 5AFWA 4RGMA 3AYHB 1JMCA 4O0AA 4FDBA 2R7DA 3OSOA 3H0GB 5A2QL 5JJKA 1PRTC 2YU9B 3H09A 5COYA 1PH6A 4FYDA 5ELOA 4JI0L 4ME5A 2ENBA 2R92G 2NWGA 1B9MA 1F2YA 1RTNA 3A0JA 3BVMA 5C4HA 2VQFL 1Q82C 4CDDC 2YTYA 1N32L 1L2FA 1TWHH 2F0EA 1TWFB 1N32Q 1BF4A 1Y14B 4U673 4A3BB 1HUNA 4L6TB 2CHBD 3RZDB 3DMUA 4KV6A 2F52A 3LNNA 2SNSA 1I4GA 1YBYA 3G71A 1V1PB 1AE3A 1CKMA 2ZM6L 3TEHB 2B63H 5GAEC 2DY7A 3GO5A 5EPKA 1NJIC 1UE6A 2YV5A 2JA6H 4F87A 1QVGA 2DUDA 2B3GA 2OCEA 1STHA 3HG9A 4JC0A 4RCNA 3H3VH 1XTCD 2NTTA 2Z4IA 5CV7A 1HNZL 4JYAQ 2E2IH 2K7VA 1PVOA 2JA7G 4B9WA 2SDFA 2Q8TA 5C3EH 1F9SA 4JYAL 4YY3L 2XN9C 3GTOH 2H4OA 5IYBH 1TWAH 4GN3B 2L1BA 1X3QA 1VQMA 2JA7B 3Q0AA 3MXNA 4A3JG 1I50H 3NWTA 3PF4A 3QR8A 5EGTA 1EYDA 2I5HA 4CDFC 2F0KA 5EKLA 5I2XA 3DEPA 1SYFA 1ICFB 1PLFA 1Q1EA 3C1EA 5C44G 4K6LA 1HNWQ 3R2TA 1PH2A 1UNSA 4ZKBB 1A0IA 5KRUA 3QOLA 3V05A 3FP9A 1U4MA 2F0GA 3UDXA 2VUMG 1EOVA 5K36G 2EJGC 3LWEA 4QGUA 3RD4A 1WTQA 3KLSX 1PXUA 3CXCA 1Q12A 4N8X1 1STEA 1Y8PB 5I2YA 5CV9A 2YYZA 3S16H 1R4QB 1TXYA 1ZEQX 2EXZA 3VYUA 3J81E 2NVQH 5J3BA 5JJZA 3KK7A 1C0AA 1G2TA 3HOYG 2JK8A 5CBEE 4L5RC 3S1NB 1VQDA 3K6OA 4DAPA 1EY0A 3GTGB 5D14A 1YJNA 1A3TA 3I4MB 1YHAA 4F8MA 3PQIA 1B4OA 4JI1L 5KNDA 5JOBA 2QEJC 3L9AX 3H0GG 2K5VA 4DV2L 1M1KC 1EWIA 1O78A 2NVTB 4IURA 2ZJRA 2E2HB 4K5XA 1CUKA 4GLAC 4JI5Q 1XJVA 2FMCA 5JJIA 5E4XA 3MWYW 2DNCA 4DUZQ 4JI5L 1JCKB 2EQSA 2CH4A 4DN4M 4NB3A 5IT9c 1STGA 1VQAA 1LT3D 1X3PA 4YHHQ 5AJ3Q 2DJGC 2JA7H 3NBHA 1N34Q 5BN3A 1CZWA 4X65Q 3GTJB 3BYYB 4OGQC 1XNRL 2FJ2A 1N34L 2D2CC 2HCCA 4MTNA 3VYRA 2D0PA 2ZTCA 5ELDA 3D6WA 4DXGA 4DAYB 2K5DA 1GXDC 1ET9A 3KLWA 3CHBD 2Z6KC 4OWXB 3K5MA 1ILQA 1D1IA 5IYDH 4FXDA 4KKTA 1CFMA 3G48A 3J81i 3BZKA 3VYSA 2VUMB 2BH8A 4APVA 3IAYA 1A15A 2VQFQ 2R6GA 2A68D 3E5SA 5JEAH 1EFWA 3M7NA 4QUFA 4DA2A 3M7GA 2F3VA 3KBXA 2K04A 3JAML 3CKIB 1W2BA 2OTJA 2SNMA 4C3JB 4KHPQ 5EPJA 3M85A 2A69D 2NB0A 2Z6BA 1WTXA 1VMPA 1SE2A 1GKHA 1YI2A 1HCZA 5D3DA 4DUYL 4BY7G 3N52A 1VQFA 2VB3X 4BBSB 1HFGA 1KTKA 3OHXC 4DUYQ 4NW2A 2VNUD 4DV1Q 3HOVH 1NAPA 2DY8A 4QY7A 3CRKC 4AQYL 2EE1A 1PRTD 1N9WA 3X3NA 3FRPB 1K8OA 1A3VA 3GDEA 1IW7C 4A3IG 2F0FA 2N8NA 3CF5A 1XMOQ 4MHEA 3UE1A 4POFA 3NTIA 5T1GA 2KCNA 4YY3Q 1BCPC 3I4NH 1SBBB 1L0WA 4NDXA 4JK1C 4IUQA 2A68C 2HHHL 2E5LL 3CCSA 1LTTD 3C1FA 4RGTA 5C4ZA 5EBDA 2F0HA 3PO2B 4CJ2C 1F9PA 5CV5A 2JA9A 4ILWA 5HY6A 4DV6L 5GAGC 2N78A 3CPFA 3S1MH 1QUQA 5J39A 2C9OA 1E22A 2WV6D 4RHSA 1VS0A 2PZTA 1F2LA 3D6CA 4FNFA 1OO9B 2JA5G 2VZAA 1DOMA 2CFMA 2R3ZA 4BY1B 1CHPD 4BA1I 3CMAA 1KIXA 1E0BA 1EY8A 3AFQA 4K8JA 5IP7H 1CA6A 1X56A 1TWCB 4A93B 4H13C 1U4PA 4LJZC 3GTMB 3BDOA 2X6LA 4LNQA 4FF2A 3J80E 4TRDA 1I6HB 2MPMA 3GTKH 4RHRA 4NKLA 2EYOA 2Z8LA 2BCOA 1L0XB 4Q5VA 2EXDA 5FLXc 1P16A 1YJWA 4LF4L 1HA6A 4MN3A 4PMCA 4G4KA 2IHEA 3EFXD 3M4OB 4G57A 1H9MA 2Q2HA 1OTCA 3E6ZX 4LFBQ 4FXKC 2IHFA 3TP6A 3R93A 3S15H 3NP8A 1J9OA 1S5BD 3GTPB 2LXKA 1KRTA 2K28A 1IKLA 3KF8B 3CC2A 1Y1VH 3GTLB 3W1BA 3V96A 1DOKA 1H9KA 2UXDQ 3EJIA 1BCPD 5FKAC 3MFGA 5EQ0A 3PIO3 4X65L 3GTOB 3M4YA 3W3AA 4WRDA 2D62A 3ER0A 1O7IA 1GM5A 1EIGA 3VR4A 1U0LA 2AQ2B 5C3XA 1Q1BA 3D4WA 4IFDH 3GTLH 4DV7Q 4DV3L 1K83B 4DV4L 3IKJA 4UP8A 3NBIA 4OIJA 4DV4Q 4JI7L 1LTID 2EZVA 1GHKA 3FEWX 3PIP3 2UXCQ 4UP9A 2HUGA 2PW5A 1XWEA 2PI2E 2JA8G 4KN4C 4UY8C 3NELA 5A2QE 3BZDB 1OXTA 1SNQA 3QB3A 1ENAA 2F4IA 1Q8KA 4EQNA 2ASBA 4LF6L 3W2DA 4XTCS 4CKEA 1T5EA 3A5UA 2GA4B 3VR5A 1SNCA 1L1OB 1O7YA 5ELBA 3CCQA 4X66Q 3D4DA 2QDBA 3U50C 3ERSX 3TSSA 3FVQA 1SMYC 5I4DA 3BS1A 4AQYQ 1SYEA 3HOXB 4HJ9A 1SYCA 3GTKB 4DAMA 1YNNC 1XMOL 4QIWB 1TS4A 4DR6Q 1IHZA 2F0QA 5CV4A 3HEJA 5IGFA 1QOHA 4DFAA 2NVXH 5M5XH 3T16A 1Y8NB 4B3RQ 1JOOA 1Y1VB 5DM73 5IGGA 4I65A 5LMNQ 1GUNA 1D5ZC 2PQAA 3S2HB 5KNBA 5LMNL 4QMGA 5EAYA 1SMXA 2AUJD 2WKCA 2QKIC 3NTKA 1KDCA 3S9WA 4IPDA 4DF7A 3GTPH 1XYIA 3CRLC 5JAVA 3DM3A 2E76C 3NK9A 1PDQA 4LMQD 3SXHA 4KHVA 1AE2A 1K0SA 1DYQA 1YITA 2LFNA 1GOZA 2H1EA 4EVOA 3D4RA 4PMWA 1ET6A 2IX3A 5ELEA 5CC4A 3F2DA 1PH8A 1LV9A 1W6KA 4GZYC 2B2TA 1UWVA 2HCIA 4NP5A 3O13A 1OXVA 4NMZA 1LM0A 4YWLA 3WOFA 3MEHA 4FF3A 1GUGA 1XPUA 3HOVG 2O2LD 5FO9B 1FNVA 2L0CA 4BWGB 2UUCL 2IX0A 1ZYRC 5LHY1 2V1CC 2EYLA 1BDOA 5CYUA 5C0XJ 2BH2A 2K32A 5C3EG 1YIJA 4GOPA 3MVVA 1ONLA 5DNFA 2F0IA 1JB7A 4A4IA 3EBEA 5C5LA 3T4AC 2FMMA 2BE5C 2WP8J 1I94L 3JAMi 2K33A 4OWTB 4ALPA 2EYJA 2J7ZA 1J5EL 1ENCA 3DWQA 2FINB 1LUZA 1E2WA 1K28A 2CH4W 3T51B 4LWCA 1QNUA 4TVAB 1Q90A 5FLMH 2PMZB 4JI3L 3CQZH 3SK4A 1II3A 5C44B 4A3MB 5FO7B 1M90C 3HOWB 3PO3B 4WORA 1PZID 3GTQH 2I5MX 4LF5Q 1A2TA 3AB9A 3S1RH 3PSIA 4LF5L 4A3EG 3RN2A 2E2DC 1Y1WH 3KFUA 4IO9A 3MXPA 5E3FA 3H6MA 4KJOA 4GOPC 3VYTA 5J1ZA 2RQXA 2F1MA 4K2LA 1GD7A 3SEBA 2WB1E 1WJJA 4CBVA 4IUTA 3FKIH 1LT5D 4CJ0B 1PA6A 4A75A 2UXCL 4G7ZC 1QJOA 2XTIA 1WTWA 3RLNA 2UUBL 5IYBG 2K4KA 3FHWA 4B9XA 1E2VA 3DEOA 1UE7A 4L5SA 2UXBQ 2JE6I 4A3FH 1IW7D 4R8IA 1HR0W 3IRBA 4Z9CB 5NUCA 4OX9Q 3KDFB 2RCFA 1KRSA 2AMCB 3GV3A 3KF6A 1Q81C 4OX9L 2JA6G 1STBA 4KMUC 1UE5A 5KYIA 1G91A 4N9PA 3CCRA 3I4OA 2ID0A 3PF5A 4RCOA 4N8FA 1K73C 4X64Q 4O1NA 2XRSD 1SYGA 2DGYA 1GJXA 3UI2A 4DR6L 4R4IA 1NTGA 4M8AA 4HAEA 1WYDA 1HNZQ 1YNND 1EQVA 4C3JH 5JEAJ 2CWPA 1SDFA 3MXUA 4YCVA 1BBUA 1GUWA 4DR5Q 3H3VI 5ELCA 4CDEC 3PMFA 3KYHC 4WFN3 4A3GB 1GUTA 2K75A 4PZ7A 3DLLA 3PUVA 2KEEA 4ID6A 5K5PA 1VQIA 3G6JB 4B3SQ 2J4XA 4R9WA 1Y1WB 5C4XB 2QDLA 1VQCA 1X3EA 1HPCA 4ZUIA 2EJFC 4IPGA 4G7HC 1XXGA 3PO3H 2WKDA 3CC4A 2EY1A 1TVXA 3J81c 3C46A 1LLRD 1ILPA 5GROA 2UU9Q 3A7LA 2NN6I 1LABA 4GKKQ 3K7AB 3A8IE 5C0XH 4BXXG 1WCMH 1TS5A 3GP7A 4XQNA 4BA2I 2E8GA 4HSPA 3I8ZA 5EBCA 3KBGA 1E1OA 4HJ5A 3S15B 1HFNA 2O4XA 4HIDA 2M2LA 2KCCA 4DAVA 1KLGD 2EYPA 4AYBE 4M1UB 2Q8IB 1UEBA 1M8AA 3T56B 4IUUA 1AW7A 4X3UA 2PQEA 4QL5A 4X3TA 4JVZA 4LFCQ 2R93B 4E6IA 3OIQA 1J5EQ 1TWHB 1EQTA 4HTHA 1EYAA 1S72A 2F0VA 1VF7A 1WOCA 2K5HA 4LF8L 2EY5A 2L5TA 2MO0A 4DKAC 3HRZC 3J7YW 1XPRA 4LF8Q 1H95A 5ELNA 4MZ9A 4XXEA 1OXUA 1WTPA 1GO3E 4A3FB 1SXTA 1EU4A 5TSSA 1EY4A 1CT1D 4ZUJA 1XNRQ 4C2MB 1VQBA 2KCMA 5IGEA 1TIID 4JI0Q 1R9TB 4UAIA 4DR3Q 4XDXA 3VR2A 3DWPA 4A3GG 2K5NA 3DXJC 4DR3L 3KDFA 3FPPA 1EWCA 4KD4A 2Q2TA 1C4QA 4PZ6A 4DNTB 3MTSA 1VQHA 1PFNA 4IPHA 1AZPA 1SNDA 2CVRA 4QIWE 1KL9A 3S1QH 4JPBW 1B44D 1IZ6A 3I70A 3NQIA 2ATWA 1ZKOA 1U4RA 2KECA 2K01A 1C8CA 1I4XA 5A35A 3J7AF 4L5TA 1YHQA 4KHPL 1ESFA 4HIMA 5EJWA 1CKNB 1ESRA 2XIWA 2WB1B 1AP0A 5C44H 2EJMA 3A8KE 4HSVA 4YCUA 3BZCA 2ZM6Q 5C0XG 2RA4A 1VQJA 4OO1H 2X69A 3HZXA 3NTHA 2I5LX 1C7YA 1O7LA 1VQ5A 2B63B 1VMCA 1B7YB 3MHBA 1X55A 3DWAA 3UDIA 4X64L 2ZJQA 3QJYA 4BBRG 3QWNA 4R8NA 5F2DA 2NTSA 4WJ4A 2NBFA 4KKSA 3OMGA 3PUXA 1DONA 5IE8A 2OTLA 2F3IA 3LWUA 3G7LA 1STNA 3FKIB 4Y7NH 3K5OA 1JOQA 4IUNA 2B39A 2N49A 3LGJA 2B8FA 4C56C 2E5LQ 2WAQG 3J81j 3M3YB 5ISRA 4R4OA 1D7QA 2PZUA 3PO2H 4A3KG 1L0YB 4YWMA 3OWEB 2D0OA 4DPGA 4O2DA 3EVQA 4B3SL 2Z4HA 1B3QA 1RD9D 3HKZG 3BYTB 2A69C 4HR7B 4B3TQ 1I4PA 1SAPA 5C3EB 5LMNW 3S14B 3M4PA 2E2IB 4DAYA 1WTVA 3EIVA 5M5YB 4K14A 4ZKCB 2KHSA 3H3VC 3SVMA 3RMHA 2AUKA 2MNAA 1TKWB 3CQZB 2NN6G 5KIXA 1DOLA 2N88A 3M3YH 3HOVB 4A3DH 4ZAIA 3NHHA 3AFPA 2OT2A 3F1ZA 3G4SA 2IX1A 4A3LG 4A3GH 3OW2A 3B6YA 3NWSA 3SE0A 1Q3LA 2YTVA 4Y7NB 1JE4A 1R9TH 2E2HH 1V9PA 1X54A 3HGBA 1JQYD 1WTOA 3H94A 1EIHA 1UUPA 3PIPA 3UDGA 3CU7A 2B2VC 3ITPA 3QO2A 4JI1Q 2RHSB 4OONA 3I4MG 1KC8C 4IJHA 5LL6S 4FXGC 1WTHA 4IOAA 4HCSA 1YVCA 5IYCG 2GVAA 2VUMH 1SNOA 1TWFH 1XPOA 5DAUA 4X3KA 3HOYB 4JBKA 1KHIA 2XNAC 4HIKA 4YWKA 3L7ZC 4OO1G 1NMFA 3SR1A 3K5NA 2PZWA 4J6HA 4GOPB 4A3JH 3LX0A 1PTOD 4S3SA 3RZOB 1YZ6A 1WD1A 4LK1C 1CHQD 3KLSA 2R61A 5L37A 4YHHL 4JI8Q 3RLOA 5AJ3L 2UXDL 4CGYB 1MIUA 3L2PA 1MD2D 1X3GA 4KHZA 4IPCA 1JOKA 1S5CD 4GNXA 4LF7Q 1RHPA 3S1MB 3TP7A 1W3SA 1JE5A 3BDCA 1B50A 2WACA 2QF7A 3D8GA 1WCMG 3GD7A 3J80L 4A3KH 2A6EC 1S40A 3N6RA 1SFOH 2TMPA 1EY9A 2Y0SB 1VQEA 4DV3Q 1ASZA 3SK5A 5IGDA 1B8AA 1CI3M 4KJNA 1QVFA 4RH6A 4Y52H 3AMUA 3HKZB 3D0FA 5JJLA 4OXPA 3PO3G 3NENA 4IZ8A 4FP5D 5G3LD 4P73A 3ZJYC 1VQ6A 4LFAL 1LACA 3W1GA 3TS2A 2JA8B 3HOXH 3NXWA 4LFAQ 3NUCA 5DEHA 4DR1Q 4R4TA 5C0XI 2F0LA 4LF6Q 4DR1L 3S1NH 5C4XH 1SRUA 1GVPA 2BOSA 4KN7C 3P7JA 3FKIG 1QILA 2ZJPA 4DV1L 3ERQA 2HD3A 3IFTA 4DR7Q 4X66L 3CCJA 2KEDA 1E1TA 4GNXC 2HIVA 4H44C 2TSSA 4QJFA 1BVSA 1LYLA 3SK6A 2D5DA 2JN4A 1FR3A 4ZCKA 3BJUA 3QIAA 1HJPA 4C3HH 4LUOA 1IYJB 4CHTB 1D2BA 4PMBA 1PFMA 2KHIA 4RWSC 2R7ZG 1VQOA 3UE0A 3RZDH 1EQQA 2EYFA 3KF8A 1KDAA 1EZ6A 2LS01 1IL2A 2K5QA 2HHHQ 1XNQL 4JOIC 1D5XC 3Q24A 4B3RL 1RDPD 2A73B 3J7ZC 5FK9C 4BXXH 3OYYA 1IL8A 2MGSA 3CP0A 1EYCA 3KJPA 3TP8A 1NSNS 1FL0A 2A6ED 1BBXC 3J7AV 4F88A 4P72A 3WDNA 1E7ZA 5IODA 2PNRC 5DLQE 2LXJA 4HJAA 5M5WH 1AH9A 3I4NG 1MJCA 3GTMH 4B3TL 2NZOA 1OXSC 4QF4A 1WD0A 1MSGA 3A5ZB 1RIPA 1RKNA 3H15A 2JXMB 4FF1A 2KENA 4J15A 3HKSA 2ZT9C 4OIKA 5M3FG 2ZXRA 5M3FB 4GKJQ 5IIFA 1TS3A 1ICWA 1C9OA 3U4VA 4DU9A 2HDMA 1LT6D 3CCMA 2WB1G 1A6XA 3F2CA 4YCWA 2VW9A 2F4VL 1QZGA 1QCBD 1SLJA 3DUZA 1HHVA 3K7UC 1TQOA 2F03A 2A6HD 4ME3A 5IP7G 4LF4Q 1RCVD 2EYMA 2KUMA 1N36Q 5J22A 3QG1A 5JVG3 3AQQA 5LMUQ 1ENFA 3I4MH 4DR4L 2PW7A 2BDNA 2F0OA 1YHBA 5IP9G 2VL6A 3C2PA 3M4OH 4A3CH 5H1SE 1MI2A 3GTQB 4DR4Q 1TT2A 1VQKA 3HOWH 2MHVA 3NPPA 1B70B 1I6HH 1LTRD 4JBJA 2HIXA 1BCPB 3KJOA 2PMZE 3QOJA 4X6AH 2QEXA 1H9JA 4JV5Q 1PH5A 2JSOA 3AU7A 3MZ5A 2HQEA 4XT3B 1MHWC 1I3QH 4C3IB 4A3FG 4JI3Q 4IFDI 5JPMC 5I9OA 2N3SA 3KUPA 3Q8DA 4XYOA 4BY1G 2R7ZH 5E4WC 2JA5B 5D3IB 1M4VA 2XRQD 4WJ3M 1PTOC 5K36H 2A8VA 4YIJA 4A3BH 2O5IC 1H9RA 2NVYH 4U68A 1CK1A 1IBMQ 3X3MA 3K7AH 4P74A 2L12A 3RR5A 1CA5A 1EEID 1L1OA 1R4PB 4C3IG 4EX5A 1JJGA 2V4DA 4C3JG 1NNXA 1DM0B 2AWNA 3UDFA 4Q0FA 3TN2A 4POGA 2XWJB 1K0RA 2IT1A 3R8BA 1XMQL 1PRTB 2NUCA 1HUMA 2FFKB 3CD6A 1RJTA 1BUVT 4GLVB 2Z0SA 1VQGA 1GUOA 3I90A 3MC0B 2CKZB 1G6ZA 5IT9E 4HCEA 4BBSH 2K14A 3K80C 2KVMA 2PQAB 4X62L 1D1KA 4P2CB 1HRJA 4X62Q 1SJED 1I4RA 1PYWD 3U9OA 3T1YL 2K50A 3ND9A 1B53A 4C3HG 2EDGA 1EFID 1EWHA 4DK3C 3HOUH 3RNUA 1WCMB 3SDZA 4JBMA 3C3LA 4OL7A 1IKMA 2VQEL 1BQQT 1WI5A 1XX8A 3GV6A 1PZKD 4ZRZA 1CQFA 1B1ZA 3E0JA 1V1OA 2ICIA 5C3WA 1NCVA 5C5MA 4CKCA 1DJRD 4FO2A 1HZCA 2R92H 4R4QA 2IL8A 3CCVA 4NPSA 4QB4A 1TWAB 4AH6A 1RL2A 3ZYYX 1E3PA 3H0GH 3A54A 1HXYD 3IL8A 1A8VA 2YTXA 2ZXOA 2YU9H 1BKBA 3HOXG 2DJFC 5KEEA 1EQRA 4LF9L 1SE4A 4DV5Q 4G7OC 2E75C 3SK8A 1KLUD 5JVH3 3I56A 2CW0D 5FJ8G 5KYLA 4KY5A 5JEAG 4GKJL 5FLMG 3A55A 1N33Q 1U5KA 2PYKA 2B29A 1IXRA 2RHQB 4A76A 1N33L 1S5FD 2UU9L 2EOTA 1G6PA 3TBIB 1HA5A 2F4VQ 5I6YA 3FDTA 2RSOA 2XSCA 4DV0Q 4GKKL 4R4CA 3OPOA 2Q2IA 1JWMD 3ND8A 4A3MG 2NN6H 4A3KB 4HJ8A 3I4NB 1YNXA 1CM9A 3E9IA 4I7ZC 1JORA 4RAUC 4IN3A 2Z6KA 3CCUA 1AN8A 1JWSD 5LMUL 4WJWA 1X3FA 1TY2A 3EN2A 1I94Q 2C35B 3BU2A 1TWGH 3E3XA 4K0KQ 1EEFD 3M9BA 4GS3A 4CJ1B 1CSPA 4K0KL 4LFCL 1RODA 5E7NA 3TZUA 4A3JB 1LT4D 4BBSG 1DCZA 3PUZA 3I2ZA 4C1NK 2IW3A 4RFBA 5M3MH 4JV5L 1VQPA 1IBLL 2G9HD 2EYHA 1VQNA 1EIYB 3ULLA 3HFZB 1HR0Q 2K1BA 1FJGQ 4K5VA 1VQ4A 1JJ2A 1P8LA 4TKOB 4MNOA 3MXNB 5ELFA 2KJXA 3P1HA 4JW0A 2XWBB 3I73A 5EPLA 2B2UA 3CW2C 1ZYRD 1K9MC 1HH2P 2B2WA 3AEVA 3CCEA 1IYVA 1YEZA 1DZ1A 3URYA 3TZDA 4A3LH 3CC7A 2QW7A 1KNAA 4P75A 1V1PA 3HP3A 4KTAA 3MEFA 4KK7A 4ULLA 1FNUA 5IP9H 2A19A 1ML0D 1PFBA 4KKUA 2EVBA 4GNXB 2O5JC 2WIIB 1PFSA 2F0UA 1G2SA 3I91A 3P75A 5IOCA 1EIFA 5LL6X 4BY1H 2UXBL 1NBWA 1PTOF 1BO0A 2Z9HA 3D3RA 1MKHA 4ZK9B 1SJHD 1UE1A 1HQMC 3J7A5 2NYZD 1Y1VG 1G291 1VCIA 4LAAA 5CGKA 2R92B 4RKBA 4HEDA 5GAHC 2JP1A 3J80i 4DUZL 2N55A 2F0MA 3PUWA 5JPNC 4UP7A 1X65A 2B2WC 1PH4A 3IFDA 3NSWA 2B2TC 4JI4Q 1D6EC 2RDHA 1AZQA 4OHJA 3TRZA 2PI2A 2M9VA 1U9RA 3KLRA 1VDZA 3E9HA 3MFYA 4IUPA 1SSOA 1MBYA 3Q6SA 3OWFA 2VQEQ 3OMCA 4ODGA 3K81C 4DR5L 4LUVA 4NXNQ 1AFPA 1SNPA 2L4NA 3I55A 1I3QB 4C3IH 4OO1I 2WAQE 3BVGA 1NR4A 1E24A 1CTMA 4A93H 1A2UA 1KDBA 3L0OA 1V8QA 5M9OA 1CQVA 2HQLA 4A3IB 2G9DA 5IT9L 3S17B 3I72A 4AYBB 4PV1C 4P71A 3W5OA 2KQ3A 5BR8L 4EQPA 4DV5L 4DR2L 1WVLA 1FNWA 1PV4A 1EL0A 5BR8Q 2LKVA 3ONAB 2GN5A
chains in the Genus database with same CATH topology
4B3RQ 4GNXA 4LF7Q 2UUAL 2BA1A 1W3SA 5LMNQ 1JE5A 2PQAA 4A3KH 1WCMG 3GD7A 5LMNL 1S40A 5EAYA 1SMXA 1SFOH 1IL2A 1K3RA 4KI0A 4IPDA 1SN8A 1VQEA 1V43A 2Y0SG 4DV3Q 3GTPH 1ASZA 5IYDG 2FXQA 1VQ8A 3DM3A 3TS0A 1CSQA 1B8AA 4RMFA 3HKZE 2A1AA 1QVFA 3TQYA 2R7FA 4GN4B 1AE2A 4Y52H 2PNHA 1I5FA 3VDYA 2KBNA 4JOIA 4GLXA 1LTLA 3D0FA 4JI4L 1CKNA 3PV0A 4OXPA 3PO3G 1YJ9A 3NENA 5GADC 1YITA 5JJLA 3NEMA 4P73A 3ZJYC 1VQ6A 4LFAL 3W1GA 3GTGH 3TS2A 1JMCA 3AYHB 4O0AA 3HOXH 4FDBA 2R7DA 4PMWA 4LFAQ 4DR1Q 3F2DA 1PH8A 5JJKA 3NBHB 4A3IH 4R4TA 5C0XI 3S17H 4LF6Q 4DR1L 1PH6A 5C4XH 3S1NH 4RG1A 1SRUA 5ELOA 5M3MG 4JI0L 1Q7YC 1GVPA 1UWVA 4YWLA 2R92G 1OXVA 3FKIG 1LM0A 2ZJPA 4DV1L 2KHJA 1FVIA 4DR7Q 1XPUA 4X66L 3HOVG 3CCJA 3A0JA 1E1TA 2AKWB 4DV6Q 1QVCA 4GNXC 3RN5A 2HIVA 3ULPA 2VQFL 1IBLQ 4IFDG 1Q82C 3K0XA 4QJFA 1BVSA 1MJEA 2YTYA 1N32L 2UUCL 2IX0A 1LYLA 5C4XG 1L2FA 1TWHH 1Z9FA 1N32Q 1Y14B 2LSSA 3PUYA 3BJUA 2JQOA 2V1CC 1HJPA 5C0XJ 2BH2A 4C3HH 4LUOA 1IYJB 5C3EG 3G6EA 4GOPA 1YIJA 1PH1A 2KHIA 2R7ZG 1VQOA 3OTOL 1JB7A 3UE0A 4B3MQ 3RZDH 4A4IA 1NY4A 3EBEA 1EQQA 1VQ9A 2CQOA 3OTOQ 2WP8J 2F52A 4IOCA 1EUJA 1I94L 2HHHQ 4JOIC 3JAMi 4OWTB 4LF8Q 4JG2A 4ALPA 1XNQL 4B3RL 4LF7L 1YBYA 3G71A 1PH9A 3J7ZC 1J5EL 4A93G 4BXXH 1AE3A 1CKMA 3OYYA 3CP0A 3TEHB 2ZM6L 2B63H 1LUZA 5GAEC 3GO5A 3KJPA 1FL0A 1PHJA 1ASYA 4LWCA 1UE6A 1NJIC 2YV5A 2JA6H 4P72A 4TVAB 1E7ZA 5FLMH 4JI3L 1QVGA 2DUDA 3CQZH 2LXJA 5DLQE 5M5WH 2B3GA 4HJAA 3I4NG 1AH9A 2OCEA 1MJCA 3GTJH 1TWCH 3GTMH 4B3TL 4JC0A 2NZOA 1OXSC 1M90C 3H3VH 2JEBI 4IFDJ 1HNZL 4JYAQ 4A3CG 2E2IH 1OXXK 3A5ZB 1RIPA 1L1OC 3H15A 3GTQH 4LFBL 2JA7G 1PVOA 2I5MX 4LF5Q 3F8TA 5C3EH 4DV2Q 2R93G 4JYAL 4YY3L 3GTOH 2KENA 3S1RH 4J15A 3HKSA 2JA8H 3PSIA 5M3FG 5IYBH 4LF5L 4A3EG 1SROA 1TWAH 3RN2A 3KFUA 1Y1WH 4GN3B 4IO9A 4GKJQ 4DK6C 1VQMA 2ZTEA 4A3JG 1I50H 4GOPC 3PF4A 1A63A 1C9OA 4LUZA 2I5HA 3U4VA 1GD7A 1Q46A 2WB1E 1Q1EA 1WJJA 3CCMA 5C44G 2WB1G 1HNWQ 1PH2A 3F2CA 3FKIH 4YCWA 2VW9A 2F4VL 1QZGA 1A0IA 1SLJA 1CKOA 2EIFA 2XGTA 4A75A 1PA6A 3FP9A 3K7UC 1KXLA 2UXCL 4LF4Q 4ME3A 5IP7G 3UDXA 2XTIA 4GN5A 3RLNA 2VUMG 1EOVA 2UUBL 5IYBG 1V1QA 1N36Q 4PZ8A 5K36G 4QGUA 1PYSB 2K4KA 2OQKA 3FHWA 3AQQA 5LMUQ 3CXCA 3I4MH 4DR4L 1UE7A 3M4OH 5IP9G 1Q12A 1YHBA 2VL6A 4AYBG 2JE6I 4L5SA 4A3CH 2UXBQ 5H1SE 4A3FH 4DR4Q 1K8AC 1HR0W 1VQKA 2YYZA 3E0EA 3IRBA 3HOWH 3S16H 1HNXL 4OX9Q 3I7FA 3KDFB 1TXYA 1KRSA 4NXNL 2AMCB 1Q81C 1PYBA 2VS1A 1B70B 3KF6A 1I6HH 4JBJA 4OX9L 2JA6G 4DV7L 2HIXA 2NVQH 2MO1A 3PO2G 3KJOA 1UE5A 2PMZE 5J3BA 1X6OA 2QA4A 1C0AA 4X6AH 3CCRA 2QEXA 3HOYG 2JK8A 4HIOA 4JV5Q 1PH5A 4JI7Q 3F2BA 3I4OA 2ID0A 4L5RC 3PIOA 3PF5A 1VQDA 1K73C 4X64Q 1T9HA 1SR3A 2CCZA 1I3QH 4A3FG 2DGYA 4JI3Q 4IFDI 4JBWA 1YJNA 2N3SA 4R4IA 1YHAA 4DR6L 1FGUA 3Q8DA 4DR2Q 4BY1G 1NTGA 2R7ZH 4JI2Q 4JI1L 1WYDA 3T1HL 1PH3A 1HNZQ 4C3JH 4JI2L 4LW1A 4WJ3M 4QQBX 2A8VA 4BBRH 5JEAJ 3H0GG 2K5VA 2CWPA 4DV2L 1M1KC 4A3BH 4YCVA 1BBUA 1EWIA 4DR5Q 3H3VI 2ZJRA 3PCOB 1CUKA 2NVYH 3KOJA 3KYHC 1IBMQ 3K7AH 4GLAC 2RCNA 4P74A 3RR5A 4JI5Q 1XJVA 2Y0SE 5JJIA 4BY7H 2K75A 4JI5L 4DUZQ 1L1OA 4PZ7A 3DLLA 4EX5A 1JJGA 3PUVA 4IJLA 3D31A 2EQSA 5HGQA 1VQIA 4NB3A 4B3SQ 4A3EH 5IT9c 1VQAA 1SE8A 1Y1WG 3JAMc 2CWAA 5M3FH 2AWNA 4YHHQ 1VQCA 5AJ3Q 4NXMQ 1X3EA 3UDFA 2JA7H 1N34Q 4JI6Q 4X65Q 3HOZH 3CPWA 4IPGA 2OQ0A 4POGA 2BA0A 1N34L 4JI6L 1XNRL 1Q86C 1K0RA 2IT1A 4MTNA 1XMQL 3PO3H 3CC4A 2D0PA 2ZTCA 3RZOH 3CD6A 1JJCB 4DAYB 3J81c 5GROA 2UU9Q 3KLWA 4GLVB 2Z6KC 2Z0SA 1VQGA 4OWXB 2NN6I 5IYDH 2CKZB 4BBSH 2K14A 3G48A 4KLKA 3BZKA 3J81i 3K80C 2BH8A 4APVA 3U58A 4BXXG 4GKKQ 2PQAB 1WCMH 4X62L 2R6GA 5IY0A 2VQFQ 4A3DG 1EFWA 4X62Q 3M7NA 4BA2I 2E8GA 2VY3A 3S2DH 3T1YL 2K50A 1WFQA 4JI8L 1E1OA 4HJ5A 4HIDA 1W2BA 2OTJA 3CAMA 4KHPQ 3M85A 4AYBE 4DK3C 4B3ML 1UEBA 3HOUH 3RNUA 4JBMA 1N8RC 2WFWA 2VQEL 1GKHA 4QL5A 2AHOB 1YI2A 1WI5A 4DUYL 4LFCQ 4BY7G 1VQFA 1J5EQ 4DUYQ 2VNUD 4DV1Q 1JT8A 2ALYB 1S72A 3HOVH 1HZCA 2R92H 1IBML 1EYGA 4R4QA 1S3OA 1WOCA 2ES2A 1DGSA 3CCVA 4NPSA 3WWVA 4QY7A 2K5HA 4AH6A 2GVBA 4AQYL 1RL2A 1N9WA 4LF8L 1E3PA 3H0GH 2MO0A 3RLFA 3GDEA 4DKAC 3HOUG 1A8VA 2YTXA 4A3IG 1XPRA 5IYCH 1BKBA 2N8NA 3HOXG 3CF5A 1XMOQ 5ELNA 1EQRA 4MZ9A 3UE1A 4OWWB 1H95A 4POFA 1OXUA 4LF9L 5C4JH 4DV5Q 1GO3E 1HZBA 4YY3Q 3I56A 5FJ8G 1XNRQ 3I4NH 2I0QA 1L0WA 5JEAG 2RF4A 1XMQQ 4GKJL 5FLMG 2UUAQ 1N33Q 2HHHL 1U5KA 2E5LL 3CCSA 2B29A 1VQBA 2KCMA 3K8AA 1IXRA 2RHQB 4A76A 4JI0Q 1QZHA 1N33L 4EQ5A 2UU9L 4XIGS 4DR3Q 2B63G 4DR7L 2NVTH 1G6PA 2JA9A 4A3GG 5HY6A 2K5NA 4DV6L 4DR3L 3KDFA 2Q2TA 2F4VQ 5GAGC 2N78A 3CPFA 4PZ6A 3S1MH 4DV0Q 4DNIA 4GKKL 1VQHA 4R4CA 1QUQA 2Q2IA 4IPHA 3HOWG 4QIWE 1KL9A 4A3MG 1E22A 3S1QH 1VS0A 4HJ8A 4PG3A 1IZ6A 3S2HH 1X9NA 1YNXA 1HZAA 2ATWA 3E9IA 4C2MH 3HOZG 3CCUA 2Z6KA 3T1YQ 1D8LA 2JA5G 5LMUL 2VZAA 2CFMA 2JA5H 1J6QA 1VQLA 4BA1I 3CMAA 1KIXA 3JC66 1X3FA 4L5TA 3AFQA 5IP7H 4L5QA 4HIMA 1YHQA 1CKNB 1X56A 1VQ7A 4KHPL 3EN2A 1I94Q 1XNQQ 2C35B 2KCTA 3BU2A 1HNXQ 1G51A 1TWGH 4K0KQ 3M9BA 4GS3A 5C44H 4YCUA 4LNQA 1CSPA 3BZCA 4K0KL 4LFCL 2ZM6Q 5E7NA 5C0XG 3GTKH 1VQJA 4BBSG 3PUZA 3I2ZA 1K8GA 2I5LX 2HT1A 5M3MH 4JV5L 1C7YA 2EXDA 5FLXc 1VQPA 1IBLL 4JCVE 1VQ5A 1B7YB 2ZJQA 1X55A 4X64L 3UDIA 1VQNA 4A3BG 1EIYB 4BBRG 1P16A 1YJWA 4LF4L 3ULLA 4AIMA 2IHEA 1HZ9A 2UUBQ 2R93H 3HFZB 2Q2UA 2Q2HA 5FJ8H 2QGQA 3CMEA 1HR0Q 1FJGQ 1OTCA 4WJ4A 2AWOA 1VQ4A 4LFBQ 3PUXA 1JJ2A 1P8LA 2IHFA 3CCLA 5IE8A 3T1HQ 2OTLA 4MNOA 3MXNB 3M4QA 4LF9Q 2F3IA 3S15H 1Z47A 3CW2C 4Y7NH 1K9MC 1HH2P 3AEVA 1K83H 2N49A 3LGJA 3CCEA 1YEZA 2LXKA 2JEAI 1KRTA 2E5LQ 2WAQG 3J81j 4A3LH 3KF8B 4R4OA 1KD1C 3CC7A 1D7QA 2MFIA 3PO2H 4A3KG 4YWMA 3CC2A 2D0OA 4DPGA 1Y1VH 4O2DA 4P75A 3W1BA 5IWAL 4B3SL 3HKZG 3MEFA 2NZHA 4DV0L 2UXDQ 1BBWA 5IP9H 5IWAQ 1N36L 2A19A 4B3TQ 5LMNW 4NXML 5GQOA 4GNXB 3S24A 3M4PA 1PFSA 4X65L 3EIVA 1QUQB 1EIFA 2D62A 3ER0A 3KF6B 1O7IA 5M5YH 4BY1H 1NBWA 2UXBL 1GM5A 2MNAA 2IY5B 1U0LA 1MKHA 2NN6G 1KAWA 4A3MH 1Q1BA 3J80c 3ICEA 3M3YH 4A3DH 1UE1A 3J7A5 3GTLH 3AFPA 4HJ7A 4DV7Q 1A62A 1Y1VG 1G291 1VCIA 4DV3L 2ZTDA 4DV4L 3F1ZA 4UPAA 3HOYH 4UP8A 3G4SA 2IX1A 4A3LG 4A3GH 3OW2A 3B6YA 5GAHC 4DV4Q 1HNWL 3J80i 3SGIA 4DUZL 4JI7L 3PUWA 2YTVA 4UP7A 1X65A 1PH4A 1KQSA 1R9TH 2E2HH 1V9PA 1X54A 2UXCQ 4UP9A 2PI2E 2JA8G 4JI4Q 4UY8C 3NELA 3PIPA 3UDGA 1OXTA 2JJQA 2L15A 4JI1Q 1HR0L 2RHSB 4OONA 1FJGL 3I4MG 1KC8C 4IJHA 3TRZA 2PI2A 1Q8KA 4IOAA 3E9HA 1YVCA 2ASBA 4LF6L 4XTCS 5IYCG 2GVAA 2VUMH 2VQEQ 3A5UA 2E2JH 2OWOA 1TWFH 3K81C 4DR5L 4LUVA 1XPOA 1PH7A 3U4ZA 4NXNQ 1L1OB 3STBC 2YU9H 1NE3A 4JBKA 3TREA 3CCQA 1KHIA 3I55A 4C3IH 4X66Q 4OO1I 4HIKA 2WAQE 4YWKA 4TQUS 3L7ZC 1E24A 3U50C 3ULJA 4OO1G 4A93H 2MQHA 1NMFA 3ERSX 2K52A 3L0OA 2UUCQ 4AQYQ 3STBD 2HQLA 4GOPB 4A3JH 4R1JA 4HJ9A 4DAMA 1YZ6A 3PGZA 1XTDA 4YHHL 5AJ3L 4P71A 1XMOL 4DR6Q 4JI8Q 3RLOA 3S14H 3W5OA 5BR8L 1IBKQ 2UXDL 1NMGA 2H5XA 4DV5L 4DR2L 4H02A 1MIUA 3L2PA 1PV4A 1X3GA 5BR8Q 4KHZA 1IBKL 2NVXH 3A74A 4IPCA 5M5XH 2GN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R Q;  4GNX A;  4LF7 Q;  2UUA L;  2BA1 A;  1W3S A;  5LMN Q;  1JE5 A;  2PQA A;  4A3K H;  1WCM G;  3GD7 A;  5LMN L;  1S40 A;  5EAY A;  1SMX A;  1SFO H;  1IL2 A;  1K3R A;  4KI0 A;  4IPD A;  1SN8 A;  1VQE A;  1V43 A;  2Y0S G;  4DV3 Q;  3GTP H;  1ASZ A;  5IYD G;  2FXQ A;  1VQ8 A;  3DM3 A;  3TS0 A;  1CSQ A;  1B8A A;  4RMF A;  3HKZ E;  2A1A A;  1QVF A;  3TQY A;  2R7F A;  4GN4 B;  1AE2 A;  4Y52 H;  2PNH A;  1I5F A;  3VDY A;  2KBN A;  4JOI A;  4GLX A;  1LTL A;  3D0F A;  4JI4 L;  1CKN A;  3PV0 A;  4OXP A;  3PO3 G;  1YJ9 A;  3NEN A;  5GAD C;  1YIT A;  5JJL A;  3NEM A;  4P73 A;  3ZJY C;  1VQ6 A;  4LFA L;  3W1G A;  3GTG H;  3TS2 A;  1JMC A;  3AYH B;  4O0A A;  3HOX H;  4FDB A;  2R7D A;  4PMW A;  4LFA Q;  4DR1 Q;  3F2D A;  1PH8 A;  5JJK A;  3NBH B;  4A3I H;  4R4T A;  5C0X I;  3S17 H;  4LF6 Q;  4DR1 L;  1PH6 A;  5C4X H;  3S1N H;  4RG1 A;  1SRU A;  5ELO A;  5M3M G;  4JI0 L;  1Q7Y C;  1GVP A;  1UWV A;  4YWL A;  2R92 G;  1OXV A;  3FKI G;  1LM0 A;  2ZJP A;  4DV1 L;  2KHJ A;  1FVI A;  4DR7 Q;  1XPU A;  4X66 L;  3HOV G;  3CCJ A;  3A0J A;  1E1T A;  2AKW B;  4DV6 Q;  1QVC A;  4GNX C;  3RN5 A;  2HIV A;  3ULP A;  2VQF L;  1IBL Q;  4IFD G;  1Q82 C;  3K0X A;  4QJF A;  1BVS A;  1MJE A;  2YTY A;  1N32 L;  2UUC L;  2IX0 A;  1LYL A;  5C4X G;  1L2F A;  1TWH H;  1Z9F A;  1N32 Q;  1Y14 B;  2LSS A;  3PUY A;  3BJU A;  2JQO A;  2V1C C;  1HJP A;  5C0X J;  2BH2 A;  4C3H H;  4LUO A;  1IYJ B;  5C3E G;  3G6E A;  4GOP A;  1YIJ A;  1PH1 A;  2KHI A;  2R7Z G;  1VQO A;  3OTO L;  1JB7 A;  3UE0 A;  4B3M Q;  3RZD H;  4A4I A;  1NY4 A;  3EBE A;  1EQQ A;  1VQ9 A;  2CQO A;  3OTO Q;  2WP8 J;  2F52 A;  4IOC A;  1EUJ A;  1I94 L;  2HHH Q;  4JOI C;  3JAM i;  4OWT B;  4LF8 Q;  4JG2 A;  4ALP A;  1XNQ L;  4B3R L;  4LF7 L;  1YBY A;  3G71 A;  1PH9 A;  3J7Z C;  1J5E L;  4A93 G;  4BXX H;  1AE3 A;  1CKM A;  3OYY A;  3CP0 A;  3TEH B;  2ZM6 L;  2B63 H;  1LUZ A;  5GAE C;  3GO5 A;  3KJP A;  1FL0 A;  1PHJ A;  1ASY A;  4LWC A;  1UE6 A;  1NJI C;  2YV5 A;  2JA6 H;  4P72 A;  4TVA B;  1E7Z A;  5FLM H;  4JI3 L;  1QVG A;  2DUD A;  3CQZ H;  2LXJ A;  5DLQ E;  5M5W H;  2B3G A;  4HJA A;  3I4N G;  1AH9 A;  2OCE A;  1MJC A;  3GTJ H;  1TWC H;  3GTM H;  4B3T L;  4JC0 A;  2NZO A;  1OXS C;  1M90 C;  3H3V H;  2JEB I;  4IFD J;  1HNZ L;  4JYA Q;  4A3C G;  2E2I H;  1OXX K;  3A5Z B;  1RIP A;  1L1O C;  3H15 A;  3GTQ H;  4LFB L;  2JA7 G;  1PVO A;  2I5M X;  4LF5 Q;  3F8T A;  5C3E H;  4DV2 Q;  2R93 G;  4JYA L;  4YY3 L;  3GTO H;  2KEN A;  3S1R H;  4J15 A;  3HKS A;  2JA8 H;  3PSI A;  5M3F G;  5IYB H;  4LF5 L;  4A3E G;  1SRO A;  1TWA H;  3RN2 A;  3KFU A;  1Y1W H;  4GN3 B;  4IO9 A;  4GKJ Q;  4DK6 C;  1VQM A;  2ZTE A;  4A3J G;  1I50 H;  4GOP C;  3PF4 A;  1A63 A;  1C9O A;  4LUZ A;  2I5H A;  3U4V A;  1GD7 A;  1Q46 A;  2WB1 E;  1Q1E A;  1WJJ A;  3CCM A;  5C44 G;  2WB1 G;  1HNW Q;  1PH2 A;  3F2C A;  3FKI H;  4YCW A;  2VW9 A;  2F4V L;  1QZG A;  1A0I A;  1SLJ A;  1CKO A;  2EIF A;  2XGT A;  4A75 A;  1PA6 A;  3FP9 A;  3K7U C;  1KXL A;  2UXC L;  4LF4 Q;  4ME3 A;  5IP7 G;  3UDX A;  2XTI A;  4GN5 A;  3RLN A;  2VUM G;  1EOV A;  2UUB L;  5IYB G;  1V1Q A;  1N36 Q;  4PZ8 A;  5K36 G;  4QGU A;  1PYS B;  2K4K A;  2OQK A;  3FHW A;  3AQQ A;  5LMU Q;  3CXC A;  3I4M H;  4DR4 L;  1UE7 A;  3M4O H;  5IP9 G;  1Q12 A;  1YHB A;  2VL6 A;  4AYB G;  2JE6 I;  4L5S A;  4A3C H;  2UXB Q;  5H1S E;  4A3F H;  4DR4 Q;  1K8A C;  1HR0 W;  1VQK A;  2YYZ A;  3E0E A;  3IRB A;  3HOW H;  3S16 H;  1HNX L;  4OX9 Q;  3I7F A;  3KDF B;  1TXY A;  1KRS A;  4NXN L;  2AMC B;  1Q81 C;  1PYB A;  2VS1 A;  1B70 B;  3KF6 A;  1I6H H;  4JBJ A;  4OX9 L;  2JA6 G;  4DV7 L;  2HIX A;  2NVQ H;  2MO1 A;  3PO2 G;  3KJO A;  1UE5 A;  2PMZ E;  5J3B A;  1X6O A;  2QA4 A;  1C0A A;  4X6A H;  3CCR A;  2QEX A;  3HOY G;  2JK8 A;  4HIO A;  4JV5 Q;  1PH5 A;  4JI7 Q;  3F2B A;  3I4O A;  2ID0 A;  4L5R C;  3PIO A;  3PF5 A;  1VQD A;  1K73 C;  4X64 Q;  1T9H A;  1SR3 A;  2CCZ A;  1I3Q H;  4A3F G;  2DGY A;  4JI3 Q;  4IFD I;  4JBW A;  1YJN A;  2N3S A;  4R4I A;  1YHA A;  4DR6 L;  1FGU A;  3Q8D A;  4DR2 Q;  4BY1 G;  1NTG A;  2R7Z H;  4JI2 Q;  4JI1 L;  1WYD A;  3T1H L;  1PH3 A;  1HNZ Q;  4C3J H;  4JI2 L;  4LW1 A;  4WJ3 M;  4QQB X;  2A8V A;  4BBR H;  5JEA J;  3H0G G;  2K5V A;  2CWP A;  4DV2 L;  1M1K C;  4A3B H;  4YCV A;  1BBU A;  1EWI A;  4DR5 Q;  3H3V I;  2ZJR A;  3PCO B;  1CUK A;  2NVY H;  3KOJ A;  3KYH C;  1IBM Q;  3K7A H;  4GLA C;  2RCN A;  4P74 A;  3RR5 A;  4JI5 Q;  1XJV A;  2Y0S E;  5JJI A;  4BY7 H;  2K75 A;  4JI5 L;  4DUZ Q;  1L1O A;  4PZ7 A;  3DLL A;  4EX5 A;  1JJG A;  3PUV A;  4IJL A;  3D31 A;  2EQS A;  5HGQ A;  1VQI A;  4NB3 A;  4B3S Q;  4A3E H;  5IT9 c;  1VQA A;  1SE8 A;  1Y1W G;  3JAM c;  2CWA A;  5M3F H;  2AWN A;  4YHH Q;  1VQC A;  5AJ3 Q;  4NXM Q;  1X3E A;  3UDF A;  2JA7 H;  1N34 Q;  4JI6 Q;  4X65 Q;  3HOZ H;  3CPW A;  4IPG A;  2OQ0 A;  4POG A;  2BA0 A;  1N34 L;  4JI6 L;  1XNR L;  1Q86 C;  1K0R A;  2IT1 A;  4MTN A;  1XMQ L;  3PO3 H;  3CC4 A;  2D0P A;  2ZTC A;  3RZO H;  3CD6 A;  1JJC B;  4DAY B;  3J81 c;  5GRO A;  2UU9 Q;  3KLW A;  4GLV B;  2Z6K C;  2Z0S A;  1VQG A;  4OWX B;  2NN6 I;  5IYD H;  2CKZ B;  4BBS H;  2K14 A;  3G48 A;  4KLK A;  3BZK A;  3J81 i;  3K80 C;  2BH8 A;  4APV A;  3U58 A;  4BXX G;  4GKK Q;  2PQA B;  1WCM H;  4X62 L;  2R6G A;  5IY0 A;  2VQF Q;  4A3D G;  1EFW A;  4X62 Q;  3M7N A;  4BA2 I;  2E8G A;  2VY3 A;  3S2D H;  3T1Y L;  2K50 A;  1WFQ A;  4JI8 L;  1E1O A;  4HJ5 A;  4HID A;  1W2B A;  2OTJ A;  3CAM A;  4KHP Q;  3M85 A;  4AYB E;  4DK3 C;  4B3M L;  1UEB A;  3HOU H;  3RNU A;  4JBM A;  1N8R C;  2WFW A;  2VQE L;  1GKH A;  4QL5 A;  2AHO B;  1YI2 A;  1WI5 A;  4DUY L;  4LFC Q;  4BY7 G;  1VQF A;  1J5E Q;  4DUY Q;  2VNU D;  4DV1 Q;  1JT8 A;  2ALY B;  1S72 A;  3HOV H;  1HZC A;  2R92 H;  1IBM L;  1EYG A;  4R4Q A;  1S3O A;  1WOC A;  2ES2 A;  1DGS A;  3CCV A;  4NPS A;  3WWV A;  4QY7 A;  2K5H A;  4AH6 A;  2GVB A;  4AQY L;  1RL2 A;  1N9W A;  4LF8 L;  1E3P A;  3H0G H;  2MO0 A;  3RLF A;  3GDE A;  4DKA C;  3HOU G;  1A8V A;  2YTX A;  4A3I G;  1XPR A;  5IYC H;  1BKB A;  2N8N A;  3HOX G;  3CF5 A;  1XMO Q;  5ELN A;  1EQR A;  4MZ9 A;  3UE1 A;  4OWW B;  1H95 A;  4POF A;  1OXU A;  4LF9 L;  5C4J H;  4DV5 Q;  1GO3 E;  1HZB A;  4YY3 Q;  3I56 A;  5FJ8 G;  1XNR Q;  3I4N H;  2I0Q A;  1L0W A;  5JEA G;  2RF4 A;  1XMQ Q;  4GKJ L;  5FLM G;  2UUA Q;  1N33 Q;  2HHH L;  1U5K A;  2E5L L;  3CCS A;  2B29 A;  1VQB A;  2KCM A;  3K8A A;  1IXR A;  2RHQ B;  4A76 A;  4JI0 Q;  1QZH A;  1N33 L;  4EQ5 A;  2UU9 L;  4XIG S;  4DR3 Q;  2B63 G;  4DR7 L;  2NVT H;  1G6P A;  2JA9 A;  4A3G G;  5HY6 A;  2K5N A;  4DV6 L;  4DR3 L;  3KDF A;  2Q2T A;  2F4V Q;  5GAG C;  2N78 A;  3CPF A;  4PZ6 A;  3S1M H;  4DV0 Q;  4DNI A;  4GKK L;  1VQH A;  4R4C A;  1QUQ A;  2Q2I A;  4IPH A;  3HOW G;  4QIW E;  1KL9 A;  4A3M G;  1E22 A;  3S1Q H;  1VS0 A;  4HJ8 A;  4PG3 A;  1IZ6 A;  3S2H H;  1X9N A;  1YNX A;  1HZA A;  2ATW A;  3E9I A;  4C2M H;  3HOZ G;  3CCU A;  2Z6K A;  3T1Y Q;  1D8L A;  2JA5 G;  5LMU L;  2VZA A;  2CFM A;  2JA5 H;  1J6Q A;  1VQL A;  4BA1 I;  3CMA A;  1KIX A;  3JC6 6;  1X3F A;  4L5T A;  3AFQ A;  5IP7 H;  4L5Q A;  4HIM A;  1YHQ A;  1CKN B;  1X56 A;  1VQ7 A;  4KHP L;  3EN2 A;  1I94 Q;  1XNQ Q;  2C35 B;  2KCT A;  3BU2 A;  1HNX Q;  1G51 A;  1TWG H;  4K0K Q;  3M9B A;  4GS3 A;  5C44 H;  4YCU A;  4LNQ A;  1CSP A;  3BZC A;  4K0K L;  4LFC L;  2ZM6 Q;  5E7N A;  5C0X G;  3GTK H;  1VQJ A;  4BBS G;  3PUZ A;  3I2Z A;  1K8G A;  2I5L X;  2HT1 A;  5M3M H;  4JV5 L;  1C7Y A;  2EXD A;  5FLX c;  1VQP A;  1IBL L;  4JCV E;  1VQ5 A;  1B7Y B;  2ZJQ A;  1X55 A;  4X64 L;  3UDI A;  1VQN A;  4A3B G;  1EIY B;  4BBR G;  1P16 A;  1YJW A;  4LF4 L;  3ULL A;  4AIM A;  2IHE A;  1HZ9 A;  2UUB Q;  2R93 H;  3HFZ B;  2Q2U A;  2Q2H A;  5FJ8 H;  2QGQ A;  3CME A;  1HR0 Q;  1FJG Q;  1OTC A;  4WJ4 A;  2AWO A;  1VQ4 A;  4LFB Q;  3PUX A;  1JJ2 A;  1P8L A;  2IHF A;  3CCL A;  5IE8 A;  3T1H Q;  2OTL A;  4MNO A;  3MXN B;  3M4Q A;  4LF9 Q;  2F3I A;  3S15 H;  1Z47 A;  3CW2 C;  4Y7N H;  1K9M C;  1HH2 P;  3AEV A;  1K83 H;  2N49 A;  3LGJ A;  3CCE A;  1YEZ A;  2LXK A;  2JEA I;  1KRT A;  2E5L Q;  2WAQ G;  3J81 j;  4A3L H;  3KF8 B;  4R4O A;  1KD1 C;  3CC7 A;  1D7Q A;  2MFI A;  3PO2 H;  4A3K G;  4YWM A;  3CC2 A;  2D0O A;  4DPG A;  1Y1V H;  4O2D A;  4P75 A;  3W1B A;  5IWA L;  4B3S L;  3HKZ G;  3MEF A;  2NZH A;  4DV0 L;  2UXD Q;  1BBW A;  5IP9 H;  5IWA Q;  1N36 L;  2A19 A;  4B3T Q;  5LMN W;  4NXM L;  5GQO A;  4GNX B;  3S24 A;  3M4P A;  1PFS A;  4X65 L;  3EIV A;  1QUQ B;  1EIF A;  2D62 A;  3ER0 A;  3KF6 B;  1O7I A;  5M5Y H;  4BY1 H;  1NBW A;  2UXB L;  1GM5 A;  2MNA A;  2IY5 B;  1U0L A;  1MKH A;  2NN6 G;  1KAW A;  4A3M H;  1Q1B A;  3J80 c;  3ICE A;  3M3Y H;  4A3D H;  1UE1 A;  3J7A 5;  3GTL H;  3AFP A;  4HJ7 A;  4DV7 Q;  1A62 A;  1Y1V G;  1G29 1;  1VCI A;  4DV3 L;  2ZTD A;  4DV4 L;  3F1Z A;  4UPA A;  3HOY H;  4UP8 A;  3G4S A;  2IX1 A;  4A3L G;  4A3G H;  3OW2 A;  3B6Y A;  5GAH C;  4DV4 Q;  1HNW L;  3J80 i;  3SGI A;  4DUZ L;  4JI7 L;  3PUW A;  2YTV A;  4UP7 A;  1X65 A;  1PH4 A;  1KQS A;  1R9T H;  2E2H H;  1V9P A;  1X54 A;  2UXC Q;  4UP9 A;  2PI2 E;  2JA8 G;  4JI4 Q;  4UY8 C;  3NEL A;  3PIP A;  3UDG A;  1OXT A;  2JJQ A;  2L15 A;  4JI1 Q;  1HR0 L;  2RHS B;  4OON A;  1FJG L;  3I4M G;  1KC8 C;  4IJH A;  3TRZ A;  2PI2 A;  1Q8K A;  4IOA A;  3E9H A;  1YVC A;  2ASB A;  4LF6 L;  4XTC S;  5IYC G;  2GVA A;  2VUM H;  2VQE Q;  3A5U A;  2E2J H;  2OWO A;  1TWF H;  3K81 C;  4DR5 L;  4LUV A;  1XPO A;  1PH7 A;  3U4Z A;  4NXN Q;  1L1O B;  3STB C;  2YU9 H;  1NE3 A;  4JBK A;  3TRE A;  3CCQ A;  1KHI A;  3I55 A;  4C3I H;  4X66 Q;  4OO1 I;  4HIK A;  2WAQ E;  4YWK A;  4TQU S;  3L7Z C;  1E24 A;  3U50 C;  3ULJ A;  4OO1 G;  4A93 H;  2MQH A;  1NMF A;  3ERS X;  2K52 A;  3L0O A;  2UUC Q;  4AQY Q;  3STB D;  2HQL A;  4GOP B;  4A3J H;  4R1J A;  4HJ9 A;  4DAM A;  1YZ6 A;  3PGZ A;  1XTD A;  4YHH L;  5AJ3 L;  4P71 A;  1XMO L;  4DR6 Q;  4JI8 Q;  3RLO A;  3S14 H;  3W5O A;  5BR8 L;  1IBK Q;  2UXD L;  1NMG A;  2H5X A;  4DV5 L;  4DR2 L;  4H02 A;  1MIU A;  3L2P A;  1PV4 A;  1X3G A;  5BR8 Q;  4KHZ A;  1IBK L;  2NVX H;  3A74 A;  4IPC A;  5M5X H;  2GN5 A; 
#chains in the Genus database with same CATH topology
 1S5E D;  4CDC C;  5DM6 3;  4EQO A;  5BN4 A;  3K57 A;  1D5M C;  3S1Q B;  2F0S A;  1PMR A;  2XVS A;  1SN8 A;  4HN7 A;  3VR6 A;  5IYD G;  2FXQ A;  2L55 A;  4UHV A;  5FO8 B;  1I50 B;  1CSQ A;  2NVX B;  2A1A A;  5KGU A;  1I5F A;  3VDY A;  1S4Z A;  2KBN A;  4JOI A;  3VR3 A;  1LTL A;  1CKN A;  1BR9 A;  5GAD C;  2MP1 A;  3ERO A;  3NEM A;  3GTG H;  1KAB A;  3P20 A;  5FOB B;  3K59 A;  1JB3 A;  5CMD A;  3NBH B;  4A3I H;  2WAQ B;  3T13 A;  5T1I A;  3BVZ A;  3S17 H;  4RG1 A;  2IWH A;  5M3M G;  1Q7Y C;  5M5W B;  1J8I A;  1PTO B;  2KHJ A;  1FVI A;  4RA8 A;  1EZ8 A;  1STY A;  3S16 B;  2AKW B;  4DV6 Q;  1QVC A;  3RN5 A;  3ULP A;  1IBL Q;  3A7A B;  4IFD G;  2QIL A;  3K0X A;  1MJE A;  4IUV A;  3HS0 C;  4DNR B;  3Q22 A;  5C4X G;  1Z9F A;  2EY6 A;  1U4L A;  1T5X D;  1B2T A;  2LSS A;  3K58 A;  3PUY A;  2JQO A;  4B08 A;  2KOL A;  3G6E A;  5CBA E;  1PH1 A;  3OTO L;  4B3M Q;  1NY4 A;  1VQ9 A;  2A6H C;  2CQO A;  5COR A;  3OTO Q;  1C48 A;  2LY7 A;  4ZQ3 A;  4IOC A;  1EUJ A;  4JG2 A;  1HQR D;  4LF7 L;  1PH9 A;  4EGV A;  2QCP X;  3K5L A;  2EPB A;  4A93 G;  2A5H A;  4I7A A;  5M3M B;  1PHJ A;  1ASY A;  2A74 C;  1F9Q A;  4ZYS A;  3GTJ H;  1G8Z D;  1TWC H;  1SE3 A;  1EOT A;  1H9S A;  2K6A A;  1TWG B;  4QCL A;  2JEB I;  4IFD J;  4A3C G;  4LFB L;  1OXX K;  1L1O C;  1S5D D;  5CR3 A;  3F8T A;  4DV2 Q;  2R93 G;  5EKI A;  2JA8 H;  4A3E B;  3OOC A;  2JA6 B;  1SRO A;  1B9N A;  2F0P A;  1LTG D;  3I4L A;  1B3A A;  1KAA A;  4DK6 C;  2ZTE A;  2ZXP A;  2PCF B;  4H7B A;  1A63 A;  4LUZ A;  4MIU A;  2HDL A;  1Q46 A;  3OIP A;  2F0N A;  1F2Z A;  1CKO A;  2EIF A;  2XGT A;  1SFO B;  2F3W A;  1KXL A;  3BDL A;  2MJ8 A;  4GN5 A;  1TS2 A;  2B8G A;  1V1Q A;  3MA2 B;  4PZ8 A;  1PYS B;  2OQK A;  3V2T A;  4K8I A;  1QE6 A;  2B2Y A;  2L11 A;  4AYB G;  3R2I A;  3L3O C;  1K8A C;  3E0E A;  1HNX L;  1BXT A;  3I7F A;  4NXN L;  1PYB A;  2VS1 A;  2Z1C A;  3PO2 G;  4DV7 L;  2F0J A;  1K8M A;  2MO1 A;  1QNK A;  1PRT F;  1X6O A;  2QA4 A;  4HIO A;  1GHJ A;  4JI7 Q;  1LTB D;  3F2B A;  4K2K A;  3PIO A;  3A56 A;  1I6V C;  2RDG A;  1T9H A;  1SR3 A;  2CCZ A;  1TR5 A;  4JBW A;  3TME A;  5CV6 A;  3SHL A;  1FGU A;  4DK0 A;  4DR2 Q;  2K03 A;  4JI2 Q;  4K5W A;  3T1H L;  3HOU B;  1PH3 A;  2NZ1 D;  4JI2 L;  4LW1 A;  4QQB X;  2CQA A;  4BBR H;  4BS9 A;  4ABN A;  3H91 A;  1BOS A;  3PCO B;  1MSH A;  3KOJ A;  2B2Y C;  3R3O A;  2RCN A;  4K6D A;  4L8J A;  1FGB D;  2Y0S E;  2VB2 X;  4KY7 A;  4BY7 H;  1EY7 A;  4HMI A;  4DXF A;  3S1R B;  4IJL A;  3D31 A;  5HGQ A;  4A3E H;  1SE8 A;  1Y1W G;  3JAM c;  2CWA A;  5M3F H;  1QWY A;  4NXM Q;  4MTK A;  4JI6 Q;  5C4J B;  3HOZ H;  3CPW A;  2OQ0 A;  3TP5 A;  2BA0 A;  1VF5 C;  5I9P A;  4JI6 L;  1Q86 C;  3RZO H;  2OEO A;  1SNM A;  1JJC B;  3T53 B;  1O7Z A;  1I4H A;  1SYB A;  4F7X A;  5CV8 A;  1UAP A;  2MUY A;  5HUR A;  4KLK A;  3U58 A;  5G3L F;  1YNJ D;  5IY0 A;  4V0B A;  4A3D G;  3DM1 A;  3U9S A;  2WIN B;  2VY3 A;  3S2D H;  5IGC A;  1WFQ A;  4JI8 L;  5E1F A;  1F9R A;  3CAM A;  3TDQ A;  4ZLT F;  1RF2 D;  4C3H B;  3MAQ A;  4B3M L;  4XYQ A;  2ICE C;  5FLX E;  3NE5 B;  2KA7 A;  1N8R C;  3BG3 A;  2WFW A;  2JYO A;  1LO5 D;  2AHO B;  2BDO A;  1QG7 A;  1JWU D;  1PTO H;  3GQB A;  4TSS A;  1JR0 D;  1JT8 A;  1IYU A;  2ALY B;  3EQL C;  1IBM L;  1EYG A;  1S3O A;  2ES2 A;  1DGS A;  3WWV A;  5C6A A;  2NVQ B;  2GVB A;  1Y69 U;  1FYC A;  1HTP A;  4KY6 A;  3WOE A;  1EY6 A;  4RGO S;  3OW7 A;  3RLF A;  3HOU G;  5IYC H;  4OWW B;  1LTS D;  5C4J H;  3HOZ B;  3MXG A;  1HZB A;  1NR2 A;  1STA A;  2I0Q A;  5IGB A;  2RF4 A;  1XMQ Q;  2X6G A;  4X3S A;  2UUA Q;  4J1M A;  1YNJ C;  3K8A A;  3J81 L;  1QZH A;  4EQ5 A;  4XIG S;  2B63 G;  4DR7 L;  1Z6H A;  2NVT H;  4H0L C;  1GUS A;  1O80 A;  2P5Z X;  4DNI A;  2F0T A;  4UDU C;  3HOW G;  1F77 A;  2FHT A;  3VA5 A;  2B2U C;  4PG3 A;  3S2H H;  1X9N A;  1HZA A;  4XQQ A;  4C2M H;  1WTR A;  3HOZ G;  3T1Y Q;  1D8L A;  1JC7 A;  2JA5 H;  2K5W A;  1J6Q A;  1VQL A;  3JC6 6;  5M5X B;  1VQ7 A;  4L5Q A;  1XNQ Q;  1HTL D;  2KCT A;  1HNX Q;  1G51 A;  2B2V A;  5D65 A;  2M00 A;  1SMY D;  2SEB D;  1RTO A;  4IQZ A;  1K8G A;  2HT1 A;  1E2Z A;  2AQ3 B;  4JCV E;  2E2J B;  1SEB D;  1ZXT A;  4A3B G;  4V19 0;  2J0T D;  4AIM A;  1HZ9 A;  2UUB Q;  2R93 H;  4XQJ A;  2Q2U A;  3CME A;  5FJ8 H;  2QGQ A;  2AWO A;  3VA7 A;  3CCL A;  1F2M A;  2RDF A;  3A8J E;  3T1H Q;  3M4Q A;  4LF9 Q;  1BCP F;  4PQX A;  2OXP A;  1SYD A;  2AQ1 B;  3S2D B;  2DN8 A;  1Z47 A;  4J8Q A;  1K83 H;  5KNC A;  2RSN A;  2JEA I;  1CZG A;  3K0Y A;  2G5D A;  1KD1 C;  1Y8O B;  2C5C A;  2MFI A;  4C1N I;  4RGN A;  4KD3 A;  2D9U A;  2VXW A;  1TY0 A;  2IPK D;  3FPU B;  5IWA L;  1TU2 B;  4RKL A;  3F2U A;  4DV0 L;  2NZH A;  1BBW A;  2BE5 D;  5IWA Q;  2PO4 A;  1N36 L;  2RVL A;  4NXM L;  5GQO A;  3S24 A;  3JAM E;  2DNE A;  1QUQ B;  3KF6 B;  5M5Y H;  4FF4 A;  2IY5 B;  3Q23 A;  1KAW A;  4O42 A;  4A3M H;  3J80 c;  2PPB C;  3ICE A;  4OEM B;  2SOB A;  1BNZ A;  1I4Q A;  4HJ7 A;  1A62 A;  3EA6 A;  2ZTD A;  4UPA A;  3HOY H;  2F0W A;  1HNW L;  3SGI A;  1Z7T A;  1KQS A;  3NQT A;  1AEX A;  4IAL A;  2L9H A;  2NVY B;  1X32 A;  4HMJ A;  3FMC A;  2JJQ A;  2L15 A;  1HR0 L;  1FJG L;  1KNE A;  2R7Z B;  4DK1 A;  1K3B C;  1A3U A;  3I3C A;  2OWO A;  2E2J H;  1JIC A;  1PH7 A;  2K05 A;  4FVM A;  3STB C;  3U4Z A;  1NE3 A;  3TRE A;  2F0D A;  2I46 A;  4TQU S;  3ULJ A;  4CKB A;  1UEA B;  2EY2 A;  2MQH A;  2K52 A;  4OEL B;  5I6W A;  2UUC Q;  1NUC A;  2RKS A;  3STB D;  4PNY A;  4R1J A;  4DGZ A;  3PGZ A;  1XTD A;  2I07 B;  5EKK A;  5HGT A;  3S14 H;  1IBK Q;  1NMG A;  2H5X A;  4H02 A;  4QUC A;  1IBK L;  3A74 A;  3DHQ A;  2RBM A;  2Q8R E;  4BY7 B;  2UUA L;  1DD2 A;  2BA1 A;  1Q8I A;  1MGS A;  5BN5 A;  5FLX L;  1K3R A;  4KI0 A;  4XT1 B;  2LMC B;  1EU3 A;  2IJ0 A;  1V43 A;  2Y0S G;  1H9S B;  4N9T A;  4BBR B;  1VQ8 A;  3TS0 A;  1LTA D;  2E74 C;  1W6J A;  3HKZ E;  1EY5 A;  4RMF A;  3TQY A;  2R7F A;  2OF1 A;  1DXM A;  4GN4 B;  4A3D B;  1QB5 D;  2PNH A;  4L63 B;  4GLX A;  3RUZ A;  4JI4 L;  2CW0 C;  3PV0 A;  1YJ9 A;  1FD7 D;  1PZJ D;  5AFW A;  4RGM A;  3AYH B;  1JMC A;  4O0A A;  4FDB A;  2R7D A;  3OSO A;  3H0G B;  5A2Q L;  5JJK A;  1PRT C;  2YU9 B;  3H09 A;  5COY A;  1PH6 A;  4FYD A;  5ELO A;  4JI0 L;  4ME5 A;  2ENB A;  2R92 G;  2NWG A;  1B9M A;  1F2Y A;  1RTN A;  3A0J A;  3BVM A;  5C4H A;  2VQF L;  1Q82 C;  4CDD C;  2YTY A;  1N32 L;  1L2F A;  1TWH H;  2F0E A;  1TWF B;  1N32 Q;  1BF4 A;  1Y14 B;  4U67 3;  4A3B B;  1HUN A;  4L6T B;  2CHB D;  3RZD B;  3DMU A;  4KV6 A;  2F52 A;  3LNN A;  2SNS A;  1I4G A;  1YBY A;  3G71 A;  1V1P B;  1AE3 A;  1CKM A;  2ZM6 L;  3TEH B;  2B63 H;  5GAE C;  2DY7 A;  3GO5 A;  5EPK A;  1NJI C;  1UE6 A;  2YV5 A;  2JA6 H;  4F87 A;  1QVG A;  2DUD A;  2B3G A;  2OCE A;  1STH A;  3HG9 A;  4JC0 A;  4RCN A;  3H3V H;  1XTC D;  2NTT A;  2Z4I A;  5CV7 A;  1HNZ L;  4JYA Q;  2E2I H;  2K7V A;  1PVO A;  2JA7 G;  4B9W A;  2SDF A;  2Q8T A;  5C3E H;  1F9S A;  4JYA L;  4YY3 L;  2XN9 C;  3GTO H;  2H4O A;  5IYB H;  1TWA H;  4GN3 B;  2L1B A;  1X3Q A;  1VQM A;  2JA7 B;  3Q0A A;  3MXN A;  4A3J G;  1I50 H;  3NWT A;  3PF4 A;  3QR8 A;  5EGT A;  1EYD A;  2I5H A;  4CDF C;  2F0K A;  5EKL A;  5I2X A;  3DEP A;  1SYF A;  1ICF B;  1PLF A;  1Q1E A;  3C1E A;  5C44 G;  4K6L A;  1HNW Q;  3R2T A;  1PH2 A;  1UNS A;  4ZKB B;  1A0I A;  5KRU A;  3QOL A;  3V05 A;  3FP9 A;  1U4M A;  2F0G A;  3UDX A;  2VUM G;  1EOV A;  5K36 G;  2EJG C;  3LWE A;  4QGU A;  3RD4 A;  1WTQ A;  3KLS X;  1PXU A;  3CXC A;  1Q12 A;  4N8X 1;  1STE A;  1Y8P B;  5I2Y A;  5CV9 A;  2YYZ A;  3S16 H;  1R4Q B;  1TXY A;  1ZEQ X;  2EXZ A;  3VYU A;  3J81 E;  2NVQ H;  5J3B A;  5JJZ A;  3KK7 A;  1C0A A;  1G2T A;  3HOY G;  2JK8 A;  5CBE E;  4L5R C;  3S1N B;  1VQD A;  3K6O A;  4DAP A;  1EY0 A;  3GTG B;  5D14 A;  1YJN A;  1A3T A;  3I4M B;  1YHA A;  4F8M A;  3PQI A;  1B4O A;  4JI1 L;  5KND A;  5JOB A;  2QEJ C;  3L9A X;  3H0G G;  2K5V A;  4DV2 L;  1M1K C;  1EWI A;  1O78 A;  2NVT B;  4IUR A;  2ZJR A;  2E2H B;  4K5X A;  1CUK A;  4GLA C;  4JI5 Q;  1XJV A;  2FMC A;  5JJI A;  5E4X A;  3MWY W;  2DNC A;  4DUZ Q;  4JI5 L;  1JCK B;  2EQS A;  2CH4 A;  4DN4 M;  4NB3 A;  5IT9 c;  1STG A;  1VQA A;  1LT3 D;  1X3P A;  4YHH Q;  5AJ3 Q;  2DJG C;  2JA7 H;  3NBH A;  1N34 Q;  5BN3 A;  1CZW A;  4X65 Q;  3GTJ B;  3BYY B;  4OGQ C;  1XNR L;  2FJ2 A;  1N34 L;  2D2C C;  2HCC A;  4MTN A;  3VYR A;  2D0P A;  2ZTC A;  5ELD A;  3D6W A;  4DXG A;  4DAY B;  2K5D A;  1GXD C;  1ET9 A;  3KLW A;  3CHB D;  2Z6K C;  4OWX B;  3K5M A;  1ILQ A;  1D1I A;  5IYD H;  4FXD A;  4KKT A;  1CFM A;  3G48 A;  3J81 i;  3BZK A;  3VYS A;  2VUM B;  2BH8 A;  4APV A;  3IAY A;  1A15 A;  2VQF Q;  2R6G A;  2A68 D;  3E5S A;  5JEA H;  1EFW A;  3M7N A;  4QUF A;  4DA2 A;  3M7G A;  2F3V A;  3KBX A;  2K04 A;  3JAM L;  3CKI B;  1W2B A;  2OTJ A;  2SNM A;  4C3J B;  4KHP Q;  5EPJ A;  3M85 A;  2A69 D;  2NB0 A;  2Z6B A;  1WTX A;  1VMP A;  1SE2 A;  1GKH A;  1YI2 A;  1HCZ A;  5D3D A;  4DUY L;  4BY7 G;  3N52 A;  1VQF A;  2VB3 X;  4BBS B;  1HFG A;  1KTK A;  3OHX C;  4DUY Q;  4NW2 A;  2VNU D;  4DV1 Q;  3HOV H;  1NAP A;  2DY8 A;  4QY7 A;  3CRK C;  4AQY L;  2EE1 A;  1PRT D;  1N9W A;  3X3N A;  3FRP B;  1K8O A;  1A3V A;  3GDE A;  1IW7 C;  4A3I G;  2F0F A;  2N8N A;  3CF5 A;  1XMO Q;  4MHE A;  3UE1 A;  4POF A;  3NTI A;  5T1G A;  2KCN A;  4YY3 Q;  1BCP C;  3I4N H;  1SBB B;  1L0W A;  4NDX A;  4JK1 C;  4IUQ A;  2A68 C;  2HHH L;  2E5L L;  3CCS A;  1LTT D;  3C1F A;  4RGT A;  5C4Z A;  5EBD A;  2F0H A;  3PO2 B;  4CJ2 C;  1F9P A;  5CV5 A;  2JA9 A;  4ILW A;  5HY6 A;  4DV6 L;  5GAG C;  2N78 A;  3CPF A;  3S1M H;  1QUQ A;  5J39 A;  2C9O A;  1E22 A;  2WV6 D;  4RHS A;  1VS0 A;  2PZT A;  1F2L A;  3D6C A;  4FNF A;  1OO9 B;  2JA5 G;  2VZA A;  1DOM A;  2CFM A;  2R3Z A;  4BY1 B;  1CHP D;  4BA1 I;  3CMA A;  1KIX A;  1E0B A;  1EY8 A;  3AFQ A;  4K8J A;  5IP7 H;  1CA6 A;  1X56 A;  1TWC B;  4A93 B;  4H13 C;  1U4P A;  4LJZ C;  3GTM B;  3BDO A;  2X6L A;  4LNQ A;  4FF2 A;  3J80 E;  4TRD A;  1I6H B;  2MPM A;  3GTK H;  4RHR A;  4NKL A;  2EYO A;  2Z8L A;  2BCO A;  1L0X B;  4Q5V A;  2EXD A;  5FLX c;  1P16 A;  1YJW A;  4LF4 L;  1HA6 A;  4MN3 A;  4PMC A;  4G4K A;  2IHE A;  3EFX D;  3M4O B;  4G57 A;  1H9M A;  2Q2H A;  1OTC A;  3E6Z X;  4LFB Q;  4FXK C;  2IHF A;  3TP6 A;  3R93 A;  3S15 H;  3NP8 A;  1J9O A;  1S5B D;  3GTP B;  2LXK A;  1KRT A;  2K28 A;  1IKL A;  3KF8 B;  3CC2 A;  1Y1V H;  3GTL B;  3W1B A;  3V96 A;  1DOK A;  1H9K A;  2UXD Q;  3EJI A;  1BCP D;  5FKA C;  3MFG A;  5EQ0 A;  3PIO 3;  4X65 L;  3GTO B;  3M4Y A;  3W3A A;  4WRD A;  2D62 A;  3ER0 A;  1O7I A;  1GM5 A;  1EIG A;  3VR4 A;  1U0L A;  2AQ2 B;  5C3X A;  1Q1B A;  3D4W A;  4IFD H;  3GTL H;  4DV7 Q;  4DV3 L;  1K83 B;  4DV4 L;  3IKJ A;  4UP8 A;  3NBI A;  4OIJ A;  4DV4 Q;  4JI7 L;  1LTI D;  2EZV A;  1GHK A;  3FEW X;  3PIP 3;  2UXC Q;  4UP9 A;  2HUG A;  2PW5 A;  1XWE A;  2PI2 E;  2JA8 G;  4KN4 C;  4UY8 C;  3NEL A;  5A2Q E;  3BZD B;  1OXT A;  1SNQ A;  3QB3 A;  1ENA A;  2F4I A;  1Q8K A;  4EQN A;  2ASB A;  4LF6 L;  3W2D A;  4XTC S;  4CKE A;  1T5E A;  3A5U A;  2GA4 B;  3VR5 A;  1SNC A;  1L1O B;  1O7Y A;  5ELB A;  3CCQ A;  4X66 Q;  3D4D A;  2QDB A;  3U50 C;  3ERS X;  3TSS A;  3FVQ A;  1SMY C;  5I4D A;  3BS1 A;  4AQY Q;  1SYE A;  3HOX B;  4HJ9 A;  1SYC A;  3GTK B;  4DAM A;  1YNN C;  1XMO L;  4QIW B;  1TS4 A;  4DR6 Q;  1IHZ A;  2F0Q A;  5CV4 A;  3HEJ A;  5IGF A;  1QOH A;  4DFA A;  2NVX H;  5M5X H;  3T16 A;  1Y8N B;  4B3R Q;  1JOO A;  1Y1V B;  5DM7 3;  5IGG A;  4I65 A;  5LMN Q;  1GUN A;  1D5Z C;  2PQA A;  3S2H B;  5KNB A;  5LMN L;  4QMG A;  5EAY A;  1SMX A;  2AUJ D;  2WKC A;  2QKI C;  3NTK A;  1KDC A;  3S9W A;  4IPD A;  4DF7 A;  3GTP H;  1XYI A;  3CRL C;  5JAV A;  3DM3 A;  2E76 C;  3NK9 A;  1PDQ A;  4LMQ D;  3SXH A;  4KHV A;  1AE2 A;  1K0S A;  1DYQ A;  1YIT A;  2LFN A;  1GOZ A;  2H1E A;  4EVO A;  3D4R A;  4PMW A;  1ET6 A;  2IX3 A;  5ELE A;  5CC4 A;  3F2D A;  1PH8 A;  1LV9 A;  1W6K A;  4GZY C;  2B2T A;  1UWV A;  2HCI A;  4NP5 A;  3O13 A;  1OXV A;  4NMZ A;  1LM0 A;  4YWL A;  3WOF A;  3MEH A;  4FF3 A;  1GUG A;  1XPU A;  3HOV G;  2O2L D;  5FO9 B;  1FNV A;  2L0C A;  4BWG B;  2UUC L;  2IX0 A;  1ZYR C;  5LHY 1;  2V1C C;  2EYL A;  1BDO A;  5CYU A;  5C0X J;  2BH2 A;  2K32 A;  5C3E G;  1YIJ A;  4GOP A;  3MVV A;  1ONL A;  5DNF A;  2F0I A;  1JB7 A;  4A4I A;  3EBE A;  5C5L A;  3T4A C;  2FMM A;  2BE5 C;  2WP8 J;  1I94 L;  3JAM i;  2K33 A;  4OWT B;  4ALP A;  2EYJ A;  2J7Z A;  1J5E L;  1ENC A;  3DWQ A;  2FIN B;  1LUZ A;  1E2W A;  1K28 A;  2CH4 W;  3T51 B;  4LWC A;  1QNU A;  4TVA B;  1Q90 A;  5FLM H;  2PMZ B;  4JI3 L;  3CQZ H;  3SK4 A;  1II3 A;  5C44 B;  4A3M B;  5FO7 B;  1M90 C;  3HOW B;  3PO3 B;  4WOR A;  1PZI D;  3GTQ H;  2I5M X;  4LF5 Q;  1A2T A;  3AB9 A;  3S1R H;  3PSI A;  4LF5 L;  4A3E G;  3RN2 A;  2E2D C;  1Y1W H;  3KFU A;  4IO9 A;  3MXP A;  5E3F A;  3H6M A;  4KJO A;  4GOP C;  3VYT A;  5J1Z A;  2RQX A;  2F1M A;  4K2L A;  1GD7 A;  3SEB A;  2WB1 E;  1WJJ A;  4CBV A;  4IUT A;  3FKI H;  1LT5 D;  4CJ0 B;  1PA6 A;  4A75 A;  2UXC L;  4G7Z C;  1QJO A;  2XTI A;  1WTW A;  3RLN A;  2UUB L;  5IYB G;  2K4K A;  3FHW A;  4B9X A;  1E2V A;  3DEO A;  1UE7 A;  4L5S A;  2UXB Q;  2JE6 I;  4A3F H;  1IW7 D;  4R8I A;  1HR0 W;  3IRB A;  4Z9C B;  5NUC A;  4OX9 Q;  3KDF B;  2RCF A;  1KRS A;  2AMC B;  3GV3 A;  3KF6 A;  1Q81 C;  4OX9 L;  2JA6 G;  1STB A;  4KMU C;  1UE5 A;  5KYI A;  1G91 A;  4N9P A;  3CCR A;  3I4O A;  2ID0 A;  3PF5 A;  4RCO A;  4N8F A;  1K73 C;  4X64 Q;  4O1N A;  2XRS D;  1SYG A;  2DGY A;  1GJX A;  3UI2 A;  4DR6 L;  4R4I A;  1NTG A;  4M8A A;  4HAE A;  1WYD A;  1HNZ Q;  1YNN D;  1EQV A;  4C3J H;  5JEA J;  2CWP A;  1SDF A;  3MXU A;  4YCV A;  1BBU A;  1GUW A;  4DR5 Q;  3H3V I;  5ELC A;  4CDE C;  3PMF A;  3KYH C;  4WFN 3;  4A3G B;  1GUT A;  2K75 A;  4PZ7 A;  3DLL A;  3PUV A;  2KEE A;  4ID6 A;  5K5P A;  1VQI A;  3G6J B;  4B3S Q;  2J4X A;  4R9W A;  1Y1W B;  5C4X B;  2QDL A;  1VQC A;  1X3E A;  1HPC A;  4ZUI A;  2EJF C;  4IPG A;  4G7H C;  1XXG A;  3PO3 H;  2WKD A;  3CC4 A;  2EY1 A;  1TVX A;  3J81 c;  3C46 A;  1LLR D;  1ILP A;  5GRO A;  2UU9 Q;  3A7L A;  2NN6 I;  1LAB A;  4GKK Q;  3K7A B;  3A8I E;  5C0X H;  4BXX G;  1WCM H;  1TS5 A;  3GP7 A;  4XQN A;  4BA2 I;  2E8G A;  4HSP A;  3I8Z A;  5EBC A;  3KBG A;  1E1O A;  4HJ5 A;  3S15 B;  1HFN A;  2O4X A;  4HID A;  2M2L A;  2KCC A;  4DAV A;  1KLG D;  2EYP A;  4AYB E;  4M1U B;  2Q8I B;  1UEB A;  1M8A A;  3T56 B;  4IUU A;  1AW7 A;  4X3U A;  2PQE A;  4QL5 A;  4X3T A;  4JVZ A;  4LFC Q;  2R93 B;  4E6I A;  3OIQ A;  1J5E Q;  1TWH B;  1EQT A;  4HTH A;  1EYA A;  1S72 A;  2F0V A;  1VF7 A;  1WOC A;  2K5H A;  4LF8 L;  2EY5 A;  2L5T A;  2MO0 A;  4DKA C;  3HRZ C;  3J7Y W;  1XPR A;  4LF8 Q;  1H95 A;  5ELN A;  4MZ9 A;  4XXE A;  1OXU A;  1WTP A;  1GO3 E;  4A3F B;  1SXT A;  1EU4 A;  5TSS A;  1EY4 A;  1CT1 D;  4ZUJ A;  1XNR Q;  4C2M B;  1VQB A;  2KCM A;  5IGE A;  1TII D;  4JI0 Q;  1R9T B;  4UAI A;  4DR3 Q;  4XDX A;  3VR2 A;  3DWP A;  4A3G G;  2K5N A;  3DXJ C;  4DR3 L;  3KDF A;  3FPP A;  1EWC A;  4KD4 A;  2Q2T A;  1C4Q A;  4PZ6 A;  4DNT B;  3MTS A;  1VQH A;  1PFN A;  4IPH A;  1AZP A;  1SND A;  2CVR A;  4QIW E;  1KL9 A;  3S1Q H;  4JPB W;  1B44 D;  1IZ6 A;  3I70 A;  3NQI A;  2ATW A;  1ZKO A;  1U4R A;  2KEC A;  2K01 A;  1C8C A;  1I4X A;  5A35 A;  3J7A F;  4L5T A;  1YHQ A;  4KHP L;  1ESF A;  4HIM A;  5EJW A;  1CKN B;  1ESR A;  2XIW A;  2WB1 B;  1AP0 A;  5C44 H;  2EJM A;  3A8K E;  4HSV A;  4YCU A;  3BZC A;  2ZM6 Q;  5C0X G;  2RA4 A;  1VQJ A;  4OO1 H;  2X69 A;  3HZX A;  3NTH A;  2I5L X;  1C7Y A;  1O7L A;  1VQ5 A;  2B63 B;  1VMC A;  1B7Y B;  3MHB A;  1X55 A;  3DWA A;  3UDI A;  4X64 L;  2ZJQ A;  3QJY A;  4BBR G;  3QWN A;  4R8N A;  5F2D A;  2NTS A;  4WJ4 A;  2NBF A;  4KKS A;  3OMG A;  3PUX A;  1DON A;  5IE8 A;  2OTL A;  2F3I A;  3LWU A;  3G7L A;  1STN A;  3FKI B;  4Y7N H;  3K5O A;  1JOQ A;  4IUN A;  2B39 A;  2N49 A;  3LGJ A;  2B8F A;  4C56 C;  2E5L Q;  2WAQ G;  3J81 j;  3M3Y B;  5ISR A;  4R4O A;  1D7Q A;  2PZU A;  3PO2 H;  4A3K G;  1L0Y B;  4YWM A;  3OWE B;  2D0O A;  4DPG A;  4O2D A;  3EVQ A;  4B3S L;  2Z4H A;  1B3Q A;  1RD9 D;  3HKZ G;  3BYT B;  2A69 C;  4HR7 B;  4B3T Q;  1I4P A;  1SAP A;  5C3E B;  5LMN W;  3S14 B;  3M4P A;  2E2I B;  4DAY A;  1WTV A;  3EIV A;  5M5Y B;  4K14 A;  4ZKC B;  2KHS A;  3H3V C;  3SVM A;  3RMH A;  2AUK A;  2MNA A;  1TKW B;  3CQZ B;  2NN6 G;  5KIX A;  1DOL A;  2N88 A;  3M3Y H;  3HOV B;  4A3D H;  4ZAI A;  3NHH A;  3AFP A;  2OT2 A;  3F1Z A;  3G4S A;  2IX1 A;  4A3L G;  4A3G H;  3OW2 A;  3B6Y A;  3NWS A;  3SE0 A;  1Q3L A;  2YTV A;  4Y7N B;  1JE4 A;  1R9T H;  2E2H H;  1V9P A;  1X54 A;  3HGB A;  1JQY D;  1WTO A;  3H94 A;  1EIH A;  1UUP A;  3PIP A;  3UDG A;  3CU7 A;  2B2V C;  3ITP A;  3QO2 A;  4JI1 Q;  2RHS B;  4OON A;  3I4M G;  1KC8 C;  4IJH A;  5LL6 S;  4FXG C;  1WTH A;  4IOA A;  4HCS A;  1YVC A;  5IYC G;  2GVA A;  2VUM H;  1SNO A;  1TWF H;  1XPO A;  5DAU A;  4X3K A;  3HOY B;  4JBK A;  1KHI A;  2XNA C;  4HIK A;  4YWK A;  3L7Z C;  4OO1 G;  1NMF A;  3SR1 A;  3K5N A;  2PZW A;  4J6H A;  4GOP B;  4A3J H;  3LX0 A;  1PTO D;  4S3S A;  3RZO B;  1YZ6 A;  1WD1 A;  4LK1 C;  1CHQ D;  3KLS A;  2R61 A;  5L37 A;  4YHH L;  4JI8 Q;  3RLO A;  5AJ3 L;  2UXD L;  4CGY B;  1MIU A;  3L2P A;  1MD2 D;  1X3G A;  4KHZ A;  4IPC A;  1JOK A;  1S5C D;  4GNX A;  4LF7 Q;  1RHP A;  3S1M B;  3TP7 A;  1W3S A;  1JE5 A;  3BDC A;  1B50 A;  2WAC A;  2QF7 A;  3D8G A;  1WCM G;  3GD7 A;  3J80 L;  4A3K H;  2A6E C;  1S40 A;  3N6R A;  1SFO H;  2TMP A;  1EY9 A;  2Y0S B;  1VQE A;  4DV3 Q;  1ASZ A;  3SK5 A;  5IGD A;  1B8A A;  1CI3 M;  4KJN A;  1QVF A;  4RH6 A;  4Y52 H;  3AMU A;  3HKZ B;  3D0F A;  5JJL A;  4OXP A;  3PO3 G;  3NEN A;  4IZ8 A;  4FP5 D;  5G3L D;  4P73 A;  3ZJY C;  1VQ6 A;  4LFA L;  1LAC A;  3W1G A;  3TS2 A;  2JA8 B;  3HOX H;  3NXW A;  4LFA Q;  3NUC A;  5DEH A;  4DR1 Q;  4R4T A;  5C0X I;  2F0L A;  4LF6 Q;  4DR1 L;  3S1N H;  5C4X H;  1SRU A;  1GVP A;  2BOS A;  4KN7 C;  3P7J A;  3FKI G;  1QIL A;  2ZJP A;  4DV1 L;  3ERQ A;  2HD3 A;  3IFT A;  4DR7 Q;  4X66 L;  3CCJ A;  2KED A;  1E1T A;  4GNX C;  2HIV A;  4H44 C;  2TSS A;  4QJF A;  1BVS A;  1LYL A;  3SK6 A;  2D5D A;  2JN4 A;  1FR3 A;  4ZCK A;  3BJU A;  3QIA A;  1HJP A;  4C3H H;  4LUO A;  1IYJ B;  4CHT B;  1D2B A;  4PMB A;  1PFM A;  2KHI A;  4RWS C;  2R7Z G;  1VQO A;  3UE0 A;  3RZD H;  1EQQ A;  2EYF A;  3KF8 A;  1KDA A;  1EZ6 A;  2LS0 1;  1IL2 A;  2K5Q A;  2HHH Q;  1XNQ L;  4JOI C;  1D5X C;  3Q24 A;  4B3R L;  1RDP D;  2A73 B;  3J7Z C;  5FK9 C;  4BXX H;  3OYY A;  1IL8 A;  2MGS A;  3CP0 A;  1EYC A;  3KJP A;  3TP8 A;  1NSN S;  1FL0 A;  2A6E D;  1BBX C;  3J7A V;  4F88 A;  4P72 A;  3WDN A;  1E7Z A;  5IOD A;  2PNR C;  5DLQ E;  2LXJ A;  4HJA A;  5M5W H;  1AH9 A;  3I4N G;  1MJC A;  3GTM H;  4B3T L;  2NZO A;  1OXS C;  4QF4 A;  1WD0 A;  1MSG A;  3A5Z B;  1RIP A;  1RKN A;  3H15 A;  2JXM B;  4FF1 A;  2KEN A;  4J15 A;  3HKS A;  2ZT9 C;  4OIK A;  5M3F G;  2ZXR A;  5M3F B;  4GKJ Q;  5IIF A;  1TS3 A;  1ICW A;  1C9O A;  3U4V A;  4DU9 A;  2HDM A;  1LT6 D;  3CCM A;  2WB1 G;  1A6X A;  3F2C A;  4YCW A;  2VW9 A;  2F4V L;  1QZG A;  1QCB D;  1SLJ A;  3DUZ A;  1HHV A;  3K7U C;  1TQO A;  2F03 A;  2A6H D;  4ME3 A;  5IP7 G;  4LF4 Q;  1RCV D;  2EYM A;  2KUM A;  1N36 Q;  5J22 A;  3QG1 A;  5JVG 3;  3AQQ A;  5LMU Q;  1ENF A;  3I4M H;  4DR4 L;  2PW7 A;  2BDN A;  2F0O A;  1YHB A;  5IP9 G;  2VL6 A;  3C2P A;  3M4O H;  4A3C H;  5H1S E;  1MI2 A;  3GTQ B;  4DR4 Q;  1TT2 A;  1VQK A;  3HOW H;  2MHV A;  3NPP A;  1B70 B;  1I6H H;  1LTR D;  4JBJ A;  2HIX A;  1BCP B;  3KJO A;  2PMZ E;  3QOJ A;  4X6A H;  2QEX A;  1H9J A;  4JV5 Q;  1PH5 A;  2JSO A;  3AU7 A;  3MZ5 A;  2HQE A;  4XT3 B;  1MHW C;  1I3Q H;  4C3I B;  4A3F G;  4JI3 Q;  4IFD I;  5JPM C;  5I9O A;  2N3S A;  3KUP A;  3Q8D A;  4XYO A;  4BY1 G;  2R7Z H;  5E4W C;  2JA5 B;  5D3I B;  1M4V A;  2XRQ D;  4WJ3 M;  1PTO C;  5K36 H;  2A8V A;  4YIJ A;  4A3B H;  2O5I C;  1H9R A;  2NVY H;  4U68 A;  1CK1 A;  1IBM Q;  3X3M A;  3K7A H;  4P74 A;  2L12 A;  3RR5 A;  1CA5 A;  1EEI D;  1L1O A;  1R4P B;  4C3I G;  4EX5 A;  1JJG A;  2V4D A;  4C3J G;  1NNX A;  1DM0 B;  2AWN A;  3UDF A;  4Q0F A;  3TN2 A;  4POG A;  2XWJ B;  1K0R A;  2IT1 A;  3R8B A;  1XMQ L;  1PRT B;  2NUC A;  1HUM A;  2FFK B;  3CD6 A;  1RJT A;  1BUV T;  4GLV B;  2Z0S A;  1VQG A;  1GUO A;  3I90 A;  3MC0 B;  2CKZ B;  1G6Z A;  5IT9 E;  4HCE A;  4BBS H;  2K14 A;  3K80 C;  2KVM A;  2PQA B;  4X62 L;  1D1K A;  4P2C B;  1HRJ A;  4X62 Q;  1SJE D;  1I4R A;  1PYW D;  3U9O A;  3T1Y L;  2K50 A;  3ND9 A;  1B53 A;  4C3H G;  2EDG A;  1EFI D;  1EWH A;  4DK3 C;  3HOU H;  3RNU A;  1WCM B;  3SDZ A;  4JBM A;  3C3L A;  4OL7 A;  1IKM A;  2VQE L;  1BQQ T;  1WI5 A;  1XX8 A;  3GV6 A;  1PZK D;  4ZRZ A;  1CQF A;  1B1Z A;  3E0J A;  1V1O A;  2ICI A;  5C3W A;  1NCV A;  5C5M A;  4CKC A;  1DJR D;  4FO2 A;  1HZC A;  2R92 H;  4R4Q A;  2IL8 A;  3CCV A;  4NPS A;  4QB4 A;  1TWA B;  4AH6 A;  1RL2 A;  3ZYY X;  1E3P A;  3H0G H;  3A54 A;  1HXY D;  3IL8 A;  1A8V A;  2YTX A;  2ZXO A;  2YU9 H;  1BKB A;  3HOX G;  2DJF C;  5KEE A;  1EQR A;  4LF9 L;  1SE4 A;  4DV5 Q;  4G7O C;  2E75 C;  3SK8 A;  1KLU D;  5JVH 3;  3I56 A;  2CW0 D;  5FJ8 G;  5KYL A;  4KY5 A;  5JEA G;  4GKJ L;  5FLM G;  3A55 A;  1N33 Q;  1U5K A;  2PYK A;  2B29 A;  1IXR A;  2RHQ B;  4A76 A;  1N33 L;  1S5F D;  2UU9 L;  2EOT A;  1G6P A;  3TBI B;  1HA5 A;  2F4V Q;  5I6Y A;  3FDT A;  2RSO A;  2XSC A;  4DV0 Q;  4GKK L;  4R4C A;  3OPO A;  2Q2I A;  1JWM D;  3ND8 A;  4A3M G;  2NN6 H;  4A3K B;  4HJ8 A;  3I4N B;  1YNX A;  1CM9 A;  3E9I A;  4I7Z C;  1JOR A;  4RAU C;  4IN3 A;  2Z6K A;  3CCU A;  1AN8 A;  1JWS D;  5LMU L;  4WJW A;  1X3F A;  1TY2 A;  3EN2 A;  1I94 Q;  2C35 B;  3BU2 A;  1TWG H;  3E3X A;  4K0K Q;  1EEF D;  3M9B A;  4GS3 A;  4CJ1 B;  1CSP A;  4K0K L;  4LFC L;  1ROD A;  5E7N A;  3TZU A;  4A3J B;  1LT4 D;  4BBS G;  1DCZ A;  3PUZ A;  3I2Z A;  4C1N K;  2IW3 A;  4RFB A;  5M3M H;  4JV5 L;  1VQP A;  1IBL L;  2G9H D;  2EYH A;  1VQN A;  1EIY B;  3ULL A;  3HFZ B;  1HR0 Q;  2K1B A;  1FJG Q;  4K5V A;  1VQ4 A;  1JJ2 A;  1P8L A;  4TKO B;  4MNO A;  3MXN B;  5ELF A;  2KJX A;  3P1H A;  4JW0 A;  2XWB B;  3I73 A;  5EPL A;  2B2U A;  3CW2 C;  1ZYR D;  1K9M C;  1HH2 P;  2B2W A;  3AEV A;  3CCE A;  1IYV A;  1YEZ A;  1DZ1 A;  3URY A;  3TZD A;  4A3L H;  3CC7 A;  2QW7 A;  1KNA A;  4P75 A;  1V1P A;  3HP3 A;  4KTA A;  3MEF A;  4KK7 A;  4ULL A;  1FNU A;  5IP9 H;  2A19 A;  1ML0 D;  1PFB A;  4KKU A;  2EVB A;  4GNX B;  2O5J C;  2WII B;  1PFS A;  2F0U A;  1G2S A;  3I91 A;  3P75 A;  5IOC A;  1EIF A;  5LL6 X;  4BY1 H;  2UXB L;  1NBW A;  1PTO F;  1BO0 A;  2Z9H A;  3D3R A;  1MKH A;  4ZK9 B;  1SJH D;  1UE1 A;  1HQM C;  3J7A 5;  2NYZ D;  1Y1V G;  1G29 1;  1VCI A;  4LAA A;  5CGK A;  2R92 B;  4RKB A;  4HED A;  5GAH C;  2JP1 A;  3J80 i;  4DUZ L;  2N55 A;  2F0M A;  3PUW A;  5JPN C;  4UP7 A;  1X65 A;  2B2W C;  1PH4 A;  3IFD A;  3NSW A;  2B2T C;  4JI4 Q;  1D6E C;  2RDH A;  1AZQ A;  4OHJ A;  3TRZ A;  2PI2 A;  2M9V A;  1U9R A;  3KLR A;  1VDZ A;  3E9H A;  3MFY A;  4IUP A;  1SSO A;  1MBY A;  3Q6S A;  3OWF A;  2VQE Q;  3OMC A;  4ODG A;  3K81 C;  4DR5 L;  4LUV A;  4NXN Q;  1AFP A;  1SNP A;  2L4N A;  3I55 A;  1I3Q B;  4C3I H;  4OO1 I;  2WAQ E;  3BVG A;  1NR4 A;  1E24 A;  1CTM A;  4A93 H;  1A2U A;  1KDB A;  3L0O A;  1V8Q A;  5M9O A;  1CQV A;  2HQL A;  4A3I B;  2G9D A;  5IT9 L;  3S17 B;  3I72 A;  4AYB B;  4PV1 C;  4P71 A;  3W5O A;  2KQ3 A;  5BR8 L;  4EQP A;  4DV5 L;  4DR2 L;  1WVL A;  1FNW A;  1PV4 A;  1EL0 A;  5BR8 Q;  2LKV A;  3ONA B;  2GN5 A; 
#chains in the Genus database with same CATH homology
 4B3R Q;  4GNX A;  4LF7 Q;  2UUA L;  2BA1 A;  1W3S A;  5LMN Q;  1JE5 A;  2PQA A;  4A3K H;  1WCM G;  3GD7 A;  5LMN L;  1S40 A;  5EAY A;  1SMX A;  1SFO H;  1IL2 A;  1K3R A;  4KI0 A;  4IPD A;  1SN8 A;  1VQE A;  1V43 A;  2Y0S G;  4DV3 Q;  3GTP H;  1ASZ A;  5IYD G;  2FXQ A;  1VQ8 A;  3DM3 A;  3TS0 A;  1CSQ A;  1B8A A;  4RMF A;  3HKZ E;  2A1A A;  1QVF A;  3TQY A;  2R7F A;  4GN4 B;  1AE2 A;  4Y52 H;  2PNH A;  1I5F A;  3VDY A;  2KBN A;  4JOI A;  4GLX A;  1LTL A;  3D0F A;  4JI4 L;  1CKN A;  3PV0 A;  4OXP A;  3PO3 G;  1YJ9 A;  3NEN A;  5GAD C;  1YIT A;  5JJL A;  3NEM A;  4P73 A;  3ZJY C;  1VQ6 A;  4LFA L;  3W1G A;  3GTG H;  3TS2 A;  1JMC A;  3AYH B;  4O0A A;  3HOX H;  4FDB A;  2R7D A;  4PMW A;  4LFA Q;  4DR1 Q;  3F2D A;  1PH8 A;  5JJK A;  3NBH B;  4A3I H;  4R4T A;  5C0X I;  3S17 H;  4LF6 Q;  4DR1 L;  1PH6 A;  5C4X H;  3S1N H;  4RG1 A;  1SRU A;  5ELO A;  5M3M G;  4JI0 L;  1Q7Y C;  1GVP A;  1UWV A;  4YWL A;  2R92 G;  1OXV A;  3FKI G;  1LM0 A;  2ZJP A;  4DV1 L;  2KHJ A;  1FVI A;  4DR7 Q;  1XPU A;  4X66 L;  3HOV G;  3CCJ A;  3A0J A;  1E1T A;  2AKW B;  4DV6 Q;  1QVC A;  4GNX C;  3RN5 A;  2HIV A;  3ULP A;  2VQF L;  1IBL Q;  4IFD G;  1Q82 C;  3K0X A;  4QJF A;  1BVS A;  1MJE A;  2YTY A;  1N32 L;  2UUC L;  2IX0 A;  1LYL A;  5C4X G;  1L2F A;  1TWH H;  1Z9F A;  1N32 Q;  1Y14 B;  2LSS A;  3PUY A;  3BJU A;  2JQO A;  2V1C C;  1HJP A;  5C0X J;  2BH2 A;  4C3H H;  4LUO A;  1IYJ B;  5C3E G;  3G6E A;  4GOP A;  1YIJ A;  1PH1 A;  2KHI A;  2R7Z G;  1VQO A;  3OTO L;  1JB7 A;  3UE0 A;  4B3M Q;  3RZD H;  4A4I A;  1NY4 A;  3EBE A;  1EQQ A;  1VQ9 A;  2CQO A;  3OTO Q;  2WP8 J;  2F52 A;  4IOC A;  1EUJ A;  1I94 L;  2HHH Q;  4JOI C;  3JAM i;  4OWT B;  4LF8 Q;  4JG2 A;  4ALP A;  1XNQ L;  4B3R L;  4LF7 L;  1YBY A;  3G71 A;  1PH9 A;  3J7Z C;  1J5E L;  4A93 G;  4BXX H;  1AE3 A;  1CKM A;  3OYY A;  3CP0 A;  3TEH B;  2ZM6 L;  2B63 H;  1LUZ A;  5GAE C;  3GO5 A;  3KJP A;  1FL0 A;  1PHJ A;  1ASY A;  4LWC A;  1UE6 A;  1NJI C;  2YV5 A;  2JA6 H;  4P72 A;  4TVA B;  1E7Z A;  5FLM H;  4JI3 L;  1QVG A;  2DUD A;  3CQZ H;  2LXJ A;  5DLQ E;  5M5W H;  2B3G A;  4HJA A;  3I4N G;  1AH9 A;  2OCE A;  1MJC A;  3GTJ H;  1TWC H;  3GTM H;  4B3T L;  4JC0 A;  2NZO A;  1OXS C;  1M90 C;  3H3V H;  2JEB I;  4IFD J;  1HNZ L;  4JYA Q;  4A3C G;  2E2I H;  1OXX K;  3A5Z B;  1RIP A;  1L1O C;  3H15 A;  3GTQ H;  4LFB L;  2JA7 G;  1PVO A;  2I5M X;  4LF5 Q;  3F8T A;  5C3E H;  4DV2 Q;  2R93 G;  4JYA L;  4YY3 L;  3GTO H;  2KEN A;  3S1R H;  4J15 A;  3HKS A;  2JA8 H;  3PSI A;  5M3F G;  5IYB H;  4LF5 L;  4A3E G;  1SRO A;  1TWA H;  3RN2 A;  3KFU A;  1Y1W H;  4GN3 B;  4IO9 A;  4GKJ Q;  4DK6 C;  1VQM A;  2ZTE A;  4A3J G;  1I50 H;  4GOP C;  3PF4 A;  1A63 A;  1C9O A;  4LUZ A;  2I5H A;  3U4V A;  1GD7 A;  1Q46 A;  2WB1 E;  1Q1E A;  1WJJ A;  3CCM A;  5C44 G;  2WB1 G;  1HNW Q;  1PH2 A;  3F2C A;  3FKI H;  4YCW A;  2VW9 A;  2F4V L;  1QZG A;  1A0I A;  1SLJ A;  1CKO A;  2EIF A;  2XGT A;  4A75 A;  1PA6 A;  3FP9 A;  3K7U C;  1KXL A;  2UXC L;  4LF4 Q;  4ME3 A;  5IP7 G;  3UDX A;  2XTI A;  4GN5 A;  3RLN A;  2VUM G;  1EOV A;  2UUB L;  5IYB G;  1V1Q A;  1N36 Q;  4PZ8 A;  5K36 G;  4QGU A;  1PYS B;  2K4K A;  2OQK A;  3FHW A;  3AQQ A;  5LMU Q;  3CXC A;  3I4M H;  4DR4 L;  1UE7 A;  3M4O H;  5IP9 G;  1Q12 A;  1YHB A;  2VL6 A;  4AYB G;  2JE6 I;  4L5S A;  4A3C H;  2UXB Q;  5H1S E;  4A3F H;  4DR4 Q;  1K8A C;  1HR0 W;  1VQK A;  2YYZ A;  3E0E A;  3IRB A;  3HOW H;  3S16 H;  1HNX L;  4OX9 Q;  3I7F A;  3KDF B;  1TXY A;  1KRS A;  4NXN L;  2AMC B;  1Q81 C;  1PYB A;  2VS1 A;  1B70 B;  3KF6 A;  1I6H H;  4JBJ A;  4OX9 L;  2JA6 G;  4DV7 L;  2HIX A;  2NVQ H;  2MO1 A;  3PO2 G;  3KJO A;  1UE5 A;  2PMZ E;  5J3B A;  1X6O A;  2QA4 A;  1C0A A;  4X6A H;  3CCR A;  2QEX A;  3HOY G;  2JK8 A;  4HIO A;  4JV5 Q;  1PH5 A;  4JI7 Q;  3F2B A;  3I4O A;  2ID0 A;  4L5R C;  3PIO A;  3PF5 A;  1VQD A;  1K73 C;  4X64 Q;  1T9H A;  1SR3 A;  2CCZ A;  1I3Q H;  4A3F G;  2DGY A;  4JI3 Q;  4IFD I;  4JBW A;  1YJN A;  2N3S A;  4R4I A;  1YHA A;  4DR6 L;  1FGU A;  3Q8D A;  4DR2 Q;  4BY1 G;  1NTG A;  2R7Z H;  4JI2 Q;  4JI1 L;  1WYD A;  3T1H L;  1PH3 A;  1HNZ Q;  4C3J H;  4JI2 L;  4LW1 A;  4WJ3 M;  4QQB X;  2A8V A;  4BBR H;  5JEA J;  3H0G G;  2K5V A;  2CWP A;  4DV2 L;  1M1K C;  4A3B H;  4YCV A;  1BBU A;  1EWI A;  4DR5 Q;  3H3V I;  2ZJR A;  3PCO B;  1CUK A;  2NVY H;  3KOJ A;  3KYH C;  1IBM Q;  3K7A H;  4GLA C;  2RCN A;  4P74 A;  3RR5 A;  4JI5 Q;  1XJV A;  2Y0S E;  5JJI A;  4BY7 H;  2K75 A;  4JI5 L;  4DUZ Q;  1L1O A;  4PZ7 A;  3DLL A;  4EX5 A;  1JJG A;  3PUV A;  4IJL A;  3D31 A;  2EQS A;  5HGQ A;  1VQI A;  4NB3 A;  4B3S Q;  4A3E H;  5IT9 c;  1VQA A;  1SE8 A;  1Y1W G;  3JAM c;  2CWA A;  5M3F H;  2AWN A;  4YHH Q;  1VQC A;  5AJ3 Q;  4NXM Q;  1X3E A;  3UDF A;  2JA7 H;  1N34 Q;  4JI6 Q;  4X65 Q;  3HOZ H;  3CPW A;  4IPG A;  2OQ0 A;  4POG A;  2BA0 A;  1N34 L;  4JI6 L;  1XNR L;  1Q86 C;  1K0R A;  2IT1 A;  4MTN A;  1XMQ L;  3PO3 H;  3CC4 A;  2D0P A;  2ZTC A;  3RZO H;  3CD6 A;  1JJC B;  4DAY B;  3J81 c;  5GRO A;  2UU9 Q;  3KLW A;  4GLV B;  2Z6K C;  2Z0S A;  1VQG A;  4OWX B;  2NN6 I;  5IYD H;  2CKZ B;  4BBS H;  2K14 A;  3G48 A;  4KLK A;  3BZK A;  3J81 i;  3K80 C;  2BH8 A;  4APV A;  3U58 A;  4BXX G;  4GKK Q;  2PQA B;  1WCM H;  4X62 L;  2R6G A;  5IY0 A;  2VQF Q;  4A3D G;  1EFW A;  4X62 Q;  3M7N A;  4BA2 I;  2E8G A;  2VY3 A;  3S2D H;  3T1Y L;  2K50 A;  1WFQ A;  4JI8 L;  1E1O A;  4HJ5 A;  4HID A;  1W2B A;  2OTJ A;  3CAM A;  4KHP Q;  3M85 A;  4AYB E;  4DK3 C;  4B3M L;  1UEB A;  3HOU H;  3RNU A;  4JBM A;  1N8R C;  2WFW A;  2VQE L;  1GKH A;  4QL5 A;  2AHO B;  1YI2 A;  1WI5 A;  4DUY L;  4LFC Q;  4BY7 G;  1VQF A;  1J5E Q;  4DUY Q;  2VNU D;  4DV1 Q;  1JT8 A;  2ALY B;  1S72 A;  3HOV H;  1HZC A;  2R92 H;  1IBM L;  1EYG A;  4R4Q A;  1S3O A;  1WOC A;  2ES2 A;  1DGS A;  3CCV A;  4NPS A;  3WWV A;  4QY7 A;  2K5H A;  4AH6 A;  2GVB A;  4AQY L;  1RL2 A;  1N9W A;  4LF8 L;  1E3P A;  3H0G H;  2MO0 A;  3RLF A;  3GDE A;  4DKA C;  3HOU G;  1A8V A;  2YTX A;  4A3I G;  1XPR A;  5IYC H;  1BKB A;  2N8N A;  3HOX G;  3CF5 A;  1XMO Q;  5ELN A;  1EQR A;  4MZ9 A;  3UE1 A;  4OWW B;  1H95 A;  4POF A;  1OXU A;  4LF9 L;  5C4J H;  4DV5 Q;  1GO3 E;  1HZB A;  4YY3 Q;  3I56 A;  5FJ8 G;  1XNR Q;  3I4N H;  2I0Q A;  1L0W A;  5JEA G;  2RF4 A;  1XMQ Q;  4GKJ L;  5FLM G;  2UUA Q;  1N33 Q;  2HHH L;  1U5K A;  2E5L L;  3CCS A;  2B29 A;  1VQB A;  2KCM A;  3K8A A;  1IXR A;  2RHQ B;  4A76 A;  4JI0 Q;  1QZH A;  1N33 L;  4EQ5 A;  2UU9 L;  4XIG S;  4DR3 Q;  2B63 G;  4DR7 L;  2NVT H;  1G6P A;  2JA9 A;  4A3G G;  5HY6 A;  2K5N A;  4DV6 L;  4DR3 L;  3KDF A;  2Q2T A;  2F4V Q;  5GAG C;  2N78 A;  3CPF A;  4PZ6 A;  3S1M H;  4DV0 Q;  4DNI A;  4GKK L;  1VQH A;  4R4C A;  1QUQ A;  2Q2I A;  4IPH A;  3HOW G;  4QIW E;  1KL9 A;  4A3M G;  1E22 A;  3S1Q H;  1VS0 A;  4HJ8 A;  4PG3 A;  1IZ6 A;  3S2H H;  1X9N A;  1YNX A;  1HZA A;  2ATW A;  3E9I A;  4C2M H;  3HOZ G;  3CCU A;  2Z6K A;  3T1Y Q;  1D8L A;  2JA5 G;  5LMU L;  2VZA A;  2CFM A;  2JA5 H;  1J6Q A;  1VQL A;  4BA1 I;  3CMA A;  1KIX A;  3JC6 6;  1X3F A;  4L5T A;  3AFQ A;  5IP7 H;  4L5Q A;  4HIM A;  1YHQ A;  1CKN B;  1X56 A;  1VQ7 A;  4KHP L;  3EN2 A;  1I94 Q;  1XNQ Q;  2C35 B;  2KCT A;  3BU2 A;  1HNX Q;  1G51 A;  1TWG H;  4K0K Q;  3M9B A;  4GS3 A;  5C44 H;  4YCU A;  4LNQ A;  1CSP A;  3BZC A;  4K0K L;  4LFC L;  2ZM6 Q;  5E7N A;  5C0X G;  3GTK H;  1VQJ A;  4BBS G;  3PUZ A;  3I2Z A;  1K8G A;  2I5L X;  2HT1 A;  5M3M H;  4JV5 L;  1C7Y A;  2EXD A;  5FLX c;  1VQP A;  1IBL L;  4JCV E;  1VQ5 A;  1B7Y B;  2ZJQ A;  1X55 A;  4X64 L;  3UDI A;  1VQN A;  4A3B G;  1EIY B;  4BBR G;  1P16 A;  1YJW A;  4LF4 L;  3ULL A;  4AIM A;  2IHE A;  1HZ9 A;  2UUB Q;  2R93 H;  3HFZ B;  2Q2U A;  2Q2H A;  5FJ8 H;  2QGQ A;  3CME A;  1HR0 Q;  1FJG Q;  1OTC A;  4WJ4 A;  2AWO A;  1VQ4 A;  4LFB Q;  3PUX A;  1JJ2 A;  1P8L A;  2IHF A;  3CCL A;  5IE8 A;  3T1H Q;  2OTL A;  4MNO A;  3MXN B;  3M4Q A;  4LF9 Q;  2F3I A;  3S15 H;  1Z47 A;  3CW2 C;  4Y7N H;  1K9M C;  1HH2 P;  3AEV A;  1K83 H;  2N49 A;  3LGJ A;  3CCE A;  1YEZ A;  2LXK A;  2JEA I;  1KRT A;  2E5L Q;  2WAQ G;  3J81 j;  4A3L H;  3KF8 B;  4R4O A;  1KD1 C;  3CC7 A;  1D7Q A;  2MFI A;  3PO2 H;  4A3K G;  4YWM A;  3CC2 A;  2D0O A;  4DPG A;  1Y1V H;  4O2D A;  4P75 A;  3W1B A;  5IWA L;  4B3S L;  3HKZ G;  3MEF A;  2NZH A;  4DV0 L;  2UXD Q;  1BBW A;  5IP9 H;  5IWA Q;  1N36 L;  2A19 A;  4B3T Q;  5LMN W;  4NXM L;  5GQO A;  4GNX B;  3S24 A;  3M4P A;  1PFS A;  4X65 L;  3EIV A;  1QUQ B;  1EIF A;  2D62 A;  3ER0 A;  3KF6 B;  1O7I A;  5M5Y H;  4BY1 H;  1NBW A;  2UXB L;  1GM5 A;  2MNA A;  2IY5 B;  1U0L A;  1MKH A;  2NN6 G;  1KAW A;  4A3M H;  1Q1B A;  3J80 c;  3ICE A;  3M3Y H;  4A3D H;  1UE1 A;  3J7A 5;  3GTL H;  3AFP A;  4HJ7 A;  4DV7 Q;  1A62 A;  1Y1V G;  1G29 1;  1VCI A;  4DV3 L;  2ZTD A;  4DV4 L;  3F1Z A;  4UPA A;  3HOY H;  4UP8 A;  3G4S A;  2IX1 A;  4A3L G;  4A3G H;  3OW2 A;  3B6Y A;  5GAH C;  4DV4 Q;  1HNW L;  3J80 i;  3SGI A;  4DUZ L;  4JI7 L;  3PUW A;  2YTV A;  4UP7 A;  1X65 A;  1PH4 A;  1KQS A;  1R9T H;  2E2H H;  1V9P A;  1X54 A;  2UXC Q;  4UP9 A;  2PI2 E;  2JA8 G;  4JI4 Q;  4UY8 C;  3NEL A;  3PIP A;  3UDG A;  1OXT A;  2JJQ A;  2L15 A;  4JI1 Q;  1HR0 L;  2RHS B;  4OON A;  1FJG L;  3I4M G;  1KC8 C;  4IJH A;  3TRZ A;  2PI2 A;  1Q8K A;  4IOA A;  3E9H A;  1YVC A;  2ASB A;  4LF6 L;  4XTC S;  5IYC G;  2GVA A;  2VUM H;  2VQE Q;  3A5U A;  2E2J H;  2OWO A;  1TWF H;  3K81 C;  4DR5 L;  4LUV A;  1XPO A;  1PH7 A;  3U4Z A;  4NXN Q;  1L1O B;  3STB C;  2YU9 H;  1NE3 A;  4JBK A;  3TRE A;  3CCQ A;  1KHI A;  3I55 A;  4C3I H;  4X66 Q;  4OO1 I;  4HIK A;  2WAQ E;  4YWK A;  4TQU S;  3L7Z C;  1E24 A;  3U50 C;  3ULJ A;  4OO1 G;  4A93 H;  2MQH A;  1NMF A;  3ERS X;  2K52 A;  3L0O A;  2UUC Q;  4AQY Q;  3STB D;  2HQL A;  4GOP B;  4A3J H;  4R1J A;  4HJ9 A;  4DAM A;  1YZ6 A;  3PGZ A;  1XTD A;  4YHH L;  5AJ3 L;  4P71 A;  1XMO L;  4DR6 Q;  4JI8 Q;  3RLO A;  3S14 H;  3W5O A;  5BR8 L;  1IBK Q;  2UXD L;  1NMG A;  2H5X A;  4DV5 L;  4DR2 L;  4H02 A;  1MIU A;  3L2P A;  1PV4 A;  1X3G A;  5BR8 Q;  4KHZ A;  1IBK L;  2NVX H;  3A74 A;  4IPC A;  5M5X H;  2GN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...