4DR6Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 20
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr6Q00
2ZM6Q 4BBSH 4DV3L 1PA6A 2ATWA 4LF5L 5M5YH 3KOJA 1HNXQ 1KL9A 2JA5G 1X65A 4IOAA 2GVBA 1Q8KA 5HGQA 4K0KL 1UE6A 4PZ6A 5GAHC 2WB1G 2JQOA 2Z6KC 1K8GA 4BBSG 4K0KQ 4R1JA 4XIGS 1YIJA 3S1NH 4X65Q 2YV5A 1HZAA 2GN5A 2R93G 5C0XI 2ZJQA 5GAEC 5AJ3Q 4IPCA 3J80c 3M3YH 1OXUA 1P8LA 2DGYA 4LF4Q 3D31A 1XMOQ 4LFAQ 1OXTA 1ASYA 4WJ3M 3G4SA 4DV0L 2NZOA 2PNHA 3GD7A 4DV7L 5LMNW 3G6EA 2UUBQ 4JG2A 2UXBL 1NTGA 2Q2TA 3BJUA 1V1QA 4JI0L 1UWVA 4LFCQ 2UXBQ 3CP0A 5M3FG 3CF5A 1AE2A 3M9BA 4QIWE 3W1GA 4YCVA 2QA4A 1N36L 1JB7A 4QL5A 2UUCL 4B3SL 4KHPL 1A63A 4KLKA 4H02A 2B29A 1IBLL 2VNUD 3IRBA 5C0XJ 4KHPQ 2ID0A 3ULLA 2ALYB 1YEZA 3PGZA 1PV4A 1YBYA 2R7FA 1E7ZA 1L2FA 1TWGH 4GN5A 2WFWA 1G6PA 2NZHA 1QUQB 2KBNA 4DUZQ 5LMUL 4R4CA 1X54A 2PMZE 4AIMA 1LM0A 4DV6Q 1WFQA 3M4PA 3CAMA 4LNQA 1V43A 4MZ9A 4NXML 5ELNA 3CCMA 4A75A 4IJLA 4B3ML 4JI6L 1D8LA 1I50H 1TWCH 2EQSA 2BH2A 4A3DH 4A76A 3AQQA 3DLLA 3J80i 4B3TL 3PCOB 4B3MQ 4JI6Q 1XNQQ 1Y14B 2I5MX 2Z0SA 3I7FA 4DR3L 1XPUA 4LF6L 4TQUS 3A74A 4B3TQ 4PZ8A 3JC66 2K75A 1N33L 2HIVA 2LSSA 1JE5A 2D62A 4LF6Q 2K52A 2WP8J 3KF8B 4YY3L 4GOPB 3M4QA 4BY7G 1K9MC 3PO2H 3PF5A 4YY3Q 2L15A 1GKHA 5C4XH 2Q2UA 1NMFA 1VQJA 5IE8A 3CCQA 3CC2A 4IPHA 4AQYL 3EN2A 3J7A5 4UP7A 3EBEA 1XPOA 1BBWA 4AQYQ 1B8AA 2KHIA 2YTXA 1EWIA 1Y1WH 4BY1G 3H3VI 3PO2G 4FDBA 2VZAA 2VQFL 1EIYB 2NVQH 1VQCA 1VQGA 5C4XG 1JT8A 1EOVA 2VQFQ 1Q7YC 1KXLA 1J6QA 3S15H 3U4ZA 5FLXc 2Z6KA 5IYDH 3JAMc 4EX5A 2OTLA 2AKWB 5HY6A 1Y1WG 5M5WH 1E22A 3L0OA 1AE3A 4QGUA 1CUKA 1U0LA 1I3QH 4X62L 4X64L 1VQNA 4A3GH 3HKZG 3S1RH 3K7UC 4LF8Q 1VQ9A 4DR4L 1Z47A 2YTVA 3RN5A 4A3FH 2ZTDA 5IYDG 1UEBA 1PH5A 4DR4Q 1IXRA 2VUMG 2ZTCA 2JE6I 2PI2A 2N8NA 4YWKA 2HIXA 4JI4L 2F4VQ 3J81c 4A3BH 4JYAQ 4A3GG 5M3MH 3CCRA 1IYJB 3FKIH 3J81j 2ZJRA 5C44H 2K4KA 3I4MG 4P72A 2WAQG 3F1ZA 1UE7A 5LMNQ 3KF6B 3MEFA 3I2ZA 4A3FG 1VQBA 1HNZL 1NBWA 2AWNA 2UUAL 1IBMQ 1TWHH 4AH6A 4DPGA 1HNZQ 1Q82C 2UUAQ 4A3LH 5M3MG 3FKIG 2R7ZG 2K5NA 3AEVA 5FLMG 4A93H 2NN6I 1JJCB 2MO1A 2JEBI 4ALPA 3M4OH 1L1OC 3JAMi 1J5EQ 1EUJA 2F52A 4A3JH 1VQ5A 4DKAC 2Y0SG 2JA7H 4JV5L 5JJLA 4PG3A 1Q46A 1C7YA 4A3LG 1N32Q 1NMGA 4YCWA 4DR5L 2JA6G 1WJJA 3S2HH 4GKKL 4OXPA 2RHQB 3NBHB 4C3JH 4A93G 1YVCA 3U50C 3WWVA 3I4NH 4GKKQ 2LXKA 2JA5H 2OQKA 3OTOL 1XMQQ 5GADC 2ZM6L 1VQ4A 2B63H 3BU2A 1HNXL 2IHFA 1K73C 4YHHL 5FJ8G 3I4NG 3Q8DA 4DR7L 1ASZA 4YHHQ 4OWTB 2R93H 3TRZA 2AHOB 4JBJA 3W5OA 4DR7Q 1D7QA 4IPDA 2E5LL 2OCEA 4JC0A 4LUVA 4HJ8A 2B63G 3M85A 4X65L 5C0XG 2E5LQ 1KRTA 5J3BA 2WB1E 4LUOA 4O0AA 1PH3A 4BXXG 2ZTEA 3MXNB 2B3GA 5AJ3L 1BBUA 4A4IA 1P16A 4LF4L 3HOVH 2K50A 4PZ7A 4P71A 4YWMA 5BR8Q 5IP9G 3CQZH 2IX0A 5M3FH 1XMOL 2UUBL 4LFAL 2JJQA 3DM3A 4GN3B 1I5FA 3CPWA 4B3RQ 3L2PA 4GNXB 4HJ9A 1N9WA 4DAYB 1T9HA 4HIOA 4LFCL 2D0OA 4WJ4A 1S3OA 2JK8A 5IYCH 1EIFA 2HHHQ 1W2BA 4BA2I 3HOVG 4GKJQ 2IY5B 5JJIA 4RMFA 3RZDH 2V1CC 1FVIA 3A0JA 1I6HH 1CKNB 1HR0W 2NVXH 2OQ0A 4LUZA 4DNIA 3PIOA 1C0AA 1CSPA 3OYYA 1BVSA 3HOWH 1SMXA 4LW1A 5IYCG 4L5SA 1Q12A 4NXNL 2AWOA 1X3EA 4DV6L 4C2MH 4Y7NH 1N8RC 4PMWA 1EYGA 4X6AH 4DUYQ 3CCEA 3GTLH 4GLAC 3E9HA 5IYBH 3GO5A 3TREA 1Y1VH 3F2BA 2YYZA 2OWOA 3HOWG 1X3FA 2RCNA 3BZCA 3KJPA 4BY7H 1XNQL 4TVAB 3GTOH 3H15A 1SFOH 1AH9A 2I5LX 1BKBA 1L1OA 1Q1EA 2KHJA 3T1HL 3HFZB 5IYBG 4JOIC 1FJGL 2D0PA 1Y1VG 2YTYA 3H3VH 4Y52H 4AYBG 3T1HQ 1FJGQ 4JI3L 3G71A 3RNUA 3FP9A 1WCMH 1QVFA 2FXQA 2BA1A 4BY1H 2K5VA 3CMEA 4JBMA 4JI3Q 2R92H 2VS1A 4LF9L 2R6GA 1XTDA 1LYLA 1XNRQ 4LF9Q 3H0GG 3RLOA 3U4VA 2VL6A 1WCMG 1O7IA 5DLQE 3TS2A 2UXCL 2R92G 1KQSA 1E1TA 1HZ9A 3K7AH 2VY3A 4DR1Q 2UXCQ 3F2DA 2JA8H 3J7ZC 1CKMA 3S24A 4DV5Q 2K14A 1EFWA 4R4TA 3A5UA 1KAWA 1UE5A 1IBKL 2N78A 1PYSB 1PHJA 3I55A 4JI7Q 3UDIA 3CC4A 3UE0A 2VUMH 1MJCA 3CPFA 1VQ6A 3ULPA 4LF8L 1SLJA 3LGJA 2JA8G 1Z9FA 3K80C 3I4MH 4JBKA 3KLWA 4MNOA 3CC7A 4GLXA 1KIXA 4DV2L 4HIDA 4GOPC 3HKZE 3HOUH 4DR6L 1PH6A 2F4VL 2ZJPA 1WI5A 2MNAA 4IFDI 1GO3E 4DV2Q 4J15A 5GROA 4DR6Q 4JYAL 1VQOA 1S40A 3T1YL 1VQIA 4LF7L 4OWXB 5K36G 1XPRA 5LMNL 3KDFA 4IOCA 2PQAA 1G51A 3T1YQ 2R7ZH 3S2DH 5FLMH 4LF7Q 3RLFA 1VQEA 1SN8A 3KJOA 1IBML 3HOUG 1W3SA 3GTGH 4A3IH 1YHAA 3G48A 4P73A 1CKOA 2WAQE 4ME3A 3UDFA 3A5ZB 4HJAA 2NN6G 2A19A 2E8GA 2MFIA 3PUVA 1KD1C 1VQ8A 1WOCA 2CKZB 1M1KC 1HR0Q 4UY8C 3SGIA 1E1OA 2CWPA 2A1AA 4QJFA 1KHIA 4QY7A 4APVA 2JA6H 3S17H 4IFDJ 4YCUA 2R7DA 3E0EA 1J5EL 3TS0A 4A3IG 1VS0A 2CCZA 3GTPH 1NY4A 4QQBX 1N32L 1NJIC 1QVCA 1TWFH 1Q86C 4YWLA 3S1MH 3STBC 5JJKA 4XTCS 4DAMA 2Y0SE 1X3GA 4A3CH 2CQOA 1IL2A 1K83H 4X66Q 1RL2A 4JI2Q 4C3HH 1HJPA 1QVGA 3KFUA 2F3IA 1LTLA 5FJ8H 1MIUA 4JI8Q 1XMQL 1MJEA 4JOIA 1QZGA 3E9IA 1LUZA 1K3RA 2IT1A 4O2DA 1PH4A 4A3EG 1OXSC 4A3CG 3PIPA 3GDEA 3D0FA 2IHEA 2CWAA 4BXXH 1H95A 2K5HA 2VW9A 4GN4B 1YJ9A 3ULJA 4DK6C 1PH9A 1SR3A 1KC8C 5IP9H 2IX1A 1HNWQ 1Q1BA 2E2IH 4EQ5A 1WYDA 2XGTA 1OXXK 1KRSA 1QUQA 3PUWA 1RIPA 1PH1A 4OX9Q 2OTJA 4B3RL 3TEHB 5BR8L 1N34Q 5E7NA 3GTKH 3PO3H 3S1QH 2UXDQ 3M7NA 2EXDA 4NPSA 3CW2C 3HOZH 1QZHA 3VDYA 1K0RA 4P74A 3CCJA 2JEAI 4OO1G 1FL0A 3PUZA 3UE1A 5C3EG 4HJ5A 5C4JH 4A3KG 1VQDA 3PV0A 4GKJL 2HHHL 4DV3Q 3F2CA 4R4IA 1VQMA 4LF5Q 1PH8A 5JEAJ 3PO3G 3AFPA 4GOPA 1OTCA 1VQAA 4OO1I 1GM5A 1VQ7A 3GTMH 3HOYH 3HOZG 5GQOA 3ZJYC 2PI2E 1TWAH 3HKSA 1X9NA 1FGUA 5H1SE 2BA0A 1HZBA 4DUYL 4LFBL 1YZ6A 2N49A 1NE3A 3RN2A 3HOYG 4LFBQ 1GD7A 4GLVB 3I4OA 3CCUA 4L5TA 3L7ZC 1YNXA 4KI0A 2XTIA 3U58A 4DV0Q 1G291 3CD6A 4DV7Q 1PH7A 2H5XA 1A8VA 2UU9L 4MTNA 1I94L 4UP8A 2HT1A 4JI0Q 4GS3A 4UPAA 1XJVA 2UU9Q 3CCLA 1C9OA 4GNXC 1I94Q 2UUCQ 4A3MH 1HH2P 1N36Q 4B3SQ 3H0GH 3PF4A 1OXVA 3AFQA 1A62A 3K8AA 5IY0A 1JJGA 1IBLQ 3PSIA 4RG1A 1PVOA 2JA9A 4AYBE 5M5XH 4HJ7A 1CSQA 2E2HH 1B70B 1XNRL 3CCVA 4POFA 2KCMA 1L0WA 1VQPA 1VQLA 3GTJH 1IBKQ 4A3MG 5LMUQ 1R9TH 2E2JH 1VQFA 2EIFA 4DV4L 3KF6A 3RZOH 3F8TA 1YHBA 2C35B 4DR1L 4NXMQ 2ASBA 4DV4Q 1E24A 1SE8A 2I5HA 1M90C 4DV5L 4NB3A 3CCSA 3EIVA 3S16H 4DR3Q 3ER0A 4JI7L 4JI5L 3ICEA 3STBD 1N33Q 1MKHA 3UDXA 4A3DG 4JI5Q 2ES2A 3KYHC 4IFDG 4UP9A 2KCTA 4HIMA 1UE1A 4P75A 1DGSA 3HOXH 1S72A 5ELOA 3K81C 4R4OA 3RR5A 4BBRH 2CFMA 4BA1I 4OWWB 3FHWA 4POGA 2Q2HA 4DK3C 3TQYA 1YITA 1K8AC 2LXJA 2N3SA 3NELA 4JBWA 1X56A 3HOXG 2Q2IA 1A0IA 1HZCA 1HR0L 4BBRG 1L1OB 2NVYH 1PH2A 3GTQH 2GVAA 2MQHA 4LWCA 4X62Q 2QGQA 4X64Q 1PYBA 2I0QA 1VQKA 1EQQA 3PUXA 2BH8A 3UDGA 1VCIA 1X6OA 3PUYA 4JI1L 1GVPA 1YI2A 3ERSX 4L5QA 3CXCA 1EQRA 4L5RC 4JI1Q 1PFSA 4X66L 1SRUA 1JMCA 4A3EH 2AMCB 4JI2L 4JI4Q 3S14H 1JJ2A 4JI8L 2RF4A 4IPGA 4R4QA 1YJNA 2A8VA 4GNXA 2RHSB 2MO0A 3RLNA 2NVTH 4A3BG 3W1BA 1VQHA 2QEXA 1SROA 2VQEL 4DR2L 5C44G 1B7YB 3CMAA 1CKNA 3B6YA 2VQEQ 1E3PA 3OW2A 4KHZA 5JEAG 4DR2Q 1Q81C 1IZ6A 5IP7H 3I56A 3NEMA 2KENA 1YHQA 1TXYA 4IJHA 4IO9A 2YU9H 1HNWL 4OONA 4JV5Q 4JCVE 5IWAL 3BZKA 4DV1L 5IT9c 4OX9L 1U5KA 5C3EH 2HQLA 4DR5Q 5GAGC 5IWAQ 4C3IH 4DV1Q 1X55A 4A3KH 1N34L 2UXDL 4NXNQ 5IP7G 1V9PA 2DUDA 3K0XA 4DUZL 4A3JG 2JA7G 1YJWA 3KDFB 3J81i 2PQAB 4HIKA 5EAYA 3OTOQ 3AYHB 3NENA
chains in the Genus database with same CATH superfamily
2ZM6Q 2QEJC 1W6JA 3KOJA 2IJ0A 1J9OA 4F87A 2F1MA 1RDPD 4C56C 1GUWA 5HGQA 5FKAC 1UE6A 5IT9E 1FNUA 4BBSG 3NUCA 1SNPA 4R1JA 2EYLA 5DEHA 2GN5A 2R93G 2NYZD 4H13C 1Q3LA 5GAEC 3M3YH 3BDCA 1OXTA 4DU9A 2NZOA 2PNHA 3GD7A 2RDGA 1V1QA 4GZYC 2F0WA 4LFCQ 4FXGC 1AE2A 3WDNA 3W1GA 4YCVA 2QA4A 4B3SL 4JW0A 2EYFA 3NWSA 3IRBA 5IGCA 2HCCA 1YBYA 2QW7A 2GA4B 1IBKL 2KBNA 1EY4A 1LM0A 5CC4A 4A3DB 2BDOA 3OW7A 3RZOB 4MZ9A 1X3PA 5ELNA 1NR2A 4A75A 4JI6L 1TT2A 5M9OA 2BH2A 4QB4A 2QCPX 4B3MQ 2CVRA 3KLSX 1Y14B 1RTNA 2I5MX 2Z0SA 4RGTA 4LF6L 3JC66 2HIVA 1JE5A 4TSSA 2K7VA 1D6EC 1K9MC 1PZKD 3PO2H 4YIJA 3AMUA 3FPUB 4K2LA 3VYUA 2WINB 1SYEA 3D6CA 1VQJA 2OXPA 5JJZA 4IPHA 2O5IC 4UP7A 2YTXA 3TP6A 3H3VI 2NVQH 3EJIA 2VQFQ 3TN2A 5CV8A 2K33A 1J6QA 3TZUA 3U4ZA 3OSOA 5FLXc 5IGBA 3SHLA 2AKWB 1Y1WG 3AU7A 5M5WH 1DOMA 4X3TA 1AE3A 1MSGA 1CUKA 1I3QH 1B3AA 2YTVA 2BE5D 1EZ6A 5IYDG 4DR4Q 1BO0A 1IXRA 2ZTCA 2M2LA 2R61A 5E1FA 4YWKA 3VR2A 5M3MH 3CCRA 1PTOF 2ZJRA 1G8ZD 1V1PB 3JAME 2NVTB 1VQBA 4KKSA 1NBWA 1DD2A 2UUAL 1CQVA 4RHRA 1TWHH 1LTTD 3F2UA 5TSSA 5FLMG 1V1OA 1JQYD 1WTPA 2IPKD 1L1OC 3OWEB 3JAMi 5KRUA 4JV5L 1VQ5A 4DR5L 1XTCD 4YCWA 3PMFA 4C3JH 4A93G 3NBIA 2OQKA 5KYLA 1QG7A 5GADC 1VQ4A 3SK8A 5I2YA 5C0XH 4B9WA 1HNXL 1K8MA 2IHFA 3MVVA 3SE0A 3IAYA 5FJ8G 3Q8DA 2WACA 4DR7L 1TVXA 1ASZA 4OWTB 2XN9C 2B63G 1LTBD 2FINB 4HJ8A 1FGBD 2E5LQ 1EY7A 3D4RA 4LUOA 4O0AA 1PH3A 1A3VA 2ZTEA 2EJFC 5AJ3L 1BBUA 2BCOA 3CKIB 2K50A 3S16H 4YWMA 3CQZH 4K6DA 4WJWA 3P7JA 3I72A 3CPWA 3PQIA 2RA4A 1Y8OB 1N9WA 1G6ZA 1I4QA 2D0OA 4WJ4A 1A15A 2HHHQ 4BA2I 2IY5B 4RMFA 1KLUD 2G9DA 1D1IA 3A0JA 1HR0W 2NVXH 4LUZA 3QIAA 4DNIA 5C3WA 3PIOA 1IYUA 3MAQA 1C0AA 1B4OA 1SNQA 3N6RA 1H9RA 4ZUJA 5IYCG 5KIXA 1FNVA 1NSNS 2AWOA 1X3EA 2L12A 4Y7NH 3HP3A 4H7BA 4X6AH 1KDBA 3GO5A 2B39A 2EYPA 3FRPB 1TWCB 2OWOA 3HOWG 2RCNA 3BZCA 2F0HA 2KOLA 1X32A 2NUCA 3KJPA 4BY7H 3MFGA 1XNQL 3K6OA 1F9QA 1AH9A 2I5LX 4XT1B 1A2TA 1BKBA 1Q1EA 2E2DC 3T1HL 1EY9A 3J7AV 1Y1VG 1SNDA 2YTYA 4Y52H 4OHJA 2EJMA 4AYBG 1FJGQ 4CKBA 3G71A 3FP9A 4JI3Q 4LF9L 3CU7A 1LYLA 1XNRQ 3SR1A 2KVMA 1T5EA 5JPMC 3RLOA 5ISRA 2UXCL 1KQSA 1HZ9A 3Q24A 3S15B 2F0KA 3J7ZC 4P2CB 1DXMA 1CKMA 3S24A 1JR0D 4RGNA 2K14A 5C5LA 2EYHA 1EFWA 3OMGA 2MP1A 3ITPA 3UDIA 1F2YA 3UE0A 3CC4A 3I4MB 5C5MA 5K36H 2JA8G 4A3FB 4I65A 4GLXA 1KIXA 1CT1D 2PZUA 2C9OA 4A3BB 4CJ0B 4IFDI 1GO3E 2AQ2B 3FKIB 4XT3B 4DR6Q 3NWTA 5C44B 3A56A 1BCPC 4CJ2C 2L5TA 4IOCA 3T1YQ 3BG3A 1SN8A 1IBML 1PRTF 4ME3A 5CMDA 2NN6G 2HQEA 1VQ8A 1WOCA 2CKZB 1M1KC 1HR0Q 2CWPA 2B2TA 4WRDA 4A3JB 1J5EL 4A3IG 5E3FA 2AQ1B 3NK9A 4HR7B 2K5WA 1PZID 3R8BA 5ELEA 5JJKA 2K03A 4CGYB 1RL2A 3E3XA 3KFUA 2F3IA 1MIUA 1PDQA 4IUPA 1LUZA 1SNCA 2Q8TA 1GUGA 1PFBA 1G2TA 2OT2A 2QILA 4CDEC 2XSCA 2IX3A 1Q8IA 3GDEA 4G7ZC 2R93B 3KK7A 2CWAA 1MBYA 3URYA 4MHEA 4BXXH 1H95A 1ENCA 2ICIA 3MC0B 1SR3A 5IP9H 2NTSA 4CKEA 1HNWQ 2AUKA 1WYDA 4M1UB 3I8ZA 3M7GA 2E75C 3HOVB 4IUQA 5CV6A 3TEHB 5J22A 1N34Q 3GTKH 2EXDA 2QKIC 3CW2C 2F0GA 1RHPA 4GKJL 4KN4C 3F2CA 3KF8A 1NNXA 1JC7A 2RSNA 1C48A 3GTMH 1AZPA 3ZJYC 2PI2E 1TWAH 1TU2B 3Q0AA 1X9NA 2K01A 4C2MB 2HCIA 4LFBL 1YZ6A 1NE3A 4U68A 5EKIA 1SBBB 5I2XA 2XVSA 3BYYB 2H4OA 2A69C 3GTOB 3U58A 2SNSA 2ENBA 1A8VA 4MTNA 2G5DA 1VDZA 4OGQC 4UPAA 1XJVA 4GNXC 1I94Q 1B44D 1WCMB 1QNKA 5LHY1 4A3MH 4B3SQ 2E2HB 1A62A 3K8AA 3QO2A 1JJGA 4KK7A 4RG1A 2F03A 1WTRA 4AYBE 5M5XH 3QOJA 5KYIA 1DONA 3CCVA 1YNJC 1IBKQ 2VB3X 2EIFA 1JB3A 3K7AB 4DR1L 4DV4Q 1J8IA 4NB3A 2KQ3A 1KDCA 2CH4A 1MKHA 4A3DG 1KDAA 3NHHA 3NTHA 1C4QA 4UP9A 2KCTA 4HIMA 1CZWA 2K5QA 4P75A 4F88A 3JAML 2P5ZX 3D4DA 3V96A 2KCNA 3NBHA 1FNWA 3K81C 4Q0FA 5COYA 3TP7A 1TY0A 1ZEQX 5NUCA 1LTSD 5I9OA 1K8AC 3NQTA 4JBWA 3NELA 3MWYW 5CBAE 2Q2IA 4G7OC 1HZCA 3C3LA 5T1IA 2NVYH 4FP5D 4G57A 2GVAA 2MQHA 2TSSA 3GTPB 1IKLA 1GUNA 1NAPA 3UDGA 3S1MB 4RAUC 1ZKOA 1HRJA 2F0DA 3MXNA 1GVPA 5FO7B 2D5DA 3ERSX 3CXCA 4L5RC 3MXGA 3EFXD 4C3HB 4K5XA 4A3EH 2AMCB 3G7LA 4JI8L 2RF4A 2F0NA 4DNRB 2RHSB 5C3XA 4Z9CB 3DMUA 2E74C 2VQEL 4DR2L 1B7YB 1CKNA 1Q81C 4KHZA 3L9AX 2YU9B 2B2VA 4N8X1 3K59A 4IO9A 4EQOA 4JV5Q 2RBMA 1S5FD 5C3EH 4DR5Q 4A3KH 5GAGC 5IWAQ 4C3IH 4DV1Q 2FHTA 5IGGA 3HOZB 1V9PA 2KJXA 2JA7G 1YJWA 4UDUC 4HIKA 2O5JC 1JWSD 1AEXA 3NENA 4BBSH 1B1ZA 5C4ZA 1PA6A 4N9PA 4LF5L 1HNXQ 1KL9A 4IOAA 5D14A 3VR3A 2GVBA 3HOYB 1UUPA 1FR3A 4NW2A 4XDXA 5EBDA 5GAHC 4PZ6A 3C1EA 2JQOA 2Z6KC 1K8GA 4K0KQ 3S1NH 1KNEA 1HZAA 2ZJQA 3VYSA 3L3OC 5AJ3Q 4IPCA 3J80c 2DGYA 3R3OA 1KABA 4DV0L 4JG2A 1NTGA 4JI0L 2UXBQ 2EY2A 4EQNA 1X3QA 3CF5A 1JB7A 1N36L 4KHPL 4H02A 1IBLL 1H9SA 3D3RA 1STHA 4KHVA 3ULLA 3PGZA 1YEZA 2R7FA 1E7ZA 3GTJB 1ESFA 1SMYC 1R9TB 2E2JB 3IFDA 3SXHA 2EZVA 3H91A 3I90A 1V43A 4IALA 3NPPA 4RGOS 4NXML 3CCMA 2J0TD 4IJLA 1I50H 1AFPA 2EQSA 4B3TL 1XNQQ 1WTWA 4ZRZA 3A74A 1N33L 2LMCB 2I46A 2D62A 4BWGB 1LO5D 2K52A 3KF8B 2F0OA 4YY3L 4CKCA 3PF5A 5ELFA 1GKHA 2Q2UA 3HOXB 3GQBA 2EPBA 2B2UC 3J7A5 4DK1A 1I6HH 2RSOA 1B8AA 4I7ZC 4AQYQ 1Y1WH 2VZAA 2D9UA 4BS9A 1EOVA 4RH6A 1KXLA 2O4XA 1TIID 3VR6A 2TMPA 2E76C 5IYDH 4EX5A 5HY6A 1A6XA 1U0LA 4PQXA 4X64L 1VQNA 4RWSC 3S1RH 1VQ9A 1Z47A 3RN5A 1SYDA 1PH5A 1RODA 4RKBA 3S14B 4JI4L 3J81c 1I4XA 3TSSA 1IYJB 5DNFA 4DXGA 1WD0A 5G3LF 3I4MG 2K4KA 4ODGA 1HHVA 1UE7A 3MEFA 4A3FG 1ICWA 1IBMQ 1GUTA 4AH6A 1HNZQ 1JWMD 1PZJD 3FKIG 2K5NA 1PRTB 4ZKCB 4A93H 4NP5A 2Z6BA 3SDZA 2MO1A 1PMRA 4ZYSA 2K6AA 1BNZA 4ALPA 1SXTA 1J5EQ 2F52A 5JJLA 2Y0SG 1EU3A 3MA2B 1NMGA 1U4LA 5FO8B 3S2HH 4GKKL 4OXPA 2RHQB 3NBHB 1MSHA 3WWVA 4XXEA 2JA5H 1ZXTA 4K5WA 3VYRA 4M8AA 1G2SA 1DCZA 2BE5C 2PQEA 3GV3A 2B63H 5M5YB 4XYQA 3DEPA 1PTOH 4L6TB 2A68D 1SMYD 4YHHQ 3TRZA 1I4HA 2AHOB 3W5OA 1ET9A 4HTHA 1U4RA 1AP0A 4X65L 4DA2A 1KRTA 5EPJA 5EQ0A 3C46A 3MXNB 1UEAB 2B3GA 3SK6A 1K0SA 1B53A 3V05A 4LF4L 4WORA 5M3FH 4LFAL 1MHWC 2UUBL 1BQQT 4GN3B 5KGUA 4B3RQ 2XWJB 4HJ9A 4NKLA 2L55A 1T9HA 3EROA 5IYCH 3Q23A 1EQTA 4GKJQ 2ZXPA 3HOVG 5JJIA 3K5LA 1CKNB 1SAPA 4ILWA 2F0UA 1HTLD 2OQ0A 4PNYA 5EKLA 3OYYA 1BVSA 4RFBA 3HOWH 1TWGB 1SYCA 4LW1A 3W2DA 2WIIB 1Q12A 1D5XC 1S5CD 5EKKA 3GTLH 3E9HA 1Y1VH 5FOBB 3QG1A 3NE5B 3S9WA 2KEEA 3H15A 4RCOA 1GOZA 1L1OA 1DJRD 2KHJA 3I70A 5IYBG 4JOIC 1TS3A 3TP5A 4KTAA 1BCPF 4DK0A 5CYUA 5C4XB 1QVFA 4BY1H 2VS1A 1CA5A 2CW0D 1XTDA 5EBCA 2FMCA 3OOCA 1QOHA 5CV4A 3H0GG 4LAAA 2K04A 4B08A 2F3WA 1WCMG 1O7IA 1Y69U 3HKZB 3HRZC 4DFAA 3Q22A 2OEOA 4DR1Q 3F2DA 3K5MA 3OIQA 2JA8H 2MJ8A 4HSVA 2XNAC 3LX0A 4A3GB 2VUMH 1PHJA 3LNNA 1MJCA 3CPFA 1A3TA 4LF8L 4IUNA 3LGJA 1H9SB 3K80C 3D8GA 4MNOA 3CC7A 4GOPC 1WI5A 2MUYA 2MNAA 4DV2Q 2NN6H 1S40A 2X69A 3QB3A 1EZ8A 2PYKA 4LF7L 1XPRA 3R2IA 4DGZA 3KDFA 5LMNL 2R7ZH 1EEID 3RLFA 3KJOA 4KD4A 1W3SA 3GTGH 4A3IH 1YHAA 2DNEA 1BBXC 3A5ZB 5LL6S 3NXWA 2EDGA 4MIUA 4ME5A 3SVMA 1JT8A 2JA6H 1E1OA 4QY7A 4APVA 1KHIA 3S17H 3M4OB 4IFDJ 4YCUA 3E0EA 2JA7B 4JPBW 1SE3A 1VS0A 3DWPA 2CCZA 1NY4A 1TS4A 1N32L 3MFYA 1NJIC 1QVCA 3T51B 4YWLA 1Q86C 3STBC 4ULLA 5C4HA 2Y0SE 4CDFC 3I4NB 2CQOA 2DY8A 1EWCA 1LTLA 3A55A 3ERQA 4JI8Q 1XMQL 2DJFC 4OEMB 2IT1A 4O2DA 1F9SA 4OIJA 4A3CG 2XRQD 3E0JA 4C3HG 2IHEA 2K5HA 1ILQA 1DM0B 2VW9A 2ZXOA 1NCVA 1GUSA 2E2IH 2M9VA 2XGTA 2Q8RE 1QUQA 1ET6A 1RIPA 2C5CA 1GXDC 1JORA 3S1QH 4NPSA 1EYCA 4X3UA 1K0RA 4P74A 2JEAI 4OO1G 3PUZA 4IN3A 4HJ5A 1VQDA 3SK5A 4NMZA 3DEOA 4R4IA 4LF5Q 5JEAJ 4OO1I 1GM5A 2Z4HA 3HOZG 1TS2A 1RKNA 4N8FA 1U4MA 2BA0A 3K0YA 5AFWA 4DUYL 1EY5A 3VA7A 3HOYG 1GD7A 3I4OA 1A3UA 1T5XD 2SDFA 1YNXA 1SFOB 2XTIA 3HS0C 2L9HA 4DV0Q 4L63B 3O13A 3FPPA 2UU9L 3IFTA 2HT1A 4JI0Q 1SYFA 1C9OA 1B9MA 1HH2P 4J8QA 1N36Q 1Y8PB 3PF4A 1OXVA 3FMCA 2R92B 1IBLQ 1CM9A 4HJ7A 5I4DA 1L0WA 1VQPA 1VQLA 1BOSA 3BS1A 3MEHA 3RZOH 3IKJA 1YHBA 3KLSA 4OELB 4NXMQ 2SEBD 1E24A 1SE8A 4ZUIA 1TR5A 2L0CA 3ER0A 4JI7L 4E6IA 4K2KA 4JI5L 3STBD 4KD3A 1N33Q 5CBEE 3WOFA 1R4PB 4IFDG 1CHPD 4V190 3HOUB 1Q90A 1LACA 1TS5A 1S72A 5ELOA 1EFID 3RR5A 2CFMA 4X3SA 3S2DB 3V2TA 3FHWA 1SNOA 3MXPA 4POGA 2B2WC 3TQYA 2X6LA 2LXJA 4ID6A 2Y0SB 1X56A 3HOXG 2NVYB 1A0IA 1L1OB 1ILPA 4L8JA 1PH2A 2NTTA 5CV7A 3U9OA 2RCFA 4KY7A 4DNTB 4X64Q 1PYBA 2I0QA 1D5ZC 1TWFB 5D65A 1EQQA 3EVQA 3K5NA 1VCIA 1X6OA 4JI1L 4A3EB 1YI2A 4HN7A 1EYDA 1ZYRC 1PFSA 1JMCA 1ESRA 4JI4Q 1H9JA 4IPGA 1QWYA 2A5HA 1YJNA 2A8VA 4GNXA 1UAPA 1F77A 1LT3D 2MO0A 5JVH3 4FF3A 3A8IE 2NVTH 3W1BA 3HEJA 4IQZA 1ONLA 2L11A 5IGDA 3B6YA 5JEAG 3OPOA 3I56A 1TXYA 4IJHA 3J81E 4C3IB 5DM63 3BZKA 4KKTA 5IT9c 2VB2X 3DWQA 2HQLA 3PO3B 4MTKA 2UXDL 3P20A 5CORA 4LMQD 1CA6A 3K0XA 4DUZL 3KDFB 3J81i 5C4JB 3AYHB 3AB9A 1HPCA 4DV3L 2QDLA 1XWEA 2ZT9C 5FK9C 2AUJD 1PTOC 1OO9B 2F0FA 2RQXA 2OF1A 2F0SA 2J4XA 2WB1G 1K3BC 4XIGS 2RKSA 4X65Q 2YV5A 1Z7TA 5C0XI 2F0IA 1EWHA 1FD7D 4IUUA 1OXUA 4HCEA 4LF4Q 4UAIA 1ASYA 3FVQA 4LFAQ 3LWUA 4WJ3M 2UUBQ 4KKUA 4DV7L 5LMNW 3T53B 4F8MA 3BJUA 1C8CA 1UWVA 4QF4A 1GHJA 2FFKB 3M9BA 1ML0D 3H0GB 4QIWE 2UUCL 4QL5A 5I6YA 4KLKA 2B29A 2VNUD 2K32A 2ID0A 2IW3A 2ALYB 4GN5A 1G6PA 2J7ZA 2NZHA 1QUQB 4DXFA 5LMUL 4R4CA 1X54A 4AIMA 3SK4A 1WFQA 5DM73 2DNCA 3CAMA 1S5BD 4B3ML 1AW7A 1D8LA 1TWCH 4S3SA 3AQQA 3DLLA 4JI6Q 4FF1A 3I7FA 4DR3L 1XPUA 2N88A 2K75A 2Z8LA 2A6HD 4LF6Q 1QB5D 2WP8J 5IGFA 1ZYRD 3MZ5A 4BY7G 1WTQA 2L15A 2B2YC 3P1HA 1BCPB 1F2ZA 1HUMA 3GP7A 2CQAA 5IE8A 3CCQA 3CC2A 4BBRB 3EN2A 3EBEA 1SE2A 4FDBA 4HSPA 2F0JA 2VQFL 1EIYB 1VQCA 1VQGA 3J7AF 5C4XG 3MTSA 3S15H 2JYOA 1SSOA 2Z6KA 3JAMc 1EY6A 1O7LA 2OTLA 4KY5A 3IL8A 3I3CA 1DOLA 1MGSA 3HKZG 2BOSA 2XWBB 4KV6A 4LF8Q 4DR4L 3TZDA 4A3FH 1JCKB 4A3BH 4A3GG 4FXDA 3J81j 1NR4A 2F0VA 3FKIH 5C44H 2MHVA 3F1ZA 1PTOD 5FLXE 5LMNQ 2PNRC 3I2ZA 1CI3M 2AWNA 3CRLC 2UUAQ 5KNBA 4ZKBB 1JJCB 1H9MA 2JEBI 1EUJA 4R8NA 4A3JH 4DKAC 4PG3A 1Q46A 1ENAA 2IL8A 4A3LG 1N32Q 1WJJA 5LL6X 2LS01 2NB0A 3ONAB 2PW5A 3QWNA 4IZ8A 2CHBD 2F3VA 1F2MA 1XMQQ 1XX8A 3OIPA 1B2TA 1EU4A 1A2UA 3BU2A 1K73C 3A8KE 3T13A 3HZXA 3U9SA 2D2CC 2EY6A 2MPMA 3I4NG 3ND9A 2B2UA 5I9PA 2R93H 4DR7Q 2VXWA 3N52A 3A7LA 4IPDA 2E5LL 1JOKA 2OCEA 4H44C 4LUVA 4FO2A 4QIWB 5J3BA 2WB1E 4ABNA 2G9HD 3NQIA 3T56B 4BXXG 3M3YB 4A4IA 2B8GA 1P16A 3HOVH 1XMOL 3CHBD 4P71A 4PZ7A 5IP9G 3OTOQ 1VQ6A 2IX0A 2PZTA 2JJQA 3DM3A 4HAEA 3SEBA 3Q6SA 3L2PA 4GNXB 1S5DD 2JN4A 2JK8A 3J80L 3K5OA 3RZDH 2V1CC 4H0LC 1CSPA 2KECA 4QUFA 5JAVA 2KA7A 3OMCA 1B9NA 4NXNL 4DV6L 4C2MH 1N8RC 4PMWA 1EYGA 2A68C 3C1FA 4DUYQ 1DOKA 3CCEA 4GLAC 5IYBH 4HCSA 3TREA 2K28A 1X3FA 5HGTA 4IURA 4N9TA 3H09A 4XQJA 3TDQA 3GTOH 1FJGL 3H3VH 2KEDA 3PO2B 3T1HQ 4JI3L 1D2BA 3RNUA 4R8IA 1WCMH 3QOLA 2FXQA 2BA1A 2K5VA 1WTVA 2R6GA 2QF7A 4LF9Q 5IODA 1RJTA 1QCBD 2EJGC 4JK1C 2NVQB 1BXTA 3TS2A 2R92G 1E1TA 3K7AH 2VY3A 4KJNA 2PPBC 2UXCQ 3X3MA 4QMGA 2VUMB 2XRSD 5M5WB 3OHXC 5BN4A 1I3QB 1PYSB 3I55A 4JI7Q 2WAQB 1EIGA 4JBKA 4HIDA 2N55A 3HKZE 4DR6L 3HG9A 2F4VL 1VF5C 2ZJPA 5M3MB 4J15A 4JYAL 1VQOA 1DZ1A 3T1YL 1VQIA 4OWXB 2HDMA 2PQAA 5FLMH 2V4DA 1VQEA 2CW0C 1TWHB 3HOUG 1CFMA 1HXYD 4P73A 3J81L 1B3QA 3UDFA 5A2QE 2JA6B 1PRTD 2E8GA 2Z1CA 4X3KA 2MFIA 3PUVA 1KD1C 3SGIA 2JSOA 3KLRA 2R3ZA 5EPLA 1RF2D 3D6WA 5F2DA 1G91A 3TS0A 3GTPH 3S1MH 4C3JB 4XTCS 4A3CH 1IL2A 1K83H 1R4QB 1SEBD 4KMUC 1L0YB 4C3HH 1HJPA 1QVGA 1PYWD 5FJ8H 4JOIA 3E9IA 3BVGA 2WB1B 4A3EG 1OXSC 1STEA 4HMJA 1LT5D 2FMMA 3EA6A 3ND8A 1LABA 3DHQA 4GN4B 2IX1A 4RA8A 2WKDA 1STGA 1Q1BA 3H94A 4FXKC 3PUWA 1VF7A 1PH1A 3S16B 5E4XA 3CQZB 5BR8L 5FO9B 4MN3A 5E7NA 2UXDQ 3M7NA 1O80A 3HOZH 3VDYA 3CCJA 5C3EG 4A3KG 4C3IG 4IUVA 1O7ZA 4DV3Q 4RKLA 1VMCA 1WTHA 3PO3G 2NVXB 4GOPA 1L0XB 1VQ7A 3HOYH 1YNND 1LTAD 4Y7NB 5L37A 1FGUA 5H1SE 4JVZA 2N49A 1O78A 1BF4A 1QE6A 3RN2A 4LFBQ 2Z4IA 4BY7B 4L5TA 5IIFA 4G4KA 1F9PA 4DV7Q 4UHVA 1I94L 4RGMA 1UNSA 1ENFA 4R9WA 2UUCQ 1I4GA 3PSIA 1PVOA 3LWEA 1LT4D 3H6MA 1CSQA 1H9KA 3KBGA 3E6ZX 2KCMA 4ZQ3A 1IW7D 3GTJH 5LMUQ 1R9TH 2E2JH 4PMCA 1VQFA 1S4ZA 1QJOA 4DV4L 3ZYYX 3KF6A 3F8TA 2C35B 4J6HA 2ASBA 1BR9A 4IFDH 2I5HA 3PIP3 4DV5L 1PFMA 4PV1C 3CCSA 2NBFA 2WV6D 1V8QA 4DR3Q 5C6AA 1VMPA 4C1NI 2Z9HA 2PZWA 1HFNA 2LFNA 1IKMA 1JE4A 5FLXL 4ZCKA 1UE1A 1DGSA 3HOXH 1TKWB 4R4OA 4BA1I 3NSWA 2KUMA 1STAA 1STBA 2F4IA 2Q2HA 1E2VA 2WKCA 4BBRG 3D4WA 2L1BA 3GTQH 3OWFA 5JVG3 3PUXA 4L5QA 5CV9A 5ELDA 4X66L 1SRUA 4HEDA 4JI2L 1JOQA 3S14H 1EY0A 5JEAH 4R4QA 2XIWA 4O42A 4QUCA 4DAYA 1O7YA 3RLNA 4Q5VA 2IWHA 2VQEQ 1E3PA 3OW2A 2EYMA 4DR2Q 1IZ6A 1BDOA 4ZAIA 1YHQA 1I6VC 1E2WA 1EQVA 4OL7A 5IWAL 4DV1L 3T4AC 4OX9L 1LTRD 1U5KA 1PLFA 3GTKB 1X55A 5J1ZA 3K57A 5IP7G 2EE1A 1EEFD 1QILA 2PQAB 5EAYA 1BUVT 3RMHA 2ES2A 4DAVA 4U673 2ATWA 2SOBA 5M5YH 2JA5G 1X65A 3TMEA 3GTMB 1QNUA 4LJZC 1Q8KA 1TWAB 4K0KL 1LT6D 3RD4A 1FYCA 1YIJA 2KHSA 2AQ3B 2B2WA 1CK1A 3EQLC 2O2LD 3K58A 1P8LA 3D31A 4B9XA 1XMOQ 2EOTA 5CR3A 3G4SA 3G6EA 2UXBL 1U4PA 2F0MA 2PW7A 4KN7C 4C1NK 2Q2TA 1I4PA 5D3IB 2F0PA 3CP0A 5M3FG 4A3MB 1A63A 2ZXRA 1DYQA 5M5XB 5C0XJ 4KHPQ 3KBXA 2RDHA 1LTID 1PV4A 4V0BA 3J80E 1XXGA 1TWGH 1L2FA 4OIKA 5HURA 2WFWA 1STYA 4NXNQ 4DV6Q 2PMZE 3M4PA 4ZLTF 4LNQA 4K14A 4A3DH 4CJ1B 4A76A 3J80i 3PCOB 1EY8A 1LTGD 4TQUS 1F9RA 4B3TQ 1D1KA 4PZ8A 1KTKA 2LSSA 1HUNA 2K1BA 2EXZA 4GOPB 5CGKA 3M4QA 3H3VC 4YY3Q 5C4XH 1NMFA 1SE4A 4NDXA 4AQYL 3GV6A 1HQMC 4KJOA 5A2QL 1K28A 1XPOA 1BBWA 2KHIA 3PO2G 1EWIA 4BY1G 1HFGA 5EPKA 4I7AA 1Q7YC 1HA6A 4G7HC 1E22A 3L0OA 3CRKC 2MGSA 4QGUA 4A3GH 4X62L 4K6LA 1EIHA 3K7UC 1M8AA 2ZTDA 1UEBA 2VUMG 2A6HC 2EY1A 2JE6I 2N8NA 2PI2A 2HIXA 2F4VQ 3W3AA 4JYAQ 4P72A 2ICEC 2WAQG 5ELCA 5G3LD 3KF6B 2B8FA 2X6GA 1HNZL 3FEWX 4DPGA 4CDDC 1Q82C 4A3LH 5M3MG 2R7ZG 1WTOA 3AEVA 2EYJA 5EGTA 2NN6I 3M4OH 1SYBA 3T16A 2JA7H 3A54A 5C3EB 1C7YA 4A3KB 5EJWA 2JA6G 3A8JE 2I07B 1HCZA 1YVCA 3U50C 4GKKQ 3I4NH 2LXKA 4FF4A 3OTOL 4BBSB 5IT9L 2ZM6L 5BN3A 2PO4A 5T1GA 4C3JG 4YHHL 2B2YA 3BZDB 3VYTA 4JBJA 1MD2D 1D7QA 5K5PA 2L4NA 4JC0A 4RHSA 3S1NB 3M85A 5C0XG 4PMBA 3KUPA 5ELBA 3DWAA 3J7YW 5BR8Q 4B3RL 4XQNA 1EYAA 1EL0A 1I5FA 2PCFB 2Q8IB 4DAYB 2PMZB 4HIOA 4LFCL 3RZDB 1S3OA 1II3A 1EIFA 1W2BA 1FVIA 4K5VA 4J1MA 1LLRD 2F0EA 3C2PA 1SYGA 1SMXA 3BDLA 4L5SA 1JWUD 2B2TC 1AN8A 2HDLA 2CH4W 1ICFB 3F2BA 2YYZA 1I50B 2QDBA 4CHTB 4TVAB 1CZGA 1WTXA 1SFOH 5I6WA 2K5DA 2A6EC 3HFZB 3DUZA 1PXUA 2D0PA 3BVMA 1BCPD 2EVBA 4JBMA 3CMEA 2F0QA 2R92H 1MI2A 1I6HB 4K8IA 3NTKA 1Y1WB 3U4VA 1B50A 2VL6A 1IHZA 2LKVA 3FDTA 1PFNA 5DLQE 2A74C 1SDFA 4HMIA 2EYOA 4DV5Q 4R4TA 4F7XA 1KAWA 1UE5A 3A5UA 2N78A 3S1RB 3ULPA 3UI2A 1SLJA 1GUOA 1Z9FA 4ZK9B 3I4MH 3KLWA 3BDOA 1K8OA 2H1EA 4RCNA 2HD3A 4DV2L 3HOUH 3I4LA 1PH6A 5GROA 5K36G 1G51A 3S2DH 4LF7Q 1XYIA 3G48A 1CKOA 2WAQE 4HJAA 5KEEA 2A19A 3M4YA 1HTPA 4A93B 3DM1A 4UY8C 2RVLA 3PIO3 1CTMA 2A1AA 4QJFA 1HA5A 2F0LA 2R7DA 2RDFA 1CHQD 1Y8NB 1AZQA 3A7AB 4QQBX 1IYVA 3S2HB 1K83B 1TWFH 4DAMA 4CDCC 4TKOB 1X3GA 1JICA 4X66Q 2JA5B 3MXUA 4JI2Q 1KNAA 1MJEA 1QZGA 2B63B 1K3RA 1PTOB 4KY6A 1PH4A 2FJ2A 1WD1A 3PIPA 4DF7A 4FVMA 5BN5A 3D0FA 1YJ9A 3ULJA 4DK6C 1PH9A 4FYDA 1KC8C 2F0TA 2A69D 1PRTC 1EOTA 4EQ5A 1OXXK 1KRSA 4FNFA 1RCVD 5A35A 5KNDA 2K05A 4OX9Q 2OTJA 5M3FB 4K8JA 5DAUA 3PO3H 2A6ED 2DJGC 1HQRD 2M00A 2JP1A 1QZHA 2NWGA 1FL0A 3UE1A 5C4JH 2A73B 3HGBA 3PV0A 1KLGD 2HHHL 1VQMA 1U9RA 1PH8A 3AFPA 1YNJD 1OTCA 1VQAA 3E5SA 5GQOA 3HOWB 2DY7A 3X3NA 3BVZA 3HKSA 3VR4A 1E2ZA 5IGEA 2HUGA 3P75A 3GTLB 1HZBA 1Y1VB 5E4WC 3BYTB 3I91A 4AYBB 4GLVB 1IL8A 2SNMA 3CCUA 3L7ZC 4EGVA 3NTIA 4KI0A 1G291 3CD6A 1PH7A 2BDNA 2H5XA 4FF2A 4UP8A 1I4RA 4GS3A 5D3DA 2UU9Q 3CCLA 5JOBA 3H0GH 4BY1B 3AFQA 2JXMB 5IY0A 1Z6HA 2JA9A 2E2HH 1B70B 3I73A 1XNRL 4POFA 1TY2A 2B2VC 1SJHD 4A3MG 1WVLA 1YNNC 1V1PA 4XYOA 3R93A 2JA8B 2KCCA 5JPNC 5J39A 1M90C 4XQQA 2LY7A 3R2TA 4DAPA 4EVOA 3EIVA 5KNCA 3ICEA 3TP8A 4QCLA 3UDXA 4CBVA 4JI5Q 3KYHC 3NP8A 3RUZA 1M4VA 1SNMA 2EY5A 1KAAA 1NUCA 1GJXA 1S5ED 1D5MC 4BBRH 4OWWB 2R7ZB 3GTGB 4A3IB 4DK3C 1YITA 4LK1C 4TRDA 2N3SA 5CV5A 1IW7C 3VA5A 3GTQB 1HR0L 3S17B 3WOEA 4LWCA 4IUTA 4X62Q 2QGQA 3QR8A 1TQOA 1VQKA 2BH8A 3DXJC 3PUYA 3MHBA 2NZ1D 4DN4M 1EQRA 4JI1Q 4WFN3 1JJ2A 1JOOA 1RTOA 5IOCA 1E0BA 4A3BG 3QJYA 1VQHA 2QEXA 1SROA 1CQFA 5C44G 3CMAA 5IP7H 1W6KA 2KENA 3NEMA 4EQPA 2E2IB 1HNWL 2YU9H 4OONA 3VR5A 1RD9D 3TBIB 4JCVE 1STNA 4OO1H 1N34L 1GHKA 1LV9A 3S1QB 1SJED 3G6JB 2DUDA 4A3JG 2DN8A 4DUZQ 4O1NA 1F2LA
chains in the Genus database with same CATH topology
2ZM6Q 4BBSH 4DV3L 1PA6A 2ATWA 4LF5L 5M5YH 3KOJA 1HNXQ 1KL9A 2JA5G 1X65A 4IOAA 2GVBA 1Q8KA 5HGQA 4K0KL 1UE6A 4PZ6A 5GAHC 2WB1G 2JQOA 2Z6KC 1K8GA 4BBSG 4K0KQ 4R1JA 4XIGS 1YIJA 3S1NH 4X65Q 2YV5A 1HZAA 2GN5A 2R93G 5C0XI 2ZJQA 5GAEC 5AJ3Q 4IPCA 3J80c 3M3YH 1OXUA 1P8LA 2DGYA 4LF4Q 3D31A 1XMOQ 4LFAQ 1OXTA 1ASYA 4WJ3M 3G4SA 4DV0L 2NZOA 2PNHA 3GD7A 4DV7L 5LMNW 3G6EA 2UUBQ 4JG2A 2UXBL 1NTGA 2Q2TA 3BJUA 1V1QA 4JI0L 1UWVA 4LFCQ 2UXBQ 3CP0A 5M3FG 3CF5A 1AE2A 3M9BA 4QIWE 3W1GA 4YCVA 2QA4A 1N36L 1JB7A 4QL5A 2UUCL 4B3SL 4KHPL 1A63A 4KLKA 4H02A 2B29A 1IBLL 2VNUD 3IRBA 5C0XJ 4KHPQ 2ID0A 3ULLA 2ALYB 1YEZA 3PGZA 1PV4A 1YBYA 2R7FA 1E7ZA 1L2FA 1TWGH 4GN5A 2WFWA 1G6PA 2NZHA 1QUQB 2KBNA 4DUZQ 5LMUL 4R4CA 1X54A 2PMZE 4AIMA 1LM0A 4DV6Q 1WFQA 3M4PA 3CAMA 4LNQA 1V43A 4MZ9A 4NXML 5ELNA 3CCMA 4A75A 4IJLA 4B3ML 4JI6L 1D8LA 1I50H 1TWCH 2EQSA 2BH2A 4A3DH 4A76A 3AQQA 3DLLA 3J80i 4B3TL 3PCOB 4B3MQ 4JI6Q 1XNQQ 1Y14B 2I5MX 2Z0SA 3I7FA 4DR3L 1XPUA 4LF6L 4TQUS 3A74A 4B3TQ 4PZ8A 3JC66 2K75A 1N33L 2HIVA 2LSSA 1JE5A 2D62A 4LF6Q 2K52A 2WP8J 3KF8B 4YY3L 4GOPB 3M4QA 4BY7G 1K9MC 3PO2H 3PF5A 4YY3Q 2L15A 1GKHA 5C4XH 2Q2UA 1NMFA 1VQJA 5IE8A 3CCQA 3CC2A 4IPHA 4AQYL 3EN2A 3J7A5 4UP7A 3EBEA 1XPOA 1BBWA 4AQYQ 1B8AA 2KHIA 2YTXA 1EWIA 1Y1WH 4BY1G 3H3VI 3PO2G 4FDBA 2VZAA 2VQFL 1EIYB 2NVQH 1VQCA 1VQGA 5C4XG 1JT8A 1EOVA 2VQFQ 1Q7YC 1KXLA 1J6QA 3S15H 3U4ZA 5FLXc 2Z6KA 5IYDH 3JAMc 4EX5A 2OTLA 2AKWB 5HY6A 1Y1WG 5M5WH 1E22A 3L0OA 1AE3A 4QGUA 1CUKA 1U0LA 1I3QH 4X62L 4X64L 1VQNA 4A3GH 3HKZG 3S1RH 3K7UC 4LF8Q 1VQ9A 4DR4L 1Z47A 2YTVA 3RN5A 4A3FH 2ZTDA 5IYDG 1UEBA 1PH5A 4DR4Q 1IXRA 2VUMG 2ZTCA 2JE6I 2PI2A 2N8NA 4YWKA 2HIXA 4JI4L 2F4VQ 3J81c 4A3BH 4JYAQ 4A3GG 5M3MH 3CCRA 1IYJB 3FKIH 3J81j 2ZJRA 5C44H 2K4KA 3I4MG 4P72A 2WAQG 3F1ZA 1UE7A 5LMNQ 3KF6B 3MEFA 3I2ZA 4A3FG 1VQBA 1HNZL 1NBWA 2AWNA 2UUAL 1IBMQ 1TWHH 4AH6A 4DPGA 1HNZQ 1Q82C 2UUAQ 4A3LH 5M3MG 3FKIG 2R7ZG 2K5NA 3AEVA 5FLMG 4A93H 2NN6I 1JJCB 2MO1A 2JEBI 4ALPA 3M4OH 1L1OC 3JAMi 1J5EQ 1EUJA 2F52A 4A3JH 1VQ5A 4DKAC 2Y0SG 2JA7H 4JV5L 5JJLA 4PG3A 1Q46A 1C7YA 4A3LG 1N32Q 1NMGA 4YCWA 4DR5L 2JA6G 1WJJA 3S2HH 4GKKL 4OXPA 2RHQB 3NBHB 4C3JH 4A93G 1YVCA 3U50C 3WWVA 3I4NH 4GKKQ 2LXKA 2JA5H 2OQKA 3OTOL 1XMQQ 5GADC 2ZM6L 1VQ4A 2B63H 3BU2A 1HNXL 2IHFA 1K73C 4YHHL 5FJ8G 3I4NG 3Q8DA 4DR7L 1ASZA 4YHHQ 4OWTB 2R93H 3TRZA 2AHOB 4JBJA 3W5OA 4DR7Q 1D7QA 4IPDA 2E5LL 2OCEA 4JC0A 4LUVA 4HJ8A 2B63G 3M85A 4X65L 5C0XG 2E5LQ 1KRTA 5J3BA 2WB1E 4LUOA 4O0AA 1PH3A 4BXXG 2ZTEA 3MXNB 2B3GA 5AJ3L 1BBUA 4A4IA 1P16A 4LF4L 3HOVH 2K50A 4PZ7A 4P71A 4YWMA 5BR8Q 5IP9G 3CQZH 2IX0A 5M3FH 1XMOL 2UUBL 4LFAL 2JJQA 3DM3A 4GN3B 1I5FA 3CPWA 4B3RQ 3L2PA 4GNXB 4HJ9A 1N9WA 4DAYB 1T9HA 4HIOA 4LFCL 2D0OA 4WJ4A 1S3OA 2JK8A 5IYCH 1EIFA 2HHHQ 1W2BA 4BA2I 3HOVG 4GKJQ 2IY5B 5JJIA 4RMFA 3RZDH 2V1CC 1FVIA 3A0JA 1I6HH 1CKNB 1HR0W 2NVXH 2OQ0A 4LUZA 4DNIA 3PIOA 1C0AA 1CSPA 3OYYA 1BVSA 3HOWH 1SMXA 4LW1A 5IYCG 4L5SA 1Q12A 4NXNL 2AWOA 1X3EA 4DV6L 4C2MH 4Y7NH 1N8RC 4PMWA 1EYGA 4X6AH 4DUYQ 3CCEA 3GTLH 4GLAC 3E9HA 5IYBH 3GO5A 3TREA 1Y1VH 3F2BA 2YYZA 2OWOA 3HOWG 1X3FA 2RCNA 3BZCA 3KJPA 4BY7H 1XNQL 4TVAB 3GTOH 3H15A 1SFOH 1AH9A 2I5LX 1BKBA 1L1OA 1Q1EA 2KHJA 3T1HL 3HFZB 5IYBG 4JOIC 1FJGL 2D0PA 1Y1VG 2YTYA 3H3VH 4Y52H 4AYBG 3T1HQ 1FJGQ 4JI3L 3G71A 3RNUA 3FP9A 1WCMH 1QVFA 2FXQA 2BA1A 4BY1H 2K5VA 3CMEA 4JBMA 4JI3Q 2R92H 2VS1A 4LF9L 2R6GA 1XTDA 1LYLA 1XNRQ 4LF9Q 3H0GG 3RLOA 3U4VA 2VL6A 1WCMG 1O7IA 5DLQE 3TS2A 2UXCL 2R92G 1KQSA 1E1TA 1HZ9A 3K7AH 2VY3A 4DR1Q 2UXCQ 3F2DA 2JA8H 3J7ZC 1CKMA 3S24A 4DV5Q 2K14A 1EFWA 4R4TA 3A5UA 1KAWA 1UE5A 1IBKL 2N78A 1PYSB 1PHJA 3I55A 4JI7Q 3UDIA 3CC4A 3UE0A 2VUMH 1MJCA 3CPFA 1VQ6A 3ULPA 4LF8L 1SLJA 3LGJA 2JA8G 1Z9FA 3K80C 3I4MH 4JBKA 3KLWA 4MNOA 3CC7A 4GLXA 1KIXA 4DV2L 4HIDA 4GOPC 3HKZE 3HOUH 4DR6L 1PH6A 2F4VL 2ZJPA 1WI5A 2MNAA 4IFDI 1GO3E 4DV2Q 4J15A 5GROA 4DR6Q 4JYAL 1VQOA 1S40A 3T1YL 1VQIA 4LF7L 4OWXB 5K36G 1XPRA 5LMNL 3KDFA 4IOCA 2PQAA 1G51A 3T1YQ 2R7ZH 3S2DH 5FLMH 4LF7Q 3RLFA 1VQEA 1SN8A 3KJOA 1IBML 3HOUG 1W3SA 3GTGH 4A3IH 1YHAA 3G48A 4P73A 1CKOA 2WAQE 4ME3A 3UDFA 3A5ZB 4HJAA 2NN6G 2A19A 2E8GA 2MFIA 3PUVA 1KD1C 1VQ8A 1WOCA 2CKZB 1M1KC 1HR0Q 4UY8C 3SGIA 1E1OA 2CWPA 2A1AA 4QJFA 1KHIA 4QY7A 4APVA 2JA6H 3S17H 4IFDJ 4YCUA 2R7DA 3E0EA 1J5EL 3TS0A 4A3IG 1VS0A 2CCZA 3GTPH 1NY4A 4QQBX 1N32L 1NJIC 1QVCA 1TWFH 1Q86C 4YWLA 3S1MH 3STBC 5JJKA 4XTCS 4DAMA 2Y0SE 1X3GA 4A3CH 2CQOA 1IL2A 1K83H 4X66Q 1RL2A 4JI2Q 4C3HH 1HJPA 1QVGA 3KFUA 2F3IA 1LTLA 5FJ8H 1MIUA 4JI8Q 1XMQL 1MJEA 4JOIA 1QZGA 3E9IA 1LUZA 1K3RA 2IT1A 4O2DA 1PH4A 4A3EG 1OXSC 4A3CG 3PIPA 3GDEA 3D0FA 2IHEA 2CWAA 4BXXH 1H95A 2K5HA 2VW9A 4GN4B 1YJ9A 3ULJA 4DK6C 1PH9A 1SR3A 1KC8C 5IP9H 2IX1A 1HNWQ 1Q1BA 2E2IH 4EQ5A 1WYDA 2XGTA 1OXXK 1KRSA 1QUQA 3PUWA 1RIPA 1PH1A 4OX9Q 2OTJA 4B3RL 3TEHB 5BR8L 1N34Q 5E7NA 3GTKH 3PO3H 3S1QH 2UXDQ 3M7NA 2EXDA 4NPSA 3CW2C 3HOZH 1QZHA 3VDYA 1K0RA 4P74A 3CCJA 2JEAI 4OO1G 1FL0A 3PUZA 3UE1A 5C3EG 4HJ5A 5C4JH 4A3KG 1VQDA 3PV0A 4GKJL 2HHHL 4DV3Q 3F2CA 4R4IA 1VQMA 4LF5Q 1PH8A 5JEAJ 3PO3G 3AFPA 4GOPA 1OTCA 1VQAA 4OO1I 1GM5A 1VQ7A 3GTMH 3HOYH 3HOZG 5GQOA 3ZJYC 2PI2E 1TWAH 3HKSA 1X9NA 1FGUA 5H1SE 2BA0A 1HZBA 4DUYL 4LFBL 1YZ6A 2N49A 1NE3A 3RN2A 3HOYG 4LFBQ 1GD7A 4GLVB 3I4OA 3CCUA 4L5TA 3L7ZC 1YNXA 4KI0A 2XTIA 3U58A 4DV0Q 1G291 3CD6A 4DV7Q 1PH7A 2H5XA 1A8VA 2UU9L 4MTNA 1I94L 4UP8A 2HT1A 4JI0Q 4GS3A 4UPAA 1XJVA 2UU9Q 3CCLA 1C9OA 4GNXC 1I94Q 2UUCQ 4A3MH 1HH2P 1N36Q 4B3SQ 3H0GH 3PF4A 1OXVA 3AFQA 1A62A 3K8AA 5IY0A 1JJGA 1IBLQ 3PSIA 4RG1A 1PVOA 2JA9A 4AYBE 5M5XH 4HJ7A 1CSQA 2E2HH 1B70B 1XNRL 3CCVA 4POFA 2KCMA 1L0WA 1VQPA 1VQLA 3GTJH 1IBKQ 4A3MG 5LMUQ 1R9TH 2E2JH 1VQFA 2EIFA 4DV4L 3KF6A 3RZOH 3F8TA 1YHBA 2C35B 4DR1L 4NXMQ 2ASBA 4DV4Q 1E24A 1SE8A 2I5HA 1M90C 4DV5L 4NB3A 3CCSA 3EIVA 3S16H 4DR3Q 3ER0A 4JI7L 4JI5L 3ICEA 3STBD 1N33Q 1MKHA 3UDXA 4A3DG 4JI5Q 2ES2A 3KYHC 4IFDG 4UP9A 2KCTA 4HIMA 1UE1A 4P75A 1DGSA 3HOXH 1S72A 5ELOA 3K81C 4R4OA 3RR5A 4BBRH 2CFMA 4BA1I 4OWWB 3FHWA 4POGA 2Q2HA 4DK3C 3TQYA 1YITA 1K8AC 2LXJA 2N3SA 3NELA 4JBWA 1X56A 3HOXG 2Q2IA 1A0IA 1HZCA 1HR0L 4BBRG 1L1OB 2NVYH 1PH2A 3GTQH 2GVAA 2MQHA 4LWCA 4X62Q 2QGQA 4X64Q 1PYBA 2I0QA 1VQKA 1EQQA 3PUXA 2BH8A 3UDGA 1VCIA 1X6OA 3PUYA 4JI1L 1GVPA 1YI2A 3ERSX 4L5QA 3CXCA 1EQRA 4L5RC 4JI1Q 1PFSA 4X66L 1SRUA 1JMCA 4A3EH 2AMCB 4JI2L 4JI4Q 3S14H 1JJ2A 4JI8L 2RF4A 4IPGA 4R4QA 1YJNA 2A8VA 4GNXA 2RHSB 2MO0A 3RLNA 2NVTH 4A3BG 3W1BA 1VQHA 2QEXA 1SROA 2VQEL 4DR2L 5C44G 1B7YB 3CMAA 1CKNA 3B6YA 2VQEQ 1E3PA 3OW2A 4KHZA 5JEAG 4DR2Q 1Q81C 1IZ6A 5IP7H 3I56A 3NEMA 2KENA 1YHQA 1TXYA 4IJHA 4IO9A 2YU9H 1HNWL 4OONA 4JV5Q 4JCVE 5IWAL 3BZKA 4DV1L 5IT9c 4OX9L 1U5KA 5C3EH 2HQLA 4DR5Q 5GAGC 5IWAQ 4C3IH 4DV1Q 1X55A 4A3KH 1N34L 2UXDL 4NXNQ 5IP7G 1V9PA 2DUDA 3K0XA 4DUZL 4A3JG 2JA7G 1YJWA 3KDFB 3J81i 2PQAB 4HIKA 5EAYA 3OTOQ 3AYHB 3NENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 Q;  4BBS H;  4DV3 L;  1PA6 A;  2ATW A;  4LF5 L;  5M5Y H;  3KOJ A;  1HNX Q;  1KL9 A;  2JA5 G;  1X65 A;  4IOA A;  2GVB A;  1Q8K A;  5HGQ A;  4K0K L;  1UE6 A;  4PZ6 A;  5GAH C;  2WB1 G;  2JQO A;  2Z6K C;  1K8G A;  4BBS G;  4K0K Q;  4R1J A;  4XIG S;  1YIJ A;  3S1N H;  4X65 Q;  2YV5 A;  1HZA A;  2GN5 A;  2R93 G;  5C0X I;  2ZJQ A;  5GAE C;  5AJ3 Q;  4IPC A;  3J80 c;  3M3Y H;  1OXU A;  1P8L A;  2DGY A;  4LF4 Q;  3D31 A;  1XMO Q;  4LFA Q;  1OXT A;  1ASY A;  4WJ3 M;  3G4S A;  4DV0 L;  2NZO A;  2PNH A;  3GD7 A;  4DV7 L;  5LMN W;  3G6E A;  2UUB Q;  4JG2 A;  2UXB L;  1NTG A;  2Q2T A;  3BJU A;  1V1Q A;  4JI0 L;  1UWV A;  4LFC Q;  2UXB Q;  3CP0 A;  5M3F G;  3CF5 A;  1AE2 A;  3M9B A;  4QIW E;  3W1G A;  4YCV A;  2QA4 A;  1N36 L;  1JB7 A;  4QL5 A;  2UUC L;  4B3S L;  4KHP L;  1A63 A;  4KLK A;  4H02 A;  2B29 A;  1IBL L;  2VNU D;  3IRB A;  5C0X J;  4KHP Q;  2ID0 A;  3ULL A;  2ALY B;  1YEZ A;  3PGZ A;  1PV4 A;  1YBY A;  2R7F A;  1E7Z A;  1L2F A;  1TWG H;  4GN5 A;  2WFW A;  1G6P A;  2NZH A;  1QUQ B;  2KBN A;  4DUZ Q;  5LMU L;  4R4C A;  1X54 A;  2PMZ E;  4AIM A;  1LM0 A;  4DV6 Q;  1WFQ A;  3M4P A;  3CAM A;  4LNQ A;  1V43 A;  4MZ9 A;  4NXM L;  5ELN A;  3CCM A;  4A75 A;  4IJL A;  4B3M L;  4JI6 L;  1D8L A;  1I50 H;  1TWC H;  2EQS A;  2BH2 A;  4A3D H;  4A76 A;  3AQQ A;  3DLL A;  3J80 i;  4B3T L;  3PCO B;  4B3M Q;  4JI6 Q;  1XNQ Q;  1Y14 B;  2I5M X;  2Z0S A;  3I7F A;  4DR3 L;  1XPU A;  4LF6 L;  4TQU S;  3A74 A;  4B3T Q;  4PZ8 A;  3JC6 6;  2K75 A;  1N33 L;  2HIV A;  2LSS A;  1JE5 A;  2D62 A;  4LF6 Q;  2K52 A;  2WP8 J;  3KF8 B;  4YY3 L;  4GOP B;  3M4Q A;  4BY7 G;  1K9M C;  3PO2 H;  3PF5 A;  4YY3 Q;  2L15 A;  1GKH A;  5C4X H;  2Q2U A;  1NMF A;  1VQJ A;  5IE8 A;  3CCQ A;  3CC2 A;  4IPH A;  4AQY L;  3EN2 A;  3J7A 5;  4UP7 A;  3EBE A;  1XPO A;  1BBW A;  4AQY Q;  1B8A A;  2KHI A;  2YTX A;  1EWI A;  1Y1W H;  4BY1 G;  3H3V I;  3PO2 G;  4FDB A;  2VZA A;  2VQF L;  1EIY B;  2NVQ H;  1VQC A;  1VQG A;  5C4X G;  1JT8 A;  1EOV A;  2VQF Q;  1Q7Y C;  1KXL A;  1J6Q A;  3S15 H;  3U4Z A;  5FLX c;  2Z6K A;  5IYD H;  3JAM c;  4EX5 A;  2OTL A;  2AKW B;  5HY6 A;  1Y1W G;  5M5W H;  1E22 A;  3L0O A;  1AE3 A;  4QGU A;  1CUK A;  1U0L A;  1I3Q H;  4X62 L;  4X64 L;  1VQN A;  4A3G H;  3HKZ G;  3S1R H;  3K7U C;  4LF8 Q;  1VQ9 A;  4DR4 L;  1Z47 A;  2YTV A;  3RN5 A;  4A3F H;  2ZTD A;  5IYD G;  1UEB A;  1PH5 A;  4DR4 Q;  1IXR A;  2VUM G;  2ZTC A;  2JE6 I;  2PI2 A;  2N8N A;  4YWK A;  2HIX A;  4JI4 L;  2F4V Q;  3J81 c;  4A3B H;  4JYA Q;  4A3G G;  5M3M H;  3CCR A;  1IYJ B;  3FKI H;  3J81 j;  2ZJR A;  5C44 H;  2K4K A;  3I4M G;  4P72 A;  2WAQ G;  3F1Z A;  1UE7 A;  5LMN Q;  3KF6 B;  3MEF A;  3I2Z A;  4A3F G;  1VQB A;  1HNZ L;  1NBW A;  2AWN A;  2UUA L;  1IBM Q;  1TWH H;  4AH6 A;  4DPG A;  1HNZ Q;  1Q82 C;  2UUA Q;  4A3L H;  5M3M G;  3FKI G;  2R7Z G;  2K5N A;  3AEV A;  5FLM G;  4A93 H;  2NN6 I;  1JJC B;  2MO1 A;  2JEB I;  4ALP A;  3M4O H;  1L1O C;  3JAM i;  1J5E Q;  1EUJ A;  2F52 A;  4A3J H;  1VQ5 A;  4DKA C;  2Y0S G;  2JA7 H;  4JV5 L;  5JJL A;  4PG3 A;  1Q46 A;  1C7Y A;  4A3L G;  1N32 Q;  1NMG A;  4YCW A;  4DR5 L;  2JA6 G;  1WJJ A;  3S2H H;  4GKK L;  4OXP A;  2RHQ B;  3NBH B;  4C3J H;  4A93 G;  1YVC A;  3U50 C;  3WWV A;  3I4N H;  4GKK Q;  2LXK A;  2JA5 H;  2OQK A;  3OTO L;  1XMQ Q;  5GAD C;  2ZM6 L;  1VQ4 A;  2B63 H;  3BU2 A;  1HNX L;  2IHF A;  1K73 C;  4YHH L;  5FJ8 G;  3I4N G;  3Q8D A;  4DR7 L;  1ASZ A;  4YHH Q;  4OWT B;  2R93 H;  3TRZ A;  2AHO B;  4JBJ A;  3W5O A;  4DR7 Q;  1D7Q A;  4IPD A;  2E5L L;  2OCE A;  4JC0 A;  4LUV A;  4HJ8 A;  2B63 G;  3M85 A;  4X65 L;  5C0X G;  2E5L Q;  1KRT A;  5J3B A;  2WB1 E;  4LUO A;  4O0A A;  1PH3 A;  4BXX G;  2ZTE A;  3MXN B;  2B3G A;  5AJ3 L;  1BBU A;  4A4I A;  1P16 A;  4LF4 L;  3HOV H;  2K50 A;  4PZ7 A;  4P71 A;  4YWM A;  5BR8 Q;  5IP9 G;  3CQZ H;  2IX0 A;  5M3F H;  1XMO L;  2UUB L;  4LFA L;  2JJQ A;  3DM3 A;  4GN3 B;  1I5F A;  3CPW A;  4B3R Q;  3L2P A;  4GNX B;  4HJ9 A;  1N9W A;  4DAY B;  1T9H A;  4HIO A;  4LFC L;  2D0O A;  4WJ4 A;  1S3O A;  2JK8 A;  5IYC H;  1EIF A;  2HHH Q;  1W2B A;  4BA2 I;  3HOV G;  4GKJ Q;  2IY5 B;  5JJI A;  4RMF A;  3RZD H;  2V1C C;  1FVI A;  3A0J A;  1I6H H;  1CKN B;  1HR0 W;  2NVX H;  2OQ0 A;  4LUZ A;  4DNI A;  3PIO A;  1C0A A;  1CSP A;  3OYY A;  1BVS A;  3HOW H;  1SMX A;  4LW1 A;  5IYC G;  4L5S A;  1Q12 A;  4NXN L;  2AWO A;  1X3E A;  4DV6 L;  4C2M H;  4Y7N H;  1N8R C;  4PMW A;  1EYG A;  4X6A H;  4DUY Q;  3CCE A;  3GTL H;  4GLA C;  3E9H A;  5IYB H;  3GO5 A;  3TRE A;  1Y1V H;  3F2B A;  2YYZ A;  2OWO A;  3HOW G;  1X3F A;  2RCN A;  3BZC A;  3KJP A;  4BY7 H;  1XNQ L;  4TVA B;  3GTO H;  3H15 A;  1SFO H;  1AH9 A;  2I5L X;  1BKB A;  1L1O A;  1Q1E A;  2KHJ A;  3T1H L;  3HFZ B;  5IYB G;  4JOI C;  1FJG L;  2D0P A;  1Y1V G;  2YTY A;  3H3V H;  4Y52 H;  4AYB G;  3T1H Q;  1FJG Q;  4JI3 L;  3G71 A;  3RNU A;  3FP9 A;  1WCM H;  1QVF A;  2FXQ A;  2BA1 A;  4BY1 H;  2K5V A;  3CME A;  4JBM A;  4JI3 Q;  2R92 H;  2VS1 A;  4LF9 L;  2R6G A;  1XTD A;  1LYL A;  1XNR Q;  4LF9 Q;  3H0G G;  3RLO A;  3U4V A;  2VL6 A;  1WCM G;  1O7I A;  5DLQ E;  3TS2 A;  2UXC L;  2R92 G;  1KQS A;  1E1T A;  1HZ9 A;  3K7A H;  2VY3 A;  4DR1 Q;  2UXC Q;  3F2D A;  2JA8 H;  3J7Z C;  1CKM A;  3S24 A;  4DV5 Q;  2K14 A;  1EFW A;  4R4T A;  3A5U A;  1KAW A;  1UE5 A;  1IBK L;  2N78 A;  1PYS B;  1PHJ A;  3I55 A;  4JI7 Q;  3UDI A;  3CC4 A;  3UE0 A;  2VUM H;  1MJC A;  3CPF A;  1VQ6 A;  3ULP A;  4LF8 L;  1SLJ A;  3LGJ A;  2JA8 G;  1Z9F A;  3K80 C;  3I4M H;  4JBK A;  3KLW A;  4MNO A;  3CC7 A;  4GLX A;  1KIX A;  4DV2 L;  4HID A;  4GOP C;  3HKZ E;  3HOU H;  4DR6 L;  1PH6 A;  2F4V L;  2ZJP A;  1WI5 A;  2MNA A;  4IFD I;  1GO3 E;  4DV2 Q;  4J15 A;  5GRO A;  4DR6 Q;  4JYA L;  1VQO A;  1S40 A;  3T1Y L;  1VQI A;  4LF7 L;  4OWX B;  5K36 G;  1XPR A;  5LMN L;  3KDF A;  4IOC A;  2PQA A;  1G51 A;  3T1Y Q;  2R7Z H;  3S2D H;  5FLM H;  4LF7 Q;  3RLF A;  1VQE A;  1SN8 A;  3KJO A;  1IBM L;  3HOU G;  1W3S A;  3GTG H;  4A3I H;  1YHA A;  3G48 A;  4P73 A;  1CKO A;  2WAQ E;  4ME3 A;  3UDF A;  3A5Z B;  4HJA A;  2NN6 G;  2A19 A;  2E8G A;  2MFI A;  3PUV A;  1KD1 C;  1VQ8 A;  1WOC A;  2CKZ B;  1M1K C;  1HR0 Q;  4UY8 C;  3SGI A;  1E1O A;  2CWP A;  2A1A A;  4QJF A;  1KHI A;  4QY7 A;  4APV A;  2JA6 H;  3S17 H;  4IFD J;  4YCU A;  2R7D A;  3E0E A;  1J5E L;  3TS0 A;  4A3I G;  1VS0 A;  2CCZ A;  3GTP H;  1NY4 A;  4QQB X;  1N32 L;  1NJI C;  1QVC A;  1TWF H;  1Q86 C;  4YWL A;  3S1M H;  3STB C;  5JJK A;  4XTC S;  4DAM A;  2Y0S E;  1X3G A;  4A3C H;  2CQO A;  1IL2 A;  1K83 H;  4X66 Q;  1RL2 A;  4JI2 Q;  4C3H H;  1HJP A;  1QVG A;  3KFU A;  2F3I A;  1LTL A;  5FJ8 H;  1MIU A;  4JI8 Q;  1XMQ L;  1MJE A;  4JOI A;  1QZG A;  3E9I A;  1LUZ A;  1K3R A;  2IT1 A;  4O2D A;  1PH4 A;  4A3E G;  1OXS C;  4A3C G;  3PIP A;  3GDE A;  3D0F A;  2IHE A;  2CWA A;  4BXX H;  1H95 A;  2K5H A;  2VW9 A;  4GN4 B;  1YJ9 A;  3ULJ A;  4DK6 C;  1PH9 A;  1SR3 A;  1KC8 C;  5IP9 H;  2IX1 A;  1HNW Q;  1Q1B A;  2E2I H;  4EQ5 A;  1WYD A;  2XGT A;  1OXX K;  1KRS A;  1QUQ A;  3PUW A;  1RIP A;  1PH1 A;  4OX9 Q;  2OTJ A;  4B3R L;  3TEH B;  5BR8 L;  1N34 Q;  5E7N A;  3GTK H;  3PO3 H;  3S1Q H;  2UXD Q;  3M7N A;  2EXD A;  4NPS A;  3CW2 C;  3HOZ H;  1QZH A;  3VDY A;  1K0R A;  4P74 A;  3CCJ A;  2JEA I;  4OO1 G;  1FL0 A;  3PUZ A;  3UE1 A;  5C3E G;  4HJ5 A;  5C4J H;  4A3K G;  1VQD A;  3PV0 A;  4GKJ L;  2HHH L;  4DV3 Q;  3F2C A;  4R4I A;  1VQM A;  4LF5 Q;  1PH8 A;  5JEA J;  3PO3 G;  3AFP A;  4GOP A;  1OTC A;  1VQA A;  4OO1 I;  1GM5 A;  1VQ7 A;  3GTM H;  3HOY H;  3HOZ G;  5GQO A;  3ZJY C;  2PI2 E;  1TWA H;  3HKS A;  1X9N A;  1FGU A;  5H1S E;  2BA0 A;  1HZB A;  4DUY L;  4LFB L;  1YZ6 A;  2N49 A;  1NE3 A;  3RN2 A;  3HOY G;  4LFB Q;  1GD7 A;  4GLV B;  3I4O A;  3CCU A;  4L5T A;  3L7Z C;  1YNX A;  4KI0 A;  2XTI A;  3U58 A;  4DV0 Q;  1G29 1;  3CD6 A;  4DV7 Q;  1PH7 A;  2H5X A;  1A8V A;  2UU9 L;  4MTN A;  1I94 L;  4UP8 A;  2HT1 A;  4JI0 Q;  4GS3 A;  4UPA A;  1XJV A;  2UU9 Q;  3CCL A;  1C9O A;  4GNX C;  1I94 Q;  2UUC Q;  4A3M H;  1HH2 P;  1N36 Q;  4B3S Q;  3H0G H;  3PF4 A;  1OXV A;  3AFQ A;  1A62 A;  3K8A A;  5IY0 A;  1JJG A;  1IBL Q;  3PSI A;  4RG1 A;  1PVO A;  2JA9 A;  4AYB E;  5M5X H;  4HJ7 A;  1CSQ A;  2E2H H;  1B70 B;  1XNR L;  3CCV A;  4POF A;  2KCM A;  1L0W A;  1VQP A;  1VQL A;  3GTJ H;  1IBK Q;  4A3M G;  5LMU Q;  1R9T H;  2E2J H;  1VQF A;  2EIF A;  4DV4 L;  3KF6 A;  3RZO H;  3F8T A;  1YHB A;  2C35 B;  4DR1 L;  4NXM Q;  2ASB A;  4DV4 Q;  1E24 A;  1SE8 A;  2I5H A;  1M90 C;  4DV5 L;  4NB3 A;  3CCS A;  3EIV A;  3S16 H;  4DR3 Q;  3ER0 A;  4JI7 L;  4JI5 L;  3ICE A;  3STB D;  1N33 Q;  1MKH A;  3UDX A;  4A3D G;  4JI5 Q;  2ES2 A;  3KYH C;  4IFD G;  4UP9 A;  2KCT A;  4HIM A;  1UE1 A;  4P75 A;  1DGS A;  3HOX H;  1S72 A;  5ELO A;  3K81 C;  4R4O A;  3RR5 A;  4BBR H;  2CFM A;  4BA1 I;  4OWW B;  3FHW A;  4POG A;  2Q2H A;  4DK3 C;  3TQY A;  1YIT A;  1K8A C;  2LXJ A;  2N3S A;  3NEL A;  4JBW A;  1X56 A;  3HOX G;  2Q2I A;  1A0I A;  1HZC A;  1HR0 L;  4BBR G;  1L1O B;  2NVY H;  1PH2 A;  3GTQ H;  2GVA A;  2MQH A;  4LWC A;  4X62 Q;  2QGQ A;  4X64 Q;  1PYB A;  2I0Q A;  1VQK A;  1EQQ A;  3PUX A;  2BH8 A;  3UDG A;  1VCI A;  1X6O A;  3PUY A;  4JI1 L;  1GVP A;  1YI2 A;  3ERS X;  4L5Q A;  3CXC A;  1EQR A;  4L5R C;  4JI1 Q;  1PFS A;  4X66 L;  1SRU A;  1JMC A;  4A3E H;  2AMC B;  4JI2 L;  4JI4 Q;  3S14 H;  1JJ2 A;  4JI8 L;  2RF4 A;  4IPG A;  4R4Q A;  1YJN A;  2A8V A;  4GNX A;  2RHS B;  2MO0 A;  3RLN A;  2NVT H;  4A3B G;  3W1B A;  1VQH A;  2QEX A;  1SRO A;  2VQE L;  4DR2 L;  5C44 G;  1B7Y B;  3CMA A;  1CKN A;  3B6Y A;  2VQE Q;  1E3P A;  3OW2 A;  4KHZ A;  5JEA G;  4DR2 Q;  1Q81 C;  1IZ6 A;  5IP7 H;  3I56 A;  3NEM A;  2KEN A;  1YHQ A;  1TXY A;  4IJH A;  4IO9 A;  2YU9 H;  1HNW L;  4OON A;  4JV5 Q;  4JCV E;  5IWA L;  3BZK A;  4DV1 L;  5IT9 c;  4OX9 L;  1U5K A;  5C3E H;  2HQL A;  4DR5 Q;  5GAG C;  5IWA Q;  4C3I H;  4DV1 Q;  1X55 A;  4A3K H;  1N34 L;  2UXD L;  4NXN Q;  5IP7 G;  1V9P A;  2DUD A;  3K0X A;  4DUZ L;  4A3J G;  2JA7 G;  1YJW A;  3KDF B;  3J81 i;  2PQA B;  4HIK A;  5EAY A;  3OTO Q;  3AYH B;  3NEN A; 
#chains in the Genus database with same CATH topology
 2ZM6 Q;  2QEJ C;  1W6J A;  3KOJ A;  2IJ0 A;  1J9O A;  4F87 A;  2F1M A;  1RDP D;  4C56 C;  1GUW A;  5HGQ A;  5FKA C;  1UE6 A;  5IT9 E;  1FNU A;  4BBS G;  3NUC A;  1SNP A;  4R1J A;  2EYL A;  5DEH A;  2GN5 A;  2R93 G;  2NYZ D;  4H13 C;  1Q3L A;  5GAE C;  3M3Y H;  3BDC A;  1OXT A;  4DU9 A;  2NZO A;  2PNH A;  3GD7 A;  2RDG A;  1V1Q A;  4GZY C;  2F0W A;  4LFC Q;  4FXG C;  1AE2 A;  3WDN A;  3W1G A;  4YCV A;  2QA4 A;  4B3S L;  4JW0 A;  2EYF A;  3NWS A;  3IRB A;  5IGC A;  2HCC A;  1YBY A;  2QW7 A;  2GA4 B;  1IBK L;  2KBN A;  1EY4 A;  1LM0 A;  5CC4 A;  4A3D B;  2BDO A;  3OW7 A;  3RZO B;  4MZ9 A;  1X3P A;  5ELN A;  1NR2 A;  4A75 A;  4JI6 L;  1TT2 A;  5M9O A;  2BH2 A;  4QB4 A;  2QCP X;  4B3M Q;  2CVR A;  3KLS X;  1Y14 B;  1RTN A;  2I5M X;  2Z0S A;  4RGT A;  4LF6 L;  3JC6 6;  2HIV A;  1JE5 A;  4TSS A;  2K7V A;  1D6E C;  1K9M C;  1PZK D;  3PO2 H;  4YIJ A;  3AMU A;  3FPU B;  4K2L A;  3VYU A;  2WIN B;  1SYE A;  3D6C A;  1VQJ A;  2OXP A;  5JJZ A;  4IPH A;  2O5I C;  4UP7 A;  2YTX A;  3TP6 A;  3H3V I;  2NVQ H;  3EJI A;  2VQF Q;  3TN2 A;  5CV8 A;  2K33 A;  1J6Q A;  3TZU A;  3U4Z A;  3OSO A;  5FLX c;  5IGB A;  3SHL A;  2AKW B;  1Y1W G;  3AU7 A;  5M5W H;  1DOM A;  4X3T A;  1AE3 A;  1MSG A;  1CUK A;  1I3Q H;  1B3A A;  2YTV A;  2BE5 D;  1EZ6 A;  5IYD G;  4DR4 Q;  1BO0 A;  1IXR A;  2ZTC A;  2M2L A;  2R61 A;  5E1F A;  4YWK A;  3VR2 A;  5M3M H;  3CCR A;  1PTO F;  2ZJR A;  1G8Z D;  1V1P B;  3JAM E;  2NVT B;  1VQB A;  4KKS A;  1NBW A;  1DD2 A;  2UUA L;  1CQV A;  4RHR A;  1TWH H;  1LTT D;  3F2U A;  5TSS A;  5FLM G;  1V1O A;  1JQY D;  1WTP A;  2IPK D;  1L1O C;  3OWE B;  3JAM i;  5KRU A;  4JV5 L;  1VQ5 A;  4DR5 L;  1XTC D;  4YCW A;  3PMF A;  4C3J H;  4A93 G;  3NBI A;  2OQK A;  5KYL A;  1QG7 A;  5GAD C;  1VQ4 A;  3SK8 A;  5I2Y A;  5C0X H;  4B9W A;  1HNX L;  1K8M A;  2IHF A;  3MVV A;  3SE0 A;  3IAY A;  5FJ8 G;  3Q8D A;  2WAC A;  4DR7 L;  1TVX A;  1ASZ A;  4OWT B;  2XN9 C;  2B63 G;  1LTB D;  2FIN B;  4HJ8 A;  1FGB D;  2E5L Q;  1EY7 A;  3D4R A;  4LUO A;  4O0A A;  1PH3 A;  1A3V A;  2ZTE A;  2EJF C;  5AJ3 L;  1BBU A;  2BCO A;  3CKI B;  2K50 A;  3S16 H;  4YWM A;  3CQZ H;  4K6D A;  4WJW A;  3P7J A;  3I72 A;  3CPW A;  3PQI A;  2RA4 A;  1Y8O B;  1N9W A;  1G6Z A;  1I4Q A;  2D0O A;  4WJ4 A;  1A15 A;  2HHH Q;  4BA2 I;  2IY5 B;  4RMF A;  1KLU D;  2G9D A;  1D1I A;  3A0J A;  1HR0 W;  2NVX H;  4LUZ A;  3QIA A;  4DNI A;  5C3W A;  3PIO A;  1IYU A;  3MAQ A;  1C0A A;  1B4O A;  1SNQ A;  3N6R A;  1H9R A;  4ZUJ A;  5IYC G;  5KIX A;  1FNV A;  1NSN S;  2AWO A;  1X3E A;  2L12 A;  4Y7N H;  3HP3 A;  4H7B A;  4X6A H;  1KDB A;  3GO5 A;  2B39 A;  2EYP A;  3FRP B;  1TWC B;  2OWO A;  3HOW G;  2RCN A;  3BZC A;  2F0H A;  2KOL A;  1X32 A;  2NUC A;  3KJP A;  4BY7 H;  3MFG A;  1XNQ L;  3K6O A;  1F9Q A;  1AH9 A;  2I5L X;  4XT1 B;  1A2T A;  1BKB A;  1Q1E A;  2E2D C;  3T1H L;  1EY9 A;  3J7A V;  1Y1V G;  1SND A;  2YTY A;  4Y52 H;  4OHJ A;  2EJM A;  4AYB G;  1FJG Q;  4CKB A;  3G71 A;  3FP9 A;  4JI3 Q;  4LF9 L;  3CU7 A;  1LYL A;  1XNR Q;  3SR1 A;  2KVM A;  1T5E A;  5JPM C;  3RLO A;  5ISR A;  2UXC L;  1KQS A;  1HZ9 A;  3Q24 A;  3S15 B;  2F0K A;  3J7Z C;  4P2C B;  1DXM A;  1CKM A;  3S24 A;  1JR0 D;  4RGN A;  2K14 A;  5C5L A;  2EYH A;  1EFW A;  3OMG A;  2MP1 A;  3ITP A;  3UDI A;  1F2Y A;  3UE0 A;  3CC4 A;  3I4M B;  5C5M A;  5K36 H;  2JA8 G;  4A3F B;  4I65 A;  4GLX A;  1KIX A;  1CT1 D;  2PZU A;  2C9O A;  4A3B B;  4CJ0 B;  4IFD I;  1GO3 E;  2AQ2 B;  3FKI B;  4XT3 B;  4DR6 Q;  3NWT A;  5C44 B;  3A56 A;  1BCP C;  4CJ2 C;  2L5T A;  4IOC A;  3T1Y Q;  3BG3 A;  1SN8 A;  1IBM L;  1PRT F;  4ME3 A;  5CMD A;  2NN6 G;  2HQE A;  1VQ8 A;  1WOC A;  2CKZ B;  1M1K C;  1HR0 Q;  2CWP A;  2B2T A;  4WRD A;  4A3J B;  1J5E L;  4A3I G;  5E3F A;  2AQ1 B;  3NK9 A;  4HR7 B;  2K5W A;  1PZI D;  3R8B A;  5ELE A;  5JJK A;  2K03 A;  4CGY B;  1RL2 A;  3E3X A;  3KFU A;  2F3I A;  1MIU A;  1PDQ A;  4IUP A;  1LUZ A;  1SNC A;  2Q8T A;  1GUG A;  1PFB A;  1G2T A;  2OT2 A;  2QIL A;  4CDE C;  2XSC A;  2IX3 A;  1Q8I A;  3GDE A;  4G7Z C;  2R93 B;  3KK7 A;  2CWA A;  1MBY A;  3URY A;  4MHE A;  4BXX H;  1H95 A;  1ENC A;  2ICI A;  3MC0 B;  1SR3 A;  5IP9 H;  2NTS A;  4CKE A;  1HNW Q;  2AUK A;  1WYD A;  4M1U B;  3I8Z A;  3M7G A;  2E75 C;  3HOV B;  4IUQ A;  5CV6 A;  3TEH B;  5J22 A;  1N34 Q;  3GTK H;  2EXD A;  2QKI C;  3CW2 C;  2F0G A;  1RHP A;  4GKJ L;  4KN4 C;  3F2C A;  3KF8 A;  1NNX A;  1JC7 A;  2RSN A;  1C48 A;  3GTM H;  1AZP A;  3ZJY C;  2PI2 E;  1TWA H;  1TU2 B;  3Q0A A;  1X9N A;  2K01 A;  4C2M B;  2HCI A;  4LFB L;  1YZ6 A;  1NE3 A;  4U68 A;  5EKI A;  1SBB B;  5I2X A;  2XVS A;  3BYY B;  2H4O A;  2A69 C;  3GTO B;  3U58 A;  2SNS A;  2ENB A;  1A8V A;  4MTN A;  2G5D A;  1VDZ A;  4OGQ C;  4UPA A;  1XJV A;  4GNX C;  1I94 Q;  1B44 D;  1WCM B;  1QNK A;  5LHY 1;  4A3M H;  4B3S Q;  2E2H B;  1A62 A;  3K8A A;  3QO2 A;  1JJG A;  4KK7 A;  4RG1 A;  2F03 A;  1WTR A;  4AYB E;  5M5X H;  3QOJ A;  5KYI A;  1DON A;  3CCV A;  1YNJ C;  1IBK Q;  2VB3 X;  2EIF A;  1JB3 A;  3K7A B;  4DR1 L;  4DV4 Q;  1J8I A;  4NB3 A;  2KQ3 A;  1KDC A;  2CH4 A;  1MKH A;  4A3D G;  1KDA A;  3NHH A;  3NTH A;  1C4Q A;  4UP9 A;  2KCT A;  4HIM A;  1CZW A;  2K5Q A;  4P75 A;  4F88 A;  3JAM L;  2P5Z X;  3D4D A;  3V96 A;  2KCN A;  3NBH A;  1FNW A;  3K81 C;  4Q0F A;  5COY A;  3TP7 A;  1TY0 A;  1ZEQ X;  5NUC A;  1LTS D;  5I9O A;  1K8A C;  3NQT A;  4JBW A;  3NEL A;  3MWY W;  5CBA E;  2Q2I A;  4G7O C;  1HZC A;  3C3L A;  5T1I A;  2NVY H;  4FP5 D;  4G57 A;  2GVA A;  2MQH A;  2TSS A;  3GTP B;  1IKL A;  1GUN A;  1NAP A;  3UDG A;  3S1M B;  4RAU C;  1ZKO A;  1HRJ A;  2F0D A;  3MXN A;  1GVP A;  5FO7 B;  2D5D A;  3ERS X;  3CXC A;  4L5R C;  3MXG A;  3EFX D;  4C3H B;  4K5X A;  4A3E H;  2AMC B;  3G7L A;  4JI8 L;  2RF4 A;  2F0N A;  4DNR B;  2RHS B;  5C3X A;  4Z9C B;  3DMU A;  2E74 C;  2VQE L;  4DR2 L;  1B7Y B;  1CKN A;  1Q81 C;  4KHZ A;  3L9A X;  2YU9 B;  2B2V A;  4N8X 1;  3K59 A;  4IO9 A;  4EQO A;  4JV5 Q;  2RBM A;  1S5F D;  5C3E H;  4DR5 Q;  4A3K H;  5GAG C;  5IWA Q;  4C3I H;  4DV1 Q;  2FHT A;  5IGG A;  3HOZ B;  1V9P A;  2KJX A;  2JA7 G;  1YJW A;  4UDU C;  4HIK A;  2O5J C;  1JWS D;  1AEX A;  3NEN A;  4BBS H;  1B1Z A;  5C4Z A;  1PA6 A;  4N9P A;  4LF5 L;  1HNX Q;  1KL9 A;  4IOA A;  5D14 A;  3VR3 A;  2GVB A;  3HOY B;  1UUP A;  1FR3 A;  4NW2 A;  4XDX A;  5EBD A;  5GAH C;  4PZ6 A;  3C1E A;  2JQO A;  2Z6K C;  1K8G A;  4K0K Q;  3S1N H;  1KNE A;  1HZA A;  2ZJQ A;  3VYS A;  3L3O C;  5AJ3 Q;  4IPC A;  3J80 c;  2DGY A;  3R3O A;  1KAB A;  4DV0 L;  4JG2 A;  1NTG A;  4JI0 L;  2UXB Q;  2EY2 A;  4EQN A;  1X3Q A;  3CF5 A;  1JB7 A;  1N36 L;  4KHP L;  4H02 A;  1IBL L;  1H9S A;  3D3R A;  1STH A;  4KHV A;  3ULL A;  3PGZ A;  1YEZ A;  2R7F A;  1E7Z A;  3GTJ B;  1ESF A;  1SMY C;  1R9T B;  2E2J B;  3IFD A;  3SXH A;  2EZV A;  3H91 A;  3I90 A;  1V43 A;  4IAL A;  3NPP A;  4RGO S;  4NXM L;  3CCM A;  2J0T D;  4IJL A;  1I50 H;  1AFP A;  2EQS A;  4B3T L;  1XNQ Q;  1WTW A;  4ZRZ A;  3A74 A;  1N33 L;  2LMC B;  2I46 A;  2D62 A;  4BWG B;  1LO5 D;  2K52 A;  3KF8 B;  2F0O A;  4YY3 L;  4CKC A;  3PF5 A;  5ELF A;  1GKH A;  2Q2U A;  3HOX B;  3GQB A;  2EPB A;  2B2U C;  3J7A 5;  4DK1 A;  1I6H H;  2RSO A;  1B8A A;  4I7Z C;  4AQY Q;  1Y1W H;  2VZA A;  2D9U A;  4BS9 A;  1EOV A;  4RH6 A;  1KXL A;  2O4X A;  1TII D;  3VR6 A;  2TMP A;  2E76 C;  5IYD H;  4EX5 A;  5HY6 A;  1A6X A;  1U0L A;  4PQX A;  4X64 L;  1VQN A;  4RWS C;  3S1R H;  1VQ9 A;  1Z47 A;  3RN5 A;  1SYD A;  1PH5 A;  1ROD A;  4RKB A;  3S14 B;  4JI4 L;  3J81 c;  1I4X A;  3TSS A;  1IYJ B;  5DNF A;  4DXG A;  1WD0 A;  5G3L F;  3I4M G;  2K4K A;  4ODG A;  1HHV A;  1UE7 A;  3MEF A;  4A3F G;  1ICW A;  1IBM Q;  1GUT A;  4AH6 A;  1HNZ Q;  1JWM D;  1PZJ D;  3FKI G;  2K5N A;  1PRT B;  4ZKC B;  4A93 H;  4NP5 A;  2Z6B A;  3SDZ A;  2MO1 A;  1PMR A;  4ZYS A;  2K6A A;  1BNZ A;  4ALP A;  1SXT A;  1J5E Q;  2F52 A;  5JJL A;  2Y0S G;  1EU3 A;  3MA2 B;  1NMG A;  1U4L A;  5FO8 B;  3S2H H;  4GKK L;  4OXP A;  2RHQ B;  3NBH B;  1MSH A;  3WWV A;  4XXE A;  2JA5 H;  1ZXT A;  4K5W A;  3VYR A;  4M8A A;  1G2S A;  1DCZ A;  2BE5 C;  2PQE A;  3GV3 A;  2B63 H;  5M5Y B;  4XYQ A;  3DEP A;  1PTO H;  4L6T B;  2A68 D;  1SMY D;  4YHH Q;  3TRZ A;  1I4H A;  2AHO B;  3W5O A;  1ET9 A;  4HTH A;  1U4R A;  1AP0 A;  4X65 L;  4DA2 A;  1KRT A;  5EPJ A;  5EQ0 A;  3C46 A;  3MXN B;  1UEA B;  2B3G A;  3SK6 A;  1K0S A;  1B53 A;  3V05 A;  4LF4 L;  4WOR A;  5M3F H;  4LFA L;  1MHW C;  2UUB L;  1BQQ T;  4GN3 B;  5KGU A;  4B3R Q;  2XWJ B;  4HJ9 A;  4NKL A;  2L55 A;  1T9H A;  3ERO A;  5IYC H;  3Q23 A;  1EQT A;  4GKJ Q;  2ZXP A;  3HOV G;  5JJI A;  3K5L A;  1CKN B;  1SAP A;  4ILW A;  2F0U A;  1HTL D;  2OQ0 A;  4PNY A;  5EKL A;  3OYY A;  1BVS A;  4RFB A;  3HOW H;  1TWG B;  1SYC A;  4LW1 A;  3W2D A;  2WII B;  1Q12 A;  1D5X C;  1S5C D;  5EKK A;  3GTL H;  3E9H A;  1Y1V H;  5FOB B;  3QG1 A;  3NE5 B;  3S9W A;  2KEE A;  3H15 A;  4RCO A;  1GOZ A;  1L1O A;  1DJR D;  2KHJ A;  3I70 A;  5IYB G;  4JOI C;  1TS3 A;  3TP5 A;  4KTA A;  1BCP F;  4DK0 A;  5CYU A;  5C4X B;  1QVF A;  4BY1 H;  2VS1 A;  1CA5 A;  2CW0 D;  1XTD A;  5EBC A;  2FMC A;  3OOC A;  1QOH A;  5CV4 A;  3H0G G;  4LAA A;  2K04 A;  4B08 A;  2F3W A;  1WCM G;  1O7I A;  1Y69 U;  3HKZ B;  3HRZ C;  4DFA A;  3Q22 A;  2OEO A;  4DR1 Q;  3F2D A;  3K5M A;  3OIQ A;  2JA8 H;  2MJ8 A;  4HSV A;  2XNA C;  3LX0 A;  4A3G B;  2VUM H;  1PHJ A;  3LNN A;  1MJC A;  3CPF A;  1A3T A;  4LF8 L;  4IUN A;  3LGJ A;  1H9S B;  3K80 C;  3D8G A;  4MNO A;  3CC7 A;  4GOP C;  1WI5 A;  2MUY A;  2MNA A;  4DV2 Q;  2NN6 H;  1S40 A;  2X69 A;  3QB3 A;  1EZ8 A;  2PYK A;  4LF7 L;  1XPR A;  3R2I A;  4DGZ A;  3KDF A;  5LMN L;  2R7Z H;  1EEI D;  3RLF A;  3KJO A;  4KD4 A;  1W3S A;  3GTG H;  4A3I H;  1YHA A;  2DNE A;  1BBX C;  3A5Z B;  5LL6 S;  3NXW A;  2EDG A;  4MIU A;  4ME5 A;  3SVM A;  1JT8 A;  2JA6 H;  1E1O A;  4QY7 A;  4APV A;  1KHI A;  3S17 H;  3M4O B;  4IFD J;  4YCU A;  3E0E A;  2JA7 B;  4JPB W;  1SE3 A;  1VS0 A;  3DWP A;  2CCZ A;  1NY4 A;  1TS4 A;  1N32 L;  3MFY A;  1NJI C;  1QVC A;  3T51 B;  4YWL A;  1Q86 C;  3STB C;  4ULL A;  5C4H A;  2Y0S E;  4CDF C;  3I4N B;  2CQO A;  2DY8 A;  1EWC A;  1LTL A;  3A55 A;  3ERQ A;  4JI8 Q;  1XMQ L;  2DJF C;  4OEM B;  2IT1 A;  4O2D A;  1F9S A;  4OIJ A;  4A3C G;  2XRQ D;  3E0J A;  4C3H G;  2IHE A;  2K5H A;  1ILQ A;  1DM0 B;  2VW9 A;  2ZXO A;  1NCV A;  1GUS A;  2E2I H;  2M9V A;  2XGT A;  2Q8R E;  1QUQ A;  1ET6 A;  1RIP A;  2C5C A;  1GXD C;  1JOR A;  3S1Q H;  4NPS A;  1EYC A;  4X3U A;  1K0R A;  4P74 A;  2JEA I;  4OO1 G;  3PUZ A;  4IN3 A;  4HJ5 A;  1VQD A;  3SK5 A;  4NMZ A;  3DEO A;  4R4I A;  4LF5 Q;  5JEA J;  4OO1 I;  1GM5 A;  2Z4H A;  3HOZ G;  1TS2 A;  1RKN A;  4N8F A;  1U4M A;  2BA0 A;  3K0Y A;  5AFW A;  4DUY L;  1EY5 A;  3VA7 A;  3HOY G;  1GD7 A;  3I4O A;  1A3U A;  1T5X D;  2SDF A;  1YNX A;  1SFO B;  2XTI A;  3HS0 C;  2L9H A;  4DV0 Q;  4L63 B;  3O13 A;  3FPP A;  2UU9 L;  3IFT A;  2HT1 A;  4JI0 Q;  1SYF A;  1C9O A;  1B9M A;  1HH2 P;  4J8Q A;  1N36 Q;  1Y8P B;  3PF4 A;  1OXV A;  3FMC A;  2R92 B;  1IBL Q;  1CM9 A;  4HJ7 A;  5I4D A;  1L0W A;  1VQP A;  1VQL A;  1BOS A;  3BS1 A;  3MEH A;  3RZO H;  3IKJ A;  1YHB A;  3KLS A;  4OEL B;  4NXM Q;  2SEB D;  1E24 A;  1SE8 A;  4ZUI A;  1TR5 A;  2L0C A;  3ER0 A;  4JI7 L;  4E6I A;  4K2K A;  4JI5 L;  3STB D;  4KD3 A;  1N33 Q;  5CBE E;  3WOF A;  1R4P B;  4IFD G;  1CHP D;  4V19 0;  3HOU B;  1Q90 A;  1LAC A;  1TS5 A;  1S72 A;  5ELO A;  1EFI D;  3RR5 A;  2CFM A;  4X3S A;  3S2D B;  3V2T A;  3FHW A;  1SNO A;  3MXP A;  4POG A;  2B2W C;  3TQY A;  2X6L A;  2LXJ A;  4ID6 A;  2Y0S B;  1X56 A;  3HOX G;  2NVY B;  1A0I A;  1L1O B;  1ILP A;  4L8J A;  1PH2 A;  2NTT A;  5CV7 A;  3U9O A;  2RCF A;  4KY7 A;  4DNT B;  4X64 Q;  1PYB A;  2I0Q A;  1D5Z C;  1TWF B;  5D65 A;  1EQQ A;  3EVQ A;  3K5N A;  1VCI A;  1X6O A;  4JI1 L;  4A3E B;  1YI2 A;  4HN7 A;  1EYD A;  1ZYR C;  1PFS A;  1JMC A;  1ESR A;  4JI4 Q;  1H9J A;  4IPG A;  1QWY A;  2A5H A;  1YJN A;  2A8V A;  4GNX A;  1UAP A;  1F77 A;  1LT3 D;  2MO0 A;  5JVH 3;  4FF3 A;  3A8I E;  2NVT H;  3W1B A;  3HEJ A;  4IQZ A;  1ONL A;  2L11 A;  5IGD A;  3B6Y A;  5JEA G;  3OPO A;  3I56 A;  1TXY A;  4IJH A;  3J81 E;  4C3I B;  5DM6 3;  3BZK A;  4KKT A;  5IT9 c;  2VB2 X;  3DWQ A;  2HQL A;  3PO3 B;  4MTK A;  2UXD L;  3P20 A;  5COR A;  4LMQ D;  1CA6 A;  3K0X A;  4DUZ L;  3KDF B;  3J81 i;  5C4J B;  3AYH B;  3AB9 A;  1HPC A;  4DV3 L;  2QDL A;  1XWE A;  2ZT9 C;  5FK9 C;  2AUJ D;  1PTO C;  1OO9 B;  2F0F A;  2RQX A;  2OF1 A;  2F0S A;  2J4X A;  2WB1 G;  1K3B C;  4XIG S;  2RKS A;  4X65 Q;  2YV5 A;  1Z7T A;  5C0X I;  2F0I A;  1EWH A;  1FD7 D;  4IUU A;  1OXU A;  4HCE A;  4LF4 Q;  4UAI A;  1ASY A;  3FVQ A;  4LFA Q;  3LWU A;  4WJ3 M;  2UUB Q;  4KKU A;  4DV7 L;  5LMN W;  3T53 B;  4F8M A;  3BJU A;  1C8C A;  1UWV A;  4QF4 A;  1GHJ A;  2FFK B;  3M9B A;  1ML0 D;  3H0G B;  4QIW E;  2UUC L;  4QL5 A;  5I6Y A;  4KLK A;  2B29 A;  2VNU D;  2K32 A;  2ID0 A;  2IW3 A;  2ALY B;  4GN5 A;  1G6P A;  2J7Z A;  2NZH A;  1QUQ B;  4DXF A;  5LMU L;  4R4C A;  1X54 A;  4AIM A;  3SK4 A;  1WFQ A;  5DM7 3;  2DNC A;  3CAM A;  1S5B D;  4B3M L;  1AW7 A;  1D8L A;  1TWC H;  4S3S A;  3AQQ A;  3DLL A;  4JI6 Q;  4FF1 A;  3I7F A;  4DR3 L;  1XPU A;  2N88 A;  2K75 A;  2Z8L A;  2A6H D;  4LF6 Q;  1QB5 D;  2WP8 J;  5IGF A;  1ZYR D;  3MZ5 A;  4BY7 G;  1WTQ A;  2L15 A;  2B2Y C;  3P1H A;  1BCP B;  1F2Z A;  1HUM A;  3GP7 A;  2CQA A;  5IE8 A;  3CCQ A;  3CC2 A;  4BBR B;  3EN2 A;  3EBE A;  1SE2 A;  4FDB A;  4HSP A;  2F0J A;  2VQF L;  1EIY B;  1VQC A;  1VQG A;  3J7A F;  5C4X G;  3MTS A;  3S15 H;  2JYO A;  1SSO A;  2Z6K A;  3JAM c;  1EY6 A;  1O7L A;  2OTL A;  4KY5 A;  3IL8 A;  3I3C A;  1DOL A;  1MGS A;  3HKZ G;  2BOS A;  2XWB B;  4KV6 A;  4LF8 Q;  4DR4 L;  3TZD A;  4A3F H;  1JCK B;  4A3B H;  4A3G G;  4FXD A;  3J81 j;  1NR4 A;  2F0V A;  3FKI H;  5C44 H;  2MHV A;  3F1Z A;  1PTO D;  5FLX E;  5LMN Q;  2PNR C;  3I2Z A;  1CI3 M;  2AWN A;  3CRL C;  2UUA Q;  5KNB A;  4ZKB B;  1JJC B;  1H9M A;  2JEB I;  1EUJ A;  4R8N A;  4A3J H;  4DKA C;  4PG3 A;  1Q46 A;  1ENA A;  2IL8 A;  4A3L G;  1N32 Q;  1WJJ A;  5LL6 X;  2LS0 1;  2NB0 A;  3ONA B;  2PW5 A;  3QWN A;  4IZ8 A;  2CHB D;  2F3V A;  1F2M A;  1XMQ Q;  1XX8 A;  3OIP A;  1B2T A;  1EU4 A;  1A2U A;  3BU2 A;  1K73 C;  3A8K E;  3T13 A;  3HZX A;  3U9S A;  2D2C C;  2EY6 A;  2MPM A;  3I4N G;  3ND9 A;  2B2U A;  5I9P A;  2R93 H;  4DR7 Q;  2VXW A;  3N52 A;  3A7L A;  4IPD A;  2E5L L;  1JOK A;  2OCE A;  4H44 C;  4LUV A;  4FO2 A;  4QIW B;  5J3B A;  2WB1 E;  4ABN A;  2G9H D;  3NQI A;  3T56 B;  4BXX G;  3M3Y B;  4A4I A;  2B8G A;  1P16 A;  3HOV H;  1XMO L;  3CHB D;  4P71 A;  4PZ7 A;  5IP9 G;  3OTO Q;  1VQ6 A;  2IX0 A;  2PZT A;  2JJQ A;  3DM3 A;  4HAE A;  3SEB A;  3Q6S A;  3L2P A;  4GNX B;  1S5D D;  2JN4 A;  2JK8 A;  3J80 L;  3K5O A;  3RZD H;  2V1C C;  4H0L C;  1CSP A;  2KEC A;  4QUF A;  5JAV A;  2KA7 A;  3OMC A;  1B9N A;  4NXN L;  4DV6 L;  4C2M H;  1N8R C;  4PMW A;  1EYG A;  2A68 C;  3C1F A;  4DUY Q;  1DOK A;  3CCE A;  4GLA C;  5IYB H;  4HCS A;  3TRE A;  2K28 A;  1X3F A;  5HGT A;  4IUR A;  4N9T A;  3H09 A;  4XQJ A;  3TDQ A;  3GTO H;  1FJG L;  3H3V H;  2KED A;  3PO2 B;  3T1H Q;  4JI3 L;  1D2B A;  3RNU A;  4R8I A;  1WCM H;  3QOL A;  2FXQ A;  2BA1 A;  2K5V A;  1WTV A;  2R6G A;  2QF7 A;  4LF9 Q;  5IOD A;  1RJT A;  1QCB D;  2EJG C;  4JK1 C;  2NVQ B;  1BXT A;  3TS2 A;  2R92 G;  1E1T A;  3K7A H;  2VY3 A;  4KJN A;  2PPB C;  2UXC Q;  3X3M A;  4QMG A;  2VUM B;  2XRS D;  5M5W B;  3OHX C;  5BN4 A;  1I3Q B;  1PYS B;  3I55 A;  4JI7 Q;  2WAQ B;  1EIG A;  4JBK A;  4HID A;  2N55 A;  3HKZ E;  4DR6 L;  3HG9 A;  2F4V L;  1VF5 C;  2ZJP A;  5M3M B;  4J15 A;  4JYA L;  1VQO A;  1DZ1 A;  3T1Y L;  1VQI A;  4OWX B;  2HDM A;  2PQA A;  5FLM H;  2V4D A;  1VQE A;  2CW0 C;  1TWH B;  3HOU G;  1CFM A;  1HXY D;  4P73 A;  3J81 L;  1B3Q A;  3UDF A;  5A2Q E;  2JA6 B;  1PRT D;  2E8G A;  2Z1C A;  4X3K A;  2MFI A;  3PUV A;  1KD1 C;  3SGI A;  2JSO A;  3KLR A;  2R3Z A;  5EPL A;  1RF2 D;  3D6W A;  5F2D A;  1G91 A;  3TS0 A;  3GTP H;  3S1M H;  4C3J B;  4XTC S;  4A3C H;  1IL2 A;  1K83 H;  1R4Q B;  1SEB D;  4KMU C;  1L0Y B;  4C3H H;  1HJP A;  1QVG A;  1PYW D;  5FJ8 H;  4JOI A;  3E9I A;  3BVG A;  2WB1 B;  4A3E G;  1OXS C;  1STE A;  4HMJ A;  1LT5 D;  2FMM A;  3EA6 A;  3ND8 A;  1LAB A;  3DHQ A;  4GN4 B;  2IX1 A;  4RA8 A;  2WKD A;  1STG A;  1Q1B A;  3H94 A;  4FXK C;  3PUW A;  1VF7 A;  1PH1 A;  3S16 B;  5E4X A;  3CQZ B;  5BR8 L;  5FO9 B;  4MN3 A;  5E7N A;  2UXD Q;  3M7N A;  1O80 A;  3HOZ H;  3VDY A;  3CCJ A;  5C3E G;  4A3K G;  4C3I G;  4IUV A;  1O7Z A;  4DV3 Q;  4RKL A;  1VMC A;  1WTH A;  3PO3 G;  2NVX B;  4GOP A;  1L0X B;  1VQ7 A;  3HOY H;  1YNN D;  1LTA D;  4Y7N B;  5L37 A;  1FGU A;  5H1S E;  4JVZ A;  2N49 A;  1O78 A;  1BF4 A;  1QE6 A;  3RN2 A;  4LFB Q;  2Z4I A;  4BY7 B;  4L5T A;  5IIF A;  4G4K A;  1F9P A;  4DV7 Q;  4UHV A;  1I94 L;  4RGM A;  1UNS A;  1ENF A;  4R9W A;  2UUC Q;  1I4G A;  3PSI A;  1PVO A;  3LWE A;  1LT4 D;  3H6M A;  1CSQ A;  1H9K A;  3KBG A;  3E6Z X;  2KCM A;  4ZQ3 A;  1IW7 D;  3GTJ H;  5LMU Q;  1R9T H;  2E2J H;  4PMC A;  1VQF A;  1S4Z A;  1QJO A;  4DV4 L;  3ZYY X;  3KF6 A;  3F8T A;  2C35 B;  4J6H A;  2ASB A;  1BR9 A;  4IFD H;  2I5H A;  3PIP 3;  4DV5 L;  1PFM A;  4PV1 C;  3CCS A;  2NBF A;  2WV6 D;  1V8Q A;  4DR3 Q;  5C6A A;  1VMP A;  4C1N I;  2Z9H A;  2PZW A;  1HFN A;  2LFN A;  1IKM A;  1JE4 A;  5FLX L;  4ZCK A;  1UE1 A;  1DGS A;  3HOX H;  1TKW B;  4R4O A;  4BA1 I;  3NSW A;  2KUM A;  1STA A;  1STB A;  2F4I A;  2Q2H A;  1E2V A;  2WKC A;  4BBR G;  3D4W A;  2L1B A;  3GTQ H;  3OWF A;  5JVG 3;  3PUX A;  4L5Q A;  5CV9 A;  5ELD A;  4X66 L;  1SRU A;  4HED A;  4JI2 L;  1JOQ A;  3S14 H;  1EY0 A;  5JEA H;  4R4Q A;  2XIW A;  4O42 A;  4QUC A;  4DAY A;  1O7Y A;  3RLN A;  4Q5V A;  2IWH A;  2VQE Q;  1E3P A;  3OW2 A;  2EYM A;  4DR2 Q;  1IZ6 A;  1BDO A;  4ZAI A;  1YHQ A;  1I6V C;  1E2W A;  1EQV A;  4OL7 A;  5IWA L;  4DV1 L;  3T4A C;  4OX9 L;  1LTR D;  1U5K A;  1PLF A;  3GTK B;  1X55 A;  5J1Z A;  3K57 A;  5IP7 G;  2EE1 A;  1EEF D;  1QIL A;  2PQA B;  5EAY A;  1BUV T;  3RMH A;  2ES2 A;  4DAV A;  4U67 3;  2ATW A;  2SOB A;  5M5Y H;  2JA5 G;  1X65 A;  3TME A;  3GTM B;  1QNU A;  4LJZ C;  1Q8K A;  1TWA B;  4K0K L;  1LT6 D;  3RD4 A;  1FYC A;  1YIJ A;  2KHS A;  2AQ3 B;  2B2W A;  1CK1 A;  3EQL C;  2O2L D;  3K58 A;  1P8L A;  3D31 A;  4B9X A;  1XMO Q;  2EOT A;  5CR3 A;  3G4S A;  3G6E A;  2UXB L;  1U4P A;  2F0M A;  2PW7 A;  4KN7 C;  4C1N K;  2Q2T A;  1I4P A;  5D3I B;  2F0P A;  3CP0 A;  5M3F G;  4A3M B;  1A63 A;  2ZXR A;  1DYQ A;  5M5X B;  5C0X J;  4KHP Q;  3KBX A;  2RDH A;  1LTI D;  1PV4 A;  4V0B A;  3J80 E;  1XXG A;  1TWG H;  1L2F A;  4OIK A;  5HUR A;  2WFW A;  1STY A;  4NXN Q;  4DV6 Q;  2PMZ E;  3M4P A;  4ZLT F;  4LNQ A;  4K14 A;  4A3D H;  4CJ1 B;  4A76 A;  3J80 i;  3PCO B;  1EY8 A;  1LTG D;  4TQU S;  1F9R A;  4B3T Q;  1D1K A;  4PZ8 A;  1KTK A;  2LSS A;  1HUN A;  2K1B A;  2EXZ A;  4GOP B;  5CGK A;  3M4Q A;  3H3V C;  4YY3 Q;  5C4X H;  1NMF A;  1SE4 A;  4NDX A;  4AQY L;  3GV6 A;  1HQM C;  4KJO A;  5A2Q L;  1K28 A;  1XPO A;  1BBW A;  2KHI A;  3PO2 G;  1EWI A;  4BY1 G;  1HFG A;  5EPK A;  4I7A A;  1Q7Y C;  1HA6 A;  4G7H C;  1E22 A;  3L0O A;  3CRK C;  2MGS A;  4QGU A;  4A3G H;  4X62 L;  4K6L A;  1EIH A;  3K7U C;  1M8A A;  2ZTD A;  1UEB A;  2VUM G;  2A6H C;  2EY1 A;  2JE6 I;  2N8N A;  2PI2 A;  2HIX A;  2F4V Q;  3W3A A;  4JYA Q;  4P72 A;  2ICE C;  2WAQ G;  5ELC A;  5G3L D;  3KF6 B;  2B8F A;  2X6G A;  1HNZ L;  3FEW X;  4DPG A;  4CDD C;  1Q82 C;  4A3L H;  5M3M G;  2R7Z G;  1WTO A;  3AEV A;  2EYJ A;  5EGT A;  2NN6 I;  3M4O H;  1SYB A;  3T16 A;  2JA7 H;  3A54 A;  5C3E B;  1C7Y A;  4A3K B;  5EJW A;  2JA6 G;  3A8J E;  2I07 B;  1HCZ A;  1YVC A;  3U50 C;  4GKK Q;  3I4N H;  2LXK A;  4FF4 A;  3OTO L;  4BBS B;  5IT9 L;  2ZM6 L;  5BN3 A;  2PO4 A;  5T1G A;  4C3J G;  4YHH L;  2B2Y A;  3BZD B;  3VYT A;  4JBJ A;  1MD2 D;  1D7Q A;  5K5P A;  2L4N A;  4JC0 A;  4RHS A;  3S1N B;  3M85 A;  5C0X G;  4PMB A;  3KUP A;  5ELB A;  3DWA A;  3J7Y W;  5BR8 Q;  4B3R L;  4XQN A;  1EYA A;  1EL0 A;  1I5F A;  2PCF B;  2Q8I B;  4DAY B;  2PMZ B;  4HIO A;  4LFC L;  3RZD B;  1S3O A;  1II3 A;  1EIF A;  1W2B A;  1FVI A;  4K5V A;  4J1M A;  1LLR D;  2F0E A;  3C2P A;  1SYG A;  1SMX A;  3BDL A;  4L5S A;  1JWU D;  2B2T C;  1AN8 A;  2HDL A;  2CH4 W;  1ICF B;  3F2B A;  2YYZ A;  1I50 B;  2QDB A;  4CHT B;  4TVA B;  1CZG A;  1WTX A;  1SFO H;  5I6W A;  2K5D A;  2A6E C;  3HFZ B;  3DUZ A;  1PXU A;  2D0P A;  3BVM A;  1BCP D;  2EVB A;  4JBM A;  3CME A;  2F0Q A;  2R92 H;  1MI2 A;  1I6H B;  4K8I A;  3NTK A;  1Y1W B;  3U4V A;  1B50 A;  2VL6 A;  1IHZ A;  2LKV A;  3FDT A;  1PFN A;  5DLQ E;  2A74 C;  1SDF A;  4HMI A;  2EYO A;  4DV5 Q;  4R4T A;  4F7X A;  1KAW A;  1UE5 A;  3A5U A;  2N78 A;  3S1R B;  3ULP A;  3UI2 A;  1SLJ A;  1GUO A;  1Z9F A;  4ZK9 B;  3I4M H;  3KLW A;  3BDO A;  1K8O A;  2H1E A;  4RCN A;  2HD3 A;  4DV2 L;  3HOU H;  3I4L A;  1PH6 A;  5GRO A;  5K36 G;  1G51 A;  3S2D H;  4LF7 Q;  1XYI A;  3G48 A;  1CKO A;  2WAQ E;  4HJA A;  5KEE A;  2A19 A;  3M4Y A;  1HTP A;  4A93 B;  3DM1 A;  4UY8 C;  2RVL A;  3PIO 3;  1CTM A;  2A1A A;  4QJF A;  1HA5 A;  2F0L A;  2R7D A;  2RDF A;  1CHQ D;  1Y8N B;  1AZQ A;  3A7A B;  4QQB X;  1IYV A;  3S2H B;  1K83 B;  1TWF H;  4DAM A;  4CDC C;  4TKO B;  1X3G A;  1JIC A;  4X66 Q;  2JA5 B;  3MXU A;  4JI2 Q;  1KNA A;  1MJE A;  1QZG A;  2B63 B;  1K3R A;  1PTO B;  4KY6 A;  1PH4 A;  2FJ2 A;  1WD1 A;  3PIP A;  4DF7 A;  4FVM A;  5BN5 A;  3D0F A;  1YJ9 A;  3ULJ A;  4DK6 C;  1PH9 A;  4FYD A;  1KC8 C;  2F0T A;  2A69 D;  1PRT C;  1EOT A;  4EQ5 A;  1OXX K;  1KRS A;  4FNF A;  1RCV D;  5A35 A;  5KND A;  2K05 A;  4OX9 Q;  2OTJ A;  5M3F B;  4K8J A;  5DAU A;  3PO3 H;  2A6E D;  2DJG C;  1HQR D;  2M00 A;  2JP1 A;  1QZH A;  2NWG A;  1FL0 A;  3UE1 A;  5C4J H;  2A73 B;  3HGB A;  3PV0 A;  1KLG D;  2HHH L;  1VQM A;  1U9R A;  1PH8 A;  3AFP A;  1YNJ D;  1OTC A;  1VQA A;  3E5S A;  5GQO A;  3HOW B;  2DY7 A;  3X3N A;  3BVZ A;  3HKS A;  3VR4 A;  1E2Z A;  5IGE A;  2HUG A;  3P75 A;  3GTL B;  1HZB A;  1Y1V B;  5E4W C;  3BYT B;  3I91 A;  4AYB B;  4GLV B;  1IL8 A;  2SNM A;  3CCU A;  3L7Z C;  4EGV A;  3NTI A;  4KI0 A;  1G29 1;  3CD6 A;  1PH7 A;  2BDN A;  2H5X A;  4FF2 A;  4UP8 A;  1I4R A;  4GS3 A;  5D3D A;  2UU9 Q;  3CCL A;  5JOB A;  3H0G H;  4BY1 B;  3AFQ A;  2JXM B;  5IY0 A;  1Z6H A;  2JA9 A;  2E2H H;  1B70 B;  3I73 A;  1XNR L;  4POF A;  1TY2 A;  2B2V C;  1SJH D;  4A3M G;  1WVL A;  1YNN C;  1V1P A;  4XYO A;  3R93 A;  2JA8 B;  2KCC A;  5JPN C;  5J39 A;  1M90 C;  4XQQ A;  2LY7 A;  3R2T A;  4DAP A;  4EVO A;  3EIV A;  5KNC A;  3ICE A;  3TP8 A;  4QCL A;  3UDX A;  4CBV A;  4JI5 Q;  3KYH C;  3NP8 A;  3RUZ A;  1M4V A;  1SNM A;  2EY5 A;  1KAA A;  1NUC A;  1GJX A;  1S5E D;  1D5M C;  4BBR H;  4OWW B;  2R7Z B;  3GTG B;  4A3I B;  4DK3 C;  1YIT A;  4LK1 C;  4TRD A;  2N3S A;  5CV5 A;  1IW7 C;  3VA5 A;  3GTQ B;  1HR0 L;  3S17 B;  3WOE A;  4LWC A;  4IUT A;  4X62 Q;  2QGQ A;  3QR8 A;  1TQO A;  1VQK A;  2BH8 A;  3DXJ C;  3PUY A;  3MHB A;  2NZ1 D;  4DN4 M;  1EQR A;  4JI1 Q;  4WFN 3;  1JJ2 A;  1JOO A;  1RTO A;  5IOC A;  1E0B A;  4A3B G;  3QJY A;  1VQH A;  2QEX A;  1SRO A;  1CQF A;  5C44 G;  3CMA A;  5IP7 H;  1W6K A;  2KEN A;  3NEM A;  4EQP A;  2E2I B;  1HNW L;  2YU9 H;  4OON A;  3VR5 A;  1RD9 D;  3TBI B;  4JCV E;  1STN A;  4OO1 H;  1N34 L;  1GHK A;  1LV9 A;  3S1Q B;  1SJE D;  3G6J B;  2DUD A;  4A3J G;  2DN8 A;  4DUZ Q;  4O1N A;  1F2L A; 
#chains in the Genus database with same CATH homology
 2ZM6 Q;  4BBS H;  4DV3 L;  1PA6 A;  2ATW A;  4LF5 L;  5M5Y H;  3KOJ A;  1HNX Q;  1KL9 A;  2JA5 G;  1X65 A;  4IOA A;  2GVB A;  1Q8K A;  5HGQ A;  4K0K L;  1UE6 A;  4PZ6 A;  5GAH C;  2WB1 G;  2JQO A;  2Z6K C;  1K8G A;  4BBS G;  4K0K Q;  4R1J A;  4XIG S;  1YIJ A;  3S1N H;  4X65 Q;  2YV5 A;  1HZA A;  2GN5 A;  2R93 G;  5C0X I;  2ZJQ A;  5GAE C;  5AJ3 Q;  4IPC A;  3J80 c;  3M3Y H;  1OXU A;  1P8L A;  2DGY A;  4LF4 Q;  3D31 A;  1XMO Q;  4LFA Q;  1OXT A;  1ASY A;  4WJ3 M;  3G4S A;  4DV0 L;  2NZO A;  2PNH A;  3GD7 A;  4DV7 L;  5LMN W;  3G6E A;  2UUB Q;  4JG2 A;  2UXB L;  1NTG A;  2Q2T A;  3BJU A;  1V1Q A;  4JI0 L;  1UWV A;  4LFC Q;  2UXB Q;  3CP0 A;  5M3F G;  3CF5 A;  1AE2 A;  3M9B A;  4QIW E;  3W1G A;  4YCV A;  2QA4 A;  1N36 L;  1JB7 A;  4QL5 A;  2UUC L;  4B3S L;  4KHP L;  1A63 A;  4KLK A;  4H02 A;  2B29 A;  1IBL L;  2VNU D;  3IRB A;  5C0X J;  4KHP Q;  2ID0 A;  3ULL A;  2ALY B;  1YEZ A;  3PGZ A;  1PV4 A;  1YBY A;  2R7F A;  1E7Z A;  1L2F A;  1TWG H;  4GN5 A;  2WFW A;  1G6P A;  2NZH A;  1QUQ B;  2KBN A;  4DUZ Q;  5LMU L;  4R4C A;  1X54 A;  2PMZ E;  4AIM A;  1LM0 A;  4DV6 Q;  1WFQ A;  3M4P A;  3CAM A;  4LNQ A;  1V43 A;  4MZ9 A;  4NXM L;  5ELN A;  3CCM A;  4A75 A;  4IJL A;  4B3M L;  4JI6 L;  1D8L A;  1I50 H;  1TWC H;  2EQS A;  2BH2 A;  4A3D H;  4A76 A;  3AQQ A;  3DLL A;  3J80 i;  4B3T L;  3PCO B;  4B3M Q;  4JI6 Q;  1XNQ Q;  1Y14 B;  2I5M X;  2Z0S A;  3I7F A;  4DR3 L;  1XPU A;  4LF6 L;  4TQU S;  3A74 A;  4B3T Q;  4PZ8 A;  3JC6 6;  2K75 A;  1N33 L;  2HIV A;  2LSS A;  1JE5 A;  2D62 A;  4LF6 Q;  2K52 A;  2WP8 J;  3KF8 B;  4YY3 L;  4GOP B;  3M4Q A;  4BY7 G;  1K9M C;  3PO2 H;  3PF5 A;  4YY3 Q;  2L15 A;  1GKH A;  5C4X H;  2Q2U A;  1NMF A;  1VQJ A;  5IE8 A;  3CCQ A;  3CC2 A;  4IPH A;  4AQY L;  3EN2 A;  3J7A 5;  4UP7 A;  3EBE A;  1XPO A;  1BBW A;  4AQY Q;  1B8A A;  2KHI A;  2YTX A;  1EWI A;  1Y1W H;  4BY1 G;  3H3V I;  3PO2 G;  4FDB A;  2VZA A;  2VQF L;  1EIY B;  2NVQ H;  1VQC A;  1VQG A;  5C4X G;  1JT8 A;  1EOV A;  2VQF Q;  1Q7Y C;  1KXL A;  1J6Q A;  3S15 H;  3U4Z A;  5FLX c;  2Z6K A;  5IYD H;  3JAM c;  4EX5 A;  2OTL A;  2AKW B;  5HY6 A;  1Y1W G;  5M5W H;  1E22 A;  3L0O A;  1AE3 A;  4QGU A;  1CUK A;  1U0L A;  1I3Q H;  4X62 L;  4X64 L;  1VQN A;  4A3G H;  3HKZ G;  3S1R H;  3K7U C;  4LF8 Q;  1VQ9 A;  4DR4 L;  1Z47 A;  2YTV A;  3RN5 A;  4A3F H;  2ZTD A;  5IYD G;  1UEB A;  1PH5 A;  4DR4 Q;  1IXR A;  2VUM G;  2ZTC A;  2JE6 I;  2PI2 A;  2N8N A;  4YWK A;  2HIX A;  4JI4 L;  2F4V Q;  3J81 c;  4A3B H;  4JYA Q;  4A3G G;  5M3M H;  3CCR A;  1IYJ B;  3FKI H;  3J81 j;  2ZJR A;  5C44 H;  2K4K A;  3I4M G;  4P72 A;  2WAQ G;  3F1Z A;  1UE7 A;  5LMN Q;  3KF6 B;  3MEF A;  3I2Z A;  4A3F G;  1VQB A;  1HNZ L;  1NBW A;  2AWN A;  2UUA L;  1IBM Q;  1TWH H;  4AH6 A;  4DPG A;  1HNZ Q;  1Q82 C;  2UUA Q;  4A3L H;  5M3M G;  3FKI G;  2R7Z G;  2K5N A;  3AEV A;  5FLM G;  4A93 H;  2NN6 I;  1JJC B;  2MO1 A;  2JEB I;  4ALP A;  3M4O H;  1L1O C;  3JAM i;  1J5E Q;  1EUJ A;  2F52 A;  4A3J H;  1VQ5 A;  4DKA C;  2Y0S G;  2JA7 H;  4JV5 L;  5JJL A;  4PG3 A;  1Q46 A;  1C7Y A;  4A3L G;  1N32 Q;  1NMG A;  4YCW A;  4DR5 L;  2JA6 G;  1WJJ A;  3S2H H;  4GKK L;  4OXP A;  2RHQ B;  3NBH B;  4C3J H;  4A93 G;  1YVC A;  3U50 C;  3WWV A;  3I4N H;  4GKK Q;  2LXK A;  2JA5 H;  2OQK A;  3OTO L;  1XMQ Q;  5GAD C;  2ZM6 L;  1VQ4 A;  2B63 H;  3BU2 A;  1HNX L;  2IHF A;  1K73 C;  4YHH L;  5FJ8 G;  3I4N G;  3Q8D A;  4DR7 L;  1ASZ A;  4YHH Q;  4OWT B;  2R93 H;  3TRZ A;  2AHO B;  4JBJ A;  3W5O A;  4DR7 Q;  1D7Q A;  4IPD A;  2E5L L;  2OCE A;  4JC0 A;  4LUV A;  4HJ8 A;  2B63 G;  3M85 A;  4X65 L;  5C0X G;  2E5L Q;  1KRT A;  5J3B A;  2WB1 E;  4LUO A;  4O0A A;  1PH3 A;  4BXX G;  2ZTE A;  3MXN B;  2B3G A;  5AJ3 L;  1BBU A;  4A4I A;  1P16 A;  4LF4 L;  3HOV H;  2K50 A;  4PZ7 A;  4P71 A;  4YWM A;  5BR8 Q;  5IP9 G;  3CQZ H;  2IX0 A;  5M3F H;  1XMO L;  2UUB L;  4LFA L;  2JJQ A;  3DM3 A;  4GN3 B;  1I5F A;  3CPW A;  4B3R Q;  3L2P A;  4GNX B;  4HJ9 A;  1N9W A;  4DAY B;  1T9H A;  4HIO A;  4LFC L;  2D0O A;  4WJ4 A;  1S3O A;  2JK8 A;  5IYC H;  1EIF A;  2HHH Q;  1W2B A;  4BA2 I;  3HOV G;  4GKJ Q;  2IY5 B;  5JJI A;  4RMF A;  3RZD H;  2V1C C;  1FVI A;  3A0J A;  1I6H H;  1CKN B;  1HR0 W;  2NVX H;  2OQ0 A;  4LUZ A;  4DNI A;  3PIO A;  1C0A A;  1CSP A;  3OYY A;  1BVS A;  3HOW H;  1SMX A;  4LW1 A;  5IYC G;  4L5S A;  1Q12 A;  4NXN L;  2AWO A;  1X3E A;  4DV6 L;  4C2M H;  4Y7N H;  1N8R C;  4PMW A;  1EYG A;  4X6A H;  4DUY Q;  3CCE A;  3GTL H;  4GLA C;  3E9H A;  5IYB H;  3GO5 A;  3TRE A;  1Y1V H;  3F2B A;  2YYZ A;  2OWO A;  3HOW G;  1X3F A;  2RCN A;  3BZC A;  3KJP A;  4BY7 H;  1XNQ L;  4TVA B;  3GTO H;  3H15 A;  1SFO H;  1AH9 A;  2I5L X;  1BKB A;  1L1O A;  1Q1E A;  2KHJ A;  3T1H L;  3HFZ B;  5IYB G;  4JOI C;  1FJG L;  2D0P A;  1Y1V G;  2YTY A;  3H3V H;  4Y52 H;  4AYB G;  3T1H Q;  1FJG Q;  4JI3 L;  3G71 A;  3RNU A;  3FP9 A;  1WCM H;  1QVF A;  2FXQ A;  2BA1 A;  4BY1 H;  2K5V A;  3CME A;  4JBM A;  4JI3 Q;  2R92 H;  2VS1 A;  4LF9 L;  2R6G A;  1XTD A;  1LYL A;  1XNR Q;  4LF9 Q;  3H0G G;  3RLO A;  3U4V A;  2VL6 A;  1WCM G;  1O7I A;  5DLQ E;  3TS2 A;  2UXC L;  2R92 G;  1KQS A;  1E1T A;  1HZ9 A;  3K7A H;  2VY3 A;  4DR1 Q;  2UXC Q;  3F2D A;  2JA8 H;  3J7Z C;  1CKM A;  3S24 A;  4DV5 Q;  2K14 A;  1EFW A;  4R4T A;  3A5U A;  1KAW A;  1UE5 A;  1IBK L;  2N78 A;  1PYS B;  1PHJ A;  3I55 A;  4JI7 Q;  3UDI A;  3CC4 A;  3UE0 A;  2VUM H;  1MJC A;  3CPF A;  1VQ6 A;  3ULP A;  4LF8 L;  1SLJ A;  3LGJ A;  2JA8 G;  1Z9F A;  3K80 C;  3I4M H;  4JBK A;  3KLW A;  4MNO A;  3CC7 A;  4GLX A;  1KIX A;  4DV2 L;  4HID A;  4GOP C;  3HKZ E;  3HOU H;  4DR6 L;  1PH6 A;  2F4V L;  2ZJP A;  1WI5 A;  2MNA A;  4IFD I;  1GO3 E;  4DV2 Q;  4J15 A;  5GRO A;  4DR6 Q;  4JYA L;  1VQO A;  1S40 A;  3T1Y L;  1VQI A;  4LF7 L;  4OWX B;  5K36 G;  1XPR A;  5LMN L;  3KDF A;  4IOC A;  2PQA A;  1G51 A;  3T1Y Q;  2R7Z H;  3S2D H;  5FLM H;  4LF7 Q;  3RLF A;  1VQE A;  1SN8 A;  3KJO A;  1IBM L;  3HOU G;  1W3S A;  3GTG H;  4A3I H;  1YHA A;  3G48 A;  4P73 A;  1CKO A;  2WAQ E;  4ME3 A;  3UDF A;  3A5Z B;  4HJA A;  2NN6 G;  2A19 A;  2E8G A;  2MFI A;  3PUV A;  1KD1 C;  1VQ8 A;  1WOC A;  2CKZ B;  1M1K C;  1HR0 Q;  4UY8 C;  3SGI A;  1E1O A;  2CWP A;  2A1A A;  4QJF A;  1KHI A;  4QY7 A;  4APV A;  2JA6 H;  3S17 H;  4IFD J;  4YCU A;  2R7D A;  3E0E A;  1J5E L;  3TS0 A;  4A3I G;  1VS0 A;  2CCZ A;  3GTP H;  1NY4 A;  4QQB X;  1N32 L;  1NJI C;  1QVC A;  1TWF H;  1Q86 C;  4YWL A;  3S1M H;  3STB C;  5JJK A;  4XTC S;  4DAM A;  2Y0S E;  1X3G A;  4A3C H;  2CQO A;  1IL2 A;  1K83 H;  4X66 Q;  1RL2 A;  4JI2 Q;  4C3H H;  1HJP A;  1QVG A;  3KFU A;  2F3I A;  1LTL A;  5FJ8 H;  1MIU A;  4JI8 Q;  1XMQ L;  1MJE A;  4JOI A;  1QZG A;  3E9I A;  1LUZ A;  1K3R A;  2IT1 A;  4O2D A;  1PH4 A;  4A3E G;  1OXS C;  4A3C G;  3PIP A;  3GDE A;  3D0F A;  2IHE A;  2CWA A;  4BXX H;  1H95 A;  2K5H A;  2VW9 A;  4GN4 B;  1YJ9 A;  3ULJ A;  4DK6 C;  1PH9 A;  1SR3 A;  1KC8 C;  5IP9 H;  2IX1 A;  1HNW Q;  1Q1B A;  2E2I H;  4EQ5 A;  1WYD A;  2XGT A;  1OXX K;  1KRS A;  1QUQ A;  3PUW A;  1RIP A;  1PH1 A;  4OX9 Q;  2OTJ A;  4B3R L;  3TEH B;  5BR8 L;  1N34 Q;  5E7N A;  3GTK H;  3PO3 H;  3S1Q H;  2UXD Q;  3M7N A;  2EXD A;  4NPS A;  3CW2 C;  3HOZ H;  1QZH A;  3VDY A;  1K0R A;  4P74 A;  3CCJ A;  2JEA I;  4OO1 G;  1FL0 A;  3PUZ A;  3UE1 A;  5C3E G;  4HJ5 A;  5C4J H;  4A3K G;  1VQD A;  3PV0 A;  4GKJ L;  2HHH L;  4DV3 Q;  3F2C A;  4R4I A;  1VQM A;  4LF5 Q;  1PH8 A;  5JEA J;  3PO3 G;  3AFP A;  4GOP A;  1OTC A;  1VQA A;  4OO1 I;  1GM5 A;  1VQ7 A;  3GTM H;  3HOY H;  3HOZ G;  5GQO A;  3ZJY C;  2PI2 E;  1TWA H;  3HKS A;  1X9N A;  1FGU A;  5H1S E;  2BA0 A;  1HZB A;  4DUY L;  4LFB L;  1YZ6 A;  2N49 A;  1NE3 A;  3RN2 A;  3HOY G;  4LFB Q;  1GD7 A;  4GLV B;  3I4O A;  3CCU A;  4L5T A;  3L7Z C;  1YNX A;  4KI0 A;  2XTI A;  3U58 A;  4DV0 Q;  1G29 1;  3CD6 A;  4DV7 Q;  1PH7 A;  2H5X A;  1A8V A;  2UU9 L;  4MTN A;  1I94 L;  4UP8 A;  2HT1 A;  4JI0 Q;  4GS3 A;  4UPA A;  1XJV A;  2UU9 Q;  3CCL A;  1C9O A;  4GNX C;  1I94 Q;  2UUC Q;  4A3M H;  1HH2 P;  1N36 Q;  4B3S Q;  3H0G H;  3PF4 A;  1OXV A;  3AFQ A;  1A62 A;  3K8A A;  5IY0 A;  1JJG A;  1IBL Q;  3PSI A;  4RG1 A;  1PVO A;  2JA9 A;  4AYB E;  5M5X H;  4HJ7 A;  1CSQ A;  2E2H H;  1B70 B;  1XNR L;  3CCV A;  4POF A;  2KCM A;  1L0W A;  1VQP A;  1VQL A;  3GTJ H;  1IBK Q;  4A3M G;  5LMU Q;  1R9T H;  2E2J H;  1VQF A;  2EIF A;  4DV4 L;  3KF6 A;  3RZO H;  3F8T A;  1YHB A;  2C35 B;  4DR1 L;  4NXM Q;  2ASB A;  4DV4 Q;  1E24 A;  1SE8 A;  2I5H A;  1M90 C;  4DV5 L;  4NB3 A;  3CCS A;  3EIV A;  3S16 H;  4DR3 Q;  3ER0 A;  4JI7 L;  4JI5 L;  3ICE A;  3STB D;  1N33 Q;  1MKH A;  3UDX A;  4A3D G;  4JI5 Q;  2ES2 A;  3KYH C;  4IFD G;  4UP9 A;  2KCT A;  4HIM A;  1UE1 A;  4P75 A;  1DGS A;  3HOX H;  1S72 A;  5ELO A;  3K81 C;  4R4O A;  3RR5 A;  4BBR H;  2CFM A;  4BA1 I;  4OWW B;  3FHW A;  4POG A;  2Q2H A;  4DK3 C;  3TQY A;  1YIT A;  1K8A C;  2LXJ A;  2N3S A;  3NEL A;  4JBW A;  1X56 A;  3HOX G;  2Q2I A;  1A0I A;  1HZC A;  1HR0 L;  4BBR G;  1L1O B;  2NVY H;  1PH2 A;  3GTQ H;  2GVA A;  2MQH A;  4LWC A;  4X62 Q;  2QGQ A;  4X64 Q;  1PYB A;  2I0Q A;  1VQK A;  1EQQ A;  3PUX A;  2BH8 A;  3UDG A;  1VCI A;  1X6O A;  3PUY A;  4JI1 L;  1GVP A;  1YI2 A;  3ERS X;  4L5Q A;  3CXC A;  1EQR A;  4L5R C;  4JI1 Q;  1PFS A;  4X66 L;  1SRU A;  1JMC A;  4A3E H;  2AMC B;  4JI2 L;  4JI4 Q;  3S14 H;  1JJ2 A;  4JI8 L;  2RF4 A;  4IPG A;  4R4Q A;  1YJN A;  2A8V A;  4GNX A;  2RHS B;  2MO0 A;  3RLN A;  2NVT H;  4A3B G;  3W1B A;  1VQH A;  2QEX A;  1SRO A;  2VQE L;  4DR2 L;  5C44 G;  1B7Y B;  3CMA A;  1CKN A;  3B6Y A;  2VQE Q;  1E3P A;  3OW2 A;  4KHZ A;  5JEA G;  4DR2 Q;  1Q81 C;  1IZ6 A;  5IP7 H;  3I56 A;  3NEM A;  2KEN A;  1YHQ A;  1TXY A;  4IJH A;  4IO9 A;  2YU9 H;  1HNW L;  4OON A;  4JV5 Q;  4JCV E;  5IWA L;  3BZK A;  4DV1 L;  5IT9 c;  4OX9 L;  1U5K A;  5C3E H;  2HQL A;  4DR5 Q;  5GAG C;  5IWA Q;  4C3I H;  4DV1 Q;  1X55 A;  4A3K H;  1N34 L;  2UXD L;  4NXN Q;  5IP7 G;  1V9P A;  2DUD A;  3K0X A;  4DUZ L;  4A3J G;  2JA7 G;  1YJW A;  3KDF B;  3J81 i;  2PQA B;  4HIK A;  5EAY A;  3OTO Q;  3AYH B;  3NEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...