4DR6Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr6Q00
4YY3L 1AE2A 1Q12A 4NXNQ 3L7ZC 4JI1L 3HKZE 2MO1A 1PH5A 1XNQQ 3ZJYC 2ES2A 3PO3G 1Z47A 3T1HL 2GVAA 2NVYH 4IJHA 3CCRA 4DR7L 4NXMQ 1TWGH 2OQ0A 2N3SA 3E9HA 3ICEA 1UE1A 5BR8L 3KJPA 1S40A 2OWOA 4IOCA 1YZ6A 1B70B 3OTOQ 4DUYQ 1PHJA 1YHBA 1G51A 4HJ9A 2NZHA 4LFAQ 4YWKA 4HJ5A 2KENA 3W1BA 4JI6L 3S2HH 1YITA 2UXCQ 1OTCA 1Z9FA 3EN2A 1N8RC 1ASYA 4A3DG 1IBLQ 2UXDL 4KHPQ 1JJGA 2CWAA 5IP7H 3ULJA 1VQPA 1LM0A 4UP8A 4HIKA 4GOPA 4LF7Q 1N33Q 3PCOB 4IO9A 3KFUA 1XPUA 3H0GG 4PZ8A 3W1GA 1LUZA 3WWVA 5IYBG 1B8AA 4HJ8A 3NBHB 4A3JG 3GTKH 4P74A 1Y1VH 1VQ6A 3GO5A 1KD1C 3CXCA 3HOYG 3CCLA 2IX1A 2UU9L 2VL6A 5IP9H 4LF6L 3HOVG 3F1ZA 3HOUG 1IL2A 4DV2L 3TRZA 1VQ5A 3G6EA 3CP0A 1FGUA 1X3FA 2GN5A 2K14A 2ZJRA 2PMZE 4DR5L 1YJNA 4A3BG 2KHIA 5C0XG 1YI2A 3CQZH 2UUCL 4BBRH 3KDFA 3KF8B 1PH7A 4OO1I 1VS0A 3F2BA 3PIOA 2CCZA 3BJUA 4B3TL 2F4VL 3RNUA 1N36Q 4BA2I 1BBUA 3S1QH 3CCMA 5ELOA 4WJ4A 1W2BA 3D31A 2XTIA 1K9MC 3HOZG 1K73C 3CCUA 3FHWA 4PMWA 3A0JA 1KL9A 4X62Q 1SROA 4LF8Q 2R93G 1MIUA 1TWHH 1LYLA 5LMNQ 3K7UC 1DGSA 3I2ZA 1IBKQ 4LF9Q 1VQ8A 4A3IH 3AEVA 4JI7Q 1HZAA 4NB3A 3I4MG 1XNRL 4K0KL 1FVIA 1PH1A 4A93G 3PF5A 4P72A 5LMUL 1A0IA 1YVCA 3KF6B 1V9PA 3RLFA 3I7FA 3S17H 2Q2UA 1HJPA 4O0AA 5M3MH 4DV6L 5E7NA 3CCQA 2OTJA 5C0XI 4X64L 2R6GA 3UE1A 4A3MG 5LMNW 2JK8A 5J3BA 1NE3A 1KC8C 4HIOA 4X65Q 1EYGA 2E2IH 2JA8G 1AE3A 1C0AA 4NXNL 4IPCA 3GDEA 1VQBA 2MO0A 2IHEA 1XNQL 5C3EG 2OQKA 4P71A 2JA5H 4B3ML 1P8LA 3I56A 4DV5Q 1K8AC 2YTYA 3PUZA 1HNWQ 3CPWA 4JV5Q 4JBKA 4PG3A 4NXML 2D0OA 4GNXA 1YIJA 1J5EQ 1WYDA 3G71A 1JE5A 3U4VA 3OTOL 4TVAB 4UPAA 2VQEQ 4DUYL 5C4XG 4Y7NH 4LFAL 2E2HH 3NENA 2UXCL 3FKIH 1EWIA 4C2MH 1QZHA 2LXKA 2UUAQ 1IBLL 1B7YB 1CKMA 4KHPL 4A3FG 3M7NA 1UE5A 1OXVA 5IYCG 1N33L 5C44H 4P73A 2WB1E 2Q2IA 4AIMA 1NY4A 3S15H 4AQYQ 1OXTA 1P16A 2GVBA 2B63H 4IOAA 3GTLH 3HKZG 4A3LH 1PV4A 4POFA 4DK3C 3S1MH 1PH8A 1Y1WH 3NEMA 3KJOA 4GKJQ 2Y0SE 2KBNA 1J6QA 4QQBX 5AJ3Q 1WFQA 2NVTH 1SR3A 1JB7A 2JEAI 3PUXA 1XNRQ 5IWAQ 3HFZB 2ZM6Q 1EOVA 1PYBA 1OXSC 2FXQA 2MNAA 4HJ7A 4DPGA 4BA1I 2BH2A 1SMXA 3LGJA 4ALPA 4YWLA 3J7ZC 3GTPH 1VQMA 4LNQA 5JJKA 3BZCA 4EX5A 1E22A 3KF6A 1N36L 2DGYA 2K52A 3E9IA 3JAMi 2EXDA 2CKZB 1E1OA 4HIDA 3S1RH 1Y1VG 4B3SL 4YCUA 2K5VA 2Z0SA 2D62A 4JC0A 1BKBA 3E0EA 5IP9G 4L5TA 2RCNA 2R7ZG 4B3MQ 5IYDH 2VNUD 3I4OA 1A62A 2BA1A 4GN5A 4X62L 4GOPC 3TS0A 4LF8L 4IPHA 2OCEA 1QUQA 5LMNL 1S72A 1IBKL 1Q1BA 2I0QA 4LF9L 4IFDI 1KIXA 3EBEA 4GN3B 3HOXH 4JI7L 3RLOA 4QIWE 4BBRG 4YHHQ 4OX9Q 1XPOA 2HT1A 5JEAJ 1E7ZA 1UE7A 4OONA 4QY7A 1XTDA 4IFDJ 4DV0Q 3J81i 1CKOA 2V1CC 3RLNA 5M3FG 1CKNB 1HZ9A 4C3IH 2VY3A 2PI2A 5M5XH 1PH4A 4DR6Q 1EQRA 2Q2HA 4KHZA 4RG1A 3U4ZA 4X65L 4JI4Q 2IHFA 1Y14B 4DR3Q 2UUBQ 2ZJQA 1VCIA 5FJ8H 2L15A 1M90C 4GNXB 3RR5A 4MNOA 1K83H 1SLJA 5M5WH 1NBWA 1TWFH 4A3IG 2JEBI 5GQOA 4DV5L 1QZGA 1N34Q 1HNWL 4DV4Q 4JV5L 3F2DA 1BVSA 3UDGA 3H3VH 1E24A 1N32Q 2LXJA 1J5EL 4UP7A 2R92H 2QEXA 2AWNA 3KYHC 1D8LA 2VQEL 4A3EH 5M3MG 3HOWH 1X65A 4X66Q 1JJCB 2UUAL 1XMQQ 1VQGA 1AH9A 1HR0Q 4JI8Q 4B3SQ 2HQLA 4DAMA 5H1SE 1PH6A 3CF5A 3M85A 1X3GA 1NMGA 3GTOH 5GAGC 3CC7A 1LTLA 1C7YA 4AQYL 2Q2TA 2JA5G 2YU9H 1FJGQ 3PO3H 1KRSA 3D0FA 3PUVA 2I5HA 2JA7H 1I5FA 4L5SA 4KI0A 2IX0A 3HKSA 4GKJL 1D7QA 4OWXB 1HR0W 1QVCA 5AJ3L 3J81j 2WAQG 5FLMH 3PO2G 1C9OA 3RZOH 3W5OA 1VQAA 2A1AA 2ASBA 5GAEC 2ID0A 5IWAL 3L2PA 4A3DH 2ZTEA 2ZM6L 1K0RA 2PI2E 3KLWA 3PV0A 4R4QA 2YTVA 4GS3A 5HGQA 2R7FA 3CMEA 2IY5B 4ME3A 1CUKA 2K4KA 5DLQE 4GNXC 2HHHQ 1YHQA 4A3CH 2B63G 4QL5A 1HZCA 1UWVA 2CFMA 4A3LG 4IPGA 1CKNA 2AWOA 1Q7YC 1T9HA 5C0XJ 1QUQB 1L1OA 2K5HA 3M9BA 5GROA 1PH3A 3GTMH 1UEBA 5HY6A 1VQ9A 4A3GG 3PUYA 4P75A 1NMFA 2PNHA 4A3BH 1YNXA 1IBML 4DK6C 4A3KH 3OW2A 3K80C 1CSPA 4AYBE 1M1KC 2JA6H 4GKKQ 2F3IA 4YHHL 4OX9L 1TXYA 1XJVA 1I94Q 2B3GA 4BY1H 4JBJA 1GKHA 4JCVE 1PVOA 2HIVA 3ER0A 1SE8A 5GADC 3T1YQ 3KOJA 1VQEA 1NJIC 4DV0L 4MZ9A 4JBMA 4WJ3M 4YCWA 3K8AA 3AYHB 5ELNA 2UXBQ 4PZ7A 4JI3Q 1KHIA 4H02A 4DR6L 1XMOQ 4DR4Q 5IYDG 3CMAA 4LWCA 2BA0A 4JI4L 4BXXH 2UUBL 4DR3L 2RHQB 3NELA 4BBSH 2C35B 1IZ6A 2KCMA 4JI0Q 1IYJB 2VZAA 4LFCQ 1PFSA 3TQYA 1A63A 1N34L 5K36G 3HOXG 2KCTA 3CW2C 4DV4L 4DUZQ 3UDXA 3FP9A 4DR2Q 1N32L 5GAHC 1VQ7A 3CCVA 3M4QA 4DV3Q 5IP7G 2NN6G 3ULPA 4X66L 2BH8A 4A3MH 3K81C 3M4PA 1WCMH 2MQHA 3AQQA 3EIVA 3SGIA 3UDIA 1XMQL 4JI2Q 1OXUA 3CPFA 1HR0L 3CCJA 4JI8L 3F2CA 4BY7H 5JJLA 4LF4Q 3A5UA 5IE8A 2MFIA 3CC2A 5IY0A 1I3QH 1L0WA 2VQFQ 4OXPA 1PA6A 1FJGL 4LUVA 2ZJPA 1QVGA 4LUZA 4XTCS 1EIYB 3S14H 2HIXA 4NPSA 1XPRA 3UDFA 1PH2A 5EAYA 1VQDA 4DNIA 1X54A 1QVFA 1IBMQ 1X55A 2R92G 2Z6KA 1VQNA 1HH2P 4OWTB 1GVPA 1S3OA 1VQIA 4X6AH 4JOIA 2PQAA 4O2DA 4POGA 3G4SA 1WI5A 1X6OA 3DM3A 3L0OA 4PZ6A 4JI5L 2RF4A 4APVA 5IYCH 1K8GA 2R7DA 2JE6I 2H5XA 3ERSX 2NN6I 1L1OB 2ZTDA 2HHHL 4B3RQ 1GO3E 1EIFA 4YCVA 4C3JH 2N49A 2ATWA 4GLVB 2JA7G 3CD6A 4LFBQ 3JC66 1V1QA 4OO1G 1GD7A 4DV7Q 2NVQH 1X9NA 3STBD 3JAMc 4R4TA 4HIMA 3GTQH 2JQOA 1E3PA 1U5KA 2CQOA 3BZKA 3PUWA 4LUOA 5FLMG 4R4CA 4JYAL 2VUMH 3B6YA 1VQLA 3DLLA 1YJWA 1RIPA 2OTLA 3I4NH 3AFPA 2EIFA 3MXNB 3GTJH 2QGQA 3H3VI 4GKKL 3AFQA 4FDBA 1G6PA 3S24A 1L2FA 1PH9A 1I94L 1IXRA 2E5LQ 4AH6A 4DV1Q 3T1YL 1EQQA 3H15A 3A5ZB 4C3HH 3TS2A 2IT1A 3PIPA 4A3CG 4KLKA 4RMFA 3IRBA 2UXBL 2E2JH 4Y52H 1KRTA 4JI3L 1SFOH 1YHAA 2N8NA 1A8VA 4OWWB 2R7ZH 1XMOL 3A74A 1Q82C 4DR4L 3PGZA 4GLAC 2JA9A 3CCSA 1HNZQ 3J81c 2AKWB 4R1JA 2XGTA 1BBWA 5IT9c 4JI0L 2QA4A 4LFCL 1HNXQ 4LF5Q 1WOCA 4A3KG 3UE0A 3M3YH 1TWAH 1MJEA 2JA6G 1TWCH 4DUZL 4DR2L 4BY1G 1ASZA 5M5YH 1YBYA 3FKIG 4MTNA 4AYBG 2K5NA 1L1OC 4JI5Q 1CSQA 2ALYB 4YY3Q 4DV3L 3Q8DA 4L5RC 5M3FH 1UE6A 1I50H 3M4OH 1W3SA 4JI1Q 3PSIA 3H0GH 5C44G 5IYBH 4A3JH 1NTGA 2DUDA 4JI2L 2KHJA 1V43A 1SRUA 2D0PA 2A19A 3T1HQ 3K0XA 4LF4L 2WB1G 3CCEA 1JJ2A 3HOYH 2YV5A 4BBSG 1X3EA 4BXXG 4DR7Q 2VQFL 1Y1WG 3HOVH 3BU2A 1RL2A 4L5QA 5BR8Q 3HOUH 1KXLA 2YYZA 3OYYA 2JJQA 4UY8C 3S2DH 3MEFA 3CC4A 1EFWA 4JYAQ 2EQSA 4JG2A 3U58A 4JI6Q 2YTXA 1HZBA 2Y0SG 1H95A 1MKHA 4R4IA 5C4JH 2UXDQ 3F8TA 1WJJA 2PQAB 2WFWA 4DR1L 2WP8J 4TQUS 1YJ9A 1Q46A 3J80i 1O7IA 1VQ4A 1WCMG 1VQOA 3I55A 1E1TA 3TREA 1X56A 4BY7G 2AHOB 1EUJA 2E8GA 1GM5A 2ZTCA 1VQKA 2UU9Q 4LW1A 4LF6Q 1G291 4R4OA 3HOZH 4A76A 4B3RL 2LSSA 4DV2Q 1Q1EA 1FL0A 2WAQE 2R93H 1OXXK 3VDYA 1MJCA 2RHSB 4GN4B 4A75A 4LFBL 2NZOA 4DV7L 4DR5Q 3S1NH 2K50A 3CAMA 3PO2H 2UUCQ 1JMCA 4EQ5A 4IPDA 4GOPB 1KAWA 3I4MH 4GLXA 4HJAA 2NVXH 2A8VA 2I5LX 2F4VQ 4B3TQ 4DKAC 4A93H 4JBWA 1I6HH 1YEZA 2VW9A 1VQJA 1Q81C 1VQHA 4LF7L 2E5LL 1VQFA 4DV1L 1R9TH 5JEAG 4J15A 4DAYB 4UP9A 4YWMA 4XIGS 2JA8H 1Q86C 4IFDG 2VS1A 2CWPA 2Z6KC 3J80c 3J7A5 5FJ8G 1N9WA 4QJFA 4QGUA 5C3EH 4JOIC 1U0LA 4IJLA 4A3GH 1HNZL 3KDFB 3U50C 3K7AH 2VUMG 4K0KQ 2F52A 1PYSB 1SN8A 5LMUQ 5FLXc 3RN2A 3I4NG 1HNXL 4LF5L 5C4XH 3G48A 4DR1Q 4DV6Q 2AMCB 4A3EG 2B29A 3HOWG 1KQSA 4X64Q 1JT8A 2N78A 1K3RA 3RN5A 3GTGH 3S16H 3ULLA 4A4IA 2K75A 3GD7A 3STBC 3RZDH 4A3FH 2I5MX 1Q8KA 3TEHB 1VQCA 3PF4A 5JJIA
chains in the Genus database with same CATH superfamily
1I4RA 1MBYA 4RH6A 1Z7TA 1PH5A 3GTLB 3ZJYC 3PO3G 1Z47A 5C3EB 4KHVA 2NVYH 3BVZA 1SNMA 2OQ0A 2N3SA 2NVTB 2F0NA 5FK9C 1UE1A 1ESFA 1YZ6A 1ET9A 5IODA 2CH4W 2MUYA 1YITA 1ASYA 1CHPD 4A3DG 1PFMA 1JWMD 2EOTA 3ULJA 2WINB 3FPUB 5JOBA 3BS1A 1O78A 4RA8A 4X3SA 3R2IA 1XPUA 4BS9A 1DD2A 1LUZA 4HJ8A 4A3JG 3NBHB 3D4RA 3D4DA 3KUPA 3BVGA 1CHQD 3GO5A 3EFXD 3HOYG 3OPOA 2UU9L 5IP9H 4EGVA 1IL2A 3A56A 3G6EA 2GN5A 2K14A 2ZXPA 1YJNA 3S2HB 4A3BG 1TVXA 1YI2A 4OHJA 2UUCL 3KF8B 4OO1I 1ENCA 3BJUA 2Z6BA 4BA2I 5ELOA 3TBIB 4DK0A 5G3LD 1CFMA 2MPMA 5M5WB 1KL9A 1TWFB 4LF8Q 1SROA 1XYIA 2R93G 1MIUA 1LYLA 3K7UC 3I2ZA 4N9TA 5CBEE 2AUKA 3AEVA 1HZAA 5T1GA 2B2WA 3CQZB 3PF5A 3S17H 5LMUL 1D2BA 1STNA 3KF6B 2Q2UA 5E7NA 3CCQA 1HA6A 2R6GA 5LMNW 2JK8A 5COYA 1AE3A 1LABA 1PFNA 4KKUA 2F0KA 1XNQL 1KDBA 2JA5H 4DXFA 4JBKA 5D65A 3RUZA 1JICA 3T16A 1YIJA 3K5MA 4FXGC 3OTOL 4UPAA 3K5NA 4R8IA 2UXCL 4C2MH 1QZHA 1IBLL 1B7YB 1Y8PB 1KAAA 4A3FG 1WVLA 1IW7C 1F9PA 1L0YB 3NPPA 2E2IB 2O2LD 2SOBA 1OXTA 1P16A 2B63H 3GTLH 2IPKD 1CA6A 4X3TA 4DK3C 3T4AC 4FNFA 1V8QA 4QQBX 5AJ3Q 1E0BA 3P75A 2NVTH 1B9MA 1SR3A 1JB7A 1XNRQ 1H9KA 3HFZB 2ZM6Q 3DWQA 1PYBA 3FKIB 1OXSC 2MNAA 4ALPA 4YWLA 3PIO3 1VQMA 4LNQA 1Q3LA 4EX5A 4LJZC 2EXDA 4B3SL 1E1OA 4CDFC 2K5VA 4I7ZC 1I4GA 2D62A 2K32A 1ICFB 2Z4IA 2EVBA 4ZKBB 3J81L 2A68D 2RCNA 4B3MQ 2X6GA 3DXJC 2BA1A 4KKTA 4X62L 3TS0A 5M9OA 5LMNL 1IBKL 3MFYA 4LF9L 4KD4A 2F0DA 4QIWE 1AEXA 3KBXA 4OONA 3L9AX 3BG3A 1QWYA 3GV3A 3DEPA 1NNXA 1CKOA 5EJWA 1WD1A 5JAVA 1GHJA 1SXTA 4WORA 2DJFC 3MWYW 4PMBA 4C3IH 4DR6Q 2Q2HA 4ZLTF 3I90A 3U4ZA 4X65L 2B2VA 2K6AA 1Y14B 4DR3Q 5CBAE 1HQMC 3NUCA 3RR5A 5M5WH 1RDPD 5KRUA 1TWFH 2F03A 5GQOA 1BCPF 1DCZA 4DV4Q 3UDGA 4X3KA 3H3VH 1EIGA 1E24A 1N32Q 1HQRD 2LXJA 2XIWA 4UP7A 1A2UA 2EYJA 3IAYA 4QIWB 1JJCB 2UUAL 1WD0A 1AH9A 3SDZA 4JI8Q 1BUVT 4DAMA 1PH6A 3CF5A 1EEFD 1NMGA 1ZEQX 3IFTA 2KJXA 1C7YA 3PO3H 1QE6A 2RDGA 3VR6A 4M8AA 1QVCA 3W5OA 1VQAA 2ASBA 3GTJB 4A3EB 4XQNA 5EKLA 1A15A 3FRPB 4A3DH 3HOWB 4N9PA 1EZ6A 1PZID 3OMCA 1RHPA 2YTVA 3LNNA 1ZXTA 4GS3A 5HGQA 2L12A 4G57A 1JQYD 4RCOA 3CMEA 1CUKA 3ZYYX 4A3CH 4QL5A 1UWVA 2BCOA 4CJ0B 2YU9B 2AWOA 4ODGA 1QUQB 2K5HA 2JA7B 4CJ2C 1B2TA 4A3GG 2H4OA 4A3BH 2NYZD 4A3KH 3OW2A 1CSPA 2HDMA 4AYBE 4GKKQ 1CA5A 1MGSA 2F3IA 2QW7A 4JBJA 1GKHA 4R9WA 5FO7B 2HIVA 2VB2X 3H0GB 4DV0L 4MZ9A 4MIUA 2NTTA 1XMOQ 3H3VC 3CMAA 4JI4L 5DEHA 2RHQB 3NELA 1YNJC 2F0JA 4RKBA 2C35B 1U4LA 4LFCQ 1MD2D 1NUCA 1N34L 2NZ1D 1SYFA 2VB3X 3QIAA 3HOXG 2KCTA 1D1IA 1GOZA 2C5CA 1O7LA 5GAHC 2EXZA 2FMCA 2A74C 3CCVA 4AYBB 5IP7G 3ULPA 1LLRD 3AQQA 1WTXA 1PTOH 3K5LA 2XSCA 2JSOA 5JJLA 5IE8A 3HGBA 5IY0A 1JOOA 3NWTA 1FD7D 1EIYB 1QVGA 5I2XA 3S14H 5K5PA 4NPSA 1XPRA 1PH2A 3DWPA 1IBMQ 1X55A 5CC4A 1VQNA 2G5DA 1EOTA 3VR2A 4HAEA 4JOIA 3N6RA 4RAUC 1WCMB 2K5QA 1WI5A 1X6OA 5EPJA 3L0OA 1CQFA 3G4SA 1R9TB 1I4QA 1SNDA 3OWFA 3ERSX 4ABNA 1PRTF 1U4RA 1GUTA 3JC66 1NAPA 4DV7Q 3JAMc 3MHBA 5C4XB 2M9VA 4MN3A 4ZYSA 1VQLA 1YJWA 1JR0D 1RIPA 3MXNB 3GTJH 1G6PA 2A69C 3S24A 1IXRA 3Q24A 2B2TC 3DUZA 4AH6A 5CV9A 3SK5A 4YIJA 2IT1A 4B08A 5CR3A 1TS5A 4IUPA 1EY9A 4RMFA 2UXBL 3MC0B 4C3JB 4Y52H 3A74A 1BBXC 2A69D 2NVQB 3GTQB 3J81c 2XGTA 1HNXQ 2QF7A 4LF5Q 1HHVA 1ICWA 2JA6G 1PTOC 1TWCH 2IX3A 1HRJA 4MTNA 1FNUA 1K3BC 2F1MA 2C9OA 1GUWA 1LT3D 5HGTA 3AU7A 4L5RC 4C3HB 3H0GH 5DAUA 5EKIA 5C44G 5IYBH 2DUDA 4ULLA 4JI2L 3J80L 1SFOB 1PTOD 2WB1G 2WACA 3K58A 2R7ZB 4BBSG 2CH4A 1Y1WG 3HOVH 3OYYA 5KNCA 4UY8C 3S2DH 1LACA 4JYAQ 4IUVA 2SNSA 3TN2A 3ND8A 4I7AA 1HZBA 1H95A 4R4IA 1UUPA 5EBDA 2WP8J 4WRDA 5IOCA 3WDNA 1ONLA 1GUNA 1LTRD 4X3UA 2O5IC 4G7ZC 1J9OA 1VQKA 3TP8A 2UU9Q 4LW1A 2E2DC 1G291 1KLGD 1DONA 2WAQE 4A3IB 1CQVA 1OXXK 4LFBL 1B4OA 2RHSB 4A75A 3OHXC 3I72A 2UUCQ 1KAWA 2A8VA 5M3MB 2I5LX 4RHRA 2A6ED 4XYQA 2PW5A 3E6ZX 4LF7L 2E5LL 2SDFA 3M7GA 1VQFA 1R9TH 5C4HA 4J15A 2J4XA 4DAYB 4YWMA 4ILWA 1QOHA 5C3XA 3PIP3 2IJ0A 4IFDG 3MAQA 2Q8RE 3J7A5 5FJ8G 3D3RA 1E2WA 4A3GH 3KDFB 3QO2A 2WAQB 3K7AH 1PYSB 3A55A 5LMUQ 1ML0D 3RN2A 3I4NG 2FHTA 5C4XH 3G48A 4IUUA 4F7XA 3W3AA 1KQSA 1JORA 3ND9A 3K0YA 3STBC 1DOKA 3PF4A 5JJIA 2EY5A 1Q12A 3HKZE 1XNQQ 1G6ZA 4ZUJA 4KN4C 3G6JB 4RWSC 4IJHA 4DFAA 4DR7L 5BR8L 3KJPA 4DGZA 4IOCA 1B70B 3OTOQ 1G51A 1H9RA 4L8JA 4YWKA 1LTAD 4JI6L 2UXCQ 1OTCA 4H13C 1Z9FA 3EN2A 1N8RC 1BF4A 1IBLQ 2L9HA 3GTPB 2UXDL 1JJGA 2CWAA 5IP7H 4HIKA 4GOPA 4DAVA 1CI3M 4KV6A 5EQ0A 3IFDA 1Y1VH 3EVQA 4RGOS 1KD1C 1HUMA 3CCLA 1B3AA 3F1ZA 2LKVA 3HOUG 4EQPA 4QMGA 3TRZA 3QWNA 3MZ5A 3QB3A 2ZJRA 2KCCA 4DR5L 3GP7A 2KHIA 5C0XG 2K03A 3SEBA 4BBRH 1J8IA 5I9PA 3VR5A 4B3TL 1DOMA 3RNUA 3AMUA 1W2BA 3D31A 5C3WA 5M5XB 1JE4A 2XTIA 2Q8IB 2K28A 1K73C 3CCUA 4X62Q 1TWHH 5LMNQ 3EJIA 5C6AA 1IBKQ 4UDUC 4LF9Q 4A3IH 1LTBD 2WKCA 2N55A 3RMHA 3I4MG 3O13A 2F3WA 4K0KL 4A93G 4P72A 4KY7A 1YVCA 3SK8A 3RLFA 1V9PA 5ELCA 2E75C 1HJPA 4O0AA 5M3MH 2OTJA 1LO5D 3M4YA 3UE1A 3NSWA 4A3MG 2G9DA 1KC8C 4KY6A 1EYCA 4WFN3 4X65Q 2JA8G 4NXNL 2VXWA 1G2TA 4DAPA 1MSHA 2MO0A 1B50A 5C3EG 3I56A 1FR3A 2YTYA 2EE1A 1HUNA 4NXML 3EA6A 3G71A 1JE5A 1CTMA 2PYKA 3S17B 4LFAL 1EWIA 1LT4D 2UUAQ 4KHPL 1JC7A 5IYCG 1RD9D 1N33L 5C44H 2HCCA 1SYBA 2Q8TA 4A3LH 2JA5B 1F2YA 3S1MH 1PH8A 1Y1WH 3NEMA 3KJOA 2QKIC 1PZJD 1TKWB 3A54A 2Y0SE 2JEAI 3PUXA 2NUCA 4C2MB 1F2MA 2FXQA 4HJ7A 2BH2A 4BA1I 3LGJA 3GTPH 3BZCA 1E22A 2RSNA 4UAIA 4UHVA 3S1RH 1C8CA 2Z0SA 1L0XB 3IL8A 2B63B 2BOSA 2VNUD 4KD3A 1EYAA 4IPHA 2I0QA 1QUQA 1S72A 1EWCA 1Q1BA 2Y0SB 1KIXA 5K36H 3RLOA 1XPOA 2HT1A 5JEAJ 2RQXA 2F0WA 1BO0A 2CW0D 4DV0Q 1D5XC 3I70A 4BY7B 2XNAC 4RFBA 2R3ZA 4QF4A 3V2TA 4DN4M 1WTOA 2F0FA 5M5XH 1VMCA 1A2TA 1EQRA 4HSVA 1I3QB 4JI4Q 2ZJQA 1VCIA 1I4XA 5FJ8H 2KECA 4MNOA 1QNKA 4F87A 1NBWA 1N34Q 2JEBI 4DV5L 1B1ZA 3F2DA 2R92H 2QEXA 4M1UB 2AWNA 3KYHC 4FF4A 3ONAB 1PXUA 4P2CB 3PQIA 4WJWA 4HTHA 4Z9CB 4S3SA 5IGDA 4C3IB 1RODA 3M85A 3VYTA 1SYDA 4IN3A 3GTOH 1BNZA 4AQYL 1JWUD 2Q2TA 1BCPD 3TP7A 1R4QB 2EY1A 2I5HA 4KI0A 2IX0A 3T13A 4GKJL 1K28A 1QG7A 4OWXB 1HR0W 1TY2A 2VUMB 4OGQC 3PO2G 5I6WA 3NBIA 3D6CA 4K8JA 2DN8A 3RZOH 1AFPA 2ID0A 5IWAL 3L2PA 3H09A 3LWEA 2PI2E 3PV0A 4F8MA 1BDOA 4NP5A 4GNXC 2HCIA 1YHQA 1LTGD 2CFMA 3PO3B 2Z8LA 4IPGA 3BZDB 1CKNA 1IYVA 1NSNS 2QCPX 3BDOA 4DA2A 3GTMH 1JWSD 5J22A 5HY6A 1VQ9A 1CZGA 1B3QA 2F0QA 1NMFA 2M2LA 4A3DB 2EJGC 2JN4A 4ZAIA 4YHHL 1SE3A 2F4IA 2B3GA 4BY1H 4JCVE 1PVOA 5GADC 1I50B 4QB4A 1NJIC 4JBMA 4WJ3M 5CORA 1NR4A 1S5BD 3AYHB 2PQEA 2R61A 4OIKA 5ELNA 2UXBQ 1DOLA 1R4PB 1I6VC 5IYDG 2UUBL 3JAML 1DM0B 1IYJB 2VZAA 5KNDA 2ZT9C 3GQBA 4A3BB 4A3KB 3WOEA 1D6EC 5DM63 1VQ7A 2A68C 2B8FA 3M4QA 5FO8B 2NN6G 2BH8A 4A3MH 2B2YC 4RCNA 3UDIA 4JI2Q 1HR0L 4KY5A 3F2CA 4BY7H 2HUGA 1I3QH 4OXPA 1X3QA 1FJGL 2R93B 4LUVA 2RCFA 1TS4A 1WTQA 1WTHA 2O5JC 2HIXA 3CU7A 1AZPA 3S1NB 1SEBD 2XWBB 2EY6A 3E0JA 1I6HB 1MSGA 2Z6KA 3TSSA 1HH2P 2K33A 4OWTB 1S3OA 3T51B 4GZYC 1ET6A 4JI5L 1PTOB 5IYCH 3R93A 2RF4A 1GHKA 2HDLA 2E74C 2FFKB 1K8GA 2JE6I 5JEAH 5DM73 2HHHL 3I4LA 1U9RA 3KBGA 1ENFA 2F0VA 2N49A 2ATWA 2WV6D 3I8ZA 2JA7G 3FVQA 3CD6A 3S14B 4LFBQ 2A6HD 2D2CC 4OO1G 1X9NA 4HIMA 1E3PA 1PRTC 5FLMG 2VUMH 3B6YA 5IGFA 3SXHA 3SR1A 1RKNA 3KK7A 2B8GA 4A3FB 1STYA 1I94L 1VF5C 4RGNA 2E5LQ 3A5ZB 2RDFA 2F0OA 3TS2A 1PRTD 2NB0A 4ZUIA 4KLKA 5IT9E 5IGBA 3IRBA 5KEEA 4JI3L 4OWWB 3OIPA 1TWGB 4GLAC 2JA9A 1OO9B 5NUCA 2AKWB 2BDOA 3J7AV 3UE0A 1DXMA 2EPBA 2TMPA 3A8KE 1YBYA 1V1PB 1EY8A 3TZUA 4AYBG 1XXGA 1L1OC 4KKSA 4DV3L 1I50H 2K04A 3M4OH 5ELFA 3DM1A 4A3JH 2ICIA 1SJHD 3BVMA 3QJYA 4LF4L 4L63B 1SYGA 3HOYH 2YV5A 4BXXG 4DR7Q 3SE0A 3BU2A 1ZYRD 1H9SB 5BR8Q 4RHSA 2EQSA 4JI6Q 1G2SA 3CKIB 3BYTB 2UXDQ 1TWCB 4HMJA 4KK7A 4TQUS 2BE5C 4ID6A 1O7IA 2B39A 4JPBW 1WCMG 3I55A 1E2ZA 5T1IA 2KQ3A 2AHOB 1GM5A 5ELBA 2ZTCA 4PMCA 2QDLA 1TQOA 2RBMA 4B3RL 2LSSA 1Q1EA 3HOVB 4NKLA 2R93H 1SSOA 2BE5D 1MJCA 3S2DB 4DR5Q 3S1NH 2K50A 1QNUA 3CAMA 3PO2H 3VR4A 4EQ5A 1CK1A 4B3TQ 4JBWA 1I6HH 1SJED 5C5MA 1KNAA 4Q5VA 4DV1L 3ITPA 4OELB 4UP9A 4XIGS 1Q90A 2VS1A 4C3JG 4FP5D 1PDQA 1U0LA 4IJLA 1HNZL 3U50C 4TKOB 4K0KQ 4DK1A 1U4MA 4DR1Q 3NTHA 4V190 4HCSA 1S5CD 4EQNA 3GTGH 2HQEA 1EY0A 4IURA 4A4IA 1QJOA 4A3FH 3TEHB 4C3HG 4CDDC 3S15B 4NXNQ 3L7ZC 1IKLA 1U4PA 5CV5A 4H7BA 2ES2A 1DJRD 2DNEA 1ILQA 1QILA 3QOJA 4HEDA 1EL0A 2GVAA 2WKDA 4NXMQ 4HR7B 1TWGH 3E9HA 4A3GB 3ICEA 1S40A 2OWOA 3K7AB 5D3IB 1PHJA 3OW7A 1YHBA 4LFAQ 2KENA 5D14A 3W1BA 3X3NA 2F0HA 2J7ZA 4KHPQ 1CT1D 1LM0A 4UP8A 5TSSA 3CHBD 1N33Q 3PCOB 4IO9A 1ESRA 3W1GA 3WWVA 3GTKH 1PMRA 3E5SA 4RGMA 1S5DD 1KNEA 3CXCA 2IX1A 2VL6A 3MXGA 4LF6L 3BDLA 5A35A 1W6JA 4DV2L 1VQ5A 3CP0A 1FGUA 3OIQA 1X3FA 2PMZE 5I9OA 1QB5D 4KN7C 1VS0A 2KEEA 3F2BA 3PIOA 5J1ZA 4O1NA 3S1QH 1NCVA 3IKJA 4PQXA 4WJ4A 3CRKC 5E4WC 1Y1VB 3OOCA 1K9MC 4ZQ3A 3TP5A 2K05A 5AFWA 3HOZG 3FHWA 3LX0A 4PMWA 3A0JA 2CHBD 4X6AH 3I3CA 1DGSA 3W2DA 1RTNA 4CKEA 1CZWA 4NB3A 1XNRL 2F0LA 4BBRB 3HS0C 2PMZB 5JVG3 3C3LA 5C0XI 1UAPA 4I65A 4HCEA 4FVMA 1NE3A 4HIOA 1S5FD 1C0AA 5F2DA 4KMUC 2PNRC 4MHEA 2A6EC 3NBHA 2OQKA 2PZWA 1TWHB 4B3ML 2L11A 4DV5Q 5IGGA 3PUZA 1K8AC 5CV7A 1IL8A 1STAA 2D0OA 4C56C 3R2TA 1WYDA 3R3OA 4DUYL 4Y7NH 4K8IA 2E2HH 3NENA 4U673 1PYWD 3M7NA 1ENAA 3KF8A 1Q8IA 1UE5A 4P73A 5KIXA 2WB1E 1EEID 4AIMA 1NY4A 2F0UA 3FDTA 3S15H 4AQYQ 2TSSA 3SHLA 4JK1C 5JJZA 3K59A 5KYIA 4K14A 4IOAA 1PFBA 3HKZG 1SNQA 2DJGC 5FLXE 1ILPA 2EYMA 3NQIA 3D4WA 4GKJQ 1GXDC 1Z6HA 5IWAQ 1LT5D 1FYCA 4DPGA 4XQJA 3J7ZC 2A73B 1Y8OB 1TIID 3KF6A 1N36L 2DGYA 2K52A 3C1FA 3E9IA 4BWGB 5C44B 1BCPB 1GUOA 2CKZB 4HIDA 2EYOA 4YCUA 3T56B 1RF2D 1CM9A 2WB1B 1JB3A 3E0EA 4IQZA 2I46A 5IP9G 2QDBA 4EVOA 4L5TA 3S1MB 1Y1WB 2EDGA 1A62A 3V96A 2OEOA 2X6LA 4ME5A 4TSSA 4OIJA 1LT6D 3HOXH 1SE2A 4JI7L 2CQAA 4YHHQ 3MA2B 1UE7A 4IALA 4QY7A 4IFDJ 5M3FG 1RTOA 2LY7A 3S1RB 2F0TA 1HZ9A 2I07B 2VY3A 2PI2A 1H9JA 4RG1A 4KHZA 2UUBQ 3KLRA 1M90C 4GNXB 1K83H 4HN7A 3AB9A 3DWAA 1JOKA 2H1EA 1QZGA 5A2QL 1HNWL 1EY7A 1WTWA 4JV5L 1BVSA 2B2UA 1J5EL 2F3VA 4DXGA 2VQEL 2KOLA 1D8LA 4IUQA 1HR0Q 2MJ8A 4B3SQ 2HQLA 5H1SE 4CKBA 2B2WC 4J8QA 2PZTA 3CC7A 1A3UA 1KDAA 1FJGQ 3S9WA 1S4ZA 2JA5G 1KRSA 3L3OC 1YNNC 4L5SA 2B2TA 1DYQA 3HKSA 1K8OA 1XTCD 1FNVA 2RA4A 3I4NB 2R92B 2KEDA 2XVSA 4O42A 5GAEC 3H91A 1SYEA 3KLWA 4R4QA 2E76C 1YNND 3DEOA 4G4KA 2HHHQ 3X3MA 2E2JB 1LTSD 3GTOB 2B63G 1T5XD 2SNMA 1FGBD 2K1BA 1Q7YC 5C0XJ 1HFGA 3D8GA 5GROA 1PH3A 1UEBA 5JVH3 3PUYA 3VYRA 1TY0A 1TWAB 3RZOB 2WIIB 1YNXA 1IBML 2DY7A 3K80C 3MVVA 2JA6H 4OX9L 1TXYA 1XJVA 1I94Q 1JCKB 5BN5A 1LTTD 4YCWA 1SMYC 1QCBD 4PZ7A 4JI3Q 3TDQA 3SVMA 4H02A 1GUSA 1KLUD 4LWCA 2BA0A 3HOUB 5DNFA 3GTMB 4BBSH 5FKAC 1IZ6A 3VYSA 3MXPA 4ZK9B 3RD4A 1EU4A 4KJNA 3LWUA 2NWGA 1SMYD 3FP9A 3UDXA 5E3FA 4BY1B 5EPKA 1PRTB 5J39A 4DV3Q 3TP6A 1HTPA 2KCNA 4X66L 3K81C 3M4PA 3SGIA 1XMQL 2M00A 3CPFA 4C3IG 1EWHA 3CCJA 4QCLA 1WTRA 4LF4Q 3A5UA 2MFIA 3CC2A 1W6KA 1L0WA 2EY2A 5LHY1 1PA6A 2ZJPA 2CW0C 1EY5A 3HRZC 3UDFA 4N8X1 5EAYA 4DNIA 1F77A 1H9SA 4A93B 3ERQA 2B2VC 1PZKD 1A3TA 5C4ZA 3SK4A 3OMGA 4A3MB 1AN8A 4K5VA 4PZ6A 1I4HA 2JA8B 2FJ2A 3JAME 2H5XA 2NN6I 1L1OB 4B3RQ 1EIFA 4IFDH 3J7YW 1GD7A 4Q0FA 1EY6A 1Y8NB 3PUWA 1STBA 1HCZA 1U5KA 3BZKA 4JYAL 4R4CA 3DLLA 3I4NH 1DZ1A 2OTLA 1BCPC 3S16B 1L2FA 1FNWA 1PH9A 2ICEC 1BR9A 4DV1Q 3T1YL 1F2LA 3J81E 4LMQD 3PIPA 4A3CG 2OT2A 2E2JH 1MHWC 2XN9C 4PV1C 1KRTA 2N8NA 1A8VA 2AQ3B 4DR4L 3CCSA 1HNZQ 1LV9A 2F0EA 4JI0L 4R8NA 1H9MA 2LS01 2QA4A 4A3KG 3M3YH 1TWAH 4CDCC 4DUZL 4CJ1B 4DR2L 3CRLC 3K5OA 3FKIG 2K5NA 2GA4B 1CSQA 5M3FH 3PSIA 2Z4HA 1V43A 5LL6X 5EPLA 1X3EA 2RDHA 2EYLA 2VQFL 1RL2A 4L5QA 3HOUH 3KLSX 5KGUA 2JJQA 5CYUA 2DNCA 5EKKA 3MEFA 4K5XA 4JG2A 2J0TD 3FEWX 5EBCA 1F9QA 1HA5A 1HFNA 3F8TA 5C0XH 2PQAB 1YJ9A 1Q46A 4G7OC 3C1EA 1VQ4A 3M4OB 2OXPA 3MXNA 4OL7A 1X56A 4A3JB 1EUJA 5CV6A 1BQQT 4EQOA 4LF6Q 3HOYB 3MXUA 4DV2Q 3QR8A 3WOFA 2BDNA 3VDYA 4GN4B 3A8JE 1K8MA 2ZXOA 4XT3B 3FMCA 1JMCA 1M4VA 1IKMA 2D5DA 1TT2A 4GOPB 3I4MH 4HJAA 1STEA 2NVXH 4A93H 1D5ZC 2X69A 1YEZA 2VW9A 2IL8A 1VQHA 4XYOA 3NTKA 2L0CA 2JA8H 4C1NI 1IHZA 2CWPA 3D6WA 4FF3A 4QJFA 4QGUA 5C3EH 4JOIC 5CGKA 1IW7D 1EY4A 3PO2B 1SN8A 5FLXc 2F0GA 2JYOA 4KTAA 4A3EG 2AMCB 3VR3A 4DNRB 3HOWG 4FXDA 5CV4A 2A6HC 4LK1C 3S16H 3ULLA 2K75A 1VQCA 1D1KA 4YY3L 4K5WA 3I73A 1AE2A 4JI1L 2MO1A 3NK9A 4B9WA 3T1HL 1TU2B 1HXYD 3FPPA 3CCRA 2KUMA 2AUJD 1G91A 4DUYQ 4HJ9A 2NZHA 3S2HH 4HJ5A 5E1FA 3VYUA 2JP1A 3GTGB 2LMCB 1VQPA 1EQVA 4LF7Q 3EROA 3KFUA 3H0GG 4PZ8A 5IYBG 1B8AA 1STHA 4P74A 3HG9A 1VQ6A 1I4PA 3NP8A 2OF1A 5G3LF 4DAYA 3HOVG 2XRQD 5D3DA 3DMUA 4H44C 4XDXA 3CQZH 3KDFA 1PH7A 2CCZA 2F4VL 1N36Q 1NR2A 2CVRA 1BBUA 1ZYRC 5I6YA 1A3VA 4XT1B 3GTKB 1F2ZA 1SDFA 2EZVA 2G9HD 1STGA 1VQ8A 4JI7Q 4DNTB 1X3PA 5ELDA 1FVIA 1PH1A 2PO4A 3QOLA 1A0IA 3I7FA 5JPMC 4DV6L 3S1QB 4X64L 2EYFA 3HEJA 4F88A 5J3BA 3VA7A 1EYGA 2E2IH 3URYA 4IPCA 1JOQA 3GDEA 1VQBA 1KTKA 2IHEA 4P71A 4K2KA 2DY8A 1P8LA 3DHQA 4OEMB 2NBFA 1HNWQ 3CPWA 4V0BA 4JV5Q 4PG3A 1VDZA 4GNXA 1J5EQ 3SK6A 3U4VA 4TVAB 2VQEQ 5C4XG 1BOSA 1B53A 3FKIH 2LXKA 4ZRZA 2K5DA 1CKMA 5I4DA 3J80E 1OXVA 1Y69U 1EU3A 2Q2IA 2MP1A 3HP3A 4CKCA 2GVBA 2RSOA 1PV4A 4POFA 3NXWA 3Q0AA 4NMZA 2KBNA 1J6QA 1WFQA 3HZXA 2L1BA 2A5HA 4Y7NB 2E2HB 2PCFB 1EOVA 1VF7A 3P20A 1SMXA 4ZKCB 1YNJD 5JJKA 4MTKA 3JAMi 1UNSA 5FOBB 1Y1VG 1A6XA 2F0SA 1SYCA 4JC0A 1BKBA 3TZDA 1XX8A 2R7ZG 5IYDH 1KABA 3Q6SA 5IT9L 3I4OA 4GN5A 4GOPC 4LF8L 2AQ1B 2B2YA 3NWSA 2OCEA 5BN4A 1TS2A 4IFDI 2K5WA 3EBEA 4GN3B 2EYHA 4BBRG 4OX9Q 3Q22A 3H94A 4IUNA 1E7ZA 4IUTA 4HSPA 1B9NA 1XTDA 4NW2A 2NN6H 3J81i 2V1CC 3RLNA 1CKNB 5LL6S 1F9RA 2B2UC 5KNBA 1PH4A 2F0PA 2IHFA 5ELEA 4IZ8A 2L15A 1EIHA 2V4DA 4K2LA 1SLJA 4A3IG 2AQ2B 1HPCA 3N52A 3HOXB 3G7LA 4FYDA 3T53B 4A3EH 5M3MG 5BN3A 3HOWH 5KYLA 1X65A 4X66Q 1XMQQ 1VQGA 1SNCA 1SBBB 2XWJB 3QG1A 2IWHA 1X3GA 2EJFC 1EZ8A 2D9UA 2JXMB 1LTLA 5GAGC 4G7HC 2YU9H 5CMDA 3H6MA 2EJMA 1K83B 2NTSA 3D0FA 3PUVA 1I5FA 2JA7H 4OO1H 4B9XA 1D7QA 3P1HA 5AJ3L 3J81j 2WAQG 5FLMH 1C9OA 5IGCA 2A1AA 3MFGA 2ZTEA 2ZM6L 1K0RA 4CGYB 3KLSA 2R7FA 3U9OA 2IY5B 4ME3A 3VA5A 2K4KA 5DLQE 4QUCA 3OSOA 5E4XA 3U9SA 1WTVA 5HURA 1HZCA 5I2YA 4A3LG 5A2QE 1T9HA 1SE4A 4DU9A 4U68A 4TRDA 1L1OA 5IIFA 3M9BA 2LFNA 3BDCA 2FMMA 4P75A 2PPBC 1EFID 2EYPA 4H0LC 1HTLD 2PNHA 1O80A 3NTIA 4DK6C 1GJXA 4J1MA 5M5YB 1M1KC 1TR5A 2MHVA 2FINB 3ER0A 1SE8A 3T1YQ 3KOJA 1VQEA 3BYYB 3K8AA 1KHIA 4DR6L 1LTID 4DR4Q 5EGTA 1S5ED 4BXXH 4K6LA 4DR3L 4QUFA 1O7YA 2KCMA 4LAAA 1T5EA 4JI0Q 1PFSA 3TQYA 1A63A 5K36G 3V05A 2Z1CA 5C4JB 3CW2C 4DV4L 4DUZQ 4DR2Q 1N32L 2JA6B 3J7AF 2PW7A 3MEHA 2L5TA 2KHSA 1WCMH 2MQHA 3EIVA 1OXUA 4JI8L 3HOZB 4NDXA 1EYDA 2VQFQ 4BBSB 1VMPA 1G8ZD 2ZXRA 4LUZA 4XTCS 1K0SA 1VQDA 1QVFA 1X54A 3Q23A 2R92G 1TS3A 4JVZA 1GVPA 1VQIA 3PMFA 2PQAA 4O2DA 4POGA 3NHHA 4JW0A 3DM3A 4APVA 1UEAB 2N88A 2R7DA 2ENBA 1MI2A 2ZTDA 1GO3E 4YCVA 4C3JH 4GLVB 4XXEA 1F9SA 2F0IA 2P5ZX 1V1QA 4FF1A 3F2UA 2K01A 2NVQH 3STBD 3GTQH 4R4TA 5CV8A 2JQOA 2CQOA 1D5MC 4LUOA 3I91A 4N8FA 2XRSD 1AW7A 3AFPA 2EIFA 2QILA 2QGQA 3H3VI 4GKKL 3AFQA 4FDBA 3RZDB 2RKSA 1GUGA 3UI2A 1EQQA 4L6TB 3H15A 4C3HH 4KJOA 1BXTA 1ZKOA 2F0MA 3HKZB 3NE5B 3E3XA 1YHAA 2NVYB 3MTSA 1SFOH 4FF2A 1B44D 2R7ZH 1XMOL 1Q82C 3PGZA 3A7AB 4CDEC 1PTOF 4R1JA 1BBWA 4E6IA 5IT9c 1PLFA 4LFCL 2Z9HA 1WOCA 3P7JA 1MJEA 4BY1G 4C1NK 5M5YH 1ASZA 2RVLA 3EQLC 2L4NA 3A8IE 4JI5Q 2ALYB 4YY3Q 3Q8DA 1WTPA 1M8AA 1UE6A 1W3SA 4JI1Q 5C5LA 4RKLA 1NTGA 2KHJA 1SRUA 2D0PA 4K6DA 2A19A 2QEJC 4J6HA 3T1HQ 3K0XA 1X32A 3CCEA 1JJ2A 1E2VA 2MGSA 2IW3A 1KXLA 2YYZA 3CC4A 5FLXL 1EFWA 3U58A 2YTXA 4CHTB 3M3YB 2Y0SG 1AZQA 5L37A 1MKHA 5C4JH 5ISRA 1WJJA 2WFWA 1C4QA 1V1OA 5IGEA 4DR1L 4DF7A 4XQQA 2O4XA 3J80i 1IYUA 1RCVD 1VQOA 3TMEA 1E1TA 5M3FB 3TREA 3C2PA 5JPNC 1C48A 4BY7G 2E8GA 3R8BA 4R4OA 3HOZH 4RGTA 4A76A 2PZUA 2SEBD 1FL0A 1SAPA 3GV6A 5FO9B 3C46A 2NZOA 4DV7L 1KDCA 3NQTA 1O7ZA 4IPDA 4GLXA 2F4VQ 4DKAC 4FO2A 1VQJA 4ZCKA 1Q81C 1II3A 1V1PA 2KA7A 5JEAG 3K57A 1SNPA 4PNYA 1RJTA 1Q86C 2K7VA 2Z6KC 3J80c 1N9WA 1XWEA 4FXKC 3OWEB 1AP0A 2VUMG 2F52A 2KVMA 2L55A 3I4MB 4CBVA 1HNXL 2NVXB 4LF5L 3A7LA 1SNOA 2HD3A 4HMIA 4DV6Q 2B29A 1EQTA 4X64Q 1JT8A 2N78A 1K3RA 3RN5A 3GD7A 3RZDH 3K6OA 2I5MX 1Q8KA 3CCMA
chains in the Genus database with same CATH topology
4YY3L 1AE2A 1Q12A 4NXNQ 3L7ZC 4JI1L 3HKZE 2MO1A 1PH5A 1XNQQ 3ZJYC 2ES2A 3PO3G 1Z47A 3T1HL 2GVAA 2NVYH 4IJHA 3CCRA 4DR7L 4NXMQ 1TWGH 2OQ0A 2N3SA 3E9HA 3ICEA 1UE1A 5BR8L 3KJPA 1S40A 2OWOA 4IOCA 1YZ6A 1B70B 3OTOQ 4DUYQ 1PHJA 1YHBA 1G51A 4HJ9A 2NZHA 4LFAQ 4YWKA 4HJ5A 2KENA 3W1BA 4JI6L 3S2HH 1YITA 2UXCQ 1OTCA 1Z9FA 3EN2A 1N8RC 1ASYA 4A3DG 1IBLQ 2UXDL 4KHPQ 1JJGA 2CWAA 5IP7H 3ULJA 1VQPA 1LM0A 4UP8A 4HIKA 4GOPA 4LF7Q 1N33Q 3PCOB 4IO9A 3KFUA 1XPUA 3H0GG 4PZ8A 3W1GA 1LUZA 3WWVA 5IYBG 1B8AA 4HJ8A 3NBHB 4A3JG 3GTKH 4P74A 1Y1VH 1VQ6A 3GO5A 1KD1C 3CXCA 3HOYG 3CCLA 2IX1A 2UU9L 2VL6A 5IP9H 4LF6L 3HOVG 3F1ZA 3HOUG 1IL2A 4DV2L 3TRZA 1VQ5A 3G6EA 3CP0A 1FGUA 1X3FA 2GN5A 2K14A 2ZJRA 2PMZE 4DR5L 1YJNA 4A3BG 2KHIA 5C0XG 1YI2A 3CQZH 2UUCL 4BBRH 3KDFA 3KF8B 1PH7A 4OO1I 1VS0A 3F2BA 3PIOA 2CCZA 3BJUA 4B3TL 2F4VL 3RNUA 1N36Q 4BA2I 1BBUA 3S1QH 3CCMA 5ELOA 4WJ4A 1W2BA 3D31A 2XTIA 1K9MC 3HOZG 1K73C 3CCUA 3FHWA 4PMWA 3A0JA 1KL9A 4X62Q 1SROA 4LF8Q 2R93G 1MIUA 1TWHH 1LYLA 5LMNQ 3K7UC 1DGSA 3I2ZA 1IBKQ 4LF9Q 1VQ8A 4A3IH 3AEVA 4JI7Q 1HZAA 4NB3A 3I4MG 1XNRL 4K0KL 1FVIA 1PH1A 4A93G 3PF5A 4P72A 5LMUL 1A0IA 1YVCA 3KF6B 1V9PA 3RLFA 3I7FA 3S17H 2Q2UA 1HJPA 4O0AA 5M3MH 4DV6L 5E7NA 3CCQA 2OTJA 5C0XI 4X64L 2R6GA 3UE1A 4A3MG 5LMNW 2JK8A 5J3BA 1NE3A 1KC8C 4HIOA 4X65Q 1EYGA 2E2IH 2JA8G 1AE3A 1C0AA 4NXNL 4IPCA 3GDEA 1VQBA 2MO0A 2IHEA 1XNQL 5C3EG 2OQKA 4P71A 2JA5H 4B3ML 1P8LA 3I56A 4DV5Q 1K8AC 2YTYA 3PUZA 1HNWQ 3CPWA 4JV5Q 4JBKA 4PG3A 4NXML 2D0OA 4GNXA 1YIJA 1J5EQ 1WYDA 3G71A 1JE5A 3U4VA 3OTOL 4TVAB 4UPAA 2VQEQ 4DUYL 5C4XG 4Y7NH 4LFAL 2E2HH 3NENA 2UXCL 3FKIH 1EWIA 4C2MH 1QZHA 2LXKA 2UUAQ 1IBLL 1B7YB 1CKMA 4KHPL 4A3FG 3M7NA 1UE5A 1OXVA 5IYCG 1N33L 5C44H 4P73A 2WB1E 2Q2IA 4AIMA 1NY4A 3S15H 4AQYQ 1OXTA 1P16A 2GVBA 2B63H 4IOAA 3GTLH 3HKZG 4A3LH 1PV4A 4POFA 4DK3C 3S1MH 1PH8A 1Y1WH 3NEMA 3KJOA 4GKJQ 2Y0SE 2KBNA 1J6QA 4QQBX 5AJ3Q 1WFQA 2NVTH 1SR3A 1JB7A 2JEAI 3PUXA 1XNRQ 5IWAQ 3HFZB 2ZM6Q 1EOVA 1PYBA 1OXSC 2FXQA 2MNAA 4HJ7A 4DPGA 4BA1I 2BH2A 1SMXA 3LGJA 4ALPA 4YWLA 3J7ZC 3GTPH 1VQMA 4LNQA 5JJKA 3BZCA 4EX5A 1E22A 3KF6A 1N36L 2DGYA 2K52A 3E9IA 3JAMi 2EXDA 2CKZB 1E1OA 4HIDA 3S1RH 1Y1VG 4B3SL 4YCUA 2K5VA 2Z0SA 2D62A 4JC0A 1BKBA 3E0EA 5IP9G 4L5TA 2RCNA 2R7ZG 4B3MQ 5IYDH 2VNUD 3I4OA 1A62A 2BA1A 4GN5A 4X62L 4GOPC 3TS0A 4LF8L 4IPHA 2OCEA 1QUQA 5LMNL 1S72A 1IBKL 1Q1BA 2I0QA 4LF9L 4IFDI 1KIXA 3EBEA 4GN3B 3HOXH 4JI7L 3RLOA 4QIWE 4BBRG 4YHHQ 4OX9Q 1XPOA 2HT1A 5JEAJ 1E7ZA 1UE7A 4OONA 4QY7A 1XTDA 4IFDJ 4DV0Q 3J81i 1CKOA 2V1CC 3RLNA 5M3FG 1CKNB 1HZ9A 4C3IH 2VY3A 2PI2A 5M5XH 1PH4A 4DR6Q 1EQRA 2Q2HA 4KHZA 4RG1A 3U4ZA 4X65L 4JI4Q 2IHFA 1Y14B 4DR3Q 2UUBQ 2ZJQA 1VCIA 5FJ8H 2L15A 1M90C 4GNXB 3RR5A 4MNOA 1K83H 1SLJA 5M5WH 1NBWA 1TWFH 4A3IG 2JEBI 5GQOA 4DV5L 1QZGA 1N34Q 1HNWL 4DV4Q 4JV5L 3F2DA 1BVSA 3UDGA 3H3VH 1E24A 1N32Q 2LXJA 1J5EL 4UP7A 2R92H 2QEXA 2AWNA 3KYHC 1D8LA 2VQEL 4A3EH 5M3MG 3HOWH 1X65A 4X66Q 1JJCB 2UUAL 1XMQQ 1VQGA 1AH9A 1HR0Q 4JI8Q 4B3SQ 2HQLA 4DAMA 5H1SE 1PH6A 3CF5A 3M85A 1X3GA 1NMGA 3GTOH 5GAGC 3CC7A 1LTLA 1C7YA 4AQYL 2Q2TA 2JA5G 2YU9H 1FJGQ 3PO3H 1KRSA 3D0FA 3PUVA 2I5HA 2JA7H 1I5FA 4L5SA 4KI0A 2IX0A 3HKSA 4GKJL 1D7QA 4OWXB 1HR0W 1QVCA 5AJ3L 3J81j 2WAQG 5FLMH 3PO2G 1C9OA 3RZOH 3W5OA 1VQAA 2A1AA 2ASBA 5GAEC 2ID0A 5IWAL 3L2PA 4A3DH 2ZTEA 2ZM6L 1K0RA 2PI2E 3KLWA 3PV0A 4R4QA 2YTVA 4GS3A 5HGQA 2R7FA 3CMEA 2IY5B 4ME3A 1CUKA 2K4KA 5DLQE 4GNXC 2HHHQ 1YHQA 4A3CH 2B63G 4QL5A 1HZCA 1UWVA 2CFMA 4A3LG 4IPGA 1CKNA 2AWOA 1Q7YC 1T9HA 5C0XJ 1QUQB 1L1OA 2K5HA 3M9BA 5GROA 1PH3A 3GTMH 1UEBA 5HY6A 1VQ9A 4A3GG 3PUYA 4P75A 1NMFA 2PNHA 4A3BH 1YNXA 1IBML 4DK6C 4A3KH 3OW2A 3K80C 1CSPA 4AYBE 1M1KC 2JA6H 4GKKQ 2F3IA 4YHHL 4OX9L 1TXYA 1XJVA 1I94Q 2B3GA 4BY1H 4JBJA 1GKHA 4JCVE 1PVOA 2HIVA 3ER0A 1SE8A 5GADC 3T1YQ 3KOJA 1VQEA 1NJIC 4DV0L 4MZ9A 4JBMA 4WJ3M 4YCWA 3K8AA 3AYHB 5ELNA 2UXBQ 4PZ7A 4JI3Q 1KHIA 4H02A 4DR6L 1XMOQ 4DR4Q 5IYDG 3CMAA 4LWCA 2BA0A 4JI4L 4BXXH 2UUBL 4DR3L 2RHQB 3NELA 4BBSH 2C35B 1IZ6A 2KCMA 4JI0Q 1IYJB 2VZAA 4LFCQ 1PFSA 3TQYA 1A63A 1N34L 5K36G 3HOXG 2KCTA 3CW2C 4DV4L 4DUZQ 3UDXA 3FP9A 4DR2Q 1N32L 5GAHC 1VQ7A 3CCVA 3M4QA 4DV3Q 5IP7G 2NN6G 3ULPA 4X66L 2BH8A 4A3MH 3K81C 3M4PA 1WCMH 2MQHA 3AQQA 3EIVA 3SGIA 3UDIA 1XMQL 4JI2Q 1OXUA 3CPFA 1HR0L 3CCJA 4JI8L 3F2CA 4BY7H 5JJLA 4LF4Q 3A5UA 5IE8A 2MFIA 3CC2A 5IY0A 1I3QH 1L0WA 2VQFQ 4OXPA 1PA6A 1FJGL 4LUVA 2ZJPA 1QVGA 4LUZA 4XTCS 1EIYB 3S14H 2HIXA 4NPSA 1XPRA 3UDFA 1PH2A 5EAYA 1VQDA 4DNIA 1X54A 1QVFA 1IBMQ 1X55A 2R92G 2Z6KA 1VQNA 1HH2P 4OWTB 1GVPA 1S3OA 1VQIA 4X6AH 4JOIA 2PQAA 4O2DA 4POGA 3G4SA 1WI5A 1X6OA 3DM3A 3L0OA 4PZ6A 4JI5L 2RF4A 4APVA 5IYCH 1K8GA 2R7DA 2JE6I 2H5XA 3ERSX 2NN6I 1L1OB 2ZTDA 2HHHL 4B3RQ 1GO3E 1EIFA 4YCVA 4C3JH 2N49A 2ATWA 4GLVB 2JA7G 3CD6A 4LFBQ 3JC66 1V1QA 4OO1G 1GD7A 4DV7Q 2NVQH 1X9NA 3STBD 3JAMc 4R4TA 4HIMA 3GTQH 2JQOA 1E3PA 1U5KA 2CQOA 3BZKA 3PUWA 4LUOA 5FLMG 4R4CA 4JYAL 2VUMH 3B6YA 1VQLA 3DLLA 1YJWA 1RIPA 2OTLA 3I4NH 3AFPA 2EIFA 3MXNB 3GTJH 2QGQA 3H3VI 4GKKL 3AFQA 4FDBA 1G6PA 3S24A 1L2FA 1PH9A 1I94L 1IXRA 2E5LQ 4AH6A 4DV1Q 3T1YL 1EQQA 3H15A 3A5ZB 4C3HH 3TS2A 2IT1A 3PIPA 4A3CG 4KLKA 4RMFA 3IRBA 2UXBL 2E2JH 4Y52H 1KRTA 4JI3L 1SFOH 1YHAA 2N8NA 1A8VA 4OWWB 2R7ZH 1XMOL 3A74A 1Q82C 4DR4L 3PGZA 4GLAC 2JA9A 3CCSA 1HNZQ 3J81c 2AKWB 4R1JA 2XGTA 1BBWA 5IT9c 4JI0L 2QA4A 4LFCL 1HNXQ 4LF5Q 1WOCA 4A3KG 3UE0A 3M3YH 1TWAH 1MJEA 2JA6G 1TWCH 4DUZL 4DR2L 4BY1G 1ASZA 5M5YH 1YBYA 3FKIG 4MTNA 4AYBG 2K5NA 1L1OC 4JI5Q 1CSQA 2ALYB 4YY3Q 4DV3L 3Q8DA 4L5RC 5M3FH 1UE6A 1I50H 3M4OH 1W3SA 4JI1Q 3PSIA 3H0GH 5C44G 5IYBH 4A3JH 1NTGA 2DUDA 4JI2L 2KHJA 1V43A 1SRUA 2D0PA 2A19A 3T1HQ 3K0XA 4LF4L 2WB1G 3CCEA 1JJ2A 3HOYH 2YV5A 4BBSG 1X3EA 4BXXG 4DR7Q 2VQFL 1Y1WG 3HOVH 3BU2A 1RL2A 4L5QA 5BR8Q 3HOUH 1KXLA 2YYZA 3OYYA 2JJQA 4UY8C 3S2DH 3MEFA 3CC4A 1EFWA 4JYAQ 2EQSA 4JG2A 3U58A 4JI6Q 2YTXA 1HZBA 2Y0SG 1H95A 1MKHA 4R4IA 5C4JH 2UXDQ 3F8TA 1WJJA 2PQAB 2WFWA 4DR1L 2WP8J 4TQUS 1YJ9A 1Q46A 3J80i 1O7IA 1VQ4A 1WCMG 1VQOA 3I55A 1E1TA 3TREA 1X56A 4BY7G 2AHOB 1EUJA 2E8GA 1GM5A 2ZTCA 1VQKA 2UU9Q 4LW1A 4LF6Q 1G291 4R4OA 3HOZH 4A76A 4B3RL 2LSSA 4DV2Q 1Q1EA 1FL0A 2WAQE 2R93H 1OXXK 3VDYA 1MJCA 2RHSB 4GN4B 4A75A 4LFBL 2NZOA 4DV7L 4DR5Q 3S1NH 2K50A 3CAMA 3PO2H 2UUCQ 1JMCA 4EQ5A 4IPDA 4GOPB 1KAWA 3I4MH 4GLXA 4HJAA 2NVXH 2A8VA 2I5LX 2F4VQ 4B3TQ 4DKAC 4A93H 4JBWA 1I6HH 1YEZA 2VW9A 1VQJA 1Q81C 1VQHA 4LF7L 2E5LL 1VQFA 4DV1L 1R9TH 5JEAG 4J15A 4DAYB 4UP9A 4YWMA 4XIGS 2JA8H 1Q86C 4IFDG 2VS1A 2CWPA 2Z6KC 3J80c 3J7A5 5FJ8G 1N9WA 4QJFA 4QGUA 5C3EH 4JOIC 1U0LA 4IJLA 4A3GH 1HNZL 3KDFB 3U50C 3K7AH 2VUMG 4K0KQ 2F52A 1PYSB 1SN8A 5LMUQ 5FLXc 3RN2A 3I4NG 1HNXL 4LF5L 5C4XH 3G48A 4DR1Q 4DV6Q 2AMCB 4A3EG 2B29A 3HOWG 1KQSA 4X64Q 1JT8A 2N78A 1K3RA 3RN5A 3GTGH 3S16H 3ULLA 4A4IA 2K75A 3GD7A 3STBC 3RZDH 4A3FH 2I5MX 1Q8KA 3TEHB 1VQCA 3PF4A 5JJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 L;  1AE2 A;  1Q12 A;  4NXN Q;  3L7Z C;  4JI1 L;  3HKZ E;  2MO1 A;  1PH5 A;  1XNQ Q;  3ZJY C;  2ES2 A;  3PO3 G;  1Z47 A;  3T1H L;  2GVA A;  2NVY H;  4IJH A;  3CCR A;  4DR7 L;  4NXM Q;  1TWG H;  2OQ0 A;  2N3S A;  3E9H A;  3ICE A;  1UE1 A;  5BR8 L;  3KJP A;  1S40 A;  2OWO A;  4IOC A;  1YZ6 A;  1B70 B;  3OTO Q;  4DUY Q;  1PHJ A;  1YHB A;  1G51 A;  4HJ9 A;  2NZH A;  4LFA Q;  4YWK A;  4HJ5 A;  2KEN A;  3W1B A;  4JI6 L;  3S2H H;  1YIT A;  2UXC Q;  1OTC A;  1Z9F A;  3EN2 A;  1N8R C;  1ASY A;  4A3D G;  1IBL Q;  2UXD L;  4KHP Q;  1JJG A;  2CWA A;  5IP7 H;  3ULJ A;  1VQP A;  1LM0 A;  4UP8 A;  4HIK A;  4GOP A;  4LF7 Q;  1N33 Q;  3PCO B;  4IO9 A;  3KFU A;  1XPU A;  3H0G G;  4PZ8 A;  3W1G A;  1LUZ A;  3WWV A;  5IYB G;  1B8A A;  4HJ8 A;  3NBH B;  4A3J G;  3GTK H;  4P74 A;  1Y1V H;  1VQ6 A;  3GO5 A;  1KD1 C;  3CXC A;  3HOY G;  3CCL A;  2IX1 A;  2UU9 L;  2VL6 A;  5IP9 H;  4LF6 L;  3HOV G;  3F1Z A;  3HOU G;  1IL2 A;  4DV2 L;  3TRZ A;  1VQ5 A;  3G6E A;  3CP0 A;  1FGU A;  1X3F A;  2GN5 A;  2K14 A;  2ZJR A;  2PMZ E;  4DR5 L;  1YJN A;  4A3B G;  2KHI A;  5C0X G;  1YI2 A;  3CQZ H;  2UUC L;  4BBR H;  3KDF A;  3KF8 B;  1PH7 A;  4OO1 I;  1VS0 A;  3F2B A;  3PIO A;  2CCZ A;  3BJU A;  4B3T L;  2F4V L;  3RNU A;  1N36 Q;  4BA2 I;  1BBU A;  3S1Q H;  3CCM A;  5ELO A;  4WJ4 A;  1W2B A;  3D31 A;  2XTI A;  1K9M C;  3HOZ G;  1K73 C;  3CCU A;  3FHW A;  4PMW A;  3A0J A;  1KL9 A;  4X62 Q;  1SRO A;  4LF8 Q;  2R93 G;  1MIU A;  1TWH H;  1LYL A;  5LMN Q;  3K7U C;  1DGS A;  3I2Z A;  1IBK Q;  4LF9 Q;  1VQ8 A;  4A3I H;  3AEV A;  4JI7 Q;  1HZA A;  4NB3 A;  3I4M G;  1XNR L;  4K0K L;  1FVI A;  1PH1 A;  4A93 G;  3PF5 A;  4P72 A;  5LMU L;  1A0I A;  1YVC A;  3KF6 B;  1V9P A;  3RLF A;  3I7F A;  3S17 H;  2Q2U A;  1HJP A;  4O0A A;  5M3M H;  4DV6 L;  5E7N A;  3CCQ A;  2OTJ A;  5C0X I;  4X64 L;  2R6G A;  3UE1 A;  4A3M G;  5LMN W;  2JK8 A;  5J3B A;  1NE3 A;  1KC8 C;  4HIO A;  4X65 Q;  1EYG A;  2E2I H;  2JA8 G;  1AE3 A;  1C0A A;  4NXN L;  4IPC A;  3GDE A;  1VQB A;  2MO0 A;  2IHE A;  1XNQ L;  5C3E G;  2OQK A;  4P71 A;  2JA5 H;  4B3M L;  1P8L A;  3I56 A;  4DV5 Q;  1K8A C;  2YTY A;  3PUZ A;  1HNW Q;  3CPW A;  4JV5 Q;  4JBK A;  4PG3 A;  4NXM L;  2D0O A;  4GNX A;  1YIJ A;  1J5E Q;  1WYD A;  3G71 A;  1JE5 A;  3U4V A;  3OTO L;  4TVA B;  4UPA A;  2VQE Q;  4DUY L;  5C4X G;  4Y7N H;  4LFA L;  2E2H H;  3NEN A;  2UXC L;  3FKI H;  1EWI A;  4C2M H;  1QZH A;  2LXK A;  2UUA Q;  1IBL L;  1B7Y B;  1CKM A;  4KHP L;  4A3F G;  3M7N A;  1UE5 A;  1OXV A;  5IYC G;  1N33 L;  5C44 H;  4P73 A;  2WB1 E;  2Q2I A;  4AIM A;  1NY4 A;  3S15 H;  4AQY Q;  1OXT A;  1P16 A;  2GVB A;  2B63 H;  4IOA A;  3GTL H;  3HKZ G;  4A3L H;  1PV4 A;  4POF A;  4DK3 C;  3S1M H;  1PH8 A;  1Y1W H;  3NEM A;  3KJO A;  4GKJ Q;  2Y0S E;  2KBN A;  1J6Q A;  4QQB X;  5AJ3 Q;  1WFQ A;  2NVT H;  1SR3 A;  1JB7 A;  2JEA I;  3PUX A;  1XNR Q;  5IWA Q;  3HFZ B;  2ZM6 Q;  1EOV A;  1PYB A;  1OXS C;  2FXQ A;  2MNA A;  4HJ7 A;  4DPG A;  4BA1 I;  2BH2 A;  1SMX A;  3LGJ A;  4ALP A;  4YWL A;  3J7Z C;  3GTP H;  1VQM A;  4LNQ A;  5JJK A;  3BZC A;  4EX5 A;  1E22 A;  3KF6 A;  1N36 L;  2DGY A;  2K52 A;  3E9I A;  3JAM i;  2EXD A;  2CKZ B;  1E1O A;  4HID A;  3S1R H;  1Y1V G;  4B3S L;  4YCU A;  2K5V A;  2Z0S A;  2D62 A;  4JC0 A;  1BKB A;  3E0E A;  5IP9 G;  4L5T A;  2RCN A;  2R7Z G;  4B3M Q;  5IYD H;  2VNU D;  3I4O A;  1A62 A;  2BA1 A;  4GN5 A;  4X62 L;  4GOP C;  3TS0 A;  4LF8 L;  4IPH A;  2OCE A;  1QUQ A;  5LMN L;  1S72 A;  1IBK L;  1Q1B A;  2I0Q A;  4LF9 L;  4IFD I;  1KIX A;  3EBE A;  4GN3 B;  3HOX H;  4JI7 L;  3RLO A;  4QIW E;  4BBR G;  4YHH Q;  4OX9 Q;  1XPO A;  2HT1 A;  5JEA J;  1E7Z A;  1UE7 A;  4OON A;  4QY7 A;  1XTD A;  4IFD J;  4DV0 Q;  3J81 i;  1CKO A;  2V1C C;  3RLN A;  5M3F G;  1CKN B;  1HZ9 A;  4C3I H;  2VY3 A;  2PI2 A;  5M5X H;  1PH4 A;  4DR6 Q;  1EQR A;  2Q2H A;  4KHZ A;  4RG1 A;  3U4Z A;  4X65 L;  4JI4 Q;  2IHF A;  1Y14 B;  4DR3 Q;  2UUB Q;  2ZJQ A;  1VCI A;  5FJ8 H;  2L15 A;  1M90 C;  4GNX B;  3RR5 A;  4MNO A;  1K83 H;  1SLJ A;  5M5W H;  1NBW A;  1TWF H;  4A3I G;  2JEB I;  5GQO A;  4DV5 L;  1QZG A;  1N34 Q;  1HNW L;  4DV4 Q;  4JV5 L;  3F2D A;  1BVS A;  3UDG A;  3H3V H;  1E24 A;  1N32 Q;  2LXJ A;  1J5E L;  4UP7 A;  2R92 H;  2QEX A;  2AWN A;  3KYH C;  1D8L A;  2VQE L;  4A3E H;  5M3M G;  3HOW H;  1X65 A;  4X66 Q;  1JJC B;  2UUA L;  1XMQ Q;  1VQG A;  1AH9 A;  1HR0 Q;  4JI8 Q;  4B3S Q;  2HQL A;  4DAM A;  5H1S E;  1PH6 A;  3CF5 A;  3M85 A;  1X3G A;  1NMG A;  3GTO H;  5GAG C;  3CC7 A;  1LTL A;  1C7Y A;  4AQY L;  2Q2T A;  2JA5 G;  2YU9 H;  1FJG Q;  3PO3 H;  1KRS A;  3D0F A;  3PUV A;  2I5H A;  2JA7 H;  1I5F A;  4L5S A;  4KI0 A;  2IX0 A;  3HKS A;  4GKJ L;  1D7Q A;  4OWX B;  1HR0 W;  1QVC A;  5AJ3 L;  3J81 j;  2WAQ G;  5FLM H;  3PO2 G;  1C9O A;  3RZO H;  3W5O A;  1VQA A;  2A1A A;  2ASB A;  5GAE C;  2ID0 A;  5IWA L;  3L2P A;  4A3D H;  2ZTE A;  2ZM6 L;  1K0R A;  2PI2 E;  3KLW A;  3PV0 A;  4R4Q A;  2YTV A;  4GS3 A;  5HGQ A;  2R7F A;  3CME A;  2IY5 B;  4ME3 A;  1CUK A;  2K4K A;  5DLQ E;  4GNX C;  2HHH Q;  1YHQ A;  4A3C H;  2B63 G;  4QL5 A;  1HZC A;  1UWV A;  2CFM A;  4A3L G;  4IPG A;  1CKN A;  2AWO A;  1Q7Y C;  1T9H A;  5C0X J;  1QUQ B;  1L1O A;  2K5H A;  3M9B A;  5GRO A;  1PH3 A;  3GTM H;  1UEB A;  5HY6 A;  1VQ9 A;  4A3G G;  3PUY A;  4P75 A;  1NMF A;  2PNH A;  4A3B H;  1YNX A;  1IBM L;  4DK6 C;  4A3K H;  3OW2 A;  3K80 C;  1CSP A;  4AYB E;  1M1K C;  2JA6 H;  4GKK Q;  2F3I A;  4YHH L;  4OX9 L;  1TXY A;  1XJV A;  1I94 Q;  2B3G A;  4BY1 H;  4JBJ A;  1GKH A;  4JCV E;  1PVO A;  2HIV A;  3ER0 A;  1SE8 A;  5GAD C;  3T1Y Q;  3KOJ A;  1VQE A;  1NJI C;  4DV0 L;  4MZ9 A;  4JBM A;  4WJ3 M;  4YCW A;  3K8A A;  3AYH B;  5ELN A;  2UXB Q;  4PZ7 A;  4JI3 Q;  1KHI A;  4H02 A;  4DR6 L;  1XMO Q;  4DR4 Q;  5IYD G;  3CMA A;  4LWC A;  2BA0 A;  4JI4 L;  4BXX H;  2UUB L;  4DR3 L;  2RHQ B;  3NEL A;  4BBS H;  2C35 B;  1IZ6 A;  2KCM A;  4JI0 Q;  1IYJ B;  2VZA A;  4LFC Q;  1PFS A;  3TQY A;  1A63 A;  1N34 L;  5K36 G;  3HOX G;  2KCT A;  3CW2 C;  4DV4 L;  4DUZ Q;  3UDX A;  3FP9 A;  4DR2 Q;  1N32 L;  5GAH C;  1VQ7 A;  3CCV A;  3M4Q A;  4DV3 Q;  5IP7 G;  2NN6 G;  3ULP A;  4X66 L;  2BH8 A;  4A3M H;  3K81 C;  3M4P A;  1WCM H;  2MQH A;  3AQQ A;  3EIV A;  3SGI A;  3UDI A;  1XMQ L;  4JI2 Q;  1OXU A;  3CPF A;  1HR0 L;  3CCJ A;  4JI8 L;  3F2C A;  4BY7 H;  5JJL A;  4LF4 Q;  3A5U A;  5IE8 A;  2MFI A;  3CC2 A;  5IY0 A;  1I3Q H;  1L0W A;  2VQF Q;  4OXP A;  1PA6 A;  1FJG L;  4LUV A;  2ZJP A;  1QVG A;  4LUZ A;  4XTC S;  1EIY B;  3S14 H;  2HIX A;  4NPS A;  1XPR A;  3UDF A;  1PH2 A;  5EAY A;  1VQD A;  4DNI A;  1X54 A;  1QVF A;  1IBM Q;  1X55 A;  2R92 G;  2Z6K A;  1VQN A;  1HH2 P;  4OWT B;  1GVP A;  1S3O A;  1VQI A;  4X6A H;  4JOI A;  2PQA A;  4O2D A;  4POG A;  3G4S A;  1WI5 A;  1X6O A;  3DM3 A;  3L0O A;  4PZ6 A;  4JI5 L;  2RF4 A;  4APV A;  5IYC H;  1K8G A;  2R7D A;  2JE6 I;  2H5X A;  3ERS X;  2NN6 I;  1L1O B;  2ZTD A;  2HHH L;  4B3R Q;  1GO3 E;  1EIF A;  4YCV A;  4C3J H;  2N49 A;  2ATW A;  4GLV B;  2JA7 G;  3CD6 A;  4LFB Q;  3JC6 6;  1V1Q A;  4OO1 G;  1GD7 A;  4DV7 Q;  2NVQ H;  1X9N A;  3STB D;  3JAM c;  4R4T A;  4HIM A;  3GTQ H;  2JQO A;  1E3P A;  1U5K A;  2CQO A;  3BZK A;  3PUW A;  4LUO A;  5FLM G;  4R4C A;  4JYA L;  2VUM H;  3B6Y A;  1VQL A;  3DLL A;  1YJW A;  1RIP A;  2OTL A;  3I4N H;  3AFP A;  2EIF A;  3MXN B;  3GTJ H;  2QGQ A;  3H3V I;  4GKK L;  3AFQ A;  4FDB A;  1G6P A;  3S24 A;  1L2F A;  1PH9 A;  1I94 L;  1IXR A;  2E5L Q;  4AH6 A;  4DV1 Q;  3T1Y L;  1EQQ A;  3H15 A;  3A5Z B;  4C3H H;  3TS2 A;  2IT1 A;  3PIP A;  4A3C G;  4KLK A;  4RMF A;  3IRB A;  2UXB L;  2E2J H;  4Y52 H;  1KRT A;  4JI3 L;  1SFO H;  1YHA A;  2N8N A;  1A8V A;  4OWW B;  2R7Z H;  1XMO L;  3A74 A;  1Q82 C;  4DR4 L;  3PGZ A;  4GLA C;  2JA9 A;  3CCS A;  1HNZ Q;  3J81 c;  2AKW B;  4R1J A;  2XGT A;  1BBW A;  5IT9 c;  4JI0 L;  2QA4 A;  4LFC L;  1HNX Q;  4LF5 Q;  1WOC A;  4A3K G;  3UE0 A;  3M3Y H;  1TWA H;  1MJE A;  2JA6 G;  1TWC H;  4DUZ L;  4DR2 L;  4BY1 G;  1ASZ A;  5M5Y H;  1YBY A;  3FKI G;  4MTN A;  4AYB G;  2K5N A;  1L1O C;  4JI5 Q;  1CSQ A;  2ALY B;  4YY3 Q;  4DV3 L;  3Q8D A;  4L5R C;  5M3F H;  1UE6 A;  1I50 H;  3M4O H;  1W3S A;  4JI1 Q;  3PSI A;  3H0G H;  5C44 G;  5IYB H;  4A3J H;  1NTG A;  2DUD A;  4JI2 L;  2KHJ A;  1V43 A;  1SRU A;  2D0P A;  2A19 A;  3T1H Q;  3K0X A;  4LF4 L;  2WB1 G;  3CCE A;  1JJ2 A;  3HOY H;  2YV5 A;  4BBS G;  1X3E A;  4BXX G;  4DR7 Q;  2VQF L;  1Y1W G;  3HOV H;  3BU2 A;  1RL2 A;  4L5Q A;  5BR8 Q;  3HOU H;  1KXL A;  2YYZ A;  3OYY A;  2JJQ A;  4UY8 C;  3S2D H;  3MEF A;  3CC4 A;  1EFW A;  4JYA Q;  2EQS A;  4JG2 A;  3U58 A;  4JI6 Q;  2YTX A;  1HZB A;  2Y0S G;  1H95 A;  1MKH A;  4R4I A;  5C4J H;  2UXD Q;  3F8T A;  1WJJ A;  2PQA B;  2WFW A;  4DR1 L;  2WP8 J;  4TQU S;  1YJ9 A;  1Q46 A;  3J80 i;  1O7I A;  1VQ4 A;  1WCM G;  1VQO A;  3I55 A;  1E1T A;  3TRE A;  1X56 A;  4BY7 G;  2AHO B;  1EUJ A;  2E8G A;  1GM5 A;  2ZTC A;  1VQK A;  2UU9 Q;  4LW1 A;  4LF6 Q;  1G29 1;  4R4O A;  3HOZ H;  4A76 A;  4B3R L;  2LSS A;  4DV2 Q;  1Q1E A;  1FL0 A;  2WAQ E;  2R93 H;  1OXX K;  3VDY A;  1MJC A;  2RHS B;  4GN4 B;  4A75 A;  4LFB L;  2NZO A;  4DV7 L;  4DR5 Q;  3S1N H;  2K50 A;  3CAM A;  3PO2 H;  2UUC Q;  1JMC A;  4EQ5 A;  4IPD A;  4GOP B;  1KAW A;  3I4M H;  4GLX A;  4HJA A;  2NVX H;  2A8V A;  2I5L X;  2F4V Q;  4B3T Q;  4DKA C;  4A93 H;  4JBW A;  1I6H H;  1YEZ A;  2VW9 A;  1VQJ A;  1Q81 C;  1VQH A;  4LF7 L;  2E5L L;  1VQF A;  4DV1 L;  1R9T H;  5JEA G;  4J15 A;  4DAY B;  4UP9 A;  4YWM A;  4XIG S;  2JA8 H;  1Q86 C;  4IFD G;  2VS1 A;  2CWP A;  2Z6K C;  3J80 c;  3J7A 5;  5FJ8 G;  1N9W A;  4QJF A;  4QGU A;  5C3E H;  4JOI C;  1U0L A;  4IJL A;  4A3G H;  1HNZ L;  3KDF B;  3U50 C;  3K7A H;  2VUM G;  4K0K Q;  2F52 A;  1PYS B;  1SN8 A;  5LMU Q;  5FLX c;  3RN2 A;  3I4N G;  1HNX L;  4LF5 L;  5C4X H;  3G48 A;  4DR1 Q;  4DV6 Q;  2AMC B;  4A3E G;  2B29 A;  3HOW G;  1KQS A;  4X64 Q;  1JT8 A;  2N78 A;  1K3R A;  3RN5 A;  3GTG H;  3S16 H;  3ULL A;  4A4I A;  2K75 A;  3GD7 A;  3STB C;  3RZD H;  4A3F H;  2I5M X;  1Q8K A;  3TEH B;  1VQC A;  3PF4 A;  5JJI A; 
#chains in the Genus database with same CATH topology
 1I4R A;  1MBY A;  4RH6 A;  1Z7T A;  1PH5 A;  3GTL B;  3ZJY C;  3PO3 G;  1Z47 A;  5C3E B;  4KHV A;  2NVY H;  3BVZ A;  1SNM A;  2OQ0 A;  2N3S A;  2NVT B;  2F0N A;  5FK9 C;  1UE1 A;  1ESF A;  1YZ6 A;  1ET9 A;  5IOD A;  2CH4 W;  2MUY A;  1YIT A;  1ASY A;  1CHP D;  4A3D G;  1PFM A;  1JWM D;  2EOT A;  3ULJ A;  2WIN B;  3FPU B;  5JOB A;  3BS1 A;  1O78 A;  4RA8 A;  4X3S A;  3R2I A;  1XPU A;  4BS9 A;  1DD2 A;  1LUZ A;  4HJ8 A;  4A3J G;  3NBH B;  3D4R A;  3D4D A;  3KUP A;  3BVG A;  1CHQ D;  3GO5 A;  3EFX D;  3HOY G;  3OPO A;  2UU9 L;  5IP9 H;  4EGV A;  1IL2 A;  3A56 A;  3G6E A;  2GN5 A;  2K14 A;  2ZXP A;  1YJN A;  3S2H B;  4A3B G;  1TVX A;  1YI2 A;  4OHJ A;  2UUC L;  3KF8 B;  4OO1 I;  1ENC A;  3BJU A;  2Z6B A;  4BA2 I;  5ELO A;  3TBI B;  4DK0 A;  5G3L D;  1CFM A;  2MPM A;  5M5W B;  1KL9 A;  1TWF B;  4LF8 Q;  1SRO A;  1XYI A;  2R93 G;  1MIU A;  1LYL A;  3K7U C;  3I2Z A;  4N9T A;  5CBE E;  2AUK A;  3AEV A;  1HZA A;  5T1G A;  2B2W A;  3CQZ B;  3PF5 A;  3S17 H;  5LMU L;  1D2B A;  1STN A;  3KF6 B;  2Q2U A;  5E7N A;  3CCQ A;  1HA6 A;  2R6G A;  5LMN W;  2JK8 A;  5COY A;  1AE3 A;  1LAB A;  1PFN A;  4KKU A;  2F0K A;  1XNQ L;  1KDB A;  2JA5 H;  4DXF A;  4JBK A;  5D65 A;  3RUZ A;  1JIC A;  3T16 A;  1YIJ A;  3K5M A;  4FXG C;  3OTO L;  4UPA A;  3K5N A;  4R8I A;  2UXC L;  4C2M H;  1QZH A;  1IBL L;  1B7Y B;  1Y8P B;  1KAA A;  4A3F G;  1WVL A;  1IW7 C;  1F9P A;  1L0Y B;  3NPP A;  2E2I B;  2O2L D;  2SOB A;  1OXT A;  1P16 A;  2B63 H;  3GTL H;  2IPK D;  1CA6 A;  4X3T A;  4DK3 C;  3T4A C;  4FNF A;  1V8Q A;  4QQB X;  5AJ3 Q;  1E0B A;  3P75 A;  2NVT H;  1B9M A;  1SR3 A;  1JB7 A;  1XNR Q;  1H9K A;  3HFZ B;  2ZM6 Q;  3DWQ A;  1PYB A;  3FKI B;  1OXS C;  2MNA A;  4ALP A;  4YWL A;  3PIO 3;  1VQM A;  4LNQ A;  1Q3L A;  4EX5 A;  4LJZ C;  2EXD A;  4B3S L;  1E1O A;  4CDF C;  2K5V A;  4I7Z C;  1I4G A;  2D62 A;  2K32 A;  1ICF B;  2Z4I A;  2EVB A;  4ZKB B;  3J81 L;  2A68 D;  2RCN A;  4B3M Q;  2X6G A;  3DXJ C;  2BA1 A;  4KKT A;  4X62 L;  3TS0 A;  5M9O A;  5LMN L;  1IBK L;  3MFY A;  4LF9 L;  4KD4 A;  2F0D A;  4QIW E;  1AEX A;  3KBX A;  4OON A;  3L9A X;  3BG3 A;  1QWY A;  3GV3 A;  3DEP A;  1NNX A;  1CKO A;  5EJW A;  1WD1 A;  5JAV A;  1GHJ A;  1SXT A;  4WOR A;  2DJF C;  3MWY W;  4PMB A;  4C3I H;  4DR6 Q;  2Q2H A;  4ZLT F;  3I90 A;  3U4Z A;  4X65 L;  2B2V A;  2K6A A;  1Y14 B;  4DR3 Q;  5CBA E;  1HQM C;  3NUC A;  3RR5 A;  5M5W H;  1RDP D;  5KRU A;  1TWF H;  2F03 A;  5GQO A;  1BCP F;  1DCZ A;  4DV4 Q;  3UDG A;  4X3K A;  3H3V H;  1EIG A;  1E24 A;  1N32 Q;  1HQR D;  2LXJ A;  2XIW A;  4UP7 A;  1A2U A;  2EYJ A;  3IAY A;  4QIW B;  1JJC B;  2UUA L;  1WD0 A;  1AH9 A;  3SDZ A;  4JI8 Q;  1BUV T;  4DAM A;  1PH6 A;  3CF5 A;  1EEF D;  1NMG A;  1ZEQ X;  3IFT A;  2KJX A;  1C7Y A;  3PO3 H;  1QE6 A;  2RDG A;  3VR6 A;  4M8A A;  1QVC A;  3W5O A;  1VQA A;  2ASB A;  3GTJ B;  4A3E B;  4XQN A;  5EKL A;  1A15 A;  3FRP B;  4A3D H;  3HOW B;  4N9P A;  1EZ6 A;  1PZI D;  3OMC A;  1RHP A;  2YTV A;  3LNN A;  1ZXT A;  4GS3 A;  5HGQ A;  2L12 A;  4G57 A;  1JQY D;  4RCO A;  3CME A;  1CUK A;  3ZYY X;  4A3C H;  4QL5 A;  1UWV A;  2BCO A;  4CJ0 B;  2YU9 B;  2AWO A;  4ODG A;  1QUQ B;  2K5H A;  2JA7 B;  4CJ2 C;  1B2T A;  4A3G G;  2H4O A;  4A3B H;  2NYZ D;  4A3K H;  3OW2 A;  1CSP A;  2HDM A;  4AYB E;  4GKK Q;  1CA5 A;  1MGS A;  2F3I A;  2QW7 A;  4JBJ A;  1GKH A;  4R9W A;  5FO7 B;  2HIV A;  2VB2 X;  3H0G B;  4DV0 L;  4MZ9 A;  4MIU A;  2NTT A;  1XMO Q;  3H3V C;  3CMA A;  4JI4 L;  5DEH A;  2RHQ B;  3NEL A;  1YNJ C;  2F0J A;  4RKB A;  2C35 B;  1U4L A;  4LFC Q;  1MD2 D;  1NUC A;  1N34 L;  2NZ1 D;  1SYF A;  2VB3 X;  3QIA A;  3HOX G;  2KCT A;  1D1I A;  1GOZ A;  2C5C A;  1O7L A;  5GAH C;  2EXZ A;  2FMC A;  2A74 C;  3CCV A;  4AYB B;  5IP7 G;  3ULP A;  1LLR D;  3AQQ A;  1WTX A;  1PTO H;  3K5L A;  2XSC A;  2JSO A;  5JJL A;  5IE8 A;  3HGB A;  5IY0 A;  1JOO A;  3NWT A;  1FD7 D;  1EIY B;  1QVG A;  5I2X A;  3S14 H;  5K5P A;  4NPS A;  1XPR A;  1PH2 A;  3DWP A;  1IBM Q;  1X55 A;  5CC4 A;  1VQN A;  2G5D A;  1EOT A;  3VR2 A;  4HAE A;  4JOI A;  3N6R A;  4RAU C;  1WCM B;  2K5Q A;  1WI5 A;  1X6O A;  5EPJ A;  3L0O A;  1CQF A;  3G4S A;  1R9T B;  1I4Q A;  1SND A;  3OWF A;  3ERS X;  4ABN A;  1PRT F;  1U4R A;  1GUT A;  3JC6 6;  1NAP A;  4DV7 Q;  3JAM c;  3MHB A;  5C4X B;  2M9V A;  4MN3 A;  4ZYS A;  1VQL A;  1YJW A;  1JR0 D;  1RIP A;  3MXN B;  3GTJ H;  1G6P A;  2A69 C;  3S24 A;  1IXR A;  3Q24 A;  2B2T C;  3DUZ A;  4AH6 A;  5CV9 A;  3SK5 A;  4YIJ A;  2IT1 A;  4B08 A;  5CR3 A;  1TS5 A;  4IUP A;  1EY9 A;  4RMF A;  2UXB L;  3MC0 B;  4C3J B;  4Y52 H;  3A74 A;  1BBX C;  2A69 D;  2NVQ B;  3GTQ B;  3J81 c;  2XGT A;  1HNX Q;  2QF7 A;  4LF5 Q;  1HHV A;  1ICW A;  2JA6 G;  1PTO C;  1TWC H;  2IX3 A;  1HRJ A;  4MTN A;  1FNU A;  1K3B C;  2F1M A;  2C9O A;  1GUW A;  1LT3 D;  5HGT A;  3AU7 A;  4L5R C;  4C3H B;  3H0G H;  5DAU A;  5EKI A;  5C44 G;  5IYB H;  2DUD A;  4ULL A;  4JI2 L;  3J80 L;  1SFO B;  1PTO D;  2WB1 G;  2WAC A;  3K58 A;  2R7Z B;  4BBS G;  2CH4 A;  1Y1W G;  3HOV H;  3OYY A;  5KNC A;  4UY8 C;  3S2D H;  1LAC A;  4JYA Q;  4IUV A;  2SNS A;  3TN2 A;  3ND8 A;  4I7A A;  1HZB A;  1H95 A;  4R4I A;  1UUP A;  5EBD A;  2WP8 J;  4WRD A;  5IOC A;  3WDN A;  1ONL A;  1GUN A;  1LTR D;  4X3U A;  2O5I C;  4G7Z C;  1J9O A;  1VQK A;  3TP8 A;  2UU9 Q;  4LW1 A;  2E2D C;  1G29 1;  1KLG D;  1DON A;  2WAQ E;  4A3I B;  1CQV A;  1OXX K;  4LFB L;  1B4O A;  2RHS B;  4A75 A;  3OHX C;  3I72 A;  2UUC Q;  1KAW A;  2A8V A;  5M3M B;  2I5L X;  4RHR A;  2A6E D;  4XYQ A;  2PW5 A;  3E6Z X;  4LF7 L;  2E5L L;  2SDF A;  3M7G A;  1VQF A;  1R9T H;  5C4H A;  4J15 A;  2J4X A;  4DAY B;  4YWM A;  4ILW A;  1QOH A;  5C3X A;  3PIP 3;  2IJ0 A;  4IFD G;  3MAQ A;  2Q8R E;  3J7A 5;  5FJ8 G;  3D3R A;  1E2W A;  4A3G H;  3KDF B;  3QO2 A;  2WAQ B;  3K7A H;  1PYS B;  3A55 A;  5LMU Q;  1ML0 D;  3RN2 A;  3I4N G;  2FHT A;  5C4X H;  3G48 A;  4IUU A;  4F7X A;  3W3A A;  1KQS A;  1JOR A;  3ND9 A;  3K0Y A;  3STB C;  1DOK A;  3PF4 A;  5JJI A;  2EY5 A;  1Q12 A;  3HKZ E;  1XNQ Q;  1G6Z A;  4ZUJ A;  4KN4 C;  3G6J B;  4RWS C;  4IJH A;  4DFA A;  4DR7 L;  5BR8 L;  3KJP A;  4DGZ A;  4IOC A;  1B70 B;  3OTO Q;  1G51 A;  1H9R A;  4L8J A;  4YWK A;  1LTA D;  4JI6 L;  2UXC Q;  1OTC A;  4H13 C;  1Z9F A;  3EN2 A;  1N8R C;  1BF4 A;  1IBL Q;  2L9H A;  3GTP B;  2UXD L;  1JJG A;  2CWA A;  5IP7 H;  4HIK A;  4GOP A;  4DAV A;  1CI3 M;  4KV6 A;  5EQ0 A;  3IFD A;  1Y1V H;  3EVQ A;  4RGO S;  1KD1 C;  1HUM A;  3CCL A;  1B3A A;  3F1Z A;  2LKV A;  3HOU G;  4EQP A;  4QMG A;  3TRZ A;  3QWN A;  3MZ5 A;  3QB3 A;  2ZJR A;  2KCC A;  4DR5 L;  3GP7 A;  2KHI A;  5C0X G;  2K03 A;  3SEB A;  4BBR H;  1J8I A;  5I9P A;  3VR5 A;  4B3T L;  1DOM A;  3RNU A;  3AMU A;  1W2B A;  3D31 A;  5C3W A;  5M5X B;  1JE4 A;  2XTI A;  2Q8I B;  2K28 A;  1K73 C;  3CCU A;  4X62 Q;  1TWH H;  5LMN Q;  3EJI A;  5C6A A;  1IBK Q;  4UDU C;  4LF9 Q;  4A3I H;  1LTB D;  2WKC A;  2N55 A;  3RMH A;  3I4M G;  3O13 A;  2F3W A;  4K0K L;  4A93 G;  4P72 A;  4KY7 A;  1YVC A;  3SK8 A;  3RLF A;  1V9P A;  5ELC A;  2E75 C;  1HJP A;  4O0A A;  5M3M H;  2OTJ A;  1LO5 D;  3M4Y A;  3UE1 A;  3NSW A;  4A3M G;  2G9D A;  1KC8 C;  4KY6 A;  1EYC A;  4WFN 3;  4X65 Q;  2JA8 G;  4NXN L;  2VXW A;  1G2T A;  4DAP A;  1MSH A;  2MO0 A;  1B50 A;  5C3E G;  3I56 A;  1FR3 A;  2YTY A;  2EE1 A;  1HUN A;  4NXM L;  3EA6 A;  3G71 A;  1JE5 A;  1CTM A;  2PYK A;  3S17 B;  4LFA L;  1EWI A;  1LT4 D;  2UUA Q;  4KHP L;  1JC7 A;  5IYC G;  1RD9 D;  1N33 L;  5C44 H;  2HCC A;  1SYB A;  2Q8T A;  4A3L H;  2JA5 B;  1F2Y A;  3S1M H;  1PH8 A;  1Y1W H;  3NEM A;  3KJO A;  2QKI C;  1PZJ D;  1TKW B;  3A54 A;  2Y0S E;  2JEA I;  3PUX A;  2NUC A;  4C2M B;  1F2M A;  2FXQ A;  4HJ7 A;  2BH2 A;  4BA1 I;  3LGJ A;  3GTP H;  3BZC A;  1E22 A;  2RSN A;  4UAI A;  4UHV A;  3S1R H;  1C8C A;  2Z0S A;  1L0X B;  3IL8 A;  2B63 B;  2BOS A;  2VNU D;  4KD3 A;  1EYA A;  4IPH A;  2I0Q A;  1QUQ A;  1S72 A;  1EWC A;  1Q1B A;  2Y0S B;  1KIX A;  5K36 H;  3RLO A;  1XPO A;  2HT1 A;  5JEA J;  2RQX A;  2F0W A;  1BO0 A;  2CW0 D;  4DV0 Q;  1D5X C;  3I70 A;  4BY7 B;  2XNA C;  4RFB A;  2R3Z A;  4QF4 A;  3V2T A;  4DN4 M;  1WTO A;  2F0F A;  5M5X H;  1VMC A;  1A2T A;  1EQR A;  4HSV A;  1I3Q B;  4JI4 Q;  2ZJQ A;  1VCI A;  1I4X A;  5FJ8 H;  2KEC A;  4MNO A;  1QNK A;  4F87 A;  1NBW A;  1N34 Q;  2JEB I;  4DV5 L;  1B1Z A;  3F2D A;  2R92 H;  2QEX A;  4M1U B;  2AWN A;  3KYH C;  4FF4 A;  3ONA B;  1PXU A;  4P2C B;  3PQI A;  4WJW A;  4HTH A;  4Z9C B;  4S3S A;  5IGD A;  4C3I B;  1ROD A;  3M85 A;  3VYT A;  1SYD A;  4IN3 A;  3GTO H;  1BNZ A;  4AQY L;  1JWU D;  2Q2T A;  1BCP D;  3TP7 A;  1R4Q B;  2EY1 A;  2I5H A;  4KI0 A;  2IX0 A;  3T13 A;  4GKJ L;  1K28 A;  1QG7 A;  4OWX B;  1HR0 W;  1TY2 A;  2VUM B;  4OGQ C;  3PO2 G;  5I6W A;  3NBI A;  3D6C A;  4K8J A;  2DN8 A;  3RZO H;  1AFP A;  2ID0 A;  5IWA L;  3L2P A;  3H09 A;  3LWE A;  2PI2 E;  3PV0 A;  4F8M A;  1BDO A;  4NP5 A;  4GNX C;  2HCI A;  1YHQ A;  1LTG D;  2CFM A;  3PO3 B;  2Z8L A;  4IPG A;  3BZD B;  1CKN A;  1IYV A;  1NSN S;  2QCP X;  3BDO A;  4DA2 A;  3GTM H;  1JWS D;  5J22 A;  5HY6 A;  1VQ9 A;  1CZG A;  1B3Q A;  2F0Q A;  1NMF A;  2M2L A;  4A3D B;  2EJG C;  2JN4 A;  4ZAI A;  4YHH L;  1SE3 A;  2F4I A;  2B3G A;  4BY1 H;  4JCV E;  1PVO A;  5GAD C;  1I50 B;  4QB4 A;  1NJI C;  4JBM A;  4WJ3 M;  5COR A;  1NR4 A;  1S5B D;  3AYH B;  2PQE A;  2R61 A;  4OIK A;  5ELN A;  2UXB Q;  1DOL A;  1R4P B;  1I6V C;  5IYD G;  2UUB L;  3JAM L;  1DM0 B;  1IYJ B;  2VZA A;  5KND A;  2ZT9 C;  3GQB A;  4A3B B;  4A3K B;  3WOE A;  1D6E C;  5DM6 3;  1VQ7 A;  2A68 C;  2B8F A;  3M4Q A;  5FO8 B;  2NN6 G;  2BH8 A;  4A3M H;  2B2Y C;  4RCN A;  3UDI A;  4JI2 Q;  1HR0 L;  4KY5 A;  3F2C A;  4BY7 H;  2HUG A;  1I3Q H;  4OXP A;  1X3Q A;  1FJG L;  2R93 B;  4LUV A;  2RCF A;  1TS4 A;  1WTQ A;  1WTH A;  2O5J C;  2HIX A;  3CU7 A;  1AZP A;  3S1N B;  1SEB D;  2XWB B;  2EY6 A;  3E0J A;  1I6H B;  1MSG A;  2Z6K A;  3TSS A;  1HH2 P;  2K33 A;  4OWT B;  1S3O A;  3T51 B;  4GZY C;  1ET6 A;  4JI5 L;  1PTO B;  5IYC H;  3R93 A;  2RF4 A;  1GHK A;  2HDL A;  2E74 C;  2FFK B;  1K8G A;  2JE6 I;  5JEA H;  5DM7 3;  2HHH L;  3I4L A;  1U9R A;  3KBG A;  1ENF A;  2F0V A;  2N49 A;  2ATW A;  2WV6 D;  3I8Z A;  2JA7 G;  3FVQ A;  3CD6 A;  3S14 B;  4LFB Q;  2A6H D;  2D2C C;  4OO1 G;  1X9N A;  4HIM A;  1E3P A;  1PRT C;  5FLM G;  2VUM H;  3B6Y A;  5IGF A;  3SXH A;  3SR1 A;  1RKN A;  3KK7 A;  2B8G A;  4A3F B;  1STY A;  1I94 L;  1VF5 C;  4RGN A;  2E5L Q;  3A5Z B;  2RDF A;  2F0O A;  3TS2 A;  1PRT D;  2NB0 A;  4ZUI A;  4KLK A;  5IT9 E;  5IGB A;  3IRB A;  5KEE A;  4JI3 L;  4OWW B;  3OIP A;  1TWG B;  4GLA C;  2JA9 A;  1OO9 B;  5NUC A;  2AKW B;  2BDO A;  3J7A V;  3UE0 A;  1DXM A;  2EPB A;  2TMP A;  3A8K E;  1YBY A;  1V1P B;  1EY8 A;  3TZU A;  4AYB G;  1XXG A;  1L1O C;  4KKS A;  4DV3 L;  1I50 H;  2K04 A;  3M4O H;  5ELF A;  3DM1 A;  4A3J H;  2ICI A;  1SJH D;  3BVM A;  3QJY A;  4LF4 L;  4L63 B;  1SYG A;  3HOY H;  2YV5 A;  4BXX G;  4DR7 Q;  3SE0 A;  3BU2 A;  1ZYR D;  1H9S B;  5BR8 Q;  4RHS A;  2EQS A;  4JI6 Q;  1G2S A;  3CKI B;  3BYT B;  2UXD Q;  1TWC B;  4HMJ A;  4KK7 A;  4TQU S;  2BE5 C;  4ID6 A;  1O7I A;  2B39 A;  4JPB W;  1WCM G;  3I55 A;  1E2Z A;  5T1I A;  2KQ3 A;  2AHO B;  1GM5 A;  5ELB A;  2ZTC A;  4PMC A;  2QDL A;  1TQO A;  2RBM A;  4B3R L;  2LSS A;  1Q1E A;  3HOV B;  4NKL A;  2R93 H;  1SSO A;  2BE5 D;  1MJC A;  3S2D B;  4DR5 Q;  3S1N H;  2K50 A;  1QNU A;  3CAM A;  3PO2 H;  3VR4 A;  4EQ5 A;  1CK1 A;  4B3T Q;  4JBW A;  1I6H H;  1SJE D;  5C5M A;  1KNA A;  4Q5V A;  4DV1 L;  3ITP A;  4OEL B;  4UP9 A;  4XIG S;  1Q90 A;  2VS1 A;  4C3J G;  4FP5 D;  1PDQ A;  1U0L A;  4IJL A;  1HNZ L;  3U50 C;  4TKO B;  4K0K Q;  4DK1 A;  1U4M A;  4DR1 Q;  3NTH A;  4V19 0;  4HCS A;  1S5C D;  4EQN A;  3GTG H;  2HQE A;  1EY0 A;  4IUR A;  4A4I A;  1QJO A;  4A3F H;  3TEH B;  4C3H G;  4CDD C;  3S15 B;  4NXN Q;  3L7Z C;  1IKL A;  1U4P A;  5CV5 A;  4H7B A;  2ES2 A;  1DJR D;  2DNE A;  1ILQ A;  1QIL A;  3QOJ A;  4HED A;  1EL0 A;  2GVA A;  2WKD A;  4NXM Q;  4HR7 B;  1TWG H;  3E9H A;  4A3G B;  3ICE A;  1S40 A;  2OWO A;  3K7A B;  5D3I B;  1PHJ A;  3OW7 A;  1YHB A;  4LFA Q;  2KEN A;  5D14 A;  3W1B A;  3X3N A;  2F0H A;  2J7Z A;  4KHP Q;  1CT1 D;  1LM0 A;  4UP8 A;  5TSS A;  3CHB D;  1N33 Q;  3PCO B;  4IO9 A;  1ESR A;  3W1G A;  3WWV A;  3GTK H;  1PMR A;  3E5S A;  4RGM A;  1S5D D;  1KNE A;  3CXC A;  2IX1 A;  2VL6 A;  3MXG A;  4LF6 L;  3BDL A;  5A35 A;  1W6J A;  4DV2 L;  1VQ5 A;  3CP0 A;  1FGU A;  3OIQ A;  1X3F A;  2PMZ E;  5I9O A;  1QB5 D;  4KN7 C;  1VS0 A;  2KEE A;  3F2B A;  3PIO A;  5J1Z A;  4O1N A;  3S1Q H;  1NCV A;  3IKJ A;  4PQX A;  4WJ4 A;  3CRK C;  5E4W C;  1Y1V B;  3OOC A;  1K9M C;  4ZQ3 A;  3TP5 A;  2K05 A;  5AFW A;  3HOZ G;  3FHW A;  3LX0 A;  4PMW A;  3A0J A;  2CHB D;  4X6A H;  3I3C A;  1DGS A;  3W2D A;  1RTN A;  4CKE A;  1CZW A;  4NB3 A;  1XNR L;  2F0L A;  4BBR B;  3HS0 C;  2PMZ B;  5JVG 3;  3C3L A;  5C0X I;  1UAP A;  4I65 A;  4HCE A;  4FVM A;  1NE3 A;  4HIO A;  1S5F D;  1C0A A;  5F2D A;  4KMU C;  2PNR C;  4MHE A;  2A6E C;  3NBH A;  2OQK A;  2PZW A;  1TWH B;  4B3M L;  2L11 A;  4DV5 Q;  5IGG A;  3PUZ A;  1K8A C;  5CV7 A;  1IL8 A;  1STA A;  2D0O A;  4C56 C;  3R2T A;  1WYD A;  3R3O A;  4DUY L;  4Y7N H;  4K8I A;  2E2H H;  3NEN A;  4U67 3;  1PYW D;  3M7N A;  1ENA A;  3KF8 A;  1Q8I A;  1UE5 A;  4P73 A;  5KIX A;  2WB1 E;  1EEI D;  4AIM A;  1NY4 A;  2F0U A;  3FDT A;  3S15 H;  4AQY Q;  2TSS A;  3SHL A;  4JK1 C;  5JJZ A;  3K59 A;  5KYI A;  4K14 A;  4IOA A;  1PFB A;  3HKZ G;  1SNQ A;  2DJG C;  5FLX E;  1ILP A;  2EYM A;  3NQI A;  3D4W A;  4GKJ Q;  1GXD C;  1Z6H A;  5IWA Q;  1LT5 D;  1FYC A;  4DPG A;  4XQJ A;  3J7Z C;  2A73 B;  1Y8O B;  1TII D;  3KF6 A;  1N36 L;  2DGY A;  2K52 A;  3C1F A;  3E9I A;  4BWG B;  5C44 B;  1BCP B;  1GUO A;  2CKZ B;  4HID A;  2EYO A;  4YCU A;  3T56 B;  1RF2 D;  1CM9 A;  2WB1 B;  1JB3 A;  3E0E A;  4IQZ A;  2I46 A;  5IP9 G;  2QDB A;  4EVO A;  4L5T A;  3S1M B;  1Y1W B;  2EDG A;  1A62 A;  3V96 A;  2OEO A;  2X6L A;  4ME5 A;  4TSS A;  4OIJ A;  1LT6 D;  3HOX H;  1SE2 A;  4JI7 L;  2CQA A;  4YHH Q;  3MA2 B;  1UE7 A;  4IAL A;  4QY7 A;  4IFD J;  5M3F G;  1RTO A;  2LY7 A;  3S1R B;  2F0T A;  1HZ9 A;  2I07 B;  2VY3 A;  2PI2 A;  1H9J A;  4RG1 A;  4KHZ A;  2UUB Q;  3KLR A;  1M90 C;  4GNX B;  1K83 H;  4HN7 A;  3AB9 A;  3DWA A;  1JOK A;  2H1E A;  1QZG A;  5A2Q L;  1HNW L;  1EY7 A;  1WTW A;  4JV5 L;  1BVS A;  2B2U A;  1J5E L;  2F3V A;  4DXG A;  2VQE L;  2KOL A;  1D8L A;  4IUQ A;  1HR0 Q;  2MJ8 A;  4B3S Q;  2HQL A;  5H1S E;  4CKB A;  2B2W C;  4J8Q A;  2PZT A;  3CC7 A;  1A3U A;  1KDA A;  1FJG Q;  3S9W A;  1S4Z A;  2JA5 G;  1KRS A;  3L3O C;  1YNN C;  4L5S A;  2B2T A;  1DYQ A;  3HKS A;  1K8O A;  1XTC D;  1FNV A;  2RA4 A;  3I4N B;  2R92 B;  2KED A;  2XVS A;  4O42 A;  5GAE C;  3H91 A;  1SYE A;  3KLW A;  4R4Q A;  2E76 C;  1YNN D;  3DEO A;  4G4K A;  2HHH Q;  3X3M A;  2E2J B;  1LTS D;  3GTO B;  2B63 G;  1T5X D;  2SNM A;  1FGB D;  2K1B A;  1Q7Y C;  5C0X J;  1HFG A;  3D8G A;  5GRO A;  1PH3 A;  1UEB A;  5JVH 3;  3PUY A;  3VYR A;  1TY0 A;  1TWA B;  3RZO B;  2WII B;  1YNX A;  1IBM L;  2DY7 A;  3K80 C;  3MVV A;  2JA6 H;  4OX9 L;  1TXY A;  1XJV A;  1I94 Q;  1JCK B;  5BN5 A;  1LTT D;  4YCW A;  1SMY C;  1QCB D;  4PZ7 A;  4JI3 Q;  3TDQ A;  3SVM A;  4H02 A;  1GUS A;  1KLU D;  4LWC A;  2BA0 A;  3HOU B;  5DNF A;  3GTM B;  4BBS H;  5FKA C;  1IZ6 A;  3VYS A;  3MXP A;  4ZK9 B;  3RD4 A;  1EU4 A;  4KJN A;  3LWU A;  2NWG A;  1SMY D;  3FP9 A;  3UDX A;  5E3F A;  4BY1 B;  5EPK A;  1PRT B;  5J39 A;  4DV3 Q;  3TP6 A;  1HTP A;  2KCN A;  4X66 L;  3K81 C;  3M4P A;  3SGI A;  1XMQ L;  2M00 A;  3CPF A;  4C3I G;  1EWH A;  3CCJ A;  4QCL A;  1WTR A;  4LF4 Q;  3A5U A;  2MFI A;  3CC2 A;  1W6K A;  1L0W A;  2EY2 A;  5LHY 1;  1PA6 A;  2ZJP A;  2CW0 C;  1EY5 A;  3HRZ C;  3UDF A;  4N8X 1;  5EAY A;  4DNI A;  1F77 A;  1H9S A;  4A93 B;  3ERQ A;  2B2V C;  1PZK D;  1A3T A;  5C4Z A;  3SK4 A;  3OMG A;  4A3M B;  1AN8 A;  4K5V A;  4PZ6 A;  1I4H A;  2JA8 B;  2FJ2 A;  3JAM E;  2H5X A;  2NN6 I;  1L1O B;  4B3R Q;  1EIF A;  4IFD H;  3J7Y W;  1GD7 A;  4Q0F A;  1EY6 A;  1Y8N B;  3PUW A;  1STB A;  1HCZ A;  1U5K A;  3BZK A;  4JYA L;  4R4C A;  3DLL A;  3I4N H;  1DZ1 A;  2OTL A;  1BCP C;  3S16 B;  1L2F A;  1FNW A;  1PH9 A;  2ICE C;  1BR9 A;  4DV1 Q;  3T1Y L;  1F2L A;  3J81 E;  4LMQ D;  3PIP A;  4A3C G;  2OT2 A;  2E2J H;  1MHW C;  2XN9 C;  4PV1 C;  1KRT A;  2N8N A;  1A8V A;  2AQ3 B;  4DR4 L;  3CCS A;  1HNZ Q;  1LV9 A;  2F0E A;  4JI0 L;  4R8N A;  1H9M A;  2LS0 1;  2QA4 A;  4A3K G;  3M3Y H;  1TWA H;  4CDC C;  4DUZ L;  4CJ1 B;  4DR2 L;  3CRL C;  3K5O A;  3FKI G;  2K5N A;  2GA4 B;  1CSQ A;  5M3F H;  3PSI A;  2Z4H A;  1V43 A;  5LL6 X;  5EPL A;  1X3E A;  2RDH A;  2EYL A;  2VQF L;  1RL2 A;  4L5Q A;  3HOU H;  3KLS X;  5KGU A;  2JJQ A;  5CYU A;  2DNC A;  5EKK A;  3MEF A;  4K5X A;  4JG2 A;  2J0T D;  3FEW X;  5EBC A;  1F9Q A;  1HA5 A;  1HFN A;  3F8T A;  5C0X H;  2PQA B;  1YJ9 A;  1Q46 A;  4G7O C;  3C1E A;  1VQ4 A;  3M4O B;  2OXP A;  3MXN A;  4OL7 A;  1X56 A;  4A3J B;  1EUJ A;  5CV6 A;  1BQQ T;  4EQO A;  4LF6 Q;  3HOY B;  3MXU A;  4DV2 Q;  3QR8 A;  3WOF A;  2BDN A;  3VDY A;  4GN4 B;  3A8J E;  1K8M A;  2ZXO A;  4XT3 B;  3FMC A;  1JMC A;  1M4V A;  1IKM A;  2D5D A;  1TT2 A;  4GOP B;  3I4M H;  4HJA A;  1STE A;  2NVX H;  4A93 H;  1D5Z C;  2X69 A;  1YEZ A;  2VW9 A;  2IL8 A;  1VQH A;  4XYO A;  3NTK A;  2L0C A;  2JA8 H;  4C1N I;  1IHZ A;  2CWP A;  3D6W A;  4FF3 A;  4QJF A;  4QGU A;  5C3E H;  4JOI C;  5CGK A;  1IW7 D;  1EY4 A;  3PO2 B;  1SN8 A;  5FLX c;  2F0G A;  2JYO A;  4KTA A;  4A3E G;  2AMC B;  3VR3 A;  4DNR B;  3HOW G;  4FXD A;  5CV4 A;  2A6H C;  4LK1 C;  3S16 H;  3ULL A;  2K75 A;  1VQC A;  1D1K A;  4YY3 L;  4K5W A;  3I73 A;  1AE2 A;  4JI1 L;  2MO1 A;  3NK9 A;  4B9W A;  3T1H L;  1TU2 B;  1HXY D;  3FPP A;  3CCR A;  2KUM A;  2AUJ D;  1G91 A;  4DUY Q;  4HJ9 A;  2NZH A;  3S2H H;  4HJ5 A;  5E1F A;  3VYU A;  2JP1 A;  3GTG B;  2LMC B;  1VQP A;  1EQV A;  4LF7 Q;  3ERO A;  3KFU A;  3H0G G;  4PZ8 A;  5IYB G;  1B8A A;  1STH A;  4P74 A;  3HG9 A;  1VQ6 A;  1I4P A;  3NP8 A;  2OF1 A;  5G3L F;  4DAY A;  3HOV G;  2XRQ D;  5D3D A;  3DMU A;  4H44 C;  4XDX A;  3CQZ H;  3KDF A;  1PH7 A;  2CCZ A;  2F4V L;  1N36 Q;  1NR2 A;  2CVR A;  1BBU A;  1ZYR C;  5I6Y A;  1A3V A;  4XT1 B;  3GTK B;  1F2Z A;  1SDF A;  2EZV A;  2G9H D;  1STG A;  1VQ8 A;  4JI7 Q;  4DNT B;  1X3P A;  5ELD A;  1FVI A;  1PH1 A;  2PO4 A;  3QOL A;  1A0I A;  3I7F A;  5JPM C;  4DV6 L;  3S1Q B;  4X64 L;  2EYF A;  3HEJ A;  4F88 A;  5J3B A;  3VA7 A;  1EYG A;  2E2I H;  3URY A;  4IPC A;  1JOQ A;  3GDE A;  1VQB A;  1KTK A;  2IHE A;  4P71 A;  4K2K A;  2DY8 A;  1P8L A;  3DHQ A;  4OEM B;  2NBF A;  1HNW Q;  3CPW A;  4V0B A;  4JV5 Q;  4PG3 A;  1VDZ A;  4GNX A;  1J5E Q;  3SK6 A;  3U4V A;  4TVA B;  2VQE Q;  5C4X G;  1BOS A;  1B53 A;  3FKI H;  2LXK A;  4ZRZ A;  2K5D A;  1CKM A;  5I4D A;  3J80 E;  1OXV A;  1Y69 U;  1EU3 A;  2Q2I A;  2MP1 A;  3HP3 A;  4CKC A;  2GVB A;  2RSO A;  1PV4 A;  4POF A;  3NXW A;  3Q0A A;  4NMZ A;  2KBN A;  1J6Q A;  1WFQ A;  3HZX A;  2L1B A;  2A5H A;  4Y7N B;  2E2H B;  2PCF B;  1EOV A;  1VF7 A;  3P20 A;  1SMX A;  4ZKC B;  1YNJ D;  5JJK A;  4MTK A;  3JAM i;  1UNS A;  5FOB B;  1Y1V G;  1A6X A;  2F0S A;  1SYC A;  4JC0 A;  1BKB A;  3TZD A;  1XX8 A;  2R7Z G;  5IYD H;  1KAB A;  3Q6S A;  5IT9 L;  3I4O A;  4GN5 A;  4GOP C;  4LF8 L;  2AQ1 B;  2B2Y A;  3NWS A;  2OCE A;  5BN4 A;  1TS2 A;  4IFD I;  2K5W A;  3EBE A;  4GN3 B;  2EYH A;  4BBR G;  4OX9 Q;  3Q22 A;  3H94 A;  4IUN A;  1E7Z A;  4IUT A;  4HSP A;  1B9N A;  1XTD A;  4NW2 A;  2NN6 H;  3J81 i;  2V1C C;  3RLN A;  1CKN B;  5LL6 S;  1F9R A;  2B2U C;  5KNB A;  1PH4 A;  2F0P A;  2IHF A;  5ELE A;  4IZ8 A;  2L15 A;  1EIH A;  2V4D A;  4K2L A;  1SLJ A;  4A3I G;  2AQ2 B;  1HPC A;  3N52 A;  3HOX B;  3G7L A;  4FYD A;  3T53 B;  4A3E H;  5M3M G;  5BN3 A;  3HOW H;  5KYL A;  1X65 A;  4X66 Q;  1XMQ Q;  1VQG A;  1SNC A;  1SBB B;  2XWJ B;  3QG1 A;  2IWH A;  1X3G A;  2EJF C;  1EZ8 A;  2D9U A;  2JXM B;  1LTL A;  5GAG C;  4G7H C;  2YU9 H;  5CMD A;  3H6M A;  2EJM A;  1K83 B;  2NTS A;  3D0F A;  3PUV A;  1I5F A;  2JA7 H;  4OO1 H;  4B9X A;  1D7Q A;  3P1H A;  5AJ3 L;  3J81 j;  2WAQ G;  5FLM H;  1C9O A;  5IGC A;  2A1A A;  3MFG A;  2ZTE A;  2ZM6 L;  1K0R A;  4CGY B;  3KLS A;  2R7F A;  3U9O A;  2IY5 B;  4ME3 A;  3VA5 A;  2K4K A;  5DLQ E;  4QUC A;  3OSO A;  5E4X A;  3U9S A;  1WTV A;  5HUR A;  1HZC A;  5I2Y A;  4A3L G;  5A2Q E;  1T9H A;  1SE4 A;  4DU9 A;  4U68 A;  4TRD A;  1L1O A;  5IIF A;  3M9B A;  2LFN A;  3BDC A;  2FMM A;  4P75 A;  2PPB C;  1EFI D;  2EYP A;  4H0L C;  1HTL D;  2PNH A;  1O80 A;  3NTI A;  4DK6 C;  1GJX A;  4J1M A;  5M5Y B;  1M1K C;  1TR5 A;  2MHV A;  2FIN B;  3ER0 A;  1SE8 A;  3T1Y Q;  3KOJ A;  1VQE A;  3BYY B;  3K8A A;  1KHI A;  4DR6 L;  1LTI D;  4DR4 Q;  5EGT A;  1S5E D;  4BXX H;  4K6L A;  4DR3 L;  4QUF A;  1O7Y A;  2KCM A;  4LAA A;  1T5E A;  4JI0 Q;  1PFS A;  3TQY A;  1A63 A;  5K36 G;  3V05 A;  2Z1C A;  5C4J B;  3CW2 C;  4DV4 L;  4DUZ Q;  4DR2 Q;  1N32 L;  2JA6 B;  3J7A F;  2PW7 A;  3MEH A;  2L5T A;  2KHS A;  1WCM H;  2MQH A;  3EIV A;  1OXU A;  4JI8 L;  3HOZ B;  4NDX A;  1EYD A;  2VQF Q;  4BBS B;  1VMP A;  1G8Z D;  2ZXR A;  4LUZ A;  4XTC S;  1K0S A;  1VQD A;  1QVF A;  1X54 A;  3Q23 A;  2R92 G;  1TS3 A;  4JVZ A;  1GVP A;  1VQI A;  3PMF A;  2PQA A;  4O2D A;  4POG A;  3NHH A;  4JW0 A;  3DM3 A;  4APV A;  1UEA B;  2N88 A;  2R7D A;  2ENB A;  1MI2 A;  2ZTD A;  1GO3 E;  4YCV A;  4C3J H;  4GLV B;  4XXE A;  1F9S A;  2F0I A;  2P5Z X;  1V1Q A;  4FF1 A;  3F2U A;  2K01 A;  2NVQ H;  3STB D;  3GTQ H;  4R4T A;  5CV8 A;  2JQO A;  2CQO A;  1D5M C;  4LUO A;  3I91 A;  4N8F A;  2XRS D;  1AW7 A;  3AFP A;  2EIF A;  2QIL A;  2QGQ A;  3H3V I;  4GKK L;  3AFQ A;  4FDB A;  3RZD B;  2RKS A;  1GUG A;  3UI2 A;  1EQQ A;  4L6T B;  3H15 A;  4C3H H;  4KJO A;  1BXT A;  1ZKO A;  2F0M A;  3HKZ B;  3NE5 B;  3E3X A;  1YHA A;  2NVY B;  3MTS A;  1SFO H;  4FF2 A;  1B44 D;  2R7Z H;  1XMO L;  1Q82 C;  3PGZ A;  3A7A B;  4CDE C;  1PTO F;  4R1J A;  1BBW A;  4E6I A;  5IT9 c;  1PLF A;  4LFC L;  2Z9H A;  1WOC A;  3P7J A;  1MJE A;  4BY1 G;  4C1N K;  5M5Y H;  1ASZ A;  2RVL A;  3EQL C;  2L4N A;  3A8I E;  4JI5 Q;  2ALY B;  4YY3 Q;  3Q8D A;  1WTP A;  1M8A A;  1UE6 A;  1W3S A;  4JI1 Q;  5C5L A;  4RKL A;  1NTG A;  2KHJ A;  1SRU A;  2D0P A;  4K6D A;  2A19 A;  2QEJ C;  4J6H A;  3T1H Q;  3K0X A;  1X32 A;  3CCE A;  1JJ2 A;  1E2V A;  2MGS A;  2IW3 A;  1KXL A;  2YYZ A;  3CC4 A;  5FLX L;  1EFW A;  3U58 A;  2YTX A;  4CHT B;  3M3Y B;  2Y0S G;  1AZQ A;  5L37 A;  1MKH A;  5C4J H;  5ISR A;  1WJJ A;  2WFW A;  1C4Q A;  1V1O A;  5IGE A;  4DR1 L;  4DF7 A;  4XQQ A;  2O4X A;  3J80 i;  1IYU A;  1RCV D;  1VQO A;  3TME A;  1E1T A;  5M3F B;  3TRE A;  3C2P A;  5JPN C;  1C48 A;  4BY7 G;  2E8G A;  3R8B A;  4R4O A;  3HOZ H;  4RGT A;  4A76 A;  2PZU A;  2SEB D;  1FL0 A;  1SAP A;  3GV6 A;  5FO9 B;  3C46 A;  2NZO A;  4DV7 L;  1KDC A;  3NQT A;  1O7Z A;  4IPD A;  4GLX A;  2F4V Q;  4DKA C;  4FO2 A;  1VQJ A;  4ZCK A;  1Q81 C;  1II3 A;  1V1P A;  2KA7 A;  5JEA G;  3K57 A;  1SNP A;  4PNY A;  1RJT A;  1Q86 C;  2K7V A;  2Z6K C;  3J80 c;  1N9W A;  1XWE A;  4FXK C;  3OWE B;  1AP0 A;  2VUM G;  2F52 A;  2KVM A;  2L55 A;  3I4M B;  4CBV A;  1HNX L;  2NVX B;  4LF5 L;  3A7L A;  1SNO A;  2HD3 A;  4HMI A;  4DV6 Q;  2B29 A;  1EQT A;  4X64 Q;  1JT8 A;  2N78 A;  1K3R A;  3RN5 A;  3GD7 A;  3RZD H;  3K6O A;  2I5M X;  1Q8K A;  3CCM A; 
#chains in the Genus database with same CATH homology
 4YY3 L;  1AE2 A;  1Q12 A;  4NXN Q;  3L7Z C;  4JI1 L;  3HKZ E;  2MO1 A;  1PH5 A;  1XNQ Q;  3ZJY C;  2ES2 A;  3PO3 G;  1Z47 A;  3T1H L;  2GVA A;  2NVY H;  4IJH A;  3CCR A;  4DR7 L;  4NXM Q;  1TWG H;  2OQ0 A;  2N3S A;  3E9H A;  3ICE A;  1UE1 A;  5BR8 L;  3KJP A;  1S40 A;  2OWO A;  4IOC A;  1YZ6 A;  1B70 B;  3OTO Q;  4DUY Q;  1PHJ A;  1YHB A;  1G51 A;  4HJ9 A;  2NZH A;  4LFA Q;  4YWK A;  4HJ5 A;  2KEN A;  3W1B A;  4JI6 L;  3S2H H;  1YIT A;  2UXC Q;  1OTC A;  1Z9F A;  3EN2 A;  1N8R C;  1ASY A;  4A3D G;  1IBL Q;  2UXD L;  4KHP Q;  1JJG A;  2CWA A;  5IP7 H;  3ULJ A;  1VQP A;  1LM0 A;  4UP8 A;  4HIK A;  4GOP A;  4LF7 Q;  1N33 Q;  3PCO B;  4IO9 A;  3KFU A;  1XPU A;  3H0G G;  4PZ8 A;  3W1G A;  1LUZ A;  3WWV A;  5IYB G;  1B8A A;  4HJ8 A;  3NBH B;  4A3J G;  3GTK H;  4P74 A;  1Y1V H;  1VQ6 A;  3GO5 A;  1KD1 C;  3CXC A;  3HOY G;  3CCL A;  2IX1 A;  2UU9 L;  2VL6 A;  5IP9 H;  4LF6 L;  3HOV G;  3F1Z A;  3HOU G;  1IL2 A;  4DV2 L;  3TRZ A;  1VQ5 A;  3G6E A;  3CP0 A;  1FGU A;  1X3F A;  2GN5 A;  2K14 A;  2ZJR A;  2PMZ E;  4DR5 L;  1YJN A;  4A3B G;  2KHI A;  5C0X G;  1YI2 A;  3CQZ H;  2UUC L;  4BBR H;  3KDF A;  3KF8 B;  1PH7 A;  4OO1 I;  1VS0 A;  3F2B A;  3PIO A;  2CCZ A;  3BJU A;  4B3T L;  2F4V L;  3RNU A;  1N36 Q;  4BA2 I;  1BBU A;  3S1Q H;  3CCM A;  5ELO A;  4WJ4 A;  1W2B A;  3D31 A;  2XTI A;  1K9M C;  3HOZ G;  1K73 C;  3CCU A;  3FHW A;  4PMW A;  3A0J A;  1KL9 A;  4X62 Q;  1SRO A;  4LF8 Q;  2R93 G;  1MIU A;  1TWH H;  1LYL A;  5LMN Q;  3K7U C;  1DGS A;  3I2Z A;  1IBK Q;  4LF9 Q;  1VQ8 A;  4A3I H;  3AEV A;  4JI7 Q;  1HZA A;  4NB3 A;  3I4M G;  1XNR L;  4K0K L;  1FVI A;  1PH1 A;  4A93 G;  3PF5 A;  4P72 A;  5LMU L;  1A0I A;  1YVC A;  3KF6 B;  1V9P A;  3RLF A;  3I7F A;  3S17 H;  2Q2U A;  1HJP A;  4O0A A;  5M3M H;  4DV6 L;  5E7N A;  3CCQ A;  2OTJ A;  5C0X I;  4X64 L;  2R6G A;  3UE1 A;  4A3M G;  5LMN W;  2JK8 A;  5J3B A;  1NE3 A;  1KC8 C;  4HIO A;  4X65 Q;  1EYG A;  2E2I H;  2JA8 G;  1AE3 A;  1C0A A;  4NXN L;  4IPC A;  3GDE A;  1VQB A;  2MO0 A;  2IHE A;  1XNQ L;  5C3E G;  2OQK A;  4P71 A;  2JA5 H;  4B3M L;  1P8L A;  3I56 A;  4DV5 Q;  1K8A C;  2YTY A;  3PUZ A;  1HNW Q;  3CPW A;  4JV5 Q;  4JBK A;  4PG3 A;  4NXM L;  2D0O A;  4GNX A;  1YIJ A;  1J5E Q;  1WYD A;  3G71 A;  1JE5 A;  3U4V A;  3OTO L;  4TVA B;  4UPA A;  2VQE Q;  4DUY L;  5C4X G;  4Y7N H;  4LFA L;  2E2H H;  3NEN A;  2UXC L;  3FKI H;  1EWI A;  4C2M H;  1QZH A;  2LXK A;  2UUA Q;  1IBL L;  1B7Y B;  1CKM A;  4KHP L;  4A3F G;  3M7N A;  1UE5 A;  1OXV A;  5IYC G;  1N33 L;  5C44 H;  4P73 A;  2WB1 E;  2Q2I A;  4AIM A;  1NY4 A;  3S15 H;  4AQY Q;  1OXT A;  1P16 A;  2GVB A;  2B63 H;  4IOA A;  3GTL H;  3HKZ G;  4A3L H;  1PV4 A;  4POF A;  4DK3 C;  3S1M H;  1PH8 A;  1Y1W H;  3NEM A;  3KJO A;  4GKJ Q;  2Y0S E;  2KBN A;  1J6Q A;  4QQB X;  5AJ3 Q;  1WFQ A;  2NVT H;  1SR3 A;  1JB7 A;  2JEA I;  3PUX A;  1XNR Q;  5IWA Q;  3HFZ B;  2ZM6 Q;  1EOV A;  1PYB A;  1OXS C;  2FXQ A;  2MNA A;  4HJ7 A;  4DPG A;  4BA1 I;  2BH2 A;  1SMX A;  3LGJ A;  4ALP A;  4YWL A;  3J7Z C;  3GTP H;  1VQM A;  4LNQ A;  5JJK A;  3BZC A;  4EX5 A;  1E22 A;  3KF6 A;  1N36 L;  2DGY A;  2K52 A;  3E9I A;  3JAM i;  2EXD A;  2CKZ B;  1E1O A;  4HID A;  3S1R H;  1Y1V G;  4B3S L;  4YCU A;  2K5V A;  2Z0S A;  2D62 A;  4JC0 A;  1BKB A;  3E0E A;  5IP9 G;  4L5T A;  2RCN A;  2R7Z G;  4B3M Q;  5IYD H;  2VNU D;  3I4O A;  1A62 A;  2BA1 A;  4GN5 A;  4X62 L;  4GOP C;  3TS0 A;  4LF8 L;  4IPH A;  2OCE A;  1QUQ A;  5LMN L;  1S72 A;  1IBK L;  1Q1B A;  2I0Q A;  4LF9 L;  4IFD I;  1KIX A;  3EBE A;  4GN3 B;  3HOX H;  4JI7 L;  3RLO A;  4QIW E;  4BBR G;  4YHH Q;  4OX9 Q;  1XPO A;  2HT1 A;  5JEA J;  1E7Z A;  1UE7 A;  4OON A;  4QY7 A;  1XTD A;  4IFD J;  4DV0 Q;  3J81 i;  1CKO A;  2V1C C;  3RLN A;  5M3F G;  1CKN B;  1HZ9 A;  4C3I H;  2VY3 A;  2PI2 A;  5M5X H;  1PH4 A;  4DR6 Q;  1EQR A;  2Q2H A;  4KHZ A;  4RG1 A;  3U4Z A;  4X65 L;  4JI4 Q;  2IHF A;  1Y14 B;  4DR3 Q;  2UUB Q;  2ZJQ A;  1VCI A;  5FJ8 H;  2L15 A;  1M90 C;  4GNX B;  3RR5 A;  4MNO A;  1K83 H;  1SLJ A;  5M5W H;  1NBW A;  1TWF H;  4A3I G;  2JEB I;  5GQO A;  4DV5 L;  1QZG A;  1N34 Q;  1HNW L;  4DV4 Q;  4JV5 L;  3F2D A;  1BVS A;  3UDG A;  3H3V H;  1E24 A;  1N32 Q;  2LXJ A;  1J5E L;  4UP7 A;  2R92 H;  2QEX A;  2AWN A;  3KYH C;  1D8L A;  2VQE L;  4A3E H;  5M3M G;  3HOW H;  1X65 A;  4X66 Q;  1JJC B;  2UUA L;  1XMQ Q;  1VQG A;  1AH9 A;  1HR0 Q;  4JI8 Q;  4B3S Q;  2HQL A;  4DAM A;  5H1S E;  1PH6 A;  3CF5 A;  3M85 A;  1X3G A;  1NMG A;  3GTO H;  5GAG C;  3CC7 A;  1LTL A;  1C7Y A;  4AQY L;  2Q2T A;  2JA5 G;  2YU9 H;  1FJG Q;  3PO3 H;  1KRS A;  3D0F A;  3PUV A;  2I5H A;  2JA7 H;  1I5F A;  4L5S A;  4KI0 A;  2IX0 A;  3HKS A;  4GKJ L;  1D7Q A;  4OWX B;  1HR0 W;  1QVC A;  5AJ3 L;  3J81 j;  2WAQ G;  5FLM H;  3PO2 G;  1C9O A;  3RZO H;  3W5O A;  1VQA A;  2A1A A;  2ASB A;  5GAE C;  2ID0 A;  5IWA L;  3L2P A;  4A3D H;  2ZTE A;  2ZM6 L;  1K0R A;  2PI2 E;  3KLW A;  3PV0 A;  4R4Q A;  2YTV A;  4GS3 A;  5HGQ A;  2R7F A;  3CME A;  2IY5 B;  4ME3 A;  1CUK A;  2K4K A;  5DLQ E;  4GNX C;  2HHH Q;  1YHQ A;  4A3C H;  2B63 G;  4QL5 A;  1HZC A;  1UWV A;  2CFM A;  4A3L G;  4IPG A;  1CKN A;  2AWO A;  1Q7Y C;  1T9H A;  5C0X J;  1QUQ B;  1L1O A;  2K5H A;  3M9B A;  5GRO A;  1PH3 A;  3GTM H;  1UEB A;  5HY6 A;  1VQ9 A;  4A3G G;  3PUY A;  4P75 A;  1NMF A;  2PNH A;  4A3B H;  1YNX A;  1IBM L;  4DK6 C;  4A3K H;  3OW2 A;  3K80 C;  1CSP A;  4AYB E;  1M1K C;  2JA6 H;  4GKK Q;  2F3I A;  4YHH L;  4OX9 L;  1TXY A;  1XJV A;  1I94 Q;  2B3G A;  4BY1 H;  4JBJ A;  1GKH A;  4JCV E;  1PVO A;  2HIV A;  3ER0 A;  1SE8 A;  5GAD C;  3T1Y Q;  3KOJ A;  1VQE A;  1NJI C;  4DV0 L;  4MZ9 A;  4JBM A;  4WJ3 M;  4YCW A;  3K8A A;  3AYH B;  5ELN A;  2UXB Q;  4PZ7 A;  4JI3 Q;  1KHI A;  4H02 A;  4DR6 L;  1XMO Q;  4DR4 Q;  5IYD G;  3CMA A;  4LWC A;  2BA0 A;  4JI4 L;  4BXX H;  2UUB L;  4DR3 L;  2RHQ B;  3NEL A;  4BBS H;  2C35 B;  1IZ6 A;  2KCM A;  4JI0 Q;  1IYJ B;  2VZA A;  4LFC Q;  1PFS A;  3TQY A;  1A63 A;  1N34 L;  5K36 G;  3HOX G;  2KCT A;  3CW2 C;  4DV4 L;  4DUZ Q;  3UDX A;  3FP9 A;  4DR2 Q;  1N32 L;  5GAH C;  1VQ7 A;  3CCV A;  3M4Q A;  4DV3 Q;  5IP7 G;  2NN6 G;  3ULP A;  4X66 L;  2BH8 A;  4A3M H;  3K81 C;  3M4P A;  1WCM H;  2MQH A;  3AQQ A;  3EIV A;  3SGI A;  3UDI A;  1XMQ L;  4JI2 Q;  1OXU A;  3CPF A;  1HR0 L;  3CCJ A;  4JI8 L;  3F2C A;  4BY7 H;  5JJL A;  4LF4 Q;  3A5U A;  5IE8 A;  2MFI A;  3CC2 A;  5IY0 A;  1I3Q H;  1L0W A;  2VQF Q;  4OXP A;  1PA6 A;  1FJG L;  4LUV A;  2ZJP A;  1QVG A;  4LUZ A;  4XTC S;  1EIY B;  3S14 H;  2HIX A;  4NPS A;  1XPR A;  3UDF A;  1PH2 A;  5EAY A;  1VQD A;  4DNI A;  1X54 A;  1QVF A;  1IBM Q;  1X55 A;  2R92 G;  2Z6K A;  1VQN A;  1HH2 P;  4OWT B;  1GVP A;  1S3O A;  1VQI A;  4X6A H;  4JOI A;  2PQA A;  4O2D A;  4POG A;  3G4S A;  1WI5 A;  1X6O A;  3DM3 A;  3L0O A;  4PZ6 A;  4JI5 L;  2RF4 A;  4APV A;  5IYC H;  1K8G A;  2R7D A;  2JE6 I;  2H5X A;  3ERS X;  2NN6 I;  1L1O B;  2ZTD A;  2HHH L;  4B3R Q;  1GO3 E;  1EIF A;  4YCV A;  4C3J H;  2N49 A;  2ATW A;  4GLV B;  2JA7 G;  3CD6 A;  4LFB Q;  3JC6 6;  1V1Q A;  4OO1 G;  1GD7 A;  4DV7 Q;  2NVQ H;  1X9N A;  3STB D;  3JAM c;  4R4T A;  4HIM A;  3GTQ H;  2JQO A;  1E3P A;  1U5K A;  2CQO A;  3BZK A;  3PUW A;  4LUO A;  5FLM G;  4R4C A;  4JYA L;  2VUM H;  3B6Y A;  1VQL A;  3DLL A;  1YJW A;  1RIP A;  2OTL A;  3I4N H;  3AFP A;  2EIF A;  3MXN B;  3GTJ H;  2QGQ A;  3H3V I;  4GKK L;  3AFQ A;  4FDB A;  1G6P A;  3S24 A;  1L2F A;  1PH9 A;  1I94 L;  1IXR A;  2E5L Q;  4AH6 A;  4DV1 Q;  3T1Y L;  1EQQ A;  3H15 A;  3A5Z B;  4C3H H;  3TS2 A;  2IT1 A;  3PIP A;  4A3C G;  4KLK A;  4RMF A;  3IRB A;  2UXB L;  2E2J H;  4Y52 H;  1KRT A;  4JI3 L;  1SFO H;  1YHA A;  2N8N A;  1A8V A;  4OWW B;  2R7Z H;  1XMO L;  3A74 A;  1Q82 C;  4DR4 L;  3PGZ A;  4GLA C;  2JA9 A;  3CCS A;  1HNZ Q;  3J81 c;  2AKW B;  4R1J A;  2XGT A;  1BBW A;  5IT9 c;  4JI0 L;  2QA4 A;  4LFC L;  1HNX Q;  4LF5 Q;  1WOC A;  4A3K G;  3UE0 A;  3M3Y H;  1TWA H;  1MJE A;  2JA6 G;  1TWC H;  4DUZ L;  4DR2 L;  4BY1 G;  1ASZ A;  5M5Y H;  1YBY A;  3FKI G;  4MTN A;  4AYB G;  2K5N A;  1L1O C;  4JI5 Q;  1CSQ A;  2ALY B;  4YY3 Q;  4DV3 L;  3Q8D A;  4L5R C;  5M3F H;  1UE6 A;  1I50 H;  3M4O H;  1W3S A;  4JI1 Q;  3PSI A;  3H0G H;  5C44 G;  5IYB H;  4A3J H;  1NTG A;  2DUD A;  4JI2 L;  2KHJ A;  1V43 A;  1SRU A;  2D0P A;  2A19 A;  3T1H Q;  3K0X A;  4LF4 L;  2WB1 G;  3CCE A;  1JJ2 A;  3HOY H;  2YV5 A;  4BBS G;  1X3E A;  4BXX G;  4DR7 Q;  2VQF L;  1Y1W G;  3HOV H;  3BU2 A;  1RL2 A;  4L5Q A;  5BR8 Q;  3HOU H;  1KXL A;  2YYZ A;  3OYY A;  2JJQ A;  4UY8 C;  3S2D H;  3MEF A;  3CC4 A;  1EFW A;  4JYA Q;  2EQS A;  4JG2 A;  3U58 A;  4JI6 Q;  2YTX A;  1HZB A;  2Y0S G;  1H95 A;  1MKH A;  4R4I A;  5C4J H;  2UXD Q;  3F8T A;  1WJJ A;  2PQA B;  2WFW A;  4DR1 L;  2WP8 J;  4TQU S;  1YJ9 A;  1Q46 A;  3J80 i;  1O7I A;  1VQ4 A;  1WCM G;  1VQO A;  3I55 A;  1E1T A;  3TRE A;  1X56 A;  4BY7 G;  2AHO B;  1EUJ A;  2E8G A;  1GM5 A;  2ZTC A;  1VQK A;  2UU9 Q;  4LW1 A;  4LF6 Q;  1G29 1;  4R4O A;  3HOZ H;  4A76 A;  4B3R L;  2LSS A;  4DV2 Q;  1Q1E A;  1FL0 A;  2WAQ E;  2R93 H;  1OXX K;  3VDY A;  1MJC A;  2RHS B;  4GN4 B;  4A75 A;  4LFB L;  2NZO A;  4DV7 L;  4DR5 Q;  3S1N H;  2K50 A;  3CAM A;  3PO2 H;  2UUC Q;  1JMC A;  4EQ5 A;  4IPD A;  4GOP B;  1KAW A;  3I4M H;  4GLX A;  4HJA A;  2NVX H;  2A8V A;  2I5L X;  2F4V Q;  4B3T Q;  4DKA C;  4A93 H;  4JBW A;  1I6H H;  1YEZ A;  2VW9 A;  1VQJ A;  1Q81 C;  1VQH A;  4LF7 L;  2E5L L;  1VQF A;  4DV1 L;  1R9T H;  5JEA G;  4J15 A;  4DAY B;  4UP9 A;  4YWM A;  4XIG S;  2JA8 H;  1Q86 C;  4IFD G;  2VS1 A;  2CWP A;  2Z6K C;  3J80 c;  3J7A 5;  5FJ8 G;  1N9W A;  4QJF A;  4QGU A;  5C3E H;  4JOI C;  1U0L A;  4IJL A;  4A3G H;  1HNZ L;  3KDF B;  3U50 C;  3K7A H;  2VUM G;  4K0K Q;  2F52 A;  1PYS B;  1SN8 A;  5LMU Q;  5FLX c;  3RN2 A;  3I4N G;  1HNX L;  4LF5 L;  5C4X H;  3G48 A;  4DR1 Q;  4DV6 Q;  2AMC B;  4A3E G;  2B29 A;  3HOW G;  1KQS A;  4X64 Q;  1JT8 A;  2N78 A;  1K3R A;  3RN5 A;  3GTG H;  3S16 H;  3ULL A;  4A4I A;  2K75 A;  3GD7 A;  3STB C;  3RZD H;  4A3F H;  2I5M X;  1Q8K A;  3TEH B;  1VQC A;  3PF4 A;  5JJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...