4DR6Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, near-cognate transfer rna anticodon stem-loop mismatched at the first codon position and streptomycin bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
100
structure length
100
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 20
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr6Q00
4R4CA 5C44G 1YI2A 1Q46A 4Y7NH 3GO5A 1Y14B 4GN3B 3U4ZA 3UDFA 3K80C 4YWMA 2NN6G 3GTPH 2UXBL 1OXVA 3KFUA 1FJGL 2V1CC 4DR1Q 2WB1E 4RG1A 3JAMc 1IBLQ 4LF5L 2R7DA 5DLQE 3M4QA 2N3SA 1QUQB 3PUYA 1EQQA 1S3OA 4JI5L 2AMCB 4OONA 4A4IA 1Y1WG 4KHPL 4GN5A 3MEFA 5BR8Q 3FKIG 5GAGC 2R92H 1CKNB 1P8LA 4WJ4A 1K0RA 1GVPA 1X3GA 3SGIA 4ALPA 1XJVA 1Q12A 1JMCA 1Y1WH 2ASBA 1KQSA 4OWXB 1KRSA 4JI2Q 4Y52H 3MXNB 4JI6Q 4X66Q 4JI0L 1KIXA 2C35B 4B3TQ 4DKAC 1I5FA 3J81j 2N8NA 2JA8H 3PIPA 5C4XH 4HJ9A 4A3GH 2MO0A 3CC4A 4JI1Q 1EFWA 1PVOA 1CKNA 1W2BA 4DV3Q 2KENA 4JI3L 3H3VI 3S14H 2F52A 2RHQB 2JA8G 1NE3A 2WFWA 5GADC 2R7FA 4B3MQ 1HNXL 4X62Q 5JJLA 3L0OA 4L5QA 1MJEA 1PFSA 1UEBA 4EQ5A 2ZTCA 1C7YA 2JJQA 1WOCA 4DK6C 4TQUS 4X65Q 3M3YH 5IWAQ 2K75A 4JI4Q 1PHJA 1HNZQ 1NTGA 3HOYG 1SN8A 3CCUA 4DV1Q 3TREA 3S17H 4OX9L 1GD7A 4R4OA 3HOVG 1J6QA 4DR7L 4IPGA 4OXPA 2H5XA 3HKZG 1DGSA 1QVCA 1J5EQ 2UXCL 4JV5L 1KD1C 2YYZA 1M90C 4DNIA 3KOJA 4A93H 3PO2H 2VY3A 3J81i 1KAWA 4C3HH 5EAYA 2ZTEA 3CPFA 4X6AH 4DR4L 2YTXA 2Z6KA 1TXYA 3HKSA 5J3BA 4A93G 1E3PA 4AYBG 4DAYB 1FVIA 2IHFA 2PI2E 4YY3L 1VQ4A 4JBMA 4OWTB 4JV5Q 4JOIA 2VZAA 3A5ZB 2EQSA 4UP7A 4R4QA 4BBSH 3BU2A 1JT8A 5C3EH 2OTJA 2VW9A 1YHQA 3RNUA 4IPDA 3HOZH 2E2IH 4B3SQ 1YNXA 3AEVA 1B7YB 4P71A 3GD7A 2KCTA 1IBKQ 1T9HA 4DR6Q 1VQMA 4WJ3M 4JG2A 1YEZA 2MNAA 2VQFQ 4A3FG 4A3LG 2IY5B 3UE0A 2Q2HA 4DPGA 4X62L 3CCVA 4DUYQ 4YWLA 4DV7Q 4A3EH 4LF4Q 2YU9H 3A5UA 1Q8KA 1X6OA 1KC8C 2NVQH 1NMFA 4A3KH 4P74A 3HOXH 2PI2A 3I4OA 4A3LH 1MJCA 1G6PA 3HFZB 3CCRA 1PH9A 3CPWA 2R7ZG 4A3EG 2K5VA 3DM3A 5ELNA 3CC2A 4DV5Q 3FKIH 2YTVA 2R92G 4KHZA 3PUZA 2ES2A 2OQKA 1V43A 1PH6A 1I50H 4DR2Q 5IT9c 1N34L 4JCVE 4B3TL 3CCQA 2PQAA 5M3MG 1ASYA 3I55A 3HOWG 2VL6A 4JI6L 2VQFL 2HT1A 3UE1A 3KLWA 2UUAL 3KF8B 4DR5Q 1MKHA 4DV6L 3CD6A 4A75A 4DR6L 3BJUA 3I4MG 1BVSA 1OXUA 3HOWH 3I4NH 1V9PA 3JC66 4AQYQ 3VDYA 1X65A 3F1ZA 5IYDG 2UUCL 3CAMA 2JEAI 3S1NH 4A3GG 3ULPA 5C4XG 3AQQA 1SROA 1VQEA 1IL2A 3E0EA 2UXDL 1QUQA 1VQIA 2F4VQ 4GOPC 2MQHA 3I4NG 3T1YL 4O0AA 4AYBE 4IO9A 2JQOA 5IYDH 4BBRG 1EYGA 1Q1EA 2IT1A 2PNHA 5FLXc 4DV5L 4L5TA 3KDFA 3CMEA 4JI7L 4LFCQ 1D8LA 5FLMG 2AWNA 3PO2G 5H1SE 2RCNA 4PZ8A 1Q86C 4HJ7A 4K0KL 5C0XI 2KHIA 3KF6A 4DR5L 4C2MH 4LFBQ 1VQDA 1EQRA 4DV7L 3HOYH 2HIXA 2JA7G 2UXCQ 4YCVA 5IYBH 3BZCA 4GNXA 1IBMQ 1H95A 2UUBQ 2QA4A 2F4VL 4GLVB 4DR7Q 4GOPA 4GS3A 4DV4L 1QVGA 1JB7A 4DV0Q 4OX9Q 2B63G 5IP7G 4DV1L 1XMOL 1XPUA 2JA7H 5IYBG 3PSIA 1PYSB 1VQAA 4JI8Q 1HNZL 4JI4L 4LF7L 2F3IA 4KI0A 3AFQA 3STBD 1IXRA 3H15A 2HQLA 4DV4Q 1Q1BA 4DV6Q 1XNRL 1GM5A 2ZM6Q 2QGQA 3H0GG 4LUZA 2PQAB 5IP7H 1XPRA 1N8RC 5M5WH 3G4SA 3S15H 5IY0A 1G51A 4LUVA 4JBWA 4GNXB 4YY3Q 1AE2A 2IX0A 2HHHQ 3H0GH 4BBSG 2E5LQ 1CSQA 1NBWA 4JI7Q 2E5LL 4QQBX 4OWWB 4QIWE 3S2DH 1A0IA 1A8VA 4MNOA 4POFA 2HHHL 3PUWA 3HOZG 4OO1G 3GTKH 3ER0A 2WAQE 2E2JH 1E24A 3KJPA 1VQ9A 3EIVA 2WP8J 1VQCA 2MO1A 2GVAA 4QGUA 1V1QA 2K50A 1UE1A 1KRTA 1EWIA 4JI2L 3STBC 3H3VH 3KDFB 4P75A 4A3FH 2UUCQ 1XNRQ 1I3QH 1TWGH 3AFPA 4LUOA 3RN5A 2I5MX 1JJCB 3NELA 1KHIA 4NXNL 4A3KG 3HOXG 4DV0L 3J7A5 1YITA 4RMFA 2ZJRA 4PG3A 1YJWA 2LXKA 1YBYA 4KHPQ 4HIKA 4BA1I 2K4KA 2UUBL 4L5RC 1Y1VH 5GQOA 3GTMH 5IE8A 3CF5A 3RZDH 4NXMQ 2AKWB 1FJGQ 4GNXC 1EUJA 1P16A 1UE6A 2EXDA 4K0KQ 4LNQA 2OCEA 2B29A 1LTLA 2WAQG 5M3MH 5IYCH 4UP9A 1Y1VG 5ELOA 5IP9G 3FHWA 4JI1L 4R1JA 4YCWA 4J15A 1GO3E 3U58A 1HNWQ 2D0OA 2Q2TA 2Z0SA 1K3RA 1HZAA 1WFQA 2ZJPA 2NVYH 3I4MH 3CCLA 1PH7A 3W1GA 5IYCG 2K14A 1E22A 2AHOB 1VQ6A 1X3FA 5IP9H 2CKZB 1J5EL 3B6YA 1NJIC 1K8GA 2UXDQ 3WWVA 3K0XA 1UE7A 2ZJQA 2KHJA 2N78A 3RR5A 1HR0Q 3U4VA 4X64L 1JE5A 1IBKL 3S2HH 2KCMA 4YWKA 1I94L 3GTLH 1CUKA 1L1OB 4GLXA 1QZHA 4B3SL 4BBRH 3A0JA 4AIMA 3HOUG 1VQGA 5E7NA 4X64Q 3RZOH 1OXTA 1AE3A 3GTGH 1NMGA 4JI5Q 1PH2A 5FLMH 3S16H 1G291 1FL0A 1L1OC 4DK3C 3D31A 2NVTH 2IX1A 4DAMA 4UP8A 3ICEA 4NB3A 4LFBL 3HOUH 2BA1A 1WCMG 2WB1G 2XGTA 4MZ9A 4HJAA 4YHHQ 4LFCL 2VUMG 1XMQL 3L7ZC 1WCMH 1BKBA 2B63H 5HGQA 2A19A 4APVA 5HY6A 3GTJH 5AJ3Q 3T1YQ 1VQLA 2VUMH 3TRZA 2CWAA 3CP0A 4DUYL 2CFMA 1SR3A 1VS0A 5LMUL 3GTOH 1Q81C 4YCUA 4NXNQ 4HIMA 3PGZA 4LF6Q 1WYDA 3E9IA 4IFDG 2A1AA 5LMNL 4XTCS 4X65L 4IJLA 3PF4A 2YTYA 3KF6B 1GKHA 4LW1A 4A3MG 2UUAQ 2YV5A 2VQEL 4O2DA 1SRUA 2XTIA 3DLLA 3K81C 2KBNA 1D7QA 3EBEA 1VQKA 5JJIA 3KYHC 4DUZQ 2NVXH 4PZ7A 4JI3Q 4DV3L 1VQ8A 2DUDA 5GAHC 3J80i 2I5HA 3CXCA 1YHBA 4HJ8A 5LMNW 3HKZE 1O7IA 4IJHA 4HJ5A 1EIYB 1IYJB 4LWCA 4GKKL 1HZ9A 1N36Q 1EIFA 4LF4L 1XNQQ 1LUZA 1Q82C 1X54A 2NZOA 4QY7A 1Z47A 2HIVA 1ASZA 3PUVA 3G71A 2MFIA 4JBJA 1VQFA 4A3BH 4LF7Q 4JI8L 4A76A 3PIOA 4AH6A 1C0AA 4DR3Q 2CQOA 1CKOA 4C3JH 1AH9A 5IWAL 1X3EA 2UU9L 3I2ZA 1QVFA 4JYAQ 1Q7YC 1U5KA 5M3FH 4A3BG 4HIDA 4BA2I 1M1KC 1PH5A 1IBML 1U0LA 1SFOH 1YJNA 1HH2P 4LF5Q 1X56A 2D0PA 2L15A 2CWPA 1PH1A 4LF9Q 2D62A 1W3SA 1N36L 3M4OH 4LF8L 5M3FG 3E9HA 1VQ7A 4DR4Q 3PCOB 1WJJA 1K83H 2K5HA 2NZHA 4ME3A 4GN4B 2GN5A 3RLNA 1VQPA 2E2HH 2UXBQ 5C4JH 2JEBI 4IFDJ 3S1QH 2K52A 4IOCA 3Q8DA 4QJFA 2LSSA 3BZKA 2IHEA 4KLKA 3S24A 1X55A 2JA5G 3CCMA 2Q2UA 4A3JG 4LFAQ 4P73A 3JAMi 3I7FA 3TS2A 1KXLA 3OTOL 1E7ZA 3W5OA 4IFDI 1CSPA 1MIUA 3U50C 4AQYL 1JJGA 4A3DG 1OXXK 1PV4A 2CCZA 1VCIA 4BY7G 2JA5H 5LMNQ 4C3IH 1S72A 3J7ZC 2PMZE 1SMXA 3CCSA 3TS0A 1IZ6A 1A63A 4IOAA 1I6HH 1TWHH 4A3DH 3TQYA 2EIFA 1VQNA 4OO1I 5JJKA 4B3ML 4DR2L 1BBWA 5LMUQ 3UDGA 1VQOA 1PH3A 1N34Q 1K8AC 1JJ2A 1XTDA 1IBLL 1LM0A 1N33Q 5AJ3L 1CKMA 2BH8A 4GLAC 3EN2A 4JOIC 1VQJA 1L1OA 3F8TA 3F2BA 2OWOA 3LGJA 3M85A 2R93G 3UDIA 1UE5A 4QL5A 1KL9A 3M7NA 1SE8A 3IRBA 2ALYB 3NENA 5M5XH 3S1RH 4BXXH 2JA9A 1NY4A 1YIJA 1N33L 4LF9L 3CC7A 3M4PA 4JC0A 4X66L 4A3MH 1S40A 4UPAA 3D0FA 5C0XJ 2VS1A 2I0QA 1FGUA 3UDXA 1E1OA 1TWAH 2OTLA 4BXXG 1LYLA 4JYAL 1HZBA 1B8AA 5FJ8G 3NBHB 4DR3L 4BY1G 5GAEC 3PO3H 3AYHB 2Y0SG 3L2PA 1WI5A 3PV0A 3K8AA 3ZJYC 5FJ8H 1RIPA 4P72A 3G6EA 3CW2C 3CCEA 4BY1H 1XNQL 4B3RL 3PO3G 2ZTDA 1K9MC 1HNWL 1YZ6A 1SLJA 3T1HQ 1PH8A 4HIOA 1XPOA 3CCJA 3GTQH 5M5YH 1L2FA 4LF8Q 4DUZL 1TWFH 1YHAA 2E8GA 2NN6I 3RLFA 4DV2L 4JBKA 5K36G 5JEAG 3CQZH 3K7AH 1N9WA 1PYBA 2OQ0A 1HR0W 4NXML 2ID0A 1X9NA 2N49A 2BH2A 3S1MH 2RHSB 3FP9A 4XIGS 3TEHB 2ATWA 3KJOA 1QZGA 2UU9Q 2Q2IA 2R6GA 1C9OA 2Y0SE 4R4IA 2LXJA 1EOVA 3GDEA 2VNUD 2GVBA 4A3CG 3J81c 4MTNA 3A74A 1YVCA 1HZCA 3OW2A 3OTOQ 1PA6A 3RN2A 1BBUA 2A8VA 1HNXQ 4PMWA 1YJ9A 4LFAL 4A3IG 2R7ZH 1K73C 4A3CH 4GKJQ 4GKKQ 1N32Q 4DV2Q 1OTCA 3PUXA 1VQHA 3K7UC 2DGYA 5GROA 4GOPB 1B70B 5C0XG 1XMQQ 3HOVH 1Z9FA 4A3JH 4A3IH 3T1HL 4H02A 3ULLA 4YHHL 2BA0A 3PF5A 4NPSA 2FXQA 2K5NA 3NEMA 4IPHA 2RF4A 3F2DA 4GKJL 4JI0Q 1RL2A 3ERSX 4BY7H 4B3RQ 1N32L 4R4TA 4IPCA 3ULJA 1VQBA 2JA6H 2VQEQ 2JE6I 2ZM6L 3I56A 1TWCH 2B3GA 1VQ5A 2I5LX 3F2CA 1UWVA 1E1TA 2Z6KC 4L5SA 4FDBA 4LF6L 3W1BA 5BR8L 1XMOQ 1I94Q 2JA6G 1R9TH 3J80c 4TVAB 3OYYA 1OXSC 3G48A 5C3EG 1HR0L 4EX5A 1L0WA 2AWOA 4POGA 2R93H 1A62A 3M9BA 5C44H 4DR1L 3RLOA 4UY8C 2JK8A 4PZ6A 3CMAA 5JEAJ 1PH4A 1HJPA 2QEXA
chains in the Genus database with same CATH superfamily
2R7ZB 3CKIB 1SYFA 1Y14B 2MUYA 2NN6G 3KFUA 4TSSA 2EY6A 2JSOA 4K5WA 1K3BC 4RG1A 1IBLQ 4A3FB 2TMPA 3GTLB 4JI5L 2AMCB 3MEFA 1P8LA 1PFNA 4WJ4A 4XXEA 1GVPA 2HDLA 1ICFB 1XJVA 1Q12A 4XYQA 2RBMA 2IX3A 3SK8A 1Y1WH 4XQNA 1KRSA 4JI6Q 2QCPX 2F1MA 3J81j 2NYZD 2JA8H 4HJ9A 1KDBA 2MO0A 4V0BA 1PVOA 1CKNA 2EDGA 3T51B 3H3VI 1LTSD 5C44B 4JPBW 5BN3A 3LWEA 4YIJA 5GADC 1DM0B 5I2YA 1XTCD 4B3MQ 2J0TD 1RODA 1L0XB 3I4LA 3FEWX 4DK0A 1C8CA 3S9WA 3SDZA 4WORA 2JJQA 5IWAQ 3GTGB 1NTGA 2O2LD 5CMDA 3CCUA 1A6XA 5CV5A 1CK1A 1CI3M 1CT1D 4DR7L 2H5XA 3DWAA 2JYOA 3NPPA 5ELDA 1KD1C 2QKIC 3PO2H 3J81i 1KAWA 5EAYA 4X6AH 1T5EA 3HKSA 2MP1A 1FVIA 2O5JC 1WTOA 3UI2A 2EQSA 3CRKC 1JT8A 2VW9A 2NZ1D 1YHQA 3ND9A 3HOZH 1YNXA 1RDPD 2KCTA 3MC0B 2BDNA 5C3EB 1I3QB 1WTPA 2VQFQ 2K05A 1ENFA 2DY7A 2Q2HA 4DPGA 4DUYQ 4LF4Q 4YWLA 2YU9H 3A5UA 1KC8C 1NNXA 1TWHB 5FLXE 2ZXRA 1MJCA 2R7ZG 4A3EG 1TT2A 3DM3A 4EGVA 1I4QA 1XYIA 1DXMA 1V43A 2B2VA 2DJFC 2OQKA 4DR2Q 3MFYA 1SNQA 5IT9c 1PH6A 3CCQA 2Q8TA 1ASYA 1HHVA 4QMGA 3S1RB 5M5WB 3EROA 4A75A 3SR1A 1BVSA 1V9PA 3JC66 1I4XA 1X65A 5IYDG 2JEAI 4A3GG 1HQMC 5ELCA 5EBDA 4FF3A 1VQEA 3RD4A 1IL2A 1YNND 3A56A 2MQHA 3J7AF 4O0AA 4AYBE 2PYKA 1O7YA 1Q1EA 4K8IA 2OXPA 1SYDA 2RSNA 4MTKA 1NUCA 4FXDA 3S1QB 4X3SA 4JI7L 1D8LA 1R4QB 1C4QA 4K0KL 2KHIA 4DR5L 4C2MH 3MA2B 5IYBH 1G8ZD 3HEJA 3TBIB 1S5BD 4DR7Q 3QO2A 1JB7A 4DV0Q 4OX9Q 1STNA 5J22A 1XMOL 4ZAIA 1HNZL 1A3UA 1PYSB 4LF7L 4OGQC 3PO2G 4KI0A 3AFQA 4DV6Q 4HMIA 1SAPA 4G4KA 2QGQA 5FO7B 2EYOA 1AE2A 4KKSA 1NBWA 3HGBA 5C3XA 1A0IA 1J8IA 3PUWA 2E2JH 1VQ9A 3KBGA 5NUCA 1IHZA 2MO1A 1UE1A 1EWIA 1Q3LA 1LTBD 2PNRC 4P75A 2C9OA 2WACA 3RZOB 1C48A 3D3RA 1TWGH 3RN5A 2F4IA 4ZQ3A 3FRPB 4DV0L 1HCZA 3HS0C 1FNUA 4KHPQ 2K4KA 1XWEA 2R92B 2Z6BA 5EPJA 5IE8A 1P16A 3GTQB 4K0KQ 5KNDA 3NP8A 3KUPA 2OCEA 1LTLA 1O7LA 2B29A 2WAQG 3E5SA 4R1JA 4FXGC 1GO3E 2D0OA 3T4AC 2Z0SA 1HZAA 4LAAA 3CCLA 1PH7A 2MJ8A 1TWCB 1X3FA 2D9UA 1K8GA 3DWQA 1JB3A 3WWVA 2ZJQA 2KHJA 1PZJD 4I7ZC 5KNCA 1IBKL 1EY0A 1I94L 4H13C 1L1OB 1QE6A 1HRJA 3A0JA 4NMZA 4IURA 3RZOH 1OXTA 3U9OA 4JI5Q 1CHQD 1FL0A 1L1OC 1O80A 4DK3C 2NVTH 2IX1A 2FMMA 4UP8A 3HOUH 1RJTA 2N55A 4DN4M 1AFPA 1JCKB 1DCZA 2WB1G 2XGTA 4MZ9A 4KJNA 4FF4A 1JOKA 1H9MA 2A5HA 3L7ZC 4G7HC 1V1PA 3CP0A 5EBCA 5KYLA 4DUYL 1AP0A 1Y8NB 1XXGA 3PGZA 3PF4A 3K58A 4CKBA 3SEBA 3KF6B 4A3MG 2UUAQ 2L9HA 3V2TA 1SRUA 2XTIA 2DN8A 2A6HD 4C1NK 4IUQA 1WTXA 3VYTA 4DV3L 2DUDA 4QB4A 5GAHC 3J80i 1BUVT 1YHBA 4HJ8A 5LMNW 4A3BB 1TIID 2FFKB 4F88A 2NVQB 1EIFA 2NTSA 4LF4L 4C3JB 2NZOA 4QY7A 5DAUA 2HIVA 1ASZA 5G3LF 4X3UA 3PUVA 5CR3A 2PZTA 3JAME 4DA2A 2E76C 4JI8L 1WCMB 4EQOA 1FNWA 4A3DB 3H09A 2ZXOA 2UU9L 2Z4HA 1Q7YC 5M3FH 3VR6A 3AMUA 3PO2B 1M1KC 1PH5A 1IBML 1GUNA 1W6KA 5COYA 3OOCA 4B9XA 5DNFA 1N36L 3M4OH 4ULLA 4DR4Q 1SYEA 4HR7B 3OPOA 3VR2A 3QJYA 2PW5A 4QJFA 2LSSA 2HCCA 4KLKA 1X55A 2F03A 2Q2UA 4EQNA 4A3JG 4Y7NB 1KXLA 2ENBA 4WRDA 1IKMA 3U50C 4CJ0B 1JC7A 4LJZC 2J4XA 4C3IH 2FJ2A 3CCSA 1IZ6A 3PIP3 5D3IB 3K5OA 1TWHH 4A3DH 3TQYA 2EIFA 4OO1I 4ZUIA 4JOIC 1L1OA 5DM63 3LGJA 3M85A 2R93G 1KL9A 1SE8A 2ALYB 3S1RH 4BS9A 2JA9A 1N33L 3S2DB 3A54A 4JC0A 3D0FA 2LKVA 2CQAA 3UDXA 1TWAH 2NN6H 1LYLA 1HZBA 3J7AV 1ET9A 4ME5A 4DR3L 1H9SA 3MVVA 2L0CA 4A3JB 4OIKA 5FLXL 4UHVA 3CCEA 5JVG3 1I4HA 3KK7A 4ID6A 1NCVA 4M1UB 4HIOA 1XPOA 4KN4C 5M5YH 2BE5C 1VF5C 4K2KA 1X3QA 3CQZH 1N9WA 2F3WA 4C3HB 4IUTA 2XNAC 2P5ZX 3BG3A 5HGTA 1X9NA 3S1MH 2K5WA 3KJOA 1EQVA 2Q2IA 2R6GA 3S1NB 1VMCA 1D6EC 1F9PA 1MSHA 3BDOA 1PXUA 4MTNA 1IKLA 1BBUA 1HNXQ 3H94A 4LFAL 4GKJQ 4GKKQ 2K04A 1YNJD 1VQHA 4HAEA 1QG7A 4RGOS 5M9OA 1UNSA 1XMQQ 4F7XA 4YHHL 2BA0A 3PQIA 3PF5A 4NPSA 2FXQA 2RF4A 2BCOA 1CM9A 4B3RQ 4R4TA 4IPCA 2B63B 4F8MA 3C46A 2WB1B 2B39A 4R8IA 2ZM6L 3AB9A 2IW3A 3N6RA 3I56A 1CQVA 4QIWB 3VYRA 1ICWA 4L5SA 3S1MB 1XMOQ 1OXSC 3G48A 1HR0L 2AWOA 3I72A 5JJZA 2R93H 5L37A 5C44H 4DR1L 4IUNA 4UY8C 4PNYA 4PZ6A 4DR5Q 1PH4A 4KY7A 4R4CA 1ZYRC 4HEDA 4Y7NH 3UDFA 5IODA 1O78A 1OXVA 5EPLA 2MPMA 1PTOH 4P2CB 1WVLA 2WB1E 4LF5L 2NVXB 3MZ5A 1LTRD 3M4QA 3MEHA 1QUQB 2F0IA 3PUYA 4OONA 4RHRA 3GTJB 1SNMA 3K5LA 1EY4A 4ALPA 4BY7B 4X66Q 2A6ED 4JI0L 4HMJA 1EIGA 4DKAC 1I5FA 3D6WA 1FR3A 2N8NA 3PIPA 5C4XH 4A3GH 4DXGA 5LL6S 1W2BA 4DV3Q 4JI3L 4N9PA 1SFOB 2RHQB 2JA8G 1B53A 4L63B 2H4OA 4ZRZA 3H3VC 3ERQA 3MXNA 4U68A 1HNXL 5CV9A 3HOYB 1WOCA 1F2YA 4Z9CB 4JI4Q 1PHJA 5ISRA 4DV1Q 1VMPA 4R4OA 2JN4A 1BR9A 1J6QA 4IPGA 2Z8LA 1HFNA 3DEPA 4A93H 3S17B 2X69A 1SMYC 2VY3A 4KHVA 2EYMA 2F0KA 4C3HH 2ZTEA 3CPFA 2IL8A 3FMCA 1E3PA 4DAVA 4JBMA 2IHFA 2PI2E 4YY3L 2JA6B 2IWHA 4OWTB 3H91A 3R93A 4OELB 2OTJA 1QWYA 1HPCA 4UDUC 4IPDA 5CBAE 3AEVA 3LNNA 2A6HC 1EFID 1IBKQ 4A3KB 1VQMA 1A2TA 2PPBC 4JG2A 2A69C 4K6LA 4A3LG 2IY5B 1BCPC 2F0OA 4X62L 2E2IB 4DV7Q 2K32A 2XWJB 3TP8A 1NMFA 4XQQA 2PI2A 1G6PA 3CCRA 1PH9A 3CPWA 3D4WA 2YTVA 4KHZA 3JAML 2ES2A 3HKZB 4B3TL 4DFAA 3HOWG 4JCVE 2KQ3A 4IUPA 5M3MG 2XVSA 5D14A 2VL6A 1TWFB 4JI6L 4U673 4DV6L 3CD6A 3BJUA 3I4MG 3I4NH 3VDYA 5C4XG 3AQQA 4HSPA 4K6DA 2SDFA 1CZWA 1QUQA 1VQIA 3OIPA 1LACA 1CZGA 2JQOA 1JE4A 3MHBA 1EYGA 5FLXc 4PZ8A 2FMCA 4R8NA 1Q86C 1OO9B 4HJ7A 2I07B 5C0XI 1TWGB 2K28A 1AZPA 1EQRA 4DV7L 2UXCQ 2JA7G 1IBMQ 2UUBQ 2QA4A 3DMUA 4DV4L 4OL7A 4H44C 2A74C 4DV1L 5IYBG 1EU4A 3PSIA 1VQAA 5I6WA 4JI4L 5C4XB 2F3IA 4KV6A 3STBD 1XNRL 1IXRA 2HQLA 4C3HG 2LFNA 1RTNA 4LUZA 2PQAB 1STYA 3G4SA 5IY0A 1QCBD 1G51A 5JPMC 4JBWA 5M5YB 3Q0AA 2E5LQ 1SNOA 4JI7Q 2E5LL 4OWWB 3TDQA 2X6GA 2HHHL 4N8FA 1CQFA 4JVZA 2WP8J 4HCEA 3X3MA 1PDQA 2GVAA 4QGUA 2K50A 4I7AA 1KRTA 1K83B 3H3VH 1STHA 3KDFB 2DY8A 1VF7A 3KLSA 3MFGA 3QG1A 4LUOA 1QB5D 4ZCKA 3HOXG 2ZJRA 2KA7A 4PG3A 1YJWA 2LXKA 1S5DD 1YBYA 2UUBL 4RKBA 5GQOA 3RZDH 3G6JB 5EPKA 1II3A 2J7ZA 3DHQA 4GNXC 1UE6A 2EXDA 3IAYA 4LNQA 4OIJA 5M3MH 4IALA 1Y1VG 3ND8A 5ELOA 5IP9G 3FHWA 4J15A 1I4PA 1K3RA 1WFQA 3I4MH 2NVYH 1NAPA 4KD4A 2NWGA 3IKJA 5IYCG 1SEBD 1NJIC 3S2HH 3RMHA 2QF7A 4M8AA 2G9HD 3EQLC 1CUKA 1F9QA 4AIMA 3P7JA 3S16H 5FLMH 3E3XA 3D31A 4NB3A 5DEHA 5ELFA 2KOLA 4C3IG 1SBBB 3I8ZA 2KCCA 2X6LA 4YHHQ 4LFCL 1DOLA 1XMQL 1WCMH 2HD3A 2A19A 2EZVA 5CGKA 5HY6A 3GTJH 1ONLA 3NQTA 2VUMH 5IGDA 2CFMA 1VS0A 3GTOH 5ELBA 2NVYB 1PZKD 3GP7A 4Q0FA 1WTQA 1HUMA 5IGBA 4LF6Q 1WYDA 1EEID 3E9IA 2A1AA 1GUGA 1MI2A 2VB2X 4KTAA 2EJMA 1AN8A 1GKHA 1IW7D 4PMBA 3K81C 2XRSD 1K8MA 1LT3D 2EYPA 3EBEA 5CV7A 4N9TA 3A7AB 3WOEA 3CXCA 1EIYB 4LWCA 2RCFA 1HZ9A 3MWYW 1XNQQ 1Q82C 2B2WC 1Q90A 1EYCA 2WKDA 4A76A 3K7AB 3PIOA 4AH6A 1Y1WB 3TP7A 4DR3Q 1I6HB 3GTMB 1X3EA 1RF2D 3I2ZA 3A8KE 2K1BA 1U5KA 5CC4A 4KJOA 1U0LA 1HH2P 4EQPA 5CBEE 2D0PA 2D62A 1W3SA 1HTPA 2K5DA 4LF8L 3PIO3 3E9HA 3VR3A 1HQRD 1WJJA 1K83H 3RLNA 4ME3A 1TWAB 5TSSA 2JEBI 4E6IA 3HOXB 1E0BA 1BO0A 2IHEA 2QDLA 1H9RA 1SNDA 1Z6HA 3TN2A 3I7FA 1ET6A 1QNKA 3W5OA 1CSPA 5EKIA 4IFDI 1JJGA 1OXXK 2JA5H 5LMNQ 2PMZE 4UAIA 1B9NA 1DOMA 4IOAA 1I6HH 4MN3A 3OMCA 4DR2L 5LMUQ 1PH3A 1LM0A 3I4MB 2BH8A 3I91A 2K6AA 3F8TA 2OWOA 1E2ZA 5M5XH 2PQEA 3X3NA 3VR4A 1PTOC 3M4PA 4X66L 5CYUA 4ODGA 4UPAA 1S40A 4V190 1RKNA 4G57A 2VS1A 2OEOA 2CHBD 5FJ8G 2E2JB 3VR5A 1CA6A 2EYJA 3PO3H 3AYHB 3L2PA 2JA5B 3PV0A 3K8AA 3ZJYC 1RIPA 3G6EA 4BY1H 2KECA 1LT5D 3BYTB 3LWUA 3S15B 2VUMB 1YZ6A 3QOJA 1PH8A 3CCJA 1HA5A 1LT4D 1B44D 1KLGD 2E8GA 2NN6I 3RLFA 4H7BA 2AUJD 3QB3A 4JBKA 1SXTA 5JEAG 2A69D 5I9OA 1FD7D 3QIAA 2RDHA 3FP9A 4FF1A 3TEHB 1QZGA 2UU9Q 4R4IA 1EOVA 2LXJA 3GDEA 1DYQA 2PZWA 3CHBD 4FO2A 2A8VA 4K2LA 1EY5A 4IUUA 4KN7C 4A3CH 1GXDC 4DV2Q 5EKLA 4NP5A 1EY6A 1HA6A 5F2DA 5GROA 1DONA 1B70B 5C0XG 3HOVH 1EY7A 2L5TA 3BDCA 4H02A 3ULLA 4L6TB 3NEMA 4IPHA 1TU2B 1N32L 5A35A 4BY7H 2EE1A 3ULJA 2AUKA 1S5CD 1H9JA 2VQEQ 2JE6I 5T1IA 1YNNC 1ILPA 2LMCB 1UWVA 1E1TA 4FDBA 1KABA 1ENCA 3MXPA 5C3EG 1ZEQX 3PMFA 2F3VA 4POGA 1A62A 3M9BA 3IL8A 2JXMB 2F0HA 5JEAJ 3K6OA 1HJPA 1D5MC 3D4DA 2QEXA 4ZUJA 1Z7TA 4IN3A 1Q46A 3K80C 3NK9A 1W6JA 2OT2A 2F0JA 1PRTB 3T16A 2Z9HA 1FJGL 3D6CA 2QW7A 3M3YB 4IZ8A 1EQQA 5DM73 1JOQA 4KHPL 4R9WA 1MD2D 5GAGC 1EZ6A 1SYCA 3R3OA 1K0RA 3I3CA 2H1EA 3FPPA 2KEDA 1JMCA 2ASBA 2B2TA 1G6ZA 4OWXB 4L8JA 1F2ZA 1B1ZA 4B3TQ 3BS1A 1D1KA 1ML0D 1JWMD 4JI1Q 1MHWC 1Y8PB 2F52A 1G2SA 1NE3A 1PZID 2CH4A 3DM1A 2R7FA 2F0NA 4X62Q 2ICEC 1MJEA 1UEBA 4EQ5A 1VDZA 1U4PA 1LO5D 1C7YA 2I46A 1EU3A 4DK6C 3M3YH 1HNZQ 4BY1B 5I6YA 1SN8A 1E2VA 2L4NA 1BCPF 3T13A 4RAUC 5FK9C 1GD7A 3TREA 4OX9L 3HOUB 4N8X1 3HOVG 4NDXA 1J5EQ 1DGSA 1QVCA 3TSSA 2IJ0A 5KEEA 3C2PA 4CKEA 2V4DA 2YYZA 4DNIA 1LTTD 1EL0A 1E2WA 4DR4L 2YTXA 2Z6KA 3P20A 1TXYA 5J3BA 2HDMA 5C5LA 5KRUA 4JV5Q 2VZAA 4UP7A 2QEJC 3FVQA 4R4QA 3BU2A 5C3EH 4O42A 2ZT9C 3RNUA 1STGA 3S14B 4FYDA 2B2VC 4B3SQ 4MHEA 1B7YB 2TSSA 3GD7A 1T9HA 4DR6Q 2L12A 4RH6A 4WJ3M 2CW0D 4A3FG 2R7ZH 3CCVA 2CW0C 2E2DC 1BBXC 3ONAB 4RGNA 4P74A 4HTHA 3HOXH 3K5MA 2Z4IA 4A3LH 1U4MA 1IL8A 2K5VA 5ELNA 4DV5Q 3FKIH 2R92G 1N34L 2PQAA 1TS4A 1K0SA 2VQFL 5EKKA 3UE1A 2UUAL 3SK4A 1MKHA 4DR6L 5C5MA 3A8JE 1UAPA 3HOWH 1H9KA 4MIUA 3CAMA 1EQTA 2E74C 3E0JA 3E0EA 2UXDL 2E2HB 2F4VQ 2E75C 3I4NG 1M8AA 3T1YL 4IO9A 3RUZA 5IYDH 4DV5L 2XIWA 3KDFA 2FINB 5FLMG 1BQQT 4XQJA 5H1SE 2RCNA 2Y0SB 1B4OA 2RA4A 1JQYD 1D5ZC 1KDAA 3NBIA 2AQ1B 1VQDA 1PRTD 1MSGA 3NTKA 4K5XA 4RKLA 4DK1A 3BZCA 5I9PA 4GNXA 2VB3X 4GLVB 4GOPA 3OHXC 3PO3B 3WDNA 1TY0A 3OWEB 5IP7G 2EXZA 2EY1A 3J80L 1XPUA 4DV4Q 2F0UA 2ZM6Q 3H0GG 3EJIA 4ZKBB 3S15H 4LUVA 1SMYD 2MGSA 2IX0A 1CSQA 3S2HB 3S2DH 1SDFA 1G2TA 1A8VA 4TRDA 1PTOF 1KTKA 1UUPA 4RCNA 5BN5A 1NR2A 2WAQE 3ER0A 1E24A 5E4XA 4ZK9B 4PQXA 1V1QA 5E1FA 5IGFA 4CHTB 5C4JB 2UUCQ 4A3FH 4ZKCB 4HSVA 1I3QH 3AFPA 2O5IC 2I5MX 1JJCB 3NELA 3J7A5 1YITA 2YU9B 3Q6SA 1EWHA 3T53B 4BA1I 5HURA 4L5RC 1TVXA 1WTHA 2JA7B 5M3FB 4C3JG 1A3TA 1AEXA 1FJGQ 1WD1A 1FNVA 5A2QL 4JI1L 4YCWA 2WAQB 1TS3A 3OW7A 3A8IE 2K14A 1E22A 2AHOB 4HCSA 1VQ6A 4K5VA 2A73B 3B6YA 3GTPB 2UXDQ 5C6AA 2F0SA 3K0XA 4PV1C 2EJGC 3R8BA 1QOHA 4YWKA 1S5FD 5J39A 2CH4W 1QZHA 3HOUG 1VQGA 4X64Q 3U9SA 2XN9C 3W3AA 3GTGH 1X3PA 1I6VC 1PH2A 2F0QA 3KLSX 1FGBD 1GOZA 5JOBA 3ICEA 4WFN3 2KUMA 2BA1A 1PLFA 2VXWA 3HZXA 4CDDC 1FYCA 4HJAA 1LABA 5KIXA 3DWPA 1WD0A 3QR8A 5I4DA 1WTRA 3F2UA 2B63H 5HGQA 3T56B 4QUCA 3T1YQ 5AJ3Q 1EYAA 1VQLA 3TRZA 1PYWD 1SR3A 1X32A 4NXNQ 1HUNA 2D2CC 3OSOA 4I65A 1PFMA 4XTCS 4X3TA 4ZLTF 4X65L 1B3AA 3BVZA 2VQEL 1SE4A 2EY2A 2L11A 3DLLA 2IPKD 5E3FA 5J1ZA 3K59A 2EOTA 3KYHC 1GUTA 4JI3Q 2A6EC 4XT1B 2I5HA 4RWSC 2M2LA 1IYJB 3IFDA 4OEMB 2FHTA 1N36Q 4IQZA 1X54A 3G71A 4JBJA 1VQFA 4A3BH 2D5DA 3CQZB 1C0AA 4XDXA 2NB0A 3I73A 4C3JH 5IWAL 3M4OB 2K03A 2K01A 4JYAQ 1QVFA 5KYIA 4AYBB 3E6ZX 4RFBA 1YJNA 4LF5Q 1B9MA 2K5QA 2Q8IB 2L15A 1PH1A 4LF9Q 3CRLC 3D4RA 3O13A 3TZDA 5M3FG 4RCOA 1I4GA 3PCOB 2K5HA 4GN4B 2HQEA 3BDLA 1VQPA 5C4JH 2EYHA 3S1QH 2AQ2B 1KDCA 1GUOA 1SE3A 3S24A 2RDFA 3NTIA 4LFAQ 2EPBA 4G7ZC 4C2MB 5C4HA 1SNPA 2K7VA 4AQYL 1PV4A 2CCZA 4BY7G 4RGTA 4Q5VA 1SMXA 1F9SA 2L55A 4B3ML 3UDGA 1K8AC 1JJ2A 1IBLL 1XTDA 5AJ3L 4C3IB 1F77A 2LY7A 3EN2A 1VQJA 2M00A 1KNAA 1ZKOA 3I70A 1UE5A 1JR0D 3M7NA 4BXXH 3HOZB 3NENA 1HXYD 1NY4A 2PW7A 4KY5A 2BDOA 5C0XJ 2I0QA 1FGUA 2OTLA 2KHSA 3MAQA 2DNEA 1B8AA 3GV3A 3NBHB 4K8JA 5IGGA 2Z1CA 2Y0SG 3MXUA 1ESFA 3CW2C 1XNQL 5LL6X 2Q8RE 2L1BA 2ZTDA 3L9AX 2QILA 4XT3B 1SLJA 3NXWA 4FF2A 3GTQH 1EEFD 1L2FA 4A3GB 4LF8Q 2KVMA 4KY6A 4DUZL 1TWFH 1YHAA 4DV2L 4PMCA 5K36G 1HR0W 2N49A 3VYUA 3OMGA 2B2YC 1KNEA 2VNUD 1LT6D 4DXFA 2N88A 4A3MB 3A74A 1HZCA 1PA6A 1L0YB 1V8QA 1ESRA 4K14A 4PMWA 4DAYA 1EY8A 4A3IG 2G5DA 1GHJA 1N32Q 5FKAC 3M4YA 2WIIB 2NVTB 1Y1VB 2G9DA 3T1HL 2XRQD 1T5XD 5FO9B 3BVMA 3F2DA 4JI0Q 1RL2A 3QWNA 1VQBA 1U4RA 2JA6H 1BNZA 5KGUA 3K5NA 1CFMA 1VQ5A 3NUCA 2I5LX 3F2CA 3C1EA 2F0WA 4NW2A 5CV4A 2C5CA 2BE5D 4LF6L 3W1BA 5BR8L 4TVAB 1SJED 3SXHA 4ILWA 5E4WC 2DJGC 1GJXA 2EVBA 3RLOA 4CDFC 3NSWA 5IGEA 3CMAA 2UXBQ 4HN7A 2NBFA 1PMRA 1TY2A 3VYSA 5C44G 1YI2A 2R93B 1TS5A 3GO5A 1PRTC 4GN3B 3U4ZA 4YWMA 3GTPH 2UXBL 3MXGA 2V1CC 4DR1Q 3JAMc 2R7DA 5DLQE 1QNUA 4RHSA 2N3SA 3QOLA 5EJWA 4KD3A 1S3OA 4A3IB 4A4IA 1Y1WG 4GN5A 4FXKC 5BR8Q 3FKIG 2R92H 1CKNB 3NE5B 2R3ZA 1EOTA 1X3GA 5G3LD 3SGIA 2LS01 3RZDB 2EYFA 1F9RA 3NQIA 1KQSA 1WTVA 4JI2Q 1ILQA 4Y52H 3MXNB 3TZUA 1IYVA 1KIXA 2C35B 4DF7A 1A2UA 1R9TB 2F0VA 3L3OC 3CC4A 3NBHA 1I4RA 2EY5A 1EFWA 1EYDA 2KENA 2SEBD 5CV8A 3S14H 1EZ8A 4LMQD 4RA8A 2WFWA 1V1OA 1K28A 5JJLA 3L0OA 4L5QA 1PFSA 2WKCA 2ZTCA 4X65Q 4TQUS 2K75A 3S16B 3HOYG 3S17H 4A93B 4S3SA 1STBA 1A3VA 2F0DA 4OXPA 5IGCA 3BZDB 3HKZG 1EY9A 2UXCL 1HTLD 4JV5L 1M90C 3KOJA 5CV6A 1DOKA 1G91A 1TKWB 4A93G 4AYBG 4DAYB 1VQ4A 1ENAA 3NHHA 4JOIA 3A5ZB 4IUVA 4BBSH 5IT9L 1TS2A 4FVMA 5CORA 3NTHA 3M7GA 5M5XB 2E2IH 4P71A 1SYBA 2BOSA 3SK5A 1R4PB 1YEZA 2MNAA 3UE0A 4A3EH 1TR5A 1Q8KA 3BYYB 4DU9A 1X6OA 2NVQH 4A3KH 3I4OA 3HFZB 2B2TC 4LK1C 1RCVD 3CC2A 1B50A 1KAAA 1U4LA 1MGSA 3PUZA 1JWSD 5EGTA 1I50H 5LHY1 1EWCA 2KEEA 3I55A 1LTID 2HT1A 3BVGA 3KLWA 3FDTA 2O4XA 3KF8B 1STEA 1OXUA 4J8QA 2DNCA 4AQYQ 3F1ZA 2UUCL 2RVLA 3S1NH 3ULPA 2SNSA 1SROA 3HP3A 2RKSA 3DUZA 3R2TA 4GOPC 2B2UC 4BBRG 2B2WA 2IT1A 1KLUD 2A68C 2PNHA 4L5TA 4A3EB 1PRTF 3CMEA 4LFCQ 4FNFA 2AWNA 4ZYSA 3FPUB 1D1IA 1Q8IA 3KF6A 2R61A 2WV6D 4LFBQ 2AQ3B 2RSOA 3HOYH 3IFTA 2HIXA 1K8OA 4YCVA 1H95A 1LLRD 2F4VL 4GS3A 4KKUA 5D3DA 1MBYA 1QVGA 1I50B 1U9RA 2EYLA 1A15A 2B63G 5T1GA 5JVH3 2JA7H 2F0LA 4JI8Q 2CVRA 3H15A 1Q1BA 1GM5A 4WJWA 5IP7H 3J81E 1XPRA 1N8RC 5M5WH 3A55A 3VA5A 1BCPD 1TQOA 2ZXPA 3KF8A 4YY3Q 4GNXB 2HHHQ 3H0GH 5JPNC 4BBSG 3HRZC 4QQBX 4B9WA 4QIWE 3VA7A 1GUWA 2PCFB 4MNOA 4POFA 2HCIA 1BXTA 2SNMA 3DEOA 4DNTB 3GTKH 3HOZG 4OO1G 3SVMA 3KJPA 3EIVA 1VQCA 3GV6A 1SE2A 1IYUA 1RD9D 1PTOB 2PMZB 4JI2L 4GZYC 3STBC 3D8GA 1XNRQ 3HG9A 1S4ZA 1AW7A 4TKOB 4H0LC 5C3WA 1KHIA 4NXNL 4A3KG 4RMFA 4HIKA 1Y1VH 3GTMH 5AFWA 3CF5A 2B8GA 4NXMQ 2AKWB 2ICIA 2NTTA 1EUJA 2XWBB 5IYCH 1D5XC 1J9OA 4UP9A 4JK1C 3U58A 1HNWQ 2B8FA 3NWTA 2Q2TA 1JOOA 3H0GB 2ZJPA 3W1GA 4J1MA 1BOSA 2JP1A 1J5EL 5IP9H 2CKZB 1IW7C 1SJHD 3I4NB 1UE7A 2N78A 4CGYB 3RR5A 1HR0Q 3U4VA 4X64L 1JE5A 2B2UA 3V05A 2KCMA 3GTLH 1BF4A 4B3SL 4GLXA 4BBRH 2WINB 5E7NA 3AU7A 5I2XA 1AE3A 1NMGA 1LTGD 1G291 2EJFC 3ITPA 4DAMA 4BWGB 4LFBL 1WCMG 2VUMG 5K5PA 4KK7A 2JA8B 3GQBA 2KJXA 1RHPA 1BKBA 1H9SB 1ZYRD 5ELEA 4X3KA 2B2YA 4APVA 3J80E 2CWAA 4C1NI 5LMUL 1Q81C 4YCUA 3J7YW 2GA4B 1ZXTA 2RQXA 3SK6A 4HIMA 3TP6A 4IFDG 5LMNL 3TMEA 4IJLA 2YTYA 4LW1A 3CU7A 2A68D 1CTMA 2YV5A 4C56C 1XX8A 4O2DA 1PFBA 2KBNA 1D7QA 4OO1H 3C3LA 1VQKA 4RGMA 1RTOA 5JJIA 4DUZQ 2NVXH 4PZ7A 4O1NA 1S5ED 1SSOA 1VQ8A 1F2MA 4DGZA 3KBXA 3LX0A 4HJ5A 3HKZE 1O7IA 4IJHA 4CJ2C 1JWUD 4GKKL 1LV9A 1LUZA 3ZYYX 1Z47A 1HFGA 2OF1A 2MFIA 4LF7Q 3FKIB 5KNBA 2HUGA 2CQOA 1CKOA 5K36H 1AH9A 1Y69U 4NKLA 4KMUC 1SNCA 4A3BG 4HIDA 4BA2I 1V1PB 1GHKA 1SFOH 2XSCA 5M3MB 5A2QE 1X56A 1DZ1A 2CWPA 2F0MA 3HOWB 1O7ZA 3GTKB 2F0TA 1QILA 1VQ7A 3V96A 5D65A 3I90A 3P75A 4DAPA 1F2LA 2NZHA 1GUSA 2E2HH 2GN5A 3K0YA 1DJRD 3EFXD 4BBSB 2RDGA 4IFDJ 2K52A 4IOCA 3Q8DA 1CA5A 3HOVB 4CDEC 3BZKA 2JA5G 3CCMA 3TS2A 4P73A 3JAMi 4QUFA 4EVOA 3OTOL 1E7ZA 1MIUA 1NSNS 3N52A 3MTSA 4A3DG 2KCNA 3TP5A 1VCIA 1S72A 3J7ZC 3TS0A 1CHPD 1A63A 2F0PA 1VQNA 5JJKA 2MHVA 1N34Q 1BBWA 2F0GA 1VQOA 1N33Q 1QJOA 1CKMA 5EQ0A 3SHLA 4GLAC 3URYA 3F2BA 3EA6A 3UDIA 3DXJC 4QL5A 5IT9E 3GTOB 1WTWA 3IRBA 4IFDH 1YIJA 3Q22A 3CC7A 4BBRB 4LF9L 4A3MH 3P1HA 1E1OA 4BXXG 4JYAL 2QDBA 1BCPB 4BY1G 1Y8OB 5GAEC 5FOBB 5C4ZA 1WI5A 5FJ8H 4CBVA 4P72A 4QF4A 4B3RL 2K33A 3OWFA 4DNRB 3PO3G 1K9MC 1HNWL 1PTOD 3T1HQ 1D2BA 1B3QA 1DD2A 1UEAB 4G7OC 4NXML 3K7AH 1PYBA 2OQ0A 5FO8B 4ABNA 2ID0A 3OIQA 2BH2A 1SYGA 2NUCA 2RHSB 4XIGS 2ATWA 1JORA 2SOBA 3C1FA 3K57A 1C9OA 2Y0SE 5JEAH 5IOCA 2GVBA 3EVQA 3W2DA 5JAVA 4A3CG 3J81c 4XYOA 1JICA 1YVCA 4FP5D 3OTOQ 3OW2A 3RN2A 1YJ9A 2PO4A 4CDCC 1K73C 1EIHA 1OTCA 1STAA 3K7UC 3PUXA 4QCLA 2DGYA 4GOPB 1BDOA 4B08A 1AZQA 1Z9FA 3A7LA 4A3IH 4A3JH 4F87A 2K5NA 4OHJA 4GKJL 1B2TA 3ERSX 5C0XH 5IIFA 3Q24A 2F0EA 3R2IA 1TWCH 2B3GA 2M9VA 4JW0A 4CJ1B 2F0FA 2PZUA 4KKTA 3H6MA 3KLRA 3Q23A 4J6HA 4CKCA 3J81L 2Z6KC 1I94Q 2JA6G 1R9TH 1NR4A 3J80c 3OYYA 3G7LA 1M4VA 4EX5A 1L0WA 1YNJC 3SE0A 5BN4A 3NWSA 1LTAD 2JK8A 3WOFA
chains in the Genus database with same CATH topology
4R4CA 5C44G 1YI2A 1Q46A 4Y7NH 3GO5A 1Y14B 4GN3B 3U4ZA 3UDFA 3K80C 4YWMA 2NN6G 3GTPH 2UXBL 1OXVA 3KFUA 1FJGL 2V1CC 4DR1Q 2WB1E 4RG1A 3JAMc 1IBLQ 4LF5L 2R7DA 5DLQE 3M4QA 2N3SA 1QUQB 3PUYA 1EQQA 1S3OA 4JI5L 2AMCB 4OONA 4A4IA 1Y1WG 4KHPL 4GN5A 3MEFA 5BR8Q 3FKIG 5GAGC 2R92H 1CKNB 1P8LA 4WJ4A 1K0RA 1GVPA 1X3GA 3SGIA 4ALPA 1XJVA 1Q12A 1JMCA 1Y1WH 2ASBA 1KQSA 4OWXB 1KRSA 4JI2Q 4Y52H 3MXNB 4JI6Q 4X66Q 4JI0L 1KIXA 2C35B 4B3TQ 4DKAC 1I5FA 3J81j 2N8NA 2JA8H 3PIPA 5C4XH 4HJ9A 4A3GH 2MO0A 3CC4A 4JI1Q 1EFWA 1PVOA 1CKNA 1W2BA 4DV3Q 2KENA 4JI3L 3H3VI 3S14H 2F52A 2RHQB 2JA8G 1NE3A 2WFWA 5GADC 2R7FA 4B3MQ 1HNXL 4X62Q 5JJLA 3L0OA 4L5QA 1MJEA 1PFSA 1UEBA 4EQ5A 2ZTCA 1C7YA 2JJQA 1WOCA 4DK6C 4TQUS 4X65Q 3M3YH 5IWAQ 2K75A 4JI4Q 1PHJA 1HNZQ 1NTGA 3HOYG 1SN8A 3CCUA 4DV1Q 3TREA 3S17H 4OX9L 1GD7A 4R4OA 3HOVG 1J6QA 4DR7L 4IPGA 4OXPA 2H5XA 3HKZG 1DGSA 1QVCA 1J5EQ 2UXCL 4JV5L 1KD1C 2YYZA 1M90C 4DNIA 3KOJA 4A93H 3PO2H 2VY3A 3J81i 1KAWA 4C3HH 5EAYA 2ZTEA 3CPFA 4X6AH 4DR4L 2YTXA 2Z6KA 1TXYA 3HKSA 5J3BA 4A93G 1E3PA 4AYBG 4DAYB 1FVIA 2IHFA 2PI2E 4YY3L 1VQ4A 4JBMA 4OWTB 4JV5Q 4JOIA 2VZAA 3A5ZB 2EQSA 4UP7A 4R4QA 4BBSH 3BU2A 1JT8A 5C3EH 2OTJA 2VW9A 1YHQA 3RNUA 4IPDA 3HOZH 2E2IH 4B3SQ 1YNXA 3AEVA 1B7YB 4P71A 3GD7A 2KCTA 1IBKQ 1T9HA 4DR6Q 1VQMA 4WJ3M 4JG2A 1YEZA 2MNAA 2VQFQ 4A3FG 4A3LG 2IY5B 3UE0A 2Q2HA 4DPGA 4X62L 3CCVA 4DUYQ 4YWLA 4DV7Q 4A3EH 4LF4Q 2YU9H 3A5UA 1Q8KA 1X6OA 1KC8C 2NVQH 1NMFA 4A3KH 4P74A 3HOXH 2PI2A 3I4OA 4A3LH 1MJCA 1G6PA 3HFZB 3CCRA 1PH9A 3CPWA 2R7ZG 4A3EG 2K5VA 3DM3A 5ELNA 3CC2A 4DV5Q 3FKIH 2YTVA 2R92G 4KHZA 3PUZA 2ES2A 2OQKA 1V43A 1PH6A 1I50H 4DR2Q 5IT9c 1N34L 4JCVE 4B3TL 3CCQA 2PQAA 5M3MG 1ASYA 3I55A 3HOWG 2VL6A 4JI6L 2VQFL 2HT1A 3UE1A 3KLWA 2UUAL 3KF8B 4DR5Q 1MKHA 4DV6L 3CD6A 4A75A 4DR6L 3BJUA 3I4MG 1BVSA 1OXUA 3HOWH 3I4NH 1V9PA 3JC66 4AQYQ 3VDYA 1X65A 3F1ZA 5IYDG 2UUCL 3CAMA 2JEAI 3S1NH 4A3GG 3ULPA 5C4XG 3AQQA 1SROA 1VQEA 1IL2A 3E0EA 2UXDL 1QUQA 1VQIA 2F4VQ 4GOPC 2MQHA 3I4NG 3T1YL 4O0AA 4AYBE 4IO9A 2JQOA 5IYDH 4BBRG 1EYGA 1Q1EA 2IT1A 2PNHA 5FLXc 4DV5L 4L5TA 3KDFA 3CMEA 4JI7L 4LFCQ 1D8LA 5FLMG 2AWNA 3PO2G 5H1SE 2RCNA 4PZ8A 1Q86C 4HJ7A 4K0KL 5C0XI 2KHIA 3KF6A 4DR5L 4C2MH 4LFBQ 1VQDA 1EQRA 4DV7L 3HOYH 2HIXA 2JA7G 2UXCQ 4YCVA 5IYBH 3BZCA 4GNXA 1IBMQ 1H95A 2UUBQ 2QA4A 2F4VL 4GLVB 4DR7Q 4GOPA 4GS3A 4DV4L 1QVGA 1JB7A 4DV0Q 4OX9Q 2B63G 5IP7G 4DV1L 1XMOL 1XPUA 2JA7H 5IYBG 3PSIA 1PYSB 1VQAA 4JI8Q 1HNZL 4JI4L 4LF7L 2F3IA 4KI0A 3AFQA 3STBD 1IXRA 3H15A 2HQLA 4DV4Q 1Q1BA 4DV6Q 1XNRL 1GM5A 2ZM6Q 2QGQA 3H0GG 4LUZA 2PQAB 5IP7H 1XPRA 1N8RC 5M5WH 3G4SA 3S15H 5IY0A 1G51A 4LUVA 4JBWA 4GNXB 4YY3Q 1AE2A 2IX0A 2HHHQ 3H0GH 4BBSG 2E5LQ 1CSQA 1NBWA 4JI7Q 2E5LL 4QQBX 4OWWB 4QIWE 3S2DH 1A0IA 1A8VA 4MNOA 4POFA 2HHHL 3PUWA 3HOZG 4OO1G 3GTKH 3ER0A 2WAQE 2E2JH 1E24A 3KJPA 1VQ9A 3EIVA 2WP8J 1VQCA 2MO1A 2GVAA 4QGUA 1V1QA 2K50A 1UE1A 1KRTA 1EWIA 4JI2L 3STBC 3H3VH 3KDFB 4P75A 4A3FH 2UUCQ 1XNRQ 1I3QH 1TWGH 3AFPA 4LUOA 3RN5A 2I5MX 1JJCB 3NELA 1KHIA 4NXNL 4A3KG 3HOXG 4DV0L 3J7A5 1YITA 4RMFA 2ZJRA 4PG3A 1YJWA 2LXKA 1YBYA 4KHPQ 4HIKA 4BA1I 2K4KA 2UUBL 4L5RC 1Y1VH 5GQOA 3GTMH 5IE8A 3CF5A 3RZDH 4NXMQ 2AKWB 1FJGQ 4GNXC 1EUJA 1P16A 1UE6A 2EXDA 4K0KQ 4LNQA 2OCEA 2B29A 1LTLA 2WAQG 5M3MH 5IYCH 4UP9A 1Y1VG 5ELOA 5IP9G 3FHWA 4JI1L 4R1JA 4YCWA 4J15A 1GO3E 3U58A 1HNWQ 2D0OA 2Q2TA 2Z0SA 1K3RA 1HZAA 1WFQA 2ZJPA 2NVYH 3I4MH 3CCLA 1PH7A 3W1GA 5IYCG 2K14A 1E22A 2AHOB 1VQ6A 1X3FA 5IP9H 2CKZB 1J5EL 3B6YA 1NJIC 1K8GA 2UXDQ 3WWVA 3K0XA 1UE7A 2ZJQA 2KHJA 2N78A 3RR5A 1HR0Q 3U4VA 4X64L 1JE5A 1IBKL 3S2HH 2KCMA 4YWKA 1I94L 3GTLH 1CUKA 1L1OB 4GLXA 1QZHA 4B3SL 4BBRH 3A0JA 4AIMA 3HOUG 1VQGA 5E7NA 4X64Q 3RZOH 1OXTA 1AE3A 3GTGH 1NMGA 4JI5Q 1PH2A 5FLMH 3S16H 1G291 1FL0A 1L1OC 4DK3C 3D31A 2NVTH 2IX1A 4DAMA 4UP8A 3ICEA 4NB3A 4LFBL 3HOUH 2BA1A 1WCMG 2WB1G 2XGTA 4MZ9A 4HJAA 4YHHQ 4LFCL 2VUMG 1XMQL 3L7ZC 1WCMH 1BKBA 2B63H 5HGQA 2A19A 4APVA 5HY6A 3GTJH 5AJ3Q 3T1YQ 1VQLA 2VUMH 3TRZA 2CWAA 3CP0A 4DUYL 2CFMA 1SR3A 1VS0A 5LMUL 3GTOH 1Q81C 4YCUA 4NXNQ 4HIMA 3PGZA 4LF6Q 1WYDA 3E9IA 4IFDG 2A1AA 5LMNL 4XTCS 4X65L 4IJLA 3PF4A 2YTYA 3KF6B 1GKHA 4LW1A 4A3MG 2UUAQ 2YV5A 2VQEL 4O2DA 1SRUA 2XTIA 3DLLA 3K81C 2KBNA 1D7QA 3EBEA 1VQKA 5JJIA 3KYHC 4DUZQ 2NVXH 4PZ7A 4JI3Q 4DV3L 1VQ8A 2DUDA 5GAHC 3J80i 2I5HA 3CXCA 1YHBA 4HJ8A 5LMNW 3HKZE 1O7IA 4IJHA 4HJ5A 1EIYB 1IYJB 4LWCA 4GKKL 1HZ9A 1N36Q 1EIFA 4LF4L 1XNQQ 1LUZA 1Q82C 1X54A 2NZOA 4QY7A 1Z47A 2HIVA 1ASZA 3PUVA 3G71A 2MFIA 4JBJA 1VQFA 4A3BH 4LF7Q 4JI8L 4A76A 3PIOA 4AH6A 1C0AA 4DR3Q 2CQOA 1CKOA 4C3JH 1AH9A 5IWAL 1X3EA 2UU9L 3I2ZA 1QVFA 4JYAQ 1Q7YC 1U5KA 5M3FH 4A3BG 4HIDA 4BA2I 1M1KC 1PH5A 1IBML 1U0LA 1SFOH 1YJNA 1HH2P 4LF5Q 1X56A 2D0PA 2L15A 2CWPA 1PH1A 4LF9Q 2D62A 1W3SA 1N36L 3M4OH 4LF8L 5M3FG 3E9HA 1VQ7A 4DR4Q 3PCOB 1WJJA 1K83H 2K5HA 2NZHA 4ME3A 4GN4B 2GN5A 3RLNA 1VQPA 2E2HH 2UXBQ 5C4JH 2JEBI 4IFDJ 3S1QH 2K52A 4IOCA 3Q8DA 4QJFA 2LSSA 3BZKA 2IHEA 4KLKA 3S24A 1X55A 2JA5G 3CCMA 2Q2UA 4A3JG 4LFAQ 4P73A 3JAMi 3I7FA 3TS2A 1KXLA 3OTOL 1E7ZA 3W5OA 4IFDI 1CSPA 1MIUA 3U50C 4AQYL 1JJGA 4A3DG 1OXXK 1PV4A 2CCZA 1VCIA 4BY7G 2JA5H 5LMNQ 4C3IH 1S72A 3J7ZC 2PMZE 1SMXA 3CCSA 3TS0A 1IZ6A 1A63A 4IOAA 1I6HH 1TWHH 4A3DH 3TQYA 2EIFA 1VQNA 4OO1I 5JJKA 4B3ML 4DR2L 1BBWA 5LMUQ 3UDGA 1VQOA 1PH3A 1N34Q 1K8AC 1JJ2A 1XTDA 1IBLL 1LM0A 1N33Q 5AJ3L 1CKMA 2BH8A 4GLAC 3EN2A 4JOIC 1VQJA 1L1OA 3F8TA 3F2BA 2OWOA 3LGJA 3M85A 2R93G 3UDIA 1UE5A 4QL5A 1KL9A 3M7NA 1SE8A 3IRBA 2ALYB 3NENA 5M5XH 3S1RH 4BXXH 2JA9A 1NY4A 1YIJA 1N33L 4LF9L 3CC7A 3M4PA 4JC0A 4X66L 4A3MH 1S40A 4UPAA 3D0FA 5C0XJ 2VS1A 2I0QA 1FGUA 3UDXA 1E1OA 1TWAH 2OTLA 4BXXG 1LYLA 4JYAL 1HZBA 1B8AA 5FJ8G 3NBHB 4DR3L 4BY1G 5GAEC 3PO3H 3AYHB 2Y0SG 3L2PA 1WI5A 3PV0A 3K8AA 3ZJYC 5FJ8H 1RIPA 4P72A 3G6EA 3CW2C 3CCEA 4BY1H 1XNQL 4B3RL 3PO3G 2ZTDA 1K9MC 1HNWL 1YZ6A 1SLJA 3T1HQ 1PH8A 4HIOA 1XPOA 3CCJA 3GTQH 5M5YH 1L2FA 4LF8Q 4DUZL 1TWFH 1YHAA 2E8GA 2NN6I 3RLFA 4DV2L 4JBKA 5K36G 5JEAG 3CQZH 3K7AH 1N9WA 1PYBA 2OQ0A 1HR0W 4NXML 2ID0A 1X9NA 2N49A 2BH2A 3S1MH 2RHSB 3FP9A 4XIGS 3TEHB 2ATWA 3KJOA 1QZGA 2UU9Q 2Q2IA 2R6GA 1C9OA 2Y0SE 4R4IA 2LXJA 1EOVA 3GDEA 2VNUD 2GVBA 4A3CG 3J81c 4MTNA 3A74A 1YVCA 1HZCA 3OW2A 3OTOQ 1PA6A 3RN2A 1BBUA 2A8VA 1HNXQ 4PMWA 1YJ9A 4LFAL 4A3IG 2R7ZH 1K73C 4A3CH 4GKJQ 4GKKQ 1N32Q 4DV2Q 1OTCA 3PUXA 1VQHA 3K7UC 2DGYA 5GROA 4GOPB 1B70B 5C0XG 1XMQQ 3HOVH 1Z9FA 4A3JH 4A3IH 3T1HL 4H02A 3ULLA 4YHHL 2BA0A 3PF5A 4NPSA 2FXQA 2K5NA 3NEMA 4IPHA 2RF4A 3F2DA 4GKJL 4JI0Q 1RL2A 3ERSX 4BY7H 4B3RQ 1N32L 4R4TA 4IPCA 3ULJA 1VQBA 2JA6H 2VQEQ 2JE6I 2ZM6L 3I56A 1TWCH 2B3GA 1VQ5A 2I5LX 3F2CA 1UWVA 1E1TA 2Z6KC 4L5SA 4FDBA 4LF6L 3W1BA 5BR8L 1XMOQ 1I94Q 2JA6G 1R9TH 3J80c 4TVAB 3OYYA 1OXSC 3G48A 5C3EG 1HR0L 4EX5A 1L0WA 2AWOA 4POGA 2R93H 1A62A 3M9BA 5C44H 4DR1L 3RLOA 4UY8C 2JK8A 4PZ6A 3CMAA 5JEAJ 1PH4A 1HJPA 2QEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4C A;  5C44 G;  1YI2 A;  1Q46 A;  4Y7N H;  3GO5 A;  1Y14 B;  4GN3 B;  3U4Z A;  3UDF A;  3K80 C;  4YWM A;  2NN6 G;  3GTP H;  2UXB L;  1OXV A;  3KFU A;  1FJG L;  2V1C C;  4DR1 Q;  2WB1 E;  4RG1 A;  3JAM c;  1IBL Q;  4LF5 L;  2R7D A;  5DLQ E;  3M4Q A;  2N3S A;  1QUQ B;  3PUY A;  1EQQ A;  1S3O A;  4JI5 L;  2AMC B;  4OON A;  4A4I A;  1Y1W G;  4KHP L;  4GN5 A;  3MEF A;  5BR8 Q;  3FKI G;  5GAG C;  2R92 H;  1CKN B;  1P8L A;  4WJ4 A;  1K0R A;  1GVP A;  1X3G A;  3SGI A;  4ALP A;  1XJV A;  1Q12 A;  1JMC A;  1Y1W H;  2ASB A;  1KQS A;  4OWX B;  1KRS A;  4JI2 Q;  4Y52 H;  3MXN B;  4JI6 Q;  4X66 Q;  4JI0 L;  1KIX A;  2C35 B;  4B3T Q;  4DKA C;  1I5F A;  3J81 j;  2N8N A;  2JA8 H;  3PIP A;  5C4X H;  4HJ9 A;  4A3G H;  2MO0 A;  3CC4 A;  4JI1 Q;  1EFW A;  1PVO A;  1CKN A;  1W2B A;  4DV3 Q;  2KEN A;  4JI3 L;  3H3V I;  3S14 H;  2F52 A;  2RHQ B;  2JA8 G;  1NE3 A;  2WFW A;  5GAD C;  2R7F A;  4B3M Q;  1HNX L;  4X62 Q;  5JJL A;  3L0O A;  4L5Q A;  1MJE A;  1PFS A;  1UEB A;  4EQ5 A;  2ZTC A;  1C7Y A;  2JJQ A;  1WOC A;  4DK6 C;  4TQU S;  4X65 Q;  3M3Y H;  5IWA Q;  2K75 A;  4JI4 Q;  1PHJ A;  1HNZ Q;  1NTG A;  3HOY G;  1SN8 A;  3CCU A;  4DV1 Q;  3TRE A;  3S17 H;  4OX9 L;  1GD7 A;  4R4O A;  3HOV G;  1J6Q A;  4DR7 L;  4IPG A;  4OXP A;  2H5X A;  3HKZ G;  1DGS A;  1QVC A;  1J5E Q;  2UXC L;  4JV5 L;  1KD1 C;  2YYZ A;  1M90 C;  4DNI A;  3KOJ A;  4A93 H;  3PO2 H;  2VY3 A;  3J81 i;  1KAW A;  4C3H H;  5EAY A;  2ZTE A;  3CPF A;  4X6A H;  4DR4 L;  2YTX A;  2Z6K A;  1TXY A;  3HKS A;  5J3B A;  4A93 G;  1E3P A;  4AYB G;  4DAY B;  1FVI A;  2IHF A;  2PI2 E;  4YY3 L;  1VQ4 A;  4JBM A;  4OWT B;  4JV5 Q;  4JOI A;  2VZA A;  3A5Z B;  2EQS A;  4UP7 A;  4R4Q A;  4BBS H;  3BU2 A;  1JT8 A;  5C3E H;  2OTJ A;  2VW9 A;  1YHQ A;  3RNU A;  4IPD A;  3HOZ H;  2E2I H;  4B3S Q;  1YNX A;  3AEV A;  1B7Y B;  4P71 A;  3GD7 A;  2KCT A;  1IBK Q;  1T9H A;  4DR6 Q;  1VQM A;  4WJ3 M;  4JG2 A;  1YEZ A;  2MNA A;  2VQF Q;  4A3F G;  4A3L G;  2IY5 B;  3UE0 A;  2Q2H A;  4DPG A;  4X62 L;  3CCV A;  4DUY Q;  4YWL A;  4DV7 Q;  4A3E H;  4LF4 Q;  2YU9 H;  3A5U A;  1Q8K A;  1X6O A;  1KC8 C;  2NVQ H;  1NMF A;  4A3K H;  4P74 A;  3HOX H;  2PI2 A;  3I4O A;  4A3L H;  1MJC A;  1G6P A;  3HFZ B;  3CCR A;  1PH9 A;  3CPW A;  2R7Z G;  4A3E G;  2K5V A;  3DM3 A;  5ELN A;  3CC2 A;  4DV5 Q;  3FKI H;  2YTV A;  2R92 G;  4KHZ A;  3PUZ A;  2ES2 A;  2OQK A;  1V43 A;  1PH6 A;  1I50 H;  4DR2 Q;  5IT9 c;  1N34 L;  4JCV E;  4B3T L;  3CCQ A;  2PQA A;  5M3M G;  1ASY A;  3I55 A;  3HOW G;  2VL6 A;  4JI6 L;  2VQF L;  2HT1 A;  3UE1 A;  3KLW A;  2UUA L;  3KF8 B;  4DR5 Q;  1MKH A;  4DV6 L;  3CD6 A;  4A75 A;  4DR6 L;  3BJU A;  3I4M G;  1BVS A;  1OXU A;  3HOW H;  3I4N H;  1V9P A;  3JC6 6;  4AQY Q;  3VDY A;  1X65 A;  3F1Z A;  5IYD G;  2UUC L;  3CAM A;  2JEA I;  3S1N H;  4A3G G;  3ULP A;  5C4X G;  3AQQ A;  1SRO A;  1VQE A;  1IL2 A;  3E0E A;  2UXD L;  1QUQ A;  1VQI A;  2F4V Q;  4GOP C;  2MQH A;  3I4N G;  3T1Y L;  4O0A A;  4AYB E;  4IO9 A;  2JQO A;  5IYD H;  4BBR G;  1EYG A;  1Q1E A;  2IT1 A;  2PNH A;  5FLX c;  4DV5 L;  4L5T A;  3KDF A;  3CME A;  4JI7 L;  4LFC Q;  1D8L A;  5FLM G;  2AWN A;  3PO2 G;  5H1S E;  2RCN A;  4PZ8 A;  1Q86 C;  4HJ7 A;  4K0K L;  5C0X I;  2KHI A;  3KF6 A;  4DR5 L;  4C2M H;  4LFB Q;  1VQD A;  1EQR A;  4DV7 L;  3HOY H;  2HIX A;  2JA7 G;  2UXC Q;  4YCV A;  5IYB H;  3BZC A;  4GNX A;  1IBM Q;  1H95 A;  2UUB Q;  2QA4 A;  2F4V L;  4GLV B;  4DR7 Q;  4GOP A;  4GS3 A;  4DV4 L;  1QVG A;  1JB7 A;  4DV0 Q;  4OX9 Q;  2B63 G;  5IP7 G;  4DV1 L;  1XMO L;  1XPU A;  2JA7 H;  5IYB G;  3PSI A;  1PYS B;  1VQA A;  4JI8 Q;  1HNZ L;  4JI4 L;  4LF7 L;  2F3I A;  4KI0 A;  3AFQ A;  3STB D;  1IXR A;  3H15 A;  2HQL A;  4DV4 Q;  1Q1B A;  4DV6 Q;  1XNR L;  1GM5 A;  2ZM6 Q;  2QGQ A;  3H0G G;  4LUZ A;  2PQA B;  5IP7 H;  1XPR A;  1N8R C;  5M5W H;  3G4S A;  3S15 H;  5IY0 A;  1G51 A;  4LUV A;  4JBW A;  4GNX B;  4YY3 Q;  1AE2 A;  2IX0 A;  2HHH Q;  3H0G H;  4BBS G;  2E5L Q;  1CSQ A;  1NBW A;  4JI7 Q;  2E5L L;  4QQB X;  4OWW B;  4QIW E;  3S2D H;  1A0I A;  1A8V A;  4MNO A;  4POF A;  2HHH L;  3PUW A;  3HOZ G;  4OO1 G;  3GTK H;  3ER0 A;  2WAQ E;  2E2J H;  1E24 A;  3KJP A;  1VQ9 A;  3EIV A;  2WP8 J;  1VQC A;  2MO1 A;  2GVA A;  4QGU A;  1V1Q A;  2K50 A;  1UE1 A;  1KRT A;  1EWI A;  4JI2 L;  3STB C;  3H3V H;  3KDF B;  4P75 A;  4A3F H;  2UUC Q;  1XNR Q;  1I3Q H;  1TWG H;  3AFP A;  4LUO A;  3RN5 A;  2I5M X;  1JJC B;  3NEL A;  1KHI A;  4NXN L;  4A3K G;  3HOX G;  4DV0 L;  3J7A 5;  1YIT A;  4RMF A;  2ZJR A;  4PG3 A;  1YJW A;  2LXK A;  1YBY A;  4KHP Q;  4HIK A;  4BA1 I;  2K4K A;  2UUB L;  4L5R C;  1Y1V H;  5GQO A;  3GTM H;  5IE8 A;  3CF5 A;  3RZD H;  4NXM Q;  2AKW B;  1FJG Q;  4GNX C;  1EUJ A;  1P16 A;  1UE6 A;  2EXD A;  4K0K Q;  4LNQ A;  2OCE A;  2B29 A;  1LTL A;  2WAQ G;  5M3M H;  5IYC H;  4UP9 A;  1Y1V G;  5ELO A;  5IP9 G;  3FHW A;  4JI1 L;  4R1J A;  4YCW A;  4J15 A;  1GO3 E;  3U58 A;  1HNW Q;  2D0O A;  2Q2T A;  2Z0S A;  1K3R A;  1HZA A;  1WFQ A;  2ZJP A;  2NVY H;  3I4M H;  3CCL A;  1PH7 A;  3W1G A;  5IYC G;  2K14 A;  1E22 A;  2AHO B;  1VQ6 A;  1X3F A;  5IP9 H;  2CKZ B;  1J5E L;  3B6Y A;  1NJI C;  1K8G A;  2UXD Q;  3WWV A;  3K0X A;  1UE7 A;  2ZJQ A;  2KHJ A;  2N78 A;  3RR5 A;  1HR0 Q;  3U4V A;  4X64 L;  1JE5 A;  1IBK L;  3S2H H;  2KCM A;  4YWK A;  1I94 L;  3GTL H;  1CUK A;  1L1O B;  4GLX A;  1QZH A;  4B3S L;  4BBR H;  3A0J A;  4AIM A;  3HOU G;  1VQG A;  5E7N A;  4X64 Q;  3RZO H;  1OXT A;  1AE3 A;  3GTG H;  1NMG A;  4JI5 Q;  1PH2 A;  5FLM H;  3S16 H;  1G29 1;  1FL0 A;  1L1O C;  4DK3 C;  3D31 A;  2NVT H;  2IX1 A;  4DAM A;  4UP8 A;  3ICE A;  4NB3 A;  4LFB L;  3HOU H;  2BA1 A;  1WCM G;  2WB1 G;  2XGT A;  4MZ9 A;  4HJA A;  4YHH Q;  4LFC L;  2VUM G;  1XMQ L;  3L7Z C;  1WCM H;  1BKB A;  2B63 H;  5HGQ A;  2A19 A;  4APV A;  5HY6 A;  3GTJ H;  5AJ3 Q;  3T1Y Q;  1VQL A;  2VUM H;  3TRZ A;  2CWA A;  3CP0 A;  4DUY L;  2CFM A;  1SR3 A;  1VS0 A;  5LMU L;  3GTO H;  1Q81 C;  4YCU A;  4NXN Q;  4HIM A;  3PGZ A;  4LF6 Q;  1WYD A;  3E9I A;  4IFD G;  2A1A A;  5LMN L;  4XTC S;  4X65 L;  4IJL A;  3PF4 A;  2YTY A;  3KF6 B;  1GKH A;  4LW1 A;  4A3M G;  2UUA Q;  2YV5 A;  2VQE L;  4O2D A;  1SRU A;  2XTI A;  3DLL A;  3K81 C;  2KBN A;  1D7Q A;  3EBE A;  1VQK A;  5JJI A;  3KYH C;  4DUZ Q;  2NVX H;  4PZ7 A;  4JI3 Q;  4DV3 L;  1VQ8 A;  2DUD A;  5GAH C;  3J80 i;  2I5H A;  3CXC A;  1YHB A;  4HJ8 A;  5LMN W;  3HKZ E;  1O7I A;  4IJH A;  4HJ5 A;  1EIY B;  1IYJ B;  4LWC A;  4GKK L;  1HZ9 A;  1N36 Q;  1EIF A;  4LF4 L;  1XNQ Q;  1LUZ A;  1Q82 C;  1X54 A;  2NZO A;  4QY7 A;  1Z47 A;  2HIV A;  1ASZ A;  3PUV A;  3G71 A;  2MFI A;  4JBJ A;  1VQF A;  4A3B H;  4LF7 Q;  4JI8 L;  4A76 A;  3PIO A;  4AH6 A;  1C0A A;  4DR3 Q;  2CQO A;  1CKO A;  4C3J H;  1AH9 A;  5IWA L;  1X3E A;  2UU9 L;  3I2Z A;  1QVF A;  4JYA Q;  1Q7Y C;  1U5K A;  5M3F H;  4A3B G;  4HID A;  4BA2 I;  1M1K C;  1PH5 A;  1IBM L;  1U0L A;  1SFO H;  1YJN A;  1HH2 P;  4LF5 Q;  1X56 A;  2D0P A;  2L15 A;  2CWP A;  1PH1 A;  4LF9 Q;  2D62 A;  1W3S A;  1N36 L;  3M4O H;  4LF8 L;  5M3F G;  3E9H A;  1VQ7 A;  4DR4 Q;  3PCO B;  1WJJ A;  1K83 H;  2K5H A;  2NZH A;  4ME3 A;  4GN4 B;  2GN5 A;  3RLN A;  1VQP A;  2E2H H;  2UXB Q;  5C4J H;  2JEB I;  4IFD J;  3S1Q H;  2K52 A;  4IOC A;  3Q8D A;  4QJF A;  2LSS A;  3BZK A;  2IHE A;  4KLK A;  3S24 A;  1X55 A;  2JA5 G;  3CCM A;  2Q2U A;  4A3J G;  4LFA Q;  4P73 A;  3JAM i;  3I7F A;  3TS2 A;  1KXL A;  3OTO L;  1E7Z A;  3W5O A;  4IFD I;  1CSP A;  1MIU A;  3U50 C;  4AQY L;  1JJG A;  4A3D G;  1OXX K;  1PV4 A;  2CCZ A;  1VCI A;  4BY7 G;  2JA5 H;  5LMN Q;  4C3I H;  1S72 A;  3J7Z C;  2PMZ E;  1SMX A;  3CCS A;  3TS0 A;  1IZ6 A;  1A63 A;  4IOA A;  1I6H H;  1TWH H;  4A3D H;  3TQY A;  2EIF A;  1VQN A;  4OO1 I;  5JJK A;  4B3M L;  4DR2 L;  1BBW A;  5LMU Q;  3UDG A;  1VQO A;  1PH3 A;  1N34 Q;  1K8A C;  1JJ2 A;  1XTD A;  1IBL L;  1LM0 A;  1N33 Q;  5AJ3 L;  1CKM A;  2BH8 A;  4GLA C;  3EN2 A;  4JOI C;  1VQJ A;  1L1O A;  3F8T A;  3F2B A;  2OWO A;  3LGJ A;  3M85 A;  2R93 G;  3UDI A;  1UE5 A;  4QL5 A;  1KL9 A;  3M7N A;  1SE8 A;  3IRB A;  2ALY B;  3NEN A;  5M5X H;  3S1R H;  4BXX H;  2JA9 A;  1NY4 A;  1YIJ A;  1N33 L;  4LF9 L;  3CC7 A;  3M4P A;  4JC0 A;  4X66 L;  4A3M H;  1S40 A;  4UPA A;  3D0F A;  5C0X J;  2VS1 A;  2I0Q A;  1FGU A;  3UDX A;  1E1O A;  1TWA H;  2OTL A;  4BXX G;  1LYL A;  4JYA L;  1HZB A;  1B8A A;  5FJ8 G;  3NBH B;  4DR3 L;  4BY1 G;  5GAE C;  3PO3 H;  3AYH B;  2Y0S G;  3L2P A;  1WI5 A;  3PV0 A;  3K8A A;  3ZJY C;  5FJ8 H;  1RIP A;  4P72 A;  3G6E A;  3CW2 C;  3CCE A;  4BY1 H;  1XNQ L;  4B3R L;  3PO3 G;  2ZTD A;  1K9M C;  1HNW L;  1YZ6 A;  1SLJ A;  3T1H Q;  1PH8 A;  4HIO A;  1XPO A;  3CCJ A;  3GTQ H;  5M5Y H;  1L2F A;  4LF8 Q;  4DUZ L;  1TWF H;  1YHA A;  2E8G A;  2NN6 I;  3RLF A;  4DV2 L;  4JBK A;  5K36 G;  5JEA G;  3CQZ H;  3K7A H;  1N9W A;  1PYB A;  2OQ0 A;  1HR0 W;  4NXM L;  2ID0 A;  1X9N A;  2N49 A;  2BH2 A;  3S1M H;  2RHS B;  3FP9 A;  4XIG S;  3TEH B;  2ATW A;  3KJO A;  1QZG A;  2UU9 Q;  2Q2I A;  2R6G A;  1C9O A;  2Y0S E;  4R4I A;  2LXJ A;  1EOV A;  3GDE A;  2VNU D;  2GVB A;  4A3C G;  3J81 c;  4MTN A;  3A74 A;  1YVC A;  1HZC A;  3OW2 A;  3OTO Q;  1PA6 A;  3RN2 A;  1BBU A;  2A8V A;  1HNX Q;  4PMW A;  1YJ9 A;  4LFA L;  4A3I G;  2R7Z H;  1K73 C;  4A3C H;  4GKJ Q;  4GKK Q;  1N32 Q;  4DV2 Q;  1OTC A;  3PUX A;  1VQH A;  3K7U C;  2DGY A;  5GRO A;  4GOP B;  1B70 B;  5C0X G;  1XMQ Q;  3HOV H;  1Z9F A;  4A3J H;  4A3I H;  3T1H L;  4H02 A;  3ULL A;  4YHH L;  2BA0 A;  3PF5 A;  4NPS A;  2FXQ A;  2K5N A;  3NEM A;  4IPH A;  2RF4 A;  3F2D A;  4GKJ L;  4JI0 Q;  1RL2 A;  3ERS X;  4BY7 H;  4B3R Q;  1N32 L;  4R4T A;  4IPC A;  3ULJ A;  1VQB A;  2JA6 H;  2VQE Q;  2JE6 I;  2ZM6 L;  3I56 A;  1TWC H;  2B3G A;  1VQ5 A;  2I5L X;  3F2C A;  1UWV A;  1E1T A;  2Z6K C;  4L5S A;  4FDB A;  4LF6 L;  3W1B A;  5BR8 L;  1XMO Q;  1I94 Q;  2JA6 G;  1R9T H;  3J80 c;  4TVA B;  3OYY A;  1OXS C;  3G48 A;  5C3E G;  1HR0 L;  4EX5 A;  1L0W A;  2AWO A;  4POG A;  2R93 H;  1A62 A;  3M9B A;  5C44 H;  4DR1 L;  3RLO A;  4UY8 C;  2JK8 A;  4PZ6 A;  3CMA A;  5JEA J;  1PH4 A;  1HJP A;  2QEX A; 
#chains in the Genus database with same CATH topology
 2R7Z B;  3CKI B;  1SYF A;  1Y14 B;  2MUY A;  2NN6 G;  3KFU A;  4TSS A;  2EY6 A;  2JSO A;  4K5W A;  1K3B C;  4RG1 A;  1IBL Q;  4A3F B;  2TMP A;  3GTL B;  4JI5 L;  2AMC B;  3MEF A;  1P8L A;  1PFN A;  4WJ4 A;  4XXE A;  1GVP A;  2HDL A;  1ICF B;  1XJV A;  1Q12 A;  4XYQ A;  2RBM A;  2IX3 A;  3SK8 A;  1Y1W H;  4XQN A;  1KRS A;  4JI6 Q;  2QCP X;  2F1M A;  3J81 j;  2NYZ D;  2JA8 H;  4HJ9 A;  1KDB A;  2MO0 A;  4V0B A;  1PVO A;  1CKN A;  2EDG A;  3T51 B;  3H3V I;  1LTS D;  5C44 B;  4JPB W;  5BN3 A;  3LWE A;  4YIJ A;  5GAD C;  1DM0 B;  5I2Y A;  1XTC D;  4B3M Q;  2J0T D;  1ROD A;  1L0X B;  3I4L A;  3FEW X;  4DK0 A;  1C8C A;  3S9W A;  3SDZ A;  4WOR A;  2JJQ A;  5IWA Q;  3GTG B;  1NTG A;  2O2L D;  5CMD A;  3CCU A;  1A6X A;  5CV5 A;  1CK1 A;  1CI3 M;  1CT1 D;  4DR7 L;  2H5X A;  3DWA A;  2JYO A;  3NPP A;  5ELD A;  1KD1 C;  2QKI C;  3PO2 H;  3J81 i;  1KAW A;  5EAY A;  4X6A H;  1T5E A;  3HKS A;  2MP1 A;  1FVI A;  2O5J C;  1WTO A;  3UI2 A;  2EQS A;  3CRK C;  1JT8 A;  2VW9 A;  2NZ1 D;  1YHQ A;  3ND9 A;  3HOZ H;  1YNX A;  1RDP D;  2KCT A;  3MC0 B;  2BDN A;  5C3E B;  1I3Q B;  1WTP A;  2VQF Q;  2K05 A;  1ENF A;  2DY7 A;  2Q2H A;  4DPG A;  4DUY Q;  4LF4 Q;  4YWL A;  2YU9 H;  3A5U A;  1KC8 C;  1NNX A;  1TWH B;  5FLX E;  2ZXR A;  1MJC A;  2R7Z G;  4A3E G;  1TT2 A;  3DM3 A;  4EGV A;  1I4Q A;  1XYI A;  1DXM A;  1V43 A;  2B2V A;  2DJF C;  2OQK A;  4DR2 Q;  3MFY A;  1SNQ A;  5IT9 c;  1PH6 A;  3CCQ A;  2Q8T A;  1ASY A;  1HHV A;  4QMG A;  3S1R B;  5M5W B;  3ERO A;  4A75 A;  3SR1 A;  1BVS A;  1V9P A;  3JC6 6;  1I4X A;  1X65 A;  5IYD G;  2JEA I;  4A3G G;  1HQM C;  5ELC A;  5EBD A;  4FF3 A;  1VQE A;  3RD4 A;  1IL2 A;  1YNN D;  3A56 A;  2MQH A;  3J7A F;  4O0A A;  4AYB E;  2PYK A;  1O7Y A;  1Q1E A;  4K8I A;  2OXP A;  1SYD A;  2RSN A;  4MTK A;  1NUC A;  4FXD A;  3S1Q B;  4X3S A;  4JI7 L;  1D8L A;  1R4Q B;  1C4Q A;  4K0K L;  2KHI A;  4DR5 L;  4C2M H;  3MA2 B;  5IYB H;  1G8Z D;  3HEJ A;  3TBI B;  1S5B D;  4DR7 Q;  3QO2 A;  1JB7 A;  4DV0 Q;  4OX9 Q;  1STN A;  5J22 A;  1XMO L;  4ZAI A;  1HNZ L;  1A3U A;  1PYS B;  4LF7 L;  4OGQ C;  3PO2 G;  4KI0 A;  3AFQ A;  4DV6 Q;  4HMI A;  1SAP A;  4G4K A;  2QGQ A;  5FO7 B;  2EYO A;  1AE2 A;  4KKS A;  1NBW A;  3HGB A;  5C3X A;  1A0I A;  1J8I A;  3PUW A;  2E2J H;  1VQ9 A;  3KBG A;  5NUC A;  1IHZ A;  2MO1 A;  1UE1 A;  1EWI A;  1Q3L A;  1LTB D;  2PNR C;  4P75 A;  2C9O A;  2WAC A;  3RZO B;  1C48 A;  3D3R A;  1TWG H;  3RN5 A;  2F4I A;  4ZQ3 A;  3FRP B;  4DV0 L;  1HCZ A;  3HS0 C;  1FNU A;  4KHP Q;  2K4K A;  1XWE A;  2R92 B;  2Z6B A;  5EPJ A;  5IE8 A;  1P16 A;  3GTQ B;  4K0K Q;  5KND A;  3NP8 A;  3KUP A;  2OCE A;  1LTL A;  1O7L A;  2B29 A;  2WAQ G;  3E5S A;  4R1J A;  4FXG C;  1GO3 E;  2D0O A;  3T4A C;  2Z0S A;  1HZA A;  4LAA A;  3CCL A;  1PH7 A;  2MJ8 A;  1TWC B;  1X3F A;  2D9U A;  1K8G A;  3DWQ A;  1JB3 A;  3WWV A;  2ZJQ A;  2KHJ A;  1PZJ D;  4I7Z C;  5KNC A;  1IBK L;  1EY0 A;  1I94 L;  4H13 C;  1L1O B;  1QE6 A;  1HRJ A;  3A0J A;  4NMZ A;  4IUR A;  3RZO H;  1OXT A;  3U9O A;  4JI5 Q;  1CHQ D;  1FL0 A;  1L1O C;  1O80 A;  4DK3 C;  2NVT H;  2IX1 A;  2FMM A;  4UP8 A;  3HOU H;  1RJT A;  2N55 A;  4DN4 M;  1AFP A;  1JCK B;  1DCZ A;  2WB1 G;  2XGT A;  4MZ9 A;  4KJN A;  4FF4 A;  1JOK A;  1H9M A;  2A5H A;  3L7Z C;  4G7H C;  1V1P A;  3CP0 A;  5EBC A;  5KYL A;  4DUY L;  1AP0 A;  1Y8N B;  1XXG A;  3PGZ A;  3PF4 A;  3K58 A;  4CKB A;  3SEB A;  3KF6 B;  4A3M G;  2UUA Q;  2L9H A;  3V2T A;  1SRU A;  2XTI A;  2DN8 A;  2A6H D;  4C1N K;  4IUQ A;  1WTX A;  3VYT A;  4DV3 L;  2DUD A;  4QB4 A;  5GAH C;  3J80 i;  1BUV T;  1YHB A;  4HJ8 A;  5LMN W;  4A3B B;  1TII D;  2FFK B;  4F88 A;  2NVQ B;  1EIF A;  2NTS A;  4LF4 L;  4C3J B;  2NZO A;  4QY7 A;  5DAU A;  2HIV A;  1ASZ A;  5G3L F;  4X3U A;  3PUV A;  5CR3 A;  2PZT A;  3JAM E;  4DA2 A;  2E76 C;  4JI8 L;  1WCM B;  4EQO A;  1FNW A;  4A3D B;  3H09 A;  2ZXO A;  2UU9 L;  2Z4H A;  1Q7Y C;  5M3F H;  3VR6 A;  3AMU A;  3PO2 B;  1M1K C;  1PH5 A;  1IBM L;  1GUN A;  1W6K A;  5COY A;  3OOC A;  4B9X A;  5DNF A;  1N36 L;  3M4O H;  4ULL A;  4DR4 Q;  1SYE A;  4HR7 B;  3OPO A;  3VR2 A;  3QJY A;  2PW5 A;  4QJF A;  2LSS A;  2HCC A;  4KLK A;  1X55 A;  2F03 A;  2Q2U A;  4EQN A;  4A3J G;  4Y7N B;  1KXL A;  2ENB A;  4WRD A;  1IKM A;  3U50 C;  4CJ0 B;  1JC7 A;  4LJZ C;  2J4X A;  4C3I H;  2FJ2 A;  3CCS A;  1IZ6 A;  3PIP 3;  5D3I B;  3K5O A;  1TWH H;  4A3D H;  3TQY A;  2EIF A;  4OO1 I;  4ZUI A;  4JOI C;  1L1O A;  5DM6 3;  3LGJ A;  3M85 A;  2R93 G;  1KL9 A;  1SE8 A;  2ALY B;  3S1R H;  4BS9 A;  2JA9 A;  1N33 L;  3S2D B;  3A54 A;  4JC0 A;  3D0F A;  2LKV A;  2CQA A;  3UDX A;  1TWA H;  2NN6 H;  1LYL A;  1HZB A;  3J7A V;  1ET9 A;  4ME5 A;  4DR3 L;  1H9S A;  3MVV A;  2L0C A;  4A3J B;  4OIK A;  5FLX L;  4UHV A;  3CCE A;  5JVG 3;  1I4H A;  3KK7 A;  4ID6 A;  1NCV A;  4M1U B;  4HIO A;  1XPO A;  4KN4 C;  5M5Y H;  2BE5 C;  1VF5 C;  4K2K A;  1X3Q A;  3CQZ H;  1N9W A;  2F3W A;  4C3H B;  4IUT A;  2XNA C;  2P5Z X;  3BG3 A;  5HGT A;  1X9N A;  3S1M H;  2K5W A;  3KJO A;  1EQV A;  2Q2I A;  2R6G A;  3S1N B;  1VMC A;  1D6E C;  1F9P A;  1MSH A;  3BDO A;  1PXU A;  4MTN A;  1IKL A;  1BBU A;  1HNX Q;  3H94 A;  4LFA L;  4GKJ Q;  4GKK Q;  2K04 A;  1YNJ D;  1VQH A;  4HAE A;  1QG7 A;  4RGO S;  5M9O A;  1UNS A;  1XMQ Q;  4F7X A;  4YHH L;  2BA0 A;  3PQI A;  3PF5 A;  4NPS A;  2FXQ A;  2RF4 A;  2BCO A;  1CM9 A;  4B3R Q;  4R4T A;  4IPC A;  2B63 B;  4F8M A;  3C46 A;  2WB1 B;  2B39 A;  4R8I A;  2ZM6 L;  3AB9 A;  2IW3 A;  3N6R A;  3I56 A;  1CQV A;  4QIW B;  3VYR A;  1ICW A;  4L5S A;  3S1M B;  1XMO Q;  1OXS C;  3G48 A;  1HR0 L;  2AWO A;  3I72 A;  5JJZ A;  2R93 H;  5L37 A;  5C44 H;  4DR1 L;  4IUN A;  4UY8 C;  4PNY A;  4PZ6 A;  4DR5 Q;  1PH4 A;  4KY7 A;  4R4C A;  1ZYR C;  4HED A;  4Y7N H;  3UDF A;  5IOD A;  1O78 A;  1OXV A;  5EPL A;  2MPM A;  1PTO H;  4P2C B;  1WVL A;  2WB1 E;  4LF5 L;  2NVX B;  3MZ5 A;  1LTR D;  3M4Q A;  3MEH A;  1QUQ B;  2F0I A;  3PUY A;  4OON A;  4RHR A;  3GTJ B;  1SNM A;  3K5L A;  1EY4 A;  4ALP A;  4BY7 B;  4X66 Q;  2A6E D;  4JI0 L;  4HMJ A;  1EIG A;  4DKA C;  1I5F A;  3D6W A;  1FR3 A;  2N8N A;  3PIP A;  5C4X H;  4A3G H;  4DXG A;  5LL6 S;  1W2B A;  4DV3 Q;  4JI3 L;  4N9P A;  1SFO B;  2RHQ B;  2JA8 G;  1B53 A;  4L63 B;  2H4O A;  4ZRZ A;  3H3V C;  3ERQ A;  3MXN A;  4U68 A;  1HNX L;  5CV9 A;  3HOY B;  1WOC A;  1F2Y A;  4Z9C B;  4JI4 Q;  1PHJ A;  5ISR A;  4DV1 Q;  1VMP A;  4R4O A;  2JN4 A;  1BR9 A;  1J6Q A;  4IPG A;  2Z8L A;  1HFN A;  3DEP A;  4A93 H;  3S17 B;  2X69 A;  1SMY C;  2VY3 A;  4KHV A;  2EYM A;  2F0K A;  4C3H H;  2ZTE A;  3CPF A;  2IL8 A;  3FMC A;  1E3P A;  4DAV A;  4JBM A;  2IHF A;  2PI2 E;  4YY3 L;  2JA6 B;  2IWH A;  4OWT B;  3H91 A;  3R93 A;  4OEL B;  2OTJ A;  1QWY A;  1HPC A;  4UDU C;  4IPD A;  5CBA E;  3AEV A;  3LNN A;  2A6H C;  1EFI D;  1IBK Q;  4A3K B;  1VQM A;  1A2T A;  2PPB C;  4JG2 A;  2A69 C;  4K6L A;  4A3L G;  2IY5 B;  1BCP C;  2F0O A;  4X62 L;  2E2I B;  4DV7 Q;  2K32 A;  2XWJ B;  3TP8 A;  1NMF A;  4XQQ A;  2PI2 A;  1G6P A;  3CCR A;  1PH9 A;  3CPW A;  3D4W A;  2YTV A;  4KHZ A;  3JAM L;  2ES2 A;  3HKZ B;  4B3T L;  4DFA A;  3HOW G;  4JCV E;  2KQ3 A;  4IUP A;  5M3M G;  2XVS A;  5D14 A;  2VL6 A;  1TWF B;  4JI6 L;  4U67 3;  4DV6 L;  3CD6 A;  3BJU A;  3I4M G;  3I4N H;  3VDY A;  5C4X G;  3AQQ A;  4HSP A;  4K6D A;  2SDF A;  1CZW A;  1QUQ A;  1VQI A;  3OIP A;  1LAC A;  1CZG A;  2JQO A;  1JE4 A;  3MHB A;  1EYG A;  5FLX c;  4PZ8 A;  2FMC A;  4R8N A;  1Q86 C;  1OO9 B;  4HJ7 A;  2I07 B;  5C0X I;  1TWG B;  2K28 A;  1AZP A;  1EQR A;  4DV7 L;  2UXC Q;  2JA7 G;  1IBM Q;  2UUB Q;  2QA4 A;  3DMU A;  4DV4 L;  4OL7 A;  4H44 C;  2A74 C;  4DV1 L;  5IYB G;  1EU4 A;  3PSI A;  1VQA A;  5I6W A;  4JI4 L;  5C4X B;  2F3I A;  4KV6 A;  3STB D;  1XNR L;  1IXR A;  2HQL A;  4C3H G;  2LFN A;  1RTN A;  4LUZ A;  2PQA B;  1STY A;  3G4S A;  5IY0 A;  1QCB D;  1G51 A;  5JPM C;  4JBW A;  5M5Y B;  3Q0A A;  2E5L Q;  1SNO A;  4JI7 Q;  2E5L L;  4OWW B;  3TDQ A;  2X6G A;  2HHH L;  4N8F A;  1CQF A;  4JVZ A;  2WP8 J;  4HCE A;  3X3M A;  1PDQ A;  2GVA A;  4QGU A;  2K50 A;  4I7A A;  1KRT A;  1K83 B;  3H3V H;  1STH A;  3KDF B;  2DY8 A;  1VF7 A;  3KLS A;  3MFG A;  3QG1 A;  4LUO A;  1QB5 D;  4ZCK A;  3HOX G;  2ZJR A;  2KA7 A;  4PG3 A;  1YJW A;  2LXK A;  1S5D D;  1YBY A;  2UUB L;  4RKB A;  5GQO A;  3RZD H;  3G6J B;  5EPK A;  1II3 A;  2J7Z A;  3DHQ A;  4GNX C;  1UE6 A;  2EXD A;  3IAY A;  4LNQ A;  4OIJ A;  5M3M H;  4IAL A;  1Y1V G;  3ND8 A;  5ELO A;  5IP9 G;  3FHW A;  4J15 A;  1I4P A;  1K3R A;  1WFQ A;  3I4M H;  2NVY H;  1NAP A;  4KD4 A;  2NWG A;  3IKJ A;  5IYC G;  1SEB D;  1NJI C;  3S2H H;  3RMH A;  2QF7 A;  4M8A A;  2G9H D;  3EQL C;  1CUK A;  1F9Q A;  4AIM A;  3P7J A;  3S16 H;  5FLM H;  3E3X A;  3D31 A;  4NB3 A;  5DEH A;  5ELF A;  2KOL A;  4C3I G;  1SBB B;  3I8Z A;  2KCC A;  2X6L A;  4YHH Q;  4LFC L;  1DOL A;  1XMQ L;  1WCM H;  2HD3 A;  2A19 A;  2EZV A;  5CGK A;  5HY6 A;  3GTJ H;  1ONL A;  3NQT A;  2VUM H;  5IGD A;  2CFM A;  1VS0 A;  3GTO H;  5ELB A;  2NVY B;  1PZK D;  3GP7 A;  4Q0F A;  1WTQ A;  1HUM A;  5IGB A;  4LF6 Q;  1WYD A;  1EEI D;  3E9I A;  2A1A A;  1GUG A;  1MI2 A;  2VB2 X;  4KTA A;  2EJM A;  1AN8 A;  1GKH A;  1IW7 D;  4PMB A;  3K81 C;  2XRS D;  1K8M A;  1LT3 D;  2EYP A;  3EBE A;  5CV7 A;  4N9T A;  3A7A B;  3WOE A;  3CXC A;  1EIY B;  4LWC A;  2RCF A;  1HZ9 A;  3MWY W;  1XNQ Q;  1Q82 C;  2B2W C;  1Q90 A;  1EYC A;  2WKD A;  4A76 A;  3K7A B;  3PIO A;  4AH6 A;  1Y1W B;  3TP7 A;  4DR3 Q;  1I6H B;  3GTM B;  1X3E A;  1RF2 D;  3I2Z A;  3A8K E;  2K1B A;  1U5K A;  5CC4 A;  4KJO A;  1U0L A;  1HH2 P;  4EQP A;  5CBE E;  2D0P A;  2D62 A;  1W3S A;  1HTP A;  2K5D A;  4LF8 L;  3PIO 3;  3E9H A;  3VR3 A;  1HQR D;  1WJJ A;  1K83 H;  3RLN A;  4ME3 A;  1TWA B;  5TSS A;  2JEB I;  4E6I A;  3HOX B;  1E0B A;  1BO0 A;  2IHE A;  2QDL A;  1H9R A;  1SND A;  1Z6H A;  3TN2 A;  3I7F A;  1ET6 A;  1QNK A;  3W5O A;  1CSP A;  5EKI A;  4IFD I;  1JJG A;  1OXX K;  2JA5 H;  5LMN Q;  2PMZ E;  4UAI A;  1B9N A;  1DOM A;  4IOA A;  1I6H H;  4MN3 A;  3OMC A;  4DR2 L;  5LMU Q;  1PH3 A;  1LM0 A;  3I4M B;  2BH8 A;  3I91 A;  2K6A A;  3F8T A;  2OWO A;  1E2Z A;  5M5X H;  2PQE A;  3X3N A;  3VR4 A;  1PTO C;  3M4P A;  4X66 L;  5CYU A;  4ODG A;  4UPA A;  1S40 A;  4V19 0;  1RKN A;  4G57 A;  2VS1 A;  2OEO A;  2CHB D;  5FJ8 G;  2E2J B;  3VR5 A;  1CA6 A;  2EYJ A;  3PO3 H;  3AYH B;  3L2P A;  2JA5 B;  3PV0 A;  3K8A A;  3ZJY C;  1RIP A;  3G6E A;  4BY1 H;  2KEC A;  1LT5 D;  3BYT B;  3LWU A;  3S15 B;  2VUM B;  1YZ6 A;  3QOJ A;  1PH8 A;  3CCJ A;  1HA5 A;  1LT4 D;  1B44 D;  1KLG D;  2E8G A;  2NN6 I;  3RLF A;  4H7B A;  2AUJ D;  3QB3 A;  4JBK A;  1SXT A;  5JEA G;  2A69 D;  5I9O A;  1FD7 D;  3QIA A;  2RDH A;  3FP9 A;  4FF1 A;  3TEH B;  1QZG A;  2UU9 Q;  4R4I A;  1EOV A;  2LXJ A;  3GDE A;  1DYQ A;  2PZW A;  3CHB D;  4FO2 A;  2A8V A;  4K2L A;  1EY5 A;  4IUU A;  4KN7 C;  4A3C H;  1GXD C;  4DV2 Q;  5EKL A;  4NP5 A;  1EY6 A;  1HA6 A;  5F2D A;  5GRO A;  1DON A;  1B70 B;  5C0X G;  3HOV H;  1EY7 A;  2L5T A;  3BDC A;  4H02 A;  3ULL A;  4L6T B;  3NEM A;  4IPH A;  1TU2 B;  1N32 L;  5A35 A;  4BY7 H;  2EE1 A;  3ULJ A;  2AUK A;  1S5C D;  1H9J A;  2VQE Q;  2JE6 I;  5T1I A;  1YNN C;  1ILP A;  2LMC B;  1UWV A;  1E1T A;  4FDB A;  1KAB A;  1ENC A;  3MXP A;  5C3E G;  1ZEQ X;  3PMF A;  2F3V A;  4POG A;  1A62 A;  3M9B A;  3IL8 A;  2JXM B;  2F0H A;  5JEA J;  3K6O A;  1HJP A;  1D5M C;  3D4D A;  2QEX A;  4ZUJ A;  1Z7T A;  4IN3 A;  1Q46 A;  3K80 C;  3NK9 A;  1W6J A;  2OT2 A;  2F0J A;  1PRT B;  3T16 A;  2Z9H A;  1FJG L;  3D6C A;  2QW7 A;  3M3Y B;  4IZ8 A;  1EQQ A;  5DM7 3;  1JOQ A;  4KHP L;  4R9W A;  1MD2 D;  5GAG C;  1EZ6 A;  1SYC A;  3R3O A;  1K0R A;  3I3C A;  2H1E A;  3FPP A;  2KED A;  1JMC A;  2ASB A;  2B2T A;  1G6Z A;  4OWX B;  4L8J A;  1F2Z A;  1B1Z A;  4B3T Q;  3BS1 A;  1D1K A;  1ML0 D;  1JWM D;  4JI1 Q;  1MHW C;  1Y8P B;  2F52 A;  1G2S A;  1NE3 A;  1PZI D;  2CH4 A;  3DM1 A;  2R7F A;  2F0N A;  4X62 Q;  2ICE C;  1MJE A;  1UEB A;  4EQ5 A;  1VDZ A;  1U4P A;  1LO5 D;  1C7Y A;  2I46 A;  1EU3 A;  4DK6 C;  3M3Y H;  1HNZ Q;  4BY1 B;  5I6Y A;  1SN8 A;  1E2V A;  2L4N A;  1BCP F;  3T13 A;  4RAU C;  5FK9 C;  1GD7 A;  3TRE A;  4OX9 L;  3HOU B;  4N8X 1;  3HOV G;  4NDX A;  1J5E Q;  1DGS A;  1QVC A;  3TSS A;  2IJ0 A;  5KEE A;  3C2P A;  4CKE A;  2V4D A;  2YYZ A;  4DNI A;  1LTT D;  1EL0 A;  1E2W A;  4DR4 L;  2YTX A;  2Z6K A;  3P20 A;  1TXY A;  5J3B A;  2HDM A;  5C5L A;  5KRU A;  4JV5 Q;  2VZA A;  4UP7 A;  2QEJ C;  3FVQ A;  4R4Q A;  3BU2 A;  5C3E H;  4O42 A;  2ZT9 C;  3RNU A;  1STG A;  3S14 B;  4FYD A;  2B2V C;  4B3S Q;  4MHE A;  1B7Y B;  2TSS A;  3GD7 A;  1T9H A;  4DR6 Q;  2L12 A;  4RH6 A;  4WJ3 M;  2CW0 D;  4A3F G;  2R7Z H;  3CCV A;  2CW0 C;  2E2D C;  1BBX C;  3ONA B;  4RGN A;  4P74 A;  4HTH A;  3HOX H;  3K5M A;  2Z4I A;  4A3L H;  1U4M A;  1IL8 A;  2K5V A;  5ELN A;  4DV5 Q;  3FKI H;  2R92 G;  1N34 L;  2PQA A;  1TS4 A;  1K0S A;  2VQF L;  5EKK A;  3UE1 A;  2UUA L;  3SK4 A;  1MKH A;  4DR6 L;  5C5M A;  3A8J E;  1UAP A;  3HOW H;  1H9K A;  4MIU A;  3CAM A;  1EQT A;  2E74 C;  3E0J A;  3E0E A;  2UXD L;  2E2H B;  2F4V Q;  2E75 C;  3I4N G;  1M8A A;  3T1Y L;  4IO9 A;  3RUZ A;  5IYD H;  4DV5 L;  2XIW A;  3KDF A;  2FIN B;  5FLM G;  1BQQ T;  4XQJ A;  5H1S E;  2RCN A;  2Y0S B;  1B4O A;  2RA4 A;  1JQY D;  1D5Z C;  1KDA A;  3NBI A;  2AQ1 B;  1VQD A;  1PRT D;  1MSG A;  3NTK A;  4K5X A;  4RKL A;  4DK1 A;  3BZC A;  5I9P A;  4GNX A;  2VB3 X;  4GLV B;  4GOP A;  3OHX C;  3PO3 B;  3WDN A;  1TY0 A;  3OWE B;  5IP7 G;  2EXZ A;  2EY1 A;  3J80 L;  1XPU A;  4DV4 Q;  2F0U A;  2ZM6 Q;  3H0G G;  3EJI A;  4ZKB B;  3S15 H;  4LUV A;  1SMY D;  2MGS A;  2IX0 A;  1CSQ A;  3S2H B;  3S2D H;  1SDF A;  1G2T A;  1A8V A;  4TRD A;  1PTO F;  1KTK A;  1UUP A;  4RCN A;  5BN5 A;  1NR2 A;  2WAQ E;  3ER0 A;  1E24 A;  5E4X A;  4ZK9 B;  4PQX A;  1V1Q A;  5E1F A;  5IGF A;  4CHT B;  5C4J B;  2UUC Q;  4A3F H;  4ZKC B;  4HSV A;  1I3Q H;  3AFP A;  2O5I C;  2I5M X;  1JJC B;  3NEL A;  3J7A 5;  1YIT A;  2YU9 B;  3Q6S A;  1EWH A;  3T53 B;  4BA1 I;  5HUR A;  4L5R C;  1TVX A;  1WTH A;  2JA7 B;  5M3F B;  4C3J G;  1A3T A;  1AEX A;  1FJG Q;  1WD1 A;  1FNV A;  5A2Q L;  4JI1 L;  4YCW A;  2WAQ B;  1TS3 A;  3OW7 A;  3A8I E;  2K14 A;  1E22 A;  2AHO B;  4HCS A;  1VQ6 A;  4K5V A;  2A73 B;  3B6Y A;  3GTP B;  2UXD Q;  5C6A A;  2F0S A;  3K0X A;  4PV1 C;  2EJG C;  3R8B A;  1QOH A;  4YWK A;  1S5F D;  5J39 A;  2CH4 W;  1QZH A;  3HOU G;  1VQG A;  4X64 Q;  3U9S A;  2XN9 C;  3W3A A;  3GTG H;  1X3P A;  1I6V C;  1PH2 A;  2F0Q A;  3KLS X;  1FGB D;  1GOZ A;  5JOB A;  3ICE A;  4WFN 3;  2KUM A;  2BA1 A;  1PLF A;  2VXW A;  3HZX A;  4CDD C;  1FYC A;  4HJA A;  1LAB A;  5KIX A;  3DWP A;  1WD0 A;  3QR8 A;  5I4D A;  1WTR A;  3F2U A;  2B63 H;  5HGQ A;  3T56 B;  4QUC A;  3T1Y Q;  5AJ3 Q;  1EYA A;  1VQL A;  3TRZ A;  1PYW D;  1SR3 A;  1X32 A;  4NXN Q;  1HUN A;  2D2C C;  3OSO A;  4I65 A;  1PFM A;  4XTC S;  4X3T A;  4ZLT F;  4X65 L;  1B3A A;  3BVZ A;  2VQE L;  1SE4 A;  2EY2 A;  2L11 A;  3DLL A;  2IPK D;  5E3F A;  5J1Z A;  3K59 A;  2EOT A;  3KYH C;  1GUT A;  4JI3 Q;  2A6E C;  4XT1 B;  2I5H A;  4RWS C;  2M2L A;  1IYJ B;  3IFD A;  4OEM B;  2FHT A;  1N36 Q;  4IQZ A;  1X54 A;  3G71 A;  4JBJ A;  1VQF A;  4A3B H;  2D5D A;  3CQZ B;  1C0A A;  4XDX A;  2NB0 A;  3I73 A;  4C3J H;  5IWA L;  3M4O B;  2K03 A;  2K01 A;  4JYA Q;  1QVF A;  5KYI A;  4AYB B;  3E6Z X;  4RFB A;  1YJN A;  4LF5 Q;  1B9M A;  2K5Q A;  2Q8I B;  2L15 A;  1PH1 A;  4LF9 Q;  3CRL C;  3D4R A;  3O13 A;  3TZD A;  5M3F G;  4RCO A;  1I4G A;  3PCO B;  2K5H A;  4GN4 B;  2HQE A;  3BDL A;  1VQP A;  5C4J H;  2EYH A;  3S1Q H;  2AQ2 B;  1KDC A;  1GUO A;  1SE3 A;  3S24 A;  2RDF A;  3NTI A;  4LFA Q;  2EPB A;  4G7Z C;  4C2M B;  5C4H A;  1SNP A;  2K7V A;  4AQY L;  1PV4 A;  2CCZ A;  4BY7 G;  4RGT A;  4Q5V A;  1SMX A;  1F9S A;  2L55 A;  4B3M L;  3UDG A;  1K8A C;  1JJ2 A;  1IBL L;  1XTD A;  5AJ3 L;  4C3I B;  1F77 A;  2LY7 A;  3EN2 A;  1VQJ A;  2M00 A;  1KNA A;  1ZKO A;  3I70 A;  1UE5 A;  1JR0 D;  3M7N A;  4BXX H;  3HOZ B;  3NEN A;  1HXY D;  1NY4 A;  2PW7 A;  4KY5 A;  2BDO A;  5C0X J;  2I0Q A;  1FGU A;  2OTL A;  2KHS A;  3MAQ A;  2DNE A;  1B8A A;  3GV3 A;  3NBH B;  4K8J A;  5IGG A;  2Z1C A;  2Y0S G;  3MXU A;  1ESF A;  3CW2 C;  1XNQ L;  5LL6 X;  2Q8R E;  2L1B A;  2ZTD A;  3L9A X;  2QIL A;  4XT3 B;  1SLJ A;  3NXW A;  4FF2 A;  3GTQ H;  1EEF D;  1L2F A;  4A3G B;  4LF8 Q;  2KVM A;  4KY6 A;  4DUZ L;  1TWF H;  1YHA A;  4DV2 L;  4PMC A;  5K36 G;  1HR0 W;  2N49 A;  3VYU A;  3OMG A;  2B2Y C;  1KNE A;  2VNU D;  1LT6 D;  4DXF A;  2N88 A;  4A3M B;  3A74 A;  1HZC A;  1PA6 A;  1L0Y B;  1V8Q A;  1ESR A;  4K14 A;  4PMW A;  4DAY A;  1EY8 A;  4A3I G;  2G5D A;  1GHJ A;  1N32 Q;  5FKA C;  3M4Y A;  2WII B;  2NVT B;  1Y1V B;  2G9D A;  3T1H L;  2XRQ D;  1T5X D;  5FO9 B;  3BVM A;  3F2D A;  4JI0 Q;  1RL2 A;  3QWN A;  1VQB A;  1U4R A;  2JA6 H;  1BNZ A;  5KGU A;  3K5N A;  1CFM A;  1VQ5 A;  3NUC A;  2I5L X;  3F2C A;  3C1E A;  2F0W A;  4NW2 A;  5CV4 A;  2C5C A;  2BE5 D;  4LF6 L;  3W1B A;  5BR8 L;  4TVA B;  1SJE D;  3SXH A;  4ILW A;  5E4W C;  2DJG C;  1GJX A;  2EVB A;  3RLO A;  4CDF C;  3NSW A;  5IGE A;  3CMA A;  2UXB Q;  4HN7 A;  2NBF A;  1PMR A;  1TY2 A;  3VYS A;  5C44 G;  1YI2 A;  2R93 B;  1TS5 A;  3GO5 A;  1PRT C;  4GN3 B;  3U4Z A;  4YWM A;  3GTP H;  2UXB L;  3MXG A;  2V1C C;  4DR1 Q;  3JAM c;  2R7D A;  5DLQ E;  1QNU A;  4RHS A;  2N3S A;  3QOL A;  5EJW A;  4KD3 A;  1S3O A;  4A3I B;  4A4I A;  1Y1W G;  4GN5 A;  4FXK C;  5BR8 Q;  3FKI G;  2R92 H;  1CKN B;  3NE5 B;  2R3Z A;  1EOT A;  1X3G A;  5G3L D;  3SGI A;  2LS0 1;  3RZD B;  2EYF A;  1F9R A;  3NQI A;  1KQS A;  1WTV A;  4JI2 Q;  1ILQ A;  4Y52 H;  3MXN B;  3TZU A;  1IYV A;  1KIX A;  2C35 B;  4DF7 A;  1A2U A;  1R9T B;  2F0V A;  3L3O C;  3CC4 A;  3NBH A;  1I4R A;  2EY5 A;  1EFW A;  1EYD A;  2KEN A;  2SEB D;  5CV8 A;  3S14 H;  1EZ8 A;  4LMQ D;  4RA8 A;  2WFW A;  1V1O A;  1K28 A;  5JJL A;  3L0O A;  4L5Q A;  1PFS A;  2WKC A;  2ZTC A;  4X65 Q;  4TQU S;  2K75 A;  3S16 B;  3HOY G;  3S17 H;  4A93 B;  4S3S A;  1STB A;  1A3V A;  2F0D A;  4OXP A;  5IGC A;  3BZD B;  3HKZ G;  1EY9 A;  2UXC L;  1HTL D;  4JV5 L;  1M90 C;  3KOJ A;  5CV6 A;  1DOK A;  1G91 A;  1TKW B;  4A93 G;  4AYB G;  4DAY B;  1VQ4 A;  1ENA A;  3NHH A;  4JOI A;  3A5Z B;  4IUV A;  4BBS H;  5IT9 L;  1TS2 A;  4FVM A;  5COR A;  3NTH A;  3M7G A;  5M5X B;  2E2I H;  4P71 A;  1SYB A;  2BOS A;  3SK5 A;  1R4P B;  1YEZ A;  2MNA A;  3UE0 A;  4A3E H;  1TR5 A;  1Q8K A;  3BYY B;  4DU9 A;  1X6O A;  2NVQ H;  4A3K H;  3I4O A;  3HFZ B;  2B2T C;  4LK1 C;  1RCV D;  3CC2 A;  1B50 A;  1KAA A;  1U4L A;  1MGS A;  3PUZ A;  1JWS D;  5EGT A;  1I50 H;  5LHY 1;  1EWC A;  2KEE A;  3I55 A;  1LTI D;  2HT1 A;  3BVG A;  3KLW A;  3FDT A;  2O4X A;  3KF8 B;  1STE A;  1OXU A;  4J8Q A;  2DNC A;  4AQY Q;  3F1Z A;  2UUC L;  2RVL A;  3S1N H;  3ULP A;  2SNS A;  1SRO A;  3HP3 A;  2RKS A;  3DUZ A;  3R2T A;  4GOP C;  2B2U C;  4BBR G;  2B2W A;  2IT1 A;  1KLU D;  2A68 C;  2PNH A;  4L5T A;  4A3E B;  1PRT F;  3CME A;  4LFC Q;  4FNF A;  2AWN A;  4ZYS A;  3FPU B;  1D1I A;  1Q8I A;  3KF6 A;  2R61 A;  2WV6 D;  4LFB Q;  2AQ3 B;  2RSO A;  3HOY H;  3IFT A;  2HIX A;  1K8O A;  4YCV A;  1H95 A;  1LLR D;  2F4V L;  4GS3 A;  4KKU A;  5D3D A;  1MBY A;  1QVG A;  1I50 B;  1U9R A;  2EYL A;  1A15 A;  2B63 G;  5T1G A;  5JVH 3;  2JA7 H;  2F0L A;  4JI8 Q;  2CVR A;  3H15 A;  1Q1B A;  1GM5 A;  4WJW A;  5IP7 H;  3J81 E;  1XPR A;  1N8R C;  5M5W H;  3A55 A;  3VA5 A;  1BCP D;  1TQO A;  2ZXP A;  3KF8 A;  4YY3 Q;  4GNX B;  2HHH Q;  3H0G H;  5JPN C;  4BBS G;  3HRZ C;  4QQB X;  4B9W A;  4QIW E;  3VA7 A;  1GUW A;  2PCF B;  4MNO A;  4POF A;  2HCI A;  1BXT A;  2SNM A;  3DEO A;  4DNT B;  3GTK H;  3HOZ G;  4OO1 G;  3SVM A;  3KJP A;  3EIV A;  1VQC A;  3GV6 A;  1SE2 A;  1IYU A;  1RD9 D;  1PTO B;  2PMZ B;  4JI2 L;  4GZY C;  3STB C;  3D8G A;  1XNR Q;  3HG9 A;  1S4Z A;  1AW7 A;  4TKO B;  4H0L C;  5C3W A;  1KHI A;  4NXN L;  4A3K G;  4RMF A;  4HIK A;  1Y1V H;  3GTM H;  5AFW A;  3CF5 A;  2B8G A;  4NXM Q;  2AKW B;  2ICI A;  2NTT A;  1EUJ A;  2XWB B;  5IYC H;  1D5X C;  1J9O A;  4UP9 A;  4JK1 C;  3U58 A;  1HNW Q;  2B8F A;  3NWT A;  2Q2T A;  1JOO A;  3H0G B;  2ZJP A;  3W1G A;  4J1M A;  1BOS A;  2JP1 A;  1J5E L;  5IP9 H;  2CKZ B;  1IW7 C;  1SJH D;  3I4N B;  1UE7 A;  2N78 A;  4CGY B;  3RR5 A;  1HR0 Q;  3U4V A;  4X64 L;  1JE5 A;  2B2U A;  3V05 A;  2KCM A;  3GTL H;  1BF4 A;  4B3S L;  4GLX A;  4BBR H;  2WIN B;  5E7N A;  3AU7 A;  5I2X A;  1AE3 A;  1NMG A;  1LTG D;  1G29 1;  2EJF C;  3ITP A;  4DAM A;  4BWG B;  4LFB L;  1WCM G;  2VUM G;  5K5P A;  4KK7 A;  2JA8 B;  3GQB A;  2KJX A;  1RHP A;  1BKB A;  1H9S B;  1ZYR D;  5ELE A;  4X3K A;  2B2Y A;  4APV A;  3J80 E;  2CWA A;  4C1N I;  5LMU L;  1Q81 C;  4YCU A;  3J7Y W;  2GA4 B;  1ZXT A;  2RQX A;  3SK6 A;  4HIM A;  3TP6 A;  4IFD G;  5LMN L;  3TME A;  4IJL A;  2YTY A;  4LW1 A;  3CU7 A;  2A68 D;  1CTM A;  2YV5 A;  4C56 C;  1XX8 A;  4O2D A;  1PFB A;  2KBN A;  1D7Q A;  4OO1 H;  3C3L A;  1VQK A;  4RGM A;  1RTO A;  5JJI A;  4DUZ Q;  2NVX H;  4PZ7 A;  4O1N A;  1S5E D;  1SSO A;  1VQ8 A;  1F2M A;  4DGZ A;  3KBX A;  3LX0 A;  4HJ5 A;  3HKZ E;  1O7I A;  4IJH A;  4CJ2 C;  1JWU D;  4GKK L;  1LV9 A;  1LUZ A;  3ZYY X;  1Z47 A;  1HFG A;  2OF1 A;  2MFI A;  4LF7 Q;  3FKI B;  5KNB A;  2HUG A;  2CQO A;  1CKO A;  5K36 H;  1AH9 A;  1Y69 U;  4NKL A;  4KMU C;  1SNC A;  4A3B G;  4HID A;  4BA2 I;  1V1P B;  1GHK A;  1SFO H;  2XSC A;  5M3M B;  5A2Q E;  1X56 A;  1DZ1 A;  2CWP A;  2F0M A;  3HOW B;  1O7Z A;  3GTK B;  2F0T A;  1QIL A;  1VQ7 A;  3V96 A;  5D65 A;  3I90 A;  3P75 A;  4DAP A;  1F2L A;  2NZH A;  1GUS A;  2E2H H;  2GN5 A;  3K0Y A;  1DJR D;  3EFX D;  4BBS B;  2RDG A;  4IFD J;  2K52 A;  4IOC A;  3Q8D A;  1CA5 A;  3HOV B;  4CDE C;  3BZK A;  2JA5 G;  3CCM A;  3TS2 A;  4P73 A;  3JAM i;  4QUF A;  4EVO A;  3OTO L;  1E7Z A;  1MIU A;  1NSN S;  3N52 A;  3MTS A;  4A3D G;  2KCN A;  3TP5 A;  1VCI A;  1S72 A;  3J7Z C;  3TS0 A;  1CHP D;  1A63 A;  2F0P A;  1VQN A;  5JJK A;  2MHV A;  1N34 Q;  1BBW A;  2F0G A;  1VQO A;  1N33 Q;  1QJO A;  1CKM A;  5EQ0 A;  3SHL A;  4GLA C;  3URY A;  3F2B A;  3EA6 A;  3UDI A;  3DXJ C;  4QL5 A;  5IT9 E;  3GTO B;  1WTW A;  3IRB A;  4IFD H;  1YIJ A;  3Q22 A;  3CC7 A;  4BBR B;  4LF9 L;  4A3M H;  3P1H A;  1E1O A;  4BXX G;  4JYA L;  2QDB A;  1BCP B;  4BY1 G;  1Y8O B;  5GAE C;  5FOB B;  5C4Z A;  1WI5 A;  5FJ8 H;  4CBV A;  4P72 A;  4QF4 A;  4B3R L;  2K33 A;  3OWF A;  4DNR B;  3PO3 G;  1K9M C;  1HNW L;  1PTO D;  3T1H Q;  1D2B A;  1B3Q A;  1DD2 A;  1UEA B;  4G7O C;  4NXM L;  3K7A H;  1PYB A;  2OQ0 A;  5FO8 B;  4ABN A;  2ID0 A;  3OIQ A;  2BH2 A;  1SYG A;  2NUC A;  2RHS B;  4XIG S;  2ATW A;  1JOR A;  2SOB A;  3C1F A;  3K57 A;  1C9O A;  2Y0S E;  5JEA H;  5IOC A;  2GVB A;  3EVQ A;  3W2D A;  5JAV A;  4A3C G;  3J81 c;  4XYO A;  1JIC A;  1YVC A;  4FP5 D;  3OTO Q;  3OW2 A;  3RN2 A;  1YJ9 A;  2PO4 A;  4CDC C;  1K73 C;  1EIH A;  1OTC A;  1STA A;  3K7U C;  3PUX A;  4QCL A;  2DGY A;  4GOP B;  1BDO A;  4B08 A;  1AZQ A;  1Z9F A;  3A7L A;  4A3I H;  4A3J H;  4F87 A;  2K5N A;  4OHJ A;  4GKJ L;  1B2T A;  3ERS X;  5C0X H;  5IIF A;  3Q24 A;  2F0E A;  3R2I A;  1TWC H;  2B3G A;  2M9V A;  4JW0 A;  4CJ1 B;  2F0F A;  2PZU A;  4KKT A;  3H6M A;  3KLR A;  3Q23 A;  4J6H A;  4CKC A;  3J81 L;  2Z6K C;  1I94 Q;  2JA6 G;  1R9T H;  1NR4 A;  3J80 c;  3OYY A;  3G7L A;  1M4V A;  4EX5 A;  1L0W A;  1YNJ C;  3SE0 A;  5BN4 A;  3NWS A;  1LTA D;  2JK8 A;  3WOF A; 
#chains in the Genus database with same CATH homology
 4R4C A;  5C44 G;  1YI2 A;  1Q46 A;  4Y7N H;  3GO5 A;  1Y14 B;  4GN3 B;  3U4Z A;  3UDF A;  3K80 C;  4YWM A;  2NN6 G;  3GTP H;  2UXB L;  1OXV A;  3KFU A;  1FJG L;  2V1C C;  4DR1 Q;  2WB1 E;  4RG1 A;  3JAM c;  1IBL Q;  4LF5 L;  2R7D A;  5DLQ E;  3M4Q A;  2N3S A;  1QUQ B;  3PUY A;  1EQQ A;  1S3O A;  4JI5 L;  2AMC B;  4OON A;  4A4I A;  1Y1W G;  4KHP L;  4GN5 A;  3MEF A;  5BR8 Q;  3FKI G;  5GAG C;  2R92 H;  1CKN B;  1P8L A;  4WJ4 A;  1K0R A;  1GVP A;  1X3G A;  3SGI A;  4ALP A;  1XJV A;  1Q12 A;  1JMC A;  1Y1W H;  2ASB A;  1KQS A;  4OWX B;  1KRS A;  4JI2 Q;  4Y52 H;  3MXN B;  4JI6 Q;  4X66 Q;  4JI0 L;  1KIX A;  2C35 B;  4B3T Q;  4DKA C;  1I5F A;  3J81 j;  2N8N A;  2JA8 H;  3PIP A;  5C4X H;  4HJ9 A;  4A3G H;  2MO0 A;  3CC4 A;  4JI1 Q;  1EFW A;  1PVO A;  1CKN A;  1W2B A;  4DV3 Q;  2KEN A;  4JI3 L;  3H3V I;  3S14 H;  2F52 A;  2RHQ B;  2JA8 G;  1NE3 A;  2WFW A;  5GAD C;  2R7F A;  4B3M Q;  1HNX L;  4X62 Q;  5JJL A;  3L0O A;  4L5Q A;  1MJE A;  1PFS A;  1UEB A;  4EQ5 A;  2ZTC A;  1C7Y A;  2JJQ A;  1WOC A;  4DK6 C;  4TQU S;  4X65 Q;  3M3Y H;  5IWA Q;  2K75 A;  4JI4 Q;  1PHJ A;  1HNZ Q;  1NTG A;  3HOY G;  1SN8 A;  3CCU A;  4DV1 Q;  3TRE A;  3S17 H;  4OX9 L;  1GD7 A;  4R4O A;  3HOV G;  1J6Q A;  4DR7 L;  4IPG A;  4OXP A;  2H5X A;  3HKZ G;  1DGS A;  1QVC A;  1J5E Q;  2UXC L;  4JV5 L;  1KD1 C;  2YYZ A;  1M90 C;  4DNI A;  3KOJ A;  4A93 H;  3PO2 H;  2VY3 A;  3J81 i;  1KAW A;  4C3H H;  5EAY A;  2ZTE A;  3CPF A;  4X6A H;  4DR4 L;  2YTX A;  2Z6K A;  1TXY A;  3HKS A;  5J3B A;  4A93 G;  1E3P A;  4AYB G;  4DAY B;  1FVI A;  2IHF A;  2PI2 E;  4YY3 L;  1VQ4 A;  4JBM A;  4OWT B;  4JV5 Q;  4JOI A;  2VZA A;  3A5Z B;  2EQS A;  4UP7 A;  4R4Q A;  4BBS H;  3BU2 A;  1JT8 A;  5C3E H;  2OTJ A;  2VW9 A;  1YHQ A;  3RNU A;  4IPD A;  3HOZ H;  2E2I H;  4B3S Q;  1YNX A;  3AEV A;  1B7Y B;  4P71 A;  3GD7 A;  2KCT A;  1IBK Q;  1T9H A;  4DR6 Q;  1VQM A;  4WJ3 M;  4JG2 A;  1YEZ A;  2MNA A;  2VQF Q;  4A3F G;  4A3L G;  2IY5 B;  3UE0 A;  2Q2H A;  4DPG A;  4X62 L;  3CCV A;  4DUY Q;  4YWL A;  4DV7 Q;  4A3E H;  4LF4 Q;  2YU9 H;  3A5U A;  1Q8K A;  1X6O A;  1KC8 C;  2NVQ H;  1NMF A;  4A3K H;  4P74 A;  3HOX H;  2PI2 A;  3I4O A;  4A3L H;  1MJC A;  1G6P A;  3HFZ B;  3CCR A;  1PH9 A;  3CPW A;  2R7Z G;  4A3E G;  2K5V A;  3DM3 A;  5ELN A;  3CC2 A;  4DV5 Q;  3FKI H;  2YTV A;  2R92 G;  4KHZ A;  3PUZ A;  2ES2 A;  2OQK A;  1V43 A;  1PH6 A;  1I50 H;  4DR2 Q;  5IT9 c;  1N34 L;  4JCV E;  4B3T L;  3CCQ A;  2PQA A;  5M3M G;  1ASY A;  3I55 A;  3HOW G;  2VL6 A;  4JI6 L;  2VQF L;  2HT1 A;  3UE1 A;  3KLW A;  2UUA L;  3KF8 B;  4DR5 Q;  1MKH A;  4DV6 L;  3CD6 A;  4A75 A;  4DR6 L;  3BJU A;  3I4M G;  1BVS A;  1OXU A;  3HOW H;  3I4N H;  1V9P A;  3JC6 6;  4AQY Q;  3VDY A;  1X65 A;  3F1Z A;  5IYD G;  2UUC L;  3CAM A;  2JEA I;  3S1N H;  4A3G G;  3ULP A;  5C4X G;  3AQQ A;  1SRO A;  1VQE A;  1IL2 A;  3E0E A;  2UXD L;  1QUQ A;  1VQI A;  2F4V Q;  4GOP C;  2MQH A;  3I4N G;  3T1Y L;  4O0A A;  4AYB E;  4IO9 A;  2JQO A;  5IYD H;  4BBR G;  1EYG A;  1Q1E A;  2IT1 A;  2PNH A;  5FLX c;  4DV5 L;  4L5T A;  3KDF A;  3CME A;  4JI7 L;  4LFC Q;  1D8L A;  5FLM G;  2AWN A;  3PO2 G;  5H1S E;  2RCN A;  4PZ8 A;  1Q86 C;  4HJ7 A;  4K0K L;  5C0X I;  2KHI A;  3KF6 A;  4DR5 L;  4C2M H;  4LFB Q;  1VQD A;  1EQR A;  4DV7 L;  3HOY H;  2HIX A;  2JA7 G;  2UXC Q;  4YCV A;  5IYB H;  3BZC A;  4GNX A;  1IBM Q;  1H95 A;  2UUB Q;  2QA4 A;  2F4V L;  4GLV B;  4DR7 Q;  4GOP A;  4GS3 A;  4DV4 L;  1QVG A;  1JB7 A;  4DV0 Q;  4OX9 Q;  2B63 G;  5IP7 G;  4DV1 L;  1XMO L;  1XPU A;  2JA7 H;  5IYB G;  3PSI A;  1PYS B;  1VQA A;  4JI8 Q;  1HNZ L;  4JI4 L;  4LF7 L;  2F3I A;  4KI0 A;  3AFQ A;  3STB D;  1IXR A;  3H15 A;  2HQL A;  4DV4 Q;  1Q1B A;  4DV6 Q;  1XNR L;  1GM5 A;  2ZM6 Q;  2QGQ A;  3H0G G;  4LUZ A;  2PQA B;  5IP7 H;  1XPR A;  1N8R C;  5M5W H;  3G4S A;  3S15 H;  5IY0 A;  1G51 A;  4LUV A;  4JBW A;  4GNX B;  4YY3 Q;  1AE2 A;  2IX0 A;  2HHH Q;  3H0G H;  4BBS G;  2E5L Q;  1CSQ A;  1NBW A;  4JI7 Q;  2E5L L;  4QQB X;  4OWW B;  4QIW E;  3S2D H;  1A0I A;  1A8V A;  4MNO A;  4POF A;  2HHH L;  3PUW A;  3HOZ G;  4OO1 G;  3GTK H;  3ER0 A;  2WAQ E;  2E2J H;  1E24 A;  3KJP A;  1VQ9 A;  3EIV A;  2WP8 J;  1VQC A;  2MO1 A;  2GVA A;  4QGU A;  1V1Q A;  2K50 A;  1UE1 A;  1KRT A;  1EWI A;  4JI2 L;  3STB C;  3H3V H;  3KDF B;  4P75 A;  4A3F H;  2UUC Q;  1XNR Q;  1I3Q H;  1TWG H;  3AFP A;  4LUO A;  3RN5 A;  2I5M X;  1JJC B;  3NEL A;  1KHI A;  4NXN L;  4A3K G;  3HOX G;  4DV0 L;  3J7A 5;  1YIT A;  4RMF A;  2ZJR A;  4PG3 A;  1YJW A;  2LXK A;  1YBY A;  4KHP Q;  4HIK A;  4BA1 I;  2K4K A;  2UUB L;  4L5R C;  1Y1V H;  5GQO A;  3GTM H;  5IE8 A;  3CF5 A;  3RZD H;  4NXM Q;  2AKW B;  1FJG Q;  4GNX C;  1EUJ A;  1P16 A;  1UE6 A;  2EXD A;  4K0K Q;  4LNQ A;  2OCE A;  2B29 A;  1LTL A;  2WAQ G;  5M3M H;  5IYC H;  4UP9 A;  1Y1V G;  5ELO A;  5IP9 G;  3FHW A;  4JI1 L;  4R1J A;  4YCW A;  4J15 A;  1GO3 E;  3U58 A;  1HNW Q;  2D0O A;  2Q2T A;  2Z0S A;  1K3R A;  1HZA A;  1WFQ A;  2ZJP A;  2NVY H;  3I4M H;  3CCL A;  1PH7 A;  3W1G A;  5IYC G;  2K14 A;  1E22 A;  2AHO B;  1VQ6 A;  1X3F A;  5IP9 H;  2CKZ B;  1J5E L;  3B6Y A;  1NJI C;  1K8G A;  2UXD Q;  3WWV A;  3K0X A;  1UE7 A;  2ZJQ A;  2KHJ A;  2N78 A;  3RR5 A;  1HR0 Q;  3U4V A;  4X64 L;  1JE5 A;  1IBK L;  3S2H H;  2KCM A;  4YWK A;  1I94 L;  3GTL H;  1CUK A;  1L1O B;  4GLX A;  1QZH A;  4B3S L;  4BBR H;  3A0J A;  4AIM A;  3HOU G;  1VQG A;  5E7N A;  4X64 Q;  3RZO H;  1OXT A;  1AE3 A;  3GTG H;  1NMG A;  4JI5 Q;  1PH2 A;  5FLM H;  3S16 H;  1G29 1;  1FL0 A;  1L1O C;  4DK3 C;  3D31 A;  2NVT H;  2IX1 A;  4DAM A;  4UP8 A;  3ICE A;  4NB3 A;  4LFB L;  3HOU H;  2BA1 A;  1WCM G;  2WB1 G;  2XGT A;  4MZ9 A;  4HJA A;  4YHH Q;  4LFC L;  2VUM G;  1XMQ L;  3L7Z C;  1WCM H;  1BKB A;  2B63 H;  5HGQ A;  2A19 A;  4APV A;  5HY6 A;  3GTJ H;  5AJ3 Q;  3T1Y Q;  1VQL A;  2VUM H;  3TRZ A;  2CWA A;  3CP0 A;  4DUY L;  2CFM A;  1SR3 A;  1VS0 A;  5LMU L;  3GTO H;  1Q81 C;  4YCU A;  4NXN Q;  4HIM A;  3PGZ A;  4LF6 Q;  1WYD A;  3E9I A;  4IFD G;  2A1A A;  5LMN L;  4XTC S;  4X65 L;  4IJL A;  3PF4 A;  2YTY A;  3KF6 B;  1GKH A;  4LW1 A;  4A3M G;  2UUA Q;  2YV5 A;  2VQE L;  4O2D A;  1SRU A;  2XTI A;  3DLL A;  3K81 C;  2KBN A;  1D7Q A;  3EBE A;  1VQK A;  5JJI A;  3KYH C;  4DUZ Q;  2NVX H;  4PZ7 A;  4JI3 Q;  4DV3 L;  1VQ8 A;  2DUD A;  5GAH C;  3J80 i;  2I5H A;  3CXC A;  1YHB A;  4HJ8 A;  5LMN W;  3HKZ E;  1O7I A;  4IJH A;  4HJ5 A;  1EIY B;  1IYJ B;  4LWC A;  4GKK L;  1HZ9 A;  1N36 Q;  1EIF A;  4LF4 L;  1XNQ Q;  1LUZ A;  1Q82 C;  1X54 A;  2NZO A;  4QY7 A;  1Z47 A;  2HIV A;  1ASZ A;  3PUV A;  3G71 A;  2MFI A;  4JBJ A;  1VQF A;  4A3B H;  4LF7 Q;  4JI8 L;  4A76 A;  3PIO A;  4AH6 A;  1C0A A;  4DR3 Q;  2CQO A;  1CKO A;  4C3J H;  1AH9 A;  5IWA L;  1X3E A;  2UU9 L;  3I2Z A;  1QVF A;  4JYA Q;  1Q7Y C;  1U5K A;  5M3F H;  4A3B G;  4HID A;  4BA2 I;  1M1K C;  1PH5 A;  1IBM L;  1U0L A;  1SFO H;  1YJN A;  1HH2 P;  4LF5 Q;  1X56 A;  2D0P A;  2L15 A;  2CWP A;  1PH1 A;  4LF9 Q;  2D62 A;  1W3S A;  1N36 L;  3M4O H;  4LF8 L;  5M3F G;  3E9H A;  1VQ7 A;  4DR4 Q;  3PCO B;  1WJJ A;  1K83 H;  2K5H A;  2NZH A;  4ME3 A;  4GN4 B;  2GN5 A;  3RLN A;  1VQP A;  2E2H H;  2UXB Q;  5C4J H;  2JEB I;  4IFD J;  3S1Q H;  2K52 A;  4IOC A;  3Q8D A;  4QJF A;  2LSS A;  3BZK A;  2IHE A;  4KLK A;  3S24 A;  1X55 A;  2JA5 G;  3CCM A;  2Q2U A;  4A3J G;  4LFA Q;  4P73 A;  3JAM i;  3I7F A;  3TS2 A;  1KXL A;  3OTO L;  1E7Z A;  3W5O A;  4IFD I;  1CSP A;  1MIU A;  3U50 C;  4AQY L;  1JJG A;  4A3D G;  1OXX K;  1PV4 A;  2CCZ A;  1VCI A;  4BY7 G;  2JA5 H;  5LMN Q;  4C3I H;  1S72 A;  3J7Z C;  2PMZ E;  1SMX A;  3CCS A;  3TS0 A;  1IZ6 A;  1A63 A;  4IOA A;  1I6H H;  1TWH H;  4A3D H;  3TQY A;  2EIF A;  1VQN A;  4OO1 I;  5JJK A;  4B3M L;  4DR2 L;  1BBW A;  5LMU Q;  3UDG A;  1VQO A;  1PH3 A;  1N34 Q;  1K8A C;  1JJ2 A;  1XTD A;  1IBL L;  1LM0 A;  1N33 Q;  5AJ3 L;  1CKM A;  2BH8 A;  4GLA C;  3EN2 A;  4JOI C;  1VQJ A;  1L1O A;  3F8T A;  3F2B A;  2OWO A;  3LGJ A;  3M85 A;  2R93 G;  3UDI A;  1UE5 A;  4QL5 A;  1KL9 A;  3M7N A;  1SE8 A;  3IRB A;  2ALY B;  3NEN A;  5M5X H;  3S1R H;  4BXX H;  2JA9 A;  1NY4 A;  1YIJ A;  1N33 L;  4LF9 L;  3CC7 A;  3M4P A;  4JC0 A;  4X66 L;  4A3M H;  1S40 A;  4UPA A;  3D0F A;  5C0X J;  2VS1 A;  2I0Q A;  1FGU A;  3UDX A;  1E1O A;  1TWA H;  2OTL A;  4BXX G;  1LYL A;  4JYA L;  1HZB A;  1B8A A;  5FJ8 G;  3NBH B;  4DR3 L;  4BY1 G;  5GAE C;  3PO3 H;  3AYH B;  2Y0S G;  3L2P A;  1WI5 A;  3PV0 A;  3K8A A;  3ZJY C;  5FJ8 H;  1RIP A;  4P72 A;  3G6E A;  3CW2 C;  3CCE A;  4BY1 H;  1XNQ L;  4B3R L;  3PO3 G;  2ZTD A;  1K9M C;  1HNW L;  1YZ6 A;  1SLJ A;  3T1H Q;  1PH8 A;  4HIO A;  1XPO A;  3CCJ A;  3GTQ H;  5M5Y H;  1L2F A;  4LF8 Q;  4DUZ L;  1TWF H;  1YHA A;  2E8G A;  2NN6 I;  3RLF A;  4DV2 L;  4JBK A;  5K36 G;  5JEA G;  3CQZ H;  3K7A H;  1N9W A;  1PYB A;  2OQ0 A;  1HR0 W;  4NXM L;  2ID0 A;  1X9N A;  2N49 A;  2BH2 A;  3S1M H;  2RHS B;  3FP9 A;  4XIG S;  3TEH B;  2ATW A;  3KJO A;  1QZG A;  2UU9 Q;  2Q2I A;  2R6G A;  1C9O A;  2Y0S E;  4R4I A;  2LXJ A;  1EOV A;  3GDE A;  2VNU D;  2GVB A;  4A3C G;  3J81 c;  4MTN A;  3A74 A;  1YVC A;  1HZC A;  3OW2 A;  3OTO Q;  1PA6 A;  3RN2 A;  1BBU A;  2A8V A;  1HNX Q;  4PMW A;  1YJ9 A;  4LFA L;  4A3I G;  2R7Z H;  1K73 C;  4A3C H;  4GKJ Q;  4GKK Q;  1N32 Q;  4DV2 Q;  1OTC A;  3PUX A;  1VQH A;  3K7U C;  2DGY A;  5GRO A;  4GOP B;  1B70 B;  5C0X G;  1XMQ Q;  3HOV H;  1Z9F A;  4A3J H;  4A3I H;  3T1H L;  4H02 A;  3ULL A;  4YHH L;  2BA0 A;  3PF5 A;  4NPS A;  2FXQ A;  2K5N A;  3NEM A;  4IPH A;  2RF4 A;  3F2D A;  4GKJ L;  4JI0 Q;  1RL2 A;  3ERS X;  4BY7 H;  4B3R Q;  1N32 L;  4R4T A;  4IPC A;  3ULJ A;  1VQB A;  2JA6 H;  2VQE Q;  2JE6 I;  2ZM6 L;  3I56 A;  1TWC H;  2B3G A;  1VQ5 A;  2I5L X;  3F2C A;  1UWV A;  1E1T A;  2Z6K C;  4L5S A;  4FDB A;  4LF6 L;  3W1B A;  5BR8 L;  1XMO Q;  1I94 Q;  2JA6 G;  1R9T H;  3J80 c;  4TVA B;  3OYY A;  1OXS C;  3G48 A;  5C3E G;  1HR0 L;  4EX5 A;  1L0W A;  2AWO A;  4POG A;  2R93 H;  1A62 A;  3M9B A;  5C44 H;  4DR1 L;  3RLO A;  4UY8 C;  2JK8 A;  4PZ6 A;  3CMA A;  5JEA J;  1PH4 A;  1HJP A;  2QEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...