2EYPA

Crystal structure of staphylococcal nuclease mutant t120v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNVHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eypA00
2ENBA 2F0GA 2PZUA 2PZWA 1EY5A 5KIXA 1A2TA 1SNDA 3TP5A 5CV4A 1KDAA 1U9RA 2F0IA 3BDCA 4IZ8A 4KD4A 4QB4A 5ISRA 4OL7A 2F0OA 2HQEA 5IGCA 4HTHA 3SK6A 5JOBA 5KYLA 4DU9A 3C1EA 5I9PA 1SNQA 3DMUA 5IIFA 1SYGA 4I65A 3E5SA 1EY0A 5CV9A 2F0VA 3MXPA 5CC4A 4HMJA 2WACA 1EY8A 2EY1A 2O4XA 2QDBA 4K2LA 1EYCA 5DAUA 5NUCA 1A3VA 3R3OA 1EYDA 4PMBA 5IGDA 3OWFA 3EVQA 4QF4A 4ZUIA 1A3TA 1AEXA 4HMIA 4KJOA 4NP5A 4B9WA 4R8NA 1RKNA 2F0DA 2EYPA 1SYDA 4IALA 5C5MA 3P75A 5CV8A 3SK4A 3VA5A 4F8MA 5IGGA 5CGKA 1SNPA 1SYBA 5IOCA 3NP8A 3NUCA 1II3A 4K5VA 5EKKA 4ZUJA 2PYKA 2F3VA 3SK8A 5C3WA 1IHZA 5CV5A 1STBA 5CR3A 5CV6A 5E3FA 2PZTA 3D6CA 2RDFA 4H7BA 4KY6A 5J1ZA 3TP8A 3HEJA 1SNCA 3PMFA 2EYOA 3U9OA 5E1FA 2F0HA 3RUZA 1SYCA 5C3XA 2EYJA 2RKSA 4IUNA 2PW5A 1SNOA 3OMCA 4N9TA 4ZQ3A 5I6WA 1STGA 5DEHA 2EYHA 1SYFA 4G57A 3NXWA 1JOQA 1JOOA 1F2MA 3D4DA 1A2UA 5KRUA 2F0NA 3T13A 2EYFA 4S3SA 3MEHA 3T16A 4WRDA 4KTAA 1KAAA 4K5WA 4YIJA 5C6AA 5C4HA 4E6IA 2M00A 3QOLA 4WORA 3NHHA 5IGEA 5J22A 1EZ6A 4KY5A 4ODGA 2EY6A 3V2TA 2F0EA 3OMGA 4KJNA 5K5PA 4QMGA 1ENCA 1NSNS 2EY5A 3QB3A 3BDLA 3H6MA 5JAVA 2F0JA 2PW7A 4F7XA 4EQPA 4PNYA 4N9PA 5M9OA 1KDCA 4KHVA 1STYA 3OSOA 1SNMA 1A3UA 1EY6A 2F0MA 2PQEA 4MIUA 2F0KA 2EY2A 1STNA 2F0TA 2F0WA 2F0LA 5C4ZA 2OF1A 1NUCA 5IGFA 1STAA 5C5LA 2LKVA 1KDBA 4EQNA 5KEEA 4DGZA 1EY9A 3SR1A 3NQTA 4NMZA 5HURA 1F2ZA 2RBMA 4ID6A 4J1MA 2NUCA 4K2KA 5CV7A 4EVOA 2KHSA 2EYMA 5IODA 1TQOA 4K6DA 3SK5A 2EXZA 3P1HA 5KGUA 3MHBA 4KV6A 2F0QA 4LAAA 5F2DA 1JOKA 3EJIA 4K14A 4EQOA 2SNSA 3D8GA 5EGTA 5HGTA 4J6HA 2KQ3A 4PMCA 3ITPA 3LX0A 4TRDA 5I6YA 3TP6A 4KY7A 1TT2A 2F0PA 1F2YA 4NKLA 3D4WA 2SNMA 1EYAA 3TP7A 3EROA 3S9WA 2F0SA 1EZ8A 1EY4A 3DHQA 2F0UA 3HZXA 1SYEA 4K8JA 1EY7A 2SOBA 3SHLA 4B9XA 3MZ5A 3QOJA 1KABA 5IGBA 1JORA 3MVVA 5KYIA 4ME5A 5EKLA 4K8IA 4RKLA 1STHA 2EYLA 2F3WA 5J39A 1ENAA 2OXPA 4RKBA 4NDXA 1EQVA 2F0FA 3NK9A 2OEOA 3SXHA 3C1FA 4DFAA 5I9OA 3ERQA 1TR5A 4DF7A 3TMEA 4KD3A 4K5XA
chains in the Genus database with same CATH superfamily
2HHHL 1SRUA 2E2HH 4H44C 4A3BB 5AFWA 1I50H 1KDAA 2I07B 2R3ZA 1YJNA 2AQ2B 4LF7L 1SYGA 3UE0A 2JA7B 1PFMA 3H3VI 1RD9D 2HIVA 3KLSX 1YIJA 2K7VA 4DK3C 1EYCA 1L0YB 1A3VA 4BS9A 1JB7A 3VR6A 1KXLA 1TIID 3J80L 3K7AB 4RGMA 2QEXA 5LHY1 5ELEA 3SK4A 1CA5A 1OXTA 3NPPA 2R7DA 4IPCA 4ZUJA 1RDPD 1HTPA 1DM0B 4IN3A 4LF6Q 5IY0A 3KBGA 1LABA 3CCRA 3ULJA 1SYCA 2Z0SA 2RKSA 3BDOA 3OMCA 1CTMA 3CRLC 2LY7A 2HCCA 2PNHA 4J15A 4JYAQ 1HNWL 3RR5A 2UXBQ 4MTKA 3T16A 5GAHC 3U4ZA 3W5OA 2M00A 3EN2A 3QOLA 3CU7A 4KN7C 1L2FA 4KY5A 3OTOQ 4A75A 1RCVD 1Q90A 4RWSC 3CCQA 3G6EA 1PHJA 3OMGA 1QUQB 2RHQB 1NNXA 2A19A 2PW7A 1EU3A 1P8LA 3HFZB 4XQJA 3L2PA 4CKCA 4OWWB 3S1MH 1QILA 1CK1A 5IYDH 5IGFA 4GKJL 4A93H 1GJXA 1OTCA 4EVOA 2I46A 3SK5A 2YTXA 2YTVA 3EJIA 3HG9A 1IBMQ 2N49A 4TVAB 3K7UC 1J5EQ 1SJED 4R4TA 5A2QL 2L15A 3K5NA 2VB3X 4X3KA 1BCPD 2NVTB 2XVSA 3QIAA 1KAWA 2LSSA 5JEAG 5C44G 4YCWA 1LTGD 1VQFA 1LTLA 1X6OA 1B3AA 2OXPA 1FNUA 4P72A 1V9PA 2N88A 3C1FA 3DWPA 3M9BA 2R7ZB 3PO3B 1KD1C 2MP1A 2PMZE 4K5XA 1JQYD 1A2TA 3KF6A 1N32Q 1PTOB 4H13C 4RHSA 5KNBA 3S17H 1LUZA 1TWGH 3DMUA 5C4XH 5M5WH 1K83H 3E0EA 4YY3L 2AHOB 3A55A 2KECA 3D31A 4UDUC 2EPBA 4OO1G 2DNCA 3S1RH 1E2ZA 1M4VA 2LMCB 1HA6A 1I4HA 4QF4A 2NVQB 2WKDA 1PRTB 1TWFB 1RKNA 2K01A 5KNCA 1G6PA 4B3MQ 4CJ1B 1W2BA 3BU2A 1K8AC 1X54A 3HOWG 5G3LF 2UXBL 5FLMH 4JI0Q 2JA5G 1Y69U 1GXDC 4JG2A 2B63B 4FP5D 3S2DH 1LYLA 1NR4A 3BYYB 5M5XH 2PMZB 2EYHA 1JR0D 3H09A 1XJVA 3VYTA 2CH4W 4KK7A 4KTAA 1MIUA 3HOUB 1EZ6A 4H02A 4PZ7A 2CCZA 2DY8A 2F3IA 1SE3A 2K5HA 3UE1A 1VQ9A 5DM73 4OGQC 1SXTA 3OHXC 4JI3Q 1E1TA 3J80E 3MXNB 1VQNA 3GTKH 4C1NK 1PVOA 2IHEA 3DM1A 2HDLA 2F0TA 2F0WA 2Q2HA 3PUXA 2K52A 3AEVA 5C5LA 3BZCA 2LKVA 5AJ3L 3I73A 1IBML 3H91A 2X6LA 3FP9A 1MSGA 4NMZA 3OYYA 3TREA 1J5EL 4J1MA 1PXUA 4P75A 2F0QA 4DR2Q 1BBXC 4P74A 5HGTA 2KQ3A 1CKNA 2RCNA 4IPDA 3SVMA 4DAMA 2CWPA 5E7NA 2Q2UA 2L4NA 2N55A 3D4WA 3AFPA 3TP7A 1YZ6A 3SDZA 1O78A 1IW7D 4DV6Q 3TDQA 1CM9A 2D5DA 3DHQA 1TWCB 1Y1WH 3TRZA 4LUVA 2LFNA 3MZ5A 2D9UA 4BBSH 1V1OA 4BBRB 2LXJA 2EYLA 1R9TB 5CMDA 4NW2A 4C2MH 4NDXA 1EQVA 3KUPA 3BZKA 4Y7NB 1NE3A 1BCPB 4DF7A 4QJFA 4OWTB 4XYQA 2K5VA 3I8ZA 1K0SA 3MWYW 1CSQA 5GADC 5EBDA 3VDYA 2WV6D 2M2LA 4X66L 3A7AB 4ZKBB 1H9SA 1L1OB 2IX1A 3IFTA 3U50C 5NUCA 1IL2A 3E9HA 5IGDA 4OX9Q 3PUZA 2AUKA 3EVQA 2NVXH 5A2QE 1HZBA 1ASZA 4OWXB 4IOCA 3A56A 2KEEA 3CCMA 4RFBA 4IJLA 2EJMA 3NE5B 4A3MG 3I4NG 1XPUA 4A3LH 2QEJC 1SE8A 1AFPA 1GD7A 1STBA 5CV6A 3MFYA 4IUUA 5J1ZA 4ZLTF 2D0OA 3HOXG 1Y1VG 1NCVA 1PH1A 2F0HA 2FMCA 4JI7Q 4U673 2CW0D 3J7AV 1QZGA 3CCEA 1Q8IA 1WD0A 1ILPA 4S3SA 1BOSA 4DUZQ 2PQAA 4JI3L 2K50A 3OOCA 1HFNA 4WFN3 3ER0A 1SMYC 1WVLA 4JI6Q 1KLGD 4JCVE 4MZ9A 4B3TQ 2YU9H 3J7YW 4DV5Q 4M8AA 3S1QB 4AH6A 1QZHA 3MXUA 1CKOA 4KHZA 4FXKC 1Y8PB 4L6TB 2TMPA 2A6EC 5BR8Q 3SE0A 1PDQA 2F52A 3D3RA 5IODA 2EXZA 2UU9L 3J7AF 5J3BA 1G291 1ML0D 2Y0SG 4ME3A 2K4KA 1TKWB 4DV6L 3CP0A 5EGTA 3I55A 3RN2A 4HCEA 1PRTC 4B3SL 4O2DA 4C3JB 5K36G 2OTJA 3VYSA 2VUMH 5M3FG 3OIPA 1ZKOA 3CC2A 2A5HA 5EKLA 2WFWA 1DONA 1EIFA 1HFGA 4CDCC 2VQFL 2VXWA 1R4PB 4QL5A 4DFAA 1PH7A 1ET9A 1WTPA 4A3IG 3AFQA 1M8AA 4FF1A 4KD4A 2ZJQA 1ET6A 4OX9L 1LACA 4KHPQ 2B2YA 4UHVA 3PIP3 1Y8NB 4POGA 1SE2A 2WACA 2H4OA 4LF8Q 5IP7G 3L7ZC 2R61A 1MGSA 2NYZD 3KOJA 1WD1A 4F8MA 1VQIA 4GNXB 4JI7L 1F2LA 2EQSA 2ZJRA 4GLAC 3I4MG 3DWAA 5C3WA 5CV5A 4R8IA 1EU4A 2J0TD 3M4YA 1JWMD 1S5ED 3RLNA 2MFIA 4LFAL 4DR1Q 4DNTB 1O7LA 1PZJD 1EIGA 5EJWA 5JEAH 3U9OA 5C44H 1BO0A 3CMAA 2NWGA 2B2TC 1SYFA 3J81j 3T1HQ 4A93G 1X3EA 3MFGA 3T13A 5C0XG 4B3TL 2R93G 1E1OA 4DV5L 3PF5A 1S4ZA 2I5HA 1EEFD 1LT6D 1I94L 4ODGA 2BCOA 4QMGA 2L9HA 4BY7B 5DLQE 1BCPC 4A3JG 3GTPH 1U4MA 1U5KA 1WCMB 2HIXA 1KRSA 4HIOA 4G7ZC 1LTTD 4OO1H 2VL6A 4IPGA 1CKNB 3S1NB 3A8IE 2ZXOA 3CW2C 3FPUB 2JA8G 3I4OA 4DK6C 5HURA 1I6HH 1GKHA 5M3MH 3P7JA 1CA6A 2WAQE 1C7YA 5M5YB 1TQOA 2BH2A 4ZKCB 4R9WA 3KFUA 1DD2A 4LF4Q 2R92G 4KY7A 2J4XA 2QILA 2JA5H 4NKLA 2CWAA 4BY1G 1BXTA 1IL8A 1EY4A 2ZXPA 3IFDA 3VYRA 1EY7A 2AWNA 1HR0W 4L5RC 2WKCA 2WINB 2JN4A 1GUNA 4HJAA 1XX8A 2NN6G 1ENAA 3HOVG 4KHPL 1HQRD 1A0IA 2E2IH 5KYLA 5ELFA 4LF8L 2GN5A 3TP5A 1JE4A 5CYUA 4QB4A 3PO2H 3UDXA 3RLOA 5JOBA 4I65A 2RQXA 2WAQB 1O7YA 1SJHD 1F9PA 2D2CC 4HMJA 3ZYYX 4K2LA 2K28A 2NZHA 5FLXL 2K04A 3R3OA 1HXYD 1EYDA 1N36Q 3DEOA 4IFDI 2N3SA 2IY5B 3JC66 4R8NA 2F0DA 4X65Q 2EYPA 4UP7A 3AMUA 3J81L 1D2BA 1WTWA 1C9OA 2NVYH 2ICEC 3SK8A 4C3HB 3EQLC 4ALPA 2PQAB 1FNWA 1K3RA 3KK7A 2UXDQ 3R2IA 4RAUC 4JI2Q 1HCZA 3CCSA 1G6ZA 4R4IA 3F2CA 2HT1A 4R1JA 4CGYB 2HHHQ 1XNRL 2EYJA 4CDDC 4DV2Q 3S2HB 3OPOA 4G57A 1JOQA 1FNVA 3GTGH 1JWUD 2MO0A 4IOAA 2XIWA 3BG3A 4YIJA 4DNRB 1HUNA 3F2UA 3I4LA 4A3EH 4LF7Q 5DM63 1D7QA 2KCNA 4LW1A 4RG1A 3V2TA 1I4PA 1GHJA 4F87A 2K05A 1G2SA 1IW7C 4K0KL 2Q2IA 4DR4L 3OSOA 3CQZH 1E24A 1CHPD 4JBJA 4V190 1MKHA 4LF4L 2R6GA 4KKUA 3HS0C 4KKSA 2NUCA 1JMCA 2DJGC 4XXEA 4A3DG 3I4NH 4A3MH 3H94A 4A3GG 1XPRA 2OCEA 4G4KA 1XMQQ 2JP1A 2JA6B 2A68D 3S1QH 1F9RA 3CPFA 2V1CC 2KA7A 3NELA 3OWEB 1Q82C 3G71A 5EBCA 1HNWQ 1CI3M 4IFDJ 3FPPA 2UXCQ 1B4OA 3HOXH 1Y1VH 4GN3B 4UPAA 1VQ8A 1RIPA 1CSPA 3PUWA 2HCIA 2SDFA 1WTVA 1MSHA 1I5FA 1M1KC 4IURA 2J7ZA 3GDEA 4QGUA 1A15A 4K6LA 3UDGA 1UE5A 3MXNA 4X3UA 1Q1EA 4A3BG 4GKJQ 4ILWA 3A74A 1K28A 1H9MA 2N78A 1N36L 1EFID 1A62A 1GHKA 1H9JA 3TBIB 2JA7G 2B2VA 2CW0C 1I4GA 3D6WA 3C3LA 3MXPA 1GUTA 5GQOA 3S16B 1NAPA 1EL0A 2EY1A 5I2YA 2Q2TA 2RHSB 3CC7A 1PTOD 4JOIA 2KCTA 3K5OA 2FJ2A 1IKLA 4KJOA 3GTMH 2UXDL 1BF4A 4HEDA 4ZCKA 1EIYB 3OIQA 3PIPA 4DV2L 5EKKA 2FINB 2PZTA 5K36H 1TS4A 3R93A 3T51B 4EQ5A 1I4QA 1ZXTA 5M3FH 1F77A 1PRTD 3HEJA 1CUKA 3HKZE 1GUGA 3U4VA 4DKAC 4RGTA 1X3FA 2E2JH 5C4JH 2L11A 5DEHA 5JPMC 1IYVA 1DXMA 4JI8L 4YY3Q 3Q24A 3S15H 4A3IH 2O5JC 2MNAA 3F2DA 3KYHC 5EPLA 3I90A 5FLXE 2EY5A 1L1OA 3HOYB 1G8ZD 4G7HC 2K75A 4IUQA 5JVH3 5LMUQ 3RN5A 3J81E 2VUMG 1HNXL 1XMQL 5KEEA 1PH5A 5IP7H 4K2KA 2DJFC 4HSPA 3ERSX 4PV1C 2UXCL 2NB0A 3MHBA 4CJ2C 3SEBA 2KVMA 3K5MA 1YHQA 4GKKQ 3I4MH 2WP8J 4KI0A 1FVIA 3HKZB 1L0WA 2QW7A 3TP6A 4GOPB 2MPMA 1TXYA 1EYAA 1SE4A 2F0SA 3GTOH 1UNSA 1HJPA 2L12A 3M3YB 4FF2A 1TWHH 5IGBA 1QWYA 1CT1D 4CDEC 2K5QA 5C0XH 2BH8A 3ZJYC 2R93H 1R4QB 2ZT9C 1YJ9A 2R7ZG 1IXRA 3PO3G 1AE3A 1XTDA 1PFSA 3R2TA 4CKBA 2RF4A 3HKSA 3STBD 3VR3A 1TS5A 5AJ3Q 1MJEA 1EUJA 4FNFA 2WB1E 4NB3A 4A3JH 4OL7A 1LV9A 5CBAE 1XWEA 4A3KB 1RF2D 1UUPA 1PH8A 3Q0AA 3MXGA 2JA8H 2KUMA 4C3IH 3IAYA 2H1EA 4I7ZC 4PMBA 3CD6A 1X56A 4ZUIA 3K6OA 4JBMA 4XYOA 3B6YA 1HNZQ 1CQFA 3CCVA 2R92H 5C3EB 1V1PB 3NUCA 2PYKA 1ONLA 4Q0FA 1SBBB 5H1SE 4BY1H 1E3PA 4RH6A 3H15A 4YWMA 3TP8A 4EX5A 2B63G 1WTOA 1X3GA 4OO1I 1E7ZA 2BA1A 1HZ9A 1B44D 1STGA 1I4XA 3NXWA 3HOVH 2NN6H 3BVGA 1CHQD 2WB1B 4X66Q 3HOUG 2IPKD 1KAAA 5M3MG 2B29A 2ZTEA 2OT2A 5IGEA 2KCMA 1JJCB 5LMUL 3M4OH 1DCZA 2B2YC 2EY6A 1WTRA 5D14A 4ZAIA 4ABNA 3CPWA 1PZID 1I3QB 3BVZA 2UUAQ 1CZWA 1GOZA 3I72A 5C4ZA 4B08A 4GKKL 1NUCA 4IUPA 5EQ0A 4HJ7A 4IUVA 1KRTA 2C9OA 1Q86C 4GNXA 1TY0A 1F2ZA 2I5MX 1VMCA 5KGUA 2K5DA 2K33A 4YWLA 1QG7A 3MC0B 4EQOA 4LFBL 2MUYA 1HA5A 5ELNA 2Z8LA 1PLFA 1VQJA 3K58A 3KLWA 3GTLH 1F2YA 4XQNA 2SNMA 3RZOB 4JBWA 3KLRA 5E4WC 5EAYA 3FHWA 3PO2G 3PIOA 4K8JA 2ZM6L 2G9HD 2XSCA 4DV0L 4BBRG 4HIDA 1KABA 4OIKA 2IT1A 3MVVA 4ME5A 4RKLA 1UEAB 5J39A 4JI4Q 1SFOB 3NK9A 1TY2A 2XTIA 5I9OA 4X3SA 1IYUA 1MI2A 4RA8A 1QVFA 2BA0A 5LMNW 4P73A 1K8MA 1QB5D 2IHFA 3GTJH 4RCNA 3HOZH 2F0IA 4GS3A 3HOWB 4DR7Q 1BR9A 1D6EC 2UU9Q 1PFNA 3E5SA 2CKZB 3E0JA 1FR3A 1HNZL 4N8X1 3NTKA 2JE6I 4AQYL 1H95A 1IBLQ 2DN8A 4B3SQ 2Q8TA 4A3DH 1ESRA 1VQCA 1BBWA 4A3GH 1SYDA 2MQHA 4IALA 4JV5L 5ELCA 1B53A 4A3EG 1HR0L 4BXXH 4LNQA 1RODA 1CKMA 1II3A 4TSSA 3U58A 1Z6HA 4TQUS 2VQFQ 1ICWA 1FL0A 3M4QA 1TWAB 4GOPC 1G51A 2E5LL 2GVBA 4RGOS 4IUNA 2B8FA 5CORA 3U9SA 1KNEA 1EOTA 1WYDA 1UE7A 1B50A 2X69A 2VNUD 2UUAL 4A3BH 1ENFA 2A68C 3EFXD 4A3FB 1QE6A 4FVMA 4HCSA 1EWIA 3H3VC 1KNAA 4DV7L 4JW0A 3Q6SA 1WTXA 4KJNA 1BKBA 4CDFC 1NMGA 3J7ZC 2JA7H 5D3DA 2H5XA 3A5ZB 3IRBA 2XNAC 4MNOA 3SGIA 4KN4C 2F0MA 2F0LA 2R7FA 1X55A 5I4DA 4DK0A 5JPNC 3K7AH 3FKIB 3NQTA 1VQEA 2RBMA 5CV7A 1GUSA 2C35B 5KNDA 4X6AH 2A73B 4LFAQ 1KQSA 3D8GA 1BDOA 1F9QA 2MO1A 4PMCA 3L0OA 3TQYA 3TS2A 2EJFC 4C3JG 1PYWD 4JI4L 4HSVA 3RZDB 2F0UA 3EA6A 3CCJA 2JK8A 1I94Q 1PTOC 4LF9L 4P71A 3I7FA 3MEFA 1STEA 1AW7A 3OW2A 3M7GA 4FF4A 1Q3LA 4DR7L 4HAEA 1BCPF 3PUYA 4HJ8A 3JAMc 2ENBA 1B8AA 5EPJA 5IWAQ 5HY6A 2ZJPA 2V4DA 1TS3A 1QNUA 5ISRA 4AYBE 2AMCB 1HUMA 4DR3Q 1T5XD 1IBLL 4UP8A 3T56B 2VQEL 2WIIB 1A8VA 4LMQD 2YYZA 2F0VA 2FFKB 2RDGA 1RL2A 1EOVA 4WJWA 2CFMA 2TSSA 3S14B 1NMFA 3I56A 2QKIC 1S3OA 3H0GB 1H9RA 3AQQA 3NWTA 1A3TA 4HMIA 4B9WA 1J8IA 2KOLA 3E3XA 4APVA 4DR6Q 1DZ1A 1YNXA 1LT3D 3NEMA 2NVTH 3DXJC 2RDFA 1FJGQ 4R4CA 5GAGC 3RUZA 4ZRZA 2ICIA 3I91A 5IP9H 5IT9c 2R7ZH 1PA6A 3PF4A 3PO3H 2A69D 1YNND 4AYBB 1K73C 3KJOA 2E74C 1JB3A 1PTOH 1B1ZA 1VQBA 3QJYA 4OXPA 2AQ1B 2G9DA 2B2VC 5IYCG 3QB3A 2E2HB 1B3QA 1WCMG 2F0JA 3WOEA 1EFWA 1LTID 4N9PA 1I50B 3M85A 1BBUA 1STYA 4JOIC 4DUYL 2NVQH 3FVQA 4OEMB 1VQAA 3WWVA 5C0XI 1TWFH 3PCOB 2XRQD 3DM3A 3F8TA 2I5LX 3STBC 1XNRQ 4MTNA 5HGQA 1JCKB 3LX0A 1OXUA 2A6HC 4R4QA 4F88A 1C8CA 2BE5C 3FEWX 1SN8A 2B63H 4JVZA 2AQ3B 3TEHB 3S9WA 2AKWB 3T53B 4LF5L 4JI1L 2JXMB 2UUBQ 5JJLA 1V1QA 3ND8A 5IWAL 1JORA 2MJ8A 4OHJA 3HOUH 1LLRD 4C3IG 4DR3L 4L63B 4RKBA 5JJKA 4K0KQ 1SEBD 4DR4Q 1C48A 5FLXc 1L1OC 4DV4L 1GO3E 2ZTDA 2PZUA 5GROA 4L5TA 1DOMA 3F1ZA 3QWNA 5EPKA 1X9NA 3CKIB 2WAQG 4DU9A 2P5ZX 1SNQA 4FXDA 3L9AX 3NTIA 5CV9A 4DR6L 3A0JA 4X3TA 2PCFB 2O4XA 5DAUA 4LWCA 2NN6I 1RTNA 4A93B 3RNUA 4GOPA 1FJGL 3VYUA 2Q8RE 5CBEE 4UY8C 4TKOB 3VA5A 1JJ2A 1SYBA 3A7LA 4C3HG 2JJQA 3T4AC 4L5SA 5C0XJ 1BNZA 4IO9A 1HZCA 1TWCH 2JQOA 4PZ8A 4QIWE 3PMFA 4BBRH 1R9TH 1SNOA 4NXNL 1VQLA 1U4RA 1AE2A 3D4DA 3K8AA 4Y7NH 2MGSA 4ULLA 3DLLA 5E4XA 1MBYA 2CHBD 1DYQA 4POFA 1E0BA 3MA2B 3EIVA 1YHAA 4HJ5A 3H6MA 2A1AA 4F7XA 1Q1BA 1EWHA 4DXFA 4QY7A 3E6ZX 2YTYA 2A8VA 2F4VL 1W3SA 3S17B 1VDZA 2PQEA 2RVLA 2EY2A 2CQAA 4P2CB 1TWGB 1N8RC 5M5WB 5C4XB 1K83B 1DJRD 1X3PA 2KJXA 2IX3A 4O0AA 1S5CD 1V1PA 1YBYA 1S5FD 3S1RB 2EYMA 2VZAA 4IPHA 1QVGA 5F2DA 4QIWB 5ELOA 1VF7A 2Z4IA 4BA2I 3A8JE 2UUBL 1NBWA 4DPGA 2D0PA 3HOZG 1SLJA 3GTQB 5DNFA 2QDLA 4JI8Q 4XT3B 3S2DB 5M5XB 1RJTA 3R8BA 1I4RA 1IKMA 1WTQA 3PIO3 4CKEA 4N8FA 1PV4A 3ND9A 5BN3A 1WI5A 1N34Q 5FO7B 1NY4A 1YNJD 4DAPA 4KD3A 1LTSD 4RCOA 1HNXQ 2CH4A 1JWSD 1PMRA 1U9RA 3BDCA 4BXXG 3RZDH 4FYDA 1KHIA 2HQEA 3BZDB 5I9PA 1HTLD 3N6RA 2M9VA 4GNXC 3GTKB 1JT8A 2XGTA 2QDBA 3ICEA 4LK1C 5G3LD 1EEID 3HGBA 3X3NA 4XIGS 3TZDA 4MHEA 3C2PA 2Q8IB 2PNRC 1K9MC 1YEZA 3J80c 1EQRA 3W1GA 5IOCA 4C3JH 2L5TA 1G91A 1SR3A 2K03A 4DV3Q 1Q81C 3GV6A 3CAMA 1SNCA 4RGNA 1V43A 1E2VA 5FOBB 5I6WA 2NTTA 5LMNL 1Y1WB 1UE1A 2JA9A 4BBSB 1FD7D 1F2MA 1A2UA 1Q7YC 3VR2A 2E75C 2ZXRA 4E6IA 2DY7A 2FXQA 4C2MB 2HD3A 2JYOA 1WOCA 2GVAA 4QQBX 3HOYG 1YITA 2NBFA 4GN4B 3QR8A 2EZVA 4ZYSA 1UWVA 4O42A 1S5DD 2AUJD 1A3UA 1EY6A 2EOTA 2OF1A 4HIMA 4EQNA 3WDNA 1XNQQ 3CCUA 1F9SA 1U4LA 1XMOQ 2KCCA 3X3MA 2NVXB 3GQBA 3CRKC 4B3RL 3HKZG 5BN4A 3KLSA 2UUCQ 3QO2A 2QCPX 5TSSA 2F0PA 2PPBC 1HH2P 2CVRA 3EROA 3KJPA 1N34L 1G2TA 3K0YA 2L55A 2VS1A 1FYCA 1KL9A 4XT1B 3KBXA 1STHA 3P20A 4LUZA 2LS01 1LM0A 1Y8OB 1H9KA 3PGZA 4I7AA 3J80i 2B2UA 5IYCH 4BY7H 1E22A 1CFMA 1XYIA 1WCMH 3KF8A 3ULPA 3IL8A 4JC0A 4A3KG 2F0OA 1AN8A 2K1BA 3A8KE 3S1NH 1B7YB 1U4PA 5IIFA 1FGBD 2YU9B 2E2DC 4LFBQ 2VY3A 1IYJB 5M5YH 2QA4A 2A69C 3CC4A 1YNNC 5IP9G 1AEXA 2MHVA 4DV3L 3NWSA 3RD4A 4NXMQ 1VQ5A 4L5QA 5C3EG 2ZM6Q 4DV1L 1NJIC 1SNPA 4DV0Q 2B2WA 4K5VA 5E3FA 2A6HD 2B8GA 2BE5D 1Z7TA 1KTKA 3E9IA 3G4SA 2EYOA 4X64Q 1AZPA 3AU7A 1PYBA 3FDTA 2I0QA 2VUMB 2XRSD 1B70B 2WB1G 2F0NA 1YHBA 1V8QA 3N52A 3VR5A 4DR5L 3BJUA 4K5WA 1EWCA 1HPCA 3S24A 1ZYRD 2F4IA 1J6QA 5IYBG 2HQLA 1PH3A 1UAPA 3TS0A 1NSNS 4AQYQ 1XNQL 4YWKA 1JJGA 4EQPA 2K32A 1VS0A 1D8LA 3W3AA 1XMOL 4KKTA 3A54A 5KRUA 3V05A 4BA1I 1IBKQ 5FO9B 1PH6A 4JV5Q 1P16A 1STAA 1HR0Q 1B9NA 3ULLA 2Z6BA 1PH2A 5T1GA 5D3IB 2UUCL 4UP9A 4KV6A 1D1IA 1QNKA 3M7NA 4K14A 4C3HH 3F2BA 2E5LQ 2ASBA 4J6HA 5I6YA 2KBNA 4QCLA 2OWOA 2EVBA 1B2TA 3HZXA 3S2HH 2SOBA 3QOJA 4OELB 5C44B 4DV7Q 3CF5A 1DOKA 4A4IA 3LNNA 4LF6L 3L3OC 4WJ4A 2RA4A 1TVXA 5JEAJ 3W1BA 1DGSA 2PZWA 4YCVA 5KIXA 1D5ZC 3OW7A 3VA7A 3GTQH 4JYAL 4IZ8A 4DA2A 2Z6KA 3TN2A 1O80A 1SSOA 5LL6S 1VMPA 2D62A 4NXML 3GTPB 3OTOL 4C56C 1LT4D 1LO5D 5FKAC 4IFDH 2K5WA 2C5CA 4CJ0B 4FO2A 2JA6H 1I6HB 5M3MB 5C5MA 3D0FA 4X64L 1QVCA 2K6AA 5CV8A 5IGGA 1PZKD 4LF9Q 3K80C 1EYGA 1PTOF 1EQTA 1M90C 4DNIA 1IHZA 1NR2A 1VQ4A 3K81C 3D6CA 4H7BA 2JEBI 2JA5B 2PI2A 5C3XA 5T1IA 4DAVA 1W6JA 1PFBA 3MTSA 2NZOA 2ES2A 1MHWC 3CMEA 3MEHA 1PRTF 2VQEQ 5L37A 4A3FG 1Q12A 4A3CH 2E8GA 4IJHA 2E2IB 1IBKL 1UEBA 3T1YQ 3BDLA 2PO4A 3WOFA 4PNYA 1VQ7A 3S16H 2EIFA 1JC7A 5GAEC 1VQMA 1Y14B 3PO2B 3Q22A 2F0KA 3PUVA 3FKIG 1KDBA 4NPSA 1N32L 4IQZA 3TSSA 4JPBW 4DXGA 1YNJC 3I70A 4YHHQ 1YI2A 3HRZC 3GV3A 1JOKA 2Z4HA 3ITPA 3BS1A 2IX0A 2NVYB 1X3QA 4GLVB 2EDGA 2G5DA 1T9HA 1ESFA 2X6GA 1GM5A 4DN4M 1SYEA 3Q23A 4B3ML 1BVSA 1QOHA 3O13A 3KF8B 4XQQA 4AIMA 4XTCS 3A5UA 5JVG3 4JI0L 3DEPA 3GTGB 3ERQA 4HIKA 4CHTB 1K8GA 5LL6X 3HOYH 1EY5A 2FHTA 1O7IA 4A3EB 4DUYQ 5CV4A 3URYA 1A63A 4RMFA 1D5MC 1VCIA 3K57A 4Y52H 3FRPB 1BUVT 3BVMA 3KDFA 3NBHA 1ASYA 4PMWA 1RTOA 2LXKA 1K8OA 5CC4A 1WJJA 3I2ZA 3CQZB 1Q8KA 3PV0A 1E2WA 1HQMC 3H0GG 3M4PA 2JSOA 3VR4A 5FO8B 3CCLA 2L0CA 4X62Q 4PZ6A 1Q46A 1GVPA 2DGYA 4FDBA 3RMHA 4U68A 3Q8DA 4QUFA 4V0BA 1VQKA 1VQ6A 4YCUA 2EJGC 4LF5Q 2VW9A 2IJ0A 4JI1Q 1ILQA 3I4NB 1Z9FA 4A3MB 2ZTCA 1CQVA 1D1KA 3BYTB 1YVCA 1C0AA 4DK1A 4GN5A 3M3YH 3J7A5 3LWEA 2Y0SE 4DR2L 5E1FA 3HOXB 1Y1VB 4DV4Q 3H3VH 4C1NI 1X65A 4GLXA 1N9WA 5EKIA 3T1YL 3AB9A 4H0LC 4AYBG 4JI5Q 4WRDA 1HHVA 5C4HA 3GD7A 2KHJA 3NENA 5FJ8G 4FXGC 1D5XC 4JK1C 4RHRA 4A76A 1BQQT 4A3KH 1NTGA 3NQIA 3W2DA 4UAIA 5M9OA 3NSWA 4KHVA 1VQOA 4YHHL 2E76C 1SNMA 3RLFA 1MJCA 2O2LD 3KF6B 5D65A 5COYA 1KLUD 1WFQA 4DAYA 3DWQA 1KIXA 5I2XA 2XWJB 2A74C 4HJ9A 1XXGA 2AWOA 2KHSA 1PYSB 4CBVA 1SROA 5C3EH 4QUCA 1I6VC 4Q5VA 2Z9HA 2SNSA 3GTMB 2QGQA 2Y0SB 4NXNQ 3UDFA 4BY7G 1JE5A 4JBKA 2PI2E 4FF3A 3ONAB 1TS2A 2L1BA 5M3FB 2VB2X 1WTHA 2JEAI 3JAML 1LT5D 4K8IA 1SAPA 2E2JB 5C4JB 2F0FA 1T5EA 2F4VQ 5IYBH 1TR5A 4M1UB 3JAMi 2HDMA 4ZK9B 1QJOA 1KC8C 4LFCQ 1I3QH 1SNDA 5FK9C 3S15B 4XDXA 4A3IB 1X32A 4X62L 4DUZL 4HTHA 3IKJA 5A35A 2CQOA 3C1EA 1VF5C 1XTCD 4OIJA 1U0LA 2ID0A 1OXXK 1MD2D 4KLKA 1EY8A 4KMUC 5IYDG 4JI6L 3C46A 1VQDA 1K3BC 1OO9B 3V96A 2OTLA 1ZYRC 2XN9C 3CXCA 4NP5A 1K0RA 5IE8A 2K5NA 2Z1CA 3P75A 1PH4A 1HZAA 2RSOA 3NTHA 3RZOH 5BR8L 4PG3A 1HRJA 2YV5A 3I4MB 1DOLA 2KEDA 4KY6A 3J81c 4JI5L 5IT9L 1GUWA 1RHPA 4ZQ3A 3GTOB 1SFOH 3FMCA 3S1MB 3D4RA 1AZQA 2XWBB 3G6JB 2B2UC 1TWHB 2EYFA 1LTBD 3DUZA 1LTRD 1S72A 2R93B 1UE6A 1VQHA 5J22A 4J8QA 1N33Q 5JJZA 3HOWH 1SMXA 1ENCA 1XPOA 4HN7A 3GO5A 4A3JB 2OQ0A 5C4XG 1STNA 3HP3A 1W6KA 2EXDA 5ELDA 2BOSA 1OXVA 3SR1A 2EE1A 1QUQA 2RCFA 3QG1A 2JA8B 2B2WC 4C3IB 1H9SB 4K6DA 2ATWA 1AP0A 4LAAA 4PQXA 1YJWA 2F1MA 1A6XA 1PH9A 5LMNQ 4HR7B 1TT2A 2R92B 1TWAH 1QCBD 5FLMG 2BDOA 5ELBA 4BY1B 4B9XA 3SHLA 2NTSA 2NZ1D 3UI2A 4LFCL 4WJ3M 3NBHB 3KDFB 4IUTA 4IFDG 4A3FH 3HOVB 4DR1L 2DUDA 2PW5A 4N9TA 1S40A 3TMEA 5JJIA 2F0GA 2OQKA 4G7OC 2JA6G 2FMMA 3M4OB 3T1HL 1TU2B 2KENA 3J81i 2B3GA 3LWUA 5IGCA 3SK6A 3MAQA 1EY0A 2GA4B 3TZUA 2F03A 4B3RQ 3FKIH 1OXSC 1VQPA 1C4QA 3OWFA 2BDNA 3NBIA 3I3CA 1L0XB 2RDHA 1GUOA 3K5LA 5CGKA 3EBEA 4A3CG 3NP8A 2F3VA 1CZGA 1SDFA 5CR3A 3JAME 1Z47A 1IZ6A 3GTLB 1ZEQX 3LGJA 2QF7A 5BN5A 2K14A 1B9MA 2O5IC 3G48A 1Y1WG 1N33L 2IWHA 3UDIA 4BBSG 4O1NA 1JOOA 2N8NA 5C6AA 2IW3A 4WORA 4Z9CB 2Z6KC 3NHHA 4MN3A 4EGVA 4DAYB 3K59A 1EQQA 4L8JA 2F0EA 5K5PA 5JAVA 2SEBD 3HOZB 3GTJB 1KDCA 1VQGA 1JICA 1LTAD 4MIUA 4DV1Q 3S14H 1ICFB 4R4OA 3H0GH 1S5BD 4DGZA 1EY9A 3AYHB 1J9OA 4ID6A 3CHBD 1FGUA 4LJZC 3P1HA 2DNEA 5IT9E 2ALYB 4A3DB 4GZYC 1AH9A 2RSNA 2HUGA 4A3GB 2IL8A 4A3LG 4TRDA 1SMYD 4DR5Q 1O7ZA 4OONA 1EIHA 3G7LA 4X65L 1EZ8A 4BWGB 5KYIA 3PSIA 2F3WA 3PQIA 2A6ED 3SXHA 2OEOA 4JI2L 5FJ8H 2B39A 4LUOA 2B2TA 3GP7A 2KHIA 3K0XA
chains in the Genus database with same CATH topology
4H44C 4A3BB 5AFWA 1KDAA 2I07B 2R3ZA 2AQ2B 1SYGA 2JA7B 1PFMA 1RD9D 3KLSX 2K7VA 1EYCA 1L0YB 1A3VA 4BS9A 3VR6A 1TIID 3J80L 3K7AB 4RGMA 5LHY1 5ELEA 3SK4A 1CA5A 1OXTA 3NPPA 4ZUJA 1RDPD 1HTPA 1DM0B 4IN3A 3KBGA 1LABA 1SYCA 3BDOA 2RKSA 3OMCA 1CTMA 3CRLC 2LY7A 2HCCA 3T16A 2M00A 3QOLA 3CU7A 4KN7C 4KY5A 1RCVD 1Q90A 4RWSC 3OMGA 2PW7A 1EU3A 4XQJA 4CKCA 1QILA 1CK1A 5IGFA 1GJXA 4EVOA 2I46A 3SK5A 3EJIA 3HG9A 1SJED 5A2QL 3K5NA 2VB3X 4X3KA 1BCPD 2NVTB 2XVSA 3QIAA 5JEAG 1LTGD 1B3AA 2OXPA 1FNUA 2R7ZB 2N88A 3C1FA 3DWPA 3PO3B 2MP1A 4K5XA 1JQYD 1A2TA 1PTOB 4H13C 4RHSA 5KNBA 3DMUA 3A55A 2KECA 3D31A 4UDUC 2EPBA 4OO1G 2DNCA 1E2ZA 1M4VA 2LMCB 1HA6A 1I4HA 4QF4A 2NVQB 2WKDA 1PRTB 1TWFB 1RKNA 2K01A 5KNCA 4CJ1B 5G3LF 1Y69U 1GXDC 2B63B 4FP5D 1NR4A 3BYYB 2PMZB 2EYHA 1JR0D 3H09A 3VYTA 4KK7A 4KTAA 3HOUB 1EZ6A 2DY8A 1SE3A 5DM73 4OGQC 1SXTA 3OHXC 3J80E 4C1NK 3DM1A 2HDLA 2F0TA 2F0WA 3PUXA 5C5LA 2LKVA 3I73A 3H91A 2X6LA 1MSGA 4NMZA 4J1MA 1PXUA 2F0QA 1BBXC 5HGTA 2KQ3A 3SVMA 2L4NA 2N55A 3D4WA 3TP7A 3SDZA 1O78A 1IW7D 3TDQA 1CM9A 2D5DA 3DHQA 1TWCB 2LFNA 3MZ5A 2D9UA 1V1OA 4BBRB 2EYLA 1R9TB 5CMDA 4NW2A 4NDXA 1EQVA 3KUPA 4Y7NB 1BCPB 4DF7A 4XYQA 3I8ZA 3MWYW 5EBDA 2WV6D 2M2LA 3A7AB 4ZKBB 1H9SA 2IX1A 3IFTA 5NUCA 5IGDA 3PUZA 2AUKA 3EVQA 5A2QE 3A56A 2KEEA 4RFBA 2EJMA 3NE5B 2QEJC 1AFPA 1STBA 5CV6A 3MFYA 4IUUA 5J1ZA 4ZLTF 1NCVA 2F0HA 2FMCA 4U673 2CW0D 3J7AV 1Q8IA 1WD0A 1ILPA 4S3SA 1BOSA 3OOCA 1HFNA 4WFN3 1SMYC 1WVLA 1KLGD 3J7YW 4M8AA 3S1QB 3MXUA 4KHZA 4FXKC 1Y8PB 4L6TB 2TMPA 2A6EC 3SE0A 1PDQA 3D3RA 5IODA 2EXZA 3J7AF 1G291 1ML0D 1TKWB 5EGTA 4HCEA 1PRTC 4C3JB 5K36G 3VYSA 3OIPA 1ZKOA 2A5HA 5EKLA 1DONA 1HFGA 2VXWA 1R4PB 4DFAA 1ET9A 1WTPA 1M8AA 4FF1A 4KD4A 1ET6A 1LACA 2B2YA 3PIP3 1Y8NB 1SE2A 2WACA 2H4OA 3L7ZC 2R61A 1MGSA 2NYZD 1WD1A 4F8MA 1F2LA 3DWAA 5C3WA 5CV5A 4R8IA 1EU4A 2J0TD 3M4YA 1JWMD 1S5ED 4DNTB 1O7LA 1PZJD 1EIGA 5EJWA 5JEAH 3U9OA 1BO0A 2NWGA 2B2TC 1SYFA 3MFGA 3T13A 5C0XG 1S4ZA 1EEFD 1LT6D 4ODGA 2BCOA 4QMGA 2L9HA 4BY7B 1BCPC 1U4MA 1WCMB 4G7ZC 1LTTD 4OO1H 3S1NB 3A8IE 2ZXOA 3FPUB 5HURA 3P7JA 1CA6A 5M5YB 1TQOA 4ZKCB 4R9WA 1DD2A 4KY7A 2J4XA 2QILA 4NKLA 1BXTA 1IL8A 1EY4A 2ZXPA 3IFDA 3VYRA 1EY7A 2AWNA 2WKCA 2WINB 1GUNA 1XX8A 2NN6G 1ENAA 1HQRD 5KYLA 5ELFA 3TP5A 1JE4A 5CYUA 4QB4A 5JOBA 4I65A 2RQXA 2WAQB 1O7YA 1SJHD 1F9PA 2D2CC 4HMJA 3ZYYX 4K2LA 2K28A 5FLXL 2K04A 3R3OA 1HXYD 1EYDA 3DEOA 4IFDI 4R8NA 2F0DA 2EYPA 3AMUA 3J81L 1D2BA 1WTWA 2ICEC 3SK8A 4C3HB 3EQLC 1FNWA 3KK7A 3R2IA 4RAUC 1HCZA 1G6ZA 4CGYB 2EYJA 3S2HB 3OPOA 4G57A 1JOQA 1FNVA 1JWUD 2XIWA 3BG3A 4YIJA 4DNRB 1HUNA 3F2UA 3I4LA 5DM63 2KCNA 3V2TA 1I4PA 1GHJA 4F87A 2K05A 1G2SA 1IW7C 3OSOA 1CHPD 4V190 2R6GA 4KKUA 3HS0C 4KKSA 2NUCA 4XXEA 3H94A 4G4KA 2JP1A 2JA6B 2A68D 1F9RA 2KA7A 3OWEB 5EBCA 1CI3M 4IFDJ 3FPPA 1B4OA 3PUWA 2HCIA 2SDFA 1WTVA 1MSHA 4IURA 2J7ZA 1A15A 4K6LA 3MXNA 4X3UA 1Q1EA 4ILWA 1H9MA 1EFID 1GHKA 1H9JA 3TBIB 2B2VA 2CW0C 1I4GA 3D6WA 3C3LA 3MXPA 1GUTA 3S16B 1NAPA 1EL0A 2EY1A 5I2YA 1PTOD 3K5OA 2FJ2A 1IKLA 4KJOA 1BF4A 4HEDA 3OIQA 5EKKA 2FINB 2PZTA 5K36H 1TS4A 3R93A 3T51B 1I4QA 1ZXTA 1F77A 1PRTD 3HEJA 1GUGA 4RGTA 2L11A 5DEHA 5JPMC 1IYVA 1DXMA 3Q24A 2O5JC 5EPLA 3I90A 5FLXE 2EY5A 3HOYB 1G8ZD 4G7HC 4IUQA 5JVH3 3J81E 5KEEA 4K2KA 4HSPA 4PV1C 2NB0A 3MHBA 4CJ2C 3SEBA 2KVMA 3K5MA 2WP8J 4KI0A 3HKZB 3TP6A 2MPMA 1EYAA 1SE4A 2F0SA 1UNSA 2L12A 3M3YB 4FF2A 5IGBA 1QWYA 1CT1D 2K5QA 5C0XH 1R4QB 2ZT9C 4CKBA 3R2TA 3VR3A 1TS5A 4FNFA 4OL7A 1LV9A 5CBAE 1XWEA 4A3KB 1RF2D 1UUPA 3Q0AA 3MXGA 2KUMA 3IAYA 2H1EA 4I7ZC 4PMBA 4ZUIA 3K6OA 4XYOA 1CQFA 5C3EB 1V1PB 3NUCA 2PYKA 1ONLA 4Q0FA 1SBBB 4RH6A 3TP8A 1WTOA 4OO1I 2BA1A 1B44D 1STGA 1I4XA 3NXWA 2NN6H 3BVGA 1CHQD 2WB1B 2IPKD 1KAAA 2OT2A 5IGEA 1DCZA 2B2YC 2EY6A 1WTRA 5D14A 4ZAIA 4ABNA 1PZID 1I3QB 3BVZA 1CZWA 1GOZA 3I72A 5C4ZA 4B08A 1NUCA 4IUPA 5EQ0A 4IUVA 2C9OA 1TY0A 1F2ZA 1VMCA 5KGUA 2K5DA 2K33A 1QG7A 3MC0B 4EQOA 2MUYA 1HA5A 2Z8LA 1PLFA 3K58A 1F2YA 4XQNA 2SNMA 3RZOB 4JBWA 3KLRA 5E4WC 4K8JA 2G9HD 2XSCA 1KABA 4OIKA 2IT1A 3MVVA 4ME5A 4RKLA 1UEAB 5J39A 1SFOB 3NK9A 1TY2A 5I9OA 4X3SA 1IYUA 1MI2A 4RA8A 2BA0A 1K8MA 1QB5D 4RCNA 2F0IA 3HOWB 1BR9A 1D6EC 1PFNA 3E5SA 3E0JA 1FR3A 3NTKA 2JE6I 2DN8A 2Q8TA 1ESRA 1SYDA 4IALA 5ELCA 1B53A 1RODA 1II3A 4TSSA 1Z6HA 4TQUS 1ICWA 1TWAB 4RGOS 4IUNA 2B8FA 5CORA 3U9SA 1KNEA 1EOTA 1B50A 2X69A 2VNUD 1ENFA 2A68C 3EFXD 4A3FB 1QE6A 4FVMA 4HCSA 3H3VC 1KNAA 1WTXA 3Q6SA 4KJNA 5D3DA 2XNAC 4KN4C 2F0MA 2F0LA 5I4DA 4DK0A 5JPNC 3FKIB 3NQTA 2RBMA 5CV7A 1GUSA 5KNDA 2A73B 3D8GA 1BDOA 1F9QA 4PMCA 2EJFC 4C3JG 1PYWD 4HSVA 3RZDB 2F0UA 3EA6A 1PTOC 1STEA 1AW7A 4FF4A 3M7GA 1Q3LA 4HAEA 1BCPF 3PUYA 2ENBA 5EPJA 2V4DA 1TS3A 1QNUA 5ISRA 1HUMA 1T5XD 3T56B 2WIIB 4LMQD 2YYZA 2F0VA 2FFKB 2RDGA 4WJWA 2TSSA 3S14B 2QKIC 3H0GB 1H9RA 3NWTA 1A3TA 4HMIA 4B9WA 1J8IA 2KOLA 1DZ1A 1LT3D 3DXJC 2RDFA 3RUZA 4ZRZA 2ICIA 3I91A 2A69D 1YNND 4AYBB 2E74C 1JB3A 1PTOH 1B1ZA 3QJYA 2AQ1B 2G9DA 2B2VC 3QB3A 2E2HB 2F0JA 3WOEA 1LTID 4N9PA 1I50B 3M85A 1STYA 3FVQA 5C0XI 2XRQD 1JCKB 3LX0A 1OXUA 2A6HC 4F88A 1C8CA 2BE5C 3FEWX 2AQ3B 3S9WA 3T53B 2JXMB 3ND8A 1JORA 2MJ8A 4OHJA 1LLRD 4C3IG 4L63B 4RKBA 1SEBD 1C48A 2PZUA 1DOMA 3QWNA 5EPKA 3CKIB 4DU9A 4FXDA 1SNQA 3L9AX 3NTIA 5CV9A 4X3TA 2PCFB 2O4XA 5DAUA 2NN6I 1RTNA 4A93B 3VYUA 2Q8RE 5CBEE 4TKOB 3VA5A 1SYBA 3A7LA 4C3HG 3T4AC 5C0XJ 1BNZA 3PMFA 1SNOA 1U4RA 3D4DA 2MGSA 4ULLA 5E4XA 1MBYA 2CHBD 1DYQA 1E0BA 3MA2B 3H6MA 4F7XA 1Q1BA 1EWHA 4DXFA 3E6ZX 3S17B 1VDZA 2PQEA 2RVLA 2EY2A 2CQAA 4P2CB 1TWGB 5M5WB 5C4XB 1K83B 1DJRD 1X3PA 2KJXA 2IX3A 1S5CD 1V1PA 1S5FD 3S1RB 2EYMA 5F2DA 4QIWB 1VF7A 2Z4IA 4BA2I 3A8JE 3GTQB 5DNFA 4XT3B 3S2DB 5M5XB 1RJTA 3R8BA 1I4RA 1IKMA 1WTQA 3PIO3 4CKEA 3ND9A 5BN3A 5FO7B 1YNJD 4DAPA 4KD3A 1LTSD 4RCOA 1JWSD 1PMRA 1U9RA 3BDCA 4FYDA 2HQEA 3BZDB 5I9PA 1HTLD 3N6RA 2M9VA 3GTKB 2QDBA 4LK1C 5G3LD 1EEID 3HGBA 3X3NA 4XIGS 3TZDA 4MHEA 3C2PA 2Q8IB 2PNRC 5IOCA 2L5TA 1G91A 2K03A 3GV6A 1SNCA 4RGNA 1V43A 1E2VA 5FOBB 5I6WA 2NTTA 1Y1WB 4BBSB 1FD7D 1F2MA 1A2UA 3VR2A 2E75C 2ZXRA 4E6IA 2DY7A 4C2MB 2JYOA 2NBFA 2EZVA 4ZYSA 4O42A 1S5DD 2AUJD 1A3UA 1EY6A 2EOTA 2OF1A 4EQNA 3WDNA 1F9SA 1U4LA 2KCCA 3X3MA 2NVXB 3GQBA 3CRKC 5BN4A 3KLSA 3QO2A 2QCPX 5TSSA 2F0PA 2PPBC 2CVRA 3EROA 1G2TA 3K0YA 2L55A 1FYCA 4XT1B 3KBXA 1STHA 3P20A 2LS01 1Y8OB 1H9KA 2B2UA 1CFMA 1XYIA 3KF8A 3IL8A 2F0OA 1AN8A 2K1BA 3A8KE 5IIFA 1U4PA 1FGBD 2YU9B 2E2DC 2A69C 1YNNC 1AEXA 2MHVA 3NWSA 3RD4A 1SNPA 2B2WA 4K5VA 5E3FA 2A6HD 2B8GA 2BE5D 1Z7TA 1KTKA 2EYOA 1AZPA 3AU7A 3FDTA 2VUMB 2XRSD 2F0NA 1V8QA 3N52A 3VR5A 4K5WA 1EWCA 1HPCA 1ZYRD 2F4IA 1UAPA 1NSNS 4EQPA 2K32A 3W3AA 4KKTA 3A54A 5KRUA 3V05A 4BA1I 5FO9B 1STAA 1B9NA 5T1GA 5D3IB 4KV6A 1D1IA 1QNKA 3M7NA 4K14A 4J6HA 5I6YA 4QCLA 2EVBA 1B2TA 3HZXA 2SOBA 3QOJA 5C44B 1DOKA 3LNNA 3L3OC 2RA4A 1TVXA 5JEAJ 2PZWA 5KIXA 1D5ZC 3OW7A 3VA7A 4IZ8A 4DA2A 3TN2A 1O80A 1SSOA 5LL6S 1VMPA 2D62A 3GTPB 4C56C 1LT4D 1LO5D 5FKAC 4IFDH 2K5WA 2C5CA 4CJ0B 4FO2A 1I6HB 5M3MB 5C5MA 5CV8A 2K6AA 5IGGA 1PZKD 1PTOF 1EQTA 1IHZA 1NR2A 3D6CA 4H7BA 2JEBI 2JA5B 5C3XA 5T1IA 4DAVA 1W6JA 1PFBA 3MTSA 3MEHA 1PRTF 1Q12A 2E2IB 3BDLA 2PO4A 3WOFA 4PNYA 1JC7A 3PO2B 3Q22A 2F0KA 3PUVA 1KDBA 4IQZA 3TSSA 4DXGA 1YNJC 3I70A 3HRZC 3GV3A 1JOKA 2Z4HA 3ITPA 3BS1A 2IX0A 2NVYB 1X3QA 2EDGA 1ESFA 2X6GA 4DN4M 1SYEA 3Q23A 1QOHA 3O13A 4XQQA 4XTCS 5JVG3 3DEPA 3GTGB 3ERQA 4CHTB 5LL6X 1EY5A 2FHTA 4A3EB 5CV4A 3URYA 1D5MC 1VCIA 3K57A 3FRPB 1BUVT 3BVMA 3NBHA 4PMWA 1RTOA 1K8OA 5CC4A 3CQZB 3PV0A 1E2WA 1HQMC 3VR4A 5FO8B 2JSOA 2L0CA 3RMHA 4U68A 4QUFA 4V0BA 2EJGC 2IJ0A 1ILQA 3I4NB 4A3MB 1CQVA 1D1KA 3BYTB 4DK1A 3LWEA 5E1FA 3HOXB 1Y1VB 4C1NI 5EKIA 3AB9A 4H0LC 4WRDA 1HHVA 5C4HA 3GD7A 4FXGC 1D5XC 4JK1C 4RHRA 1BQQT 3NQIA 3W2DA 4UAIA 5M9OA 3NSWA 4KHVA 2E76C 1SNMA 3RLFA 2O2LD 5D65A 5COYA 1KLUD 4DAYA 3DWQA 5I2XA 2XWJB 2A74C 1XXGA 2AWOA 2KHSA 4CBVA 4QUCA 1I6VC 4Q5VA 2SNSA 3GTMB 2Y0SB 4FF3A 3ONAB 1TS2A 2L1BA 5M3FB 2VB2X 2JEAI 3JAML 1LT5D 4K8IA 1SAPA 2E2JB 5C4JB 2F0FA 1T5EA 1TR5A 4M1UB 2HDMA 4ZK9B 1QJOA 1SNDA 5FK9C 3S15B 4XDXA 4A3IB 1X32A 4HTHA 3IKJA 5A35A 3C1EA 1VF5C 1XTCD 4OIJA 2ID0A 1OXXK 1MD2D 1EY8A 4KMUC 3C46A 1OO9B 3V96A 1ZYRC 2XN9C 4NP5A 2Z1CA 3P75A 3NTHA 2RSOA 1HRJA 3I4MB 1DOLA 2KEDA 4KY6A 5IT9L 1GUWA 1RHPA 4ZQ3A 3GTOB 3FMCA 3S1MB 3D4RA 1AZQA 2XWBB 3G6JB 2B2UC 1TWHB 2EYFA 1LTBD 3DUZA 1LTRD 2R93B 5J22A 4J8QA 5JJZA 1ENCA 4HN7A 3GO5A 4A3JB 1STNA 3HP3A 1W6KA 5ELDA 2BOSA 1OXVA 3SR1A 2EE1A 3QG1A 2JA8B 2B2WC 4C3IB 1H9SB 4K6DA 1AP0A 4LAAA 4PQXA 2F1MA 1A6XA 4HR7B 1TT2A 2R92B 1QCBD 2BDOA 5ELBA 4BY1B 4B9XA 3SHLA 2NTSA 2NZ1D 3UI2A 4IUTA 4IFDG 3HOVB 2PW5A 4N9TA 3TMEA 2F0GA 4G7OC 2FMMA 3M4OB 1TU2B 3LWUA 5IGCA 3SK6A 3MAQA 1EY0A 2GA4B 3TZUA 2F03A 1OXSC 1C4QA 3OWFA 2BDNA 3NBIA 3I3CA 1L0XB 2RDHA 1GUOA 3K5LA 5CGKA 3NP8A 2F3VA 1CZGA 1SDFA 5CR3A 3JAME 1Z47A 3GTLB 1ZEQX 2QF7A 5BN5A 1B9MA 2O5IC 2IWHA 4O1NA 1JOOA 5C6AA 2IW3A 4WORA 4Z9CB 3NHHA 4MN3A 3K59A 4EGVA 4L8JA 2F0EA 5K5PA 5JAVA 2SEBD 3HOZB 3GTJB 1KDCA 1JICA 1LTAD 4MIUA 1S5BD 4DGZA 1EY9A 1J9OA 4ID6A 3CHBD 4LJZC 3P1HA 2DNEA 5IT9E 4A3DB 4GZYC 2RSNA 2HUGA 4A3GB 2IL8A 4TRDA 1SMYD 1O7ZA 1EIHA 3G7LA 1EZ8A 4BWGB 5KYIA 2F3WA 2A6ED 3SXHA 2OEOA 2B39A 2B2TA 3GP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENB A;  2F0G A;  2PZU A;  2PZW A;  1EY5 A;  5KIX A;  1A2T A;  1SND A;  3TP5 A;  5CV4 A;  1KDA A;  1U9R A;  2F0I A;  3BDC A;  4IZ8 A;  4KD4 A;  4QB4 A;  5ISR A;  4OL7 A;  2F0O A;  2HQE A;  5IGC A;  4HTH A;  3SK6 A;  5JOB A;  5KYL A;  4DU9 A;  3C1E A;  5I9P A;  1SNQ A;  3DMU A;  5IIF A;  1SYG A;  4I65 A;  3E5S A;  1EY0 A;  5CV9 A;  2F0V A;  3MXP A;  5CC4 A;  4HMJ A;  2WAC A;  1EY8 A;  2EY1 A;  2O4X A;  2QDB A;  4K2L A;  1EYC A;  5DAU A;  5NUC A;  1A3V A;  3R3O A;  1EYD A;  4PMB A;  5IGD A;  3OWF A;  3EVQ A;  4QF4 A;  4ZUI A;  1A3T A;  1AEX A;  4HMI A;  4KJO A;  4NP5 A;  4B9W A;  4R8N A;  1RKN A;  2F0D A;  2EYP A;  1SYD A;  4IAL A;  5C5M A;  3P75 A;  5CV8 A;  3SK4 A;  3VA5 A;  4F8M A;  5IGG A;  5CGK A;  1SNP A;  1SYB A;  5IOC A;  3NP8 A;  3NUC A;  1II3 A;  4K5V A;  5EKK A;  4ZUJ A;  2PYK A;  2F3V A;  3SK8 A;  5C3W A;  1IHZ A;  5CV5 A;  1STB A;  5CR3 A;  5CV6 A;  5E3F A;  2PZT A;  3D6C A;  2RDF A;  4H7B A;  4KY6 A;  5J1Z A;  3TP8 A;  3HEJ A;  1SNC A;  3PMF A;  2EYO A;  3U9O A;  5E1F A;  2F0H A;  3RUZ A;  1SYC A;  5C3X A;  2EYJ A;  2RKS A;  4IUN A;  2PW5 A;  1SNO A;  3OMC A;  4N9T A;  4ZQ3 A;  5I6W A;  1STG A;  5DEH A;  2EYH A;  1SYF A;  4G57 A;  3NXW A;  1JOQ A;  1JOO A;  1F2M A;  3D4D A;  1A2U A;  5KRU A;  2F0N A;  3T13 A;  2EYF A;  4S3S A;  3MEH A;  3T16 A;  4WRD A;  4KTA A;  1KAA A;  4K5W A;  4YIJ A;  5C6A A;  5C4H A;  4E6I A;  2M00 A;  3QOL A;  4WOR A;  3NHH A;  5IGE A;  5J22 A;  1EZ6 A;  4KY5 A;  4ODG A;  2EY6 A;  3V2T A;  2F0E A;  3OMG A;  4KJN A;  5K5P A;  4QMG A;  1ENC A;  1NSN S;  2EY5 A;  3QB3 A;  3BDL A;  3H6M A;  5JAV A;  2F0J A;  2PW7 A;  4F7X A;  4EQP A;  4PNY A;  4N9P A;  5M9O A;  1KDC A;  4KHV A;  1STY A;  3OSO A;  1SNM A;  1A3U A;  1EY6 A;  2F0M A;  2PQE A;  4MIU A;  2F0K A;  2EY2 A;  1STN A;  2F0T A;  2F0W A;  2F0L A;  5C4Z A;  2OF1 A;  1NUC A;  5IGF A;  1STA A;  5C5L A;  2LKV A;  1KDB A;  4EQN A;  5KEE A;  4DGZ A;  1EY9 A;  3SR1 A;  3NQT A;  4NMZ A;  5HUR A;  1F2Z A;  2RBM A;  4ID6 A;  4J1M A;  2NUC A;  4K2K A;  5CV7 A;  4EVO A;  2KHS A;  2EYM A;  5IOD A;  1TQO A;  4K6D A;  3SK5 A;  2EXZ A;  3P1H A;  5KGU A;  3MHB A;  4KV6 A;  2F0Q A;  4LAA A;  5F2D A;  1JOK A;  3EJI A;  4K14 A;  4EQO A;  2SNS A;  3D8G A;  5EGT A;  5HGT A;  4J6H A;  2KQ3 A;  4PMC A;  3ITP A;  3LX0 A;  4TRD A;  5I6Y A;  3TP6 A;  4KY7 A;  1TT2 A;  2F0P A;  1F2Y A;  4NKL A;  3D4W A;  2SNM A;  1EYA A;  3TP7 A;  3ERO A;  3S9W A;  2F0S A;  1EZ8 A;  1EY4 A;  3DHQ A;  2F0U A;  3HZX A;  1SYE A;  4K8J A;  1EY7 A;  2SOB A;  3SHL A;  4B9X A;  3MZ5 A;  3QOJ A;  1KAB A;  5IGB A;  1JOR A;  3MVV A;  5KYI A;  4ME5 A;  5EKL A;  4K8I A;  4RKL A;  1STH A;  2EYL A;  2F3W A;  5J39 A;  1ENA A;  2OXP A;  4RKB A;  4NDX A;  1EQV A;  2F0F A;  3NK9 A;  2OEO A;  3SXH A;  3C1F A;  4DFA A;  5I9O A;  3ERQ A;  1TR5 A;  4DF7 A;  3TME A;  4KD3 A;  4K5X A; 
#chains in the Genus database with same CATH topology
 2HHH L;  1SRU A;  2E2H H;  4H44 C;  4A3B B;  5AFW A;  1I50 H;  1KDA A;  2I07 B;  2R3Z A;  1YJN A;  2AQ2 B;  4LF7 L;  1SYG A;  3UE0 A;  2JA7 B;  1PFM A;  3H3V I;  1RD9 D;  2HIV A;  3KLS X;  1YIJ A;  2K7V A;  4DK3 C;  1EYC A;  1L0Y B;  1A3V A;  4BS9 A;  1JB7 A;  3VR6 A;  1KXL A;  1TII D;  3J80 L;  3K7A B;  4RGM A;  2QEX A;  5LHY 1;  5ELE A;  3SK4 A;  1CA5 A;  1OXT A;  3NPP A;  2R7D A;  4IPC A;  4ZUJ A;  1RDP D;  1HTP A;  1DM0 B;  4IN3 A;  4LF6 Q;  5IY0 A;  3KBG A;  1LAB A;  3CCR A;  3ULJ A;  1SYC A;  2Z0S A;  2RKS A;  3BDO A;  3OMC A;  1CTM A;  3CRL C;  2LY7 A;  2HCC A;  2PNH A;  4J15 A;  4JYA Q;  1HNW L;  3RR5 A;  2UXB Q;  4MTK A;  3T16 A;  5GAH C;  3U4Z A;  3W5O A;  2M00 A;  3EN2 A;  3QOL A;  3CU7 A;  4KN7 C;  1L2F A;  4KY5 A;  3OTO Q;  4A75 A;  1RCV D;  1Q90 A;  4RWS C;  3CCQ A;  3G6E A;  1PHJ A;  3OMG A;  1QUQ B;  2RHQ B;  1NNX A;  2A19 A;  2PW7 A;  1EU3 A;  1P8L A;  3HFZ B;  4XQJ A;  3L2P A;  4CKC A;  4OWW B;  3S1M H;  1QIL A;  1CK1 A;  5IYD H;  5IGF A;  4GKJ L;  4A93 H;  1GJX A;  1OTC A;  4EVO A;  2I46 A;  3SK5 A;  2YTX A;  2YTV A;  3EJI A;  3HG9 A;  1IBM Q;  2N49 A;  4TVA B;  3K7U C;  1J5E Q;  1SJE D;  4R4T A;  5A2Q L;  2L15 A;  3K5N A;  2VB3 X;  4X3K A;  1BCP D;  2NVT B;  2XVS A;  3QIA A;  1KAW A;  2LSS A;  5JEA G;  5C44 G;  4YCW A;  1LTG D;  1VQF A;  1LTL A;  1X6O A;  1B3A A;  2OXP A;  1FNU A;  4P72 A;  1V9P A;  2N88 A;  3C1F A;  3DWP A;  3M9B A;  2R7Z B;  3PO3 B;  1KD1 C;  2MP1 A;  2PMZ E;  4K5X A;  1JQY D;  1A2T A;  3KF6 A;  1N32 Q;  1PTO B;  4H13 C;  4RHS A;  5KNB A;  3S17 H;  1LUZ A;  1TWG H;  3DMU A;  5C4X H;  5M5W H;  1K83 H;  3E0E A;  4YY3 L;  2AHO B;  3A55 A;  2KEC A;  3D31 A;  4UDU C;  2EPB A;  4OO1 G;  2DNC A;  3S1R H;  1E2Z A;  1M4V A;  2LMC B;  1HA6 A;  1I4H A;  4QF4 A;  2NVQ B;  2WKD A;  1PRT B;  1TWF B;  1RKN A;  2K01 A;  5KNC A;  1G6P A;  4B3M Q;  4CJ1 B;  1W2B A;  3BU2 A;  1K8A C;  1X54 A;  3HOW G;  5G3L F;  2UXB L;  5FLM H;  4JI0 Q;  2JA5 G;  1Y69 U;  1GXD C;  4JG2 A;  2B63 B;  4FP5 D;  3S2D H;  1LYL A;  1NR4 A;  3BYY B;  5M5X H;  2PMZ B;  2EYH A;  1JR0 D;  3H09 A;  1XJV A;  3VYT A;  2CH4 W;  4KK7 A;  4KTA A;  1MIU A;  3HOU B;  1EZ6 A;  4H02 A;  4PZ7 A;  2CCZ A;  2DY8 A;  2F3I A;  1SE3 A;  2K5H A;  3UE1 A;  1VQ9 A;  5DM7 3;  4OGQ C;  1SXT A;  3OHX C;  4JI3 Q;  1E1T A;  3J80 E;  3MXN B;  1VQN A;  3GTK H;  4C1N K;  1PVO A;  2IHE A;  3DM1 A;  2HDL A;  2F0T A;  2F0W A;  2Q2H A;  3PUX A;  2K52 A;  3AEV A;  5C5L A;  3BZC A;  2LKV A;  5AJ3 L;  3I73 A;  1IBM L;  3H91 A;  2X6L A;  3FP9 A;  1MSG A;  4NMZ A;  3OYY A;  3TRE A;  1J5E L;  4J1M A;  1PXU A;  4P75 A;  2F0Q A;  4DR2 Q;  1BBX C;  4P74 A;  5HGT A;  2KQ3 A;  1CKN A;  2RCN A;  4IPD A;  3SVM A;  4DAM A;  2CWP A;  5E7N A;  2Q2U A;  2L4N A;  2N55 A;  3D4W A;  3AFP A;  3TP7 A;  1YZ6 A;  3SDZ A;  1O78 A;  1IW7 D;  4DV6 Q;  3TDQ A;  1CM9 A;  2D5D A;  3DHQ A;  1TWC B;  1Y1W H;  3TRZ A;  4LUV A;  2LFN A;  3MZ5 A;  2D9U A;  4BBS H;  1V1O A;  4BBR B;  2LXJ A;  2EYL A;  1R9T B;  5CMD A;  4NW2 A;  4C2M H;  4NDX A;  1EQV A;  3KUP A;  3BZK A;  4Y7N B;  1NE3 A;  1BCP B;  4DF7 A;  4QJF A;  4OWT B;  4XYQ A;  2K5V A;  3I8Z A;  1K0S A;  3MWY W;  1CSQ A;  5GAD C;  5EBD A;  3VDY A;  2WV6 D;  2M2L A;  4X66 L;  3A7A B;  4ZKB B;  1H9S A;  1L1O B;  2IX1 A;  3IFT A;  3U50 C;  5NUC A;  1IL2 A;  3E9H A;  5IGD A;  4OX9 Q;  3PUZ A;  2AUK A;  3EVQ A;  2NVX H;  5A2Q E;  1HZB A;  1ASZ A;  4OWX B;  4IOC A;  3A56 A;  2KEE A;  3CCM A;  4RFB A;  4IJL A;  2EJM A;  3NE5 B;  4A3M G;  3I4N G;  1XPU A;  4A3L H;  2QEJ C;  1SE8 A;  1AFP A;  1GD7 A;  1STB A;  5CV6 A;  3MFY A;  4IUU A;  5J1Z A;  4ZLT F;  2D0O A;  3HOX G;  1Y1V G;  1NCV A;  1PH1 A;  2F0H A;  2FMC A;  4JI7 Q;  4U67 3;  2CW0 D;  3J7A V;  1QZG A;  3CCE A;  1Q8I A;  1WD0 A;  1ILP A;  4S3S A;  1BOS A;  4DUZ Q;  2PQA A;  4JI3 L;  2K50 A;  3OOC A;  1HFN A;  4WFN 3;  3ER0 A;  1SMY C;  1WVL A;  4JI6 Q;  1KLG D;  4JCV E;  4MZ9 A;  4B3T Q;  2YU9 H;  3J7Y W;  4DV5 Q;  4M8A A;  3S1Q B;  4AH6 A;  1QZH A;  3MXU A;  1CKO A;  4KHZ A;  4FXK C;  1Y8P B;  4L6T B;  2TMP A;  2A6E C;  5BR8 Q;  3SE0 A;  1PDQ A;  2F52 A;  3D3R A;  5IOD A;  2EXZ A;  2UU9 L;  3J7A F;  5J3B A;  1G29 1;  1ML0 D;  2Y0S G;  4ME3 A;  2K4K A;  1TKW B;  4DV6 L;  3CP0 A;  5EGT A;  3I55 A;  3RN2 A;  4HCE A;  1PRT C;  4B3S L;  4O2D A;  4C3J B;  5K36 G;  2OTJ A;  3VYS A;  2VUM H;  5M3F G;  3OIP A;  1ZKO A;  3CC2 A;  2A5H A;  5EKL A;  2WFW A;  1DON A;  1EIF A;  1HFG A;  4CDC C;  2VQF L;  2VXW A;  1R4P B;  4QL5 A;  4DFA A;  1PH7 A;  1ET9 A;  1WTP A;  4A3I G;  3AFQ A;  1M8A A;  4FF1 A;  4KD4 A;  2ZJQ A;  1ET6 A;  4OX9 L;  1LAC A;  4KHP Q;  2B2Y A;  4UHV A;  3PIP 3;  1Y8N B;  4POG A;  1SE2 A;  2WAC A;  2H4O A;  4LF8 Q;  5IP7 G;  3L7Z C;  2R61 A;  1MGS A;  2NYZ D;  3KOJ A;  1WD1 A;  4F8M A;  1VQI A;  4GNX B;  4JI7 L;  1F2L A;  2EQS A;  2ZJR A;  4GLA C;  3I4M G;  3DWA A;  5C3W A;  5CV5 A;  4R8I A;  1EU4 A;  2J0T D;  3M4Y A;  1JWM D;  1S5E D;  3RLN A;  2MFI A;  4LFA L;  4DR1 Q;  4DNT B;  1O7L A;  1PZJ D;  1EIG A;  5EJW A;  5JEA H;  3U9O A;  5C44 H;  1BO0 A;  3CMA A;  2NWG A;  2B2T C;  1SYF A;  3J81 j;  3T1H Q;  4A93 G;  1X3E A;  3MFG A;  3T13 A;  5C0X G;  4B3T L;  2R93 G;  1E1O A;  4DV5 L;  3PF5 A;  1S4Z A;  2I5H A;  1EEF D;  1LT6 D;  1I94 L;  4ODG A;  2BCO A;  4QMG A;  2L9H A;  4BY7 B;  5DLQ E;  1BCP C;  4A3J G;  3GTP H;  1U4M A;  1U5K A;  1WCM B;  2HIX A;  1KRS A;  4HIO A;  4G7Z C;  1LTT D;  4OO1 H;  2VL6 A;  4IPG A;  1CKN B;  3S1N B;  3A8I E;  2ZXO A;  3CW2 C;  3FPU B;  2JA8 G;  3I4O A;  4DK6 C;  5HUR A;  1I6H H;  1GKH A;  5M3M H;  3P7J A;  1CA6 A;  2WAQ E;  1C7Y A;  5M5Y B;  1TQO A;  2BH2 A;  4ZKC B;  4R9W A;  3KFU A;  1DD2 A;  4LF4 Q;  2R92 G;  4KY7 A;  2J4X A;  2QIL A;  2JA5 H;  4NKL A;  2CWA A;  4BY1 G;  1BXT A;  1IL8 A;  1EY4 A;  2ZXP A;  3IFD A;  3VYR A;  1EY7 A;  2AWN A;  1HR0 W;  4L5R C;  2WKC A;  2WIN B;  2JN4 A;  1GUN A;  4HJA A;  1XX8 A;  2NN6 G;  1ENA A;  3HOV G;  4KHP L;  1HQR D;  1A0I A;  2E2I H;  5KYL A;  5ELF A;  4LF8 L;  2GN5 A;  3TP5 A;  1JE4 A;  5CYU A;  4QB4 A;  3PO2 H;  3UDX A;  3RLO A;  5JOB A;  4I65 A;  2RQX A;  2WAQ B;  1O7Y A;  1SJH D;  1F9P A;  2D2C C;  4HMJ A;  3ZYY X;  4K2L A;  2K28 A;  2NZH A;  5FLX L;  2K04 A;  3R3O A;  1HXY D;  1EYD A;  1N36 Q;  3DEO A;  4IFD I;  2N3S A;  2IY5 B;  3JC6 6;  4R8N A;  2F0D A;  4X65 Q;  2EYP A;  4UP7 A;  3AMU A;  3J81 L;  1D2B A;  1WTW A;  1C9O A;  2NVY H;  2ICE C;  3SK8 A;  4C3H B;  3EQL C;  4ALP A;  2PQA B;  1FNW A;  1K3R A;  3KK7 A;  2UXD Q;  3R2I A;  4RAU C;  4JI2 Q;  1HCZ A;  3CCS A;  1G6Z A;  4R4I A;  3F2C A;  2HT1 A;  4R1J A;  4CGY B;  2HHH Q;  1XNR L;  2EYJ A;  4CDD C;  4DV2 Q;  3S2H B;  3OPO A;  4G57 A;  1JOQ A;  1FNV A;  3GTG H;  1JWU D;  2MO0 A;  4IOA A;  2XIW A;  3BG3 A;  4YIJ A;  4DNR B;  1HUN A;  3F2U A;  3I4L A;  4A3E H;  4LF7 Q;  5DM6 3;  1D7Q A;  2KCN A;  4LW1 A;  4RG1 A;  3V2T A;  1I4P A;  1GHJ A;  4F87 A;  2K05 A;  1G2S A;  1IW7 C;  4K0K L;  2Q2I A;  4DR4 L;  3OSO A;  3CQZ H;  1E24 A;  1CHP D;  4JBJ A;  4V19 0;  1MKH A;  4LF4 L;  2R6G A;  4KKU A;  3HS0 C;  4KKS A;  2NUC A;  1JMC A;  2DJG C;  4XXE A;  4A3D G;  3I4N H;  4A3M H;  3H94 A;  4A3G G;  1XPR A;  2OCE A;  4G4K A;  1XMQ Q;  2JP1 A;  2JA6 B;  2A68 D;  3S1Q H;  1F9R A;  3CPF A;  2V1C C;  2KA7 A;  3NEL A;  3OWE B;  1Q82 C;  3G71 A;  5EBC A;  1HNW Q;  1CI3 M;  4IFD J;  3FPP A;  2UXC Q;  1B4O A;  3HOX H;  1Y1V H;  4GN3 B;  4UPA A;  1VQ8 A;  1RIP A;  1CSP A;  3PUW A;  2HCI A;  2SDF A;  1WTV A;  1MSH A;  1I5F A;  1M1K C;  4IUR A;  2J7Z A;  3GDE A;  4QGU A;  1A15 A;  4K6L A;  3UDG A;  1UE5 A;  3MXN A;  4X3U A;  1Q1E A;  4A3B G;  4GKJ Q;  4ILW A;  3A74 A;  1K28 A;  1H9M A;  2N78 A;  1N36 L;  1EFI D;  1A62 A;  1GHK A;  1H9J A;  3TBI B;  2JA7 G;  2B2V A;  2CW0 C;  1I4G A;  3D6W A;  3C3L A;  3MXP A;  1GUT A;  5GQO A;  3S16 B;  1NAP A;  1EL0 A;  2EY1 A;  5I2Y A;  2Q2T A;  2RHS B;  3CC7 A;  1PTO D;  4JOI A;  2KCT A;  3K5O A;  2FJ2 A;  1IKL A;  4KJO A;  3GTM H;  2UXD L;  1BF4 A;  4HED A;  4ZCK A;  1EIY B;  3OIQ A;  3PIP A;  4DV2 L;  5EKK A;  2FIN B;  2PZT A;  5K36 H;  1TS4 A;  3R93 A;  3T51 B;  4EQ5 A;  1I4Q A;  1ZXT A;  5M3F H;  1F77 A;  1PRT D;  3HEJ A;  1CUK A;  3HKZ E;  1GUG A;  3U4V A;  4DKA C;  4RGT A;  1X3F A;  2E2J H;  5C4J H;  2L11 A;  5DEH A;  5JPM C;  1IYV A;  1DXM A;  4JI8 L;  4YY3 Q;  3Q24 A;  3S15 H;  4A3I H;  2O5J C;  2MNA A;  3F2D A;  3KYH C;  5EPL A;  3I90 A;  5FLX E;  2EY5 A;  1L1O A;  3HOY B;  1G8Z D;  4G7H C;  2K75 A;  4IUQ A;  5JVH 3;  5LMU Q;  3RN5 A;  3J81 E;  2VUM G;  1HNX L;  1XMQ L;  5KEE A;  1PH5 A;  5IP7 H;  4K2K A;  2DJF C;  4HSP A;  3ERS X;  4PV1 C;  2UXC L;  2NB0 A;  3MHB A;  4CJ2 C;  3SEB A;  2KVM A;  3K5M A;  1YHQ A;  4GKK Q;  3I4M H;  2WP8 J;  4KI0 A;  1FVI A;  3HKZ B;  1L0W A;  2QW7 A;  3TP6 A;  4GOP B;  2MPM A;  1TXY A;  1EYA A;  1SE4 A;  2F0S A;  3GTO H;  1UNS A;  1HJP A;  2L12 A;  3M3Y B;  4FF2 A;  1TWH H;  5IGB A;  1QWY A;  1CT1 D;  4CDE C;  2K5Q A;  5C0X H;  2BH8 A;  3ZJY C;  2R93 H;  1R4Q B;  2ZT9 C;  1YJ9 A;  2R7Z G;  1IXR A;  3PO3 G;  1AE3 A;  1XTD A;  1PFS A;  3R2T A;  4CKB A;  2RF4 A;  3HKS A;  3STB D;  3VR3 A;  1TS5 A;  5AJ3 Q;  1MJE A;  1EUJ A;  4FNF A;  2WB1 E;  4NB3 A;  4A3J H;  4OL7 A;  1LV9 A;  5CBA E;  1XWE A;  4A3K B;  1RF2 D;  1UUP A;  1PH8 A;  3Q0A A;  3MXG A;  2JA8 H;  2KUM A;  4C3I H;  3IAY A;  2H1E A;  4I7Z C;  4PMB A;  3CD6 A;  1X56 A;  4ZUI A;  3K6O A;  4JBM A;  4XYO A;  3B6Y A;  1HNZ Q;  1CQF A;  3CCV A;  2R92 H;  5C3E B;  1V1P B;  3NUC A;  2PYK A;  1ONL A;  4Q0F A;  1SBB B;  5H1S E;  4BY1 H;  1E3P A;  4RH6 A;  3H15 A;  4YWM A;  3TP8 A;  4EX5 A;  2B63 G;  1WTO A;  1X3G A;  4OO1 I;  1E7Z A;  2BA1 A;  1HZ9 A;  1B44 D;  1STG A;  1I4X A;  3NXW A;  3HOV H;  2NN6 H;  3BVG A;  1CHQ D;  2WB1 B;  4X66 Q;  3HOU G;  2IPK D;  1KAA A;  5M3M G;  2B29 A;  2ZTE A;  2OT2 A;  5IGE A;  2KCM A;  1JJC B;  5LMU L;  3M4O H;  1DCZ A;  2B2Y C;  2EY6 A;  1WTR A;  5D14 A;  4ZAI A;  4ABN A;  3CPW A;  1PZI D;  1I3Q B;  3BVZ A;  2UUA Q;  1CZW A;  1GOZ A;  3I72 A;  5C4Z A;  4B08 A;  4GKK L;  1NUC A;  4IUP A;  5EQ0 A;  4HJ7 A;  4IUV A;  1KRT A;  2C9O A;  1Q86 C;  4GNX A;  1TY0 A;  1F2Z A;  2I5M X;  1VMC A;  5KGU A;  2K5D A;  2K33 A;  4YWL A;  1QG7 A;  3MC0 B;  4EQO A;  4LFB L;  2MUY A;  1HA5 A;  5ELN A;  2Z8L A;  1PLF A;  1VQJ A;  3K58 A;  3KLW A;  3GTL H;  1F2Y A;  4XQN A;  2SNM A;  3RZO B;  4JBW A;  3KLR A;  5E4W C;  5EAY A;  3FHW A;  3PO2 G;  3PIO A;  4K8J A;  2ZM6 L;  2G9H D;  2XSC A;  4DV0 L;  4BBR G;  4HID A;  1KAB A;  4OIK A;  2IT1 A;  3MVV A;  4ME5 A;  4RKL A;  1UEA B;  5J39 A;  4JI4 Q;  1SFO B;  3NK9 A;  1TY2 A;  2XTI A;  5I9O A;  4X3S A;  1IYU A;  1MI2 A;  4RA8 A;  1QVF A;  2BA0 A;  5LMN W;  4P73 A;  1K8M A;  1QB5 D;  2IHF A;  3GTJ H;  4RCN A;  3HOZ H;  2F0I A;  4GS3 A;  3HOW B;  4DR7 Q;  1BR9 A;  1D6E C;  2UU9 Q;  1PFN A;  3E5S A;  2CKZ B;  3E0J A;  1FR3 A;  1HNZ L;  4N8X 1;  3NTK A;  2JE6 I;  4AQY L;  1H95 A;  1IBL Q;  2DN8 A;  4B3S Q;  2Q8T A;  4A3D H;  1ESR A;  1VQC A;  1BBW A;  4A3G H;  1SYD A;  2MQH A;  4IAL A;  4JV5 L;  5ELC A;  1B53 A;  4A3E G;  1HR0 L;  4BXX H;  4LNQ A;  1ROD A;  1CKM A;  1II3 A;  4TSS A;  3U58 A;  1Z6H A;  4TQU S;  2VQF Q;  1ICW A;  1FL0 A;  3M4Q A;  1TWA B;  4GOP C;  1G51 A;  2E5L L;  2GVB A;  4RGO S;  4IUN A;  2B8F A;  5COR A;  3U9S A;  1KNE A;  1EOT A;  1WYD A;  1UE7 A;  1B50 A;  2X69 A;  2VNU D;  2UUA L;  4A3B H;  1ENF A;  2A68 C;  3EFX D;  4A3F B;  1QE6 A;  4FVM A;  4HCS A;  1EWI A;  3H3V C;  1KNA A;  4DV7 L;  4JW0 A;  3Q6S A;  1WTX A;  4KJN A;  1BKB A;  4CDF C;  1NMG A;  3J7Z C;  2JA7 H;  5D3D A;  2H5X A;  3A5Z B;  3IRB A;  2XNA C;  4MNO A;  3SGI A;  4KN4 C;  2F0M A;  2F0L A;  2R7F A;  1X55 A;  5I4D A;  4DK0 A;  5JPN C;  3K7A H;  3FKI B;  3NQT A;  1VQE A;  2RBM A;  5CV7 A;  1GUS A;  2C35 B;  5KND A;  4X6A H;  2A73 B;  4LFA Q;  1KQS A;  3D8G A;  1BDO A;  1F9Q A;  2MO1 A;  4PMC A;  3L0O A;  3TQY A;  3TS2 A;  2EJF C;  4C3J G;  1PYW D;  4JI4 L;  4HSV A;  3RZD B;  2F0U A;  3EA6 A;  3CCJ A;  2JK8 A;  1I94 Q;  1PTO C;  4LF9 L;  4P71 A;  3I7F A;  3MEF A;  1STE A;  1AW7 A;  3OW2 A;  3M7G A;  4FF4 A;  1Q3L A;  4DR7 L;  4HAE A;  1BCP F;  3PUY A;  4HJ8 A;  3JAM c;  2ENB A;  1B8A A;  5EPJ A;  5IWA Q;  5HY6 A;  2ZJP A;  2V4D A;  1TS3 A;  1QNU A;  5ISR A;  4AYB E;  2AMC B;  1HUM A;  4DR3 Q;  1T5X D;  1IBL L;  4UP8 A;  3T56 B;  2VQE L;  2WII B;  1A8V A;  4LMQ D;  2YYZ A;  2F0V A;  2FFK B;  2RDG A;  1RL2 A;  1EOV A;  4WJW A;  2CFM A;  2TSS A;  3S14 B;  1NMF A;  3I56 A;  2QKI C;  1S3O A;  3H0G B;  1H9R A;  3AQQ A;  3NWT A;  1A3T A;  4HMI A;  4B9W A;  1J8I A;  2KOL A;  3E3X A;  4APV A;  4DR6 Q;  1DZ1 A;  1YNX A;  1LT3 D;  3NEM A;  2NVT H;  3DXJ C;  2RDF A;  1FJG Q;  4R4C A;  5GAG C;  3RUZ A;  4ZRZ A;  2ICI A;  3I91 A;  5IP9 H;  5IT9 c;  2R7Z H;  1PA6 A;  3PF4 A;  3PO3 H;  2A69 D;  1YNN D;  4AYB B;  1K73 C;  3KJO A;  2E74 C;  1JB3 A;  1PTO H;  1B1Z A;  1VQB A;  3QJY A;  4OXP A;  2AQ1 B;  2G9D A;  2B2V C;  5IYC G;  3QB3 A;  2E2H B;  1B3Q A;  1WCM G;  2F0J A;  3WOE A;  1EFW A;  1LTI D;  4N9P A;  1I50 B;  3M85 A;  1BBU A;  1STY A;  4JOI C;  4DUY L;  2NVQ H;  3FVQ A;  4OEM B;  1VQA A;  3WWV A;  5C0X I;  1TWF H;  3PCO B;  2XRQ D;  3DM3 A;  3F8T A;  2I5L X;  3STB C;  1XNR Q;  4MTN A;  5HGQ A;  1JCK B;  3LX0 A;  1OXU A;  2A6H C;  4R4Q A;  4F88 A;  1C8C A;  2BE5 C;  3FEW X;  1SN8 A;  2B63 H;  4JVZ A;  2AQ3 B;  3TEH B;  3S9W A;  2AKW B;  3T53 B;  4LF5 L;  4JI1 L;  2JXM B;  2UUB Q;  5JJL A;  1V1Q A;  3ND8 A;  5IWA L;  1JOR A;  2MJ8 A;  4OHJ A;  3HOU H;  1LLR D;  4C3I G;  4DR3 L;  4L63 B;  4RKB A;  5JJK A;  4K0K Q;  1SEB D;  4DR4 Q;  1C48 A;  5FLX c;  1L1O C;  4DV4 L;  1GO3 E;  2ZTD A;  2PZU A;  5GRO A;  4L5T A;  1DOM A;  3F1Z A;  3QWN A;  5EPK A;  1X9N A;  3CKI B;  2WAQ G;  4DU9 A;  2P5Z X;  1SNQ A;  4FXD A;  3L9A X;  3NTI A;  5CV9 A;  4DR6 L;  3A0J A;  4X3T A;  2PCF B;  2O4X A;  5DAU A;  4LWC A;  2NN6 I;  1RTN A;  4A93 B;  3RNU A;  4GOP A;  1FJG L;  3VYU A;  2Q8R E;  5CBE E;  4UY8 C;  4TKO B;  3VA5 A;  1JJ2 A;  1SYB A;  3A7L A;  4C3H G;  2JJQ A;  3T4A C;  4L5S A;  5C0X J;  1BNZ A;  4IO9 A;  1HZC A;  1TWC H;  2JQO A;  4PZ8 A;  4QIW E;  3PMF A;  4BBR H;  1R9T H;  1SNO A;  4NXN L;  1VQL A;  1U4R A;  1AE2 A;  3D4D A;  3K8A A;  4Y7N H;  2MGS A;  4ULL A;  3DLL A;  5E4X A;  1MBY A;  2CHB D;  1DYQ A;  4POF A;  1E0B A;  3MA2 B;  3EIV A;  1YHA A;  4HJ5 A;  3H6M A;  2A1A A;  4F7X A;  1Q1B A;  1EWH A;  4DXF A;  4QY7 A;  3E6Z X;  2YTY A;  2A8V A;  2F4V L;  1W3S A;  3S17 B;  1VDZ A;  2PQE A;  2RVL A;  2EY2 A;  2CQA A;  4P2C B;  1TWG B;  1N8R C;  5M5W B;  5C4X B;  1K83 B;  1DJR D;  1X3P A;  2KJX A;  2IX3 A;  4O0A A;  1S5C D;  1V1P A;  1YBY A;  1S5F D;  3S1R B;  2EYM A;  2VZA A;  4IPH A;  1QVG A;  5F2D A;  4QIW B;  5ELO A;  1VF7 A;  2Z4I A;  4BA2 I;  3A8J E;  2UUB L;  1NBW A;  4DPG A;  2D0P A;  3HOZ G;  1SLJ A;  3GTQ B;  5DNF A;  2QDL A;  4JI8 Q;  4XT3 B;  3S2D B;  5M5X B;  1RJT A;  3R8B A;  1I4R A;  1IKM A;  1WTQ A;  3PIO 3;  4CKE A;  4N8F A;  1PV4 A;  3ND9 A;  5BN3 A;  1WI5 A;  1N34 Q;  5FO7 B;  1NY4 A;  1YNJ D;  4DAP A;  4KD3 A;  1LTS D;  4RCO A;  1HNX Q;  2CH4 A;  1JWS D;  1PMR A;  1U9R A;  3BDC A;  4BXX G;  3RZD H;  4FYD A;  1KHI A;  2HQE A;  3BZD B;  5I9P A;  1HTL D;  3N6R A;  2M9V A;  4GNX C;  3GTK B;  1JT8 A;  2XGT A;  2QDB A;  3ICE A;  4LK1 C;  5G3L D;  1EEI D;  3HGB A;  3X3N A;  4XIG S;  3TZD A;  4MHE A;  3C2P A;  2Q8I B;  2PNR C;  1K9M C;  1YEZ A;  3J80 c;  1EQR A;  3W1G A;  5IOC A;  4C3J H;  2L5T A;  1G91 A;  1SR3 A;  2K03 A;  4DV3 Q;  1Q81 C;  3GV6 A;  3CAM A;  1SNC A;  4RGN A;  1V43 A;  1E2V A;  5FOB B;  5I6W A;  2NTT A;  5LMN L;  1Y1W B;  1UE1 A;  2JA9 A;  4BBS B;  1FD7 D;  1F2M A;  1A2U A;  1Q7Y C;  3VR2 A;  2E75 C;  2ZXR A;  4E6I A;  2DY7 A;  2FXQ A;  4C2M B;  2HD3 A;  2JYO A;  1WOC A;  2GVA A;  4QQB X;  3HOY G;  1YIT A;  2NBF A;  4GN4 B;  3QR8 A;  2EZV A;  4ZYS A;  1UWV A;  4O42 A;  1S5D D;  2AUJ D;  1A3U A;  1EY6 A;  2EOT A;  2OF1 A;  4HIM A;  4EQN A;  3WDN A;  1XNQ Q;  3CCU A;  1F9S A;  1U4L A;  1XMO Q;  2KCC A;  3X3M A;  2NVX B;  3GQB A;  3CRK C;  4B3R L;  3HKZ G;  5BN4 A;  3KLS A;  2UUC Q;  3QO2 A;  2QCP X;  5TSS A;  2F0P A;  2PPB C;  1HH2 P;  2CVR A;  3ERO A;  3KJP A;  1N34 L;  1G2T A;  3K0Y A;  2L55 A;  2VS1 A;  1FYC A;  1KL9 A;  4XT1 B;  3KBX A;  1STH A;  3P20 A;  4LUZ A;  2LS0 1;  1LM0 A;  1Y8O B;  1H9K A;  3PGZ A;  4I7A A;  3J80 i;  2B2U A;  5IYC H;  4BY7 H;  1E22 A;  1CFM A;  1XYI A;  1WCM H;  3KF8 A;  3ULP A;  3IL8 A;  4JC0 A;  4A3K G;  2F0O A;  1AN8 A;  2K1B A;  3A8K E;  3S1N H;  1B7Y B;  1U4P A;  5IIF A;  1FGB D;  2YU9 B;  2E2D C;  4LFB Q;  2VY3 A;  1IYJ B;  5M5Y H;  2QA4 A;  2A69 C;  3CC4 A;  1YNN C;  5IP9 G;  1AEX A;  2MHV A;  4DV3 L;  3NWS A;  3RD4 A;  4NXM Q;  1VQ5 A;  4L5Q A;  5C3E G;  2ZM6 Q;  4DV1 L;  1NJI C;  1SNP A;  4DV0 Q;  2B2W A;  4K5V A;  5E3F A;  2A6H D;  2B8G A;  2BE5 D;  1Z7T A;  1KTK A;  3E9I A;  3G4S A;  2EYO A;  4X64 Q;  1AZP A;  3AU7 A;  1PYB A;  3FDT A;  2I0Q A;  2VUM B;  2XRS D;  1B70 B;  2WB1 G;  2F0N A;  1YHB A;  1V8Q A;  3N52 A;  3VR5 A;  4DR5 L;  3BJU A;  4K5W A;  1EWC A;  1HPC A;  3S24 A;  1ZYR D;  2F4I A;  1J6Q A;  5IYB G;  2HQL A;  1PH3 A;  1UAP A;  3TS0 A;  1NSN S;  4AQY Q;  1XNQ L;  4YWK A;  1JJG A;  4EQP A;  2K32 A;  1VS0 A;  1D8L A;  3W3A A;  1XMO L;  4KKT A;  3A54 A;  5KRU A;  3V05 A;  4BA1 I;  1IBK Q;  5FO9 B;  1PH6 A;  4JV5 Q;  1P16 A;  1STA A;  1HR0 Q;  1B9N A;  3ULL A;  2Z6B A;  1PH2 A;  5T1G A;  5D3I B;  2UUC L;  4UP9 A;  4KV6 A;  1D1I A;  1QNK A;  3M7N A;  4K14 A;  4C3H H;  3F2B A;  2E5L Q;  2ASB A;  4J6H A;  5I6Y A;  2KBN A;  4QCL A;  2OWO A;  2EVB A;  1B2T A;  3HZX A;  3S2H H;  2SOB A;  3QOJ A;  4OEL B;  5C44 B;  4DV7 Q;  3CF5 A;  1DOK A;  4A4I A;  3LNN A;  4LF6 L;  3L3O C;  4WJ4 A;  2RA4 A;  1TVX A;  5JEA J;  3W1B A;  1DGS A;  2PZW A;  4YCV A;  5KIX A;  1D5Z C;  3OW7 A;  3VA7 A;  3GTQ H;  4JYA L;  4IZ8 A;  4DA2 A;  2Z6K A;  3TN2 A;  1O80 A;  1SSO A;  5LL6 S;  1VMP A;  2D62 A;  4NXM L;  3GTP B;  3OTO L;  4C56 C;  1LT4 D;  1LO5 D;  5FKA C;  4IFD H;  2K5W A;  2C5C A;  4CJ0 B;  4FO2 A;  2JA6 H;  1I6H B;  5M3M B;  5C5M A;  3D0F A;  4X64 L;  1QVC A;  2K6A A;  5CV8 A;  5IGG A;  1PZK D;  4LF9 Q;  3K80 C;  1EYG A;  1PTO F;  1EQT A;  1M90 C;  4DNI A;  1IHZ A;  1NR2 A;  1VQ4 A;  3K81 C;  3D6C A;  4H7B A;  2JEB I;  2JA5 B;  2PI2 A;  5C3X A;  5T1I A;  4DAV A;  1W6J A;  1PFB A;  3MTS A;  2NZO A;  2ES2 A;  1MHW C;  3CME A;  3MEH A;  1PRT F;  2VQE Q;  5L37 A;  4A3F G;  1Q12 A;  4A3C H;  2E8G A;  4IJH A;  2E2I B;  1IBK L;  1UEB A;  3T1Y Q;  3BDL A;  2PO4 A;  3WOF A;  4PNY A;  1VQ7 A;  3S16 H;  2EIF A;  1JC7 A;  5GAE C;  1VQM A;  1Y14 B;  3PO2 B;  3Q22 A;  2F0K A;  3PUV A;  3FKI G;  1KDB A;  4NPS A;  1N32 L;  4IQZ A;  3TSS A;  4JPB W;  4DXG A;  1YNJ C;  3I70 A;  4YHH Q;  1YI2 A;  3HRZ C;  3GV3 A;  1JOK A;  2Z4H A;  3ITP A;  3BS1 A;  2IX0 A;  2NVY B;  1X3Q A;  4GLV B;  2EDG A;  2G5D A;  1T9H A;  1ESF A;  2X6G A;  1GM5 A;  4DN4 M;  1SYE A;  3Q23 A;  4B3M L;  1BVS A;  1QOH A;  3O13 A;  3KF8 B;  4XQQ A;  4AIM A;  4XTC S;  3A5U A;  5JVG 3;  4JI0 L;  3DEP A;  3GTG B;  3ERQ A;  4HIK A;  4CHT B;  1K8G A;  5LL6 X;  3HOY H;  1EY5 A;  2FHT A;  1O7I A;  4A3E B;  4DUY Q;  5CV4 A;  3URY A;  1A63 A;  4RMF A;  1D5M C;  1VCI A;  3K57 A;  4Y52 H;  3FRP B;  1BUV T;  3BVM A;  3KDF A;  3NBH A;  1ASY A;  4PMW A;  1RTO A;  2LXK A;  1K8O A;  5CC4 A;  1WJJ A;  3I2Z A;  3CQZ B;  1Q8K A;  3PV0 A;  1E2W A;  1HQM C;  3H0G G;  3M4P A;  2JSO A;  3VR4 A;  5FO8 B;  3CCL A;  2L0C A;  4X62 Q;  4PZ6 A;  1Q46 A;  1GVP A;  2DGY A;  4FDB A;  3RMH A;  4U68 A;  3Q8D A;  4QUF A;  4V0B A;  1VQK A;  1VQ6 A;  4YCU A;  2EJG C;  4LF5 Q;  2VW9 A;  2IJ0 A;  4JI1 Q;  1ILQ A;  3I4N B;  1Z9F A;  4A3M B;  2ZTC A;  1CQV A;  1D1K A;  3BYT B;  1YVC A;  1C0A A;  4DK1 A;  4GN5 A;  3M3Y H;  3J7A 5;  3LWE A;  2Y0S E;  4DR2 L;  5E1F A;  3HOX B;  1Y1V B;  4DV4 Q;  3H3V H;  4C1N I;  1X65 A;  4GLX A;  1N9W A;  5EKI A;  3T1Y L;  3AB9 A;  4H0L C;  4AYB G;  4JI5 Q;  4WRD A;  1HHV A;  5C4H A;  3GD7 A;  2KHJ A;  3NEN A;  5FJ8 G;  4FXG C;  1D5X C;  4JK1 C;  4RHR A;  4A76 A;  1BQQ T;  4A3K H;  1NTG A;  3NQI A;  3W2D A;  4UAI A;  5M9O A;  3NSW A;  4KHV A;  1VQO A;  4YHH L;  2E76 C;  1SNM A;  3RLF A;  1MJC A;  2O2L D;  3KF6 B;  5D65 A;  5COY A;  1KLU D;  1WFQ A;  4DAY A;  3DWQ A;  1KIX A;  5I2X A;  2XWJ B;  2A74 C;  4HJ9 A;  1XXG A;  2AWO A;  2KHS A;  1PYS B;  4CBV A;  1SRO A;  5C3E H;  4QUC A;  1I6V C;  4Q5V A;  2Z9H A;  2SNS A;  3GTM B;  2QGQ A;  2Y0S B;  4NXN Q;  3UDF A;  4BY7 G;  1JE5 A;  4JBK A;  2PI2 E;  4FF3 A;  3ONA B;  1TS2 A;  2L1B A;  5M3F B;  2VB2 X;  1WTH A;  2JEA I;  3JAM L;  1LT5 D;  4K8I A;  1SAP A;  2E2J B;  5C4J B;  2F0F A;  1T5E A;  2F4V Q;  5IYB H;  1TR5 A;  4M1U B;  3JAM i;  2HDM A;  4ZK9 B;  1QJO A;  1KC8 C;  4LFC Q;  1I3Q H;  1SND A;  5FK9 C;  3S15 B;  4XDX A;  4A3I B;  1X32 A;  4X62 L;  4DUZ L;  4HTH A;  3IKJ A;  5A35 A;  2CQO A;  3C1E A;  1VF5 C;  1XTC D;  4OIJ A;  1U0L A;  2ID0 A;  1OXX K;  1MD2 D;  4KLK A;  1EY8 A;  4KMU C;  5IYD G;  4JI6 L;  3C46 A;  1VQD A;  1K3B C;  1OO9 B;  3V96 A;  2OTL A;  1ZYR C;  2XN9 C;  3CXC A;  4NP5 A;  1K0R A;  5IE8 A;  2K5N A;  2Z1C A;  3P75 A;  1PH4 A;  1HZA A;  2RSO A;  3NTH A;  3RZO H;  5BR8 L;  4PG3 A;  1HRJ A;  2YV5 A;  3I4M B;  1DOL A;  2KED A;  4KY6 A;  3J81 c;  4JI5 L;  5IT9 L;  1GUW A;  1RHP A;  4ZQ3 A;  3GTO B;  1SFO H;  3FMC A;  3S1M B;  3D4R A;  1AZQ A;  2XWB B;  3G6J B;  2B2U C;  1TWH B;  2EYF A;  1LTB D;  3DUZ A;  1LTR D;  1S72 A;  2R93 B;  1UE6 A;  1VQH A;  5J22 A;  4J8Q A;  1N33 Q;  5JJZ A;  3HOW H;  1SMX A;  1ENC A;  1XPO A;  4HN7 A;  3GO5 A;  4A3J B;  2OQ0 A;  5C4X G;  1STN A;  3HP3 A;  1W6K A;  2EXD A;  5ELD A;  2BOS A;  1OXV A;  3SR1 A;  2EE1 A;  1QUQ A;  2RCF A;  3QG1 A;  2JA8 B;  2B2W C;  4C3I B;  1H9S B;  4K6D A;  2ATW A;  1AP0 A;  4LAA A;  4PQX A;  1YJW A;  2F1M A;  1A6X A;  1PH9 A;  5LMN Q;  4HR7 B;  1TT2 A;  2R92 B;  1TWA H;  1QCB D;  5FLM G;  2BDO A;  5ELB A;  4BY1 B;  4B9X A;  3SHL A;  2NTS A;  2NZ1 D;  3UI2 A;  4LFC L;  4WJ3 M;  3NBH B;  3KDF B;  4IUT A;  4IFD G;  4A3F H;  3HOV B;  4DR1 L;  2DUD A;  2PW5 A;  4N9T A;  1S40 A;  3TME A;  5JJI A;  2F0G A;  2OQK A;  4G7O C;  2JA6 G;  2FMM A;  3M4O B;  3T1H L;  1TU2 B;  2KEN A;  3J81 i;  2B3G A;  3LWU A;  5IGC A;  3SK6 A;  3MAQ A;  1EY0 A;  2GA4 B;  3TZU A;  2F03 A;  4B3R Q;  3FKI H;  1OXS C;  1VQP A;  1C4Q A;  3OWF A;  2BDN A;  3NBI A;  3I3C A;  1L0X B;  2RDH A;  1GUO A;  3K5L A;  5CGK A;  3EBE A;  4A3C G;  3NP8 A;  2F3V A;  1CZG A;  1SDF A;  5CR3 A;  3JAM E;  1Z47 A;  1IZ6 A;  3GTL B;  1ZEQ X;  3LGJ A;  2QF7 A;  5BN5 A;  2K14 A;  1B9M A;  2O5I C;  3G48 A;  1Y1W G;  1N33 L;  2IWH A;  3UDI A;  4BBS G;  4O1N A;  1JOO A;  2N8N A;  5C6A A;  2IW3 A;  4WOR A;  4Z9C B;  2Z6K C;  3NHH A;  4MN3 A;  4EGV A;  4DAY B;  3K59 A;  1EQQ A;  4L8J A;  2F0E A;  5K5P A;  5JAV A;  2SEB D;  3HOZ B;  3GTJ B;  1KDC A;  1VQG A;  1JIC A;  1LTA D;  4MIU A;  4DV1 Q;  3S14 H;  1ICF B;  4R4O A;  3H0G H;  1S5B D;  4DGZ A;  1EY9 A;  3AYH B;  1J9O A;  4ID6 A;  3CHB D;  1FGU A;  4LJZ C;  3P1H A;  2DNE A;  5IT9 E;  2ALY B;  4A3D B;  4GZY C;  1AH9 A;  2RSN A;  2HUG A;  4A3G B;  2IL8 A;  4A3L G;  4TRD A;  1SMY D;  4DR5 Q;  1O7Z A;  4OON A;  1EIH A;  3G7L A;  4X65 L;  1EZ8 A;  4BWG B;  5KYI A;  3PSI A;  2F3W A;  3PQI A;  2A6E D;  3SXH A;  2OEO A;  4JI2 L;  5FJ8 H;  2B39 A;  4LUO A;  2B2T A;  3GP7 A;  2KHI A;  3K0X A; 
#chains in the Genus database with same CATH homology
 4H44 C;  4A3B B;  5AFW A;  1KDA A;  2I07 B;  2R3Z A;  2AQ2 B;  1SYG A;  2JA7 B;  1PFM A;  1RD9 D;  3KLS X;  2K7V A;  1EYC A;  1L0Y B;  1A3V A;  4BS9 A;  3VR6 A;  1TII D;  3J80 L;  3K7A B;  4RGM A;  5LHY 1;  5ELE A;  3SK4 A;  1CA5 A;  1OXT A;  3NPP A;  4ZUJ A;  1RDP D;  1HTP A;  1DM0 B;  4IN3 A;  3KBG A;  1LAB A;  1SYC A;  3BDO A;  2RKS A;  3OMC A;  1CTM A;  3CRL C;  2LY7 A;  2HCC A;  3T16 A;  2M00 A;  3QOL A;  3CU7 A;  4KN7 C;  4KY5 A;  1RCV D;  1Q90 A;  4RWS C;  3OMG A;  2PW7 A;  1EU3 A;  4XQJ A;  4CKC A;  1QIL A;  1CK1 A;  5IGF A;  1GJX A;  4EVO A;  2I46 A;  3SK5 A;  3EJI A;  3HG9 A;  1SJE D;  5A2Q L;  3K5N A;  2VB3 X;  4X3K A;  1BCP D;  2NVT B;  2XVS A;  3QIA A;  5JEA G;  1LTG D;  1B3A A;  2OXP A;  1FNU A;  2R7Z B;  2N88 A;  3C1F A;  3DWP A;  3PO3 B;  2MP1 A;  4K5X A;  1JQY D;  1A2T A;  1PTO B;  4H13 C;  4RHS A;  5KNB A;  3DMU A;  3A55 A;  2KEC A;  3D31 A;  4UDU C;  2EPB A;  4OO1 G;  2DNC A;  1E2Z A;  1M4V A;  2LMC B;  1HA6 A;  1I4H A;  4QF4 A;  2NVQ B;  2WKD A;  1PRT B;  1TWF B;  1RKN A;  2K01 A;  5KNC A;  4CJ1 B;  5G3L F;  1Y69 U;  1GXD C;  2B63 B;  4FP5 D;  1NR4 A;  3BYY B;  2PMZ B;  2EYH A;  1JR0 D;  3H09 A;  3VYT A;  4KK7 A;  4KTA A;  3HOU B;  1EZ6 A;  2DY8 A;  1SE3 A;  5DM7 3;  4OGQ C;  1SXT A;  3OHX C;  3J80 E;  4C1N K;  3DM1 A;  2HDL A;  2F0T A;  2F0W A;  3PUX A;  5C5L A;  2LKV A;  3I73 A;  3H91 A;  2X6L A;  1MSG A;  4NMZ A;  4J1M A;  1PXU A;  2F0Q A;  1BBX C;  5HGT A;  2KQ3 A;  3SVM A;  2L4N A;  2N55 A;  3D4W A;  3TP7 A;  3SDZ A;  1O78 A;  1IW7 D;  3TDQ A;  1CM9 A;  2D5D A;  3DHQ A;  1TWC B;  2LFN A;  3MZ5 A;  2D9U A;  1V1O A;  4BBR B;  2EYL A;  1R9T B;  5CMD A;  4NW2 A;  4NDX A;  1EQV A;  3KUP A;  4Y7N B;  1BCP B;  4DF7 A;  4XYQ A;  3I8Z A;  3MWY W;  5EBD A;  2WV6 D;  2M2L A;  3A7A B;  4ZKB B;  1H9S A;  2IX1 A;  3IFT A;  5NUC A;  5IGD A;  3PUZ A;  2AUK A;  3EVQ A;  5A2Q E;  3A56 A;  2KEE A;  4RFB A;  2EJM A;  3NE5 B;  2QEJ C;  1AFP A;  1STB A;  5CV6 A;  3MFY A;  4IUU A;  5J1Z A;  4ZLT F;  1NCV A;  2F0H A;  2FMC A;  4U67 3;  2CW0 D;  3J7A V;  1Q8I A;  1WD0 A;  1ILP A;  4S3S A;  1BOS A;  3OOC A;  1HFN A;  4WFN 3;  1SMY C;  1WVL A;  1KLG D;  3J7Y W;  4M8A A;  3S1Q B;  3MXU A;  4KHZ A;  4FXK C;  1Y8P B;  4L6T B;  2TMP A;  2A6E C;  3SE0 A;  1PDQ A;  3D3R A;  5IOD A;  2EXZ A;  3J7A F;  1G29 1;  1ML0 D;  1TKW B;  5EGT A;  4HCE A;  1PRT C;  4C3J B;  5K36 G;  3VYS A;  3OIP A;  1ZKO A;  2A5H A;  5EKL A;  1DON A;  1HFG A;  2VXW A;  1R4P B;  4DFA A;  1ET9 A;  1WTP A;  1M8A A;  4FF1 A;  4KD4 A;  1ET6 A;  1LAC A;  2B2Y A;  3PIP 3;  1Y8N B;  1SE2 A;  2WAC A;  2H4O A;  3L7Z C;  2R61 A;  1MGS A;  2NYZ D;  1WD1 A;  4F8M A;  1F2L A;  3DWA A;  5C3W A;  5CV5 A;  4R8I A;  1EU4 A;  2J0T D;  3M4Y A;  1JWM D;  1S5E D;  4DNT B;  1O7L A;  1PZJ D;  1EIG A;  5EJW A;  5JEA H;  3U9O A;  1BO0 A;  2NWG A;  2B2T C;  1SYF A;  3MFG A;  3T13 A;  5C0X G;  1S4Z A;  1EEF D;  1LT6 D;  4ODG A;  2BCO A;  4QMG A;  2L9H A;  4BY7 B;  1BCP C;  1U4M A;  1WCM B;  4G7Z C;  1LTT D;  4OO1 H;  3S1N B;  3A8I E;  2ZXO A;  3FPU B;  5HUR A;  3P7J A;  1CA6 A;  5M5Y B;  1TQO A;  4ZKC B;  4R9W A;  1DD2 A;  4KY7 A;  2J4X A;  2QIL A;  4NKL A;  1BXT A;  1IL8 A;  1EY4 A;  2ZXP A;  3IFD A;  3VYR A;  1EY7 A;  2AWN A;  2WKC A;  2WIN B;  1GUN A;  1XX8 A;  2NN6 G;  1ENA A;  1HQR D;  5KYL A;  5ELF A;  3TP5 A;  1JE4 A;  5CYU A;  4QB4 A;  5JOB A;  4I65 A;  2RQX A;  2WAQ B;  1O7Y A;  1SJH D;  1F9P A;  2D2C C;  4HMJ A;  3ZYY X;  4K2L A;  2K28 A;  5FLX L;  2K04 A;  3R3O A;  1HXY D;  1EYD A;  3DEO A;  4IFD I;  4R8N A;  2F0D A;  2EYP A;  3AMU A;  3J81 L;  1D2B A;  1WTW A;  2ICE C;  3SK8 A;  4C3H B;  3EQL C;  1FNW A;  3KK7 A;  3R2I A;  4RAU C;  1HCZ A;  1G6Z A;  4CGY B;  2EYJ A;  3S2H B;  3OPO A;  4G57 A;  1JOQ A;  1FNV A;  1JWU D;  2XIW A;  3BG3 A;  4YIJ A;  4DNR B;  1HUN A;  3F2U A;  3I4L A;  5DM6 3;  2KCN A;  3V2T A;  1I4P A;  1GHJ A;  4F87 A;  2K05 A;  1G2S A;  1IW7 C;  3OSO A;  1CHP D;  4V19 0;  2R6G A;  4KKU A;  3HS0 C;  4KKS A;  2NUC A;  4XXE A;  3H94 A;  4G4K A;  2JP1 A;  2JA6 B;  2A68 D;  1F9R A;  2KA7 A;  3OWE B;  5EBC A;  1CI3 M;  4IFD J;  3FPP A;  1B4O A;  3PUW A;  2HCI A;  2SDF A;  1WTV A;  1MSH A;  4IUR A;  2J7Z A;  1A15 A;  4K6L A;  3MXN A;  4X3U A;  1Q1E A;  4ILW A;  1H9M A;  1EFI D;  1GHK A;  1H9J A;  3TBI B;  2B2V A;  2CW0 C;  1I4G A;  3D6W A;  3C3L A;  3MXP A;  1GUT A;  3S16 B;  1NAP A;  1EL0 A;  2EY1 A;  5I2Y A;  1PTO D;  3K5O A;  2FJ2 A;  1IKL A;  4KJO A;  1BF4 A;  4HED A;  3OIQ A;  5EKK A;  2FIN B;  2PZT A;  5K36 H;  1TS4 A;  3R93 A;  3T51 B;  1I4Q A;  1ZXT A;  1F77 A;  1PRT D;  3HEJ A;  1GUG A;  4RGT A;  2L11 A;  5DEH A;  5JPM C;  1IYV A;  1DXM A;  3Q24 A;  2O5J C;  5EPL A;  3I90 A;  5FLX E;  2EY5 A;  3HOY B;  1G8Z D;  4G7H C;  4IUQ A;  5JVH 3;  3J81 E;  5KEE A;  4K2K A;  4HSP A;  4PV1 C;  2NB0 A;  3MHB A;  4CJ2 C;  3SEB A;  2KVM A;  3K5M A;  2WP8 J;  4KI0 A;  3HKZ B;  3TP6 A;  2MPM A;  1EYA A;  1SE4 A;  2F0S A;  1UNS A;  2L12 A;  3M3Y B;  4FF2 A;  5IGB A;  1QWY A;  1CT1 D;  2K5Q A;  5C0X H;  1R4Q B;  2ZT9 C;  4CKB A;  3R2T A;  3VR3 A;  1TS5 A;  4FNF A;  4OL7 A;  1LV9 A;  5CBA E;  1XWE A;  4A3K B;  1RF2 D;  1UUP A;  3Q0A A;  3MXG A;  2KUM A;  3IAY A;  2H1E A;  4I7Z C;  4PMB A;  4ZUI A;  3K6O A;  4XYO A;  1CQF A;  5C3E B;  1V1P B;  3NUC A;  2PYK A;  1ONL A;  4Q0F A;  1SBB B;  4RH6 A;  3TP8 A;  1WTO A;  4OO1 I;  2BA1 A;  1B44 D;  1STG A;  1I4X A;  3NXW A;  2NN6 H;  3BVG A;  1CHQ D;  2WB1 B;  2IPK D;  1KAA A;  2OT2 A;  5IGE A;  1DCZ A;  2B2Y C;  2EY6 A;  1WTR A;  5D14 A;  4ZAI A;  4ABN A;  1PZI D;  1I3Q B;  3BVZ A;  1CZW A;  1GOZ A;  3I72 A;  5C4Z A;  4B08 A;  1NUC A;  4IUP A;  5EQ0 A;  4IUV A;  2C9O A;  1TY0 A;  1F2Z A;  1VMC A;  5KGU A;  2K5D A;  2K33 A;  1QG7 A;  3MC0 B;  4EQO A;  2MUY A;  1HA5 A;  2Z8L A;  1PLF A;  3K58 A;  1F2Y A;  4XQN A;  2SNM A;  3RZO B;  4JBW A;  3KLR A;  5E4W C;  4K8J A;  2G9H D;  2XSC A;  1KAB A;  4OIK A;  2IT1 A;  3MVV A;  4ME5 A;  4RKL A;  1UEA B;  5J39 A;  1SFO B;  3NK9 A;  1TY2 A;  5I9O A;  4X3S A;  1IYU A;  1MI2 A;  4RA8 A;  2BA0 A;  1K8M A;  1QB5 D;  4RCN A;  2F0I A;  3HOW B;  1BR9 A;  1D6E C;  1PFN A;  3E5S A;  3E0J A;  1FR3 A;  3NTK A;  2JE6 I;  2DN8 A;  2Q8T A;  1ESR A;  1SYD A;  4IAL A;  5ELC A;  1B53 A;  1ROD A;  1II3 A;  4TSS A;  1Z6H A;  4TQU S;  1ICW A;  1TWA B;  4RGO S;  4IUN A;  2B8F A;  5COR A;  3U9S A;  1KNE A;  1EOT A;  1B50 A;  2X69 A;  2VNU D;  1ENF A;  2A68 C;  3EFX D;  4A3F B;  1QE6 A;  4FVM A;  4HCS A;  3H3V C;  1KNA A;  1WTX A;  3Q6S A;  4KJN A;  5D3D A;  2XNA C;  4KN4 C;  2F0M A;  2F0L A;  5I4D A;  4DK0 A;  5JPN C;  3FKI B;  3NQT A;  2RBM A;  5CV7 A;  1GUS A;  5KND A;  2A73 B;  3D8G A;  1BDO A;  1F9Q A;  4PMC A;  2EJF C;  4C3J G;  1PYW D;  4HSV A;  3RZD B;  2F0U A;  3EA6 A;  1PTO C;  1STE A;  1AW7 A;  4FF4 A;  3M7G A;  1Q3L A;  4HAE A;  1BCP F;  3PUY A;  2ENB A;  5EPJ A;  2V4D A;  1TS3 A;  1QNU A;  5ISR A;  1HUM A;  1T5X D;  3T56 B;  2WII B;  4LMQ D;  2YYZ A;  2F0V A;  2FFK B;  2RDG A;  4WJW A;  2TSS A;  3S14 B;  2QKI C;  3H0G B;  1H9R A;  3NWT A;  1A3T A;  4HMI A;  4B9W A;  1J8I A;  2KOL A;  1DZ1 A;  1LT3 D;  3DXJ C;  2RDF A;  3RUZ A;  4ZRZ A;  2ICI A;  3I91 A;  2A69 D;  1YNN D;  4AYB B;  2E74 C;  1JB3 A;  1PTO H;  1B1Z A;  3QJY A;  2AQ1 B;  2G9D A;  2B2V C;  3QB3 A;  2E2H B;  2F0J A;  3WOE A;  1LTI D;  4N9P A;  1I50 B;  3M85 A;  1STY A;  3FVQ A;  5C0X I;  2XRQ D;  1JCK B;  3LX0 A;  1OXU A;  2A6H C;  4F88 A;  1C8C A;  2BE5 C;  3FEW X;  2AQ3 B;  3S9W A;  3T53 B;  2JXM B;  3ND8 A;  1JOR A;  2MJ8 A;  4OHJ A;  1LLR D;  4C3I G;  4L63 B;  4RKB A;  1SEB D;  1C48 A;  2PZU A;  1DOM A;  3QWN A;  5EPK A;  3CKI B;  4DU9 A;  4FXD A;  1SNQ A;  3L9A X;  3NTI A;  5CV9 A;  4X3T A;  2PCF B;  2O4X A;  5DAU A;  2NN6 I;  1RTN A;  4A93 B;  3VYU A;  2Q8R E;  5CBE E;  4TKO B;  3VA5 A;  1SYB A;  3A7L A;  4C3H G;  3T4A C;  5C0X J;  1BNZ A;  3PMF A;  1SNO A;  1U4R A;  3D4D A;  2MGS A;  4ULL A;  5E4X A;  1MBY A;  2CHB D;  1DYQ A;  1E0B A;  3MA2 B;  3H6M A;  4F7X A;  1Q1B A;  1EWH A;  4DXF A;  3E6Z X;  3S17 B;  1VDZ A;  2PQE A;  2RVL A;  2EY2 A;  2CQA A;  4P2C B;  1TWG B;  5M5W B;  5C4X B;  1K83 B;  1DJR D;  1X3P A;  2KJX A;  2IX3 A;  1S5C D;  1V1P A;  1S5F D;  3S1R B;  2EYM A;  5F2D A;  4QIW B;  1VF7 A;  2Z4I A;  4BA2 I;  3A8J E;  3GTQ B;  5DNF A;  4XT3 B;  3S2D B;  5M5X B;  1RJT A;  3R8B A;  1I4R A;  1IKM A;  1WTQ A;  3PIO 3;  4CKE A;  3ND9 A;  5BN3 A;  5FO7 B;  1YNJ D;  4DAP A;  4KD3 A;  1LTS D;  4RCO A;  1JWS D;  1PMR A;  1U9R A;  3BDC A;  4FYD A;  2HQE A;  3BZD B;  5I9P A;  1HTL D;  3N6R A;  2M9V A;  3GTK B;  2QDB A;  4LK1 C;  5G3L D;  1EEI D;  3HGB A;  3X3N A;  4XIG S;  3TZD A;  4MHE A;  3C2P A;  2Q8I B;  2PNR C;  5IOC A;  2L5T A;  1G91 A;  2K03 A;  3GV6 A;  1SNC A;  4RGN A;  1V43 A;  1E2V A;  5FOB B;  5I6W A;  2NTT A;  1Y1W B;  4BBS B;  1FD7 D;  1F2M A;  1A2U A;  3VR2 A;  2E75 C;  2ZXR A;  4E6I A;  2DY7 A;  4C2M B;  2JYO A;  2NBF A;  2EZV A;  4ZYS A;  4O42 A;  1S5D D;  2AUJ D;  1A3U A;  1EY6 A;  2EOT A;  2OF1 A;  4EQN A;  3WDN A;  1F9S A;  1U4L A;  2KCC A;  3X3M A;  2NVX B;  3GQB A;  3CRK C;  5BN4 A;  3KLS A;  3QO2 A;  2QCP X;  5TSS A;  2F0P A;  2PPB C;  2CVR A;  3ERO A;  1G2T A;  3K0Y A;  2L55 A;  1FYC A;  4XT1 B;  3KBX A;  1STH A;  3P20 A;  2LS0 1;  1Y8O B;  1H9K A;  2B2U A;  1CFM A;  1XYI A;  3KF8 A;  3IL8 A;  2F0O A;  1AN8 A;  2K1B A;  3A8K E;  5IIF A;  1U4P A;  1FGB D;  2YU9 B;  2E2D C;  2A69 C;  1YNN C;  1AEX A;  2MHV A;  3NWS A;  3RD4 A;  1SNP A;  2B2W A;  4K5V A;  5E3F A;  2A6H D;  2B8G A;  2BE5 D;  1Z7T A;  1KTK A;  2EYO A;  1AZP A;  3AU7 A;  3FDT A;  2VUM B;  2XRS D;  2F0N A;  1V8Q A;  3N52 A;  3VR5 A;  4K5W A;  1EWC A;  1HPC A;  1ZYR D;  2F4I A;  1UAP A;  1NSN S;  4EQP A;  2K32 A;  3W3A A;  4KKT A;  3A54 A;  5KRU A;  3V05 A;  4BA1 I;  5FO9 B;  1STA A;  1B9N A;  5T1G A;  5D3I B;  4KV6 A;  1D1I A;  1QNK A;  3M7N A;  4K14 A;  4J6H A;  5I6Y A;  4QCL A;  2EVB A;  1B2T A;  3HZX A;  2SOB A;  3QOJ A;  5C44 B;  1DOK A;  3LNN A;  3L3O C;  2RA4 A;  1TVX A;  5JEA J;  2PZW A;  5KIX A;  1D5Z C;  3OW7 A;  3VA7 A;  4IZ8 A;  4DA2 A;  3TN2 A;  1O80 A;  1SSO A;  5LL6 S;  1VMP A;  2D62 A;  3GTP B;  4C56 C;  1LT4 D;  1LO5 D;  5FKA C;  4IFD H;  2K5W A;  2C5C A;  4CJ0 B;  4FO2 A;  1I6H B;  5M3M B;  5C5M A;  5CV8 A;  2K6A A;  5IGG A;  1PZK D;  1PTO F;  1EQT A;  1IHZ A;  1NR2 A;  3D6C A;  4H7B A;  2JEB I;  2JA5 B;  5C3X A;  5T1I A;  4DAV A;  1W6J A;  1PFB A;  3MTS A;  3MEH A;  1PRT F;  1Q12 A;  2E2I B;  3BDL A;  2PO4 A;  3WOF A;  4PNY A;  1JC7 A;  3PO2 B;  3Q22 A;  2F0K A;  3PUV A;  1KDB A;  4IQZ A;  3TSS A;  4DXG A;  1YNJ C;  3I70 A;  3HRZ C;  3GV3 A;  1JOK A;  2Z4H A;  3ITP A;  3BS1 A;  2IX0 A;  2NVY B;  1X3Q A;  2EDG A;  1ESF A;  2X6G A;  4DN4 M;  1SYE A;  3Q23 A;  1QOH A;  3O13 A;  4XQQ A;  4XTC S;  5JVG 3;  3DEP A;  3GTG B;  3ERQ A;  4CHT B;  5LL6 X;  1EY5 A;  2FHT A;  4A3E B;  5CV4 A;  3URY A;  1D5M C;  1VCI A;  3K57 A;  3FRP B;  1BUV T;  3BVM A;  3NBH A;  4PMW A;  1RTO A;  1K8O A;  5CC4 A;  3CQZ B;  3PV0 A;  1E2W A;  1HQM C;  3VR4 A;  5FO8 B;  2JSO A;  2L0C A;  3RMH A;  4U68 A;  4QUF A;  4V0B A;  2EJG C;  2IJ0 A;  1ILQ A;  3I4N B;  4A3M B;  1CQV A;  1D1K A;  3BYT B;  4DK1 A;  3LWE A;  5E1F A;  3HOX B;  1Y1V B;  4C1N I;  5EKI A;  3AB9 A;  4H0L C;  4WRD A;  1HHV A;  5C4H A;  3GD7 A;  4FXG C;  1D5X C;  4JK1 C;  4RHR A;  1BQQ T;  3NQI A;  3W2D A;  4UAI A;  5M9O A;  3NSW A;  4KHV A;  2E76 C;  1SNM A;  3RLF A;  2O2L D;  5D65 A;  5COY A;  1KLU D;  4DAY A;  3DWQ A;  5I2X A;  2XWJ B;  2A74 C;  1XXG A;  2AWO A;  2KHS A;  4CBV A;  4QUC A;  1I6V C;  4Q5V A;  2SNS A;  3GTM B;  2Y0S B;  4FF3 A;  3ONA B;  1TS2 A;  2L1B A;  5M3F B;  2VB2 X;  2JEA I;  3JAM L;  1LT5 D;  4K8I A;  1SAP A;  2E2J B;  5C4J B;  2F0F A;  1T5E A;  1TR5 A;  4M1U B;  2HDM A;  4ZK9 B;  1QJO A;  1SND A;  5FK9 C;  3S15 B;  4XDX A;  4A3I B;  1X32 A;  4HTH A;  3IKJ A;  5A35 A;  3C1E A;  1VF5 C;  1XTC D;  4OIJ A;  2ID0 A;  1OXX K;  1MD2 D;  1EY8 A;  4KMU C;  3C46 A;  1OO9 B;  3V96 A;  1ZYR C;  2XN9 C;  4NP5 A;  2Z1C A;  3P75 A;  3NTH A;  2RSO A;  1HRJ A;  3I4M B;  1DOL A;  2KED A;  4KY6 A;  5IT9 L;  1GUW A;  1RHP A;  4ZQ3 A;  3GTO B;  3FMC A;  3S1M B;  3D4R A;  1AZQ A;  2XWB B;  3G6J B;  2B2U C;  1TWH B;  2EYF A;  1LTB D;  3DUZ A;  1LTR D;  2R93 B;  5J22 A;  4J8Q A;  5JJZ A;  1ENC A;  4HN7 A;  3GO5 A;  4A3J B;  1STN A;  3HP3 A;  1W6K A;  5ELD A;  2BOS A;  1OXV A;  3SR1 A;  2EE1 A;  3QG1 A;  2JA8 B;  2B2W C;  4C3I B;  1H9S B;  4K6D A;  1AP0 A;  4LAA A;  4PQX A;  2F1M A;  1A6X A;  4HR7 B;  1TT2 A;  2R92 B;  1QCB D;  2BDO A;  5ELB A;  4BY1 B;  4B9X A;  3SHL A;  2NTS A;  2NZ1 D;  3UI2 A;  4IUT A;  4IFD G;  3HOV B;  2PW5 A;  4N9T A;  3TME A;  2F0G A;  4G7O C;  2FMM A;  3M4O B;  1TU2 B;  3LWU A;  5IGC A;  3SK6 A;  3MAQ A;  1EY0 A;  2GA4 B;  3TZU A;  2F03 A;  1OXS C;  1C4Q A;  3OWF A;  2BDN A;  3NBI A;  3I3C A;  1L0X B;  2RDH A;  1GUO A;  3K5L A;  5CGK A;  3NP8 A;  2F3V A;  1CZG A;  1SDF A;  5CR3 A;  3JAM E;  1Z47 A;  3GTL B;  1ZEQ X;  2QF7 A;  5BN5 A;  1B9M A;  2O5I C;  2IWH A;  4O1N A;  1JOO A;  5C6A A;  2IW3 A;  4WOR A;  4Z9C B;  3NHH A;  4MN3 A;  3K59 A;  4EGV A;  4L8J A;  2F0E A;  5K5P A;  5JAV A;  2SEB D;  3HOZ B;  3GTJ B;  1KDC A;  1JIC A;  1LTA D;  4MIU A;  1S5B D;  4DGZ A;  1EY9 A;  1J9O A;  4ID6 A;  3CHB D;  4LJZ C;  3P1H A;  2DNE A;  5IT9 E;  4A3D B;  4GZY C;  2RSN A;  2HUG A;  4A3G B;  2IL8 A;  4TRD A;  1SMY D;  1O7Z A;  1EIH A;  3G7L A;  1EZ8 A;  4BWG B;  5KYI A;  2F3W A;  2A6E D;  3SXH A;  2OEO A;  2B39 A;  2B2T A;  3GP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...