2N3SA

Nmr assignments and structure of translation initiation factor if-1 from burkholderia thailandensis e264.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Assignments and structure of Translation initiation factor IF-1 from Burkholderia thailandensis E264.
rcsb
source organism Burkholderia thailandensis e264
molecule tags Translation
molecule keywords Translation initiation factor IF-1
total genus 8
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2n3sA00
2BH8A 3B6YA 1J5EL 4B3RL 4DR1L 4LF5Q 3HOYH 4JI4Q 4HJ5A 2EXDA 3K7AH 2ZJQA 2Q2UA 1NMGA 1XJVA 5FLMH 5AJ3Q 4BA1I 5M3FH 1YZ6A 2Z0SA 2Z6KA 4R4CA 4DV5Q 4AH6A 1GKHA 2E8GA 3I4MG 1OXSC 2A19A 4GNXC 4X65Q 1RL2A 2VS1A 2NVTH 3HKZG 3J7ZC 1HJPA 3J81c 1U0LA 1A63A 5M5YH 3PUXA 4DV4L 2F3IA 3EBEA 4JI7Q 2F4VQ 4BBRG 2UUAL 2JJQA 4A3GH 1JT8A 2F52A 3RZOH 3CF5A 3PUVA 4A3IG 2MNAA 3HOVH 2WFWA 2R6GA 3EN2A 4OWXB 4DUYQ 4WJ3M 4B3SL 4DV7Q 3HOZG 5C3EH 2AKWB 1QZHA 2KCMA 3PUYA 2RHQB 5M3MG 2PI2A 3GO5A 3S17H 4NXNL 1NBWA 1D7QA 2K52A 4A3IH 4LF4L 3CCVA 1UE6A 2MQHA 1HZAA 3TS2A 1LTLA 4B3ML 3T1HL 4A3EG 3GTKH 1G291 4DK6C 3D31A 5IP9H 2D62A 3W5OA 5FLMG 5M3FG 1VQ7A 4KHPQ 2EIFA 5BR8L 1YBYA 4DR7Q 1YITA 2E5LQ 1XNRQ 2UXDQ 1B8AA 2KCTA 2VQEQ 2PI2E 5C4XG 3CPFA 4GOPB 3HOWG 1Y1WH 4HIKA 1VQNA 3HOYG 2WP8J 5LMUL 2AWOA 3A5UA 4BA2I 5JJLA 5FJ8G 3HOUH 2VQFL 1HNXL 1L0WA 2ZTDA 2DUDA 2PQAA 4JI8L 4DK3C 1VQ9A 4JBMA 3HKZE 4BBSG 3A0JA 4X66L 1WI5A 1VQMA 4DUZQ 3GDEA 3SGIA 4JI3L 4LF6Q 4TQUS 2HQLA 3FKIG 4JBJA 2I0QA 2WAQE 2YV5A 4IPHA 3U4VA 4JI2L 2WB1E 3HOUG 1C9OA 1VS0A 4DNIA 4DUYL 4A93H 4DKAC 1QUQA 2UUBL 1VQFA 2I5LX 3F2BA 1YI2A 4LUVA 3RN5A 4DV0Q 1IBML 4LF7Q 1VQLA 4BY1H 2Y0SG 3PGZA 2GVAA 3ULLA 3RLOA 3VDYA 4GN4B 2Q2TA 3CCUA 5LMUQ 1E7ZA 1PA6A 4XIGS 4NXML 3ICEA 2B3GA 2N49A 1Y14B 4PZ6A 1YJWA 5IY0A 3KDFA 1PYBA 2WAQG 3AQQA 4R1JA 5LMNL 1PH2A 1KD1C 4HJ7A 2YU9H 2NZOA 3CXCA 2UU9L 2R93G 1UEBA 4QIWE 4JI5Q 2PNHA 1A8VA 1Q46A 2A1AA 2N78A 4PG3A 3S1MH 4JI4L 1C0AA 2CFMA 1J5EQ 1WFQA 4LF8L 4K0KL 4UY8C 1OXVA 3T1YL 3PO3H 1TWFH 2I5MX 1FJGL 1G6PA 1K0RA 3FHWA 4IOCA 1Q86C 1JJCB 4MZ9A 2V1CC 1BBUA 3H15A 1IZ6A 2R7ZG 1DGSA 4JV5L 1CKNA 1A0IA 3PO2H 4A3LH 1EIFA 1TWHH 4B3TL 2VUMG 4IPGA 2CQOA 3L0OA 2R7DA 4OO1I 1JMCA 4GKJL 4AYBG 4NXMQ 4A3GG 2K5HA 1N33Q 4DR6Q 5FJ8H 4DUZL 3JAMc 2R7FA 1Y1WG 4GN5A 2OCEA 3CCLA 2IHEA 4P71A 4RG1A 1KRSA 2JA8H 3S14H 3CCSA 3CD6A 2R93H 1VQBA 4PZ8A 1X55A 3WWVA 4A3KH 1X65A 1M90C 4LUZA 1Y1VG 2Q2HA 2NVYH 5IYDG 1VQKA 4JI2Q 2JE6I 2UUCQ 1EUJA 2KHIA 1OXUA 3M4PA 3KF6A 4GLXA 2HHHL 2H5XA 4A3BH 1E1OA 4DV1Q 3PCOB 5IP9G 3RLNA 4FDBA 4A75A 3M85A 2JA7G 1WCMG 3OTOQ 3HOXH 5K36G 4LWCA 4LW1A 1EWIA 1NTGA 2KBNA 3KJOA 1N32L 1LM0A 2UUCL 4XTCS 5GADC 1L1OC 4GN3B 4DR1Q 4IFDI 1HR0W 1Q1BA 2L15A 3BZCA 3ERSX 4B3MQ 4GS3A 1N9WA 2HT1A 1XNQL 3PV0A 4DR5L 1N36Q 2Z6KC 2ID0A 1NMFA 3W1BA 2CCZA 4LFBL 1EQRA 4JI6Q 4NXNQ 3RZDH 1YNXA 2UXCQ 1N33L 2BA0A 1IBLQ 2KHJA 4DR7L 4GNXA 2KENA 1D8LA 3S24A 1N34Q 2MFIA 4YY3L 4IJHA 4DPGA 2MO1A 3GTOH 1MIUA 3CW2C 4YWLA 4L5TA 3CC4A 4A3FH 3S15H 4A3JH 2AMCB 1FJGQ 3RR5A 1E3PA 4JOIC 4TVAB 2IX1A 5IP7H 2VQFQ 1HNXQ 2JA6G 1VQ4A 5IYDH 1TWGH 4POFA 3ZJYC 1HH2P 2CWPA 2D0OA 1CKMA 3MEFA 4UP9A 1OXTA 1X3EA 4JI1Q 5JEAJ 3AEVA 4DR4Q 1N34L 2UXBQ 1IYJB 1IBKL 3PUWA 2LXJA 4JI3Q 4DV7L 2OQ0A 3KLWA 4A3JG 3UDIA 3E9IA 4H02A 4A93G 3PIPA 1A62A 1YEZA 3EIVA 2LSSA 4IJLA 4C3IH 1XPUA 2QGQA 2C35B 4KI0A 5DLQE 5IWAL 1ASZA 3HKSA 2AWNA 4R4OA 4DR4L 1TXYA 2OWOA 2F4VL 1K8GA 2ZM6L 3H0GG 4JG2A 1PHJA 3KFUA 1W2BA 2EQSA 3KOJA 1SFOH 1QVCA 4BBSH 1MKHA 2VZAA 1HR0L 3LGJA 3CCEA 2D0PA 5IYBG 4DR2Q 1S3OA 2NVQH 5AJ3L 2K5NA 1VQDA 5C44G 1XPRA 3S1NH 2K4KA 2UXBL 1VQEA 3BJUA 3D0FA 1T9HA 4EQ5A 4DR2L 2IX0A 3K80C 3S1RH 4JI6L 3CP0A 1NJIC 3F1ZA 4UPAA 1G51A 4DV0L 1E24A 3T1YQ 4JI8Q 2VY3A 3I56A 3GTPH 4JBKA 4A3MG 3Q8DA 2JA6H 5IWAQ 4A3BG 1I5FA 4JI5L 1MJCA 1UWVA 4BY7H 2R92H 1YHBA 1BBWA 3K7UC 1K9MC 2UU9Q 1WJJA 4A3FG 2YTVA 2YTXA 3TS0A 4DV5L 4A3DG 1KQSA 3S16H 2AHOB 1P8LA 3I55A 4APVA 5IYCG 1IBKQ 1HR0Q 4JI1L 1JB7A 4LF8Q 2VW9A 3T1HQ 3AYHB 5ELOA 3I4NG 4PZ7A 2ALYB 4OWWB 2YTYA 5C4JH 3U4ZA 4DV6Q 5M5WH 3PO2G 1NY4A 5E7NA 3OTOL 1Z9FA 1Q12A 5LMNQ 4DV3L 5JJIA 4O0AA 4YY3Q 4IPCA 3NELA 3PO3G 4A4IA 1L2FA 1I50H 5LMNW 4HJAA 4NPSA 3UDFA 2N3SA 1XMQQ 4J15A 4KHZA 4B3SQ 4L5RC 1PH9A 4X6AH 3M4QA 4YWKA 5GQOA 2NN6I 4DR5Q 4YCVA 3PUZA 1Q82C 1GVPA 5EAYA 4DR3L 1KC8C 1N36L 1HZBA 4A3CH 3TREA 4OX9L 4QGUA 3TRZA 2OTJA 5GAHC 1XMQL 4GKJQ 2K14A 3CAMA 1N32Q 3CCMA 4GNXB 3E0EA 1E1TA 3OW2A 2PMZE 1IBLL 2NN6G 1KXLA 2E2JH 4A3EH 3G71A 4DV2L 1YHQA 1XNRL 3U58A 4R4QA 5FLXc 1VQPA 1VQCA 4C3HH 2JA5G 1VQOA 3ULJA 5BR8Q 3F2DA 1CSPA 3KDFB 2K50A 5C3EG 1SR3A 2Y0SE 3F2CA 3PF5A 2ZM6Q 1SRUA 2DGYA 3G6EA 1X54A 3G48A 4R4IA 1V1QA 4GOPC 1H95A 1YVCA 4Y52H 4DAMA 3S2HH 5GROA 3KJPA 1WYDA 4AYBE 3CC2A 1KHIA 1SMXA 4DR6L 1QUQB 1W3SA 2N8NA 2E5LL 1K3RA 2UXDL 4IOAA 2RCNA 4DV1L 4IPDA 3RNUA 1UE1A 3UE1A 2R92G 3HOWH 5C0XI 3KF8B 1X3GA 1Q7YC 5M5XH 3RLFA 1EQQA 2JA5H 3JC66 3W1GA 1WCMH 5IE8A 3HOXG 1X6OA 4B3RQ 2GVBA 4X64L 4BY7G 4LFAQ 1AE2A 2B29A 4C2MH 3GD7A 2ES2A 4EX5A 4K0KQ 1Y1VH 3BZKA 4A3MH 3A5ZB 3NENA 2OTLA 4LF9L 4A3CG 1I94L 1K73C 1N8RC 2E2IH 4ME3A 1EFWA 5H1SE 2LXKA 4OO1G 1FVIA 4IFDJ 4GLVB 4LNQA 3U50C 1QVFA 4A76A 3K81C 4OONA 5ELNA 4X66Q 4YHHL 2FXQA 3I4OA 1X3FA 4UP8A 2JEAI 4AIMA 4JOIA 4WJ4A 1PH8A 3ULPA 1I6HH 4HIDA 3CMEA 1RIPA 1PH7A 2IY5B 1OXXK 2R7ZH 3H0GH 1PV4A 5M3MH 1IBMQ 4LF7L 3HOVG 4OWTB 2RHSB 3M7NA 2VL6A 4QQBX 4LF4Q 4L5QA 1PVOA 1VQAA 1VQJA 2NZHA 1PYSB 3GTJH 1HNZL 3IRBA 4GKKL 3GTGH 5JJKA 1JJGA 1WOCA 1I3QH 1KL9A 2GN5A 1PFSA 2HHHQ 5GAEC 2Q2IA 1S72A 2HIXA 4P75A 1IXRA 4AQYL 3I4MH 2K5VA 2JEBI 1V43A 2BA1A 3M3YH 1JE5A 5JEAG 4GOPA 1CKOA 2YYZA 3UE0A 1AE3A 1Q8KA 1TWAH 1V9PA 5IP7G 3RN2A 1K8AC 1Z47A 1X56A 4UP7A 1L1OA 1SROA 4JC0A 1VQHA 3GTQH 2XGTA 4C3JH 2VNUD 3HFZB 4O2DA 4JYAQ 1JJ2A 1CSQA 1BVSA 2ZJRA 3GTLH 3K0XA 2K75A 1ASYA 4LF6L 3CQZH 4LFAL 4LFCQ 4YWMA 3S1QH 4R4TA 4LFBQ 4JV5Q 1TWCH 1EYGA 3H3VH 1XMOQ 1O7IA 1E22A 1QZGA 4QL5A 1C7YA 4JYAL 4Y7NH 1GD7A 1LYLA 1MJEA 4QJFA 1EOVA 3A74A 4DV3Q 1HNZQ 1B70B 5C0XG 3GTMH 2IT1A 4A3LG 2WB1G 3TEHB 3STBC 4X62Q 3I7FA 4JI0Q 4A3DH 1X9NA 3FP9A 3H3VI 1VQGA 3KF6B 4JBWA 1BKBA 3DLLA 4KHPL 1XTDA 4LF5L 1PH5A 4QY7A 2HIVA 4LUOA 1EIYB 1YIJA 1UE5A 2JA7H 1GO3E 1Q1EA 4MTNA 4LFCL 4HJ9A 4HJ8A 4P74A 4X62L 1YJNA 1UE7A 2UUBQ 2ZJPA 2PQAB 3DM3A 3F8TA 3M9BA 1SE8A 3CCRA 1QVGA 4JCVE 4NB3A 4X65L 1GM5A 1HZ9A 3KYHC 1VQIA 1PH3A 1CUKA 2OQKA 3JAMi 2RF4A 4HIOA 2BH2A 4BXXG 4IO9A 4X64Q 2ZTCA 2I5HA 3J80c 5HGQA 1U5KA 3E9HA 2B63H 3CMAA 2VUMH 3NBHB 2JK8A 3TQYA 1VQ6A 2JQOA 1B7YB 3AFPA 5HY6A 1M1KC 3I2ZA 1I94Q 3I4NH 1J6QA 3AFQA 1HZCA 3CCJA 5IT9c 4JI0L 1FGUA 1P16A 2JA9A 4OXPA 5C0XJ 3UDXA 3S2DH 2A8VA 2B63G 4BBRH 2VQEL 1XNQQ 3K8AA 2XTIA 3CCQA 4HIMA 1KIXA 3J7A5 1AH9A 1LUZA 4BXXH 1PH1A 4YCUA 3G4SA 3ER0A 1VCIA 2NVXH 4DAYB 3BU2A 4AQYQ 1L1OB 2CKZB 1R9TH 1XMOL 1VQ5A 3UDGA 1K83H 1CKNB 5J3BA 2CWAA 3MXNB 1PH4A 3CPWA 3PF4A 4GKKQ 1HNWQ 1IL2A 1KAWA 3NEMA 3PSIA 2JA8G 3M4OH 2ASBA 4KLKA 2ATWA 2ZTEA 1Q81C 4A3KG 4BY1G 2QA4A 1KRTA 4POGA 3J81i 3J81j 3OYYA 5C44H 4RMFA 3J80i 1HNWL 3L2PA 3FKIH 4GLAC 1XPOA 3STBD 4YHHQ 4DV2Q 4YCWA 5IYBH 3L7ZC 1OTCA 1S40A 4PMWA 4P73A 2UUAQ 3PIOA 3HOZH 4DV4Q 4B3TQ 4JI7L 1NE3A 2QEXA 3CC7A 4LF9Q 4L5SA 1PH6A 2UXCL 1VQ8A 1FL0A 1YJ9A 4IFDG 4P72A 5GAGC 1SLJA 4OX9Q 4DV6L 5IYCH 4DR3Q 4MNOA 1YHAA 2MO0A 2E2HH 1SN8A 5C4XH 2IHFA 4ALPA
chains in the Genus database with same CATH superfamily
2B2VC 2BH8A 1YNND 2EXDA 2ZJQA 1NMGA 1C8CA 5AJ3Q 4R4CA 4AH6A 1BCPD 1LTGD 3Q22A 2BE5C 4P2CB 2B2WA 4DNRB 3R2TA 5EBDA 1I4RA 1KDAA 2SEBD 5M5YH 2F3IA 1NR4A 4BBRG 2H1EA 2F52A 3CF5A 3PUVA 1SYBA 5KEEA 4K6DA 2R6GA 1LTTD 2EPBA 4DUYQ 4OEMB 2RDFA 4CDEC 2KCMA 2RHQB 2PI2A 4NXNL 5EKIA 1D7QA 2K52A 3GP7A 1QILA 2I07B 3GTKH 4A3GB 2D62A 1EEFD 3W5OA 5FLMG 2EIFA 4DR7Q 1YITA 2E5LQ 2K05A 2QDLA 5DM63 5C4XG 4HMJA 4Z9CB 3HOWG 1VQNA 5LMUL 1B9MA 2AUJD 4U673 1XXGA 2ZTDA 1JQYD 2PQAA 2Z6BA 3VR5A 4JBMA 4X66L 4M8AA 1WI5A 2F0LA 1VQMA 4DUZQ 3GDEA 4JI3L 4TQUS 3FKIG 5A2QE 1RODA 2VB2X 3L9AX 4IPHA 3HGBA 4DUYL 1II3A 3F2BA 3ND8A 3H3VC 1LO5D 4LF7Q 1PRTC 3RLOA 3GTKB 4RA8A 1E7ZA 1T5EA 1JCKB 2B3GA 1B50A 4PZ6A 3DMUA 1G6ZA 1LT4D 4X3TA 1Q8IA 3NSWA 3CXCA 2UU9L 4JI5Q 4OIJA 1A8VA 2N78A 2OT2A 1GUNA 2KEEA 4LF8L 2F0PA 1H9KA 1HCZA 2I5MX 1B53A 5KYIA 1CT1D 2WINB 2V1CC 3NWTA 2R7ZG 1DGSA 4A3LH 4A3DB 4B3TL 1FGBD 4OO1I 2CQOA 1JMCA 1SNDA 1IW7C 4DUZL 3JAMc 2F0KA 2R7FA 2OCEA 1SJED 4RG1A 1KRSA 2QDBA 3CCSA 2R93H 4PZ8A 4A3KH 3TBIB 1M90C 2E2HB 4G4KA 4DAVA 3BDCA 2JE6I 4JI2Q 1EUJA 3F2UA 1OXUA 4A3BH 3KF6A 4EQPA 2H5XA 4RCNA 3J81L 3PCOB 3RLNA 4FDBA 2JA7G 3OTOQ 1PTOH 3KJOA 4XTCS 4RKBA 4DR1Q 3SK6A 4KJNA 3BZCA 1B1ZA 1S5DD 3ERSX 1LT6D 4B3MQ 1N9WA 3S14B 1LLRD 1N36Q 1JE4A 3RZOB 4NXNQ 1PLFA 4GNXA 1GOZA 1TVXA 3MWYW 4ABNA 3C46A 2MO1A 3GTOH 1MIUA 3P75A 2IL8A 1EYDA 4CJ2C 1H9SA 3S15H 4A3JH 4NKLA 1EYCA 2AMCB 1V1PB 1E3PA 2JA8B 1XX8A 1VQ4A 3MFYA 4KJOA 3I90A 2CWPA 3AEVA 3MEFA 4A3KB 1CTMA 4XT1B 4JI1Q 2NBFA 1IYJB 1IBKL 3A8IE 1PFMA 2E2JB 1DZ1A 2MP1A 1IHZA 1HXYD 3E9IA 5M9OA 1A62A 4WRDA 4KI0A 2EY6A 3HKSA 1WD1A 1PHJA 1PRTB 2PCFB 2NWGA 1MKHA 1O7YA 2VZAA 3D6CA 3Q0AA 1HR0L 1AP0A 1VMPA 3LGJA 4DFAA 3VA5A 4DR2Q 1D5MC 2E2IB 3PQIA 4R8IA 1TWHB 4CDFC 5C44G 4OO1H 2DNEA 4WORA 3CHBD 1K28A 4EQ5A 1T9HA 3S1RH 3F1ZA 1V8QA 1LACA 4DV0L 4A3FB 2WKDA 2F0MA 3MXPA 3I56A 3NQIA 1GHKA 4XQNA 3Q8DA 5IWAQ 4A3BG 2L12A 3C2PA 1MJCA 3J80E 1BBWA 1BCPB 2D9UA 3TS0A 4DV5L 1BF4A 3S16H 3CRKC 1HR0Q 1UAPA 4APVA 5ELDA 5IYCG 3C3LA 4AYBB 4C3IB 2R7ZB 4LF8Q 3T1HQ 5ELOA 1HUMA 4PZ7A 1TT2A 2ALYB 4DV6Q 4NMZA 1D1IA 4YY3Q 4IPCA 4ZLTF 2F1MA 1CI3M 3HS0C 3Q6SA 5LHY1 1ESFA 3M4QA 3KK7A 4NW2A 2NN6I 4DR5Q 1GVPA 4DR3L 1E2WA 4QGUA 5EKKA 2OTJA 1IYVA 2I46A 4GKJQ 2K14A 3CAMA 2K5WA 3CCMA 3OW2A 3E0EA 1B2TA 2KEDA 1KLGD 1KDCA 2M2LA 1ZXTA 2E2JH 3G71A 1YHQA 4R4QA 1WD0A 1VQCA 4C3HH 1VQOA 5BR8Q 3ND9A 1EY6A 3E6ZX 3VYTA 2HD3A 1SR3A 3F2CA 3PF5A 4HAEA 3G48A 1KTKA 5G3LF 1JOKA 2O5IC 2QW7A 4Y52H 4DAMA 5I6YA 1WYDA 1KHIA 2XVSA 2B2YA 3RUZA 4M1UB 1K3RA 3RNUA 3UE1A 3OMCA 1A2UA 3KF8B 1X3GA 5M5XH 2OXPA 1EQQA 1SE2A 5IE8A 2GVBA 4CKCA 4BY7G 4LFAQ 5C4XB 3GD7A 2HDMA 1Y1VH 3BZKA 4WFN3 4A3MH 4A3CG 1I94L 1N8RC 1EFWA 2G9DA 1S5ED 5LL6X 1EOTA 4A76A 4OONA 1X3FA 1EU4A 1H9RA 1BQQT 2A6HD 4DAYA 1PH7A 3OIQA 2JP1A 2IY5B 1PTOF 2R7ZH 1PV4A 1U4PA 1TS4A 3FDTA 2RHSB 4QQBX 5C5LA 4LF4Q 4BBSB 4L5QA 2RA4A 4ZKCB 1PVOA 2K5DA 1HNZL 1RTOA 3VR2A 2F0JA 2GN5A 1PFSA 2RVLA 5I4DA 4B9XA 4AQYL 2K5VA 5FO9B 4UHVA 4GOPA 4HCSA 3UE0A 1K8AC 1TWAH 3QIAA 3H0GB 3H94A 1MI2A 5EPLA 1YNJD 2PMZB 2GA4B 3GTMB 1ESRA 4JYAQ 3BZDB 4PMCA 3SR1A 1BNZA 3EQLC 4R4TA 1TS3A 1HTPA 1QG7A 1STHA 2QCPX 1WTWA 1QZGA 2HDLA 1G8ZD 3NHHA 3I4MB 5CC4A 4QJFA 3MZ5A 1EOVA 4KY6A 1HNZQ 2L11A 1SNMA 3SEBA 1D6EC 4DF7A 3GTMH 4CDCC 4X62Q 1PXUA 5C4JB 1E2ZA 1SMYC 3H3VI 1VQGA 3KF6B 1HHVA 3K5LA 2E2DC 4KD4A 2RDHA 2HIVA 1Q1EA 4LFCL 2B63B 3TDQA 4Y7NB 3CCRA 1ZYRC 5M5YB 1EU3A 4OGQC 4EVOA 1SE3A 2OQKA 1J9OA 3BYTB 5A35A 3WDNA 5HGQA 1CHQD 2HQEA 3CMAA 3L3OC 2VUMH 3NBHB 2JK8A 4DN4M 1RD9D 3I4NH 4FF1A 5C0XJ 4UDUC 5C3WA 3OPOA 2A8VA 2B63G 5ELCA 2XTIA 1DJRD 3S2HB 4YCUA 2NVXH 1TY0A 3ER0A 4DAYB 4AQYQ 5J1ZA 4X3KA 1CK1A 2J0TD 1ZYRD 1K83H 2EJMA 3NWSA 2FJ2A 5J39A 3VR3A 3A56A 3PF4A 1KAWA 2HCIA 3PSIA 2NYZD 1Z7TA 2ASBA 1ML0D 2PPBC 2ATWA 4NP5A 1Q81C 4BY1G 1U4MA 1KRTA 4C3JB 3ONAB 1C4QA 2F0NA 3L2PA 4PQXA 1XPOA 1D5XC 3HG9A 3L7ZC 2KJXA 2K03A 1FNVA 1S40A 4P73A 3PIOA 3S9WA 3HOZH 4JI7L 2WKCA 2UXCL 1PH6A 2IPKD 1GUTA 4DV6L 2XRSD 1YHAA 2R3ZA 3B6YA 1J5EL 4B3RL 2RBMA 4DR1L 4LF5Q 3K7AH 4HSVA 1XJVA 4V190 2Z0SA 1SE4A 2E8GA 3A55A 1TWGB 5G3LD 1RL2A 1HPCA 2VS1A 2JA6B 1HJPA 1U0LA 2PW5A 4JI7Q 4IN3A 1TWFB 3E5SA 3EBEA 3MTSA 1JT8A 3K7AB 2KQ3A 4A3IG 4HEDA 1NUCA 4WJ3M 4OELB 4B3SL 4LJZC 2K5QA 2Z9HA 1I4GA 1L0YB 5C3EH 1F9SA 1QZHA 1A3UA 3PMFA 5D14A 2Q8TA 1WVLA 3TP7A 4HMIA 2MQHA 2NUCA 4A3EG 1G291 5IP9H 3MXUA 1VQ7A 3NBHA 4ME5A 4BWGB 1QE6A 2UXDQ 2RCFA 1IKLA 1O7ZA 3VR4A 2KCTA 2F0IA 4A3IB 3U9OA 2X69A 3URYA 2JN4A 3A7AB 4KN7C 4GOPB 1KNAA 1Y1WH 3HOYG 2P5ZX 2WP8J 3A5UA 2VQFL 2DUDA 2WB1B 4IZ8A 1VQ9A 2WIIB 1WTOA 4LF6Q 2HQLA 4F8MA 4JBJA 1I6VC 5E4XA 3GTOB 4JI2L 3DEOA 1VS0A 1NNXA 4DNIA 1QUQA 3FEWX 4DV0Q 5JPMC 1VQLA 3PGZA 4LAAA 3ULLA 2K01A 3CCUA 1PA6A 4XIGS 3PO3B 1Y14B 2MPMA 2NZ1D 5IY0A 1PYBA 2WAQG 5E1FA 4R1JA 4HJ7A 2NZOA 1QNKA 1HA5A 2Y0SB 1C48A 1Q46A 5I6WA 1STAA 1C0AA 1S5FD 2CFMA 4K0KL 1HRJA 4UY8C 1OXVA 3JAML 3T1YL 3PO3H 1TWFH 4R9WA 1PFBA 4RGTA 1G6PA 1K0RA 3FHWA 1JJCB 1F2ZA 4MZ9A 4DAPA 1IZ6A 1CKNA 1A0IA 2EYMA 3S1NB 1B9NA 1TWHH 4J8QA 1UNSA 3L0OA 2R7DA 4GKJL 5C3EB 4NXMQ 2F0DA 4A3GG 4DR6Q 5FJ8H 3K59A 2CW0D 4N9PA 4RAUC 4L8JA 1PRTD 1SNOA 3CD6A 1VQBA 1X65A 4IQZA 4LUZA 1Y1VG 3VA7A 5IYDG 5EKLA 2A6EC 3M85A 5JJZA 4LWCA 3NP8A 1NTGA 2KBNA 4A3MB 1IW7D 1LM0A 2UUCL 5CORA 5GADC 1A3VA 4GN3B 4CGYB 5C5MA 2AQ2B 1Q90A 1I4HA 3FPPA 4G57A 2ID0A 2CCZA 1EQRA 1YNXA 1Q3LA 1EIGA 1CZGA 1ZKOA 2F3WA 4DR7L 2A69D 2G5DA 1N34Q 4YY3L 4YWLA 3BG3A 4O42A 4JOIC 2A73B 4TVAB 2IX1A 3DXJC 2QKIC 1ET9A 1YNNC 4POFA 2D0OA 4DR4Q 2ZT9C 1OXTA 5JVH3 2R92B 2X6GA 4DV7L 3KLWA 1EQTA 3PIPA 3EIVA 1F9QA 1XPUA 3Q23A 2NTTA 4R4OA 4NDXA 2OWOA 2ZXOA 1IL8A 3KFUA 2EQSA 3KOJA 1QVCA 3KBXA 3IL8A 2C5CA 1S3OA 1SBBB 1VDZA 2M00A 3RZDB 4JVZA 5AJ3L 1XPRA 3S1NH 3PIO3 3BJUA 1WTHA 1ZEQX 4DR2L 3FRPB 2VB3X 3K80C 3CP0A 1G51A 3FPUB 3J7AV 1ENAA 5D3IB 2XN9C 1A3TA 1STYA 4UAIA 4BY1B 3RD4A 1I5FA 4JI5L 1T5XD 1K9MC 1CM9A 3WOEA 2YTVA 2YTXA 1H9MA 5CV8A 1MBYA 1LTSD 1KQSA 1M8AA 2O5JC 1G91A 4RWSC 1I4XA 3AB9A 3NTKA 2VW9A 3AYHB 4FNFA 4MTKA 5CGKA 5C4JH 1U9RA 3PO2G 1NY4A 3MXGA 5E7NA 2KVMA 3OTOL 5JJIA 5A2QL 3NELA 4A4IA 1L2FA 1EFID 5LMNW 4NPSA 3SHLA 4KHZA 4B3SQ 4YWKA 5K5PA 1HFGA 1JWMD 1N36L 3P7JA 1Q82C 5JOBA 5KGUA 4A3CH 3TREA 2NVXB 5FO8B 3K58A 4XT3B 1SMYD 1XMQL 4IUNA 4CHTB 5KNBA 4GNXB 4DXGA 1E1TA 2A6HC 1IBLL 1JR0D 3H09A 2JA5G 3F2DA 3KLSX 3NPPA 3KDFB 2HCCA 2K50A 4IUQA 5FLXE 5FOBB 2Y0SE 3MVVA 1SYCA 1SRUA 2EJFC 4HSPA 4X3UA 2TSSA 1YVCA 3MA2B 2RDGA 3S2HH 3D4RA 3KJPA 1EY5A 4KHVA 4AYBE 5IGEA 4ZUJA 3SVMA 3CC2A 4A3EB 1W3SA 2N8NA 4FF3A 2F0SA 1UE1A 5IT9E 1Q7YC 2JA5H 4KKSA 2JA7B 3JC66 3W1GA 4A3BB 2ENBA 1X6OA 4ID6A 4X64L 2B29A 4EX5A 3HOYB 3NENA 2OTLA 5JVG3 4LF9L 5M3FB 5H1SE 4OO1G 1FVIA 1QVFA 4FYDA 4X3SA 3M7NA 1UUPA 2JEAI 4XYOA 1RJTA 3ULPA 2EY5A 3ERQA 3TP6A 4HIDA 3CMEA 1RIPA 1OXXK 4PMBA 2F0OA 3HOVG 1SFOB 4GKKL 3GTJH 3W2DA 4IALA 1I3QH 4MN3A 1KL9A 1S72A 4RHRA 1S5CD 4P75A 1IXRA 3TP8A 4IUPA 1NCVA 2L9HA 3EFXD 1JE5A 4HN7A 5JEAG 3I70A 4KN4C 5EPJA 1NAPA 1BCPC 1V9PA 3N6RA 1X56A 3H91A 4OIKA 1I4PA 1QB5D 1SROA 2JSOA 2XNAC 1GUSA 2E74C 3HFZB 4O2DA 2PYKA 4ZYSA 2K75A 4LF6L 3CQZH 3D8GA 4LFCQ 3S1QH 4LFBQ 3HKZB 4QUCA 1EYGA 1O7IA 1E22A 3S16B 4JYAL 2AQ1B 3QJYA 1CQFA 5COYA 4G7HC 1JWUD 1B70B 5C0XG 4BBRB 2IT1A 3I73A 4A3DH 2XIWA 1ICFB 1X9NA 4J6HA 4JK1C 4JBWA 4B9WA 1BKBA 4KHPL 1FYCA 1QCBD 1XTDA 1K0SA 1EIYB 4XYQA 3QO2A 4MTNA 1GO3E 2AQ3B 2XSCA 2H4OA 4MHEA 4HJ8A 4ILWA 4P74A 1YJNA 2NVTB 1VMCA 2ZJPA 3F8TA 2NVYB 1QVGA 1IYUA 4YIJA 5HGTA 4NB3A 3I8ZA 1VQIA 3ZYYX 5I2XA 2RF4A 5BN5A 4BXXG 4X64Q 2I5HA 3PIP3 1BBXC 1U5KA 4ZK9B 3EJIA 2A74C 1WTVA 3OHXC 2K04A 1VF5C 2JQOA 3AFPA 5HY6A 1I94Q 5E4WC 5EQ0A 1HZCA 1FGUA 1P16A 2JA9A 4OXPA 2QF7A 4BBRH 1XNQQ 3K8AA 5IGBA 1QNUA 1DYQA 2FINB 2IJ0A 3Q24A 4BXXH 1VCIA 3BU2A 3V96A 2A69C 1JOQA 4PNYA 3S15B 4C3JG 5JEAH 5J3BA 3MXNA 3MXNB 1PH4A 3SK5A 4GKKQ 1HNWQ 1IL2A 1Y1WB 4DA2A 3M4OH 3NK9A 4TRDA 2QA4A 1LTBD 3QOLA 3R3OA 4CKBA 2F3VA 3LWEA 3HOVB 1STBA 2K1BA 3VYRA 4YCWA 5IYBH 1OTCA 1V1OA 1R9TB 4PMWA 1EY9A 1FR3A 2QEXA 1FL0A 5GAGC 1K8OA 4DR3Q 4MNOA 3SDZA 1SN8A 5C4XH 3SK4A 2E2IH 4JI4Q 4HJ5A 1BUVT 3X3MA 2Q2UA 4KTAA 1CHPD 4U68A 5FLMH 1RDPD 2B8GA 2Z6KA 5IT9L 3MC0B 4V0BA 1GKHA 3NE5B 2A19A 4X65Q 2NVTH 3HKZG 1EY0A 5IGCA 5JAVA 1A63A 3PUXA 2F4VQ 3N52A 5FKAC 2DY8A 3J81E 3DWQA 5ELBA 4HCEA 3R93A 3P1HA 3WOFA 3HOVH 5I9OA 3EN2A 2B2YC 5F2DA 4DV7Q 1CFMA 1PRTF 3GTGB 1FNUA 5IGGA 1RKNA 4FXKC 3PUYA 1CQVA 5M3MG 3GO5A 3LWUA 2EZVA 2V4DA 1NBWA 3S17H 1HTLD 3GV3A 4LF4L 3G6JB 3TZDA 1LTLA 4B3ML 3T1HL 2IX3A 2Z4HA 3T13A 1F2YA 1L0XB 1EWCA 1YBYA 1XNRQ 2B2UA 5CV7A 1B8AA 1LV9A 3U9SA 3FVQA 1GUGA 2PI2E 5EJWA 4QF4A 1TQOA 4K5XA 1DONA 2FMCA 3BVMA 2AWOA 4BA2I 1I6HB 5FJ8G 3HOUH 1HNXL 1L0WA 4JI8L 4DK3C 1S4ZA 2E75C 3HKZE 4BBSG 3IFDA 2SNSA 3EROA 3SGIA 3AU7A 2F0VA 2FHTA 3K6OA 2WAQE 1AW7A 4H0LC 4DKAC 2ICEC 1VQFA 2SNMA 4LUVA 3RN5A 1J8IA 2N88A 4K8IA 2Y0SG 4BY1H 2GVAA 1AN8A 1SJHD 4GN4B 2Q2TA 4NXML 3ICEA 5CV5A 2F0GA 1ENCA 1YJWA 3K0YA 3HOXB 3AQQA 1X3PA 5LMNL 3R8BA 1PH2A 1KD1C 1DCZA 3I72A 4KD3A 2O2LD 1UEBA 2PNHA 3S1MH 4PG3A 4JI4L 4K6LA 4QUFA 1WFQA 1LABA 3SXHA 3D3RA 2Z1CA 2N55A 1ILQA 3H15A 1BBUA 2NTSA 4R8NA 3D6WA 3T51B 3PO2H 4IPGA 2A5HA 1ENFA 5DEHA 3OMGA 4AYBG 4C3IG 2CH4W 2K5HA 3JAME 2YU9B 1W6KA 3CCLA 2Q8IB 2JA8H 1HFNA 4OL7A 3HRZC 1E0BA 1X55A 2EYHA 3DWPA 1TS5A 2KUMA 2Q2HA 2NVYH 1VQKA 3V2TA 2KOLA 5KRUA 2KHIA 3X3NA 3M4PA 2HHHL 1G2TA 5IP9G 4A75A 3HOXH 5K36G 1SYEA 1EWIA 1N32L 2K7VA 1HR0W 2L15A 5I2YA 1EWHA 1STEA 1XNQL 2HT1A 3PV0A 1NMFA 3W1BA 4E6IA 1PTOB 2UXCQ 2DY7A 2BA0A 2KENA 1D8LA 3S24A 2FMMA 3AMUA 3CW2C 3CC4A 3BYYB 4A3FH 2NN6H 3CU7A 3EA6A 1U4RA 3RR5A 5IP7H 2VQFQ 3KLRA 1GUOA 1F9RA 2JA6G 1TWGH 1HH2P 1MD2D 4IUUA 1CKMA 1JWSD 4XDXA 2EOTA 3PUWA 1PZJD 1Y8PB 4EQNA 4JI3Q 1KDBA 4L6TB 4A93G 4C3IH 4DNTB 2QGQA 5EGTA 2AWNA 1SYFA 1RHPA 1K8GA 2MUYA 4JG2A 2M9VA 4FXGC 5L37A 1W2BA 2WV6D 1SFOH 1Y69U 3E3XA 2HUGA 3CCEA 2D0PA 2B39A 5JPNC 1TIID 2RSOA 3BDOA 4OHJA 5IYBG 1STGA 2NVQH 1U4LA 2F0WA 4QIWB 1S5BD 1VQDA 2K4KA 2UXBL 1VQEA 3T4AC 1E24A 1KNEA 4RGNA 3T1YQ 4A93B 4JI8Q 3GTPH 4QCLA 4JBKA 4A3MG 2D5DA 3MFGA 1XWEA 4IUVA 3OW7A 3A54A 5CV4A 1UWVA 5M5WB 4BY7H 1YHBA 1HA6A 1PTOD 4A3DG 1P8LA 3I55A 3TP5A 3VYUA 1JB7A 3C1EA 2BDNA 1MSHA 2MGSA 2CH4A 4N8FA 4XXEA 5M5WH 3K5MA 4FF2A 1EEID 4XQQA 1I3QB 3NXWA 4DV3L 1Q12A 5LMNQ 1WTQA 4LMQD 3HOZB 3PO3G 2NVQB 1PZID 3EVQA 1I50H 5C3XA 3NUCA 2DJGC 4J15A 1PH9A 4X6AH 5GQOA 4C3HB 2PW7A 1O7LA 2K28A 4YCVA 3PUZA 1DOMA 1O78A 5EAYA 4OX9L 2DNCA 3TRZA 3IKJA 2KCNA 5GAHC 1G2SA 3TSSA 5KNDA 4DXFA 4G7ZC 1NSNS 5CR3A 2PNRC 2NN6G 3J7YW 3IAYA 3U58A 5FLXc 1ILPA 2BCOA 5C3EG 5C0XH 1K8MA 2ZM6Q 3G6EA 1X54A 4R4IA 3DM1A 4FF4A 4ZUIA 4H7BA 1SMXA 4DR6L 2E5LL 1QJOA 4DU9A 2RCNA 1OO9B 1SDFA 3A7LA 4B3RQ 1WCMH 1GXDC 2WAQB 1EY8A 2KA7A 3J7AF 1H9JA 1AE2A 4CJ0B 2ES2A 4ZCKA 4K0KQ 3M7GA 4ME3A 2EYLA 2LXKA 4IFDJ 1A15A 5ELNA 2FXQA 1X32A 4UP8A 5DM73 4JOIA 3HOWB 1NR2A 1PH8A 3T53B 1JB3A 5M3MH 1IBMQ 2EE1A 2L5TA 2CVRA 4KK7A 4ODGA 1BXTA 1VQAA 5JJKA 1PYSB 3IRBA 3GTGH 1JJGA 1F2LA 2NB0A 2Q2IA 4KY7A 1AEXA 1STNA 4DK1A 5C4ZA 1V43A 2BA1A 2G9HD 4K2LA 5M5XB 1CA6A 1CKOA 2SDFA 2YYZA 1AE3A 1Q8KA 1H9SB 3RN2A 3M4OB 2L55A 5TSSA 1L1OA 4KKUA 4O1NA 1VQHA 1O80A 1JJ2A 1PDQA 1BVSA 1LT5D 3GTLH 2BDOA 3K0XA 3OWEB 1ASYA 2LKVA 3CRLC 4JV5Q 2B2TA 4KY5A 1A2TA 4QL5A 1GD7A 1LYLA 3A74A 3H6MA 4DV3Q 2B2UC 1F2MA 3S2DB 3DUZA 3TEHB 3STBC 4C3HG 5CV6A 5ISRA 1HQMC 1AZQA 1K83B 4LF5L 4LUOA 1FD7D 3C1FA 4X62L 5CBAE 4B08A 1JORA 4ZRZA 2UUBQ 1BCPF 4L63B 2PQAB 1SAPA 1Z6HA 1BDOA 3TZUA 1HZ9A 2JXMB 3KYHC 3JAMi 5T1GA 1Y8NB 3BS1A 3J80c 1KAAA 2EYJA 2B63H 1TKWB 3KBGA 2EYOA 1B3AA 3TQYA 4Q0FA 3M4YA 3QB3A 3I2ZA 4QB4A 1WTRA 3AFQA 4MIUA 2JYOA 2EJGC 1B4OA 3S2DH 4ZAIA 2VQEL 2F0QA 1GJXA 3KUPA 3BVGA 3G4SA 5E3FA 1L1OB 2CKZB 1R9TH 4ULLA 1FNWA 3E0JA 3UDGA 3OWFA 2OF1A 2PQEA 4I7AA 2CWAA 3MEHA 3FMCA 3CPWA 1TS2A 3NEMA 1M4VA 4IUTA 2JA8G 2MJ8A 4K5WA 2ZTEA 4A3KG 3J81j 3DEPA 4PV1C 4RMFA 3J80i 3FKIH 4GZYC 4GLAC 4FVMA 3PO2B 4DV2Q 2MHVA 2UUAQ 4DV4Q 1NE3A 1I50B 3I4NB 2J4XA 2EVBA 4IFDG 1SLJA 1PZKD 5IYCH 5IGDA 1JICA 2AUKA 3FKIB 1PMRA 2IHFA 4C2MB 2E2HH 4LK1C 4XQJA 3HOYH 3VR6A 2RKSA 1EZ6A 4EQOA 5M3FH 4BA1I 1YZ6A 4DV5Q 3O13A 3S17B 4KV6A 3HP3A 3I4MG 1OXSC 4GNXC 3J7ZC 3DWAA 1BR9A 3J81c 4DV4L 1ET6A 4JW0A 4A3GH 1TY2A 2JJQA 2UUAL 3RMHA 3RZOH 1V1PA 1DXMA 2MNAA 2WFWA 3CQZB 4OWXB 4EGVA 3HOZG 2AKWB 2O4XA 4A3IH 2K33A 3CCVA 1UE6A 1HZAA 5D65A 5T1IA 3TS2A 1PYWD 5KYLA 4DK6C 3D31A 5M3FG 4KHPQ 4Q5VA 5BR8L 1HQRD 4I7ZC 2VQEQ 2F0TA 3CPFA 3HZXA 3NBIA 4HIKA 2B2VA 4IFDH 2TMPA 3CKIB 5JJLA 2CQAA 2CHBD 5BN3A 1F9PA 3A0JA 4TKOB 1PFNA 3KF8A 2B2WC 2XWBB 5IOCA 2I0QA 5KNCA 2YV5A 3U4VA 2WB1E 5ELEA 3HOUG 1AZPA 1C9OA 4A93H 2QEJC 2UUBL 2I5LX 1QWYA 1YI2A 1IBML 2Z4IA 2A68C 1SNCA 3VDYA 5LMUQ 2OEOA 2N49A 3KDFA 1K3BC 1MHWC 3GV6A 4RHSA 2K32A 4RCOA 3K5NA 2YU9H 1SEBD 2R93G 4QIWE 3V05A 2A1AA 3G7LA 4J1MA 5CMDA 2R61A 1J5EQ 5CV9A 4JPBW 1FJGL 2BE5D 3SK8A 4IOCA 4A3LG 1Q86C 4JV5L 3VYSA 3TN2A 3K5OA 1EIFA 4ZQ3A 2VUMG 4DK0A 2EDGA 3S1RB 2L0CA 1WTXA 1N33Q 1DOLA 2ZXRA 4TSSA 4CBVA 5CYUA 2RQXA 1KLUD 1Y1WG 4GN5A 3S14H 2IHEA 4P71A 3GTPB 1LTAD 3WWVA 4CKEA 2UUCQ 3BDLA 1R4QB 3HEJA 4GLXA 4WJWA 3A8JE 1E1OA 4DV1Q 5IIFA 1WCMG 5IGFA 4LW1A 2CW0C 3LX0A 4F87A 4KMUC 3MHBA 1L1OC 2VUMB 5C4HA 4IFDI 1Q1BA 2Z8LA 2EY2A 4GS3A 4DR5L 3P20A 2Z6KC 4S3SA 1DOKA 2Q8RE 4LFBL 4JI6Q 2F0UA 2B2TC 3RZDH 4CDDC 1N33L 3I91A 1IBLQ 2KHJA 1RCVD 2XWJB 5AFWA 3NTHA 4RH6A 5ELFA 2MFIA 1DD2A 4IJHA 4DPGA 4L5TA 3D4DA 1FJGQ 1HNXQ 2LY7A 5IYDH 3ZJYC 4UP9A 2KCCA 5LL6S 5JEAJ 1X3EA 1IKMA 2UXBQ 2F03A 1N34L 2L4NA 5EPKA 2LXJA 2OQ0A 4A3JG 4HTHA 3UDIA 1EY4A 4H02A 3QR8A 1YEZA 1W6JA 1LTID 2LSSA 4IJLA 5DLQE 2C35B 1ASZA 5IWAL 2KHSA 2F0FA 4BS9A 4DR4L 3S1MB 2BOSA 3I4LA 1TXYA 3IFTA 2F4VL 1TU2B 1Y8OB 3H0GG 2ZM6L 1KABA 3OIPA 2PO4A 4BBSH 3HOUB 2DJFC 3BVZA 4F88A 2K5NA 4RFBA 3D0FA 4FP5D 2IX0A 4JI6L 1JOOA 4HR7B 4UPAA 1NJIC 3K57A 4H13C 2VY3A 2B8FA 2A6ED 2R93B 3TMEA 5DAUA 1B44D 1BOSA 2JA6H 1ICWA 3LNNA 1TR5A 2R92H 2UU9Q 3K7UC 3UI2A 2K6AA 1WJJA 4A3FG 2F0HA 2AHOB 1IBKQ 4JI1L 2DN8A 5M3MB 3I4NG 3J80L 2F0EA 4OWWB 2YTYA 3U4ZA 1SNPA 4K14A 1Z9FA 4O0AA 2LMCB 1SYGA 1XMQQ 4HJAA 3UDFA 2N3SA 2QILA 4L5RC 2D2CC 1A6XA 4QMGA 5FLXL 1HUNA 1UEAB 5IODA 1KC8C 1HZBA 4F7XA 1DM0B 1LT3D 1N32Q 2PMZE 2A68D 5NUCA 1D5ZC 2ZXPA 1KXLA 4A3EH 4DV2L 1XNRL 1VQPA 3ULJA 1EY7A 1CSPA 3KLSA 2WACA 1SNQA 2DGYA 5EBCA 4KKTA 2EY1A 1EIHA 1V1QA 4GOPC 2PZWA 1H95A 1D1KA 3GTJB 1GHJA 5GROA 1YNJC 1QUQB 2UXDL 1BO0A 4IOAA 4DV1L 4IPDA 1MSGA 2R92G 3HOWH 5C0XI 3RLFA 3T16A 3QG1A 4RGMA 3HOXG 5K36H 1F77A 4C2MH 4A3JB 2VXWA 3A5ZB 1I4QA 1K73C 4GLVB 2EYPA 2FFKB 4I65A 4LNQA 1TWCB 3U50C 4BY7B 1X3QA 3K81C 4X66Q 4YHHL 3I4OA 4WJ4A 4AIMA 1I6HH 3ITPA 3NTIA 4N8X1 2IW3A 3H0GH 4LF7L 4OWTB 2VL6A 3I3CA 3GTLB 1SSOA 3D4WA 1VQJA 1R4PB 2NZHA 2EXZA 4K5VA 1WOCA 1QOHA 1XYIA 2SOBA 4G7OC 3NQTA 2HHHQ 2C9OA 5GAEC 4C56C 2HIXA 3I4MH 1MGSA 2RSNA 2JEBI 3M3YH 2XRQD 1RTNA 1LTRD 3T56B 5C6AA 1XTCD 3DHQA 5IP7G 1Z47A 4UP7A 1E2VA 3OOCA 4JC0A 1RF2D 3GTQH 2XGTA 4C3JH 2VNUD 3OSOA 3W3AA 1CSQA 2ZJRA 1SYDA 1B3QA 4LFAL 2L1BA 4YWMA 1TWCH 3QOJA 3H3VH 1XMOQ 5KIXA 4RGOS 1C7YA 1SXTA 4Y7NH 2J7ZA 1MJEA 2LS01 3GTQB 2KECA 2LFNA 2WB1G 3I7FA 5D3DA 4JI0Q 4FXDA 3FP9A 3DLLA 5FO7B 1PH5A 4QY7A 5FK9C 1YIJA 1UE5A 2JA7H 2JA5B 1WCMB 4HJ9A 1EQVA 4K2KA 1UE7A 3DM3A 3M9BA 1SE8A 1JC7A 2PZTA 1Y1VB 4JCVE 2IWHA 2E76C 4X65L 1GM5A 1PH3A 1CUKA 4HIOA 2BH2A 4C1NK 4N9TA 4IO9A 2EYFA 2ZTCA 1AFPA 3R2IA 3S1QB 3E9HA 1GUWA 3QWNA 1CA5A 1VQ6A 1WTPA 1B7YB 1M1KC 1J6QA 5BN4A 3CCJA 4JI0L 1PTOC 5IT9c 1EYAA 5DNFA 3UDXA 3GQBA 4CJ1B 3CCQA 4HIMA 5J22A 1KIXA 3J7A5 1AH9A 4ZKBB 1LUZA 3MAQA 1PH1A 2ICIA 4IURA 5C44B 1XMOL 1VQ5A 2X6LA 1CKNB 3M3YB 4DGZA 1TWAB 5HURA 4KLKA 1CZWA 5CBEE 4POGA 1EZ8A 3J81i 1EL0A 1D2BA 3OYYA 5I9PA 4RKLA 4FO2A 5C44H 1HNWL 2F4IA 2PZUA 4K8JA 3STBD 4YHHQ 4H44C 1ONLA 3SE0A 4B3TQ 3CC7A 4LF9Q 4L5SA 1VQ8A 1YJ9A 4C1NI 4P72A 1VF7A 4OX9Q 2MO0A 3A8KE 4ALPA
chains in the Genus database with same CATH topology
2BH8A 3B6YA 1J5EL 4B3RL 4DR1L 4LF5Q 3HOYH 4JI4Q 4HJ5A 2EXDA 3K7AH 2ZJQA 2Q2UA 1NMGA 1XJVA 5FLMH 5AJ3Q 4BA1I 5M3FH 1YZ6A 2Z0SA 2Z6KA 4R4CA 4DV5Q 4AH6A 1GKHA 2E8GA 3I4MG 1OXSC 2A19A 4GNXC 4X65Q 1RL2A 2VS1A 2NVTH 3HKZG 3J7ZC 1HJPA 3J81c 1U0LA 1A63A 5M5YH 3PUXA 4DV4L 2F3IA 3EBEA 4JI7Q 2F4VQ 4BBRG 2UUAL 2JJQA 4A3GH 1JT8A 2F52A 3RZOH 3CF5A 3PUVA 4A3IG 2MNAA 3HOVH 2WFWA 2R6GA 3EN2A 4OWXB 4DUYQ 4WJ3M 4B3SL 4DV7Q 3HOZG 5C3EH 2AKWB 1QZHA 2KCMA 3PUYA 2RHQB 5M3MG 2PI2A 3GO5A 3S17H 4NXNL 1NBWA 1D7QA 2K52A 4A3IH 4LF4L 3CCVA 1UE6A 2MQHA 1HZAA 3TS2A 1LTLA 4B3ML 3T1HL 4A3EG 3GTKH 1G291 4DK6C 3D31A 5IP9H 2D62A 3W5OA 5FLMG 5M3FG 1VQ7A 4KHPQ 2EIFA 5BR8L 1YBYA 4DR7Q 1YITA 2E5LQ 1XNRQ 2UXDQ 1B8AA 2KCTA 2VQEQ 2PI2E 5C4XG 3CPFA 4GOPB 3HOWG 1Y1WH 4HIKA 1VQNA 3HOYG 2WP8J 5LMUL 2AWOA 3A5UA 4BA2I 5JJLA 5FJ8G 3HOUH 2VQFL 1HNXL 1L0WA 2ZTDA 2DUDA 2PQAA 4JI8L 4DK3C 1VQ9A 4JBMA 3HKZE 4BBSG 3A0JA 4X66L 1WI5A 1VQMA 4DUZQ 3GDEA 3SGIA 4JI3L 4LF6Q 4TQUS 2HQLA 3FKIG 4JBJA 2I0QA 2WAQE 2YV5A 4IPHA 3U4VA 4JI2L 2WB1E 3HOUG 1C9OA 1VS0A 4DNIA 4DUYL 4A93H 4DKAC 1QUQA 2UUBL 1VQFA 2I5LX 3F2BA 1YI2A 4LUVA 3RN5A 4DV0Q 1IBML 4LF7Q 1VQLA 4BY1H 2Y0SG 3PGZA 2GVAA 3ULLA 3RLOA 3VDYA 4GN4B 2Q2TA 3CCUA 5LMUQ 1E7ZA 1PA6A 4XIGS 4NXML 3ICEA 2B3GA 2N49A 1Y14B 4PZ6A 1YJWA 5IY0A 3KDFA 1PYBA 2WAQG 3AQQA 4R1JA 5LMNL 1PH2A 1KD1C 4HJ7A 2YU9H 2NZOA 3CXCA 2UU9L 2R93G 1UEBA 4QIWE 4JI5Q 2PNHA 1A8VA 1Q46A 2A1AA 2N78A 4PG3A 3S1MH 4JI4L 1C0AA 2CFMA 1J5EQ 1WFQA 4LF8L 4K0KL 4UY8C 1OXVA 3T1YL 3PO3H 1TWFH 2I5MX 1FJGL 1G6PA 1K0RA 3FHWA 4IOCA 1Q86C 1JJCB 4MZ9A 2V1CC 1BBUA 3H15A 1IZ6A 2R7ZG 1DGSA 4JV5L 1CKNA 1A0IA 3PO2H 4A3LH 1EIFA 1TWHH 4B3TL 2VUMG 4IPGA 2CQOA 3L0OA 2R7DA 4OO1I 1JMCA 4GKJL 4AYBG 4NXMQ 4A3GG 2K5HA 1N33Q 4DR6Q 5FJ8H 4DUZL 3JAMc 2R7FA 1Y1WG 4GN5A 2OCEA 3CCLA 2IHEA 4P71A 4RG1A 1KRSA 2JA8H 3S14H 3CCSA 3CD6A 2R93H 1VQBA 4PZ8A 1X55A 3WWVA 4A3KH 1X65A 1M90C 4LUZA 1Y1VG 2Q2HA 2NVYH 5IYDG 1VQKA 4JI2Q 2JE6I 2UUCQ 1EUJA 2KHIA 1OXUA 3M4PA 3KF6A 4GLXA 2HHHL 2H5XA 4A3BH 1E1OA 4DV1Q 3PCOB 5IP9G 3RLNA 4FDBA 4A75A 3M85A 2JA7G 1WCMG 3OTOQ 3HOXH 5K36G 4LWCA 4LW1A 1EWIA 1NTGA 2KBNA 3KJOA 1N32L 1LM0A 2UUCL 4XTCS 5GADC 1L1OC 4GN3B 4DR1Q 4IFDI 1HR0W 1Q1BA 2L15A 3BZCA 3ERSX 4B3MQ 4GS3A 1N9WA 2HT1A 1XNQL 3PV0A 4DR5L 1N36Q 2Z6KC 2ID0A 1NMFA 3W1BA 2CCZA 4LFBL 1EQRA 4JI6Q 4NXNQ 3RZDH 1YNXA 2UXCQ 1N33L 2BA0A 1IBLQ 2KHJA 4DR7L 4GNXA 2KENA 1D8LA 3S24A 1N34Q 2MFIA 4YY3L 4IJHA 4DPGA 2MO1A 3GTOH 1MIUA 3CW2C 4YWLA 4L5TA 3CC4A 4A3FH 3S15H 4A3JH 2AMCB 1FJGQ 3RR5A 1E3PA 4JOIC 4TVAB 2IX1A 5IP7H 2VQFQ 1HNXQ 2JA6G 1VQ4A 5IYDH 1TWGH 4POFA 3ZJYC 1HH2P 2CWPA 2D0OA 1CKMA 3MEFA 4UP9A 1OXTA 1X3EA 4JI1Q 5JEAJ 3AEVA 4DR4Q 1N34L 2UXBQ 1IYJB 1IBKL 3PUWA 2LXJA 4JI3Q 4DV7L 2OQ0A 3KLWA 4A3JG 3UDIA 3E9IA 4H02A 4A93G 3PIPA 1A62A 1YEZA 3EIVA 2LSSA 4IJLA 4C3IH 1XPUA 2QGQA 2C35B 4KI0A 5DLQE 5IWAL 1ASZA 3HKSA 2AWNA 4R4OA 4DR4L 1TXYA 2OWOA 2F4VL 1K8GA 2ZM6L 3H0GG 4JG2A 1PHJA 3KFUA 1W2BA 2EQSA 3KOJA 1SFOH 1QVCA 4BBSH 1MKHA 2VZAA 1HR0L 3LGJA 3CCEA 2D0PA 5IYBG 4DR2Q 1S3OA 2NVQH 5AJ3L 2K5NA 1VQDA 5C44G 1XPRA 3S1NH 2K4KA 2UXBL 1VQEA 3BJUA 3D0FA 1T9HA 4EQ5A 4DR2L 2IX0A 3K80C 3S1RH 4JI6L 3CP0A 1NJIC 3F1ZA 4UPAA 1G51A 4DV0L 1E24A 3T1YQ 4JI8Q 2VY3A 3I56A 3GTPH 4JBKA 4A3MG 3Q8DA 2JA6H 5IWAQ 4A3BG 1I5FA 4JI5L 1MJCA 1UWVA 4BY7H 2R92H 1YHBA 1BBWA 3K7UC 1K9MC 2UU9Q 1WJJA 4A3FG 2YTVA 2YTXA 3TS0A 4DV5L 4A3DG 1KQSA 3S16H 2AHOB 1P8LA 3I55A 4APVA 5IYCG 1IBKQ 1HR0Q 4JI1L 1JB7A 4LF8Q 2VW9A 3T1HQ 3AYHB 5ELOA 3I4NG 4PZ7A 2ALYB 4OWWB 2YTYA 5C4JH 3U4ZA 4DV6Q 5M5WH 3PO2G 1NY4A 5E7NA 3OTOL 1Z9FA 1Q12A 5LMNQ 4DV3L 5JJIA 4O0AA 4YY3Q 4IPCA 3NELA 3PO3G 4A4IA 1L2FA 1I50H 5LMNW 4HJAA 4NPSA 3UDFA 2N3SA 1XMQQ 4J15A 4KHZA 4B3SQ 4L5RC 1PH9A 4X6AH 3M4QA 4YWKA 5GQOA 2NN6I 4DR5Q 4YCVA 3PUZA 1Q82C 1GVPA 5EAYA 4DR3L 1KC8C 1N36L 1HZBA 4A3CH 3TREA 4OX9L 4QGUA 3TRZA 2OTJA 5GAHC 1XMQL 4GKJQ 2K14A 3CAMA 1N32Q 3CCMA 4GNXB 3E0EA 1E1TA 3OW2A 2PMZE 1IBLL 2NN6G 1KXLA 2E2JH 4A3EH 3G71A 4DV2L 1YHQA 1XNRL 3U58A 4R4QA 5FLXc 1VQPA 1VQCA 4C3HH 2JA5G 1VQOA 3ULJA 5BR8Q 3F2DA 1CSPA 3KDFB 2K50A 5C3EG 1SR3A 2Y0SE 3F2CA 3PF5A 2ZM6Q 1SRUA 2DGYA 3G6EA 1X54A 3G48A 4R4IA 1V1QA 4GOPC 1H95A 1YVCA 4Y52H 4DAMA 3S2HH 5GROA 3KJPA 1WYDA 4AYBE 3CC2A 1KHIA 1SMXA 4DR6L 1QUQB 1W3SA 2N8NA 2E5LL 1K3RA 2UXDL 4IOAA 2RCNA 4DV1L 4IPDA 3RNUA 1UE1A 3UE1A 2R92G 3HOWH 5C0XI 3KF8B 1X3GA 1Q7YC 5M5XH 3RLFA 1EQQA 2JA5H 3JC66 3W1GA 1WCMH 5IE8A 3HOXG 1X6OA 4B3RQ 2GVBA 4X64L 4BY7G 4LFAQ 1AE2A 2B29A 4C2MH 3GD7A 2ES2A 4EX5A 4K0KQ 1Y1VH 3BZKA 4A3MH 3A5ZB 3NENA 2OTLA 4LF9L 4A3CG 1I94L 1K73C 1N8RC 2E2IH 4ME3A 1EFWA 5H1SE 2LXKA 4OO1G 1FVIA 4IFDJ 4GLVB 4LNQA 3U50C 1QVFA 4A76A 3K81C 4OONA 5ELNA 4X66Q 4YHHL 2FXQA 3I4OA 1X3FA 4UP8A 2JEAI 4AIMA 4JOIA 4WJ4A 1PH8A 3ULPA 1I6HH 4HIDA 3CMEA 1RIPA 1PH7A 2IY5B 1OXXK 2R7ZH 3H0GH 1PV4A 5M3MH 1IBMQ 4LF7L 3HOVG 4OWTB 2RHSB 3M7NA 2VL6A 4QQBX 4LF4Q 4L5QA 1PVOA 1VQAA 1VQJA 2NZHA 1PYSB 3GTJH 1HNZL 3IRBA 4GKKL 3GTGH 5JJKA 1JJGA 1WOCA 1I3QH 1KL9A 2GN5A 1PFSA 2HHHQ 5GAEC 2Q2IA 1S72A 2HIXA 4P75A 1IXRA 4AQYL 3I4MH 2K5VA 2JEBI 1V43A 2BA1A 3M3YH 1JE5A 5JEAG 4GOPA 1CKOA 2YYZA 3UE0A 1AE3A 1Q8KA 1TWAH 1V9PA 5IP7G 3RN2A 1K8AC 1Z47A 1X56A 4UP7A 1L1OA 1SROA 4JC0A 1VQHA 3GTQH 2XGTA 4C3JH 2VNUD 3HFZB 4O2DA 4JYAQ 1JJ2A 1CSQA 1BVSA 2ZJRA 3GTLH 3K0XA 2K75A 1ASYA 4LF6L 3CQZH 4LFAL 4LFCQ 4YWMA 3S1QH 4R4TA 4LFBQ 4JV5Q 1TWCH 1EYGA 3H3VH 1XMOQ 1O7IA 1E22A 1QZGA 4QL5A 1C7YA 4JYAL 4Y7NH 1GD7A 1LYLA 1MJEA 4QJFA 1EOVA 3A74A 4DV3Q 1HNZQ 1B70B 5C0XG 3GTMH 2IT1A 4A3LG 2WB1G 3TEHB 3STBC 4X62Q 3I7FA 4JI0Q 4A3DH 1X9NA 3FP9A 3H3VI 1VQGA 3KF6B 4JBWA 1BKBA 3DLLA 4KHPL 1XTDA 4LF5L 1PH5A 4QY7A 2HIVA 4LUOA 1EIYB 1YIJA 1UE5A 2JA7H 1GO3E 1Q1EA 4MTNA 4LFCL 4HJ9A 4HJ8A 4P74A 4X62L 1YJNA 1UE7A 2UUBQ 2ZJPA 2PQAB 3DM3A 3F8TA 3M9BA 1SE8A 3CCRA 1QVGA 4JCVE 4NB3A 4X65L 1GM5A 1HZ9A 3KYHC 1VQIA 1PH3A 1CUKA 2OQKA 3JAMi 2RF4A 4HIOA 2BH2A 4BXXG 4IO9A 4X64Q 2ZTCA 2I5HA 3J80c 5HGQA 1U5KA 3E9HA 2B63H 3CMAA 2VUMH 3NBHB 2JK8A 3TQYA 1VQ6A 2JQOA 1B7YB 3AFPA 5HY6A 1M1KC 3I2ZA 1I94Q 3I4NH 1J6QA 3AFQA 1HZCA 3CCJA 5IT9c 4JI0L 1FGUA 1P16A 2JA9A 4OXPA 5C0XJ 3UDXA 3S2DH 2A8VA 2B63G 4BBRH 2VQEL 1XNQQ 3K8AA 2XTIA 3CCQA 4HIMA 1KIXA 3J7A5 1AH9A 1LUZA 4BXXH 1PH1A 4YCUA 3G4SA 3ER0A 1VCIA 2NVXH 4DAYB 3BU2A 4AQYQ 1L1OB 2CKZB 1R9TH 1XMOL 1VQ5A 3UDGA 1K83H 1CKNB 5J3BA 2CWAA 3MXNB 1PH4A 3CPWA 3PF4A 4GKKQ 1HNWQ 1IL2A 1KAWA 3NEMA 3PSIA 2JA8G 3M4OH 2ASBA 4KLKA 2ATWA 2ZTEA 1Q81C 4A3KG 4BY1G 2QA4A 1KRTA 4POGA 3J81i 3J81j 3OYYA 5C44H 4RMFA 3J80i 1HNWL 3L2PA 3FKIH 4GLAC 1XPOA 3STBD 4YHHQ 4DV2Q 4YCWA 5IYBH 3L7ZC 1OTCA 1S40A 4PMWA 4P73A 2UUAQ 3PIOA 3HOZH 4DV4Q 4B3TQ 4JI7L 1NE3A 2QEXA 3CC7A 4LF9Q 4L5SA 1PH6A 2UXCL 1VQ8A 1FL0A 1YJ9A 4IFDG 4P72A 5GAGC 1SLJA 4OX9Q 4DV6L 5IYCH 4DR3Q 4MNOA 1YHAA 2MO0A 2E2HH 1SN8A 5C4XH 2IHFA 4ALPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH8 A;  3B6Y A;  1J5E L;  4B3R L;  4DR1 L;  4LF5 Q;  3HOY H;  4JI4 Q;  4HJ5 A;  2EXD A;  3K7A H;  2ZJQ A;  2Q2U A;  1NMG A;  1XJV A;  5FLM H;  5AJ3 Q;  4BA1 I;  5M3F H;  1YZ6 A;  2Z0S A;  2Z6K A;  4R4C A;  4DV5 Q;  4AH6 A;  1GKH A;  2E8G A;  3I4M G;  1OXS C;  2A19 A;  4GNX C;  4X65 Q;  1RL2 A;  2VS1 A;  2NVT H;  3HKZ G;  3J7Z C;  1HJP A;  3J81 c;  1U0L A;  1A63 A;  5M5Y H;  3PUX A;  4DV4 L;  2F3I A;  3EBE A;  4JI7 Q;  2F4V Q;  4BBR G;  2UUA L;  2JJQ A;  4A3G H;  1JT8 A;  2F52 A;  3RZO H;  3CF5 A;  3PUV A;  4A3I G;  2MNA A;  3HOV H;  2WFW A;  2R6G A;  3EN2 A;  4OWX B;  4DUY Q;  4WJ3 M;  4B3S L;  4DV7 Q;  3HOZ G;  5C3E H;  2AKW B;  1QZH A;  2KCM A;  3PUY A;  2RHQ B;  5M3M G;  2PI2 A;  3GO5 A;  3S17 H;  4NXN L;  1NBW A;  1D7Q A;  2K52 A;  4A3I H;  4LF4 L;  3CCV A;  1UE6 A;  2MQH A;  1HZA A;  3TS2 A;  1LTL A;  4B3M L;  3T1H L;  4A3E G;  3GTK H;  1G29 1;  4DK6 C;  3D31 A;  5IP9 H;  2D62 A;  3W5O A;  5FLM G;  5M3F G;  1VQ7 A;  4KHP Q;  2EIF A;  5BR8 L;  1YBY A;  4DR7 Q;  1YIT A;  2E5L Q;  1XNR Q;  2UXD Q;  1B8A A;  2KCT A;  2VQE Q;  2PI2 E;  5C4X G;  3CPF A;  4GOP B;  3HOW G;  1Y1W H;  4HIK A;  1VQN A;  3HOY G;  2WP8 J;  5LMU L;  2AWO A;  3A5U A;  4BA2 I;  5JJL A;  5FJ8 G;  3HOU H;  2VQF L;  1HNX L;  1L0W A;  2ZTD A;  2DUD A;  2PQA A;  4JI8 L;  4DK3 C;  1VQ9 A;  4JBM A;  3HKZ E;  4BBS G;  3A0J A;  4X66 L;  1WI5 A;  1VQM A;  4DUZ Q;  3GDE A;  3SGI A;  4JI3 L;  4LF6 Q;  4TQU S;  2HQL A;  3FKI G;  4JBJ A;  2I0Q A;  2WAQ E;  2YV5 A;  4IPH A;  3U4V A;  4JI2 L;  2WB1 E;  3HOU G;  1C9O A;  1VS0 A;  4DNI A;  4DUY L;  4A93 H;  4DKA C;  1QUQ A;  2UUB L;  1VQF A;  2I5L X;  3F2B A;  1YI2 A;  4LUV A;  3RN5 A;  4DV0 Q;  1IBM L;  4LF7 Q;  1VQL A;  4BY1 H;  2Y0S G;  3PGZ A;  2GVA A;  3ULL A;  3RLO A;  3VDY A;  4GN4 B;  2Q2T A;  3CCU A;  5LMU Q;  1E7Z A;  1PA6 A;  4XIG S;  4NXM L;  3ICE A;  2B3G A;  2N49 A;  1Y14 B;  4PZ6 A;  1YJW A;  5IY0 A;  3KDF A;  1PYB A;  2WAQ G;  3AQQ A;  4R1J A;  5LMN L;  1PH2 A;  1KD1 C;  4HJ7 A;  2YU9 H;  2NZO A;  3CXC A;  2UU9 L;  2R93 G;  1UEB A;  4QIW E;  4JI5 Q;  2PNH A;  1A8V A;  1Q46 A;  2A1A A;  2N78 A;  4PG3 A;  3S1M H;  4JI4 L;  1C0A A;  2CFM A;  1J5E Q;  1WFQ A;  4LF8 L;  4K0K L;  4UY8 C;  1OXV A;  3T1Y L;  3PO3 H;  1TWF H;  2I5M X;  1FJG L;  1G6P A;  1K0R A;  3FHW A;  4IOC A;  1Q86 C;  1JJC B;  4MZ9 A;  2V1C C;  1BBU A;  3H15 A;  1IZ6 A;  2R7Z G;  1DGS A;  4JV5 L;  1CKN A;  1A0I A;  3PO2 H;  4A3L H;  1EIF A;  1TWH H;  4B3T L;  2VUM G;  4IPG A;  2CQO A;  3L0O A;  2R7D A;  4OO1 I;  1JMC A;  4GKJ L;  4AYB G;  4NXM Q;  4A3G G;  2K5H A;  1N33 Q;  4DR6 Q;  5FJ8 H;  4DUZ L;  3JAM c;  2R7F A;  1Y1W G;  4GN5 A;  2OCE A;  3CCL A;  2IHE A;  4P71 A;  4RG1 A;  1KRS A;  2JA8 H;  3S14 H;  3CCS A;  3CD6 A;  2R93 H;  1VQB A;  4PZ8 A;  1X55 A;  3WWV A;  4A3K H;  1X65 A;  1M90 C;  4LUZ A;  1Y1V G;  2Q2H A;  2NVY H;  5IYD G;  1VQK A;  4JI2 Q;  2JE6 I;  2UUC Q;  1EUJ A;  2KHI A;  1OXU A;  3M4P A;  3KF6 A;  4GLX A;  2HHH L;  2H5X A;  4A3B H;  1E1O A;  4DV1 Q;  3PCO B;  5IP9 G;  3RLN A;  4FDB A;  4A75 A;  3M85 A;  2JA7 G;  1WCM G;  3OTO Q;  3HOX H;  5K36 G;  4LWC A;  4LW1 A;  1EWI A;  1NTG A;  2KBN A;  3KJO A;  1N32 L;  1LM0 A;  2UUC L;  4XTC S;  5GAD C;  1L1O C;  4GN3 B;  4DR1 Q;  4IFD I;  1HR0 W;  1Q1B A;  2L15 A;  3BZC A;  3ERS X;  4B3M Q;  4GS3 A;  1N9W A;  2HT1 A;  1XNQ L;  3PV0 A;  4DR5 L;  1N36 Q;  2Z6K C;  2ID0 A;  1NMF A;  3W1B A;  2CCZ A;  4LFB L;  1EQR A;  4JI6 Q;  4NXN Q;  3RZD H;  1YNX A;  2UXC Q;  1N33 L;  2BA0 A;  1IBL Q;  2KHJ A;  4DR7 L;  4GNX A;  2KEN A;  1D8L A;  3S24 A;  1N34 Q;  2MFI A;  4YY3 L;  4IJH A;  4DPG A;  2MO1 A;  3GTO H;  1MIU A;  3CW2 C;  4YWL A;  4L5T A;  3CC4 A;  4A3F H;  3S15 H;  4A3J H;  2AMC B;  1FJG Q;  3RR5 A;  1E3P A;  4JOI C;  4TVA B;  2IX1 A;  5IP7 H;  2VQF Q;  1HNX Q;  2JA6 G;  1VQ4 A;  5IYD H;  1TWG H;  4POF A;  3ZJY C;  1HH2 P;  2CWP A;  2D0O A;  1CKM A;  3MEF A;  4UP9 A;  1OXT A;  1X3E A;  4JI1 Q;  5JEA J;  3AEV A;  4DR4 Q;  1N34 L;  2UXB Q;  1IYJ B;  1IBK L;  3PUW A;  2LXJ A;  4JI3 Q;  4DV7 L;  2OQ0 A;  3KLW A;  4A3J G;  3UDI A;  3E9I A;  4H02 A;  4A93 G;  3PIP A;  1A62 A;  1YEZ A;  3EIV A;  2LSS A;  4IJL A;  4C3I H;  1XPU A;  2QGQ A;  2C35 B;  4KI0 A;  5DLQ E;  5IWA L;  1ASZ A;  3HKS A;  2AWN A;  4R4O A;  4DR4 L;  1TXY A;  2OWO A;  2F4V L;  1K8G A;  2ZM6 L;  3H0G G;  4JG2 A;  1PHJ A;  3KFU A;  1W2B A;  2EQS A;  3KOJ A;  1SFO H;  1QVC A;  4BBS H;  1MKH A;  2VZA A;  1HR0 L;  3LGJ A;  3CCE A;  2D0P A;  5IYB G;  4DR2 Q;  1S3O A;  2NVQ H;  5AJ3 L;  2K5N A;  1VQD A;  5C44 G;  1XPR A;  3S1N H;  2K4K A;  2UXB L;  1VQE A;  3BJU A;  3D0F A;  1T9H A;  4EQ5 A;  4DR2 L;  2IX0 A;  3K80 C;  3S1R H;  4JI6 L;  3CP0 A;  1NJI C;  3F1Z A;  4UPA A;  1G51 A;  4DV0 L;  1E24 A;  3T1Y Q;  4JI8 Q;  2VY3 A;  3I56 A;  3GTP H;  4JBK A;  4A3M G;  3Q8D A;  2JA6 H;  5IWA Q;  4A3B G;  1I5F A;  4JI5 L;  1MJC A;  1UWV A;  4BY7 H;  2R92 H;  1YHB A;  1BBW A;  3K7U C;  1K9M C;  2UU9 Q;  1WJJ A;  4A3F G;  2YTV A;  2YTX A;  3TS0 A;  4DV5 L;  4A3D G;  1KQS A;  3S16 H;  2AHO B;  1P8L A;  3I55 A;  4APV A;  5IYC G;  1IBK Q;  1HR0 Q;  4JI1 L;  1JB7 A;  4LF8 Q;  2VW9 A;  3T1H Q;  3AYH B;  5ELO A;  3I4N G;  4PZ7 A;  2ALY B;  4OWW B;  2YTY A;  5C4J H;  3U4Z A;  4DV6 Q;  5M5W H;  3PO2 G;  1NY4 A;  5E7N A;  3OTO L;  1Z9F A;  1Q12 A;  5LMN Q;  4DV3 L;  5JJI A;  4O0A A;  4YY3 Q;  4IPC A;  3NEL A;  3PO3 G;  4A4I A;  1L2F A;  1I50 H;  5LMN W;  4HJA A;  4NPS A;  3UDF A;  2N3S A;  1XMQ Q;  4J15 A;  4KHZ A;  4B3S Q;  4L5R C;  1PH9 A;  4X6A H;  3M4Q A;  4YWK A;  5GQO A;  2NN6 I;  4DR5 Q;  4YCV A;  3PUZ A;  1Q82 C;  1GVP A;  5EAY A;  4DR3 L;  1KC8 C;  1N36 L;  1HZB A;  4A3C H;  3TRE A;  4OX9 L;  4QGU A;  3TRZ A;  2OTJ A;  5GAH C;  1XMQ L;  4GKJ Q;  2K14 A;  3CAM A;  1N32 Q;  3CCM A;  4GNX B;  3E0E A;  1E1T A;  3OW2 A;  2PMZ E;  1IBL L;  2NN6 G;  1KXL A;  2E2J H;  4A3E H;  3G71 A;  4DV2 L;  1YHQ A;  1XNR L;  3U58 A;  4R4Q A;  5FLX c;  1VQP A;  1VQC A;  4C3H H;  2JA5 G;  1VQO A;  3ULJ A;  5BR8 Q;  3F2D A;  1CSP A;  3KDF B;  2K50 A;  5C3E G;  1SR3 A;  2Y0S E;  3F2C A;  3PF5 A;  2ZM6 Q;  1SRU A;  2DGY A;  3G6E A;  1X54 A;  3G48 A;  4R4I A;  1V1Q A;  4GOP C;  1H95 A;  1YVC A;  4Y52 H;  4DAM A;  3S2H H;  5GRO A;  3KJP A;  1WYD A;  4AYB E;  3CC2 A;  1KHI A;  1SMX A;  4DR6 L;  1QUQ B;  1W3S A;  2N8N A;  2E5L L;  1K3R A;  2UXD L;  4IOA A;  2RCN A;  4DV1 L;  4IPD A;  3RNU A;  1UE1 A;  3UE1 A;  2R92 G;  3HOW H;  5C0X I;  3KF8 B;  1X3G A;  1Q7Y C;  5M5X H;  3RLF A;  1EQQ A;  2JA5 H;  3JC6 6;  3W1G A;  1WCM H;  5IE8 A;  3HOX G;  1X6O A;  4B3R Q;  2GVB A;  4X64 L;  4BY7 G;  4LFA Q;  1AE2 A;  2B29 A;  4C2M H;  3GD7 A;  2ES2 A;  4EX5 A;  4K0K Q;  1Y1V H;  3BZK A;  4A3M H;  3A5Z B;  3NEN A;  2OTL A;  4LF9 L;  4A3C G;  1I94 L;  1K73 C;  1N8R C;  2E2I H;  4ME3 A;  1EFW A;  5H1S E;  2LXK A;  4OO1 G;  1FVI A;  4IFD J;  4GLV B;  4LNQ A;  3U50 C;  1QVF A;  4A76 A;  3K81 C;  4OON A;  5ELN A;  4X66 Q;  4YHH L;  2FXQ A;  3I4O A;  1X3F A;  4UP8 A;  2JEA I;  4AIM A;  4JOI A;  4WJ4 A;  1PH8 A;  3ULP A;  1I6H H;  4HID A;  3CME A;  1RIP A;  1PH7 A;  2IY5 B;  1OXX K;  2R7Z H;  3H0G H;  1PV4 A;  5M3M H;  1IBM Q;  4LF7 L;  3HOV G;  4OWT B;  2RHS B;  3M7N A;  2VL6 A;  4QQB X;  4LF4 Q;  4L5Q A;  1PVO A;  1VQA A;  1VQJ A;  2NZH A;  1PYS B;  3GTJ H;  1HNZ L;  3IRB A;  4GKK L;  3GTG H;  5JJK A;  1JJG A;  1WOC A;  1I3Q H;  1KL9 A;  2GN5 A;  1PFS A;  2HHH Q;  5GAE C;  2Q2I A;  1S72 A;  2HIX A;  4P75 A;  1IXR A;  4AQY L;  3I4M H;  2K5V A;  2JEB I;  1V43 A;  2BA1 A;  3M3Y H;  1JE5 A;  5JEA G;  4GOP A;  1CKO A;  2YYZ A;  3UE0 A;  1AE3 A;  1Q8K A;  1TWA H;  1V9P A;  5IP7 G;  3RN2 A;  1K8A C;  1Z47 A;  1X56 A;  4UP7 A;  1L1O A;  1SRO A;  4JC0 A;  1VQH A;  3GTQ H;  2XGT A;  4C3J H;  2VNU D;  3HFZ B;  4O2D A;  4JYA Q;  1JJ2 A;  1CSQ A;  1BVS A;  2ZJR A;  3GTL H;  3K0X A;  2K75 A;  1ASY A;  4LF6 L;  3CQZ H;  4LFA L;  4LFC Q;  4YWM A;  3S1Q H;  4R4T A;  4LFB Q;  4JV5 Q;  1TWC H;  1EYG A;  3H3V H;  1XMO Q;  1O7I A;  1E22 A;  1QZG A;  4QL5 A;  1C7Y A;  4JYA L;  4Y7N H;  1GD7 A;  1LYL A;  1MJE A;  4QJF A;  1EOV A;  3A74 A;  4DV3 Q;  1HNZ Q;  1B70 B;  5C0X G;  3GTM H;  2IT1 A;  4A3L G;  2WB1 G;  3TEH B;  3STB C;  4X62 Q;  3I7F A;  4JI0 Q;  4A3D H;  1X9N A;  3FP9 A;  3H3V I;  1VQG A;  3KF6 B;  4JBW A;  1BKB A;  3DLL A;  4KHP L;  1XTD A;  4LF5 L;  1PH5 A;  4QY7 A;  2HIV A;  4LUO A;  1EIY B;  1YIJ A;  1UE5 A;  2JA7 H;  1GO3 E;  1Q1E A;  4MTN A;  4LFC L;  4HJ9 A;  4HJ8 A;  4P74 A;  4X62 L;  1YJN A;  1UE7 A;  2UUB Q;  2ZJP A;  2PQA B;  3DM3 A;  3F8T A;  3M9B A;  1SE8 A;  3CCR A;  1QVG A;  4JCV E;  4NB3 A;  4X65 L;  1GM5 A;  1HZ9 A;  3KYH C;  1VQI A;  1PH3 A;  1CUK A;  2OQK A;  3JAM i;  2RF4 A;  4HIO A;  2BH2 A;  4BXX G;  4IO9 A;  4X64 Q;  2ZTC A;  2I5H A;  3J80 c;  5HGQ A;  1U5K A;  3E9H A;  2B63 H;  3CMA A;  2VUM H;  3NBH B;  2JK8 A;  3TQY A;  1VQ6 A;  2JQO A;  1B7Y B;  3AFP A;  5HY6 A;  1M1K C;  3I2Z A;  1I94 Q;  3I4N H;  1J6Q A;  3AFQ A;  1HZC A;  3CCJ A;  5IT9 c;  4JI0 L;  1FGU A;  1P16 A;  2JA9 A;  4OXP A;  5C0X J;  3UDX A;  3S2D H;  2A8V A;  2B63 G;  4BBR H;  2VQE L;  1XNQ Q;  3K8A A;  2XTI A;  3CCQ A;  4HIM A;  1KIX A;  3J7A 5;  1AH9 A;  1LUZ A;  4BXX H;  1PH1 A;  4YCU A;  3G4S A;  3ER0 A;  1VCI A;  2NVX H;  4DAY B;  3BU2 A;  4AQY Q;  1L1O B;  2CKZ B;  1R9T H;  1XMO L;  1VQ5 A;  3UDG A;  1K83 H;  1CKN B;  5J3B A;  2CWA A;  3MXN B;  1PH4 A;  3CPW A;  3PF4 A;  4GKK Q;  1HNW Q;  1IL2 A;  1KAW A;  3NEM A;  3PSI A;  2JA8 G;  3M4O H;  2ASB A;  4KLK A;  2ATW A;  2ZTE A;  1Q81 C;  4A3K G;  4BY1 G;  2QA4 A;  1KRT A;  4POG A;  3J81 i;  3J81 j;  3OYY A;  5C44 H;  4RMF A;  3J80 i;  1HNW L;  3L2P A;  3FKI H;  4GLA C;  1XPO A;  3STB D;  4YHH Q;  4DV2 Q;  4YCW A;  5IYB H;  3L7Z C;  1OTC A;  1S40 A;  4PMW A;  4P73 A;  2UUA Q;  3PIO A;  3HOZ H;  4DV4 Q;  4B3T Q;  4JI7 L;  1NE3 A;  2QEX A;  3CC7 A;  4LF9 Q;  4L5S A;  1PH6 A;  2UXC L;  1VQ8 A;  1FL0 A;  1YJ9 A;  4IFD G;  4P72 A;  5GAG C;  1SLJ A;  4OX9 Q;  4DV6 L;  5IYC H;  4DR3 Q;  4MNO A;  1YHA A;  2MO0 A;  2E2H H;  1SN8 A;  5C4X H;  2IHF A;  4ALP A; 
#chains in the Genus database with same CATH topology
 2B2V C;  2BH8 A;  1YNN D;  2EXD A;  2ZJQ A;  1NMG A;  1C8C A;  5AJ3 Q;  4R4C A;  4AH6 A;  1BCP D;  1LTG D;  3Q22 A;  2BE5 C;  4P2C B;  2B2W A;  4DNR B;  3R2T A;  5EBD A;  1I4R A;  1KDA A;  2SEB D;  5M5Y H;  2F3I A;  1NR4 A;  4BBR G;  2H1E A;  2F52 A;  3CF5 A;  3PUV A;  1SYB A;  5KEE A;  4K6D A;  2R6G A;  1LTT D;  2EPB A;  4DUY Q;  4OEM B;  2RDF A;  4CDE C;  2KCM A;  2RHQ B;  2PI2 A;  4NXN L;  5EKI A;  1D7Q A;  2K52 A;  3GP7 A;  1QIL A;  2I07 B;  3GTK H;  4A3G B;  2D62 A;  1EEF D;  3W5O A;  5FLM G;  2EIF A;  4DR7 Q;  1YIT A;  2E5L Q;  2K05 A;  2QDL A;  5DM6 3;  5C4X G;  4HMJ A;  4Z9C B;  3HOW G;  1VQN A;  5LMU L;  1B9M A;  2AUJ D;  4U67 3;  1XXG A;  2ZTD A;  1JQY D;  2PQA A;  2Z6B A;  3VR5 A;  4JBM A;  4X66 L;  4M8A A;  1WI5 A;  2F0L A;  1VQM A;  4DUZ Q;  3GDE A;  4JI3 L;  4TQU S;  3FKI G;  5A2Q E;  1ROD A;  2VB2 X;  3L9A X;  4IPH A;  3HGB A;  4DUY L;  1II3 A;  3F2B A;  3ND8 A;  3H3V C;  1LO5 D;  4LF7 Q;  1PRT C;  3RLO A;  3GTK B;  4RA8 A;  1E7Z A;  1T5E A;  1JCK B;  2B3G A;  1B50 A;  4PZ6 A;  3DMU A;  1G6Z A;  1LT4 D;  4X3T A;  1Q8I A;  3NSW A;  3CXC A;  2UU9 L;  4JI5 Q;  4OIJ A;  1A8V A;  2N78 A;  2OT2 A;  1GUN A;  2KEE A;  4LF8 L;  2F0P A;  1H9K A;  1HCZ A;  2I5M X;  1B53 A;  5KYI A;  1CT1 D;  2WIN B;  2V1C C;  3NWT A;  2R7Z G;  1DGS A;  4A3L H;  4A3D B;  4B3T L;  1FGB D;  4OO1 I;  2CQO A;  1JMC A;  1SND A;  1IW7 C;  4DUZ L;  3JAM c;  2F0K A;  2R7F A;  2OCE A;  1SJE D;  4RG1 A;  1KRS A;  2QDB A;  3CCS A;  2R93 H;  4PZ8 A;  4A3K H;  3TBI B;  1M90 C;  2E2H B;  4G4K A;  4DAV A;  3BDC A;  2JE6 I;  4JI2 Q;  1EUJ A;  3F2U A;  1OXU A;  4A3B H;  3KF6 A;  4EQP A;  2H5X A;  4RCN A;  3J81 L;  3PCO B;  3RLN A;  4FDB A;  2JA7 G;  3OTO Q;  1PTO H;  3KJO A;  4XTC S;  4RKB A;  4DR1 Q;  3SK6 A;  4KJN A;  3BZC A;  1B1Z A;  1S5D D;  3ERS X;  1LT6 D;  4B3M Q;  1N9W A;  3S14 B;  1LLR D;  1N36 Q;  1JE4 A;  3RZO B;  4NXN Q;  1PLF A;  4GNX A;  1GOZ A;  1TVX A;  3MWY W;  4ABN A;  3C46 A;  2MO1 A;  3GTO H;  1MIU A;  3P75 A;  2IL8 A;  1EYD A;  4CJ2 C;  1H9S A;  3S15 H;  4A3J H;  4NKL A;  1EYC A;  2AMC B;  1V1P B;  1E3P A;  2JA8 B;  1XX8 A;  1VQ4 A;  3MFY A;  4KJO A;  3I90 A;  2CWP A;  3AEV A;  3MEF A;  4A3K B;  1CTM A;  4XT1 B;  4JI1 Q;  2NBF A;  1IYJ B;  1IBK L;  3A8I E;  1PFM A;  2E2J B;  1DZ1 A;  2MP1 A;  1IHZ A;  1HXY D;  3E9I A;  5M9O A;  1A62 A;  4WRD A;  4KI0 A;  2EY6 A;  3HKS A;  1WD1 A;  1PHJ A;  1PRT B;  2PCF B;  2NWG A;  1MKH A;  1O7Y A;  2VZA A;  3D6C A;  3Q0A A;  1HR0 L;  1AP0 A;  1VMP A;  3LGJ A;  4DFA A;  3VA5 A;  4DR2 Q;  1D5M C;  2E2I B;  3PQI A;  4R8I A;  1TWH B;  4CDF C;  5C44 G;  4OO1 H;  2DNE A;  4WOR A;  3CHB D;  1K28 A;  4EQ5 A;  1T9H A;  3S1R H;  3F1Z A;  1V8Q A;  1LAC A;  4DV0 L;  4A3F B;  2WKD A;  2F0M A;  3MXP A;  3I56 A;  3NQI A;  1GHK A;  4XQN A;  3Q8D A;  5IWA Q;  4A3B G;  2L12 A;  3C2P A;  1MJC A;  3J80 E;  1BBW A;  1BCP B;  2D9U A;  3TS0 A;  4DV5 L;  1BF4 A;  3S16 H;  3CRK C;  1HR0 Q;  1UAP A;  4APV A;  5ELD A;  5IYC G;  3C3L A;  4AYB B;  4C3I B;  2R7Z B;  4LF8 Q;  3T1H Q;  5ELO A;  1HUM A;  4PZ7 A;  1TT2 A;  2ALY B;  4DV6 Q;  4NMZ A;  1D1I A;  4YY3 Q;  4IPC A;  4ZLT F;  2F1M A;  1CI3 M;  3HS0 C;  3Q6S A;  5LHY 1;  1ESF A;  3M4Q A;  3KK7 A;  4NW2 A;  2NN6 I;  4DR5 Q;  1GVP A;  4DR3 L;  1E2W A;  4QGU A;  5EKK A;  2OTJ A;  1IYV A;  2I46 A;  4GKJ Q;  2K14 A;  3CAM A;  2K5W A;  3CCM A;  3OW2 A;  3E0E A;  1B2T A;  2KED A;  1KLG D;  1KDC A;  2M2L A;  1ZXT A;  2E2J H;  3G71 A;  1YHQ A;  4R4Q A;  1WD0 A;  1VQC A;  4C3H H;  1VQO A;  5BR8 Q;  3ND9 A;  1EY6 A;  3E6Z X;  3VYT A;  2HD3 A;  1SR3 A;  3F2C A;  3PF5 A;  4HAE A;  3G48 A;  1KTK A;  5G3L F;  1JOK A;  2O5I C;  2QW7 A;  4Y52 H;  4DAM A;  5I6Y A;  1WYD A;  1KHI A;  2XVS A;  2B2Y A;  3RUZ A;  4M1U B;  1K3R A;  3RNU A;  3UE1 A;  3OMC A;  1A2U A;  3KF8 B;  1X3G A;  5M5X H;  2OXP A;  1EQQ A;  1SE2 A;  5IE8 A;  2GVB A;  4CKC A;  4BY7 G;  4LFA Q;  5C4X B;  3GD7 A;  2HDM A;  1Y1V H;  3BZK A;  4WFN 3;  4A3M H;  4A3C G;  1I94 L;  1N8R C;  1EFW A;  2G9D A;  1S5E D;  5LL6 X;  1EOT A;  4A76 A;  4OON A;  1X3F A;  1EU4 A;  1H9R A;  1BQQ T;  2A6H D;  4DAY A;  1PH7 A;  3OIQ A;  2JP1 A;  2IY5 B;  1PTO F;  2R7Z H;  1PV4 A;  1U4P A;  1TS4 A;  3FDT A;  2RHS B;  4QQB X;  5C5L A;  4LF4 Q;  4BBS B;  4L5Q A;  2RA4 A;  4ZKC B;  1PVO A;  2K5D A;  1HNZ L;  1RTO A;  3VR2 A;  2F0J A;  2GN5 A;  1PFS A;  2RVL A;  5I4D A;  4B9X A;  4AQY L;  2K5V A;  5FO9 B;  4UHV A;  4GOP A;  4HCS A;  3UE0 A;  1K8A C;  1TWA H;  3QIA A;  3H0G B;  3H94 A;  1MI2 A;  5EPL A;  1YNJ D;  2PMZ B;  2GA4 B;  3GTM B;  1ESR A;  4JYA Q;  3BZD B;  4PMC A;  3SR1 A;  1BNZ A;  3EQL C;  4R4T A;  1TS3 A;  1HTP A;  1QG7 A;  1STH A;  2QCP X;  1WTW A;  1QZG A;  2HDL A;  1G8Z D;  3NHH A;  3I4M B;  5CC4 A;  4QJF A;  3MZ5 A;  1EOV A;  4KY6 A;  1HNZ Q;  2L11 A;  1SNM A;  3SEB A;  1D6E C;  4DF7 A;  3GTM H;  4CDC C;  4X62 Q;  1PXU A;  5C4J B;  1E2Z A;  1SMY C;  3H3V I;  1VQG A;  3KF6 B;  1HHV A;  3K5L A;  2E2D C;  4KD4 A;  2RDH A;  2HIV A;  1Q1E A;  4LFC L;  2B63 B;  3TDQ A;  4Y7N B;  3CCR A;  1ZYR C;  5M5Y B;  1EU3 A;  4OGQ C;  4EVO A;  1SE3 A;  2OQK A;  1J9O A;  3BYT B;  5A35 A;  3WDN A;  5HGQ A;  1CHQ D;  2HQE A;  3CMA A;  3L3O C;  2VUM H;  3NBH B;  2JK8 A;  4DN4 M;  1RD9 D;  3I4N H;  4FF1 A;  5C0X J;  4UDU C;  5C3W A;  3OPO A;  2A8V A;  2B63 G;  5ELC A;  2XTI A;  1DJR D;  3S2H B;  4YCU A;  2NVX H;  1TY0 A;  3ER0 A;  4DAY B;  4AQY Q;  5J1Z A;  4X3K A;  1CK1 A;  2J0T D;  1ZYR D;  1K83 H;  2EJM A;  3NWS A;  2FJ2 A;  5J39 A;  3VR3 A;  3A56 A;  3PF4 A;  1KAW A;  2HCI A;  3PSI A;  2NYZ D;  1Z7T A;  2ASB A;  1ML0 D;  2PPB C;  2ATW A;  4NP5 A;  1Q81 C;  4BY1 G;  1U4M A;  1KRT A;  4C3J B;  3ONA B;  1C4Q A;  2F0N A;  3L2P A;  4PQX A;  1XPO A;  1D5X C;  3HG9 A;  3L7Z C;  2KJX A;  2K03 A;  1FNV A;  1S40 A;  4P73 A;  3PIO A;  3S9W A;  3HOZ H;  4JI7 L;  2WKC A;  2UXC L;  1PH6 A;  2IPK D;  1GUT A;  4DV6 L;  2XRS D;  1YHA A;  2R3Z A;  3B6Y A;  1J5E L;  4B3R L;  2RBM A;  4DR1 L;  4LF5 Q;  3K7A H;  4HSV A;  1XJV A;  4V19 0;  2Z0S A;  1SE4 A;  2E8G A;  3A55 A;  1TWG B;  5G3L D;  1RL2 A;  1HPC A;  2VS1 A;  2JA6 B;  1HJP A;  1U0L A;  2PW5 A;  4JI7 Q;  4IN3 A;  1TWF B;  3E5S A;  3EBE A;  3MTS A;  1JT8 A;  3K7A B;  2KQ3 A;  4A3I G;  4HED A;  1NUC A;  4WJ3 M;  4OEL B;  4B3S L;  4LJZ C;  2K5Q A;  2Z9H A;  1I4G A;  1L0Y B;  5C3E H;  1F9S A;  1QZH A;  1A3U A;  3PMF A;  5D14 A;  2Q8T A;  1WVL A;  3TP7 A;  4HMI A;  2MQH A;  2NUC A;  4A3E G;  1G29 1;  5IP9 H;  3MXU A;  1VQ7 A;  3NBH A;  4ME5 A;  4BWG B;  1QE6 A;  2UXD Q;  2RCF A;  1IKL A;  1O7Z A;  3VR4 A;  2KCT A;  2F0I A;  4A3I B;  3U9O A;  2X69 A;  3URY A;  2JN4 A;  3A7A B;  4KN7 C;  4GOP B;  1KNA A;  1Y1W H;  3HOY G;  2P5Z X;  2WP8 J;  3A5U A;  2VQF L;  2DUD A;  2WB1 B;  4IZ8 A;  1VQ9 A;  2WII B;  1WTO A;  4LF6 Q;  2HQL A;  4F8M A;  4JBJ A;  1I6V C;  5E4X A;  3GTO B;  4JI2 L;  3DEO A;  1VS0 A;  1NNX A;  4DNI A;  1QUQ A;  3FEW X;  4DV0 Q;  5JPM C;  1VQL A;  3PGZ A;  4LAA A;  3ULL A;  2K01 A;  3CCU A;  1PA6 A;  4XIG S;  3PO3 B;  1Y14 B;  2MPM A;  2NZ1 D;  5IY0 A;  1PYB A;  2WAQ G;  5E1F A;  4R1J A;  4HJ7 A;  2NZO A;  1QNK A;  1HA5 A;  2Y0S B;  1C48 A;  1Q46 A;  5I6W A;  1STA A;  1C0A A;  1S5F D;  2CFM A;  4K0K L;  1HRJ A;  4UY8 C;  1OXV A;  3JAM L;  3T1Y L;  3PO3 H;  1TWF H;  4R9W A;  1PFB A;  4RGT A;  1G6P A;  1K0R A;  3FHW A;  1JJC B;  1F2Z A;  4MZ9 A;  4DAP A;  1IZ6 A;  1CKN A;  1A0I A;  2EYM A;  3S1N B;  1B9N A;  1TWH H;  4J8Q A;  1UNS A;  3L0O A;  2R7D A;  4GKJ L;  5C3E B;  4NXM Q;  2F0D A;  4A3G G;  4DR6 Q;  5FJ8 H;  3K59 A;  2CW0 D;  4N9P A;  4RAU C;  4L8J A;  1PRT D;  1SNO A;  3CD6 A;  1VQB A;  1X65 A;  4IQZ A;  4LUZ A;  1Y1V G;  3VA7 A;  5IYD G;  5EKL A;  2A6E C;  3M85 A;  5JJZ A;  4LWC A;  3NP8 A;  1NTG A;  2KBN A;  4A3M B;  1IW7 D;  1LM0 A;  2UUC L;  5COR A;  5GAD C;  1A3V A;  4GN3 B;  4CGY B;  5C5M A;  2AQ2 B;  1Q90 A;  1I4H A;  3FPP A;  4G57 A;  2ID0 A;  2CCZ A;  1EQR A;  1YNX A;  1Q3L A;  1EIG A;  1CZG A;  1ZKO A;  2F3W A;  4DR7 L;  2A69 D;  2G5D A;  1N34 Q;  4YY3 L;  4YWL A;  3BG3 A;  4O42 A;  4JOI C;  2A73 B;  4TVA B;  2IX1 A;  3DXJ C;  2QKI C;  1ET9 A;  1YNN C;  4POF A;  2D0O A;  4DR4 Q;  2ZT9 C;  1OXT A;  5JVH 3;  2R92 B;  2X6G A;  4DV7 L;  3KLW A;  1EQT A;  3PIP A;  3EIV A;  1F9Q A;  1XPU A;  3Q23 A;  2NTT A;  4R4O A;  4NDX A;  2OWO A;  2ZXO A;  1IL8 A;  3KFU A;  2EQS A;  3KOJ A;  1QVC A;  3KBX A;  3IL8 A;  2C5C A;  1S3O A;  1SBB B;  1VDZ A;  2M00 A;  3RZD B;  4JVZ A;  5AJ3 L;  1XPR A;  3S1N H;  3PIO 3;  3BJU A;  1WTH A;  1ZEQ X;  4DR2 L;  3FRP B;  2VB3 X;  3K80 C;  3CP0 A;  1G51 A;  3FPU B;  3J7A V;  1ENA A;  5D3I B;  2XN9 C;  1A3T A;  1STY A;  4UAI A;  4BY1 B;  3RD4 A;  1I5F A;  4JI5 L;  1T5X D;  1K9M C;  1CM9 A;  3WOE A;  2YTV A;  2YTX A;  1H9M A;  5CV8 A;  1MBY A;  1LTS D;  1KQS A;  1M8A A;  2O5J C;  1G91 A;  4RWS C;  1I4X A;  3AB9 A;  3NTK A;  2VW9 A;  3AYH B;  4FNF A;  4MTK A;  5CGK A;  5C4J H;  1U9R A;  3PO2 G;  1NY4 A;  3MXG A;  5E7N A;  2KVM A;  3OTO L;  5JJI A;  5A2Q L;  3NEL A;  4A4I A;  1L2F A;  1EFI D;  5LMN W;  4NPS A;  3SHL A;  4KHZ A;  4B3S Q;  4YWK A;  5K5P A;  1HFG A;  1JWM D;  1N36 L;  3P7J A;  1Q82 C;  5JOB A;  5KGU A;  4A3C H;  3TRE A;  2NVX B;  5FO8 B;  3K58 A;  4XT3 B;  1SMY D;  1XMQ L;  4IUN A;  4CHT B;  5KNB A;  4GNX B;  4DXG A;  1E1T A;  2A6H C;  1IBL L;  1JR0 D;  3H09 A;  2JA5 G;  3F2D A;  3KLS X;  3NPP A;  3KDF B;  2HCC A;  2K50 A;  4IUQ A;  5FLX E;  5FOB B;  2Y0S E;  3MVV A;  1SYC A;  1SRU A;  2EJF C;  4HSP A;  4X3U A;  2TSS A;  1YVC A;  3MA2 B;  2RDG A;  3S2H H;  3D4R A;  3KJP A;  1EY5 A;  4KHV A;  4AYB E;  5IGE A;  4ZUJ A;  3SVM A;  3CC2 A;  4A3E B;  1W3S A;  2N8N A;  4FF3 A;  2F0S A;  1UE1 A;  5IT9 E;  1Q7Y C;  2JA5 H;  4KKS A;  2JA7 B;  3JC6 6;  3W1G A;  4A3B B;  2ENB A;  1X6O A;  4ID6 A;  4X64 L;  2B29 A;  4EX5 A;  3HOY B;  3NEN A;  2OTL A;  5JVG 3;  4LF9 L;  5M3F B;  5H1S E;  4OO1 G;  1FVI A;  1QVF A;  4FYD A;  4X3S A;  3M7N A;  1UUP A;  2JEA I;  4XYO A;  1RJT A;  3ULP A;  2EY5 A;  3ERQ A;  3TP6 A;  4HID A;  3CME A;  1RIP A;  1OXX K;  4PMB A;  2F0O A;  3HOV G;  1SFO B;  4GKK L;  3GTJ H;  3W2D A;  4IAL A;  1I3Q H;  4MN3 A;  1KL9 A;  1S72 A;  4RHR A;  1S5C D;  4P75 A;  1IXR A;  3TP8 A;  4IUP A;  1NCV A;  2L9H A;  3EFX D;  1JE5 A;  4HN7 A;  5JEA G;  3I70 A;  4KN4 C;  5EPJ A;  1NAP A;  1BCP C;  1V9P A;  3N6R A;  1X56 A;  3H91 A;  4OIK A;  1I4P A;  1QB5 D;  1SRO A;  2JSO A;  2XNA C;  1GUS A;  2E74 C;  3HFZ B;  4O2D A;  2PYK A;  4ZYS A;  2K75 A;  4LF6 L;  3CQZ H;  3D8G A;  4LFC Q;  3S1Q H;  4LFB Q;  3HKZ B;  4QUC A;  1EYG A;  1O7I A;  1E22 A;  3S16 B;  4JYA L;  2AQ1 B;  3QJY A;  1CQF A;  5COY A;  4G7H C;  1JWU D;  1B70 B;  5C0X G;  4BBR B;  2IT1 A;  3I73 A;  4A3D H;  2XIW A;  1ICF B;  1X9N A;  4J6H A;  4JK1 C;  4JBW A;  4B9W A;  1BKB A;  4KHP L;  1FYC A;  1QCB D;  1XTD A;  1K0S A;  1EIY B;  4XYQ A;  3QO2 A;  4MTN A;  1GO3 E;  2AQ3 B;  2XSC A;  2H4O A;  4MHE A;  4HJ8 A;  4ILW A;  4P74 A;  1YJN A;  2NVT B;  1VMC A;  2ZJP A;  3F8T A;  2NVY B;  1QVG A;  1IYU A;  4YIJ A;  5HGT A;  4NB3 A;  3I8Z A;  1VQI A;  3ZYY X;  5I2X A;  2RF4 A;  5BN5 A;  4BXX G;  4X64 Q;  2I5H A;  3PIP 3;  1BBX C;  1U5K A;  4ZK9 B;  3EJI A;  2A74 C;  1WTV A;  3OHX C;  2K04 A;  1VF5 C;  2JQO A;  3AFP A;  5HY6 A;  1I94 Q;  5E4W C;  5EQ0 A;  1HZC A;  1FGU A;  1P16 A;  2JA9 A;  4OXP A;  2QF7 A;  4BBR H;  1XNQ Q;  3K8A A;  5IGB A;  1QNU A;  1DYQ A;  2FIN B;  2IJ0 A;  3Q24 A;  4BXX H;  1VCI A;  3BU2 A;  3V96 A;  2A69 C;  1JOQ A;  4PNY A;  3S15 B;  4C3J G;  5JEA H;  5J3B A;  3MXN A;  3MXN B;  1PH4 A;  3SK5 A;  4GKK Q;  1HNW Q;  1IL2 A;  1Y1W B;  4DA2 A;  3M4O H;  3NK9 A;  4TRD A;  2QA4 A;  1LTB D;  3QOL A;  3R3O A;  4CKB A;  2F3V A;  3LWE A;  3HOV B;  1STB A;  2K1B A;  3VYR A;  4YCW A;  5IYB H;  1OTC A;  1V1O A;  1R9T B;  4PMW A;  1EY9 A;  1FR3 A;  2QEX A;  1FL0 A;  5GAG C;  1K8O A;  4DR3 Q;  4MNO A;  3SDZ A;  1SN8 A;  5C4X H;  3SK4 A;  2E2I H;  4JI4 Q;  4HJ5 A;  1BUV T;  3X3M A;  2Q2U A;  4KTA A;  1CHP D;  4U68 A;  5FLM H;  1RDP D;  2B8G A;  2Z6K A;  5IT9 L;  3MC0 B;  4V0B A;  1GKH A;  3NE5 B;  2A19 A;  4X65 Q;  2NVT H;  3HKZ G;  1EY0 A;  5IGC A;  5JAV A;  1A63 A;  3PUX A;  2F4V Q;  3N52 A;  5FKA C;  2DY8 A;  3J81 E;  3DWQ A;  5ELB A;  4HCE A;  3R93 A;  3P1H A;  3WOF A;  3HOV H;  5I9O A;  3EN2 A;  2B2Y C;  5F2D A;  4DV7 Q;  1CFM A;  1PRT F;  3GTG B;  1FNU A;  5IGG A;  1RKN A;  4FXK C;  3PUY A;  1CQV A;  5M3M G;  3GO5 A;  3LWU A;  2EZV A;  2V4D A;  1NBW A;  3S17 H;  1HTL D;  3GV3 A;  4LF4 L;  3G6J B;  3TZD A;  1LTL A;  4B3M L;  3T1H L;  2IX3 A;  2Z4H A;  3T13 A;  1F2Y A;  1L0X B;  1EWC A;  1YBY A;  1XNR Q;  2B2U A;  5CV7 A;  1B8A A;  1LV9 A;  3U9S A;  3FVQ A;  1GUG A;  2PI2 E;  5EJW A;  4QF4 A;  1TQO A;  4K5X A;  1DON A;  2FMC A;  3BVM A;  2AWO A;  4BA2 I;  1I6H B;  5FJ8 G;  3HOU H;  1HNX L;  1L0W A;  4JI8 L;  4DK3 C;  1S4Z A;  2E75 C;  3HKZ E;  4BBS G;  3IFD A;  2SNS A;  3ERO A;  3SGI A;  3AU7 A;  2F0V A;  2FHT A;  3K6O A;  2WAQ E;  1AW7 A;  4H0L C;  4DKA C;  2ICE C;  1VQF A;  2SNM A;  4LUV A;  3RN5 A;  1J8I A;  2N88 A;  4K8I A;  2Y0S G;  4BY1 H;  2GVA A;  1AN8 A;  1SJH D;  4GN4 B;  2Q2T A;  4NXM L;  3ICE A;  5CV5 A;  2F0G A;  1ENC A;  1YJW A;  3K0Y A;  3HOX B;  3AQQ A;  1X3P A;  5LMN L;  3R8B A;  1PH2 A;  1KD1 C;  1DCZ A;  3I72 A;  4KD3 A;  2O2L D;  1UEB A;  2PNH A;  3S1M H;  4PG3 A;  4JI4 L;  4K6L A;  4QUF A;  1WFQ A;  1LAB A;  3SXH A;  3D3R A;  2Z1C A;  2N55 A;  1ILQ A;  3H15 A;  1BBU A;  2NTS A;  4R8N A;  3D6W A;  3T51 B;  3PO2 H;  4IPG A;  2A5H A;  1ENF A;  5DEH A;  3OMG A;  4AYB G;  4C3I G;  2CH4 W;  2K5H A;  3JAM E;  2YU9 B;  1W6K A;  3CCL A;  2Q8I B;  2JA8 H;  1HFN A;  4OL7 A;  3HRZ C;  1E0B A;  1X55 A;  2EYH A;  3DWP A;  1TS5 A;  2KUM A;  2Q2H A;  2NVY H;  1VQK A;  3V2T A;  2KOL A;  5KRU A;  2KHI A;  3X3N A;  3M4P A;  2HHH L;  1G2T A;  5IP9 G;  4A75 A;  3HOX H;  5K36 G;  1SYE A;  1EWI A;  1N32 L;  2K7V A;  1HR0 W;  2L15 A;  5I2Y A;  1EWH A;  1STE A;  1XNQ L;  2HT1 A;  3PV0 A;  1NMF A;  3W1B A;  4E6I A;  1PTO B;  2UXC Q;  2DY7 A;  2BA0 A;  2KEN A;  1D8L A;  3S24 A;  2FMM A;  3AMU A;  3CW2 C;  3CC4 A;  3BYY B;  4A3F H;  2NN6 H;  3CU7 A;  3EA6 A;  1U4R A;  3RR5 A;  5IP7 H;  2VQF Q;  3KLR A;  1GUO A;  1F9R A;  2JA6 G;  1TWG H;  1HH2 P;  1MD2 D;  4IUU A;  1CKM A;  1JWS D;  4XDX A;  2EOT A;  3PUW A;  1PZJ D;  1Y8P B;  4EQN A;  4JI3 Q;  1KDB A;  4L6T B;  4A93 G;  4C3I H;  4DNT B;  2QGQ A;  5EGT A;  2AWN A;  1SYF A;  1RHP A;  1K8G A;  2MUY A;  4JG2 A;  2M9V A;  4FXG C;  5L37 A;  1W2B A;  2WV6 D;  1SFO H;  1Y69 U;  3E3X A;  2HUG A;  3CCE A;  2D0P A;  2B39 A;  5JPN C;  1TII D;  2RSO A;  3BDO A;  4OHJ A;  5IYB G;  1STG A;  2NVQ H;  1U4L A;  2F0W A;  4QIW B;  1S5B D;  1VQD A;  2K4K A;  2UXB L;  1VQE A;  3T4A C;  1E24 A;  1KNE A;  4RGN A;  3T1Y Q;  4A93 B;  4JI8 Q;  3GTP H;  4QCL A;  4JBK A;  4A3M G;  2D5D A;  3MFG A;  1XWE A;  4IUV A;  3OW7 A;  3A54 A;  5CV4 A;  1UWV A;  5M5W B;  4BY7 H;  1YHB A;  1HA6 A;  1PTO D;  4A3D G;  1P8L A;  3I55 A;  3TP5 A;  3VYU A;  1JB7 A;  3C1E A;  2BDN A;  1MSH A;  2MGS A;  2CH4 A;  4N8F A;  4XXE A;  5M5W H;  3K5M A;  4FF2 A;  1EEI D;  4XQQ A;  1I3Q B;  3NXW A;  4DV3 L;  1Q12 A;  5LMN Q;  1WTQ A;  4LMQ D;  3HOZ B;  3PO3 G;  2NVQ B;  1PZI D;  3EVQ A;  1I50 H;  5C3X A;  3NUC A;  2DJG C;  4J15 A;  1PH9 A;  4X6A H;  5GQO A;  4C3H B;  2PW7 A;  1O7L A;  2K28 A;  4YCV A;  3PUZ A;  1DOM A;  1O78 A;  5EAY A;  4OX9 L;  2DNC A;  3TRZ A;  3IKJ A;  2KCN A;  5GAH C;  1G2S A;  3TSS A;  5KND A;  4DXF A;  4G7Z C;  1NSN S;  5CR3 A;  2PNR C;  2NN6 G;  3J7Y W;  3IAY A;  3U58 A;  5FLX c;  1ILP A;  2BCO A;  5C3E G;  5C0X H;  1K8M A;  2ZM6 Q;  3G6E A;  1X54 A;  4R4I A;  3DM1 A;  4FF4 A;  4ZUI A;  4H7B A;  1SMX A;  4DR6 L;  2E5L L;  1QJO A;  4DU9 A;  2RCN A;  1OO9 B;  1SDF A;  3A7L A;  4B3R Q;  1WCM H;  1GXD C;  2WAQ B;  1EY8 A;  2KA7 A;  3J7A F;  1H9J A;  1AE2 A;  4CJ0 B;  2ES2 A;  4ZCK A;  4K0K Q;  3M7G A;  4ME3 A;  2EYL A;  2LXK A;  4IFD J;  1A15 A;  5ELN A;  2FXQ A;  1X32 A;  4UP8 A;  5DM7 3;  4JOI A;  3HOW B;  1NR2 A;  1PH8 A;  3T53 B;  1JB3 A;  5M3M H;  1IBM Q;  2EE1 A;  2L5T A;  2CVR A;  4KK7 A;  4ODG A;  1BXT A;  1VQA A;  5JJK A;  1PYS B;  3IRB A;  3GTG H;  1JJG A;  1F2L A;  2NB0 A;  2Q2I A;  4KY7 A;  1AEX A;  1STN A;  4DK1 A;  5C4Z A;  1V43 A;  2BA1 A;  2G9H D;  4K2L A;  5M5X B;  1CA6 A;  1CKO A;  2SDF A;  2YYZ A;  1AE3 A;  1Q8K A;  1H9S B;  3RN2 A;  3M4O B;  2L55 A;  5TSS A;  1L1O A;  4KKU A;  4O1N A;  1VQH A;  1O80 A;  1JJ2 A;  1PDQ A;  1BVS A;  1LT5 D;  3GTL H;  2BDO A;  3K0X A;  3OWE B;  1ASY A;  2LKV A;  3CRL C;  4JV5 Q;  2B2T A;  4KY5 A;  1A2T A;  4QL5 A;  1GD7 A;  1LYL A;  3A74 A;  3H6M A;  4DV3 Q;  2B2U C;  1F2M A;  3S2D B;  3DUZ A;  3TEH B;  3STB C;  4C3H G;  5CV6 A;  5ISR A;  1HQM C;  1AZQ A;  1K83 B;  4LF5 L;  4LUO A;  1FD7 D;  3C1F A;  4X62 L;  5CBA E;  4B08 A;  1JOR A;  4ZRZ A;  2UUB Q;  1BCP F;  4L63 B;  2PQA B;  1SAP A;  1Z6H A;  1BDO A;  3TZU A;  1HZ9 A;  2JXM B;  3KYH C;  3JAM i;  5T1G A;  1Y8N B;  3BS1 A;  3J80 c;  1KAA A;  2EYJ A;  2B63 H;  1TKW B;  3KBG A;  2EYO A;  1B3A A;  3TQY A;  4Q0F A;  3M4Y A;  3QB3 A;  3I2Z A;  4QB4 A;  1WTR A;  3AFQ A;  4MIU A;  2JYO A;  2EJG C;  1B4O A;  3S2D H;  4ZAI A;  2VQE L;  2F0Q A;  1GJX A;  3KUP A;  3BVG A;  3G4S A;  5E3F A;  1L1O B;  2CKZ B;  1R9T H;  4ULL A;  1FNW A;  3E0J A;  3UDG A;  3OWF A;  2OF1 A;  2PQE A;  4I7A A;  2CWA A;  3MEH A;  3FMC A;  3CPW A;  1TS2 A;  3NEM A;  1M4V A;  4IUT A;  2JA8 G;  2MJ8 A;  4K5W A;  2ZTE A;  4A3K G;  3J81 j;  3DEP A;  4PV1 C;  4RMF A;  3J80 i;  3FKI H;  4GZY C;  4GLA C;  4FVM A;  3PO2 B;  4DV2 Q;  2MHV A;  2UUA Q;  4DV4 Q;  1NE3 A;  1I50 B;  3I4N B;  2J4X A;  2EVB A;  4IFD G;  1SLJ A;  1PZK D;  5IYC H;  5IGD A;  1JIC A;  2AUK A;  3FKI B;  1PMR A;  2IHF A;  4C2M B;  2E2H H;  4LK1 C;  4XQJ A;  3HOY H;  3VR6 A;  2RKS A;  1EZ6 A;  4EQO A;  5M3F H;  4BA1 I;  1YZ6 A;  4DV5 Q;  3O13 A;  3S17 B;  4KV6 A;  3HP3 A;  3I4M G;  1OXS C;  4GNX C;  3J7Z C;  3DWA A;  1BR9 A;  3J81 c;  4DV4 L;  1ET6 A;  4JW0 A;  4A3G H;  1TY2 A;  2JJQ A;  2UUA L;  3RMH A;  3RZO H;  1V1P A;  1DXM A;  2MNA A;  2WFW A;  3CQZ B;  4OWX B;  4EGV A;  3HOZ G;  2AKW B;  2O4X A;  4A3I H;  2K33 A;  3CCV A;  1UE6 A;  1HZA A;  5D65 A;  5T1I A;  3TS2 A;  1PYW D;  5KYL A;  4DK6 C;  3D31 A;  5M3F G;  4KHP Q;  4Q5V A;  5BR8 L;  1HQR D;  4I7Z C;  2VQE Q;  2F0T A;  3CPF A;  3HZX A;  3NBI A;  4HIK A;  2B2V A;  4IFD H;  2TMP A;  3CKI B;  5JJL A;  2CQA A;  2CHB D;  5BN3 A;  1F9P A;  3A0J A;  4TKO B;  1PFN A;  3KF8 A;  2B2W C;  2XWB B;  5IOC A;  2I0Q A;  5KNC A;  2YV5 A;  3U4V A;  2WB1 E;  5ELE A;  3HOU G;  1AZP A;  1C9O A;  4A93 H;  2QEJ C;  2UUB L;  2I5L X;  1QWY A;  1YI2 A;  1IBM L;  2Z4I A;  2A68 C;  1SNC A;  3VDY A;  5LMU Q;  2OEO A;  2N49 A;  3KDF A;  1K3B C;  1MHW C;  3GV6 A;  4RHS A;  2K32 A;  4RCO A;  3K5N A;  2YU9 H;  1SEB D;  2R93 G;  4QIW E;  3V05 A;  2A1A A;  3G7L A;  4J1M A;  5CMD A;  2R61 A;  1J5E Q;  5CV9 A;  4JPB W;  1FJG L;  2BE5 D;  3SK8 A;  4IOC A;  4A3L G;  1Q86 C;  4JV5 L;  3VYS A;  3TN2 A;  3K5O A;  1EIF A;  4ZQ3 A;  2VUM G;  4DK0 A;  2EDG A;  3S1R B;  2L0C A;  1WTX A;  1N33 Q;  1DOL A;  2ZXR A;  4TSS A;  4CBV A;  5CYU A;  2RQX A;  1KLU D;  1Y1W G;  4GN5 A;  3S14 H;  2IHE A;  4P71 A;  3GTP B;  1LTA D;  3WWV A;  4CKE A;  2UUC Q;  3BDL A;  1R4Q B;  3HEJ A;  4GLX A;  4WJW A;  3A8J E;  1E1O A;  4DV1 Q;  5IIF A;  1WCM G;  5IGF A;  4LW1 A;  2CW0 C;  3LX0 A;  4F87 A;  4KMU C;  3MHB A;  1L1O C;  2VUM B;  5C4H A;  4IFD I;  1Q1B A;  2Z8L A;  2EY2 A;  4GS3 A;  4DR5 L;  3P20 A;  2Z6K C;  4S3S A;  1DOK A;  2Q8R E;  4LFB L;  4JI6 Q;  2F0U A;  2B2T C;  3RZD H;  4CDD C;  1N33 L;  3I91 A;  1IBL Q;  2KHJ A;  1RCV D;  2XWJ B;  5AFW A;  3NTH A;  4RH6 A;  5ELF A;  2MFI A;  1DD2 A;  4IJH A;  4DPG A;  4L5T A;  3D4D A;  1FJG Q;  1HNX Q;  2LY7 A;  5IYD H;  3ZJY C;  4UP9 A;  2KCC A;  5LL6 S;  5JEA J;  1X3E A;  1IKM A;  2UXB Q;  2F03 A;  1N34 L;  2L4N A;  5EPK A;  2LXJ A;  2OQ0 A;  4A3J G;  4HTH A;  3UDI A;  1EY4 A;  4H02 A;  3QR8 A;  1YEZ A;  1W6J A;  1LTI D;  2LSS A;  4IJL A;  5DLQ E;  2C35 B;  1ASZ A;  5IWA L;  2KHS A;  2F0F A;  4BS9 A;  4DR4 L;  3S1M B;  2BOS A;  3I4L A;  1TXY A;  3IFT A;  2F4V L;  1TU2 B;  1Y8O B;  3H0G G;  2ZM6 L;  1KAB A;  3OIP A;  2PO4 A;  4BBS H;  3HOU B;  2DJF C;  3BVZ A;  4F88 A;  2K5N A;  4RFB A;  3D0F A;  4FP5 D;  2IX0 A;  4JI6 L;  1JOO A;  4HR7 B;  4UPA A;  1NJI C;  3K57 A;  4H13 C;  2VY3 A;  2B8F A;  2A6E D;  2R93 B;  3TME A;  5DAU A;  1B44 D;  1BOS A;  2JA6 H;  1ICW A;  3LNN A;  1TR5 A;  2R92 H;  2UU9 Q;  3K7U C;  3UI2 A;  2K6A A;  1WJJ A;  4A3F G;  2F0H A;  2AHO B;  1IBK Q;  4JI1 L;  2DN8 A;  5M3M B;  3I4N G;  3J80 L;  2F0E A;  4OWW B;  2YTY A;  3U4Z A;  1SNP A;  4K14 A;  1Z9F A;  4O0A A;  2LMC B;  1SYG A;  1XMQ Q;  4HJA A;  3UDF A;  2N3S A;  2QIL A;  4L5R C;  2D2C C;  1A6X A;  4QMG A;  5FLX L;  1HUN A;  1UEA B;  5IOD A;  1KC8 C;  1HZB A;  4F7X A;  1DM0 B;  1LT3 D;  1N32 Q;  2PMZ E;  2A68 D;  5NUC A;  1D5Z C;  2ZXP A;  1KXL A;  4A3E H;  4DV2 L;  1XNR L;  1VQP A;  3ULJ A;  1EY7 A;  1CSP A;  3KLS A;  2WAC A;  1SNQ A;  2DGY A;  5EBC A;  4KKT A;  2EY1 A;  1EIH A;  1V1Q A;  4GOP C;  2PZW A;  1H95 A;  1D1K A;  3GTJ B;  1GHJ A;  5GRO A;  1YNJ C;  1QUQ B;  2UXD L;  1BO0 A;  4IOA A;  4DV1 L;  4IPD A;  1MSG A;  2R92 G;  3HOW H;  5C0X I;  3RLF A;  3T16 A;  3QG1 A;  4RGM A;  3HOX G;  5K36 H;  1F77 A;  4C2M H;  4A3J B;  2VXW A;  3A5Z B;  1I4Q A;  1K73 C;  4GLV B;  2EYP A;  2FFK B;  4I65 A;  4LNQ A;  1TWC B;  3U50 C;  4BY7 B;  1X3Q A;  3K81 C;  4X66 Q;  4YHH L;  3I4O A;  4WJ4 A;  4AIM A;  1I6H H;  3ITP A;  3NTI A;  4N8X 1;  2IW3 A;  3H0G H;  4LF7 L;  4OWT B;  2VL6 A;  3I3C A;  3GTL B;  1SSO A;  3D4W A;  1VQJ A;  1R4P B;  2NZH A;  2EXZ A;  4K5V A;  1WOC A;  1QOH A;  1XYI A;  2SOB A;  4G7O C;  3NQT A;  2HHH Q;  2C9O A;  5GAE C;  4C56 C;  2HIX A;  3I4M H;  1MGS A;  2RSN A;  2JEB I;  3M3Y H;  2XRQ D;  1RTN A;  1LTR D;  3T56 B;  5C6A A;  1XTC D;  3DHQ A;  5IP7 G;  1Z47 A;  4UP7 A;  1E2V A;  3OOC A;  4JC0 A;  1RF2 D;  3GTQ H;  2XGT A;  4C3J H;  2VNU D;  3OSO A;  3W3A A;  1CSQ A;  2ZJR A;  1SYD A;  1B3Q A;  4LFA L;  2L1B A;  4YWM A;  1TWC H;  3QOJ A;  3H3V H;  1XMO Q;  5KIX A;  4RGO S;  1C7Y A;  1SXT A;  4Y7N H;  2J7Z A;  1MJE A;  2LS0 1;  3GTQ B;  2KEC A;  2LFN A;  2WB1 G;  3I7F A;  5D3D A;  4JI0 Q;  4FXD A;  3FP9 A;  3DLL A;  5FO7 B;  1PH5 A;  4QY7 A;  5FK9 C;  1YIJ A;  1UE5 A;  2JA7 H;  2JA5 B;  1WCM B;  4HJ9 A;  1EQV A;  4K2K A;  1UE7 A;  3DM3 A;  3M9B A;  1SE8 A;  1JC7 A;  2PZT A;  1Y1V B;  4JCV E;  2IWH A;  2E76 C;  4X65 L;  1GM5 A;  1PH3 A;  1CUK A;  4HIO A;  2BH2 A;  4C1N K;  4N9T A;  4IO9 A;  2EYF A;  2ZTC A;  1AFP A;  3R2I A;  3S1Q B;  3E9H A;  1GUW A;  3QWN A;  1CA5 A;  1VQ6 A;  1WTP A;  1B7Y B;  1M1K C;  1J6Q A;  5BN4 A;  3CCJ A;  4JI0 L;  1PTO C;  5IT9 c;  1EYA A;  5DNF A;  3UDX A;  3GQB A;  4CJ1 B;  3CCQ A;  4HIM A;  5J22 A;  1KIX A;  3J7A 5;  1AH9 A;  4ZKB B;  1LUZ A;  3MAQ A;  1PH1 A;  2ICI A;  4IUR A;  5C44 B;  1XMO L;  1VQ5 A;  2X6L A;  1CKN B;  3M3Y B;  4DGZ A;  1TWA B;  5HUR A;  4KLK A;  1CZW A;  5CBE E;  4POG A;  1EZ8 A;  3J81 i;  1EL0 A;  1D2B A;  3OYY A;  5I9P A;  4RKL A;  4FO2 A;  5C44 H;  1HNW L;  2F4I A;  2PZU A;  4K8J A;  3STB D;  4YHH Q;  4H44 C;  1ONL A;  3SE0 A;  4B3T Q;  3CC7 A;  4LF9 Q;  4L5S A;  1VQ8 A;  1YJ9 A;  4C1N I;  4P72 A;  1VF7 A;  4OX9 Q;  2MO0 A;  3A8K E;  4ALP A; 
#chains in the Genus database with same CATH homology
 2BH8 A;  3B6Y A;  1J5E L;  4B3R L;  4DR1 L;  4LF5 Q;  3HOY H;  4JI4 Q;  4HJ5 A;  2EXD A;  3K7A H;  2ZJQ A;  2Q2U A;  1NMG A;  1XJV A;  5FLM H;  5AJ3 Q;  4BA1 I;  5M3F H;  1YZ6 A;  2Z0S A;  2Z6K A;  4R4C A;  4DV5 Q;  4AH6 A;  1GKH A;  2E8G A;  3I4M G;  1OXS C;  2A19 A;  4GNX C;  4X65 Q;  1RL2 A;  2VS1 A;  2NVT H;  3HKZ G;  3J7Z C;  1HJP A;  3J81 c;  1U0L A;  1A63 A;  5M5Y H;  3PUX A;  4DV4 L;  2F3I A;  3EBE A;  4JI7 Q;  2F4V Q;  4BBR G;  2UUA L;  2JJQ A;  4A3G H;  1JT8 A;  2F52 A;  3RZO H;  3CF5 A;  3PUV A;  4A3I G;  2MNA A;  3HOV H;  2WFW A;  2R6G A;  3EN2 A;  4OWX B;  4DUY Q;  4WJ3 M;  4B3S L;  4DV7 Q;  3HOZ G;  5C3E H;  2AKW B;  1QZH A;  2KCM A;  3PUY A;  2RHQ B;  5M3M G;  2PI2 A;  3GO5 A;  3S17 H;  4NXN L;  1NBW A;  1D7Q A;  2K52 A;  4A3I H;  4LF4 L;  3CCV A;  1UE6 A;  2MQH A;  1HZA A;  3TS2 A;  1LTL A;  4B3M L;  3T1H L;  4A3E G;  3GTK H;  1G29 1;  4DK6 C;  3D31 A;  5IP9 H;  2D62 A;  3W5O A;  5FLM G;  5M3F G;  1VQ7 A;  4KHP Q;  2EIF A;  5BR8 L;  1YBY A;  4DR7 Q;  1YIT A;  2E5L Q;  1XNR Q;  2UXD Q;  1B8A A;  2KCT A;  2VQE Q;  2PI2 E;  5C4X G;  3CPF A;  4GOP B;  3HOW G;  1Y1W H;  4HIK A;  1VQN A;  3HOY G;  2WP8 J;  5LMU L;  2AWO A;  3A5U A;  4BA2 I;  5JJL A;  5FJ8 G;  3HOU H;  2VQF L;  1HNX L;  1L0W A;  2ZTD A;  2DUD A;  2PQA A;  4JI8 L;  4DK3 C;  1VQ9 A;  4JBM A;  3HKZ E;  4BBS G;  3A0J A;  4X66 L;  1WI5 A;  1VQM A;  4DUZ Q;  3GDE A;  3SGI A;  4JI3 L;  4LF6 Q;  4TQU S;  2HQL A;  3FKI G;  4JBJ A;  2I0Q A;  2WAQ E;  2YV5 A;  4IPH A;  3U4V A;  4JI2 L;  2WB1 E;  3HOU G;  1C9O A;  1VS0 A;  4DNI A;  4DUY L;  4A93 H;  4DKA C;  1QUQ A;  2UUB L;  1VQF A;  2I5L X;  3F2B A;  1YI2 A;  4LUV A;  3RN5 A;  4DV0 Q;  1IBM L;  4LF7 Q;  1VQL A;  4BY1 H;  2Y0S G;  3PGZ A;  2GVA A;  3ULL A;  3RLO A;  3VDY A;  4GN4 B;  2Q2T A;  3CCU A;  5LMU Q;  1E7Z A;  1PA6 A;  4XIG S;  4NXM L;  3ICE A;  2B3G A;  2N49 A;  1Y14 B;  4PZ6 A;  1YJW A;  5IY0 A;  3KDF A;  1PYB A;  2WAQ G;  3AQQ A;  4R1J A;  5LMN L;  1PH2 A;  1KD1 C;  4HJ7 A;  2YU9 H;  2NZO A;  3CXC A;  2UU9 L;  2R93 G;  1UEB A;  4QIW E;  4JI5 Q;  2PNH A;  1A8V A;  1Q46 A;  2A1A A;  2N78 A;  4PG3 A;  3S1M H;  4JI4 L;  1C0A A;  2CFM A;  1J5E Q;  1WFQ A;  4LF8 L;  4K0K L;  4UY8 C;  1OXV A;  3T1Y L;  3PO3 H;  1TWF H;  2I5M X;  1FJG L;  1G6P A;  1K0R A;  3FHW A;  4IOC A;  1Q86 C;  1JJC B;  4MZ9 A;  2V1C C;  1BBU A;  3H15 A;  1IZ6 A;  2R7Z G;  1DGS A;  4JV5 L;  1CKN A;  1A0I A;  3PO2 H;  4A3L H;  1EIF A;  1TWH H;  4B3T L;  2VUM G;  4IPG A;  2CQO A;  3L0O A;  2R7D A;  4OO1 I;  1JMC A;  4GKJ L;  4AYB G;  4NXM Q;  4A3G G;  2K5H A;  1N33 Q;  4DR6 Q;  5FJ8 H;  4DUZ L;  3JAM c;  2R7F A;  1Y1W G;  4GN5 A;  2OCE A;  3CCL A;  2IHE A;  4P71 A;  4RG1 A;  1KRS A;  2JA8 H;  3S14 H;  3CCS A;  3CD6 A;  2R93 H;  1VQB A;  4PZ8 A;  1X55 A;  3WWV A;  4A3K H;  1X65 A;  1M90 C;  4LUZ A;  1Y1V G;  2Q2H A;  2NVY H;  5IYD G;  1VQK A;  4JI2 Q;  2JE6 I;  2UUC Q;  1EUJ A;  2KHI A;  1OXU A;  3M4P A;  3KF6 A;  4GLX A;  2HHH L;  2H5X A;  4A3B H;  1E1O A;  4DV1 Q;  3PCO B;  5IP9 G;  3RLN A;  4FDB A;  4A75 A;  3M85 A;  2JA7 G;  1WCM G;  3OTO Q;  3HOX H;  5K36 G;  4LWC A;  4LW1 A;  1EWI A;  1NTG A;  2KBN A;  3KJO A;  1N32 L;  1LM0 A;  2UUC L;  4XTC S;  5GAD C;  1L1O C;  4GN3 B;  4DR1 Q;  4IFD I;  1HR0 W;  1Q1B A;  2L15 A;  3BZC A;  3ERS X;  4B3M Q;  4GS3 A;  1N9W A;  2HT1 A;  1XNQ L;  3PV0 A;  4DR5 L;  1N36 Q;  2Z6K C;  2ID0 A;  1NMF A;  3W1B A;  2CCZ A;  4LFB L;  1EQR A;  4JI6 Q;  4NXN Q;  3RZD H;  1YNX A;  2UXC Q;  1N33 L;  2BA0 A;  1IBL Q;  2KHJ A;  4DR7 L;  4GNX A;  2KEN A;  1D8L A;  3S24 A;  1N34 Q;  2MFI A;  4YY3 L;  4IJH A;  4DPG A;  2MO1 A;  3GTO H;  1MIU A;  3CW2 C;  4YWL A;  4L5T A;  3CC4 A;  4A3F H;  3S15 H;  4A3J H;  2AMC B;  1FJG Q;  3RR5 A;  1E3P A;  4JOI C;  4TVA B;  2IX1 A;  5IP7 H;  2VQF Q;  1HNX Q;  2JA6 G;  1VQ4 A;  5IYD H;  1TWG H;  4POF A;  3ZJY C;  1HH2 P;  2CWP A;  2D0O A;  1CKM A;  3MEF A;  4UP9 A;  1OXT A;  1X3E A;  4JI1 Q;  5JEA J;  3AEV A;  4DR4 Q;  1N34 L;  2UXB Q;  1IYJ B;  1IBK L;  3PUW A;  2LXJ A;  4JI3 Q;  4DV7 L;  2OQ0 A;  3KLW A;  4A3J G;  3UDI A;  3E9I A;  4H02 A;  4A93 G;  3PIP A;  1A62 A;  1YEZ A;  3EIV A;  2LSS A;  4IJL A;  4C3I H;  1XPU A;  2QGQ A;  2C35 B;  4KI0 A;  5DLQ E;  5IWA L;  1ASZ A;  3HKS A;  2AWN A;  4R4O A;  4DR4 L;  1TXY A;  2OWO A;  2F4V L;  1K8G A;  2ZM6 L;  3H0G G;  4JG2 A;  1PHJ A;  3KFU A;  1W2B A;  2EQS A;  3KOJ A;  1SFO H;  1QVC A;  4BBS H;  1MKH A;  2VZA A;  1HR0 L;  3LGJ A;  3CCE A;  2D0P A;  5IYB G;  4DR2 Q;  1S3O A;  2NVQ H;  5AJ3 L;  2K5N A;  1VQD A;  5C44 G;  1XPR A;  3S1N H;  2K4K A;  2UXB L;  1VQE A;  3BJU A;  3D0F A;  1T9H A;  4EQ5 A;  4DR2 L;  2IX0 A;  3K80 C;  3S1R H;  4JI6 L;  3CP0 A;  1NJI C;  3F1Z A;  4UPA A;  1G51 A;  4DV0 L;  1E24 A;  3T1Y Q;  4JI8 Q;  2VY3 A;  3I56 A;  3GTP H;  4JBK A;  4A3M G;  3Q8D A;  2JA6 H;  5IWA Q;  4A3B G;  1I5F A;  4JI5 L;  1MJC A;  1UWV A;  4BY7 H;  2R92 H;  1YHB A;  1BBW A;  3K7U C;  1K9M C;  2UU9 Q;  1WJJ A;  4A3F G;  2YTV A;  2YTX A;  3TS0 A;  4DV5 L;  4A3D G;  1KQS A;  3S16 H;  2AHO B;  1P8L A;  3I55 A;  4APV A;  5IYC G;  1IBK Q;  1HR0 Q;  4JI1 L;  1JB7 A;  4LF8 Q;  2VW9 A;  3T1H Q;  3AYH B;  5ELO A;  3I4N G;  4PZ7 A;  2ALY B;  4OWW B;  2YTY A;  5C4J H;  3U4Z A;  4DV6 Q;  5M5W H;  3PO2 G;  1NY4 A;  5E7N A;  3OTO L;  1Z9F A;  1Q12 A;  5LMN Q;  4DV3 L;  5JJI A;  4O0A A;  4YY3 Q;  4IPC A;  3NEL A;  3PO3 G;  4A4I A;  1L2F A;  1I50 H;  5LMN W;  4HJA A;  4NPS A;  3UDF A;  2N3S A;  1XMQ Q;  4J15 A;  4KHZ A;  4B3S Q;  4L5R C;  1PH9 A;  4X6A H;  3M4Q A;  4YWK A;  5GQO A;  2NN6 I;  4DR5 Q;  4YCV A;  3PUZ A;  1Q82 C;  1GVP A;  5EAY A;  4DR3 L;  1KC8 C;  1N36 L;  1HZB A;  4A3C H;  3TRE A;  4OX9 L;  4QGU A;  3TRZ A;  2OTJ A;  5GAH C;  1XMQ L;  4GKJ Q;  2K14 A;  3CAM A;  1N32 Q;  3CCM A;  4GNX B;  3E0E A;  1E1T A;  3OW2 A;  2PMZ E;  1IBL L;  2NN6 G;  1KXL A;  2E2J H;  4A3E H;  3G71 A;  4DV2 L;  1YHQ A;  1XNR L;  3U58 A;  4R4Q A;  5FLX c;  1VQP A;  1VQC A;  4C3H H;  2JA5 G;  1VQO A;  3ULJ A;  5BR8 Q;  3F2D A;  1CSP A;  3KDF B;  2K50 A;  5C3E G;  1SR3 A;  2Y0S E;  3F2C A;  3PF5 A;  2ZM6 Q;  1SRU A;  2DGY A;  3G6E A;  1X54 A;  3G48 A;  4R4I A;  1V1Q A;  4GOP C;  1H95 A;  1YVC A;  4Y52 H;  4DAM A;  3S2H H;  5GRO A;  3KJP A;  1WYD A;  4AYB E;  3CC2 A;  1KHI A;  1SMX A;  4DR6 L;  1QUQ B;  1W3S A;  2N8N A;  2E5L L;  1K3R A;  2UXD L;  4IOA A;  2RCN A;  4DV1 L;  4IPD A;  3RNU A;  1UE1 A;  3UE1 A;  2R92 G;  3HOW H;  5C0X I;  3KF8 B;  1X3G A;  1Q7Y C;  5M5X H;  3RLF A;  1EQQ A;  2JA5 H;  3JC6 6;  3W1G A;  1WCM H;  5IE8 A;  3HOX G;  1X6O A;  4B3R Q;  2GVB A;  4X64 L;  4BY7 G;  4LFA Q;  1AE2 A;  2B29 A;  4C2M H;  3GD7 A;  2ES2 A;  4EX5 A;  4K0K Q;  1Y1V H;  3BZK A;  4A3M H;  3A5Z B;  3NEN A;  2OTL A;  4LF9 L;  4A3C G;  1I94 L;  1K73 C;  1N8R C;  2E2I H;  4ME3 A;  1EFW A;  5H1S E;  2LXK A;  4OO1 G;  1FVI A;  4IFD J;  4GLV B;  4LNQ A;  3U50 C;  1QVF A;  4A76 A;  3K81 C;  4OON A;  5ELN A;  4X66 Q;  4YHH L;  2FXQ A;  3I4O A;  1X3F A;  4UP8 A;  2JEA I;  4AIM A;  4JOI A;  4WJ4 A;  1PH8 A;  3ULP A;  1I6H H;  4HID A;  3CME A;  1RIP A;  1PH7 A;  2IY5 B;  1OXX K;  2R7Z H;  3H0G H;  1PV4 A;  5M3M H;  1IBM Q;  4LF7 L;  3HOV G;  4OWT B;  2RHS B;  3M7N A;  2VL6 A;  4QQB X;  4LF4 Q;  4L5Q A;  1PVO A;  1VQA A;  1VQJ A;  2NZH A;  1PYS B;  3GTJ H;  1HNZ L;  3IRB A;  4GKK L;  3GTG H;  5JJK A;  1JJG A;  1WOC A;  1I3Q H;  1KL9 A;  2GN5 A;  1PFS A;  2HHH Q;  5GAE C;  2Q2I A;  1S72 A;  2HIX A;  4P75 A;  1IXR A;  4AQY L;  3I4M H;  2K5V A;  2JEB I;  1V43 A;  2BA1 A;  3M3Y H;  1JE5 A;  5JEA G;  4GOP A;  1CKO A;  2YYZ A;  3UE0 A;  1AE3 A;  1Q8K A;  1TWA H;  1V9P A;  5IP7 G;  3RN2 A;  1K8A C;  1Z47 A;  1X56 A;  4UP7 A;  1L1O A;  1SRO A;  4JC0 A;  1VQH A;  3GTQ H;  2XGT A;  4C3J H;  2VNU D;  3HFZ B;  4O2D A;  4JYA Q;  1JJ2 A;  1CSQ A;  1BVS A;  2ZJR A;  3GTL H;  3K0X A;  2K75 A;  1ASY A;  4LF6 L;  3CQZ H;  4LFA L;  4LFC Q;  4YWM A;  3S1Q H;  4R4T A;  4LFB Q;  4JV5 Q;  1TWC H;  1EYG A;  3H3V H;  1XMO Q;  1O7I A;  1E22 A;  1QZG A;  4QL5 A;  1C7Y A;  4JYA L;  4Y7N H;  1GD7 A;  1LYL A;  1MJE A;  4QJF A;  1EOV A;  3A74 A;  4DV3 Q;  1HNZ Q;  1B70 B;  5C0X G;  3GTM H;  2IT1 A;  4A3L G;  2WB1 G;  3TEH B;  3STB C;  4X62 Q;  3I7F A;  4JI0 Q;  4A3D H;  1X9N A;  3FP9 A;  3H3V I;  1VQG A;  3KF6 B;  4JBW A;  1BKB A;  3DLL A;  4KHP L;  1XTD A;  4LF5 L;  1PH5 A;  4QY7 A;  2HIV A;  4LUO A;  1EIY B;  1YIJ A;  1UE5 A;  2JA7 H;  1GO3 E;  1Q1E A;  4MTN A;  4LFC L;  4HJ9 A;  4HJ8 A;  4P74 A;  4X62 L;  1YJN A;  1UE7 A;  2UUB Q;  2ZJP A;  2PQA B;  3DM3 A;  3F8T A;  3M9B A;  1SE8 A;  3CCR A;  1QVG A;  4JCV E;  4NB3 A;  4X65 L;  1GM5 A;  1HZ9 A;  3KYH C;  1VQI A;  1PH3 A;  1CUK A;  2OQK A;  3JAM i;  2RF4 A;  4HIO A;  2BH2 A;  4BXX G;  4IO9 A;  4X64 Q;  2ZTC A;  2I5H A;  3J80 c;  5HGQ A;  1U5K A;  3E9H A;  2B63 H;  3CMA A;  2VUM H;  3NBH B;  2JK8 A;  3TQY A;  1VQ6 A;  2JQO A;  1B7Y B;  3AFP A;  5HY6 A;  1M1K C;  3I2Z A;  1I94 Q;  3I4N H;  1J6Q A;  3AFQ A;  1HZC A;  3CCJ A;  5IT9 c;  4JI0 L;  1FGU A;  1P16 A;  2JA9 A;  4OXP A;  5C0X J;  3UDX A;  3S2D H;  2A8V A;  2B63 G;  4BBR H;  2VQE L;  1XNQ Q;  3K8A A;  2XTI A;  3CCQ A;  4HIM A;  1KIX A;  3J7A 5;  1AH9 A;  1LUZ A;  4BXX H;  1PH1 A;  4YCU A;  3G4S A;  3ER0 A;  1VCI A;  2NVX H;  4DAY B;  3BU2 A;  4AQY Q;  1L1O B;  2CKZ B;  1R9T H;  1XMO L;  1VQ5 A;  3UDG A;  1K83 H;  1CKN B;  5J3B A;  2CWA A;  3MXN B;  1PH4 A;  3CPW A;  3PF4 A;  4GKK Q;  1HNW Q;  1IL2 A;  1KAW A;  3NEM A;  3PSI A;  2JA8 G;  3M4O H;  2ASB A;  4KLK A;  2ATW A;  2ZTE A;  1Q81 C;  4A3K G;  4BY1 G;  2QA4 A;  1KRT A;  4POG A;  3J81 i;  3J81 j;  3OYY A;  5C44 H;  4RMF A;  3J80 i;  1HNW L;  3L2P A;  3FKI H;  4GLA C;  1XPO A;  3STB D;  4YHH Q;  4DV2 Q;  4YCW A;  5IYB H;  3L7Z C;  1OTC A;  1S40 A;  4PMW A;  4P73 A;  2UUA Q;  3PIO A;  3HOZ H;  4DV4 Q;  4B3T Q;  4JI7 L;  1NE3 A;  2QEX A;  3CC7 A;  4LF9 Q;  4L5S A;  1PH6 A;  2UXC L;  1VQ8 A;  1FL0 A;  1YJ9 A;  4IFD G;  4P72 A;  5GAG C;  1SLJ A;  4OX9 Q;  4DV6 L;  5IYC H;  4DR3 Q;  4MNO A;  1YHA A;  2MO0 A;  2E2H H;  1SN8 A;  5C4X H;  2IHF A;  4ALP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...