2N3SA

Nmr assignments and structure of translation initiation factor if-1 from burkholderia thailandensis e264.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor IF-1
publication title NMR Assignments and structure of Translation initiation factor IF-1 from Burkholderia thailandensis E264.
rcsb
source organism Burkholderia thailandensis e264
total genus 8
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2n3sA00
1HH2P 2VQFQ 2I5HA 3FKIG 5M5XH 1YJWA 3S1RH 1FGUA 2UXBL 4X6AH 2BH8A 3TREA 4JI0L 2E8GA 5IWAL 1VQ6A 5C4XG 1L1OA 2K14A 2N8NA 3PIOA 3CCLA 3PO3G 3HOWG 3KJPA 4DUZL 3S1MH 2I5MX 1VQOA 2NVTH 2MQHA 3W5OA 3PUWA 4A3KG 3KDFA 1O7IA 4AIMA 4UP9A 1V43A 1VQMA 1IZ6A 3A74A 3I2ZA 3CMEA 4AQYQ 1WCMH 4DV3Q 1Z47A 4GNXA 4GLXA 3GTOH 4A3JG 1JE5A 3S16H 5IYCG 4A3DG 2R93G 1GVPA 3GTGH 4OONA 1S72A 1IL2A 1VQCA 4L5SA 2EQSA 3D31A 1YNXA 4NPSA 4LUOA 1YHAA 5IYBG 1Q86C 2R92G 3S2HH 1YHBA 2VS1A 4A3BH 1U0LA 2H5XA 4APVA 1EOVA 4BA2I 3BJUA 1K0RA 4DAYB 2DUDA 1VQFA 2I0QA 1CKNB 1RIPA 4KHPL 2HIXA 4BY1G 4HIMA 1Q82C 4OWWB 4XIGS 2UXBQ 1Q12A 1J6QA 2RHQB 2E2JH 2Z0SA 2CKZB 3STBD 4JI0Q 3S1NH 4LNQA 1NMGA 4C2MH 4NXMQ 1X55A 3H3VH 4YY3L 4JI4Q 3VDYA 3T1YQ 1VQHA 3RZOH 3CF5A 2YU9H 1N36Q 3HOUH 1SE8A 5AJ3Q 2I5LX 1LUZA 3E9IA 4DV4L 2F4VQ 5M3MH 4LF9Q 1XNRL 4MTNA 1U5KA 3KLWA 4JI5Q 1X3FA 2K52A 4JOIC 5C3EG 2NZHA 3I56A 5IP7H 2MNAA 2UUAL 3DM3A 5LMNW 5GAEC 4O2DA 2K75A 3JAMi 3J81j 4GN3B 4DR1L 2R7DA 4GOPB 4PZ8A 2CWAA 3NBHB 3CCSA 3PIPA 3PV0A 4R4IA 3CD6A 2Z6KA 4OX9Q 1PH2A 4GLAC 4ALPA 1EIFA 1S40A 5ELNA 3SGIA 4DUYL 4UY8C 4IPCA 1K83H 1QVCA 4X65Q 2F3IA 3I55A 2JA7H 4P73A 1VQGA 1N34L 2OQKA 4QQBX 1Y1VH 5FLXc 2OCEA 4Y7NH 4BXXG 3K7AH 3CCUA 3WWVA 1HNWL 1VQEA 4GNXB 3RLFA 4DV7Q 3FKIH 4DV4Q 4QL5A 4KHZA 3OW2A 4HJ9A 1HZ9A 2B29A 3G48A 1GD7A 3TEHB 3F2BA 1KRSA 1Q81C 2VQEL 2VNUD 2K5HA 4YHHQ 1CKMA 2VY3A 4BBRG 4P71A 4LFAQ 5C4XH 3MXNB 4IFDJ 1VS0A 2K5NA 3FHWA 3J80c 3AQQA 1PYSB 1HNZQ 3PO3H 2R7ZG 3TQYA 1K9MC 3HOWH 4DR1Q 4KLKA 4AYBG 2ALYB 1D8LA 2K5VA 3B6YA 3PUYA 3PF5A 4JI3L 1VQ8A 1YHQA 1W2BA 3CCVA 4A3KH 3T1HQ 3M4QA 4QGUA 1HR0Q 2VQFL 2GVBA 3I4OA 4A3DH 4A3JH 4IFDI 5IYCH 1TWHH 4DUYQ 2AWNA 2LSSA 5JJLA 2E2IH 2KHJA 2PQAA 4QY7A 2D0OA 3F8TA 2R92H 4JV5L 1X3GA 3AFPA 2LXJA 2KCMA 2NVYH 2JA6H 4DR7L 1VQDA 4IPHA 4BY1H 5IT9c 2Q2IA 4AH6A 1TWGH 4JYAL 3E0EA 1A63A 4DV2Q 1QVGA 4AQYL 2CQOA 3IRBA 4DV3L 1E22A 1MJEA 2PNHA 4K0KQ 1K73C 4DR2Q 2UUCQ 3KYHC 4PZ7A 5LMUL 3G4SA 1ASYA 1C9OA 1E7ZA 4GOPC 4DV6Q 2A8VA 1Q7YC 3ULPA 1GM5A 3J7A5 4MZ9A 5GADC 2CCZA 2IHFA 5J3BA 4A3IG 4HJ8A 1XPOA 1TWCH 2DGYA 2K4KA 5C3EH 4A3CG 3RLNA 4UPAA 1LTLA 2R6GA 1VQIA 1HZBA 2ZM6Q 1YJNA 3S2DH 1UWVA 4AYBE 3EBEA 4GS3A 2WFWA 3RZDH 4NXML 4JI4L 3RR5A 3T1YL 4JV5Q 3M4OH 1X54A 3HKSA 4GNXC 3HOYG 1N36L 4DR7Q 4X66Q 5H1SE 5AJ3L 1V1QA 1VQ5A 3S17H 3CCRA 4NB3A 1PH6A 2F4VL 1PHJA 1B70B 4LF9L 4JYAQ 1NJIC 2GVAA 2WAQG 3RLOA 3F1ZA 3U4ZA 1PH3A 4JI5L 2D62A 1X56A 2KHIA 4C3IH 1C0AA 2KCTA 5JJKA 2R7FA 1OXSC 1LYLA 1VCIA 4IJHA 4DAMA 5LMUQ 1J5EL 4UP7A 1LM0A 4BBSG 4BXXH 2MO0A 1N32Q 1QUQA 1TWFH 1I94Q 3CC7A 1UE1A 3CQZH 1MJCA 2Y0SG 3RN5A 1BKBA 4A76A 4J15A 4A3LG 3RN2A 1SROA 4OX9L 3H3VI 5M3FG 1Z9FA 5JEAG 4BBRH 3PUXA 4JBJA 1KXLA 1IBLL 4OWXB 4X65L 2RHSB 1PH8A 3AYHB 4HIKA 5FLMG 1N9WA 1B8AA 1XPRA 1YZ6A 4DV1Q 5GROA 2QGQA 2WP8J 3PF4A 5IYDG 4LWCA 4A3FG 2YV5A 1E1TA 4DV7L 4DR5Q 2HIVA 1SFOH 5C0XG 2EXDA 2OTLA 1AE2A 1Q1BA 4GLVB 2BH2A 4B3MQ 4YHHL 2ASBA 3UDFA 4OO1I 4LFAL 1YIJA 2OWOA 4HJAA 1VQNA 1J5EQ 2Z6KC 1A8VA 1HNZL 1D7QA 1OXTA 4JI7Q 5M5YH 3K0XA 2UXCQ 1UE7A 4P74A 1HNXL 4IO9A 3TS0A 2V1CC 1L2FA 1CUKA 2WAQE 3CP0A 4XTCS 3U50C 4DV5Q 2RF4A 2YTYA 3T1HL 3J7ZC 1OXXK 2NN6G 5LMNQ 1HR0L 2HHHL 3UDXA 1BVSA 1UE6A 4PZ6A 4JI1L 1JT8A 1L1OB 1AE3A 3KF6A 3J80i 3A5UA 2JE6I 5IP9G 1IBLQ 5K36G 4UP8A 1W3SA 1L0WA 2HT1A 2UXDQ 3L7ZC 4EQ5A 2Y0SE 1WFQA 2UUBL 2Q2HA 4RG1A 5IE8A 2B63G 2RCNA 1WOCA 3KDFB 5HGQA 4HIDA 3EN2A 4YCVA 4A3IH 2VUMG 3NENA 2ZJRA 1EYGA 1PVOA 1KAWA 1VQ4A 3M85A 1UE5A 4DKAC 3A0JA 3K8AA 1FVIA 1KIXA 1IBKQ 4A3CH 3CAMA 4TQUS 4DV2L 1MKHA 3ERSX 2ZTDA 5HY6A 4GKJQ 2IX1A 4GN5A 2JEAI 4K0KL 4DR2L 4LF7Q 1SLJA 1DGSA 1E3PA 2BA0A 2UUCL 4B3SL 3H15A 4LFCL 1PA6A 3H0GG 4YWLA 3HOYH 1QZHA 4DV6L 5JEAJ 1WI5A 2KBNA 3I4MG 4JI6Q 1HNXQ 2JEBI 1XJVA 2N3SA 1Y14B 3BZKA 4OWTB 3ZJYC 3KJOA 4A3MG 2HHHQ 3U4VA 2JA8G 4JI1Q 4LF5Q 3TS2A 5JJIA 2R93H 1VQPA 1TXYA 4R1JA 3GTPH 4DR3L 4MNOA 4BBSH 3D0FA 1Q46A 3UE1A 1IBMQ 1PYBA 4YCUA 3ULJA 2ZM6L 4GN4B 5IYBH 2EIFA 5C0XJ 2UUBQ 1IXRA 4IPGA 4A3LH 1X6OA 4X66L 3HFZB 5M3FH 1HR0W 1TWAH 4TVAB 4NXNL 5GAGC 4A4IA 3CC4A 3F2DA 5C4JH 2ATWA 4QJFA 4C3HH 1PFSA 2E5LQ 4LF6Q 2NVXH 5BR8Q 1SR3A 2LXKA 2NZOA 1NMFA 5FLMH 1PV4A 3HOUG 3K7UC 1GO3E 4GKKQ 3CW2C 4B3SQ 1OXVA 1XMQQ 5IYDH 4LFCQ 3NELA 1N32L 1G6PA 1PH9A 1VQJA 1XMOQ 4LF4Q 1SMXA 1YBYA 3DLLA 1I94L 3HKZG 2YYZA 4DR6Q 4A3GG 4A93G 1CKNA 1Y1WG 2MO1A 2PI2E 4LF8Q 3ICEA 3ULLA 1L1OC 4DK3C 3AEVA 4H02A 5GAHC 1PH4A 1QVFA 1AH9A 2IY5B 1YI2A 4DR3Q 2VZAA 3E9HA 3M7NA 1WYDA 1VQLA 1KC8C 4JI2L 3PSIA 3S14H 4OO1G 1YEZA 3W1GA 5C44G 4YWKA 2ES2A 2UU9L 2GN5A 3OTOQ 3PUZA 4X62Q 4DV1L 3CCMA 1X65A 2PMZE 5EAYA 3J81i 3F2CA 3GTLH 4LUVA 3UDIA 1K8GA 3HOVG 2XTIA 1B7YB 1UEBA 1X9NA 4DR5L 4NXNQ 4LFBQ 1FL0A 3L0OA 1BBUA 3BU2A 5IP9H 1XPUA 1CKOA 3CCEA 4X64Q 4L5TA 2JA9A 4B3ML 5IY0A 4BA1I 4DR4Q 3PO2G 3I4NG 4WJ4A 4A3EG 1OXUA 3GDEA 4GOPA 4B3RQ 3G6EA 3EIVA 4IOAA 4JC0A 2VUMH 1VQAA 5M5WH 4HJ7A 3U58A 4JI7L 1FJGQ 2UXCL 3HOZG 3GTKH 1KL9A 2ID0A 1P16A 1I5FA 1NBWA 4DV5L 3GTQH 3GD7A 2PQAB 4C3JH 1XTDA 2N78A 4R4CA 4R4TA 5LMNL 5FJ8G 3J81c 3FP9A 2JA5G 1JMCA 4BY7G 3BZCA 3HOXG 2MFIA 1JJCB 1Q8KA 4JBWA 2Q2TA 2R7ZH 3H0GH 4JI2Q 2ZJQA 2UXDL 1EQRA 2WB1G 3HKZE 2UU9Q 1YITA 3I4MH 3KFUA 3M3YH 4IJLA 1N33Q 4JBKA 2QEXA 4A3MH 2A1AA 4FDBA 3RNUA 2JA8H 1OTCA 2N49A 1KD1C 4IOCA 4JI8Q 1IBKL 4IFDG 1RL2A 4RMFA 4GKJL 2OTJA 2F52A 1A62A 2JA6G 1M1KC 3CMAA 1X3EA 3PCOB 1K8AC 2CWPA 2IT1A 4LF7L 1I6HH 4O0AA 3ER0A 1VQ7A 3S15H 2BA1A 2K50A 1EWIA 5IWAQ 4JI6L 2ZTEA 1K3RA 4EX5A 4B3TL 1P8LA 3NEMA 3JC66 1IYJB 1SRUA 4DV0L 4LF5L 1MIUA 4POGA 4DUZQ 1BBWA 1N8RC 2AHOB 3CXCA 1EQQA 2QA4A 2Q2UA 4JCVE 1T9HA 1PH1A 1IBML 3KF8B 2KENA 3AFQA 4DK6C 1ASZA 3LGJA 1I3QH 4A3GH 1EIYB 4QIWE 4A93H 1G51A 1Y1WH 4P75A 2C35B 3A5ZB 4P72A 2IHEA 1E1OA 1E24A 2YTXA 4PMWA 3UE0A 2E5LL 3PUVA 4R4OA 1HZAA 1QUQB 4JOIA 4LF6L 5BR8L 1A0IA 5C44H 3S1QH 1NTGA 2WB1E 1KRTA 4JG2A 4DNIA 1G291 4GKKL 3GO5A 3CCJA 1XMQL 2AWOA 4KHPQ 4R4QA 1H95A 3HOVH 5ELOA 5DLQE 1XMOL 4LF4L 4DR6L 1EUJA 4L5QA 1C7YA 1WCMG 2YTVA 1WJJA 2JK8A 2CFMA 1R9TH 4YY3Q 4LF8L 4B3TQ 4OXPA 4DPGA 5E7NA 3L2PA 1HZCA 4DV0Q 3PO2H 3I4NH 4HJ5A 1XNQL 4A3EH 3K80C 1JJGA 3JAMc 4YWMA 2D0PA 2VW9A 1EFWA 1XNRQ 1CSPA 2XGTA 4A3BG 1V9PA 4Y52H 3OTOL 4X62L 3HOZH 3Q8DA 4ME3A 1PH5A 1VQKA 3I7FA 3K81C 5GQOA 4IPDA 1VQBA 2HQLA 2UUAQ 2A19A 1CSQA 5FJ8H 3CPWA 1VQ9A 4LW1A 2JA5H 1I50H 3GTJH 3CCQA 4BY7H 3HOXH 4LFBL 3OYYA 2B3GA 2ZJPA 1QZGA 4X64L 3GTMH 1PH7A 2NVQH 4DR4L 1KQSA 5C0XI 2ZTCA 1YVCA 4KI0A 4B3RL 3PGZA 5M3MG 2IX0A 4A3FH 1NE3A 1FJGL 3KF6B 4PG3A 1N34Q 2E2HH 4YCWA 3S24A 1KHIA 1Q1EA 3CPFA 3M4PA 5IP7G 3UDGA 1HNWQ 3W1BA 1XNQQ 4HIOA 3M9BA 2JJQA 4A75A 1SN8A 2NN6I 3STBC 1JJ2A 2L15A 4L5RC 3G71A 4POFA 1JB7A 4JBMA 2OQ0A 2VQEQ 2FXQA 2AMCB 1GKHA 4LUZA 1N33L 1M90C 1S3OA 2JA7G 4WJ3M 1NY4A 1YJ9A 2AKWB 3CC2A 4JI8L 1HJPA 2VL6A 3KOJA 4JI3Q 3TRZA 1Y1VG 2JQOA 3MEFA 2PI2A 2B63H
chains in the Genus database with same CATH superfamily
1JOKA 2X69A 3BVGA 1Y8NB 2UXBL 1I4RA 3NPPA 5IWAL 1I4PA 2QDBA 3MXGA 4C3HB 3CCLA 4IUNA 4QMGA 1VQOA 2NVTH 3W5OA 4A3KG 1IZ6A 3I2ZA 1ICWA 3DUZA 5JJKA 1JE5A 5DM73 4OONA 1S72A 4L5SA 4OHJA 1MD2D 1EZ8A 4NPSA 1EOTA 1YHAA 4LUOA 3S2HH 4BA2I 2OF1A 3BYYB 1EU3A 1CKNB 2B2UC 4BY1G 1Q82C 4HIMA 2EY6A 1DONA 1Q12A 5IGFA 3MFGA 4QUFA 4C2MH 4G4KA 4YY3L 2HQEA 1AFPA 1LT6D 5AJ3Q 3E9IA 1YNNC 4ME5A 2SOBA 2C9OA 1U5KA 3TZDA 4EQNA 4CJ0B 4KKTA 1CTMA 3SK8A 1AP0A 5IP7H 2UUAL 5LMNW 5GAEC 2K75A 3JAMi 3D3RA 1AN8A 1SSOA 3LX0A 2CWAA 3C46A 2PW7A 3DWAA 5EJWA 1PH2A 1JORA 4GLAC 4AYBB 1S40A 4UY8C 4IPCA 1K83H 4IALA 2JA7H 4P73A 3PMFA 3RMHA 2EJGC 3DEPA 5IGCA 2OQKA 2CQAA 5FLXc 3O13A 1S5DD 3CCUA 3ND8A 1EYCA 3K57A 1HNWL 1VQEA 4DV4Q 1I6HB 2B29A 3TMEA 3F2BA 2F3WA 2VQEL 4ZKBB 3EROA 2VY3A 4P71A 4LFAQ 3RD4A 2WKDA 3MXNB 1RTOA 1VS0A 2B2YA 3J80c 3AQQA 3IAYA 2NB0A 4KLKA 3PF5A 3C3LA 5D65A 1HR0Q 4A3DH 2E2IH 2PQAA 2D0OA 3F8TA 5KRUA 2RA4A 1U4PA 1WTRA 3QB3A 2QF7A 2LXJA 2F0TA 2JA6H 4KV6A 4IPHA 1QB5D 5IT9c 2CW0C 1I6VC 1MJEA 4V0BA 4LAAA 4UAIA 5EKIA 5FO9B 3J7YW 5LMUL 2EOTA 2WAQB 5FLXE 1C8CA 2A8VA 1IYVA 2PO4A 1Q7YC 2EE1A 4FF1A 1B53A 4A3IG 1SNOA 1TWCH 2DGYA 5C3EH 4A3CG 3RLNA 4UPAA 5IGBA 5DEHA 2R6GA 1TY2A 2AQ2B 3J80E 3TP8A 1YJNA 4AYBE 4NXML 3RZDH 2MJ8A 3RR5A 4JI4L 3D4RA 1X54A 1A2UA 4GNXC 2J4XA 3KF8A 4X66Q 3QWNA 1STHA 1KTKA 3I4LA 2WB1B 3CKIB 1B70B 3NP8A 4LF9L 3R2IA 3F1ZA 4X3SA 4GZYC 2A68C 2EJFC 4JI5L 1C0AA 3OMCA 3IFDA 1LM0A 4BBSG 4BXXH 1O80A 2NTSA 1PYWD 1MJCA 3A55A 2M2LA 2Y0SG 3M7GA 1ESRA 3I72A 4A3LG 1TY0A 1B9MA 1SROA 5C3XA 5IT9E 3S14B 2FMMA 1PTOF 4BBRH 3PUXA 4JBJA 1NAPA 1KNEA 4X65L 3OMGA 4K5WA 2KJXA 3GTLB 1B8AA 1XPRA 5GROA 4J1MA 3PF4A 2EYOA 5EPLA 4ODGA 4DR5Q 2HIVA 4CBVA 5C0XG 1AE2A 2BH2A 1LT3D 2JN4A 1ONLA 2ASBA 3EFXD 5CYUA 1VQNA 1J5EQ 1BR9A 4C3JB 1SYBA 2UXCQ 3TS0A 3AB9A 2V1CC 2WAQE 4DV5Q 4FNFA 1FNUA 1L1OB 3A8KE 3KF6A 3J80i 5JPNC 3A5UA 5IP9G 3I4MB 1EL0A 3DWPA 5EBDA 2UXDQ 2JA8B 3L7ZC 1WFQA 4IZ8A 5A35A 2F3VA 2RCNA 3KDFB 3EN2A 3S2HB 2VUMG 1PVOA 1EYGA 4ABNA 5CR3A 3A0JA 4ZUIA 4RGTA 1BCPB 3J81E 3CAMA 3ITPA 4TQUS 3ERSX 2DJFC 5HY6A 4XDXA 4QF4A 4GKJQ 4K0KL 3HRZC 2UUCL 4C2MB 3H15A 4LFCL 5A2QL 1PA6A 3H0GG 2HD3A 5I4DA 4CDFC 3T13A 3UI2A 3KJOA 4XT3B 3U4VA 2LFNA 4JI1Q 4LF5Q 3HKZB 4RAUC 1VQPA 3P75A 3CU7A 4A93B 4YCUA 3ULJA 2UUBQ 2VB3X 4OEMB 1HR0W 1TWAH 3CC4A 5C4JH 1G2SA 1GUNA 1GOZA 4B08A 3Q6SA 5BR8Q 1SR3A 2JA7B 2NZOA 3J7AF 1IKMA 1GUSA 5AFWA 2PZUA 1G6PA 1PH9A 4LF4Q 4A3GG 3A7AB 4A3EB 1CKNA 4U68A 2J0TD 2PI2E 3ICEA 3ULLA 3D4DA 2B39A 1AH9A 1PH4A 3K59A 1SNDA 3D6CA 4FP5D 1S5ED 1VQLA 2EY5A 1KC8C 4JI2L 3A8IE 2GN5A 2JA5B 1I50B 4DV1L 4BY7B 3HOXB 1BQQT 2PMZE 3J81i 1CQVA 3HOVG 1YNJD 3UDIA 1K8GA 2NVQB 1A15A 2XTIA 1UEBA 4FVMA 4KHVA 1FL0A 1BBUA 5K36H 3EVQA 4B3ML 5IY0A 4RGOS 3PO2G 1H9JA 1OXUA 3H3VC 3G6EA 3TP7A 4FXKC 2PYKA 1PZID 1TQOA 1QNKA 5M5WH 1PRTB 3U58A 2JA6B 5CV8A 2E2DC 2QEJC 1I5FA 4DXFA 2P5ZX 2N78A 5LMNL 2XIWA 4U673 1TR5A 2MFIA 2EY1A 1JJCB 4JBWA 1CHPD 1F2ZA 2WB1G 3HKZE 2UU9Q 1YITA 3M3YH 1N33Q 4A3MH 2A1AA 3Q22A 3NE5B 3RNUA 4DK0A 1SMYD 5M5XB 3MXNA 4IFDG 1RL2A 4RMFA 2MPMA 2OTJA 1A62A 2PZWA 5J39A 1RHPA 2CWPA 2K04A 4ZAIA 1B44D 3ER0A 2V4DA 2BA1A 2K50A 2B2VC 3V96A 1C4QA 1KDBA 1DZ1A 5IGGA 4XQJA 3CXCA 4F88A 3GTGB 2KENA 1F9PA 1ASZA 1LLRD 3FVQA 1HQMC 3E3XA 1Y1WH 3A8JE 2C35B 2EDGA 2RKSA 4FXDA 2YTXA 1E24A 4RKBA 1BBXC 1QUQB 4LF6L 5C44H 1C48A 1U4MA 1YNJC 1KRTA 2KEDA 1ZKOA 5ELOA 5DLQE 1XMOL 1C7YA 2YTVA 1WJJA 1SE4A 5JAVA 2L1BA 3SR1A 1LTGD 4H13C 4LF8L 3L2PA 3I4NH 4UHVA 1XNQL 1G2TA 1AZQA 1V9PA 1JOQA 2WV6D 1A3TA 3Q8DA 1VQKA 3K81C 5GQOA 4ID6A 4IPDA 5JVH3 3NXWA 1VQBA 2PQEA 2O5JC 1CSQA 2NYZD 5ELBA 3E5SA 1VQ9A 3MC0B 4LFBL 2FMCA 3CCQA 3PQIA 4XXEA 3OYYA 1PLFA 1KDAA 4R8IA 1PH7A 3GTMH 2D2CC 2J7ZA 4KN7C 1YVCA 3PGZA 3X3NA 3K7AB 1FJGL 1K0SA 1STNA 5D14A 3QG1A 5D3DA 5IP7G 3T51B 1H9SB 4BS9A 5CV5A 2JJQA 3STBC 5IODA 4POFA 2F0HA 2OQ0A 3BDOA 1B9NA 3OW7A 4LUZA 2RBMA 4A3KB 3NHHA 2JA7G 1S4ZA 4WJ3M 2RCFA 4JI8L 1PRTD 1JICA 2B2WA 1PDQA 2MGSA 2MNAA 3NBIA 1GHKA 2PI2A 4PZ8A 1HH2P 4PQXA 1VMCA 4N8FA 2LS01 1E2WA 1J9OA 1L1OA 3SXHA 4BY1B 4EGVA 4KD4A 2I07B 3PIOA 1FGBD 4CKEA 3KJPA 4DUZL 3S1MH 3PUWA 3KDFA 1V43A 2CH4A 2MP1A 3A74A 5ELCA 1VQMA 1V1PB 3CMEA 1WCMH 4K2LA 4GLXA 3GTOH 4A3DG 2F0GA 2A6EC 2K01A 3KLSA 2PW5A 2F0PA 1VQCA 1H9MA 3I8ZA 3D31A 4KD3A 5NUCA 5JVG3 3M4YA 1WTXA 4A3BH 1U0LA 2KCNA 1RDPD 3GV3A 1TS3A 1L0YB 1ESFA 1EOVA 5FK9C 5T1IA 2HCCA 5CV4A 1K0RA 2L4NA 1TS2A 1VQFA 2DUDA 1RIPA 2X6GA 4KY6A 3S2DB 5LL6S 2AUJD 2QKIC 2RHQB 5KYIA 2Z0SA 2CKZB 3S1NH 3FPPA 5C3WA 3H3VH 4CKBA 2YU9H 1N36Q 4NP5A 1SE8A 4ZUJA 4DV4L 1Q8IA 4XQQA 5M3MH 2F4VQ 3K5LA 1XNRL 4L8JA 4MTNA 2Z6BA 1X3FA 2K52A 4LMQD 4JOIC 5C3EG 4G57A 2Z4IA 1WD0A 4NKLA 1LTAD 5A2QE 3CCSA 3TN2A 2SNSA 3NWSA 1U9RA 2Z6KA 4OX9Q 2RVLA 1L0XB 1B3AA 2XRQD 4K8JA 5ELNA 3MVVA 1NCVA 1PXUA 2FINB 1VQGA 1N34L 4QQBX 1Y1VH 4OELB 4ZQ3A 4BXXG 4KKSA 3SHLA 3WWVA 4GNXB 1Y69U 4DV7Q 1B50A 2LKVA 2AQ1B 3T16A 2IL8A 3G48A 1DJRD 1KRSA 3WOEA 2K5HA 4YHHQ 1CKMA 4BBRG 5C4XH 4MHEA 4IFDJ 1B4OA 2K5NA 2F0EA 3PO3H 1NR2A 1EEID 1K9MC 4DR1Q 1F2MA 2K5VA 1VQ8A 3MFYA 4JI3L 1YHQA 3EA6A 1AEXA 3T1HQ 3M4QA 2RDHA 4QGUA 2VQFL 2GVBA 2HDMA 3I4OA 2KECA 4A3JH 5IYCH 5CV6A 4X3KA 4N9PA 4XYOA 2KHJA 2A6HC 1YNND 2R92H 4F7XA 2KOLA 1RKNA 4HN7A 1W6JA 2F0MA 2K5DA 2Q2IA 3A56A 4AH6A 2RDGA 2K1BA 4AQYL 3IRBA 4DV3L 1E22A 5G3LD 4DR2Q 2E75C 4PZ7A 1ASYA 2JYOA 2EZVA 4GOPC 5KNBA 4DV6Q 1WTHA 1ICFB 4MZ9A 2IHFA 4BBSB 3I91A 4ZLTF 2B2TC 2Y0SB 4QIWB 1LTLA 4TKOB 1D1KA 1UWVA 2PNRC 1J8IA 4GS3A 3WDNA 3T1YL 3BYTB 3HKSA 3HZXA 3DHQA 4FF2A 4DR7Q 3BZDB 4RWSC 3S17H 3K0YA 3MWYW 1WTPA 1PHJA 1PMRA 4JYAQ 4IUTA 2GVAA 3U4ZA 3K6OA 1HQRD 1I4GA 2D62A 5BN5A 1X56A 2KHIA 4C3IH 1JQYD 2R7FA 1JWUD 1LYLA 4IJHA 2ZXPA 1J5EL 3BDCA 1QUQA 1TWFH 1HCZA 1I94Q 3CC7A 1UE1A 2SDFA 3NWTA 1BKBA 5I9OA 1S5FD 2IW3A 1M4VA 5T1GA 3ONAB 1HTPA 3P1HA 3N6RA 1RF2D 4HIKA 1N9WA 2CW0D 1MSGA 2QGQA 2WP8J 1KNAA 2F0DA 1A2TA 1EY9A 2KEEA 2YV5A 4C1NK 2EJMA 4HMIA 4KK7A 1E0BA 1SFOH 3ERQA 4RGMA 4IUPA 5J22A 3QIAA 2VUMB 4G7OC 3IFTA 2WIIB 3UDFA 2OWOA 5HURA 3GTKB 4CJ1B 1HNZL 3WOFA 1D7QA 2B8FA 2D5DA 1F77A 5M5YH 3K0XA 1UE7A 4P74A 1L2FA 2B2UA 1U4RA 3OWEB 3H0GB 1EYDA 1BVSA 1UE6A 4PZ6A 1UUPA 4JI1L 1WCMB 1AE3A 3GTOB 2JE6I 5K36G 1SYEA 5ELFA 1H9SA 1S5BD 3OWFA 2Y0SE 2UUBL 2A68D 5HGQA 3NENA 2TSSA 2DNCA 1FVIA 1KIXA 1IBKQ 4DV2L 5IGDA 4GN5A 4DF7A 4LF7Q 1DGSA 5KYLA 3HOYH 3KLRA 1EEFD 5JEAJ 3IL8A 2KBNA 1SDFA 5M3MB 3MZ5A 1HHVA 4A3MG 5D3IB 1DYQA 2F0LA 2BE5C 1I3QB 4A3GB 2XRSD 3GTPH 1I4QA 4MNOA 1IBMQ 3UE1A 2Q8TA 2BDOA 2ZM6L 4GN4B 2XSCA 4K5XA 2EIFA 5CORA 4H7BA 4IPGA 2F4IA 2KCCA 4FXGC 3NUCA 4C1NI 5M3FH 5JEAH 1V1PA 4TVAB 5GAGC 3S1QB 4A4IA 3FPUB 1PFSA 3OPOA 3HOVB 2LXKA 1TVXA 3HOUG 3K7UC 5EKKA 4GKKQ 4B3SQ 1N32L 4DR6Q 1YBYA 3DLLA 3PO2B 1PFNA 4IN3A 3TSSA 1Y1WG 3QR8A 3CHBD 4DK3C 4H02A 5GAHC 4DNTB 4DR3Q 5C4XB 2VZAA 3E9HA 5CV9A 1YEZA 5C44G 4IUVA 1BCPF 2UU9L 1GUGA 4X62Q 3CCMA 1JOOA 5EAYA 3F2CA 1STYA 2NN6H 1PZJD 3L0OA 1WD1A 4L5TA 2JA9A 5LL6X 1I4XA 2EPBA 4DR4Q 3I4NG 2MHVA 1SXTA 1F2LA 5FO8B 4JC0A 4JI7L 2K5WA 2ID0A 3GTQH 2IX3A 3NSWA 3ZYYX 3FP9A 2K33A 4S3SA 3J81c 2EYFA 1EQVA 1LABA 3VR6A 4H0LC 4IJLA 4JBKA 2N55A 4FDBA 2WKCA 3C1FA 1BF4A 1GHJA 1TU2B 2F0OA 3VR2A 1KD1C 5E4WC 2QDLA 2ICEC 3MA2B 4RGNA 5M9OA 1PFBA 5IWAQ 1QILA 4JI6L 2BDNA 4DFAA 2NVTB 4G7HC 1JE4A 1P8LA 3JC66 1SRUA 1ZYRC 4R8NA 4C3IB 4JCVE 1V8QA 2OXPA 4DK6C 1TWFB 3LGJA 1VF7A 1G51A 1NNXA 1T5EA 3UE0A 4PMWA 1WTOA 2E5LL 1JB3A 1HZAA 1PRTF 2WB1E 2L11A 1H95A 1XMQL 2E74C 4XT1B 4R4QA 1QG7A 4ZK9B 1EUJA 1DXMA 1WCMG 2CFMA 4WJWA 3SVMA 1R9TH 4YY3Q 1CA6A 4OXPA 4B3TQ 2K05A 1HZCA 4DV0Q 4YIJA 2A74C 1SYDA 3BG3A 3BVMA 2O5IC 1JJGA 2D0PA 3PIP3 4A3BG 2XGTA 3OTOL 5TSSA 5M5YB 3I7FA 4L6TB 1ET9A 2HQLA 2UUAQ 5FJ8H 4LW1A 3GTJH 2ZJPA 1QZGA 4X64L 1SNPA 5IGEA 1K83B 3VA5A 3P7JA 5C0XI 3V2TA 4KI0A 4B3RL 5M3MG 2KHSA 3SK6A 2WACA 4PG3A 2E2HH 2Z9HA 2KQ3A 3V05A 2HCIA 1HNWQ 1QJOA 4A75A 4BWGB 5I2XA 1JJ2A 1XX8A 2L15A 4KN4C 2VQEQ 1HPCA 1GKHA 3Q23A 3C1EA 1CZGA 3VA7A 2AKWB 4A3DB 2RDFA 1Y1VG 3TBIB 1EY0A 3GTPB 2E2IB 3MEFA 1R4PB 3DMUA 3GQBA 3S1RH 1FGUA 2BH8A 2LMCB 3QJYA 1EWHA 1VQ6A 5C4XG 4ILWA 4CHTB 3PO3G 1DM0B 2I5MX 1IW7C 2KA7A 1O7IA 2DJGC 3S16H 1R4QB 4A3JG 5IYCG 4HTHA 1IL2A 4LJZC 2ZXOA 2R92G 1Q86C 1OO9B 1TWCB 2HUGA 2EYHA 2VS1A 5C3EB 2H5XA 4JPBW 2HDLA 2I0QA 4ULLA 2QCPX 4KHPL 2HIXA 3RZDB 1MHWC 4XIGS 1Y8PB 1J6QA 2E2JH 3STBD 4JI0Q 5EBCA 4LNQA 2ENBA 4NXMQ 4JI4Q 3VDYA 1VQHA 3RZOH 3CF5A 1BOSA 5CC4A 3HOUH 2I5LX 1MGSA 4DU9A 5KIXA 4LF9Q 1SE3A 3OHXC 4JI5Q 4FYDA 2NZHA 5F2DA 2H1EA 3I56A 1D5ZC 1RODA 3DM3A 4O2DA 4DR1L 1WVLA 2R7DA 4GOPB 4BBRB 2K6AA 3VR3A 4R4IA 1EIFA 3SGIA 2AUKA 4KJOA 4X65Q 1NR4A 2F3IA 3I55A 3U9SA 4I65A 4C3IG 3FMCA 5EGTA 4Q0FA 4B9WA 4Y7NH 4TRDA 2A6ED 3RLFA 3FKIH 4QL5A 1H9KA 1QWYA 4KHZA 1SNQA 1WTQA 4M8AA 5J1ZA 5EPKA 3FHWA 1PYSB 2R7ZG 3TQYA 5EQ0A 3HOWH 3B6YA 2B8GA 1W2BA 5C6AA 1B2TA 4B9XA 3LWUA 4IFDI 4R9WA 1TWHH 4DUYQ 2AWNA 4M1UB 5ELEA 4EQOA 4QY7A 3K5MA 4K6LA 5BN4A 1X3GA 2RSOA 4DXGA 3W2DA 2KCMA 4DR7L 4JYAL 3E0EA 3NTKA 3QOJA 1QVGA 1EY5A 2PNHA 4K0KQ 1K73C 2UUCQ 3KYHC 1E7ZA 5KNDA 2AQ3B 3ULPA 1GM5A 4FF3A 2CCZA 2BOSA 5C4ZA 1ILQA 4HJ8A 3AMUA 3FRPB 1K3BC 1LT5D 1VQIA 1QE6A 1HZBA 4N8X1 1TWAB 4PMBA 4JV5Q 4I7ZC 5C4JB 3L3OC 3VYUA 3HOYG 3H94A 4HCEA 5H1SE 5AJ3L 1VQ5A 3SK5A 3CCRA 1PH6A 1BCPC 1PH3A 1NSNS 1D2BA 4NW2A 1OXSC 1VCIA 4RHRA 4DAMA 5C4HA 4UP7A 1HUMA 2MO0A 2F0KA 1IHZA 3CQZH 3RN5A 2A6HD 1WTVA 1X3PA 3SK4A 5M3FG 1Z9FA 5JEAG 1KXLA 1ENFA 4KY7A 4OWXB 5I2YA 2C5CA 2EYLA 1PH8A 3AYHB 1PTOC 3I70A 2L9HA 1YZ6A 4DV1Q 4LWCA 4A3FG 2R3ZA 1HUNA 3KLSX 1Q1BA 4GLVB 2DY7A 1D5MC 2O2LD 4B3MQ 5M5WB 4OO1I 1II3A 4K6DA 1YIJA 4LFAL 4HJAA 2Z6KC 1A8VA 1OXTA 3F2UA 4IO9A 1V1OA 4XTCS 3U50C 3GV6A 2RF4A 3NQIA 3J7ZC 1HR0L 2NN6G 2KUMA 5LMNQ 5DAUA 4KJNA 1IBLQ 1W3SA 3M3YB 2F0NA 1L0WA 4A3MB 2L55A 2B63G 3BDLA 2Q2HA 1T5XD 1TIID 4YCVA 1JWSD 2VB2X 4RFBA 3M85A 1VQ4A 4DKAC 3K8AA 5L37A 4JVZA 1MKHA 3I73A 2E2JB 4XQNA 3D8GA 1E3PA 2BA0A 4B3SL 3I3CA 5CV7A 4YWLA 2CVRA 4WRDA 2PPBC 3DM1A 3HOUB 2F0UA 1HNXQ 2A5HA 1K8MA 1Y14B 3BZKA 4OWTB 3ZJYC 5K5PA 2HHHQ 4PV1C 2MUYA 5JJIA 1CHQD 4DR3L 1STEA 1Y1WB 1Q46A 2R61A 3TP6A 1CA5A 3K5OA 4C56C 4X66L 1DCZA 3TZUA 3HFZB 5C44B 4RCOA 1AW7A 1HFNA 2ATWA 1CQFA 4QB4A 2G5DA 4LF6Q 4L63B 2NVXH 2ZT9C 1NMFA 2RSNA 3KBGA 5FLMH 1PV4A 3CW2C 1OXVA 1BDOA 5IYDH 3DEOA 1XMOQ 2YYZA 3I4NB 2K32A 1ILPA 2MO1A 4LF8Q 5E1FA 2F0SA 4DGZA 5IOCA 2NZ1D 3HEJA 3G7LA 1UNSA 1YI2A 3J7AV 3M7NA 1IKLA 1WYDA 4IQZA 3S14H 3PSIA 3W1GA 4HAEA 5I6WA 4YWKA 3PUZA 1X65A 4OIJA 3GTLH 3GTMB 1B7YB 3H6MA 5DNFA 4DR5L 4NXNQ 4LFBQ 2IJ0A 3NK9A 3BU2A 1XPUA 1G6ZA 4BA1I 1K28A 1ZXTA 3A54A 4GOPA 3EIVA 4UDUC 2BCOA 2BE5D 2A69C 5FO7B 1FJGQ 2UXCL 4KMUC 2G9DA 1NBWA 4DV5L 2B2TA 4C3JH 1GUTA 1XTDA 5FJ8G 3Q24A 1DOLA 1FNVA 4XYQA 3BZCA 4OGQC 1Q8KA 2Q2TA 2R7ZH 2ZJQA 2UXDL 3R3OA 2DN8A 3I4MH 1M8AA 4H44C 4K5VA 3OIPA 4KTAA 5EKLA 2JA8H 5I6YA 1OTCA 2F03A 4IOCA 4JI8Q 5LHY1 1HTLD 4GKJL 3K58A 1DOMA 4N9TA 1M1KC 1K8AC 2CHBD 4G7ZC 2IT1A 1EIHA 2F0IA 4O0AA 3OIQA 1VQ7A 3S15H 1SNCA 1EWIA 1SNMA 4FO2A 2QW7A 3S1MB 1G91A 2ZTEA 4PNYA 1K3RA 4B3TL 3NEMA 1IYJB 4DV0L 4LF5L 1MIUA 4DUZQ 1BBWA 1N8RC 1T9HA 1F9RA 1PH1A 1A6XA 4EQPA 3AFQA 4DA2A 3VR4A 4QIWE 4A93H 3CQZB 1Q90A 4P75A 4MN3A 1EY6A 4A3BB 2IHEA 1PTOH 1TT2A 2B2YC 1E1OA 4R4OA 4OO1H 5BR8L 1CZWA 1ENAA 2DY8A 3S1NB 2X6LA 4K8IA 4JG2A 5ELDA 1G291 4HMJA 3CCJA 1EQTA 3RUZA 4LF4L 3T4AC 2YU9B 2IWHA 2JK8A 1WTWA 4DPGA 4A3EH 4YWMA 2VW9A 1EFWA 1XNRQ 1CSPA 4ZYSA 1CFMA 3HOZH 1D5XC 1D1IA 4Z9CB 2NTTA 2F0JA 2ICIA 4DNRB 5BN3A 3LWEA 2N88A 2JA5H 1I50H 4BY7H 3HOXH 1IL8A 2B3GA 3NTHA 4RA8A 2NVQH 1SYCA 2IX0A 1Y1VB 4CDCC 4DAVA 1ZYRD 4DK1A 2Z1CA 4A3FH 1NE3A 1N34Q 1I4HA 4X3TA 3S24A 1Q1EA 3OOCA 3CPFA 3M4PA 3UDGA 1Z6HA 2K7VA 2QILA 1LO5D 4HIOA 3M9BA 1GJXA 3G6JB 1JB7A 3PO3B 3K5NA 2FXQA 4F87A 1FYCA 3R93A 1M90C 1N33L 1S3OA 4FF4A 1YJ9A 1KABA 3CC2A 1HXYD 2LY7A 4A3JB 3KOJA 2VL6A 4JI3Q 3TRZA 2SNMA 2JQOA 2B63H 2VQFQ 4CGYB 2I5HA 3FKIG 2R92B 5M5XH 1YJWA 2L5TA 4X6AH 4HEDA 3TREA 4CDEC 5IIFA 2M9VA 4JI0L 2E8GA 4F8MA 1U4LA 3A7LA 1QNUA 2K14A 2N8NA 3MAQA 3HOWG 2NVXB 1KAAA 5FOBB 4ZRZA 2MQHA 2M00A 4AIMA 4UP9A 3MHBA 4AQYQ 4DV3Q 1Z47A 4GNXA 2NBFA 2R93G 1GVPA 3GTGH 4CDDC 1STAA 2WINB 2EQSA 1YNXA 5IYBG 2NUCA 5CMDA 1YHBA 3MEHA 4APVA 1XWEA 3BJUA 4DAYB 4OWWB 2PZTA 3NTIA 3NQTA 4C3HG 2UXBQ 1HA6A 1TS5A 1ZEQX 3VYRA 3S17B 1NMGA 1X55A 3T1YQ 1ML0D 3DWQA 1HFGA 1LUZA 1LACA 1PZKD 2XNAC 3VYTA 2L12A 3KLWA 1LTTD 1LT4D 4J6HA 1MSHA 3J81j 4GN3B 4Q5VA 3URYA 3OSOA 1G8ZD 3NBHB 1Q3LA 3PIPA 1CI3M 3PV0A 3CD6A 2R7ZB 4ALPA 1EU4A 3GP7A 4DUYL 3I90A 3QOLA 1QVCA 1IW7D 4EVOA 2PMZB 3BVZA 4RHSA 4HSPA 1SFOB 3KUPA 2OCEA 3K7AH 3OW2A 1QCBD 5FKAC 4HJ9A 1HZ9A 3TEHB 3EQLC 1GD7A 4HCSA 1GXDC 1XYIA 2VNUD 3S15B 2O4XA 3E6ZX 3MTSA 1HNZQ 2NWGA 3IKJA 4AYBG 2ALYB 1D8LA 3PUYA 2JP1A 4HSVA 3CCVA 4A3KH 1LTBD 2IPKD 1QOHA 3FEWX 4OIKA 1E2VA 2A73B 2XVSA 2LSSA 5JJLA 4OL7A 1STBA 2KVMA 4JV5L 2EVBA 4JW0A 1PTOB 1BO0A 3E0JA 3AFPA 2NVYH 2L0CA 1VQDA 2FHTA 3W3AA 4BY1H 1TWGH 1EY8A 1A63A 4DV2Q 4HR7B 3HOYB 2CQOA 2JSOA 4K2KA 3G4SA 3SEBA 1C9OA 1TS4A 3P20A 1UAPA 3J7A5 3AU7A 5GADC 1LTRD 5J3BA 1EY7A 2K28A 1XPOA 1FD7D 2K4KA 3HOZB 1O7LA 3TDQA 1BNZA 4DAPA 1Y8OB 2ZM6Q 3S2DH 5M3FB 3L9AX 1VMPA 3EBEA 2WFWA 4I7AA 3M4OH 1EFID 1N36L 1KDCA 1V1QA 3KK7A 4NB3A 2F4VL 1RCVD 1NJIC 2WAQG 3RLOA 1LV9A 4KKUA 2FFKB 4A3FB 3R8BA 2KCTA 3H91A 2EYJA 3R2TA 5LMUQ 1N32Q 5KGUA 5JJZA 4JK1C 3JAML 4IURA 4A76A 4J15A 3RN2A 4OX9L 3H3VI 1IBLL 2RHSB 4QUCA 5KNCA 1W6KA 2JXMB 1AZPA 4J8QA 5FLMG 4QCLA 5IYDG 1CK1A 2DNEA 2GA4B 1E1TA 2D9UA 4DV7L 4V190 1X3QA 2OTLA 2B63B 2EXDA 1Z7TA 5CGKA 4IUQA 1JC7A 5E4XA 4YHHL 5JPMC 1K8OA 5G3LF 1O7ZA 2I46A 3GTQB 1SYGA 4JI7Q 1HNXL 2EXZA 1CUKA 3CP0A 1Q81C 3T1HL 2YTYA 2HHHL 1OXXK 1JT8A 2VXWA 3UDXA 4IUUA 2F0FA 4NMZA 1B1ZA 2B2VA 4UP8A 3SDZA 1IYUA 2CH4W 1BCPD 2HT1A 4EQ5A 4E6IA 4RG1A 5IE8A 1WOCA 4DN4M 4HIDA 5EPJA 4A3IH 2ZJRA 1KAWA 1O7YA 1VDZA 1UE5A 3CRLC 4A3CH 1D6EC 1NUCA 4C3JG 2ZTDA 2IX1A 2JEAI 4DR2L 1EIGA 1SLJA 2OEOA 1JCKB 3VYSA 1SEBD 1SJED 2XN9C 3HS0C 4DV6L 1QZHA 1RTNA 1WI5A 3I4MG 4JI6Q 2JEBI 1XJVA 1HA5A 1PTOD 2N3SA 3X3MA 3HG9A 1E2ZA 2JA8G 3TS2A 2R93H 1TXYA 4R1JA 4BBSH 3D0FA 2RQXA 1PYBA 1JWMD 1LTID 2PCFB 5IYBH 1STGA 5C0XJ 1IXRA 4A3LH 1X6OA 3C2PA 1X32A 4NXNL 3F2DA 4QJFA 2Q8IB 4C3HH 2E5LQ 1PFMA 1JR0D 4TSSA 1EY4A 2B2WC 2SEBD 1GO3E 1XTCD 3T56B 1XMQQ 2F0VA 2K5QA 1R9TB 4LFCQ 3NELA 1SMYC 1VQJA 4WORA 2Z4HA 1SMXA 1I94L 3HKZG 4CJ2C 4DAYA 5C0XH 4A93G 2EYMA 3QO2A 5E3FA 1CM9A 1L1OC 3AEVA 1QVFA 1F9QA 2IY5B 2XWJB 2FJ2A 4OO1G 1H9RA 2OT2A 2ES2A 1BXTA 3OTOQ 3S9WA 3GTJB 1GUOA 3HGBA 3TP5A 4LUVA 3BS1A 4PMCA 1X9NA 1UEAB 1ENCA 1CT1D 3U9OA 5IP9H 1SBBB 1CKOA 1ET6A 1SE2A 3CCEA 4X64Q 1EWCA 5KEEA 4ZKCB 1DD2A 2K03A 4WJ4A 5FLXL 5DM63 1A3UA 4A3EG 3GDEA 4B3RQ 2E2HB 4IOAA 3NBHA 2VUMH 4RKLA 5JOBA 1VQAA 4HJ7A 2NVYB 3HOZG 3GTKH 1KL9A 1P16A 3GD7A 1TWGB 2PQAB 4R4TA 4NDXA 4R4CA 2F0QA 5COYA 2JA5G 1JMCA 4BY7G 1KLUD 3J80L 4CKCA 3HOXG 4ZCKA 3H0GH 4JI2Q 2G9HD 1EQRA 3KFUA 2QEXA 1EZ6A 2N49A 1IBKL 1B3QA 4O1NA 3T53B 5CBEE 3S1RB 3PIO3 2F52A 2JA6G 3SE0A 2Z8LA 3PCOB 1X3EA 1FR3A 3CMAA 4LF7L 1VF5C 3Q0AA 1I6HH 4X3UA 2E76C 3M4OB 3ND9A 5IT9L 1O78A 1F2YA 1KLGD 3VR5A 4EX5A 1RJTA 3CRKC 4K14A 1MBYA 4POGA 3S16B 2AHOB 1EQQA 2Q2UA 2QA4A 1IBML 1EYAA 3KF8B 1GUWA 1I3QH 4A3GH 4KY5A 1EIYB 3A5ZB 4P72A 3D4WA 4RH6A 2A69D 1A3VA 1RD9D 3PUVA 4JOIA 1A0IA 1SAPA 4WFN3 1NTGA 3S1QH 4DNIA 4GKKL 4KHPQ 3GO5A 2AWOA 2F1MA 3HOVH 3KBXA 1PRTC 4DR6L 3RZOB 4LK1C 1SJHD 4L5QA 3D6WA 4MTKA 2TMPA 5E7NA 1F9SA 3PO2H 3N52A 5CBAE 4HJ5A 2EYPA 1MI2A 3K80C 3MXUA 3MXPA 3JAMc 4Y52H 2ZXRA 4X62L 4ME3A 1PH5A 1BUVT 1DOKA 2H4OA 3J81L 3HP3A 2A19A 3LNNA 3CPWA 1FNWA 3H09A 4DR4L 1KQSA 4MIUA 2ZTCA 1S5CD 1XXGA 1SYFA 5HGTA 5C5MA 4Y7NB 3DXJC 4A3IB 4O42A 2EY2A 3KF6B 4YCWA 3FKIB 1KHIA 1TKWB 4IFDH 5I9PA 1HRJA 3W1BA 1XNQQ 1LTSD 4RCNA 1SN8A 2NN6I 4L5RC 3G71A 4JBMA 5ISRA 3EJIA 3HOWB 2Q8RE 2AMCB 3FDTA 2XWBB 5C5LA 1NY4A 4P2CB 1HJPA 2R93B 1TWHB 3JAME 2F0WA
chains in the Genus database with same CATH topology
1HH2P 2VQFQ 2I5HA 3FKIG 5M5XH 1YJWA 3S1RH 1FGUA 2UXBL 4X6AH 2BH8A 3TREA 4JI0L 2E8GA 5IWAL 1VQ6A 5C4XG 1L1OA 2K14A 2N8NA 3PIOA 3CCLA 3PO3G 3HOWG 3KJPA 4DUZL 3S1MH 2I5MX 1VQOA 2NVTH 2MQHA 3W5OA 3PUWA 4A3KG 3KDFA 1O7IA 4AIMA 4UP9A 1V43A 1VQMA 1IZ6A 3A74A 3I2ZA 3CMEA 4AQYQ 1WCMH 4DV3Q 1Z47A 4GNXA 4GLXA 3GTOH 4A3JG 1JE5A 3S16H 5IYCG 4A3DG 2R93G 1GVPA 3GTGH 4OONA 1S72A 1IL2A 1VQCA 4L5SA 2EQSA 3D31A 1YNXA 4NPSA 4LUOA 1YHAA 5IYBG 1Q86C 2R92G 3S2HH 1YHBA 2VS1A 4A3BH 1U0LA 2H5XA 4APVA 1EOVA 4BA2I 3BJUA 1K0RA 4DAYB 2DUDA 1VQFA 2I0QA 1CKNB 1RIPA 4KHPL 2HIXA 4BY1G 4HIMA 1Q82C 4OWWB 4XIGS 2UXBQ 1Q12A 1J6QA 2RHQB 2E2JH 2Z0SA 2CKZB 3STBD 4JI0Q 3S1NH 4LNQA 1NMGA 4C2MH 4NXMQ 1X55A 3H3VH 4YY3L 4JI4Q 3VDYA 3T1YQ 1VQHA 3RZOH 3CF5A 2YU9H 1N36Q 3HOUH 1SE8A 5AJ3Q 2I5LX 1LUZA 3E9IA 4DV4L 2F4VQ 5M3MH 4LF9Q 1XNRL 4MTNA 1U5KA 3KLWA 4JI5Q 1X3FA 2K52A 4JOIC 5C3EG 2NZHA 3I56A 5IP7H 2MNAA 2UUAL 3DM3A 5LMNW 5GAEC 4O2DA 2K75A 3JAMi 3J81j 4GN3B 4DR1L 2R7DA 4GOPB 4PZ8A 2CWAA 3NBHB 3CCSA 3PIPA 3PV0A 4R4IA 3CD6A 2Z6KA 4OX9Q 1PH2A 4GLAC 4ALPA 1EIFA 1S40A 5ELNA 3SGIA 4DUYL 4UY8C 4IPCA 1K83H 1QVCA 4X65Q 2F3IA 3I55A 2JA7H 4P73A 1VQGA 1N34L 2OQKA 4QQBX 1Y1VH 5FLXc 2OCEA 4Y7NH 4BXXG 3K7AH 3CCUA 3WWVA 1HNWL 1VQEA 4GNXB 3RLFA 4DV7Q 3FKIH 4DV4Q 4QL5A 4KHZA 3OW2A 4HJ9A 1HZ9A 2B29A 3G48A 1GD7A 3TEHB 3F2BA 1KRSA 1Q81C 2VQEL 2VNUD 2K5HA 4YHHQ 1CKMA 2VY3A 4BBRG 4P71A 4LFAQ 5C4XH 3MXNB 4IFDJ 1VS0A 2K5NA 3FHWA 3J80c 3AQQA 1PYSB 1HNZQ 3PO3H 2R7ZG 3TQYA 1K9MC 3HOWH 4DR1Q 4KLKA 4AYBG 2ALYB 1D8LA 2K5VA 3B6YA 3PUYA 3PF5A 4JI3L 1VQ8A 1YHQA 1W2BA 3CCVA 4A3KH 3T1HQ 3M4QA 4QGUA 1HR0Q 2VQFL 2GVBA 3I4OA 4A3DH 4A3JH 4IFDI 5IYCH 1TWHH 4DUYQ 2AWNA 2LSSA 5JJLA 2E2IH 2KHJA 2PQAA 4QY7A 2D0OA 3F8TA 2R92H 4JV5L 1X3GA 3AFPA 2LXJA 2KCMA 2NVYH 2JA6H 4DR7L 1VQDA 4IPHA 4BY1H 5IT9c 2Q2IA 4AH6A 1TWGH 4JYAL 3E0EA 1A63A 4DV2Q 1QVGA 4AQYL 2CQOA 3IRBA 4DV3L 1E22A 1MJEA 2PNHA 4K0KQ 1K73C 4DR2Q 2UUCQ 3KYHC 4PZ7A 5LMUL 3G4SA 1ASYA 1C9OA 1E7ZA 4GOPC 4DV6Q 2A8VA 1Q7YC 3ULPA 1GM5A 3J7A5 4MZ9A 5GADC 2CCZA 2IHFA 5J3BA 4A3IG 4HJ8A 1XPOA 1TWCH 2DGYA 2K4KA 5C3EH 4A3CG 3RLNA 4UPAA 1LTLA 2R6GA 1VQIA 1HZBA 2ZM6Q 1YJNA 3S2DH 1UWVA 4AYBE 3EBEA 4GS3A 2WFWA 3RZDH 4NXML 4JI4L 3RR5A 3T1YL 4JV5Q 3M4OH 1X54A 3HKSA 4GNXC 3HOYG 1N36L 4DR7Q 4X66Q 5H1SE 5AJ3L 1V1QA 1VQ5A 3S17H 3CCRA 4NB3A 1PH6A 2F4VL 1PHJA 1B70B 4LF9L 4JYAQ 1NJIC 2GVAA 2WAQG 3RLOA 3F1ZA 3U4ZA 1PH3A 4JI5L 2D62A 1X56A 2KHIA 4C3IH 1C0AA 2KCTA 5JJKA 2R7FA 1OXSC 1LYLA 1VCIA 4IJHA 4DAMA 5LMUQ 1J5EL 4UP7A 1LM0A 4BBSG 4BXXH 2MO0A 1N32Q 1QUQA 1TWFH 1I94Q 3CC7A 1UE1A 3CQZH 1MJCA 2Y0SG 3RN5A 1BKBA 4A76A 4J15A 4A3LG 3RN2A 1SROA 4OX9L 3H3VI 5M3FG 1Z9FA 5JEAG 4BBRH 3PUXA 4JBJA 1KXLA 1IBLL 4OWXB 4X65L 2RHSB 1PH8A 3AYHB 4HIKA 5FLMG 1N9WA 1B8AA 1XPRA 1YZ6A 4DV1Q 5GROA 2QGQA 2WP8J 3PF4A 5IYDG 4LWCA 4A3FG 2YV5A 1E1TA 4DV7L 4DR5Q 2HIVA 1SFOH 5C0XG 2EXDA 2OTLA 1AE2A 1Q1BA 4GLVB 2BH2A 4B3MQ 4YHHL 2ASBA 3UDFA 4OO1I 4LFAL 1YIJA 2OWOA 4HJAA 1VQNA 1J5EQ 2Z6KC 1A8VA 1HNZL 1D7QA 1OXTA 4JI7Q 5M5YH 3K0XA 2UXCQ 1UE7A 4P74A 1HNXL 4IO9A 3TS0A 2V1CC 1L2FA 1CUKA 2WAQE 3CP0A 4XTCS 3U50C 4DV5Q 2RF4A 2YTYA 3T1HL 3J7ZC 1OXXK 2NN6G 5LMNQ 1HR0L 2HHHL 3UDXA 1BVSA 1UE6A 4PZ6A 4JI1L 1JT8A 1L1OB 1AE3A 3KF6A 3J80i 3A5UA 2JE6I 5IP9G 1IBLQ 5K36G 4UP8A 1W3SA 1L0WA 2HT1A 2UXDQ 3L7ZC 4EQ5A 2Y0SE 1WFQA 2UUBL 2Q2HA 4RG1A 5IE8A 2B63G 2RCNA 1WOCA 3KDFB 5HGQA 4HIDA 3EN2A 4YCVA 4A3IH 2VUMG 3NENA 2ZJRA 1EYGA 1PVOA 1KAWA 1VQ4A 3M85A 1UE5A 4DKAC 3A0JA 3K8AA 1FVIA 1KIXA 1IBKQ 4A3CH 3CAMA 4TQUS 4DV2L 1MKHA 3ERSX 2ZTDA 5HY6A 4GKJQ 2IX1A 4GN5A 2JEAI 4K0KL 4DR2L 4LF7Q 1SLJA 1DGSA 1E3PA 2BA0A 2UUCL 4B3SL 3H15A 4LFCL 1PA6A 3H0GG 4YWLA 3HOYH 1QZHA 4DV6L 5JEAJ 1WI5A 2KBNA 3I4MG 4JI6Q 1HNXQ 2JEBI 1XJVA 2N3SA 1Y14B 3BZKA 4OWTB 3ZJYC 3KJOA 4A3MG 2HHHQ 3U4VA 2JA8G 4JI1Q 4LF5Q 3TS2A 5JJIA 2R93H 1VQPA 1TXYA 4R1JA 3GTPH 4DR3L 4MNOA 4BBSH 3D0FA 1Q46A 3UE1A 1IBMQ 1PYBA 4YCUA 3ULJA 2ZM6L 4GN4B 5IYBH 2EIFA 5C0XJ 2UUBQ 1IXRA 4IPGA 4A3LH 1X6OA 4X66L 3HFZB 5M3FH 1HR0W 1TWAH 4TVAB 4NXNL 5GAGC 4A4IA 3CC4A 3F2DA 5C4JH 2ATWA 4QJFA 4C3HH 1PFSA 2E5LQ 4LF6Q 2NVXH 5BR8Q 1SR3A 2LXKA 2NZOA 1NMFA 5FLMH 1PV4A 3HOUG 3K7UC 1GO3E 4GKKQ 3CW2C 4B3SQ 1OXVA 1XMQQ 5IYDH 4LFCQ 3NELA 1N32L 1G6PA 1PH9A 1VQJA 1XMOQ 4LF4Q 1SMXA 1YBYA 3DLLA 1I94L 3HKZG 2YYZA 4DR6Q 4A3GG 4A93G 1CKNA 1Y1WG 2MO1A 2PI2E 4LF8Q 3ICEA 3ULLA 1L1OC 4DK3C 3AEVA 4H02A 5GAHC 1PH4A 1QVFA 1AH9A 2IY5B 1YI2A 4DR3Q 2VZAA 3E9HA 3M7NA 1WYDA 1VQLA 1KC8C 4JI2L 3PSIA 3S14H 4OO1G 1YEZA 3W1GA 5C44G 4YWKA 2ES2A 2UU9L 2GN5A 3OTOQ 3PUZA 4X62Q 4DV1L 3CCMA 1X65A 2PMZE 5EAYA 3J81i 3F2CA 3GTLH 4LUVA 3UDIA 1K8GA 3HOVG 2XTIA 1B7YB 1UEBA 1X9NA 4DR5L 4NXNQ 4LFBQ 1FL0A 3L0OA 1BBUA 3BU2A 5IP9H 1XPUA 1CKOA 3CCEA 4X64Q 4L5TA 2JA9A 4B3ML 5IY0A 4BA1I 4DR4Q 3PO2G 3I4NG 4WJ4A 4A3EG 1OXUA 3GDEA 4GOPA 4B3RQ 3G6EA 3EIVA 4IOAA 4JC0A 2VUMH 1VQAA 5M5WH 4HJ7A 3U58A 4JI7L 1FJGQ 2UXCL 3HOZG 3GTKH 1KL9A 2ID0A 1P16A 1I5FA 1NBWA 4DV5L 3GTQH 3GD7A 2PQAB 4C3JH 1XTDA 2N78A 4R4CA 4R4TA 5LMNL 5FJ8G 3J81c 3FP9A 2JA5G 1JMCA 4BY7G 3BZCA 3HOXG 2MFIA 1JJCB 1Q8KA 4JBWA 2Q2TA 2R7ZH 3H0GH 4JI2Q 2ZJQA 2UXDL 1EQRA 2WB1G 3HKZE 2UU9Q 1YITA 3I4MH 3KFUA 3M3YH 4IJLA 1N33Q 4JBKA 2QEXA 4A3MH 2A1AA 4FDBA 3RNUA 2JA8H 1OTCA 2N49A 1KD1C 4IOCA 4JI8Q 1IBKL 4IFDG 1RL2A 4RMFA 4GKJL 2OTJA 2F52A 1A62A 2JA6G 1M1KC 3CMAA 1X3EA 3PCOB 1K8AC 2CWPA 2IT1A 4LF7L 1I6HH 4O0AA 3ER0A 1VQ7A 3S15H 2BA1A 2K50A 1EWIA 5IWAQ 4JI6L 2ZTEA 1K3RA 4EX5A 4B3TL 1P8LA 3NEMA 3JC66 1IYJB 1SRUA 4DV0L 4LF5L 1MIUA 4POGA 4DUZQ 1BBWA 1N8RC 2AHOB 3CXCA 1EQQA 2QA4A 2Q2UA 4JCVE 1T9HA 1PH1A 1IBML 3KF8B 2KENA 3AFQA 4DK6C 1ASZA 3LGJA 1I3QH 4A3GH 1EIYB 4QIWE 4A93H 1G51A 1Y1WH 4P75A 2C35B 3A5ZB 4P72A 2IHEA 1E1OA 1E24A 2YTXA 4PMWA 3UE0A 2E5LL 3PUVA 4R4OA 1HZAA 1QUQB 4JOIA 4LF6L 5BR8L 1A0IA 5C44H 3S1QH 1NTGA 2WB1E 1KRTA 4JG2A 4DNIA 1G291 4GKKL 3GO5A 3CCJA 1XMQL 2AWOA 4KHPQ 4R4QA 1H95A 3HOVH 5ELOA 5DLQE 1XMOL 4LF4L 4DR6L 1EUJA 4L5QA 1C7YA 1WCMG 2YTVA 1WJJA 2JK8A 2CFMA 1R9TH 4YY3Q 4LF8L 4B3TQ 4OXPA 4DPGA 5E7NA 3L2PA 1HZCA 4DV0Q 3PO2H 3I4NH 4HJ5A 1XNQL 4A3EH 3K80C 1JJGA 3JAMc 4YWMA 2D0PA 2VW9A 1EFWA 1XNRQ 1CSPA 2XGTA 4A3BG 1V9PA 4Y52H 3OTOL 4X62L 3HOZH 3Q8DA 4ME3A 1PH5A 1VQKA 3I7FA 3K81C 5GQOA 4IPDA 1VQBA 2HQLA 2UUAQ 2A19A 1CSQA 5FJ8H 3CPWA 1VQ9A 4LW1A 2JA5H 1I50H 3GTJH 3CCQA 4BY7H 3HOXH 4LFBL 3OYYA 2B3GA 2ZJPA 1QZGA 4X64L 3GTMH 1PH7A 2NVQH 4DR4L 1KQSA 5C0XI 2ZTCA 1YVCA 4KI0A 4B3RL 3PGZA 5M3MG 2IX0A 4A3FH 1NE3A 1FJGL 3KF6B 4PG3A 1N34Q 2E2HH 4YCWA 3S24A 1KHIA 1Q1EA 3CPFA 3M4PA 5IP7G 3UDGA 1HNWQ 3W1BA 1XNQQ 4HIOA 3M9BA 2JJQA 4A75A 1SN8A 2NN6I 3STBC 1JJ2A 2L15A 4L5RC 3G71A 4POFA 1JB7A 4JBMA 2OQ0A 2VQEQ 2FXQA 2AMCB 1GKHA 4LUZA 1N33L 1M90C 1S3OA 2JA7G 4WJ3M 1NY4A 1YJ9A 2AKWB 3CC2A 4JI8L 1HJPA 2VL6A 3KOJA 4JI3Q 3TRZA 1Y1VG 2JQOA 3MEFA 2PI2A 2B63H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HH2 P;  2VQF Q;  2I5H A;  3FKI G;  5M5X H;  1YJW A;  3S1R H;  1FGU A;  2UXB L;  4X6A H;  2BH8 A;  3TRE A;  4JI0 L;  2E8G A;  5IWA L;  1VQ6 A;  5C4X G;  1L1O A;  2K14 A;  2N8N A;  3PIO A;  3CCL A;  3PO3 G;  3HOW G;  3KJP A;  4DUZ L;  3S1M H;  2I5M X;  1VQO A;  2NVT H;  2MQH A;  3W5O A;  3PUW A;  4A3K G;  3KDF A;  1O7I A;  4AIM A;  4UP9 A;  1V43 A;  1VQM A;  1IZ6 A;  3A74 A;  3I2Z A;  3CME A;  4AQY Q;  1WCM H;  4DV3 Q;  1Z47 A;  4GNX A;  4GLX A;  3GTO H;  4A3J G;  1JE5 A;  3S16 H;  5IYC G;  4A3D G;  2R93 G;  1GVP A;  3GTG H;  4OON A;  1S72 A;  1IL2 A;  1VQC A;  4L5S A;  2EQS A;  3D31 A;  1YNX A;  4NPS A;  4LUO A;  1YHA A;  5IYB G;  1Q86 C;  2R92 G;  3S2H H;  1YHB A;  2VS1 A;  4A3B H;  1U0L A;  2H5X A;  4APV A;  1EOV A;  4BA2 I;  3BJU A;  1K0R A;  4DAY B;  2DUD A;  1VQF A;  2I0Q A;  1CKN B;  1RIP A;  4KHP L;  2HIX A;  4BY1 G;  4HIM A;  1Q82 C;  4OWW B;  4XIG S;  2UXB Q;  1Q12 A;  1J6Q A;  2RHQ B;  2E2J H;  2Z0S A;  2CKZ B;  3STB D;  4JI0 Q;  3S1N H;  4LNQ A;  1NMG A;  4C2M H;  4NXM Q;  1X55 A;  3H3V H;  4YY3 L;  4JI4 Q;  3VDY A;  3T1Y Q;  1VQH A;  3RZO H;  3CF5 A;  2YU9 H;  1N36 Q;  3HOU H;  1SE8 A;  5AJ3 Q;  2I5L X;  1LUZ A;  3E9I A;  4DV4 L;  2F4V Q;  5M3M H;  4LF9 Q;  1XNR L;  4MTN A;  1U5K A;  3KLW A;  4JI5 Q;  1X3F A;  2K52 A;  4JOI C;  5C3E G;  2NZH A;  3I56 A;  5IP7 H;  2MNA A;  2UUA L;  3DM3 A;  5LMN W;  5GAE C;  4O2D A;  2K75 A;  3JAM i;  3J81 j;  4GN3 B;  4DR1 L;  2R7D A;  4GOP B;  4PZ8 A;  2CWA A;  3NBH B;  3CCS A;  3PIP A;  3PV0 A;  4R4I A;  3CD6 A;  2Z6K A;  4OX9 Q;  1PH2 A;  4GLA C;  4ALP A;  1EIF A;  1S40 A;  5ELN A;  3SGI A;  4DUY L;  4UY8 C;  4IPC A;  1K83 H;  1QVC A;  4X65 Q;  2F3I A;  3I55 A;  2JA7 H;  4P73 A;  1VQG A;  1N34 L;  2OQK A;  4QQB X;  1Y1V H;  5FLX c;  2OCE A;  4Y7N H;  4BXX G;  3K7A H;  3CCU A;  3WWV A;  1HNW L;  1VQE A;  4GNX B;  3RLF A;  4DV7 Q;  3FKI H;  4DV4 Q;  4QL5 A;  4KHZ A;  3OW2 A;  4HJ9 A;  1HZ9 A;  2B29 A;  3G48 A;  1GD7 A;  3TEH B;  3F2B A;  1KRS A;  1Q81 C;  2VQE L;  2VNU D;  2K5H A;  4YHH Q;  1CKM A;  2VY3 A;  4BBR G;  4P71 A;  4LFA Q;  5C4X H;  3MXN B;  4IFD J;  1VS0 A;  2K5N A;  3FHW A;  3J80 c;  3AQQ A;  1PYS B;  1HNZ Q;  3PO3 H;  2R7Z G;  3TQY A;  1K9M C;  3HOW H;  4DR1 Q;  4KLK A;  4AYB G;  2ALY B;  1D8L A;  2K5V A;  3B6Y A;  3PUY A;  3PF5 A;  4JI3 L;  1VQ8 A;  1YHQ A;  1W2B A;  3CCV A;  4A3K H;  3T1H Q;  3M4Q A;  4QGU A;  1HR0 Q;  2VQF L;  2GVB A;  3I4O A;  4A3D H;  4A3J H;  4IFD I;  5IYC H;  1TWH H;  4DUY Q;  2AWN A;  2LSS A;  5JJL A;  2E2I H;  2KHJ A;  2PQA A;  4QY7 A;  2D0O A;  3F8T A;  2R92 H;  4JV5 L;  1X3G A;  3AFP A;  2LXJ A;  2KCM A;  2NVY H;  2JA6 H;  4DR7 L;  1VQD A;  4IPH A;  4BY1 H;  5IT9 c;  2Q2I A;  4AH6 A;  1TWG H;  4JYA L;  3E0E A;  1A63 A;  4DV2 Q;  1QVG A;  4AQY L;  2CQO A;  3IRB A;  4DV3 L;  1E22 A;  1MJE A;  2PNH A;  4K0K Q;  1K73 C;  4DR2 Q;  2UUC Q;  3KYH C;  4PZ7 A;  5LMU L;  3G4S A;  1ASY A;  1C9O A;  1E7Z A;  4GOP C;  4DV6 Q;  2A8V A;  1Q7Y C;  3ULP A;  1GM5 A;  3J7A 5;  4MZ9 A;  5GAD C;  2CCZ A;  2IHF A;  5J3B A;  4A3I G;  4HJ8 A;  1XPO A;  1TWC H;  2DGY A;  2K4K A;  5C3E H;  4A3C G;  3RLN A;  4UPA A;  1LTL A;  2R6G A;  1VQI A;  1HZB A;  2ZM6 Q;  1YJN A;  3S2D H;  1UWV A;  4AYB E;  3EBE A;  4GS3 A;  2WFW A;  3RZD H;  4NXM L;  4JI4 L;  3RR5 A;  3T1Y L;  4JV5 Q;  3M4O H;  1X54 A;  3HKS A;  4GNX C;  3HOY G;  1N36 L;  4DR7 Q;  4X66 Q;  5H1S E;  5AJ3 L;  1V1Q A;  1VQ5 A;  3S17 H;  3CCR A;  4NB3 A;  1PH6 A;  2F4V L;  1PHJ A;  1B70 B;  4LF9 L;  4JYA Q;  1NJI C;  2GVA A;  2WAQ G;  3RLO A;  3F1Z A;  3U4Z A;  1PH3 A;  4JI5 L;  2D62 A;  1X56 A;  2KHI A;  4C3I H;  1C0A A;  2KCT A;  5JJK A;  2R7F A;  1OXS C;  1LYL A;  1VCI A;  4IJH A;  4DAM A;  5LMU Q;  1J5E L;  4UP7 A;  1LM0 A;  4BBS G;  4BXX H;  2MO0 A;  1N32 Q;  1QUQ A;  1TWF H;  1I94 Q;  3CC7 A;  1UE1 A;  3CQZ H;  1MJC A;  2Y0S G;  3RN5 A;  1BKB A;  4A76 A;  4J15 A;  4A3L G;  3RN2 A;  1SRO A;  4OX9 L;  3H3V I;  5M3F G;  1Z9F A;  5JEA G;  4BBR H;  3PUX A;  4JBJ A;  1KXL A;  1IBL L;  4OWX B;  4X65 L;  2RHS B;  1PH8 A;  3AYH B;  4HIK A;  5FLM G;  1N9W A;  1B8A A;  1XPR A;  1YZ6 A;  4DV1 Q;  5GRO A;  2QGQ A;  2WP8 J;  3PF4 A;  5IYD G;  4LWC A;  4A3F G;  2YV5 A;  1E1T A;  4DV7 L;  4DR5 Q;  2HIV A;  1SFO H;  5C0X G;  2EXD A;  2OTL A;  1AE2 A;  1Q1B A;  4GLV B;  2BH2 A;  4B3M Q;  4YHH L;  2ASB A;  3UDF A;  4OO1 I;  4LFA L;  1YIJ A;  2OWO A;  4HJA A;  1VQN A;  1J5E Q;  2Z6K C;  1A8V A;  1HNZ L;  1D7Q A;  1OXT A;  4JI7 Q;  5M5Y H;  3K0X A;  2UXC Q;  1UE7 A;  4P74 A;  1HNX L;  4IO9 A;  3TS0 A;  2V1C C;  1L2F A;  1CUK A;  2WAQ E;  3CP0 A;  4XTC S;  3U50 C;  4DV5 Q;  2RF4 A;  2YTY A;  3T1H L;  3J7Z C;  1OXX K;  2NN6 G;  5LMN Q;  1HR0 L;  2HHH L;  3UDX A;  1BVS A;  1UE6 A;  4PZ6 A;  4JI1 L;  1JT8 A;  1L1O B;  1AE3 A;  3KF6 A;  3J80 i;  3A5U A;  2JE6 I;  5IP9 G;  1IBL Q;  5K36 G;  4UP8 A;  1W3S A;  1L0W A;  2HT1 A;  2UXD Q;  3L7Z C;  4EQ5 A;  2Y0S E;  1WFQ A;  2UUB L;  2Q2H A;  4RG1 A;  5IE8 A;  2B63 G;  2RCN A;  1WOC A;  3KDF B;  5HGQ A;  4HID A;  3EN2 A;  4YCV A;  4A3I H;  2VUM G;  3NEN A;  2ZJR A;  1EYG A;  1PVO A;  1KAW A;  1VQ4 A;  3M85 A;  1UE5 A;  4DKA C;  3A0J A;  3K8A A;  1FVI A;  1KIX A;  1IBK Q;  4A3C H;  3CAM A;  4TQU S;  4DV2 L;  1MKH A;  3ERS X;  2ZTD A;  5HY6 A;  4GKJ Q;  2IX1 A;  4GN5 A;  2JEA I;  4K0K L;  4DR2 L;  4LF7 Q;  1SLJ A;  1DGS A;  1E3P A;  2BA0 A;  2UUC L;  4B3S L;  3H15 A;  4LFC L;  1PA6 A;  3H0G G;  4YWL A;  3HOY H;  1QZH A;  4DV6 L;  5JEA J;  1WI5 A;  2KBN A;  3I4M G;  4JI6 Q;  1HNX Q;  2JEB I;  1XJV A;  2N3S A;  1Y14 B;  3BZK A;  4OWT B;  3ZJY C;  3KJO A;  4A3M G;  2HHH Q;  3U4V A;  2JA8 G;  4JI1 Q;  4LF5 Q;  3TS2 A;  5JJI A;  2R93 H;  1VQP A;  1TXY A;  4R1J A;  3GTP H;  4DR3 L;  4MNO A;  4BBS H;  3D0F A;  1Q46 A;  3UE1 A;  1IBM Q;  1PYB A;  4YCU A;  3ULJ A;  2ZM6 L;  4GN4 B;  5IYB H;  2EIF A;  5C0X J;  2UUB Q;  1IXR A;  4IPG A;  4A3L H;  1X6O A;  4X66 L;  3HFZ B;  5M3F H;  1HR0 W;  1TWA H;  4TVA B;  4NXN L;  5GAG C;  4A4I A;  3CC4 A;  3F2D A;  5C4J H;  2ATW A;  4QJF A;  4C3H H;  1PFS A;  2E5L Q;  4LF6 Q;  2NVX H;  5BR8 Q;  1SR3 A;  2LXK A;  2NZO A;  1NMF A;  5FLM H;  1PV4 A;  3HOU G;  3K7U C;  1GO3 E;  4GKK Q;  3CW2 C;  4B3S Q;  1OXV A;  1XMQ Q;  5IYD H;  4LFC Q;  3NEL A;  1N32 L;  1G6P A;  1PH9 A;  1VQJ A;  1XMO Q;  4LF4 Q;  1SMX A;  1YBY A;  3DLL A;  1I94 L;  3HKZ G;  2YYZ A;  4DR6 Q;  4A3G G;  4A93 G;  1CKN A;  1Y1W G;  2MO1 A;  2PI2 E;  4LF8 Q;  3ICE A;  3ULL A;  1L1O C;  4DK3 C;  3AEV A;  4H02 A;  5GAH C;  1PH4 A;  1QVF A;  1AH9 A;  2IY5 B;  1YI2 A;  4DR3 Q;  2VZA A;  3E9H A;  3M7N A;  1WYD A;  1VQL A;  1KC8 C;  4JI2 L;  3PSI A;  3S14 H;  4OO1 G;  1YEZ A;  3W1G A;  5C44 G;  4YWK A;  2ES2 A;  2UU9 L;  2GN5 A;  3OTO Q;  3PUZ A;  4X62 Q;  4DV1 L;  3CCM A;  1X65 A;  2PMZ E;  5EAY A;  3J81 i;  3F2C A;  3GTL H;  4LUV A;  3UDI A;  1K8G A;  3HOV G;  2XTI A;  1B7Y B;  1UEB A;  1X9N A;  4DR5 L;  4NXN Q;  4LFB Q;  1FL0 A;  3L0O A;  1BBU A;  3BU2 A;  5IP9 H;  1XPU A;  1CKO A;  3CCE A;  4X64 Q;  4L5T A;  2JA9 A;  4B3M L;  5IY0 A;  4BA1 I;  4DR4 Q;  3PO2 G;  3I4N G;  4WJ4 A;  4A3E G;  1OXU A;  3GDE A;  4GOP A;  4B3R Q;  3G6E A;  3EIV A;  4IOA A;  4JC0 A;  2VUM H;  1VQA A;  5M5W H;  4HJ7 A;  3U58 A;  4JI7 L;  1FJG Q;  2UXC L;  3HOZ G;  3GTK H;  1KL9 A;  2ID0 A;  1P16 A;  1I5F A;  1NBW A;  4DV5 L;  3GTQ H;  3GD7 A;  2PQA B;  4C3J H;  1XTD A;  2N78 A;  4R4C A;  4R4T A;  5LMN L;  5FJ8 G;  3J81 c;  3FP9 A;  2JA5 G;  1JMC A;  4BY7 G;  3BZC A;  3HOX G;  2MFI A;  1JJC B;  1Q8K A;  4JBW A;  2Q2T A;  2R7Z H;  3H0G H;  4JI2 Q;  2ZJQ A;  2UXD L;  1EQR A;  2WB1 G;  3HKZ E;  2UU9 Q;  1YIT A;  3I4M H;  3KFU A;  3M3Y H;  4IJL A;  1N33 Q;  4JBK A;  2QEX A;  4A3M H;  2A1A A;  4FDB A;  3RNU A;  2JA8 H;  1OTC A;  2N49 A;  1KD1 C;  4IOC A;  4JI8 Q;  1IBK L;  4IFD G;  1RL2 A;  4RMF A;  4GKJ L;  2OTJ A;  2F52 A;  1A62 A;  2JA6 G;  1M1K C;  3CMA A;  1X3E A;  3PCO B;  1K8A C;  2CWP A;  2IT1 A;  4LF7 L;  1I6H H;  4O0A A;  3ER0 A;  1VQ7 A;  3S15 H;  2BA1 A;  2K50 A;  1EWI A;  5IWA Q;  4JI6 L;  2ZTE A;  1K3R A;  4EX5 A;  4B3T L;  1P8L A;  3NEM A;  3JC6 6;  1IYJ B;  1SRU A;  4DV0 L;  4LF5 L;  1MIU A;  4POG A;  4DUZ Q;  1BBW A;  1N8R C;  2AHO B;  3CXC A;  1EQQ A;  2QA4 A;  2Q2U A;  4JCV E;  1T9H A;  1PH1 A;  1IBM L;  3KF8 B;  2KEN A;  3AFQ A;  4DK6 C;  1ASZ A;  3LGJ A;  1I3Q H;  4A3G H;  1EIY B;  4QIW E;  4A93 H;  1G51 A;  1Y1W H;  4P75 A;  2C35 B;  3A5Z B;  4P72 A;  2IHE A;  1E1O A;  1E24 A;  2YTX A;  4PMW A;  3UE0 A;  2E5L L;  3PUV A;  4R4O A;  1HZA A;  1QUQ B;  4JOI A;  4LF6 L;  5BR8 L;  1A0I A;  5C44 H;  3S1Q H;  1NTG A;  2WB1 E;  1KRT A;  4JG2 A;  4DNI A;  1G29 1;  4GKK L;  3GO5 A;  3CCJ A;  1XMQ L;  2AWO A;  4KHP Q;  4R4Q A;  1H95 A;  3HOV H;  5ELO A;  5DLQ E;  1XMO L;  4LF4 L;  4DR6 L;  1EUJ A;  4L5Q A;  1C7Y A;  1WCM G;  2YTV A;  1WJJ A;  2JK8 A;  2CFM A;  1R9T H;  4YY3 Q;  4LF8 L;  4B3T Q;  4OXP A;  4DPG A;  5E7N A;  3L2P A;  1HZC A;  4DV0 Q;  3PO2 H;  3I4N H;  4HJ5 A;  1XNQ L;  4A3E H;  3K80 C;  1JJG A;  3JAM c;  4YWM A;  2D0P A;  2VW9 A;  1EFW A;  1XNR Q;  1CSP A;  2XGT A;  4A3B G;  1V9P A;  4Y52 H;  3OTO L;  4X62 L;  3HOZ H;  3Q8D A;  4ME3 A;  1PH5 A;  1VQK A;  3I7F A;  3K81 C;  5GQO A;  4IPD A;  1VQB A;  2HQL A;  2UUA Q;  2A19 A;  1CSQ A;  5FJ8 H;  3CPW A;  1VQ9 A;  4LW1 A;  2JA5 H;  1I50 H;  3GTJ H;  3CCQ A;  4BY7 H;  3HOX H;  4LFB L;  3OYY A;  2B3G A;  2ZJP A;  1QZG A;  4X64 L;  3GTM H;  1PH7 A;  2NVQ H;  4DR4 L;  1KQS A;  5C0X I;  2ZTC A;  1YVC A;  4KI0 A;  4B3R L;  3PGZ A;  5M3M G;  2IX0 A;  4A3F H;  1NE3 A;  1FJG L;  3KF6 B;  4PG3 A;  1N34 Q;  2E2H H;  4YCW A;  3S24 A;  1KHI A;  1Q1E A;  3CPF A;  3M4P A;  5IP7 G;  3UDG A;  1HNW Q;  3W1B A;  1XNQ Q;  4HIO A;  3M9B A;  2JJQ A;  4A75 A;  1SN8 A;  2NN6 I;  3STB C;  1JJ2 A;  2L15 A;  4L5R C;  3G71 A;  4POF A;  1JB7 A;  4JBM A;  2OQ0 A;  2VQE Q;  2FXQ A;  2AMC B;  1GKH A;  4LUZ A;  1N33 L;  1M90 C;  1S3O A;  2JA7 G;  4WJ3 M;  1NY4 A;  1YJ9 A;  2AKW B;  3CC2 A;  4JI8 L;  1HJP A;  2VL6 A;  3KOJ A;  4JI3 Q;  3TRZ A;  1Y1V G;  2JQO A;  3MEF A;  2PI2 A;  2B63 H; 
#chains in the Genus database with same CATH topology
 1JOK A;  2X69 A;  3BVG A;  1Y8N B;  2UXB L;  1I4R A;  3NPP A;  5IWA L;  1I4P A;  2QDB A;  3MXG A;  4C3H B;  3CCL A;  4IUN A;  4QMG A;  1VQO A;  2NVT H;  3W5O A;  4A3K G;  1IZ6 A;  3I2Z A;  1ICW A;  3DUZ A;  5JJK A;  1JE5 A;  5DM7 3;  4OON A;  1S72 A;  4L5S A;  4OHJ A;  1MD2 D;  1EZ8 A;  4NPS A;  1EOT A;  1YHA A;  4LUO A;  3S2H H;  4BA2 I;  2OF1 A;  3BYY B;  1EU3 A;  1CKN B;  2B2U C;  4BY1 G;  1Q82 C;  4HIM A;  2EY6 A;  1DON A;  1Q12 A;  5IGF A;  3MFG A;  4QUF A;  4C2M H;  4G4K A;  4YY3 L;  2HQE A;  1AFP A;  1LT6 D;  5AJ3 Q;  3E9I A;  1YNN C;  4ME5 A;  2SOB A;  2C9O A;  1U5K A;  3TZD A;  4EQN A;  4CJ0 B;  4KKT A;  1CTM A;  3SK8 A;  1AP0 A;  5IP7 H;  2UUA L;  5LMN W;  5GAE C;  2K75 A;  3JAM i;  3D3R A;  1AN8 A;  1SSO A;  3LX0 A;  2CWA A;  3C46 A;  2PW7 A;  3DWA A;  5EJW A;  1PH2 A;  1JOR A;  4GLA C;  4AYB B;  1S40 A;  4UY8 C;  4IPC A;  1K83 H;  4IAL A;  2JA7 H;  4P73 A;  3PMF A;  3RMH A;  2EJG C;  3DEP A;  5IGC A;  2OQK A;  2CQA A;  5FLX c;  3O13 A;  1S5D D;  3CCU A;  3ND8 A;  1EYC A;  3K57 A;  1HNW L;  1VQE A;  4DV4 Q;  1I6H B;  2B29 A;  3TME A;  3F2B A;  2F3W A;  2VQE L;  4ZKB B;  3ERO A;  2VY3 A;  4P71 A;  4LFA Q;  3RD4 A;  2WKD A;  3MXN B;  1RTO A;  1VS0 A;  2B2Y A;  3J80 c;  3AQQ A;  3IAY A;  2NB0 A;  4KLK A;  3PF5 A;  3C3L A;  5D65 A;  1HR0 Q;  4A3D H;  2E2I H;  2PQA A;  2D0O A;  3F8T A;  5KRU A;  2RA4 A;  1U4P A;  1WTR A;  3QB3 A;  2QF7 A;  2LXJ A;  2F0T A;  2JA6 H;  4KV6 A;  4IPH A;  1QB5 D;  5IT9 c;  2CW0 C;  1I6V C;  1MJE A;  4V0B A;  4LAA A;  4UAI A;  5EKI A;  5FO9 B;  3J7Y W;  5LMU L;  2EOT A;  2WAQ B;  5FLX E;  1C8C A;  2A8V A;  1IYV A;  2PO4 A;  1Q7Y C;  2EE1 A;  4FF1 A;  1B53 A;  4A3I G;  1SNO A;  1TWC H;  2DGY A;  5C3E H;  4A3C G;  3RLN A;  4UPA A;  5IGB A;  5DEH A;  2R6G A;  1TY2 A;  2AQ2 B;  3J80 E;  3TP8 A;  1YJN A;  4AYB E;  4NXM L;  3RZD H;  2MJ8 A;  3RR5 A;  4JI4 L;  3D4R A;  1X54 A;  1A2U A;  4GNX C;  2J4X A;  3KF8 A;  4X66 Q;  3QWN A;  1STH A;  1KTK A;  3I4L A;  2WB1 B;  3CKI B;  1B70 B;  3NP8 A;  4LF9 L;  3R2I A;  3F1Z A;  4X3S A;  4GZY C;  2A68 C;  2EJF C;  4JI5 L;  1C0A A;  3OMC A;  3IFD A;  1LM0 A;  4BBS G;  4BXX H;  1O80 A;  2NTS A;  1PYW D;  1MJC A;  3A55 A;  2M2L A;  2Y0S G;  3M7G A;  1ESR A;  3I72 A;  4A3L G;  1TY0 A;  1B9M A;  1SRO A;  5C3X A;  5IT9 E;  3S14 B;  2FMM A;  1PTO F;  4BBR H;  3PUX A;  4JBJ A;  1NAP A;  1KNE A;  4X65 L;  3OMG A;  4K5W A;  2KJX A;  3GTL B;  1B8A A;  1XPR A;  5GRO A;  4J1M A;  3PF4 A;  2EYO A;  5EPL A;  4ODG A;  4DR5 Q;  2HIV A;  4CBV A;  5C0X G;  1AE2 A;  2BH2 A;  1LT3 D;  2JN4 A;  1ONL A;  2ASB A;  3EFX D;  5CYU A;  1VQN A;  1J5E Q;  1BR9 A;  4C3J B;  1SYB A;  2UXC Q;  3TS0 A;  3AB9 A;  2V1C C;  2WAQ E;  4DV5 Q;  4FNF A;  1FNU A;  1L1O B;  3A8K E;  3KF6 A;  3J80 i;  5JPN C;  3A5U A;  5IP9 G;  3I4M B;  1EL0 A;  3DWP A;  5EBD A;  2UXD Q;  2JA8 B;  3L7Z C;  1WFQ A;  4IZ8 A;  5A35 A;  2F3V A;  2RCN A;  3KDF B;  3EN2 A;  3S2H B;  2VUM G;  1PVO A;  1EYG A;  4ABN A;  5CR3 A;  3A0J A;  4ZUI A;  4RGT A;  1BCP B;  3J81 E;  3CAM A;  3ITP A;  4TQU S;  3ERS X;  2DJF C;  5HY6 A;  4XDX A;  4QF4 A;  4GKJ Q;  4K0K L;  3HRZ C;  2UUC L;  4C2M B;  3H15 A;  4LFC L;  5A2Q L;  1PA6 A;  3H0G G;  2HD3 A;  5I4D A;  4CDF C;  3T13 A;  3UI2 A;  3KJO A;  4XT3 B;  3U4V A;  2LFN A;  4JI1 Q;  4LF5 Q;  3HKZ B;  4RAU C;  1VQP A;  3P75 A;  3CU7 A;  4A93 B;  4YCU A;  3ULJ A;  2UUB Q;  2VB3 X;  4OEM B;  1HR0 W;  1TWA H;  3CC4 A;  5C4J H;  1G2S A;  1GUN A;  1GOZ A;  4B08 A;  3Q6S A;  5BR8 Q;  1SR3 A;  2JA7 B;  2NZO A;  3J7A F;  1IKM A;  1GUS A;  5AFW A;  2PZU A;  1G6P A;  1PH9 A;  4LF4 Q;  4A3G G;  3A7A B;  4A3E B;  1CKN A;  4U68 A;  2J0T D;  2PI2 E;  3ICE A;  3ULL A;  3D4D A;  2B39 A;  1AH9 A;  1PH4 A;  3K59 A;  1SND A;  3D6C A;  4FP5 D;  1S5E D;  1VQL A;  2EY5 A;  1KC8 C;  4JI2 L;  3A8I E;  2GN5 A;  2JA5 B;  1I50 B;  4DV1 L;  4BY7 B;  3HOX B;  1BQQ T;  2PMZ E;  3J81 i;  1CQV A;  3HOV G;  1YNJ D;  3UDI A;  1K8G A;  2NVQ B;  1A15 A;  2XTI A;  1UEB A;  4FVM A;  4KHV A;  1FL0 A;  1BBU A;  5K36 H;  3EVQ A;  4B3M L;  5IY0 A;  4RGO S;  3PO2 G;  1H9J A;  1OXU A;  3H3V C;  3G6E A;  3TP7 A;  4FXK C;  2PYK A;  1PZI D;  1TQO A;  1QNK A;  5M5W H;  1PRT B;  3U58 A;  2JA6 B;  5CV8 A;  2E2D C;  2QEJ C;  1I5F A;  4DXF A;  2P5Z X;  2N78 A;  5LMN L;  2XIW A;  4U67 3;  1TR5 A;  2MFI A;  2EY1 A;  1JJC B;  4JBW A;  1CHP D;  1F2Z A;  2WB1 G;  3HKZ E;  2UU9 Q;  1YIT A;  3M3Y H;  1N33 Q;  4A3M H;  2A1A A;  3Q22 A;  3NE5 B;  3RNU A;  4DK0 A;  1SMY D;  5M5X B;  3MXN A;  4IFD G;  1RL2 A;  4RMF A;  2MPM A;  2OTJ A;  1A62 A;  2PZW A;  5J39 A;  1RHP A;  2CWP A;  2K04 A;  4ZAI A;  1B44 D;  3ER0 A;  2V4D A;  2BA1 A;  2K50 A;  2B2V C;  3V96 A;  1C4Q A;  1KDB A;  1DZ1 A;  5IGG A;  4XQJ A;  3CXC A;  4F88 A;  3GTG B;  2KEN A;  1F9P A;  1ASZ A;  1LLR D;  3FVQ A;  1HQM C;  3E3X A;  1Y1W H;  3A8J E;  2C35 B;  2EDG A;  2RKS A;  4FXD A;  2YTX A;  1E24 A;  4RKB A;  1BBX C;  1QUQ B;  4LF6 L;  5C44 H;  1C48 A;  1U4M A;  1YNJ C;  1KRT A;  2KED A;  1ZKO A;  5ELO A;  5DLQ E;  1XMO L;  1C7Y A;  2YTV A;  1WJJ A;  1SE4 A;  5JAV A;  2L1B A;  3SR1 A;  1LTG D;  4H13 C;  4LF8 L;  3L2P A;  3I4N H;  4UHV A;  1XNQ L;  1G2T A;  1AZQ A;  1V9P A;  1JOQ A;  2WV6 D;  1A3T A;  3Q8D A;  1VQK A;  3K81 C;  5GQO A;  4ID6 A;  4IPD A;  5JVH 3;  3NXW A;  1VQB A;  2PQE A;  2O5J C;  1CSQ A;  2NYZ D;  5ELB A;  3E5S A;  1VQ9 A;  3MC0 B;  4LFB L;  2FMC A;  3CCQ A;  3PQI A;  4XXE A;  3OYY A;  1PLF A;  1KDA A;  4R8I A;  1PH7 A;  3GTM H;  2D2C C;  2J7Z A;  4KN7 C;  1YVC A;  3PGZ A;  3X3N A;  3K7A B;  1FJG L;  1K0S A;  1STN A;  5D14 A;  3QG1 A;  5D3D A;  5IP7 G;  3T51 B;  1H9S B;  4BS9 A;  5CV5 A;  2JJQ A;  3STB C;  5IOD A;  4POF A;  2F0H A;  2OQ0 A;  3BDO A;  1B9N A;  3OW7 A;  4LUZ A;  2RBM A;  4A3K B;  3NHH A;  2JA7 G;  1S4Z A;  4WJ3 M;  2RCF A;  4JI8 L;  1PRT D;  1JIC A;  2B2W A;  1PDQ A;  2MGS A;  2MNA A;  3NBI A;  1GHK A;  2PI2 A;  4PZ8 A;  1HH2 P;  4PQX A;  1VMC A;  4N8F A;  2LS0 1;  1E2W A;  1J9O A;  1L1O A;  3SXH A;  4BY1 B;  4EGV A;  4KD4 A;  2I07 B;  3PIO A;  1FGB D;  4CKE A;  3KJP A;  4DUZ L;  3S1M H;  3PUW A;  3KDF A;  1V43 A;  2CH4 A;  2MP1 A;  3A74 A;  5ELC A;  1VQM A;  1V1P B;  3CME A;  1WCM H;  4K2L A;  4GLX A;  3GTO H;  4A3D G;  2F0G A;  2A6E C;  2K01 A;  3KLS A;  2PW5 A;  2F0P A;  1VQC A;  1H9M A;  3I8Z A;  3D31 A;  4KD3 A;  5NUC A;  5JVG 3;  3M4Y A;  1WTX A;  4A3B H;  1U0L A;  2KCN A;  1RDP D;  3GV3 A;  1TS3 A;  1L0Y B;  1ESF A;  1EOV A;  5FK9 C;  5T1I A;  2HCC A;  5CV4 A;  1K0R A;  2L4N A;  1TS2 A;  1VQF A;  2DUD A;  1RIP A;  2X6G A;  4KY6 A;  3S2D B;  5LL6 S;  2AUJ D;  2QKI C;  2RHQ B;  5KYI A;  2Z0S A;  2CKZ B;  3S1N H;  3FPP A;  5C3W A;  3H3V H;  4CKB A;  2YU9 H;  1N36 Q;  4NP5 A;  1SE8 A;  4ZUJ A;  4DV4 L;  1Q8I A;  4XQQ A;  5M3M H;  2F4V Q;  3K5L A;  1XNR L;  4L8J A;  4MTN A;  2Z6B A;  1X3F A;  2K52 A;  4LMQ D;  4JOI C;  5C3E G;  4G57 A;  2Z4I A;  1WD0 A;  4NKL A;  1LTA D;  5A2Q E;  3CCS A;  3TN2 A;  2SNS A;  3NWS A;  1U9R A;  2Z6K A;  4OX9 Q;  2RVL A;  1L0X B;  1B3A A;  2XRQ D;  4K8J A;  5ELN A;  3MVV A;  1NCV A;  1PXU A;  2FIN B;  1VQG A;  1N34 L;  4QQB X;  1Y1V H;  4OEL B;  4ZQ3 A;  4BXX G;  4KKS A;  3SHL A;  3WWV A;  4GNX B;  1Y69 U;  4DV7 Q;  1B50 A;  2LKV A;  2AQ1 B;  3T16 A;  2IL8 A;  3G48 A;  1DJR D;  1KRS A;  3WOE A;  2K5H A;  4YHH Q;  1CKM A;  4BBR G;  5C4X H;  4MHE A;  4IFD J;  1B4O A;  2K5N A;  2F0E A;  3PO3 H;  1NR2 A;  1EEI D;  1K9M C;  4DR1 Q;  1F2M A;  2K5V A;  1VQ8 A;  3MFY A;  4JI3 L;  1YHQ A;  3EA6 A;  1AEX A;  3T1H Q;  3M4Q A;  2RDH A;  4QGU A;  2VQF L;  2GVB A;  2HDM A;  3I4O A;  2KEC A;  4A3J H;  5IYC H;  5CV6 A;  4X3K A;  4N9P A;  4XYO A;  2KHJ A;  2A6H C;  1YNN D;  2R92 H;  4F7X A;  2KOL A;  1RKN A;  4HN7 A;  1W6J A;  2F0M A;  2K5D A;  2Q2I A;  3A56 A;  4AH6 A;  2RDG A;  2K1B A;  4AQY L;  3IRB A;  4DV3 L;  1E22 A;  5G3L D;  4DR2 Q;  2E75 C;  4PZ7 A;  1ASY A;  2JYO A;  2EZV A;  4GOP C;  5KNB A;  4DV6 Q;  1WTH A;  1ICF B;  4MZ9 A;  2IHF A;  4BBS B;  3I91 A;  4ZLT F;  2B2T C;  2Y0S B;  4QIW B;  1LTL A;  4TKO B;  1D1K A;  1UWV A;  2PNR C;  1J8I A;  4GS3 A;  3WDN A;  3T1Y L;  3BYT B;  3HKS A;  3HZX A;  3DHQ A;  4FF2 A;  4DR7 Q;  3BZD B;  4RWS C;  3S17 H;  3K0Y A;  3MWY W;  1WTP A;  1PHJ A;  1PMR A;  4JYA Q;  4IUT A;  2GVA A;  3U4Z A;  3K6O A;  1HQR D;  1I4G A;  2D62 A;  5BN5 A;  1X56 A;  2KHI A;  4C3I H;  1JQY D;  2R7F A;  1JWU D;  1LYL A;  4IJH A;  2ZXP A;  1J5E L;  3BDC A;  1QUQ A;  1TWF H;  1HCZ A;  1I94 Q;  3CC7 A;  1UE1 A;  2SDF A;  3NWT A;  1BKB A;  5I9O A;  1S5F D;  2IW3 A;  1M4V A;  5T1G A;  3ONA B;  1HTP A;  3P1H A;  3N6R A;  1RF2 D;  4HIK A;  1N9W A;  2CW0 D;  1MSG A;  2QGQ A;  2WP8 J;  1KNA A;  2F0D A;  1A2T A;  1EY9 A;  2KEE A;  2YV5 A;  4C1N K;  2EJM A;  4HMI A;  4KK7 A;  1E0B A;  1SFO H;  3ERQ A;  4RGM A;  4IUP A;  5J22 A;  3QIA A;  2VUM B;  4G7O C;  3IFT A;  2WII B;  3UDF A;  2OWO A;  5HUR A;  3GTK B;  4CJ1 B;  1HNZ L;  3WOF A;  1D7Q A;  2B8F A;  2D5D A;  1F77 A;  5M5Y H;  3K0X A;  1UE7 A;  4P74 A;  1L2F A;  2B2U A;  1U4R A;  3OWE B;  3H0G B;  1EYD A;  1BVS A;  1UE6 A;  4PZ6 A;  1UUP A;  4JI1 L;  1WCM B;  1AE3 A;  3GTO B;  2JE6 I;  5K36 G;  1SYE A;  5ELF A;  1H9S A;  1S5B D;  3OWF A;  2Y0S E;  2UUB L;  2A68 D;  5HGQ A;  3NEN A;  2TSS A;  2DNC A;  1FVI A;  1KIX A;  1IBK Q;  4DV2 L;  5IGD A;  4GN5 A;  4DF7 A;  4LF7 Q;  1DGS A;  5KYL A;  3HOY H;  3KLR A;  1EEF D;  5JEA J;  3IL8 A;  2KBN A;  1SDF A;  5M3M B;  3MZ5 A;  1HHV A;  4A3M G;  5D3I B;  1DYQ A;  2F0L A;  2BE5 C;  1I3Q B;  4A3G B;  2XRS D;  3GTP H;  1I4Q A;  4MNO A;  1IBM Q;  3UE1 A;  2Q8T A;  2BDO A;  2ZM6 L;  4GN4 B;  2XSC A;  4K5X A;  2EIF A;  5COR A;  4H7B A;  4IPG A;  2F4I A;  2KCC A;  4FXG C;  3NUC A;  4C1N I;  5M3F H;  5JEA H;  1V1P A;  4TVA B;  5GAG C;  3S1Q B;  4A4I A;  3FPU B;  1PFS A;  3OPO A;  3HOV B;  2LXK A;  1TVX A;  3HOU G;  3K7U C;  5EKK A;  4GKK Q;  4B3S Q;  1N32 L;  4DR6 Q;  1YBY A;  3DLL A;  3PO2 B;  1PFN A;  4IN3 A;  3TSS A;  1Y1W G;  3QR8 A;  3CHB D;  4DK3 C;  4H02 A;  5GAH C;  4DNT B;  4DR3 Q;  5C4X B;  2VZA A;  3E9H A;  5CV9 A;  1YEZ A;  5C44 G;  4IUV A;  1BCP F;  2UU9 L;  1GUG A;  4X62 Q;  3CCM A;  1JOO A;  5EAY A;  3F2C A;  1STY A;  2NN6 H;  1PZJ D;  3L0O A;  1WD1 A;  4L5T A;  2JA9 A;  5LL6 X;  1I4X A;  2EPB A;  4DR4 Q;  3I4N G;  2MHV A;  1SXT A;  1F2L A;  5FO8 B;  4JC0 A;  4JI7 L;  2K5W A;  2ID0 A;  3GTQ H;  2IX3 A;  3NSW A;  3ZYY X;  3FP9 A;  2K33 A;  4S3S A;  3J81 c;  2EYF A;  1EQV A;  1LAB A;  3VR6 A;  4H0L C;  4IJL A;  4JBK A;  2N55 A;  4FDB A;  2WKC A;  3C1F A;  1BF4 A;  1GHJ A;  1TU2 B;  2F0O A;  3VR2 A;  1KD1 C;  5E4W C;  2QDL A;  2ICE C;  3MA2 B;  4RGN A;  5M9O A;  1PFB A;  5IWA Q;  1QIL A;  4JI6 L;  2BDN A;  4DFA A;  2NVT B;  4G7H C;  1JE4 A;  1P8L A;  3JC6 6;  1SRU A;  1ZYR C;  4R8N A;  4C3I B;  4JCV E;  1V8Q A;  2OXP A;  4DK6 C;  1TWF B;  3LGJ A;  1VF7 A;  1G51 A;  1NNX A;  1T5E A;  3UE0 A;  4PMW A;  1WTO A;  2E5L L;  1JB3 A;  1HZA A;  1PRT F;  2WB1 E;  2L11 A;  1H95 A;  1XMQ L;  2E74 C;  4XT1 B;  4R4Q A;  1QG7 A;  4ZK9 B;  1EUJ A;  1DXM A;  1WCM G;  2CFM A;  4WJW A;  3SVM A;  1R9T H;  4YY3 Q;  1CA6 A;  4OXP A;  4B3T Q;  2K05 A;  1HZC A;  4DV0 Q;  4YIJ A;  2A74 C;  1SYD A;  3BG3 A;  3BVM A;  2O5I C;  1JJG A;  2D0P A;  3PIP 3;  4A3B G;  2XGT A;  3OTO L;  5TSS A;  5M5Y B;  3I7F A;  4L6T B;  1ET9 A;  2HQL A;  2UUA Q;  5FJ8 H;  4LW1 A;  3GTJ H;  2ZJP A;  1QZG A;  4X64 L;  1SNP A;  5IGE A;  1K83 B;  3VA5 A;  3P7J A;  5C0X I;  3V2T A;  4KI0 A;  4B3R L;  5M3M G;  2KHS A;  3SK6 A;  2WAC A;  4PG3 A;  2E2H H;  2Z9H A;  2KQ3 A;  3V05 A;  2HCI A;  1HNW Q;  1QJO A;  4A75 A;  4BWG B;  5I2X A;  1JJ2 A;  1XX8 A;  2L15 A;  4KN4 C;  2VQE Q;  1HPC A;  1GKH A;  3Q23 A;  3C1E A;  1CZG A;  3VA7 A;  2AKW B;  4A3D B;  2RDF A;  1Y1V G;  3TBI B;  1EY0 A;  3GTP B;  2E2I B;  3MEF A;  1R4P B;  3DMU A;  3GQB A;  3S1R H;  1FGU A;  2BH8 A;  2LMC B;  3QJY A;  1EWH A;  1VQ6 A;  5C4X G;  4ILW A;  4CHT B;  3PO3 G;  1DM0 B;  2I5M X;  1IW7 C;  2KA7 A;  1O7I A;  2DJG C;  3S16 H;  1R4Q B;  4A3J G;  5IYC G;  4HTH A;  1IL2 A;  4LJZ C;  2ZXO A;  2R92 G;  1Q86 C;  1OO9 B;  1TWC B;  2HUG A;  2EYH A;  2VS1 A;  5C3E B;  2H5X A;  4JPB W;  2HDL A;  2I0Q A;  4ULL A;  2QCP X;  4KHP L;  2HIX A;  3RZD B;  1MHW C;  4XIG S;  1Y8P B;  1J6Q A;  2E2J H;  3STB D;  4JI0 Q;  5EBC A;  4LNQ A;  2ENB A;  4NXM Q;  4JI4 Q;  3VDY A;  1VQH A;  3RZO H;  3CF5 A;  1BOS A;  5CC4 A;  3HOU H;  2I5L X;  1MGS A;  4DU9 A;  5KIX A;  4LF9 Q;  1SE3 A;  3OHX C;  4JI5 Q;  4FYD A;  2NZH A;  5F2D A;  2H1E A;  3I56 A;  1D5Z C;  1ROD A;  3DM3 A;  4O2D A;  4DR1 L;  1WVL A;  2R7D A;  4GOP B;  4BBR B;  2K6A A;  3VR3 A;  4R4I A;  1EIF A;  3SGI A;  2AUK A;  4KJO A;  4X65 Q;  1NR4 A;  2F3I A;  3I55 A;  3U9S A;  4I65 A;  4C3I G;  3FMC A;  5EGT A;  4Q0F A;  4B9W A;  4Y7N H;  4TRD A;  2A6E D;  3RLF A;  3FKI H;  4QL5 A;  1H9K A;  1QWY A;  4KHZ A;  1SNQ A;  1WTQ A;  4M8A A;  5J1Z A;  5EPK A;  3FHW A;  1PYS B;  2R7Z G;  3TQY A;  5EQ0 A;  3HOW H;  3B6Y A;  2B8G A;  1W2B A;  5C6A A;  1B2T A;  4B9X A;  3LWU A;  4IFD I;  4R9W A;  1TWH H;  4DUY Q;  2AWN A;  4M1U B;  5ELE A;  4EQO A;  4QY7 A;  3K5M A;  4K6L A;  5BN4 A;  1X3G A;  2RSO A;  4DXG A;  3W2D A;  2KCM A;  4DR7 L;  4JYA L;  3E0E A;  3NTK A;  3QOJ A;  1QVG A;  1EY5 A;  2PNH A;  4K0K Q;  1K73 C;  2UUC Q;  3KYH C;  1E7Z A;  5KND A;  2AQ3 B;  3ULP A;  1GM5 A;  4FF3 A;  2CCZ A;  2BOS A;  5C4Z A;  1ILQ A;  4HJ8 A;  3AMU A;  3FRP B;  1K3B C;  1LT5 D;  1VQI A;  1QE6 A;  1HZB A;  4N8X 1;  1TWA B;  4PMB A;  4JV5 Q;  4I7Z C;  5C4J B;  3L3O C;  3VYU A;  3HOY G;  3H94 A;  4HCE A;  5H1S E;  5AJ3 L;  1VQ5 A;  3SK5 A;  3CCR A;  1PH6 A;  1BCP C;  1PH3 A;  1NSN S;  1D2B A;  4NW2 A;  1OXS C;  1VCI A;  4RHR A;  4DAM A;  5C4H A;  4UP7 A;  1HUM A;  2MO0 A;  2F0K A;  1IHZ A;  3CQZ H;  3RN5 A;  2A6H D;  1WTV A;  1X3P A;  3SK4 A;  5M3F G;  1Z9F A;  5JEA G;  1KXL A;  1ENF A;  4KY7 A;  4OWX B;  5I2Y A;  2C5C A;  2EYL A;  1PH8 A;  3AYH B;  1PTO C;  3I70 A;  2L9H A;  1YZ6 A;  4DV1 Q;  4LWC A;  4A3F G;  2R3Z A;  1HUN A;  3KLS X;  1Q1B A;  4GLV B;  2DY7 A;  1D5M C;  2O2L D;  4B3M Q;  5M5W B;  4OO1 I;  1II3 A;  4K6D A;  1YIJ A;  4LFA L;  4HJA A;  2Z6K C;  1A8V A;  1OXT A;  3F2U A;  4IO9 A;  1V1O A;  4XTC S;  3U50 C;  3GV6 A;  2RF4 A;  3NQI A;  3J7Z C;  1HR0 L;  2NN6 G;  2KUM A;  5LMN Q;  5DAU A;  4KJN A;  1IBL Q;  1W3S A;  3M3Y B;  2F0N A;  1L0W A;  4A3M B;  2L55 A;  2B63 G;  3BDL A;  2Q2H A;  1T5X D;  1TII D;  4YCV A;  1JWS D;  2VB2 X;  4RFB A;  3M85 A;  1VQ4 A;  4DKA C;  3K8A A;  5L37 A;  4JVZ A;  1MKH A;  3I73 A;  2E2J B;  4XQN A;  3D8G A;  1E3P A;  2BA0 A;  4B3S L;  3I3C A;  5CV7 A;  4YWL A;  2CVR A;  4WRD A;  2PPB C;  3DM1 A;  3HOU B;  2F0U A;  1HNX Q;  2A5H A;  1K8M A;  1Y14 B;  3BZK A;  4OWT B;  3ZJY C;  5K5P A;  2HHH Q;  4PV1 C;  2MUY A;  5JJI A;  1CHQ D;  4DR3 L;  1STE A;  1Y1W B;  1Q46 A;  2R61 A;  3TP6 A;  1CA5 A;  3K5O A;  4C56 C;  4X66 L;  1DCZ A;  3TZU A;  3HFZ B;  5C44 B;  4RCO A;  1AW7 A;  1HFN A;  2ATW A;  1CQF A;  4QB4 A;  2G5D A;  4LF6 Q;  4L63 B;  2NVX H;  2ZT9 C;  1NMF A;  2RSN A;  3KBG A;  5FLM H;  1PV4 A;  3CW2 C;  1OXV A;  1BDO A;  5IYD H;  3DEO A;  1XMO Q;  2YYZ A;  3I4N B;  2K32 A;  1ILP A;  2MO1 A;  4LF8 Q;  5E1F A;  2F0S A;  4DGZ A;  5IOC A;  2NZ1 D;  3HEJ A;  3G7L A;  1UNS A;  1YI2 A;  3J7A V;  3M7N A;  1IKL A;  1WYD A;  4IQZ A;  3S14 H;  3PSI A;  3W1G A;  4HAE A;  5I6W A;  4YWK A;  3PUZ A;  1X65 A;  4OIJ A;  3GTL H;  3GTM B;  1B7Y B;  3H6M A;  5DNF A;  4DR5 L;  4NXN Q;  4LFB Q;  2IJ0 A;  3NK9 A;  3BU2 A;  1XPU A;  1G6Z A;  4BA1 I;  1K28 A;  1ZXT A;  3A54 A;  4GOP A;  3EIV A;  4UDU C;  2BCO A;  2BE5 D;  2A69 C;  5FO7 B;  1FJG Q;  2UXC L;  4KMU C;  2G9D A;  1NBW A;  4DV5 L;  2B2T A;  4C3J H;  1GUT A;  1XTD A;  5FJ8 G;  3Q24 A;  1DOL A;  1FNV A;  4XYQ A;  3BZC A;  4OGQ C;  1Q8K A;  2Q2T A;  2R7Z H;  2ZJQ A;  2UXD L;  3R3O A;  2DN8 A;  3I4M H;  1M8A A;  4H44 C;  4K5V A;  3OIP A;  4KTA A;  5EKL A;  2JA8 H;  5I6Y A;  1OTC A;  2F03 A;  4IOC A;  4JI8 Q;  5LHY 1;  1HTL D;  4GKJ L;  3K58 A;  1DOM A;  4N9T A;  1M1K C;  1K8A C;  2CHB D;  4G7Z C;  2IT1 A;  1EIH A;  2F0I A;  4O0A A;  3OIQ A;  1VQ7 A;  3S15 H;  1SNC A;  1EWI A;  1SNM A;  4FO2 A;  2QW7 A;  3S1M B;  1G91 A;  2ZTE A;  4PNY A;  1K3R A;  4B3T L;  3NEM A;  1IYJ B;  4DV0 L;  4LF5 L;  1MIU A;  4DUZ Q;  1BBW A;  1N8R C;  1T9H A;  1F9R A;  1PH1 A;  1A6X A;  4EQP A;  3AFQ A;  4DA2 A;  3VR4 A;  4QIW E;  4A93 H;  3CQZ B;  1Q90 A;  4P75 A;  4MN3 A;  1EY6 A;  4A3B B;  2IHE A;  1PTO H;  1TT2 A;  2B2Y C;  1E1O A;  4R4O A;  4OO1 H;  5BR8 L;  1CZW A;  1ENA A;  2DY8 A;  3S1N B;  2X6L A;  4K8I A;  4JG2 A;  5ELD A;  1G29 1;  4HMJ A;  3CCJ A;  1EQT A;  3RUZ A;  4LF4 L;  3T4A C;  2YU9 B;  2IWH A;  2JK8 A;  1WTW A;  4DPG A;  4A3E H;  4YWM A;  2VW9 A;  1EFW A;  1XNR Q;  1CSP A;  4ZYS A;  1CFM A;  3HOZ H;  1D5X C;  1D1I A;  4Z9C B;  2NTT A;  2F0J A;  2ICI A;  4DNR B;  5BN3 A;  3LWE A;  2N88 A;  2JA5 H;  1I50 H;  4BY7 H;  3HOX H;  1IL8 A;  2B3G A;  3NTH A;  4RA8 A;  2NVQ H;  1SYC A;  2IX0 A;  1Y1V B;  4CDC C;  4DAV A;  1ZYR D;  4DK1 A;  2Z1C A;  4A3F H;  1NE3 A;  1N34 Q;  1I4H A;  4X3T A;  3S24 A;  1Q1E A;  3OOC A;  3CPF A;  3M4P A;  3UDG A;  1Z6H A;  2K7V A;  2QIL A;  1LO5 D;  4HIO A;  3M9B A;  1GJX A;  3G6J B;  1JB7 A;  3PO3 B;  3K5N A;  2FXQ A;  4F87 A;  1FYC A;  3R93 A;  1M90 C;  1N33 L;  1S3O A;  4FF4 A;  1YJ9 A;  1KAB A;  3CC2 A;  1HXY D;  2LY7 A;  4A3J B;  3KOJ A;  2VL6 A;  4JI3 Q;  3TRZ A;  2SNM A;  2JQO A;  2B63 H;  2VQF Q;  4CGY B;  2I5H A;  3FKI G;  2R92 B;  5M5X H;  1YJW A;  2L5T A;  4X6A H;  4HED A;  3TRE A;  4CDE C;  5IIF A;  2M9V A;  4JI0 L;  2E8G A;  4F8M A;  1U4L A;  3A7L A;  1QNU A;  2K14 A;  2N8N A;  3MAQ A;  3HOW G;  2NVX B;  1KAA A;  5FOB B;  4ZRZ A;  2MQH A;  2M00 A;  4AIM A;  4UP9 A;  3MHB A;  4AQY Q;  4DV3 Q;  1Z47 A;  4GNX A;  2NBF A;  2R93 G;  1GVP A;  3GTG H;  4CDD C;  1STA A;  2WIN B;  2EQS A;  1YNX A;  5IYB G;  2NUC A;  5CMD A;  1YHB A;  3MEH A;  4APV A;  1XWE A;  3BJU A;  4DAY B;  4OWW B;  2PZT A;  3NTI A;  3NQT A;  4C3H G;  2UXB Q;  1HA6 A;  1TS5 A;  1ZEQ X;  3VYR A;  3S17 B;  1NMG A;  1X55 A;  3T1Y Q;  1ML0 D;  3DWQ A;  1HFG A;  1LUZ A;  1LAC A;  1PZK D;  2XNA C;  3VYT A;  2L12 A;  3KLW A;  1LTT D;  1LT4 D;  4J6H A;  1MSH A;  3J81 j;  4GN3 B;  4Q5V A;  3URY A;  3OSO A;  1G8Z D;  3NBH B;  1Q3L A;  3PIP A;  1CI3 M;  3PV0 A;  3CD6 A;  2R7Z B;  4ALP A;  1EU4 A;  3GP7 A;  4DUY L;  3I90 A;  3QOL A;  1QVC A;  1IW7 D;  4EVO A;  2PMZ B;  3BVZ A;  4RHS A;  4HSP A;  1SFO B;  3KUP A;  2OCE A;  3K7A H;  3OW2 A;  1QCB D;  5FKA C;  4HJ9 A;  1HZ9 A;  3TEH B;  3EQL C;  1GD7 A;  4HCS A;  1GXD C;  1XYI A;  2VNU D;  3S15 B;  2O4X A;  3E6Z X;  3MTS A;  1HNZ Q;  2NWG A;  3IKJ A;  4AYB G;  2ALY B;  1D8L A;  3PUY A;  2JP1 A;  4HSV A;  3CCV A;  4A3K H;  1LTB D;  2IPK D;  1QOH A;  3FEW X;  4OIK A;  1E2V A;  2A73 B;  2XVS A;  2LSS A;  5JJL A;  4OL7 A;  1STB A;  2KVM A;  4JV5 L;  2EVB A;  4JW0 A;  1PTO B;  1BO0 A;  3E0J A;  3AFP A;  2NVY H;  2L0C A;  1VQD A;  2FHT A;  3W3A A;  4BY1 H;  1TWG H;  1EY8 A;  1A63 A;  4DV2 Q;  4HR7 B;  3HOY B;  2CQO A;  2JSO A;  4K2K A;  3G4S A;  3SEB A;  1C9O A;  1TS4 A;  3P20 A;  1UAP A;  3J7A 5;  3AU7 A;  5GAD C;  1LTR D;  5J3B A;  1EY7 A;  2K28 A;  1XPO A;  1FD7 D;  2K4K A;  3HOZ B;  1O7L A;  3TDQ A;  1BNZ A;  4DAP A;  1Y8O B;  2ZM6 Q;  3S2D H;  5M3F B;  3L9A X;  1VMP A;  3EBE A;  2WFW A;  4I7A A;  3M4O H;  1EFI D;  1N36 L;  1KDC A;  1V1Q A;  3KK7 A;  4NB3 A;  2F4V L;  1RCV D;  1NJI C;  2WAQ G;  3RLO A;  1LV9 A;  4KKU A;  2FFK B;  4A3F B;  3R8B A;  2KCT A;  3H91 A;  2EYJ A;  3R2T A;  5LMU Q;  1N32 Q;  5KGU A;  5JJZ A;  4JK1 C;  3JAM L;  4IUR A;  4A76 A;  4J15 A;  3RN2 A;  4OX9 L;  3H3V I;  1IBL L;  2RHS B;  4QUC A;  5KNC A;  1W6K A;  2JXM B;  1AZP A;  4J8Q A;  5FLM G;  4QCL A;  5IYD G;  1CK1 A;  2DNE A;  2GA4 B;  1E1T A;  2D9U A;  4DV7 L;  4V19 0;  1X3Q A;  2OTL A;  2B63 B;  2EXD A;  1Z7T A;  5CGK A;  4IUQ A;  1JC7 A;  5E4X A;  4YHH L;  5JPM C;  1K8O A;  5G3L F;  1O7Z A;  2I46 A;  3GTQ B;  1SYG A;  4JI7 Q;  1HNX L;  2EXZ A;  1CUK A;  3CP0 A;  1Q81 C;  3T1H L;  2YTY A;  2HHH L;  1OXX K;  1JT8 A;  2VXW A;  3UDX A;  4IUU A;  2F0F A;  4NMZ A;  1B1Z A;  2B2V A;  4UP8 A;  3SDZ A;  1IYU A;  2CH4 W;  1BCP D;  2HT1 A;  4EQ5 A;  4E6I A;  4RG1 A;  5IE8 A;  1WOC A;  4DN4 M;  4HID A;  5EPJ A;  4A3I H;  2ZJR A;  1KAW A;  1O7Y A;  1VDZ A;  1UE5 A;  3CRL C;  4A3C H;  1D6E C;  1NUC A;  4C3J G;  2ZTD A;  2IX1 A;  2JEA I;  4DR2 L;  1EIG A;  1SLJ A;  2OEO A;  1JCK B;  3VYS A;  1SEB D;  1SJE D;  2XN9 C;  3HS0 C;  4DV6 L;  1QZH A;  1RTN A;  1WI5 A;  3I4M G;  4JI6 Q;  2JEB I;  1XJV A;  1HA5 A;  1PTO D;  2N3S A;  3X3M A;  3HG9 A;  1E2Z A;  2JA8 G;  3TS2 A;  2R93 H;  1TXY A;  4R1J A;  4BBS H;  3D0F A;  2RQX A;  1PYB A;  1JWM D;  1LTI D;  2PCF B;  5IYB H;  1STG A;  5C0X J;  1IXR A;  4A3L H;  1X6O A;  3C2P A;  1X32 A;  4NXN L;  3F2D A;  4QJF A;  2Q8I B;  4C3H H;  2E5L Q;  1PFM A;  1JR0 D;  4TSS A;  1EY4 A;  2B2W C;  2SEB D;  1GO3 E;  1XTC D;  3T56 B;  1XMQ Q;  2F0V A;  2K5Q A;  1R9T B;  4LFC Q;  3NEL A;  1SMY C;  1VQJ A;  4WOR A;  2Z4H A;  1SMX A;  1I94 L;  3HKZ G;  4CJ2 C;  4DAY A;  5C0X H;  4A93 G;  2EYM A;  3QO2 A;  5E3F A;  1CM9 A;  1L1O C;  3AEV A;  1QVF A;  1F9Q A;  2IY5 B;  2XWJ B;  2FJ2 A;  4OO1 G;  1H9R A;  2OT2 A;  2ES2 A;  1BXT A;  3OTO Q;  3S9W A;  3GTJ B;  1GUO A;  3HGB A;  3TP5 A;  4LUV A;  3BS1 A;  4PMC A;  1X9N A;  1UEA B;  1ENC A;  1CT1 D;  3U9O A;  5IP9 H;  1SBB B;  1CKO A;  1ET6 A;  1SE2 A;  3CCE A;  4X64 Q;  1EWC A;  5KEE A;  4ZKC B;  1DD2 A;  2K03 A;  4WJ4 A;  5FLX L;  5DM6 3;  1A3U A;  4A3E G;  3GDE A;  4B3R Q;  2E2H B;  4IOA A;  3NBH A;  2VUM H;  4RKL A;  5JOB A;  1VQA A;  4HJ7 A;  2NVY B;  3HOZ G;  3GTK H;  1KL9 A;  1P16 A;  3GD7 A;  1TWG B;  2PQA B;  4R4T A;  4NDX A;  4R4C A;  2F0Q A;  5COY A;  2JA5 G;  1JMC A;  4BY7 G;  1KLU D;  3J80 L;  4CKC A;  3HOX G;  4ZCK A;  3H0G H;  4JI2 Q;  2G9H D;  1EQR A;  3KFU A;  2QEX A;  1EZ6 A;  2N49 A;  1IBK L;  1B3Q A;  4O1N A;  3T53 B;  5CBE E;  3S1R B;  3PIO 3;  2F52 A;  2JA6 G;  3SE0 A;  2Z8L A;  3PCO B;  1X3E A;  1FR3 A;  3CMA A;  4LF7 L;  1VF5 C;  3Q0A A;  1I6H H;  4X3U A;  2E76 C;  3M4O B;  3ND9 A;  5IT9 L;  1O78 A;  1F2Y A;  1KLG D;  3VR5 A;  4EX5 A;  1RJT A;  3CRK C;  4K14 A;  1MBY A;  4POG A;  3S16 B;  2AHO B;  1EQQ A;  2Q2U A;  2QA4 A;  1IBM L;  1EYA A;  3KF8 B;  1GUW A;  1I3Q H;  4A3G H;  4KY5 A;  1EIY B;  3A5Z B;  4P72 A;  3D4W A;  4RH6 A;  2A69 D;  1A3V A;  1RD9 D;  3PUV A;  4JOI A;  1A0I A;  1SAP A;  4WFN 3;  1NTG A;  3S1Q H;  4DNI A;  4GKK L;  4KHP Q;  3GO5 A;  2AWO A;  2F1M A;  3HOV H;  3KBX A;  1PRT C;  4DR6 L;  3RZO B;  4LK1 C;  1SJH D;  4L5Q A;  3D6W A;  4MTK A;  2TMP A;  5E7N A;  1F9S A;  3PO2 H;  3N52 A;  5CBA E;  4HJ5 A;  2EYP A;  1MI2 A;  3K80 C;  3MXU A;  3MXP A;  3JAM c;  4Y52 H;  2ZXR A;  4X62 L;  4ME3 A;  1PH5 A;  1BUV T;  1DOK A;  2H4O A;  3J81 L;  3HP3 A;  2A19 A;  3LNN A;  3CPW A;  1FNW A;  3H09 A;  4DR4 L;  1KQS A;  4MIU A;  2ZTC A;  1S5C D;  1XXG A;  1SYF A;  5HGT A;  5C5M A;  4Y7N B;  3DXJ C;  4A3I B;  4O42 A;  2EY2 A;  3KF6 B;  4YCW A;  3FKI B;  1KHI A;  1TKW B;  4IFD H;  5I9P A;  1HRJ A;  3W1B A;  1XNQ Q;  1LTS D;  4RCN A;  1SN8 A;  2NN6 I;  4L5R C;  3G71 A;  4JBM A;  5ISR A;  3EJI A;  3HOW B;  2Q8R E;  2AMC B;  3FDT A;  2XWB B;  5C5L A;  1NY4 A;  4P2C B;  1HJP A;  2R93 B;  1TWH B;  3JAM E;  2F0W A; 
#chains in the Genus database with same CATH homology
 1HH2 P;  2VQF Q;  2I5H A;  3FKI G;  5M5X H;  1YJW A;  3S1R H;  1FGU A;  2UXB L;  4X6A H;  2BH8 A;  3TRE A;  4JI0 L;  2E8G A;  5IWA L;  1VQ6 A;  5C4X G;  1L1O A;  2K14 A;  2N8N A;  3PIO A;  3CCL A;  3PO3 G;  3HOW G;  3KJP A;  4DUZ L;  3S1M H;  2I5M X;  1VQO A;  2NVT H;  2MQH A;  3W5O A;  3PUW A;  4A3K G;  3KDF A;  1O7I A;  4AIM A;  4UP9 A;  1V43 A;  1VQM A;  1IZ6 A;  3A74 A;  3I2Z A;  3CME A;  4AQY Q;  1WCM H;  4DV3 Q;  1Z47 A;  4GNX A;  4GLX A;  3GTO H;  4A3J G;  1JE5 A;  3S16 H;  5IYC G;  4A3D G;  2R93 G;  1GVP A;  3GTG H;  4OON A;  1S72 A;  1IL2 A;  1VQC A;  4L5S A;  2EQS A;  3D31 A;  1YNX A;  4NPS A;  4LUO A;  1YHA A;  5IYB G;  1Q86 C;  2R92 G;  3S2H H;  1YHB A;  2VS1 A;  4A3B H;  1U0L A;  2H5X A;  4APV A;  1EOV A;  4BA2 I;  3BJU A;  1K0R A;  4DAY B;  2DUD A;  1VQF A;  2I0Q A;  1CKN B;  1RIP A;  4KHP L;  2HIX A;  4BY1 G;  4HIM A;  1Q82 C;  4OWW B;  4XIG S;  2UXB Q;  1Q12 A;  1J6Q A;  2RHQ B;  2E2J H;  2Z0S A;  2CKZ B;  3STB D;  4JI0 Q;  3S1N H;  4LNQ A;  1NMG A;  4C2M H;  4NXM Q;  1X55 A;  3H3V H;  4YY3 L;  4JI4 Q;  3VDY A;  3T1Y Q;  1VQH A;  3RZO H;  3CF5 A;  2YU9 H;  1N36 Q;  3HOU H;  1SE8 A;  5AJ3 Q;  2I5L X;  1LUZ A;  3E9I A;  4DV4 L;  2F4V Q;  5M3M H;  4LF9 Q;  1XNR L;  4MTN A;  1U5K A;  3KLW A;  4JI5 Q;  1X3F A;  2K52 A;  4JOI C;  5C3E G;  2NZH A;  3I56 A;  5IP7 H;  2MNA A;  2UUA L;  3DM3 A;  5LMN W;  5GAE C;  4O2D A;  2K75 A;  3JAM i;  3J81 j;  4GN3 B;  4DR1 L;  2R7D A;  4GOP B;  4PZ8 A;  2CWA A;  3NBH B;  3CCS A;  3PIP A;  3PV0 A;  4R4I A;  3CD6 A;  2Z6K A;  4OX9 Q;  1PH2 A;  4GLA C;  4ALP A;  1EIF A;  1S40 A;  5ELN A;  3SGI A;  4DUY L;  4UY8 C;  4IPC A;  1K83 H;  1QVC A;  4X65 Q;  2F3I A;  3I55 A;  2JA7 H;  4P73 A;  1VQG A;  1N34 L;  2OQK A;  4QQB X;  1Y1V H;  5FLX c;  2OCE A;  4Y7N H;  4BXX G;  3K7A H;  3CCU A;  3WWV A;  1HNW L;  1VQE A;  4GNX B;  3RLF A;  4DV7 Q;  3FKI H;  4DV4 Q;  4QL5 A;  4KHZ A;  3OW2 A;  4HJ9 A;  1HZ9 A;  2B29 A;  3G48 A;  1GD7 A;  3TEH B;  3F2B A;  1KRS A;  1Q81 C;  2VQE L;  2VNU D;  2K5H A;  4YHH Q;  1CKM A;  2VY3 A;  4BBR G;  4P71 A;  4LFA Q;  5C4X H;  3MXN B;  4IFD J;  1VS0 A;  2K5N A;  3FHW A;  3J80 c;  3AQQ A;  1PYS B;  1HNZ Q;  3PO3 H;  2R7Z G;  3TQY A;  1K9M C;  3HOW H;  4DR1 Q;  4KLK A;  4AYB G;  2ALY B;  1D8L A;  2K5V A;  3B6Y A;  3PUY A;  3PF5 A;  4JI3 L;  1VQ8 A;  1YHQ A;  1W2B A;  3CCV A;  4A3K H;  3T1H Q;  3M4Q A;  4QGU A;  1HR0 Q;  2VQF L;  2GVB A;  3I4O A;  4A3D H;  4A3J H;  4IFD I;  5IYC H;  1TWH H;  4DUY Q;  2AWN A;  2LSS A;  5JJL A;  2E2I H;  2KHJ A;  2PQA A;  4QY7 A;  2D0O A;  3F8T A;  2R92 H;  4JV5 L;  1X3G A;  3AFP A;  2LXJ A;  2KCM A;  2NVY H;  2JA6 H;  4DR7 L;  1VQD A;  4IPH A;  4BY1 H;  5IT9 c;  2Q2I A;  4AH6 A;  1TWG H;  4JYA L;  3E0E A;  1A63 A;  4DV2 Q;  1QVG A;  4AQY L;  2CQO A;  3IRB A;  4DV3 L;  1E22 A;  1MJE A;  2PNH A;  4K0K Q;  1K73 C;  4DR2 Q;  2UUC Q;  3KYH C;  4PZ7 A;  5LMU L;  3G4S A;  1ASY A;  1C9O A;  1E7Z A;  4GOP C;  4DV6 Q;  2A8V A;  1Q7Y C;  3ULP A;  1GM5 A;  3J7A 5;  4MZ9 A;  5GAD C;  2CCZ A;  2IHF A;  5J3B A;  4A3I G;  4HJ8 A;  1XPO A;  1TWC H;  2DGY A;  2K4K A;  5C3E H;  4A3C G;  3RLN A;  4UPA A;  1LTL A;  2R6G A;  1VQI A;  1HZB A;  2ZM6 Q;  1YJN A;  3S2D H;  1UWV A;  4AYB E;  3EBE A;  4GS3 A;  2WFW A;  3RZD H;  4NXM L;  4JI4 L;  3RR5 A;  3T1Y L;  4JV5 Q;  3M4O H;  1X54 A;  3HKS A;  4GNX C;  3HOY G;  1N36 L;  4DR7 Q;  4X66 Q;  5H1S E;  5AJ3 L;  1V1Q A;  1VQ5 A;  3S17 H;  3CCR A;  4NB3 A;  1PH6 A;  2F4V L;  1PHJ A;  1B70 B;  4LF9 L;  4JYA Q;  1NJI C;  2GVA A;  2WAQ G;  3RLO A;  3F1Z A;  3U4Z A;  1PH3 A;  4JI5 L;  2D62 A;  1X56 A;  2KHI A;  4C3I H;  1C0A A;  2KCT A;  5JJK A;  2R7F A;  1OXS C;  1LYL A;  1VCI A;  4IJH A;  4DAM A;  5LMU Q;  1J5E L;  4UP7 A;  1LM0 A;  4BBS G;  4BXX H;  2MO0 A;  1N32 Q;  1QUQ A;  1TWF H;  1I94 Q;  3CC7 A;  1UE1 A;  3CQZ H;  1MJC A;  2Y0S G;  3RN5 A;  1BKB A;  4A76 A;  4J15 A;  4A3L G;  3RN2 A;  1SRO A;  4OX9 L;  3H3V I;  5M3F G;  1Z9F A;  5JEA G;  4BBR H;  3PUX A;  4JBJ A;  1KXL A;  1IBL L;  4OWX B;  4X65 L;  2RHS B;  1PH8 A;  3AYH B;  4HIK A;  5FLM G;  1N9W A;  1B8A A;  1XPR A;  1YZ6 A;  4DV1 Q;  5GRO A;  2QGQ A;  2WP8 J;  3PF4 A;  5IYD G;  4LWC A;  4A3F G;  2YV5 A;  1E1T A;  4DV7 L;  4DR5 Q;  2HIV A;  1SFO H;  5C0X G;  2EXD A;  2OTL A;  1AE2 A;  1Q1B A;  4GLV B;  2BH2 A;  4B3M Q;  4YHH L;  2ASB A;  3UDF A;  4OO1 I;  4LFA L;  1YIJ A;  2OWO A;  4HJA A;  1VQN A;  1J5E Q;  2Z6K C;  1A8V A;  1HNZ L;  1D7Q A;  1OXT A;  4JI7 Q;  5M5Y H;  3K0X A;  2UXC Q;  1UE7 A;  4P74 A;  1HNX L;  4IO9 A;  3TS0 A;  2V1C C;  1L2F A;  1CUK A;  2WAQ E;  3CP0 A;  4XTC S;  3U50 C;  4DV5 Q;  2RF4 A;  2YTY A;  3T1H L;  3J7Z C;  1OXX K;  2NN6 G;  5LMN Q;  1HR0 L;  2HHH L;  3UDX A;  1BVS A;  1UE6 A;  4PZ6 A;  4JI1 L;  1JT8 A;  1L1O B;  1AE3 A;  3KF6 A;  3J80 i;  3A5U A;  2JE6 I;  5IP9 G;  1IBL Q;  5K36 G;  4UP8 A;  1W3S A;  1L0W A;  2HT1 A;  2UXD Q;  3L7Z C;  4EQ5 A;  2Y0S E;  1WFQ A;  2UUB L;  2Q2H A;  4RG1 A;  5IE8 A;  2B63 G;  2RCN A;  1WOC A;  3KDF B;  5HGQ A;  4HID A;  3EN2 A;  4YCV A;  4A3I H;  2VUM G;  3NEN A;  2ZJR A;  1EYG A;  1PVO A;  1KAW A;  1VQ4 A;  3M85 A;  1UE5 A;  4DKA C;  3A0J A;  3K8A A;  1FVI A;  1KIX A;  1IBK Q;  4A3C H;  3CAM A;  4TQU S;  4DV2 L;  1MKH A;  3ERS X;  2ZTD A;  5HY6 A;  4GKJ Q;  2IX1 A;  4GN5 A;  2JEA I;  4K0K L;  4DR2 L;  4LF7 Q;  1SLJ A;  1DGS A;  1E3P A;  2BA0 A;  2UUC L;  4B3S L;  3H15 A;  4LFC L;  1PA6 A;  3H0G G;  4YWL A;  3HOY H;  1QZH A;  4DV6 L;  5JEA J;  1WI5 A;  2KBN A;  3I4M G;  4JI6 Q;  1HNX Q;  2JEB I;  1XJV A;  2N3S A;  1Y14 B;  3BZK A;  4OWT B;  3ZJY C;  3KJO A;  4A3M G;  2HHH Q;  3U4V A;  2JA8 G;  4JI1 Q;  4LF5 Q;  3TS2 A;  5JJI A;  2R93 H;  1VQP A;  1TXY A;  4R1J A;  3GTP H;  4DR3 L;  4MNO A;  4BBS H;  3D0F A;  1Q46 A;  3UE1 A;  1IBM Q;  1PYB A;  4YCU A;  3ULJ A;  2ZM6 L;  4GN4 B;  5IYB H;  2EIF A;  5C0X J;  2UUB Q;  1IXR A;  4IPG A;  4A3L H;  1X6O A;  4X66 L;  3HFZ B;  5M3F H;  1HR0 W;  1TWA H;  4TVA B;  4NXN L;  5GAG C;  4A4I A;  3CC4 A;  3F2D A;  5C4J H;  2ATW A;  4QJF A;  4C3H H;  1PFS A;  2E5L Q;  4LF6 Q;  2NVX H;  5BR8 Q;  1SR3 A;  2LXK A;  2NZO A;  1NMF A;  5FLM H;  1PV4 A;  3HOU G;  3K7U C;  1GO3 E;  4GKK Q;  3CW2 C;  4B3S Q;  1OXV A;  1XMQ Q;  5IYD H;  4LFC Q;  3NEL A;  1N32 L;  1G6P A;  1PH9 A;  1VQJ A;  1XMO Q;  4LF4 Q;  1SMX A;  1YBY A;  3DLL A;  1I94 L;  3HKZ G;  2YYZ A;  4DR6 Q;  4A3G G;  4A93 G;  1CKN A;  1Y1W G;  2MO1 A;  2PI2 E;  4LF8 Q;  3ICE A;  3ULL A;  1L1O C;  4DK3 C;  3AEV A;  4H02 A;  5GAH C;  1PH4 A;  1QVF A;  1AH9 A;  2IY5 B;  1YI2 A;  4DR3 Q;  2VZA A;  3E9H A;  3M7N A;  1WYD A;  1VQL A;  1KC8 C;  4JI2 L;  3PSI A;  3S14 H;  4OO1 G;  1YEZ A;  3W1G A;  5C44 G;  4YWK A;  2ES2 A;  2UU9 L;  2GN5 A;  3OTO Q;  3PUZ A;  4X62 Q;  4DV1 L;  3CCM A;  1X65 A;  2PMZ E;  5EAY A;  3J81 i;  3F2C A;  3GTL H;  4LUV A;  3UDI A;  1K8G A;  3HOV G;  2XTI A;  1B7Y B;  1UEB A;  1X9N A;  4DR5 L;  4NXN Q;  4LFB Q;  1FL0 A;  3L0O A;  1BBU A;  3BU2 A;  5IP9 H;  1XPU A;  1CKO A;  3CCE A;  4X64 Q;  4L5T A;  2JA9 A;  4B3M L;  5IY0 A;  4BA1 I;  4DR4 Q;  3PO2 G;  3I4N G;  4WJ4 A;  4A3E G;  1OXU A;  3GDE A;  4GOP A;  4B3R Q;  3G6E A;  3EIV A;  4IOA A;  4JC0 A;  2VUM H;  1VQA A;  5M5W H;  4HJ7 A;  3U58 A;  4JI7 L;  1FJG Q;  2UXC L;  3HOZ G;  3GTK H;  1KL9 A;  2ID0 A;  1P16 A;  1I5F A;  1NBW A;  4DV5 L;  3GTQ H;  3GD7 A;  2PQA B;  4C3J H;  1XTD A;  2N78 A;  4R4C A;  4R4T A;  5LMN L;  5FJ8 G;  3J81 c;  3FP9 A;  2JA5 G;  1JMC A;  4BY7 G;  3BZC A;  3HOX G;  2MFI A;  1JJC B;  1Q8K A;  4JBW A;  2Q2T A;  2R7Z H;  3H0G H;  4JI2 Q;  2ZJQ A;  2UXD L;  1EQR A;  2WB1 G;  3HKZ E;  2UU9 Q;  1YIT A;  3I4M H;  3KFU A;  3M3Y H;  4IJL A;  1N33 Q;  4JBK A;  2QEX A;  4A3M H;  2A1A A;  4FDB A;  3RNU A;  2JA8 H;  1OTC A;  2N49 A;  1KD1 C;  4IOC A;  4JI8 Q;  1IBK L;  4IFD G;  1RL2 A;  4RMF A;  4GKJ L;  2OTJ A;  2F52 A;  1A62 A;  2JA6 G;  1M1K C;  3CMA A;  1X3E A;  3PCO B;  1K8A C;  2CWP A;  2IT1 A;  4LF7 L;  1I6H H;  4O0A A;  3ER0 A;  1VQ7 A;  3S15 H;  2BA1 A;  2K50 A;  1EWI A;  5IWA Q;  4JI6 L;  2ZTE A;  1K3R A;  4EX5 A;  4B3T L;  1P8L A;  3NEM A;  3JC6 6;  1IYJ B;  1SRU A;  4DV0 L;  4LF5 L;  1MIU A;  4POG A;  4DUZ Q;  1BBW A;  1N8R C;  2AHO B;  3CXC A;  1EQQ A;  2QA4 A;  2Q2U A;  4JCV E;  1T9H A;  1PH1 A;  1IBM L;  3KF8 B;  2KEN A;  3AFQ A;  4DK6 C;  1ASZ A;  3LGJ A;  1I3Q H;  4A3G H;  1EIY B;  4QIW E;  4A93 H;  1G51 A;  1Y1W H;  4P75 A;  2C35 B;  3A5Z B;  4P72 A;  2IHE A;  1E1O A;  1E24 A;  2YTX A;  4PMW A;  3UE0 A;  2E5L L;  3PUV A;  4R4O A;  1HZA A;  1QUQ B;  4JOI A;  4LF6 L;  5BR8 L;  1A0I A;  5C44 H;  3S1Q H;  1NTG A;  2WB1 E;  1KRT A;  4JG2 A;  4DNI A;  1G29 1;  4GKK L;  3GO5 A;  3CCJ A;  1XMQ L;  2AWO A;  4KHP Q;  4R4Q A;  1H95 A;  3HOV H;  5ELO A;  5DLQ E;  1XMO L;  4LF4 L;  4DR6 L;  1EUJ A;  4L5Q A;  1C7Y A;  1WCM G;  2YTV A;  1WJJ A;  2JK8 A;  2CFM A;  1R9T H;  4YY3 Q;  4LF8 L;  4B3T Q;  4OXP A;  4DPG A;  5E7N A;  3L2P A;  1HZC A;  4DV0 Q;  3PO2 H;  3I4N H;  4HJ5 A;  1XNQ L;  4A3E H;  3K80 C;  1JJG A;  3JAM c;  4YWM A;  2D0P A;  2VW9 A;  1EFW A;  1XNR Q;  1CSP A;  2XGT A;  4A3B G;  1V9P A;  4Y52 H;  3OTO L;  4X62 L;  3HOZ H;  3Q8D A;  4ME3 A;  1PH5 A;  1VQK A;  3I7F A;  3K81 C;  5GQO A;  4IPD A;  1VQB A;  2HQL A;  2UUA Q;  2A19 A;  1CSQ A;  5FJ8 H;  3CPW A;  1VQ9 A;  4LW1 A;  2JA5 H;  1I50 H;  3GTJ H;  3CCQ A;  4BY7 H;  3HOX H;  4LFB L;  3OYY A;  2B3G A;  2ZJP A;  1QZG A;  4X64 L;  3GTM H;  1PH7 A;  2NVQ H;  4DR4 L;  1KQS A;  5C0X I;  2ZTC A;  1YVC A;  4KI0 A;  4B3R L;  3PGZ A;  5M3M G;  2IX0 A;  4A3F H;  1NE3 A;  1FJG L;  3KF6 B;  4PG3 A;  1N34 Q;  2E2H H;  4YCW A;  3S24 A;  1KHI A;  1Q1E A;  3CPF A;  3M4P A;  5IP7 G;  3UDG A;  1HNW Q;  3W1B A;  1XNQ Q;  4HIO A;  3M9B A;  2JJQ A;  4A75 A;  1SN8 A;  2NN6 I;  3STB C;  1JJ2 A;  2L15 A;  4L5R C;  3G71 A;  4POF A;  1JB7 A;  4JBM A;  2OQ0 A;  2VQE Q;  2FXQ A;  2AMC B;  1GKH A;  4LUZ A;  1N33 L;  1M90 C;  1S3O A;  2JA7 G;  4WJ3 M;  1NY4 A;  1YJ9 A;  2AKW B;  3CC2 A;  4JI8 L;  1HJP A;  2VL6 A;  3KOJ A;  4JI3 Q;  3TRZ A;  1Y1V G;  2JQO A;  3MEF A;  2PI2 A;  2B63 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...