2N3SA

Nmr assignments and structure of translation initiation factor if-1 from burkholderia thailandensis e264.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor IF-1
publication title NMR Assignments and structure of Translation initiation factor IF-1 from Burkholderia thailandensis E264.
rcsb
source organism Burkholderia thailandensis e264
molecule tags Translation
total genus 8
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2n3sA00
3EN2A 2OTLA 5C44H 3HOWH 3W5OA 4A75A 1VQJA 1PH6A 4JYAQ 3J80c 5GAEC 1M1KC 2R92G 4IO9A 2EXDA 3PUYA 3I56A 2AKWB 4BBRG 4KHZA 1N33L 2B29A 3A5ZB 2JA5H 3HKSA 2K5HA 3TEHB 1QUQA 1VQPA 2ID0A 2NZOA 2JA8G 3PO2H 1MJEA 3UDGA 2VQFL 1EOVA 4DV0L 3ULPA 4A3DG 3M4QA 1XNQL 5HGQA 2ZM6Q 2FXQA 5IYBH 4DV3L 1HZBA 1KRTA 4LF7L 4EQ5A 4HIOA 2WP8J 2PMZE 3WWVA 1VQ9A 3S17H 3S2HH 3SGIA 1YHQA 1YI2A 4OX9L 4JI4L 4BY7H 4AH6A 1Q8KA 2YTXA 3K80C 1P16A 4IFDI 4HIKA 4DR3Q 1HJPA 2ZTEA 1IBMQ 4JBMA 1JJCB 3AFQA 1S40A 2PI2A 1JJGA 1Y1WG 5IWAQ 1KXLA 4OONA 1X54A 4BBSG 3UE1A 2R6GA 4DAYB 2E2JH 4DR6Q 3PGZA 4GKJQ 1YHBA 5IYCG 2UUCQ 3CPWA 4YCVA 3MEFA 4X64L 1VQNA 1HNWL 1TXYA 3RN2A 2IHFA 4OXPA 3GTPH 4NXMQ 2RF4A 2EIFA 4JOIC 4PG3A 3F2CA 4DV5Q 1BVSA 3RR5A 2WB1E 5FJ8G 5BR8Q 1K0RA 2K75A 3S14H 4A93G 3CC7A 1VCIA 3OTOL 4LF5L 2JEAI 3S2DH 2WB1G 1WYDA 2ALYB 4O0AA 4PMWA 2A8VA 2HHHL 2R7FA 3F2BA 2JK8A 2KBNA 2PNHA 1V43A 1I94Q 4JI8L 4R4CA 2UXDL 1D7QA 1IXRA 4R4IA 1FJGQ 3PSIA 2F3IA 4K0KL 1E7ZA 1RL2A 1YIJA 5JEAG 1V1QA 1YJNA 4LF8Q 2R93G 3AEVA 3PO2G 4A3LH 3RN5A 3T1YL 5ELNA 4JV5L 2E5LQ 4KHPQ 3PUVA 4IOCA 4A3KG 2HIVA 1QZGA 4JI3Q 4UPAA 3HOYH 5IYBG 1X3FA 5IP7G 2OWOA 1Y1VH 4UP7A 2RHQB 4IPHA 4X66Q 1LTLA 1HZAA 4A3CH 1E1OA 3BJUA 4HIDA 5GROA 3HOVH 2CKZB 2D62A 1E22A 4R4QA 2QGQA 3KYHC 4DR4Q 3G48A 4DNIA 2UXCQ 2GVBA 4HJ7A 2VY3A 2CFMA 4DV7L 1L1OB 4B3TQ 2YTYA 1VQLA 4DR2Q 5C4XH 3T1HL 4X65L 3I55A 1GKHA 4QQBX 2OQKA 2N78A 2VQEL 1QVCA 5C0XG 5M5WH 1N33Q 4QL5A 4B3ML 3KF6A 1UE7A 4JCVE 2L15A 3KLWA 2D0OA 2UUBL 3S1QH 2UUAL 3GTGH 1EUJA 2AWNA 5M3FH 3PO3G 3FKIG 1UEBA 1B8AA 2C35B 2K4KA 2VQFQ 4DV0Q 4DR7L 2IHEA 1XNQQ 3F8TA 1WI5A 5FLMH 1WFQA 4LF4L 2N8NA 1Z9FA 3CQZH 2F52A 4DV3Q 2ZTDA 3CF5A 4HJ8A 1IBLL 4LF7Q 2VUMH 1GD7A 1G51A 2JQOA 2OCEA 3E9IA 1KRSA 5LMUL 2E2IH 2YU9H 3KDFA 1LM0A 4PZ6A 1GVPA 2CCZA 1OXVA 4JI4Q 4LF6L 4OX9Q 1YJ9A 4GKKL 1TWGH 4L5SA 1HR0W 4LF9L 1G6PA 1XPRA 1AE3A 3G6EA 1I3QH 4GN4B 4HJ5A 3AFPA 1GM5A 4A3LG 3JC66 4IPDA 1VQIA 4DV1Q 2D0PA 3H0GG 5JEAJ 2LXKA 2NVTH 4GNXA 2NN6I 3CMEA 3E9HA 3HOXH 4A3FH 1PH7A 3RZDH 1VQ7A 3HOYG 3TS2A 4X6AH 3HKZE 3RLNA 1XMOL 1N9WA 4POGA 2Z0SA 2N3SA 4X64Q 2ES2A 3CCVA 2BH2A 4RG1A 4LFBL 3UDIA 3HKZG 1XNRL 2NN6G 1UE1A 1PA6A 1M90C 2ZJQA 1ASYA 3VDYA 2VZAA 1S72A 1K83H 4QY7A 1VQDA 3PIPA 3OTOQ 1PH2A 3CC2A 4LF5Q 1LUZA 2Z6KA 5IYDH 4GLAC 1A62A 4IJLA 4RMFA 1PYSB 3DM3A 1OXSC 4NPSA 3B6YA 2MFIA 1VQ8A 4C3IH 4KI0A 4QJFA 4JI8Q 1CKNB 4LUVA 2UXDQ 2BH8A 3UDFA 2OTJA 2WAQE 5C3EH 1PV4A 4KLKA 4K0KQ 1KD1C 5M3FG 3T1YQ 2NVXH 4JV5Q 1G291 2JEBI 1EYGA 1N34L 1L2FA 1Q82C 1NTGA 1EQRA 1VQEA 3A5UA 1S3OA 2UXBL 2VUMG 4YWMA 1K3RA 5LMNQ 4DR1L 4LUOA 1KAWA 2KHIA 3K7UC 2N49A 1IBKQ 2A1AA 4IJHA 1TWAH 4JI7Q 3TQYA 1C9OA 1KHIA 5J3BA 3I4NH 3HOZG 2UU9L 5M3MH 2Q2HA 1N8RC 2LSSA 3F2DA 1HNXL 4WJ3M 4XTCS 3G4SA 4JI1L 1Q46A 2I5HA 4DV7Q 3EBEA 2A19A 4A3IH 4R4TA 3T1HQ 4GLVB 4A3EG 2B3GA 4X65Q 2JA6H 4BXXG 4ME3A 1L0WA 1J6QA 2VQEQ 4O2DA 5JJLA 2VL6A 4A3MH 1PH3A 1U0LA 3J7ZC 2H5XA 3I2ZA 1WCMG 5M5XH 2E8GA 2UUBQ 3PUXA 4MNOA 1YITA 2UUAQ 1VQ6A 1NY4A 3J81i 1VQ5A 3ER0A 4GN3B 4UY8C 1SRUA 1YZ6A 2PI2E 1C7YA 5C44G 3GTQH 3HOWG 4DR7Q 4LF4Q 1NMFA 1WOCA 4DUYL 1N36Q 1IBLQ 4AIMA 4PZ7A 4GNXC 2NZHA 4B3SL 1LYLA 4YWLA 3M85A 5LMUQ 3HFZB 5HY6A 2JA5G 4A3GH 5AJ3L 2I0QA 4C3HH 3AYHB 4LF6Q 5JJIA 2I5MX 1OXUA 3FP9A 3S15H 4GKKQ 4POFA 4APVA 2F4VL 2NVQH 4DK6C 4LNQA 4LF9Q 1X3GA 4BA2I 3BZKA 5C3EG 1Q1BA 4DAMA 1PHJA 2MO0A 1D8LA 2OQ0A 4JI0L 4YY3L 1MKHA 2Z6KC 5IE8A 1N32L 4HJ9A 4JBKA 1FGUA 1R9TH 5FLXc 1PH1A 3H3VH 1VQHA 4BY7G 1X56A 2BA1A 5K36G 4R1JA 1QUQB 2VS1A 3S1RH 1CSQA 3TRZA 4LFBQ 3BU2A 4TQUS 1XNRQ 1EIFA 1YBYA 1OTCA 4DPGA 5IY0A 4GOPA 5C0XI 2KENA 4FDBA 1Q86C 4JC0A 4DV2L 2JE6I 4JI6L 2RCNA 1E24A 3ZJYC 2KHJA 3G71A 1IYJB 3K0XA 3GDEA 1XJVA 1CSPA 1Q1EA 4A3IG 3GO5A 3CP0A 4AQYL 2RHSB 4MTNA 3PIOA 3GTJH 2R7ZH 3CCUA 3NENA 3UE0A 2JA7H 3CC4A 4QIWE 1YNXA 1NJIC 4J15A 5M5YH 1JJ2A 4A3JH 1X9NA 1J5EL 3PF4A 2R92H 5E7NA 3STBD 1N34Q 1JE5A 1K73C 1YVCA 4BBRH 5C4JH 4DV6L 2UXBQ 4NXNL 3OW2A 4DV4L 4DR1Q 3CXCA 1I50H 2QEXA 2XGTA 2ZJPA 4A3GG 1IZ6A 1NE3A 1QVGA 4P75A 2LXJA 1MIUA 3LGJA 2UU9Q 5GAGC 3TS0A 3L2PA 4HJAA 3JAMi 1ASZA 1HNXQ 3ERSX 4R4OA 2Q2UA 4YHHL 3A74A 1HNWQ 1I6HH 4A76A 3ULJA 1I94L 1Y1VG 2Q2TA 1O7IA 3D31A 2V1CC 2NVYH 3PCOB 1UE6A 4X62L 4P73A 1E1TA 3J80i 3HOVG 4A3CG 4DR5L 1PH5A 1Y1WH 4TVAB 3CAMA 1SROA 3W1BA 1PYBA 1Y14B 2K52A 1XMQL 1VQKA 3GTLH 1VQ4A 4LFCL 3RLOA 4BBSH 2K50A 3NBHB 3CD6A 4HIMA 1PH8A 3TREA 1KIXA 4PZ8A 2K14A 5IYCH 2HHHQ 1KQSA 1VQMA 5C4XG 3W1GA 1NMGA 3E0EA 2MQHA 3AQQA 3CMAA 1XPUA 1HZCA 4DUYQ 4JBJA 4A4IA 3S1MH 4B3SQ 1VQBA 2KCMA 3CCSA 2B63H 1JT8A 2BA0A 5FJ8H 1WJJA 4A93H 4L5QA 5AJ3Q 1UE5A 5C0XJ 3CW2C 1CKMA 3RLFA 4GOPB 2WAQG 1B70B 3M7NA 1CUKA 2DUDA 3K8AA 1DGSA 2R7DA 3M4PA 4GOPC 2JA7G 5IP9H 5FLMG 1YJWA 1HR0L 1A63A 4YCUA 2E2HH 4JI0Q 2ATWA 4YY3Q 4A3JG 4DK3C 2WFWA 1RIPA 1N32Q 1JB7A 3IRBA 2EQSA 3GD7A 4JBWA 4JI5L 1Z47A 3I4MH 3KF6B 1V9PA 1PH4A 2R93H 1VQGA 2CWPA 4Y7NH 1K8GA 3M9BA 2AWOA 1HNZL 1E3PA 4A3KH 4C3JH 3K81C 2K5NA 4UP8A 4DUZL 1L1OA 3GTKH 4GLXA 4DV2Q 3U4VA 1BBUA 1K8AC 1P8LA 4A3FG 3J81j 3HOXG 4JI6Q 1GO3E 4H02A 5IP7H 4A3BH 2AMCB 2ASBA 1U5KA 3KDFB 4LUZA 1X65A 2IY5B 1OXXK 4MZ9A 2IX1A 4B3MQ 1JMCA 3M4OH 4AQYQ 4UP9A 4B3RL 1OXTA 2XTIA 1BBWA 3S16H 3CCRA 5LMNW 4L5TA 2VW9A 1QVFA 1FVIA 4DV1L 3CCLA 4JI2L 5IYDG 4LWCA 4GNXB 4IFDG 3S1NH 4IOAA 4P72A 1TWHH 1UWVA 1J5EQ 1A8VA 1H95A 2GVAA 2IX0A 2QA4A 3I4OA 3EIVA 4P71A 4ALPA 2I5LX 3H15A 2YV5A 4DV6Q 4LFAL 3GTOH 2YTVA 4NXNQ 1KL9A 4DV4Q 2B63G 1X3EA 1SMXA 4QGUA 3CCEA 3HOUH 3PO3H 3FKIH 4LW1A 3Q8DA 1TWFH 1W2BA 4JYAL 5GQOA 4YWKA 3FHWA 2ZTCA 5GADC 3L0OA 1FL0A 2IT1A 2MO1A 1SFOH 5IP9G 1EQQA 4YHHQ 1XMOQ 2K5VA 1SE8A 4OWXB 3PV0A 1A0IA 3KOJA 3MXNB 1QZHA 4X62Q 3J81c 5JJKA 5EAYA 3KJPA 5IT9c 3I4MG 3J7A5 4DKAC 4DR5Q 3PF5A 2HQLA 2PQAA 2ZM6L 4BY1H 2ZJRA 1XMQQ 1VQFA 5M3MG 4IPGA 3H0GH 4EX5A 4LFCQ 2HIXA 2KCTA 1W3SA 1TWCH 3GTMH 3KF8B 1BKBA 4A3BG 1HZ9A 5LMNL 5GAHC 4YCWA 2JA6G 4OWWB 4DR3L 1IBKL 1IBML 2CWAA 1CKNA 1EWIA 4DR2L 4JI7L 4A3MG 1B7YB 3NELA 5IWAL 4BA1I 1Q7YC 1C0AA 1YEZA 3NEMA 5ELOA 1MJCA 5DLQE 4DR6L 3U4ZA 4GKJL 2MNAA 3CPFA 2AHOB 3U50C 2UUCL 1PH9A 1L1OC 2CQOA 4XIGS 1HR0Q 3K7AH 4OO1I 3A0JA 3PUWA 1XPOA 1SN8A 4NXML 4DV5L 1HH2P 1X6OA 2HT1A 4IFDJ 2JA8H 5BR8L 1Q81C 4C2MH 4JI5Q 4A3DH 4OO1G 4JG2A 1PFSA 4WJ4A 4AYBE 3I7FA 3H3VI 3HOUG 3CCMA 1HNZQ 4L5RC 1VQAA 3BZCA 2VNUD 4DUZQ 4JI1Q 1VS0A 1X55A 1EIYB 1T9HA 3STBC 4AYBG 1N36L 3M3YH 4JOIA 3RNUA 3S24A 1CKOA 1Q12A 1FJGL 1SLJA 2GN5A 1YHAA 2JA9A 4LF8L 1XTDA 2JJQA 1EFWA 4NB3A 3L7ZC 3ULLA 2E5LL 3HOZH 4B3RQ 4JI3L 4KHPL 1NBWA 1AE2A 3CCQA 4IPCA 3OYYA 2Q2IA 4BY1G 1VQOA 1PVOA 1AH9A 3ICEA 3UDXA 1SR3A 1KC8C 1IL2A 4JI2Q 3I4NG 4GS3A 4X66L 5H1SE 3KJOA 4A3EH 3KFUA 2Y0SE 4P74A 4BXXH 4GN5A 3F1ZA 2DGYA 3DLLA 4OWTB 4DR4L 2Y0SG 4LFAQ 1K9MC 2UXCL 2YYZA 1WCMH 3PUZA 3JAMc 2R7ZG 3U58A 3RZOH 4Y52H 3D0FA 1VQCA 2F4VQ 1I5FA 3CCJA 4B3TL 2PQAB
chains in the Genus database with same CATH superfamily
3C3LA 4LK1C 1M1KC 1B9MA 4TKOB 3IFTA 3HOUB 2O4XA 1TKWB 2AKWB 1N33L 3A5ZB 2JA5H 2G9HD 1EY5A 3PO2H 3SHLA 2VQFL 2XSCA 4NP5A 3ULPA 3FVQA 2PPBC 1BOSA 5HGQA 2ZM6Q 4DV3L 1HZBA 2HCIA 3NQTA 3QB3A 4HIOA 4UAIA 1RKNA 3H6MA 3S17H 3LWEA 3S2HH 3SGIA 4BY1B 3HGBA 1ZXTA 4HR7B 4HIKA 4DR3Q 4JBMA 1F9QA 1HUMA 1CQVA 4OONA 2F0HA 2Y0SB 2R6GA 2R7ZB 4DAYB 2E2JH 4DR6Q 3PGZA 3BS1A 2F0NA 4IN3A 4RGNA 3QOJA 3GTPH 4NXMQ 5CR3A 3F2CA 4DV5Q 2R92B 1BVSA 3RR5A 5BR8Q 4A93G 4DAPA 4LF5L 2JEAI 3S2DH 2WB1G 3PQIA 4O0AA 5FOBB 2A8VA 2HHHL 2R7FA 2RCFA 2XNAC 4TRDA 2EVBA 1WTHA 5C3WA 4OIKA 2F0IA 2UXDL 4K8JA 4R4IA 1FJGQ 4G4KA 4O42A 2SEBD 1YIJA 1Z7TA 2J4XA 1V1QA 1A3VA 4K0KL 3AEVA 1TVXA 2E76C 3T1YL 4JV5L 2E5LQ 3PUVA 5KEEA 4C3JG 4A3KG 1Y1WB 1XWEA 3P75A 2B2YC 4BBSB 3SEBA 4UP7A 5J22A 3NTHA 2K6AA 1GUSA 2B2VC 4A3CH 1E1OA 3KLSX 3HOVH 5FK9C 2RVLA 2IW3A 3SK6A 1LABA 4DV7L 4XYOA 4B3TQ 1VQLA 1F9RA 5KNDA 4N9TA 3O13A 1UAPA 1GKHA 4CBVA 5C5MA 4QL5A 4JCVE 1B3AA 3GTGH 2EYFA 1UEBA 2C35B 4DV0Q 4X3SA 1EQVA 2IHEA 3F8TA 2PYKA 2N8NA 4L63B 4HJ8A 3PO2B 1KDAA 1G51A 2OCEA 3E9IA 1KRSA 5LMUL 3BVGA 4JW0A 4HCEA 3S2HB 3C1EA 1HR0W 5CV9A 4HSVA 4HJ5A 1GM5A 3VR2A 4A3FH 2NN6I 3HOXH 1VQ7A 2A68D 4ID6A 3HOYG 2I07B 3RLNA 4POGA 2XVSA 1HFNA 1QOHA 1ZEQX 4RG1A 3UDIA 2E2JB 1XNRL 1LTTD 1M90C 2ZJQA 1S72A 1VQDA 3GTPB 2P5ZX 1PH2A 3CC2A 1LUZA 2Z6KA 3Q6SA 4GLAC 1G6ZA 4RMFA 4DGZA 1NR2A 1OXSC 1SYEA 3B6YA 1HCZA 3I72A 3S2DB 2MFIA 1MHWC 5EPJA 4FXGC 4QJFA 4JI8Q 5IOCA 3UDFA 1PFBA 4Z9CB 5C3EH 1PV4A 3I70A 2JEBI 4HSPA 4OHJA 4HCSA 3KF8A 1NTGA 4UHVA 1JORA 3A5UA 3H94A 2UXBL 1K3RA 3OMGA 5LMNQ 4LUOA 2KHIA 2N49A 3GTMB 2A1AA 1TWAH 5M3MH 1N8RC 3H3VC 3HOVB 3EFXD 1L0XB 3NPPA 2F0PA 3EBEA 3QIAA 3GV6A 2JA6H 2B3GA 4X65Q 2G5DA 5F2DA 4DFAA 2VQEQ 2L5TA 1S4ZA 5JJLA 2VL6A 1U0LA 5M5XH 1FNUA 1TS5A 4NMZA 1VF5C 3NWTA 1D2BA 2E8GA 1YITA 1ML0D 3J81i 4UY8C 1SRUA 1C7YA 4DR7Q 4V190 1NMFA 3GTGB 4AIMA 4QUCA 1LYLA 4YWLA 1SNPA 4FF1A 1SYGA 2I0QA 3BDLA 3FP9A 4GKKQ 3HS0C 4APVA 4BA2I 4LF9Q 3BZKA 3NP8A 1NNXA 4H0LC 3DEPA 2A74C 1D8LA 2OQ0A 1I4GA 3BG3A 4YY3L 4JI0L 2CW0D 1GUNA 3V05A 5HGTA 3T13A 1FGUA 4K2KA 1PH1A 3H3VH 1VQHA 5L37A 5K36G 1SE4A 4IUUA 4IUPA 2PZTA 3HOXB 4OELB 4DF7A 1YBYA 3M7GA 1OTCA 5IY0A 2E2DC 4EQPA 4H13C 4FDBA 4G7OC 2Z4IA 4DV2L 1IYJB 1K28A 1XJVA 3K5NA 3IL8A 3HOWB 3CP0A 4MTNA 2EPBA 3PIOA 4ZAIA 1GUGA 1STAA 5IT9L 1EFID 4DA2A 1YNXA 3GP7A 1X9NA 5C3EB 5FO8B 1YVCA 3VA5A 4BBRH 5C4JH 4DV4L 4DR1Q 1WTQA 1MI2A 1I50H 3OIPA 2XGTA 2ZJPA 4A3GG 1EY8A 4WRDA 4CDCC 1QVGA 3I73A 4KHVA 1A2TA 1ENCA 3L2PA 4HAEA 1TWAB 3C46A 1B50A 5M3MB 1I94L 4X62L 3PCOB 3KLSA 3J80i 1EZ6A 1M8AA 3LWUA 1SROA 1ZYRC 2K52A 5A2QL 1XMQL 4C1NI 1VQKA 2JA6B 1YNND 3RLOA 3NBHB 3TREA 1KIXA 3VA7A 2XRSD 1NMGA 3E0EA 2MQHA 5CV5A 4DUYQ 4JBJA 4A4IA 2EDGA 2KCMA 2B63H 3DMUA 1LV9A 1WTXA 1FNVA 3UI2A 1LTID 3EA6A 1UE5A 3TMEA 1BR9A 3SK4A 3CW2C 2QDBA 3BYTB 2NZ1D 1CKMA 3M7NA 3M4PA 5CC4A 1A63A 2MP1A 5IP9H 5FLMG 1HR0L 2RA4A 1D1KA 4YCUA 1SAPA 1FNWA 1ZKOA 2ATWA 2OT2A 2WFWA 5CYUA 3OW7A 2Q8IB 1N32Q 3GV3A 3GD7A 4JBWA 1Z47A 3N6RA 3I4MH 3KF6B 2VB3X 2R93H 4Q5VA 4H44C 3BVZA 3QOLA 1K8AC 3J81j 3K57A 1JB3A 5IP7H 1WTPA 4LAAA 1U5KA 3KDFB 1EWCA 1KNAA 2RKSA 4MZ9A 4ZKCB 4AQYQ 4B3RL 1SYDA 1D6EC 3S16H 1SXTA 3ND9A 1KAAA 3QJYA 5M5WB 1EY9A 1FVIA 1CZGA 1H9SB 5D3DA 4DV1L 1QNKA 4JI2L 2J7ZA 3D6CA 3S1NH 3NUCA 4P72A 4JVZA 3CQZB 1ENFA 4DV6Q 2YV5A 1LT6D 4NXNQ 2K05A 1KL9A 1SMXA 1AZQA 3FKIH 3G6JB 4BBRB 3ITPA 3Q8DA 1TWFH 5IGFA 4JPBW 1I50B 1XTCD 3L0OA 2MO1A 1SFOH 1MGSA 1TU2B 4M1UB 5EGTA 4CKBA 3P7JA 4YHHQ 1XMOQ 4OWXB 5I4DA 2K03A 3J7YW 3RZDB 1QZHA 3AB9A 5IT9c 2LMCB 2ZJRA 3KLRA 3A55A 2KQ3A 2MHVA 3H09A 1BKBA 2NWGA 4YCWA 1TS3A 1IBKL 2CWAA 1XX8A 1C0AA 3NELA 2F0MA 2LS01 3NEMA 5ELOA 5DLQE 3A54A 1HXYD 4NDXA 2B63B 1O7YA 2EJGC 1PH9A 3C2PA 1A6XA 1XPOA 1SN8A 5AFWA 4KJNA 1CT1D 1DOMA 3FPPA 3X3NA 4KY5A 4A3DH 4OO1G 4ZK9B 4WJ4A 3H3VI 3HOUG 3CCMA 1STHA 1VQAA 1J8IA 3I4MB 3STBC 2DNCA 3AU7A 4ZUJA 1SLJA 5D3IB 1XTDA 1EFWA 5KNCA 3ULLA 4U68A 3W2DA 2FMCA 1WTOA 1HFGA 3IAYA 4KHPL 1AE2A 3OYYA 2WIIB 4A3MB 4BY1G 1SSOA 4WFN3 1SR3A 1EEID 1CA5A 1PZKD 1BXTA 3KJOA 4A3EH 3S16B 1HUNA 2RDFA 1B4OA 4ME5A 3D4WA 3DEOA 2Y0SG 3S1NB 3PUZA 3JAMc 2R7ZG 2IX3A 4Y52H 3D0FA 1VQCA 2F4VQ 3KBXA 3IKJA 2AQ2B 2OTLA 2MPMA 5C44H 2EYMA 4JYAQ 2L11A 2R92G 3FKIB 3I56A 3W3AA 4KHZA 1LT3D 5DEHA 1CI3M 3HKSA 1G8ZD 2ID0A 1SFOB 3UDGA 1IYVA 1EOVA 2FXQA 1PRTF 5IYBH 3NTIA 2PMZE 1SBBB 3QG1A 2B2TA 3WWVA 1AZPA 1YHQA 1YI2A 3HP3A 3SXHA 4JI4L 4OX9L 3MFGA 4BY7H 1Q8KA 1KLUD 2EYHA 1IBMQ 1W6JA 3K5OA 3AFQA 1S40A 2PI2A 1JJGA 1Y1WG 3P1HA 2L1BA 1X54A 3A7AB 4BBSG 1I4PA 4GKJQ 1B2TA 2ICEC 2WINB 3MEFA 4X64L 1TXYA 5C0XH 2IHFA 4CDDC 4JOIC 2MUYA 4PG3A 5JVG3 2DN8A 4PNYA 2O2LD 1BF4A 1BCPC 3DXJC 3S14H 3OWFA 3VR3A 1SJED 4KJOA 4KTAA 2H4OA 2ALYB 5BN3A 5C4ZA 5EKIA 4A3DB 3F2BA 2JK8A 2KBNA 4O1NA 2XN9C 3G7LA 5IGDA 1D7QA 3NE5B 2EE1A 1YJNA 5JEAG 2KA7A 4LF8Q 3PO2G 4A3LH 1CZWA 1QZGA 5FO9B 1X3FA 3DWPA 2F0QA 1FD7D 3DHQA 1Y1VH 4IPHA 4DN4M 1M4VA 2BDNA 4RHSA 2QGQA 3KYHC 1BBXC 1PYWD 2NBFA 3G48A 4TSSA 4A3EB 2UXCQ 3FRPB 4MTKA 2YTYA 4DR2Q 1B9NA 1UUPA 4EQOA 3MHBA 5CV8A 5C4XH 2B2WA 5FLXL 1QVCA 1N33Q 1F2MA 1TY0A 1UE7A 2L15A 3S1QH 2D0OA 2UUBL 3R2TA 1IKMA 1EUJA 3QWNA 1VDZA 2K4KA 2VQFQ 4L6TB 4LF4L 4Y7NB 4DV3Q 2F52A 4KV6A 1LO5D 1EYAA 4F87A 1GD7A 1STBA 1U4MA 4PZ6A 2FJ2A 1OXVA 4RWSC 3HZXA 5EPLA 4L5SA 1R4QB 3EJIA 1XPRA 1AE3A 3EVQA 1ZYRD 4BY7B 3AFPA 4IPDA 5I6YA 1VQIA 3H0GG 5JEAJ 1DD2A 2LXKA 3M4YA 3CMEA 1TT2A 1PH7A 3TS2A 3HKZE 1EQTA 1N9WA 1D5ZC 2Z0SA 1JR0D 1EYDA 3CCVA 2BH2A 4LFBL 4RCOA 5LHY1 1ASYA 2VZAA 1K83H 4FNFA 3GTOB 2RDGA 4EQNA 4LF5Q 5IYDH 1EZ8A 4IFDH 3PO3B 4IJLA 3D6WA 3S14B 4NPSA 1PTOC 5ELDA 3RD4A 2R61A 4C3IH 2UXDQ 1LT4D 3MXUA 3K5LA 1DOLA 2BH8A 1A2UA 2OTJA 4K0KQ 1S5CD 1KD1C 4DK0A 3T1YQ 2NVXH 4JV5Q 1MBYA 1EYGA 3KK7A 1L2FA 1VQEA 1S3OA 1AFPA 1KAWA 1F77A 3MAQA 4BWGB 4JI7Q 3TQYA 5J3BA 1Y1VB 3HOZG 3PIP3 2X69A 3HKZB 2J0TD 4XYQA 5EQ0A 5FKAC 3G4SA 4DV7Q 5DAUA 2ZXOA 2HUGA 1TR5A 1EY7A 4A3IH 4J6HA 4KN4C 1J6QA 2F0OA 2L0CA 1BCPB 1UNSA 2Z8LA 5C4XB 1PTOH 3J7ZC 5KRUA 2EJFC 4MNOA 1VQ6A 1C48A 3HOWG 1EY0A 2L12A 2IWHA 3CRLC 1O78A 3M85A 5LMUQ 3HFZB 3NXWA 1DM0B 2F0DA 4I65A 4C3HH 3M3YB 3AYHB 1GHJA 4K5XA 1V8QA 2NVQH 4DK6C 5C3EG 1Q1BA 4DAMA 1PHJA 1HA5A 3T53B 3MXPA 1MKHA 3BVMA 5E1FA 2Z6KC 5IE8A 4HJ9A 1H9RA 1R9TH 5FLXc 2XWJB 1X56A 1R4PB 2BA1A 3S1RH 1CSQA 3R2IA 3TRZA 4TQUS 1XNRQ 1EIFA 4ODGA 3NTKA 5C0XI 1NR4A 5J1ZA 1S5DD 4JI6L 1WCMB 1HA6A 3MC0B 3RZOB 1LTBD 3K0XA 1K83B 1CSPA 1Q1EA 2PNRC 2RHSB 1LTGD 2CH4A 3MFYA 1TQOA 2JA5B 3VYRA 3CC4A 2JA7H 4C3IB 5M5YH 1GUTA 1MSGA 1JJ2A 5EBDA 5EKKA 1JOQA 3STBD 1K73C 5KIXA 1T5EA 1I4QA 2UXBQ 1CK1A 2EY2A 3K58A 2QEXA 3S17B 4RHRA 3U9OA 1V1PA 1SJHD 3SK8A 1U4LA 4P75A 2LXJA 3V96A 3SE0A 3LGJA 3ERSX 4R4OA 2F1MA 1X3QA 3C1FA 1HNWQ 1I6HH 2IJ0A 5C6AA 2IL8A 2NVYH 2V1CC 1UE6A 3NQIA 4P73A 3I8ZA 4L8JA 4DR5L 1PH5A 1EL0A 3WOEA 3VYUA 4A3IB 1PYBA 4HMIA 3GTLH 4LFCL 1QWYA 3VR4A 1PH8A 4PZ8A 3A8JE 4FO2A 1PTOB 1KQSA 4X3UA 2XIWA 4ABNA 1J9OA 3AQQA 5IGCA 1VQBA 4XQQA 2EJMA 4CGYB 4XQNA 2BA0A 3NSWA 1D1IA 4A93H 2VXWA 2V4DA 1OO9B 1CQFA 3RLFA 2WAQG 5BN5A 2DUDA 2R7DA 1EY6A 4C3HB 2E2HH 3T51B 4JI0Q 4YY3Q 3A8KE 2NVQB 1RIPA 4AYBB 1PH4A 2CWPA 3RMHA 1R9TB 4A3KH 4C3JH 3K81C 5JAVA 1L1OA 3S1RB 4DV2Q 1IYUA 2FHTA 4H02A 2AMCB 2ASBA 4LMQD 2IX1A 4B3MQ 2DJGC 2Z1CA 3BDOA 1T5XD 4F88A 1BCPD 2XTIA 1BBWA 2HCCA 4L5TA 1Y8PB 1QVFA 2A6HC 3TZUA 5G3LD 3CCLA 2L4NA 2O5IC 4RGOS 2JA7B 2IX0A 4OIJA 1G2TA 5M5YB 4DV4Q 2B63G 4QGUA 2AQ1B 1RTOA 4RAUC 4WORA 4E6IA 3HRZC 4YWKA 3S9WA 3FHWA 3OWEB 5DM63 2IT1A 2GA4B 4F7XA 1I6VC 1QG7A 1X32A 4DU9A 5IP9G 2K5VA 1SE8A 1C4QA 2PO4A 5J39A 4I7ZC 4IURA 3KOJA 5I6WA 4A3FB 2A69C 4XT3B 4X62Q 3J81c 3KJPA 3I4MG 1I6HB 3PF5A 2Z4HA 3I4NG 1NAPA 3MVVA 1XMQQ 2NVYB 4IPGA 1W6KA 4EX5A 2HIXA 2F3WA 2KCTA 1TWCH 1TIID 3KF8B 3GTLB 5LMNL 1CKNA 4A3MG 5IWAL 3VYSA 2KEDA 2F0KA 2CHBD 3CPFA 2UUCL 2CQOA 4A93B 1HR0Q 1F2YA 3PUWA 1FGBD 2JA8H 2QW7A 2E2HB 4C2MH 2A6EC 1LACA 4L5RC 3QO2A 3BZCA 4MIUA 4I7AA 4JI1Q 1X55A 1T9HA 1QJOA 4A3KB 3S24A 1CKOA 2GN5A 2JSOA 1JOKA 5IT9E 1BUVT 3T16A 2NB0A 4B3RQ 4JI3L 1DOKA 3CCQA 2Q2IA 3OHXC 4EGVA 5M5XB 2F0TA 3UDXA 1IL2A 4JI2Q 2E75C 4X66L 1PTOD 3F1ZA 5C4HA 2DGYA 2WV6D 4OWTB 4DR4L 2X6GA 1K9MC 3Q0AA 1SNMA 3WOFA 3CCJA 1TS4A 3W5OA 3J80c 4IO9A 4RFBA 1KNEA 4RKBA 2EXDA 2Q8TA 4B9WA 4OL7A 2K5HA 1QUQA 1PFNA 1G2SA 3E0JA 3JAML 5A2QE 1MJEA 3P20A 1Y8NB 5ELEA 4A3DG 3M4QA 4NKLA 4Q0FA 1XNQL 1KRTA 4LF7L 2WP8J 3URYA 2EYLA 4F8MA 3PMFA 1I4RA 1P16A 1IW7C 4RA8A 1JCKB 1TWCB 5LL6X 4KKSA 2KCNA 1RF2D 1TS2A 2DY8A 3A56A 2QKIC 1KXLA 5EJWA 1JICA 2B8FA 1DCZA 1SNQA 1PXUA 1YHBA 5JOBA 5IYCG 1LT5D 3CPWA 4YCVA 1VQNA 4FXKC 2RF4A 2EIFA 1RODA 2KCCA 3JAME 1ILQA 5FJ8G 3MWYW 1K0RA 2K75A 5C4JB 3OTOL 1I4XA 3DWAA 1QNUA 1GHKA 1RD9D 2WKCA 1WYDA 2JA8B 4PMWA 2RSNA 2QEJC 2F0JA 2N55A 2PNHA 1BQQT 4J8QA 2EY6A 1IXRA 3PSIA 3SDZA 1ICWA 5ELNA 4KHPQ 4IOCA 3A8IE 4UPAA 5IYBG 4U673 4RKLA 2F0UA 3RUZA 1HZAA 2K33A 3BJUA 2CKZB 2D62A 1Q8IA 1IL8A 4DNIA 1Y69U 3K6OA 2G9DA 5K5PA 1XXGA 1PDQA 2EY5A 3T1HL 4B9XA 2K32A 5KGUA 2B2TC 2OQKA 2N78A 2AUJD 4QQBX 5C0XG 1F2LA 2Z6BA 4K5WA 2UUAL 5EPKA 2AWNA 5M3FH 3PO3G 5JVH3 2R93B 5FLMH 1E2ZA 1WFQA 1IBLL 1Z9FA 2VUMH 3CRKC 3MEHA 2E2IH 1D5XC 3NBIA 1PFMA 1G91A 1LM0A 1JE4A 1GVPA 2CCZA 4OX9Q 4JI4Q 4LF6L 1YJ9A 1TWGH 1CHPD 2B39A 3D4RA 2KOLA 2M00A 3TP7A 1IHZA 3KBGA 3A7LA 4A3LG 2NTTA 5TSSA 3T4AC 4GNXA 4X6AH 2KVMA 1XMOL 2D2CC 2N3SA 4DXGA 4X64Q 2ES2A 1BO0A 1LLRD 3HKZG 2NN6G 1E2WA 1UE1A 3PIO3 1PA6A 3VDYA 1AN8A 3Q22A 3PIPA 2TMPA 1A62A 3EQLC 2QILA 1TWFB 2VB2X 1STGA 4YIJA 1VQ8A 2F0GA 3MXNA 1H9KA 4X3KA 4KLKA 5EKLA 1LTAD 1G291 5COYA 5C5LA 1N34L 1EQRA 2XRQD 3J7AV 1A15A 4ZCKA 4YWMA 1K3BC 1U9RA 2B2WC 4ZUIA 5CMDA 4FF4A 4IJHA 1C9OA 1PMRA 4QMGA 2UU9L 2F03A 2QCPX 1HNXL 1O7ZA 4WJ3M 4XTCS 1PZID 2A6HD 1NUCA 4K5VA 5I9OA 2A19A 2EOTA 1Q90A 4R4TA 4GLVB 4BXXG 1PH3A 2H5XA 4HN7A 1WCMG 2UUBQ 3PUXA 2PI2E 3GTQH 1II3A 2JN4A 4LF4Q 1N36Q 5M3FB 4NW2A 3QR8A 2NZHA 4B3SL 4KN7C 5HY6A 2JA5G 5AJ3L 2A69D 2KEEA 3BDCA 2VUMB 2I5MX 4OO1H 5CGKA 3S15H 2F4VL 2E2IB 5DM73 1DXMA 3I90A 2BDOA 1TWGB 1ET6A 2EZVA 5D65A 2O5JC 1ILPA 2NUCA 3OSOA 1JWSD 5T1IA 4R1JA 4LFBQ 3BU2A 1EU4A 1Q3LA 1HTPA 4DPGA 4GOPA 1KDBA 2KENA 5JJZA 4JC0A 2JE6I 2HDMA 3D4DA 3ZJYC 2CVRA 3GDEA 4FYDA 1A3TA 4A3IG 5C44B 3GO5A 3AMUA 1EU3A 2IPKD 3GTJH 2R7ZH 3CCUA 3R93A 3NENA 2LY7A 3UE0A 4H7BA 2A6ED 4QIWE 2X6LA 1NJIC 1STNA 4A3JH 1EY4A 3KUPA 1J5EL 5M9OA 3PF4A 2R92H 5E7NA 4FF2A 3TN2A 1S5ED 2OF1A 4B08A 3Q24A 3OW2A 1O80A 2BE5C 2EY1A 1PRTC 2F4IA 1IZ6A 1NE3A 4C3HG 1MIUA 1SYBA 5GAGC 3TS0A 4HJAA 1PZJD 4DAYA 1ASZA 2DJFC 1NCVA 5FLXE 2Q2TA 1O7IA 3MZ5A 4LJZC 4A3CG 5D14A 3HOVG 4IQZA 2F3VA 1Y1WH 4TVAB 2A73B 5T1GA 3W1BA 2BCOA 3OOCA 4BBSH 3CD6A 4HIMA 1RHPA 5E4XA 2K14A 2HHHQ 1VQMA 3W1GA 5KYIA 1XPUA 4DK1A 3S1MH 1VF7A 3R8BA 2K01A 3GTQB 4QIWB 1F9PA 1WJJA 3I91A 2WKDA 2K5WA 4GOPB 1B70B 2R3ZA 1CUKA 4N9PA 2JA7G 4R8IA 4DXFA 1YJWA 2K28A 3S15B 2M2LA 4DK3C 3CKIB 4CHTB 1JB7A 3FDTA 3IRBA 2QDLA 3L9AX 4JI5L 1IW7D 2JP1A 5JEAH 4KKUA 3M9BA 4HMJA 1B44D 2AWOA 1HNZL 3V2TA 3GTKH 1HTLD 2K5NA 4UP8A 4DUZL 5IIFA 4K2LA 3U4VA 1BBUA 5HURA 4A3FG 4JI6Q 3HOXG 4A3BH 1SEBD 2NTSA 4K6DA 3HEJA 1OXXK 1JMCA 4UP9A 1WVLA 5LMNW 2VW9A 3S1QB 3BZDB 4LWCA 3GTJB 1EYCA 1TWHH 1UWVA 1A8VA 4ZLTF 2GVAA 3I4OA 1DJRD 2B2UA 4ALPA 2I5LX 4LFAL 2ZXRA 2E74C 4A3JB 1H9MA 1DZ1A 5IGGA 4HTHA 3TBIB 2ZTCA 1RJTA 1Y8OB 1ONLA 3E3XA 1EQQA 2KHSA 1A0IA 1KDCA 4N8X1 4HEDA 4QF4A 1DONA 5JJKA 5EAYA 4DKAC 4DR5Q 2ZM6L 1B1ZA 5M3MG 4PV1C 3H0GH 4CJ1B 4LFCQ 1W3SA 3ERQA 5NUCA 3GTMH 3K5MA 1BNZA 2L55A 1HZ9A 1SYFA 2JA6G 4DR3L 3J81L 4JI7L 3SVMA 4BA1I 4XXEA 1YEZA 1MJCA 3K0YA 3S1MB 4DR6L 2MNAA 2AHOB 1HQRD 1UEAB 1L1OC 3K7AH 4OO1I 1WTRA 3I3CA 4NXML 2NVXB 2B8GA 4DV5L 1X6OA 1PRTB 5BR8L 1Q81C 5C3XA 4JG2A 4AYBE 3CHBD 4S3SA 3TP6A 3GTKB 1SNCA 1Q12A 1WTWA 2EYJA 3J81E 1FJGL 2JA9A 4A3BB 2C9OA 3L7ZC 5KYLA 1CA6A 2E5LL 4QB4A 3HOZH 1EIHA 1ENAA 4IPCA 1AH9A 1KC8C 4GS3A 4GN5A 1GUOA 5A35A 1ICFB 2YYZA 1TWHB 2HQEA 3SK5A 5ISRA 4B3TL 3TSSA 3EN2A 3HOWH 4A75A 1VQJA 2B2YA 1PH6A 5GAEC 3MTSA 3PUYA 2B2VA 4J1MA 4BBRG 2B29A 1JWMD 3TEHB 4KD3A 1VQPA 2NZOA 2JA8G 1QE6A 1O7LA 1S5FD 5I9PA 2ICIA 1SMYC 4DV0L 2PZWA 2DNEA 2SNMA 4EQ5A 3J80L 4IUTA 1MSHA 3VR6A 1VQ9A 2ENBA 3U9SA 4AH6A 2YTXA 3H0GB 3K80C 1MD2D 4IFDI 1HJPA 2ZTEA 1V1PB 1HRJA 3IFDA 1JJCB 5IWAQ 2MJ8A 4PQXA 3UE1A 4RH6A 4ZQ3A 4IALA 2UUCQ 1HNWL 3RN2A 2MGSA 4OXPA 1RDPD 1STYA 1ET9A 2F0SA 4P2CB 2WB1E 4IUVA 3K7AB 1U4RA 3CC7A 1VCIA 4G7HC 3J80E 2K04A 1SNOA 1V43A 1I94Q 4ILWA 4JI8L 4R4CA 1KABA 2F3IA 1E7ZA 1RL2A 2R93G 3T56B 4KY6A 3RN5A 1JWUD 4JI3Q 3NBHA 2HIVA 5BN4A 1LTSD 3HOYH 3HG9A 2D5DA 2F0FA 1ESFA 5IP7G 1YNJC 3HOZB 2OWOA 2RHQB 4X66Q 1LTLA 4HIDA 1JOOA 5GROA 3CU7A 1E22A 4R4QA 4DR4Q 3TZDA 1K8OA 2GVBA 4HJ7A 5IGEA 2VY3A 2CFMA 1L1OB 4X65L 2WB1B 3I55A 2VQEL 4G7ZC 5CORA 5M5WH 4WJWA 4R8NA 4B3ML 3KF6A 2BE5D 2EYPA 1PRTD 3KLWA 5I2XA 2KJXA 3FKIG 1B8AA 3SR1A 4DR7L 1XNQQ 1WI5A 1EWHA 3CQZH 2ZTDA 3CF5A 4CDEC 4LF7Q 1EEFD 4FF3A 2JQOA 1K0SA 4C3JB 3E6ZX 3FPUB 5KNBA 2YU9H 3KDFA 2HDLA 4GKKL 1SYCA 3NHHA 4M8AA 1G6PA 4LF9L 3G6EA 1I3QH 4GN4B 1H9SA 3JC66 1SNDA 2K1BA 4DV1Q 2NVTH 2D0PA 1B3QA 1JQYD 3E9HA 3RZDH 2Z9HA 2EXZA 4V0BA 3H91A 5EBCA 4C1NK 2D9UA 4K8IA 3ONAB 5CBAE 1D5MC 4QY7A 2PW7A 2A5HA 3OTOQ 3TP8A 2OXPA 4N8FA 1PYSB 3DM3A 2SOBA 4PMCA 5FO7B 4KI0A 1ESRA 1CKNB 4LUVA 2WAQE 2F0LA 5M3FG 2EYOA 5CV4A 1Q82C 1K8MA 1FYCA 2VUMG 4RCNA 4DR1L 2L9HA 4IUQA 5K36H 3K7UC 1I4HA 1IBKQ 4FXDA 1E2VA 3HOYB 3E5SA 1KHIA 3I4NH 2RDHA 4K6LA 2Q2HA 1SE3A 2LSSA 3F2DA 3OIQA 4JI1L 1Q46A 2I5HA 3T1HQ 4A3EG 2QF7A 4ME3A 1CM9A 2PQEA 1L0WA 4O2DA 5ELCA 4A3MH 3I2ZA 1EOTA 2BOSA 2UUAQ 4CJ2C 1NY4A 3DM1A 1VQ5A 3ER0A 4PMBA 4GN3B 4C2MB 1YZ6A 5C44G 1WOCA 1IBLQ 4DUYL 4GNXC 4PZ7A 4R9WA 4KK7A 1U4PA 4CJ0B 4XQJA 2WAQB 1S5BD 4A3GH 2DY7A 1SE2A 2TSSA 4LF6Q 5JJIA 3DWQA 1OXUA 1GOZA 3X3MA 4POFA 2YU9B 4LNQA 4CKEA 1X3GA 2MO0A 3VR5A 1N32L 1JC7A 4JBKA 1I3QB 4DNTB 4JK1C 1SDFA 4BY7G 2NVTB 2SNSA 3LX0A 1QUQB 2VS1A 4KMUC 1GXDC 1A3UA 1AW7A 2FMMA 2M9VA 4FVMA 1Q86C 3MXGA 1NSNS 4CDFC 2RCNA 1E24A 3R3OA 5IGBA 2KHJA 4G57A 3G71A 4AQYL 2KUMA 1GJXA 3BYYB 1FR3A 4ZKBB 1WD0A 4J15A 1DYQA 2ZXPA 1BCPF 3OMCA 5E3FA 1N34Q 1JE5A 4XT1B 4DV6L 5G3LF 4NXNL 2K5QA 3CXCA 3I4LA 4GZYC 2UU9Q 3N52A 3JAMi 2K5DA 4QUFA 1HNXQ 2Q2UA 4YHHL 3A74A 3I4NB 1KLGD 4A76A 3ULJA 2F0VA 1Y1VG 1EIGA 3D31A 2JYOA 4UDUC 2H1EA 1E1TA 3LNNA 4ULLA 2Q8RE 3CAMA 4IOAA 1Y14B 1VQ4A 2I46A 2K50A 1HPCA 5IYCH 2A68C 5C4XG 3F2UA 1B53A 3CMAA 1E0BA 1HZCA 4OGQC 2N88A 4MHEA 4B3SQ 2RBMA 3CCSA 1JT8A 5FJ8H 2PCFB 4L5QA 5AJ3Q 5C0XJ 1TY2A 2ZT9C 5ELFA 1IKLA 1SMYD 3FEWX 1RTNA 2AUKA 4A3GB 3K8AA 4GOPC 1DGSA 4IZ8A 4A3JG 4KD4A 3D8GA 4RGMA 5ELBA 2FFKB 2EQSA 2K7VA 5CV6A 3ZYYX 1V9PA 1VQGA 4MN3A 5IODA 4Y7NH 1K8GA 1STEA 1PLFA 4C56C 1QB5D 4EVOA 1E3PA 4GLXA 1AEXA 4DAVA 1P8LA 2XWBB 1GO3E 1HHVA 3J7AF 2F0EA 4LUZA 1X65A 2IY5B 2CH4W 3M4OH 3EROA 1OXTA 1WTVA 1WD1A 4ZYSA 3CCRA 2F0WA 2OEOA 1VMPA 5IYDG 3D3RA 4ZRZA 4GNXB 4IFDG 1J5EQ 4IUNA 5CV7A 1H95A 2QA4A 1Z6HA 1VMCA 3EIVA 4P71A 1CHQD 3H15A 3GTOH 3VYTA 4C3IG 2YTVA 3L3OC 1PTOF 1X3EA 4KY7A 3CCEA 3HOUH 3PO3H 2PW5A 4LW1A 1GUWA 1CTMA 1W2BA 2HD3A 3DUZA 4JYAL 5GQOA 1F2ZA 5GADC 1FL0A 1YNJD 1BDOA 3PV0A 1V1OA 1XYIA 3MXNB 3K59A 3J7A5 5E4WC 1CFMA 2HQLA 2PQAA 2PMZB 4BY1H 1VQFA 2RSOA 5CBEE 1C8CA 2CW0C 5DNFA 4A3BG 5GAHC 4BS9A 1AP0A 4OWWB 1IBML 5JPMC 4FP5D 3ND8A 2NN6H 1EWIA 3GQBA 4DR2L 1B7YB 1Q7YC 5LL6S 3TDQA 1RCVD 4XDXA 3U4ZA 4GKJL 1QCBD 3U50C 4XIGS 3A0JA 3NK9A 1LTRD 1HH2P 2HT1A 2FINB 2PZUA 3OPOA 4IFDJ 1F9SA 2NYZD 4JI5Q 4X3TA 2CQAA 1PFSA 4QCLA 3I7FA 1HNZQ 5I2YA 1QILA 2VNUD 4DUZQ 1VS0A 1EIYB 4AYBG 1N36L 3WDNA 3M3YH 4K14A 5JPNC 1L0YB 1HQMC 4JOIA 1KTKA 2WACA 3RNUA 3NWSA 3TP5A 2LKVA 1YHAA 4KKTA 2B2UC 4LF8L 2JJQA 2RQXA 4NB3A 1H9JA 1NBWA 4DNRB 2LFNA 1VQOA 1PVOA 3M4OB 3ICEA 2C5CA 3KFUA 1X3PA 4CKCA 5H1SE 4BXXH 2Y0SE 4P74A 2JXMB 3FMCA 3DLLA 2SDFA 4LFAQ 2KECA 2AQ3B 2UXCL 4OEMB 1WCMH 3Q23A 3RZOH 3U58A 1I5FA 1YNNC 2PQAB 3MA2B 4RGTA
chains in the Genus database with same CATH topology
3EN2A 2OTLA 5C44H 3HOWH 3W5OA 4A75A 1VQJA 1PH6A 4JYAQ 3J80c 5GAEC 1M1KC 2R92G 4IO9A 2EXDA 3PUYA 3I56A 2AKWB 4BBRG 4KHZA 1N33L 2B29A 3A5ZB 2JA5H 3HKSA 2K5HA 3TEHB 1QUQA 1VQPA 2ID0A 2NZOA 2JA8G 3PO2H 1MJEA 3UDGA 2VQFL 1EOVA 4DV0L 3ULPA 4A3DG 3M4QA 1XNQL 5HGQA 2ZM6Q 2FXQA 5IYBH 4DV3L 1HZBA 1KRTA 4LF7L 4EQ5A 4HIOA 2WP8J 2PMZE 3WWVA 1VQ9A 3S17H 3S2HH 3SGIA 1YHQA 1YI2A 4OX9L 4JI4L 4BY7H 4AH6A 1Q8KA 2YTXA 3K80C 1P16A 4IFDI 4HIKA 4DR3Q 1HJPA 2ZTEA 1IBMQ 4JBMA 1JJCB 3AFQA 1S40A 2PI2A 1JJGA 1Y1WG 5IWAQ 1KXLA 4OONA 1X54A 4BBSG 3UE1A 2R6GA 4DAYB 2E2JH 4DR6Q 3PGZA 4GKJQ 1YHBA 5IYCG 2UUCQ 3CPWA 4YCVA 3MEFA 4X64L 1VQNA 1HNWL 1TXYA 3RN2A 2IHFA 4OXPA 3GTPH 4NXMQ 2RF4A 2EIFA 4JOIC 4PG3A 3F2CA 4DV5Q 1BVSA 3RR5A 2WB1E 5FJ8G 5BR8Q 1K0RA 2K75A 3S14H 4A93G 3CC7A 1VCIA 3OTOL 4LF5L 2JEAI 3S2DH 2WB1G 1WYDA 2ALYB 4O0AA 4PMWA 2A8VA 2HHHL 2R7FA 3F2BA 2JK8A 2KBNA 2PNHA 1V43A 1I94Q 4JI8L 4R4CA 2UXDL 1D7QA 1IXRA 4R4IA 1FJGQ 3PSIA 2F3IA 4K0KL 1E7ZA 1RL2A 1YIJA 5JEAG 1V1QA 1YJNA 4LF8Q 2R93G 3AEVA 3PO2G 4A3LH 3RN5A 3T1YL 5ELNA 4JV5L 2E5LQ 4KHPQ 3PUVA 4IOCA 4A3KG 2HIVA 1QZGA 4JI3Q 4UPAA 3HOYH 5IYBG 1X3FA 5IP7G 2OWOA 1Y1VH 4UP7A 2RHQB 4IPHA 4X66Q 1LTLA 1HZAA 4A3CH 1E1OA 3BJUA 4HIDA 5GROA 3HOVH 2CKZB 2D62A 1E22A 4R4QA 2QGQA 3KYHC 4DR4Q 3G48A 4DNIA 2UXCQ 2GVBA 4HJ7A 2VY3A 2CFMA 4DV7L 1L1OB 4B3TQ 2YTYA 1VQLA 4DR2Q 5C4XH 3T1HL 4X65L 3I55A 1GKHA 4QQBX 2OQKA 2N78A 2VQEL 1QVCA 5C0XG 5M5WH 1N33Q 4QL5A 4B3ML 3KF6A 1UE7A 4JCVE 2L15A 3KLWA 2D0OA 2UUBL 3S1QH 2UUAL 3GTGH 1EUJA 2AWNA 5M3FH 3PO3G 3FKIG 1UEBA 1B8AA 2C35B 2K4KA 2VQFQ 4DV0Q 4DR7L 2IHEA 1XNQQ 3F8TA 1WI5A 5FLMH 1WFQA 4LF4L 2N8NA 1Z9FA 3CQZH 2F52A 4DV3Q 2ZTDA 3CF5A 4HJ8A 1IBLL 4LF7Q 2VUMH 1GD7A 1G51A 2JQOA 2OCEA 3E9IA 1KRSA 5LMUL 2E2IH 2YU9H 3KDFA 1LM0A 4PZ6A 1GVPA 2CCZA 1OXVA 4JI4Q 4LF6L 4OX9Q 1YJ9A 4GKKL 1TWGH 4L5SA 1HR0W 4LF9L 1G6PA 1XPRA 1AE3A 3G6EA 1I3QH 4GN4B 4HJ5A 3AFPA 1GM5A 4A3LG 3JC66 4IPDA 1VQIA 4DV1Q 2D0PA 3H0GG 5JEAJ 2LXKA 2NVTH 4GNXA 2NN6I 3CMEA 3E9HA 3HOXH 4A3FH 1PH7A 3RZDH 1VQ7A 3HOYG 3TS2A 4X6AH 3HKZE 3RLNA 1XMOL 1N9WA 4POGA 2Z0SA 2N3SA 4X64Q 2ES2A 3CCVA 2BH2A 4RG1A 4LFBL 3UDIA 3HKZG 1XNRL 2NN6G 1UE1A 1PA6A 1M90C 2ZJQA 1ASYA 3VDYA 2VZAA 1S72A 1K83H 4QY7A 1VQDA 3PIPA 3OTOQ 1PH2A 3CC2A 4LF5Q 1LUZA 2Z6KA 5IYDH 4GLAC 1A62A 4IJLA 4RMFA 1PYSB 3DM3A 1OXSC 4NPSA 3B6YA 2MFIA 1VQ8A 4C3IH 4KI0A 4QJFA 4JI8Q 1CKNB 4LUVA 2UXDQ 2BH8A 3UDFA 2OTJA 2WAQE 5C3EH 1PV4A 4KLKA 4K0KQ 1KD1C 5M3FG 3T1YQ 2NVXH 4JV5Q 1G291 2JEBI 1EYGA 1N34L 1L2FA 1Q82C 1NTGA 1EQRA 1VQEA 3A5UA 1S3OA 2UXBL 2VUMG 4YWMA 1K3RA 5LMNQ 4DR1L 4LUOA 1KAWA 2KHIA 3K7UC 2N49A 1IBKQ 2A1AA 4IJHA 1TWAH 4JI7Q 3TQYA 1C9OA 1KHIA 5J3BA 3I4NH 3HOZG 2UU9L 5M3MH 2Q2HA 1N8RC 2LSSA 3F2DA 1HNXL 4WJ3M 4XTCS 3G4SA 4JI1L 1Q46A 2I5HA 4DV7Q 3EBEA 2A19A 4A3IH 4R4TA 3T1HQ 4GLVB 4A3EG 2B3GA 4X65Q 2JA6H 4BXXG 4ME3A 1L0WA 1J6QA 2VQEQ 4O2DA 5JJLA 2VL6A 4A3MH 1PH3A 1U0LA 3J7ZC 2H5XA 3I2ZA 1WCMG 5M5XH 2E8GA 2UUBQ 3PUXA 4MNOA 1YITA 2UUAQ 1VQ6A 1NY4A 3J81i 1VQ5A 3ER0A 4GN3B 4UY8C 1SRUA 1YZ6A 2PI2E 1C7YA 5C44G 3GTQH 3HOWG 4DR7Q 4LF4Q 1NMFA 1WOCA 4DUYL 1N36Q 1IBLQ 4AIMA 4PZ7A 4GNXC 2NZHA 4B3SL 1LYLA 4YWLA 3M85A 5LMUQ 3HFZB 5HY6A 2JA5G 4A3GH 5AJ3L 2I0QA 4C3HH 3AYHB 4LF6Q 5JJIA 2I5MX 1OXUA 3FP9A 3S15H 4GKKQ 4POFA 4APVA 2F4VL 2NVQH 4DK6C 4LNQA 4LF9Q 1X3GA 4BA2I 3BZKA 5C3EG 1Q1BA 4DAMA 1PHJA 2MO0A 1D8LA 2OQ0A 4JI0L 4YY3L 1MKHA 2Z6KC 5IE8A 1N32L 4HJ9A 4JBKA 1FGUA 1R9TH 5FLXc 1PH1A 3H3VH 1VQHA 4BY7G 1X56A 2BA1A 5K36G 4R1JA 1QUQB 2VS1A 3S1RH 1CSQA 3TRZA 4LFBQ 3BU2A 4TQUS 1XNRQ 1EIFA 1YBYA 1OTCA 4DPGA 5IY0A 4GOPA 5C0XI 2KENA 4FDBA 1Q86C 4JC0A 4DV2L 2JE6I 4JI6L 2RCNA 1E24A 3ZJYC 2KHJA 3G71A 1IYJB 3K0XA 3GDEA 1XJVA 1CSPA 1Q1EA 4A3IG 3GO5A 3CP0A 4AQYL 2RHSB 4MTNA 3PIOA 3GTJH 2R7ZH 3CCUA 3NENA 3UE0A 2JA7H 3CC4A 4QIWE 1YNXA 1NJIC 4J15A 5M5YH 1JJ2A 4A3JH 1X9NA 1J5EL 3PF4A 2R92H 5E7NA 3STBD 1N34Q 1JE5A 1K73C 1YVCA 4BBRH 5C4JH 4DV6L 2UXBQ 4NXNL 3OW2A 4DV4L 4DR1Q 3CXCA 1I50H 2QEXA 2XGTA 2ZJPA 4A3GG 1IZ6A 1NE3A 1QVGA 4P75A 2LXJA 1MIUA 3LGJA 2UU9Q 5GAGC 3TS0A 3L2PA 4HJAA 3JAMi 1ASZA 1HNXQ 3ERSX 4R4OA 2Q2UA 4YHHL 3A74A 1HNWQ 1I6HH 4A76A 3ULJA 1I94L 1Y1VG 2Q2TA 1O7IA 3D31A 2V1CC 2NVYH 3PCOB 1UE6A 4X62L 4P73A 1E1TA 3J80i 3HOVG 4A3CG 4DR5L 1PH5A 1Y1WH 4TVAB 3CAMA 1SROA 3W1BA 1PYBA 1Y14B 2K52A 1XMQL 1VQKA 3GTLH 1VQ4A 4LFCL 3RLOA 4BBSH 2K50A 3NBHB 3CD6A 4HIMA 1PH8A 3TREA 1KIXA 4PZ8A 2K14A 5IYCH 2HHHQ 1KQSA 1VQMA 5C4XG 3W1GA 1NMGA 3E0EA 2MQHA 3AQQA 3CMAA 1XPUA 1HZCA 4DUYQ 4JBJA 4A4IA 3S1MH 4B3SQ 1VQBA 2KCMA 3CCSA 2B63H 1JT8A 2BA0A 5FJ8H 1WJJA 4A93H 4L5QA 5AJ3Q 1UE5A 5C0XJ 3CW2C 1CKMA 3RLFA 4GOPB 2WAQG 1B70B 3M7NA 1CUKA 2DUDA 3K8AA 1DGSA 2R7DA 3M4PA 4GOPC 2JA7G 5IP9H 5FLMG 1YJWA 1HR0L 1A63A 4YCUA 2E2HH 4JI0Q 2ATWA 4YY3Q 4A3JG 4DK3C 2WFWA 1RIPA 1N32Q 1JB7A 3IRBA 2EQSA 3GD7A 4JBWA 4JI5L 1Z47A 3I4MH 3KF6B 1V9PA 1PH4A 2R93H 1VQGA 2CWPA 4Y7NH 1K8GA 3M9BA 2AWOA 1HNZL 1E3PA 4A3KH 4C3JH 3K81C 2K5NA 4UP8A 4DUZL 1L1OA 3GTKH 4GLXA 4DV2Q 3U4VA 1BBUA 1K8AC 1P8LA 4A3FG 3J81j 3HOXG 4JI6Q 1GO3E 4H02A 5IP7H 4A3BH 2AMCB 2ASBA 1U5KA 3KDFB 4LUZA 1X65A 2IY5B 1OXXK 4MZ9A 2IX1A 4B3MQ 1JMCA 3M4OH 4AQYQ 4UP9A 4B3RL 1OXTA 2XTIA 1BBWA 3S16H 3CCRA 5LMNW 4L5TA 2VW9A 1QVFA 1FVIA 4DV1L 3CCLA 4JI2L 5IYDG 4LWCA 4GNXB 4IFDG 3S1NH 4IOAA 4P72A 1TWHH 1UWVA 1J5EQ 1A8VA 1H95A 2GVAA 2IX0A 2QA4A 3I4OA 3EIVA 4P71A 4ALPA 2I5LX 3H15A 2YV5A 4DV6Q 4LFAL 3GTOH 2YTVA 4NXNQ 1KL9A 4DV4Q 2B63G 1X3EA 1SMXA 4QGUA 3CCEA 3HOUH 3PO3H 3FKIH 4LW1A 3Q8DA 1TWFH 1W2BA 4JYAL 5GQOA 4YWKA 3FHWA 2ZTCA 5GADC 3L0OA 1FL0A 2IT1A 2MO1A 1SFOH 5IP9G 1EQQA 4YHHQ 1XMOQ 2K5VA 1SE8A 4OWXB 3PV0A 1A0IA 3KOJA 3MXNB 1QZHA 4X62Q 3J81c 5JJKA 5EAYA 3KJPA 5IT9c 3I4MG 3J7A5 4DKAC 4DR5Q 3PF5A 2HQLA 2PQAA 2ZM6L 4BY1H 2ZJRA 1XMQQ 1VQFA 5M3MG 4IPGA 3H0GH 4EX5A 4LFCQ 2HIXA 2KCTA 1W3SA 1TWCH 3GTMH 3KF8B 1BKBA 4A3BG 1HZ9A 5LMNL 5GAHC 4YCWA 2JA6G 4OWWB 4DR3L 1IBKL 1IBML 2CWAA 1CKNA 1EWIA 4DR2L 4JI7L 4A3MG 1B7YB 3NELA 5IWAL 4BA1I 1Q7YC 1C0AA 1YEZA 3NEMA 5ELOA 1MJCA 5DLQE 4DR6L 3U4ZA 4GKJL 2MNAA 3CPFA 2AHOB 3U50C 2UUCL 1PH9A 1L1OC 2CQOA 4XIGS 1HR0Q 3K7AH 4OO1I 3A0JA 3PUWA 1XPOA 1SN8A 4NXML 4DV5L 1HH2P 1X6OA 2HT1A 4IFDJ 2JA8H 5BR8L 1Q81C 4C2MH 4JI5Q 4A3DH 4OO1G 4JG2A 1PFSA 4WJ4A 4AYBE 3I7FA 3H3VI 3HOUG 3CCMA 1HNZQ 4L5RC 1VQAA 3BZCA 2VNUD 4DUZQ 4JI1Q 1VS0A 1X55A 1EIYB 1T9HA 3STBC 4AYBG 1N36L 3M3YH 4JOIA 3RNUA 3S24A 1CKOA 1Q12A 1FJGL 1SLJA 2GN5A 1YHAA 2JA9A 4LF8L 1XTDA 2JJQA 1EFWA 4NB3A 3L7ZC 3ULLA 2E5LL 3HOZH 4B3RQ 4JI3L 4KHPL 1NBWA 1AE2A 3CCQA 4IPCA 3OYYA 2Q2IA 4BY1G 1VQOA 1PVOA 1AH9A 3ICEA 3UDXA 1SR3A 1KC8C 1IL2A 4JI2Q 3I4NG 4GS3A 4X66L 5H1SE 3KJOA 4A3EH 3KFUA 2Y0SE 4P74A 4BXXH 4GN5A 3F1ZA 2DGYA 3DLLA 4OWTB 4DR4L 2Y0SG 4LFAQ 1K9MC 2UXCL 2YYZA 1WCMH 3PUZA 3JAMc 2R7ZG 3U58A 3RZOH 4Y52H 3D0FA 1VQCA 2F4VQ 1I5FA 3CCJA 4B3TL 2PQAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EN2 A;  2OTL A;  5C44 H;  3HOW H;  3W5O A;  4A75 A;  1VQJ A;  1PH6 A;  4JYA Q;  3J80 c;  5GAE C;  1M1K C;  2R92 G;  4IO9 A;  2EXD A;  3PUY A;  3I56 A;  2AKW B;  4BBR G;  4KHZ A;  1N33 L;  2B29 A;  3A5Z B;  2JA5 H;  3HKS A;  2K5H A;  3TEH B;  1QUQ A;  1VQP A;  2ID0 A;  2NZO A;  2JA8 G;  3PO2 H;  1MJE A;  3UDG A;  2VQF L;  1EOV A;  4DV0 L;  3ULP A;  4A3D G;  3M4Q A;  1XNQ L;  5HGQ A;  2ZM6 Q;  2FXQ A;  5IYB H;  4DV3 L;  1HZB A;  1KRT A;  4LF7 L;  4EQ5 A;  4HIO A;  2WP8 J;  2PMZ E;  3WWV A;  1VQ9 A;  3S17 H;  3S2H H;  3SGI A;  1YHQ A;  1YI2 A;  4OX9 L;  4JI4 L;  4BY7 H;  4AH6 A;  1Q8K A;  2YTX A;  3K80 C;  1P16 A;  4IFD I;  4HIK A;  4DR3 Q;  1HJP A;  2ZTE A;  1IBM Q;  4JBM A;  1JJC B;  3AFQ A;  1S40 A;  2PI2 A;  1JJG A;  1Y1W G;  5IWA Q;  1KXL A;  4OON A;  1X54 A;  4BBS G;  3UE1 A;  2R6G A;  4DAY B;  2E2J H;  4DR6 Q;  3PGZ A;  4GKJ Q;  1YHB A;  5IYC G;  2UUC Q;  3CPW A;  4YCV A;  3MEF A;  4X64 L;  1VQN A;  1HNW L;  1TXY A;  3RN2 A;  2IHF A;  4OXP A;  3GTP H;  4NXM Q;  2RF4 A;  2EIF A;  4JOI C;  4PG3 A;  3F2C A;  4DV5 Q;  1BVS A;  3RR5 A;  2WB1 E;  5FJ8 G;  5BR8 Q;  1K0R A;  2K75 A;  3S14 H;  4A93 G;  3CC7 A;  1VCI A;  3OTO L;  4LF5 L;  2JEA I;  3S2D H;  2WB1 G;  1WYD A;  2ALY B;  4O0A A;  4PMW A;  2A8V A;  2HHH L;  2R7F A;  3F2B A;  2JK8 A;  2KBN A;  2PNH A;  1V43 A;  1I94 Q;  4JI8 L;  4R4C A;  2UXD L;  1D7Q A;  1IXR A;  4R4I A;  1FJG Q;  3PSI A;  2F3I A;  4K0K L;  1E7Z A;  1RL2 A;  1YIJ A;  5JEA G;  1V1Q A;  1YJN A;  4LF8 Q;  2R93 G;  3AEV A;  3PO2 G;  4A3L H;  3RN5 A;  3T1Y L;  5ELN A;  4JV5 L;  2E5L Q;  4KHP Q;  3PUV A;  4IOC A;  4A3K G;  2HIV A;  1QZG A;  4JI3 Q;  4UPA A;  3HOY H;  5IYB G;  1X3F A;  5IP7 G;  2OWO A;  1Y1V H;  4UP7 A;  2RHQ B;  4IPH A;  4X66 Q;  1LTL A;  1HZA A;  4A3C H;  1E1O A;  3BJU A;  4HID A;  5GRO A;  3HOV H;  2CKZ B;  2D62 A;  1E22 A;  4R4Q A;  2QGQ A;  3KYH C;  4DR4 Q;  3G48 A;  4DNI A;  2UXC Q;  2GVB A;  4HJ7 A;  2VY3 A;  2CFM A;  4DV7 L;  1L1O B;  4B3T Q;  2YTY A;  1VQL A;  4DR2 Q;  5C4X H;  3T1H L;  4X65 L;  3I55 A;  1GKH A;  4QQB X;  2OQK A;  2N78 A;  2VQE L;  1QVC A;  5C0X G;  5M5W H;  1N33 Q;  4QL5 A;  4B3M L;  3KF6 A;  1UE7 A;  4JCV E;  2L15 A;  3KLW A;  2D0O A;  2UUB L;  3S1Q H;  2UUA L;  3GTG H;  1EUJ A;  2AWN A;  5M3F H;  3PO3 G;  3FKI G;  1UEB A;  1B8A A;  2C35 B;  2K4K A;  2VQF Q;  4DV0 Q;  4DR7 L;  2IHE A;  1XNQ Q;  3F8T A;  1WI5 A;  5FLM H;  1WFQ A;  4LF4 L;  2N8N A;  1Z9F A;  3CQZ H;  2F52 A;  4DV3 Q;  2ZTD A;  3CF5 A;  4HJ8 A;  1IBL L;  4LF7 Q;  2VUM H;  1GD7 A;  1G51 A;  2JQO A;  2OCE A;  3E9I A;  1KRS A;  5LMU L;  2E2I H;  2YU9 H;  3KDF A;  1LM0 A;  4PZ6 A;  1GVP A;  2CCZ A;  1OXV A;  4JI4 Q;  4LF6 L;  4OX9 Q;  1YJ9 A;  4GKK L;  1TWG H;  4L5S A;  1HR0 W;  4LF9 L;  1G6P A;  1XPR A;  1AE3 A;  3G6E A;  1I3Q H;  4GN4 B;  4HJ5 A;  3AFP A;  1GM5 A;  4A3L G;  3JC6 6;  4IPD A;  1VQI A;  4DV1 Q;  2D0P A;  3H0G G;  5JEA J;  2LXK A;  2NVT H;  4GNX A;  2NN6 I;  3CME A;  3E9H A;  3HOX H;  4A3F H;  1PH7 A;  3RZD H;  1VQ7 A;  3HOY G;  3TS2 A;  4X6A H;  3HKZ E;  3RLN A;  1XMO L;  1N9W A;  4POG A;  2Z0S A;  2N3S A;  4X64 Q;  2ES2 A;  3CCV A;  2BH2 A;  4RG1 A;  4LFB L;  3UDI A;  3HKZ G;  1XNR L;  2NN6 G;  1UE1 A;  1PA6 A;  1M90 C;  2ZJQ A;  1ASY A;  3VDY A;  2VZA A;  1S72 A;  1K83 H;  4QY7 A;  1VQD A;  3PIP A;  3OTO Q;  1PH2 A;  3CC2 A;  4LF5 Q;  1LUZ A;  2Z6K A;  5IYD H;  4GLA C;  1A62 A;  4IJL A;  4RMF A;  1PYS B;  3DM3 A;  1OXS C;  4NPS A;  3B6Y A;  2MFI A;  1VQ8 A;  4C3I H;  4KI0 A;  4QJF A;  4JI8 Q;  1CKN B;  4LUV A;  2UXD Q;  2BH8 A;  3UDF A;  2OTJ A;  2WAQ E;  5C3E H;  1PV4 A;  4KLK A;  4K0K Q;  1KD1 C;  5M3F G;  3T1Y Q;  2NVX H;  4JV5 Q;  1G29 1;  2JEB I;  1EYG A;  1N34 L;  1L2F A;  1Q82 C;  1NTG A;  1EQR A;  1VQE A;  3A5U A;  1S3O A;  2UXB L;  2VUM G;  4YWM A;  1K3R A;  5LMN Q;  4DR1 L;  4LUO A;  1KAW A;  2KHI A;  3K7U C;  2N49 A;  1IBK Q;  2A1A A;  4IJH A;  1TWA H;  4JI7 Q;  3TQY A;  1C9O A;  1KHI A;  5J3B A;  3I4N H;  3HOZ G;  2UU9 L;  5M3M H;  2Q2H A;  1N8R C;  2LSS A;  3F2D A;  1HNX L;  4WJ3 M;  4XTC S;  3G4S A;  4JI1 L;  1Q46 A;  2I5H A;  4DV7 Q;  3EBE A;  2A19 A;  4A3I H;  4R4T A;  3T1H Q;  4GLV B;  4A3E G;  2B3G A;  4X65 Q;  2JA6 H;  4BXX G;  4ME3 A;  1L0W A;  1J6Q A;  2VQE Q;  4O2D A;  5JJL A;  2VL6 A;  4A3M H;  1PH3 A;  1U0L A;  3J7Z C;  2H5X A;  3I2Z A;  1WCM G;  5M5X H;  2E8G A;  2UUB Q;  3PUX A;  4MNO A;  1YIT A;  2UUA Q;  1VQ6 A;  1NY4 A;  3J81 i;  1VQ5 A;  3ER0 A;  4GN3 B;  4UY8 C;  1SRU A;  1YZ6 A;  2PI2 E;  1C7Y A;  5C44 G;  3GTQ H;  3HOW G;  4DR7 Q;  4LF4 Q;  1NMF A;  1WOC A;  4DUY L;  1N36 Q;  1IBL Q;  4AIM A;  4PZ7 A;  4GNX C;  2NZH A;  4B3S L;  1LYL A;  4YWL A;  3M85 A;  5LMU Q;  3HFZ B;  5HY6 A;  2JA5 G;  4A3G H;  5AJ3 L;  2I0Q A;  4C3H H;  3AYH B;  4LF6 Q;  5JJI A;  2I5M X;  1OXU A;  3FP9 A;  3S15 H;  4GKK Q;  4POF A;  4APV A;  2F4V L;  2NVQ H;  4DK6 C;  4LNQ A;  4LF9 Q;  1X3G A;  4BA2 I;  3BZK A;  5C3E G;  1Q1B A;  4DAM A;  1PHJ A;  2MO0 A;  1D8L A;  2OQ0 A;  4JI0 L;  4YY3 L;  1MKH A;  2Z6K C;  5IE8 A;  1N32 L;  4HJ9 A;  4JBK A;  1FGU A;  1R9T H;  5FLX c;  1PH1 A;  3H3V H;  1VQH A;  4BY7 G;  1X56 A;  2BA1 A;  5K36 G;  4R1J A;  1QUQ B;  2VS1 A;  3S1R H;  1CSQ A;  3TRZ A;  4LFB Q;  3BU2 A;  4TQU S;  1XNR Q;  1EIF A;  1YBY A;  1OTC A;  4DPG A;  5IY0 A;  4GOP A;  5C0X I;  2KEN A;  4FDB A;  1Q86 C;  4JC0 A;  4DV2 L;  2JE6 I;  4JI6 L;  2RCN A;  1E24 A;  3ZJY C;  2KHJ A;  3G71 A;  1IYJ B;  3K0X A;  3GDE A;  1XJV A;  1CSP A;  1Q1E A;  4A3I G;  3GO5 A;  3CP0 A;  4AQY L;  2RHS B;  4MTN A;  3PIO A;  3GTJ H;  2R7Z H;  3CCU A;  3NEN A;  3UE0 A;  2JA7 H;  3CC4 A;  4QIW E;  1YNX A;  1NJI C;  4J15 A;  5M5Y H;  1JJ2 A;  4A3J H;  1X9N A;  1J5E L;  3PF4 A;  2R92 H;  5E7N A;  3STB D;  1N34 Q;  1JE5 A;  1K73 C;  1YVC A;  4BBR H;  5C4J H;  4DV6 L;  2UXB Q;  4NXN L;  3OW2 A;  4DV4 L;  4DR1 Q;  3CXC A;  1I50 H;  2QEX A;  2XGT A;  2ZJP A;  4A3G G;  1IZ6 A;  1NE3 A;  1QVG A;  4P75 A;  2LXJ A;  1MIU A;  3LGJ A;  2UU9 Q;  5GAG C;  3TS0 A;  3L2P A;  4HJA A;  3JAM i;  1ASZ A;  1HNX Q;  3ERS X;  4R4O A;  2Q2U A;  4YHH L;  3A74 A;  1HNW Q;  1I6H H;  4A76 A;  3ULJ A;  1I94 L;  1Y1V G;  2Q2T A;  1O7I A;  3D31 A;  2V1C C;  2NVY H;  3PCO B;  1UE6 A;  4X62 L;  4P73 A;  1E1T A;  3J80 i;  3HOV G;  4A3C G;  4DR5 L;  1PH5 A;  1Y1W H;  4TVA B;  3CAM A;  1SRO A;  3W1B A;  1PYB A;  1Y14 B;  2K52 A;  1XMQ L;  1VQK A;  3GTL H;  1VQ4 A;  4LFC L;  3RLO A;  4BBS H;  2K50 A;  3NBH B;  3CD6 A;  4HIM A;  1PH8 A;  3TRE A;  1KIX A;  4PZ8 A;  2K14 A;  5IYC H;  2HHH Q;  1KQS A;  1VQM A;  5C4X G;  3W1G A;  1NMG A;  3E0E A;  2MQH A;  3AQQ A;  3CMA A;  1XPU A;  1HZC A;  4DUY Q;  4JBJ A;  4A4I A;  3S1M H;  4B3S Q;  1VQB A;  2KCM A;  3CCS A;  2B63 H;  1JT8 A;  2BA0 A;  5FJ8 H;  1WJJ A;  4A93 H;  4L5Q A;  5AJ3 Q;  1UE5 A;  5C0X J;  3CW2 C;  1CKM A;  3RLF A;  4GOP B;  2WAQ G;  1B70 B;  3M7N A;  1CUK A;  2DUD A;  3K8A A;  1DGS A;  2R7D A;  3M4P A;  4GOP C;  2JA7 G;  5IP9 H;  5FLM G;  1YJW A;  1HR0 L;  1A63 A;  4YCU A;  2E2H H;  4JI0 Q;  2ATW A;  4YY3 Q;  4A3J G;  4DK3 C;  2WFW A;  1RIP A;  1N32 Q;  1JB7 A;  3IRB A;  2EQS A;  3GD7 A;  4JBW A;  4JI5 L;  1Z47 A;  3I4M H;  3KF6 B;  1V9P A;  1PH4 A;  2R93 H;  1VQG A;  2CWP A;  4Y7N H;  1K8G A;  3M9B A;  2AWO A;  1HNZ L;  1E3P A;  4A3K H;  4C3J H;  3K81 C;  2K5N A;  4UP8 A;  4DUZ L;  1L1O A;  3GTK H;  4GLX A;  4DV2 Q;  3U4V A;  1BBU A;  1K8A C;  1P8L A;  4A3F G;  3J81 j;  3HOX G;  4JI6 Q;  1GO3 E;  4H02 A;  5IP7 H;  4A3B H;  2AMC B;  2ASB A;  1U5K A;  3KDF B;  4LUZ A;  1X65 A;  2IY5 B;  1OXX K;  4MZ9 A;  2IX1 A;  4B3M Q;  1JMC A;  3M4O H;  4AQY Q;  4UP9 A;  4B3R L;  1OXT A;  2XTI A;  1BBW A;  3S16 H;  3CCR A;  5LMN W;  4L5T A;  2VW9 A;  1QVF A;  1FVI A;  4DV1 L;  3CCL A;  4JI2 L;  5IYD G;  4LWC A;  4GNX B;  4IFD G;  3S1N H;  4IOA A;  4P72 A;  1TWH H;  1UWV A;  1J5E Q;  1A8V A;  1H95 A;  2GVA A;  2IX0 A;  2QA4 A;  3I4O A;  3EIV A;  4P71 A;  4ALP A;  2I5L X;  3H15 A;  2YV5 A;  4DV6 Q;  4LFA L;  3GTO H;  2YTV A;  4NXN Q;  1KL9 A;  4DV4 Q;  2B63 G;  1X3E A;  1SMX A;  4QGU A;  3CCE A;  3HOU H;  3PO3 H;  3FKI H;  4LW1 A;  3Q8D A;  1TWF H;  1W2B A;  4JYA L;  5GQO A;  4YWK A;  3FHW A;  2ZTC A;  5GAD C;  3L0O A;  1FL0 A;  2IT1 A;  2MO1 A;  1SFO H;  5IP9 G;  1EQQ A;  4YHH Q;  1XMO Q;  2K5V A;  1SE8 A;  4OWX B;  3PV0 A;  1A0I A;  3KOJ A;  3MXN B;  1QZH A;  4X62 Q;  3J81 c;  5JJK A;  5EAY A;  3KJP A;  5IT9 c;  3I4M G;  3J7A 5;  4DKA C;  4DR5 Q;  3PF5 A;  2HQL A;  2PQA A;  2ZM6 L;  4BY1 H;  2ZJR A;  1XMQ Q;  1VQF A;  5M3M G;  4IPG A;  3H0G H;  4EX5 A;  4LFC Q;  2HIX A;  2KCT A;  1W3S A;  1TWC H;  3GTM H;  3KF8 B;  1BKB A;  4A3B G;  1HZ9 A;  5LMN L;  5GAH C;  4YCW A;  2JA6 G;  4OWW B;  4DR3 L;  1IBK L;  1IBM L;  2CWA A;  1CKN A;  1EWI A;  4DR2 L;  4JI7 L;  4A3M G;  1B7Y B;  3NEL A;  5IWA L;  4BA1 I;  1Q7Y C;  1C0A A;  1YEZ A;  3NEM A;  5ELO A;  1MJC A;  5DLQ E;  4DR6 L;  3U4Z A;  4GKJ L;  2MNA A;  3CPF A;  2AHO B;  3U50 C;  2UUC L;  1PH9 A;  1L1O C;  2CQO A;  4XIG S;  1HR0 Q;  3K7A H;  4OO1 I;  3A0J A;  3PUW A;  1XPO A;  1SN8 A;  4NXM L;  4DV5 L;  1HH2 P;  1X6O A;  2HT1 A;  4IFD J;  2JA8 H;  5BR8 L;  1Q81 C;  4C2M H;  4JI5 Q;  4A3D H;  4OO1 G;  4JG2 A;  1PFS A;  4WJ4 A;  4AYB E;  3I7F A;  3H3V I;  3HOU G;  3CCM A;  1HNZ Q;  4L5R C;  1VQA A;  3BZC A;  2VNU D;  4DUZ Q;  4JI1 Q;  1VS0 A;  1X55 A;  1EIY B;  1T9H A;  3STB C;  4AYB G;  1N36 L;  3M3Y H;  4JOI A;  3RNU A;  3S24 A;  1CKO A;  1Q12 A;  1FJG L;  1SLJ A;  2GN5 A;  1YHA A;  2JA9 A;  4LF8 L;  1XTD A;  2JJQ A;  1EFW A;  4NB3 A;  3L7Z C;  3ULL A;  2E5L L;  3HOZ H;  4B3R Q;  4JI3 L;  4KHP L;  1NBW A;  1AE2 A;  3CCQ A;  4IPC A;  3OYY A;  2Q2I A;  4BY1 G;  1VQO A;  1PVO A;  1AH9 A;  3ICE A;  3UDX A;  1SR3 A;  1KC8 C;  1IL2 A;  4JI2 Q;  3I4N G;  4GS3 A;  4X66 L;  5H1S E;  3KJO A;  4A3E H;  3KFU A;  2Y0S E;  4P74 A;  4BXX H;  4GN5 A;  3F1Z A;  2DGY A;  3DLL A;  4OWT B;  4DR4 L;  2Y0S G;  4LFA Q;  1K9M C;  2UXC L;  2YYZ A;  1WCM H;  3PUZ A;  3JAM c;  2R7Z G;  3U58 A;  3RZO H;  4Y52 H;  3D0F A;  1VQC A;  2F4V Q;  1I5F A;  3CCJ A;  4B3T L;  2PQA B; 
#chains in the Genus database with same CATH topology
 3C3L A;  4LK1 C;  1M1K C;  1B9M A;  4TKO B;  3IFT A;  3HOU B;  2O4X A;  1TKW B;  2AKW B;  1N33 L;  3A5Z B;  2JA5 H;  2G9H D;  1EY5 A;  3PO2 H;  3SHL A;  2VQF L;  2XSC A;  4NP5 A;  3ULP A;  3FVQ A;  2PPB C;  1BOS A;  5HGQ A;  2ZM6 Q;  4DV3 L;  1HZB A;  2HCI A;  3NQT A;  3QB3 A;  4HIO A;  4UAI A;  1RKN A;  3H6M A;  3S17 H;  3LWE A;  3S2H H;  3SGI A;  4BY1 B;  3HGB A;  1ZXT A;  4HR7 B;  4HIK A;  4DR3 Q;  4JBM A;  1F9Q A;  1HUM A;  1CQV A;  4OON A;  2F0H A;  2Y0S B;  2R6G A;  2R7Z B;  4DAY B;  2E2J H;  4DR6 Q;  3PGZ A;  3BS1 A;  2F0N A;  4IN3 A;  4RGN A;  3QOJ A;  3GTP H;  4NXM Q;  5CR3 A;  3F2C A;  4DV5 Q;  2R92 B;  1BVS A;  3RR5 A;  5BR8 Q;  4A93 G;  4DAP A;  4LF5 L;  2JEA I;  3S2D H;  2WB1 G;  3PQI A;  4O0A A;  5FOB B;  2A8V A;  2HHH L;  2R7F A;  2RCF A;  2XNA C;  4TRD A;  2EVB A;  1WTH A;  5C3W A;  4OIK A;  2F0I A;  2UXD L;  4K8J A;  4R4I A;  1FJG Q;  4G4K A;  4O42 A;  2SEB D;  1YIJ A;  1Z7T A;  2J4X A;  1V1Q A;  1A3V A;  4K0K L;  3AEV A;  1TVX A;  2E76 C;  3T1Y L;  4JV5 L;  2E5L Q;  3PUV A;  5KEE A;  4C3J G;  4A3K G;  1Y1W B;  1XWE A;  3P75 A;  2B2Y C;  4BBS B;  3SEB A;  4UP7 A;  5J22 A;  3NTH A;  2K6A A;  1GUS A;  2B2V C;  4A3C H;  1E1O A;  3KLS X;  3HOV H;  5FK9 C;  2RVL A;  2IW3 A;  3SK6 A;  1LAB A;  4DV7 L;  4XYO A;  4B3T Q;  1VQL A;  1F9R A;  5KND A;  4N9T A;  3O13 A;  1UAP A;  1GKH A;  4CBV A;  5C5M A;  4QL5 A;  4JCV E;  1B3A A;  3GTG H;  2EYF A;  1UEB A;  2C35 B;  4DV0 Q;  4X3S A;  1EQV A;  2IHE A;  3F8T A;  2PYK A;  2N8N A;  4L63 B;  4HJ8 A;  3PO2 B;  1KDA A;  1G51 A;  2OCE A;  3E9I A;  1KRS A;  5LMU L;  3BVG A;  4JW0 A;  4HCE A;  3S2H B;  3C1E A;  1HR0 W;  5CV9 A;  4HSV A;  4HJ5 A;  1GM5 A;  3VR2 A;  4A3F H;  2NN6 I;  3HOX H;  1VQ7 A;  2A68 D;  4ID6 A;  3HOY G;  2I07 B;  3RLN A;  4POG A;  2XVS A;  1HFN A;  1QOH A;  1ZEQ X;  4RG1 A;  3UDI A;  2E2J B;  1XNR L;  1LTT D;  1M90 C;  2ZJQ A;  1S72 A;  1VQD A;  3GTP B;  2P5Z X;  1PH2 A;  3CC2 A;  1LUZ A;  2Z6K A;  3Q6S A;  4GLA C;  1G6Z A;  4RMF A;  4DGZ A;  1NR2 A;  1OXS C;  1SYE A;  3B6Y A;  1HCZ A;  3I72 A;  3S2D B;  2MFI A;  1MHW C;  5EPJ A;  4FXG C;  4QJF A;  4JI8 Q;  5IOC A;  3UDF A;  1PFB A;  4Z9C B;  5C3E H;  1PV4 A;  3I70 A;  2JEB I;  4HSP A;  4OHJ A;  4HCS A;  3KF8 A;  1NTG A;  4UHV A;  1JOR A;  3A5U A;  3H94 A;  2UXB L;  1K3R A;  3OMG A;  5LMN Q;  4LUO A;  2KHI A;  2N49 A;  3GTM B;  2A1A A;  1TWA H;  5M3M H;  1N8R C;  3H3V C;  3HOV B;  3EFX D;  1L0X B;  3NPP A;  2F0P A;  3EBE A;  3QIA A;  3GV6 A;  2JA6 H;  2B3G A;  4X65 Q;  2G5D A;  5F2D A;  4DFA A;  2VQE Q;  2L5T A;  1S4Z A;  5JJL A;  2VL6 A;  1U0L A;  5M5X H;  1FNU A;  1TS5 A;  4NMZ A;  1VF5 C;  3NWT A;  1D2B A;  2E8G A;  1YIT A;  1ML0 D;  3J81 i;  4UY8 C;  1SRU A;  1C7Y A;  4DR7 Q;  4V19 0;  1NMF A;  3GTG B;  4AIM A;  4QUC A;  1LYL A;  4YWL A;  1SNP A;  4FF1 A;  1SYG A;  2I0Q A;  3BDL A;  3FP9 A;  4GKK Q;  3HS0 C;  4APV A;  4BA2 I;  4LF9 Q;  3BZK A;  3NP8 A;  1NNX A;  4H0L C;  3DEP A;  2A74 C;  1D8L A;  2OQ0 A;  1I4G A;  3BG3 A;  4YY3 L;  4JI0 L;  2CW0 D;  1GUN A;  3V05 A;  5HGT A;  3T13 A;  1FGU A;  4K2K A;  1PH1 A;  3H3V H;  1VQH A;  5L37 A;  5K36 G;  1SE4 A;  4IUU A;  4IUP A;  2PZT A;  3HOX B;  4OEL B;  4DF7 A;  1YBY A;  3M7G A;  1OTC A;  5IY0 A;  2E2D C;  4EQP A;  4H13 C;  4FDB A;  4G7O C;  2Z4I A;  4DV2 L;  1IYJ B;  1K28 A;  1XJV A;  3K5N A;  3IL8 A;  3HOW B;  3CP0 A;  4MTN A;  2EPB A;  3PIO A;  4ZAI A;  1GUG A;  1STA A;  5IT9 L;  1EFI D;  4DA2 A;  1YNX A;  3GP7 A;  1X9N A;  5C3E B;  5FO8 B;  1YVC A;  3VA5 A;  4BBR H;  5C4J H;  4DV4 L;  4DR1 Q;  1WTQ A;  1MI2 A;  1I50 H;  3OIP A;  2XGT A;  2ZJP A;  4A3G G;  1EY8 A;  4WRD A;  4CDC C;  1QVG A;  3I73 A;  4KHV A;  1A2T A;  1ENC A;  3L2P A;  4HAE A;  1TWA B;  3C46 A;  1B50 A;  5M3M B;  1I94 L;  4X62 L;  3PCO B;  3KLS A;  3J80 i;  1EZ6 A;  1M8A A;  3LWU A;  1SRO A;  1ZYR C;  2K52 A;  5A2Q L;  1XMQ L;  4C1N I;  1VQK A;  2JA6 B;  1YNN D;  3RLO A;  3NBH B;  3TRE A;  1KIX A;  3VA7 A;  2XRS D;  1NMG A;  3E0E A;  2MQH A;  5CV5 A;  4DUY Q;  4JBJ A;  4A4I A;  2EDG A;  2KCM A;  2B63 H;  3DMU A;  1LV9 A;  1WTX A;  1FNV A;  3UI2 A;  1LTI D;  3EA6 A;  1UE5 A;  3TME A;  1BR9 A;  3SK4 A;  3CW2 C;  2QDB A;  3BYT B;  2NZ1 D;  1CKM A;  3M7N A;  3M4P A;  5CC4 A;  1A63 A;  2MP1 A;  5IP9 H;  5FLM G;  1HR0 L;  2RA4 A;  1D1K A;  4YCU A;  1SAP A;  1FNW A;  1ZKO A;  2ATW A;  2OT2 A;  2WFW A;  5CYU A;  3OW7 A;  2Q8I B;  1N32 Q;  3GV3 A;  3GD7 A;  4JBW A;  1Z47 A;  3N6R A;  3I4M H;  3KF6 B;  2VB3 X;  2R93 H;  4Q5V A;  4H44 C;  3BVZ A;  3QOL A;  1K8A C;  3J81 j;  3K57 A;  1JB3 A;  5IP7 H;  1WTP A;  4LAA A;  1U5K A;  3KDF B;  1EWC A;  1KNA A;  2RKS A;  4MZ9 A;  4ZKC B;  4AQY Q;  4B3R L;  1SYD A;  1D6E C;  3S16 H;  1SXT A;  3ND9 A;  1KAA A;  3QJY A;  5M5W B;  1EY9 A;  1FVI A;  1CZG A;  1H9S B;  5D3D A;  4DV1 L;  1QNK A;  4JI2 L;  2J7Z A;  3D6C A;  3S1N H;  3NUC A;  4P72 A;  4JVZ A;  3CQZ B;  1ENF A;  4DV6 Q;  2YV5 A;  1LT6 D;  4NXN Q;  2K05 A;  1KL9 A;  1SMX A;  1AZQ A;  3FKI H;  3G6J B;  4BBR B;  3ITP A;  3Q8D A;  1TWF H;  5IGF A;  4JPB W;  1I50 B;  1XTC D;  3L0O A;  2MO1 A;  1SFO H;  1MGS A;  1TU2 B;  4M1U B;  5EGT A;  4CKB A;  3P7J A;  4YHH Q;  1XMO Q;  4OWX B;  5I4D A;  2K03 A;  3J7Y W;  3RZD B;  1QZH A;  3AB9 A;  5IT9 c;  2LMC B;  2ZJR A;  3KLR A;  3A55 A;  2KQ3 A;  2MHV A;  3H09 A;  1BKB A;  2NWG A;  4YCW A;  1TS3 A;  1IBK L;  2CWA A;  1XX8 A;  1C0A A;  3NEL A;  2F0M A;  2LS0 1;  3NEM A;  5ELO A;  5DLQ E;  3A54 A;  1HXY D;  4NDX A;  2B63 B;  1O7Y A;  2EJG C;  1PH9 A;  3C2P A;  1A6X A;  1XPO A;  1SN8 A;  5AFW A;  4KJN A;  1CT1 D;  1DOM A;  3FPP A;  3X3N A;  4KY5 A;  4A3D H;  4OO1 G;  4ZK9 B;  4WJ4 A;  3H3V I;  3HOU G;  3CCM A;  1STH A;  1VQA A;  1J8I A;  3I4M B;  3STB C;  2DNC A;  3AU7 A;  4ZUJ A;  1SLJ A;  5D3I B;  1XTD A;  1EFW A;  5KNC A;  3ULL A;  4U68 A;  3W2D A;  2FMC A;  1WTO A;  1HFG A;  3IAY A;  4KHP L;  1AE2 A;  3OYY A;  2WII B;  4A3M B;  4BY1 G;  1SSO A;  4WFN 3;  1SR3 A;  1EEI D;  1CA5 A;  1PZK D;  1BXT A;  3KJO A;  4A3E H;  3S16 B;  1HUN A;  2RDF A;  1B4O A;  4ME5 A;  3D4W A;  3DEO A;  2Y0S G;  3S1N B;  3PUZ A;  3JAM c;  2R7Z G;  2IX3 A;  4Y52 H;  3D0F A;  1VQC A;  2F4V Q;  3KBX A;  3IKJ A;  2AQ2 B;  2OTL A;  2MPM A;  5C44 H;  2EYM A;  4JYA Q;  2L11 A;  2R92 G;  3FKI B;  3I56 A;  3W3A A;  4KHZ A;  1LT3 D;  5DEH A;  1CI3 M;  3HKS A;  1G8Z D;  2ID0 A;  1SFO B;  3UDG A;  1IYV A;  1EOV A;  2FXQ A;  1PRT F;  5IYB H;  3NTI A;  2PMZ E;  1SBB B;  3QG1 A;  2B2T A;  3WWV A;  1AZP A;  1YHQ A;  1YI2 A;  3HP3 A;  3SXH A;  4JI4 L;  4OX9 L;  3MFG A;  4BY7 H;  1Q8K A;  1KLU D;  2EYH A;  1IBM Q;  1W6J A;  3K5O A;  3AFQ A;  1S40 A;  2PI2 A;  1JJG A;  1Y1W G;  3P1H A;  2L1B A;  1X54 A;  3A7A B;  4BBS G;  1I4P A;  4GKJ Q;  1B2T A;  2ICE C;  2WIN B;  3MEF A;  4X64 L;  1TXY A;  5C0X H;  2IHF A;  4CDD C;  4JOI C;  2MUY A;  4PG3 A;  5JVG 3;  2DN8 A;  4PNY A;  2O2L D;  1BF4 A;  1BCP C;  3DXJ C;  3S14 H;  3OWF A;  3VR3 A;  1SJE D;  4KJO A;  4KTA A;  2H4O A;  2ALY B;  5BN3 A;  5C4Z A;  5EKI A;  4A3D B;  3F2B A;  2JK8 A;  2KBN A;  4O1N A;  2XN9 C;  3G7L A;  5IGD A;  1D7Q A;  3NE5 B;  2EE1 A;  1YJN A;  5JEA G;  2KA7 A;  4LF8 Q;  3PO2 G;  4A3L H;  1CZW A;  1QZG A;  5FO9 B;  1X3F A;  3DWP A;  2F0Q A;  1FD7 D;  3DHQ A;  1Y1V H;  4IPH A;  4DN4 M;  1M4V A;  2BDN A;  4RHS A;  2QGQ A;  3KYH C;  1BBX C;  1PYW D;  2NBF A;  3G48 A;  4TSS A;  4A3E B;  2UXC Q;  3FRP B;  4MTK A;  2YTY A;  4DR2 Q;  1B9N A;  1UUP A;  4EQO A;  3MHB A;  5CV8 A;  5C4X H;  2B2W A;  5FLX L;  1QVC A;  1N33 Q;  1F2M A;  1TY0 A;  1UE7 A;  2L15 A;  3S1Q H;  2D0O A;  2UUB L;  3R2T A;  1IKM A;  1EUJ A;  3QWN A;  1VDZ A;  2K4K A;  2VQF Q;  4L6T B;  4LF4 L;  4Y7N B;  4DV3 Q;  2F52 A;  4KV6 A;  1LO5 D;  1EYA A;  4F87 A;  1GD7 A;  1STB A;  1U4M A;  4PZ6 A;  2FJ2 A;  1OXV A;  4RWS C;  3HZX A;  5EPL A;  4L5S A;  1R4Q B;  3EJI A;  1XPR A;  1AE3 A;  3EVQ A;  1ZYR D;  4BY7 B;  3AFP A;  4IPD A;  5I6Y A;  1VQI A;  3H0G G;  5JEA J;  1DD2 A;  2LXK A;  3M4Y A;  3CME A;  1TT2 A;  1PH7 A;  3TS2 A;  3HKZ E;  1EQT A;  1N9W A;  1D5Z C;  2Z0S A;  1JR0 D;  1EYD A;  3CCV A;  2BH2 A;  4LFB L;  4RCO A;  5LHY 1;  1ASY A;  2VZA A;  1K83 H;  4FNF A;  3GTO B;  2RDG A;  4EQN A;  4LF5 Q;  5IYD H;  1EZ8 A;  4IFD H;  3PO3 B;  4IJL A;  3D6W A;  3S14 B;  4NPS A;  1PTO C;  5ELD A;  3RD4 A;  2R61 A;  4C3I H;  2UXD Q;  1LT4 D;  3MXU A;  3K5L A;  1DOL A;  2BH8 A;  1A2U A;  2OTJ A;  4K0K Q;  1S5C D;  1KD1 C;  4DK0 A;  3T1Y Q;  2NVX H;  4JV5 Q;  1MBY A;  1EYG A;  3KK7 A;  1L2F A;  1VQE A;  1S3O A;  1AFP A;  1KAW A;  1F77 A;  3MAQ A;  4BWG B;  4JI7 Q;  3TQY A;  5J3B A;  1Y1V B;  3HOZ G;  3PIP 3;  2X69 A;  3HKZ B;  2J0T D;  4XYQ A;  5EQ0 A;  5FKA C;  3G4S A;  4DV7 Q;  5DAU A;  2ZXO A;  2HUG A;  1TR5 A;  1EY7 A;  4A3I H;  4J6H A;  4KN4 C;  1J6Q A;  2F0O A;  2L0C A;  1BCP B;  1UNS A;  2Z8L A;  5C4X B;  1PTO H;  3J7Z C;  5KRU A;  2EJF C;  4MNO A;  1VQ6 A;  1C48 A;  3HOW G;  1EY0 A;  2L12 A;  2IWH A;  3CRL C;  1O78 A;  3M85 A;  5LMU Q;  3HFZ B;  3NXW A;  1DM0 B;  2F0D A;  4I65 A;  4C3H H;  3M3Y B;  3AYH B;  1GHJ A;  4K5X A;  1V8Q A;  2NVQ H;  4DK6 C;  5C3E G;  1Q1B A;  4DAM A;  1PHJ A;  1HA5 A;  3T53 B;  3MXP A;  1MKH A;  3BVM A;  5E1F A;  2Z6K C;  5IE8 A;  4HJ9 A;  1H9R A;  1R9T H;  5FLX c;  2XWJ B;  1X56 A;  1R4P B;  2BA1 A;  3S1R H;  1CSQ A;  3R2I A;  3TRZ A;  4TQU S;  1XNR Q;  1EIF A;  4ODG A;  3NTK A;  5C0X I;  1NR4 A;  5J1Z A;  1S5D D;  4JI6 L;  1WCM B;  1HA6 A;  3MC0 B;  3RZO B;  1LTB D;  3K0X A;  1K83 B;  1CSP A;  1Q1E A;  2PNR C;  2RHS B;  1LTG D;  2CH4 A;  3MFY A;  1TQO A;  2JA5 B;  3VYR A;  3CC4 A;  2JA7 H;  4C3I B;  5M5Y H;  1GUT A;  1MSG A;  1JJ2 A;  5EBD A;  5EKK A;  1JOQ A;  3STB D;  1K73 C;  5KIX A;  1T5E A;  1I4Q A;  2UXB Q;  1CK1 A;  2EY2 A;  3K58 A;  2QEX A;  3S17 B;  4RHR A;  3U9O A;  1V1P A;  1SJH D;  3SK8 A;  1U4L A;  4P75 A;  2LXJ A;  3V96 A;  3SE0 A;  3LGJ A;  3ERS X;  4R4O A;  2F1M A;  1X3Q A;  3C1F A;  1HNW Q;  1I6H H;  2IJ0 A;  5C6A A;  2IL8 A;  2NVY H;  2V1C C;  1UE6 A;  3NQI A;  4P73 A;  3I8Z A;  4L8J A;  4DR5 L;  1PH5 A;  1EL0 A;  3WOE A;  3VYU A;  4A3I B;  1PYB A;  4HMI A;  3GTL H;  4LFC L;  1QWY A;  3VR4 A;  1PH8 A;  4PZ8 A;  3A8J E;  4FO2 A;  1PTO B;  1KQS A;  4X3U A;  2XIW A;  4ABN A;  1J9O A;  3AQQ A;  5IGC A;  1VQB A;  4XQQ A;  2EJM A;  4CGY B;  4XQN A;  2BA0 A;  3NSW A;  1D1I A;  4A93 H;  2VXW A;  2V4D A;  1OO9 B;  1CQF A;  3RLF A;  2WAQ G;  5BN5 A;  2DUD A;  2R7D A;  1EY6 A;  4C3H B;  2E2H H;  3T51 B;  4JI0 Q;  4YY3 Q;  3A8K E;  2NVQ B;  1RIP A;  4AYB B;  1PH4 A;  2CWP A;  3RMH A;  1R9T B;  4A3K H;  4C3J H;  3K81 C;  5JAV A;  1L1O A;  3S1R B;  4DV2 Q;  1IYU A;  2FHT A;  4H02 A;  2AMC B;  2ASB A;  4LMQ D;  2IX1 A;  4B3M Q;  2DJG C;  2Z1C A;  3BDO A;  1T5X D;  4F88 A;  1BCP D;  2XTI A;  1BBW A;  2HCC A;  4L5T A;  1Y8P B;  1QVF A;  2A6H C;  3TZU A;  5G3L D;  3CCL A;  2L4N A;  2O5I C;  4RGO S;  2JA7 B;  2IX0 A;  4OIJ A;  1G2T A;  5M5Y B;  4DV4 Q;  2B63 G;  4QGU A;  2AQ1 B;  1RTO A;  4RAU C;  4WOR A;  4E6I A;  3HRZ C;  4YWK A;  3S9W A;  3FHW A;  3OWE B;  5DM6 3;  2IT1 A;  2GA4 B;  4F7X A;  1I6V C;  1QG7 A;  1X32 A;  4DU9 A;  5IP9 G;  2K5V A;  1SE8 A;  1C4Q A;  2PO4 A;  5J39 A;  4I7Z C;  4IUR A;  3KOJ A;  5I6W A;  4A3F B;  2A69 C;  4XT3 B;  4X62 Q;  3J81 c;  3KJP A;  3I4M G;  1I6H B;  3PF5 A;  2Z4H A;  3I4N G;  1NAP A;  3MVV A;  1XMQ Q;  2NVY B;  4IPG A;  1W6K A;  4EX5 A;  2HIX A;  2F3W A;  2KCT A;  1TWC H;  1TII D;  3KF8 B;  3GTL B;  5LMN L;  1CKN A;  4A3M G;  5IWA L;  3VYS A;  2KED A;  2F0K A;  2CHB D;  3CPF A;  2UUC L;  2CQO A;  4A93 B;  1HR0 Q;  1F2Y A;  3PUW A;  1FGB D;  2JA8 H;  2QW7 A;  2E2H B;  4C2M H;  2A6E C;  1LAC A;  4L5R C;  3QO2 A;  3BZC A;  4MIU A;  4I7A A;  4JI1 Q;  1X55 A;  1T9H A;  1QJO A;  4A3K B;  3S24 A;  1CKO A;  2GN5 A;  2JSO A;  1JOK A;  5IT9 E;  1BUV T;  3T16 A;  2NB0 A;  4B3R Q;  4JI3 L;  1DOK A;  3CCQ A;  2Q2I A;  3OHX C;  4EGV A;  5M5X B;  2F0T A;  3UDX A;  1IL2 A;  4JI2 Q;  2E75 C;  4X66 L;  1PTO D;  3F1Z A;  5C4H A;  2DGY A;  2WV6 D;  4OWT B;  4DR4 L;  2X6G A;  1K9M C;  3Q0A A;  1SNM A;  3WOF A;  3CCJ A;  1TS4 A;  3W5O A;  3J80 c;  4IO9 A;  4RFB A;  1KNE A;  4RKB A;  2EXD A;  2Q8T A;  4B9W A;  4OL7 A;  2K5H A;  1QUQ A;  1PFN A;  1G2S A;  3E0J A;  3JAM L;  5A2Q E;  1MJE A;  3P20 A;  1Y8N B;  5ELE A;  4A3D G;  3M4Q A;  4NKL A;  4Q0F A;  1XNQ L;  1KRT A;  4LF7 L;  2WP8 J;  3URY A;  2EYL A;  4F8M A;  3PMF A;  1I4R A;  1P16 A;  1IW7 C;  4RA8 A;  1JCK B;  1TWC B;  5LL6 X;  4KKS A;  2KCN A;  1RF2 D;  1TS2 A;  2DY8 A;  3A56 A;  2QKI C;  1KXL A;  5EJW A;  1JIC A;  2B8F A;  1DCZ A;  1SNQ A;  1PXU A;  1YHB A;  5JOB A;  5IYC G;  1LT5 D;  3CPW A;  4YCV A;  1VQN A;  4FXK C;  2RF4 A;  2EIF A;  1ROD A;  2KCC A;  3JAM E;  1ILQ A;  5FJ8 G;  3MWY W;  1K0R A;  2K75 A;  5C4J B;  3OTO L;  1I4X A;  3DWA A;  1QNU A;  1GHK A;  1RD9 D;  2WKC A;  1WYD A;  2JA8 B;  4PMW A;  2RSN A;  2QEJ C;  2F0J A;  2N55 A;  2PNH A;  1BQQ T;  4J8Q A;  2EY6 A;  1IXR A;  3PSI A;  3SDZ A;  1ICW A;  5ELN A;  4KHP Q;  4IOC A;  3A8I E;  4UPA A;  5IYB G;  4U67 3;  4RKL A;  2F0U A;  3RUZ A;  1HZA A;  2K33 A;  3BJU A;  2CKZ B;  2D62 A;  1Q8I A;  1IL8 A;  4DNI A;  1Y69 U;  3K6O A;  2G9D A;  5K5P A;  1XXG A;  1PDQ A;  2EY5 A;  3T1H L;  4B9X A;  2K32 A;  5KGU A;  2B2T C;  2OQK A;  2N78 A;  2AUJ D;  4QQB X;  5C0X G;  1F2L A;  2Z6B A;  4K5W A;  2UUA L;  5EPK A;  2AWN A;  5M3F H;  3PO3 G;  5JVH 3;  2R93 B;  5FLM H;  1E2Z A;  1WFQ A;  1IBL L;  1Z9F A;  2VUM H;  3CRK C;  3MEH A;  2E2I H;  1D5X C;  3NBI A;  1PFM A;  1G91 A;  1LM0 A;  1JE4 A;  1GVP A;  2CCZ A;  4OX9 Q;  4JI4 Q;  4LF6 L;  1YJ9 A;  1TWG H;  1CHP D;  2B39 A;  3D4R A;  2KOL A;  2M00 A;  3TP7 A;  1IHZ A;  3KBG A;  3A7L A;  4A3L G;  2NTT A;  5TSS A;  3T4A C;  4GNX A;  4X6A H;  2KVM A;  1XMO L;  2D2C C;  2N3S A;  4DXG A;  4X64 Q;  2ES2 A;  1BO0 A;  1LLR D;  3HKZ G;  2NN6 G;  1E2W A;  1UE1 A;  3PIO 3;  1PA6 A;  3VDY A;  1AN8 A;  3Q22 A;  3PIP A;  2TMP A;  1A62 A;  3EQL C;  2QIL A;  1TWF B;  2VB2 X;  1STG A;  4YIJ A;  1VQ8 A;  2F0G A;  3MXN A;  1H9K A;  4X3K A;  4KLK A;  5EKL A;  1LTA D;  1G29 1;  5COY A;  5C5L A;  1N34 L;  1EQR A;  2XRQ D;  3J7A V;  1A15 A;  4ZCK A;  4YWM A;  1K3B C;  1U9R A;  2B2W C;  4ZUI A;  5CMD A;  4FF4 A;  4IJH A;  1C9O A;  1PMR A;  4QMG A;  2UU9 L;  2F03 A;  2QCP X;  1HNX L;  1O7Z A;  4WJ3 M;  4XTC S;  1PZI D;  2A6H D;  1NUC A;  4K5V A;  5I9O A;  2A19 A;  2EOT A;  1Q90 A;  4R4T A;  4GLV B;  4BXX G;  1PH3 A;  2H5X A;  4HN7 A;  1WCM G;  2UUB Q;  3PUX A;  2PI2 E;  3GTQ H;  1II3 A;  2JN4 A;  4LF4 Q;  1N36 Q;  5M3F B;  4NW2 A;  3QR8 A;  2NZH A;  4B3S L;  4KN7 C;  5HY6 A;  2JA5 G;  5AJ3 L;  2A69 D;  2KEE A;  3BDC A;  2VUM B;  2I5M X;  4OO1 H;  5CGK A;  3S15 H;  2F4V L;  2E2I B;  5DM7 3;  1DXM A;  3I90 A;  2BDO A;  1TWG B;  1ET6 A;  2EZV A;  5D65 A;  2O5J C;  1ILP A;  2NUC A;  3OSO A;  1JWS D;  5T1I A;  4R1J A;  4LFB Q;  3BU2 A;  1EU4 A;  1Q3L A;  1HTP A;  4DPG A;  4GOP A;  1KDB A;  2KEN A;  5JJZ A;  4JC0 A;  2JE6 I;  2HDM A;  3D4D A;  3ZJY C;  2CVR A;  3GDE A;  4FYD A;  1A3T A;  4A3I G;  5C44 B;  3GO5 A;  3AMU A;  1EU3 A;  2IPK D;  3GTJ H;  2R7Z H;  3CCU A;  3R93 A;  3NEN A;  2LY7 A;  3UE0 A;  4H7B A;  2A6E D;  4QIW E;  2X6L A;  1NJI C;  1STN A;  4A3J H;  1EY4 A;  3KUP A;  1J5E L;  5M9O A;  3PF4 A;  2R92 H;  5E7N A;  4FF2 A;  3TN2 A;  1S5E D;  2OF1 A;  4B08 A;  3Q24 A;  3OW2 A;  1O80 A;  2BE5 C;  2EY1 A;  1PRT C;  2F4I A;  1IZ6 A;  1NE3 A;  4C3H G;  1MIU A;  1SYB A;  5GAG C;  3TS0 A;  4HJA A;  1PZJ D;  4DAY A;  1ASZ A;  2DJF C;  1NCV A;  5FLX E;  2Q2T A;  1O7I A;  3MZ5 A;  4LJZ C;  4A3C G;  5D14 A;  3HOV G;  4IQZ A;  2F3V A;  1Y1W H;  4TVA B;  2A73 B;  5T1G A;  3W1B A;  2BCO A;  3OOC A;  4BBS H;  3CD6 A;  4HIM A;  1RHP A;  5E4X A;  2K14 A;  2HHH Q;  1VQM A;  3W1G A;  5KYI A;  1XPU A;  4DK1 A;  3S1M H;  1VF7 A;  3R8B A;  2K01 A;  3GTQ B;  4QIW B;  1F9P A;  1WJJ A;  3I91 A;  2WKD A;  2K5W A;  4GOP B;  1B70 B;  2R3Z A;  1CUK A;  4N9P A;  2JA7 G;  4R8I A;  4DXF A;  1YJW A;  2K28 A;  3S15 B;  2M2L A;  4DK3 C;  3CKI B;  4CHT B;  1JB7 A;  3FDT A;  3IRB A;  2QDL A;  3L9A X;  4JI5 L;  1IW7 D;  2JP1 A;  5JEA H;  4KKU A;  3M9B A;  4HMJ A;  1B44 D;  2AWO A;  1HNZ L;  3V2T A;  3GTK H;  1HTL D;  2K5N A;  4UP8 A;  4DUZ L;  5IIF A;  4K2L A;  3U4V A;  1BBU A;  5HUR A;  4A3F G;  4JI6 Q;  3HOX G;  4A3B H;  1SEB D;  2NTS A;  4K6D A;  3HEJ A;  1OXX K;  1JMC A;  4UP9 A;  1WVL A;  5LMN W;  2VW9 A;  3S1Q B;  3BZD B;  4LWC A;  3GTJ B;  1EYC A;  1TWH H;  1UWV A;  1A8V A;  4ZLT F;  2GVA A;  3I4O A;  1DJR D;  2B2U A;  4ALP A;  2I5L X;  4LFA L;  2ZXR A;  2E74 C;  4A3J B;  1H9M A;  1DZ1 A;  5IGG A;  4HTH A;  3TBI B;  2ZTC A;  1RJT A;  1Y8O B;  1ONL A;  3E3X A;  1EQQ A;  2KHS A;  1A0I A;  1KDC A;  4N8X 1;  4HED A;  4QF4 A;  1DON A;  5JJK A;  5EAY A;  4DKA C;  4DR5 Q;  2ZM6 L;  1B1Z A;  5M3M G;  4PV1 C;  3H0G H;  4CJ1 B;  4LFC Q;  1W3S A;  3ERQ A;  5NUC A;  3GTM H;  3K5M A;  1BNZ A;  2L55 A;  1HZ9 A;  1SYF A;  2JA6 G;  4DR3 L;  3J81 L;  4JI7 L;  3SVM A;  4BA1 I;  4XXE A;  1YEZ A;  1MJC A;  3K0Y A;  3S1M B;  4DR6 L;  2MNA A;  2AHO B;  1HQR D;  1UEA B;  1L1O C;  3K7A H;  4OO1 I;  1WTR A;  3I3C A;  4NXM L;  2NVX B;  2B8G A;  4DV5 L;  1X6O A;  1PRT B;  5BR8 L;  1Q81 C;  5C3X A;  4JG2 A;  4AYB E;  3CHB D;  4S3S A;  3TP6 A;  3GTK B;  1SNC A;  1Q12 A;  1WTW A;  2EYJ A;  3J81 E;  1FJG L;  2JA9 A;  4A3B B;  2C9O A;  3L7Z C;  5KYL A;  1CA6 A;  2E5L L;  4QB4 A;  3HOZ H;  1EIH A;  1ENA A;  4IPC A;  1AH9 A;  1KC8 C;  4GS3 A;  4GN5 A;  1GUO A;  5A35 A;  1ICF B;  2YYZ A;  1TWH B;  2HQE A;  3SK5 A;  5ISR A;  4B3T L;  3TSS A;  3EN2 A;  3HOW H;  4A75 A;  1VQJ A;  2B2Y A;  1PH6 A;  5GAE C;  3MTS A;  3PUY A;  2B2V A;  4J1M A;  4BBR G;  2B29 A;  1JWM D;  3TEH B;  4KD3 A;  1VQP A;  2NZO A;  2JA8 G;  1QE6 A;  1O7L A;  1S5F D;  5I9P A;  2ICI A;  1SMY C;  4DV0 L;  2PZW A;  2DNE A;  2SNM A;  4EQ5 A;  3J80 L;  4IUT A;  1MSH A;  3VR6 A;  1VQ9 A;  2ENB A;  3U9S A;  4AH6 A;  2YTX A;  3H0G B;  3K80 C;  1MD2 D;  4IFD I;  1HJP A;  2ZTE A;  1V1P B;  1HRJ A;  3IFD A;  1JJC B;  5IWA Q;  2MJ8 A;  4PQX A;  3UE1 A;  4RH6 A;  4ZQ3 A;  4IAL A;  2UUC Q;  1HNW L;  3RN2 A;  2MGS A;  4OXP A;  1RDP D;  1STY A;  1ET9 A;  2F0S A;  4P2C B;  2WB1 E;  4IUV A;  3K7A B;  1U4R A;  3CC7 A;  1VCI A;  4G7H C;  3J80 E;  2K04 A;  1SNO A;  1V43 A;  1I94 Q;  4ILW A;  4JI8 L;  4R4C A;  1KAB A;  2F3I A;  1E7Z A;  1RL2 A;  2R93 G;  3T56 B;  4KY6 A;  3RN5 A;  1JWU D;  4JI3 Q;  3NBH A;  2HIV A;  5BN4 A;  1LTS D;  3HOY H;  3HG9 A;  2D5D A;  2F0F A;  1ESF A;  5IP7 G;  1YNJ C;  3HOZ B;  2OWO A;  2RHQ B;  4X66 Q;  1LTL A;  4HID A;  1JOO A;  5GRO A;  3CU7 A;  1E22 A;  4R4Q A;  4DR4 Q;  3TZD A;  1K8O A;  2GVB A;  4HJ7 A;  5IGE A;  2VY3 A;  2CFM A;  1L1O B;  4X65 L;  2WB1 B;  3I55 A;  2VQE L;  4G7Z C;  5COR A;  5M5W H;  4WJW A;  4R8N A;  4B3M L;  3KF6 A;  2BE5 D;  2EYP A;  1PRT D;  3KLW A;  5I2X A;  2KJX A;  3FKI G;  1B8A A;  3SR1 A;  4DR7 L;  1XNQ Q;  1WI5 A;  1EWH A;  3CQZ H;  2ZTD A;  3CF5 A;  4CDE C;  4LF7 Q;  1EEF D;  4FF3 A;  2JQO A;  1K0S A;  4C3J B;  3E6Z X;  3FPU B;  5KNB A;  2YU9 H;  3KDF A;  2HDL A;  4GKK L;  1SYC A;  3NHH A;  4M8A A;  1G6P A;  4LF9 L;  3G6E A;  1I3Q H;  4GN4 B;  1H9S A;  3JC6 6;  1SND A;  2K1B A;  4DV1 Q;  2NVT H;  2D0P A;  1B3Q A;  1JQY D;  3E9H A;  3RZD H;  2Z9H A;  2EXZ A;  4V0B A;  3H91 A;  5EBC A;  4C1N K;  2D9U A;  4K8I A;  3ONA B;  5CBA E;  1D5M C;  4QY7 A;  2PW7 A;  2A5H A;  3OTO Q;  3TP8 A;  2OXP A;  4N8F A;  1PYS B;  3DM3 A;  2SOB A;  4PMC A;  5FO7 B;  4KI0 A;  1ESR A;  1CKN B;  4LUV A;  2WAQ E;  2F0L A;  5M3F G;  2EYO A;  5CV4 A;  1Q82 C;  1K8M A;  1FYC A;  2VUM G;  4RCN A;  4DR1 L;  2L9H A;  4IUQ A;  5K36 H;  3K7U C;  1I4H A;  1IBK Q;  4FXD A;  1E2V A;  3HOY B;  3E5S A;  1KHI A;  3I4N H;  2RDH A;  4K6L A;  2Q2H A;  1SE3 A;  2LSS A;  3F2D A;  3OIQ A;  4JI1 L;  1Q46 A;  2I5H A;  3T1H Q;  4A3E G;  2QF7 A;  4ME3 A;  1CM9 A;  2PQE A;  1L0W A;  4O2D A;  5ELC A;  4A3M H;  3I2Z A;  1EOT A;  2BOS A;  2UUA Q;  4CJ2 C;  1NY4 A;  3DM1 A;  1VQ5 A;  3ER0 A;  4PMB A;  4GN3 B;  4C2M B;  1YZ6 A;  5C44 G;  1WOC A;  1IBL Q;  4DUY L;  4GNX C;  4PZ7 A;  4R9W A;  4KK7 A;  1U4P A;  4CJ0 B;  4XQJ A;  2WAQ B;  1S5B D;  4A3G H;  2DY7 A;  1SE2 A;  2TSS A;  4LF6 Q;  5JJI A;  3DWQ A;  1OXU A;  1GOZ A;  3X3M A;  4POF A;  2YU9 B;  4LNQ A;  4CKE A;  1X3G A;  2MO0 A;  3VR5 A;  1N32 L;  1JC7 A;  4JBK A;  1I3Q B;  4DNT B;  4JK1 C;  1SDF A;  4BY7 G;  2NVT B;  2SNS A;  3LX0 A;  1QUQ B;  2VS1 A;  4KMU C;  1GXD C;  1A3U A;  1AW7 A;  2FMM A;  2M9V A;  4FVM A;  1Q86 C;  3MXG A;  1NSN S;  4CDF C;  2RCN A;  1E24 A;  3R3O A;  5IGB A;  2KHJ A;  4G57 A;  3G71 A;  4AQY L;  2KUM A;  1GJX A;  3BYY B;  1FR3 A;  4ZKB B;  1WD0 A;  4J15 A;  1DYQ A;  2ZXP A;  1BCP F;  3OMC A;  5E3F A;  1N34 Q;  1JE5 A;  4XT1 B;  4DV6 L;  5G3L F;  4NXN L;  2K5Q A;  3CXC A;  3I4L A;  4GZY C;  2UU9 Q;  3N52 A;  3JAM i;  2K5D A;  4QUF A;  1HNX Q;  2Q2U A;  4YHH L;  3A74 A;  3I4N B;  1KLG D;  4A76 A;  3ULJ A;  2F0V A;  1Y1V G;  1EIG A;  3D31 A;  2JYO A;  4UDU C;  2H1E A;  1E1T A;  3LNN A;  4ULL A;  2Q8R E;  3CAM A;  4IOA A;  1Y14 B;  1VQ4 A;  2I46 A;  2K50 A;  1HPC A;  5IYC H;  2A68 C;  5C4X G;  3F2U A;  1B53 A;  3CMA A;  1E0B A;  1HZC A;  4OGQ C;  2N88 A;  4MHE A;  4B3S Q;  2RBM A;  3CCS A;  1JT8 A;  5FJ8 H;  2PCF B;  4L5Q A;  5AJ3 Q;  5C0X J;  1TY2 A;  2ZT9 C;  5ELF A;  1IKL A;  1SMY D;  3FEW X;  1RTN A;  2AUK A;  4A3G B;  3K8A A;  4GOP C;  1DGS A;  4IZ8 A;  4A3J G;  4KD4 A;  3D8G A;  4RGM A;  5ELB A;  2FFK B;  2EQS A;  2K7V A;  5CV6 A;  3ZYY X;  1V9P A;  1VQG A;  4MN3 A;  5IOD A;  4Y7N H;  1K8G A;  1STE A;  1PLF A;  4C56 C;  1QB5 D;  4EVO A;  1E3P A;  4GLX A;  1AEX A;  4DAV A;  1P8L A;  2XWB B;  1GO3 E;  1HHV A;  3J7A F;  2F0E A;  4LUZ A;  1X65 A;  2IY5 B;  2CH4 W;  3M4O H;  3ERO A;  1OXT A;  1WTV A;  1WD1 A;  4ZYS A;  3CCR A;  2F0W A;  2OEO A;  1VMP A;  5IYD G;  3D3R A;  4ZRZ A;  4GNX B;  4IFD G;  1J5E Q;  4IUN A;  5CV7 A;  1H95 A;  2QA4 A;  1Z6H A;  1VMC A;  3EIV A;  4P71 A;  1CHQ D;  3H15 A;  3GTO H;  3VYT A;  4C3I G;  2YTV A;  3L3O C;  1PTO F;  1X3E A;  4KY7 A;  3CCE A;  3HOU H;  3PO3 H;  2PW5 A;  4LW1 A;  1GUW A;  1CTM A;  1W2B A;  2HD3 A;  3DUZ A;  4JYA L;  5GQO A;  1F2Z A;  5GAD C;  1FL0 A;  1YNJ D;  1BDO A;  3PV0 A;  1V1O A;  1XYI A;  3MXN B;  3K59 A;  3J7A 5;  5E4W C;  1CFM A;  2HQL A;  2PQA A;  2PMZ B;  4BY1 H;  1VQF A;  2RSO A;  5CBE E;  1C8C A;  2CW0 C;  5DNF A;  4A3B G;  5GAH C;  4BS9 A;  1AP0 A;  4OWW B;  1IBM L;  5JPM C;  4FP5 D;  3ND8 A;  2NN6 H;  1EWI A;  3GQB A;  4DR2 L;  1B7Y B;  1Q7Y C;  5LL6 S;  3TDQ A;  1RCV D;  4XDX A;  3U4Z A;  4GKJ L;  1QCB D;  3U50 C;  4XIG S;  3A0J A;  3NK9 A;  1LTR D;  1HH2 P;  2HT1 A;  2FIN B;  2PZU A;  3OPO A;  4IFD J;  1F9S A;  2NYZ D;  4JI5 Q;  4X3T A;  2CQA A;  1PFS A;  4QCL A;  3I7F A;  1HNZ Q;  5I2Y A;  1QIL A;  2VNU D;  4DUZ Q;  1VS0 A;  1EIY B;  4AYB G;  1N36 L;  3WDN A;  3M3Y H;  4K14 A;  5JPN C;  1L0Y B;  1HQM C;  4JOI A;  1KTK A;  2WAC A;  3RNU A;  3NWS A;  3TP5 A;  2LKV A;  1YHA A;  4KKT A;  2B2U C;  4LF8 L;  2JJQ A;  2RQX A;  4NB3 A;  1H9J A;  1NBW A;  4DNR B;  2LFN A;  1VQO A;  1PVO A;  3M4O B;  3ICE A;  2C5C A;  3KFU A;  1X3P A;  4CKC A;  5H1S E;  4BXX H;  2Y0S E;  4P74 A;  2JXM B;  3FMC A;  3DLL A;  2SDF A;  4LFA Q;  2KEC A;  2AQ3 B;  2UXC L;  4OEM B;  1WCM H;  3Q23 A;  3RZO H;  3U58 A;  1I5F A;  1YNN C;  2PQA B;  3MA2 B;  4RGT A; 
#chains in the Genus database with same CATH homology
 3EN2 A;  2OTL A;  5C44 H;  3HOW H;  3W5O A;  4A75 A;  1VQJ A;  1PH6 A;  4JYA Q;  3J80 c;  5GAE C;  1M1K C;  2R92 G;  4IO9 A;  2EXD A;  3PUY A;  3I56 A;  2AKW B;  4BBR G;  4KHZ A;  1N33 L;  2B29 A;  3A5Z B;  2JA5 H;  3HKS A;  2K5H A;  3TEH B;  1QUQ A;  1VQP A;  2ID0 A;  2NZO A;  2JA8 G;  3PO2 H;  1MJE A;  3UDG A;  2VQF L;  1EOV A;  4DV0 L;  3ULP A;  4A3D G;  3M4Q A;  1XNQ L;  5HGQ A;  2ZM6 Q;  2FXQ A;  5IYB H;  4DV3 L;  1HZB A;  1KRT A;  4LF7 L;  4EQ5 A;  4HIO A;  2WP8 J;  2PMZ E;  3WWV A;  1VQ9 A;  3S17 H;  3S2H H;  3SGI A;  1YHQ A;  1YI2 A;  4OX9 L;  4JI4 L;  4BY7 H;  4AH6 A;  1Q8K A;  2YTX A;  3K80 C;  1P16 A;  4IFD I;  4HIK A;  4DR3 Q;  1HJP A;  2ZTE A;  1IBM Q;  4JBM A;  1JJC B;  3AFQ A;  1S40 A;  2PI2 A;  1JJG A;  1Y1W G;  5IWA Q;  1KXL A;  4OON A;  1X54 A;  4BBS G;  3UE1 A;  2R6G A;  4DAY B;  2E2J H;  4DR6 Q;  3PGZ A;  4GKJ Q;  1YHB A;  5IYC G;  2UUC Q;  3CPW A;  4YCV A;  3MEF A;  4X64 L;  1VQN A;  1HNW L;  1TXY A;  3RN2 A;  2IHF A;  4OXP A;  3GTP H;  4NXM Q;  2RF4 A;  2EIF A;  4JOI C;  4PG3 A;  3F2C A;  4DV5 Q;  1BVS A;  3RR5 A;  2WB1 E;  5FJ8 G;  5BR8 Q;  1K0R A;  2K75 A;  3S14 H;  4A93 G;  3CC7 A;  1VCI A;  3OTO L;  4LF5 L;  2JEA I;  3S2D H;  2WB1 G;  1WYD A;  2ALY B;  4O0A A;  4PMW A;  2A8V A;  2HHH L;  2R7F A;  3F2B A;  2JK8 A;  2KBN A;  2PNH A;  1V43 A;  1I94 Q;  4JI8 L;  4R4C A;  2UXD L;  1D7Q A;  1IXR A;  4R4I A;  1FJG Q;  3PSI A;  2F3I A;  4K0K L;  1E7Z A;  1RL2 A;  1YIJ A;  5JEA G;  1V1Q A;  1YJN A;  4LF8 Q;  2R93 G;  3AEV A;  3PO2 G;  4A3L H;  3RN5 A;  3T1Y L;  5ELN A;  4JV5 L;  2E5L Q;  4KHP Q;  3PUV A;  4IOC A;  4A3K G;  2HIV A;  1QZG A;  4JI3 Q;  4UPA A;  3HOY H;  5IYB G;  1X3F A;  5IP7 G;  2OWO A;  1Y1V H;  4UP7 A;  2RHQ B;  4IPH A;  4X66 Q;  1LTL A;  1HZA A;  4A3C H;  1E1O A;  3BJU A;  4HID A;  5GRO A;  3HOV H;  2CKZ B;  2D62 A;  1E22 A;  4R4Q A;  2QGQ A;  3KYH C;  4DR4 Q;  3G48 A;  4DNI A;  2UXC Q;  2GVB A;  4HJ7 A;  2VY3 A;  2CFM A;  4DV7 L;  1L1O B;  4B3T Q;  2YTY A;  1VQL A;  4DR2 Q;  5C4X H;  3T1H L;  4X65 L;  3I55 A;  1GKH A;  4QQB X;  2OQK A;  2N78 A;  2VQE L;  1QVC A;  5C0X G;  5M5W H;  1N33 Q;  4QL5 A;  4B3M L;  3KF6 A;  1UE7 A;  4JCV E;  2L15 A;  3KLW A;  2D0O A;  2UUB L;  3S1Q H;  2UUA L;  3GTG H;  1EUJ A;  2AWN A;  5M3F H;  3PO3 G;  3FKI G;  1UEB A;  1B8A A;  2C35 B;  2K4K A;  2VQF Q;  4DV0 Q;  4DR7 L;  2IHE A;  1XNQ Q;  3F8T A;  1WI5 A;  5FLM H;  1WFQ A;  4LF4 L;  2N8N A;  1Z9F A;  3CQZ H;  2F52 A;  4DV3 Q;  2ZTD A;  3CF5 A;  4HJ8 A;  1IBL L;  4LF7 Q;  2VUM H;  1GD7 A;  1G51 A;  2JQO A;  2OCE A;  3E9I A;  1KRS A;  5LMU L;  2E2I H;  2YU9 H;  3KDF A;  1LM0 A;  4PZ6 A;  1GVP A;  2CCZ A;  1OXV A;  4JI4 Q;  4LF6 L;  4OX9 Q;  1YJ9 A;  4GKK L;  1TWG H;  4L5S A;  1HR0 W;  4LF9 L;  1G6P A;  1XPR A;  1AE3 A;  3G6E A;  1I3Q H;  4GN4 B;  4HJ5 A;  3AFP A;  1GM5 A;  4A3L G;  3JC6 6;  4IPD A;  1VQI A;  4DV1 Q;  2D0P A;  3H0G G;  5JEA J;  2LXK A;  2NVT H;  4GNX A;  2NN6 I;  3CME A;  3E9H A;  3HOX H;  4A3F H;  1PH7 A;  3RZD H;  1VQ7 A;  3HOY G;  3TS2 A;  4X6A H;  3HKZ E;  3RLN A;  1XMO L;  1N9W A;  4POG A;  2Z0S A;  2N3S A;  4X64 Q;  2ES2 A;  3CCV A;  2BH2 A;  4RG1 A;  4LFB L;  3UDI A;  3HKZ G;  1XNR L;  2NN6 G;  1UE1 A;  1PA6 A;  1M90 C;  2ZJQ A;  1ASY A;  3VDY A;  2VZA A;  1S72 A;  1K83 H;  4QY7 A;  1VQD A;  3PIP A;  3OTO Q;  1PH2 A;  3CC2 A;  4LF5 Q;  1LUZ A;  2Z6K A;  5IYD H;  4GLA C;  1A62 A;  4IJL A;  4RMF A;  1PYS B;  3DM3 A;  1OXS C;  4NPS A;  3B6Y A;  2MFI A;  1VQ8 A;  4C3I H;  4KI0 A;  4QJF A;  4JI8 Q;  1CKN B;  4LUV A;  2UXD Q;  2BH8 A;  3UDF A;  2OTJ A;  2WAQ E;  5C3E H;  1PV4 A;  4KLK A;  4K0K Q;  1KD1 C;  5M3F G;  3T1Y Q;  2NVX H;  4JV5 Q;  1G29 1;  2JEB I;  1EYG A;  1N34 L;  1L2F A;  1Q82 C;  1NTG A;  1EQR A;  1VQE A;  3A5U A;  1S3O A;  2UXB L;  2VUM G;  4YWM A;  1K3R A;  5LMN Q;  4DR1 L;  4LUO A;  1KAW A;  2KHI A;  3K7U C;  2N49 A;  1IBK Q;  2A1A A;  4IJH A;  1TWA H;  4JI7 Q;  3TQY A;  1C9O A;  1KHI A;  5J3B A;  3I4N H;  3HOZ G;  2UU9 L;  5M3M H;  2Q2H A;  1N8R C;  2LSS A;  3F2D A;  1HNX L;  4WJ3 M;  4XTC S;  3G4S A;  4JI1 L;  1Q46 A;  2I5H A;  4DV7 Q;  3EBE A;  2A19 A;  4A3I H;  4R4T A;  3T1H Q;  4GLV B;  4A3E G;  2B3G A;  4X65 Q;  2JA6 H;  4BXX G;  4ME3 A;  1L0W A;  1J6Q A;  2VQE Q;  4O2D A;  5JJL A;  2VL6 A;  4A3M H;  1PH3 A;  1U0L A;  3J7Z C;  2H5X A;  3I2Z A;  1WCM G;  5M5X H;  2E8G A;  2UUB Q;  3PUX A;  4MNO A;  1YIT A;  2UUA Q;  1VQ6 A;  1NY4 A;  3J81 i;  1VQ5 A;  3ER0 A;  4GN3 B;  4UY8 C;  1SRU A;  1YZ6 A;  2PI2 E;  1C7Y A;  5C44 G;  3GTQ H;  3HOW G;  4DR7 Q;  4LF4 Q;  1NMF A;  1WOC A;  4DUY L;  1N36 Q;  1IBL Q;  4AIM A;  4PZ7 A;  4GNX C;  2NZH A;  4B3S L;  1LYL A;  4YWL A;  3M85 A;  5LMU Q;  3HFZ B;  5HY6 A;  2JA5 G;  4A3G H;  5AJ3 L;  2I0Q A;  4C3H H;  3AYH B;  4LF6 Q;  5JJI A;  2I5M X;  1OXU A;  3FP9 A;  3S15 H;  4GKK Q;  4POF A;  4APV A;  2F4V L;  2NVQ H;  4DK6 C;  4LNQ A;  4LF9 Q;  1X3G A;  4BA2 I;  3BZK A;  5C3E G;  1Q1B A;  4DAM A;  1PHJ A;  2MO0 A;  1D8L A;  2OQ0 A;  4JI0 L;  4YY3 L;  1MKH A;  2Z6K C;  5IE8 A;  1N32 L;  4HJ9 A;  4JBK A;  1FGU A;  1R9T H;  5FLX c;  1PH1 A;  3H3V H;  1VQH A;  4BY7 G;  1X56 A;  2BA1 A;  5K36 G;  4R1J A;  1QUQ B;  2VS1 A;  3S1R H;  1CSQ A;  3TRZ A;  4LFB Q;  3BU2 A;  4TQU S;  1XNR Q;  1EIF A;  1YBY A;  1OTC A;  4DPG A;  5IY0 A;  4GOP A;  5C0X I;  2KEN A;  4FDB A;  1Q86 C;  4JC0 A;  4DV2 L;  2JE6 I;  4JI6 L;  2RCN A;  1E24 A;  3ZJY C;  2KHJ A;  3G71 A;  1IYJ B;  3K0X A;  3GDE A;  1XJV A;  1CSP A;  1Q1E A;  4A3I G;  3GO5 A;  3CP0 A;  4AQY L;  2RHS B;  4MTN A;  3PIO A;  3GTJ H;  2R7Z H;  3CCU A;  3NEN A;  3UE0 A;  2JA7 H;  3CC4 A;  4QIW E;  1YNX A;  1NJI C;  4J15 A;  5M5Y H;  1JJ2 A;  4A3J H;  1X9N A;  1J5E L;  3PF4 A;  2R92 H;  5E7N A;  3STB D;  1N34 Q;  1JE5 A;  1K73 C;  1YVC A;  4BBR H;  5C4J H;  4DV6 L;  2UXB Q;  4NXN L;  3OW2 A;  4DV4 L;  4DR1 Q;  3CXC A;  1I50 H;  2QEX A;  2XGT A;  2ZJP A;  4A3G G;  1IZ6 A;  1NE3 A;  1QVG A;  4P75 A;  2LXJ A;  1MIU A;  3LGJ A;  2UU9 Q;  5GAG C;  3TS0 A;  3L2P A;  4HJA A;  3JAM i;  1ASZ A;  1HNX Q;  3ERS X;  4R4O A;  2Q2U A;  4YHH L;  3A74 A;  1HNW Q;  1I6H H;  4A76 A;  3ULJ A;  1I94 L;  1Y1V G;  2Q2T A;  1O7I A;  3D31 A;  2V1C C;  2NVY H;  3PCO B;  1UE6 A;  4X62 L;  4P73 A;  1E1T A;  3J80 i;  3HOV G;  4A3C G;  4DR5 L;  1PH5 A;  1Y1W H;  4TVA B;  3CAM A;  1SRO A;  3W1B A;  1PYB A;  1Y14 B;  2K52 A;  1XMQ L;  1VQK A;  3GTL H;  1VQ4 A;  4LFC L;  3RLO A;  4BBS H;  2K50 A;  3NBH B;  3CD6 A;  4HIM A;  1PH8 A;  3TRE A;  1KIX A;  4PZ8 A;  2K14 A;  5IYC H;  2HHH Q;  1KQS A;  1VQM A;  5C4X G;  3W1G A;  1NMG A;  3E0E A;  2MQH A;  3AQQ A;  3CMA A;  1XPU A;  1HZC A;  4DUY Q;  4JBJ A;  4A4I A;  3S1M H;  4B3S Q;  1VQB A;  2KCM A;  3CCS A;  2B63 H;  1JT8 A;  2BA0 A;  5FJ8 H;  1WJJ A;  4A93 H;  4L5Q A;  5AJ3 Q;  1UE5 A;  5C0X J;  3CW2 C;  1CKM A;  3RLF A;  4GOP B;  2WAQ G;  1B70 B;  3M7N A;  1CUK A;  2DUD A;  3K8A A;  1DGS A;  2R7D A;  3M4P A;  4GOP C;  2JA7 G;  5IP9 H;  5FLM G;  1YJW A;  1HR0 L;  1A63 A;  4YCU A;  2E2H H;  4JI0 Q;  2ATW A;  4YY3 Q;  4A3J G;  4DK3 C;  2WFW A;  1RIP A;  1N32 Q;  1JB7 A;  3IRB A;  2EQS A;  3GD7 A;  4JBW A;  4JI5 L;  1Z47 A;  3I4M H;  3KF6 B;  1V9P A;  1PH4 A;  2R93 H;  1VQG A;  2CWP A;  4Y7N H;  1K8G A;  3M9B A;  2AWO A;  1HNZ L;  1E3P A;  4A3K H;  4C3J H;  3K81 C;  2K5N A;  4UP8 A;  4DUZ L;  1L1O A;  3GTK H;  4GLX A;  4DV2 Q;  3U4V A;  1BBU A;  1K8A C;  1P8L A;  4A3F G;  3J81 j;  3HOX G;  4JI6 Q;  1GO3 E;  4H02 A;  5IP7 H;  4A3B H;  2AMC B;  2ASB A;  1U5K A;  3KDF B;  4LUZ A;  1X65 A;  2IY5 B;  1OXX K;  4MZ9 A;  2IX1 A;  4B3M Q;  1JMC A;  3M4O H;  4AQY Q;  4UP9 A;  4B3R L;  1OXT A;  2XTI A;  1BBW A;  3S16 H;  3CCR A;  5LMN W;  4L5T A;  2VW9 A;  1QVF A;  1FVI A;  4DV1 L;  3CCL A;  4JI2 L;  5IYD G;  4LWC A;  4GNX B;  4IFD G;  3S1N H;  4IOA A;  4P72 A;  1TWH H;  1UWV A;  1J5E Q;  1A8V A;  1H95 A;  2GVA A;  2IX0 A;  2QA4 A;  3I4O A;  3EIV A;  4P71 A;  4ALP A;  2I5L X;  3H15 A;  2YV5 A;  4DV6 Q;  4LFA L;  3GTO H;  2YTV A;  4NXN Q;  1KL9 A;  4DV4 Q;  2B63 G;  1X3E A;  1SMX A;  4QGU A;  3CCE A;  3HOU H;  3PO3 H;  3FKI H;  4LW1 A;  3Q8D A;  1TWF H;  1W2B A;  4JYA L;  5GQO A;  4YWK A;  3FHW A;  2ZTC A;  5GAD C;  3L0O A;  1FL0 A;  2IT1 A;  2MO1 A;  1SFO H;  5IP9 G;  1EQQ A;  4YHH Q;  1XMO Q;  2K5V A;  1SE8 A;  4OWX B;  3PV0 A;  1A0I A;  3KOJ A;  3MXN B;  1QZH A;  4X62 Q;  3J81 c;  5JJK A;  5EAY A;  3KJP A;  5IT9 c;  3I4M G;  3J7A 5;  4DKA C;  4DR5 Q;  3PF5 A;  2HQL A;  2PQA A;  2ZM6 L;  4BY1 H;  2ZJR A;  1XMQ Q;  1VQF A;  5M3M G;  4IPG A;  3H0G H;  4EX5 A;  4LFC Q;  2HIX A;  2KCT A;  1W3S A;  1TWC H;  3GTM H;  3KF8 B;  1BKB A;  4A3B G;  1HZ9 A;  5LMN L;  5GAH C;  4YCW A;  2JA6 G;  4OWW B;  4DR3 L;  1IBK L;  1IBM L;  2CWA A;  1CKN A;  1EWI A;  4DR2 L;  4JI7 L;  4A3M G;  1B7Y B;  3NEL A;  5IWA L;  4BA1 I;  1Q7Y C;  1C0A A;  1YEZ A;  3NEM A;  5ELO A;  1MJC A;  5DLQ E;  4DR6 L;  3U4Z A;  4GKJ L;  2MNA A;  3CPF A;  2AHO B;  3U50 C;  2UUC L;  1PH9 A;  1L1O C;  2CQO A;  4XIG S;  1HR0 Q;  3K7A H;  4OO1 I;  3A0J A;  3PUW A;  1XPO A;  1SN8 A;  4NXM L;  4DV5 L;  1HH2 P;  1X6O A;  2HT1 A;  4IFD J;  2JA8 H;  5BR8 L;  1Q81 C;  4C2M H;  4JI5 Q;  4A3D H;  4OO1 G;  4JG2 A;  1PFS A;  4WJ4 A;  4AYB E;  3I7F A;  3H3V I;  3HOU G;  3CCM A;  1HNZ Q;  4L5R C;  1VQA A;  3BZC A;  2VNU D;  4DUZ Q;  4JI1 Q;  1VS0 A;  1X55 A;  1EIY B;  1T9H A;  3STB C;  4AYB G;  1N36 L;  3M3Y H;  4JOI A;  3RNU A;  3S24 A;  1CKO A;  1Q12 A;  1FJG L;  1SLJ A;  2GN5 A;  1YHA A;  2JA9 A;  4LF8 L;  1XTD A;  2JJQ A;  1EFW A;  4NB3 A;  3L7Z C;  3ULL A;  2E5L L;  3HOZ H;  4B3R Q;  4JI3 L;  4KHP L;  1NBW A;  1AE2 A;  3CCQ A;  4IPC A;  3OYY A;  2Q2I A;  4BY1 G;  1VQO A;  1PVO A;  1AH9 A;  3ICE A;  3UDX A;  1SR3 A;  1KC8 C;  1IL2 A;  4JI2 Q;  3I4N G;  4GS3 A;  4X66 L;  5H1S E;  3KJO A;  4A3E H;  3KFU A;  2Y0S E;  4P74 A;  4BXX H;  4GN5 A;  3F1Z A;  2DGY A;  3DLL A;  4OWT B;  4DR4 L;  2Y0S G;  4LFA Q;  1K9M C;  2UXC L;  2YYZ A;  1WCM H;  3PUZ A;  3JAM c;  2R7Z G;  3U58 A;  3RZO H;  4Y52 H;  3D0F A;  1VQC A;  2F4V Q;  1I5F A;  3CCJ A;  4B3T L;  2PQA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...