2N3SA

Nmr assignments and structure of translation initiation factor if-1 from burkholderia thailandensis e264.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
b'MAKDDVIQMQGEVIENLPNATFRVKLENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor IF-1
publication title NMR Assignments and structure of Translation initiation factor IF-1 from Burkholderia thailandensis E264.
rcsb
source organism Burkholderia thailandensis e264
molecule tags Translation
total genus 8
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2n3sA00
5M3FG 3CCJA 1Z9FA 2C35B 4JI2Q 2KCMA 3PGZA 3F1ZA 1L1OC 1EYGA 1Y1VH 2KENA 4JI8Q 1VQIA 5JEAJ 2PI2A 5IP9G 1Q86C 1JB7A 1HNXL 2UXBL 1N33Q 2JA8G 2AKWB 3BZCA 3U4VA 1NMFA 2N8NA 3HKZG 3Q8DA 4DAMA 4HJ7A 4A76A 3CCMA 1CKNB 4C2MH 1VQCA 3M4PA 4OO1I 5FJ8H 2XTIA 4DK6C 4DR5L 3G48A 2JEAI 4KHPQ 3TS2A 1VQ6A 4AH6A 2XGTA 4NXMQ 2VQFL 3F8TA 1WYDA 3GTGH 4JI2L 3CXCA 4JI8L 2JQOA 2JJQA 1K8GA 3UDIA 5C44H 1YHAA 3KJOA 1E1OA 2VQEQ 1ASZA 4JI0Q 2FXQA 5BR8Q 4BY1H 4GN3B 4C3IH 3CC7A 4UY8C 5GAGC 1FJGQ 2HT1A 1SN8A 3A5ZB 4HJ9A 5AJ3Q 3CC2A 3S1RH 1N36Q 3J7ZC 3FKIH 4KHPL 2YTVA 1UE6A 2Q2HA 3I4MG 1TWAH 4BBRH 1G291 3F2DA 4YY3L 2I5MX 4Y7NH 2NVQH 1L1OB 2EXDA 3H0GH 3HKZE 2PI2E 2F4VQ 4JOIC 1VQHA 2VQEL 3A74A 3T1HQ 2VL6A 5BR8L 5IE8A 1R9TH 2GVBA 4GLVB 5AJ3L 1LTLA 4DR7Q 4OONA 4EQ5A 1SR3A 1N36L 1Y1WG 2CFMA 4DK3C 4LUVA 4P75A 4L5QA 1SMXA 1YI2A 1PH2A 4DV6Q 1EIFA 4UPAA 4GS3A 2HQLA 1QZHA 4BBSH 4DUZQ 4EX5A 3PIOA 1VQNA 3KFUA 3KLWA 3CPFA 2ZM6Q 2JA5H 4B3SQ 3T1HL 1HZ9A 1I3QH 3RR5A 5EAYA 3S15H 4QJFA 4DV0L 4JCVE 2D0OA 2D62A 3HOXG 1SE8A 1Q81C 4DR7L 4A3MG 3RNUA 2JA7G 2YTYA 4DV6L 4A3EH 4LF4L 4BXXH 1IZ6A 3GD7A 5J3BA 1PH1A 5M3MH 2UUBL 3CP0A 4DUZL 3CD6A 2WB1G 3H15A 1C0AA 1VS0A 1HZCA 2NZHA 2A8VA 4QQBX 3TEHB 1XMOQ 3GTOH 4IPHA 4P71A 3W1GA 5LMUQ 4DV1Q 3K81C 3CCSA 1L0WA 2BH8A 3ICEA 2ALYB 3CCLA 3SGIA 3K0XA 1GO3E 2JE6I 4X66Q 1KRTA 3IRBA 4A3IG 1VQPA 5C4XG 3NBHB 2IY5B 2GVAA 5C0XJ 3I4NG 2UUAL 4IJHA 1K0RA 1NE3A 3OW2A 1EUJA 1TWGH 4OX9Q 5IP7H 1I6HH 4DV1L 3W5OA 4QGUA 5LMUL 2DUDA 3BU2A 3CPWA 4JI3Q 1X54A 3WWVA 1VQFA 5ELNA 3HOVH 4JYAQ 3GO5A 2AWOA 3AFQA 1HR0L 2ID0A 1E3PA 4IFDJ 1MJEA 2WB1E 4IPGA 2PQAA 4JBKA 3CW2C 1PH3A 1NY4A 1VCIA 3GTKH 4A3FG 1FVIA 4JV5Q 4A93H 2R93G 2YU9H 1GVPA 1WCMH 4AQYQ 3D0FA 3RZDH 1O7IA 3LGJA 2K50A 4JC0A 3I2ZA 5IWAL 2JK8A 2A1AA 3CAMA 3UE0A 3A5UA 1JE5A 4JI7Q 1A0IA 3GTQH 4K0KL 2KHIA 4JYAL 4NXNQ 1WJJA 3RLOA 3STBC 5C4JH 4YCWA 3MXNB 1OXSC 4DAYB 4HIDA 1P8LA 4DV3Q 3KF6A 1PH4A 4A3GH 3GTMH 3NENA 2MNAA 4LFBQ 3FHWA 4JV5L 2PMZE 5IY0A 2ZJRA 2IX1A 3PF4A 4A75A 4AQYL 3T1YL 2CWAA 5JJIA 2WP8J 3ULPA 4A3BG 4TVAB 4X65Q 2VZAA 4JI5Q 1V43A 5IYCH 1UE1A 1W3SA 4DV2Q 4JI7L 1GD7A 4GLXA 4DR1L 4DR4Q 3PSIA 4IOAA 4JBJA 4GKJQ 1X3GA 2F3IA 1IBLQ 3PO3H 4DV4Q 1YVCA 2ZTEA 3J80i 2YTXA 1Y1VG 1PH9A 1ASYA 1NBWA 5LMNW 1N32L 2F52A 3PUWA 4DV3L 3PO2G 1OTCA 3L2PA 4LFBL 4KHZA 1K3RA 1Q1EA 2NN6I 1EQQA 3HOYG 2E2JH 4JI5L 4LFAL 5FJ8G 3I56A 4DV2L 2Z0SA 4NPSA 3I4OA 1U0LA 4KI0A 4DR4L 1VQOA 4DNIA 1IBLL 2CQOA 1TWHH 1UWVA 3K80C 3E0EA 1N8RC 4RG1A 1E22A 5IP9H 4DUYQ 1YHBA 3K8AA 1N33L 2Y0SG 4JI1Q 4OWTB 4JBWA 1MKHA 3PUXA 5C44G 1N9WA 1EIYB 3ULJA 1X3EA 2E5LQ 4BY1G 1W2BA 1UE5A 1HZBA 4PMWA 2OWOA 4DV5Q 3FKIG 1V9PA 1Q12A 2UUCQ 4A3LH 2IHEA 4YWMA 4NXML 1M1KC 2KBNA 1HNZQ 1XMQQ 3U4ZA 4QIWE 3F2BA 4BBRG 3OYYA 1X56A 1PFSA 3HOUG 4DUYL 4MNOA 1WFQA 2E8GA 2HIVA 4PZ7A 4JI1L 4JI6Q 4JI0L 1FJGL 2E5LL 2CKZB 1I94Q 1QVCA 4P72A 1U5KA 1PVOA 4L5RC 2UU9Q 1QUQA 4DV5L 4HJ5A 5GQOA 2IHFA 2OTLA 1LUZA 1PH5A 2UUCL 1PV4A 2R7ZG 1FL0A 3U50C 1XMQL 1S40A 3KDFB 1YJ9A 1J5EQ 3J7A5 4B3TQ 3RLFA 5LMNQ 2Y0SE 2B29A 2NVYH 5GROA 1TXYA 2F4VL 2CCZA 1QZGA 3U58A 1KHIA 2E2IH 4JI6L 2JA5G 4P74A 1NMGA 3RN2A 1VQ5A 1PH6A 2NZOA 1I94L 3ER0A 1SLJA 3UDFA 3STBD 2UU9L 2Q2UA 1YEZA 2NN6G 4OO1G 1YZ6A 2QEXA 4LF7Q 2OQKA 1KL9A 4O2DA 1OXTA 2HIXA 3DM3A 3G71A 2K5HA 4BXXG 3PIPA 5LMNL 1VQLA 5JJKA 3S1MH 1IBKQ 1H95A 5M3MG 5H1SE 5IT9c 4JBMA 4LF8Q 1JJGA 2ZM6L 2K14A 4B3SL 1TWFH 1PYBA 3NELA 2Z6KA 4A3JH 1MIUA 2ZTDA 4DKAC 3NEMA 2K4KA 2N78A 1PA6A 4LF7L 3M3YH 1XTDA 2QA4A 2NVXH 3AEVA 2LXJA 1YITA 5IYBG 2K75A 2JA7H 1UEBA 5M5YH 1Z47A 1T9HA 2WAQG 3RZOH 1IBKL 2HHHQ 4LF6Q 3S1NH 4IFDI 2B63H 2VY3A 2EQSA 4AYBE 1XPRA 2B3GA 1E1TA 2WFWA 1XMOL 3UE1A 1Q82C 3S24A 5IP7G 1YJNA 4JG2A 4JI4Q 2PNHA 4X66L 3HOVG 5HY6A 3AQQA 1CKMA 3HOZG 1OXVA 3H3VH 4A3CH 3F2CA 4AIMA 4DR2Q 2KHJA 2ZJQA 4A3IH 2QGQA 5C4XH 2RHSB 3J80c 4HJ8A 2UXCQ 5DLQE 2HHHL 4LF6L 3PUZA 1S72A 1GM5A 3I4NH 1XPOA 3S2DH 3CMAA 1KD1C 2LXKA 4OX9L 2V1CC 4BY7G 1EOVA 4JI3L 1B7YB 4DV7Q 3S14H 4JI4L 1YJWA 4R4OA 2R92G 1AH9A 1LM0A 3RLNA 4RMFA 5IYDH 2WAQE 1K8AC 1A63A 4DR2L 5FLMG 5ELOA 4GNXA 4A3DG 2VS1A 4A3KH 3HOWH 2OQ0A 4UP8A 4HIMA 1XNRQ 2LSSA 4A3FH 1PYSB 3PUYA 4GKKQ 2Z6KC 4IPDA 2D0PA 3BZKA 4YCUA 2R93H 3K7AH 1JJ2A 3E9IA 4NB3A 2ASBA 2JA6H 2VUMH 1X9NA 4NXNL 3PF5A 4UP9A 1YHQA 1XNQQ 4L5SA 5GAEC 2MQHA 1BBWA 2ZJPA 3S1QH 3AFPA 2ES2A 2L15A 3CCUA 4C3HH 4PZ6A 1M90C 2UXBQ 5GAHC 1NJIC 1PH7A 3UDGA 1BBUA 1X6OA 1CSQA 2JA9A 1HNXQ 1G6PA 1VQJA 1GKHA 3G4SA 5C3EH 2GN5A 4X65L 3TREA 3W1BA 4XIGS 4LNQA 1E24A 4BA2I 1K73C 2AWNA 4L5TA 2KCTA 4WJ3M 1VQGA 4GKJL 4X64Q 1EWIA 5M3FH 3CCRA 4DV4L 1XNQL 2VQFQ 1IL2A 2OCEA 4MZ9A 4R4TA 1G51A 5K36G 1DGSA 4GN4B 3ULLA 3PUVA 3CMEA 2YV5A 3L0OA 2JA8H 2A19A 2MFIA 3I7FA 3PO2H 1Q1BA 4IO9A 4GOPA 1KAWA 4UP7A 4DR6Q 3HOYH 3S2HH 2YYZA 2VNUD 3KOJA 4A3LG 1SRUA 2R6GA 4X64L 4MTNA 2I5LX 1JJCB 1C7YA 4LUZA 1HJPA 1HZAA 1KXLA 4GNXC 3H0GG 2Q2IA 4YY3Q 1I50H 1OXUA 3FP9A 4A4IA 3J81j 3OTOQ 5JEAG 3S16H 4GLAC 4QY7A 1IBMQ 1VQ9A 1V1QA 1KIXA 1Q8KA 4DR6L 3JAMc 3M9BA 3H3VI 1HNZL 3I4MH 2EIFA 3KF8B 1SROA 3PV0A 4APVA 1B8AA 2H5XA 2PQAB 1D7QA 2AHOB 4BBSG 2IT1A 1HR0W 2ZTCA 3HOUH 1KC8C 3GTPH 3OTOL 2IX0A 3TS0A 4LFCQ 3ERSX 4YWKA 1OXXK 2BA1A 4AYBG 1K9MC 1IBML 1RL2A 4R4CA 3KYHC 1VQKA 4HIOA 2OTJA 2DGYA 4DV0Q 4POFA 1Y1WH 1CSPA 2K5VA 1WI5A 3HFZB 4LUOA 4HIKA 1J5EL 4A3EG 2R7ZH 1UE7A 1BVSA 1VQMA 4B3TL 5E7NA 1EQRA 1NTGA 4ME3A 5HGQA 3ZJYC 4R4IA 1KRSA 4X62Q 1IYJB 3EN2A 4J15A 4LF4Q 1JMCA 3UDXA 4GNXB 5C0XI 2R7DA 1VQDA 1VQAA 1Y14B 1IXRA 3KF6B 2UUBQ 3CC4A 4FDBA 1WOCA 1CKNA 1P16A 4POGA 4LFCL 4IJLA 4A3JG 3MEFA 4GOPC 1AE3A 1Q46A 3EIVA 1N34Q 2K52A 3JAMi 1VQ7A 4Y52H 1RIPA 3HOXH 4PG3A 1LYLA 4A3MH 2JEBI 3EBEA 3J81c 4WJ4A 1BKBA 4B3RQ 2MO1A 5M5XH 4R1JA 2BA0A 3JC66 4LF5Q 2ATWA 4R4QA 4X62L 4LF8L 4QL5A 1JT8A 2B63G 3M4OH 1E7ZA 1EFWA 4LWCA 3KJPA 4H02A 2UUAQ 3S17H 3TRZA 1VQBA 2AMCB 1Q7YC 1B70B 1S3OA 1N34L 4B3MQ 1QVGA 4HJAA 1C9OA 1X65A 3E9HA 2CWPA 4YWLA 1VQ8A 1CKOA 1J6QA 1HNWQ 1A8VA 4B3RL 4A3CG 4DPGA 3I55A 2UXDQ 5FLXc 4LF5L 1L1OA 1YBYA 5IYBH 3K7UC 1HR0Q 1TWCH 2RF4A 3AYHB 3CQZH 3PCOB 4A93G 4BA1I 4C3JH 5GADC 1XJVA 1A62A 1WCMG 4OWXB 4DR3Q 2BH2A 3D31A 3CCVA 3L7ZC 4IPCA 3BJUA 3TQYA 4B3ML 4GOPB 3B6YA 4P73A 1HH2P 4KLKA 3J81i 5IWAQ 1PHJA 2N3SA 4K0KQ 3M7NA 4GN5A 2K5NA 3HKSA 5IYDG 1K83H 3M4QA 1HNWL 3KDFA 1QVFA 3CCEA 3HOZH 2UXCL 1X3FA 2UXDL 2I5HA 3GDEA 3CF5A 2I0QA 4A3GG 4A3KG 3HOWG 1L2FA 4LF9Q 1YNXA 3G6EA 3RN5A 1PH8A 5C0XG 1X55A 3A0JA 1D8LA 4YHHQ 3M85A 4DR3L 4IOCA 4ALPA 1VQEA 2R7FA 4DV7L 3T1YQ 5IYCG 4BY7H 1QUQB 1FGUA 2JA6G 1VQ4A 2VUMG 2NVTH 3PO3G 4TQUS 5JJLA 1YIJA 2R92H 3GTLH 4DR1Q 3CCQA 2VW9A 1CUKA 3VDYA 2Q2TA 3DLLA 4XTCS 2RHQB 5FLMH 4O0AA 1N32Q 4A3DH 4JOIA 1XNRL 4LF9L 4OXPA 2RCNA 4IFDG 4X6AH 4PZ8A 4OWWB 4GKKL 1I5FA 4YCVA 5C3EG 4YHHL 1XPUA 4A3BH 1MJCA 2E2HH 1AE2A 3GTJH 1SFOH 4DR5Q 4LFAQ 1KQSA 2MO0A 4LW1A 2N49A 5M5WH
chains in the Genus database with same CATH superfamily
5BN3A 1Z9FA 4RKBA 3GTMH 1STNA 5JEAJ 3QG1A 1L0YB 4DGZA 2NB0A 1EY5A 2EY5A 3WOFA 4A3JB 1NMFA 2NTSA 3Q8DA 4HJ7A 3W3AA 3M7GA 4OO1I 2K04A 5LL6S 2JEAI 3TS2A 1VQ6A 5M5YB 4J6HA 3S1NB 3F8TA 1LTSD 3PMFA 1FNWA 5K36H 2JQOA 1K8GA 5C44H 1I4HA 2VQEQ 1E1OA 2FXQA 1G91A 1N36Q 4CGYB 4DAYA 1PZID 1EY7A 2NVQH 1L1OB 4FXGC 1X3QA 2F4VQ 2KEEA 2VQEL 1JWSD 4M8AA 5ELFA 1R9TH 4GLVB 1NCVA 1N36L 4EQ5A 2CFMA 1YI2A 1PH2A 2XSCA 4OIJA 1PRTC 4KKSA 4N8X1 2HQLA 2JSOA 1Q3LA 1VQNA 2JA5H 1V1PB 1I3QH 4ZUIA 3RR5A 4QJFA 4M1UB 3MVVA 1JE4A 4LK1C 3S1QB 1SE2A 3NQIA 1LT3D 4A3EH 3GD7A 1G2SA 5M3MH 3CD6A 2WB1G 4K8JA 1C0AA 2CW0C 3TP8A 1HZCA 3DHQA 3MHBA 4L8JA 1TIID 4P71A 3W1GA 5CBEE 3K81C 5D14A 3ICEA 2ALYB 3CCLA 1TKWB 3K0XA 4A3IG 1DOMA 1VQPA 3NBHB 1CT1D 2GVAA 3TZDA 5C0XJ 3HKZB 1TS3A 3NWSA 1K0RA 2Z6BA 2R61A 5IP7H 4FVMA 2DUDA 3SEBA 4BS9A 4KKTA 1LT6D 3WWVA 4LMQD 5ELNA 3E3XA 4IUNA 4JYAQ 2EYMA 3VYSA 1KTKA 4RGNA 5D3IB 5I9OA 4JBKA 1D5MC 1VCIA 4JV5Q 4A93H 2R93G 3BG3A 3MEHA 3D0FA 2F0VA 2K50A 4ZQ3A 5IWAL 2A1AA 3UE0A 1A0IA 4QMGA 3TP5A 2SDFA 1AFPA 4JYAL 5TSSA 1Y8PB 4C3HG 5C4JH 3MXNB 2E74C 5L37A 4A3GH 3EA6A 4JV5L 2PMZE 5IY0A 3PF4A 2CWAA 2WP8J 1RKNA 1DONA 1W6JA 2VZAA 3A8KE 4JI5Q 1PRTD 1W3SA 5IYCH 4KKUA 4DV2Q 1CFMA 4GKJQ 3PO3H 3KBGA 3J80i 1N32L 1EY0A 1OTCA 2M9VA 1K3RA 1F2ZA 1NR4A 4JI5L 4LFAL 5FJ8G 1B9NA 1ENFA 4DV2L 4NPSA 1U0LA 1TS5A 2CQOA 4KD3A 2CW0D 3E0EA 1N8RC 1U4LA 3K8AA 4RWSC 3OW7A 3ULJA 2B2VC 1LTRD 2FFKB 1UE5A 3GV3A 2G9DA 3OWFA 2B2WC 3VYUA 3FKIG 5FK9C 4A3LH 4NXML 2KBNA 1KNEA 4BBRG 1IW7C 2AUJD 2FJ2A 1PFSA 4MNOA 2HIVA 5EKLA 4P72A 2F1MA 4U673 4L5RC 1MD2D 2OTLA 1LUZA 2WKCA 1PV4A 1D1KA 2RA4A 5IODA 1S40A 1YJ9A 3J81E 4A3FB 4JPBW 3U58A 1VQ5A 1B50A 4FF1A 1AW7A 1SLJA 3UDFA 2Q2UA 4OO1G 1SDFA 2QEXA 4LF7Q 4V0BA 3DM3A 4RCNA 3S1MH 1IBKQ 3NUCA 1PYBA 2K01A 2Z6KA 1B1ZA 4KN7C 2EJGC 4R8NA 2H1EA 1EIHA 1ILQA 4R8IA 2K4KA 2EYFA 4F87A 4LF7L 1RTNA 1KDBA 2PW7A 3CU7A 2L9HA 2EY6A 3NXWA 1HFNA 3RZOH 1IBKL 4LF6Q 4IFDI 1SBBB 1TS4A 2VY3A 3HOYB 2B3GA 5FO9B 1XMOL 2OF1A 2E75C 4JG2A 1SNCA 1U4RA 4KMUC 4X66L 3SK4A 4A3CH 2KHJA 2Y0SB 4A3IH 4ULLA 4LF6L 4BY1B 1XPOA 1KD1C 3S1RB 5J1ZA 2V1CC 3C1FA 3M4YA 4F7XA 4BY7G 4F8MA 1B7YB 3S14H 1IW7D 1TWAB 3OPOA 5IYDH 4C56C 1JWUD 2I07B 4J8QA 4Y7NB 2KOLA 3ZYYX 3FDTA 1A63A 4GNXA 1I4XA 2VS1A 3HOWH 2MPMA 4MTKA 3MXUA 3X3MA 4UP8A 4PNYA 4HIMA 4WFN3 2LSSA 2F0KA 1UAPA 5A35A 2R93H 4IPDA 2D0PA 2R7ZB 3SR1A 2A6EC 4X3KA 3WOEA 2A74C 4NXNL 1XNQQ 2XVSA 3MWYW 4IALA 4C3HH 3L9AX 1M90C 2UXBQ 1G6ZA 1NJIC 1AEXA 2JA9A 1G6PA 3BVGA 1PYWD 1A2UA 3TREA 1WTVA 1VMPA 4L5TA 3G6JB 3I3CA 2EY1A 4X64Q 1EWIA 4FF4A 1XNQL 2PZUA 3BZDB 2VQFQ 1G51A 1R4PB 4GN4B 1STYA 1WTHA 3PUVA 1II3A 2YV5A 2MFIA 4IUVA 4GOPA 3Q23A 3S2HH 2VNUD 1DXMA 2BE5D 2DY8A 2FMCA 2R6GA 4X64L 2WAQB 4MTNA 4C3JB 4XQJA 1HJPA 2A6HC 3H0GG 1U4PA 4YY3Q 1I50H 1OXUA 4A4IA 3J81j 2L55A 4G57A 1I6HB 1RHPA 4QY7A 1PDQA 3HOZB 3M9BA 3BDLA 3OWEB 1HNZL 3T13A 4CKBA 2H5XA 3QWNA 4NP5A 2PQAB 3GTKB 1D7QA 1HR0W 2ZTCA 3GTPH 2IX0A 3Q24A 3TS0A 5NUCA 1EU3A 2PQEA 3VR2A 2LMCB 2BA1A 1RL2A 4R4CA 4ZYSA 3GTLB 4HIOA 1Y1WH 2F0HA 4K14A 2K5VA 3HFZB 2F0DA 1S5ED 4B3TL 4A3DB 4ME3A 1KDAA 4LF4Q 2A6ED 1SFOB 1LV9A 1WOCA 3VR3A 4IJLA 3NE5B 5IOCA 4A3JG 1AE3A 1VQ7A 3HOXH 2F0LA 4L6TB 4OO1H 4B3RQ 2MO1A 3L3OC 2BA0A 4YIJA 1EQVA 4O1NA 5IIFA 1FD7D 2L12A 4QL5A 4C2MB 4LWCA 1S5DD 3TP6A 1R4QB 2AMCB 4B3MQ 1EL0A 1QVGA 1GUNA 3UI2A 1B2TA 2F0MA 1X65A 3I90A 1M4VA 1CKOA 4B3RL 2UXDQ 1TWCH 2C9OA 1HTLD 4XQQA 1A62A 4OWXB 1GUGA 1SNPA 4IPCA 1JB3A 4B3ML 3B6YA 1TY2A 1HH2P 1LTBD 3PQIA 3J81i 1PZJD 3M7NA 1RD9D 2K5NA 1T5EA 1K83H 5DM73 3KDFA 4B9WA 3CCEA 2UXDL 3GDEA 3CF5A 5KNCA 3C3LA 4LF9Q 4HEDA 3V96A 3RN5A 1PH8A 3NK9A 5ELCA 5KNDA 1X55A 4KK7A 4IOCA 4BY7H 3OMGA 3RD4A 4K6LA 3FVQA 4DR1Q 1HA6A 3VDYA 1TQOA 2Q2TA 4DXGA 2F0IA 3P20A 5F2DA 2FMMA 4LF9L 4OXPA 3S15B 4IFDG 4AYBB 4PZ8A 4GKKL 4YCVA 1XPUA 4A3BH 5FKAC 1AE2A 3X3NA 4Z9CB 4DR5Q 1WTWA 1MBYA 1H9MA 1Q12A 1EY8A 1A3VA 3HEJA 4QUFA 5EKIA 4DN4M 1EYGA 1HCZA 1Y1VH 4JI8Q 1PFBA 2CHBD 4PV1C 1Q86C 1FYCA 1HNXL 2PCFB 1N33Q 2AKWB 3BZCA 3QR8A 4ZKBB 2N8NA 3HKZG 4DAMA 1CKNB 1SNOA 1MHWC 1VQCA 2AQ3B 2TSSA 4DK6C 4DR5L 1D5ZC 3G48A 4KHPQ 2JXMB 3AB9A 2XGTA 1WYDA 2HDLA 1QE6A 4JI8L 1TWGB 4CJ2C 1EOTA 4I7AA 3KJOA 1ASZA 4JI0Q 4GN3B 4C3IH 3CC7A 4UY8C 3A5ZB 4HJ9A 5AJ3Q 4H13C 1MGSA 1VDZA 4DAVA 3EQLC 4KHPL 1UE6A 1HRJA 3FPPA 1G291 4LAAA 4XDXA 2I5MX 3S2DB 1WCMB 2IL8A 3H0GH 2PI2E 2QEJC 1JOQA 1GUWA 2B39A 2CQAA 5IT9E 3SDZA 5IE8A 5AJ3L 4OONA 5J39A 1VMCA 3SXHA 1BR9A 1MI2A 4DV6Q 3C1EA 1EIFA 4O42A 2NWGA 1QZHA 4RH6A 4I7ZC 4B3SQ 1HZ9A 3DUZA 1I4PA 2JA6B 4DV0L 4IUPA 2D0OA 2WACA 4JCVE 1SE8A 2AQ2B 2Z4IA 1I6VC 4DV6L 4DNTB 4BXXH 3C2PA 3D8GA 2I46A 1U9RA 1LT4D 4EGVA 1PH1A 2UUBL 3QO2A 2WV6D 1TS2A 3H15A 2A8VA 5I6YA 2MP1A 5CORA 5M3FB 1BXTA 5IGFA 2IW3A 1CM9A 4HR7B 5I4DA 2JA8B 1FNVA 2IY5B 2PPBC 1NE3A 3JAML 3OW2A 1EUJA 2O5JC 4RHRA 4H44C 5CYUA 3HRZC 4JI3Q 5E3FA 2QDLA 1X54A 4IUQA 1VQFA 3U9SA 3HOVH 3GO5A 2ID0A 1E3PA 2WB1E 4IPGA 1RJTA 4S3SA 1TR5A 2MUYA 4A3FG 1FVIA 2B2VA 4AQYQ 1JCKB 2EOTA 3RZDH 2PZTA 1O7IA 3I4MB 2DNCA 2JK8A 1D1IA 1ZXTA 3CAMA 3FMCA 4JI7Q 2NVYB 3RLOA 3NSWA 2E2IB 5C3XA 1OXSC 1IKMA 4DAYB 4HIDA 4DV3Q 3KF6A 3QOJA 3D6CA 3NENA 4LFBQ 3S9WA 2ZJRA 4AQYL 4X65Q 1IYVA 4JI7L 4DR4Q 1ENCA 4DV4Q 1TWFB 1WTXA 2YTXA 1NBWA 1A3UA 2RSOA 4CKCA 4DV3L 4UDUC 4NDXA 4LFBL 4IFDH 1BCPB 2EY2A 1U4MA 4A3MB 3HOYG 1LO5D 1W6KA 5FLXL 2EYPA 4KI0A 3SK8A 2EZVA 4DR4L 3QIAA 1UWVA 3N6RA 3M4OB 1YHBA 2Y0SG 4OWTB 4JBWA 1FJGQ 1BO0A 1ICFB 4BY1G 1GHJA 1H9JA 3A8JE 4PMWA 2OWOA 3RUZA 4DV5Q 3LWEA 2UUCQ 2IHEA 3NQTA 4QIWE 3I4NB 1X56A 2F0WA 3MXGA 1FJGL 2H4OA 2F3WA 1ET6A 1PVOA 4MIUA 4DV5L 4HJ5A 5GQOA 2R7ZG 2UUCL 1FL0A 3DXJC 2DNEA 3U50C 1J5EQ 3J7A5 2B29A 5GROA 1TXYA 2F4VL 1QZGA 1O78A 1S5FD 1NMGA 3RN2A 1X32A 4FP5D 4K5XA 2K5QA 2NN6G 4PMBA 3D3RA 3OIQA 1VQLA 1H95A 4B08A 2NYZD 5H1SE 4LF8Q 2K5DA 2RSNA 4IQZA 1F9SA 1UNSA 4K2LA 4DK1A 1UEAB 2EYOA 4DKAC 5JJZA 4JVZA 1WVLA 1PA6A 3I70A 3M3YH 2NVXH 3AEVA 2CVRA 5IYBG 1UEBA 3PO2B 2WAQG 1QNUA 4C3JG 2B63H 2EQSA 4AYBE 1SJED 1E1TA 1WD0A 2VXWA 3S24A 3IKJA 1GJXA 1B3QA 3KF8A 3HOZG 1OXVA 3F2CA 3TP7A 2XNAC 4DR2Q 2QGQA 2RHSB 4HJ8A 3S16B 4XYQA 1S72A 4NMZA 2LS01 1EOVA 4DV7Q 1YJWA 4JW0A 1XTCD 1AH9A 4RMFA 1G2TA 2L4NA 1K8AC 4DR2L 5FLMG 5ELOA 4A3DG 2OQ0A 1R9TB 4A3FH 1H9KA 1V1PA 4WJWA 2O4XA 3K7AH 5CMDA 4G7ZC 4ZCKA 3PF5A 1HQMC 2PZWA 4UP9A 1YHQA 4L5SA 1BBWA 4HTHA 1QOHA 2ES2A 2L15A 1I3QB 3MTSA 3VA5A 3W1BA 1CQVA 4XIGS 1VQGA 4GKJL 1C8CA 5M3MB 1IL2A 3NBHA 4MZ9A 1ILPA 2JN4A 1PTOB 3NBIA 3ONAB 2NUCA 2A19A 5BN5A 1Q1BA 1FGBD 1JQYD 4C1NI 1SNQA 4UP7A 1HXYD 3HOYH 2QF7A 1O7ZA 4RGMA 1T5XD 3IAYA 1NSNS 2I5LX 1KXLA 3FEWX 4BWGB 3LX0A 3OTOQ 2QILA 2B2YC 3H6MA 5JEAG 4FYDA 3D4WA 1VQ9A 2DJFC 4DA2A 5T1GA 1Q8KA 2F3VA 3JAMc 2KVMA 3K6OA 2EIFA 3A56A 1HPCA 4FNFA 1F2LA 3IL8A 3MXNA 4RFBA 3VR5A 2IT1A 4B9XA 3OTOL 1QILA 2AQ1B 3ERSX 2NVTB 4IN3A 5ELDA 1OXXK 5G3LF 4AYBG 3KYHC 1HFGA 4KV6A 4POFA 5T1IA 5ELBA 5C4HA 1Y69U 1WI5A 4LUOA 2R7ZH 3BVMA 1LACA 1UE7A 1BVSA 1KLUD 5I9PA 2ICIA 4R4IA 4X62Q 4GNXB 2PO4A 1VQAA 1Y14B 4F88A 2EYHA 2K6AA 4POGA 3ND8A 1N34Q 5M5WB 5DNFA 1RIPA 1SYGA 2RQXA 3V2TA 2JEBI 2A69C 4XQNA 4R1JA 1EZ6A 4LF5Q 2ATWA 3K5OA 4X62L 2RCFA 2HDMA 1HTPA 3OSOA 2UUAQ 3S17H 3KLSA 1Q7YC 1S3OA 1N34L 1BUVT 4OGQC 4HJAA 1C9OA 3GTGB 2CWPA 5CV8A 4RGOS 2WINB 1HNWQ 4CJ0B 5A2QE 2F0PA 1RTOA 3OHXC 1YBYA 5FLXc 5IYBH 3K7UC 1HR0Q 2RF4A 4LF5L 3CQZH 4WRDA 4BA1I 4C3JH 5GADC 1XJVA 1WCMG 4TSSA 4DR3Q 3D31A 3L7ZC 3BJUA 4G7HC 2F0EA 1ZKOA 4GOPB 4X3SA 1QB5D 3H91A 3GP7A 4K0KQ 3TSSA 1SYFA 1H9RA 1HNWL 1QVFA 3HOZH 2I5HA 3MC0B 2I0QA 4A3KG 5KNBA 1LTAD 1JWMD 5C0XG 2K28A 4DR3L 1D8LA 2HCIA 3M85A 1SAPA 4ALPA 1KDCA 3T1YQ 1O7YA 1QUQB 2JA6G 4HSPA 1VQ4A 2VUMG 5JJLA 3GTLH 4BBSB 3CCQA 2VW9A 5KIXA 4ID6A 2NBFA 4CHTB 2RHQB 5FLMH 4A3DH 2RCNA 3SK6A 5C3EG 2E2HH 1SFOH 4FO2A 2F0OA 2N49A 3S1MB 3NTKA 5M3FG 4DU9A 2O2LD 3HP3A 2KCMA 3F1ZA 1L1OC 1F9QA 5IP9G 2UXBL 2PI2A 3MAQA 2JA8G 3GTOB 1CHPD 3U4VA 4A76A 4IZ8A 4BA2I 2A69D 3CCMA 2J7ZA 5J22A 4C2MH 4DFAA 4IUTA 3M4PA 3G7LA 2XTIA 3DWAA 1QNKA 5FJ8H 1J8IA 1LTTD 3NTHA 1EY4A 2VQFL 3CXCA 4EQOA 1BQQT 3BVZA 2NTTA 1RCVD 4ZK9B 1YHAA 2G5DA 5BR8Q 5DM63 4HCEA 3CC2A 2HQEA 4ZKCB 3FKIH 4EQNA 2YTVA 1EIGA 1KLGD 3I4MG 1JICA 4BBRH 3TMEA 1S4ZA 4YY3L 2YU9B 1K0SA 4KY6A 3HKZE 1C4QA 3A74A 3EROA 3S14B 2VL6A 5JEAH 4PQXA 5BR8L 1F2YA 1X3PA 1LTLA 4DR7Q 2RBMA 4JK1C 2BCOA 3K0YA 4DK3C 4LUVA 1EEFD 1SMXA 3KK7A 5JVG3 3P1HA 2IJ0A 3HOWB 2KA7A 4GS3A 3W2DA 1ICWA 1IYUA 1PFNA 4DUZQ 1VF7A 3KLWA 2ZM6Q 1Z7TA 2D9UA 4V190 3S15H 4ODGA 2D62A 1Q81C 4DR7L 2F0JA 2MGSA 4A3MG 1ZYRC 2TMPA 4NKLA 2M00A 2YTYA 4LF4L 1IZ6A 3VA7A 5I2XA 4DUZL 1JOKA 3T51B 1VS0A 3SE0A 4KJOA 3TEHB 4IPHA 4DV1Q 5LMUQ 2B8GA 5KRUA 2BH8A 1E2ZA 1A2TA 3SGIA 2KUMA 1GO3E 2JE6I 3R2TA 5IGBA 1PRTB 1K8MA 3I4NG 3KLSX 1Z6HA 3QOLA 1TWGH 3S2HB 4ME5A 4OX9Q 2A6HD 4DV1L 3W5OA 5LMUL 3BU2A 3NP8A 4CDCC 1SMYC 2XRQD 1ZEQX 4OIKA 1EWCA 1WD1A 1PMRA 2PQAA 1LTID 1PH3A 1NY4A 1TVXA 1CK1A 1WCMH 2EVBA 4JC0A 3Q0AA 1S5CD 1JE5A 3F2UA 3GTQH 1YNJC 2KHIA 1WJJA 3KBXA 2QW7A 1PZKD 1CZWA 2MNAA 4DXFA 2F03A 2IX1A 3HG9A 3MA2B 5EPJA 5JJIA 3ULPA 2FHTA 1Y1WB 3J81L 4TVAB 1V43A 1UE1A 3A8IE 4DR1L 3PSIA 4JBJA 5C6AA 2F3IA 4OL7A 1IBLQ 4QCLA 2K32A 3VYTA 2ZTEA 2BOSA 1AZPA 1ASYA 1H9SA 5LMNW 1SYBA 2F52A 3PUWA 3PO2G 3L2PA 1Q1EA 1ZYRD 4IURA 2NN6I 3HOXB 2IX3A 1EQQA 2E2JH 2EDGA 2JA7B 3T4AC 1A6XA 2Z0SA 4KTAA 1ESFA 4DNIA 4HN7A 1IBLL 1TWHH 2XIWA 4N9PA 4X3UA 1DD2A 2B8FA 1GUTA 4RG1A 1E22A 2KEDA 5IP9H 4DUYQ 1N33L 3K5MA 3PUXA 5C44G 1N9WA 1EIYB 1X3EA 1M8AA 1W2BA 1HZBA 1F2MA 2MHVA 4CKEA 5C4XB 2PW5A 4YWMA 3U4ZA 1TWCB 3A7AB 3F2BA 3K5LA 1I4QA 3OYYA 4ZLTF 2EE1A 4DUYL 3KUPA 1WFQA 4EQPA 4JI6Q 4JI0L 2X6LA 5KGUA 2PMZB 4GZYC 5EPLA 1SMYD 2CKZB 2R3ZA 1QVCA 3VYRA 1U5KA 2UU9Q 2IHFA 4K5VA 4A3KB 3J7AF 4ZUJA 2Y0SE 1CI3M 2NVYH 3NPPA 4QB4A 5E4WC 1KHIA 2E2IH 3EVQA 2JA5G 2RDFA 4JI6L 1PH6A 2VUMB 2NZOA 1YNJD 4HCSA 5JAVA 2UU9L 2AUKA 1YEZA 1GUOA 1YZ6A 2OQKA 1KL9A 4O2DA 1OXTA 1HUNA 4HMIA 1WTRA 4UAIA 5JJKA 3SHLA 5C3EB 3T56B 5M3MG 4JBMA 5DAUA 2F4IA 4B3SL 4A3BB 1TWFH 3HZXA 3FRPB 5JOBA 4C1NK 1O7LA 4A3JH 1MIUA 1IL8A 1QG7A 3KLRA 5CV6A 2PYKA 2KHSA 2QA4A 2QCPX 1Y1VB 1YITA 2LY7A 2K75A 1QWYA 2P5ZX 5M5YH 1T9HA 2HHHQ 3S1NH 2Z8LA 5IGCA 1J9OA 2WFWA 1Q82C 5IP7G 4JI4Q 5FO8B 2PNHA 3PIO3 1CKMA 4DF7A 1L0XB 4AIMA 3BDOA 3ERQA 2ZJQA 1TU2B 2FINB 2UXCQ 4ZAIA 2HHHL 3PUZA 1GM5A 3I4NH 4C3IB 2LXKA 3CRKC 3T53B 1YNNC 5CV7A 1WTOA 4JI3L 1V8QA 4JI4L 5IGDA 1LM0A 5CC4A 2WAQE 2XWJB 3HOUB 1EY6A 1G8ZD 5EQ0A 2E76C 1FNUA 2B2YA 1XNRQ 3U9OA 3PUYA 4G7OC 3BZKA 1K8OA 4K2KA 1HUMA 3TDQA 1SNMA 3E9IA 5C5MA 2DY7A 2XN9C 3S1QH 5GAEC 2ZJPA 4Q5VA 3AFPA 4P2CB 5D3DA 1LTGD 1SE3A 5GAHC 4FXKC 1X6OA 1CSQA 1CTMA 1BDOA 2GN5A 2G9HD 4X65L 5C3WA 5M5XB 1DYQA 2Q8RE 2Z4HA 1K73C 2AWNA 3E5SA 1PLFA 1SYCA 1CA6A 1RODA 2V4DA 4DAPA 4DV4L 1IHZA 1XWEA 3I4LA 2OCEA 4R4TA 1DGSA 1JR0D 3ULLA 5E4XA 1TT2A 3L0OA 5EGTA 3PO2H 4L63B 4IO9A 1KAWA 2ZXOA 2DJGC 4DR6Q 2HD3A 4A3LG 2KCCA 1SSOA 1SRUA 2EJFC 1OO9B 1C7YA 2B2UC 3I8ZA 1CHQD 1DOLA 3S16H 1IBMQ 1V1QA 4K5WA 3HOVB 4DR6L 2RDHA 3H3VI 3KF8B 3PV0A 1SROA 2OT2A 2VB2X 1B8AA 1MSHA 2AHOB 1YNND 4BBSG 3LWUA 3RZDB 4YWKA 3O13A 1IBML 1K9MC 2HCCA 2R92B 2DGYA 2L5TA 1EYCA 1CSPA 4XYOA 1B9MA 1J5EL 4KY7A 2SNMA 5E7NA 1EQRA 5HGQA 1BNZA 3ZJYC 1JC7A 1KRSA 3EN2A 5CR3A 1JMCA 3UDXA 5C0XI 3VR6A 1CQFA 3CC4A 3GTJB 4FDBA 1B3AA 3OOCA 1P16A 3MEFA 4Y52H 2L0CA 1SEBD 5EBDA 4PG3A 1LYLA 1ENAA 3GTMB 4WJ4A 3J81c 1NUCA 1BKBA 1IKLA 4PMCA 3JC66 4DNRB 3DMUA 4LF8L 1UUPA 2ZXRA 1C48A 3H94A 3IFTA 3KJPA 1SE4A 4H02A 1PTOH 3J7YW 1VQBA 2C5CA 4FF2A 1ET9A 3E9HA 4YWLA 1VQ8A 3RMHA 2F0TA 4A3CG 2RDGA 2Z1CA 5C44B 1L1OA 3TBIB 4G4KA 3AYHB 3PCOB 1B53A 3PIP3 1WTPA 3HGBA 3TQYA 4XXEA 1LT5D 4P73A 4KLKA 5IWAQ 2N3SA 4RKLA 2NVQB 3QB3A 4GN5A 3HKSA 5IYDG 3M4QA 1X3FA 2ZXPA 3HOWG 1L2FA 1ESRA 1YNXA 3G6EA 3A0JA 4YHHQ 4TRDA 1VQEA 2R7FA 4DV7L 5JVH3 3BS1A 2NVTH 5CGKA 5IT9L 1KAAA 1CUKA 3TN2A 2JA5B 3DLLA 4O0AA 1N32Q 5C4ZA 4X6AH 2OEOA 4KD4A 4YHHL 3P7JA 3K5NA 1BCPF 4A3EB 3H3VC 3DEOA 4LFAQ 4U68A 1KQSA 5M5WH 2F0GA 2C35B 3FPUB 3Q6SA 4JI2Q 3CCJA 3PGZA 3URYA 5CV9A 4WORA 2KENA 1JB7A 1VQIA 1E0BA 3NWTA 2KECA 2K33A 1GHKA 3M3YB 2NVXB 3ND9A 5I6WA 3ITPA 1I4RA 3J80L 4AH6A 4NXMQ 3GTGH 4JI2L 2B63B 5KEEA 1B44D 2KQ3A 2VB3X 2JJQA 3UDIA 1O80A 5IGEA 3AMUA 5I2YA 4BY1H 2HT1A 5GAGC 1STAA 1SN8A 3S1RH 3J7ZC 1DCZA 1VF5C 2Q2HA 4N9TA 3K58A 1TWAH 4OHJA 4FF3A 3F2DA 4A93B 4Y7NH 2J0TD 2EXDA 2WKDA 1EWHA 3T16A 1RF2D 4JOIC 5HGTA 1VQHA 3T1HQ 3HS0C 2K05A 5FOBB 2GVBA 2ZT9C 3BDCA 5FO7B 1SR3A 1STGA 5C4JB 1Y1WG 1DOKA 1E2WA 4P75A 4L5QA 3D4DA 1A3TA 4A3GB 3NTIA 1JOOA 1DJRD 4IUUA 4UPAA 2K03A 2L1BA 1EFID 5ISRA 4BBSH 4EX5A 2D2CC 3PIOA 3KFUA 3CPFA 3K7AB 3T1HL 5EAYA 1STHA 3PO3B 3HOXG 2NN6H 5IGGA 3RNUA 2JA7G 1SYDA 5J3BA 3CP0A 3GV6A 1K3BC 4RCOA 3I72A 1GOZA 3R3OA 2NZHA 4QQBX 3K57A 1XMOQ 1EYAA 1BBXC 3GTOH 3CCSA 1L0WA 3N52A 4X66Q 1KRTA 3IRBA 5C4XG 3D6WA 2WIIB 2BE5C 2RKSA 2UUAL 1EYDA 4IJHA 4CJ1B 1ONLA 2QKIC 1I6HH 2QDBA 4QGUA 3CPWA 4CBVA 2MJ8A 5LL6X 2IPKD 2AWOA 3AFQA 1HR0L 4KJNA 2B2TA 4IFDJ 1MJEA 4RHSA 1D6EC 4CDEC 3CW2C 5EBCA 3GTKH 1BCPC 2YU9H 1GVPA 3LGJA 1K28A 1KNAA 3I2ZA 4KHVA 3A5UA 3E6ZX 4K0KL 4LJZC 4NXNQ 3DEPA 3STBC 4YCWA 2EXZA 3R2IA 1P8LA 1D2BA 1PH4A 4UHVA 3FHWA 1XYIA 3I91A 3TZUA 4A75A 3T1YL 3SVMA 4A3BG 3CRLC 1SJHD 4FXDA 1GD7A 4GLXA 4KY5A 4IOAA 3CHBD 1X3GA 1NNXA 1YVCA 1Y1VG 1PH9A 1LLRD 5C5LA 1PTOF 5JPMC 4KHZA 2X69A 5D65A 5DEHA 3IFDA 3I56A 1Q8IA 2N88A 3RZOB 2X6GA 3I4OA 3JAME 1VQOA 3K80C 2OXPA 2WB1B 5BN4A 3S17B 5AFWA 2ENBA 3LNNA 4JI1Q 1MKHA 2E5LQ 4C3IG 5CBAE 3QJYA 3MFGA 1V9PA 2A68C 3OMCA 4A3IB 1M1KC 1HNZQ 1XMQQ 2N55A 1Y8NB 3CQZB 4EVOA 2GA4B 3HOUG 2EJMA 1BF4A 4PZ7A 2E8GA 4JI1L 3GQBA 2E5LL 4DK0A 4RAUC 1I94Q 3BYYB 1ML0D 1F9RA 1QUQA 4E6IA 1PH5A 2BDNA 1NAPA 1XMQL 3KDFB 1BCPD 4B3TQ 3RLFA 1EU4A 4ZRZA 5LMNQ 4CDDC 2R93B 2BDOA 4RA8A 2CCZA 4P74A 1AP0A 5EJWA 1I94L 3ER0A 2HUGA 3STBD 3MXPA 3J7AV 4C3HB 3G71A 2HIXA 1V1OA 4OELB 2K5HA 2XWBB 4BXXG 3PIPA 5JPNC 5LMNL 5FLXE 5IT9c 1JJGA 2ZM6L 1JORA 1NR2A 2K14A 2SOBA 2E2HB 3NELA 2ZTDA 2XRSD 3NEMA 4Q0FA 2PNRC 2N78A 4MN3A 1XTDA 4XT3B 5HURA 2LXJA 4QIWB 4H7BA 2JA7H 1TY0A 2ICEC 2KJXA 1Z47A 4OEMB 1CZGA 1H9SB 1XPRA 3UE1A 1YJNA 2DN8A 4CDFC 5G3LD 3HOVG 5HY6A 3AQQA 1I50B 3R8BA 3H3VH 1BOSA 2M2LA 1STBA 2IWHA 1S5BD 2F0UA 3J80c 5C4XH 5DLQE 3S2DH 5E1FA 3CMAA 2EYLA 2A68D 2Q8TA 4OX9L 3FKIB 4NW2A 2A5HA 4BBRB 4R4OA 2R92G 1GUSA 1SXTA 3RLNA 3GTPB 1PTOC 2B2UA 4H0LC 1HQRD 3I73A 3C46A 4A3KH 2F0QA 5K5PA 3WDNA 1CA5A 5C0XH 1PYSB 4GKKQ 2CH4W 2Z6KC 4YCUA 1JJ2A 4NB3A 3AU7A 2ASBA 2JA6H 5KYLA 2VUMH 1X9NA 4ABNA 3Q22A 3BYTB 2MQHA 3EJIA 5M9OA 5ELEA 1HA5A 3CCUA 2Z9HA 4PZ6A 1Y8OB 1I4GA 4K8IA 1HNXQ 1PH7A 3UDGA 1BBUA 1VQJA 1GKHA 1XXGA 3G4SA 2LFNA 5C3EH 4LNQA 1E24A 5LHY1 1DZ1A 2KCTA 4WJ3M 4R9WA 1A15A 1F9PA 5M3FH 3CCRA 2B2TC 4MHEA 1HHVA 4N8FA 1PXUA 3A55A 5K36G 3CMEA 2JA8H 3I7FA 1D5XC 2F0SA 2O5IC 2YYZA 1AZQA 1QCBD 3KOJA 2J4XA 1WTQA 1JJCB 1MSGA 4LUZA 1HZAA 5EPKA 4GNXC 1LABA 2Q2IA 3FP9A 3CKIB 4GLAC 5A2QL 1KIXA 1K83B 1EEID 4ILWA 2A73B 3I4MH 2RVLA 4X3TA 4APVA 2Q8IB 2K7VA 3R93A 3HOUH 1KC8C 4BY7B 4LFCQ 2OTJA 1VQKA 3GTQB 1RDPD 1KABA 1PTOD 3D4RA 4KN4C 4DV0Q 5CV4A 4HIKA 3A54A 4A3EG 2E2DC 5CV5A 3VR4A 1VQMA 1NTGA 1IYJB 4J15A 2R7DA 3KF6B 1VQDA 2UUBQ 1IXRA 3A7LA 4J1MA 1CKNA 3MFYA 4LFCL 4GOPC 1Q46A 3EIVA 2K52A 3E0JA 3JAMi 3DWQA 2CH4A 4A3MH 3P75A 3EBEA 4HSVA 5M5XH 1PFMA 1EY9A 4K6DA 4R4QA 1SNDA 5KYIA 1JT8A 2B63G 3M4OH 1E7ZA 1EFWA 1PRTF 1DM0B 5EKKA 3J80E 3TRZA 2E2JB 1GXDC 1B70B 2L11A 3NHHA 1B4OA 2D5DA 1EQTA 2K5WA 4HAEA 4HMJA 1TWHB 1J6QA 2NZ1D 1A8VA 1F77A 4I65A 4DPGA 3I55A 2KCNA 4TKOB 3DWPA 2SEBD 3SK5A 4A93G 2BH2A 3CCVA 1STEA 3H09A 1XX8A 1PHJA 1EZ8A 4QUCA 3H0GB 1SYEA 3OIPA 1Q90A 2UXCL 2EPBA 2F0FA 4A3GG 4XT1B 2F0NA 1AN8A 3MZ5A 5COYA 5IYCG 1FGUA 2LKVA 2B2WA 4RGTA 3PO3G 4TQUS 1YIJA 2R92H 2JYOA 2SNSA 4XTCS 3K59A 2K1BA 3DM1A 4JOIA 1XNRL 4OWWB 1I5FA 3EFXD 1MJCA 2JP1A 3GTJH 1QJOA 1E2VA 4QF4A 1FR3A 3V05A 2EYJA 2MO0A 4LW1A
chains in the Genus database with same CATH topology
5M3FG 3CCJA 1Z9FA 2C35B 4JI2Q 2KCMA 3PGZA 3F1ZA 1L1OC 1EYGA 1Y1VH 2KENA 4JI8Q 1VQIA 5JEAJ 2PI2A 5IP9G 1Q86C 1JB7A 1HNXL 2UXBL 1N33Q 2JA8G 2AKWB 3BZCA 3U4VA 1NMFA 2N8NA 3HKZG 3Q8DA 4DAMA 4HJ7A 4A76A 3CCMA 1CKNB 4C2MH 1VQCA 3M4PA 4OO1I 5FJ8H 2XTIA 4DK6C 4DR5L 3G48A 2JEAI 4KHPQ 3TS2A 1VQ6A 4AH6A 2XGTA 4NXMQ 2VQFL 3F8TA 1WYDA 3GTGH 4JI2L 3CXCA 4JI8L 2JQOA 2JJQA 1K8GA 3UDIA 5C44H 1YHAA 3KJOA 1E1OA 2VQEQ 1ASZA 4JI0Q 2FXQA 5BR8Q 4BY1H 4GN3B 4C3IH 3CC7A 4UY8C 5GAGC 1FJGQ 2HT1A 1SN8A 3A5ZB 4HJ9A 5AJ3Q 3CC2A 3S1RH 1N36Q 3J7ZC 3FKIH 4KHPL 2YTVA 1UE6A 2Q2HA 3I4MG 1TWAH 4BBRH 1G291 3F2DA 4YY3L 2I5MX 4Y7NH 2NVQH 1L1OB 2EXDA 3H0GH 3HKZE 2PI2E 2F4VQ 4JOIC 1VQHA 2VQEL 3A74A 3T1HQ 2VL6A 5BR8L 5IE8A 1R9TH 2GVBA 4GLVB 5AJ3L 1LTLA 4DR7Q 4OONA 4EQ5A 1SR3A 1N36L 1Y1WG 2CFMA 4DK3C 4LUVA 4P75A 4L5QA 1SMXA 1YI2A 1PH2A 4DV6Q 1EIFA 4UPAA 4GS3A 2HQLA 1QZHA 4BBSH 4DUZQ 4EX5A 3PIOA 1VQNA 3KFUA 3KLWA 3CPFA 2ZM6Q 2JA5H 4B3SQ 3T1HL 1HZ9A 1I3QH 3RR5A 5EAYA 3S15H 4QJFA 4DV0L 4JCVE 2D0OA 2D62A 3HOXG 1SE8A 1Q81C 4DR7L 4A3MG 3RNUA 2JA7G 2YTYA 4DV6L 4A3EH 4LF4L 4BXXH 1IZ6A 3GD7A 5J3BA 1PH1A 5M3MH 2UUBL 3CP0A 4DUZL 3CD6A 2WB1G 3H15A 1C0AA 1VS0A 1HZCA 2NZHA 2A8VA 4QQBX 3TEHB 1XMOQ 3GTOH 4IPHA 4P71A 3W1GA 5LMUQ 4DV1Q 3K81C 3CCSA 1L0WA 2BH8A 3ICEA 2ALYB 3CCLA 3SGIA 3K0XA 1GO3E 2JE6I 4X66Q 1KRTA 3IRBA 4A3IG 1VQPA 5C4XG 3NBHB 2IY5B 2GVAA 5C0XJ 3I4NG 2UUAL 4IJHA 1K0RA 1NE3A 3OW2A 1EUJA 1TWGH 4OX9Q 5IP7H 1I6HH 4DV1L 3W5OA 4QGUA 5LMUL 2DUDA 3BU2A 3CPWA 4JI3Q 1X54A 3WWVA 1VQFA 5ELNA 3HOVH 4JYAQ 3GO5A 2AWOA 3AFQA 1HR0L 2ID0A 1E3PA 4IFDJ 1MJEA 2WB1E 4IPGA 2PQAA 4JBKA 3CW2C 1PH3A 1NY4A 1VCIA 3GTKH 4A3FG 1FVIA 4JV5Q 4A93H 2R93G 2YU9H 1GVPA 1WCMH 4AQYQ 3D0FA 3RZDH 1O7IA 3LGJA 2K50A 4JC0A 3I2ZA 5IWAL 2JK8A 2A1AA 3CAMA 3UE0A 3A5UA 1JE5A 4JI7Q 1A0IA 3GTQH 4K0KL 2KHIA 4JYAL 4NXNQ 1WJJA 3RLOA 3STBC 5C4JH 4YCWA 3MXNB 1OXSC 4DAYB 4HIDA 1P8LA 4DV3Q 3KF6A 1PH4A 4A3GH 3GTMH 3NENA 2MNAA 4LFBQ 3FHWA 4JV5L 2PMZE 5IY0A 2ZJRA 2IX1A 3PF4A 4A75A 4AQYL 3T1YL 2CWAA 5JJIA 2WP8J 3ULPA 4A3BG 4TVAB 4X65Q 2VZAA 4JI5Q 1V43A 5IYCH 1UE1A 1W3SA 4DV2Q 4JI7L 1GD7A 4GLXA 4DR1L 4DR4Q 3PSIA 4IOAA 4JBJA 4GKJQ 1X3GA 2F3IA 1IBLQ 3PO3H 4DV4Q 1YVCA 2ZTEA 3J80i 2YTXA 1Y1VG 1PH9A 1ASYA 1NBWA 5LMNW 1N32L 2F52A 3PUWA 4DV3L 3PO2G 1OTCA 3L2PA 4LFBL 4KHZA 1K3RA 1Q1EA 2NN6I 1EQQA 3HOYG 2E2JH 4JI5L 4LFAL 5FJ8G 3I56A 4DV2L 2Z0SA 4NPSA 3I4OA 1U0LA 4KI0A 4DR4L 1VQOA 4DNIA 1IBLL 2CQOA 1TWHH 1UWVA 3K80C 3E0EA 1N8RC 4RG1A 1E22A 5IP9H 4DUYQ 1YHBA 3K8AA 1N33L 2Y0SG 4JI1Q 4OWTB 4JBWA 1MKHA 3PUXA 5C44G 1N9WA 1EIYB 3ULJA 1X3EA 2E5LQ 4BY1G 1W2BA 1UE5A 1HZBA 4PMWA 2OWOA 4DV5Q 3FKIG 1V9PA 1Q12A 2UUCQ 4A3LH 2IHEA 4YWMA 4NXML 1M1KC 2KBNA 1HNZQ 1XMQQ 3U4ZA 4QIWE 3F2BA 4BBRG 3OYYA 1X56A 1PFSA 3HOUG 4DUYL 4MNOA 1WFQA 2E8GA 2HIVA 4PZ7A 4JI1L 4JI6Q 4JI0L 1FJGL 2E5LL 2CKZB 1I94Q 1QVCA 4P72A 1U5KA 1PVOA 4L5RC 2UU9Q 1QUQA 4DV5L 4HJ5A 5GQOA 2IHFA 2OTLA 1LUZA 1PH5A 2UUCL 1PV4A 2R7ZG 1FL0A 3U50C 1XMQL 1S40A 3KDFB 1YJ9A 1J5EQ 3J7A5 4B3TQ 3RLFA 5LMNQ 2Y0SE 2B29A 2NVYH 5GROA 1TXYA 2F4VL 2CCZA 1QZGA 3U58A 1KHIA 2E2IH 4JI6L 2JA5G 4P74A 1NMGA 3RN2A 1VQ5A 1PH6A 2NZOA 1I94L 3ER0A 1SLJA 3UDFA 3STBD 2UU9L 2Q2UA 1YEZA 2NN6G 4OO1G 1YZ6A 2QEXA 4LF7Q 2OQKA 1KL9A 4O2DA 1OXTA 2HIXA 3DM3A 3G71A 2K5HA 4BXXG 3PIPA 5LMNL 1VQLA 5JJKA 3S1MH 1IBKQ 1H95A 5M3MG 5H1SE 5IT9c 4JBMA 4LF8Q 1JJGA 2ZM6L 2K14A 4B3SL 1TWFH 1PYBA 3NELA 2Z6KA 4A3JH 1MIUA 2ZTDA 4DKAC 3NEMA 2K4KA 2N78A 1PA6A 4LF7L 3M3YH 1XTDA 2QA4A 2NVXH 3AEVA 2LXJA 1YITA 5IYBG 2K75A 2JA7H 1UEBA 5M5YH 1Z47A 1T9HA 2WAQG 3RZOH 1IBKL 2HHHQ 4LF6Q 3S1NH 4IFDI 2B63H 2VY3A 2EQSA 4AYBE 1XPRA 2B3GA 1E1TA 2WFWA 1XMOL 3UE1A 1Q82C 3S24A 5IP7G 1YJNA 4JG2A 4JI4Q 2PNHA 4X66L 3HOVG 5HY6A 3AQQA 1CKMA 3HOZG 1OXVA 3H3VH 4A3CH 3F2CA 4AIMA 4DR2Q 2KHJA 2ZJQA 4A3IH 2QGQA 5C4XH 2RHSB 3J80c 4HJ8A 2UXCQ 5DLQE 2HHHL 4LF6L 3PUZA 1S72A 1GM5A 3I4NH 1XPOA 3S2DH 3CMAA 1KD1C 2LXKA 4OX9L 2V1CC 4BY7G 1EOVA 4JI3L 1B7YB 4DV7Q 3S14H 4JI4L 1YJWA 4R4OA 2R92G 1AH9A 1LM0A 3RLNA 4RMFA 5IYDH 2WAQE 1K8AC 1A63A 4DR2L 5FLMG 5ELOA 4GNXA 4A3DG 2VS1A 4A3KH 3HOWH 2OQ0A 4UP8A 4HIMA 1XNRQ 2LSSA 4A3FH 1PYSB 3PUYA 4GKKQ 2Z6KC 4IPDA 2D0PA 3BZKA 4YCUA 2R93H 3K7AH 1JJ2A 3E9IA 4NB3A 2ASBA 2JA6H 2VUMH 1X9NA 4NXNL 3PF5A 4UP9A 1YHQA 1XNQQ 4L5SA 5GAEC 2MQHA 1BBWA 2ZJPA 3S1QH 3AFPA 2ES2A 2L15A 3CCUA 4C3HH 4PZ6A 1M90C 2UXBQ 5GAHC 1NJIC 1PH7A 3UDGA 1BBUA 1X6OA 1CSQA 2JA9A 1HNXQ 1G6PA 1VQJA 1GKHA 3G4SA 5C3EH 2GN5A 4X65L 3TREA 3W1BA 4XIGS 4LNQA 1E24A 4BA2I 1K73C 2AWNA 4L5TA 2KCTA 4WJ3M 1VQGA 4GKJL 4X64Q 1EWIA 5M3FH 3CCRA 4DV4L 1XNQL 2VQFQ 1IL2A 2OCEA 4MZ9A 4R4TA 1G51A 5K36G 1DGSA 4GN4B 3ULLA 3PUVA 3CMEA 2YV5A 3L0OA 2JA8H 2A19A 2MFIA 3I7FA 3PO2H 1Q1BA 4IO9A 4GOPA 1KAWA 4UP7A 4DR6Q 3HOYH 3S2HH 2YYZA 2VNUD 3KOJA 4A3LG 1SRUA 2R6GA 4X64L 4MTNA 2I5LX 1JJCB 1C7YA 4LUZA 1HJPA 1HZAA 1KXLA 4GNXC 3H0GG 2Q2IA 4YY3Q 1I50H 1OXUA 3FP9A 4A4IA 3J81j 3OTOQ 5JEAG 3S16H 4GLAC 4QY7A 1IBMQ 1VQ9A 1V1QA 1KIXA 1Q8KA 4DR6L 3JAMc 3M9BA 3H3VI 1HNZL 3I4MH 2EIFA 3KF8B 1SROA 3PV0A 4APVA 1B8AA 2H5XA 2PQAB 1D7QA 2AHOB 4BBSG 2IT1A 1HR0W 2ZTCA 3HOUH 1KC8C 3GTPH 3OTOL 2IX0A 3TS0A 4LFCQ 3ERSX 4YWKA 1OXXK 2BA1A 4AYBG 1K9MC 1IBML 1RL2A 4R4CA 3KYHC 1VQKA 4HIOA 2OTJA 2DGYA 4DV0Q 4POFA 1Y1WH 1CSPA 2K5VA 1WI5A 3HFZB 4LUOA 4HIKA 1J5EL 4A3EG 2R7ZH 1UE7A 1BVSA 1VQMA 4B3TL 5E7NA 1EQRA 1NTGA 4ME3A 5HGQA 3ZJYC 4R4IA 1KRSA 4X62Q 1IYJB 3EN2A 4J15A 4LF4Q 1JMCA 3UDXA 4GNXB 5C0XI 2R7DA 1VQDA 1VQAA 1Y14B 1IXRA 3KF6B 2UUBQ 3CC4A 4FDBA 1WOCA 1CKNA 1P16A 4POGA 4LFCL 4IJLA 4A3JG 3MEFA 4GOPC 1AE3A 1Q46A 3EIVA 1N34Q 2K52A 3JAMi 1VQ7A 4Y52H 1RIPA 3HOXH 4PG3A 1LYLA 4A3MH 2JEBI 3EBEA 3J81c 4WJ4A 1BKBA 4B3RQ 2MO1A 5M5XH 4R1JA 2BA0A 3JC66 4LF5Q 2ATWA 4R4QA 4X62L 4LF8L 4QL5A 1JT8A 2B63G 3M4OH 1E7ZA 1EFWA 4LWCA 3KJPA 4H02A 2UUAQ 3S17H 3TRZA 1VQBA 2AMCB 1Q7YC 1B70B 1S3OA 1N34L 4B3MQ 1QVGA 4HJAA 1C9OA 1X65A 3E9HA 2CWPA 4YWLA 1VQ8A 1CKOA 1J6QA 1HNWQ 1A8VA 4B3RL 4A3CG 4DPGA 3I55A 2UXDQ 5FLXc 4LF5L 1L1OA 1YBYA 5IYBH 3K7UC 1HR0Q 1TWCH 2RF4A 3AYHB 3CQZH 3PCOB 4A93G 4BA1I 4C3JH 5GADC 1XJVA 1A62A 1WCMG 4OWXB 4DR3Q 2BH2A 3D31A 3CCVA 3L7ZC 4IPCA 3BJUA 3TQYA 4B3ML 4GOPB 3B6YA 4P73A 1HH2P 4KLKA 3J81i 5IWAQ 1PHJA 2N3SA 4K0KQ 3M7NA 4GN5A 2K5NA 3HKSA 5IYDG 1K83H 3M4QA 1HNWL 3KDFA 1QVFA 3CCEA 3HOZH 2UXCL 1X3FA 2UXDL 2I5HA 3GDEA 3CF5A 2I0QA 4A3GG 4A3KG 3HOWG 1L2FA 4LF9Q 1YNXA 3G6EA 3RN5A 1PH8A 5C0XG 1X55A 3A0JA 1D8LA 4YHHQ 3M85A 4DR3L 4IOCA 4ALPA 1VQEA 2R7FA 4DV7L 3T1YQ 5IYCG 4BY7H 1QUQB 1FGUA 2JA6G 1VQ4A 2VUMG 2NVTH 3PO3G 4TQUS 5JJLA 1YIJA 2R92H 3GTLH 4DR1Q 3CCQA 2VW9A 1CUKA 3VDYA 2Q2TA 3DLLA 4XTCS 2RHQB 5FLMH 4O0AA 1N32Q 4A3DH 4JOIA 1XNRL 4LF9L 4OXPA 2RCNA 4IFDG 4X6AH 4PZ8A 4OWWB 4GKKL 1I5FA 4YCVA 5C3EG 4YHHL 1XPUA 4A3BH 1MJCA 2E2HH 1AE2A 3GTJH 1SFOH 4DR5Q 4LFAQ 1KQSA 2MO0A 4LW1A 2N49A 5M5WH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3F G;  3CCJ A;  1Z9F A;  2C35 B;  4JI2 Q;  2KCM A;  3PGZ A;  3F1Z A;  1L1O C;  1EYG A;  1Y1V H;  2KEN A;  4JI8 Q;  1VQI A;  5JEA J;  2PI2 A;  5IP9 G;  1Q86 C;  1JB7 A;  1HNX L;  2UXB L;  1N33 Q;  2JA8 G;  2AKW B;  3BZC A;  3U4V A;  1NMF A;  2N8N A;  3HKZ G;  3Q8D A;  4DAM A;  4HJ7 A;  4A76 A;  3CCM A;  1CKN B;  4C2M H;  1VQC A;  3M4P A;  4OO1 I;  5FJ8 H;  2XTI A;  4DK6 C;  4DR5 L;  3G48 A;  2JEA I;  4KHP Q;  3TS2 A;  1VQ6 A;  4AH6 A;  2XGT A;  4NXM Q;  2VQF L;  3F8T A;  1WYD A;  3GTG H;  4JI2 L;  3CXC A;  4JI8 L;  2JQO A;  2JJQ A;  1K8G A;  3UDI A;  5C44 H;  1YHA A;  3KJO A;  1E1O A;  2VQE Q;  1ASZ A;  4JI0 Q;  2FXQ A;  5BR8 Q;  4BY1 H;  4GN3 B;  4C3I H;  3CC7 A;  4UY8 C;  5GAG C;  1FJG Q;  2HT1 A;  1SN8 A;  3A5Z B;  4HJ9 A;  5AJ3 Q;  3CC2 A;  3S1R H;  1N36 Q;  3J7Z C;  3FKI H;  4KHP L;  2YTV A;  1UE6 A;  2Q2H A;  3I4M G;  1TWA H;  4BBR H;  1G29 1;  3F2D A;  4YY3 L;  2I5M X;  4Y7N H;  2NVQ H;  1L1O B;  2EXD A;  3H0G H;  3HKZ E;  2PI2 E;  2F4V Q;  4JOI C;  1VQH A;  2VQE L;  3A74 A;  3T1H Q;  2VL6 A;  5BR8 L;  5IE8 A;  1R9T H;  2GVB A;  4GLV B;  5AJ3 L;  1LTL A;  4DR7 Q;  4OON A;  4EQ5 A;  1SR3 A;  1N36 L;  1Y1W G;  2CFM A;  4DK3 C;  4LUV A;  4P75 A;  4L5Q A;  1SMX A;  1YI2 A;  1PH2 A;  4DV6 Q;  1EIF A;  4UPA A;  4GS3 A;  2HQL A;  1QZH A;  4BBS H;  4DUZ Q;  4EX5 A;  3PIO A;  1VQN A;  3KFU A;  3KLW A;  3CPF A;  2ZM6 Q;  2JA5 H;  4B3S Q;  3T1H L;  1HZ9 A;  1I3Q H;  3RR5 A;  5EAY A;  3S15 H;  4QJF A;  4DV0 L;  4JCV E;  2D0O A;  2D62 A;  3HOX G;  1SE8 A;  1Q81 C;  4DR7 L;  4A3M G;  3RNU A;  2JA7 G;  2YTY A;  4DV6 L;  4A3E H;  4LF4 L;  4BXX H;  1IZ6 A;  3GD7 A;  5J3B A;  1PH1 A;  5M3M H;  2UUB L;  3CP0 A;  4DUZ L;  3CD6 A;  2WB1 G;  3H15 A;  1C0A A;  1VS0 A;  1HZC A;  2NZH A;  2A8V A;  4QQB X;  3TEH B;  1XMO Q;  3GTO H;  4IPH A;  4P71 A;  3W1G A;  5LMU Q;  4DV1 Q;  3K81 C;  3CCS A;  1L0W A;  2BH8 A;  3ICE A;  2ALY B;  3CCL A;  3SGI A;  3K0X A;  1GO3 E;  2JE6 I;  4X66 Q;  1KRT A;  3IRB A;  4A3I G;  1VQP A;  5C4X G;  3NBH B;  2IY5 B;  2GVA A;  5C0X J;  3I4N G;  2UUA L;  4IJH A;  1K0R A;  1NE3 A;  3OW2 A;  1EUJ A;  1TWG H;  4OX9 Q;  5IP7 H;  1I6H H;  4DV1 L;  3W5O A;  4QGU A;  5LMU L;  2DUD A;  3BU2 A;  3CPW A;  4JI3 Q;  1X54 A;  3WWV A;  1VQF A;  5ELN A;  3HOV H;  4JYA Q;  3GO5 A;  2AWO A;  3AFQ A;  1HR0 L;  2ID0 A;  1E3P A;  4IFD J;  1MJE A;  2WB1 E;  4IPG A;  2PQA A;  4JBK A;  3CW2 C;  1PH3 A;  1NY4 A;  1VCI A;  3GTK H;  4A3F G;  1FVI A;  4JV5 Q;  4A93 H;  2R93 G;  2YU9 H;  1GVP A;  1WCM H;  4AQY Q;  3D0F A;  3RZD H;  1O7I A;  3LGJ A;  2K50 A;  4JC0 A;  3I2Z A;  5IWA L;  2JK8 A;  2A1A A;  3CAM A;  3UE0 A;  3A5U A;  1JE5 A;  4JI7 Q;  1A0I A;  3GTQ H;  4K0K L;  2KHI A;  4JYA L;  4NXN Q;  1WJJ A;  3RLO A;  3STB C;  5C4J H;  4YCW A;  3MXN B;  1OXS C;  4DAY B;  4HID A;  1P8L A;  4DV3 Q;  3KF6 A;  1PH4 A;  4A3G H;  3GTM H;  3NEN A;  2MNA A;  4LFB Q;  3FHW A;  4JV5 L;  2PMZ E;  5IY0 A;  2ZJR A;  2IX1 A;  3PF4 A;  4A75 A;  4AQY L;  3T1Y L;  2CWA A;  5JJI A;  2WP8 J;  3ULP A;  4A3B G;  4TVA B;  4X65 Q;  2VZA A;  4JI5 Q;  1V43 A;  5IYC H;  1UE1 A;  1W3S A;  4DV2 Q;  4JI7 L;  1GD7 A;  4GLX A;  4DR1 L;  4DR4 Q;  3PSI A;  4IOA A;  4JBJ A;  4GKJ Q;  1X3G A;  2F3I A;  1IBL Q;  3PO3 H;  4DV4 Q;  1YVC A;  2ZTE A;  3J80 i;  2YTX A;  1Y1V G;  1PH9 A;  1ASY A;  1NBW A;  5LMN W;  1N32 L;  2F52 A;  3PUW A;  4DV3 L;  3PO2 G;  1OTC A;  3L2P A;  4LFB L;  4KHZ A;  1K3R A;  1Q1E A;  2NN6 I;  1EQQ A;  3HOY G;  2E2J H;  4JI5 L;  4LFA L;  5FJ8 G;  3I56 A;  4DV2 L;  2Z0S A;  4NPS A;  3I4O A;  1U0L A;  4KI0 A;  4DR4 L;  1VQO A;  4DNI A;  1IBL L;  2CQO A;  1TWH H;  1UWV A;  3K80 C;  3E0E A;  1N8R C;  4RG1 A;  1E22 A;  5IP9 H;  4DUY Q;  1YHB A;  3K8A A;  1N33 L;  2Y0S G;  4JI1 Q;  4OWT B;  4JBW A;  1MKH A;  3PUX A;  5C44 G;  1N9W A;  1EIY B;  3ULJ A;  1X3E A;  2E5L Q;  4BY1 G;  1W2B A;  1UE5 A;  1HZB A;  4PMW A;  2OWO A;  4DV5 Q;  3FKI G;  1V9P A;  1Q12 A;  2UUC Q;  4A3L H;  2IHE A;  4YWM A;  4NXM L;  1M1K C;  2KBN A;  1HNZ Q;  1XMQ Q;  3U4Z A;  4QIW E;  3F2B A;  4BBR G;  3OYY A;  1X56 A;  1PFS A;  3HOU G;  4DUY L;  4MNO A;  1WFQ A;  2E8G A;  2HIV A;  4PZ7 A;  4JI1 L;  4JI6 Q;  4JI0 L;  1FJG L;  2E5L L;  2CKZ B;  1I94 Q;  1QVC A;  4P72 A;  1U5K A;  1PVO A;  4L5R C;  2UU9 Q;  1QUQ A;  4DV5 L;  4HJ5 A;  5GQO A;  2IHF A;  2OTL A;  1LUZ A;  1PH5 A;  2UUC L;  1PV4 A;  2R7Z G;  1FL0 A;  3U50 C;  1XMQ L;  1S40 A;  3KDF B;  1YJ9 A;  1J5E Q;  3J7A 5;  4B3T Q;  3RLF A;  5LMN Q;  2Y0S E;  2B29 A;  2NVY H;  5GRO A;  1TXY A;  2F4V L;  2CCZ A;  1QZG A;  3U58 A;  1KHI A;  2E2I H;  4JI6 L;  2JA5 G;  4P74 A;  1NMG A;  3RN2 A;  1VQ5 A;  1PH6 A;  2NZO A;  1I94 L;  3ER0 A;  1SLJ A;  3UDF A;  3STB D;  2UU9 L;  2Q2U A;  1YEZ A;  2NN6 G;  4OO1 G;  1YZ6 A;  2QEX A;  4LF7 Q;  2OQK A;  1KL9 A;  4O2D A;  1OXT A;  2HIX A;  3DM3 A;  3G71 A;  2K5H A;  4BXX G;  3PIP A;  5LMN L;  1VQL A;  5JJK A;  3S1M H;  1IBK Q;  1H95 A;  5M3M G;  5H1S E;  5IT9 c;  4JBM A;  4LF8 Q;  1JJG A;  2ZM6 L;  2K14 A;  4B3S L;  1TWF H;  1PYB A;  3NEL A;  2Z6K A;  4A3J H;  1MIU A;  2ZTD A;  4DKA C;  3NEM A;  2K4K A;  2N78 A;  1PA6 A;  4LF7 L;  3M3Y H;  1XTD A;  2QA4 A;  2NVX H;  3AEV A;  2LXJ A;  1YIT A;  5IYB G;  2K75 A;  2JA7 H;  1UEB A;  5M5Y H;  1Z47 A;  1T9H A;  2WAQ G;  3RZO H;  1IBK L;  2HHH Q;  4LF6 Q;  3S1N H;  4IFD I;  2B63 H;  2VY3 A;  2EQS A;  4AYB E;  1XPR A;  2B3G A;  1E1T A;  2WFW A;  1XMO L;  3UE1 A;  1Q82 C;  3S24 A;  5IP7 G;  1YJN A;  4JG2 A;  4JI4 Q;  2PNH A;  4X66 L;  3HOV G;  5HY6 A;  3AQQ A;  1CKM A;  3HOZ G;  1OXV A;  3H3V H;  4A3C H;  3F2C A;  4AIM A;  4DR2 Q;  2KHJ A;  2ZJQ A;  4A3I H;  2QGQ A;  5C4X H;  2RHS B;  3J80 c;  4HJ8 A;  2UXC Q;  5DLQ E;  2HHH L;  4LF6 L;  3PUZ A;  1S72 A;  1GM5 A;  3I4N H;  1XPO A;  3S2D H;  3CMA A;  1KD1 C;  2LXK A;  4OX9 L;  2V1C C;  4BY7 G;  1EOV A;  4JI3 L;  1B7Y B;  4DV7 Q;  3S14 H;  4JI4 L;  1YJW A;  4R4O A;  2R92 G;  1AH9 A;  1LM0 A;  3RLN A;  4RMF A;  5IYD H;  2WAQ E;  1K8A C;  1A63 A;  4DR2 L;  5FLM G;  5ELO A;  4GNX A;  4A3D G;  2VS1 A;  4A3K H;  3HOW H;  2OQ0 A;  4UP8 A;  4HIM A;  1XNR Q;  2LSS A;  4A3F H;  1PYS B;  3PUY A;  4GKK Q;  2Z6K C;  4IPD A;  2D0P A;  3BZK A;  4YCU A;  2R93 H;  3K7A H;  1JJ2 A;  3E9I A;  4NB3 A;  2ASB A;  2JA6 H;  2VUM H;  1X9N A;  4NXN L;  3PF5 A;  4UP9 A;  1YHQ A;  1XNQ Q;  4L5S A;  5GAE C;  2MQH A;  1BBW A;  2ZJP A;  3S1Q H;  3AFP A;  2ES2 A;  2L15 A;  3CCU A;  4C3H H;  4PZ6 A;  1M90 C;  2UXB Q;  5GAH C;  1NJI C;  1PH7 A;  3UDG A;  1BBU A;  1X6O A;  1CSQ A;  2JA9 A;  1HNX Q;  1G6P A;  1VQJ A;  1GKH A;  3G4S A;  5C3E H;  2GN5 A;  4X65 L;  3TRE A;  3W1B A;  4XIG S;  4LNQ A;  1E24 A;  4BA2 I;  1K73 C;  2AWN A;  4L5T A;  2KCT A;  4WJ3 M;  1VQG A;  4GKJ L;  4X64 Q;  1EWI A;  5M3F H;  3CCR A;  4DV4 L;  1XNQ L;  2VQF Q;  1IL2 A;  2OCE A;  4MZ9 A;  4R4T A;  1G51 A;  5K36 G;  1DGS A;  4GN4 B;  3ULL A;  3PUV A;  3CME A;  2YV5 A;  3L0O A;  2JA8 H;  2A19 A;  2MFI A;  3I7F A;  3PO2 H;  1Q1B A;  4IO9 A;  4GOP A;  1KAW A;  4UP7 A;  4DR6 Q;  3HOY H;  3S2H H;  2YYZ A;  2VNU D;  3KOJ A;  4A3L G;  1SRU A;  2R6G A;  4X64 L;  4MTN A;  2I5L X;  1JJC B;  1C7Y A;  4LUZ A;  1HJP A;  1HZA A;  1KXL A;  4GNX C;  3H0G G;  2Q2I A;  4YY3 Q;  1I50 H;  1OXU A;  3FP9 A;  4A4I A;  3J81 j;  3OTO Q;  5JEA G;  3S16 H;  4GLA C;  4QY7 A;  1IBM Q;  1VQ9 A;  1V1Q A;  1KIX A;  1Q8K A;  4DR6 L;  3JAM c;  3M9B A;  3H3V I;  1HNZ L;  3I4M H;  2EIF A;  3KF8 B;  1SRO A;  3PV0 A;  4APV A;  1B8A A;  2H5X A;  2PQA B;  1D7Q A;  2AHO B;  4BBS G;  2IT1 A;  1HR0 W;  2ZTC A;  3HOU H;  1KC8 C;  3GTP H;  3OTO L;  2IX0 A;  3TS0 A;  4LFC Q;  3ERS X;  4YWK A;  1OXX K;  2BA1 A;  4AYB G;  1K9M C;  1IBM L;  1RL2 A;  4R4C A;  3KYH C;  1VQK A;  4HIO A;  2OTJ A;  2DGY A;  4DV0 Q;  4POF A;  1Y1W H;  1CSP A;  2K5V A;  1WI5 A;  3HFZ B;  4LUO A;  4HIK A;  1J5E L;  4A3E G;  2R7Z H;  1UE7 A;  1BVS A;  1VQM A;  4B3T L;  5E7N A;  1EQR A;  1NTG A;  4ME3 A;  5HGQ A;  3ZJY C;  4R4I A;  1KRS A;  4X62 Q;  1IYJ B;  3EN2 A;  4J15 A;  4LF4 Q;  1JMC A;  3UDX A;  4GNX B;  5C0X I;  2R7D A;  1VQD A;  1VQA A;  1Y14 B;  1IXR A;  3KF6 B;  2UUB Q;  3CC4 A;  4FDB A;  1WOC A;  1CKN A;  1P16 A;  4POG A;  4LFC L;  4IJL A;  4A3J G;  3MEF A;  4GOP C;  1AE3 A;  1Q46 A;  3EIV A;  1N34 Q;  2K52 A;  3JAM i;  1VQ7 A;  4Y52 H;  1RIP A;  3HOX H;  4PG3 A;  1LYL A;  4A3M H;  2JEB I;  3EBE A;  3J81 c;  4WJ4 A;  1BKB A;  4B3R Q;  2MO1 A;  5M5X H;  4R1J A;  2BA0 A;  3JC6 6;  4LF5 Q;  2ATW A;  4R4Q A;  4X62 L;  4LF8 L;  4QL5 A;  1JT8 A;  2B63 G;  3M4O H;  1E7Z A;  1EFW A;  4LWC A;  3KJP A;  4H02 A;  2UUA Q;  3S17 H;  3TRZ A;  1VQB A;  2AMC B;  1Q7Y C;  1B70 B;  1S3O A;  1N34 L;  4B3M Q;  1QVG A;  4HJA A;  1C9O A;  1X65 A;  3E9H A;  2CWP A;  4YWL A;  1VQ8 A;  1CKO A;  1J6Q A;  1HNW Q;  1A8V A;  4B3R L;  4A3C G;  4DPG A;  3I55 A;  2UXD Q;  5FLX c;  4LF5 L;  1L1O A;  1YBY A;  5IYB H;  3K7U C;  1HR0 Q;  1TWC H;  2RF4 A;  3AYH B;  3CQZ H;  3PCO B;  4A93 G;  4BA1 I;  4C3J H;  5GAD C;  1XJV A;  1A62 A;  1WCM G;  4OWX B;  4DR3 Q;  2BH2 A;  3D31 A;  3CCV A;  3L7Z C;  4IPC A;  3BJU A;  3TQY A;  4B3M L;  4GOP B;  3B6Y A;  4P73 A;  1HH2 P;  4KLK A;  3J81 i;  5IWA Q;  1PHJ A;  2N3S A;  4K0K Q;  3M7N A;  4GN5 A;  2K5N A;  3HKS A;  5IYD G;  1K83 H;  3M4Q A;  1HNW L;  3KDF A;  1QVF A;  3CCE A;  3HOZ H;  2UXC L;  1X3F A;  2UXD L;  2I5H A;  3GDE A;  3CF5 A;  2I0Q A;  4A3G G;  4A3K G;  3HOW G;  1L2F A;  4LF9 Q;  1YNX A;  3G6E A;  3RN5 A;  1PH8 A;  5C0X G;  1X55 A;  3A0J A;  1D8L A;  4YHH Q;  3M85 A;  4DR3 L;  4IOC A;  4ALP A;  1VQE A;  2R7F A;  4DV7 L;  3T1Y Q;  5IYC G;  4BY7 H;  1QUQ B;  1FGU A;  2JA6 G;  1VQ4 A;  2VUM G;  2NVT H;  3PO3 G;  4TQU S;  5JJL A;  1YIJ A;  2R92 H;  3GTL H;  4DR1 Q;  3CCQ A;  2VW9 A;  1CUK A;  3VDY A;  2Q2T A;  3DLL A;  4XTC S;  2RHQ B;  5FLM H;  4O0A A;  1N32 Q;  4A3D H;  4JOI A;  1XNR L;  4LF9 L;  4OXP A;  2RCN A;  4IFD G;  4X6A H;  4PZ8 A;  4OWW B;  4GKK L;  1I5F A;  4YCV A;  5C3E G;  4YHH L;  1XPU A;  4A3B H;  1MJC A;  2E2H H;  1AE2 A;  3GTJ H;  1SFO H;  4DR5 Q;  4LFA Q;  1KQS A;  2MO0 A;  4LW1 A;  2N49 A;  5M5W H; 
#chains in the Genus database with same CATH topology
 5BN3 A;  1Z9F A;  4RKB A;  3GTM H;  1STN A;  5JEA J;  3QG1 A;  1L0Y B;  4DGZ A;  2NB0 A;  1EY5 A;  2EY5 A;  3WOF A;  4A3J B;  1NMF A;  2NTS A;  3Q8D A;  4HJ7 A;  3W3A A;  3M7G A;  4OO1 I;  2K04 A;  5LL6 S;  2JEA I;  3TS2 A;  1VQ6 A;  5M5Y B;  4J6H A;  3S1N B;  3F8T A;  1LTS D;  3PMF A;  1FNW A;  5K36 H;  2JQO A;  1K8G A;  5C44 H;  1I4H A;  2VQE Q;  1E1O A;  2FXQ A;  1G91 A;  1N36 Q;  4CGY B;  4DAY A;  1PZI D;  1EY7 A;  2NVQ H;  1L1O B;  4FXG C;  1X3Q A;  2F4V Q;  2KEE A;  2VQE L;  1JWS D;  4M8A A;  5ELF A;  1R9T H;  4GLV B;  1NCV A;  1N36 L;  4EQ5 A;  2CFM A;  1YI2 A;  1PH2 A;  2XSC A;  4OIJ A;  1PRT C;  4KKS A;  4N8X 1;  2HQL A;  2JSO A;  1Q3L A;  1VQN A;  2JA5 H;  1V1P B;  1I3Q H;  4ZUI A;  3RR5 A;  4QJF A;  4M1U B;  3MVV A;  1JE4 A;  4LK1 C;  3S1Q B;  1SE2 A;  3NQI A;  1LT3 D;  4A3E H;  3GD7 A;  1G2S A;  5M3M H;  3CD6 A;  2WB1 G;  4K8J A;  1C0A A;  2CW0 C;  3TP8 A;  1HZC A;  3DHQ A;  3MHB A;  4L8J A;  1TII D;  4P71 A;  3W1G A;  5CBE E;  3K81 C;  5D14 A;  3ICE A;  2ALY B;  3CCL A;  1TKW B;  3K0X A;  4A3I G;  1DOM A;  1VQP A;  3NBH B;  1CT1 D;  2GVA A;  3TZD A;  5C0X J;  3HKZ B;  1TS3 A;  3NWS A;  1K0R A;  2Z6B A;  2R61 A;  5IP7 H;  4FVM A;  2DUD A;  3SEB A;  4BS9 A;  4KKT A;  1LT6 D;  3WWV A;  4LMQ D;  5ELN A;  3E3X A;  4IUN A;  4JYA Q;  2EYM A;  3VYS A;  1KTK A;  4RGN A;  5D3I B;  5I9O A;  4JBK A;  1D5M C;  1VCI A;  4JV5 Q;  4A93 H;  2R93 G;  3BG3 A;  3MEH A;  3D0F A;  2F0V A;  2K50 A;  4ZQ3 A;  5IWA L;  2A1A A;  3UE0 A;  1A0I A;  4QMG A;  3TP5 A;  2SDF A;  1AFP A;  4JYA L;  5TSS A;  1Y8P B;  4C3H G;  5C4J H;  3MXN B;  2E74 C;  5L37 A;  4A3G H;  3EA6 A;  4JV5 L;  2PMZ E;  5IY0 A;  3PF4 A;  2CWA A;  2WP8 J;  1RKN A;  1DON A;  1W6J A;  2VZA A;  3A8K E;  4JI5 Q;  1PRT D;  1W3S A;  5IYC H;  4KKU A;  4DV2 Q;  1CFM A;  4GKJ Q;  3PO3 H;  3KBG A;  3J80 i;  1N32 L;  1EY0 A;  1OTC A;  2M9V A;  1K3R A;  1F2Z A;  1NR4 A;  4JI5 L;  4LFA L;  5FJ8 G;  1B9N A;  1ENF A;  4DV2 L;  4NPS A;  1U0L A;  1TS5 A;  2CQO A;  4KD3 A;  2CW0 D;  3E0E A;  1N8R C;  1U4L A;  3K8A A;  4RWS C;  3OW7 A;  3ULJ A;  2B2V C;  1LTR D;  2FFK B;  1UE5 A;  3GV3 A;  2G9D A;  3OWF A;  2B2W C;  3VYU A;  3FKI G;  5FK9 C;  4A3L H;  4NXM L;  2KBN A;  1KNE A;  4BBR G;  1IW7 C;  2AUJ D;  2FJ2 A;  1PFS A;  4MNO A;  2HIV A;  5EKL A;  4P72 A;  2F1M A;  4U67 3;  4L5R C;  1MD2 D;  2OTL A;  1LUZ A;  2WKC A;  1PV4 A;  1D1K A;  2RA4 A;  5IOD A;  1S40 A;  1YJ9 A;  3J81 E;  4A3F B;  4JPB W;  3U58 A;  1VQ5 A;  1B50 A;  4FF1 A;  1AW7 A;  1SLJ A;  3UDF A;  2Q2U A;  4OO1 G;  1SDF A;  2QEX A;  4LF7 Q;  4V0B A;  3DM3 A;  4RCN A;  3S1M H;  1IBK Q;  3NUC A;  1PYB A;  2K01 A;  2Z6K A;  1B1Z A;  4KN7 C;  2EJG C;  4R8N A;  2H1E A;  1EIH A;  1ILQ A;  4R8I A;  2K4K A;  2EYF A;  4F87 A;  4LF7 L;  1RTN A;  1KDB A;  2PW7 A;  3CU7 A;  2L9H A;  2EY6 A;  3NXW A;  1HFN A;  3RZO H;  1IBK L;  4LF6 Q;  4IFD I;  1SBB B;  1TS4 A;  2VY3 A;  3HOY B;  2B3G A;  5FO9 B;  1XMO L;  2OF1 A;  2E75 C;  4JG2 A;  1SNC A;  1U4R A;  4KMU C;  4X66 L;  3SK4 A;  4A3C H;  2KHJ A;  2Y0S B;  4A3I H;  4ULL A;  4LF6 L;  4BY1 B;  1XPO A;  1KD1 C;  3S1R B;  5J1Z A;  2V1C C;  3C1F A;  3M4Y A;  4F7X A;  4BY7 G;  4F8M A;  1B7Y B;  3S14 H;  1IW7 D;  1TWA B;  3OPO A;  5IYD H;  4C56 C;  1JWU D;  2I07 B;  4J8Q A;  4Y7N B;  2KOL A;  3ZYY X;  3FDT A;  1A63 A;  4GNX A;  1I4X A;  2VS1 A;  3HOW H;  2MPM A;  4MTK A;  3MXU A;  3X3M A;  4UP8 A;  4PNY A;  4HIM A;  4WFN 3;  2LSS A;  2F0K A;  1UAP A;  5A35 A;  2R93 H;  4IPD A;  2D0P A;  2R7Z B;  3SR1 A;  2A6E C;  4X3K A;  3WOE A;  2A74 C;  4NXN L;  1XNQ Q;  2XVS A;  3MWY W;  4IAL A;  4C3H H;  3L9A X;  1M90 C;  2UXB Q;  1G6Z A;  1NJI C;  1AEX A;  2JA9 A;  1G6P A;  3BVG A;  1PYW D;  1A2U A;  3TRE A;  1WTV A;  1VMP A;  4L5T A;  3G6J B;  3I3C A;  2EY1 A;  4X64 Q;  1EWI A;  4FF4 A;  1XNQ L;  2PZU A;  3BZD B;  2VQF Q;  1G51 A;  1R4P B;  4GN4 B;  1STY A;  1WTH A;  3PUV A;  1II3 A;  2YV5 A;  2MFI A;  4IUV A;  4GOP A;  3Q23 A;  3S2H H;  2VNU D;  1DXM A;  2BE5 D;  2DY8 A;  2FMC A;  2R6G A;  4X64 L;  2WAQ B;  4MTN A;  4C3J B;  4XQJ A;  1HJP A;  2A6H C;  3H0G G;  1U4P A;  4YY3 Q;  1I50 H;  1OXU A;  4A4I A;  3J81 j;  2L55 A;  4G57 A;  1I6H B;  1RHP A;  4QY7 A;  1PDQ A;  3HOZ B;  3M9B A;  3BDL A;  3OWE B;  1HNZ L;  3T13 A;  4CKB A;  2H5X A;  3QWN A;  4NP5 A;  2PQA B;  3GTK B;  1D7Q A;  1HR0 W;  2ZTC A;  3GTP H;  2IX0 A;  3Q24 A;  3TS0 A;  5NUC A;  1EU3 A;  2PQE A;  3VR2 A;  2LMC B;  2BA1 A;  1RL2 A;  4R4C A;  4ZYS A;  3GTL B;  4HIO A;  1Y1W H;  2F0H A;  4K14 A;  2K5V A;  3HFZ B;  2F0D A;  1S5E D;  4B3T L;  4A3D B;  4ME3 A;  1KDA A;  4LF4 Q;  2A6E D;  1SFO B;  1LV9 A;  1WOC A;  3VR3 A;  4IJL A;  3NE5 B;  5IOC A;  4A3J G;  1AE3 A;  1VQ7 A;  3HOX H;  2F0L A;  4L6T B;  4OO1 H;  4B3R Q;  2MO1 A;  3L3O C;  2BA0 A;  4YIJ A;  1EQV A;  4O1N A;  5IIF A;  1FD7 D;  2L12 A;  4QL5 A;  4C2M B;  4LWC A;  1S5D D;  3TP6 A;  1R4Q B;  2AMC B;  4B3M Q;  1EL0 A;  1QVG A;  1GUN A;  3UI2 A;  1B2T A;  2F0M A;  1X65 A;  3I90 A;  1M4V A;  1CKO A;  4B3R L;  2UXD Q;  1TWC H;  2C9O A;  1HTL D;  4XQQ A;  1A62 A;  4OWX B;  1GUG A;  1SNP A;  4IPC A;  1JB3 A;  4B3M L;  3B6Y A;  1TY2 A;  1HH2 P;  1LTB D;  3PQI A;  3J81 i;  1PZJ D;  3M7N A;  1RD9 D;  2K5N A;  1T5E A;  1K83 H;  5DM7 3;  3KDF A;  4B9W A;  3CCE A;  2UXD L;  3GDE A;  3CF5 A;  5KNC A;  3C3L A;  4LF9 Q;  4HED A;  3V96 A;  3RN5 A;  1PH8 A;  3NK9 A;  5ELC A;  5KND A;  1X55 A;  4KK7 A;  4IOC A;  4BY7 H;  3OMG A;  3RD4 A;  4K6L A;  3FVQ A;  4DR1 Q;  1HA6 A;  3VDY A;  1TQO A;  2Q2T A;  4DXG A;  2F0I A;  3P20 A;  5F2D A;  2FMM A;  4LF9 L;  4OXP A;  3S15 B;  4IFD G;  4AYB B;  4PZ8 A;  4GKK L;  4YCV A;  1XPU A;  4A3B H;  5FKA C;  1AE2 A;  3X3N A;  4Z9C B;  4DR5 Q;  1WTW A;  1MBY A;  1H9M A;  1Q12 A;  1EY8 A;  1A3V A;  3HEJ A;  4QUF A;  5EKI A;  4DN4 M;  1EYG A;  1HCZ A;  1Y1V H;  4JI8 Q;  1PFB A;  2CHB D;  4PV1 C;  1Q86 C;  1FYC A;  1HNX L;  2PCF B;  1N33 Q;  2AKW B;  3BZC A;  3QR8 A;  4ZKB B;  2N8N A;  3HKZ G;  4DAM A;  1CKN B;  1SNO A;  1MHW C;  1VQC A;  2AQ3 B;  2TSS A;  4DK6 C;  4DR5 L;  1D5Z C;  3G48 A;  4KHP Q;  2JXM B;  3AB9 A;  2XGT A;  1WYD A;  2HDL A;  1QE6 A;  4JI8 L;  1TWG B;  4CJ2 C;  1EOT A;  4I7A A;  3KJO A;  1ASZ A;  4JI0 Q;  4GN3 B;  4C3I H;  3CC7 A;  4UY8 C;  3A5Z B;  4HJ9 A;  5AJ3 Q;  4H13 C;  1MGS A;  1VDZ A;  4DAV A;  3EQL C;  4KHP L;  1UE6 A;  1HRJ A;  3FPP A;  1G29 1;  4LAA A;  4XDX A;  2I5M X;  3S2D B;  1WCM B;  2IL8 A;  3H0G H;  2PI2 E;  2QEJ C;  1JOQ A;  1GUW A;  2B39 A;  2CQA A;  5IT9 E;  3SDZ A;  5IE8 A;  5AJ3 L;  4OON A;  5J39 A;  1VMC A;  3SXH A;  1BR9 A;  1MI2 A;  4DV6 Q;  3C1E A;  1EIF A;  4O42 A;  2NWG A;  1QZH A;  4RH6 A;  4I7Z C;  4B3S Q;  1HZ9 A;  3DUZ A;  1I4P A;  2JA6 B;  4DV0 L;  4IUP A;  2D0O A;  2WAC A;  4JCV E;  1SE8 A;  2AQ2 B;  2Z4I A;  1I6V C;  4DV6 L;  4DNT B;  4BXX H;  3C2P A;  3D8G A;  2I46 A;  1U9R A;  1LT4 D;  4EGV A;  1PH1 A;  2UUB L;  3QO2 A;  2WV6 D;  1TS2 A;  3H15 A;  2A8V A;  5I6Y A;  2MP1 A;  5COR A;  5M3F B;  1BXT A;  5IGF A;  2IW3 A;  1CM9 A;  4HR7 B;  5I4D A;  2JA8 B;  1FNV A;  2IY5 B;  2PPB C;  1NE3 A;  3JAM L;  3OW2 A;  1EUJ A;  2O5J C;  4RHR A;  4H44 C;  5CYU A;  3HRZ C;  4JI3 Q;  5E3F A;  2QDL A;  1X54 A;  4IUQ A;  1VQF A;  3U9S A;  3HOV H;  3GO5 A;  2ID0 A;  1E3P A;  2WB1 E;  4IPG A;  1RJT A;  4S3S A;  1TR5 A;  2MUY A;  4A3F G;  1FVI A;  2B2V A;  4AQY Q;  1JCK B;  2EOT A;  3RZD H;  2PZT A;  1O7I A;  3I4M B;  2DNC A;  2JK8 A;  1D1I A;  1ZXT A;  3CAM A;  3FMC A;  4JI7 Q;  2NVY B;  3RLO A;  3NSW A;  2E2I B;  5C3X A;  1OXS C;  1IKM A;  4DAY B;  4HID A;  4DV3 Q;  3KF6 A;  3QOJ A;  3D6C A;  3NEN A;  4LFB Q;  3S9W A;  2ZJR A;  4AQY L;  4X65 Q;  1IYV A;  4JI7 L;  4DR4 Q;  1ENC A;  4DV4 Q;  1TWF B;  1WTX A;  2YTX A;  1NBW A;  1A3U A;  2RSO A;  4CKC A;  4DV3 L;  4UDU C;  4NDX A;  4LFB L;  4IFD H;  1BCP B;  2EY2 A;  1U4M A;  4A3M B;  3HOY G;  1LO5 D;  1W6K A;  5FLX L;  2EYP A;  4KI0 A;  3SK8 A;  2EZV A;  4DR4 L;  3QIA A;  1UWV A;  3N6R A;  3M4O B;  1YHB A;  2Y0S G;  4OWT B;  4JBW A;  1FJG Q;  1BO0 A;  1ICF B;  4BY1 G;  1GHJ A;  1H9J A;  3A8J E;  4PMW A;  2OWO A;  3RUZ A;  4DV5 Q;  3LWE A;  2UUC Q;  2IHE A;  3NQT A;  4QIW E;  3I4N B;  1X56 A;  2F0W A;  3MXG A;  1FJG L;  2H4O A;  2F3W A;  1ET6 A;  1PVO A;  4MIU A;  4DV5 L;  4HJ5 A;  5GQO A;  2R7Z G;  2UUC L;  1FL0 A;  3DXJ C;  2DNE A;  3U50 C;  1J5E Q;  3J7A 5;  2B29 A;  5GRO A;  1TXY A;  2F4V L;  1QZG A;  1O78 A;  1S5F D;  1NMG A;  3RN2 A;  1X32 A;  4FP5 D;  4K5X A;  2K5Q A;  2NN6 G;  4PMB A;  3D3R A;  3OIQ A;  1VQL A;  1H95 A;  4B08 A;  2NYZ D;  5H1S E;  4LF8 Q;  2K5D A;  2RSN A;  4IQZ A;  1F9S A;  1UNS A;  4K2L A;  4DK1 A;  1UEA B;  2EYO A;  4DKA C;  5JJZ A;  4JVZ A;  1WVL A;  1PA6 A;  3I70 A;  3M3Y H;  2NVX H;  3AEV A;  2CVR A;  5IYB G;  1UEB A;  3PO2 B;  2WAQ G;  1QNU A;  4C3J G;  2B63 H;  2EQS A;  4AYB E;  1SJE D;  1E1T A;  1WD0 A;  2VXW A;  3S24 A;  3IKJ A;  1GJX A;  1B3Q A;  3KF8 A;  3HOZ G;  1OXV A;  3F2C A;  3TP7 A;  2XNA C;  4DR2 Q;  2QGQ A;  2RHS B;  4HJ8 A;  3S16 B;  4XYQ A;  1S72 A;  4NMZ A;  2LS0 1;  1EOV A;  4DV7 Q;  1YJW A;  4JW0 A;  1XTC D;  1AH9 A;  4RMF A;  1G2T A;  2L4N A;  1K8A C;  4DR2 L;  5FLM G;  5ELO A;  4A3D G;  2OQ0 A;  1R9T B;  4A3F H;  1H9K A;  1V1P A;  4WJW A;  2O4X A;  3K7A H;  5CMD A;  4G7Z C;  4ZCK A;  3PF5 A;  1HQM C;  2PZW A;  4UP9 A;  1YHQ A;  4L5S A;  1BBW A;  4HTH A;  1QOH A;  2ES2 A;  2L15 A;  1I3Q B;  3MTS A;  3VA5 A;  3W1B A;  1CQV A;  4XIG S;  1VQG A;  4GKJ L;  1C8C A;  5M3M B;  1IL2 A;  3NBH A;  4MZ9 A;  1ILP A;  2JN4 A;  1PTO B;  3NBI A;  3ONA B;  2NUC A;  2A19 A;  5BN5 A;  1Q1B A;  1FGB D;  1JQY D;  4C1N I;  1SNQ A;  4UP7 A;  1HXY D;  3HOY H;  2QF7 A;  1O7Z A;  4RGM A;  1T5X D;  3IAY A;  1NSN S;  2I5L X;  1KXL A;  3FEW X;  4BWG B;  3LX0 A;  3OTO Q;  2QIL A;  2B2Y C;  3H6M A;  5JEA G;  4FYD A;  3D4W A;  1VQ9 A;  2DJF C;  4DA2 A;  5T1G A;  1Q8K A;  2F3V A;  3JAM c;  2KVM A;  3K6O A;  2EIF A;  3A56 A;  1HPC A;  4FNF A;  1F2L A;  3IL8 A;  3MXN A;  4RFB A;  3VR5 A;  2IT1 A;  4B9X A;  3OTO L;  1QIL A;  2AQ1 B;  3ERS X;  2NVT B;  4IN3 A;  5ELD A;  1OXX K;  5G3L F;  4AYB G;  3KYH C;  1HFG A;  4KV6 A;  4POF A;  5T1I A;  5ELB A;  5C4H A;  1Y69 U;  1WI5 A;  4LUO A;  2R7Z H;  3BVM A;  1LAC A;  1UE7 A;  1BVS A;  1KLU D;  5I9P A;  2ICI A;  4R4I A;  4X62 Q;  4GNX B;  2PO4 A;  1VQA A;  1Y14 B;  4F88 A;  2EYH A;  2K6A A;  4POG A;  3ND8 A;  1N34 Q;  5M5W B;  5DNF A;  1RIP A;  1SYG A;  2RQX A;  3V2T A;  2JEB I;  2A69 C;  4XQN A;  4R1J A;  1EZ6 A;  4LF5 Q;  2ATW A;  3K5O A;  4X62 L;  2RCF A;  2HDM A;  1HTP A;  3OSO A;  2UUA Q;  3S17 H;  3KLS A;  1Q7Y C;  1S3O A;  1N34 L;  1BUV T;  4OGQ C;  4HJA A;  1C9O A;  3GTG B;  2CWP A;  5CV8 A;  4RGO S;  2WIN B;  1HNW Q;  4CJ0 B;  5A2Q E;  2F0P A;  1RTO A;  3OHX C;  1YBY A;  5FLX c;  5IYB H;  3K7U C;  1HR0 Q;  2RF4 A;  4LF5 L;  3CQZ H;  4WRD A;  4BA1 I;  4C3J H;  5GAD C;  1XJV A;  1WCM G;  4TSS A;  4DR3 Q;  3D31 A;  3L7Z C;  3BJU A;  4G7H C;  2F0E A;  1ZKO A;  4GOP B;  4X3S A;  1QB5 D;  3H91 A;  3GP7 A;  4K0K Q;  3TSS A;  1SYF A;  1H9R A;  1HNW L;  1QVF A;  3HOZ H;  2I5H A;  3MC0 B;  2I0Q A;  4A3K G;  5KNB A;  1LTA D;  1JWM D;  5C0X G;  2K28 A;  4DR3 L;  1D8L A;  2HCI A;  3M85 A;  1SAP A;  4ALP A;  1KDC A;  3T1Y Q;  1O7Y A;  1QUQ B;  2JA6 G;  4HSP A;  1VQ4 A;  2VUM G;  5JJL A;  3GTL H;  4BBS B;  3CCQ A;  2VW9 A;  5KIX A;  4ID6 A;  2NBF A;  4CHT B;  2RHQ B;  5FLM H;  4A3D H;  2RCN A;  3SK6 A;  5C3E G;  2E2H H;  1SFO H;  4FO2 A;  2F0O A;  2N49 A;  3S1M B;  3NTK A;  5M3F G;  4DU9 A;  2O2L D;  3HP3 A;  2KCM A;  3F1Z A;  1L1O C;  1F9Q A;  5IP9 G;  2UXB L;  2PI2 A;  3MAQ A;  2JA8 G;  3GTO B;  1CHP D;  3U4V A;  4A76 A;  4IZ8 A;  4BA2 I;  2A69 D;  3CCM A;  2J7Z A;  5J22 A;  4C2M H;  4DFA A;  4IUT A;  3M4P A;  3G7L A;  2XTI A;  3DWA A;  1QNK A;  5FJ8 H;  1J8I A;  1LTT D;  3NTH A;  1EY4 A;  2VQF L;  3CXC A;  4EQO A;  1BQQ T;  3BVZ A;  2NTT A;  1RCV D;  4ZK9 B;  1YHA A;  2G5D A;  5BR8 Q;  5DM6 3;  4HCE A;  3CC2 A;  2HQE A;  4ZKC B;  3FKI H;  4EQN A;  2YTV A;  1EIG A;  1KLG D;  3I4M G;  1JIC A;  4BBR H;  3TME A;  1S4Z A;  4YY3 L;  2YU9 B;  1K0S A;  4KY6 A;  3HKZ E;  1C4Q A;  3A74 A;  3ERO A;  3S14 B;  2VL6 A;  5JEA H;  4PQX A;  5BR8 L;  1F2Y A;  1X3P A;  1LTL A;  4DR7 Q;  2RBM A;  4JK1 C;  2BCO A;  3K0Y A;  4DK3 C;  4LUV A;  1EEF D;  1SMX A;  3KK7 A;  5JVG 3;  3P1H A;  2IJ0 A;  3HOW B;  2KA7 A;  4GS3 A;  3W2D A;  1ICW A;  1IYU A;  1PFN A;  4DUZ Q;  1VF7 A;  3KLW A;  2ZM6 Q;  1Z7T A;  2D9U A;  4V19 0;  3S15 H;  4ODG A;  2D62 A;  1Q81 C;  4DR7 L;  2F0J A;  2MGS A;  4A3M G;  1ZYR C;  2TMP A;  4NKL A;  2M00 A;  2YTY A;  4LF4 L;  1IZ6 A;  3VA7 A;  5I2X A;  4DUZ L;  1JOK A;  3T51 B;  1VS0 A;  3SE0 A;  4KJO A;  3TEH B;  4IPH A;  4DV1 Q;  5LMU Q;  2B8G A;  5KRU A;  2BH8 A;  1E2Z A;  1A2T A;  3SGI A;  2KUM A;  1GO3 E;  2JE6 I;  3R2T A;  5IGB A;  1PRT B;  1K8M A;  3I4N G;  3KLS X;  1Z6H A;  3QOL A;  1TWG H;  3S2H B;  4ME5 A;  4OX9 Q;  2A6H D;  4DV1 L;  3W5O A;  5LMU L;  3BU2 A;  3NP8 A;  4CDC C;  1SMY C;  2XRQ D;  1ZEQ X;  4OIK A;  1EWC A;  1WD1 A;  1PMR A;  2PQA A;  1LTI D;  1PH3 A;  1NY4 A;  1TVX A;  1CK1 A;  1WCM H;  2EVB A;  4JC0 A;  3Q0A A;  1S5C D;  1JE5 A;  3F2U A;  3GTQ H;  1YNJ C;  2KHI A;  1WJJ A;  3KBX A;  2QW7 A;  1PZK D;  1CZW A;  2MNA A;  4DXF A;  2F03 A;  2IX1 A;  3HG9 A;  3MA2 B;  5EPJ A;  5JJI A;  3ULP A;  2FHT A;  1Y1W B;  3J81 L;  4TVA B;  1V43 A;  1UE1 A;  3A8I E;  4DR1 L;  3PSI A;  4JBJ A;  5C6A A;  2F3I A;  4OL7 A;  1IBL Q;  4QCL A;  2K32 A;  3VYT A;  2ZTE A;  2BOS A;  1AZP A;  1ASY A;  1H9S A;  5LMN W;  1SYB A;  2F52 A;  3PUW A;  3PO2 G;  3L2P A;  1Q1E A;  1ZYR D;  4IUR A;  2NN6 I;  3HOX B;  2IX3 A;  1EQQ A;  2E2J H;  2EDG A;  2JA7 B;  3T4A C;  1A6X A;  2Z0S A;  4KTA A;  1ESF A;  4DNI A;  4HN7 A;  1IBL L;  1TWH H;  2XIW A;  4N9P A;  4X3U A;  1DD2 A;  2B8F A;  1GUT A;  4RG1 A;  1E22 A;  2KED A;  5IP9 H;  4DUY Q;  1N33 L;  3K5M A;  3PUX A;  5C44 G;  1N9W A;  1EIY B;  1X3E A;  1M8A A;  1W2B A;  1HZB A;  1F2M A;  2MHV A;  4CKE A;  5C4X B;  2PW5 A;  4YWM A;  3U4Z A;  1TWC B;  3A7A B;  3F2B A;  3K5L A;  1I4Q A;  3OYY A;  4ZLT F;  2EE1 A;  4DUY L;  3KUP A;  1WFQ A;  4EQP A;  4JI6 Q;  4JI0 L;  2X6L A;  5KGU A;  2PMZ B;  4GZY C;  5EPL A;  1SMY D;  2CKZ B;  2R3Z A;  1QVC A;  3VYR A;  1U5K A;  2UU9 Q;  2IHF A;  4K5V A;  4A3K B;  3J7A F;  4ZUJ A;  2Y0S E;  1CI3 M;  2NVY H;  3NPP A;  4QB4 A;  5E4W C;  1KHI A;  2E2I H;  3EVQ A;  2JA5 G;  2RDF A;  4JI6 L;  1PH6 A;  2VUM B;  2NZO A;  1YNJ D;  4HCS A;  5JAV A;  2UU9 L;  2AUK A;  1YEZ A;  1GUO A;  1YZ6 A;  2OQK A;  1KL9 A;  4O2D A;  1OXT A;  1HUN A;  4HMI A;  1WTR A;  4UAI A;  5JJK A;  3SHL A;  5C3E B;  3T56 B;  5M3M G;  4JBM A;  5DAU A;  2F4I A;  4B3S L;  4A3B B;  1TWF H;  3HZX A;  3FRP B;  5JOB A;  4C1N K;  1O7L A;  4A3J H;  1MIU A;  1IL8 A;  1QG7 A;  3KLR A;  5CV6 A;  2PYK A;  2KHS A;  2QA4 A;  2QCP X;  1Y1V B;  1YIT A;  2LY7 A;  2K75 A;  1QWY A;  2P5Z X;  5M5Y H;  1T9H A;  2HHH Q;  3S1N H;  2Z8L A;  5IGC A;  1J9O A;  2WFW A;  1Q82 C;  5IP7 G;  4JI4 Q;  5FO8 B;  2PNH A;  3PIO 3;  1CKM A;  4DF7 A;  1L0X B;  4AIM A;  3BDO A;  3ERQ A;  2ZJQ A;  1TU2 B;  2FIN B;  2UXC Q;  4ZAI A;  2HHH L;  3PUZ A;  1GM5 A;  3I4N H;  4C3I B;  2LXK A;  3CRK C;  3T53 B;  1YNN C;  5CV7 A;  1WTO A;  4JI3 L;  1V8Q A;  4JI4 L;  5IGD A;  1LM0 A;  5CC4 A;  2WAQ E;  2XWJ B;  3HOU B;  1EY6 A;  1G8Z D;  5EQ0 A;  2E76 C;  1FNU A;  2B2Y A;  1XNR Q;  3U9O A;  3PUY A;  4G7O C;  3BZK A;  1K8O A;  4K2K A;  1HUM A;  3TDQ A;  1SNM A;  3E9I A;  5C5M A;  2DY7 A;  2XN9 C;  3S1Q H;  5GAE C;  2ZJP A;  4Q5V A;  3AFP A;  4P2C B;  5D3D A;  1LTG D;  1SE3 A;  5GAH C;  4FXK C;  1X6O A;  1CSQ A;  1CTM A;  1BDO A;  2GN5 A;  2G9H D;  4X65 L;  5C3W A;  5M5X B;  1DYQ A;  2Q8R E;  2Z4H A;  1K73 C;  2AWN A;  3E5S A;  1PLF A;  1SYC A;  1CA6 A;  1ROD A;  2V4D A;  4DAP A;  4DV4 L;  1IHZ A;  1XWE A;  3I4L A;  2OCE A;  4R4T A;  1DGS A;  1JR0 D;  3ULL A;  5E4X A;  1TT2 A;  3L0O A;  5EGT A;  3PO2 H;  4L63 B;  4IO9 A;  1KAW A;  2ZXO A;  2DJG C;  4DR6 Q;  2HD3 A;  4A3L G;  2KCC A;  1SSO A;  1SRU A;  2EJF C;  1OO9 B;  1C7Y A;  2B2U C;  3I8Z A;  1CHQ D;  1DOL A;  3S16 H;  1IBM Q;  1V1Q A;  4K5W A;  3HOV B;  4DR6 L;  2RDH A;  3H3V I;  3KF8 B;  3PV0 A;  1SRO A;  2OT2 A;  2VB2 X;  1B8A A;  1MSH A;  2AHO B;  1YNN D;  4BBS G;  3LWU A;  3RZD B;  4YWK A;  3O13 A;  1IBM L;  1K9M C;  2HCC A;  2R92 B;  2DGY A;  2L5T A;  1EYC A;  1CSP A;  4XYO A;  1B9M A;  1J5E L;  4KY7 A;  2SNM A;  5E7N A;  1EQR A;  5HGQ A;  1BNZ A;  3ZJY C;  1JC7 A;  1KRS A;  3EN2 A;  5CR3 A;  1JMC A;  3UDX A;  5C0X I;  3VR6 A;  1CQF A;  3CC4 A;  3GTJ B;  4FDB A;  1B3A A;  3OOC A;  1P16 A;  3MEF A;  4Y52 H;  2L0C A;  1SEB D;  5EBD A;  4PG3 A;  1LYL A;  1ENA A;  3GTM B;  4WJ4 A;  3J81 c;  1NUC A;  1BKB A;  1IKL A;  4PMC A;  3JC6 6;  4DNR B;  3DMU A;  4LF8 L;  1UUP A;  2ZXR A;  1C48 A;  3H94 A;  3IFT A;  3KJP A;  1SE4 A;  4H02 A;  1PTO H;  3J7Y W;  1VQB A;  2C5C A;  4FF2 A;  1ET9 A;  3E9H A;  4YWL A;  1VQ8 A;  3RMH A;  2F0T A;  4A3C G;  2RDG A;  2Z1C A;  5C44 B;  1L1O A;  3TBI B;  4G4K A;  3AYH B;  3PCO B;  1B53 A;  3PIP 3;  1WTP A;  3HGB A;  3TQY A;  4XXE A;  1LT5 D;  4P73 A;  4KLK A;  5IWA Q;  2N3S A;  4RKL A;  2NVQ B;  3QB3 A;  4GN5 A;  3HKS A;  5IYD G;  3M4Q A;  1X3F A;  2ZXP A;  3HOW G;  1L2F A;  1ESR A;  1YNX A;  3G6E A;  3A0J A;  4YHH Q;  4TRD A;  1VQE A;  2R7F A;  4DV7 L;  5JVH 3;  3BS1 A;  2NVT H;  5CGK A;  5IT9 L;  1KAA A;  1CUK A;  3TN2 A;  2JA5 B;  3DLL A;  4O0A A;  1N32 Q;  5C4Z A;  4X6A H;  2OEO A;  4KD4 A;  4YHH L;  3P7J A;  3K5N A;  1BCP F;  4A3E B;  3H3V C;  3DEO A;  4LFA Q;  4U68 A;  1KQS A;  5M5W H;  2F0G A;  2C35 B;  3FPU B;  3Q6S A;  4JI2 Q;  3CCJ A;  3PGZ A;  3URY A;  5CV9 A;  4WOR A;  2KEN A;  1JB7 A;  1VQI A;  1E0B A;  3NWT A;  2KEC A;  2K33 A;  1GHK A;  3M3Y B;  2NVX B;  3ND9 A;  5I6W A;  3ITP A;  1I4R A;  3J80 L;  4AH6 A;  4NXM Q;  3GTG H;  4JI2 L;  2B63 B;  5KEE A;  1B44 D;  2KQ3 A;  2VB3 X;  2JJQ A;  3UDI A;  1O80 A;  5IGE A;  3AMU A;  5I2Y A;  4BY1 H;  2HT1 A;  5GAG C;  1STA A;  1SN8 A;  3S1R H;  3J7Z C;  1DCZ A;  1VF5 C;  2Q2H A;  4N9T A;  3K58 A;  1TWA H;  4OHJ A;  4FF3 A;  3F2D A;  4A93 B;  4Y7N H;  2J0T D;  2EXD A;  2WKD A;  1EWH A;  3T16 A;  1RF2 D;  4JOI C;  5HGT A;  1VQH A;  3T1H Q;  3HS0 C;  2K05 A;  5FOB B;  2GVB A;  2ZT9 C;  3BDC A;  5FO7 B;  1SR3 A;  1STG A;  5C4J B;  1Y1W G;  1DOK A;  1E2W A;  4P75 A;  4L5Q A;  3D4D A;  1A3T A;  4A3G B;  3NTI A;  1JOO A;  1DJR D;  4IUU A;  4UPA A;  2K03 A;  2L1B A;  1EFI D;  5ISR A;  4BBS H;  4EX5 A;  2D2C C;  3PIO A;  3KFU A;  3CPF A;  3K7A B;  3T1H L;  5EAY A;  1STH A;  3PO3 B;  3HOX G;  2NN6 H;  5IGG A;  3RNU A;  2JA7 G;  1SYD A;  5J3B A;  3CP0 A;  3GV6 A;  1K3B C;  4RCO A;  3I72 A;  1GOZ A;  3R3O A;  2NZH A;  4QQB X;  3K57 A;  1XMO Q;  1EYA A;  1BBX C;  3GTO H;  3CCS A;  1L0W A;  3N52 A;  4X66 Q;  1KRT A;  3IRB A;  5C4X G;  3D6W A;  2WII B;  2BE5 C;  2RKS A;  2UUA L;  1EYD A;  4IJH A;  4CJ1 B;  1ONL A;  2QKI C;  1I6H H;  2QDB A;  4QGU A;  3CPW A;  4CBV A;  2MJ8 A;  5LL6 X;  2IPK D;  2AWO A;  3AFQ A;  1HR0 L;  4KJN A;  2B2T A;  4IFD J;  1MJE A;  4RHS A;  1D6E C;  4CDE C;  3CW2 C;  5EBC A;  3GTK H;  1BCP C;  2YU9 H;  1GVP A;  3LGJ A;  1K28 A;  1KNA A;  3I2Z A;  4KHV A;  3A5U A;  3E6Z X;  4K0K L;  4LJZ C;  4NXN Q;  3DEP A;  3STB C;  4YCW A;  2EXZ A;  3R2I A;  1P8L A;  1D2B A;  1PH4 A;  4UHV A;  3FHW A;  1XYI A;  3I91 A;  3TZU A;  4A75 A;  3T1Y L;  3SVM A;  4A3B G;  3CRL C;  1SJH D;  4FXD A;  1GD7 A;  4GLX A;  4KY5 A;  4IOA A;  3CHB D;  1X3G A;  1NNX A;  1YVC A;  1Y1V G;  1PH9 A;  1LLR D;  5C5L A;  1PTO F;  5JPM C;  4KHZ A;  2X69 A;  5D65 A;  5DEH A;  3IFD A;  3I56 A;  1Q8I A;  2N88 A;  3RZO B;  2X6G A;  3I4O A;  3JAM E;  1VQO A;  3K80 C;  2OXP A;  2WB1 B;  5BN4 A;  3S17 B;  5AFW A;  2ENB A;  3LNN A;  4JI1 Q;  1MKH A;  2E5L Q;  4C3I G;  5CBA E;  3QJY A;  3MFG A;  1V9P A;  2A68 C;  3OMC A;  4A3I B;  1M1K C;  1HNZ Q;  1XMQ Q;  2N55 A;  1Y8N B;  3CQZ B;  4EVO A;  2GA4 B;  3HOU G;  2EJM A;  1BF4 A;  4PZ7 A;  2E8G A;  4JI1 L;  3GQB A;  2E5L L;  4DK0 A;  4RAU C;  1I94 Q;  3BYY B;  1ML0 D;  1F9R A;  1QUQ A;  4E6I A;  1PH5 A;  2BDN A;  1NAP A;  1XMQ L;  3KDF B;  1BCP D;  4B3T Q;  3RLF A;  1EU4 A;  4ZRZ A;  5LMN Q;  4CDD C;  2R93 B;  2BDO A;  4RA8 A;  2CCZ A;  4P74 A;  1AP0 A;  5EJW A;  1I94 L;  3ER0 A;  2HUG A;  3STB D;  3MXP A;  3J7A V;  4C3H B;  3G71 A;  2HIX A;  1V1O A;  4OEL B;  2K5H A;  2XWB B;  4BXX G;  3PIP A;  5JPN C;  5LMN L;  5FLX E;  5IT9 c;  1JJG A;  2ZM6 L;  1JOR A;  1NR2 A;  2K14 A;  2SOB A;  2E2H B;  3NEL A;  2ZTD A;  2XRS D;  3NEM A;  4Q0F A;  2PNR C;  2N78 A;  4MN3 A;  1XTD A;  4XT3 B;  5HUR A;  2LXJ A;  4QIW B;  4H7B A;  2JA7 H;  1TY0 A;  2ICE C;  2KJX A;  1Z47 A;  4OEM B;  1CZG A;  1H9S B;  1XPR A;  3UE1 A;  1YJN A;  2DN8 A;  4CDF C;  5G3L D;  3HOV G;  5HY6 A;  3AQQ A;  1I50 B;  3R8B A;  3H3V H;  1BOS A;  2M2L A;  1STB A;  2IWH A;  1S5B D;  2F0U A;  3J80 c;  5C4X H;  5DLQ E;  3S2D H;  5E1F A;  3CMA A;  2EYL A;  2A68 D;  2Q8T A;  4OX9 L;  3FKI B;  4NW2 A;  2A5H A;  4BBR B;  4R4O A;  2R92 G;  1GUS A;  1SXT A;  3RLN A;  3GTP B;  1PTO C;  2B2U A;  4H0L C;  1HQR D;  3I73 A;  3C46 A;  4A3K H;  2F0Q A;  5K5P A;  3WDN A;  1CA5 A;  5C0X H;  1PYS B;  4GKK Q;  2CH4 W;  2Z6K C;  4YCU A;  1JJ2 A;  4NB3 A;  3AU7 A;  2ASB A;  2JA6 H;  5KYL A;  2VUM H;  1X9N A;  4ABN A;  3Q22 A;  3BYT B;  2MQH A;  3EJI A;  5M9O A;  5ELE A;  1HA5 A;  3CCU A;  2Z9H A;  4PZ6 A;  1Y8O B;  1I4G A;  4K8I A;  1HNX Q;  1PH7 A;  3UDG A;  1BBU A;  1VQJ A;  1GKH A;  1XXG A;  3G4S A;  2LFN A;  5C3E H;  4LNQ A;  1E24 A;  5LHY 1;  1DZ1 A;  2KCT A;  4WJ3 M;  4R9W A;  1A15 A;  1F9P A;  5M3F H;  3CCR A;  2B2T C;  4MHE A;  1HHV A;  4N8F A;  1PXU A;  3A55 A;  5K36 G;  3CME A;  2JA8 H;  3I7F A;  1D5X C;  2F0S A;  2O5I C;  2YYZ A;  1AZQ A;  1QCB D;  3KOJ A;  2J4X A;  1WTQ A;  1JJC B;  1MSG A;  4LUZ A;  1HZA A;  5EPK A;  4GNX C;  1LAB A;  2Q2I A;  3FP9 A;  3CKI B;  4GLA C;  5A2Q L;  1KIX A;  1K83 B;  1EEI D;  4ILW A;  2A73 B;  3I4M H;  2RVL A;  4X3T A;  4APV A;  2Q8I B;  2K7V A;  3R93 A;  3HOU H;  1KC8 C;  4BY7 B;  4LFC Q;  2OTJ A;  1VQK A;  3GTQ B;  1RDP D;  1KAB A;  1PTO D;  3D4R A;  4KN4 C;  4DV0 Q;  5CV4 A;  4HIK A;  3A54 A;  4A3E G;  2E2D C;  5CV5 A;  3VR4 A;  1VQM A;  1NTG A;  1IYJ B;  4J15 A;  2R7D A;  3KF6 B;  1VQD A;  2UUB Q;  1IXR A;  3A7L A;  4J1M A;  1CKN A;  3MFY A;  4LFC L;  4GOP C;  1Q46 A;  3EIV A;  2K52 A;  3E0J A;  3JAM i;  3DWQ A;  2CH4 A;  4A3M H;  3P75 A;  3EBE A;  4HSV A;  5M5X H;  1PFM A;  1EY9 A;  4K6D A;  4R4Q A;  1SND A;  5KYI A;  1JT8 A;  2B63 G;  3M4O H;  1E7Z A;  1EFW A;  1PRT F;  1DM0 B;  5EKK A;  3J80 E;  3TRZ A;  2E2J B;  1GXD C;  1B70 B;  2L11 A;  3NHH A;  1B4O A;  2D5D A;  1EQT A;  2K5W A;  4HAE A;  4HMJ A;  1TWH B;  1J6Q A;  2NZ1 D;  1A8V A;  1F77 A;  4I65 A;  4DPG A;  3I55 A;  2KCN A;  4TKO B;  3DWP A;  2SEB D;  3SK5 A;  4A93 G;  2BH2 A;  3CCV A;  1STE A;  3H09 A;  1XX8 A;  1PHJ A;  1EZ8 A;  4QUC A;  3H0G B;  1SYE A;  3OIP A;  1Q90 A;  2UXC L;  2EPB A;  2F0F A;  4A3G G;  4XT1 B;  2F0N A;  1AN8 A;  3MZ5 A;  5COY A;  5IYC G;  1FGU A;  2LKV A;  2B2W A;  4RGT A;  3PO3 G;  4TQU S;  1YIJ A;  2R92 H;  2JYO A;  2SNS A;  4XTC S;  3K59 A;  2K1B A;  3DM1 A;  4JOI A;  1XNR L;  4OWW B;  1I5F A;  3EFX D;  1MJC A;  2JP1 A;  3GTJ H;  1QJO A;  1E2V A;  4QF4 A;  1FR3 A;  3V05 A;  2EYJ A;  2MO0 A;  4LW1 A; 
#chains in the Genus database with same CATH homology
 5M3F G;  3CCJ A;  1Z9F A;  2C35 B;  4JI2 Q;  2KCM A;  3PGZ A;  3F1Z A;  1L1O C;  1EYG A;  1Y1V H;  2KEN A;  4JI8 Q;  1VQI A;  5JEA J;  2PI2 A;  5IP9 G;  1Q86 C;  1JB7 A;  1HNX L;  2UXB L;  1N33 Q;  2JA8 G;  2AKW B;  3BZC A;  3U4V A;  1NMF A;  2N8N A;  3HKZ G;  3Q8D A;  4DAM A;  4HJ7 A;  4A76 A;  3CCM A;  1CKN B;  4C2M H;  1VQC A;  3M4P A;  4OO1 I;  5FJ8 H;  2XTI A;  4DK6 C;  4DR5 L;  3G48 A;  2JEA I;  4KHP Q;  3TS2 A;  1VQ6 A;  4AH6 A;  2XGT A;  4NXM Q;  2VQF L;  3F8T A;  1WYD A;  3GTG H;  4JI2 L;  3CXC A;  4JI8 L;  2JQO A;  2JJQ A;  1K8G A;  3UDI A;  5C44 H;  1YHA A;  3KJO A;  1E1O A;  2VQE Q;  1ASZ A;  4JI0 Q;  2FXQ A;  5BR8 Q;  4BY1 H;  4GN3 B;  4C3I H;  3CC7 A;  4UY8 C;  5GAG C;  1FJG Q;  2HT1 A;  1SN8 A;  3A5Z B;  4HJ9 A;  5AJ3 Q;  3CC2 A;  3S1R H;  1N36 Q;  3J7Z C;  3FKI H;  4KHP L;  2YTV A;  1UE6 A;  2Q2H A;  3I4M G;  1TWA H;  4BBR H;  1G29 1;  3F2D A;  4YY3 L;  2I5M X;  4Y7N H;  2NVQ H;  1L1O B;  2EXD A;  3H0G H;  3HKZ E;  2PI2 E;  2F4V Q;  4JOI C;  1VQH A;  2VQE L;  3A74 A;  3T1H Q;  2VL6 A;  5BR8 L;  5IE8 A;  1R9T H;  2GVB A;  4GLV B;  5AJ3 L;  1LTL A;  4DR7 Q;  4OON A;  4EQ5 A;  1SR3 A;  1N36 L;  1Y1W G;  2CFM A;  4DK3 C;  4LUV A;  4P75 A;  4L5Q A;  1SMX A;  1YI2 A;  1PH2 A;  4DV6 Q;  1EIF A;  4UPA A;  4GS3 A;  2HQL A;  1QZH A;  4BBS H;  4DUZ Q;  4EX5 A;  3PIO A;  1VQN A;  3KFU A;  3KLW A;  3CPF A;  2ZM6 Q;  2JA5 H;  4B3S Q;  3T1H L;  1HZ9 A;  1I3Q H;  3RR5 A;  5EAY A;  3S15 H;  4QJF A;  4DV0 L;  4JCV E;  2D0O A;  2D62 A;  3HOX G;  1SE8 A;  1Q81 C;  4DR7 L;  4A3M G;  3RNU A;  2JA7 G;  2YTY A;  4DV6 L;  4A3E H;  4LF4 L;  4BXX H;  1IZ6 A;  3GD7 A;  5J3B A;  1PH1 A;  5M3M H;  2UUB L;  3CP0 A;  4DUZ L;  3CD6 A;  2WB1 G;  3H15 A;  1C0A A;  1VS0 A;  1HZC A;  2NZH A;  2A8V A;  4QQB X;  3TEH B;  1XMO Q;  3GTO H;  4IPH A;  4P71 A;  3W1G A;  5LMU Q;  4DV1 Q;  3K81 C;  3CCS A;  1L0W A;  2BH8 A;  3ICE A;  2ALY B;  3CCL A;  3SGI A;  3K0X A;  1GO3 E;  2JE6 I;  4X66 Q;  1KRT A;  3IRB A;  4A3I G;  1VQP A;  5C4X G;  3NBH B;  2IY5 B;  2GVA A;  5C0X J;  3I4N G;  2UUA L;  4IJH A;  1K0R A;  1NE3 A;  3OW2 A;  1EUJ A;  1TWG H;  4OX9 Q;  5IP7 H;  1I6H H;  4DV1 L;  3W5O A;  4QGU A;  5LMU L;  2DUD A;  3BU2 A;  3CPW A;  4JI3 Q;  1X54 A;  3WWV A;  1VQF A;  5ELN A;  3HOV H;  4JYA Q;  3GO5 A;  2AWO A;  3AFQ A;  1HR0 L;  2ID0 A;  1E3P A;  4IFD J;  1MJE A;  2WB1 E;  4IPG A;  2PQA A;  4JBK A;  3CW2 C;  1PH3 A;  1NY4 A;  1VCI A;  3GTK H;  4A3F G;  1FVI A;  4JV5 Q;  4A93 H;  2R93 G;  2YU9 H;  1GVP A;  1WCM H;  4AQY Q;  3D0F A;  3RZD H;  1O7I A;  3LGJ A;  2K50 A;  4JC0 A;  3I2Z A;  5IWA L;  2JK8 A;  2A1A A;  3CAM A;  3UE0 A;  3A5U A;  1JE5 A;  4JI7 Q;  1A0I A;  3GTQ H;  4K0K L;  2KHI A;  4JYA L;  4NXN Q;  1WJJ A;  3RLO A;  3STB C;  5C4J H;  4YCW A;  3MXN B;  1OXS C;  4DAY B;  4HID A;  1P8L A;  4DV3 Q;  3KF6 A;  1PH4 A;  4A3G H;  3GTM H;  3NEN A;  2MNA A;  4LFB Q;  3FHW A;  4JV5 L;  2PMZ E;  5IY0 A;  2ZJR A;  2IX1 A;  3PF4 A;  4A75 A;  4AQY L;  3T1Y L;  2CWA A;  5JJI A;  2WP8 J;  3ULP A;  4A3B G;  4TVA B;  4X65 Q;  2VZA A;  4JI5 Q;  1V43 A;  5IYC H;  1UE1 A;  1W3S A;  4DV2 Q;  4JI7 L;  1GD7 A;  4GLX A;  4DR1 L;  4DR4 Q;  3PSI A;  4IOA A;  4JBJ A;  4GKJ Q;  1X3G A;  2F3I A;  1IBL Q;  3PO3 H;  4DV4 Q;  1YVC A;  2ZTE A;  3J80 i;  2YTX A;  1Y1V G;  1PH9 A;  1ASY A;  1NBW A;  5LMN W;  1N32 L;  2F52 A;  3PUW A;  4DV3 L;  3PO2 G;  1OTC A;  3L2P A;  4LFB L;  4KHZ A;  1K3R A;  1Q1E A;  2NN6 I;  1EQQ A;  3HOY G;  2E2J H;  4JI5 L;  4LFA L;  5FJ8 G;  3I56 A;  4DV2 L;  2Z0S A;  4NPS A;  3I4O A;  1U0L A;  4KI0 A;  4DR4 L;  1VQO A;  4DNI A;  1IBL L;  2CQO A;  1TWH H;  1UWV A;  3K80 C;  3E0E A;  1N8R C;  4RG1 A;  1E22 A;  5IP9 H;  4DUY Q;  1YHB A;  3K8A A;  1N33 L;  2Y0S G;  4JI1 Q;  4OWT B;  4JBW A;  1MKH A;  3PUX A;  5C44 G;  1N9W A;  1EIY B;  3ULJ A;  1X3E A;  2E5L Q;  4BY1 G;  1W2B A;  1UE5 A;  1HZB A;  4PMW A;  2OWO A;  4DV5 Q;  3FKI G;  1V9P A;  1Q12 A;  2UUC Q;  4A3L H;  2IHE A;  4YWM A;  4NXM L;  1M1K C;  2KBN A;  1HNZ Q;  1XMQ Q;  3U4Z A;  4QIW E;  3F2B A;  4BBR G;  3OYY A;  1X56 A;  1PFS A;  3HOU G;  4DUY L;  4MNO A;  1WFQ A;  2E8G A;  2HIV A;  4PZ7 A;  4JI1 L;  4JI6 Q;  4JI0 L;  1FJG L;  2E5L L;  2CKZ B;  1I94 Q;  1QVC A;  4P72 A;  1U5K A;  1PVO A;  4L5R C;  2UU9 Q;  1QUQ A;  4DV5 L;  4HJ5 A;  5GQO A;  2IHF A;  2OTL A;  1LUZ A;  1PH5 A;  2UUC L;  1PV4 A;  2R7Z G;  1FL0 A;  3U50 C;  1XMQ L;  1S40 A;  3KDF B;  1YJ9 A;  1J5E Q;  3J7A 5;  4B3T Q;  3RLF A;  5LMN Q;  2Y0S E;  2B29 A;  2NVY H;  5GRO A;  1TXY A;  2F4V L;  2CCZ A;  1QZG A;  3U58 A;  1KHI A;  2E2I H;  4JI6 L;  2JA5 G;  4P74 A;  1NMG A;  3RN2 A;  1VQ5 A;  1PH6 A;  2NZO A;  1I94 L;  3ER0 A;  1SLJ A;  3UDF A;  3STB D;  2UU9 L;  2Q2U A;  1YEZ A;  2NN6 G;  4OO1 G;  1YZ6 A;  2QEX A;  4LF7 Q;  2OQK A;  1KL9 A;  4O2D A;  1OXT A;  2HIX A;  3DM3 A;  3G71 A;  2K5H A;  4BXX G;  3PIP A;  5LMN L;  1VQL A;  5JJK A;  3S1M H;  1IBK Q;  1H95 A;  5M3M G;  5H1S E;  5IT9 c;  4JBM A;  4LF8 Q;  1JJG A;  2ZM6 L;  2K14 A;  4B3S L;  1TWF H;  1PYB A;  3NEL A;  2Z6K A;  4A3J H;  1MIU A;  2ZTD A;  4DKA C;  3NEM A;  2K4K A;  2N78 A;  1PA6 A;  4LF7 L;  3M3Y H;  1XTD A;  2QA4 A;  2NVX H;  3AEV A;  2LXJ A;  1YIT A;  5IYB G;  2K75 A;  2JA7 H;  1UEB A;  5M5Y H;  1Z47 A;  1T9H A;  2WAQ G;  3RZO H;  1IBK L;  2HHH Q;  4LF6 Q;  3S1N H;  4IFD I;  2B63 H;  2VY3 A;  2EQS A;  4AYB E;  1XPR A;  2B3G A;  1E1T A;  2WFW A;  1XMO L;  3UE1 A;  1Q82 C;  3S24 A;  5IP7 G;  1YJN A;  4JG2 A;  4JI4 Q;  2PNH A;  4X66 L;  3HOV G;  5HY6 A;  3AQQ A;  1CKM A;  3HOZ G;  1OXV A;  3H3V H;  4A3C H;  3F2C A;  4AIM A;  4DR2 Q;  2KHJ A;  2ZJQ A;  4A3I H;  2QGQ A;  5C4X H;  2RHS B;  3J80 c;  4HJ8 A;  2UXC Q;  5DLQ E;  2HHH L;  4LF6 L;  3PUZ A;  1S72 A;  1GM5 A;  3I4N H;  1XPO A;  3S2D H;  3CMA A;  1KD1 C;  2LXK A;  4OX9 L;  2V1C C;  4BY7 G;  1EOV A;  4JI3 L;  1B7Y B;  4DV7 Q;  3S14 H;  4JI4 L;  1YJW A;  4R4O A;  2R92 G;  1AH9 A;  1LM0 A;  3RLN A;  4RMF A;  5IYD H;  2WAQ E;  1K8A C;  1A63 A;  4DR2 L;  5FLM G;  5ELO A;  4GNX A;  4A3D G;  2VS1 A;  4A3K H;  3HOW H;  2OQ0 A;  4UP8 A;  4HIM A;  1XNR Q;  2LSS A;  4A3F H;  1PYS B;  3PUY A;  4GKK Q;  2Z6K C;  4IPD A;  2D0P A;  3BZK A;  4YCU A;  2R93 H;  3K7A H;  1JJ2 A;  3E9I A;  4NB3 A;  2ASB A;  2JA6 H;  2VUM H;  1X9N A;  4NXN L;  3PF5 A;  4UP9 A;  1YHQ A;  1XNQ Q;  4L5S A;  5GAE C;  2MQH A;  1BBW A;  2ZJP A;  3S1Q H;  3AFP A;  2ES2 A;  2L15 A;  3CCU A;  4C3H H;  4PZ6 A;  1M90 C;  2UXB Q;  5GAH C;  1NJI C;  1PH7 A;  3UDG A;  1BBU A;  1X6O A;  1CSQ A;  2JA9 A;  1HNX Q;  1G6P A;  1VQJ A;  1GKH A;  3G4S A;  5C3E H;  2GN5 A;  4X65 L;  3TRE A;  3W1B A;  4XIG S;  4LNQ A;  1E24 A;  4BA2 I;  1K73 C;  2AWN A;  4L5T A;  2KCT A;  4WJ3 M;  1VQG A;  4GKJ L;  4X64 Q;  1EWI A;  5M3F H;  3CCR A;  4DV4 L;  1XNQ L;  2VQF Q;  1IL2 A;  2OCE A;  4MZ9 A;  4R4T A;  1G51 A;  5K36 G;  1DGS A;  4GN4 B;  3ULL A;  3PUV A;  3CME A;  2YV5 A;  3L0O A;  2JA8 H;  2A19 A;  2MFI A;  3I7F A;  3PO2 H;  1Q1B A;  4IO9 A;  4GOP A;  1KAW A;  4UP7 A;  4DR6 Q;  3HOY H;  3S2H H;  2YYZ A;  2VNU D;  3KOJ A;  4A3L G;  1SRU A;  2R6G A;  4X64 L;  4MTN A;  2I5L X;  1JJC B;  1C7Y A;  4LUZ A;  1HJP A;  1HZA A;  1KXL A;  4GNX C;  3H0G G;  2Q2I A;  4YY3 Q;  1I50 H;  1OXU A;  3FP9 A;  4A4I A;  3J81 j;  3OTO Q;  5JEA G;  3S16 H;  4GLA C;  4QY7 A;  1IBM Q;  1VQ9 A;  1V1Q A;  1KIX A;  1Q8K A;  4DR6 L;  3JAM c;  3M9B A;  3H3V I;  1HNZ L;  3I4M H;  2EIF A;  3KF8 B;  1SRO A;  3PV0 A;  4APV A;  1B8A A;  2H5X A;  2PQA B;  1D7Q A;  2AHO B;  4BBS G;  2IT1 A;  1HR0 W;  2ZTC A;  3HOU H;  1KC8 C;  3GTP H;  3OTO L;  2IX0 A;  3TS0 A;  4LFC Q;  3ERS X;  4YWK A;  1OXX K;  2BA1 A;  4AYB G;  1K9M C;  1IBM L;  1RL2 A;  4R4C A;  3KYH C;  1VQK A;  4HIO A;  2OTJ A;  2DGY A;  4DV0 Q;  4POF A;  1Y1W H;  1CSP A;  2K5V A;  1WI5 A;  3HFZ B;  4LUO A;  4HIK A;  1J5E L;  4A3E G;  2R7Z H;  1UE7 A;  1BVS A;  1VQM A;  4B3T L;  5E7N A;  1EQR A;  1NTG A;  4ME3 A;  5HGQ A;  3ZJY C;  4R4I A;  1KRS A;  4X62 Q;  1IYJ B;  3EN2 A;  4J15 A;  4LF4 Q;  1JMC A;  3UDX A;  4GNX B;  5C0X I;  2R7D A;  1VQD A;  1VQA A;  1Y14 B;  1IXR A;  3KF6 B;  2UUB Q;  3CC4 A;  4FDB A;  1WOC A;  1CKN A;  1P16 A;  4POG A;  4LFC L;  4IJL A;  4A3J G;  3MEF A;  4GOP C;  1AE3 A;  1Q46 A;  3EIV A;  1N34 Q;  2K52 A;  3JAM i;  1VQ7 A;  4Y52 H;  1RIP A;  3HOX H;  4PG3 A;  1LYL A;  4A3M H;  2JEB I;  3EBE A;  3J81 c;  4WJ4 A;  1BKB A;  4B3R Q;  2MO1 A;  5M5X H;  4R1J A;  2BA0 A;  3JC6 6;  4LF5 Q;  2ATW A;  4R4Q A;  4X62 L;  4LF8 L;  4QL5 A;  1JT8 A;  2B63 G;  3M4O H;  1E7Z A;  1EFW A;  4LWC A;  3KJP A;  4H02 A;  2UUA Q;  3S17 H;  3TRZ A;  1VQB A;  2AMC B;  1Q7Y C;  1B70 B;  1S3O A;  1N34 L;  4B3M Q;  1QVG A;  4HJA A;  1C9O A;  1X65 A;  3E9H A;  2CWP A;  4YWL A;  1VQ8 A;  1CKO A;  1J6Q A;  1HNW Q;  1A8V A;  4B3R L;  4A3C G;  4DPG A;  3I55 A;  2UXD Q;  5FLX c;  4LF5 L;  1L1O A;  1YBY A;  5IYB H;  3K7U C;  1HR0 Q;  1TWC H;  2RF4 A;  3AYH B;  3CQZ H;  3PCO B;  4A93 G;  4BA1 I;  4C3J H;  5GAD C;  1XJV A;  1A62 A;  1WCM G;  4OWX B;  4DR3 Q;  2BH2 A;  3D31 A;  3CCV A;  3L7Z C;  4IPC A;  3BJU A;  3TQY A;  4B3M L;  4GOP B;  3B6Y A;  4P73 A;  1HH2 P;  4KLK A;  3J81 i;  5IWA Q;  1PHJ A;  2N3S A;  4K0K Q;  3M7N A;  4GN5 A;  2K5N A;  3HKS A;  5IYD G;  1K83 H;  3M4Q A;  1HNW L;  3KDF A;  1QVF A;  3CCE A;  3HOZ H;  2UXC L;  1X3F A;  2UXD L;  2I5H A;  3GDE A;  3CF5 A;  2I0Q A;  4A3G G;  4A3K G;  3HOW G;  1L2F A;  4LF9 Q;  1YNX A;  3G6E A;  3RN5 A;  1PH8 A;  5C0X G;  1X55 A;  3A0J A;  1D8L A;  4YHH Q;  3M85 A;  4DR3 L;  4IOC A;  4ALP A;  1VQE A;  2R7F A;  4DV7 L;  3T1Y Q;  5IYC G;  4BY7 H;  1QUQ B;  1FGU A;  2JA6 G;  1VQ4 A;  2VUM G;  2NVT H;  3PO3 G;  4TQU S;  5JJL A;  1YIJ A;  2R92 H;  3GTL H;  4DR1 Q;  3CCQ A;  2VW9 A;  1CUK A;  3VDY A;  2Q2T A;  3DLL A;  4XTC S;  2RHQ B;  5FLM H;  4O0A A;  1N32 Q;  4A3D H;  4JOI A;  1XNR L;  4LF9 L;  4OXP A;  2RCN A;  4IFD G;  4X6A H;  4PZ8 A;  4OWW B;  4GKK L;  1I5F A;  4YCV A;  5C3E G;  4YHH L;  1XPU A;  4A3B H;  1MJC A;  2E2H H;  1AE2 A;  3GTJ H;  1SFO H;  4DR5 Q;  4LFA Q;  1KQS A;  2MO0 A;  4LW1 A;  2N49 A;  5M5W H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...