5JEAH

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
305
structure length
282
Chain Sequence
DSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTITRLEEESSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 77
structure length 282
sequence length 305
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jeaH01
3OOCA 1O78A 1Q90A 5KNCA 1IW7D 3ND9A 1GUSA 1IYVA 4H0LC 4BA2I 1SMYC 5C0XG 1TKWB 2EJGC 2R6GA 4KHZA 4OO1G 1LABA 3IFTA 4KKTA 3VR3A 1CI3M 1O7LA 1GUGA 1Q1BA 2NN6H 3SE0A 2BE5C 3NE5B 1H9MA 2JEAI 3A8JE 3SDZA 5BN3A 1IYUA 2O5IC 1IW7C 3MXUA 5JEAG 3M4YA 1H9SB 3D4RA 3I4LA 3W3AA 2IT1A 4DNRB 1Z6HA 4XIGS 5C0XH 3I73A 4OO1H 1GHKA 1Y69U 3I72A 2K32A 2A69D 4BA1I 1QJOA 2E76C 4IFDG 2NN6G 2EJMA 1V43A 2PNRC 3VR4A 1CTMA 1H9KA 1T5EA 3A8IE 5JEAH 3PUWA 1GHJA 3A7LA 4LK1C 1OXVA 4G7HC 1GJXA 1VF7A 4KN7C 3DXJC 1YNJC 1ZYRC 2A6ED 4KKUA 2KA7A 2D62A 2V4DA 2QF7A 5BN5A 3GD7A 3WDNA 2A69C 1E2WA 1Q1EA 2EVBA 4KN4C 4H13C 1BDOA 1B9NA 4IFDH 4GZYC 1Y8OB 3A8KE 1PMRA 3EQLC 2A68D 1OXSC 2O5JC 3H94A 1OXXK 1DXMA 1E2ZA 2BA0A 3CRLC 3MFYA 3QIAA 4IQZA 1G291 1HTPA 1OXTA 3AB9A 2A6EC 5K36H 1A6XA 3VA7A 2AWOA 3PUXA 3D31A 2DNCA 3PV0A 2LMCB 3T53B 3QJYA 2AUJD 2E74C 3GQBA 3BDOA 3ND8A 1Q12A 2A68C 2D2CC 2A6HD 2DN8A 4TQUS 3VR6A 5BN4A 1VCIA 1Z7TA 3CRKC 2DNEA 1DCZA 4LJZC 4XTCS 5KNBA 1FYCA 3OW7A 3U9SA 1HPCA 2PPBC 2PCFB 4I7ZC 1VDZA 1K8OA 2K33A 2JEBI 4DNTB 5K36G 3PUZA 2YYZA 3BG3A 2BA1A 2B8FA 2E75C 4OGQC 4PV1C 3FMCA 1CFMA 3A7AB 4DK0A 2A6HC 4JBWA 1K8MA 1FR3A 1VF5C 3L7ZC 1TU2B 1I6VC 1GUNA 3LNNA 3VR5A 3VR2A 4L8JA 3P20A 2BDOA 3PUYA 4KMUC 4KI0A 5A35A 1DD2A 4G7ZC 1ONLA 3M85A 2B8GA 4G7OC 1ZKOA 2AUKA 2K7VA 4HR7B 2CW0C 4RCNA 1GUOA 2D5DA 4H44C 4TKOB 3T51B 2EDGA 2JXMB 3M7NA 1H9JA 2ZT9C 1E2VA 3QG1A 1HCZA 1B9MA 3FPPA 3KLRA 3RLFA 2NN6I 2KCCA 1YNNC 2Q8IB 1OXUA 4KKSA 2JE6I 1GUTA 4DK1A 1H9RA 1HQMC 1H9SA 3HGBA 3OPOA 3LWUA 1LACA 3T56B 3TZUA 3N6RA 3PUVA 1V8QA 5KNDA 1Y8NB 1EWHA 2F1MA 2BE5D 2EJFC 2L5TA 4JK1C 3IKJA 1Y8PB
chains in the Genus database with same CATH superfamily
3CD6A 2FHTA 5KNCA 3BDLA 4DV1Q 5HY6A 1MHWC 1VQMA 1EQQA 3RZOB 2C35B 5IYBG 1EEID 3CCRA 3J7YW 3R93A 2B2TA 4AQYQ 1BF4A 3I55A 2BE5C 5L37A 1D6EC 1H9MA 1YJ9A 2AWNA 4DNIA 4DV4L 5CV9A 5BN3A 1IYUA 4ZUJA 2E5LL 1HA6A 2IT1A 2F0LA 3FEWX 1D8LA 5ELOA 2CQAA 3MHBA 1E1TA 1F2YA 2NWGA 1C7YA 4DR5Q 1LTTD 4DV0L 2EY1A 1EOVA 4DXGA 5J22A 1G91A 3JAMc 1JE5A 3M4QA 4Q5VA 3AYHB 3AFPA 2XWJB 4HN7A 1EZ8A 5J39A 1CA5A 2F4VL 1S5ED 3I4OA 1CHPD 1ASYA 2Z9HA 5AFWA 2VY3A 1CSQA 1F9RA 2K1BA 1OXSC 4FDBA 3H94A 1OXXK 4FNFA 1E2ZA 2BOSA 2R3ZA 2JJQA 2E2JB 4O1NA 5C5LA 3ONAB 1VQEA 2NVTH 1EWCA 2K5WA 3S16B 2KCNA 2O4XA 1NTGA 3BZCA 3PV0A 4JOIC 5FO9B 1TWAH 2XWBB 3IRBA 3TP7A 1L0YB 1IBKL 5DAUA 1N32L 2UU9Q 4L6TB 3W1BA 4FVMA 3U50C 4A3FB 3I56A 1K8MA 1N36L 4QIWE 2ZJQA 2I5MX 4LF8Q 1VF5C 1WTOA 4IUQA 2YTYA 1K8GA 2PMZE 3FVQA 5JJIA 1GUWA 1L1OA 3GTMB 4DAYB 2CQOA 2X69A 4KMUC 5A2QL 4KTAA 1W2BA 1P16A 3WOFA 1GM5A 1XTCD 1FD7D 4AIMA 3MEFA 4GN5A 3OTOL 1MSGA 5CBAE 2QEJC 4CDDC 5EKLA 1YEZA 2A73B 4K2LA 1XMQQ 2ENBA 4NPSA 1EY9A 2B2WC 3A74A 2PQAB 1JB3A 3RZDB 4NXNL 2ZXRA 1SNDA 4DPGA 1SROA 2P5ZX 1WTVA 3BJUA 1L0WA 5IP9H 1U4MA 2F1MA 4HSVA 1STGA 4LAAA 3EVQA 1WTRA 4MHEA 2G5DA 1IYVA 4NMZA 5M3FH 1IL8A 1QG7A 2R6GA 4JI4Q 1ZXTA 2EYMA 1SNCA 5IT9c 3VR3A 2VQEL 1EZ6A 1FGUA 4X3TA 4DN4M 2MO1A 5JEAG 3CCUA 3M4YA 1YITA 2ICEC 4CKBA 2CVRA 3K59A 4JI0Q 1PTOH 4JG2A 5IYBH 4IFDG 2I0QA 3TQYA 4R4IA 3A8IE 1JOOA 3A7LA 4LK1C 4HCSA 2UUAQ 3BU2A 4OELB 3DXJC 1DOMA 3DWPA 2QKIC 2UUCL 2A69C 3S1QB 1PZID 1SJHD 2Y0SB 1D1KA 1SYFA 3S15H 2EQSA 3TP8A 1A15A 4BBSB 1G291 2RQXA 2KENA 3BYTB 3D31A 4DR2Q 3T4AC 4QB4A 2JA7H 5JJKA 3V96A 2SDFA 4HCEA 1AH9A 1D5MC 2WAQB 3U9SA 5KNBA 4B3TQ 1VDZA 3ULPA 1NUCA 2B3GA 1VQFA 4A3JB 4WJ4A 1CFMA 1BO0A 1A0IA 3GTJH 5EJWA 3L7ZC 1NSNS 1UE5A 1XJVA 3GDEA 2N55A 3VA5A 4LFAQ 1LTBD 1VQ4A 2Q2TA 3NEMA 3PUYA 1LM0A 1R4PB 1YZ6A 4XDXA 2IJ0A 5C44B 2JYOA 3E0JA 4AYBB 1K83B 1B2TA 1R4QB 2CW0C 4YWKA 2Q2HA 1L1OC 1CKNB 2JXMB 3J80L 1EOTA 1NE3A 2M2LA 3KLRA 3W2DA 4IUTA 3S17H 2CH4A 1XPRA 5EKKA 2NVQB 3HKZG 5LHY1 2F0OA 1VQDA 2OWOA 3PO2G 2N49A 2EOTA 3SXHA 4B3ML 2F0VA 5M3MB 3JAME 2MHVA 1EWHA 3PO2B 3HOYB 1BCPD 1R9TH 3OOCA 1O78A 4J8QA 1E24A 2MP1A 3T1YL 4A76A 4LF7L 3KJPA 4A3IB 2JQOA 2JA6G 3A54A 2VUMG 1EYAA 1TXYA 4HAEA 4P73A 4HEDA 3I3CA 5I6WA 1KAAA 1KD1C 3NHHA 1O7ZA 3KYHC 2OTJA 3HOXG 2NN6G 4JI5Q 3SK6A 4DUYQ 5JEAH 1NY4A 1TWGB 3LWEA 3RN2A 3K58A 4QJFA 4K0KL 3HRZC 3Q24A 5BN5A 1SAPA 3GTQH 2QF7A 3P7JA 2R7ZG 4IUPA 3URYA 2F0TA 2CFMA 4IFDH 2WB1E 4OWWB 3A8KE 4FXKC 4IURA 1IYJB 4JCVE 3KF8B 3MXNA 2RCFA 4DAVA 2SOBA 1F2MA 4HIOA 2QILA 1SE8A 3MTSA 2Z6KA 2DNCA 2OQ0A 2PZWA 1U9RA 3NTHA 4K8JA 4LW1A 4DV4Q 2E5LQ 1FYCA 2A74C 5DLQE 4IOAA 5JPNC 3WWVA 5IGEA 4ZUIA 4P71A 1JB7A 2YYZA 4LUOA 4ABNA 1HR0Q 2ZTCA 5AJ3L 2A6HC 1NR4A 2ZM6Q 4DV0Q 2R92H 4DGZA 1O80A 4NW2A 1WTQA 1H95A 1TS3A 3J81c 2FFKB 1PYSB 2EZVA 1YNXA 2EXZA 3KLWA 4RHRA 1S5FD 3S2DB 3JAMi 2F4VQ 4EQPA 2C5CA 3O13A 4G7ZC 1ONLA 4S3SA 1PFNA 2M9VA 2I5HA 1STNA 2H1EA 2OT2A 5IGDA 5C0XJ 1M1KC 5KEEA 1H9JA 4NXMQ 1KXLA 4HMJA 2N3SA 1H9RA 3NWSA 4EVOA 3ITPA 1IBKQ 1N32Q 1HFGA 3NBIA 2RKSA 5D3DA 5E1FA 4DV6Q 2OEOA 4B9XA 1PA6A 2BE5D 5IGBA 2NVXB 4C3JG 1Q8IA 1SE4A 4BA2I 4C3JB 2YTVA 3GTKH 2XRSD 4EQOA 1DM0B 3KK7A 4ZKBB 1Q3LA 1NMGA 4BY7G 2JEAI 1PFSA 3KFUA 3RN5A 3S2HH 2LKVA 2LXJA 3CC4A 4ID6A 1TVXA 2WB1B 4PG3A 3CPFA 1CKOA 4PZ7A 5E4WC 3NQIA 3GV3A 1QILA 3MVVA 4POGA 2NVYH 1ET6A 5HGQA 4TRDA 1LYLA 4LFBQ 3SEBA 2VQFQ 1CA6A 3GTPH 4KN7C 1X3FA 5I2XA 1TWHB 4L5SA 1RHPA 4YCWA 2XN9C 3I4MH 4BBRG 4DK3C 2L55A 5EBDA 5IT9L 1HA5A 1J9OA 2ZTEA 4EQNA 1PH5A 5C3EB 2A6EC 1G6PA 2N78A 4A3KG 1XPUA 1I6HH 4DAYA 3QJYA 4TVAB 1X32A 3GQBA 1YI2A 2Z6KC 4I7ZC 2JEBI 3K6OA 5F2DA 4MZ9A 1RL2A 3R3OA 5JOBA 2PQAA 4JBWA 5GAHC 4RMFA 4C3IB 2EYHA 4XYOA 1O7IA 1TU2B 1PH7A 1EQRA 1BUVT 4OEMB 1ASZA 2QEXA 1DGSA 3W5OA 4JI7L 1TS4A 1DD2A 3PO3B 5KYIA 2HDLA 2A8VA 4HMIA 2EY2A 1STBA 4O2DA 1Y1WG 2F0JA 1HCZA 1B9MA 2ZTDA 3OYYA 4WFN3 4J6HA 1KLUD 1IBMQ 4DR3Q 3HOUB 3BDCA 2XSCA 3HOWH 4C3HH 4BY1H 1LTGD 1NNXA 5GAGC 2L5TA 4KD4A 1TWCH 1B70B 2K5QA 1Q90A 1U4PA 5ELCA 3TRZA 3HG9A 1WFQA 2G9DA 1HUMA 3CHBD 1Y1VH 3QB3A 4JI3Q 4UP9A 4HJ7A 2DJGC 3A8JE 5FJ8G 1DOLA 3T1HL 4K6DA 4A93B 1PH9A 4KLKA 4A4IA 1I50B 2JSOA 3I4LA 1DYQA 4XIGS 4LF6Q 1GKHA 1Y69U 1HNZL 2NYZD 1J8IA 2A69D 3ZYYX 1VQIA 4BY7H 2AQ1B 1K3BC 3VR4A 4A3EB 1I3QH 3M9BA 4V190 2UXDQ 2F0EA 1JT8A 2DY8A 3FKIB 3LGJA 2ATWA 4B3RQ 1B3AA 1B9NA 1PV4A 4KHPL 4IPGA 1STHA 1LTID 3EQLC 3J81E 3Q0AA 1I4HA 1HTPA 1X55A 2F0GA 5IP7H 4A3BH 5K36H 1WCMH 4TSSA 4LF7Q 1AFPA 2RDFA 2A68C 1QVCA 3CRKC 3BYYB 2WP8J 2XNAC 2K01A 3OMCA 2K33A 2WACA 1CKNA 1XMOL 1WTHA 2SNSA 1UAPA 2E75C 1AW7A 2GVAA 1EYDA 3FMCA 4QCLA 4JOIA 5EPKA 1BBUA 2CW0D 1TWAB 2RHQB 4K0KQ 4C56C 4DR6Q 2JA8H 1X3PA 1UE7A 5CC4A 5A35A 2F0WA 3FP9A 4DK6C 2A5HA 2EPBA 2CWAA 5C4XH 5KIXA 1GUOA 2CWPA 4X3KA 3S9WA 3J80c 3NUCA 5LMNL 4HJ8A 1TIID 5ELEA 1PXUA 1LV9A 1P8LA 4WRDA 2WFWA 1G6ZA 2F0QA 2Z8LA 1EU4A 4IUNA 2YU9B 4QGUA 4KY5A 1ENCA 2OQKA 4KK7A 2L0CA 5I9PA 3K8AA 5IIFA 4NP5A 3H0GB 1B50A 2EY5A 3K7AB 4GNXB 4JBKA 1HQRD 3EROA 4UPAA 1LABA 2Z6BA 4QL5A 1CZWA 2R93H 1RCVD 1Q1BA 4IPHA 3D0FA 5IP9G 2O5IC 5M3FG 4N8X1 3KF8A 5EPLA 3UDIA 2KEEA 3H6MA 4R4TA 3I2ZA 3NTKA 3TP5A 3QOJA 1N8RC 2RSOA 4RGTA 1S3OA 2XTIA 3PUWA 3G6JB 1MKHA 4XYQA 4B3SQ 5NUCA 2ZXPA 4NKLA 4HIKA 1SFOB 1T5XD 1WJJA 2AQ3B 4GKKL 2I46A 4DXFA 4J15A 5CV6A 4EQ5A 1LTAD 2JA5H 4OONA 4X3UA 5A2QE 2BA0A 3PIPA 1YIJA 3CXCA 3DHQA 5G3LF 1A6XA 4FYDA 3GP7A 2A6HD 3NELA 3UI2A 1VQ5A 5M5XH 1I4GA 1DOKA 5C6AA 1PLFA 4DNTB 3F2CA 1JJGA 4K6LA 4DV7Q 4G4KA 4HJAA 1S5DD 3RLNA 4OGQC 2HHHQ 4LF4L 2JA7G 4ME5A 4X3SA 3NWTA 3K5NA 2JA7B 1FNVA 4NDXA 4X62Q 1M8AA 1KQSA 4JPBW 1PYBA 1IKMA 3VR2A 3HOZH 2EXDA 1HRJA 2F0FA 1WTXA 1ICFB 4QQBX 2NTSA 2PO4A 4FF2A 2HDMA 2LY7A 3OIQA 2JK8A 1M4VA 4APVA 2HCCA 1N9WA 2Q2UA 1EUJA 2I5LX 3R8BA 2Y0SE 4YHHQ 2Q8TA 1B8AA 1HNXL 4JV5L 3FPPA 3BZDB 3HFZB 3U4VA 3F2DA 2UUBL 1EYGA 2L4NA 3RD4A 2B2YA 3S14H 1S40A 3ULLA 1Y8PB 3OWEB 2WAQE 5C4ZA 1BQQT 1PH2A 1N33L 5C0XG 1UUPA 4JYAQ 1B53A 3J7AF 2UXBL 1ZEQX 2NTTA 2AKWB 3SE0A 3S24A 5JVH3 1XNQL 4ALPA 2MJ8A 4JI7Q 1IW7C 1YHQA 1H9SB 3W3AA 4JI6L 4BXXH 1XNRL 4XT3B 4H02A 4JVZA 3TSSA 1AE3A 2F0SA 4AYBE 1II3A 1B7YB 2I07B 1U4RA 4PZ6A 1KHIA 1X3QA 4X66L 2GN5A 3E3XA 3UE1A 1OTCA 3CCMA 4B08A 3GTLH 1K9MC 4MTKA 4G7HC 1S5CD 1GJXA 1VF7A 3J7ZC 1YNJC 2A6ED 4KKUA 5CYUA 4V0BA 1SE2A 2KCTA 1LT6D 5CMDA 1PMRA 1EY7A 4O0AA 1UNSA 1DXMA 1RODA 3RNUA 2J7ZA 2X6GA 3AB9A 1EFID 4R8IA 2F3WA 1CHQD 2XIWA 3E9HA 3VA7A 5BR8Q 2HQEA 3ND8A 1V1OA 5IOCA 4TQUS 3J80E 4O42A 1RD9D 1ICWA 2DNEA 4XTCS 4DF7A 1J5EQ 1U5KA 1Q8KA 1HZBA 4DAPA 3KDFB 3KBXA 4DK0A 3T13A 3T16A 4JI2L 3S1MB 1FNUA 1ESRA 4A3MG 3P20A 5LMUL 3IL8A 1S72A 4PQXA 2K50A 3TDQA 4ME3A 4JI1L 3GTGB 1W6JA 4KHPQ 3M85A 2R92G 3SK5A 1VQ6A 2N88A 5D14A 4H44C 3T51B 1CQFA 3UDXA 2ZT9C 2K5HA 3AEVA 4IFDI 1I94L 4PMBA 1A62A 2LXKA 3TS0A 1W6KA 1EFWA 2F52A 1VQHA 3OPOA 4HTHA 4ZAIA 4DV5Q 3PGZA 1SYGA 1Y8NB 2DJFC 1M90C 2E2JH 1XMOQ 1HH2P 1A8VA 3GTOB 1VMPA 3S16H 1BR9A 1PVOA 1Z47A 4F8MA 4X65Q 2IPKD 1SMYC 3I70A 2MGSA 3HKSA 4OO1G 2B2YC 1CI3M 3QO2A 3Q22A 1N34L 1IBLL 3H3VI 3FHWA 1L2FA 2QCPX 3MXUA 3EN2A 4ILWA 3SVMA 3EJIA 3K57A 2SEBD 5C0XH 1UE6A 1PH8A 4MN3A 4K5XA 3GV6A 3HKZB 2F0HA 1STEA 2K32A 3MA2B 4DR1L 3U9OA 3GTKB 4L63B 4ZKCB 1BBWA 4UP7A 3KLSA 3G71A 1T5EA 4DA2A 3J80i 3GTMH 1V9PA 3HOVH 2D62A 1LTRD 1E2WA 3S1RH 4DV3Q 2UXCQ 4PZ8A 2R7DA 2KHIA 3ERQA 2JA6B 2A68D 2VUMB 2MFIA 1ET9A 1X56A 1CK1A 3D3RA 3RZDH 3JC66 1FJGL 3GTPB 3I4MG 4RH6A 2DY7A 5CV4A 3CCEA 1SE3A 2DN8A 2D2CC 5LMNW 3CW2C 4LF9Q 2PZTA 3HOXB 4H7BA 4R9WA 2B63G 4IUUA 4N8FA 4DAMA 4U68A 2VZAA 1JE4A 5GROA 4PV1C 4Y52H 1Q46A 2R7ZB 2QW7A 3A55A 1I6VC 3LNNA 1ILQA 3VR5A 3F2BA 1IKLA 1EY0A 1HNWL 1Q86C 1K73C 2BDOA 3H09A 2E2IH 2RHSB 4X64L 4FF1A 2MQHA 1PH4A 5JJZA 4GNXA 2K7VA 4HR7B 4JI8L 3MAQA 4A3MH 1SNQA 1V1PB 1YHBA 1GO3E 2AMCB 4XXEA 2NN6I 2KCCA 1D5XC 1YNNC 3VYTA 4HIMA 4GKJL 3S1QH 2NBFA 1SR3A 3LWUA 2K4KA 1X9NA 3K81C 4EGVA 5TSSA 3A0JA 1EIFA 5JVG3 3G7LA 1PRTC 3KF6B 1EIGA 4LUVA 2E8GA 5IT9E 1LO5D 1VQJA 4YY3L 1QVFA 3HOWG 1SXTA 3U4ZA 4C3HG 4KKTA 3G4SA 3CU7A 3K7UC 4BY1G 4DR7L 2IL8A 3HOWB 2QDBA 3NE5B 1NJIC 1LT4D 1SYDA 1JC7A 2RSNA 4LFCL 3NXWA 3CMEA 4DR4L 1FL0A 4FO2A 1VQNA 2VB2X 2IX1A 4A3JH 3KBGA 4OO1H 2J0TD 1Q81C 3NP8A 4C2MH 5T1GA 1QJOA 1Y1VG 2E2DC 4MTNA 3X3MA 3DWQA 3IAYA 1MBYA 1GHJA 5H1SE 1LTLA 2HD3A 1OXVA 4LF5L 1KC8C 1W3SA 1N36Q 5C44H 1KAWA 4OX9L 1K83H 1JOKA 1UEAB 1ESFA 2EVBA 1QB5D 5C4JB 1EIYB 3PSIA 3ER0A 3CRLC 1YVCA 4R8NA 5M5WH 4BY7B 4A3DG 4AQYL 2F0UA 4HSPA 5HURA 3FRPB 2NVQH 3OTOQ 4DUZL 3M3YH 4R4CA 1J6QA 2LMCB 2SNMA 3T53B 3PIP3 2XRQD 2WV6D 1PRTF 1IZ6A 1Q12A 4RWSC 5M5YB 5D3IB 1G51A 1RKNA 4LJZC 1PH3A 1MJEA 4F88A 3HOYH 4DR5L 4NXNQ 5IP7G 4A3BG 5K36G 1WCMG 2YV5A 1JWSD 3PUZA 1Z9FA 1Y14B 1IL2A 4ZCKA 2B2UA 3I4NG 3A7AB 4A3IH 5JEAJ 1LUZA 3K5OA 4BBRB 4ULLA 1GUNA 2B63H 1HZ9A 3BVZA 4IPDA 2OF1A 4L5TA 4IFDJ 1MD2D 2F3VA 5FK9C 3PCOB 2VQEQ 3A5ZB 3PF4A 4A3KB 1C4QA 2AUKA 3D6CA 3LX0A 4OHJA 3M7NA 1TWGH 4F87A 2JA8G 1CSPA 3RLFA 2BH2A 4AH6A 2M00A 4GNXC 1OXUA 4QUCA 5ELDA 1H9SA 5CGKA 5C4XG 3CCVA 2PNHA 2ES2A 3TZUA 4RKLA 3HS0C 3OWFA 5KNDA 4LF8L 3IKJA 4CDCC 2VNUD 2UUCQ 1IW7D 4JW0A 1CQVA 1BKBA 1NMFA 1TT2A 1CUKA 2C9OA 4KY7A 2HIXA 3G48A 1ML0D 3K5LA 1GXDC 4A3CH 5LMUQ 5CR3A 5C3WA 1CT1D 1STYA 3SDZA 1S5BD 3Q23A 1Y1WB 1VQBA 2F0DA 1QZGA 5DNFA 4JI1Q 3EBEA 2RCNA 3F1ZA 1KDBA 5EKIA 1GHKA 1YNJD 2R93G 4IJLA 2E76C 3L3OC 4LMQD 4CHTB 1PTOC 1Q7YC 1C8CA 5T1IA 3S2DH 4G57A 5IODA 1QE6A 4UDUC 4CDFC 5KRUA 3H91A 4CGYB 3PF5A 4H13C 2FMCA 3KDFA 1Y8OB 4JI4L 1PRTB 1TWFB 2Z4HA 5IE8A 1SYCA 1I4QA 1VQ9A 1VQOA 1AE2A 2E74C 1N34Q 2PZUA 1B44D 4PNYA 4YIJA 2JA5G 1VCIA 2NVXH 3OW7A 4A3DH 2TMPA 2JA5B 3HEJA 3M4OH 1ILPA 1RDPD 2K5DA 4MIUA 3EIVA 1V1QA 4B3MQ 3SR1A 2UUAL 1OO9B 2PYKA 3DM3A 2EYOA 2F03A 4RA8A 1RTOA 1HZAA 3MXGA 2IHFA 3T1YQ 1VQAA 2QGQA 2B2UC 1FNWA 1PTOF 2NZHA 2F0KA 2L15A 3TZDA 3SK8A 2QA4A 3I4NH 5IGGA 1JJCB 4N9PA 1EQTA 1SN8A 3UDGA 3D8GA 1GOZA 4DR2L 1VQLA 5ELNA 1LT5D 3RMHA 1E2VA 3HOZG 4GLXA 2PI2A 1YHAA 2KEDA 1TWHH 4B3TL 2NVTB 3F8TA 4DK1A 3NQTA 1KTKA 5JPMC 1EU3A 1SMYD 2B29A 2F0NA 3PIO3 3T56B 1HUNA 3N6RA 3MEHA 1NAPA 5ELBA 4POFA 1SNMA 4LFAL 1TKWB 3CAMA 1HFNA 4RFBA 4GOPC 1SRUA 1O7LA 5KYLA 1HNWQ 4QY7A 2RDGA 4A3GH 3ICEA 1E3PA 1KLGD 4JI8Q 4WORA 4C3IH 3FDTA 5ISRA 4ZRZA 4C1NK 3VYUA 2L1BA 1BXTA 2NZOA 1B3QA 5AJ3Q 4BXXG 1CZGA 3C46A 3PO3H 1ZYRC 4CJ1B 4LNQA 3WDNA 1BCPF 1XPOA 4KN4C 3CF5A 2KCMA 2KVMA 5FLXL 1GD7A 2O5JC 4DKAC 3I91A 3J81i 2ALYB 1SNOA 2QDLA 2JA9A 4X6AH 3TN2A 4J1MA 4OIKA 1A63A 5M3FB 3HOUH 1X65A 2EYLA 1WYDA 4DR7Q 4DU9A 4YWLA 1QVGA 3CKIB 3VR6A 5FO7B 4LFCQ 2R7FA 1VQGA 1F77A 5CBEE 4JI5L 2IW3A 3NENA 1V1PA 2BA1A 5DEHA 2B8FA 5COYA 1D7QA 4Y7NH 1XYIA 2L12A 1PTOB 1FR3A 3H3VC 4KJOA 3L9AX 4XQQA 1D5ZC 1L0XB 3ERSX 1I50H 3CQZH 3AMUA 2FXQA 4N9TA 4EX5A 2OTLA 4I7AA 1YNND 3M7GA 3KF6A 2LFNA 4B9WA 4RCNA 4OWXB 2EDGA 2CHBD 4A3EH 1VQ8A 3S15B 1T9HA 2Z0SA 1CKMA 3A5UA 4WJWA 3FKIH 4DUZQ 1K0RA 1PRTD 2DUDA 1B1ZA 1I4RA 3K0YA 3OHXC 3CMAA 1LACA 5IYCH 1HR0L 1V8QA 1YBYA 2KBNA 2ZM6L 1O7YA 4RCOA 1WVLA 1GUSA 2E2HH 4P74A 1K3RA 4KHZA 1NR2A 3K80C 4BS9A 4CKCA 3GTJB 1F9QA 1C9OA 1KL9A 3CCLA 1BNZA 3TBIB 1YJNA 3F2UA 3DMUA 4CJ0B 1HHVA 1JICA 4NXML 3WOEA 2F3IA 2L9HA 1PYWD 1BCPB 4CDEC 5IYDH 3S1NH 2NZ1D 2MNAA 4DV6L 4U673 4A3FG 4QMGA 1EYCA 3S17B 3GD7A 4BWGB 3E0EA 3L0OA 3AQQA 2PQEA 3R2IA 5C3XA 3D4DA 4OIJA 3P75A 4IUVA 1VQPA 3R2TA 3ULJA 1R9TB 4FP5D 3HOVG 3NPPA 1VQCA 2AWOA 1K0SA 1A3VA 2YU9H 4MNOA 3RR5A 4GOPB 3HOVB 1VS0A 5IY0A 2BCOA 3K0XA 4IO9A 3S1RB 2L11A 1DCZA 1HPCA 3H0GH 2PI2E 2PPBC 3K7AH 3MFGA 1SNPA 4LFBL 2VQFL 2BH8A 1F9SA 3K5MA 1E1OA 3BS1A 3CPWA 3HKZE 4FXDA 5C0XI 4R4QA 4K5VA 4HJ5A 2KHSA 2RDHA 1UEBA 3PMFA 2ID0A 3OIPA 1TS5A 5DM73 5EAYA 1SJED 3CCJA 3GTQB 4KD3A 2B8GA 5JAVA 1JWMD 1ENAA 2HUGA 2IWHA 4HJ9A 3T1HQ 2IX3A 4K8IA 3NK9A 1WD1A 2XVSA 1HNZQ 1D2BA 3UE0A 4LUZA 3RZOH 4KKSA 1QZHA 1QNUA 2E2IB 1SFOH 2B2TC 2F0PA 1NBWA 3UDFA 4IALA 2F0IA 2KJXA 1X3GA 4JK1C 4TKOB 4A3MB 3NBHB 3DM1A 3ND9A 2WKDA 2EJGC 2Y0SG 4KHVA 2G9HD 2R92B 5K5PA 2FMMA 4XT1B 1TR5A 4RG1A 4BBSG 2Q8RE 1PTOD 1U4LA 3PIOA 3Q6SA 1WD0A 3I90A 2EE1A 2XGTA 1KRSA 1WI5A 2OCEA 3D4RA 1KRTA 5I4DA 3RUZA 1Z6HA 5I9OA 4QIWB 5IGCA 3HZXA 4KJNA 3VYRA 4GS3A 2WINB 2LS01 2PMZB 3KUPA 2WAQG 4XQNA 4DR3L 1IBML 5JJLA 4RGNA 2K6AA 3TREA 1YJWA 3W1GA 1MIUA 4A3JG 4PMWA 3KJOA 3IFDA 1LLRD 5ELFA 5FO8B 1Q1EA 1RF2D 2CH4W 1EIHA 4GN3B 4C2MB 1QOHA 1EY5A 3QIAA 4KV6A 1E0BA 2WKCA 4JI3L 4A3FH 5C44G 4AYBG 3H15A 3PUXA 1HZCA 5LMNQ 1K8AC 2DGYA 1KIXA 3L2PA 1AP0A 3ZJYC 1PZKD 1AZPA 3OMGA 4LF6L 2HCIA 4XQJA 5J3BA 1A2UA 3AFQA 1KDAA 1JJ2A 3C1FA 1K8OA 2OXPA 2WIIB 3S2HB 5M5WB 1EY6A 3J7A5 4UAIA 2UXDL 3M3YB 5M3MG 1XXGA 3CCSA 1MI2A 1QNKA 2NVYB 3J7AV 2ASBA 3HOYG 1PH6A 4OO1I 4B3RL 2PW5A 1S4ZA 5D65A 4P75A 1QUQB 2RA4A 2MUYA 3BVMA 3I4MB 4A3IG 3SGIA 1SYEA 4E6IA 2X6LA 4HIDA 3RLOA 3TS2A 3BZKA 1C0AA 3QG1A 2B63B 1JR0D 2PW7A 1XWEA 3CC7A 2B2VA 2LSSA 4ZLTF 3CCQA 2JE6I 1PH1A 5CV5A 1I6HB 4A3LG 4JBMA 1RIPA 3DWAA 3KOJA 1DZ1A 3E6ZX 3PUVA 2TSSA 4A75A 5IWAL 4DFAA 1JOQA 4H0LC 4GKKQ 3QWNA 4DR6L 4QUFA 1WTPA 4RAUC 3IFTA 3STBC 1LTSD 5FOBB 5FLMG 1GUGA 1FVIA 4UY8C 2ZXOA 2D0OA 2NB0A 5G3LD 2K04A 3I73A 1ZYRD 2GA4B 2KECA 3AU7A 3EFXD 5M9OA 3NTIA 4BA1I 3S1MH 2EIFA 4A3CG 3DUZA 4BBSH 3TEHB 2PNRC 2V1CC 2K03A 1CTMA 1H9KA 4LF4Q 4F7XA 3JAML 1JCKB 3GTGH 2KA7A 5EQ0A 5FLXc 3H3VH 1TQOA 4DV2L 4C3HB 3C3LA 1PDQA 4BY1B 3E9IA 1E7ZA 5E4XA 3C1EA 1TWCB 1AN8A 4L5RC 2ZJRA 1KDCA 3V05A 2AUJD 1HNXQ 4JV5Q 1DONA 3A56A 1A3TA 1Z7TA 1Y1VB 1JQYD 1JMCA 4OWTB 2BDNA 3CP0A 4YCVA 3GTOH 1X54A 2UUBQ 1K28A 2ICIA 3BG3A 4RGMA 2AQ2B 1VMCA 4P72A 1AZQA 1KNAA 2R61A 5EGTA 4DV1L 1HR0W 3KLSX 1U0LA 1I4PA 4B3SL 2K5VA 1EL0A 1N33Q 1I3QB 3U58A 4R1JA 1QWYA 4A3DB 3TMEA 1JORA 2UXBQ 2IY5B 1PZJD 2F0MA 3M4OB 4JBJA 3OW2A 3Q8DA 4GN4B 1ZKOA 4M1UB 5CV8A 5M3MH 1XNQQ 4FXGC 3PO2H 2IHEA 4IOCA 4JI6Q 1XNRQ 3QOLA 1D1IA 1KABA 1MGSA 5E3FA 2WB1G 1G2TA 1EQVA 4A3BB 1WCMB 4X66Q 1HQMC 4DV7L 2MO0A 3I4NB 4YWMA 3J81j 2JA6H 1L1OB 1BVSA 2A1AA 2HHHL 2VUMH 1WOCA 2B2VC 2D0PA 2MPMA 1G8ZD 2EY6A 4X62L 3PQIA 3V2TA 1MSHA 3SHLA 3DLLA 1MJCA 4Q0FA 4A3LH 1STAA 4CBVA 4RKBA 3HOXH 1RJTA 4CKEA 1I4XA 4GLAC 2NN6H 2VS1A 1XX8A 5C3EG 1G2SA 5EBCA 3TP6A 2UU9L 2B39A 2JA8B 2Q2IA 4YHHL 2HT1A 1JWUD 5CORA 4FF3A 2R7ZH 1I5FA 3I72A 5FLMH 5I6YA 1PFMA 5C4XB 2N8NA 2EJMA 3P1HA 4GOPA 1SLJA 1V43A 4UP8A 4A3GG 2EYJA 1SMXA 2EYFA 2Z4IA 4A3GB 5HGTA 1PFBA 3SK4A 4JI2Q 2D9UA 4C3IG 2K75A 1LT3D 4K5WA 1DJRD 2YTXA 4JYAL 2RBMA 2H5XA 5GADC 1PHJA 1OXTA 2RF4A 3I7FA 3I8ZA 1XMQL 3PO3G 2VXWA 4CJ2C 5I2YA 2KUMA 1BOSA 2R93B 1I94Q 1RTNA 4QF4A 2FJ2A 2CCZA 3X3NA 1CM9A 1IHZA 3M4PA 4ODGA 2EYPA 5C5MA 1Q82C 3HOUG 4OXPA 4PMCA 3HP3A 3VDYA 4C1NI 1UE1A 4GLVB 3DEPA 2AHOB 4I65A 4RHSA 1F2ZA 4K14A 3GO5A 4KY6A 1HXYD 2FINB 4IJHA 2IX0A 3NBHA 1IBLQ 2K28A 3FPUB 4JI0L 1ENFA 4Y7NB 1TY2A 4IPCA 5J1ZA 5BR8L 1A2TA 4ZK9B 4A93G 1TY0A 1XTDA 4C3JH 5LL6X 1J5EL 4DR1Q 5FKAC 2Q8IB 4YCUA 5EPJA 3MXPA 3CQZB 3HGBA 5C4JH 3MWYW 4M8AA 2K5NA 2KQ3A 1UWVA 4A3EG 4L5QA 5M5XB 1IXRA 2EJFC 4IZ8A 3CC2A 2ZJPA 3FKIG 1F2LA 2H4OA 2JP1A 5GQOA 4K2KA 5FLXE 1TS2A 5GAEC 5M5YH 5IYCG 3OSOA 1EY4A 1FJGQ 1BCPC 1F9PA 2NUCA 4UHVA 3HOZB 4DNRB 1BBXC 5IGFA 1X3EA 1B4OA 1C48A 4FF4A 4BBRH 2E2HB 4P2CB 3VYSA 3MC0B 5C3EH 3D6WA 1SEBD 4DV5L 2KHJA 2HIVA 2V4DA 1AEXA 4A3KH 4ZQ3A 5E7NA 4WJ3M 1BDOA 2VL6A 5CV7A 4X65L 4GZYC 1EEFD 3B6YA 5IWAQ 5IYDG 1SSOA 2GVBA 4X64Q 4IQZA 3MFYA 3S14B 4IN3A 1HJPA 3S1NB 5C4HA 1GVPA 1QUQA 2K52A 3BDOA 1EWIA 2K14A 3E5SA 2Z1CA 5BN4A 2VB3X 3BVGA 1SDFA 4ZYSA 4NB3A 2PCFB 4GKJQ 2KOLA 3G6EA 5DM63 3MZ5A 1E22A 1QCBD 1HTLD 3MXNB 3D4WA 3NSWA 1WTWA 2K05A 2A19A 2UXCL 3H0GG 4DV3L 4L8JA 4JC0A 1Y1WH 3QR8A 3J81L 2JN4A 1A3UA 5LL6S 4YY3Q 1X6OA 3GTLB 4KI0A 3C2PA 2B2WA 1EY8A 4DV2Q 1NCVA 1SYBA 4G7OC 2O2LD 3N52A 4DR4Q 1SBBB 2D5DA 5KGUA 4LWCA 4LF9L 4DUYL 1VQKA 3EA6A 2VW9A 2HQLA 2F4IA 1GUTA 4R4OA 2CKZB 1FGBD 2J4XA 4OL7A 3STBD 4RGOS 2RVLA 4LF5Q 4A93H 1VQ7A 1TWFH 1KNEA 5FJ8H 4OX9Q 3DEOA 4Z9CB
chains in the Genus database with same CATH topology
2FHTA 5KNCA 3BDLA 3RZOB 1EEID 3J7YW 3R93A 2B2TA 1BF4A 2BE5C 1D6EC 1H9MA 2AWNA 5CV9A 5BN3A 1IYUA 4ZUJA 1HA6A 2IT1A 2F0LA 3FEWX 2CQAA 3MHBA 1F2YA 2NWGA 1LTTD 2EY1A 4DXGA 5J22A 1G91A 4Q5VA 2XWJB 4HN7A 1EZ8A 5J39A 1CA5A 1S5ED 1CHPD 5AFWA 1F9RA 2K1BA 1OXSC 3H94A 1OXXK 4FNFA 1E2ZA 2BOSA 2R3ZA 2E2JB 4O1NA 5C5LA 3ONAB 1EWCA 2K5WA 3S16B 2KCNA 2O4XA 3PV0A 5FO9B 2XWBB 3TP7A 1L0YB 5DAUA 4L6TB 4FVMA 4A3FB 1K8MA 1VF5C 1WTOA 4IUQA 3FVQA 1GUWA 3GTMB 2X69A 4KMUC 5A2QL 4KTAA 3WOFA 1XTCD 1FD7D 1MSGA 5CBAE 2QEJC 5EKLA 2A73B 4K2LA 2ENBA 1EY9A 2B2WC 1JB3A 3RZDB 2ZXRA 1SNDA 1WTVA 1U4MA 2F1MA 4HSVA 1STGA 4LAAA 3EVQA 1WTRA 4MHEA 1IYVA 4NMZA 1IL8A 1QG7A 2R6GA 1ZXTA 2EYMA 1SNCA 3VR3A 1EZ6A 4X3TA 4DN4M 5JEAG 3M4YA 2ICEC 4CKBA 2CVRA 3K59A 1PTOH 4IFDG 3A8IE 1JOOA 3A7LA 4LK1C 4HCSA 3DXJC 1DOMA 3DWPA 2QKIC 2A69C 3S1QB 1PZID 1SJHD 2Y0SB 1D1KA 1SYFA 3TP8A 1A15A 4BBSB 1G291 2RQXA 3BYTB 3D31A 3T4AC 4QB4A 3V96A 2SDFA 4HCEA 1D5MC 2WAQB 3U9SA 5KNBA 1VDZA 1NUCA 4A3JB 1CFMA 1BO0A 5EJWA 3L7ZC 1NSNS 2N55A 3VA5A 1LTBD 3PUYA 1R4PB 4XDXA 2IJ0A 5C44B 2JYOA 3E0JA 4AYBB 1K83B 1B2TA 1R4QB 2CW0C 2JXMB 3J80L 1EOTA 2M2LA 3KLRA 3W2DA 4IUTA 5EKKA 2NVQB 5LHY1 2F0OA 2EOTA 3SXHA 2F0VA 5M3MB 3JAME 2MHVA 1EWHA 3PO2B 3HOYB 1BCPD 3OOCA 1O78A 4J8QA 2MP1A 4A3IB 3A54A 1EYAA 4HAEA 4HEDA 3I3CA 5I6WA 1KAAA 3NHHA 1O7ZA 2NN6G 3SK6A 5JEAH 1TWGB 3LWEA 3K58A 3HRZC 3Q24A 5BN5A 1SAPA 2QF7A 3P7JA 4IUPA 3URYA 2F0TA 4IFDH 3A8KE 4FXKC 4IURA 3MXNA 4DAVA 2SOBA 1F2MA 2QILA 3MTSA 2DNCA 2PZWA 1U9RA 3NTHA 4K8JA 1FYCA 2A74C 5JPNC 5IGEA 4ZUIA 2YYZA 4ABNA 2A6HC 1NR4A 4DGZA 1O80A 4NW2A 1WTQA 1TS3A 2FFKB 2EZVA 2EXZA 4RHRA 1S5FD 3S2DB 4EQPA 2C5CA 3O13A 4G7ZC 1ONLA 4S3SA 1PFNA 2M9VA 1STNA 2H1EA 2OT2A 5IGDA 5C0XJ 5KEEA 1H9JA 4HMJA 1H9RA 3NWSA 4EVOA 3ITPA 1HFGA 3NBIA 2RKSA 5D3DA 5E1FA 2OEOA 4B9XA 2NVXB 2BE5D 5IGBA 4C3JG 1Q8IA 1SE4A 4BA2I 4C3JB 2XRSD 4EQOA 1DM0B 3KK7A 4ZKBB 1Q3LA 2JEAI 2LKVA 4ID6A 1TVXA 2WB1B 5E4WC 3NQIA 3GV3A 1QILA 3MVVA 1ET6A 4TRDA 3SEBA 1CA6A 4KN7C 5I2XA 1TWHB 1RHPA 2XN9C 2L55A 5EBDA 5IT9L 1HA5A 1J9OA 4EQNA 5C3EB 2A6EC 4DAYA 3QJYA 1X32A 3GQBA 4I7ZC 2JEBI 3K6OA 5F2DA 3R3OA 5JOBA 4JBWA 4C3IB 2EYHA 4XYOA 1TU2B 1BUVT 1TS4A 1DD2A 3PO3B 5KYIA 2HDLA 4HMIA 2EY2A 1STBA 2F0JA 1HCZA 1B9MA 4WFN3 4J6HA 1KLUD 3HOUB 3BDCA 2XSCA 1LTGD 4KD4A 2L5TA 2K5QA 1Q90A 1U4PA 5ELCA 3HG9A 2G9DA 1HUMA 3CHBD 3QB3A 3A8JE 1DOLA 4K6DA 4A93B 1I50B 2JSOA 3I4LA 1DYQA 4XIGS 1Y69U 2NYZD 1J8IA 2A69D 3ZYYX 2AQ1B 3VR4A 4A3EB 4V190 2F0EA 2DY8A 3FKIB 1B3AA 1B9NA 1STHA 1LTID 3EQLC 3J81E 3Q0AA 1I4HA 1HTPA 2F0GA 5K36H 4TSSA 1AFPA 2RDFA 2A68C 3CRKC 3BYYB 2WP8J 2XNAC 2K01A 3OMCA 2K33A 2WACA 2SNSA 1UAPA 2E75C 1AW7A 1EYDA 3FMCA 4QCLA 5EPKA 2CW0D 1TWAB 4C56C 1X3PA 5CC4A 5A35A 2F0WA 2A5HA 2EPBA 5KIXA 1GUOA 4X3KA 3S9WA 3NUCA 1TIID 5ELEA 1PXUA 1LV9A 4WRDA 1G6ZA 2F0QA 2Z8LA 1EU4A 4IUNA 2YU9B 4KY5A 1ENCA 4KK7A 2L0CA 5I9PA 5IIFA 4NP5A 3H0GB 1B50A 2EY5A 3K7AB 1HQRD 3EROA 1LABA 1CZWA 1RCVD 1Q1BA 2O5IC 3KF8A 5EPLA 2KEEA 3H6MA 3NTKA 3TP5A 3QOJA 2RSOA 4RGTA 3PUWA 3G6JB 4XYQA 5NUCA 2ZXPA 4NKLA 1SFOB 1T5XD 2AQ3B 2I46A 4DXFA 5CV6A 1LTAD 4X3UA 5A2QE 2BA0A 3DHQA 5G3LF 1A6XA 4FYDA 3GP7A 2A6HD 3UI2A 1I4GA 1DOKA 5C6AA 1PLFA 4DNTB 4K6LA 4G4KA 1S5DD 4OGQC 4ME5A 4X3SA 3NWTA 3K5NA 2JA7B 1FNVA 4NDXA 1M8AA 1IKMA 3VR2A 1HRJA 2F0FA 1WTXA 2NTSA 2PO4A 4FF2A 2HDMA 2LY7A 3OIQA 1M4VA 2HCCA 3R8BA 2Q8TA 3FPPA 3BZDB 2L4NA 3RD4A 2B2YA 1Y8PB 3OWEB 5C4ZA 1BQQT 5C0XG 1UUPA 1B53A 3J7AF 1ZEQX 2NTTA 3SE0A 5JVH3 2MJ8A 1IW7C 1H9SB 3W3AA 4XT3B 3TSSA 2F0SA 1II3A 2I07B 1U4RA 1X3QA 4B08A 4G7HC 1S5CD 1GJXA 1VF7A 1YNJC 2A6ED 4KKUA 5CYUA 4V0BA 1SE2A 1LT6D 5CMDA 1PMRA 1EY7A 1UNSA 1DXMA 1RODA 2J7ZA 2X6GA 3AB9A 1EFID 4R8IA 2F3WA 1CHQD 2XIWA 3VA7A 2HQEA 3ND8A 1V1OA 5IOCA 4TQUS 3J80E 4O42A 1RD9D 1ICWA 2DNEA 4XTCS 4DF7A 4DAPA 3KBXA 4DK0A 3T13A 3T16A 3S1MB 1FNUA 1ESRA 3P20A 3IL8A 4PQXA 3TDQA 3GTGB 1W6JA 3M85A 3SK5A 2N88A 5D14A 4H44C 3T51B 1CQFA 2ZT9C 4IFDI 4PMBA 1W6KA 3OPOA 4HTHA 4ZAIA 1SYGA 1Y8NB 3GTOB 1VMPA 1BR9A 1Z47A 4F8MA 2IPKD 1SMYC 3I70A 2MGSA 4OO1G 2B2YC 1CI3M 3QO2A 3Q22A 2QCPX 3MXUA 4ILWA 3SVMA 3EJIA 3K57A 2SEBD 5C0XH 4MN3A 4K5XA 3GV6A 3HKZB 2F0HA 1STEA 2K32A 3MA2B 3U9OA 3GTKB 4L63B 4ZKCB 3KLSA 1T5EA 4DA2A 2D62A 1LTRD 1E2WA 3ERQA 2JA6B 2A68D 2VUMB 1ET9A 1CK1A 3D3RA 3GTPB 4RH6A 2DY7A 5CV4A 1SE3A 2DN8A 2D2CC 2PZTA 3HOXB 4H7BA 4R9WA 4IUUA 4U68A 1JE4A 4PV1C 2R7ZB 3A55A 1I6VC 3LNNA 1ILQA 3VR5A 1IKLA 1EY0A 2BDOA 3H09A 4FF1A 5JJZA 2K7VA 4HR7B 3MAQA 1SNQA 1V1PB 4XXEA 2NN6I 2KCCA 1D5XC 1YNNC 3VYTA 2NBFA 3LWUA 4EGVA 5TSSA 5JVG3 3G7LA 1PRTC 1EIGA 5IT9E 1LO5D 1SXTA 4C3HG 4KKTA 3CU7A 2IL8A 3HOWB 2QDBA 3NE5B 1LT4D 1SYDA 1JC7A 2RSNA 3NXWA 4FO2A 2VB2X 2IX1A 3KBGA 4OO1H 2J0TD 3NP8A 5T1GA 1QJOA 2E2DC 3X3MA 3DWQA 3IAYA 1MBYA 1GHJA 1OXVA 1JOKA 1UEAB 1ESFA 2EVBA 1QB5D 5C4JB 3CRLC 4R8NA 4BY7B 2F0UA 4HSPA 5HURA 3FRPB 2LMCB 2SNMA 3T53B 3PIP3 2XRQD 2WV6D 1PRTF 1Q12A 4RWSC 5M5YB 5D3IB 1RKNA 4LJZC 4F88A 5K36G 1JWSD 3PUZA 2B2UA 3A7AB 5JEAJ 3K5OA 4BBRB 4ULLA 1GUNA 3BVZA 2OF1A 4IFDJ 1MD2D 2F3VA 5FK9C 4A3KB 1C4QA 2AUKA 3D6CA 3LX0A 4OHJA 3M7NA 4F87A 3RLFA 2M00A 1OXUA 4QUCA 5ELDA 1H9SA 5CGKA 3TZUA 4RKLA 3HS0C 3OWFA 5KNDA 3IKJA 2VNUD 1IW7D 1CQVA 1TT2A 2C9OA 4KY7A 1ML0D 3K5LA 1GXDC 5CR3A 5C3WA 1CT1D 1STYA 3SDZA 1S5BD 3Q23A 1Y1WB 2F0DA 5DNFA 1KDBA 5EKIA 1GHKA 1YNJD 2E76C 3L3OC 4LMQD 4CHTB 1PTOC 1C8CA 5T1IA 4G57A 5IODA 1QE6A 4UDUC 5KRUA 3H91A 4CGYB 4H13C 2FMCA 1Y8OB 1PRTB 1TWFB 2Z4HA 1SYCA 1I4QA 2E74C 2PZUA 1B44D 4PNYA 4YIJA 1VCIA 3OW7A 2TMPA 2JA5B 3HEJA 1ILPA 1RDPD 2K5DA 4MIUA 3SR1A 1OO9B 2PYKA 2EYOA 2F03A 4RA8A 1RTOA 3MXGA 2B2UC 1FNWA 1PTOF 2F0KA 3TZDA 3SK8A 5IGGA 4N9PA 1EQTA 3D8GA 1GOZA 1LT5D 3RMHA 1E2VA 2KEDA 2NVTB 4DK1A 3NQTA 1KTKA 5JPMC 1EU3A 1SMYD 2F0NA 3PIO3 3T56B 1HUNA 3N6RA 3MEHA 1NAPA 5ELBA 1SNMA 1TKWB 1HFNA 4RFBA 1O7LA 5KYLA 2RDGA 1KLGD 4WORA 3FDTA 5ISRA 4ZRZA 4C1NK 3VYUA 2L1BA 1BXTA 1CZGA 3C46A 1ZYRC 4CJ1B 3WDNA 1BCPF 4KN4C 2KVMA 5FLXL 2O5JC 3I91A 1SNOA 3TN2A 4J1MA 4OIKA 5M3FB 2EYLA 4DU9A 3CKIB 3VR6A 5FO7B 1F77A 5CBEE 2IW3A 1V1PA 2BA1A 5DEHA 2B8FA 5COYA 1XYIA 2L12A 1PTOB 1FR3A 3H3VC 4KJOA 3L9AX 4XQQA 1D5ZC 1L0XB 3AMUA 4N9TA 1YNND 3M7GA 2LFNA 4B9WA 4RCNA 2EDGA 2CHBD 3S15B 4WJWA 1PRTD 1B1ZA 1I4RA 3K0YA 3OHXC 1LACA 1V8QA 1O7YA 4RCOA 1WVLA 1GUSA 4KHZA 1NR2A 4BS9A 4CKCA 3GTJB 1F9QA 1BNZA 3TBIB 3F2UA 3DMUA 4CJ0B 1HHVA 1JICA 3WOEA 2L9HA 1PYWD 1BCPB 2NZ1D 4U673 4QMGA 1EYCA 3S17B 3GD7A 4BWGB 2PQEA 3R2IA 5C3XA 3D4DA 4OIJA 3P75A 4IUVA 3R2TA 1R9TB 4FP5D 3NPPA 2AWOA 1A3VA 3HOVB 2BCOA 3S1RB 2L11A 1DCZA 1HPCA 2PPBC 3MFGA 1SNPA 1F9SA 3K5MA 3BS1A 4FXDA 5C0XI 4K5VA 2KHSA 2RDHA 3PMFA 2ID0A 3OIPA 1TS5A 5DM73 1SJED 3GTQB 4KD3A 2B8GA 5JAVA 2IWHA 1JWMD 1ENAA 2HUGA 2IX3A 4K8IA 3NK9A 1WD1A 2XVSA 1D2BA 4KKSA 1QNUA 2E2IB 2B2TC 2F0PA 4IALA 2F0IA 2KJXA 4JK1C 4TKOB 4A3MB 3DM1A 3ND9A 2WKDA 2EJGC 4KHVA 2G9HD 2R92B 5K5PA 2FMMA 4XT1B 1TR5A 2Q8RE 1PTOD 1U4LA 3Q6SA 1WD0A 3I90A 2EE1A 5I4DA 3D4RA 3RUZA 1Z6HA 5I9OA 4QIWB 5IGCA 3HZXA 4KJNA 3VYRA 2WINB 2LS01 2PMZB 3KUPA 4XQNA 4RGNA 2K6AA 4PMWA 3IFDA 1LLRD 5ELFA 5FO8B 1Q1EA 1RF2D 1EIHA 4C2MB 1QOHA 1EY5A 3QIAA 4KV6A 1E0BA 2WKCA 3PUXA 1AP0A 1PZKD 1AZPA 3OMGA 2HCIA 4XQJA 1A2UA 1KDAA 1K8OA 3C1FA 2OXPA 2WIIB 3S2HB 5M5WB 1EY6A 4UAIA 3M3YB 1XXGA 1MI2A 1QNKA 2NVYB 3J7AV 4OO1I 2PW5A 1S4ZA 5D65A 2RA4A 2MUYA 3BVMA 3I4MB 1SYEA 4E6IA 2X6LA 3QG1A 2B63B 1JR0D 2PW7A 1XWEA 2B2VA 4ZLTF 2JE6I 5CV5A 1I6HB 3DWAA 1DZ1A 3E6ZX 3PUVA 2TSSA 4DFAA 1JOQA 4H0LC 3QWNA 4QUFA 1WTPA 4RAUC 3IFTA 5FOBB 1LTSD 1GUGA 2ZXOA 2NB0A 5G3LD 2K04A 3I73A 1ZYRD 2GA4B 2KECA 3AU7A 3EFXD 5M9OA 3NTIA 4BA1I 3DUZA 2PNRC 2K03A 1CTMA 1H9KA 4F7XA 3JAML 1JCKB 2KA7A 5EQ0A 1TQOA 4C3HB 3C3LA 1PDQA 4BY1B 5E4XA 3C1EA 1TWCB 1AN8A 1KDCA 3V05A 2AUJD 1DONA 3A56A 1A3TA 1Z7TA 1Y1VB 1JQYD 2BDNA 2ICIA 3BG3A 4RGMA 2AQ2B 1VMCA 1AZQA 1KNAA 2R61A 5EGTA 3KLSX 1I4PA 1EL0A 1I3QB 1QWYA 4A3DB 3TMEA 1JORA 1PZJD 2F0MA 3M4OB 1ZKOA 4M1UB 5CV8A 4FXGC 3QOLA 1D1IA 1KABA 1MGSA 5E3FA 1G2TA 1EQVA 4A3BB 1WCMB 1HQMC 3I4NB 2B2VC 2MPMA 1G8ZD 2EY6A 3V2TA 1MSHA 3SHLA 4Q0FA 1STAA 4CBVA 4RKBA 1RJTA 4CKEA 1I4XA 2NN6H 1XX8A 1G2SA 5EBCA 3TP6A 2B39A 2JA8B 1JWUD 5CORA 4FF3A 3I72A 5I6YA 1PFMA 5C4XB 2EJMA 3P1HA 1V43A 2EYJA 2EYFA 2Z4IA 4A3GB 5HGTA 1PFBA 3SK4A 2D9UA 4C3IG 1LT3D 4K5WA 1DJRD 2RBMA 1OXTA 3I8ZA 2VXWA 4CJ2C 5I2YA 2KUMA 1BOSA 2R93B 1RTNA 4QF4A 2FJ2A 3X3NA 1CM9A 1IHZA 4ODGA 2EYPA 5C5MA 4PMCA 3HP3A 4C1NI 3DEPA 4I65A 4RHSA 1F2ZA 4K14A 3GO5A 4KY6A 1HXYD 2FINB 2IX0A 3NBHA 2K28A 3FPUB 1ENFA 4Y7NB 1TY2A 5J1ZA 1A2TA 4ZK9B 1TY0A 5LL6X 5FKAC 2Q8IB 5EPJA 3MXPA 3CQZB 3HGBA 3MWYW 4M8AA 2KQ3A 5M5XB 2EJFC 4IZ8A 1F2LA 2H4OA 2JP1A 4K2KA 5FLXE 1TS2A 3OSOA 1EY4A 1BCPC 1F9PA 2NUCA 3HOZB 4DNRB 1BBXC 5IGFA 1B4OA 1C48A 4FF4A 2E2HB 4P2CB 3VYSA 3MC0B 3D6WA 1SEBD 2V4DA 1AEXA 4ZQ3A 1BDOA 5CV7A 4GZYC 1EEFD 1SSOA 4IQZA 3MFYA 3S14B 4IN3A 3S1NB 5C4HA 3BDOA 3E5SA 2Z1CA 5BN4A 2VB3X 3BVGA 1SDFA 4ZYSA 2PCFB 2KOLA 5DM63 3MZ5A 1QCBD 1HTLD 3D4WA 3NSWA 1WTWA 2K05A 4L8JA 3J81L 1A3UA 5LL6S 3GTLB 4KI0A 3C2PA 2B2WA 1EY8A 1NCVA 1SYBA 4G7OC 2O2LD 3N52A 1SBBB 2D5DA 5KGUA 3EA6A 2F4IA 1GUTA 1FGBD 2J4XA 4OL7A 4RGOS 2RVLA 1KNEA 3DEOA 4Z9CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOC A;  1O78 A;  1Q90 A;  5KNC A;  1IW7 D;  3ND9 A;  1GUS A;  1IYV A;  4H0L C;  4BA2 I;  1SMY C;  5C0X G;  1TKW B;  2EJG C;  2R6G A;  4KHZ A;  4OO1 G;  1LAB A;  3IFT A;  4KKT A;  3VR3 A;  1CI3 M;  1O7L A;  1GUG A;  1Q1B A;  2NN6 H;  3SE0 A;  2BE5 C;  3NE5 B;  1H9M A;  2JEA I;  3A8J E;  3SDZ A;  5BN3 A;  1IYU A;  2O5I C;  1IW7 C;  3MXU A;  5JEA G;  3M4Y A;  1H9S B;  3D4R A;  3I4L A;  3W3A A;  2IT1 A;  4DNR B;  1Z6H A;  4XIG S;  5C0X H;  3I73 A;  4OO1 H;  1GHK A;  1Y69 U;  3I72 A;  2K32 A;  2A69 D;  4BA1 I;  1QJO A;  2E76 C;  4IFD G;  2NN6 G;  2EJM A;  1V43 A;  2PNR C;  3VR4 A;  1CTM A;  1H9K A;  1T5E A;  3A8I E;  5JEA H;  3PUW A;  1GHJ A;  3A7L A;  4LK1 C;  1OXV A;  4G7H C;  1GJX A;  1VF7 A;  4KN7 C;  3DXJ C;  1YNJ C;  1ZYR C;  2A6E D;  4KKU A;  2KA7 A;  2D62 A;  2V4D A;  2QF7 A;  5BN5 A;  3GD7 A;  3WDN A;  2A69 C;  1E2W A;  1Q1E A;  2EVB A;  4KN4 C;  4H13 C;  1BDO A;  1B9N A;  4IFD H;  4GZY C;  1Y8O B;  3A8K E;  1PMR A;  3EQL C;  2A68 D;  1OXS C;  2O5J C;  3H94 A;  1OXX K;  1DXM A;  1E2Z A;  2BA0 A;  3CRL C;  3MFY A;  3QIA A;  4IQZ A;  1G29 1;  1HTP A;  1OXT A;  3AB9 A;  2A6E C;  5K36 H;  1A6X A;  3VA7 A;  2AWO A;  3PUX A;  3D31 A;  2DNC A;  3PV0 A;  2LMC B;  3T53 B;  3QJY A;  2AUJ D;  2E74 C;  3GQB A;  3BDO A;  3ND8 A;  1Q12 A;  2A68 C;  2D2C C;  2A6H D;  2DN8 A;  4TQU S;  3VR6 A;  5BN4 A;  1VCI A;  1Z7T A;  3CRK C;  2DNE A;  1DCZ A;  4LJZ C;  4XTC S;  5KNB A;  1FYC A;  3OW7 A;  3U9S A;  1HPC A;  2PPB C;  2PCF B;  4I7Z C;  1VDZ A;  1K8O A;  2K33 A;  2JEB I;  4DNT B;  5K36 G;  3PUZ A;  2YYZ A;  3BG3 A;  2BA1 A;  2B8F A;  2E75 C;  4OGQ C;  4PV1 C;  3FMC A;  1CFM A;  3A7A B;  4DK0 A;  2A6H C;  4JBW A;  1K8M A;  1FR3 A;  1VF5 C;  3L7Z C;  1TU2 B;  1I6V C;  1GUN A;  3LNN A;  3VR5 A;  3VR2 A;  4L8J A;  3P20 A;  2BDO A;  3PUY A;  4KMU C;  4KI0 A;  5A35 A;  1DD2 A;  4G7Z C;  1ONL A;  3M85 A;  2B8G A;  4G7O C;  1ZKO A;  2AUK A;  2K7V A;  4HR7 B;  2CW0 C;  4RCN A;  1GUO A;  2D5D A;  4H44 C;  4TKO B;  3T51 B;  2EDG A;  2JXM B;  3M7N A;  1H9J A;  2ZT9 C;  1E2V A;  3QG1 A;  1HCZ A;  1B9M A;  3FPP A;  3KLR A;  3RLF A;  2NN6 I;  2KCC A;  1YNN C;  2Q8I B;  1OXU A;  4KKS A;  2JE6 I;  1GUT A;  4DK1 A;  1H9R A;  1HQM C;  1H9S A;  3HGB A;  3OPO A;  3LWU A;  1LAC A;  3T56 B;  3TZU A;  3N6R A;  3PUV A;  1V8Q A;  5KND A;  1Y8N B;  1EWH A;  2F1M A;  2BE5 D;  2EJF C;  2L5T A;  4JK1 C;  3IKJ A;  1Y8P B; 
#chains in the Genus database with same CATH topology
 3CD6 A;  2FHT A;  5KNC A;  3BDL A;  4DV1 Q;  5HY6 A;  1MHW C;  1VQM A;  1EQQ A;  3RZO B;  2C35 B;  5IYB G;  1EEI D;  3CCR A;  3J7Y W;  3R93 A;  2B2T A;  4AQY Q;  1BF4 A;  3I55 A;  2BE5 C;  5L37 A;  1D6E C;  1H9M A;  1YJ9 A;  2AWN A;  4DNI A;  4DV4 L;  5CV9 A;  5BN3 A;  1IYU A;  4ZUJ A;  2E5L L;  1HA6 A;  2IT1 A;  2F0L A;  3FEW X;  1D8L A;  5ELO A;  2CQA A;  3MHB A;  1E1T A;  1F2Y A;  2NWG A;  1C7Y A;  4DR5 Q;  1LTT D;  4DV0 L;  2EY1 A;  1EOV A;  4DXG A;  5J22 A;  1G91 A;  3JAM c;  1JE5 A;  3M4Q A;  4Q5V A;  3AYH B;  3AFP A;  2XWJ B;  4HN7 A;  1EZ8 A;  5J39 A;  1CA5 A;  2F4V L;  1S5E D;  3I4O A;  1CHP D;  1ASY A;  2Z9H A;  5AFW A;  2VY3 A;  1CSQ A;  1F9R A;  2K1B A;  1OXS C;  4FDB A;  3H94 A;  1OXX K;  4FNF A;  1E2Z A;  2BOS A;  2R3Z A;  2JJQ A;  2E2J B;  4O1N A;  5C5L A;  3ONA B;  1VQE A;  2NVT H;  1EWC A;  2K5W A;  3S16 B;  2KCN A;  2O4X A;  1NTG A;  3BZC A;  3PV0 A;  4JOI C;  5FO9 B;  1TWA H;  2XWB B;  3IRB A;  3TP7 A;  1L0Y B;  1IBK L;  5DAU A;  1N32 L;  2UU9 Q;  4L6T B;  3W1B A;  4FVM A;  3U50 C;  4A3F B;  3I56 A;  1K8M A;  1N36 L;  4QIW E;  2ZJQ A;  2I5M X;  4LF8 Q;  1VF5 C;  1WTO A;  4IUQ A;  2YTY A;  1K8G A;  2PMZ E;  3FVQ A;  5JJI A;  1GUW A;  1L1O A;  3GTM B;  4DAY B;  2CQO A;  2X69 A;  4KMU C;  5A2Q L;  4KTA A;  1W2B A;  1P16 A;  3WOF A;  1GM5 A;  1XTC D;  1FD7 D;  4AIM A;  3MEF A;  4GN5 A;  3OTO L;  1MSG A;  5CBA E;  2QEJ C;  4CDD C;  5EKL A;  1YEZ A;  2A73 B;  4K2L A;  1XMQ Q;  2ENB A;  4NPS A;  1EY9 A;  2B2W C;  3A74 A;  2PQA B;  1JB3 A;  3RZD B;  4NXN L;  2ZXR A;  1SND A;  4DPG A;  1SRO A;  2P5Z X;  1WTV A;  3BJU A;  1L0W A;  5IP9 H;  1U4M A;  2F1M A;  4HSV A;  1STG A;  4LAA A;  3EVQ A;  1WTR A;  4MHE A;  2G5D A;  1IYV A;  4NMZ A;  5M3F H;  1IL8 A;  1QG7 A;  2R6G A;  4JI4 Q;  1ZXT A;  2EYM A;  1SNC A;  5IT9 c;  3VR3 A;  2VQE L;  1EZ6 A;  1FGU A;  4X3T A;  4DN4 M;  2MO1 A;  5JEA G;  3CCU A;  3M4Y A;  1YIT A;  2ICE C;  4CKB A;  2CVR A;  3K59 A;  4JI0 Q;  1PTO H;  4JG2 A;  5IYB H;  4IFD G;  2I0Q A;  3TQY A;  4R4I A;  3A8I E;  1JOO A;  3A7L A;  4LK1 C;  4HCS A;  2UUA Q;  3BU2 A;  4OEL B;  3DXJ C;  1DOM A;  3DWP A;  2QKI C;  2UUC L;  2A69 C;  3S1Q B;  1PZI D;  1SJH D;  2Y0S B;  1D1K A;  1SYF A;  3S15 H;  2EQS A;  3TP8 A;  1A15 A;  4BBS B;  1G29 1;  2RQX A;  2KEN A;  3BYT B;  3D31 A;  4DR2 Q;  3T4A C;  4QB4 A;  2JA7 H;  5JJK A;  3V96 A;  2SDF A;  4HCE A;  1AH9 A;  1D5M C;  2WAQ B;  3U9S A;  5KNB A;  4B3T Q;  1VDZ A;  3ULP A;  1NUC A;  2B3G A;  1VQF A;  4A3J B;  4WJ4 A;  1CFM A;  1BO0 A;  1A0I A;  3GTJ H;  5EJW A;  3L7Z C;  1NSN S;  1UE5 A;  1XJV A;  3GDE A;  2N55 A;  3VA5 A;  4LFA Q;  1LTB D;  1VQ4 A;  2Q2T A;  3NEM A;  3PUY A;  1LM0 A;  1R4P B;  1YZ6 A;  4XDX A;  2IJ0 A;  5C44 B;  2JYO A;  3E0J A;  4AYB B;  1K83 B;  1B2T A;  1R4Q B;  2CW0 C;  4YWK A;  2Q2H A;  1L1O C;  1CKN B;  2JXM B;  3J80 L;  1EOT A;  1NE3 A;  2M2L A;  3KLR A;  3W2D A;  4IUT A;  3S17 H;  2CH4 A;  1XPR A;  5EKK A;  2NVQ B;  3HKZ G;  5LHY 1;  2F0O A;  1VQD A;  2OWO A;  3PO2 G;  2N49 A;  2EOT A;  3SXH A;  4B3M L;  2F0V A;  5M3M B;  3JAM E;  2MHV A;  1EWH A;  3PO2 B;  3HOY B;  1BCP D;  1R9T H;  3OOC A;  1O78 A;  4J8Q A;  1E24 A;  2MP1 A;  3T1Y L;  4A76 A;  4LF7 L;  3KJP A;  4A3I B;  2JQO A;  2JA6 G;  3A54 A;  2VUM G;  1EYA A;  1TXY A;  4HAE A;  4P73 A;  4HED A;  3I3C A;  5I6W A;  1KAA A;  1KD1 C;  3NHH A;  1O7Z A;  3KYH C;  2OTJ A;  3HOX G;  2NN6 G;  4JI5 Q;  3SK6 A;  4DUY Q;  5JEA H;  1NY4 A;  1TWG B;  3LWE A;  3RN2 A;  3K58 A;  4QJF A;  4K0K L;  3HRZ C;  3Q24 A;  5BN5 A;  1SAP A;  3GTQ H;  2QF7 A;  3P7J A;  2R7Z G;  4IUP A;  3URY A;  2F0T A;  2CFM A;  4IFD H;  2WB1 E;  4OWW B;  3A8K E;  4FXK C;  4IUR A;  1IYJ B;  4JCV E;  3KF8 B;  3MXN A;  2RCF A;  4DAV A;  2SOB A;  1F2M A;  4HIO A;  2QIL A;  1SE8 A;  3MTS A;  2Z6K A;  2DNC A;  2OQ0 A;  2PZW A;  1U9R A;  3NTH A;  4K8J A;  4LW1 A;  4DV4 Q;  2E5L Q;  1FYC A;  2A74 C;  5DLQ E;  4IOA A;  5JPN C;  3WWV A;  5IGE A;  4ZUI A;  4P71 A;  1JB7 A;  2YYZ A;  4LUO A;  4ABN A;  1HR0 Q;  2ZTC A;  5AJ3 L;  2A6H C;  1NR4 A;  2ZM6 Q;  4DV0 Q;  2R92 H;  4DGZ A;  1O80 A;  4NW2 A;  1WTQ A;  1H95 A;  1TS3 A;  3J81 c;  2FFK B;  1PYS B;  2EZV A;  1YNX A;  2EXZ A;  3KLW A;  4RHR A;  1S5F D;  3S2D B;  3JAM i;  2F4V Q;  4EQP A;  2C5C A;  3O13 A;  4G7Z C;  1ONL A;  4S3S A;  1PFN A;  2M9V A;  2I5H A;  1STN A;  2H1E A;  2OT2 A;  5IGD A;  5C0X J;  1M1K C;  5KEE A;  1H9J A;  4NXM Q;  1KXL A;  4HMJ A;  2N3S A;  1H9R A;  3NWS A;  4EVO A;  3ITP A;  1IBK Q;  1N32 Q;  1HFG A;  3NBI A;  2RKS A;  5D3D A;  5E1F A;  4DV6 Q;  2OEO A;  4B9X A;  1PA6 A;  2BE5 D;  5IGB A;  2NVX B;  4C3J G;  1Q8I A;  1SE4 A;  4BA2 I;  4C3J B;  2YTV A;  3GTK H;  2XRS D;  4EQO A;  1DM0 B;  3KK7 A;  4ZKB B;  1Q3L A;  1NMG A;  4BY7 G;  2JEA I;  1PFS A;  3KFU A;  3RN5 A;  3S2H H;  2LKV A;  2LXJ A;  3CC4 A;  4ID6 A;  1TVX A;  2WB1 B;  4PG3 A;  3CPF A;  1CKO A;  4PZ7 A;  5E4W C;  3NQI A;  3GV3 A;  1QIL A;  3MVV A;  4POG A;  2NVY H;  1ET6 A;  5HGQ A;  4TRD A;  1LYL A;  4LFB Q;  3SEB A;  2VQF Q;  1CA6 A;  3GTP H;  4KN7 C;  1X3F A;  5I2X A;  1TWH B;  4L5S A;  1RHP A;  4YCW A;  2XN9 C;  3I4M H;  4BBR G;  4DK3 C;  2L55 A;  5EBD A;  5IT9 L;  1HA5 A;  1J9O A;  2ZTE A;  4EQN A;  1PH5 A;  5C3E B;  2A6E C;  1G6P A;  2N78 A;  4A3K G;  1XPU A;  1I6H H;  4DAY A;  3QJY A;  4TVA B;  1X32 A;  3GQB A;  1YI2 A;  2Z6K C;  4I7Z C;  2JEB I;  3K6O A;  5F2D A;  4MZ9 A;  1RL2 A;  3R3O A;  5JOB A;  2PQA A;  4JBW A;  5GAH C;  4RMF A;  4C3I B;  2EYH A;  4XYO A;  1O7I A;  1TU2 B;  1PH7 A;  1EQR A;  1BUV T;  4OEM B;  1ASZ A;  2QEX A;  1DGS A;  3W5O A;  4JI7 L;  1TS4 A;  1DD2 A;  3PO3 B;  5KYI A;  2HDL A;  2A8V A;  4HMI A;  2EY2 A;  1STB A;  4O2D A;  1Y1W G;  2F0J A;  1HCZ A;  1B9M A;  2ZTD A;  3OYY A;  4WFN 3;  4J6H A;  1KLU D;  1IBM Q;  4DR3 Q;  3HOU B;  3BDC A;  2XSC A;  3HOW H;  4C3H H;  4BY1 H;  1LTG D;  1NNX A;  5GAG C;  2L5T A;  4KD4 A;  1TWC H;  1B70 B;  2K5Q A;  1Q90 A;  1U4P A;  5ELC A;  3TRZ A;  3HG9 A;  1WFQ A;  2G9D A;  1HUM A;  3CHB D;  1Y1V H;  3QB3 A;  4JI3 Q;  4UP9 A;  4HJ7 A;  2DJG C;  3A8J E;  5FJ8 G;  1DOL A;  3T1H L;  4K6D A;  4A93 B;  1PH9 A;  4KLK A;  4A4I A;  1I50 B;  2JSO A;  3I4L A;  1DYQ A;  4XIG S;  4LF6 Q;  1GKH A;  1Y69 U;  1HNZ L;  2NYZ D;  1J8I A;  2A69 D;  3ZYY X;  1VQI A;  4BY7 H;  2AQ1 B;  1K3B C;  3VR4 A;  4A3E B;  1I3Q H;  3M9B A;  4V19 0;  2UXD Q;  2F0E A;  1JT8 A;  2DY8 A;  3FKI B;  3LGJ A;  2ATW A;  4B3R Q;  1B3A A;  1B9N A;  1PV4 A;  4KHP L;  4IPG A;  1STH A;  1LTI D;  3EQL C;  3J81 E;  3Q0A A;  1I4H A;  1HTP A;  1X55 A;  2F0G A;  5IP7 H;  4A3B H;  5K36 H;  1WCM H;  4TSS A;  4LF7 Q;  1AFP A;  2RDF A;  2A68 C;  1QVC A;  3CRK C;  3BYY B;  2WP8 J;  2XNA C;  2K01 A;  3OMC A;  2K33 A;  2WAC A;  1CKN A;  1XMO L;  1WTH A;  2SNS A;  1UAP A;  2E75 C;  1AW7 A;  2GVA A;  1EYD A;  3FMC A;  4QCL A;  4JOI A;  5EPK A;  1BBU A;  2CW0 D;  1TWA B;  2RHQ B;  4K0K Q;  4C56 C;  4DR6 Q;  2JA8 H;  1X3P A;  1UE7 A;  5CC4 A;  5A35 A;  2F0W A;  3FP9 A;  4DK6 C;  2A5H A;  2EPB A;  2CWA A;  5C4X H;  5KIX A;  1GUO A;  2CWP A;  4X3K A;  3S9W A;  3J80 c;  3NUC A;  5LMN L;  4HJ8 A;  1TII D;  5ELE A;  1PXU A;  1LV9 A;  1P8L A;  4WRD A;  2WFW A;  1G6Z A;  2F0Q A;  2Z8L A;  1EU4 A;  4IUN A;  2YU9 B;  4QGU A;  4KY5 A;  1ENC A;  2OQK A;  4KK7 A;  2L0C A;  5I9P A;  3K8A A;  5IIF A;  4NP5 A;  3H0G B;  1B50 A;  2EY5 A;  3K7A B;  4GNX B;  4JBK A;  1HQR D;  3ERO A;  4UPA A;  1LAB A;  2Z6B A;  4QL5 A;  1CZW A;  2R93 H;  1RCV D;  1Q1B A;  4IPH A;  3D0F A;  5IP9 G;  2O5I C;  5M3F G;  4N8X 1;  3KF8 A;  5EPL A;  3UDI A;  2KEE A;  3H6M A;  4R4T A;  3I2Z A;  3NTK A;  3TP5 A;  3QOJ A;  1N8R C;  2RSO A;  4RGT A;  1S3O A;  2XTI A;  3PUW A;  3G6J B;  1MKH A;  4XYQ A;  4B3S Q;  5NUC A;  2ZXP A;  4NKL A;  4HIK A;  1SFO B;  1T5X D;  1WJJ A;  2AQ3 B;  4GKK L;  2I46 A;  4DXF A;  4J15 A;  5CV6 A;  4EQ5 A;  1LTA D;  2JA5 H;  4OON A;  4X3U A;  5A2Q E;  2BA0 A;  3PIP A;  1YIJ A;  3CXC A;  3DHQ A;  5G3L F;  1A6X A;  4FYD A;  3GP7 A;  2A6H D;  3NEL A;  3UI2 A;  1VQ5 A;  5M5X H;  1I4G A;  1DOK A;  5C6A A;  1PLF A;  4DNT B;  3F2C A;  1JJG A;  4K6L A;  4DV7 Q;  4G4K A;  4HJA A;  1S5D D;  3RLN A;  4OGQ C;  2HHH Q;  4LF4 L;  2JA7 G;  4ME5 A;  4X3S A;  3NWT A;  3K5N A;  2JA7 B;  1FNV A;  4NDX A;  4X62 Q;  1M8A A;  1KQS A;  4JPB W;  1PYB A;  1IKM A;  3VR2 A;  3HOZ H;  2EXD A;  1HRJ A;  2F0F A;  1WTX A;  1ICF B;  4QQB X;  2NTS A;  2PO4 A;  4FF2 A;  2HDM A;  2LY7 A;  3OIQ A;  2JK8 A;  1M4V A;  4APV A;  2HCC A;  1N9W A;  2Q2U A;  1EUJ A;  2I5L X;  3R8B A;  2Y0S E;  4YHH Q;  2Q8T A;  1B8A A;  1HNX L;  4JV5 L;  3FPP A;  3BZD B;  3HFZ B;  3U4V A;  3F2D A;  2UUB L;  1EYG A;  2L4N A;  3RD4 A;  2B2Y A;  3S14 H;  1S40 A;  3ULL A;  1Y8P B;  3OWE B;  2WAQ E;  5C4Z A;  1BQQ T;  1PH2 A;  1N33 L;  5C0X G;  1UUP A;  4JYA Q;  1B53 A;  3J7A F;  2UXB L;  1ZEQ X;  2NTT A;  2AKW B;  3SE0 A;  3S24 A;  5JVH 3;  1XNQ L;  4ALP A;  2MJ8 A;  4JI7 Q;  1IW7 C;  1YHQ A;  1H9S B;  3W3A A;  4JI6 L;  4BXX H;  1XNR L;  4XT3 B;  4H02 A;  4JVZ A;  3TSS A;  1AE3 A;  2F0S A;  4AYB E;  1II3 A;  1B7Y B;  2I07 B;  1U4R A;  4PZ6 A;  1KHI A;  1X3Q A;  4X66 L;  2GN5 A;  3E3X A;  3UE1 A;  1OTC A;  3CCM A;  4B08 A;  3GTL H;  1K9M C;  4MTK A;  4G7H C;  1S5C D;  1GJX A;  1VF7 A;  3J7Z C;  1YNJ C;  2A6E D;  4KKU A;  5CYU A;  4V0B A;  1SE2 A;  2KCT A;  1LT6 D;  5CMD A;  1PMR A;  1EY7 A;  4O0A A;  1UNS A;  1DXM A;  1ROD A;  3RNU A;  2J7Z A;  2X6G A;  3AB9 A;  1EFI D;  4R8I A;  2F3W A;  1CHQ D;  2XIW A;  3E9H A;  3VA7 A;  5BR8 Q;  2HQE A;  3ND8 A;  1V1O A;  5IOC A;  4TQU S;  3J80 E;  4O42 A;  1RD9 D;  1ICW A;  2DNE A;  4XTC S;  4DF7 A;  1J5E Q;  1U5K A;  1Q8K A;  1HZB A;  4DAP A;  3KDF B;  3KBX A;  4DK0 A;  3T13 A;  3T16 A;  4JI2 L;  3S1M B;  1FNU A;  1ESR A;  4A3M G;  3P20 A;  5LMU L;  3IL8 A;  1S72 A;  4PQX A;  2K50 A;  3TDQ A;  4ME3 A;  4JI1 L;  3GTG B;  1W6J A;  4KHP Q;  3M85 A;  2R92 G;  3SK5 A;  1VQ6 A;  2N88 A;  5D14 A;  4H44 C;  3T51 B;  1CQF A;  3UDX A;  2ZT9 C;  2K5H A;  3AEV A;  4IFD I;  1I94 L;  4PMB A;  1A62 A;  2LXK A;  3TS0 A;  1W6K A;  1EFW A;  2F52 A;  1VQH A;  3OPO A;  4HTH A;  4ZAI A;  4DV5 Q;  3PGZ A;  1SYG A;  1Y8N B;  2DJF C;  1M90 C;  2E2J H;  1XMO Q;  1HH2 P;  1A8V A;  3GTO B;  1VMP A;  3S16 H;  1BR9 A;  1PVO A;  1Z47 A;  4F8M A;  4X65 Q;  2IPK D;  1SMY C;  3I70 A;  2MGS A;  3HKS A;  4OO1 G;  2B2Y C;  1CI3 M;  3QO2 A;  3Q22 A;  1N34 L;  1IBL L;  3H3V I;  3FHW A;  1L2F A;  2QCP X;  3MXU A;  3EN2 A;  4ILW A;  3SVM A;  3EJI A;  3K57 A;  2SEB D;  5C0X H;  1UE6 A;  1PH8 A;  4MN3 A;  4K5X A;  3GV6 A;  3HKZ B;  2F0H A;  1STE A;  2K32 A;  3MA2 B;  4DR1 L;  3U9O A;  3GTK B;  4L63 B;  4ZKC B;  1BBW A;  4UP7 A;  3KLS A;  3G71 A;  1T5E A;  4DA2 A;  3J80 i;  3GTM H;  1V9P A;  3HOV H;  2D62 A;  1LTR D;  1E2W A;  3S1R H;  4DV3 Q;  2UXC Q;  4PZ8 A;  2R7D A;  2KHI A;  3ERQ A;  2JA6 B;  2A68 D;  2VUM B;  2MFI A;  1ET9 A;  1X56 A;  1CK1 A;  3D3R A;  3RZD H;  3JC6 6;  1FJG L;  3GTP B;  3I4M G;  4RH6 A;  2DY7 A;  5CV4 A;  3CCE A;  1SE3 A;  2DN8 A;  2D2C C;  5LMN W;  3CW2 C;  4LF9 Q;  2PZT A;  3HOX B;  4H7B A;  4R9W A;  2B63 G;  4IUU A;  4N8F A;  4DAM A;  4U68 A;  2VZA A;  1JE4 A;  5GRO A;  4PV1 C;  4Y52 H;  1Q46 A;  2R7Z B;  2QW7 A;  3A55 A;  1I6V C;  3LNN A;  1ILQ A;  3VR5 A;  3F2B A;  1IKL A;  1EY0 A;  1HNW L;  1Q86 C;  1K73 C;  2BDO A;  3H09 A;  2E2I H;  2RHS B;  4X64 L;  4FF1 A;  2MQH A;  1PH4 A;  5JJZ A;  4GNX A;  2K7V A;  4HR7 B;  4JI8 L;  3MAQ A;  4A3M H;  1SNQ A;  1V1P B;  1YHB A;  1GO3 E;  2AMC B;  4XXE A;  2NN6 I;  2KCC A;  1D5X C;  1YNN C;  3VYT A;  4HIM A;  4GKJ L;  3S1Q H;  2NBF A;  1SR3 A;  3LWU A;  2K4K A;  1X9N A;  3K81 C;  4EGV A;  5TSS A;  3A0J A;  1EIF A;  5JVG 3;  3G7L A;  1PRT C;  3KF6 B;  1EIG A;  4LUV A;  2E8G A;  5IT9 E;  1LO5 D;  1VQJ A;  4YY3 L;  1QVF A;  3HOW G;  1SXT A;  3U4Z A;  4C3H G;  4KKT A;  3G4S A;  3CU7 A;  3K7U C;  4BY1 G;  4DR7 L;  2IL8 A;  3HOW B;  2QDB A;  3NE5 B;  1NJI C;  1LT4 D;  1SYD A;  1JC7 A;  2RSN A;  4LFC L;  3NXW A;  3CME A;  4DR4 L;  1FL0 A;  4FO2 A;  1VQN A;  2VB2 X;  2IX1 A;  4A3J H;  3KBG A;  4OO1 H;  2J0T D;  1Q81 C;  3NP8 A;  4C2M H;  5T1G A;  1QJO A;  1Y1V G;  2E2D C;  4MTN A;  3X3M A;  3DWQ A;  3IAY A;  1MBY A;  1GHJ A;  5H1S E;  1LTL A;  2HD3 A;  1OXV A;  4LF5 L;  1KC8 C;  1W3S A;  1N36 Q;  5C44 H;  1KAW A;  4OX9 L;  1K83 H;  1JOK A;  1UEA B;  1ESF A;  2EVB A;  1QB5 D;  5C4J B;  1EIY B;  3PSI A;  3ER0 A;  3CRL C;  1YVC A;  4R8N A;  5M5W H;  4BY7 B;  4A3D G;  4AQY L;  2F0U A;  4HSP A;  5HUR A;  3FRP B;  2NVQ H;  3OTO Q;  4DUZ L;  3M3Y H;  4R4C A;  1J6Q A;  2LMC B;  2SNM A;  3T53 B;  3PIP 3;  2XRQ D;  2WV6 D;  1PRT F;  1IZ6 A;  1Q12 A;  4RWS C;  5M5Y B;  5D3I B;  1G51 A;  1RKN A;  4LJZ C;  1PH3 A;  1MJE A;  4F88 A;  3HOY H;  4DR5 L;  4NXN Q;  5IP7 G;  4A3B G;  5K36 G;  1WCM G;  2YV5 A;  1JWS D;  3PUZ A;  1Z9F A;  1Y14 B;  1IL2 A;  4ZCK A;  2B2U A;  3I4N G;  3A7A B;  4A3I H;  5JEA J;  1LUZ A;  3K5O A;  4BBR B;  4ULL A;  1GUN A;  2B63 H;  1HZ9 A;  3BVZ A;  4IPD A;  2OF1 A;  4L5T A;  4IFD J;  1MD2 D;  2F3V A;  5FK9 C;  3PCO B;  2VQE Q;  3A5Z B;  3PF4 A;  4A3K B;  1C4Q A;  2AUK A;  3D6C A;  3LX0 A;  4OHJ A;  3M7N A;  1TWG H;  4F87 A;  2JA8 G;  1CSP A;  3RLF A;  2BH2 A;  4AH6 A;  2M00 A;  4GNX C;  1OXU A;  4QUC A;  5ELD A;  1H9S A;  5CGK A;  5C4X G;  3CCV A;  2PNH A;  2ES2 A;  3TZU A;  4RKL A;  3HS0 C;  3OWF A;  5KND A;  4LF8 L;  3IKJ A;  4CDC C;  2VNU D;  2UUC Q;  1IW7 D;  4JW0 A;  1CQV A;  1BKB A;  1NMF A;  1TT2 A;  1CUK A;  2C9O A;  4KY7 A;  2HIX A;  3G48 A;  1ML0 D;  3K5L A;  1GXD C;  4A3C H;  5LMU Q;  5CR3 A;  5C3W A;  1CT1 D;  1STY A;  3SDZ A;  1S5B D;  3Q23 A;  1Y1W B;  1VQB A;  2F0D A;  1QZG A;  5DNF A;  4JI1 Q;  3EBE A;  2RCN A;  3F1Z A;  1KDB A;  5EKI A;  1GHK A;  1YNJ D;  2R93 G;  4IJL A;  2E76 C;  3L3O C;  4LMQ D;  4CHT B;  1PTO C;  1Q7Y C;  1C8C A;  5T1I A;  3S2D H;  4G57 A;  5IOD A;  1QE6 A;  4UDU C;  4CDF C;  5KRU A;  3H91 A;  4CGY B;  3PF5 A;  4H13 C;  2FMC A;  3KDF A;  1Y8O B;  4JI4 L;  1PRT B;  1TWF B;  2Z4H A;  5IE8 A;  1SYC A;  1I4Q A;  1VQ9 A;  1VQO A;  1AE2 A;  2E74 C;  1N34 Q;  2PZU A;  1B44 D;  4PNY A;  4YIJ A;  2JA5 G;  1VCI A;  2NVX H;  3OW7 A;  4A3D H;  2TMP A;  2JA5 B;  3HEJ A;  3M4O H;  1ILP A;  1RDP D;  2K5D A;  4MIU A;  3EIV A;  1V1Q A;  4B3M Q;  3SR1 A;  2UUA L;  1OO9 B;  2PYK A;  3DM3 A;  2EYO A;  2F03 A;  4RA8 A;  1RTO A;  1HZA A;  3MXG A;  2IHF A;  3T1Y Q;  1VQA A;  2QGQ A;  2B2U C;  1FNW A;  1PTO F;  2NZH A;  2F0K A;  2L15 A;  3TZD A;  3SK8 A;  2QA4 A;  3I4N H;  5IGG A;  1JJC B;  4N9P A;  1EQT A;  1SN8 A;  3UDG A;  3D8G A;  1GOZ A;  4DR2 L;  1VQL A;  5ELN A;  1LT5 D;  3RMH A;  1E2V A;  3HOZ G;  4GLX A;  2PI2 A;  1YHA A;  2KED A;  1TWH H;  4B3T L;  2NVT B;  3F8T A;  4DK1 A;  3NQT A;  1KTK A;  5JPM C;  1EU3 A;  1SMY D;  2B29 A;  2F0N A;  3PIO 3;  3T56 B;  1HUN A;  3N6R A;  3MEH A;  1NAP A;  5ELB A;  4POF A;  1SNM A;  4LFA L;  1TKW B;  3CAM A;  1HFN A;  4RFB A;  4GOP C;  1SRU A;  1O7L A;  5KYL A;  1HNW Q;  4QY7 A;  2RDG A;  4A3G H;  3ICE A;  1E3P A;  1KLG D;  4JI8 Q;  4WOR A;  4C3I H;  3FDT A;  5ISR A;  4ZRZ A;  4C1N K;  3VYU A;  2L1B A;  1BXT A;  2NZO A;  1B3Q A;  5AJ3 Q;  4BXX G;  1CZG A;  3C46 A;  3PO3 H;  1ZYR C;  4CJ1 B;  4LNQ A;  3WDN A;  1BCP F;  1XPO A;  4KN4 C;  3CF5 A;  2KCM A;  2KVM A;  5FLX L;  1GD7 A;  2O5J C;  4DKA C;  3I91 A;  3J81 i;  2ALY B;  1SNO A;  2QDL A;  2JA9 A;  4X6A H;  3TN2 A;  4J1M A;  4OIK A;  1A63 A;  5M3F B;  3HOU H;  1X65 A;  2EYL A;  1WYD A;  4DR7 Q;  4DU9 A;  4YWL A;  1QVG A;  3CKI B;  3VR6 A;  5FO7 B;  4LFC Q;  2R7F A;  1VQG A;  1F77 A;  5CBE E;  4JI5 L;  2IW3 A;  3NEN A;  1V1P A;  2BA1 A;  5DEH A;  2B8F A;  5COY A;  1D7Q A;  4Y7N H;  1XYI A;  2L12 A;  1PTO B;  1FR3 A;  3H3V C;  4KJO A;  3L9A X;  4XQQ A;  1D5Z C;  1L0X B;  3ERS X;  1I50 H;  3CQZ H;  3AMU A;  2FXQ A;  4N9T A;  4EX5 A;  2OTL A;  4I7A A;  1YNN D;  3M7G A;  3KF6 A;  2LFN A;  4B9W A;  4RCN A;  4OWX B;  2EDG A;  2CHB D;  4A3E H;  1VQ8 A;  3S15 B;  1T9H A;  2Z0S A;  1CKM A;  3A5U A;  4WJW A;  3FKI H;  4DUZ Q;  1K0R A;  1PRT D;  2DUD A;  1B1Z A;  1I4R A;  3K0Y A;  3OHX C;  3CMA A;  1LAC A;  5IYC H;  1HR0 L;  1V8Q A;  1YBY A;  2KBN A;  2ZM6 L;  1O7Y A;  4RCO A;  1WVL A;  1GUS A;  2E2H H;  4P74 A;  1K3R A;  4KHZ A;  1NR2 A;  3K80 C;  4BS9 A;  4CKC A;  3GTJ B;  1F9Q A;  1C9O A;  1KL9 A;  3CCL A;  1BNZ A;  3TBI B;  1YJN A;  3F2U A;  3DMU A;  4CJ0 B;  1HHV A;  1JIC A;  4NXM L;  3WOE A;  2F3I A;  2L9H A;  1PYW D;  1BCP B;  4CDE C;  5IYD H;  3S1N H;  2NZ1 D;  2MNA A;  4DV6 L;  4U67 3;  4A3F G;  4QMG A;  1EYC A;  3S17 B;  3GD7 A;  4BWG B;  3E0E A;  3L0O A;  3AQQ A;  2PQE A;  3R2I A;  5C3X A;  3D4D A;  4OIJ A;  3P75 A;  4IUV A;  1VQP A;  3R2T A;  3ULJ A;  1R9T B;  4FP5 D;  3HOV G;  3NPP A;  1VQC A;  2AWO A;  1K0S A;  1A3V A;  2YU9 H;  4MNO A;  3RR5 A;  4GOP B;  3HOV B;  1VS0 A;  5IY0 A;  2BCO A;  3K0X A;  4IO9 A;  3S1R B;  2L11 A;  1DCZ A;  1HPC A;  3H0G H;  2PI2 E;  2PPB C;  3K7A H;  3MFG A;  1SNP A;  4LFB L;  2VQF L;  2BH8 A;  1F9S A;  3K5M A;  1E1O A;  3BS1 A;  3CPW A;  3HKZ E;  4FXD A;  5C0X I;  4R4Q A;  4K5V A;  4HJ5 A;  2KHS A;  2RDH A;  1UEB A;  3PMF A;  2ID0 A;  3OIP A;  1TS5 A;  5DM7 3;  5EAY A;  1SJE D;  3CCJ A;  3GTQ B;  4KD3 A;  2B8G A;  5JAV A;  1JWM D;  1ENA A;  2HUG A;  2IWH A;  4HJ9 A;  3T1H Q;  2IX3 A;  4K8I A;  3NK9 A;  1WD1 A;  2XVS A;  1HNZ Q;  1D2B A;  3UE0 A;  4LUZ A;  3RZO H;  4KKS A;  1QZH A;  1QNU A;  2E2I B;  1SFO H;  2B2T C;  2F0P A;  1NBW A;  3UDF A;  4IAL A;  2F0I A;  2KJX A;  1X3G A;  4JK1 C;  4TKO B;  4A3M B;  3NBH B;  3DM1 A;  3ND9 A;  2WKD A;  2EJG C;  2Y0S G;  4KHV A;  2G9H D;  2R92 B;  5K5P A;  2FMM A;  4XT1 B;  1TR5 A;  4RG1 A;  4BBS G;  2Q8R E;  1PTO D;  1U4L A;  3PIO A;  3Q6S A;  1WD0 A;  3I90 A;  2EE1 A;  2XGT A;  1KRS A;  1WI5 A;  2OCE A;  3D4R A;  1KRT A;  5I4D A;  3RUZ A;  1Z6H A;  5I9O A;  4QIW B;  5IGC A;  3HZX A;  4KJN A;  3VYR A;  4GS3 A;  2WIN B;  2LS0 1;  2PMZ B;  3KUP A;  2WAQ G;  4XQN A;  4DR3 L;  1IBM L;  5JJL A;  4RGN A;  2K6A A;  3TRE A;  1YJW A;  3W1G A;  1MIU A;  4A3J G;  4PMW A;  3KJO A;  3IFD A;  1LLR D;  5ELF A;  5FO8 B;  1Q1E A;  1RF2 D;  2CH4 W;  1EIH A;  4GN3 B;  4C2M B;  1QOH A;  1EY5 A;  3QIA A;  4KV6 A;  1E0B A;  2WKC A;  4JI3 L;  4A3F H;  5C44 G;  4AYB G;  3H15 A;  3PUX A;  1HZC A;  5LMN Q;  1K8A C;  2DGY A;  1KIX A;  3L2P A;  1AP0 A;  3ZJY C;  1PZK D;  1AZP A;  3OMG A;  4LF6 L;  2HCI A;  4XQJ A;  5J3B A;  1A2U A;  3AFQ A;  1KDA A;  1JJ2 A;  3C1F A;  1K8O A;  2OXP A;  2WII B;  3S2H B;  5M5W B;  1EY6 A;  3J7A 5;  4UAI A;  2UXD L;  3M3Y B;  5M3M G;  1XXG A;  3CCS A;  1MI2 A;  1QNK A;  2NVY B;  3J7A V;  2ASB A;  3HOY G;  1PH6 A;  4OO1 I;  4B3R L;  2PW5 A;  1S4Z A;  5D65 A;  4P75 A;  1QUQ B;  2RA4 A;  2MUY A;  3BVM A;  3I4M B;  4A3I G;  3SGI A;  1SYE A;  4E6I A;  2X6L A;  4HID A;  3RLO A;  3TS2 A;  3BZK A;  1C0A A;  3QG1 A;  2B63 B;  1JR0 D;  2PW7 A;  1XWE A;  3CC7 A;  2B2V A;  2LSS A;  4ZLT F;  3CCQ A;  2JE6 I;  1PH1 A;  5CV5 A;  1I6H B;  4A3L G;  4JBM A;  1RIP A;  3DWA A;  3KOJ A;  1DZ1 A;  3E6Z X;  3PUV A;  2TSS A;  4A75 A;  5IWA L;  4DFA A;  1JOQ A;  4H0L C;  4GKK Q;  3QWN A;  4DR6 L;  4QUF A;  1WTP A;  4RAU C;  3IFT A;  3STB C;  1LTS D;  5FOB B;  5FLM G;  1GUG A;  1FVI A;  4UY8 C;  2ZXO A;  2D0O A;  2NB0 A;  5G3L D;  2K04 A;  3I73 A;  1ZYR D;  2GA4 B;  2KEC A;  3AU7 A;  3EFX D;  5M9O A;  3NTI A;  4BA1 I;  3S1M H;  2EIF A;  4A3C G;  3DUZ A;  4BBS H;  3TEH B;  2PNR C;  2V1C C;  2K03 A;  1CTM A;  1H9K A;  4LF4 Q;  4F7X A;  3JAM L;  1JCK B;  3GTG H;  2KA7 A;  5EQ0 A;  5FLX c;  3H3V H;  1TQO A;  4DV2 L;  4C3H B;  3C3L A;  1PDQ A;  4BY1 B;  3E9I A;  1E7Z A;  5E4X A;  3C1E A;  1TWC B;  1AN8 A;  4L5R C;  2ZJR A;  1KDC A;  3V05 A;  2AUJ D;  1HNX Q;  4JV5 Q;  1DON A;  3A56 A;  1A3T A;  1Z7T A;  1Y1V B;  1JQY D;  1JMC A;  4OWT B;  2BDN A;  3CP0 A;  4YCV A;  3GTO H;  1X54 A;  2UUB Q;  1K28 A;  2ICI A;  3BG3 A;  4RGM A;  2AQ2 B;  1VMC A;  4P72 A;  1AZQ A;  1KNA A;  2R61 A;  5EGT A;  4DV1 L;  1HR0 W;  3KLS X;  1U0L A;  1I4P A;  4B3S L;  2K5V A;  1EL0 A;  1N33 Q;  1I3Q B;  3U58 A;  4R1J A;  1QWY A;  4A3D B;  3TME A;  1JOR A;  2UXB Q;  2IY5 B;  1PZJ D;  2F0M A;  3M4O B;  4JBJ A;  3OW2 A;  3Q8D A;  4GN4 B;  1ZKO A;  4M1U B;  5CV8 A;  5M3M H;  1XNQ Q;  4FXG C;  3PO2 H;  2IHE A;  4IOC A;  4JI6 Q;  1XNR Q;  3QOL A;  1D1I A;  1KAB A;  1MGS A;  5E3F A;  2WB1 G;  1G2T A;  1EQV A;  4A3B B;  1WCM B;  4X66 Q;  1HQM C;  4DV7 L;  2MO0 A;  3I4N B;  4YWM A;  3J81 j;  2JA6 H;  1L1O B;  1BVS A;  2A1A A;  2HHH L;  2VUM H;  1WOC A;  2B2V C;  2D0P A;  2MPM A;  1G8Z D;  2EY6 A;  4X62 L;  3PQI A;  3V2T A;  1MSH A;  3SHL A;  3DLL A;  1MJC A;  4Q0F A;  4A3L H;  1STA A;  4CBV A;  4RKB A;  3HOX H;  1RJT A;  4CKE A;  1I4X A;  4GLA C;  2NN6 H;  2VS1 A;  1XX8 A;  5C3E G;  1G2S A;  5EBC A;  3TP6 A;  2UU9 L;  2B39 A;  2JA8 B;  2Q2I A;  4YHH L;  2HT1 A;  1JWU D;  5COR A;  4FF3 A;  2R7Z H;  1I5F A;  3I72 A;  5FLM H;  5I6Y A;  1PFM A;  5C4X B;  2N8N A;  2EJM A;  3P1H A;  4GOP A;  1SLJ A;  1V43 A;  4UP8 A;  4A3G G;  2EYJ A;  1SMX A;  2EYF A;  2Z4I A;  4A3G B;  5HGT A;  1PFB A;  3SK4 A;  4JI2 Q;  2D9U A;  4C3I G;  2K75 A;  1LT3 D;  4K5W A;  1DJR D;  2YTX A;  4JYA L;  2RBM A;  2H5X A;  5GAD C;  1PHJ A;  1OXT A;  2RF4 A;  3I7F A;  3I8Z A;  1XMQ L;  3PO3 G;  2VXW A;  4CJ2 C;  5I2Y A;  2KUM A;  1BOS A;  2R93 B;  1I94 Q;  1RTN A;  4QF4 A;  2FJ2 A;  2CCZ A;  3X3N A;  1CM9 A;  1IHZ A;  3M4P A;  4ODG A;  2EYP A;  5C5M A;  1Q82 C;  3HOU G;  4OXP A;  4PMC A;  3HP3 A;  3VDY A;  4C1N I;  1UE1 A;  4GLV B;  3DEP A;  2AHO B;  4I65 A;  4RHS A;  1F2Z A;  4K14 A;  3GO5 A;  4KY6 A;  1HXY D;  2FIN B;  4IJH A;  2IX0 A;  3NBH A;  1IBL Q;  2K28 A;  3FPU B;  4JI0 L;  1ENF A;  4Y7N B;  1TY2 A;  4IPC A;  5J1Z A;  5BR8 L;  1A2T A;  4ZK9 B;  4A93 G;  1TY0 A;  1XTD A;  4C3J H;  5LL6 X;  1J5E L;  4DR1 Q;  5FKA C;  2Q8I B;  4YCU A;  5EPJ A;  3MXP A;  3CQZ B;  3HGB A;  5C4J H;  3MWY W;  4M8A A;  2K5N A;  2KQ3 A;  1UWV A;  4A3E G;  4L5Q A;  5M5X B;  1IXR A;  2EJF C;  4IZ8 A;  3CC2 A;  2ZJP A;  3FKI G;  1F2L A;  2H4O A;  2JP1 A;  5GQO A;  4K2K A;  5FLX E;  1TS2 A;  5GAE C;  5M5Y H;  5IYC G;  3OSO A;  1EY4 A;  1FJG Q;  1BCP C;  1F9P A;  2NUC A;  4UHV A;  3HOZ B;  4DNR B;  1BBX C;  5IGF A;  1X3E A;  1B4O A;  1C48 A;  4FF4 A;  4BBR H;  2E2H B;  4P2C B;  3VYS A;  3MC0 B;  5C3E H;  3D6W A;  1SEB D;  4DV5 L;  2KHJ A;  2HIV A;  2V4D A;  1AEX A;  4A3K H;  4ZQ3 A;  5E7N A;  4WJ3 M;  1BDO A;  2VL6 A;  5CV7 A;  4X65 L;  4GZY C;  1EEF D;  3B6Y A;  5IWA Q;  5IYD G;  1SSO A;  2GVB A;  4X64 Q;  4IQZ A;  3MFY A;  3S14 B;  4IN3 A;  1HJP A;  3S1N B;  5C4H A;  1GVP A;  1QUQ A;  2K52 A;  3BDO A;  1EWI A;  2K14 A;  3E5S A;  2Z1C A;  5BN4 A;  2VB3 X;  3BVG A;  1SDF A;  4ZYS A;  4NB3 A;  2PCF B;  4GKJ Q;  2KOL A;  3G6E A;  5DM6 3;  3MZ5 A;  1E22 A;  1QCB D;  1HTL D;  3MXN B;  3D4W A;  3NSW A;  1WTW A;  2K05 A;  2A19 A;  2UXC L;  3H0G G;  4DV3 L;  4L8J A;  4JC0 A;  1Y1W H;  3QR8 A;  3J81 L;  2JN4 A;  1A3U A;  5LL6 S;  4YY3 Q;  1X6O A;  3GTL B;  4KI0 A;  3C2P A;  2B2W A;  1EY8 A;  4DV2 Q;  1NCV A;  1SYB A;  4G7O C;  2O2L D;  3N52 A;  4DR4 Q;  1SBB B;  2D5D A;  5KGU A;  4LWC A;  4LF9 L;  4DUY L;  1VQK A;  3EA6 A;  2VW9 A;  2HQL A;  2F4I A;  1GUT A;  4R4O A;  2CKZ B;  1FGB D;  2J4X A;  4OL7 A;  3STB D;  4RGO S;  2RVL A;  4LF5 Q;  4A93 H;  1VQ7 A;  1TWF H;  1KNE A;  5FJ8 H;  4OX9 Q;  3DEO A;  4Z9C B; 
#chains in the Genus database with same CATH homology
 2FHT A;  5KNC A;  3BDL A;  3RZO B;  1EEI D;  3J7Y W;  3R93 A;  2B2T A;  1BF4 A;  2BE5 C;  1D6E C;  1H9M A;  2AWN A;  5CV9 A;  5BN3 A;  1IYU A;  4ZUJ A;  1HA6 A;  2IT1 A;  2F0L A;  3FEW X;  2CQA A;  3MHB A;  1F2Y A;  2NWG A;  1LTT D;  2EY1 A;  4DXG A;  5J22 A;  1G91 A;  4Q5V A;  2XWJ B;  4HN7 A;  1EZ8 A;  5J39 A;  1CA5 A;  1S5E D;  1CHP D;  5AFW A;  1F9R A;  2K1B A;  1OXS C;  3H94 A;  1OXX K;  4FNF A;  1E2Z A;  2BOS A;  2R3Z A;  2E2J B;  4O1N A;  5C5L A;  3ONA B;  1EWC A;  2K5W A;  3S16 B;  2KCN A;  2O4X A;  3PV0 A;  5FO9 B;  2XWB B;  3TP7 A;  1L0Y B;  5DAU A;  4L6T B;  4FVM A;  4A3F B;  1K8M A;  1VF5 C;  1WTO A;  4IUQ A;  3FVQ A;  1GUW A;  3GTM B;  2X69 A;  4KMU C;  5A2Q L;  4KTA A;  3WOF A;  1XTC D;  1FD7 D;  1MSG A;  5CBA E;  2QEJ C;  5EKL A;  2A73 B;  4K2L A;  2ENB A;  1EY9 A;  2B2W C;  1JB3 A;  3RZD B;  2ZXR A;  1SND A;  1WTV A;  1U4M A;  2F1M A;  4HSV A;  1STG A;  4LAA A;  3EVQ A;  1WTR A;  4MHE A;  1IYV A;  4NMZ A;  1IL8 A;  1QG7 A;  2R6G A;  1ZXT A;  2EYM A;  1SNC A;  3VR3 A;  1EZ6 A;  4X3T A;  4DN4 M;  5JEA G;  3M4Y A;  2ICE C;  4CKB A;  2CVR A;  3K59 A;  1PTO H;  4IFD G;  3A8I E;  1JOO A;  3A7L A;  4LK1 C;  4HCS A;  3DXJ C;  1DOM A;  3DWP A;  2QKI C;  2A69 C;  3S1Q B;  1PZI D;  1SJH D;  2Y0S B;  1D1K A;  1SYF A;  3TP8 A;  1A15 A;  4BBS B;  1G29 1;  2RQX A;  3BYT B;  3D31 A;  3T4A C;  4QB4 A;  3V96 A;  2SDF A;  4HCE A;  1D5M C;  2WAQ B;  3U9S A;  5KNB A;  1VDZ A;  1NUC A;  4A3J B;  1CFM A;  1BO0 A;  5EJW A;  3L7Z C;  1NSN S;  2N55 A;  3VA5 A;  1LTB D;  3PUY A;  1R4P B;  4XDX A;  2IJ0 A;  5C44 B;  2JYO A;  3E0J A;  4AYB B;  1K83 B;  1B2T A;  1R4Q B;  2CW0 C;  2JXM B;  3J80 L;  1EOT A;  2M2L A;  3KLR A;  3W2D A;  4IUT A;  5EKK A;  2NVQ B;  5LHY 1;  2F0O A;  2EOT A;  3SXH A;  2F0V A;  5M3M B;  3JAM E;  2MHV A;  1EWH A;  3PO2 B;  3HOY B;  1BCP D;  3OOC A;  1O78 A;  4J8Q A;  2MP1 A;  4A3I B;  3A54 A;  1EYA A;  4HAE A;  4HED A;  3I3C A;  5I6W A;  1KAA A;  3NHH A;  1O7Z A;  2NN6 G;  3SK6 A;  5JEA H;  1TWG B;  3LWE A;  3K58 A;  3HRZ C;  3Q24 A;  5BN5 A;  1SAP A;  2QF7 A;  3P7J A;  4IUP A;  3URY A;  2F0T A;  4IFD H;  3A8K E;  4FXK C;  4IUR A;  3MXN A;  4DAV A;  2SOB A;  1F2M A;  2QIL A;  3MTS A;  2DNC A;  2PZW A;  1U9R A;  3NTH A;  4K8J A;  1FYC A;  2A74 C;  5JPN C;  5IGE A;  4ZUI A;  2YYZ A;  4ABN A;  2A6H C;  1NR4 A;  4DGZ A;  1O80 A;  4NW2 A;  1WTQ A;  1TS3 A;  2FFK B;  2EZV A;  2EXZ A;  4RHR A;  1S5F D;  3S2D B;  4EQP A;  2C5C A;  3O13 A;  4G7Z C;  1ONL A;  4S3S A;  1PFN A;  2M9V A;  1STN A;  2H1E A;  2OT2 A;  5IGD A;  5C0X J;  5KEE A;  1H9J A;  4HMJ A;  1H9R A;  3NWS A;  4EVO A;  3ITP A;  1HFG A;  3NBI A;  2RKS A;  5D3D A;  5E1F A;  2OEO A;  4B9X A;  2NVX B;  2BE5 D;  5IGB A;  4C3J G;  1Q8I A;  1SE4 A;  4BA2 I;  4C3J B;  2XRS D;  4EQO A;  1DM0 B;  3KK7 A;  4ZKB B;  1Q3L A;  2JEA I;  2LKV A;  4ID6 A;  1TVX A;  2WB1 B;  5E4W C;  3NQI A;  3GV3 A;  1QIL A;  3MVV A;  1ET6 A;  4TRD A;  3SEB A;  1CA6 A;  4KN7 C;  5I2X A;  1TWH B;  1RHP A;  2XN9 C;  2L55 A;  5EBD A;  5IT9 L;  1HA5 A;  1J9O A;  4EQN A;  5C3E B;  2A6E C;  4DAY A;  3QJY A;  1X32 A;  3GQB A;  4I7Z C;  2JEB I;  3K6O A;  5F2D A;  3R3O A;  5JOB A;  4JBW A;  4C3I B;  2EYH A;  4XYO A;  1TU2 B;  1BUV T;  1TS4 A;  1DD2 A;  3PO3 B;  5KYI A;  2HDL A;  4HMI A;  2EY2 A;  1STB A;  2F0J A;  1HCZ A;  1B9M A;  4WFN 3;  4J6H A;  1KLU D;  3HOU B;  3BDC A;  2XSC A;  1LTG D;  4KD4 A;  2L5T A;  2K5Q A;  1Q90 A;  1U4P A;  5ELC A;  3HG9 A;  2G9D A;  1HUM A;  3CHB D;  3QB3 A;  3A8J E;  1DOL A;  4K6D A;  4A93 B;  1I50 B;  2JSO A;  3I4L A;  1DYQ A;  4XIG S;  1Y69 U;  2NYZ D;  1J8I A;  2A69 D;  3ZYY X;  2AQ1 B;  3VR4 A;  4A3E B;  4V19 0;  2F0E A;  2DY8 A;  3FKI B;  1B3A A;  1B9N A;  1STH A;  1LTI D;  3EQL C;  3J81 E;  3Q0A A;  1I4H A;  1HTP A;  2F0G A;  5K36 H;  4TSS A;  1AFP A;  2RDF A;  2A68 C;  3CRK C;  3BYY B;  2WP8 J;  2XNA C;  2K01 A;  3OMC A;  2K33 A;  2WAC A;  2SNS A;  1UAP A;  2E75 C;  1AW7 A;  1EYD A;  3FMC A;  4QCL A;  5EPK A;  2CW0 D;  1TWA B;  4C56 C;  1X3P A;  5CC4 A;  5A35 A;  2F0W A;  2A5H A;  2EPB A;  5KIX A;  1GUO A;  4X3K A;  3S9W A;  3NUC A;  1TII D;  5ELE A;  1PXU A;  1LV9 A;  4WRD A;  1G6Z A;  2F0Q A;  2Z8L A;  1EU4 A;  4IUN A;  2YU9 B;  4KY5 A;  1ENC A;  4KK7 A;  2L0C A;  5I9P A;  5IIF A;  4NP5 A;  3H0G B;  1B50 A;  2EY5 A;  3K7A B;  1HQR D;  3ERO A;  1LAB A;  1CZW A;  1RCV D;  1Q1B A;  2O5I C;  3KF8 A;  5EPL A;  2KEE A;  3H6M A;  3NTK A;  3TP5 A;  3QOJ A;  2RSO A;  4RGT A;  3PUW A;  3G6J B;  4XYQ A;  5NUC A;  2ZXP A;  4NKL A;  1SFO B;  1T5X D;  2AQ3 B;  2I46 A;  4DXF A;  5CV6 A;  1LTA D;  4X3U A;  5A2Q E;  2BA0 A;  3DHQ A;  5G3L F;  1A6X A;  4FYD A;  3GP7 A;  2A6H D;  3UI2 A;  1I4G A;  1DOK A;  5C6A A;  1PLF A;  4DNT B;  4K6L A;  4G4K A;  1S5D D;  4OGQ C;  4ME5 A;  4X3S A;  3NWT A;  3K5N A;  2JA7 B;  1FNV A;  4NDX A;  1M8A A;  1IKM A;  3VR2 A;  1HRJ A;  2F0F A;  1WTX A;  2NTS A;  2PO4 A;  4FF2 A;  2HDM A;  2LY7 A;  3OIQ A;  1M4V A;  2HCC A;  3R8B A;  2Q8T A;  3FPP A;  3BZD B;  2L4N A;  3RD4 A;  2B2Y A;  1Y8P B;  3OWE B;  5C4Z A;  1BQQ T;  5C0X G;  1UUP A;  1B53 A;  3J7A F;  1ZEQ X;  2NTT A;  3SE0 A;  5JVH 3;  2MJ8 A;  1IW7 C;  1H9S B;  3W3A A;  4XT3 B;  3TSS A;  2F0S A;  1II3 A;  2I07 B;  1U4R A;  1X3Q A;  4B08 A;  4G7H C;  1S5C D;  1GJX A;  1VF7 A;  1YNJ C;  2A6E D;  4KKU A;  5CYU A;  4V0B A;  1SE2 A;  1LT6 D;  5CMD A;  1PMR A;  1EY7 A;  1UNS A;  1DXM A;  1ROD A;  2J7Z A;  2X6G A;  3AB9 A;  1EFI D;  4R8I A;  2F3W A;  1CHQ D;  2XIW A;  3VA7 A;  2HQE A;  3ND8 A;  1V1O A;  5IOC A;  4TQU S;  3J80 E;  4O42 A;  1RD9 D;  1ICW A;  2DNE A;  4XTC S;  4DF7 A;  4DAP A;  3KBX A;  4DK0 A;  3T13 A;  3T16 A;  3S1M B;  1FNU A;  1ESR A;  3P20 A;  3IL8 A;  4PQX A;  3TDQ A;  3GTG B;  1W6J A;  3M85 A;  3SK5 A;  2N88 A;  5D14 A;  4H44 C;  3T51 B;  1CQF A;  2ZT9 C;  4IFD I;  4PMB A;  1W6K A;  3OPO A;  4HTH A;  4ZAI A;  1SYG A;  1Y8N B;  3GTO B;  1VMP A;  1BR9 A;  1Z47 A;  4F8M A;  2IPK D;  1SMY C;  3I70 A;  2MGS A;  4OO1 G;  2B2Y C;  1CI3 M;  3QO2 A;  3Q22 A;  2QCP X;  3MXU A;  4ILW A;  3SVM A;  3EJI A;  3K57 A;  2SEB D;  5C0X H;  4MN3 A;  4K5X A;  3GV6 A;  3HKZ B;  2F0H A;  1STE A;  2K32 A;  3MA2 B;  3U9O A;  3GTK B;  4L63 B;  4ZKC B;  3KLS A;  1T5E A;  4DA2 A;  2D62 A;  1LTR D;  1E2W A;  3ERQ A;  2JA6 B;  2A68 D;  2VUM B;  1ET9 A;  1CK1 A;  3D3R A;  3GTP B;  4RH6 A;  2DY7 A;  5CV4 A;  1SE3 A;  2DN8 A;  2D2C C;  2PZT A;  3HOX B;  4H7B A;  4R9W A;  4IUU A;  4U68 A;  1JE4 A;  4PV1 C;  2R7Z B;  3A55 A;  1I6V C;  3LNN A;  1ILQ A;  3VR5 A;  1IKL A;  1EY0 A;  2BDO A;  3H09 A;  4FF1 A;  5JJZ A;  2K7V A;  4HR7 B;  3MAQ A;  1SNQ A;  1V1P B;  4XXE A;  2NN6 I;  2KCC A;  1D5X C;  1YNN C;  3VYT A;  2NBF A;  3LWU A;  4EGV A;  5TSS A;  5JVG 3;  3G7L A;  1PRT C;  1EIG A;  5IT9 E;  1LO5 D;  1SXT A;  4C3H G;  4KKT A;  3CU7 A;  2IL8 A;  3HOW B;  2QDB A;  3NE5 B;  1LT4 D;  1SYD A;  1JC7 A;  2RSN A;  3NXW A;  4FO2 A;  2VB2 X;  2IX1 A;  3KBG A;  4OO1 H;  2J0T D;  3NP8 A;  5T1G A;  1QJO A;  2E2D C;  3X3M A;  3DWQ A;  3IAY A;  1MBY A;  1GHJ A;  1OXV A;  1JOK A;  1UEA B;  1ESF A;  2EVB A;  1QB5 D;  5C4J B;  3CRL C;  4R8N A;  4BY7 B;  2F0U A;  4HSP A;  5HUR A;  3FRP B;  2LMC B;  2SNM A;  3T53 B;  3PIP 3;  2XRQ D;  2WV6 D;  1PRT F;  1Q12 A;  4RWS C;  5M5Y B;  5D3I B;  1RKN A;  4LJZ C;  4F88 A;  5K36 G;  1JWS D;  3PUZ A;  2B2U A;  3A7A B;  5JEA J;  3K5O A;  4BBR B;  4ULL A;  1GUN A;  3BVZ A;  2OF1 A;  4IFD J;  1MD2 D;  2F3V A;  5FK9 C;  4A3K B;  1C4Q A;  2AUK A;  3D6C A;  3LX0 A;  4OHJ A;  3M7N A;  4F87 A;  3RLF A;  2M00 A;  1OXU A;  4QUC A;  5ELD A;  1H9S A;  5CGK A;  3TZU A;  4RKL A;  3HS0 C;  3OWF A;  5KND A;  3IKJ A;  2VNU D;  1IW7 D;  1CQV A;  1TT2 A;  2C9O A;  4KY7 A;  1ML0 D;  3K5L A;  1GXD C;  5CR3 A;  5C3W A;  1CT1 D;  1STY A;  3SDZ A;  1S5B D;  3Q23 A;  1Y1W B;  2F0D A;  5DNF A;  1KDB A;  5EKI A;  1GHK A;  1YNJ D;  2E76 C;  3L3O C;  4LMQ D;  4CHT B;  1PTO C;  1C8C A;  5T1I A;  4G57 A;  5IOD A;  1QE6 A;  4UDU C;  5KRU A;  3H91 A;  4CGY B;  4H13 C;  2FMC A;  1Y8O B;  1PRT B;  1TWF B;  2Z4H A;  1SYC A;  1I4Q A;  2E74 C;  2PZU A;  1B44 D;  4PNY A;  4YIJ A;  1VCI A;  3OW7 A;  2TMP A;  2JA5 B;  3HEJ A;  1ILP A;  1RDP D;  2K5D A;  4MIU A;  3SR1 A;  1OO9 B;  2PYK A;  2EYO A;  2F03 A;  4RA8 A;  1RTO A;  3MXG A;  2B2U C;  1FNW A;  1PTO F;  2F0K A;  3TZD A;  3SK8 A;  5IGG A;  4N9P A;  1EQT A;  3D8G A;  1GOZ A;  1LT5 D;  3RMH A;  1E2V A;  2KED A;  2NVT B;  4DK1 A;  3NQT A;  1KTK A;  5JPM C;  1EU3 A;  1SMY D;  2F0N A;  3PIO 3;  3T56 B;  1HUN A;  3N6R A;  3MEH A;  1NAP A;  5ELB A;  1SNM A;  1TKW B;  1HFN A;  4RFB A;  1O7L A;  5KYL A;  2RDG A;  1KLG D;  4WOR A;  3FDT A;  5ISR A;  4ZRZ A;  4C1N K;  3VYU A;  2L1B A;  1BXT A;  1CZG A;  3C46 A;  1ZYR C;  4CJ1 B;  3WDN A;  1BCP F;  4KN4 C;  2KVM A;  5FLX L;  2O5J C;  3I91 A;  1SNO A;  3TN2 A;  4J1M A;  4OIK A;  5M3F B;  2EYL A;  4DU9 A;  3CKI B;  3VR6 A;  5FO7 B;  1F77 A;  5CBE E;  2IW3 A;  1V1P A;  2BA1 A;  5DEH A;  2B8F A;  5COY A;  1XYI A;  2L12 A;  1PTO B;  1FR3 A;  3H3V C;  4KJO A;  3L9A X;  4XQQ A;  1D5Z C;  1L0X B;  3AMU A;  4N9T A;  1YNN D;  3M7G A;  2LFN A;  4B9W A;  4RCN A;  2EDG A;  2CHB D;  3S15 B;  4WJW A;  1PRT D;  1B1Z A;  1I4R A;  3K0Y A;  3OHX C;  1LAC A;  1V8Q A;  1O7Y A;  4RCO A;  1WVL A;  1GUS A;  4KHZ A;  1NR2 A;  4BS9 A;  4CKC A;  3GTJ B;  1F9Q A;  1BNZ A;  3TBI B;  3F2U A;  3DMU A;  4CJ0 B;  1HHV A;  1JIC A;  3WOE A;  2L9H A;  1PYW D;  1BCP B;  2NZ1 D;  4U67 3;  4QMG A;  1EYC A;  3S17 B;  3GD7 A;  4BWG B;  2PQE A;  3R2I A;  5C3X A;  3D4D A;  4OIJ A;  3P75 A;  4IUV A;  3R2T A;  1R9T B;  4FP5 D;  3NPP A;  2AWO A;  1A3V A;  3HOV B;  2BCO A;  3S1R B;  2L11 A;  1DCZ A;  1HPC A;  2PPB C;  3MFG A;  1SNP A;  1F9S A;  3K5M A;  3BS1 A;  4FXD A;  5C0X I;  4K5V A;  2KHS A;  2RDH A;  3PMF A;  2ID0 A;  3OIP A;  1TS5 A;  5DM7 3;  1SJE D;  3GTQ B;  4KD3 A;  2B8G A;  5JAV A;  2IWH A;  1JWM D;  1ENA A;  2HUG A;  2IX3 A;  4K8I A;  3NK9 A;  1WD1 A;  2XVS A;  1D2B A;  4KKS A;  1QNU A;  2E2I B;  2B2T C;  2F0P A;  4IAL A;  2F0I A;  2KJX A;  4JK1 C;  4TKO B;  4A3M B;  3DM1 A;  3ND9 A;  2WKD A;  2EJG C;  4KHV A;  2G9H D;  2R92 B;  5K5P A;  2FMM A;  4XT1 B;  1TR5 A;  2Q8R E;  1PTO D;  1U4L A;  3Q6S A;  1WD0 A;  3I90 A;  2EE1 A;  5I4D A;  3D4R A;  3RUZ A;  1Z6H A;  5I9O A;  4QIW B;  5IGC A;  3HZX A;  4KJN A;  3VYR A;  2WIN B;  2LS0 1;  2PMZ B;  3KUP A;  4XQN A;  4RGN A;  2K6A A;  4PMW A;  3IFD A;  1LLR D;  5ELF A;  5FO8 B;  1Q1E A;  1RF2 D;  1EIH A;  4C2M B;  1QOH A;  1EY5 A;  3QIA A;  4KV6 A;  1E0B A;  2WKC A;  3PUX A;  1AP0 A;  1PZK D;  1AZP A;  3OMG A;  2HCI A;  4XQJ A;  1A2U A;  1KDA A;  1K8O A;  3C1F A;  2OXP A;  2WII B;  3S2H B;  5M5W B;  1EY6 A;  4UAI A;  3M3Y B;  1XXG A;  1MI2 A;  1QNK A;  2NVY B;  3J7A V;  4OO1 I;  2PW5 A;  1S4Z A;  5D65 A;  2RA4 A;  2MUY A;  3BVM A;  3I4M B;  1SYE A;  4E6I A;  2X6L A;  3QG1 A;  2B63 B;  1JR0 D;  2PW7 A;  1XWE A;  2B2V A;  4ZLT F;  2JE6 I;  5CV5 A;  1I6H B;  3DWA A;  1DZ1 A;  3E6Z X;  3PUV A;  2TSS A;  4DFA A;  1JOQ A;  4H0L C;  3QWN A;  4QUF A;  1WTP A;  4RAU C;  3IFT A;  5FOB B;  1LTS D;  1GUG A;  2ZXO A;  2NB0 A;  5G3L D;  2K04 A;  3I73 A;  1ZYR D;  2GA4 B;  2KEC A;  3AU7 A;  3EFX D;  5M9O A;  3NTI A;  4BA1 I;  3DUZ A;  2PNR C;  2K03 A;  1CTM A;  1H9K A;  4F7X A;  3JAM L;  1JCK B;  2KA7 A;  5EQ0 A;  1TQO A;  4C3H B;  3C3L A;  1PDQ A;  4BY1 B;  5E4X A;  3C1E A;  1TWC B;  1AN8 A;  1KDC A;  3V05 A;  2AUJ D;  1DON A;  3A56 A;  1A3T A;  1Z7T A;  1Y1V B;  1JQY D;  2BDN A;  2ICI A;  3BG3 A;  4RGM A;  2AQ2 B;  1VMC A;  1AZQ A;  1KNA A;  2R61 A;  5EGT A;  3KLS X;  1I4P A;  1EL0 A;  1I3Q B;  1QWY A;  4A3D B;  3TME A;  1JOR A;  1PZJ D;  2F0M A;  3M4O B;  1ZKO A;  4M1U B;  5CV8 A;  4FXG C;  3QOL A;  1D1I A;  1KAB A;  1MGS A;  5E3F A;  1G2T A;  1EQV A;  4A3B B;  1WCM B;  1HQM C;  3I4N B;  2B2V C;  2MPM A;  1G8Z D;  2EY6 A;  3V2T A;  1MSH A;  3SHL A;  4Q0F A;  1STA A;  4CBV A;  4RKB A;  1RJT A;  4CKE A;  1I4X A;  2NN6 H;  1XX8 A;  1G2S A;  5EBC A;  3TP6 A;  2B39 A;  2JA8 B;  1JWU D;  5COR A;  4FF3 A;  3I72 A;  5I6Y A;  1PFM A;  5C4X B;  2EJM A;  3P1H A;  1V43 A;  2EYJ A;  2EYF A;  2Z4I A;  4A3G B;  5HGT A;  1PFB A;  3SK4 A;  2D9U A;  4C3I G;  1LT3 D;  4K5W A;  1DJR D;  2RBM A;  1OXT A;  3I8Z A;  2VXW A;  4CJ2 C;  5I2Y A;  2KUM A;  1BOS A;  2R93 B;  1RTN A;  4QF4 A;  2FJ2 A;  3X3N A;  1CM9 A;  1IHZ A;  4ODG A;  2EYP A;  5C5M A;  4PMC A;  3HP3 A;  4C1N I;  3DEP A;  4I65 A;  4RHS A;  1F2Z A;  4K14 A;  3GO5 A;  4KY6 A;  1HXY D;  2FIN B;  2IX0 A;  3NBH A;  2K28 A;  3FPU B;  1ENF A;  4Y7N B;  1TY2 A;  5J1Z A;  1A2T A;  4ZK9 B;  1TY0 A;  5LL6 X;  5FKA C;  2Q8I B;  5EPJ A;  3MXP A;  3CQZ B;  3HGB A;  3MWY W;  4M8A A;  2KQ3 A;  5M5X B;  2EJF C;  4IZ8 A;  1F2L A;  2H4O A;  2JP1 A;  4K2K A;  5FLX E;  1TS2 A;  3OSO A;  1EY4 A;  1BCP C;  1F9P A;  2NUC A;  3HOZ B;  4DNR B;  1BBX C;  5IGF A;  1B4O A;  1C48 A;  4FF4 A;  2E2H B;  4P2C B;  3VYS A;  3MC0 B;  3D6W A;  1SEB D;  2V4D A;  1AEX A;  4ZQ3 A;  1BDO A;  5CV7 A;  4GZY C;  1EEF D;  1SSO A;  4IQZ A;  3MFY A;  3S14 B;  4IN3 A;  3S1N B;  5C4H A;  3BDO A;  3E5S A;  2Z1C A;  5BN4 A;  2VB3 X;  3BVG A;  1SDF A;  4ZYS A;  2PCF B;  2KOL A;  5DM6 3;  3MZ5 A;  1QCB D;  1HTL D;  3D4W A;  3NSW A;  1WTW A;  2K05 A;  4L8J A;  3J81 L;  1A3U A;  5LL6 S;  3GTL B;  4KI0 A;  3C2P A;  2B2W A;  1EY8 A;  1NCV A;  1SYB A;  4G7O C;  2O2L D;  3N52 A;  1SBB B;  2D5D A;  5KGU A;  3EA6 A;  2F4I A;  1GUT A;  1FGB D;  2J4X A;  4OL7 A;  4RGO S;  2RVL A;  1KNE A;  3DEO A;  4Z9C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...