5JEAH

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
305
structure length
282
Chain Sequence
DSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTITRLEEESSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 77
structure length 282
sequence length 305
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jeaH01
4RCNA 4BA1I 3M4YA 3MXUA 2A6HC 2BE5D 2PNRC 5BN5A 3VR2A 2O5IC 1VF7A 3D31A 2O5JC 1IW7C 1O7LA 1TU2B 4DNRB 1G291 3QJYA 1H9KA 3M7NA 3LWUA 3ND9A 1HPCA 1Q1BA 4LK1C 3T56B 4L8JA 1VDZA 3VR5A 4XTCS 1Z6HA 1CI3M 5JEAG 5JEAH 2A69C 2NN6I 3VR6A 1GUTA 2QF7A 4DK1A 4IQZA 1GUGA 3IKJA 1OXSC 1ONLA 3A7LA 3HGBA 1GHKA 1VCIA 1QJOA 2JEBI 3A8IE 3N6RA 2DN8A 1V43A 1CTMA 2EJGC 3DXJC 3CRLC 4GZYC 2E76C 2AWOA 2DNCA 2A6HD 4DK0A 1GUNA 1B9NA 1O78A 2EJMA 2BA0A 3IFTA 2AUKA 1IW7D 1DXMA 3PV0A 1ZYRC 3SDZA 1YNNC 2EVBA 2E74C 2A6EC 3VR3A 1A6XA 3MFYA 1Y69U 5BN3A 5A35A 4H13C 3I72A 1H9JA 3TZUA 2A69D 4JBWA 1H9SA 4KN7C 2LMCB 1EWHA 4OGQC 1LACA 4KN4C 2NN6G 3QIAA 2NN6H 1VF5C 1TKWB 1Y8NB 2B8GA 2BDOA 2K33A 2E75C 4I7ZC 1H9RA 3SE0A 1T5EA 2KCCA 1Z7TA 5BN4A 1Q12A 4KKSA 4H0LC 1E2ZA 3KLRA 4LJZC 3VR4A 5KNBA 3FPPA 2Q8IB 1K8MA 2PPBC 1OXVA 4KKUA 2AUJD 4HR7B 2B8FA 1OXXK 1PMRA 1ZKOA 2A68C 2K7VA 4H44C 1FR3A 2A6ED 2V4DA 4OO1G 2K32A 4OO1H 1GJXA 1Q1EA 4BA2I 2EJFC 1Y8PB 3QG1A 1HTPA 1Y8OB 4TKOB 3U9SA 3AB9A 4XIGS 3L7ZC 1V8QA 2JEAI 3A7AB 2EDGA 4G7ZC 1GUSA 3EQLC 3PUWA 5KNCA 1GUOA 2PCFB 2ZT9C 2D5DA 3OPOA 1H9MA 5KNDA 3H94A 4KKTA 3GQBA 3T51B 1K8OA 1E2WA 1OXTA 2YYZA 1E2VA 2DNEA 4KMUC 3PUZA 2D62A 1I6VC 4G7HC 2JE6I 1GHJA 1LABA 3FMCA 2D2CC 3A8KE 3D4RA 3LNNA 1FYCA 2BA1A 3OOCA 1IYVA 1DD2A 4JK1C 2BE5C 2KA7A 2R6GA 1B9MA 2A68D 4KI0A 3BG3A 3W3AA 4TQUS 1SMYC 5K36G 5K36H 4DNTB 3P20A 3BDOA 3PUYA 1YNJC 3PUVA 4IFDG 4IFDH 4G7OC 3A8JE 3GD7A 2CW0C 1DCZA 1BDOA 1HCZA 1Q90A 3ND8A 3I73A 3NE5B 3CRKC 3T53B 3VA7A 4PV1C 1IYUA 2IT1A 2L5TA 5C0XG 5C0XH 3M85A 1OXUA 4KHZA 3RLFA 3OW7A 3PUXA 1HQMC 2F1MA 2JXMB 3I4LA 1CFMA 3WDNA 1H9SB
chains in the Genus database with same CATH superfamily
2R7ZB 3EA6A 4JBJA 1XNRQ 1PTOF 3UDIA 1Q81C 1PH1A 2O5JC 5FLXL 1IW7C 4DNRB 2NZ1D 1A15A 1H9KA 2EYMA 3M7NA 3GTKH 2QW7A 1X3EA 1LM0A 1PV4A 2EYHA 2A69C 3VR6A 5FOBB 5HY6A 3CCVA 4ZCKA 1RTOA 2YV5A 3HGBA 1Q3LA 4DV2L 3MXGA 1VQNA 4DV3Q 1D5XC 4ZUJA 3U9OA 1RHPA 4LF9L 4OWWB 2A6HD 3M4QA 2K5NA 5C0XJ 5EBDA 1O78A 2EJMA 3IFTA 5IT9L 3KF6B 1PDQA 4AQYL 1PH9A 4LAAA 4R8IA 5EBCA 2I07B 4K2LA 1EIGA 4JI5Q 5BN3A 1CHQD 5C4XG 1TS2A 4JVZA 2K01A 4HEDA 4KHPL 3I7FA 4PZ8A 2JA5B 2KJXA 3KLRA 5KNBA 3MC0B 3GTMH 1ZYRD 1CZGA 2EPBA 4QUCA 2V4DA 1C0AA 1KRTA 3G6JB 1MJCA 2R7DA 3HOZH 1EIHA 2OT2A 4Y7NH 4XIGS 4DV0Q 4KTAA 3UDXA 2QCPX 5ISRA 3PUWA 3KOJA 3GTGH 2JK8A 2E2IB 1HZBA 3F2BA 5E4WC 4X66Q 1C9OA 3KF6A 5H1SE 4R1JA 4JC0A 2IW3A 1XMQQ 3J80c 5COYA 1DD2A 4O2DA 2KA7A 5CGKA 3BG3A 3W3AA 1X55A 1XJVA 3DWAA 4OEMB 4IFDH 1B3QA 2K6AA 1LUZA 1S5DD 3ND8A 4A3LG 1UEAB 3GTLH 1YZ6A 3CCQA 5M5YH 2JA6B 4HSPA 4OL7A 2VW9A 4GKJL 3MTSA 1NR2A 1KXLA 2A1AA 2N8NA 1J6QA 4Z9CB 1J8IA 3NELA 1JC7A 1CSQA 5I2XA 2F0MA 4YIJA 2CCZA 4DKAC 1S5BD 4G4KA 2PNRC 4RGTA 4APVA 5DLQE 4ZK9B 5BN5A 3KBXA 2ZXPA 1FGUA 4YWMA 4DNIA 1I6HB 1SFOB 2FFKB 3RD4A 2YTXA 4DV2Q 3LWUA 1C7YA 1JB3A 2EE1A 1EEFD 3ULLA 4FF2A 4LF9Q 5JEAG 3S2HB 4M8AA 1B44D 2DGYA 4DK1A 1MBYA 3HOXH 3FKIG 3MZ5A 3K7UC 2VUMG 3S15H 3ONAB 5IYDG 3CHBD 4BBRB 2MUYA 4AQYQ 1FL0A 1EQQA 3GTPH 3K5NA 4EQOA 3PIPA 3RZOB 5JVG3 3S1QH 2KHJA 3FRPB 2Z0SA 1T9HA 4EX5A 4NKLA 2JA8H 3MFYA 1HFGA 3E5SA 1B70B 3NTKA 1H9JA 4JI1L 2O2LD 4IUTA 3SK5A 2LY7A 2ZJRA 2RHSB 4KN4C 4CDFC 5DM63 1BBWA 4L6TB 2SOBA 1YHQA 2Z1CA 1T5EA 1LO5D 5M5XB 1PTOB 1VQAA 1O80A 4JBMA 2OQKA 2Z4HA 5DM73 2A68C 4A3IG 3HOUB 1DONA 4A3DB 2NVQH 3GTOH 4A3KG 1I4RA 3E9IA 3HOWH 3STBC 2R93H 4KKTA 2BOSA 2K5HA 2E5LQ 3NP8A 1EYGA 4IPGA 4IUQA 5C3EH 3FMCA 4H02A 2RVLA 3KLSA 4TVAB 4BY1H 2F0JA 5FO8B 4GKJQ 5ELCA 1LTAD 2VL6A 1E24A 5EKKA 3A8JE 3NEMA 2R61A 1EU3A 1PH5A 1SROA 4K8JA 5I2YA 2GVBA 4C3IG 3RR5A 1KC8C 1PHJA 4IPHA 1FD7D 5I9PA 1F9PA 2OF1A 1XMOL 1F77A 3QOJA 3R8BA 3HOYH 1H95A 4MNOA 1SR3A 3T4AC 3VYRA 2A6HC 4ALPA 3VR2A 1XPUA 3PO3G 3CW2C 4POGA 5C4HA 5KYIA 4OELB 2R92H 3OWEB 3G48A 3NWSA 4R4QA 2C5CA 1VMCA 1J9OA 2I5HA 5KIXA 4PMWA 4X64L 1PZJD 3GV3A 3ITPA 3S1RB 1GUTA 2CH4A 1FNUA 1R4PB 4A3FG 4CKEA 3DXJC 2ZTEA 5GADC 1IYJB 1EU4A 2LXJA 4LUVA 2ZTCA 4JI1Q 1IBML 4R4OA 3CQZB 3HKZB 1ZYRC 1WVLA 1I94L 4JYAL 1A6XA 2PZWA 3B6YA 2G9HD 4H7BA 4EQNA 1WI5A 4BS9A 3SVMA 2LMCB 3F2DA 3AU7A 1TKWB 1AEXA 3P75A 5M3FB 4NP5A 1I5FA 3Q23A 3I4MG 4KKUA 5I4DA 2RA4A 2K7VA 2WB1G 4Q5VA 3BVMA 2A6ED 4A3JB 2K32A 1I50H 1WTPA 1L0YB 1K0RA 2IWHA 1GKHA 1QUQA 4XDXA 5F2DA 5C4XH 4K0KL 2B63H 5ELEA 3SK6A 5IP7H 3M4PA 5LL6X 1ESFA 4B08A 2NYZD 4MTKA 4DF7A 3OW2A 4A93B 4IZ8A 1FYCA 1G2SA 1BOSA 1SDFA 4POFA 3NTIA 3P20A 5EGTA 4G57A 3BVGA 5LMNL 5CV9A 1XPRA 4QQBX 3CCEA 3MXNA 3TP8A 1G6ZA 4GLVB 1DYQA 4LUZA 3H0GB 1KD1C 1M90C 3DHQA 4HJ7A 3I4LA 4A3BG 4BY7G 4X6AH 1H9SB 1I4XA 1K9MC 1BNZA 1Y1WB 1EYCA 4X64Q 5FLXE 2OQ0A 3BZDB 3MXUA 1G91A 1OO9B 3ULJA 3E3XA 4RA8A 4C3JB 1HR0L 5FLMH 2DY7A 2UUBL 2MO1A 2FJ2A 3S14B 2Q8RE 1Q1BA 1EY5A 4JI2L 3NBIA 4KJOA 2XIWA 3OMCA 5FO7B 3KLSX 4A3LH 2QF7A 1KNEA 1TIID 5E1FA 1IBLQ 5T1IA 1TY2A 1IBMQ 4HTHA 4A3CH 1BXTA 1I94Q 4JYAQ 5M3MB 3A0JA 3G7LA 4UHVA 1TWCB 2NTTA 5IT9E 1MI2A 2HIXA 1D5MC 1Y1VB 2VQEL 1VQ5A 3RZDB 5D14A 3M3YB 5GQOA 2L0CA 4ZUIA 2YTYA 2E2IH 1LTID 1QG7A 2HUGA 1CK1A 3DMUA 1H9SA 3K8AA 1NMFA 2CH4W 3Q0AA 1LACA 2ICIA 2LXKA 3GO5A 1K83H 5BR8L 5IYDH 3SE0A 2L11A 5IGEA 1VQ6A 4XT3B 1SMXA 3SK4A 2G5DA 5JJKA 3CD6A 3QR8A 1RTNA 3E6ZX 4X65L 3U4VA 2JA9A 2NVTH 4K0KQ 1XXGA 2NVYB 1MHWC 4DR1L 3J80L 2JA6H 1GD7A 2A19A 1AH9A 3HOZG 1E3PA 5M5WH 1WTQA 1MIUA 1F9SA 2RHQB 4P75A 2CVRA 1PRTF 5KNCA 2XN9C 3NK9A 3L9AX 1VQIA 3W2DA 3S1MB 4KMUC 1EWIA 3TMEA 4HAEA 5J39A 2UXCL 1GVPA 4G7HC 3CPFA 5LMNQ 3MA2B 4DK3C 4A75A 4QY7A 2OWOA 3OOCA 4B3RL 1ASYA 4IFDG 4I65A 2RF4A 2NWGA 5JOBA 4U673 4YWKA 2PI2E 5ELNA 1BDOA 3ERQA 1HCZA 1ET9A 3H3VC 2Q2IA 3RZOH 3FEWX 1YEZA 3TQYA 3CC4A 3A56A 1HR0Q 2UUBQ 1M8AA 2NTSA 2EY2A 4JI2Q 4BA1I 3MXPA 3MFGA 4CJ2C 1HNXL 1STEA 2F0IA 1YNXA 2EY6A 1DZ1A 3C1EA 1EY8A 1TU2B 3H09A 4LUOA 1EYDA 3KBGA 4XQJA 1KAAA 2CQOA 3F1ZA 2MHVA 1IL2A 1HRJA 5M5XH 1PTOH 3HOXG 1Q8IA 4MHEA 1HNZL 2VQEQ 3A8IE 4RKLA 1M1KC 1SSOA 2F0WA 5ELOA 1W6KA 3HOUH 2J0TD 3PIO3 5JEAJ 3KFUA 4BBSG 2K4KA 3ULPA 3V2TA 1JB7A 2HDLA 2VS1A 1W6JA 3PO3H 2K1BA 1CSPA 1UE6A 2JA8G 2A6EC 2D0OA 4FNFA 5BR8Q 2UXBL 1HUMA 4LF8L 1VQCA 2BH2A 3GDEA 2GVAA 3A54A 2K14A 5C6AA 5DNFA 4X65Q 4PMBA 3NSWA 4OHJA 2F0TA 1B50A 2XWBB 3G4SA 4DR1Q 2I0QA 4A3FH 1Z7TA 2NVXB 3C2PA 2PYKA 1KABA 3I90A 4MN3A 2Q8IB 1HHVA 1KLUD 3D4DA 1X3GA 2HQEA 2Z9HA 2OTLA 4IURA 2F0FA 2CKZB 3AFPA 1SAPA 5E7NA 4YCUA 3TS2A 1Q46A 4TKOB 4A3EB 5NUCA 3AB9A 2Q2UA 2UXCQ 1HQRD 3J81j 3HOWG 1V9PA 1QB5D 5KNDA 4B3RQ 3H94A 1XX8A 1V1OA 1WJJA 1JMCA 1BKBA 3K7AB 3CC7A 1S40A 2HCIA 3PUZA 5HGTA 3J80i 3J7A5 1WYDA 2CWPA 2D2CC 1VQKA 2PW5A 5C5MA 1PH2A 1ENCA 4BY1G 1X3FA 3JAMc 3OWFA 3PUYA 1DOKA 2AWNA 3EROA 4C1NK 4IALA 1TVXA 4RAUC 1EZ8A 2L1BA 1HNXQ 5C0XH 2EIFA 3I56A 1CKMA 4JG2A 4KHZA 5CR3A 5C44B 4F88A 3D6CA 4ME5A 1DOLA 1CFMA 4JI8L 3VR5A 2HQLA 3HOYG 5IY0A 1AZQA 4DR3Q 4XT1B 1E1OA 2R92G 1KDAA 1HNZQ 3I4NH 1L2FA 3EVQA 3SEBA 1VDZA 5LHY1 2KVMA 4XTCS 3GTJB 1LTRD 4WJ4A 1VQ8A 4PQXA 3IL8A 1YJWA 2RSNA 1ONLA 4QMGA 1F2ZA 3CAMA 2DN8A 4A3JH 2M2LA 1ENAA 4A3BH 3MEFA 4BY7H 2UXBQ 2E76C 3HEJA 4LF8Q 2DNCA 1IKMA 2EYLA 1STHA 1TXYA 1PVOA 3TBIB 2OXPA 1JCKB 4DR5L 3RLOA 4WFN3 4HJAA 4UDUC 1Y69U 4LF7L 5IGGA 1S5FD 4RHRA 1B2TA 5EPLA 3S1NB 3HG9A 1E22A 2RDHA 4C2MB 2BDOA 1VQHA 3K81C 2XSCA 1N33L 1SE8A 2KCCA 1G8ZD 4LFCL 3CCUA 1CT1D 3IFDA 1CZWA 1ASZA 4JCVE 1WTWA 4GS3A 1A8VA 3T13A 1JWUD 3OIPA 2KQ3A 5DAUA 4PZ7A 1RD9D 3CCRA 1JT8A 2R7ZG 1RJTA 4K5VA 4FYDA 1QNUA 2B63G 5IP7G 2AQ2B 2YYZA 4LF4L 1D1KA 4C3JH 1PFSA 1QILA 3PO2B 2N88A 1GUWA 3R2IA 2KENA 4RGMA 2X69A 3TN2A 3HZXA 1VQBA 3QWNA 1CM9A 1I3QH 3S16B 4DNTB 4IFDI 1TS5A 1NBWA 1XWEA 3BYYB 2E2DC 3KK7A 3G71A 4HIOA 4JI8Q 4RG1A 1N9WA 5M3MH 3M4OB 1TWCH 4HJ5A 1SNOA 1WTHA 3M85A 1Y14B 3PUXA 3TREA 2QEXA 1Y1VH 1AN8A 1TS3A 1SRUA 5EKLA 5GAHC 1T5XD 1QOHA 1NMGA 3GTQB 1EIFA 1EY0A 4N9PA 5IIFA 2F0OA 4A3GB 3MEHA 5FLMG 3GV6A 4IUUA 2F03A 4DPGA 2E5LL 2XRSD 3RN5A 1Q7YC 3T56B 3F2CA 3W1GA 3K0YA 1YHBA 3OTOL 1Q82C 4A3CG 1SXTA 4L5QA 3BS1A 3HOVB 2NVYH 1X3QA 3A74A 2IPKD 4DR5Q 1STAA 1LTLA 4LF7Q 1CA5A 1RKNA 4KD4A 4B9WA 2KBNA 2EYJA 1N33Q 1P8LA 3SR1A 1WTXA 1PH8A 2XRQD 2HHHL 4LFCQ 1SNCA 4YY3L 4DK6C 1UE7A 1VF5C 5JPNC 4NDXA 3EJIA 4OXPA 2RCFA 5AFWA 3G6EA 1E2ZA 1L0XB 1PYSB 1TWAH 4UP8A 4BBSH 3MHBA 2Z8LA 3J80E 3K5OA 2EY5A 4LW1A 2JA6G 1VQ4A 1GJXA 2L12A 4A3MB 4AH6A 3J7AF 1BO0A 1SNDA 4LF4Q 1HTPA 1GOZA 1IZ6A 4NPSA 1PFBA 2N78A 5JJIA 1EYAA 4K2KA 4QJFA 2D5DA 2PO4A 4YWLA 2CWAA 1KIXA 2VY3A 1EUJA 3WOFA 2NB0A 2MJ8A 3DWQA 1EL0A 3UE0A 2Y0SG 2ICEC 4UP7A 4KI0A 1CQFA 4TQUS 1BF4A 5DEHA 1N34L 3PUVA 3NXWA 2PNHA 4BBRG 4LMQD 1S4ZA 3D3RA 1V1PB 2PI2A 3ZJYC 4LF5L 4KHVA 5IP9H 2L5TA 4IFDJ 1AE2A 1HQMC 2E2JB 4X3UA 4FXKC 5FKAC 4FF4A 1UE1A 1KTKA 4C3HB 2N3SA 3NQTA 1SNQA 1ESRA 2HCCA 4QB4A 3OTOQ 2BH8A 2YU9B 4CDEC 4V0BA 2MP1A 3HFZB 4WJ3M 4KD3A 1A62A 1BR9A 4ULLA 5C4JH 2EYFA 2NN6I 3R93A 4Y52H 4XYOA 1E7ZA 1QJOA 2KCTA 4OX9L 1X3PA 3HOUG 2KCMA 4A3DG 1LLRD 4L63B 4FDBA 3X3MA 4A3EH 3S2DB 2HHHQ 4YY3Q 4DU9A 1V1PA 2NZOA 1XYIA 4AYBG 5CV4A 2E2HB 2ENBA 1RL2A 2KEDA 2NN6H 3BVZA 1Y8NB 1ENFA 3FDTA 2WACA 5BN4A 4OWXB 1QUQB 4H0LC 3VA5A 4KY7A 4J1MA 2RQXA 3T16A 3J7YW 3FPPA 1R9TH 3NBHA 1IBLL 4XQQA 2OCEA 4BWGB 2WAQB 2EOTA 2JA7B 4GN4B 1Q1EA 4DAPA 4BA2I 2EJFC 1LT5D 2J7ZA 4P2CB 3HRZC 3L7ZC 4GN5A 1U4PA 3NWTA 3EQLC 1EZ6A 4JW0A 4R4IA 5EJWA 3T51B 1N34Q 4K8IA 3DWPA 2D62A 2IX1A 1HZ9A 1C4QA 3U4ZA 3MXNB 3TP6A 4JI0L 1XNQL 1ILPA 4LF5Q 2PQEA 4J8QA 5FO9B 4R4CA 1LT6D 3I2ZA 3EBEA 3S17B 3CRKC 2H4OA 3DEOA 4YCVA 2R7ZH 5C0XG 5FJ8G 3EFXD 3RLFA 3KJPA 4XYQA 3HKZG 2RDFA 1BBUA 1TWGB 1IKLA 1KHIA 5IYCH 5KRUA 3D31A 5KGUA 5IGDA 1ET6A 2KOLA 3I4NG 3UI2A 4OX9Q 4IUNA 1SYEA 2QILA 1FJGL 3ZYYX 1O7YA 1JOKA 3AEVA 2OEOA 3GTKB 3OSOA 2JEBI 4RWSC 3LX0A 2EXZA 5ELDA 4GNXC 1CTMA 4A3JG 5IT9c 4CGYB 1VS0A 4ILWA 4GOPC 2AWOA 2I46A 4JI7L 4ZQ3A 4IO9A 4B3ML 3U58A 2EVBA 2E74C 2ZJQA 4MTNA 2BCOA 2K05A 3TRZA 3VYTA 2H5XA 3R2TA 4DXFA 2JA5H 1IHZA 4A93G 4GNXB 1U4MA 4GOPB 2A8VA 4HMIA 5CV8A 4EGVA 2E75C 4K5XA 4JOIC 1H9RA 3S16H 2QKIC 1GO3E 5L37A 2J4XA 4PNYA 1K3BC 1UUPA 1IL8A 5J22A 4K6DA 5KEEA 2MFIA 1K8AC 2TSSA 3J81c 2MO0A 2FMMA 5I9OA 1A63A 4RFBA 4ZKBB 2Q2TA 4F8MA 4WJWA 5CV5A 3GTMB 4HCEA 2WP8J 1Q86C 3A7AB 1UWVA 4G7ZC 1Y1WG 3GTQH 3FPUB 1XNQQ 4JI0Q 1EWCA 4RH6A 2IX3A 1EY9A 1VQMA 3UDFA 1E2WA 4A3GH 2I5LX 2DNEA 4LWCA 4Y7NB 4C3JG 2LFNA 1II3A 1LTGD 1UNSA 1KNAA 3NTHA 1YJNA 2X6LA 1JJ2A 2DJFC 2X6GA 2M9VA 3JAMi 2R6GA 5A2QL 1UEBA 4GNXA 1CQVA 1NSNS 1CA6A 4GOPA 3S24A 1HA6A 2JSOA 3HOVH 3NE5B 2N55A 5M3MG 1FGBD 1PH7A 2K50A 2D9UA 3CCLA 1Y1VG 2F1MA 4GN3B 3J7AV 2D0PA 2JXMB 3D4WA 3D6WA 4CDCC 1I6HH 1SFOH 5M5YB 3MWYW 2BE5D 1FJGQ 4JOIA 3ICEA 3S2HH 3PIP3 4NXML 2SDFA 3CMEA 2Z6BA 4P74A 2B2YC 4RGOS 1G2TA 2B29A 3KF8B 1PYBA 4BBRH 4EQ5A 4HSVA 3URYA 2IJ0A 4HIKA 1Z6HA 1MGSA 3K58A 1J5EQ 2F0GA 1BCPD 4JI7Q 1K73C 3FVQA 4HIMA 2VNUD 1STYA 4B3MQ 1B7YB 2QA4A 4E6IA 1IXRA 4NMZA 4X3KA 1JORA 2Y0SE 4A3MH 4GZYC 3HOXB 2KHSA 4ZRZA 3S15B 5TSSA 3CP0A 1ML0D 4IUPA 4B3TL 3P7JA 3BDCA 5D65A 2QDBA 3S1QB 2LS01 3O13A 5HURA 4IOCA 3H15A 3AQQA 1PA6A 1B3AA 1TWFB 4QGUA 2ALYB 4DR3L 2JA8B 4BXXH 2F0DA 3D0FA 2B8GA 1LT4D 3JC66 2B39A 3I70A 4IOAA 4A3DH 1D5ZC 4QL5A 4DA2A 5IWAL 4LJZC 1BQQT 4JI3L 2YTVA 3KF8A 1A3VA 1A0IA 4HR7B 4LF6Q 4EVOA 4DV6L 3KYHC 1HTLD 2IHFA 5CV6A 4TSSA 1GXDC 4IUVA 1V8QA 2NVQB 1I4GA 4N9TA 2B2YA 3GQBA 4ZLTF 3GTOB 2YU9H 4XQNA 1KRSA 2K75A 4J6HA 1HFNA 4IPDA 5J1ZA 2JE6I 1X32A 2FINB 2OTJA 3A8KE 2R93B 2MPMA 3CKIB 1MJEA 2K5QA 4DR6L 3K57A 4V190 1HH2P 1WCMB 4RGNA 5C3EB 2NZHA 3PF4A 4OIKA 4AYBE 4DV4L 1DCZA 4FXDA 4BY1B 1ICWA 2IX0A 3T53B 3CXCA 5C0XI 1CKNB 5IP9G 1IYUA 4C1NI 4A4IA 1LTBD 3OW7A 4DV1Q 4ID6A 2XTIA 4NXMQ 1HNWL 4RCNA 2B2TC 2K5WA 4P71A 2L55A 5I6YA 3S1RH 1YNJD 1SYFA 2BDNA 3KUPA 1G291 5D3IB 5LMNW 3HOYB 1K28A 4DV5L 1NUCA 1EY4A 2R92B 2F4VL 4FVMA 2ATWA 4ZYSA 1GUGA 1UAPA 2IHEA 4B3TQ 1NTGA 1VCIA 1JE5A 5FJ8H 1N36L 4KJNA 1PH4A 2MQHA 3CQZH 2PZUA 5G3LD 4ABNA 4A3EG 1KDBA 1ZXTA 1QVGA 2B2VC 3HS0C 5IGBA 4QCLA 2F52A 2WB1E 1CHPD 2N49A 2K04A 1PTOD 3HKSA 1HR0W 2SEBD 1CKNA 3TEHB 1JICA 3OYYA 5C3XA 5M3FH 1N8RC 3I72A 4P72A 2TMPA 5IWAQ 4JI3Q 1EWHA 2E8GA 2NN6G 2F0QA 3VDYA 4HJ8A 2EYPA 4RHSA 3DEPA 1F2YA 1XPOA 1PH3A 4DV6Q 4X3TA 1KL9A 1Q12A 4KK7A 1EOTA 1A2UA 3VR4A 1CKOA 4I7AA 1TS4A 1EQVA 4R4TA 1TY0A 1ZKOA 3NQIA 1EOVA 3TP5A 4H44C 2F0VA 1L1OC 1O7ZA 4OO1H 2B2TA 3NPPA 5C44G 3QG1A 1V1QA 3U9SA 3RUZA 3C1FA 2WIIB 1I50B 2PCFB 4A93H 1WTOA 1OXTA 4DR6Q 1E2VA 4KLKA 4DAMA 1KDCA 4UAIA 2F3WA 1DM0B 1BVSA 5C4XB 1L1OB 1GHJA 4DV4Q 2B63B 1VQPA 4JI4L 2SNMA 2BE5C 1QNKA 1NCVA 1YBYA 2K28A 3KJOA 3Q22A 4YHHL 4FF1A 4RMFA 1RIPA 2B2VA 1SBBB 1B1ZA 1JJCB 3H0GH 1HNWQ 3I73A 5IOCA 2F0NA 1BCPC 1Y1WH 4PG3A 4M1UB 2KUMA 1U4RA 1EQTA 3NUCA 4DR2L 1DXMA 3S14H 2A73B 2FMCA 1FNVA 4DV5Q 2HIVA 1YIJA 5IYCG 2PW7A 4B3SL 2F4VQ 2RBMA 3FP9A 4DR7Q 2MGSA 1BCPB 4LK1C 1N36Q 1Q8KA 1NR4A 5IYBH 3TP7A 1L1OA 5IE8A 5D3DA 1Z9FA 4JI6L 1SYDA 3RZDH 2HT1A 3SXHA 3M3YH 1YHAA 3CRLC 3HP3A 5HGQA 1YVCA 1JWMD 1TWHB 1VQ9A 3VYUA 5GROA 1QVFA 1LTSD 3TSSA 3VYSA 4DXGA 3EIVA 3J81L 3PO2G 2JA5G 1VQ7A 1D1IA 4QIWE 4L5RC 1KQSA 3ER0A 2PMZE 1STBA 3AMUA 2XGTA 1S72A 5LL6S 1A2TA 2VXWA 3FKIB 2VUMB 1K83B 1F2MA 2AUJD 3F2UA 3NENA 2XNAC 1WD0A 1YNND 4UP9A 1S3OA 1NNXA 2L15A 4CJ1B 3S1MH 2ZXRA 4DAVA 3BYTB 2NVTB 2JQOA 3SHLA 3BDLA 2ZT9C 4JI4Q 3D8GA 1K8OA 1DJRD 4A3GG 3I91A 3H3VI 5M5WB 3DM3A 4YHHQ 5JJLA 1NE3A 3LNNA 3D4RA 5A2QE 1SEBD 1IYVA 1JWSD 2I5MX 1JE4A 5IGFA 3CCMA 1YNJC 1D7QA 2NBFA 4UY8C 1JOOA 1X6OA 2Y0SB 3HOVG 4DR2Q 5AJ3L 5LMUL 4GLAC 2JN4A 1X54A 4A3IB 4JPBW 3KDFB 4O1NA 4B3SQ 2Z6KC 4QF4A 1ZEQX 4DFAA 2FHTA 5M9OA 4JV5L 2IY5B 1P16A 2VZAA 4A3KB 3H3VH 3A55A 2F0SA 3IAYA 1E1TA 4UPAA 1SMYD 1PTOC 1AW7A 1TWFH 2ZTDA 5GAGC 2ASBA 4KHPQ 3Q6SA 3ND9A 1HPCA 1I4PA 4L8JA 1HJPA 4JI6Q 2UXDL 1HXYD 4DAYB 2HD3A 1LYLA 1I4HA 3DM1A 2HDMA 3T1YL 4HN7A 4HIDA 4IQZA 3MAQA 1F9QA 3WWVA 4R8NA 3Q8DA 2DUDA 1U5KA 3Q24A 4A3MG 1FNWA 4DR4L 1JOQA 2EZVA 1PZKD 1TQOA 4C3IB 3UE1A 2K5VA 4RKBA 3I4OA 1B9NA 3I3CA 2F0UA 2VB2X 1ICFB 3VR3A 3KDFA 1SN8A 1G51A 2LKVA 3A5ZB 4ME3A 3L2PA 5E3FA 5A35A 3NBHB 3PO3B 2NVXH 4KN7C 4BXXG 1AZPA 1KAWA 2AMCB 2B3GA 1CUKA 3QIAA 1PXUA 3PIOA 4R9WA 2QEJC 1WCMH 2RSOA 4AYBB 1QZHA 1R4QB 5ELFA 4C56C 1PYWD 2AKWB 2Z6KA 2PPBC 1OXVA 1S5ED 2B8FA 5CMDA 4DAYA 3J81i 4GLXA 4A3FB 1JQYD 1X65A 5K5PA 5C3WA 1PFMA 2XWJB 2K5DA 3K7AH 4C3HG 5KYLA 1VQLA 3OIQA 1GM5A 2QDLA 1SE3A 1H9MA 1D2BA 1UE5A 3TDQA 3AYHB 1K0SA 3CC2A 1I6VC 3R3OA 2DY8A 2C9OA 1SYGA 1EY7A 4WORA 4KY6A 2BA1A 2P5ZX 2PZTA 5AJ3Q 4JK1C 2KHIA 5LMUQ 4JBKA 5K36H 1HA5A 2G9DA 2GA4B 1WOCA 3I4MB 3GD7A 4JV5Q 1PZID 4LFAL 4FO2A 4KV6A 4F7XA 5C44H 3PSIA 1STNA 1Q90A 3JAML 2WB1B 3DUZA 3C46A 2IL8A 1XTDA 3PMFA 2CFMA 3BZKA 4HJ9A 3WDNA 2UXDQ 2H1EA 1SYBA 2F3IA 2JP1A 3LGJA 3LWEA 3T1YQ 3PF5A 1SYCA 2Q2HA 1WD1A 3GTJH 2R3ZA 4P73A 3S9WA 3QJYA 4MZ9A 4O42A 4DR4Q 1NY4A 2WV6D 2F0HA 1OXSC 3A7LA 3IKJA 3I4NB 5C4ZA 2AQ3B 2WAQG 5E4XA 1VQDA 2JA7G 2EJGC 3BJUA 3PQIA 5FLXc 4AIMA 3H91A 1SLJA 5CV7A 2WKDA 1QVCA 2BA0A 3SDZA 1Z47A 2NUCA 1YNNC 4A3BB 2F4IA 4BY7B 4CKCA 3S1NH 5CBEE 4C2MH 2K52A 4NB3A 5M3FG 4H13C 4PMCA 1EEID 2B2WC 4Q0FA 3BU2A 1VQOA 3A5UA 3C3LA 2GN5A 1QCBD 4B9XA 1YI2A 4IJLA 1F2LA 1OTCA 1J5EL 1K8GA 1VQFA 1PMRA 1S5CD 3K6OA 4FP5D 1FR3A 1TT2A 2O4XA 1LT3D 4OO1G 3I55A 1G6PA 3ERSX 1XMOQ 2JJQA 2ZJPA 3OMGA 5JVH3 3PO2H 1FVIA 4RCOA 3OPOA 3RNUA 3V96A 4F87A 4K5WA 2F0LA 4IJHA 3CF5A 5T1GA 4LFAQ 3MVVA 3H6MA 4DUYL 1MSHA 1F9RA 1A3UA 4PZ6A 1SMYC 3M4OH 2F0PA 3CU7A 1M4VA 2KCNA 3H0GG 3V05A 2B2UC 1I3QB 3NHHA 1N32L 1EY6A 3RMHA 4LF6L 5FK9C 2ES2A 1TWHH 1EIYB 1OXUA 2VQFL 1PRTD 4LFBL 3M9BA 3HOZB 4OONA 2B2WA 2QGQA 1QZGA 1W2BA 2KECA 2V1CC 1RCVD 3GTGB 1SNPA 1YITA 4GKKL 4QIWB 3UDGA 1O7LA 2A5HA 4NW2A 2UUCL 3AFQA 2CW0D 4NXNL 2PMZB 5IYBG 3T1HL 4CKBA 2WFWA 2RCNA 5JEAH 2K03A 2ZXOA 5CC4A 1LTTD 3FKIH 5J3BA 2VUMH 4IN3A 4S3SA 5CORA 1V43A 3FHWA 3IRBA 4CJ0B 1D6EC 3GTLB 2XVSA 3OHXC 1PH6A 1GUNA 1SE4A 2RKSA 1EQRA 2AUKA 1IW7D 4EQPA 2ZM6L 4DV1L 5EPKA 5CBAE 3CPWA 3J81E 4CDDC 4ZAIA 4DV7L 2UU9L 2R7FA 3RLNA 1PFNA 1VQEA 2A69D 3TZUA 3W1BA 3K0XA 5EKIA 4J15A 4L5TA 1DOMA 4OGQC 4XXEA 4ZKCB 2ID0A 2B2UA 1YJ9A 4FF3A 1TR5A 1VQGA 2AQ1B 4X62L 2SNSA 1XTCD 1O7IA 1OXXK 1SNMA 2Q8TA 4A3IH 3M7GA 4MIUA 3QO2A 1I4QA 1WTVA 2EQSA 1TWAB 3GTPB 4LNQA 4BBSB 3DLLA 4A3KH 3L3OC 1MSGA 2VB3X 1GUSA 3K80C 1GUOA 4DUYQ 3WOEA 1K3RA 1MD2D 3X3NA 1JJGA 4N8FA 1L0WA 4DN4M 4HMJA 4CBVA 3TS0A 1ILQA 2LSSA 3J7ZC 1N32Q 4A76A 2UUAL 3I8ZA 3F8TA 1B53A 1KLGD 4G7OC 2VQFQ 3TZDA 1C8CA 4LFBQ 3E0JA 3L0OA 2E2JH 3P1HA 4L5SA 3PCOB 1BCPF 4O0AA 4K14A 2RDGA 4HCSA 3CCSA 3VA7A 4C3HH 4C3IH 4PV1C 1IBKL 1B8AA 2IT1A 3QB3A 3W5OA 4GKKQ 1D8LA 4DUZL 2UUCQ 2L4NA 1X56A 3HOWB 4NXNQ 3T1HQ 2EY1A 3M4YA 4QUFA 1VQJA 2O5IC 1U0LA 4FXGC 1VF7A 3EN2A 1U9RA 2PQAB 4K6LA 3BZCA 1SJHD 4N8X1 2FXQA 1MKHA 1A3TA 1XNRL 1SE2A 1CI3M 2EXDA 3S2DH 5ELBA 1GHKA 3N6RA 2ZM6Q 3PGZA 1RODA 5C4JB 4KY5A 2F0KA 2WINB 3KLWA 2A74C 1DGSA 4DV7Q 2UU9Q 3SK8A 1U4LA 4DK0A 1AFPA 1JR0D 2F0EA 2Z4IA 3PV0A 2E2HH 2MNAA 4DV3L 1C48A 3E9HA 4WRDA 5CYUA 4JBWA 4X62Q 3QOLA 2R93G 1W3SA 2KEEA 5JJZA 1EFWA 1B4OA 4DR7L 2K33A 4I7ZC 3K5MA 5EAYA 2PQAA 1HZAA 1WCMG 3N52A 5C5LA 4JI5L 5C3EG 4DGZA 3RN2A 1QE6A 4KKSA 2JA7H 3I4MH 1LV9A 5JAVA 2EYOA 4X3SA 1K8MA 3K59A 3CMAA 1PLFA 2CHBD 4OO1I 1RDPD 5EPJA 5EQ0A 1EFID 1Y8PB 1BUVT 1Y8OB 1R9TB 4ODGA 2JEAI 1QWYA 2EDGA 2F3VA 1VMPA 5I6WA 2WAQE 3HKZE 1NAPA 4CHTB 2C35B 1PRTC 2WKCA 1WFQA 4OWTB 2JYOA 2UUAQ 2L9HA 5JPMC 4OIJA 4YCWA 4DV0L 3U50C 1LABA 2DJGC 1AE3A 1HUNA 1HZCA 3E0EA 1B9MA 2A68D 3S17H 5K36G 1IBKQ 5IODA 3BDOA 4X66L 3JAME 4DUZQ 2CW0C 1BBXC 1XMQL 1RF2D 3GP7A 1PRTB 3CCJA 5GAEC 1STGA 4IPCA 1E0BA 2AHOB 1X9NA 3STBD 1TWGH 5IGCA 3K5LA 1NJIC 1AP0A 4TRDA 4U68A 5G3LF 2M00A 2CQAA 1SJED 1WTRA 3SGIA
chains in the Genus database with same CATH topology
2R7ZB 3EA6A 1PTOF 2O5JC 5FLXL 1IW7C 4DNRB 2NZ1D 1A15A 1H9KA 2EYMA 3M7NA 2EYHA 2A69C 3VR6A 5FOBB 1RTOA 3HGBA 1Q3LA 3MXGA 1D5XC 4ZUJA 3U9OA 1RHPA 2A6HD 5C0XJ 5EBDA 1O78A 2EJMA 3IFTA 5IT9L 1PDQA 4LAAA 4R8IA 5EBCA 2I07B 4K2LA 1EIGA 5BN3A 1CHQD 1TS2A 2K01A 4HEDA 2JA5B 2KJXA 3KLRA 5KNBA 3MC0B 1ZYRD 1CZGA 2EPBA 4QUCA 2V4DA 3G6JB 1EIHA 2OT2A 4XIGS 4KTAA 2QCPX 5ISRA 3PUWA 2E2IB 5E4WC 2IW3A 5COYA 1DD2A 2KA7A 5CGKA 3BG3A 3W3AA 3DWAA 4IFDH 2K6AA 1S5DD 3ND8A 1UEAB 2JA6B 4HSPA 4OL7A 3MTSA 1NR2A 4Z9CB 1J8IA 1JC7A 5I2XA 2F0MA 4YIJA 1S5BD 4G4KA 2PNRC 4RGTA 5BN5A 4ZK9B 3KBXA 2ZXPA 1I6HB 1SFOB 2FFKB 3RD4A 3LWUA 1JB3A 2EE1A 1EEFD 4FF2A 5JEAG 3S2HB 4M8AA 1B44D 4DK1A 1MBYA 3MZ5A 3ONAB 3CHBD 4BBRB 2MUYA 3K5NA 4EQOA 3RZOB 5JVG3 3FRPB 4NKLA 3MFYA 1HFGA 3E5SA 3NTKA 1H9JA 2O2LD 4IUTA 3SK5A 2LY7A 4KN4C 5DM63 4L6TB 2SOBA 2Z1CA 1T5EA 1LO5D 5M5XB 1PTOB 1O80A 2Z4HA 5DM73 2A68C 3HOUB 1DONA 4A3DB 1I4RA 4KKTA 2BOSA 3NP8A 4IUQA 3FMCA 2RVLA 3KLSA 2F0JA 5FO8B 5ELCA 1LTAD 5EKKA 3A8JE 2R61A 1EU3A 4K8JA 5I2YA 4C3IG 1FD7D 5I9PA 1F9PA 2OF1A 1F77A 3QOJA 3R8BA 3T4AC 3VYRA 2A6HC 3VR2A 5C4HA 5KYIA 3OWEB 3NWSA 2C5CA 1VMCA 1J9OA 5KIXA 4PMWA 1PZJD 3GV3A 3ITPA 3S1RB 1GUTA 1FNUA 1R4PB 4CKEA 3DXJC 1EU4A 3CQZB 3HKZB 1ZYRC 1WVLA 1A6XA 2PZWA 2G9HD 4H7BA 4EQNA 4BS9A 3SVMA 2LMCB 3AU7A 1TKWB 1AEXA 3P75A 5M3FB 4NP5A 3Q23A 4KKUA 5I4DA 2RA4A 2K7VA 4Q5VA 3BVMA 2A6ED 4A3JB 2K32A 1WTPA 1L0YB 2IWHA 4XDXA 5F2DA 5ELEA 3SK6A 5LL6X 1ESFA 4B08A 2NYZD 4DF7A 4A93B 4IZ8A 1FYCA 1G2SA 1BOSA 1SDFA 3NTIA 3P20A 5EGTA 4G57A 3BVGA 5CV9A 3MXNA 3TP8A 1G6ZA 1DYQA 3H0GB 3DHQA 3I4LA 1H9SB 1I4XA 1BNZA 1Y1WB 1EYCA 5FLXE 3BZDB 3MXUA 1G91A 1OO9B 4RA8A 4C3JB 2DY7A 2FJ2A 3S14B 2Q8RE 1Q1BA 1EY5A 3NBIA 4KJOA 2XIWA 3OMCA 5FO7B 3KLSX 2QF7A 1KNEA 1TIID 5E1FA 5T1IA 1TY2A 4HTHA 1BXTA 5M3MB 3G7LA 1TWCB 2NTTA 5IT9E 1MI2A 1D5MC 1Y1VB 3RZDB 5D14A 3M3YB 2L0CA 4ZUIA 1LTID 1QG7A 2HUGA 1CK1A 3DMUA 1H9SA 3Q0AA 1LACA 2ICIA 3GO5A 3SE0A 2L11A 5IGEA 4XT3B 3SK4A 1RTNA 3E6ZX 1XXGA 2NVYB 3J80L 1WTQA 1F9SA 2CVRA 1PRTF 5KNCA 2XN9C 3NK9A 3L9AX 3W2DA 3S1MB 4KMUC 3TMEA 4HAEA 5J39A 4G7HC 3MA2B 3OOCA 4IFDG 4I65A 2NWGA 5JOBA 4U673 1BDOA 3ERQA 1HCZA 1ET9A 3H3VC 3FEWX 3A56A 1M8AA 2NTSA 2EY2A 4BA1I 3MXPA 3MFGA 4CJ2C 1STEA 2F0IA 1DZ1A 2EY6A 3C1EA 1EY8A 1TU2B 3H09A 4XQJA 1EYDA 3KBGA 1KAAA 2MHVA 1HRJA 1PTOH 1Q8IA 4MHEA 3A8IE 4RKLA 1SSOA 2F0WA 1W6KA 2J0TD 3PIO3 5JEAJ 3V2TA 2HDLA 1W6JA 2K1BA 2A6EC 4FNFA 1HUMA 3A54A 5C6AA 5DNFA 4PMBA 3NSWA 4OHJA 2F0TA 1B50A 2XWBB 1Z7TA 2NVXB 3C2PA 2PYKA 1KABA 3I90A 4MN3A 2Q8IB 1HHVA 1KLUD 3D4DA 2HQEA 4IURA 2F0FA 1SAPA 4TKOB 4A3EB 5NUCA 3AB9A 1HQRD 1QB5D 5KNDA 3H94A 1XX8A 1V1OA 3K7AB 2HCIA 3PUZA 5HGTA 2D2CC 2PW5A 5C5MA 1ENCA 3OWFA 3PUYA 1DOKA 2AWNA 3EROA 4C1NK 4IALA 1TVXA 4RAUC 1EZ8A 2L1BA 5C0XH 4KHZA 5CR3A 5C44B 4F88A 3D6CA 4ME5A 1DOLA 1CFMA 3VR5A 1AZQA 4XT1B 1KDAA 3EVQA 3SEBA 1VDZA 5LHY1 2KVMA 4XTCS 3GTJB 1LTRD 4PQXA 3IL8A 2RSNA 1ONLA 4QMGA 1F2ZA 2DN8A 2M2LA 1ENAA 2E76C 3HEJA 2DNCA 1IKMA 2EYLA 1STHA 3TBIB 2OXPA 1JCKB 4WFN3 1Y69U 4UDUC 5IGGA 1S5FD 4RHRA 1B2TA 5EPLA 3S1NB 3HG9A 2RDHA 4C2MB 2BDOA 2XSCA 2KCCA 1G8ZD 1CT1D 3IFDA 1CZWA 1WTWA 3T13A 1JWUD 3OIPA 2KQ3A 5DAUA 1RD9D 1RJTA 4K5VA 4FYDA 1QNUA 2AQ2B 2YYZA 1D1KA 1QILA 3PO2B 2N88A 1GUWA 3R2IA 4RGMA 2X69A 3TN2A 3HZXA 3QWNA 1CM9A 3S16B 4IFDI 4DNTB 1TS5A 1XWEA 3BYYB 2E2DC 3KK7A 3M4OB 1SNOA 3M85A 3PUXA 1AN8A 1TS3A 5EKLA 1T5XD 1QOHA 3GTQB 1EY0A 4N9PA 5IIFA 2F0OA 4A3GB 3MEHA 3GV6A 4IUUA 2F03A 2XRSD 3T56B 3K0YA 1SXTA 3BS1A 3HOVB 1X3QA 2IPKD 1STAA 1CA5A 1RKNA 4KD4A 4B9WA 2EYJA 3SR1A 1WTXA 2XRQD 1SNCA 1VF5C 5JPNC 4NDXA 3EJIA 5AFWA 1E2ZA 1L0XB 3MHBA 2Z8LA 3J80E 3K5OA 2EY5A 1GJXA 2L12A 4A3MB 3J7AF 1BO0A 1SNDA 1HTPA 1GOZA 1PFBA 1EYAA 4K2KA 2D5DA 2PO4A 3WOFA 2NB0A 2MJ8A 3DWQA 1EL0A 2ICEC 4KI0A 1CQFA 4TQUS 1BF4A 5DEHA 3PUVA 3NXWA 4LMQD 1S4ZA 3D3RA 1V1PB 4KHVA 2L5TA 4IFDJ 1HQMC 2E2JB 4X3UA 4FXKC 5FKAC 4FF4A 1KTKA 4C3HB 3NQTA 1SNQA 1ESRA 2HCCA 4QB4A 2YU9B 4V0BA 2MP1A 4KD3A 1BR9A 4ULLA 2EYFA 2NN6I 3R93A 4XYOA 1QJOA 1X3PA 1LLRD 4L63B 3X3MA 3S2DB 4DU9A 1V1PA 1XYIA 5CV4A 2E2HB 2ENBA 2KEDA 2NN6H 3BVZA 1Y8NB 1ENFA 3FDTA 2WACA 5BN4A 4H0LC 3VA5A 4KY7A 4J1MA 2RQXA 3T16A 3J7YW 3FPPA 3NBHA 4XQQA 4BWGB 2WAQB 2EOTA 2JA7B 1Q1EA 4DAPA 4BA2I 2EJFC 1LT5D 2J7ZA 4P2CB 3HRZC 3L7ZC 1U4PA 3NWTA 3EQLC 1EZ6A 5EJWA 3T51B 4K8IA 3DWPA 2D62A 2IX1A 1C4QA 3TP6A 1ILPA 2PQEA 4J8QA 5FO9B 1LT6D 3S17B 3CRKC 2H4OA 3DEOA 5C0XG 3EFXD 3RLFA 4XYQA 2RDFA 1TWGB 1IKLA 5KRUA 3D31A 5KGUA 5IGDA 1ET6A 2KOLA 3UI2A 4IUNA 1SYEA 2QILA 3ZYYX 1O7YA 1JOKA 2OEOA 3GTKB 3OSOA 2JEBI 4RWSC 3LX0A 2EXZA 5ELDA 1CTMA 4CGYB 4ILWA 2AWOA 2I46A 4ZQ3A 2EVBA 2E74C 2BCOA 2K05A 3VYTA 3R2TA 4DXFA 1IHZA 1U4MA 4HMIA 5CV8A 4EGVA 2E75C 4K5XA 1H9RA 2QKIC 2J4XA 4PNYA 1UUPA 1IL8A 5J22A 4K6DA 5KEEA 2TSSA 2FMMA 5I9OA 4RFBA 4ZKBB 4F8MA 4WJWA 5CV5A 3GTMB 4HCEA 2WP8J 3A7AB 4G7ZC 3FPUB 1EWCA 4RH6A 2IX3A 1EY9A 1E2WA 2DNEA 4Y7NB 4C3JG 2LFNA 1II3A 1LTGD 1UNSA 1KNAA 3NTHA 2X6LA 2X6GA 2M9VA 2R6GA 5A2QL 1CQVA 1NSNS 1CA6A 1HA6A 2JSOA 3NE5B 2N55A 1FGBD 2D9UA 2F1MA 3J7AV 2JXMB 3D4WA 3D6WA 5M5YB 3MWYW 2BE5D 3PIP3 2SDFA 2B2YC 4RGOS 1G2TA 4HSVA 3URYA 2IJ0A 1Z6HA 1MGSA 3K58A 2F0GA 1BCPD 3FVQA 2VNUD 1STYA 4E6IA 4NMZA 4X3KA 1JORA 4GZYC 3HOXB 2KHSA 4ZRZA 3S15B 5TSSA 1ML0D 4IUPA 3P7JA 3BDCA 5D65A 2QDBA 3S1QB 2LS01 3O13A 5HURA 1B3AA 1TWFB 2JA8B 2F0DA 2B8GA 1LT4D 2B39A 3I70A 1D5ZC 4DA2A 4LJZC 1BQQT 3KF8A 1A3VA 4HR7B 4EVOA 1HTLD 5CV6A 4TSSA 1GXDC 4IUVA 1V8QA 2NVQB 1I4GA 4N9TA 2B2YA 3GQBA 4ZLTF 3GTOB 4XQNA 4J6HA 1HFNA 5J1ZA 2JE6I 1X32A 2FINB 3A8KE 2R93B 2MPMA 3CKIB 2K5QA 3K57A 4V190 1WCMB 4RGNA 5C3EB 4OIKA 1DCZA 4FXDA 4BY1B 1ICWA 2IX0A 3T53B 5C0XI 1IYUA 4C1NI 1LTBD 3OW7A 4ID6A 4RCNA 2B2TC 2K5WA 2L55A 5I6YA 1YNJD 1SYFA 2BDNA 3KUPA 1G291 5D3IB 3HOYB 1NUCA 1EY4A 2R92B 4FVMA 4ZYSA 1GUGA 1UAPA 1VCIA 4KJNA 5G3LD 2PZUA 4ABNA 1KDBA 1ZXTA 4QCLA 2B2VC 3HS0C 5IGBA 1CHPD 2K04A 1PTOD 2SEBD 1JICA 5C3XA 3I72A 2TMPA 1EWHA 2NN6G 2F0QA 2EYPA 4RHSA 3DEPA 1F2YA 4X3TA 1Q12A 4KK7A 1EOTA 1A2UA 3VR4A 1TS4A 1EQVA 1TY0A 1ZKOA 3NQIA 3TP5A 4H44C 2F0VA 1O7ZA 4OO1H 2B2TA 3NPPA 3QG1A 3U9SA 3RUZA 3C1FA 2WIIB 1I50B 2PCFB 1WTOA 1OXTA 1E2VA 1KDCA 4UAIA 2F3WA 1DM0B 5C4XB 1GHJA 2B63B 2SNMA 2BE5C 1QNKA 1NCVA 2K28A 3Q22A 4FF1A 2B2VA 1SBBB 1B1ZA 3I73A 5IOCA 2F0NA 1BCPC 4M1UB 2KUMA 1U4RA 1EQTA 3NUCA 1DXMA 2A73B 2FMCA 1FNVA 2PW7A 2RBMA 2MGSA 1BCPB 4LK1C 1NR4A 3TP7A 5D3DA 1SYDA 3SXHA 3CRLC 3HP3A 1JWMD 1TWHB 3VYUA 1LTSD 3TSSA 3VYSA 4DXGA 3J81L 1D1IA 1STBA 3AMUA 5LL6S 1A2TA 2VXWA 3FKIB 2VUMB 1K83B 1F2MA 2AUJD 3F2UA 2XNAC 1WD0A 1YNND 4CJ1B 2ZXRA 4DAVA 3BYTB 2NVTB 3SHLA 3BDLA 2ZT9C 3D8GA 1K8OA 1DJRD 3I91A 5M5WB 3LNNA 3D4RA 5A2QE 1SEBD 1IYVA 1JWSD 5IGFA 1JE4A 1YNJC 2NBFA 1JOOA 2Y0SB 4A3IB 4O1NA 4QF4A 1ZEQX 4DFAA 2FHTA 5M9OA 4A3KB 3A55A 2F0SA 3IAYA 1SMYD 1PTOC 1AW7A 3Q6SA 3ND9A 1HPCA 1I4PA 4L8JA 1HXYD 1I4HA 3DM1A 2HDMA 4HN7A 4IQZA 3MAQA 1F9QA 4R8NA 3Q24A 1FNWA 1JOQA 2EZVA 1PZKD 1TQOA 4C3IB 4RKBA 1B9NA 3I3CA 2F0UA 2VB2X 3VR3A 2LKVA 5E3FA 5A35A 3PO3B 4KN7C 1AZPA 3QIAA 1PXUA 4R9WA 2QEJC 2RSOA 4AYBB 1R4QB 5ELFA 4C56C 1PYWD 2PPBC 1OXVA 1S5ED 2B8FA 5CMDA 4DAYA 4A3FB 1JQYD 5K5PA 5C3WA 1PFMA 2XWJB 2K5DA 4C3HG 5KYLA 3OIQA 1SE3A 1H9MA 1D2BA 3TDQA 1I6VC 3R3OA 2DY8A 2C9OA 1SYGA 1EY7A 4WORA 4KY6A 2BA1A 2PZTA 4JK1C 5K36H 1HA5A 2G9DA 2GA4B 3I4MB 3GD7A 1PZID 4FO2A 4KV6A 4F7XA 1STNA 1Q90A 3JAML 2WB1B 3DUZA 3C46A 2IL8A 3PMFA 3WDNA 2H1EA 1SYBA 2JP1A 3LWEA 1SYCA 1WD1A 2R3ZA 3S9WA 3QJYA 4O42A 2WV6D 2F0HA 1OXSC 3A7LA 3IKJA 3I4NB 5C4ZA 2AQ3B 5E4XA 2EJGC 3H91A 5CV7A 2WKDA 2BA0A 3SDZA 1Z47A 2NUCA 1YNNC 4A3BB 2F4IA 4BY7B 4CKCA 5CBEE 4H13C 4PMCA 1EEID 2B2WC 4Q0FA 3C3LA 1QCBD 4B9XA 1F2LA 3K6OA 1PMRA 1S5CD 4FP5D 1FR3A 1TT2A 2O4XA 1LT3D 4OO1G 3OMGA 5JVH3 4RCOA 3OPOA 3V96A 4F87A 4K5WA 2F0LA 5T1GA 3MVVA 3H6MA 1MSHA 1F9RA 1A3UA 1SMYC 2F0PA 3CU7A 1M4VA 2KCNA 3V05A 2B2UC 1I3QB 3NHHA 1EY6A 3RMHA 5FK9C 1OXUA 1PRTD 3HOZB 2B2WA 2KECA 1RCVD 3GTGB 1SNPA 4QIWB 4NW2A 1O7LA 2A5HA 2CW0D 2PMZB 4CKBA 5JEAH 2K03A 2ZXOA 5CC4A 1LTTD 4IN3A 4S3SA 5CORA 1V43A 4CJ0B 1D6EC 3GTLB 2XVSA 3OHXC 1GUNA 1SE4A 2RKSA 2AUKA 1IW7D 4EQPA 5EPKA 5CBAE 3J81E 4ZAIA 1PFNA 3TZUA 2A69D 5EKIA 4OGQC 1DOMA 4XXEA 4ZKCB 2ID0A 2B2UA 4FF3A 1TR5A 2AQ1B 2SNSA 1XTCD 1OXXK 1SNMA 2Q8TA 3M7GA 4MIUA 3QO2A 1I4QA 1WTVA 1TWAB 3GTPB 4BBSB 3L3OC 1MSGA 2VB3X 1GUSA 1GUOA 3WOEA 1MD2D 3X3NA 4DN4M 4HMJA 4CBVA 1ILQA 3I8ZA 1B53A 1KLGD 4G7OC 3TZDA 1C8CA 3E0JA 3P1HA 1BCPF 4K14A 2RDGA 4HCSA 3VA7A 4PV1C 2IT1A 3QB3A 2L4NA 3HOWB 2EY1A 3M4YA 4QUFA 2O5IC 4FXGC 1VF7A 1U9RA 4K6LA 1SJHD 1A3TA 1SE2A 1CI3M 5ELBA 1GHKA 3N6RA 1RODA 5C4JB 4KY5A 2F0KA 2WINB 2A74C 3SK8A 1U4LA 4DK0A 1AFPA 1JR0D 2F0EA 2Z4IA 3PV0A 1C48A 4WRDA 5CYUA 4JBWA 3QOLA 2KEEA 5JJZA 1B4OA 2K33A 4I7ZC 3K5MA 3N52A 5C5LA 4DGZA 1QE6A 4KKSA 1LV9A 5JAVA 2EYOA 4X3SA 1K8MA 3K59A 1PLFA 2CHBD 4OO1I 1RDPD 5EPJA 5EQ0A 1EFID 1Y8PB 1BUVT 1Y8OB 1R9TB 4ODGA 2JEAI 1QWYA 5I6WA 2EDGA 2F3VA 1VMPA 1NAPA 4CHTB 1PRTC 2WKCA 2JYOA 2L9HA 5JPMC 4OIJA 1LABA 1HUNA 1B9MA 2A68D 5K36G 5IODA 3BDOA 3JAME 2CW0C 1BBXC 1RF2D 3GP7A 1PRTB 1STGA 1E0BA 1AP0A 5IGCA 3K5LA 4TRDA 4U68A 5G3LF 2M00A 2CQAA 1SJED 1WTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RCN A;  4BA1 I;  3M4Y A;  3MXU A;  2A6H C;  2BE5 D;  2PNR C;  5BN5 A;  3VR2 A;  2O5I C;  1VF7 A;  3D31 A;  2O5J C;  1IW7 C;  1O7L A;  1TU2 B;  4DNR B;  1G29 1;  3QJY A;  1H9K A;  3M7N A;  3LWU A;  3ND9 A;  1HPC A;  1Q1B A;  4LK1 C;  3T56 B;  4L8J A;  1VDZ A;  3VR5 A;  4XTC S;  1Z6H A;  1CI3 M;  5JEA G;  5JEA H;  2A69 C;  2NN6 I;  3VR6 A;  1GUT A;  2QF7 A;  4DK1 A;  4IQZ A;  1GUG A;  3IKJ A;  1OXS C;  1ONL A;  3A7L A;  3HGB A;  1GHK A;  1VCI A;  1QJO A;  2JEB I;  3A8I E;  3N6R A;  2DN8 A;  1V43 A;  1CTM A;  2EJG C;  3DXJ C;  3CRL C;  4GZY C;  2E76 C;  2AWO A;  2DNC A;  2A6H D;  4DK0 A;  1GUN A;  1B9N A;  1O78 A;  2EJM A;  2BA0 A;  3IFT A;  2AUK A;  1IW7 D;  1DXM A;  3PV0 A;  1ZYR C;  3SDZ A;  1YNN C;  2EVB A;  2E74 C;  2A6E C;  3VR3 A;  1A6X A;  3MFY A;  1Y69 U;  5BN3 A;  5A35 A;  4H13 C;  3I72 A;  1H9J A;  3TZU A;  2A69 D;  4JBW A;  1H9S A;  4KN7 C;  2LMC B;  1EWH A;  4OGQ C;  1LAC A;  4KN4 C;  2NN6 G;  3QIA A;  2NN6 H;  1VF5 C;  1TKW B;  1Y8N B;  2B8G A;  2BDO A;  2K33 A;  2E75 C;  4I7Z C;  1H9R A;  3SE0 A;  1T5E A;  2KCC A;  1Z7T A;  5BN4 A;  1Q12 A;  4KKS A;  4H0L C;  1E2Z A;  3KLR A;  4LJZ C;  3VR4 A;  5KNB A;  3FPP A;  2Q8I B;  1K8M A;  2PPB C;  1OXV A;  4KKU A;  2AUJ D;  4HR7 B;  2B8F A;  1OXX K;  1PMR A;  1ZKO A;  2A68 C;  2K7V A;  4H44 C;  1FR3 A;  2A6E D;  2V4D A;  4OO1 G;  2K32 A;  4OO1 H;  1GJX A;  1Q1E A;  4BA2 I;  2EJF C;  1Y8P B;  3QG1 A;  1HTP A;  1Y8O B;  4TKO B;  3U9S A;  3AB9 A;  4XIG S;  3L7Z C;  1V8Q A;  2JEA I;  3A7A B;  2EDG A;  4G7Z C;  1GUS A;  3EQL C;  3PUW A;  5KNC A;  1GUO A;  2PCF B;  2ZT9 C;  2D5D A;  3OPO A;  1H9M A;  5KND A;  3H94 A;  4KKT A;  3GQB A;  3T51 B;  1K8O A;  1E2W A;  1OXT A;  2YYZ A;  1E2V A;  2DNE A;  4KMU C;  3PUZ A;  2D62 A;  1I6V C;  4G7H C;  2JE6 I;  1GHJ A;  1LAB A;  3FMC A;  2D2C C;  3A8K E;  3D4R A;  3LNN A;  1FYC A;  2BA1 A;  3OOC A;  1IYV A;  1DD2 A;  4JK1 C;  2BE5 C;  2KA7 A;  2R6G A;  1B9M A;  2A68 D;  4KI0 A;  3BG3 A;  3W3A A;  4TQU S;  1SMY C;  5K36 G;  5K36 H;  4DNT B;  3P20 A;  3BDO A;  3PUY A;  1YNJ C;  3PUV A;  4IFD G;  4IFD H;  4G7O C;  3A8J E;  3GD7 A;  2CW0 C;  1DCZ A;  1BDO A;  1HCZ A;  1Q90 A;  3ND8 A;  3I73 A;  3NE5 B;  3CRK C;  3T53 B;  3VA7 A;  4PV1 C;  1IYU A;  2IT1 A;  2L5T A;  5C0X G;  5C0X H;  3M85 A;  1OXU A;  4KHZ A;  3RLF A;  3OW7 A;  3PUX A;  1HQM C;  2F1M A;  2JXM B;  3I4L A;  1CFM A;  3WDN A;  1H9S B; 
#chains in the Genus database with same CATH topology
 2R7Z B;  3EA6 A;  4JBJ A;  1XNR Q;  1PTO F;  3UDI A;  1Q81 C;  1PH1 A;  2O5J C;  5FLX L;  1IW7 C;  4DNR B;  2NZ1 D;  1A15 A;  1H9K A;  2EYM A;  3M7N A;  3GTK H;  2QW7 A;  1X3E A;  1LM0 A;  1PV4 A;  2EYH A;  2A69 C;  3VR6 A;  5FOB B;  5HY6 A;  3CCV A;  4ZCK A;  1RTO A;  2YV5 A;  3HGB A;  1Q3L A;  4DV2 L;  3MXG A;  1VQN A;  4DV3 Q;  1D5X C;  4ZUJ A;  3U9O A;  1RHP A;  4LF9 L;  4OWW B;  2A6H D;  3M4Q A;  2K5N A;  5C0X J;  5EBD A;  1O78 A;  2EJM A;  3IFT A;  5IT9 L;  3KF6 B;  1PDQ A;  4AQY L;  1PH9 A;  4LAA A;  4R8I A;  5EBC A;  2I07 B;  4K2L A;  1EIG A;  4JI5 Q;  5BN3 A;  1CHQ D;  5C4X G;  1TS2 A;  4JVZ A;  2K01 A;  4HED A;  4KHP L;  3I7F A;  4PZ8 A;  2JA5 B;  2KJX A;  3KLR A;  5KNB A;  3MC0 B;  3GTM H;  1ZYR D;  1CZG A;  2EPB A;  4QUC A;  2V4D A;  1C0A A;  1KRT A;  3G6J B;  1MJC A;  2R7D A;  3HOZ H;  1EIH A;  2OT2 A;  4Y7N H;  4XIG S;  4DV0 Q;  4KTA A;  3UDX A;  2QCP X;  5ISR A;  3PUW A;  3KOJ A;  3GTG H;  2JK8 A;  2E2I B;  1HZB A;  3F2B A;  5E4W C;  4X66 Q;  1C9O A;  3KF6 A;  5H1S E;  4R1J A;  4JC0 A;  2IW3 A;  1XMQ Q;  3J80 c;  5COY A;  1DD2 A;  4O2D A;  2KA7 A;  5CGK A;  3BG3 A;  3W3A A;  1X55 A;  1XJV A;  3DWA A;  4OEM B;  4IFD H;  1B3Q A;  2K6A A;  1LUZ A;  1S5D D;  3ND8 A;  4A3L G;  1UEA B;  3GTL H;  1YZ6 A;  3CCQ A;  5M5Y H;  2JA6 B;  4HSP A;  4OL7 A;  2VW9 A;  4GKJ L;  3MTS A;  1NR2 A;  1KXL A;  2A1A A;  2N8N A;  1J6Q A;  4Z9C B;  1J8I A;  3NEL A;  1JC7 A;  1CSQ A;  5I2X A;  2F0M A;  4YIJ A;  2CCZ A;  4DKA C;  1S5B D;  4G4K A;  2PNR C;  4RGT A;  4APV A;  5DLQ E;  4ZK9 B;  5BN5 A;  3KBX A;  2ZXP A;  1FGU A;  4YWM A;  4DNI A;  1I6H B;  1SFO B;  2FFK B;  3RD4 A;  2YTX A;  4DV2 Q;  3LWU A;  1C7Y A;  1JB3 A;  2EE1 A;  1EEF D;  3ULL A;  4FF2 A;  4LF9 Q;  5JEA G;  3S2H B;  4M8A A;  1B44 D;  2DGY A;  4DK1 A;  1MBY A;  3HOX H;  3FKI G;  3MZ5 A;  3K7U C;  2VUM G;  3S15 H;  3ONA B;  5IYD G;  3CHB D;  4BBR B;  2MUY A;  4AQY Q;  1FL0 A;  1EQQ A;  3GTP H;  3K5N A;  4EQO A;  3PIP A;  3RZO B;  5JVG 3;  3S1Q H;  2KHJ A;  3FRP B;  2Z0S A;  1T9H A;  4EX5 A;  4NKL A;  2JA8 H;  3MFY A;  1HFG A;  3E5S A;  1B70 B;  3NTK A;  1H9J A;  4JI1 L;  2O2L D;  4IUT A;  3SK5 A;  2LY7 A;  2ZJR A;  2RHS B;  4KN4 C;  4CDF C;  5DM6 3;  1BBW A;  4L6T B;  2SOB A;  1YHQ A;  2Z1C A;  1T5E A;  1LO5 D;  5M5X B;  1PTO B;  1VQA A;  1O80 A;  4JBM A;  2OQK A;  2Z4H A;  5DM7 3;  2A68 C;  4A3I G;  3HOU B;  1DON A;  4A3D B;  2NVQ H;  3GTO H;  4A3K G;  1I4R A;  3E9I A;  3HOW H;  3STB C;  2R93 H;  4KKT A;  2BOS A;  2K5H A;  2E5L Q;  3NP8 A;  1EYG A;  4IPG A;  4IUQ A;  5C3E H;  3FMC A;  4H02 A;  2RVL A;  3KLS A;  4TVA B;  4BY1 H;  2F0J A;  5FO8 B;  4GKJ Q;  5ELC A;  1LTA D;  2VL6 A;  1E24 A;  5EKK A;  3A8J E;  3NEM A;  2R61 A;  1EU3 A;  1PH5 A;  1SRO A;  4K8J A;  5I2Y A;  2GVB A;  4C3I G;  3RR5 A;  1KC8 C;  1PHJ A;  4IPH A;  1FD7 D;  5I9P A;  1F9P A;  2OF1 A;  1XMO L;  1F77 A;  3QOJ A;  3R8B A;  3HOY H;  1H95 A;  4MNO A;  1SR3 A;  3T4A C;  3VYR A;  2A6H C;  4ALP A;  3VR2 A;  1XPU A;  3PO3 G;  3CW2 C;  4POG A;  5C4H A;  5KYI A;  4OEL B;  2R92 H;  3OWE B;  3G48 A;  3NWS A;  4R4Q A;  2C5C A;  1VMC A;  1J9O A;  2I5H A;  5KIX A;  4PMW A;  4X64 L;  1PZJ D;  3GV3 A;  3ITP A;  3S1R B;  1GUT A;  2CH4 A;  1FNU A;  1R4P B;  4A3F G;  4CKE A;  3DXJ C;  2ZTE A;  5GAD C;  1IYJ B;  1EU4 A;  2LXJ A;  4LUV A;  2ZTC A;  4JI1 Q;  1IBM L;  4R4O A;  3CQZ B;  3HKZ B;  1ZYR C;  1WVL A;  1I94 L;  4JYA L;  1A6X A;  2PZW A;  3B6Y A;  2G9H D;  4H7B A;  4EQN A;  1WI5 A;  4BS9 A;  3SVM A;  2LMC B;  3F2D A;  3AU7 A;  1TKW B;  1AEX A;  3P75 A;  5M3F B;  4NP5 A;  1I5F A;  3Q23 A;  3I4M G;  4KKU A;  5I4D A;  2RA4 A;  2K7V A;  2WB1 G;  4Q5V A;  3BVM A;  2A6E D;  4A3J B;  2K32 A;  1I50 H;  1WTP A;  1L0Y B;  1K0R A;  2IWH A;  1GKH A;  1QUQ A;  4XDX A;  5F2D A;  5C4X H;  4K0K L;  2B63 H;  5ELE A;  3SK6 A;  5IP7 H;  3M4P A;  5LL6 X;  1ESF A;  4B08 A;  2NYZ D;  4MTK A;  4DF7 A;  3OW2 A;  4A93 B;  4IZ8 A;  1FYC A;  1G2S A;  1BOS A;  1SDF A;  4POF A;  3NTI A;  3P20 A;  5EGT A;  4G57 A;  3BVG A;  5LMN L;  5CV9 A;  1XPR A;  4QQB X;  3CCE A;  3MXN A;  3TP8 A;  1G6Z A;  4GLV B;  1DYQ A;  4LUZ A;  3H0G B;  1KD1 C;  1M90 C;  3DHQ A;  4HJ7 A;  3I4L A;  4A3B G;  4BY7 G;  4X6A H;  1H9S B;  1I4X A;  1K9M C;  1BNZ A;  1Y1W B;  1EYC A;  4X64 Q;  5FLX E;  2OQ0 A;  3BZD B;  3MXU A;  1G91 A;  1OO9 B;  3ULJ A;  3E3X A;  4RA8 A;  4C3J B;  1HR0 L;  5FLM H;  2DY7 A;  2UUB L;  2MO1 A;  2FJ2 A;  3S14 B;  2Q8R E;  1Q1B A;  1EY5 A;  4JI2 L;  3NBI A;  4KJO A;  2XIW A;  3OMC A;  5FO7 B;  3KLS X;  4A3L H;  2QF7 A;  1KNE A;  1TII D;  5E1F A;  1IBL Q;  5T1I A;  1TY2 A;  1IBM Q;  4HTH A;  4A3C H;  1BXT A;  1I94 Q;  4JYA Q;  5M3M B;  3A0J A;  3G7L A;  4UHV A;  1TWC B;  2NTT A;  5IT9 E;  1MI2 A;  2HIX A;  1D5M C;  1Y1V B;  2VQE L;  1VQ5 A;  3RZD B;  5D14 A;  3M3Y B;  5GQO A;  2L0C A;  4ZUI A;  2YTY A;  2E2I H;  1LTI D;  1QG7 A;  2HUG A;  1CK1 A;  3DMU A;  1H9S A;  3K8A A;  1NMF A;  2CH4 W;  3Q0A A;  1LAC A;  2ICI A;  2LXK A;  3GO5 A;  1K83 H;  5BR8 L;  5IYD H;  3SE0 A;  2L11 A;  5IGE A;  1VQ6 A;  4XT3 B;  1SMX A;  3SK4 A;  2G5D A;  5JJK A;  3CD6 A;  3QR8 A;  1RTN A;  3E6Z X;  4X65 L;  3U4V A;  2JA9 A;  2NVT H;  4K0K Q;  1XXG A;  2NVY B;  1MHW C;  4DR1 L;  3J80 L;  2JA6 H;  1GD7 A;  2A19 A;  1AH9 A;  3HOZ G;  1E3P A;  5M5W H;  1WTQ A;  1MIU A;  1F9S A;  2RHQ B;  4P75 A;  2CVR A;  1PRT F;  5KNC A;  2XN9 C;  3NK9 A;  3L9A X;  1VQI A;  3W2D A;  3S1M B;  4KMU C;  1EWI A;  3TME A;  4HAE A;  5J39 A;  2UXC L;  1GVP A;  4G7H C;  3CPF A;  5LMN Q;  3MA2 B;  4DK3 C;  4A75 A;  4QY7 A;  2OWO A;  3OOC A;  4B3R L;  1ASY A;  4IFD G;  4I65 A;  2RF4 A;  2NWG A;  5JOB A;  4U67 3;  4YWK A;  2PI2 E;  5ELN A;  1BDO A;  3ERQ A;  1HCZ A;  1ET9 A;  3H3V C;  2Q2I A;  3RZO H;  3FEW X;  1YEZ A;  3TQY A;  3CC4 A;  3A56 A;  1HR0 Q;  2UUB Q;  1M8A A;  2NTS A;  2EY2 A;  4JI2 Q;  4BA1 I;  3MXP A;  3MFG A;  4CJ2 C;  1HNX L;  1STE A;  2F0I A;  1YNX A;  2EY6 A;  1DZ1 A;  3C1E A;  1EY8 A;  1TU2 B;  3H09 A;  4LUO A;  1EYD A;  3KBG A;  4XQJ A;  1KAA A;  2CQO A;  3F1Z A;  2MHV A;  1IL2 A;  1HRJ A;  5M5X H;  1PTO H;  3HOX G;  1Q8I A;  4MHE A;  1HNZ L;  2VQE Q;  3A8I E;  4RKL A;  1M1K C;  1SSO A;  2F0W A;  5ELO A;  1W6K A;  3HOU H;  2J0T D;  3PIO 3;  5JEA J;  3KFU A;  4BBS G;  2K4K A;  3ULP A;  3V2T A;  1JB7 A;  2HDL A;  2VS1 A;  1W6J A;  3PO3 H;  2K1B A;  1CSP A;  1UE6 A;  2JA8 G;  2A6E C;  2D0O A;  4FNF A;  5BR8 Q;  2UXB L;  1HUM A;  4LF8 L;  1VQC A;  2BH2 A;  3GDE A;  2GVA A;  3A54 A;  2K14 A;  5C6A A;  5DNF A;  4X65 Q;  4PMB A;  3NSW A;  4OHJ A;  2F0T A;  1B50 A;  2XWB B;  3G4S A;  4DR1 Q;  2I0Q A;  4A3F H;  1Z7T A;  2NVX B;  3C2P A;  2PYK A;  1KAB A;  3I90 A;  4MN3 A;  2Q8I B;  1HHV A;  1KLU D;  3D4D A;  1X3G A;  2HQE A;  2Z9H A;  2OTL A;  4IUR A;  2F0F A;  2CKZ B;  3AFP A;  1SAP A;  5E7N A;  4YCU A;  3TS2 A;  1Q46 A;  4TKO B;  4A3E B;  5NUC A;  3AB9 A;  2Q2U A;  2UXC Q;  1HQR D;  3J81 j;  3HOW G;  1V9P A;  1QB5 D;  5KND A;  4B3R Q;  3H94 A;  1XX8 A;  1V1O A;  1WJJ A;  1JMC A;  1BKB A;  3K7A B;  3CC7 A;  1S40 A;  2HCI A;  3PUZ A;  5HGT A;  3J80 i;  3J7A 5;  1WYD A;  2CWP A;  2D2C C;  1VQK A;  2PW5 A;  5C5M A;  1PH2 A;  1ENC A;  4BY1 G;  1X3F A;  3JAM c;  3OWF A;  3PUY A;  1DOK A;  2AWN A;  3ERO A;  4C1N K;  4IAL A;  1TVX A;  4RAU C;  1EZ8 A;  2L1B A;  1HNX Q;  5C0X H;  2EIF A;  3I56 A;  1CKM A;  4JG2 A;  4KHZ A;  5CR3 A;  5C44 B;  4F88 A;  3D6C A;  4ME5 A;  1DOL A;  1CFM A;  4JI8 L;  3VR5 A;  2HQL A;  3HOY G;  5IY0 A;  1AZQ A;  4DR3 Q;  4XT1 B;  1E1O A;  2R92 G;  1KDA A;  1HNZ Q;  3I4N H;  1L2F A;  3EVQ A;  3SEB A;  1VDZ A;  5LHY 1;  2KVM A;  4XTC S;  3GTJ B;  1LTR D;  4WJ4 A;  1VQ8 A;  4PQX A;  3IL8 A;  1YJW A;  2RSN A;  1ONL A;  4QMG A;  1F2Z A;  3CAM A;  2DN8 A;  4A3J H;  2M2L A;  1ENA A;  4A3B H;  3MEF A;  4BY7 H;  2UXB Q;  2E76 C;  3HEJ A;  4LF8 Q;  2DNC A;  1IKM A;  2EYL A;  1STH A;  1TXY A;  1PVO A;  3TBI B;  2OXP A;  1JCK B;  4DR5 L;  3RLO A;  4WFN 3;  4HJA A;  4UDU C;  1Y69 U;  4LF7 L;  5IGG A;  1S5F D;  4RHR A;  1B2T A;  5EPL A;  3S1N B;  3HG9 A;  1E22 A;  2RDH A;  4C2M B;  2BDO A;  1VQH A;  3K81 C;  2XSC A;  1N33 L;  1SE8 A;  2KCC A;  1G8Z D;  4LFC L;  3CCU A;  1CT1 D;  3IFD A;  1CZW A;  1ASZ A;  4JCV E;  1WTW A;  4GS3 A;  1A8V A;  3T13 A;  1JWU D;  3OIP A;  2KQ3 A;  5DAU A;  4PZ7 A;  1RD9 D;  3CCR A;  1JT8 A;  2R7Z G;  1RJT A;  4K5V A;  4FYD A;  1QNU A;  2B63 G;  5IP7 G;  2AQ2 B;  2YYZ A;  4LF4 L;  1D1K A;  4C3J H;  1PFS A;  1QIL A;  3PO2 B;  2N88 A;  1GUW A;  3R2I A;  2KEN A;  4RGM A;  2X69 A;  3TN2 A;  3HZX A;  1VQB A;  3QWN A;  1CM9 A;  1I3Q H;  3S16 B;  4DNT B;  4IFD I;  1TS5 A;  1NBW A;  1XWE A;  3BYY B;  2E2D C;  3KK7 A;  3G71 A;  4HIO A;  4JI8 Q;  4RG1 A;  1N9W A;  5M3M H;  3M4O B;  1TWC H;  4HJ5 A;  1SNO A;  1WTH A;  3M85 A;  1Y14 B;  3PUX A;  3TRE A;  2QEX A;  1Y1V H;  1AN8 A;  1TS3 A;  1SRU A;  5EKL A;  5GAH C;  1T5X D;  1QOH A;  1NMG A;  3GTQ B;  1EIF A;  1EY0 A;  4N9P A;  5IIF A;  2F0O A;  4A3G B;  3MEH A;  5FLM G;  3GV6 A;  4IUU A;  2F03 A;  4DPG A;  2E5L L;  2XRS D;  3RN5 A;  1Q7Y C;  3T56 B;  3F2C A;  3W1G A;  3K0Y A;  1YHB A;  3OTO L;  1Q82 C;  4A3C G;  1SXT A;  4L5Q A;  3BS1 A;  3HOV B;  2NVY H;  1X3Q A;  3A74 A;  2IPK D;  4DR5 Q;  1STA A;  1LTL A;  4LF7 Q;  1CA5 A;  1RKN A;  4KD4 A;  4B9W A;  2KBN A;  2EYJ A;  1N33 Q;  1P8L A;  3SR1 A;  1WTX A;  1PH8 A;  2XRQ D;  2HHH L;  4LFC Q;  1SNC A;  4YY3 L;  4DK6 C;  1UE7 A;  1VF5 C;  5JPN C;  4NDX A;  3EJI A;  4OXP A;  2RCF A;  5AFW A;  3G6E A;  1E2Z A;  1L0X B;  1PYS B;  1TWA H;  4UP8 A;  4BBS H;  3MHB A;  2Z8L A;  3J80 E;  3K5O A;  2EY5 A;  4LW1 A;  2JA6 G;  1VQ4 A;  1GJX A;  2L12 A;  4A3M B;  4AH6 A;  3J7A F;  1BO0 A;  1SND A;  4LF4 Q;  1HTP A;  1GOZ A;  1IZ6 A;  4NPS A;  1PFB A;  2N78 A;  5JJI A;  1EYA A;  4K2K A;  4QJF A;  2D5D A;  2PO4 A;  4YWL A;  2CWA A;  1KIX A;  2VY3 A;  1EUJ A;  3WOF A;  2NB0 A;  2MJ8 A;  3DWQ A;  1EL0 A;  3UE0 A;  2Y0S G;  2ICE C;  4UP7 A;  4KI0 A;  1CQF A;  4TQU S;  1BF4 A;  5DEH A;  1N34 L;  3PUV A;  3NXW A;  2PNH A;  4BBR G;  4LMQ D;  1S4Z A;  3D3R A;  1V1P B;  2PI2 A;  3ZJY C;  4LF5 L;  4KHV A;  5IP9 H;  2L5T A;  4IFD J;  1AE2 A;  1HQM C;  2E2J B;  4X3U A;  4FXK C;  5FKA C;  4FF4 A;  1UE1 A;  1KTK A;  4C3H B;  2N3S A;  3NQT A;  1SNQ A;  1ESR A;  2HCC A;  4QB4 A;  3OTO Q;  2BH8 A;  2YU9 B;  4CDE C;  4V0B A;  2MP1 A;  3HFZ B;  4WJ3 M;  4KD3 A;  1A62 A;  1BR9 A;  4ULL A;  5C4J H;  2EYF A;  2NN6 I;  3R93 A;  4Y52 H;  4XYO A;  1E7Z A;  1QJO A;  2KCT A;  4OX9 L;  1X3P A;  3HOU G;  2KCM A;  4A3D G;  1LLR D;  4L63 B;  4FDB A;  3X3M A;  4A3E H;  3S2D B;  2HHH Q;  4YY3 Q;  4DU9 A;  1V1P A;  2NZO A;  1XYI A;  4AYB G;  5CV4 A;  2E2H B;  2ENB A;  1RL2 A;  2KED A;  2NN6 H;  3BVZ A;  1Y8N B;  1ENF A;  3FDT A;  2WAC A;  5BN4 A;  4OWX B;  1QUQ B;  4H0L C;  3VA5 A;  4KY7 A;  4J1M A;  2RQX A;  3T16 A;  3J7Y W;  3FPP A;  1R9T H;  3NBH A;  1IBL L;  4XQQ A;  2OCE A;  4BWG B;  2WAQ B;  2EOT A;  2JA7 B;  4GN4 B;  1Q1E A;  4DAP A;  4BA2 I;  2EJF C;  1LT5 D;  2J7Z A;  4P2C B;  3HRZ C;  3L7Z C;  4GN5 A;  1U4P A;  3NWT A;  3EQL C;  1EZ6 A;  4JW0 A;  4R4I A;  5EJW A;  3T51 B;  1N34 Q;  4K8I A;  3DWP A;  2D62 A;  2IX1 A;  1HZ9 A;  1C4Q A;  3U4Z A;  3MXN B;  3TP6 A;  4JI0 L;  1XNQ L;  1ILP A;  4LF5 Q;  2PQE A;  4J8Q A;  5FO9 B;  4R4C A;  1LT6 D;  3I2Z A;  3EBE A;  3S17 B;  3CRK C;  2H4O A;  3DEO A;  4YCV A;  2R7Z H;  5C0X G;  5FJ8 G;  3EFX D;  3RLF A;  3KJP A;  4XYQ A;  3HKZ G;  2RDF A;  1BBU A;  1TWG B;  1IKL A;  1KHI A;  5IYC H;  5KRU A;  3D31 A;  5KGU A;  5IGD A;  1ET6 A;  2KOL A;  3I4N G;  3UI2 A;  4OX9 Q;  4IUN A;  1SYE A;  2QIL A;  1FJG L;  3ZYY X;  1O7Y A;  1JOK A;  3AEV A;  2OEO A;  3GTK B;  3OSO A;  2JEB I;  4RWS C;  3LX0 A;  2EXZ A;  5ELD A;  4GNX C;  1CTM A;  4A3J G;  5IT9 c;  4CGY B;  1VS0 A;  4ILW A;  4GOP C;  2AWO A;  2I46 A;  4JI7 L;  4ZQ3 A;  4IO9 A;  4B3M L;  3U58 A;  2EVB A;  2E74 C;  2ZJQ A;  4MTN A;  2BCO A;  2K05 A;  3TRZ A;  3VYT A;  2H5X A;  3R2T A;  4DXF A;  2JA5 H;  1IHZ A;  4A93 G;  4GNX B;  1U4M A;  4GOP B;  2A8V A;  4HMI A;  5CV8 A;  4EGV A;  2E75 C;  4K5X A;  4JOI C;  1H9R A;  3S16 H;  2QKI C;  1GO3 E;  5L37 A;  2J4X A;  4PNY A;  1K3B C;  1UUP A;  1IL8 A;  5J22 A;  4K6D A;  5KEE A;  2MFI A;  1K8A C;  2TSS A;  3J81 c;  2MO0 A;  2FMM A;  5I9O A;  1A63 A;  4RFB A;  4ZKB B;  2Q2T A;  4F8M A;  4WJW A;  5CV5 A;  3GTM B;  4HCE A;  2WP8 J;  1Q86 C;  3A7A B;  1UWV A;  4G7Z C;  1Y1W G;  3GTQ H;  3FPU B;  1XNQ Q;  4JI0 Q;  1EWC A;  4RH6 A;  2IX3 A;  1EY9 A;  1VQM A;  3UDF A;  1E2W A;  4A3G H;  2I5L X;  2DNE A;  4LWC A;  4Y7N B;  4C3J G;  2LFN A;  1II3 A;  1LTG D;  1UNS A;  1KNA A;  3NTH A;  1YJN A;  2X6L A;  1JJ2 A;  2DJF C;  2X6G A;  2M9V A;  3JAM i;  2R6G A;  5A2Q L;  1UEB A;  4GNX A;  1CQV A;  1NSN S;  1CA6 A;  4GOP A;  3S24 A;  1HA6 A;  2JSO A;  3HOV H;  3NE5 B;  2N55 A;  5M3M G;  1FGB D;  1PH7 A;  2K50 A;  2D9U A;  3CCL A;  1Y1V G;  2F1M A;  4GN3 B;  3J7A V;  2D0P A;  2JXM B;  3D4W A;  3D6W A;  4CDC C;  1I6H H;  1SFO H;  5M5Y B;  3MWY W;  2BE5 D;  1FJG Q;  4JOI A;  3ICE A;  3S2H H;  3PIP 3;  4NXM L;  2SDF A;  3CME A;  2Z6B A;  4P74 A;  2B2Y C;  4RGO S;  1G2T A;  2B29 A;  3KF8 B;  1PYB A;  4BBR H;  4EQ5 A;  4HSV A;  3URY A;  2IJ0 A;  4HIK A;  1Z6H A;  1MGS A;  3K58 A;  1J5E Q;  2F0G A;  1BCP D;  4JI7 Q;  1K73 C;  3FVQ A;  4HIM A;  2VNU D;  1STY A;  4B3M Q;  1B7Y B;  2QA4 A;  4E6I A;  1IXR A;  4NMZ A;  4X3K A;  1JOR A;  2Y0S E;  4A3M H;  4GZY C;  3HOX B;  2KHS A;  4ZRZ A;  3S15 B;  5TSS A;  3CP0 A;  1ML0 D;  4IUP A;  4B3T L;  3P7J A;  3BDC A;  5D65 A;  2QDB A;  3S1Q B;  2LS0 1;  3O13 A;  5HUR A;  4IOC A;  3H15 A;  3AQQ A;  1PA6 A;  1B3A A;  1TWF B;  4QGU A;  2ALY B;  4DR3 L;  2JA8 B;  4BXX H;  2F0D A;  3D0F A;  2B8G A;  1LT4 D;  3JC6 6;  2B39 A;  3I70 A;  4IOA A;  4A3D H;  1D5Z C;  4QL5 A;  4DA2 A;  5IWA L;  4LJZ C;  1BQQ T;  4JI3 L;  2YTV A;  3KF8 A;  1A3V A;  1A0I A;  4HR7 B;  4LF6 Q;  4EVO A;  4DV6 L;  3KYH C;  1HTL D;  2IHF A;  5CV6 A;  4TSS A;  1GXD C;  4IUV A;  1V8Q A;  2NVQ B;  1I4G A;  4N9T A;  2B2Y A;  3GQB A;  4ZLT F;  3GTO B;  2YU9 H;  4XQN A;  1KRS A;  2K75 A;  4J6H A;  1HFN A;  4IPD A;  5J1Z A;  2JE6 I;  1X32 A;  2FIN B;  2OTJ A;  3A8K E;  2R93 B;  2MPM A;  3CKI B;  1MJE A;  2K5Q A;  4DR6 L;  3K57 A;  4V19 0;  1HH2 P;  1WCM B;  4RGN A;  5C3E B;  2NZH A;  3PF4 A;  4OIK A;  4AYB E;  4DV4 L;  1DCZ A;  4FXD A;  4BY1 B;  1ICW A;  2IX0 A;  3T53 B;  3CXC A;  5C0X I;  1CKN B;  5IP9 G;  1IYU A;  4C1N I;  4A4I A;  1LTB D;  3OW7 A;  4DV1 Q;  4ID6 A;  2XTI A;  4NXM Q;  1HNW L;  4RCN A;  2B2T C;  2K5W A;  4P71 A;  2L55 A;  5I6Y A;  3S1R H;  1YNJ D;  1SYF A;  2BDN A;  3KUP A;  1G29 1;  5D3I B;  5LMN W;  3HOY B;  1K28 A;  4DV5 L;  1NUC A;  1EY4 A;  2R92 B;  2F4V L;  4FVM A;  2ATW A;  4ZYS A;  1GUG A;  1UAP A;  2IHE A;  4B3T Q;  1NTG A;  1VCI A;  1JE5 A;  5FJ8 H;  1N36 L;  4KJN A;  1PH4 A;  2MQH A;  3CQZ H;  2PZU A;  5G3L D;  4ABN A;  4A3E G;  1KDB A;  1ZXT A;  1QVG A;  2B2V C;  3HS0 C;  5IGB A;  4QCL A;  2F52 A;  2WB1 E;  1CHP D;  2N49 A;  2K04 A;  1PTO D;  3HKS A;  1HR0 W;  2SEB D;  1CKN A;  3TEH B;  1JIC A;  3OYY A;  5C3X A;  5M3F H;  1N8R C;  3I72 A;  4P72 A;  2TMP A;  5IWA Q;  4JI3 Q;  1EWH A;  2E8G A;  2NN6 G;  2F0Q A;  3VDY A;  4HJ8 A;  2EYP A;  4RHS A;  3DEP A;  1F2Y A;  1XPO A;  1PH3 A;  4DV6 Q;  4X3T A;  1KL9 A;  1Q12 A;  4KK7 A;  1EOT A;  1A2U A;  3VR4 A;  1CKO A;  4I7A A;  1TS4 A;  1EQV A;  4R4T A;  1TY0 A;  1ZKO A;  3NQI A;  1EOV A;  3TP5 A;  4H44 C;  2F0V A;  1L1O C;  1O7Z A;  4OO1 H;  2B2T A;  3NPP A;  5C44 G;  3QG1 A;  1V1Q A;  3U9S A;  3RUZ A;  3C1F A;  2WII B;  1I50 B;  2PCF B;  4A93 H;  1WTO A;  1OXT A;  4DR6 Q;  1E2V A;  4KLK A;  4DAM A;  1KDC A;  4UAI A;  2F3W A;  1DM0 B;  1BVS A;  5C4X B;  1L1O B;  1GHJ A;  4DV4 Q;  2B63 B;  1VQP A;  4JI4 L;  2SNM A;  2BE5 C;  1QNK A;  1NCV A;  1YBY A;  2K28 A;  3KJO A;  3Q22 A;  4YHH L;  4FF1 A;  4RMF A;  1RIP A;  2B2V A;  1SBB B;  1B1Z A;  1JJC B;  3H0G H;  1HNW Q;  3I73 A;  5IOC A;  2F0N A;  1BCP C;  1Y1W H;  4PG3 A;  4M1U B;  2KUM A;  1U4R A;  1EQT A;  3NUC A;  4DR2 L;  1DXM A;  3S14 H;  2A73 B;  2FMC A;  1FNV A;  4DV5 Q;  2HIV A;  1YIJ A;  5IYC G;  2PW7 A;  4B3S L;  2F4V Q;  2RBM A;  3FP9 A;  4DR7 Q;  2MGS A;  1BCP B;  4LK1 C;  1N36 Q;  1Q8K A;  1NR4 A;  5IYB H;  3TP7 A;  1L1O A;  5IE8 A;  5D3D A;  1Z9F A;  4JI6 L;  1SYD A;  3RZD H;  2HT1 A;  3SXH A;  3M3Y H;  1YHA A;  3CRL C;  3HP3 A;  5HGQ A;  1YVC A;  1JWM D;  1TWH B;  1VQ9 A;  3VYU A;  5GRO A;  1QVF A;  1LTS D;  3TSS A;  3VYS A;  4DXG A;  3EIV A;  3J81 L;  3PO2 G;  2JA5 G;  1VQ7 A;  1D1I A;  4QIW E;  4L5R C;  1KQS A;  3ER0 A;  2PMZ E;  1STB A;  3AMU A;  2XGT A;  1S72 A;  5LL6 S;  1A2T A;  2VXW A;  3FKI B;  2VUM B;  1K83 B;  1F2M A;  2AUJ D;  3F2U A;  3NEN A;  2XNA C;  1WD0 A;  1YNN D;  4UP9 A;  1S3O A;  1NNX A;  2L15 A;  4CJ1 B;  3S1M H;  2ZXR A;  4DAV A;  3BYT B;  2NVT B;  2JQO A;  3SHL A;  3BDL A;  2ZT9 C;  4JI4 Q;  3D8G A;  1K8O A;  1DJR D;  4A3G G;  3I91 A;  3H3V I;  5M5W B;  3DM3 A;  4YHH Q;  5JJL A;  1NE3 A;  3LNN A;  3D4R A;  5A2Q E;  1SEB D;  1IYV A;  1JWS D;  2I5M X;  1JE4 A;  5IGF A;  3CCM A;  1YNJ C;  1D7Q A;  2NBF A;  4UY8 C;  1JOO A;  1X6O A;  2Y0S B;  3HOV G;  4DR2 Q;  5AJ3 L;  5LMU L;  4GLA C;  2JN4 A;  1X54 A;  4A3I B;  4JPB W;  3KDF B;  4O1N A;  4B3S Q;  2Z6K C;  4QF4 A;  1ZEQ X;  4DFA A;  2FHT A;  5M9O A;  4JV5 L;  2IY5 B;  1P16 A;  2VZA A;  4A3K B;  3H3V H;  3A55 A;  2F0S A;  3IAY A;  1E1T A;  4UPA A;  1SMY D;  1PTO C;  1AW7 A;  1TWF H;  2ZTD A;  5GAG C;  2ASB A;  4KHP Q;  3Q6S A;  3ND9 A;  1HPC A;  1I4P A;  4L8J A;  1HJP A;  4JI6 Q;  2UXD L;  1HXY D;  4DAY B;  2HD3 A;  1LYL A;  1I4H A;  3DM1 A;  2HDM A;  3T1Y L;  4HN7 A;  4HID A;  4IQZ A;  3MAQ A;  1F9Q A;  3WWV A;  4R8N A;  3Q8D A;  2DUD A;  1U5K A;  3Q24 A;  4A3M G;  1FNW A;  4DR4 L;  1JOQ A;  2EZV A;  1PZK D;  1TQO A;  4C3I B;  3UE1 A;  2K5V A;  4RKB A;  3I4O A;  1B9N A;  3I3C A;  2F0U A;  2VB2 X;  1ICF B;  3VR3 A;  3KDF A;  1SN8 A;  1G51 A;  2LKV A;  3A5Z B;  4ME3 A;  3L2P A;  5E3F A;  5A35 A;  3NBH B;  3PO3 B;  2NVX H;  4KN7 C;  4BXX G;  1AZP A;  1KAW A;  2AMC B;  2B3G A;  1CUK A;  3QIA A;  1PXU A;  3PIO A;  4R9W A;  2QEJ C;  1WCM H;  2RSO A;  4AYB B;  1QZH A;  1R4Q B;  5ELF A;  4C56 C;  1PYW D;  2AKW B;  2Z6K A;  2PPB C;  1OXV A;  1S5E D;  2B8F A;  5CMD A;  4DAY A;  3J81 i;  4GLX A;  4A3F B;  1JQY D;  1X65 A;  5K5P A;  5C3W A;  1PFM A;  2XWJ B;  2K5D A;  3K7A H;  4C3H G;  5KYL A;  1VQL A;  3OIQ A;  1GM5 A;  2QDL A;  1SE3 A;  1H9M A;  1D2B A;  1UE5 A;  3TDQ A;  3AYH B;  1K0S A;  3CC2 A;  1I6V C;  3R3O A;  2DY8 A;  2C9O A;  1SYG A;  1EY7 A;  4WOR A;  4KY6 A;  2BA1 A;  2P5Z X;  2PZT A;  5AJ3 Q;  4JK1 C;  2KHI A;  5LMU Q;  4JBK A;  5K36 H;  1HA5 A;  2G9D A;  2GA4 B;  1WOC A;  3I4M B;  3GD7 A;  4JV5 Q;  1PZI D;  4LFA L;  4FO2 A;  4KV6 A;  4F7X A;  5C44 H;  3PSI A;  1STN A;  1Q90 A;  3JAM L;  2WB1 B;  3DUZ A;  3C46 A;  2IL8 A;  1XTD A;  3PMF A;  2CFM A;  3BZK A;  4HJ9 A;  3WDN A;  2UXD Q;  2H1E A;  1SYB A;  2F3I A;  2JP1 A;  3LGJ A;  3LWE A;  3T1Y Q;  3PF5 A;  1SYC A;  2Q2H A;  1WD1 A;  3GTJ H;  2R3Z A;  4P73 A;  3S9W A;  3QJY A;  4MZ9 A;  4O42 A;  4DR4 Q;  1NY4 A;  2WV6 D;  2F0H A;  1OXS C;  3A7L A;  3IKJ A;  3I4N B;  5C4Z A;  2AQ3 B;  2WAQ G;  5E4X A;  1VQD A;  2JA7 G;  2EJG C;  3BJU A;  3PQI A;  5FLX c;  4AIM A;  3H91 A;  1SLJ A;  5CV7 A;  2WKD A;  1QVC A;  2BA0 A;  3SDZ A;  1Z47 A;  2NUC A;  1YNN C;  4A3B B;  2F4I A;  4BY7 B;  4CKC A;  3S1N H;  5CBE E;  4C2M H;  2K52 A;  4NB3 A;  5M3F G;  4H13 C;  4PMC A;  1EEI D;  2B2W C;  4Q0F A;  3BU2 A;  1VQO A;  3A5U A;  3C3L A;  2GN5 A;  1QCB D;  4B9X A;  1YI2 A;  4IJL A;  1F2L A;  1OTC A;  1J5E L;  1K8G A;  1VQF A;  1PMR A;  1S5C D;  3K6O A;  4FP5 D;  1FR3 A;  1TT2 A;  2O4X A;  1LT3 D;  4OO1 G;  3I55 A;  1G6P A;  3ERS X;  1XMO Q;  2JJQ A;  2ZJP A;  3OMG A;  5JVH 3;  3PO2 H;  1FVI A;  4RCO A;  3OPO A;  3RNU A;  3V96 A;  4F87 A;  4K5W A;  2F0L A;  4IJH A;  3CF5 A;  5T1G A;  4LFA Q;  3MVV A;  3H6M A;  4DUY L;  1MSH A;  1F9R A;  1A3U A;  4PZ6 A;  1SMY C;  3M4O H;  2F0P A;  3CU7 A;  1M4V A;  2KCN A;  3H0G G;  3V05 A;  2B2U C;  1I3Q B;  3NHH A;  1N32 L;  1EY6 A;  3RMH A;  4LF6 L;  5FK9 C;  2ES2 A;  1TWH H;  1EIY B;  1OXU A;  2VQF L;  1PRT D;  4LFB L;  3M9B A;  3HOZ B;  4OON A;  2B2W A;  2QGQ A;  1QZG A;  1W2B A;  2KEC A;  2V1C C;  1RCV D;  3GTG B;  1SNP A;  1YIT A;  4GKK L;  4QIW B;  3UDG A;  1O7L A;  2A5H A;  4NW2 A;  2UUC L;  3AFQ A;  2CW0 D;  4NXN L;  2PMZ B;  5IYB G;  3T1H L;  4CKB A;  2WFW A;  2RCN A;  5JEA H;  2K03 A;  2ZXO A;  5CC4 A;  1LTT D;  3FKI H;  5J3B A;  2VUM H;  4IN3 A;  4S3S A;  5COR A;  1V43 A;  3FHW A;  3IRB A;  4CJ0 B;  1D6E C;  3GTL B;  2XVS A;  3OHX C;  1PH6 A;  1GUN A;  1SE4 A;  2RKS A;  1EQR A;  2AUK A;  1IW7 D;  4EQP A;  2ZM6 L;  4DV1 L;  5EPK A;  5CBA E;  3CPW A;  3J81 E;  4CDD C;  4ZAI A;  4DV7 L;  2UU9 L;  2R7F A;  3RLN A;  1PFN A;  1VQE A;  2A69 D;  3TZU A;  3W1B A;  3K0X A;  5EKI A;  4J15 A;  4L5T A;  1DOM A;  4OGQ C;  4XXE A;  4ZKC B;  2ID0 A;  2B2U A;  1YJ9 A;  4FF3 A;  1TR5 A;  1VQG A;  2AQ1 B;  4X62 L;  2SNS A;  1XTC D;  1O7I A;  1OXX K;  1SNM A;  2Q8T A;  4A3I H;  3M7G A;  4MIU A;  3QO2 A;  1I4Q A;  1WTV A;  2EQS A;  1TWA B;  3GTP B;  4LNQ A;  4BBS B;  3DLL A;  4A3K H;  3L3O C;  1MSG A;  2VB3 X;  1GUS A;  3K80 C;  1GUO A;  4DUY Q;  3WOE A;  1K3R A;  1MD2 D;  3X3N A;  1JJG A;  4N8F A;  1L0W A;  4DN4 M;  4HMJ A;  4CBV A;  3TS0 A;  1ILQ A;  2LSS A;  3J7Z C;  1N32 Q;  4A76 A;  2UUA L;  3I8Z A;  3F8T A;  1B53 A;  1KLG D;  4G7O C;  2VQF Q;  3TZD A;  1C8C A;  4LFB Q;  3E0J A;  3L0O A;  2E2J H;  3P1H A;  4L5S A;  3PCO B;  1BCP F;  4O0A A;  4K14 A;  2RDG A;  4HCS A;  3CCS A;  3VA7 A;  4C3H H;  4C3I H;  4PV1 C;  1IBK L;  1B8A A;  2IT1 A;  3QB3 A;  3W5O A;  4GKK Q;  1D8L A;  4DUZ L;  2UUC Q;  2L4N A;  1X56 A;  3HOW B;  4NXN Q;  3T1H Q;  2EY1 A;  3M4Y A;  4QUF A;  1VQJ A;  2O5I C;  1U0L A;  4FXG C;  1VF7 A;  3EN2 A;  1U9R A;  2PQA B;  4K6L A;  3BZC A;  1SJH D;  4N8X 1;  2FXQ A;  1MKH A;  1A3T A;  1XNR L;  1SE2 A;  1CI3 M;  2EXD A;  3S2D H;  5ELB A;  1GHK A;  3N6R A;  2ZM6 Q;  3PGZ A;  1ROD A;  5C4J B;  4KY5 A;  2F0K A;  2WIN B;  3KLW A;  2A74 C;  1DGS A;  4DV7 Q;  2UU9 Q;  3SK8 A;  1U4L A;  4DK0 A;  1AFP A;  1JR0 D;  2F0E A;  2Z4I A;  3PV0 A;  2E2H H;  2MNA A;  4DV3 L;  1C48 A;  3E9H A;  4WRD A;  5CYU A;  4JBW A;  4X62 Q;  3QOL A;  2R93 G;  1W3S A;  2KEE A;  5JJZ A;  1EFW A;  1B4O A;  4DR7 L;  2K33 A;  4I7Z C;  3K5M A;  5EAY A;  2PQA A;  1HZA A;  1WCM G;  3N52 A;  5C5L A;  4JI5 L;  5C3E G;  4DGZ A;  3RN2 A;  1QE6 A;  4KKS A;  2JA7 H;  3I4M H;  1LV9 A;  5JAV A;  2EYO A;  4X3S A;  1K8M A;  3K59 A;  3CMA A;  1PLF A;  2CHB D;  4OO1 I;  1RDP D;  5EPJ A;  5EQ0 A;  1EFI D;  1Y8P B;  1BUV T;  1Y8O B;  1R9T B;  4ODG A;  2JEA I;  1QWY A;  2EDG A;  2F3V A;  1VMP A;  5I6W A;  2WAQ E;  3HKZ E;  1NAP A;  4CHT B;  2C35 B;  1PRT C;  2WKC A;  1WFQ A;  4OWT B;  2JYO A;  2UUA Q;  2L9H A;  5JPM C;  4OIJ A;  4YCW A;  4DV0 L;  3U50 C;  1LAB A;  2DJG C;  1AE3 A;  1HUN A;  1HZC A;  3E0E A;  1B9M A;  2A68 D;  3S17 H;  5K36 G;  1IBK Q;  5IOD A;  3BDO A;  4X66 L;  3JAM E;  4DUZ Q;  2CW0 C;  1BBX C;  1XMQ L;  1RF2 D;  3GP7 A;  1PRT B;  3CCJ A;  5GAE C;  1STG A;  4IPC A;  1E0B A;  2AHO B;  1X9N A;  3STB D;  1TWG H;  5IGC A;  3K5L A;  1NJI C;  1AP0 A;  4TRD A;  4U68 A;  5G3L F;  2M00 A;  2CQA A;  1SJE D;  1WTR A;  3SGI A; 
#chains in the Genus database with same CATH homology
 2R7Z B;  3EA6 A;  1PTO F;  2O5J C;  5FLX L;  1IW7 C;  4DNR B;  2NZ1 D;  1A15 A;  1H9K A;  2EYM A;  3M7N A;  2EYH A;  2A69 C;  3VR6 A;  5FOB B;  1RTO A;  3HGB A;  1Q3L A;  3MXG A;  1D5X C;  4ZUJ A;  3U9O A;  1RHP A;  2A6H D;  5C0X J;  5EBD A;  1O78 A;  2EJM A;  3IFT A;  5IT9 L;  1PDQ A;  4LAA A;  4R8I A;  5EBC A;  2I07 B;  4K2L A;  1EIG A;  5BN3 A;  1CHQ D;  1TS2 A;  2K01 A;  4HED A;  2JA5 B;  2KJX A;  3KLR A;  5KNB A;  3MC0 B;  1ZYR D;  1CZG A;  2EPB A;  4QUC A;  2V4D A;  3G6J B;  1EIH A;  2OT2 A;  4XIG S;  4KTA A;  2QCP X;  5ISR A;  3PUW A;  2E2I B;  5E4W C;  2IW3 A;  5COY A;  1DD2 A;  2KA7 A;  5CGK A;  3BG3 A;  3W3A A;  3DWA A;  4IFD H;  2K6A A;  1S5D D;  3ND8 A;  1UEA B;  2JA6 B;  4HSP A;  4OL7 A;  3MTS A;  1NR2 A;  4Z9C B;  1J8I A;  1JC7 A;  5I2X A;  2F0M A;  4YIJ A;  1S5B D;  4G4K A;  2PNR C;  4RGT A;  5BN5 A;  4ZK9 B;  3KBX A;  2ZXP A;  1I6H B;  1SFO B;  2FFK B;  3RD4 A;  3LWU A;  1JB3 A;  2EE1 A;  1EEF D;  4FF2 A;  5JEA G;  3S2H B;  4M8A A;  1B44 D;  4DK1 A;  1MBY A;  3MZ5 A;  3ONA B;  3CHB D;  4BBR B;  2MUY A;  3K5N A;  4EQO A;  3RZO B;  5JVG 3;  3FRP B;  4NKL A;  3MFY A;  1HFG A;  3E5S A;  3NTK A;  1H9J A;  2O2L D;  4IUT A;  3SK5 A;  2LY7 A;  4KN4 C;  5DM6 3;  4L6T B;  2SOB A;  2Z1C A;  1T5E A;  1LO5 D;  5M5X B;  1PTO B;  1O80 A;  2Z4H A;  5DM7 3;  2A68 C;  3HOU B;  1DON A;  4A3D B;  1I4R A;  4KKT A;  2BOS A;  3NP8 A;  4IUQ A;  3FMC A;  2RVL A;  3KLS A;  2F0J A;  5FO8 B;  5ELC A;  1LTA D;  5EKK A;  3A8J E;  2R61 A;  1EU3 A;  4K8J A;  5I2Y A;  4C3I G;  1FD7 D;  5I9P A;  1F9P A;  2OF1 A;  1F77 A;  3QOJ A;  3R8B A;  3T4A C;  3VYR A;  2A6H C;  3VR2 A;  5C4H A;  5KYI A;  3OWE B;  3NWS A;  2C5C A;  1VMC A;  1J9O A;  5KIX A;  4PMW A;  1PZJ D;  3GV3 A;  3ITP A;  3S1R B;  1GUT A;  1FNU A;  1R4P B;  4CKE A;  3DXJ C;  1EU4 A;  3CQZ B;  3HKZ B;  1ZYR C;  1WVL A;  1A6X A;  2PZW A;  2G9H D;  4H7B A;  4EQN A;  4BS9 A;  3SVM A;  2LMC B;  3AU7 A;  1TKW B;  1AEX A;  3P75 A;  5M3F B;  4NP5 A;  3Q23 A;  4KKU A;  5I4D A;  2RA4 A;  2K7V A;  4Q5V A;  3BVM A;  2A6E D;  4A3J B;  2K32 A;  1WTP A;  1L0Y B;  2IWH A;  4XDX A;  5F2D A;  5ELE A;  3SK6 A;  5LL6 X;  1ESF A;  4B08 A;  2NYZ D;  4DF7 A;  4A93 B;  4IZ8 A;  1FYC A;  1G2S A;  1BOS A;  1SDF A;  3NTI A;  3P20 A;  5EGT A;  4G57 A;  3BVG A;  5CV9 A;  3MXN A;  3TP8 A;  1G6Z A;  1DYQ A;  3H0G B;  3DHQ A;  3I4L A;  1H9S B;  1I4X A;  1BNZ A;  1Y1W B;  1EYC A;  5FLX E;  3BZD B;  3MXU A;  1G91 A;  1OO9 B;  4RA8 A;  4C3J B;  2DY7 A;  2FJ2 A;  3S14 B;  2Q8R E;  1Q1B A;  1EY5 A;  3NBI A;  4KJO A;  2XIW A;  3OMC A;  5FO7 B;  3KLS X;  2QF7 A;  1KNE A;  1TII D;  5E1F A;  5T1I A;  1TY2 A;  4HTH A;  1BXT A;  5M3M B;  3G7L A;  1TWC B;  2NTT A;  5IT9 E;  1MI2 A;  1D5M C;  1Y1V B;  3RZD B;  5D14 A;  3M3Y B;  2L0C A;  4ZUI A;  1LTI D;  1QG7 A;  2HUG A;  1CK1 A;  3DMU A;  1H9S A;  3Q0A A;  1LAC A;  2ICI A;  3GO5 A;  3SE0 A;  2L11 A;  5IGE A;  4XT3 B;  3SK4 A;  1RTN A;  3E6Z X;  1XXG A;  2NVY B;  3J80 L;  1WTQ A;  1F9S A;  2CVR A;  1PRT F;  5KNC A;  2XN9 C;  3NK9 A;  3L9A X;  3W2D A;  3S1M B;  4KMU C;  3TME A;  4HAE A;  5J39 A;  4G7H C;  3MA2 B;  3OOC A;  4IFD G;  4I65 A;  2NWG A;  5JOB A;  4U67 3;  1BDO A;  3ERQ A;  1HCZ A;  1ET9 A;  3H3V C;  3FEW X;  3A56 A;  1M8A A;  2NTS A;  2EY2 A;  4BA1 I;  3MXP A;  3MFG A;  4CJ2 C;  1STE A;  2F0I A;  1DZ1 A;  2EY6 A;  3C1E A;  1EY8 A;  1TU2 B;  3H09 A;  4XQJ A;  1EYD A;  3KBG A;  1KAA A;  2MHV A;  1HRJ A;  1PTO H;  1Q8I A;  4MHE A;  3A8I E;  4RKL A;  1SSO A;  2F0W A;  1W6K A;  2J0T D;  3PIO 3;  5JEA J;  3V2T A;  2HDL A;  1W6J A;  2K1B A;  2A6E C;  4FNF A;  1HUM A;  3A54 A;  5C6A A;  5DNF A;  4PMB A;  3NSW A;  4OHJ A;  2F0T A;  1B50 A;  2XWB B;  1Z7T A;  2NVX B;  3C2P A;  2PYK A;  1KAB A;  3I90 A;  4MN3 A;  2Q8I B;  1HHV A;  1KLU D;  3D4D A;  2HQE A;  4IUR A;  2F0F A;  1SAP A;  4TKO B;  4A3E B;  5NUC A;  3AB9 A;  1HQR D;  1QB5 D;  5KND A;  3H94 A;  1XX8 A;  1V1O A;  3K7A B;  2HCI A;  3PUZ A;  5HGT A;  2D2C C;  2PW5 A;  5C5M A;  1ENC A;  3OWF A;  3PUY A;  1DOK A;  2AWN A;  3ERO A;  4C1N K;  4IAL A;  1TVX A;  4RAU C;  1EZ8 A;  2L1B A;  5C0X H;  4KHZ A;  5CR3 A;  5C44 B;  4F88 A;  3D6C A;  4ME5 A;  1DOL A;  1CFM A;  3VR5 A;  1AZQ A;  4XT1 B;  1KDA A;  3EVQ A;  3SEB A;  1VDZ A;  5LHY 1;  2KVM A;  4XTC S;  3GTJ B;  1LTR D;  4PQX A;  3IL8 A;  2RSN A;  1ONL A;  4QMG A;  1F2Z A;  2DN8 A;  2M2L A;  1ENA A;  2E76 C;  3HEJ A;  2DNC A;  1IKM A;  2EYL A;  1STH A;  3TBI B;  2OXP A;  1JCK B;  4WFN 3;  1Y69 U;  4UDU C;  5IGG A;  1S5F D;  4RHR A;  1B2T A;  5EPL A;  3S1N B;  3HG9 A;  2RDH A;  4C2M B;  2BDO A;  2XSC A;  2KCC A;  1G8Z D;  1CT1 D;  3IFD A;  1CZW A;  1WTW A;  3T13 A;  1JWU D;  3OIP A;  2KQ3 A;  5DAU A;  1RD9 D;  1RJT A;  4K5V A;  4FYD A;  1QNU A;  2AQ2 B;  2YYZ A;  1D1K A;  1QIL A;  3PO2 B;  2N88 A;  1GUW A;  3R2I A;  4RGM A;  2X69 A;  3TN2 A;  3HZX A;  3QWN A;  1CM9 A;  3S16 B;  4IFD I;  4DNT B;  1TS5 A;  1XWE A;  3BYY B;  2E2D C;  3KK7 A;  3M4O B;  1SNO A;  3M85 A;  3PUX A;  1AN8 A;  1TS3 A;  5EKL A;  1T5X D;  1QOH A;  3GTQ B;  1EY0 A;  4N9P A;  5IIF A;  2F0O A;  4A3G B;  3MEH A;  3GV6 A;  4IUU A;  2F03 A;  2XRS D;  3T56 B;  3K0Y A;  1SXT A;  3BS1 A;  3HOV B;  1X3Q A;  2IPK D;  1STA A;  1CA5 A;  1RKN A;  4KD4 A;  4B9W A;  2EYJ A;  3SR1 A;  1WTX A;  2XRQ D;  1SNC A;  1VF5 C;  5JPN C;  4NDX A;  3EJI A;  5AFW A;  1E2Z A;  1L0X B;  3MHB A;  2Z8L A;  3J80 E;  3K5O A;  2EY5 A;  1GJX A;  2L12 A;  4A3M B;  3J7A F;  1BO0 A;  1SND A;  1HTP A;  1GOZ A;  1PFB A;  1EYA A;  4K2K A;  2D5D A;  2PO4 A;  3WOF A;  2NB0 A;  2MJ8 A;  3DWQ A;  1EL0 A;  2ICE C;  4KI0 A;  1CQF A;  4TQU S;  1BF4 A;  5DEH A;  3PUV A;  3NXW A;  4LMQ D;  1S4Z A;  3D3R A;  1V1P B;  4KHV A;  2L5T A;  4IFD J;  1HQM C;  2E2J B;  4X3U A;  4FXK C;  5FKA C;  4FF4 A;  1KTK A;  4C3H B;  3NQT A;  1SNQ A;  1ESR A;  2HCC A;  4QB4 A;  2YU9 B;  4V0B A;  2MP1 A;  4KD3 A;  1BR9 A;  4ULL A;  2EYF A;  2NN6 I;  3R93 A;  4XYO A;  1QJO A;  1X3P A;  1LLR D;  4L63 B;  3X3M A;  3S2D B;  4DU9 A;  1V1P A;  1XYI A;  5CV4 A;  2E2H B;  2ENB A;  2KED A;  2NN6 H;  3BVZ A;  1Y8N B;  1ENF A;  3FDT A;  2WAC A;  5BN4 A;  4H0L C;  3VA5 A;  4KY7 A;  4J1M A;  2RQX A;  3T16 A;  3J7Y W;  3FPP A;  3NBH A;  4XQQ A;  4BWG B;  2WAQ B;  2EOT A;  2JA7 B;  1Q1E A;  4DAP A;  4BA2 I;  2EJF C;  1LT5 D;  2J7Z A;  4P2C B;  3HRZ C;  3L7Z C;  1U4P A;  3NWT A;  3EQL C;  1EZ6 A;  5EJW A;  3T51 B;  4K8I A;  3DWP A;  2D62 A;  2IX1 A;  1C4Q A;  3TP6 A;  1ILP A;  2PQE A;  4J8Q A;  5FO9 B;  1LT6 D;  3S17 B;  3CRK C;  2H4O A;  3DEO A;  5C0X G;  3EFX D;  3RLF A;  4XYQ A;  2RDF A;  1TWG B;  1IKL A;  5KRU A;  3D31 A;  5KGU A;  5IGD A;  1ET6 A;  2KOL A;  3UI2 A;  4IUN A;  1SYE A;  2QIL A;  3ZYY X;  1O7Y A;  1JOK A;  2OEO A;  3GTK B;  3OSO A;  2JEB I;  4RWS C;  3LX0 A;  2EXZ A;  5ELD A;  1CTM A;  4CGY B;  4ILW A;  2AWO A;  2I46 A;  4ZQ3 A;  2EVB A;  2E74 C;  2BCO A;  2K05 A;  3VYT A;  3R2T A;  4DXF A;  1IHZ A;  1U4M A;  4HMI A;  5CV8 A;  4EGV A;  2E75 C;  4K5X A;  1H9R A;  2QKI C;  2J4X A;  4PNY A;  1UUP A;  1IL8 A;  5J22 A;  4K6D A;  5KEE A;  2TSS A;  2FMM A;  5I9O A;  4RFB A;  4ZKB B;  4F8M A;  4WJW A;  5CV5 A;  3GTM B;  4HCE A;  2WP8 J;  3A7A B;  4G7Z C;  3FPU B;  1EWC A;  4RH6 A;  2IX3 A;  1EY9 A;  1E2W A;  2DNE A;  4Y7N B;  4C3J G;  2LFN A;  1II3 A;  1LTG D;  1UNS A;  1KNA A;  3NTH A;  2X6L A;  2X6G A;  2M9V A;  2R6G A;  5A2Q L;  1CQV A;  1NSN S;  1CA6 A;  1HA6 A;  2JSO A;  3NE5 B;  2N55 A;  1FGB D;  2D9U A;  2F1M A;  3J7A V;  2JXM B;  3D4W A;  3D6W A;  5M5Y B;  3MWY W;  2BE5 D;  3PIP 3;  2SDF A;  2B2Y C;  4RGO S;  1G2T A;  4HSV A;  3URY A;  2IJ0 A;  1Z6H A;  1MGS A;  3K58 A;  2F0G A;  1BCP D;  3FVQ A;  2VNU D;  1STY A;  4E6I A;  4NMZ A;  4X3K A;  1JOR A;  4GZY C;  3HOX B;  2KHS A;  4ZRZ A;  3S15 B;  5TSS A;  1ML0 D;  4IUP A;  3P7J A;  3BDC A;  5D65 A;  2QDB A;  3S1Q B;  2LS0 1;  3O13 A;  5HUR A;  1B3A A;  1TWF B;  2JA8 B;  2F0D A;  2B8G A;  1LT4 D;  2B39 A;  3I70 A;  1D5Z C;  4DA2 A;  4LJZ C;  1BQQ T;  3KF8 A;  1A3V A;  4HR7 B;  4EVO A;  1HTL D;  5CV6 A;  4TSS A;  1GXD C;  4IUV A;  1V8Q A;  2NVQ B;  1I4G A;  4N9T A;  2B2Y A;  3GQB A;  4ZLT F;  3GTO B;  4XQN A;  4J6H A;  1HFN A;  5J1Z A;  2JE6 I;  1X32 A;  2FIN B;  3A8K E;  2R93 B;  2MPM A;  3CKI B;  2K5Q A;  3K57 A;  4V19 0;  1WCM B;  4RGN A;  5C3E B;  4OIK A;  1DCZ A;  4FXD A;  4BY1 B;  1ICW A;  2IX0 A;  3T53 B;  5C0X I;  1IYU A;  4C1N I;  1LTB D;  3OW7 A;  4ID6 A;  4RCN A;  2B2T C;  2K5W A;  2L55 A;  5I6Y A;  1YNJ D;  1SYF A;  2BDN A;  3KUP A;  1G29 1;  5D3I B;  3HOY B;  1NUC A;  1EY4 A;  2R92 B;  4FVM A;  4ZYS A;  1GUG A;  1UAP A;  1VCI A;  4KJN A;  5G3L D;  2PZU A;  4ABN A;  1KDB A;  1ZXT A;  4QCL A;  2B2V C;  3HS0 C;  5IGB A;  1CHP D;  2K04 A;  1PTO D;  2SEB D;  1JIC A;  5C3X A;  3I72 A;  2TMP A;  1EWH A;  2NN6 G;  2F0Q A;  2EYP A;  4RHS A;  3DEP A;  1F2Y A;  4X3T A;  1Q12 A;  4KK7 A;  1EOT A;  1A2U A;  3VR4 A;  1TS4 A;  1EQV A;  1TY0 A;  1ZKO A;  3NQI A;  3TP5 A;  4H44 C;  2F0V A;  1O7Z A;  4OO1 H;  2B2T A;  3NPP A;  3QG1 A;  3U9S A;  3RUZ A;  3C1F A;  2WII B;  1I50 B;  2PCF B;  1WTO A;  1OXT A;  1E2V A;  1KDC A;  4UAI A;  2F3W A;  1DM0 B;  5C4X B;  1GHJ A;  2B63 B;  2SNM A;  2BE5 C;  1QNK A;  1NCV A;  2K28 A;  3Q22 A;  4FF1 A;  2B2V A;  1SBB B;  1B1Z A;  3I73 A;  5IOC A;  2F0N A;  1BCP C;  4M1U B;  2KUM A;  1U4R A;  1EQT A;  3NUC A;  1DXM A;  2A73 B;  2FMC A;  1FNV A;  2PW7 A;  2RBM A;  2MGS A;  1BCP B;  4LK1 C;  1NR4 A;  3TP7 A;  5D3D A;  1SYD A;  3SXH A;  3CRL C;  3HP3 A;  1JWM D;  1TWH B;  3VYU A;  1LTS D;  3TSS A;  3VYS A;  4DXG A;  3J81 L;  1D1I A;  1STB A;  3AMU A;  5LL6 S;  1A2T A;  2VXW A;  3FKI B;  2VUM B;  1K83 B;  1F2M A;  2AUJ D;  3F2U A;  2XNA C;  1WD0 A;  1YNN D;  4CJ1 B;  2ZXR A;  4DAV A;  3BYT B;  2NVT B;  3SHL A;  3BDL A;  2ZT9 C;  3D8G A;  1K8O A;  1DJR D;  3I91 A;  5M5W B;  3LNN A;  3D4R A;  5A2Q E;  1SEB D;  1IYV A;  1JWS D;  5IGF A;  1JE4 A;  1YNJ C;  2NBF A;  1JOO A;  2Y0S B;  4A3I B;  4O1N A;  4QF4 A;  1ZEQ X;  4DFA A;  2FHT A;  5M9O A;  4A3K B;  3A55 A;  2F0S A;  3IAY A;  1SMY D;  1PTO C;  1AW7 A;  3Q6S A;  3ND9 A;  1HPC A;  1I4P A;  4L8J A;  1HXY D;  1I4H A;  3DM1 A;  2HDM A;  4HN7 A;  4IQZ A;  3MAQ A;  1F9Q A;  4R8N A;  3Q24 A;  1FNW A;  1JOQ A;  2EZV A;  1PZK D;  1TQO A;  4C3I B;  4RKB A;  1B9N A;  3I3C A;  2F0U A;  2VB2 X;  3VR3 A;  2LKV A;  5E3F A;  5A35 A;  3PO3 B;  4KN7 C;  1AZP A;  3QIA A;  1PXU A;  4R9W A;  2QEJ C;  2RSO A;  4AYB B;  1R4Q B;  5ELF A;  4C56 C;  1PYW D;  2PPB C;  1OXV A;  1S5E D;  2B8F A;  5CMD A;  4DAY A;  4A3F B;  1JQY D;  5K5P A;  5C3W A;  1PFM A;  2XWJ B;  2K5D A;  4C3H G;  5KYL A;  3OIQ A;  1SE3 A;  1H9M A;  1D2B A;  3TDQ A;  1I6V C;  3R3O A;  2DY8 A;  2C9O A;  1SYG A;  1EY7 A;  4WOR A;  4KY6 A;  2BA1 A;  2PZT A;  4JK1 C;  5K36 H;  1HA5 A;  2G9D A;  2GA4 B;  3I4M B;  3GD7 A;  1PZI D;  4FO2 A;  4KV6 A;  4F7X A;  1STN A;  1Q90 A;  3JAM L;  2WB1 B;  3DUZ A;  3C46 A;  2IL8 A;  3PMF A;  3WDN A;  2H1E A;  1SYB A;  2JP1 A;  3LWE A;  1SYC A;  1WD1 A;  2R3Z A;  3S9W A;  3QJY A;  4O42 A;  2WV6 D;  2F0H A;  1OXS C;  3A7L A;  3IKJ A;  3I4N B;  5C4Z A;  2AQ3 B;  5E4X A;  2EJG C;  3H91 A;  5CV7 A;  2WKD A;  2BA0 A;  3SDZ A;  1Z47 A;  2NUC A;  1YNN C;  4A3B B;  2F4I A;  4BY7 B;  4CKC A;  5CBE E;  4H13 C;  4PMC A;  1EEI D;  2B2W C;  4Q0F A;  3C3L A;  1QCB D;  4B9X A;  1F2L A;  3K6O A;  1PMR A;  1S5C D;  4FP5 D;  1FR3 A;  1TT2 A;  2O4X A;  1LT3 D;  4OO1 G;  3OMG A;  5JVH 3;  4RCO A;  3OPO A;  3V96 A;  4F87 A;  4K5W A;  2F0L A;  5T1G A;  3MVV A;  3H6M A;  1MSH A;  1F9R A;  1A3U A;  1SMY C;  2F0P A;  3CU7 A;  1M4V A;  2KCN A;  3V05 A;  2B2U C;  1I3Q B;  3NHH A;  1EY6 A;  3RMH A;  5FK9 C;  1OXU A;  1PRT D;  3HOZ B;  2B2W A;  2KEC A;  1RCV D;  3GTG B;  1SNP A;  4QIW B;  4NW2 A;  1O7L A;  2A5H A;  2CW0 D;  2PMZ B;  4CKB A;  5JEA H;  2K03 A;  2ZXO A;  5CC4 A;  1LTT D;  4IN3 A;  4S3S A;  5COR A;  1V43 A;  4CJ0 B;  1D6E C;  3GTL B;  2XVS A;  3OHX C;  1GUN A;  1SE4 A;  2RKS A;  2AUK A;  1IW7 D;  4EQP A;  5EPK A;  5CBA E;  3J81 E;  4ZAI A;  1PFN A;  3TZU A;  2A69 D;  5EKI A;  4OGQ C;  1DOM A;  4XXE A;  4ZKC B;  2ID0 A;  2B2U A;  4FF3 A;  1TR5 A;  2AQ1 B;  2SNS A;  1XTC D;  1OXX K;  1SNM A;  2Q8T A;  3M7G A;  4MIU A;  3QO2 A;  1I4Q A;  1WTV A;  1TWA B;  3GTP B;  4BBS B;  3L3O C;  1MSG A;  2VB3 X;  1GUS A;  1GUO A;  3WOE A;  1MD2 D;  3X3N A;  4DN4 M;  4HMJ A;  4CBV A;  1ILQ A;  3I8Z A;  1B53 A;  1KLG D;  4G7O C;  3TZD A;  1C8C A;  3E0J A;  3P1H A;  1BCP F;  4K14 A;  2RDG A;  4HCS A;  3VA7 A;  4PV1 C;  2IT1 A;  3QB3 A;  2L4N A;  3HOW B;  2EY1 A;  3M4Y A;  4QUF A;  2O5I C;  4FXG C;  1VF7 A;  1U9R A;  4K6L A;  1SJH D;  1A3T A;  1SE2 A;  1CI3 M;  5ELB A;  1GHK A;  3N6R A;  1ROD A;  5C4J B;  4KY5 A;  2F0K A;  2WIN B;  2A74 C;  3SK8 A;  1U4L A;  4DK0 A;  1AFP A;  1JR0 D;  2F0E A;  2Z4I A;  3PV0 A;  1C48 A;  4WRD A;  5CYU A;  4JBW A;  3QOL A;  2KEE A;  5JJZ A;  1B4O A;  2K33 A;  4I7Z C;  3K5M A;  3N52 A;  5C5L A;  4DGZ A;  1QE6 A;  4KKS A;  1LV9 A;  5JAV A;  2EYO A;  4X3S A;  1K8M A;  3K59 A;  1PLF A;  2CHB D;  4OO1 I;  1RDP D;  5EPJ A;  5EQ0 A;  1EFI D;  1Y8P B;  1BUV T;  1Y8O B;  1R9T B;  4ODG A;  2JEA I;  1QWY A;  5I6W A;  2EDG A;  2F3V A;  1VMP A;  1NAP A;  4CHT B;  1PRT C;  2WKC A;  2JYO A;  2L9H A;  5JPM C;  4OIJ A;  1LAB A;  1HUN A;  1B9M A;  2A68 D;  5K36 G;  5IOD A;  3BDO A;  3JAM E;  2CW0 C;  1BBX C;  1RF2 D;  3GP7 A;  1PRT B;  1STG A;  1E0B A;  1AP0 A;  5IGC A;  3K5L A;  4TRD A;  4U68 A;  5G3L F;  2M00 A;  2CQA A;  1SJE D;  1WTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...