5JEAH

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
305
structure length
282
Chain Sequence
DSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTITRLEEESSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 77
structure length 282
sequence length 305
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF14382 ECR1_N Exosome complex exonuclease RRP4 N-terminal region
H PF15985 KH_6 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5jeaH01
3T51B 1HPCA 2K32A 3VR5A 1OXXK 1CI3M 3MXUA 1FYCA 4OO1G 1H9MA 2A68C 2PPBC 2E76C 3HGBA 3ND9A 4IQZA 1K8MA 4TQUS 4GZYC 2A6HD 1FR3A 1Z7TA 4G7HC 2BE5D 1H9RA 3A8KE 3PUXA 1Z6HA 1A6XA 1YNJC 2PCFB 3PUWA 2LMCB 5K36G 1B9MA 1O7LA 2EDGA 2L5TA 3TZUA 2JXMB 2YYZA 3PUVA 4KI0A 2IT1A 1K8OA 1TU2B 2AUKA 4H44C 1H9SB 1IYUA 4LJZC 3VR2A 4HR7B 3LNNA 3P20A 2JE6I 1Y8OB 3SDZA 1DXMA 2O5IC 1O78A 2D2CC 3H94A 1E2WA 1E2VA 1HCZA 2A6EC 4KKUA 3AB9A 3NE5B 4KMUC 3OPOA 5KNBA 5KNCA 5JEAG 3QJYA 1E2ZA 2CW0C 3I72A 1GUNA 3I73A 4KHZA 3I4LA 4OO1H 3RLFA 4H13C 1GUTA 4JBWA 1VDZA 4DNRB 4PV1C 1Q90A 2O5JC 4DNTB 2K7VA 3L7ZC 1IYVA 1CTMA 1VF7A 2JEAI 2A6HC 1ZKOA 4XIGS 3A8JE 1B9NA 1IW7D 2NN6G 3VR6A 4DK1A 3U9SA 2BE5C 5C0XG 5K36H 2E74C 2NN6I 4KKTA 3VR4A 2DNCA 4KN7C 2EJFC 5KNDA 3GQBA 3A7LA 1HQMC 4OGQC 4KKSA 4RCNA 3T53B 3BDOA 3D31A 1OXSC 3ND8A 1VF5C 2PNRC 3PUYA 1OXUA 1SMYC 2EJGC 1OXTA 1TKWB 3KLRA 3QG1A 4KN4C 3SE0A 3D4RA 3FPPA 2BA1A 2KCCA 1GHJA 2B8FA 1ONLA 1ZYRC 2AWOA 2A69D 4G7ZC 1Y8PB 1I6VC 1G291 2AUJD 3CRKC 2B8GA 1GUOA 3VA7A 1Q1BA 1YNNC 2V4DA 3T56B 1VCIA 1EWHA 5BN5A 4IFDG 2QF7A 3IFTA 3CRLC 1PMRA 2D5DA 1LACA 2NN6H 3N6RA 1GJXA 3OOCA 1IW7C 1OXVA 2D62A 1QJOA 4LK1C 5C0XH 2BA0A 4G7OC 3A8IE 1Q1EA 1GUSA 2F1MA 2R6GA 3M4YA 2EVBA 1CFMA 2ZT9C 3BG3A 2A68D 3OW7A 1Q12A 3PV0A 1V43A 4DK0A 4I7ZC 1GUGA 3LWUA 2BDOA 3W3AA 4BA2I 4BA1I 3GD7A 1GHKA 3M85A 4TKOB 1H9JA 5A35A 3EQLC 5JEAH 3MFYA 2JEBI 3QIAA 3FMCA 3PUZA 4JK1C 5BN3A 2A69C 1Y8NB 2KA7A 1HTPA 2K33A 3A7AB 1V8QA 1H9SA 4XTCS 1Y69U 3M7NA 4L8JA 1DCZA 3IKJA 2DNEA 3WDNA 4IFDH 3DXJC 5BN4A 1DD2A 2EJMA 4H0LC 1BDOA 2A6ED 3VR3A 2Q8IB 2E75C 2DN8A 1H9KA 1LABA 1T5EA
chains in the Genus database with same CATH superfamily
3OYYA 2E2JB 4KLKA 3T51B 1EY0A 1FNVA 1S3OA 4K6DA 4C3IH 4LF8Q 4QL5A 2RDGA 3HOXH 3U9OA 3L0OA 2E2IB 4JI0L 2K1BA 1Q81C 3I3CA 3K5NA 4LF7L 1SFOB 1SJED 2VZAA 3HOWG 3MVVA 1TU2B 3ULLA 1N8RC 1XMOQ 1K3BC 2EIFA 4LJZC 3CHBD 1LTSD 3NPPA 1Q82C 5JEAJ 1SYBA 5IY0A 2I5LX 1SNDA 2D2CC 2F0LA 4LF4Q 4LF8L 1D1IA 5KNBA 3RLOA 2JA5H 5FLMH 1EFID 1JB3A 1F9PA 4L5SA 2NUCA 5A2QL 5I6WA 4XQNA 4NXNQ 4OHJA 1IYVA 2A6HC 2EYJA 4DUYQ 1XMOL 1TR5A 3MHBA 2BE5C 1DM0B 4QCLA 2B2YA 3STBC 4NXMQ 2QEJC 3F2DA 5IIFA 3HS0C 4LF4L 2PNRC 1TKWB 4BBRG 3KJOA 1TQOA 2IX1A 5COYA 4EQPA 1ZYRC 4ZKCB 4X62Q 1G91A 1EIGA 4DN4M 4GNXA 5CV9A 4G7ZC 4NXNL 2CHBD 2NTTA 5C4JH 1AE3A 4DUYL 2RSNA 3SK5A 1I4QA 3W1GA 1B7YB 4CKEA 3PCOB 4QB4A 4IFDG 3UDXA 2TSSA 1EIYB 3CRLC 4NXML 3C46A 3S9WA 1SSOA 3BU2A 5LL6S 5DLQE 5JJLA 3MXNB 4ILWA 3HKZG 2JA7G 3K5OA 4DK0A 3GTJH 4P71A 3S14B 5DEHA 4X62L 2BDOA 3E5SA 4HIOA 2XVSA 4TKOB 1IBKQ 1MD2D 2Z0SA 3S17H 2XWBB 4PNYA 1O7IA 3PUZA 1W2BA 1A3UA 1EQTA 1EU4A 2KA7A 1PH5A 1EZ8A 4TVAB 3BZCA 2FHTA 2E8GA 1TS2A 1Y1VH 1EY4A 1JMCA 3H6MA 1CQFA 2EXZA 1BBXC 2G9HD 1K0SA 4A3KG 1T9HA 1AEXA 4A3DG 5E1FA 4XDXA 1N32Q 4KN4C 5M5WH 4U68A 1QCBD 4JI8Q 3L3OC 4HSPA 4G4KA 3KFUA 2F0EA 3GTQH 4ID6A 4BBRH 1IBKL 3OIPA 2KUMA 3K5LA 2PMZE 1FR3A 2KOLA 1WTOA 1JCKB 3K7AH 4HJ5A 4F7XA 3J80i 3VA5A 1D6EC 1CKNA 2L55A 4KV6A 1EWCA 1N32L 1EIFA 2F0SA 3KF8B 2B2UA 1SNPA 1WI5A 4JI8L 2O5IC 2QDLA 5AJ3L 2YU9B 4ZKBB 4RFBA 1HUMA 1Q3LA 3T13A 2BDNA 4UP8A 3AMUA 4HJ9A 4YIJA 1WTQA 2K28A 3ERQA 4XYOA 4A76A 3T16A 1XYIA 2K7VA 2KCTA 3BYTB 3TP6A 1TVXA 5H1SE 1Q86C 4DK1A 3F2UA 2UU9Q 3NTKA 3MA2B 1C7YA 3R93A 4JW0A 1L2FA 3BDOA 1OXSC 5I4DA 1GVPA 1I94Q 1G2TA 3WWVA 1AP0A 5KYIA 3FRPB 4A3KH 4DPGA 3KLSX 4A3DH 4ZAIA 1V1PA 4YWKA 2KHIA 2I46A 1Y8PB 4UPAA 3S1RB 1QE6A 4HMIA 1WTHA 2F0GA 2IWHA 2AKWB 5LMNW 2ICIA 1Q1BA 2UU9L 4GLVB 4LMQD 2IL8A 5IGEA 1KD1C 2JQOA 5C6AA 1KTKA 4R4CA 3HOUG 4B3RQ 1F2LA 5C0XH 2ICEC 5CYUA 2WB1B 1I94L 4V190 1AH9A 4RG1A 1EY9A 2R7ZB 1UAPA 3JAML 3PIP3 1BR9A 1K83B 1YITA 2Q2IA 1GD7A 1F2YA 2J0TD 2OCEA 1PA6A 3W3AA 4K6LA 1KIXA 1PH1A 4ALPA 3L9AX 3MWYW 1X6OA 1VMCA 3G6JB 3HOZG 4MNOA 3MFYA 3TBIB 5IODA 2QA4A 2R3ZA 3BVMA 2WV6D 3S1MH 1HTPA 1NAPA 2YTVA 3RR5A 4B3RL 3BS1A 4L5QA 5ELBA 1PH4A 3KYHC 1SE8A 4IN3A 4ODGA 5C3WA 4YCVA 2A6ED 3A55A 4HMJA 1KQSA 4RH6A 2QDBA 2HD3A 4DAVA 3Q22A 1EFWA 1IKLA 1J9OA 1CI3M 3DUZA 4AYBG 4DAYA 3JC66 1EZ6A 5CV8A 4C3JG 4F88A 3PO3B 1BNZA 4O2DA 4K8JA 2LMCB 1C8CA 4O42A 1O7LA 3CCQA 4A3FG 3H3VH 4LNQA 2L4NA 4WORA 1M8AA 1X32A 1B3QA 2EE1A 1VQFA 1PTOF 2CKZB 2KEDA 1VQAA 1XMQQ 2F0OA 3PO2B 1G6ZA 4A3MG 2NBFA 3OW2A 1E2VA 1QWYA 2K6AA 4JBMA 1S5BD 3D0FA 3Q0AA 5KIXA 2CW0C 1HZAA 3D3RA 3I4LA 3KLWA 5C44G 1DOMA 1CSPA 2IX3A 1Y1WG 3Q6SA 1BBWA 4YCWA 3HOZH 1B9NA 2OTJA 1JOQA 2BH8A 3H91A 1YVCA 1TY0A 2ALYB 5G3LD 1XMQL 2Z6KC 1R9TH 1KXLA 3ND8A 4N9TA 5G3LF 5C4XH 4POFA 1ASZA 3NENA 4DA2A 1UE6A 3EJIA 2EYMA 2Y0SB 2AWOA 2N78A 4DR5Q 1G291 1RCVD 4J6HA 2B8GA 3VA7A 1DOLA 4UAIA 5EJWA 1GKHA 1NBWA 3IFTA 3NBHB 4HN7A 1VQ9A 1LACA 2NVTH 3HOYH 3NELA 5IYCG 4A3FH 4FNFA 5GAEC 3UE0A 2K5HA 2JSOA 3PQIA 4FXGC 1J8IA 4DR5L 4A3MH 4BA2I 1YNJD 1LTLA 4GKKQ 3TSSA 2JK8A 1VQKA 4A3GH 2Z9HA 2HDMA 3VYUA 1U0LA 3GTKB 3TDQA 5C44H 2WIIB 3S24A 2YV5A 5BN4A 4H0LC 4A3JB 3EA6A 1PH3A 1QZGA 2FFKB 3ULJA 4DV6Q 1LM0A 2LXKA 4GKKL 2NZ1D 2AWNA 3HOWB 2F0JA 1X3QA 3CCRA 3GTPB 4L5TA 3GTOH 1TWHH 3JAMc 3AEVA 1ENAA 3H0GB 4CKCA 2B2WA 5FO8B 4BY7G 1ICWA 1YNXA 2QW7A 4ZK9B 4N8FA 2RCNA 4HCSA 4DV7Q 1VQ4A 1WTWA 2SNMA 2EYLA 3NHHA 3SDZA 3HEJA 4DV6L 4A3CH 1IBMQ 2VQFQ 2A6EC 3I91A 4KKUA 4KMUC 3DLLA 1I6HH 3CCVA 1E2ZA 1GUNA 3PSIA 4OO1I 5M5WB 1Q90A 3K57A 4A93G 3VR6A 2UXBQ 4FXDA 3CCJA 1O7YA 5CBEE 4DV7L 3GTLH 3OSOA 3MXPA 3CC2A 2F0WA 4DXGA 4K5VA 1IBML 1PTOC 1U4LA 2VQFL 2UUBQ 5M5YH 4LFBQ 1ZXTA 4LF9Q 3ONAB 3F2CA 1C0AA 1F77A 1TY2A 2KCCA 2NVYB 1BCPB 5KRUA 3DHQA 2I07B 2N88A 2FJ2A 4EVOA 1Q8KA 5CC4A 1EWIA 1QVCA 3OWEB 1RKNA 4BY7H 2B2TA 4S3SA 3FVQA 3CU7A 3KF8A 2JA7B 1UNSA 1PRTF 1B50A 2WAQG 2UUBL 3M4PA 4LFBL 2N8NA 2R6GA 3R2TA 2XWJB 3UDIA 1P16A 2WINB 4P75A 4GLXA 1LTRD 3OHXC 1WFQA 1WTXA 1SYFA 1CSQA 2A5HA 1NTGA 1XPOA 1V9PA 4FVMA 4IPDA 5A35A 3BVGA 3O13A 1UUPA 1WCMG 4DV2Q 4A93H 2C9OA 2DNEA 4R8IA 1S72A 3I4NG 1AFPA 3FPUB 3TN2A 1BBUA 5EKLA 2F3VA 5C5LA 2A73B 2MO1A 4B3MQ 5I9PA 1H9MA 4PQXA 1QB5D 4IQZA 1YJ9A 3RZDH 4MHEA 2R92G 1NNXA 3A8KE 4BY1G 1Z6HA 1SNQA 1YNJC 3A54A 1YHQA 2VY3A 4H02A 2JXMB 2YYZA 2IT1A 4BBSG 5IP9G 2SEBD 2AHOB 4RGMA 4LFCQ 1S40A 1PDQA 1HJPA 3GTMB 1EEID 1AZQA 1P8LA 1STYA 4B3ML 2Z4IA 3TQYA 1HNXQ 3OPOA 2RQXA 2HIXA 2D0PA 4N9PA 2HQEA 3S2HB 4GOPC 4DAMA 5CV5A 3H15A 2LS01 4CDCC 4LUVA 1QNKA 4GKJQ 2XRQD 4XIGS 1W3SA 2XGTA 3STBD 3U9SA 1RL2A 4CHTB 4LFCL 4Y7NH 2E75C 4YY3Q 5E3FA 2CH4W 3RZOH 5KNDA 1IXRA 1WCMH 3I7FA 1CKMA 2B2UC 5C5MA 1HNXL 3I4NH 3QG1A 3J7AF 1AZPA 3T1HQ 3SK8A 2CQAA 3FPPA 1I3QH 1I4PA 3NEMA 1JQYD 1W6JA 4UP7A 4IFDJ 1UE7A 5EPLA 4CKBA 4GKJL 1JWUD 3HOUB 1HRJA 5ELDA 2LY7A 3CKIB 5JOBA 1HTLD 2C5CA 1NSNS 2JA6B 3J81j 4DV5Q 4YY3L 4BY1H 4FO2A 2LFNA 2H5XA 3SK4A 2D5DA 5IYBH 4JPBW 2Z4HA 1L0WA 1STGA 4DAPA 1KAAA 4BBSH 4G7OC 4FF3A 3T1HL 4C3IG 3BG3A 5ELNA 3D8GA 4NDXA 4K5XA 3H3VC 1DGSA 2XSCA 5HGQA 4RGTA 3FHWA 2JEBI 4DV5L 4WJ3M 1FVIA 4LUOA 3JAME 1LT3D 2GVAA 2HHHQ 3BJUA 1EYDA 2DY8A 2Q2HA 4JG2A 2BCOA 1FNUA 4UP9A 1G2SA 2RVLA 1PRTC 1RHPA 5M3MH 2QKIC 1VQCA 4XT1B 5E7NA 3X3MA 1H9KA 5EBDA 4C3JB 5GAGC 3BYYB 5I2XA 1YBYA 1KLUD 3M3YB 1CZGA 5J1ZA 1WTRA 4FF2A 5FLMG 4GLAC 4LFAL 4TQUS 4A3FB 4DF7A 3I56A 3ZJYC 3CMAA 2HHHL 1A6XA 1U5KA 3NBHA 1CA5A 4PMWA 2MQHA 5JPMC 3K0XA 2AUKA 3S16H 1C4QA 1MJCA 4I7AA 1D1KA 1VQOA 2K50A 4YWMA 3QOJA 3FP9A 4IJHA 3Q24A 5EQ0A 3SHLA 3J80c 5C44B 3MFGA 5M5XB 1SXTA 4HSVA 1Y1WB 5JAVA 1K3RA 1X3PA 1PXUA 3QB3A 1STHA 4CDDC 2EYHA 3RLFA 3EROA 4DNRB 4LAAA 3K59A 3VR4A 2P5ZX 1HNWQ 1TWGH 1VQ7A 4GN3B 3I90A 1K0RA 1I4RA 2VB2X 3HKSA 2WACA 1F9QA 3NWTA 4PG3A 1FGUA 4GS3A 1SAPA 3URYA 5FO9B 1GHJA 1GO3E 1MGSA 2CQOA 3QOLA 4U673 1K8GA 4A3LG 4NMZA 1KNEA 1WVLA 1GUOA 4DR2L 1SYDA 1TXYA 4K0KQ 1W6KA 1Y1VG 2HCIA 4EQ5A 2M00A 3GV6A 2SOBA 2ZTCA 2E2HB 2ZTDA 4QIWE 2ZM6Q 2RDHA 1HNWL 4GN5A 2GA4B 2G9DA 4ZCKA 2F0UA 2NN6H 2RA4A 3N6RA 4A3EG 3D6WA 4XT3B 2F1MA 2D9UA 5JJKA 3R8BA 4A3BB 2O4XA 1V1QA 2RKSA 5J22A 1GXDC 3EVQA 1KRTA 1LTTD 5K5PA 2JN4A 4K0KL 2ZM6L 3CCEA 1ESRA 1G8ZD 3MTSA 2F0TA 3DXJC 5GQOA 1DD2A 4J15A 2DN8A 3L2PA 1X3EA 1HPCA 3SK6A 3VR5A 3CC4A 2HCCA 4QQBX 3MXUA 5CORA 1B53A 3HOVH 1PZJD 2B29A 1WYDA 4BXXG 2MP1A 1PTOH 4A3LH 1IL2A 2EDGA 3TZUA 1K9MC 1SDFA 1SYCA 2MO0A 1FNWA 5TSSA 4HR7B 2PQAA 2A19A 4DR6Q 5IGDA 1UEBA 4A3EH 4RHRA 1JT8A 3S1NB 2CW0D 4NKLA 1EEFD 2LXJA 2F3WA 4OEMB 2L12A 5AJ3Q 4IUVA 4KJOA 4KJNA 4OO1H 1TWFH 1XX8A 4B3TQ 3PIPA 4DV4Q 1JOOA 4EGVA 5D65A 4LW1A 3AQQA 3CP0A 4A4IA 5C0XG 4R8NA 1HNZQ 1JB7A 3A5UA 4DR6L 4X3SA 1YHBA 3C1FA 4F8MA 1VQIA 1RJTA 4AH6A 3S2DH 2L0CA 1HXYD 1EU3A 4OIKA 2IHEA 4B3TL 4DR4Q 2L9HA 4HAEA 5ELCA 4DV4L 2EOTA 3DMUA 2WAQB 3PMFA 5JJZA 1KNAA 2L15A 1MSGA 3A74A 5J39A 3QO2A 1BF4A 1HNZL 2MFIA 4IUNA 4BXXH 2ZXOA 3I4MG 5C3EB 4P74A 3K7UC 1SNMA 5D14A 1A62A 1GUSA 2M2LA 3OW7A 2G5DA 4JVZA 2OWOA 4IOAA 2RHQB 1TWAH 4I7ZC 2ZJQA 4JOIC 4DR4L 5DM63 2QILA 2MJ8A 3M4OH 5M3FH 1VQLA 3CAMA 3TP5A 1HZBA 2F0HA 4WJ4A 4M8AA 1RF2D 4RKBA 1D8LA 2K03A 2F4VQ 1UWVA 3KDFA 1WD1A 2TMPA 4WJWA 3VDYA 3G71A 1C9OA 3A7AB 4NB3A 1H9SA 2B2TC 4HEDA 1CK1A 4WRDA 3ZYYX 1BXTA 2O2LD 1S5DD 3WOEA 1PYSB 2R92B 2N55A 4Y52H 2UUAQ 2VNUD 3G7LA 4IALA 3J80E 4FF4A 4UY8C 3HGBA 1K8MA 2F4VL 4BBSB 1A0IA 1LV9A 3HP3A 1UEAB 4QJFA 2NVXH 1K8OA 4Q0FA 3CQZB 2JA8G 2DJFC 4HJ8A 1NMGA 4DV0Q 5J3BA 1XJVA 2PZUA 5C4XG 4RA8A 3I4MH 2B2VA 4JV5Q 2UUAL 2ZJRA 3IRBA 1JWSD 1PLFA 2CH4A 3DEPA 1RTOA 4IPCA 1E7ZA 1K8AC 5D3IB 1A15A 3MXGA 1XNQQ 3GTGB 1VF7A 4JI3Q 1XPUA 1IW7D 3HOYG 2RCFA 4DV0L 1U4RA 4J8QA 4M1UB 2EY5A 1PTOD 1NY4A 1SLJA 3PIO3 4JV5L 2HUGA 1A2UA 5LL6X 2WB1E 4C3HH 4R1JA 1EOTA 4I65A 4A3GG 1VMPA 2MGSA 4DK3C 1CHQD 1XNQL 4JI3L 2V4DA 4QGUA 1QOHA 4C3IB 2R93G 3TREA 2EQSA 3HOXB 4MZ9A 5I2YA 3HRZC 2VUMH 1HFGA 1I4XA 4IOCA 2JA8H 5FOBB 2GVBA 2EXDA 5LHY1 1L0XB 5IOCA 3C1EA 1J5EL 4OX9Q 2MUYA 1MSHA 2AQ1B 3EQLC 2IJ0A 1TWCH 3NBIA 4JK1C 4N8X1 3W1BA 1LYLA 4ULLA 3SEBA 3NQTA 3CXCA 2XRSD 1DCZA 3S1QH 2JA5B 1NE3A 1SJHD 3IL8A 4GN4B 4A3CG 1ZEQX 2OQ0A 4X66Q 1SE3A 1A2TA 4RWSC 4YHHQ 4KD4A 2K32A 1NJIC 4OX9L 4HIMA 2UXDQ 2E76C 1HZCA 1CKOA 4R4QA 1QVGA 1L1OC 3PUXA 3E9HA 3K80C 2PCFB 1M90C 3S15H 1HH2P 3KF6B 2F0NA 2NWGA 3TS2A 4X66L 2QEXA 2R93H 5C4HA 4YHHL 4YWLA 5C4JB 4OL7A 1KDCA 5HY6A 4JYAQ 2UXDL 2IHFA 4IO9A 4OONA 4OWWB 1CHPD 2J4XA 3G48A 2F0QA 2NVQH 5EAYA 1LTGD 2RDFA 2Y0SE 1PH2A 5ISRA 1Q46A 4CJ1B 4DNTB 2E2JH 5DAUA 1RIPA 4X64Q 2JEAI 3GTJB 1TIID 5K36H 1UE1A 2E2IH 5IT9L 3MXNA 2EJFC 1KABA 3GQBA 4JYAL 3T53B 3FDTA 1KLGD 3TRZA 3S17B 1PTOB 5GADC 3J7A5 3D4WA 5NUCA 1SFOH 2C35B 1SRUA 3W5OA 1Y1VB 1IZ6A 4V0BA 4X64L 4B9XA 3BDLA 3RN2A 3J81i 1SEBD 5KEEA 3VYRA 5BN5A 2WP8J 3CD6A 2QF7A 3GTQB 4BBRB 4K8IA 1IW7C 3U58A 5CV6A 4IUPA 4NPSA 1VQMA 2E5LQ 2PZTA 3K7AB 5A2QE 2EVBA 4JBKA 2XTIA 4TRDA 1LTBD 4IUTA 2I5MX 5CV7A 3ER0A 2ZXRA 3CCSA 4DNIA 5IYDH 3DWQA 2PZWA 3QIAA 3MC0B 2MNAA 5FLXL 1PRTD 4XTCS 4L63B 3HKZB 1PVOA 2E5LL 4IFDI 4X3KA 3NUCA 2K04A 3IFDA 2B2YC 4JCVE 1OXXK 1LTID 4KHVA 1II3A 3MEFA 1IYJB 2QGQA 3BVZA 4GZYC 4GNXC 1AW7A 3OMGA 1VS0A 1TWAB 4JI4Q 4LWCA 4RHSA 3E6ZX 3ULPA 4A3KB 1BKBA 1VQBA 4A3DB 1QZHA 1D2BA 5I9OA 2JE6I 2MPMA 3J7YW 2FXQA 1X55A 2NZHA 1R4PB 1TS5A 2BH2A 4DR1Q 5KNCA 1DONA 3QJYA 5JVG3 2DY7A 1S5CD 4GOPB 4H13C 3RN5A 1IHZA 4JI4L 2X6LA 1EIHA 3J7ZC 5IYBG 4O1NA 4DV1Q 2D0OA 5LMUQ 4RCOA 4CDEC 5C3XA 1SE4A 1VQ8A 2VXWA 3C3LA 1OXUA 3ICEA 4AQYQ 3S1MB 3SE0A 4DR1L 3K81C 3NXWA 2BA1A 2WFWA 3QWNA 5F2DA 1GOZA 1ASYA 2ENBA 2F0PA 2KCNA 2R7ZG 4NP5A 2X69A 1JE5A 1KDAA 2CWPA 3F2BA 2AUJD 2YU9H 4DV1L 4UDUC 5IGFA 5IP7G 1X3FA 5LMUL 1YHAA 3H09A 4P73A 1WD0A 5GAHC 1EYAA 1TS3A 2H1EA 4JI1Q 5M3MG 1PZID 1HFNA 4DKAC 1PV4A 4AQYL 4MTNA 1B44D 1U4PA 3A8IE 2XN9C 1EYCA 4POGA 3UDFA 4RMFA 1KL9A 1Q12A 1RD9D 1RODA 1SBBB 4Z9CB 5IT9c 3CC7A 1QG7A 3V05A 3V96A 3GD7A 1GHKA 3M85A 3C2PA 2DGYA 2F4IA 4R4OA 5CGKA 1DJRD 5IGGA 1DZ1A 3PF4A 1B70B 5GROA 4KY5A 4PMBA 1LUZA 4JI1L 2XIWA 3I70A 3H3VI 3M7NA 3IKJA 5CR3A 2Z6KA 4IJLA 1PRTB 1SMXA 3OIQA 1EY8A 3S1RH 2I5HA 1XWEA 3HOZB 3NSWA 4RGNA 4R9WA 2E2DC 1T5XD 1K73C 1F9SA 1Z7TA 2JA8B 4LFAQ 1R9TB 1VQDA 4ZYSA 2R7ZH 1HQRD 5C4XB 3EFXD 1CQVA 2Q8TA 1K83H 2K52A 2KCMA 3I55A 3VR2A 4AYBB 1XNRQ 5IP7H 5FLXc 2OTLA 1TWCB 5EKKA 1Y8OB 1N36L 1X65A 1DXMA 4DV3Q 2RBMA 1Q8IA 2K01A 1JJ2A 1ENFA 1E2WA 3M7GA 1HCZA 1KAWA 3T1YL 3GO5A 3NE5B 2NVTB 3HOYB 2NZOA 1YNND 5IWAQ 1GUTA 5C0XJ 2RF4A 5E4WC 1BO0A 1CTMA 3BDCA 3TS0A 5AFWA 2NN6G 3U4VA 1XNRL 2Q2TA 4A3MB 2DNCA 4DV3L 5M9OA 2DJGC 4QUCA 3MAQA 4A3GB 4PZ6A 1JOKA 3PO3H 4DK6C 3TP7A 1ET9A 1OXTA 3KLRA 2KVMA 4H7BA 3R3OA 5IWAL 2Q8RE 2VL6A 2A69D 4JI6Q 1I6VC 3KF6A 3PO2H 2A74C 5ELOA 2RSOA 4ZRZA 3WOFA 4XQQA 1HA5A 2PNHA 2EY1A 4DR2Q 2KHJA 1Z47A 2FMMA 1GJXA 3GTOB 3E3XA 1TWHB 1NCVA 3BZDB 3J7AV 1Q1EA 1SE2A 1CT1D 3RNUA 4B3SQ 4R4IA 3HOVG 3VYTA 4A3JG 5T1GA 2OXPA 4IZ8A 4JI6L 5FK9C 4CJ0B 4IURA 1U9RA 1PH7A 3B6YA 4BS9A 5BN3A 3AFPA 1I5FA 3KJPA 4C1NI 1I6HB 3H0GG 1I50H 3CPFA 2LKVA 3F1ZA 3N52A 1LABA 3I72A 4B3SL 4IUUA 4FDBA 2BOSA 4OO1G 3GTLB 2IPKD 2OT2A 4E6IA 4HCEA 4G7HC 3IAYA 1SNOA 4IPGA 2MHVA 4OWTB 5M5YB 1LO5D 4KD3A 4LF6Q 3K6OA 2B63G 1H95A 1FL0A 3SXHA 1N34Q 5CV4A 2K14A 4BY7B 1PFMA 3GTKH 2UXCQ 4JI2Q 2AQ2B 2VW9A 1IL8A 2PMZB 1PFSA 4KHZA 3UDGA 1PFBA 1JE4A 1VDZA 4A3JH 1AN8A 3CPWA 3EN2A 1RTNA 1NR2A 4PV1C 3KBGA 4LF6L 3DEOA 3J81L 2E74C 4X65Q 4KKTA 2K5VA 3HOWH 3GTPH 2R7DA 1FJGQ 1IKMA 1LT6D 1HQMC 3H0GH 1N34L 2ID0A 2K5WA 3LGJA 2EPBA 2UXCL 4JI2L 1M1KC 3D4RA 5M3FG 3K58A 1KRSA 1BUVT 5IT9E 4K2LA 4A93B 1FGBD 3ITPA 3DWAA 4ZUJA 1F2MA 4OIJA 2F0DA 1D5MC 2CCZA 1YNNC 2B2WC 3OTOQ 4X65L 1K28A 1YJNA 1FJGL 1X9NA 3RZDB 4LK1C 5EPKA 4WFN3 2B63H 2CFMA 4J1MA 3PV0A 4FF1A 1V43A 1KC8C 1LT5D 4GOPA 1GUGA 3LWUA 1QNUA 2EY6A 2R7FA 4RGOS 2EYOA 2HIVA 5HGTA 1CA6A 3HG9A 3OTOL 5KGUA 1YIJA 3NWSA 2A69C 1WJJA 2K33A 2V1CC 2WKCA 1S4ZA 1PHJA 1MI2A 1MJEA 2KBNA 2Q8IB 1MHWC 2NVYH 2UUCQ 1YJWA 4IFDH 1HHVA 4A3IG 4PZ8A 1BDOA 1SR3A 3VR3A 1S5FD 1SN8A 1EY5A 4K14A 5FLXE 3CCLA 4FXKC 1ET6A 4Y7NB 4G57A 2JA7H 3PIOA 2PPBC 3RZOB 1A63A 4ZUIA 1WCMB 3KLSA 1A3VA 1E3PA 3I4NB 3PUWA 3MEHA 3FKIG 2ES2A 5EBCA 2UUCL 1CM9A 1I3QB 3PUVA 2Z6BA 4PZ7A 2J7ZA 5EKIA 3NTHA 1EL0A 1SMYD 1Y14B 3TP8A 1HR0Q 4JI5Q 5HURA 3KBXA 1HUNA 3AFQA 4FYDA 3P7JA 4C3HG 1PYBA 1VQHA 3H94A 3PGZA 4BY1B 4QY7A 4CBVA 5JEAG 3I73A 1QVFA 2EYFA 2F0FA 4DXFA 3EIVA 3KK7A 2OF1A 3I4OA 5FO7B 3CW2C 2VUMG 2WAQE 2PYKA 1STBA 2F0KA 1EUJA 2SNSA 1EOVA 4C2MH 2KQ3A 4KN7C 4X3UA 1MIUA 1E0BA 4JI5L 1N9WA 1HR0L 1VQ5A 2Z8LA 2JA6G 1E24A 2A1AA 3D31A 1X54A 1B1ZA 4A3IH 2PI2A 2EZVA 1LT4D 3RUZA 2PW5A 2Q2UA 4B9WA 1BOSA 3GTMH 5M3MB 4K2KA 2ZJPA 4XQJA 2ATWA 1RDPD 4ME5A 2JYOA 3Q23A 3S2HH 3RMHA 2F0VA 2JP1A 1B2TA 3FKIH 2ZXPA 3OOCA 5T1IA 1QJOA 1SNCA 1QUQB 3NTIA 5JPNC 3D4DA 3J81c 2ZT9C 1CFMA 4MN3A 3E9IA 3F8TA 1B4OA 2JJQA 2NYZD 2K5QA 4EQNA 2CVRA 1FD7D 2EY2A 3S16B 3TEHB 4BA1I 1B8AA 1G51A 5L37A 1J5EQ 4OELB 5JEAH 1O80A 3P1HA 1VQJA 4F87A 1XTDA 1EY7A 1ML0D 1CUKA 2KEEA 3NP8A 3K8AA 3G6EA 1ILPA 1M4VA 3HOUH 1T5EA 1D5XC 4BWGB 2JA6H 3DWPA 4OXPA 1F9RA 1FYCA 3E0EA 4DUZQ 5CBAE 1IBLQ 2K05A 3FEWX 1TWGB 5FKAC 1D7QA 4ZLTF 3TMEA 1L1OB 2SDFA 4OWXB 5K36G 1B9MA 2L5TA 4KI0A 4CDFC 1F2ZA 1GM5A 4DU9A 4QF4A 3LNNA 4P2CB 3CCMA 1BCPD 3LX0A 4IUQA 4LUZA 5E4XA 2IX0A 1TT2A 1C48A 4DUZL 3A0JA 1D5ZC 1IBLL 1I50B 1BCPF 1AE2A 3QR8A 4ZQ3A 2CWAA 4EX5A 4DFAA 2H4OA 2L11A 4C3JH 3NQIA 2O5JC 1CZWA 2PQEA 2M9VA 4HJ7A 3M3YH 1LLRD 3NK9A 3SGIA 1I4GA 2NN6I 3V2TA 2N49A 4YCUA 3SR1A 4UHVA 4AIMA 1BQQT 5BR8Q 3ERSX 1JWMD 3BZKA 2ZTEA 3PUYA 2IY5B 1SMYC 4KK7A 2DUDA 4KHPQ 5IYDG 1NR4A 3Q8DA 2WKDA 1EY6A 3R2IA 4C56C 1R4QB 1N33Q 4A3BG 1JJGA 4C1NK 4DGZA 1PH9A 3CRKC 2F03A 4KTAA 2HT1A 1G6PA 1GUWA 5M5XH 1Y1WH 1A8VA 2F0MA 2Z1CA 4JBJA 2NB0A 3UI2A 1NMFA 5BR8L 3HOVB 1OXVA 4KHPL 2A68D 4QMGA 3VYSA 3CF5A 1N33L 1PH8A 3K5MA 1EQRA 3AYHB 3U50C 2XNAC 4X6AH 2F52A 4A3EB 1VQPA 3DM1A 5CMDA 2K5DA 1Y69U 3GDEA 1PYWD 4CJ2C 1S5ED 1OTCA 1ICFB 1TWFB 5IYCH 4A75A 1YZ6A 3L7ZC 4XXEA 1HA6A 3U4ZA 1HZ9A 2E2HH 3HFZB 4HJAA 1NUCA 2KHSA 1X56A 4L5RC 5KYLA 2QCPX 3CCUA 2LSSA 1JR0D 2B63B 3SVMA 1H9RA 4GNXB 1VQ6A 4A3BH 4B08A 2GN5A 3A56A 3S2DB 2N3SA 5DM73 4H44C 4RAUC 1E1TA 1IYUA 1EYGA 4HIDA 2VB3X 3I2ZA 1O78A 1I4HA 4JOIA 3LWEA 4K5WA 1LTAD 1WTVA 4TSSA 4O0AA 2AQ3B 1V1OA 2UXBL 4EQOA 1YEZA 5FJ8G 1ZKOA 5IGCA 4RKLA 2EYPA 5DNFA 1PFNA 3S14H 3E0JA 2L1BA 4HIKA 3M4OB 5M3FB 4X3TA 5JVH3 4LF9L 4KKSA 3MZ5A 1VF5C 2AMCB 1VQGA 1BVSA 2HQLA 2PQAB 3P75A 2KECA 5C3EG 3J81E 1OO9B 4P72A 2KENA 5EPJA 2B8FA 1BCPC 4APVA 1WOCA 3M9BA 4MIUA 1ESFA 3EBEA 1PH6A 1XXGA 1E22A 3T56B 3S1NH 1HR0W 5D3DA 1WTPA 3J80L 1PMRA 1Q7YC 3OWFA 1JJCB 1KHIA 2D62A 2YTYA 2BA0A 3HKZE 5C0XI 2OQKA 1CKNB 2F3IA 2K5NA 5I6YA 4DR3Q 1DYQA 3UE1A 2NVXB 2B39A 3KUPA 3CMEA 2WB1G 4C2MB 1STNA 2B3GA 1PZKD 3A5ZB 4A3IB 2X6GA 3I4MB 3FMCA 4DV2L 1XPRA 2PO4A 1STEA 1V8QA 5FJ8H 3WDNA 1XTCD 4LF5Q 2EJMA 5C4ZA 3JAMi 1SYGA 5ELEA 4DR3L 1DOKA 2F0IA 1EQVA 3GV3A 4MTKA 1ENCA 4KY7A 5IGBA 1TS4A 3FKIB 2A68C 2IW3A 3ND9A 4JC0A 5C3EH 2A6HD 1X3GA 2KJXA 2BE5D 1V1PB 1Z9FA 1MKHA 4FP5D 3X3NA 3KDFB 4C3HB 5IE8A 4Q5VA 4LF5L 1QUQA 1YI2A 1H9SB 3AU7A 3PO3G 2HDLA 5LMNQ 2JA9A 2FMCA 3P20A 2VQEQ 1SROA 3KOJA 4CGYB 1ZYRD 1N36Q 1STAA 1JORA 3AB9A 1VQNA 2VUMB 3T1YQ 4JBWA 1J6QA 3HZXA 2ASBA 2NTSA 3PO2G 4JI7Q 1EQQA 2R92H 1VQEA 3A8JE 4QUFA 3RD4A 3OMCA 2YTXA 5LMNL 2VQEL 4KY6A 3M4QA 3A7LA 4OGQC 5IP9H 3W2DA 4RCNA 1A3TA 3DM3A 3HOXG 2EJGC 2PW7A 3D6CA 4DR7Q 4ME3A 2I0QA 2K4KA 1B3AA 3CQZH 4L6TB 1ONLA 3S1QB 4IPHA 3G4SA 1L1OA 4DAYB 4JI7L 5EGTA 3I8ZA 1L0YB 1VCIA 3PF5A 2OEOA 2R61A 1EWHA 3T4AC 2Y0SG 2A8VA 1UE5A 4DR7L 3M4YA 3TZDA 3RLNA 3GTGH 3S15B 2JA5G 1KDBA 2B2VC 1O7ZA 1QILA 1U4MA 2R93B 2PI2E 4PMCA 1H9JA 2K75A 4R4TA 4JI0Q 3GP7A 1JC7A 4HTHA 4LF7Q 4QIWB 5ELFA 2VS1A 2RHSB 1Y8NB 4ABNA 5JJIA 1E1OA 1JICA 4L8JA 2NVQB 2FINB 1ILQA 4XYQA 4NW2A 1MBYA 1SYEA 3K0YA 4AYBE
chains in the Genus database with same CATH topology
2E2JB 3T51B 1EY0A 1FNVA 4K6DA 2RDGA 3U9OA 2E2IB 2K1BA 3I3CA 3K5NA 1SFOB 1SJED 3MVVA 1TU2B 4LJZC 3CHBD 1LTSD 3NPPA 5JEAJ 1SYBA 1SNDA 2D2CC 2F0LA 1D1IA 5KNBA 1EFID 1JB3A 1F9PA 2NUCA 5A2QL 5I6WA 4XQNA 4OHJA 1IYVA 2A6HC 2EYJA 1TR5A 3MHBA 2BE5C 1DM0B 4QCLA 2B2YA 2QEJC 5IIFA 3HS0C 2PNRC 1TKWB 1TQOA 2IX1A 5COYA 4EQPA 1ZYRC 4ZKCB 1G91A 1EIGA 4DN4M 5CV9A 4G7ZC 2CHBD 2NTTA 2RSNA 3SK5A 1I4QA 4CKEA 4QB4A 4IFDG 2TSSA 3CRLC 3C46A 3S9WA 1SSOA 5LL6S 4ILWA 3K5OA 4DK0A 3S14B 5DEHA 2BDOA 3E5SA 2XVSA 4TKOB 1MD2D 2XWBB 4PNYA 3PUZA 1A3UA 1EQTA 1EU4A 2KA7A 1EZ8A 2FHTA 1TS2A 1EY4A 3H6MA 1CQFA 2EXZA 1BBXC 2G9HD 1AEXA 5E1FA 4XDXA 4KN4C 4U68A 1QCBD 3L3OC 4HSPA 4G4KA 2F0EA 4ID6A 3OIPA 2KUMA 3K5LA 1FR3A 2KOLA 1WTOA 1JCKB 4F7XA 3VA5A 1D6EC 2L55A 4KV6A 1EWCA 2F0SA 2B2UA 1SNPA 2O5IC 2YU9B 4ZKBB 4RFBA 1HUMA 1Q3LA 3T13A 2BDNA 3AMUA 4YIJA 1WTQA 2K28A 3ERQA 4XYOA 3T16A 1XYIA 2K7VA 3BYTB 3TP6A 1TVXA 4DK1A 3F2UA 3NTKA 3MA2B 3R93A 3BDOA 1OXSC 5I4DA 1G2TA 1AP0A 5KYIA 3FRPB 3KLSX 4ZAIA 1V1PA 2I46A 1Y8PB 3S1RB 1QE6A 4HMIA 2F0GA 2IWHA 2ICIA 1Q1BA 4LMQD 2IL8A 5IGEA 5C6AA 1KTKA 1F2LA 5C0XH 2ICEC 5CYUA 2WB1B 4V190 1EY9A 2R7ZB 1UAPA 3JAML 3PIP3 1BR9A 1K83B 1F2YA 2J0TD 3W3AA 4K6LA 3L9AX 3MWYW 1VMCA 3G6JB 3MFYA 3TBIB 5IODA 2R3ZA 3BVMA 2WV6D 1HTPA 1NAPA 3BS1A 5ELBA 4IN3A 4ODGA 5C3WA 2A6ED 3A55A 4HMJA 4RH6A 2QDBA 4DAVA 3Q22A 1IKLA 1J9OA 1CI3M 3DUZA 4DAYA 1EZ6A 5CV8A 4C3JG 4F88A 3PO3B 1BNZA 4K8JA 2LMCB 1C8CA 4O42A 1O7LA 2L4NA 4WORA 1M8AA 1X32A 2EE1A 1PTOF 2KEDA 2F0OA 3PO2B 1G6ZA 2NBFA 1E2VA 1QWYA 2K6AA 1S5BD 3Q0AA 5KIXA 2CW0C 3D3RA 3I4LA 1DOMA 2IX3A 3Q6SA 1B9NA 1JOQA 3H91A 1TY0A 5G3LD 3ND8A 4N9TA 5G3LF 4DA2A 3EJIA 2EYMA 2Y0SB 2AWOA 1G291 1RCVD 4J6HA 2B8GA 3VA7A 1DOLA 4UAIA 5EJWA 4HN7A 3IFTA 1LACA 4FNFA 4FXGC 2JSOA 1J8IA 4BA2I 1YNJD 3TSSA 2HDMA 3VYUA 3GTKB 3TDQA 2WIIB 5BN4A 4H0LC 4A3JB 3EA6A 2FFKB 2NZ1D 2AWNA 3HOWB 2F0JA 1X3QA 3GTPB 1ENAA 3H0GB 4CKCA 2B2WA 5FO8B 1ICWA 4ZK9B 4HCSA 1WTWA 2SNMA 2EYLA 3NHHA 3SDZA 3HEJA 2A6EC 3I91A 4KKUA 4KMUC 1E2ZA 1GUNA 4OO1I 5M5WB 1Q90A 3K57A 3VR6A 4FXDA 1O7YA 5CBEE 3OSOA 3MXPA 2F0WA 4DXGA 4K5VA 1PTOC 1U4LA 1ZXTA 3ONAB 1F77A 1TY2A 2KCCA 2NVYB 1BCPB 5KRUA 3DHQA 2I07B 2N88A 2FJ2A 4EVOA 5CC4A 3OWEB 1RKNA 2B2TA 4S3SA 3FVQA 3CU7A 3KF8A 2JA7B 1UNSA 1PRTF 1B50A 2R6GA 3R2TA 2XWJB 2WINB 1LTRD 3OHXC 1WTXA 1SYFA 2A5HA 4FVMA 5A35A 3BVGA 3O13A 1UUPA 2C9OA 2DNEA 4R8IA 1AFPA 3FPUB 3TN2A 5EKLA 2F3VA 5C5LA 2A73B 5I9PA 1H9MA 4PQXA 1QB5D 4IQZA 4MHEA 3A8KE 1Z6HA 1SNQA 1YNJC 3A54A 2JXMB 2YYZA 2IT1A 2SEBD 4RGMA 1PDQA 3GTMB 1EEID 1AZQA 1STYA 2Z4IA 3OPOA 2RQXA 3S2HB 4N9PA 2HQEA 5CV5A 2LS01 1QNKA 2XRQD 4XIGS 3U9SA 4CHTB 2E75C 5E3FA 5KNDA 2B2UC 5C5MA 3QG1A 3J7AF 1AZPA 3SK8A 2CQAA 3FPPA 1I4PA 1JQYD 1W6JA 4IFDJ 5EPLA 4CKBA 1JWUD 3HOUB 1HRJA 5ELDA 2LY7A 3CKIB 5JOBA 1HTLD 2C5CA 1NSNS 2JA6B 4FO2A 2LFNA 3SK4A 2D5DA 2Z4HA 4DAPA 1STGA 1KAAA 4G7OC 4FF3A 4C3IG 3BG3A 3D8GA 4NDXA 4K5XA 3H3VC 2XSCA 4RGTA 2JEBI 3JAME 1LT3D 1EYDA 2DY8A 2BCOA 1FNUA 1G2SA 2RVLA 1PRTC 1RHPA 2QKIC 4XT1B 3X3MA 1H9KA 5EBDA 4C3JB 5I2XA 3BYYB 1KLUD 3M3YB 1CZGA 5J1ZA 1WTRA 4FF2A 4TQUS 4A3FB 4DF7A 1A6XA 3NBHA 1CA5A 4PMWA 5JPMC 2AUKA 1C4QA 1D1KA 3QOJA 3Q24A 5EQ0A 3SHLA 5C44B 3MFGA 5M5XB 1SXTA 4HSVA 1Y1WB 5JAVA 1X3PA 1PXUA 3QB3A 1STHA 2EYHA 3RLFA 3EROA 4DNRB 4LAAA 3K59A 3VR4A 3I90A 1I4RA 2VB2X 2WACA 1F9QA 3NWTA 1SAPA 3URYA 5FO9B 1GHJA 1MGSA 3QOLA 4U673 4NMZA 1KNEA 1WVLA 1GUOA 1SYDA 1W6KA 2HCIA 2M00A 3GV6A 2SOBA 2E2HB 2RDHA 2GA4B 2G9DA 2F0UA 2NN6H 2RA4A 3N6RA 3D6WA 4XT3B 2F1MA 2D9UA 3R8BA 4A3BB 2O4XA 2RKSA 5J22A 1GXDC 3EVQA 1LTTD 5K5PA 1ESRA 1G8ZD 3MTSA 2F0TA 3DXJC 1DD2A 2DN8A 1HPCA 3SK6A 3VR5A 2HCCA 3MXUA 5CORA 1B53A 1PZJD 2MP1A 1PTOH 2EDGA 3TZUA 1SDFA 1SYCA 1FNWA 5TSSA 4HR7B 5IGDA 4RHRA 3S1NB 2CW0D 4NKLA 1EEFD 2F3WA 2L12A 4IUVA 4KJOA 4KJNA 4OO1H 1XX8A 1JOOA 4EGVA 5D65A 5C0XG 4R8NA 4X3SA 3C1FA 4F8MA 1RJTA 2L0CA 1HXYD 1EU3A 4OIKA 2L9HA 4HAEA 5ELCA 2EOTA 3DMUA 2WAQB 3PMFA 5JJZA 1KNAA 1MSGA 5J39A 3QO2A 1BF4A 4IUNA 2ZXOA 5C3EB 1SNMA 5D14A 1GUSA 2M2LA 3OW7A 4I7ZC 5DM63 2QILA 2MJ8A 3TP5A 2F0HA 4M8AA 1RF2D 4RKBA 2K03A 1WD1A 2TMPA 4WJWA 3A7AB 1H9SA 2B2TC 4HEDA 1CK1A 4WRDA 3ZYYX 1BXTA 2O2LD 1S5DD 3WOEA 2R92B 2N55A 2VNUD 3G7LA 4IALA 3J80E 4FF4A 3HGBA 1K8MA 4BBSB 1LV9A 3HP3A 1UEAB 1K8OA 4Q0FA 3CQZB 2PZUA 4RA8A 2B2VA 1JWSD 1PLFA 3DEPA 1RTOA 5D3IB 1A15A 3MXGA 3GTGB 1VF7A 1IW7D 1U4RA 4J8QA 4M1UB 2EY5A 1PTOD 3PIO3 2HUGA 1A2UA 5LL6X 1EOTA 4I65A 1VMPA 2MGSA 1CHQD 2V4DA 1QOHA 4C3IB 3HOXB 5I2YA 3HRZC 1HFGA 1I4XA 5FOBB 5LHY1 1L0XB 5IOCA 3C1EA 2MUYA 1MSHA 2AQ1B 3EQLC 2IJ0A 3NBIA 4JK1C 4ULLA 3SEBA 3NQTA 2XRSD 1DCZA 2JA5B 3IL8A 1SJHD 1ZEQX 1SE3A 1A2TA 4RWSC 4KD4A 2K32A 2E76C 3PUXA 2PCFB 2F0NA 2NWGA 5C4HA 5C4JB 4OL7A 1KDCA 1CHPD 2J4XA 2F0QA 1LTGD 2RDFA 5ISRA 4CJ1B 4DNTB 5DAUA 2JEAI 3GTJB 1TIID 5K36H 5IT9L 3MXNA 2EJFC 1KABA 3GQBA 3T53B 3FDTA 1KLGD 3S17B 1PTOB 3D4WA 5NUCA 1Y1VB 4V0BA 4B9XA 3BDLA 1SEBD 5KEEA 3VYRA 5BN5A 2WP8J 2QF7A 3GTQB 4BBRB 4K8IA 1IW7C 5CV6A 4IUPA 2PZTA 3K7AB 5A2QE 2EVBA 4TRDA 1LTBD 4IUTA 5CV7A 2ZXRA 3DWQA 2PZWA 3QIAA 3MC0B 5FLXL 1PRTD 4XTCS 4L63B 3HKZB 4IFDI 4X3KA 3NUCA 2K04A 3IFDA 2B2YC 1OXXK 1LTID 4KHVA 1II3A 3BVZA 4GZYC 1AW7A 3OMGA 1TWAB 4A3KB 4RHSA 3E6ZX 4A3DB 1D2BA 5I9OA 2JE6I 2MPMA 3J7YW 1R4PB 1TS5A 5KNCA 1DONA 3QJYA 5JVG3 2DY7A 1S5CD 4H13C 1IHZA 2X6LA 1EIHA 4O1NA 1SYEA 4RCOA 5C3XA 1SE4A 2VXWA 3C3LA 1OXUA 3S1MB 3SE0A 3NXWA 2BA1A 3QWNA 5F2DA 1GOZA 2ENBA 2F0PA 2KCNA 4NP5A 2X69A 1KDAA 2AUJD 4UDUC 5IGFA 3H09A 1WD0A 1EYAA 1TS3A 2H1EA 1PZID 1HFNA 1B44D 1U4PA 3A8IE 2XN9C 1EYCA 1Q12A 1RD9D 1RODA 1SBBB 4Z9CB 1QG7A 3V05A 3V96A 3GD7A 1GHKA 3M85A 3C2PA 2F4IA 5CGKA 1DJRD 5IGGA 1DZ1A 4KY5A 4PMBA 2XIWA 3I70A 3M7NA 3IKJA 5CR3A 1PRTB 3OIQA 1EY8A 1XWEA 3HOZB 3NSWA 4RGNA 4R9WA 2E2DC 1T5XD 1F9SA 1Z7TA 2JA8B 1R9TB 4ZYSA 1HQRD 5C4XB 3EFXD 1CQVA 2Q8TA 3VR2A 4AYBB 1TWCB 5EKKA 1Y8OB 1DXMA 2RBMA 1Q8IA 2K01A 1ENFA 1E2WA 3M7GA 1HCZA 3GO5A 3NE5B 2NVTB 3HOYB 1YNND 1GUTA 5C0XJ 5E4WC 1BO0A 1CTMA 3BDCA 5AFWA 2NN6G 4A3MB 2DNCA 5M9OA 4QUCA 3MAQA 4A3GB 1JOKA 3TP7A 1ET9A 1OXTA 3KLRA 2KVMA 4H7BA 3R3OA 2Q8RE 2A69D 1I6VC 2A74C 2RSOA 4ZRZA 3WOFA 4XQQA 1HA5A 2EY1A 1Z47A 2FMMA 1GJXA 3GTOB 1TWHB 1NCVA 3BZDB 3J7AV 1Q1EA 1SE2A 1CT1D 3VYTA 5T1GA 2OXPA 4IZ8A 5FK9C 4CJ0B 4IURA 1U9RA 4BS9A 5BN3A 4C1NI 1I6HB 2LKVA 3N52A 1LABA 3I72A 4IUUA 2BOSA 4OO1G 3GTLB 2IPKD 2OT2A 4E6IA 4HCEA 4G7HC 3IAYA 1SNOA 2MHVA 5M5YB 1LO5D 4KD3A 3K6OA 3SXHA 5CV4A 4BY7B 1PFMA 2AQ2B 1IL8A 2PMZB 4KHZA 1PFBA 1JE4A 1VDZA 1AN8A 1RTNA 1NR2A 4PV1C 3KBGA 3DEOA 3J81L 2E74C 4KKTA 1IKMA 1LT6D 1HQMC 2ID0A 2K5WA 2EPBA 3D4RA 3K58A 1BUVT 5IT9E 4K2LA 4A93B 1FGBD 3ITPA 3DWAA 4ZUJA 1F2MA 4OIJA 2F0DA 1D5MC 1YNNC 2B2WC 3RZDB 4LK1C 5EPKA 4WFN3 4J1MA 3PV0A 4FF1A 1V43A 1LT5D 1GUGA 3LWUA 1QNUA 2EY6A 4RGOS 2EYOA 5HGTA 1CA6A 3HG9A 5KGUA 3NWSA 2A69C 2K33A 2WKCA 1S4ZA 1MI2A 4IFDH 1HHVA 1BDOA 3VR3A 1S5FD 1EY5A 4K14A 5FLXE 4FXKC 1ET6A 4Y7NB 4G57A 2PPBC 3RZOB 4ZUIA 1WCMB 3KLSA 1A3VA 3I4NB 3PUWA 3MEHA 5EBCA 1CM9A 1I3QB 3PUVA 2J7ZA 5EKIA 3NTHA 1EL0A 1SMYD 3TP8A 5HURA 3KBXA 1HUNA 4FYDA 3P7JA 4C3HG 3H94A 4BY1B 4CBVA 5JEAG 3I73A 2EYFA 2F0FA 4DXFA 3KK7A 2OF1A 5FO7B 2PYKA 1STBA 2F0KA 2SNSA 2KQ3A 4KN7C 4X3UA 1E0BA 2Z8LA 3D31A 1B1ZA 2EZVA 1LT4D 3RUZA 2PW5A 4B9WA 1BOSA 5M3MB 4K2KA 4XQJA 1RDPD 4ME5A 2JYOA 3Q23A 3RMHA 2F0VA 2JP1A 1B2TA 2ZXPA 3OOCA 5T1IA 1QJOA 1SNCA 3NTIA 5JPNC 3D4DA 2ZT9C 1CFMA 4MN3A 1B4OA 2NYZD 4EQNA 2K5QA 2CVRA 1FD7D 2EY2A 3S16B 4BA1I 5JEAH 1O80A 3P1HA 4F87A 1EY7A 1ML0D 2KEEA 3NP8A 1ILPA 1M4VA 1T5EA 1D5XC 4BWGB 3DWPA 1F9RA 1FYCA 5CBAE 2K05A 3FEWX 1TWGB 5FKAC 4ZLTF 3TMEA 2SDFA 5K36G 1B9MA 2L5TA 4KI0A 1F2ZA 4DU9A 4QF4A 3LNNA 4P2CB 1BCPD 3LX0A 4IUQA 5E4XA 2IX0A 1TT2A 1C48A 1D5ZC 1I50B 1BCPF 4ZQ3A 4DFAA 2H4OA 2L11A 2O5JC 3NQIA 1CZWA 2PQEA 2M9VA 1LLRD 3NK9A 1I4GA 2NN6I 3V2TA 3SR1A 1BQQT 1JWMD 3PUYA 1SMYC 4KK7A 1NR4A 2WKDA 1EY6A 3R2IA 4C56C 1R4QB 4C1NK 4DGZA 3CRKC 2F03A 4KTAA 1GUWA 2F0MA 2Z1CA 2NB0A 3UI2A 3HOVB 1OXVA 2A68D 4QMGA 3VYSA 3K5MA 2XNAC 4A3EB 3DM1A 5CMDA 2K5DA 1Y69U 4CJ2C 1PYWD 1S5ED 1TWFB 4XXEA 3L7ZC 1HA6A 1NUCA 2KHSA 5KYLA 2QCPX 1JR0D 2B63B 3SVMA 1H9RA 4B08A 3A56A 3S2DB 5DM73 4H44C 4RAUC 1IYUA 2VB3X 1O78A 1I4HA 3LWEA 4K5WA 1LTAD 1WTVA 4TSSA 2AQ3B 1V1OA 4EQOA 1ZKOA 5IGCA 4RKLA 2EYPA 5DNFA 1PFNA 3E0JA 2L1BA 3M4OB 5M3FB 4X3TA 5JVH3 4KKSA 3MZ5A 1VF5C 3P75A 2KECA 3J81E 1OO9B 5EPJA 2B8FA 1BCPC 4MIUA 1ESFA 1XXGA 3T56B 5D3DA 1WTPA 3J80L 1PMRA 3OWFA 2D62A 2BA0A 5C0XI 5I6YA 1DYQA 2NVXB 2B39A 3KUPA 4C2MB 1STNA 1PZKD 4A3IB 2X6GA 3I4MB 3FMCA 2PO4A 1STEA 1V8QA 3WDNA 1XTCD 2EJMA 5C4ZA 1SYGA 5ELEA 1DOKA 2F0IA 1EQVA 3GV3A 1ENCA 4KY7A 5IGBA 1TS4A 3FKIB 2A68C 2IW3A 3ND9A 2A6HD 2KJXA 2BE5D 1V1PB 4FP5D 3X3NA 4C3HB 4Q5VA 1H9SB 3AU7A 2HDLA 2FMCA 3P20A 4CGYB 1ZYRD 1STAA 1JORA 3AB9A 2VUMB 4JBWA 3HZXA 2NTSA 3A8JE 4QUFA 3RD4A 3OMCA 4KY6A 3A7LA 4OGQC 3W2DA 4RCNA 1A3TA 2EJGC 2PW7A 3D6CA 1B3AA 4L6TB 1ONLA 3S1QB 5EGTA 3I8ZA 1L0YB 1VCIA 2OEOA 2R61A 1EWHA 3T4AC 3M4YA 3TZDA 3S15B 1KDBA 2B2VC 1O7ZA 1QILA 1U4MA 2R93B 4PMCA 1H9JA 3GP7A 1JC7A 4HTHA 4QIWB 5ELFA 1Y8NB 4ABNA 1JICA 4L8JA 2NVQB 2FINB 1ILQA 4XYQA 4NW2A 1MBYA 2Q8IB 3K0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T51 B;  1HPC A;  2K32 A;  3VR5 A;  1OXX K;  1CI3 M;  3MXU A;  1FYC A;  4OO1 G;  1H9M A;  2A68 C;  2PPB C;  2E76 C;  3HGB A;  3ND9 A;  4IQZ A;  1K8M A;  4TQU S;  4GZY C;  2A6H D;  1FR3 A;  1Z7T A;  4G7H C;  2BE5 D;  1H9R A;  3A8K E;  3PUX A;  1Z6H A;  1A6X A;  1YNJ C;  2PCF B;  3PUW A;  2LMC B;  5K36 G;  1B9M A;  1O7L A;  2EDG A;  2L5T A;  3TZU A;  2JXM B;  2YYZ A;  3PUV A;  4KI0 A;  2IT1 A;  1K8O A;  1TU2 B;  2AUK A;  4H44 C;  1H9S B;  1IYU A;  4LJZ C;  3VR2 A;  4HR7 B;  3LNN A;  3P20 A;  2JE6 I;  1Y8O B;  3SDZ A;  1DXM A;  2O5I C;  1O78 A;  2D2C C;  3H94 A;  1E2W A;  1E2V A;  1HCZ A;  2A6E C;  4KKU A;  3AB9 A;  3NE5 B;  4KMU C;  3OPO A;  5KNB A;  5KNC A;  5JEA G;  3QJY A;  1E2Z A;  2CW0 C;  3I72 A;  1GUN A;  3I73 A;  4KHZ A;  3I4L A;  4OO1 H;  3RLF A;  4H13 C;  1GUT A;  4JBW A;  1VDZ A;  4DNR B;  4PV1 C;  1Q90 A;  2O5J C;  4DNT B;  2K7V A;  3L7Z C;  1IYV A;  1CTM A;  1VF7 A;  2JEA I;  2A6H C;  1ZKO A;  4XIG S;  3A8J E;  1B9N A;  1IW7 D;  2NN6 G;  3VR6 A;  4DK1 A;  3U9S A;  2BE5 C;  5C0X G;  5K36 H;  2E74 C;  2NN6 I;  4KKT A;  3VR4 A;  2DNC A;  4KN7 C;  2EJF C;  5KND A;  3GQB A;  3A7L A;  1HQM C;  4OGQ C;  4KKS A;  4RCN A;  3T53 B;  3BDO A;  3D31 A;  1OXS C;  3ND8 A;  1VF5 C;  2PNR C;  3PUY A;  1OXU A;  1SMY C;  2EJG C;  1OXT A;  1TKW B;  3KLR A;  3QG1 A;  4KN4 C;  3SE0 A;  3D4R A;  3FPP A;  2BA1 A;  2KCC A;  1GHJ A;  2B8F A;  1ONL A;  1ZYR C;  2AWO A;  2A69 D;  4G7Z C;  1Y8P B;  1I6V C;  1G29 1;  2AUJ D;  3CRK C;  2B8G A;  1GUO A;  3VA7 A;  1Q1B A;  1YNN C;  2V4D A;  3T56 B;  1VCI A;  1EWH A;  5BN5 A;  4IFD G;  2QF7 A;  3IFT A;  3CRL C;  1PMR A;  2D5D A;  1LAC A;  2NN6 H;  3N6R A;  1GJX A;  3OOC A;  1IW7 C;  1OXV A;  2D62 A;  1QJO A;  4LK1 C;  5C0X H;  2BA0 A;  4G7O C;  3A8I E;  1Q1E A;  1GUS A;  2F1M A;  2R6G A;  3M4Y A;  2EVB A;  1CFM A;  2ZT9 C;  3BG3 A;  2A68 D;  3OW7 A;  1Q12 A;  3PV0 A;  1V43 A;  4DK0 A;  4I7Z C;  1GUG A;  3LWU A;  2BDO A;  3W3A A;  4BA2 I;  4BA1 I;  3GD7 A;  1GHK A;  3M85 A;  4TKO B;  1H9J A;  5A35 A;  3EQL C;  5JEA H;  3MFY A;  2JEB I;  3QIA A;  3FMC A;  3PUZ A;  4JK1 C;  5BN3 A;  2A69 C;  1Y8N B;  2KA7 A;  1HTP A;  2K33 A;  3A7A B;  1V8Q A;  1H9S A;  4XTC S;  1Y69 U;  3M7N A;  4L8J A;  1DCZ A;  3IKJ A;  2DNE A;  3WDN A;  4IFD H;  3DXJ C;  5BN4 A;  1DD2 A;  2EJM A;  4H0L C;  1BDO A;  2A6E D;  3VR3 A;  2Q8I B;  2E75 C;  2DN8 A;  1H9K A;  1LAB A;  1T5E A; 
#chains in the Genus database with same CATH topology
 3OYY A;  2E2J B;  4KLK A;  3T51 B;  1EY0 A;  1FNV A;  1S3O A;  4K6D A;  4C3I H;  4LF8 Q;  4QL5 A;  2RDG A;  3HOX H;  3U9O A;  3L0O A;  2E2I B;  4JI0 L;  2K1B A;  1Q81 C;  3I3C A;  3K5N A;  4LF7 L;  1SFO B;  1SJE D;  2VZA A;  3HOW G;  3MVV A;  1TU2 B;  3ULL A;  1N8R C;  1XMO Q;  1K3B C;  2EIF A;  4LJZ C;  3CHB D;  1LTS D;  3NPP A;  1Q82 C;  5JEA J;  1SYB A;  5IY0 A;  2I5L X;  1SND A;  2D2C C;  2F0L A;  4LF4 Q;  4LF8 L;  1D1I A;  5KNB A;  3RLO A;  2JA5 H;  5FLM H;  1EFI D;  1JB3 A;  1F9P A;  4L5S A;  2NUC A;  5A2Q L;  5I6W A;  4XQN A;  4NXN Q;  4OHJ A;  1IYV A;  2A6H C;  2EYJ A;  4DUY Q;  1XMO L;  1TR5 A;  3MHB A;  2BE5 C;  1DM0 B;  4QCL A;  2B2Y A;  3STB C;  4NXM Q;  2QEJ C;  3F2D A;  5IIF A;  3HS0 C;  4LF4 L;  2PNR C;  1TKW B;  4BBR G;  3KJO A;  1TQO A;  2IX1 A;  5COY A;  4EQP A;  1ZYR C;  4ZKC B;  4X62 Q;  1G91 A;  1EIG A;  4DN4 M;  4GNX A;  5CV9 A;  4G7Z C;  4NXN L;  2CHB D;  2NTT A;  5C4J H;  1AE3 A;  4DUY L;  2RSN A;  3SK5 A;  1I4Q A;  3W1G A;  1B7Y B;  4CKE A;  3PCO B;  4QB4 A;  4IFD G;  3UDX A;  2TSS A;  1EIY B;  3CRL C;  4NXM L;  3C46 A;  3S9W A;  1SSO A;  3BU2 A;  5LL6 S;  5DLQ E;  5JJL A;  3MXN B;  4ILW A;  3HKZ G;  2JA7 G;  3K5O A;  4DK0 A;  3GTJ H;  4P71 A;  3S14 B;  5DEH A;  4X62 L;  2BDO A;  3E5S A;  4HIO A;  2XVS A;  4TKO B;  1IBK Q;  1MD2 D;  2Z0S A;  3S17 H;  2XWB B;  4PNY A;  1O7I A;  3PUZ A;  1W2B A;  1A3U A;  1EQT A;  1EU4 A;  2KA7 A;  1PH5 A;  1EZ8 A;  4TVA B;  3BZC A;  2FHT A;  2E8G A;  1TS2 A;  1Y1V H;  1EY4 A;  1JMC A;  3H6M A;  1CQF A;  2EXZ A;  1BBX C;  2G9H D;  1K0S A;  4A3K G;  1T9H A;  1AEX A;  4A3D G;  5E1F A;  4XDX A;  1N32 Q;  4KN4 C;  5M5W H;  4U68 A;  1QCB D;  4JI8 Q;  3L3O C;  4HSP A;  4G4K A;  3KFU A;  2F0E A;  3GTQ H;  4ID6 A;  4BBR H;  1IBK L;  3OIP A;  2KUM A;  3K5L A;  2PMZ E;  1FR3 A;  2KOL A;  1WTO A;  1JCK B;  3K7A H;  4HJ5 A;  4F7X A;  3J80 i;  3VA5 A;  1D6E C;  1CKN A;  2L55 A;  4KV6 A;  1EWC A;  1N32 L;  1EIF A;  2F0S A;  3KF8 B;  2B2U A;  1SNP A;  1WI5 A;  4JI8 L;  2O5I C;  2QDL A;  5AJ3 L;  2YU9 B;  4ZKB B;  4RFB A;  1HUM A;  1Q3L A;  3T13 A;  2BDN A;  4UP8 A;  3AMU A;  4HJ9 A;  4YIJ A;  1WTQ A;  2K28 A;  3ERQ A;  4XYO A;  4A76 A;  3T16 A;  1XYI A;  2K7V A;  2KCT A;  3BYT B;  3TP6 A;  1TVX A;  5H1S E;  1Q86 C;  4DK1 A;  3F2U A;  2UU9 Q;  3NTK A;  3MA2 B;  1C7Y A;  3R93 A;  4JW0 A;  1L2F A;  3BDO A;  1OXS C;  5I4D A;  1GVP A;  1I94 Q;  1G2T A;  3WWV A;  1AP0 A;  5KYI A;  3FRP B;  4A3K H;  4DPG A;  3KLS X;  4A3D H;  4ZAI A;  1V1P A;  4YWK A;  2KHI A;  2I46 A;  1Y8P B;  4UPA A;  3S1R B;  1QE6 A;  4HMI A;  1WTH A;  2F0G A;  2IWH A;  2AKW B;  5LMN W;  2ICI A;  1Q1B A;  2UU9 L;  4GLV B;  4LMQ D;  2IL8 A;  5IGE A;  1KD1 C;  2JQO A;  5C6A A;  1KTK A;  4R4C A;  3HOU G;  4B3R Q;  1F2L A;  5C0X H;  2ICE C;  5CYU A;  2WB1 B;  1I94 L;  4V19 0;  1AH9 A;  4RG1 A;  1EY9 A;  2R7Z B;  1UAP A;  3JAM L;  3PIP 3;  1BR9 A;  1K83 B;  1YIT A;  2Q2I A;  1GD7 A;  1F2Y A;  2J0T D;  2OCE A;  1PA6 A;  3W3A A;  4K6L A;  1KIX A;  1PH1 A;  4ALP A;  3L9A X;  3MWY W;  1X6O A;  1VMC A;  3G6J B;  3HOZ G;  4MNO A;  3MFY A;  3TBI B;  5IOD A;  2QA4 A;  2R3Z A;  3BVM A;  2WV6 D;  3S1M H;  1HTP A;  1NAP A;  2YTV A;  3RR5 A;  4B3R L;  3BS1 A;  4L5Q A;  5ELB A;  1PH4 A;  3KYH C;  1SE8 A;  4IN3 A;  4ODG A;  5C3W A;  4YCV A;  2A6E D;  3A55 A;  4HMJ A;  1KQS A;  4RH6 A;  2QDB A;  2HD3 A;  4DAV A;  3Q22 A;  1EFW A;  1IKL A;  1J9O A;  1CI3 M;  3DUZ A;  4AYB G;  4DAY A;  3JC6 6;  1EZ6 A;  5CV8 A;  4C3J G;  4F88 A;  3PO3 B;  1BNZ A;  4O2D A;  4K8J A;  2LMC B;  1C8C A;  4O42 A;  1O7L A;  3CCQ A;  4A3F G;  3H3V H;  4LNQ A;  2L4N A;  4WOR A;  1M8A A;  1X32 A;  1B3Q A;  2EE1 A;  1VQF A;  1PTO F;  2CKZ B;  2KED A;  1VQA A;  1XMQ Q;  2F0O A;  3PO2 B;  1G6Z A;  4A3M G;  2NBF A;  3OW2 A;  1E2V A;  1QWY A;  2K6A A;  4JBM A;  1S5B D;  3D0F A;  3Q0A A;  5KIX A;  2CW0 C;  1HZA A;  3D3R A;  3I4L A;  3KLW A;  5C44 G;  1DOM A;  1CSP A;  2IX3 A;  1Y1W G;  3Q6S A;  1BBW A;  4YCW A;  3HOZ H;  1B9N A;  2OTJ A;  1JOQ A;  2BH8 A;  3H91 A;  1YVC A;  1TY0 A;  2ALY B;  5G3L D;  1XMQ L;  2Z6K C;  1R9T H;  1KXL A;  3ND8 A;  4N9T A;  5G3L F;  5C4X H;  4POF A;  1ASZ A;  3NEN A;  4DA2 A;  1UE6 A;  3EJI A;  2EYM A;  2Y0S B;  2AWO A;  2N78 A;  4DR5 Q;  1G29 1;  1RCV D;  4J6H A;  2B8G A;  3VA7 A;  1DOL A;  4UAI A;  5EJW A;  1GKH A;  1NBW A;  3IFT A;  3NBH B;  4HN7 A;  1VQ9 A;  1LAC A;  2NVT H;  3HOY H;  3NEL A;  5IYC G;  4A3F H;  4FNF A;  5GAE C;  3UE0 A;  2K5H A;  2JSO A;  3PQI A;  4FXG C;  1J8I A;  4DR5 L;  4A3M H;  4BA2 I;  1YNJ D;  1LTL A;  4GKK Q;  3TSS A;  2JK8 A;  1VQK A;  4A3G H;  2Z9H A;  2HDM A;  3VYU A;  1U0L A;  3GTK B;  3TDQ A;  5C44 H;  2WII B;  3S24 A;  2YV5 A;  5BN4 A;  4H0L C;  4A3J B;  3EA6 A;  1PH3 A;  1QZG A;  2FFK B;  3ULJ A;  4DV6 Q;  1LM0 A;  2LXK A;  4GKK L;  2NZ1 D;  2AWN A;  3HOW B;  2F0J A;  1X3Q A;  3CCR A;  3GTP B;  4L5T A;  3GTO H;  1TWH H;  3JAM c;  3AEV A;  1ENA A;  3H0G B;  4CKC A;  2B2W A;  5FO8 B;  4BY7 G;  1ICW A;  1YNX A;  2QW7 A;  4ZK9 B;  4N8F A;  2RCN A;  4HCS A;  4DV7 Q;  1VQ4 A;  1WTW A;  2SNM A;  2EYL A;  3NHH A;  3SDZ A;  3HEJ A;  4DV6 L;  4A3C H;  1IBM Q;  2VQF Q;  2A6E C;  3I91 A;  4KKU A;  4KMU C;  3DLL A;  1I6H H;  3CCV A;  1E2Z A;  1GUN A;  3PSI A;  4OO1 I;  5M5W B;  1Q90 A;  3K57 A;  4A93 G;  3VR6 A;  2UXB Q;  4FXD A;  3CCJ A;  1O7Y A;  5CBE E;  4DV7 L;  3GTL H;  3OSO A;  3MXP A;  3CC2 A;  2F0W A;  4DXG A;  4K5V A;  1IBM L;  1PTO C;  1U4L A;  2VQF L;  2UUB Q;  5M5Y H;  4LFB Q;  1ZXT A;  4LF9 Q;  3ONA B;  3F2C A;  1C0A A;  1F77 A;  1TY2 A;  2KCC A;  2NVY B;  1BCP B;  5KRU A;  3DHQ A;  2I07 B;  2N88 A;  2FJ2 A;  4EVO A;  1Q8K A;  5CC4 A;  1EWI A;  1QVC A;  3OWE B;  1RKN A;  4BY7 H;  2B2T A;  4S3S A;  3FVQ A;  3CU7 A;  3KF8 A;  2JA7 B;  1UNS A;  1PRT F;  1B50 A;  2WAQ G;  2UUB L;  3M4P A;  4LFB L;  2N8N A;  2R6G A;  3R2T A;  2XWJ B;  3UDI A;  1P16 A;  2WIN B;  4P75 A;  4GLX A;  1LTR D;  3OHX C;  1WFQ A;  1WTX A;  1SYF A;  1CSQ A;  2A5H A;  1NTG A;  1XPO A;  1V9P A;  4FVM A;  4IPD A;  5A35 A;  3BVG A;  3O13 A;  1UUP A;  1WCM G;  4DV2 Q;  4A93 H;  2C9O A;  2DNE A;  4R8I A;  1S72 A;  3I4N G;  1AFP A;  3FPU B;  3TN2 A;  1BBU A;  5EKL A;  2F3V A;  5C5L A;  2A73 B;  2MO1 A;  4B3M Q;  5I9P A;  1H9M A;  4PQX A;  1QB5 D;  4IQZ A;  1YJ9 A;  3RZD H;  4MHE A;  2R92 G;  1NNX A;  3A8K E;  4BY1 G;  1Z6H A;  1SNQ A;  1YNJ C;  3A54 A;  1YHQ A;  2VY3 A;  4H02 A;  2JXM B;  2YYZ A;  2IT1 A;  4BBS G;  5IP9 G;  2SEB D;  2AHO B;  4RGM A;  4LFC Q;  1S40 A;  1PDQ A;  1HJP A;  3GTM B;  1EEI D;  1AZQ A;  1P8L A;  1STY A;  4B3M L;  2Z4I A;  3TQY A;  1HNX Q;  3OPO A;  2RQX A;  2HIX A;  2D0P A;  4N9P A;  2HQE A;  3S2H B;  4GOP C;  4DAM A;  5CV5 A;  3H15 A;  2LS0 1;  4CDC C;  4LUV A;  1QNK A;  4GKJ Q;  2XRQ D;  4XIG S;  1W3S A;  2XGT A;  3STB D;  3U9S A;  1RL2 A;  4CHT B;  4LFC L;  4Y7N H;  2E75 C;  4YY3 Q;  5E3F A;  2CH4 W;  3RZO H;  5KND A;  1IXR A;  1WCM H;  3I7F A;  1CKM A;  2B2U C;  5C5M A;  1HNX L;  3I4N H;  3QG1 A;  3J7A F;  1AZP A;  3T1H Q;  3SK8 A;  2CQA A;  3FPP A;  1I3Q H;  1I4P A;  3NEM A;  1JQY D;  1W6J A;  4UP7 A;  4IFD J;  1UE7 A;  5EPL A;  4CKB A;  4GKJ L;  1JWU D;  3HOU B;  1HRJ A;  5ELD A;  2LY7 A;  3CKI B;  5JOB A;  1HTL D;  2C5C A;  1NSN S;  2JA6 B;  3J81 j;  4DV5 Q;  4YY3 L;  4BY1 H;  4FO2 A;  2LFN A;  2H5X A;  3SK4 A;  2D5D A;  5IYB H;  4JPB W;  2Z4H A;  1L0W A;  1STG A;  4DAP A;  1KAA A;  4BBS H;  4G7O C;  4FF3 A;  3T1H L;  4C3I G;  3BG3 A;  5ELN A;  3D8G A;  4NDX A;  4K5X A;  3H3V C;  1DGS A;  2XSC A;  5HGQ A;  4RGT A;  3FHW A;  2JEB I;  4DV5 L;  4WJ3 M;  1FVI A;  4LUO A;  3JAM E;  1LT3 D;  2GVA A;  2HHH Q;  3BJU A;  1EYD A;  2DY8 A;  2Q2H A;  4JG2 A;  2BCO A;  1FNU A;  4UP9 A;  1G2S A;  2RVL A;  1PRT C;  1RHP A;  5M3M H;  2QKI C;  1VQC A;  4XT1 B;  5E7N A;  3X3M A;  1H9K A;  5EBD A;  4C3J B;  5GAG C;  3BYY B;  5I2X A;  1YBY A;  1KLU D;  3M3Y B;  1CZG A;  5J1Z A;  1WTR A;  4FF2 A;  5FLM G;  4GLA C;  4LFA L;  4TQU S;  4A3F B;  4DF7 A;  3I56 A;  3ZJY C;  3CMA A;  2HHH L;  1A6X A;  1U5K A;  3NBH A;  1CA5 A;  4PMW A;  2MQH A;  5JPM C;  3K0X A;  2AUK A;  3S16 H;  1C4Q A;  1MJC A;  4I7A A;  1D1K A;  1VQO A;  2K50 A;  4YWM A;  3QOJ A;  3FP9 A;  4IJH A;  3Q24 A;  5EQ0 A;  3SHL A;  3J80 c;  5C44 B;  3MFG A;  5M5X B;  1SXT A;  4HSV A;  1Y1W B;  5JAV A;  1K3R A;  1X3P A;  1PXU A;  3QB3 A;  1STH A;  4CDD C;  2EYH A;  3RLF A;  3ERO A;  4DNR B;  4LAA A;  3K59 A;  3VR4 A;  2P5Z X;  1HNW Q;  1TWG H;  1VQ7 A;  4GN3 B;  3I90 A;  1K0R A;  1I4R A;  2VB2 X;  3HKS A;  2WAC A;  1F9Q A;  3NWT A;  4PG3 A;  1FGU A;  4GS3 A;  1SAP A;  3URY A;  5FO9 B;  1GHJ A;  1GO3 E;  1MGS A;  2CQO A;  3QOL A;  4U67 3;  1K8G A;  4A3L G;  4NMZ A;  1KNE A;  1WVL A;  1GUO A;  4DR2 L;  1SYD A;  1TXY A;  4K0K Q;  1W6K A;  1Y1V G;  2HCI A;  4EQ5 A;  2M00 A;  3GV6 A;  2SOB A;  2ZTC A;  2E2H B;  2ZTD A;  4QIW E;  2ZM6 Q;  2RDH A;  1HNW L;  4GN5 A;  2GA4 B;  2G9D A;  4ZCK A;  2F0U A;  2NN6 H;  2RA4 A;  3N6R A;  4A3E G;  3D6W A;  4XT3 B;  2F1M A;  2D9U A;  5JJK A;  3R8B A;  4A3B B;  2O4X A;  1V1Q A;  2RKS A;  5J22 A;  1GXD C;  3EVQ A;  1KRT A;  1LTT D;  5K5P A;  2JN4 A;  4K0K L;  2ZM6 L;  3CCE A;  1ESR A;  1G8Z D;  3MTS A;  2F0T A;  3DXJ C;  5GQO A;  1DD2 A;  4J15 A;  2DN8 A;  3L2P A;  1X3E A;  1HPC A;  3SK6 A;  3VR5 A;  3CC4 A;  2HCC A;  4QQB X;  3MXU A;  5COR A;  1B53 A;  3HOV H;  1PZJ D;  2B29 A;  1WYD A;  4BXX G;  2MP1 A;  1PTO H;  4A3L H;  1IL2 A;  2EDG A;  3TZU A;  1K9M C;  1SDF A;  1SYC A;  2MO0 A;  1FNW A;  5TSS A;  4HR7 B;  2PQA A;  2A19 A;  4DR6 Q;  5IGD A;  1UEB A;  4A3E H;  4RHR A;  1JT8 A;  3S1N B;  2CW0 D;  4NKL A;  1EEF D;  2LXJ A;  2F3W A;  4OEM B;  2L12 A;  5AJ3 Q;  4IUV A;  4KJO A;  4KJN A;  4OO1 H;  1TWF H;  1XX8 A;  4B3T Q;  3PIP A;  4DV4 Q;  1JOO A;  4EGV A;  5D65 A;  4LW1 A;  3AQQ A;  3CP0 A;  4A4I A;  5C0X G;  4R8N A;  1HNZ Q;  1JB7 A;  3A5U A;  4DR6 L;  4X3S A;  1YHB A;  3C1F A;  4F8M A;  1VQI A;  1RJT A;  4AH6 A;  3S2D H;  2L0C A;  1HXY D;  1EU3 A;  4OIK A;  2IHE A;  4B3T L;  4DR4 Q;  2L9H A;  4HAE A;  5ELC A;  4DV4 L;  2EOT A;  3DMU A;  2WAQ B;  3PMF A;  5JJZ A;  1KNA A;  2L15 A;  1MSG A;  3A74 A;  5J39 A;  3QO2 A;  1BF4 A;  1HNZ L;  2MFI A;  4IUN A;  4BXX H;  2ZXO A;  3I4M G;  5C3E B;  4P74 A;  3K7U C;  1SNM A;  5D14 A;  1A62 A;  1GUS A;  2M2L A;  3OW7 A;  2G5D A;  4JVZ A;  2OWO A;  4IOA A;  2RHQ B;  1TWA H;  4I7Z C;  2ZJQ A;  4JOI C;  4DR4 L;  5DM6 3;  2QIL A;  2MJ8 A;  3M4O H;  5M3F H;  1VQL A;  3CAM A;  3TP5 A;  1HZB A;  2F0H A;  4WJ4 A;  4M8A A;  1RF2 D;  4RKB A;  1D8L A;  2K03 A;  2F4V Q;  1UWV A;  3KDF A;  1WD1 A;  2TMP A;  4WJW A;  3VDY A;  3G71 A;  1C9O A;  3A7A B;  4NB3 A;  1H9S A;  2B2T C;  4HED A;  1CK1 A;  4WRD A;  3ZYY X;  1BXT A;  2O2L D;  1S5D D;  3WOE A;  1PYS B;  2R92 B;  2N55 A;  4Y52 H;  2UUA Q;  2VNU D;  3G7L A;  4IAL A;  3J80 E;  4FF4 A;  4UY8 C;  3HGB A;  1K8M A;  2F4V L;  4BBS B;  1A0I A;  1LV9 A;  3HP3 A;  1UEA B;  4QJF A;  2NVX H;  1K8O A;  4Q0F A;  3CQZ B;  2JA8 G;  2DJF C;  4HJ8 A;  1NMG A;  4DV0 Q;  5J3B A;  1XJV A;  2PZU A;  5C4X G;  4RA8 A;  3I4M H;  2B2V A;  4JV5 Q;  2UUA L;  2ZJR A;  3IRB A;  1JWS D;  1PLF A;  2CH4 A;  3DEP A;  1RTO A;  4IPC A;  1E7Z A;  1K8A C;  5D3I B;  1A15 A;  3MXG A;  1XNQ Q;  3GTG B;  1VF7 A;  4JI3 Q;  1XPU A;  1IW7 D;  3HOY G;  2RCF A;  4DV0 L;  1U4R A;  4J8Q A;  4M1U B;  2EY5 A;  1PTO D;  1NY4 A;  1SLJ A;  3PIO 3;  4JV5 L;  2HUG A;  1A2U A;  5LL6 X;  2WB1 E;  4C3H H;  4R1J A;  1EOT A;  4I65 A;  4A3G G;  1VMP A;  2MGS A;  4DK3 C;  1CHQ D;  1XNQ L;  4JI3 L;  2V4D A;  4QGU A;  1QOH A;  4C3I B;  2R93 G;  3TRE A;  2EQS A;  3HOX B;  4MZ9 A;  5I2Y A;  3HRZ C;  2VUM H;  1HFG A;  1I4X A;  4IOC A;  2JA8 H;  5FOB B;  2GVB A;  2EXD A;  5LHY 1;  1L0X B;  5IOC A;  3C1E A;  1J5E L;  4OX9 Q;  2MUY A;  1MSH A;  2AQ1 B;  3EQL C;  2IJ0 A;  1TWC H;  3NBI A;  4JK1 C;  4N8X 1;  3W1B A;  1LYL A;  4ULL A;  3SEB A;  3NQT A;  3CXC A;  2XRS D;  1DCZ A;  3S1Q H;  2JA5 B;  1NE3 A;  1SJH D;  3IL8 A;  4GN4 B;  4A3C G;  1ZEQ X;  2OQ0 A;  4X66 Q;  1SE3 A;  1A2T A;  4RWS C;  4YHH Q;  4KD4 A;  2K32 A;  1NJI C;  4OX9 L;  4HIM A;  2UXD Q;  2E76 C;  1HZC A;  1CKO A;  4R4Q A;  1QVG A;  1L1O C;  3PUX A;  3E9H A;  3K80 C;  2PCF B;  1M90 C;  3S15 H;  1HH2 P;  3KF6 B;  2F0N A;  2NWG A;  3TS2 A;  4X66 L;  2QEX A;  2R93 H;  5C4H A;  4YHH L;  4YWL A;  5C4J B;  4OL7 A;  1KDC A;  5HY6 A;  4JYA Q;  2UXD L;  2IHF A;  4IO9 A;  4OON A;  4OWW B;  1CHP D;  2J4X A;  3G48 A;  2F0Q A;  2NVQ H;  5EAY A;  1LTG D;  2RDF A;  2Y0S E;  1PH2 A;  5ISR A;  1Q46 A;  4CJ1 B;  4DNT B;  2E2J H;  5DAU A;  1RIP A;  4X64 Q;  2JEA I;  3GTJ B;  1TII D;  5K36 H;  1UE1 A;  2E2I H;  5IT9 L;  3MXN A;  2EJF C;  1KAB A;  3GQB A;  4JYA L;  3T53 B;  3FDT A;  1KLG D;  3TRZ A;  3S17 B;  1PTO B;  5GAD C;  3J7A 5;  3D4W A;  5NUC A;  1SFO H;  2C35 B;  1SRU A;  3W5O A;  1Y1V B;  1IZ6 A;  4V0B A;  4X64 L;  4B9X A;  3BDL A;  3RN2 A;  3J81 i;  1SEB D;  5KEE A;  3VYR A;  5BN5 A;  2WP8 J;  3CD6 A;  2QF7 A;  3GTQ B;  4BBR B;  4K8I A;  1IW7 C;  3U58 A;  5CV6 A;  4IUP A;  4NPS A;  1VQM A;  2E5L Q;  2PZT A;  3K7A B;  5A2Q E;  2EVB A;  4JBK A;  2XTI A;  4TRD A;  1LTB D;  4IUT A;  2I5M X;  5CV7 A;  3ER0 A;  2ZXR A;  3CCS A;  4DNI A;  5IYD H;  3DWQ A;  2PZW A;  3QIA A;  3MC0 B;  2MNA A;  5FLX L;  1PRT D;  4XTC S;  4L63 B;  3HKZ B;  1PVO A;  2E5L L;  4IFD I;  4X3K A;  3NUC A;  2K04 A;  3IFD A;  2B2Y C;  4JCV E;  1OXX K;  1LTI D;  4KHV A;  1II3 A;  3MEF A;  1IYJ B;  2QGQ A;  3BVZ A;  4GZY C;  4GNX C;  1AW7 A;  3OMG A;  1VS0 A;  1TWA B;  4JI4 Q;  4LWC A;  4RHS A;  3E6Z X;  3ULP A;  4A3K B;  1BKB A;  1VQB A;  4A3D B;  1QZH A;  1D2B A;  5I9O A;  2JE6 I;  2MPM A;  3J7Y W;  2FXQ A;  1X55 A;  2NZH A;  1R4P B;  1TS5 A;  2BH2 A;  4DR1 Q;  5KNC A;  1DON A;  3QJY A;  5JVG 3;  2DY7 A;  1S5C D;  4GOP B;  4H13 C;  3RN5 A;  1IHZ A;  4JI4 L;  2X6L A;  1EIH A;  3J7Z C;  5IYB G;  4O1N A;  4DV1 Q;  2D0O A;  5LMU Q;  4RCO A;  4CDE C;  5C3X A;  1SE4 A;  1VQ8 A;  2VXW A;  3C3L A;  1OXU A;  3ICE A;  4AQY Q;  3S1M B;  3SE0 A;  4DR1 L;  3K81 C;  3NXW A;  2BA1 A;  2WFW A;  3QWN A;  5F2D A;  1GOZ A;  1ASY A;  2ENB A;  2F0P A;  2KCN A;  2R7Z G;  4NP5 A;  2X69 A;  1JE5 A;  1KDA A;  2CWP A;  3F2B A;  2AUJ D;  2YU9 H;  4DV1 L;  4UDU C;  5IGF A;  5IP7 G;  1X3F A;  5LMU L;  1YHA A;  3H09 A;  4P73 A;  1WD0 A;  5GAH C;  1EYA A;  1TS3 A;  2H1E A;  4JI1 Q;  5M3M G;  1PZI D;  1HFN A;  4DKA C;  1PV4 A;  4AQY L;  4MTN A;  1B44 D;  1U4P A;  3A8I E;  2XN9 C;  1EYC A;  4POG A;  3UDF A;  4RMF A;  1KL9 A;  1Q12 A;  1RD9 D;  1ROD A;  1SBB B;  4Z9C B;  5IT9 c;  3CC7 A;  1QG7 A;  3V05 A;  3V96 A;  3GD7 A;  1GHK A;  3M85 A;  3C2P A;  2DGY A;  2F4I A;  4R4O A;  5CGK A;  1DJR D;  5IGG A;  1DZ1 A;  3PF4 A;  1B70 B;  5GRO A;  4KY5 A;  4PMB A;  1LUZ A;  4JI1 L;  2XIW A;  3I70 A;  3H3V I;  3M7N A;  3IKJ A;  5CR3 A;  2Z6K A;  4IJL A;  1PRT B;  1SMX A;  3OIQ A;  1EY8 A;  3S1R H;  2I5H A;  1XWE A;  3HOZ B;  3NSW A;  4RGN A;  4R9W A;  2E2D C;  1T5X D;  1K73 C;  1F9S A;  1Z7T A;  2JA8 B;  4LFA Q;  1R9T B;  1VQD A;  4ZYS A;  2R7Z H;  1HQR D;  5C4X B;  3EFX D;  1CQV A;  2Q8T A;  1K83 H;  2K52 A;  2KCM A;  3I55 A;  3VR2 A;  4AYB B;  1XNR Q;  5IP7 H;  5FLX c;  2OTL A;  1TWC B;  5EKK A;  1Y8O B;  1N36 L;  1X65 A;  1DXM A;  4DV3 Q;  2RBM A;  1Q8I A;  2K01 A;  1JJ2 A;  1ENF A;  1E2W A;  3M7G A;  1HCZ A;  1KAW A;  3T1Y L;  3GO5 A;  3NE5 B;  2NVT B;  3HOY B;  2NZO A;  1YNN D;  5IWA Q;  1GUT A;  5C0X J;  2RF4 A;  5E4W C;  1BO0 A;  1CTM A;  3BDC A;  3TS0 A;  5AFW A;  2NN6 G;  3U4V A;  1XNR L;  2Q2T A;  4A3M B;  2DNC A;  4DV3 L;  5M9O A;  2DJG C;  4QUC A;  3MAQ A;  4A3G B;  4PZ6 A;  1JOK A;  3PO3 H;  4DK6 C;  3TP7 A;  1ET9 A;  1OXT A;  3KLR A;  2KVM A;  4H7B A;  3R3O A;  5IWA L;  2Q8R E;  2VL6 A;  2A69 D;  4JI6 Q;  1I6V C;  3KF6 A;  3PO2 H;  2A74 C;  5ELO A;  2RSO A;  4ZRZ A;  3WOF A;  4XQQ A;  1HA5 A;  2PNH A;  2EY1 A;  4DR2 Q;  2KHJ A;  1Z47 A;  2FMM A;  1GJX A;  3GTO B;  3E3X A;  1TWH B;  1NCV A;  3BZD B;  3J7A V;  1Q1E A;  1SE2 A;  1CT1 D;  3RNU A;  4B3S Q;  4R4I A;  3HOV G;  3VYT A;  4A3J G;  5T1G A;  2OXP A;  4IZ8 A;  4JI6 L;  5FK9 C;  4CJ0 B;  4IUR A;  1U9R A;  1PH7 A;  3B6Y A;  4BS9 A;  5BN3 A;  3AFP A;  1I5F A;  3KJP A;  4C1N I;  1I6H B;  3H0G G;  1I50 H;  3CPF A;  2LKV A;  3F1Z A;  3N52 A;  1LAB A;  3I72 A;  4B3S L;  4IUU A;  4FDB A;  2BOS A;  4OO1 G;  3GTL B;  2IPK D;  2OT2 A;  4E6I A;  4HCE A;  4G7H C;  3IAY A;  1SNO A;  4IPG A;  2MHV A;  4OWT B;  5M5Y B;  1LO5 D;  4KD3 A;  4LF6 Q;  3K6O A;  2B63 G;  1H95 A;  1FL0 A;  3SXH A;  1N34 Q;  5CV4 A;  2K14 A;  4BY7 B;  1PFM A;  3GTK H;  2UXC Q;  4JI2 Q;  2AQ2 B;  2VW9 A;  1IL8 A;  2PMZ B;  1PFS A;  4KHZ A;  3UDG A;  1PFB A;  1JE4 A;  1VDZ A;  4A3J H;  1AN8 A;  3CPW A;  3EN2 A;  1RTN A;  1NR2 A;  4PV1 C;  3KBG A;  4LF6 L;  3DEO A;  3J81 L;  2E74 C;  4X65 Q;  4KKT A;  2K5V A;  3HOW H;  3GTP H;  2R7D A;  1FJG Q;  1IKM A;  1LT6 D;  1HQM C;  3H0G H;  1N34 L;  2ID0 A;  2K5W A;  3LGJ A;  2EPB A;  2UXC L;  4JI2 L;  1M1K C;  3D4R A;  5M3F G;  3K58 A;  1KRS A;  1BUV T;  5IT9 E;  4K2L A;  4A93 B;  1FGB D;  3ITP A;  3DWA A;  4ZUJ A;  1F2M A;  4OIJ A;  2F0D A;  1D5M C;  2CCZ A;  1YNN C;  2B2W C;  3OTO Q;  4X65 L;  1K28 A;  1YJN A;  1FJG L;  1X9N A;  3RZD B;  4LK1 C;  5EPK A;  4WFN 3;  2B63 H;  2CFM A;  4J1M A;  3PV0 A;  4FF1 A;  1V43 A;  1KC8 C;  1LT5 D;  4GOP A;  1GUG A;  3LWU A;  1QNU A;  2EY6 A;  2R7F A;  4RGO S;  2EYO A;  2HIV A;  5HGT A;  1CA6 A;  3HG9 A;  3OTO L;  5KGU A;  1YIJ A;  3NWS A;  2A69 C;  1WJJ A;  2K33 A;  2V1C C;  2WKC A;  1S4Z A;  1PHJ A;  1MI2 A;  1MJE A;  2KBN A;  2Q8I B;  1MHW C;  2NVY H;  2UUC Q;  1YJW A;  4IFD H;  1HHV A;  4A3I G;  4PZ8 A;  1BDO A;  1SR3 A;  3VR3 A;  1S5F D;  1SN8 A;  1EY5 A;  4K14 A;  5FLX E;  3CCL A;  4FXK C;  1ET6 A;  4Y7N B;  4G57 A;  2JA7 H;  3PIO A;  2PPB C;  3RZO B;  1A63 A;  4ZUI A;  1WCM B;  3KLS A;  1A3V A;  1E3P A;  3I4N B;  3PUW A;  3MEH A;  3FKI G;  2ES2 A;  5EBC A;  2UUC L;  1CM9 A;  1I3Q B;  3PUV A;  2Z6B A;  4PZ7 A;  2J7Z A;  5EKI A;  3NTH A;  1EL0 A;  1SMY D;  1Y14 B;  3TP8 A;  1HR0 Q;  4JI5 Q;  5HUR A;  3KBX A;  1HUN A;  3AFQ A;  4FYD A;  3P7J A;  4C3H G;  1PYB A;  1VQH A;  3H94 A;  3PGZ A;  4BY1 B;  4QY7 A;  4CBV A;  5JEA G;  3I73 A;  1QVF A;  2EYF A;  2F0F A;  4DXF A;  3EIV A;  3KK7 A;  2OF1 A;  3I4O A;  5FO7 B;  3CW2 C;  2VUM G;  2WAQ E;  2PYK A;  1STB A;  2F0K A;  1EUJ A;  2SNS A;  1EOV A;  4C2M H;  2KQ3 A;  4KN7 C;  4X3U A;  1MIU A;  1E0B A;  4JI5 L;  1N9W A;  1HR0 L;  1VQ5 A;  2Z8L A;  2JA6 G;  1E24 A;  2A1A A;  3D31 A;  1X54 A;  1B1Z A;  4A3I H;  2PI2 A;  2EZV A;  1LT4 D;  3RUZ A;  2PW5 A;  2Q2U A;  4B9W A;  1BOS A;  3GTM H;  5M3M B;  4K2K A;  2ZJP A;  4XQJ A;  2ATW A;  1RDP D;  4ME5 A;  2JYO A;  3Q23 A;  3S2H H;  3RMH A;  2F0V A;  2JP1 A;  1B2T A;  3FKI H;  2ZXP A;  3OOC A;  5T1I A;  1QJO A;  1SNC A;  1QUQ B;  3NTI A;  5JPN C;  3D4D A;  3J81 c;  2ZT9 C;  1CFM A;  4MN3 A;  3E9I A;  3F8T A;  1B4O A;  2JJQ A;  2NYZ D;  2K5Q A;  4EQN A;  2CVR A;  1FD7 D;  2EY2 A;  3S16 B;  3TEH B;  4BA1 I;  1B8A A;  1G51 A;  5L37 A;  1J5E Q;  4OEL B;  5JEA H;  1O80 A;  3P1H A;  1VQJ A;  4F87 A;  1XTD A;  1EY7 A;  1ML0 D;  1CUK A;  2KEE A;  3NP8 A;  3K8A A;  3G6E A;  1ILP A;  1M4V A;  3HOU H;  1T5E A;  1D5X C;  4BWG B;  2JA6 H;  3DWP A;  4OXP A;  1F9R A;  1FYC A;  3E0E A;  4DUZ Q;  5CBA E;  1IBL Q;  2K05 A;  3FEW X;  1TWG B;  5FKA C;  1D7Q A;  4ZLT F;  3TME A;  1L1O B;  2SDF A;  4OWX B;  5K36 G;  1B9M A;  2L5T A;  4KI0 A;  4CDF C;  1F2Z A;  1GM5 A;  4DU9 A;  4QF4 A;  3LNN A;  4P2C B;  3CCM A;  1BCP D;  3LX0 A;  4IUQ A;  4LUZ A;  5E4X A;  2IX0 A;  1TT2 A;  1C48 A;  4DUZ L;  3A0J A;  1D5Z C;  1IBL L;  1I50 B;  1BCP F;  1AE2 A;  3QR8 A;  4ZQ3 A;  2CWA A;  4EX5 A;  4DFA A;  2H4O A;  2L11 A;  4C3J H;  3NQI A;  2O5J C;  1CZW A;  2PQE A;  2M9V A;  4HJ7 A;  3M3Y H;  1LLR D;  3NK9 A;  3SGI A;  1I4G A;  2NN6 I;  3V2T A;  2N49 A;  4YCU A;  3SR1 A;  4UHV A;  4AIM A;  1BQQ T;  5BR8 Q;  3ERS X;  1JWM D;  3BZK A;  2ZTE A;  3PUY A;  2IY5 B;  1SMY C;  4KK7 A;  2DUD A;  4KHP Q;  5IYD G;  1NR4 A;  3Q8D A;  2WKD A;  1EY6 A;  3R2I A;  4C56 C;  1R4Q B;  1N33 Q;  4A3B G;  1JJG A;  4C1N K;  4DGZ A;  1PH9 A;  3CRK C;  2F03 A;  4KTA A;  2HT1 A;  1G6P A;  1GUW A;  5M5X H;  1Y1W H;  1A8V A;  2F0M A;  2Z1C A;  4JBJ A;  2NB0 A;  3UI2 A;  1NMF A;  5BR8 L;  3HOV B;  1OXV A;  4KHP L;  2A68 D;  4QMG A;  3VYS A;  3CF5 A;  1N33 L;  1PH8 A;  3K5M A;  1EQR A;  3AYH B;  3U50 C;  2XNA C;  4X6A H;  2F52 A;  4A3E B;  1VQP A;  3DM1 A;  5CMD A;  2K5D A;  1Y69 U;  3GDE A;  1PYW D;  4CJ2 C;  1S5E D;  1OTC A;  1ICF B;  1TWF B;  5IYC H;  4A75 A;  1YZ6 A;  3L7Z C;  4XXE A;  1HA6 A;  3U4Z A;  1HZ9 A;  2E2H H;  3HFZ B;  4HJA A;  1NUC A;  2KHS A;  1X56 A;  4L5R C;  5KYL A;  2QCP X;  3CCU A;  2LSS A;  1JR0 D;  2B63 B;  3SVM A;  1H9R A;  4GNX B;  1VQ6 A;  4A3B H;  4B08 A;  2GN5 A;  3A56 A;  3S2D B;  2N3S A;  5DM7 3;  4H44 C;  4RAU C;  1E1T A;  1IYU A;  1EYG A;  4HID A;  2VB3 X;  3I2Z A;  1O78 A;  1I4H A;  4JOI A;  3LWE A;  4K5W A;  1LTA D;  1WTV A;  4TSS A;  4O0A A;  2AQ3 B;  1V1O A;  2UXB L;  4EQO A;  1YEZ A;  5FJ8 G;  1ZKO A;  5IGC A;  4RKL A;  2EYP A;  5DNF A;  1PFN A;  3S14 H;  3E0J A;  2L1B A;  4HIK A;  3M4O B;  5M3F B;  4X3T A;  5JVH 3;  4LF9 L;  4KKS A;  3MZ5 A;  1VF5 C;  2AMC B;  1VQG A;  1BVS A;  2HQL A;  2PQA B;  3P75 A;  2KEC A;  5C3E G;  3J81 E;  1OO9 B;  4P72 A;  2KEN A;  5EPJ A;  2B8F A;  1BCP C;  4APV A;  1WOC A;  3M9B A;  4MIU A;  1ESF A;  3EBE A;  1PH6 A;  1XXG A;  1E22 A;  3T56 B;  3S1N H;  1HR0 W;  5D3D A;  1WTP A;  3J80 L;  1PMR A;  1Q7Y C;  3OWF A;  1JJC B;  1KHI A;  2D62 A;  2YTY A;  2BA0 A;  3HKZ E;  5C0X I;  2OQK A;  1CKN B;  2F3I A;  2K5N A;  5I6Y A;  4DR3 Q;  1DYQ A;  3UE1 A;  2NVX B;  2B39 A;  3KUP A;  3CME A;  2WB1 G;  4C2M B;  1STN A;  2B3G A;  1PZK D;  3A5Z B;  4A3I B;  2X6G A;  3I4M B;  3FMC A;  4DV2 L;  1XPR A;  2PO4 A;  1STE A;  1V8Q A;  5FJ8 H;  3WDN A;  1XTC D;  4LF5 Q;  2EJM A;  5C4Z A;  3JAM i;  1SYG A;  5ELE A;  4DR3 L;  1DOK A;  2F0I A;  1EQV A;  3GV3 A;  4MTK A;  1ENC A;  4KY7 A;  5IGB A;  1TS4 A;  3FKI B;  2A68 C;  2IW3 A;  3ND9 A;  4JC0 A;  5C3E H;  2A6H D;  1X3G A;  2KJX A;  2BE5 D;  1V1P B;  1Z9F A;  1MKH A;  4FP5 D;  3X3N A;  3KDF B;  4C3H B;  5IE8 A;  4Q5V A;  4LF5 L;  1QUQ A;  1YI2 A;  1H9S B;  3AU7 A;  3PO3 G;  2HDL A;  5LMN Q;  2JA9 A;  2FMC A;  3P20 A;  2VQE Q;  1SRO A;  3KOJ A;  4CGY B;  1ZYR D;  1N36 Q;  1STA A;  1JOR A;  3AB9 A;  1VQN A;  2VUM B;  3T1Y Q;  4JBW A;  1J6Q A;  3HZX A;  2ASB A;  2NTS A;  3PO2 G;  4JI7 Q;  1EQQ A;  2R92 H;  1VQE A;  3A8J E;  4QUF A;  3RD4 A;  3OMC A;  2YTX A;  5LMN L;  2VQE L;  4KY6 A;  3M4Q A;  3A7L A;  4OGQ C;  5IP9 H;  3W2D A;  4RCN A;  1A3T A;  3DM3 A;  3HOX G;  2EJG C;  2PW7 A;  3D6C A;  4DR7 Q;  4ME3 A;  2I0Q A;  2K4K A;  1B3A A;  3CQZ H;  4L6T B;  1ONL A;  3S1Q B;  4IPH A;  3G4S A;  1L1O A;  4DAY B;  4JI7 L;  5EGT A;  3I8Z A;  1L0Y B;  1VCI A;  3PF5 A;  2OEO A;  2R61 A;  1EWH A;  3T4A C;  2Y0S G;  2A8V A;  1UE5 A;  4DR7 L;  3M4Y A;  3TZD A;  3RLN A;  3GTG H;  3S15 B;  2JA5 G;  1KDB A;  2B2V C;  1O7Z A;  1QIL A;  1U4M A;  2R93 B;  2PI2 E;  4PMC A;  1H9J A;  2K75 A;  4R4T A;  4JI0 Q;  3GP7 A;  1JC7 A;  4HTH A;  4LF7 Q;  4QIW B;  5ELF A;  2VS1 A;  2RHS B;  1Y8N B;  4ABN A;  5JJI A;  1E1O A;  1JIC A;  4L8J A;  2NVQ B;  2FIN B;  1ILQ A;  4XYQ A;  4NW2 A;  1MBY A;  1SYE A;  3K0Y A;  4AYB E; 
#chains in the Genus database with same CATH homology
 2E2J B;  3T51 B;  1EY0 A;  1FNV A;  4K6D A;  2RDG A;  3U9O A;  2E2I B;  2K1B A;  3I3C A;  3K5N A;  1SFO B;  1SJE D;  3MVV A;  1TU2 B;  4LJZ C;  3CHB D;  1LTS D;  3NPP A;  5JEA J;  1SYB A;  1SND A;  2D2C C;  2F0L A;  1D1I A;  5KNB A;  1EFI D;  1JB3 A;  1F9P A;  2NUC A;  5A2Q L;  5I6W A;  4XQN A;  4OHJ A;  1IYV A;  2A6H C;  2EYJ A;  1TR5 A;  3MHB A;  2BE5 C;  1DM0 B;  4QCL A;  2B2Y A;  2QEJ C;  5IIF A;  3HS0 C;  2PNR C;  1TKW B;  1TQO A;  2IX1 A;  5COY A;  4EQP A;  1ZYR C;  4ZKC B;  1G91 A;  1EIG A;  4DN4 M;  5CV9 A;  4G7Z C;  2CHB D;  2NTT A;  2RSN A;  3SK5 A;  1I4Q A;  4CKE A;  4QB4 A;  4IFD G;  2TSS A;  3CRL C;  3C46 A;  3S9W A;  1SSO A;  5LL6 S;  4ILW A;  3K5O A;  4DK0 A;  3S14 B;  5DEH A;  2BDO A;  3E5S A;  2XVS A;  4TKO B;  1MD2 D;  2XWB B;  4PNY A;  3PUZ A;  1A3U A;  1EQT A;  1EU4 A;  2KA7 A;  1EZ8 A;  2FHT A;  1TS2 A;  1EY4 A;  3H6M A;  1CQF A;  2EXZ A;  1BBX C;  2G9H D;  1AEX A;  5E1F A;  4XDX A;  4KN4 C;  4U68 A;  1QCB D;  3L3O C;  4HSP A;  4G4K A;  2F0E A;  4ID6 A;  3OIP A;  2KUM A;  3K5L A;  1FR3 A;  2KOL A;  1WTO A;  1JCK B;  4F7X A;  3VA5 A;  1D6E C;  2L55 A;  4KV6 A;  1EWC A;  2F0S A;  2B2U A;  1SNP A;  2O5I C;  2YU9 B;  4ZKB B;  4RFB A;  1HUM A;  1Q3L A;  3T13 A;  2BDN A;  3AMU A;  4YIJ A;  1WTQ A;  2K28 A;  3ERQ A;  4XYO A;  3T16 A;  1XYI A;  2K7V A;  3BYT B;  3TP6 A;  1TVX A;  4DK1 A;  3F2U A;  3NTK A;  3MA2 B;  3R93 A;  3BDO A;  1OXS C;  5I4D A;  1G2T A;  1AP0 A;  5KYI A;  3FRP B;  3KLS X;  4ZAI A;  1V1P A;  2I46 A;  1Y8P B;  3S1R B;  1QE6 A;  4HMI A;  2F0G A;  2IWH A;  2ICI A;  1Q1B A;  4LMQ D;  2IL8 A;  5IGE A;  5C6A A;  1KTK A;  1F2L A;  5C0X H;  2ICE C;  5CYU A;  2WB1 B;  4V19 0;  1EY9 A;  2R7Z B;  1UAP A;  3JAM L;  3PIP 3;  1BR9 A;  1K83 B;  1F2Y A;  2J0T D;  3W3A A;  4K6L A;  3L9A X;  3MWY W;  1VMC A;  3G6J B;  3MFY A;  3TBI B;  5IOD A;  2R3Z A;  3BVM A;  2WV6 D;  1HTP A;  1NAP A;  3BS1 A;  5ELB A;  4IN3 A;  4ODG A;  5C3W A;  2A6E D;  3A55 A;  4HMJ A;  4RH6 A;  2QDB A;  4DAV A;  3Q22 A;  1IKL A;  1J9O A;  1CI3 M;  3DUZ A;  4DAY A;  1EZ6 A;  5CV8 A;  4C3J G;  4F88 A;  3PO3 B;  1BNZ A;  4K8J A;  2LMC B;  1C8C A;  4O42 A;  1O7L A;  2L4N A;  4WOR A;  1M8A A;  1X32 A;  2EE1 A;  1PTO F;  2KED A;  2F0O A;  3PO2 B;  1G6Z A;  2NBF A;  1E2V A;  1QWY A;  2K6A A;  1S5B D;  3Q0A A;  5KIX A;  2CW0 C;  3D3R A;  3I4L A;  1DOM A;  2IX3 A;  3Q6S A;  1B9N A;  1JOQ A;  3H91 A;  1TY0 A;  5G3L D;  3ND8 A;  4N9T A;  5G3L F;  4DA2 A;  3EJI A;  2EYM A;  2Y0S B;  2AWO A;  1G29 1;  1RCV D;  4J6H A;  2B8G A;  3VA7 A;  1DOL A;  4UAI A;  5EJW A;  4HN7 A;  3IFT A;  1LAC A;  4FNF A;  4FXG C;  2JSO A;  1J8I A;  4BA2 I;  1YNJ D;  3TSS A;  2HDM A;  3VYU A;  3GTK B;  3TDQ A;  2WII B;  5BN4 A;  4H0L C;  4A3J B;  3EA6 A;  2FFK B;  2NZ1 D;  2AWN A;  3HOW B;  2F0J A;  1X3Q A;  3GTP B;  1ENA A;  3H0G B;  4CKC A;  2B2W A;  5FO8 B;  1ICW A;  4ZK9 B;  4HCS A;  1WTW A;  2SNM A;  2EYL A;  3NHH A;  3SDZ A;  3HEJ A;  2A6E C;  3I91 A;  4KKU A;  4KMU C;  1E2Z A;  1GUN A;  4OO1 I;  5M5W B;  1Q90 A;  3K57 A;  3VR6 A;  4FXD A;  1O7Y A;  5CBE E;  3OSO A;  3MXP A;  2F0W A;  4DXG A;  4K5V A;  1PTO C;  1U4L A;  1ZXT A;  3ONA B;  1F77 A;  1TY2 A;  2KCC A;  2NVY B;  1BCP B;  5KRU A;  3DHQ A;  2I07 B;  2N88 A;  2FJ2 A;  4EVO A;  5CC4 A;  3OWE B;  1RKN A;  2B2T A;  4S3S A;  3FVQ A;  3CU7 A;  3KF8 A;  2JA7 B;  1UNS A;  1PRT F;  1B50 A;  2R6G A;  3R2T A;  2XWJ B;  2WIN B;  1LTR D;  3OHX C;  1WTX A;  1SYF A;  2A5H A;  4FVM A;  5A35 A;  3BVG A;  3O13 A;  1UUP A;  2C9O A;  2DNE A;  4R8I A;  1AFP A;  3FPU B;  3TN2 A;  5EKL A;  2F3V A;  5C5L A;  2A73 B;  5I9P A;  1H9M A;  4PQX A;  1QB5 D;  4IQZ A;  4MHE A;  3A8K E;  1Z6H A;  1SNQ A;  1YNJ C;  3A54 A;  2JXM B;  2YYZ A;  2IT1 A;  2SEB D;  4RGM A;  1PDQ A;  3GTM B;  1EEI D;  1AZQ A;  1STY A;  2Z4I A;  3OPO A;  2RQX A;  3S2H B;  4N9P A;  2HQE A;  5CV5 A;  2LS0 1;  1QNK A;  2XRQ D;  4XIG S;  3U9S A;  4CHT B;  2E75 C;  5E3F A;  5KND A;  2B2U C;  5C5M A;  3QG1 A;  3J7A F;  1AZP A;  3SK8 A;  2CQA A;  3FPP A;  1I4P A;  1JQY D;  1W6J A;  4IFD J;  5EPL A;  4CKB A;  1JWU D;  3HOU B;  1HRJ A;  5ELD A;  2LY7 A;  3CKI B;  5JOB A;  1HTL D;  2C5C A;  1NSN S;  2JA6 B;  4FO2 A;  2LFN A;  3SK4 A;  2D5D A;  2Z4H A;  4DAP A;  1STG A;  1KAA A;  4G7O C;  4FF3 A;  4C3I G;  3BG3 A;  3D8G A;  4NDX A;  4K5X A;  3H3V C;  2XSC A;  4RGT A;  2JEB I;  3JAM E;  1LT3 D;  1EYD A;  2DY8 A;  2BCO A;  1FNU A;  1G2S A;  2RVL A;  1PRT C;  1RHP A;  2QKI C;  4XT1 B;  3X3M A;  1H9K A;  5EBD A;  4C3J B;  5I2X A;  3BYY B;  1KLU D;  3M3Y B;  1CZG A;  5J1Z A;  1WTR A;  4FF2 A;  4TQU S;  4A3F B;  4DF7 A;  1A6X A;  3NBH A;  1CA5 A;  4PMW A;  5JPM C;  2AUK A;  1C4Q A;  1D1K A;  3QOJ A;  3Q24 A;  5EQ0 A;  3SHL A;  5C44 B;  3MFG A;  5M5X B;  1SXT A;  4HSV A;  1Y1W B;  5JAV A;  1X3P A;  1PXU A;  3QB3 A;  1STH A;  2EYH A;  3RLF A;  3ERO A;  4DNR B;  4LAA A;  3K59 A;  3VR4 A;  3I90 A;  1I4R A;  2VB2 X;  2WAC A;  1F9Q A;  3NWT A;  1SAP A;  3URY A;  5FO9 B;  1GHJ A;  1MGS A;  3QOL A;  4U67 3;  4NMZ A;  1KNE A;  1WVL A;  1GUO A;  1SYD A;  1W6K A;  2HCI A;  2M00 A;  3GV6 A;  2SOB A;  2E2H B;  2RDH A;  2GA4 B;  2G9D A;  2F0U A;  2NN6 H;  2RA4 A;  3N6R A;  3D6W A;  4XT3 B;  2F1M A;  2D9U A;  3R8B A;  4A3B B;  2O4X A;  2RKS A;  5J22 A;  1GXD C;  3EVQ A;  1LTT D;  5K5P A;  1ESR A;  1G8Z D;  3MTS A;  2F0T A;  3DXJ C;  1DD2 A;  2DN8 A;  1HPC A;  3SK6 A;  3VR5 A;  2HCC A;  3MXU A;  5COR A;  1B53 A;  1PZJ D;  2MP1 A;  1PTO H;  2EDG A;  3TZU A;  1SDF A;  1SYC A;  1FNW A;  5TSS A;  4HR7 B;  5IGD A;  4RHR A;  3S1N B;  2CW0 D;  4NKL A;  1EEF D;  2F3W A;  2L12 A;  4IUV A;  4KJO A;  4KJN A;  4OO1 H;  1XX8 A;  1JOO A;  4EGV A;  5D65 A;  5C0X G;  4R8N A;  4X3S A;  3C1F A;  4F8M A;  1RJT A;  2L0C A;  1HXY D;  1EU3 A;  4OIK A;  2L9H A;  4HAE A;  5ELC A;  2EOT A;  3DMU A;  2WAQ B;  3PMF A;  5JJZ A;  1KNA A;  1MSG A;  5J39 A;  3QO2 A;  1BF4 A;  4IUN A;  2ZXO A;  5C3E B;  1SNM A;  5D14 A;  1GUS A;  2M2L A;  3OW7 A;  4I7Z C;  5DM6 3;  2QIL A;  2MJ8 A;  3TP5 A;  2F0H A;  4M8A A;  1RF2 D;  4RKB A;  2K03 A;  1WD1 A;  2TMP A;  4WJW A;  3A7A B;  1H9S A;  2B2T C;  4HED A;  1CK1 A;  4WRD A;  3ZYY X;  1BXT A;  2O2L D;  1S5D D;  3WOE A;  2R92 B;  2N55 A;  2VNU D;  3G7L A;  4IAL A;  3J80 E;  4FF4 A;  3HGB A;  1K8M A;  4BBS B;  1LV9 A;  3HP3 A;  1UEA B;  1K8O A;  4Q0F A;  3CQZ B;  2PZU A;  4RA8 A;  2B2V A;  1JWS D;  1PLF A;  3DEP A;  1RTO A;  5D3I B;  1A15 A;  3MXG A;  3GTG B;  1VF7 A;  1IW7 D;  1U4R A;  4J8Q A;  4M1U B;  2EY5 A;  1PTO D;  3PIO 3;  2HUG A;  1A2U A;  5LL6 X;  1EOT A;  4I65 A;  1VMP A;  2MGS A;  1CHQ D;  2V4D A;  1QOH A;  4C3I B;  3HOX B;  5I2Y A;  3HRZ C;  1HFG A;  1I4X A;  5FOB B;  5LHY 1;  1L0X B;  5IOC A;  3C1E A;  2MUY A;  1MSH A;  2AQ1 B;  3EQL C;  2IJ0 A;  3NBI A;  4JK1 C;  4ULL A;  3SEB A;  3NQT A;  2XRS D;  1DCZ A;  2JA5 B;  3IL8 A;  1SJH D;  1ZEQ X;  1SE3 A;  1A2T A;  4RWS C;  4KD4 A;  2K32 A;  2E76 C;  3PUX A;  2PCF B;  2F0N A;  2NWG A;  5C4H A;  5C4J B;  4OL7 A;  1KDC A;  1CHP D;  2J4X A;  2F0Q A;  1LTG D;  2RDF A;  5ISR A;  4CJ1 B;  4DNT B;  5DAU A;  2JEA I;  3GTJ B;  1TII D;  5K36 H;  5IT9 L;  3MXN A;  2EJF C;  1KAB A;  3GQB A;  3T53 B;  3FDT A;  1KLG D;  3S17 B;  1PTO B;  3D4W A;  5NUC A;  1Y1V B;  4V0B A;  4B9X A;  3BDL A;  1SEB D;  5KEE A;  3VYR A;  5BN5 A;  2WP8 J;  2QF7 A;  3GTQ B;  4BBR B;  4K8I A;  1IW7 C;  5CV6 A;  4IUP A;  2PZT A;  3K7A B;  5A2Q E;  2EVB A;  4TRD A;  1LTB D;  4IUT A;  5CV7 A;  2ZXR A;  3DWQ A;  2PZW A;  3QIA A;  3MC0 B;  5FLX L;  1PRT D;  4XTC S;  4L63 B;  3HKZ B;  4IFD I;  4X3K A;  3NUC A;  2K04 A;  3IFD A;  2B2Y C;  1OXX K;  1LTI D;  4KHV A;  1II3 A;  3BVZ A;  4GZY C;  1AW7 A;  3OMG A;  1TWA B;  4A3K B;  4RHS A;  3E6Z X;  4A3D B;  1D2B A;  5I9O A;  2JE6 I;  2MPM A;  3J7Y W;  1R4P B;  1TS5 A;  5KNC A;  1DON A;  3QJY A;  5JVG 3;  2DY7 A;  1S5C D;  4H13 C;  1IHZ A;  2X6L A;  1EIH A;  4O1N A;  1SYE A;  4RCO A;  5C3X A;  1SE4 A;  2VXW A;  3C3L A;  1OXU A;  3S1M B;  3SE0 A;  3NXW A;  2BA1 A;  3QWN A;  5F2D A;  1GOZ A;  2ENB A;  2F0P A;  2KCN A;  4NP5 A;  2X69 A;  1KDA A;  2AUJ D;  4UDU C;  5IGF A;  3H09 A;  1WD0 A;  1EYA A;  1TS3 A;  2H1E A;  1PZI D;  1HFN A;  1B44 D;  1U4P A;  3A8I E;  2XN9 C;  1EYC A;  1Q12 A;  1RD9 D;  1ROD A;  1SBB B;  4Z9C B;  1QG7 A;  3V05 A;  3V96 A;  3GD7 A;  1GHK A;  3M85 A;  3C2P A;  2F4I A;  5CGK A;  1DJR D;  5IGG A;  1DZ1 A;  4KY5 A;  4PMB A;  2XIW A;  3I70 A;  3M7N A;  3IKJ A;  5CR3 A;  1PRT B;  3OIQ A;  1EY8 A;  1XWE A;  3HOZ B;  3NSW A;  4RGN A;  4R9W A;  2E2D C;  1T5X D;  1F9S A;  1Z7T A;  2JA8 B;  1R9T B;  4ZYS A;  1HQR D;  5C4X B;  3EFX D;  1CQV A;  2Q8T A;  3VR2 A;  4AYB B;  1TWC B;  5EKK A;  1Y8O B;  1DXM A;  2RBM A;  1Q8I A;  2K01 A;  1ENF A;  1E2W A;  3M7G A;  1HCZ A;  3GO5 A;  3NE5 B;  2NVT B;  3HOY B;  1YNN D;  1GUT A;  5C0X J;  5E4W C;  1BO0 A;  1CTM A;  3BDC A;  5AFW A;  2NN6 G;  4A3M B;  2DNC A;  5M9O A;  4QUC A;  3MAQ A;  4A3G B;  1JOK A;  3TP7 A;  1ET9 A;  1OXT A;  3KLR A;  2KVM A;  4H7B A;  3R3O A;  2Q8R E;  2A69 D;  1I6V C;  2A74 C;  2RSO A;  4ZRZ A;  3WOF A;  4XQQ A;  1HA5 A;  2EY1 A;  1Z47 A;  2FMM A;  1GJX A;  3GTO B;  1TWH B;  1NCV A;  3BZD B;  3J7A V;  1Q1E A;  1SE2 A;  1CT1 D;  3VYT A;  5T1G A;  2OXP A;  4IZ8 A;  5FK9 C;  4CJ0 B;  4IUR A;  1U9R A;  4BS9 A;  5BN3 A;  4C1N I;  1I6H B;  2LKV A;  3N52 A;  1LAB A;  3I72 A;  4IUU A;  2BOS A;  4OO1 G;  3GTL B;  2IPK D;  2OT2 A;  4E6I A;  4HCE A;  4G7H C;  3IAY A;  1SNO A;  2MHV A;  5M5Y B;  1LO5 D;  4KD3 A;  3K6O A;  3SXH A;  5CV4 A;  4BY7 B;  1PFM A;  2AQ2 B;  1IL8 A;  2PMZ B;  4KHZ A;  1PFB A;  1JE4 A;  1VDZ A;  1AN8 A;  1RTN A;  1NR2 A;  4PV1 C;  3KBG A;  3DEO A;  3J81 L;  2E74 C;  4KKT A;  1IKM A;  1LT6 D;  1HQM C;  2ID0 A;  2K5W A;  2EPB A;  3D4R A;  3K58 A;  1BUV T;  5IT9 E;  4K2L A;  4A93 B;  1FGB D;  3ITP A;  3DWA A;  4ZUJ A;  1F2M A;  4OIJ A;  2F0D A;  1D5M C;  1YNN C;  2B2W C;  3RZD B;  4LK1 C;  5EPK A;  4WFN 3;  4J1M A;  3PV0 A;  4FF1 A;  1V43 A;  1LT5 D;  1GUG A;  3LWU A;  1QNU A;  2EY6 A;  4RGO S;  2EYO A;  5HGT A;  1CA6 A;  3HG9 A;  5KGU A;  3NWS A;  2A69 C;  2K33 A;  2WKC A;  1S4Z A;  1MI2 A;  4IFD H;  1HHV A;  1BDO A;  3VR3 A;  1S5F D;  1EY5 A;  4K14 A;  5FLX E;  4FXK C;  1ET6 A;  4Y7N B;  4G57 A;  2PPB C;  3RZO B;  4ZUI A;  1WCM B;  3KLS A;  1A3V A;  3I4N B;  3PUW A;  3MEH A;  5EBC A;  1CM9 A;  1I3Q B;  3PUV A;  2J7Z A;  5EKI A;  3NTH A;  1EL0 A;  1SMY D;  3TP8 A;  5HUR A;  3KBX A;  1HUN A;  4FYD A;  3P7J A;  4C3H G;  3H94 A;  4BY1 B;  4CBV A;  5JEA G;  3I73 A;  2EYF A;  2F0F A;  4DXF A;  3KK7 A;  2OF1 A;  5FO7 B;  2PYK A;  1STB A;  2F0K A;  2SNS A;  2KQ3 A;  4KN7 C;  4X3U A;  1E0B A;  2Z8L A;  3D31 A;  1B1Z A;  2EZV A;  1LT4 D;  3RUZ A;  2PW5 A;  4B9W A;  1BOS A;  5M3M B;  4K2K A;  4XQJ A;  1RDP D;  4ME5 A;  2JYO A;  3Q23 A;  3RMH A;  2F0V A;  2JP1 A;  1B2T A;  2ZXP A;  3OOC A;  5T1I A;  1QJO A;  1SNC A;  3NTI A;  5JPN C;  3D4D A;  2ZT9 C;  1CFM A;  4MN3 A;  1B4O A;  2NYZ D;  4EQN A;  2K5Q A;  2CVR A;  1FD7 D;  2EY2 A;  3S16 B;  4BA1 I;  5JEA H;  1O80 A;  3P1H A;  4F87 A;  1EY7 A;  1ML0 D;  2KEE A;  3NP8 A;  1ILP A;  1M4V A;  1T5E A;  1D5X C;  4BWG B;  3DWP A;  1F9R A;  1FYC A;  5CBA E;  2K05 A;  3FEW X;  1TWG B;  5FKA C;  4ZLT F;  3TME A;  2SDF A;  5K36 G;  1B9M A;  2L5T A;  4KI0 A;  1F2Z A;  4DU9 A;  4QF4 A;  3LNN A;  4P2C B;  1BCP D;  3LX0 A;  4IUQ A;  5E4X A;  2IX0 A;  1TT2 A;  1C48 A;  1D5Z C;  1I50 B;  1BCP F;  4ZQ3 A;  4DFA A;  2H4O A;  2L11 A;  2O5J C;  3NQI A;  1CZW A;  2PQE A;  2M9V A;  1LLR D;  3NK9 A;  1I4G A;  2NN6 I;  3V2T A;  3SR1 A;  1BQQ T;  1JWM D;  3PUY A;  1SMY C;  4KK7 A;  1NR4 A;  2WKD A;  1EY6 A;  3R2I A;  4C56 C;  1R4Q B;  4C1N K;  4DGZ A;  3CRK C;  2F03 A;  4KTA A;  1GUW A;  2F0M A;  2Z1C A;  2NB0 A;  3UI2 A;  3HOV B;  1OXV A;  2A68 D;  4QMG A;  3VYS A;  3K5M A;  2XNA C;  4A3E B;  3DM1 A;  5CMD A;  2K5D A;  1Y69 U;  4CJ2 C;  1PYW D;  1S5E D;  1TWF B;  4XXE A;  3L7Z C;  1HA6 A;  1NUC A;  2KHS A;  5KYL A;  2QCP X;  1JR0 D;  2B63 B;  3SVM A;  1H9R A;  4B08 A;  3A56 A;  3S2D B;  5DM7 3;  4H44 C;  4RAU C;  1IYU A;  2VB3 X;  1O78 A;  1I4H A;  3LWE A;  4K5W A;  1LTA D;  1WTV A;  4TSS A;  2AQ3 B;  1V1O A;  4EQO A;  1ZKO A;  5IGC A;  4RKL A;  2EYP A;  5DNF A;  1PFN A;  3E0J A;  2L1B A;  3M4O B;  5M3F B;  4X3T A;  5JVH 3;  4KKS A;  3MZ5 A;  1VF5 C;  3P75 A;  2KEC A;  3J81 E;  1OO9 B;  5EPJ A;  2B8F A;  1BCP C;  4MIU A;  1ESF A;  1XXG A;  3T56 B;  5D3D A;  1WTP A;  3J80 L;  1PMR A;  3OWF A;  2D62 A;  2BA0 A;  5C0X I;  5I6Y A;  1DYQ A;  2NVX B;  2B39 A;  3KUP A;  4C2M B;  1STN A;  1PZK D;  4A3I B;  2X6G A;  3I4M B;  3FMC A;  2PO4 A;  1STE A;  1V8Q A;  3WDN A;  1XTC D;  2EJM A;  5C4Z A;  1SYG A;  5ELE A;  1DOK A;  2F0I A;  1EQV A;  3GV3 A;  1ENC A;  4KY7 A;  5IGB A;  1TS4 A;  3FKI B;  2A68 C;  2IW3 A;  3ND9 A;  2A6H D;  2KJX A;  2BE5 D;  1V1P B;  4FP5 D;  3X3N A;  4C3H B;  4Q5V A;  1H9S B;  3AU7 A;  2HDL A;  2FMC A;  3P20 A;  4CGY B;  1ZYR D;  1STA A;  1JOR A;  3AB9 A;  2VUM B;  4JBW A;  3HZX A;  2NTS A;  3A8J E;  4QUF A;  3RD4 A;  3OMC A;  4KY6 A;  3A7L A;  4OGQ C;  3W2D A;  4RCN A;  1A3T A;  2EJG C;  2PW7 A;  3D6C A;  1B3A A;  4L6T B;  1ONL A;  3S1Q B;  5EGT A;  3I8Z A;  1L0Y B;  1VCI A;  2OEO A;  2R61 A;  1EWH A;  3T4A C;  3M4Y A;  3TZD A;  3S15 B;  1KDB A;  2B2V C;  1O7Z A;  1QIL A;  1U4M A;  2R93 B;  4PMC A;  1H9J A;  3GP7 A;  1JC7 A;  4HTH A;  4QIW B;  5ELF A;  1Y8N B;  4ABN A;  1JIC A;  4L8J A;  2NVQ B;  2FIN B;  1ILQ A;  4XYQ A;  4NW2 A;  1MBY A;  2Q8I B;  3K0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...