1U4MA

Human rantes complexed to heparin-derived disaccharide iii-s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Attractant
molecule keywords Small inducible cytokine A5
total genus 14
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u4mA00
1IL8A 1RHPA 3IFDA 4OIKA 1RJTA 2HDMA 4ZK9B 1CA6A 5AFWA 1EQTA 1EOTA 4NW2A 2KEEA 4OIJA 4XT1B 2L9HA 2MPMA 1IKMA 3FDTA 3UI2A 1ICWA 1ILPA 2NWGA 5CBEE 1U4LA 4QUCA 3F2UA 1B53A 4MHEA 2HCCA 3KUPA 3FPUB 5EQ0A 1BBXC 2FFKB 2MGSA 4HAEA 1A15A 2KECA 1KNAA 2Q8TA 5E4WC 1J9OA 1MGSA 1MSGA 2B2UC 2H1EA 1HFNA 2KOLA 3IL8A 2RSNA 2JP1A 2X69A 3ONAB 3TN2A 1WD0A 1BF4A 3I91A 1E0BA 2L1BA 4U68A 4CJ2C 2B2TA 2M2LA 2KUMA 3Q6SA 2B2WA 2NZ1D 1U4RA 4HSVA 1C8CA 1WTOA 1RODA 1PFMA 4ZKBB 3TZDA 1WTQA 5CMDA 1AZQA 1U4PA 2K04A 4IUPA 3KBXA 1ESRA 3GV6A 1PFBA 3MWYW 3I8ZA 4X3TA 4DN4M 1SSOA 2B2YA 2KVMA 2JYOA 1DOLA 1X3QA 1QNKA 1S4ZA 2L4NA 1MI2A 4RAUC 4ZKCB 1O7ZA 1X32A 2MP1A 1SAPA 2EE1A 4X3UA 1BNZA 4IUVA 1HA6A 5CORA 3HP3A 2K03A 5CBAE 2DY8A 2FMMA 1ML0D 1DOMA 2J7ZA 1F9QA 4R9WA 4IURA 1TVXA 1NR4A 3GV3A 1F9RA 3G7LA 1WVLA 1PFNA 1WD1A 2N55A 2B2YC 3I90A 2D9UA 5T1GA 1VMPA 2Q8RE 3MTSA 1EIGA 4X3KA 1HUMA 1M8AA 1WTPA 3QO2A 1KNEA 2RVLA 1EL0A 1QG7A 2KEDA 2X6GA 4O42A 1VMCA 1EIHA 3DM1A 4IUQA 2K1BA 5JJZA 4HEDA 2B2VC 4R8IA 3H91A 2K05A 4XDXA 2R3ZA 5EPJA 2L11A 2X6LA 1WTXA 5EKIA 4HCSA 5EPKA 1HFGA 2EOTA 2B2TC 1B3AA 2K28A 2MJ8A 3D6WA 3DEOA 4CJ1B 1NR2A 5COYA 1HUNA 5EJWA 1QE6A 1PDQA 1XYIA 1CM9A 2VXWA 1HRJA 1JE4A 1AZPA 2CVRA 2L12A 5D65A 2K01A 2FINB 2N88A 5E4XA 1GUWA 1ZXTA 2B2WC 1X3PA 2B2UA 1G2SA 1ILQA 1RTOA 3DEPA 3N52A 1DZ1A 1O7YA 2RSOA 3P7JA 2RA4A 1DONA 1JICA 1DOKA 4LMQD 1XX8A 2DY7A 4ZLTF 4IUTA 1F9PA 1G2TA 4CJ0B 1O80A 1B50A 2SDFA 1J8IA 4IUUA 1G6ZA 5DNFA 1PLFA 2EPBA 2HCIA 5T1IA 1Q3LA 2IL8A 4UAIA 1B2TA 3LWEA 1B4OA 2FJ2A 1F2LA 2B2VA 1RTNA 4RWSC 2NYZD 3R93A 2BDNA 1CA5A 1WTRA 5EPLA 4RA8A 3I3CA 1HHVA 4QUFA 4X3SA 1AP0A 1WTWA 1SDFA 1MSHA 2FHTA 4XT3B 3SVMA 1NAPA 2HUGA 4MN3A 1G91A 2HDLA 5D14A 1U4MA 1NCVA 1LV9A 4ZAIA 1F9SA 1WTVA 2XIWA 1BO0A 1IKLA
chains in the Genus database with same CATH superfamily
4JI6Q 1CA6A 2F0NA 3HOXH 1EQTA 4DR2L 4BBRH 2R92H 3DWAA 3F2UA 3CC7A 4C3HG 5C3WA 1JMCA 1SYFA 5M3FG 2Q8TA 4A3KG 2PW7A 1JB7A 1XTCD 1S5BD 3OHXC 3ONAB 3TN2A 2L5TA 1PH3A 2L55A 3AQQA 2QA4A 3M4OB 1STNA 4QMGA 3HG9A 5I2YA 1X3GA 2AQ2B 1N33Q 4JYAQ 1VDZA 2VW9A 1UE7A 1AZQA 1QB5D 3I4NB 2FXQA 2XVSA 3I8ZA 1I3QB 4O1NA 3V2TA 1SE4A 4PNYA 5CV7A 2BH2A 4OO1I 4CKCA 1BNZA 4JI2L 2L0CA 1CSQA 1MJEA 2EJMA 5I6YA 1ML0D 4NP5A 1X3FA 5IGDA 1PFNA 1HNZQ 2B2YC 1IW7D 2JA8B 2YYZA 4R4TA 1SFOH 2K1BA 1QCBD 3K5LA 4WJWA 2ATWA 2R3ZA 1S5CD 5EKIA 5H1SE 3K5MA 4R1JA 2B2TC 3CPFA 3M4PA 1H9MA 3EVQA 1K83H 4LJZC 5C0XH 4DV1L 3ERSX 5DAUA 4KHPL 4IALA 1JWUD 4TVAB 3JAMi 2UXBQ 3K7UC 2PYKA 3C1EA 5E4XA 1HQRD 1V1PB 4LF9L 1ZXTA 2RCNA 2UXCL 3S16H 4K6LA 5CGKA 3DEPA 4C3IH 1ZKOA 4JI4Q 1C9OA 5HURA 1DONA 2DY7A 1G2TA 1N34Q 4DR1L 1HQMC 2N8NA 1LTSD 2R93H 5M3MB 1VQ5A 3TS0A 3PSIA 1BKBA 1F2LA 1D7QA 4FO2A 3NBIA 1V43A 4DR3Q 1TWGH 2RKSA 1E2VA 5A35A 3CMEA 1WTWA 2G9DA 1GO3E 4XT3B 2JA9A 4JI8L 1NCVA 3A5UA 5C4JB 1T9HA 1BCPC 1PH8A 4K2LA 2VQFL 2PO4A 3S2DB 2LXJA 1VQKA 2EYOA 2AKWB 5HGQA 1E22A 3AB9A 3CCSA 3S17B 5BN3A 1LUZA 1MSGA 1J6QA 2AMCB 2F0SA 1QZGA 3A5ZB 4PMWA 3SGIA 1YNND 5IP9H 1YJ9A 4BBSH 2F0TA 4X64Q 1XXGA 1WFQA 4C2MB 3DXJC 2Z4HA 3KOJA 1ENFA 4AYBE 1ICFB 1X55A 1STHA 1VQ6A 2EXZA 1IYJB 2B2YA 2F3VA 3A7AB 3S1RB 3RNUA 4A3KH 2EE1A 2A74C 1ASYA 2BE5C 4DR6Q 2XGTA 4DAYA 4A3JH 3FHWA 1DOMA 2OT2A 2B8GA 3TDQA 3M4QA 3QG1A 5HGTA 1VQEA 2DUDA 1WD1A 4DR4L 4X66L 4OL7A 3TP8A 1X54A 4BY1B 3ER0A 1XNRL 2IHEA 4R4CA 1HNWL 1QG7A 5EGTA 1TS4A 1GHJA 1S72A 3TP7A 2IJ0A 1KDAA 3TRZA 3HOZH 2L11A 1MHWC 5C3EG 2QEJC 4DK6C 4LUVA 1I6VC 3AU7A 1YBYA 2A6EC 1V8QA 3T1YQ 3MXUA 4DR6L 4A3IH 2HHHL 3BZDB 4R4OA 3MA2B 5IYCG 4NXML 4XQNA 3TQYA 1ILQA 4BY7G 1RTOA 1DZ1A 4JI0L 1MJCA 2MNAA 3A7LA 4DR5L 3CXCA 4DNTB 1N36L 2YTYA 2EPBA 2YTVA 4YCVA 5EKKA 4A93B 2B3GA 2ZJQA 2F3WA 2VS1A 4XXEA 2IPKD 2PZUA 1QZHA 1HHVA 1L2FA 4LF5L 1STBA 4FXGC 3ULLA 3URYA 1N36Q 3U9OA 1EUJA 5IYBH 1UWVA 1N8RC 3KFUA 4U673 3HOWH 1CQFA 2WB1G 2HIXA 1XMQL 4ZK9B 2HDMA 1CZGA 4OX9L 2MO0A 1BR9A 5EKLA 4UPAA 4PMBA 4XIGS 3JAME 3AYHB 3BVZA 1CKNA 4QUCA 2JA5G 2CQOA 3FPUB 2ZTDA 1EY6A 1TKWB 3PIO3 3L3OC 1PZID 1PH9A 4BXXG 2JA7B 2ZJRA 3LNNA 5IGBA 5IIFA 1Y1WH 3J80L 2IX1A 1IHZA 2IX0A 2R61A 1AFPA 3GTJH 4LFCL 2JK8A 4IFDH 2OTLA 3MFGA 4KKUA 1F2YA 3A8KE 4GNXB 4JV5Q 1TXYA 2HD3A 1Y1VB 1XMOQ 3L9AX 3T4AC 4DU9A 3VR4A 2UUAL 1S4ZA 2PQAB 2F0HA 1B7YB 2A68C 3BDCA 1A63A 2DY8A 3K5NA 1Q7YC 3J80E 1EYDA 4KMUC 3V96A 2Q8IB 3OWEB 4B3TQ 1BCPD 1PZKD 4ZYSA 1I4HA 4DR1Q 3PO2G 2A69C 4DXFA 2EOTA 4ZUIA 3D6WA 2A68D 4LF6Q 4DV0Q 3MXPA 5KNDA 3H0GH 1N32L 2CKZB 2E75C 1JCKB 4IOCA 4P75A 1UAPA 2I46A 1KHIA 2UUCL 3H6MA 4L5SA 3PUVA 3RD4A 1SMXA 2NN6G 2OF1A 4NB3A 3J7AV 2FJ2A 1FR3A 2EY2A 2QF7A 1CA5A 2F3IA 2UXDQ 3PIOA 2F0VA 1VQ4A 4AH6A 1AH9A 1SYCA 3SK6A 4C2MH 3D3RA 4BY7H 2A6HC 1EEFD 1EL0A 1VQNA 1R9TB 4BBSB 4A3IB 2LSSA 1Y14B 4NW2A 5IP7G 1OXTA 3HOYH 5K36G 1ILPA 1YNXA 1TWFB 3T13A 1K8OA 1G8ZD 2E74C 2OEOA 1L1OC 5AJ3Q 5FJ8H 5HY6A 2J4XA 2F0PA 1BBXC 2FFKB 5E3FA 4RGTA 2LS01 1E24A 4JI3L 5E4WC 1NBWA 2E2HH 1A2TA 3L2PA 1M4VA 2KOLA 5M3FB 4JOIC 3U9SA 4DKAC 1WD0A 1SNPA 3S15H 2PQEA 3I55A 4IFDI 2JA7G 3I72A 5ELNA 3D4RA 2K50A 4KN7C 3KJOA 5D3DA 2KVMA 4KJNA 2LFNA 2OQ0A 2CW0C 3TP6A 1YNJD 2K03A 2K14A 1VQGA 2I5LX 4HMIA 1EIFA 3GD7A 2D0OA 2WAQB 3HOUH 4IJLA 1R4PB 2UU9Q 4E6IA 4AIMA 4A3GH 4JG2A 4A3DG 2H4OA 1TU2B 3HEJA 4NPSA 4A93H 1WTXA 3CCEA 1OO9B 4RCOA 2UUAQ 1B3AA 4LF8Q 4A3FB 1W6JA 1VF7A 1SNDA 2R7ZG 2XWBB 4QGUA 1EWHA 2NVYB 3J7YW 4Q5VA 1EYGA 2C35B 4BY7B 3CQZH 1TY2A 3MXNB 2ICIA 2FINB 1GUWA 2JQOA 3OTOL 1IBKQ 1QNUA 4DV2Q 1FD7D 4JI6L 1QILA 4H0LC 3F2BA 1TWHB 5KYIA 2PQAA 3UDFA 1ONLA 3W1GA 4CJ0B 4DV6Q 2E8GA 3HRZC 5LL6S 3PF4A 3HGBA 1PLFA 4G7HC 2G5DA 4CHTB 3UE1A 5C44H 1B4OA 2LY7A 4JK1C 2WFWA 2BDNA 3BJUA 1IYVA 4X3SA 3SVMA 3HOUB 4A75A 4GKKQ 2KEDA 4LF4Q 4A3MH 3HOVH 4L5QA 2KEEA 5C44B 5C4XH 2ZXRA 5C0XG 1TWFH 4DR4Q 1FL0A 1SR3A 1JORA 3N6RA 1B8AA 1SMYC 1EY9A 2KECA 3LWUA 1V1QA 1MGSA 2DNEA 4RCNA 2HHHQ 2RSNA 2X69A 2ICEC 1DGSA 2EJFC 2E2IH 3CMAA 4CDEC 5M9OA 2E5LQ 1W3SA 3H09A 1RD9D 2RHSB 1HA5A 4PZ8A 3KBXA 2JA6H 4N9TA 2L15A 1KAWA 5IT9L 4JBKA 1SSOA 1VQIA 1QNKA 1YJWA 2NVQH 4FF1A 4ZKCB 4H7BA 1WCMG 4V0BA 4CDFC 5JPNC 1D5ZC 3OPOA 5CBAE 1L0XB 2Z8LA 4IURA 2LKVA 1STAA 4GKJQ 2JA7H 3A8IE 3F1ZA 2PNHA 3OW7A 2D2CC 4R8NA 2KQ3A 1HUMA 1BBWA 1EY7A 3FKIH 3KLSX 2TMPA 1PA6A 3Q24A 2B8FA 4DV5Q 1Y69U 3T16A 1PH5A 2MJ8A 3NUCA 5KNBA 1EY4A 1M90C 3U4VA 1PDQA 2F0FA 2R92G 4BBRG 1KABA 1BOSA 2R93G 5CV8A 2EJGC 3E9HA 4CBVA 4A3MG 3GTOH 4APVA 3HOVG 2F0KA 5TSSA 4POGA 1G2SA 2EZVA 2UUCQ 5ISRA 1A6XA 3STBD 1CKOA 2EY1A 4G7OC 5IGFA 1H95A 2Z0SA 3P1HA 2MO1A 1RCVD 3NWTA 2IL8A 4GLAC 1VQ7A 3HKZG 5JJLA 3MC0B 4NKLA 1QJOA 2F0EA 1R9TH 2F0WA 3T53B 1ENCA 1H9SB 3HKZB 5CV5A 3NPPA 4CKEA 3E0EA 2GN5A 4DAMA 4A3LH 1KTKA 1CSPA 2K6AA 2V4DA 1SNMA 3FDTA 1N34L 4OXPA 3JAML 3PIP3 3HOZB 4FVMA 2QDLA 1I50H 4PV1C 1I3QH 4F88A 3OMCA 4EX5A 3OYYA 4AYBG 5L37A 3PUWA 3E3XA 4XQJA 4L5RC 1CTMA 4PMCA 2UXBL 4Z9CB 1F2ZA 3KBGA 1B1ZA 1SBBB 1U4RA 1Q82C 2PZWA 1HXYD 3S9WA 5FK9C 4A3KB 5DM63 1SE3A 1IW7C 4JYAL 1SYGA 5ELBA 4OWWB 3M7NA 1TS3A 4K5WA 2OXPA 3KLRA 3NTHA 4XQQA 4DV5L 1VQLA 3PO2B 3FKIB 4NDXA 4IUNA 4DN4M 1KIXA 1X3QA 3WWVA 1SAPA 1D6EC 1UE1A 5CORA 4JC0A 2EDGA 4LF7L 3K0XA 2A19A 2J7ZA 2RF4A 5FLXE 1EY0A 2I0QA 3C1FA 1NMGA 4HJ9A 2C9OA 1IBMQ 3EA6A 4DR2Q 1KNEA 3PGZA 3S17H 5KEEA 1MKHA 4C3JH 4HCEA 1N33L 4FXKC 1I6HH 5C6AA 4CJ1B 2AWNA 3CRLC 4YY3Q 2Z4IA 1SE8A 1CM9A 2B39A 3O13A 1XYIA 1A3TA 3E5SA 5K36H 2KCTA 5IP7H 4RGMA 3B6YA 3RLFA 1U5KA 3NTKA 4YWKA 1K0SA 1X3PA 3N52A 1O7YA 5C44G 2RA4A 1JICA 3U4ZA 1X65A 4IUTA 2XWJB 2AQ3B 4J15A 3KDFA 2K5VA 5C4XB 1PTOC 4M8AA 4C3JB 4GLVB 1LT5D 1GUNA 1VQHA 3RN2A 4DR7L 4B3RL 2NYZD 5IYDG 4HJAA 1A3UA 1YEZA 1Z47A 1QWYA 3TBIB 4GKKL 3A55A 2HDLA 3X3NA 5IWAL 1F9SA 3KUPA 1LTRD 2XIWA 5D3IB 4X66Q 5C5LA 3DMUA 4DV4Q 2VNUD 4JBWA 3QB3A 4RHRA 4O2DA 3IRBA 3NE5B 4A93G 2BA1A 3V05A 1EZ6A 1ESFA 2BH8A 3NELA 4NMZA 5C4ZA 3PO2H 2JA8H 1JT8A 4CDCC 4LW1A 1L0WA 1PRTC 4MNOA 1H9JA 4J6HA 4OO1H 3QOJA 3PO3H 1A3VA 1IBKL 3AEVA 1Q86C 4HR7B 5JPMC 3J80i 1WYDA 3VR5A 1HNWQ 1HZCA 3VR2A 4ZKBB 4QL5A 5IT9E 1QVCA 2ENBA 1S5DD 1LACA 3GV6A 3I4OA 1IXRA 1CFMA 3KF6B 1DOLA 1YNNC 3CCQA 1I4XA 4X3UA 4BY1G 3EBEA 1VQJA 4EGVA 1F9QA 3CD6A 5C4HA 1D8LA 3GV3A 3G7LA 3SK4A 2WKCA 5C0XI 4AQYQ 2GVBA 4A3DB 5AJ3L 2CCZA 1M8AA 3J80c 1IBML 1TWCB 1H9RA 3HOYG 1EQRA 4N9PA 3UDXA 3S2HH 2YV5A 3GTPH 4IN3A 1Y8NB 2A1AA 4DV3Q 1HUNA 3HOXB 3L0OA 3I7FA 1S5FD 3MVVA 4L8JA 3S15B 5DEHA 2K01A 1OXUA 5M3FH 2R6GA 2QW7A 1GXDC 1FNVA 4IO9A 2B2UA 5CV6A 4LNQA 2E2HB 3VYUA 4RFBA 1HR0W 1P16A 3A8JE 3STBC 3CP0A 5FLXL 3HOXG 2WB1E 1JC7A 1EWCA 1O80A 5E1FA 3GTPB 1K8GA 4B3MQ 1KLGD 1FGBD 3HOYB 2BA0A 3CC4A 1FJGQ 3NQTA 2EXDA 2DN8A 1HR0L 2YTXA 3H0GG 5FLMG 4RMFA 1GD7A 2ZT9C 1QOHA 1IKLA 3OWFA 3IFDA 4JBJA 4OIJA 1CI3M 2L9HA 4A3IG 4PQXA 1JWMD 1Y8PB 3IFTA 1PYWD 1E7ZA 2PZTA 3KF8B 4ILWA 4I7ZC 5IODA 4KD3A 2QGQA 3I4NH 3K5OA 4UY8C 1TWAB 2PI2A 1XJVA 1J5EL 2KBNA 3M4OH 1PVOA 4KJOA 3EROA 2B2TA 3Q6SA 2JE6I 4HSVA 3K7AH 3G4SA 1K83B 2CFMA 2F0UA 1WTOA 1RODA 1WTQA 4ZRZA 4DV0L 2K04A 3S2HB 3WOFA 3ICEA 1SNOA 2YU9H 2F0JA 2NBFA 1G6PA 1O7ZA 2NVXH 3QJYA 4K2KA 1VQFA 4IUVA 2A6ED 4L5TA 2PPBC 4CDDC 4OO1G 5CV9A 1NR4A 3TZUA 3KLSA 1WVLA 3OIPA 2RDHA 4ABNA 3D6CA 3A54A 5DLQE 2Q8RE 1NUCA 5J22A 1CZWA 1VQ8A 2F4IA 4O42A 3J7A5 2NZHA 3H91A 5IOCA 4GKJL 3E6ZX 2B63G 4JV5L 4LF6L 4C3HH 1Y1WB 1TWCH 4LFAL 3GTLH 1TR5A 4FXDA 4X65Q 5JJIA 1Q8KA 3G48A 4LF5Q 4KD4A 4WJ3M 1C4QA 5FKAC 4A3BG 3MZ5A 4IQZA 4DAYB 4G7ZC 4I7AA 4A76A 3U50C 1K8AC 1JOKA 1RL2A 1GVPA 2LMCB 5KIXA 2O2LD 1ET6A 1STEA 1NNXA 4L6TB 4JI5L 5CV4A 1RTNA 4RWSC 1YZ6A 2NB0A 3I3CA 3PIPA 4A3GB 1LYLA 4GOPA 4OWTB 1NMFA 3Q8DA 4OWXB 4EQ5A 1WTVA 3EFXD 4IPHA 1PTOH 1RJTA 5M5WB 2WV6D 3RR5A 1EOTA 5C5MA 4XT1B 4H02A 4YWMA 3HFZB 1Q1BA 1K73C 1GKHA 2WAQG 4FP5D 3KF8A 4HSPA 5EQ0A 2MGSA 2Q2IA 2A73B 2F0OA 3S24A 1VQPA 4A3DH 2PW5A 3RN5A 2VUMG 1JJGA 4CJ2C 2KCCA 2Z1CA 2E2JH 4YWLA 1C8CA 1OXXK 4UDUC 3W1BA 1A8VA 1PFMA 2K75A 3T1YL 5CMDA 4UHVA 4AYBB 1OTCA 2PMZE 4QF4A 4BS9A 2I5HA 3SK8A 1RIPA 4DGZA 2QDBA 4P74A 4DR3L 4DK0A 3HP3A 2E2JB 1Z7TA 2NVTH 1HR0Q 2VUMH 2FMMA 4NXNL 5LMUQ 4DR5Q 3CF5A 1HTLD 2NZOA 4YCWA 3MXNA 4JI0Q 5C0XJ 2VY3A 1Q1EA 5T1GA 4FYDA 4C1NI 1VMPA 4X3KA 1IZ6A 3PV0A 1B9NA 2K4KA 1STYA 5I9OA 3H15A 5C4XG 1AW7A 2X6LA 4A3EH 4I65A 2J0TD 1E1OA 1KDCA 5FJ8G 5FO8B 5IYDH 4HJ7A 3K7AB 1QE6A 4V190 3DLLA 2L12A 4QIWB 3BVMA 3BU2A 2CH4W 4DV3L 2N78A 3CKIB 3K6OA 2RSOA 3P7JA 1LTGD 2ZTEA 3UDIA 4Y52H 2HQLA 5EBDA 2SDFA 4GOPC 1SYDA 1YHAA 3WOEA 4HIOA 2UUBQ 2WINB 2O5IC 3E9IA 3GTGH 3M3YB 4JI2Q 2NN6H 4QQBX 1IYUA 1SMYD 2F0DA 4WJ4A 2B29A 2Y0SB 1O7LA 2A69D 5M3MG 1NAPA 4ZAIA 1BO0A 1OXSC 1IL8A 2PI2E 5CC4A 2EVBA 1L0YB 3SE0A 2RCFA 4KHVA 2KJXA 5GAGC 3RZDH 1HNXQ 1M1KC 3FKIG 2Q2HA 3CCMA 5KNCA 4EQNA 3HZXA 4MHEA 3W3AA 5J39A 3A0JA 1JE5A 4PG3A 4HAEA 4ALPA 1EFID 3AFPA 1HFNA 4PZ6A 4NXNQ 1EFWA 3VR6A 3NHHA 1Y1VG 1BF4A 1BQQT 3I91A 1E0BA 2AQ1B 4LF9Q 1OXVA 2E2IB 1BCPF 4QY7A 4LFBQ 1PH2A 1JOQA 4DV1Q 1K9MC 4WFN3 3C3LA 1Y8OB 4G4KA 4K8IA 1ESRA 1VQAA 1DCZA 2RHQB 1VCIA 2YU9B 1UUPA 3KDFB 2M00A 2JYOA 5IGCA 1MBYA 2JN4A 1S3OA 2KHSA 4P2CB 1H9KA 1ASZA 4R9WA 3H3VI 4RG1A 2F52A 3QR8A 3TMEA 3WDNA 4OHJA 2F0LA 1E1TA 4X62L 3AFQA 2D9UA 3I4NG 1ZYRD 3MTSA 3GTKH 1X3EA 2NVQB 1LT4D 1VMCA 1TY0A 3A74A 4JOIA 3K0YA 3J81j 4K8JA 4DR7Q 4B3RQ 3PQIA 1NSNS 5GQOA 1O78A 1NR2A 5COYA 4BWGB 3DUZA 1E2ZA 2VXWA 4G57A 2O5JC 5LMNL 1HZ9A 4RKBA 2F1MA 1L1OA 4HIDA 3F2DA 2CQAA 1YIJA 3JAMc 3PF5A 3R3OA 5JEAJ 1SJHD 4WRDA 4DUYL 3NSWA 3ULJA 1E2WA 1B44D 3NTIA 4ZLTF 2HIVA 4GLXA 4YCUA 1Q90A 1V1OA 1VS0A 1JWSD 3PMFA 4LFBL 4KTAA 5JVH3 3DWQA 2B2VA 3T51B 3QWNA 3T1HQ 2ZJPA 4HMJA 4TKOB 3U58A 4QUFA 3ULPA 2Y0SE 4LF7Q 1MSHA 2FHTA 3MXGA 5D14A 1YI2A 1HCZA 3BZKA 2G9HD 3OSOA 1IBLQ 3CCUA 2IWHA 2VQFQ 3FVQA 3UI2A 1HJPA 2A6HD 5JOBA 2SNMA 1U4LA 1GUOA 3UE0A 1B53A 3FP9A 4DF7A 3SHLA 4A3GG 5C3EH 3CCVA 3TP5A 2EQSA 1QVGA 4DV2L 1WCMH 4YY3L 1MD2D 1J9OA 4OELB 2B2UC 4WORA 5ELDA 4GN5A 2XRQD 1EWIA 5JEAG 1KLUD 1ET9A 4X64L 2K7VA 4LUZA 4ULLA 1JOOA 4A3MB 3HOVB 1H9SA 2NZ1D 1C7YA 3ZJYC 1O7IA 2NVYH 1YHQA 2DJGC 2F4VL 4LFAQ 4JW0A 1FVIA 2IT1A 1EQVA 4UP9A 5JJKA 2KHJA 3K57A 4IFDG 1HZAA 1ZEQX 4LF8L 2OTJA 1RDPD 3M4YA 2EYLA 3S2DH 1TQOA 1G291 1B9MA 3QOLA 4UP7A 2B63B 1PYBA 4BXXH 2E76C 4RH6A 1TVXA 2WAQE 3I90A 1FNWA 1HZBA 1JR0D 4IPDA 4DUZQ 4ZCKA 4TQUS 1WOCA 2F0MA 1WCMB 1W6KA 3FMCA 4KLKA 4A3FH 1R4QB 3BVGA 1SNCA 1MIUA 2ZXPA 5M5YH 3OOCA 1A62A 3DEOA 4LFCQ 1NJIC 3BDLA 4P71A 4H13C 4Y7NH 3GTKB 2ASBA 1F2MA 3G6EA 4K0KL 3S16B 2K5DA 4JCVE 4GZYC 4QCLA 1LTAD 4Y7NB 1I50B 2KHIA 2BCOA 1G6ZA 2P5ZX 4DV7Q 3CPWA 1FGUA 1GOZA 1DJRD 5KRUA 4N8FA 4CGYB 5GAEC 2R7ZH 1KC8C 1DYQA 5BN5A 1IBLL 4KI0A 1K3BC 3R2IA 5IGGA 1LTTD 2KCNA 3Q23A 1BCPB 1G51A 4MN3A 1LV9A 1TIID 4HIMA 4KY5A 1UNSA 2K5HA 2QKIC 3T56B 1KRTA 5ELFA 2JEBI 4QJFA 1ICWA 3OIQA 1CKMA 2Z6KA 1D5XC 1NTGA 3BZCA 3FRPB 5ELEA 4P73A 4JBMA 4KV6A 1UEAB 1JJ2A 3IL8A 2JP1A 3VA5A 1I5FA 4A3EG 4DK1A 2NTSA 1A0IA 4ODGA 1KD1C 1K28A 3NK9A 1YJNA 1SEBD 2F4VQ 1PMRA 4F7XA 2EYJA 1N32Q 2IX3A 2DJFC 3RLNA 3PO3G 4X3TA 3I4LA 1NE3A 3C2PA 5CR3A 4N8X1 2JEAI 1BDOA 1FJGL 1I4QA 2MP1A 3FEWX 1I4GA 4BBSG 1QUQB 1RF2D 2ID0A 1IL2A 4R4QA 1YHBA 1JB3A 4L63B 4YIJA 1K3RA 4LF4L 2Z6KC 3VYTA 1KAAA 3D0FA 2BOSA 2Z6BA 1T5EA 1ZYRC 1EIHA 4IUQA 3LGJA 5FLMH 2NTTA 3S1MB 1FNUA 3KJPA 4A3LG 4JI1L 1PRTD 3X3MA 3HS0C 4EVOA 1U9RA 1EEID 1KXLA 2EYPA 4DA2A 2EY6A 3ITPA 2RQXA 1JE4A 3M9BA 5D65A 3Q22A 3MHBA 1EYCA 2VQEL 3TS2A 1PRTF 1JJCB 4EQPA 1D1IA 3D8GA 4LWCA 4XYQA 4DUYQ 2MHVA 3M3YH 3CAMA 1SXTA 3MEHA 2K5WA 1Q3LA 1BUVT 3VR3A 4C3IG 2D5DA 4KK7A 5F2DA 3VYRA 3NBHA 4JI7L 1AEXA 2BDOA 3GTOB 4C3JG 4TRDA 3CRKC 4JI8Q 2WACA 2XN9C 2HQEA 2R7DA 2VL6A 1RHPA 4HJ8A 5LHY1 5LMNW 3M7GA 5AFWA 4POFA 1E3PA 4DAPA 1IKMA 1AE2A 2MPMA 2AUJD 5IT9c 4IPCA 1I4PA 1PH7A 2OWOA 5C3XA 3GO5A 2HCCA 1A15A 5IY0A 1VQMA 1EYAA 3OMGA 2H1EA 2HT1A 1S5ED 3J81c 4HIKA 3D4DA 4K14A 3CQZB 3TREA 2B63H 1J5EQ 3HOWB 2M2LA 2KUMA 4KY6A 4DNIA 3TSSA 2KENA 2JSOA 1X9NA 1UEBA 2NVTB 2R7ZB 4A3CH 3D4WA 2KCMA 3P20A 4DAVA 4K6DA 4DK3C 2O4XA 1Y1VH 3PUZA 2GA4B 3KLWA 1ENAA 2L4NA 4X62Q 2JJQA 1VQBA 4K5XA 3SXHA 4BY1H 1HTPA 3AMUA 1LM0A 3R8BA 5IP9G 4A3CG 3CW2C 2AUKA 5LMUL 1L1OB 4KKSA 5J1ZA 2CWAA 5GROA 5M5YB 1WTPA 3QO2A 2EY5A 1W2BA 3W5OA 3S1QB 2UXDL 2QCPX 3SDZA 5M3MH 2K05A 3PUXA 4ME5A 5IYBG 1AN8A 5GADC 1SRUA 3CCRA 4AQYL 5EPKA 2K28A 2WIIB 4K5VA 5EJWA 4DXGA 4H44C 2ZM6L 1HRJA 1EY5A 2IHFA 1XPOA 2D62A 5IE8A 2C5CA 3DM3A 1LT6D 4UP8A 2R7FA 5J3BA 2SEBD 3K80C 4J8QA 1X56A 1GUGA 3I4MG 4JPBW 4C56C 2ES2A 1HNXL 2GVAA 2A5HA 1B50A 2JA6B 5DNFA 5IYCH 4GNXA 3PCOB 3S1RH 5T1IA 2DNCA 3W2DA 1GM5A 3I4MH 1B2TA 3LX0A 4A4IA 1Q46A 1RKNA 2CHBD 2MUYA 3K81C 4JVZA 3GQBA 1DD2A 4RA8A 2XRSD 4B3SL 3F2CA 1SROA 4DV7L 1AE3A 1G91A 5BR8L 2VB3X 3G71A 1CHPD 4OIKA 1TWGB 4KN4C 4CKBA 1VQDA 3MAQA 3I4MB 3GTLB 1HPCA 4GN3B 1Z6HA 1PRTB 2QILA 5CBEE 2Z9HA 1CKNB 3HKSA 4IJHA 3Q0AA 1FYCA 4LK1C 1EU4A 3NP8A 5I2XA 1VQCA 3VYSA 5ELOA 3P75A 3S1NH 1LT3D 4HTHA 1PV4A 1T5XD 2EYMA 1Q12A 1KQSA 1EOVA 2JA6G 3D31A 3RUZA 4PZ7A 3NBHB 2ZM6Q 1PXUA 1B3QA 4GNXC 3J81L 1U4PA 2OQKA 1SLJA 2PNRC 5FOBB 5C3EB 4B3SQ 4MTKA 2EYHA 3MWYW 3S1QH 1Z9FA 4FDBA 1SFOB 4F87A 2R93B 3J7ZC 4IZ8A 4RAUC 1TWHH 3KK7A 2R92B 1Q81C 2PCFB 3SR1A 1YITA 3RMHA 2E2DC 5KGUA 3VA7A 1CT1D 4KHZA 4DV6L 2N55A 1K8MA 1SE2A 3BYYB 2RDGA 3EN2A 1XNQQ 2F0QA 2X6GA 3I70A 5M5XB 3RZOH 3S14H 4ZUJA 1CUKA 1PTOF 1X6OA 4B9WA 3UDGA 2E5LL 2Q2UA 3M85A 5BN4A 3BG3A 4NXMQ 3GTQB 3J81i 2CVRA 4KKTA 5LMNQ 4J1MA 2N88A 5JAVA 2JA5H 4LUOA 4DV4L 1QUQA 4RKLA 4OX9Q 3SEBA 4RGOS 3GTQH 4LMQD 1VQOA 1XX8A 3CCLA 5E7NA 3IAYA 3VDYA 3HOWG 1J8IA 1EY8A 1KL9A 1GHKA 4LAAA 3GTMH 1BVSA 3DHQA 1CK1A 2OCEA 4B3TL 4M1UB 3GDEA 1WTRA 4DUZL 3JC66 1TS2A 4C3IB 3HKZE 1U4MA 4YHHQ 1SN8A 4JI1Q 4MIUA 4FF3A 2Y0SG 3OW2A 5G3LF 1C48A 1D5MC 3NQIA 4IOAA 3MFYA 1U0LA 5I9PA 4FF4A 2NWGA 2XTIA 4FF2A 4B3ML 4YHHL 1C0AA 1I4RA 3QIAA 3DWPA 4GS3A 1KNAA 4RHSA 5I6WA 3I2ZA 4A3FG 3PUYA 1PH4A 1WI5A 3NWSA 1EU3A 1XNQL 5I4DA 1WTHA 4GOPB 3OTOQ 1LTBD 2VUMB 3HOZG 2B2WA 2K52A 2ZXOA 3ERQA 3BS1A 5KYLA 1XPRA 3S1NB 3S1MH 2F0GA 2VB2X 3NENA 2H5XA 3GP7A 1Q8IA 4X65L 1D2BA 4JI7Q 4O0AA 5JVG3 3K58A 1MI2A 2K33A 3RZDB 1YNJC 1DXMA 3GTJB 3L7ZC 1HH2P 1HA6A 2CW0D 3H3VC 4XYOA 3ZYYX 1V1PA 1F77A 3H94A 4S3SA 5DM73 3H0GB 4P72A 4HN7A 3PO3B 2N3SA 2MFIA 2WKDA 1V9PA 1NY4A 2RVLA 3T1HL 2F03A 1XPUA 5IGEA 1SJED 3DM1A 3GTGB 2QEXA 1I94Q 2KA7A 2B2VC 1BBUA 4B9XA 2AHOB 1HFGA 2UUBL 4IPGA 3NEMA 1CHQD 4BBRB 1UE5A 1SNQA 3IKJA 1UE6A 3BYTB 5GAHC 2SNSA 1AZPA 4A3BB 3H3VH 2V1CC 1STGA 1SYBA 3SK5A 4ME3A 2K32A 1KDBA 4ZQ3A 1GUSA 2NN6I 4Q0FA 2UU9L 2A8VA 2UXCQ 4IFDJ 5EBCA 1PH1A 2FMCA 4JI3Q 1K0RA 4B08A 1BXTA 1F9PA 4TSSA 2ZTCA 2ALYB 4A3EB 2EYFA 3CCJA 4UAIA 4BA1I 1JQYD 3NXWA 5EPLA 1XNRQ 1AP0A 3EIVA 3J81E 1SDFA 1XMOL 4MTNA 2HUGA 2AWOA 1I94L 4KY7A 1HNZL 2CH4A 4EQOA 3ND9A 4DPGA 4JI4L 1WJJA 2IW3A 3MEFA 4C1NK 3ND8A 2M9VA 1LO5D 5BR8Q 1EIYB 3R2TA 2I5MX 4X6AH 5CYUA 3EJIA 5M5WH 1VQ9A 1PFSA 1CQVA 1KRSA 1LTLA 2JXMB 1A2UA 2EIFA 4A3JG 4ID6A 1PTOD 3EQLC 5FO9B 2L1BA 4OEMB 4U68A 4K0KQ 4A3JB 1DM0B 4R4IA 1N9WA 2NVXB 2SOBA 3TZDA 1PHJA 1Y1WG 2WP8J 2PMZB 3A56A 4IUPA 1TT2A 2N49A 4DNRB 1PFBA 3RLOA 3HOUG 3CHBD 1GUTA 3FPPA 2K5QA 5ELCA 2VQEQ 1X32A 2JA8G 4BA2I 2XSCA 1PZJD 4OONA 2F0IA 1GJXA 5JEAH 1EZ8A 1LLRD 3J7AF 1PH6A 1F9RA 2RBMA 5NUCA 1II3A 4HJ5A 5A2QE 1EIGA 3CC2A 2CWPA 2RDFA 4QB4A 4HEDA 5JJZA 2LXKA 5IWAQ 3GTMB 4R8IA 1XTDA 2I07B 3CU7A 3K8AA 4XDXA 1VF5C 5EPJA 1LABA 5A2QL 1XMQQ 4HCSA 4JI5Q 3K59A 5EAYA 5G3LD 3E0JA 1QVFA 2BE5D 5FO7B 4F8MA 2K5NA 2XNAC 2MQHA 3F8TA 5C4JH 5FLXc 2Q2TA 4QIWE 2JA5B 2B2WC 4DFAA 2NUCA 2TSSA 1D1KA 1PYSB 2VZAA 4KHPQ 1LTID 1DOKA 2DGYA 3I73A 3C46A 2WB1B 2IY5B 2D0PA 3KF6A 5LL6X 1SYEA 4C3HB 1S40A 1EQQA 4XTCS 4IUUA 3G6JB 3TEHB 1I6HB 2HCIA 3S14B 3LWEA 3RZOB 5M5XH 1XWEA 1P8LA 3BDOA 3R93A 4FNFA 3I56A 1PTOB 1TS5A 1B70B 5K5PA 4MZ9A 4RGNA 1TWAH 4OGQC 4GN4B 4A3BH 3KYHC 1YVCA
chains in the Genus database with same CATH topology
1CA6A 2F0NA 1EQTA 3DWAA 3F2UA 4C3HG 5C3WA 1SYFA 2Q8TA 2PW7A 1XTCD 1S5BD 3OHXC 3ONAB 3TN2A 2L5TA 2L55A 3M4OB 1STNA 4QMGA 3HG9A 5I2YA 2AQ2B 1VDZA 1AZQA 1QB5D 3I4NB 2XVSA 3I8ZA 1I3QB 4O1NA 3V2TA 1SE4A 4PNYA 5CV7A 4OO1I 4CKCA 1BNZA 2L0CA 2EJMA 5I6YA 1ML0D 4NP5A 5IGDA 1PFNA 2B2YC 1IW7D 2JA8B 2YYZA 2K1BA 1QCBD 3K5LA 4WJWA 2R3ZA 1S5CD 5EKIA 3K5MA 2B2TC 1H9MA 3EVQA 4LJZC 5C0XH 5DAUA 4IALA 1JWUD 2PYKA 3C1EA 5E4XA 1HQRD 1V1PB 1ZXTA 4K6LA 5CGKA 3DEPA 1ZKOA 5HURA 1DONA 2DY7A 1G2TA 1HQMC 1LTSD 5M3MB 1F2LA 4FO2A 3NBIA 1V43A 2RKSA 1E2VA 5A35A 1WTWA 2G9DA 4XT3B 1NCVA 5C4JB 1BCPC 4K2LA 2PO4A 3S2DB 2EYOA 3AB9A 3S17B 5BN3A 1MSGA 2F0SA 4PMWA 1YNND 2F0TA 1XXGA 4C2MB 3DXJC 2Z4HA 1ENFA 1STHA 2EXZA 2B2YA 2F3VA 3A7AB 3S1RB 2EE1A 2A74C 2BE5C 4DAYA 1DOMA 2OT2A 2B8GA 3TDQA 3QG1A 5HGTA 1WD1A 4OL7A 3TP8A 4BY1B 1QG7A 5EGTA 1TS4A 1GHJA 3TP7A 2IJ0A 1KDAA 2L11A 2QEJC 1I6VC 3AU7A 2A6EC 1V8QA 3MXUA 3BZDB 3MA2B 4XQNA 1ILQA 1RTOA 1DZ1A 3A7LA 4DNTB 2EPBA 5EKKA 4A93B 2F3WA 4XXEA 2IPKD 2PZUA 1HHVA 1STBA 4FXGC 3URYA 3U9OA 4U673 1CQFA 4ZK9B 2HDMA 1CZGA 1BR9A 5EKLA 4PMBA 4XIGS 3JAME 3BVZA 4QUCA 3FPUB 1EY6A 1TKWB 3PIO3 3L3OC 1PZID 2JA7B 3LNNA 5IGBA 5IIFA 3J80L 2IX1A 1IHZA 2IX0A 2R61A 1AFPA 4IFDH 3MFGA 4KKUA 1F2YA 3A8KE 1Y1VB 3L9AX 3T4AC 4DU9A 3VR4A 1S4ZA 2F0HA 2A68C 3BDCA 2DY8A 3K5NA 3J80E 1EYDA 4KMUC 3V96A 2Q8IB 3OWEB 1BCPD 1PZKD 4ZYSA 1I4HA 2A69C 4DXFA 2EOTA 4ZUIA 3D6WA 2A68D 3MXPA 5KNDA 2E75C 1JCKB 1UAPA 2I46A 3H6MA 3PUVA 3RD4A 2NN6G 2OF1A 3J7AV 2FJ2A 1FR3A 2EY2A 2QF7A 1CA5A 2F0VA 1SYCA 3SK6A 3D3RA 2A6HC 1EEFD 1EL0A 1R9TB 4BBSB 4A3IB 4NW2A 1OXTA 5K36G 1ILPA 1TWFB 3T13A 1K8OA 1G8ZD 2E74C 2OEOA 2J4XA 2F0PA 1BBXC 2FFKB 5E3FA 4RGTA 2LS01 5E4WC 1A2TA 1M4VA 2KOLA 5M3FB 3U9SA 1WD0A 1SNPA 2PQEA 4IFDI 3I72A 3D4RA 4KN7C 5D3DA 2KVMA 4KJNA 2LFNA 2CW0C 3TP6A 1YNJD 2K03A 4HMIA 3GD7A 2WAQB 1R4PB 4E6IA 2H4OA 1TU2B 3HEJA 1WTXA 1OO9B 4RCOA 1B3AA 4A3FB 1W6JA 1VF7A 1SNDA 2XWBB 1EWHA 2NVYB 3J7YW 4Q5VA 4BY7B 1TY2A 2ICIA 2FINB 1GUWA 1QNUA 1FD7D 1QILA 4H0LC 1TWHB 5KYIA 1ONLA 4CJ0B 5LL6S 3HRZC 3HGBA 1PLFA 4G7HC 4CHTB 1B4OA 2LY7A 4JK1C 2BDNA 1IYVA 4X3SA 3SVMA 3HOUB 2KEDA 2KEEA 5C44B 2ZXRA 5C0XG 1JORA 3N6RA 1SMYC 1EY9A 2KECA 3LWUA 1MGSA 2DNEA 4RCNA 2RSNA 2X69A 2ICEC 2EJFC 5M9OA 3H09A 1RD9D 1HA5A 3KBXA 4N9TA 5IT9L 1SSOA 1QNKA 4FF1A 4ZKCB 4H7BA 4V0BA 5JPNC 1D5ZC 3OPOA 5CBAE 1L0XB 2Z8LA 4IURA 2LKVA 1STAA 3A8IE 3OW7A 2D2CC 4R8NA 2KQ3A 1HUMA 1EY7A 3KLSX 2TMPA 3Q24A 2B8FA 1Y69U 3T16A 2MJ8A 3NUCA 5KNBA 1EY4A 1PDQA 2F0FA 1KABA 1BOSA 5CV8A 2EJGC 4CBVA 2F0KA 5TSSA 1G2SA 2EZVA 5ISRA 1A6XA 2EY1A 4G7OC 5IGFA 3P1HA 1RCVD 3NWTA 2IL8A 3MC0B 4NKLA 1QJOA 2F0EA 2F0WA 3T53B 1ENCA 1H9SB 3HKZB 5CV5A 3NPPA 4CKEA 1KTKA 2K6AA 2V4DA 1SNMA 3FDTA 3JAML 3PIP3 3HOZB 4FVMA 4PV1C 4F88A 3OMCA 3PUWA 4XQJA 1CTMA 4PMCA 4Z9CB 1F2ZA 3KBGA 1B1ZA 1SBBB 1U4RA 2PZWA 1HXYD 3S9WA 5FK9C 4A3KB 5DM63 1SE3A 1IW7C 1SYGA 5ELBA 3M7NA 1TS3A 4K5WA 2OXPA 3KLRA 3NTHA 4XQQA 3PO2B 3FKIB 4NDXA 4IUNA 4DN4M 1X3QA 1SAPA 1D6EC 5CORA 2EDGA 2J7ZA 5FLXE 1EY0A 3C1FA 2C9OA 3EA6A 1KNEA 5KEEA 4HCEA 4FXKC 5C6AA 4CJ1B 2AWNA 3CRLC 2Z4IA 2B39A 1CM9A 3O13A 1XYIA 1A3TA 3E5SA 5K36H 4RGMA 3RLFA 3NTKA 1X3PA 3N52A 1O7YA 2RA4A 1JICA 4IUTA 2XWJB 2AQ3B 5C4XB 1PTOC 4M8AA 4C3JB 1LT5D 1GUNA 2NYZD 1A3UA 1Z47A 1QWYA 3TBIB 3A55A 2HDLA 3X3NA 1F9SA 3KUPA 1LTRD 2XIWA 5D3IB 5C5LA 3DMUA 2VNUD 4JBWA 3QB3A 4RHRA 3NE5B 2BA1A 3V05A 1EZ6A 1ESFA 4NMZA 5C4ZA 1PRTC 1H9JA 4J6HA 4OO1H 3QOJA 1A3VA 4HR7B 5JPMC 3VR5A 3VR2A 4ZKBB 5IT9E 2ENBA 1S5DD 1LACA 3GV6A 1CFMA 1DOLA 1YNNC 1I4XA 4X3UA 4EGVA 1F9QA 5C4HA 3GV3A 3G7LA 3SK4A 2WKCA 5C0XI 4A3DB 1M8AA 1TWCB 1H9RA 4N9PA 4IN3A 1Y8NB 1HUNA 3HOXB 1S5FD 3MVVA 4L8JA 3S15B 5DEHA 2K01A 1OXUA 2R6GA 1GXDC 1FNVA 2B2UA 5CV6A 2E2HB 3VYUA 4RFBA 3A8JE 5FLXL 1JC7A 1EWCA 1O80A 5E1FA 3GTPB 1KLGD 1FGBD 3HOYB 2BA0A 3NQTA 2DN8A 2ZT9C 1QOHA 1IKLA 3OWFA 3IFDA 4OIJA 1CI3M 2L9HA 4PQXA 1JWMD 1Y8PB 2PZTA 1PYWD 3IFTA 4ILWA 4I7ZC 5IODA 4KD3A 3K5OA 1TWAB 4KJOA 3EROA 2B2TA 3Q6SA 2JE6I 4HSVA 1K83B 2F0UA 1WTOA 1RODA 1WTQA 4ZRZA 2K04A 3S2HB 3WOFA 1SNOA 2F0JA 2NBFA 1O7ZA 3QJYA 4K2KA 4IUVA 2A6ED 2PPBC 4OO1G 5CV9A 1NR4A 3TZUA 3KLSA 1WVLA 3OIPA 2RDHA 4ABNA 3D6CA 3A54A 2Q8RE 1NUCA 5J22A 1CZWA 2F4IA 4O42A 5IOCA 3H91A 3E6ZX 1Y1WB 1TR5A 4FXDA 4KD4A 1C4QA 5FKAC 3MZ5A 4IQZA 4G7ZC 1JOKA 2LMCB 5KIXA 2O2LD 1ET6A 1STEA 4L6TB 5CV4A 1RTNA 4RWSC 2NB0A 3I3CA 4A3GB 1WTVA 3EFXD 1PTOH 1RJTA 5M5WB 2WV6D 1EOTA 5C5MA 4XT1B 1Q1BA 4FP5D 3KF8A 4HSPA 5EQ0A 2MGSA 2A73B 2F0OA 2PW5A 4CJ2C 2KCCA 2Z1CA 1C8CA 1OXXK 4UDUC 1PFMA 5CMDA 4AYBB 4QF4A 4BS9A 3SK8A 4DGZA 2QDBA 4DK0A 3HP3A 2E2JB 1Z7TA 2FMMA 1HTLD 3MXNA 5C0XJ 4FYDA 1Q1EA 5T1GA 4C1NI 1VMPA 4X3KA 3PV0A 1B9NA 1STYA 5I9OA 1AW7A 2X6LA 4I65A 2J0TD 1KDCA 5FO8B 3K7AB 1QE6A 4V190 2L12A 4QIWB 3BVMA 3CKIB 3K6OA 2RSOA 3P7JA 1LTGD 5EBDA 2SDFA 1SYDA 3WOEA 2WINB 2O5IC 3M3YB 2NN6H 1IYUA 1SMYD 2F0DA 2Y0SB 1O7LA 2A69D 1NAPA 4ZAIA 1BO0A 1OXSC 1IL8A 5CC4A 2EVBA 1L0YB 3SE0A 4KHVA 2KJXA 5KNCA 4EQNA 3HZXA 4MHEA 3W3AA 5J39A 4HAEA 1EFID 1HFNA 3VR6A 3NHHA 1BF4A 1BQQT 3I91A 1E0BA 2AQ1B 1OXVA 2E2IB 1BCPF 1JOQA 4WFN3 3C3LA 1Y8OB 4G4KA 4K8IA 1ESRA 1DCZA 1VCIA 2YU9B 1UUPA 2M00A 2JYOA 5IGCA 1MBYA 2KHSA 4P2CB 1H9KA 4R9WA 3TMEA 3WDNA 4OHJA 2F0LA 2D9UA 1ZYRD 3MTSA 2NVQB 1LT4D 1VMCA 1TY0A 3K0YA 4K8JA 1NSNS 1O78A 4BWGB 1NR2A 5COYA 3DUZA 1E2ZA 2VXWA 4G57A 2O5JC 4RKBA 2F1MA 2CQAA 3R3OA 5JEAJ 1SJHD 4WRDA 3NSWA 1E2WA 1B44D 3NTIA 4ZLTF 1Q90A 1V1OA 1JWSD 3PMFA 4KTAA 5JVH3 3DWQA 2B2VA 3T51B 3QWNA 4HMJA 4TKOB 4QUFA 1MSHA 2FHTA 3MXGA 5D14A 1HCZA 2G9HD 3OSOA 2IWHA 3FVQA 3UI2A 2A6HD 5JOBA 2SNMA 1U4LA 1GUOA 1B53A 4DF7A 3SHLA 3TP5A 1MD2D 1J9OA 4WORA 2B2UC 5ELDA 2XRQD 5JEAG 1KLUD 1ET9A 2K7VA 4ULLA 1JOOA 4A3MB 3HOVB 1H9SA 2NZ1D 2IT1A 1EQVA 3K57A 4IFDG 1ZEQX 1RDPD 3M4YA 2EYLA 1TQOA 1G291 1B9MA 3QOLA 2B63B 2E76C 4RH6A 1TVXA 3I90A 1FNWA 1JR0D 4TQUS 2F0MA 1WCMB 1W6KA 3FMCA 1R4QB 3BVGA 1SNCA 2ZXPA 3DEOA 3OOCA 3BDLA 4H13C 3GTKB 1F2MA 3S16B 2K5DA 4GZYC 4QCLA 1LTAD 4Y7NB 1I50B 2BCOA 1G6ZA 1GOZA 1DJRD 5KRUA 4CGYB 1DYQA 5BN5A 4KI0A 3R2IA 5IGGA 1LTTD 2KCNA 3Q23A 1BCPB 4MN3A 1LV9A 1TIID 4KY5A 1UNSA 2QKIC 3T56B 5ELFA 2JEBI 1ICWA 3OIQA 1D5XC 3FRPB 5ELEA 4KV6A 1UEAB 3IL8A 2JP1A 3VA5A 4DK1A 2NTSA 4ODGA 3NK9A 1SEBD 1PMRA 4F7XA 2EYJA 2IX3A 4X3TA 3I4LA 3C2PA 5CR3A 2JEAI 1BDOA 1I4QA 2MP1A 3FEWX 1I4GA 1RF2D 2ID0A 1JB3A 4L63B 4YIJA 3VYTA 1KAAA 2BOSA 1T5EA 1ZYRC 1EIHA 4IUQA 2NTTA 3S1MB 1FNUA 1PRTD 3X3MA 3HS0C 4EVOA 1U9RA 1EEID 2EYPA 4DA2A 2EY6A 3ITPA 2RQXA 1JE4A 5D65A 3Q22A 3MHBA 1EYCA 1PRTF 4EQPA 1D1IA 3D8GA 4XYQA 2MHVA 1SXTA 3MEHA 2K5WA 1Q3LA 1BUVT 3VR3A 4C3IG 2D5DA 4KK7A 5F2DA 3VYRA 3NBHA 1AEXA 2BDOA 3GTOB 4C3JG 4TRDA 3CRKC 2WACA 2XN9C 2HQEA 1RHPA 5LHY1 3M7GA 5AFWA 4DAPA 1IKMA 2MPMA 2AUJD 1I4PA 5C3XA 3GO5A 2HCCA 1A15A 1EYAA 3OMGA 2H1EA 1S5ED 3D4DA 4K14A 3CQZB 3HOWB 2M2LA 2KUMA 4KY6A 3TSSA 2JSOA 2NVTB 2R7ZB 3D4WA 3P20A 4DAVA 4K6DA 2O4XA 3PUZA 2GA4B 1ENAA 2L4NA 4K5XA 3SXHA 1HTPA 3AMUA 3R8BA 2AUKA 4KKSA 5J1ZA 5M5YB 1WTPA 3QO2A 2EY5A 3S1QB 2QCPX 3SDZA 2K05A 3PUXA 4ME5A 1AN8A 5EPKA 2K28A 2WIIB 4K5VA 5EJWA 4DXGA 4H44C 1HRJA 1EY5A 2D62A 2C5CA 1LT6D 2SEBD 4J8QA 1GUGA 4C56C 2A5HA 1B50A 2JA6B 5DNFA 5T1IA 2DNCA 3W2DA 1B2TA 3LX0A 1RKNA 2CHBD 2MUYA 3GQBA 1DD2A 4RA8A 2XRSD 1G91A 2VB3X 1CHPD 4OIKA 1TWGB 4KN4C 4CKBA 3MAQA 3I4MB 3GTLB 1HPCA 1Z6HA 1PRTB 2QILA 5CBEE 3Q0AA 1FYCA 4LK1C 1EU4A 3NP8A 5I2XA 3VYSA 3P75A 1LT3D 4HTHA 1T5XD 2EYMA 1Q12A 3D31A 3RUZA 1PXUA 3J81L 1U4PA 2PNRC 5FOBB 5C3EB 2EYHA 3MWYW 1SFOB 4F87A 2R93B 4IZ8A 4RAUC 3KK7A 2R92B 2PCFB 3SR1A 3RMHA 2E2DC 5KGUA 3VA7A 1CT1D 4KHZA 2N55A 1K8MA 1SE2A 3BYYB 2RDGA 2F0QA 2X6GA 3I70A 5M5XB 4ZUJA 1PTOF 4B9WA 3M85A 5BN4A 3BG3A 3GTQB 2CVRA 4KKTA 4J1MA 2N88A 5JAVA 4RKLA 3SEBA 4RGOS 4LMQD 1XX8A 3IAYA 1J8IA 1EY8A 1GHKA 4LAAA 3DHQA 1CK1A 4M1UB 1WTRA 1TS2A 4C3IB 1U4MA 4MIUA 4FF3A 5G3LF 1C48A 1D5MC 3NQIA 3MFYA 5I9PA 4FF4A 2NWGA 4FF2A 1I4RA 3QIAA 3DWPA 4RHSA 1KNAA 5I6WA 3PUYA 3NWSA 1EU3A 5I4DA 1LTBD 2VUMB 2B2WA 2ZXOA 3ERQA 3BS1A 5KYLA 3S1NB 2F0GA 2VB2X 3GP7A 1Q8IA 1D2BA 5JVG3 3K58A 1MI2A 2K33A 3RZDB 1YNJC 1DXMA 3GTJB 3L7ZC 1HA6A 2CW0D 3H3VC 4XYOA 3ZYYX 1V1PA 1F77A 3H94A 4S3SA 5DM73 3H0GB 4HN7A 3PO3B 2WKDA 2RVLA 2F03A 5IGEA 1SJED 3DM1A 3GTGB 2KA7A 2B2VC 4B9XA 1HFGA 1CHQD 4BBRB 1SNQA 3IKJA 3BYTB 2SNSA 1AZPA 4A3BB 1STGA 1SYBA 3SK5A 2K32A 1KDBA 4ZQ3A 1GUSA 2NN6I 4Q0FA 4IFDJ 5EBCA 2FMCA 4B08A 1BXTA 1F9PA 4TSSA 4A3EB 2EYFA 4UAIA 4BA1I 1JQYD 3NXWA 5EPLA 1AP0A 3J81E 1SDFA 2HUGA 2AWOA 4KY7A 4EQOA 3ND9A 2IW3A 4C1NK 3ND8A 2M9VA 1LO5D 3R2TA 5CYUA 3EJIA 1CQVA 2JXMB 1A2UA 4ID6A 1PTOD 3EQLC 5FO9B 2L1BA 4U68A 4A3JB 1DM0B 2NVXB 2SOBA 3TZDA 2WP8J 2PMZB 3A56A 4IUPA 1TT2A 4DNRB 1PFBA 3CHBD 1GUTA 3FPPA 2K5QA 5ELCA 1X32A 4BA2I 2XSCA 1PZJD 1GJXA 2F0IA 5JEAH 1EZ8A 1LLRD 3J7AF 1F9RA 2RBMA 5NUCA 1II3A 5A2QE 1EIGA 2RDFA 4QB4A 4HEDA 5JJZA 3GTMB 4R8IA 2I07B 3CU7A 4XDXA 5EPJA 1VF5C 1LABA 5A2QL 4HCSA 3K59A 5G3LD 3E0JA 2BE5D 5FO7B 4F8MA 2XNAC 2JA5B 2B2WC 4DFAA 2NUCA 2TSSA 1D1KA 1LTID 1DOKA 3I73A 3C46A 2WB1B 5LL6X 1SYEA 4C3HB 4XTCS 4IUUA 3G6JB 1I6HB 2HCIA 3S14B 3LWEA 3RZOB 1XWEA 3BDOA 3R93A 4FNFA 1PTOB 1TS5A 5K5PA 4RGNA 4OGQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IL8 A;  1RHP A;  3IFD A;  4OIK A;  1RJT A;  2HDM A;  4ZK9 B;  1CA6 A;  5AFW A;  1EQT A;  1EOT A;  4NW2 A;  2KEE A;  4OIJ A;  4XT1 B;  2L9H A;  2MPM A;  1IKM A;  3FDT A;  3UI2 A;  1ICW A;  1ILP A;  2NWG A;  5CBE E;  1U4L A;  4QUC A;  3F2U A;  1B53 A;  4MHE A;  2HCC A;  3KUP A;  3FPU B;  5EQ0 A;  1BBX C;  2FFK B;  2MGS A;  4HAE A;  1A15 A;  2KEC A;  1KNA A;  2Q8T A;  5E4W C;  1J9O A;  1MGS A;  1MSG A;  2B2U C;  2H1E A;  1HFN A;  2KOL A;  3IL8 A;  2RSN A;  2JP1 A;  2X69 A;  3ONA B;  3TN2 A;  1WD0 A;  1BF4 A;  3I91 A;  1E0B A;  2L1B A;  4U68 A;  4CJ2 C;  2B2T A;  2M2L A;  2KUM A;  3Q6S A;  2B2W A;  2NZ1 D;  1U4R A;  4HSV A;  1C8C A;  1WTO A;  1ROD A;  1PFM A;  4ZKB B;  3TZD A;  1WTQ A;  5CMD A;  1AZQ A;  1U4P A;  2K04 A;  4IUP A;  3KBX A;  1ESR A;  3GV6 A;  1PFB A;  3MWY W;  3I8Z A;  4X3T A;  4DN4 M;  1SSO A;  2B2Y A;  2KVM A;  2JYO A;  1DOL A;  1X3Q A;  1QNK A;  1S4Z A;  2L4N A;  1MI2 A;  4RAU C;  4ZKC B;  1O7Z A;  1X32 A;  2MP1 A;  1SAP A;  2EE1 A;  4X3U A;  1BNZ A;  4IUV A;  1HA6 A;  5COR A;  3HP3 A;  2K03 A;  5CBA E;  2DY8 A;  2FMM A;  1ML0 D;  1DOM A;  2J7Z A;  1F9Q A;  4R9W A;  4IUR A;  1TVX A;  1NR4 A;  3GV3 A;  1F9R A;  3G7L A;  1WVL A;  1PFN A;  1WD1 A;  2N55 A;  2B2Y C;  3I90 A;  2D9U A;  5T1G A;  1VMP A;  2Q8R E;  3MTS A;  1EIG A;  4X3K A;  1HUM A;  1M8A A;  1WTP A;  3QO2 A;  1KNE A;  2RVL A;  1EL0 A;  1QG7 A;  2KED A;  2X6G A;  4O42 A;  1VMC A;  1EIH A;  3DM1 A;  4IUQ A;  2K1B A;  5JJZ A;  4HED A;  2B2V C;  4R8I A;  3H91 A;  2K05 A;  4XDX A;  2R3Z A;  5EPJ A;  2L11 A;  2X6L A;  1WTX A;  5EKI A;  4HCS A;  5EPK A;  1HFG A;  2EOT A;  2B2T C;  1B3A A;  2K28 A;  2MJ8 A;  3D6W A;  3DEO A;  4CJ1 B;  1NR2 A;  5COY A;  1HUN A;  5EJW A;  1QE6 A;  1PDQ A;  1XYI A;  1CM9 A;  2VXW A;  1HRJ A;  1JE4 A;  1AZP A;  2CVR A;  2L12 A;  5D65 A;  2K01 A;  2FIN B;  2N88 A;  5E4X A;  1GUW A;  1ZXT A;  2B2W C;  1X3P A;  2B2U A;  1G2S A;  1ILQ A;  1RTO A;  3DEP A;  3N52 A;  1DZ1 A;  1O7Y A;  2RSO A;  3P7J A;  2RA4 A;  1DON A;  1JIC A;  1DOK A;  4LMQ D;  1XX8 A;  2DY7 A;  4ZLT F;  4IUT A;  1F9P A;  1G2T A;  4CJ0 B;  1O80 A;  1B50 A;  2SDF A;  1J8I A;  4IUU A;  1G6Z A;  5DNF A;  1PLF A;  2EPB A;  2HCI A;  5T1I A;  1Q3L A;  2IL8 A;  4UAI A;  1B2T A;  3LWE A;  1B4O A;  2FJ2 A;  1F2L A;  2B2V A;  1RTN A;  4RWS C;  2NYZ D;  3R93 A;  2BDN A;  1CA5 A;  1WTR A;  5EPL A;  4RA8 A;  3I3C A;  1HHV A;  4QUF A;  4X3S A;  1AP0 A;  1WTW A;  1SDF A;  1MSH A;  2FHT A;  4XT3 B;  3SVM A;  1NAP A;  2HUG A;  4MN3 A;  1G91 A;  2HDL A;  5D14 A;  1U4M A;  1NCV A;  1LV9 A;  4ZAI A;  1F9S A;  1WTV A;  2XIW A;  1BO0 A;  1IKL A; 
#chains in the Genus database with same CATH topology
 4JI6 Q;  1CA6 A;  2F0N A;  3HOX H;  1EQT A;  4DR2 L;  4BBR H;  2R92 H;  3DWA A;  3F2U A;  3CC7 A;  4C3H G;  5C3W A;  1JMC A;  1SYF A;  5M3F G;  2Q8T A;  4A3K G;  2PW7 A;  1JB7 A;  1XTC D;  1S5B D;  3OHX C;  3ONA B;  3TN2 A;  2L5T A;  1PH3 A;  2L55 A;  3AQQ A;  2QA4 A;  3M4O B;  1STN A;  4QMG A;  3HG9 A;  5I2Y A;  1X3G A;  2AQ2 B;  1N33 Q;  4JYA Q;  1VDZ A;  2VW9 A;  1UE7 A;  1AZQ A;  1QB5 D;  3I4N B;  2FXQ A;  2XVS A;  3I8Z A;  1I3Q B;  4O1N A;  3V2T A;  1SE4 A;  4PNY A;  5CV7 A;  2BH2 A;  4OO1 I;  4CKC A;  1BNZ A;  4JI2 L;  2L0C A;  1CSQ A;  1MJE A;  2EJM A;  5I6Y A;  1ML0 D;  4NP5 A;  1X3F A;  5IGD A;  1PFN A;  1HNZ Q;  2B2Y C;  1IW7 D;  2JA8 B;  2YYZ A;  4R4T A;  1SFO H;  2K1B A;  1QCB D;  3K5L A;  4WJW A;  2ATW A;  2R3Z A;  1S5C D;  5EKI A;  5H1S E;  3K5M A;  4R1J A;  2B2T C;  3CPF A;  3M4P A;  1H9M A;  3EVQ A;  1K83 H;  4LJZ C;  5C0X H;  4DV1 L;  3ERS X;  5DAU A;  4KHP L;  4IAL A;  1JWU D;  4TVA B;  3JAM i;  2UXB Q;  3K7U C;  2PYK A;  3C1E A;  5E4X A;  1HQR D;  1V1P B;  4LF9 L;  1ZXT A;  2RCN A;  2UXC L;  3S16 H;  4K6L A;  5CGK A;  3DEP A;  4C3I H;  1ZKO A;  4JI4 Q;  1C9O A;  5HUR A;  1DON A;  2DY7 A;  1G2T A;  1N34 Q;  4DR1 L;  1HQM C;  2N8N A;  1LTS D;  2R93 H;  5M3M B;  1VQ5 A;  3TS0 A;  3PSI A;  1BKB A;  1F2L A;  1D7Q A;  4FO2 A;  3NBI A;  1V43 A;  4DR3 Q;  1TWG H;  2RKS A;  1E2V A;  5A35 A;  3CME A;  1WTW A;  2G9D A;  1GO3 E;  4XT3 B;  2JA9 A;  4JI8 L;  1NCV A;  3A5U A;  5C4J B;  1T9H A;  1BCP C;  1PH8 A;  4K2L A;  2VQF L;  2PO4 A;  3S2D B;  2LXJ A;  1VQK A;  2EYO A;  2AKW B;  5HGQ A;  1E22 A;  3AB9 A;  3CCS A;  3S17 B;  5BN3 A;  1LUZ A;  1MSG A;  1J6Q A;  2AMC B;  2F0S A;  1QZG A;  3A5Z B;  4PMW A;  3SGI A;  1YNN D;  5IP9 H;  1YJ9 A;  4BBS H;  2F0T A;  4X64 Q;  1XXG A;  1WFQ A;  4C2M B;  3DXJ C;  2Z4H A;  3KOJ A;  1ENF A;  4AYB E;  1ICF B;  1X55 A;  1STH A;  1VQ6 A;  2EXZ A;  1IYJ B;  2B2Y A;  2F3V A;  3A7A B;  3S1R B;  3RNU A;  4A3K H;  2EE1 A;  2A74 C;  1ASY A;  2BE5 C;  4DR6 Q;  2XGT A;  4DAY A;  4A3J H;  3FHW A;  1DOM A;  2OT2 A;  2B8G A;  3TDQ A;  3M4Q A;  3QG1 A;  5HGT A;  1VQE A;  2DUD A;  1WD1 A;  4DR4 L;  4X66 L;  4OL7 A;  3TP8 A;  1X54 A;  4BY1 B;  3ER0 A;  1XNR L;  2IHE A;  4R4C A;  1HNW L;  1QG7 A;  5EGT A;  1TS4 A;  1GHJ A;  1S72 A;  3TP7 A;  2IJ0 A;  1KDA A;  3TRZ A;  3HOZ H;  2L11 A;  1MHW C;  5C3E G;  2QEJ C;  4DK6 C;  4LUV A;  1I6V C;  3AU7 A;  1YBY A;  2A6E C;  1V8Q A;  3T1Y Q;  3MXU A;  4DR6 L;  4A3I H;  2HHH L;  3BZD B;  4R4O A;  3MA2 B;  5IYC G;  4NXM L;  4XQN A;  3TQY A;  1ILQ A;  4BY7 G;  1RTO A;  1DZ1 A;  4JI0 L;  1MJC A;  2MNA A;  3A7L A;  4DR5 L;  3CXC A;  4DNT B;  1N36 L;  2YTY A;  2EPB A;  2YTV A;  4YCV A;  5EKK A;  4A93 B;  2B3G A;  2ZJQ A;  2F3W A;  2VS1 A;  4XXE A;  2IPK D;  2PZU A;  1QZH A;  1HHV A;  1L2F A;  4LF5 L;  1STB A;  4FXG C;  3ULL A;  3URY A;  1N36 Q;  3U9O A;  1EUJ A;  5IYB H;  1UWV A;  1N8R C;  3KFU A;  4U67 3;  3HOW H;  1CQF A;  2WB1 G;  2HIX A;  1XMQ L;  4ZK9 B;  2HDM A;  1CZG A;  4OX9 L;  2MO0 A;  1BR9 A;  5EKL A;  4UPA A;  4PMB A;  4XIG S;  3JAM E;  3AYH B;  3BVZ A;  1CKN A;  4QUC A;  2JA5 G;  2CQO A;  3FPU B;  2ZTD A;  1EY6 A;  1TKW B;  3PIO 3;  3L3O C;  1PZI D;  1PH9 A;  4BXX G;  2JA7 B;  2ZJR A;  3LNN A;  5IGB A;  5IIF A;  1Y1W H;  3J80 L;  2IX1 A;  1IHZ A;  2IX0 A;  2R61 A;  1AFP A;  3GTJ H;  4LFC L;  2JK8 A;  4IFD H;  2OTL A;  3MFG A;  4KKU A;  1F2Y A;  3A8K E;  4GNX B;  4JV5 Q;  1TXY A;  2HD3 A;  1Y1V B;  1XMO Q;  3L9A X;  3T4A C;  4DU9 A;  3VR4 A;  2UUA L;  1S4Z A;  2PQA B;  2F0H A;  1B7Y B;  2A68 C;  3BDC A;  1A63 A;  2DY8 A;  3K5N A;  1Q7Y C;  3J80 E;  1EYD A;  4KMU C;  3V96 A;  2Q8I B;  3OWE B;  4B3T Q;  1BCP D;  1PZK D;  4ZYS A;  1I4H A;  4DR1 Q;  3PO2 G;  2A69 C;  4DXF A;  2EOT A;  4ZUI A;  3D6W A;  2A68 D;  4LF6 Q;  4DV0 Q;  3MXP A;  5KND A;  3H0G H;  1N32 L;  2CKZ B;  2E75 C;  1JCK B;  4IOC A;  4P75 A;  1UAP A;  2I46 A;  1KHI A;  2UUC L;  3H6M A;  4L5S A;  3PUV A;  3RD4 A;  1SMX A;  2NN6 G;  2OF1 A;  4NB3 A;  3J7A V;  2FJ2 A;  1FR3 A;  2EY2 A;  2QF7 A;  1CA5 A;  2F3I A;  2UXD Q;  3PIO A;  2F0V A;  1VQ4 A;  4AH6 A;  1AH9 A;  1SYC A;  3SK6 A;  4C2M H;  3D3R A;  4BY7 H;  2A6H C;  1EEF D;  1EL0 A;  1VQN A;  1R9T B;  4BBS B;  4A3I B;  2LSS A;  1Y14 B;  4NW2 A;  5IP7 G;  1OXT A;  3HOY H;  5K36 G;  1ILP A;  1YNX A;  1TWF B;  3T13 A;  1K8O A;  1G8Z D;  2E74 C;  2OEO A;  1L1O C;  5AJ3 Q;  5FJ8 H;  5HY6 A;  2J4X A;  2F0P A;  1BBX C;  2FFK B;  5E3F A;  4RGT A;  2LS0 1;  1E24 A;  4JI3 L;  5E4W C;  1NBW A;  2E2H H;  1A2T A;  3L2P A;  1M4V A;  2KOL A;  5M3F B;  4JOI C;  3U9S A;  4DKA C;  1WD0 A;  1SNP A;  3S15 H;  2PQE A;  3I55 A;  4IFD I;  2JA7 G;  3I72 A;  5ELN A;  3D4R A;  2K50 A;  4KN7 C;  3KJO A;  5D3D A;  2KVM A;  4KJN A;  2LFN A;  2OQ0 A;  2CW0 C;  3TP6 A;  1YNJ D;  2K03 A;  2K14 A;  1VQG A;  2I5L X;  4HMI A;  1EIF A;  3GD7 A;  2D0O A;  2WAQ B;  3HOU H;  4IJL A;  1R4P B;  2UU9 Q;  4E6I A;  4AIM A;  4A3G H;  4JG2 A;  4A3D G;  2H4O A;  1TU2 B;  3HEJ A;  4NPS A;  4A93 H;  1WTX A;  3CCE A;  1OO9 B;  4RCO A;  2UUA Q;  1B3A A;  4LF8 Q;  4A3F B;  1W6J A;  1VF7 A;  1SND A;  2R7Z G;  2XWB B;  4QGU A;  1EWH A;  2NVY B;  3J7Y W;  4Q5V A;  1EYG A;  2C35 B;  4BY7 B;  3CQZ H;  1TY2 A;  3MXN B;  2ICI A;  2FIN B;  1GUW A;  2JQO A;  3OTO L;  1IBK Q;  1QNU A;  4DV2 Q;  1FD7 D;  4JI6 L;  1QIL A;  4H0L C;  3F2B A;  1TWH B;  5KYI A;  2PQA A;  3UDF A;  1ONL A;  3W1G A;  4CJ0 B;  4DV6 Q;  2E8G A;  3HRZ C;  5LL6 S;  3PF4 A;  3HGB A;  1PLF A;  4G7H C;  2G5D A;  4CHT B;  3UE1 A;  5C44 H;  1B4O A;  2LY7 A;  4JK1 C;  2WFW A;  2BDN A;  3BJU A;  1IYV A;  4X3S A;  3SVM A;  3HOU B;  4A75 A;  4GKK Q;  2KED A;  4LF4 Q;  4A3M H;  3HOV H;  4L5Q A;  2KEE A;  5C44 B;  5C4X H;  2ZXR A;  5C0X G;  1TWF H;  4DR4 Q;  1FL0 A;  1SR3 A;  1JOR A;  3N6R A;  1B8A A;  1SMY C;  1EY9 A;  2KEC A;  3LWU A;  1V1Q A;  1MGS A;  2DNE A;  4RCN A;  2HHH Q;  2RSN A;  2X69 A;  2ICE C;  1DGS A;  2EJF C;  2E2I H;  3CMA A;  4CDE C;  5M9O A;  2E5L Q;  1W3S A;  3H09 A;  1RD9 D;  2RHS B;  1HA5 A;  4PZ8 A;  3KBX A;  2JA6 H;  4N9T A;  2L15 A;  1KAW A;  5IT9 L;  4JBK A;  1SSO A;  1VQI A;  1QNK A;  1YJW A;  2NVQ H;  4FF1 A;  4ZKC B;  4H7B A;  1WCM G;  4V0B A;  4CDF C;  5JPN C;  1D5Z C;  3OPO A;  5CBA E;  1L0X B;  2Z8L A;  4IUR A;  2LKV A;  1STA A;  4GKJ Q;  2JA7 H;  3A8I E;  3F1Z A;  2PNH A;  3OW7 A;  2D2C C;  4R8N A;  2KQ3 A;  1HUM A;  1BBW A;  1EY7 A;  3FKI H;  3KLS X;  2TMP A;  1PA6 A;  3Q24 A;  2B8F A;  4DV5 Q;  1Y69 U;  3T16 A;  1PH5 A;  2MJ8 A;  3NUC A;  5KNB A;  1EY4 A;  1M90 C;  3U4V A;  1PDQ A;  2F0F A;  2R92 G;  4BBR G;  1KAB A;  1BOS A;  2R93 G;  5CV8 A;  2EJG C;  3E9H A;  4CBV A;  4A3M G;  3GTO H;  4APV A;  3HOV G;  2F0K A;  5TSS A;  4POG A;  1G2S A;  2EZV A;  2UUC Q;  5ISR A;  1A6X A;  3STB D;  1CKO A;  2EY1 A;  4G7O C;  5IGF A;  1H95 A;  2Z0S A;  3P1H A;  2MO1 A;  1RCV D;  3NWT A;  2IL8 A;  4GLA C;  1VQ7 A;  3HKZ G;  5JJL A;  3MC0 B;  4NKL A;  1QJO A;  2F0E A;  1R9T H;  2F0W A;  3T53 B;  1ENC A;  1H9S B;  3HKZ B;  5CV5 A;  3NPP A;  4CKE A;  3E0E A;  2GN5 A;  4DAM A;  4A3L H;  1KTK A;  1CSP A;  2K6A A;  2V4D A;  1SNM A;  3FDT A;  1N34 L;  4OXP A;  3JAM L;  3PIP 3;  3HOZ B;  4FVM A;  2QDL A;  1I50 H;  4PV1 C;  1I3Q H;  4F88 A;  3OMC A;  4EX5 A;  3OYY A;  4AYB G;  5L37 A;  3PUW A;  3E3X A;  4XQJ A;  4L5R C;  1CTM A;  4PMC A;  2UXB L;  4Z9C B;  1F2Z A;  3KBG A;  1B1Z A;  1SBB B;  1U4R A;  1Q82 C;  2PZW A;  1HXY D;  3S9W A;  5FK9 C;  4A3K B;  5DM6 3;  1SE3 A;  1IW7 C;  4JYA L;  1SYG A;  5ELB A;  4OWW B;  3M7N A;  1TS3 A;  4K5W A;  2OXP A;  3KLR A;  3NTH A;  4XQQ A;  4DV5 L;  1VQL A;  3PO2 B;  3FKI B;  4NDX A;  4IUN A;  4DN4 M;  1KIX A;  1X3Q A;  3WWV A;  1SAP A;  1D6E C;  1UE1 A;  5COR A;  4JC0 A;  2EDG A;  4LF7 L;  3K0X A;  2A19 A;  2J7Z A;  2RF4 A;  5FLX E;  1EY0 A;  2I0Q A;  3C1F A;  1NMG A;  4HJ9 A;  2C9O A;  1IBM Q;  3EA6 A;  4DR2 Q;  1KNE A;  3PGZ A;  3S17 H;  5KEE A;  1MKH A;  4C3J H;  4HCE A;  1N33 L;  4FXK C;  1I6H H;  5C6A A;  4CJ1 B;  2AWN A;  3CRL C;  4YY3 Q;  2Z4I A;  1SE8 A;  1CM9 A;  2B39 A;  3O13 A;  1XYI A;  1A3T A;  3E5S A;  5K36 H;  2KCT A;  5IP7 H;  4RGM A;  3B6Y A;  3RLF A;  1U5K A;  3NTK A;  4YWK A;  1K0S A;  1X3P A;  3N52 A;  1O7Y A;  5C44 G;  2RA4 A;  1JIC A;  3U4Z A;  1X65 A;  4IUT A;  2XWJ B;  2AQ3 B;  4J15 A;  3KDF A;  2K5V A;  5C4X B;  1PTO C;  4M8A A;  4C3J B;  4GLV B;  1LT5 D;  1GUN A;  1VQH A;  3RN2 A;  4DR7 L;  4B3R L;  2NYZ D;  5IYD G;  4HJA A;  1A3U A;  1YEZ A;  1Z47 A;  1QWY A;  3TBI B;  4GKK L;  3A55 A;  2HDL A;  3X3N A;  5IWA L;  1F9S A;  3KUP A;  1LTR D;  2XIW A;  5D3I B;  4X66 Q;  5C5L A;  3DMU A;  4DV4 Q;  2VNU D;  4JBW A;  3QB3 A;  4RHR A;  4O2D A;  3IRB A;  3NE5 B;  4A93 G;  2BA1 A;  3V05 A;  1EZ6 A;  1ESF A;  2BH8 A;  3NEL A;  4NMZ A;  5C4Z A;  3PO2 H;  2JA8 H;  1JT8 A;  4CDC C;  4LW1 A;  1L0W A;  1PRT C;  4MNO A;  1H9J A;  4J6H A;  4OO1 H;  3QOJ A;  3PO3 H;  1A3V A;  1IBK L;  3AEV A;  1Q86 C;  4HR7 B;  5JPM C;  3J80 i;  1WYD A;  3VR5 A;  1HNW Q;  1HZC A;  3VR2 A;  4ZKB B;  4QL5 A;  5IT9 E;  1QVC A;  2ENB A;  1S5D D;  1LAC A;  3GV6 A;  3I4O A;  1IXR A;  1CFM A;  3KF6 B;  1DOL A;  1YNN C;  3CCQ A;  1I4X A;  4X3U A;  4BY1 G;  3EBE A;  1VQJ A;  4EGV A;  1F9Q A;  3CD6 A;  5C4H A;  1D8L A;  3GV3 A;  3G7L A;  3SK4 A;  2WKC A;  5C0X I;  4AQY Q;  2GVB A;  4A3D B;  5AJ3 L;  2CCZ A;  1M8A A;  3J80 c;  1IBM L;  1TWC B;  1H9R A;  3HOY G;  1EQR A;  4N9P A;  3UDX A;  3S2H H;  2YV5 A;  3GTP H;  4IN3 A;  1Y8N B;  2A1A A;  4DV3 Q;  1HUN A;  3HOX B;  3L0O A;  3I7F A;  1S5F D;  3MVV A;  4L8J A;  3S15 B;  5DEH A;  2K01 A;  1OXU A;  5M3F H;  2R6G A;  2QW7 A;  1GXD C;  1FNV A;  4IO9 A;  2B2U A;  5CV6 A;  4LNQ A;  2E2H B;  3VYU A;  4RFB A;  1HR0 W;  1P16 A;  3A8J E;  3STB C;  3CP0 A;  5FLX L;  3HOX G;  2WB1 E;  1JC7 A;  1EWC A;  1O80 A;  5E1F A;  3GTP B;  1K8G A;  4B3M Q;  1KLG D;  1FGB D;  3HOY B;  2BA0 A;  3CC4 A;  1FJG Q;  3NQT A;  2EXD A;  2DN8 A;  1HR0 L;  2YTX A;  3H0G G;  5FLM G;  4RMF A;  1GD7 A;  2ZT9 C;  1QOH A;  1IKL A;  3OWF A;  3IFD A;  4JBJ A;  4OIJ A;  1CI3 M;  2L9H A;  4A3I G;  4PQX A;  1JWM D;  1Y8P B;  3IFT A;  1PYW D;  1E7Z A;  2PZT A;  3KF8 B;  4ILW A;  4I7Z C;  5IOD A;  4KD3 A;  2QGQ A;  3I4N H;  3K5O A;  4UY8 C;  1TWA B;  2PI2 A;  1XJV A;  1J5E L;  2KBN A;  3M4O H;  1PVO A;  4KJO A;  3ERO A;  2B2T A;  3Q6S A;  2JE6 I;  4HSV A;  3K7A H;  3G4S A;  1K83 B;  2CFM A;  2F0U A;  1WTO A;  1ROD A;  1WTQ A;  4ZRZ A;  4DV0 L;  2K04 A;  3S2H B;  3WOF A;  3ICE A;  1SNO A;  2YU9 H;  2F0J A;  2NBF A;  1G6P A;  1O7Z A;  2NVX H;  3QJY A;  4K2K A;  1VQF A;  4IUV A;  2A6E D;  4L5T A;  2PPB C;  4CDD C;  4OO1 G;  5CV9 A;  1NR4 A;  3TZU A;  3KLS A;  1WVL A;  3OIP A;  2RDH A;  4ABN A;  3D6C A;  3A54 A;  5DLQ E;  2Q8R E;  1NUC A;  5J22 A;  1CZW A;  1VQ8 A;  2F4I A;  4O42 A;  3J7A 5;  2NZH A;  3H91 A;  5IOC A;  4GKJ L;  3E6Z X;  2B63 G;  4JV5 L;  4LF6 L;  4C3H H;  1Y1W B;  1TWC H;  4LFA L;  3GTL H;  1TR5 A;  4FXD A;  4X65 Q;  5JJI A;  1Q8K A;  3G48 A;  4LF5 Q;  4KD4 A;  4WJ3 M;  1C4Q A;  5FKA C;  4A3B G;  3MZ5 A;  4IQZ A;  4DAY B;  4G7Z C;  4I7A A;  4A76 A;  3U50 C;  1K8A C;  1JOK A;  1RL2 A;  1GVP A;  2LMC B;  5KIX A;  2O2L D;  1ET6 A;  1STE A;  1NNX A;  4L6T B;  4JI5 L;  5CV4 A;  1RTN A;  4RWS C;  1YZ6 A;  2NB0 A;  3I3C A;  3PIP A;  4A3G B;  1LYL A;  4GOP A;  4OWT B;  1NMF A;  3Q8D A;  4OWX B;  4EQ5 A;  1WTV A;  3EFX D;  4IPH A;  1PTO H;  1RJT A;  5M5W B;  2WV6 D;  3RR5 A;  1EOT A;  5C5M A;  4XT1 B;  4H02 A;  4YWM A;  3HFZ B;  1Q1B A;  1K73 C;  1GKH A;  2WAQ G;  4FP5 D;  3KF8 A;  4HSP A;  5EQ0 A;  2MGS A;  2Q2I A;  2A73 B;  2F0O A;  3S24 A;  1VQP A;  4A3D H;  2PW5 A;  3RN5 A;  2VUM G;  1JJG A;  4CJ2 C;  2KCC A;  2Z1C A;  2E2J H;  4YWL A;  1C8C A;  1OXX K;  4UDU C;  3W1B A;  1A8V A;  1PFM A;  2K75 A;  3T1Y L;  5CMD A;  4UHV A;  4AYB B;  1OTC A;  2PMZ E;  4QF4 A;  4BS9 A;  2I5H A;  3SK8 A;  1RIP A;  4DGZ A;  2QDB A;  4P74 A;  4DR3 L;  4DK0 A;  3HP3 A;  2E2J B;  1Z7T A;  2NVT H;  1HR0 Q;  2VUM H;  2FMM A;  4NXN L;  5LMU Q;  4DR5 Q;  3CF5 A;  1HTL D;  2NZO A;  4YCW A;  3MXN A;  4JI0 Q;  5C0X J;  2VY3 A;  1Q1E A;  5T1G A;  4FYD A;  4C1N I;  1VMP A;  4X3K A;  1IZ6 A;  3PV0 A;  1B9N A;  2K4K A;  1STY A;  5I9O A;  3H15 A;  5C4X G;  1AW7 A;  2X6L A;  4A3E H;  4I65 A;  2J0T D;  1E1O A;  1KDC A;  5FJ8 G;  5FO8 B;  5IYD H;  4HJ7 A;  3K7A B;  1QE6 A;  4V19 0;  3DLL A;  2L12 A;  4QIW B;  3BVM A;  3BU2 A;  2CH4 W;  4DV3 L;  2N78 A;  3CKI B;  3K6O A;  2RSO A;  3P7J A;  1LTG D;  2ZTE A;  3UDI A;  4Y52 H;  2HQL A;  5EBD A;  2SDF A;  4GOP C;  1SYD A;  1YHA A;  3WOE A;  4HIO A;  2UUB Q;  2WIN B;  2O5I C;  3E9I A;  3GTG H;  3M3Y B;  4JI2 Q;  2NN6 H;  4QQB X;  1IYU A;  1SMY D;  2F0D A;  4WJ4 A;  2B29 A;  2Y0S B;  1O7L A;  2A69 D;  5M3M G;  1NAP A;  4ZAI A;  1BO0 A;  1OXS C;  1IL8 A;  2PI2 E;  5CC4 A;  2EVB A;  1L0Y B;  3SE0 A;  2RCF A;  4KHV A;  2KJX A;  5GAG C;  3RZD H;  1HNX Q;  1M1K C;  3FKI G;  2Q2H A;  3CCM A;  5KNC A;  4EQN A;  3HZX A;  4MHE A;  3W3A A;  5J39 A;  3A0J A;  1JE5 A;  4PG3 A;  4HAE A;  4ALP A;  1EFI D;  3AFP A;  1HFN A;  4PZ6 A;  4NXN Q;  1EFW A;  3VR6 A;  3NHH A;  1Y1V G;  1BF4 A;  1BQQ T;  3I91 A;  1E0B A;  2AQ1 B;  4LF9 Q;  1OXV A;  2E2I B;  1BCP F;  4QY7 A;  4LFB Q;  1PH2 A;  1JOQ A;  4DV1 Q;  1K9M C;  4WFN 3;  3C3L A;  1Y8O B;  4G4K A;  4K8I A;  1ESR A;  1VQA A;  1DCZ A;  2RHQ B;  1VCI A;  2YU9 B;  1UUP A;  3KDF B;  2M00 A;  2JYO A;  5IGC A;  1MBY A;  2JN4 A;  1S3O A;  2KHS A;  4P2C B;  1H9K A;  1ASZ A;  4R9W A;  3H3V I;  4RG1 A;  2F52 A;  3QR8 A;  3TME A;  3WDN A;  4OHJ A;  2F0L A;  1E1T A;  4X62 L;  3AFQ A;  2D9U A;  3I4N G;  1ZYR D;  3MTS A;  3GTK H;  1X3E A;  2NVQ B;  1LT4 D;  1VMC A;  1TY0 A;  3A74 A;  4JOI A;  3K0Y A;  3J81 j;  4K8J A;  4DR7 Q;  4B3R Q;  3PQI A;  1NSN S;  5GQO A;  1O78 A;  1NR2 A;  5COY A;  4BWG B;  3DUZ A;  1E2Z A;  2VXW A;  4G57 A;  2O5J C;  5LMN L;  1HZ9 A;  4RKB A;  2F1M A;  1L1O A;  4HID A;  3F2D A;  2CQA A;  1YIJ A;  3JAM c;  3PF5 A;  3R3O A;  5JEA J;  1SJH D;  4WRD A;  4DUY L;  3NSW A;  3ULJ A;  1E2W A;  1B44 D;  3NTI A;  4ZLT F;  2HIV A;  4GLX A;  4YCU A;  1Q90 A;  1V1O A;  1VS0 A;  1JWS D;  3PMF A;  4LFB L;  4KTA A;  5JVH 3;  3DWQ A;  2B2V A;  3T51 B;  3QWN A;  3T1H Q;  2ZJP A;  4HMJ A;  4TKO B;  3U58 A;  4QUF A;  3ULP A;  2Y0S E;  4LF7 Q;  1MSH A;  2FHT A;  3MXG A;  5D14 A;  1YI2 A;  1HCZ A;  3BZK A;  2G9H D;  3OSO A;  1IBL Q;  3CCU A;  2IWH A;  2VQF Q;  3FVQ A;  3UI2 A;  1HJP A;  2A6H D;  5JOB A;  2SNM A;  1U4L A;  1GUO A;  3UE0 A;  1B53 A;  3FP9 A;  4DF7 A;  3SHL A;  4A3G G;  5C3E H;  3CCV A;  3TP5 A;  2EQS A;  1QVG A;  4DV2 L;  1WCM H;  4YY3 L;  1MD2 D;  1J9O A;  4OEL B;  2B2U C;  4WOR A;  5ELD A;  4GN5 A;  2XRQ D;  1EWI A;  5JEA G;  1KLU D;  1ET9 A;  4X64 L;  2K7V A;  4LUZ A;  4ULL A;  1JOO A;  4A3M B;  3HOV B;  1H9S A;  2NZ1 D;  1C7Y A;  3ZJY C;  1O7I A;  2NVY H;  1YHQ A;  2DJG C;  2F4V L;  4LFA Q;  4JW0 A;  1FVI A;  2IT1 A;  1EQV A;  4UP9 A;  5JJK A;  2KHJ A;  3K57 A;  4IFD G;  1HZA A;  1ZEQ X;  4LF8 L;  2OTJ A;  1RDP D;  3M4Y A;  2EYL A;  3S2D H;  1TQO A;  1G29 1;  1B9M A;  3QOL A;  4UP7 A;  2B63 B;  1PYB A;  4BXX H;  2E76 C;  4RH6 A;  1TVX A;  2WAQ E;  3I90 A;  1FNW A;  1HZB A;  1JR0 D;  4IPD A;  4DUZ Q;  4ZCK A;  4TQU S;  1WOC A;  2F0M A;  1WCM B;  1W6K A;  3FMC A;  4KLK A;  4A3F H;  1R4Q B;  3BVG A;  1SNC A;  1MIU A;  2ZXP A;  5M5Y H;  3OOC A;  1A62 A;  3DEO A;  4LFC Q;  1NJI C;  3BDL A;  4P71 A;  4H13 C;  4Y7N H;  3GTK B;  2ASB A;  1F2M A;  3G6E A;  4K0K L;  3S16 B;  2K5D A;  4JCV E;  4GZY C;  4QCL A;  1LTA D;  4Y7N B;  1I50 B;  2KHI A;  2BCO A;  1G6Z A;  2P5Z X;  4DV7 Q;  3CPW A;  1FGU A;  1GOZ A;  1DJR D;  5KRU A;  4N8F A;  4CGY B;  5GAE C;  2R7Z H;  1KC8 C;  1DYQ A;  5BN5 A;  1IBL L;  4KI0 A;  1K3B C;  3R2I A;  5IGG A;  1LTT D;  2KCN A;  3Q23 A;  1BCP B;  1G51 A;  4MN3 A;  1LV9 A;  1TII D;  4HIM A;  4KY5 A;  1UNS A;  2K5H A;  2QKI C;  3T56 B;  1KRT A;  5ELF A;  2JEB I;  4QJF A;  1ICW A;  3OIQ A;  1CKM A;  2Z6K A;  1D5X C;  1NTG A;  3BZC A;  3FRP B;  5ELE A;  4P73 A;  4JBM A;  4KV6 A;  1UEA B;  1JJ2 A;  3IL8 A;  2JP1 A;  3VA5 A;  1I5F A;  4A3E G;  4DK1 A;  2NTS A;  1A0I A;  4ODG A;  1KD1 C;  1K28 A;  3NK9 A;  1YJN A;  1SEB D;  2F4V Q;  1PMR A;  4F7X A;  2EYJ A;  1N32 Q;  2IX3 A;  2DJF C;  3RLN A;  3PO3 G;  4X3T A;  3I4L A;  1NE3 A;  3C2P A;  5CR3 A;  4N8X 1;  2JEA I;  1BDO A;  1FJG L;  1I4Q A;  2MP1 A;  3FEW X;  1I4G A;  4BBS G;  1QUQ B;  1RF2 D;  2ID0 A;  1IL2 A;  4R4Q A;  1YHB A;  1JB3 A;  4L63 B;  4YIJ A;  1K3R A;  4LF4 L;  2Z6K C;  3VYT A;  1KAA A;  3D0F A;  2BOS A;  2Z6B A;  1T5E A;  1ZYR C;  1EIH A;  4IUQ A;  3LGJ A;  5FLM H;  2NTT A;  3S1M B;  1FNU A;  3KJP A;  4A3L G;  4JI1 L;  1PRT D;  3X3M A;  3HS0 C;  4EVO A;  1U9R A;  1EEI D;  1KXL A;  2EYP A;  4DA2 A;  2EY6 A;  3ITP A;  2RQX A;  1JE4 A;  3M9B A;  5D65 A;  3Q22 A;  3MHB A;  1EYC A;  2VQE L;  3TS2 A;  1PRT F;  1JJC B;  4EQP A;  1D1I A;  3D8G A;  4LWC A;  4XYQ A;  4DUY Q;  2MHV A;  3M3Y H;  3CAM A;  1SXT A;  3MEH A;  2K5W A;  1Q3L A;  1BUV T;  3VR3 A;  4C3I G;  2D5D A;  4KK7 A;  5F2D A;  3VYR A;  3NBH A;  4JI7 L;  1AEX A;  2BDO A;  3GTO B;  4C3J G;  4TRD A;  3CRK C;  4JI8 Q;  2WAC A;  2XN9 C;  2HQE A;  2R7D A;  2VL6 A;  1RHP A;  4HJ8 A;  5LHY 1;  5LMN W;  3M7G A;  5AFW A;  4POF A;  1E3P A;  4DAP A;  1IKM A;  1AE2 A;  2MPM A;  2AUJ D;  5IT9 c;  4IPC A;  1I4P A;  1PH7 A;  2OWO A;  5C3X A;  3GO5 A;  2HCC A;  1A15 A;  5IY0 A;  1VQM A;  1EYA A;  3OMG A;  2H1E A;  2HT1 A;  1S5E D;  3J81 c;  4HIK A;  3D4D A;  4K14 A;  3CQZ B;  3TRE A;  2B63 H;  1J5E Q;  3HOW B;  2M2L A;  2KUM A;  4KY6 A;  4DNI A;  3TSS A;  2KEN A;  2JSO A;  1X9N A;  1UEB A;  2NVT B;  2R7Z B;  4A3C H;  3D4W A;  2KCM A;  3P20 A;  4DAV A;  4K6D A;  4DK3 C;  2O4X A;  1Y1V H;  3PUZ A;  2GA4 B;  3KLW A;  1ENA A;  2L4N A;  4X62 Q;  2JJQ A;  1VQB A;  4K5X A;  3SXH A;  4BY1 H;  1HTP A;  3AMU A;  1LM0 A;  3R8B A;  5IP9 G;  4A3C G;  3CW2 C;  2AUK A;  5LMU L;  1L1O B;  4KKS A;  5J1Z A;  2CWA A;  5GRO A;  5M5Y B;  1WTP A;  3QO2 A;  2EY5 A;  1W2B A;  3W5O A;  3S1Q B;  2UXD L;  2QCP X;  3SDZ A;  5M3M H;  2K05 A;  3PUX A;  4ME5 A;  5IYB G;  1AN8 A;  5GAD C;  1SRU A;  3CCR A;  4AQY L;  5EPK A;  2K28 A;  2WII B;  4K5V A;  5EJW A;  4DXG A;  4H44 C;  2ZM6 L;  1HRJ A;  1EY5 A;  2IHF A;  1XPO A;  2D62 A;  5IE8 A;  2C5C A;  3DM3 A;  1LT6 D;  4UP8 A;  2R7F A;  5J3B A;  2SEB D;  3K80 C;  4J8Q A;  1X56 A;  1GUG A;  3I4M G;  4JPB W;  4C56 C;  2ES2 A;  1HNX L;  2GVA A;  2A5H A;  1B50 A;  2JA6 B;  5DNF A;  5IYC H;  4GNX A;  3PCO B;  3S1R H;  5T1I A;  2DNC A;  3W2D A;  1GM5 A;  3I4M H;  1B2T A;  3LX0 A;  4A4I A;  1Q46 A;  1RKN A;  2CHB D;  2MUY A;  3K81 C;  4JVZ A;  3GQB A;  1DD2 A;  4RA8 A;  2XRS D;  4B3S L;  3F2C A;  1SRO A;  4DV7 L;  1AE3 A;  1G91 A;  5BR8 L;  2VB3 X;  3G71 A;  1CHP D;  4OIK A;  1TWG B;  4KN4 C;  4CKB A;  1VQD A;  3MAQ A;  3I4M B;  3GTL B;  1HPC A;  4GN3 B;  1Z6H A;  1PRT B;  2QIL A;  5CBE E;  2Z9H A;  1CKN B;  3HKS A;  4IJH A;  3Q0A A;  1FYC A;  4LK1 C;  1EU4 A;  3NP8 A;  5I2X A;  1VQC A;  3VYS A;  5ELO A;  3P75 A;  3S1N H;  1LT3 D;  4HTH A;  1PV4 A;  1T5X D;  2EYM A;  1Q12 A;  1KQS A;  1EOV A;  2JA6 G;  3D31 A;  3RUZ A;  4PZ7 A;  3NBH B;  2ZM6 Q;  1PXU A;  1B3Q A;  4GNX C;  3J81 L;  1U4P A;  2OQK A;  1SLJ A;  2PNR C;  5FOB B;  5C3E B;  4B3S Q;  4MTK A;  2EYH A;  3MWY W;  3S1Q H;  1Z9F A;  4FDB A;  1SFO B;  4F87 A;  2R93 B;  3J7Z C;  4IZ8 A;  4RAU C;  1TWH H;  3KK7 A;  2R92 B;  1Q81 C;  2PCF B;  3SR1 A;  1YIT A;  3RMH A;  2E2D C;  5KGU A;  3VA7 A;  1CT1 D;  4KHZ A;  4DV6 L;  2N55 A;  1K8M A;  1SE2 A;  3BYY B;  2RDG A;  3EN2 A;  1XNQ Q;  2F0Q A;  2X6G A;  3I70 A;  5M5X B;  3RZO H;  3S14 H;  4ZUJ A;  1CUK A;  1PTO F;  1X6O A;  4B9W A;  3UDG A;  2E5L L;  2Q2U A;  3M85 A;  5BN4 A;  3BG3 A;  4NXM Q;  3GTQ B;  3J81 i;  2CVR A;  4KKT A;  5LMN Q;  4J1M A;  2N88 A;  5JAV A;  2JA5 H;  4LUO A;  4DV4 L;  1QUQ A;  4RKL A;  4OX9 Q;  3SEB A;  4RGO S;  3GTQ H;  4LMQ D;  1VQO A;  1XX8 A;  3CCL A;  5E7N A;  3IAY A;  3VDY A;  3HOW G;  1J8I A;  1EY8 A;  1KL9 A;  1GHK A;  4LAA A;  3GTM H;  1BVS A;  3DHQ A;  1CK1 A;  2OCE A;  4B3T L;  4M1U B;  3GDE A;  1WTR A;  4DUZ L;  3JC6 6;  1TS2 A;  4C3I B;  3HKZ E;  1U4M A;  4YHH Q;  1SN8 A;  4JI1 Q;  4MIU A;  4FF3 A;  2Y0S G;  3OW2 A;  5G3L F;  1C48 A;  1D5M C;  3NQI A;  4IOA A;  3MFY A;  1U0L A;  5I9P A;  4FF4 A;  2NWG A;  2XTI A;  4FF2 A;  4B3M L;  4YHH L;  1C0A A;  1I4R A;  3QIA A;  3DWP A;  4GS3 A;  1KNA A;  4RHS A;  5I6W A;  3I2Z A;  4A3F G;  3PUY A;  1PH4 A;  1WI5 A;  3NWS A;  1EU3 A;  1XNQ L;  5I4D A;  1WTH A;  4GOP B;  3OTO Q;  1LTB D;  2VUM B;  3HOZ G;  2B2W A;  2K52 A;  2ZXO A;  3ERQ A;  3BS1 A;  5KYL A;  1XPR A;  3S1N B;  3S1M H;  2F0G A;  2VB2 X;  3NEN A;  2H5X A;  3GP7 A;  1Q8I A;  4X65 L;  1D2B A;  4JI7 Q;  4O0A A;  5JVG 3;  3K58 A;  1MI2 A;  2K33 A;  3RZD B;  1YNJ C;  1DXM A;  3GTJ B;  3L7Z C;  1HH2 P;  1HA6 A;  2CW0 D;  3H3V C;  4XYO A;  3ZYY X;  1V1P A;  1F77 A;  3H94 A;  4S3S A;  5DM7 3;  3H0G B;  4P72 A;  4HN7 A;  3PO3 B;  2N3S A;  2MFI A;  2WKD A;  1V9P A;  1NY4 A;  2RVL A;  3T1H L;  2F03 A;  1XPU A;  5IGE A;  1SJE D;  3DM1 A;  3GTG B;  2QEX A;  1I94 Q;  2KA7 A;  2B2V C;  1BBU A;  4B9X A;  2AHO B;  1HFG A;  2UUB L;  4IPG A;  3NEM A;  1CHQ D;  4BBR B;  1UE5 A;  1SNQ A;  3IKJ A;  1UE6 A;  3BYT B;  5GAH C;  2SNS A;  1AZP A;  4A3B B;  3H3V H;  2V1C C;  1STG A;  1SYB A;  3SK5 A;  4ME3 A;  2K32 A;  1KDB A;  4ZQ3 A;  1GUS A;  2NN6 I;  4Q0F A;  2UU9 L;  2A8V A;  2UXC Q;  4IFD J;  5EBC A;  1PH1 A;  2FMC A;  4JI3 Q;  1K0R A;  4B08 A;  1BXT A;  1F9P A;  4TSS A;  2ZTC A;  2ALY B;  4A3E B;  2EYF A;  3CCJ A;  4UAI A;  4BA1 I;  1JQY D;  3NXW A;  5EPL A;  1XNR Q;  1AP0 A;  3EIV A;  3J81 E;  1SDF A;  1XMO L;  4MTN A;  2HUG A;  2AWO A;  1I94 L;  4KY7 A;  1HNZ L;  2CH4 A;  4EQO A;  3ND9 A;  4DPG A;  4JI4 L;  1WJJ A;  2IW3 A;  3MEF A;  4C1N K;  3ND8 A;  2M9V A;  1LO5 D;  5BR8 Q;  1EIY B;  3R2T A;  2I5M X;  4X6A H;  5CYU A;  3EJI A;  5M5W H;  1VQ9 A;  1PFS A;  1CQV A;  1KRS A;  1LTL A;  2JXM B;  1A2U A;  2EIF A;  4A3J G;  4ID6 A;  1PTO D;  3EQL C;  5FO9 B;  2L1B A;  4OEM B;  4U68 A;  4K0K Q;  4A3J B;  1DM0 B;  4R4I A;  1N9W A;  2NVX B;  2SOB A;  3TZD A;  1PHJ A;  1Y1W G;  2WP8 J;  2PMZ B;  3A56 A;  4IUP A;  1TT2 A;  2N49 A;  4DNR B;  1PFB A;  3RLO A;  3HOU G;  3CHB D;  1GUT A;  3FPP A;  2K5Q A;  5ELC A;  2VQE Q;  1X32 A;  2JA8 G;  4BA2 I;  2XSC A;  1PZJ D;  4OON A;  2F0I A;  1GJX A;  5JEA H;  1EZ8 A;  1LLR D;  3J7A F;  1PH6 A;  1F9R A;  2RBM A;  5NUC A;  1II3 A;  4HJ5 A;  5A2Q E;  1EIG A;  3CC2 A;  2CWP A;  2RDF A;  4QB4 A;  4HED A;  5JJZ A;  2LXK A;  5IWA Q;  3GTM B;  4R8I A;  1XTD A;  2I07 B;  3CU7 A;  3K8A A;  4XDX A;  1VF5 C;  5EPJ A;  1LAB A;  5A2Q L;  1XMQ Q;  4HCS A;  4JI5 Q;  3K59 A;  5EAY A;  5G3L D;  3E0J A;  1QVF A;  2BE5 D;  5FO7 B;  4F8M A;  2K5N A;  2XNA C;  2MQH A;  3F8T A;  5C4J H;  5FLX c;  2Q2T A;  4QIW E;  2JA5 B;  2B2W C;  4DFA A;  2NUC A;  2TSS A;  1D1K A;  1PYS B;  2VZA A;  4KHP Q;  1LTI D;  1DOK A;  2DGY A;  3I73 A;  3C46 A;  2WB1 B;  2IY5 B;  2D0P A;  3KF6 A;  5LL6 X;  1SYE A;  4C3H B;  1S40 A;  1EQQ A;  4XTC S;  4IUU A;  3G6J B;  3TEH B;  1I6H B;  2HCI A;  3S14 B;  3LWE A;  3RZO B;  5M5X H;  1XWE A;  1P8L A;  3BDO A;  3R93 A;  4FNF A;  3I56 A;  1PTO B;  1TS5 A;  1B70 B;  5K5P A;  4MZ9 A;  4RGN A;  1TWA H;  4OGQ C;  4GN4 B;  4A3B H;  3KYH C;  1YVC A; 
#chains in the Genus database with same CATH homology
 1CA6 A;  2F0N A;  1EQT A;  3DWA A;  3F2U A;  4C3H G;  5C3W A;  1SYF A;  2Q8T A;  2PW7 A;  1XTC D;  1S5B D;  3OHX C;  3ONA B;  3TN2 A;  2L5T A;  2L55 A;  3M4O B;  1STN A;  4QMG A;  3HG9 A;  5I2Y A;  2AQ2 B;  1VDZ A;  1AZQ A;  1QB5 D;  3I4N B;  2XVS A;  3I8Z A;  1I3Q B;  4O1N A;  3V2T A;  1SE4 A;  4PNY A;  5CV7 A;  4OO1 I;  4CKC A;  1BNZ A;  2L0C A;  2EJM A;  5I6Y A;  1ML0 D;  4NP5 A;  5IGD A;  1PFN A;  2B2Y C;  1IW7 D;  2JA8 B;  2YYZ A;  2K1B A;  1QCB D;  3K5L A;  4WJW A;  2R3Z A;  1S5C D;  5EKI A;  3K5M A;  2B2T C;  1H9M A;  3EVQ A;  4LJZ C;  5C0X H;  5DAU A;  4IAL A;  1JWU D;  2PYK A;  3C1E A;  5E4X A;  1HQR D;  1V1P B;  1ZXT A;  4K6L A;  5CGK A;  3DEP A;  1ZKO A;  5HUR A;  1DON A;  2DY7 A;  1G2T A;  1HQM C;  1LTS D;  5M3M B;  1F2L A;  4FO2 A;  3NBI A;  1V43 A;  2RKS A;  1E2V A;  5A35 A;  1WTW A;  2G9D A;  4XT3 B;  1NCV A;  5C4J B;  1BCP C;  4K2L A;  2PO4 A;  3S2D B;  2EYO A;  3AB9 A;  3S17 B;  5BN3 A;  1MSG A;  2F0S A;  4PMW A;  1YNN D;  2F0T A;  1XXG A;  4C2M B;  3DXJ C;  2Z4H A;  1ENF A;  1STH A;  2EXZ A;  2B2Y A;  2F3V A;  3A7A B;  3S1R B;  2EE1 A;  2A74 C;  2BE5 C;  4DAY A;  1DOM A;  2OT2 A;  2B8G A;  3TDQ A;  3QG1 A;  5HGT A;  1WD1 A;  4OL7 A;  3TP8 A;  4BY1 B;  1QG7 A;  5EGT A;  1TS4 A;  1GHJ A;  3TP7 A;  2IJ0 A;  1KDA A;  2L11 A;  2QEJ C;  1I6V C;  3AU7 A;  2A6E C;  1V8Q A;  3MXU A;  3BZD B;  3MA2 B;  4XQN A;  1ILQ A;  1RTO A;  1DZ1 A;  3A7L A;  4DNT B;  2EPB A;  5EKK A;  4A93 B;  2F3W A;  4XXE A;  2IPK D;  2PZU A;  1HHV A;  1STB A;  4FXG C;  3URY A;  3U9O A;  4U67 3;  1CQF A;  4ZK9 B;  2HDM A;  1CZG A;  1BR9 A;  5EKL A;  4PMB A;  4XIG S;  3JAM E;  3BVZ A;  4QUC A;  3FPU B;  1EY6 A;  1TKW B;  3PIO 3;  3L3O C;  1PZI D;  2JA7 B;  3LNN A;  5IGB A;  5IIF A;  3J80 L;  2IX1 A;  1IHZ A;  2IX0 A;  2R61 A;  1AFP A;  4IFD H;  3MFG A;  4KKU A;  1F2Y A;  3A8K E;  1Y1V B;  3L9A X;  3T4A C;  4DU9 A;  3VR4 A;  1S4Z A;  2F0H A;  2A68 C;  3BDC A;  2DY8 A;  3K5N A;  3J80 E;  1EYD A;  4KMU C;  3V96 A;  2Q8I B;  3OWE B;  1BCP D;  1PZK D;  4ZYS A;  1I4H A;  2A69 C;  4DXF A;  2EOT A;  4ZUI A;  3D6W A;  2A68 D;  3MXP A;  5KND A;  2E75 C;  1JCK B;  1UAP A;  2I46 A;  3H6M A;  3PUV A;  3RD4 A;  2NN6 G;  2OF1 A;  3J7A V;  2FJ2 A;  1FR3 A;  2EY2 A;  2QF7 A;  1CA5 A;  2F0V A;  1SYC A;  3SK6 A;  3D3R A;  2A6H C;  1EEF D;  1EL0 A;  1R9T B;  4BBS B;  4A3I B;  4NW2 A;  1OXT A;  5K36 G;  1ILP A;  1TWF B;  3T13 A;  1K8O A;  1G8Z D;  2E74 C;  2OEO A;  2J4X A;  2F0P A;  1BBX C;  2FFK B;  5E3F A;  4RGT A;  2LS0 1;  5E4W C;  1A2T A;  1M4V A;  2KOL A;  5M3F B;  3U9S A;  1WD0 A;  1SNP A;  2PQE A;  4IFD I;  3I72 A;  3D4R A;  4KN7 C;  5D3D A;  2KVM A;  4KJN A;  2LFN A;  2CW0 C;  3TP6 A;  1YNJ D;  2K03 A;  4HMI A;  3GD7 A;  2WAQ B;  1R4P B;  4E6I A;  2H4O A;  1TU2 B;  3HEJ A;  1WTX A;  1OO9 B;  4RCO A;  1B3A A;  4A3F B;  1W6J A;  1VF7 A;  1SND A;  2XWB B;  1EWH A;  2NVY B;  3J7Y W;  4Q5V A;  4BY7 B;  1TY2 A;  2ICI A;  2FIN B;  1GUW A;  1QNU A;  1FD7 D;  1QIL A;  4H0L C;  1TWH B;  5KYI A;  1ONL A;  4CJ0 B;  5LL6 S;  3HRZ C;  3HGB A;  1PLF A;  4G7H C;  4CHT B;  1B4O A;  2LY7 A;  4JK1 C;  2BDN A;  1IYV A;  4X3S A;  3SVM A;  3HOU B;  2KED A;  2KEE A;  5C44 B;  2ZXR A;  5C0X G;  1JOR A;  3N6R A;  1SMY C;  1EY9 A;  2KEC A;  3LWU A;  1MGS A;  2DNE A;  4RCN A;  2RSN A;  2X69 A;  2ICE C;  2EJF C;  5M9O A;  3H09 A;  1RD9 D;  1HA5 A;  3KBX A;  4N9T A;  5IT9 L;  1SSO A;  1QNK A;  4FF1 A;  4ZKC B;  4H7B A;  4V0B A;  5JPN C;  1D5Z C;  3OPO A;  5CBA E;  1L0X B;  2Z8L A;  4IUR A;  2LKV A;  1STA A;  3A8I E;  3OW7 A;  2D2C C;  4R8N A;  2KQ3 A;  1HUM A;  1EY7 A;  3KLS X;  2TMP A;  3Q24 A;  2B8F A;  1Y69 U;  3T16 A;  2MJ8 A;  3NUC A;  5KNB A;  1EY4 A;  1PDQ A;  2F0F A;  1KAB A;  1BOS A;  5CV8 A;  2EJG C;  4CBV A;  2F0K A;  5TSS A;  1G2S A;  2EZV A;  5ISR A;  1A6X A;  2EY1 A;  4G7O C;  5IGF A;  3P1H A;  1RCV D;  3NWT A;  2IL8 A;  3MC0 B;  4NKL A;  1QJO A;  2F0E A;  2F0W A;  3T53 B;  1ENC A;  1H9S B;  3HKZ B;  5CV5 A;  3NPP A;  4CKE A;  1KTK A;  2K6A A;  2V4D A;  1SNM A;  3FDT A;  3JAM L;  3PIP 3;  3HOZ B;  4FVM A;  4PV1 C;  4F88 A;  3OMC A;  3PUW A;  4XQJ A;  1CTM A;  4PMC A;  4Z9C B;  1F2Z A;  3KBG A;  1B1Z A;  1SBB B;  1U4R A;  2PZW A;  1HXY D;  3S9W A;  5FK9 C;  4A3K B;  5DM6 3;  1SE3 A;  1IW7 C;  1SYG A;  5ELB A;  3M7N A;  1TS3 A;  4K5W A;  2OXP A;  3KLR A;  3NTH A;  4XQQ A;  3PO2 B;  3FKI B;  4NDX A;  4IUN A;  4DN4 M;  1X3Q A;  1SAP A;  1D6E C;  5COR A;  2EDG A;  2J7Z A;  5FLX E;  1EY0 A;  3C1F A;  2C9O A;  3EA6 A;  1KNE A;  5KEE A;  4HCE A;  4FXK C;  5C6A A;  4CJ1 B;  2AWN A;  3CRL C;  2Z4I A;  2B39 A;  1CM9 A;  3O13 A;  1XYI A;  1A3T A;  3E5S A;  5K36 H;  4RGM A;  3RLF A;  3NTK A;  1X3P A;  3N52 A;  1O7Y A;  2RA4 A;  1JIC A;  4IUT A;  2XWJ B;  2AQ3 B;  5C4X B;  1PTO C;  4M8A A;  4C3J B;  1LT5 D;  1GUN A;  2NYZ D;  1A3U A;  1Z47 A;  1QWY A;  3TBI B;  3A55 A;  2HDL A;  3X3N A;  1F9S A;  3KUP A;  1LTR D;  2XIW A;  5D3I B;  5C5L A;  3DMU A;  2VNU D;  4JBW A;  3QB3 A;  4RHR A;  3NE5 B;  2BA1 A;  3V05 A;  1EZ6 A;  1ESF A;  4NMZ A;  5C4Z A;  1PRT C;  1H9J A;  4J6H A;  4OO1 H;  3QOJ A;  1A3V A;  4HR7 B;  5JPM C;  3VR5 A;  3VR2 A;  4ZKB B;  5IT9 E;  2ENB A;  1S5D D;  1LAC A;  3GV6 A;  1CFM A;  1DOL A;  1YNN C;  1I4X A;  4X3U A;  4EGV A;  1F9Q A;  5C4H A;  3GV3 A;  3G7L A;  3SK4 A;  2WKC A;  5C0X I;  4A3D B;  1M8A A;  1TWC B;  1H9R A;  4N9P A;  4IN3 A;  1Y8N B;  1HUN A;  3HOX B;  1S5F D;  3MVV A;  4L8J A;  3S15 B;  5DEH A;  2K01 A;  1OXU A;  2R6G A;  1GXD C;  1FNV A;  2B2U A;  5CV6 A;  2E2H B;  3VYU A;  4RFB A;  3A8J E;  5FLX L;  1JC7 A;  1EWC A;  1O80 A;  5E1F A;  3GTP B;  1KLG D;  1FGB D;  3HOY B;  2BA0 A;  3NQT A;  2DN8 A;  2ZT9 C;  1QOH A;  1IKL A;  3OWF A;  3IFD A;  4OIJ A;  1CI3 M;  2L9H A;  4PQX A;  1JWM D;  1Y8P B;  2PZT A;  1PYW D;  3IFT A;  4ILW A;  4I7Z C;  5IOD A;  4KD3 A;  3K5O A;  1TWA B;  4KJO A;  3ERO A;  2B2T A;  3Q6S A;  2JE6 I;  4HSV A;  1K83 B;  2F0U A;  1WTO A;  1ROD A;  1WTQ A;  4ZRZ A;  2K04 A;  3S2H B;  3WOF A;  1SNO A;  2F0J A;  2NBF A;  1O7Z A;  3QJY A;  4K2K A;  4IUV A;  2A6E D;  2PPB C;  4OO1 G;  5CV9 A;  1NR4 A;  3TZU A;  3KLS A;  1WVL A;  3OIP A;  2RDH A;  4ABN A;  3D6C A;  3A54 A;  2Q8R E;  1NUC A;  5J22 A;  1CZW A;  2F4I A;  4O42 A;  5IOC A;  3H91 A;  3E6Z X;  1Y1W B;  1TR5 A;  4FXD A;  4KD4 A;  1C4Q A;  5FKA C;  3MZ5 A;  4IQZ A;  4G7Z C;  1JOK A;  2LMC B;  5KIX A;  2O2L D;  1ET6 A;  1STE A;  4L6T B;  5CV4 A;  1RTN A;  4RWS C;  2NB0 A;  3I3C A;  4A3G B;  1WTV A;  3EFX D;  1PTO H;  1RJT A;  5M5W B;  2WV6 D;  1EOT A;  5C5M A;  4XT1 B;  1Q1B A;  4FP5 D;  3KF8 A;  4HSP A;  5EQ0 A;  2MGS A;  2A73 B;  2F0O A;  2PW5 A;  4CJ2 C;  2KCC A;  2Z1C A;  1C8C A;  1OXX K;  4UDU C;  1PFM A;  5CMD A;  4AYB B;  4QF4 A;  4BS9 A;  3SK8 A;  4DGZ A;  2QDB A;  4DK0 A;  3HP3 A;  2E2J B;  1Z7T A;  2FMM A;  1HTL D;  3MXN A;  5C0X J;  4FYD A;  1Q1E A;  5T1G A;  4C1N I;  1VMP A;  4X3K A;  3PV0 A;  1B9N A;  1STY A;  5I9O A;  1AW7 A;  2X6L A;  4I65 A;  2J0T D;  1KDC A;  5FO8 B;  3K7A B;  1QE6 A;  4V19 0;  2L12 A;  4QIW B;  3BVM A;  3CKI B;  3K6O A;  2RSO A;  3P7J A;  1LTG D;  5EBD A;  2SDF A;  1SYD A;  3WOE A;  2WIN B;  2O5I C;  3M3Y B;  2NN6 H;  1IYU A;  1SMY D;  2F0D A;  2Y0S B;  1O7L A;  2A69 D;  1NAP A;  4ZAI A;  1BO0 A;  1OXS C;  1IL8 A;  5CC4 A;  2EVB A;  1L0Y B;  3SE0 A;  4KHV A;  2KJX A;  5KNC A;  4EQN A;  3HZX A;  4MHE A;  3W3A A;  5J39 A;  4HAE A;  1EFI D;  1HFN A;  3VR6 A;  3NHH A;  1BF4 A;  1BQQ T;  3I91 A;  1E0B A;  2AQ1 B;  1OXV A;  2E2I B;  1BCP F;  1JOQ A;  4WFN 3;  3C3L A;  1Y8O B;  4G4K A;  4K8I A;  1ESR A;  1DCZ A;  1VCI A;  2YU9 B;  1UUP A;  2M00 A;  2JYO A;  5IGC A;  1MBY A;  2KHS A;  4P2C B;  1H9K A;  4R9W A;  3TME A;  3WDN A;  4OHJ A;  2F0L A;  2D9U A;  1ZYR D;  3MTS A;  2NVQ B;  1LT4 D;  1VMC A;  1TY0 A;  3K0Y A;  4K8J A;  1NSN S;  1O78 A;  4BWG B;  1NR2 A;  5COY A;  3DUZ A;  1E2Z A;  2VXW A;  4G57 A;  2O5J C;  4RKB A;  2F1M A;  2CQA A;  3R3O A;  5JEA J;  1SJH D;  4WRD A;  3NSW A;  1E2W A;  1B44 D;  3NTI A;  4ZLT F;  1Q90 A;  1V1O A;  1JWS D;  3PMF A;  4KTA A;  5JVH 3;  3DWQ A;  2B2V A;  3T51 B;  3QWN A;  4HMJ A;  4TKO B;  4QUF A;  1MSH A;  2FHT A;  3MXG A;  5D14 A;  1HCZ A;  2G9H D;  3OSO A;  2IWH A;  3FVQ A;  3UI2 A;  2A6H D;  5JOB A;  2SNM A;  1U4L A;  1GUO A;  1B53 A;  4DF7 A;  3SHL A;  3TP5 A;  1MD2 D;  1J9O A;  4WOR A;  2B2U C;  5ELD A;  2XRQ D;  5JEA G;  1KLU D;  1ET9 A;  2K7V A;  4ULL A;  1JOO A;  4A3M B;  3HOV B;  1H9S A;  2NZ1 D;  2IT1 A;  1EQV A;  3K57 A;  4IFD G;  1ZEQ X;  1RDP D;  3M4Y A;  2EYL A;  1TQO A;  1G29 1;  1B9M A;  3QOL A;  2B63 B;  2E76 C;  4RH6 A;  1TVX A;  3I90 A;  1FNW A;  1JR0 D;  4TQU S;  2F0M A;  1WCM B;  1W6K A;  3FMC A;  1R4Q B;  3BVG A;  1SNC A;  2ZXP A;  3DEO A;  3OOC A;  3BDL A;  4H13 C;  3GTK B;  1F2M A;  3S16 B;  2K5D A;  4GZY C;  4QCL A;  1LTA D;  4Y7N B;  1I50 B;  2BCO A;  1G6Z A;  1GOZ A;  1DJR D;  5KRU A;  4CGY B;  1DYQ A;  5BN5 A;  4KI0 A;  3R2I A;  5IGG A;  1LTT D;  2KCN A;  3Q23 A;  1BCP B;  4MN3 A;  1LV9 A;  1TII D;  4KY5 A;  1UNS A;  2QKI C;  3T56 B;  5ELF A;  2JEB I;  1ICW A;  3OIQ A;  1D5X C;  3FRP B;  5ELE A;  4KV6 A;  1UEA B;  3IL8 A;  2JP1 A;  3VA5 A;  4DK1 A;  2NTS A;  4ODG A;  3NK9 A;  1SEB D;  1PMR A;  4F7X A;  2EYJ A;  2IX3 A;  4X3T A;  3I4L A;  3C2P A;  5CR3 A;  2JEA I;  1BDO A;  1I4Q A;  2MP1 A;  3FEW X;  1I4G A;  1RF2 D;  2ID0 A;  1JB3 A;  4L63 B;  4YIJ A;  3VYT A;  1KAA A;  2BOS A;  1T5E A;  1ZYR C;  1EIH A;  4IUQ A;  2NTT A;  3S1M B;  1FNU A;  1PRT D;  3X3M A;  3HS0 C;  4EVO A;  1U9R A;  1EEI D;  2EYP A;  4DA2 A;  2EY6 A;  3ITP A;  2RQX A;  1JE4 A;  5D65 A;  3Q22 A;  3MHB A;  1EYC A;  1PRT F;  4EQP A;  1D1I A;  3D8G A;  4XYQ A;  2MHV A;  1SXT A;  3MEH A;  2K5W A;  1Q3L A;  1BUV T;  3VR3 A;  4C3I G;  2D5D A;  4KK7 A;  5F2D A;  3VYR A;  3NBH A;  1AEX A;  2BDO A;  3GTO B;  4C3J G;  4TRD A;  3CRK C;  2WAC A;  2XN9 C;  2HQE A;  1RHP A;  5LHY 1;  3M7G A;  5AFW A;  4DAP A;  1IKM A;  2MPM A;  2AUJ D;  1I4P A;  5C3X A;  3GO5 A;  2HCC A;  1A15 A;  1EYA A;  3OMG A;  2H1E A;  1S5E D;  3D4D A;  4K14 A;  3CQZ B;  3HOW B;  2M2L A;  2KUM A;  4KY6 A;  3TSS A;  2JSO A;  2NVT B;  2R7Z B;  3D4W A;  3P20 A;  4DAV A;  4K6D A;  2O4X A;  3PUZ A;  2GA4 B;  1ENA A;  2L4N A;  4K5X A;  3SXH A;  1HTP A;  3AMU A;  3R8B A;  2AUK A;  4KKS A;  5J1Z A;  5M5Y B;  1WTP A;  3QO2 A;  2EY5 A;  3S1Q B;  2QCP X;  3SDZ A;  2K05 A;  3PUX A;  4ME5 A;  1AN8 A;  5EPK A;  2K28 A;  2WII B;  4K5V A;  5EJW A;  4DXG A;  4H44 C;  1HRJ A;  1EY5 A;  2D62 A;  2C5C A;  1LT6 D;  2SEB D;  4J8Q A;  1GUG A;  4C56 C;  2A5H A;  1B50 A;  2JA6 B;  5DNF A;  5T1I A;  2DNC A;  3W2D A;  1B2T A;  3LX0 A;  1RKN A;  2CHB D;  2MUY A;  3GQB A;  1DD2 A;  4RA8 A;  2XRS D;  1G91 A;  2VB3 X;  1CHP D;  4OIK A;  1TWG B;  4KN4 C;  4CKB A;  3MAQ A;  3I4M B;  3GTL B;  1HPC A;  1Z6H A;  1PRT B;  2QIL A;  5CBE E;  3Q0A A;  1FYC A;  4LK1 C;  1EU4 A;  3NP8 A;  5I2X A;  3VYS A;  3P75 A;  1LT3 D;  4HTH A;  1T5X D;  2EYM A;  1Q12 A;  3D31 A;  3RUZ A;  1PXU A;  3J81 L;  1U4P A;  2PNR C;  5FOB B;  5C3E B;  2EYH A;  3MWY W;  1SFO B;  4F87 A;  2R93 B;  4IZ8 A;  4RAU C;  3KK7 A;  2R92 B;  2PCF B;  3SR1 A;  3RMH A;  2E2D C;  5KGU A;  3VA7 A;  1CT1 D;  4KHZ A;  2N55 A;  1K8M A;  1SE2 A;  3BYY B;  2RDG A;  2F0Q A;  2X6G A;  3I70 A;  5M5X B;  4ZUJ A;  1PTO F;  4B9W A;  3M85 A;  5BN4 A;  3BG3 A;  3GTQ B;  2CVR A;  4KKT A;  4J1M A;  2N88 A;  5JAV A;  4RKL A;  3SEB A;  4RGO S;  4LMQ D;  1XX8 A;  3IAY A;  1J8I A;  1EY8 A;  1GHK A;  4LAA A;  3DHQ A;  1CK1 A;  4M1U B;  1WTR A;  1TS2 A;  4C3I B;  1U4M A;  4MIU A;  4FF3 A;  5G3L F;  1C48 A;  1D5M C;  3NQI A;  3MFY A;  5I9P A;  4FF4 A;  2NWG A;  4FF2 A;  1I4R A;  3QIA A;  3DWP A;  4RHS A;  1KNA A;  5I6W A;  3PUY A;  3NWS A;  1EU3 A;  5I4D A;  1LTB D;  2VUM B;  2B2W A;  2ZXO A;  3ERQ A;  3BS1 A;  5KYL A;  3S1N B;  2F0G A;  2VB2 X;  3GP7 A;  1Q8I A;  1D2B A;  5JVG 3;  3K58 A;  1MI2 A;  2K33 A;  3RZD B;  1YNJ C;  1DXM A;  3GTJ B;  3L7Z C;  1HA6 A;  2CW0 D;  3H3V C;  4XYO A;  3ZYY X;  1V1P A;  1F77 A;  3H94 A;  4S3S A;  5DM7 3;  3H0G B;  4HN7 A;  3PO3 B;  2WKD A;  2RVL A;  2F03 A;  5IGE A;  1SJE D;  3DM1 A;  3GTG B;  2KA7 A;  2B2V C;  4B9X A;  1HFG A;  1CHQ D;  4BBR B;  1SNQ A;  3IKJ A;  3BYT B;  2SNS A;  1AZP A;  4A3B B;  1STG A;  1SYB A;  3SK5 A;  2K32 A;  1KDB A;  4ZQ3 A;  1GUS A;  2NN6 I;  4Q0F A;  4IFD J;  5EBC A;  2FMC A;  4B08 A;  1BXT A;  1F9P A;  4TSS A;  4A3E B;  2EYF A;  4UAI A;  4BA1 I;  1JQY D;  3NXW A;  5EPL A;  1AP0 A;  3J81 E;  1SDF A;  2HUG A;  2AWO A;  4KY7 A;  4EQO A;  3ND9 A;  2IW3 A;  4C1N K;  3ND8 A;  2M9V A;  1LO5 D;  3R2T A;  5CYU A;  3EJI A;  1CQV A;  2JXM B;  1A2U A;  4ID6 A;  1PTO D;  3EQL C;  5FO9 B;  2L1B A;  4U68 A;  4A3J B;  1DM0 B;  2NVX B;  2SOB A;  3TZD A;  2WP8 J;  2PMZ B;  3A56 A;  4IUP A;  1TT2 A;  4DNR B;  1PFB A;  3CHB D;  1GUT A;  3FPP A;  2K5Q A;  5ELC A;  1X32 A;  4BA2 I;  2XSC A;  1PZJ D;  1GJX A;  2F0I A;  5JEA H;  1EZ8 A;  1LLR D;  3J7A F;  1F9R A;  2RBM A;  5NUC A;  1II3 A;  5A2Q E;  1EIG A;  2RDF A;  4QB4 A;  4HED A;  5JJZ A;  3GTM B;  4R8I A;  2I07 B;  3CU7 A;  4XDX A;  5EPJ A;  1VF5 C;  1LAB A;  5A2Q L;  4HCS A;  3K59 A;  5G3L D;  3E0J A;  2BE5 D;  5FO7 B;  4F8M A;  2XNA C;  2JA5 B;  2B2W C;  4DFA A;  2NUC A;  2TSS A;  1D1K A;  1LTI D;  1DOK A;  3I73 A;  3C46 A;  2WB1 B;  5LL6 X;  1SYE A;  4C3H B;  4XTC S;  4IUU A;  3G6J B;  1I6H B;  2HCI A;  3S14 B;  3LWE A;  3RZO B;  1XWE A;  3BDO A;  3R93 A;  4FNF A;  1PTO B;  1TS5 A;  5K5P A;  4RGN A;  4OGQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...