1U4MA

Human rantes complexed to heparin-derived disaccharide iii-s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A5
publication title The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Attractant
total genus 14
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u4mA00
1EL0A 2MJ8A 3MTSA 3DEOA 1Q3LA 1G2TA 1DZ1A 1MI2A 1BBXC 2D9UA 2RVLA 4O42A 1QG7A 3P7JA 2DY7A 1HUNA 1WTWA 2X69A 1B3AA 3I90A 4ZAIA 3TN2A 3R93A 3SVMA 5EPKA 4HSVA 3GV3A 2CVRA 5E4WC 5CMDA 1U4MA 5EJWA 1LV9A 1X3PA 1ZXTA 1PFNA 1M8AA 4NW2A 4UAIA 3MWYW 1WTQA 1TVXA 2L12A 1JICA 2MGSA 5DNFA 1HFNA 1AP0A 5T1IA 1X32A 4HEDA 1MSHA 3KUPA 4ZLTF 1A15A 1J8IA 1PFMA 2DY8A 1ICWA 3KBXA 4CJ0B 1IL8A 1QE6A 1G2SA 1HFGA 3HP3A 1NR4A 3I8ZA 1PDQA 4QUCA 4XDXA 3TZDA 2L1BA 2VXWA 1BNZA 5EPJA 4CJ2C 1DOKA 1KNEA 2L4NA 3LWEA 1WTVA 4MHEA 2KECA 1GUWA 1XX8A 2FHTA 4IUTA 2X6LA 1NAPA 1NCVA 5CORA 1RHPA 4QUFA 1WVLA 1F9RA 3IFDA 1HUMA 3ONAB 1B4OA 4OIKA 2HUGA 2RA4A 5E4XA 4HCSA 1U4RA 2H1EA 1F9QA 2KUMA 1AZQA 4IUUA 2K05A 2KVMA 4X3KA 2FJ2A 3FPUB 3G7LA 2HCIA 2NWGA 3FDTA 1RTOA 4HAEA 5EPLA 4CJ1B 1PFBA 2B2YC 1G6ZA 2R3ZA 1O80A 1ILQA 1DOMA 1RODA 2B2VC 5AFWA 1C8CA 1KNAA 4IUQA 2B2UA 3IL8A 1HA6A 1RJTA 1ILPA 1EQTA 2KEEA 3I91A 2L11A 1AZPA 3I3CA 2K04A 4IUPA 2NZ1D 1WD1A 5D14A 1BO0A 2B2YA 2L9HA 2RSNA 3H91A 1VMPA 1SDFA 1F9SA 2B2VA 1BF4A 4ZKCB 1U4LA 2JP1A 1XYIA 1WTRA 1EOTA 1WTOA 1WTPA 4ZKBB 1EIHA 1RTNA 3DM1A 4MN3A 1DOLA 1G91A 4ZK9B 2BDNA 2B2WC 4IUVA 3D6WA 2K01A 4X3TA 2B2TA 2JYOA 1E0BA 2EOTA 4IURA 1B2TA 2KOLA 2K1BA 3GV6A 2B2UC 2N88A 5EKIA 4R9WA 5CBEE 4X3SA 2KEDA 2M2LA 1WTXA 2B2WA 1PLFA 2MP1A 4XT3B 4R8IA 4DN4M 2HCCA 1CA5A 2J7ZA 1HRJA 2MPMA 5COYA 1B50A 1F9PA 2SDFA 1MSGA 1B53A 1J9OA 4RWSC 5D65A 1DONA 2X6GA 1HHVA 4RAUC 1F2LA 1VMCA 2EPBA 2K28A 3QO2A 1SSOA 1EIGA 1O7YA 1S4ZA 2Q8RE 2NYZD 1SAPA 1CM9A 1QNKA 2B2TC 2HDLA 4RA8A 4X3UA 1U4PA 5EQ0A 1IKMA 3Q6SA 2IL8A 2FMMA 2RSOA 4LMQD 1O7ZA 1ML0D 3DEPA 1JE4A 2FINB 1NR2A 2K03A 2N55A 4U68A 4XT1B 2Q8TA 1MGSA 1WD0A 1X3QA 1ESRA 2XIWA 2HDMA 4OIJA 5JJZA 1CA6A 2EE1A 2FFKB 3UI2A 3F2UA 5CBAE 5T1GA 1IKLA 3N52A
chains in the Genus database with same CATH superfamily
4KI0A 4WJ4A 1M90C 1NMGA 5IT9L 4OGQC 2KA7A 4HIDA 1PH4A 1YHBA 4AQYL 2A1AA 1Z47A 1B8AA 1AN8A 1TWHB 2Z0SA 3HOWH 4DV2Q 3SK8A 1GKHA 5C4JB 1TVXA 4CHTB 4XTCS 4FXKC 1PH1A 3A8JE 1K0RA 2AWNA 2A6EC 3KOJA 5BN5A 3J7AF 3CC4A 3L2PA 5GQOA 4L6TB 1EYDA 3CCLA 4FXDA 3GTGB 3NELA 2K5DA 2XRSD 5FOBB 4Q5VA 2YTYA 1N33Q 3VR2A 3S15H 2JA7H 3S2DH 4DKAC 1L2FA 4IUTA 1B3QA 1UWVA 4A3GH 3DWPA 3I4NH 1D5MC 3KLSX 3A54A 4GN5A 4LF7Q 1N8RC 1M4VA 2A5HA 1IHZA 3FP9A 3G7LA 4QF4A 5A2QE 4A4IA 1PFBA 5M5YB 1RD9D 1ILQA 1NY4A 1K8AC 3J7A5 3CPWA 4HTHA 3CCVA 4DAPA 3VYUA 4B3TQ 2JE6I 2F1MA 1P16A 3M7GA 5C3WA 3I2ZA 2B2VA 5EKLA 4YHHL 1B70B 4EGVA 4DAYA 1KHIA 1SE4A 1VQPA 4ILWA 3BYTB 1IYUA 3B6YA 1UEBA 4BXXH 4A3JB 2EOTA 3EJIA 2VS1A 3GV6A 2B2UC 1BCPD 4BS9A 3P75A 5LHY1 3J81L 2KEDA 1MHWC 3E6ZX 3JC66 1HRJA 1B50A 1LT3D 5IYCG 1S5DD 3E3XA 2PI2A 2R61A 1ZYRD 5FJ8H 3M7NA 1DJRD 1ENFA 4X3UA 1LO5D 5JEAJ 4IPHA 1NJIC 3TDQA 4AYBB 2EE1A 3BYYB 4DAYB 2F3WA 1BCPF 4BY1H 3I4MH 4KHPL 2R7ZB 1K8GA 4R4OA 3TREA 2ZTCA 5CV8A 4IFDG 4OWXB 2DNCA 4DK3C 1EYGA 4GS3A 3W2DA 3Q0AA 3H0GH 1LUZA 1VQJA 1S5BD 5EPKA 3G6EA 5KNBA 4IJHA 4IJLA 4RG1A 1WCMB 1TT2A 3M9BA 1XPUA 1TR5A 4NW2A 1EUJA 4LFCL 2PO4A 1H9SA 3WWVA 5IGBA 4DR1Q 4LF6Q 2WB1B 1PTOD 5HGTA 1SNCA 5CYUA 1GJXA 4RGMA 3PUWA 4C3HB 2EJGC 3CCJA 2H4OA 1IYVA 4DU9A 5CV4A 3JAML 1K8MA 4LAAA 1BR9A 3KDFB 5CV6A 1SNPA 5CORA 1F9RA 1YJWA 2UUCQ 1GVPA 3GTKB 5LMNL 2HUGA 1STBA 2AHOB 2SNSA 2KUMA 1HPCA 2MO1A 5HY6A 2A6HC 2HCIA 3SR1A 4DV2L 1X3EA 3D4DA 1EZ6A 1LTSD 1PTOF 4IUQA 2B2UA 3T16A 5JPNC 4GKJQ 2JA7B 3S2DB 4A3JG 1VQMA 1JC7A 3V05A 1QNUA 2WV6D 4A3GB 3D31A 4XIGS 4ZKCB 5IWAQ 3DLLA 3I4NB 5GAHC 3GD7A 1OXVA 4IPGA 4MN3A 3TS2A 5K36G 2SNMA 2K6AA 5C0XJ 4FP5D 3ER0A 4DV1Q 3T1HL 4IURA 1JOQA 2QILA 1LT5D 3A8KE 2A69C 3D0FA 1X3GA 2M2LA 2K5WA 1EQVA 4HJ5A 4G7OC 4TRDA 2LXJA 3ERQA 3VDYA 1JWSD 1O7YA 1GUNA 1LTTD 3GTMB 2IL8A 2R7ZG 4ME5A 5G3LF 1QWYA 2NN6I 1PZJD 3BG3A 2XIWA 3CCEA 1PV4A 2JN4A 3F2UA 4X64Q 1CQFA 2BA1A 1LABA 4JI8Q 3AYHB 2K5VA 1V1PB 3PF5A 1VQCA 1PH7A 2NVTH 1CTMA 1WCMG 4UPAA 1MI2A 3S1RH 2BH8A 2RKSA 1BOSA 3M4OB 2QEXA 2WB1G 3KYHC 1Y69U 4FF4A 3S16B 1HFNA 1EY8A 5I9OA 4BY1B 3I4MB 2A68C 2NVQH 4C3HG 2ZM6L 2DUDA 4IPCA 4FF1A 1VQ6A 2DJGC 5IGGA 4X65L 4QJFA 4BBRH 1G8ZD 1NR4A 4F7XA 2D2CC 2L1BA 4GZYC 2Z6BA 2V4DA 3H0GB 2KHIA 3RN5A 5FLMH 2FXQA 1VCIA 3HG9A 1MBYA 1IW7D 2F0IA 1WVLA 3KF6A 1H9RA 2NTSA 1LT6D 2E8GA 2YYZA 3STBD 2O4XA 2RA4A 4QGUA 1CZWA 2JA7G 3UE0A 3K5NA 2NN6H 4A3GG 4C3IH 1PRTD 3I4NG 4R4IA 1JB7A 4FO2A 1SFOH 2E2JH 1BO0A 3RLNA 4LF6L 1UEAB 1U4LA 1WTRA 1NSNS 2OXPA 4ZKBB 5J39A 2UXCQ 1TWFH 2O2LD 3DUZA 4IUVA 4JCVE 5IGFA 4WFN3 1KD1C 2UXBQ 5HURA 1C4QA 2E5LQ 2K1BA 3P1HA 2F03A 2AMCB 3J81i 1HNZL 4DXGA 4BXXG 2ZT9C 1PRTF 2HCCA 3K5LA 3PV0A 3PGZA 5ELDA 1IBLQ 2NB0A 2VL6A 1TS5A 1SSOA 1EIGA 1JOKA 2AQ3B 4IN3A 2Z6KC 3GTOB 4P74A 4JYAQ 2LMCB 2VQEQ 2IWHA 2WAQB 3TS0A 4X62L 2GVBA 5FJ8G 1N32Q 1YJ9A 2PPBC 1FL0A 3HKZB 2E74C 2FFKB 3H3VC 1IKLA 5IWAL 3I72A 1I4GA 3PSIA 3K7UC 1Q3LA 4PG3A 3NSWA 1CK1A 5E7NA 1CKNA 4O42A 4A3EG 4DAVA 3I4MG 3HOYG 1TU2B 4YCWA 4XQQA 4Y52H 1VF5C 5C0XI 3HFZB 1RIPA 4CDFC 3KJOA 2N78A 4DK1A 5C3EH 2L12A 5IE8A 1C9OA 1AP0A 5KGUA 1MSHA 4Q0FA 1PZKD 4LF9L 2EY6A 2HD3A 3X3MA 2RQXA 4ZLTF 1I4XA 2NVTB 1J8IA 4YWMA 3S1RB 2EYOA 4UP9A 4UY8C 4K14A 2UUBL 2EYPA 5CGKA 5AJ3L 3K5MA 1XMOQ 1XNQL 4FYDA 2G5DA 5CV9A 4JI8L 4K6LA 3ULJA 1KLGD 2KECA 3K7AB 3V96A 3JAMi 3VA7A 2O5JC 3J7YW 2NVQB 4K5XA 1W3SA 4LF8L 2Z8LA 3CHBD 1J5EL 2I5MX 4X66L 4BBRB 3GTPB 2XRQD 5AFWA 3OIQA 4FF3A 3S24A 4A3MH 3HOVB 2VB2X 2F3VA 3T51B 3HOZB 4B9WA 3ICEA 3LNNA 1HXYD 3J81j 3W5OA 5FO9B 1WYDA 2LFNA 1VDZA 4JI2Q 2K5NA 1DD2A 4JG2A 5LL6S 1XPOA 3PIO3 3NEMA 1BKBA 1CHQD 1JR0D 1PLFA 1SFOB 2J7ZA 2E2JB 2WAQG 1MSGA 3T13A 3V2TA 3HKZG 1E22A 4V190 1TWFB 3TP8A 1VQNA 1DGSA 2SOBA 1HH2P 2EY2A 4A3DH 1D7QA 4XT1B 4GNXA 1KL9A 3F2BA 1SE3A 3A55A 2PYKA 4KHZA 3K8AA 3BDLA 4POFA 4TQUS 4LUOA 2D5DA 3K57A 4RCOA 2E5LL 1CFMA 3S9WA 5M3MH 2DY7A 1TWGB 1H95A 3NPPA 3OWFA 3L9AX 3LGJA 5KYLA 4UAIA 1IBLL 5JJLA 3BVZA 2MGSA 1JICA 4TSSA 4DV6Q 2KCNA 3F8TA 2R7DA 3VYRA 1PH9A 4XQNA 4JYAL 1Z6HA 4CJ0B 1I94Q 4KMUC 2H5XA 2VQEL 4EVOA 2V1CC 3H6MA 1N32L 4JW0A 3TZUA 4OELB 2XWJB 4BBRG 1TWCH 1XX8A 5C3EB 3Q8DA 1EU3A 4QUFA 4J6HA 4AYBE 4OIKA 3GO5A 3HOVG 1JE5A 4HCSA 3HOZG 2A6ED 4P72A 4X3KA 3FKIH 5EPLA 1STGA 2KBNA 3E9IA 3OMGA 4XQJA 2HIXA 1NMFA 4YHHQ 2N49A 1QVFA 4GKKL 3AU7A 4K5VA 2CH4W 5CV7A 1O7LA 2PCFB 4DGZA 1HZBA 2BCOA 2OEOA 4JBMA 1EYAA 2PI2E 4M8AA 1N34L 5IYDH 4DR2Q 4HJ8A 3WDNA 2QF7A 3DM1A 2IHEA 4PZ8A 2DGYA 4DV7Q 1ASZA 3U9SA 2K01A 3CAMA 1XMOL 3MEFA 1LM0A 3MXNB 1EZ8A 2ICIA 1FNWA 1R4QB 2WB1E 4A3MB 3UDXA 5JVH3 2R6GA 4XT3B 5ELCA 3E0EA 2VUMH 4RGTA 1F9PA 4OO1G 1I4RA 5D65A 1JWMD 2EPBA 5JAVA 1YITA 5M5XB 1BUVT 1HTPA 3HOXH 4UP7A 1YHQA 1V43A 4KHPQ 4LWCA 3M4PA 2Y0SB 1K3RA 1X3QA 2PNRC 1IBML 1XTCD 3RUZA 2SEBD 5FO8B 2ENBA 4FNFA 5M3FH 4JI5L 5BN4A 3WOFA 5A2QL 5JOBA 4JI7L 4H7BA 1Y1WH 4LFCQ 3QR8A 5NUCA 2RCFA 4A3DB 2E2IH 3R93A 1EQQA 2K7VA 3DWAA 3GP7A 4PMBA 5KIXA 3QOLA 2HT1A 1T9HA 3KK7A 3KUPA 2VQFL 4KD3A 5D3IB 5C3EG 3EIVA 1PDQA 5M3MB 3FMCA 2EYHA 2LY7A 1KAAA 3I7FA 2UUAQ 5LMNQ 3F1ZA 5IOCA 2EXZA 1Q82C 1Q1EA 1RCVD 1ENCA 3CRKC 3QB3A 4PMCA 3U9OA 4DV0L 3UDGA 3R2IA 3I70A 1Y8PB 4JC0A 3TBIB 5M9OA 1HA6A 1TWCB 2KEEA 2L11A 3RMHA 4DV6L 1GOZA 5D14A 3SK5A 3T1HQ 4MTKA 4BBSB 1F9SA 1I94L 5KNDA 4A3MG 3N6RA 4QL5A 2EZVA 2JA8H 4HR7B 1MJCA 2BDOA 5K5PA 1H9KA 5GAGC 3FKIB 4I7AA 3S1NH 4FVMA 1SE2A 1V9PA 2IJ0A 3MFGA 2PZTA 1RKNA 4DV3L 2Y0SG 2X6GA 4LFBL 2EXDA 3QO2A 4BA1I 2HDLA 1PH5A 1PHJA 1H9JA 3MHBA 3P20A 3FVQA 4Y7NB 4H02A 3EA6A 3NHHA 2EQSA 3D6CA 2MNAA 3VA5A 2A69D 1QB5D 3PCOB 3T4AC 5IT9c 1L1OC 5EBCA 4RKBA 2VUMB 5BR8L 3N52A 2KENA 1SRUA 3J80c 1IZ6A 4DR2L 1FJGQ 1K28A 1I4PA 1E7ZA 2ZTEA 2ZXRA 4DV7L 1SN8A 4NMZA 1CUKA 2I5HA 3BJUA 1TKWB 4CDCC 5J22A 3E0JA 2P5ZX 1SNQA 4BWGB 3I90A 2ZM6Q 5EKKA 1XTDA 1AH9A 1NUCA 2VZAA 4HJ7A 1LV9A 3I4OA 4X65Q 5M3MG 4RH6A 5M3FB 3C3LA 2PMZB 2ZXPA 5IT9E 1EFWA 1B9NA 2EJMA 1L0YB 1E3PA 5IP7H 5E1FA 3J80E 2RF4A 1PFMA 1SE8A 3FEWX 3VR4A 3C1FA 4IQZA 1Y1WB 2VXWA 5FLXc 3KDFA 2E2IB 3A0JA 1HZAA 4JI6Q 2CFMA 2WAQE 5ELEA 4A76A 3HKZE 3W1BA 1HUMA 1I3QH 2A68D 3L0OA 2GN5A 1KDBA 3FDTA 1RTOA 4BBSG 2E76C 2OCEA 1UE5A 1WI5A 4AH6A 1ZEQX 1C8CA 2BE5D 3MFYA 1STAA 2JA5H 3NTKA 5FLXE 4KD4A 1VQEA 3FKIG 2MUYA 4R4TA 1I6HH 4K6DA 1K8OA 1PVOA 4KV6A 3HOWB 1X9NA 1BF4A 5I4DA 3RN2A 1WTPA 2NVYH 1HNZQ 3D6WA 1NTGA 4QB4A 4B9XA 5I9PA 2UUAL 1GO3E 3MAQA 5IYDG 5CBEE 2XSCA 2WP8J 1V1QA 4RFBA 3PIPA 3E5SA 1Q12A 5C44H 4R8IA 3CXCA 1CA5A 1YHAA 2MPMA 5COYA 4GLXA 1EY4A 3TP5A 2DNEA 1A8VA 4X62Q 4QIWB 3CRLC 3S15B 3NTHA 1STYA 4EQPA 4OXPA 2RDHA 1EQRA 3S1NB 5G3LD 3S1QH 4IOCA 1V1PA 3HEJA 2A73B 4PZ7A 1KC8C 1VQLA 5CC4A 1O7IA 1C0AA 5DAUA 3EN2A 1Y8OB 4P73A 1JT8A 3AQQA 2ZJQA 1PFSA 3SK4A 5M3FG 2F0QA 3URYA 4AYBG 1DCZA 4F88A 2ZJPA 4JK1C 1L1OB 4ZAIA 4DK6C 4LF9Q 1RF2D 2PQAB 1VQFA 3U4ZA 1VQ5A 1SYCA 2F0KA 5CMDA 3SE0A 1EEFD 2OF1A 1Y1WG 3MEHA 1SJHD 1JCKB 1HJPA 1EU4A 5KYIA 2UUBQ 5AJ3Q 3OWEB 4HN7A 1XNQQ 1ICFB 1XXGA 2DY8A 2F0DA 3KBXA 2F0TA 5HGQA 3QIAA 4JVZA 1ONLA 3RZDH 2F4IA 2QGQA 3NE5B 1OXUA 2NBFA 5C6AA 3JAMc 2R92H 4LF8Q 1D1KA 1J5EQ 1ENAA 1ZYRC 1WTVA 4JBWA 1K83H 1FJGL 4X66Q 3A7AB 2NVXH 1RHPA 4WRDA 2LKVA 5LL6X 1B4OA 2ZJRA 3G4SA 5IYBH 4A93H 3HS0C 2F0NA 4IUUA 4DR7L 3M3YH 1GUTA 3HOWG 4IUNA 3OMCA 3AB9A 4CGYB 1BVSA 3WOEA 3RZOH 3IL8A 3JAME 5GAEC 2K14A 1R9TH 4DV5L 1X3FA 1GHJA 1DOLA 3LWUA 5C5MA 4IFDJ 3EQLC 4H44C 1VQOA 3FPPA 4UHVA 1VQHA 5C3XA 2KOLA 4JI6L 1XJVA 1PTOH 1U0LA 1WTXA 1PH3A 2IT1A 1I6HB 3AFQA 1STHA 2YV5A 3O13A 2Q2UA 4RWSC 1WOCA 1QJOA 3NP8A 1D2BA 2K28A 2UU9L 2Q8RE 2WKCA 4KTAA 2NVYB 1SJED 3SDZA 3I73A 2I07B 5GROA 1ASYA 4YY3L 3GTQH 4HIMA 4HIOA 4TKOB 4LJZC 1PH8A 5CBAE 5C44B 2YU9H 4KJOA 3F2DA 2MQHA 5H1SE 5M5WH 1DXMA 3NQTA 2EYMA 2N8NA 4UDUC 1L0XB 5ELFA 3S1QB 1B3AA 1KTKA 2B8FA 3ND9A 1B1ZA 3AMUA 3EFXD 5JEAH 1WTQA 3GQBA 4O1NA 1JQYD 3C2PA 3TP6A 4HEDA 3ULPA 1TWAH 3IKJA 3C1EA 4KN4C 1YI2A 4JI3L 4OWTB 4QUCA 1QVGA 1KDCA 5IP7G 4BY1G 1PH2A 3PUYA 1GUWA 3W1GA 1QOHA 2Y0SE 3D4WA 5CR3A 2QA4A 2F52A 1K0SA 1LYLA 4G4KA 4GKKQ 1HTLD 1PYSB 1WTHA 3H0GG 3W3AA 3Q22A 1TY0A 1YJNA 3K81C 2NWGA 1VQ7A 2B2YC 2F0VA 2R92B 1N34Q 1S5ED 5FKAC 5FO7B 3S17H 1SLJA 1L0WA 1EQTA 4N8X1 3I91A 1WD1A 1LTBD 2NZ1D 5TSSA 1OXSC 2NVXB 1SDFA 1IXRA 1A63A 3K59A 4A93B 4DXFA 1EY0A 1CKMA 3VR3A 3M3YB 2CH4A 3PQIA 4DR6Q 4JV5L 1R9TB 5EGTA 1K9MC 3VR6A 1B53A 1YBYA 3MXGA 3A5ZB 4V0BA 2BOSA 1W6KA 5GADC 2FMCA 2NYZD 1JJ2A 1IBMQ 2B2TC 3OYYA 1SNDA 4OEMB 2EY1A 3NK9A 2OT2A 4JI5Q 2FINB 1IW7C 2D0OA 1DM0B 1ESRA 1GUOA 2GVAA 4KHVA 1PTOB 5IY0A 1IBKL 2Z6KA 3STBC 4JI7Q 1E24A 3BVGA 4PQXA 2AQ2B 4C3IB 4CDEC 5C0XH 5IGEA 1GHKA 1VF7A 1W6JA 1YNXA 3I4LA 1S72A 1PRTC 2CQAA 3TP7A 1F77A 1SEBD 3CMEA 3BU2A 1DZ1A 1D8LA 2RVLA 3PIOA 1QG7A 5KEEA 1GM5A 1YVCA 1Y8NB 3GTQB 2VQFQ 4C1NI 2NZHA 4OHJA 3VYTA 2YU9B 2IW3A 4YIJA 5M5WB 5EAYA 4WJ3M 3PO3H 4I65A 3CPFA 3CU7A 2LSSA 1FD7D 2KCMA 1STNA 4IZ8A 1YEZA 3BDOA 5ELBA 1EWHA 2MFIA 3BS1A 4OX9Q 2EJFC 4MHEA 2WACA 4YWKA 4DV0Q 1VQGA 3OW7A 2XGTA 2UXDL 4ZQ3A 2R92G 1X56A 4MIUA 3NTIA 1ESFA 4POGA 4KN7C 2KVMA 3CMAA 1HZ9A 4HAEA 4CJ1B 1PMRA 3KF8B 1UUPA 2JK8A 3GTJH 1VQKA 2RHQB 4A93G 2WFWA 1RL2A 3EVQA 3L7ZC 2E2DC 5BN3A 4L5RC 2K5HA 5KRUA 1I4QA 1Y1VH 1TWHH 2Q2HA 3MXNA 5JJIA 2F4VL 1I6VC 2B2WC 2PMZE 4RMFA 3K58A 5FLMG 1V8QA 4DV3Q 2B2TA 1H9MA 4PZ6A 1HNWL 5EKIA 4A3LH 1A62A 1F2ZA 4LFBQ 3S17B 1BBUA 2ZTDA 4NP5A 4DR3L 4R4CA 1GXDC 1EEID 4LFAL 3DHQA 1F2LA 2NN6G 1HQRD 4C3IG 3CCUA 1CM9A 2F0OA 1HCZA 2PW7A 2ZXOA 2WINB 4P2CB 1YNNC 5BR8Q 2OWOA 2XNAC 2Q8TA 1JE4A 2I5LX 3RD4A 1RDPD 3ND8A 2KHSA 5KNCA 4CDDC 4GN3B 1G291 5JJZA 3DMUA 1LTRD 3ULLA 4H13C 1S40A 3AFPA 1SR3A 2HIVA 5IIFA 2DN8A 4DR5Q 2M00A 3QWNA 1U9RA 2K5QA 4DR6L 2L55A 1QCBD 2F0LA 2JQOA 2AUJD 3TQYA 2OTLA 4LW1A 4JI0L 1S5CD 5EJWA 2PW5A 1VS0A 1PRTB 1EFID 3G48A 4JOIC 2EVBA 1TS3A 5LMNW 2HQLA 4F8MA 4FXGC 2EYJA 1HR0L 4K8JA 1JWUD 5JEAG 1YNJC 4G7HC 3MVVA 1G2SA 4WORA 4QIWE 1F2YA 2CW0C 1TXYA 4BA2I 3ZYYX 3G71A 4CJ2C 1YIJA 1CT1D 5K36H 4LF5Q 1FVIA 3LWEA 1Q7YC 4P71A 1TQOA 1HNXL 1GUGA 4K5WA 2X6LA 1NAPA 4N9PA 3VYSA 4JI4Q 2Q8IB 5ELNA 1V1OA 3PO3B 4HMIA 3G6JB 1AZQA 1TY2A 3A8IE 3DM3A 2OQKA 1AW7A 2R3ZA 3MXUA 2B2VC 4J15A 3NUCA 1X65A 3PO2H 4MNOA 1PH6A 2VB3X 4IUPA 1EY9A 1J6QA 2RSNA 2MHVA 4Z9CB 2JA6H 1UE7A 4DV4Q 2JP1A 3U4VA 1S5FD 2AQ1B 1B44D 1OXTA 1KRSA 4G7ZC 1B2TA 2AWOA 2F0GA 4OX9L 2N88A 3NBHB 4R9WA 4B3RQ 4JBKA 1HA5A 2OTJA 3J80L 4DN4M 1UE1A 3Q24A 2SDFA 5C4HA 4ABNA 2EYFA 4ID6A 1Y1VB 4RAUC 3M4QA 3TRZA 3J7ZC 4LUVA 3ITPA 4GOPC 3KLRA 5EQ0A 1QNKA 4C3HH 4IOAA 2QCPX 4N8FA 1G6PA 3S14H 4H0LC 2HHHQ 1ML0D 3DEPA 1LTID 4C2MH 5JPMC 3J7AV 4HIKA 1SYDA 3GTKH 1EY7A 3EROA 2A6HD 4YCUA 3KFUA 3FRPB 1IL2A 4JOIA 1XMQL 1UNSA 1I5FA 5C0XG 5FLXL 2AUKA 1Y14B 2X69A 2A8VA 3PUVA 1PA6A 3HZXA 1SMYC 2KJXA 1M8AA 3BZDB 3IRBA 3VR5A 1Q8IA 1FNUA 1FGUA 1ICWA 4A3DG 5LMUL 1X54A 3HP3A 1F2MA 4ZUJA 2EDGA 4ODGA 1Q86C 4M1UB 1A2TA 4B3MQ 3PO3G 4C3JH 1A3VA 1DOKA 3HOXB 1Q1BA 2Z4IA 1LTGD 1S3OA 3CCMA 1JB3A 3CCQA 4DR7Q 4NKLA 3T1YL 2EY5A 3L3OC 3KJPA 3GTMH 4DR5L 3IFDA 3ONAB 4ME3A 3RR5A 4APVA 4E6IA 1U4RA 1E2VA 1SNOA 2BA0A 2EYLA 3BZKA 2FJ2A 5D3DA 1DONA 1LT4D 4IPDA 4DV5Q 4KK7A 3NQIA 1HQMC 3PF4A 1KQSA 1ILPA 1NE3A 1PYBA 3OW2A 4F87A 2L9HA 1B9MA 3MC0B 4AIMA 5ELOA 4U673 1XYIA 1EOTA 1WTOA 3M4OH 3SXHA 5DEHA 1WJJA 3SK6A 4GOPA 3DXJC 2CKZB 2YTXA 2JYOA 4NXMQ 4LF5L 2L0CA 1Y1VG 4DNTB 3S16H 4LF4L 3LX0A 4A3EH 1FR3A 2KQ3A 3HOYH 2UU9Q 4DF7A 3PO2B 2A19A 4JI4L 2F3IA 4JBJA 4A75A 4YY3Q 4K0KL 2JA6B 1G51A 4A3LG 3UE1A 1N9WA 4KKSA 1HHVA 4DFAA 1MD2D 3D8GA 1OXXK 5IGDA 4LMQD 4J1MA 1NR2A 1SYBA 4DUZL 1LACA 1STEA 4O0AA 3J81c 3UI2A 2LS01 4MTNA 4DR4L 5T1GA 4DV4L 3TMEA 2RBMA 3ERSX 1VQ4A 4GOPB 1CZGA 4RCNA 4OL7A 4JI1Q 1G2TA 1B7YB 3CP0A 3SEBA 1BBXC 1L1OA 1FNVA 2JEBI 2PQAA 3R8BA 3C46A 3D4RA 3OTOQ 2I0QA 3S14B 4B3RL 1WTWA 4C2MB 1BQQT 2QDLA 2VUMG 2JA8B 3GV3A 3CC7A 1U4MA 3PIP3 1CI3M 1X3PA 3TSSA 4JI3Q 2G9DA 3MWYW 1QILA 5C4XH 3M4YA 3J81E 4XYOA 2CWPA 1CSQA 1SBBB 1TS4A 5ISRA 2K32A 3HOXG 1LLRD 2F0EA 3OOCA 4HSPA 1H9SB 2ALYB 2HHHL 2YTVA 4CKEA 1CQVA 3FHWA 1E2WA 2KCTA 5I2XA 2F0FA 4L5QA 1KNEA 2N3SA 3U50C 4FDBA 3NXWA 1O78A 3GTOH 1EWIA 2IHFA 4KJNA 4DK0A 1N33L 2H1EA 3HOUH 1MJEA 1F9QA 3K6OA 1ET9A 1QZHA 3PUXA 1SYFA 2Z1CA 1A0IA 1BCPC 1JORA 1O80A 4C3JB 4LF7L 2KCCA 1M1KC 4A3BH 2F0WA 3I3CA 3CCSA 1VMPA 3Q23A 2IX0A 1E2ZA 4JV5Q 4G57A 3PO2G 1RTNA 1II3A 4HCEA 4ZK9B 1G91A 4B3TL 2QW7A 3H94A 5J3BA 2XVSA 1Q90A 4B3ML 2JA6G 1E0BA 4NPSA 2IY5B 3ZJYC 2PQEA 4X3SA 1Z9FA 2J0TD 3I56A 1QUQA 2NUCA 3DWQA 3J80i 1E1TA 2F0MA 4A3FH 1A3UA 1IBKQ 4KY6A 4RA8A 1KXLA 1U4PA 4OO1I 5DM63 2FMMA 1I3QB 3NBIA 3OPOA 2XTIA 3K7AH 2R7FA 1KLUD 1MGSA 1VQBA 2L5TA 4A3EB 2VNUD 3HOYB 4A3IH 1LTAD 4QCLA 4RHRA 4CKCA 1PZID 2CCZA 1I50H 2JA8G 3SGIA 2JA5B 2LXKA 2L15A 3DEOA 3GTPH 5DM73 1BBWA 1EIYB 2F0SA 3S1MH 1QVCA 2BE5C 1PTOC 2K33A 4NXML 4A3CH 4KKUA 3UDIA 1PXUA 1QUQB 3H3VI 3HOVH 3HOZH 4BY7H 2O5IC 1W2BA 2D62A 1AE3A 4DNIA 1D5XC 1MKHA 1PFNA 2MO0A 5E3FA 4DAMA 1JMCA 4C56C 3A74A 5T1IA 1X32A 1EOVA 4DNRB 3RNUA 2Q2IA 2RDGA 4B3SQ 4NDXA 4OWWB 3NWTA 1HFGA 3M85A 2F0PA 4N9TA 2C5CA 2UXDQ 4XDXA 3TZDA 3H15A 5I6YA 5EBDA 4GLVB 1ET6A 4DR1L 2Z4HA 4YCVA 2BH2A 1KRTA 3E9HA 4JI1L 5IP9H 2F0UA 3K0XA 5C4XB 1NCVA 4S3SA 2J4XA 4JPBW 4PNYA 4C3JG 1U5KA 3OHXC 5E4XA 5A35A 2M9VA 4OO1H 4I7ZC 3OTOL 4DUYQ 2GA4B 3KF6B 5CV5A 3GDEA 1G6ZA 1VQIA 2UUCL 4ZCKA 3A7LA 1KNAA 3IAYA 1YZ6A 4X6AH 4R8NA 1RJTA 4C1NK 1FGBD 1EIFA 2F4VQ 1CHPD 1K3BC 3GTLH 2B8GA 1AZPA 2K04A 3RLOA 2ICEC 1AE2A 1SMXA 4O2DA 1HNWQ 1TWGH 2K75A 2B63H 1EIHA 3HOUB 3H3VH 2D0PA 1BCPB 4KY7A 4DR3Q 2CQOA 4GKJL 1SXTA 5L37A 2IX1A 4QY7A 2R93H 4DA2A 1Q8KA 4LFAQ 2Z9HA 1JJCB 2OQ0A 1N36Q 4NB3A 1XNRQ 3RZDB 2F0JA 1HR0W 4A3KH 5C4ZA 1Z7TA 4ZRZA 4A3BB 2JXMB 2RHSB 4DV1L 2Q2TA 4YWLA 4L5SA 5I6WA 1XPRA 1K83B 3TEHB 4GNXC 2B3GA 3CC2A 1ZKOA 1X6OA 3Q6SA 1GD7A 2JA5G 3K80C 2N55A 1QZGA 1OTCA 3R2TA 2B29A 5I2YA 4OIJA 3OIPA 2ATWA 1NBWA 4GLAC 4ULLA 1AEXA 5C5LA 4L8JA 2MJ8A 4HJ9A 4A3FB 3RZOB 3K0YA 3MTSA 4JI0Q 2I46A 2JSOA 2RCNA 4X64L 3BDCA 2EIFA 3NWSA 3P7JA 5J1ZA 4CKBA 1A6XA 3T56B 1HUNA 1YNND 1D6EC 5C44G 3SVMA 1BXTA 4LNQA 1CKNB 4HSVA 1HR0Q 2CVRA 4A3IB 2ASBA 4KKTA 1UE6A 1ZXTA 2HQEA 3CKIB 4B08A 1I50B 1OO9B 3U58A 5DLQE 1VQ8A 4RGOS 1IYJB 2E2HH 1WFQA 1JOOA 3S1MB 3AEVA 1IL8A 3PMFA 1Q81C 2WIIB 1UAPA 5C4XG 1HNXQ 2E75C 1EYCA 5EPJA 3RLFA 4RHSA 4BY7B 3R3OA 1SYEA 3A5UA 4NXNQ 4HMJA 3UDFA 4OONA 4IFDI 1PYWD 5M5XH 1SROA 4FF2A 3KF8A 1YNJD 4K2KA 3FPUB 3BZCA 2CW0D 1RODA 2NTTA 4IALA 3HOUG 2K4KA 4CBVA 2K50A 4QQBX 3KLWA 3CW2C 2AKWB 2B2YA 4EQ5A 4B3SL 3S2HH 1A2UA 2XN9C 4J8QA 2QEJC 1FYCA 4DPGA 4A3BG 2BDNA 4KY5A 4EQOA 1VQAA 2WKDA 4GN4B 4X3TA 4AQYQ 4ZYSA 4PV1C 1TWAB 1Q46A 1LTLA 5IYCH 3CQZH 3NENA 3F2CA 2UXCL 2DJFC 3HKSA 3GTLB 2UXBL 3SHLA 1K73C 5IYBG 3I55A 3A56A 1J9OA 4DUYL 1AFPA 3BVMA 2B63B 1T5XD 1S4ZA 4L63B 1SAPA 1CSPA 2PZWA 4K8IA 2RSOA 4A3FG 2JJQA 4L5TA 1O7ZA 2R93B 2K03A 4UP8A 1VQ9A 1NNXA 2K52A 5JJKA 1XMQQ 4ALPA 2HDMA 4EX5A 1I4HA 2JEAI 4A3KB 4IFDH 5C4JH 4GNXB 1DYQA 1EL0A 3QOJA 3MXPA 4A3IG 2QDBA 4R4QA 2VY3A 3D3RA 1EY5A 2D9UA 3HGBA 3QJYA 4TVAB 4WJWA 1N36L 2TMPA 1XNRL 3GTGH 2C9OA 3CCRA 3TN2A 1TS2A 1XWEA 4A3CG 4BBSH 5E4WC 2C35B 1R4PB 5IODA 5LMUQ 2B39A 5DNFA 4BY7G 2KHJA 2A74C 4LK1C 4XXEA 5JVG3 1D1IA 1A15A 3IFTA 5IGCA 1QE6A 1MIUA 4P75A 3I8ZA 2JA9A 2ES2A 3T1YQ 1BNZA 3KLSA 5M5YH 4EQNA 4QMGA 1C48A 4PMWA 3MZ5A 3HRZC 2L4NA 1SMYD 5FK9C 1X55A 3KBGA 2FHTA 1GUSA 2QKIC 1EWCA 2IX3A 1BDOA 4Y7NH 2E2HB 4ZUIA 5IP9G 2K05A 1EY6A 1T5EA 3QG1A 2IPKD 4A3JH 4KLKA 1DOMA 1SNMA 5F2DA 2VW9A 4K2LA 1E1OA 3CD6A 3K5OA 1TIID 2ID0A 1VQDA 4RKLA 4HJAA 3H91A 1KABA 4LF4Q 1KDAA 1P8LA 1KIXA 2G9HD 4XYQA 2RDFA 1C7YA 1CKOA 3NBHA 4LUZA 2PNHA 4R1JA 1SYGA 4NXNL 3OSOA 4K0KQ 2F0HA 3T53B 2NZOA 2B63G 2PZUA 2B2WA 2MP1A 3MA2B 1A3TA 3CF5A 4JI2L 3H09A 2R93G 1KAWA 1D5ZC 2R7ZH 3S2HB 2CWAA 2TSSA 4DUZQ 1VMCA 3EBEA 4MZ9A 4A3KG 4RGNA 2CHBD 1IKMA 4DR4Q 1JJGA 2XWBB 4U68A 1WD0A 3PUZA 3CQZB 1WCMH 1CA6A 1HZCA 4IO9A 3X3NA 3GTJB
chains in the Genus database with same CATH topology
4KI0A 5IT9L 4OGQC 2KA7A 1Z47A 1AN8A 1TWHB 3SK8A 5C4JB 1TVXA 4CHTB 4XTCS 4FXKC 3A8JE 2AWNA 2A6EC 5BN5A 3J7AF 4L6TB 1EYDA 4FXDA 3GTGB 2K5DA 2XRSD 5FOBB 4Q5VA 3VR2A 4IUTA 3DWPA 1D5MC 3KLSX 3A54A 1M4VA 2A5HA 1IHZA 3G7LA 4QF4A 5A2QE 1PFBA 5M5YB 1RD9D 1ILQA 4HTHA 4DAPA 3VYUA 2JE6I 2F1MA 5C3WA 3M7GA 2B2VA 5EKLA 4EGVA 4DAYA 1SE4A 4ILWA 3BYTB 1IYUA 4A3JB 2EOTA 3EJIA 3GV6A 2B2UC 1BCPD 4BS9A 3P75A 5LHY1 3J81L 2KEDA 3E6ZX 1HRJA 1B50A 1LT3D 1S5DD 2R61A 1ZYRD 3M7NA 1DJRD 1ENFA 4X3UA 1LO5D 5JEAJ 3TDQA 4AYBB 2EE1A 3BYYB 2F3WA 1BCPF 2R7ZB 5CV8A 4IFDG 2DNCA 3W2DA 3Q0AA 5EPKA 1S5BD 5KNBA 1WCMB 1TT2A 1TR5A 4NW2A 2PO4A 1H9SA 5IGBA 2WB1B 1PTOD 5HGTA 1SNCA 5CYUA 1GJXA 4RGMA 3PUWA 4C3HB 2EJGC 2H4OA 1IYVA 4DU9A 5CV4A 3JAML 1K8MA 4LAAA 1BR9A 5CV6A 1SNPA 5CORA 1F9RA 3GTKB 2HUGA 1STBA 2SNSA 2KUMA 1HPCA 2A6HC 2HCIA 3SR1A 3D4DA 1EZ6A 1LTSD 1PTOF 4IUQA 2B2UA 3T16A 5JPNC 2JA7B 3S2DB 1JC7A 3V05A 1QNUA 2WV6D 4A3GB 3D31A 4XIGS 4ZKCB 3I4NB 3GD7A 1OXVA 4MN3A 5K36G 2SNMA 2K6AA 5C0XJ 4FP5D 4IURA 1JOQA 2QILA 1LT5D 3A8KE 2A69C 2M2LA 2K5WA 1EQVA 4G7OC 4TRDA 3ERQA 1JWSD 1O7YA 1GUNA 1LTTD 3GTMB 2IL8A 4ME5A 5G3LF 1QWYA 2NN6I 1PZJD 3BG3A 2XIWA 3F2UA 1CQFA 2BA1A 1LABA 1V1PB 1CTMA 1MI2A 2RKSA 1BOSA 3M4OB 1Y69U 4FF4A 3S16B 1HFNA 1EY8A 5I9OA 4BY1B 3I4MB 2A68C 4C3HG 4FF1A 5IGGA 1G8ZD 1NR4A 4F7XA 2D2CC 2L1BA 4GZYC 3H0GB 2V4DA 1VCIA 3HG9A 1MBYA 1IW7D 2F0IA 1WVLA 1H9RA 2NTSA 1LT6D 2YYZA 2O4XA 2RA4A 1CZWA 3K5NA 2NN6H 1PRTD 4FO2A 1BO0A 1UEAB 1U4LA 1WTRA 1NSNS 2OXPA 4ZKBB 5J39A 2O2LD 3DUZA 4IUVA 5IGFA 4WFN3 5HURA 1C4QA 2K1BA 3P1HA 2F03A 4DXGA 2ZT9C 1PRTF 2HCCA 3K5LA 3PV0A 5ELDA 2NB0A 1TS5A 1SSOA 1EIGA 1JOKA 2AQ3B 4IN3A 3GTOB 2LMCB 2IWHA 2WAQB 2PPBC 3HKZB 2E74C 2FFKB 3H3VC 1IKLA 3I72A 1I4GA 1Q3LA 3NSWA 1CK1A 4O42A 4DAVA 1TU2B 4XQQA 1VF5C 5C0XI 4DK1A 2L12A 1AP0A 5KGUA 1MSHA 4Q0FA 1PZKD 2EY6A 4ZLTF 3X3MA 2RQXA 2NVTB 1I4XA 1J8IA 3S1RB 2EYOA 4K14A 2EYPA 5CGKA 3K5MA 4FYDA 5CV9A 4K6LA 1KLGD 2KECA 3K7AB 3V96A 3VA7A 2O5JC 3J7YW 2NVQB 4K5XA 2Z8LA 3CHBD 4BBRB 3GTPB 2XRQD 5AFWA 3OIQA 4FF3A 3HOVB 2VB2X 2F3VA 3T51B 3HOZB 4B9WA 3LNNA 1HXYD 5FO9B 2LFNA 1VDZA 1DD2A 5LL6S 3PIO3 1CHQD 1JR0D 1PLFA 1SFOB 2J7ZA 2E2JB 1MSGA 3T13A 3V2TA 4V190 1TWFB 3TP8A 2SOBA 2EY2A 4XT1B 1SE3A 3A55A 2PYKA 4KHZA 3BDLA 4TQUS 2D5DA 3K57A 4RCOA 1CFMA 3S9WA 2DY7A 1TWGB 3NPPA 3OWFA 3L9AX 5KYLA 4UAIA 3BVZA 2MGSA 1JICA 4TSSA 2KCNA 3VYRA 4XQNA 1Z6HA 4CJ0B 4KMUC 4EVOA 3H6MA 3TZUA 2XWJB 1XX8A 5C3EB 1EU3A 4QUFA 4J6HA 4OIKA 3GO5A 4HCSA 2A6ED 4X3KA 5EPLA 1STGA 3OMGA 4XQJA 3AU7A 4K5VA 5CV7A 1O7LA 2PCFB 4DGZA 2BCOA 2OEOA 1EYAA 4M8AA 3WDNA 2QF7A 3DM1A 3U9SA 2K01A 1EZ8A 2ICIA 1FNWA 1R4QB 4A3MB 5JVH3 2R6GA 4XT3B 5ELCA 4RGTA 1F9PA 4OO1G 1I4RA 5D65A 1JWMD 2EPBA 5JAVA 5M5XB 1BUVT 1HTPA 1V43A 2Y0SB 1X3QA 2PNRC 1XTCD 3RUZA 2SEBD 5FO8B 2ENBA 4FNFA 5BN4A 3WOFA 5A2QL 5JOBA 4H7BA 5NUCA 4A3DB 3R93A 2K7VA 3DWAA 3GP7A 4PMBA 5KIXA 3QOLA 3KK7A 3KUPA 4KD3A 5D3IB 1PDQA 5M3MB 3FMCA 2EYHA 2LY7A 1KAAA 5IOCA 2EXZA 1Q1EA 1RCVD 1ENCA 3CRKC 3QB3A 4PMCA 3U9OA 3R2IA 3I70A 1Y8PB 3TBIB 5M9OA 1HA6A 1TWCB 2KEEA 2L11A 3RMHA 1GOZA 5D14A 3SK5A 4BBSB 1F9SA 5KNDA 3N6RA 2EZVA 4HR7B 2BDOA 5K5PA 1H9KA 3FKIB 4FVMA 1SE2A 2IJ0A 3MFGA 2PZTA 1RKNA 2X6GA 3QO2A 4BA1I 2HDLA 1H9JA 3MHBA 3P20A 3FVQA 4Y7NB 3EA6A 3NHHA 3D6CA 3VA5A 2A69D 1QB5D 3T4AC 5EBCA 4RKBA 2VUMB 3N52A 1I4PA 2ZXRA 4NMZA 1TKWB 5J22A 3E0JA 1SNQA 4BWGB 3I90A 5EKKA 1NUCA 1LV9A 4RH6A 5M3FB 3C3LA 2PMZB 2ZXPA 5IT9E 1B9NA 2EJMA 1L0YB 5E1FA 3J80E 1PFMA 3FEWX 3VR4A 3C1FA 4IQZA 1Y1WB 2VXWA 2E2IB 5ELEA 1HUMA 2A68D 1KDBA 3FDTA 1RTOA 2E76C 1ZEQX 1C8CA 2BE5D 3MFYA 1STAA 3NTKA 5FLXE 4KD4A 2MUYA 4K6DA 1K8OA 4KV6A 3HOWB 1BF4A 5I4DA 1WTPA 3D6WA 4QB4A 4B9XA 5I9PA 3MAQA 5CBEE 2XSCA 2WP8J 4RFBA 3E5SA 1Q12A 4R8IA 1CA5A 2MPMA 5COYA 1EY4A 3TP5A 2DNEA 4QIWB 3CRLC 3S15B 3NTHA 1STYA 4EQPA 2RDHA 3S1NB 5G3LD 1V1PA 3HEJA 2A73B 5CC4A 5DAUA 1Y8OB 3SK4A 2F0QA 3URYA 4F88A 1DCZA 4JK1C 4ZAIA 1RF2D 1SYCA 2F0KA 5CMDA 3SE0A 1EEFD 2OF1A 3MEHA 1SJHD 1JCKB 1EU4A 5KYIA 3OWEB 4HN7A 1XXGA 2DY8A 2F0DA 3KBXA 2F0TA 3QIAA 1ONLA 2F4IA 3NE5B 1OXUA 2NBFA 5C6AA 1D1KA 1ENAA 1ZYRC 1WTVA 4JBWA 3A7AB 1RHPA 4WRDA 2LKVA 5LL6X 1B4OA 3HS0C 2F0NA 4IUUA 1GUTA 4IUNA 3OMCA 3AB9A 4CGYB 3WOEA 3IL8A 3JAME 1GHJA 1DOLA 3LWUA 5C5MA 4IFDJ 3EQLC 4H44C 3FPPA 5C3XA 2KOLA 1PTOH 1WTXA 2IT1A 1I6HB 1STHA 3O13A 4RWSC 1QJOA 3NP8A 1D2BA 2K28A 2Q8RE 2WKCA 4KTAA 2NVYB 1SJED 3SDZA 3I73A 2I07B 4TKOB 4LJZC 5CBAE 5C44B 4KJOA 1DXMA 3NQTA 2EYMA 4UDUC 1L0XB 5ELFA 3S1QB 1B3AA 1KTKA 2B8FA 3ND9A 1B1ZA 3AMUA 3EFXD 5JEAH 1WTQA 3GQBA 4O1NA 1JQYD 3C2PA 3TP6A 4HEDA 3IKJA 3C1EA 4KN4C 4QUCA 1KDCA 3PUYA 1GUWA 1QOHA 3D4WA 5CR3A 4G4KA 1HTLD 3W3AA 3Q22A 1TY0A 2NWGA 2B2YC 2F0VA 2R92B 1S5ED 5FKAC 5FO7B 1EQTA 3I91A 1WD1A 1LTBD 2NZ1D 5TSSA 1OXSC 2NVXB 1SDFA 3K59A 4A93B 4DXFA 1EY0A 3VR3A 3M3YB 1R9TB 5EGTA 3VR6A 1B53A 3MXGA 4V0BA 2BOSA 1W6KA 2FMCA 2NYZD 2B2TC 1SNDA 2EY1A 3NK9A 2OT2A 2FINB 1IW7C 1DM0B 1ESRA 1GUOA 4KHVA 1PTOB 3BVGA 4PQXA 2AQ2B 4C3IB 1GHKA 5C0XH 5IGEA 1VF7A 1W6JA 3I4LA 1PRTC 2CQAA 3TP7A 1F77A 1SEBD 1DZ1A 2RVLA 1QG7A 5KEEA 1Y8NB 3GTQB 4C1NI 4OHJA 3VYTA 2YU9B 2IW3A 4YIJA 5M5WB 4I65A 3CU7A 1FD7D 1STNA 4IZ8A 3BDOA 5ELBA 1EWHA 3BS1A 2EJFC 4MHEA 2WACA 3OW7A 4ZQ3A 4MIUA 3NTIA 1ESFA 4KN7C 2KVMA 4HAEA 4CJ1B 1PMRA 1UUPA 3EVQA 3L7ZC 2E2DC 5BN3A 5KRUA 1I4QA 3MXNA 1I6VC 2B2WC 3K58A 1V8QA 2B2TA 1H9MA 5EKIA 1F2ZA 3S17B 4NP5A 1GXDC 1EEID 3DHQA 1F2LA 2NN6G 1HQRD 4C3IG 1CM9A 2F0OA 1HCZA 2PW7A 2ZXOA 2WINB 4P2CB 1YNNC 2XNAC 2Q8TA 1JE4A 3RD4A 1RDPD 3ND8A 2KHSA 5KNCA 5JJZA 1G291 3DMUA 1LTRD 4H13C 5IIFA 2DN8A 2M00A 3QWNA 1U9RA 2K5QA 2L55A 1QCBD 2F0LA 2AUJD 1S5CD 5EJWA 2PW5A 1PRTB 1EFID 2EVBA 1TS3A 4F8MA 4FXGC 2EYJA 4K8JA 1JWUD 5JEAG 1YNJC 4G7HC 3MVVA 1G2SA 4WORA 1F2YA 2CW0C 4BA2I 3ZYYX 4CJ2C 1CT1D 5K36H 3LWEA 1TQOA 1GUGA 4K5WA 2X6LA 1NAPA 4N9PA 3VYSA 2Q8IB 1V1OA 3PO3B 4HMIA 3G6JB 1AZQA 1TY2A 3A8IE 1AW7A 2R3ZA 3MXUA 2B2VC 3NUCA 2VB3X 4IUPA 1EY9A 4Z9CB 2RSNA 2MHVA 2JP1A 1S5FD 2AQ1B 1B44D 1OXTA 4G7ZC 1B2TA 2AWOA 2F0GA 2N88A 4R9WA 1HA5A 3J80L 4DN4M 3Q24A 2SDFA 5C4HA 4ABNA 2EYFA 4ID6A 1Y1VB 4RAUC 3ITPA 3KLRA 5EQ0A 1QNKA 2QCPX 4H0LC 1ML0D 3DEPA 1LTID 5JPMC 3J7AV 1SYDA 1EY7A 3EROA 2A6HD 3FRPB 1UNSA 5C0XG 5FLXL 2AUKA 2X69A 3PUVA 3HZXA 1SMYC 2KJXA 1M8AA 3BZDB 3VR5A 1Q8IA 1FNUA 1ICWA 3HP3A 1F2MA 4ZUJA 2EDGA 4ODGA 4M1UB 1A2TA 1A3VA 1DOKA 3HOXB 1Q1BA 2Z4IA 1LTGD 1JB3A 4NKLA 2EY5A 3L3OC 3IFDA 3ONAB 4E6IA 1U4RA 1E2VA 1SNOA 2BA0A 2EYLA 2FJ2A 5D3DA 1DONA 1LT4D 4KK7A 3NQIA 1HQMC 1ILPA 4F87A 2L9HA 1B9MA 3MC0B 4U673 1XYIA 1EOTA 1WTOA 3SXHA 5DEHA 3SK6A 3DXJC 2JYOA 2L0CA 4DNTB 3LX0A 1FR3A 2KQ3A 4DF7A 3PO2B 2JA6B 4KKSA 1HHVA 4DFAA 1MD2D 3D8GA 1OXXK 5IGDA 4LMQD 4J1MA 1NR2A 1SYBA 1LACA 1STEA 3UI2A 2LS01 5T1GA 3TMEA 2RBMA 1CZGA 4RCNA 4OL7A 1G2TA 3SEBA 1BBXC 1FNVA 2JEBI 3R8BA 3C46A 3D4RA 3S14B 1WTWA 4C2MB 1BQQT 2JA8B 3GV3A 1U4MA 3PIP3 1CI3M 1X3PA 3TSSA 2G9DA 3MWYW 1QILA 3M4YA 3J81E 4XYOA 1SBBB 1TS4A 5ISRA 2K32A 1LLRD 2F0EA 3OOCA 4HSPA 1H9SB 4CKEA 1CQVA 1E2WA 5I2XA 2F0FA 1KNEA 3NXWA 1O78A 4KJNA 4DK0A 2H1EA 1F9QA 3K6OA 1ET9A 3PUXA 1SYFA 2Z1CA 1BCPC 1JORA 1O80A 4C3JB 2KCCA 2F0WA 3I3CA 1VMPA 3Q23A 2IX0A 1E2ZA 4G57A 1RTNA 1II3A 4HCEA 4ZK9B 1G91A 3H94A 2XVSA 1Q90A 1E0BA 2PQEA 4X3SA 2J0TD 2NUCA 3DWQA 2F0MA 1A3UA 4KY6A 4RA8A 1U4PA 4OO1I 5DM63 2FMMA 1I3QB 3NBIA 3OPOA 1KLUD 1MGSA 2L5TA 4A3EB 2VNUD 3HOYB 1LTAD 4QCLA 4RHRA 4CKCA 1PZID 2JA5B 3DEOA 5DM73 2F0SA 2BE5C 1PTOC 2K33A 4KKUA 1PXUA 2O5IC 2D62A 1D5XC 1PFNA 5E3FA 4C56C 5T1IA 1X32A 4DNRB 2RDGA 4NDXA 3NWTA 1HFGA 3M85A 2F0PA 4N9TA 2C5CA 4XDXA 3TZDA 5I6YA 5EBDA 1ET6A 2Z4HA 2F0UA 5C4XB 1NCVA 4S3SA 2J4XA 4PNYA 4C3JG 3OHXC 5E4XA 5A35A 2M9VA 4OO1H 4I7ZC 2GA4B 5CV5A 1G6ZA 3A7LA 1KNAA 3IAYA 4R8NA 1RJTA 4C1NK 1FGBD 1CHPD 2B8GA 1AZPA 2K04A 2ICEC 1EIHA 3HOUB 1BCPB 4KY7A 1SXTA 2IX1A 4DA2A 3RZDB 2F0JA 5C4ZA 1Z7TA 4ZRZA 4A3BB 2JXMB 5I6WA 1K83B 1ZKOA 3Q6SA 2N55A 3R2TA 5I2YA 4OIJA 3OIPA 4ULLA 1AEXA 5C5LA 4L8JA 2MJ8A 4A3FB 3RZOB 3K0YA 3MTSA 2I46A 2JSOA 3BDCA 4CKBA 3NWSA 3P7JA 5J1ZA 1A6XA 3T56B 1HUNA 1YNND 1D6EC 3SVMA 1BXTA 4HSVA 2CVRA 4A3IB 4KKTA 1ZXTA 2HQEA 3CKIB 4B08A 1I50B 1OO9B 4RGOS 1JOOA 3S1MB 1IL8A 3PMFA 2WIIB 1UAPA 2E75C 1EYCA 5EPJA 3RLFA 4RHSA 4BY7B 3R3OA 1SYEA 4HMJA 4IFDI 1PYWD 4FF2A 3KF8A 1YNJD 4K2KA 3FPUB 2CW0D 1RODA 2NTTA 4IALA 4CBVA 2B2YA 1A2UA 2XN9C 4J8QA 2QEJC 1FYCA 2BDNA 4KY5A 4EQOA 2WKDA 4X3TA 4ZYSA 4PV1C 1TWAB 3GTLB 3SHLA 3A56A 1J9OA 1AFPA 3BVMA 2B63B 1T5XD 1S4ZA 4L63B 1SAPA 2PZWA 4K8IA 2RSOA 1O7ZA 2R93B 2K03A 2HDMA 1I4HA 2JEAI 4A3KB 4IFDH 1DYQA 1EL0A 3QOJA 3MXPA 2QDBA 3D3RA 1EY5A 2D9UA 3HGBA 3QJYA 4WJWA 2TMPA 2C9OA 3TN2A 1TS2A 1XWEA 5E4WC 1R4PB 5IODA 2B39A 5DNFA 2A74C 4LK1C 4XXEA 5JVG3 1D1IA 1A15A 3IFTA 5IGCA 1QE6A 3I8ZA 1BNZA 3KLSA 4EQNA 4QMGA 1C48A 4PMWA 3MZ5A 3HRZC 2L4NA 1SMYD 5FK9C 3KBGA 2FHTA 1GUSA 2QKIC 1EWCA 2IX3A 1BDOA 2E2HB 4ZUIA 2K05A 1EY6A 1T5EA 3QG1A 2IPKD 1DOMA 1SNMA 5F2DA 4K2LA 3K5OA 1TIID 2ID0A 4RKLA 3H91A 1KABA 1KDAA 2G9HD 4XYQA 2RDFA 3NBHA 1SYGA 3OSOA 2F0HA 3T53B 2PZUA 2B2WA 2MP1A 3MA2B 1A3TA 3H09A 1D5ZC 3S2HB 2TSSA 1VMCA 4RGNA 2CHBD 1IKMA 2XWBB 4U68A 1WD0A 3PUZA 3CQZB 1CA6A 3X3NA 3GTJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL0 A;  2MJ8 A;  3MTS A;  3DEO A;  1Q3L A;  1G2T A;  1DZ1 A;  1MI2 A;  1BBX C;  2D9U A;  2RVL A;  4O42 A;  1QG7 A;  3P7J A;  2DY7 A;  1HUN A;  1WTW A;  2X69 A;  1B3A A;  3I90 A;  4ZAI A;  3TN2 A;  3R93 A;  3SVM A;  5EPK A;  4HSV A;  3GV3 A;  2CVR A;  5E4W C;  5CMD A;  1U4M A;  5EJW A;  1LV9 A;  1X3P A;  1ZXT A;  1PFN A;  1M8A A;  4NW2 A;  4UAI A;  3MWY W;  1WTQ A;  1TVX A;  2L12 A;  1JIC A;  2MGS A;  5DNF A;  1HFN A;  1AP0 A;  5T1I A;  1X32 A;  4HED A;  1MSH A;  3KUP A;  4ZLT F;  1A15 A;  1J8I A;  1PFM A;  2DY8 A;  1ICW A;  3KBX A;  4CJ0 B;  1IL8 A;  1QE6 A;  1G2S A;  1HFG A;  3HP3 A;  1NR4 A;  3I8Z A;  1PDQ A;  4QUC A;  4XDX A;  3TZD A;  2L1B A;  2VXW A;  1BNZ A;  5EPJ A;  4CJ2 C;  1DOK A;  1KNE A;  2L4N A;  3LWE A;  1WTV A;  4MHE A;  2KEC A;  1GUW A;  1XX8 A;  2FHT A;  4IUT A;  2X6L A;  1NAP A;  1NCV A;  5COR A;  1RHP A;  4QUF A;  1WVL A;  1F9R A;  3IFD A;  1HUM A;  3ONA B;  1B4O A;  4OIK A;  2HUG A;  2RA4 A;  5E4X A;  4HCS A;  1U4R A;  2H1E A;  1F9Q A;  2KUM A;  1AZQ A;  4IUU A;  2K05 A;  2KVM A;  4X3K A;  2FJ2 A;  3FPU B;  3G7L A;  2HCI A;  2NWG A;  3FDT A;  1RTO A;  4HAE A;  5EPL A;  4CJ1 B;  1PFB A;  2B2Y C;  1G6Z A;  2R3Z A;  1O80 A;  1ILQ A;  1DOM A;  1ROD A;  2B2V C;  5AFW A;  1C8C A;  1KNA A;  4IUQ A;  2B2U A;  3IL8 A;  1HA6 A;  1RJT A;  1ILP A;  1EQT A;  2KEE A;  3I91 A;  2L11 A;  1AZP A;  3I3C A;  2K04 A;  4IUP A;  2NZ1 D;  1WD1 A;  5D14 A;  1BO0 A;  2B2Y A;  2L9H A;  2RSN A;  3H91 A;  1VMP A;  1SDF A;  1F9S A;  2B2V A;  1BF4 A;  4ZKC B;  1U4L A;  2JP1 A;  1XYI A;  1WTR A;  1EOT A;  1WTO A;  1WTP A;  4ZKB B;  1EIH A;  1RTN A;  3DM1 A;  4MN3 A;  1DOL A;  1G91 A;  4ZK9 B;  2BDN A;  2B2W C;  4IUV A;  3D6W A;  2K01 A;  4X3T A;  2B2T A;  2JYO A;  1E0B A;  2EOT A;  4IUR A;  1B2T A;  2KOL A;  2K1B A;  3GV6 A;  2B2U C;  2N88 A;  5EKI A;  4R9W A;  5CBE E;  4X3S A;  2KED A;  2M2L A;  1WTX A;  2B2W A;  1PLF A;  2MP1 A;  4XT3 B;  4R8I A;  4DN4 M;  2HCC A;  1CA5 A;  2J7Z A;  1HRJ A;  2MPM A;  5COY A;  1B50 A;  1F9P A;  2SDF A;  1MSG A;  1B53 A;  1J9O A;  4RWS C;  5D65 A;  1DON A;  2X6G A;  1HHV A;  4RAU C;  1F2L A;  1VMC A;  2EPB A;  2K28 A;  3QO2 A;  1SSO A;  1EIG A;  1O7Y A;  1S4Z A;  2Q8R E;  2NYZ D;  1SAP A;  1CM9 A;  1QNK A;  2B2T C;  2HDL A;  4RA8 A;  4X3U A;  1U4P A;  5EQ0 A;  1IKM A;  3Q6S A;  2IL8 A;  2FMM A;  2RSO A;  4LMQ D;  1O7Z A;  1ML0 D;  3DEP A;  1JE4 A;  2FIN B;  1NR2 A;  2K03 A;  2N55 A;  4U68 A;  4XT1 B;  2Q8T A;  1MGS A;  1WD0 A;  1X3Q A;  1ESR A;  2XIW A;  2HDM A;  4OIJ A;  5JJZ A;  1CA6 A;  2EE1 A;  2FFK B;  3UI2 A;  3F2U A;  5CBA E;  5T1G A;  1IKL A;  3N52 A; 
#chains in the Genus database with same CATH topology
 4KI0 A;  4WJ4 A;  1M90 C;  1NMG A;  5IT9 L;  4OGQ C;  2KA7 A;  4HID A;  1PH4 A;  1YHB A;  4AQY L;  2A1A A;  1Z47 A;  1B8A A;  1AN8 A;  1TWH B;  2Z0S A;  3HOW H;  4DV2 Q;  3SK8 A;  1GKH A;  5C4J B;  1TVX A;  4CHT B;  4XTC S;  4FXK C;  1PH1 A;  3A8J E;  1K0R A;  2AWN A;  2A6E C;  3KOJ A;  5BN5 A;  3J7A F;  3CC4 A;  3L2P A;  5GQO A;  4L6T B;  1EYD A;  3CCL A;  4FXD A;  3GTG B;  3NEL A;  2K5D A;  2XRS D;  5FOB B;  4Q5V A;  2YTY A;  1N33 Q;  3VR2 A;  3S15 H;  2JA7 H;  3S2D H;  4DKA C;  1L2F A;  4IUT A;  1B3Q A;  1UWV A;  4A3G H;  3DWP A;  3I4N H;  1D5M C;  3KLS X;  3A54 A;  4GN5 A;  4LF7 Q;  1N8R C;  1M4V A;  2A5H A;  1IHZ A;  3FP9 A;  3G7L A;  4QF4 A;  5A2Q E;  4A4I A;  1PFB A;  5M5Y B;  1RD9 D;  1ILQ A;  1NY4 A;  1K8A C;  3J7A 5;  3CPW A;  4HTH A;  3CCV A;  4DAP A;  3VYU A;  4B3T Q;  2JE6 I;  2F1M A;  1P16 A;  3M7G A;  5C3W A;  3I2Z A;  2B2V A;  5EKL A;  4YHH L;  1B70 B;  4EGV A;  4DAY A;  1KHI A;  1SE4 A;  1VQP A;  4ILW A;  3BYT B;  1IYU A;  3B6Y A;  1UEB A;  4BXX H;  4A3J B;  2EOT A;  3EJI A;  2VS1 A;  3GV6 A;  2B2U C;  1BCP D;  4BS9 A;  3P75 A;  5LHY 1;  3J81 L;  2KED A;  1MHW C;  3E6Z X;  3JC6 6;  1HRJ A;  1B50 A;  1LT3 D;  5IYC G;  1S5D D;  3E3X A;  2PI2 A;  2R61 A;  1ZYR D;  5FJ8 H;  3M7N A;  1DJR D;  1ENF A;  4X3U A;  1LO5 D;  5JEA J;  4IPH A;  1NJI C;  3TDQ A;  4AYB B;  2EE1 A;  3BYY B;  4DAY B;  2F3W A;  1BCP F;  4BY1 H;  3I4M H;  4KHP L;  2R7Z B;  1K8G A;  4R4O A;  3TRE A;  2ZTC A;  5CV8 A;  4IFD G;  4OWX B;  2DNC A;  4DK3 C;  1EYG A;  4GS3 A;  3W2D A;  3Q0A A;  3H0G H;  1LUZ A;  1VQJ A;  1S5B D;  5EPK A;  3G6E A;  5KNB A;  4IJH A;  4IJL A;  4RG1 A;  1WCM B;  1TT2 A;  3M9B A;  1XPU A;  1TR5 A;  4NW2 A;  1EUJ A;  4LFC L;  2PO4 A;  1H9S A;  3WWV A;  5IGB A;  4DR1 Q;  4LF6 Q;  2WB1 B;  1PTO D;  5HGT A;  1SNC A;  5CYU A;  1GJX A;  4RGM A;  3PUW A;  4C3H B;  2EJG C;  3CCJ A;  2H4O A;  1IYV A;  4DU9 A;  5CV4 A;  3JAM L;  1K8M A;  4LAA A;  1BR9 A;  3KDF B;  5CV6 A;  1SNP A;  5COR A;  1F9R A;  1YJW A;  2UUC Q;  1GVP A;  3GTK B;  5LMN L;  2HUG A;  1STB A;  2AHO B;  2SNS A;  2KUM A;  1HPC A;  2MO1 A;  5HY6 A;  2A6H C;  2HCI A;  3SR1 A;  4DV2 L;  1X3E A;  3D4D A;  1EZ6 A;  1LTS D;  1PTO F;  4IUQ A;  2B2U A;  3T16 A;  5JPN C;  4GKJ Q;  2JA7 B;  3S2D B;  4A3J G;  1VQM A;  1JC7 A;  3V05 A;  1QNU A;  2WV6 D;  4A3G B;  3D31 A;  4XIG S;  4ZKC B;  5IWA Q;  3DLL A;  3I4N B;  5GAH C;  3GD7 A;  1OXV A;  4IPG A;  4MN3 A;  3TS2 A;  5K36 G;  2SNM A;  2K6A A;  5C0X J;  4FP5 D;  3ER0 A;  4DV1 Q;  3T1H L;  4IUR A;  1JOQ A;  2QIL A;  1LT5 D;  3A8K E;  2A69 C;  3D0F A;  1X3G A;  2M2L A;  2K5W A;  1EQV A;  4HJ5 A;  4G7O C;  4TRD A;  2LXJ A;  3ERQ A;  3VDY A;  1JWS D;  1O7Y A;  1GUN A;  1LTT D;  3GTM B;  2IL8 A;  2R7Z G;  4ME5 A;  5G3L F;  1QWY A;  2NN6 I;  1PZJ D;  3BG3 A;  2XIW A;  3CCE A;  1PV4 A;  2JN4 A;  3F2U A;  4X64 Q;  1CQF A;  2BA1 A;  1LAB A;  4JI8 Q;  3AYH B;  2K5V A;  1V1P B;  3PF5 A;  1VQC A;  1PH7 A;  2NVT H;  1CTM A;  1WCM G;  4UPA A;  1MI2 A;  3S1R H;  2BH8 A;  2RKS A;  1BOS A;  3M4O B;  2QEX A;  2WB1 G;  3KYH C;  1Y69 U;  4FF4 A;  3S16 B;  1HFN A;  1EY8 A;  5I9O A;  4BY1 B;  3I4M B;  2A68 C;  2NVQ H;  4C3H G;  2ZM6 L;  2DUD A;  4IPC A;  4FF1 A;  1VQ6 A;  2DJG C;  5IGG A;  4X65 L;  4QJF A;  4BBR H;  1G8Z D;  1NR4 A;  4F7X A;  2D2C C;  2L1B A;  4GZY C;  2Z6B A;  2V4D A;  3H0G B;  2KHI A;  3RN5 A;  5FLM H;  2FXQ A;  1VCI A;  3HG9 A;  1MBY A;  1IW7 D;  2F0I A;  1WVL A;  3KF6 A;  1H9R A;  2NTS A;  1LT6 D;  2E8G A;  2YYZ A;  3STB D;  2O4X A;  2RA4 A;  4QGU A;  1CZW A;  2JA7 G;  3UE0 A;  3K5N A;  2NN6 H;  4A3G G;  4C3I H;  1PRT D;  3I4N G;  4R4I A;  1JB7 A;  4FO2 A;  1SFO H;  2E2J H;  1BO0 A;  3RLN A;  4LF6 L;  1UEA B;  1U4L A;  1WTR A;  1NSN S;  2OXP A;  4ZKB B;  5J39 A;  2UXC Q;  1TWF H;  2O2L D;  3DUZ A;  4IUV A;  4JCV E;  5IGF A;  4WFN 3;  1KD1 C;  2UXB Q;  5HUR A;  1C4Q A;  2E5L Q;  2K1B A;  3P1H A;  2F03 A;  2AMC B;  3J81 i;  1HNZ L;  4DXG A;  4BXX G;  2ZT9 C;  1PRT F;  2HCC A;  3K5L A;  3PV0 A;  3PGZ A;  5ELD A;  1IBL Q;  2NB0 A;  2VL6 A;  1TS5 A;  1SSO A;  1EIG A;  1JOK A;  2AQ3 B;  4IN3 A;  2Z6K C;  3GTO B;  4P74 A;  4JYA Q;  2LMC B;  2VQE Q;  2IWH A;  2WAQ B;  3TS0 A;  4X62 L;  2GVB A;  5FJ8 G;  1N32 Q;  1YJ9 A;  2PPB C;  1FL0 A;  3HKZ B;  2E74 C;  2FFK B;  3H3V C;  1IKL A;  5IWA L;  3I72 A;  1I4G A;  3PSI A;  3K7U C;  1Q3L A;  4PG3 A;  3NSW A;  1CK1 A;  5E7N A;  1CKN A;  4O42 A;  4A3E G;  4DAV A;  3I4M G;  3HOY G;  1TU2 B;  4YCW A;  4XQQ A;  4Y52 H;  1VF5 C;  5C0X I;  3HFZ B;  1RIP A;  4CDF C;  3KJO A;  2N78 A;  4DK1 A;  5C3E H;  2L12 A;  5IE8 A;  1C9O A;  1AP0 A;  5KGU A;  1MSH A;  4Q0F A;  1PZK D;  4LF9 L;  2EY6 A;  2HD3 A;  3X3M A;  2RQX A;  4ZLT F;  1I4X A;  2NVT B;  1J8I A;  4YWM A;  3S1R B;  2EYO A;  4UP9 A;  4UY8 C;  4K14 A;  2UUB L;  2EYP A;  5CGK A;  5AJ3 L;  3K5M A;  1XMO Q;  1XNQ L;  4FYD A;  2G5D A;  5CV9 A;  4JI8 L;  4K6L A;  3ULJ A;  1KLG D;  2KEC A;  3K7A B;  3V96 A;  3JAM i;  3VA7 A;  2O5J C;  3J7Y W;  2NVQ B;  4K5X A;  1W3S A;  4LF8 L;  2Z8L A;  3CHB D;  1J5E L;  2I5M X;  4X66 L;  4BBR B;  3GTP B;  2XRQ D;  5AFW A;  3OIQ A;  4FF3 A;  3S24 A;  4A3M H;  3HOV B;  2VB2 X;  2F3V A;  3T51 B;  3HOZ B;  4B9W A;  3ICE A;  3LNN A;  1HXY D;  3J81 j;  3W5O A;  5FO9 B;  1WYD A;  2LFN A;  1VDZ A;  4JI2 Q;  2K5N A;  1DD2 A;  4JG2 A;  5LL6 S;  1XPO A;  3PIO 3;  3NEM A;  1BKB A;  1CHQ D;  1JR0 D;  1PLF A;  1SFO B;  2J7Z A;  2E2J B;  2WAQ G;  1MSG A;  3T13 A;  3V2T A;  3HKZ G;  1E22 A;  4V19 0;  1TWF B;  3TP8 A;  1VQN A;  1DGS A;  2SOB A;  1HH2 P;  2EY2 A;  4A3D H;  1D7Q A;  4XT1 B;  4GNX A;  1KL9 A;  3F2B A;  1SE3 A;  3A55 A;  2PYK A;  4KHZ A;  3K8A A;  3BDL A;  4POF A;  4TQU S;  4LUO A;  2D5D A;  3K57 A;  4RCO A;  2E5L L;  1CFM A;  3S9W A;  5M3M H;  2DY7 A;  1TWG B;  1H95 A;  3NPP A;  3OWF A;  3L9A X;  3LGJ A;  5KYL A;  4UAI A;  1IBL L;  5JJL A;  3BVZ A;  2MGS A;  1JIC A;  4TSS A;  4DV6 Q;  2KCN A;  3F8T A;  2R7D A;  3VYR A;  1PH9 A;  4XQN A;  4JYA L;  1Z6H A;  4CJ0 B;  1I94 Q;  4KMU C;  2H5X A;  2VQE L;  4EVO A;  2V1C C;  3H6M A;  1N32 L;  4JW0 A;  3TZU A;  4OEL B;  2XWJ B;  4BBR G;  1TWC H;  1XX8 A;  5C3E B;  3Q8D A;  1EU3 A;  4QUF A;  4J6H A;  4AYB E;  4OIK A;  3GO5 A;  3HOV G;  1JE5 A;  4HCS A;  3HOZ G;  2A6E D;  4P72 A;  4X3K A;  3FKI H;  5EPL A;  1STG A;  2KBN A;  3E9I A;  3OMG A;  4XQJ A;  2HIX A;  1NMF A;  4YHH Q;  2N49 A;  1QVF A;  4GKK L;  3AU7 A;  4K5V A;  2CH4 W;  5CV7 A;  1O7L A;  2PCF B;  4DGZ A;  1HZB A;  2BCO A;  2OEO A;  4JBM A;  1EYA A;  2PI2 E;  4M8A A;  1N34 L;  5IYD H;  4DR2 Q;  4HJ8 A;  3WDN A;  2QF7 A;  3DM1 A;  2IHE A;  4PZ8 A;  2DGY A;  4DV7 Q;  1ASZ A;  3U9S A;  2K01 A;  3CAM A;  1XMO L;  3MEF A;  1LM0 A;  3MXN B;  1EZ8 A;  2ICI A;  1FNW A;  1R4Q B;  2WB1 E;  4A3M B;  3UDX A;  5JVH 3;  2R6G A;  4XT3 B;  5ELC A;  3E0E A;  2VUM H;  4RGT A;  1F9P A;  4OO1 G;  1I4R A;  5D65 A;  1JWM D;  2EPB A;  5JAV A;  1YIT A;  5M5X B;  1BUV T;  1HTP A;  3HOX H;  4UP7 A;  1YHQ A;  1V43 A;  4KHP Q;  4LWC A;  3M4P A;  2Y0S B;  1K3R A;  1X3Q A;  2PNR C;  1IBM L;  1XTC D;  3RUZ A;  2SEB D;  5FO8 B;  2ENB A;  4FNF A;  5M3F H;  4JI5 L;  5BN4 A;  3WOF A;  5A2Q L;  5JOB A;  4JI7 L;  4H7B A;  1Y1W H;  4LFC Q;  3QR8 A;  5NUC A;  2RCF A;  4A3D B;  2E2I H;  3R93 A;  1EQQ A;  2K7V A;  3DWA A;  3GP7 A;  4PMB A;  5KIX A;  3QOL A;  2HT1 A;  1T9H A;  3KK7 A;  3KUP A;  2VQF L;  4KD3 A;  5D3I B;  5C3E G;  3EIV A;  1PDQ A;  5M3M B;  3FMC A;  2EYH A;  2LY7 A;  1KAA A;  3I7F A;  2UUA Q;  5LMN Q;  3F1Z A;  5IOC A;  2EXZ A;  1Q82 C;  1Q1E A;  1RCV D;  1ENC A;  3CRK C;  3QB3 A;  4PMC A;  3U9O A;  4DV0 L;  3UDG A;  3R2I A;  3I70 A;  1Y8P B;  4JC0 A;  3TBI B;  5M9O A;  1HA6 A;  1TWC B;  2KEE A;  2L11 A;  3RMH A;  4DV6 L;  1GOZ A;  5D14 A;  3SK5 A;  3T1H Q;  4MTK A;  4BBS B;  1F9S A;  1I94 L;  5KND A;  4A3M G;  3N6R A;  4QL5 A;  2EZV A;  2JA8 H;  4HR7 B;  1MJC A;  2BDO A;  5K5P A;  1H9K A;  5GAG C;  3FKI B;  4I7A A;  3S1N H;  4FVM A;  1SE2 A;  1V9P A;  2IJ0 A;  3MFG A;  2PZT A;  1RKN A;  4DV3 L;  2Y0S G;  2X6G A;  4LFB L;  2EXD A;  3QO2 A;  4BA1 I;  2HDL A;  1PH5 A;  1PHJ A;  1H9J A;  3MHB A;  3P20 A;  3FVQ A;  4Y7N B;  4H02 A;  3EA6 A;  3NHH A;  2EQS A;  3D6C A;  2MNA A;  3VA5 A;  2A69 D;  1QB5 D;  3PCO B;  3T4A C;  5IT9 c;  1L1O C;  5EBC A;  4RKB A;  2VUM B;  5BR8 L;  3N52 A;  2KEN A;  1SRU A;  3J80 c;  1IZ6 A;  4DR2 L;  1FJG Q;  1K28 A;  1I4P A;  1E7Z A;  2ZTE A;  2ZXR A;  4DV7 L;  1SN8 A;  4NMZ A;  1CUK A;  2I5H A;  3BJU A;  1TKW B;  4CDC C;  5J22 A;  3E0J A;  2P5Z X;  1SNQ A;  4BWG B;  3I90 A;  2ZM6 Q;  5EKK A;  1XTD A;  1AH9 A;  1NUC A;  2VZA A;  4HJ7 A;  1LV9 A;  3I4O A;  4X65 Q;  5M3M G;  4RH6 A;  5M3F B;  3C3L A;  2PMZ B;  2ZXP A;  5IT9 E;  1EFW A;  1B9N A;  2EJM A;  1L0Y B;  1E3P A;  5IP7 H;  5E1F A;  3J80 E;  2RF4 A;  1PFM A;  1SE8 A;  3FEW X;  3VR4 A;  3C1F A;  4IQZ A;  1Y1W B;  2VXW A;  5FLX c;  3KDF A;  2E2I B;  3A0J A;  1HZA A;  4JI6 Q;  2CFM A;  2WAQ E;  5ELE A;  4A76 A;  3HKZ E;  3W1B A;  1HUM A;  1I3Q H;  2A68 D;  3L0O A;  2GN5 A;  1KDB A;  3FDT A;  1RTO A;  4BBS G;  2E76 C;  2OCE A;  1UE5 A;  1WI5 A;  4AH6 A;  1ZEQ X;  1C8C A;  2BE5 D;  3MFY A;  1STA A;  2JA5 H;  3NTK A;  5FLX E;  4KD4 A;  1VQE A;  3FKI G;  2MUY A;  4R4T A;  1I6H H;  4K6D A;  1K8O A;  1PVO A;  4KV6 A;  3HOW B;  1X9N A;  1BF4 A;  5I4D A;  3RN2 A;  1WTP A;  2NVY H;  1HNZ Q;  3D6W A;  1NTG A;  4QB4 A;  4B9X A;  5I9P A;  2UUA L;  1GO3 E;  3MAQ A;  5IYD G;  5CBE E;  2XSC A;  2WP8 J;  1V1Q A;  4RFB A;  3PIP A;  3E5S A;  1Q12 A;  5C44 H;  4R8I A;  3CXC A;  1CA5 A;  1YHA A;  2MPM A;  5COY A;  4GLX A;  1EY4 A;  3TP5 A;  2DNE A;  1A8V A;  4X62 Q;  4QIW B;  3CRL C;  3S15 B;  3NTH A;  1STY A;  4EQP A;  4OXP A;  2RDH A;  1EQR A;  3S1N B;  5G3L D;  3S1Q H;  4IOC A;  1V1P A;  3HEJ A;  2A73 B;  4PZ7 A;  1KC8 C;  1VQL A;  5CC4 A;  1O7I A;  1C0A A;  5DAU A;  3EN2 A;  1Y8O B;  4P73 A;  1JT8 A;  3AQQ A;  2ZJQ A;  1PFS A;  3SK4 A;  5M3F G;  2F0Q A;  3URY A;  4AYB G;  1DCZ A;  4F88 A;  2ZJP A;  4JK1 C;  1L1O B;  4ZAI A;  4DK6 C;  4LF9 Q;  1RF2 D;  2PQA B;  1VQF A;  3U4Z A;  1VQ5 A;  1SYC A;  2F0K A;  5CMD A;  3SE0 A;  1EEF D;  2OF1 A;  1Y1W G;  3MEH A;  1SJH D;  1JCK B;  1HJP A;  1EU4 A;  5KYI A;  2UUB Q;  5AJ3 Q;  3OWE B;  4HN7 A;  1XNQ Q;  1ICF B;  1XXG A;  2DY8 A;  2F0D A;  3KBX A;  2F0T A;  5HGQ A;  3QIA A;  4JVZ A;  1ONL A;  3RZD H;  2F4I A;  2QGQ A;  3NE5 B;  1OXU A;  2NBF A;  5C6A A;  3JAM c;  2R92 H;  4LF8 Q;  1D1K A;  1J5E Q;  1ENA A;  1ZYR C;  1WTV A;  4JBW A;  1K83 H;  1FJG L;  4X66 Q;  3A7A B;  2NVX H;  1RHP A;  4WRD A;  2LKV A;  5LL6 X;  1B4O A;  2ZJR A;  3G4S A;  5IYB H;  4A93 H;  3HS0 C;  2F0N A;  4IUU A;  4DR7 L;  3M3Y H;  1GUT A;  3HOW G;  4IUN A;  3OMC A;  3AB9 A;  4CGY B;  1BVS A;  3WOE A;  3RZO H;  3IL8 A;  3JAM E;  5GAE C;  2K14 A;  1R9T H;  4DV5 L;  1X3F A;  1GHJ A;  1DOL A;  3LWU A;  5C5M A;  4IFD J;  3EQL C;  4H44 C;  1VQO A;  3FPP A;  4UHV A;  1VQH A;  5C3X A;  2KOL A;  4JI6 L;  1XJV A;  1PTO H;  1U0L A;  1WTX A;  1PH3 A;  2IT1 A;  1I6H B;  3AFQ A;  1STH A;  2YV5 A;  3O13 A;  2Q2U A;  4RWS C;  1WOC A;  1QJO A;  3NP8 A;  1D2B A;  2K28 A;  2UU9 L;  2Q8R E;  2WKC A;  4KTA A;  2NVY B;  1SJE D;  3SDZ A;  3I73 A;  2I07 B;  5GRO A;  1ASY A;  4YY3 L;  3GTQ H;  4HIM A;  4HIO A;  4TKO B;  4LJZ C;  1PH8 A;  5CBA E;  5C44 B;  2YU9 H;  4KJO A;  3F2D A;  2MQH A;  5H1S E;  5M5W H;  1DXM A;  3NQT A;  2EYM A;  2N8N A;  4UDU C;  1L0X B;  5ELF A;  3S1Q B;  1B3A A;  1KTK A;  2B8F A;  3ND9 A;  1B1Z A;  3AMU A;  3EFX D;  5JEA H;  1WTQ A;  3GQB A;  4O1N A;  1JQY D;  3C2P A;  3TP6 A;  4HED A;  3ULP A;  1TWA H;  3IKJ A;  3C1E A;  4KN4 C;  1YI2 A;  4JI3 L;  4OWT B;  4QUC A;  1QVG A;  1KDC A;  5IP7 G;  4BY1 G;  1PH2 A;  3PUY A;  1GUW A;  3W1G A;  1QOH A;  2Y0S E;  3D4W A;  5CR3 A;  2QA4 A;  2F52 A;  1K0S A;  1LYL A;  4G4K A;  4GKK Q;  1HTL D;  1PYS B;  1WTH A;  3H0G G;  3W3A A;  3Q22 A;  1TY0 A;  1YJN A;  3K81 C;  2NWG A;  1VQ7 A;  2B2Y C;  2F0V A;  2R92 B;  1N34 Q;  1S5E D;  5FKA C;  5FO7 B;  3S17 H;  1SLJ A;  1L0W A;  1EQT A;  4N8X 1;  3I91 A;  1WD1 A;  1LTB D;  2NZ1 D;  5TSS A;  1OXS C;  2NVX B;  1SDF A;  1IXR A;  1A63 A;  3K59 A;  4A93 B;  4DXF A;  1EY0 A;  1CKM A;  3VR3 A;  3M3Y B;  2CH4 A;  3PQI A;  4DR6 Q;  4JV5 L;  1R9T B;  5EGT A;  1K9M C;  3VR6 A;  1B53 A;  1YBY A;  3MXG A;  3A5Z B;  4V0B A;  2BOS A;  1W6K A;  5GAD C;  2FMC A;  2NYZ D;  1JJ2 A;  1IBM Q;  2B2T C;  3OYY A;  1SND A;  4OEM B;  2EY1 A;  3NK9 A;  2OT2 A;  4JI5 Q;  2FIN B;  1IW7 C;  2D0O A;  1DM0 B;  1ESR A;  1GUO A;  2GVA A;  4KHV A;  1PTO B;  5IY0 A;  1IBK L;  2Z6K A;  3STB C;  4JI7 Q;  1E24 A;  3BVG A;  4PQX A;  2AQ2 B;  4C3I B;  4CDE C;  5C0X H;  5IGE A;  1GHK A;  1VF7 A;  1W6J A;  1YNX A;  3I4L A;  1S72 A;  1PRT C;  2CQA A;  3TP7 A;  1F77 A;  1SEB D;  3CME A;  3BU2 A;  1DZ1 A;  1D8L A;  2RVL A;  3PIO A;  1QG7 A;  5KEE A;  1GM5 A;  1YVC A;  1Y8N B;  3GTQ B;  2VQF Q;  4C1N I;  2NZH A;  4OHJ A;  3VYT A;  2YU9 B;  2IW3 A;  4YIJ A;  5M5W B;  5EAY A;  4WJ3 M;  3PO3 H;  4I65 A;  3CPF A;  3CU7 A;  2LSS A;  1FD7 D;  2KCM A;  1STN A;  4IZ8 A;  1YEZ A;  3BDO A;  5ELB A;  1EWH A;  2MFI A;  3BS1 A;  4OX9 Q;  2EJF C;  4MHE A;  2WAC A;  4YWK A;  4DV0 Q;  1VQG A;  3OW7 A;  2XGT A;  2UXD L;  4ZQ3 A;  2R92 G;  1X56 A;  4MIU A;  3NTI A;  1ESF A;  4POG A;  4KN7 C;  2KVM A;  3CMA A;  1HZ9 A;  4HAE A;  4CJ1 B;  1PMR A;  3KF8 B;  1UUP A;  2JK8 A;  3GTJ H;  1VQK A;  2RHQ B;  4A93 G;  2WFW A;  1RL2 A;  3EVQ A;  3L7Z C;  2E2D C;  5BN3 A;  4L5R C;  2K5H A;  5KRU A;  1I4Q A;  1Y1V H;  1TWH H;  2Q2H A;  3MXN A;  5JJI A;  2F4V L;  1I6V C;  2B2W C;  2PMZ E;  4RMF A;  3K58 A;  5FLM G;  1V8Q A;  4DV3 Q;  2B2T A;  1H9M A;  4PZ6 A;  1HNW L;  5EKI A;  4A3L H;  1A62 A;  1F2Z A;  4LFB Q;  3S17 B;  1BBU A;  2ZTD A;  4NP5 A;  4DR3 L;  4R4C A;  1GXD C;  1EEI D;  4LFA L;  3DHQ A;  1F2L A;  2NN6 G;  1HQR D;  4C3I G;  3CCU A;  1CM9 A;  2F0O A;  1HCZ A;  2PW7 A;  2ZXO A;  2WIN B;  4P2C B;  1YNN C;  5BR8 Q;  2OWO A;  2XNA C;  2Q8T A;  1JE4 A;  2I5L X;  3RD4 A;  1RDP D;  3ND8 A;  2KHS A;  5KNC A;  4CDD C;  4GN3 B;  1G29 1;  5JJZ A;  3DMU A;  1LTR D;  3ULL A;  4H13 C;  1S40 A;  3AFP A;  1SR3 A;  2HIV A;  5IIF A;  2DN8 A;  4DR5 Q;  2M00 A;  3QWN A;  1U9R A;  2K5Q A;  4DR6 L;  2L55 A;  1QCB D;  2F0L A;  2JQO A;  2AUJ D;  3TQY A;  2OTL A;  4LW1 A;  4JI0 L;  1S5C D;  5EJW A;  2PW5 A;  1VS0 A;  1PRT B;  1EFI D;  3G48 A;  4JOI C;  2EVB A;  1TS3 A;  5LMN W;  2HQL A;  4F8M A;  4FXG C;  2EYJ A;  1HR0 L;  4K8J A;  1JWU D;  5JEA G;  1YNJ C;  4G7H C;  3MVV A;  1G2S A;  4WOR A;  4QIW E;  1F2Y A;  2CW0 C;  1TXY A;  4BA2 I;  3ZYY X;  3G71 A;  4CJ2 C;  1YIJ A;  1CT1 D;  5K36 H;  4LF5 Q;  1FVI A;  3LWE A;  1Q7Y C;  4P71 A;  1TQO A;  1HNX L;  1GUG A;  4K5W A;  2X6L A;  1NAP A;  4N9P A;  3VYS A;  4JI4 Q;  2Q8I B;  5ELN A;  1V1O A;  3PO3 B;  4HMI A;  3G6J B;  1AZQ A;  1TY2 A;  3A8I E;  3DM3 A;  2OQK A;  1AW7 A;  2R3Z A;  3MXU A;  2B2V C;  4J15 A;  3NUC A;  1X65 A;  3PO2 H;  4MNO A;  1PH6 A;  2VB3 X;  4IUP A;  1EY9 A;  1J6Q A;  2RSN A;  2MHV A;  4Z9C B;  2JA6 H;  1UE7 A;  4DV4 Q;  2JP1 A;  3U4V A;  1S5F D;  2AQ1 B;  1B44 D;  1OXT A;  1KRS A;  4G7Z C;  1B2T A;  2AWO A;  2F0G A;  4OX9 L;  2N88 A;  3NBH B;  4R9W A;  4B3R Q;  4JBK A;  1HA5 A;  2OTJ A;  3J80 L;  4DN4 M;  1UE1 A;  3Q24 A;  2SDF A;  5C4H A;  4ABN A;  2EYF A;  4ID6 A;  1Y1V B;  4RAU C;  3M4Q A;  3TRZ A;  3J7Z C;  4LUV A;  3ITP A;  4GOP C;  3KLR A;  5EQ0 A;  1QNK A;  4C3H H;  4IOA A;  2QCP X;  4N8F A;  1G6P A;  3S14 H;  4H0L C;  2HHH Q;  1ML0 D;  3DEP A;  1LTI D;  4C2M H;  5JPM C;  3J7A V;  4HIK A;  1SYD A;  3GTK H;  1EY7 A;  3ERO A;  2A6H D;  4YCU A;  3KFU A;  3FRP B;  1IL2 A;  4JOI A;  1XMQ L;  1UNS A;  1I5F A;  5C0X G;  5FLX L;  2AUK A;  1Y14 B;  2X69 A;  2A8V A;  3PUV A;  1PA6 A;  3HZX A;  1SMY C;  2KJX A;  1M8A A;  3BZD B;  3IRB A;  3VR5 A;  1Q8I A;  1FNU A;  1FGU A;  1ICW A;  4A3D G;  5LMU L;  1X54 A;  3HP3 A;  1F2M A;  4ZUJ A;  2EDG A;  4ODG A;  1Q86 C;  4M1U B;  1A2T A;  4B3M Q;  3PO3 G;  4C3J H;  1A3V A;  1DOK A;  3HOX B;  1Q1B A;  2Z4I A;  1LTG D;  1S3O A;  3CCM A;  1JB3 A;  3CCQ A;  4DR7 Q;  4NKL A;  3T1Y L;  2EY5 A;  3L3O C;  3KJP A;  3GTM H;  4DR5 L;  3IFD A;  3ONA B;  4ME3 A;  3RR5 A;  4APV A;  4E6I A;  1U4R A;  1E2V A;  1SNO A;  2BA0 A;  2EYL A;  3BZK A;  2FJ2 A;  5D3D A;  1DON A;  1LT4 D;  4IPD A;  4DV5 Q;  4KK7 A;  3NQI A;  1HQM C;  3PF4 A;  1KQS A;  1ILP A;  1NE3 A;  1PYB A;  3OW2 A;  4F87 A;  2L9H A;  1B9M A;  3MC0 B;  4AIM A;  5ELO A;  4U67 3;  1XYI A;  1EOT A;  1WTO A;  3M4O H;  3SXH A;  5DEH A;  1WJJ A;  3SK6 A;  4GOP A;  3DXJ C;  2CKZ B;  2YTX A;  2JYO A;  4NXM Q;  4LF5 L;  2L0C A;  1Y1V G;  4DNT B;  3S16 H;  4LF4 L;  3LX0 A;  4A3E H;  1FR3 A;  2KQ3 A;  3HOY H;  2UU9 Q;  4DF7 A;  3PO2 B;  2A19 A;  4JI4 L;  2F3I A;  4JBJ A;  4A75 A;  4YY3 Q;  4K0K L;  2JA6 B;  1G51 A;  4A3L G;  3UE1 A;  1N9W A;  4KKS A;  1HHV A;  4DFA A;  1MD2 D;  3D8G A;  1OXX K;  5IGD A;  4LMQ D;  4J1M A;  1NR2 A;  1SYB A;  4DUZ L;  1LAC A;  1STE A;  4O0A A;  3J81 c;  3UI2 A;  2LS0 1;  4MTN A;  4DR4 L;  5T1G A;  4DV4 L;  3TME A;  2RBM A;  3ERS X;  1VQ4 A;  4GOP B;  1CZG A;  4RCN A;  4OL7 A;  4JI1 Q;  1G2T A;  1B7Y B;  3CP0 A;  3SEB A;  1BBX C;  1L1O A;  1FNV A;  2JEB I;  2PQA A;  3R8B A;  3C46 A;  3D4R A;  3OTO Q;  2I0Q A;  3S14 B;  4B3R L;  1WTW A;  4C2M B;  1BQQ T;  2QDL A;  2VUM G;  2JA8 B;  3GV3 A;  3CC7 A;  1U4M A;  3PIP 3;  1CI3 M;  1X3P A;  3TSS A;  4JI3 Q;  2G9D A;  3MWY W;  1QIL A;  5C4X H;  3M4Y A;  3J81 E;  4XYO A;  2CWP A;  1CSQ A;  1SBB B;  1TS4 A;  5ISR A;  2K32 A;  3HOX G;  1LLR D;  2F0E A;  3OOC A;  4HSP A;  1H9S B;  2ALY B;  2HHH L;  2YTV A;  4CKE A;  1CQV A;  3FHW A;  1E2W A;  2KCT A;  5I2X A;  2F0F A;  4L5Q A;  1KNE A;  2N3S A;  3U50 C;  4FDB A;  3NXW A;  1O78 A;  3GTO H;  1EWI A;  2IHF A;  4KJN A;  4DK0 A;  1N33 L;  2H1E A;  3HOU H;  1MJE A;  1F9Q A;  3K6O A;  1ET9 A;  1QZH A;  3PUX A;  1SYF A;  2Z1C A;  1A0I A;  1BCP C;  1JOR A;  1O80 A;  4C3J B;  4LF7 L;  2KCC A;  1M1K C;  4A3B H;  2F0W A;  3I3C A;  3CCS A;  1VMP A;  3Q23 A;  2IX0 A;  1E2Z A;  4JV5 Q;  4G57 A;  3PO2 G;  1RTN A;  1II3 A;  4HCE A;  4ZK9 B;  1G91 A;  4B3T L;  2QW7 A;  3H94 A;  5J3B A;  2XVS A;  1Q90 A;  4B3M L;  2JA6 G;  1E0B A;  4NPS A;  2IY5 B;  3ZJY C;  2PQE A;  4X3S A;  1Z9F A;  2J0T D;  3I56 A;  1QUQ A;  2NUC A;  3DWQ A;  3J80 i;  1E1T A;  2F0M A;  4A3F H;  1A3U A;  1IBK Q;  4KY6 A;  4RA8 A;  1KXL A;  1U4P A;  4OO1 I;  5DM6 3;  2FMM A;  1I3Q B;  3NBI A;  3OPO A;  2XTI A;  3K7A H;  2R7F A;  1KLU D;  1MGS A;  1VQB A;  2L5T A;  4A3E B;  2VNU D;  3HOY B;  4A3I H;  1LTA D;  4QCL A;  4RHR A;  4CKC A;  1PZI D;  2CCZ A;  1I50 H;  2JA8 G;  3SGI A;  2JA5 B;  2LXK A;  2L15 A;  3DEO A;  3GTP H;  5DM7 3;  1BBW A;  1EIY B;  2F0S A;  3S1M H;  1QVC A;  2BE5 C;  1PTO C;  2K33 A;  4NXM L;  4A3C H;  4KKU A;  3UDI A;  1PXU A;  1QUQ B;  3H3V I;  3HOV H;  3HOZ H;  4BY7 H;  2O5I C;  1W2B A;  2D62 A;  1AE3 A;  4DNI A;  1D5X C;  1MKH A;  1PFN A;  2MO0 A;  5E3F A;  4DAM A;  1JMC A;  4C56 C;  3A74 A;  5T1I A;  1X32 A;  1EOV A;  4DNR B;  3RNU A;  2Q2I A;  2RDG A;  4B3S Q;  4NDX A;  4OWW B;  3NWT A;  1HFG A;  3M85 A;  2F0P A;  4N9T A;  2C5C A;  2UXD Q;  4XDX A;  3TZD A;  3H15 A;  5I6Y A;  5EBD A;  4GLV B;  1ET6 A;  4DR1 L;  2Z4H A;  4YCV A;  2BH2 A;  1KRT A;  3E9H A;  4JI1 L;  5IP9 H;  2F0U A;  3K0X A;  5C4X B;  1NCV A;  4S3S A;  2J4X A;  4JPB W;  4PNY A;  4C3J G;  1U5K A;  3OHX C;  5E4X A;  5A35 A;  2M9V A;  4OO1 H;  4I7Z C;  3OTO L;  4DUY Q;  2GA4 B;  3KF6 B;  5CV5 A;  3GDE A;  1G6Z A;  1VQI A;  2UUC L;  4ZCK A;  3A7L A;  1KNA A;  3IAY A;  1YZ6 A;  4X6A H;  4R8N A;  1RJT A;  4C1N K;  1FGB D;  1EIF A;  2F4V Q;  1CHP D;  1K3B C;  3GTL H;  2B8G A;  1AZP A;  2K04 A;  3RLO A;  2ICE C;  1AE2 A;  1SMX A;  4O2D A;  1HNW Q;  1TWG H;  2K75 A;  2B63 H;  1EIH A;  3HOU B;  3H3V H;  2D0P A;  1BCP B;  4KY7 A;  4DR3 Q;  2CQO A;  4GKJ L;  1SXT A;  5L37 A;  2IX1 A;  4QY7 A;  2R93 H;  4DA2 A;  1Q8K A;  4LFA Q;  2Z9H A;  1JJC B;  2OQ0 A;  1N36 Q;  4NB3 A;  1XNR Q;  3RZD B;  2F0J A;  1HR0 W;  4A3K H;  5C4Z A;  1Z7T A;  4ZRZ A;  4A3B B;  2JXM B;  2RHS B;  4DV1 L;  2Q2T A;  4YWL A;  4L5S A;  5I6W A;  1XPR A;  1K83 B;  3TEH B;  4GNX C;  2B3G A;  3CC2 A;  1ZKO A;  1X6O A;  3Q6S A;  1GD7 A;  2JA5 G;  3K80 C;  2N55 A;  1QZG A;  1OTC A;  3R2T A;  2B29 A;  5I2Y A;  4OIJ A;  3OIP A;  2ATW A;  1NBW A;  4GLA C;  4ULL A;  1AEX A;  5C5L A;  4L8J A;  2MJ8 A;  4HJ9 A;  4A3F B;  3RZO B;  3K0Y A;  3MTS A;  4JI0 Q;  2I46 A;  2JSO A;  2RCN A;  4X64 L;  3BDC A;  2EIF A;  3NWS A;  3P7J A;  5J1Z A;  4CKB A;  1A6X A;  3T56 B;  1HUN A;  1YNN D;  1D6E C;  5C44 G;  3SVM A;  1BXT A;  4LNQ A;  1CKN B;  4HSV A;  1HR0 Q;  2CVR A;  4A3I B;  2ASB A;  4KKT A;  1UE6 A;  1ZXT A;  2HQE A;  3CKI B;  4B08 A;  1I50 B;  1OO9 B;  3U58 A;  5DLQ E;  1VQ8 A;  4RGO S;  1IYJ B;  2E2H H;  1WFQ A;  1JOO A;  3S1M B;  3AEV A;  1IL8 A;  3PMF A;  1Q81 C;  2WII B;  1UAP A;  5C4X G;  1HNX Q;  2E75 C;  1EYC A;  5EPJ A;  3RLF A;  4RHS A;  4BY7 B;  3R3O A;  1SYE A;  3A5U A;  4NXN Q;  4HMJ A;  3UDF A;  4OON A;  4IFD I;  1PYW D;  5M5X H;  1SRO A;  4FF2 A;  3KF8 A;  1YNJ D;  4K2K A;  3FPU B;  3BZC A;  2CW0 D;  1ROD A;  2NTT A;  4IAL A;  3HOU G;  2K4K A;  4CBV A;  2K50 A;  4QQB X;  3KLW A;  3CW2 C;  2AKW B;  2B2Y A;  4EQ5 A;  4B3S L;  3S2H H;  1A2U A;  2XN9 C;  4J8Q A;  2QEJ C;  1FYC A;  4DPG A;  4A3B G;  2BDN A;  4KY5 A;  4EQO A;  1VQA A;  2WKD A;  4GN4 B;  4X3T A;  4AQY Q;  4ZYS A;  4PV1 C;  1TWA B;  1Q46 A;  1LTL A;  5IYC H;  3CQZ H;  3NEN A;  3F2C A;  2UXC L;  2DJF C;  3HKS A;  3GTL B;  2UXB L;  3SHL A;  1K73 C;  5IYB G;  3I55 A;  3A56 A;  1J9O A;  4DUY L;  1AFP A;  3BVM A;  2B63 B;  1T5X D;  1S4Z A;  4L63 B;  1SAP A;  1CSP A;  2PZW A;  4K8I A;  2RSO A;  4A3F G;  2JJQ A;  4L5T A;  1O7Z A;  2R93 B;  2K03 A;  4UP8 A;  1VQ9 A;  1NNX A;  2K52 A;  5JJK A;  1XMQ Q;  4ALP A;  2HDM A;  4EX5 A;  1I4H A;  2JEA I;  4A3K B;  4IFD H;  5C4J H;  4GNX B;  1DYQ A;  1EL0 A;  3QOJ A;  3MXP A;  4A3I G;  2QDB A;  4R4Q A;  2VY3 A;  3D3R A;  1EY5 A;  2D9U A;  3HGB A;  3QJY A;  4TVA B;  4WJW A;  1N36 L;  2TMP A;  1XNR L;  3GTG H;  2C9O A;  3CCR A;  3TN2 A;  1TS2 A;  1XWE A;  4A3C G;  4BBS H;  5E4W C;  2C35 B;  1R4P B;  5IOD A;  5LMU Q;  2B39 A;  5DNF A;  4BY7 G;  2KHJ A;  2A74 C;  4LK1 C;  4XXE A;  5JVG 3;  1D1I A;  1A15 A;  3IFT A;  5IGC A;  1QE6 A;  1MIU A;  4P75 A;  3I8Z A;  2JA9 A;  2ES2 A;  3T1Y Q;  1BNZ A;  3KLS A;  5M5Y H;  4EQN A;  4QMG A;  1C48 A;  4PMW A;  3MZ5 A;  3HRZ C;  2L4N A;  1SMY D;  5FK9 C;  1X55 A;  3KBG A;  2FHT A;  1GUS A;  2QKI C;  1EWC A;  2IX3 A;  1BDO A;  4Y7N H;  2E2H B;  4ZUI A;  5IP9 G;  2K05 A;  1EY6 A;  1T5E A;  3QG1 A;  2IPK D;  4A3J H;  4KLK A;  1DOM A;  1SNM A;  5F2D A;  2VW9 A;  4K2L A;  1E1O A;  3CD6 A;  3K5O A;  1TII D;  2ID0 A;  1VQD A;  4RKL A;  4HJA A;  3H91 A;  1KAB A;  4LF4 Q;  1KDA A;  1P8L A;  1KIX A;  2G9H D;  4XYQ A;  2RDF A;  1C7Y A;  1CKO A;  3NBH A;  4LUZ A;  2PNH A;  4R1J A;  1SYG A;  4NXN L;  3OSO A;  4K0K Q;  2F0H A;  3T53 B;  2NZO A;  2B63 G;  2PZU A;  2B2W A;  2MP1 A;  3MA2 B;  1A3T A;  3CF5 A;  4JI2 L;  3H09 A;  2R93 G;  1KAW A;  1D5Z C;  2R7Z H;  3S2H B;  2CWA A;  2TSS A;  4DUZ Q;  1VMC A;  3EBE A;  4MZ9 A;  4A3K G;  4RGN A;  2CHB D;  1IKM A;  4DR4 Q;  1JJG A;  2XWB B;  4U68 A;  1WD0 A;  3PUZ A;  3CQZ B;  1WCM H;  1CA6 A;  1HZC A;  4IO9 A;  3X3N A;  3GTJ B; 
#chains in the Genus database with same CATH homology
 4KI0 A;  5IT9 L;  4OGQ C;  2KA7 A;  1Z47 A;  1AN8 A;  1TWH B;  3SK8 A;  5C4J B;  1TVX A;  4CHT B;  4XTC S;  4FXK C;  3A8J E;  2AWN A;  2A6E C;  5BN5 A;  3J7A F;  4L6T B;  1EYD A;  4FXD A;  3GTG B;  2K5D A;  2XRS D;  5FOB B;  4Q5V A;  3VR2 A;  4IUT A;  3DWP A;  1D5M C;  3KLS X;  3A54 A;  1M4V A;  2A5H A;  1IHZ A;  3G7L A;  4QF4 A;  5A2Q E;  1PFB A;  5M5Y B;  1RD9 D;  1ILQ A;  4HTH A;  4DAP A;  3VYU A;  2JE6 I;  2F1M A;  5C3W A;  3M7G A;  2B2V A;  5EKL A;  4EGV A;  4DAY A;  1SE4 A;  4ILW A;  3BYT B;  1IYU A;  4A3J B;  2EOT A;  3EJI A;  3GV6 A;  2B2U C;  1BCP D;  4BS9 A;  3P75 A;  5LHY 1;  3J81 L;  2KED A;  3E6Z X;  1HRJ A;  1B50 A;  1LT3 D;  1S5D D;  2R61 A;  1ZYR D;  3M7N A;  1DJR D;  1ENF A;  4X3U A;  1LO5 D;  5JEA J;  3TDQ A;  4AYB B;  2EE1 A;  3BYY B;  2F3W A;  1BCP F;  2R7Z B;  5CV8 A;  4IFD G;  2DNC A;  3W2D A;  3Q0A A;  5EPK A;  1S5B D;  5KNB A;  1WCM B;  1TT2 A;  1TR5 A;  4NW2 A;  2PO4 A;  1H9S A;  5IGB A;  2WB1 B;  1PTO D;  5HGT A;  1SNC A;  5CYU A;  1GJX A;  4RGM A;  3PUW A;  4C3H B;  2EJG C;  2H4O A;  1IYV A;  4DU9 A;  5CV4 A;  3JAM L;  1K8M A;  4LAA A;  1BR9 A;  5CV6 A;  1SNP A;  5COR A;  1F9R A;  3GTK B;  2HUG A;  1STB A;  2SNS A;  2KUM A;  1HPC A;  2A6H C;  2HCI A;  3SR1 A;  3D4D A;  1EZ6 A;  1LTS D;  1PTO F;  4IUQ A;  2B2U A;  3T16 A;  5JPN C;  2JA7 B;  3S2D B;  1JC7 A;  3V05 A;  1QNU A;  2WV6 D;  4A3G B;  3D31 A;  4XIG S;  4ZKC B;  3I4N B;  3GD7 A;  1OXV A;  4MN3 A;  5K36 G;  2SNM A;  2K6A A;  5C0X J;  4FP5 D;  4IUR A;  1JOQ A;  2QIL A;  1LT5 D;  3A8K E;  2A69 C;  2M2L A;  2K5W A;  1EQV A;  4G7O C;  4TRD A;  3ERQ A;  1JWS D;  1O7Y A;  1GUN A;  1LTT D;  3GTM B;  2IL8 A;  4ME5 A;  5G3L F;  1QWY A;  2NN6 I;  1PZJ D;  3BG3 A;  2XIW A;  3F2U A;  1CQF A;  2BA1 A;  1LAB A;  1V1P B;  1CTM A;  1MI2 A;  2RKS A;  1BOS A;  3M4O B;  1Y69 U;  4FF4 A;  3S16 B;  1HFN A;  1EY8 A;  5I9O A;  4BY1 B;  3I4M B;  2A68 C;  4C3H G;  4FF1 A;  5IGG A;  1G8Z D;  1NR4 A;  4F7X A;  2D2C C;  2L1B A;  4GZY C;  3H0G B;  2V4D A;  1VCI A;  3HG9 A;  1MBY A;  1IW7 D;  2F0I A;  1WVL A;  1H9R A;  2NTS A;  1LT6 D;  2YYZ A;  2O4X A;  2RA4 A;  1CZW A;  3K5N A;  2NN6 H;  1PRT D;  4FO2 A;  1BO0 A;  1UEA B;  1U4L A;  1WTR A;  1NSN S;  2OXP A;  4ZKB B;  5J39 A;  2O2L D;  3DUZ A;  4IUV A;  5IGF A;  4WFN 3;  5HUR A;  1C4Q A;  2K1B A;  3P1H A;  2F03 A;  4DXG A;  2ZT9 C;  1PRT F;  2HCC A;  3K5L A;  3PV0 A;  5ELD A;  2NB0 A;  1TS5 A;  1SSO A;  1EIG A;  1JOK A;  2AQ3 B;  4IN3 A;  3GTO B;  2LMC B;  2IWH A;  2WAQ B;  2PPB C;  3HKZ B;  2E74 C;  2FFK B;  3H3V C;  1IKL A;  3I72 A;  1I4G A;  1Q3L A;  3NSW A;  1CK1 A;  4O42 A;  4DAV A;  1TU2 B;  4XQQ A;  1VF5 C;  5C0X I;  4DK1 A;  2L12 A;  1AP0 A;  5KGU A;  1MSH A;  4Q0F A;  1PZK D;  2EY6 A;  4ZLT F;  3X3M A;  2RQX A;  2NVT B;  1I4X A;  1J8I A;  3S1R B;  2EYO A;  4K14 A;  2EYP A;  5CGK A;  3K5M A;  4FYD A;  5CV9 A;  4K6L A;  1KLG D;  2KEC A;  3K7A B;  3V96 A;  3VA7 A;  2O5J C;  3J7Y W;  2NVQ B;  4K5X A;  2Z8L A;  3CHB D;  4BBR B;  3GTP B;  2XRQ D;  5AFW A;  3OIQ A;  4FF3 A;  3HOV B;  2VB2 X;  2F3V A;  3T51 B;  3HOZ B;  4B9W A;  3LNN A;  1HXY D;  5FO9 B;  2LFN A;  1VDZ A;  1DD2 A;  5LL6 S;  3PIO 3;  1CHQ D;  1JR0 D;  1PLF A;  1SFO B;  2J7Z A;  2E2J B;  1MSG A;  3T13 A;  3V2T A;  4V19 0;  1TWF B;  3TP8 A;  2SOB A;  2EY2 A;  4XT1 B;  1SE3 A;  3A55 A;  2PYK A;  4KHZ A;  3BDL A;  4TQU S;  2D5D A;  3K57 A;  4RCO A;  1CFM A;  3S9W A;  2DY7 A;  1TWG B;  3NPP A;  3OWF A;  3L9A X;  5KYL A;  4UAI A;  3BVZ A;  2MGS A;  1JIC A;  4TSS A;  2KCN A;  3VYR A;  4XQN A;  1Z6H A;  4CJ0 B;  4KMU C;  4EVO A;  3H6M A;  3TZU A;  2XWJ B;  1XX8 A;  5C3E B;  1EU3 A;  4QUF A;  4J6H A;  4OIK A;  3GO5 A;  4HCS A;  2A6E D;  4X3K A;  5EPL A;  1STG A;  3OMG A;  4XQJ A;  3AU7 A;  4K5V A;  5CV7 A;  1O7L A;  2PCF B;  4DGZ A;  2BCO A;  2OEO A;  1EYA A;  4M8A A;  3WDN A;  2QF7 A;  3DM1 A;  3U9S A;  2K01 A;  1EZ8 A;  2ICI A;  1FNW A;  1R4Q B;  4A3M B;  5JVH 3;  2R6G A;  4XT3 B;  5ELC A;  4RGT A;  1F9P A;  4OO1 G;  1I4R A;  5D65 A;  1JWM D;  2EPB A;  5JAV A;  5M5X B;  1BUV T;  1HTP A;  1V43 A;  2Y0S B;  1X3Q A;  2PNR C;  1XTC D;  3RUZ A;  2SEB D;  5FO8 B;  2ENB A;  4FNF A;  5BN4 A;  3WOF A;  5A2Q L;  5JOB A;  4H7B A;  5NUC A;  4A3D B;  3R93 A;  2K7V A;  3DWA A;  3GP7 A;  4PMB A;  5KIX A;  3QOL A;  3KK7 A;  3KUP A;  4KD3 A;  5D3I B;  1PDQ A;  5M3M B;  3FMC A;  2EYH A;  2LY7 A;  1KAA A;  5IOC A;  2EXZ A;  1Q1E A;  1RCV D;  1ENC A;  3CRK C;  3QB3 A;  4PMC A;  3U9O A;  3R2I A;  3I70 A;  1Y8P B;  3TBI B;  5M9O A;  1HA6 A;  1TWC B;  2KEE A;  2L11 A;  3RMH A;  1GOZ A;  5D14 A;  3SK5 A;  4BBS B;  1F9S A;  5KND A;  3N6R A;  2EZV A;  4HR7 B;  2BDO A;  5K5P A;  1H9K A;  3FKI B;  4FVM A;  1SE2 A;  2IJ0 A;  3MFG A;  2PZT A;  1RKN A;  2X6G A;  3QO2 A;  4BA1 I;  2HDL A;  1H9J A;  3MHB A;  3P20 A;  3FVQ A;  4Y7N B;  3EA6 A;  3NHH A;  3D6C A;  3VA5 A;  2A69 D;  1QB5 D;  3T4A C;  5EBC A;  4RKB A;  2VUM B;  3N52 A;  1I4P A;  2ZXR A;  4NMZ A;  1TKW B;  5J22 A;  3E0J A;  1SNQ A;  4BWG B;  3I90 A;  5EKK A;  1NUC A;  1LV9 A;  4RH6 A;  5M3F B;  3C3L A;  2PMZ B;  2ZXP A;  5IT9 E;  1B9N A;  2EJM A;  1L0Y B;  5E1F A;  3J80 E;  1PFM A;  3FEW X;  3VR4 A;  3C1F A;  4IQZ A;  1Y1W B;  2VXW A;  2E2I B;  5ELE A;  1HUM A;  2A68 D;  1KDB A;  3FDT A;  1RTO A;  2E76 C;  1ZEQ X;  1C8C A;  2BE5 D;  3MFY A;  1STA A;  3NTK A;  5FLX E;  4KD4 A;  2MUY A;  4K6D A;  1K8O A;  4KV6 A;  3HOW B;  1BF4 A;  5I4D A;  1WTP A;  3D6W A;  4QB4 A;  4B9X A;  5I9P A;  3MAQ A;  5CBE E;  2XSC A;  2WP8 J;  4RFB A;  3E5S A;  1Q12 A;  4R8I A;  1CA5 A;  2MPM A;  5COY A;  1EY4 A;  3TP5 A;  2DNE A;  4QIW B;  3CRL C;  3S15 B;  3NTH A;  1STY A;  4EQP A;  2RDH A;  3S1N B;  5G3L D;  1V1P A;  3HEJ A;  2A73 B;  5CC4 A;  5DAU A;  1Y8O B;  3SK4 A;  2F0Q A;  3URY A;  4F88 A;  1DCZ A;  4JK1 C;  4ZAI A;  1RF2 D;  1SYC A;  2F0K A;  5CMD A;  3SE0 A;  1EEF D;  2OF1 A;  3MEH A;  1SJH D;  1JCK B;  1EU4 A;  5KYI A;  3OWE B;  4HN7 A;  1XXG A;  2DY8 A;  2F0D A;  3KBX A;  2F0T A;  3QIA A;  1ONL A;  2F4I A;  3NE5 B;  1OXU A;  2NBF A;  5C6A A;  1D1K A;  1ENA A;  1ZYR C;  1WTV A;  4JBW A;  3A7A B;  1RHP A;  4WRD A;  2LKV A;  5LL6 X;  1B4O A;  3HS0 C;  2F0N A;  4IUU A;  1GUT A;  4IUN A;  3OMC A;  3AB9 A;  4CGY B;  3WOE A;  3IL8 A;  3JAM E;  1GHJ A;  1DOL A;  3LWU A;  5C5M A;  4IFD J;  3EQL C;  4H44 C;  3FPP A;  5C3X A;  2KOL A;  1PTO H;  1WTX A;  2IT1 A;  1I6H B;  1STH A;  3O13 A;  4RWS C;  1QJO A;  3NP8 A;  1D2B A;  2K28 A;  2Q8R E;  2WKC A;  4KTA A;  2NVY B;  1SJE D;  3SDZ A;  3I73 A;  2I07 B;  4TKO B;  4LJZ C;  5CBA E;  5C44 B;  4KJO A;  1DXM A;  3NQT A;  2EYM A;  4UDU C;  1L0X B;  5ELF A;  3S1Q B;  1B3A A;  1KTK A;  2B8F A;  3ND9 A;  1B1Z A;  3AMU A;  3EFX D;  5JEA H;  1WTQ A;  3GQB A;  4O1N A;  1JQY D;  3C2P A;  3TP6 A;  4HED A;  3IKJ A;  3C1E A;  4KN4 C;  4QUC A;  1KDC A;  3PUY A;  1GUW A;  1QOH A;  3D4W A;  5CR3 A;  4G4K A;  1HTL D;  3W3A A;  3Q22 A;  1TY0 A;  2NWG A;  2B2Y C;  2F0V A;  2R92 B;  1S5E D;  5FKA C;  5FO7 B;  1EQT A;  3I91 A;  1WD1 A;  1LTB D;  2NZ1 D;  5TSS A;  1OXS C;  2NVX B;  1SDF A;  3K59 A;  4A93 B;  4DXF A;  1EY0 A;  3VR3 A;  3M3Y B;  1R9T B;  5EGT A;  3VR6 A;  1B53 A;  3MXG A;  4V0B A;  2BOS A;  1W6K A;  2FMC A;  2NYZ D;  2B2T C;  1SND A;  2EY1 A;  3NK9 A;  2OT2 A;  2FIN B;  1IW7 C;  1DM0 B;  1ESR A;  1GUO A;  4KHV A;  1PTO B;  3BVG A;  4PQX A;  2AQ2 B;  4C3I B;  1GHK A;  5C0X H;  5IGE A;  1VF7 A;  1W6J A;  3I4L A;  1PRT C;  2CQA A;  3TP7 A;  1F77 A;  1SEB D;  1DZ1 A;  2RVL A;  1QG7 A;  5KEE A;  1Y8N B;  3GTQ B;  4C1N I;  4OHJ A;  3VYT A;  2YU9 B;  2IW3 A;  4YIJ A;  5M5W B;  4I65 A;  3CU7 A;  1FD7 D;  1STN A;  4IZ8 A;  3BDO A;  5ELB A;  1EWH A;  3BS1 A;  2EJF C;  4MHE A;  2WAC A;  3OW7 A;  4ZQ3 A;  4MIU A;  3NTI A;  1ESF A;  4KN7 C;  2KVM A;  4HAE A;  4CJ1 B;  1PMR A;  1UUP A;  3EVQ A;  3L7Z C;  2E2D C;  5BN3 A;  5KRU A;  1I4Q A;  3MXN A;  1I6V C;  2B2W C;  3K58 A;  1V8Q A;  2B2T A;  1H9M A;  5EKI A;  1F2Z A;  3S17 B;  4NP5 A;  1GXD C;  1EEI D;  3DHQ A;  1F2L A;  2NN6 G;  1HQR D;  4C3I G;  1CM9 A;  2F0O A;  1HCZ A;  2PW7 A;  2ZXO A;  2WIN B;  4P2C B;  1YNN C;  2XNA C;  2Q8T A;  1JE4 A;  3RD4 A;  1RDP D;  3ND8 A;  2KHS A;  5KNC A;  5JJZ A;  1G29 1;  3DMU A;  1LTR D;  4H13 C;  5IIF A;  2DN8 A;  2M00 A;  3QWN A;  1U9R A;  2K5Q A;  2L55 A;  1QCB D;  2F0L A;  2AUJ D;  1S5C D;  5EJW A;  2PW5 A;  1PRT B;  1EFI D;  2EVB A;  1TS3 A;  4F8M A;  4FXG C;  2EYJ A;  4K8J A;  1JWU D;  5JEA G;  1YNJ C;  4G7H C;  3MVV A;  1G2S A;  4WOR A;  1F2Y A;  2CW0 C;  4BA2 I;  3ZYY X;  4CJ2 C;  1CT1 D;  5K36 H;  3LWE A;  1TQO A;  1GUG A;  4K5W A;  2X6L A;  1NAP A;  4N9P A;  3VYS A;  2Q8I B;  1V1O A;  3PO3 B;  4HMI A;  3G6J B;  1AZQ A;  1TY2 A;  3A8I E;  1AW7 A;  2R3Z A;  3MXU A;  2B2V C;  3NUC A;  2VB3 X;  4IUP A;  1EY9 A;  4Z9C B;  2RSN A;  2MHV A;  2JP1 A;  1S5F D;  2AQ1 B;  1B44 D;  1OXT A;  4G7Z C;  1B2T A;  2AWO A;  2F0G A;  2N88 A;  4R9W A;  1HA5 A;  3J80 L;  4DN4 M;  3Q24 A;  2SDF A;  5C4H A;  4ABN A;  2EYF A;  4ID6 A;  1Y1V B;  4RAU C;  3ITP A;  3KLR A;  5EQ0 A;  1QNK A;  2QCP X;  4H0L C;  1ML0 D;  3DEP A;  1LTI D;  5JPM C;  3J7A V;  1SYD A;  1EY7 A;  3ERO A;  2A6H D;  3FRP B;  1UNS A;  5C0X G;  5FLX L;  2AUK A;  2X69 A;  3PUV A;  3HZX A;  1SMY C;  2KJX A;  1M8A A;  3BZD B;  3VR5 A;  1Q8I A;  1FNU A;  1ICW A;  3HP3 A;  1F2M A;  4ZUJ A;  2EDG A;  4ODG A;  4M1U B;  1A2T A;  1A3V A;  1DOK A;  3HOX B;  1Q1B A;  2Z4I A;  1LTG D;  1JB3 A;  4NKL A;  2EY5 A;  3L3O C;  3IFD A;  3ONA B;  4E6I A;  1U4R A;  1E2V A;  1SNO A;  2BA0 A;  2EYL A;  2FJ2 A;  5D3D A;  1DON A;  1LT4 D;  4KK7 A;  3NQI A;  1HQM C;  1ILP A;  4F87 A;  2L9H A;  1B9M A;  3MC0 B;  4U67 3;  1XYI A;  1EOT A;  1WTO A;  3SXH A;  5DEH A;  3SK6 A;  3DXJ C;  2JYO A;  2L0C A;  4DNT B;  3LX0 A;  1FR3 A;  2KQ3 A;  4DF7 A;  3PO2 B;  2JA6 B;  4KKS A;  1HHV A;  4DFA A;  1MD2 D;  3D8G A;  1OXX K;  5IGD A;  4LMQ D;  4J1M A;  1NR2 A;  1SYB A;  1LAC A;  1STE A;  3UI2 A;  2LS0 1;  5T1G A;  3TME A;  2RBM A;  1CZG A;  4RCN A;  4OL7 A;  1G2T A;  3SEB A;  1BBX C;  1FNV A;  2JEB I;  3R8B A;  3C46 A;  3D4R A;  3S14 B;  1WTW A;  4C2M B;  1BQQ T;  2JA8 B;  3GV3 A;  1U4M A;  3PIP 3;  1CI3 M;  1X3P A;  3TSS A;  2G9D A;  3MWY W;  1QIL A;  3M4Y A;  3J81 E;  4XYO A;  1SBB B;  1TS4 A;  5ISR A;  2K32 A;  1LLR D;  2F0E A;  3OOC A;  4HSP A;  1H9S B;  4CKE A;  1CQV A;  1E2W A;  5I2X A;  2F0F A;  1KNE A;  3NXW A;  1O78 A;  4KJN A;  4DK0 A;  2H1E A;  1F9Q A;  3K6O A;  1ET9 A;  3PUX A;  1SYF A;  2Z1C A;  1BCP C;  1JOR A;  1O80 A;  4C3J B;  2KCC A;  2F0W A;  3I3C A;  1VMP A;  3Q23 A;  2IX0 A;  1E2Z A;  4G57 A;  1RTN A;  1II3 A;  4HCE A;  4ZK9 B;  1G91 A;  3H94 A;  2XVS A;  1Q90 A;  1E0B A;  2PQE A;  4X3S A;  2J0T D;  2NUC A;  3DWQ A;  2F0M A;  1A3U A;  4KY6 A;  4RA8 A;  1U4P A;  4OO1 I;  5DM6 3;  2FMM A;  1I3Q B;  3NBI A;  3OPO A;  1KLU D;  1MGS A;  2L5T A;  4A3E B;  2VNU D;  3HOY B;  1LTA D;  4QCL A;  4RHR A;  4CKC A;  1PZI D;  2JA5 B;  3DEO A;  5DM7 3;  2F0S A;  2BE5 C;  1PTO C;  2K33 A;  4KKU A;  1PXU A;  2O5I C;  2D62 A;  1D5X C;  1PFN A;  5E3F A;  4C56 C;  5T1I A;  1X32 A;  4DNR B;  2RDG A;  4NDX A;  3NWT A;  1HFG A;  3M85 A;  2F0P A;  4N9T A;  2C5C A;  4XDX A;  3TZD A;  5I6Y A;  5EBD A;  1ET6 A;  2Z4H A;  2F0U A;  5C4X B;  1NCV A;  4S3S A;  2J4X A;  4PNY A;  4C3J G;  3OHX C;  5E4X A;  5A35 A;  2M9V A;  4OO1 H;  4I7Z C;  2GA4 B;  5CV5 A;  1G6Z A;  3A7L A;  1KNA A;  3IAY A;  4R8N A;  1RJT A;  4C1N K;  1FGB D;  1CHP D;  2B8G A;  1AZP A;  2K04 A;  2ICE C;  1EIH A;  3HOU B;  1BCP B;  4KY7 A;  1SXT A;  2IX1 A;  4DA2 A;  3RZD B;  2F0J A;  5C4Z A;  1Z7T A;  4ZRZ A;  4A3B B;  2JXM B;  5I6W A;  1K83 B;  1ZKO A;  3Q6S A;  2N55 A;  3R2T A;  5I2Y A;  4OIJ A;  3OIP A;  4ULL A;  1AEX A;  5C5L A;  4L8J A;  2MJ8 A;  4A3F B;  3RZO B;  3K0Y A;  3MTS A;  2I46 A;  2JSO A;  3BDC A;  4CKB A;  3NWS A;  3P7J A;  5J1Z A;  1A6X A;  3T56 B;  1HUN A;  1YNN D;  1D6E C;  3SVM A;  1BXT A;  4HSV A;  2CVR A;  4A3I B;  4KKT A;  1ZXT A;  2HQE A;  3CKI B;  4B08 A;  1I50 B;  1OO9 B;  4RGO S;  1JOO A;  3S1M B;  1IL8 A;  3PMF A;  2WII B;  1UAP A;  2E75 C;  1EYC A;  5EPJ A;  3RLF A;  4RHS A;  4BY7 B;  3R3O A;  1SYE A;  4HMJ A;  4IFD I;  1PYW D;  4FF2 A;  3KF8 A;  1YNJ D;  4K2K A;  3FPU B;  2CW0 D;  1ROD A;  2NTT A;  4IAL A;  4CBV A;  2B2Y A;  1A2U A;  2XN9 C;  4J8Q A;  2QEJ C;  1FYC A;  2BDN A;  4KY5 A;  4EQO A;  2WKD A;  4X3T A;  4ZYS A;  4PV1 C;  1TWA B;  3GTL B;  3SHL A;  3A56 A;  1J9O A;  1AFP A;  3BVM A;  2B63 B;  1T5X D;  1S4Z A;  4L63 B;  1SAP A;  2PZW A;  4K8I A;  2RSO A;  1O7Z A;  2R93 B;  2K03 A;  2HDM A;  1I4H A;  2JEA I;  4A3K B;  4IFD H;  1DYQ A;  1EL0 A;  3QOJ A;  3MXP A;  2QDB A;  3D3R A;  1EY5 A;  2D9U A;  3HGB A;  3QJY A;  4WJW A;  2TMP A;  2C9O A;  3TN2 A;  1TS2 A;  1XWE A;  5E4W C;  1R4P B;  5IOD A;  2B39 A;  5DNF A;  2A74 C;  4LK1 C;  4XXE A;  5JVG 3;  1D1I A;  1A15 A;  3IFT A;  5IGC A;  1QE6 A;  3I8Z A;  1BNZ A;  3KLS A;  4EQN A;  4QMG A;  1C48 A;  4PMW A;  3MZ5 A;  3HRZ C;  2L4N A;  1SMY D;  5FK9 C;  3KBG A;  2FHT A;  1GUS A;  2QKI C;  1EWC A;  2IX3 A;  1BDO A;  2E2H B;  4ZUI A;  2K05 A;  1EY6 A;  1T5E A;  3QG1 A;  2IPK D;  1DOM A;  1SNM A;  5F2D A;  4K2L A;  3K5O A;  1TII D;  2ID0 A;  4RKL A;  3H91 A;  1KAB A;  1KDA A;  2G9H D;  4XYQ A;  2RDF A;  3NBH A;  1SYG A;  3OSO A;  2F0H A;  3T53 B;  2PZU A;  2B2W A;  2MP1 A;  3MA2 B;  1A3T A;  3H09 A;  1D5Z C;  3S2H B;  2TSS A;  1VMC A;  4RGN A;  2CHB D;  1IKM A;  2XWB B;  4U68 A;  1WD0 A;  3PUZ A;  3CQZ B;  1CA6 A;  3X3N A;  3GTJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...