1U4MA

Human rantes complexed to heparin-derived disaccharide iii-s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Attractant
molecule keywords Small inducible cytokine A5
publication title The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u4mA00
1NR4A 3D6WA 4X3TA 3LWEA 1HFNA 1ZXTA 1G2SA 2DY8A 2X6GA 2CVRA 1WTXA 3R93A 5JJZA 2L11A 1MSGA 4U68A 4ZKBB 2SDFA 4ZKCB 1F9RA 5T1GA 4OIKA 1BF4A 1QE6A 2RSOA 5EPLA 1B4OA 2VXWA 1C8CA 1BBXC 1WTWA 3DM1A 2MPMA 3I8ZA 4X3UA 5EKIA 1WTPA 1IL8A 2RA4A 1HUNA 2HCCA 2N55A 4XT1B 1J8IA 2Q8TA 3MWYW 2B2UA 2FJ2A 4XT3B 1JICA 2R3ZA 3TZDA 2K05A 5T1IA 1RTOA 1MSHA 1U4RA 1B53A 3KBXA 1O7YA 1U4MA 2HDLA 2L1BA 2RSNA 4HSVA 4NW2A 4RWSC 4ZK9B 2B2VA 2KEDA 1CA5A 1F2LA 1AZPA 2FINB 2MJ8A 3GV6A 1B2TA 2B2TC 2JYOA 4MN3A 2RVLA 1WTVA 1HHVA 4QUCA 4RAUC 3DEPA 3I3CA 3H91A 2Q8RE 1EIHA 1ICWA 2L4NA 5CORA 2B2WA 3F2UA 4RA8A 1DZ1A 1HFGA 3Q6SA 1U4PA 2K01A 2J7ZA 1XX8A 2L12A 1G6ZA 1BO0A 5EJWA 2FFKB 3FDTA 1CA6A 1F9QA 1NCVA 1O80A 3UI2A 1RHPA 4QUFA 4IUVA 1XYIA 1WVLA 2K1BA 2NYZD 4X3SA 1KNAA 2X69A 1G91A 1F9SA 1LV9A 1MGSA 2KVMA 1IKLA 5COYA 3P7JA 1DOMA 2HDMA 1RTNA 1HRJA 2L9HA 1BNZA 1J9OA 1DOKA 2N88A 4ZAIA 4IURA 1SAPA 2X6LA 1S4ZA 1EIGA 4R9WA 4IUQA 1DONA 4X3KA 1JE4A 3DEOA 1PLFA 4CJ2C 1X32A 4CJ1B 4IUPA 2B2YA 3G7LA 5E4WC 3KUPA 3FPUB 1RODA 3IL8A 2B2UC 1MI2A 4OIJA 4DN4M 4CJ0B 1WD1A 1AZQA 1ILPA 1WTOA 3SVMA 1G2TA 1A15A 1U4LA 1X3PA 1SSOA 1F9PA 1DOLA 1TVXA 4IUUA 2HUGA 1WD0A 1HUMA 2KOLA 3TN2A 4UAIA 1M8AA 2B2VC 1B3AA 4R8IA 2M2LA 1GUWA 5AFWA 5E4XA 1ESRA 4HCSA 5CMDA 2FMMA 2B2YC 3ONAB 2HCIA 5EPKA 4MHEA 1KNEA 2KEEA 5D14A 4ZLTF 4LMQD 1PDQA 4XDXA 1X3QA 2B2WC 2K28A 2EE1A 3HP3A 5CBEE 1NAPA 1NR2A 4IUTA 4O42A 2K04A 2XIWA 1RJTA 1QNKA 1ML0D 1PFBA 2BDNA 1WTQA 1EL0A 3IFDA 1E0BA 1O7ZA 5EQ0A 1PFMA 1Q3LA 2JP1A 1PFNA 2B2TA 1EQTA 1B50A 2KUMA 2D9UA 2MP1A 1SDFA 2EPBA 2MGSA 4HEDA 5DNFA 5CBAE 2DY7A 1IKMA 3I90A 1ILQA 3MTSA 2K03A 3QO2A 2H1EA 5EPJA 2KECA 3GV3A 1AP0A 1CM9A 3N52A 3I91A 1QG7A 1VMCA 2EOTA 1VMPA 2IL8A 2FHTA 2NWGA 4HAEA 1HA6A 1WTRA 2NZ1D 1EOTA 5D65A
chains in the Genus database with same CATH superfamily
3LWEA 2X6GA 1MJCA 2PQEA 3J7A5 4AH6A 1K0RA 1BBXC 2VXWA 1E2WA 1DJRD 2E5LQ 3NENA 4APVA 1EFWA 2K33A 2UXBQ 1QOHA 4X6AH 1EU3A 1RIPA 3FKIG 2OXPA 5ELNA 2K05A 3E6ZX 3IFTA 4LFAQ 3MXNA 1B53A 4JI1Q 2HDLA 4ZK9B 4RWSC 1VQKA 2B2VA 1X56A 1S40A 2MJ8A 4DR1L 5C4XG 4HIMA 1UE6A 1WCMG 1SR3A 5I9PA 4J15A 3U9OA 5CORA 1MHWC 1YBYA 4RA8A 1XJVA 2AMCB 1BCPB 1QCBD 4C2MH 4A3DB 3K80C 1JWSD 2F0WA 4KY6A 4RH6A 4H44C 5EKKA 3TBIB 1MIUA 2CFMA 2OT2A 4LUVA 2R61A 3K7UC 3PQIA 1DOMA 1Q90A 3PO3B 4IURA 4LUOA 4YCUA 4IN3A 2WP8J 5C44G 1FYCA 1GXDC 3RZDB 1S5BD 1X9NA 5BR8Q 3CCUA 5IYDH 1WI5A 3NTKA 4IUUA 2EVBA 4GNXC 4FVMA 1KLUD 2RDGA 4F7XA 1ET9A 3SXHA 5JJLA 5D3DA 3TP5A 3SR1A 5LHY1 2DUDA 3NHHA 3E5SA 2F4VQ 5BN4A 5EPKA 2JQOA 5D14A 1GD7A 3KF6A 3A8KE 2KHSA 4DFAA 3T1HL 1VQ6A 4C3HH 5K36G 4QCLA 2R92B 2B2TA 4UPAA 1JOOA 3MXPA 4X62Q 4KN4C 3MXGA 3STBC 4C1NI 3I90A 4K0KQ 1K3BC 1V9PA 3OIPA 4BBRG 2BDOA 1VF7A 1SEBD 5M3MH 4J6HA 2UUBQ 3TZUA 2VUMG 3GO5A 3K58A 2FXQA 4RFBA 1LTBD 2K50A 4NP5A 2R93G 3I56A 1K0SA 2LS01 1Q81C 2A73B 4X3UA 3PUYA 2O4XA 2XWJB 5ELCA 2CH4A 1SYCA 5EKLA 1YI2A 1GVPA 1SYBA 4A3MG 1CKNA 1O7YA 4DK6C 4JV5L 5DAUA 4HR7B 2K14A 4IZ8A 5FO8B 4DV3Q 2VQEL 2VZAA 5HURA 2IPKD 2ZXRA 4DKAC 3DEPA 5C0XH 2JE6I 1OO9B 4YWKA 2QKIC 2ZTDA 4B3ML 3GTKB 1U4PA 1F2ZA 1W6JA 5F2DA 1F9QA 3UI2A 1JJCB 4X65Q 3IKJA 4HSPA 1STHA 3A8JE 2WKDA 1FJGL 1ONLA 1R4PB 4GKJL 4K2LA 5JEAJ 2GA4B 3I4OA 2N88A 3NXWA 3T1YQ 5FLXE 1PRTD 4DUYQ 3H3VI 1UE7A 1TR5A 2C9OA 1KHIA 4S3SA 4K8IA 1BVSA 3A55A 3SK8A 1FNUA 1PH2A 1LYLA 3PUVA 4YY3Q 1SFOH 3CC7A 4POFA 1D2BA 5C4XH 1CQVA 1WCMH 1PH4A 1WJJA 4NXML 3KF8B 3S2HH 1KC8C 1XWEA 4N9PA 1TIID 3DXJC 1NJIC 2EE1A 5CBEE 2F0JA 2NVQH 1RJTA 1QNKA 4O0AA 5EQ0A 3QIAA 1H9KA 3GTQB 5IP9G 1Q3LA 1BCPD 1CI3M 2EPBA 3BZCA 1N32Q 2Z4HA 3F1ZA 3VR4A 1XPRA 4IQZA 3QJYA 2H1EA 1O7IA 5C44H 3BYTB 4L8JA 4DV7L 1VQBA 1GUGA 2WINB 4DV0Q 4XYOA 1Q86C 2RF4A 1LT3D 3CW2C 1KDAA 2KQ3A 3A74A 1HA5A 2DY8A 1HNZQ 3CC2A 4ZKCB 4F87A 4A3CG 1E2VA 2F0SA 4M8AA 5CR3A 4CBVA 4XIGS 3KF6B 3CRLC 1TWGH 1SNQA 2A68C 1Z47A 4NB3A 3Q23A 4B08A 2Z0SA 3FKIB 4KD4A 5LMUQ 1D1IA 1KAWA 1AFPA 3CCJA 3PF4A 1YHAA 1F2LA 1B1ZA 4JI2Q 1YNJD 1K83B 4LFCL 1WTVA 1E1TA 1WCMB 3WDNA 5IT9E 2EYPA 1CT1D 2DJGC 4UP9A 4PQXA 2RQXA 2J7ZA 2L12A 2NVQB 3NEMA 2VUMH 1D1KA 5J1ZA 1AEXA 2F0UA 1RHPA 4KKTA 1IW7C 4UY8C 1VQOA 3FP9A 2UXCQ 3BZDB 1PA6A 2WKCA 3Q24A 1PH5A 1CHPD 5C44B 1ASZA 5IT9L 1E22A 4G4KA 4C3JG 4X3KA 2AWOA 4B3TQ 3PIOA 1VQ8A 1CKNB 2KCNA 3SK4A 3IL8A 5CYUA 5CV4A 3KFUA 4A3MH 1R4QB 2B29A 3H3VC 2JA6B 5C4ZA 1PH3A 2F03A 2BH2A 1SLJA 5HGQA 1K73C 4E6IA 1A2TA 1CZGA 3SEBA 5DM63 4DV6L 2WB1G 4FO2A 4G7HC 3S24A 3K8AA 4PV1C 2F3WA 5KYLA 3H0GB 2LY7A 4DV1L 4K14A 3DLLA 2K04A 4G7OC 1XMOL 1SBBB 2I46A 2BE5C 1IYJB 3NBHA 4UHVA 1EQTA 2MGSA 1KABA 1YVCA 2EYHA 1VQNA 3K6OA 4BBRB 5ELBA 3KDFA 2PW7A 4IFDJ 1Y8PB 1VQ5A 2IX1A 1I6HH 2KA7A 2K75A 4QIWE 2QEJC 1ZXTA 5G3LF 4R4CA 2H4OA 2CVRA 2F0TA 3GTOB 2R93B 1V1PA 4JYAQ 5FO9B 3RZOB 1KL9A 4QGUA 2RSOA 5EPLA 1B4OA 1H9JA 4KKSA 4A93G 1T9HA 1U0LA 1X3GA 2N8NA 2F0HA 2E2JH 2DJFC 2D0OA 5C3XA 5IIFA 5IGDA 2MHVA 1OTCA 5KEEA 5NUCA 2NTTA 3P75A 1JMCA 1N9WA 1STAA 3V2TA 2QEXA 1XXGA 4C3IB 1TWFH 3D4WA 1B7YB 3LGJA 1UAPA 1ICWA 1XTDA 3LX0A 4BWGB 1QZGA 4XXEA 1SYGA 1SMYD 2GVBA 3S1RB 1WYDA 1M4VA 1A3VA 4DR3L 3W3AA 3R8BA 4ULLA 1LV9A 4GKKL 1PFSA 4YCWA 4LFBL 4A3CH 1BNZA 3VYRA 1DOKA 4R9WA 2I5MX 4TSSA 1F2MA 2YU9H 1XPOA 1I6HB 1Z6HA 5KGUA 3W1BA 2F0MA 1YNXA 3G4SA 1SMXA 4DNRB 3OSOA 2O5IC 1B3AA 1GKHA 4N8X1 4Y7NB 4A3DG 3RMHA 2CW0C 1TY0A 1J6QA 2B2YC 2ZJRA 2I5LX 1RKNA 4JV5Q 1EQRA 4ZLTF 4A3GG 3AYHB 4A3KG 1H9RA 1X3QA 2B2WC 3KLSX 4LAAA 5E7NA 3PSIA 3PO3G 4OX9L 2JA7B 1BBWA 1TXYA 5HY6A 4KK7A 2JJQA 4KJOA 3KYHC 4BY1G 3HRZC 1EQQA 2L15A 3S14H 2B39A 4HEDA 4H7BA 1TWFB 5CBAE 3NP8A 1B44D 4DR5Q 2GVAA 4C3JH 1AP0A 4O2DA 1STBA 1FJGQ 1PZJD 1CSQA 4GKJQ 3PO2G 3J80E 1FR3A 3CCEA 3PGZA 3S16B 4FXGC 4DU9A 5E1FA 4C1NK 1CHQD 1WFQA 1HPCA 2F0DA 3R93A 2PW5A 2KJXA 4GLAC 3KOJA 4AQYQ 1K8GA 1RCVD 4O1NA 2Y0SE 4BBSB 4HIDA 2RA4A 4MZ9A 2R92G 2HCCA 2N55A 3N6RA 3NWSA 1YHQA 4B9WA 3NPPA 1BCPC 1TS3A 2WB1E 4DR4L 2LXKA 3K0XA 3J80L 2NVYH 3S2DH 2L1BA 3NBHB 2EY1A 4NXMQ 3S15H 1EIFA 4DF7A 5M5YH 3PMFA 1OXTA 1Z7TA 2DNCA 4DV5Q 4DAMA 2WACA 2L4NA 1IYVA 3CCMA 3F2UA 3GP7A 3RUZA 5EJWA 2FFKB 3FDTA 2K4KA 4JI5L 3FPPA 1V1PB 3ICEA 1XYIA 4KLKA 4IUNA 4B3RL 4KI0A 4X66Q 1L1OA 3CCVA 4FF3A 2R7DA 2HDMA 2L9HA 4A93H 2X6LA 1LT4D 2E2HH 4C3JB 4RGTA 1DONA 4PMWA 2Z6KA 3S1NH 1VQDA 3GTJH 2F0VA 3K81C 1RODA 4JI0L 1YNJC 4LF9L 2A6ED 1WTOA 4A3JG 3SGIA 1A3UA 4A3FG 2K52A 2RCNA 1D5XC 2J0TD 4R8IA 1ASYA 1IBKL 2HQEA 4RHSA 3HOYG 2WB1B 2HCIA 2PI2A 3SHLA 4PZ8A 1N33Q 5LMNW 4OHJA 2L55A 4LFCQ 3W1GA 3L2PA 5CV9A 5FLXc 1JR0D 1YJNA 2VNUD 3I2ZA 2EJGC 5IGEA 2E8GA 2WFWA 3F2CA 2K5NA 4P74A 1VS0A 3K7AB 3T13A 3HGBA 1ENCA 1W3SA 3M3YB 1OXSC 3BG3A 4PMCA 2B63B 2EYMA 3T53B 1L0XB 1PH8A 2D0PA 1H95A 1NR4A 4X3TA 3Q0AA 3J7ZC 3HOWB 4MTKA 5C3EG 2XN9C 4ILWA 4U68A 4BY7B 4A3DH 1HH2P 1YZ6A 3SK5A 3K59A 3NWTA 3HS0C 3HEJA 3HKZG 5FK9C 3ZYYX 1ET6A 1HUNA 1PTOD 4XT1B 2XNAC 1B8AA 3QWNA 3PCOB 4XT3B 3FHWA 1TS4A 4CKEA 3PO3H 3FRPB 1EWIA 4P75A 3TS2A 3RZDH 4HJ7A 1EY4A 4DV6Q 1XNQQ 2KEDA 3GTGB 4TQUS 3F8TA 4MIUA 3GV6A 1IBLQ 1KXLA 3MFYA 4QUCA 2Q8RE 1PRTB 2EXZA 4EGVA 3TDQA 1HNXQ 4HMIA 1V1OA 3PUWA 2LSSA 1EUJA 1CA6A 4A3EB 1O80A 4K5WA 2KCTA 5JVG3 1KNAA 4FXDA 1SROA 5COYA 1I4PA 1O78A 4K2KA 3KLSA 3J7AV 1A6XA 3SK6A 4LF6L 1S4ZA 3D8GA 2PZTA 3DWQA 4I7AA 5JEAG 2R92H 4IUQA 1D6EC 1JE4A 2HIVA 2IT1A 2DN8A 3H09A 3C2PA 4GOPA 4V190 1OXUA 3BDOA 1EYDA 4P72A 5CV8A 5IT9c 1X3PA 1IYUA 1E24A 3CD6A 3PUZA 3K5MA 3ULPA 2M2LA 2WIIB 5AFWA 2L0CA 1TKWB 1VQ9A 4DNTB 4BS9A 3PIPA 4A3GB 2VS1A 4RKBA 4A3KB 2TSSA 4LF7L 1PZKD 5J39A 1NAPA 3MHBA 3OHXC 4BY1B 1L1OB 1JORA 1DXMA 2JP1A 2NVXB 3MZ5A 3CQZH 1UUPA 2UU9L 1A2UA 1XNRQ 4FP5D 1HNWL 2QGQA 3RLNA 5KNDA 2JA6G 4QMGA 2KECA 5I4DA 1J5EQ 1CTMA 3PO2B 1QVCA 1VMCA 1VMPA 1I4RA 4UAIA 5GADC 4R4OA 3MAQA 3GTKH 4A3FH 1JOKA 3A5UA 5LMNQ 2L11A 3H0GG 2B8FA 3ND8A 5KNBA 1FGUA 3GDEA 3GTMH 1NTGA 3R2TA 3HOYH 4JI3L 1JWUD 1Y1VG 2QDBA 5DLQE 2VQFL 5H1SE 2EQSA 4LUZA 4N9TA 3U50C 2A8VA 5C4HA 3HKSA 3QR8A 4ABNA 1MSHA 4GNXA 4L5QA 4Z9CB 4YWMA 1FD7D 1EY7A 2Z9HA 1P16A 1VQHA 2JYOA 4JI4L 5KYIA 3AU7A 1IBMQ 4ZYSA 1GUNA 2K6AA 4G7ZC 4ME3A 4EQPA 4MTNA 2MFIA 2AWNA 1GUOA 5C3EH 1G91A 3A56A 1BDOA 3CQZB 1IKLA 1HR0L 1L0YB 1RTNA 1EWHA 4ZAIA 5CC4A 3GTQH 1D7QA 3UE1A 1TQOA 1R9TB 3KLWA 2IY5B 3I4MB 4C3IG 1GHKA 2B2UC 1AZQA 2A1AA 3HKZE 4A3JB 4ME5A 5C5LA 2UUAL 1TWCH 1QWYA 4RGMA 2JA8G 5C0XJ 4A3FB 1DOLA 2JXMB 4YHHL 5I2YA 2EJMA 5IODA 3GTMB 1HTLD 3HOYB 3TMEA 2ZJQA 2D62A 1PYWD 4XDXA 2E2DC 4KHPL 2K28A 4YIJA 3HOZB 1SE2A 2RDFA 3CMAA 4RKLA 4DV4L 1KDCA 2F3VA 3L0OA 4H02A 3UDXA 3ERQA 3MXNB 3FKIH 4JI6Q 2UXDL 1VDZA 2OWOA 1YJ9A 3QO2A 2A6EC 1EY6A 5JEAH 1LTGD 1V1QA 4KMUC 4A3IB 4GOPB 1K83H 2CCZA 2YTVA 4B9XA 4DR7L 4AYBB 1CUKA 4OWWB 4IFDG 2ENBA 2NZ1D 5C3EB 3GTLH 1G6PA 2HIXA 1V43A 2JA7G 2C5CA 2B8GA 2SDFA 3DUZA 4I7ZC 3ZJYC 4RCOA 1S3OA 3M7NA 3HKZB 2SOBA 1N34Q 1TWHB 4LWCA 2A6HC 2Q2TA 1EOVA 5GQOA 2C35B 1VQFA 5A35A 3PUXA 3IAYA 3OWFA 1BCPF 1TWCB 2Z4IA 4RG1A 4IPCA 5IOCA 4HSVA 3NQTA 1EIYB 5ELDA 2JA5G 1SXTA 4A3BB 3J80c 2N49A 2JA6H 1ZYRC 1FVIA 1YHBA 2IW3A 2Z6BA 3OIQA 5A2QL 3S17B 1PMRA 4H0LC 4JC0A 1EIHA 1I94L 2TMPA 2IWHA 1PH6A 1EWCA 2VB2X 4K8JA 5JAVA 2QW7A 1CSPA 1DD2A 4OO1G 4QUFA 1Y1WB 4BBSG 1WVLA 2K1BA 3SDZA 2CHBD 3H0GH 5JOBA 4LF8L 1VQ4A 1EEFD 1QZHA 3P7JA 3GTPB 5K36H 2OQKA 1SAPA 1Y8NB 2NN6G 1U5KA 4DK3C 3E9HA 3CMEA 1Y14B 3TS0A 5E4WC 1K8AC 1MI2A 4BBRH 3CXCA 1A15A 2GN5A 2F0FA 1SSOA 3GTLB 5KIXA 1AE3A 1A3TA 3AEVA 2EYOA 3RR5A 3GTOH 2R93H 1OXVA 2KEEA 3RZOH 1UEBA 1Q12A 4L5TA 3M4OB 1BXTA 3HOUB 2XIWA 3HFZB 2BDNA 2XRQD 2VL6A 3EIVA 4K6LA 1IXRA 1EFID 1JB3A 3ND9A 2OTJA 2YTYA 2DY7A 3CU7A 3MTSA 2K03A 1EYGA 1ENFA 4HJAA 3AMUA 3ULLA 3VA7A 5EGTA 1D5ZC 4C3IH 2BH8A 3EBEA 2F1MA 2MNAA 2RKSA 3R3OA 1EY8A 3C1FA 1EOTA 4FF4A 2QF7A 2I07B 1GM5A 3NE5B 2K32A 3NELA 4DR1Q 5JJZA 3S1RH 2NB0A 4ZKBB 1F9RA 4JI7L 4ZCKA 3WOEA 1Y1VB 3E3XA 1BF4A 3CRKC 3MVVA 5BN5A 5M3FG 4DR6L 1IL8A 3D0FA 3RNUA 2XSCA 3HOXB 4P71A 3M9BA 3J80i 2R7ZB 1CKMA 1CA5A 1X6OA 3EFXD 2B63G 2P5ZX 3BS1A 4UP8A 1LUZA 4L5SA 3HOVG 4EQOA 4B3SL 4KHVA 3HOWG 1MJEA 4OXPA 4Y7NH 4BY7G 4IFDH 2V1CC 2UXBL 5C6AA 3T4AC 1FNWA 4LFAL 4CDCC 2KHIA 4X64L 2F0EA 1MGSA 2IJ0A 3A5ZB 1BQQT 4JI1L 3G6EA 2JA7H 1K8MA 1EEID 1IL2A 5IP9H 2CQAA 1JCKB 2AKWB 4J1MA 4IPDA 3TP7A 3T56B 1B70B 3DEOA 2F4IA 3PV0A 3G7LA 3J81E 1STEA 3OTOL 5AJ3L 3T1HQ 2JA8B 2A19A 1SNOA 4L5RC 2JA5H 2HUGA 2VQFQ 1LACA 5LL6X 1GUWA 3S16H 1STNA 4WFN3 4A3EG 1X3EA 2N3SA 1JE5A 1V8QA 2PQAA 1AE2A 3J81L 4JOIC 4BBSH 1BKBA 1E0BA 5BR8L 4HJ5A 4OGQC 3X3NA 2D9UA 2LMCB 2AUJD 3S1QH 1VQPA 1ILQA 2A74C 1JJ2A 4ZQ3A 1NSNS 2Q8IB 1PTOB 1KQSA 2F4VL 3OYYA 1E3PA 1UE1A 4KY7A 1HA6A 5C4JB 5J22A 1KLGD 3U4VA 1G2SA 2VQEQ 1GOZA 4WORA 2EY6A 2G5DA 1SE8A 1SNPA 5IGFA 4X62L 2HT1A 4B3MQ 1HQRD 3D3RA 1VQIA 1PRTC 3HZXA 4YHHQ 3OW2A 4K0KL 1HZ9A 4RMFA 2R3ZA 1Y8OB 2PCFB 2XRSD 3KBXA 2JA5B 3ULJA 2UUBL 1BUVT 2XGTA 1NMFA 3T16A 1UNSA 2NZHA 3AFPA 1HHVA 3EJIA 3AFQA 1B3QA 3CPFA 1HZBA 1S5ED 1SYFA 2E74C 2B2WA 5IYBG 4JBWA 1P8LA 3Q6SA 1NY4A 2RHSB 4OL7A 1PH7A 3V05A 1XX8A 3S1MB 1G6ZA 1BO0A 1AN8A 1WOCA 5IWAL 2NTSA 2ZM6L 2X69A 4CDEC 3I72A 1F2YA 2F0PA 1DGSA 4DR7Q 2XTIA 3S1QB 4JI8L 2G9DA 4H13C 1ENAA 3CAMA 5M3FH 1NBWA 3KDFB 4CJ1B 1QUQA 1EZ6A 1G51A 2ZT9C 4GS3A 4OWTB 4K6DA 3FEWX 4QY7A 3K7AH 2I0QA 1B9MA 3CCQA 1L1OC 3M3YH 3UE0A 3DWAA 3TQYA 3A0JA 4DA2A 3J7YW 2B63H 4PNYA 1E1OA 4X65L 3HOVH 3AB9A 1QJOA 2ZTCA 1HZCA 3HOWH 1NMGA 4DV7Q 5FOBB 3ONAB 1YIJA 4LMQD 4OELB 2F3IA 4RCNA 4BY7H 3V96A 2O5JC 4DUYL 1G291 1CK1A 2RCFA 2ASBA 3M7GA 3I70A 4DK0A 2LXJA 1SRUA 1PFMA 5FLMG 4IJLA 3I4MG 4YY3L 5IP7G 1I4XA 2HHHL 3GTGH 2RBMA 5IYDG 1X3FA 2JN4A 1RD9D 1YNND 3GD7A 2B3GA 1WTRA 4XQNA 4CHTB 2F0KA 3MA2B 1VQEA 3WOFA 2PYKA 2E2IH 1SN8A 2EJFC 5I6WA 3HOZG 1SNCA 5K5PA 4A3EH 3CCSA 1RDPD 2K7VA 5GAHC 1N36L 2D5DA 5M3FB 1C4QA 4AIMA 4NXNL 1T5XD 1TWAB 5FO7B 4ID6A 3M85A 3ER0A 4FDBA 1QVGA 1PH9A 4DV0L 1U4RA 1SNDA 4A3IG 4NW2A 1WTHA 3TP6A 2WAQG 3G6JB 4AYBG 2MO0A 3HOVB 3DWPA 4IOCA 1EY0A 1SYDA 1HNZL 4RAUC 1C9OA 3I7FA 5E3FA 1TT2A 5CGKA 1N8RC 3OW7A 1RF2D 4QL5A 3H6MA 4TRDA 5JVH3 3OOCA 5M5XH 4A3GH 4A3KH 2LKVA 4BA2I 5FJ8G 4NMZA 1I5FA 4EVOA 5LMUL 1JOQA 2NVTB 2KVMA 2UUCL 2G9HD 3OPOA 3TP8A 4F8MA 4BY1H 4JI2L 4XYQA 4XQJA 4FXKC 1DCZA 4A3BG 2NVXH 4YCVA 4JG2A 1VQLA 4DV1Q 3CKIB 1XMQL 3R2IA 2A68D 4EQNA 1XMOQ 4ODGA 4DN4M 1WD1A 1JC7A 3JAME 5JPNC 2PPBC 4P2CB 1A63A 1WD0A 1TVXA 2E2IB 3PO2H 4POGA 2B2VC 1L0WA 3VYTA 5C0XG 3BJUA 3BDCA 4OONA 1Y1WG 2UXCL 1AH9A 2EYJA 1ESRA 1LABA 3MFGA 2R6GA 4HCSA 4LJZC 5EAYA 3U4ZA 5CMDA 4A3LG 3NUCA 5IYBH 3T51B 3F2BA 3D4RA 4B3TL 4O42A 4B3SQ 1WTQA 1ML0D 3D4DA 3JAML 3H94A 1O7ZA 2PI2E 2F0LA 2BOSA 5EBDA 4C56C 1IW7D 1GJXA 2WV6D 1LTRD 3VR5A 3KK7A 1SDFA 5D3IB 3DMUA 3I73A 2LFNA 1QUQB 4FF2A 3VYSA 1KAAA 1Q8IA 2FMCA 2R7FA 1HCZA 3I4NB 1SMYC 4BA1I 4X64Q 1SYEA 2EOTA 5M5XB 1BOSA 2NWGA 4KN7C 3TEHB 2SNMA 3BZKA 1T5EA 4DAYA 1LO5D 3G48A 1QVFA 1I50B 1MSGA 3ITPA 4KJNA 3OTOQ 4DAPA 3HOUG 5AJ3Q 3G71A 2JEBI 3MEFA 1TS5A 2KENA 3KF8A 2AQ2B 1ZEQX 1S5DD 1Q46A 2AQ3B 5DM73 4I65A 3TZDA 4LF4L 3E0JA 2KBNA 5ELEA 4DR3Q 1EY5A 1R9TH 3D31A 4GKKQ 5FLMH 1XTCD 3I4MH 4LFBQ 2BE5D 5M5WB 2HQLA 1EY9A 4A3JH 1KRTA 2B2TC 2AUKA 4JYAL 4JW0A 5IP7H 4N8FA 3VYUA 4A75A 1PH1A 4RGOS 4ZUIA 1LTID 2Q2HA 5JJKA 3MEHA 3I4LA 2JA9A 2M00A 5TSSA 1S72A 1YJWA 4DV2L 3HOZH 3W2DA 4ZRZA 3HOXG 1LTLA 2DNEA 4IO9A 4GLXA 1G8ZD 4DR2L 2F0NA 2R7ZG 3U58A 3K5NA 1W2BA 4OX9Q 5ISRA 4WJWA 3KUPA 2QDLA 3BU2A 1C48A 3MC0B 4A3IH 4WRDA 3O13A 5IGBA 2YTXA 4OWXB 2EY5A 3P1HA 4DUZL 1KTKA 4IFDI 5E4XA 2NZOA 3SE0A 2WAQE 4AYBE 3L7ZC 1H9SA 2ALYB 1CQFA 4C2MB 2ICEC 1HQMC 1I3QH 1KIXA 3P20A 1EU4A 1XPUA 1LT5D 3VR2A 1NR2A 1LTTD 2YV5A 3NTIA 3RLFA 5FJ8H 1UEAB 1TWHH 2F0OA 2L5TA 5IE8A 4NDXA 2NBFA 1PFNA 3J81c 3K5LA 2MP1A 4EQ5A 3KLRA 4HN7A 5IGGA 4A3BH 2A69D 2XVSA 5IWAQ 2ZM6Q 2EIFA 3BVZA 4JK1C 4IOAA 3EROA 5CV7A 3BVGA 4DR4Q 5J3BA 3S17H 4LNQA 2FHTA 2KCMA 1NE3A 3EN2A 3B6YA 2EYLA 1UE5A 2D2CC 4JI8Q 3U9SA 4DGZA 5EBCA 4UP7A 2O2LD 5T1GA 4OIKA 1Y1WH 3M4YA 4FYDA 4A3LH 4OO1I 1LLRD 3E9IA 2CW0D 5EKIA 3TRZA 1PRTF 3W5OA 3S9WA 4DR5L 1A62A 2B2UA 2FJ2A 4G57A 4C3HB 4JI5Q 3GTPH 5GAEC 1KD1C 3C1EA 2CQOA 3CP0A 3K0YA 1JWMD 1M1KC 4B3RQ 4CKCA 2NN6I 2WAQB 1EZ8A 3RN5A 1AZPA 3CCLA 1B2TA 1JB7A 1GO3E 3M4PA 3X3MA 1BR9A 1YNNC 2F52A 5M3MB 3MXUA 4NPSA 1O7LA 1GUSA 4L6TB 4AQYL 1DYQA 1GHJA 1VQCA 3EVQA 2H5XA 4JI0Q 1I3QB 5A2QE 5IGCA 4LF9Q 1SJHD 1Z9FA 4QJFA 4DAYB 1E2ZA 5CV5A 4LK1C 4WJ3M 4R8NA 2E75C 2HHHQ 1ICFB 2RHQB 3RLOA 4R4QA 2AHOB 3M4OH 1D5MC 1L2FA 1IBKQ 5FLXL 2EYFA 3HOUH 2IHEA 4KHZA 5ELOA 3EQLC 2J4XA 4HCEA 1C7YA 3CPWA 4DV5L 3OMGA 3SVMA 1II3A 4HJ9A 1N36Q 1G2TA 1F9PA 1PV4A 5FKAC 4NXNQ 2KOLA 1CFMA 2K5HA 1SE4A 2Z8LA 3I55A 1DM0B 4IPGA 1MKHA 2ZXOA 4X66L 1IHZA 1PTOC 5I6YA 4GN5A 4UDUC 1W6KA 1Y1VH 2PZWA 3DHQA 3CC4A 3CF5A 1TY2A 3D6CA 1PFBA 1S5FD 4LF5L 3J81i 3CHBD 4GNXB 2BA1A 3HOXH 4HIKA 2OF1A 2OTLA 1LT6D 4ALPA 3KJPA 5DNFA 5DEHA 2R7ZH 4HJ8A 2KCCA 1VQAA 2EDGA 1HR0W 4A76A 1SFOB 2UUCQ 2SNSA 1N33L 1SE3A 2I5HA 4DXGA 5C4XB 3L9AX 2IHFA 1EQVA 4GN4B 1WTXA 2IX0A 2OCEA 2PZUA 1XMQQ 3NQIA 3S2HB 3A54A 3J7AF 1B9NA 4CDDC 1H9SB 1QE6A 1C8CA 3OMCA 1WTWA 2YYZA 1WTPA 3I8ZA 4PG3A 1K28A 2SEBD 2Q8TA 1JICA 2ZTEA 2PNRC 3NK9A 1NNXA 2ICIA 3ERSX 1VQMA 1A0IA 2QA4A 2JA8H 4R1JA 2ZXPA 4MN3A 4LF6Q 2RDHA 2VY3A 2BA0A 1I4QA 3Q22A 1HFGA 3AQQA 3BYYB 3EA6A 2Y0SG 4MNOA 3J81j 3JC66 4NKLA 1JQYD 1IZ6A 4IJHA 1AW7A 1QILA 2NYZD 1TWGB 1XNQL 2F0GA 1TS2A 4HIOA 4LF7Q 1IBLL 1HZAA 2Z1CA 1EIGA 5JJIA 2ATWA 3VA5A 3FPUB 4PMBA 4PZ7A 1SJED 1PTOH 1HNXL 2E5LL 3NSWA 2UU9Q 3TN2A 1K8OA 1HNWQ 4GZYC 3LWUA 2Q2IA 5C4JH 3PIP3 4LF4Q 5G3LD 2XWBB 2FMMA 1KNEA 2VUMB 1LM0A 1MD2D 4KV6A 1HTPA 4R4TA 4XQQA 3PF5A 4CDFC 1PVOA 3C3LA 1EL0A 3IFDA 1C0AA 3VR6A 4RHRA 5I2XA 4JI3Q 1HXYD 1IKMA 2VB3X 3A7AB 3JAMc 1Q7YC 3QG1A 4A3MB 3GV3A 4DV2Q 2CH4W 3I91A 5HGTA 1CKOA 2CWPA 5C5MA 1K9MC 3UDGA 3QOJA 4M1UB 2ZJPA 2V4DA 3FMCA 3D6WA 4DR2Q 1Q8KA 1HFNA 3RD4A 2CWAA 3BVMA 1X55A 2A5HA 4JI4Q 3S1MH 1HJPA 4OO1H 5BN3A 4XTCS 1FNVA 1CZWA 2ES2A 1XNRL 3URYA 4TVAB 4KD3A 2MQHA 4JPBW 1PYBA 2OQ0A 4J8QA 2PMZE 2NN6H 4HMJA 4FF1A 4DUZQ 1J5EL 2MUYA 5T1IA 3FVQA 1U4MA 1UWVA 3I4NG 5GROA 3H3VH 2A69C 5IYCG 4Y52H 1HR0Q 4IPHA 4QQBX 1FGBD 4QIWB 5LMNL 2ID0A 2RVLA 2PO4A 3NTHA 1JJGA 3H91A 1K3RA 3RN2A 3IRBA 1LTSD 5GAGC 1STGA 2UUAQ 2F0QA 2K5VA 3C46A 2K01A 4JOIA 4DXFA 3L3OC 2IX3A 2MO1A 4V0BA 3H15A 4BXXG 5KNCA 1NCVA 2NUCA 4R4IA 3OWEB 2E2JB 1PZID 2OEOA 1J9OA 4HTHA 4KHPQ 2JK8A 4GLVB 4TKOB 1PYSB 1E7ZA 1X32A 1IBML 4IUPA 2B2YA 3STBD 4DV4Q 1OXXK 4OIJA 3KJOA 1ILPA 1EYCA 4CJ0B 2JSOA 4CGYB 3VDYA 1U4LA 5JPMC 2UXDQ 1ZKOA 5LL6S 1M8AA 3M4QA 1VQJA 2EZVA 2HD3A 1STYA 1F77A 2PMZB 3TREA 3NBIA 3WWVA 4MHEA 1PDQA 4DV3L 3DM3A 1M90C 4FNFA 2F0IA 5CV6A 2QILA 1TWAH 5ELFA 1H9MA 4QF4A 3JAMi 3CCRA 3TSSA 1PHJA 2JEAI 2YU9B 2EY2A 1LTAD 1X65A 3K57A 5EPJA 1TU2B 2Z6KC 2E76C 2IL8A 5D65A 1JT8A 1QB5D 3T1YL 2N78A 5I9OA 1VQ7A 4JBKA 1GUTA 4L63B 3UDFA 1I94Q 4JI6L 3A7LA 3QB3A 3UDIA 3DM1A 2MPMA 1NUCA 4JBJA 2NVTH 1J8IA 3MWYW 3S14B 4LW1A 1RTOA 2K5QA 3KBGA 2RSNA 1X54A 3A8IE 4LF8Q 4RGNA 1RL2A 4ZUJA 4YWLA 2FINB 1VF5C 4DNIA 3I3CA 1SNMA 2K5WA 4KY5A 1KDBA 4LF5Q 4K5XA 1DZ1A 2BCOA 2Y0SB 1N34L 5C0XI 2PQAB 1Q1EA 1KRSA 1N32L 1PXUA 4OEMB 4IUVA 2KHJA 4X3SA 2AQ1B 4KTAA 1F9SA 4P73A 4C3HG 1I6VC 5IY0A 1D8LA 2QCPX 1YEZA 1HRJA 4QB4A 2DGYA 5KRUA 1U9RA 1FL0A 2NVYB 3S2DB 4CJ2C 1PLFA 5C3WA 2A6HD 4K5VA 3S15B 1EYAA 1VCIA 2M9VA 5M3MG 1QNUA 3QOLA 4U673 5M5YB 4DK1A 3I4NH 4JCVE 2EXDA 3LNNA 5IYCH 1HUMA 3K5OA 1BBUA 1VQGA 4JVZA 1I4GA 1ZYRD 1A8VA 1I50H 1Q1BA 4EX5A 5L37A 2PNHA 3F2DA 4JBMA 1PTOF 4CKBA 4DAVA 1Q82C 2VW9A 2Q2UA 3E0EA 3HP3A 4Q5VA 4BXXH 4IUTA 1S5CD 3BDLA 3PIO3 1I4HA 1MBYA 4IALA 3GQBA 4F88A 5M9OA 4A93B 4JI7Q 2E2HB 4DPGA 1B50A 2KUMA 3VR3A 3S1NB 3GTJB 4DR6Q 2CKZB 1YITA 2K5DA 5M5WH 4KKUA 3Q8DA 4Q0FA 1Y69U 4A4IA 1CM9A 3N52A 1QG7A 4HAEA 4PZ6A 4GN3B 3HG9A 4GOPC 1ESFA 4WJ4A
chains in the Genus database with same CATH topology
3LWEA 2X6GA 2PQEA 1BBXC 2VXWA 1E2WA 1DJRD 2K33A 1QOHA 1EU3A 2OXPA 2K05A 3E6ZX 3IFTA 3MXNA 1B53A 4ZK9B 2HDLA 4RWSC 2B2VA 2MJ8A 5I9PA 3U9OA 5CORA 4RA8A 1BCPB 1QCBD 4A3DB 1JWSD 5EKKA 2F0WA 4KY6A 4H44C 4RH6A 3TBIB 2OT2A 2R61A 1DOMA 1Q90A 3PO3B 4IURA 4IN3A 2WP8J 1FYCA 1GXDC 3RZDB 1S5BD 3NTKA 4IUUA 2EVBA 4FVMA 1KLUD 2RDGA 4F7XA 1ET9A 3SXHA 5D3DA 3TP5A 3SR1A 5LHY1 3NHHA 3E5SA 5BN4A 5EPKA 5D14A 3A8KE 2KHSA 4DFAA 5K36G 4QCLA 2R92B 2B2TA 1JOOA 3MXPA 4KN4C 3MXGA 4C1NI 3I90A 3OIPA 2BDOA 1VF7A 1SEBD 4J6HA 3TZUA 3GO5A 3K58A 4RFBA 1LTBD 4NP5A 2LS01 2A73B 4X3UA 3PUYA 2O4XA 2XWJB 5ELCA 1SYCA 5EKLA 1SYBA 1O7YA 5DAUA 4HR7B 4IZ8A 5FO8B 5HURA 2IPKD 2ZXRA 3DEPA 5C0XH 2JE6I 1OO9B 2QKIC 3GTKB 1U4PA 1F2ZA 1W6JA 5F2DA 1F9QA 3UI2A 3IKJA 4HSPA 1STHA 3A8JE 2WKDA 1ONLA 1R4PB 4K2LA 5JEAJ 2GA4B 2N88A 3NXWA 5FLXE 1PRTD 1TR5A 2C9OA 4S3SA 4K8IA 3A55A 3SK8A 1FNUA 3PUVA 1D2BA 1CQVA 1XWEA 4N9PA 1TIID 3DXJC 2EE1A 5CBEE 2F0JA 1RJTA 1QNKA 5EQ0A 3QIAA 1H9KA 3GTQB 1Q3LA 1BCPD 1CI3M 2EPBA 2Z4HA 3VR4A 4IQZA 3QJYA 2H1EA 3BYTB 4L8JA 1GUGA 2WINB 4XYOA 1LT3D 1KDAA 2KQ3A 1HA5A 2DY8A 4ZKCB 4F87A 1E2VA 2F0SA 4M8AA 5CR3A 4CBVA 4XIGS 3CRLC 1SNQA 2A68C 1Z47A 3Q23A 4B08A 3FKIB 4KD4A 1D1IA 1AFPA 1F2LA 1B1ZA 1YNJD 1K83B 1WTVA 1WCMB 3WDNA 5IT9E 2EYPA 1CT1D 4PQXA 2RQXA 2J7ZA 2L12A 2NVQB 1D1KA 5J1ZA 1AEXA 2F0UA 1RHPA 4KKTA 1IW7C 3BZDB 2WKCA 3Q24A 1CHPD 5C44B 5IT9L 4G4KA 4C3JG 4X3KA 2AWOA 2KCNA 3SK4A 3IL8A 5CYUA 5CV4A 1R4QB 3H3VC 2JA6B 5C4ZA 2F03A 4E6IA 1A2TA 1CZGA 3SEBA 5DM63 4FO2A 4G7HC 4PV1C 5KYLA 2F3WA 3H0GB 2LY7A 4K14A 2K04A 4G7OC 1SBBB 2I46A 2BE5C 3NBHA 1EQTA 2MGSA 1KABA 2EYHA 3K6OA 4BBRB 5ELBA 2PW7A 4IFDJ 1Y8PB 2IX1A 2KA7A 2QEJC 1ZXTA 5G3LF 2H4OA 2CVRA 2F0TA 3GTOB 2R93B 1V1PA 5FO9B 3RZOB 2RSOA 5EPLA 1B4OA 1H9JA 4KKSA 2F0HA 5C3XA 5IIFA 5IGDA 2MHVA 5KEEA 5NUCA 2NTTA 3P75A 1STAA 3V2TA 1XXGA 4C3IB 3D4WA 1UAPA 1ICWA 3LX0A 4BWGB 4XXEA 1SYGA 1SMYD 3S1RB 1M4VA 1A3VA 3W3AA 3R8BA 4ULLA 1LV9A 1BNZA 3VYRA 1DOKA 4R9WA 4TSSA 1F2MA 1I6HB 1Z6HA 5KGUA 2F0MA 4DNRB 3OSOA 2O5IC 1B3AA 4Y7NB 3RMHA 2CW0C 1TY0A 2B2YC 1RKNA 4ZLTF 1H9RA 1X3QA 2B2WC 3KLSX 4LAAA 2JA7B 4KK7A 4KJOA 3HRZC 2B39A 4HEDA 4H7BA 1TWFB 5CBAE 3NP8A 1B44D 1AP0A 1STBA 1PZJD 3J80E 1FR3A 3S16B 4FXGC 4DU9A 5E1FA 4C1NK 1CHQD 1HPCA 2F0DA 3R93A 2PW5A 2KJXA 1RCVD 4O1NA 4BBSB 2RA4A 2HCCA 2N55A 3N6RA 3NWSA 4B9WA 3NPPA 1BCPC 1TS3A 3J80L 2L1BA 2EY1A 4DF7A 3PMFA 1OXTA 1Z7TA 2DNCA 2WACA 2L4NA 1IYVA 3F2UA 3GP7A 3RUZA 5EJWA 2FFKB 3FDTA 3FPPA 1V1PB 1XYIA 4IUNA 4KI0A 4FF3A 2HDMA 2L9HA 2X6LA 1LT4D 4C3JB 4RGTA 1DONA 4PMWA 2F0VA 1RODA 1YNJC 2A6ED 1WTOA 1A3UA 1D5XC 2J0TD 4R8IA 2HQEA 4RHSA 2WB1B 2HCIA 3SHLA 4OHJA 2L55A 5CV9A 1JR0D 2VNUD 2EJGC 5IGEA 3K7AB 3T13A 3HGBA 1ENCA 3M3YB 1OXSC 3BG3A 4PMCA 2B63B 2EYMA 3T53B 1L0XB 1NR4A 4X3TA 3Q0AA 3HOWB 2XN9C 4ILWA 4U68A 4BY7B 3SK5A 3K59A 3NWTA 3HS0C 3HEJA 5FK9C 3ZYYX 1ET6A 1HUNA 1PTOD 4XT1B 2XNAC 3QWNA 4CKEA 4XT3B 1TS4A 3FRPB 1EY4A 2KEDA 3GTGB 4TQUS 4MIUA 3GV6A 3MFYA 4QUCA 2Q8RE 1PRTB 2EXZA 4EGVA 3TDQA 4HMIA 1V1OA 3PUWA 1CA6A 4A3EB 1O80A 4K5WA 5JVG3 1KNAA 4FXDA 5COYA 1I4PA 1O78A 4K2KA 3KLSA 3J7AV 1A6XA 3SK6A 1S4ZA 3D8GA 2PZTA 3DWQA 5JEAG 4IUQA 1D6EC 1JE4A 2IT1A 2DN8A 3H09A 3C2PA 4V190 1OXUA 3BDOA 1EYDA 5CV8A 1X3PA 1IYUA 3PUZA 3K5MA 2M2LA 2WIIB 5AFWA 2L0CA 1TKWB 4DNTB 4BS9A 4A3GB 4RKBA 4A3KB 2TSSA 1PZKD 5J39A 1NAPA 3MHBA 3OHXC 4BY1B 1JORA 1DXMA 2JP1A 2NVXB 3MZ5A 1UUPA 1A2UA 4FP5D 5KNDA 4QMGA 2KECA 5I4DA 1CTMA 3PO2B 1VMCA 1VMPA 1I4RA 4UAIA 3MAQA 1JOKA 2L11A 2B8FA 3ND8A 5KNBA 3R2TA 1JWUD 2QDBA 4N9TA 5C4HA 4ABNA 1MSHA 4Z9CB 1FD7D 1EY7A 2JYOA 5KYIA 3AU7A 4ZYSA 1GUNA 2K6AA 4G7ZC 4EQPA 2AWNA 1GUOA 1G91A 3A56A 1BDOA 3CQZB 1IKLA 1L0YB 1RTNA 1EWHA 4ZAIA 5CC4A 1TQOA 1R9TB 3I4MB 4C3IG 1GHKA 2B2UC 1AZQA 4A3JB 4ME5A 5C5LA 1QWYA 4RGMA 5C0XJ 4A3FB 1DOLA 2JXMB 5I2YA 2EJMA 5IODA 3GTMB 1HTLD 3HOYB 3TMEA 2D62A 1PYWD 4XDXA 2E2DC 2K28A 4YIJA 3HOZB 1SE2A 2RDFA 4RKLA 1KDCA 2F3VA 3ERQA 1VDZA 3QO2A 2A6EC 1EY6A 5JEAH 1LTGD 4KMUC 4A3IB 4B9XA 4AYBB 4IFDG 2ENBA 2NZ1D 5C3EB 1V43A 2C5CA 2B8GA 2SDFA 3DUZA 4I7ZC 4RCOA 3M7NA 3HKZB 2SOBA 1TWHB 2A6HC 5A35A 3PUXA 3IAYA 3OWFA 1BCPF 1TWCB 2Z4IA 5IOCA 4HSVA 3NQTA 5ELDA 1SXTA 4A3BB 1ZYRC 2IW3A 3OIQA 3S17B 5A2QL 1PMRA 4H0LC 1EIHA 2TMPA 2IWHA 1EWCA 2VB2X 4K8JA 5JAVA 1DD2A 4OO1G 4QUFA 1Y1WB 1WVLA 2K1BA 3SDZA 2CHBD 5JOBA 1EEFD 3P7JA 3GTPB 5K36H 1SAPA 1Y8NB 2NN6G 5E4WC 1MI2A 1A15A 2F0FA 1SSOA 3GTLB 5KIXA 1A3TA 2EYOA 1OXVA 2KEEA 1Q12A 3M4OB 1BXTA 3HOUB 2XIWA 2BDNA 2XRQD 4K6LA 1EFID 1JB3A 3ND9A 2DY7A 3CU7A 3MTSA 2K03A 1ENFA 3AMUA 3VA7A 5EGTA 1D5ZC 2F1MA 2RKSA 3R3OA 1EY8A 3C1FA 1EOTA 4FF4A 2QF7A 2I07B 3NE5B 2K32A 5JJZA 2NB0A 4ZKBB 1F9RA 3WOEA 1Y1VB 1BF4A 3CRKC 3MVVA 5BN5A 1IL8A 2XSCA 3HOXB 2R7ZB 1CA5A 3EFXD 3BS1A 4EQOA 4KHVA 4IFDH 5C6AA 3T4AC 1FNWA 2F0EA 1MGSA 2IJ0A 1BQQT 1K8MA 1EEID 2CQAA 1JCKB 4J1MA 3TP7A 3T56B 3DEOA 2F4IA 3PV0A 3G7LA 3J81E 1STEA 2JA8B 1SNOA 2HUGA 1LACA 5LL6X 1GUWA 1STNA 4WFN3 1V8QA 3J81L 1E0BA 4OGQC 3X3NA 2D9UA 2LMCB 2AUJD 1ILQA 2A74C 4ZQ3A 1NSNS 2Q8IB 1PTOB 4KY7A 1HA6A 5C4JB 5J22A 1KLGD 1G2SA 1GOZA 4WORA 2EY6A 1SNPA 5IGFA 1HQRD 3D3RA 1PRTC 3HZXA 2R3ZA 1Y8OB 2PCFB 2XRSD 3KBXA 2JA5B 1BUVT 3T16A 1UNSA 1HHVA 3EJIA 1S5ED 1SYFA 2E74C 2B2WA 4JBWA 3Q6SA 4OL7A 3S1MB 3V05A 1XX8A 1G6ZA 1BO0A 1AN8A 2NTSA 2X69A 3I72A 1F2YA 2F0PA 3S1QB 2G9DA 4H13C 1ENAA 4CJ1B 1EZ6A 2ZT9C 4K6DA 3FEWX 1B9MA 3DWAA 4DA2A 3J7YW 4PNYA 3AB9A 1QJOA 5FOBB 3ONAB 4LMQD 4RCNA 3V96A 2O5JC 1G291 1CK1A 3M7GA 3I70A 4DK0A 1PFMA 1I4XA 2RBMA 1RD9D 1YNND 3GD7A 1WTRA 4XQNA 4CHTB 2F0KA 3MA2B 3WOFA 2PYKA 2EJFC 5I6WA 1SNCA 5K5PA 1RDPD 2K7VA 2D5DA 5M3FB 1C4QA 1T5XD 1TWAB 5FO7B 4ID6A 3M85A 1U4RA 1SNDA 4NW2A 3TP6A 3G6JB 3HOVB 3DWPA 1EY0A 1SYDA 4RAUC 5E3FA 1TT2A 5CGKA 3OW7A 1RF2D 3H6MA 4TRDA 5JVH3 3OOCA 4BA2I 2LKVA 4NMZA 4EVOA 1JOQA 2NVTB 2KVMA 2G9HD 3OPOA 3TP8A 4F8MA 4XYQA 4XQJA 4FXKC 1DCZA 3CKIB 3R2IA 2A68D 4EQNA 4ODGA 4DN4M 1WD1A 1JC7A 3JAME 5JPNC 2PPBC 4P2CB 1WD0A 1TVXA 2E2IB 2B2VC 3VYTA 5C0XG 3BDCA 2EYJA 4LJZC 1ESRA 1LABA 2R6GA 3MFGA 4HCSA 5CMDA 3NUCA 3T51B 3D4RA 4O42A 1WTQA 1ML0D 3D4DA 3JAML 5EBDA 1O7ZA 3H94A 2F0LA 2BOSA 4C56C 1GJXA 1IW7D 2WV6D 1LTRD 3VR5A 3KK7A 1SDFA 5D3IB 3DMUA 3I73A 2LFNA 4FF2A 3VYSA 1KAAA 1Q8IA 2FMCA 1HCZA 3I4NB 1SMYC 4BA1I 1SYEA 2EOTA 5M5XB 1BOSA 2NWGA 4KN7C 2SNMA 1T5EA 4DAYA 1LO5D 1I50B 1MSGA 3ITPA 4KJNA 4DAPA 2JEBI 1TS5A 3KF8A 2AQ2B 1ZEQX 1S5DD 2AQ3B 5DM73 4I65A 3TZDA 3E0JA 5ELEA 1EY5A 3D31A 1XTCD 2BE5D 5M5WB 1EY9A 2B2TC 2AUKA 3VYUA 4RGOS 4ZUIA 1LTID 3MEHA 3I4LA 2M00A 5TSSA 3W2DA 4ZRZA 2DNEA 1G8ZD 2F0NA 3K5NA 5ISRA 4WJWA 3KUPA 1C48A 3MC0B 4WRDA 3O13A 5IGBA 2EY5A 3P1HA 1KTKA 4IFDI 5E4XA 3SE0A 3L7ZC 1H9SA 4C2MB 1CQFA 2ICEC 1HQMC 3P20A 1EU4A 1LT5D 3VR2A 1NR2A 1LTTD 3NTIA 3RLFA 1UEAB 2F0OA 2L5TA 4NDXA 2NBFA 1PFNA 3K5LA 2MP1A 3KLRA 4HN7A 5IGGA 2A69D 2XVSA 3BVZA 4JK1C 3EROA 5CV7A 3BVGA 2FHTA 3U9SA 2EYLA 2D2CC 4DGZA 5EBCA 2O2LD 5T1GA 4OIKA 3M4YA 4FYDA 4OO1I 1LLRD 2CW0D 5EKIA 1PRTF 3S9WA 2B2UA 2FJ2A 4G57A 4C3HB 3C1EA 3K0YA 1JWMD 4CKCA 2NN6I 2WAQB 1EZ8A 1AZPA 1B2TA 3X3MA 1BR9A 1YNNC 5M3MB 3MXUA 1O7LA 1GUSA 4L6TB 1DYQA 1GHJA 3EVQA 1I3QB 5A2QE 5IGCA 1SJHD 1E2ZA 5CV5A 4LK1C 4R8NA 2E75C 1D5MC 5FLXL 2EYFA 4KHZA 3EQLC 2J4XA 4HCEA 3OMGA 3SVMA 1II3A 1G2TA 1F9PA 5FKAC 2KOLA 1CFMA 1SE4A 2Z8LA 1DM0B 2ZXOA 1IHZA 1PTOC 5I6YA 4UDUC 1W6KA 2PZWA 3DHQA 1TY2A 3D6CA 1PFBA 1S5FD 3CHBD 2BA1A 2OF1A 1LT6D 5DNFA 5DEHA 2KCCA 2EDGA 1SFOB 2SNSA 1SE3A 4DXGA 5C4XB 3L9AX 1EQVA 1WTXA 2IX0A 2PZUA 3NQIA 3S2HB 3A54A 3J7AF 1B9NA 1H9SB 1QE6A 1C8CA 3OMCA 1WTWA 2YYZA 1WTPA 3I8ZA 2SEBD 2Q8TA 1JICA 2PNRC 3NK9A 2ICIA 2ZXPA 4MN3A 2RDHA 2BA0A 1I4QA 3Q22A 1HFGA 3BYYB 3EA6A 4NKLA 1JQYD 1AW7A 1QILA 2NYZD 1TWGB 2F0GA 1TS2A 2Z1CA 1EIGA 3VA5A 3FPUB 4PMBA 1SJED 1PTOH 3NSWA 3TN2A 1K8OA 4GZYC 3LWUA 3PIP3 5G3LD 2XWBB 2FMMA 1KNEA 2VUMB 1MD2D 4KV6A 1HTPA 4XQQA 3C3LA 1EL0A 3IFDA 3VR6A 4RHRA 5I2XA 1HXYD 1IKMA 2VB3X 3A7AB 3QG1A 4A3MB 3GV3A 3I91A 5HGTA 5C5MA 3QOJA 4M1UB 2V4DA 3FMCA 3D6WA 1HFNA 3RD4A 3BVMA 2A5HA 4OO1H 5BN3A 4XTCS 1FNVA 1CZWA 3URYA 4KD3A 4J8QA 2NN6H 4HMJA 4FF1A 2MUYA 5T1IA 3FVQA 1U4MA 2A69C 1FGBD 4QIWB 2ID0A 2RVLA 2PO4A 3NTHA 3H91A 1LTSD 1STGA 2F0QA 3C46A 2K01A 4DXFA 3L3OC 2IX3A 4V0BA 5KNCA 1NCVA 2NUCA 3OWEB 2E2JB 1PZID 2OEOA 1J9OA 4HTHA 4TKOB 1X32A 4IUPA 2B2YA 1OXXK 4OIJA 1ILPA 1EYCA 4CJ0B 2JSOA 4CGYB 1U4LA 5JPMC 1ZKOA 5LL6S 1M8AA 2EZVA 1STYA 1F77A 2PMZB 3NBIA 4MHEA 1PDQA 4FNFA 2F0IA 5CV6A 2QILA 5ELFA 1H9MA 4QF4A 3TSSA 2JEAI 2YU9B 2EY2A 1LTAD 3K57A 5EPJA 1TU2B 2E76C 2IL8A 5D65A 1QB5D 5I9OA 1GUTA 4L63B 3A7LA 3QB3A 3DM1A 2MPMA 1NUCA 1J8IA 3MWYW 3S14B 1RTOA 2K5QA 3KBGA 2RSNA 3A8IE 4RGNA 4ZUJA 2FINB 1VF5C 3I3CA 1SNMA 2K5WA 4KY5A 1KDBA 4K5XA 1DZ1A 2BCOA 2Y0SB 5C0XI 1Q1EA 1PXUA 4IUVA 4X3SA 2AQ1B 4KTAA 1F9SA 4C3HG 1I6VC 2QCPX 1HRJA 4QB4A 5KRUA 1U9RA 2NVYB 3S2DB 4CJ2C 1PLFA 5C3WA 2A6HD 4K5VA 3S15B 1EYAA 1VCIA 2M9VA 1QNUA 3QOLA 4U673 5M5YB 4DK1A 3LNNA 1HUMA 3K5OA 1I4GA 1ZYRD 1Q1BA 1PTOF 4CKBA 4DAVA 3HP3A 4Q5VA 4IUTA 1S5CD 3BDLA 3PIO3 1I4HA 1MBYA 4IALA 3GQBA 4F88A 5M9OA 4A93B 2E2HB 1B50A 2KUMA 3VR3A 3S1NB 3GTJB 2K5DA 4KKUA 4Q0FA 1Y69U 1CM9A 3N52A 1QG7A 4HAEA 3HG9A 1ESFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR4 A;  3D6W A;  4X3T A;  3LWE A;  1HFN A;  1ZXT A;  1G2S A;  2DY8 A;  2X6G A;  2CVR A;  1WTX A;  3R93 A;  5JJZ A;  2L11 A;  1MSG A;  4U68 A;  4ZKB B;  2SDF A;  4ZKC B;  1F9R A;  5T1G A;  4OIK A;  1BF4 A;  1QE6 A;  2RSO A;  5EPL A;  1B4O A;  2VXW A;  1C8C A;  1BBX C;  1WTW A;  3DM1 A;  2MPM A;  3I8Z A;  4X3U A;  5EKI A;  1WTP A;  1IL8 A;  2RA4 A;  1HUN A;  2HCC A;  2N55 A;  4XT1 B;  1J8I A;  2Q8T A;  3MWY W;  2B2U A;  2FJ2 A;  4XT3 B;  1JIC A;  2R3Z A;  3TZD A;  2K05 A;  5T1I A;  1RTO A;  1MSH A;  1U4R A;  1B53 A;  3KBX A;  1O7Y A;  1U4M A;  2HDL A;  2L1B A;  2RSN A;  4HSV A;  4NW2 A;  4RWS C;  4ZK9 B;  2B2V A;  2KED A;  1CA5 A;  1F2L A;  1AZP A;  2FIN B;  2MJ8 A;  3GV6 A;  1B2T A;  2B2T C;  2JYO A;  4MN3 A;  2RVL A;  1WTV A;  1HHV A;  4QUC A;  4RAU C;  3DEP A;  3I3C A;  3H91 A;  2Q8R E;  1EIH A;  1ICW A;  2L4N A;  5COR A;  2B2W A;  3F2U A;  4RA8 A;  1DZ1 A;  1HFG A;  3Q6S A;  1U4P A;  2K01 A;  2J7Z A;  1XX8 A;  2L12 A;  1G6Z A;  1BO0 A;  5EJW A;  2FFK B;  3FDT A;  1CA6 A;  1F9Q A;  1NCV A;  1O80 A;  3UI2 A;  1RHP A;  4QUF A;  4IUV A;  1XYI A;  1WVL A;  2K1B A;  2NYZ D;  4X3S A;  1KNA A;  2X69 A;  1G91 A;  1F9S A;  1LV9 A;  1MGS A;  2KVM A;  1IKL A;  5COY A;  3P7J A;  1DOM A;  2HDM A;  1RTN A;  1HRJ A;  2L9H A;  1BNZ A;  1J9O A;  1DOK A;  2N88 A;  4ZAI A;  4IUR A;  1SAP A;  2X6L A;  1S4Z A;  1EIG A;  4R9W A;  4IUQ A;  1DON A;  4X3K A;  1JE4 A;  3DEO A;  1PLF A;  4CJ2 C;  1X32 A;  4CJ1 B;  4IUP A;  2B2Y A;  3G7L A;  5E4W C;  3KUP A;  3FPU B;  1ROD A;  3IL8 A;  2B2U C;  1MI2 A;  4OIJ A;  4DN4 M;  4CJ0 B;  1WD1 A;  1AZQ A;  1ILP A;  1WTO A;  3SVM A;  1G2T A;  1A15 A;  1U4L A;  1X3P A;  1SSO A;  1F9P A;  1DOL A;  1TVX A;  4IUU A;  2HUG A;  1WD0 A;  1HUM A;  2KOL A;  3TN2 A;  4UAI A;  1M8A A;  2B2V C;  1B3A A;  4R8I A;  2M2L A;  1GUW A;  5AFW A;  5E4X A;  1ESR A;  4HCS A;  5CMD A;  2FMM A;  2B2Y C;  3ONA B;  2HCI A;  5EPK A;  4MHE A;  1KNE A;  2KEE A;  5D14 A;  4ZLT F;  4LMQ D;  1PDQ A;  4XDX A;  1X3Q A;  2B2W C;  2K28 A;  2EE1 A;  3HP3 A;  5CBE E;  1NAP A;  1NR2 A;  4IUT A;  4O42 A;  2K04 A;  2XIW A;  1RJT A;  1QNK A;  1ML0 D;  1PFB A;  2BDN A;  1WTQ A;  1EL0 A;  3IFD A;  1E0B A;  1O7Z A;  5EQ0 A;  1PFM A;  1Q3L A;  2JP1 A;  1PFN A;  2B2T A;  1EQT A;  1B50 A;  2KUM A;  2D9U A;  2MP1 A;  1SDF A;  2EPB A;  2MGS A;  4HED A;  5DNF A;  5CBA E;  2DY7 A;  1IKM A;  3I90 A;  1ILQ A;  3MTS A;  2K03 A;  3QO2 A;  2H1E A;  5EPJ A;  2KEC A;  3GV3 A;  1AP0 A;  1CM9 A;  3N52 A;  3I91 A;  1QG7 A;  1VMC A;  2EOT A;  1VMP A;  2IL8 A;  2FHT A;  2NWG A;  4HAE A;  1HA6 A;  1WTR A;  2NZ1 D;  1EOT A;  5D65 A; 
#chains in the Genus database with same CATH topology
 3LWE A;  2X6G A;  1MJC A;  2PQE A;  3J7A 5;  4AH6 A;  1K0R A;  1BBX C;  2VXW A;  1E2W A;  1DJR D;  2E5L Q;  3NEN A;  4APV A;  1EFW A;  2K33 A;  2UXB Q;  1QOH A;  4X6A H;  1EU3 A;  1RIP A;  3FKI G;  2OXP A;  5ELN A;  2K05 A;  3E6Z X;  3IFT A;  4LFA Q;  3MXN A;  1B53 A;  4JI1 Q;  2HDL A;  4ZK9 B;  4RWS C;  1VQK A;  2B2V A;  1X56 A;  1S40 A;  2MJ8 A;  4DR1 L;  5C4X G;  4HIM A;  1UE6 A;  1WCM G;  1SR3 A;  5I9P A;  4J15 A;  3U9O A;  5COR A;  1MHW C;  1YBY A;  4RA8 A;  1XJV A;  2AMC B;  1BCP B;  1QCB D;  4C2M H;  4A3D B;  3K80 C;  1JWS D;  2F0W A;  4KY6 A;  4RH6 A;  4H44 C;  5EKK A;  3TBI B;  1MIU A;  2CFM A;  2OT2 A;  4LUV A;  2R61 A;  3K7U C;  3PQI A;  1DOM A;  1Q90 A;  3PO3 B;  4IUR A;  4LUO A;  4YCU A;  4IN3 A;  2WP8 J;  5C44 G;  1FYC A;  1GXD C;  3RZD B;  1S5B D;  1X9N A;  5BR8 Q;  3CCU A;  5IYD H;  1WI5 A;  3NTK A;  4IUU A;  2EVB A;  4GNX C;  4FVM A;  1KLU D;  2RDG A;  4F7X A;  1ET9 A;  3SXH A;  5JJL A;  5D3D A;  3TP5 A;  3SR1 A;  5LHY 1;  2DUD A;  3NHH A;  3E5S A;  2F4V Q;  5BN4 A;  5EPK A;  2JQO A;  5D14 A;  1GD7 A;  3KF6 A;  3A8K E;  2KHS A;  4DFA A;  3T1H L;  1VQ6 A;  4C3H H;  5K36 G;  4QCL A;  2R92 B;  2B2T A;  4UPA A;  1JOO A;  3MXP A;  4X62 Q;  4KN4 C;  3MXG A;  3STB C;  4C1N I;  3I90 A;  4K0K Q;  1K3B C;  1V9P A;  3OIP A;  4BBR G;  2BDO A;  1VF7 A;  1SEB D;  5M3M H;  4J6H A;  2UUB Q;  3TZU A;  2VUM G;  3GO5 A;  3K58 A;  2FXQ A;  4RFB A;  1LTB D;  2K50 A;  4NP5 A;  2R93 G;  3I56 A;  1K0S A;  2LS0 1;  1Q81 C;  2A73 B;  4X3U A;  3PUY A;  2O4X A;  2XWJ B;  5ELC A;  2CH4 A;  1SYC A;  5EKL A;  1YI2 A;  1GVP A;  1SYB A;  4A3M G;  1CKN A;  1O7Y A;  4DK6 C;  4JV5 L;  5DAU A;  4HR7 B;  2K14 A;  4IZ8 A;  5FO8 B;  4DV3 Q;  2VQE L;  2VZA A;  5HUR A;  2IPK D;  2ZXR A;  4DKA C;  3DEP A;  5C0X H;  2JE6 I;  1OO9 B;  4YWK A;  2QKI C;  2ZTD A;  4B3M L;  3GTK B;  1U4P A;  1F2Z A;  1W6J A;  5F2D A;  1F9Q A;  3UI2 A;  1JJC B;  4X65 Q;  3IKJ A;  4HSP A;  1STH A;  3A8J E;  2WKD A;  1FJG L;  1ONL A;  1R4P B;  4GKJ L;  4K2L A;  5JEA J;  2GA4 B;  3I4O A;  2N88 A;  3NXW A;  3T1Y Q;  5FLX E;  1PRT D;  4DUY Q;  3H3V I;  1UE7 A;  1TR5 A;  2C9O A;  1KHI A;  4S3S A;  4K8I A;  1BVS A;  3A55 A;  3SK8 A;  1FNU A;  1PH2 A;  1LYL A;  3PUV A;  4YY3 Q;  1SFO H;  3CC7 A;  4POF A;  1D2B A;  5C4X H;  1CQV A;  1WCM H;  1PH4 A;  1WJJ A;  4NXM L;  3KF8 B;  3S2H H;  1KC8 C;  1XWE A;  4N9P A;  1TII D;  3DXJ C;  1NJI C;  2EE1 A;  5CBE E;  2F0J A;  2NVQ H;  1RJT A;  1QNK A;  4O0A A;  5EQ0 A;  3QIA A;  1H9K A;  3GTQ B;  5IP9 G;  1Q3L A;  1BCP D;  1CI3 M;  2EPB A;  3BZC A;  1N32 Q;  2Z4H A;  3F1Z A;  3VR4 A;  1XPR A;  4IQZ A;  3QJY A;  2H1E A;  1O7I A;  5C44 H;  3BYT B;  4L8J A;  4DV7 L;  1VQB A;  1GUG A;  2WIN B;  4DV0 Q;  4XYO A;  1Q86 C;  2RF4 A;  1LT3 D;  3CW2 C;  1KDA A;  2KQ3 A;  3A74 A;  1HA5 A;  2DY8 A;  1HNZ Q;  3CC2 A;  4ZKC B;  4F87 A;  4A3C G;  1E2V A;  2F0S A;  4M8A A;  5CR3 A;  4CBV A;  4XIG S;  3KF6 B;  3CRL C;  1TWG H;  1SNQ A;  2A68 C;  1Z47 A;  4NB3 A;  3Q23 A;  4B08 A;  2Z0S A;  3FKI B;  4KD4 A;  5LMU Q;  1D1I A;  1KAW A;  1AFP A;  3CCJ A;  3PF4 A;  1YHA A;  1F2L A;  1B1Z A;  4JI2 Q;  1YNJ D;  1K83 B;  4LFC L;  1WTV A;  1E1T A;  1WCM B;  3WDN A;  5IT9 E;  2EYP A;  1CT1 D;  2DJG C;  4UP9 A;  4PQX A;  2RQX A;  2J7Z A;  2L12 A;  2NVQ B;  3NEM A;  2VUM H;  1D1K A;  5J1Z A;  1AEX A;  2F0U A;  1RHP A;  4KKT A;  1IW7 C;  4UY8 C;  1VQO A;  3FP9 A;  2UXC Q;  3BZD B;  1PA6 A;  2WKC A;  3Q24 A;  1PH5 A;  1CHP D;  5C44 B;  1ASZ A;  5IT9 L;  1E22 A;  4G4K A;  4C3J G;  4X3K A;  2AWO A;  4B3T Q;  3PIO A;  1VQ8 A;  1CKN B;  2KCN A;  3SK4 A;  3IL8 A;  5CYU A;  5CV4 A;  3KFU A;  4A3M H;  1R4Q B;  2B29 A;  3H3V C;  2JA6 B;  5C4Z A;  1PH3 A;  2F03 A;  2BH2 A;  1SLJ A;  5HGQ A;  1K73 C;  4E6I A;  1A2T A;  1CZG A;  3SEB A;  5DM6 3;  4DV6 L;  2WB1 G;  4FO2 A;  4G7H C;  3S24 A;  3K8A A;  4PV1 C;  2F3W A;  5KYL A;  3H0G B;  2LY7 A;  4DV1 L;  4K14 A;  3DLL A;  2K04 A;  4G7O C;  1XMO L;  1SBB B;  2I46 A;  2BE5 C;  1IYJ B;  3NBH A;  4UHV A;  1EQT A;  2MGS A;  1KAB A;  1YVC A;  2EYH A;  1VQN A;  3K6O A;  4BBR B;  5ELB A;  3KDF A;  2PW7 A;  4IFD J;  1Y8P B;  1VQ5 A;  2IX1 A;  1I6H H;  2KA7 A;  2K75 A;  4QIW E;  2QEJ C;  1ZXT A;  5G3L F;  4R4C A;  2H4O A;  2CVR A;  2F0T A;  3GTO B;  2R93 B;  1V1P A;  4JYA Q;  5FO9 B;  3RZO B;  1KL9 A;  4QGU A;  2RSO A;  5EPL A;  1B4O A;  1H9J A;  4KKS A;  4A93 G;  1T9H A;  1U0L A;  1X3G A;  2N8N A;  2F0H A;  2E2J H;  2DJF C;  2D0O A;  5C3X A;  5IIF A;  5IGD A;  2MHV A;  1OTC A;  5KEE A;  5NUC A;  2NTT A;  3P75 A;  1JMC A;  1N9W A;  1STA A;  3V2T A;  2QEX A;  1XXG A;  4C3I B;  1TWF H;  3D4W A;  1B7Y B;  3LGJ A;  1UAP A;  1ICW A;  1XTD A;  3LX0 A;  4BWG B;  1QZG A;  4XXE A;  1SYG A;  1SMY D;  2GVB A;  3S1R B;  1WYD A;  1M4V A;  1A3V A;  4DR3 L;  3W3A A;  3R8B A;  4ULL A;  1LV9 A;  4GKK L;  1PFS A;  4YCW A;  4LFB L;  4A3C H;  1BNZ A;  3VYR A;  1DOK A;  4R9W A;  2I5M X;  4TSS A;  1F2M A;  2YU9 H;  1XPO A;  1I6H B;  1Z6H A;  5KGU A;  3W1B A;  2F0M A;  1YNX A;  3G4S A;  1SMX A;  4DNR B;  3OSO A;  2O5I C;  1B3A A;  1GKH A;  4N8X 1;  4Y7N B;  4A3D G;  3RMH A;  2CW0 C;  1TY0 A;  1J6Q A;  2B2Y C;  2ZJR A;  2I5L X;  1RKN A;  4JV5 Q;  1EQR A;  4ZLT F;  4A3G G;  3AYH B;  4A3K G;  1H9R A;  1X3Q A;  2B2W C;  3KLS X;  4LAA A;  5E7N A;  3PSI A;  3PO3 G;  4OX9 L;  2JA7 B;  1BBW A;  1TXY A;  5HY6 A;  4KK7 A;  2JJQ A;  4KJO A;  3KYH C;  4BY1 G;  3HRZ C;  1EQQ A;  2L15 A;  3S14 H;  2B39 A;  4HED A;  4H7B A;  1TWF B;  5CBA E;  3NP8 A;  1B44 D;  4DR5 Q;  2GVA A;  4C3J H;  1AP0 A;  4O2D A;  1STB A;  1FJG Q;  1PZJ D;  1CSQ A;  4GKJ Q;  3PO2 G;  3J80 E;  1FR3 A;  3CCE A;  3PGZ A;  3S16 B;  4FXG C;  4DU9 A;  5E1F A;  4C1N K;  1CHQ D;  1WFQ A;  1HPC A;  2F0D A;  3R93 A;  2PW5 A;  2KJX A;  4GLA C;  3KOJ A;  4AQY Q;  1K8G A;  1RCV D;  4O1N A;  2Y0S E;  4BBS B;  4HID A;  2RA4 A;  4MZ9 A;  2R92 G;  2HCC A;  2N55 A;  3N6R A;  3NWS A;  1YHQ A;  4B9W A;  3NPP A;  1BCP C;  1TS3 A;  2WB1 E;  4DR4 L;  2LXK A;  3K0X A;  3J80 L;  2NVY H;  3S2D H;  2L1B A;  3NBH B;  2EY1 A;  4NXM Q;  3S15 H;  1EIF A;  4DF7 A;  5M5Y H;  3PMF A;  1OXT A;  1Z7T A;  2DNC A;  4DV5 Q;  4DAM A;  2WAC A;  2L4N A;  1IYV A;  3CCM A;  3F2U A;  3GP7 A;  3RUZ A;  5EJW A;  2FFK B;  3FDT A;  2K4K A;  4JI5 L;  3FPP A;  1V1P B;  3ICE A;  1XYI A;  4KLK A;  4IUN A;  4B3R L;  4KI0 A;  4X66 Q;  1L1O A;  3CCV A;  4FF3 A;  2R7D A;  2HDM A;  2L9H A;  4A93 H;  2X6L A;  1LT4 D;  2E2H H;  4C3J B;  4RGT A;  1DON A;  4PMW A;  2Z6K A;  3S1N H;  1VQD A;  3GTJ H;  2F0V A;  3K81 C;  1ROD A;  4JI0 L;  1YNJ C;  4LF9 L;  2A6E D;  1WTO A;  4A3J G;  3SGI A;  1A3U A;  4A3F G;  2K52 A;  2RCN A;  1D5X C;  2J0T D;  4R8I A;  1ASY A;  1IBK L;  2HQE A;  4RHS A;  3HOY G;  2WB1 B;  2HCI A;  2PI2 A;  3SHL A;  4PZ8 A;  1N33 Q;  5LMN W;  4OHJ A;  2L55 A;  4LFC Q;  3W1G A;  3L2P A;  5CV9 A;  5FLX c;  1JR0 D;  1YJN A;  2VNU D;  3I2Z A;  2EJG C;  5IGE A;  2E8G A;  2WFW A;  3F2C A;  2K5N A;  4P74 A;  1VS0 A;  3K7A B;  3T13 A;  3HGB A;  1ENC A;  1W3S A;  3M3Y B;  1OXS C;  3BG3 A;  4PMC A;  2B63 B;  2EYM A;  3T53 B;  1L0X B;  1PH8 A;  2D0P A;  1H95 A;  1NR4 A;  4X3T A;  3Q0A A;  3J7Z C;  3HOW B;  4MTK A;  5C3E G;  2XN9 C;  4ILW A;  4U68 A;  4BY7 B;  4A3D H;  1HH2 P;  1YZ6 A;  3SK5 A;  3K59 A;  3NWT A;  3HS0 C;  3HEJ A;  3HKZ G;  5FK9 C;  3ZYY X;  1ET6 A;  1HUN A;  1PTO D;  4XT1 B;  2XNA C;  1B8A A;  3QWN A;  3PCO B;  4XT3 B;  3FHW A;  1TS4 A;  4CKE A;  3PO3 H;  3FRP B;  1EWI A;  4P75 A;  3TS2 A;  3RZD H;  4HJ7 A;  1EY4 A;  4DV6 Q;  1XNQ Q;  2KED A;  3GTG B;  4TQU S;  3F8T A;  4MIU A;  3GV6 A;  1IBL Q;  1KXL A;  3MFY A;  4QUC A;  2Q8R E;  1PRT B;  2EXZ A;  4EGV A;  3TDQ A;  1HNX Q;  4HMI A;  1V1O A;  3PUW A;  2LSS A;  1EUJ A;  1CA6 A;  4A3E B;  1O80 A;  4K5W A;  2KCT A;  5JVG 3;  1KNA A;  4FXD A;  1SRO A;  5COY A;  1I4P A;  1O78 A;  4K2K A;  3KLS A;  3J7A V;  1A6X A;  3SK6 A;  4LF6 L;  1S4Z A;  3D8G A;  2PZT A;  3DWQ A;  4I7A A;  5JEA G;  2R92 H;  4IUQ A;  1D6E C;  1JE4 A;  2HIV A;  2IT1 A;  2DN8 A;  3H09 A;  3C2P A;  4GOP A;  4V19 0;  1OXU A;  3BDO A;  1EYD A;  4P72 A;  5CV8 A;  5IT9 c;  1X3P A;  1IYU A;  1E24 A;  3CD6 A;  3PUZ A;  3K5M A;  3ULP A;  2M2L A;  2WII B;  5AFW A;  2L0C A;  1TKW B;  1VQ9 A;  4DNT B;  4BS9 A;  3PIP A;  4A3G B;  2VS1 A;  4RKB A;  4A3K B;  2TSS A;  4LF7 L;  1PZK D;  5J39 A;  1NAP A;  3MHB A;  3OHX C;  4BY1 B;  1L1O B;  1JOR A;  1DXM A;  2JP1 A;  2NVX B;  3MZ5 A;  3CQZ H;  1UUP A;  2UU9 L;  1A2U A;  1XNR Q;  4FP5 D;  1HNW L;  2QGQ A;  3RLN A;  5KND A;  2JA6 G;  4QMG A;  2KEC A;  5I4D A;  1J5E Q;  1CTM A;  3PO2 B;  1QVC A;  1VMC A;  1VMP A;  1I4R A;  4UAI A;  5GAD C;  4R4O A;  3MAQ A;  3GTK H;  4A3F H;  1JOK A;  3A5U A;  5LMN Q;  2L11 A;  3H0G G;  2B8F A;  3ND8 A;  5KNB A;  1FGU A;  3GDE A;  3GTM H;  1NTG A;  3R2T A;  3HOY H;  4JI3 L;  1JWU D;  1Y1V G;  2QDB A;  5DLQ E;  2VQF L;  5H1S E;  2EQS A;  4LUZ A;  4N9T A;  3U50 C;  2A8V A;  5C4H A;  3HKS A;  3QR8 A;  4ABN A;  1MSH A;  4GNX A;  4L5Q A;  4Z9C B;  4YWM A;  1FD7 D;  1EY7 A;  2Z9H A;  1P16 A;  1VQH A;  2JYO A;  4JI4 L;  5KYI A;  3AU7 A;  1IBM Q;  4ZYS A;  1GUN A;  2K6A A;  4G7Z C;  4ME3 A;  4EQP A;  4MTN A;  2MFI A;  2AWN A;  1GUO A;  5C3E H;  1G91 A;  3A56 A;  1BDO A;  3CQZ B;  1IKL A;  1HR0 L;  1L0Y B;  1RTN A;  1EWH A;  4ZAI A;  5CC4 A;  3GTQ H;  1D7Q A;  3UE1 A;  1TQO A;  1R9T B;  3KLW A;  2IY5 B;  3I4M B;  4C3I G;  1GHK A;  2B2U C;  1AZQ A;  2A1A A;  3HKZ E;  4A3J B;  4ME5 A;  5C5L A;  2UUA L;  1TWC H;  1QWY A;  4RGM A;  2JA8 G;  5C0X J;  4A3F B;  1DOL A;  2JXM B;  4YHH L;  5I2Y A;  2EJM A;  5IOD A;  3GTM B;  1HTL D;  3HOY B;  3TME A;  2ZJQ A;  2D62 A;  1PYW D;  4XDX A;  2E2D C;  4KHP L;  2K28 A;  4YIJ A;  3HOZ B;  1SE2 A;  2RDF A;  3CMA A;  4RKL A;  4DV4 L;  1KDC A;  2F3V A;  3L0O A;  4H02 A;  3UDX A;  3ERQ A;  3MXN B;  3FKI H;  4JI6 Q;  2UXD L;  1VDZ A;  2OWO A;  1YJ9 A;  3QO2 A;  2A6E C;  1EY6 A;  5JEA H;  1LTG D;  1V1Q A;  4KMU C;  4A3I B;  4GOP B;  1K83 H;  2CCZ A;  2YTV A;  4B9X A;  4DR7 L;  4AYB B;  1CUK A;  4OWW B;  4IFD G;  2ENB A;  2NZ1 D;  5C3E B;  3GTL H;  1G6P A;  2HIX A;  1V43 A;  2JA7 G;  2C5C A;  2B8G A;  2SDF A;  3DUZ A;  4I7Z C;  3ZJY C;  4RCO A;  1S3O A;  3M7N A;  3HKZ B;  2SOB A;  1N34 Q;  1TWH B;  4LWC A;  2A6H C;  2Q2T A;  1EOV A;  5GQO A;  2C35 B;  1VQF A;  5A35 A;  3PUX A;  3IAY A;  3OWF A;  1BCP F;  1TWC B;  2Z4I A;  4RG1 A;  4IPC A;  5IOC A;  4HSV A;  3NQT A;  1EIY B;  5ELD A;  2JA5 G;  1SXT A;  4A3B B;  3J80 c;  2N49 A;  2JA6 H;  1ZYR C;  1FVI A;  1YHB A;  2IW3 A;  2Z6B A;  3OIQ A;  5A2Q L;  3S17 B;  1PMR A;  4H0L C;  4JC0 A;  1EIH A;  1I94 L;  2TMP A;  2IWH A;  1PH6 A;  1EWC A;  2VB2 X;  4K8J A;  5JAV A;  2QW7 A;  1CSP A;  1DD2 A;  4OO1 G;  4QUF A;  1Y1W B;  4BBS G;  1WVL A;  2K1B A;  3SDZ A;  2CHB D;  3H0G H;  5JOB A;  4LF8 L;  1VQ4 A;  1EEF D;  1QZH A;  3P7J A;  3GTP B;  5K36 H;  2OQK A;  1SAP A;  1Y8N B;  2NN6 G;  1U5K A;  4DK3 C;  3E9H A;  3CME A;  1Y14 B;  3TS0 A;  5E4W C;  1K8A C;  1MI2 A;  4BBR H;  3CXC A;  1A15 A;  2GN5 A;  2F0F A;  1SSO A;  3GTL B;  5KIX A;  1AE3 A;  1A3T A;  3AEV A;  2EYO A;  3RR5 A;  3GTO H;  2R93 H;  1OXV A;  2KEE A;  3RZO H;  1UEB A;  1Q12 A;  4L5T A;  3M4O B;  1BXT A;  3HOU B;  2XIW A;  3HFZ B;  2BDN A;  2XRQ D;  2VL6 A;  3EIV A;  4K6L A;  1IXR A;  1EFI D;  1JB3 A;  3ND9 A;  2OTJ A;  2YTY A;  2DY7 A;  3CU7 A;  3MTS A;  2K03 A;  1EYG A;  1ENF A;  4HJA A;  3AMU A;  3ULL A;  3VA7 A;  5EGT A;  1D5Z C;  4C3I H;  2BH8 A;  3EBE A;  2F1M A;  2MNA A;  2RKS A;  3R3O A;  1EY8 A;  3C1F A;  1EOT A;  4FF4 A;  2QF7 A;  2I07 B;  1GM5 A;  3NE5 B;  2K32 A;  3NEL A;  4DR1 Q;  5JJZ A;  3S1R H;  2NB0 A;  4ZKB B;  1F9R A;  4JI7 L;  4ZCK A;  3WOE A;  1Y1V B;  3E3X A;  1BF4 A;  3CRK C;  3MVV A;  5BN5 A;  5M3F G;  4DR6 L;  1IL8 A;  3D0F A;  3RNU A;  2XSC A;  3HOX B;  4P71 A;  3M9B A;  3J80 i;  2R7Z B;  1CKM A;  1CA5 A;  1X6O A;  3EFX D;  2B63 G;  2P5Z X;  3BS1 A;  4UP8 A;  1LUZ A;  4L5S A;  3HOV G;  4EQO A;  4B3S L;  4KHV A;  3HOW G;  1MJE A;  4OXP A;  4Y7N H;  4BY7 G;  4IFD H;  2V1C C;  2UXB L;  5C6A A;  3T4A C;  1FNW A;  4LFA L;  4CDC C;  2KHI A;  4X64 L;  2F0E A;  1MGS A;  2IJ0 A;  3A5Z B;  1BQQ T;  4JI1 L;  3G6E A;  2JA7 H;  1K8M A;  1EEI D;  1IL2 A;  5IP9 H;  2CQA A;  1JCK B;  2AKW B;  4J1M A;  4IPD A;  3TP7 A;  3T56 B;  1B70 B;  3DEO A;  2F4I A;  3PV0 A;  3G7L A;  3J81 E;  1STE A;  3OTO L;  5AJ3 L;  3T1H Q;  2JA8 B;  2A19 A;  1SNO A;  4L5R C;  2JA5 H;  2HUG A;  2VQF Q;  1LAC A;  5LL6 X;  1GUW A;  3S16 H;  1STN A;  4WFN 3;  4A3E G;  1X3E A;  2N3S A;  1JE5 A;  1V8Q A;  2PQA A;  1AE2 A;  3J81 L;  4JOI C;  4BBS H;  1BKB A;  1E0B A;  5BR8 L;  4HJ5 A;  4OGQ C;  3X3N A;  2D9U A;  2LMC B;  2AUJ D;  3S1Q H;  1VQP A;  1ILQ A;  2A74 C;  1JJ2 A;  4ZQ3 A;  1NSN S;  2Q8I B;  1PTO B;  1KQS A;  2F4V L;  3OYY A;  1E3P A;  1UE1 A;  4KY7 A;  1HA6 A;  5C4J B;  5J22 A;  1KLG D;  3U4V A;  1G2S A;  2VQE Q;  1GOZ A;  4WOR A;  2EY6 A;  2G5D A;  1SE8 A;  1SNP A;  5IGF A;  4X62 L;  2HT1 A;  4B3M Q;  1HQR D;  3D3R A;  1VQI A;  1PRT C;  3HZX A;  4YHH Q;  3OW2 A;  4K0K L;  1HZ9 A;  4RMF A;  2R3Z A;  1Y8O B;  2PCF B;  2XRS D;  3KBX A;  2JA5 B;  3ULJ A;  2UUB L;  1BUV T;  2XGT A;  1NMF A;  3T16 A;  1UNS A;  2NZH A;  3AFP A;  1HHV A;  3EJI A;  3AFQ A;  1B3Q A;  3CPF A;  1HZB A;  1S5E D;  1SYF A;  2E74 C;  2B2W A;  5IYB G;  4JBW A;  1P8L A;  3Q6S A;  1NY4 A;  2RHS B;  4OL7 A;  1PH7 A;  3V05 A;  1XX8 A;  3S1M B;  1G6Z A;  1BO0 A;  1AN8 A;  1WOC A;  5IWA L;  2NTS A;  2ZM6 L;  2X69 A;  4CDE C;  3I72 A;  1F2Y A;  2F0P A;  1DGS A;  4DR7 Q;  2XTI A;  3S1Q B;  4JI8 L;  2G9D A;  4H13 C;  1ENA A;  3CAM A;  5M3F H;  1NBW A;  3KDF B;  4CJ1 B;  1QUQ A;  1EZ6 A;  1G51 A;  2ZT9 C;  4GS3 A;  4OWT B;  4K6D A;  3FEW X;  4QY7 A;  3K7A H;  2I0Q A;  1B9M A;  3CCQ A;  1L1O C;  3M3Y H;  3UE0 A;  3DWA A;  3TQY A;  3A0J A;  4DA2 A;  3J7Y W;  2B63 H;  4PNY A;  1E1O A;  4X65 L;  3HOV H;  3AB9 A;  1QJO A;  2ZTC A;  1HZC A;  3HOW H;  1NMG A;  4DV7 Q;  5FOB B;  3ONA B;  1YIJ A;  4LMQ D;  4OEL B;  2F3I A;  4RCN A;  4BY7 H;  3V96 A;  2O5J C;  4DUY L;  1G29 1;  1CK1 A;  2RCF A;  2ASB A;  3M7G A;  3I70 A;  4DK0 A;  2LXJ A;  1SRU A;  1PFM A;  5FLM G;  4IJL A;  3I4M G;  4YY3 L;  5IP7 G;  1I4X A;  2HHH L;  3GTG H;  2RBM A;  5IYD G;  1X3F A;  2JN4 A;  1RD9 D;  1YNN D;  3GD7 A;  2B3G A;  1WTR A;  4XQN A;  4CHT B;  2F0K A;  3MA2 B;  1VQE A;  3WOF A;  2PYK A;  2E2I H;  1SN8 A;  2EJF C;  5I6W A;  3HOZ G;  1SNC A;  5K5P A;  4A3E H;  3CCS A;  1RDP D;  2K7V A;  5GAH C;  1N36 L;  2D5D A;  5M3F B;  1C4Q A;  4AIM A;  4NXN L;  1T5X D;  1TWA B;  5FO7 B;  4ID6 A;  3M85 A;  3ER0 A;  4FDB A;  1QVG A;  1PH9 A;  4DV0 L;  1U4R A;  1SND A;  4A3I G;  4NW2 A;  1WTH A;  3TP6 A;  2WAQ G;  3G6J B;  4AYB G;  2MO0 A;  3HOV B;  3DWP A;  4IOC A;  1EY0 A;  1SYD A;  1HNZ L;  4RAU C;  1C9O A;  3I7F A;  5E3F A;  1TT2 A;  5CGK A;  1N8R C;  3OW7 A;  1RF2 D;  4QL5 A;  3H6M A;  4TRD A;  5JVH 3;  3OOC A;  5M5X H;  4A3G H;  4A3K H;  2LKV A;  4BA2 I;  5FJ8 G;  4NMZ A;  1I5F A;  4EVO A;  5LMU L;  1JOQ A;  2NVT B;  2KVM A;  2UUC L;  2G9H D;  3OPO A;  3TP8 A;  4F8M A;  4BY1 H;  4JI2 L;  4XYQ A;  4XQJ A;  4FXK C;  1DCZ A;  4A3B G;  2NVX H;  4YCV A;  4JG2 A;  1VQL A;  4DV1 Q;  3CKI B;  1XMQ L;  3R2I A;  2A68 D;  4EQN A;  1XMO Q;  4ODG A;  4DN4 M;  1WD1 A;  1JC7 A;  3JAM E;  5JPN C;  2PPB C;  4P2C B;  1A63 A;  1WD0 A;  1TVX A;  2E2I B;  3PO2 H;  4POG A;  2B2V C;  1L0W A;  3VYT A;  5C0X G;  3BJU A;  3BDC A;  4OON A;  1Y1W G;  2UXC L;  1AH9 A;  2EYJ A;  1ESR A;  1LAB A;  3MFG A;  2R6G A;  4HCS A;  4LJZ C;  5EAY A;  3U4Z A;  5CMD A;  4A3L G;  3NUC A;  5IYB H;  3T51 B;  3F2B A;  3D4R A;  4B3T L;  4O42 A;  4B3S Q;  1WTQ A;  1ML0 D;  3D4D A;  3JAM L;  3H94 A;  1O7Z A;  2PI2 E;  2F0L A;  2BOS A;  5EBD A;  4C56 C;  1IW7 D;  1GJX A;  2WV6 D;  1LTR D;  3VR5 A;  3KK7 A;  1SDF A;  5D3I B;  3DMU A;  3I73 A;  2LFN A;  1QUQ B;  4FF2 A;  3VYS A;  1KAA A;  1Q8I A;  2FMC A;  2R7F A;  1HCZ A;  3I4N B;  1SMY C;  4BA1 I;  4X64 Q;  1SYE A;  2EOT A;  5M5X B;  1BOS A;  2NWG A;  4KN7 C;  3TEH B;  2SNM A;  3BZK A;  1T5E A;  4DAY A;  1LO5 D;  3G48 A;  1QVF A;  1I50 B;  1MSG A;  3ITP A;  4KJN A;  3OTO Q;  4DAP A;  3HOU G;  5AJ3 Q;  3G71 A;  2JEB I;  3MEF A;  1TS5 A;  2KEN A;  3KF8 A;  2AQ2 B;  1ZEQ X;  1S5D D;  1Q46 A;  2AQ3 B;  5DM7 3;  4I65 A;  3TZD A;  4LF4 L;  3E0J A;  2KBN A;  5ELE A;  4DR3 Q;  1EY5 A;  1R9T H;  3D31 A;  4GKK Q;  5FLM H;  1XTC D;  3I4M H;  4LFB Q;  2BE5 D;  5M5W B;  2HQL A;  1EY9 A;  4A3J H;  1KRT A;  2B2T C;  2AUK A;  4JYA L;  4JW0 A;  5IP7 H;  4N8F A;  3VYU A;  4A75 A;  1PH1 A;  4RGO S;  4ZUI A;  1LTI D;  2Q2H A;  5JJK A;  3MEH A;  3I4L A;  2JA9 A;  2M00 A;  5TSS A;  1S72 A;  1YJW A;  4DV2 L;  3HOZ H;  3W2D A;  4ZRZ A;  3HOX G;  1LTL A;  2DNE A;  4IO9 A;  4GLX A;  1G8Z D;  4DR2 L;  2F0N A;  2R7Z G;  3U58 A;  3K5N A;  1W2B A;  4OX9 Q;  5ISR A;  4WJW A;  3KUP A;  2QDL A;  3BU2 A;  1C48 A;  3MC0 B;  4A3I H;  4WRD A;  3O13 A;  5IGB A;  2YTX A;  4OWX B;  2EY5 A;  3P1H A;  4DUZ L;  1KTK A;  4IFD I;  5E4X A;  2NZO A;  3SE0 A;  2WAQ E;  4AYB E;  3L7Z C;  1H9S A;  2ALY B;  1CQF A;  4C2M B;  2ICE C;  1HQM C;  1I3Q H;  1KIX A;  3P20 A;  1EU4 A;  1XPU A;  1LT5 D;  3VR2 A;  1NR2 A;  1LTT D;  2YV5 A;  3NTI A;  3RLF A;  5FJ8 H;  1UEA B;  1TWH H;  2F0O A;  2L5T A;  5IE8 A;  4NDX A;  2NBF A;  1PFN A;  3J81 c;  3K5L A;  2MP1 A;  4EQ5 A;  3KLR A;  4HN7 A;  5IGG A;  4A3B H;  2A69 D;  2XVS A;  5IWA Q;  2ZM6 Q;  2EIF A;  3BVZ A;  4JK1 C;  4IOA A;  3ERO A;  5CV7 A;  3BVG A;  4DR4 Q;  5J3B A;  3S17 H;  4LNQ A;  2FHT A;  2KCM A;  1NE3 A;  3EN2 A;  3B6Y A;  2EYL A;  1UE5 A;  2D2C C;  4JI8 Q;  3U9S A;  4DGZ A;  5EBC A;  4UP7 A;  2O2L D;  5T1G A;  4OIK A;  1Y1W H;  3M4Y A;  4FYD A;  4A3L H;  4OO1 I;  1LLR D;  3E9I A;  2CW0 D;  5EKI A;  3TRZ A;  1PRT F;  3W5O A;  3S9W A;  4DR5 L;  1A62 A;  2B2U A;  2FJ2 A;  4G57 A;  4C3H B;  4JI5 Q;  3GTP H;  5GAE C;  1KD1 C;  3C1E A;  2CQO A;  3CP0 A;  3K0Y A;  1JWM D;  1M1K C;  4B3R Q;  4CKC A;  2NN6 I;  2WAQ B;  1EZ8 A;  3RN5 A;  1AZP A;  3CCL A;  1B2T A;  1JB7 A;  1GO3 E;  3M4P A;  3X3M A;  1BR9 A;  1YNN C;  2F52 A;  5M3M B;  3MXU A;  4NPS A;  1O7L A;  1GUS A;  4L6T B;  4AQY L;  1DYQ A;  1GHJ A;  1VQC A;  3EVQ A;  2H5X A;  4JI0 Q;  1I3Q B;  5A2Q E;  5IGC A;  4LF9 Q;  1SJH D;  1Z9F A;  4QJF A;  4DAY B;  1E2Z A;  5CV5 A;  4LK1 C;  4WJ3 M;  4R8N A;  2E75 C;  2HHH Q;  1ICF B;  2RHQ B;  3RLO A;  4R4Q A;  2AHO B;  3M4O H;  1D5M C;  1L2F A;  1IBK Q;  5FLX L;  2EYF A;  3HOU H;  2IHE A;  4KHZ A;  5ELO A;  3EQL C;  2J4X A;  4HCE A;  1C7Y A;  3CPW A;  4DV5 L;  3OMG A;  3SVM A;  1II3 A;  4HJ9 A;  1N36 Q;  1G2T A;  1F9P A;  1PV4 A;  5FKA C;  4NXN Q;  2KOL A;  1CFM A;  2K5H A;  1SE4 A;  2Z8L A;  3I55 A;  1DM0 B;  4IPG A;  1MKH A;  2ZXO A;  4X66 L;  1IHZ A;  1PTO C;  5I6Y A;  4GN5 A;  4UDU C;  1W6K A;  1Y1V H;  2PZW A;  3DHQ A;  3CC4 A;  3CF5 A;  1TY2 A;  3D6C A;  1PFB A;  1S5F D;  4LF5 L;  3J81 i;  3CHB D;  4GNX B;  2BA1 A;  3HOX H;  4HIK A;  2OF1 A;  2OTL A;  1LT6 D;  4ALP A;  3KJP A;  5DNF A;  5DEH A;  2R7Z H;  4HJ8 A;  2KCC A;  1VQA A;  2EDG A;  1HR0 W;  4A76 A;  1SFO B;  2UUC Q;  2SNS A;  1N33 L;  1SE3 A;  2I5H A;  4DXG A;  5C4X B;  3L9A X;  2IHF A;  1EQV A;  4GN4 B;  1WTX A;  2IX0 A;  2OCE A;  2PZU A;  1XMQ Q;  3NQI A;  3S2H B;  3A54 A;  3J7A F;  1B9N A;  4CDD C;  1H9S B;  1QE6 A;  1C8C A;  3OMC A;  1WTW A;  2YYZ A;  1WTP A;  3I8Z A;  4PG3 A;  1K28 A;  2SEB D;  2Q8T A;  1JIC A;  2ZTE A;  2PNR C;  3NK9 A;  1NNX A;  2ICI A;  3ERS X;  1VQM A;  1A0I A;  2QA4 A;  2JA8 H;  4R1J A;  2ZXP A;  4MN3 A;  4LF6 Q;  2RDH A;  2VY3 A;  2BA0 A;  1I4Q A;  3Q22 A;  1HFG A;  3AQQ A;  3BYY B;  3EA6 A;  2Y0S G;  4MNO A;  3J81 j;  3JC6 6;  4NKL A;  1JQY D;  1IZ6 A;  4IJH A;  1AW7 A;  1QIL A;  2NYZ D;  1TWG B;  1XNQ L;  2F0G A;  1TS2 A;  4HIO A;  4LF7 Q;  1IBL L;  1HZA A;  2Z1C A;  1EIG A;  5JJI A;  2ATW A;  3VA5 A;  3FPU B;  4PMB A;  4PZ7 A;  1SJE D;  1PTO H;  1HNX L;  2E5L L;  3NSW A;  2UU9 Q;  3TN2 A;  1K8O A;  1HNW Q;  4GZY C;  3LWU A;  2Q2I A;  5C4J H;  3PIP 3;  4LF4 Q;  5G3L D;  2XWB B;  2FMM A;  1KNE A;  2VUM B;  1LM0 A;  1MD2 D;  4KV6 A;  1HTP A;  4R4T A;  4XQQ A;  3PF5 A;  4CDF C;  1PVO A;  3C3L A;  1EL0 A;  3IFD A;  1C0A A;  3VR6 A;  4RHR A;  5I2X A;  4JI3 Q;  1HXY D;  1IKM A;  2VB3 X;  3A7A B;  3JAM c;  1Q7Y C;  3QG1 A;  4A3M B;  3GV3 A;  4DV2 Q;  2CH4 W;  3I91 A;  5HGT A;  1CKO A;  2CWP A;  5C5M A;  1K9M C;  3UDG A;  3QOJ A;  4M1U B;  2ZJP A;  2V4D A;  3FMC A;  3D6W A;  4DR2 Q;  1Q8K A;  1HFN A;  3RD4 A;  2CWA A;  3BVM A;  1X55 A;  2A5H A;  4JI4 Q;  3S1M H;  1HJP A;  4OO1 H;  5BN3 A;  4XTC S;  1FNV A;  1CZW A;  2ES2 A;  1XNR L;  3URY A;  4TVA B;  4KD3 A;  2MQH A;  4JPB W;  1PYB A;  2OQ0 A;  4J8Q A;  2PMZ E;  2NN6 H;  4HMJ A;  4FF1 A;  4DUZ Q;  1J5E L;  2MUY A;  5T1I A;  3FVQ A;  1U4M A;  1UWV A;  3I4N G;  5GRO A;  3H3V H;  2A69 C;  5IYC G;  4Y52 H;  1HR0 Q;  4IPH A;  4QQB X;  1FGB D;  4QIW B;  5LMN L;  2ID0 A;  2RVL A;  2PO4 A;  3NTH A;  1JJG A;  3H91 A;  1K3R A;  3RN2 A;  3IRB A;  1LTS D;  5GAG C;  1STG A;  2UUA Q;  2F0Q A;  2K5V A;  3C46 A;  2K01 A;  4JOI A;  4DXF A;  3L3O C;  2IX3 A;  2MO1 A;  4V0B A;  3H15 A;  4BXX G;  5KNC A;  1NCV A;  2NUC A;  4R4I A;  3OWE B;  2E2J B;  1PZI D;  2OEO A;  1J9O A;  4HTH A;  4KHP Q;  2JK8 A;  4GLV B;  4TKO B;  1PYS B;  1E7Z A;  1X32 A;  1IBM L;  4IUP A;  2B2Y A;  3STB D;  4DV4 Q;  1OXX K;  4OIJ A;  3KJO A;  1ILP A;  1EYC A;  4CJ0 B;  2JSO A;  4CGY B;  3VDY A;  1U4L A;  5JPM C;  2UXD Q;  1ZKO A;  5LL6 S;  1M8A A;  3M4Q A;  1VQJ A;  2EZV A;  2HD3 A;  1STY A;  1F77 A;  2PMZ B;  3TRE A;  3NBI A;  3WWV A;  4MHE A;  1PDQ A;  4DV3 L;  3DM3 A;  1M90 C;  4FNF A;  2F0I A;  5CV6 A;  2QIL A;  1TWA H;  5ELF A;  1H9M A;  4QF4 A;  3JAM i;  3CCR A;  3TSS A;  1PHJ A;  2JEA I;  2YU9 B;  2EY2 A;  1LTA D;  1X65 A;  3K57 A;  5EPJ A;  1TU2 B;  2Z6K C;  2E76 C;  2IL8 A;  5D65 A;  1JT8 A;  1QB5 D;  3T1Y L;  2N78 A;  5I9O A;  1VQ7 A;  4JBK A;  1GUT A;  4L63 B;  3UDF A;  1I94 Q;  4JI6 L;  3A7L A;  3QB3 A;  3UDI A;  3DM1 A;  2MPM A;  1NUC A;  4JBJ A;  2NVT H;  1J8I A;  3MWY W;  3S14 B;  4LW1 A;  1RTO A;  2K5Q A;  3KBG A;  2RSN A;  1X54 A;  3A8I E;  4LF8 Q;  4RGN A;  1RL2 A;  4ZUJ A;  4YWL A;  2FIN B;  1VF5 C;  4DNI A;  3I3C A;  1SNM A;  2K5W A;  4KY5 A;  1KDB A;  4LF5 Q;  4K5X A;  1DZ1 A;  2BCO A;  2Y0S B;  1N34 L;  5C0X I;  2PQA B;  1Q1E A;  1KRS A;  1N32 L;  1PXU A;  4OEM B;  4IUV A;  2KHJ A;  4X3S A;  2AQ1 B;  4KTA A;  1F9S A;  4P73 A;  4C3H G;  1I6V C;  5IY0 A;  1D8L A;  2QCP X;  1YEZ A;  1HRJ A;  4QB4 A;  2DGY A;  5KRU A;  1U9R A;  1FL0 A;  2NVY B;  3S2D B;  4CJ2 C;  1PLF A;  5C3W A;  2A6H D;  4K5V A;  3S15 B;  1EYA A;  1VCI A;  2M9V A;  5M3M G;  1QNU A;  3QOL A;  4U67 3;  5M5Y B;  4DK1 A;  3I4N H;  4JCV E;  2EXD A;  3LNN A;  5IYC H;  1HUM A;  3K5O A;  1BBU A;  1VQG A;  4JVZ A;  1I4G A;  1ZYR D;  1A8V A;  1I50 H;  1Q1B A;  4EX5 A;  5L37 A;  2PNH A;  3F2D A;  4JBM A;  1PTO F;  4CKB A;  4DAV A;  1Q82 C;  2VW9 A;  2Q2U A;  3E0E A;  3HP3 A;  4Q5V A;  4BXX H;  4IUT A;  1S5C D;  3BDL A;  3PIO 3;  1I4H A;  1MBY A;  4IAL A;  3GQB A;  4F88 A;  5M9O A;  4A93 B;  4JI7 Q;  2E2H B;  4DPG A;  1B50 A;  2KUM A;  3VR3 A;  3S1N B;  3GTJ B;  4DR6 Q;  2CKZ B;  1YIT A;  2K5D A;  5M5W H;  4KKU A;  3Q8D A;  4Q0F A;  1Y69 U;  4A4I A;  1CM9 A;  3N52 A;  1QG7 A;  4HAE A;  4PZ6 A;  4GN3 B;  3HG9 A;  4GOP C;  1ESF A;  4WJ4 A; 
#chains in the Genus database with same CATH homology
 3LWE A;  2X6G A;  2PQE A;  1BBX C;  2VXW A;  1E2W A;  1DJR D;  2K33 A;  1QOH A;  1EU3 A;  2OXP A;  2K05 A;  3E6Z X;  3IFT A;  3MXN A;  1B53 A;  4ZK9 B;  2HDL A;  4RWS C;  2B2V A;  2MJ8 A;  5I9P A;  3U9O A;  5COR A;  4RA8 A;  1BCP B;  1QCB D;  4A3D B;  1JWS D;  5EKK A;  2F0W A;  4KY6 A;  4H44 C;  4RH6 A;  3TBI B;  2OT2 A;  2R61 A;  1DOM A;  1Q90 A;  3PO3 B;  4IUR A;  4IN3 A;  2WP8 J;  1FYC A;  1GXD C;  3RZD B;  1S5B D;  3NTK A;  4IUU A;  2EVB A;  4FVM A;  1KLU D;  2RDG A;  4F7X A;  1ET9 A;  3SXH A;  5D3D A;  3TP5 A;  3SR1 A;  5LHY 1;  3NHH A;  3E5S A;  5BN4 A;  5EPK A;  5D14 A;  3A8K E;  2KHS A;  4DFA A;  5K36 G;  4QCL A;  2R92 B;  2B2T A;  1JOO A;  3MXP A;  4KN4 C;  3MXG A;  4C1N I;  3I90 A;  3OIP A;  2BDO A;  1VF7 A;  1SEB D;  4J6H A;  3TZU A;  3GO5 A;  3K58 A;  4RFB A;  1LTB D;  4NP5 A;  2LS0 1;  2A73 B;  4X3U A;  3PUY A;  2O4X A;  2XWJ B;  5ELC A;  1SYC A;  5EKL A;  1SYB A;  1O7Y A;  5DAU A;  4HR7 B;  4IZ8 A;  5FO8 B;  5HUR A;  2IPK D;  2ZXR A;  3DEP A;  5C0X H;  2JE6 I;  1OO9 B;  2QKI C;  3GTK B;  1U4P A;  1F2Z A;  1W6J A;  5F2D A;  1F9Q A;  3UI2 A;  3IKJ A;  4HSP A;  1STH A;  3A8J E;  2WKD A;  1ONL A;  1R4P B;  4K2L A;  5JEA J;  2GA4 B;  2N88 A;  3NXW A;  5FLX E;  1PRT D;  1TR5 A;  2C9O A;  4S3S A;  4K8I A;  3A55 A;  3SK8 A;  1FNU A;  3PUV A;  1D2B A;  1CQV A;  1XWE A;  4N9P A;  1TII D;  3DXJ C;  2EE1 A;  5CBE E;  2F0J A;  1RJT A;  1QNK A;  5EQ0 A;  3QIA A;  1H9K A;  3GTQ B;  1Q3L A;  1BCP D;  1CI3 M;  2EPB A;  2Z4H A;  3VR4 A;  4IQZ A;  3QJY A;  2H1E A;  3BYT B;  4L8J A;  1GUG A;  2WIN B;  4XYO A;  1LT3 D;  1KDA A;  2KQ3 A;  1HA5 A;  2DY8 A;  4ZKC B;  4F87 A;  1E2V A;  2F0S A;  4M8A A;  5CR3 A;  4CBV A;  4XIG S;  3CRL C;  1SNQ A;  2A68 C;  1Z47 A;  3Q23 A;  4B08 A;  3FKI B;  4KD4 A;  1D1I A;  1AFP A;  1F2L A;  1B1Z A;  1YNJ D;  1K83 B;  1WTV A;  1WCM B;  3WDN A;  5IT9 E;  2EYP A;  1CT1 D;  4PQX A;  2RQX A;  2J7Z A;  2L12 A;  2NVQ B;  1D1K A;  5J1Z A;  1AEX A;  2F0U A;  1RHP A;  4KKT A;  1IW7 C;  3BZD B;  2WKC A;  3Q24 A;  1CHP D;  5C44 B;  5IT9 L;  4G4K A;  4C3J G;  4X3K A;  2AWO A;  2KCN A;  3SK4 A;  3IL8 A;  5CYU A;  5CV4 A;  1R4Q B;  3H3V C;  2JA6 B;  5C4Z A;  2F03 A;  4E6I A;  1A2T A;  1CZG A;  3SEB A;  5DM6 3;  4FO2 A;  4G7H C;  4PV1 C;  5KYL A;  2F3W A;  3H0G B;  2LY7 A;  4K14 A;  2K04 A;  4G7O C;  1SBB B;  2I46 A;  2BE5 C;  3NBH A;  1EQT A;  2MGS A;  1KAB A;  2EYH A;  3K6O A;  4BBR B;  5ELB A;  2PW7 A;  4IFD J;  1Y8P B;  2IX1 A;  2KA7 A;  2QEJ C;  1ZXT A;  5G3L F;  2H4O A;  2CVR A;  2F0T A;  3GTO B;  2R93 B;  1V1P A;  5FO9 B;  3RZO B;  2RSO A;  5EPL A;  1B4O A;  1H9J A;  4KKS A;  2F0H A;  5C3X A;  5IIF A;  5IGD A;  2MHV A;  5KEE A;  5NUC A;  2NTT A;  3P75 A;  1STA A;  3V2T A;  1XXG A;  4C3I B;  3D4W A;  1UAP A;  1ICW A;  3LX0 A;  4BWG B;  4XXE A;  1SYG A;  1SMY D;  3S1R B;  1M4V A;  1A3V A;  3W3A A;  3R8B A;  4ULL A;  1LV9 A;  1BNZ A;  3VYR A;  1DOK A;  4R9W A;  4TSS A;  1F2M A;  1I6H B;  1Z6H A;  5KGU A;  2F0M A;  4DNR B;  3OSO A;  2O5I C;  1B3A A;  4Y7N B;  3RMH A;  2CW0 C;  1TY0 A;  2B2Y C;  1RKN A;  4ZLT F;  1H9R A;  1X3Q A;  2B2W C;  3KLS X;  4LAA A;  2JA7 B;  4KK7 A;  4KJO A;  3HRZ C;  2B39 A;  4HED A;  4H7B A;  1TWF B;  5CBA E;  3NP8 A;  1B44 D;  1AP0 A;  1STB A;  1PZJ D;  3J80 E;  1FR3 A;  3S16 B;  4FXG C;  4DU9 A;  5E1F A;  4C1N K;  1CHQ D;  1HPC A;  2F0D A;  3R93 A;  2PW5 A;  2KJX A;  1RCV D;  4O1N A;  4BBS B;  2RA4 A;  2HCC A;  2N55 A;  3N6R A;  3NWS A;  4B9W A;  3NPP A;  1BCP C;  1TS3 A;  3J80 L;  2L1B A;  2EY1 A;  4DF7 A;  3PMF A;  1OXT A;  1Z7T A;  2DNC A;  2WAC A;  2L4N A;  1IYV A;  3F2U A;  3GP7 A;  3RUZ A;  5EJW A;  2FFK B;  3FDT A;  3FPP A;  1V1P B;  1XYI A;  4IUN A;  4KI0 A;  4FF3 A;  2HDM A;  2L9H A;  2X6L A;  1LT4 D;  4C3J B;  4RGT A;  1DON A;  4PMW A;  2F0V A;  1ROD A;  1YNJ C;  2A6E D;  1WTO A;  1A3U A;  1D5X C;  2J0T D;  4R8I A;  2HQE A;  4RHS A;  2WB1 B;  2HCI A;  3SHL A;  4OHJ A;  2L55 A;  5CV9 A;  1JR0 D;  2VNU D;  2EJG C;  5IGE A;  3K7A B;  3T13 A;  3HGB A;  1ENC A;  3M3Y B;  1OXS C;  3BG3 A;  4PMC A;  2B63 B;  2EYM A;  3T53 B;  1L0X B;  1NR4 A;  4X3T A;  3Q0A A;  3HOW B;  2XN9 C;  4ILW A;  4U68 A;  4BY7 B;  3SK5 A;  3K59 A;  3NWT A;  3HS0 C;  3HEJ A;  5FK9 C;  3ZYY X;  1ET6 A;  1HUN A;  1PTO D;  4XT1 B;  2XNA C;  3QWN A;  4CKE A;  4XT3 B;  1TS4 A;  3FRP B;  1EY4 A;  2KED A;  3GTG B;  4TQU S;  4MIU A;  3GV6 A;  3MFY A;  4QUC A;  2Q8R E;  1PRT B;  2EXZ A;  4EGV A;  3TDQ A;  4HMI A;  1V1O A;  3PUW A;  1CA6 A;  4A3E B;  1O80 A;  4K5W A;  5JVG 3;  1KNA A;  4FXD A;  5COY A;  1I4P A;  1O78 A;  4K2K A;  3KLS A;  3J7A V;  1A6X A;  3SK6 A;  1S4Z A;  3D8G A;  2PZT A;  3DWQ A;  5JEA G;  4IUQ A;  1D6E C;  1JE4 A;  2IT1 A;  2DN8 A;  3H09 A;  3C2P A;  4V19 0;  1OXU A;  3BDO A;  1EYD A;  5CV8 A;  1X3P A;  1IYU A;  3PUZ A;  3K5M A;  2M2L A;  2WII B;  5AFW A;  2L0C A;  1TKW B;  4DNT B;  4BS9 A;  4A3G B;  4RKB A;  4A3K B;  2TSS A;  1PZK D;  5J39 A;  1NAP A;  3MHB A;  3OHX C;  4BY1 B;  1JOR A;  1DXM A;  2JP1 A;  2NVX B;  3MZ5 A;  1UUP A;  1A2U A;  4FP5 D;  5KND A;  4QMG A;  2KEC A;  5I4D A;  1CTM A;  3PO2 B;  1VMC A;  1VMP A;  1I4R A;  4UAI A;  3MAQ A;  1JOK A;  2L11 A;  2B8F A;  3ND8 A;  5KNB A;  3R2T A;  1JWU D;  2QDB A;  4N9T A;  5C4H A;  4ABN A;  1MSH A;  4Z9C B;  1FD7 D;  1EY7 A;  2JYO A;  5KYI A;  3AU7 A;  4ZYS A;  1GUN A;  2K6A A;  4G7Z C;  4EQP A;  2AWN A;  1GUO A;  1G91 A;  3A56 A;  1BDO A;  3CQZ B;  1IKL A;  1L0Y B;  1RTN A;  1EWH A;  4ZAI A;  5CC4 A;  1TQO A;  1R9T B;  3I4M B;  4C3I G;  1GHK A;  2B2U C;  1AZQ A;  4A3J B;  4ME5 A;  5C5L A;  1QWY A;  4RGM A;  5C0X J;  4A3F B;  1DOL A;  2JXM B;  5I2Y A;  2EJM A;  5IOD A;  3GTM B;  1HTL D;  3HOY B;  3TME A;  2D62 A;  1PYW D;  4XDX A;  2E2D C;  2K28 A;  4YIJ A;  3HOZ B;  1SE2 A;  2RDF A;  4RKL A;  1KDC A;  2F3V A;  3ERQ A;  1VDZ A;  3QO2 A;  2A6E C;  1EY6 A;  5JEA H;  1LTG D;  4KMU C;  4A3I B;  4B9X A;  4AYB B;  4IFD G;  2ENB A;  2NZ1 D;  5C3E B;  1V43 A;  2C5C A;  2B8G A;  2SDF A;  3DUZ A;  4I7Z C;  4RCO A;  3M7N A;  3HKZ B;  2SOB A;  1TWH B;  2A6H C;  5A35 A;  3PUX A;  3IAY A;  3OWF A;  1BCP F;  1TWC B;  2Z4I A;  5IOC A;  4HSV A;  3NQT A;  5ELD A;  1SXT A;  4A3B B;  1ZYR C;  2IW3 A;  3OIQ A;  3S17 B;  5A2Q L;  1PMR A;  4H0L C;  1EIH A;  2TMP A;  2IWH A;  1EWC A;  2VB2 X;  4K8J A;  5JAV A;  1DD2 A;  4OO1 G;  4QUF A;  1Y1W B;  1WVL A;  2K1B A;  3SDZ A;  2CHB D;  5JOB A;  1EEF D;  3P7J A;  3GTP B;  5K36 H;  1SAP A;  1Y8N B;  2NN6 G;  5E4W C;  1MI2 A;  1A15 A;  2F0F A;  1SSO A;  3GTL B;  5KIX A;  1A3T A;  2EYO A;  1OXV A;  2KEE A;  1Q12 A;  3M4O B;  1BXT A;  3HOU B;  2XIW A;  2BDN A;  2XRQ D;  4K6L A;  1EFI D;  1JB3 A;  3ND9 A;  2DY7 A;  3CU7 A;  3MTS A;  2K03 A;  1ENF A;  3AMU A;  3VA7 A;  5EGT A;  1D5Z C;  2F1M A;  2RKS A;  3R3O A;  1EY8 A;  3C1F A;  1EOT A;  4FF4 A;  2QF7 A;  2I07 B;  3NE5 B;  2K32 A;  5JJZ A;  2NB0 A;  4ZKB B;  1F9R A;  3WOE A;  1Y1V B;  1BF4 A;  3CRK C;  3MVV A;  5BN5 A;  1IL8 A;  2XSC A;  3HOX B;  2R7Z B;  1CA5 A;  3EFX D;  3BS1 A;  4EQO A;  4KHV A;  4IFD H;  5C6A A;  3T4A C;  1FNW A;  2F0E A;  1MGS A;  2IJ0 A;  1BQQ T;  1K8M A;  1EEI D;  2CQA A;  1JCK B;  4J1M A;  3TP7 A;  3T56 B;  3DEO A;  2F4I A;  3PV0 A;  3G7L A;  3J81 E;  1STE A;  2JA8 B;  1SNO A;  2HUG A;  1LAC A;  5LL6 X;  1GUW A;  1STN A;  4WFN 3;  1V8Q A;  3J81 L;  1E0B A;  4OGQ C;  3X3N A;  2D9U A;  2LMC B;  2AUJ D;  1ILQ A;  2A74 C;  4ZQ3 A;  1NSN S;  2Q8I B;  1PTO B;  4KY7 A;  1HA6 A;  5C4J B;  5J22 A;  1KLG D;  1G2S A;  1GOZ A;  4WOR A;  2EY6 A;  1SNP A;  5IGF A;  1HQR D;  3D3R A;  1PRT C;  3HZX A;  2R3Z A;  1Y8O B;  2PCF B;  2XRS D;  3KBX A;  2JA5 B;  1BUV T;  3T16 A;  1UNS A;  1HHV A;  3EJI A;  1S5E D;  1SYF A;  2E74 C;  2B2W A;  4JBW A;  3Q6S A;  4OL7 A;  3S1M B;  3V05 A;  1XX8 A;  1G6Z A;  1BO0 A;  1AN8 A;  2NTS A;  2X69 A;  3I72 A;  1F2Y A;  2F0P A;  3S1Q B;  2G9D A;  4H13 C;  1ENA A;  4CJ1 B;  1EZ6 A;  2ZT9 C;  4K6D A;  3FEW X;  1B9M A;  3DWA A;  4DA2 A;  3J7Y W;  4PNY A;  3AB9 A;  1QJO A;  5FOB B;  3ONA B;  4LMQ D;  4RCN A;  3V96 A;  2O5J C;  1G29 1;  1CK1 A;  3M7G A;  3I70 A;  4DK0 A;  1PFM A;  1I4X A;  2RBM A;  1RD9 D;  1YNN D;  3GD7 A;  1WTR A;  4XQN A;  4CHT B;  2F0K A;  3MA2 B;  3WOF A;  2PYK A;  2EJF C;  5I6W A;  1SNC A;  5K5P A;  1RDP D;  2K7V A;  2D5D A;  5M3F B;  1C4Q A;  1T5X D;  1TWA B;  5FO7 B;  4ID6 A;  3M85 A;  1U4R A;  1SND A;  4NW2 A;  3TP6 A;  3G6J B;  3HOV B;  3DWP A;  1EY0 A;  1SYD A;  4RAU C;  5E3F A;  1TT2 A;  5CGK A;  3OW7 A;  1RF2 D;  3H6M A;  4TRD A;  5JVH 3;  3OOC A;  4BA2 I;  2LKV A;  4NMZ A;  4EVO A;  1JOQ A;  2NVT B;  2KVM A;  2G9H D;  3OPO A;  3TP8 A;  4F8M A;  4XYQ A;  4XQJ A;  4FXK C;  1DCZ A;  3CKI B;  3R2I A;  2A68 D;  4EQN A;  4ODG A;  4DN4 M;  1WD1 A;  1JC7 A;  3JAM E;  5JPN C;  2PPB C;  4P2C B;  1WD0 A;  1TVX A;  2E2I B;  2B2V C;  3VYT A;  5C0X G;  3BDC A;  2EYJ A;  4LJZ C;  1ESR A;  1LAB A;  2R6G A;  3MFG A;  4HCS A;  5CMD A;  3NUC A;  3T51 B;  3D4R A;  4O42 A;  1WTQ A;  1ML0 D;  3D4D A;  3JAM L;  5EBD A;  1O7Z A;  3H94 A;  2F0L A;  2BOS A;  4C56 C;  1GJX A;  1IW7 D;  2WV6 D;  1LTR D;  3VR5 A;  3KK7 A;  1SDF A;  5D3I B;  3DMU A;  3I73 A;  2LFN A;  4FF2 A;  3VYS A;  1KAA A;  1Q8I A;  2FMC A;  1HCZ A;  3I4N B;  1SMY C;  4BA1 I;  1SYE A;  2EOT A;  5M5X B;  1BOS A;  2NWG A;  4KN7 C;  2SNM A;  1T5E A;  4DAY A;  1LO5 D;  1I50 B;  1MSG A;  3ITP A;  4KJN A;  4DAP A;  2JEB I;  1TS5 A;  3KF8 A;  2AQ2 B;  1ZEQ X;  1S5D D;  2AQ3 B;  5DM7 3;  4I65 A;  3TZD A;  3E0J A;  5ELE A;  1EY5 A;  3D31 A;  1XTC D;  2BE5 D;  5M5W B;  1EY9 A;  2B2T C;  2AUK A;  3VYU A;  4RGO S;  4ZUI A;  1LTI D;  3MEH A;  3I4L A;  2M00 A;  5TSS A;  3W2D A;  4ZRZ A;  2DNE A;  1G8Z D;  2F0N A;  3K5N A;  5ISR A;  4WJW A;  3KUP A;  1C48 A;  3MC0 B;  4WRD A;  3O13 A;  5IGB A;  2EY5 A;  3P1H A;  1KTK A;  4IFD I;  5E4X A;  3SE0 A;  3L7Z C;  1H9S A;  4C2M B;  1CQF A;  2ICE C;  1HQM C;  3P20 A;  1EU4 A;  1LT5 D;  3VR2 A;  1NR2 A;  1LTT D;  3NTI A;  3RLF A;  1UEA B;  2F0O A;  2L5T A;  4NDX A;  2NBF A;  1PFN A;  3K5L A;  2MP1 A;  3KLR A;  4HN7 A;  5IGG A;  2A69 D;  2XVS A;  3BVZ A;  4JK1 C;  3ERO A;  5CV7 A;  3BVG A;  2FHT A;  3U9S A;  2EYL A;  2D2C C;  4DGZ A;  5EBC A;  2O2L D;  5T1G A;  4OIK A;  3M4Y A;  4FYD A;  4OO1 I;  1LLR D;  2CW0 D;  5EKI A;  1PRT F;  3S9W A;  2B2U A;  2FJ2 A;  4G57 A;  4C3H B;  3C1E A;  3K0Y A;  1JWM D;  4CKC A;  2NN6 I;  2WAQ B;  1EZ8 A;  1AZP A;  1B2T A;  3X3M A;  1BR9 A;  1YNN C;  5M3M B;  3MXU A;  1O7L A;  1GUS A;  4L6T B;  1DYQ A;  1GHJ A;  3EVQ A;  1I3Q B;  5A2Q E;  5IGC A;  1SJH D;  1E2Z A;  5CV5 A;  4LK1 C;  4R8N A;  2E75 C;  1D5M C;  5FLX L;  2EYF A;  4KHZ A;  3EQL C;  2J4X A;  4HCE A;  3OMG A;  3SVM A;  1II3 A;  1G2T A;  1F9P A;  5FKA C;  2KOL A;  1CFM A;  1SE4 A;  2Z8L A;  1DM0 B;  2ZXO A;  1IHZ A;  1PTO C;  5I6Y A;  4UDU C;  1W6K A;  2PZW A;  3DHQ A;  1TY2 A;  3D6C A;  1PFB A;  1S5F D;  3CHB D;  2BA1 A;  2OF1 A;  1LT6 D;  5DNF A;  5DEH A;  2KCC A;  2EDG A;  1SFO B;  2SNS A;  1SE3 A;  4DXG A;  5C4X B;  3L9A X;  1EQV A;  1WTX A;  2IX0 A;  2PZU A;  3NQI A;  3S2H B;  3A54 A;  3J7A F;  1B9N A;  1H9S B;  1QE6 A;  1C8C A;  3OMC A;  1WTW A;  2YYZ A;  1WTP A;  3I8Z A;  2SEB D;  2Q8T A;  1JIC A;  2PNR C;  3NK9 A;  2ICI A;  2ZXP A;  4MN3 A;  2RDH A;  2BA0 A;  1I4Q A;  3Q22 A;  1HFG A;  3BYY B;  3EA6 A;  4NKL A;  1JQY D;  1AW7 A;  1QIL A;  2NYZ D;  1TWG B;  2F0G A;  1TS2 A;  2Z1C A;  1EIG A;  3VA5 A;  3FPU B;  4PMB A;  1SJE D;  1PTO H;  3NSW A;  3TN2 A;  1K8O A;  4GZY C;  3LWU A;  3PIP 3;  5G3L D;  2XWB B;  2FMM A;  1KNE A;  2VUM B;  1MD2 D;  4KV6 A;  1HTP A;  4XQQ A;  3C3L A;  1EL0 A;  3IFD A;  3VR6 A;  4RHR A;  5I2X A;  1HXY D;  1IKM A;  2VB3 X;  3A7A B;  3QG1 A;  4A3M B;  3GV3 A;  3I91 A;  5HGT A;  5C5M A;  3QOJ A;  4M1U B;  2V4D A;  3FMC A;  3D6W A;  1HFN A;  3RD4 A;  3BVM A;  2A5H A;  4OO1 H;  5BN3 A;  4XTC S;  1FNV A;  1CZW A;  3URY A;  4KD3 A;  4J8Q A;  2NN6 H;  4HMJ A;  4FF1 A;  2MUY A;  5T1I A;  3FVQ A;  1U4M A;  2A69 C;  1FGB D;  4QIW B;  2ID0 A;  2RVL A;  2PO4 A;  3NTH A;  3H91 A;  1LTS D;  1STG A;  2F0Q A;  3C46 A;  2K01 A;  4DXF A;  3L3O C;  2IX3 A;  4V0B A;  5KNC A;  1NCV A;  2NUC A;  3OWE B;  2E2J B;  1PZI D;  2OEO A;  1J9O A;  4HTH A;  4TKO B;  1X32 A;  4IUP A;  2B2Y A;  1OXX K;  4OIJ A;  1ILP A;  1EYC A;  4CJ0 B;  2JSO A;  4CGY B;  1U4L A;  5JPM C;  1ZKO A;  5LL6 S;  1M8A A;  2EZV A;  1STY A;  1F77 A;  2PMZ B;  3NBI A;  4MHE A;  1PDQ A;  4FNF A;  2F0I A;  5CV6 A;  2QIL A;  5ELF A;  1H9M A;  4QF4 A;  3TSS A;  2JEA I;  2YU9 B;  2EY2 A;  1LTA D;  3K57 A;  5EPJ A;  1TU2 B;  2E76 C;  2IL8 A;  5D65 A;  1QB5 D;  5I9O A;  1GUT A;  4L63 B;  3A7L A;  3QB3 A;  3DM1 A;  2MPM A;  1NUC A;  1J8I A;  3MWY W;  3S14 B;  1RTO A;  2K5Q A;  3KBG A;  2RSN A;  3A8I E;  4RGN A;  4ZUJ A;  2FIN B;  1VF5 C;  3I3C A;  1SNM A;  2K5W A;  4KY5 A;  1KDB A;  4K5X A;  1DZ1 A;  2BCO A;  2Y0S B;  5C0X I;  1Q1E A;  1PXU A;  4IUV A;  4X3S A;  2AQ1 B;  4KTA A;  1F9S A;  4C3H G;  1I6V C;  2QCP X;  1HRJ A;  4QB4 A;  5KRU A;  1U9R A;  2NVY B;  3S2D B;  4CJ2 C;  1PLF A;  5C3W A;  2A6H D;  4K5V A;  3S15 B;  1EYA A;  1VCI A;  2M9V A;  1QNU A;  3QOL A;  4U67 3;  5M5Y B;  4DK1 A;  3LNN A;  1HUM A;  3K5O A;  1I4G A;  1ZYR D;  1Q1B A;  1PTO F;  4CKB A;  4DAV A;  3HP3 A;  4Q5V A;  4IUT A;  1S5C D;  3BDL A;  3PIO 3;  1I4H A;  1MBY A;  4IAL A;  3GQB A;  4F88 A;  5M9O A;  4A93 B;  2E2H B;  1B50 A;  2KUM A;  3VR3 A;  3S1N B;  3GTJ B;  2K5D A;  4KKU A;  4Q0F A;  1Y69 U;  1CM9 A;  3N52 A;  1QG7 A;  4HAE A;  3HG9 A;  1ESF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...