1NMGA

Major cold-shock protein, nmr, minimized average structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
67
structure length
67
Chain Sequence
b'MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR COLD-SHOCK PROTEIN
publication title Structure in solution of the major cold-shock protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulation
total genus 4
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1996-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1nmgA00
2NN6G 1I94Q 2DGYA 1VQBA 1VCIA 3CMAA 4B3SL 4KHPL 2K50A 3CCVA 2CWPA 1GKHA 3PUXA 4IOAA 1TWHH 4Y52H 3HKZG 1I5FA 1N32L 1OXUA 3HOYG 1PH3A 1HJPA 4AQYQ 4JI6Q 4BY1G 4GKJQ 4YWKA 3K7AH 3M4PA 4R4OA 1KRTA 4GNXB 4LF9L 3S1NH 1LM0A 2I0QA 2A19A 1FJGQ 2UUCQ 4A93H 2KCTA 2XGTA 3L0OA 3HOYH 1CKNB 4JI8Q 1UEBA 4BY1H 4L5SA 4IFDG 5DLQE 1G51A 3T1YL 3PO2G 1UE6A 3T1HQ 3F2BA 1HNWQ 1TWAH 3FKIG 4GOPB 4LFAL 4A3IG 1OXSC 2YYZA 4GLAC 3ULLA 4DV3Q 2NN6I 3LGJA 4LUZA 4YY3Q 4A3GG 2IHFA 5GAGC 2CCZA 5IWAL 3PO2H 4X64Q 4P72A 3PF4A 3FKIH 4GN5A 5LMUQ 4DR3Q 3S1RH 1OTCA 3GD7A 3KYHC 3J81j 4A3IH 1NE3A 4OWTB 5GAEC 4A3CG 4A3GH 1EUJA 4AH6A 5EAYA 5GROA 4LF5L 2A1AA 3KJPA 4JYAQ 2QEXA 4DV5L 4B3TL 4LNQA 5IE8A 4LFCL 4A3CH 1IBLL 1X3FA 4LF4Q 3M3YH 4DR4Q 2AWNA 3RLOA 1HR0L 1T9HA 2PI2A 2UUAL 4PZ6A 1MJCA 4BBRG 4IFDI 1YHAA 3S17H 1NBWA 4HIKA 3A74A 1V43A 3CF5A 4NXMQ 1PV4A 1XNRQ 2K5HA 3CC2A 4A3KG 5IYBG 4BBRH 1JJGA 2JEAI 3HOWG 1CKMA 5JJLA 4X66Q 3I2ZA 3KOJA 3GTJH 3TREA 3HOVG 4JBJA 2VQFQ 4HJAA 4A3KH 5IYBH 5AJ3Q 2UXCL 2XTIA 1J6QA 1V1QA 3PV0A 3HOWH 1YJNA 1S3OA 3PUVA 4DR5Q 3UDGA 4B3MQ 3HOVH 1L2FA 4X62L 3W5OA 4IOCA 2GVAA 2UUCL 3PO3H 4DAYB 1CKOA 2YTYA 2R93G 2L15A 1E1OA 5M3MG 3FHWA 4OX9L 1YI2A 3RN5A 1O7IA 3UDXA 3KF6A 3NENA 3IRBA 2R93H 2JK8A 4JC0A 1Z9FA 4YCWA 5M3MH 2Q2HA 2OQKA 2OCEA 3MXNB 5HGQA 1PH8A 2UUBL 4DV0Q 1EIYB 2MO1A 4A3FG 3G71A 1KD1C 3CPFA 1IBMQ 1WOCA 2UXDQ 3EIVA 4UY8C 3I7FA 1YJWA 4JYAL 1Q86C 2RHQB 1K3RA 1TWCH 4OWXB 1JJ2A 1JMCA 1CKNA 4A3FH 1TWGH 2NVQH 3S1QH 2WFWA 3HKSA 4DR4L 3J80c 2AHOB 1VQ9A 4IFDJ 2Z6KC 4NPSA 1PH6A 4GOPA 2E8GA 2Z6KA 4C3IH 5JJIA 1Y1VH 2CKZB 3J7ZC 3K0XA 3U4ZA 1X9NA 1XNRL 3PIOA 1ASYA 2KENA 2C35B 1UE7A 1I3QH 2JE6I 1C9OA 3DLLA 4DR2L 1VQKA 1N9WA 4JI3Q 2I5MX 2F4VL 2ZJPA 1W3SA 2Z0SA 1VQLA 2N49A 1Q7YC 5M3FG 3GTPH 2MFIA 4DR6L 3HKZE 3GTMH 3STBC 2ID0A 1UE5A 4DR5L 1HZ9A 1X3EA 1X54A 2A8VA 5M3FH 4R4QA 2LSSA 2KHJA 5LMNW 1VQ6A 1AH9A 1HNXQ 4QIWE 1XPRA 3F2CA 4JCVE 3HFZB 4YWLA 2V1CC 1YVCA 1VQ8A 1I50H 3J81i 4GN4B 4A76A 4L5QA 1E7ZA 5IP7H 2WAQG 1KL9A 2DUDA 1VQ7A 4BY7G 5FJ8H 1NMGA 1U0LA 1Q46A 2VQEQ 3AFQA 4B3RQ 3KF6B 2JA5G 3H3VH 2RHSB 4DV0L 4DV4L 1XMQL 3CW2C 2UXDL 3Q8DA 3S2HH 4BBSG 3RZDH 5IT9c 2ATWA 4BY7H 2N8NA 4OO1G 3A5ZB 4JI5Q 1CSQA 2E5LQ 4PZ7A 4C3JH 4Y7NH 2AKWB 1HNZL 2JA5H 4JBWA 2HIVA 1FL0A 2PMZE 3E9IA 2WB1G 4PZ8A 4DUZQ 1KQSA 4JOIC 4BBSH 1SRUA 2Y0SG 4JOIA 2WP8J 1SE8A 4YHHQ 4A3JG 3OYYA 4XIGS 1ASZA 1N33Q 1QVFA 1HH2P 1OXTA 4DR1Q 3CCMA 1K83H 1PYBA 2JA7G 3H3VI 1FVIA 1YNXA 1EWIA 3RLFA 4DUYL 4LF7L 1GVPA 3J80i 4DV6Q 3S16H 1VS0A 4L5TA 4R4CA 2EIFA 1L1OC 2K52A 4JI1L 5IP9G 4A3JH 4A3MG 1QVGA 4WJ4A 1L1OA 1CSPA 2EXDA 1A8VA 2YTVA 4KI0A 3OTOL 4DV2Q 2JA7H 4A3DG 1VQDA 2NZHA 5BR8L 5GADC 4QQBX 1C7YA 4JV5Q 1P16A 5C4JH 1PH5A 5IP9H 4A3MH 1QVCA 3W1GA 3MEFA 4JI2Q 3FP9A 4A3DH 2AMCB 4LWCA 2PI2E 4YWMA 4X65L 3TEHB 4DV7Q 2R92G 4DR7L 4DV1L 4JBKA 4LF8Q 2JA6G 1X3GA 4LFBL 3CPWA 1N34L 1K0RA 1X65A 1LUZA 2IT1A 1JE5A 4LW1A 3GO5A 4AIMA 3CCEA 2R92H 2JA6H 1LTLA 5C44G 1E22A 2R7DA 1I94L 3S15H 1YHBA 1KXLA 2AWOA 2BH8A 1A62A 1BBWA 1QUQA 4NB3A 2HHHQ 3CC4A 4JG2A 2IX0A 2FXQA 4GLXA 5C44H 2QGQA 1AE2A 3CAMA 4AQYL 4JI6L 3PUYA 2ZM6Q 4GKJL 1D7QA 3NBHB 2VS1A 3VDYA 3GTQH 4C2MH 1VQNA 1WI5A 4A75A 4POGA 3AFPA 1KRSA 1FJGL 5E7NA 1HZCA 4H02A 3M4OH 1Q1BA 1VQ5A 3PUWA 5FLXc 4JI8L 3U50C 1K8AC 2UXBQ 2NZOA 3K7UC 1M1KC 3T1HL 1MIUA 1HNWL 4DV6L 4HJ8A 1KHIA 2RCNA 1U5KA 4DV3L 4LF6Q 2K75A 4YY3L 3GTGH 3BU2A 3F2DA 4IPDA 3S24A 3RN2A 4A3EG 4X64L 2ALYB 3NELA 3K81C 5LMUL 4DR3L 1W2BA 2ZJQA 5JEAG 1HZAA 1WCMG 2CFMA 1Q81C 3CD6A 4A3LG 1L1OB 4JI2L 3W1BA 4A3EH 1KAWA 2MNAA 1UE1A 2CWAA 1Y14B 3CP0A 3CCQA 1VQFA 1WCMH 4A3LH 4DPGA 4LF8L 4P74A 3GTLH 3D31A 1HZBA 4O2DA 2UU9Q 4LF4L 4JI7Q 1XPOA 2B29A 3F8TA 1B8AA 1VQHA 4O0AA 3TS2A 1K73C 4GLVB 1X56A 2R7FA 5JJKA 1YIJA 4NXML 4NXNQ 4AYBE 1S72A 1BKBA 2K4KA 2GVBA 4C3HH 3GTOH 3E0EA 1WYDA 1SN8A 2VY3A 1KC8C 1NTGA 4B3SQ 1FGUA 2ES2A 4KHPQ 4BXXG 2OTJA 4X66L 1SLJA 2K5VA 3UDFA 2VQFL 1E1TA 3AYHB 2OTLA 3PGZA 1QUQB 1OXXK 1TWFH 2MQHA 5AJ3L 1N32Q 3F1ZA 4BXXH 2WB1E 5C3EG 4QGUA 1K9MC 4B3ML 1A63A 2OQ0A 4LF9Q 1GM5A 1HR0W 2GN5A 1M90C 1B70B 4FDBA 2OWOA 2UXBL 3HOUG 5C3EH 3T1YQ 5GAHC 2E2HH 4QJFA 3ZJYC 3PUZA 4APVA 1VQAA 3EBEA 4LFAQ 2KCMA 3I4OA 4R4TA 2VUMG 1SROA 3UE1A 1K8GA 5IWAQ 5GQOA 1PHJA 4IPCA 2VW9A 1EYGA 4DAMA 1SFOH 1PH9A 1TXYA 1E3PA 2VUMH 1IBML 1EOVA 1DGSA 4JI0Q 3A0JA 1PH2A 1IXRA 2JQOA 3STBD 1VQPA 1PYSB 4DV5Q 4B3TQ 4HJ7A 4LFCQ 1YEZA 1IBLQ 1NMFA 2HIXA 3L7ZC 5LMNQ 1HR0Q 2UUAQ 5FLMG 1QZGA 2LXJA 1GO3E 3CQZH 2D0OA 5HY6A 3ER0A 1VQGA 3UE0A 4POFA 3TRZA 2VNUD 4A3BG 3I56A 5FLMH 5M5WH 1VQ4A 1JB7A 1XTDA 4JI3L 3U4VA 5JEAJ 5C0XG 1SR3A 1I6HH 4PG3A 3ULPA 1J5EQ 4HIDA 4A93G 1N8RC 1EQRA 2N78A 2ASBA 2KBNA 3GTKH 4A3BH 3HOZG 1LYLA 3HOUH 2BA1A 2ZTEA 4DK6C 4QL5A 2UXCQ 4XTCS 2YU9H 4UP7A 1VQMA 1XPUA 4GKKQ 3S14H 1RIPA 1PFSA 3EN2A 4X62Q 4JI4Q 3M7NA 1E24A 2VL6A 4DK3C 4BA2I 2IY5B 3HOZH 4OONA 1Q1EA 4TVAB 1HNXL 5ELNA 2B63G 1YZ6A 3CCSA 3CC7A 5IY0A 1C0AA 1BVSA 2CQOA 3AQQA 4A4IA 1S40A 4OX9Q 2HT1A 2F3IA 3JAMc 1VQJA 1G6PA 5ELOA 2QA4A 3WWVA 5J3BA 1XNQQ 1VQEA 2B63H 2E2JH 3AEVA 4YCVA 2D62A 3CMEA 4EX5A 1NY4A 4IJLA 4P75A 2VQEL 4HJ9A 4B3RL 1B7YB 5C0XI 2IHEA 2UUBQ 3K80C 2R7ZG 1X55A 2JA8G 2PQAA 3I55A 4JI0L 4JI5L 2E5LL 3BZKA 4UP8A 3NEMA 3M4QA 1WFQA 3KF8B 3L2PA 1R9TH 3KDFA 4R4IA 1X6OA 4DUZL 3PF5A 2R7ZH 1GD7A 1P8LA 3JC66 2JA8H 3RZOH 5LMNL 1EIFA 1G291 1BBUA 3HOXG 4YHHL 2HQLA 3BJUA 1EFWA 1N33L 5H1SE 4RG1A 3E9HA 4IPGA 3SGIA 4DR1L 4K0KQ 1PH4A 3OW2A 4HJ5A 4EQ5A 2MO0A 2BA0A 1EQQA 3RR5A 1VQCA 1YJ9A 3HOXH 4PMWA 4DR2Q 3ERSX 3TS0A 1J5EL 2F4VQ 2I5LX 3A5UA 4DV2L 3PO3G 3GDEA 1IL2A 2JJQA 1MJEA 4DR6Q 2ZJRA 4JV5L 2LXKA 4LUOA 3TQYA 4GKKL 1YHQA 3J81c 1OXVA 3PCOB 4JI4L 4GN3B 2JEBI 2VZAA 4IO9A 1Y1WG 1NJIC 4DV7L 3KLWA 1N36Q 4BA1I 3I4NG 3M9BA 1D8LA 5IYDG 3CCRA 2N3SA 2Q2IA 4JBMA 2NVXH 1RL2A 1MKHA 1Q82C 3I4MG 1XNQL 4IPHA 4HIOA 4QY7A 1Y1WH 3J7A5 1XMOQ 3D0FA 2NVYH 1PA6A 3I4NH 1IBKQ 1JT8A 5C0XJ 5IYDH 2R6GA 2JA9A 2K5NA 2WAQE 4R1JA 3PIPA 3KFUA 2RF4A 2ZTDA 2HHHL 3I4MH 4P73A 3M85A 4DV4Q 3JAMi 1Q8KA 1XMQQ 1JJCB 4GNXC 3PSIA 3RNUA 2F52A 4P71A 2EQSA 4GNXA 4KLKA 1IZ6A 4MTNA 1SMXA 2YTXA 4YCUA 2H5XA 4X6AH 3G6EA 4TQUS 4ME3A 2ZM6L 1HNZQ 1Y1VG 4MNOA 3S2DH 2PQAB 5IYCG 1UWVA 1WJJA 1Z47A 5C4XG 4GOPC 2D0PA 1CUKA 3ICEA 1QZHA 2Y0SE 3KDFB 1IBKL 1L0WA 4K0KL 1YITA 1PVOA 4DKAC 5IYCH 1A0IA 5C4XH 3BZCA 4ALPA 3H0GG 4DUYQ 4LUVA 1YBYA 2YV5A 4LF7Q 1PH1A 4LF6L 4WJ3M 4JI1Q 2E2IH 1H95A 4HIMA 1Q12A 4OXPA 3OTOQ 4OO1I 2B3GA 3H15A 3H0GH 5BR8Q 2IX1A 1KIXA 2KHIA 3UDIA 4MZ9A 4GS3A 4RMFA 3ULJA 2Q2UA 3B6YA 4DNIA 4UPAA 5K36G 3CXCA 3G4SA 5M5XH 4LF5Q 1IYJB 1V9PA 1VQOA 2Q2TA 4KHZA 1AE3A 1N36L 4X65Q 5M5YH 3G48A 3KJOA 1PH7A 4DR7Q 4DV1Q 2PNHA 5IP7G 3CCUA 2UU9L 1VQIA 4IJHA 4JI7L 5FJ8G 2BH2A 1N34Q 2I5HA 2NVTH 3S1MH 4J15A 3CCLA 4LFBQ 2K14A 3K8AA 3U58A 4OWWB 4UP9A 4L5RC 1XMOL 2ZTCA 3RLNA 4AYBG 3CCJA 3DM3A 4NXNL 1XJVA
chains in the Genus database with same CATH superfamily
3I90A 2K7VA 5CMDA 1LO5D 1VCIA 5HURA 1EL0A 1S5ED 2K50A 4G7ZC 1GKHA 3DWQA 4IOAA 1TWHH 4Y52H 1I5FA 1EIGA 3H0GB 4DAYA 4BY1G 5CYUA 4R4OA 1SE3A 3S1NH 1ENFA 3BVGA 2A19A 1AZQA 2UUCQ 4IUPA 4JI8Q 4WORA 4BY1H 4IFDG 1G51A 3J7AF 3U9SA 3PO2G 2NVTB 3V96A 3BS1A 1TWAH 4GOPB 2SOBA 5CR3A 4K2LA 4A3GG 4HSVA 2CCZA 4IFDH 3PO2H 1B50A 4GN5A 4EQOA 1CK1A 4DR3Q 1OTCA 3J81j 3VYSA 4OWTB 5GAEC 4A3GH 1EUJA 4XXEA 3NTHA 4RGNA 3GP7A 5GROA 1GXDC 1UEAB 4LF5L 2EDGA 5CV5A 2PYKA 5CV4A 3TP7A 4KN7C 3M3YH 2AWNA 1G91A 4A93B 4MIUA 1HA5A 1MJCA 4BBRG 1TT2A 3HOZB 4CJ1B 3S17H 2Z8LA 4HIKA 3D6CA 3K5LA 1V43A 1XNRQ 4J6HA 4BBRH 1JQYD 2JEAI 3K58A 3HOWG 4C56C 4X66Q 3BYTB 3FKIB 2UXCL 3FDTA 4F87A 3HOWH 2G9DA 3UDGA 4B3MQ 1L2FA 1F2ZA 1QILA 3A7LA 2GVAA 4X62L 2UUCL 4DAYB 1CKOA 2R93G 2L15A 4FF2A 3MVVA 1YI2A 3RN5A 3UDXA 3KF6A 3IRBA 2R93H 2OQKA 2K01A 1TY0A 1RTOA 1PH8A 2UUBL 3G71A 3CPFA 3I70A 1YJWA 1DCZA 1K3RA 1JJ2A 2XN9C 4KKUA 4DAVA 3J80c 1ET6A 1PH6A 2EZVA 3KLRA 1Y1VH 1XNRL 3PIOA 3H3VC 1UE7A 1PXUA 2JE6I 3DLLA 3T56B 4DR2L 5AFWA 2KUMA 1N9WA 3MEHA 1VQKA 1FNVA 1XWEA 2Z0SA 3LWUA 1Q7YC 1ET9A 3J80L 1UE5A 1HZ9A 1X3EA 4K6DA 1ZXTA 2A8VA 1GUWA 5LMNW 1VQ6A 3S1QB 1TWGB 4KY6A 4YWLA 1Z6HA 2QW7A 2V1CC 3J81i 3URYA 2XWBB 2EY5A 2WAQG 3TN2A 1W6JA 5FJ8H 2K6AA 3V05A 1QB5D 2VQEQ 4B3RQ 3KF6B 2Z4HA 4K5VA 3NBHA 3QJYA 2N55A 2N8NA 4JI5Q 2E5LQ 4PZ7A 2E2DC 2AKWB 4Y7NH 2HIVA 5IT9E 5M3FB 1H9SA 1Y8NB 2WP8J 1SE8A 2VB3X 3OYYA 4LJZC 1N33Q 1PZID 4FF4A 2D2CC 2JA7G 3H3VI 2EE1A 4DUYL 4ID6A 1I50B 4LF7L 4FF1A 1VS0A 4L5TA 1U4PA 2K52A 4A3MG 2SNMA 4CDDC 1QVGA 1CSPA 4WJWA 1BDOA 2JA7H 3OTOL 4DV2Q 1VQDA 1C7YA 4A3MH 2L0CA 2MJ8A 2F0KA 4JI2Q 1WTXA 2PI2E 4N8FA 5C3WA 2MP1A 4DV1L 4JBKA 1JOKA 1N34L 4BBSB 4J8QA 2LY7A 5I2YA 1JE5A 4AIMA 1JC7A 4DFAA 1LTLA 5C44G 4ZYSA 1KXLA 1QUQA 1BBWA 3PQIA 2HQEA 5C44H 3CAMA 4AQYL 4JI6L 3PUYA 5F2DA 2CH4W 4GKJL 1EY9A 2XIWA 2VS1A 3NBHB 3VR4A 2XRQD 1WI5A 4A75A 1HFGA 1QOHA 4FVMA 1K8AC 2NZOA 3K7UC 2Z9HA 1SJHD 3FRPB 3T1HL 1HNWL 3QWNA 5FLXE 1H9SB 1EY4A 4DGZA 1KHIA 1U5KA 2RCNA 5I6YA 3GTGH 3BU2A 4WRDA 4IPDA 3F2DA 2RSOA 1JORA 1TVXA 4I7AA 3NELA 3FVQA 1W2BA 3PMFA 4O42A 2F0GA 5JEAG 1WCMG 2F0IA 5E4WC 4FP5D 4XQJA 1CA6A 3CD6A 5KNCA 4HTHA 4JI2L 3W1BA 1LTID 3FMCA 1Y14B 2QEJC 1WTOA 5JEAH 1WCMH 3OW7A 1DXMA 3GTQB 4C2MB 4LF4L 1XPOA 1AZPA 1VQHA 3TS2A 3M4YA 1K73C 5JJKA 1S4ZA 2EY6A 4NXML 2RBMA 3GTOH 2K4KA 1F2YA 1NTGA 1FGUA 1SLJA 2VQFL 1GOZA 3AYHB 5CV9A 1QUQB 1VF5C 1DONA 4ZKCB 1STNA 1EFID 1K9MC 4ZAIA 4LF9Q 1GM5A 1HQMC 1B70B 2NVQB 3GTLB 3T1YQ 2E2HH 3ZJYC 3PUZA 4APVA 3EBEA 2KCMA 4KN4C 4FXKC 4C3IB 1PZKD 1I4HA 2K33A 2B2TC 5I9PA 2B2TA 1IHZA 1STGA 4IUNA 5M9OA 1PH9A 1TXYA 1U4LA 3PIP3 5EPKA 1DOLA 1IBML 5JOBA 3GTPB 2JQOA 5FOBB 1VQPA 1PYSB 2BOSA 2F0EA 1CQFA 4TRDA 2HIXA 1HR0Q 3NWTA 5FLMG 1NCVA 1KTKA 2OEOA 5JVG3 3NPPA 3ZYYX 1D1IA 1VQGA 4POFA 3TRZA 1A15A 1D5ZC 5FLMH 5M5WH 4JI3L 3U4VA 5KEEA 1I6HH 4PG3A 4XT1B 2ASBA 1SFOB 3HOUH 2BA1A 2VUMB 4XTCS 1VQMA 2F0LA 2M00A 4J1MA 1PFSA 3RZDB 1PYWD 3M7NA 4BA2I 2VL6A 4DK3C 2R3ZA 2AQ1B 2IY5B 4N8X1 1SXTA 1C0AA 3CCSA 2CQOA 1WTVA 3T4AC 5C5LA 1VQJA 2CW0C 1SYEA 3WWVA 1XNQQ 1VQEA 2XVSA 2E2JH 3AEVA 1K83B 2D62A 4RHRA 3CMEA 4P75A 4HJ9A 1SNPA 5C0XI 4QF4A 4R9WA 3K80C 3M7GA 1KDBA 2JA8G 4NW2A 2QKIC 5COYA 3VA7A 4UP8A 3G7LA 3GTKB 4A3BB 1JWSD 5I6WA 4DUZL 1P8LA 2JA8H 1PDQA 5G3LF 5IODA 1EFWA 4RG1A 4IPGA 4K0KQ 1YNJD 2BA0A 3RR5A 1VQCA 2A73B 2B2WC 2B2WA 3ERSX 2JA6B 3TS0A 3BDCA 2I5LX 4CHTB 4Z9CB 1SJED 5IIFA 1IL2A 3PO3G 4JV5L 3OWEB 3J7YW 3J81c 1YHQA 4FXDA 3PCOB 1Q3LA 3SE0A 2EYFA 3HEJA 2F0SA 3H91A 4DV7L 3RD4A 1FYCA 4BA1I 1SYGA 2X69A 4HN7A 4HCSA 1EY6A 2N3SA 3A8KE 2NVXH 1MKHA 1XNQL 3J7AV 4IN3A 3D0FA 4OGQC 2NVYH 4RKLA 4N9TA 1BO0A 4HCEA 2HHHL 1GUTA 4OO1G 1Q8KA 3RNUA 1IZ6A 5DEHA 2EJMA 3NHHA 2KOLA 4TQUS 4OO1H 4H0LC 1UWVA 2E75C 3IAYA 1B44D 4HMJA 1QZHA 1D5MC 3CHBD 4NMZA 4K0KL 3E6ZX 1D1KA 4ALPA 4KJOA 2YV5A 4KTAA 1PH1A 4WJ3M 1JOQA 1HTPA 2HDLA 2QF7A 1ENAA 2B3GA 2Q8IB 3K5NA 3LX0A 2KHIA 1R4PB 1LT5D 4L8JA 1A2UA 4UPAA 1IYJB 1ESFA 1VQOA 1TWFB 3KJOA 5M5YH 3G48A 1PH7A 1DJRD 3S1MH 3S2DB 4H7BA 2F4IA 4JI7L 1MI2A 1WTQA 2I5HA 1DD2A 1F2LA 4ZK9B 3SK5A 2CHBD 2ZTCA 4FNFA 2P5ZX 1TQOA 1B53A 2ZT9C 4NXNL 3SK4A 5C4XB 4DN4M 1LTAD 4B3SL 4IUTA 4KHPL 4RCNA 3PUXA 2NTTA 3HKZG 1N32L 2DN8A 3HOYG 1PH3A 3FPPA 2FMMA 1SYBA 4LMQD 2I0QA 1C48A 1QG7A 5M5XB 1TR5A 2XGTA 3HOYH 2EY1A 1CKNB 1UEBA 3E3XA 4RWSC 1ILPA 4LFAL 4R8NA 1OXSC 2YYZA 1PRTC 4GLAC 4WFN3 5GAGC 5IWAL 4FXGC 3MZ5A 4X64Q 1MBYA 2K5DA 3S1RH 3R93A 3GD7A 2B2YC 1JWUD 2E76C 4A3CG 1HQRD 2B2YA 4AH6A 4JK1C 2A1AA 3KJPA 2O5JC 1F9SA 3KLSX 3VR2A 5FK9C 2YU9B 4LFCL 4A3CH 1X3FA 4DR4Q 1SMYD 3RLOA 2JN4A 1T9HA 2PI2A 2UUAL 3C3LA 1V8QA 4IFDI 1JB3A 1LV9A 3KBGA 1O7YA 4BY1B 1TY2A 3A74A 1FD7D 2ICIA 1K8OA 4A3KG 3DXJC 1CKMA 5JJLA 5J1ZA 4DF7A 4RA8A 4JBJA 3HG9A 4HJAA 4A3KH 3NP8A 5AJ3Q 2XTIA 1BNZA 1J6QA 4DR5Q 4A3GB 3EQLC 3W5OA 2NUCA 2NZ1D 4QUFA 5M3MG 2EYHA 4OX9L 2E74C 4JC0A 5KNDA 1LTSD 1BUVT 4IALA 3S17B 3VR3A 1VMPA 5M3MH 2OCEA 5G3LD 3ITPA 4BBRB 1WVLA 1GUNA 4K6LA 1PRTB 2F0TA 3QG1A 2UXDQ 3EIVA 3I7FA 5IGEA 3NE5B 1STEA 1B9NA 1Q86C 3BG3A 1F77A 1TWCH 1MGSA 1EU3A 2VXWA 2XRSD 5A35A 2WFWA 3HKSA 4DR4L 1VQ9A 4GOPA 2E8GA 2CKZB 5IGBA 3J7ZC 3K0XA 1W6KA 3U4ZA 1A3UA 1BXTA 2F0JA 1I3QH 2IL8A 2QDLA 2WACA 2R93B 1H9MA 2I5MX 2A6HC 1PZJD 2MUYA 1TS5A 2MFIA 3I4MB 3HKZE 1LT3D 3STBC 2D5DA 4DR5L 4B08A 4R4QA 1KDCA 2ZXRA 3E5SA 1AH9A 1HNXQ 4F8MA 1XPRA 1O7ZA 3F2CA 4JCVE 1VF7A 3VYUA 3MTSA 4QB4A 1Y1VB 4L5QA 1E7ZA 4DK1A 1SDFA 3A54A 4BY7G 1D2BA 4HR7B 1U0LA 4C3JG 3AFQA 3OPOA 3P75A 4DV4L 1XMQL 2E2IB 2DJGC 2UXDL 3Q8DA 4V190 2ATWA 4BY7H 1CSQA 4C3JH 2HD3A 1HNZL 5ELCA 1SYDA 4JBWA 4PZ8A 4JOIC 1FNUA 4PMBA 2Y0SG 4JOIA 5D3DA 2F0FA 4DXFA 5CC4A 4YHHQ 4XIGS 3OIPA 1EYDA 5JAVA 3S16H 2K5QA 3MHBA 5DNFA 4JI1L 4R4CA 1L1OC 5IP9G 5KNBA 1L1OA 4XT3B 2YTVA 1TU2B 1SNCA 5GADC 4QQBX 2EYOA 3T53B 5C4JH 3LWEA 5IP9H 3A56A 2OF1A 2R61A 3MEFA 2WAQB 1PMRA 1BCPF 1I4QA 3FP9A 5E1FA 2AMCB 1EEFD 4X65L 3TEHB 2L12A 3OMCA 2R92G 4DR7L 1BF4A 4LF8Q 3K7AB 3A55A 1G6ZA 2AUJD 1ZKOA 5IGFA 1O7LA 4DU9A 1LUZA 2IT1A 1PTOF 1O78A 1MSHA 2R92H 1BCPC 2RQXA 4JPBW 1E22A 1YHBA 2BH8A 3ND8A 1A62A 2A68C 1PTOC 2RDFA 4A3IB 1D7QA 4A3MB 3VDYA 1VQNA 1KRSA 3C1FA 1VQ5A 1SNOA 4JI8L 2UXBQ 3H6MA 2G9HD 2F3WA 2AQ2B 4KY5A 4OELB 3I91A 1B4OA 2B39A 2BE5D 4C1NK 3BZDB 2KECA 3K81C 4DR3L 1HZAA 2CFMA 2SDFA 1L1OB 1TS2A 5LHY1 3GTJB 1ZYRD 2MNAA 5C44B 1M8AA 3CP0A 4DXGA 1VQFA 2OXPA 4LF8L 1I6VC 3D31A 2XNAC 2HCIA 3HOVB 2K03A 4C3HG 1F9PA 4O0AA 1J8IA 1U4RA 1X56A 2PCFB 1YIJA 2O2LD 4C3HH 2GVBA 1WYDA 1PLFA 2VY3A 1KC8C 4TKOB 2A6EC 2ES2A 4BXXG 4X66L 1BCPB 2K5VA 3TP8A 3UDFA 2OTLA 1FR3A 1SAPA 3EJIA 3F1ZA 3NTKA 4B9WA 1UUPA 4BXXH 2MGSA 3DEOA 2AUKA 5C3EG 4B3ML 4QGUA 3SR1A 5EBDA 1PTOB 2UXBL 2IX3A 3P7JA 5C3EH 1LTTD 2O5IC 4IPCA 3GTOB 1EYGA 1CQVA 2CH4A 1MHWC 3KF8A 2IW3A 3TBIB 1EOVA 4JI0Q 3A0JA 1PH2A 1X32A 3NK9A 3STBD 3GTMB 4DV5Q 1OO9B 4B3TQ 4HJ7A 1IBLQ 1D6EC 3L7ZC 2RVLA 2PZUA 2QILA 4F7XA 1IL8A 4QUCA 1QZGA 3ONAB 3T51B 2D0OA 4ABNA 2J4XA 2NTSA 1V1PA 2F0OA 3UE0A 1NR4A 5ISRA 1VQ4A 1EY0A 1JB7A 1CA5A 1XTDA 1J5EQ 4HIDA 4A93G 1GHKA 1EQRA 1QCBD 3HOZG 1LYLA 4KD4A 4DK6C 4QL5A 3EN2A 2IPKD 3DEPA 3HOZH 4OONA 4TVAB 2Z4IA 2JA5B 5ELNA 4LAAA 4G4KA 1BVSA 2EOTA 3NTIA 2F3IA 3JAMc 4TSSA 1ENCA 4KK7A 5FO7B 5J3BA 3GV6A 4QMGA 4IJLA 4KJNA 2VQEL 4B3RL 2IHEA 4R8IA 2RCFA 2KJXA 1RDPD 5CORA 4HEDA 4JI0L 4JI5L 2E5LL 3BZKA 1SNMA 1EY7A 2PQEA 2QCPX 3DMUA 3KF8B 1BBXC 3HOUB 1R9TH 4KMUC 3JAML 1SNQA 1HRJA 5LL6S 1EIFA 4A3DB 4IURA 4X3TA 2HQLA 1N33L 3QOJA 2G5DA 1LTGD 3OW2A 1K0SA 1EQQA 1YJ9A 2H1EA 1J5EL 3VA5A 2F4VQ 1V1PB 4DV2L 3GDEA 4DR6Q 2LXKA 5KYLA 3TQYA 1F2MA 1IKLA 1S5CD 4YIJA 4DNRB 5IGDA 3ND9A 3NXWA 5A2QL 1Y1WG 2HDMA 3KLWA 3M9BA 1D8LA 2K32A 2Q2IA 1RL2A 3M4OB 1CZGA 3AU7A 1Y1WH 4HIOA 1HUMA 5EKLA 1B2TA 3NWSA 1LABA 3DHQA 2I46A 1IBKQ 1JT8A 2K5NA 2WAQE 2RF4A 2FINB 1JJCB 4GNXC 2XWJB 4GNXA 5TSSA 1KDAA 4KKTA 3OSOA 4A3EB 2H4OA 3UI2A 3ICEA 1YITA 3NQTA 2NVXB 4LUVA 1AP0A 1H95A 3D3RA 2NBFA 3Q23A 4HIMA 1Q12A 2CQAA 4OO1I 3H15A 1EWHA 5BR8Q 1D5XC 3TP6A 1KIXA 3UDIA 1KLUD 2A6ED 1EIHA 3MFYA 3SVMA 2RKSA 1A3TA 3G4SA 3GV3A 1V9PA 3D4WA 2Q2TA 4KHZA 4EVOA 3I73A 1HTLD 5IP7G 3CCUA 1A2TA 4DA2A 2BH2A 4LFBQ 4J15A 3CCLA 1ICFB 2K14A 3K8AA 4X3SA 4L5RC 4ILWA 4AYBG 3I72A 3CCJA 1IBKL 2NN6G 1I94Q 3CMAA 2BCOA 3OHXC 1Y69U 4EQNA 2NN6H 1L0XB 3MAQA 4JVZA 1HJPA 2KEDA 1XTCD 3S9WA 3M4PA 1A6XA 4GNXB 3K59A 4LF9L 1LM0A 4IUVA 1QWYA 1FJGQ 2KCTA 1XX8A 3L0OA 5M5YB 5DLQE 3T1YL 2EYMA 3F2BA 3MXNA 2NYZD 1H9KA 4DV3Q 4LUZA 4YY3Q 3PF4A 4P72A 2FHTA 4DK0A 5LMUQ 4Q0FA 4JW0A 2K5WA 3C2PA 1NE3A 1KAAA 1S5FD 5EAYA 1LT6D 4JYAQ 2WINB 1JWMD 2QEXA 3S14B 4V0BA 1HR0L 2RSNA 3HKZB 3Q0AA 1YHAA 3SEBA 1NBWA 5T1GA 1PV4A 5IYBG 5C3XA 2B63B 3KOJA 1WTWA 3TREA 3QO2A 3S1RB 5IYBH 3DM1A 2BDOA 3PV0A 1YJNA 3PUVA 3PO3H 2R7ZB 3WOEA 3TZUA 4YCWA 1Z9FA 2EYLA 3VYTA 3BVZA 3MXNB 5HGQA 1CFMA 3J81L 1EIYB 2MO1A 4A3FG 1G8ZD 3OMGA 1HCZA 2EY2A 5C6AA 4JYAL 4A3KB 4C3IG 2RHQB 1K3BC 3NQIA 4OWXB 1JMCA 1CKNA 4A3FH 3TP5A 2NVQH 2DY7A 3TZDA 3Q24A 2PPBC 4NPSA 1RTNA 4ZUJA 3CRKC 2DY8A 4C3IH 3J80E 2N88A 4N9PA 1X9NA 1ASYA 2KENA 1TS3A 3ERQA 5E4XA 4RH6A 3I4NB 4OHJA 5ELBA 3VR5A 2ZJPA 3GTPH 1X54A 3HP3A 2KHSA 4XYQA 1SBBB 3DWPA 5L37A 4QIWE 4OIKA 3X3MA 4GN4B 3VR6A 4A76A 1T5XD 2Z1CA 4ZRZA 1B3QA 3RUZA 1KL9A 2KQ3A 1NMGA 2F0DA 1Q46A 2A69C 1LTRD 1BR9A 3SXHA 3S2HH 1KLGD 3RZDH 5IT9c 3MC0B 2DNEA 4CJ2C 1FL0A 2PMZE 3E9IA 2WB1G 3SK8A 1PRTF 4ODGA 1JICA 3WDNA 4A3JG 1E2ZA 1HH2P 1OXTA 4DR1Q 3CCMA 1K83H 1FVIA 1YNXA 1EWIA 1GHJA 3J80i 4DV6Q 1EQTA 2O4XA 4WJ4A 4A3JH 5C4HA 1EYCA 2EXZA 2EXDA 4KI0A 2NZHA 1Q90A 2A74C 4CKBA 1P16A 2Q8RE 1QVCA 3W1GA 1EYAA 3C1EA 4HAEA 4KV6A 1TWHB 4LWCA 4C3JB 4YWMA 2JA6G 4PMCA 1Y8OB 3S1NB 4S3SA 1K0RA 1X65A 4LW1A 1HFNA 3H94A 1HPCA 2F0PA 2JA6H 3Q22A 1E2VA 3S15H 2CW0D 1TWAB 2AWOA 3EFXD 4NB3A 2WKDA 3PO2B 4KY7A 5EKKA 2EYJA 3TSSA 2ZM6Q 4EQPA 1CI3M 4POGA 5E7NA 1HZCA 4H02A 1Q1BA 1S5BD 3PUWA 5FLXc 3U50C 2ZXOA 5C4ZA 2ENBA 3M3YB 4DV6L 4HJ8A 2JP1A 4LF6Q 5A2QE 3RN2A 2FFKB 3MA2B 4X64L 4RAUC 1AFPA 2EYPA 4ZQ3A 1DYQA 4A3LG 1Z7TA 3IFTA 1KAWA 5FLXL 5BN3A 3CCQA 3HS0C 2K04A 4X3UA 3GQBA 4A3LH 3HOWB 1HZBA 4O2DA 2UU9Q 2HCCA 3F8TA 4XQQA 4ULLA 2X6LA 2PZTA 1HXYD 3QIAA 2V4DA 4RGTA 5J39A 5JVH3 1BKBA 1CM9A 1QJOA 1TIID 5T1IA 4KKSA 3EA6A 4E6IA 3OIQA 1YNNC 3PGZA 5JJZA 3IFDA 1OXXK 1TWFH 2LKVA 5AJ3L 3CKIB 1STHA 2WB1E 2OQ0A 1EU4A 2K28A 4CGYB 2OWOA 2MPMA 3KLSA 1SROA 5EQ0A 5GQOA 1PHJA 4C3HB 2RDHA 1M4VA 1VMCA 4RHSA 2PZWA 1IYUA 1EOTA 2B8GA 4FO2A 3MXGA 1IXRA 3DWAA 1B3AA 5LMNQ 4NP5A 1WTRA 2RA4A 4HMIA 3CQZH 5HY6A 4OEMB 3FEWX 2KCNA 1DM0B 1VDZA 2KA7A 3T13A 1RHPA 1IW7C 1N8RC 2A69D 3D4RA 1SEBD 2UXCQ 1GJXA 2YU9H 4GKKQ 1RIPA 4X62Q 1XYIA 1E24A 4Y7NB 1Q1EA 1O80A 1HNXL 2L5TA 1V1OA 3AQQA 3R8BA 5ELOA 1QNKA 4G7OC 4LK1C 1PRTD 2UUBQ 4K2KA 4IZ8A 4RGOS 1X55A 1IYVA 1CT1D 2SNSA 1IKMA 3BDLA 2JA7B 5IGCA 3L2PA 1NAPA 1X6OA 3RZOH 1X3QA 3CU7A 5LMNL 1G291 1BBUA 1WTPA 3HOXG 4YHHL 5H1SE 3E9HA 3SGIA 3RMHA 1PH4A 4EQ5A 2AQ3B 2MO0A 5EJWA 3HOXH 4PMWA 4FYDA 2XSCA 4DR2Q 3A5UA 1CHPD 1MJEA 5K5PA 5ELFA 4IUUA 3D4DA 4GKKL 1ESRA 2VZAA 1NJIC 1CTMA 1N36Q 3R2TA 1R9TB 3J81E 1LACA 1ML0D 4B9XA 5IYDG 3I4MG 4QY7A 3J7A5 1XMOQ 1PA6A 5C0XJ 5IYDH 2R6GA 2JA9A 1G2SA 4K5WA 3KFUA 2ZTDA 3I4MH 1GUOA 4CDFC 3GTGB 3PSIA 3QOLA 4P71A 4DAPA 4KLKA 4X6AH 1U4MA 3G6EA 4ME3A 1Y1VG 4M1UB 3FPUB 5DAUA 1Y8PB 5EGTA 2L4NA 4MN3A 1WJJA 1Z47A 2D0PA 4G57A 4K8JA 1ONLA 2D9UA 2Y0SE 1WCMB 2TMPA 1L0WA 2JSOA 1PVOA 4DKAC 4XQNA 1A0IA 3BZCA 3H0GG 4DUYQ 1YBYA 4LF7Q 1R4QB 5FKAC 1Y1WB 1NUCA 2E2IH 2A5HA 1Q8IA 1C8CA 4OXPA 3OTOQ 3H0GH 2F0MA 4MZ9A 4GS3A 4RMFA 3ULJA 2Q2UA 2A6HD 4DNIA 3CXCA 1YNND 3W2DA 1RCVD 4K8IA 1N36L 4Q5VA 4DV1Q 2PNHA 5ELDA 5FJ8G 2WKCA 4RCOA 1N34Q 2NVTH 4U68A 3U58A 1XMOL 5D65A 3RLNA 5CV8A 3DM3A 5IGGA 2E2HB 2DGYA 1VQBA 2EJFC 1NNXA 5CV6A 3CCVA 4XYOA 2CWPA 2J7ZA 5D14A 1OXUA 4AQYQ 4JI6Q 5KRUA 1EEID 4GKJQ 4YWKA 1H9JA 3K7AH 1JCKB 1PFNA 1KRTA 2F03A 1I4PA 4IQZA 4A93H 3QR8A 2K05A 4L63B 2FJ2A 1NR2A 1RODA 2Q8TA 1AEXA 4L5SA 2L9HA 4X3KA 1UE6A 3NSWA 3T1HQ 1HNWQ 2PW5A 3FKIG 4A3IG 3ULLA 2NN6I 3LGJA 2IHFA 4H13C 1LTBD 2PW7A 1I4GA 3FKIH 1ICWA 3KYHC 5M5WB 4A3IH 1I6HB 5D3IB 1IW7D 4AYBB 3P1HA 5C5MA 4DV5L 4B3TL 4LNQA 1II3A 5IE8A 1JR0D 1PFMA 1IBLL 4LF4Q 4PZ6A 1YNJC 3AB9A 2SEBD 1FNWA 3X3NA 3CF5A 4NXMQ 2K5HA 1EWCA 3CC2A 4F88A 4CJ0B 1BCPD 1JJGA 3TDQA 4QIWB 5NUCA 2M2LA 1ILQA 3MWYW 3I2ZA 3GTJH 3HOVG 2E2JB 5EPJA 2VQFQ 2A68D 2LS01 1V1QA 1WD0A 1S3OA 1PTOD 3I3CA 1QE6A 3HGBA 3HOVH 4IOCA 2OT2A 2YTYA 1E1OA 2JA8B 3FHWA 3CRLC 3DUZA 1O7IA 1STYA 2EVBA 2PMZB 3NENA 2ICEC 2JK8A 4MHEA 2Q2HA 3MXPA 4CKEA 1NSNS 3H09A 4ME5A 4DV0Q 1KD1C 1IBMQ 1WOCA 4UY8C 1PTOH 2WV6D 1E2WA 3S1QH 1TWGH 3SDZA 2F0WA 1STBA 2AHOB 4IFDJ 3W3AA 2Z6KC 3PO3B 2Z6KA 4U673 5JJIA 1EY5A 1SNDA 2C35B 3D8GA 1C9OA 2F0HA 1A3VA 4JI3Q 5IOCA 2F4VL 2NVYB 4PNYA 1RD9D 1W3SA 4KHVA 1VQLA 2N49A 5M3FG 4DR6L 1HUNA 3GTMH 2ID0A 5CGKA 1KNEA 2RDGA 5I9OA 5M3FH 2LSSA 2KHJA 2F1MA 4A3FB 5ELEA 3HFZB 1B9MA 1VQ8A 1YVCA 1I50H 1TS4A 4K5XA 3TMEA 4ZCKA 1S5DD 5IP7H 1VQ7A 2DUDA 2KVMA 3V2TA 4ZLTF 1L0YB 3H3VH 2JA5G 1JOOA 2RHSB 4DV0L 3CW2C 3K57A 4BBSG 3A5ZB 3VYRA 1J9OA 1AW7A 2JA5H 4G7HC 4DUZQ 1KQSA 4BBSH 1SRUA 2NB0A 1ASZA 2FMCA 1QVFA 1C4QA 3S1MB 1PYBA 2DJFC 2EJGC 3RLFA 1GVPA 4UHVA 3HOUG 2EIFA 4C1NI 1MD2D 1LLRD 3N52A 3LNNA 1A8VA 1SE2A 4A3DG 2F0NA 5BR8L 4JV5Q 2B2UC 5CV7A 1PH5A 2B2UA 3S2HB 2F0VA 2EPBA 1SMYC 4A3DH 1I4RA 4DV7Q 4OIJA 1X3GA 2LMCB 3CPWA 4LFBL 3NBIA 3HOYB 3GO5A 3CCEA 2WB1B 3R3OA 1GUSA 1I94L 2R7DA 5HGTA 1EZ8A 3CC4A 1RJTA 1WD1A 2HHHQ 2X6GA 4A3JB 1I4XA 4JG2A 2IX0A 1K28A 5JPNC 2FXQA 5BN5A 1SYCA 4GLXA 2PNRC 1DOKA 2QGQA 1AE2A 3GTQH 4C2MH 5KYIA 3AFPA 1FJGL 1KNAA 1EY8A 1CHQD 3MXUA 5I4DA 3M4OH 3SK6A 4I65A 1M1KC 1MIUA 3IL8A 4P2CB 3C46A 2L1BA 4DV3L 3R2IA 2K75A 4YY3L 3S24A 2J0TD 4A3EG 2ALYB 3S15B 5LMUL 2ZJQA 3OOCA 1Q81C 3G6JB 1UNSA 2HUGA 1KABA 2KEEA 3I4LA 3KUPA 4A3EH 5BN4A 1UE1A 1F9RA 1H9RA 3Q6SA 1E0BA 2CWAA 4NDXA 1ZEQX 4DPGA 2VB2X 4IUQA 4P74A 3GTLH 4I7ZC 4JI7Q 2B29A 2C5CA 5CBAE 1B8AA 2PO4A 4GLVB 2R7FA 3HZXA 4NXNQ 4AYBE 1S72A 1UAPA 3E0EA 5FO8B 1SN8A 4B3SQ 1AN8A 4KHPQ 2B2VC 3KBXA 2OTJA 5M3MB 2B2VA 1E1TA 2L55A 1N32Q 2MQHA 3HRZC 5FO9B 4QCLA 4RKBA 4M8AA 1FGBD 4KD3A 1A63A 4ZKBB 4EGVA 1HHVA 5DM63 2TSSA 1HR0W 2GN5A 1M90C 4FDBA 1TWCB 1TKWB 3K6OA 4OL7A 2Z6BA 1DOMA 5GAHC 2CVRA 3IKJA 1VQAA 3NUCA 4LFAQ 1BOSA 3I4OA 4R4TA 4RGMA 2VUMG 3UE1A 1K8GA 5IWAQ 4K14A 2VW9A 1HA6A 3U9OA 1I3QB 3MFGA 4DAMA 1SFOH 1E3PA 2VUMH 3BDOA 4BS9A 1DGSA 4CBVA 3I8ZA 4ZUIA 3A8IE 2F0QA 1B1ZA 4LFCQ 1YEZA 4UAIA 1NMFA 2UUAQ 4GZYC 4BWGB 1X3PA 2LXJA 1GO3E 3ER0A 3K0YA 3A7AB 3T16A 1F9QA 2VNUD 1SSOA 1GUGA 4A3BG 2BDNA 3PIO3 3I56A 3WOFA 4L6TB 5IT9L 5JEAJ 5C0XG 1SR3A 3ULPA 3L9AX 2N78A 2KBNA 3GTKH 4A3BH 3BVMA 2ZTEA 5I2XA 4O1NA 1XPUA 4UP7A 5C0XH 3EVQA 3S14H 1K8MA 4BY7B 3D6WA 4JI4Q 4CKCA 5EPLA 4FF3A 1JE4A 3P20A 3EROA 2B63G 1YZ6A 3CC7A 5IY0A 2LFNA 4H44C 4A4IA 1S40A 4OX9Q 2HT1A 1G6PA 3QB3A 2QA4A 1SYFA 3CQZB 2B63H 4CDEC 4YCVA 3JAME 1RF2D 4EX5A 1NY4A 3S16B 1EQVA 2Y0SB 1B7YB 3BYYB 5LL6X 2R7ZG 1G2TA 3O13A 2PQAA 3I55A 5KIXA 3NEMA 3M4QA 1WFQA 5C4JB 3KDFA 4R4IA 1EZ6A 3PF5A 2R7ZH 1GD7A 3JC66 3F2UA 2K1BA 5CBEE 4PV1C 1PFBA 3BJUA 3KK7A 4CDCC 4DR1L 2QDBA 4HJ5A 2C9OA 2BE5C 2R92B 1ZYRC 2JJQA 1MSGA 2ZJRA 4MTKA 3E0JA 1SE4A 4LUOA 4HSPA 1OXVA 4JI4L 4XDXA 4GN3B 2KCCA 2JEBI 4IO9A 4DNTB 2M9VA 3I4NG 3RZOB 3CCRA 3AMUA 2NWGA 4JBMA 1Q82C 4IPHA 1WTHA 3I4NH 2ZXPA 4R1JA 1CZWA 1LT4D 3PIPA 2JXMB 3OWFA 3HOXB 2B8FA 4P73A 3M85A 3JAMi 4DV4Q 1XMQQ 1RKNA 2IJ0A 2WIIB 5DM73 2F52A 5E3FA 2EQSA 4MTNA 4NKLA 1SMXA 2F3VA 2YTXA 2H5XA 4YCUA 1HNZQ 2ZM6L 4MNOA 4RFBA 5EKIA 2PQAB 5IYCG 3S2DH 1U9RA 5C4XG 4GOPC 5KGUA 1CUKA 3SHLA 3KDFB 3N6RA 1STAA 5EBCA 5JPMC 5IYCH 5C4XH 3K5OA 1DZ1A 2JYOA 4LF6L 2MHVA 4JI1Q 3K5MA 1T5EA 2GA4B 3L3OC 4PQXA 2IX1A 3B6YA 1BQQT 5K36G 2IWHA 2F0UA 2I07B 3A8JE 5M5XH 4LF5Q 1QNUA 5J22A 1AE3A 2L11A 2DNCA 4X65Q 4DR7Q 2UU9L 5K36H 1VQIA 4IJHA 4UDUC 4OWWB 4UP9A 1XXGA 4QJFA 5C3EB 1XJVA
chains in the Genus database with same CATH topology
2NN6G 1I94Q 2DGYA 1VQBA 1VCIA 3CMAA 4B3SL 4KHPL 2K50A 3CCVA 2CWPA 1GKHA 3PUXA 4IOAA 1TWHH 4Y52H 3HKZG 1I5FA 1N32L 1OXUA 3HOYG 1PH3A 1HJPA 4AQYQ 4JI6Q 4BY1G 4GKJQ 4YWKA 3K7AH 3M4PA 4R4OA 1KRTA 4GNXB 4LF9L 3S1NH 1LM0A 2I0QA 2A19A 1FJGQ 2UUCQ 4A93H 2KCTA 2XGTA 3L0OA 3HOYH 1CKNB 4JI8Q 1UEBA 4BY1H 4L5SA 4IFDG 5DLQE 1G51A 3T1YL 3PO2G 1UE6A 3T1HQ 3F2BA 1HNWQ 1TWAH 3FKIG 4GOPB 4LFAL 4A3IG 1OXSC 2YYZA 4GLAC 3ULLA 4DV3Q 2NN6I 3LGJA 4LUZA 4YY3Q 4A3GG 2IHFA 5GAGC 2CCZA 5IWAL 3PO2H 4X64Q 4P72A 3PF4A 3FKIH 4GN5A 5LMUQ 4DR3Q 3S1RH 1OTCA 3GD7A 3KYHC 3J81j 4A3IH 1NE3A 4OWTB 5GAEC 4A3CG 4A3GH 1EUJA 4AH6A 5EAYA 5GROA 4LF5L 2A1AA 3KJPA 4JYAQ 2QEXA 4DV5L 4B3TL 4LNQA 5IE8A 4LFCL 4A3CH 1IBLL 1X3FA 4LF4Q 3M3YH 4DR4Q 2AWNA 3RLOA 1HR0L 1T9HA 2PI2A 2UUAL 4PZ6A 1MJCA 4BBRG 4IFDI 1YHAA 3S17H 1NBWA 4HIKA 3A74A 1V43A 3CF5A 4NXMQ 1PV4A 1XNRQ 2K5HA 3CC2A 4A3KG 5IYBG 4BBRH 1JJGA 2JEAI 3HOWG 1CKMA 5JJLA 4X66Q 3I2ZA 3KOJA 3GTJH 3TREA 3HOVG 4JBJA 2VQFQ 4HJAA 4A3KH 5IYBH 5AJ3Q 2UXCL 2XTIA 1J6QA 1V1QA 3PV0A 3HOWH 1YJNA 1S3OA 3PUVA 4DR5Q 3UDGA 4B3MQ 3HOVH 1L2FA 4X62L 3W5OA 4IOCA 2GVAA 2UUCL 3PO3H 4DAYB 1CKOA 2YTYA 2R93G 2L15A 1E1OA 5M3MG 3FHWA 4OX9L 1YI2A 3RN5A 1O7IA 3UDXA 3KF6A 3NENA 3IRBA 2R93H 2JK8A 4JC0A 1Z9FA 4YCWA 5M3MH 2Q2HA 2OQKA 2OCEA 3MXNB 5HGQA 1PH8A 2UUBL 4DV0Q 1EIYB 2MO1A 4A3FG 3G71A 1KD1C 3CPFA 1IBMQ 1WOCA 2UXDQ 3EIVA 4UY8C 3I7FA 1YJWA 4JYAL 1Q86C 2RHQB 1K3RA 1TWCH 4OWXB 1JJ2A 1JMCA 1CKNA 4A3FH 1TWGH 2NVQH 3S1QH 2WFWA 3HKSA 4DR4L 3J80c 2AHOB 1VQ9A 4IFDJ 2Z6KC 4NPSA 1PH6A 4GOPA 2E8GA 2Z6KA 4C3IH 5JJIA 1Y1VH 2CKZB 3J7ZC 3K0XA 3U4ZA 1X9NA 1XNRL 3PIOA 1ASYA 2KENA 2C35B 1UE7A 1I3QH 2JE6I 1C9OA 3DLLA 4DR2L 1VQKA 1N9WA 4JI3Q 2I5MX 2F4VL 2ZJPA 1W3SA 2Z0SA 1VQLA 2N49A 1Q7YC 5M3FG 3GTPH 2MFIA 4DR6L 3HKZE 3GTMH 3STBC 2ID0A 1UE5A 4DR5L 1HZ9A 1X3EA 1X54A 2A8VA 5M3FH 4R4QA 2LSSA 2KHJA 5LMNW 1VQ6A 1AH9A 1HNXQ 4QIWE 1XPRA 3F2CA 4JCVE 3HFZB 4YWLA 2V1CC 1YVCA 1VQ8A 1I50H 3J81i 4GN4B 4A76A 4L5QA 1E7ZA 5IP7H 2WAQG 1KL9A 2DUDA 1VQ7A 4BY7G 5FJ8H 1NMGA 1U0LA 1Q46A 2VQEQ 3AFQA 4B3RQ 3KF6B 2JA5G 3H3VH 2RHSB 4DV0L 4DV4L 1XMQL 3CW2C 2UXDL 3Q8DA 3S2HH 4BBSG 3RZDH 5IT9c 2ATWA 4BY7H 2N8NA 4OO1G 3A5ZB 4JI5Q 1CSQA 2E5LQ 4PZ7A 4C3JH 4Y7NH 2AKWB 1HNZL 2JA5H 4JBWA 2HIVA 1FL0A 2PMZE 3E9IA 2WB1G 4PZ8A 4DUZQ 1KQSA 4JOIC 4BBSH 1SRUA 2Y0SG 4JOIA 2WP8J 1SE8A 4YHHQ 4A3JG 3OYYA 4XIGS 1ASZA 1N33Q 1QVFA 1HH2P 1OXTA 4DR1Q 3CCMA 1K83H 1PYBA 2JA7G 3H3VI 1FVIA 1YNXA 1EWIA 3RLFA 4DUYL 4LF7L 1GVPA 3J80i 4DV6Q 3S16H 1VS0A 4L5TA 4R4CA 2EIFA 1L1OC 2K52A 4JI1L 5IP9G 4A3JH 4A3MG 1QVGA 4WJ4A 1L1OA 1CSPA 2EXDA 1A8VA 2YTVA 4KI0A 3OTOL 4DV2Q 2JA7H 4A3DG 1VQDA 2NZHA 5BR8L 5GADC 4QQBX 1C7YA 4JV5Q 1P16A 5C4JH 1PH5A 5IP9H 4A3MH 1QVCA 3W1GA 3MEFA 4JI2Q 3FP9A 4A3DH 2AMCB 4LWCA 2PI2E 4YWMA 4X65L 3TEHB 4DV7Q 2R92G 4DR7L 4DV1L 4JBKA 4LF8Q 2JA6G 1X3GA 4LFBL 3CPWA 1N34L 1K0RA 1X65A 1LUZA 2IT1A 1JE5A 4LW1A 3GO5A 4AIMA 3CCEA 2R92H 2JA6H 1LTLA 5C44G 1E22A 2R7DA 1I94L 3S15H 1YHBA 1KXLA 2AWOA 2BH8A 1A62A 1BBWA 1QUQA 4NB3A 2HHHQ 3CC4A 4JG2A 2IX0A 2FXQA 4GLXA 5C44H 2QGQA 1AE2A 3CAMA 4AQYL 4JI6L 3PUYA 2ZM6Q 4GKJL 1D7QA 3NBHB 2VS1A 3VDYA 3GTQH 4C2MH 1VQNA 1WI5A 4A75A 4POGA 3AFPA 1KRSA 1FJGL 5E7NA 1HZCA 4H02A 3M4OH 1Q1BA 1VQ5A 3PUWA 5FLXc 4JI8L 3U50C 1K8AC 2UXBQ 2NZOA 3K7UC 1M1KC 3T1HL 1MIUA 1HNWL 4DV6L 4HJ8A 1KHIA 2RCNA 1U5KA 4DV3L 4LF6Q 2K75A 4YY3L 3GTGH 3BU2A 3F2DA 4IPDA 3S24A 3RN2A 4A3EG 4X64L 2ALYB 3NELA 3K81C 5LMUL 4DR3L 1W2BA 2ZJQA 5JEAG 1HZAA 1WCMG 2CFMA 1Q81C 3CD6A 4A3LG 1L1OB 4JI2L 3W1BA 4A3EH 1KAWA 2MNAA 1UE1A 2CWAA 1Y14B 3CP0A 3CCQA 1VQFA 1WCMH 4A3LH 4DPGA 4LF8L 4P74A 3GTLH 3D31A 1HZBA 4O2DA 2UU9Q 4LF4L 4JI7Q 1XPOA 2B29A 3F8TA 1B8AA 1VQHA 4O0AA 3TS2A 1K73C 4GLVB 1X56A 2R7FA 5JJKA 1YIJA 4NXML 4NXNQ 4AYBE 1S72A 1BKBA 2K4KA 2GVBA 4C3HH 3GTOH 3E0EA 1WYDA 1SN8A 2VY3A 1KC8C 1NTGA 4B3SQ 1FGUA 2ES2A 4KHPQ 4BXXG 2OTJA 4X66L 1SLJA 2K5VA 3UDFA 2VQFL 1E1TA 3AYHB 2OTLA 3PGZA 1QUQB 1OXXK 1TWFH 2MQHA 5AJ3L 1N32Q 3F1ZA 4BXXH 2WB1E 5C3EG 4QGUA 1K9MC 4B3ML 1A63A 2OQ0A 4LF9Q 1GM5A 1HR0W 2GN5A 1M90C 1B70B 4FDBA 2OWOA 2UXBL 3HOUG 5C3EH 3T1YQ 5GAHC 2E2HH 4QJFA 3ZJYC 3PUZA 4APVA 1VQAA 3EBEA 4LFAQ 2KCMA 3I4OA 4R4TA 2VUMG 1SROA 3UE1A 1K8GA 5IWAQ 5GQOA 1PHJA 4IPCA 2VW9A 1EYGA 4DAMA 1SFOH 1PH9A 1TXYA 1E3PA 2VUMH 1IBML 1EOVA 1DGSA 4JI0Q 3A0JA 1PH2A 1IXRA 2JQOA 3STBD 1VQPA 1PYSB 4DV5Q 4B3TQ 4HJ7A 4LFCQ 1YEZA 1IBLQ 1NMFA 2HIXA 3L7ZC 5LMNQ 1HR0Q 2UUAQ 5FLMG 1QZGA 2LXJA 1GO3E 3CQZH 2D0OA 5HY6A 3ER0A 1VQGA 3UE0A 4POFA 3TRZA 2VNUD 4A3BG 3I56A 5FLMH 5M5WH 1VQ4A 1JB7A 1XTDA 4JI3L 3U4VA 5JEAJ 5C0XG 1SR3A 1I6HH 4PG3A 3ULPA 1J5EQ 4HIDA 4A93G 1N8RC 1EQRA 2N78A 2ASBA 2KBNA 3GTKH 4A3BH 3HOZG 1LYLA 3HOUH 2BA1A 2ZTEA 4DK6C 4QL5A 2UXCQ 4XTCS 2YU9H 4UP7A 1VQMA 1XPUA 4GKKQ 3S14H 1RIPA 1PFSA 3EN2A 4X62Q 4JI4Q 3M7NA 1E24A 2VL6A 4DK3C 4BA2I 2IY5B 3HOZH 4OONA 1Q1EA 4TVAB 1HNXL 5ELNA 2B63G 1YZ6A 3CCSA 3CC7A 5IY0A 1C0AA 1BVSA 2CQOA 3AQQA 4A4IA 1S40A 4OX9Q 2HT1A 2F3IA 3JAMc 1VQJA 1G6PA 5ELOA 2QA4A 3WWVA 5J3BA 1XNQQ 1VQEA 2B63H 2E2JH 3AEVA 4YCVA 2D62A 3CMEA 4EX5A 1NY4A 4IJLA 4P75A 2VQEL 4HJ9A 4B3RL 1B7YB 5C0XI 2IHEA 2UUBQ 3K80C 2R7ZG 1X55A 2JA8G 2PQAA 3I55A 4JI0L 4JI5L 2E5LL 3BZKA 4UP8A 3NEMA 3M4QA 1WFQA 3KF8B 3L2PA 1R9TH 3KDFA 4R4IA 1X6OA 4DUZL 3PF5A 2R7ZH 1GD7A 1P8LA 3JC66 2JA8H 3RZOH 5LMNL 1EIFA 1G291 1BBUA 3HOXG 4YHHL 2HQLA 3BJUA 1EFWA 1N33L 5H1SE 4RG1A 3E9HA 4IPGA 3SGIA 4DR1L 4K0KQ 1PH4A 3OW2A 4HJ5A 4EQ5A 2MO0A 2BA0A 1EQQA 3RR5A 1VQCA 1YJ9A 3HOXH 4PMWA 4DR2Q 3ERSX 3TS0A 1J5EL 2F4VQ 2I5LX 3A5UA 4DV2L 3PO3G 3GDEA 1IL2A 2JJQA 1MJEA 4DR6Q 2ZJRA 4JV5L 2LXKA 4LUOA 3TQYA 4GKKL 1YHQA 3J81c 1OXVA 3PCOB 4JI4L 4GN3B 2JEBI 2VZAA 4IO9A 1Y1WG 1NJIC 4DV7L 3KLWA 1N36Q 4BA1I 3I4NG 3M9BA 1D8LA 5IYDG 3CCRA 2N3SA 2Q2IA 4JBMA 2NVXH 1RL2A 1MKHA 1Q82C 3I4MG 1XNQL 4IPHA 4HIOA 4QY7A 1Y1WH 3J7A5 1XMOQ 3D0FA 2NVYH 1PA6A 3I4NH 1IBKQ 1JT8A 5C0XJ 5IYDH 2R6GA 2JA9A 2K5NA 2WAQE 4R1JA 3PIPA 3KFUA 2RF4A 2ZTDA 2HHHL 3I4MH 4P73A 3M85A 4DV4Q 3JAMi 1Q8KA 1XMQQ 1JJCB 4GNXC 3PSIA 3RNUA 2F52A 4P71A 2EQSA 4GNXA 4KLKA 1IZ6A 4MTNA 1SMXA 2YTXA 4YCUA 2H5XA 4X6AH 3G6EA 4TQUS 4ME3A 2ZM6L 1HNZQ 1Y1VG 4MNOA 3S2DH 2PQAB 5IYCG 1UWVA 1WJJA 1Z47A 5C4XG 4GOPC 2D0PA 1CUKA 3ICEA 1QZHA 2Y0SE 3KDFB 1IBKL 1L0WA 4K0KL 1YITA 1PVOA 4DKAC 5IYCH 1A0IA 5C4XH 3BZCA 4ALPA 3H0GG 4DUYQ 4LUVA 1YBYA 2YV5A 4LF7Q 1PH1A 4LF6L 4WJ3M 4JI1Q 2E2IH 1H95A 4HIMA 1Q12A 4OXPA 3OTOQ 4OO1I 2B3GA 3H15A 3H0GH 5BR8Q 2IX1A 1KIXA 2KHIA 3UDIA 4MZ9A 4GS3A 4RMFA 3ULJA 2Q2UA 3B6YA 4DNIA 4UPAA 5K36G 3CXCA 3G4SA 5M5XH 4LF5Q 1IYJB 1V9PA 1VQOA 2Q2TA 4KHZA 1AE3A 1N36L 4X65Q 5M5YH 3G48A 3KJOA 1PH7A 4DR7Q 4DV1Q 2PNHA 5IP7G 3CCUA 2UU9L 1VQIA 4IJHA 4JI7L 5FJ8G 2BH2A 1N34Q 2I5HA 2NVTH 3S1MH 4J15A 3CCLA 4LFBQ 2K14A 3K8AA 3U58A 4OWWB 4UP9A 4L5RC 1XMOL 2ZTCA 3RLNA 4AYBG 3CCJA 3DM3A 4NXNL 1XJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 G;  1I94 Q;  2DGY A;  1VQB A;  1VCI A;  3CMA A;  4B3S L;  4KHP L;  2K50 A;  3CCV A;  2CWP A;  1GKH A;  3PUX A;  4IOA A;  1TWH H;  4Y52 H;  3HKZ G;  1I5F A;  1N32 L;  1OXU A;  3HOY G;  1PH3 A;  1HJP A;  4AQY Q;  4JI6 Q;  4BY1 G;  4GKJ Q;  4YWK A;  3K7A H;  3M4P A;  4R4O A;  1KRT A;  4GNX B;  4LF9 L;  3S1N H;  1LM0 A;  2I0Q A;  2A19 A;  1FJG Q;  2UUC Q;  4A93 H;  2KCT A;  2XGT A;  3L0O A;  3HOY H;  1CKN B;  4JI8 Q;  1UEB A;  4BY1 H;  4L5S A;  4IFD G;  5DLQ E;  1G51 A;  3T1Y L;  3PO2 G;  1UE6 A;  3T1H Q;  3F2B A;  1HNW Q;  1TWA H;  3FKI G;  4GOP B;  4LFA L;  4A3I G;  1OXS C;  2YYZ A;  4GLA C;  3ULL A;  4DV3 Q;  2NN6 I;  3LGJ A;  4LUZ A;  4YY3 Q;  4A3G G;  2IHF A;  5GAG C;  2CCZ A;  5IWA L;  3PO2 H;  4X64 Q;  4P72 A;  3PF4 A;  3FKI H;  4GN5 A;  5LMU Q;  4DR3 Q;  3S1R H;  1OTC A;  3GD7 A;  3KYH C;  3J81 j;  4A3I H;  1NE3 A;  4OWT B;  5GAE C;  4A3C G;  4A3G H;  1EUJ A;  4AH6 A;  5EAY A;  5GRO A;  4LF5 L;  2A1A A;  3KJP A;  4JYA Q;  2QEX A;  4DV5 L;  4B3T L;  4LNQ A;  5IE8 A;  4LFC L;  4A3C H;  1IBL L;  1X3F A;  4LF4 Q;  3M3Y H;  4DR4 Q;  2AWN A;  3RLO A;  1HR0 L;  1T9H A;  2PI2 A;  2UUA L;  4PZ6 A;  1MJC A;  4BBR G;  4IFD I;  1YHA A;  3S17 H;  1NBW A;  4HIK A;  3A74 A;  1V43 A;  3CF5 A;  4NXM Q;  1PV4 A;  1XNR Q;  2K5H A;  3CC2 A;  4A3K G;  5IYB G;  4BBR H;  1JJG A;  2JEA I;  3HOW G;  1CKM A;  5JJL A;  4X66 Q;  3I2Z A;  3KOJ A;  3GTJ H;  3TRE A;  3HOV G;  4JBJ A;  2VQF Q;  4HJA A;  4A3K H;  5IYB H;  5AJ3 Q;  2UXC L;  2XTI A;  1J6Q A;  1V1Q A;  3PV0 A;  3HOW H;  1YJN A;  1S3O A;  3PUV A;  4DR5 Q;  3UDG A;  4B3M Q;  3HOV H;  1L2F A;  4X62 L;  3W5O A;  4IOC A;  2GVA A;  2UUC L;  3PO3 H;  4DAY B;  1CKO A;  2YTY A;  2R93 G;  2L15 A;  1E1O A;  5M3M G;  3FHW A;  4OX9 L;  1YI2 A;  3RN5 A;  1O7I A;  3UDX A;  3KF6 A;  3NEN A;  3IRB A;  2R93 H;  2JK8 A;  4JC0 A;  1Z9F A;  4YCW A;  5M3M H;  2Q2H A;  2OQK A;  2OCE A;  3MXN B;  5HGQ A;  1PH8 A;  2UUB L;  4DV0 Q;  1EIY B;  2MO1 A;  4A3F G;  3G71 A;  1KD1 C;  3CPF A;  1IBM Q;  1WOC A;  2UXD Q;  3EIV A;  4UY8 C;  3I7F A;  1YJW A;  4JYA L;  1Q86 C;  2RHQ B;  1K3R A;  1TWC H;  4OWX B;  1JJ2 A;  1JMC A;  1CKN A;  4A3F H;  1TWG H;  2NVQ H;  3S1Q H;  2WFW A;  3HKS A;  4DR4 L;  3J80 c;  2AHO B;  1VQ9 A;  4IFD J;  2Z6K C;  4NPS A;  1PH6 A;  4GOP A;  2E8G A;  2Z6K A;  4C3I H;  5JJI A;  1Y1V H;  2CKZ B;  3J7Z C;  3K0X A;  3U4Z A;  1X9N A;  1XNR L;  3PIO A;  1ASY A;  2KEN A;  2C35 B;  1UE7 A;  1I3Q H;  2JE6 I;  1C9O A;  3DLL A;  4DR2 L;  1VQK A;  1N9W A;  4JI3 Q;  2I5M X;  2F4V L;  2ZJP A;  1W3S A;  2Z0S A;  1VQL A;  2N49 A;  1Q7Y C;  5M3F G;  3GTP H;  2MFI A;  4DR6 L;  3HKZ E;  3GTM H;  3STB C;  2ID0 A;  1UE5 A;  4DR5 L;  1HZ9 A;  1X3E A;  1X54 A;  2A8V A;  5M3F H;  4R4Q A;  2LSS A;  2KHJ A;  5LMN W;  1VQ6 A;  1AH9 A;  1HNX Q;  4QIW E;  1XPR A;  3F2C A;  4JCV E;  3HFZ B;  4YWL A;  2V1C C;  1YVC A;  1VQ8 A;  1I50 H;  3J81 i;  4GN4 B;  4A76 A;  4L5Q A;  1E7Z A;  5IP7 H;  2WAQ G;  1KL9 A;  2DUD A;  1VQ7 A;  4BY7 G;  5FJ8 H;  1NMG A;  1U0L A;  1Q46 A;  2VQE Q;  3AFQ A;  4B3R Q;  3KF6 B;  2JA5 G;  3H3V H;  2RHS B;  4DV0 L;  4DV4 L;  1XMQ L;  3CW2 C;  2UXD L;  3Q8D A;  3S2H H;  4BBS G;  3RZD H;  5IT9 c;  2ATW A;  4BY7 H;  2N8N A;  4OO1 G;  3A5Z B;  4JI5 Q;  1CSQ A;  2E5L Q;  4PZ7 A;  4C3J H;  4Y7N H;  2AKW B;  1HNZ L;  2JA5 H;  4JBW A;  2HIV A;  1FL0 A;  2PMZ E;  3E9I A;  2WB1 G;  4PZ8 A;  4DUZ Q;  1KQS A;  4JOI C;  4BBS H;  1SRU A;  2Y0S G;  4JOI A;  2WP8 J;  1SE8 A;  4YHH Q;  4A3J G;  3OYY A;  4XIG S;  1ASZ A;  1N33 Q;  1QVF A;  1HH2 P;  1OXT A;  4DR1 Q;  3CCM A;  1K83 H;  1PYB A;  2JA7 G;  3H3V I;  1FVI A;  1YNX A;  1EWI A;  3RLF A;  4DUY L;  4LF7 L;  1GVP A;  3J80 i;  4DV6 Q;  3S16 H;  1VS0 A;  4L5T A;  4R4C A;  2EIF A;  1L1O C;  2K52 A;  4JI1 L;  5IP9 G;  4A3J H;  4A3M G;  1QVG A;  4WJ4 A;  1L1O A;  1CSP A;  2EXD A;  1A8V A;  2YTV A;  4KI0 A;  3OTO L;  4DV2 Q;  2JA7 H;  4A3D G;  1VQD A;  2NZH A;  5BR8 L;  5GAD C;  4QQB X;  1C7Y A;  4JV5 Q;  1P16 A;  5C4J H;  1PH5 A;  5IP9 H;  4A3M H;  1QVC A;  3W1G A;  3MEF A;  4JI2 Q;  3FP9 A;  4A3D H;  2AMC B;  4LWC A;  2PI2 E;  4YWM A;  4X65 L;  3TEH B;  4DV7 Q;  2R92 G;  4DR7 L;  4DV1 L;  4JBK A;  4LF8 Q;  2JA6 G;  1X3G A;  4LFB L;  3CPW A;  1N34 L;  1K0R A;  1X65 A;  1LUZ A;  2IT1 A;  1JE5 A;  4LW1 A;  3GO5 A;  4AIM A;  3CCE A;  2R92 H;  2JA6 H;  1LTL A;  5C44 G;  1E22 A;  2R7D A;  1I94 L;  3S15 H;  1YHB A;  1KXL A;  2AWO A;  2BH8 A;  1A62 A;  1BBW A;  1QUQ A;  4NB3 A;  2HHH Q;  3CC4 A;  4JG2 A;  2IX0 A;  2FXQ A;  4GLX A;  5C44 H;  2QGQ A;  1AE2 A;  3CAM A;  4AQY L;  4JI6 L;  3PUY A;  2ZM6 Q;  4GKJ L;  1D7Q A;  3NBH B;  2VS1 A;  3VDY A;  3GTQ H;  4C2M H;  1VQN A;  1WI5 A;  4A75 A;  4POG A;  3AFP A;  1KRS A;  1FJG L;  5E7N A;  1HZC A;  4H02 A;  3M4O H;  1Q1B A;  1VQ5 A;  3PUW A;  5FLX c;  4JI8 L;  3U50 C;  1K8A C;  2UXB Q;  2NZO A;  3K7U C;  1M1K C;  3T1H L;  1MIU A;  1HNW L;  4DV6 L;  4HJ8 A;  1KHI A;  2RCN A;  1U5K A;  4DV3 L;  4LF6 Q;  2K75 A;  4YY3 L;  3GTG H;  3BU2 A;  3F2D A;  4IPD A;  3S24 A;  3RN2 A;  4A3E G;  4X64 L;  2ALY B;  3NEL A;  3K81 C;  5LMU L;  4DR3 L;  1W2B A;  2ZJQ A;  5JEA G;  1HZA A;  1WCM G;  2CFM A;  1Q81 C;  3CD6 A;  4A3L G;  1L1O B;  4JI2 L;  3W1B A;  4A3E H;  1KAW A;  2MNA A;  1UE1 A;  2CWA A;  1Y14 B;  3CP0 A;  3CCQ A;  1VQF A;  1WCM H;  4A3L H;  4DPG A;  4LF8 L;  4P74 A;  3GTL H;  3D31 A;  1HZB A;  4O2D A;  2UU9 Q;  4LF4 L;  4JI7 Q;  1XPO A;  2B29 A;  3F8T A;  1B8A A;  1VQH A;  4O0A A;  3TS2 A;  1K73 C;  4GLV B;  1X56 A;  2R7F A;  5JJK A;  1YIJ A;  4NXM L;  4NXN Q;  4AYB E;  1S72 A;  1BKB A;  2K4K A;  2GVB A;  4C3H H;  3GTO H;  3E0E A;  1WYD A;  1SN8 A;  2VY3 A;  1KC8 C;  1NTG A;  4B3S Q;  1FGU A;  2ES2 A;  4KHP Q;  4BXX G;  2OTJ A;  4X66 L;  1SLJ A;  2K5V A;  3UDF A;  2VQF L;  1E1T A;  3AYH B;  2OTL A;  3PGZ A;  1QUQ B;  1OXX K;  1TWF H;  2MQH A;  5AJ3 L;  1N32 Q;  3F1Z A;  4BXX H;  2WB1 E;  5C3E G;  4QGU A;  1K9M C;  4B3M L;  1A63 A;  2OQ0 A;  4LF9 Q;  1GM5 A;  1HR0 W;  2GN5 A;  1M90 C;  1B70 B;  4FDB A;  2OWO A;  2UXB L;  3HOU G;  5C3E H;  3T1Y Q;  5GAH C;  2E2H H;  4QJF A;  3ZJY C;  3PUZ A;  4APV A;  1VQA A;  3EBE A;  4LFA Q;  2KCM A;  3I4O A;  4R4T A;  2VUM G;  1SRO A;  3UE1 A;  1K8G A;  5IWA Q;  5GQO A;  1PHJ A;  4IPC A;  2VW9 A;  1EYG A;  4DAM A;  1SFO H;  1PH9 A;  1TXY A;  1E3P A;  2VUM H;  1IBM L;  1EOV A;  1DGS A;  4JI0 Q;  3A0J A;  1PH2 A;  1IXR A;  2JQO A;  3STB D;  1VQP A;  1PYS B;  4DV5 Q;  4B3T Q;  4HJ7 A;  4LFC Q;  1YEZ A;  1IBL Q;  1NMF A;  2HIX A;  3L7Z C;  5LMN Q;  1HR0 Q;  2UUA Q;  5FLM G;  1QZG A;  2LXJ A;  1GO3 E;  3CQZ H;  2D0O A;  5HY6 A;  3ER0 A;  1VQG A;  3UE0 A;  4POF A;  3TRZ A;  2VNU D;  4A3B G;  3I56 A;  5FLM H;  5M5W H;  1VQ4 A;  1JB7 A;  1XTD A;  4JI3 L;  3U4V A;  5JEA J;  5C0X G;  1SR3 A;  1I6H H;  4PG3 A;  3ULP A;  1J5E Q;  4HID A;  4A93 G;  1N8R C;  1EQR A;  2N78 A;  2ASB A;  2KBN A;  3GTK H;  4A3B H;  3HOZ G;  1LYL A;  3HOU H;  2BA1 A;  2ZTE A;  4DK6 C;  4QL5 A;  2UXC Q;  4XTC S;  2YU9 H;  4UP7 A;  1VQM A;  1XPU A;  4GKK Q;  3S14 H;  1RIP A;  1PFS A;  3EN2 A;  4X62 Q;  4JI4 Q;  3M7N A;  1E24 A;  2VL6 A;  4DK3 C;  4BA2 I;  2IY5 B;  3HOZ H;  4OON A;  1Q1E A;  4TVA B;  1HNX L;  5ELN A;  2B63 G;  1YZ6 A;  3CCS A;  3CC7 A;  5IY0 A;  1C0A A;  1BVS A;  2CQO A;  3AQQ A;  4A4I A;  1S40 A;  4OX9 Q;  2HT1 A;  2F3I A;  3JAM c;  1VQJ A;  1G6P A;  5ELO A;  2QA4 A;  3WWV A;  5J3B A;  1XNQ Q;  1VQE A;  2B63 H;  2E2J H;  3AEV A;  4YCV A;  2D62 A;  3CME A;  4EX5 A;  1NY4 A;  4IJL A;  4P75 A;  2VQE L;  4HJ9 A;  4B3R L;  1B7Y B;  5C0X I;  2IHE A;  2UUB Q;  3K80 C;  2R7Z G;  1X55 A;  2JA8 G;  2PQA A;  3I55 A;  4JI0 L;  4JI5 L;  2E5L L;  3BZK A;  4UP8 A;  3NEM A;  3M4Q A;  1WFQ A;  3KF8 B;  3L2P A;  1R9T H;  3KDF A;  4R4I A;  1X6O A;  4DUZ L;  3PF5 A;  2R7Z H;  1GD7 A;  1P8L A;  3JC6 6;  2JA8 H;  3RZO H;  5LMN L;  1EIF A;  1G29 1;  1BBU A;  3HOX G;  4YHH L;  2HQL A;  3BJU A;  1EFW A;  1N33 L;  5H1S E;  4RG1 A;  3E9H A;  4IPG A;  3SGI A;  4DR1 L;  4K0K Q;  1PH4 A;  3OW2 A;  4HJ5 A;  4EQ5 A;  2MO0 A;  2BA0 A;  1EQQ A;  3RR5 A;  1VQC A;  1YJ9 A;  3HOX H;  4PMW A;  4DR2 Q;  3ERS X;  3TS0 A;  1J5E L;  2F4V Q;  2I5L X;  3A5U A;  4DV2 L;  3PO3 G;  3GDE A;  1IL2 A;  2JJQ A;  1MJE A;  4DR6 Q;  2ZJR A;  4JV5 L;  2LXK A;  4LUO A;  3TQY A;  4GKK L;  1YHQ A;  3J81 c;  1OXV A;  3PCO B;  4JI4 L;  4GN3 B;  2JEB I;  2VZA A;  4IO9 A;  1Y1W G;  1NJI C;  4DV7 L;  3KLW A;  1N36 Q;  4BA1 I;  3I4N G;  3M9B A;  1D8L A;  5IYD G;  3CCR A;  2N3S A;  2Q2I A;  4JBM A;  2NVX H;  1RL2 A;  1MKH A;  1Q82 C;  3I4M G;  1XNQ L;  4IPH A;  4HIO A;  4QY7 A;  1Y1W H;  3J7A 5;  1XMO Q;  3D0F A;  2NVY H;  1PA6 A;  3I4N H;  1IBK Q;  1JT8 A;  5C0X J;  5IYD H;  2R6G A;  2JA9 A;  2K5N A;  2WAQ E;  4R1J A;  3PIP A;  3KFU A;  2RF4 A;  2ZTD A;  2HHH L;  3I4M H;  4P73 A;  3M85 A;  4DV4 Q;  3JAM i;  1Q8K A;  1XMQ Q;  1JJC B;  4GNX C;  3PSI A;  3RNU A;  2F52 A;  4P71 A;  2EQS A;  4GNX A;  4KLK A;  1IZ6 A;  4MTN A;  1SMX A;  2YTX A;  4YCU A;  2H5X A;  4X6A H;  3G6E A;  4TQU S;  4ME3 A;  2ZM6 L;  1HNZ Q;  1Y1V G;  4MNO A;  3S2D H;  2PQA B;  5IYC G;  1UWV A;  1WJJ A;  1Z47 A;  5C4X G;  4GOP C;  2D0P A;  1CUK A;  3ICE A;  1QZH A;  2Y0S E;  3KDF B;  1IBK L;  1L0W A;  4K0K L;  1YIT A;  1PVO A;  4DKA C;  5IYC H;  1A0I A;  5C4X H;  3BZC A;  4ALP A;  3H0G G;  4DUY Q;  4LUV A;  1YBY A;  2YV5 A;  4LF7 Q;  1PH1 A;  4LF6 L;  4WJ3 M;  4JI1 Q;  2E2I H;  1H95 A;  4HIM A;  1Q12 A;  4OXP A;  3OTO Q;  4OO1 I;  2B3G A;  3H15 A;  3H0G H;  5BR8 Q;  2IX1 A;  1KIX A;  2KHI A;  3UDI A;  4MZ9 A;  4GS3 A;  4RMF A;  3ULJ A;  2Q2U A;  3B6Y A;  4DNI A;  4UPA A;  5K36 G;  3CXC A;  3G4S A;  5M5X H;  4LF5 Q;  1IYJ B;  1V9P A;  1VQO A;  2Q2T A;  4KHZ A;  1AE3 A;  1N36 L;  4X65 Q;  5M5Y H;  3G48 A;  3KJO A;  1PH7 A;  4DR7 Q;  4DV1 Q;  2PNH A;  5IP7 G;  3CCU A;  2UU9 L;  1VQI A;  4IJH A;  4JI7 L;  5FJ8 G;  2BH2 A;  1N34 Q;  2I5H A;  2NVT H;  3S1M H;  4J15 A;  3CCL A;  4LFB Q;  2K14 A;  3K8A A;  3U58 A;  4OWW B;  4UP9 A;  4L5R C;  1XMO L;  2ZTC A;  3RLN A;  4AYB G;  3CCJ A;  3DM3 A;  4NXN L;  1XJV A; 
#chains in the Genus database with same CATH topology
 3I90 A;  2K7V A;  5CMD A;  1LO5 D;  1VCI A;  5HUR A;  1EL0 A;  1S5E D;  2K50 A;  4G7Z C;  1GKH A;  3DWQ A;  4IOA A;  1TWH H;  4Y52 H;  1I5F A;  1EIG A;  3H0G B;  4DAY A;  4BY1 G;  5CYU A;  4R4O A;  1SE3 A;  3S1N H;  1ENF A;  3BVG A;  2A19 A;  1AZQ A;  2UUC Q;  4IUP A;  4JI8 Q;  4WOR A;  4BY1 H;  4IFD G;  1G51 A;  3J7A F;  3U9S A;  3PO2 G;  2NVT B;  3V96 A;  3BS1 A;  1TWA H;  4GOP B;  2SOB A;  5CR3 A;  4K2L A;  4A3G G;  4HSV A;  2CCZ A;  4IFD H;  3PO2 H;  1B50 A;  4GN5 A;  4EQO A;  1CK1 A;  4DR3 Q;  1OTC A;  3J81 j;  3VYS A;  4OWT B;  5GAE C;  4A3G H;  1EUJ A;  4XXE A;  3NTH A;  4RGN A;  3GP7 A;  5GRO A;  1GXD C;  1UEA B;  4LF5 L;  2EDG A;  5CV5 A;  2PYK A;  5CV4 A;  3TP7 A;  4KN7 C;  3M3Y H;  2AWN A;  1G91 A;  4A93 B;  4MIU A;  1HA5 A;  1MJC A;  4BBR G;  1TT2 A;  3HOZ B;  4CJ1 B;  3S17 H;  2Z8L A;  4HIK A;  3D6C A;  3K5L A;  1V43 A;  1XNR Q;  4J6H A;  4BBR H;  1JQY D;  2JEA I;  3K58 A;  3HOW G;  4C56 C;  4X66 Q;  3BYT B;  3FKI B;  2UXC L;  3FDT A;  4F87 A;  3HOW H;  2G9D A;  3UDG A;  4B3M Q;  1L2F A;  1F2Z A;  1QIL A;  3A7L A;  2GVA A;  4X62 L;  2UUC L;  4DAY B;  1CKO A;  2R93 G;  2L15 A;  4FF2 A;  3MVV A;  1YI2 A;  3RN5 A;  3UDX A;  3KF6 A;  3IRB A;  2R93 H;  2OQK A;  2K01 A;  1TY0 A;  1RTO A;  1PH8 A;  2UUB L;  3G71 A;  3CPF A;  3I70 A;  1YJW A;  1DCZ A;  1K3R A;  1JJ2 A;  2XN9 C;  4KKU A;  4DAV A;  3J80 c;  1ET6 A;  1PH6 A;  2EZV A;  3KLR A;  1Y1V H;  1XNR L;  3PIO A;  3H3V C;  1UE7 A;  1PXU A;  2JE6 I;  3DLL A;  3T56 B;  4DR2 L;  5AFW A;  2KUM A;  1N9W A;  3MEH A;  1VQK A;  1FNV A;  1XWE A;  2Z0S A;  3LWU A;  1Q7Y C;  1ET9 A;  3J80 L;  1UE5 A;  1HZ9 A;  1X3E A;  4K6D A;  1ZXT A;  2A8V A;  1GUW A;  5LMN W;  1VQ6 A;  3S1Q B;  1TWG B;  4KY6 A;  4YWL A;  1Z6H A;  2QW7 A;  2V1C C;  3J81 i;  3URY A;  2XWB B;  2EY5 A;  2WAQ G;  3TN2 A;  1W6J A;  5FJ8 H;  2K6A A;  3V05 A;  1QB5 D;  2VQE Q;  4B3R Q;  3KF6 B;  2Z4H A;  4K5V A;  3NBH A;  3QJY A;  2N55 A;  2N8N A;  4JI5 Q;  2E5L Q;  4PZ7 A;  2E2D C;  2AKW B;  4Y7N H;  2HIV A;  5IT9 E;  5M3F B;  1H9S A;  1Y8N B;  2WP8 J;  1SE8 A;  2VB3 X;  3OYY A;  4LJZ C;  1N33 Q;  1PZI D;  4FF4 A;  2D2C C;  2JA7 G;  3H3V I;  2EE1 A;  4DUY L;  4ID6 A;  1I50 B;  4LF7 L;  4FF1 A;  1VS0 A;  4L5T A;  1U4P A;  2K52 A;  4A3M G;  2SNM A;  4CDD C;  1QVG A;  1CSP A;  4WJW A;  1BDO A;  2JA7 H;  3OTO L;  4DV2 Q;  1VQD A;  1C7Y A;  4A3M H;  2L0C A;  2MJ8 A;  2F0K A;  4JI2 Q;  1WTX A;  2PI2 E;  4N8F A;  5C3W A;  2MP1 A;  4DV1 L;  4JBK A;  1JOK A;  1N34 L;  4BBS B;  4J8Q A;  2LY7 A;  5I2Y A;  1JE5 A;  4AIM A;  1JC7 A;  4DFA A;  1LTL A;  5C44 G;  4ZYS A;  1KXL A;  1QUQ A;  1BBW A;  3PQI A;  2HQE A;  5C44 H;  3CAM A;  4AQY L;  4JI6 L;  3PUY A;  5F2D A;  2CH4 W;  4GKJ L;  1EY9 A;  2XIW A;  2VS1 A;  3NBH B;  3VR4 A;  2XRQ D;  1WI5 A;  4A75 A;  1HFG A;  1QOH A;  4FVM A;  1K8A C;  2NZO A;  3K7U C;  2Z9H A;  1SJH D;  3FRP B;  3T1H L;  1HNW L;  3QWN A;  5FLX E;  1H9S B;  1EY4 A;  4DGZ A;  1KHI A;  1U5K A;  2RCN A;  5I6Y A;  3GTG H;  3BU2 A;  4WRD A;  4IPD A;  3F2D A;  2RSO A;  1JOR A;  1TVX A;  4I7A A;  3NEL A;  3FVQ A;  1W2B A;  3PMF A;  4O42 A;  2F0G A;  5JEA G;  1WCM G;  2F0I A;  5E4W C;  4FP5 D;  4XQJ A;  1CA6 A;  3CD6 A;  5KNC A;  4HTH A;  4JI2 L;  3W1B A;  1LTI D;  3FMC A;  1Y14 B;  2QEJ C;  1WTO A;  5JEA H;  1WCM H;  3OW7 A;  1DXM A;  3GTQ B;  4C2M B;  4LF4 L;  1XPO A;  1AZP A;  1VQH A;  3TS2 A;  3M4Y A;  1K73 C;  5JJK A;  1S4Z A;  2EY6 A;  4NXM L;  2RBM A;  3GTO H;  2K4K A;  1F2Y A;  1NTG A;  1FGU A;  1SLJ A;  2VQF L;  1GOZ A;  3AYH B;  5CV9 A;  1QUQ B;  1VF5 C;  1DON A;  4ZKC B;  1STN A;  1EFI D;  1K9M C;  4ZAI A;  4LF9 Q;  1GM5 A;  1HQM C;  1B70 B;  2NVQ B;  3GTL B;  3T1Y Q;  2E2H H;  3ZJY C;  3PUZ A;  4APV A;  3EBE A;  2KCM A;  4KN4 C;  4FXK C;  4C3I B;  1PZK D;  1I4H A;  2K33 A;  2B2T C;  5I9P A;  2B2T A;  1IHZ A;  1STG A;  4IUN A;  5M9O A;  1PH9 A;  1TXY A;  1U4L A;  3PIP 3;  5EPK A;  1DOL A;  1IBM L;  5JOB A;  3GTP B;  2JQO A;  5FOB B;  1VQP A;  1PYS B;  2BOS A;  2F0E A;  1CQF A;  4TRD A;  2HIX A;  1HR0 Q;  3NWT A;  5FLM G;  1NCV A;  1KTK A;  2OEO A;  5JVG 3;  3NPP A;  3ZYY X;  1D1I A;  1VQG A;  4POF A;  3TRZ A;  1A15 A;  1D5Z C;  5FLM H;  5M5W H;  4JI3 L;  3U4V A;  5KEE A;  1I6H H;  4PG3 A;  4XT1 B;  2ASB A;  1SFO B;  3HOU H;  2BA1 A;  2VUM B;  4XTC S;  1VQM A;  2F0L A;  2M00 A;  4J1M A;  1PFS A;  3RZD B;  1PYW D;  3M7N A;  4BA2 I;  2VL6 A;  4DK3 C;  2R3Z A;  2AQ1 B;  2IY5 B;  4N8X 1;  1SXT A;  1C0A A;  3CCS A;  2CQO A;  1WTV A;  3T4A C;  5C5L A;  1VQJ A;  2CW0 C;  1SYE A;  3WWV A;  1XNQ Q;  1VQE A;  2XVS A;  2E2J H;  3AEV A;  1K83 B;  2D62 A;  4RHR A;  3CME A;  4P75 A;  4HJ9 A;  1SNP A;  5C0X I;  4QF4 A;  4R9W A;  3K80 C;  3M7G A;  1KDB A;  2JA8 G;  4NW2 A;  2QKI C;  5COY A;  3VA7 A;  4UP8 A;  3G7L A;  3GTK B;  4A3B B;  1JWS D;  5I6W A;  4DUZ L;  1P8L A;  2JA8 H;  1PDQ A;  5G3L F;  5IOD A;  1EFW A;  4RG1 A;  4IPG A;  4K0K Q;  1YNJ D;  2BA0 A;  3RR5 A;  1VQC A;  2A73 B;  2B2W C;  2B2W A;  3ERS X;  2JA6 B;  3TS0 A;  3BDC A;  2I5L X;  4CHT B;  4Z9C B;  1SJE D;  5IIF A;  1IL2 A;  3PO3 G;  4JV5 L;  3OWE B;  3J7Y W;  3J81 c;  1YHQ A;  4FXD A;  3PCO B;  1Q3L A;  3SE0 A;  2EYF A;  3HEJ A;  2F0S A;  3H91 A;  4DV7 L;  3RD4 A;  1FYC A;  4BA1 I;  1SYG A;  2X69 A;  4HN7 A;  4HCS A;  1EY6 A;  2N3S A;  3A8K E;  2NVX H;  1MKH A;  1XNQ L;  3J7A V;  4IN3 A;  3D0F A;  4OGQ C;  2NVY H;  4RKL A;  4N9T A;  1BO0 A;  4HCE A;  2HHH L;  1GUT A;  4OO1 G;  1Q8K A;  3RNU A;  1IZ6 A;  5DEH A;  2EJM A;  3NHH A;  2KOL A;  4TQU S;  4OO1 H;  4H0L C;  1UWV A;  2E75 C;  3IAY A;  1B44 D;  4HMJ A;  1QZH A;  1D5M C;  3CHB D;  4NMZ A;  4K0K L;  3E6Z X;  1D1K A;  4ALP A;  4KJO A;  2YV5 A;  4KTA A;  1PH1 A;  4WJ3 M;  1JOQ A;  1HTP A;  2HDL A;  2QF7 A;  1ENA A;  2B3G A;  2Q8I B;  3K5N A;  3LX0 A;  2KHI A;  1R4P B;  1LT5 D;  4L8J A;  1A2U A;  4UPA A;  1IYJ B;  1ESF A;  1VQO A;  1TWF B;  3KJO A;  5M5Y H;  3G48 A;  1PH7 A;  1DJR D;  3S1M H;  3S2D B;  4H7B A;  2F4I A;  4JI7 L;  1MI2 A;  1WTQ A;  2I5H A;  1DD2 A;  1F2L A;  4ZK9 B;  3SK5 A;  2CHB D;  2ZTC A;  4FNF A;  2P5Z X;  1TQO A;  1B53 A;  2ZT9 C;  4NXN L;  3SK4 A;  5C4X B;  4DN4 M;  1LTA D;  4B3S L;  4IUT A;  4KHP L;  4RCN A;  3PUX A;  2NTT A;  3HKZ G;  1N32 L;  2DN8 A;  3HOY G;  1PH3 A;  3FPP A;  2FMM A;  1SYB A;  4LMQ D;  2I0Q A;  1C48 A;  1QG7 A;  5M5X B;  1TR5 A;  2XGT A;  3HOY H;  2EY1 A;  1CKN B;  1UEB A;  3E3X A;  4RWS C;  1ILP A;  4LFA L;  4R8N A;  1OXS C;  2YYZ A;  1PRT C;  4GLA C;  4WFN 3;  5GAG C;  5IWA L;  4FXG C;  3MZ5 A;  4X64 Q;  1MBY A;  2K5D A;  3S1R H;  3R93 A;  3GD7 A;  2B2Y C;  1JWU D;  2E76 C;  4A3C G;  1HQR D;  2B2Y A;  4AH6 A;  4JK1 C;  2A1A A;  3KJP A;  2O5J C;  1F9S A;  3KLS X;  3VR2 A;  5FK9 C;  2YU9 B;  4LFC L;  4A3C H;  1X3F A;  4DR4 Q;  1SMY D;  3RLO A;  2JN4 A;  1T9H A;  2PI2 A;  2UUA L;  3C3L A;  1V8Q A;  4IFD I;  1JB3 A;  1LV9 A;  3KBG A;  1O7Y A;  4BY1 B;  1TY2 A;  3A74 A;  1FD7 D;  2ICI A;  1K8O A;  4A3K G;  3DXJ C;  1CKM A;  5JJL A;  5J1Z A;  4DF7 A;  4RA8 A;  4JBJ A;  3HG9 A;  4HJA A;  4A3K H;  3NP8 A;  5AJ3 Q;  2XTI A;  1BNZ A;  1J6Q A;  4DR5 Q;  4A3G B;  3EQL C;  3W5O A;  2NUC A;  2NZ1 D;  4QUF A;  5M3M G;  2EYH A;  4OX9 L;  2E74 C;  4JC0 A;  5KND A;  1LTS D;  1BUV T;  4IAL A;  3S17 B;  3VR3 A;  1VMP A;  5M3M H;  2OCE A;  5G3L D;  3ITP A;  4BBR B;  1WVL A;  1GUN A;  4K6L A;  1PRT B;  2F0T A;  3QG1 A;  2UXD Q;  3EIV A;  3I7F A;  5IGE A;  3NE5 B;  1STE A;  1B9N A;  1Q86 C;  3BG3 A;  1F77 A;  1TWC H;  1MGS A;  1EU3 A;  2VXW A;  2XRS D;  5A35 A;  2WFW A;  3HKS A;  4DR4 L;  1VQ9 A;  4GOP A;  2E8G A;  2CKZ B;  5IGB A;  3J7Z C;  3K0X A;  1W6K A;  3U4Z A;  1A3U A;  1BXT A;  2F0J A;  1I3Q H;  2IL8 A;  2QDL A;  2WAC A;  2R93 B;  1H9M A;  2I5M X;  2A6H C;  1PZJ D;  2MUY A;  1TS5 A;  2MFI A;  3I4M B;  3HKZ E;  1LT3 D;  3STB C;  2D5D A;  4DR5 L;  4B08 A;  4R4Q A;  1KDC A;  2ZXR A;  3E5S A;  1AH9 A;  1HNX Q;  4F8M A;  1XPR A;  1O7Z A;  3F2C A;  4JCV E;  1VF7 A;  3VYU A;  3MTS A;  4QB4 A;  1Y1V B;  4L5Q A;  1E7Z A;  4DK1 A;  1SDF A;  3A54 A;  4BY7 G;  1D2B A;  4HR7 B;  1U0L A;  4C3J G;  3AFQ A;  3OPO A;  3P75 A;  4DV4 L;  1XMQ L;  2E2I B;  2DJG C;  2UXD L;  3Q8D A;  4V19 0;  2ATW A;  4BY7 H;  1CSQ A;  4C3J H;  2HD3 A;  1HNZ L;  5ELC A;  1SYD A;  4JBW A;  4PZ8 A;  4JOI C;  1FNU A;  4PMB A;  2Y0S G;  4JOI A;  5D3D A;  2F0F A;  4DXF A;  5CC4 A;  4YHH Q;  4XIG S;  3OIP A;  1EYD A;  5JAV A;  3S16 H;  2K5Q A;  3MHB A;  5DNF A;  4JI1 L;  4R4C A;  1L1O C;  5IP9 G;  5KNB A;  1L1O A;  4XT3 B;  2YTV A;  1TU2 B;  1SNC A;  5GAD C;  4QQB X;  2EYO A;  3T53 B;  5C4J H;  3LWE A;  5IP9 H;  3A56 A;  2OF1 A;  2R61 A;  3MEF A;  2WAQ B;  1PMR A;  1BCP F;  1I4Q A;  3FP9 A;  5E1F A;  2AMC B;  1EEF D;  4X65 L;  3TEH B;  2L12 A;  3OMC A;  2R92 G;  4DR7 L;  1BF4 A;  4LF8 Q;  3K7A B;  3A55 A;  1G6Z A;  2AUJ D;  1ZKO A;  5IGF A;  1O7L A;  4DU9 A;  1LUZ A;  2IT1 A;  1PTO F;  1O78 A;  1MSH A;  2R92 H;  1BCP C;  2RQX A;  4JPB W;  1E22 A;  1YHB A;  2BH8 A;  3ND8 A;  1A62 A;  2A68 C;  1PTO C;  2RDF A;  4A3I B;  1D7Q A;  4A3M B;  3VDY A;  1VQN A;  1KRS A;  3C1F A;  1VQ5 A;  1SNO A;  4JI8 L;  2UXB Q;  3H6M A;  2G9H D;  2F3W A;  2AQ2 B;  4KY5 A;  4OEL B;  3I91 A;  1B4O A;  2B39 A;  2BE5 D;  4C1N K;  3BZD B;  2KEC A;  3K81 C;  4DR3 L;  1HZA A;  2CFM A;  2SDF A;  1L1O B;  1TS2 A;  5LHY 1;  3GTJ B;  1ZYR D;  2MNA A;  5C44 B;  1M8A A;  3CP0 A;  4DXG A;  1VQF A;  2OXP A;  4LF8 L;  1I6V C;  3D31 A;  2XNA C;  2HCI A;  3HOV B;  2K03 A;  4C3H G;  1F9P A;  4O0A A;  1J8I A;  1U4R A;  1X56 A;  2PCF B;  1YIJ A;  2O2L D;  4C3H H;  2GVB A;  1WYD A;  1PLF A;  2VY3 A;  1KC8 C;  4TKO B;  2A6E C;  2ES2 A;  4BXX G;  4X66 L;  1BCP B;  2K5V A;  3TP8 A;  3UDF A;  2OTL A;  1FR3 A;  1SAP A;  3EJI A;  3F1Z A;  3NTK A;  4B9W A;  1UUP A;  4BXX H;  2MGS A;  3DEO A;  2AUK A;  5C3E G;  4B3M L;  4QGU A;  3SR1 A;  5EBD A;  1PTO B;  2UXB L;  2IX3 A;  3P7J A;  5C3E H;  1LTT D;  2O5I C;  4IPC A;  3GTO B;  1EYG A;  1CQV A;  2CH4 A;  1MHW C;  3KF8 A;  2IW3 A;  3TBI B;  1EOV A;  4JI0 Q;  3A0J A;  1PH2 A;  1X32 A;  3NK9 A;  3STB D;  3GTM B;  4DV5 Q;  1OO9 B;  4B3T Q;  4HJ7 A;  1IBL Q;  1D6E C;  3L7Z C;  2RVL A;  2PZU A;  2QIL A;  4F7X A;  1IL8 A;  4QUC A;  1QZG A;  3ONA B;  3T51 B;  2D0O A;  4ABN A;  2J4X A;  2NTS A;  1V1P A;  2F0O A;  3UE0 A;  1NR4 A;  5ISR A;  1VQ4 A;  1EY0 A;  1JB7 A;  1CA5 A;  1XTD A;  1J5E Q;  4HID A;  4A93 G;  1GHK A;  1EQR A;  1QCB D;  3HOZ G;  1LYL A;  4KD4 A;  4DK6 C;  4QL5 A;  3EN2 A;  2IPK D;  3DEP A;  3HOZ H;  4OON A;  4TVA B;  2Z4I A;  2JA5 B;  5ELN A;  4LAA A;  4G4K A;  1BVS A;  2EOT A;  3NTI A;  2F3I A;  3JAM c;  4TSS A;  1ENC A;  4KK7 A;  5FO7 B;  5J3B A;  3GV6 A;  4QMG A;  4IJL A;  4KJN A;  2VQE L;  4B3R L;  2IHE A;  4R8I A;  2RCF A;  2KJX A;  1RDP D;  5COR A;  4HED A;  4JI0 L;  4JI5 L;  2E5L L;  3BZK A;  1SNM A;  1EY7 A;  2PQE A;  2QCP X;  3DMU A;  3KF8 B;  1BBX C;  3HOU B;  1R9T H;  4KMU C;  3JAM L;  1SNQ A;  1HRJ A;  5LL6 S;  1EIF A;  4A3D B;  4IUR A;  4X3T A;  2HQL A;  1N33 L;  3QOJ A;  2G5D A;  1LTG D;  3OW2 A;  1K0S A;  1EQQ A;  1YJ9 A;  2H1E A;  1J5E L;  3VA5 A;  2F4V Q;  1V1P B;  4DV2 L;  3GDE A;  4DR6 Q;  2LXK A;  5KYL A;  3TQY A;  1F2M A;  1IKL A;  1S5C D;  4YIJ A;  4DNR B;  5IGD A;  3ND9 A;  3NXW A;  5A2Q L;  1Y1W G;  2HDM A;  3KLW A;  3M9B A;  1D8L A;  2K32 A;  2Q2I A;  1RL2 A;  3M4O B;  1CZG A;  3AU7 A;  1Y1W H;  4HIO A;  1HUM A;  5EKL A;  1B2T A;  3NWS A;  1LAB A;  3DHQ A;  2I46 A;  1IBK Q;  1JT8 A;  2K5N A;  2WAQ E;  2RF4 A;  2FIN B;  1JJC B;  4GNX C;  2XWJ B;  4GNX A;  5TSS A;  1KDA A;  4KKT A;  3OSO A;  4A3E B;  2H4O A;  3UI2 A;  3ICE A;  1YIT A;  3NQT A;  2NVX B;  4LUV A;  1AP0 A;  1H95 A;  3D3R A;  2NBF A;  3Q23 A;  4HIM A;  1Q12 A;  2CQA A;  4OO1 I;  3H15 A;  1EWH A;  5BR8 Q;  1D5X C;  3TP6 A;  1KIX A;  3UDI A;  1KLU D;  2A6E D;  1EIH A;  3MFY A;  3SVM A;  2RKS A;  1A3T A;  3G4S A;  3GV3 A;  1V9P A;  3D4W A;  2Q2T A;  4KHZ A;  4EVO A;  3I73 A;  1HTL D;  5IP7 G;  3CCU A;  1A2T A;  4DA2 A;  2BH2 A;  4LFB Q;  4J15 A;  3CCL A;  1ICF B;  2K14 A;  3K8A A;  4X3S A;  4L5R C;  4ILW A;  4AYB G;  3I72 A;  3CCJ A;  1IBK L;  2NN6 G;  1I94 Q;  3CMA A;  2BCO A;  3OHX C;  1Y69 U;  4EQN A;  2NN6 H;  1L0X B;  3MAQ A;  4JVZ A;  1HJP A;  2KED A;  1XTC D;  3S9W A;  3M4P A;  1A6X A;  4GNX B;  3K59 A;  4LF9 L;  1LM0 A;  4IUV A;  1QWY A;  1FJG Q;  2KCT A;  1XX8 A;  3L0O A;  5M5Y B;  5DLQ E;  3T1Y L;  2EYM A;  3F2B A;  3MXN A;  2NYZ D;  1H9K A;  4DV3 Q;  4LUZ A;  4YY3 Q;  3PF4 A;  4P72 A;  2FHT A;  4DK0 A;  5LMU Q;  4Q0F A;  4JW0 A;  2K5W A;  3C2P A;  1NE3 A;  1KAA A;  1S5F D;  5EAY A;  1LT6 D;  4JYA Q;  2WIN B;  1JWM D;  2QEX A;  3S14 B;  4V0B A;  1HR0 L;  2RSN A;  3HKZ B;  3Q0A A;  1YHA A;  3SEB A;  1NBW A;  5T1G A;  1PV4 A;  5IYB G;  5C3X A;  2B63 B;  3KOJ A;  1WTW A;  3TRE A;  3QO2 A;  3S1R B;  5IYB H;  3DM1 A;  2BDO A;  3PV0 A;  1YJN A;  3PUV A;  3PO3 H;  2R7Z B;  3WOE A;  3TZU A;  4YCW A;  1Z9F A;  2EYL A;  3VYT A;  3BVZ A;  3MXN B;  5HGQ A;  1CFM A;  3J81 L;  1EIY B;  2MO1 A;  4A3F G;  1G8Z D;  3OMG A;  1HCZ A;  2EY2 A;  5C6A A;  4JYA L;  4A3K B;  4C3I G;  2RHQ B;  1K3B C;  3NQI A;  4OWX B;  1JMC A;  1CKN A;  4A3F H;  3TP5 A;  2NVQ H;  2DY7 A;  3TZD A;  3Q24 A;  2PPB C;  4NPS A;  1RTN A;  4ZUJ A;  3CRK C;  2DY8 A;  4C3I H;  3J80 E;  2N88 A;  4N9P A;  1X9N A;  1ASY A;  2KEN A;  1TS3 A;  3ERQ A;  5E4X A;  4RH6 A;  3I4N B;  4OHJ A;  5ELB A;  3VR5 A;  2ZJP A;  3GTP H;  1X54 A;  3HP3 A;  2KHS A;  4XYQ A;  1SBB B;  3DWP A;  5L37 A;  4QIW E;  4OIK A;  3X3M A;  4GN4 B;  3VR6 A;  4A76 A;  1T5X D;  2Z1C A;  4ZRZ A;  1B3Q A;  3RUZ A;  1KL9 A;  2KQ3 A;  1NMG A;  2F0D A;  1Q46 A;  2A69 C;  1LTR D;  1BR9 A;  3SXH A;  3S2H H;  1KLG D;  3RZD H;  5IT9 c;  3MC0 B;  2DNE A;  4CJ2 C;  1FL0 A;  2PMZ E;  3E9I A;  2WB1 G;  3SK8 A;  1PRT F;  4ODG A;  1JIC A;  3WDN A;  4A3J G;  1E2Z A;  1HH2 P;  1OXT A;  4DR1 Q;  3CCM A;  1K83 H;  1FVI A;  1YNX A;  1EWI A;  1GHJ A;  3J80 i;  4DV6 Q;  1EQT A;  2O4X A;  4WJ4 A;  4A3J H;  5C4H A;  1EYC A;  2EXZ A;  2EXD A;  4KI0 A;  2NZH A;  1Q90 A;  2A74 C;  4CKB A;  1P16 A;  2Q8R E;  1QVC A;  3W1G A;  1EYA A;  3C1E A;  4HAE A;  4KV6 A;  1TWH B;  4LWC A;  4C3J B;  4YWM A;  2JA6 G;  4PMC A;  1Y8O B;  3S1N B;  4S3S A;  1K0R A;  1X65 A;  4LW1 A;  1HFN A;  3H94 A;  1HPC A;  2F0P A;  2JA6 H;  3Q22 A;  1E2V A;  3S15 H;  2CW0 D;  1TWA B;  2AWO A;  3EFX D;  4NB3 A;  2WKD A;  3PO2 B;  4KY7 A;  5EKK A;  2EYJ A;  3TSS A;  2ZM6 Q;  4EQP A;  1CI3 M;  4POG A;  5E7N A;  1HZC A;  4H02 A;  1Q1B A;  1S5B D;  3PUW A;  5FLX c;  3U50 C;  2ZXO A;  5C4Z A;  2ENB A;  3M3Y B;  4DV6 L;  4HJ8 A;  2JP1 A;  4LF6 Q;  5A2Q E;  3RN2 A;  2FFK B;  3MA2 B;  4X64 L;  4RAU C;  1AFP A;  2EYP A;  4ZQ3 A;  1DYQ A;  4A3L G;  1Z7T A;  3IFT A;  1KAW A;  5FLX L;  5BN3 A;  3CCQ A;  3HS0 C;  2K04 A;  4X3U A;  3GQB A;  4A3L H;  3HOW B;  1HZB A;  4O2D A;  2UU9 Q;  2HCC A;  3F8T A;  4XQQ A;  4ULL A;  2X6L A;  2PZT A;  1HXY D;  3QIA A;  2V4D A;  4RGT A;  5J39 A;  5JVH 3;  1BKB A;  1CM9 A;  1QJO A;  1TII D;  5T1I A;  4KKS A;  3EA6 A;  4E6I A;  3OIQ A;  1YNN C;  3PGZ A;  5JJZ A;  3IFD A;  1OXX K;  1TWF H;  2LKV A;  5AJ3 L;  3CKI B;  1STH A;  2WB1 E;  2OQ0 A;  1EU4 A;  2K28 A;  4CGY B;  2OWO A;  2MPM A;  3KLS A;  1SRO A;  5EQ0 A;  5GQO A;  1PHJ A;  4C3H B;  2RDH A;  1M4V A;  1VMC A;  4RHS A;  2PZW A;  1IYU A;  1EOT A;  2B8G A;  4FO2 A;  3MXG A;  1IXR A;  3DWA A;  1B3A A;  5LMN Q;  4NP5 A;  1WTR A;  2RA4 A;  4HMI A;  3CQZ H;  5HY6 A;  4OEM B;  3FEW X;  2KCN A;  1DM0 B;  1VDZ A;  2KA7 A;  3T13 A;  1RHP A;  1IW7 C;  1N8R C;  2A69 D;  3D4R A;  1SEB D;  2UXC Q;  1GJX A;  2YU9 H;  4GKK Q;  1RIP A;  4X62 Q;  1XYI A;  1E24 A;  4Y7N B;  1Q1E A;  1O80 A;  1HNX L;  2L5T A;  1V1O A;  3AQQ A;  3R8B A;  5ELO A;  1QNK A;  4G7O C;  4LK1 C;  1PRT D;  2UUB Q;  4K2K A;  4IZ8 A;  4RGO S;  1X55 A;  1IYV A;  1CT1 D;  2SNS A;  1IKM A;  3BDL A;  2JA7 B;  5IGC A;  3L2P A;  1NAP A;  1X6O A;  3RZO H;  1X3Q A;  3CU7 A;  5LMN L;  1G29 1;  1BBU A;  1WTP A;  3HOX G;  4YHH L;  5H1S E;  3E9H A;  3SGI A;  3RMH A;  1PH4 A;  4EQ5 A;  2AQ3 B;  2MO0 A;  5EJW A;  3HOX H;  4PMW A;  4FYD A;  2XSC A;  4DR2 Q;  3A5U A;  1CHP D;  1MJE A;  5K5P A;  5ELF A;  4IUU A;  3D4D A;  4GKK L;  1ESR A;  2VZA A;  1NJI C;  1CTM A;  1N36 Q;  3R2T A;  1R9T B;  3J81 E;  1LAC A;  1ML0 D;  4B9X A;  5IYD G;  3I4M G;  4QY7 A;  3J7A 5;  1XMO Q;  1PA6 A;  5C0X J;  5IYD H;  2R6G A;  2JA9 A;  1G2S A;  4K5W A;  3KFU A;  2ZTD A;  3I4M H;  1GUO A;  4CDF C;  3GTG B;  3PSI A;  3QOL A;  4P71 A;  4DAP A;  4KLK A;  4X6A H;  1U4M A;  3G6E A;  4ME3 A;  1Y1V G;  4M1U B;  3FPU B;  5DAU A;  1Y8P B;  5EGT A;  2L4N A;  4MN3 A;  1WJJ A;  1Z47 A;  2D0P A;  4G57 A;  4K8J A;  1ONL A;  2D9U A;  2Y0S E;  1WCM B;  2TMP A;  1L0W A;  2JSO A;  1PVO A;  4DKA C;  4XQN A;  1A0I A;  3BZC A;  3H0G G;  4DUY Q;  1YBY A;  4LF7 Q;  1R4Q B;  5FKA C;  1Y1W B;  1NUC A;  2E2I H;  2A5H A;  1Q8I A;  1C8C A;  4OXP A;  3OTO Q;  3H0G H;  2F0M A;  4MZ9 A;  4GS3 A;  4RMF A;  3ULJ A;  2Q2U A;  2A6H D;  4DNI A;  3CXC A;  1YNN D;  3W2D A;  1RCV D;  4K8I A;  1N36 L;  4Q5V A;  4DV1 Q;  2PNH A;  5ELD A;  5FJ8 G;  2WKC A;  4RCO A;  1N34 Q;  2NVT H;  4U68 A;  3U58 A;  1XMO L;  5D65 A;  3RLN A;  5CV8 A;  3DM3 A;  5IGG A;  2E2H B;  2DGY A;  1VQB A;  2EJF C;  1NNX A;  5CV6 A;  3CCV A;  4XYO A;  2CWP A;  2J7Z A;  5D14 A;  1OXU A;  4AQY Q;  4JI6 Q;  5KRU A;  1EEI D;  4GKJ Q;  4YWK A;  1H9J A;  3K7A H;  1JCK B;  1PFN A;  1KRT A;  2F03 A;  1I4P A;  4IQZ A;  4A93 H;  3QR8 A;  2K05 A;  4L63 B;  2FJ2 A;  1NR2 A;  1ROD A;  2Q8T A;  1AEX A;  4L5S A;  2L9H A;  4X3K A;  1UE6 A;  3NSW A;  3T1H Q;  1HNW Q;  2PW5 A;  3FKI G;  4A3I G;  3ULL A;  2NN6 I;  3LGJ A;  2IHF A;  4H13 C;  1LTB D;  2PW7 A;  1I4G A;  3FKI H;  1ICW A;  3KYH C;  5M5W B;  4A3I H;  1I6H B;  5D3I B;  1IW7 D;  4AYB B;  3P1H A;  5C5M A;  4DV5 L;  4B3T L;  4LNQ A;  1II3 A;  5IE8 A;  1JR0 D;  1PFM A;  1IBL L;  4LF4 Q;  4PZ6 A;  1YNJ C;  3AB9 A;  2SEB D;  1FNW A;  3X3N A;  3CF5 A;  4NXM Q;  2K5H A;  1EWC A;  3CC2 A;  4F88 A;  4CJ0 B;  1BCP D;  1JJG A;  3TDQ A;  4QIW B;  5NUC A;  2M2L A;  1ILQ A;  3MWY W;  3I2Z A;  3GTJ H;  3HOV G;  2E2J B;  5EPJ A;  2VQF Q;  2A68 D;  2LS0 1;  1V1Q A;  1WD0 A;  1S3O A;  1PTO D;  3I3C A;  1QE6 A;  3HGB A;  3HOV H;  4IOC A;  2OT2 A;  2YTY A;  1E1O A;  2JA8 B;  3FHW A;  3CRL C;  3DUZ A;  1O7I A;  1STY A;  2EVB A;  2PMZ B;  3NEN A;  2ICE C;  2JK8 A;  4MHE A;  2Q2H A;  3MXP A;  4CKE A;  1NSN S;  3H09 A;  4ME5 A;  4DV0 Q;  1KD1 C;  1IBM Q;  1WOC A;  4UY8 C;  1PTO H;  2WV6 D;  1E2W A;  3S1Q H;  1TWG H;  3SDZ A;  2F0W A;  1STB A;  2AHO B;  4IFD J;  3W3A A;  2Z6K C;  3PO3 B;  2Z6K A;  4U67 3;  5JJI A;  1EY5 A;  1SND A;  2C35 B;  3D8G A;  1C9O A;  2F0H A;  1A3V A;  4JI3 Q;  5IOC A;  2F4V L;  2NVY B;  4PNY A;  1RD9 D;  1W3S A;  4KHV A;  1VQL A;  2N49 A;  5M3F G;  4DR6 L;  1HUN A;  3GTM H;  2ID0 A;  5CGK A;  1KNE A;  2RDG A;  5I9O A;  5M3F H;  2LSS A;  2KHJ A;  2F1M A;  4A3F B;  5ELE A;  3HFZ B;  1B9M A;  1VQ8 A;  1YVC A;  1I50 H;  1TS4 A;  4K5X A;  3TME A;  4ZCK A;  1S5D D;  5IP7 H;  1VQ7 A;  2DUD A;  2KVM A;  3V2T A;  4ZLT F;  1L0Y B;  3H3V H;  2JA5 G;  1JOO A;  2RHS B;  4DV0 L;  3CW2 C;  3K57 A;  4BBS G;  3A5Z B;  3VYR A;  1J9O A;  1AW7 A;  2JA5 H;  4G7H C;  4DUZ Q;  1KQS A;  4BBS H;  1SRU A;  2NB0 A;  1ASZ A;  2FMC A;  1QVF A;  1C4Q A;  3S1M B;  1PYB A;  2DJF C;  2EJG C;  3RLF A;  1GVP A;  4UHV A;  3HOU G;  2EIF A;  4C1N I;  1MD2 D;  1LLR D;  3N52 A;  3LNN A;  1A8V A;  1SE2 A;  4A3D G;  2F0N A;  5BR8 L;  4JV5 Q;  2B2U C;  5CV7 A;  1PH5 A;  2B2U A;  3S2H B;  2F0V A;  2EPB A;  1SMY C;  4A3D H;  1I4R A;  4DV7 Q;  4OIJ A;  1X3G A;  2LMC B;  3CPW A;  4LFB L;  3NBI A;  3HOY B;  3GO5 A;  3CCE A;  2WB1 B;  3R3O A;  1GUS A;  1I94 L;  2R7D A;  5HGT A;  1EZ8 A;  3CC4 A;  1RJT A;  1WD1 A;  2HHH Q;  2X6G A;  4A3J B;  1I4X A;  4JG2 A;  2IX0 A;  1K28 A;  5JPN C;  2FXQ A;  5BN5 A;  1SYC A;  4GLX A;  2PNR C;  1DOK A;  2QGQ A;  1AE2 A;  3GTQ H;  4C2M H;  5KYI A;  3AFP A;  1FJG L;  1KNA A;  1EY8 A;  1CHQ D;  3MXU A;  5I4D A;  3M4O H;  3SK6 A;  4I65 A;  1M1K C;  1MIU A;  3IL8 A;  4P2C B;  3C46 A;  2L1B A;  4DV3 L;  3R2I A;  2K75 A;  4YY3 L;  3S24 A;  2J0T D;  4A3E G;  2ALY B;  3S15 B;  5LMU L;  2ZJQ A;  3OOC A;  1Q81 C;  3G6J B;  1UNS A;  2HUG A;  1KAB A;  2KEE A;  3I4L A;  3KUP A;  4A3E H;  5BN4 A;  1UE1 A;  1F9R A;  1H9R A;  3Q6S A;  1E0B A;  2CWA A;  4NDX A;  1ZEQ X;  4DPG A;  2VB2 X;  4IUQ A;  4P74 A;  3GTL H;  4I7Z C;  4JI7 Q;  2B29 A;  2C5C A;  5CBA E;  1B8A A;  2PO4 A;  4GLV B;  2R7F A;  3HZX A;  4NXN Q;  4AYB E;  1S72 A;  1UAP A;  3E0E A;  5FO8 B;  1SN8 A;  4B3S Q;  1AN8 A;  4KHP Q;  2B2V C;  3KBX A;  2OTJ A;  5M3M B;  2B2V A;  1E1T A;  2L55 A;  1N32 Q;  2MQH A;  3HRZ C;  5FO9 B;  4QCL A;  4RKB A;  4M8A A;  1FGB D;  4KD3 A;  1A63 A;  4ZKB B;  4EGV A;  1HHV A;  5DM6 3;  2TSS A;  1HR0 W;  2GN5 A;  1M90 C;  4FDB A;  1TWC B;  1TKW B;  3K6O A;  4OL7 A;  2Z6B A;  1DOM A;  5GAH C;  2CVR A;  3IKJ A;  1VQA A;  3NUC A;  4LFA Q;  1BOS A;  3I4O A;  4R4T A;  4RGM A;  2VUM G;  3UE1 A;  1K8G A;  5IWA Q;  4K14 A;  2VW9 A;  1HA6 A;  3U9O A;  1I3Q B;  3MFG A;  4DAM A;  1SFO H;  1E3P A;  2VUM H;  3BDO A;  4BS9 A;  1DGS A;  4CBV A;  3I8Z A;  4ZUI A;  3A8I E;  2F0Q A;  1B1Z A;  4LFC Q;  1YEZ A;  4UAI A;  1NMF A;  2UUA Q;  4GZY C;  4BWG B;  1X3P A;  2LXJ A;  1GO3 E;  3ER0 A;  3K0Y A;  3A7A B;  3T16 A;  1F9Q A;  2VNU D;  1SSO A;  1GUG A;  4A3B G;  2BDN A;  3PIO 3;  3I56 A;  3WOF A;  4L6T B;  5IT9 L;  5JEA J;  5C0X G;  1SR3 A;  3ULP A;  3L9A X;  2N78 A;  2KBN A;  3GTK H;  4A3B H;  3BVM A;  2ZTE A;  5I2X A;  4O1N A;  1XPU A;  4UP7 A;  5C0X H;  3EVQ A;  3S14 H;  1K8M A;  4BY7 B;  3D6W A;  4JI4 Q;  4CKC A;  5EPL A;  4FF3 A;  1JE4 A;  3P20 A;  3ERO A;  2B63 G;  1YZ6 A;  3CC7 A;  5IY0 A;  2LFN A;  4H44 C;  4A4I A;  1S40 A;  4OX9 Q;  2HT1 A;  1G6P A;  3QB3 A;  2QA4 A;  1SYF A;  3CQZ B;  2B63 H;  4CDE C;  4YCV A;  3JAM E;  1RF2 D;  4EX5 A;  1NY4 A;  3S16 B;  1EQV A;  2Y0S B;  1B7Y B;  3BYY B;  5LL6 X;  2R7Z G;  1G2T A;  3O13 A;  2PQA A;  3I55 A;  5KIX A;  3NEM A;  3M4Q A;  1WFQ A;  5C4J B;  3KDF A;  4R4I A;  1EZ6 A;  3PF5 A;  2R7Z H;  1GD7 A;  3JC6 6;  3F2U A;  2K1B A;  5CBE E;  4PV1 C;  1PFB A;  3BJU A;  3KK7 A;  4CDC C;  4DR1 L;  2QDB A;  4HJ5 A;  2C9O A;  2BE5 C;  2R92 B;  1ZYR C;  2JJQ A;  1MSG A;  2ZJR A;  4MTK A;  3E0J A;  1SE4 A;  4LUO A;  4HSP A;  1OXV A;  4JI4 L;  4XDX A;  4GN3 B;  2KCC A;  2JEB I;  4IO9 A;  4DNT B;  2M9V A;  3I4N G;  3RZO B;  3CCR A;  3AMU A;  2NWG A;  4JBM A;  1Q82 C;  4IPH A;  1WTH A;  3I4N H;  2ZXP A;  4R1J A;  1CZW A;  1LT4 D;  3PIP A;  2JXM B;  3OWF A;  3HOX B;  2B8F A;  4P73 A;  3M85 A;  3JAM i;  4DV4 Q;  1XMQ Q;  1RKN A;  2IJ0 A;  2WII B;  5DM7 3;  2F52 A;  5E3F A;  2EQS A;  4MTN A;  4NKL A;  1SMX A;  2F3V A;  2YTX A;  2H5X A;  4YCU A;  1HNZ Q;  2ZM6 L;  4MNO A;  4RFB A;  5EKI A;  2PQA B;  5IYC G;  3S2D H;  1U9R A;  5C4X G;  4GOP C;  5KGU A;  1CUK A;  3SHL A;  3KDF B;  3N6R A;  1STA A;  5EBC A;  5JPM C;  5IYC H;  5C4X H;  3K5O A;  1DZ1 A;  2JYO A;  4LF6 L;  2MHV A;  4JI1 Q;  3K5M A;  1T5E A;  2GA4 B;  3L3O C;  4PQX A;  2IX1 A;  3B6Y A;  1BQQ T;  5K36 G;  2IWH A;  2F0U A;  2I07 B;  3A8J E;  5M5X H;  4LF5 Q;  1QNU A;  5J22 A;  1AE3 A;  2L11 A;  2DNC A;  4X65 Q;  4DR7 Q;  2UU9 L;  5K36 H;  1VQI A;  4IJH A;  4UDU C;  4OWW B;  4UP9 A;  1XXG A;  4QJF A;  5C3E B;  1XJV A; 
#chains in the Genus database with same CATH homology
 2NN6 G;  1I94 Q;  2DGY A;  1VQB A;  1VCI A;  3CMA A;  4B3S L;  4KHP L;  2K50 A;  3CCV A;  2CWP A;  1GKH A;  3PUX A;  4IOA A;  1TWH H;  4Y52 H;  3HKZ G;  1I5F A;  1N32 L;  1OXU A;  3HOY G;  1PH3 A;  1HJP A;  4AQY Q;  4JI6 Q;  4BY1 G;  4GKJ Q;  4YWK A;  3K7A H;  3M4P A;  4R4O A;  1KRT A;  4GNX B;  4LF9 L;  3S1N H;  1LM0 A;  2I0Q A;  2A19 A;  1FJG Q;  2UUC Q;  4A93 H;  2KCT A;  2XGT A;  3L0O A;  3HOY H;  1CKN B;  4JI8 Q;  1UEB A;  4BY1 H;  4L5S A;  4IFD G;  5DLQ E;  1G51 A;  3T1Y L;  3PO2 G;  1UE6 A;  3T1H Q;  3F2B A;  1HNW Q;  1TWA H;  3FKI G;  4GOP B;  4LFA L;  4A3I G;  1OXS C;  2YYZ A;  4GLA C;  3ULL A;  4DV3 Q;  2NN6 I;  3LGJ A;  4LUZ A;  4YY3 Q;  4A3G G;  2IHF A;  5GAG C;  2CCZ A;  5IWA L;  3PO2 H;  4X64 Q;  4P72 A;  3PF4 A;  3FKI H;  4GN5 A;  5LMU Q;  4DR3 Q;  3S1R H;  1OTC A;  3GD7 A;  3KYH C;  3J81 j;  4A3I H;  1NE3 A;  4OWT B;  5GAE C;  4A3C G;  4A3G H;  1EUJ A;  4AH6 A;  5EAY A;  5GRO A;  4LF5 L;  2A1A A;  3KJP A;  4JYA Q;  2QEX A;  4DV5 L;  4B3T L;  4LNQ A;  5IE8 A;  4LFC L;  4A3C H;  1IBL L;  1X3F A;  4LF4 Q;  3M3Y H;  4DR4 Q;  2AWN A;  3RLO A;  1HR0 L;  1T9H A;  2PI2 A;  2UUA L;  4PZ6 A;  1MJC A;  4BBR G;  4IFD I;  1YHA A;  3S17 H;  1NBW A;  4HIK A;  3A74 A;  1V43 A;  3CF5 A;  4NXM Q;  1PV4 A;  1XNR Q;  2K5H A;  3CC2 A;  4A3K G;  5IYB G;  4BBR H;  1JJG A;  2JEA I;  3HOW G;  1CKM A;  5JJL A;  4X66 Q;  3I2Z A;  3KOJ A;  3GTJ H;  3TRE A;  3HOV G;  4JBJ A;  2VQF Q;  4HJA A;  4A3K H;  5IYB H;  5AJ3 Q;  2UXC L;  2XTI A;  1J6Q A;  1V1Q A;  3PV0 A;  3HOW H;  1YJN A;  1S3O A;  3PUV A;  4DR5 Q;  3UDG A;  4B3M Q;  3HOV H;  1L2F A;  4X62 L;  3W5O A;  4IOC A;  2GVA A;  2UUC L;  3PO3 H;  4DAY B;  1CKO A;  2YTY A;  2R93 G;  2L15 A;  1E1O A;  5M3M G;  3FHW A;  4OX9 L;  1YI2 A;  3RN5 A;  1O7I A;  3UDX A;  3KF6 A;  3NEN A;  3IRB A;  2R93 H;  2JK8 A;  4JC0 A;  1Z9F A;  4YCW A;  5M3M H;  2Q2H A;  2OQK A;  2OCE A;  3MXN B;  5HGQ A;  1PH8 A;  2UUB L;  4DV0 Q;  1EIY B;  2MO1 A;  4A3F G;  3G71 A;  1KD1 C;  3CPF A;  1IBM Q;  1WOC A;  2UXD Q;  3EIV A;  4UY8 C;  3I7F A;  1YJW A;  4JYA L;  1Q86 C;  2RHQ B;  1K3R A;  1TWC H;  4OWX B;  1JJ2 A;  1JMC A;  1CKN A;  4A3F H;  1TWG H;  2NVQ H;  3S1Q H;  2WFW A;  3HKS A;  4DR4 L;  3J80 c;  2AHO B;  1VQ9 A;  4IFD J;  2Z6K C;  4NPS A;  1PH6 A;  4GOP A;  2E8G A;  2Z6K A;  4C3I H;  5JJI A;  1Y1V H;  2CKZ B;  3J7Z C;  3K0X A;  3U4Z A;  1X9N A;  1XNR L;  3PIO A;  1ASY A;  2KEN A;  2C35 B;  1UE7 A;  1I3Q H;  2JE6 I;  1C9O A;  3DLL A;  4DR2 L;  1VQK A;  1N9W A;  4JI3 Q;  2I5M X;  2F4V L;  2ZJP A;  1W3S A;  2Z0S A;  1VQL A;  2N49 A;  1Q7Y C;  5M3F G;  3GTP H;  2MFI A;  4DR6 L;  3HKZ E;  3GTM H;  3STB C;  2ID0 A;  1UE5 A;  4DR5 L;  1HZ9 A;  1X3E A;  1X54 A;  2A8V A;  5M3F H;  4R4Q A;  2LSS A;  2KHJ A;  5LMN W;  1VQ6 A;  1AH9 A;  1HNX Q;  4QIW E;  1XPR A;  3F2C A;  4JCV E;  3HFZ B;  4YWL A;  2V1C C;  1YVC A;  1VQ8 A;  1I50 H;  3J81 i;  4GN4 B;  4A76 A;  4L5Q A;  1E7Z A;  5IP7 H;  2WAQ G;  1KL9 A;  2DUD A;  1VQ7 A;  4BY7 G;  5FJ8 H;  1NMG A;  1U0L A;  1Q46 A;  2VQE Q;  3AFQ A;  4B3R Q;  3KF6 B;  2JA5 G;  3H3V H;  2RHS B;  4DV0 L;  4DV4 L;  1XMQ L;  3CW2 C;  2UXD L;  3Q8D A;  3S2H H;  4BBS G;  3RZD H;  5IT9 c;  2ATW A;  4BY7 H;  2N8N A;  4OO1 G;  3A5Z B;  4JI5 Q;  1CSQ A;  2E5L Q;  4PZ7 A;  4C3J H;  4Y7N H;  2AKW B;  1HNZ L;  2JA5 H;  4JBW A;  2HIV A;  1FL0 A;  2PMZ E;  3E9I A;  2WB1 G;  4PZ8 A;  4DUZ Q;  1KQS A;  4JOI C;  4BBS H;  1SRU A;  2Y0S G;  4JOI A;  2WP8 J;  1SE8 A;  4YHH Q;  4A3J G;  3OYY A;  4XIG S;  1ASZ A;  1N33 Q;  1QVF A;  1HH2 P;  1OXT A;  4DR1 Q;  3CCM A;  1K83 H;  1PYB A;  2JA7 G;  3H3V I;  1FVI A;  1YNX A;  1EWI A;  3RLF A;  4DUY L;  4LF7 L;  1GVP A;  3J80 i;  4DV6 Q;  3S16 H;  1VS0 A;  4L5T A;  4R4C A;  2EIF A;  1L1O C;  2K52 A;  4JI1 L;  5IP9 G;  4A3J H;  4A3M G;  1QVG A;  4WJ4 A;  1L1O A;  1CSP A;  2EXD A;  1A8V A;  2YTV A;  4KI0 A;  3OTO L;  4DV2 Q;  2JA7 H;  4A3D G;  1VQD A;  2NZH A;  5BR8 L;  5GAD C;  4QQB X;  1C7Y A;  4JV5 Q;  1P16 A;  5C4J H;  1PH5 A;  5IP9 H;  4A3M H;  1QVC A;  3W1G A;  3MEF A;  4JI2 Q;  3FP9 A;  4A3D H;  2AMC B;  4LWC A;  2PI2 E;  4YWM A;  4X65 L;  3TEH B;  4DV7 Q;  2R92 G;  4DR7 L;  4DV1 L;  4JBK A;  4LF8 Q;  2JA6 G;  1X3G A;  4LFB L;  3CPW A;  1N34 L;  1K0R A;  1X65 A;  1LUZ A;  2IT1 A;  1JE5 A;  4LW1 A;  3GO5 A;  4AIM A;  3CCE A;  2R92 H;  2JA6 H;  1LTL A;  5C44 G;  1E22 A;  2R7D A;  1I94 L;  3S15 H;  1YHB A;  1KXL A;  2AWO A;  2BH8 A;  1A62 A;  1BBW A;  1QUQ A;  4NB3 A;  2HHH Q;  3CC4 A;  4JG2 A;  2IX0 A;  2FXQ A;  4GLX A;  5C44 H;  2QGQ A;  1AE2 A;  3CAM A;  4AQY L;  4JI6 L;  3PUY A;  2ZM6 Q;  4GKJ L;  1D7Q A;  3NBH B;  2VS1 A;  3VDY A;  3GTQ H;  4C2M H;  1VQN A;  1WI5 A;  4A75 A;  4POG A;  3AFP A;  1KRS A;  1FJG L;  5E7N A;  1HZC A;  4H02 A;  3M4O H;  1Q1B A;  1VQ5 A;  3PUW A;  5FLX c;  4JI8 L;  3U50 C;  1K8A C;  2UXB Q;  2NZO A;  3K7U C;  1M1K C;  3T1H L;  1MIU A;  1HNW L;  4DV6 L;  4HJ8 A;  1KHI A;  2RCN A;  1U5K A;  4DV3 L;  4LF6 Q;  2K75 A;  4YY3 L;  3GTG H;  3BU2 A;  3F2D A;  4IPD A;  3S24 A;  3RN2 A;  4A3E G;  4X64 L;  2ALY B;  3NEL A;  3K81 C;  5LMU L;  4DR3 L;  1W2B A;  2ZJQ A;  5JEA G;  1HZA A;  1WCM G;  2CFM A;  1Q81 C;  3CD6 A;  4A3L G;  1L1O B;  4JI2 L;  3W1B A;  4A3E H;  1KAW A;  2MNA A;  1UE1 A;  2CWA A;  1Y14 B;  3CP0 A;  3CCQ A;  1VQF A;  1WCM H;  4A3L H;  4DPG A;  4LF8 L;  4P74 A;  3GTL H;  3D31 A;  1HZB A;  4O2D A;  2UU9 Q;  4LF4 L;  4JI7 Q;  1XPO A;  2B29 A;  3F8T A;  1B8A A;  1VQH A;  4O0A A;  3TS2 A;  1K73 C;  4GLV B;  1X56 A;  2R7F A;  5JJK A;  1YIJ A;  4NXM L;  4NXN Q;  4AYB E;  1S72 A;  1BKB A;  2K4K A;  2GVB A;  4C3H H;  3GTO H;  3E0E A;  1WYD A;  1SN8 A;  2VY3 A;  1KC8 C;  1NTG A;  4B3S Q;  1FGU A;  2ES2 A;  4KHP Q;  4BXX G;  2OTJ A;  4X66 L;  1SLJ A;  2K5V A;  3UDF A;  2VQF L;  1E1T A;  3AYH B;  2OTL A;  3PGZ A;  1QUQ B;  1OXX K;  1TWF H;  2MQH A;  5AJ3 L;  1N32 Q;  3F1Z A;  4BXX H;  2WB1 E;  5C3E G;  4QGU A;  1K9M C;  4B3M L;  1A63 A;  2OQ0 A;  4LF9 Q;  1GM5 A;  1HR0 W;  2GN5 A;  1M90 C;  1B70 B;  4FDB A;  2OWO A;  2UXB L;  3HOU G;  5C3E H;  3T1Y Q;  5GAH C;  2E2H H;  4QJF A;  3ZJY C;  3PUZ A;  4APV A;  1VQA A;  3EBE A;  4LFA Q;  2KCM A;  3I4O A;  4R4T A;  2VUM G;  1SRO A;  3UE1 A;  1K8G A;  5IWA Q;  5GQO A;  1PHJ A;  4IPC A;  2VW9 A;  1EYG A;  4DAM A;  1SFO H;  1PH9 A;  1TXY A;  1E3P A;  2VUM H;  1IBM L;  1EOV A;  1DGS A;  4JI0 Q;  3A0J A;  1PH2 A;  1IXR A;  2JQO A;  3STB D;  1VQP A;  1PYS B;  4DV5 Q;  4B3T Q;  4HJ7 A;  4LFC Q;  1YEZ A;  1IBL Q;  1NMF A;  2HIX A;  3L7Z C;  5LMN Q;  1HR0 Q;  2UUA Q;  5FLM G;  1QZG A;  2LXJ A;  1GO3 E;  3CQZ H;  2D0O A;  5HY6 A;  3ER0 A;  1VQG A;  3UE0 A;  4POF A;  3TRZ A;  2VNU D;  4A3B G;  3I56 A;  5FLM H;  5M5W H;  1VQ4 A;  1JB7 A;  1XTD A;  4JI3 L;  3U4V A;  5JEA J;  5C0X G;  1SR3 A;  1I6H H;  4PG3 A;  3ULP A;  1J5E Q;  4HID A;  4A93 G;  1N8R C;  1EQR A;  2N78 A;  2ASB A;  2KBN A;  3GTK H;  4A3B H;  3HOZ G;  1LYL A;  3HOU H;  2BA1 A;  2ZTE A;  4DK6 C;  4QL5 A;  2UXC Q;  4XTC S;  2YU9 H;  4UP7 A;  1VQM A;  1XPU A;  4GKK Q;  3S14 H;  1RIP A;  1PFS A;  3EN2 A;  4X62 Q;  4JI4 Q;  3M7N A;  1E24 A;  2VL6 A;  4DK3 C;  4BA2 I;  2IY5 B;  3HOZ H;  4OON A;  1Q1E A;  4TVA B;  1HNX L;  5ELN A;  2B63 G;  1YZ6 A;  3CCS A;  3CC7 A;  5IY0 A;  1C0A A;  1BVS A;  2CQO A;  3AQQ A;  4A4I A;  1S40 A;  4OX9 Q;  2HT1 A;  2F3I A;  3JAM c;  1VQJ A;  1G6P A;  5ELO A;  2QA4 A;  3WWV A;  5J3B A;  1XNQ Q;  1VQE A;  2B63 H;  2E2J H;  3AEV A;  4YCV A;  2D62 A;  3CME A;  4EX5 A;  1NY4 A;  4IJL A;  4P75 A;  2VQE L;  4HJ9 A;  4B3R L;  1B7Y B;  5C0X I;  2IHE A;  2UUB Q;  3K80 C;  2R7Z G;  1X55 A;  2JA8 G;  2PQA A;  3I55 A;  4JI0 L;  4JI5 L;  2E5L L;  3BZK A;  4UP8 A;  3NEM A;  3M4Q A;  1WFQ A;  3KF8 B;  3L2P A;  1R9T H;  3KDF A;  4R4I A;  1X6O A;  4DUZ L;  3PF5 A;  2R7Z H;  1GD7 A;  1P8L A;  3JC6 6;  2JA8 H;  3RZO H;  5LMN L;  1EIF A;  1G29 1;  1BBU A;  3HOX G;  4YHH L;  2HQL A;  3BJU A;  1EFW A;  1N33 L;  5H1S E;  4RG1 A;  3E9H A;  4IPG A;  3SGI A;  4DR1 L;  4K0K Q;  1PH4 A;  3OW2 A;  4HJ5 A;  4EQ5 A;  2MO0 A;  2BA0 A;  1EQQ A;  3RR5 A;  1VQC A;  1YJ9 A;  3HOX H;  4PMW A;  4DR2 Q;  3ERS X;  3TS0 A;  1J5E L;  2F4V Q;  2I5L X;  3A5U A;  4DV2 L;  3PO3 G;  3GDE A;  1IL2 A;  2JJQ A;  1MJE A;  4DR6 Q;  2ZJR A;  4JV5 L;  2LXK A;  4LUO A;  3TQY A;  4GKK L;  1YHQ A;  3J81 c;  1OXV A;  3PCO B;  4JI4 L;  4GN3 B;  2JEB I;  2VZA A;  4IO9 A;  1Y1W G;  1NJI C;  4DV7 L;  3KLW A;  1N36 Q;  4BA1 I;  3I4N G;  3M9B A;  1D8L A;  5IYD G;  3CCR A;  2N3S A;  2Q2I A;  4JBM A;  2NVX H;  1RL2 A;  1MKH A;  1Q82 C;  3I4M G;  1XNQ L;  4IPH A;  4HIO A;  4QY7 A;  1Y1W H;  3J7A 5;  1XMO Q;  3D0F A;  2NVY H;  1PA6 A;  3I4N H;  1IBK Q;  1JT8 A;  5C0X J;  5IYD H;  2R6G A;  2JA9 A;  2K5N A;  2WAQ E;  4R1J A;  3PIP A;  3KFU A;  2RF4 A;  2ZTD A;  2HHH L;  3I4M H;  4P73 A;  3M85 A;  4DV4 Q;  3JAM i;  1Q8K A;  1XMQ Q;  1JJC B;  4GNX C;  3PSI A;  3RNU A;  2F52 A;  4P71 A;  2EQS A;  4GNX A;  4KLK A;  1IZ6 A;  4MTN A;  1SMX A;  2YTX A;  4YCU A;  2H5X A;  4X6A H;  3G6E A;  4TQU S;  4ME3 A;  2ZM6 L;  1HNZ Q;  1Y1V G;  4MNO A;  3S2D H;  2PQA B;  5IYC G;  1UWV A;  1WJJ A;  1Z47 A;  5C4X G;  4GOP C;  2D0P A;  1CUK A;  3ICE A;  1QZH A;  2Y0S E;  3KDF B;  1IBK L;  1L0W A;  4K0K L;  1YIT A;  1PVO A;  4DKA C;  5IYC H;  1A0I A;  5C4X H;  3BZC A;  4ALP A;  3H0G G;  4DUY Q;  4LUV A;  1YBY A;  2YV5 A;  4LF7 Q;  1PH1 A;  4LF6 L;  4WJ3 M;  4JI1 Q;  2E2I H;  1H95 A;  4HIM A;  1Q12 A;  4OXP A;  3OTO Q;  4OO1 I;  2B3G A;  3H15 A;  3H0G H;  5BR8 Q;  2IX1 A;  1KIX A;  2KHI A;  3UDI A;  4MZ9 A;  4GS3 A;  4RMF A;  3ULJ A;  2Q2U A;  3B6Y A;  4DNI A;  4UPA A;  5K36 G;  3CXC A;  3G4S A;  5M5X H;  4LF5 Q;  1IYJ B;  1V9P A;  1VQO A;  2Q2T A;  4KHZ A;  1AE3 A;  1N36 L;  4X65 Q;  5M5Y H;  3G48 A;  3KJO A;  1PH7 A;  4DR7 Q;  4DV1 Q;  2PNH A;  5IP7 G;  3CCU A;  2UU9 L;  1VQI A;  4IJH A;  4JI7 L;  5FJ8 G;  2BH2 A;  1N34 Q;  2I5H A;  2NVT H;  3S1M H;  4J15 A;  3CCL A;  4LFB Q;  2K14 A;  3K8A A;  3U58 A;  4OWW B;  4UP9 A;  4L5R C;  1XMO L;  2ZTC A;  3RLN A;  4AYB G;  3CCJ A;  3DM3 A;  4NXN L;  1XJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...