1NMGA

Major cold-shock protein, nmr, minimized average structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR COLD-SHOCK PROTEIN
publication title Structure in solution of the major cold-shock protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulation
total genus 4
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1996-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1nmgA00
4IFDJ 1I3QH 1GO3E 4DAMA 1I94L 2OTLA 1N9WA 3BU2A 4QGUA 1PH1A 3I4NH 1E22A 4OX9Q 1K83H 1NE3A 4GN3B 3PUXA 3I4MH 1TWHH 3EN2A 3M9BA 4GN4B 3PO2G 1QZHA 5C44G 4B3ML 1PH8A 4BY1H 3GTJH 4WJ4A 1Z9FA 3KLWA 1L0WA 2JA6H 1KRSA 1IBLQ 1OXVA 1X56A 1IYJB 3ER0A 3K0XA 1Q1BA 2D62A 5C0XJ 2GVAA 3ZJYC 1VQFA 2E8GA 1K0RA 2KBNA 2ZM6Q 2NVXH 4KHPL 4JBJA 3UE1A 4JBMA 3CCLA 3HOZH 1OXUA 1MJCA 2CKZB 3M4PA 1SE8A 4JBKA 4A75A 2NVQH 1WCMG 2K5HA 1X6OA 2MQHA 1UE5A 2PQAA 3CC7A 4AQYQ 1XMQQ 2R93G 2AMCB 2YV5A 4A76A 3BJUA 3U4ZA 3T1HL 5E7NA 2HHHQ 1G291 3E9IA 1VQ6A 3PO3H 3MEFA 3Q8DA 2UXBL 5C3EH 1XPRA 4JI5Q 1AE3A 2VW9A 3F8TA 2B29A 1JJ2A 2JA6G 1TWAH 1LM0A 3CW2C 2GVBA 4X62Q 1DGSA 2AHOB 5GAEC 2Q2HA 4GOPC 4RG1A 3HOXG 3DM3A 1VQ5A 3S15H 5IYDH 4MZ9A 5M3MH 2ATWA 4DV2Q 2D0OA 2F4VL 4DUZL 1YZ6A 4LFBL 3GTQH 5JJLA 2I5HA 1PA6A 2Y0SG 1P16A 2E2JH 1VQJA 4OWWB 3ULJA 5C4XH 5IP7H 1WOCA 1Y14B 1VQIA 1BBUA 3UDIA 2I5LX 3CMEA 5H1SE 2E2IH 3J81i 1EOVA 3CCEA 3J80i 5IYBG 4IPDA 2IX0A 3F2CA 3HOWH 1YJ9A 4DR3Q 1YI2A 4LFAL 5IYDG 3RNUA 1CUKA 4LF7L 4A3BG 1I6HH 5JJIA 2JE6I 2KENA 2B3GA 3CCUA 2VNUD 2OTJA 2UU9L 1XMOL 3UDGA 5M5XH 1HH2P 3CC4A 1HZCA 4LF8L 1UE1A 5IT9c 2R7DA 1E24A 2DGYA 5IWAQ 5C4XG 2VQFQ 3EIVA 4LF9Q 4DV1L 2JA9A 3DLLA 3CC2A 3S16H 2HIVA 4GLAC 1N33Q 4DKAC 4A3LG 1SR3A 4K0KQ 1HR0Q 2HQLA 4P71A 1V9PA 4PZ7A 4GOPB 1AE2A 3HOWG 4JV5Q 3J80c 2IX1A 3E0EA 3GTPH 4LF4Q 4LUVA 3GTOH 1WYDA 3M4QA 3TS0A 2YTXA 4DV0L 4BA2I 5AJ3L 4YY3Q 3W1GA 3I56A 4DV7Q 1RIPA 3KYHC 4HJAA 4LF5Q 1J5EL 4LFCL 4A93G 4JI1L 4H02A 1KIXA 1VQEA 2Q2IA 3UDXA 2VY3A 1HJPA 4A3KG 4LF8Q 2WAQG 1UEBA 2PI2E 4OONA 5ELOA 4DR5L 2E5LL 2IT1A 4YHHQ 4HJ5A 3RN2A 2BA0A 1NJIC 2E2HH 4JI2L 1XJVA 1QVGA 4JG2A 4JI8L 1ASYA 4O2DA 2UXCL 1HZ9A 3STBD 2ZJRA 2F3IA 1TWGH 2OQ0A 4DR4L 4OO1G 3JAMi 4UP8A 1K8GA 3RLOA 1NY4A 1XNRL 1N32Q 2UUAL 3S24A 5M3FH 1Q46A 1EQQA 5GQOA 1K8AC 4B3TL 3J7A5 2KCMA 3F2DA 3CCRA 1N36L 1VQAA 4DR2L 1KQSA 4DV4Q 4GOPA 4NXMQ 2VQEL 1EWIA 1Q82C 4JI4L 4OWXB 2OWOA 4R4IA 3JC66 4DR1Q 2R92G 4GKJQ 1SMXA 5JJKA 5FJ8G 2LSSA 1O7IA 3NEMA 5GROA 5C44H 4A3CG 1IXRA 4DV6L 2MO1A 4EX5A 1NTGA 3CMAA 5LMNQ 4LF6Q 3KOJA 3CPWA 3NELA 4HJ9A 1KRTA 3K80C 4IJHA 4KLKA 4PMWA 3T1YQ 4DK3C 4LWCA 1K73C 1VQLA 3PCOB 1NBWA 1X9NA 1Q12A 4GS3A 1VQKA 1WCMH 3M4OH 2A8VA 2R93H 1FJGL 4DNIA 5C0XG 2ZM6L 4ALPA 4JI6Q 5FLXc 3L2PA 1Y1WG 1Y1VG 4DV3Q 1QUQB 1IBKQ 2BA1A 3TEHB 4DUYL 4AQYL 1A62A 4DPGA 1C0AA 1OXXK 2RHSB 3KF8B 3G71A 4IOCA 1Q7YC 1M90C 3AYHB 1SN8A 3PUWA 4A3JG 2HHHL 2CFMA 3KJPA 4JI7Q 3HOXH 1L2FA 4R4OA 4DV5Q 3OTOL 2K5NA 4DK6C 1SLJA 2L15A 1YEZA 2WFWA 2WB1G 2KHJA 3FHWA 4C3HH 2Z6KA 1HNXL 1XNQQ 1AH9A 4IPCA 2UUCL 3RLFA 4YCUA 2VL6A 3PIOA 1NMGA 3M7NA 4IO9A 1K9MC 2QGQA 1U0LA 4DV2L 1XPOA 2CQOA 3CQZH 2AWNA 2D0PA 3CP0A 3PGZA 4JYAL 3EBEA 1N34Q 2OQKA 5IYBH 2R7ZH 5BR8Q 1HZBA 1YJWA 1VQ9A 2JEAI 5M5WH 5IYCG 4L5QA 4A3BH 4PZ8A 4EQ5A 1MKHA 3CCJA 4GNXB 3H0GG 4AYBG 4IPGA 4L5TA 2Y0SE 5DLQE 1QUQA 4B3MQ 3S1NH 4BXXH 3SGIA 2BH2A 2ZTDA 5C4JH 1U5KA 1VCIA 3TQYA 1IL2A 1V1QA 2XTIA 2ID0A 4KHPQ 2EIFA 3G6EA 4PZ6A 4R4CA 1WJJA 2IHFA 2UUBL 4DR6L 3G4SA 3HKZG 2N8NA 4A3LH 3D0FA 3PIPA 2R7ZG 1IBML 2K5VA 4YWKA 2A1AA 1VQHA 3HOVG 3FKIG 1C9OA 4JI3L 2IY5B 4P75A 3G48A 4XIGS 1N33L 1T9HA 3IRBA 2MO0A 3HFZB 4NPSA 4UPAA 2MNAA 1PH9A 1X65A 2UXBQ 3S2HH 1P8LA 1GVPA 4YWLA 4A3FG 4X64L 4BXXG 3CCVA 5LMUL 4LF4L 4A93H 4GKKL 4JCVE 2MFIA 2XGTA 3FP9A 4YCVA 2NN6I 2OCEA 2Z6KC 3RR5A 5M5YH 2ZJPA 2B63G 2YTYA 1JJCB 4YY3L 4A3KH 1VQMA 4L5SA 3PF5A 1VQ4A 2JJQA 1YBYA 1TWFH 2F4VQ 4GNXA 4A3GG 4DUZQ 1A0IA 1H95A 1YITA 1PH5A 1IZ6A 3AFQA 3I2ZA 3MXNB 1XPUA 3K7AH 1HNZQ 1EIFA 4GLVB 4B3RL 4AIMA 4YHHL 3GTGH 3NENA 1S3OA 2JA7G 1VQCA 3CXCA 3S1QH 4X65L 3GTKH 1G51A 1CKNB 3CAMA 1TWCH 3LGJA 1J6QA 4TVAB 2WAQE 4UP9A 2N78A 4KHZA 4LFAQ 3H3VI 4B3SL 1OTCA 4A3DH 3OW2A 1N32L 2R92H 2JK8A 2KCTA 5FJ8H 2EQSA 1YNXA 4A3CH 3GTMH 2UU9Q 4BBRG 3W5OA 1GM5A 1N8RC 3OYYA 1VQDA 2K50A 3PSIA 4X66L 4A3IG 1EYGA 2AWOA 4JC0A 4PG3A 3TREA 4DR1L 4DR7L 1GKHA 4GKJL 4NB3A 1HNWL 3K8AA 2IHEA 4QJFA 5GAHC 4DV1Q 2JA5G 4NXNL 3S1RH 1D8LA 4LW1A 1R9TH 5LMNL 2YYZA 2CWAA 2R7FA 4BY7G 4A3EG 4HIKA 1Y1WH 3S2DH 3T1YL 3A0JA 4JI0Q 1VQ8A 1Y1VH 4J15A 2NZOA 4WJ3M 3A5UA 2DUDA 4DV0Q 3I7FA 3K7UC 1S72A 5AJ3Q 4UY8C 4LUOA 4JI6L 4A4IA 2K52A 2Q2UA 1JE5A 3HOYH 4A3JH 3KF6A 1J5EQ 1MJEA 2A19A 4QIWE 1YHBA 4QL5A 4JI1Q 4BA1I 4LFCQ 4OX9L 1CKNA 3RN5A 2RF4A 4GNXC 4BBSG 4GN5A 4AH6A 1LTLA 1C7YA 1KXLA 1IBLL 4POFA 2V1CC 4HJ8A 4DR5Q 2E5LQ 1K3RA 3AEVA 4QQBX 4JI7L 3BZCA 1FL0A 2VUMG 4JI8Q 2HIXA 4IFDI 1PFSA 1XNQL 3M3YH 1V43A 2PMZE 1ASZA 3KJOA 5IP9G 5J3BA 4DR4Q 1JMCA 5IY0A 4C3JH 1XMQL 3PUZA 1KHIA 2KHIA 1A8VA 3CCMA 2AKWB 1XNRQ 3HOYG 3GD7A 2UUAQ 1YHAA 3ICEA 5HGQA 1FVIA 1Q1EA 3F1ZA 2WB1E 3WWVA 4B3TQ 1PVOA 2BH8A 1JJGA 4JI5L 3GDEA 5IYCH 1VS0A 4L5RC 3H0GH 2VQEQ 1YIJA 1PH6A 4X62L 1GD7A 1PYBA 2RCNA 5LMNW 2CCZA 1E7ZA 1CSPA 4DV6Q 2GN5A 1FGUA 4P72A 1BKBA 1UWVA 2F52A 4C3IH 3J81j 2YU9H 4P73A 1SRUA 1QVFA 1B70B 2ALYB 1PHJA 3KDFA 1VQNA 3NBHB 1XTDA 5HY6A 1VQPA 1I5FA 1PH3A 4TQUS 4P74A 1YHQA 3HOVH 4HJ7A 3FKIH 1FJGQ 4AYBE 4HIMA 2ES2A 2JA8G 1L1OA 1I94Q 3TS2A 3ULPA 1A63A 1CKOA 1KAWA 4DUYQ 3PUYA 4A3FH 4DR3L 4IPHA 1EIYB 1EQRA 4R4TA 3I4NG 2YTVA 3I4MG 2ZTEA 2QA4A 2HT1A 3HKZE 5ELNA 2B63H 1W2BA 3OTOQ 4Y52H 4QY7A 4BY1G 2R6GA 2H5XA 3W1BA 1HNXQ 1Q81C 4MTNA 3CPFA 1VQBA 2UUCQ 4A3GH 5K36G 5IWAL 3HOUG 1YVCA 1X3GA 4OWTB 3ULLA 2VQFL 4LF9L 2VZAA 3I55A 3UE0A 3U58A 1G6PA 3HOZG 5FLMH 3T1HQ 4K0KL 1HR0L 3GO5A 4LNQA 2C35B 1X3EA 1UE6A 1QZGA 2K14A 1BVSA 4JYAQ 1S40A 2JA7H 4JV5L 3A74A 2K75A 2LXJA 4FDBA 1HNZL 1VQ7A 4R4QA 1KC8C 3PO3G 2ZJQA 4JOIC 3D31A 3RZDH 5C3EG 1NMFA 3E9HA 1VQGA 3CF5A 1B7YB 4DV7L 1JT8A 3A5ZB 4LF5L 4RMFA 4DAYB 3AFPA 3L0OA 5GADC 3S1MH 4LFBQ 2NN6G 1TXYA 3ERSX 4JBWA 3STBC 4BBRH 3S17H 3H15A 5M3MG 4A3IH 3H3VH 2QEXA 2UXDL 5JEAG 1EUJA 1X3FA 5FLMG 4IOAA 4YCWA 3S14H 1CSQA 2ASBA 1YJNA 2JA5H 1MIUA 3KF6B 1W3SA 2UUBQ 4DR6Q 1VQOA 1BBWA 1WI5A 1L1OC 1PH2A 2JEBI 1IBMQ 5IP7G 4APVA 2PI2A 1E1OA 4BY7H 4A3EH 2Q2TA 5JEAJ 4JI3Q 4HIDA 4LF7Q 1E3PA 1D7QA 5GAGC 1PH4A 4KI0A 4UP7A 3RLNA 3GTLH 4Y7NH 2ZTCA 3J81c 1XMOQ 4X64Q 1CKMA 2VS1A 4DV4L 4NXML 4JI0L 5LMUQ 1PV4A 4MNOA 2NVTH 4GKKQ 1EFWA 3K81C 4R1JA 1SROA 1HR0W 4BBSH 1PH7A 4XTCS 3KFUA 1PYSB 5IE8A 1QVCA 3CCSA 3PV0A 2NZHA 4LF6L 4ME3A 4A3MH 1OXTA 3J7ZC 2I0QA 2VUMH 2JQOA 2N49A 2Z0SA 2WP8J 1KD1C 3CD6A 3TRZA 4OO1I 2I5MX 1X55A 3U50C 3L7ZC 5IP9H 4B3RQ 3VDYA 1Q86C 2RHQB 3PUVA 4A3DG 4X65Q 1RL2A 3U4VA 4DV3L 1I50H 4LUZA 1KL9A 1IBKL 2CWPA 1HZAA 5M3FG 3KDFB 4POGA 4X6AH 3PF4A 3RZOH 4B3SQ 1WFQA 2NVYH 5EAYA 3B6YA 2PNHA 2FXQA 1L1OB 4A3MG 4DV5L 3AQQA 2LXKA 4IJLA 4JI2Q 3UDFA 4C2MH 2EXDA 2UXCQ 3M85A 1Z47A 3I4OA 4O0AA 4X66Q 4DR7Q 2UXDQ 3PO2H 1JB7A 1B8AA 1X54A 2PQAB 1HNWQ 3HOUH 4OXPA 4HIOA 3CCQA 4NXNQ 4IFDG 4GLXA 1LYLA 2N3SA 3HKSA 1LUZA 1SFOH 5C0XI 1E1TA 2JA8H 1N36Q 3F2BA 4DR2Q 4YWMA 1OXSC 1M1KC 1UE7A 1N34L 4JOIA 4JI4Q 3BZKA 2K4KA 3JAMc 1Q8KA 5BR8L
chains in the Genus database with same CATH superfamily
4X3KA 4RCNA 2E2JB 4KKTA 5CYUA 1I94L 4DAMA 1WTRA 2RKSA 4A3DG 1PH1A 3I4NH 1SDFA 4OX9Q 3I4MH 1NE3A 3PO2G 3EN2A 3I72A 3GTJH 1Z9FA 1L0WA 2D2CC 2MP1A 1U4LA 4EGVA 1E0BA 1Q1BA 1VQFA 1K0RA 1DOKA 4JBJA 3UE1A 5ISRA 1OXUA 1MJCA 1SE8A 1WCMG 2F0UA 4DNTB 4DFAA 2R93G 4PQXA 1CQVA 4ZLTF 2PYKA 2WAQB 5C3EH 4KKUA 4JI5Q 2H4OA 1XX8A 1TWAH 1LM0A 4X62Q 2AHOB 4IZ8A 4K2LA 2NN6H 4KD3A 3GTPB 3DM3A 1C48A 4DK0A 5IYDH 4M1UB 4MZ9A 4DV2Q 1BXTA 2IPKD 4LFBL 2I5HA 3HEJA 4PV1C 3I4LA 2E2JH 4OWWB 3ULJA 2IWHA 1BBUA 3UDIA 1GJXA 1EOVA 3KBXA 4LJZC 3J80i 5EKIA 2IX0A 1JWSD 5IYDG 3RNUA 4LF7L 2PO4A 3VYSA 2JE6I 5AFWA 2B3GA 3EQLC 1XMOL 1BF4A 1GUOA 1BCPB 3AU7A 5C4ZA 5FLXL 5IT9c 2R7DA 2VQFQ 2HIVA 3I8ZA 1HR0Q 2HQLA 2DY8A 2PMZB 4MHEA 3QB3A 3CU7A 2IX1A 3GTPH 1I4GA 3C3LA 4BA2I 5DM73 5AJ3L 4YY3Q 1RIPA 4LF5Q 1J5EL 3VR5A 5KGUA 1Q3LA 2VY3A 4ZCKA 1CI3M 2WAQG 1UEBA 5E4XA 5ELBA 4F88A 1BNZA 4DR5L 4HJ5A 1DD2A 2BA0A 2K04A 4JI8L 1BBXC 4O2DA 2IJ0A 4V0BA 3STBD 4CDDC 1QOHA 4IFDH 2F3IA 1TWGH 2F0GA 2OQ0A 4OO1G 1HQMC 4C3HB 3H0GB 3MFYA 1C4QA 1XNRL 3H94A 3S24A 4V190 3J7A5 3F2DA 5HGTA 2IW3A 1TS2A 3CQZB 2CQAA 4YIJA 1XPUA 2OT2A 2SNSA 2OWOA 2A6ED 3MXNA 4A3CG 2EE1A 5GROA 5IGFA 5C44H 3HKZB 1D5XC 4G4KA 2R7ZB 4DV6L 1NTGA 3K59A 3FKIB 4KY7A 3P20A 3K5MA 4KLKA 3T1YQ 3Q24A 1K73C 3A7AB 1F77A 3T53B 2MPMA 2VB3X 2WINB 2O5JC 4QB4A 4N9TA 4HAEA 4LMQD 3RUZA 4LAAA 2K33A 1C0AA 1TS4A 1OXXK 2RHSB 3G71A 4IOCA 1Q7YC 1M90C 3AYHB 3PUWA 2HHHL 3HOXH 1ET9A 3BVZA 4U68A 4CKCA 1JICA 1TT2A 4DK6C 2ZXOA 2F0LA 2WFWA 3FHWA 1QB5D 4C3HH 4IPCA 3O13A 3FEWX 3CHBD 4IO9A 1ENFA 4K6DA 1U0LA 4HEDA 5EKLA 3CQZH 3CP0A 4JYAL 1NR4A 4C3JG 2QDBA 4HCEA 4DNRB 2R7ZH 5I4DA 1EY6A 2RQXA 4HMIA 5IYCG 4EQ5A 1MKHA 3H0GG 2JYOA 4FP5D 1QE6A 1IYUA 2EIFA 4MIUA 2FJ2A 2UUBL 1EZ8A 2F3VA 3HKZG 3G4SA 4A3LH 2R7ZG 2K5VA 3NP8A 4Y7NB 1AFPA 4CBVA 2KCNA 3FKIG 4HTHA 2MHVA 4XIGS 3X3NA 1T9HA 1DOMA 3JAME 1EYCA 4BBSB 5DNFA 1PH9A 4EQNA 4YWLA 4A3FG 4H7BA 2VUMB 2XGTA 3FP9A 2OCEA 2AUKA 1B4OA 1H9RA 1RTOA 2WIIB 3T56B 1VQ4A 1YBYA 1I4HA 1A0IA 1LTAD 3NTIA 1B1ZA 1H95A 4B9WA 1YITA 1IZ6A 2PZTA 1M8AA 3AFQA 3K7AH 1PRTF 3OSOA 1EIFA 4B3RL 1STEA 1SNPA 1BR9A 4J6HA 5EBDA 2Z8LA 1CKNB 2E74C 1TWCH 3CAMA 1J6QA 3NSWA 4TVAB 4KHZA 1GHJA 3M3YB 3MXUA 2KCTA 5FJ8H 3DUZA 4X3SA 4XT1B 2KEEA 2XNAC 4RAUC 2CVRA 2K50A 2G5DA 2AWOA 4JC0A 4PG3A 2UXDL 4NB3A 3K8AA 5GAHC 2VXWA 3VA5A 4AYBB 1SYFA 3NHHA 4NXNL 2WV6D 3BDCA 5LMNL 3DEPA 3DMUA 1A15A 4DAYA 1GUTA 5D65A 3MEHA 3A0JA 1VQ8A 1Y1VH 2NZOA 1UEAB 4BY1B 1S5FD 2DUDA 1S72A 1QNKA 5AJ3Q 4OIJA 4JI6L 1HXYD 2HD3A 4KTAA 2NTTA 2K52A 5D3IB 4A4IA 1JE5A 2Q2UA 2DNCA 1J5EQ 1MJEA 4XQJA 1CKNA 3N6RA 2RF4A 4BBSG 4GN5A 4AH6A 4CDCC 1WD0A 1HFNA 2V1CC 4DR5Q 4QQBX 4JI7L 1FL0A 2VUMG 4JI8Q 1WVLA 4TSSA 1PFSA 3J7AF 1XNQL 3M3YH 1V43A 1STGA 5EGTA 5J3BA 1EY5A 3AB9A 4KMUC 2AKWB 3F2UA 1XNRQ 2O4XA 1HCZA 1FVIA 4H13C 3S15B 1JJGA 3IFDA 1PVOA 2L5TA 3MFGA 1RCVD 4HSVA 4BWGB 3BDOA 3MAQA 2L4NA 4FF1A 4DV6Q 2EXZA 2GN5A 4K5WA 1BKBA 3RZDB 1LLRD 3BYYB 1B70B 1TIID 1TQOA 2K5WA 3NBHB 1VQPA 1I5FA 4HR7B 5CR3A 1YHQA 3HOVH 4A3IB 4AYBE 3Q0AA 3TS2A 2F0HA 1CM9A 3RMHA 2CH4W 2EVBA 1HTLD 3A7LA 1KAWA 5M5XB 4ABNA 5IODA 3NQIA 4R4TA 2B2TA 2FMCA 5JPNC 2YTVA 3OMGA 2A69C 1MSHA 5ELNA 2ZXPA 1ET6A 4BY1G 5I6WA 2CW0D 3E0JA 3GTLB 3CPFA 1VQBA 1VF7A 5K36G 5IWAL 3HOUG 4FYDA 5CV6A 1G6PA 3N52A 3I90A 2F0KA 5BN5A 5FLMH 1V1OA 4MTKA 2BE5C 2F0PA 4JYAQ 1BVSA 3ONAB 5EPLA 3MHBA 3RD4A 2JA7H 4JV5L 1BCPD 4FDBA 2LXJA 1Y8PB 1ZEQX 2B2VC 1II3A 3RZDH 2Q8IB 1EFID 4DV7L 4FXGC 1DOLA 4E6IA 4I7ZC 3AFPA 4XQQA 1KLUD 4FXKC 4RGTA 4A3IH 2KVMA 2F0NA 5FLMG 1EUJA 1X3FA 1MD2D 4ZUIA 3SXHA 4YCWA 3K57A 5FO9B 1YJNA 3JAML 3KF6B 1W3SA 2UUBQ 1GUWA 3NK9A 1QNUA 2JEBI 2PI2A 5CV8A 4L8JA 4NDXA 1F9PA 1YNNC 5JVG3 4F8MA 2F0FA 1LACA 2B2TC 3P7JA 2XWJB 4UP7A 4LK1C 3GTLH 1HHVA 2ZTCA 4L63B 2VS1A 4DV4L 2V4DA 2NVTH 4MNOA 1EFWA 1LTRD 2EZVA 1SROA 3HGBA 1I6HB 1QVCA 1S5DD 3PV0A 2M00A 2QW7A 1WTXA 3KLSA 1SMYD 1PTOC 4ZRZA 5EPJA 1S5BD 2JQOA 2N49A 2PCFB 4FNFA 1KD1C 1K8OA 5C5LA 1X32A 5IP9H 1X55A 4B3RQ 2KCCA 3E6ZX 2JA6B 1S5CD 3ND9A 4DV3L 3WOEA 4LUZA 1IBKL 2F0MA 2EYHA 2R61A 3HOZB 1A2TA 3RZOH 2JN4A 2Y0SB 1L1OB 1PZID 3UDFA 2KECA 3M85A 5FO8B 2K1BA 2RSNA 1Z47A 3C1FA 3I4OA 2UXDQ 1JB7A 3SVMA 1DZ1A 4NXNQ 1A2UA 1LYLA 5IGGA 1STHA 5IGCA 5C0XI 4A3BB 4O42A 4JI4Q 1FNUA 3GTQB 3BZKA 3ULLA 1I6HH 2D5DA 4IFDJ 4RKLA 5C4XB 3DXJC 4QGUA 3Q6SA 1E22A 1K83H 3K0YA 1QZHA 1PH8A 2MUYA 1TR5A 2JA6H 1KRSA 2HCIA 1EY8A 1OXVA 1X56A 1IYJB 3HOWB 5CV4A 2GVAA 3ZJYC 2KBNA 2OXPA 2ZM6Q 3HOZH 4JBKA 1SJED 4K8IA 4A75A 3CC7A 2AMCB 1WTPA 3NQTA 3R8BA 2YV5A 4A76A 3GP7A 3BJUA 3T1HL 1G291 5JVH3 1CFMA 1AE3A 3TZDA 2B29A 2HUGA 2JA6G 2EYFA 2GVBA 3DWQA 4GOPC 3Q22A 1B3QA 3GTOB 4KK7A 5M3MH 2ATWA 3GTGB 2SEBD 4DUZL 1HUMA 1YZ6A 3GTQH 5JJLA 5T1GA 3S1QB 2Y0SG 1SNCA 4KJNA 2QEJC 4PMCA 5C4XH 5IP7H 1KDBA 3P1HA 1WTOA 1D2BA 2F0OA 2K6AA 5H1SE 4FXDA 2A6HC 4RGMA 1HUNA 1YNJC 3HOWH 4A3BG 1H9SB 2Z6BA 3PMFA 3CCUA 1GUGA 3MXPA 4LF8L 3W2DA 5JPMC 5K5PA 5C4XG 4K8JA 4KN7C 5IWAQ 2EYMA 1ONLA 2A69D 1GOZA 4A3DB 1FR3A 4GLAC 3KK7A 1N33Q 4XQNA 4PZ7A 1RDPD 1SNDA 2F0IA 3HOWG 4JV5Q 1STBA 3BVGA 1S5ED 4LF4Q 3GTOH 1WYDA 1F9QA 2JP1A 3R93A 4J1MA 2NB0A 4DV0L 2A5HA 2WB1B 2BE5D 3W1GA 3I56A 4DV7Q 3KYHC 4NKLA 4LFCL 4A93G 4H02A 1F9RA 3UDXA 1BO0A 3IL8A 1Y8OB 5ELOA 3RN2A 1NJIC 1CT1D 4JI2L 1QVGA 1ASYA 2UXCL 4IUTA 3PIO3 2B2WA 4DR4L 2DY7A 1M4VA 2QCPX 2M2LA 5GQOA 4B3TL 1H9JA 3HS0C 1N36L 1KQSA 4DR2L 4DV4Q 4A3DH 2VQEL 1EWIA 1YNND 1SAPA 2R92G 4DR1Q 4GKJQ 5JJKA 1SMXA 2YU9B 2LSSA 3NEMA 1IXRA 3OIQA 3J7YW 4H0LC 5EPKA 5FO7B 4LWCA 1VQLA 3PCOB 5IIFA 3S1NB 3SEBA 1AEXA 1SYEA 1JE4A 1WCMH 2R93H 5ELFA 5C0XG 1PTOD 1Y1WG 1ESFA 5EQ0A 1EZ6A 3QG1A 4DV3Q 1Q90A 1IBKQ 2BA1A 3TEHB 3J81E 4AQYL 2ENBA 1FNVA 4ILWA 4A3JG 1H9MA 4H44C 3OTOL 2K05A 2L15A 2WB1G 1HNXL 3D4WA 1AH9A 4ZKCB 3RLFA 1NUCA 2VL6A 3M7NA 3QWNA 2B2WC 5ELCA 3TP6A 2RSOA 2XN9C 3KBGA 2F0SA 2A73B 4RH6A 1V8QA 2OQKA 2OEOA 4NMZA 1FYCA 4PZ8A 1KNEA 3S14B 1PDQA 2JA5B 2DNEA 3S1NH 1RJTA 1QCBD 1VCIA 1SBBB 2ID0A 4C3IG 1LT4D 2I46A 2LS01 4PZ6A 4R4CA 1B44D 1U4RA 1Q8IA 2L9HA 1CZWA 4ZKBB 1GHKA 4RA8A 4C1NI 2IY5B 2F0JA 3G48A 3NPPA 3IRBA 3HFZB 4NPSA 3ZYYX 2MNAA 1X65A 1GVPA 2F0WA 3S1RB 4X64L 4ZQ3A 3CCVA 2EJFC 5LMUL 4GKKL 4C56C 1X3PA 4JCVE 5I6YA 4YCVA 2ZJPA 1W6JA 1JJCB 3BVMA 4L5SA 2FMMA 4DUZQ 1UAPA 4QCLA 1PH5A 1EY7A 3MXNB 1J8IA 1ENAA 4GLVB 4IUUA 4OO1H 4AIMA 4YHHL 5CBAE 3NENA 1EYDA 1CA5A 3LGJA 2JXMB 2WAQE 1CQFA 1UNSA 4B3SL 1OTCA 3OW2A 1N32L 2NYZD 4C3JB 4A3CH 3D6CA 1PFNA 1YNJD 4LF8Q 4PNYA 2JA8B 4XDXA 5ELEA 4QJFA 2JA5G 4GZYC 3S1RH 2CWAA 5E1FA 3J7AV 4JI0Q 1HPCA 4WJ3M 3A5UA 4DV0Q 4JVZA 4UY8C 5LL6S 4NW2A 4LFCQ 3H3VC 1YHBA 2NVXB 1XTCD 3NUCA 1V1PA 1BCPF 3HZXA 1KXLA 5IT9E 3HP3A 3LWUA 3QJYA 4A3FB 1K3RA 5BN4A 4ODGA 2KUMA 4Z9CB 2L12A 3PO3B 1ILQA 2PMZE 3NWTA 3KJOA 4DR4Q 1JMCA 1EEID 1D6EC 4C3JH 3CCMA 2K28A 3GD7A 3ICEA 5HGQA 1Q1EA 3WWVA 4B3TQ 3T4AC 5IYCH 1VS0A 3H0GH 2VQEQ 1PH6A 1GD7A 3M4YA 2FFKB 3FVQA 4DAVA 1FGUA 1R4QB 2G9DA 2E2IB 2ALYB 1PHJA 5KRUA 1VQNA 3J81L 3S1MB 2EYPA 3D6WA 1EIHA 4CJ0B 3S17B 3FKIH 2JA8G 1A63A 1I94Q 3ULPA 1E2VA 3ERQA 3CKIB 3IAYA 3MA2B 3D3RA 4A3FH 4DR3L 2E75C 1EIYB 4IURA 3L3OC 3SK5A 5IOCA 3OIPA 2LFNA 2ZTEA 1G8ZD 3HKZE 5NUCA 3OTOQ 4Y52H 2R6GA 2H5XA 5G3LD 3W1BA 1HNXQ 1Q81C 4MTNA 1GUNA 2KEDA 3VA7A 4R8IA 2VZAA 3UE0A 3U58A 1WTWA 4KY5A 5BN3A 4WFN3 4K0KL 2EY2A 4LNQA 1X3EA 2F03A 1JR0D 3OHXC 1HNZL 1VQ7A 3P75A 1KC8C 3PO3G 1W6KA 2F0VA 1VQGA 1LT5D 4DAYB 1B3AA 2O2LD 3S1MH 4LFBQ 1EQVA 5F2DA 3S17H 4XXEA 5JEAG 2K5QA 4WJWA 1CSQA 2ASBA 1LT3D 2PW5A 4RHSA 1BBWA 1T5XD 5KNCA 1SE2A 1JOOA 4LF7Q 1E3PA 3A8IE 2K32A 4Y7NH 4DAPA 5CV7A 1XMOQ 4X64Q 3M7GA 1I4QA 5LMUQ 3R2IA 4GKKQ 2F4IA 4O1NA 1K8MA 4DF7A 4BBSH 1PH7A 5D3DA 1PYSB 1E2ZA 1I3QB 1F2LA 2VUMH 2TSSA 4IQZA 1TWHB 2I5MX 3U50C 1T5EA 3SK6A 3G6JB 3HOUB 3PUVA 1SNOA 1CA6A 1RL2A 1SE4A 1EQTA 5EBCA 4X6AH 3PF4A 4B3SQ 1WFQA 3DWAA 2P5ZX 3X3MA 1ZYRC 2WKCA 4I65A 4WRDA 1PRTC 2EY5A 4DV5L 5CV5A 1SYBA 2EXDA 1D5MC 2GA4B 2CHBD 1X54A 2PQAB 5ELDA 4OXPA 1R4PB 3CCQA 3QR8A 2N3SA 4OEMB 1E1TA 3V96A 3F2BA 1DXMA 4YWMA 1OXSC 3H09A 5CMDA 1M1KC 2L11A 1N34L 2B2VA 2K4KA 4RWSC 1Q8KA 5BR8L 5M3FG 1HRJA 3BDLA 3OWFA 5IT9L 1I3QH 5KIXA 1GO3E 2OTLA 1PTOB 1N9WA 3VR2A 3PUXA 1TWHH 3M9BA 4GN4B 4BY1H 1A3VA 4WJ4A 3E3XA 3EVQA 3H6MA 4ZK9B 5K36H 3K0XA 5C0XJ 3ER0A 3HOUH 2PW7A 4KHPL 2E8GA 3MWYW 2Z9HA 4JBMA 1O7YA 2RVLA 2K5HA 1X6OA 2MQHA 1UE5A 2PQAA 1B9NA 4S3SA 2AUJD 2HHHQ 3U4ZA 2NZ1D 5M5YB 3S16B 3MEFA 1XPRA 2VW9A 5EJWA 1HA5A 4CJ2C 3QO2A 2Q2HA 1HQRD 1VQ5A 1I4RA 3S15H 1SE3A 2J4XA 1E2WA 3WDNA 2LY7A 3KF8A 1PTOH 1Y14B 1VQIA 1TY0A 3U9OA 3CCEA 1ILPA 5IYBG 4IPDA 3FPPA 1STNA 2LKVA 1YJ9A 4DR3Q 4LFAL 1IKMA 2QDLA 3T13A 4IN3A 4Q5VA 3OWEB 4QIWB 5TSSA 2VNUD 2OTJA 2UU9L 1PZKD 5C5MA 3UDGA 5M5XH 1HH2P 1R9TB 3CC4A 1HZCA 1G6ZA 3EIVA 4DV1L 3DHQA 3SDZA 2JA9A 3DLLA 3CC2A 3S16H 1SR3A 4K0KQ 3SR1A 4P71A 1V9PA 2A74C 2EY6A 4GOPB 4X3TA 3J80c 1KABA 1OO9B 4LUVA 3M4QA 4X3UA 1EWHA 2A68C 1TVXA 1B9MA 3NBIA 1VQEA 2Q2IA 1HJPA 4A3KG 1EY4A 1CTMA 2PI2E 2Z4IA 1JQYD 4QUCA 2ZJRA 1XYIA 3DEOA 5JJZA 3JAMi 1AZPA 3EROA 3RLOA 1NY4A 1WTVA 2UUAL 1Q46A 1EQQA 3V2TA 4G7OC 3CCRA 1G91A 1VQAA 2F0DA 2Z1CA 4GOPA 5KNBA 3I73A 4OWXB 4R4IA 3JC66 1O7IA 1KNAA 4EX5A 5LMNQ 3I3CA 4DK1A 3KOJA 3CPWA 3TP5A 4NP5A 3NELA 1I4PA 3Q23A 4IUQA 4UAIA 1X9NA 4GS3A 5C4JB 1WD1A 1FJGL 4JI6Q 5FLXc 3PIP3 2X6GA 2B63B 1QUQB 1A62A 1RTNA 5LL6X 4A3GB 1AN8A 2CFMA 4JI7Q 4DV5Q 4R4OA 2K5NA 1LO5D 1YEZA 2NWGA 4KKSA 1Y8NB 1XNQQ 1EYAA 2UUCL 1ZYRD 1EEFD 1SSOA 3BZDB 3PIOA 1L0YB 1EL0A 2PPBC 4A93B 4DV2L 3MTSA 1PXUA 2CQOA 2AWNA 4CGYB 3PGZA 1TWFB 2RCFA 1N34Q 4XYOA 1BUVT 5BR8Q 4FF2A 1HZBA 5I2YA 1YJWA 3K5OA 1VQ9A 3LX0A 2KHSA 4A3BH 4L5QA 5EKKA 1O80A 3CCJA 1K3BC 4L5TA 4RFBA 2Y0SE 5DLQE 1QUQA 3GTKB 4BXXH 2E2DC 3SGIA 2ZTDA 4KN4C 1U5KA 5C4JH 4DXFA 3LWEA 3TQYA 1IL2A 2BH2A 3MVVA 1V1QA 4A3EB 3NTKA 1Z7TA 4KHPQ 1A3TA 2AQ1B 3I91A 3G6EA 1WJJA 2IHFA 2R92B 3K58A 4PMBA 4JW0A 1CK1A 1RHPA 2KA7A 2R3ZA 4F87A 1C9OA 1U4MA 4JI3L 4EQOA 1PLFA 2PZWA 2MO0A 5FK9C 4UPAA 4TRDA 2PZUA 1PFMA 4BXXG 5I2XA 4UDUC 1GXDC 4A93H 2MFIA 2NN6I 1Y1WB 4K6LA 3RR5A 2B63G 3S2DB 2YTYA 4YY3L 4FVMA 3KUPA 1QG7A 2JJQA 1TWFH 4A3GG 4A3JB 1EIGA 1IKLA 2XRQD 4IUPA 3GTGH 1STAA 3CXCA 3S1QH 1KAAA 3GTKH 1G51A 4N8X1 1SEBD 3UI2A 1MGSA 1KTKA 2N78A 4UP9A 4LFAQ 3URYA 3H3VI 2R92H 2A6EC 4N9PA 3BS1A 2UU9Q 4BBRG 3W5OA 4DN4M 1N8RC 1NSNS 1VQDA 3OYYA 3PSIA 1GM5A 1EYGA 3TDQA 4DR7L 3EA6A 1GKHA 1HNWL 4HN7A 4DV1Q 2KOLA 2WACA 1ENCA 4G7HC 1G2SA 2YYZA 5C0XH 4BY7G 1O78A 4A3EG 3I4NB 4ME5A 1Y1WH 4UHVA 3T1YL 3I4MB 3NE5B 3S2DH 1RODA 4C3IB 4KJOA 3TP7A 1F2MA 3I7FA 3K7UC 4LUOA 2QILA 4A3JH 1PYWD 2A19A 4QL5A 2B2UA 1CZGA 2LMCB 1IYVA 4OL7A 2A68D 1WTHA 1IBLL 4POFA 4HJ8A 5COYA 4CKBA 2XRSD 4IFDI 4OGQC 4DA2A 3W3AA 3ITPA 1XMQL 3EFXD 1X3QA 3PUZA 1A8VA 1TWAB 5DEHA 1JWUD 2UUAQ 2WB1E 2BH8A 4L5RC 2K01A 1LTID 4OHJA 2RCNA 1BOSA 3H91A 1CSPA 1HTPA 3R3OA 2K5DA 1TS5A 1UWVA 2F52A 3ND8A 4C3IH 1NAPA 2YU9H 4P73A 1SRUA 1QVFA 2IX3A 3KDFA 2I07B 2WKDA 1XTDA 5HY6A 3J80L 1PH3A 1FJGQ 4HIMA 3HRZC 2ES2A 3NWSA 4R8NA 1CKOA 1IHZA 4HMJA 3BYTB 2B2UC 1EQRA 5D14A 2SNMA 3TBIB 3I4NG 3I4MG 2QA4A 2L1BA 2HT1A 4JPBW 1W2BA 3T16A 4QY7A 1JB3A 2NTSA 1DYQA 1IW7C 2UUCQ 4QF4A 1YVCA 1X3GA 4LF9L 3FPUB 3HG9A 3I55A 3T1HQ 5M9OA 3GO5A 4KV6A 2K14A 4CJ1B 4A3MB 4ZAIA 2ZJQA 4JOIC 5C3EG 1B7YB 1XXGA 3A5ZB 2L0CA 3R2TA 3L0OA 4F7XA 5GADC 2NN6G 1TXYA 1EOTA 3ERSX 2BDOA 1TY2A 1TWGB 1NCVA 2ZXRA 3H15A 3H3VH 1B2TA 4IOAA 3S14H 4EVOA 2NVYB 2AQ3B 5I9PA 2JA5H 3QOLA 1VQOA 1WI5A 1EWCA 1PH2A 1V1PB 3K5NA 3SE0A 1E1OA 2Q2TA 4JI3Q 3MZ5A 4HIDA 1D7QA 5GAGC 2F3WA 3GQBA 2A6HD 1PH4A 5C44B 2J0TD 1MI2A 3RLNA 1LTSD 3U9SA 4CDFC 1CKMA 4NXML 1LTBD 1SFOB 3TSSA 2EOTA 1HR0W 4XTCS 3AMUA 4KHVA 4CHTB 4LF6L 1F9SA 1SYDA 4A3MH 2B8FA 3OOCA 2Z0SA 2WP8J 5FKAC 3A55A 3TRZA 3WOFA 2Q8RE 3L7ZC 2ICIA 2MJ8A 3VDYA 1Q86C 2NUCA 2RHQB 1ZXTA 3U4VA 3HOXB 1KL9A 2BCOA 1KDAA 4POGA 3KLSX 2NVYH 5EAYA 1LV9A 2PNHA 3B6YA 1G2TA 2NVQB 2F1MA 3QOJA 2FHTA 2FXQA 1PFBA 3SHLA 4A3MG 3AQQA 4JI2Q 2UXCQ 4WORA 3TZUA 5IGEA 5CC4A 4DR7Q 1HNWQ 4G57A 4KY6A 4B08A 4HIOA 4KD4A 2Q8TA 4QMGA 4IFDG 3HKSA 3IFTA 1LUZA 1SNQA 1SFOH 1WTQA 2JA8H 1N36Q 4DR2Q 2RDGA 4EQPA 3JAMc 4RGOS 2N88A 3BU2A 4GN3B 3SK8A 1JORA 1GUSA 4RHRA 5C44G 2CW0C 4B3ML 3KLWA 2F0EA 4BS9A 4IUNA 1IBLQ 1C7YA 2D62A 2NVXH 1NNXA 1DCZA 3CCLA 2CKZB 1EU4A 3M4PA 3VYRA 1KLGD 2NVQH 4OELB 4AQYQ 2N55A 1XMQQ 1PRTB 1BCPC 2B39A 2RBMA 1O7ZA 1U9RA 3G7LA 5C3XA 5E7NA 3E9IA 1VQ6A 3PO3H 2X69A 3Q8DA 2UXBL 3NXWA 1HFGA 1O7LA 3C2PA 3F8TA 1JJ2A 3CW2C 5GAEC 1DGSA 4RG1A 3HOXG 3K7AB 5JEAH 4K5VA 4C3HG 2SDFA 2D0OA 2F4VL 1Z6HA 2K03A 1PA6A 1SYGA 3K5LA 1P16A 1TWCB 1VQJA 4U673 1WOCA 3A8JE 3CRLC 2I5LX 2XIWA 3CMEA 2E2IH 3J81i 1I6VC 3OMCA 2E2HB 1NR2A 3A56A 3F2CA 2DN8A 4DU9A 1YI2A 1CUKA 1ICWA 1I4XA 5JJIA 2KENA 1ESRA 5M3FB 1UE1A 1E24A 2DGYA 1SMYC 4LF9Q 1Y1VB 4DKAC 4A3LG 1IW7D 5T1IA 5KNDA 1AE2A 1SYCA 1ZKOA 4MN3A 3OW7A 3E0EA 1JC7A 3TS0A 1EY9A 2YTXA 4XYQA 3CRKC 4HJAA 3D4DA 1C8CA 3M4OB 5A35A 4JI1L 1KIXA 1MBYA 1BQQT 5LHY1 4K14A 5J39A 3D4RA 4OONA 2XWBB 2E5LL 2IT1A 4YHHQ 1AW7A 2E2HH 1XJVA 4JG2A 5L37A 5IGDA 4J8QA 1HZ9A 1QILA 2MGSA 5C4HA 1BDOA 4UP8A 5CORA 1K8GA 1N32Q 1H9KA 2PQEA 2Z4HA 5M3FH 2HDMA 1K8AC 2KCMA 5C6AA 1A3UA 3VR3A 4NXMQ 1Q82C 4JI4L 1QJOA 3DWPA 3VR6A 5CBEE 5FJ8G 2B2YA 3TN2A 2F0TA 4JK1C 5A2QE 2MO1A 3CMAA 4LF6Q 3HOVB 5CGKA 5M5WB 1D5ZC 2TMPA 2XVSA 1KRTA 3K80C 4HJ9A 4IJHA 4PMWA 2EYLA 4DK3C 3MXGA 1J9OA 1NBWA 1Q12A 1VQKA 3LNNA 3M4OH 1EU3A 2A8VA 4DNIA 1JWMD 2ZM6L 4ALPA 3L2PA 2B8GA 1Y1VG 2HDLA 2EJMA 1FNWA 2BDNA 4DUYL 4DPGA 3KF8B 1SN8A 3KJPA 1L2FA 1SLJA 2HQEA 3MC0B 2KHJA 3S9WA 2Z6KA 2DJGC 3S2HB 4YCUA 3OPOA 2JA7B 1NMGA 3NTHA 1K9MC 2QGQA 4M8AA 4IUVA 1XPOA 2FINB 2D0PA 4A3KB 1LTGD 3EBEA 5IYBH 3VYTA 4Q0FA 2JEAI 2B2YC 2E76C 4DXGA 5M5WH 5KYLA 4GNXB 4AYBG 4IPGA 3TMEA 2EYOA 2HCCA 4B3MQ 1DM0B 2XTIA 1XWEA 2EYJA 4DR6L 1FGBD 2N8NA 2QKIC 3D0FA 3PIPA 3GTMB 1IBML 4YWKA 3D8GA 3K6OA 2A1AA 1VQHA 3HOVG 2NVTB 4QUFA 4P75A 1N33L 2BOSA 1ML0D 1D1KA 1PTOF 2UXBQ 2H1EA 1P8LA 3S2HH 1TS3A 4LF4L 4DGZA 3NBHA 2Z6KC 4K5XA 5M5YH 1VQMA 1SNMA 4A3KH 3PF5A 2F4VQ 4GNXA 3HOYB 4G7ZC 3FMCA 3I2ZA 1K28A 1HNZQ 3RZOB 1F2ZA 4ID6A 2XSCA 1S3OA 1Y69U 2JA7G 1VQCA 4X65L 2OF1A 4CDEC 3A54A 3FDTA 2G9HD 4HSPA 2NBFA 5DAUA 2JK8A 5E3FA 2EQSA 1YNXA 3GTMH 2QF7A 4A3IG 4X66L 3TREA 1LT6D 1CHQD 4DR1L 4GKJL 2IHEA 1AP0A 5KEEA 1D8LA 1RF2D 4LW1A 1R9TH 1ICFB 3I70A 2R7FA 3PQIA 4HIKA 4FF4A 1K83B 4J15A 1LABA 1DONA 1L0XB 2VB2X 3HOYH 1F2YA 3KF6A 4OX9L 4BA1I 4QIWE 4JI1Q 4RGNA 4ULLA 4I7AA 3RN5A 4GNXC 3BG3A 2AQ2B 4N8FA 1LTLA 5KYIA 2E5LQ 2KJXA 2EY1A 3AEVA 3SK4A 3BZCA 1S4ZA 1PZJD 4XT3B 2HIXA 2M9VA 1ASZA 2K7VA 1JCKB 5IP9G 1SJHD 5IY0A 1IL8A 2RDFA 3J80E 1KHIA 2KHIA 3HOYG 1YHAA 5A2QL 3F1ZA 5M3MB 1HA6A 4JI5L 3GDEA 1YIJA 3VYUA 4X62L 1PYBA 2J7ZA 5LMNW 1PRTD 2CCZA 1E7ZA 1TKWB 1B50A 1AZQA 4HCSA 2C9OA 4P72A 3J81j 1A6XA 3GV6A 2PNRC 1MSGA 5JOBA 4K2KA 4TQUS 4P74A 4BBRB 4HJ7A 3V05A 1L1OA 2SOBA 4DUYQ 3PUYA 2DJFC 4IPHA 4IALA 2KQ3A 4BY7B 2B63H 4RCOA 2EDGA 2O5IC 4RKBA 4A3GH 4OIKA 2L55A 2VQFL 4OWTB 2F0QA 2IL8A 3HOZG 1LTTD 1HR0L 2C35B 4ZYSA 1UE6A 1QZGA 5FLXE 1S40A 1STYA 5J1ZA 4FO2A 3A74A 2K75A 3DM1A 4R4QA 3D31A 1NMFA 3E9HA 3CF5A 1JT8A 4ZUJA 4LF5L 4RMFA 1JOQA 4JBWA 3STBC 4BBRH 1I50B 5I9OA 5M3MG 1PMRA 2QEXA 1D1IA 3E5SA 2EPBA 5CV9A 1MIUA 1UUPA 4DR6Q 3KLRA 1KDCA 1L1OC 1IBMQ 5DM63 2EJGC 4C2MB 4APVA 5IP7G 2RDHA 4TKOB 4A3EH 4BY7H 5C3WA 5JEAJ 3PO2B 4B9XA 5J22A 2D9UA 4KI0A 3C1EA 2CH4A 3J81c 4L6TB 5E4WC 1EY0A 4JI0L 1PV4A 1VF5C 3K81C 1MHWC 3A8KE 4R1JA 5FOBB 5HURA 1VMCA 2C5CA 3KFUA 5IE8A 5JAVA 3CCSA 2NZHA 1WCMB 3VR4A 3QIAA 2R93B 4ME3A 2ZT9C 5G3LF 1OXTA 3J7ZC 2I0QA 4FF3A 3CD6A 4OO1I 3GTJB 1H9SA 2ICEC 3EJIA 1QWYA 1U4PA 4X65Q 1I50H 3FRPB 2CWPA 1HZAA 1TU2B 3KDFB 4P2CB 2JSOA 5IGBA 1RKNA 1SXTA 1VDZA 3GV3A 4C1NK 2LXKA 4IJLA 4C2MH 1K0SA 4R9WA 4O0AA 3TP8A 4X66Q 3PO2H 5C3EB 1B8AA 3T51B 4CKEA 3L9AX 2RA4A 1FD7D 1VMPA 4GLXA 3C46A 1RD9D 3IKJA 1CHPD 1JOKA 1B53A 2X6LA 1UE7A 4JOIA 1DJRD
chains in the Genus database with same CATH topology
4IFDJ 1I3QH 1GO3E 4DAMA 1I94L 2OTLA 1N9WA 3BU2A 4QGUA 1PH1A 3I4NH 1E22A 4OX9Q 1K83H 1NE3A 4GN3B 3PUXA 3I4MH 1TWHH 3EN2A 3M9BA 4GN4B 3PO2G 1QZHA 5C44G 4B3ML 1PH8A 4BY1H 3GTJH 4WJ4A 1Z9FA 3KLWA 1L0WA 2JA6H 1KRSA 1IBLQ 1OXVA 1X56A 1IYJB 3ER0A 3K0XA 1Q1BA 2D62A 5C0XJ 2GVAA 3ZJYC 1VQFA 2E8GA 1K0RA 2KBNA 2ZM6Q 2NVXH 4KHPL 4JBJA 3UE1A 4JBMA 3CCLA 3HOZH 1OXUA 1MJCA 2CKZB 3M4PA 1SE8A 4JBKA 4A75A 2NVQH 1WCMG 2K5HA 1X6OA 2MQHA 1UE5A 2PQAA 3CC7A 4AQYQ 1XMQQ 2R93G 2AMCB 2YV5A 4A76A 3BJUA 3U4ZA 3T1HL 5E7NA 2HHHQ 1G291 3E9IA 1VQ6A 3PO3H 3MEFA 3Q8DA 2UXBL 5C3EH 1XPRA 4JI5Q 1AE3A 2VW9A 3F8TA 2B29A 1JJ2A 2JA6G 1TWAH 1LM0A 3CW2C 2GVBA 4X62Q 1DGSA 2AHOB 5GAEC 2Q2HA 4GOPC 4RG1A 3HOXG 3DM3A 1VQ5A 3S15H 5IYDH 4MZ9A 5M3MH 2ATWA 4DV2Q 2D0OA 2F4VL 4DUZL 1YZ6A 4LFBL 3GTQH 5JJLA 2I5HA 1PA6A 2Y0SG 1P16A 2E2JH 1VQJA 4OWWB 3ULJA 5C4XH 5IP7H 1WOCA 1Y14B 1VQIA 1BBUA 3UDIA 2I5LX 3CMEA 5H1SE 2E2IH 3J81i 1EOVA 3CCEA 3J80i 5IYBG 4IPDA 2IX0A 3F2CA 3HOWH 1YJ9A 4DR3Q 1YI2A 4LFAL 5IYDG 3RNUA 1CUKA 4LF7L 4A3BG 1I6HH 5JJIA 2JE6I 2KENA 2B3GA 3CCUA 2VNUD 2OTJA 2UU9L 1XMOL 3UDGA 5M5XH 1HH2P 3CC4A 1HZCA 4LF8L 1UE1A 5IT9c 2R7DA 1E24A 2DGYA 5IWAQ 5C4XG 2VQFQ 3EIVA 4LF9Q 4DV1L 2JA9A 3DLLA 3CC2A 3S16H 2HIVA 4GLAC 1N33Q 4DKAC 4A3LG 1SR3A 4K0KQ 1HR0Q 2HQLA 4P71A 1V9PA 4PZ7A 4GOPB 1AE2A 3HOWG 4JV5Q 3J80c 2IX1A 3E0EA 3GTPH 4LF4Q 4LUVA 3GTOH 1WYDA 3M4QA 3TS0A 2YTXA 4DV0L 4BA2I 5AJ3L 4YY3Q 3W1GA 3I56A 4DV7Q 1RIPA 3KYHC 4HJAA 4LF5Q 1J5EL 4LFCL 4A93G 4JI1L 4H02A 1KIXA 1VQEA 2Q2IA 3UDXA 2VY3A 1HJPA 4A3KG 4LF8Q 2WAQG 1UEBA 2PI2E 4OONA 5ELOA 4DR5L 2E5LL 2IT1A 4YHHQ 4HJ5A 3RN2A 2BA0A 1NJIC 2E2HH 4JI2L 1XJVA 1QVGA 4JG2A 4JI8L 1ASYA 4O2DA 2UXCL 1HZ9A 3STBD 2ZJRA 2F3IA 1TWGH 2OQ0A 4DR4L 4OO1G 3JAMi 4UP8A 1K8GA 3RLOA 1NY4A 1XNRL 1N32Q 2UUAL 3S24A 5M3FH 1Q46A 1EQQA 5GQOA 1K8AC 4B3TL 3J7A5 2KCMA 3F2DA 3CCRA 1N36L 1VQAA 4DR2L 1KQSA 4DV4Q 4GOPA 4NXMQ 2VQEL 1EWIA 1Q82C 4JI4L 4OWXB 2OWOA 4R4IA 3JC66 4DR1Q 2R92G 4GKJQ 1SMXA 5JJKA 5FJ8G 2LSSA 1O7IA 3NEMA 5GROA 5C44H 4A3CG 1IXRA 4DV6L 2MO1A 4EX5A 1NTGA 3CMAA 5LMNQ 4LF6Q 3KOJA 3CPWA 3NELA 4HJ9A 1KRTA 3K80C 4IJHA 4KLKA 4PMWA 3T1YQ 4DK3C 4LWCA 1K73C 1VQLA 3PCOB 1NBWA 1X9NA 1Q12A 4GS3A 1VQKA 1WCMH 3M4OH 2A8VA 2R93H 1FJGL 4DNIA 5C0XG 2ZM6L 4ALPA 4JI6Q 5FLXc 3L2PA 1Y1WG 1Y1VG 4DV3Q 1QUQB 1IBKQ 2BA1A 3TEHB 4DUYL 4AQYL 1A62A 4DPGA 1C0AA 1OXXK 2RHSB 3KF8B 3G71A 4IOCA 1Q7YC 1M90C 3AYHB 1SN8A 3PUWA 4A3JG 2HHHL 2CFMA 3KJPA 4JI7Q 3HOXH 1L2FA 4R4OA 4DV5Q 3OTOL 2K5NA 4DK6C 1SLJA 2L15A 1YEZA 2WFWA 2WB1G 2KHJA 3FHWA 4C3HH 2Z6KA 1HNXL 1XNQQ 1AH9A 4IPCA 2UUCL 3RLFA 4YCUA 2VL6A 3PIOA 1NMGA 3M7NA 4IO9A 1K9MC 2QGQA 1U0LA 4DV2L 1XPOA 2CQOA 3CQZH 2AWNA 2D0PA 3CP0A 3PGZA 4JYAL 3EBEA 1N34Q 2OQKA 5IYBH 2R7ZH 5BR8Q 1HZBA 1YJWA 1VQ9A 2JEAI 5M5WH 5IYCG 4L5QA 4A3BH 4PZ8A 4EQ5A 1MKHA 3CCJA 4GNXB 3H0GG 4AYBG 4IPGA 4L5TA 2Y0SE 5DLQE 1QUQA 4B3MQ 3S1NH 4BXXH 3SGIA 2BH2A 2ZTDA 5C4JH 1U5KA 1VCIA 3TQYA 1IL2A 1V1QA 2XTIA 2ID0A 4KHPQ 2EIFA 3G6EA 4PZ6A 4R4CA 1WJJA 2IHFA 2UUBL 4DR6L 3G4SA 3HKZG 2N8NA 4A3LH 3D0FA 3PIPA 2R7ZG 1IBML 2K5VA 4YWKA 2A1AA 1VQHA 3HOVG 3FKIG 1C9OA 4JI3L 2IY5B 4P75A 3G48A 4XIGS 1N33L 1T9HA 3IRBA 2MO0A 3HFZB 4NPSA 4UPAA 2MNAA 1PH9A 1X65A 2UXBQ 3S2HH 1P8LA 1GVPA 4YWLA 4A3FG 4X64L 4BXXG 3CCVA 5LMUL 4LF4L 4A93H 4GKKL 4JCVE 2MFIA 2XGTA 3FP9A 4YCVA 2NN6I 2OCEA 2Z6KC 3RR5A 5M5YH 2ZJPA 2B63G 2YTYA 1JJCB 4YY3L 4A3KH 1VQMA 4L5SA 3PF5A 1VQ4A 2JJQA 1YBYA 1TWFH 2F4VQ 4GNXA 4A3GG 4DUZQ 1A0IA 1H95A 1YITA 1PH5A 1IZ6A 3AFQA 3I2ZA 3MXNB 1XPUA 3K7AH 1HNZQ 1EIFA 4GLVB 4B3RL 4AIMA 4YHHL 3GTGH 3NENA 1S3OA 2JA7G 1VQCA 3CXCA 3S1QH 4X65L 3GTKH 1G51A 1CKNB 3CAMA 1TWCH 3LGJA 1J6QA 4TVAB 2WAQE 4UP9A 2N78A 4KHZA 4LFAQ 3H3VI 4B3SL 1OTCA 4A3DH 3OW2A 1N32L 2R92H 2JK8A 2KCTA 5FJ8H 2EQSA 1YNXA 4A3CH 3GTMH 2UU9Q 4BBRG 3W5OA 1GM5A 1N8RC 3OYYA 1VQDA 2K50A 3PSIA 4X66L 4A3IG 1EYGA 2AWOA 4JC0A 4PG3A 3TREA 4DR1L 4DR7L 1GKHA 4GKJL 4NB3A 1HNWL 3K8AA 2IHEA 4QJFA 5GAHC 4DV1Q 2JA5G 4NXNL 3S1RH 1D8LA 4LW1A 1R9TH 5LMNL 2YYZA 2CWAA 2R7FA 4BY7G 4A3EG 4HIKA 1Y1WH 3S2DH 3T1YL 3A0JA 4JI0Q 1VQ8A 1Y1VH 4J15A 2NZOA 4WJ3M 3A5UA 2DUDA 4DV0Q 3I7FA 3K7UC 1S72A 5AJ3Q 4UY8C 4LUOA 4JI6L 4A4IA 2K52A 2Q2UA 1JE5A 3HOYH 4A3JH 3KF6A 1J5EQ 1MJEA 2A19A 4QIWE 1YHBA 4QL5A 4JI1Q 4BA1I 4LFCQ 4OX9L 1CKNA 3RN5A 2RF4A 4GNXC 4BBSG 4GN5A 4AH6A 1LTLA 1C7YA 1KXLA 1IBLL 4POFA 2V1CC 4HJ8A 4DR5Q 2E5LQ 1K3RA 3AEVA 4QQBX 4JI7L 3BZCA 1FL0A 2VUMG 4JI8Q 2HIXA 4IFDI 1PFSA 1XNQL 3M3YH 1V43A 2PMZE 1ASZA 3KJOA 5IP9G 5J3BA 4DR4Q 1JMCA 5IY0A 4C3JH 1XMQL 3PUZA 1KHIA 2KHIA 1A8VA 3CCMA 2AKWB 1XNRQ 3HOYG 3GD7A 2UUAQ 1YHAA 3ICEA 5HGQA 1FVIA 1Q1EA 3F1ZA 2WB1E 3WWVA 4B3TQ 1PVOA 2BH8A 1JJGA 4JI5L 3GDEA 5IYCH 1VS0A 4L5RC 3H0GH 2VQEQ 1YIJA 1PH6A 4X62L 1GD7A 1PYBA 2RCNA 5LMNW 2CCZA 1E7ZA 1CSPA 4DV6Q 2GN5A 1FGUA 4P72A 1BKBA 1UWVA 2F52A 4C3IH 3J81j 2YU9H 4P73A 1SRUA 1QVFA 1B70B 2ALYB 1PHJA 3KDFA 1VQNA 3NBHB 1XTDA 5HY6A 1VQPA 1I5FA 1PH3A 4TQUS 4P74A 1YHQA 3HOVH 4HJ7A 3FKIH 1FJGQ 4AYBE 4HIMA 2ES2A 2JA8G 1L1OA 1I94Q 3TS2A 3ULPA 1A63A 1CKOA 1KAWA 4DUYQ 3PUYA 4A3FH 4DR3L 4IPHA 1EIYB 1EQRA 4R4TA 3I4NG 2YTVA 3I4MG 2ZTEA 2QA4A 2HT1A 3HKZE 5ELNA 2B63H 1W2BA 3OTOQ 4Y52H 4QY7A 4BY1G 2R6GA 2H5XA 3W1BA 1HNXQ 1Q81C 4MTNA 3CPFA 1VQBA 2UUCQ 4A3GH 5K36G 5IWAL 3HOUG 1YVCA 1X3GA 4OWTB 3ULLA 2VQFL 4LF9L 2VZAA 3I55A 3UE0A 3U58A 1G6PA 3HOZG 5FLMH 3T1HQ 4K0KL 1HR0L 3GO5A 4LNQA 2C35B 1X3EA 1UE6A 1QZGA 2K14A 1BVSA 4JYAQ 1S40A 2JA7H 4JV5L 3A74A 2K75A 2LXJA 4FDBA 1HNZL 1VQ7A 4R4QA 1KC8C 3PO3G 2ZJQA 4JOIC 3D31A 3RZDH 5C3EG 1NMFA 3E9HA 1VQGA 3CF5A 1B7YB 4DV7L 1JT8A 3A5ZB 4LF5L 4RMFA 4DAYB 3AFPA 3L0OA 5GADC 3S1MH 4LFBQ 2NN6G 1TXYA 3ERSX 4JBWA 3STBC 4BBRH 3S17H 3H15A 5M3MG 4A3IH 3H3VH 2QEXA 2UXDL 5JEAG 1EUJA 1X3FA 5FLMG 4IOAA 4YCWA 3S14H 1CSQA 2ASBA 1YJNA 2JA5H 1MIUA 3KF6B 1W3SA 2UUBQ 4DR6Q 1VQOA 1BBWA 1WI5A 1L1OC 1PH2A 2JEBI 1IBMQ 5IP7G 4APVA 2PI2A 1E1OA 4BY7H 4A3EH 2Q2TA 5JEAJ 4JI3Q 4HIDA 4LF7Q 1E3PA 1D7QA 5GAGC 1PH4A 4KI0A 4UP7A 3RLNA 3GTLH 4Y7NH 2ZTCA 3J81c 1XMOQ 4X64Q 1CKMA 2VS1A 4DV4L 4NXML 4JI0L 5LMUQ 1PV4A 4MNOA 2NVTH 4GKKQ 1EFWA 3K81C 4R1JA 1SROA 1HR0W 4BBSH 1PH7A 4XTCS 3KFUA 1PYSB 5IE8A 1QVCA 3CCSA 3PV0A 2NZHA 4LF6L 4ME3A 4A3MH 1OXTA 3J7ZC 2I0QA 2VUMH 2JQOA 2N49A 2Z0SA 2WP8J 1KD1C 3CD6A 3TRZA 4OO1I 2I5MX 1X55A 3U50C 3L7ZC 5IP9H 4B3RQ 3VDYA 1Q86C 2RHQB 3PUVA 4A3DG 4X65Q 1RL2A 3U4VA 4DV3L 1I50H 4LUZA 1KL9A 1IBKL 2CWPA 1HZAA 5M3FG 3KDFB 4POGA 4X6AH 3PF4A 3RZOH 4B3SQ 1WFQA 2NVYH 5EAYA 3B6YA 2PNHA 2FXQA 1L1OB 4A3MG 4DV5L 3AQQA 2LXKA 4IJLA 4JI2Q 3UDFA 4C2MH 2EXDA 2UXCQ 3M85A 1Z47A 3I4OA 4O0AA 4X66Q 4DR7Q 2UXDQ 3PO2H 1JB7A 1B8AA 1X54A 2PQAB 1HNWQ 3HOUH 4OXPA 4HIOA 3CCQA 4NXNQ 4IFDG 4GLXA 1LYLA 2N3SA 3HKSA 1LUZA 1SFOH 5C0XI 1E1TA 2JA8H 1N36Q 3F2BA 4DR2Q 4YWMA 1OXSC 1M1KC 1UE7A 1N34L 4JOIA 4JI4Q 3BZKA 2K4KA 3JAMc 1Q8KA 5BR8L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD J;  1I3Q H;  1GO3 E;  4DAM A;  1I94 L;  2OTL A;  1N9W A;  3BU2 A;  4QGU A;  1PH1 A;  3I4N H;  1E22 A;  4OX9 Q;  1K83 H;  1NE3 A;  4GN3 B;  3PUX A;  3I4M H;  1TWH H;  3EN2 A;  3M9B A;  4GN4 B;  3PO2 G;  1QZH A;  5C44 G;  4B3M L;  1PH8 A;  4BY1 H;  3GTJ H;  4WJ4 A;  1Z9F A;  3KLW A;  1L0W A;  2JA6 H;  1KRS A;  1IBL Q;  1OXV A;  1X56 A;  1IYJ B;  3ER0 A;  3K0X A;  1Q1B A;  2D62 A;  5C0X J;  2GVA A;  3ZJY C;  1VQF A;  2E8G A;  1K0R A;  2KBN A;  2ZM6 Q;  2NVX H;  4KHP L;  4JBJ A;  3UE1 A;  4JBM A;  3CCL A;  3HOZ H;  1OXU A;  1MJC A;  2CKZ B;  3M4P A;  1SE8 A;  4JBK A;  4A75 A;  2NVQ H;  1WCM G;  2K5H A;  1X6O A;  2MQH A;  1UE5 A;  2PQA A;  3CC7 A;  4AQY Q;  1XMQ Q;  2R93 G;  2AMC B;  2YV5 A;  4A76 A;  3BJU A;  3U4Z A;  3T1H L;  5E7N A;  2HHH Q;  1G29 1;  3E9I A;  1VQ6 A;  3PO3 H;  3MEF A;  3Q8D A;  2UXB L;  5C3E H;  1XPR A;  4JI5 Q;  1AE3 A;  2VW9 A;  3F8T A;  2B29 A;  1JJ2 A;  2JA6 G;  1TWA H;  1LM0 A;  3CW2 C;  2GVB A;  4X62 Q;  1DGS A;  2AHO B;  5GAE C;  2Q2H A;  4GOP C;  4RG1 A;  3HOX G;  3DM3 A;  1VQ5 A;  3S15 H;  5IYD H;  4MZ9 A;  5M3M H;  2ATW A;  4DV2 Q;  2D0O A;  2F4V L;  4DUZ L;  1YZ6 A;  4LFB L;  3GTQ H;  5JJL A;  2I5H A;  1PA6 A;  2Y0S G;  1P16 A;  2E2J H;  1VQJ A;  4OWW B;  3ULJ A;  5C4X H;  5IP7 H;  1WOC A;  1Y14 B;  1VQI A;  1BBU A;  3UDI A;  2I5L X;  3CME A;  5H1S E;  2E2I H;  3J81 i;  1EOV A;  3CCE A;  3J80 i;  5IYB G;  4IPD A;  2IX0 A;  3F2C A;  3HOW H;  1YJ9 A;  4DR3 Q;  1YI2 A;  4LFA L;  5IYD G;  3RNU A;  1CUK A;  4LF7 L;  4A3B G;  1I6H H;  5JJI A;  2JE6 I;  2KEN A;  2B3G A;  3CCU A;  2VNU D;  2OTJ A;  2UU9 L;  1XMO L;  3UDG A;  5M5X H;  1HH2 P;  3CC4 A;  1HZC A;  4LF8 L;  1UE1 A;  5IT9 c;  2R7D A;  1E24 A;  2DGY A;  5IWA Q;  5C4X G;  2VQF Q;  3EIV A;  4LF9 Q;  4DV1 L;  2JA9 A;  3DLL A;  3CC2 A;  3S16 H;  2HIV A;  4GLA C;  1N33 Q;  4DKA C;  4A3L G;  1SR3 A;  4K0K Q;  1HR0 Q;  2HQL A;  4P71 A;  1V9P A;  4PZ7 A;  4GOP B;  1AE2 A;  3HOW G;  4JV5 Q;  3J80 c;  2IX1 A;  3E0E A;  3GTP H;  4LF4 Q;  4LUV A;  3GTO H;  1WYD A;  3M4Q A;  3TS0 A;  2YTX A;  4DV0 L;  4BA2 I;  5AJ3 L;  4YY3 Q;  3W1G A;  3I56 A;  4DV7 Q;  1RIP A;  3KYH C;  4HJA A;  4LF5 Q;  1J5E L;  4LFC L;  4A93 G;  4JI1 L;  4H02 A;  1KIX A;  1VQE A;  2Q2I A;  3UDX A;  2VY3 A;  1HJP A;  4A3K G;  4LF8 Q;  2WAQ G;  1UEB A;  2PI2 E;  4OON A;  5ELO A;  4DR5 L;  2E5L L;  2IT1 A;  4YHH Q;  4HJ5 A;  3RN2 A;  2BA0 A;  1NJI C;  2E2H H;  4JI2 L;  1XJV A;  1QVG A;  4JG2 A;  4JI8 L;  1ASY A;  4O2D A;  2UXC L;  1HZ9 A;  3STB D;  2ZJR A;  2F3I A;  1TWG H;  2OQ0 A;  4DR4 L;  4OO1 G;  3JAM i;  4UP8 A;  1K8G A;  3RLO A;  1NY4 A;  1XNR L;  1N32 Q;  2UUA L;  3S24 A;  5M3F H;  1Q46 A;  1EQQ A;  5GQO A;  1K8A C;  4B3T L;  3J7A 5;  2KCM A;  3F2D A;  3CCR A;  1N36 L;  1VQA A;  4DR2 L;  1KQS A;  4DV4 Q;  4GOP A;  4NXM Q;  2VQE L;  1EWI A;  1Q82 C;  4JI4 L;  4OWX B;  2OWO A;  4R4I A;  3JC6 6;  4DR1 Q;  2R92 G;  4GKJ Q;  1SMX A;  5JJK A;  5FJ8 G;  2LSS A;  1O7I A;  3NEM A;  5GRO A;  5C44 H;  4A3C G;  1IXR A;  4DV6 L;  2MO1 A;  4EX5 A;  1NTG A;  3CMA A;  5LMN Q;  4LF6 Q;  3KOJ A;  3CPW A;  3NEL A;  4HJ9 A;  1KRT A;  3K80 C;  4IJH A;  4KLK A;  4PMW A;  3T1Y Q;  4DK3 C;  4LWC A;  1K73 C;  1VQL A;  3PCO B;  1NBW A;  1X9N A;  1Q12 A;  4GS3 A;  1VQK A;  1WCM H;  3M4O H;  2A8V A;  2R93 H;  1FJG L;  4DNI A;  5C0X G;  2ZM6 L;  4ALP A;  4JI6 Q;  5FLX c;  3L2P A;  1Y1W G;  1Y1V G;  4DV3 Q;  1QUQ B;  1IBK Q;  2BA1 A;  3TEH B;  4DUY L;  4AQY L;  1A62 A;  4DPG A;  1C0A A;  1OXX K;  2RHS B;  3KF8 B;  3G71 A;  4IOC A;  1Q7Y C;  1M90 C;  3AYH B;  1SN8 A;  3PUW A;  4A3J G;  2HHH L;  2CFM A;  3KJP A;  4JI7 Q;  3HOX H;  1L2F A;  4R4O A;  4DV5 Q;  3OTO L;  2K5N A;  4DK6 C;  1SLJ A;  2L15 A;  1YEZ A;  2WFW A;  2WB1 G;  2KHJ A;  3FHW A;  4C3H H;  2Z6K A;  1HNX L;  1XNQ Q;  1AH9 A;  4IPC A;  2UUC L;  3RLF A;  4YCU A;  2VL6 A;  3PIO A;  1NMG A;  3M7N A;  4IO9 A;  1K9M C;  2QGQ A;  1U0L A;  4DV2 L;  1XPO A;  2CQO A;  3CQZ H;  2AWN A;  2D0P A;  3CP0 A;  3PGZ A;  4JYA L;  3EBE A;  1N34 Q;  2OQK A;  5IYB H;  2R7Z H;  5BR8 Q;  1HZB A;  1YJW A;  1VQ9 A;  2JEA I;  5M5W H;  5IYC G;  4L5Q A;  4A3B H;  4PZ8 A;  4EQ5 A;  1MKH A;  3CCJ A;  4GNX B;  3H0G G;  4AYB G;  4IPG A;  4L5T A;  2Y0S E;  5DLQ E;  1QUQ A;  4B3M Q;  3S1N H;  4BXX H;  3SGI A;  2BH2 A;  2ZTD A;  5C4J H;  1U5K A;  1VCI A;  3TQY A;  1IL2 A;  1V1Q A;  2XTI A;  2ID0 A;  4KHP Q;  2EIF A;  3G6E A;  4PZ6 A;  4R4C A;  1WJJ A;  2IHF A;  2UUB L;  4DR6 L;  3G4S A;  3HKZ G;  2N8N A;  4A3L H;  3D0F A;  3PIP A;  2R7Z G;  1IBM L;  2K5V A;  4YWK A;  2A1A A;  1VQH A;  3HOV G;  3FKI G;  1C9O A;  4JI3 L;  2IY5 B;  4P75 A;  3G48 A;  4XIG S;  1N33 L;  1T9H A;  3IRB A;  2MO0 A;  3HFZ B;  4NPS A;  4UPA A;  2MNA A;  1PH9 A;  1X65 A;  2UXB Q;  3S2H H;  1P8L A;  1GVP A;  4YWL A;  4A3F G;  4X64 L;  4BXX G;  3CCV A;  5LMU L;  4LF4 L;  4A93 H;  4GKK L;  4JCV E;  2MFI A;  2XGT A;  3FP9 A;  4YCV A;  2NN6 I;  2OCE A;  2Z6K C;  3RR5 A;  5M5Y H;  2ZJP A;  2B63 G;  2YTY A;  1JJC B;  4YY3 L;  4A3K H;  1VQM A;  4L5S A;  3PF5 A;  1VQ4 A;  2JJQ A;  1YBY A;  1TWF H;  2F4V Q;  4GNX A;  4A3G G;  4DUZ Q;  1A0I A;  1H95 A;  1YIT A;  1PH5 A;  1IZ6 A;  3AFQ A;  3I2Z A;  3MXN B;  1XPU A;  3K7A H;  1HNZ Q;  1EIF A;  4GLV B;  4B3R L;  4AIM A;  4YHH L;  3GTG H;  3NEN A;  1S3O A;  2JA7 G;  1VQC A;  3CXC A;  3S1Q H;  4X65 L;  3GTK H;  1G51 A;  1CKN B;  3CAM A;  1TWC H;  3LGJ A;  1J6Q A;  4TVA B;  2WAQ E;  4UP9 A;  2N78 A;  4KHZ A;  4LFA Q;  3H3V I;  4B3S L;  1OTC A;  4A3D H;  3OW2 A;  1N32 L;  2R92 H;  2JK8 A;  2KCT A;  5FJ8 H;  2EQS A;  1YNX A;  4A3C H;  3GTM H;  2UU9 Q;  4BBR G;  3W5O A;  1GM5 A;  1N8R C;  3OYY A;  1VQD A;  2K50 A;  3PSI A;  4X66 L;  4A3I G;  1EYG A;  2AWO A;  4JC0 A;  4PG3 A;  3TRE A;  4DR1 L;  4DR7 L;  1GKH A;  4GKJ L;  4NB3 A;  1HNW L;  3K8A A;  2IHE A;  4QJF A;  5GAH C;  4DV1 Q;  2JA5 G;  4NXN L;  3S1R H;  1D8L A;  4LW1 A;  1R9T H;  5LMN L;  2YYZ A;  2CWA A;  2R7F A;  4BY7 G;  4A3E G;  4HIK A;  1Y1W H;  3S2D H;  3T1Y L;  3A0J A;  4JI0 Q;  1VQ8 A;  1Y1V H;  4J15 A;  2NZO A;  4WJ3 M;  3A5U A;  2DUD A;  4DV0 Q;  3I7F A;  3K7U C;  1S72 A;  5AJ3 Q;  4UY8 C;  4LUO A;  4JI6 L;  4A4I A;  2K52 A;  2Q2U A;  1JE5 A;  3HOY H;  4A3J H;  3KF6 A;  1J5E Q;  1MJE A;  2A19 A;  4QIW E;  1YHB A;  4QL5 A;  4JI1 Q;  4BA1 I;  4LFC Q;  4OX9 L;  1CKN A;  3RN5 A;  2RF4 A;  4GNX C;  4BBS G;  4GN5 A;  4AH6 A;  1LTL A;  1C7Y A;  1KXL A;  1IBL L;  4POF A;  2V1C C;  4HJ8 A;  4DR5 Q;  2E5L Q;  1K3R A;  3AEV A;  4QQB X;  4JI7 L;  3BZC A;  1FL0 A;  2VUM G;  4JI8 Q;  2HIX A;  4IFD I;  1PFS A;  1XNQ L;  3M3Y H;  1V43 A;  2PMZ E;  1ASZ A;  3KJO A;  5IP9 G;  5J3B A;  4DR4 Q;  1JMC A;  5IY0 A;  4C3J H;  1XMQ L;  3PUZ A;  1KHI A;  2KHI A;  1A8V A;  3CCM A;  2AKW B;  1XNR Q;  3HOY G;  3GD7 A;  2UUA Q;  1YHA A;  3ICE A;  5HGQ A;  1FVI A;  1Q1E A;  3F1Z A;  2WB1 E;  3WWV A;  4B3T Q;  1PVO A;  2BH8 A;  1JJG A;  4JI5 L;  3GDE A;  5IYC H;  1VS0 A;  4L5R C;  3H0G H;  2VQE Q;  1YIJ A;  1PH6 A;  4X62 L;  1GD7 A;  1PYB A;  2RCN A;  5LMN W;  2CCZ A;  1E7Z A;  1CSP A;  4DV6 Q;  2GN5 A;  1FGU A;  4P72 A;  1BKB A;  1UWV A;  2F52 A;  4C3I H;  3J81 j;  2YU9 H;  4P73 A;  1SRU A;  1QVF A;  1B70 B;  2ALY B;  1PHJ A;  3KDF A;  1VQN A;  3NBH B;  1XTD A;  5HY6 A;  1VQP A;  1I5F A;  1PH3 A;  4TQU S;  4P74 A;  1YHQ A;  3HOV H;  4HJ7 A;  3FKI H;  1FJG Q;  4AYB E;  4HIM A;  2ES2 A;  2JA8 G;  1L1O A;  1I94 Q;  3TS2 A;  3ULP A;  1A63 A;  1CKO A;  1KAW A;  4DUY Q;  3PUY A;  4A3F H;  4DR3 L;  4IPH A;  1EIY B;  1EQR A;  4R4T A;  3I4N G;  2YTV A;  3I4M G;  2ZTE A;  2QA4 A;  2HT1 A;  3HKZ E;  5ELN A;  2B63 H;  1W2B A;  3OTO Q;  4Y52 H;  4QY7 A;  4BY1 G;  2R6G A;  2H5X A;  3W1B A;  1HNX Q;  1Q81 C;  4MTN A;  3CPF A;  1VQB A;  2UUC Q;  4A3G H;  5K36 G;  5IWA L;  3HOU G;  1YVC A;  1X3G A;  4OWT B;  3ULL A;  2VQF L;  4LF9 L;  2VZA A;  3I55 A;  3UE0 A;  3U58 A;  1G6P A;  3HOZ G;  5FLM H;  3T1H Q;  4K0K L;  1HR0 L;  3GO5 A;  4LNQ A;  2C35 B;  1X3E A;  1UE6 A;  1QZG A;  2K14 A;  1BVS A;  4JYA Q;  1S40 A;  2JA7 H;  4JV5 L;  3A74 A;  2K75 A;  2LXJ A;  4FDB A;  1HNZ L;  1VQ7 A;  4R4Q A;  1KC8 C;  3PO3 G;  2ZJQ A;  4JOI C;  3D31 A;  3RZD H;  5C3E G;  1NMF A;  3E9H A;  1VQG A;  3CF5 A;  1B7Y B;  4DV7 L;  1JT8 A;  3A5Z B;  4LF5 L;  4RMF A;  4DAY B;  3AFP A;  3L0O A;  5GAD C;  3S1M H;  4LFB Q;  2NN6 G;  1TXY A;  3ERS X;  4JBW A;  3STB C;  4BBR H;  3S17 H;  3H15 A;  5M3M G;  4A3I H;  3H3V H;  2QEX A;  2UXD L;  5JEA G;  1EUJ A;  1X3F A;  5FLM G;  4IOA A;  4YCW A;  3S14 H;  1CSQ A;  2ASB A;  1YJN A;  2JA5 H;  1MIU A;  3KF6 B;  1W3S A;  2UUB Q;  4DR6 Q;  1VQO A;  1BBW A;  1WI5 A;  1L1O C;  1PH2 A;  2JEB I;  1IBM Q;  5IP7 G;  4APV A;  2PI2 A;  1E1O A;  4BY7 H;  4A3E H;  2Q2T A;  5JEA J;  4JI3 Q;  4HID A;  4LF7 Q;  1E3P A;  1D7Q A;  5GAG C;  1PH4 A;  4KI0 A;  4UP7 A;  3RLN A;  3GTL H;  4Y7N H;  2ZTC A;  3J81 c;  1XMO Q;  4X64 Q;  1CKM A;  2VS1 A;  4DV4 L;  4NXM L;  4JI0 L;  5LMU Q;  1PV4 A;  4MNO A;  2NVT H;  4GKK Q;  1EFW A;  3K81 C;  4R1J A;  1SRO A;  1HR0 W;  4BBS H;  1PH7 A;  4XTC S;  3KFU A;  1PYS B;  5IE8 A;  1QVC A;  3CCS A;  3PV0 A;  2NZH A;  4LF6 L;  4ME3 A;  4A3M H;  1OXT A;  3J7Z C;  2I0Q A;  2VUM H;  2JQO A;  2N49 A;  2Z0S A;  2WP8 J;  1KD1 C;  3CD6 A;  3TRZ A;  4OO1 I;  2I5M X;  1X55 A;  3U50 C;  3L7Z C;  5IP9 H;  4B3R Q;  3VDY A;  1Q86 C;  2RHQ B;  3PUV A;  4A3D G;  4X65 Q;  1RL2 A;  3U4V A;  4DV3 L;  1I50 H;  4LUZ A;  1KL9 A;  1IBK L;  2CWP A;  1HZA A;  5M3F G;  3KDF B;  4POG A;  4X6A H;  3PF4 A;  3RZO H;  4B3S Q;  1WFQ A;  2NVY H;  5EAY A;  3B6Y A;  2PNH A;  2FXQ A;  1L1O B;  4A3M G;  4DV5 L;  3AQQ A;  2LXK A;  4IJL A;  4JI2 Q;  3UDF A;  4C2M H;  2EXD A;  2UXC Q;  3M85 A;  1Z47 A;  3I4O A;  4O0A A;  4X66 Q;  4DR7 Q;  2UXD Q;  3PO2 H;  1JB7 A;  1B8A A;  1X54 A;  2PQA B;  1HNW Q;  3HOU H;  4OXP A;  4HIO A;  3CCQ A;  4NXN Q;  4IFD G;  4GLX A;  1LYL A;  2N3S A;  3HKS A;  1LUZ A;  1SFO H;  5C0X I;  1E1T A;  2JA8 H;  1N36 Q;  3F2B A;  4DR2 Q;  4YWM A;  1OXS C;  1M1K C;  1UE7 A;  1N34 L;  4JOI A;  4JI4 Q;  3BZK A;  2K4K A;  3JAM c;  1Q8K A;  5BR8 L; 
#chains in the Genus database with same CATH topology
 4X3K A;  4RCN A;  2E2J B;  4KKT A;  5CYU A;  1I94 L;  4DAM A;  1WTR A;  2RKS A;  4A3D G;  1PH1 A;  3I4N H;  1SDF A;  4OX9 Q;  3I4M H;  1NE3 A;  3PO2 G;  3EN2 A;  3I72 A;  3GTJ H;  1Z9F A;  1L0W A;  2D2C C;  2MP1 A;  1U4L A;  4EGV A;  1E0B A;  1Q1B A;  1VQF A;  1K0R A;  1DOK A;  4JBJ A;  3UE1 A;  5ISR A;  1OXU A;  1MJC A;  1SE8 A;  1WCM G;  2F0U A;  4DNT B;  4DFA A;  2R93 G;  4PQX A;  1CQV A;  4ZLT F;  2PYK A;  2WAQ B;  5C3E H;  4KKU A;  4JI5 Q;  2H4O A;  1XX8 A;  1TWA H;  1LM0 A;  4X62 Q;  2AHO B;  4IZ8 A;  4K2L A;  2NN6 H;  4KD3 A;  3GTP B;  3DM3 A;  1C48 A;  4DK0 A;  5IYD H;  4M1U B;  4MZ9 A;  4DV2 Q;  1BXT A;  2IPK D;  4LFB L;  2I5H A;  3HEJ A;  4PV1 C;  3I4L A;  2E2J H;  4OWW B;  3ULJ A;  2IWH A;  1BBU A;  3UDI A;  1GJX A;  1EOV A;  3KBX A;  4LJZ C;  3J80 i;  5EKI A;  2IX0 A;  1JWS D;  5IYD G;  3RNU A;  4LF7 L;  2PO4 A;  3VYS A;  2JE6 I;  5AFW A;  2B3G A;  3EQL C;  1XMO L;  1BF4 A;  1GUO A;  1BCP B;  3AU7 A;  5C4Z A;  5FLX L;  5IT9 c;  2R7D A;  2VQF Q;  2HIV A;  3I8Z A;  1HR0 Q;  2HQL A;  2DY8 A;  2PMZ B;  4MHE A;  3QB3 A;  3CU7 A;  2IX1 A;  3GTP H;  1I4G A;  3C3L A;  4BA2 I;  5DM7 3;  5AJ3 L;  4YY3 Q;  1RIP A;  4LF5 Q;  1J5E L;  3VR5 A;  5KGU A;  1Q3L A;  2VY3 A;  4ZCK A;  1CI3 M;  2WAQ G;  1UEB A;  5E4X A;  5ELB A;  4F88 A;  1BNZ A;  4DR5 L;  4HJ5 A;  1DD2 A;  2BA0 A;  2K04 A;  4JI8 L;  1BBX C;  4O2D A;  2IJ0 A;  4V0B A;  3STB D;  4CDD C;  1QOH A;  4IFD H;  2F3I A;  1TWG H;  2F0G A;  2OQ0 A;  4OO1 G;  1HQM C;  4C3H B;  3H0G B;  3MFY A;  1C4Q A;  1XNR L;  3H94 A;  3S24 A;  4V19 0;  3J7A 5;  3F2D A;  5HGT A;  2IW3 A;  1TS2 A;  3CQZ B;  2CQA A;  4YIJ A;  1XPU A;  2OT2 A;  2SNS A;  2OWO A;  2A6E D;  3MXN A;  4A3C G;  2EE1 A;  5GRO A;  5IGF A;  5C44 H;  3HKZ B;  1D5X C;  4G4K A;  2R7Z B;  4DV6 L;  1NTG A;  3K59 A;  3FKI B;  4KY7 A;  3P20 A;  3K5M A;  4KLK A;  3T1Y Q;  3Q24 A;  1K73 C;  3A7A B;  1F77 A;  3T53 B;  2MPM A;  2VB3 X;  2WIN B;  2O5J C;  4QB4 A;  4N9T A;  4HAE A;  4LMQ D;  3RUZ A;  4LAA A;  2K33 A;  1C0A A;  1TS4 A;  1OXX K;  2RHS B;  3G71 A;  4IOC A;  1Q7Y C;  1M90 C;  3AYH B;  3PUW A;  2HHH L;  3HOX H;  1ET9 A;  3BVZ A;  4U68 A;  4CKC A;  1JIC A;  1TT2 A;  4DK6 C;  2ZXO A;  2F0L A;  2WFW A;  3FHW A;  1QB5 D;  4C3H H;  4IPC A;  3O13 A;  3FEW X;  3CHB D;  4IO9 A;  1ENF A;  4K6D A;  1U0L A;  4HED A;  5EKL A;  3CQZ H;  3CP0 A;  4JYA L;  1NR4 A;  4C3J G;  2QDB A;  4HCE A;  4DNR B;  2R7Z H;  5I4D A;  1EY6 A;  2RQX A;  4HMI A;  5IYC G;  4EQ5 A;  1MKH A;  3H0G G;  2JYO A;  4FP5 D;  1QE6 A;  1IYU A;  2EIF A;  4MIU A;  2FJ2 A;  2UUB L;  1EZ8 A;  2F3V A;  3HKZ G;  3G4S A;  4A3L H;  2R7Z G;  2K5V A;  3NP8 A;  4Y7N B;  1AFP A;  4CBV A;  2KCN A;  3FKI G;  4HTH A;  2MHV A;  4XIG S;  3X3N A;  1T9H A;  1DOM A;  3JAM E;  1EYC A;  4BBS B;  5DNF A;  1PH9 A;  4EQN A;  4YWL A;  4A3F G;  4H7B A;  2VUM B;  2XGT A;  3FP9 A;  2OCE A;  2AUK A;  1B4O A;  1H9R A;  1RTO A;  2WII B;  3T56 B;  1VQ4 A;  1YBY A;  1I4H A;  1A0I A;  1LTA D;  3NTI A;  1B1Z A;  1H95 A;  4B9W A;  1YIT A;  1IZ6 A;  2PZT A;  1M8A A;  3AFQ A;  3K7A H;  1PRT F;  3OSO A;  1EIF A;  4B3R L;  1STE A;  1SNP A;  1BR9 A;  4J6H A;  5EBD A;  2Z8L A;  1CKN B;  2E74 C;  1TWC H;  3CAM A;  1J6Q A;  3NSW A;  4TVA B;  4KHZ A;  1GHJ A;  3M3Y B;  3MXU A;  2KCT A;  5FJ8 H;  3DUZ A;  4X3S A;  4XT1 B;  2KEE A;  2XNA C;  4RAU C;  2CVR A;  2K50 A;  2G5D A;  2AWO A;  4JC0 A;  4PG3 A;  2UXD L;  4NB3 A;  3K8A A;  5GAH C;  2VXW A;  3VA5 A;  4AYB B;  1SYF A;  3NHH A;  4NXN L;  2WV6 D;  3BDC A;  5LMN L;  3DEP A;  3DMU A;  1A15 A;  4DAY A;  1GUT A;  5D65 A;  3MEH A;  3A0J A;  1VQ8 A;  1Y1V H;  2NZO A;  1UEA B;  4BY1 B;  1S5F D;  2DUD A;  1S72 A;  1QNK A;  5AJ3 Q;  4OIJ A;  4JI6 L;  1HXY D;  2HD3 A;  4KTA A;  2NTT A;  2K52 A;  5D3I B;  4A4I A;  1JE5 A;  2Q2U A;  2DNC A;  1J5E Q;  1MJE A;  4XQJ A;  1CKN A;  3N6R A;  2RF4 A;  4BBS G;  4GN5 A;  4AH6 A;  4CDC C;  1WD0 A;  1HFN A;  2V1C C;  4DR5 Q;  4QQB X;  4JI7 L;  1FL0 A;  2VUM G;  4JI8 Q;  1WVL A;  4TSS A;  1PFS A;  3J7A F;  1XNQ L;  3M3Y H;  1V43 A;  1STG A;  5EGT A;  5J3B A;  1EY5 A;  3AB9 A;  4KMU C;  2AKW B;  3F2U A;  1XNR Q;  2O4X A;  1HCZ A;  1FVI A;  4H13 C;  3S15 B;  1JJG A;  3IFD A;  1PVO A;  2L5T A;  3MFG A;  1RCV D;  4HSV A;  4BWG B;  3BDO A;  3MAQ A;  2L4N A;  4FF1 A;  4DV6 Q;  2EXZ A;  2GN5 A;  4K5W A;  1BKB A;  3RZD B;  1LLR D;  3BYY B;  1B70 B;  1TII D;  1TQO A;  2K5W A;  3NBH B;  1VQP A;  1I5F A;  4HR7 B;  5CR3 A;  1YHQ A;  3HOV H;  4A3I B;  4AYB E;  3Q0A A;  3TS2 A;  2F0H A;  1CM9 A;  3RMH A;  2CH4 W;  2EVB A;  1HTL D;  3A7L A;  1KAW A;  5M5X B;  4ABN A;  5IOD A;  3NQI A;  4R4T A;  2B2T A;  2FMC A;  5JPN C;  2YTV A;  3OMG A;  2A69 C;  1MSH A;  5ELN A;  2ZXP A;  1ET6 A;  4BY1 G;  5I6W A;  2CW0 D;  3E0J A;  3GTL B;  3CPF A;  1VQB A;  1VF7 A;  5K36 G;  5IWA L;  3HOU G;  4FYD A;  5CV6 A;  1G6P A;  3N52 A;  3I90 A;  2F0K A;  5BN5 A;  5FLM H;  1V1O A;  4MTK A;  2BE5 C;  2F0P A;  4JYA Q;  1BVS A;  3ONA B;  5EPL A;  3MHB A;  3RD4 A;  2JA7 H;  4JV5 L;  1BCP D;  4FDB A;  2LXJ A;  1Y8P B;  1ZEQ X;  2B2V C;  1II3 A;  3RZD H;  2Q8I B;  1EFI D;  4DV7 L;  4FXG C;  1DOL A;  4E6I A;  4I7Z C;  3AFP A;  4XQQ A;  1KLU D;  4FXK C;  4RGT A;  4A3I H;  2KVM A;  2F0N A;  5FLM G;  1EUJ A;  1X3F A;  1MD2 D;  4ZUI A;  3SXH A;  4YCW A;  3K57 A;  5FO9 B;  1YJN A;  3JAM L;  3KF6 B;  1W3S A;  2UUB Q;  1GUW A;  3NK9 A;  1QNU A;  2JEB I;  2PI2 A;  5CV8 A;  4L8J A;  4NDX A;  1F9P A;  1YNN C;  5JVG 3;  4F8M A;  2F0F A;  1LAC A;  2B2T C;  3P7J A;  2XWJ B;  4UP7 A;  4LK1 C;  3GTL H;  1HHV A;  2ZTC A;  4L63 B;  2VS1 A;  4DV4 L;  2V4D A;  2NVT H;  4MNO A;  1EFW A;  1LTR D;  2EZV A;  1SRO A;  3HGB A;  1I6H B;  1QVC A;  1S5D D;  3PV0 A;  2M00 A;  2QW7 A;  1WTX A;  3KLS A;  1SMY D;  1PTO C;  4ZRZ A;  5EPJ A;  1S5B D;  2JQO A;  2N49 A;  2PCF B;  4FNF A;  1KD1 C;  1K8O A;  5C5L A;  1X32 A;  5IP9 H;  1X55 A;  4B3R Q;  2KCC A;  3E6Z X;  2JA6 B;  1S5C D;  3ND9 A;  4DV3 L;  3WOE A;  4LUZ A;  1IBK L;  2F0M A;  2EYH A;  2R61 A;  3HOZ B;  1A2T A;  3RZO H;  2JN4 A;  2Y0S B;  1L1O B;  1PZI D;  3UDF A;  2KEC A;  3M85 A;  5FO8 B;  2K1B A;  2RSN A;  1Z47 A;  3C1F A;  3I4O A;  2UXD Q;  1JB7 A;  3SVM A;  1DZ1 A;  4NXN Q;  1A2U A;  1LYL A;  5IGG A;  1STH A;  5IGC A;  5C0X I;  4A3B B;  4O42 A;  4JI4 Q;  1FNU A;  3GTQ B;  3BZK A;  3ULL A;  1I6H H;  2D5D A;  4IFD J;  4RKL A;  5C4X B;  3DXJ C;  4QGU A;  3Q6S A;  1E22 A;  1K83 H;  3K0Y A;  1QZH A;  1PH8 A;  2MUY A;  1TR5 A;  2JA6 H;  1KRS A;  2HCI A;  1EY8 A;  1OXV A;  1X56 A;  1IYJ B;  3HOW B;  5CV4 A;  2GVA A;  3ZJY C;  2KBN A;  2OXP A;  2ZM6 Q;  3HOZ H;  4JBK A;  1SJE D;  4K8I A;  4A75 A;  3CC7 A;  2AMC B;  1WTP A;  3NQT A;  3R8B A;  2YV5 A;  4A76 A;  3GP7 A;  3BJU A;  3T1H L;  1G29 1;  5JVH 3;  1CFM A;  1AE3 A;  3TZD A;  2B29 A;  2HUG A;  2JA6 G;  2EYF A;  2GVB A;  3DWQ A;  4GOP C;  3Q22 A;  1B3Q A;  3GTO B;  4KK7 A;  5M3M H;  2ATW A;  3GTG B;  2SEB D;  4DUZ L;  1HUM A;  1YZ6 A;  3GTQ H;  5JJL A;  5T1G A;  3S1Q B;  2Y0S G;  1SNC A;  4KJN A;  2QEJ C;  4PMC A;  5C4X H;  5IP7 H;  1KDB A;  3P1H A;  1WTO A;  1D2B A;  2F0O A;  2K6A A;  5H1S E;  4FXD A;  2A6H C;  4RGM A;  1HUN A;  1YNJ C;  3HOW H;  4A3B G;  1H9S B;  2Z6B A;  3PMF A;  3CCU A;  1GUG A;  3MXP A;  4LF8 L;  3W2D A;  5JPM C;  5K5P A;  5C4X G;  4K8J A;  4KN7 C;  5IWA Q;  2EYM A;  1ONL A;  2A69 D;  1GOZ A;  4A3D B;  1FR3 A;  4GLA C;  3KK7 A;  1N33 Q;  4XQN A;  4PZ7 A;  1RDP D;  1SND A;  2F0I A;  3HOW G;  4JV5 Q;  1STB A;  3BVG A;  1S5E D;  4LF4 Q;  3GTO H;  1WYD A;  1F9Q A;  2JP1 A;  3R93 A;  4J1M A;  2NB0 A;  4DV0 L;  2A5H A;  2WB1 B;  2BE5 D;  3W1G A;  3I56 A;  4DV7 Q;  3KYH C;  4NKL A;  4LFC L;  4A93 G;  4H02 A;  1F9R A;  3UDX A;  1BO0 A;  3IL8 A;  1Y8O B;  5ELO A;  3RN2 A;  1NJI C;  1CT1 D;  4JI2 L;  1QVG A;  1ASY A;  2UXC L;  4IUT A;  3PIO 3;  2B2W A;  4DR4 L;  2DY7 A;  1M4V A;  2QCP X;  2M2L A;  5GQO A;  4B3T L;  1H9J A;  3HS0 C;  1N36 L;  1KQS A;  4DR2 L;  4DV4 Q;  4A3D H;  2VQE L;  1EWI A;  1YNN D;  1SAP A;  2R92 G;  4DR1 Q;  4GKJ Q;  5JJK A;  1SMX A;  2YU9 B;  2LSS A;  3NEM A;  1IXR A;  3OIQ A;  3J7Y W;  4H0L C;  5EPK A;  5FO7 B;  4LWC A;  1VQL A;  3PCO B;  5IIF A;  3S1N B;  3SEB A;  1AEX A;  1SYE A;  1JE4 A;  1WCM H;  2R93 H;  5ELF A;  5C0X G;  1PTO D;  1Y1W G;  1ESF A;  5EQ0 A;  1EZ6 A;  3QG1 A;  4DV3 Q;  1Q90 A;  1IBK Q;  2BA1 A;  3TEH B;  3J81 E;  4AQY L;  2ENB A;  1FNV A;  4ILW A;  4A3J G;  1H9M A;  4H44 C;  3OTO L;  2K05 A;  2L15 A;  2WB1 G;  1HNX L;  3D4W A;  1AH9 A;  4ZKC B;  3RLF A;  1NUC A;  2VL6 A;  3M7N A;  3QWN A;  2B2W C;  5ELC A;  3TP6 A;  2RSO A;  2XN9 C;  3KBG A;  2F0S A;  2A73 B;  4RH6 A;  1V8Q A;  2OQK A;  2OEO A;  4NMZ A;  1FYC A;  4PZ8 A;  1KNE A;  3S14 B;  1PDQ A;  2JA5 B;  2DNE A;  3S1N H;  1RJT A;  1QCB D;  1VCI A;  1SBB B;  2ID0 A;  4C3I G;  1LT4 D;  2I46 A;  2LS0 1;  4PZ6 A;  4R4C A;  1B44 D;  1U4R A;  1Q8I A;  2L9H A;  1CZW A;  4ZKB B;  1GHK A;  4RA8 A;  4C1N I;  2IY5 B;  2F0J A;  3G48 A;  3NPP A;  3IRB A;  3HFZ B;  4NPS A;  3ZYY X;  2MNA A;  1X65 A;  1GVP A;  2F0W A;  3S1R B;  4X64 L;  4ZQ3 A;  3CCV A;  2EJF C;  5LMU L;  4GKK L;  4C56 C;  1X3P A;  4JCV E;  5I6Y A;  4YCV A;  2ZJP A;  1W6J A;  1JJC B;  3BVM A;  4L5S A;  2FMM A;  4DUZ Q;  1UAP A;  4QCL A;  1PH5 A;  1EY7 A;  3MXN B;  1J8I A;  1ENA A;  4GLV B;  4IUU A;  4OO1 H;  4AIM A;  4YHH L;  5CBA E;  3NEN A;  1EYD A;  1CA5 A;  3LGJ A;  2JXM B;  2WAQ E;  1CQF A;  1UNS A;  4B3S L;  1OTC A;  3OW2 A;  1N32 L;  2NYZ D;  4C3J B;  4A3C H;  3D6C A;  1PFN A;  1YNJ D;  4LF8 Q;  4PNY A;  2JA8 B;  4XDX A;  5ELE A;  4QJF A;  2JA5 G;  4GZY C;  3S1R H;  2CWA A;  5E1F A;  3J7A V;  4JI0 Q;  1HPC A;  4WJ3 M;  3A5U A;  4DV0 Q;  4JVZ A;  4UY8 C;  5LL6 S;  4NW2 A;  4LFC Q;  3H3V C;  1YHB A;  2NVX B;  1XTC D;  3NUC A;  1V1P A;  1BCP F;  3HZX A;  1KXL A;  5IT9 E;  3HP3 A;  3LWU A;  3QJY A;  4A3F B;  1K3R A;  5BN4 A;  4ODG A;  2KUM A;  4Z9C B;  2L12 A;  3PO3 B;  1ILQ A;  2PMZ E;  3NWT A;  3KJO A;  4DR4 Q;  1JMC A;  1EEI D;  1D6E C;  4C3J H;  3CCM A;  2K28 A;  3GD7 A;  3ICE A;  5HGQ A;  1Q1E A;  3WWV A;  4B3T Q;  3T4A C;  5IYC H;  1VS0 A;  3H0G H;  2VQE Q;  1PH6 A;  1GD7 A;  3M4Y A;  2FFK B;  3FVQ A;  4DAV A;  1FGU A;  1R4Q B;  2G9D A;  2E2I B;  2ALY B;  1PHJ A;  5KRU A;  1VQN A;  3J81 L;  3S1M B;  2EYP A;  3D6W A;  1EIH A;  4CJ0 B;  3S17 B;  3FKI H;  2JA8 G;  1A63 A;  1I94 Q;  3ULP A;  1E2V A;  3ERQ A;  3CKI B;  3IAY A;  3MA2 B;  3D3R A;  4A3F H;  4DR3 L;  2E75 C;  1EIY B;  4IUR A;  3L3O C;  3SK5 A;  5IOC A;  3OIP A;  2LFN A;  2ZTE A;  1G8Z D;  3HKZ E;  5NUC A;  3OTO Q;  4Y52 H;  2R6G A;  2H5X A;  5G3L D;  3W1B A;  1HNX Q;  1Q81 C;  4MTN A;  1GUN A;  2KED A;  3VA7 A;  4R8I A;  2VZA A;  3UE0 A;  3U58 A;  1WTW A;  4KY5 A;  5BN3 A;  4WFN 3;  4K0K L;  2EY2 A;  4LNQ A;  1X3E A;  2F03 A;  1JR0 D;  3OHX C;  1HNZ L;  1VQ7 A;  3P75 A;  1KC8 C;  3PO3 G;  1W6K A;  2F0V A;  1VQG A;  1LT5 D;  4DAY B;  1B3A A;  2O2L D;  3S1M H;  4LFB Q;  1EQV A;  5F2D A;  3S17 H;  4XXE A;  5JEA G;  2K5Q A;  4WJW A;  1CSQ A;  2ASB A;  1LT3 D;  2PW5 A;  4RHS A;  1BBW A;  1T5X D;  5KNC A;  1SE2 A;  1JOO A;  4LF7 Q;  1E3P A;  3A8I E;  2K32 A;  4Y7N H;  4DAP A;  5CV7 A;  1XMO Q;  4X64 Q;  3M7G A;  1I4Q A;  5LMU Q;  3R2I A;  4GKK Q;  2F4I A;  4O1N A;  1K8M A;  4DF7 A;  4BBS H;  1PH7 A;  5D3D A;  1PYS B;  1E2Z A;  1I3Q B;  1F2L A;  2VUM H;  2TSS A;  4IQZ A;  1TWH B;  2I5M X;  3U50 C;  1T5E A;  3SK6 A;  3G6J B;  3HOU B;  3PUV A;  1SNO A;  1CA6 A;  1RL2 A;  1SE4 A;  1EQT A;  5EBC A;  4X6A H;  3PF4 A;  4B3S Q;  1WFQ A;  3DWA A;  2P5Z X;  3X3M A;  1ZYR C;  2WKC A;  4I65 A;  4WRD A;  1PRT C;  2EY5 A;  4DV5 L;  5CV5 A;  1SYB A;  2EXD A;  1D5M C;  2GA4 B;  2CHB D;  1X54 A;  2PQA B;  5ELD A;  4OXP A;  1R4P B;  3CCQ A;  3QR8 A;  2N3S A;  4OEM B;  1E1T A;  3V96 A;  3F2B A;  1DXM A;  4YWM A;  1OXS C;  3H09 A;  5CMD A;  1M1K C;  2L11 A;  1N34 L;  2B2V A;  2K4K A;  4RWS C;  1Q8K A;  5BR8 L;  5M3F G;  1HRJ A;  3BDL A;  3OWF A;  5IT9 L;  1I3Q H;  5KIX A;  1GO3 E;  2OTL A;  1PTO B;  1N9W A;  3VR2 A;  3PUX A;  1TWH H;  3M9B A;  4GN4 B;  4BY1 H;  1A3V A;  4WJ4 A;  3E3X A;  3EVQ A;  3H6M A;  4ZK9 B;  5K36 H;  3K0X A;  5C0X J;  3ER0 A;  3HOU H;  2PW7 A;  4KHP L;  2E8G A;  3MWY W;  2Z9H A;  4JBM A;  1O7Y A;  2RVL A;  2K5H A;  1X6O A;  2MQH A;  1UE5 A;  2PQA A;  1B9N A;  4S3S A;  2AUJ D;  2HHH Q;  3U4Z A;  2NZ1 D;  5M5Y B;  3S16 B;  3MEF A;  1XPR A;  2VW9 A;  5EJW A;  1HA5 A;  4CJ2 C;  3QO2 A;  2Q2H A;  1HQR D;  1VQ5 A;  1I4R A;  3S15 H;  1SE3 A;  2J4X A;  1E2W A;  3WDN A;  2LY7 A;  3KF8 A;  1PTO H;  1Y14 B;  1VQI A;  1TY0 A;  3U9O A;  3CCE A;  1ILP A;  5IYB G;  4IPD A;  3FPP A;  1STN A;  2LKV A;  1YJ9 A;  4DR3 Q;  4LFA L;  1IKM A;  2QDL A;  3T13 A;  4IN3 A;  4Q5V A;  3OWE B;  4QIW B;  5TSS A;  2VNU D;  2OTJ A;  2UU9 L;  1PZK D;  5C5M A;  3UDG A;  5M5X H;  1HH2 P;  1R9T B;  3CC4 A;  1HZC A;  1G6Z A;  3EIV A;  4DV1 L;  3DHQ A;  3SDZ A;  2JA9 A;  3DLL A;  3CC2 A;  3S16 H;  1SR3 A;  4K0K Q;  3SR1 A;  4P71 A;  1V9P A;  2A74 C;  2EY6 A;  4GOP B;  4X3T A;  3J80 c;  1KAB A;  1OO9 B;  4LUV A;  3M4Q A;  4X3U A;  1EWH A;  2A68 C;  1TVX A;  1B9M A;  3NBI A;  1VQE A;  2Q2I A;  1HJP A;  4A3K G;  1EY4 A;  1CTM A;  2PI2 E;  2Z4I A;  1JQY D;  4QUC A;  2ZJR A;  1XYI A;  3DEO A;  5JJZ A;  3JAM i;  1AZP A;  3ERO A;  3RLO A;  1NY4 A;  1WTV A;  2UUA L;  1Q46 A;  1EQQ A;  3V2T A;  4G7O C;  3CCR A;  1G91 A;  1VQA A;  2F0D A;  2Z1C A;  4GOP A;  5KNB A;  3I73 A;  4OWX B;  4R4I A;  3JC6 6;  1O7I A;  1KNA A;  4EX5 A;  5LMN Q;  3I3C A;  4DK1 A;  3KOJ A;  3CPW A;  3TP5 A;  4NP5 A;  3NEL A;  1I4P A;  3Q23 A;  4IUQ A;  4UAI A;  1X9N A;  4GS3 A;  5C4J B;  1WD1 A;  1FJG L;  4JI6 Q;  5FLX c;  3PIP 3;  2X6G A;  2B63 B;  1QUQ B;  1A62 A;  1RTN A;  5LL6 X;  4A3G B;  1AN8 A;  2CFM A;  4JI7 Q;  4DV5 Q;  4R4O A;  2K5N A;  1LO5 D;  1YEZ A;  2NWG A;  4KKS A;  1Y8N B;  1XNQ Q;  1EYA A;  2UUC L;  1ZYR D;  1EEF D;  1SSO A;  3BZD B;  3PIO A;  1L0Y B;  1EL0 A;  2PPB C;  4A93 B;  4DV2 L;  3MTS A;  1PXU A;  2CQO A;  2AWN A;  4CGY B;  3PGZ A;  1TWF B;  2RCF A;  1N34 Q;  4XYO A;  1BUV T;  5BR8 Q;  4FF2 A;  1HZB A;  5I2Y A;  1YJW A;  3K5O A;  1VQ9 A;  3LX0 A;  2KHS A;  4A3B H;  4L5Q A;  5EKK A;  1O80 A;  3CCJ A;  1K3B C;  4L5T A;  4RFB A;  2Y0S E;  5DLQ E;  1QUQ A;  3GTK B;  4BXX H;  2E2D C;  3SGI A;  2ZTD A;  4KN4 C;  1U5K A;  5C4J H;  4DXF A;  3LWE A;  3TQY A;  1IL2 A;  2BH2 A;  3MVV A;  1V1Q A;  4A3E B;  3NTK A;  1Z7T A;  4KHP Q;  1A3T A;  2AQ1 B;  3I91 A;  3G6E A;  1WJJ A;  2IHF A;  2R92 B;  3K58 A;  4PMB A;  4JW0 A;  1CK1 A;  1RHP A;  2KA7 A;  2R3Z A;  4F87 A;  1C9O A;  1U4M A;  4JI3 L;  4EQO A;  1PLF A;  2PZW A;  2MO0 A;  5FK9 C;  4UPA A;  4TRD A;  2PZU A;  1PFM A;  4BXX G;  5I2X A;  4UDU C;  1GXD C;  4A93 H;  2MFI A;  2NN6 I;  1Y1W B;  4K6L A;  3RR5 A;  2B63 G;  3S2D B;  2YTY A;  4YY3 L;  4FVM A;  3KUP A;  1QG7 A;  2JJQ A;  1TWF H;  4A3G G;  4A3J B;  1EIG A;  1IKL A;  2XRQ D;  4IUP A;  3GTG H;  1STA A;  3CXC A;  3S1Q H;  1KAA A;  3GTK H;  1G51 A;  4N8X 1;  1SEB D;  3UI2 A;  1MGS A;  1KTK A;  2N78 A;  4UP9 A;  4LFA Q;  3URY A;  3H3V I;  2R92 H;  2A6E C;  4N9P A;  3BS1 A;  2UU9 Q;  4BBR G;  3W5O A;  4DN4 M;  1N8R C;  1NSN S;  1VQD A;  3OYY A;  3PSI A;  1GM5 A;  1EYG A;  3TDQ A;  4DR7 L;  3EA6 A;  1GKH A;  1HNW L;  4HN7 A;  4DV1 Q;  2KOL A;  2WAC A;  1ENC A;  4G7H C;  1G2S A;  2YYZ A;  5C0X H;  4BY7 G;  1O78 A;  4A3E G;  3I4N B;  4ME5 A;  1Y1W H;  4UHV A;  3T1Y L;  3I4M B;  3NE5 B;  3S2D H;  1ROD A;  4C3I B;  4KJO A;  3TP7 A;  1F2M A;  3I7F A;  3K7U C;  4LUO A;  2QIL A;  4A3J H;  1PYW D;  2A19 A;  4QL5 A;  2B2U A;  1CZG A;  2LMC B;  1IYV A;  4OL7 A;  2A68 D;  1WTH A;  1IBL L;  4POF A;  4HJ8 A;  5COY A;  4CKB A;  2XRS D;  4IFD I;  4OGQ C;  4DA2 A;  3W3A A;  3ITP A;  1XMQ L;  3EFX D;  1X3Q A;  3PUZ A;  1A8V A;  1TWA B;  5DEH A;  1JWU D;  2UUA Q;  2WB1 E;  2BH8 A;  4L5R C;  2K01 A;  1LTI D;  4OHJ A;  2RCN A;  1BOS A;  3H91 A;  1CSP A;  1HTP A;  3R3O A;  2K5D A;  1TS5 A;  1UWV A;  2F52 A;  3ND8 A;  4C3I H;  1NAP A;  2YU9 H;  4P73 A;  1SRU A;  1QVF A;  2IX3 A;  3KDF A;  2I07 B;  2WKD A;  1XTD A;  5HY6 A;  3J80 L;  1PH3 A;  1FJG Q;  4HIM A;  3HRZ C;  2ES2 A;  3NWS A;  4R8N A;  1CKO A;  1IHZ A;  4HMJ A;  3BYT B;  2B2U C;  1EQR A;  5D14 A;  2SNM A;  3TBI B;  3I4N G;  3I4M G;  2QA4 A;  2L1B A;  2HT1 A;  4JPB W;  1W2B A;  3T16 A;  4QY7 A;  1JB3 A;  2NTS A;  1DYQ A;  1IW7 C;  2UUC Q;  4QF4 A;  1YVC A;  1X3G A;  4LF9 L;  3FPU B;  3HG9 A;  3I55 A;  3T1H Q;  5M9O A;  3GO5 A;  4KV6 A;  2K14 A;  4CJ1 B;  4A3M B;  4ZAI A;  2ZJQ A;  4JOI C;  5C3E G;  1B7Y B;  1XXG A;  3A5Z B;  2L0C A;  3R2T A;  3L0O A;  4F7X A;  5GAD C;  2NN6 G;  1TXY A;  1EOT A;  3ERS X;  2BDO A;  1TY2 A;  1TWG B;  1NCV A;  2ZXR A;  3H15 A;  3H3V H;  1B2T A;  4IOA A;  3S14 H;  4EVO A;  2NVY B;  2AQ3 B;  5I9P A;  2JA5 H;  3QOL A;  1VQO A;  1WI5 A;  1EWC A;  1PH2 A;  1V1P B;  3K5N A;  3SE0 A;  1E1O A;  2Q2T A;  4JI3 Q;  3MZ5 A;  4HID A;  1D7Q A;  5GAG C;  2F3W A;  3GQB A;  2A6H D;  1PH4 A;  5C44 B;  2J0T D;  1MI2 A;  3RLN A;  1LTS D;  3U9S A;  4CDF C;  1CKM A;  4NXM L;  1LTB D;  1SFO B;  3TSS A;  2EOT A;  1HR0 W;  4XTC S;  3AMU A;  4KHV A;  4CHT B;  4LF6 L;  1F9S A;  1SYD A;  4A3M H;  2B8F A;  3OOC A;  2Z0S A;  2WP8 J;  5FKA C;  3A55 A;  3TRZ A;  3WOF A;  2Q8R E;  3L7Z C;  2ICI A;  2MJ8 A;  3VDY A;  1Q86 C;  2NUC A;  2RHQ B;  1ZXT A;  3U4V A;  3HOX B;  1KL9 A;  2BCO A;  1KDA A;  4POG A;  3KLS X;  2NVY H;  5EAY A;  1LV9 A;  2PNH A;  3B6Y A;  1G2T A;  2NVQ B;  2F1M A;  3QOJ A;  2FHT A;  2FXQ A;  1PFB A;  3SHL A;  4A3M G;  3AQQ A;  4JI2 Q;  2UXC Q;  4WOR A;  3TZU A;  5IGE A;  5CC4 A;  4DR7 Q;  1HNW Q;  4G57 A;  4KY6 A;  4B08 A;  4HIO A;  4KD4 A;  2Q8T A;  4QMG A;  4IFD G;  3HKS A;  3IFT A;  1LUZ A;  1SNQ A;  1SFO H;  1WTQ A;  2JA8 H;  1N36 Q;  4DR2 Q;  2RDG A;  4EQP A;  3JAM c;  4RGO S;  2N88 A;  3BU2 A;  4GN3 B;  3SK8 A;  1JOR A;  1GUS A;  4RHR A;  5C44 G;  2CW0 C;  4B3M L;  3KLW A;  2F0E A;  4BS9 A;  4IUN A;  1IBL Q;  1C7Y A;  2D62 A;  2NVX H;  1NNX A;  1DCZ A;  3CCL A;  2CKZ B;  1EU4 A;  3M4P A;  3VYR A;  1KLG D;  2NVQ H;  4OEL B;  4AQY Q;  2N55 A;  1XMQ Q;  1PRT B;  1BCP C;  2B39 A;  2RBM A;  1O7Z A;  1U9R A;  3G7L A;  5C3X A;  5E7N A;  3E9I A;  1VQ6 A;  3PO3 H;  2X69 A;  3Q8D A;  2UXB L;  3NXW A;  1HFG A;  1O7L A;  3C2P A;  3F8T A;  1JJ2 A;  3CW2 C;  5GAE C;  1DGS A;  4RG1 A;  3HOX G;  3K7A B;  5JEA H;  4K5V A;  4C3H G;  2SDF A;  2D0O A;  2F4V L;  1Z6H A;  2K03 A;  1PA6 A;  1SYG A;  3K5L A;  1P16 A;  1TWC B;  1VQJ A;  4U67 3;  1WOC A;  3A8J E;  3CRL C;  2I5L X;  2XIW A;  3CME A;  2E2I H;  3J81 i;  1I6V C;  3OMC A;  2E2H B;  1NR2 A;  3A56 A;  3F2C A;  2DN8 A;  4DU9 A;  1YI2 A;  1CUK A;  1ICW A;  1I4X A;  5JJI A;  2KEN A;  1ESR A;  5M3F B;  1UE1 A;  1E24 A;  2DGY A;  1SMY C;  4LF9 Q;  1Y1V B;  4DKA C;  4A3L G;  1IW7 D;  5T1I A;  5KND A;  1AE2 A;  1SYC A;  1ZKO A;  4MN3 A;  3OW7 A;  3E0E A;  1JC7 A;  3TS0 A;  1EY9 A;  2YTX A;  4XYQ A;  3CRK C;  4HJA A;  3D4D A;  1C8C A;  3M4O B;  5A35 A;  4JI1 L;  1KIX A;  1MBY A;  1BQQ T;  5LHY 1;  4K14 A;  5J39 A;  3D4R A;  4OON A;  2XWB B;  2E5L L;  2IT1 A;  4YHH Q;  1AW7 A;  2E2H H;  1XJV A;  4JG2 A;  5L37 A;  5IGD A;  4J8Q A;  1HZ9 A;  1QIL A;  2MGS A;  5C4H A;  1BDO A;  4UP8 A;  5COR A;  1K8G A;  1N32 Q;  1H9K A;  2PQE A;  2Z4H A;  5M3F H;  2HDM A;  1K8A C;  2KCM A;  5C6A A;  1A3U A;  3VR3 A;  4NXM Q;  1Q82 C;  4JI4 L;  1QJO A;  3DWP A;  3VR6 A;  5CBE E;  5FJ8 G;  2B2Y A;  3TN2 A;  2F0T A;  4JK1 C;  5A2Q E;  2MO1 A;  3CMA A;  4LF6 Q;  3HOV B;  5CGK A;  5M5W B;  1D5Z C;  2TMP A;  2XVS A;  1KRT A;  3K80 C;  4HJ9 A;  4IJH A;  4PMW A;  2EYL A;  4DK3 C;  3MXG A;  1J9O A;  1NBW A;  1Q12 A;  1VQK A;  3LNN A;  3M4O H;  1EU3 A;  2A8V A;  4DNI A;  1JWM D;  2ZM6 L;  4ALP A;  3L2P A;  2B8G A;  1Y1V G;  2HDL A;  2EJM A;  1FNW A;  2BDN A;  4DUY L;  4DPG A;  3KF8 B;  1SN8 A;  3KJP A;  1L2F A;  1SLJ A;  2HQE A;  3MC0 B;  2KHJ A;  3S9W A;  2Z6K A;  2DJG C;  3S2H B;  4YCU A;  3OPO A;  2JA7 B;  1NMG A;  3NTH A;  1K9M C;  2QGQ A;  4M8A A;  4IUV A;  1XPO A;  2FIN B;  2D0P A;  4A3K B;  1LTG D;  3EBE A;  5IYB H;  3VYT A;  4Q0F A;  2JEA I;  2B2Y C;  2E76 C;  4DXG A;  5M5W H;  5KYL A;  4GNX B;  4AYB G;  4IPG A;  3TME A;  2EYO A;  2HCC A;  4B3M Q;  1DM0 B;  2XTI A;  1XWE A;  2EYJ A;  4DR6 L;  1FGB D;  2N8N A;  2QKI C;  3D0F A;  3PIP A;  3GTM B;  1IBM L;  4YWK A;  3D8G A;  3K6O A;  2A1A A;  1VQH A;  3HOV G;  2NVT B;  4QUF A;  4P75 A;  1N33 L;  2BOS A;  1ML0 D;  1D1K A;  1PTO F;  2UXB Q;  2H1E A;  1P8L A;  3S2H H;  1TS3 A;  4LF4 L;  4DGZ A;  3NBH A;  2Z6K C;  4K5X A;  5M5Y H;  1VQM A;  1SNM A;  4A3K H;  3PF5 A;  2F4V Q;  4GNX A;  3HOY B;  4G7Z C;  3FMC A;  3I2Z A;  1K28 A;  1HNZ Q;  3RZO B;  1F2Z A;  4ID6 A;  2XSC A;  1S3O A;  1Y69 U;  2JA7 G;  1VQC A;  4X65 L;  2OF1 A;  4CDE C;  3A54 A;  3FDT A;  2G9H D;  4HSP A;  2NBF A;  5DAU A;  2JK8 A;  5E3F A;  2EQS A;  1YNX A;  3GTM H;  2QF7 A;  4A3I G;  4X66 L;  3TRE A;  1LT6 D;  1CHQ D;  4DR1 L;  4GKJ L;  2IHE A;  1AP0 A;  5KEE A;  1D8L A;  1RF2 D;  4LW1 A;  1R9T H;  1ICF B;  3I70 A;  2R7F A;  3PQI A;  4HIK A;  4FF4 A;  1K83 B;  4J15 A;  1LAB A;  1DON A;  1L0X B;  2VB2 X;  3HOY H;  1F2Y A;  3KF6 A;  4OX9 L;  4BA1 I;  4QIW E;  4JI1 Q;  4RGN A;  4ULL A;  4I7A A;  3RN5 A;  4GNX C;  3BG3 A;  2AQ2 B;  4N8F A;  1LTL A;  5KYI A;  2E5L Q;  2KJX A;  2EY1 A;  3AEV A;  3SK4 A;  3BZC A;  1S4Z A;  1PZJ D;  4XT3 B;  2HIX A;  2M9V A;  1ASZ A;  2K7V A;  1JCK B;  5IP9 G;  1SJH D;  5IY0 A;  1IL8 A;  2RDF A;  3J80 E;  1KHI A;  2KHI A;  3HOY G;  1YHA A;  5A2Q L;  3F1Z A;  5M3M B;  1HA6 A;  4JI5 L;  3GDE A;  1YIJ A;  3VYU A;  4X62 L;  1PYB A;  2J7Z A;  5LMN W;  1PRT D;  2CCZ A;  1E7Z A;  1TKW B;  1B50 A;  1AZQ A;  4HCS A;  2C9O A;  4P72 A;  3J81 j;  1A6X A;  3GV6 A;  2PNR C;  1MSG A;  5JOB A;  4K2K A;  4TQU S;  4P74 A;  4BBR B;  4HJ7 A;  3V05 A;  1L1O A;  2SOB A;  4DUY Q;  3PUY A;  2DJF C;  4IPH A;  4IAL A;  2KQ3 A;  4BY7 B;  2B63 H;  4RCO A;  2EDG A;  2O5I C;  4RKB A;  4A3G H;  4OIK A;  2L55 A;  2VQF L;  4OWT B;  2F0Q A;  2IL8 A;  3HOZ G;  1LTT D;  1HR0 L;  2C35 B;  4ZYS A;  1UE6 A;  1QZG A;  5FLX E;  1S40 A;  1STY A;  5J1Z A;  4FO2 A;  3A74 A;  2K75 A;  3DM1 A;  4R4Q A;  3D31 A;  1NMF A;  3E9H A;  3CF5 A;  1JT8 A;  4ZUJ A;  4LF5 L;  4RMF A;  1JOQ A;  4JBW A;  3STB C;  4BBR H;  1I50 B;  5I9O A;  5M3M G;  1PMR A;  2QEX A;  1D1I A;  3E5S A;  2EPB A;  5CV9 A;  1MIU A;  1UUP A;  4DR6 Q;  3KLR A;  1KDC A;  1L1O C;  1IBM Q;  5DM6 3;  2EJG C;  4C2M B;  4APV A;  5IP7 G;  2RDH A;  4TKO B;  4A3E H;  4BY7 H;  5C3W A;  5JEA J;  3PO2 B;  4B9X A;  5J22 A;  2D9U A;  4KI0 A;  3C1E A;  2CH4 A;  3J81 c;  4L6T B;  5E4W C;  1EY0 A;  4JI0 L;  1PV4 A;  1VF5 C;  3K81 C;  1MHW C;  3A8K E;  4R1J A;  5FOB B;  5HUR A;  1VMC A;  2C5C A;  3KFU A;  5IE8 A;  5JAV A;  3CCS A;  2NZH A;  1WCM B;  3VR4 A;  3QIA A;  2R93 B;  4ME3 A;  2ZT9 C;  5G3L F;  1OXT A;  3J7Z C;  2I0Q A;  4FF3 A;  3CD6 A;  4OO1 I;  3GTJ B;  1H9S A;  2ICE C;  3EJI A;  1QWY A;  1U4P A;  4X65 Q;  1I50 H;  3FRP B;  2CWP A;  1HZA A;  1TU2 B;  3KDF B;  4P2C B;  2JSO A;  5IGB A;  1RKN A;  1SXT A;  1VDZ A;  3GV3 A;  4C1N K;  2LXK A;  4IJL A;  4C2M H;  1K0S A;  4R9W A;  4O0A A;  3TP8 A;  4X66 Q;  3PO2 H;  5C3E B;  1B8A A;  3T51 B;  4CKE A;  3L9A X;  2RA4 A;  1FD7 D;  1VMP A;  4GLX A;  3C46 A;  1RD9 D;  3IKJ A;  1CHP D;  1JOK A;  1B53 A;  2X6L A;  1UE7 A;  4JOI A;  1DJR D; 
#chains in the Genus database with same CATH homology
 4IFD J;  1I3Q H;  1GO3 E;  4DAM A;  1I94 L;  2OTL A;  1N9W A;  3BU2 A;  4QGU A;  1PH1 A;  3I4N H;  1E22 A;  4OX9 Q;  1K83 H;  1NE3 A;  4GN3 B;  3PUX A;  3I4M H;  1TWH H;  3EN2 A;  3M9B A;  4GN4 B;  3PO2 G;  1QZH A;  5C44 G;  4B3M L;  1PH8 A;  4BY1 H;  3GTJ H;  4WJ4 A;  1Z9F A;  3KLW A;  1L0W A;  2JA6 H;  1KRS A;  1IBL Q;  1OXV A;  1X56 A;  1IYJ B;  3ER0 A;  3K0X A;  1Q1B A;  2D62 A;  5C0X J;  2GVA A;  3ZJY C;  1VQF A;  2E8G A;  1K0R A;  2KBN A;  2ZM6 Q;  2NVX H;  4KHP L;  4JBJ A;  3UE1 A;  4JBM A;  3CCL A;  3HOZ H;  1OXU A;  1MJC A;  2CKZ B;  3M4P A;  1SE8 A;  4JBK A;  4A75 A;  2NVQ H;  1WCM G;  2K5H A;  1X6O A;  2MQH A;  1UE5 A;  2PQA A;  3CC7 A;  4AQY Q;  1XMQ Q;  2R93 G;  2AMC B;  2YV5 A;  4A76 A;  3BJU A;  3U4Z A;  3T1H L;  5E7N A;  2HHH Q;  1G29 1;  3E9I A;  1VQ6 A;  3PO3 H;  3MEF A;  3Q8D A;  2UXB L;  5C3E H;  1XPR A;  4JI5 Q;  1AE3 A;  2VW9 A;  3F8T A;  2B29 A;  1JJ2 A;  2JA6 G;  1TWA H;  1LM0 A;  3CW2 C;  2GVB A;  4X62 Q;  1DGS A;  2AHO B;  5GAE C;  2Q2H A;  4GOP C;  4RG1 A;  3HOX G;  3DM3 A;  1VQ5 A;  3S15 H;  5IYD H;  4MZ9 A;  5M3M H;  2ATW A;  4DV2 Q;  2D0O A;  2F4V L;  4DUZ L;  1YZ6 A;  4LFB L;  3GTQ H;  5JJL A;  2I5H A;  1PA6 A;  2Y0S G;  1P16 A;  2E2J H;  1VQJ A;  4OWW B;  3ULJ A;  5C4X H;  5IP7 H;  1WOC A;  1Y14 B;  1VQI A;  1BBU A;  3UDI A;  2I5L X;  3CME A;  5H1S E;  2E2I H;  3J81 i;  1EOV A;  3CCE A;  3J80 i;  5IYB G;  4IPD A;  2IX0 A;  3F2C A;  3HOW H;  1YJ9 A;  4DR3 Q;  1YI2 A;  4LFA L;  5IYD G;  3RNU A;  1CUK A;  4LF7 L;  4A3B G;  1I6H H;  5JJI A;  2JE6 I;  2KEN A;  2B3G A;  3CCU A;  2VNU D;  2OTJ A;  2UU9 L;  1XMO L;  3UDG A;  5M5X H;  1HH2 P;  3CC4 A;  1HZC A;  4LF8 L;  1UE1 A;  5IT9 c;  2R7D A;  1E24 A;  2DGY A;  5IWA Q;  5C4X G;  2VQF Q;  3EIV A;  4LF9 Q;  4DV1 L;  2JA9 A;  3DLL A;  3CC2 A;  3S16 H;  2HIV A;  4GLA C;  1N33 Q;  4DKA C;  4A3L G;  1SR3 A;  4K0K Q;  1HR0 Q;  2HQL A;  4P71 A;  1V9P A;  4PZ7 A;  4GOP B;  1AE2 A;  3HOW G;  4JV5 Q;  3J80 c;  2IX1 A;  3E0E A;  3GTP H;  4LF4 Q;  4LUV A;  3GTO H;  1WYD A;  3M4Q A;  3TS0 A;  2YTX A;  4DV0 L;  4BA2 I;  5AJ3 L;  4YY3 Q;  3W1G A;  3I56 A;  4DV7 Q;  1RIP A;  3KYH C;  4HJA A;  4LF5 Q;  1J5E L;  4LFC L;  4A93 G;  4JI1 L;  4H02 A;  1KIX A;  1VQE A;  2Q2I A;  3UDX A;  2VY3 A;  1HJP A;  4A3K G;  4LF8 Q;  2WAQ G;  1UEB A;  2PI2 E;  4OON A;  5ELO A;  4DR5 L;  2E5L L;  2IT1 A;  4YHH Q;  4HJ5 A;  3RN2 A;  2BA0 A;  1NJI C;  2E2H H;  4JI2 L;  1XJV A;  1QVG A;  4JG2 A;  4JI8 L;  1ASY A;  4O2D A;  2UXC L;  1HZ9 A;  3STB D;  2ZJR A;  2F3I A;  1TWG H;  2OQ0 A;  4DR4 L;  4OO1 G;  3JAM i;  4UP8 A;  1K8G A;  3RLO A;  1NY4 A;  1XNR L;  1N32 Q;  2UUA L;  3S24 A;  5M3F H;  1Q46 A;  1EQQ A;  5GQO A;  1K8A C;  4B3T L;  3J7A 5;  2KCM A;  3F2D A;  3CCR A;  1N36 L;  1VQA A;  4DR2 L;  1KQS A;  4DV4 Q;  4GOP A;  4NXM Q;  2VQE L;  1EWI A;  1Q82 C;  4JI4 L;  4OWX B;  2OWO A;  4R4I A;  3JC6 6;  4DR1 Q;  2R92 G;  4GKJ Q;  1SMX A;  5JJK A;  5FJ8 G;  2LSS A;  1O7I A;  3NEM A;  5GRO A;  5C44 H;  4A3C G;  1IXR A;  4DV6 L;  2MO1 A;  4EX5 A;  1NTG A;  3CMA A;  5LMN Q;  4LF6 Q;  3KOJ A;  3CPW A;  3NEL A;  4HJ9 A;  1KRT A;  3K80 C;  4IJH A;  4KLK A;  4PMW A;  3T1Y Q;  4DK3 C;  4LWC A;  1K73 C;  1VQL A;  3PCO B;  1NBW A;  1X9N A;  1Q12 A;  4GS3 A;  1VQK A;  1WCM H;  3M4O H;  2A8V A;  2R93 H;  1FJG L;  4DNI A;  5C0X G;  2ZM6 L;  4ALP A;  4JI6 Q;  5FLX c;  3L2P A;  1Y1W G;  1Y1V G;  4DV3 Q;  1QUQ B;  1IBK Q;  2BA1 A;  3TEH B;  4DUY L;  4AQY L;  1A62 A;  4DPG A;  1C0A A;  1OXX K;  2RHS B;  3KF8 B;  3G71 A;  4IOC A;  1Q7Y C;  1M90 C;  3AYH B;  1SN8 A;  3PUW A;  4A3J G;  2HHH L;  2CFM A;  3KJP A;  4JI7 Q;  3HOX H;  1L2F A;  4R4O A;  4DV5 Q;  3OTO L;  2K5N A;  4DK6 C;  1SLJ A;  2L15 A;  1YEZ A;  2WFW A;  2WB1 G;  2KHJ A;  3FHW A;  4C3H H;  2Z6K A;  1HNX L;  1XNQ Q;  1AH9 A;  4IPC A;  2UUC L;  3RLF A;  4YCU A;  2VL6 A;  3PIO A;  1NMG A;  3M7N A;  4IO9 A;  1K9M C;  2QGQ A;  1U0L A;  4DV2 L;  1XPO A;  2CQO A;  3CQZ H;  2AWN A;  2D0P A;  3CP0 A;  3PGZ A;  4JYA L;  3EBE A;  1N34 Q;  2OQK A;  5IYB H;  2R7Z H;  5BR8 Q;  1HZB A;  1YJW A;  1VQ9 A;  2JEA I;  5M5W H;  5IYC G;  4L5Q A;  4A3B H;  4PZ8 A;  4EQ5 A;  1MKH A;  3CCJ A;  4GNX B;  3H0G G;  4AYB G;  4IPG A;  4L5T A;  2Y0S E;  5DLQ E;  1QUQ A;  4B3M Q;  3S1N H;  4BXX H;  3SGI A;  2BH2 A;  2ZTD A;  5C4J H;  1U5K A;  1VCI A;  3TQY A;  1IL2 A;  1V1Q A;  2XTI A;  2ID0 A;  4KHP Q;  2EIF A;  3G6E A;  4PZ6 A;  4R4C A;  1WJJ A;  2IHF A;  2UUB L;  4DR6 L;  3G4S A;  3HKZ G;  2N8N A;  4A3L H;  3D0F A;  3PIP A;  2R7Z G;  1IBM L;  2K5V A;  4YWK A;  2A1A A;  1VQH A;  3HOV G;  3FKI G;  1C9O A;  4JI3 L;  2IY5 B;  4P75 A;  3G48 A;  4XIG S;  1N33 L;  1T9H A;  3IRB A;  2MO0 A;  3HFZ B;  4NPS A;  4UPA A;  2MNA A;  1PH9 A;  1X65 A;  2UXB Q;  3S2H H;  1P8L A;  1GVP A;  4YWL A;  4A3F G;  4X64 L;  4BXX G;  3CCV A;  5LMU L;  4LF4 L;  4A93 H;  4GKK L;  4JCV E;  2MFI A;  2XGT A;  3FP9 A;  4YCV A;  2NN6 I;  2OCE A;  2Z6K C;  3RR5 A;  5M5Y H;  2ZJP A;  2B63 G;  2YTY A;  1JJC B;  4YY3 L;  4A3K H;  1VQM A;  4L5S A;  3PF5 A;  1VQ4 A;  2JJQ A;  1YBY A;  1TWF H;  2F4V Q;  4GNX A;  4A3G G;  4DUZ Q;  1A0I A;  1H95 A;  1YIT A;  1PH5 A;  1IZ6 A;  3AFQ A;  3I2Z A;  3MXN B;  1XPU A;  3K7A H;  1HNZ Q;  1EIF A;  4GLV B;  4B3R L;  4AIM A;  4YHH L;  3GTG H;  3NEN A;  1S3O A;  2JA7 G;  1VQC A;  3CXC A;  3S1Q H;  4X65 L;  3GTK H;  1G51 A;  1CKN B;  3CAM A;  1TWC H;  3LGJ A;  1J6Q A;  4TVA B;  2WAQ E;  4UP9 A;  2N78 A;  4KHZ A;  4LFA Q;  3H3V I;  4B3S L;  1OTC A;  4A3D H;  3OW2 A;  1N32 L;  2R92 H;  2JK8 A;  2KCT A;  5FJ8 H;  2EQS A;  1YNX A;  4A3C H;  3GTM H;  2UU9 Q;  4BBR G;  3W5O A;  1GM5 A;  1N8R C;  3OYY A;  1VQD A;  2K50 A;  3PSI A;  4X66 L;  4A3I G;  1EYG A;  2AWO A;  4JC0 A;  4PG3 A;  3TRE A;  4DR1 L;  4DR7 L;  1GKH A;  4GKJ L;  4NB3 A;  1HNW L;  3K8A A;  2IHE A;  4QJF A;  5GAH C;  4DV1 Q;  2JA5 G;  4NXN L;  3S1R H;  1D8L A;  4LW1 A;  1R9T H;  5LMN L;  2YYZ A;  2CWA A;  2R7F A;  4BY7 G;  4A3E G;  4HIK A;  1Y1W H;  3S2D H;  3T1Y L;  3A0J A;  4JI0 Q;  1VQ8 A;  1Y1V H;  4J15 A;  2NZO A;  4WJ3 M;  3A5U A;  2DUD A;  4DV0 Q;  3I7F A;  3K7U C;  1S72 A;  5AJ3 Q;  4UY8 C;  4LUO A;  4JI6 L;  4A4I A;  2K52 A;  2Q2U A;  1JE5 A;  3HOY H;  4A3J H;  3KF6 A;  1J5E Q;  1MJE A;  2A19 A;  4QIW E;  1YHB A;  4QL5 A;  4JI1 Q;  4BA1 I;  4LFC Q;  4OX9 L;  1CKN A;  3RN5 A;  2RF4 A;  4GNX C;  4BBS G;  4GN5 A;  4AH6 A;  1LTL A;  1C7Y A;  1KXL A;  1IBL L;  4POF A;  2V1C C;  4HJ8 A;  4DR5 Q;  2E5L Q;  1K3R A;  3AEV A;  4QQB X;  4JI7 L;  3BZC A;  1FL0 A;  2VUM G;  4JI8 Q;  2HIX A;  4IFD I;  1PFS A;  1XNQ L;  3M3Y H;  1V43 A;  2PMZ E;  1ASZ A;  3KJO A;  5IP9 G;  5J3B A;  4DR4 Q;  1JMC A;  5IY0 A;  4C3J H;  1XMQ L;  3PUZ A;  1KHI A;  2KHI A;  1A8V A;  3CCM A;  2AKW B;  1XNR Q;  3HOY G;  3GD7 A;  2UUA Q;  1YHA A;  3ICE A;  5HGQ A;  1FVI A;  1Q1E A;  3F1Z A;  2WB1 E;  3WWV A;  4B3T Q;  1PVO A;  2BH8 A;  1JJG A;  4JI5 L;  3GDE A;  5IYC H;  1VS0 A;  4L5R C;  3H0G H;  2VQE Q;  1YIJ A;  1PH6 A;  4X62 L;  1GD7 A;  1PYB A;  2RCN A;  5LMN W;  2CCZ A;  1E7Z A;  1CSP A;  4DV6 Q;  2GN5 A;  1FGU A;  4P72 A;  1BKB A;  1UWV A;  2F52 A;  4C3I H;  3J81 j;  2YU9 H;  4P73 A;  1SRU A;  1QVF A;  1B70 B;  2ALY B;  1PHJ A;  3KDF A;  1VQN A;  3NBH B;  1XTD A;  5HY6 A;  1VQP A;  1I5F A;  1PH3 A;  4TQU S;  4P74 A;  1YHQ A;  3HOV H;  4HJ7 A;  3FKI H;  1FJG Q;  4AYB E;  4HIM A;  2ES2 A;  2JA8 G;  1L1O A;  1I94 Q;  3TS2 A;  3ULP A;  1A63 A;  1CKO A;  1KAW A;  4DUY Q;  3PUY A;  4A3F H;  4DR3 L;  4IPH A;  1EIY B;  1EQR A;  4R4T A;  3I4N G;  2YTV A;  3I4M G;  2ZTE A;  2QA4 A;  2HT1 A;  3HKZ E;  5ELN A;  2B63 H;  1W2B A;  3OTO Q;  4Y52 H;  4QY7 A;  4BY1 G;  2R6G A;  2H5X A;  3W1B A;  1HNX Q;  1Q81 C;  4MTN A;  3CPF A;  1VQB A;  2UUC Q;  4A3G H;  5K36 G;  5IWA L;  3HOU G;  1YVC A;  1X3G A;  4OWT B;  3ULL A;  2VQF L;  4LF9 L;  2VZA A;  3I55 A;  3UE0 A;  3U58 A;  1G6P A;  3HOZ G;  5FLM H;  3T1H Q;  4K0K L;  1HR0 L;  3GO5 A;  4LNQ A;  2C35 B;  1X3E A;  1UE6 A;  1QZG A;  2K14 A;  1BVS A;  4JYA Q;  1S40 A;  2JA7 H;  4JV5 L;  3A74 A;  2K75 A;  2LXJ A;  4FDB A;  1HNZ L;  1VQ7 A;  4R4Q A;  1KC8 C;  3PO3 G;  2ZJQ A;  4JOI C;  3D31 A;  3RZD H;  5C3E G;  1NMF A;  3E9H A;  1VQG A;  3CF5 A;  1B7Y B;  4DV7 L;  1JT8 A;  3A5Z B;  4LF5 L;  4RMF A;  4DAY B;  3AFP A;  3L0O A;  5GAD C;  3S1M H;  4LFB Q;  2NN6 G;  1TXY A;  3ERS X;  4JBW A;  3STB C;  4BBR H;  3S17 H;  3H15 A;  5M3M G;  4A3I H;  3H3V H;  2QEX A;  2UXD L;  5JEA G;  1EUJ A;  1X3F A;  5FLM G;  4IOA A;  4YCW A;  3S14 H;  1CSQ A;  2ASB A;  1YJN A;  2JA5 H;  1MIU A;  3KF6 B;  1W3S A;  2UUB Q;  4DR6 Q;  1VQO A;  1BBW A;  1WI5 A;  1L1O C;  1PH2 A;  2JEB I;  1IBM Q;  5IP7 G;  4APV A;  2PI2 A;  1E1O A;  4BY7 H;  4A3E H;  2Q2T A;  5JEA J;  4JI3 Q;  4HID A;  4LF7 Q;  1E3P A;  1D7Q A;  5GAG C;  1PH4 A;  4KI0 A;  4UP7 A;  3RLN A;  3GTL H;  4Y7N H;  2ZTC A;  3J81 c;  1XMO Q;  4X64 Q;  1CKM A;  2VS1 A;  4DV4 L;  4NXM L;  4JI0 L;  5LMU Q;  1PV4 A;  4MNO A;  2NVT H;  4GKK Q;  1EFW A;  3K81 C;  4R1J A;  1SRO A;  1HR0 W;  4BBS H;  1PH7 A;  4XTC S;  3KFU A;  1PYS B;  5IE8 A;  1QVC A;  3CCS A;  3PV0 A;  2NZH A;  4LF6 L;  4ME3 A;  4A3M H;  1OXT A;  3J7Z C;  2I0Q A;  2VUM H;  2JQO A;  2N49 A;  2Z0S A;  2WP8 J;  1KD1 C;  3CD6 A;  3TRZ A;  4OO1 I;  2I5M X;  1X55 A;  3U50 C;  3L7Z C;  5IP9 H;  4B3R Q;  3VDY A;  1Q86 C;  2RHQ B;  3PUV A;  4A3D G;  4X65 Q;  1RL2 A;  3U4V A;  4DV3 L;  1I50 H;  4LUZ A;  1KL9 A;  1IBK L;  2CWP A;  1HZA A;  5M3F G;  3KDF B;  4POG A;  4X6A H;  3PF4 A;  3RZO H;  4B3S Q;  1WFQ A;  2NVY H;  5EAY A;  3B6Y A;  2PNH A;  2FXQ A;  1L1O B;  4A3M G;  4DV5 L;  3AQQ A;  2LXK A;  4IJL A;  4JI2 Q;  3UDF A;  4C2M H;  2EXD A;  2UXC Q;  3M85 A;  1Z47 A;  3I4O A;  4O0A A;  4X66 Q;  4DR7 Q;  2UXD Q;  3PO2 H;  1JB7 A;  1B8A A;  1X54 A;  2PQA B;  1HNW Q;  3HOU H;  4OXP A;  4HIO A;  3CCQ A;  4NXN Q;  4IFD G;  4GLX A;  1LYL A;  2N3S A;  3HKS A;  1LUZ A;  1SFO H;  5C0X I;  1E1T A;  2JA8 H;  1N36 Q;  3F2B A;  4DR2 Q;  4YWM A;  1OXS C;  1M1K C;  1UE7 A;  1N34 L;  4JOI A;  4JI4 Q;  3BZK A;  2K4K A;  3JAM c;  1Q8K A;  5BR8 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...