1NMGA

Major cold-shock protein, nmr, minimized average structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords MAJOR COLD-SHOCK PROTEIN
publication title Structure in solution of the major cold-shock protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 4
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1996-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1nmgA00
3ZJYC 2KHJA 4LF8Q 2B63G 2I5LX 2ZM6L 4JI6Q 1PH4A 4YWMA 4DUZL 3AFQA 1VQ6A 1HZBA 3OTOQ 1GD7A 1BVSA 3AEVA 1SN8A 5AJ3Q 1ASYA 4LFBQ 1CSQA 1GKHA 2FXQA 4LF5L 2R7DA 3S1NH 1IZ6A 4NXNL 3PO2H 4LFAQ 5IYBH 4DV3Q 1PH5A 1MJCA 4C3HH 4B3SQ 2JA6G 1PH3A 3EN2A 4DV6Q 1N32Q 4JOIA 3M85A 1LM0A 2JJQA 4A3DH 4X6AH 5IWAQ 1UE5A 2AWOA 3A74A 2CFMA 1XNQL 2Q2UA 3K81C 4DR4Q 4LF4Q 1NMGA 5GADC 5LMNL 1UE1A 1PH7A 1HZ9A 1JJGA 5C0XG 1PV4A 1ASZA 1VQKA 1O7IA 2OTLA 3G48A 2VL6A 3KDFA 3RLNA 1I94L 4DV1Q 4DV5L 4HJ5A 4POFA 2I0QA 1VQAA 3HOWG 4DV4L 4DR1Q 2UXBQ 2QEXA 4YHHL 1X56A 1LYLA 3OYYA 4KHPQ 1LTLA 1Y1VG 1Q12A 3HOUG 4PZ8A 4NXMQ 1TWAH 1KC8C 5IYDG 4LFCQ 1N36Q 1NTGA 1QUQB 1VQEA 3HKZE 4A3KG 1XPRA 3HOYH 1HNXQ 1PHJA 5IYCG 1Q8KA 2YTYA 3FKIG 1Y1WH 2K5HA 1HJPA 4A3LH 1U5KA 3CCMA 3CP0A 2DUDA 1FJGL 1PH2A 1XNQQ 3CCRA 2GN5A 1WCMH 1V9PA 5M3FH 3H15A 4GS3A 4JYAQ 2PMZE 2VW9A 1PYSB 2RF4A 2JA9A 4JI3L 1NBWA 4GOPB 2A19A 1HNZQ 1VQ8A 1OXSC 3CCSA 1XPUA 4PZ6A 1X65A 4JI8Q 1IBKL 2HIXA 3D0FA 4R4QA 1OXXK 1KHIA 1V43A 2ZTCA 3U58A 4JI7Q 3CPWA 1S72A 1RL2A 1E3PA 3PUWA 2ZM6Q 2RHQB 4IJLA 2OTJA 4DUZQ 2MO0A 3JC66 1EIYB 5GROA 4UP7A 2VNUD 3BZCA 1L0WA 3UDXA 2JA5G 4R4OA 4LF5Q 2K5NA 5C44G 3BZKA 3PCOB 2QGQA 4NXNQ 1HZCA 1TWFH 1I3QH 1PH8A 5JJLA 2PI2A 3LGJA 3T1HL 4JV5L 1VQGA 3TQYA 5GQOA 1SFOH 2Z6KA 3CCLA 4JBKA 5C4JH 4DR3L 1S40A 1VQLA 2A1AA 4A93G 1OXVA 1S3OA 2R6GA 4R4TA 1PYBA 3MXNB 2KHIA 4C3IH 1OTCA 1K0RA 2VQEL 4YY3L 4BXXG 1YI2A 5LMNQ 1VQMA 4IO9A 3HOVG 2D0PA 4L5SA 4DV7L 1Q86C 4LUVA 1MJEA 4B3RL 4DV5Q 1VQ7A 4IFDI 5JJIA 4DR2L 2R92H 1E24A 4JBWA 4BY1G 5J3BA 1TXYA 1HR0L 2JE6I 4HJ7A 1VQ5A 5IY0A 4YHHQ 1I6HH 3IRBA 2GVBA 3HOZH 2LXKA 3I4OA 1EUJA 3RZOH 1E7ZA 2XGTA 3KLWA 4AQYL 1YHQA 4A3GG 4DV2L 5M5YH 1VQ9A 5M3MG 2NVTH 3TRZA 1X55A 2Y0SG 3PIPA 1HH2P 4K0KL 1QUQA 5C3EH 1FJGQ 3STBC 1L2FA 1MKHA 1C0AA 1UWVA 1SE8A 2C35B 2EIFA 3F8TA 4IPHA 1UE7A 2H5XA 4UP8A 4JI3Q 4EX5A 2JEBI 2RCNA 3RZDH 1PH1A 4DKAC 3J80c 4A3EG 3I4NH 1KXLA 4BY7G 3M4QA 3G6EA 1XNRL 2MO1A 3PSIA 4MZ9A 1XMQL 4A3CH 4LUOA 2CQOA 2UU9Q 2VUMG 2PQAB 1D7QA 1WI5A 3CMAA 3CCJA 3WWVA 4YCWA 1UE6A 5FLXc 3GTPH 2CWPA 2IHEA 2WP8J 1A8VA 4RG1A 4APVA 3A5UA 2R7FA 3KFUA 4DAYB 3T1HQ 2VZAA 2WAQG 3HOXH 1KRSA 4QGUA 4DR6Q 5C4XH 1B70B 3CCQA 1Q82C 4DR3Q 1PA6A 2ZJQA 4A3FH 2AWNA 5IP7G 3I56A 3DLLA 2ZJPA 1FL0A 2KCTA 2VQEQ 3E9IA 4YY3Q 4GLAC 1VQNA 1NY4A 2YYZA 3KOJA 4B3ML 5HY6A 4GNXA 4BBRH 3CCVA 5M3FG 4DV7Q 2UUCL 4JBJA 2F4VL 4B3RQ 2R93G 4DR2Q 3OW2A 4AYBG 1HR0Q 5IE8A 3A5ZB 1IXRA 1T9HA 3F1ZA 2V1CC 2YV5A 5LMUL 5JEAG 4A3BG 3CMEA 1VQPA 3K80C 1C7YA 2E2HH 4AH6A 1VCIA 2JK8A 4AQYQ 3RLOA 1XTDA 4Y7NH 3I4MH 4DV2Q 4OO1I 3CW2C 4A75A 1PH9A 4Y52H 4GN5A 5M5WH 4B3TL 3TS2A 1K83H 1KL9A 4LWCA 3RR5A 4X65L 4K0KQ 2MQHA 4LFAL 3G4SA 1L1OC 5FJ8H 4JI5L 5IP9H 4BBSH 4IFDG 4X66L 4A3IH 2JA8H 1YITA 5IT9c 2VS1A 4HJ9A 1YHBA 3K0XA 4H02A 4OWXB 3PF4A 4UY8C 4PMWA 1XNRQ 1CUKA 2N3SA 4LUZA 2Q2TA 2L15A 3ICEA 3KYHC 1XMQQ 4HIKA 3MEFA 1WYDA 1OXTA 1Q1BA 2NZOA 5ELOA 1Q81C 5C0XJ 4JBMA 5H1SE 5LMNW 4DUYL 4HIOA 4A3JG 1RIPA 1YJ9A 2IT1A 2UUBL 1Z9FA 1TWCH 4UP9A 3JAMc 3NBHB 1EWIA 1VQHA 2AMCB 2UXDL 5BR8L 1KQSA 2IY5B 3ERSX 3Q8DA 4DR5L 1X3EA 2ZTEA 1K9MC 1N33L 2BA0A 2WB1E 1B8AA 1Q7YC 2IX0A 2I5HA 2HT1A 4A3MG 1YEZA 5FLMG 3CAMA 3M9BA 3STBD 2JA6H 4YWKA 1VQIA 2N78A 2QA4A 4A76A 2NVXH 1VQJA 1PH6A 1QVCA 2JA7G 2UXCL 1M90C 3L0OA 1WOCA 3KF8B 4JI0L 3CC7A 1YHAA 2UUCQ 3KF6B 2F4VQ 4GLVB 4P73A 1W3SA 2YTVA 4P75A 2D62A 4R4IA 1AE2A 2OQKA 2B29A 5ELNA 3HOWH 3S15H 1VQOA 1K3RA 1P16A 1IL2A 3CPFA 1AH9A 5LMUQ 4JI1L 1Y1VH 2KCMA 3H0GG 3KJOA 3HOUH 2NN6I 1I94Q 5IYDH 2LXJA 3CCEA 3PO3G 5GAEC 4A3KH 4DV4Q 2F3IA 4TVAB 2WAQE 1EOVA 2CWAA 2K50A 1GO3E 3FKIH 4XTCS 5IYCH 3J81c 1KIXA 4B3TQ 4LF8L 4DPGA 4X65Q 4QIWE 3PGZA 2BH2A 3H3VH 5GAHC 1X54A 3A0JA 4EQ5A 3F2DA 4JI5Q 4PG3A 3GTMH 4X66Q 1TWGH 1N34L 1EFWA 1Q46A 3HKZG 3CCUA 1CKOA 4KLKA 1HZAA 4HJAA 4QJFA 3ULPA 2K52A 4GKKL 4WJ3M 4P72A 2WFWA 5C4XG 3FHWA 2LSSA 4MNOA 1VQ4A 4YCUA 4X64L 3PUZA 1JMCA 3S2DH 2HIVA 5IWAL 4OO1G 4QQBX 4GNXC 3K7AH 1TWHH 1YNXA 3GD7A 4JOIC 5IYBG 3W5OA 2N49A 3KDFB 3GTKH 3J80i 4DUYQ 5DLQE 2E2IH 2E8GA 2OWOA 2UXDQ 4QL5A 2IX1A 5BR8Q 2KBNA 3E0EA 4JG2A 1SMXA 1UEBA 5E7NA 1IBKQ 4LF6L 2Q2HA 4A3DG 4DR5Q 1VQFA 1LUZA 2MNAA 4GOPA 3T1YL 1M1KC 1IBLL 1HR0W 2JA5H 1N33Q 1IYJB 1YVCA 4YCVA 5C44H 3CF5A 3GTGH 4DK6C 1FVIA 1VQCA 2EXDA 2ES2A 3GO5A 3UDFA 1YJNA 3TEHB 4KHZA 3I4MG 4A93H 1NE3A 1EQRA 4JI4L 2OCEA 1MIUA 2ZTDA 1X3GA 4JV5Q 3S2HH 1W2BA 4BXXH 1QZGA 1FGUA 4JI0Q 2JQOA 1JE5A 5HGQA 3DM3A 3HOVH 3SGIA 3HOYG 4JYAL 4AIMA 4POGA 1G6PA 2NVYH 1Y1WG 3UE0A 4BY1H 4L5TA 4A3LG 2B3GA 2CKZB 3L7ZC 2BH8A 4IOCA 3GTQH 3KF6A 2EQSA 2RHSB 1SRUA 1CSPA 3EBEA 3W1BA 1WCMG 4JI1Q 3GTOH 1K8AC 1H95A 2Q2IA 3AQQA 4A3GH 1SLJA 4IPDA 2AKWB 3KJPA 4DV0L 4LF7L 2PI2E 3AFPA 3CXCA 5M3MH 3PO2G 3RNUA 1DGSA 3HFZB 1XMOL 2HQLA 3M4OH 1X3FA 3M7NA 2HHHL 1L1OB 4OWWB 3K7UC 3RN2A 1WJJA 3GTLH 1N34Q 2K14A 3PUYA 4GKJL 4O2DA 5GAGC 3UDGA 4PZ7A 3UE1A 2VQFL 3I55A 2DGYA 2UUAL 4A3EH 4GKKQ 1K73C 4BY7H 3F2CA 1SR3A 4NPSA 2NN6G 3S1QH 3EIVA 4X64Q 1C9OA 4DAMA 3ER0A 2Z6KC 2E5LL 4HIMA 2VUMH 4R1JA 1I5FA 2N8NA 1CKMA 2R7ZH 1CKNB 2K75A 3CC2A 4LF6Q 2VY3A 3BU2A 5EAYA 1IBLQ 3T1YQ 1SROA 4YWLA 5JEAJ 3BJUA 4C2MH 3PUXA 3U4VA 2ALYB 1P8LA 3NEMA 3JAMi 2NZHA 3HKSA 4LF9L 3I2ZA 1OXUA 1J5EL 1YJWA 1YIJA 4JI7L 3K8AA 3CD6A 3S14H 2PQAA 1EIFA 3I7FA 3NELA 1X6OA 2R92G 1BBUA 1V1QA 2Y0SE 5IP7H 4JI4Q 3S1MH 3U50C 3UDIA 3HOZG 4IFDJ 1I50H 3RLFA 3E9HA 1GM5A 1IBML 2KENA 3S24A 5JJKA 2R93H 4NB3A 2K5VA 1KAWA 3CC4A 2YTXA 4DNIA 2D0OA 3PUVA 3FP9A 1R9TH 1HNWL 4WJ4A 3L2PA 5C3EG 3PF5A 4B3MQ 4DR7L 4A3BH 1GVPA 1BKBA 2K4KA 3CQZH 4ALPA 4OX9L 4BBSG 1EQQA 1VS0A 1E22A 2UU9L 3I4NG 2Z0SA 4DV0Q 4R4CA 4GOPC 4LF7Q 2BA1A 3M4PA 2A8VA 1U0LA 3W1GA 2JEAI 4KI0A 3NENA 3ULJA 1XMOQ 4X62L 3J7A5 4A3CG 2CCZA 1D8LA 2HHHQ 5M5XH 4JCVE 4JI2L 1VQBA 4XIGS 1KRTA 4C3JH 4GKJQ 3RN5A 1G51A 3PV0A 1G291 3J81i 3G71A 1JJCB 3GDEA 4JI6L 1Z47A 1L1OA 2VQFQ 1AE3A 2GVAA 2UUAQ 4IOAA 4BA1I 3S17H 4DR6L 3OTOL 4L5QA 5C0XI 2NVQH 2ASBA 1JB7A 5AJ3L 4LW1A 4LFBL 4GNXB 2E5LQ 3M3YH 1XPOA 4L5RC 3ULLA 4IJHA 4MTNA 4OWTB 4DV3L 2MFIA 3J7ZC 2OQ0A 1Y14B 3HOXG 3VDYA 4A3JH 4B3SL 2JA7H 1WFQA 4HIDA 2ATWA 3PIOA 4DV6L 1N32L 4FDBA 4A3FG 3AYHB 4TQUS 1QVGA 4AYBE 1J6QA 4O0AA 1XJVA 2B63H 1JT8A 4BA2I 4DR4L 1CKNA 4GN3B 1A63A 4LF4L 2UUBQ 4LF9Q 4IPCA 4A3MH 2ID0A 1J5EQ 2I5MX 5FLMH 4BBRG 3H3VI 4IPGA 1E1TA 4DV1L 1KD1C 1NMFA 3D31A 1YBYA 4DR1L 2UXBL 2E2JH 4P71A 1Q1EA 2WB1G 4JC0A 4KHPL 3S1RH 1K8GA 4J15A 4LFCL 1IBMQ 4NXML 2F52A 1N36L 4RMFA 1HNXL 3F2BA 4ME3A 4P74A 3GTJH 2UXCQ 1X9NA 1EYGA 4LNQA 4OXPA 4DK3C 4GN4B 1YZ6A 4GLXA 1HNWQ 3TS0A 1BBWA 2ZJRA 4OONA 4DR7Q 4QY7A 5FJ8G 3TREA 1A62A 2PNHA 5IP9G 1NJIC 3H0GH 2YU9H 1QVFA 4A3IG 1B7YB 1N9WA 2JA8G 1VQDA 1PVOA 5K36G 4OX9Q 3PO3H 3U4ZA 3J81j 1HNZL 2R7ZG 4A4IA 2IHFA 1JJ2A 3B6YA 3S16H 4X62Q 4JI8L 1PFSA 1A0IA 4JI2Q 4UPAA 1N8RC 2XTIA 1QZHA 1E1OA 4HJ8A 2AHOB
chains in the Genus database with same CATH superfamily
3D6CA 3ZJYC 4LF8Q 2I5LX 2ZM6L 1B9NA 4XXEA 1PH4A 1LTSD 3D4DA 3MHBA 2F0KA 1NNXA 1UUPA 4IZ8A 1BVSA 3EFXD 1SN8A 2ICEC 3AEVA 4OO1H 3PO2H 1B9MA 2E2JB 2IPKD 2RSNA 3TBIB 1PH3A 4TSSA 1X32A 4ID6A 1H9SA 1U9RA 2AWOA 3A74A 1H9KA 1II3A 1QNUA 2CFMA 2Q2UA 2HUGA 3QJYA 3GTJB 4NDXA 3HGBA 1K0SA 1NMGA 5GADC 2EJGC 1UE1A 1K28A 1EWCA 1ML0D 1PV4A 1VQKA 1O7IA 1BOSA 1O80A 2VL6A 3G48A 1VQAA 1PRTC 2A68C 2Q8IB 1IKMA 4NMZA 1RTNA 1ET9A 4PZ8A 3ND8A 1N36Q 1QUQB 5KYIA 5A2QL 3C46A 3NPPA 1PHJA 2D2CC 5IYCG 1HNXQ 1EYCA 2RDFA 2EVBA 2YTYA 2G9DA 3G6JB 1Y1WH 1JOOA 3L3OC 4B08A 2K5DA 3J7AV 1X3PA 3LWUA 4XQJA 4JYAQ 4DAVA 1SXTA 1NBWA 3RMHA 3PO2B 2A19A 4ME5A 3SEBA 5G3LF 1WTOA 3CCSA 4KMUC 4XQQA 2MP1A 5DNFA 2F1MA 3D0FA 4KY7A 1OXXK 4JI7Q 1D5XC 5LL6X 2RHQB 2M9VA 4UP7A 4IALA 1ILQA 1D5MC 2QGQA 3KBXA 4NXNQ 1I3QH 2PI2A 3T1HL 4JV5L 3TQYA 2L5TA 1SFOH 1CA5A 3CCLA 1S40A 1MSGA 1OXVA 3K58A 1PYBA 1K0RA 1Y1WB 1MD2D 3T56B 1YI2A 5LMNQ 3A56A 3I3CA 3J80L 3NBIA 5FKAC 4DV5Q 5JJIA 1E24A 5J3BA 5J1ZA 3OSOA 5IY0A 5LHY1 4YHHQ 1CK1A 2GVBA 3HOZH 1EUJA 3T16A 3KLWA 1DD2A 2KCCA 5M3MG 1E2WA 2OT2A 1DOLA 1TY2A 3KLRA 4MIUA 4N8FA 1HCZA 1QJOA 1U4MA 2LY7A 2ZXRA 5JJZA 5ELEA 1I3QB 2PQEA 4A3EG 1PH1A 1GHKA 4BY7G 1KXLA 3D3RA 1SFOB 4LJZC 2CH4W 2CQOA 2UU9Q 4RCOA 4S3SA 1ILPA 4KY6A 1WI5A 3CCJA 3WWVA 4YCWA 1UE6A 2NTSA 5FLXc 4XQNA 3K0YA 1GOZA 3NE5B 4APVA 2ZXOA 2VZAA 2WAQG 1ESFA 1F9RA 5C5MA 5C4XH 3HOZB 4DR6Q 3P1HA 1LABA 2AWNA 4K2LA 2F0FA 5IT9L 1FL0A 2KCTA 3P7JA 4C1NI 2VQEQ 1ZYRC 3TN2A 5FO8B 4N9PA 2R93G 4B3RQ 3VA5A 1JC7A 1PRTB 3MC0B 4DR2Q 3OW2A 4AYBG 5K5PA 1IXRA 4K5VA 2A73B 2V1CC 5JEAG 1CA6A 4KV6A 1MSHA 1VQPA 4AQYQ 1U4LA 1XTDA 1SYDA 4Y7NH 1PH9A 4IN3A 1CFMA 2H4OA 1IYUA 2VB2X 5FK9C 5ELFA 1LT6D 2SNMA 2L9HA 2EY2A 1ICWA 4A3IH 1A3VA 1ENFA 1YITA 2VS1A 4HJ9A 3K0XA 4H02A 4IURA 2B8GA 2Q2TA 2F0SA 4WRDA 5C4XB 3KYHC 3MEFA 2NZOA 5J22A 5LMNW 2JA7G 2UUBL 2IT1A 3JAMc 3NBHB 1EWIA 3I72A 4FF4A 1E2VA 2BA0A 1Q7YC 2I5HA 1SSOA 1U4RA 1YEZA 2BCOA 1EOTA 3CAMA 4KY5A 2JA6H 3N6RA 4A76A 4R9WA 1VQJA 4Y7NB 4TRDA 4FP5D 1M90C 2B2VA 4JI0L 1YHAA 2F4VQ 4GLVB 5JOBA 4A3IB 2D62A 2OQKA 3HOWH 2B29A 1VQOA 1EIHA 5LMUQ 1Y1VH 3BZDB 2PZUA 1GXDC 2NN6I 3HOUH 2Z4IA 2LXJA 3CCEA 2F3IA 2PZTA 3I70A 2BH2A 5GAHC 1X54A 3GTMH 5IIFA 2BDNA 5IGBA 1TWGH 1N34L 3I91A 3ULPA 2K52A 1MHWC 1KDBA 2JA6B 4YCUA 5IWAL 4OO1G 4V0BA 3PO2G 1YNXA 3GD7A 1TS3A 3MZ5A 1HTLD 3CHBD 5DLQE 2UXDQ 3D4RA 3E0EA 1SMXA 1Y8PB 4GOPA 1WTQA 1IBLL 2JA5H 1YVCA 4YCVA 2F3VA 1GUNA 3HOWB 3SXHA 2DY8A 4BS9A 1Y1VB 1QILA 3HOUB 4DN4M 3I4MG 4A93H 1NE3A 3VYUA 4JI4L 1WTWA 2OCEA 1L0YB 3HG9A 1MIUA 4JV5Q 5IOCA 1WTHA 1FGUA 3HOVH 5BN5A 5CORA 3GTMB 1NR2A 1G6PA 2NVYH 1Y1WG 1TWGB 2KCNA 3UE0A 2B2YA 1NAPA 2EQSA 3E3XA 1SNCA 2RHSB 3TP6A 1CSPA 4DXGA 2EY1A 1LLRD 1TR5A 3DXJC 1SLJA 5C3WA 2AKWB 2N55A 3KJPA 2NB0A 2PI2E 4LF7L 3CXCA 1I4RA 2QDBA 5T1IA 3M4OH 2HQLA 3RN2A 4ILWA 2JA5B 4GKJL 4O2DA 4FVMA 4PZ7A 2UUAL 2DGYA 3EIVA 4OELB 2Q8TA 4G7ZC 4DAMA 4A93B 1STNA 4KTAA 3PIP3 1WVLA 2L12A 2EOTA 2N8NA 1D1KA 2VY3A 3HOVB 5EAYA 1SROA 1YNND 1Z7TA 5JEAJ 1G8ZD 2NVYB 4C2MH 1S5FD 2WKCA 3NEMA 1P8LA 2XRSD 4LF9L 3HKSA 3CD6A 1L0XB 3I7FA 1EY6A 1BBUA 2Y0SE 2HD3A 1H9JA 3HOZG 1I50H 3E9HA 4IUUA 2KENA 3CKIB 3FMCA 2BDOA 2D0OA 3PUVA 1HNWL 5DAUA 3PF5A 4EQNA 4A3BH 1ZKOA 1GVPA 4ALPA 1LACA 1EQQA 4CKCA 3TZDA 2O4XA 4DV0Q 4GOPC 3M4PA 1ET6A 2A8VA 1U0LA 3NENA 3ULJA 3QIAA 3K6OA 1D8LA 1G6ZA 1AP0A 4XIGS 1KRTA 4M1UB 3RN5A 2LMCB 4C2MB 3J81i 1JJCB 3GDEA 1E2ZA 1L1OA 3MFYA 4BA1I 3S17H 3RUZA 4L5QA 4N9TA 2NVQH 1VF7A 1VF5C 2K33A 4LW1A 3MVVA 4JW0A 2E5LQ 4QIWB 1XPOA 4ZUJA 3OIQA 4IJHA 4OWTB 3J7ZC 2OQ0A 1Y14B 2HCCA 1I50B 2ATWA 1QNKA 2EPBA 1ZXTA 3AYHB 3TZUA 1XJVA 1JT8A 1PXUA 4GN3B 1S5DD 2UUBQ 1BQQT 4IPCA 2I5MX 3NTIA 4A3BB 3I90A 2O5JC 1SMYC 2CQAA 5I4DA 1KD1C 2JYOA 4P71A 3HZXA 4K6LA 4IUNA 3NP8A 2J7ZA 1K8GA 2L55A 1BR9A 4J15A 1IBMQ 1QG7A 2F52A 1N36L 1LT3D 1HNXL 4ME3A 1EYGA 1BBXC 2O2LD 4GN4B 3Q24A 1JB3A 3SK8A 2ZJRA 1DZ1A 4F7XA 4KK7A 3S17B 4E6IA 2YU9H 1HHVA 2NVQB 1PVOA 4A3IG 3SR1A 1VQDA 4OX9Q 3T51B 3NUCA 4PMCA 4OEMB 4A4IA 2B39A 3S16H 2DJFC 1HPCA 4UPAA 4JI7L 2AHOB 2KHJA 4Q5VA 1J8IA 4CBVA 1KLGD 2XWJB 3AFQA 3KLSA 1HZBA 1GD7A 4OIKA 4KJNA 5AJ3Q 4IUTA 2IL8A 1IZ6A 4NXNL 5IYBH 3EJIA 4HN7A 1MJCA 4C3HH 4B3SQ 2JA6G 4JOIA 1LM0A 4X6AH 5IWAQ 2HQEA 4H7BA 4DA2A 3K81C 1FNWA 5LMNL 3QR8A 1HZ9A 5E4WC 4ZKBB 2OTLA 2YU9B 3RLNA 3KDFA 1I94L 2ICIA 1W6KA 4DV1Q 4DV5L 4HJ5A 3HOWG 2B2UC 4DR1Q 2UXBQ 1V1PA 3DEOA 4YHHL 2IJ0A 1X56A 1LYLA 4KHPQ 1LTLA 1Y1VG 3HOUG 1I4QA 4H13C 5L37A 1TWAH 3S16B 4X3TA 1NTGA 1AEXA 1EQTA 3D4WA 2LKVA 1SNQA 1U5KA 5BN3A 3AU7A 3CCRA 2GN5A 1V9PA 3H15A 2BOSA 1A2UA 2VW9A 1EU3A 3MFGA 4GOPB 1HNZQ 3NK9A 1VQ8A 4C3HB 1XPUA 3OIPA 1X65A 2HIXA 2WKDA 4NP5A 1FGBD 3U58A 1V43A 3CPWA 1F9PA 2X69A 1BCPD 2XRQD 4IJLA 2MO0A 2NN6H 2JA5G 1SJED 3L9AX 1HUNA 5CV9A 5F2DA 2N88A 5JJLA 1TWAB 2A1AA 3H6MA 4A93G 1S3OA 2R6GA 3MXNB 4C3IH 1OTCA 2VQEL 2QKIC 1VQMA 1D6EC 1SE2A 3NTKA 4ZKCB 3HOVG 2D0PA 1D1IA 2K5WA 3BVGA 4B3RL 4J1MA 2KVMA 4DR2L 1NUCA 2R92H 3NSWA 2D5DA 1NCVA 1TXYA 1VQ5A 4AQYL 1VMPA 1F2LA 1BCPC 2NVTH 2K7VA 3TRZA 2Y0SG 2K1BA 3PIPA 5C3EH 1MKHA 3F8TA 2C35B 2EIFA 2V4DA 1B4OA 4IPHA 2H5XA 2ENBA 3RZDH 4G4KA 4DKAC 3J80c 3PSIA 3ND9A 4L6TB 4A3CH 1PRTD 2QDLA 1B2TA 3CMAA 1D7QA 4C3IB 1SYBA 1H9RA 1HA5A 1NR4A 3URYA 2B2WA 2RCFA 4DGZA 1O78A 2Z4HA 3A5UA 2F4IA 4PQXA 2R92B 2KOLA 3HOXH 3HRZC 1B70B 1Q82C 1PA6A 2JP1A 4PV1C 3DLLA 4OGQC 5FLXE 2NVTB 4YY3Q 2YYZA 4ZYSA 4B3ML 5HY6A 5C3EB 4BBRH 3CCVA 4DV7Q 2F4VL 2NWGA 2LFNA 2WACA 1STAA 2VXWA 1HR0Q 3RZDB 3HS0C 3PIO3 5LMUL 4A3BG 4M8AA 3K80C 1C7YA 1DM0B 2JK8A 3RLOA 3I4MH 4DV2Q 3CW2C 4Y52H 4KKSA 3TS2A 1KL9A 4LWCA 3RR5A 5EKIA 5ELBA 3G4SA 2KEDA 4RWSC 3I8ZA 3K59A 2HDLA 5K36H 4FXDA 5IT9c 2QEJC 5CV7A 4UY8C 3PF4A 3HOXB 2N3SA 4LUZA 2Q8RE 5I6WA 3A8JE 1XMQQ 1BO0A 1Q3LA 5EPLA 4JBMA 1KABA 2B63H 1Z9FA 1TWCH 2UXDL 4RH6A 1KQSA 2EYOA 3SE0A 2IY5B 4H44C 4BBRB 3ERSX 3Q8DA 1RHPA 2EYPA 3VA7A 4KHVA 3J81L 4JVZA 4CDEC 4CKBA 1VQIA 2N78A 4KN4C 2NVXH 4IUQA 1IW7D 1QVCA 3I4MB 3JAME 3WOEA 1HQRD 4K5WA 1WOCA 3NWSA 3CC7A 2PW5A 2UUCQ 2EYLA 3KUPA 4WJWA 1Y8NB 4R4IA 1AE2A 5ELNA 1F9SA 1IL2A 1H9MA 1AH9A 1MGSA 1F2YA 4H0LC 3MXPA 1I94Q 5IYDH 2B2WC 1TS5A 1BCPB 1EOVA 2CWAA 2K50A 3QO2A 4B3TQ 1JOQA 2JXMB 3U9SA 5IGGA 2B63B 1TWCB 2CVRA 4ODGA 3MAQA 4EQ5A 4PG3A 2F0TA 3BVMA 3HEJA 4ZK9B 1ZYRD 1JQYD 4KLKA 4HJAA 2F0WA 4MNOA 3D8GA 1B3AA 4JK1C 1JMCA 2NVXB 4QQBX 1IW7C 2C9OA 5IYBG 3GTKH 3KDFB 1RDPD 4C3HG 2E8GA 2OWOA 1QOHA 2IX1A 3VYSA 5E7NA 2Q2HA 4DR5Q 1M1KC 1HR0W 5C44H 3CF5A 3GTGH 2KEEA 1FVIA 1ICFB 2E75C 1CQVA 4U68A 2EXDA 1XTCD 3QWNA 1LT4D 2ZTDA 1X3GA 4QCLA 1JE5A 3DM3A 3FVQA 3TP7A 4POGA 3TP5A 3GQBA 3KF8A 4L5TA 2B3GA 2CKZB 3L7ZC 2BH8A 5M9OA 3KF6A 5COYA 1LT5D 3EBEA 3GTOH 4IUPA 4A3GH 1ZEQX 4DV0L 3GTKB 4PNYA 3RNUA 1BXTA 4DXFA 3E0JA 1ESRA 4EGVA 1X3FA 3M7NA 5ISRA 5DM63 1RTOA 2F0PA 1XXGA 3GTLH 3FEWX 3MTSA 5GAGC 5C44B 3UE1A 1M8AA 3GTGB 3I55A 5EPJA 1SR3A 1LTGD 2NN6G 1DOMA 4X64Q 1PYWD 2E5LL 4HEDA 1I5FA 4ZLTF 1PFMA 1KAAA 1CKMA 4I7ZC 1CKNB 2K75A 4C56C 4CGYB 2L1BA 4LF6Q 5D65A 3T1YQ 1EWHA 4C3IG 3K5LA 4YWLA 1I4GA 2NZHA 1IKLA 5CV4A 1YIJA 4BWGB 2PQAA 1EIFA 4K14A 4FF3A 3GTOB 1X6OA 2R92G 4I7AA 5IP7H 3S1MH 4A3GB 5G3LD 1EQVA 1IBML 3S24A 5JJKA 4N8X1 5KNCA 1KAWA 3VR2A 3R93A 3GTLB 2DY7A 3T13A 4DNIA 2A6HC 1EYDA 1WTRA 1SE4A 5C3EG 3AMUA 5EPKA 4B3MQ 4ZRZA 1O7ZA 4XYOA 4OX9L 1E22A 4G7HC 2B2TA 3Q0AA 2JEAI 2PO4A 4KI0A 4K8JA 4A3CG 2HHHQ 5M5XH 4JCVE 4C3JH 1G291 3G71A 2GVAA 4FXKC 2KECA 4P2CB 5C0XI 2ASBA 1JB7A 1D2BA 5AJ3L 1BNZA 3S1MB 1H9SB 2MFIA 3HOXG 3VDYA 4A3JH 4WFN3 4B3SL 3PIOA 4FDBA 3SK5A 4O0AA 4DK0A 4F87A 5NUCA 2IX3A 4TKOB 2SNSA 4A3MH 2RDHA 4BBRG 3H3VI 5DM73 2Z6BA 1E1TA 4DV1L 4DR1L 2UXBL 2WV6D 5HGTA 3EA6A 1LV9A 4F88A 2EZVA 4KHPL 3P20A 2A69D 4L63B 2RSOA 5M5XB 1RJTA 3KBGA 2L0CA 2OF1A 1G2SA 3SHLA 4C3JB 1X9NA 4LNQA 4OXPA 4DK3C 5KGUA 1YZ6A 1B3QA 4OONA 1A15A 1G2TA 2L4NA 1A62A 2PNHA 3H0GH 1N9WA 1EY0A 3OPOA 4CDFC 5K36G 4KD3A 1EYAA 3J81j 1FNVA 1Q90A 1HNZL 4DNRB 2R7ZG 4A3JB 1V1OA 1JJ2A 3K57A 4X62Q 1N8RC 2XTIA 1QZHA 1E1OA 2F0VA 3SDZA 1U4PA 1S4ZA 4MN3A 2B63G 2B8FA 4JI6Q 1PTOF 5KNDA 4A3MB 3OTOQ 1QCBD 1CSQA 4G57A 1STGA 2R7DA 3QB3A 3GP7A 1PH5A 1SE3A 2F03A 3VR5A 1LTAD 2XWBB 3EN2A 4HR7B 4DU9A 5JVH3 1N32Q 2A69C 3M85A 2F0OA 2I07B 1UE5A 2B2VC 4ZCKA 5CMDA 4LF4Q 1PH7A 3E6ZX 4KN7C 4LK1C 3JAML 1ASZA 2EYFA 2I0QA 3R8BA 3H0GB 4POFA 2QEXA 3A54A 3KLSX 2O5IC 1Q12A 3ZYYX 1KC8C 5IYDG 4L8JA 1VQEA 1XPRA 3HOYH 4QB4A 3PMFA 2K5HA 4J6HA 3CCMA 2Y0SB 3CP0A 2DUDA 3M4OB 1XNQQ 5E3FA 4CJ1B 3X3NA 1EY7A 4HAEA 5EQ0A 2WINB 1OXSC 1ENCA 3OMGA 2K28A 4K8IA 4JI8Q 1SMYD 3TP8A 3WOFA 5EKKA 1KHIA 2ZTCA 1S72A 3MEHA 1E3PA 3PUWA 3DMUA 2OTJA 4DUZQ 4UDUC 3Q23A 1EIYB 4DNTB 2VNUD 2RKSA 4R4OA 4LF5Q 2DNCA 2K5NA 5C44G 3BZKA 4QF4A 3LGJA 3N52A 2FJ2A 2Z6KA 2DJGC 3LX0A 3C1EA 3NQTA 2JSOA 3M7GA 3HOYB 2KHIA 4YY3L 4QUFA 4DAPA 2B2YC 3NWTA 4DV7L 1MJEA 2L11A 4IFDI 1VQ7A 4JBWA 1HR0L 2JE6I 1PZJD 4HJ7A 1PFNA 1I6HH 2LXKA 5IGDA 3RZOH 1K8OA 1E7ZA 2XNAC 4A3GG 1PLFA 4DV2L 5EGTA 1VQ9A 1X55A 3E5SA 1QUQA 1FJGQ 3STBC 1SE8A 2KHSA 3Q22A 4JI3Q 2K6AA 2RCNA 4O42A 1SNOA 1SYEA 3LWEA 3M4QA 2MO1A 1PZID 4MZ9A 3K5OA 4FF2A 3I4LA 1XMQL 4LUOA 2PQAB 3FDTA 2E76C 4NKLA 3GTPH 2CWPA 2WP8J 2FMMA 4RG1A 3W2DA 2HDMA 1BF4A 2OEOA 3KFUA 2FINB 1CHQD 1I6HB 2Z8LA 1KRSA 3C1FA 3CCQA 3RZOB 4DR3Q 2ZJQA 1QB5D 5IP7G 3I56A 2ZJPA 1VQNA 4GLAC 1NY4A 1EY5A 3FRPB 3KOJA 2P5ZX 1SYFA 5M3FG 2UUCL 3H3VC 4JBJA 1XWEA 1SYGA 1SBBB 4I65A 1J9OA 1A3TA 3F1ZA 1JE4A 2K03A 2YV5A 1T5XD 2K5QA 4LAAA 4XT3B 1GUSA 1ONLA 2F0MA 4A75A 4KKTA 4GN5A 2GA4B 5E4XA 5M5WH 4B3TL 1K83H 3EVQA 2AQ3B 4K0KQ 4FO2A 2MQHA 3GTPB 4RFBA 1L1OC 5IP9H 4HSVA 1PMRA 2JA8H 1DONA 1SYCA 4C3JG 3IAYA 1MBYA 1CZWA 1UNSA 1XNRQ 4OHJA 2KQ3A 2L15A 3ICEA 1TS2A 4HIKA 3SK6A 1WYDA 1OXTA 1Q1BA 1Q81C 2G5DA 4A3JG 1YJ9A 3MXGA 1PTOC 4UP9A 1C48A 4FF1A 5JPNC 3WDNA 3A8KE 1FYCA 2AUKA 4DR5L 5IT9E 2ZTEA 5IGCA 1K9MC 1GUWA 5LL6S 2WB1E 1B8AA 2IX0A 2HT1A 4A3MG 1S5BD 5CGKA 1K3BC 5T1GA 2WB1B 3DM1A 4YWKA 4ZQ3A 2I46A 3MWYW 1JOKA 1STBA 1PH6A 1CQFA 2ZT9C 1KDAA 5HURA 5M5WB 2F0NA 1K83B 4K6DA 2XN9C 5C0XH 2CH4A 4X3UA 4P73A 5EJWA 1W3SA 5I9PA 5IGFA 2JA8B 3S15H 3O13A 2RVLA 2SEBD 3NHHA 4UAIA 3CPFA 3EROA 4KD4A 3H0GG 1JWMD 3KJOA 3CRKC 1ENAA 4A3KH 4TVAB 2WAQE 2KUMA 1KIXA 1GO3E 3FKIH 4XTCS 3J81c 1TU2B 4CHTB 4X65Q 3H3VH 3PGZA 1DYQA 4JI5Q 4X66Q 1SEBD 1AN8A 3V96A 1Q46A 1CKOA 4MTKA 1HZAA 4WJ3M 4ULLA 4P72A 2WFWA 3FHWA 2LSSA 1PDQA 1AW7A 2FHTA 1B50A 2PYKA 3PUZA 4X64L 2EXZA 5JPMC 2HIVA 3QOLA 4JOIC 3OWFA 4RA8A 4DUYQ 1STYA 1WD1A 2M00A 2EYMA 1JWSD 4FXGC 5BR8Q 2KBNA 2NZ1D 4XDXA 1UEBA 4LF6L 1TVXA 2NTTA 1LUZA 2MNAA 3MA2B 3T1YL 1WTXA 1N33Q 1UEAB 3Q6SA 3S15B 4DK6C 1KNAA 2DN8A 1TKWB 1VQCA 4FYDA 1HXYD 3GO5A 2K05A 3TEHB 2HCIA 2TSSA 4KHZA 1YJNA 1DOKA 3J7YW 4A3KB 4QUCA 1PTOH 5AFWA 2K32A 3FKIB 4BXXH 1TQOA 1CT1D 5ELDA 1QZGA 2RA4A 2JQOA 4CDDC 2MGSA 3G7LA 3SGIA 1HFGA 3HOYG 3VR3A 1EY9A 1HQMC 4BY1H 2M2LA 1SRUA 3W1BA 1JICA 4JI1Q 1PFBA 3DWQA 2IW3A 2Q2IA 3AQQA 1JORA 1H95A 4CJ2C 4HCSA 3H09A 3AFPA 1G91A 2PCFB 2R61A 1DGSA 5I2XA 2OXPA 3HFZB 2F0GA 2HHHL 1L1OB 4OWWB 1GHJA 5CBEE 1CHPD 2EJFC 3PUYA 5I9OA 4XYQA 1F2ZA 5KRUA 4GKKQ 5FOBB 3T53B 4KJOA 1EFID 1LTBD 3F2CA 4NPSA 3KK7A 1F77A 4HIMA 2VUMH 4R1JA 1PZKD 5CV6A 1PTOB 2C5CA 4LMQD 4RCNA 2R7ZH 1XYIA 3CC2A 3BU2A 1NSNS 5IGEA 3D6WA 1LTTD 3PUXA 2ALYB 4BY1B 1IHZA 2F0IA 3JAMi 1OXUA 1YJWA 3K8AA 3UI2A 1RCVD 1FNUA 3R2TA 3DEPA 4RGOS 4HCEA 1V1QA 1O7LA 2QCPX 3U50C 3K5NA 3F2UA 3UDIA 3SK4A 3BYTB 4OL7A 4NB3A 2K5VA 4DAYA 3CC4A 2YTXA 1R9TH 3FP9A 5EKLA 3L2PA 2DNEA 2EYHA 1BKBA 2K4KA 3U9OA 3CQZH 3A8IE 2Z0SA 2VUMB 4R4CA 5CV8A 2BA1A 3W1GA 2R7ZB 1XMOQ 3VR6A 1I6VC 4X62L 3J7A5 2CCZA 4IFDH 2F0JA 1DJRD 4ABNA 4JI6L 2VQFQ 4IOAA 1AE3A 1JCKB 3ONAB 2EJMA 1Z6HA 3OTOL 4F8MA 2X6LA 2F0UA 2IWHA 4CDCC 5C4HA 3IFDA 3A7AB 3BG3A 1RF2D 1WFQA 4HIDA 1N32L 3GV3A 5IODA 5ELCA 5A35A 4BA2I 1A63A 3V05A 1R9TB 4LF4L 2NUCA 1J5EQ 5FLMH 1V1PB 4IPGA 2NYZD 1WTVA 3CQZB 3D31A 5FO7B 3IL8A 4DFAA 2WB1G 1FD7D 3S1RH 4RMFA 5TSSA 3H94A 1E0BA 3TS0A 1BBWA 4DR7Q 3X3MA 4QMGA 4QY7A 1XNQL 2SDFA 5IP9G 1NJIC 2R3ZA 1QVFA 2JA8G 1B7YB 3TSSA 3PO3H 1B44D 5CBAE 3OW7A 1O7YA 1EEFD 2JN4A 1PFSA 1T5EA 4JI2Q 4JI8L 1VQ4A 4HJ8A 2K01A 2XVSA 1YNJD 4YWMA 4DUZL 1VQ6A 5EBDA 3H91A 4LFBQ 1ASYA 4LF5L 1GKHA 1SNPA 2FXQA 3I73A 3S1NH 2A6HD 1TT2A 1RODA 4HMIA 4LFAQ 4DV3Q 1GUOA 3VYTA 2Z1CA 4DV6Q 3S1RB 1DCZA 2JJQA 4A3DH 2AQ2B 4DR4Q 1FR3A 1GJXA 1JJGA 1MI2A 5C0XG 1EZ8A 2AQ1B 1B1ZA 2WIIB 3EQLC 4DV4L 2EY6A 3PO3B 5D3DA 3OYYA 1RKNA 5KEEA 1IYVA 2A6ED 1F2MA 3ERQA 4NXMQ 4LFCQ 3A7LA 1JWUD 4A3KG 3HKZE 4RAUC 3OHXC 3OMCA 1Q8KA 3FKIG 1I4PA 4B9WA 1HJPA 4A3LH 3HKZB 1YNJC 3OWEB 1FJGL 1PH2A 2F0EA 4IQZA 1WCMH 1WTPA 5M3FH 4GS3A 2PMZE 1PYSB 2RF4A 2JA9A 1GUGA 4JI3L 3S1NB 3BDLA 2PMZB 3ITPA 1WD0A 4PZ6A 1IBKL 3QOJA 4R4QA 4HSPA 2BE5D 1EZ6A 4A3DB 1R4PB 1RL2A 2ZM6Q 1CTMA 1KNEA 3JC66 4HMJA 5GROA 4R8IA 3BZCA 1L0WA 3UDXA 3J7AF 3PCOB 1HZCA 1TWFH 2XSCA 1PH8A 4NW2A 1VQGA 5GQOA 2NBFA 2A6EC 4ZUIA 3T4AC 3NTHA 4JBKA 5C4JH 4DR3L 1VQLA 2J4XA 3V2TA 4R4TA 4B9XA 3R2IA 4BXXG 5CYUA 4IO9A 4L5SA 1XX8A 1Q86C 4LUVA 1WCMB 5CR3A 5M3FB 4EQPA 4BY1G 1SDFA 3C3LA 4RHSA 3IRBA 3I4OA 3K5MA 1STEA 5FLXL 5C5LA 3W3AA 2XGTA 1YHQA 5JAVA 5KYLA 2BE5C 4J8QA 5M5YH 1HTPA 1HH2P 4K0KL 1L2FA 1C0AA 1UWVA 2QILA 2CHBD 2FMCA 1UE7A 4UP8A 2MHVA 4EX5A 1TWFB 2JEBI 3I4NH 2F0QA 3G6EA 1XNRL 3HP3A 5C4JB 2VUMG 2K04A 1B53A 1Q8IA 3QG1A 2IHEA 1A8VA 3BYYB 3VR4A 2R7FA 3BVZA 2TMPA 4DAYB 3T1HQ 1EL0A 4QGUA 4A3FH 2ZXPA 1M4VA 5M5YB 1CI3M 1W6JA 5J39A 3E9IA 2PW7A 4GNXA 3MXNA 3MXUA 5IE8A 4K5XA 3A5ZB 3I4NB 1A6XA 1T9HA 2B2TC 3CMEA 1V8QA 2E2HH 4AH6A 1VCIA 3IFTA 4O1NA 4OO1I 1KLUD 1KDCA 4ZAIA 4G7OC 4X65L 2F3WA 5FJ8H 4JI5L 4BBSH 4IFDG 4X66L 5BN4A 3BS1A 1EY4A 1YHBA 4OWXB 4PMWA 1LO5D 2XIWA 1CUKA 3GV6A 5D14A 2E2DC 3CRLC 3S9WA 5JVG3 4Q0FA 4A3FB 4JPBW 5ELOA 4RGNA 2E74C 5I6YA 2FFKB 5C0XJ 5H1SE 2F0HA 4DUYL 4HIOA 1RIPA 1SAPA 1VQHA 2AMCB 2PPBC 5BR8L 4CJ0B 4RGTA 1X3EA 1EY8A 1N33L 5FLMG 3STBD 3M9BA 1X3QA 2X6GA 2D9UA 2QA4A 4MHEA 2E2HB 4C1NK 3TDQA 1SNMA 2UXCL 1BCPF 3L0OA 1HFNA 4RHRA 3DHQA 3KF8B 3KF6B 4XT1B 4BBSB 2YTVA 1STHA 4P75A 3M4YA 1K3RA 1P16A 5A2QE 4JI1L 2KCMA 2B2UA 5C4ZA 1QWYA 3PO3G 5GAEC 4DV4Q 1YNNC 2AUJD 5IYCH 4LF8L 4DPGA 4QIWE 1K8MA 3BDOA 3A0JA 3F2DA 1HUMA 1SNDA 1GUTA 2QW7A 1EFWA 2A74C 3HKZG 4KKUA 3CCUA 4QJFA 4K2KA 4GKKL 5C4XG 1DXMA 1JR0D 1RD9D 5CV5A 4DF7A 2EYJA 1LTRD 4OIJA 3S2DH 3J81E 3K7AH 1TWHH 1SJHD 4GNXC 3W5OA 2N49A 3J80i 2E2IH 2PZWA 4QL5A 1I4HA 4JG2A 1IBKQ 4A3DG 5C3XA 1VQFA 1QE6A 2QF7A 3PQIA 1IYJB 2ES2A 3UDFA 1PRTF 3J80E 1EQRA 3R3OA 4RKLA 3S2HH 1W2BA 1AZQA 4JI0Q 5HGQA 1AZPA 2RQXA 4JYAL 4AIMA 3VYRA 4WORA 4A3LG 4IOCA 1PTOD 3GTQH 5KIXA 1WCMG 1K8AC 1BDOA 2EDGA 2J0TD 3S2DB 5E1FA 1S5CD 3K7AB 1TWHB 4IPDA 5M3MH 4UHVA 2E2IB 1C4QA 2VB3X 2Z9HA 1XMOL 1HRJA 3K7UC 1WJJA 5D3IB 1N34Q 2K14A 1IL8A 3UDGA 2VQFL 4A3EH 1K73C 4BY7H 4X3KA 3S1QH 2F0DA 1UAPA 1C9OA 3ER0A 2Z6KC 1BUVT 2A5HA 3S2HB 1I4XA 3LNNA 1IBLQ 4V190 2F0LA 3BJUA 3U4VA 1D5ZC 2MUYA 3GTQB 3I2ZA 1J5EL 3S14H 4X3SA 3DUZA 1R4QB 1EEID 3NELA 1VDZA 1KTKA 4JI4Q 4IFDJ 4YIJA 5M3MB 2EY5A 3RLFA 1EU4A 1CZGA 1GM5A 3DWPA 2R93H 4U673 4HTHA 3NQIA 4WJ4A 1S5ED 3A55A 1LTID 4DR7L 4A3EB 4BY7B 5JEAH 1TY0A 3S1QB 3AB9A 1VS0A 2UU9L 3I4NG 5CC4A 4LF7Q 4FNFA 1CM9A 3C2PA 4IUVA 2LS01 4R8NA 4JI2L 1VQBA 1EIGA 3FPUB 2G9HD 4PMBA 4GKJQ 1G51A 3PV0A 2SOBA 2RBMA 1AFPA 1Z47A 2MJ8A 2UUAQ 2CW0D 4DR6L 2WAQB 3S14B 2KA7A 1Y8OB 2KJXA 4LFBL 1Y69U 4GNXB 1TS4A 3M3YH 4L5RC 3CU7A 3ULLA 4MTNA 4DV3L 4LFAL 3OOCA 5DEHA 2JA7H 4EQOA 4DV6L 5FO9B 4A3FG 4TQUS 1QVGA 2H1EA 4AYBE 2R93B 1J6QA 4RGMA 3IKJA 4GZYC 4DR4L 1CKNA 5KNBA 4AYBB 3RD4A 4LF9Q 4EVOA 2ID0A 5EBCA 1OO9B 3TMEA 4Z9CB 3DWAA 1TIID 1NMFA 3NBHA 1YBYA 2E2JH 1Q1EA 3SVMA 4JC0A 1C8CA 2RDGA 4LFCL 1F9QA 4NXML 1HA6A 1A2TA 3F2BA 4P74A 3GTJH 2UXCQ 1HNWQ 4GLXA 4DK1A 4RKBA 2CW0C 5I2YA 5FJ8G 3TREA 4BBSG 3FPPA 2A68D 5C6AA 3M3YB 1A3UA 3U4ZA 4CKEA 2PNRC 2EE1A 3P75A 2JA7B 2IHFA 3BDCA 3B6YA 2MPMA 1A0IA 3NXWA 1VMCA
chains in the Genus database with same CATH topology
3ZJYC 2KHJA 4LF8Q 2B63G 2I5LX 2ZM6L 4JI6Q 1PH4A 4YWMA 4DUZL 3AFQA 1VQ6A 1HZBA 3OTOQ 1GD7A 1BVSA 3AEVA 1SN8A 5AJ3Q 1ASYA 4LFBQ 1CSQA 1GKHA 2FXQA 4LF5L 2R7DA 3S1NH 1IZ6A 4NXNL 3PO2H 4LFAQ 5IYBH 4DV3Q 1PH5A 1MJCA 4C3HH 4B3SQ 2JA6G 1PH3A 3EN2A 4DV6Q 1N32Q 4JOIA 3M85A 1LM0A 2JJQA 4A3DH 4X6AH 5IWAQ 1UE5A 2AWOA 3A74A 2CFMA 1XNQL 2Q2UA 3K81C 4DR4Q 4LF4Q 1NMGA 5GADC 5LMNL 1UE1A 1PH7A 1HZ9A 1JJGA 5C0XG 1PV4A 1ASZA 1VQKA 1O7IA 2OTLA 3G48A 2VL6A 3KDFA 3RLNA 1I94L 4DV1Q 4DV5L 4HJ5A 4POFA 2I0QA 1VQAA 3HOWG 4DV4L 4DR1Q 2UXBQ 2QEXA 4YHHL 1X56A 1LYLA 3OYYA 4KHPQ 1LTLA 1Y1VG 1Q12A 3HOUG 4PZ8A 4NXMQ 1TWAH 1KC8C 5IYDG 4LFCQ 1N36Q 1NTGA 1QUQB 1VQEA 3HKZE 4A3KG 1XPRA 3HOYH 1HNXQ 1PHJA 5IYCG 1Q8KA 2YTYA 3FKIG 1Y1WH 2K5HA 1HJPA 4A3LH 1U5KA 3CCMA 3CP0A 2DUDA 1FJGL 1PH2A 1XNQQ 3CCRA 2GN5A 1WCMH 1V9PA 5M3FH 3H15A 4GS3A 4JYAQ 2PMZE 2VW9A 1PYSB 2RF4A 2JA9A 4JI3L 1NBWA 4GOPB 2A19A 1HNZQ 1VQ8A 1OXSC 3CCSA 1XPUA 4PZ6A 1X65A 4JI8Q 1IBKL 2HIXA 3D0FA 4R4QA 1OXXK 1KHIA 1V43A 2ZTCA 3U58A 4JI7Q 3CPWA 1S72A 1RL2A 1E3PA 3PUWA 2ZM6Q 2RHQB 4IJLA 2OTJA 4DUZQ 2MO0A 3JC66 1EIYB 5GROA 4UP7A 2VNUD 3BZCA 1L0WA 3UDXA 2JA5G 4R4OA 4LF5Q 2K5NA 5C44G 3BZKA 3PCOB 2QGQA 4NXNQ 1HZCA 1TWFH 1I3QH 1PH8A 5JJLA 2PI2A 3LGJA 3T1HL 4JV5L 1VQGA 3TQYA 5GQOA 1SFOH 2Z6KA 3CCLA 4JBKA 5C4JH 4DR3L 1S40A 1VQLA 2A1AA 4A93G 1OXVA 1S3OA 2R6GA 4R4TA 1PYBA 3MXNB 2KHIA 4C3IH 1OTCA 1K0RA 2VQEL 4YY3L 4BXXG 1YI2A 5LMNQ 1VQMA 4IO9A 3HOVG 2D0PA 4L5SA 4DV7L 1Q86C 4LUVA 1MJEA 4B3RL 4DV5Q 1VQ7A 4IFDI 5JJIA 4DR2L 2R92H 1E24A 4JBWA 4BY1G 5J3BA 1TXYA 1HR0L 2JE6I 4HJ7A 1VQ5A 5IY0A 4YHHQ 1I6HH 3IRBA 2GVBA 3HOZH 2LXKA 3I4OA 1EUJA 3RZOH 1E7ZA 2XGTA 3KLWA 4AQYL 1YHQA 4A3GG 4DV2L 5M5YH 1VQ9A 5M3MG 2NVTH 3TRZA 1X55A 2Y0SG 3PIPA 1HH2P 4K0KL 1QUQA 5C3EH 1FJGQ 3STBC 1L2FA 1MKHA 1C0AA 1UWVA 1SE8A 2C35B 2EIFA 3F8TA 4IPHA 1UE7A 2H5XA 4UP8A 4JI3Q 4EX5A 2JEBI 2RCNA 3RZDH 1PH1A 4DKAC 3J80c 4A3EG 3I4NH 1KXLA 4BY7G 3M4QA 3G6EA 1XNRL 2MO1A 3PSIA 4MZ9A 1XMQL 4A3CH 4LUOA 2CQOA 2UU9Q 2VUMG 2PQAB 1D7QA 1WI5A 3CMAA 3CCJA 3WWVA 4YCWA 1UE6A 5FLXc 3GTPH 2CWPA 2IHEA 2WP8J 1A8VA 4RG1A 4APVA 3A5UA 2R7FA 3KFUA 4DAYB 3T1HQ 2VZAA 2WAQG 3HOXH 1KRSA 4QGUA 4DR6Q 5C4XH 1B70B 3CCQA 1Q82C 4DR3Q 1PA6A 2ZJQA 4A3FH 2AWNA 5IP7G 3I56A 3DLLA 2ZJPA 1FL0A 2KCTA 2VQEQ 3E9IA 4YY3Q 4GLAC 1VQNA 1NY4A 2YYZA 3KOJA 4B3ML 5HY6A 4GNXA 4BBRH 3CCVA 5M3FG 4DV7Q 2UUCL 4JBJA 2F4VL 4B3RQ 2R93G 4DR2Q 3OW2A 4AYBG 1HR0Q 5IE8A 3A5ZB 1IXRA 1T9HA 3F1ZA 2V1CC 2YV5A 5LMUL 5JEAG 4A3BG 3CMEA 1VQPA 3K80C 1C7YA 2E2HH 4AH6A 1VCIA 2JK8A 4AQYQ 3RLOA 1XTDA 4Y7NH 3I4MH 4DV2Q 4OO1I 3CW2C 4A75A 1PH9A 4Y52H 4GN5A 5M5WH 4B3TL 3TS2A 1K83H 1KL9A 4LWCA 3RR5A 4X65L 4K0KQ 2MQHA 4LFAL 3G4SA 1L1OC 5FJ8H 4JI5L 5IP9H 4BBSH 4IFDG 4X66L 4A3IH 2JA8H 1YITA 5IT9c 2VS1A 4HJ9A 1YHBA 3K0XA 4H02A 4OWXB 3PF4A 4UY8C 4PMWA 1XNRQ 1CUKA 2N3SA 4LUZA 2Q2TA 2L15A 3ICEA 3KYHC 1XMQQ 4HIKA 3MEFA 1WYDA 1OXTA 1Q1BA 2NZOA 5ELOA 1Q81C 5C0XJ 4JBMA 5H1SE 5LMNW 4DUYL 4HIOA 4A3JG 1RIPA 1YJ9A 2IT1A 2UUBL 1Z9FA 1TWCH 4UP9A 3JAMc 3NBHB 1EWIA 1VQHA 2AMCB 2UXDL 5BR8L 1KQSA 2IY5B 3ERSX 3Q8DA 4DR5L 1X3EA 2ZTEA 1K9MC 1N33L 2BA0A 2WB1E 1B8AA 1Q7YC 2IX0A 2I5HA 2HT1A 4A3MG 1YEZA 5FLMG 3CAMA 3M9BA 3STBD 2JA6H 4YWKA 1VQIA 2N78A 2QA4A 4A76A 2NVXH 1VQJA 1PH6A 1QVCA 2JA7G 2UXCL 1M90C 3L0OA 1WOCA 3KF8B 4JI0L 3CC7A 1YHAA 2UUCQ 3KF6B 2F4VQ 4GLVB 4P73A 1W3SA 2YTVA 4P75A 2D62A 4R4IA 1AE2A 2OQKA 2B29A 5ELNA 3HOWH 3S15H 1VQOA 1K3RA 1P16A 1IL2A 3CPFA 1AH9A 5LMUQ 4JI1L 1Y1VH 2KCMA 3H0GG 3KJOA 3HOUH 2NN6I 1I94Q 5IYDH 2LXJA 3CCEA 3PO3G 5GAEC 4A3KH 4DV4Q 2F3IA 4TVAB 2WAQE 1EOVA 2CWAA 2K50A 1GO3E 3FKIH 4XTCS 5IYCH 3J81c 1KIXA 4B3TQ 4LF8L 4DPGA 4X65Q 4QIWE 3PGZA 2BH2A 3H3VH 5GAHC 1X54A 3A0JA 4EQ5A 3F2DA 4JI5Q 4PG3A 3GTMH 4X66Q 1TWGH 1N34L 1EFWA 1Q46A 3HKZG 3CCUA 1CKOA 4KLKA 1HZAA 4HJAA 4QJFA 3ULPA 2K52A 4GKKL 4WJ3M 4P72A 2WFWA 5C4XG 3FHWA 2LSSA 4MNOA 1VQ4A 4YCUA 4X64L 3PUZA 1JMCA 3S2DH 2HIVA 5IWAL 4OO1G 4QQBX 4GNXC 3K7AH 1TWHH 1YNXA 3GD7A 4JOIC 5IYBG 3W5OA 2N49A 3KDFB 3GTKH 3J80i 4DUYQ 5DLQE 2E2IH 2E8GA 2OWOA 2UXDQ 4QL5A 2IX1A 5BR8Q 2KBNA 3E0EA 4JG2A 1SMXA 1UEBA 5E7NA 1IBKQ 4LF6L 2Q2HA 4A3DG 4DR5Q 1VQFA 1LUZA 2MNAA 4GOPA 3T1YL 1M1KC 1IBLL 1HR0W 2JA5H 1N33Q 1IYJB 1YVCA 4YCVA 5C44H 3CF5A 3GTGH 4DK6C 1FVIA 1VQCA 2EXDA 2ES2A 3GO5A 3UDFA 1YJNA 3TEHB 4KHZA 3I4MG 4A93H 1NE3A 1EQRA 4JI4L 2OCEA 1MIUA 2ZTDA 1X3GA 4JV5Q 3S2HH 1W2BA 4BXXH 1QZGA 1FGUA 4JI0Q 2JQOA 1JE5A 5HGQA 3DM3A 3HOVH 3SGIA 3HOYG 4JYAL 4AIMA 4POGA 1G6PA 2NVYH 1Y1WG 3UE0A 4BY1H 4L5TA 4A3LG 2B3GA 2CKZB 3L7ZC 2BH8A 4IOCA 3GTQH 3KF6A 2EQSA 2RHSB 1SRUA 1CSPA 3EBEA 3W1BA 1WCMG 4JI1Q 3GTOH 1K8AC 1H95A 2Q2IA 3AQQA 4A3GH 1SLJA 4IPDA 2AKWB 3KJPA 4DV0L 4LF7L 2PI2E 3AFPA 3CXCA 5M3MH 3PO2G 3RNUA 1DGSA 3HFZB 1XMOL 2HQLA 3M4OH 1X3FA 3M7NA 2HHHL 1L1OB 4OWWB 3K7UC 3RN2A 1WJJA 3GTLH 1N34Q 2K14A 3PUYA 4GKJL 4O2DA 5GAGC 3UDGA 4PZ7A 3UE1A 2VQFL 3I55A 2DGYA 2UUAL 4A3EH 4GKKQ 1K73C 4BY7H 3F2CA 1SR3A 4NPSA 2NN6G 3S1QH 3EIVA 4X64Q 1C9OA 4DAMA 3ER0A 2Z6KC 2E5LL 4HIMA 2VUMH 4R1JA 1I5FA 2N8NA 1CKMA 2R7ZH 1CKNB 2K75A 3CC2A 4LF6Q 2VY3A 3BU2A 5EAYA 1IBLQ 3T1YQ 1SROA 4YWLA 5JEAJ 3BJUA 4C2MH 3PUXA 3U4VA 2ALYB 1P8LA 3NEMA 3JAMi 2NZHA 3HKSA 4LF9L 3I2ZA 1OXUA 1J5EL 1YJWA 1YIJA 4JI7L 3K8AA 3CD6A 3S14H 2PQAA 1EIFA 3I7FA 3NELA 1X6OA 2R92G 1BBUA 1V1QA 2Y0SE 5IP7H 4JI4Q 3S1MH 3U50C 3UDIA 3HOZG 4IFDJ 1I50H 3RLFA 3E9HA 1GM5A 1IBML 2KENA 3S24A 5JJKA 2R93H 4NB3A 2K5VA 1KAWA 3CC4A 2YTXA 4DNIA 2D0OA 3PUVA 3FP9A 1R9TH 1HNWL 4WJ4A 3L2PA 5C3EG 3PF5A 4B3MQ 4DR7L 4A3BH 1GVPA 1BKBA 2K4KA 3CQZH 4ALPA 4OX9L 4BBSG 1EQQA 1VS0A 1E22A 2UU9L 3I4NG 2Z0SA 4DV0Q 4R4CA 4GOPC 4LF7Q 2BA1A 3M4PA 2A8VA 1U0LA 3W1GA 2JEAI 4KI0A 3NENA 3ULJA 1XMOQ 4X62L 3J7A5 4A3CG 2CCZA 1D8LA 2HHHQ 5M5XH 4JCVE 4JI2L 1VQBA 4XIGS 1KRTA 4C3JH 4GKJQ 3RN5A 1G51A 3PV0A 1G291 3J81i 3G71A 1JJCB 3GDEA 4JI6L 1Z47A 1L1OA 2VQFQ 1AE3A 2GVAA 2UUAQ 4IOAA 4BA1I 3S17H 4DR6L 3OTOL 4L5QA 5C0XI 2NVQH 2ASBA 1JB7A 5AJ3L 4LW1A 4LFBL 4GNXB 2E5LQ 3M3YH 1XPOA 4L5RC 3ULLA 4IJHA 4MTNA 4OWTB 4DV3L 2MFIA 3J7ZC 2OQ0A 1Y14B 3HOXG 3VDYA 4A3JH 4B3SL 2JA7H 1WFQA 4HIDA 2ATWA 3PIOA 4DV6L 1N32L 4FDBA 4A3FG 3AYHB 4TQUS 1QVGA 4AYBE 1J6QA 4O0AA 1XJVA 2B63H 1JT8A 4BA2I 4DR4L 1CKNA 4GN3B 1A63A 4LF4L 2UUBQ 4LF9Q 4IPCA 4A3MH 2ID0A 1J5EQ 2I5MX 5FLMH 4BBRG 3H3VI 4IPGA 1E1TA 4DV1L 1KD1C 1NMFA 3D31A 1YBYA 4DR1L 2UXBL 2E2JH 4P71A 1Q1EA 2WB1G 4JC0A 4KHPL 3S1RH 1K8GA 4J15A 4LFCL 1IBMQ 4NXML 2F52A 1N36L 4RMFA 1HNXL 3F2BA 4ME3A 4P74A 3GTJH 2UXCQ 1X9NA 1EYGA 4LNQA 4OXPA 4DK3C 4GN4B 1YZ6A 4GLXA 1HNWQ 3TS0A 1BBWA 2ZJRA 4OONA 4DR7Q 4QY7A 5FJ8G 3TREA 1A62A 2PNHA 5IP9G 1NJIC 3H0GH 2YU9H 1QVFA 4A3IG 1B7YB 1N9WA 2JA8G 1VQDA 1PVOA 5K36G 4OX9Q 3PO3H 3U4ZA 3J81j 1HNZL 2R7ZG 4A4IA 2IHFA 1JJ2A 3B6YA 3S16H 4X62Q 4JI8L 1PFSA 1A0IA 4JI2Q 4UPAA 1N8RC 2XTIA 1QZHA 1E1OA 4HJ8A 2AHOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZJY C;  2KHJ A;  4LF8 Q;  2B63 G;  2I5L X;  2ZM6 L;  4JI6 Q;  1PH4 A;  4YWM A;  4DUZ L;  3AFQ A;  1VQ6 A;  1HZB A;  3OTO Q;  1GD7 A;  1BVS A;  3AEV A;  1SN8 A;  5AJ3 Q;  1ASY A;  4LFB Q;  1CSQ A;  1GKH A;  2FXQ A;  4LF5 L;  2R7D A;  3S1N H;  1IZ6 A;  4NXN L;  3PO2 H;  4LFA Q;  5IYB H;  4DV3 Q;  1PH5 A;  1MJC A;  4C3H H;  4B3S Q;  2JA6 G;  1PH3 A;  3EN2 A;  4DV6 Q;  1N32 Q;  4JOI A;  3M85 A;  1LM0 A;  2JJQ A;  4A3D H;  4X6A H;  5IWA Q;  1UE5 A;  2AWO A;  3A74 A;  2CFM A;  1XNQ L;  2Q2U A;  3K81 C;  4DR4 Q;  4LF4 Q;  1NMG A;  5GAD C;  5LMN L;  1UE1 A;  1PH7 A;  1HZ9 A;  1JJG A;  5C0X G;  1PV4 A;  1ASZ A;  1VQK A;  1O7I A;  2OTL A;  3G48 A;  2VL6 A;  3KDF A;  3RLN A;  1I94 L;  4DV1 Q;  4DV5 L;  4HJ5 A;  4POF A;  2I0Q A;  1VQA A;  3HOW G;  4DV4 L;  4DR1 Q;  2UXB Q;  2QEX A;  4YHH L;  1X56 A;  1LYL A;  3OYY A;  4KHP Q;  1LTL A;  1Y1V G;  1Q12 A;  3HOU G;  4PZ8 A;  4NXM Q;  1TWA H;  1KC8 C;  5IYD G;  4LFC Q;  1N36 Q;  1NTG A;  1QUQ B;  1VQE A;  3HKZ E;  4A3K G;  1XPR A;  3HOY H;  1HNX Q;  1PHJ A;  5IYC G;  1Q8K A;  2YTY A;  3FKI G;  1Y1W H;  2K5H A;  1HJP A;  4A3L H;  1U5K A;  3CCM A;  3CP0 A;  2DUD A;  1FJG L;  1PH2 A;  1XNQ Q;  3CCR A;  2GN5 A;  1WCM H;  1V9P A;  5M3F H;  3H15 A;  4GS3 A;  4JYA Q;  2PMZ E;  2VW9 A;  1PYS B;  2RF4 A;  2JA9 A;  4JI3 L;  1NBW A;  4GOP B;  2A19 A;  1HNZ Q;  1VQ8 A;  1OXS C;  3CCS A;  1XPU A;  4PZ6 A;  1X65 A;  4JI8 Q;  1IBK L;  2HIX A;  3D0F A;  4R4Q A;  1OXX K;  1KHI A;  1V43 A;  2ZTC A;  3U58 A;  4JI7 Q;  3CPW A;  1S72 A;  1RL2 A;  1E3P A;  3PUW A;  2ZM6 Q;  2RHQ B;  4IJL A;  2OTJ A;  4DUZ Q;  2MO0 A;  3JC6 6;  1EIY B;  5GRO A;  4UP7 A;  2VNU D;  3BZC A;  1L0W A;  3UDX A;  2JA5 G;  4R4O A;  4LF5 Q;  2K5N A;  5C44 G;  3BZK A;  3PCO B;  2QGQ A;  4NXN Q;  1HZC A;  1TWF H;  1I3Q H;  1PH8 A;  5JJL A;  2PI2 A;  3LGJ A;  3T1H L;  4JV5 L;  1VQG A;  3TQY A;  5GQO A;  1SFO H;  2Z6K A;  3CCL A;  4JBK A;  5C4J H;  4DR3 L;  1S40 A;  1VQL A;  2A1A A;  4A93 G;  1OXV A;  1S3O A;  2R6G A;  4R4T A;  1PYB A;  3MXN B;  2KHI A;  4C3I H;  1OTC A;  1K0R A;  2VQE L;  4YY3 L;  4BXX G;  1YI2 A;  5LMN Q;  1VQM A;  4IO9 A;  3HOV G;  2D0P A;  4L5S A;  4DV7 L;  1Q86 C;  4LUV A;  1MJE A;  4B3R L;  4DV5 Q;  1VQ7 A;  4IFD I;  5JJI A;  4DR2 L;  2R92 H;  1E24 A;  4JBW A;  4BY1 G;  5J3B A;  1TXY A;  1HR0 L;  2JE6 I;  4HJ7 A;  1VQ5 A;  5IY0 A;  4YHH Q;  1I6H H;  3IRB A;  2GVB A;  3HOZ H;  2LXK A;  3I4O A;  1EUJ A;  3RZO H;  1E7Z A;  2XGT A;  3KLW A;  4AQY L;  1YHQ A;  4A3G G;  4DV2 L;  5M5Y H;  1VQ9 A;  5M3M G;  2NVT H;  3TRZ A;  1X55 A;  2Y0S G;  3PIP A;  1HH2 P;  4K0K L;  1QUQ A;  5C3E H;  1FJG Q;  3STB C;  1L2F A;  1MKH A;  1C0A A;  1UWV A;  1SE8 A;  2C35 B;  2EIF A;  3F8T A;  4IPH A;  1UE7 A;  2H5X A;  4UP8 A;  4JI3 Q;  4EX5 A;  2JEB I;  2RCN A;  3RZD H;  1PH1 A;  4DKA C;  3J80 c;  4A3E G;  3I4N H;  1KXL A;  4BY7 G;  3M4Q A;  3G6E A;  1XNR L;  2MO1 A;  3PSI A;  4MZ9 A;  1XMQ L;  4A3C H;  4LUO A;  2CQO A;  2UU9 Q;  2VUM G;  2PQA B;  1D7Q A;  1WI5 A;  3CMA A;  3CCJ A;  3WWV A;  4YCW A;  1UE6 A;  5FLX c;  3GTP H;  2CWP A;  2IHE A;  2WP8 J;  1A8V A;  4RG1 A;  4APV A;  3A5U A;  2R7F A;  3KFU A;  4DAY B;  3T1H Q;  2VZA A;  2WAQ G;  3HOX H;  1KRS A;  4QGU A;  4DR6 Q;  5C4X H;  1B70 B;  3CCQ A;  1Q82 C;  4DR3 Q;  1PA6 A;  2ZJQ A;  4A3F H;  2AWN A;  5IP7 G;  3I56 A;  3DLL A;  2ZJP A;  1FL0 A;  2KCT A;  2VQE Q;  3E9I A;  4YY3 Q;  4GLA C;  1VQN A;  1NY4 A;  2YYZ A;  3KOJ A;  4B3M L;  5HY6 A;  4GNX A;  4BBR H;  3CCV A;  5M3F G;  4DV7 Q;  2UUC L;  4JBJ A;  2F4V L;  4B3R Q;  2R93 G;  4DR2 Q;  3OW2 A;  4AYB G;  1HR0 Q;  5IE8 A;  3A5Z B;  1IXR A;  1T9H A;  3F1Z A;  2V1C C;  2YV5 A;  5LMU L;  5JEA G;  4A3B G;  3CME A;  1VQP A;  3K80 C;  1C7Y A;  2E2H H;  4AH6 A;  1VCI A;  2JK8 A;  4AQY Q;  3RLO A;  1XTD A;  4Y7N H;  3I4M H;  4DV2 Q;  4OO1 I;  3CW2 C;  4A75 A;  1PH9 A;  4Y52 H;  4GN5 A;  5M5W H;  4B3T L;  3TS2 A;  1K83 H;  1KL9 A;  4LWC A;  3RR5 A;  4X65 L;  4K0K Q;  2MQH A;  4LFA L;  3G4S A;  1L1O C;  5FJ8 H;  4JI5 L;  5IP9 H;  4BBS H;  4IFD G;  4X66 L;  4A3I H;  2JA8 H;  1YIT A;  5IT9 c;  2VS1 A;  4HJ9 A;  1YHB A;  3K0X A;  4H02 A;  4OWX B;  3PF4 A;  4UY8 C;  4PMW A;  1XNR Q;  1CUK A;  2N3S A;  4LUZ A;  2Q2T A;  2L15 A;  3ICE A;  3KYH C;  1XMQ Q;  4HIK A;  3MEF A;  1WYD A;  1OXT A;  1Q1B A;  2NZO A;  5ELO A;  1Q81 C;  5C0X J;  4JBM A;  5H1S E;  5LMN W;  4DUY L;  4HIO A;  4A3J G;  1RIP A;  1YJ9 A;  2IT1 A;  2UUB L;  1Z9F A;  1TWC H;  4UP9 A;  3JAM c;  3NBH B;  1EWI A;  1VQH A;  2AMC B;  2UXD L;  5BR8 L;  1KQS A;  2IY5 B;  3ERS X;  3Q8D A;  4DR5 L;  1X3E A;  2ZTE A;  1K9M C;  1N33 L;  2BA0 A;  2WB1 E;  1B8A A;  1Q7Y C;  2IX0 A;  2I5H A;  2HT1 A;  4A3M G;  1YEZ A;  5FLM G;  3CAM A;  3M9B A;  3STB D;  2JA6 H;  4YWK A;  1VQI A;  2N78 A;  2QA4 A;  4A76 A;  2NVX H;  1VQJ A;  1PH6 A;  1QVC A;  2JA7 G;  2UXC L;  1M90 C;  3L0O A;  1WOC A;  3KF8 B;  4JI0 L;  3CC7 A;  1YHA A;  2UUC Q;  3KF6 B;  2F4V Q;  4GLV B;  4P73 A;  1W3S A;  2YTV A;  4P75 A;  2D62 A;  4R4I A;  1AE2 A;  2OQK A;  2B29 A;  5ELN A;  3HOW H;  3S15 H;  1VQO A;  1K3R A;  1P16 A;  1IL2 A;  3CPF A;  1AH9 A;  5LMU Q;  4JI1 L;  1Y1V H;  2KCM A;  3H0G G;  3KJO A;  3HOU H;  2NN6 I;  1I94 Q;  5IYD H;  2LXJ A;  3CCE A;  3PO3 G;  5GAE C;  4A3K H;  4DV4 Q;  2F3I A;  4TVA B;  2WAQ E;  1EOV A;  2CWA A;  2K50 A;  1GO3 E;  3FKI H;  4XTC S;  5IYC H;  3J81 c;  1KIX A;  4B3T Q;  4LF8 L;  4DPG A;  4X65 Q;  4QIW E;  3PGZ A;  2BH2 A;  3H3V H;  5GAH C;  1X54 A;  3A0J A;  4EQ5 A;  3F2D A;  4JI5 Q;  4PG3 A;  3GTM H;  4X66 Q;  1TWG H;  1N34 L;  1EFW A;  1Q46 A;  3HKZ G;  3CCU A;  1CKO A;  4KLK A;  1HZA A;  4HJA A;  4QJF A;  3ULP A;  2K52 A;  4GKK L;  4WJ3 M;  4P72 A;  2WFW A;  5C4X G;  3FHW A;  2LSS A;  4MNO A;  1VQ4 A;  4YCU A;  4X64 L;  3PUZ A;  1JMC A;  3S2D H;  2HIV A;  5IWA L;  4OO1 G;  4QQB X;  4GNX C;  3K7A H;  1TWH H;  1YNX A;  3GD7 A;  4JOI C;  5IYB G;  3W5O A;  2N49 A;  3KDF B;  3GTK H;  3J80 i;  4DUY Q;  5DLQ E;  2E2I H;  2E8G A;  2OWO A;  2UXD Q;  4QL5 A;  2IX1 A;  5BR8 Q;  2KBN A;  3E0E A;  4JG2 A;  1SMX A;  1UEB A;  5E7N A;  1IBK Q;  4LF6 L;  2Q2H A;  4A3D G;  4DR5 Q;  1VQF A;  1LUZ A;  2MNA A;  4GOP A;  3T1Y L;  1M1K C;  1IBL L;  1HR0 W;  2JA5 H;  1N33 Q;  1IYJ B;  1YVC A;  4YCV A;  5C44 H;  3CF5 A;  3GTG H;  4DK6 C;  1FVI A;  1VQC A;  2EXD A;  2ES2 A;  3GO5 A;  3UDF A;  1YJN A;  3TEH B;  4KHZ A;  3I4M G;  4A93 H;  1NE3 A;  1EQR A;  4JI4 L;  2OCE A;  1MIU A;  2ZTD A;  1X3G A;  4JV5 Q;  3S2H H;  1W2B A;  4BXX H;  1QZG A;  1FGU A;  4JI0 Q;  2JQO A;  1JE5 A;  5HGQ A;  3DM3 A;  3HOV H;  3SGI A;  3HOY G;  4JYA L;  4AIM A;  4POG A;  1G6P A;  2NVY H;  1Y1W G;  3UE0 A;  4BY1 H;  4L5T A;  4A3L G;  2B3G A;  2CKZ B;  3L7Z C;  2BH8 A;  4IOC A;  3GTQ H;  3KF6 A;  2EQS A;  2RHS B;  1SRU A;  1CSP A;  3EBE A;  3W1B A;  1WCM G;  4JI1 Q;  3GTO H;  1K8A C;  1H95 A;  2Q2I A;  3AQQ A;  4A3G H;  1SLJ A;  4IPD A;  2AKW B;  3KJP A;  4DV0 L;  4LF7 L;  2PI2 E;  3AFP A;  3CXC A;  5M3M H;  3PO2 G;  3RNU A;  1DGS A;  3HFZ B;  1XMO L;  2HQL A;  3M4O H;  1X3F A;  3M7N A;  2HHH L;  1L1O B;  4OWW B;  3K7U C;  3RN2 A;  1WJJ A;  3GTL H;  1N34 Q;  2K14 A;  3PUY A;  4GKJ L;  4O2D A;  5GAG C;  3UDG A;  4PZ7 A;  3UE1 A;  2VQF L;  3I55 A;  2DGY A;  2UUA L;  4A3E H;  4GKK Q;  1K73 C;  4BY7 H;  3F2C A;  1SR3 A;  4NPS A;  2NN6 G;  3S1Q H;  3EIV A;  4X64 Q;  1C9O A;  4DAM A;  3ER0 A;  2Z6K C;  2E5L L;  4HIM A;  2VUM H;  4R1J A;  1I5F A;  2N8N A;  1CKM A;  2R7Z H;  1CKN B;  2K75 A;  3CC2 A;  4LF6 Q;  2VY3 A;  3BU2 A;  5EAY A;  1IBL Q;  3T1Y Q;  1SRO A;  4YWL A;  5JEA J;  3BJU A;  4C2M H;  3PUX A;  3U4V A;  2ALY B;  1P8L A;  3NEM A;  3JAM i;  2NZH A;  3HKS A;  4LF9 L;  3I2Z A;  1OXU A;  1J5E L;  1YJW A;  1YIJ A;  4JI7 L;  3K8A A;  3CD6 A;  3S14 H;  2PQA A;  1EIF A;  3I7F A;  3NEL A;  1X6O A;  2R92 G;  1BBU A;  1V1Q A;  2Y0S E;  5IP7 H;  4JI4 Q;  3S1M H;  3U50 C;  3UDI A;  3HOZ G;  4IFD J;  1I50 H;  3RLF A;  3E9H A;  1GM5 A;  1IBM L;  2KEN A;  3S24 A;  5JJK A;  2R93 H;  4NB3 A;  2K5V A;  1KAW A;  3CC4 A;  2YTX A;  4DNI A;  2D0O A;  3PUV A;  3FP9 A;  1R9T H;  1HNW L;  4WJ4 A;  3L2P A;  5C3E G;  3PF5 A;  4B3M Q;  4DR7 L;  4A3B H;  1GVP A;  1BKB A;  2K4K A;  3CQZ H;  4ALP A;  4OX9 L;  4BBS G;  1EQQ A;  1VS0 A;  1E22 A;  2UU9 L;  3I4N G;  2Z0S A;  4DV0 Q;  4R4C A;  4GOP C;  4LF7 Q;  2BA1 A;  3M4P A;  2A8V A;  1U0L A;  3W1G A;  2JEA I;  4KI0 A;  3NEN A;  3ULJ A;  1XMO Q;  4X62 L;  3J7A 5;  4A3C G;  2CCZ A;  1D8L A;  2HHH Q;  5M5X H;  4JCV E;  4JI2 L;  1VQB A;  4XIG S;  1KRT A;  4C3J H;  4GKJ Q;  3RN5 A;  1G51 A;  3PV0 A;  1G29 1;  3J81 i;  3G71 A;  1JJC B;  3GDE A;  4JI6 L;  1Z47 A;  1L1O A;  2VQF Q;  1AE3 A;  2GVA A;  2UUA Q;  4IOA A;  4BA1 I;  3S17 H;  4DR6 L;  3OTO L;  4L5Q A;  5C0X I;  2NVQ H;  2ASB A;  1JB7 A;  5AJ3 L;  4LW1 A;  4LFB L;  4GNX B;  2E5L Q;  3M3Y H;  1XPO A;  4L5R C;  3ULL A;  4IJH A;  4MTN A;  4OWT B;  4DV3 L;  2MFI A;  3J7Z C;  2OQ0 A;  1Y14 B;  3HOX G;  3VDY A;  4A3J H;  4B3S L;  2JA7 H;  1WFQ A;  4HID A;  2ATW A;  3PIO A;  4DV6 L;  1N32 L;  4FDB A;  4A3F G;  3AYH B;  4TQU S;  1QVG A;  4AYB E;  1J6Q A;  4O0A A;  1XJV A;  2B63 H;  1JT8 A;  4BA2 I;  4DR4 L;  1CKN A;  4GN3 B;  1A63 A;  4LF4 L;  2UUB Q;  4LF9 Q;  4IPC A;  4A3M H;  2ID0 A;  1J5E Q;  2I5M X;  5FLM H;  4BBR G;  3H3V I;  4IPG A;  1E1T A;  4DV1 L;  1KD1 C;  1NMF A;  3D31 A;  1YBY A;  4DR1 L;  2UXB L;  2E2J H;  4P71 A;  1Q1E A;  2WB1 G;  4JC0 A;  4KHP L;  3S1R H;  1K8G A;  4J15 A;  4LFC L;  1IBM Q;  4NXM L;  2F52 A;  1N36 L;  4RMF A;  1HNX L;  3F2B A;  4ME3 A;  4P74 A;  3GTJ H;  2UXC Q;  1X9N A;  1EYG A;  4LNQ A;  4OXP A;  4DK3 C;  4GN4 B;  1YZ6 A;  4GLX A;  1HNW Q;  3TS0 A;  1BBW A;  2ZJR A;  4OON A;  4DR7 Q;  4QY7 A;  5FJ8 G;  3TRE A;  1A62 A;  2PNH A;  5IP9 G;  1NJI C;  3H0G H;  2YU9 H;  1QVF A;  4A3I G;  1B7Y B;  1N9W A;  2JA8 G;  1VQD A;  1PVO A;  5K36 G;  4OX9 Q;  3PO3 H;  3U4Z A;  3J81 j;  1HNZ L;  2R7Z G;  4A4I A;  2IHF A;  1JJ2 A;  3B6Y A;  3S16 H;  4X62 Q;  4JI8 L;  1PFS A;  1A0I A;  4JI2 Q;  4UPA A;  1N8R C;  2XTI A;  1QZH A;  1E1O A;  4HJ8 A;  2AHO B; 
#chains in the Genus database with same CATH topology
 3D6C A;  3ZJY C;  4LF8 Q;  2I5L X;  2ZM6 L;  1B9N A;  4XXE A;  1PH4 A;  1LTS D;  3D4D A;  3MHB A;  2F0K A;  1NNX A;  1UUP A;  4IZ8 A;  1BVS A;  3EFX D;  1SN8 A;  2ICE C;  3AEV A;  4OO1 H;  3PO2 H;  1B9M A;  2E2J B;  2IPK D;  2RSN A;  3TBI B;  1PH3 A;  4TSS A;  1X32 A;  4ID6 A;  1H9S A;  1U9R A;  2AWO A;  3A74 A;  1H9K A;  1II3 A;  1QNU A;  2CFM A;  2Q2U A;  2HUG A;  3QJY A;  3GTJ B;  4NDX A;  3HGB A;  1K0S A;  1NMG A;  5GAD C;  2EJG C;  1UE1 A;  1K28 A;  1EWC A;  1ML0 D;  1PV4 A;  1VQK A;  1O7I A;  1BOS A;  1O80 A;  2VL6 A;  3G48 A;  1VQA A;  1PRT C;  2A68 C;  2Q8I B;  1IKM A;  4NMZ A;  1RTN A;  1ET9 A;  4PZ8 A;  3ND8 A;  1N36 Q;  1QUQ B;  5KYI A;  5A2Q L;  3C46 A;  3NPP A;  1PHJ A;  2D2C C;  5IYC G;  1HNX Q;  1EYC A;  2RDF A;  2EVB A;  2YTY A;  2G9D A;  3G6J B;  1Y1W H;  1JOO A;  3L3O C;  4B08 A;  2K5D A;  3J7A V;  1X3P A;  3LWU A;  4XQJ A;  4JYA Q;  4DAV A;  1SXT A;  1NBW A;  3RMH A;  3PO2 B;  2A19 A;  4ME5 A;  3SEB A;  5G3L F;  1WTO A;  3CCS A;  4KMU C;  4XQQ A;  2MP1 A;  5DNF A;  2F1M A;  3D0F A;  4KY7 A;  1OXX K;  4JI7 Q;  1D5X C;  5LL6 X;  2RHQ B;  2M9V A;  4UP7 A;  4IAL A;  1ILQ A;  1D5M C;  2QGQ A;  3KBX A;  4NXN Q;  1I3Q H;  2PI2 A;  3T1H L;  4JV5 L;  3TQY A;  2L5T A;  1SFO H;  1CA5 A;  3CCL A;  1S40 A;  1MSG A;  1OXV A;  3K58 A;  1PYB A;  1K0R A;  1Y1W B;  1MD2 D;  3T56 B;  1YI2 A;  5LMN Q;  3A56 A;  3I3C A;  3J80 L;  3NBI A;  5FKA C;  4DV5 Q;  5JJI A;  1E24 A;  5J3B A;  5J1Z A;  3OSO A;  5IY0 A;  5LHY 1;  4YHH Q;  1CK1 A;  2GVB A;  3HOZ H;  1EUJ A;  3T16 A;  3KLW A;  1DD2 A;  2KCC A;  5M3M G;  1E2W A;  2OT2 A;  1DOL A;  1TY2 A;  3KLR A;  4MIU A;  4N8F A;  1HCZ A;  1QJO A;  1U4M A;  2LY7 A;  2ZXR A;  5JJZ A;  5ELE A;  1I3Q B;  2PQE A;  4A3E G;  1PH1 A;  1GHK A;  4BY7 G;  1KXL A;  3D3R A;  1SFO B;  4LJZ C;  2CH4 W;  2CQO A;  2UU9 Q;  4RCO A;  4S3S A;  1ILP A;  4KY6 A;  1WI5 A;  3CCJ A;  3WWV A;  4YCW A;  1UE6 A;  2NTS A;  5FLX c;  4XQN A;  3K0Y A;  1GOZ A;  3NE5 B;  4APV A;  2ZXO A;  2VZA A;  2WAQ G;  1ESF A;  1F9R A;  5C5M A;  5C4X H;  3HOZ B;  4DR6 Q;  3P1H A;  1LAB A;  2AWN A;  4K2L A;  2F0F A;  5IT9 L;  1FL0 A;  2KCT A;  3P7J A;  4C1N I;  2VQE Q;  1ZYR C;  3TN2 A;  5FO8 B;  4N9P A;  2R93 G;  4B3R Q;  3VA5 A;  1JC7 A;  1PRT B;  3MC0 B;  4DR2 Q;  3OW2 A;  4AYB G;  5K5P A;  1IXR A;  4K5V A;  2A73 B;  2V1C C;  5JEA G;  1CA6 A;  4KV6 A;  1MSH A;  1VQP A;  4AQY Q;  1U4L A;  1XTD A;  1SYD A;  4Y7N H;  1PH9 A;  4IN3 A;  1CFM A;  2H4O A;  1IYU A;  2VB2 X;  5FK9 C;  5ELF A;  1LT6 D;  2SNM A;  2L9H A;  2EY2 A;  1ICW A;  4A3I H;  1A3V A;  1ENF A;  1YIT A;  2VS1 A;  4HJ9 A;  3K0X A;  4H02 A;  4IUR A;  2B8G A;  2Q2T A;  2F0S A;  4WRD A;  5C4X B;  3KYH C;  3MEF A;  2NZO A;  5J22 A;  5LMN W;  2JA7 G;  2UUB L;  2IT1 A;  3JAM c;  3NBH B;  1EWI A;  3I72 A;  4FF4 A;  1E2V A;  2BA0 A;  1Q7Y C;  2I5H A;  1SSO A;  1U4R A;  1YEZ A;  2BCO A;  1EOT A;  3CAM A;  4KY5 A;  2JA6 H;  3N6R A;  4A76 A;  4R9W A;  1VQJ A;  4Y7N B;  4TRD A;  4FP5 D;  1M90 C;  2B2V A;  4JI0 L;  1YHA A;  2F4V Q;  4GLV B;  5JOB A;  4A3I B;  2D62 A;  2OQK A;  3HOW H;  2B29 A;  1VQO A;  1EIH A;  5LMU Q;  1Y1V H;  3BZD B;  2PZU A;  1GXD C;  2NN6 I;  3HOU H;  2Z4I A;  2LXJ A;  3CCE A;  2F3I A;  2PZT A;  3I70 A;  2BH2 A;  5GAH C;  1X54 A;  3GTM H;  5IIF A;  2BDN A;  5IGB A;  1TWG H;  1N34 L;  3I91 A;  3ULP A;  2K52 A;  1MHW C;  1KDB A;  2JA6 B;  4YCU A;  5IWA L;  4OO1 G;  4V0B A;  3PO2 G;  1YNX A;  3GD7 A;  1TS3 A;  3MZ5 A;  1HTL D;  3CHB D;  5DLQ E;  2UXD Q;  3D4R A;  3E0E A;  1SMX A;  1Y8P B;  4GOP A;  1WTQ A;  1IBL L;  2JA5 H;  1YVC A;  4YCV A;  2F3V A;  1GUN A;  3HOW B;  3SXH A;  2DY8 A;  4BS9 A;  1Y1V B;  1QIL A;  3HOU B;  4DN4 M;  3I4M G;  4A93 H;  1NE3 A;  3VYU A;  4JI4 L;  1WTW A;  2OCE A;  1L0Y B;  3HG9 A;  1MIU A;  4JV5 Q;  5IOC A;  1WTH A;  1FGU A;  3HOV H;  5BN5 A;  5COR A;  3GTM B;  1NR2 A;  1G6P A;  2NVY H;  1Y1W G;  1TWG B;  2KCN A;  3UE0 A;  2B2Y A;  1NAP A;  2EQS A;  3E3X A;  1SNC A;  2RHS B;  3TP6 A;  1CSP A;  4DXG A;  2EY1 A;  1LLR D;  1TR5 A;  3DXJ C;  1SLJ A;  5C3W A;  2AKW B;  2N55 A;  3KJP A;  2NB0 A;  2PI2 E;  4LF7 L;  3CXC A;  1I4R A;  2QDB A;  5T1I A;  3M4O H;  2HQL A;  3RN2 A;  4ILW A;  2JA5 B;  4GKJ L;  4O2D A;  4FVM A;  4PZ7 A;  2UUA L;  2DGY A;  3EIV A;  4OEL B;  2Q8T A;  4G7Z C;  4DAM A;  4A93 B;  1STN A;  4KTA A;  3PIP 3;  1WVL A;  2L12 A;  2EOT A;  2N8N A;  1D1K A;  2VY3 A;  3HOV B;  5EAY A;  1SRO A;  1YNN D;  1Z7T A;  5JEA J;  1G8Z D;  2NVY B;  4C2M H;  1S5F D;  2WKC A;  3NEM A;  1P8L A;  2XRS D;  4LF9 L;  3HKS A;  3CD6 A;  1L0X B;  3I7F A;  1EY6 A;  1BBU A;  2Y0S E;  2HD3 A;  1H9J A;  3HOZ G;  1I50 H;  3E9H A;  4IUU A;  2KEN A;  3CKI B;  3FMC A;  2BDO A;  2D0O A;  3PUV A;  1HNW L;  5DAU A;  3PF5 A;  4EQN A;  4A3B H;  1ZKO A;  1GVP A;  4ALP A;  1LAC A;  1EQQ A;  4CKC A;  3TZD A;  2O4X A;  4DV0 Q;  4GOP C;  3M4P A;  1ET6 A;  2A8V A;  1U0L A;  3NEN A;  3ULJ A;  3QIA A;  3K6O A;  1D8L A;  1G6Z A;  1AP0 A;  4XIG S;  1KRT A;  4M1U B;  3RN5 A;  2LMC B;  4C2M B;  3J81 i;  1JJC B;  3GDE A;  1E2Z A;  1L1O A;  3MFY A;  4BA1 I;  3S17 H;  3RUZ A;  4L5Q A;  4N9T A;  2NVQ H;  1VF7 A;  1VF5 C;  2K33 A;  4LW1 A;  3MVV A;  4JW0 A;  2E5L Q;  4QIW B;  1XPO A;  4ZUJ A;  3OIQ A;  4IJH A;  4OWT B;  3J7Z C;  2OQ0 A;  1Y14 B;  2HCC A;  1I50 B;  2ATW A;  1QNK A;  2EPB A;  1ZXT A;  3AYH B;  3TZU A;  1XJV A;  1JT8 A;  1PXU A;  4GN3 B;  1S5D D;  2UUB Q;  1BQQ T;  4IPC A;  2I5M X;  3NTI A;  4A3B B;  3I90 A;  2O5J C;  1SMY C;  2CQA A;  5I4D A;  1KD1 C;  2JYO A;  4P71 A;  3HZX A;  4K6L A;  4IUN A;  3NP8 A;  2J7Z A;  1K8G A;  2L55 A;  1BR9 A;  4J15 A;  1IBM Q;  1QG7 A;  2F52 A;  1N36 L;  1LT3 D;  1HNX L;  4ME3 A;  1EYG A;  1BBX C;  2O2L D;  4GN4 B;  3Q24 A;  1JB3 A;  3SK8 A;  2ZJR A;  1DZ1 A;  4F7X A;  4KK7 A;  3S17 B;  4E6I A;  2YU9 H;  1HHV A;  2NVQ B;  1PVO A;  4A3I G;  3SR1 A;  1VQD A;  4OX9 Q;  3T51 B;  3NUC A;  4PMC A;  4OEM B;  4A4I A;  2B39 A;  3S16 H;  2DJF C;  1HPC A;  4UPA A;  4JI7 L;  2AHO B;  2KHJ A;  4Q5V A;  1J8I A;  4CBV A;  1KLG D;  2XWJ B;  3AFQ A;  3KLS A;  1HZB A;  1GD7 A;  4OIK A;  4KJN A;  5AJ3 Q;  4IUT A;  2IL8 A;  1IZ6 A;  4NXN L;  5IYB H;  3EJI A;  4HN7 A;  1MJC A;  4C3H H;  4B3S Q;  2JA6 G;  4JOI A;  1LM0 A;  4X6A H;  5IWA Q;  2HQE A;  4H7B A;  4DA2 A;  3K81 C;  1FNW A;  5LMN L;  3QR8 A;  1HZ9 A;  5E4W C;  4ZKB B;  2OTL A;  2YU9 B;  3RLN A;  3KDF A;  1I94 L;  2ICI A;  1W6K A;  4DV1 Q;  4DV5 L;  4HJ5 A;  3HOW G;  2B2U C;  4DR1 Q;  2UXB Q;  1V1P A;  3DEO A;  4YHH L;  2IJ0 A;  1X56 A;  1LYL A;  4KHP Q;  1LTL A;  1Y1V G;  3HOU G;  1I4Q A;  4H13 C;  5L37 A;  1TWA H;  3S16 B;  4X3T A;  1NTG A;  1AEX A;  1EQT A;  3D4W A;  2LKV A;  1SNQ A;  1U5K A;  5BN3 A;  3AU7 A;  3CCR A;  2GN5 A;  1V9P A;  3H15 A;  2BOS A;  1A2U A;  2VW9 A;  1EU3 A;  3MFG A;  4GOP B;  1HNZ Q;  3NK9 A;  1VQ8 A;  4C3H B;  1XPU A;  3OIP A;  1X65 A;  2HIX A;  2WKD A;  4NP5 A;  1FGB D;  3U58 A;  1V43 A;  3CPW A;  1F9P A;  2X69 A;  1BCP D;  2XRQ D;  4IJL A;  2MO0 A;  2NN6 H;  2JA5 G;  1SJE D;  3L9A X;  1HUN A;  5CV9 A;  5F2D A;  2N88 A;  5JJL A;  1TWA B;  2A1A A;  3H6M A;  4A93 G;  1S3O A;  2R6G A;  3MXN B;  4C3I H;  1OTC A;  2VQE L;  2QKI C;  1VQM A;  1D6E C;  1SE2 A;  3NTK A;  4ZKC B;  3HOV G;  2D0P A;  1D1I A;  2K5W A;  3BVG A;  4B3R L;  4J1M A;  2KVM A;  4DR2 L;  1NUC A;  2R92 H;  3NSW A;  2D5D A;  1NCV A;  1TXY A;  1VQ5 A;  4AQY L;  1VMP A;  1F2L A;  1BCP C;  2NVT H;  2K7V A;  3TRZ A;  2Y0S G;  2K1B A;  3PIP A;  5C3E H;  1MKH A;  3F8T A;  2C35 B;  2EIF A;  2V4D A;  1B4O A;  4IPH A;  2H5X A;  2ENB A;  3RZD H;  4G4K A;  4DKA C;  3J80 c;  3PSI A;  3ND9 A;  4L6T B;  4A3C H;  1PRT D;  2QDL A;  1B2T A;  3CMA A;  1D7Q A;  4C3I B;  1SYB A;  1H9R A;  1HA5 A;  1NR4 A;  3URY A;  2B2W A;  2RCF A;  4DGZ A;  1O78 A;  2Z4H A;  3A5U A;  2F4I A;  4PQX A;  2R92 B;  2KOL A;  3HOX H;  3HRZ C;  1B70 B;  1Q82 C;  1PA6 A;  2JP1 A;  4PV1 C;  3DLL A;  4OGQ C;  5FLX E;  2NVT B;  4YY3 Q;  2YYZ A;  4ZYS A;  4B3M L;  5HY6 A;  5C3E B;  4BBR H;  3CCV A;  4DV7 Q;  2F4V L;  2NWG A;  2LFN A;  2WAC A;  1STA A;  2VXW A;  1HR0 Q;  3RZD B;  3HS0 C;  3PIO 3;  5LMU L;  4A3B G;  4M8A A;  3K80 C;  1C7Y A;  1DM0 B;  2JK8 A;  3RLO A;  3I4M H;  4DV2 Q;  3CW2 C;  4Y52 H;  4KKS A;  3TS2 A;  1KL9 A;  4LWC A;  3RR5 A;  5EKI A;  5ELB A;  3G4S A;  2KED A;  4RWS C;  3I8Z A;  3K59 A;  2HDL A;  5K36 H;  4FXD A;  5IT9 c;  2QEJ C;  5CV7 A;  4UY8 C;  3PF4 A;  3HOX B;  2N3S A;  4LUZ A;  2Q8R E;  5I6W A;  3A8J E;  1XMQ Q;  1BO0 A;  1Q3L A;  5EPL A;  4JBM A;  1KAB A;  2B63 H;  1Z9F A;  1TWC H;  2UXD L;  4RH6 A;  1KQS A;  2EYO A;  3SE0 A;  2IY5 B;  4H44 C;  4BBR B;  3ERS X;  3Q8D A;  1RHP A;  2EYP A;  3VA7 A;  4KHV A;  3J81 L;  4JVZ A;  4CDE C;  4CKB A;  1VQI A;  2N78 A;  4KN4 C;  2NVX H;  4IUQ A;  1IW7 D;  1QVC A;  3I4M B;  3JAM E;  3WOE A;  1HQR D;  4K5W A;  1WOC A;  3NWS A;  3CC7 A;  2PW5 A;  2UUC Q;  2EYL A;  3KUP A;  4WJW A;  1Y8N B;  4R4I A;  1AE2 A;  5ELN A;  1F9S A;  1IL2 A;  1H9M A;  1AH9 A;  1MGS A;  1F2Y A;  4H0L C;  3MXP A;  1I94 Q;  5IYD H;  2B2W C;  1TS5 A;  1BCP B;  1EOV A;  2CWA A;  2K50 A;  3QO2 A;  4B3T Q;  1JOQ A;  2JXM B;  3U9S A;  5IGG A;  2B63 B;  1TWC B;  2CVR A;  4ODG A;  3MAQ A;  4EQ5 A;  4PG3 A;  2F0T A;  3BVM A;  3HEJ A;  4ZK9 B;  1ZYR D;  1JQY D;  4KLK A;  4HJA A;  2F0W A;  4MNO A;  3D8G A;  1B3A A;  4JK1 C;  1JMC A;  2NVX B;  4QQB X;  1IW7 C;  2C9O A;  5IYB G;  3GTK H;  3KDF B;  1RDP D;  4C3H G;  2E8G A;  2OWO A;  1QOH A;  2IX1 A;  3VYS A;  5E7N A;  2Q2H A;  4DR5 Q;  1M1K C;  1HR0 W;  5C44 H;  3CF5 A;  3GTG H;  2KEE A;  1FVI A;  1ICF B;  2E75 C;  1CQV A;  4U68 A;  2EXD A;  1XTC D;  3QWN A;  1LT4 D;  2ZTD A;  1X3G A;  4QCL A;  1JE5 A;  3DM3 A;  3FVQ A;  3TP7 A;  4POG A;  3TP5 A;  3GQB A;  3KF8 A;  4L5T A;  2B3G A;  2CKZ B;  3L7Z C;  2BH8 A;  5M9O A;  3KF6 A;  5COY A;  1LT5 D;  3EBE A;  3GTO H;  4IUP A;  4A3G H;  1ZEQ X;  4DV0 L;  3GTK B;  4PNY A;  3RNU A;  1BXT A;  4DXF A;  3E0J A;  1ESR A;  4EGV A;  1X3F A;  3M7N A;  5ISR A;  5DM6 3;  1RTO A;  2F0P A;  1XXG A;  3GTL H;  3FEW X;  3MTS A;  5GAG C;  5C44 B;  3UE1 A;  1M8A A;  3GTG B;  3I55 A;  5EPJ A;  1SR3 A;  1LTG D;  2NN6 G;  1DOM A;  4X64 Q;  1PYW D;  2E5L L;  4HED A;  1I5F A;  4ZLT F;  1PFM A;  1KAA A;  1CKM A;  4I7Z C;  1CKN B;  2K75 A;  4C56 C;  4CGY B;  2L1B A;  4LF6 Q;  5D65 A;  3T1Y Q;  1EWH A;  4C3I G;  3K5L A;  4YWL A;  1I4G A;  2NZH A;  1IKL A;  5CV4 A;  1YIJ A;  4BWG B;  2PQA A;  1EIF A;  4K14 A;  4FF3 A;  3GTO B;  1X6O A;  2R92 G;  4I7A A;  5IP7 H;  3S1M H;  4A3G B;  5G3L D;  1EQV A;  1IBM L;  3S24 A;  5JJK A;  4N8X 1;  5KNC A;  1KAW A;  3VR2 A;  3R93 A;  3GTL B;  2DY7 A;  3T13 A;  4DNI A;  2A6H C;  1EYD A;  1WTR A;  1SE4 A;  5C3E G;  3AMU A;  5EPK A;  4B3M Q;  4ZRZ A;  1O7Z A;  4XYO A;  4OX9 L;  1E22 A;  4G7H C;  2B2T A;  3Q0A A;  2JEA I;  2PO4 A;  4KI0 A;  4K8J A;  4A3C G;  2HHH Q;  5M5X H;  4JCV E;  4C3J H;  1G29 1;  3G71 A;  2GVA A;  4FXK C;  2KEC A;  4P2C B;  5C0X I;  2ASB A;  1JB7 A;  1D2B A;  5AJ3 L;  1BNZ A;  3S1M B;  1H9S B;  2MFI A;  3HOX G;  3VDY A;  4A3J H;  4WFN 3;  4B3S L;  3PIO A;  4FDB A;  3SK5 A;  4O0A A;  4DK0 A;  4F87 A;  5NUC A;  2IX3 A;  4TKO B;  2SNS A;  4A3M H;  2RDH A;  4BBR G;  3H3V I;  5DM7 3;  2Z6B A;  1E1T A;  4DV1 L;  4DR1 L;  2UXB L;  2WV6 D;  5HGT A;  3EA6 A;  1LV9 A;  4F88 A;  2EZV A;  4KHP L;  3P20 A;  2A69 D;  4L63 B;  2RSO A;  5M5X B;  1RJT A;  3KBG A;  2L0C A;  2OF1 A;  1G2S A;  3SHL A;  4C3J B;  1X9N A;  4LNQ A;  4OXP A;  4DK3 C;  5KGU A;  1YZ6 A;  1B3Q A;  4OON A;  1A15 A;  1G2T A;  2L4N A;  1A62 A;  2PNH A;  3H0G H;  1N9W A;  1EY0 A;  3OPO A;  4CDF C;  5K36 G;  4KD3 A;  1EYA A;  3J81 j;  1FNV A;  1Q90 A;  1HNZ L;  4DNR B;  2R7Z G;  4A3J B;  1V1O A;  1JJ2 A;  3K57 A;  4X62 Q;  1N8R C;  2XTI A;  1QZH A;  1E1O A;  2F0V A;  3SDZ A;  1U4P A;  1S4Z A;  4MN3 A;  2B63 G;  2B8F A;  4JI6 Q;  1PTO F;  5KND A;  4A3M B;  3OTO Q;  1QCB D;  1CSQ A;  4G57 A;  1STG A;  2R7D A;  3QB3 A;  3GP7 A;  1PH5 A;  1SE3 A;  2F03 A;  3VR5 A;  1LTA D;  2XWB B;  3EN2 A;  4HR7 B;  4DU9 A;  5JVH 3;  1N32 Q;  2A69 C;  3M85 A;  2F0O A;  2I07 B;  1UE5 A;  2B2V C;  4ZCK A;  5CMD A;  4LF4 Q;  1PH7 A;  3E6Z X;  4KN7 C;  4LK1 C;  3JAM L;  1ASZ A;  2EYF A;  2I0Q A;  3R8B A;  3H0G B;  4POF A;  2QEX A;  3A54 A;  3KLS X;  2O5I C;  1Q12 A;  3ZYY X;  1KC8 C;  5IYD G;  4L8J A;  1VQE A;  1XPR A;  3HOY H;  4QB4 A;  3PMF A;  2K5H A;  4J6H A;  3CCM A;  2Y0S B;  3CP0 A;  2DUD A;  3M4O B;  1XNQ Q;  5E3F A;  4CJ1 B;  3X3N A;  1EY7 A;  4HAE A;  5EQ0 A;  2WIN B;  1OXS C;  1ENC A;  3OMG A;  2K28 A;  4K8I A;  4JI8 Q;  1SMY D;  3TP8 A;  3WOF A;  5EKK A;  1KHI A;  2ZTC A;  1S72 A;  3MEH A;  1E3P A;  3PUW A;  3DMU A;  2OTJ A;  4DUZ Q;  4UDU C;  3Q23 A;  1EIY B;  4DNT B;  2VNU D;  2RKS A;  4R4O A;  4LF5 Q;  2DNC A;  2K5N A;  5C44 G;  3BZK A;  4QF4 A;  3LGJ A;  3N52 A;  2FJ2 A;  2Z6K A;  2DJG C;  3LX0 A;  3C1E A;  3NQT A;  2JSO A;  3M7G A;  3HOY B;  2KHI A;  4YY3 L;  4QUF A;  4DAP A;  2B2Y C;  3NWT A;  4DV7 L;  1MJE A;  2L11 A;  4IFD I;  1VQ7 A;  4JBW A;  1HR0 L;  2JE6 I;  1PZJ D;  4HJ7 A;  1PFN A;  1I6H H;  2LXK A;  5IGD A;  3RZO H;  1K8O A;  1E7Z A;  2XNA C;  4A3G G;  1PLF A;  4DV2 L;  5EGT A;  1VQ9 A;  1X55 A;  3E5S A;  1QUQ A;  1FJG Q;  3STB C;  1SE8 A;  2KHS A;  3Q22 A;  4JI3 Q;  2K6A A;  2RCN A;  4O42 A;  1SNO A;  1SYE A;  3LWE A;  3M4Q A;  2MO1 A;  1PZI D;  4MZ9 A;  3K5O A;  4FF2 A;  3I4L A;  1XMQ L;  4LUO A;  2PQA B;  3FDT A;  2E76 C;  4NKL A;  3GTP H;  2CWP A;  2WP8 J;  2FMM A;  4RG1 A;  3W2D A;  2HDM A;  1BF4 A;  2OEO A;  3KFU A;  2FIN B;  1CHQ D;  1I6H B;  2Z8L A;  1KRS A;  3C1F A;  3CCQ A;  3RZO B;  4DR3 Q;  2ZJQ A;  1QB5 D;  5IP7 G;  3I56 A;  2ZJP A;  1VQN A;  4GLA C;  1NY4 A;  1EY5 A;  3FRP B;  3KOJ A;  2P5Z X;  1SYF A;  5M3F G;  2UUC L;  3H3V C;  4JBJ A;  1XWE A;  1SYG A;  1SBB B;  4I65 A;  1J9O A;  1A3T A;  3F1Z A;  1JE4 A;  2K03 A;  2YV5 A;  1T5X D;  2K5Q A;  4LAA A;  4XT3 B;  1GUS A;  1ONL A;  2F0M A;  4A75 A;  4KKT A;  4GN5 A;  2GA4 B;  5E4X A;  5M5W H;  4B3T L;  1K83 H;  3EVQ A;  2AQ3 B;  4K0K Q;  4FO2 A;  2MQH A;  3GTP B;  4RFB A;  1L1O C;  5IP9 H;  4HSV A;  1PMR A;  2JA8 H;  1DON A;  1SYC A;  4C3J G;  3IAY A;  1MBY A;  1CZW A;  1UNS A;  1XNR Q;  4OHJ A;  2KQ3 A;  2L15 A;  3ICE A;  1TS2 A;  4HIK A;  3SK6 A;  1WYD A;  1OXT A;  1Q1B A;  1Q81 C;  2G5D A;  4A3J G;  1YJ9 A;  3MXG A;  1PTO C;  4UP9 A;  1C48 A;  4FF1 A;  5JPN C;  3WDN A;  3A8K E;  1FYC A;  2AUK A;  4DR5 L;  5IT9 E;  2ZTE A;  5IGC A;  1K9M C;  1GUW A;  5LL6 S;  2WB1 E;  1B8A A;  2IX0 A;  2HT1 A;  4A3M G;  1S5B D;  5CGK A;  1K3B C;  5T1G A;  2WB1 B;  3DM1 A;  4YWK A;  4ZQ3 A;  2I46 A;  3MWY W;  1JOK A;  1STB A;  1PH6 A;  1CQF A;  2ZT9 C;  1KDA A;  5HUR A;  5M5W B;  2F0N A;  1K83 B;  4K6D A;  2XN9 C;  5C0X H;  2CH4 A;  4X3U A;  4P73 A;  5EJW A;  1W3S A;  5I9P A;  5IGF A;  2JA8 B;  3S15 H;  3O13 A;  2RVL A;  2SEB D;  3NHH A;  4UAI A;  3CPF A;  3ERO A;  4KD4 A;  3H0G G;  1JWM D;  3KJO A;  3CRK C;  1ENA A;  4A3K H;  4TVA B;  2WAQ E;  2KUM A;  1KIX A;  1GO3 E;  3FKI H;  4XTC S;  3J81 c;  1TU2 B;  4CHT B;  4X65 Q;  3H3V H;  3PGZ A;  1DYQ A;  4JI5 Q;  4X66 Q;  1SEB D;  1AN8 A;  3V96 A;  1Q46 A;  1CKO A;  4MTK A;  1HZA A;  4WJ3 M;  4ULL A;  4P72 A;  2WFW A;  3FHW A;  2LSS A;  1PDQ A;  1AW7 A;  2FHT A;  1B50 A;  2PYK A;  3PUZ A;  4X64 L;  2EXZ A;  5JPM C;  2HIV A;  3QOL A;  4JOI C;  3OWF A;  4RA8 A;  4DUY Q;  1STY A;  1WD1 A;  2M00 A;  2EYM A;  1JWS D;  4FXG C;  5BR8 Q;  2KBN A;  2NZ1 D;  4XDX A;  1UEB A;  4LF6 L;  1TVX A;  2NTT A;  1LUZ A;  2MNA A;  3MA2 B;  3T1Y L;  1WTX A;  1N33 Q;  1UEA B;  3Q6S A;  3S15 B;  4DK6 C;  1KNA A;  2DN8 A;  1TKW B;  1VQC A;  4FYD A;  1HXY D;  3GO5 A;  2K05 A;  3TEH B;  2HCI A;  2TSS A;  4KHZ A;  1YJN A;  1DOK A;  3J7Y W;  4A3K B;  4QUC A;  1PTO H;  5AFW A;  2K32 A;  3FKI B;  4BXX H;  1TQO A;  1CT1 D;  5ELD A;  1QZG A;  2RA4 A;  2JQO A;  4CDD C;  2MGS A;  3G7L A;  3SGI A;  1HFG A;  3HOY G;  3VR3 A;  1EY9 A;  1HQM C;  4BY1 H;  2M2L A;  1SRU A;  3W1B A;  1JIC A;  4JI1 Q;  1PFB A;  3DWQ A;  2IW3 A;  2Q2I A;  3AQQ A;  1JOR A;  1H95 A;  4CJ2 C;  4HCS A;  3H09 A;  3AFP A;  1G91 A;  2PCF B;  2R61 A;  1DGS A;  5I2X A;  2OXP A;  3HFZ B;  2F0G A;  2HHH L;  1L1O B;  4OWW B;  1GHJ A;  5CBE E;  1CHP D;  2EJF C;  3PUY A;  5I9O A;  4XYQ A;  1F2Z A;  5KRU A;  4GKK Q;  5FOB B;  3T53 B;  4KJO A;  1EFI D;  1LTB D;  3F2C A;  4NPS A;  3KK7 A;  1F77 A;  4HIM A;  2VUM H;  4R1J A;  1PZK D;  5CV6 A;  1PTO B;  2C5C A;  4LMQ D;  4RCN A;  2R7Z H;  1XYI A;  3CC2 A;  3BU2 A;  1NSN S;  5IGE A;  3D6W A;  1LTT D;  3PUX A;  2ALY B;  4BY1 B;  1IHZ A;  2F0I A;  3JAM i;  1OXU A;  1YJW A;  3K8A A;  3UI2 A;  1RCV D;  1FNU A;  3R2T A;  3DEP A;  4RGO S;  4HCE A;  1V1Q A;  1O7L A;  2QCP X;  3U50 C;  3K5N A;  3F2U A;  3UDI A;  3SK4 A;  3BYT B;  4OL7 A;  4NB3 A;  2K5V A;  4DAY A;  3CC4 A;  2YTX A;  1R9T H;  3FP9 A;  5EKL A;  3L2P A;  2DNE A;  2EYH A;  1BKB A;  2K4K A;  3U9O A;  3CQZ H;  3A8I E;  2Z0S A;  2VUM B;  4R4C A;  5CV8 A;  2BA1 A;  3W1G A;  2R7Z B;  1XMO Q;  3VR6 A;  1I6V C;  4X62 L;  3J7A 5;  2CCZ A;  4IFD H;  2F0J A;  1DJR D;  4ABN A;  4JI6 L;  2VQF Q;  4IOA A;  1AE3 A;  1JCK B;  3ONA B;  2EJM A;  1Z6H A;  3OTO L;  4F8M A;  2X6L A;  2F0U A;  2IWH A;  4CDC C;  5C4H A;  3IFD A;  3A7A B;  3BG3 A;  1RF2 D;  1WFQ A;  4HID A;  1N32 L;  3GV3 A;  5IOD A;  5ELC A;  5A35 A;  4BA2 I;  1A63 A;  3V05 A;  1R9T B;  4LF4 L;  2NUC A;  1J5E Q;  5FLM H;  1V1P B;  4IPG A;  2NYZ D;  1WTV A;  3CQZ B;  3D31 A;  5FO7 B;  3IL8 A;  4DFA A;  2WB1 G;  1FD7 D;  3S1R H;  4RMF A;  5TSS A;  3H94 A;  1E0B A;  3TS0 A;  1BBW A;  4DR7 Q;  3X3M A;  4QMG A;  4QY7 A;  1XNQ L;  2SDF A;  5IP9 G;  1NJI C;  2R3Z A;  1QVF A;  2JA8 G;  1B7Y B;  3TSS A;  3PO3 H;  1B44 D;  5CBA E;  3OW7 A;  1O7Y A;  1EEF D;  2JN4 A;  1PFS A;  1T5E A;  4JI2 Q;  4JI8 L;  1VQ4 A;  4HJ8 A;  2K01 A;  2XVS A;  1YNJ D;  4YWM A;  4DUZ L;  1VQ6 A;  5EBD A;  3H91 A;  4LFB Q;  1ASY A;  4LF5 L;  1GKH A;  1SNP A;  2FXQ A;  3I73 A;  3S1N H;  2A6H D;  1TT2 A;  1ROD A;  4HMI A;  4LFA Q;  4DV3 Q;  1GUO A;  3VYT A;  2Z1C A;  4DV6 Q;  3S1R B;  1DCZ A;  2JJQ A;  4A3D H;  2AQ2 B;  4DR4 Q;  1FR3 A;  1GJX A;  1JJG A;  1MI2 A;  5C0X G;  1EZ8 A;  2AQ1 B;  1B1Z A;  2WII B;  3EQL C;  4DV4 L;  2EY6 A;  3PO3 B;  5D3D A;  3OYY A;  1RKN A;  5KEE A;  1IYV A;  2A6E D;  1F2M A;  3ERQ A;  4NXM Q;  4LFC Q;  3A7L A;  1JWU D;  4A3K G;  3HKZ E;  4RAU C;  3OHX C;  3OMC A;  1Q8K A;  3FKI G;  1I4P A;  4B9W A;  1HJP A;  4A3L H;  3HKZ B;  1YNJ C;  3OWE B;  1FJG L;  1PH2 A;  2F0E A;  4IQZ A;  1WCM H;  1WTP A;  5M3F H;  4GS3 A;  2PMZ E;  1PYS B;  2RF4 A;  2JA9 A;  1GUG A;  4JI3 L;  3S1N B;  3BDL A;  2PMZ B;  3ITP A;  1WD0 A;  4PZ6 A;  1IBK L;  3QOJ A;  4R4Q A;  4HSP A;  2BE5 D;  1EZ6 A;  4A3D B;  1R4P B;  1RL2 A;  2ZM6 Q;  1CTM A;  1KNE A;  3JC6 6;  4HMJ A;  5GRO A;  4R8I A;  3BZC A;  1L0W A;  3UDX A;  3J7A F;  3PCO B;  1HZC A;  1TWF H;  2XSC A;  1PH8 A;  4NW2 A;  1VQG A;  5GQO A;  2NBF A;  2A6E C;  4ZUI A;  3T4A C;  3NTH A;  4JBK A;  5C4J H;  4DR3 L;  1VQL A;  2J4X A;  3V2T A;  4R4T A;  4B9X A;  3R2I A;  4BXX G;  5CYU A;  4IO9 A;  4L5S A;  1XX8 A;  1Q86 C;  4LUV A;  1WCM B;  5CR3 A;  5M3F B;  4EQP A;  4BY1 G;  1SDF A;  3C3L A;  4RHS A;  3IRB A;  3I4O A;  3K5M A;  1STE A;  5FLX L;  5C5L A;  3W3A A;  2XGT A;  1YHQ A;  5JAV A;  5KYL A;  2BE5 C;  4J8Q A;  5M5Y H;  1HTP A;  1HH2 P;  4K0K L;  1L2F A;  1C0A A;  1UWV A;  2QIL A;  2CHB D;  2FMC A;  1UE7 A;  4UP8 A;  2MHV A;  4EX5 A;  1TWF B;  2JEB I;  3I4N H;  2F0Q A;  3G6E A;  1XNR L;  3HP3 A;  5C4J B;  2VUM G;  2K04 A;  1B53 A;  1Q8I A;  3QG1 A;  2IHE A;  1A8V A;  3BYY B;  3VR4 A;  2R7F A;  3BVZ A;  2TMP A;  4DAY B;  3T1H Q;  1EL0 A;  4QGU A;  4A3F H;  2ZXP A;  1M4V A;  5M5Y B;  1CI3 M;  1W6J A;  5J39 A;  3E9I A;  2PW7 A;  4GNX A;  3MXN A;  3MXU A;  5IE8 A;  4K5X A;  3A5Z B;  3I4N B;  1A6X A;  1T9H A;  2B2T C;  3CME A;  1V8Q A;  2E2H H;  4AH6 A;  1VCI A;  3IFT A;  4O1N A;  4OO1 I;  1KLU D;  1KDC A;  4ZAI A;  4G7O C;  4X65 L;  2F3W A;  5FJ8 H;  4JI5 L;  4BBS H;  4IFD G;  4X66 L;  5BN4 A;  3BS1 A;  1EY4 A;  1YHB A;  4OWX B;  4PMW A;  1LO5 D;  2XIW A;  1CUK A;  3GV6 A;  5D14 A;  2E2D C;  3CRL C;  3S9W A;  5JVG 3;  4Q0F A;  4A3F B;  4JPB W;  5ELO A;  4RGN A;  2E74 C;  5I6Y A;  2FFK B;  5C0X J;  5H1S E;  2F0H A;  4DUY L;  4HIO A;  1RIP A;  1SAP A;  1VQH A;  2AMC B;  2PPB C;  5BR8 L;  4CJ0 B;  4RGT A;  1X3E A;  1EY8 A;  1N33 L;  5FLM G;  3STB D;  3M9B A;  1X3Q A;  2X6G A;  2D9U A;  2QA4 A;  4MHE A;  2E2H B;  4C1N K;  3TDQ A;  1SNM A;  2UXC L;  1BCP F;  3L0O A;  1HFN A;  4RHR A;  3DHQ A;  3KF8 B;  3KF6 B;  4XT1 B;  4BBS B;  2YTV A;  1STH A;  4P75 A;  3M4Y A;  1K3R A;  1P16 A;  5A2Q E;  4JI1 L;  2KCM A;  2B2U A;  5C4Z A;  1QWY A;  3PO3 G;  5GAE C;  4DV4 Q;  1YNN C;  2AUJ D;  5IYC H;  4LF8 L;  4DPG A;  4QIW E;  1K8M A;  3BDO A;  3A0J A;  3F2D A;  1HUM A;  1SND A;  1GUT A;  2QW7 A;  1EFW A;  2A74 C;  3HKZ G;  4KKU A;  3CCU A;  4QJF A;  4K2K A;  4GKK L;  5C4X G;  1DXM A;  1JR0 D;  1RD9 D;  5CV5 A;  4DF7 A;  2EYJ A;  1LTR D;  4OIJ A;  3S2D H;  3J81 E;  3K7A H;  1TWH H;  1SJH D;  4GNX C;  3W5O A;  2N49 A;  3J80 i;  2E2I H;  2PZW A;  4QL5 A;  1I4H A;  4JG2 A;  1IBK Q;  4A3D G;  5C3X A;  1VQF A;  1QE6 A;  2QF7 A;  3PQI A;  1IYJ B;  2ES2 A;  3UDF A;  1PRT F;  3J80 E;  1EQR A;  3R3O A;  4RKL A;  3S2H H;  1W2B A;  1AZQ A;  4JI0 Q;  5HGQ A;  1AZP A;  2RQX A;  4JYA L;  4AIM A;  3VYR A;  4WOR A;  4A3L G;  4IOC A;  1PTO D;  3GTQ H;  5KIX A;  1WCM G;  1K8A C;  1BDO A;  2EDG A;  2J0T D;  3S2D B;  5E1F A;  1S5C D;  3K7A B;  1TWH B;  4IPD A;  5M3M H;  4UHV A;  2E2I B;  1C4Q A;  2VB3 X;  2Z9H A;  1XMO L;  1HRJ A;  3K7U C;  1WJJ A;  5D3I B;  1N34 Q;  2K14 A;  1IL8 A;  3UDG A;  2VQF L;  4A3E H;  1K73 C;  4BY7 H;  4X3K A;  3S1Q H;  2F0D A;  1UAP A;  1C9O A;  3ER0 A;  2Z6K C;  1BUV T;  2A5H A;  3S2H B;  1I4X A;  3LNN A;  1IBL Q;  4V19 0;  2F0L A;  3BJU A;  3U4V A;  1D5Z C;  2MUY A;  3GTQ B;  3I2Z A;  1J5E L;  3S14 H;  4X3S A;  3DUZ A;  1R4Q B;  1EEI D;  3NEL A;  1VDZ A;  1KTK A;  4JI4 Q;  4IFD J;  4YIJ A;  5M3M B;  2EY5 A;  3RLF A;  1EU4 A;  1CZG A;  1GM5 A;  3DWP A;  2R93 H;  4U67 3;  4HTH A;  3NQI A;  4WJ4 A;  1S5E D;  3A55 A;  1LTI D;  4DR7 L;  4A3E B;  4BY7 B;  5JEA H;  1TY0 A;  3S1Q B;  3AB9 A;  1VS0 A;  2UU9 L;  3I4N G;  5CC4 A;  4LF7 Q;  4FNF A;  1CM9 A;  3C2P A;  4IUV A;  2LS0 1;  4R8N A;  4JI2 L;  1VQB A;  1EIG A;  3FPU B;  2G9H D;  4PMB A;  4GKJ Q;  1G51 A;  3PV0 A;  2SOB A;  2RBM A;  1AFP A;  1Z47 A;  2MJ8 A;  2UUA Q;  2CW0 D;  4DR6 L;  2WAQ B;  3S14 B;  2KA7 A;  1Y8O B;  2KJX A;  4LFB L;  1Y69 U;  4GNX B;  1TS4 A;  3M3Y H;  4L5R C;  3CU7 A;  3ULL A;  4MTN A;  4DV3 L;  4LFA L;  3OOC A;  5DEH A;  2JA7 H;  4EQO A;  4DV6 L;  5FO9 B;  4A3F G;  4TQU S;  1QVG A;  2H1E A;  4AYB E;  2R93 B;  1J6Q A;  4RGM A;  3IKJ A;  4GZY C;  4DR4 L;  1CKN A;  5KNB A;  4AYB B;  3RD4 A;  4LF9 Q;  4EVO A;  2ID0 A;  5EBC A;  1OO9 B;  3TME A;  4Z9C B;  3DWA A;  1TII D;  1NMF A;  3NBH A;  1YBY A;  2E2J H;  1Q1E A;  3SVM A;  4JC0 A;  1C8C A;  2RDG A;  4LFC L;  1F9Q A;  4NXM L;  1HA6 A;  1A2T A;  3F2B A;  4P74 A;  3GTJ H;  2UXC Q;  1HNW Q;  4GLX A;  4DK1 A;  4RKB A;  2CW0 C;  5I2Y A;  5FJ8 G;  3TRE A;  4BBS G;  3FPP A;  2A68 D;  5C6A A;  3M3Y B;  1A3U A;  3U4Z A;  4CKE A;  2PNR C;  2EE1 A;  3P75 A;  2JA7 B;  2IHF A;  3BDC A;  3B6Y A;  2MPM A;  1A0I A;  3NXW A;  1VMC A; 
#chains in the Genus database with same CATH homology
 3ZJY C;  2KHJ A;  4LF8 Q;  2B63 G;  2I5L X;  2ZM6 L;  4JI6 Q;  1PH4 A;  4YWM A;  4DUZ L;  3AFQ A;  1VQ6 A;  1HZB A;  3OTO Q;  1GD7 A;  1BVS A;  3AEV A;  1SN8 A;  5AJ3 Q;  1ASY A;  4LFB Q;  1CSQ A;  1GKH A;  2FXQ A;  4LF5 L;  2R7D A;  3S1N H;  1IZ6 A;  4NXN L;  3PO2 H;  4LFA Q;  5IYB H;  4DV3 Q;  1PH5 A;  1MJC A;  4C3H H;  4B3S Q;  2JA6 G;  1PH3 A;  3EN2 A;  4DV6 Q;  1N32 Q;  4JOI A;  3M85 A;  1LM0 A;  2JJQ A;  4A3D H;  4X6A H;  5IWA Q;  1UE5 A;  2AWO A;  3A74 A;  2CFM A;  1XNQ L;  2Q2U A;  3K81 C;  4DR4 Q;  4LF4 Q;  1NMG A;  5GAD C;  5LMN L;  1UE1 A;  1PH7 A;  1HZ9 A;  1JJG A;  5C0X G;  1PV4 A;  1ASZ A;  1VQK A;  1O7I A;  2OTL A;  3G48 A;  2VL6 A;  3KDF A;  3RLN A;  1I94 L;  4DV1 Q;  4DV5 L;  4HJ5 A;  4POF A;  2I0Q A;  1VQA A;  3HOW G;  4DV4 L;  4DR1 Q;  2UXB Q;  2QEX A;  4YHH L;  1X56 A;  1LYL A;  3OYY A;  4KHP Q;  1LTL A;  1Y1V G;  1Q12 A;  3HOU G;  4PZ8 A;  4NXM Q;  1TWA H;  1KC8 C;  5IYD G;  4LFC Q;  1N36 Q;  1NTG A;  1QUQ B;  1VQE A;  3HKZ E;  4A3K G;  1XPR A;  3HOY H;  1HNX Q;  1PHJ A;  5IYC G;  1Q8K A;  2YTY A;  3FKI G;  1Y1W H;  2K5H A;  1HJP A;  4A3L H;  1U5K A;  3CCM A;  3CP0 A;  2DUD A;  1FJG L;  1PH2 A;  1XNQ Q;  3CCR A;  2GN5 A;  1WCM H;  1V9P A;  5M3F H;  3H15 A;  4GS3 A;  4JYA Q;  2PMZ E;  2VW9 A;  1PYS B;  2RF4 A;  2JA9 A;  4JI3 L;  1NBW A;  4GOP B;  2A19 A;  1HNZ Q;  1VQ8 A;  1OXS C;  3CCS A;  1XPU A;  4PZ6 A;  1X65 A;  4JI8 Q;  1IBK L;  2HIX A;  3D0F A;  4R4Q A;  1OXX K;  1KHI A;  1V43 A;  2ZTC A;  3U58 A;  4JI7 Q;  3CPW A;  1S72 A;  1RL2 A;  1E3P A;  3PUW A;  2ZM6 Q;  2RHQ B;  4IJL A;  2OTJ A;  4DUZ Q;  2MO0 A;  3JC6 6;  1EIY B;  5GRO A;  4UP7 A;  2VNU D;  3BZC A;  1L0W A;  3UDX A;  2JA5 G;  4R4O A;  4LF5 Q;  2K5N A;  5C44 G;  3BZK A;  3PCO B;  2QGQ A;  4NXN Q;  1HZC A;  1TWF H;  1I3Q H;  1PH8 A;  5JJL A;  2PI2 A;  3LGJ A;  3T1H L;  4JV5 L;  1VQG A;  3TQY A;  5GQO A;  1SFO H;  2Z6K A;  3CCL A;  4JBK A;  5C4J H;  4DR3 L;  1S40 A;  1VQL A;  2A1A A;  4A93 G;  1OXV A;  1S3O A;  2R6G A;  4R4T A;  1PYB A;  3MXN B;  2KHI A;  4C3I H;  1OTC A;  1K0R A;  2VQE L;  4YY3 L;  4BXX G;  1YI2 A;  5LMN Q;  1VQM A;  4IO9 A;  3HOV G;  2D0P A;  4L5S A;  4DV7 L;  1Q86 C;  4LUV A;  1MJE A;  4B3R L;  4DV5 Q;  1VQ7 A;  4IFD I;  5JJI A;  4DR2 L;  2R92 H;  1E24 A;  4JBW A;  4BY1 G;  5J3B A;  1TXY A;  1HR0 L;  2JE6 I;  4HJ7 A;  1VQ5 A;  5IY0 A;  4YHH Q;  1I6H H;  3IRB A;  2GVB A;  3HOZ H;  2LXK A;  3I4O A;  1EUJ A;  3RZO H;  1E7Z A;  2XGT A;  3KLW A;  4AQY L;  1YHQ A;  4A3G G;  4DV2 L;  5M5Y H;  1VQ9 A;  5M3M G;  2NVT H;  3TRZ A;  1X55 A;  2Y0S G;  3PIP A;  1HH2 P;  4K0K L;  1QUQ A;  5C3E H;  1FJG Q;  3STB C;  1L2F A;  1MKH A;  1C0A A;  1UWV A;  1SE8 A;  2C35 B;  2EIF A;  3F8T A;  4IPH A;  1UE7 A;  2H5X A;  4UP8 A;  4JI3 Q;  4EX5 A;  2JEB I;  2RCN A;  3RZD H;  1PH1 A;  4DKA C;  3J80 c;  4A3E G;  3I4N H;  1KXL A;  4BY7 G;  3M4Q A;  3G6E A;  1XNR L;  2MO1 A;  3PSI A;  4MZ9 A;  1XMQ L;  4A3C H;  4LUO A;  2CQO A;  2UU9 Q;  2VUM G;  2PQA B;  1D7Q A;  1WI5 A;  3CMA A;  3CCJ A;  3WWV A;  4YCW A;  1UE6 A;  5FLX c;  3GTP H;  2CWP A;  2IHE A;  2WP8 J;  1A8V A;  4RG1 A;  4APV A;  3A5U A;  2R7F A;  3KFU A;  4DAY B;  3T1H Q;  2VZA A;  2WAQ G;  3HOX H;  1KRS A;  4QGU A;  4DR6 Q;  5C4X H;  1B70 B;  3CCQ A;  1Q82 C;  4DR3 Q;  1PA6 A;  2ZJQ A;  4A3F H;  2AWN A;  5IP7 G;  3I56 A;  3DLL A;  2ZJP A;  1FL0 A;  2KCT A;  2VQE Q;  3E9I A;  4YY3 Q;  4GLA C;  1VQN A;  1NY4 A;  2YYZ A;  3KOJ A;  4B3M L;  5HY6 A;  4GNX A;  4BBR H;  3CCV A;  5M3F G;  4DV7 Q;  2UUC L;  4JBJ A;  2F4V L;  4B3R Q;  2R93 G;  4DR2 Q;  3OW2 A;  4AYB G;  1HR0 Q;  5IE8 A;  3A5Z B;  1IXR A;  1T9H A;  3F1Z A;  2V1C C;  2YV5 A;  5LMU L;  5JEA G;  4A3B G;  3CME A;  1VQP A;  3K80 C;  1C7Y A;  2E2H H;  4AH6 A;  1VCI A;  2JK8 A;  4AQY Q;  3RLO A;  1XTD A;  4Y7N H;  3I4M H;  4DV2 Q;  4OO1 I;  3CW2 C;  4A75 A;  1PH9 A;  4Y52 H;  4GN5 A;  5M5W H;  4B3T L;  3TS2 A;  1K83 H;  1KL9 A;  4LWC A;  3RR5 A;  4X65 L;  4K0K Q;  2MQH A;  4LFA L;  3G4S A;  1L1O C;  5FJ8 H;  4JI5 L;  5IP9 H;  4BBS H;  4IFD G;  4X66 L;  4A3I H;  2JA8 H;  1YIT A;  5IT9 c;  2VS1 A;  4HJ9 A;  1YHB A;  3K0X A;  4H02 A;  4OWX B;  3PF4 A;  4UY8 C;  4PMW A;  1XNR Q;  1CUK A;  2N3S A;  4LUZ A;  2Q2T A;  2L15 A;  3ICE A;  3KYH C;  1XMQ Q;  4HIK A;  3MEF A;  1WYD A;  1OXT A;  1Q1B A;  2NZO A;  5ELO A;  1Q81 C;  5C0X J;  4JBM A;  5H1S E;  5LMN W;  4DUY L;  4HIO A;  4A3J G;  1RIP A;  1YJ9 A;  2IT1 A;  2UUB L;  1Z9F A;  1TWC H;  4UP9 A;  3JAM c;  3NBH B;  1EWI A;  1VQH A;  2AMC B;  2UXD L;  5BR8 L;  1KQS A;  2IY5 B;  3ERS X;  3Q8D A;  4DR5 L;  1X3E A;  2ZTE A;  1K9M C;  1N33 L;  2BA0 A;  2WB1 E;  1B8A A;  1Q7Y C;  2IX0 A;  2I5H A;  2HT1 A;  4A3M G;  1YEZ A;  5FLM G;  3CAM A;  3M9B A;  3STB D;  2JA6 H;  4YWK A;  1VQI A;  2N78 A;  2QA4 A;  4A76 A;  2NVX H;  1VQJ A;  1PH6 A;  1QVC A;  2JA7 G;  2UXC L;  1M90 C;  3L0O A;  1WOC A;  3KF8 B;  4JI0 L;  3CC7 A;  1YHA A;  2UUC Q;  3KF6 B;  2F4V Q;  4GLV B;  4P73 A;  1W3S A;  2YTV A;  4P75 A;  2D62 A;  4R4I A;  1AE2 A;  2OQK A;  2B29 A;  5ELN A;  3HOW H;  3S15 H;  1VQO A;  1K3R A;  1P16 A;  1IL2 A;  3CPF A;  1AH9 A;  5LMU Q;  4JI1 L;  1Y1V H;  2KCM A;  3H0G G;  3KJO A;  3HOU H;  2NN6 I;  1I94 Q;  5IYD H;  2LXJ A;  3CCE A;  3PO3 G;  5GAE C;  4A3K H;  4DV4 Q;  2F3I A;  4TVA B;  2WAQ E;  1EOV A;  2CWA A;  2K50 A;  1GO3 E;  3FKI H;  4XTC S;  5IYC H;  3J81 c;  1KIX A;  4B3T Q;  4LF8 L;  4DPG A;  4X65 Q;  4QIW E;  3PGZ A;  2BH2 A;  3H3V H;  5GAH C;  1X54 A;  3A0J A;  4EQ5 A;  3F2D A;  4JI5 Q;  4PG3 A;  3GTM H;  4X66 Q;  1TWG H;  1N34 L;  1EFW A;  1Q46 A;  3HKZ G;  3CCU A;  1CKO A;  4KLK A;  1HZA A;  4HJA A;  4QJF A;  3ULP A;  2K52 A;  4GKK L;  4WJ3 M;  4P72 A;  2WFW A;  5C4X G;  3FHW A;  2LSS A;  4MNO A;  1VQ4 A;  4YCU A;  4X64 L;  3PUZ A;  1JMC A;  3S2D H;  2HIV A;  5IWA L;  4OO1 G;  4QQB X;  4GNX C;  3K7A H;  1TWH H;  1YNX A;  3GD7 A;  4JOI C;  5IYB G;  3W5O A;  2N49 A;  3KDF B;  3GTK H;  3J80 i;  4DUY Q;  5DLQ E;  2E2I H;  2E8G A;  2OWO A;  2UXD Q;  4QL5 A;  2IX1 A;  5BR8 Q;  2KBN A;  3E0E A;  4JG2 A;  1SMX A;  1UEB A;  5E7N A;  1IBK Q;  4LF6 L;  2Q2H A;  4A3D G;  4DR5 Q;  1VQF A;  1LUZ A;  2MNA A;  4GOP A;  3T1Y L;  1M1K C;  1IBL L;  1HR0 W;  2JA5 H;  1N33 Q;  1IYJ B;  1YVC A;  4YCV A;  5C44 H;  3CF5 A;  3GTG H;  4DK6 C;  1FVI A;  1VQC A;  2EXD A;  2ES2 A;  3GO5 A;  3UDF A;  1YJN A;  3TEH B;  4KHZ A;  3I4M G;  4A93 H;  1NE3 A;  1EQR A;  4JI4 L;  2OCE A;  1MIU A;  2ZTD A;  1X3G A;  4JV5 Q;  3S2H H;  1W2B A;  4BXX H;  1QZG A;  1FGU A;  4JI0 Q;  2JQO A;  1JE5 A;  5HGQ A;  3DM3 A;  3HOV H;  3SGI A;  3HOY G;  4JYA L;  4AIM A;  4POG A;  1G6P A;  2NVY H;  1Y1W G;  3UE0 A;  4BY1 H;  4L5T A;  4A3L G;  2B3G A;  2CKZ B;  3L7Z C;  2BH8 A;  4IOC A;  3GTQ H;  3KF6 A;  2EQS A;  2RHS B;  1SRU A;  1CSP A;  3EBE A;  3W1B A;  1WCM G;  4JI1 Q;  3GTO H;  1K8A C;  1H95 A;  2Q2I A;  3AQQ A;  4A3G H;  1SLJ A;  4IPD A;  2AKW B;  3KJP A;  4DV0 L;  4LF7 L;  2PI2 E;  3AFP A;  3CXC A;  5M3M H;  3PO2 G;  3RNU A;  1DGS A;  3HFZ B;  1XMO L;  2HQL A;  3M4O H;  1X3F A;  3M7N A;  2HHH L;  1L1O B;  4OWW B;  3K7U C;  3RN2 A;  1WJJ A;  3GTL H;  1N34 Q;  2K14 A;  3PUY A;  4GKJ L;  4O2D A;  5GAG C;  3UDG A;  4PZ7 A;  3UE1 A;  2VQF L;  3I55 A;  2DGY A;  2UUA L;  4A3E H;  4GKK Q;  1K73 C;  4BY7 H;  3F2C A;  1SR3 A;  4NPS A;  2NN6 G;  3S1Q H;  3EIV A;  4X64 Q;  1C9O A;  4DAM A;  3ER0 A;  2Z6K C;  2E5L L;  4HIM A;  2VUM H;  4R1J A;  1I5F A;  2N8N A;  1CKM A;  2R7Z H;  1CKN B;  2K75 A;  3CC2 A;  4LF6 Q;  2VY3 A;  3BU2 A;  5EAY A;  1IBL Q;  3T1Y Q;  1SRO A;  4YWL A;  5JEA J;  3BJU A;  4C2M H;  3PUX A;  3U4V A;  2ALY B;  1P8L A;  3NEM A;  3JAM i;  2NZH A;  3HKS A;  4LF9 L;  3I2Z A;  1OXU A;  1J5E L;  1YJW A;  1YIJ A;  4JI7 L;  3K8A A;  3CD6 A;  3S14 H;  2PQA A;  1EIF A;  3I7F A;  3NEL A;  1X6O A;  2R92 G;  1BBU A;  1V1Q A;  2Y0S E;  5IP7 H;  4JI4 Q;  3S1M H;  3U50 C;  3UDI A;  3HOZ G;  4IFD J;  1I50 H;  3RLF A;  3E9H A;  1GM5 A;  1IBM L;  2KEN A;  3S24 A;  5JJK A;  2R93 H;  4NB3 A;  2K5V A;  1KAW A;  3CC4 A;  2YTX A;  4DNI A;  2D0O A;  3PUV A;  3FP9 A;  1R9T H;  1HNW L;  4WJ4 A;  3L2P A;  5C3E G;  3PF5 A;  4B3M Q;  4DR7 L;  4A3B H;  1GVP A;  1BKB A;  2K4K A;  3CQZ H;  4ALP A;  4OX9 L;  4BBS G;  1EQQ A;  1VS0 A;  1E22 A;  2UU9 L;  3I4N G;  2Z0S A;  4DV0 Q;  4R4C A;  4GOP C;  4LF7 Q;  2BA1 A;  3M4P A;  2A8V A;  1U0L A;  3W1G A;  2JEA I;  4KI0 A;  3NEN A;  3ULJ A;  1XMO Q;  4X62 L;  3J7A 5;  4A3C G;  2CCZ A;  1D8L A;  2HHH Q;  5M5X H;  4JCV E;  4JI2 L;  1VQB A;  4XIG S;  1KRT A;  4C3J H;  4GKJ Q;  3RN5 A;  1G51 A;  3PV0 A;  1G29 1;  3J81 i;  3G71 A;  1JJC B;  3GDE A;  4JI6 L;  1Z47 A;  1L1O A;  2VQF Q;  1AE3 A;  2GVA A;  2UUA Q;  4IOA A;  4BA1 I;  3S17 H;  4DR6 L;  3OTO L;  4L5Q A;  5C0X I;  2NVQ H;  2ASB A;  1JB7 A;  5AJ3 L;  4LW1 A;  4LFB L;  4GNX B;  2E5L Q;  3M3Y H;  1XPO A;  4L5R C;  3ULL A;  4IJH A;  4MTN A;  4OWT B;  4DV3 L;  2MFI A;  3J7Z C;  2OQ0 A;  1Y14 B;  3HOX G;  3VDY A;  4A3J H;  4B3S L;  2JA7 H;  1WFQ A;  4HID A;  2ATW A;  3PIO A;  4DV6 L;  1N32 L;  4FDB A;  4A3F G;  3AYH B;  4TQU S;  1QVG A;  4AYB E;  1J6Q A;  4O0A A;  1XJV A;  2B63 H;  1JT8 A;  4BA2 I;  4DR4 L;  1CKN A;  4GN3 B;  1A63 A;  4LF4 L;  2UUB Q;  4LF9 Q;  4IPC A;  4A3M H;  2ID0 A;  1J5E Q;  2I5M X;  5FLM H;  4BBR G;  3H3V I;  4IPG A;  1E1T A;  4DV1 L;  1KD1 C;  1NMF A;  3D31 A;  1YBY A;  4DR1 L;  2UXB L;  2E2J H;  4P71 A;  1Q1E A;  2WB1 G;  4JC0 A;  4KHP L;  3S1R H;  1K8G A;  4J15 A;  4LFC L;  1IBM Q;  4NXM L;  2F52 A;  1N36 L;  4RMF A;  1HNX L;  3F2B A;  4ME3 A;  4P74 A;  3GTJ H;  2UXC Q;  1X9N A;  1EYG A;  4LNQ A;  4OXP A;  4DK3 C;  4GN4 B;  1YZ6 A;  4GLX A;  1HNW Q;  3TS0 A;  1BBW A;  2ZJR A;  4OON A;  4DR7 Q;  4QY7 A;  5FJ8 G;  3TRE A;  1A62 A;  2PNH A;  5IP9 G;  1NJI C;  3H0G H;  2YU9 H;  1QVF A;  4A3I G;  1B7Y B;  1N9W A;  2JA8 G;  1VQD A;  1PVO A;  5K36 G;  4OX9 Q;  3PO3 H;  3U4Z A;  3J81 j;  1HNZ L;  2R7Z G;  4A4I A;  2IHF A;  1JJ2 A;  3B6Y A;  3S16 H;  4X62 Q;  4JI8 L;  1PFS A;  1A0I A;  4JI2 Q;  4UPA A;  1N8R C;  2XTI A;  1QZH A;  1E1O A;  4HJ8 A;  2AHO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...