1NMGA

Major cold-shock protein, nmr, minimized average structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR COLD-SHOCK PROTEIN
publication title Structure in solution of the major cold-shock protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulation
total genus 4
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1996-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1nmgA00
2WAQG 2NZHA 3BJUA 4YHHL 3T1HQ 1C0AA 4DV2Q 4AH6A 4C2MH 4JBWA 3RR5A 2MQHA 4R4OA 3F2DA 3MEFA 3PIOA 2ZJPA 1J5EQ 1OXUA 1VQ4A 2GN5A 4HIKA 4JI6L 3K7AH 4JI1L 5JJKA 3A5ZB 5IP7G 2R92H 3UDIA 4AIMA 4A3EG 4A3KG 4YCUA 4X65Q 4YCVA 2E2HH 2A19A 4A93H 5DLQE 3RLFA 3RN5A 1Q82C 3B6YA 4A3FH 3S14H 5GADC 2NVXH 2I5MX 2D0PA 1SMXA 3BU2A 3GTOH 4LF9L 3PO2G 1X3GA 2DGYA 2PQAA 4X62Q 4NXMQ 2EXDA 1VQ9A 2UXDQ 2BA0A 5IYDH 1YHQA 1VQHA 2R92G 1N32Q 4YCWA 1Q12A 3NELA 1HZBA 3CPWA 1R9TH 4JI2L 4JI7Q 4PZ7A 4DV6L 4JI0L 4BY7H 2AHOB 5ELNA 1XPOA 1S72A 1QZGA 3OW2A 1EWIA 1PH9A 4R1JA 4JV5L 1G51A 1VQGA 4LF8Q 5H1SE 3WWVA 2ZJQA 4JBMA 1Q8KA 5AJ3L 4IPHA 5E7NA 4LFAL 3J7A5 1LTLA 3F2CA 3PUYA 5FJ8H 3T1YL 4YY3Q 1W2BA 4BXXH 5IYCH 4LFCL 1HZCA 2YU9H 1FJGL 4DR1Q 3JAMc 5LMNL 2HQLA 4O0AA 2NVTH 1TWAH 1VQOA 1X54A 2UXCL 3H3VH 1D7QA 4LUVA 2N78A 1N34Q 4GOPB 4Y52H 2JA7H 2K5VA 4IFDI 4GN3B 4KHPL 4GNXA 1JB7A 3GD7A 4BXXG 1N36Q 4JI4L 2ZJRA 2UXBQ 1BKBA 1NY4A 2B29A 2NN6G 3CCUA 4OO1I 1PV4A 1O7IA 2OQKA 2A1AA 3CXCA 1EIYB 1EQRA 1JJ2A 2F4VQ 1QVGA 2VNUD 4GKJQ 1EOVA 1VCIA 1PH8A 1SLJA 2PMZE 4LF7L 4GOPA 2JA7G 4HJAA 4J15A 4PZ8A 2LXJA 2EQSA 2E2IH 4IPCA 4DR5L 1S3OA 3HOVH 1HNWL 1NBWA 3H3VI 2HT1A 2JEAI 4OWWB 1KHIA 4AYBG 2Q2TA 1Y1VG 5M3FH 2E8GA 3W1BA 4GLXA 4MTNA 1IL2A 2UUBL 1OXSC 4NXNL 4DK3C 3F2BA 3M4OH 2E2JH 3HOZG 3TS2A 2F3IA 4QY7A 3KDFB 4HJ7A 3ERSX 5C0XG 4DR7L 1HR0W 4LF5L 1XNQL 3I4MH 4DAYB 1EQQA 2KCMA 4DR3Q 3M7NA 4JI6Q 2RF4A 1AH9A 2OWOA 3KLWA 1HNXQ 4JI8L 1XMOQ 1DGSA 5IY0A 5M3FG 1UEBA 1M90C 2OTJA 1I5FA 3FKIG 5IYBG 2NVQH 3CC7A 2R7DA 1K9MC 3KJOA 1VQPA 5JJIA 4HIMA 3KDFA 2JK8A 3HKZE 4P71A 5ELOA 5LMUL 3I4MG 4L5TA 4DUYQ 4A3BG 1K83H 2DUDA 2K52A 3PUVA 3HOWH 2WB1G 1MJCA 3ULPA 2JA5G 3CCLA 2I5HA 2AKWB 1YBYA 3S24A 4A3IH 4A76A 3CCVA 3OTOQ 4BY1H 4LFBQ 1KC8C 4LF4L 2PNHA 3D31A 4DV6Q 5M5XH 4X66L 3L2PA 3TQYA 4DR4L 4UY8C 1SN8A 4UP9A 4B3SQ 1VQLA 2R7ZH 3D0FA 3PF4A 4JV5Q 2N3SA 1G291 3CQZH 1YHBA 4QGUA 3HOXH 1M1KC 3NENA 1P16A 4APVA 3HKSA 1HZ9A 1WJJA 3I2ZA 3PUXA 4C3IH 2ATWA 4OX9L 4GN5A 1N33Q 5GAEC 3GTPH 4A3IG 1UE7A 2PQAB 4O2DA 3M4PA 1E24A 2HHHL 5JJLA 2IHEA 4DV4L 1E22A 4TQUS 3HFZB 3KF8B 4DV7Q 1CKNA 4LW1A 2VQEQ 2R7ZG 4RMFA 3TREA 5LMNQ 1K8GA 1A8VA 1XMQL 2E5LL 2VL6A 4DR6L 4A3DG 3RZOH 4DV3L 5FLMH 2CFMA 3S1MH 4BBSH 1YVCA 4L5QA 1VQ6A 4DPGA 3S1NH 4B3TL 2CCZA 1SR3A 1NE3A 5GAHC 2OQ0A 4KLKA 1IBKL 1HNZL 1NJIC 2K5NA 1VQ5A 2KENA 1WOCA 5C44H 2N8NA 3KF6B 4DKAC 5BR8Q 4JI3Q 1W3SA 3GTGH 4B3RL 1MKHA 1YJNA 4POGA 2I5LX 1TWGH 1I3QH 1NMFA 3I7FA 4A93G 1VQFA 4A3FG 1Z9FA 3JC66 2UUCQ 2L15A 4LF6Q 3E0EA 4EX5A 1P8LA 1V9PA 3CCSA 2IX1A 2YTVA 2MNAA 1OXTA 5M5WH 2JE6I 4R4QA 5IWAQ 5C44G 4QJFA 4JOIA 3RNUA 5C4XH 3KF6A 4JYAL 1ASYA 2UU9Q 3M3YH 3CF5A 1T9HA 5IYDG 1EIFA 1D8LA 3I4OA 5IP9H 1IBMQ 5HGQA 1AE2A 1VQDA 2RCNA 4Y7NH 1IBLQ 3S16H 3TRZA 5K36G 4GNXB 4A3CH 4NXNQ 1TXYA 2HIVA 3G6EA 2CWAA 4XTCS 3I56A 4BY7G 3S2HH 4AQYQ 4X64Q 1HR0L 1C9OA 1VQIA 2WAQE 3BZCA 4IFDG 4LF5Q 1NMGA 2AWOA 2CKZB 4WJ3M 5C0XJ 4UPAA 5C4JH 1FL0A 3KYHC 2ZM6L 4OO1G 2Y0SG 4OWTB 4DV1L 1PHJA 1L1OB 1VQBA 3G48A 3K7UC 4GLAC 1VQNA 3CC2A 5FJ8G 2JJQA 4R4CA 1EYGA 3T1HL 2ES2A 1BBUA 3UDGA 4P75A 1IYJB 5IYCG 1LM0A 4A3GH 4HIOA 3BZKA 1XNRQ 4GNXC 1E7ZA 1XPRA 4NB3A 3U4VA 1B7YB 2XGTA 2VQFQ 2BH8A 1I50H 2K75A 2JA6H 3EIVA 1KD1C 1Q86C 1L1OA 4P72A 4DV5L 1Y1WH 2VY3A 2WFWA 4IJLA 2AWNA 1TWHH 2ID0A 1EUJA 3AQQA 4X66Q 1VQ8A 2HIXA 3MXNB 4LUOA 3UDXA 4BBRH 2D0OA 4GOPC 5J3BA 1VQCA 4X62L 3L0OA 4B3ML 3RZDH 4NXML 5M3MH 2WP8J 1PH6A 2UXDL 4DV0Q 1Q1BA 1BBWA 3CCMA 1VS0A 1I94L 4YHHQ 2Z6KA 4LUZA 3K80C 1N32L 2B63H 3CD6A 5IE8A 1Y1WG 3OYYA 1B8AA 3J7ZC 2Z0SA 4TVAB 4JI7L 3EN2A 2ASBA 2HHHQ 4OWXB 4PG3A 1JE5A 4YWKA 3HOVG 1Q1EA 4JI1Q 3E9IA 2MFIA 3ER0A 5M3MG 4YWMA 4A3JH 4NPSA 1K8AC 3E9HA 1H95A 1RL2A 3H0GH 4YWLA 4A75A 2A8VA 1CSPA 1AE3A 4QL5A 1KQSA 1QZHA 2JEBI 4PZ6A 3ULJA 1XJVA 2VUMH 1UE1A 4IPGA 4LF9Q 4YY3L 1WCMH 1X3EA 1XTDA 3RLOA 2CQOA 3AEVA 4LWCA 3I55A 2MO1A 3PF5A 4IJHA 1X9NA 4DR1L 2R6GA 2UUAL 4GKKL 3J81j 2R7FA 4JI2Q 4A3MH 1I6HH 4A3JG 2PI2E 3EBEA 1PH4A 3RN2A 2R93H 3K8AA 4C3HH 4JI0Q 3L7ZC 1CKNB 1CSQA 2AMCB 1YIJA 1V1QA 4IOAA 1V43A 2ZTDA 3S15H 3JAMi 2FXQA 1YJWA 1PH1A 1N36L 1GM5A 2UXBL 4DK6C 1HH2P 2JA9A 3HOWG 1KXLA 2VW9A 4EQ5A 1K0RA 2VZAA 4JI5L 1L0WA 5AJ3Q 3CP0A 3CCRA 3PO3H 4LFAQ 2JA8H 2ZTCA 1N9WA 1Z47A 2KHJA 4BY1G 4AYBE 2YTYA 3T1YQ 2F4VL 3GTLH 3HOYH 4POFA 3U50C 4GKJL 3H15A 2YYZA 4GN4B 4LFCQ 2QA4A 1FJGQ 1KAWA 3CC4A 1WI5A 1X3FA 4GS3A 3ICEA 2UXCQ 4DUZL 4L5RC 2GVBA 1KL9A 2EIFA 2IT1A 1WFQA 3STBD 3HOXG 4A3KH 1X6OA 1OXVA 1VQAA 3CMEA 1X56A 1X55A 3SGIA 1YITA 3RLNA 4KHPQ 4KI0A 5M5YH 1HZAA 1A63A 3K81C 3UE1A 4JI4Q 1IXRA 4UP8A 1JJGA 3PO2H 5JEAG 1UE5A 2RHQB 3NEMA 2BA1A 3GTJH 1IZ6A 3DLLA 4DR3L 1PA6A 2KCTA 3CCQA 4JC0A 1XPUA 1L2FA 3J81i 2NZOA 3J80i 1Q7YC 5FLMG 1HNXL 2ALYB 1XMOL 2WB1E 3KFUA 2D62A 4BBSG 1OXXK 2RHSB 4DV5Q 4LF7Q 1YI2A 1X65A 1HNZQ 4BA2I 1QVFA 3A74A 3U4ZA 4DR5Q 4DR2L 1HJPA 1HNWQ 3GTMH 2YV5A 4WJ4A 3PCOB 3PUZA 2Q2HA 1SE8A 2I0QA 4B3MQ 3GTKH 5GQOA 4DUYL 4JOIC 1Q81C 1K3RA 2UUBQ 4KHZA 4IO9A 1SRUA 1I94Q 1PYBA 3AYHB 4K0KL 2B3GA 2N49A 3M9BA 3OTOL 1YZ6A 4LFBL 5GAGC 5GROA 5C3EH 4DR7Q 1XNQQ 4OONA 1Y14B 1VQEA 1FGUA 3FHWA 4B3SL 5C4XG 1NTGA 3PIPA 1A62A 4P73A 4JI8Q 1VQKA 2K50A 3I4NH 3S17H 4QQBX 1QVCA 5IP9G 4IPDA 1QUQB 4HIDA 3VDYA 4ME3A 1E1TA 4A3CG 1CUKA 2YTXA 3PUWA 4MNOA 1S40A 1GD7A 1YNXA 4DV2L 1LYLA 1N33L 3PV0A 1JMCA 5C3EG 3M4QA 1LUZA 2MO0A 2XTIA 3DM3A 5LMUQ 1J5EL 4DV7L 4GKKQ 1A0IA 2QGQA 2VQEL 2UUAQ 1ASZA 4RG1A 1GKHA 4LNQA 2IY5B 1IBLL 3IRBA 4R4TA 3ZJYC 4X65L 1SFOH 1EFWA 2Q2UA 4LF4Q 3I4NG 3S2DH 1PH5A 1QUQA 3ULLA 1OTCA 1E1OA 2JQOA 4ALPA 1L1OC 2NVYH 3HKZG 1PH3A 2IHFA 2K14A 4DAMA 4A3GG 4DR4Q 2LSSA 3GO5A 2LXKA 1G6PA 4OXPA 3FP9A 2VS1A 5BR8L 4X6AH 4JI3L 1PVOA 1N8RC 2JA6G 2CWPA 4JI5Q 4A3LH 1Y1VH 1VQMA 4L5SA 3S1RH 4JBJA 4OX9Q 1SROA 2H5XA 3UE0A 1JJCB 1FVIA 4DV4Q 2UUCL 2Z6KC 3HOZH 4LF6L 4C3JH 4BBRG 3S1QH 2NN6I 3F8TA 1PFSA 1KRTA 5IT9c 3KOJA 2PI2A 3K0XA 1XMQQ 4JBKA 2E5LQ 3CMAA 5IWAL 3HOUH 4DUZQ 4DR6Q 3GDEA 2Q2IA 3U58A 4XIGS 4LF8L 4DV3Q 1TWFH 2UU9L 4GLVB 4A3LG 4B3TQ 1IBML 1E3PA 3J81c 2B63G 2Y0SE 1KRSA 3J80c 1UE6A 1VQJA 1IBKQ 3FKIH 4H02A 5IYBH 1GO3E 2ZTEA 2K5HA 4JCVE 5HY6A 4IOCA 3M85A 1U5KA 1YEZA 4QIWE 4X64L 4AQYL 1PH7A 2F52A 3UDFA 4B3RQ 2BH2A 1B70B 4A3BH 5EAYA 1K73C 1J6QA 3NBHB 5LMNW 5JEAJ 1PH2A 4BA1I 1MJEA 2JA5H 4UP7A 2OTLA 3HOUG 4HJ9A 1CKMA 1U0LA 3H0GG 2QEXA 4MZ9A 3GTQH 3G71A 1N34L 2VUMG 4A4IA 2GVAA 4FDBA 3AFQA 5C0XI 1YJ9A 2OCEA 1JT8A 1KIXA 1PYSB 1WCMG 4P74A 4DR2Q 3CW2C 4JYAQ 4IFDJ 1YHAA 1GVPA 1RIPA 2KHIA 1XNRL 3CAMA 1TWCH 2V1CC 3PGZA 4A3MG 1CKOA 1UWVA 2VQFL 1C7YA 2IX0A 2C35B 3W1GA 1MIUA 3KJPA 2R93G 3AFPA 4K0KQ 1Q46A 3LGJA 2KBNA 3CCJA 3A0JA 1HR0Q 3A5UA 4HJ5A 1BVSA 1WYDA 3W5OA 3STBC 3Q8DA 1VQ7A 4DNIA 4PMWA 5IP7H 4HJ8A 2ZM6Q 3PSIA 3G4SA 3TEHB 4DV1Q 4A3EH 3TS0A 3PO3G 3F1ZA 4R4IA 4JG2A 5FLXc 4DV0L 4A3DH 2JA8G 3HOYG 3CCEA 2K4KA 3CPFA
chains in the Genus database with same CATH superfamily
3BJUA 4DV2Q 4AH6A 2MQHA 1J5EQ 1OXUA 2GN5A 2B8FA 3K7AH 1SSOA 1X3PA 3UDIA 2F0IA 4A3KG 1EL0A 4DN4M 2A19A 3I4LA 3RLFA 4A3FH 5GADC 2NVXH 2D0PA 3P20A 1SMXA 3BU2A 3PO2G 3BDLA 2PQAA 2M00A 2EYOA 1VQ9A 1BO0A 1Y8PB 1Q12A 2O2LD 1R9TH 3CPWA 1PFNA 1Y69U 4JI7Q 4WRDA 4N9PA 1RD9D 2BCOA 3QOLA 5CORA 1S72A 4UAIA 3OW2A 2EPBA 1KABA 1G51A 2EJGC 5H1SE 3WWVA 4JBMA 1Q8KA 4MN3A 4LFAL 3G7LA 3J7A5 1I4HA 3LWEA 1EWHA 4RA8A 4X3UA 1GXDC 5IYCH 1WTQA 1HZCA 4DGZA 2G9HD 3OPOA 4KHVA 3Q22A 1VQOA 1X54A 4LUVA 4IZ8A 5EKIA 1ZEQX 2QDBA 1JB7A 2LS01 1RHPA 4NDXA 5D65A 1BKBA 1EWCA 1NY4A 4O1NA 4DXGA 1K8MA 4IUPA 3TDQA 1S5ED 3OMGA 2F4VQ 4K5VA 1O80A 2DNEA 1PH8A 1CA5A 2FHTA 1KNEA 5D3IB 4KKSA 4AYBB 5C0XH 2VB3X 2E2IH 4I7ZC 4RKBA 1S3OA 3HOVH 4FXGC 3H3VI 2K5DA 2Q8IB 2JEAI 4C3JB 2Q2TA 3S1QB 2DY8A 2B39A 4N8FA 3HZXA 2E2JH 3HOZG 1Y8NB 1EFID 4QY7A 3KDFB 1E0BA 4HJ7A 5C0XG 4DR7L 1PYWD 1EQQA 4IURA 4DR3Q 1ET6A 1NUCA 3H94A 4XDXA 2WINB 2G9DA 1PFMA 1DGSA 4JI8L 2MPMA 5IY0A 4RHRA 3SK6A 1CI3M 2NVQH 3CC7A 1BCPF 2KA7A 2WB1B 1QOHA 3KJOA 1STNA 2F0HA 1RJTA 4RFBA 4ZQ3A 3GTQB 5ELOA 4L5TA 4DAYA 4DUYQ 1K83H 2DUDA 3PUVA 4FF2A 2PPBC 1MJCA 2RA4A 2AKWB 1YBYA 3OTOQ 1KC8C 3D31A 3L2PA 4DR4L 4UY8C 1JWUD 3ZYYX 3D0FA 4FF3A 1T5EA 5DAUA 3HOXH 1YHBA 1M1KC 3NENA 1P16A 1QB5D 3HKSA 4PNYA 1HZ9A 4C3IH 1B53A 1HXYD 3VYSA 1XTCD 1G2SA 2H1EA 1TS2A 3M4PA 5EPJA 5JJLA 2EYPA 4KJOA 1E22A 3HFZB 2Z4IA 4LW1A 4RMFA 3L9AX 3HS0C 4A3DG 4DV3L 4L5QA 1NSNS 3K7AB 4QMGA 1ICWA 4RGTA 2OQ0A 2P5ZX 1VQ5A 1HQMC 2N8NA 5CV9A 4A3FB 5E1FA 5K36H 1E2VA 1NR2A 2JSOA 3V96A 1I3QH 1NMFA 1Q8IA 3NP8A 1Z9FA 3GP7A 4EX5A 1VF5C 2YTVA 2MNAA 1R9TB 4JOIA 5C4XH 1ASYA 2UU9Q 3CF5A 2F0TA 1EIFA 5I9PA 3T51B 2NTSA 5K36G 3ITPA 1RTNA 1VQDA 4V190 4GNXB 4A3CH 5M5WB 2RDHA 1TXYA 2HIVA 1PZID 2WAQE 4LF5Q 1GUWA 3BG3A 2CKZB 1CTMA 4UPAA 1SYFA 1ILPA 4R8IA 1VQBA 5FO8B 3G48A 3BS1A 1EYGA 3T1HL 1BBUA 3BZKA 4OL7A 3EROA 1VMCA 4NB3A 3U4VA 1UAPA 1SE2A 3TP6A 2K75A 3T16A 1YNNC 2JA6H 1NNXA 3Q24A 5CV8A 1GUNA 1L1OA 1M4VA 4P72A 2VY3A 2IX3A 1TWHH 1STYA 1G2TA 4R9WA 4LUOA 1G8ZD 1GHJA 1VQCA 3L0OA 3RZDH 1BF4A 4DV0Q 2NYZD 2E2IB 1BBWA 3CCMA 2D5DA 3HOVB 2HUGA 3NPPA 1N32L 5IT9L 5C5MA 1W6JA 1B8AA 2ASBA 2HHHQ 1PTOD 1QILA 2NUCA 5FKAC 2E2JB 4KN4C 3J81L 4YWMA 1WTRA 5FO7B 4YWLA 1JWSD 1CSPA 1AE3A 1HCZA 1XJVA 1II3A 1AN8A 4IPGA 4YY3L 1ENAA 1X3EA 3AEVA 4LWCA 1X9NA 4DR1L 2UUAL 2NVQB 1SNCA 3J81j 1A6XA 3DWQA 4FP5D 4RGNA 1PH4A 3BYYB 1K83B 1EYAA 1AEXA 3HGBA 3QJYA 1CSQA 1V1QA 3MHBA 1F9RA 2Z8LA 3JAMi 4KY6A 2OXPA 4FO2A 3MXPA 3SK5A 3DWPA 1B3QA 1K0RA 1LV9A 4JI5L 1L0WA 4EQ5A 1B4OA 3CCRA 4LFAQ 2JA8H 4M1UB 2E2DC 4AYBE 1F9PA 1PZKD 4F8MA 1Z7TA 2F0MA 2YYZA 2RQXA 4L8JA 5EPLA 4ZK9B 2QA4A 3HOXB 1A2TA 4C3IB 1KAWA 1WI5A 4XQNA 5FLXL 2IT1A 1KL9A 2EIFA 3STBD 5DNFA 3SGIA 3RLNA 5M5YH 1FD7D 4ZUIA 1IXRA 5E3FA 2XN9C 2RHQB 3GTJH 3DHQA 1IZ6A 3DLLA 3E5SA 3CCQA 1XPUA 4JC0A 3M4YA 2J7ZA 4XQQA 1L2FA 1HNXL 2WKCA 5FLMG 1BCPC 1XMOL 2WB1E 4BBSG 1YI2A 4BA2I 3A74A 2HQEA 3U4ZA 2B2UA 3GTMH 1I3QB 3PCOB 2Q2HA 2K5WA 4B3MQ 3PQIA 4KHZA 1EEFD 1PYBA 5C4XB 3F2UA 2B3GA 2N49A 5CGKA 4DR7Q 3L3OC 3FHWA 2F4IA 1NTGA 3PIPA 2A6ED 5K5PA 4JI8Q 2K50A 3I4NH 5IP9G 1BQQT 4IPDA 4ODGA 1HFNA 3CRLC 4ME3A 1PRTF 2PNRC 1HPCA 1GD7A 1YNXA 4DV2L 1JMCA 1KDBA 2XTIA 2MO0A 1K3BC 1J5EL 4DV7L 2F0JA 1GKHA 5J22A 3I4NG 1QE6A 3EJIA 3ULLA 1SJHD 1KAAA 2JQOA 1NCVA 2NVYH 4U68A 4DR4Q 2IHFA 2JA6B 4DAMA 4A3GG 2LSSA 1SMYD 3FEWX 4XXEA 3K5MA 1G6PA 1SFOB 1D6EC 1TWHB 2LMCB 4JI3L 2CWPA 1VQMA 2EDGA 4L5SA 2A69C 4JBJA 4HSPA 4KN7C 1SROA 4CDCC 3RZDB 2A69D 4ME5A 2UUCL 2Z6KC 3MXUA 3SK4A 1U4PA 2NN6I 3DXJC 3F8TA 1KRTA 4DUZQ 2Q2IA 1QNKA 4DV3Q 3K0YA 1S5BD 1IBML 1E3PA 2B63G 3J80c 1VQJA 3FKIH 5IYBH 2B2TA 4JCVE 1I6VC 1ZKOA 5HY6A 4IOCA 4AQYL 1J8IA 4A3BH 2E76C 4RWSC 1O7ZA 2OTLA 1CKMA 1U0LA 3H0GG 4MTKA 2G5DA 2GVAA 4FDBA 3J7AF 2OCEA 4RGMA 3CW2C 3JAME 1XNRL 1GHKA 5KGUA 1MSGA 3PGZA 4A3MG 1HQRD 1UWVA 5EBDA 4K0KQ 3CCJA 2KHSA 1FNUA 4HJ5A 1WYDA 2JA8B 5IP7H 3PSIA 2XSCA 2O5JC 3F1ZA 1RTOA 4N9TA 1DCZA 3PMFA 1LT3D 3HOYG 3CCEA 4QUFA 3CPFA 2CW0D 1WTWA 2WAQG 2NZHA 4QUCA 3T1HQ 3NQTA 4C2MH 4A3EB 3F2DA 1LTBD 3NWSA 1VQ4A 3C46A 5M5YB 5IP7G 1SEBD 2N55A 4AIMA 4YCUA 5KYLA 4FXKC 4YCVA 1DJRD 1F2LA 4A93H 3GTJB 4ZYSA 5JVH3 4XQJA 1SDFA 1X3GA 5DM63 1IL8A 2K5QA 2KUMA 3DWAA 1SYCA 1EU3A 4PQXA 1IHZA 3VR6A 5D14A 1VQHA 1YHQA 1AZPA 4YCWA 3GTMB 1N32Q 1WD1A 2AQ1B 4PZ7A 4BY7H 4JI0L 4RAUC 5CV6A 2AHOB 1QZGA 4R1JA 3OIQA 1VQGA 3MA2B 4M8AA 5AJ3L 4IPHA 5E7NA 2PO4A 5HGTA 1LT5D 5FJ8H 4YY3Q 1W2BA 4BXXH 4IQZA 4DR1Q 4O0AA 1CT1D 5IGEA 1EIGA 4N8X1 2O4XA 1TS4A 2V4DA 1HTLD 2Z4HA 2X6LA 1N34Q 4Y52H 3GQBA 1PTOH 1STGA 4H13C 4GN3B 4KJNA 1QG7A 1PFBA 1K0SA 4BXXG 4JI4L 3E0JA 2ZJRA 2NN6G 1O7IA 2NVYB 2A1AA 1EQRA 3NBIA 1SLJA 1UEAB 4IPCA 3NE5B 1NBWA 1KHIA 4AYBG 3W1BA 3P1HA 4MTNA 1OXSC 4DK3C 2H4OA 2F3IA 4C3JG 3ERSX 1TQOA 4CJ0B 1HR0W 4LF5L 3I4MH 1WTXA 5BN4A 4DAYB 5M3FB 1BUVT 3FKIB 2OWOA 1HNXQ 1CM9A 1PRTC 5ELCA 1XMOQ 5A35A 2E75C 2FFKB 1M90C 3MVVA 4A3BB 5CBAE 5HURA 2R7DA 1VQPA 1HUMA 4U673 2JK8A 5LMUL 3I4MG 2K52A 2WB1G 3MAQA 1BDOA 4K14A 4A3IH 3CCVA 3R8BA 4LF4L 4G7ZC 4ILWA 1TS3A 3NK9A 4F87A 2CVRA 2F0GA 3PF4A 4JV5Q 2N3SA 3VR2A 3CQZH 3Q0AA 2F0OA 1K28A 3PUXA 1U4MA 2ATWA 4GN5A 3TBIB 5GAEC 4A3IG 4ULLA 2HHHL 2MJ8A 3VA7A 2X6GA 4DV7Q 2XWBB 3TREA 5LMNQ 2E5LL 2VL6A 4C2MB 4IALA 1U4RA 2Q8TA 3W2DA 1VQ6A 4DPGA 3S1NH 2CCZA 5IGFA 1SR3A 1XXGA 4HEDA 2F03A 1IBKL 2PW5A 2KENA 4DKAC 1TR5A 3KF8A 3MXGA 3S1MB 4A93B 1I4XA 4JI3Q 3GTGH 4B3RL 3MFGA 1YJNA 1L0YB 5COYA 4POGA 2EYMA 4CKCA 4A3FG 2UUCQ 5IOCA 2M2LA 3TMEA 3E0EA 1PTOF 2IX1A 1G6ZA 3BYTB 1OXTA 2KCCA 4RHSA 5M5WH 2JE6I 3QWNA 3MFYA 4BY7B 3M3YH 1T9HA 2F0FA 3E6ZX 1IBMQ 2RCNA 1A3TA 4Y7NH 5A2QL 4XTCS 3NTKA 4AQYQ 4NP5A 1HR0L 1C9OA 2MHVA 3BZCA 1JB3A 4DNRB 2AWOA 1B2TA 2EYFA 3LWUA 1EY5A 3MWYW 4QIWB 2EE1A 4WJ3M 5C0XJ 2ZM6L 5KNDA 1L1OB 2NBFA 1VQNA 2JJQA 4R4CA 2DN8A 3SVMA 1Q90A 1IYJB 5IYCG 2DJFC 2CQAA 2ZXPA 4ABNA 1XNRQ 3H91A 4B9WA 1PTOB 1B7YB 1CZWA 2BH8A 4DK1A 3EIVA 2LKVA 1SAPA 1Q86C 1V1PA 4DFAA 1Y1WH 3VYUA 2WKDA 4HTHA 2WFWA 4J1MA 3C2PA 4DAPA 4EQNA 4B3ML 4NXML 2KJXA 1PH6A 1Q1BA 4S3SA 2DJGC 3K80C 4FYDA 5IE8A 1Y1WG 3I70A 1SYDA 2TMPA 5LL6S 3EN2A 5M3MB 5BN3A 4QCLA 3HOVG 2Z6BA 1Q1EA 1VDZA 2MFIA 1I4RA 1C8CA 5E4WC 2F0NA 3J80L 1D1KA 2A74C 3E9HA 3I4MB 1RL2A 4A75A 4QL5A 4DU9A 4DAVA 1QZHA 1KQSA 3ULJA 2B2YA 1LTID 1B9NA 2B2VA 4CDDC 4A3JB 2F0LA 2A73B 2IWHA 2MO1A 3PF5A 2R6GA 1ONLA 1ESRA 1EU4A 3UI2A 2PI2E 3K8AA 4JI0Q 1CKNB 2CH4A 2AUJD 3PIO3 1KLUD 2ZTDA 4A3IB 1JE4A 4Q5VA 1N36L 1GM5A 2UXBL 1HH2P 2FJ2A 3PO3H 1U4LA 5AJ3Q 1AP0A 4LJZC 3NBHA 1Z47A 3EQLC 1ESFA 2YTYA 3NUCA 3CQZB 4GN4B 5JEAH 4JVZA 4I7AA 1BCPB 1X3FA 1GUSA 3C1EA 1S4ZA 1G91A 4DUZL 4C1NK 4Q0FA 3HOXG 1WFQA 1OXVA 1VQAA 1AW7A 4C3IG 2XWJB 1X55A 1YITA 1F9SA 4KI0A 4JI4Q 4UP8A 3I8ZA 5JEAG 5IT9E 3K6OA 3S1NB 3NEMA 3M7GA 1TKWB 3KBGA 1Q7YC 1DZ1A 2ALYB 3LNNA 3KFUA 2D62A 1I4GA 3GTGB 3J81E 4OELB 1EYDA 1DM0B 3DEOA 2PMZB 2EXZA 1HA5A 1H9JA 2I0QA 3GTKH 1PXUA 4ZAIA 4JOIC 1DOKA 3BZDB 5AFWA 4IO9A 1KDCA 5FOBB 1CHQD 4LAAA 4K0KL 3M9BA 3M3YB 1YZ6A 4LFBL 5GAGC 4PMCA 4OONA 3VR5A 5KNBA 4Y7NB 2F3VA 5C4XG 5T1GA 3QR8A 1SYEA 2EJFC 4KY7A 3S17H 4TSSA 4QQBX 3VR3A 2PCFB 2RSOA 2JYOA 2K28A 1DYQA 1E1TA 4A3CG 3A54A 3N52A 1ML0D 1VF7A 2YTXA 4MNOA 5C5LA 3I72A 1N33L 2F0KA 2N88A 2QEJC 3PV0A 4F7XA 5LMUQ 1HUNA 3I91A 3OW7A 4GKKQ 4RG1A 3HKZB 3SDZA 1U9RA 4R4TA 1SFOH 5FLXE 2Q2UA 4LF4Q 1PH5A 1QUQA 2EYHA 4TKOB 1L1OC 1PH3A 2K6AA 2K14A 1Y1WB 1HFGA 4HSVA 5BR8L 2XRQD 1PVOA 2JA6G 4A3LH 1Y1VH 3S1RH 1EY4A 1PTOC 2AQ2B 5CC4A 1WD0A 1FVIA 1WTVA 5IGDA 3A8JE 3A7AB 3KOJA 2E5LQ 1LACA 2EZVA 3U58A 1TWFH 4MHEA 4GLVB 4A3LG 1KRSA 2NTTA 3A8IE 1IBKQ 3CC4A 3NSWA 3M85A 1CK1A 1U5KA 1CA6A 4QIWE 4X64L 2F0EA 2C5CA 3UDFA 4B3RQ 1JQYD 3BDOA 3NWTA 5LMNW 2JA5H 1LTSD 5C3WA 1IW7D 4XYOA 1N34L 5KNCA 1YJ9A 1PYSB 3U9OA 2OEOA 3HP3A 1GOZA 2KEEA 5JJZA 3CAMA 2SOBA 2V1CC 1C7YA 1HRJA 3ERQA 1KLGD 1MIUA 1Q46A 2KBNA 1HR0Q 3PO3B 3A5UA 1BVSA 3STBC 1K8OA 1VQ7A 4DNIA 4HJ8A 2ZM6Q 4A3EH 1CZGA 4JG2A 1HA6A 2JA8G 3TP5A 1FNVA 1O7YA 1C0AA 2FMMA 3RR5A 3A56A 3W3AA 3IFTA 5JJKA 4TRDA 4A3EG 2B2WA 2NZ1D 2OT2A 4IUUA 4X65Q 2E2HH 5DLQE 2ENBA 3RN5A 1D5MC 2XNAC 3B6YA 3S14H 1SNOA 5IIFA 2I5MX 3D4RA 3GTOH 4LF9L 2KCNA 2R61A 4NXMQ 2EXDA 1H9SB 4EVOA 2B2UC 4J8QA 4PV1C 2BA0A 5KEEA 5IYDH 1TY2A 2BOSA 3NELA 4K2LA 1LTRD 3GTKB 3KLRA 4FXDA 2A6EC 1MBYA 5ELNA 1XPOA 3IKJA 4EGVA 5I2XA 4JV5L 3R3OA 1QWYA 1F2ZA 4LF8Q 4OO1H 4JPBW 1BBXC 1LTLA 2CHBD 3T1YL 1QJOA 3S17B 4XT1B 1JICA 1LTAD 2YU9H 3C1FA 2HQLA 5LMNL 4CGYB 1XX8A 2NVTH 2SNMA 1D7QA 3CRKC 1EQVA 5ISRA 1SMYC 4KKTA 1V8QA 2N78A 1STEA 1EEID 1TY0A 4XT3B 4IFDI 4WFN3 1DD2A 4KHPL 4GNXA 1KNAA 1N36Q 1STHA 2UXBQ 2B29A 1JORA 4E6IA 3CCUA 1PV4A 2JA7B 3CXCA 1EIYB 1JJ2A 1B50A 1QVGA 2VNUD 5T1IA 1EOVA 2JXMB 2FINB 2PMZE 3NQIA 3SR1A 4LF7L 4GOPA 1PRTB 4J15A 1Y1VB 2EQSA 2LXJA 3S1RB 3G6JB 1HNWL 3N6RA 1MHWC 2ZXRA 1WTPA 5M3FH 3HEJA 5ELFA 4GLXA 5DEHA 1STBA 2UUBL 3T4AC 3F2BA 3TS2A 1TWFB 4CJ1B 1XNQL 2B2TC 3M7NA 4H0LC 4JI6Q 1ZYRC 2HCCA 3KLWA 3WDNA 1ZYRD 5M3FG 4B9XA 2A5HA 3FKIG 3NTHA 5IYBG 2JA5B 4K8IA 5CBEE 1DXMA 5JJIA 5CV5A 4HIMA 1GUTA 2EY6A 5EBCA 3HKZE 4P71A 3KUPA 3NTIA 4A3BG 5TSSA 3VR4A 2D9UA 3HOWH 4K5XA 1QCBD 3HRZC 3CCLA 4EQOA 1V1OA 3S24A 4BY1H 4LFBQ 5I6YA 4DV6Q 2K03A 2ZT9C 1O7LA 1SN8A 2R7ZH 1VQLA 4JW0A 4KY5A 2IL8A 3MZ5A 4NKLA 5KIXA 3A55A 1G291 2CW0C 3DMUA 2HCIA 5IGGA 4APVA 4KTAA 2K01A 3I2ZA 4OX9L 3T53B 1N33Q 3GTPH 2PQAB 4O2DA 4DV4L 4TQUS 1C48A 4HAEA 3KF8B 1A15A 5I4DA 2R7ZG 2L55A 4OGQC 1XMQL 2L4NA 2EY2A 3RZOH 3S1MH 2MGSA 2BE5D 5GAHC 5F2DA 1PDQA 1NJIC 1SBBB 3OSOA 2QCPX 2E2HB 4OIJA 3P7JA 5BR8Q 1W3SA 5J39A 3S14B 5IGBA 4QB4A 1A3UA 3GTOB 1AFPA 4A93G 3I7FA 4FF4A 1P8LA 1V9PA 2NB0A 4IFDH 1PMRA 4FVMA 4JYAL 4QJFA 1EY9A 3KF6A 4FNFA 4HMIA 5HGQA 1AE2A 1S5CD 3TRZA 1DOLA 2RVLA 3R93A 4NXNQ 3G6EA 3S2HH 3BDCA 3I56A 4KK7A 4BY7G 4X64Q 2Y0SB 5NUCA 5I9OA 1R4QB 2WV6D 4IFDG 1X3QA 5LHY1 2L11A 2K7VA 2D2CC 5C4JH 4XYQA 4OWTB 4DV1L 2QF7A 2YU9B 1LTGD 4GLAC 2HDMA 5FJ8G 2NVTB 3ND9A 1LM0A 2F0PA 4UDUC 4HIOA 1E7ZA 1I50H 3D6CA 4OEMB 1F77A 4IJLA 4MIUA 4KKUA 2EYJA 3DUZA 2K1BA 3Q23A 4X66Q 1VQ8A 2HIXA 3UDXA 4BBRH 2D0OA 3OOCA 4X62L 1FYCA 5M3MH 2WP8J 2UXDL 3VYTA 3H3VC 3H6MA 3U9SA 1GUOA 1SYGA 4EQPA 2ZXOA 1J9OA 3J7ZC 2Z0SA 4J6HA 4OWXB 4PG3A 1OO9B 1TT2A 3MXNA 5M3MG 4A3JH 4NPSA 1K8AC 2EVBA 1FGBD 3EVQA 2L5TA 4KMUC 2JEBI 3VYRA 4PZ6A 2VUMH 2DY7A 1UE1A 4LF9Q 3TP7A 1WCMH 1EYCA 5A2QE 1BOSA 1EOTA 1XWEA 2CQOA 2F0SA 3I55A 4GKKL 5C3XA 4IJHA 3EFXD 4DK0A 2R7FA 3WOEA 1I6HH 4A3JG 3EBEA 2R93H 4G7OC 4C3HH 3L7ZC 3HOWB 1GJXA 2AMCB 4CDEC 1MI2A 3S15H 4BY1B 1PH1A 3C3LA 1NR4A 2RSNA 1KXLA 2JA9A 2M9VA 4RCOA 1SE3A 2VZAA 3CP0A 2R7ZB 4ID6A 1N9WA 2FMCA 2ZTCA 2VB2X 3T1YQ 3U50C 4GKJL 5DM73 1WTHA 3GTPB 3FPPA 3ICEA 4L5RC 1Y8OB 2GVBA 4A3KH 1X6OA 1X56A 1YNJD 4KHPQ 3I90A 1M8AA 2AUKA 5EKLA 3UE1A 4HCSA 1A63A 1JJGA 3RZOB 3PO2H 2BA1A 2LFNA 4ZCKA 5KYIA 3J81i 2KOLA 2NZOA 3J7YW 4DV5Q 4LF7Q 3J80E 1UUPA 1FR3A 1HNWQ 4IN3A 2YV5A 2KEDA 1SNPA 3KBXA 3PUZA 1SE8A 4K6LA 1EQTA 2UUBQ 1SRUA 4LMQD 1I94Q 4C56C 5C3EH 1XNQQ 1ENFA 1Y14B 1VQEA 2RBMA 4K8JA 4B3SL 2Z9HA 3S2HB 1A62A 2RDFA 4P73A 4OHJA 2PW7A 1QVCA 1QUQB 4HIDA 3VDYA 1EY7A 1CUKA 3PUWA 5C4JB 1LYLA 5C3EG 5EJWA 4CJ2C 2VQEL 2R3ZA 4HMJA 4LNQA 2J4XA 1SNQA 5JAVA 3ZJYC 4X65L 4PMBA 3S2DH 3A7LA 1JWMD 1F9QA 1MD2D 4KD4A 4ALPA 1I50B 3HKZG 4CKEA 3V05A 3OMCA 3T13A 4I65A 4OXPA 3FP9A 2VS1A 4X6AH 2PZTA 2KQ3A 1MGSA 4BBRB 4LK1C 4OX9Q 3LX0A 4X3KA 3AB9A 2H5XA 3UE0A 2L12A 4DV4Q 2F0QA 3NHHA 2PZWA 3IFDA 4RCNA 4LF6L 2A68C 2HD3A 3HOZH 5JOBA 1PFSA 2PI2A 3CU7A 1XMQQ 2A68D 3CMAA 5IWAL 3GDEA 2K04A 4LF8L 4XIGS 3J7AV 3RMHA 2K33A 1IYVA 3K5OA 2Y0SE 3SEBA 1IBLL 2QILA 1GO3E 4CKBA 3HOUB 3S9WA 1B3AA 1YEZA 3GV6A 1PH7A 2B2YC 4OIKA 1B70B 2BH2A 2JN4A 2B2VC 3MEHA 2VUMB 5JEAJ 1MJEA 4BA1I 1WVLA 1KDAA 3FPUB 4UP7A 1WCMB 3G71A 2BDNA 4A4IA 3AFQA 2KECA 2O5IC 4YIJA 1KIXA 4P74A 4DR2Q 1I6HB 4JYAQ 1YHAA 2R93B 1S5FD 2Z1CA 2KHIA 4C3HB 1NAPA 1E2ZA 1CKOA 2VQFL 1L0XB 1JOQA 2IX0A 2L0CA 2C35B 3S15B 3R2TA 3KJPA 3AFPA 1RDPD 2C9OA 4IUVA 3R2IA 3W5OA 1TWCB 3I73A 2J0TD 3Q8DA 2CH4W 5CYUA 4PMWA 3D4WA 1W6KA 5C6AA 3G4SA 4DV1Q 3PO3G 4G7HC 4A3DH 3FVQA 2K4KA 3ONAB 4YHHL 4A3KB 4JBWA 4GZYC 4R4OA 3MEFA 3PIOA 1O78A 2ZJPA 4JI6L 4HIKA 1VMPA 4JI1L 3A5ZB 2R92H 1IKMA 2SDFA 3PO2B 1GUGA 3ND8A 1Q82C 3OWEB 2L9HA 2AQ3B 2DGYA 4X62Q 3E3XA 5JPNC 1H9KA 4L6TB 2UXDQ 1IYUA 3DEPA 1AZQA 2NVXB 2R92G 1HZBA 4JI2L 5C4ZA 3AU7A 4K5WA 3URYA 4DV6L 1WTOA 1BNZA 2EJMA 1ET9A 1A3VA 1EWIA 1PH9A 1TVXA 1JCKB 5C3EB 2ZJQA 4IUTA 1LABA 5CR3A 4CDFC 4Z9CB 3F2CA 3PUYA 1BR9A 2HDLA 4LFCL 1FJGL 3QIAA 3JAMc 4DXFA 3V2TA 1TWAH 2UXCL 4NW2A 3H3VH 2A6HC 4GOPB 2JA7H 1S5DD 2K5VA 3BVMA 2A6HD 1SXTA 3GD7A 3S2DB 5IGCA 3D6WA 5IODA 4OO1I 2ICIA 2OQKA 1CHPD 1UNSA 1RKNA 4ZKCB 4UHVA 4GKJQ 1VCIA 2K32A 1YNND 4BS9A 1EY8A 2JA7G 4HJAA 4PZ8A 4DR5L 5E4XA 2HT1A 1H9MA 1PLFA 4OWWB 3HOZB 1Y1VG 2E8GA 1IL2A 4NXNL 1EY6A 3M4OH 1JOOA 2SEBD 4RGOS 2KCMA 1FNWA 2RF4A 1IW7C 1AH9A 1TU2B 1MSHA 4IUQA 1UEBA 2EYLA 2OTJA 1I5FA 1PZJD 1K9MC 4NMZA 2LY7A 3KDFA 1XYIA 2WACA 3RUZA 1H9RA 2MP1A 3FMCA 3ULPA 4G57A 2JA5G 2I5HA 4A76A 1RCVD 2Q8RE 2PNHA 1D2BA 5M5XH 4X66L 3TQYA 4UP9A 4B3SQ 1F2YA 1X32A 2E74C 1I4PA 4QGUA 5CV7A 1JOKA 3K59A 1WJJA 5M9OA 1LT4D 1ILQA 2IW3A 1UE7A 1E24A 2IHEA 4A3DB 1EIHA 1CKNA 3D3RA 2VQEQ 1K8GA 1A8VA 1DONA 2L1BA 3QO2A 4K2KA 3SE0A 4DR6L 5FLMH 2CFMA 4BBSH 1YVCA 3A8KE 4B3TL 2B2WC 1NE3A 3K5NA 2R92B 1ENCA 3CHBD 4KLKA 1HNZL 2K5NA 4H44C 5FK9C 1WOCA 5C4HA 5C44H 3PIP3 3SK8A 3KF6B 3K57A 3WOFA 2DNCA 1MKHA 3HG9A 2IJ0A 3SHLA 3FRPB 1CFMA 2I5LX 5D3DA 1TWGH 1VQFA 3JC66 2L15A 4LF6Q 3CCSA 1BCPD 4K6DA 4R4QA 5IWAQ 5C44G 3RNUA 3DM1A 3MTSA 5IYDG 5G3LF 1D8LA 1SNDA 3I4OA 4RKLA 5IP9H 3S16H 5EGTA 1IBLQ 2MUYA 2XRSD 3NXWA 5EQ0A 2CWAA 4L63B 2XVSA 1VQIA 5BN5A 2OF1A 2PYKA 1NMGA 1ICFB 2I46A 4O42A 1FL0A 3KYHC 5JPMC 4OO1G 2Y0SG 1PHJA 1D5XC 1R4PB 3K7UC 2GA4B 3CC2A 3AMUA 1TWAB 2ES2A 3UDGA 4P75A 5EKKA 4A3GH 3KLSX 3BVZA 1TS5A 5L37A 4GNXC 1ZXTA 2F1MA 1XPRA 2BDOA 4DF7A 3GV3A 1T5XD 2XGTA 3FDTA 2VQFQ 1D1IA 1KD1C 5KRUA 4DV5L 2F0DA 2AWNA 2ID0A 1EUJA 3AQQA 1EZ6A 3H09A 4P2CB 3MXNB 3RD4A 4GOPC 5J3BA 1QNUA 3D4DA 1VS0A 1I94L 2F0WA 2Z6KA 4LUZA 4DNTB 3OIPA 5I2YA 4YHHQ 2B63H 3CD6A 3KLSA 3TZUA 3OHXC 3OYYA 4JK1C 4TVAB 4JI7L 1JE5A 4YWKA 1I4QA 4JI1Q 3E9IA 3M4OB 5EPKA 3ER0A 3X3MA 1H95A 3KK7A 3H0GH 2A8VA 3TSSA 4V0BA 1SE4A 3K58A 1RF2D 4ZLTF 1XTDA 3Q6SA 3RLOA 1SJED 5ELEA 4H7BA 4JI2Q 4A3MH 3RN2A 1IKLA 1DOMA 4FF1A 1B9MA 1YIJA 2B8GA 1V43A 5ELBA 5LL6X 2FXQA 5FO9B 2JP1A 1YJWA 4DK6C 3HOWG 1CQVA 5M5XB 2VW9A 3QOJA 2I07B 2KHJA 4C1NI 4BY1G 3HOYH 2F4VL 3GTLH 4POFA 3H15A 4LFCQ 1FJGQ 3BVGA 2SNSA 5I6WA 4GS3A 2BE5C 2UXCQ 3D8GA 4IFDJ 1LTTD 3CMEA 2IPKD 1JR0D 4F88A 1HZAA 3K81C 4WORA 4G4KA 4BBSB 1UE5A 4B08A 1SNMA 2QW7A 4DR3L 2TSSA 1PA6A 2KCTA 4HN7A 3J80i 5C44B 3T56B 1OXXK 2RHSB 1X65A 4ZRZA 1QVFA 4DR5Q 4DR2L 1HJPA 1BXTA 1TWGB 2XIWA 1C4QA 4WJ4A 1LT6D 2QDLA 5GQOA 4DUYL 4ZUJA 1Q81C 1K3RA 2EY5A 3AYHB 1A2UA 2PZUA 1EZ8A 3OTOL 1SYBA 5GROA 3MC0B 3S16B 3TZDA 1JC7A 1EY0A 1FGUA 2VXWA 4QF4A 3OWFA 1V1PB 1VQKA 1H9SA 4KV6A 1Z6HA 1CQFA 1HTPA 1S40A 3JAML 3I4NB 3M4QA 1LUZA 3DM3A 1STAA 2NN6H 1A0IA 2QGQA 2K05A 2UUAQ 1F2MA 1ASZA 4BWGB 2IY5B 4A3GB 3IRBA 3X3NA 2WIIB 1EFWA 4HCEA 1OTCA 1E1OA 2ICEC 3EA6A 3QG1A 1E2WA 3GO5A 2LXKA 2RKSA 1Q3LA 1KTKA 2QKIC 1B44D 1N8RC 4IUNA 4JI5Q 3K5LA 2EY1A 5ELDA 2F0UA 1JJCB 4HR7B 4C3JH 4BBRG 3S1QH 4ZKBB 5IT9c 3K0XA 4JBKA 2B63B 3HOUH 1D5ZC 5G3LD 4DR6Q 2UU9L 1TIID 4RH6A 2F3WA 4B3TQ 3J81c 1HNZQ 1UE6A 3SXHA 1HHVA 4H02A 2ZTEA 2K5HA 3QB3A 2PQEA 3H0GB 2F52A 4X3SA 5EAYA 1K73C 3O13A 1J6QA 2F0VA 2EOTA 3NBHB 1PH2A 3HOUG 4HJ9A 2QEXA 4MZ9A 3GTQH 3CKIB 2VUMG 1PRTD 4X3TA 5C0XI 1JT8A 3IAYA 1WCMG 4A3MB 3IL8A 5CV4A 1LO5D 3VA5A 4KD3A 1RODA 1GVPA 1RIPA 3P75A 2RCFA 3I3CA 1TWCH 5JVG3 4DA2A 3TP8A 5J1ZA 4CBVA 4WJWA 3W1GA 2R93G 4C3HG 3LGJA 3A0JA 3TN2A 3HOYB 2NWGA 3GTLB 1B1ZA 1LLRD 2WAQB 3TEHB 3TS0A 1YNJC 2KVMA 4R4IA 4R8NA 5FLXc 4DV0L 4CHTB 2X69A 5CMDA 4IOAA 2RDGA
chains in the Genus database with same CATH topology
2WAQG 2NZHA 3BJUA 4YHHL 3T1HQ 1C0AA 4DV2Q 4AH6A 4C2MH 4JBWA 3RR5A 2MQHA 4R4OA 3F2DA 3MEFA 3PIOA 2ZJPA 1J5EQ 1OXUA 1VQ4A 2GN5A 4HIKA 4JI6L 3K7AH 4JI1L 5JJKA 3A5ZB 5IP7G 2R92H 3UDIA 4AIMA 4A3EG 4A3KG 4YCUA 4X65Q 4YCVA 2E2HH 2A19A 4A93H 5DLQE 3RLFA 3RN5A 1Q82C 3B6YA 4A3FH 3S14H 5GADC 2NVXH 2I5MX 2D0PA 1SMXA 3BU2A 3GTOH 4LF9L 3PO2G 1X3GA 2DGYA 2PQAA 4X62Q 4NXMQ 2EXDA 1VQ9A 2UXDQ 2BA0A 5IYDH 1YHQA 1VQHA 2R92G 1N32Q 4YCWA 1Q12A 3NELA 1HZBA 3CPWA 1R9TH 4JI2L 4JI7Q 4PZ7A 4DV6L 4JI0L 4BY7H 2AHOB 5ELNA 1XPOA 1S72A 1QZGA 3OW2A 1EWIA 1PH9A 4R1JA 4JV5L 1G51A 1VQGA 4LF8Q 5H1SE 3WWVA 2ZJQA 4JBMA 1Q8KA 5AJ3L 4IPHA 5E7NA 4LFAL 3J7A5 1LTLA 3F2CA 3PUYA 5FJ8H 3T1YL 4YY3Q 1W2BA 4BXXH 5IYCH 4LFCL 1HZCA 2YU9H 1FJGL 4DR1Q 3JAMc 5LMNL 2HQLA 4O0AA 2NVTH 1TWAH 1VQOA 1X54A 2UXCL 3H3VH 1D7QA 4LUVA 2N78A 1N34Q 4GOPB 4Y52H 2JA7H 2K5VA 4IFDI 4GN3B 4KHPL 4GNXA 1JB7A 3GD7A 4BXXG 1N36Q 4JI4L 2ZJRA 2UXBQ 1BKBA 1NY4A 2B29A 2NN6G 3CCUA 4OO1I 1PV4A 1O7IA 2OQKA 2A1AA 3CXCA 1EIYB 1EQRA 1JJ2A 2F4VQ 1QVGA 2VNUD 4GKJQ 1EOVA 1VCIA 1PH8A 1SLJA 2PMZE 4LF7L 4GOPA 2JA7G 4HJAA 4J15A 4PZ8A 2LXJA 2EQSA 2E2IH 4IPCA 4DR5L 1S3OA 3HOVH 1HNWL 1NBWA 3H3VI 2HT1A 2JEAI 4OWWB 1KHIA 4AYBG 2Q2TA 1Y1VG 5M3FH 2E8GA 3W1BA 4GLXA 4MTNA 1IL2A 2UUBL 1OXSC 4NXNL 4DK3C 3F2BA 3M4OH 2E2JH 3HOZG 3TS2A 2F3IA 4QY7A 3KDFB 4HJ7A 3ERSX 5C0XG 4DR7L 1HR0W 4LF5L 1XNQL 3I4MH 4DAYB 1EQQA 2KCMA 4DR3Q 3M7NA 4JI6Q 2RF4A 1AH9A 2OWOA 3KLWA 1HNXQ 4JI8L 1XMOQ 1DGSA 5IY0A 5M3FG 1UEBA 1M90C 2OTJA 1I5FA 3FKIG 5IYBG 2NVQH 3CC7A 2R7DA 1K9MC 3KJOA 1VQPA 5JJIA 4HIMA 3KDFA 2JK8A 3HKZE 4P71A 5ELOA 5LMUL 3I4MG 4L5TA 4DUYQ 4A3BG 1K83H 2DUDA 2K52A 3PUVA 3HOWH 2WB1G 1MJCA 3ULPA 2JA5G 3CCLA 2I5HA 2AKWB 1YBYA 3S24A 4A3IH 4A76A 3CCVA 3OTOQ 4BY1H 4LFBQ 1KC8C 4LF4L 2PNHA 3D31A 4DV6Q 5M5XH 4X66L 3L2PA 3TQYA 4DR4L 4UY8C 1SN8A 4UP9A 4B3SQ 1VQLA 2R7ZH 3D0FA 3PF4A 4JV5Q 2N3SA 1G291 3CQZH 1YHBA 4QGUA 3HOXH 1M1KC 3NENA 1P16A 4APVA 3HKSA 1HZ9A 1WJJA 3I2ZA 3PUXA 4C3IH 2ATWA 4OX9L 4GN5A 1N33Q 5GAEC 3GTPH 4A3IG 1UE7A 2PQAB 4O2DA 3M4PA 1E24A 2HHHL 5JJLA 2IHEA 4DV4L 1E22A 4TQUS 3HFZB 3KF8B 4DV7Q 1CKNA 4LW1A 2VQEQ 2R7ZG 4RMFA 3TREA 5LMNQ 1K8GA 1A8VA 1XMQL 2E5LL 2VL6A 4DR6L 4A3DG 3RZOH 4DV3L 5FLMH 2CFMA 3S1MH 4BBSH 1YVCA 4L5QA 1VQ6A 4DPGA 3S1NH 4B3TL 2CCZA 1SR3A 1NE3A 5GAHC 2OQ0A 4KLKA 1IBKL 1HNZL 1NJIC 2K5NA 1VQ5A 2KENA 1WOCA 5C44H 2N8NA 3KF6B 4DKAC 5BR8Q 4JI3Q 1W3SA 3GTGH 4B3RL 1MKHA 1YJNA 4POGA 2I5LX 1TWGH 1I3QH 1NMFA 3I7FA 4A93G 1VQFA 4A3FG 1Z9FA 3JC66 2UUCQ 2L15A 4LF6Q 3E0EA 4EX5A 1P8LA 1V9PA 3CCSA 2IX1A 2YTVA 2MNAA 1OXTA 5M5WH 2JE6I 4R4QA 5IWAQ 5C44G 4QJFA 4JOIA 3RNUA 5C4XH 3KF6A 4JYAL 1ASYA 2UU9Q 3M3YH 3CF5A 1T9HA 5IYDG 1EIFA 1D8LA 3I4OA 5IP9H 1IBMQ 5HGQA 1AE2A 1VQDA 2RCNA 4Y7NH 1IBLQ 3S16H 3TRZA 5K36G 4GNXB 4A3CH 4NXNQ 1TXYA 2HIVA 3G6EA 2CWAA 4XTCS 3I56A 4BY7G 3S2HH 4AQYQ 4X64Q 1HR0L 1C9OA 1VQIA 2WAQE 3BZCA 4IFDG 4LF5Q 1NMGA 2AWOA 2CKZB 4WJ3M 5C0XJ 4UPAA 5C4JH 1FL0A 3KYHC 2ZM6L 4OO1G 2Y0SG 4OWTB 4DV1L 1PHJA 1L1OB 1VQBA 3G48A 3K7UC 4GLAC 1VQNA 3CC2A 5FJ8G 2JJQA 4R4CA 1EYGA 3T1HL 2ES2A 1BBUA 3UDGA 4P75A 1IYJB 5IYCG 1LM0A 4A3GH 4HIOA 3BZKA 1XNRQ 4GNXC 1E7ZA 1XPRA 4NB3A 3U4VA 1B7YB 2XGTA 2VQFQ 2BH8A 1I50H 2K75A 2JA6H 3EIVA 1KD1C 1Q86C 1L1OA 4P72A 4DV5L 1Y1WH 2VY3A 2WFWA 4IJLA 2AWNA 1TWHH 2ID0A 1EUJA 3AQQA 4X66Q 1VQ8A 2HIXA 3MXNB 4LUOA 3UDXA 4BBRH 2D0OA 4GOPC 5J3BA 1VQCA 4X62L 3L0OA 4B3ML 3RZDH 4NXML 5M3MH 2WP8J 1PH6A 2UXDL 4DV0Q 1Q1BA 1BBWA 3CCMA 1VS0A 1I94L 4YHHQ 2Z6KA 4LUZA 3K80C 1N32L 2B63H 3CD6A 5IE8A 1Y1WG 3OYYA 1B8AA 3J7ZC 2Z0SA 4TVAB 4JI7L 3EN2A 2ASBA 2HHHQ 4OWXB 4PG3A 1JE5A 4YWKA 3HOVG 1Q1EA 4JI1Q 3E9IA 2MFIA 3ER0A 5M3MG 4YWMA 4A3JH 4NPSA 1K8AC 3E9HA 1H95A 1RL2A 3H0GH 4YWLA 4A75A 2A8VA 1CSPA 1AE3A 4QL5A 1KQSA 1QZHA 2JEBI 4PZ6A 3ULJA 1XJVA 2VUMH 1UE1A 4IPGA 4LF9Q 4YY3L 1WCMH 1X3EA 1XTDA 3RLOA 2CQOA 3AEVA 4LWCA 3I55A 2MO1A 3PF5A 4IJHA 1X9NA 4DR1L 2R6GA 2UUAL 4GKKL 3J81j 2R7FA 4JI2Q 4A3MH 1I6HH 4A3JG 2PI2E 3EBEA 1PH4A 3RN2A 2R93H 3K8AA 4C3HH 4JI0Q 3L7ZC 1CKNB 1CSQA 2AMCB 1YIJA 1V1QA 4IOAA 1V43A 2ZTDA 3S15H 3JAMi 2FXQA 1YJWA 1PH1A 1N36L 1GM5A 2UXBL 4DK6C 1HH2P 2JA9A 3HOWG 1KXLA 2VW9A 4EQ5A 1K0RA 2VZAA 4JI5L 1L0WA 5AJ3Q 3CP0A 3CCRA 3PO3H 4LFAQ 2JA8H 2ZTCA 1N9WA 1Z47A 2KHJA 4BY1G 4AYBE 2YTYA 3T1YQ 2F4VL 3GTLH 3HOYH 4POFA 3U50C 4GKJL 3H15A 2YYZA 4GN4B 4LFCQ 2QA4A 1FJGQ 1KAWA 3CC4A 1WI5A 1X3FA 4GS3A 3ICEA 2UXCQ 4DUZL 4L5RC 2GVBA 1KL9A 2EIFA 2IT1A 1WFQA 3STBD 3HOXG 4A3KH 1X6OA 1OXVA 1VQAA 3CMEA 1X56A 1X55A 3SGIA 1YITA 3RLNA 4KHPQ 4KI0A 5M5YH 1HZAA 1A63A 3K81C 3UE1A 4JI4Q 1IXRA 4UP8A 1JJGA 3PO2H 5JEAG 1UE5A 2RHQB 3NEMA 2BA1A 3GTJH 1IZ6A 3DLLA 4DR3L 1PA6A 2KCTA 3CCQA 4JC0A 1XPUA 1L2FA 3J81i 2NZOA 3J80i 1Q7YC 5FLMG 1HNXL 2ALYB 1XMOL 2WB1E 3KFUA 2D62A 4BBSG 1OXXK 2RHSB 4DV5Q 4LF7Q 1YI2A 1X65A 1HNZQ 4BA2I 1QVFA 3A74A 3U4ZA 4DR5Q 4DR2L 1HJPA 1HNWQ 3GTMH 2YV5A 4WJ4A 3PCOB 3PUZA 2Q2HA 1SE8A 2I0QA 4B3MQ 3GTKH 5GQOA 4DUYL 4JOIC 1Q81C 1K3RA 2UUBQ 4KHZA 4IO9A 1SRUA 1I94Q 1PYBA 3AYHB 4K0KL 2B3GA 2N49A 3M9BA 3OTOL 1YZ6A 4LFBL 5GAGC 5GROA 5C3EH 4DR7Q 1XNQQ 4OONA 1Y14B 1VQEA 1FGUA 3FHWA 4B3SL 5C4XG 1NTGA 3PIPA 1A62A 4P73A 4JI8Q 1VQKA 2K50A 3I4NH 3S17H 4QQBX 1QVCA 5IP9G 4IPDA 1QUQB 4HIDA 3VDYA 4ME3A 1E1TA 4A3CG 1CUKA 2YTXA 3PUWA 4MNOA 1S40A 1GD7A 1YNXA 4DV2L 1LYLA 1N33L 3PV0A 1JMCA 5C3EG 3M4QA 1LUZA 2MO0A 2XTIA 3DM3A 5LMUQ 1J5EL 4DV7L 4GKKQ 1A0IA 2QGQA 2VQEL 2UUAQ 1ASZA 4RG1A 1GKHA 4LNQA 2IY5B 1IBLL 3IRBA 4R4TA 3ZJYC 4X65L 1SFOH 1EFWA 2Q2UA 4LF4Q 3I4NG 3S2DH 1PH5A 1QUQA 3ULLA 1OTCA 1E1OA 2JQOA 4ALPA 1L1OC 2NVYH 3HKZG 1PH3A 2IHFA 2K14A 4DAMA 4A3GG 4DR4Q 2LSSA 3GO5A 2LXKA 1G6PA 4OXPA 3FP9A 2VS1A 5BR8L 4X6AH 4JI3L 1PVOA 1N8RC 2JA6G 2CWPA 4JI5Q 4A3LH 1Y1VH 1VQMA 4L5SA 3S1RH 4JBJA 4OX9Q 1SROA 2H5XA 3UE0A 1JJCB 1FVIA 4DV4Q 2UUCL 2Z6KC 3HOZH 4LF6L 4C3JH 4BBRG 3S1QH 2NN6I 3F8TA 1PFSA 1KRTA 5IT9c 3KOJA 2PI2A 3K0XA 1XMQQ 4JBKA 2E5LQ 3CMAA 5IWAL 3HOUH 4DUZQ 4DR6Q 3GDEA 2Q2IA 3U58A 4XIGS 4LF8L 4DV3Q 1TWFH 2UU9L 4GLVB 4A3LG 4B3TQ 1IBML 1E3PA 3J81c 2B63G 2Y0SE 1KRSA 3J80c 1UE6A 1VQJA 1IBKQ 3FKIH 4H02A 5IYBH 1GO3E 2ZTEA 2K5HA 4JCVE 5HY6A 4IOCA 3M85A 1U5KA 1YEZA 4QIWE 4X64L 4AQYL 1PH7A 2F52A 3UDFA 4B3RQ 2BH2A 1B70B 4A3BH 5EAYA 1K73C 1J6QA 3NBHB 5LMNW 5JEAJ 1PH2A 4BA1I 1MJEA 2JA5H 4UP7A 2OTLA 3HOUG 4HJ9A 1CKMA 1U0LA 3H0GG 2QEXA 4MZ9A 3GTQH 3G71A 1N34L 2VUMG 4A4IA 2GVAA 4FDBA 3AFQA 5C0XI 1YJ9A 2OCEA 1JT8A 1KIXA 1PYSB 1WCMG 4P74A 4DR2Q 3CW2C 4JYAQ 4IFDJ 1YHAA 1GVPA 1RIPA 2KHIA 1XNRL 3CAMA 1TWCH 2V1CC 3PGZA 4A3MG 1CKOA 1UWVA 2VQFL 1C7YA 2IX0A 2C35B 3W1GA 1MIUA 3KJPA 2R93G 3AFPA 4K0KQ 1Q46A 3LGJA 2KBNA 3CCJA 3A0JA 1HR0Q 3A5UA 4HJ5A 1BVSA 1WYDA 3W5OA 3STBC 3Q8DA 1VQ7A 4DNIA 4PMWA 5IP7H 4HJ8A 2ZM6Q 3PSIA 3G4SA 3TEHB 4DV1Q 4A3EH 3TS0A 3PO3G 3F1ZA 4R4IA 4JG2A 5FLXc 4DV0L 4A3DH 2JA8G 3HOYG 3CCEA 2K4KA 3CPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ G;  2NZH A;  3BJU A;  4YHH L;  3T1H Q;  1C0A A;  4DV2 Q;  4AH6 A;  4C2M H;  4JBW A;  3RR5 A;  2MQH A;  4R4O A;  3F2D A;  3MEF A;  3PIO A;  2ZJP A;  1J5E Q;  1OXU A;  1VQ4 A;  2GN5 A;  4HIK A;  4JI6 L;  3K7A H;  4JI1 L;  5JJK A;  3A5Z B;  5IP7 G;  2R92 H;  3UDI A;  4AIM A;  4A3E G;  4A3K G;  4YCU A;  4X65 Q;  4YCV A;  2E2H H;  2A19 A;  4A93 H;  5DLQ E;  3RLF A;  3RN5 A;  1Q82 C;  3B6Y A;  4A3F H;  3S14 H;  5GAD C;  2NVX H;  2I5M X;  2D0P A;  1SMX A;  3BU2 A;  3GTO H;  4LF9 L;  3PO2 G;  1X3G A;  2DGY A;  2PQA A;  4X62 Q;  4NXM Q;  2EXD A;  1VQ9 A;  2UXD Q;  2BA0 A;  5IYD H;  1YHQ A;  1VQH A;  2R92 G;  1N32 Q;  4YCW A;  1Q12 A;  3NEL A;  1HZB A;  3CPW A;  1R9T H;  4JI2 L;  4JI7 Q;  4PZ7 A;  4DV6 L;  4JI0 L;  4BY7 H;  2AHO B;  5ELN A;  1XPO A;  1S72 A;  1QZG A;  3OW2 A;  1EWI A;  1PH9 A;  4R1J A;  4JV5 L;  1G51 A;  1VQG A;  4LF8 Q;  5H1S E;  3WWV A;  2ZJQ A;  4JBM A;  1Q8K A;  5AJ3 L;  4IPH A;  5E7N A;  4LFA L;  3J7A 5;  1LTL A;  3F2C A;  3PUY A;  5FJ8 H;  3T1Y L;  4YY3 Q;  1W2B A;  4BXX H;  5IYC H;  4LFC L;  1HZC A;  2YU9 H;  1FJG L;  4DR1 Q;  3JAM c;  5LMN L;  2HQL A;  4O0A A;  2NVT H;  1TWA H;  1VQO A;  1X54 A;  2UXC L;  3H3V H;  1D7Q A;  4LUV A;  2N78 A;  1N34 Q;  4GOP B;  4Y52 H;  2JA7 H;  2K5V A;  4IFD I;  4GN3 B;  4KHP L;  4GNX A;  1JB7 A;  3GD7 A;  4BXX G;  1N36 Q;  4JI4 L;  2ZJR A;  2UXB Q;  1BKB A;  1NY4 A;  2B29 A;  2NN6 G;  3CCU A;  4OO1 I;  1PV4 A;  1O7I A;  2OQK A;  2A1A A;  3CXC A;  1EIY B;  1EQR A;  1JJ2 A;  2F4V Q;  1QVG A;  2VNU D;  4GKJ Q;  1EOV A;  1VCI A;  1PH8 A;  1SLJ A;  2PMZ E;  4LF7 L;  4GOP A;  2JA7 G;  4HJA A;  4J15 A;  4PZ8 A;  2LXJ A;  2EQS A;  2E2I H;  4IPC A;  4DR5 L;  1S3O A;  3HOV H;  1HNW L;  1NBW A;  3H3V I;  2HT1 A;  2JEA I;  4OWW B;  1KHI A;  4AYB G;  2Q2T A;  1Y1V G;  5M3F H;  2E8G A;  3W1B A;  4GLX A;  4MTN A;  1IL2 A;  2UUB L;  1OXS C;  4NXN L;  4DK3 C;  3F2B A;  3M4O H;  2E2J H;  3HOZ G;  3TS2 A;  2F3I A;  4QY7 A;  3KDF B;  4HJ7 A;  3ERS X;  5C0X G;  4DR7 L;  1HR0 W;  4LF5 L;  1XNQ L;  3I4M H;  4DAY B;  1EQQ A;  2KCM A;  4DR3 Q;  3M7N A;  4JI6 Q;  2RF4 A;  1AH9 A;  2OWO A;  3KLW A;  1HNX Q;  4JI8 L;  1XMO Q;  1DGS A;  5IY0 A;  5M3F G;  1UEB A;  1M90 C;  2OTJ A;  1I5F A;  3FKI G;  5IYB G;  2NVQ H;  3CC7 A;  2R7D A;  1K9M C;  3KJO A;  1VQP A;  5JJI A;  4HIM A;  3KDF A;  2JK8 A;  3HKZ E;  4P71 A;  5ELO A;  5LMU L;  3I4M G;  4L5T A;  4DUY Q;  4A3B G;  1K83 H;  2DUD A;  2K52 A;  3PUV A;  3HOW H;  2WB1 G;  1MJC A;  3ULP A;  2JA5 G;  3CCL A;  2I5H A;  2AKW B;  1YBY A;  3S24 A;  4A3I H;  4A76 A;  3CCV A;  3OTO Q;  4BY1 H;  4LFB Q;  1KC8 C;  4LF4 L;  2PNH A;  3D31 A;  4DV6 Q;  5M5X H;  4X66 L;  3L2P A;  3TQY A;  4DR4 L;  4UY8 C;  1SN8 A;  4UP9 A;  4B3S Q;  1VQL A;  2R7Z H;  3D0F A;  3PF4 A;  4JV5 Q;  2N3S A;  1G29 1;  3CQZ H;  1YHB A;  4QGU A;  3HOX H;  1M1K C;  3NEN A;  1P16 A;  4APV A;  3HKS A;  1HZ9 A;  1WJJ A;  3I2Z A;  3PUX A;  4C3I H;  2ATW A;  4OX9 L;  4GN5 A;  1N33 Q;  5GAE C;  3GTP H;  4A3I G;  1UE7 A;  2PQA B;  4O2D A;  3M4P A;  1E24 A;  2HHH L;  5JJL A;  2IHE A;  4DV4 L;  1E22 A;  4TQU S;  3HFZ B;  3KF8 B;  4DV7 Q;  1CKN A;  4LW1 A;  2VQE Q;  2R7Z G;  4RMF A;  3TRE A;  5LMN Q;  1K8G A;  1A8V A;  1XMQ L;  2E5L L;  2VL6 A;  4DR6 L;  4A3D G;  3RZO H;  4DV3 L;  5FLM H;  2CFM A;  3S1M H;  4BBS H;  1YVC A;  4L5Q A;  1VQ6 A;  4DPG A;  3S1N H;  4B3T L;  2CCZ A;  1SR3 A;  1NE3 A;  5GAH C;  2OQ0 A;  4KLK A;  1IBK L;  1HNZ L;  1NJI C;  2K5N A;  1VQ5 A;  2KEN A;  1WOC A;  5C44 H;  2N8N A;  3KF6 B;  4DKA C;  5BR8 Q;  4JI3 Q;  1W3S A;  3GTG H;  4B3R L;  1MKH A;  1YJN A;  4POG A;  2I5L X;  1TWG H;  1I3Q H;  1NMF A;  3I7F A;  4A93 G;  1VQF A;  4A3F G;  1Z9F A;  3JC6 6;  2UUC Q;  2L15 A;  4LF6 Q;  3E0E A;  4EX5 A;  1P8L A;  1V9P A;  3CCS A;  2IX1 A;  2YTV A;  2MNA A;  1OXT A;  5M5W H;  2JE6 I;  4R4Q A;  5IWA Q;  5C44 G;  4QJF A;  4JOI A;  3RNU A;  5C4X H;  3KF6 A;  4JYA L;  1ASY A;  2UU9 Q;  3M3Y H;  3CF5 A;  1T9H A;  5IYD G;  1EIF A;  1D8L A;  3I4O A;  5IP9 H;  1IBM Q;  5HGQ A;  1AE2 A;  1VQD A;  2RCN A;  4Y7N H;  1IBL Q;  3S16 H;  3TRZ A;  5K36 G;  4GNX B;  4A3C H;  4NXN Q;  1TXY A;  2HIV A;  3G6E A;  2CWA A;  4XTC S;  3I56 A;  4BY7 G;  3S2H H;  4AQY Q;  4X64 Q;  1HR0 L;  1C9O A;  1VQI A;  2WAQ E;  3BZC A;  4IFD G;  4LF5 Q;  1NMG A;  2AWO A;  2CKZ B;  4WJ3 M;  5C0X J;  4UPA A;  5C4J H;  1FL0 A;  3KYH C;  2ZM6 L;  4OO1 G;  2Y0S G;  4OWT B;  4DV1 L;  1PHJ A;  1L1O B;  1VQB A;  3G48 A;  3K7U C;  4GLA C;  1VQN A;  3CC2 A;  5FJ8 G;  2JJQ A;  4R4C A;  1EYG A;  3T1H L;  2ES2 A;  1BBU A;  3UDG A;  4P75 A;  1IYJ B;  5IYC G;  1LM0 A;  4A3G H;  4HIO A;  3BZK A;  1XNR Q;  4GNX C;  1E7Z A;  1XPR A;  4NB3 A;  3U4V A;  1B7Y B;  2XGT A;  2VQF Q;  2BH8 A;  1I50 H;  2K75 A;  2JA6 H;  3EIV A;  1KD1 C;  1Q86 C;  1L1O A;  4P72 A;  4DV5 L;  1Y1W H;  2VY3 A;  2WFW A;  4IJL A;  2AWN A;  1TWH H;  2ID0 A;  1EUJ A;  3AQQ A;  4X66 Q;  1VQ8 A;  2HIX A;  3MXN B;  4LUO A;  3UDX A;  4BBR H;  2D0O A;  4GOP C;  5J3B A;  1VQC A;  4X62 L;  3L0O A;  4B3M L;  3RZD H;  4NXM L;  5M3M H;  2WP8 J;  1PH6 A;  2UXD L;  4DV0 Q;  1Q1B A;  1BBW A;  3CCM A;  1VS0 A;  1I94 L;  4YHH Q;  2Z6K A;  4LUZ A;  3K80 C;  1N32 L;  2B63 H;  3CD6 A;  5IE8 A;  1Y1W G;  3OYY A;  1B8A A;  3J7Z C;  2Z0S A;  4TVA B;  4JI7 L;  3EN2 A;  2ASB A;  2HHH Q;  4OWX B;  4PG3 A;  1JE5 A;  4YWK A;  3HOV G;  1Q1E A;  4JI1 Q;  3E9I A;  2MFI A;  3ER0 A;  5M3M G;  4YWM A;  4A3J H;  4NPS A;  1K8A C;  3E9H A;  1H95 A;  1RL2 A;  3H0G H;  4YWL A;  4A75 A;  2A8V A;  1CSP A;  1AE3 A;  4QL5 A;  1KQS A;  1QZH A;  2JEB I;  4PZ6 A;  3ULJ A;  1XJV A;  2VUM H;  1UE1 A;  4IPG A;  4LF9 Q;  4YY3 L;  1WCM H;  1X3E A;  1XTD A;  3RLO A;  2CQO A;  3AEV A;  4LWC A;  3I55 A;  2MO1 A;  3PF5 A;  4IJH A;  1X9N A;  4DR1 L;  2R6G A;  2UUA L;  4GKK L;  3J81 j;  2R7F A;  4JI2 Q;  4A3M H;  1I6H H;  4A3J G;  2PI2 E;  3EBE A;  1PH4 A;  3RN2 A;  2R93 H;  3K8A A;  4C3H H;  4JI0 Q;  3L7Z C;  1CKN B;  1CSQ A;  2AMC B;  1YIJ A;  1V1Q A;  4IOA A;  1V43 A;  2ZTD A;  3S15 H;  3JAM i;  2FXQ A;  1YJW A;  1PH1 A;  1N36 L;  1GM5 A;  2UXB L;  4DK6 C;  1HH2 P;  2JA9 A;  3HOW G;  1KXL A;  2VW9 A;  4EQ5 A;  1K0R A;  2VZA A;  4JI5 L;  1L0W A;  5AJ3 Q;  3CP0 A;  3CCR A;  3PO3 H;  4LFA Q;  2JA8 H;  2ZTC A;  1N9W A;  1Z47 A;  2KHJ A;  4BY1 G;  4AYB E;  2YTY A;  3T1Y Q;  2F4V L;  3GTL H;  3HOY H;  4POF A;  3U50 C;  4GKJ L;  3H15 A;  2YYZ A;  4GN4 B;  4LFC Q;  2QA4 A;  1FJG Q;  1KAW A;  3CC4 A;  1WI5 A;  1X3F A;  4GS3 A;  3ICE A;  2UXC Q;  4DUZ L;  4L5R C;  2GVB A;  1KL9 A;  2EIF A;  2IT1 A;  1WFQ A;  3STB D;  3HOX G;  4A3K H;  1X6O A;  1OXV A;  1VQA A;  3CME A;  1X56 A;  1X55 A;  3SGI A;  1YIT A;  3RLN A;  4KHP Q;  4KI0 A;  5M5Y H;  1HZA A;  1A63 A;  3K81 C;  3UE1 A;  4JI4 Q;  1IXR A;  4UP8 A;  1JJG A;  3PO2 H;  5JEA G;  1UE5 A;  2RHQ B;  3NEM A;  2BA1 A;  3GTJ H;  1IZ6 A;  3DLL A;  4DR3 L;  1PA6 A;  2KCT A;  3CCQ A;  4JC0 A;  1XPU A;  1L2F A;  3J81 i;  2NZO A;  3J80 i;  1Q7Y C;  5FLM G;  1HNX L;  2ALY B;  1XMO L;  2WB1 E;  3KFU A;  2D62 A;  4BBS G;  1OXX K;  2RHS B;  4DV5 Q;  4LF7 Q;  1YI2 A;  1X65 A;  1HNZ Q;  4BA2 I;  1QVF A;  3A74 A;  3U4Z A;  4DR5 Q;  4DR2 L;  1HJP A;  1HNW Q;  3GTM H;  2YV5 A;  4WJ4 A;  3PCO B;  3PUZ A;  2Q2H A;  1SE8 A;  2I0Q A;  4B3M Q;  3GTK H;  5GQO A;  4DUY L;  4JOI C;  1Q81 C;  1K3R A;  2UUB Q;  4KHZ A;  4IO9 A;  1SRU A;  1I94 Q;  1PYB A;  3AYH B;  4K0K L;  2B3G A;  2N49 A;  3M9B A;  3OTO L;  1YZ6 A;  4LFB L;  5GAG C;  5GRO A;  5C3E H;  4DR7 Q;  1XNQ Q;  4OON A;  1Y14 B;  1VQE A;  1FGU A;  3FHW A;  4B3S L;  5C4X G;  1NTG A;  3PIP A;  1A62 A;  4P73 A;  4JI8 Q;  1VQK A;  2K50 A;  3I4N H;  3S17 H;  4QQB X;  1QVC A;  5IP9 G;  4IPD A;  1QUQ B;  4HID A;  3VDY A;  4ME3 A;  1E1T A;  4A3C G;  1CUK A;  2YTX A;  3PUW A;  4MNO A;  1S40 A;  1GD7 A;  1YNX A;  4DV2 L;  1LYL A;  1N33 L;  3PV0 A;  1JMC A;  5C3E G;  3M4Q A;  1LUZ A;  2MO0 A;  2XTI A;  3DM3 A;  5LMU Q;  1J5E L;  4DV7 L;  4GKK Q;  1A0I A;  2QGQ A;  2VQE L;  2UUA Q;  1ASZ A;  4RG1 A;  1GKH A;  4LNQ A;  2IY5 B;  1IBL L;  3IRB A;  4R4T A;  3ZJY C;  4X65 L;  1SFO H;  1EFW A;  2Q2U A;  4LF4 Q;  3I4N G;  3S2D H;  1PH5 A;  1QUQ A;  3ULL A;  1OTC A;  1E1O A;  2JQO A;  4ALP A;  1L1O C;  2NVY H;  3HKZ G;  1PH3 A;  2IHF A;  2K14 A;  4DAM A;  4A3G G;  4DR4 Q;  2LSS A;  3GO5 A;  2LXK A;  1G6P A;  4OXP A;  3FP9 A;  2VS1 A;  5BR8 L;  4X6A H;  4JI3 L;  1PVO A;  1N8R C;  2JA6 G;  2CWP A;  4JI5 Q;  4A3L H;  1Y1V H;  1VQM A;  4L5S A;  3S1R H;  4JBJ A;  4OX9 Q;  1SRO A;  2H5X A;  3UE0 A;  1JJC B;  1FVI A;  4DV4 Q;  2UUC L;  2Z6K C;  3HOZ H;  4LF6 L;  4C3J H;  4BBR G;  3S1Q H;  2NN6 I;  3F8T A;  1PFS A;  1KRT A;  5IT9 c;  3KOJ A;  2PI2 A;  3K0X A;  1XMQ Q;  4JBK A;  2E5L Q;  3CMA A;  5IWA L;  3HOU H;  4DUZ Q;  4DR6 Q;  3GDE A;  2Q2I A;  3U58 A;  4XIG S;  4LF8 L;  4DV3 Q;  1TWF H;  2UU9 L;  4GLV B;  4A3L G;  4B3T Q;  1IBM L;  1E3P A;  3J81 c;  2B63 G;  2Y0S E;  1KRS A;  3J80 c;  1UE6 A;  1VQJ A;  1IBK Q;  3FKI H;  4H02 A;  5IYB H;  1GO3 E;  2ZTE A;  2K5H A;  4JCV E;  5HY6 A;  4IOC A;  3M85 A;  1U5K A;  1YEZ A;  4QIW E;  4X64 L;  4AQY L;  1PH7 A;  2F52 A;  3UDF A;  4B3R Q;  2BH2 A;  1B70 B;  4A3B H;  5EAY A;  1K73 C;  1J6Q A;  3NBH B;  5LMN W;  5JEA J;  1PH2 A;  4BA1 I;  1MJE A;  2JA5 H;  4UP7 A;  2OTL A;  3HOU G;  4HJ9 A;  1CKM A;  1U0L A;  3H0G G;  2QEX A;  4MZ9 A;  3GTQ H;  3G71 A;  1N34 L;  2VUM G;  4A4I A;  2GVA A;  4FDB A;  3AFQ A;  5C0X I;  1YJ9 A;  2OCE A;  1JT8 A;  1KIX A;  1PYS B;  1WCM G;  4P74 A;  4DR2 Q;  3CW2 C;  4JYA Q;  4IFD J;  1YHA A;  1GVP A;  1RIP A;  2KHI A;  1XNR L;  3CAM A;  1TWC H;  2V1C C;  3PGZ A;  4A3M G;  1CKO A;  1UWV A;  2VQF L;  1C7Y A;  2IX0 A;  2C35 B;  3W1G A;  1MIU A;  3KJP A;  2R93 G;  3AFP A;  4K0K Q;  1Q46 A;  3LGJ A;  2KBN A;  3CCJ A;  3A0J A;  1HR0 Q;  3A5U A;  4HJ5 A;  1BVS A;  1WYD A;  3W5O A;  3STB C;  3Q8D A;  1VQ7 A;  4DNI A;  4PMW A;  5IP7 H;  4HJ8 A;  2ZM6 Q;  3PSI A;  3G4S A;  3TEH B;  4DV1 Q;  4A3E H;  3TS0 A;  3PO3 G;  3F1Z A;  4R4I A;  4JG2 A;  5FLX c;  4DV0 L;  4A3D H;  2JA8 G;  3HOY G;  3CCE A;  2K4K A;  3CPF A; 
#chains in the Genus database with same CATH topology
 3BJU A;  4DV2 Q;  4AH6 A;  2MQH A;  1J5E Q;  1OXU A;  2GN5 A;  2B8F A;  3K7A H;  1SSO A;  1X3P A;  3UDI A;  2F0I A;  4A3K G;  1EL0 A;  4DN4 M;  2A19 A;  3I4L A;  3RLF A;  4A3F H;  5GAD C;  2NVX H;  2D0P A;  3P20 A;  1SMX A;  3BU2 A;  3PO2 G;  3BDL A;  2PQA A;  2M00 A;  2EYO A;  1VQ9 A;  1BO0 A;  1Y8P B;  1Q12 A;  2O2L D;  1R9T H;  3CPW A;  1PFN A;  1Y69 U;  4JI7 Q;  4WRD A;  4N9P A;  1RD9 D;  2BCO A;  3QOL A;  5COR A;  1S72 A;  4UAI A;  3OW2 A;  2EPB A;  1KAB A;  1G51 A;  2EJG C;  5H1S E;  3WWV A;  4JBM A;  1Q8K A;  4MN3 A;  4LFA L;  3G7L A;  3J7A 5;  1I4H A;  3LWE A;  1EWH A;  4RA8 A;  4X3U A;  1GXD C;  5IYC H;  1WTQ A;  1HZC A;  4DGZ A;  2G9H D;  3OPO A;  4KHV A;  3Q22 A;  1VQO A;  1X54 A;  4LUV A;  4IZ8 A;  5EKI A;  1ZEQ X;  2QDB A;  1JB7 A;  2LS0 1;  1RHP A;  4NDX A;  5D65 A;  1BKB A;  1EWC A;  1NY4 A;  4O1N A;  4DXG A;  1K8M A;  4IUP A;  3TDQ A;  1S5E D;  3OMG A;  2F4V Q;  4K5V A;  1O80 A;  2DNE A;  1PH8 A;  1CA5 A;  2FHT A;  1KNE A;  5D3I B;  4KKS A;  4AYB B;  5C0X H;  2VB3 X;  2E2I H;  4I7Z C;  4RKB A;  1S3O A;  3HOV H;  4FXG C;  3H3V I;  2K5D A;  2Q8I B;  2JEA I;  4C3J B;  2Q2T A;  3S1Q B;  2DY8 A;  2B39 A;  4N8F A;  3HZX A;  2E2J H;  3HOZ G;  1Y8N B;  1EFI D;  4QY7 A;  3KDF B;  1E0B A;  4HJ7 A;  5C0X G;  4DR7 L;  1PYW D;  1EQQ A;  4IUR A;  4DR3 Q;  1ET6 A;  1NUC A;  3H94 A;  4XDX A;  2WIN B;  2G9D A;  1PFM A;  1DGS A;  4JI8 L;  2MPM A;  5IY0 A;  4RHR A;  3SK6 A;  1CI3 M;  2NVQ H;  3CC7 A;  1BCP F;  2KA7 A;  2WB1 B;  1QOH A;  3KJO A;  1STN A;  2F0H A;  1RJT A;  4RFB A;  4ZQ3 A;  3GTQ B;  5ELO A;  4L5T A;  4DAY A;  4DUY Q;  1K83 H;  2DUD A;  3PUV A;  4FF2 A;  2PPB C;  1MJC A;  2RA4 A;  2AKW B;  1YBY A;  3OTO Q;  1KC8 C;  3D31 A;  3L2P A;  4DR4 L;  4UY8 C;  1JWU D;  3ZYY X;  3D0F A;  4FF3 A;  1T5E A;  5DAU A;  3HOX H;  1YHB A;  1M1K C;  3NEN A;  1P16 A;  1QB5 D;  3HKS A;  4PNY A;  1HZ9 A;  4C3I H;  1B53 A;  1HXY D;  3VYS A;  1XTC D;  1G2S A;  2H1E A;  1TS2 A;  3M4P A;  5EPJ A;  5JJL A;  2EYP A;  4KJO A;  1E22 A;  3HFZ B;  2Z4I A;  4LW1 A;  4RMF A;  3L9A X;  3HS0 C;  4A3D G;  4DV3 L;  4L5Q A;  1NSN S;  3K7A B;  4QMG A;  1ICW A;  4RGT A;  2OQ0 A;  2P5Z X;  1VQ5 A;  1HQM C;  2N8N A;  5CV9 A;  4A3F B;  5E1F A;  5K36 H;  1E2V A;  1NR2 A;  2JSO A;  3V96 A;  1I3Q H;  1NMF A;  1Q8I A;  3NP8 A;  1Z9F A;  3GP7 A;  4EX5 A;  1VF5 C;  2YTV A;  2MNA A;  1R9T B;  4JOI A;  5C4X H;  1ASY A;  2UU9 Q;  3CF5 A;  2F0T A;  1EIF A;  5I9P A;  3T51 B;  2NTS A;  5K36 G;  3ITP A;  1RTN A;  1VQD A;  4V19 0;  4GNX B;  4A3C H;  5M5W B;  2RDH A;  1TXY A;  2HIV A;  1PZI D;  2WAQ E;  4LF5 Q;  1GUW A;  3BG3 A;  2CKZ B;  1CTM A;  4UPA A;  1SYF A;  1ILP A;  4R8I A;  1VQB A;  5FO8 B;  3G48 A;  3BS1 A;  1EYG A;  3T1H L;  1BBU A;  3BZK A;  4OL7 A;  3ERO A;  1VMC A;  4NB3 A;  3U4V A;  1UAP A;  1SE2 A;  3TP6 A;  2K75 A;  3T16 A;  1YNN C;  2JA6 H;  1NNX A;  3Q24 A;  5CV8 A;  1GUN A;  1L1O A;  1M4V A;  4P72 A;  2VY3 A;  2IX3 A;  1TWH H;  1STY A;  1G2T A;  4R9W A;  4LUO A;  1G8Z D;  1GHJ A;  1VQC A;  3L0O A;  3RZD H;  1BF4 A;  4DV0 Q;  2NYZ D;  2E2I B;  1BBW A;  3CCM A;  2D5D A;  3HOV B;  2HUG A;  3NPP A;  1N32 L;  5IT9 L;  5C5M A;  1W6J A;  1B8A A;  2ASB A;  2HHH Q;  1PTO D;  1QIL A;  2NUC A;  5FKA C;  2E2J B;  4KN4 C;  3J81 L;  4YWM A;  1WTR A;  5FO7 B;  4YWL A;  1JWS D;  1CSP A;  1AE3 A;  1HCZ A;  1XJV A;  1II3 A;  1AN8 A;  4IPG A;  4YY3 L;  1ENA A;  1X3E A;  3AEV A;  4LWC A;  1X9N A;  4DR1 L;  2UUA L;  2NVQ B;  1SNC A;  3J81 j;  1A6X A;  3DWQ A;  4FP5 D;  4RGN A;  1PH4 A;  3BYY B;  1K83 B;  1EYA A;  1AEX A;  3HGB A;  3QJY A;  1CSQ A;  1V1Q A;  3MHB A;  1F9R A;  2Z8L A;  3JAM i;  4KY6 A;  2OXP A;  4FO2 A;  3MXP A;  3SK5 A;  3DWP A;  1B3Q A;  1K0R A;  1LV9 A;  4JI5 L;  1L0W A;  4EQ5 A;  1B4O A;  3CCR A;  4LFA Q;  2JA8 H;  4M1U B;  2E2D C;  4AYB E;  1F9P A;  1PZK D;  4F8M A;  1Z7T A;  2F0M A;  2YYZ A;  2RQX A;  4L8J A;  5EPL A;  4ZK9 B;  2QA4 A;  3HOX B;  1A2T A;  4C3I B;  1KAW A;  1WI5 A;  4XQN A;  5FLX L;  2IT1 A;  1KL9 A;  2EIF A;  3STB D;  5DNF A;  3SGI A;  3RLN A;  5M5Y H;  1FD7 D;  4ZUI A;  1IXR A;  5E3F A;  2XN9 C;  2RHQ B;  3GTJ H;  3DHQ A;  1IZ6 A;  3DLL A;  3E5S A;  3CCQ A;  1XPU A;  4JC0 A;  3M4Y A;  2J7Z A;  4XQQ A;  1L2F A;  1HNX L;  2WKC A;  5FLM G;  1BCP C;  1XMO L;  2WB1 E;  4BBS G;  1YI2 A;  4BA2 I;  3A74 A;  2HQE A;  3U4Z A;  2B2U A;  3GTM H;  1I3Q B;  3PCO B;  2Q2H A;  2K5W A;  4B3M Q;  3PQI A;  4KHZ A;  1EEF D;  1PYB A;  5C4X B;  3F2U A;  2B3G A;  2N49 A;  5CGK A;  4DR7 Q;  3L3O C;  3FHW A;  2F4I A;  1NTG A;  3PIP A;  2A6E D;  5K5P A;  4JI8 Q;  2K50 A;  3I4N H;  5IP9 G;  1BQQ T;  4IPD A;  4ODG A;  1HFN A;  3CRL C;  4ME3 A;  1PRT F;  2PNR C;  1HPC A;  1GD7 A;  1YNX A;  4DV2 L;  1JMC A;  1KDB A;  2XTI A;  2MO0 A;  1K3B C;  1J5E L;  4DV7 L;  2F0J A;  1GKH A;  5J22 A;  3I4N G;  1QE6 A;  3EJI A;  3ULL A;  1SJH D;  1KAA A;  2JQO A;  1NCV A;  2NVY H;  4U68 A;  4DR4 Q;  2IHF A;  2JA6 B;  4DAM A;  4A3G G;  2LSS A;  1SMY D;  3FEW X;  4XXE A;  3K5M A;  1G6P A;  1SFO B;  1D6E C;  1TWH B;  2LMC B;  4JI3 L;  2CWP A;  1VQM A;  2EDG A;  4L5S A;  2A69 C;  4JBJ A;  4HSP A;  4KN7 C;  1SRO A;  4CDC C;  3RZD B;  2A69 D;  4ME5 A;  2UUC L;  2Z6K C;  3MXU A;  3SK4 A;  1U4P A;  2NN6 I;  3DXJ C;  3F8T A;  1KRT A;  4DUZ Q;  2Q2I A;  1QNK A;  4DV3 Q;  3K0Y A;  1S5B D;  1IBM L;  1E3P A;  2B63 G;  3J80 c;  1VQJ A;  3FKI H;  5IYB H;  2B2T A;  4JCV E;  1I6V C;  1ZKO A;  5HY6 A;  4IOC A;  4AQY L;  1J8I A;  4A3B H;  2E76 C;  4RWS C;  1O7Z A;  2OTL A;  1CKM A;  1U0L A;  3H0G G;  4MTK A;  2G5D A;  2GVA A;  4FDB A;  3J7A F;  2OCE A;  4RGM A;  3CW2 C;  3JAM E;  1XNR L;  1GHK A;  5KGU A;  1MSG A;  3PGZ A;  4A3M G;  1HQR D;  1UWV A;  5EBD A;  4K0K Q;  3CCJ A;  2KHS A;  1FNU A;  4HJ5 A;  1WYD A;  2JA8 B;  5IP7 H;  3PSI A;  2XSC A;  2O5J C;  3F1Z A;  1RTO A;  4N9T A;  1DCZ A;  3PMF A;  1LT3 D;  3HOY G;  3CCE A;  4QUF A;  3CPF A;  2CW0 D;  1WTW A;  2WAQ G;  2NZH A;  4QUC A;  3T1H Q;  3NQT A;  4C2M H;  4A3E B;  3F2D A;  1LTB D;  3NWS A;  1VQ4 A;  3C46 A;  5M5Y B;  5IP7 G;  1SEB D;  2N55 A;  4AIM A;  4YCU A;  5KYL A;  4FXK C;  4YCV A;  1DJR D;  1F2L A;  4A93 H;  3GTJ B;  4ZYS A;  5JVH 3;  4XQJ A;  1SDF A;  1X3G A;  5DM6 3;  1IL8 A;  2K5Q A;  2KUM A;  3DWA A;  1SYC A;  1EU3 A;  4PQX A;  1IHZ A;  3VR6 A;  5D14 A;  1VQH A;  1YHQ A;  1AZP A;  4YCW A;  3GTM B;  1N32 Q;  1WD1 A;  2AQ1 B;  4PZ7 A;  4BY7 H;  4JI0 L;  4RAU C;  5CV6 A;  2AHO B;  1QZG A;  4R1J A;  3OIQ A;  1VQG A;  3MA2 B;  4M8A A;  5AJ3 L;  4IPH A;  5E7N A;  2PO4 A;  5HGT A;  1LT5 D;  5FJ8 H;  4YY3 Q;  1W2B A;  4BXX H;  4IQZ A;  4DR1 Q;  4O0A A;  1CT1 D;  5IGE A;  1EIG A;  4N8X 1;  2O4X A;  1TS4 A;  2V4D A;  1HTL D;  2Z4H A;  2X6L A;  1N34 Q;  4Y52 H;  3GQB A;  1PTO H;  1STG A;  4H13 C;  4GN3 B;  4KJN A;  1QG7 A;  1PFB A;  1K0S A;  4BXX G;  4JI4 L;  3E0J A;  2ZJR A;  2NN6 G;  1O7I A;  2NVY B;  2A1A A;  1EQR A;  3NBI A;  1SLJ A;  1UEA B;  4IPC A;  3NE5 B;  1NBW A;  1KHI A;  4AYB G;  3W1B A;  3P1H A;  4MTN A;  1OXS C;  4DK3 C;  2H4O A;  2F3I A;  4C3J G;  3ERS X;  1TQO A;  4CJ0 B;  1HR0 W;  4LF5 L;  3I4M H;  1WTX A;  5BN4 A;  4DAY B;  5M3F B;  1BUV T;  3FKI B;  2OWO A;  1HNX Q;  1CM9 A;  1PRT C;  5ELC A;  1XMO Q;  5A35 A;  2E75 C;  2FFK B;  1M90 C;  3MVV A;  4A3B B;  5CBA E;  5HUR A;  2R7D A;  1VQP A;  1HUM A;  4U67 3;  2JK8 A;  5LMU L;  3I4M G;  2K52 A;  2WB1 G;  3MAQ A;  1BDO A;  4K14 A;  4A3I H;  3CCV A;  3R8B A;  4LF4 L;  4G7Z C;  4ILW A;  1TS3 A;  3NK9 A;  4F87 A;  2CVR A;  2F0G A;  3PF4 A;  4JV5 Q;  2N3S A;  3VR2 A;  3CQZ H;  3Q0A A;  2F0O A;  1K28 A;  3PUX A;  1U4M A;  2ATW A;  4GN5 A;  3TBI B;  5GAE C;  4A3I G;  4ULL A;  2HHH L;  2MJ8 A;  3VA7 A;  2X6G A;  4DV7 Q;  2XWB B;  3TRE A;  5LMN Q;  2E5L L;  2VL6 A;  4C2M B;  4IAL A;  1U4R A;  2Q8T A;  3W2D A;  1VQ6 A;  4DPG A;  3S1N H;  2CCZ A;  5IGF A;  1SR3 A;  1XXG A;  4HED A;  2F03 A;  1IBK L;  2PW5 A;  2KEN A;  4DKA C;  1TR5 A;  3KF8 A;  3MXG A;  3S1M B;  4A93 B;  1I4X A;  4JI3 Q;  3GTG H;  4B3R L;  3MFG A;  1YJN A;  1L0Y B;  5COY A;  4POG A;  2EYM A;  4CKC A;  4A3F G;  2UUC Q;  5IOC A;  2M2L A;  3TME A;  3E0E A;  1PTO F;  2IX1 A;  1G6Z A;  3BYT B;  1OXT A;  2KCC A;  4RHS A;  5M5W H;  2JE6 I;  3QWN A;  3MFY A;  4BY7 B;  3M3Y H;  1T9H A;  2F0F A;  3E6Z X;  1IBM Q;  2RCN A;  1A3T A;  4Y7N H;  5A2Q L;  4XTC S;  3NTK A;  4AQY Q;  4NP5 A;  1HR0 L;  1C9O A;  2MHV A;  3BZC A;  1JB3 A;  4DNR B;  2AWO A;  1B2T A;  2EYF A;  3LWU A;  1EY5 A;  3MWY W;  4QIW B;  2EE1 A;  4WJ3 M;  5C0X J;  2ZM6 L;  5KND A;  1L1O B;  2NBF A;  1VQN A;  2JJQ A;  4R4C A;  2DN8 A;  3SVM A;  1Q90 A;  1IYJ B;  5IYC G;  2DJF C;  2CQA A;  2ZXP A;  4ABN A;  1XNR Q;  3H91 A;  4B9W A;  1PTO B;  1B7Y B;  1CZW A;  2BH8 A;  4DK1 A;  3EIV A;  2LKV A;  1SAP A;  1Q86 C;  1V1P A;  4DFA A;  1Y1W H;  3VYU A;  2WKD A;  4HTH A;  2WFW A;  4J1M A;  3C2P A;  4DAP A;  4EQN A;  4B3M L;  4NXM L;  2KJX A;  1PH6 A;  1Q1B A;  4S3S A;  2DJG C;  3K80 C;  4FYD A;  5IE8 A;  1Y1W G;  3I70 A;  1SYD A;  2TMP A;  5LL6 S;  3EN2 A;  5M3M B;  5BN3 A;  4QCL A;  3HOV G;  2Z6B A;  1Q1E A;  1VDZ A;  2MFI A;  1I4R A;  1C8C A;  5E4W C;  2F0N A;  3J80 L;  1D1K A;  2A74 C;  3E9H A;  3I4M B;  1RL2 A;  4A75 A;  4QL5 A;  4DU9 A;  4DAV A;  1QZH A;  1KQS A;  3ULJ A;  2B2Y A;  1LTI D;  1B9N A;  2B2V A;  4CDD C;  4A3J B;  2F0L A;  2A73 B;  2IWH A;  2MO1 A;  3PF5 A;  2R6G A;  1ONL A;  1ESR A;  1EU4 A;  3UI2 A;  2PI2 E;  3K8A A;  4JI0 Q;  1CKN B;  2CH4 A;  2AUJ D;  3PIO 3;  1KLU D;  2ZTD A;  4A3I B;  1JE4 A;  4Q5V A;  1N36 L;  1GM5 A;  2UXB L;  1HH2 P;  2FJ2 A;  3PO3 H;  1U4L A;  5AJ3 Q;  1AP0 A;  4LJZ C;  3NBH A;  1Z47 A;  3EQL C;  1ESF A;  2YTY A;  3NUC A;  3CQZ B;  4GN4 B;  5JEA H;  4JVZ A;  4I7A A;  1BCP B;  1X3F A;  1GUS A;  3C1E A;  1S4Z A;  1G91 A;  4DUZ L;  4C1N K;  4Q0F A;  3HOX G;  1WFQ A;  1OXV A;  1VQA A;  1AW7 A;  4C3I G;  2XWJ B;  1X55 A;  1YIT A;  1F9S A;  4KI0 A;  4JI4 Q;  4UP8 A;  3I8Z A;  5JEA G;  5IT9 E;  3K6O A;  3S1N B;  3NEM A;  3M7G A;  1TKW B;  3KBG A;  1Q7Y C;  1DZ1 A;  2ALY B;  3LNN A;  3KFU A;  2D62 A;  1I4G A;  3GTG B;  3J81 E;  4OEL B;  1EYD A;  1DM0 B;  3DEO A;  2PMZ B;  2EXZ A;  1HA5 A;  1H9J A;  2I0Q A;  3GTK H;  1PXU A;  4ZAI A;  4JOI C;  1DOK A;  3BZD B;  5AFW A;  4IO9 A;  1KDC A;  5FOB B;  1CHQ D;  4LAA A;  4K0K L;  3M9B A;  3M3Y B;  1YZ6 A;  4LFB L;  5GAG C;  4PMC A;  4OON A;  3VR5 A;  5KNB A;  4Y7N B;  2F3V A;  5C4X G;  5T1G A;  3QR8 A;  1SYE A;  2EJF C;  4KY7 A;  3S17 H;  4TSS A;  4QQB X;  3VR3 A;  2PCF B;  2RSO A;  2JYO A;  2K28 A;  1DYQ A;  1E1T A;  4A3C G;  3A54 A;  3N52 A;  1ML0 D;  1VF7 A;  2YTX A;  4MNO A;  5C5L A;  3I72 A;  1N33 L;  2F0K A;  2N88 A;  2QEJ C;  3PV0 A;  4F7X A;  5LMU Q;  1HUN A;  3I91 A;  3OW7 A;  4GKK Q;  4RG1 A;  3HKZ B;  3SDZ A;  1U9R A;  4R4T A;  1SFO H;  5FLX E;  2Q2U A;  4LF4 Q;  1PH5 A;  1QUQ A;  2EYH A;  4TKO B;  1L1O C;  1PH3 A;  2K6A A;  2K14 A;  1Y1W B;  1HFG A;  4HSV A;  5BR8 L;  2XRQ D;  1PVO A;  2JA6 G;  4A3L H;  1Y1V H;  3S1R H;  1EY4 A;  1PTO C;  2AQ2 B;  5CC4 A;  1WD0 A;  1FVI A;  1WTV A;  5IGD A;  3A8J E;  3A7A B;  3KOJ A;  2E5L Q;  1LAC A;  2EZV A;  3U58 A;  1TWF H;  4MHE A;  4GLV B;  4A3L G;  1KRS A;  2NTT A;  3A8I E;  1IBK Q;  3CC4 A;  3NSW A;  3M85 A;  1CK1 A;  1U5K A;  1CA6 A;  4QIW E;  4X64 L;  2F0E A;  2C5C A;  3UDF A;  4B3R Q;  1JQY D;  3BDO A;  3NWT A;  5LMN W;  2JA5 H;  1LTS D;  5C3W A;  1IW7 D;  4XYO A;  1N34 L;  5KNC A;  1YJ9 A;  1PYS B;  3U9O A;  2OEO A;  3HP3 A;  1GOZ A;  2KEE A;  5JJZ A;  3CAM A;  2SOB A;  2V1C C;  1C7Y A;  1HRJ A;  3ERQ A;  1KLG D;  1MIU A;  1Q46 A;  2KBN A;  1HR0 Q;  3PO3 B;  3A5U A;  1BVS A;  3STB C;  1K8O A;  1VQ7 A;  4DNI A;  4HJ8 A;  2ZM6 Q;  4A3E H;  1CZG A;  4JG2 A;  1HA6 A;  2JA8 G;  3TP5 A;  1FNV A;  1O7Y A;  1C0A A;  2FMM A;  3RR5 A;  3A56 A;  3W3A A;  3IFT A;  5JJK A;  4TRD A;  4A3E G;  2B2W A;  2NZ1 D;  2OT2 A;  4IUU A;  4X65 Q;  2E2H H;  5DLQ E;  2ENB A;  3RN5 A;  1D5M C;  2XNA C;  3B6Y A;  3S14 H;  1SNO A;  5IIF A;  2I5M X;  3D4R A;  3GTO H;  4LF9 L;  2KCN A;  2R61 A;  4NXM Q;  2EXD A;  1H9S B;  4EVO A;  2B2U C;  4J8Q A;  4PV1 C;  2BA0 A;  5KEE A;  5IYD H;  1TY2 A;  2BOS A;  3NEL A;  4K2L A;  1LTR D;  3GTK B;  3KLR A;  4FXD A;  2A6E C;  1MBY A;  5ELN A;  1XPO A;  3IKJ A;  4EGV A;  5I2X A;  4JV5 L;  3R3O A;  1QWY A;  1F2Z A;  4LF8 Q;  4OO1 H;  4JPB W;  1BBX C;  1LTL A;  2CHB D;  3T1Y L;  1QJO A;  3S17 B;  4XT1 B;  1JIC A;  1LTA D;  2YU9 H;  3C1F A;  2HQL A;  5LMN L;  4CGY B;  1XX8 A;  2NVT H;  2SNM A;  1D7Q A;  3CRK C;  1EQV A;  5ISR A;  1SMY C;  4KKT A;  1V8Q A;  2N78 A;  1STE A;  1EEI D;  1TY0 A;  4XT3 B;  4IFD I;  4WFN 3;  1DD2 A;  4KHP L;  4GNX A;  1KNA A;  1N36 Q;  1STH A;  2UXB Q;  2B29 A;  1JOR A;  4E6I A;  3CCU A;  1PV4 A;  2JA7 B;  3CXC A;  1EIY B;  1JJ2 A;  1B50 A;  1QVG A;  2VNU D;  5T1I A;  1EOV A;  2JXM B;  2FIN B;  2PMZ E;  3NQI A;  3SR1 A;  4LF7 L;  4GOP A;  1PRT B;  4J15 A;  1Y1V B;  2EQS A;  2LXJ A;  3S1R B;  3G6J B;  1HNW L;  3N6R A;  1MHW C;  2ZXR A;  1WTP A;  5M3F H;  3HEJ A;  5ELF A;  4GLX A;  5DEH A;  1STB A;  2UUB L;  3T4A C;  3F2B A;  3TS2 A;  1TWF B;  4CJ1 B;  1XNQ L;  2B2T C;  3M7N A;  4H0L C;  4JI6 Q;  1ZYR C;  2HCC A;  3KLW A;  3WDN A;  1ZYR D;  5M3F G;  4B9X A;  2A5H A;  3FKI G;  3NTH A;  5IYB G;  2JA5 B;  4K8I A;  5CBE E;  1DXM A;  5JJI A;  5CV5 A;  4HIM A;  1GUT A;  2EY6 A;  5EBC A;  3HKZ E;  4P71 A;  3KUP A;  3NTI A;  4A3B G;  5TSS A;  3VR4 A;  2D9U A;  3HOW H;  4K5X A;  1QCB D;  3HRZ C;  3CCL A;  4EQO A;  1V1O A;  3S24 A;  4BY1 H;  4LFB Q;  5I6Y A;  4DV6 Q;  2K03 A;  2ZT9 C;  1O7L A;  1SN8 A;  2R7Z H;  1VQL A;  4JW0 A;  4KY5 A;  2IL8 A;  3MZ5 A;  4NKL A;  5KIX A;  3A55 A;  1G29 1;  2CW0 C;  3DMU A;  2HCI A;  5IGG A;  4APV A;  4KTA A;  2K01 A;  3I2Z A;  4OX9 L;  3T53 B;  1N33 Q;  3GTP H;  2PQA B;  4O2D A;  4DV4 L;  4TQU S;  1C48 A;  4HAE A;  3KF8 B;  1A15 A;  5I4D A;  2R7Z G;  2L55 A;  4OGQ C;  1XMQ L;  2L4N A;  2EY2 A;  3RZO H;  3S1M H;  2MGS A;  2BE5 D;  5GAH C;  5F2D A;  1PDQ A;  1NJI C;  1SBB B;  3OSO A;  2QCP X;  2E2H B;  4OIJ A;  3P7J A;  5BR8 Q;  1W3S A;  5J39 A;  3S14 B;  5IGB A;  4QB4 A;  1A3U A;  3GTO B;  1AFP A;  4A93 G;  3I7F A;  4FF4 A;  1P8L A;  1V9P A;  2NB0 A;  4IFD H;  1PMR A;  4FVM A;  4JYA L;  4QJF A;  1EY9 A;  3KF6 A;  4FNF A;  4HMI A;  5HGQ A;  1AE2 A;  1S5C D;  3TRZ A;  1DOL A;  2RVL A;  3R93 A;  4NXN Q;  3G6E A;  3S2H H;  3BDC A;  3I56 A;  4KK7 A;  4BY7 G;  4X64 Q;  2Y0S B;  5NUC A;  5I9O A;  1R4Q B;  2WV6 D;  4IFD G;  1X3Q A;  5LHY 1;  2L11 A;  2K7V A;  2D2C C;  5C4J H;  4XYQ A;  4OWT B;  4DV1 L;  2QF7 A;  2YU9 B;  1LTG D;  4GLA C;  2HDM A;  5FJ8 G;  2NVT B;  3ND9 A;  1LM0 A;  2F0P A;  4UDU C;  4HIO A;  1E7Z A;  1I50 H;  3D6C A;  4OEM B;  1F77 A;  4IJL A;  4MIU A;  4KKU A;  2EYJ A;  3DUZ A;  2K1B A;  3Q23 A;  4X66 Q;  1VQ8 A;  2HIX A;  3UDX A;  4BBR H;  2D0O A;  3OOC A;  4X62 L;  1FYC A;  5M3M H;  2WP8 J;  2UXD L;  3VYT A;  3H3V C;  3H6M A;  3U9S A;  1GUO A;  1SYG A;  4EQP A;  2ZXO A;  1J9O A;  3J7Z C;  2Z0S A;  4J6H A;  4OWX B;  4PG3 A;  1OO9 B;  1TT2 A;  3MXN A;  5M3M G;  4A3J H;  4NPS A;  1K8A C;  2EVB A;  1FGB D;  3EVQ A;  2L5T A;  4KMU C;  2JEB I;  3VYR A;  4PZ6 A;  2VUM H;  2DY7 A;  1UE1 A;  4LF9 Q;  3TP7 A;  1WCM H;  1EYC A;  5A2Q E;  1BOS A;  1EOT A;  1XWE A;  2CQO A;  2F0S A;  3I55 A;  4GKK L;  5C3X A;  4IJH A;  3EFX D;  4DK0 A;  2R7F A;  3WOE A;  1I6H H;  4A3J G;  3EBE A;  2R93 H;  4G7O C;  4C3H H;  3L7Z C;  3HOW B;  1GJX A;  2AMC B;  4CDE C;  1MI2 A;  3S15 H;  4BY1 B;  1PH1 A;  3C3L A;  1NR4 A;  2RSN A;  1KXL A;  2JA9 A;  2M9V A;  4RCO A;  1SE3 A;  2VZA A;  3CP0 A;  2R7Z B;  4ID6 A;  1N9W A;  2FMC A;  2ZTC A;  2VB2 X;  3T1Y Q;  3U50 C;  4GKJ L;  5DM7 3;  1WTH A;  3GTP B;  3FPP A;  3ICE A;  4L5R C;  1Y8O B;  2GVB A;  4A3K H;  1X6O A;  1X56 A;  1YNJ D;  4KHP Q;  3I90 A;  1M8A A;  2AUK A;  5EKL A;  3UE1 A;  4HCS A;  1A63 A;  1JJG A;  3RZO B;  3PO2 H;  2BA1 A;  2LFN A;  4ZCK A;  5KYI A;  3J81 i;  2KOL A;  2NZO A;  3J7Y W;  4DV5 Q;  4LF7 Q;  3J80 E;  1UUP A;  1FR3 A;  1HNW Q;  4IN3 A;  2YV5 A;  2KED A;  1SNP A;  3KBX A;  3PUZ A;  1SE8 A;  4K6L A;  1EQT A;  2UUB Q;  1SRU A;  4LMQ D;  1I94 Q;  4C56 C;  5C3E H;  1XNQ Q;  1ENF A;  1Y14 B;  1VQE A;  2RBM A;  4K8J A;  4B3S L;  2Z9H A;  3S2H B;  1A62 A;  2RDF A;  4P73 A;  4OHJ A;  2PW7 A;  1QVC A;  1QUQ B;  4HID A;  3VDY A;  1EY7 A;  1CUK A;  3PUW A;  5C4J B;  1LYL A;  5C3E G;  5EJW A;  4CJ2 C;  2VQE L;  2R3Z A;  4HMJ A;  4LNQ A;  2J4X A;  1SNQ A;  5JAV A;  3ZJY C;  4X65 L;  4PMB A;  3S2D H;  3A7L A;  1JWM D;  1F9Q A;  1MD2 D;  4KD4 A;  4ALP A;  1I50 B;  3HKZ G;  4CKE A;  3V05 A;  3OMC A;  3T13 A;  4I65 A;  4OXP A;  3FP9 A;  2VS1 A;  4X6A H;  2PZT A;  2KQ3 A;  1MGS A;  4BBR B;  4LK1 C;  4OX9 Q;  3LX0 A;  4X3K A;  3AB9 A;  2H5X A;  3UE0 A;  2L12 A;  4DV4 Q;  2F0Q A;  3NHH A;  2PZW A;  3IFD A;  4RCN A;  4LF6 L;  2A68 C;  2HD3 A;  3HOZ H;  5JOB A;  1PFS A;  2PI2 A;  3CU7 A;  1XMQ Q;  2A68 D;  3CMA A;  5IWA L;  3GDE A;  2K04 A;  4LF8 L;  4XIG S;  3J7A V;  3RMH A;  2K33 A;  1IYV A;  3K5O A;  2Y0S E;  3SEB A;  1IBL L;  2QIL A;  1GO3 E;  4CKB A;  3HOU B;  3S9W A;  1B3A A;  1YEZ A;  3GV6 A;  1PH7 A;  2B2Y C;  4OIK A;  1B70 B;  2BH2 A;  2JN4 A;  2B2V C;  3MEH A;  2VUM B;  5JEA J;  1MJE A;  4BA1 I;  1WVL A;  1KDA A;  3FPU B;  4UP7 A;  1WCM B;  3G71 A;  2BDN A;  4A4I A;  3AFQ A;  2KEC A;  2O5I C;  4YIJ A;  1KIX A;  4P74 A;  4DR2 Q;  1I6H B;  4JYA Q;  1YHA A;  2R93 B;  1S5F D;  2Z1C A;  2KHI A;  4C3H B;  1NAP A;  1E2Z A;  1CKO A;  2VQF L;  1L0X B;  1JOQ A;  2IX0 A;  2L0C A;  2C35 B;  3S15 B;  3R2T A;  3KJP A;  3AFP A;  1RDP D;  2C9O A;  4IUV A;  3R2I A;  3W5O A;  1TWC B;  3I73 A;  2J0T D;  3Q8D A;  2CH4 W;  5CYU A;  4PMW A;  3D4W A;  1W6K A;  5C6A A;  3G4S A;  4DV1 Q;  3PO3 G;  4G7H C;  4A3D H;  3FVQ A;  2K4K A;  3ONA B;  4YHH L;  4A3K B;  4JBW A;  4GZY C;  4R4O A;  3MEF A;  3PIO A;  1O78 A;  2ZJP A;  4JI6 L;  4HIK A;  1VMP A;  4JI1 L;  3A5Z B;  2R92 H;  1IKM A;  2SDF A;  3PO2 B;  1GUG A;  3ND8 A;  1Q82 C;  3OWE B;  2L9H A;  2AQ3 B;  2DGY A;  4X62 Q;  3E3X A;  5JPN C;  1H9K A;  4L6T B;  2UXD Q;  1IYU A;  3DEP A;  1AZQ A;  2NVX B;  2R92 G;  1HZB A;  4JI2 L;  5C4Z A;  3AU7 A;  4K5W A;  3URY A;  4DV6 L;  1WTO A;  1BNZ A;  2EJM A;  1ET9 A;  1A3V A;  1EWI A;  1PH9 A;  1TVX A;  1JCK B;  5C3E B;  2ZJQ A;  4IUT A;  1LAB A;  5CR3 A;  4CDF C;  4Z9C B;  3F2C A;  3PUY A;  1BR9 A;  2HDL A;  4LFC L;  1FJG L;  3QIA A;  3JAM c;  4DXF A;  3V2T A;  1TWA H;  2UXC L;  4NW2 A;  3H3V H;  2A6H C;  4GOP B;  2JA7 H;  1S5D D;  2K5V A;  3BVM A;  2A6H D;  1SXT A;  3GD7 A;  3S2D B;  5IGC A;  3D6W A;  5IOD A;  4OO1 I;  2ICI A;  2OQK A;  1CHP D;  1UNS A;  1RKN A;  4ZKC B;  4UHV A;  4GKJ Q;  1VCI A;  2K32 A;  1YNN D;  4BS9 A;  1EY8 A;  2JA7 G;  4HJA A;  4PZ8 A;  4DR5 L;  5E4X A;  2HT1 A;  1H9M A;  1PLF A;  4OWW B;  3HOZ B;  1Y1V G;  2E8G A;  1IL2 A;  4NXN L;  1EY6 A;  3M4O H;  1JOO A;  2SEB D;  4RGO S;  2KCM A;  1FNW A;  2RF4 A;  1IW7 C;  1AH9 A;  1TU2 B;  1MSH A;  4IUQ A;  1UEB A;  2EYL A;  2OTJ A;  1I5F A;  1PZJ D;  1K9M C;  4NMZ A;  2LY7 A;  3KDF A;  1XYI A;  2WAC A;  3RUZ A;  1H9R A;  2MP1 A;  3FMC A;  3ULP A;  4G57 A;  2JA5 G;  2I5H A;  4A76 A;  1RCV D;  2Q8R E;  2PNH A;  1D2B A;  5M5X H;  4X66 L;  3TQY A;  4UP9 A;  4B3S Q;  1F2Y A;  1X32 A;  2E74 C;  1I4P A;  4QGU A;  5CV7 A;  1JOK A;  3K59 A;  1WJJ A;  5M9O A;  1LT4 D;  1ILQ A;  2IW3 A;  1UE7 A;  1E24 A;  2IHE A;  4A3D B;  1EIH A;  1CKN A;  3D3R A;  2VQE Q;  1K8G A;  1A8V A;  1DON A;  2L1B A;  3QO2 A;  4K2K A;  3SE0 A;  4DR6 L;  5FLM H;  2CFM A;  4BBS H;  1YVC A;  3A8K E;  4B3T L;  2B2W C;  1NE3 A;  3K5N A;  2R92 B;  1ENC A;  3CHB D;  4KLK A;  1HNZ L;  2K5N A;  4H44 C;  5FK9 C;  1WOC A;  5C4H A;  5C44 H;  3PIP 3;  3SK8 A;  3KF6 B;  3K57 A;  3WOF A;  2DNC A;  1MKH A;  3HG9 A;  2IJ0 A;  3SHL A;  3FRP B;  1CFM A;  2I5L X;  5D3D A;  1TWG H;  1VQF A;  3JC6 6;  2L15 A;  4LF6 Q;  3CCS A;  1BCP D;  4K6D A;  4R4Q A;  5IWA Q;  5C44 G;  3RNU A;  3DM1 A;  3MTS A;  5IYD G;  5G3L F;  1D8L A;  1SND A;  3I4O A;  4RKL A;  5IP9 H;  3S16 H;  5EGT A;  1IBL Q;  2MUY A;  2XRS D;  3NXW A;  5EQ0 A;  2CWA A;  4L63 B;  2XVS A;  1VQI A;  5BN5 A;  2OF1 A;  2PYK A;  1NMG A;  1ICF B;  2I46 A;  4O42 A;  1FL0 A;  3KYH C;  5JPM C;  4OO1 G;  2Y0S G;  1PHJ A;  1D5X C;  1R4P B;  3K7U C;  2GA4 B;  3CC2 A;  3AMU A;  1TWA B;  2ES2 A;  3UDG A;  4P75 A;  5EKK A;  4A3G H;  3KLS X;  3BVZ A;  1TS5 A;  5L37 A;  4GNX C;  1ZXT A;  2F1M A;  1XPR A;  2BDO A;  4DF7 A;  3GV3 A;  1T5X D;  2XGT A;  3FDT A;  2VQF Q;  1D1I A;  1KD1 C;  5KRU A;  4DV5 L;  2F0D A;  2AWN A;  2ID0 A;  1EUJ A;  3AQQ A;  1EZ6 A;  3H09 A;  4P2C B;  3MXN B;  3RD4 A;  4GOP C;  5J3B A;  1QNU A;  3D4D A;  1VS0 A;  1I94 L;  2F0W A;  2Z6K A;  4LUZ A;  4DNT B;  3OIP A;  5I2Y A;  4YHH Q;  2B63 H;  3CD6 A;  3KLS A;  3TZU A;  3OHX C;  3OYY A;  4JK1 C;  4TVA B;  4JI7 L;  1JE5 A;  4YWK A;  1I4Q A;  4JI1 Q;  3E9I A;  3M4O B;  5EPK A;  3ER0 A;  3X3M A;  1H95 A;  3KK7 A;  3H0G H;  2A8V A;  3TSS A;  4V0B A;  1SE4 A;  3K58 A;  1RF2 D;  4ZLT F;  1XTD A;  3Q6S A;  3RLO A;  1SJE D;  5ELE A;  4H7B A;  4JI2 Q;  4A3M H;  3RN2 A;  1IKL A;  1DOM A;  4FF1 A;  1B9M A;  1YIJ A;  2B8G A;  1V43 A;  5ELB A;  5LL6 X;  2FXQ A;  5FO9 B;  2JP1 A;  1YJW A;  4DK6 C;  3HOW G;  1CQV A;  5M5X B;  2VW9 A;  3QOJ A;  2I07 B;  2KHJ A;  4C1N I;  4BY1 G;  3HOY H;  2F4V L;  3GTL H;  4POF A;  3H15 A;  4LFC Q;  1FJG Q;  3BVG A;  2SNS A;  5I6W A;  4GS3 A;  2BE5 C;  2UXC Q;  3D8G A;  4IFD J;  1LTT D;  3CME A;  2IPK D;  1JR0 D;  4F88 A;  1HZA A;  3K81 C;  4WOR A;  4G4K A;  4BBS B;  1UE5 A;  4B08 A;  1SNM A;  2QW7 A;  4DR3 L;  2TSS A;  1PA6 A;  2KCT A;  4HN7 A;  3J80 i;  5C44 B;  3T56 B;  1OXX K;  2RHS B;  1X65 A;  4ZRZ A;  1QVF A;  4DR5 Q;  4DR2 L;  1HJP A;  1BXT A;  1TWG B;  2XIW A;  1C4Q A;  4WJ4 A;  1LT6 D;  2QDL A;  5GQO A;  4DUY L;  4ZUJ A;  1Q81 C;  1K3R A;  2EY5 A;  3AYH B;  1A2U A;  2PZU A;  1EZ8 A;  3OTO L;  1SYB A;  5GRO A;  3MC0 B;  3S16 B;  3TZD A;  1JC7 A;  1EY0 A;  1FGU A;  2VXW A;  4QF4 A;  3OWF A;  1V1P B;  1VQK A;  1H9S A;  4KV6 A;  1Z6H A;  1CQF A;  1HTP A;  1S40 A;  3JAM L;  3I4N B;  3M4Q A;  1LUZ A;  3DM3 A;  1STA A;  2NN6 H;  1A0I A;  2QGQ A;  2K05 A;  2UUA Q;  1F2M A;  1ASZ A;  4BWG B;  2IY5 B;  4A3G B;  3IRB A;  3X3N A;  2WII B;  1EFW A;  4HCE A;  1OTC A;  1E1O A;  2ICE C;  3EA6 A;  3QG1 A;  1E2W A;  3GO5 A;  2LXK A;  2RKS A;  1Q3L A;  1KTK A;  2QKI C;  1B44 D;  1N8R C;  4IUN A;  4JI5 Q;  3K5L A;  2EY1 A;  5ELD A;  2F0U A;  1JJC B;  4HR7 B;  4C3J H;  4BBR G;  3S1Q H;  4ZKB B;  5IT9 c;  3K0X A;  4JBK A;  2B63 B;  3HOU H;  1D5Z C;  5G3L D;  4DR6 Q;  2UU9 L;  1TII D;  4RH6 A;  2F3W A;  4B3T Q;  3J81 c;  1HNZ Q;  1UE6 A;  3SXH A;  1HHV A;  4H02 A;  2ZTE A;  2K5H A;  3QB3 A;  2PQE A;  3H0G B;  2F52 A;  4X3S A;  5EAY A;  1K73 C;  3O13 A;  1J6Q A;  2F0V A;  2EOT A;  3NBH B;  1PH2 A;  3HOU G;  4HJ9 A;  2QEX A;  4MZ9 A;  3GTQ H;  3CKI B;  2VUM G;  1PRT D;  4X3T A;  5C0X I;  1JT8 A;  3IAY A;  1WCM G;  4A3M B;  3IL8 A;  5CV4 A;  1LO5 D;  3VA5 A;  4KD3 A;  1ROD A;  1GVP A;  1RIP A;  3P75 A;  2RCF A;  3I3C A;  1TWC H;  5JVG 3;  4DA2 A;  3TP8 A;  5J1Z A;  4CBV A;  4WJW A;  3W1G A;  2R93 G;  4C3H G;  3LGJ A;  3A0J A;  3TN2 A;  3HOY B;  2NWG A;  3GTL B;  1B1Z A;  1LLR D;  2WAQ B;  3TEH B;  3TS0 A;  1YNJ C;  2KVM A;  4R4I A;  4R8N A;  5FLX c;  4DV0 L;  4CHT B;  2X69 A;  5CMD A;  4IOA A;  2RDG A; 
#chains in the Genus database with same CATH homology
 2WAQ G;  2NZH A;  3BJU A;  4YHH L;  3T1H Q;  1C0A A;  4DV2 Q;  4AH6 A;  4C2M H;  4JBW A;  3RR5 A;  2MQH A;  4R4O A;  3F2D A;  3MEF A;  3PIO A;  2ZJP A;  1J5E Q;  1OXU A;  1VQ4 A;  2GN5 A;  4HIK A;  4JI6 L;  3K7A H;  4JI1 L;  5JJK A;  3A5Z B;  5IP7 G;  2R92 H;  3UDI A;  4AIM A;  4A3E G;  4A3K G;  4YCU A;  4X65 Q;  4YCV A;  2E2H H;  2A19 A;  4A93 H;  5DLQ E;  3RLF A;  3RN5 A;  1Q82 C;  3B6Y A;  4A3F H;  3S14 H;  5GAD C;  2NVX H;  2I5M X;  2D0P A;  1SMX A;  3BU2 A;  3GTO H;  4LF9 L;  3PO2 G;  1X3G A;  2DGY A;  2PQA A;  4X62 Q;  4NXM Q;  2EXD A;  1VQ9 A;  2UXD Q;  2BA0 A;  5IYD H;  1YHQ A;  1VQH A;  2R92 G;  1N32 Q;  4YCW A;  1Q12 A;  3NEL A;  1HZB A;  3CPW A;  1R9T H;  4JI2 L;  4JI7 Q;  4PZ7 A;  4DV6 L;  4JI0 L;  4BY7 H;  2AHO B;  5ELN A;  1XPO A;  1S72 A;  1QZG A;  3OW2 A;  1EWI A;  1PH9 A;  4R1J A;  4JV5 L;  1G51 A;  1VQG A;  4LF8 Q;  5H1S E;  3WWV A;  2ZJQ A;  4JBM A;  1Q8K A;  5AJ3 L;  4IPH A;  5E7N A;  4LFA L;  3J7A 5;  1LTL A;  3F2C A;  3PUY A;  5FJ8 H;  3T1Y L;  4YY3 Q;  1W2B A;  4BXX H;  5IYC H;  4LFC L;  1HZC A;  2YU9 H;  1FJG L;  4DR1 Q;  3JAM c;  5LMN L;  2HQL A;  4O0A A;  2NVT H;  1TWA H;  1VQO A;  1X54 A;  2UXC L;  3H3V H;  1D7Q A;  4LUV A;  2N78 A;  1N34 Q;  4GOP B;  4Y52 H;  2JA7 H;  2K5V A;  4IFD I;  4GN3 B;  4KHP L;  4GNX A;  1JB7 A;  3GD7 A;  4BXX G;  1N36 Q;  4JI4 L;  2ZJR A;  2UXB Q;  1BKB A;  1NY4 A;  2B29 A;  2NN6 G;  3CCU A;  4OO1 I;  1PV4 A;  1O7I A;  2OQK A;  2A1A A;  3CXC A;  1EIY B;  1EQR A;  1JJ2 A;  2F4V Q;  1QVG A;  2VNU D;  4GKJ Q;  1EOV A;  1VCI A;  1PH8 A;  1SLJ A;  2PMZ E;  4LF7 L;  4GOP A;  2JA7 G;  4HJA A;  4J15 A;  4PZ8 A;  2LXJ A;  2EQS A;  2E2I H;  4IPC A;  4DR5 L;  1S3O A;  3HOV H;  1HNW L;  1NBW A;  3H3V I;  2HT1 A;  2JEA I;  4OWW B;  1KHI A;  4AYB G;  2Q2T A;  1Y1V G;  5M3F H;  2E8G A;  3W1B A;  4GLX A;  4MTN A;  1IL2 A;  2UUB L;  1OXS C;  4NXN L;  4DK3 C;  3F2B A;  3M4O H;  2E2J H;  3HOZ G;  3TS2 A;  2F3I A;  4QY7 A;  3KDF B;  4HJ7 A;  3ERS X;  5C0X G;  4DR7 L;  1HR0 W;  4LF5 L;  1XNQ L;  3I4M H;  4DAY B;  1EQQ A;  2KCM A;  4DR3 Q;  3M7N A;  4JI6 Q;  2RF4 A;  1AH9 A;  2OWO A;  3KLW A;  1HNX Q;  4JI8 L;  1XMO Q;  1DGS A;  5IY0 A;  5M3F G;  1UEB A;  1M90 C;  2OTJ A;  1I5F A;  3FKI G;  5IYB G;  2NVQ H;  3CC7 A;  2R7D A;  1K9M C;  3KJO A;  1VQP A;  5JJI A;  4HIM A;  3KDF A;  2JK8 A;  3HKZ E;  4P71 A;  5ELO A;  5LMU L;  3I4M G;  4L5T A;  4DUY Q;  4A3B G;  1K83 H;  2DUD A;  2K52 A;  3PUV A;  3HOW H;  2WB1 G;  1MJC A;  3ULP A;  2JA5 G;  3CCL A;  2I5H A;  2AKW B;  1YBY A;  3S24 A;  4A3I H;  4A76 A;  3CCV A;  3OTO Q;  4BY1 H;  4LFB Q;  1KC8 C;  4LF4 L;  2PNH A;  3D31 A;  4DV6 Q;  5M5X H;  4X66 L;  3L2P A;  3TQY A;  4DR4 L;  4UY8 C;  1SN8 A;  4UP9 A;  4B3S Q;  1VQL A;  2R7Z H;  3D0F A;  3PF4 A;  4JV5 Q;  2N3S A;  1G29 1;  3CQZ H;  1YHB A;  4QGU A;  3HOX H;  1M1K C;  3NEN A;  1P16 A;  4APV A;  3HKS A;  1HZ9 A;  1WJJ A;  3I2Z A;  3PUX A;  4C3I H;  2ATW A;  4OX9 L;  4GN5 A;  1N33 Q;  5GAE C;  3GTP H;  4A3I G;  1UE7 A;  2PQA B;  4O2D A;  3M4P A;  1E24 A;  2HHH L;  5JJL A;  2IHE A;  4DV4 L;  1E22 A;  4TQU S;  3HFZ B;  3KF8 B;  4DV7 Q;  1CKN A;  4LW1 A;  2VQE Q;  2R7Z G;  4RMF A;  3TRE A;  5LMN Q;  1K8G A;  1A8V A;  1XMQ L;  2E5L L;  2VL6 A;  4DR6 L;  4A3D G;  3RZO H;  4DV3 L;  5FLM H;  2CFM A;  3S1M H;  4BBS H;  1YVC A;  4L5Q A;  1VQ6 A;  4DPG A;  3S1N H;  4B3T L;  2CCZ A;  1SR3 A;  1NE3 A;  5GAH C;  2OQ0 A;  4KLK A;  1IBK L;  1HNZ L;  1NJI C;  2K5N A;  1VQ5 A;  2KEN A;  1WOC A;  5C44 H;  2N8N A;  3KF6 B;  4DKA C;  5BR8 Q;  4JI3 Q;  1W3S A;  3GTG H;  4B3R L;  1MKH A;  1YJN A;  4POG A;  2I5L X;  1TWG H;  1I3Q H;  1NMF A;  3I7F A;  4A93 G;  1VQF A;  4A3F G;  1Z9F A;  3JC6 6;  2UUC Q;  2L15 A;  4LF6 Q;  3E0E A;  4EX5 A;  1P8L A;  1V9P A;  3CCS A;  2IX1 A;  2YTV A;  2MNA A;  1OXT A;  5M5W H;  2JE6 I;  4R4Q A;  5IWA Q;  5C44 G;  4QJF A;  4JOI A;  3RNU A;  5C4X H;  3KF6 A;  4JYA L;  1ASY A;  2UU9 Q;  3M3Y H;  3CF5 A;  1T9H A;  5IYD G;  1EIF A;  1D8L A;  3I4O A;  5IP9 H;  1IBM Q;  5HGQ A;  1AE2 A;  1VQD A;  2RCN A;  4Y7N H;  1IBL Q;  3S16 H;  3TRZ A;  5K36 G;  4GNX B;  4A3C H;  4NXN Q;  1TXY A;  2HIV A;  3G6E A;  2CWA A;  4XTC S;  3I56 A;  4BY7 G;  3S2H H;  4AQY Q;  4X64 Q;  1HR0 L;  1C9O A;  1VQI A;  2WAQ E;  3BZC A;  4IFD G;  4LF5 Q;  1NMG A;  2AWO A;  2CKZ B;  4WJ3 M;  5C0X J;  4UPA A;  5C4J H;  1FL0 A;  3KYH C;  2ZM6 L;  4OO1 G;  2Y0S G;  4OWT B;  4DV1 L;  1PHJ A;  1L1O B;  1VQB A;  3G48 A;  3K7U C;  4GLA C;  1VQN A;  3CC2 A;  5FJ8 G;  2JJQ A;  4R4C A;  1EYG A;  3T1H L;  2ES2 A;  1BBU A;  3UDG A;  4P75 A;  1IYJ B;  5IYC G;  1LM0 A;  4A3G H;  4HIO A;  3BZK A;  1XNR Q;  4GNX C;  1E7Z A;  1XPR A;  4NB3 A;  3U4V A;  1B7Y B;  2XGT A;  2VQF Q;  2BH8 A;  1I50 H;  2K75 A;  2JA6 H;  3EIV A;  1KD1 C;  1Q86 C;  1L1O A;  4P72 A;  4DV5 L;  1Y1W H;  2VY3 A;  2WFW A;  4IJL A;  2AWN A;  1TWH H;  2ID0 A;  1EUJ A;  3AQQ A;  4X66 Q;  1VQ8 A;  2HIX A;  3MXN B;  4LUO A;  3UDX A;  4BBR H;  2D0O A;  4GOP C;  5J3B A;  1VQC A;  4X62 L;  3L0O A;  4B3M L;  3RZD H;  4NXM L;  5M3M H;  2WP8 J;  1PH6 A;  2UXD L;  4DV0 Q;  1Q1B A;  1BBW A;  3CCM A;  1VS0 A;  1I94 L;  4YHH Q;  2Z6K A;  4LUZ A;  3K80 C;  1N32 L;  2B63 H;  3CD6 A;  5IE8 A;  1Y1W G;  3OYY A;  1B8A A;  3J7Z C;  2Z0S A;  4TVA B;  4JI7 L;  3EN2 A;  2ASB A;  2HHH Q;  4OWX B;  4PG3 A;  1JE5 A;  4YWK A;  3HOV G;  1Q1E A;  4JI1 Q;  3E9I A;  2MFI A;  3ER0 A;  5M3M G;  4YWM A;  4A3J H;  4NPS A;  1K8A C;  3E9H A;  1H95 A;  1RL2 A;  3H0G H;  4YWL A;  4A75 A;  2A8V A;  1CSP A;  1AE3 A;  4QL5 A;  1KQS A;  1QZH A;  2JEB I;  4PZ6 A;  3ULJ A;  1XJV A;  2VUM H;  1UE1 A;  4IPG A;  4LF9 Q;  4YY3 L;  1WCM H;  1X3E A;  1XTD A;  3RLO A;  2CQO A;  3AEV A;  4LWC A;  3I55 A;  2MO1 A;  3PF5 A;  4IJH A;  1X9N A;  4DR1 L;  2R6G A;  2UUA L;  4GKK L;  3J81 j;  2R7F A;  4JI2 Q;  4A3M H;  1I6H H;  4A3J G;  2PI2 E;  3EBE A;  1PH4 A;  3RN2 A;  2R93 H;  3K8A A;  4C3H H;  4JI0 Q;  3L7Z C;  1CKN B;  1CSQ A;  2AMC B;  1YIJ A;  1V1Q A;  4IOA A;  1V43 A;  2ZTD A;  3S15 H;  3JAM i;  2FXQ A;  1YJW A;  1PH1 A;  1N36 L;  1GM5 A;  2UXB L;  4DK6 C;  1HH2 P;  2JA9 A;  3HOW G;  1KXL A;  2VW9 A;  4EQ5 A;  1K0R A;  2VZA A;  4JI5 L;  1L0W A;  5AJ3 Q;  3CP0 A;  3CCR A;  3PO3 H;  4LFA Q;  2JA8 H;  2ZTC A;  1N9W A;  1Z47 A;  2KHJ A;  4BY1 G;  4AYB E;  2YTY A;  3T1Y Q;  2F4V L;  3GTL H;  3HOY H;  4POF A;  3U50 C;  4GKJ L;  3H15 A;  2YYZ A;  4GN4 B;  4LFC Q;  2QA4 A;  1FJG Q;  1KAW A;  3CC4 A;  1WI5 A;  1X3F A;  4GS3 A;  3ICE A;  2UXC Q;  4DUZ L;  4L5R C;  2GVB A;  1KL9 A;  2EIF A;  2IT1 A;  1WFQ A;  3STB D;  3HOX G;  4A3K H;  1X6O A;  1OXV A;  1VQA A;  3CME A;  1X56 A;  1X55 A;  3SGI A;  1YIT A;  3RLN A;  4KHP Q;  4KI0 A;  5M5Y H;  1HZA A;  1A63 A;  3K81 C;  3UE1 A;  4JI4 Q;  1IXR A;  4UP8 A;  1JJG A;  3PO2 H;  5JEA G;  1UE5 A;  2RHQ B;  3NEM A;  2BA1 A;  3GTJ H;  1IZ6 A;  3DLL A;  4DR3 L;  1PA6 A;  2KCT A;  3CCQ A;  4JC0 A;  1XPU A;  1L2F A;  3J81 i;  2NZO A;  3J80 i;  1Q7Y C;  5FLM G;  1HNX L;  2ALY B;  1XMO L;  2WB1 E;  3KFU A;  2D62 A;  4BBS G;  1OXX K;  2RHS B;  4DV5 Q;  4LF7 Q;  1YI2 A;  1X65 A;  1HNZ Q;  4BA2 I;  1QVF A;  3A74 A;  3U4Z A;  4DR5 Q;  4DR2 L;  1HJP A;  1HNW Q;  3GTM H;  2YV5 A;  4WJ4 A;  3PCO B;  3PUZ A;  2Q2H A;  1SE8 A;  2I0Q A;  4B3M Q;  3GTK H;  5GQO A;  4DUY L;  4JOI C;  1Q81 C;  1K3R A;  2UUB Q;  4KHZ A;  4IO9 A;  1SRU A;  1I94 Q;  1PYB A;  3AYH B;  4K0K L;  2B3G A;  2N49 A;  3M9B A;  3OTO L;  1YZ6 A;  4LFB L;  5GAG C;  5GRO A;  5C3E H;  4DR7 Q;  1XNQ Q;  4OON A;  1Y14 B;  1VQE A;  1FGU A;  3FHW A;  4B3S L;  5C4X G;  1NTG A;  3PIP A;  1A62 A;  4P73 A;  4JI8 Q;  1VQK A;  2K50 A;  3I4N H;  3S17 H;  4QQB X;  1QVC A;  5IP9 G;  4IPD A;  1QUQ B;  4HID A;  3VDY A;  4ME3 A;  1E1T A;  4A3C G;  1CUK A;  2YTX A;  3PUW A;  4MNO A;  1S40 A;  1GD7 A;  1YNX A;  4DV2 L;  1LYL A;  1N33 L;  3PV0 A;  1JMC A;  5C3E G;  3M4Q A;  1LUZ A;  2MO0 A;  2XTI A;  3DM3 A;  5LMU Q;  1J5E L;  4DV7 L;  4GKK Q;  1A0I A;  2QGQ A;  2VQE L;  2UUA Q;  1ASZ A;  4RG1 A;  1GKH A;  4LNQ A;  2IY5 B;  1IBL L;  3IRB A;  4R4T A;  3ZJY C;  4X65 L;  1SFO H;  1EFW A;  2Q2U A;  4LF4 Q;  3I4N G;  3S2D H;  1PH5 A;  1QUQ A;  3ULL A;  1OTC A;  1E1O A;  2JQO A;  4ALP A;  1L1O C;  2NVY H;  3HKZ G;  1PH3 A;  2IHF A;  2K14 A;  4DAM A;  4A3G G;  4DR4 Q;  2LSS A;  3GO5 A;  2LXK A;  1G6P A;  4OXP A;  3FP9 A;  2VS1 A;  5BR8 L;  4X6A H;  4JI3 L;  1PVO A;  1N8R C;  2JA6 G;  2CWP A;  4JI5 Q;  4A3L H;  1Y1V H;  1VQM A;  4L5S A;  3S1R H;  4JBJ A;  4OX9 Q;  1SRO A;  2H5X A;  3UE0 A;  1JJC B;  1FVI A;  4DV4 Q;  2UUC L;  2Z6K C;  3HOZ H;  4LF6 L;  4C3J H;  4BBR G;  3S1Q H;  2NN6 I;  3F8T A;  1PFS A;  1KRT A;  5IT9 c;  3KOJ A;  2PI2 A;  3K0X A;  1XMQ Q;  4JBK A;  2E5L Q;  3CMA A;  5IWA L;  3HOU H;  4DUZ Q;  4DR6 Q;  3GDE A;  2Q2I A;  3U58 A;  4XIG S;  4LF8 L;  4DV3 Q;  1TWF H;  2UU9 L;  4GLV B;  4A3L G;  4B3T Q;  1IBM L;  1E3P A;  3J81 c;  2B63 G;  2Y0S E;  1KRS A;  3J80 c;  1UE6 A;  1VQJ A;  1IBK Q;  3FKI H;  4H02 A;  5IYB H;  1GO3 E;  2ZTE A;  2K5H A;  4JCV E;  5HY6 A;  4IOC A;  3M85 A;  1U5K A;  1YEZ A;  4QIW E;  4X64 L;  4AQY L;  1PH7 A;  2F52 A;  3UDF A;  4B3R Q;  2BH2 A;  1B70 B;  4A3B H;  5EAY A;  1K73 C;  1J6Q A;  3NBH B;  5LMN W;  5JEA J;  1PH2 A;  4BA1 I;  1MJE A;  2JA5 H;  4UP7 A;  2OTL A;  3HOU G;  4HJ9 A;  1CKM A;  1U0L A;  3H0G G;  2QEX A;  4MZ9 A;  3GTQ H;  3G71 A;  1N34 L;  2VUM G;  4A4I A;  2GVA A;  4FDB A;  3AFQ A;  5C0X I;  1YJ9 A;  2OCE A;  1JT8 A;  1KIX A;  1PYS B;  1WCM G;  4P74 A;  4DR2 Q;  3CW2 C;  4JYA Q;  4IFD J;  1YHA A;  1GVP A;  1RIP A;  2KHI A;  1XNR L;  3CAM A;  1TWC H;  2V1C C;  3PGZ A;  4A3M G;  1CKO A;  1UWV A;  2VQF L;  1C7Y A;  2IX0 A;  2C35 B;  3W1G A;  1MIU A;  3KJP A;  2R93 G;  3AFP A;  4K0K Q;  1Q46 A;  3LGJ A;  2KBN A;  3CCJ A;  3A0J A;  1HR0 Q;  3A5U A;  4HJ5 A;  1BVS A;  1WYD A;  3W5O A;  3STB C;  3Q8D A;  1VQ7 A;  4DNI A;  4PMW A;  5IP7 H;  4HJ8 A;  2ZM6 Q;  3PSI A;  3G4S A;  3TEH B;  4DV1 Q;  4A3E H;  3TS0 A;  3PO3 G;  3F1Z A;  4R4I A;  4JG2 A;  5FLX c;  4DV0 L;  4A3D H;  2JA8 G;  3HOY G;  3CCE A;  2K4K A;  3CPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...