1ZXTA

Crystal structure of a viral chemokine
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
VSYTPNSCCYGFQQHPPPVQILKEWYPTSPACPKPGVILLTKRGRQICADPSKNWVRQLMQRLPAIAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of viral macrophage inflammatory protein I encoded by Kaposi's sarcoma-associated herpesvirus at 1.7A.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Signaling protein
molecule keywords functional macrophage inflammatory protein 1-alpha homolog
total genus 12
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zxtA01
3R93A 1QNKA 5EJWA 3TN2A 2N55A 1F2LA 4MHEA 1PFMA 4X3KA 2HCCA 1EL0A 3DEPA 4ZLTF 1WTOA 2X6LA 1BBXC 4R9WA 1WD0A 3I8ZA 3UI2A 2KVMA 4QUFA 2L9HA 2NZ1D 1O80A 4QUCA 1AP0A 1E0BA 1J8IA 2MJ8A 4HEDA 1SAPA 5EKIA 1WTPA 1X32A 2FHTA 3D6WA 2NYZD 5T1IA 2X69A 1EIGA 2B2UC 1SSOA 2EOTA 2L1BA 5EPJA 1B50A 1HA6A 3FPUB 1ZXTA 5D65A 4IUUA 3TZDA 2R3ZA 1JE4A 2M2LA 4ZAIA 4CJ0B 1DONA 1QG7A 4IUPA 4IURA 4IUQA 5EPKA 2FJ2A 4XDXA 2L4NA 1EIHA 1TVXA 2L11A 1IKLA 2B2VA 1NR4A 2MGSA 1AZQA 1O7YA 1MI2A 1KNAA 3DM1A 5E4XA 4RA8A 4X3TA 4CJ1B 1HUMA 1CM9A 1ILQA 2MP1A 2Q8RE 3IFDA 4RWSC 3MTSA 1O7ZA 1MSGA 1VMPA 1RTNA 3GV6A 1PFNA 3I3CA 5EQ0A 5D14A 1GUWA 2DY8A 5T1GA 1G2SA 4ZK9B 1BO0A 3I90A 5COYA 2D9UA 1VMCA 2J7ZA 5E4WC 4R8IA 2B2WC 1B4OA 1U4RA 1XX8A 1J9OA 3MWYW 1F9SA 1HRJA 1PLFA 4OIKA 1U4MA 2KUMA 1DZ1A 4MN3A 5CBAE 3Q6SA 4DN4M 2DY7A 4RAUC 1F9PA 1LV9A 1KNEA 2EE1A 1WTQA 1XYIA 1DOMA 2B2TA 1ILPA 1RHPA 2K1BA 2HDLA 2BDNA 2X6GA 3QO2A 1PFBA 4LMQD 4CJ2C 1ML0D 1WTWA 3KUPA 4HCSA 2Q8TA 1JICA 2B2VC 1MGSA 4NW2A 5EPLA 2KEDA 1BNZA 1X3QA 2B2YC 1CA5A 3N52A 1HUNA 1RTOA 1U4PA 2N88A 2HCIA 2B2WA 3F2UA 1ICWA 4OIJA 3KBXA 1G6ZA 3ONAB 1DOKA 2K01A 2KECA 2SDFA 3FDTA 5CMDA 2JYOA 2NWGA 4XT3B 1HFNA 4IUVA 3P7JA 1MSHA 2K28A 3SVMA 5CORA 1RJTA 2FINB 3I91A 2K05A 2RSOA 1U4LA 2HUGA 5AFWA 1NR2A 1G2TA 1RODA 1B3AA 1WD1A 2VXWA 5DNFA 2B2UA 4ZKBB 1WVLA 3LWEA 1F9RA 1S4ZA 4IUTA 2EPBA 4O42A 1IL8A 2B2YA 5JJZA 1F9QA 3HP3A 1Q3LA 1X3PA 4UAIA 2FMMA 2HDMA 3H91A 2B2TC 1HFGA 4HSVA 1WTXA 3GV3A 5CBEE 2MPMA 1DOLA 2K03A 2CVRA 1AZPA 2RA4A 1M8AA 2RVLA 1EQTA 1A15A 2JP1A 2XIWA 3G7LA 1B53A 1WTVA 1IKMA 1ESRA 2L12A 1B2TA 1QE6A 4X3SA 3DEOA 1CA6A 1C8CA 1NCVA 4X3UA 4ZKCB 1WTRA 2H1EA 1BF4A 2FFKB 4HAEA 1HHVA 4U68A 1SDFA 3IL8A 2KOLA 4XT1B 1EOTA 2KEEA 2RSNA 2K04A 1NAPA 2IL8A 1G91A 1PDQA
chains in the Genus database with same CATH superfamily
3R93A 4YCUA 3I4MH 1HNXQ 4A3LH 3BDOA 3QOJA 1EUJA 4BXXG 3VR2A 2PZTA 3I4OA 4YCWA 1D5MC 3C3LA 2R92G 3RLFA 1EWCA 4LF7Q 4N8FA 3OPOA 1STAA 4YIJA 2I07B 1ZXTA 4ZAIA 4NXNQ 1K0RA 3EA6A 4IUQA 1S5ED 2OXPA 1QWYA 3RN5A 2MHVA 5I6YA 3NWSA 2F0IA 2MGSA 1CHQD 1FVIA 3NQIA 3AEVA 1Y8PB 4YY3L 4JOIA 2CW0C 3MVVA 4OEMB 3GV6A 4PG3A 3K5MA 1E2VA 4HIMA 2Z1CA 1F9SA 4L6TB 1HRJA 4LF9Q 1U4MA 2LFNA 4A3IG 1EU4A 2JA8H 4BS9A 4P73A 1FNVA 2RHSB 1GD7A 3T51B 1IBKL 4RGNA 2X6GA 4DV4L 3CCEA 5M5WH 3CCQA 3PV0A 3VA7A 3VYUA 1X55A 1H9SA 2JA8G 3HOYB 5C3EH 3KBXA 1IBLQ 2A74C 2A6HD 2PZUA 4EVOA 3S2HH 3O13A 2NWGA 5K36G 4B08A 4KY5A 2WKCA 1GHKA 1Q46A 5CORA 1QNUA 2K05A 1NR2A 1Q8IA 5DNFA 2B2UA 3CMEA 1H9MA 3I4NH 1CUKA 1QB5D 3M3YB 1PVOA 1IL8A 3PIO3 2EY1A 2JE6I 4IUNA 4DR7Q 4A3BB 1SYFA 4C3HG 3X3NA 2CQOA 5I6WA 2MFIA 1SE4A 4NPSA 1A6XA 3H3VC 3T1HL 3OSOA 4CDEC 3CPWA 2EJMA 4K8JA 4TSSA 3DMUA 3DHQA 2JXMB 1CA6A 4UY8C 3STBD 1BF4A 2FFKB 4OL7A 1N36L 4U68A 3IL8A 2NN6I 1I6HB 1TS5A 3E9HA 3JAMi 1YI2A 1PH5A 3GTOB 1B3QA 4BY1H 2UUBQ 1UE7A 2K5VA 4A3LG 2BE5C 4X64Q 3HOXB 2ID0A 5JVH3 2Q2HA 1IBLL 4R8NA 4DU9A 5FO7B 4EQPA 2A6ED 1VQ6A 2NZHA 5C5LA 1FYCA 1E0BA 2HQEA 1EIYB 4CHTB 1RL2A 2YV5A 2G9DA 2NYZD 2KBNA 4CDDC 3QG1A 4QY7A 4AYBB 2B8FA 3KYHC 1PZID 2Q2UA 2IX1A 4KMUC 1VQBA 2IHFA 1GO3E 1NR4A 4K5WA 1M90C 4DV7L 2EY5A 1Z6HA 1KTKA 1YZ6A 3RZDB 2DNCA 4RA8A 3KDFA 4OELB 4RG1A 3VR4A 3GTKH 2ZTEA 5D14A 1GXDC 4PZ6A 2D9UA 2ZJRA 5G3LD 1TKWB 3NUCA 1MBYA 4FDBA 1PLFA 4KY6A 2K33A 4POGA 2EE1A 3QOLA 2TMPA 2VQEQ 1TWHH 1QCBD 3I7FA 4GN3B 1XNRQ 1B44D 4QL5A 1TXYA 1ML0D 3K5NA 3IAYA 1K3BC 1B7YB 3QB3A 3KUPA 4A93G 1ENCA 4OXPA 3DUZA 2VUMG 2KEDA 3TEHB 1QZGA 1HTPA 1L0XB 2WINB 5FLMH 3NTKA 1KC8C 2MUYA 3M4OH 2MO0A 4OIJA 5FO8B 2EYJA 5GAGC 1UEBA 3PCOB 1TS4A 3HKZG 3HOUB 2R93H 2WIIB 3H15A 1WFQA 3NP8A 3C46A 4HJAA 1G2TA 2RHQB 2HHHQ 5IYCH 1SR3A 2BE5D 4ME5A 4A3JB 4JI0L 1E1TA 2JA7B 1SYGA 3TZUA 1PTOH 4LUVA 3J80E 2FMMA 2HDMA 2NB0A 3RN2A 3CCLA 2OWOA 5KNCA 2B29A 1RDPD 1WTVA 1Y8OB 4A3FG 1HXYD 4X62Q 3F2CA 1S5FD 3G71A 1VQEA 2A68C 2JA7H 2KOLA 2KEEA 5IP7G 3ULLA 4F7XA 2VNUD 3TDQA 2RCFA 3GO5A 4OWXB 1PFMA 1AE2A 1ONLA 5DLQE 4DR3L 4GOPA 3BU2A 3V96A 4HN7A 3GD7A 2AQ1B 5IYCG 3L9AX 2NZ1D 4IZ8A 2F0UA 2D5DA 4JI5L 3C1FA 1A63A 5T1IA 1EIGA 4LFCQ 1W6JA 3NTIA 1V1PB 4JI0Q 4IPGA 1JR0D 3PUZA 4ABNA 3SK5A 4R1JA 4L5SA 1I50B 1II3A 2KA7A 1PH4A 3KJPA 1KNAA 2AKWB 2E2JB 2PW7A 2MP1A 3J80i 2CWAA 4RWSC 1O7ZA 3DWPA 4B3TL 5IIFA 1G2SA 3FHWA 3KLWA 2A5HA 2J7ZA 3J80L 1IBKQ 1EZ8A 3LNNA 1F2ZA 4KJNA 4C56C 2PMZB 3OOCA 5EAYA 5IWAL 1N32Q 3RR5A 2M00A 1JOQA 4DV6L 5CV8A 1FJGL 2F4IA 3K7UC 5LL6S 3VA5A 4BY7G 1BNZA 5FLMG 3NK9A 1N8RC 4K0KL 3S1RH 1MJCA 3SE0A 4LUZA 1A62A 2ZJPA 2F03A 2OTJA 4JBKA 5CMDA 1MSHA 3SVMA 4DF7A 5LMNW 4BY7H 1SBBB 1K73C 1STNA 2ICIA 4CKBA 4B3MQ 4C3JH 5J22A 1LT4D 5D3DA 1S4ZA 4DR7L 2I46A 1JB3A 1A3VA 1DOLA 1D7QA 1IYVA 3SR1A 2SEBD 5GROA 1N36Q 3X3MA 3NBHB 3R2TA 3OTOQ 2K5HA 1P8LA 4QGUA 1NCVA 5JEAG 4Z9CB 1SROA 1TWGH 2QKIC 4DR5Q 1PHJA 3K0XA 2IL8A 4GKJL 2AUJD 1GHJA 5CV7A 5JOBA 1N34Q 3K59A 5BN5A 4DPGA 3S1QH 4KD3A 2WAQE 4X6AH 3S15H 1Y1WG 4QJFA 1CHPD 2WAQG 1PZKD 4A3JH 1X32A 5ELNA 1U5KA 1SSOA 2A68D 4IALA 1FGBD 1NSNS 3TP5A 5C4JH 3D8GA 1SYEA 2RDGA 2OQ0A 1Q12A 2B3GA 3DM3A 2L55A 1KDBA 4X3TA 4FP5D 2NVTH 4X66L 4JI2Q 1SYBA 1U9RA 3M3YH 4A3KG 5IT9c 3PMFA 1CZWA 2YU9B 2B63H 2WB1B 5H1SE 4UP9A 5IODA 3PSIA 1AE3A 1XNRL 4DN4M 3S2HB 4JI4Q 2SNMA 2BDOA 3I4LA 2Z6BA 5ELFA 1G51A 1A2TA 1A8VA 2L5TA 2ZXRA 2F3VA 4KHPQ 3K0YA 1GUGA 3UE1A 3AMUA 4MTKA 4DKAC 1SN8A 3FDTA 3A7AB 1YJWA 4P2CB 2UUCQ 1SFOB 1LTGD 2E75C 4KKSA 4PZ8A 5C3WA 2VQFQ 4WJ4A 2YYZA 3F2DA 3RD4A 4IUTA 4O42A 4OO1G 3M7GA 1YITA 5JPMC 1GUNA 5IP9H 4L5TA 2DJFC 3CCVA 3RZOB 4YHHQ 3Q22A 3HOWB 1B53A 3DEOA 4O2DA 1WYDA 2NVXB 3RZDH 1XJVA 1IHZA 2K04A 1D1IA 3A55A 3HOVG 4GNXB 4JBJA 4BY1G 1SFOH 2CKZB 3VR6A 3UDGA 4MHEA 4XIGS 4A75A 5KNBA 3HOYG 1E22A 3DEPA 4YWLA 1Q1EA 1SYCA 2K6AA 4KV6A 1WD0A 4DV5Q 1MD2D 4QMGA 2A8VA 4LFCL 4A3JG 1Y69U 1D1KA 1UE1A 3H09A 2VQFL 1LTAD 1LTBD 1B50A 1T9HA 1AFPA 5TSSA 4K5XA 1IL2A 3E6ZX 4JK1C 4DXGA 3S15B 1MI2A 3JAMc 2AWOA 3A7LA 2PI2E 1CI3M 2UUAL 2DJGC 1I6VC 5GADC 3S2DH 1RTNA 3PIPA 2WB1E 2DY8A 1YNXA 4ZK9B 4WJWA 1VF7A 4LUOA 5C44G 1CK1A 2JA6B 2KCMA 2JA8B 2I0QA 4DV6Q 5G3LF 1B9MA 1FJGQ 1XYIA 1G91A 1STGA 1JWUD 1ILPA 1NMGA 5BR8Q 1YIJA 2F0EA 4KHZA 1WCMB 3LWUA 2OCEA 2RKSA 2QILA 3G6JB 4IPHA 2BA0A 4DV3L 5K5PA 5M5YB 1RTOA 2WV6D 4K6LA 4DV4Q 1ICWA 4IFDH 2D0PA 2F0LA 4K14A 2Z9HA 3J7YW 1ET9A 3GTKB 3IFTA 3HOZG 4A3EH 2FINB 1JOKA 4QIWB 1JMCA 3AYHB 1ICFB 1WCMH 4ZKBB 4GLAC 1K8MA 1I3QB 4P71A 1X3PA 1Y1VB 4LNQA 1UE5A 4H02A 5L37A 1JT8A 3KOJA 4IPDA 3OMCA 1JE5A 2CVRA 3A0JA 4FVMA 1EEID 4J1MA 3LGJA 1IYJB 1NJIC 1WI5A 4X3UA 1HZAA 3EJIA 1PH1A 3AB9A 4I65A 2Y0SG 1S5CD 3CQZH 2ENBA 4HEDA 2LKVA 4RGTA 4TRDA 3HOYH 4DR6L 1LT6D 3U4ZA 1EL0A 4KN4C 1XNQL 3KF8A 2UUBL 3K81C 2KVMA 4RCOA 1CTMA 1EOVA 5KYLA 3T56B 5EKIA 3U58A 3F8TA 4O0AA 2FHTA 5A2QE 3NTHA 3OW2A 2EY2A 4OWWB 1QVCA 1ASYA 3G4SA 2DGYA 2L4NA 4XDXA 1XMOL 3I4MG 1KLGD 2QA4A 1I3QH 2B2VA 3M4PA 2R7ZB 2ZM6Q 1GUTA 3OW7A 4WORA 1YHAA 1OO9B 1HUMA 4P72A 1OTCA 3FRPB 1ET6A 1EU3A 1SXTA 1MSGA 4DV7Q 5JJIA 1Q81C 1VQPA 2LS01 1I94Q 4BBSH 3PO2B 4OO1I 3CCSA 1CKNA 4RHRA 4JI4L 1BCPD 1EQQA 1X3FA 2K7VA 3CCUA 3A5ZB 3GTMB 1SNQA 4TQUS 4C3HH 3H0GB 1TIID 2IHEA 4KD4A 4GN5A 3ZYYX 3QO2A 4LMQD 4CJ2C 4LF8L 4IPCA 1TY0A 4KHPL 2IX0A 1MKHA 1YHBA 1V1OA 4ZUJA 1JWMD 1SLJA 1JQYD 1K8GA 4H7BA 3ICEA 3E0EA 3I4MB 3ONAB 3GTQB 1TWFB 2QDLA 3CPFA 4IUVA 2HT1A 1CQVA 3I70A 2PYKA 2FXQA 1V1QA 1Y1VG 1G8ZD 3BVZA 3NE5B 1R9TH 1Q90A 5FLXL 4LF7L 3DWQA 3MFYA 1SE3A 2WKDA 3J80c 3Q23A 1G6PA 5JJZA 3S14B 3HOZB 1C7YA 1EQVA 3MFGA 2EVBA 4HSVA 3ERSX 3SK8A 4K2KA 2DUDA 1SJED 1TWHB 2N3SA 4YY3Q 5EBCA 2L12A 4X3SA 4HTHA 1C8CA 4L8JA 2IJ0A 1TR5A 3GQBA 4HAEA 4LF8Q 4KKTA 4CKEA 1V43A 1GM5A 2NZOA 2L15A 1NAPA 4GLXA 2OF1A 1VQ8A 1M4VA 2CQAA 4JYAQ 4DV2L 1K83H 1YNNC 1BKBA 5IYBG 2R7ZH 3T1YL 1VQLA 2JA6G 1A2UA 3H3VH 1HR0W 4DK0A 5IP7H 2ZXOA 2V1CC 1MJEA 1MIUA 4A93H 4J15A 3KBGA 4JVZA 3CMAA 4IQZA 3A5UA 2QF7A 4DAYA 1EIHA 1EY6A 2E5LQ 3W1GA 4XQJA 5FLXc 4KKUA 4L63B 2PO4A 2O5IC 4FF4A 4LWCA 3S17H 1QUQB 1A3TA 1LYLA 5ISRA 4BBSB 1CKNB 2VB2X 3HOUG 1KAAA 2A6EC 1SNDA 4R8IA 2O4XA 1XX8A 2G9HD 2OT2A 4A3FB 4C3IG 4B3TQ 4A3MH 4DV2Q 3SEBA 3GTLH 4O1NA 4GS3A 2B2TA 1JJGA 4A3KH 4A4IA 1OXUA 2BDNA 2NTTA 1WTWA 3S1MH 3ULJA 2WAQB 4CBVA 5NUCA 2VUMH 2B2VC 3PUXA 4KHVA 4A3MG 1L2FA 2A19A 1CA5A 3K7AH 2E2JH 2HCIA 4UDUC 4PMWA 4X64L 2JEBI 1EQRA 5D3IB 3MXNA 3I73A 3F1ZA 4K0KQ 3K5LA 2PCFB 3T4AC 1QVFA 3BDLA 4FF1A 1CQFA 1QOHA 1PRTC 2KHJA 5M9OA 2A1AA 1Y1WH 3EFXD 5IY0A 3MAQA 1ZYRD 5LL6X 4JPBW 2F0NA 4RGOS 4B3ML 3PIP3 4OO1H 2NBFA 3GTJB 4N9TA 4RH6A 1VQJA 1CT1D 2KJXA 2EJFC 1AH9A 3GTQH 1HCZA 4DNIA 1AZPA 1EYGA 3C2PA 4QF4A 4CGYB 1E7ZA 2JP1A 1VQ5A 4DAPA 5C4ZA 1DD2A 4NDXA 1QILA 1W3SA 2D62A 3CF5A 2LMCB 4DR6Q 3BZKA 4C3JG 1PRTF 2B39A 4B3SQ 3KF6A 2IWHA 3J81c 2AWNA 2BH8A 4H13C 2RF4A 5M3MG 1PTOD 1JOOA 4PMBA 3MA2B 1BBXC 2SOBA 1TY2A 3CW2C 3S14H 1K3RA 4QUFA 2R7DA 4C1NK 3ZJYC 4QUCA 2PMZE 3WOEA 2ASBA 1WTPA 1HH2P 2B2UC 5I4DA 1HA6A 1S3OA 4EGVA 1H9KA 3FPUB 3TZDA 3K8AA 3EIVA 5EPKA 4P75A 2XNAC 4A3GB 1TVXA 2QGQA 3WWVA 1LUZA 3OIQA 1BDOA 1TT2A 3FKIG 2Q8IB 4BWGB 1FNWA 4HIDA 5LMNQ 1ILQA 2Q8RE 3PO3B 4OWTB 3PGZA 3S17B 4LK1C 1N9WA 1PFNA 3JAML 2R92B 3CCMA 1X6OA 4A3DB 3GTGB 1BO0A 2JJQA 2A69C 1LTLA 3S1RB 1SNCA 4CDCC 4B3SL 4K8IA 4RKBA 4RHSA 4S3SA 3GTMH 1BQQT 3D0FA 1PTOB 4X62L 3D6CA 5DEHA 4PZ7A 4BBRG 1HQMC 4DK3C 5FLXE 4R4IA 2R93B 1VQ4A 4DR3Q 4PMCA 4EQNA 1PMRA 2E2DC 2LXJA 3NXWA 2UXCQ 3P7JA 2BA1A 2O2LD 4HIOA 2RSOA 5C4HA 4IFDI 3EQLC 3C1EA 5KIXA 3S9WA 5LMNL 1A0IA 1BXTA 1IW7D 2GA4B 4LF5L 1ESFA 2B2YA 2Z0SA 2JEAI 1KABA 1VQOA 2N49A 1FD7D 3J7AV 1VQIA 1JB7A 3STBC 4R4TA 3I56A 2K03A 3HOWH 1XTCD 3KLSX 3BYTB 5K36H 1ENAA 4G57A 1KIXA 2CFMA 3J81j 4GN4B 4FYDA 3TP7A 4A3DH 3RMHA 1QJOA 3CP0A 5M5XB 3CRLC 2VXWA 1L1OA 3FMCA 3I4NG 5HY6A 2NTSA 2N55A 3S16B 1X3GA 2R7FA 4RKLA 2HCCA 3G48A 3MZ5A 5IP9G 2R7ZG 1V8QA 2PQAB 5BN3A 4EX5A 2NVQH 4X65Q 4KK7A 2AQ3B 2F0VA 2GN5A 1LTSD 3J7ZC 1IZ6A 1X56A 5FKAC 3FKIB 1QVGA 1DONA 2XRQD 2L0CA 1DJRD 5C44B 1D2BA 4KLKA 3M85A 2BOSA 4L5RC 3DM1A 4HMJA 4ZRZA 3ULPA 1YNJD 4DXFA 2WB1G 4DAYB 4CJ1B 5M5YH 1K8OA 2A73B 4A3EG 2ZTDA 4MIUA 5M5WB 1R4PB 3GTGH 2F0MA 2F0GA 5T1GA 5COYA 1KRTA 5KEEA 1HZBA 1VQGA 1AEXA 3KDFB 3MWYW 2CW0D 4RFBA 2KUMA 3MXUA 5CBAE 1C48A 2EDGA 2F4VL 1EYCA 1WTQA 1DOMA 2XGTA 3CC7A 2E74C 3SGIA 4DR5L 4DR2L 3OWFA 4JI8Q 5EPLA 4DV0Q 4LW1A 2CHBD 1N34L 3N52A 2K75A 2NN6G 4CDFC 3BS1A 4IFDG 2N78A 2J0TD 1HNZQ 3TP8A 3S1QB 3CAMA 2KHSA 2XWJB 4UP7A 1HZCA 1KLUD 2JA9A 1WOCA 1U0LA 1RCVD 3NBHA 4I7ZC 4YWKA 3KFUA 2EQSA 1BCPB 2B2TC 2EXZA 4KJOA 1H95A 1S72A 4LF4Q 2MPMA 3BVMA 1Q86C 2JA5G 2A69D 1LACA 2ICEC 2RA4A 3GTPH 4APVA 4V0BA 4DGZA 2QEJC 3A74A 4X66Q 1ESRA 4JI2L 4FXGC 5M5XH 5C4JB 1B8AA 4A3MB 2EYMA 3FEWX 2RBMA 2F52A 4DR2Q 5GQOA 1PDQA 4DFAA 1QNKA 5C0XJ 3KF8B 1DCZA 1UNSA 5KNDA 4DR1Q 2CCZA 2GVAA 3DWAA 1EZ6A 3K5OA 2DNEA 4GLVB 1TWAB 2Z4IA 2K4KA 4I7AA 1O80A 1AP0A 2EYOA 2JK8A 3NSWA 4C2MH 2CH4A 4ID6A 1UE6A 5EPJA 1D5XC 3BG3A 1DXMA 5D65A 4IUUA 3VYSA 3M4YA 3L2PA 4A3IB 2ES2A 1EYDA 4IURA 3ER0A 4JI7Q 1EY9A 2UUCL 1SMYC 4LF4L 3I4NB 2PW5A 2IX3A 3P20A 5M3FB 4A3FH 3GTJH 2EYHA 2XWBB 3IFDA 3AFPA 1I4GA 3ND9A 5C4XB 4DK6C 2UXDL 4YHHL 1EWIA 3PIOA 3RZOH 3QJYA 4JI3L 1I94L 2JSOA 1VQMA 3Q6SA 2I5MX 3W3AA 3UE0A 1KNEA 1J5EL 1ZYRC 1OXSC 1H9RA 3MC0B 5AJ3L 4KY7A 2PI2A 1PFBA 1UEAB 5A35A 4XTCS 4BBRH 4DUYQ 3VYTA 1XPOA 4MTNA 1VQCA 1Z47A 4V190 3MHBA 3K58A 1U4PA 2UXCL 5C5MA 2B2WA 4DAVA 3F2UA 5KRUA 1H9JA 4DV5L 1RIPA 2F3WA 4B9XA 2G5DA 2JYOA 1G291 4RCNA 3CRKC 5LMUL 2F0QA 5IGGA 2KHIA 4XYOA 4LF5Q 1D8LA 1J6QA 2HUGA 5AFWA 1KXLA 2K32A 4C3JB 5FK9C 5IGCA 4JBWA 2B8GA 3SXHA 4NP5A 3I72A 2ATWA 2EYPA 2TSSA 3S1NB 2UXDQ 1XPRA 3BDCA 1CSQA 4JI3Q 2PNRC 3A56A 1EYAA 1RD9D 5BN4A 4UPAA 2EJGC 3D3RA 3HOZH 1HHVA 3EBEA 4DUYL 1PH3A 4G4KA 4R4QA 1M1KC 2PQAA 1VQ7A 3TP6A 2CWPA 1VCIA 3MXPA 5IYBH 2AQ2B 4JI1L 1RF2D 4CKCA 5BR8L 1QZHA 1Z9FA 3PUYA 3UI2A 3EROA 3PO2G 2VS1A 5IGEA 4YWMA 4GOPC 1SAPA 4WFN3 1YHQA 2OQKA 2X69A 3OMGA 5M3MH 1LM0A 2F1MA 2M2LA 3MEFA 3W2DA 2IY5B 3NENA 4G7HC 2V4DA 1XMQL 4HJ5A 4C3IB 4IOCA 2LXKA 2E5LL 3KLSA 5DM73 4XQQA 2JA7G 4ME3A 3OIPA 3HFZB 3TS0A 4JI6L 1GUWA 4PNYA 4K5VA 3I90A 4NB3A 3DLLA 4N9PA 2F4VQ 1K9MC 1EY4A 1I4PA 3I2ZA 3GTLB 2WP8J 2K5WA 3HKZB 4OIKA 3G6EA 1TWFH 4F8MA 2KCNA 4BXXH 1RHPA 3AQQA 4JI8L 2AUKA 2PNHA 3RLOA 5IOCA 1TU2B 3L0OA 2HIVA 1JICA 3CCJA 2XRSD 1SEBD 3H0GG 2B2YC 5C6AA 2NN6H 2B63B 4QB4A 1XNQQ 2EYLA 2K01A 3K7AB 2NVTB 1U4LA 2ZT9C 1RKNA 1F2MA 3H94A 2I5HA 4YCVA 1BBUA 1F9QA 3NPPA 3HP3A 2NVYB 1XMOQ 4JI6Q 1L1OC 1PYBA 3EN2A 1CSPA 4RGMA 5CV5A 3AFQA 4H0LC 2XTIA 1TWCB 3V2TA 2ZM6L 5C0XH 2CH4W 4XXEA 3RNUA 4ALPA 3BZDB 2I5LX 4K6DA 1E1OA 1SRUA 2E2IH 3BZCA 2K5QA 1PRTB 4EQ5A 1DYQA 4DR1L 2BCOA 2XSCA 1Q8KA 1PH2A 1EEFD 5IE8A 4X3KA 1BVSA 3KK7A 4R4OA 3HOXG 5EBDA 1B70B 2RQXA 5DAUA 2X6LA 5LHY1 2IW3A 4R9WA 1S5BD 3M9BA 4ILWA 4BY1B 3I8ZA 2LSSA 3NHHA 1I6HH 2MJ8A 3LX0A 1BUVT 4JG2A 3E3XA 1N33Q 2EOTA 3SHLA 1LTID 3NQTA 2XVSA 1NE3A 1T5XD 1NMFA 3E5SA 4IUPA 5E7NA 4XQNA 4GOPB 1TQOA 1PH8A 2QW7A 1SJHD 3GTPB 5ELOA 3I55A 3E0JA 5HGQA 4A3GG 1PH9A 4GNXC 1O7YA 1DM0B 1S40A 4NXML 1P16A 4EQOA 4BY7B 1ASZA 5I2YA 1W6KA 3HRZC 3MTSA 1VMPA 4BBRB 4F88A 5EQ0A 4OONA 1L0WA 1PV4A 1SE8A 2F0TA 2C5CA 3J7A5 1U4RA 1J9OA 2QCPX 3A8JE 2D0OA 1AW7A 3WOFA 3GDEA 4WJ3M 4G7OC 1X65A 1PTOF 3GTOH 2EY6A 5C0XI 1VQ9A 2Z4HA 5JAVA 2ZJQA 3P75A 2E76C 1O7LA 1KRSA 1VQKA 3KLRA 4JYAL 3M7NA 4DUZL 1GUOA 2HD3A 2VZAA 2OTLA 3TMEA 3T1YQ 2B63G 2E2HH 3PF4A 4XT3B 3Q24A 1LLRD 4A3IH 3VR5A 1EY8A 3K6OA 3Q0AA 1EY5A 3QR8A 2M9VA 1PTOC 3S2DB 2EPBA 4A3EB 2F0KA 4B3RQ 1TWAH 3MXGA 4UAIA 5JJLA 5IGDA 4L5QA 4XYQA 3GV3A 1D6EC 2KCTA 4DA2A 1WTHA 1WJJA 4MNOA 2RCNA 2F0OA 3U9OA 4HMIA 1M8AA 1A15A 2VW9A 4JOIC 1STYA 3PUVA 5KGUA 3FKIH 4LFBQ 2N8NA 4A3CH 2JA5H 3IRBA 3UDIA 3HOUH 2RSNA 1HNWL 3CCRA 1E24A 3HS0C 4DUZQ 3CC4A 4ZLTF 4TKOB 5FO9B 3N6RA 3BVGA 1CFMA 1IW7C 3D4WA 3SDZA 2AHOB 3HGBA 4NXNL 3SK4A 3FP9A 3NWTA 3TQYA 4BBSG 4FNFA 1BR9A 4X65L 2HHHL 1VDZA 2Q2IA 5C3XA 5CR3A 3H0GH 1JE4A 4CJ0B 2FMCA 3QIAA 5CV6A 3TRZA 5FJ8H 2H4OA 4N8X1 1HR0Q 3TREA 5E4XA 3OHXC 1LT3D 4KI0A 3HOVB 1A3UA 1TS2A 1V1PA 3U4VA 4JC0A 4HSPA 1VF5C 1XXGA 2EXDA 2NVQB 1PH6A 1HZ9A 4AYBE 3M4OB 2B2WC 2EZVA 1HNWQ 2E2HB 3S16H 1XPUA 2DY7A 3E9IA 3HOWG 1F9PA 2WFWA 4IJLA 3TSSA 4NMZA 2JA5B 2KCCA 4PQXA 5GAHC 3CXCA 2EYFA 4J6HA 1MGSA 4NW2A 2R6GA 1K8AC 4JI5Q 3CD6A 3A8KE 5J39A 1HUNA 1HJPA 3T16A 5IT9L 1JORA 5C3EG 1VQAA 2ALYB 2HQLA 3AU7A 1HFNA 1YEZA 4ODGA 5ELBA 2YU9H 1HR0L 5EKKA 1E2ZA 1WD1A 1SMXA 1PZJD 1V9PA 2K52A 1Y14B 4IFDJ 1BCPF 3H91A 2WACA 4ZCKA 2D2CC 5FJ8G 1AN8A 3URYA 3NBIA 1X9NA 2MO1A 5I9OA 3UDFA 4C2MB 5CC4A 3FVQA 4A3GH 3G7LA 4QIWE 2QEXA 1B2TA 1JJCB 5IGFA 1EY7A 3H6MA 3NELA 1N32L 1R4QB 4IOAA 2NVXH 4U673 1VQNA 5CGKA 1SDFA 2VL6A 2AMCB 4LFAQ 2P5ZX 2F0WA 5C3EB 1F2LA 2A6HC 3W5OA 1TS3A 3F2BA 1S5DD 2RDFA 4M8AA 2L9HA 1WCMG 5HURA 1B1ZA 4Y7NH 1X54A 2VB3X 5HGTA 1PRTD 1OXVA 4ZUIA 1SMYD 3HKSA 1PH7A 2L1BA 2Z6KC 1O78A 5JVG3 5ELCA 1SNPA 2R3ZA 1I4RA 1QG7A 1C9OA 5GAEC 4MZ9A 2F0FA 4NXMQ 1IKLA 1BBWA 1AZQA 1STBA 1NUCA 4DR4Q 1SYDA 1NNXA 2EIFA 4OGQC 4HIKA 4DV1Q 2F3IA 1KD1C 1K83B 3OTOL 3PO3G 1LO5D 1K28A 2YTXA 5ELDA 4LAAA 3D31A 5IYDH 1KDAA 2UU9Q 3ND8A 3J81L 3ERQA 1FR3A 3R8BA 5FOBB 2J4XA 4HJ7A 4G7ZC 2K1BA 2K14A 5EGTA 3UDXA 2HDLA 1GKHA 3JAME 2PQEA 4HCSA 2Q8TA 5AJ3Q 3VDYA 5JEAJ 2N88A 1PFSA 3R2IA 1OXXK 1G6ZA 4R4CA 2IPKD 3U9SA 4HJ9A 4BA1I 2NVYH 4HJ8A 1F77A 2K28A 4BA2I 5JJKA 5DM63 4DR4L 4ZQ3A 1EFID 5I9PA 3BJUA 1B3AA 4AIMA 2Z8LA 3MXNB 5CV4A 1HA5A 4RMFA 2ZXPA 4DV1L 3WDNA 1GOZA 3LWEA 5J3BA 4C1NI 5A2QL 5C44H 1Q3LA 1F2YA 2BH2A 3L3OC 1HFGA 5M3FG 1YNND 1I50H 4E6IA 3TS2A 4LFBL 2UU9L 2DN8A 2OEOA 2MNAA 4GZYC 2Y0SB 4IO9A 1W2BA 2VUMB 4ZKCB 1WTRA 1H9SB 4A93B 3HEJA 1K0SA 5J1ZA 1I4QA 1ZEQX 3A8IE 2F0DA 4OX9Q 1LTRD 3TN2A 1NBWA 5ELEA 3PQIA 1QUQA 3J81E 3MEHA 4GNXA 4Q5VA 1KAWA 4AQYL 2K50A 4JI1Q 1HTLD 2KENA 3VYRA 4DV0L 4UHVA 1IBML 5CYUA 5KYIA 1Y1WB 2PZWA 3T13A 1I4HA 4DAMA 4C3IH 1YJNA 1KHIA 2O5JC 1SNOA 1C0AA 1HNZL 4IJHA 4Y7NB 1O7IA 1X3EA 4ULLA 1Q7YC 5EKLA 4KTAA 2L11A 4C3HB 2C35B 5M3MB 2E8GA 3M4QA 3PO3H 1SE2A 3PUWA 1YVCA 1JJ2A 1VMCA 1R9TB 1B4OA 5IWAQ 2K5NA 3D4RA 1KQSA 2F0HA 4OX9L 4JW0A 4JCVE 4ZYSA 4FXDA 1DZ1A 5IT9E 1SNMA 4RAUC 3B6YA 1ZKOA 1FL0A 2IT1A 2Z6KA 4JV5Q 5CV9A 3T53B 3HZXA 4FXKC 1EIFA 3R3OA 3GP7A 4AQYQ 1UAPA 1GUSA 1YJ9A 1X3QA 1IBMQ 5I2XA 2R61A 4A3CG 2JN4A 2RDHA 1EY0A 4GKKQ 2F0SA 2SDFA 2C9OA 5E3FA 4A3BG 3HOXH 2R93G 1GVPA 3IKJA 4Y52H 1L0YB 3A54A 3I91A 4WRDA 1VQHA 1HQRD 1RODA 3EVQA 3FPPA 1JCKB 3Q8DA 5C4XH 1WVLA 2UUAQ 4PV1C 1NY4A 1Q82C 4JI7L 2K5DA 3SK6A 1EWHA 4J8QA 5M3FH 1TWCH 1PYWD 1WTXA 3RUZA 4F87A 2ZTCA 2F0JA 5C0XG 3CKIB 1EQTA 2KQ3A 2XIWA 2VY3A 1IXRA 4UP8A 3J7AF 1IKMA 1QE6A 3S24A 4FF3A 1PA6A 1Y1VH 4JV5L 5JEAH 4LFAL 1LTTD 3U50C 2H1EA 3H3VI 2JA6H 2UXBQ 4GKJQ 1KL9A 3K57A 3T1HQ 4XT1B 1IYUA 1EOTA 3TBIB 4Q0FA 4DV3Q 3HOVH 5EJWA 1J5EQ 2JQOA 4A76A 1TWGB 1WTOA 4GKKL 2E2IB 1FGUA 1DGSA 3PO2H 2F0PA 3CQZB 3S1MB 2MQHA 1UUPA 1T5EA 2XN9C 1LT5D 1OXTA 2PPBC 4LF6L 4OHJA 1NTGA 1J8IA 3D6WA 4QCLA 3HKZE 4P74A 4FO2A 3HG9A 1XWEA 2NUCA 3PF5A 2QDBA 4DNTB 1N33L 2FJ2A 4FF2A 3CHBD 5LMUQ 4LJZC 4B9WA 3NEMA 1CKMA 1E3PA 3J81i 1L1OB 1E2WA 1PYSB 5E1FA 1CM9A 4DK1A 1MHWC 3BYYB 1JC7A 1LABA 3I3CA 5C4XG 2UXBL 1UWVA 3ITPA 2Q2TA 1FNUA 3CC2A 5IYDG 5E4WC 1YNJC 4KN7C 1VQFA 1STEA 3V05A 3S1NH 1STHA 3VR3A 5JPNC 1LV9A 4H44C 1CZGA 4AYBG 4A3KB 2H5XA 4AH6A 2VQEL 4POFA 3L7ZC 4LF6Q 2YTVA 1CKOA 1HNXL 1I5FA 1VQDA 2LY7A 4A3BH 1DOKA 2KECA 4DNRB 4HCEA 5F2DA 3OYYA 2Y0SE 1RJTA 2YTYA 1Z7TA 1BCPC 1Y8NB 4IN3A 4A3DG 1GJXA 2GVBA 4TVAB 4QQBX 1VS0A 1YBYA 1F9RA 5IGBA 1KDCA 1Q1BA 3RLNA 1JWSD 3W1BA 3QWNA 1I4XA 2HIXA 1HPCA 3D4DA 2SNSA 3DXJC 5CBEE 1XMQQ 3JC66 3KF6B 4K2LA 3KJOA 4B3RL 2RVLA 1BOSA 1D5ZC 4HR7B 1XTDA 1C4QA 4NKLA 4M1UB 1ENFA 4JBMA 1PXUA 3CU7A 1B9NA 1EFWA 3K80C 3P1HA 2R92H 3OWEB 4MN3A 4LF9L
chains in the Genus database with same CATH topology
3R93A 3BDOA 3QOJA 3VR2A 2PZTA 1D5MC 3C3LA 3RLFA 1EWCA 3OPOA 1STAA 4YIJA 2I07B 1ZXTA 4ZAIA 3EA6A 4IUQA 1S5ED 2OXPA 1QWYA 2MHVA 5I6YA 3NWSA 2F0IA 2MGSA 1CHQD 3NQIA 1Y8PB 2CW0C 3MVVA 3GV6A 3K5MA 1E2VA 2Z1CA 1F9SA 4L6TB 1HRJA 1U4MA 2LFNA 1EU4A 4BS9A 1FNVA 3T51B 4RGNA 2X6GA 3PV0A 3VA7A 3VYUA 1H9SA 3HOYB 3KBXA 2A74C 2A6HD 2PZUA 4EVOA 3O13A 2NWGA 5K36G 4B08A 4KY5A 2WKCA 1GHKA 5CORA 1QNUA 2K05A 1NR2A 1Q8IA 5DNFA 2B2UA 1H9MA 3M3YB 1QB5D 1IL8A 3PIO3 2EY1A 2JE6I 4IUNA 4A3BB 1SYFA 4C3HG 3X3NA 5I6WA 1SE4A 1A6XA 3H3VC 3OSOA 2EJMA 4K8JA 4TSSA 3DMUA 3DHQA 2JXMB 1CA6A 1BF4A 2FFKB 4OL7A 4U68A 3IL8A 2NN6I 1I6HB 1TS5A 3GTOB 2BE5C 3HOXB 2ID0A 5JVH3 4R8NA 4DU9A 5FO7B 4EQPA 2A6ED 5C5LA 1FYCA 1E0BA 2HQEA 4CHTB 2G9DA 2NYZD 3QG1A 4AYBB 2B8FA 1PZID 2IX1A 4KMUC 1NR4A 4K5WA 2EY5A 1Z6HA 1KTKA 3RZDB 2DNCA 4RA8A 3VR4A 5D14A 1GXDC 2D9UA 5G3LD 1TKWB 3NUCA 1MBYA 1PLFA 4KY6A 2K33A 2EE1A 3QOLA 2TMPA 1QCBD 1B44D 1ML0D 3K5NA 3IAYA 3QB3A 3KUPA 1ENCA 3DUZA 2KEDA 1HTPA 1L0XB 2WINB 3NTKA 2MUYA 4OIJA 5FO8B 2EYJA 1TS4A 3HOUB 2WIIB 3C46A 3NP8A 1G2TA 2BE5D 4ME5A 4A3JB 2JA7B 1SYGA 3TZUA 1PTOH 3J80E 2FMMA 2HDMA 2NB0A 5KNCA 1RDPD 1WTVA 1Y8OB 1HXYD 1S5FD 2A68C 2KOLA 2KEEA 4F7XA 2VNUD 3TDQA 3GO5A 1PFMA 1ONLA 3V96A 4HN7A 3GD7A 2AQ1B 3L9AX 2NZ1D 4IZ8A 2F0UA 2D5DA 3C1FA 5T1IA 1EIGA 1W6JA 3NTIA 1V1PB 1JR0D 3PUZA 4ABNA 3SK5A 1I50B 1II3A 2KA7A 1KNAA 2E2JB 2PW7A 2MP1A 4RWSC 1O7ZA 3DWPA 5IIFA 1G2SA 2A5HA 2J7ZA 3J80L 1EZ8A 3LNNA 1F2ZA 4KJNA 4C56C 2PMZB 3OOCA 2M00A 1JOQA 5CV8A 2F4IA 3VA5A 5LL6S 1BNZA 3NK9A 3SE0A 2F03A 5CMDA 1MSHA 3SVMA 4DF7A 1SBBB 1STNA 2ICIA 4CKBA 5J22A 1LT4D 5D3DA 1S4ZA 2I46A 1JB3A 1A3VA 1DOLA 1IYVA 3SR1A 2SEBD 3X3MA 3R2TA 1NCVA 5JEAG 4Z9CB 2QKIC 2IL8A 2AUJD 1GHJA 5CV7A 5JOBA 3K59A 5BN5A 4KD3A 1CHPD 1PZKD 1X32A 1SSOA 2A68D 4IALA 1FGBD 1NSNS 3TP5A 3D8GA 1SYEA 2RDGA 1Q12A 2L55A 1KDBA 4X3TA 4FP5D 1U9RA 1SYBA 3PMFA 1CZWA 2YU9B 2WB1B 5IODA 3S2HB 4DN4M 2SNMA 2BDOA 3I4LA 5ELFA 1A2TA 2L5TA 2ZXRA 2F3VA 3K0YA 1GUGA 3AMUA 3FDTA 3A7AB 4P2CB 1SFOB 1LTGD 2E75C 4KKSA 5C3WA 2YYZA 3RD4A 4IUTA 4O42A 4OO1G 3M7GA 5JPMC 1GUNA 3RZOB 3Q22A 3HOWB 1B53A 3DEOA 2NVXB 1IHZA 2K04A 1D1IA 3A55A 3VR6A 4MHEA 4XIGS 5KNBA 3DEPA 1Q1EA 1SYCA 2K6AA 4KV6A 1WD0A 1MD2D 4QMGA 1Y69U 1D1KA 3H09A 1LTAD 1LTBD 1B50A 1AFPA 5TSSA 4K5XA 3E6ZX 4JK1C 4DXGA 3S15B 1MI2A 2AWOA 3A7LA 1CI3M 1I6VC 1RTNA 2DY8A 4ZK9B 4WJWA 1VF7A 1CK1A 2JA6B 2JA8B 5G3LF 1B9MA 1XYIA 1STGA 1JWUD 1ILPA 2F0EA 4KHZA 1WCMB 3LWUA 2RKSA 2QILA 3G6JB 2BA0A 5K5PA 5M5YB 1RTOA 2WV6D 4K6LA 1ICWA 4IFDH 2F0LA 4K14A 3J7YW 1ET9A 3GTKB 3IFTA 2FINB 1JOKA 4QIWB 4ZKBB 1K8MA 1I3QB 1X3PA 1Y1VB 3OMCA 2CVRA 4FVMA 1EEID 4J1MA 4X3UA 3EJIA 3AB9A 4I65A 1S5CD 2ENBA 4HEDA 2LKVA 4RGTA 4TRDA 1LT6D 1EL0A 4KN4C 3KF8A 2KVMA 4RCOA 1CTMA 5KYLA 3T56B 5EKIA 5A2QE 2FHTA 3NTHA 2EY2A 4XDXA 2L4NA 1KLGD 2B2VA 2R7ZB 1GUTA 3OW7A 4WORA 1OO9B 1HUMA 3FRPB 1ET6A 1EU3A 1SXTA 1MSGA 2LS01 3PO2B 4OO1I 4RHRA 1BCPD 3GTMB 2K7VA 1SNQA 4TQUS 3H0GB 1TIID 4KD4A 3ZYYX 3QO2A 4LMQD 4CJ2C 1TY0A 2IX0A 1V1OA 4ZUJA 1JWMD 1JQYD 4H7BA 3I4MB 3ONAB 3GTQB 1TWFB 4IUVA 1CQVA 3I70A 2PYKA 3BVZA 1G8ZD 3NE5B 1Q90A 5FLXL 3DWQA 3MFYA 1SE3A 2WKDA 3Q23A 5JJZA 3S14B 3HOZB 1EQVA 3MFGA 2EVBA 4HSVA 3SK8A 4K2KA 1SJED 1TWHB 5EBCA 2L12A 4X3SA 4HTHA 1C8CA 4L8JA 2IJ0A 1TR5A 3GQBA 4HAEA 4KKTA 4CKEA 1V43A 1NAPA 2OF1A 1M4VA 2CQAA 1YNNC 1A2UA 4DK0A 2ZXOA 3KBGA 4IQZA 2QF7A 4DAYA 1EIHA 1EY6A 4XQJA 4KKUA 4L63B 2PO4A 2O5IC 4FF4A 1A3TA 5ISRA 4BBSB 2VB2X 1KAAA 2A6EC 1SNDA 4R8IA 2O4XA 1XX8A 2G9HD 2OT2A 4A3FB 4C3IG 3SEBA 4O1NA 2B2TA 1OXUA 2BDNA 2NTTA 1WTWA 2WAQB 4CBVA 5NUCA 2B2VC 3PUXA 4KHVA 1CA5A 2HCIA 4UDUC 4PMWA 2JEBI 5D3IB 3MXNA 3I73A 3K5LA 2PCFB 3T4AC 3BDLA 4FF1A 1CQFA 1QOHA 1PRTC 5M9OA 3EFXD 3MAQA 1ZYRD 5LL6X 2F0NA 4RGOS 3PIP3 4OO1H 2NBFA 3GTJB 4N9TA 4RH6A 1CT1D 2KJXA 2EJFC 1HCZA 1AZPA 3C2PA 4QF4A 4CGYB 2JP1A 4DAPA 5C4ZA 1DD2A 4NDXA 1QILA 2D62A 2LMCB 4C3JG 1PRTF 2B39A 2IWHA 2AWNA 4H13C 1PTOD 1JOOA 4PMBA 3MA2B 1BBXC 2SOBA 1TY2A 4QUFA 4C1NK 4QUCA 3WOEA 1WTPA 2B2UC 5I4DA 1HA6A 4EGVA 1H9KA 3TZDA 3FPUB 5EPKA 2XNAC 4A3GB 1TVXA 3OIQA 1BDOA 1TT2A 2Q8IB 4BWGB 1FNWA 1ILQA 2Q8RE 3PO3B 3S17B 4LK1C 1PFNA 3JAML 2R92B 4A3DB 3GTGB 1BO0A 2A69C 3S1RB 1SNCA 4K8IA 4RKBA 4MN3A 4RHSA 4S3SA 1BQQT 1PTOB 3D6CA 5DEHA 1HQMC 5FLXE 2R93B 4PMCA 4EQNA 1PMRA 2E2DC 3NXWA 3P7JA 2BA1A 2O2LD 2RSOA 5C4HA 4IFDI 3EQLC 3C1EA 5KIXA 3S9WA 1BXTA 1IW7D 2GA4B 1ESFA 2JEAI 2B2YA 1KABA 1FD7D 3J7AV 2K03A 1XTCD 3KLSX 3BYTB 5K36H 1ENAA 4G57A 4FYDA 3TP7A 3RMHA 1QJOA 5M5XB 3CRLC 2VXWA 3FMCA 2NTSA 2N55A 3S16B 4RKLA 2HCCA 3MZ5A 1V8QA 5BN3A 4KK7A 2AQ3B 2F0VA 1LTSD 5FKAC 3FKIB 1DONA 2XRQD 2L0CA 1DJRD 5C44B 1D2BA 3M85A 2BOSA 3DM1A 4HMJA 4ZRZA 1YNJD 4DXFA 4CJ1B 1K8OA 2A73B 4MIUA 5M5WB 1R4PB 2F0MA 2F0GA 5T1GA 5COYA 5KEEA 1AEXA 3MWYW 2CW0D 4RFBA 2KUMA 3MXUA 1C48A 2EDGA 1EYCA 1WTQA 1DOMA 2E74C 3OWFA 5EPLA 2CHBD 3N52A 2NN6G 3BS1A 4IFDG 2J0TD 3TP8A 3S1QB 2KHSA 2XWJB 1KLUD 1RCVD 3NBHA 4I7ZC 1BCPB 2B2TC 2EXZA 4KJOA 2MPMA 3BVMA 2A69D 1LACA 2ICEC 2RA4A 4V0BA 4DGZA 2QEJC 1ESRA 4FXGC 5C4JB 4A3MB 2EYMA 3FEWX 2RBMA 1PDQA 4DFAA 1QNKA 5C0XJ 1DCZA 1UNSA 5KNDA 3DWAA 1EZ6A 3K5OA 2DNEA 1TWAB 2Z4IA 1O80A 1AP0A 2EYOA 3NSWA 4ID6A 5EPJA 1D5XC 3BG3A 1DXMA 5D65A 4IUUA 3VYSA 3M4YA 4A3IB 1EYDA 4IURA 1EY9A 1SMYC 3I4NB 2PW5A 2IX3A 3P20A 5M3FB 2EYHA 2XWBB 3IFDA 1I4GA 3ND9A 5C4XB 3QJYA 2JSOA 3Q6SA 3W3AA 1KNEA 1ZYRC 1OXSC 1H9RA 3MC0B 4KY7A 1PFBA 1UEAB 5A35A 4XTCS 3VYTA 1Z47A 4V190 3MHBA 3K58A 1U4PA 5C5MA 2B2WA 4DAVA 3F2UA 5KRUA 1H9JA 2F3WA 4B9XA 2JYOA 1G291 4RCNA 3CRKC 2F0QA 5IGGA 4XYOA 2HUGA 5AFWA 2K32A 4C3JB 5FK9C 5IGCA 4JBWA 2B8GA 3SXHA 4NP5A 3I72A 2EYPA 2TSSA 3S1NB 3BDCA 2PNRC 3A56A 1EYAA 1RD9D 5BN4A 2EJGC 3D3RA 1HHVA 4G4KA 3TP6A 1VCIA 3MXPA 2AQ2B 1RF2D 4CKCA 3PUYA 3UI2A 3EROA 5IGEA 1SAPA 4WFN3 2X69A 3OMGA 2F1MA 2M2LA 3W2DA 4G7HC 2V4DA 4C3IB 3KLSA 5DM73 4XQQA 3OIPA 1GUWA 4PNYA 4K5VA 3I90A 4N9PA 1EY4A 1I4PA 3GTLB 2WP8J 2K5WA 3HKZB 4OIKA 4F8MA 2KCNA 1RHPA 2AUKA 5IOCA 1TU2B 1JICA 2XRSD 1SEBD 2B2YC 5C6AA 2NN6H 2B63B 4QB4A 2EYLA 2K01A 3K7AB 2NVTB 1U4LA 2ZT9C 1RKNA 1F2MA 3H94A 1F9QA 3HP3A 3NPPA 2NVYB 4RGMA 5CV5A 4H0LC 1TWCB 3V2TA 5C0XH 4XXEA 3BZDB 4K6DA 2K5QA 1PRTB 1DYQA 2BCOA 2XSCA 1EEFD 4X3KA 3KK7A 5EBDA 2RQXA 5DAUA 2X6LA 5LHY1 2IW3A 4R9WA 1S5BD 4ILWA 4BY1B 3I8ZA 3NHHA 2MJ8A 3LX0A 1BUVT 2EOTA 3SHLA 1LTID 3NQTA 2XVSA 1T5XD 4IUPA 3E5SA 4XQNA 1TQOA 1SJHD 3GTPB 3E0JA 1DM0B 1O7YA 4EQOA 4BY7B 5I2YA 1W6KA 3HRZC 3MTSA 1VMPA 4BBRB 4F88A 5EQ0A 2F0TA 2C5CA 1U4RA 1J9OA 2QCPX 3A8JE 1AW7A 3WOFA 4G7OC 1PTOF 2EY6A 5C0XI 2Z4HA 5JAVA 3P75A 2E76C 1O7LA 3KLRA 3M7NA 1GUOA 3TMEA 4XT3B 3Q24A 1LLRD 3VR5A 1EY8A 3K6OA 3Q0AA 1EY5A 2M9VA 1PTOC 3S2DB 2EPBA 4A3EB 2F0KA 3MXGA 4UAIA 5IGDA 4XYQA 3GV3A 1D6EC 4DA2A 2F0OA 3U9OA 4HMIA 1M8AA 1A15A 1STYA 3PUVA 5KGUA 2RSNA 3HS0C 4ZLTF 4TKOB 5FO9B 3N6RA 3BVGA 1CFMA 1IW7C 3D4WA 3SDZA 3HGBA 3SK4A 3NWTA 4FNFA 1BR9A 1VDZA 5C3XA 5CR3A 1JE4A 4CJ0B 2FMCA 3QIAA 5CV6A 2H4OA 5E4XA 3OHXC 1LT3D 4KI0A 3HOVB 1A3UA 1TS2A 1V1PA 4HSPA 1VF5C 1XXGA 2NVQB 3M4OB 2B2WC 2EZVA 2E2HB 2DY7A 1F9PA 3TSSA 4NMZA 2JA5B 2KCCA 4PQXA 2EYFA 4J6HA 1MGSA 4NW2A 2R6GA 3A8KE 5J39A 1HUNA 3T16A 5IT9L 1JORA 3AU7A 1HFNA 4ODGA 5ELBA 5EKKA 1E2ZA 1WD1A 1PZJD 4IFDJ 1BCPF 3H91A 2WACA 2D2CC 1AN8A 3URYA 3NBIA 5I9OA 4C2MB 5CC4A 3FVQA 3G7LA 1B2TA 5IGFA 1EY7A 3H6MA 1R4QB 4U673 5CGKA 1SDFA 2F0WA 5C3EB 1F2LA 2A6HC 1TS3A 1S5DD 2RDFA 4M8AA 2L9HA 5HURA 1B1ZA 2VB3X 5HGTA 1PRTD 1OXVA 4ZUIA 1SMYD 2L1BA 5JVG3 1O78A 5ELCA 1SNPA 2R3ZA 1I4RA 1QG7A 2F0FA 1IKLA 1AZQA 1STBA 1NUCA 1SYDA 4OGQC 1K83B 1LO5D 5ELDA 4LAAA 3D31A 1KDAA 3ND8A 3J81L 3ERQA 1FR3A 5FOBB 3R8BA 2J4XA 4G7ZC 2K1BA 5EGTA 2HDLA 3JAME 2PQEA 4HCSA 2Q8TA 5JEAJ 2N88A 3R2IA 1OXXK 1G6ZA 2IPKD 3U9SA 4BA1I 1F77A 2K28A 4BA2I 5DM63 4ZQ3A 1EFID 5I9PA 1B3AA 2Z8LA 5CV4A 1HA5A 2ZXPA 3WDNA 1GOZA 3LWEA 4C1NI 5A2QL 1Q3LA 1F2YA 3L3OC 1HFGA 1YNND 4E6IA 2DN8A 2OEOA 4GZYC 2Y0SB 2VUMB 4ZKCB 1WTRA 1H9SB 4A93B 3HEJA 5J1ZA 1I4QA 1ZEQX 3A8IE 2F0DA 1LTRD 3TN2A 5ELEA 3J81E 3MEHA 4Q5VA 1HTLD 3VYRA 5CYUA 5KYIA 1Y1WB 2PZWA 3T13A 1I4HA 2O5JC 1SNOA 4Y7NB 4ULLA 5EKLA 4KTAA 2L11A 4C3HB 5M3MB 1SE2A 3PUWA 1VMCA 1R9TB 1B4OA 3D4RA 2F0HA 1DZ1A 4ZYSA 4FXDA 5IT9E 1SNMA 4RAUC 1ZKOA 2IT1A 5CV9A 3T53B 3HZXA 4FXKC 3R3OA 3GP7A 1UAPA 1GUSA 1X3QA 5I2XA 2R61A 2RDHA 1EY0A 2F0SA 2SDFA 2C9OA 5E3FA 3IKJA 1L0YB 3A54A 3I91A 4WRDA 1HQRD 1RODA 3EVQA 3FPPA 1JCKB 1WVLA 4PV1C 2K5DA 3SK6A 1EWHA 4J8QA 1WTXA 1PYWD 3RUZA 4F87A 2F0JA 5C0XG 3CKIB 1EQTA 2KQ3A 2XIWA 1IKMA 3J7AF 1QE6A 4FF3A 5JEAH 1LTTD 2H1EA 3K57A 4XT1B 1IYUA 1EOTA 3TBIB 4Q0FA 5EJWA 1TWGB 1WTOA 2E2IB 2F0PA 3CQZB 3S1MB 2PPBC 1UUPA 1T5EA 2XN9C 1LT5D 1OXTA 1J8IA 4OHJA 3D6WA 4QCLA 4FO2A 3HG9A 1XWEA 2NUCA 2QDBA 4DNTB 2FJ2A 4FF2A 3CHBD 4LJZC 4B9WA 1E2WA 5E1FA 1CM9A 4DK1A 3BYYB 1JC7A 1LABA 3I3CA 3ITPA 1FNUA 5E4WC 1YNJC 4KN7C 1STEA 3V05A 1STHA 3VR3A 5JPNC 1LV9A 4H44C 1CZGA 4A3KB 3L7ZC 2LY7A 1DOKA 2KECA 4DNRB 4HCEA 5F2DA 1RJTA 1Z7TA 1BCPC 1Y8NB 4IN3A 1GJXA 1F9RA 5IGBA 1KDCA 1Q1BA 1JWSD 3QWNA 1I4XA 1HPCA 3D4DA 2SNSA 3DXJC 5CBEE 4K2LA 2RVLA 1BOSA 1D5ZC 4HR7B 1C4QA 4NKLA 4M1UB 1ENFA 1PXUA 3CU7A 1B9NA 3P1HA 3OWEB 5CBAE 1G91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R93 A;  1QNK A;  5EJW A;  3TN2 A;  2N55 A;  1F2L A;  4MHE A;  1PFM A;  4X3K A;  2HCC A;  1EL0 A;  3DEP A;  4ZLT F;  1WTO A;  2X6L A;  1BBX C;  4R9W A;  1WD0 A;  3I8Z A;  3UI2 A;  2KVM A;  4QUF A;  2L9H A;  2NZ1 D;  1O80 A;  4QUC A;  1AP0 A;  1E0B A;  1J8I A;  2MJ8 A;  4HED A;  1SAP A;  5EKI A;  1WTP A;  1X32 A;  2FHT A;  3D6W A;  2NYZ D;  5T1I A;  2X69 A;  1EIG A;  2B2U C;  1SSO A;  2EOT A;  2L1B A;  5EPJ A;  1B50 A;  1HA6 A;  3FPU B;  1ZXT A;  5D65 A;  4IUU A;  3TZD A;  2R3Z A;  1JE4 A;  2M2L A;  4ZAI A;  4CJ0 B;  1DON A;  1QG7 A;  4IUP A;  4IUR A;  4IUQ A;  5EPK A;  2FJ2 A;  4XDX A;  2L4N A;  1EIH A;  1TVX A;  2L11 A;  1IKL A;  2B2V A;  1NR4 A;  2MGS A;  1AZQ A;  1O7Y A;  1MI2 A;  1KNA A;  3DM1 A;  5E4X A;  4RA8 A;  4X3T A;  4CJ1 B;  1HUM A;  1CM9 A;  1ILQ A;  2MP1 A;  2Q8R E;  3IFD A;  4RWS C;  3MTS A;  1O7Z A;  1MSG A;  1VMP A;  1RTN A;  3GV6 A;  1PFN A;  3I3C A;  5EQ0 A;  5D14 A;  1GUW A;  2DY8 A;  5T1G A;  1G2S A;  4ZK9 B;  1BO0 A;  3I90 A;  5COY A;  2D9U A;  1VMC A;  2J7Z A;  5E4W C;  4R8I A;  2B2W C;  1B4O A;  1U4R A;  1XX8 A;  1J9O A;  3MWY W;  1F9S A;  1HRJ A;  1PLF A;  4OIK A;  1U4M A;  2KUM A;  1DZ1 A;  4MN3 A;  5CBA E;  3Q6S A;  4DN4 M;  2DY7 A;  4RAU C;  1F9P A;  1LV9 A;  1KNE A;  2EE1 A;  1WTQ A;  1XYI A;  1DOM A;  2B2T A;  1ILP A;  1RHP A;  2K1B A;  2HDL A;  2BDN A;  2X6G A;  3QO2 A;  1PFB A;  4LMQ D;  4CJ2 C;  1ML0 D;  1WTW A;  3KUP A;  4HCS A;  2Q8T A;  1JIC A;  2B2V C;  1MGS A;  4NW2 A;  5EPL A;  2KED A;  1BNZ A;  1X3Q A;  2B2Y C;  1CA5 A;  3N52 A;  1HUN A;  1RTO A;  1U4P A;  2N88 A;  2HCI A;  2B2W A;  3F2U A;  1ICW A;  4OIJ A;  3KBX A;  1G6Z A;  3ONA B;  1DOK A;  2K01 A;  2KEC A;  2SDF A;  3FDT A;  5CMD A;  2JYO A;  2NWG A;  4XT3 B;  1HFN A;  4IUV A;  3P7J A;  1MSH A;  2K28 A;  3SVM A;  5COR A;  1RJT A;  2FIN B;  3I91 A;  2K05 A;  2RSO A;  1U4L A;  2HUG A;  5AFW A;  1NR2 A;  1G2T A;  1ROD A;  1B3A A;  1WD1 A;  2VXW A;  5DNF A;  2B2U A;  4ZKB B;  1WVL A;  3LWE A;  1F9R A;  1S4Z A;  4IUT A;  2EPB A;  4O42 A;  1IL8 A;  2B2Y A;  5JJZ A;  1F9Q A;  3HP3 A;  1Q3L A;  1X3P A;  4UAI A;  2FMM A;  2HDM A;  3H91 A;  2B2T C;  1HFG A;  4HSV A;  1WTX A;  3GV3 A;  5CBE E;  2MPM A;  1DOL A;  2K03 A;  2CVR A;  1AZP A;  2RA4 A;  1M8A A;  2RVL A;  1EQT A;  1A15 A;  2JP1 A;  2XIW A;  3G7L A;  1B53 A;  1WTV A;  1IKM A;  1ESR A;  2L12 A;  1B2T A;  1QE6 A;  4X3S A;  3DEO A;  1CA6 A;  1C8C A;  1NCV A;  4X3U A;  4ZKC B;  1WTR A;  2H1E A;  1BF4 A;  2FFK B;  4HAE A;  1HHV A;  4U68 A;  1SDF A;  3IL8 A;  2KOL A;  4XT1 B;  1EOT A;  2KEE A;  2RSN A;  2K04 A;  1NAP A;  2IL8 A;  1G91 A;  1PDQ A; 
#chains in the Genus database with same CATH topology
 3R93 A;  4YCU A;  3I4M H;  1HNX Q;  4A3L H;  3BDO A;  3QOJ A;  1EUJ A;  4BXX G;  3VR2 A;  2PZT A;  3I4O A;  4YCW A;  1D5M C;  3C3L A;  2R92 G;  3RLF A;  1EWC A;  4LF7 Q;  4N8F A;  3OPO A;  1STA A;  4YIJ A;  2I07 B;  1ZXT A;  4ZAI A;  4NXN Q;  1K0R A;  3EA6 A;  4IUQ A;  1S5E D;  2OXP A;  1QWY A;  3RN5 A;  2MHV A;  5I6Y A;  3NWS A;  2F0I A;  2MGS A;  1CHQ D;  1FVI A;  3NQI A;  3AEV A;  1Y8P B;  4YY3 L;  4JOI A;  2CW0 C;  3MVV A;  4OEM B;  3GV6 A;  4PG3 A;  3K5M A;  1E2V A;  4HIM A;  2Z1C A;  1F9S A;  4L6T B;  1HRJ A;  4LF9 Q;  1U4M A;  2LFN A;  4A3I G;  1EU4 A;  2JA8 H;  4BS9 A;  4P73 A;  1FNV A;  2RHS B;  1GD7 A;  3T51 B;  1IBK L;  4RGN A;  2X6G A;  4DV4 L;  3CCE A;  5M5W H;  3CCQ A;  3PV0 A;  3VA7 A;  3VYU A;  1X55 A;  1H9S A;  2JA8 G;  3HOY B;  5C3E H;  3KBX A;  1IBL Q;  2A74 C;  2A6H D;  2PZU A;  4EVO A;  3S2H H;  3O13 A;  2NWG A;  5K36 G;  4B08 A;  4KY5 A;  2WKC A;  1GHK A;  1Q46 A;  5COR A;  1QNU A;  2K05 A;  1NR2 A;  1Q8I A;  5DNF A;  2B2U A;  3CME A;  1H9M A;  3I4N H;  1CUK A;  1QB5 D;  3M3Y B;  1PVO A;  1IL8 A;  3PIO 3;  2EY1 A;  2JE6 I;  4IUN A;  4DR7 Q;  4A3B B;  1SYF A;  4C3H G;  3X3N A;  2CQO A;  5I6W A;  2MFI A;  1SE4 A;  4NPS A;  1A6X A;  3H3V C;  3T1H L;  3OSO A;  4CDE C;  3CPW A;  2EJM A;  4K8J A;  4TSS A;  3DMU A;  3DHQ A;  2JXM B;  1CA6 A;  4UY8 C;  3STB D;  1BF4 A;  2FFK B;  4OL7 A;  1N36 L;  4U68 A;  3IL8 A;  2NN6 I;  1I6H B;  1TS5 A;  3E9H A;  3JAM i;  1YI2 A;  1PH5 A;  3GTO B;  1B3Q A;  4BY1 H;  2UUB Q;  1UE7 A;  2K5V A;  4A3L G;  2BE5 C;  4X64 Q;  3HOX B;  2ID0 A;  5JVH 3;  2Q2H A;  1IBL L;  4R8N A;  4DU9 A;  5FO7 B;  4EQP A;  2A6E D;  1VQ6 A;  2NZH A;  5C5L A;  1FYC A;  1E0B A;  2HQE A;  1EIY B;  4CHT B;  1RL2 A;  2YV5 A;  2G9D A;  2NYZ D;  2KBN A;  4CDD C;  3QG1 A;  4QY7 A;  4AYB B;  2B8F A;  3KYH C;  1PZI D;  2Q2U A;  2IX1 A;  4KMU C;  1VQB A;  2IHF A;  1GO3 E;  1NR4 A;  4K5W A;  1M90 C;  4DV7 L;  2EY5 A;  1Z6H A;  1KTK A;  1YZ6 A;  3RZD B;  2DNC A;  4RA8 A;  3KDF A;  4OEL B;  4RG1 A;  3VR4 A;  3GTK H;  2ZTE A;  5D14 A;  1GXD C;  4PZ6 A;  2D9U A;  2ZJR A;  5G3L D;  1TKW B;  3NUC A;  1MBY A;  4FDB A;  1PLF A;  4KY6 A;  2K33 A;  4POG A;  2EE1 A;  3QOL A;  2TMP A;  2VQE Q;  1TWH H;  1QCB D;  3I7F A;  4GN3 B;  1XNR Q;  1B44 D;  4QL5 A;  1TXY A;  1ML0 D;  3K5N A;  3IAY A;  1K3B C;  1B7Y B;  3QB3 A;  3KUP A;  4A93 G;  1ENC A;  4OXP A;  3DUZ A;  2VUM G;  2KED A;  3TEH B;  1QZG A;  1HTP A;  1L0X B;  2WIN B;  5FLM H;  3NTK A;  1KC8 C;  2MUY A;  3M4O H;  2MO0 A;  4OIJ A;  5FO8 B;  2EYJ A;  5GAG C;  1UEB A;  3PCO B;  1TS4 A;  3HKZ G;  3HOU B;  2R93 H;  2WII B;  3H15 A;  1WFQ A;  3NP8 A;  3C46 A;  4HJA A;  1G2T A;  2RHQ B;  2HHH Q;  5IYC H;  1SR3 A;  2BE5 D;  4ME5 A;  4A3J B;  4JI0 L;  1E1T A;  2JA7 B;  1SYG A;  3TZU A;  1PTO H;  4LUV A;  3J80 E;  2FMM A;  2HDM A;  2NB0 A;  3RN2 A;  3CCL A;  2OWO A;  5KNC A;  2B29 A;  1RDP D;  1WTV A;  1Y8O B;  4A3F G;  1HXY D;  4X62 Q;  3F2C A;  1S5F D;  3G71 A;  1VQE A;  2A68 C;  2JA7 H;  2KOL A;  2KEE A;  5IP7 G;  3ULL A;  4F7X A;  2VNU D;  3TDQ A;  2RCF A;  3GO5 A;  4OWX B;  1PFM A;  1AE2 A;  1ONL A;  5DLQ E;  4DR3 L;  4GOP A;  3BU2 A;  3V96 A;  4HN7 A;  3GD7 A;  2AQ1 B;  5IYC G;  3L9A X;  2NZ1 D;  4IZ8 A;  2F0U A;  2D5D A;  4JI5 L;  3C1F A;  1A63 A;  5T1I A;  1EIG A;  4LFC Q;  1W6J A;  3NTI A;  1V1P B;  4JI0 Q;  4IPG A;  1JR0 D;  3PUZ A;  4ABN A;  3SK5 A;  4R1J A;  4L5S A;  1I50 B;  1II3 A;  2KA7 A;  1PH4 A;  3KJP A;  1KNA A;  2AKW B;  2E2J B;  2PW7 A;  2MP1 A;  3J80 i;  2CWA A;  4RWS C;  1O7Z A;  3DWP A;  4B3T L;  5IIF A;  1G2S A;  3FHW A;  3KLW A;  2A5H A;  2J7Z A;  3J80 L;  1IBK Q;  1EZ8 A;  3LNN A;  1F2Z A;  4KJN A;  4C56 C;  2PMZ B;  3OOC A;  5EAY A;  5IWA L;  1N32 Q;  3RR5 A;  2M00 A;  1JOQ A;  4DV6 L;  5CV8 A;  1FJG L;  2F4I A;  3K7U C;  5LL6 S;  3VA5 A;  4BY7 G;  1BNZ A;  5FLM G;  3NK9 A;  1N8R C;  4K0K L;  3S1R H;  1MJC A;  3SE0 A;  4LUZ A;  1A62 A;  2ZJP A;  2F03 A;  2OTJ A;  4JBK A;  5CMD A;  1MSH A;  3SVM A;  4DF7 A;  5LMN W;  4BY7 H;  1SBB B;  1K73 C;  1STN A;  2ICI A;  4CKB A;  4B3M Q;  4C3J H;  5J22 A;  1LT4 D;  5D3D A;  1S4Z A;  4DR7 L;  2I46 A;  1JB3 A;  1A3V A;  1DOL A;  1D7Q A;  1IYV A;  3SR1 A;  2SEB D;  5GRO A;  1N36 Q;  3X3M A;  3NBH B;  3R2T A;  3OTO Q;  2K5H A;  1P8L A;  4QGU A;  1NCV A;  5JEA G;  4Z9C B;  1SRO A;  1TWG H;  2QKI C;  4DR5 Q;  1PHJ A;  3K0X A;  2IL8 A;  4GKJ L;  2AUJ D;  1GHJ A;  5CV7 A;  5JOB A;  1N34 Q;  3K59 A;  5BN5 A;  4DPG A;  3S1Q H;  4KD3 A;  2WAQ E;  4X6A H;  3S15 H;  1Y1W G;  4QJF A;  1CHP D;  2WAQ G;  1PZK D;  4A3J H;  1X32 A;  5ELN A;  1U5K A;  1SSO A;  2A68 D;  4IAL A;  1FGB D;  1NSN S;  3TP5 A;  5C4J H;  3D8G A;  1SYE A;  2RDG A;  2OQ0 A;  1Q12 A;  2B3G A;  3DM3 A;  2L55 A;  1KDB A;  4X3T A;  4FP5 D;  2NVT H;  4X66 L;  4JI2 Q;  1SYB A;  1U9R A;  3M3Y H;  4A3K G;  5IT9 c;  3PMF A;  1CZW A;  2YU9 B;  2B63 H;  2WB1 B;  5H1S E;  4UP9 A;  5IOD A;  3PSI A;  1AE3 A;  1XNR L;  4DN4 M;  3S2H B;  4JI4 Q;  2SNM A;  2BDO A;  3I4L A;  2Z6B A;  5ELF A;  1G51 A;  1A2T A;  1A8V A;  2L5T A;  2ZXR A;  2F3V A;  4KHP Q;  3K0Y A;  1GUG A;  3UE1 A;  3AMU A;  4MTK A;  4DKA C;  1SN8 A;  3FDT A;  3A7A B;  1YJW A;  4P2C B;  2UUC Q;  1SFO B;  1LTG D;  2E75 C;  4KKS A;  4PZ8 A;  5C3W A;  2VQF Q;  4WJ4 A;  2YYZ A;  3F2D A;  3RD4 A;  4IUT A;  4O42 A;  4OO1 G;  3M7G A;  1YIT A;  5JPM C;  1GUN A;  5IP9 H;  4L5T A;  2DJF C;  3CCV A;  3RZO B;  4YHH Q;  3Q22 A;  3HOW B;  1B53 A;  3DEO A;  4O2D A;  1WYD A;  2NVX B;  3RZD H;  1XJV A;  1IHZ A;  2K04 A;  1D1I A;  3A55 A;  3HOV G;  4GNX B;  4JBJ A;  4BY1 G;  1SFO H;  2CKZ B;  3VR6 A;  3UDG A;  4MHE A;  4XIG S;  4A75 A;  5KNB A;  3HOY G;  1E22 A;  3DEP A;  4YWL A;  1Q1E A;  1SYC A;  2K6A A;  4KV6 A;  1WD0 A;  4DV5 Q;  1MD2 D;  4QMG A;  2A8V A;  4LFC L;  4A3J G;  1Y69 U;  1D1K A;  1UE1 A;  3H09 A;  2VQF L;  1LTA D;  1LTB D;  1B50 A;  1T9H A;  1AFP A;  5TSS A;  4K5X A;  1IL2 A;  3E6Z X;  4JK1 C;  4DXG A;  3S15 B;  1MI2 A;  3JAM c;  2AWO A;  3A7L A;  2PI2 E;  1CI3 M;  2UUA L;  2DJG C;  1I6V C;  5GAD C;  3S2D H;  1RTN A;  3PIP A;  2WB1 E;  2DY8 A;  1YNX A;  4ZK9 B;  4WJW A;  1VF7 A;  4LUO A;  5C44 G;  1CK1 A;  2JA6 B;  2KCM A;  2JA8 B;  2I0Q A;  4DV6 Q;  5G3L F;  1B9M A;  1FJG Q;  1XYI A;  1G91 A;  1STG A;  1JWU D;  1ILP A;  1NMG A;  5BR8 Q;  1YIJ A;  2F0E A;  4KHZ A;  1WCM B;  3LWU A;  2OCE A;  2RKS A;  2QIL A;  3G6J B;  4IPH A;  2BA0 A;  4DV3 L;  5K5P A;  5M5Y B;  1RTO A;  2WV6 D;  4K6L A;  4DV4 Q;  1ICW A;  4IFD H;  2D0P A;  2F0L A;  4K14 A;  2Z9H A;  3J7Y W;  1ET9 A;  3GTK B;  3IFT A;  3HOZ G;  4A3E H;  2FIN B;  1JOK A;  4QIW B;  1JMC A;  3AYH B;  1ICF B;  1WCM H;  4ZKB B;  4GLA C;  1K8M A;  1I3Q B;  4P71 A;  1X3P A;  1Y1V B;  4LNQ A;  1UE5 A;  4H02 A;  5L37 A;  1JT8 A;  3KOJ A;  4IPD A;  3OMC A;  1JE5 A;  2CVR A;  3A0J A;  4FVM A;  1EEI D;  4J1M A;  3LGJ A;  1IYJ B;  1NJI C;  1WI5 A;  4X3U A;  1HZA A;  3EJI A;  1PH1 A;  3AB9 A;  4I65 A;  2Y0S G;  1S5C D;  3CQZ H;  2ENB A;  4HED A;  2LKV A;  4RGT A;  4TRD A;  3HOY H;  4DR6 L;  1LT6 D;  3U4Z A;  1EL0 A;  4KN4 C;  1XNQ L;  3KF8 A;  2UUB L;  3K81 C;  2KVM A;  4RCO A;  1CTM A;  1EOV A;  5KYL A;  3T56 B;  5EKI A;  3U58 A;  3F8T A;  4O0A A;  2FHT A;  5A2Q E;  3NTH A;  3OW2 A;  2EY2 A;  4OWW B;  1QVC A;  1ASY A;  3G4S A;  2DGY A;  2L4N A;  4XDX A;  1XMO L;  3I4M G;  1KLG D;  2QA4 A;  1I3Q H;  2B2V A;  3M4P A;  2R7Z B;  2ZM6 Q;  1GUT A;  3OW7 A;  4WOR A;  1YHA A;  1OO9 B;  1HUM A;  4P72 A;  1OTC A;  3FRP B;  1ET6 A;  1EU3 A;  1SXT A;  1MSG A;  4DV7 Q;  5JJI A;  1Q81 C;  1VQP A;  2LS0 1;  1I94 Q;  4BBS H;  3PO2 B;  4OO1 I;  3CCS A;  1CKN A;  4RHR A;  4JI4 L;  1BCP D;  1EQQ A;  1X3F A;  2K7V A;  3CCU A;  3A5Z B;  3GTM B;  1SNQ A;  4TQU S;  4C3H H;  3H0G B;  1TII D;  2IHE A;  4KD4 A;  4GN5 A;  3ZYY X;  3QO2 A;  4LMQ D;  4CJ2 C;  4LF8 L;  4IPC A;  1TY0 A;  4KHP L;  2IX0 A;  1MKH A;  1YHB A;  1V1O A;  4ZUJ A;  1JWM D;  1SLJ A;  1JQY D;  1K8G A;  4H7B A;  3ICE A;  3E0E A;  3I4M B;  3ONA B;  3GTQ B;  1TWF B;  2QDL A;  3CPF A;  4IUV A;  2HT1 A;  1CQV A;  3I70 A;  2PYK A;  2FXQ A;  1V1Q A;  1Y1V G;  1G8Z D;  3BVZ A;  3NE5 B;  1R9T H;  1Q90 A;  5FLX L;  4LF7 L;  3DWQ A;  3MFY A;  1SE3 A;  2WKD A;  3J80 c;  3Q23 A;  1G6P A;  5JJZ A;  3S14 B;  3HOZ B;  1C7Y A;  1EQV A;  3MFG A;  2EVB A;  4HSV A;  3ERS X;  3SK8 A;  4K2K A;  2DUD A;  1SJE D;  1TWH B;  2N3S A;  4YY3 Q;  5EBC A;  2L12 A;  4X3S A;  4HTH A;  1C8C A;  4L8J A;  2IJ0 A;  1TR5 A;  3GQB A;  4HAE A;  4LF8 Q;  4KKT A;  4CKE A;  1V43 A;  1GM5 A;  2NZO A;  2L15 A;  1NAP A;  4GLX A;  2OF1 A;  1VQ8 A;  1M4V A;  2CQA A;  4JYA Q;  4DV2 L;  1K83 H;  1YNN C;  1BKB A;  5IYB G;  2R7Z H;  3T1Y L;  1VQL A;  2JA6 G;  1A2U A;  3H3V H;  1HR0 W;  4DK0 A;  5IP7 H;  2ZXO A;  2V1C C;  1MJE A;  1MIU A;  4A93 H;  4J15 A;  3KBG A;  4JVZ A;  3CMA A;  4IQZ A;  3A5U A;  2QF7 A;  4DAY A;  1EIH A;  1EY6 A;  2E5L Q;  3W1G A;  4XQJ A;  5FLX c;  4KKU A;  4L63 B;  2PO4 A;  2O5I C;  4FF4 A;  4LWC A;  3S17 H;  1QUQ B;  1A3T A;  1LYL A;  5ISR A;  4BBS B;  1CKN B;  2VB2 X;  3HOU G;  1KAA A;  2A6E C;  1SND A;  4R8I A;  2O4X A;  1XX8 A;  2G9H D;  2OT2 A;  4A3F B;  4C3I G;  4B3T Q;  4A3M H;  4DV2 Q;  3SEB A;  3GTL H;  4O1N A;  4GS3 A;  2B2T A;  1JJG A;  4A3K H;  4A4I A;  1OXU A;  2BDN A;  2NTT A;  1WTW A;  3S1M H;  3ULJ A;  2WAQ B;  4CBV A;  5NUC A;  2VUM H;  2B2V C;  3PUX A;  4KHV A;  4A3M G;  1L2F A;  2A19 A;  1CA5 A;  3K7A H;  2E2J H;  2HCI A;  4UDU C;  4PMW A;  4X64 L;  2JEB I;  1EQR A;  5D3I B;  3MXN A;  3I73 A;  3F1Z A;  4K0K Q;  3K5L A;  2PCF B;  3T4A C;  1QVF A;  3BDL A;  4FF1 A;  1CQF A;  1QOH A;  1PRT C;  2KHJ A;  5M9O A;  2A1A A;  1Y1W H;  3EFX D;  5IY0 A;  3MAQ A;  1ZYR D;  5LL6 X;  4JPB W;  2F0N A;  4RGO S;  4B3M L;  3PIP 3;  4OO1 H;  2NBF A;  3GTJ B;  4N9T A;  4RH6 A;  1VQJ A;  1CT1 D;  2KJX A;  2EJF C;  1AH9 A;  3GTQ H;  1HCZ A;  4DNI A;  1AZP A;  1EYG A;  3C2P A;  4QF4 A;  4CGY B;  1E7Z A;  2JP1 A;  1VQ5 A;  4DAP A;  5C4Z A;  1DD2 A;  4NDX A;  1QIL A;  1W3S A;  2D62 A;  3CF5 A;  2LMC B;  4DR6 Q;  3BZK A;  4C3J G;  1PRT F;  2B39 A;  4B3S Q;  3KF6 A;  2IWH A;  3J81 c;  2AWN A;  2BH8 A;  4H13 C;  2RF4 A;  5M3M G;  1PTO D;  1JOO A;  4PMB A;  3MA2 B;  1BBX C;  2SOB A;  1TY2 A;  3CW2 C;  3S14 H;  1K3R A;  4QUF A;  2R7D A;  4C1N K;  3ZJY C;  4QUC A;  2PMZ E;  3WOE A;  2ASB A;  1WTP A;  1HH2 P;  2B2U C;  5I4D A;  1HA6 A;  1S3O A;  4EGV A;  1H9K A;  3FPU B;  3TZD A;  3K8A A;  3EIV A;  5EPK A;  4P75 A;  2XNA C;  4A3G B;  1TVX A;  2QGQ A;  3WWV A;  1LUZ A;  3OIQ A;  1BDO A;  1TT2 A;  3FKI G;  2Q8I B;  4BWG B;  1FNW A;  4HID A;  5LMN Q;  1ILQ A;  2Q8R E;  3PO3 B;  4OWT B;  3PGZ A;  3S17 B;  4LK1 C;  1N9W A;  1PFN A;  3JAM L;  2R92 B;  3CCM A;  1X6O A;  4A3D B;  3GTG B;  1BO0 A;  2JJQ A;  2A69 C;  1LTL A;  3S1R B;  1SNC A;  4CDC C;  4B3S L;  4K8I A;  4RKB A;  4RHS A;  4S3S A;  3GTM H;  1BQQ T;  3D0F A;  1PTO B;  4X62 L;  3D6C A;  5DEH A;  4PZ7 A;  4BBR G;  1HQM C;  4DK3 C;  5FLX E;  4R4I A;  2R93 B;  1VQ4 A;  4DR3 Q;  4PMC A;  4EQN A;  1PMR A;  2E2D C;  2LXJ A;  3NXW A;  2UXC Q;  3P7J A;  2BA1 A;  2O2L D;  4HIO A;  2RSO A;  5C4H A;  4IFD I;  3EQL C;  3C1E A;  5KIX A;  3S9W A;  5LMN L;  1A0I A;  1BXT A;  1IW7 D;  2GA4 B;  4LF5 L;  1ESF A;  2B2Y A;  2Z0S A;  2JEA I;  1KAB A;  1VQO A;  2N49 A;  1FD7 D;  3J7A V;  1VQI A;  1JB7 A;  3STB C;  4R4T A;  3I56 A;  2K03 A;  3HOW H;  1XTC D;  3KLS X;  3BYT B;  5K36 H;  1ENA A;  4G57 A;  1KIX A;  2CFM A;  3J81 j;  4GN4 B;  4FYD A;  3TP7 A;  4A3D H;  3RMH A;  1QJO A;  3CP0 A;  5M5X B;  3CRL C;  2VXW A;  1L1O A;  3FMC A;  3I4N G;  5HY6 A;  2NTS A;  2N55 A;  3S16 B;  1X3G A;  2R7F A;  4RKL A;  2HCC A;  3G48 A;  3MZ5 A;  5IP9 G;  2R7Z G;  1V8Q A;  2PQA B;  5BN3 A;  4EX5 A;  2NVQ H;  4X65 Q;  4KK7 A;  2AQ3 B;  2F0V A;  2GN5 A;  1LTS D;  3J7Z C;  1IZ6 A;  1X56 A;  5FKA C;  3FKI B;  1QVG A;  1DON A;  2XRQ D;  2L0C A;  1DJR D;  5C44 B;  1D2B A;  4KLK A;  3M85 A;  2BOS A;  4L5R C;  3DM1 A;  4HMJ A;  4ZRZ A;  3ULP A;  1YNJ D;  4DXF A;  2WB1 G;  4DAY B;  4CJ1 B;  5M5Y H;  1K8O A;  2A73 B;  4A3E G;  2ZTD A;  4MIU A;  5M5W B;  1R4P B;  3GTG H;  2F0M A;  2F0G A;  5T1G A;  5COY A;  1KRT A;  5KEE A;  1HZB A;  1VQG A;  1AEX A;  3KDF B;  3MWY W;  2CW0 D;  4RFB A;  2KUM A;  3MXU A;  5CBA E;  1C48 A;  2EDG A;  2F4V L;  1EYC A;  1WTQ A;  1DOM A;  2XGT A;  3CC7 A;  2E74 C;  3SGI A;  4DR5 L;  4DR2 L;  3OWF A;  4JI8 Q;  5EPL A;  4DV0 Q;  4LW1 A;  2CHB D;  1N34 L;  3N52 A;  2K75 A;  2NN6 G;  4CDF C;  3BS1 A;  4IFD G;  2N78 A;  2J0T D;  1HNZ Q;  3TP8 A;  3S1Q B;  3CAM A;  2KHS A;  2XWJ B;  4UP7 A;  1HZC A;  1KLU D;  2JA9 A;  1WOC A;  1U0L A;  1RCV D;  3NBH A;  4I7Z C;  4YWK A;  3KFU A;  2EQS A;  1BCP B;  2B2T C;  2EXZ A;  4KJO A;  1H95 A;  1S72 A;  4LF4 Q;  2MPM A;  3BVM A;  1Q86 C;  2JA5 G;  2A69 D;  1LAC A;  2ICE C;  2RA4 A;  3GTP H;  4APV A;  4V0B A;  4DGZ A;  2QEJ C;  3A74 A;  4X66 Q;  1ESR A;  4JI2 L;  4FXG C;  5M5X H;  5C4J B;  1B8A A;  4A3M B;  2EYM A;  3FEW X;  2RBM A;  2F52 A;  4DR2 Q;  5GQO A;  1PDQ A;  4DFA A;  1QNK A;  5C0X J;  3KF8 B;  1DCZ A;  1UNS A;  5KND A;  4DR1 Q;  2CCZ A;  2GVA A;  3DWA A;  1EZ6 A;  3K5O A;  2DNE A;  4GLV B;  1TWA B;  2Z4I A;  2K4K A;  4I7A A;  1O80 A;  1AP0 A;  2EYO A;  2JK8 A;  3NSW A;  4C2M H;  2CH4 A;  4ID6 A;  1UE6 A;  5EPJ A;  1D5X C;  3BG3 A;  1DXM A;  5D65 A;  4IUU A;  3VYS A;  3M4Y A;  3L2P A;  4A3I B;  2ES2 A;  1EYD A;  4IUR A;  3ER0 A;  4JI7 Q;  1EY9 A;  2UUC L;  1SMY C;  4LF4 L;  3I4N B;  2PW5 A;  2IX3 A;  3P20 A;  5M3F B;  4A3F H;  3GTJ H;  2EYH A;  2XWB B;  3IFD A;  3AFP A;  1I4G A;  3ND9 A;  5C4X B;  4DK6 C;  2UXD L;  4YHH L;  1EWI A;  3PIO A;  3RZO H;  3QJY A;  4JI3 L;  1I94 L;  2JSO A;  1VQM A;  3Q6S A;  2I5M X;  3W3A A;  3UE0 A;  1KNE A;  1J5E L;  1ZYR C;  1OXS C;  1H9R A;  3MC0 B;  5AJ3 L;  4KY7 A;  2PI2 A;  1PFB A;  1UEA B;  5A35 A;  4XTC S;  4BBR H;  4DUY Q;  3VYT A;  1XPO A;  4MTN A;  1VQC A;  1Z47 A;  4V19 0;  3MHB A;  3K58 A;  1U4P A;  2UXC L;  5C5M A;  2B2W A;  4DAV A;  3F2U A;  5KRU A;  1H9J A;  4DV5 L;  1RIP A;  2F3W A;  4B9X A;  2G5D A;  2JYO A;  1G29 1;  4RCN A;  3CRK C;  5LMU L;  2F0Q A;  5IGG A;  2KHI A;  4XYO A;  4LF5 Q;  1D8L A;  1J6Q A;  2HUG A;  5AFW A;  1KXL A;  2K32 A;  4C3J B;  5FK9 C;  5IGC A;  4JBW A;  2B8G A;  3SXH A;  4NP5 A;  3I72 A;  2ATW A;  2EYP A;  2TSS A;  3S1N B;  2UXD Q;  1XPR A;  3BDC A;  1CSQ A;  4JI3 Q;  2PNR C;  3A56 A;  1EYA A;  1RD9 D;  5BN4 A;  4UPA A;  2EJG C;  3D3R A;  3HOZ H;  1HHV A;  3EBE A;  4DUY L;  1PH3 A;  4G4K A;  4R4Q A;  1M1K C;  2PQA A;  1VQ7 A;  3TP6 A;  2CWP A;  1VCI A;  3MXP A;  5IYB H;  2AQ2 B;  4JI1 L;  1RF2 D;  4CKC A;  5BR8 L;  1QZH A;  1Z9F A;  3PUY A;  3UI2 A;  3ERO A;  3PO2 G;  2VS1 A;  5IGE A;  4YWM A;  4GOP C;  1SAP A;  4WFN 3;  1YHQ A;  2OQK A;  2X69 A;  3OMG A;  5M3M H;  1LM0 A;  2F1M A;  2M2L A;  3MEF A;  3W2D A;  2IY5 B;  3NEN A;  4G7H C;  2V4D A;  1XMQ L;  4HJ5 A;  4C3I B;  4IOC A;  2LXK A;  2E5L L;  3KLS A;  5DM7 3;  4XQQ A;  2JA7 G;  4ME3 A;  3OIP A;  3HFZ B;  3TS0 A;  4JI6 L;  1GUW A;  4PNY A;  4K5V A;  3I90 A;  4NB3 A;  3DLL A;  4N9P A;  2F4V Q;  1K9M C;  1EY4 A;  1I4P A;  3I2Z A;  3GTL B;  2WP8 J;  2K5W A;  3HKZ B;  4OIK A;  3G6E A;  1TWF H;  4F8M A;  2KCN A;  4BXX H;  1RHP A;  3AQQ A;  4JI8 L;  2AUK A;  2PNH A;  3RLO A;  5IOC A;  1TU2 B;  3L0O A;  2HIV A;  1JIC A;  3CCJ A;  2XRS D;  1SEB D;  3H0G G;  2B2Y C;  5C6A A;  2NN6 H;  2B63 B;  4QB4 A;  1XNQ Q;  2EYL A;  2K01 A;  3K7A B;  2NVT B;  1U4L A;  2ZT9 C;  1RKN A;  1F2M A;  3H94 A;  2I5H A;  4YCV A;  1BBU A;  1F9Q A;  3NPP A;  3HP3 A;  2NVY B;  1XMO Q;  4JI6 Q;  1L1O C;  1PYB A;  3EN2 A;  1CSP A;  4RGM A;  5CV5 A;  3AFQ A;  4H0L C;  2XTI A;  1TWC B;  3V2T A;  2ZM6 L;  5C0X H;  2CH4 W;  4XXE A;  3RNU A;  4ALP A;  3BZD B;  2I5L X;  4K6D A;  1E1O A;  1SRU A;  2E2I H;  3BZC A;  2K5Q A;  1PRT B;  4EQ5 A;  1DYQ A;  4DR1 L;  2BCO A;  2XSC A;  1Q8K A;  1PH2 A;  1EEF D;  5IE8 A;  4X3K A;  1BVS A;  3KK7 A;  4R4O A;  3HOX G;  5EBD A;  1B70 B;  2RQX A;  5DAU A;  2X6L A;  5LHY 1;  2IW3 A;  4R9W A;  1S5B D;  3M9B A;  4ILW A;  4BY1 B;  3I8Z A;  2LSS A;  3NHH A;  1I6H H;  2MJ8 A;  3LX0 A;  1BUV T;  4JG2 A;  3E3X A;  1N33 Q;  2EOT A;  3SHL A;  1LTI D;  3NQT A;  2XVS A;  1NE3 A;  1T5X D;  1NMF A;  3E5S A;  4IUP A;  5E7N A;  4XQN A;  4GOP B;  1TQO A;  1PH8 A;  2QW7 A;  1SJH D;  3GTP B;  5ELO A;  3I55 A;  3E0J A;  5HGQ A;  4A3G G;  1PH9 A;  4GNX C;  1O7Y A;  1DM0 B;  1S40 A;  4NXM L;  1P16 A;  4EQO A;  4BY7 B;  1ASZ A;  5I2Y A;  1W6K A;  3HRZ C;  3MTS A;  1VMP A;  4BBR B;  4F88 A;  5EQ0 A;  4OON A;  1L0W A;  1PV4 A;  1SE8 A;  2F0T A;  2C5C A;  3J7A 5;  1U4R A;  1J9O A;  2QCP X;  3A8J E;  2D0O A;  1AW7 A;  3WOF A;  3GDE A;  4WJ3 M;  4G7O C;  1X65 A;  1PTO F;  3GTO H;  2EY6 A;  5C0X I;  1VQ9 A;  2Z4H A;  5JAV A;  2ZJQ A;  3P75 A;  2E76 C;  1O7L A;  1KRS A;  1VQK A;  3KLR A;  4JYA L;  3M7N A;  4DUZ L;  1GUO A;  2HD3 A;  2VZA A;  2OTL A;  3TME A;  3T1Y Q;  2B63 G;  2E2H H;  3PF4 A;  4XT3 B;  3Q24 A;  1LLR D;  4A3I H;  3VR5 A;  1EY8 A;  3K6O A;  3Q0A A;  1EY5 A;  3QR8 A;  2M9V A;  1PTO C;  3S2D B;  2EPB A;  4A3E B;  2F0K A;  4B3R Q;  1TWA H;  3MXG A;  4UAI A;  5JJL A;  5IGD A;  4L5Q A;  4XYQ A;  3GV3 A;  1D6E C;  2KCT A;  4DA2 A;  1WTH A;  1WJJ A;  4MNO A;  2RCN A;  2F0O A;  3U9O A;  4HMI A;  1M8A A;  1A15 A;  2VW9 A;  4JOI C;  1STY A;  3PUV A;  5KGU A;  3FKI H;  4LFB Q;  2N8N A;  4A3C H;  2JA5 H;  3IRB A;  3UDI A;  3HOU H;  2RSN A;  1HNW L;  3CCR A;  1E24 A;  3HS0 C;  4DUZ Q;  3CC4 A;  4ZLT F;  4TKO B;  5FO9 B;  3N6R A;  3BVG A;  1CFM A;  1IW7 C;  3D4W A;  3SDZ A;  2AHO B;  3HGB A;  4NXN L;  3SK4 A;  3FP9 A;  3NWT A;  3TQY A;  4BBS G;  4FNF A;  1BR9 A;  4X65 L;  2HHH L;  1VDZ A;  2Q2I A;  5C3X A;  5CR3 A;  3H0G H;  1JE4 A;  4CJ0 B;  2FMC A;  3QIA A;  5CV6 A;  3TRZ A;  5FJ8 H;  2H4O A;  4N8X 1;  1HR0 Q;  3TRE A;  5E4X A;  3OHX C;  1LT3 D;  4KI0 A;  3HOV B;  1A3U A;  1TS2 A;  1V1P A;  3U4V A;  4JC0 A;  4HSP A;  1VF5 C;  1XXG A;  2EXD A;  2NVQ B;  1PH6 A;  1HZ9 A;  4AYB E;  3M4O B;  2B2W C;  2EZV A;  1HNW Q;  2E2H B;  3S16 H;  1XPU A;  2DY7 A;  3E9I A;  3HOW G;  1F9P A;  2WFW A;  4IJL A;  3TSS A;  4NMZ A;  2JA5 B;  2KCC A;  4PQX A;  5GAH C;  3CXC A;  2EYF A;  4J6H A;  1MGS A;  4NW2 A;  2R6G A;  1K8A C;  4JI5 Q;  3CD6 A;  3A8K E;  5J39 A;  1HUN A;  1HJP A;  3T16 A;  5IT9 L;  1JOR A;  5C3E G;  1VQA A;  2ALY B;  2HQL A;  3AU7 A;  1HFN A;  1YEZ A;  4ODG A;  5ELB A;  2YU9 H;  1HR0 L;  5EKK A;  1E2Z A;  1WD1 A;  1SMX A;  1PZJ D;  1V9P A;  2K52 A;  1Y14 B;  4IFD J;  1BCP F;  3H91 A;  2WAC A;  4ZCK A;  2D2C C;  5FJ8 G;  1AN8 A;  3URY A;  3NBI A;  1X9N A;  2MO1 A;  5I9O A;  3UDF A;  4C2M B;  5CC4 A;  3FVQ A;  4A3G H;  3G7L A;  4QIW E;  2QEX A;  1B2T A;  1JJC B;  5IGF A;  1EY7 A;  3H6M A;  3NEL A;  1N32 L;  1R4Q B;  4IOA A;  2NVX H;  4U67 3;  1VQN A;  5CGK A;  1SDF A;  2VL6 A;  2AMC B;  4LFA Q;  2P5Z X;  2F0W A;  5C3E B;  1F2L A;  2A6H C;  3W5O A;  1TS3 A;  3F2B A;  1S5D D;  2RDF A;  4M8A A;  2L9H A;  1WCM G;  5HUR A;  1B1Z A;  4Y7N H;  1X54 A;  2VB3 X;  5HGT A;  1PRT D;  1OXV A;  4ZUI A;  1SMY D;  3HKS A;  1PH7 A;  2L1B A;  2Z6K C;  1O78 A;  5JVG 3;  5ELC A;  1SNP A;  2R3Z A;  1I4R A;  1QG7 A;  1C9O A;  5GAE C;  4MZ9 A;  2F0F A;  4NXM Q;  1IKL A;  1BBW A;  1AZQ A;  1STB A;  1NUC A;  4DR4 Q;  1SYD A;  1NNX A;  2EIF A;  4OGQ C;  4HIK A;  4DV1 Q;  2F3I A;  1KD1 C;  1K83 B;  3OTO L;  3PO3 G;  1LO5 D;  1K28 A;  2YTX A;  5ELD A;  4LAA A;  3D31 A;  5IYD H;  1KDA A;  2UU9 Q;  3ND8 A;  3J81 L;  3ERQ A;  1FR3 A;  3R8B A;  5FOB B;  2J4X A;  4HJ7 A;  4G7Z C;  2K1B A;  2K14 A;  5EGT A;  3UDX A;  2HDL A;  1GKH A;  3JAM E;  2PQE A;  4HCS A;  2Q8T A;  5AJ3 Q;  3VDY A;  5JEA J;  2N88 A;  1PFS A;  3R2I A;  1OXX K;  1G6Z A;  4R4C A;  2IPK D;  3U9S A;  4HJ9 A;  4BA1 I;  2NVY H;  4HJ8 A;  1F77 A;  2K28 A;  4BA2 I;  5JJK A;  5DM6 3;  4DR4 L;  4ZQ3 A;  1EFI D;  5I9P A;  3BJU A;  1B3A A;  4AIM A;  2Z8L A;  3MXN B;  5CV4 A;  1HA5 A;  4RMF A;  2ZXP A;  4DV1 L;  3WDN A;  1GOZ A;  3LWE A;  5J3B A;  4C1N I;  5A2Q L;  5C44 H;  1Q3L A;  1F2Y A;  2BH2 A;  3L3O C;  1HFG A;  5M3F G;  1YNN D;  1I50 H;  4E6I A;  3TS2 A;  4LFB L;  2UU9 L;  2DN8 A;  2OEO A;  2MNA A;  4GZY C;  2Y0S B;  4IO9 A;  1W2B A;  2VUM B;  4ZKC B;  1WTR A;  1H9S B;  4A93 B;  3HEJ A;  1K0S A;  5J1Z A;  1I4Q A;  1ZEQ X;  3A8I E;  2F0D A;  4OX9 Q;  1LTR D;  3TN2 A;  1NBW A;  5ELE A;  3PQI A;  1QUQ A;  3J81 E;  3MEH A;  4GNX A;  4Q5V A;  1KAW A;  4AQY L;  2K50 A;  4JI1 Q;  1HTL D;  2KEN A;  3VYR A;  4DV0 L;  4UHV A;  1IBM L;  5CYU A;  5KYI A;  1Y1W B;  2PZW A;  3T13 A;  1I4H A;  4DAM A;  4C3I H;  1YJN A;  1KHI A;  2O5J C;  1SNO A;  1C0A A;  1HNZ L;  4IJH A;  4Y7N B;  1O7I A;  1X3E A;  4ULL A;  1Q7Y C;  5EKL A;  4KTA A;  2L11 A;  4C3H B;  2C35 B;  5M3M B;  2E8G A;  3M4Q A;  3PO3 H;  1SE2 A;  3PUW A;  1YVC A;  1JJ2 A;  1VMC A;  1R9T B;  1B4O A;  5IWA Q;  2K5N A;  3D4R A;  1KQS A;  2F0H A;  4OX9 L;  4JW0 A;  4JCV E;  4ZYS A;  4FXD A;  1DZ1 A;  5IT9 E;  1SNM A;  4RAU C;  3B6Y A;  1ZKO A;  1FL0 A;  2IT1 A;  2Z6K A;  4JV5 Q;  5CV9 A;  3T53 B;  3HZX A;  4FXK C;  1EIF A;  3R3O A;  3GP7 A;  4AQY Q;  1UAP A;  1GUS A;  1YJ9 A;  1X3Q A;  1IBM Q;  5I2X A;  2R61 A;  4A3C G;  2JN4 A;  2RDH A;  1EY0 A;  4GKK Q;  2F0S A;  2SDF A;  2C9O A;  5E3F A;  4A3B G;  3HOX H;  2R93 G;  1GVP A;  3IKJ A;  4Y52 H;  1L0Y B;  3A54 A;  3I91 A;  4WRD A;  1VQH A;  1HQR D;  1ROD A;  3EVQ A;  3FPP A;  1JCK B;  3Q8D A;  5C4X H;  1WVL A;  2UUA Q;  4PV1 C;  1NY4 A;  1Q82 C;  4JI7 L;  2K5D A;  3SK6 A;  1EWH A;  4J8Q A;  5M3F H;  1TWC H;  1PYW D;  1WTX A;  3RUZ A;  4F87 A;  2ZTC A;  2F0J A;  5C0X G;  3CKI B;  1EQT A;  2KQ3 A;  2XIW A;  2VY3 A;  1IXR A;  4UP8 A;  3J7A F;  1IKM A;  1QE6 A;  3S24 A;  4FF3 A;  1PA6 A;  1Y1V H;  4JV5 L;  5JEA H;  4LFA L;  1LTT D;  3U50 C;  2H1E A;  3H3V I;  2JA6 H;  2UXB Q;  4GKJ Q;  1KL9 A;  3K57 A;  3T1H Q;  4XT1 B;  1IYU A;  1EOT A;  3TBI B;  4Q0F A;  4DV3 Q;  3HOV H;  5EJW A;  1J5E Q;  2JQO A;  4A76 A;  1TWG B;  1WTO A;  4GKK L;  2E2I B;  1FGU A;  1DGS A;  3PO2 H;  2F0P A;  3CQZ B;  3S1M B;  2MQH A;  1UUP A;  1T5E A;  2XN9 C;  1LT5 D;  1OXT A;  2PPB C;  4LF6 L;  4OHJ A;  1NTG A;  1J8I A;  3D6W A;  4QCL A;  3HKZ E;  4P74 A;  4FO2 A;  3HG9 A;  1XWE A;  2NUC A;  3PF5 A;  2QDB A;  4DNT B;  1N33 L;  2FJ2 A;  4FF2 A;  3CHB D;  5LMU Q;  4LJZ C;  4B9W A;  3NEM A;  1CKM A;  1E3P A;  3J81 i;  1L1O B;  1E2W A;  1PYS B;  5E1F A;  1CM9 A;  4DK1 A;  1MHW C;  3BYY B;  1JC7 A;  1LAB A;  3I3C A;  5C4X G;  2UXB L;  1UWV A;  3ITP A;  2Q2T A;  1FNU A;  3CC2 A;  5IYD G;  5E4W C;  1YNJ C;  4KN7 C;  1VQF A;  1STE A;  3V05 A;  3S1N H;  1STH A;  3VR3 A;  5JPN C;  1LV9 A;  4H44 C;  1CZG A;  4AYB G;  4A3K B;  2H5X A;  4AH6 A;  2VQE L;  4POF A;  3L7Z C;  4LF6 Q;  2YTV A;  1CKO A;  1HNX L;  1I5F A;  1VQD A;  2LY7 A;  4A3B H;  1DOK A;  2KEC A;  4DNR B;  4HCE A;  5F2D A;  3OYY A;  2Y0S E;  1RJT A;  2YTY A;  1Z7T A;  1BCP C;  1Y8N B;  4IN3 A;  4A3D G;  1GJX A;  2GVB A;  4TVA B;  4QQB X;  1VS0 A;  1YBY A;  1F9R A;  5IGB A;  1KDC A;  1Q1B A;  3RLN A;  1JWS D;  3W1B A;  3QWN A;  1I4X A;  2HIX A;  1HPC A;  3D4D A;  2SNS A;  3DXJ C;  5CBE E;  1XMQ Q;  3JC6 6;  3KF6 B;  4K2L A;  3KJO A;  4B3R L;  2RVL A;  1BOS A;  1D5Z C;  4HR7 B;  1XTD A;  1C4Q A;  4NKL A;  4M1U B;  1ENF A;  4JBM A;  1PXU A;  3CU7 A;  1B9N A;  1EFW A;  3K80 C;  3P1H A;  2R92 H;  3OWE B;  4MN3 A;  4LF9 L; 
#chains in the Genus database with same CATH homology
 3R93 A;  3BDO A;  3QOJ A;  3VR2 A;  2PZT A;  1D5M C;  3C3L A;  3RLF A;  1EWC A;  3OPO A;  1STA A;  4YIJ A;  2I07 B;  1ZXT A;  4ZAI A;  3EA6 A;  4IUQ A;  1S5E D;  2OXP A;  1QWY A;  2MHV A;  5I6Y A;  3NWS A;  2F0I A;  2MGS A;  1CHQ D;  3NQI A;  1Y8P B;  2CW0 C;  3MVV A;  3GV6 A;  3K5M A;  1E2V A;  2Z1C A;  1F9S A;  4L6T B;  1HRJ A;  1U4M A;  2LFN A;  1EU4 A;  4BS9 A;  1FNV A;  3T51 B;  4RGN A;  2X6G A;  3PV0 A;  3VA7 A;  3VYU A;  1H9S A;  3HOY B;  3KBX A;  2A74 C;  2A6H D;  2PZU A;  4EVO A;  3O13 A;  2NWG A;  5K36 G;  4B08 A;  4KY5 A;  2WKC A;  1GHK A;  5COR A;  1QNU A;  2K05 A;  1NR2 A;  1Q8I A;  5DNF A;  2B2U A;  1H9M A;  3M3Y B;  1QB5 D;  1IL8 A;  3PIO 3;  2EY1 A;  2JE6 I;  4IUN A;  4A3B B;  1SYF A;  4C3H G;  3X3N A;  5I6W A;  1SE4 A;  1A6X A;  3H3V C;  3OSO A;  2EJM A;  4K8J A;  4TSS A;  3DMU A;  3DHQ A;  2JXM B;  1CA6 A;  1BF4 A;  2FFK B;  4OL7 A;  4U68 A;  3IL8 A;  2NN6 I;  1I6H B;  1TS5 A;  3GTO B;  2BE5 C;  3HOX B;  2ID0 A;  5JVH 3;  4R8N A;  4DU9 A;  5FO7 B;  4EQP A;  2A6E D;  5C5L A;  1FYC A;  1E0B A;  2HQE A;  4CHT B;  2G9D A;  2NYZ D;  3QG1 A;  4AYB B;  2B8F A;  1PZI D;  2IX1 A;  4KMU C;  1NR4 A;  4K5W A;  2EY5 A;  1Z6H A;  1KTK A;  3RZD B;  2DNC A;  4RA8 A;  3VR4 A;  5D14 A;  1GXD C;  2D9U A;  5G3L D;  1TKW B;  3NUC A;  1MBY A;  1PLF A;  4KY6 A;  2K33 A;  2EE1 A;  3QOL A;  2TMP A;  1QCB D;  1B44 D;  1ML0 D;  3K5N A;  3IAY A;  3QB3 A;  3KUP A;  1ENC A;  3DUZ A;  2KED A;  1HTP A;  1L0X B;  2WIN B;  3NTK A;  2MUY A;  4OIJ A;  5FO8 B;  2EYJ A;  1TS4 A;  3HOU B;  2WII B;  3C46 A;  3NP8 A;  1G2T A;  2BE5 D;  4ME5 A;  4A3J B;  2JA7 B;  1SYG A;  3TZU A;  1PTO H;  3J80 E;  2FMM A;  2HDM A;  2NB0 A;  5KNC A;  1RDP D;  1WTV A;  1Y8O B;  1HXY D;  1S5F D;  2A68 C;  2KOL A;  2KEE A;  4F7X A;  2VNU D;  3TDQ A;  3GO5 A;  1PFM A;  1ONL A;  3V96 A;  4HN7 A;  3GD7 A;  2AQ1 B;  3L9A X;  2NZ1 D;  4IZ8 A;  2F0U A;  2D5D A;  3C1F A;  5T1I A;  1EIG A;  1W6J A;  3NTI A;  1V1P B;  1JR0 D;  3PUZ A;  4ABN A;  3SK5 A;  1I50 B;  1II3 A;  2KA7 A;  1KNA A;  2E2J B;  2PW7 A;  2MP1 A;  4RWS C;  1O7Z A;  3DWP A;  5IIF A;  1G2S A;  2A5H A;  2J7Z A;  3J80 L;  1EZ8 A;  3LNN A;  1F2Z A;  4KJN A;  4C56 C;  2PMZ B;  3OOC A;  2M00 A;  1JOQ A;  5CV8 A;  2F4I A;  3VA5 A;  5LL6 S;  1BNZ A;  3NK9 A;  3SE0 A;  2F03 A;  5CMD A;  1MSH A;  3SVM A;  4DF7 A;  1SBB B;  1STN A;  2ICI A;  4CKB A;  5J22 A;  1LT4 D;  5D3D A;  1S4Z A;  2I46 A;  1JB3 A;  1A3V A;  1DOL A;  1IYV A;  3SR1 A;  2SEB D;  3X3M A;  3R2T A;  1NCV A;  5JEA G;  4Z9C B;  2QKI C;  2IL8 A;  2AUJ D;  1GHJ A;  5CV7 A;  5JOB A;  3K59 A;  5BN5 A;  4KD3 A;  1CHP D;  1PZK D;  1X32 A;  1SSO A;  2A68 D;  4IAL A;  1FGB D;  1NSN S;  3TP5 A;  3D8G A;  1SYE A;  2RDG A;  1Q12 A;  2L55 A;  1KDB A;  4X3T A;  4FP5 D;  1U9R A;  1SYB A;  3PMF A;  1CZW A;  2YU9 B;  2WB1 B;  5IOD A;  3S2H B;  4DN4 M;  2SNM A;  2BDO A;  3I4L A;  5ELF A;  1A2T A;  2L5T A;  2ZXR A;  2F3V A;  3K0Y A;  1GUG A;  3AMU A;  3FDT A;  3A7A B;  4P2C B;  1SFO B;  1LTG D;  2E75 C;  4KKS A;  5C3W A;  2YYZ A;  3RD4 A;  4IUT A;  4O42 A;  4OO1 G;  3M7G A;  5JPM C;  1GUN A;  3RZO B;  3Q22 A;  3HOW B;  1B53 A;  3DEO A;  2NVX B;  1IHZ A;  2K04 A;  1D1I A;  3A55 A;  3VR6 A;  4MHE A;  4XIG S;  5KNB A;  3DEP A;  1Q1E A;  1SYC A;  2K6A A;  4KV6 A;  1WD0 A;  1MD2 D;  4QMG A;  1Y69 U;  1D1K A;  3H09 A;  1LTA D;  1LTB D;  1B50 A;  1AFP A;  5TSS A;  4K5X A;  3E6Z X;  4JK1 C;  4DXG A;  3S15 B;  1MI2 A;  2AWO A;  3A7L A;  1CI3 M;  1I6V C;  1RTN A;  2DY8 A;  4ZK9 B;  4WJW A;  1VF7 A;  1CK1 A;  2JA6 B;  2JA8 B;  5G3L F;  1B9M A;  1XYI A;  1STG A;  1JWU D;  1ILP A;  2F0E A;  4KHZ A;  1WCM B;  3LWU A;  2RKS A;  2QIL A;  3G6J B;  2BA0 A;  5K5P A;  5M5Y B;  1RTO A;  2WV6 D;  4K6L A;  1ICW A;  4IFD H;  2F0L A;  4K14 A;  3J7Y W;  1ET9 A;  3GTK B;  3IFT A;  2FIN B;  1JOK A;  4QIW B;  4ZKB B;  1K8M A;  1I3Q B;  1X3P A;  1Y1V B;  3OMC A;  2CVR A;  4FVM A;  1EEI D;  4J1M A;  4X3U A;  3EJI A;  3AB9 A;  4I65 A;  1S5C D;  2ENB A;  4HED A;  2LKV A;  4RGT A;  4TRD A;  1LT6 D;  1EL0 A;  4KN4 C;  3KF8 A;  2KVM A;  4RCO A;  1CTM A;  5KYL A;  3T56 B;  5EKI A;  5A2Q E;  2FHT A;  3NTH A;  2EY2 A;  4XDX A;  2L4N A;  1KLG D;  2B2V A;  2R7Z B;  1GUT A;  3OW7 A;  4WOR A;  1OO9 B;  1HUM A;  3FRP B;  1ET6 A;  1EU3 A;  1SXT A;  1MSG A;  2LS0 1;  3PO2 B;  4OO1 I;  4RHR A;  1BCP D;  3GTM B;  2K7V A;  1SNQ A;  4TQU S;  3H0G B;  1TII D;  4KD4 A;  3ZYY X;  3QO2 A;  4LMQ D;  4CJ2 C;  1TY0 A;  2IX0 A;  1V1O A;  4ZUJ A;  1JWM D;  1JQY D;  4H7B A;  3I4M B;  3ONA B;  3GTQ B;  1TWF B;  4IUV A;  1CQV A;  3I70 A;  2PYK A;  3BVZ A;  1G8Z D;  3NE5 B;  1Q90 A;  5FLX L;  3DWQ A;  3MFY A;  1SE3 A;  2WKD A;  3Q23 A;  5JJZ A;  3S14 B;  3HOZ B;  1EQV A;  3MFG A;  2EVB A;  4HSV A;  3SK8 A;  4K2K A;  1SJE D;  1TWH B;  5EBC A;  2L12 A;  4X3S A;  4HTH A;  1C8C A;  4L8J A;  2IJ0 A;  1TR5 A;  3GQB A;  4HAE A;  4KKT A;  4CKE A;  1V43 A;  1NAP A;  2OF1 A;  1M4V A;  2CQA A;  1YNN C;  1A2U A;  4DK0 A;  2ZXO A;  3KBG A;  4IQZ A;  2QF7 A;  4DAY A;  1EIH A;  1EY6 A;  4XQJ A;  4KKU A;  4L63 B;  2PO4 A;  2O5I C;  4FF4 A;  1A3T A;  5ISR A;  4BBS B;  2VB2 X;  1KAA A;  2A6E C;  1SND A;  4R8I A;  2O4X A;  1XX8 A;  2G9H D;  2OT2 A;  4A3F B;  4C3I G;  3SEB A;  4O1N A;  2B2T A;  1OXU A;  2BDN A;  2NTT A;  1WTW A;  2WAQ B;  4CBV A;  5NUC A;  2B2V C;  3PUX A;  4KHV A;  1CA5 A;  2HCI A;  4UDU C;  4PMW A;  2JEB I;  5D3I B;  3MXN A;  3I73 A;  3K5L A;  2PCF B;  3T4A C;  3BDL A;  4FF1 A;  1CQF A;  1QOH A;  1PRT C;  5M9O A;  3EFX D;  3MAQ A;  1ZYR D;  5LL6 X;  2F0N A;  4RGO S;  3PIP 3;  4OO1 H;  2NBF A;  3GTJ B;  4N9T A;  4RH6 A;  1CT1 D;  2KJX A;  2EJF C;  1HCZ A;  1AZP A;  3C2P A;  4QF4 A;  4CGY B;  2JP1 A;  4DAP A;  5C4Z A;  1DD2 A;  4NDX A;  1QIL A;  2D62 A;  2LMC B;  4C3J G;  1PRT F;  2B39 A;  2IWH A;  2AWN A;  4H13 C;  1PTO D;  1JOO A;  4PMB A;  3MA2 B;  1BBX C;  2SOB A;  1TY2 A;  4QUF A;  4C1N K;  4QUC A;  3WOE A;  1WTP A;  2B2U C;  5I4D A;  1HA6 A;  4EGV A;  1H9K A;  3TZD A;  3FPU B;  5EPK A;  2XNA C;  4A3G B;  1TVX A;  3OIQ A;  1BDO A;  1TT2 A;  2Q8I B;  4BWG B;  1FNW A;  1ILQ A;  2Q8R E;  3PO3 B;  3S17 B;  4LK1 C;  1PFN A;  3JAM L;  2R92 B;  4A3D B;  3GTG B;  1BO0 A;  2A69 C;  3S1R B;  1SNC A;  4K8I A;  4RKB A;  4MN3 A;  4RHS A;  4S3S A;  1BQQ T;  1PTO B;  3D6C A;  5DEH A;  1HQM C;  5FLX E;  2R93 B;  4PMC A;  4EQN A;  1PMR A;  2E2D C;  3NXW A;  3P7J A;  2BA1 A;  2O2L D;  2RSO A;  5C4H A;  4IFD I;  3EQL C;  3C1E A;  5KIX A;  3S9W A;  1BXT A;  1IW7 D;  2GA4 B;  1ESF A;  2JEA I;  2B2Y A;  1KAB A;  1FD7 D;  3J7A V;  2K03 A;  1XTC D;  3KLS X;  3BYT B;  5K36 H;  1ENA A;  4G57 A;  4FYD A;  3TP7 A;  3RMH A;  1QJO A;  5M5X B;  3CRL C;  2VXW A;  3FMC A;  2NTS A;  2N55 A;  3S16 B;  4RKL A;  2HCC A;  3MZ5 A;  1V8Q A;  5BN3 A;  4KK7 A;  2AQ3 B;  2F0V A;  1LTS D;  5FKA C;  3FKI B;  1DON A;  2XRQ D;  2L0C A;  1DJR D;  5C44 B;  1D2B A;  3M85 A;  2BOS A;  3DM1 A;  4HMJ A;  4ZRZ A;  1YNJ D;  4DXF A;  4CJ1 B;  1K8O A;  2A73 B;  4MIU A;  5M5W B;  1R4P B;  2F0M A;  2F0G A;  5T1G A;  5COY A;  5KEE A;  1AEX A;  3MWY W;  2CW0 D;  4RFB A;  2KUM A;  3MXU A;  1C48 A;  2EDG A;  1EYC A;  1WTQ A;  1DOM A;  2E74 C;  3OWF A;  5EPL A;  2CHB D;  3N52 A;  2NN6 G;  3BS1 A;  4IFD G;  2J0T D;  3TP8 A;  3S1Q B;  2KHS A;  2XWJ B;  1KLU D;  1RCV D;  3NBH A;  4I7Z C;  1BCP B;  2B2T C;  2EXZ A;  4KJO A;  2MPM A;  3BVM A;  2A69 D;  1LAC A;  2ICE C;  2RA4 A;  4V0B A;  4DGZ A;  2QEJ C;  1ESR A;  4FXG C;  5C4J B;  4A3M B;  2EYM A;  3FEW X;  2RBM A;  1PDQ A;  4DFA A;  1QNK A;  5C0X J;  1DCZ A;  1UNS A;  5KND A;  3DWA A;  1EZ6 A;  3K5O A;  2DNE A;  1TWA B;  2Z4I A;  1O80 A;  1AP0 A;  2EYO A;  3NSW A;  4ID6 A;  5EPJ A;  1D5X C;  3BG3 A;  1DXM A;  5D65 A;  4IUU A;  3VYS A;  3M4Y A;  4A3I B;  1EYD A;  4IUR A;  1EY9 A;  1SMY C;  3I4N B;  2PW5 A;  2IX3 A;  3P20 A;  5M3F B;  2EYH A;  2XWB B;  3IFD A;  1I4G A;  3ND9 A;  5C4X B;  3QJY A;  2JSO A;  3Q6S A;  3W3A A;  1KNE A;  1ZYR C;  1OXS C;  1H9R A;  3MC0 B;  4KY7 A;  1PFB A;  1UEA B;  5A35 A;  4XTC S;  3VYT A;  1Z47 A;  4V19 0;  3MHB A;  3K58 A;  1U4P A;  5C5M A;  2B2W A;  4DAV A;  3F2U A;  5KRU A;  1H9J A;  2F3W A;  4B9X A;  2JYO A;  1G29 1;  4RCN A;  3CRK C;  2F0Q A;  5IGG A;  4XYO A;  2HUG A;  5AFW A;  2K32 A;  4C3J B;  5FK9 C;  5IGC A;  4JBW A;  2B8G A;  3SXH A;  4NP5 A;  3I72 A;  2EYP A;  2TSS A;  3S1N B;  3BDC A;  2PNR C;  3A56 A;  1EYA A;  1RD9 D;  5BN4 A;  2EJG C;  3D3R A;  1HHV A;  4G4K A;  3TP6 A;  1VCI A;  3MXP A;  2AQ2 B;  1RF2 D;  4CKC A;  3PUY A;  3UI2 A;  3ERO A;  5IGE A;  1SAP A;  4WFN 3;  2X69 A;  3OMG A;  2F1M A;  2M2L A;  3W2D A;  4G7H C;  2V4D A;  4C3I B;  3KLS A;  5DM7 3;  4XQQ A;  3OIP A;  1GUW A;  4PNY A;  4K5V A;  3I90 A;  4N9P A;  1EY4 A;  1I4P A;  3GTL B;  2WP8 J;  2K5W A;  3HKZ B;  4OIK A;  4F8M A;  2KCN A;  1RHP A;  2AUK A;  5IOC A;  1TU2 B;  1JIC A;  2XRS D;  1SEB D;  2B2Y C;  5C6A A;  2NN6 H;  2B63 B;  4QB4 A;  2EYL A;  2K01 A;  3K7A B;  2NVT B;  1U4L A;  2ZT9 C;  1RKN A;  1F2M A;  3H94 A;  1F9Q A;  3HP3 A;  3NPP A;  2NVY B;  4RGM A;  5CV5 A;  4H0L C;  1TWC B;  3V2T A;  5C0X H;  4XXE A;  3BZD B;  4K6D A;  2K5Q A;  1PRT B;  1DYQ A;  2BCO A;  2XSC A;  1EEF D;  4X3K A;  3KK7 A;  5EBD A;  2RQX A;  5DAU A;  2X6L A;  5LHY 1;  2IW3 A;  4R9W A;  1S5B D;  4ILW A;  4BY1 B;  3I8Z A;  3NHH A;  2MJ8 A;  3LX0 A;  1BUV T;  2EOT A;  3SHL A;  1LTI D;  3NQT A;  2XVS A;  1T5X D;  4IUP A;  3E5S A;  4XQN A;  1TQO A;  1SJH D;  3GTP B;  3E0J A;  1DM0 B;  1O7Y A;  4EQO A;  4BY7 B;  5I2Y A;  1W6K A;  3HRZ C;  3MTS A;  1VMP A;  4BBR B;  4F88 A;  5EQ0 A;  2F0T A;  2C5C A;  1U4R A;  1J9O A;  2QCP X;  3A8J E;  1AW7 A;  3WOF A;  4G7O C;  1PTO F;  2EY6 A;  5C0X I;  2Z4H A;  5JAV A;  3P75 A;  2E76 C;  1O7L A;  3KLR A;  3M7N A;  1GUO A;  3TME A;  4XT3 B;  3Q24 A;  1LLR D;  3VR5 A;  1EY8 A;  3K6O A;  3Q0A A;  1EY5 A;  2M9V A;  1PTO C;  3S2D B;  2EPB A;  4A3E B;  2F0K A;  3MXG A;  4UAI A;  5IGD A;  4XYQ A;  3GV3 A;  1D6E C;  4DA2 A;  2F0O A;  3U9O A;  4HMI A;  1M8A A;  1A15 A;  1STY A;  3PUV A;  5KGU A;  2RSN A;  3HS0 C;  4ZLT F;  4TKO B;  5FO9 B;  3N6R A;  3BVG A;  1CFM A;  1IW7 C;  3D4W A;  3SDZ A;  3HGB A;  3SK4 A;  3NWT A;  4FNF A;  1BR9 A;  1VDZ A;  5C3X A;  5CR3 A;  1JE4 A;  4CJ0 B;  2FMC A;  3QIA A;  5CV6 A;  2H4O A;  5E4X A;  3OHX C;  1LT3 D;  4KI0 A;  3HOV B;  1A3U A;  1TS2 A;  1V1P A;  4HSP A;  1VF5 C;  1XXG A;  2NVQ B;  3M4O B;  2B2W C;  2EZV A;  2E2H B;  2DY7 A;  1F9P A;  3TSS A;  4NMZ A;  2JA5 B;  2KCC A;  4PQX A;  2EYF A;  4J6H A;  1MGS A;  4NW2 A;  2R6G A;  3A8K E;  5J39 A;  1HUN A;  3T16 A;  5IT9 L;  1JOR A;  3AU7 A;  1HFN A;  4ODG A;  5ELB A;  5EKK A;  1E2Z A;  1WD1 A;  1PZJ D;  4IFD J;  1BCP F;  3H91 A;  2WAC A;  2D2C C;  1AN8 A;  3URY A;  3NBI A;  5I9O A;  4C2M B;  5CC4 A;  3FVQ A;  3G7L A;  1B2T A;  5IGF A;  1EY7 A;  3H6M A;  1R4Q B;  4U67 3;  5CGK A;  1SDF A;  2F0W A;  5C3E B;  1F2L A;  2A6H C;  1TS3 A;  1S5D D;  2RDF A;  4M8A A;  2L9H A;  5HUR A;  1B1Z A;  2VB3 X;  5HGT A;  1PRT D;  1OXV A;  4ZUI A;  1SMY D;  2L1B A;  5JVG 3;  1O78 A;  5ELC A;  1SNP A;  2R3Z A;  1I4R A;  1QG7 A;  2F0F A;  1IKL A;  1AZQ A;  1STB A;  1NUC A;  1SYD A;  4OGQ C;  1K83 B;  1LO5 D;  5ELD A;  4LAA A;  3D31 A;  1KDA A;  3ND8 A;  3J81 L;  3ERQ A;  1FR3 A;  5FOB B;  3R8B A;  2J4X A;  4G7Z C;  2K1B A;  5EGT A;  2HDL A;  3JAM E;  2PQE A;  4HCS A;  2Q8T A;  5JEA J;  2N88 A;  3R2I A;  1OXX K;  1G6Z A;  2IPK D;  3U9S A;  4BA1 I;  1F77 A;  2K28 A;  4BA2 I;  5DM6 3;  4ZQ3 A;  1EFI D;  5I9P A;  1B3A A;  2Z8L A;  5CV4 A;  1HA5 A;  2ZXP A;  3WDN A;  1GOZ A;  3LWE A;  4C1N I;  5A2Q L;  1Q3L A;  1F2Y A;  3L3O C;  1HFG A;  1YNN D;  4E6I A;  2DN8 A;  2OEO A;  4GZY C;  2Y0S B;  2VUM B;  4ZKC B;  1WTR A;  1H9S B;  4A93 B;  3HEJ A;  5J1Z A;  1I4Q A;  1ZEQ X;  3A8I E;  2F0D A;  1LTR D;  3TN2 A;  5ELE A;  3J81 E;  3MEH A;  4Q5V A;  1HTL D;  3VYR A;  5CYU A;  5KYI A;  1Y1W B;  2PZW A;  3T13 A;  1I4H A;  2O5J C;  1SNO A;  4Y7N B;  4ULL A;  5EKL A;  4KTA A;  2L11 A;  4C3H B;  5M3M B;  1SE2 A;  3PUW A;  1VMC A;  1R9T B;  1B4O A;  3D4R A;  2F0H A;  1DZ1 A;  4ZYS A;  4FXD A;  5IT9 E;  1SNM A;  4RAU C;  1ZKO A;  2IT1 A;  5CV9 A;  3T53 B;  3HZX A;  4FXK C;  3R3O A;  3GP7 A;  1UAP A;  1GUS A;  1X3Q A;  5I2X A;  2R61 A;  2RDH A;  1EY0 A;  2F0S A;  2SDF A;  2C9O A;  5E3F A;  3IKJ A;  1L0Y B;  3A54 A;  3I91 A;  4WRD A;  1HQR D;  1ROD A;  3EVQ A;  3FPP A;  1JCK B;  1WVL A;  4PV1 C;  2K5D A;  3SK6 A;  1EWH A;  4J8Q A;  1WTX A;  1PYW D;  3RUZ A;  4F87 A;  2F0J A;  5C0X G;  3CKI B;  1EQT A;  2KQ3 A;  2XIW A;  1IKM A;  3J7A F;  1QE6 A;  4FF3 A;  5JEA H;  1LTT D;  2H1E A;  3K57 A;  4XT1 B;  1IYU A;  1EOT A;  3TBI B;  4Q0F A;  5EJW A;  1TWG B;  1WTO A;  2E2I B;  2F0P A;  3CQZ B;  3S1M B;  2PPB C;  1UUP A;  1T5E A;  2XN9 C;  1LT5 D;  1OXT A;  1J8I A;  4OHJ A;  3D6W A;  4QCL A;  4FO2 A;  3HG9 A;  1XWE A;  2NUC A;  2QDB A;  4DNT B;  2FJ2 A;  4FF2 A;  3CHB D;  4LJZ C;  4B9W A;  1E2W A;  5E1F A;  1CM9 A;  4DK1 A;  3BYY B;  1JC7 A;  1LAB A;  3I3C A;  3ITP A;  1FNU A;  5E4W C;  1YNJ C;  4KN7 C;  1STE A;  3V05 A;  1STH A;  3VR3 A;  5JPN C;  1LV9 A;  4H44 C;  1CZG A;  4A3K B;  3L7Z C;  2LY7 A;  1DOK A;  2KEC A;  4DNR B;  4HCE A;  5F2D A;  1RJT A;  1Z7T A;  1BCP C;  1Y8N B;  4IN3 A;  1GJX A;  1F9R A;  5IGB A;  1KDC A;  1Q1B A;  1JWS D;  3QWN A;  1I4X A;  1HPC A;  3D4D A;  2SNS A;  3DXJ C;  5CBE E;  4K2L A;  2RVL A;  1BOS A;  1D5Z C;  4HR7 B;  1C4Q A;  4NKL A;  4M1U B;  1ENF A;  1PXU A;  3CU7 A;  1B9N A;  3P1H A;  3OWE B;  5CBA E;  1G91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...