1ZXTA

Crystal structure of a viral chemokine
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
VSYTPNSCCYGFQQHPPPVQILKEWYPTSPACPKPGVILLTKRGRQICADPSKNWVRQLMQRLPAIAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of viral macrophage inflammatory protein I encoded by Kaposi's sarcoma-associated herpesvirus at 1.7A.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Signaling protein
molecule keywords functional macrophage inflammatory protein 1-alpha homolog
total genus 12
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zxtA01
1WTOA 4ZKCB 2L1BA 3I3CA 3SVMA 2K05A 2Q8RE 1WTVA 1PFMA 3N52A 5T1GA 4HCSA 1HHVA 3GV6A 4X3KA 5D65A 1AZPA 1MSHA 1O7YA 2X69A 1WTQA 1PFBA 5E4XA 4RAUC 4U68A 2MPMA 1U4RA 1J9OA 5EQ0A 1HUNA 1BNZA 3FDTA 2MGSA 2EE1A 2FMMA 2HCIA 1NAPA 2HUGA 2JP1A 3D6WA 4NW2A 4OIJA 1NR4A 2B2TA 2FHTA 1S4ZA 1KNEA 4CJ2C 4IURA 1DOMA 1XX8A 3GV3A 1HFGA 4XDXA 4LMQD 1QNKA 2KOLA 1G2TA 1QE6A 1HRJA 5CBEE 2B2YA 2NWGA 2B2UA 3TZDA 3IFDA 1DOKA 1A15A 1WD0A 1EL0A 2EOTA 1CM9A 2JYOA 4XT3B 1U4PA 3KBXA 4QUCA 2BDNA 2NYZD 2B2UC 4IUQA 2B2YC 4IUVA 1SAPA 1B4OA 1MSGA 2DY7A 1O7ZA 2HDLA 1RHPA 2KVMA 4HSVA 2KEEA 2B2WA 4X3TA 4CJ0B 1JICA 1HA6A 2K03A 2MJ8A 1DZ1A 3QO2A 1RTOA 2B2VA 2B2TC 2RVLA 1F9PA 4HAEA 1WVLA 1WTRA 1BF4A 4CJ1B 2R3ZA 2M2LA 2SDFA 1HFNA 1PFNA 1EIGA 5EPKA 2KUMA 1EQTA 1RJTA 5T1IA 1C8CA 3FPUB 2L11A 1G2SA 1MGSA 1F9QA 1PLFA 4UAIA 2KECA 3ONAB 2MP1A 2K1BA 4IUUA 1RTNA 4ZK9B 2FJ2A 1EIHA 2RSOA 1KNAA 2KEDA 2Q8TA 2HCCA 3G7LA 3H91A 4XT1B 1SDFA 2B2VC 5E4WC 1RODA 4OIKA 1ESRA 4IUTA 3P7JA 4ZAIA 1ICWA 2B2WC 2D9UA 3I8ZA 1MI2A 1E0BA 2X6GA 2H1EA 1B50A 4MN3A 5EPLA 1B3AA 1CA5A 1IKMA 2L12A 2RSNA 5CBAE 5EJWA 4HEDA 1AP0A 1G91A 1X32A 1WTPA 1Q3LA 3DEPA 3MWYW 2L4NA 4DN4M 4MHEA 1SSOA 2RA4A 4R8IA 1X3QA 2K28A 3DM1A 1HUMA 4ZLTF 2XIWA 1AZQA 4QUFA 3I90A 5JJZA 1ILPA 2N55A 3UI2A 1F9RA 1U4MA 1VMCA 1IL8A 5DNFA 1X3PA 1BBXC 2CVRA 1JE4A 1ILQA 3TN2A 1IKLA 3F2UA 4X3UA 1VMPA 2K04A 4IUPA 1ML0D 4O42A 3Q6SA 2EPBA 2J7ZA 1G6ZA 1B53A 1F9SA 2FINB 2L9HA 3DEOA 1LV9A 2IL8A 2N88A 3LWEA 3IL8A 1GUWA 2FFKB 1U4LA 1M8AA 1QG7A 1TVXA 1BO0A 4RWSC 2NZ1D 2VXWA 2DY8A 5CMDA 1WTWA 1ZXTA 1XYIA 1NCVA 1DONA 4X3SA 4RA8A 3HP3A 5COYA 1PDQA 5CORA 5AFWA 2X6LA 3R93A 2K01A 1WTXA 2HDMA 1WD1A 1CA6A 1J8IA 1EOTA 1O80A 5EPJA 4ZKBB 1F2LA 1DOLA 3KUPA 5D14A 3I91A 5EKIA 4R9WA 1NR2A 1B2TA 3MTSA
chains in the Genus database with same CATH superfamily
2L1BA 1X54A 4LNQA 1HR0L 1X56A 1PH6A 4HCSA 4C3IG 5EKLA 5LMNQ 1AZPA 1CZGA 2WP8J 2WB1E 4CDDC 4DUZQ 3MEFA 1WTQA 2VW9A 5EAYA 5E1FA 2PMZB 4JI5L 4H7BA 4C3HH 1ASZA 1R4QB 5FLMH 1KDBA 3HOZG 4DR4Q 1PTOD 4JYAL 1Z7TA 3A0JA 4LMQD 3VR2A 4YCUA 2E2DC 3DM3A 5CBEE 2QEXA 4A3GG 1DOKA 2EJFC 2A69C 2EOTA 3S17H 3UDIA 4QUCA 3CXCA 3DHQA 2F3IA 4JV5Q 1I5FA 1XYIA 3HRZC 2Z8LA 3GTKB 5FLXc 2B2WA 4X66Q 1EIYB 3VYTA 2C5CA 4KN7C 2A6ED 1PRTC 2DNEA 4BBSB 5EKKA 4BXXH 4JVZA 2KENA 3H15A 5CV7A 4IPHA 4DPGA 1ONLA 3RZDH 4K6DA 4G4KA 1F9QA 5C4JH 1L1OB 5IGFA 4ID6A 1YHBA 3RLNA 4S3SA 1V8QA 4DAMA 4OIKA 4IOAA 2Z4HA 3S2DB 2F4IA 1PYWD 2VB3X 2XN9C 1O78A 3NUCA 2MQHA 3NTKA 1SNCA 2A68C 3STBD 3S1MB 1Q90A 2AUJD 4PMCA 1PH1A 5J39A 2WACA 4IJLA 5ELNA 4FP5D 1F9RA 3J7AV 1Y8NB 1XNQQ 5C4XG 1YEZA 1JE4A 3BU2A 2JN4A 4J1MA 1FR3A 3EIVA 4BBRH 3HFZB 1TY2A 1PTOC 1BCPD 4K14A 2F0IA 1CQFA 1SNPA 1G6PA 4A76A 1GUWA 1X9NA 2XVSA 1U4LA 5GADC 4ZCKA 1A62A 1VQAA 4A3JG 2NZ1D 3HOUG 3X3MA 5BN5A 1SN8A 1EZ8A 3A7AB 2HHHL 3I2ZA 1H9RA 1SXTA 4FNFA 1HNWL 1YZ6A 2LFNA 1PTOH 1B1ZA 2NBFA 3AQQA 3R3OA 4P2CB 3D8GA 3LGJA 3BZKA 2F4VL 2NB0A 3GTMH 4JI8Q 1PH3A 2GVBA 2JA6B 5E4XA 2F1MA 4R4TA 1PYBA 2BE5D 2F0GA 3D6WA 4O1NA 2ZJQA 1VQEA 4K5VA 4OO1I 4DGZA 2KOLA 4I7ZC 2A69D 2WV6D 2EY6A 4IFDH 5IT9L 5CGKA 4N8FA 2NYZD 5IT9E 1O7ZA 3S1QB 2N78A 2ES2A 1EQVA 1B44D 1Q8KA 4KV6A 4R4OA 4HAEA 2J4XA 2GA4B 1W6JA 1ENFA 1TY0A 2G9HD 5NUCA 3FP9A 2RDHA 3MFGA 5M3FG 4JYAQ 3ONAB 2NTSA 4DNRB 1TWHB 3RN5A 2EY2A 4XYOA 5AJ3Q 4K5WA 2KHIA 3S16H 4YHHQ 1PZJD 1E0BA 1S5BD 4X65L 2JA7B 4CDEC 1DGSA 2QDBA 3J7AF 1VQCA 2IHFA 2L12A 4PZ7A 1XTCD 5EJWA 1X32A 3KF8B 3VA7A 3HOXH 3UDFA 1DYQA 4EX5A 3DM1A 5JEAG 5IYCG 2IJ0A 5KRUA 4OWXB 4K5XA 1B7YB 1VMCA 2A5HA 2A73B 4KD3A 4X3UA 2E5LL 4QL5A 1I6VC 4O42A 4A3BB 3BVGA 4LF7L 4RGOS 5LL6S 4P72A 2CWPA 5ELDA 2WIIB 2PQEA 3FMCA 1K28A 1IYVA 1JQYD 2B8GA 1AFPA 2X6LA 3DWPA 5M9OA 1STYA 1HH2P 4OL7A 4ZKBB 1F2LA 2F52A 2IX3A 1IXRA 1WI5A 4KHZA 1DXMA 1A2UA 4ZKCB 1Z47A 2EXDA 4IOCA 3MZ5A 3Q8DA 3K80C 5LMUQ 3PIPA 4OEMB 2WKDA 5D65A 3J7YW 5HGQA 2LY7A 5EQ0A 4FF2A 1GKHA 3AFQA 2F0VA 3PO3B 1DJRD 4UP8A 4JI3L 4LFBQ 2K5WA 4DV6L 1QNKA 3QJYA 2NWGA 2HHHQ 4Q0FA 1EY8A 3D4RA 1U9RA 4GN4B 5FJ8H 4DV4L 1H9SB 3AEVA 2AMCB 3S2HH 4JI4L 2KEEA 2BH8A 4L63B 5IYDH 2ASBA 4DUZL 5JVG3 4OONA 1VQDA 3HG9A 2NVTB 4BY1G 3SDZA 3A8JE 4F7XA 1NMFA 1AEXA 4C3IB 4LJZC 1JJ2A 2ZM6Q 1XXGA 4RGMA 4GZYC 2E8GA 4B9WA 3K8AA 1V1QA 2E76C 4PZ6A 1P8LA 2JA5H 4ILWA 5C0XG 5DEHA 3U9SA 1Y69U 4R4QA 4JI7Q 3HOYB 3IFTA 2UU9Q 4YWMA 4ZUIA 1BKBA 2X6GA 4OHJA 4HIKA 3NPPA 2UUCQ 1GUSA 3KLSX 2XGTA 2KBNA 5CBAE 1D2BA 3I4MG 1PHJA 4TVAB 3G71A 4JK1C 4A3KB 1MD2D 2HIVA 2JA9A 4N9TA 3MA2B 1EWHA 1IKLA 2PZTA 3OIQA 2RHSB 4DXFA 4IQZA 3A8IE 3HOVH 4G7ZC 3FKIH 5C3EB 4KY5A 5M3FH 3UE1A 2Y0SB 3OPOA 2F0JA 1GUOA 5C6AA 1I4GA 1DONA 2AWOA 4IFDJ 4L5SA 4LWCA 1SBBB 2KCCA 3PIO3 3GTLH 1IW7D 1II3A 1H95A 4DR1Q 3G6EA 3P75A 5GQOA 1PRTF 3S14H 2D0PA 1K83B 5IWAL 3CMEA 1BOSA 3NQTA 5M5XH 3D4WA 3U4ZA 2DJGC 3WWVA 5EGTA 4KD4A 3T1HQ 4EQPA 2A6EC 3EN2A 1U0LA 3M4OB 4E6IA 2EYJA 2E2IB 3SK5A 2QCPX 2NVXH 1K8MA 1BBWA 5DM73 3A5UA 4DAVA 3TZDA 5IODA 3BDLA 2MUYA 3FPPA 4ULLA 2D0OA 2M9VA 4OO1G 1HNWQ 2JYOA 4DUYL 5AJ3L 1HXYD 2VUMH 5I2XA 3AFPA 3STBC 1V1PB 4JBKA 1H9SA 4GKKQ 3GTJH 2K03A 2JE6I 5KNCA 3T16A 1TS2A 2UXDL 1VS0A 5JVH3 1QOHA 2PMZE 4ME5A 1SYCA 4LW1A 2RDGA 3GTGH 2WB1G 1F2MA 5IGBA 1SJED 4XTCS 1CUKA 1KNAA 1IBKQ 3KBGA 3H91A 1GO3E 1Y1VB 1K9MC 5E4WC 1YBYA 1ESRA 1CFMA 4IALA 4J6HA 5FO9B 1KTKA 3M3YH 2AQ2B 1EY0A 4DV1Q 1IZ6A 2YU9H 4PMBA 4DAYB 3HOYH 1DM0B 2JA7G 3QB3A 1WTPA 3DEPA 1E3PA 4MHEA 2F0MA 2AWNA 4DXGA 3IKJA 3E5SA 1ET6A 1BXTA 1HNZL 1LTID 2DGYA 3KF6B 1ILQA 1STGA 4HCEA 5I4DA 3RZOH 3F2CA 4WJ4A 2F0TA 4IN3A 1SEBD 4HMJA 1G8ZD 1KHIA 2RQXA 2EYOA 4CDCC 2ENBA 1EZ6A 4DR5Q 2FFKB 4RCNA 2DJFC 1OO9B 3HP3A 1N32Q 4Q5VA 3CHBD 4A93H 4DA2A 3AU7A 1J8IA 4BXXG 5C3EH 3OWEB 1JOOA 2RDFA 1FVIA 3D4DA 5GAHC 1D6EC 1PYSB 1NNXA 1B2TA 1I6HB 3WOFA 3CCQA 1WTVA 1PFMA 1XTDA 1XMOL 3GV6A 1HZCA 1MSHA 1S5DD 2FMMA 1U5KA 2PPBC 3BJUA 2MO1A 1EEFD 1WJJA 4O2DA 4MNOA 1A15A 2F3WA 3GDEA 1WD0A 2XWBB 1XPOA 4OWTB 1CM9A 4XT3B 5EBCA 1PTOF 3NTIA 2VL6A 1QB5D 2QKIC 2WAQB 2B2VA 3J80c 1EEID 1LT4D 5C3EG 1WVLA 1WTRA 3GTOH 1PH8A 2SDFA 3H09A 3S2DH 4V190 1PMRA 1SRUA 1KAWA 4A3DH 4X62Q 4JI0Q 3FHWA 3SGIA 2EY1A 1CK1A 2P5ZX 4AYBB 4M8AA 3HKZG 4OXPA 3C2PA 1VQ7A 3PO3H 3GTKH 4GN3B 1I50B 2Y0SG 2Z4IA 3UDGA 4WFN3 2F0LA 2PW5A 4FDBA 2ZTDA 4RGNA 3JAMi 5IGCA 3W5OA 4YWLA 4LFCL 1E24A 2B2WC 4GKKL 4C3JG 1STAA 1WCMB 4FXKC 3PO2H 1EY4A 4TQUS 1SE2A 2O5IC 2N3SA 4A3CH 2L4NA 1Q86C 3PUYA 1X3QA 2QEJC 3DXJC 4DR1L 2F0HA 2XIWA 1UEBA 3ICEA 5JPMC 4KHVA 5I6WA 2IX0A 1BBXC 3I4NH 1LABA 1XMOQ 4CBVA 2BE5C 3L3OC 4UP9A 1QZGA 1R9TH 1ML0D 1FGBD 1WFQA 5IT9c 1UWVA 4JI7L 4B3SQ 2EYMA 1BQQT 2L9HA 1LV9A 1YNNC 2PI2A 1ZKOA 4RWSC 1YNXA 2AHOB 4P73A 3NBHA 1ZXTA 2B39A 2E2HB 4R4IA 1EY7A 1M1KC 1EOTA 3W3AA 2Y0SE 4JI2Q 4CKCA 4JBWA 4JC0A 4OELB 1S3OA 2NZOA 3VR3A 3R8BA 2A6HC 1YHAA 4C1NK 4F88A 2QILA 4MTNA 4DNIA 1C7YA 3VYRA 3E3XA 1T9HA 1L0WA 2H5XA 1HR0W 3L7ZC 3JC66 3S1QH 2FHTA 1TIID 3HOVB 4IURA 3BS1A 1HTLD 1PTOB 2LMCB 4XXEA 4C2MB 5C0XI 3IFDA 4C3JH 3EFXD 1SE3A 3H94A 2BDNA 2OT2A 3AMUA 5IWAQ 3K0XA 4IFDI 4IUQA 3QOLA 4A3KH 3SHLA 3ULPA 4R8NA 3P1HA 4LFAL 4IUNA 1JMCA 2JK8A 4DV1L 2UUAL 3QO2A 1LO5D 3A8KE 1GUTA 3S1RH 4CJ1B 2QF7A 3GTPB 5IOCA 1VQ4A 4ABNA 4A3DG 1VDZA 2N8NA 2RKSA 3FEWX 5C4XB 2ICEC 1UEAB 4B3RL 1CKNB 2IHEA 3FKIB 3FKIG 1TKWB 5I2YA 3J80L 1O7IA 5LHY1 2NN6I 2ZJRA 1H9MA 2FXQA 1P16A 2R92H 2B63H 3I73A 4A3FH 3OMCA 4DR2L 1B50A 3A54A 1B3AA 1AW7A 5C5LA 3HOZH 2ATWA 1Q3LA 3NWTA 3MVVA 2KCMA 1K73C 2BA1A 1ZYRD 1PH7A 1D1IA 3GTGB 2E2IH 1OXUA 2UUBQ 2Q2HA 3C1EA 1KABA 3ZYYX 2J7ZA 5ELCA 1G6ZA 3A5ZB 3HKSA 3CPFA 4J8QA 1YHQA 5L37A 3RZDB 1E2VA 1Y1VH 4LFCQ 2NZHA 5JOBA 2OTLA 1D1KA 4GLVB 2F03A 4HJ7A 2VXWA 2K32A 4R1JA 1PZID 2ID0A 4RA8A 4BY1H 3C1FA 1SMYD 2AQ1B 1I3QB 1QVCA 1W2BA 1KLUD 3SXHA 3E0EA 5EKIA 1SR3A 1B70B 4G57A 1BCPF 1WTOA 5C4ZA 1UAPA 2E2HH 4JI4Q 1CTMA 2CQAA 5CV9A 1CHQD 5C44G 4QJFA 1BNZA 2NVQH 4A3MG 2EE1A 3TDQA 3BDCA 4KJNA 2ZM6L 2EQSA 3H6MA 3BYTB 1I94Q 4LF6L 2PQAA 2XNAC 1B9MA 4IPDA 2O2LD 3N6RA 4A93B 4A3EH 2YTVA 5KNDA 4CHTB 2KCTA 1FYCA 1EQQA 3I56A 3G4SA 3I4LA 2D5DA 1FNUA 1VQBA 4RHRA 1VQGA 4EQOA 1N8RC 4N8X1 5C4HA 4F8MA 4L5TA 3IRBA 2KUMA 5IP9H 4NKLA 1C8CA 4BY7G 4LF5L 4LF4L 5I9PA 3S2HB 4BBRB 1MHWC 4ZK9B 2F0FA 1BR9A 1QWYA 2FJ2A 3KLWA 4F87A 4KHPQ 4NP5A 1K8GA 3RN2A 3T53B 2BA0A 4DAPA 4BBSG 2VUMG 2OEOA 3KDFA 3EQLC 4JI6L 5K36H 5J1ZA 1JWUD 3JAME 3HZXA 4ZRZA 1X6OA 1I4QA 1G91A 1AP0A 4DV5L 1UE7A 2D2CC 1IW7C 3E9IA 5FKAC 5M3FB 1NUCA 2F0UA 3NEMA 5D3DA 2LXKA 5DNFA 1X3PA 3J81E 3HKZB 4I65A 5LMUL 4QY7A 1Y8PB 1V1PA 2R61A 2YTYA 4KY6A 4Z9CB 2XWJB 1F9SA 1T5XD 1MBYA 3OTOQ 3MFYA 1IBLL 2VQFQ 2NUCA 3HEJA 4WJ3M 2HIXA 1L0XB 2YYZA 3MXUA 4ZYSA 2Z6KC 1IBML 2LKVA 2BDOA 1WTXA 1PDQA 1SJHD 2K01A 3SK6A 3PO2G 1QJOA 3R2IA 4GLAC 3HOWG 3KUPA 2XTIA 4DUYQ 1KAAA 3S16B 4RG1A 3MTSA 1ILPA 1QUQB 2R93H 3I3CA 1F77A 1LLRD 5FLXL 3E6ZX 2ZJPA 3KOJA 2JA6G 1I3QH 3N52A 3PSIA 2R7ZB 2MFIA 4K8IA 3I4NB 3NE5B 4IFDG 4NXNL 1TXYA 1RD9D 2MPMA 4LF7Q 3QWNA 1B3QA 1LTTD 5DAUA 4LAAA 4NW2A 3CKIB 1TWHH 1F2YA 1N34L 4DR6Q 1QZHA 3KYHC 5ELOA 1SNDA 3H3VC 4G7OC 2NVYB 1S5ED 3ULLA 2VQEQ 1VF7A 2CH4A 5M5XB 2CW0C 1EL0A 3VR4A 2A6HD 4JI2L 2AQ3B 2R7DA 2NTTA 3CCMA 3RLOA 2DY7A 5C0XH 1XPRA 4X3TA 2RBMA 4YIJA 2HQEA 1FNWA 1RTOA 2SOBA 1F9PA 3S1NB 1CKOA 4DK1A 2H4OA 1YNND 1OTCA 3NTHA 5KGUA 1ZEQX 1EOVA 3U9OA 5T1IA 1RCVD 4HIOA 2L11A 1RF2D 1HQMC 2YTXA 2A19A 4JI3Q 4LFBL 4PQXA 4DV6Q 3K58A 1PA6A 4CKEA 1D5ZC 4NXMQ 4A3FG 1GXDC 1L2FA 1SE4A 2HQLA 1TT2A 3U58A 1MJEA 2EDGA 1A8VA 3ER0A 3QR8A 3PF4A 2EJMA 2WFWA 4ZUJA 1ESFA 2E2JH 1M4VA 1EYGA 3RZOB 5E7NA 1IBMQ 5F2DA 3K59A 2EIFA 4HEDA 4DN4M 2JEAI 3MXGA 3NP8A 4ZLTF 3GTPH 4DU9A 4EQ5A 3UI2A 1PZKD 4GN5A 4GNXA 2Z6BA 3Q6SA 3LX0A 2ZXOA 1I6HH 4PG3A 2PCFB 4B3ML 4HMIA 1OXTA 2OQKA 2Q8IB 1EY9A 4WRDA 3SEBA 4DR6L 1JC7A 4PV1C 1I94L 4LF6Q 4X3SA 1Y8OB 2E75C 1HNXQ 1M90C 1V1OA 3LNNA 5EPJA 1JOQA 1JJCB 1MKHA 3M7NA 2MHVA 1GJXA 3TSSA 4IJHA 4JV5L 3SVMA 2JA8B 3KLSA 5CYUA 4DV2L 4POGA 4A3LH 4JW0A 1LTAD 3SK4A 4K8JA 3DWAA 2QW7A 2X69A 3ZJYC 1VQ8A 1PFBA 4RAUC 1J9OA 1NE3A 5JEAH 2K7VA 4KMUC 2JP1A 3CC4A 2VQFL 5IP7G 4JI0L 1NR4A 2B2TA 5FLMG 4CJ2C 2VY3A 1GUNA 4IO9A 3GTOB 1ZYRC 1G2TA 1LTSD 4QQBX 3KJPA 1IBKL 5C3WA 2K75A 4KLKA 3WOEA 4IPGA 1G51A 1A63A 2ICIA 1HA6A 3V2TA 4OO1H 5I9OA 4UP7A 4WORA 4YY3L 2R3ZA 1C48A 1GUGA 1PFNA 1EIGA 2Z9HA 2K4KA 3T13A 3S14B 1FD7D 1PV4A 1K8OA 2J0TD 5JAVA 3PO2B 4IZ8A 3S1NH 2ALYB 4BY7B 2V1CC 1KQSA 4DK0A 4XT1B 5JJKA 1EWIA 1RODA 1VQFA 2D9UA 3ERSX 2HD3A 4A3DB 3HOWH 4MN3A 1CZWA 2UXDQ 5KYLA 4FO2A 3SK8A 1N32L 1STHA 4A75A 2VUMB 2IW3A 1I50H 1H9KA 5IGGA 3K5LA 4DR7Q 2JJQA 3EBEA 2KCNA 3OHXC 2CVRA 4GNXC 3E9HA 2QA4A 3I4OA 3PQIA 3AB9A 2F4VQ 2I46A 4AH6A 3GQBA 2SNSA 1Q1EA 4QMGA 1CT1D 4LUZA 1UE6A 1X65A 3BZDB 1M8AA 4H13C 4DV7Q 2ZXPA 1TWGH 3I4MH 4QGUA 2EXZA 5CORA 5IP7H 4DV5Q 2VQEL 2PNRC 3I7FA 1L1OA 1SFOB 2Z0SA 4FVMA 1XNRQ 3I91A 1FNVA 2CCZA 3M3YB 5IGDA 4R9WA 1HNZQ 2Z1CA 2YU9B 1ET9A 2WAQE 3BYYB 2D62A 1BVSA 1O7LA 2YV5A 1YI2A 2CWAA 4A93G 2EYHA 3W2DA 4GOPC 5GROA 4B3RQ 5JJLA 1LM0A 1PH4A 5IYDG 3CCVA 4R8IA 5FJ8G 2SEBD 4XQNA 4X65Q 3CP0A 2C9OA 3S9WA 1QVGA 2RVLA 4DR3Q 3U50C 2VB2X 2M2LA 1HFNA 1CI3M 1S40A 3VA5A 4NB3A 3IAYA 1VQHA 2E74C 1E1TA 2CW0D 4QB4A 2MP1A 4K0KL 5C44H 1E2WA 1IYJB 1KIXA 1B8AA 3P20A 2JQOA 5HGTA 2I5LX 3H0GG 4B3MQ 1EIFA 1CKNA 1J5EQ 4JI1L 1JWMD 2F0WA 5CV4A 5EPLA 2PW7A 5M5YB 1SMYC 3M9BA 2RA4A 1SLJA 4JOIA 1I4XA 1Q81C 2EYFA 1JORA 2UXBQ 2V4DA 4TRDA 3L2PA 3TN2A 4XYQA 2DNCA 4LF9L 2K04A 1A3TA 4JOIC 1EYDA 1W3SA 1B53A 1RDPD 3GTQB 1Q8IA 1E22A 1CSQA 2IT1A 5G3LF 1X3EA 5FO8B 2K52A 2Q2IA 3R93A 4DF7A 2F0SA 1Q46A 2HDMA 2NVQB 1HZ9A 3S15B 5IE8A 1VQJA 4H44C 1NR2A 4DV4Q 4A3MB 4DV0L 2B63G 4X64Q 1RKNA 2Q8RE 1N33Q 2R93G 4X3KA 2IWHA 1CHPD 2PZWA 4KK7A 5D3IB 3D3RA 4L5RC 3AYHB 1HZAA 3FDTA 2EVBA 3H3VI 1Y1WH 3ITPA 1KNEA 1Y1WG 3V05A 4LF8Q 1AE3A 1FJGL 1BUVT 4A3IB 3CRLC 4FF4A 5IYBG 1JT8A 3OMGA 1U4PA 4L5QA 5ISRA 1JE5A 2K5QA 3CW2C 3Q22A 3D0FA 4JPBW 2B2YC 2L5TA 1B4OA 2HDLA 4JI6Q 2VZAA 2K50A 1XWEA 2CHBD 4H02A 1K3RA 4YCWA 4GOPA 4UHVA 3C46A 1GOZA 3EA6A 3KLRA 1SYBA 1C9OA 4WJWA 1SNQA 1DD2A 4RH6A 2I5MX 3FPUB 3TP6A 4UAIA 3OW7A 3G6JB 1D5MC 1RTNA 1JCKB 2N49A 4YWKA 3K7AB 1Q12A 2L0CA 1JR0D 1VQ9A 1LTRD 2IX1A 2B2VC 2CH4W 1HA5A 1GHJA 4IUTA 4P74A 1D5XC 3S17B 5JJIA 3OTOL 4NPSA 1IBLQ 4LFAQ 1EY5A 1LACA 1MI2A 1HCZA 4RGTA 4JG2A 4QIWE 4FXDA 3ND9A 4DV7L 4KKSA 4YY3Q 3CAMA 1KRSA 5IP9G 3RD4A 3MWYW 3MXPA 2A1AA 2B3GA 3VDYA 5A2QL 2K28A 1HUMA 1XNRL 3K6OA 1SYFA 2N55A 3CQZB 4DV0Q 1S5CD 2PZUA 2KA7A 1YNJD 1VQPA 3RNUA 1WOCA 3HOXB 1EFID 2OCEA 2XSCA 1SYGA 2BCOA 5M3MH 3A7LA 4GKJQ 3VR6A 1PRTD 3VYUA 5C4XH 2FINB 1HZBA 1J5EL 3WDNA 2N88A 4RKBA 2Q2TA 2R7ZH 2UUCL 4A3CG 2WINB 1UE5A 4LF8L 3J80E 2CQOA 2R7ZG 3SR1A 2OF1A 4OX9L 2JXMB 4XQQA 1VQ6A 4MIUA 2I5HA 2LSSA 2RCFA 2VS1A 1XJVA 2UXBL 4HJ5A 5BN4A 2RCNA 5M3MG 5HY6A 3TEHB 1A3UA 4FF3A 1TS3A 1I4RA 4B08A 4NMZA 4KY7A 3HKZE 3PO3G 3GD7A 1GD7A 4RMFA 1U4RA 4HJ9A 1HUNA 1NAPA 1QUQA 3K0YA 2L15A 3PV0A 5TSSA 1S4ZA 2PYKA 1DOMA 5KIXA 2L55A 3CMAA 4XDXA 3DMUA 1HRJA 3X3NA 4KHPL 1MIUA 3M85A 1SNMA 1K8AC 5A2QE 3SE0A 4B9XA 5DLQE 2B2UC 4HTHA 1S5FD 1EFWA 2OQ0A 1Q7YC 4N9PA 1PVOA 2B2TC 3RUZA 4ODGA 2E2JB 3CC7A 3VYSA 3HOXG 1LUZA 4HIDA 3M7GA 5KEEA 3KK7A 1IYUA 4C3HG 1MGSA 2DUDA 1LT5D 1Z9FA 3NWSA 4LUVA 3W1GA 3S24A 3NHHA 2Q8TA 2SNMA 4GKJL 2R92G 1VF5C 1PH2A 1TWAB 2F0OA 5E3FA 1TR5A 3OYYA 3BG3A 5ELFA 1YNJC 2HT1A 1HQRD 3L0OA 4DR3L 2PO4A 1IKMA 5C5MA 2K5VA 1BBUA 2A8VA 1V43A 1TWCH 4A3EB 3V96A 3TS2A 3JAMc 1EU4A 1AZQA 5H1SE 4LF5Q 1RL2A 1KXLA 1U4MA 2XRQD 1N33L 2NN6G 3EROA 3G48A 2WB1B 4DV2Q 4BA1I 4A3KG 4A3IG 4Y52H 2IY5B 2F0KA 1JB7A 2ZTCA 2C35B 1I4PA 3PCOB 3Q0AA 3MEHA 3LWEA 1UUPA 5CMDA 1BO0A 3T4AC 1Q82C 5A35A 3K5OA 3OW2A 5M5WH 3HOYG 5AFWA 2EY5A 1QNUA 1TWFB 1STBA 1LTBD 3TP7A 3NQIA 3FVQA 1XNQL 3J7A5 4QF4A 3A55A 3RLFA 1CQVA 1F2ZA 3Q24A 3TS0A 4LF9Q 3F1ZA 1TQOA 1KRTA 2JA8G 4UPAA 5BR8Q 2MNAA 3CCLA 1G291 3I55A 3KFUA 1ICFB 2FMCA 1V9PA 4HIMA 1K3BC 4A3JH 3HOUH 3OOCA 1SNOA 4U673 3GO5A 4NXML 2B2YA 3PUWA 3M4OH 3K57A 2JSOA 1FGUA 1NSNS 4IPCA 4A3LG 2NVXB 1JOKA 3S1RB 1YJNA 4X64L 1QVFA 3T56B 3I4NG 3RMHA 5BN3A 4CJ0B 1R4PB 4RFBA 3F2BA 3CCEA 4DV3Q 3OSOA 4NXNQ 3H3VH 4XIGS 1X3GA 1EWCA 3HOWB 1GHKA 2R93B 2RHQB 1G2SA 2JEBI 4HJAA 3H0GB 3PMFA 3UE0A 4Y7NH 1PLFA 4DR7L 2B63B 3CF5A 4MTKA 3CC2A 1EIHA 5J22A 3TZUA 3Q23A 2VNUD 1W6KA 2HCCA 3K7UC 1LTGD 2GN5A 4FXGC 4A3IH 1AE2A 3NELA 1E2ZA 1GVPA 2NN6H 3I70A 1CKMA 3K5MA 4ZAIA 1ENAA 1PRTB 4TSSA 4TKOB 2F0QA 2NVYH 4A4IA 4P75A 1SYDA 3QOJA 1KL9A 4JBJA 2RSNA 4DAYA 5FK9C 4RKLA 2F0EA 4FYDA 4X62L 1LYLA 2CKZB 2OWOA 4RHSA 3ERQA 1TWGB 3I4MB 1D7QA 1IL8A 3OWFA 4CDFC 2MO0A 4J15A 1VMPA 4MZ9A 1FL0A 4GS3A 2EPBA 4BY1B 3DEOA 5GAEC 4BWGB 2O4XA 2DN8A 3MXNB 5FO7B 1K0SA 4L6TB 1SE8A 5CR3A 1YITA 1VQKA 4PNYA 2EYLA 3TP5A 1KDCA 1S72A 2A68D 4P71A 3FRPB 4C3IH 2G9DA 3NSWA 5M5WB 4A3GB 4POFA 5T1GA 1TWFH 1HPCA 1TS4A 2E5LQ 1N9WA 2UUAQ 4DV3L 1LT3D 1O7YA 3M4YA 1BCPC 4B3SL 3DLLA 5ELBA 1VQMA 1XMQQ 2MGSA 2OTJA 3ND8A 3J81j 4CKBA 1PXUA 1SMXA 1QE6A 1C4QA 4DFAA 4QIWB 3GTLB 2LS01 4A3JB 3HOUB 4OWWB 2JA6H 3BVZA 2UU9L 2EZVA 3DWQA 4JI1Q 4DR2Q 4X6AH 4UY8C 5BR8L 3MXNA 1SYEA 5I6YA 5EPKA 3TREA 1ENCA 3PUVA 1EQTA 1RJTA 4I7AA 2JA7H 3NK9A 4R4CA 4YCVA 1KDAA 1MJCA 1N36L 3K5NA 1YVCA 5J3BA 2AKWB 3KDFB 4Y7NB 3KF8A 1L1OC 3LWUA 1ICWA 2M00A 4AYBE 2H1EA 4ZQ3A 3PUZA 1CA5A 3CCRA 4AQYL 4A3BH 4ALPA 5LL6X 3URYA 3QIAA 1SROA 3OIPA 2PI2E 1WTHA 4HSPA 3I90A 4AYBG 5JJZA 2JA8H 4KJOA 3KF6A 2KQ3A 5K36G 1ASYA 4B3TL 5FLXE 3M4QA 4KN4C 4BBSH 1K0RA 4IUPA 4H0LC 1OXSC 3CD6A 4C1NI 2UXCL 1X3FA 1NJIC 2IL8A 1T5EA 1WCMG 3F8TA 3TQYA 1I4HA 4BY7H 2BOSA 3A74A 5COYA 1C0AA 3NBHB 3UDXA 1YJ9A 3NXWA 3KJOA 1EU3A 1Y1WB 1EYCA 2Z6KA 3GP7A 2F0PA 3W1BA 1HJPA 5K5PA 1H9JA 1HHVA 1YIJA 3ULJA 2UUBL 4X66L 1A0IA 5KYIA 5IYBH 1PH9A 3RR5A 5LMNW 2LXJA 3BDOA 2R7FA 3C3LA 3T51B 4BA2I 2HCIA 1A6XA 3QG1A 5C4JB 3EVQA 4UDUC 3S15H 5JPNC 1HFGA 2K5NA 4A3MH 4K0KQ 4EVOA 3TRZA 4GOPB 2B2UA 4CGYB 3CCUA 1LT6D 1QCBD 2WKCA 4JCVE 3HOVG 4LUOA 5C0XJ 1TWCB 3T1YQ 1KD1C 4HJ8A 4KKTA 1VQIA 4IUVA 1SAPA 1MSGA 1HR0Q 4ME3A 1RHPA 3M4PA 4EGVA 3L9AX 2PNHA 2MJ8A 2I07B 5CV5A 1OXVA 2K5DA 4AQYQ 2BH2A 2CFMA 3MHBA 4DNTB 3JAML 1TU2B 2QGQA 3R2TA 2K33A 1KLGD 2XRSD 4DR4L 1JWSD 4JBMA 4KTAA 1E1OA 2KECA 2OXPA 2K1BA 4IUUA 3EJIA 2K14A 1Y1VG 4B3TQ 1EQRA 3J81L 5CV8A 2JA5G 1D8LA 1HTPA 3O13A 1Q1BA 3P7JA 5C3XA 1GM5A 1BDOA 1EUJA 2GVAA 1E7ZA 4DR5L 3CPWA 1QILA 4GNXB 2EJGC 2RF4A 2R92B 3B6YA 3TMEA 3DUZA 1SSOA 4OX9Q 3K7AH 4QUFA 5DM63 4LF4Q 1B9NA 5IY0A 2K5HA 3CRKC 3HOZB 1VQLA 3H0GH 4KI0A 3HS0C 3J7ZC 1VQOA 3I72A 3D6CA 3F2UA 4BBRG 5LMNL 4M1UB 4JI8L 3HGBA 5HURA 1JB3A 1VQNA 3D31A 3IL8A 1PFSA 1WTWA 1VQ5A 4XQJA 1NY4A 3VR5A 1IL2A 1DCZA 3CQZH 1FJGQ 1L0YB 2TMPA 3TBIB 1CA6A 1O80A 2ZT9C 3E0JA 5M3MB 4AIMA 3T1YL 3NENA 2A74C 4O0AA 4C56C 1Z6HA 5D14A 1X55A 1VCIA 5IIFA 1UNSA 2K05A 2KHSA 1OXXK 4C3HB 1J6QA 1IHZA 2KHJA 5GAGC 4U68A 2AUKA 2UXCQ 3NBIA 1KC8C 1EY6A 2EYPA 4LK1C 1PH5A 4OIJA 2HUGA 4DK3C 4DKAC 3GTJB 3J81i 1AH9A 2KJXA 4PMWA 5C44B 1UE1A 1XX8A 3GV3A 3PUXA 1K83H 1WCMH 3CU7A 4KKUA 3F2DA 4RCOA 1NBWA 3BVMA 3KBXA 5CC4A 2IPKD 3J81c 3CCJA 2KVMA 4HSVA 5M5YH 1LTLA 2ZXRA 3J80i 4YHHL 1JICA 2F0DA 1YJWA 2F3VA 1DZ1A 4A3GH 4K6LA 5IYCH 3T1HL 1BF4A 1JJGA 1R9TB 1CSPA 1XMQL 4NDXA 5CV6A 3K81C 4JI5Q 4GLXA 4BS9A 3PF5A 1N34Q 4A3BG 3MC0B 1WYDA 2K6AA 4QCLA 2RSOA 2KEDA 2F0NA 3PGZA 4DK6C 3G7LA 1TS5A 3TP8A 3BZCA 4G7HC 3GTQH 1SDFA 4C3JB 1A3VA 3S1MH 4A3EG 4K2LA 1AN8A 1XPUA 3I8ZA 2B8FA 5FOBB 1RIPA 2PQAB 1EYAA 1NTGA 2Q2UA 4EQNA 5EBDA 3PIP3 4OGQC 5JEAJ 3A56A 1HNXL 4L8JA 4APVA 1STEA 4HR7B 4HN7A 3CCSA 5IGEA 1Y14B 4FF1A 5ELEA 1N36Q 2B29A 1TWAH 2I0QA 2NVTH 4C2MH 5G3LD 2O5JC 1A2TA 1STNA 1BCPB 2WAQG 2TSSA 4K2KA 3MAQA 1SFOH 5KNBA 1QG7A 1TVXA 4A3FB 2R6GA 2DY8A 1NMGA 3U4VA 1NCVA 2G5DA 2JA5B 1WD1A 2ZTEA 3PIOA 2QDLA 4PZ8A 4V0BA 3GTMB 1DOLA
chains in the Genus database with same CATH topology
2L1BA 4HCSA 4C3IG 5EKLA 1AZPA 1CZGA 2WP8J 1WTQA 5E1FA 2PMZB 4H7BA 1R4QB 1KDBA 1PTOD 1Z7TA 4LMQD 3VR2A 2E2DC 5CBEE 1DOKA 2EJFC 2A69C 2EOTA 4QUCA 3DHQA 1XYIA 3HRZC 2Z8LA 3GTKB 2B2WA 3VYTA 2C5CA 4KN7C 2A6ED 1PRTC 2DNEA 4BBSB 5EKKA 5CV7A 1ONLA 4K6DA 4G4KA 1F9QA 5IGFA 4ID6A 4S3SA 1V8QA 4OIKA 2Z4HA 3S2DB 2F4IA 1PYWD 2VB3X 2XN9C 1O78A 3NUCA 3NTKA 1SNCA 2A68C 3S1MB 1Q90A 2AUJD 4PMCA 5J39A 2WACA 4FP5D 1F9RA 3J7AV 1Y8NB 1JE4A 4J1MA 1FR3A 1TY2A 1PTOC 1BCPD 4K14A 2F0IA 1CQFA 1SNPA 1GUWA 2XVSA 1U4LA 2NZ1D 3X3MA 5BN5A 1EZ8A 3A7AB 1H9RA 1SXTA 4FNFA 2LFNA 1PTOH 1B1ZA 2NBFA 3R3OA 4P2CB 3D8GA 2NB0A 2JA6B 5E4XA 2F1MA 2BE5D 2F0GA 3D6WA 4O1NA 4K5VA 4OO1I 4DGZA 2KOLA 4I7ZC 2A69D 2WV6D 2EY6A 4IFDH 5IT9L 5CGKA 2NYZD 5IT9E 1O7ZA 3S1QB 1EQVA 1B44D 4KV6A 4HAEA 2J4XA 2GA4B 1W6JA 1ENFA 1TY0A 2G9HD 5NUCA 2RDHA 3MFGA 3ONAB 2NTSA 4DNRB 1TWHB 2EY2A 4XYOA 4K5WA 1PZJD 1E0BA 1S5BD 2JA7B 2QDBA 3J7AF 2L12A 1XTCD 5EJWA 1X32A 3VA7A 1DYQA 3DM1A 5JEAG 2IJ0A 5KRUA 4K5XA 1VMCA 2A5HA 2A73B 4KD3A 4X3UA 1I6VC 4O42A 4A3BB 3BVGA 4RGOS 5LL6S 5ELDA 2WIIB 2PQEA 3FMCA 1IYVA 1JQYD 2B8GA 1AFPA 2X6LA 3DWPA 5M9OA 1STYA 4OL7A 4ZKBB 1F2LA 2IX3A 4KHZA 1DXMA 1A2UA 4ZKCB 1Z47A 3MZ5A 2WKDA 3J7YW 5D65A 2LY7A 5EQ0A 4FF2A 2F0VA 3PO3B 1DJRD 2K5WA 1QNKA 3QJYA 2NWGA 4Q0FA 1EY8A 3D4RA 1U9RA 1H9SB 2KEEA 4L63B 5JVG3 3HG9A 2NVTB 3SDZA 3A8JE 4F7XA 1AEXA 4C3IB 4LJZC 1XXGA 4RGMA 4GZYC 4B9WA 2E76C 4ILWA 5C0XG 5DEHA 3U9SA 1Y69U 3HOYB 3IFTA 4ZUIA 2X6GA 4OHJA 3NPPA 1GUSA 3KLSX 5CBAE 1D2BA 4JK1C 4A3KB 1MD2D 4N9TA 3MA2B 1EWHA 1IKLA 2PZTA 3OIQA 4DXFA 4IQZA 3A8IE 4G7ZC 5C3EB 4KY5A 2Y0SB 3OPOA 2F0JA 1GUOA 5C6AA 1I4GA 1DONA 2AWOA 4IFDJ 1SBBB 3PIO3 2KCCA 1IW7D 1II3A 3P75A 1PRTF 1K83B 1BOSA 3NQTA 3D4WA 5EGTA 4KD4A 4EQPA 2A6EC 3M4OB 4E6IA 2EYJA 2E2IB 3SK5A 2QCPX 1K8MA 5DM73 4DAVA 3TZDA 5IODA 3BDLA 2MUYA 3FPPA 4ULLA 4OO1G 2M9VA 2JYOA 1HXYD 5I2XA 1V1PB 1H9SA 2K03A 2JE6I 5KNCA 3T16A 1TS2A 5JVH3 1QOHA 4ME5A 1SYCA 2RDGA 1F2MA 5IGBA 1SJED 4XTCS 1KNAA 3KBGA 3H91A 1Y1VB 5E4WC 1ESRA 1CFMA 4IALA 4J6HA 5FO9B 1KTKA 2AQ2B 1EY0A 4PMBA 1DM0B 3QB3A 1WTPA 3DEPA 4MHEA 2F0MA 2AWNA 4DXGA 3IKJA 3E5SA 1ET6A 1BXTA 1LTID 1ILQA 1STGA 4HCEA 5I4DA 2F0TA 4IN3A 1SEBD 4HMJA 1G8ZD 2RQXA 2EYOA 2ENBA 1EZ6A 2FFKB 4RCNA 1OO9B 3HP3A 4Q5VA 3CHBD 4DA2A 3AU7A 1J8IA 3OWEB 1JOOA 2RDFA 3D4DA 1D6EC 1B2TA 1I6HB 3WOFA 1WTVA 1PFMA 3GV6A 1MSHA 1S5DD 2FMMA 2PPBC 1EEFD 1A15A 2F3WA 1WD0A 2XWBB 1CM9A 4XT3B 5EBCA 1PTOF 3NTIA 1QB5D 2QKIC 2WAQB 2B2VA 1EEID 1LT4D 1WVLA 1WTRA 2SDFA 3H09A 4V190 1PMRA 2EY1A 1CK1A 4AYBB 4M8AA 3C2PA 1I50B 2Z4IA 4WFN3 2F0LA 2PW5A 4RGNA 5IGCA 2B2WC 4C3JG 1STAA 1WCMB 4FXKC 1EY4A 4TQUS 1SE2A 2O5IC 2L4NA 3PUYA 1X3QA 2QEJC 3DXJC 2F0HA 2XIWA 5JPMC 4KHVA 5I6WA 2IX0A 1BBXC 1LABA 4CBVA 2BE5C 3L3OC 1ML0D 1FGBD 2EYMA 1BQQT 2L9HA 1LV9A 1YNNC 1ZKOA 4RWSC 3NBHA 1ZXTA 2B39A 2E2HB 1EY7A 1EOTA 3W3AA 4CKCA 4JBWA 3VR3A 3R8BA 2A6HC 4C1NK 4F88A 2QILA 3VYRA 3L7ZC 2FHTA 1TIID 3HOVB 4IURA 3BS1A 1HTLD 1PTOB 2LMCB 4XXEA 4C2MB 5C0XI 3IFDA 3EFXD 1SE3A 3H94A 2BDNA 2OT2A 3AMUA 4IFDI 4IUQA 3QOLA 3SHLA 4R8NA 3P1HA 4IUNA 3QO2A 1LO5D 3A8KE 1GUTA 4CJ1B 2QF7A 3GTPB 5IOCA 4ABNA 1VDZA 2RKSA 3FEWX 5C4XB 2ICEC 1UEAB 3FKIB 1TKWB 5I2YA 3J80L 5LHY1 2NN6I 1H9MA 3I73A 3OMCA 1B50A 3A54A 1B3AA 1AW7A 5C5LA 1Q3LA 3NWTA 3MVVA 2BA1A 1ZYRD 1D1IA 3GTGB 1OXUA 3C1EA 1KABA 3ZYYX 2J7ZA 5ELCA 1G6ZA 4J8QA 3RZDB 1E2VA 5JOBA 1D1KA 2F03A 2VXWA 2K32A 1PZID 2ID0A 4RA8A 3C1FA 1SMYD 2AQ1B 1I3QB 1KLUD 3SXHA 5EKIA 4G57A 1BCPF 1WTOA 5C4ZA 1UAPA 1CTMA 2CQAA 5CV9A 1CHQD 1BNZA 2EE1A 3TDQA 3BDCA 4KJNA 3H6MA 3BYTB 2XNAC 1B9MA 2O2LD 3N6RA 4A93B 5KNDA 4CHTB 1FYCA 3I4LA 2D5DA 1FNUA 4RHRA 4EQOA 5C4HA 4F8MA 2KUMA 4NKLA 1C8CA 5I9PA 3S2HB 4BBRB 4ZK9B 2F0FA 1BR9A 1QWYA 2FJ2A 4F87A 4NP5A 3T53B 2BA0A 4DAPA 2OEOA 3EQLC 5K36H 5J1ZA 1JWUD 3JAME 3HZXA 4ZRZA 1I4QA 1G91A 1AP0A 2D2CC 1IW7C 5FKAC 5M3FB 1NUCA 2F0UA 5D3DA 5DNFA 1X3PA 3J81E 3HKZB 4I65A 1Y8PB 1V1PA 2R61A 4KY6A 4Z9CB 2XWJB 1F9SA 1T5XD 1MBYA 3MFYA 2NUCA 3HEJA 1L0XB 2YYZA 3MXUA 4ZYSA 2LKVA 2BDOA 1WTXA 1PDQA 1SJHD 2K01A 3SK6A 1QJOA 3R2IA 3KUPA 1KAAA 3S16B 3MTSA 1ILPA 3I3CA 1F77A 1LLRD 5FLXL 3E6ZX 3N52A 2R7ZB 4K8IA 3I4NB 3NE5B 4IFDG 1RD9D 2MPMA 3QWNA 1LTTD 5DAUA 4LAAA 4NW2A 3CKIB 1F2YA 1SNDA 3H3VC 4G7OC 2NVYB 1S5ED 1VF7A 5M5XB 2CW0C 1EL0A 3VR4A 2A6HD 2AQ3B 2NTTA 2DY7A 5C0XH 4X3TA 2RBMA 4YIJA 2HQEA 1FNWA 1RTOA 2SOBA 1F9PA 3S1NB 4DK1A 2H4OA 1YNND 3NTHA 5KGUA 1ZEQX 3U9OA 5T1IA 1RCVD 2L11A 1RF2D 1HQMC 4PQXA 3K58A 4CKEA 1D5ZC 1GXDC 1SE4A 1TT2A 2EDGA 2EJMA 4ZUJA 1ESFA 1M4VA 3RZOB 5F2DA 3K59A 4HEDA 4DN4M 2JEAI 3MXGA 3NP8A 4ZLTF 4DU9A 3UI2A 1PZKD 3Q6SA 3LX0A 2ZXOA 2PCFB 4HMIA 1OXTA 2Q8IB 1EY9A 4WRDA 3SEBA 1JC7A 4PV1C 4X3SA 1Y8OB 2E75C 1V1OA 3LNNA 5EPJA 1JOQA 3M7NA 2MHVA 1GJXA 3TSSA 3SVMA 2JA8B 3KLSA 5CYUA 1LTAD 3SK4A 4K8JA 3DWAA 2X69A 1PFBA 4RAUC 1J9OA 5JEAH 2K7VA 4KMUC 2JP1A 1NR4A 2B2TA 4CJ2C 1GUNA 3GTOB 1ZYRC 1G2TA 1LTSD 5C3WA 3WOEA 2ICIA 1HA6A 3V2TA 4OO1H 5I9OA 4WORA 2R3ZA 1C48A 1GUGA 1PFNA 1EIGA 3T13A 3S14B 1FD7D 1K8OA 5JAVA 2J0TD 3PO2B 4IZ8A 4BY7B 4DK0A 4XT1B 1RODA 2D9UA 4A3DB 4MN3A 1CZWA 5KYLA 4FO2A 3SK8A 1STHA 2VUMB 2IW3A 1H9KA 5IGGA 3K5LA 2KCNA 3OHXC 2CVRA 3AB9A 2I46A 3GQBA 2SNSA 1Q1EA 4QMGA 1CT1D 3BZDB 1M8AA 4H13C 2ZXPA 2EXZA 5CORA 2PNRC 1SFOB 4FVMA 3I91A 1FNVA 3M3YB 5IGDA 4R9WA 2Z1CA 2YU9B 1ET9A 3BYYB 2D62A 1O7LA 2EYHA 3W2DA 4R8IA 2SEBD 4XQNA 2C9OA 3S9WA 2RVLA 2VB2X 2M2LA 1HFNA 1CI3M 3VA5A 3IAYA 2E74C 2CW0D 4QB4A 2MP1A 1E2WA 3P20A 5HGTA 1JWMD 2F0WA 5CV4A 5EPLA 2PW7A 5M5YB 1SMYC 2RA4A 1I4XA 2EYFA 1JORA 2V4DA 4TRDA 3TN2A 4XYQA 2DNCA 2K04A 1A3TA 1EYDA 1B53A 1RDPD 3GTQB 1Q8IA 2IT1A 5G3LF 5FO8B 3R93A 4DF7A 2F0SA 2HDMA 2NVQB 3S15B 1NR2A 4H44C 4A3MB 1RKNA 2Q8RE 4X3KA 2IWHA 1CHPD 2PZWA 4KK7A 5D3IB 3D3RA 3FDTA 2EVBA 3ITPA 1KNEA 3V05A 1BUVT 4A3IB 3CRLC 4FF4A 3OMGA 1U4PA 5ISRA 2K5QA 3Q22A 2B2YC 2L5TA 1B4OA 2HDLA 1XWEA 2CHBD 3C46A 1GOZA 3EA6A 3KLRA 1SYBA 4WJWA 1SNQA 1DD2A 4RH6A 3FPUB 3TP6A 4UAIA 3OW7A 3G6JB 1D5MC 1RTNA 1JCKB 3K7AB 1Q12A 2L0CA 1JR0D 1LTRD 2IX1A 2B2VC 1HA5A 1GHJA 4IUTA 3S17B 1D5XC 1EY5A 1LACA 1MI2A 1HCZA 4RGTA 4FXDA 3ND9A 4KKSA 3RD4A 3MWYW 3MXPA 5A2QL 2K28A 1HUMA 3K6OA 1SYFA 2N55A 3CQZB 1S5CD 2PZUA 2KA7A 3HOXB 1YNJD 1EFID 2XSCA 1SYGA 2BCOA 3A7LA 3VR6A 1PRTD 3VYUA 2FINB 3WDNA 2N88A 4RKBA 2WINB 3J80E 3SR1A 2OF1A 2JXMB 4XQQA 4MIUA 5BN4A 1A3UA 4FF3A 1TS3A 1I4RA 4B08A 4NMZA 4KY7A 3GD7A 1U4RA 1HUNA 1NAPA 3K0YA 3PV0A 5TSSA 1S4ZA 2PYKA 1DOMA 5KIXA 2L55A 4XDXA 3DMUA 1HRJA 3X3NA 3M85A 1SNMA 5A2QE 3SE0A 4B9XA 2B2UC 4HTHA 1S5FD 4N9PA 2B2TC 3RUZA 4ODGA 2E2JB 3VYSA 3M7GA 5KEEA 3KK7A 1IYUA 4C3HG 1MGSA 1LT5D 3NWSA 3NHHA 2Q8TA 2SNMA 1VF5C 1TWAB 2F0OA 5E3FA 1TR5A 5ELFA 3BG3A 1YNJC 1HQRD 1IKMA 2PO4A 5C5MA 1V43A 4A3EB 3V96A 1EU4A 1AZQA 1U4MA 2XRQD 2NN6G 3EROA 2WB1B 4BA1I 2F0KA 1I4PA 3Q0AA 3MEHA 3LWEA 1UUPA 5CMDA 1BO0A 3T4AC 5A35A 3K5OA 5AFWA 2EY5A 1QNUA 1TWFB 1STBA 1LTBD 3TP7A 3NQIA 3FVQA 4QF4A 3A55A 3RLFA 1CQVA 1F2ZA 3Q24A 1TQOA 1G291 2FMCA 3OOCA 1SNOA 4U673 3GO5A 2B2YA 3PUWA 3K57A 2JSOA 1NSNS 2NVXB 1JOKA 3S1RB 3T56B 3RMHA 5BN3A 4CJ0B 1R4PB 4RFBA 3OSOA 4XIGS 1EWCA 3HOWB 1GHKA 2R93B 1G2SA 2JEBI 3H0GB 3PMFA 1PLFA 2B63B 1EIHA 5J22A 3TZUA 3Q23A 2VNUD 1W6KA 2HCCA 1LTGD 4FXGC 1E2ZA 2NN6H 3I70A 3K5MA 4ZAIA 1ENAA 1PRTB 4TSSA 4TKOB 2F0QA 1SYDA 3QOJA 2RSNA 4DAYA 5FK9C 4RKLA 2F0EA 4FYDA 4RHSA 3ERQA 1TWGB 3I4MB 1IL8A 3OWFA 1VMPA 2EPBA 4BY1B 3DEOA 4BWGB 2O4XA 2DN8A 5FO7B 4L6TB 5CR3A 4PNYA 2EYLA 3TP5A 1KDCA 2A68D 3FRPB 5M5WB 2G9DA 3NSWA 4A3GB 5T1GA 1HPCA 1TS4A 1LT3D 1O7YA 3M4YA 1BCPC 5ELBA 2MGSA 3ND8A 4CKBA 1PXUA 1QE6A 1C4QA 4DFAA 4QIWB 3GTLB 2LS01 4A3JB 3HOUB 3BVZA 2EZVA 3DWQA 3MXNA 1SYEA 5I6YA 5EPKA 1ENCA 3PUVA 1EQTA 1RJTA 3NK9A 1KDAA 3K5NA 4Y7NB 3KF8A 3LWUA 1ICWA 2M00A 2H1EA 4ZQ3A 3PUZA 1CA5A 5LL6X 3URYA 3QIAA 3OIPA 4HSPA 3I90A 5JJZA 4KJOA 2KQ3A 5K36G 5FLXE 4KN4C 4IUPA 4H0LC 1OXSC 4C1NI 2IL8A 1T5EA 1I4HA 2BOSA 5COYA 3NXWA 1EU3A 1Y1WB 1EYCA 3GP7A 2F0PA 5K5PA 1H9JA 1HHVA 5KYIA 3BDOA 3C3LA 3T51B 4BA2I 2HCIA 1A6XA 3QG1A 5C4JB 3EVQA 4UDUC 5JPNC 1HFGA 4EVOA 2B2UA 4CGYB 1LT6D 1QCBD 2WKCA 5C0XJ 1TWCB 4KKTA 4IUVA 1SAPA 1MSGA 1RHPA 4EGVA 3L9AX 2MJ8A 2I07B 5CV5A 1OXVA 2K5DA 3MHBA 4DNTB 3JAML 1TU2B 3R2TA 2K33A 1KLGD 2XRSD 1JWSD 4KTAA 2KECA 2OXPA 2K1BA 3EJIA 4IUUA 3J81L 5CV8A 1HTPA 3O13A 1Q1BA 3P7JA 5C3XA 1BDOA 1QILA 2EJGC 2R92B 3TMEA 3DUZA 1SSOA 4QUFA 5DM63 1B9NA 3HOZB 3CRKC 4KI0A 3HS0C 3I72A 3D6CA 3F2UA 4M1UB 3HGBA 5HURA 1JB3A 3D31A 3IL8A 1WTWA 4XQJA 3VR5A 1DCZA 1L0YB 3TBIB 2TMPA 1CA6A 1O80A 2ZT9C 3E0JA 5M3MB 2A74C 4C56C 1Z6HA 5D14A 5IIFA 1VCIA 1UNSA 2K05A 2KHSA 1OXXK 4C3HB 1IHZA 4U68A 2AUKA 3NBIA 1EY6A 2EYPA 4LK1C 3GTJB 4OIJA 2HUGA 2KJXA 5C44B 4PMWA 1XX8A 3GV3A 3PUXA 3CU7A 4KKUA 4RCOA 3BVMA 3KBXA 5CC4A 2IPKD 2KVMA 4HSVA 2ZXRA 1JICA 2F0DA 1DZ1A 2F3VA 4K6LA 1BF4A 1R9TB 4NDXA 5CV6A 4BS9A 3MC0B 2K6AA 4QCLA 2RSOA 2KEDA 2F0NA 3G7LA 1TS5A 3TP8A 4G7HC 1SDFA 4C3JB 1A3VA 4K2LA 1AN8A 3I8ZA 2B8FA 5FOBB 1EYAA 4EQNA 5EBDA 3PIP3 4OGQC 5JEAJ 3A56A 4L8JA 1STEA 4HR7B 4HN7A 5IGEA 4FF1A 5ELEA 5G3LD 2O5JC 1A2TA 1STNA 1BCPB 2TSSA 4K2KA 3MAQA 5KNBA 1QG7A 4A3FB 1TVXA 2R6GA 2DY8A 1NCVA 2JA5B 1WD1A 4V0BA 3GTMB 1DOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTO A;  4ZKC B;  2L1B A;  3I3C A;  3SVM A;  2K05 A;  2Q8R E;  1WTV A;  1PFM A;  3N52 A;  5T1G A;  4HCS A;  1HHV A;  3GV6 A;  4X3K A;  5D65 A;  1AZP A;  1MSH A;  1O7Y A;  2X69 A;  1WTQ A;  1PFB A;  5E4X A;  4RAU C;  4U68 A;  2MPM A;  1U4R A;  1J9O A;  5EQ0 A;  1HUN A;  1BNZ A;  3FDT A;  2MGS A;  2EE1 A;  2FMM A;  2HCI A;  1NAP A;  2HUG A;  2JP1 A;  3D6W A;  4NW2 A;  4OIJ A;  1NR4 A;  2B2T A;  2FHT A;  1S4Z A;  1KNE A;  4CJ2 C;  4IUR A;  1DOM A;  1XX8 A;  3GV3 A;  1HFG A;  4XDX A;  4LMQ D;  1QNK A;  2KOL A;  1G2T A;  1QE6 A;  1HRJ A;  5CBE E;  2B2Y A;  2NWG A;  2B2U A;  3TZD A;  3IFD A;  1DOK A;  1A15 A;  1WD0 A;  1EL0 A;  2EOT A;  1CM9 A;  2JYO A;  4XT3 B;  1U4P A;  3KBX A;  4QUC A;  2BDN A;  2NYZ D;  2B2U C;  4IUQ A;  2B2Y C;  4IUV A;  1SAP A;  1B4O A;  1MSG A;  2DY7 A;  1O7Z A;  2HDL A;  1RHP A;  2KVM A;  4HSV A;  2KEE A;  2B2W A;  4X3T A;  4CJ0 B;  1JIC A;  1HA6 A;  2K03 A;  2MJ8 A;  1DZ1 A;  3QO2 A;  1RTO A;  2B2V A;  2B2T C;  2RVL A;  1F9P A;  4HAE A;  1WVL A;  1WTR A;  1BF4 A;  4CJ1 B;  2R3Z A;  2M2L A;  2SDF A;  1HFN A;  1PFN A;  1EIG A;  5EPK A;  2KUM A;  1EQT A;  1RJT A;  5T1I A;  1C8C A;  3FPU B;  2L11 A;  1G2S A;  1MGS A;  1F9Q A;  1PLF A;  4UAI A;  2KEC A;  3ONA B;  2MP1 A;  2K1B A;  4IUU A;  1RTN A;  4ZK9 B;  2FJ2 A;  1EIH A;  2RSO A;  1KNA A;  2KED A;  2Q8T A;  2HCC A;  3G7L A;  3H91 A;  4XT1 B;  1SDF A;  2B2V C;  5E4W C;  1ROD A;  4OIK A;  1ESR A;  4IUT A;  3P7J A;  4ZAI A;  1ICW A;  2B2W C;  2D9U A;  3I8Z A;  1MI2 A;  1E0B A;  2X6G A;  2H1E A;  1B50 A;  4MN3 A;  5EPL A;  1B3A A;  1CA5 A;  1IKM A;  2L12 A;  2RSN A;  5CBA E;  5EJW A;  4HED A;  1AP0 A;  1G91 A;  1X32 A;  1WTP A;  1Q3L A;  3DEP A;  3MWY W;  2L4N A;  4DN4 M;  4MHE A;  1SSO A;  2RA4 A;  4R8I A;  1X3Q A;  2K28 A;  3DM1 A;  1HUM A;  4ZLT F;  2XIW A;  1AZQ A;  4QUF A;  3I90 A;  5JJZ A;  1ILP A;  2N55 A;  3UI2 A;  1F9R A;  1U4M A;  1VMC A;  1IL8 A;  5DNF A;  1X3P A;  1BBX C;  2CVR A;  1JE4 A;  1ILQ A;  3TN2 A;  1IKL A;  3F2U A;  4X3U A;  1VMP A;  2K04 A;  4IUP A;  1ML0 D;  4O42 A;  3Q6S A;  2EPB A;  2J7Z A;  1G6Z A;  1B53 A;  1F9S A;  2FIN B;  2L9H A;  3DEO A;  1LV9 A;  2IL8 A;  2N88 A;  3LWE A;  3IL8 A;  1GUW A;  2FFK B;  1U4L A;  1M8A A;  1QG7 A;  1TVX A;  1BO0 A;  4RWS C;  2NZ1 D;  2VXW A;  2DY8 A;  5CMD A;  1WTW A;  1ZXT A;  1XYI A;  1NCV A;  1DON A;  4X3S A;  4RA8 A;  3HP3 A;  5COY A;  1PDQ A;  5COR A;  5AFW A;  2X6L A;  3R93 A;  2K01 A;  1WTX A;  2HDM A;  1WD1 A;  1CA6 A;  1J8I A;  1EOT A;  1O80 A;  5EPJ A;  4ZKB B;  1F2L A;  1DOL A;  3KUP A;  5D14 A;  3I91 A;  5EKI A;  4R9W A;  1NR2 A;  1B2T A;  3MTS A; 
#chains in the Genus database with same CATH topology
 2L1B A;  1X54 A;  4LNQ A;  1HR0 L;  1X56 A;  1PH6 A;  4HCS A;  4C3I G;  5EKL A;  5LMN Q;  1AZP A;  1CZG A;  2WP8 J;  2WB1 E;  4CDD C;  4DUZ Q;  3MEF A;  1WTQ A;  2VW9 A;  5EAY A;  5E1F A;  2PMZ B;  4JI5 L;  4H7B A;  4C3H H;  1ASZ A;  1R4Q B;  5FLM H;  1KDB A;  3HOZ G;  4DR4 Q;  1PTO D;  4JYA L;  1Z7T A;  3A0J A;  4LMQ D;  3VR2 A;  4YCU A;  2E2D C;  3DM3 A;  5CBE E;  2QEX A;  4A3G G;  1DOK A;  2EJF C;  2A69 C;  2EOT A;  3S17 H;  3UDI A;  4QUC A;  3CXC A;  3DHQ A;  2F3I A;  4JV5 Q;  1I5F A;  1XYI A;  3HRZ C;  2Z8L A;  3GTK B;  5FLX c;  2B2W A;  4X66 Q;  1EIY B;  3VYT A;  2C5C A;  4KN7 C;  2A6E D;  1PRT C;  2DNE A;  4BBS B;  5EKK A;  4BXX H;  4JVZ A;  2KEN A;  3H15 A;  5CV7 A;  4IPH A;  4DPG A;  1ONL A;  3RZD H;  4K6D A;  4G4K A;  1F9Q A;  5C4J H;  1L1O B;  5IGF A;  4ID6 A;  1YHB A;  3RLN A;  4S3S A;  1V8Q A;  4DAM A;  4OIK A;  4IOA A;  2Z4H A;  3S2D B;  2F4I A;  1PYW D;  2VB3 X;  2XN9 C;  1O78 A;  3NUC A;  2MQH A;  3NTK A;  1SNC A;  2A68 C;  3STB D;  3S1M B;  1Q90 A;  2AUJ D;  4PMC A;  1PH1 A;  5J39 A;  2WAC A;  4IJL A;  5ELN A;  4FP5 D;  1F9R A;  3J7A V;  1Y8N B;  1XNQ Q;  5C4X G;  1YEZ A;  1JE4 A;  3BU2 A;  2JN4 A;  4J1M A;  1FR3 A;  3EIV A;  4BBR H;  3HFZ B;  1TY2 A;  1PTO C;  1BCP D;  4K14 A;  2F0I A;  1CQF A;  1SNP A;  1G6P A;  4A76 A;  1GUW A;  1X9N A;  2XVS A;  1U4L A;  5GAD C;  4ZCK A;  1A62 A;  1VQA A;  4A3J G;  2NZ1 D;  3HOU G;  3X3M A;  5BN5 A;  1SN8 A;  1EZ8 A;  3A7A B;  2HHH L;  3I2Z A;  1H9R A;  1SXT A;  4FNF A;  1HNW L;  1YZ6 A;  2LFN A;  1PTO H;  1B1Z A;  2NBF A;  3AQQ A;  3R3O A;  4P2C B;  3D8G A;  3LGJ A;  3BZK A;  2F4V L;  2NB0 A;  3GTM H;  4JI8 Q;  1PH3 A;  2GVB A;  2JA6 B;  5E4X A;  2F1M A;  4R4T A;  1PYB A;  2BE5 D;  2F0G A;  3D6W A;  4O1N A;  2ZJQ A;  1VQE A;  4K5V A;  4OO1 I;  4DGZ A;  2KOL A;  4I7Z C;  2A69 D;  2WV6 D;  2EY6 A;  4IFD H;  5IT9 L;  5CGK A;  4N8F A;  2NYZ D;  5IT9 E;  1O7Z A;  3S1Q B;  2N78 A;  2ES2 A;  1EQV A;  1B44 D;  1Q8K A;  4KV6 A;  4R4O A;  4HAE A;  2J4X A;  2GA4 B;  1W6J A;  1ENF A;  1TY0 A;  2G9H D;  5NUC A;  3FP9 A;  2RDH A;  3MFG A;  5M3F G;  4JYA Q;  3ONA B;  2NTS A;  4DNR B;  1TWH B;  3RN5 A;  2EY2 A;  4XYO A;  5AJ3 Q;  4K5W A;  2KHI A;  3S16 H;  4YHH Q;  1PZJ D;  1E0B A;  1S5B D;  4X65 L;  2JA7 B;  4CDE C;  1DGS A;  2QDB A;  3J7A F;  1VQC A;  2IHF A;  2L12 A;  4PZ7 A;  1XTC D;  5EJW A;  1X32 A;  3KF8 B;  3VA7 A;  3HOX H;  3UDF A;  1DYQ A;  4EX5 A;  3DM1 A;  5JEA G;  5IYC G;  2IJ0 A;  5KRU A;  4OWX B;  4K5X A;  1B7Y B;  1VMC A;  2A5H A;  2A73 B;  4KD3 A;  4X3U A;  2E5L L;  4QL5 A;  1I6V C;  4O42 A;  4A3B B;  3BVG A;  4LF7 L;  4RGO S;  5LL6 S;  4P72 A;  2CWP A;  5ELD A;  2WII B;  2PQE A;  3FMC A;  1K28 A;  1IYV A;  1JQY D;  2B8G A;  1AFP A;  2X6L A;  3DWP A;  5M9O A;  1STY A;  1HH2 P;  4OL7 A;  4ZKB B;  1F2L A;  2F52 A;  2IX3 A;  1IXR A;  1WI5 A;  4KHZ A;  1DXM A;  1A2U A;  4ZKC B;  1Z47 A;  2EXD A;  4IOC A;  3MZ5 A;  3Q8D A;  3K80 C;  5LMU Q;  3PIP A;  4OEM B;  2WKD A;  5D65 A;  3J7Y W;  5HGQ A;  2LY7 A;  5EQ0 A;  4FF2 A;  1GKH A;  3AFQ A;  2F0V A;  3PO3 B;  1DJR D;  4UP8 A;  4JI3 L;  4LFB Q;  2K5W A;  4DV6 L;  1QNK A;  3QJY A;  2NWG A;  2HHH Q;  4Q0F A;  1EY8 A;  3D4R A;  1U9R A;  4GN4 B;  5FJ8 H;  4DV4 L;  1H9S B;  3AEV A;  2AMC B;  3S2H H;  4JI4 L;  2KEE A;  2BH8 A;  4L63 B;  5IYD H;  2ASB A;  4DUZ L;  5JVG 3;  4OON A;  1VQD A;  3HG9 A;  2NVT B;  4BY1 G;  3SDZ A;  3A8J E;  4F7X A;  1NMF A;  1AEX A;  4C3I B;  4LJZ C;  1JJ2 A;  2ZM6 Q;  1XXG A;  4RGM A;  4GZY C;  2E8G A;  4B9W A;  3K8A A;  1V1Q A;  2E76 C;  4PZ6 A;  1P8L A;  2JA5 H;  4ILW A;  5C0X G;  5DEH A;  3U9S A;  1Y69 U;  4R4Q A;  4JI7 Q;  3HOY B;  3IFT A;  2UU9 Q;  4YWM A;  4ZUI A;  1BKB A;  2X6G A;  4OHJ A;  4HIK A;  3NPP A;  2UUC Q;  1GUS A;  3KLS X;  2XGT A;  2KBN A;  5CBA E;  1D2B A;  3I4M G;  1PHJ A;  4TVA B;  3G71 A;  4JK1 C;  4A3K B;  1MD2 D;  2HIV A;  2JA9 A;  4N9T A;  3MA2 B;  1EWH A;  1IKL A;  2PZT A;  3OIQ A;  2RHS B;  4DXF A;  4IQZ A;  3A8I E;  3HOV H;  4G7Z C;  3FKI H;  5C3E B;  4KY5 A;  5M3F H;  3UE1 A;  2Y0S B;  3OPO A;  2F0J A;  1GUO A;  5C6A A;  1I4G A;  1DON A;  2AWO A;  4IFD J;  4L5S A;  4LWC A;  1SBB B;  2KCC A;  3PIO 3;  3GTL H;  1IW7 D;  1II3 A;  1H95 A;  4DR1 Q;  3G6E A;  3P75 A;  5GQO A;  1PRT F;  3S14 H;  2D0P A;  1K83 B;  5IWA L;  3CME A;  1BOS A;  3NQT A;  5M5X H;  3D4W A;  3U4Z A;  2DJG C;  3WWV A;  5EGT A;  4KD4 A;  3T1H Q;  4EQP A;  2A6E C;  3EN2 A;  1U0L A;  3M4O B;  4E6I A;  2EYJ A;  2E2I B;  3SK5 A;  2QCP X;  2NVX H;  1K8M A;  1BBW A;  5DM7 3;  3A5U A;  4DAV A;  3TZD A;  5IOD A;  3BDL A;  2MUY A;  3FPP A;  4ULL A;  2D0O A;  2M9V A;  4OO1 G;  1HNW Q;  2JYO A;  4DUY L;  5AJ3 L;  1HXY D;  2VUM H;  5I2X A;  3AFP A;  3STB C;  1V1P B;  4JBK A;  1H9S A;  4GKK Q;  3GTJ H;  2K03 A;  2JE6 I;  5KNC A;  3T16 A;  1TS2 A;  2UXD L;  1VS0 A;  5JVH 3;  1QOH A;  2PMZ E;  4ME5 A;  1SYC A;  4LW1 A;  2RDG A;  3GTG H;  2WB1 G;  1F2M A;  5IGB A;  1SJE D;  4XTC S;  1CUK A;  1KNA A;  1IBK Q;  3KBG A;  3H91 A;  1GO3 E;  1Y1V B;  1K9M C;  5E4W C;  1YBY A;  1ESR A;  1CFM A;  4IAL A;  4J6H A;  5FO9 B;  1KTK A;  3M3Y H;  2AQ2 B;  1EY0 A;  4DV1 Q;  1IZ6 A;  2YU9 H;  4PMB A;  4DAY B;  3HOY H;  1DM0 B;  2JA7 G;  3QB3 A;  1WTP A;  3DEP A;  1E3P A;  4MHE A;  2F0M A;  2AWN A;  4DXG A;  3IKJ A;  3E5S A;  1ET6 A;  1BXT A;  1HNZ L;  1LTI D;  2DGY A;  3KF6 B;  1ILQ A;  1STG A;  4HCE A;  5I4D A;  3RZO H;  3F2C A;  4WJ4 A;  2F0T A;  4IN3 A;  1SEB D;  4HMJ A;  1G8Z D;  1KHI A;  2RQX A;  2EYO A;  4CDC C;  2ENB A;  1EZ6 A;  4DR5 Q;  2FFK B;  4RCN A;  2DJF C;  1OO9 B;  3HP3 A;  1N32 Q;  4Q5V A;  3CHB D;  4A93 H;  4DA2 A;  3AU7 A;  1J8I A;  4BXX G;  5C3E H;  3OWE B;  1JOO A;  2RDF A;  1FVI A;  3D4D A;  5GAH C;  1D6E C;  1PYS B;  1NNX A;  1B2T A;  1I6H B;  3WOF A;  3CCQ A;  1WTV A;  1PFM A;  1XTD A;  1XMO L;  3GV6 A;  1HZC A;  1MSH A;  1S5D D;  2FMM A;  1U5K A;  2PPB C;  3BJU A;  2MO1 A;  1EEF D;  1WJJ A;  4O2D A;  4MNO A;  1A15 A;  2F3W A;  3GDE A;  1WD0 A;  2XWB B;  1XPO A;  4OWT B;  1CM9 A;  4XT3 B;  5EBC A;  1PTO F;  3NTI A;  2VL6 A;  1QB5 D;  2QKI C;  2WAQ B;  2B2V A;  3J80 c;  1EEI D;  1LT4 D;  5C3E G;  1WVL A;  1WTR A;  3GTO H;  1PH8 A;  2SDF A;  3H09 A;  3S2D H;  4V19 0;  1PMR A;  1SRU A;  1KAW A;  4A3D H;  4X62 Q;  4JI0 Q;  3FHW A;  3SGI A;  2EY1 A;  1CK1 A;  2P5Z X;  4AYB B;  4M8A A;  3HKZ G;  4OXP A;  3C2P A;  1VQ7 A;  3PO3 H;  3GTK H;  4GN3 B;  1I50 B;  2Y0S G;  2Z4I A;  3UDG A;  4WFN 3;  2F0L A;  2PW5 A;  4FDB A;  2ZTD A;  4RGN A;  3JAM i;  5IGC A;  3W5O A;  4YWL A;  4LFC L;  1E24 A;  2B2W C;  4GKK L;  4C3J G;  1STA A;  1WCM B;  4FXK C;  3PO2 H;  1EY4 A;  4TQU S;  1SE2 A;  2O5I C;  2N3S A;  4A3C H;  2L4N A;  1Q86 C;  3PUY A;  1X3Q A;  2QEJ C;  3DXJ C;  4DR1 L;  2F0H A;  2XIW A;  1UEB A;  3ICE A;  5JPM C;  4KHV A;  5I6W A;  2IX0 A;  1BBX C;  3I4N H;  1LAB A;  1XMO Q;  4CBV A;  2BE5 C;  3L3O C;  4UP9 A;  1QZG A;  1R9T H;  1ML0 D;  1FGB D;  1WFQ A;  5IT9 c;  1UWV A;  4JI7 L;  4B3S Q;  2EYM A;  1BQQ T;  2L9H A;  1LV9 A;  1YNN C;  2PI2 A;  1ZKO A;  4RWS C;  1YNX A;  2AHO B;  4P73 A;  3NBH A;  1ZXT A;  2B39 A;  2E2H B;  4R4I A;  1EY7 A;  1M1K C;  1EOT A;  3W3A A;  2Y0S E;  4JI2 Q;  4CKC A;  4JBW A;  4JC0 A;  4OEL B;  1S3O A;  2NZO A;  3VR3 A;  3R8B A;  2A6H C;  1YHA A;  4C1N K;  4F88 A;  2QIL A;  4MTN A;  4DNI A;  1C7Y A;  3VYR A;  3E3X A;  1T9H A;  1L0W A;  2H5X A;  1HR0 W;  3L7Z C;  3JC6 6;  3S1Q H;  2FHT A;  1TII D;  3HOV B;  4IUR A;  3BS1 A;  1HTL D;  1PTO B;  2LMC B;  4XXE A;  4C2M B;  5C0X I;  3IFD A;  4C3J H;  3EFX D;  1SE3 A;  3H94 A;  2BDN A;  2OT2 A;  3AMU A;  5IWA Q;  3K0X A;  4IFD I;  4IUQ A;  3QOL A;  4A3K H;  3SHL A;  3ULP A;  4R8N A;  3P1H A;  4LFA L;  4IUN A;  1JMC A;  2JK8 A;  4DV1 L;  2UUA L;  3QO2 A;  1LO5 D;  3A8K E;  1GUT A;  3S1R H;  4CJ1 B;  2QF7 A;  3GTP B;  5IOC A;  1VQ4 A;  4ABN A;  4A3D G;  1VDZ A;  2N8N A;  2RKS A;  3FEW X;  5C4X B;  2ICE C;  1UEA B;  4B3R L;  1CKN B;  2IHE A;  3FKI B;  3FKI G;  1TKW B;  5I2Y A;  3J80 L;  1O7I A;  5LHY 1;  2NN6 I;  2ZJR A;  1H9M A;  2FXQ A;  1P16 A;  2R92 H;  2B63 H;  3I73 A;  4A3F H;  3OMC A;  4DR2 L;  1B50 A;  3A54 A;  1B3A A;  1AW7 A;  5C5L A;  3HOZ H;  2ATW A;  1Q3L A;  3NWT A;  3MVV A;  2KCM A;  1K73 C;  2BA1 A;  1ZYR D;  1PH7 A;  1D1I A;  3GTG B;  2E2I H;  1OXU A;  2UUB Q;  2Q2H A;  3C1E A;  1KAB A;  3ZYY X;  2J7Z A;  5ELC A;  1G6Z A;  3A5Z B;  3HKS A;  3CPF A;  4J8Q A;  1YHQ A;  5L37 A;  3RZD B;  1E2V A;  1Y1V H;  4LFC Q;  2NZH A;  5JOB A;  2OTL A;  1D1K A;  4GLV B;  2F03 A;  4HJ7 A;  2VXW A;  2K32 A;  4R1J A;  1PZI D;  2ID0 A;  4RA8 A;  4BY1 H;  3C1F A;  1SMY D;  2AQ1 B;  1I3Q B;  1QVC A;  1W2B A;  1KLU D;  3SXH A;  3E0E A;  5EKI A;  1SR3 A;  1B70 B;  4G57 A;  1BCP F;  1WTO A;  5C4Z A;  1UAP A;  2E2H H;  4JI4 Q;  1CTM A;  2CQA A;  5CV9 A;  1CHQ D;  5C44 G;  4QJF A;  1BNZ A;  2NVQ H;  4A3M G;  2EE1 A;  3TDQ A;  3BDC A;  4KJN A;  2ZM6 L;  2EQS A;  3H6M A;  3BYT B;  1I94 Q;  4LF6 L;  2PQA A;  2XNA C;  1B9M A;  4IPD A;  2O2L D;  3N6R A;  4A93 B;  4A3E H;  2YTV A;  5KND A;  4CHT B;  2KCT A;  1FYC A;  1EQQ A;  3I56 A;  3G4S A;  3I4L A;  2D5D A;  1FNU A;  1VQB A;  4RHR A;  1VQG A;  4EQO A;  1N8R C;  4N8X 1;  5C4H A;  4F8M A;  4L5T A;  3IRB A;  2KUM A;  5IP9 H;  4NKL A;  1C8C A;  4BY7 G;  4LF5 L;  4LF4 L;  5I9P A;  3S2H B;  4BBR B;  1MHW C;  4ZK9 B;  2F0F A;  1BR9 A;  1QWY A;  2FJ2 A;  3KLW A;  4F87 A;  4KHP Q;  4NP5 A;  1K8G A;  3RN2 A;  3T53 B;  2BA0 A;  4DAP A;  4BBS G;  2VUM G;  2OEO A;  3KDF A;  3EQL C;  4JI6 L;  5K36 H;  5J1Z A;  1JWU D;  3JAM E;  3HZX A;  4ZRZ A;  1X6O A;  1I4Q A;  1G91 A;  1AP0 A;  4DV5 L;  1UE7 A;  2D2C C;  1IW7 C;  3E9I A;  5FKA C;  5M3F B;  1NUC A;  2F0U A;  3NEM A;  5D3D A;  2LXK A;  5DNF A;  1X3P A;  3J81 E;  3HKZ B;  4I65 A;  5LMU L;  4QY7 A;  1Y8P B;  1V1P A;  2R61 A;  2YTY A;  4KY6 A;  4Z9C B;  2XWJ B;  1F9S A;  1T5X D;  1MBY A;  3OTO Q;  3MFY A;  1IBL L;  2VQF Q;  2NUC A;  3HEJ A;  4WJ3 M;  2HIX A;  1L0X B;  2YYZ A;  3MXU A;  4ZYS A;  2Z6K C;  1IBM L;  2LKV A;  2BDO A;  1WTX A;  1PDQ A;  1SJH D;  2K01 A;  3SK6 A;  3PO2 G;  1QJO A;  3R2I A;  4GLA C;  3HOW G;  3KUP A;  2XTI A;  4DUY Q;  1KAA A;  3S16 B;  4RG1 A;  3MTS A;  1ILP A;  1QUQ B;  2R93 H;  3I3C A;  1F77 A;  1LLR D;  5FLX L;  3E6Z X;  2ZJP A;  3KOJ A;  2JA6 G;  1I3Q H;  3N52 A;  3PSI A;  2R7Z B;  2MFI A;  4K8I A;  3I4N B;  3NE5 B;  4IFD G;  4NXN L;  1TXY A;  1RD9 D;  2MPM A;  4LF7 Q;  3QWN A;  1B3Q A;  1LTT D;  5DAU A;  4LAA A;  4NW2 A;  3CKI B;  1TWH H;  1F2Y A;  1N34 L;  4DR6 Q;  1QZH A;  3KYH C;  5ELO A;  1SND A;  3H3V C;  4G7O C;  2NVY B;  1S5E D;  3ULL A;  2VQE Q;  1VF7 A;  2CH4 A;  5M5X B;  2CW0 C;  1EL0 A;  3VR4 A;  2A6H D;  4JI2 L;  2AQ3 B;  2R7D A;  2NTT A;  3CCM A;  3RLO A;  2DY7 A;  5C0X H;  1XPR A;  4X3T A;  2RBM A;  4YIJ A;  2HQE A;  1FNW A;  1RTO A;  2SOB A;  1F9P A;  3S1N B;  1CKO A;  4DK1 A;  2H4O A;  1YNN D;  1OTC A;  3NTH A;  5KGU A;  1ZEQ X;  1EOV A;  3U9O A;  5T1I A;  1RCV D;  4HIO A;  2L11 A;  1RF2 D;  1HQM C;  2YTX A;  2A19 A;  4JI3 Q;  4LFB L;  4PQX A;  4DV6 Q;  3K58 A;  1PA6 A;  4CKE A;  1D5Z C;  4NXM Q;  4A3F G;  1GXD C;  1L2F A;  1SE4 A;  2HQL A;  1TT2 A;  3U58 A;  1MJE A;  2EDG A;  1A8V A;  3ER0 A;  3QR8 A;  3PF4 A;  2EJM A;  2WFW A;  4ZUJ A;  1ESF A;  2E2J H;  1M4V A;  1EYG A;  3RZO B;  5E7N A;  1IBM Q;  5F2D A;  3K59 A;  2EIF A;  4HED A;  4DN4 M;  2JEA I;  3MXG A;  3NP8 A;  4ZLT F;  3GTP H;  4DU9 A;  4EQ5 A;  3UI2 A;  1PZK D;  4GN5 A;  4GNX A;  2Z6B A;  3Q6S A;  3LX0 A;  2ZXO A;  1I6H H;  4PG3 A;  2PCF B;  4B3M L;  4HMI A;  1OXT A;  2OQK A;  2Q8I B;  1EY9 A;  4WRD A;  3SEB A;  4DR6 L;  1JC7 A;  4PV1 C;  1I94 L;  4LF6 Q;  4X3S A;  1Y8O B;  2E75 C;  1HNX Q;  1M90 C;  1V1O A;  3LNN A;  5EPJ A;  1JOQ A;  1JJC B;  1MKH A;  3M7N A;  2MHV A;  1GJX A;  3TSS A;  4IJH A;  4JV5 L;  3SVM A;  2JA8 B;  3KLS A;  5CYU A;  4DV2 L;  4POG A;  4A3L H;  4JW0 A;  1LTA D;  3SK4 A;  4K8J A;  3DWA A;  2QW7 A;  2X69 A;  3ZJY C;  1VQ8 A;  1PFB A;  4RAU C;  1J9O A;  1NE3 A;  5JEA H;  2K7V A;  4KMU C;  2JP1 A;  3CC4 A;  2VQF L;  5IP7 G;  4JI0 L;  1NR4 A;  2B2T A;  5FLM G;  4CJ2 C;  2VY3 A;  1GUN A;  4IO9 A;  3GTO B;  1ZYR C;  1G2T A;  1LTS D;  4QQB X;  3KJP A;  1IBK L;  5C3W A;  2K75 A;  4KLK A;  3WOE A;  4IPG A;  1G51 A;  1A63 A;  2ICI A;  1HA6 A;  3V2T A;  4OO1 H;  5I9O A;  4UP7 A;  4WOR A;  4YY3 L;  2R3Z A;  1C48 A;  1GUG A;  1PFN A;  1EIG A;  2Z9H A;  2K4K A;  3T13 A;  3S14 B;  1FD7 D;  1PV4 A;  1K8O A;  2J0T D;  5JAV A;  3PO2 B;  4IZ8 A;  3S1N H;  2ALY B;  4BY7 B;  2V1C C;  1KQS A;  4DK0 A;  4XT1 B;  5JJK A;  1EWI A;  1ROD A;  1VQF A;  2D9U A;  3ERS X;  2HD3 A;  4A3D B;  3HOW H;  4MN3 A;  1CZW A;  2UXD Q;  5KYL A;  4FO2 A;  3SK8 A;  1N32 L;  1STH A;  4A75 A;  2VUM B;  2IW3 A;  1I50 H;  1H9K A;  5IGG A;  3K5L A;  4DR7 Q;  2JJQ A;  3EBE A;  2KCN A;  3OHX C;  2CVR A;  4GNX C;  3E9H A;  2QA4 A;  3I4O A;  3PQI A;  3AB9 A;  2F4V Q;  2I46 A;  4AH6 A;  3GQB A;  2SNS A;  1Q1E A;  4QMG A;  1CT1 D;  4LUZ A;  1UE6 A;  1X65 A;  3BZD B;  1M8A A;  4H13 C;  4DV7 Q;  2ZXP A;  1TWG H;  3I4M H;  4QGU A;  2EXZ A;  5COR A;  5IP7 H;  4DV5 Q;  2VQE L;  2PNR C;  3I7F A;  1L1O A;  1SFO B;  2Z0S A;  4FVM A;  1XNR Q;  3I91 A;  1FNV A;  2CCZ A;  3M3Y B;  5IGD A;  4R9W A;  1HNZ Q;  2Z1C A;  2YU9 B;  1ET9 A;  2WAQ E;  3BYY B;  2D62 A;  1BVS A;  1O7L A;  2YV5 A;  1YI2 A;  2CWA A;  4A93 G;  2EYH A;  3W2D A;  4GOP C;  5GRO A;  4B3R Q;  5JJL A;  1LM0 A;  1PH4 A;  5IYD G;  3CCV A;  4R8I A;  5FJ8 G;  2SEB D;  4XQN A;  4X65 Q;  3CP0 A;  2C9O A;  3S9W A;  1QVG A;  2RVL A;  4DR3 Q;  3U50 C;  2VB2 X;  2M2L A;  1HFN A;  1CI3 M;  1S40 A;  3VA5 A;  4NB3 A;  3IAY A;  1VQH A;  2E74 C;  1E1T A;  2CW0 D;  4QB4 A;  2MP1 A;  4K0K L;  5C44 H;  1E2W A;  1IYJ B;  1KIX A;  1B8A A;  3P20 A;  2JQO A;  5HGT A;  2I5L X;  3H0G G;  4B3M Q;  1EIF A;  1CKN A;  1J5E Q;  4JI1 L;  1JWM D;  2F0W A;  5CV4 A;  5EPL A;  2PW7 A;  5M5Y B;  1SMY C;  3M9B A;  2RA4 A;  1SLJ A;  4JOI A;  1I4X A;  1Q81 C;  2EYF A;  1JOR A;  2UXB Q;  2V4D A;  4TRD A;  3L2P A;  3TN2 A;  4XYQ A;  2DNC A;  4LF9 L;  2K04 A;  1A3T A;  4JOI C;  1EYD A;  1W3S A;  1B53 A;  1RDP D;  3GTQ B;  1Q8I A;  1E22 A;  1CSQ A;  2IT1 A;  5G3L F;  1X3E A;  5FO8 B;  2K52 A;  2Q2I A;  3R93 A;  4DF7 A;  2F0S A;  1Q46 A;  2HDM A;  2NVQ B;  1HZ9 A;  3S15 B;  5IE8 A;  1VQJ A;  4H44 C;  1NR2 A;  4DV4 Q;  4A3M B;  4DV0 L;  2B63 G;  4X64 Q;  1RKN A;  2Q8R E;  1N33 Q;  2R93 G;  4X3K A;  2IWH A;  1CHP D;  2PZW A;  4KK7 A;  5D3I B;  3D3R A;  4L5R C;  3AYH B;  1HZA A;  3FDT A;  2EVB A;  3H3V I;  1Y1W H;  3ITP A;  1KNE A;  1Y1W G;  3V05 A;  4LF8 Q;  1AE3 A;  1FJG L;  1BUV T;  4A3I B;  3CRL C;  4FF4 A;  5IYB G;  1JT8 A;  3OMG A;  1U4P A;  4L5Q A;  5ISR A;  1JE5 A;  2K5Q A;  3CW2 C;  3Q22 A;  3D0F A;  4JPB W;  2B2Y C;  2L5T A;  1B4O A;  2HDL A;  4JI6 Q;  2VZA A;  2K50 A;  1XWE A;  2CHB D;  4H02 A;  1K3R A;  4YCW A;  4GOP A;  4UHV A;  3C46 A;  1GOZ A;  3EA6 A;  3KLR A;  1SYB A;  1C9O A;  4WJW A;  1SNQ A;  1DD2 A;  4RH6 A;  2I5M X;  3FPU B;  3TP6 A;  4UAI A;  3OW7 A;  3G6J B;  1D5M C;  1RTN A;  1JCK B;  2N49 A;  4YWK A;  3K7A B;  1Q12 A;  2L0C A;  1JR0 D;  1VQ9 A;  1LTR D;  2IX1 A;  2B2V C;  2CH4 W;  1HA5 A;  1GHJ A;  4IUT A;  4P74 A;  1D5X C;  3S17 B;  5JJI A;  3OTO L;  4NPS A;  1IBL Q;  4LFA Q;  1EY5 A;  1LAC A;  1MI2 A;  1HCZ A;  4RGT A;  4JG2 A;  4QIW E;  4FXD A;  3ND9 A;  4DV7 L;  4KKS A;  4YY3 Q;  3CAM A;  1KRS A;  5IP9 G;  3RD4 A;  3MWY W;  3MXP A;  2A1A A;  2B3G A;  3VDY A;  5A2Q L;  2K28 A;  1HUM A;  1XNR L;  3K6O A;  1SYF A;  2N55 A;  3CQZ B;  4DV0 Q;  1S5C D;  2PZU A;  2KA7 A;  1YNJ D;  1VQP A;  3RNU A;  1WOC A;  3HOX B;  1EFI D;  2OCE A;  2XSC A;  1SYG A;  2BCO A;  5M3M H;  3A7L A;  4GKJ Q;  3VR6 A;  1PRT D;  3VYU A;  5C4X H;  2FIN B;  1HZB A;  1J5E L;  3WDN A;  2N88 A;  4RKB A;  2Q2T A;  2R7Z H;  2UUC L;  4A3C G;  2WIN B;  1UE5 A;  4LF8 L;  3J80 E;  2CQO A;  2R7Z G;  3SR1 A;  2OF1 A;  4OX9 L;  2JXM B;  4XQQ A;  1VQ6 A;  4MIU A;  2I5H A;  2LSS A;  2RCF A;  2VS1 A;  1XJV A;  2UXB L;  4HJ5 A;  5BN4 A;  2RCN A;  5M3M G;  5HY6 A;  3TEH B;  1A3U A;  4FF3 A;  1TS3 A;  1I4R A;  4B08 A;  4NMZ A;  4KY7 A;  3HKZ E;  3PO3 G;  3GD7 A;  1GD7 A;  4RMF A;  1U4R A;  4HJ9 A;  1HUN A;  1NAP A;  1QUQ A;  3K0Y A;  2L15 A;  3PV0 A;  5TSS A;  1S4Z A;  2PYK A;  1DOM A;  5KIX A;  2L55 A;  3CMA A;  4XDX A;  3DMU A;  1HRJ A;  3X3N A;  4KHP L;  1MIU A;  3M85 A;  1SNM A;  1K8A C;  5A2Q E;  3SE0 A;  4B9X A;  5DLQ E;  2B2U C;  4HTH A;  1S5F D;  1EFW A;  2OQ0 A;  1Q7Y C;  4N9P A;  1PVO A;  2B2T C;  3RUZ A;  4ODG A;  2E2J B;  3CC7 A;  3VYS A;  3HOX G;  1LUZ A;  4HID A;  3M7G A;  5KEE A;  3KK7 A;  1IYU A;  4C3H G;  1MGS A;  2DUD A;  1LT5 D;  1Z9F A;  3NWS A;  4LUV A;  3W1G A;  3S24 A;  3NHH A;  2Q8T A;  2SNM A;  4GKJ L;  2R92 G;  1VF5 C;  1PH2 A;  1TWA B;  2F0O A;  5E3F A;  1TR5 A;  3OYY A;  3BG3 A;  5ELF A;  1YNJ C;  2HT1 A;  1HQR D;  3L0O A;  4DR3 L;  2PO4 A;  1IKM A;  5C5M A;  2K5V A;  1BBU A;  2A8V A;  1V43 A;  1TWC H;  4A3E B;  3V96 A;  3TS2 A;  3JAM c;  1EU4 A;  1AZQ A;  5H1S E;  4LF5 Q;  1RL2 A;  1KXL A;  1U4M A;  2XRQ D;  1N33 L;  2NN6 G;  3ERO A;  3G48 A;  2WB1 B;  4DV2 Q;  4BA1 I;  4A3K G;  4A3I G;  4Y52 H;  2IY5 B;  2F0K A;  1JB7 A;  2ZTC A;  2C35 B;  1I4P A;  3PCO B;  3Q0A A;  3MEH A;  3LWE A;  1UUP A;  5CMD A;  1BO0 A;  3T4A C;  1Q82 C;  5A35 A;  3K5O A;  3OW2 A;  5M5W H;  3HOY G;  5AFW A;  2EY5 A;  1QNU A;  1TWF B;  1STB A;  1LTB D;  3TP7 A;  3NQI A;  3FVQ A;  1XNQ L;  3J7A 5;  4QF4 A;  3A55 A;  3RLF A;  1CQV A;  1F2Z A;  3Q24 A;  3TS0 A;  4LF9 Q;  3F1Z A;  1TQO A;  1KRT A;  2JA8 G;  4UPA A;  5BR8 Q;  2MNA A;  3CCL A;  1G29 1;  3I55 A;  3KFU A;  1ICF B;  2FMC A;  1V9P A;  4HIM A;  1K3B C;  4A3J H;  3HOU H;  3OOC A;  1SNO A;  4U67 3;  3GO5 A;  4NXM L;  2B2Y A;  3PUW A;  3M4O H;  3K57 A;  2JSO A;  1FGU A;  1NSN S;  4IPC A;  4A3L G;  2NVX B;  1JOK A;  3S1R B;  1YJN A;  4X64 L;  1QVF A;  3T56 B;  3I4N G;  3RMH A;  5BN3 A;  4CJ0 B;  1R4P B;  4RFB A;  3F2B A;  3CCE A;  4DV3 Q;  3OSO A;  4NXN Q;  3H3V H;  4XIG S;  1X3G A;  1EWC A;  3HOW B;  1GHK A;  2R93 B;  2RHQ B;  1G2S A;  2JEB I;  4HJA A;  3H0G B;  3PMF A;  3UE0 A;  4Y7N H;  1PLF A;  4DR7 L;  2B63 B;  3CF5 A;  4MTK A;  3CC2 A;  1EIH A;  5J22 A;  3TZU A;  3Q23 A;  2VNU D;  1W6K A;  2HCC A;  3K7U C;  1LTG D;  2GN5 A;  4FXG C;  4A3I H;  1AE2 A;  3NEL A;  1E2Z A;  1GVP A;  2NN6 H;  3I70 A;  1CKM A;  3K5M A;  4ZAI A;  1ENA A;  1PRT B;  4TSS A;  4TKO B;  2F0Q A;  2NVY H;  4A4I A;  4P75 A;  1SYD A;  3QOJ A;  1KL9 A;  4JBJ A;  2RSN A;  4DAY A;  5FK9 C;  4RKL A;  2F0E A;  4FYD A;  4X62 L;  1LYL A;  2CKZ B;  2OWO A;  4RHS A;  3ERQ A;  1TWG B;  3I4M B;  1D7Q A;  1IL8 A;  3OWF A;  4CDF C;  2MO0 A;  4J15 A;  1VMP A;  4MZ9 A;  1FL0 A;  4GS3 A;  2EPB A;  4BY1 B;  3DEO A;  5GAE C;  4BWG B;  2O4X A;  2DN8 A;  3MXN B;  5FO7 B;  1K0S A;  4L6T B;  1SE8 A;  5CR3 A;  1YIT A;  1VQK A;  4PNY A;  2EYL A;  3TP5 A;  1KDC A;  1S72 A;  2A68 D;  4P71 A;  3FRP B;  4C3I H;  2G9D A;  3NSW A;  5M5W B;  4A3G B;  4POF A;  5T1G A;  1TWF H;  1HPC A;  1TS4 A;  2E5L Q;  1N9W A;  2UUA Q;  4DV3 L;  1LT3 D;  1O7Y A;  3M4Y A;  1BCP C;  4B3S L;  3DLL A;  5ELB A;  1VQM A;  1XMQ Q;  2MGS A;  2OTJ A;  3ND8 A;  3J81 j;  4CKB A;  1PXU A;  1SMX A;  1QE6 A;  1C4Q A;  4DFA A;  4QIW B;  3GTL B;  2LS0 1;  4A3J B;  3HOU B;  4OWW B;  2JA6 H;  3BVZ A;  2UU9 L;  2EZV A;  3DWQ A;  4JI1 Q;  4DR2 Q;  4X6A H;  4UY8 C;  5BR8 L;  3MXN A;  1SYE A;  5I6Y A;  5EPK A;  3TRE A;  1ENC A;  3PUV A;  1EQT A;  1RJT A;  4I7A A;  2JA7 H;  3NK9 A;  4R4C A;  4YCV A;  1KDA A;  1MJC A;  1N36 L;  3K5N A;  1YVC A;  5J3B A;  2AKW B;  3KDF B;  4Y7N B;  3KF8 A;  1L1O C;  3LWU A;  1ICW A;  2M00 A;  4AYB E;  2H1E A;  4ZQ3 A;  3PUZ A;  1CA5 A;  3CCR A;  4AQY L;  4A3B H;  4ALP A;  5LL6 X;  3URY A;  3QIA A;  1SRO A;  3OIP A;  2PI2 E;  1WTH A;  4HSP A;  3I90 A;  4AYB G;  5JJZ A;  2JA8 H;  4KJO A;  3KF6 A;  2KQ3 A;  5K36 G;  1ASY A;  4B3T L;  5FLX E;  3M4Q A;  4KN4 C;  4BBS H;  1K0R A;  4IUP A;  4H0L C;  1OXS C;  3CD6 A;  4C1N I;  2UXC L;  1X3F A;  1NJI C;  2IL8 A;  1T5E A;  1WCM G;  3F8T A;  3TQY A;  1I4H A;  4BY7 H;  2BOS A;  3A74 A;  5COY A;  1C0A A;  3NBH B;  3UDX A;  1YJ9 A;  3NXW A;  3KJO A;  1EU3 A;  1Y1W B;  1EYC A;  2Z6K A;  3GP7 A;  2F0P A;  3W1B A;  1HJP A;  5K5P A;  1H9J A;  1HHV A;  1YIJ A;  3ULJ A;  2UUB L;  4X66 L;  1A0I A;  5KYI A;  5IYB H;  1PH9 A;  3RR5 A;  5LMN W;  2LXJ A;  3BDO A;  2R7F A;  3C3L A;  3T51 B;  4BA2 I;  2HCI A;  1A6X A;  3QG1 A;  5C4J B;  3EVQ A;  4UDU C;  3S15 H;  5JPN C;  1HFG A;  2K5N A;  4A3M H;  4K0K Q;  4EVO A;  3TRZ A;  4GOP B;  2B2U A;  4CGY B;  3CCU A;  1LT6 D;  1QCB D;  2WKC A;  4JCV E;  3HOV G;  4LUO A;  5C0X J;  1TWC B;  3T1Y Q;  1KD1 C;  4HJ8 A;  4KKT A;  1VQI A;  4IUV A;  1SAP A;  1MSG A;  1HR0 Q;  4ME3 A;  1RHP A;  3M4P A;  4EGV A;  3L9A X;  2PNH A;  2MJ8 A;  2I07 B;  5CV5 A;  1OXV A;  2K5D A;  4AQY Q;  2BH2 A;  2CFM A;  3MHB A;  4DNT B;  3JAM L;  1TU2 B;  2QGQ A;  3R2T A;  2K33 A;  1KLG D;  2XRS D;  4DR4 L;  1JWS D;  4JBM A;  4KTA A;  1E1O A;  2KEC A;  2OXP A;  2K1B A;  4IUU A;  3EJI A;  2K14 A;  1Y1V G;  4B3T Q;  1EQR A;  3J81 L;  5CV8 A;  2JA5 G;  1D8L A;  1HTP A;  3O13 A;  1Q1B A;  3P7J A;  5C3X A;  1GM5 A;  1BDO A;  1EUJ A;  2GVA A;  1E7Z A;  4DR5 L;  3CPW A;  1QIL A;  4GNX B;  2EJG C;  2RF4 A;  2R92 B;  3B6Y A;  3TME A;  3DUZ A;  1SSO A;  4OX9 Q;  3K7A H;  4QUF A;  5DM6 3;  4LF4 Q;  1B9N A;  5IY0 A;  2K5H A;  3CRK C;  3HOZ B;  1VQL A;  3H0G H;  4KI0 A;  3HS0 C;  3J7Z C;  1VQO A;  3I72 A;  3D6C A;  3F2U A;  4BBR G;  5LMN L;  4M1U B;  4JI8 L;  3HGB A;  5HUR A;  1JB3 A;  1VQN A;  3D31 A;  3IL8 A;  1PFS A;  1WTW A;  1VQ5 A;  4XQJ A;  1NY4 A;  3VR5 A;  1IL2 A;  1DCZ A;  3CQZ H;  1FJG Q;  1L0Y B;  2TMP A;  3TBI B;  1CA6 A;  1O80 A;  2ZT9 C;  3E0J A;  5M3M B;  4AIM A;  3T1Y L;  3NEN A;  2A74 C;  4O0A A;  4C56 C;  1Z6H A;  5D14 A;  1X55 A;  1VCI A;  5IIF A;  1UNS A;  2K05 A;  2KHS A;  1OXX K;  4C3H B;  1J6Q A;  1IHZ A;  2KHJ A;  5GAG C;  4U68 A;  2AUK A;  2UXC Q;  3NBI A;  1KC8 C;  1EY6 A;  2EYP A;  4LK1 C;  1PH5 A;  4OIJ A;  2HUG A;  4DK3 C;  4DKA C;  3GTJ B;  3J81 i;  1AH9 A;  2KJX A;  4PMW A;  5C44 B;  1UE1 A;  1XX8 A;  3GV3 A;  3PUX A;  1K83 H;  1WCM H;  3CU7 A;  4KKU A;  3F2D A;  4RCO A;  1NBW A;  3BVM A;  3KBX A;  5CC4 A;  2IPK D;  3J81 c;  3CCJ A;  2KVM A;  4HSV A;  5M5Y H;  1LTL A;  2ZXR A;  3J80 i;  4YHH L;  1JIC A;  2F0D A;  1YJW A;  2F3V A;  1DZ1 A;  4A3G H;  4K6L A;  5IYC H;  3T1H L;  1BF4 A;  1JJG A;  1R9T B;  1CSP A;  1XMQ L;  4NDX A;  5CV6 A;  3K81 C;  4JI5 Q;  4GLX A;  4BS9 A;  3PF5 A;  1N34 Q;  4A3B G;  3MC0 B;  1WYD A;  2K6A A;  4QCL A;  2RSO A;  2KED A;  2F0N A;  3PGZ A;  4DK6 C;  3G7L A;  1TS5 A;  3TP8 A;  3BZC A;  4G7H C;  3GTQ H;  1SDF A;  4C3J B;  1A3V A;  3S1M H;  4A3E G;  4K2L A;  1AN8 A;  1XPU A;  3I8Z A;  2B8F A;  5FOB B;  1RIP A;  2PQA B;  1EYA A;  1NTG A;  2Q2U A;  4EQN A;  5EBD A;  3PIP 3;  4OGQ C;  5JEA J;  3A56 A;  1HNX L;  4L8J A;  4APV A;  1STE A;  4HR7 B;  4HN7 A;  3CCS A;  5IGE A;  1Y14 B;  4FF1 A;  5ELE A;  1N36 Q;  2B29 A;  1TWA H;  2I0Q A;  2NVT H;  4C2M H;  5G3L D;  2O5J C;  1A2T A;  1STN A;  1BCP B;  2WAQ G;  2TSS A;  4K2K A;  3MAQ A;  1SFO H;  5KNB A;  1QG7 A;  1TVX A;  4A3F B;  2R6G A;  2DY8 A;  1NMG A;  3U4V A;  1NCV A;  2G5D A;  2JA5 B;  1WD1 A;  2ZTE A;  3PIO A;  2QDL A;  4PZ8 A;  4V0B A;  3GTM B;  1DOL A; 
#chains in the Genus database with same CATH homology
 2L1B A;  4HCS A;  4C3I G;  5EKL A;  1AZP A;  1CZG A;  2WP8 J;  1WTQ A;  5E1F A;  2PMZ B;  4H7B A;  1R4Q B;  1KDB A;  1PTO D;  1Z7T A;  4LMQ D;  3VR2 A;  2E2D C;  5CBE E;  1DOK A;  2EJF C;  2A69 C;  2EOT A;  4QUC A;  3DHQ A;  1XYI A;  3HRZ C;  2Z8L A;  3GTK B;  2B2W A;  3VYT A;  2C5C A;  4KN7 C;  2A6E D;  1PRT C;  2DNE A;  4BBS B;  5EKK A;  5CV7 A;  1ONL A;  4K6D A;  4G4K A;  1F9Q A;  5IGF A;  4ID6 A;  4S3S A;  1V8Q A;  4OIK A;  2Z4H A;  3S2D B;  2F4I A;  1PYW D;  2VB3 X;  2XN9 C;  1O78 A;  3NUC A;  3NTK A;  1SNC A;  2A68 C;  3S1M B;  1Q90 A;  2AUJ D;  4PMC A;  5J39 A;  2WAC A;  4FP5 D;  1F9R A;  3J7A V;  1Y8N B;  1JE4 A;  4J1M A;  1FR3 A;  1TY2 A;  1PTO C;  1BCP D;  4K14 A;  2F0I A;  1CQF A;  1SNP A;  1GUW A;  2XVS A;  1U4L A;  2NZ1 D;  3X3M A;  5BN5 A;  1EZ8 A;  3A7A B;  1H9R A;  1SXT A;  4FNF A;  2LFN A;  1PTO H;  1B1Z A;  2NBF A;  3R3O A;  4P2C B;  3D8G A;  2NB0 A;  2JA6 B;  5E4X A;  2F1M A;  2BE5 D;  2F0G A;  3D6W A;  4O1N A;  4K5V A;  4OO1 I;  4DGZ A;  2KOL A;  4I7Z C;  2A69 D;  2WV6 D;  2EY6 A;  4IFD H;  5IT9 L;  5CGK A;  2NYZ D;  5IT9 E;  1O7Z A;  3S1Q B;  1EQV A;  1B44 D;  4KV6 A;  4HAE A;  2J4X A;  2GA4 B;  1W6J A;  1ENF A;  1TY0 A;  2G9H D;  5NUC A;  2RDH A;  3MFG A;  3ONA B;  2NTS A;  4DNR B;  1TWH B;  2EY2 A;  4XYO A;  4K5W A;  1PZJ D;  1E0B A;  1S5B D;  2JA7 B;  2QDB A;  3J7A F;  2L12 A;  1XTC D;  5EJW A;  1X32 A;  3VA7 A;  1DYQ A;  3DM1 A;  5JEA G;  2IJ0 A;  5KRU A;  4K5X A;  1VMC A;  2A5H A;  2A73 B;  4KD3 A;  4X3U A;  1I6V C;  4O42 A;  4A3B B;  3BVG A;  4RGO S;  5LL6 S;  5ELD A;  2WII B;  2PQE A;  3FMC A;  1IYV A;  1JQY D;  2B8G A;  1AFP A;  2X6L A;  3DWP A;  5M9O A;  1STY A;  4OL7 A;  4ZKB B;  1F2L A;  2IX3 A;  4KHZ A;  1DXM A;  1A2U A;  4ZKC B;  1Z47 A;  3MZ5 A;  2WKD A;  3J7Y W;  5D65 A;  2LY7 A;  5EQ0 A;  4FF2 A;  2F0V A;  3PO3 B;  1DJR D;  2K5W A;  1QNK A;  3QJY A;  2NWG A;  4Q0F A;  1EY8 A;  3D4R A;  1U9R A;  1H9S B;  2KEE A;  4L63 B;  5JVG 3;  3HG9 A;  2NVT B;  3SDZ A;  3A8J E;  4F7X A;  1AEX A;  4C3I B;  4LJZ C;  1XXG A;  4RGM A;  4GZY C;  4B9W A;  2E76 C;  4ILW A;  5C0X G;  5DEH A;  3U9S A;  1Y69 U;  3HOY B;  3IFT A;  4ZUI A;  2X6G A;  4OHJ A;  3NPP A;  1GUS A;  3KLS X;  5CBA E;  1D2B A;  4JK1 C;  4A3K B;  1MD2 D;  4N9T A;  3MA2 B;  1EWH A;  1IKL A;  2PZT A;  3OIQ A;  4DXF A;  4IQZ A;  3A8I E;  4G7Z C;  5C3E B;  4KY5 A;  2Y0S B;  3OPO A;  2F0J A;  1GUO A;  5C6A A;  1I4G A;  1DON A;  2AWO A;  4IFD J;  1SBB B;  3PIO 3;  2KCC A;  1IW7 D;  1II3 A;  3P75 A;  1PRT F;  1K83 B;  1BOS A;  3NQT A;  3D4W A;  5EGT A;  4KD4 A;  4EQP A;  2A6E C;  3M4O B;  4E6I A;  2EYJ A;  2E2I B;  3SK5 A;  2QCP X;  1K8M A;  5DM7 3;  4DAV A;  3TZD A;  5IOD A;  3BDL A;  2MUY A;  3FPP A;  4ULL A;  4OO1 G;  2M9V A;  2JYO A;  1HXY D;  5I2X A;  1V1P B;  1H9S A;  2K03 A;  2JE6 I;  5KNC A;  3T16 A;  1TS2 A;  5JVH 3;  1QOH A;  4ME5 A;  1SYC A;  2RDG A;  1F2M A;  5IGB A;  1SJE D;  4XTC S;  1KNA A;  3KBG A;  3H91 A;  1Y1V B;  5E4W C;  1ESR A;  1CFM A;  4IAL A;  4J6H A;  5FO9 B;  1KTK A;  2AQ2 B;  1EY0 A;  4PMB A;  1DM0 B;  3QB3 A;  1WTP A;  3DEP A;  4MHE A;  2F0M A;  2AWN A;  4DXG A;  3IKJ A;  3E5S A;  1ET6 A;  1BXT A;  1LTI D;  1ILQ A;  1STG A;  4HCE A;  5I4D A;  2F0T A;  4IN3 A;  1SEB D;  4HMJ A;  1G8Z D;  2RQX A;  2EYO A;  2ENB A;  1EZ6 A;  2FFK B;  4RCN A;  1OO9 B;  3HP3 A;  4Q5V A;  3CHB D;  4DA2 A;  3AU7 A;  1J8I A;  3OWE B;  1JOO A;  2RDF A;  3D4D A;  1D6E C;  1B2T A;  1I6H B;  3WOF A;  1WTV A;  1PFM A;  3GV6 A;  1MSH A;  1S5D D;  2FMM A;  2PPB C;  1EEF D;  1A15 A;  2F3W A;  1WD0 A;  2XWB B;  1CM9 A;  4XT3 B;  5EBC A;  1PTO F;  3NTI A;  1QB5 D;  2QKI C;  2WAQ B;  2B2V A;  1EEI D;  1LT4 D;  1WVL A;  1WTR A;  2SDF A;  3H09 A;  4V19 0;  1PMR A;  2EY1 A;  1CK1 A;  4AYB B;  4M8A A;  3C2P A;  1I50 B;  2Z4I A;  4WFN 3;  2F0L A;  2PW5 A;  4RGN A;  5IGC A;  2B2W C;  4C3J G;  1STA A;  1WCM B;  4FXK C;  1EY4 A;  4TQU S;  1SE2 A;  2O5I C;  2L4N A;  3PUY A;  1X3Q A;  2QEJ C;  3DXJ C;  2F0H A;  2XIW A;  5JPM C;  4KHV A;  5I6W A;  2IX0 A;  1BBX C;  1LAB A;  4CBV A;  2BE5 C;  3L3O C;  1ML0 D;  1FGB D;  2EYM A;  1BQQ T;  2L9H A;  1LV9 A;  1YNN C;  1ZKO A;  4RWS C;  3NBH A;  1ZXT A;  2B39 A;  2E2H B;  1EY7 A;  1EOT A;  3W3A A;  4CKC A;  4JBW A;  3VR3 A;  3R8B A;  2A6H C;  4C1N K;  4F88 A;  2QIL A;  3VYR A;  3L7Z C;  2FHT A;  1TII D;  3HOV B;  4IUR A;  3BS1 A;  1HTL D;  1PTO B;  2LMC B;  4XXE A;  4C2M B;  5C0X I;  3IFD A;  3EFX D;  1SE3 A;  3H94 A;  2BDN A;  2OT2 A;  3AMU A;  4IFD I;  4IUQ A;  3QOL A;  3SHL A;  4R8N A;  3P1H A;  4IUN A;  3QO2 A;  1LO5 D;  3A8K E;  1GUT A;  4CJ1 B;  2QF7 A;  3GTP B;  5IOC A;  4ABN A;  1VDZ A;  2RKS A;  3FEW X;  5C4X B;  2ICE C;  1UEA B;  3FKI B;  1TKW B;  5I2Y A;  3J80 L;  5LHY 1;  2NN6 I;  1H9M A;  3I73 A;  3OMC A;  1B50 A;  3A54 A;  1B3A A;  1AW7 A;  5C5L A;  1Q3L A;  3NWT A;  3MVV A;  2BA1 A;  1ZYR D;  1D1I A;  3GTG B;  1OXU A;  3C1E A;  1KAB A;  3ZYY X;  2J7Z A;  5ELC A;  1G6Z A;  4J8Q A;  3RZD B;  1E2V A;  5JOB A;  1D1K A;  2F03 A;  2VXW A;  2K32 A;  1PZI D;  2ID0 A;  4RA8 A;  3C1F A;  1SMY D;  2AQ1 B;  1I3Q B;  1KLU D;  3SXH A;  5EKI A;  4G57 A;  1BCP F;  1WTO A;  5C4Z A;  1UAP A;  1CTM A;  2CQA A;  5CV9 A;  1CHQ D;  1BNZ A;  2EE1 A;  3TDQ A;  3BDC A;  4KJN A;  3H6M A;  3BYT B;  2XNA C;  1B9M A;  2O2L D;  3N6R A;  4A93 B;  5KND A;  4CHT B;  1FYC A;  3I4L A;  2D5D A;  1FNU A;  4RHR A;  4EQO A;  5C4H A;  4F8M A;  2KUM A;  4NKL A;  1C8C A;  5I9P A;  3S2H B;  4BBR B;  4ZK9 B;  2F0F A;  1BR9 A;  1QWY A;  2FJ2 A;  4F87 A;  4NP5 A;  3T53 B;  2BA0 A;  4DAP A;  2OEO A;  3EQL C;  5K36 H;  5J1Z A;  1JWU D;  3JAM E;  3HZX A;  4ZRZ A;  1I4Q A;  1G91 A;  1AP0 A;  2D2C C;  1IW7 C;  5FKA C;  5M3F B;  1NUC A;  2F0U A;  5D3D A;  5DNF A;  1X3P A;  3J81 E;  3HKZ B;  4I65 A;  1Y8P B;  1V1P A;  2R61 A;  4KY6 A;  4Z9C B;  2XWJ B;  1F9S A;  1T5X D;  1MBY A;  3MFY A;  2NUC A;  3HEJ A;  1L0X B;  2YYZ A;  3MXU A;  4ZYS A;  2LKV A;  2BDO A;  1WTX A;  1PDQ A;  1SJH D;  2K01 A;  3SK6 A;  1QJO A;  3R2I A;  3KUP A;  1KAA A;  3S16 B;  3MTS A;  1ILP A;  3I3C A;  1F77 A;  1LLR D;  5FLX L;  3E6Z X;  3N52 A;  2R7Z B;  4K8I A;  3I4N B;  3NE5 B;  4IFD G;  1RD9 D;  2MPM A;  3QWN A;  1LTT D;  5DAU A;  4LAA A;  4NW2 A;  3CKI B;  1F2Y A;  1SND A;  3H3V C;  4G7O C;  2NVY B;  1S5E D;  1VF7 A;  5M5X B;  2CW0 C;  1EL0 A;  3VR4 A;  2A6H D;  2AQ3 B;  2NTT A;  2DY7 A;  5C0X H;  4X3T A;  2RBM A;  4YIJ A;  2HQE A;  1FNW A;  1RTO A;  2SOB A;  1F9P A;  3S1N B;  4DK1 A;  2H4O A;  1YNN D;  3NTH A;  5KGU A;  1ZEQ X;  3U9O A;  5T1I A;  1RCV D;  2L11 A;  1RF2 D;  1HQM C;  4PQX A;  3K58 A;  4CKE A;  1D5Z C;  1GXD C;  1SE4 A;  1TT2 A;  2EDG A;  2EJM A;  4ZUJ A;  1ESF A;  1M4V A;  3RZO B;  5F2D A;  3K59 A;  4HED A;  4DN4 M;  2JEA I;  3MXG A;  3NP8 A;  4ZLT F;  4DU9 A;  3UI2 A;  1PZK D;  3Q6S A;  3LX0 A;  2ZXO A;  2PCF B;  4HMI A;  1OXT A;  2Q8I B;  1EY9 A;  4WRD A;  3SEB A;  1JC7 A;  4PV1 C;  4X3S A;  1Y8O B;  2E75 C;  1V1O A;  3LNN A;  5EPJ A;  1JOQ A;  3M7N A;  2MHV A;  1GJX A;  3TSS A;  3SVM A;  2JA8 B;  3KLS A;  5CYU A;  1LTA D;  3SK4 A;  4K8J A;  3DWA A;  2X69 A;  1PFB A;  4RAU C;  1J9O A;  5JEA H;  2K7V A;  4KMU C;  2JP1 A;  1NR4 A;  2B2T A;  4CJ2 C;  1GUN A;  3GTO B;  1ZYR C;  1G2T A;  1LTS D;  5C3W A;  3WOE A;  2ICI A;  1HA6 A;  3V2T A;  4OO1 H;  5I9O A;  4WOR A;  2R3Z A;  1C48 A;  1GUG A;  1PFN A;  1EIG A;  3T13 A;  3S14 B;  1FD7 D;  1K8O A;  5JAV A;  2J0T D;  3PO2 B;  4IZ8 A;  4BY7 B;  4DK0 A;  4XT1 B;  1ROD A;  2D9U A;  4A3D B;  4MN3 A;  1CZW A;  5KYL A;  4FO2 A;  3SK8 A;  1STH A;  2VUM B;  2IW3 A;  1H9K A;  5IGG A;  3K5L A;  2KCN A;  3OHX C;  2CVR A;  3AB9 A;  2I46 A;  3GQB A;  2SNS A;  1Q1E A;  4QMG A;  1CT1 D;  3BZD B;  1M8A A;  4H13 C;  2ZXP A;  2EXZ A;  5COR A;  2PNR C;  1SFO B;  4FVM A;  3I91 A;  1FNV A;  3M3Y B;  5IGD A;  4R9W A;  2Z1C A;  2YU9 B;  1ET9 A;  3BYY B;  2D62 A;  1O7L A;  2EYH A;  3W2D A;  4R8I A;  2SEB D;  4XQN A;  2C9O A;  3S9W A;  2RVL A;  2VB2 X;  2M2L A;  1HFN A;  1CI3 M;  3VA5 A;  3IAY A;  2E74 C;  2CW0 D;  4QB4 A;  2MP1 A;  1E2W A;  3P20 A;  5HGT A;  1JWM D;  2F0W A;  5CV4 A;  5EPL A;  2PW7 A;  5M5Y B;  1SMY C;  2RA4 A;  1I4X A;  2EYF A;  1JOR A;  2V4D A;  4TRD A;  3TN2 A;  4XYQ A;  2DNC A;  2K04 A;  1A3T A;  1EYD A;  1B53 A;  1RDP D;  3GTQ B;  1Q8I A;  2IT1 A;  5G3L F;  5FO8 B;  3R93 A;  4DF7 A;  2F0S A;  2HDM A;  2NVQ B;  3S15 B;  1NR2 A;  4H44 C;  4A3M B;  1RKN A;  2Q8R E;  4X3K A;  2IWH A;  1CHP D;  2PZW A;  4KK7 A;  5D3I B;  3D3R A;  3FDT A;  2EVB A;  3ITP A;  1KNE A;  3V05 A;  1BUV T;  4A3I B;  3CRL C;  4FF4 A;  3OMG A;  1U4P A;  5ISR A;  2K5Q A;  3Q22 A;  2B2Y C;  2L5T A;  1B4O A;  2HDL A;  1XWE A;  2CHB D;  3C46 A;  1GOZ A;  3EA6 A;  3KLR A;  1SYB A;  4WJW A;  1SNQ A;  1DD2 A;  4RH6 A;  3FPU B;  3TP6 A;  4UAI A;  3OW7 A;  3G6J B;  1D5M C;  1RTN A;  1JCK B;  3K7A B;  1Q12 A;  2L0C A;  1JR0 D;  1LTR D;  2IX1 A;  2B2V C;  1HA5 A;  1GHJ A;  4IUT A;  3S17 B;  1D5X C;  1EY5 A;  1LAC A;  1MI2 A;  1HCZ A;  4RGT A;  4FXD A;  3ND9 A;  4KKS A;  3RD4 A;  3MWY W;  3MXP A;  5A2Q L;  2K28 A;  1HUM A;  3K6O A;  1SYF A;  2N55 A;  3CQZ B;  1S5C D;  2PZU A;  2KA7 A;  3HOX B;  1YNJ D;  1EFI D;  2XSC A;  1SYG A;  2BCO A;  3A7L A;  3VR6 A;  1PRT D;  3VYU A;  2FIN B;  3WDN A;  2N88 A;  4RKB A;  2WIN B;  3J80 E;  3SR1 A;  2OF1 A;  2JXM B;  4XQQ A;  4MIU A;  5BN4 A;  1A3U A;  4FF3 A;  1TS3 A;  1I4R A;  4B08 A;  4NMZ A;  4KY7 A;  3GD7 A;  1U4R A;  1HUN A;  1NAP A;  3K0Y A;  3PV0 A;  5TSS A;  1S4Z A;  2PYK A;  1DOM A;  5KIX A;  2L55 A;  4XDX A;  3DMU A;  1HRJ A;  3X3N A;  3M85 A;  1SNM A;  5A2Q E;  3SE0 A;  4B9X A;  2B2U C;  4HTH A;  1S5F D;  4N9P A;  2B2T C;  3RUZ A;  4ODG A;  2E2J B;  3VYS A;  3M7G A;  5KEE A;  3KK7 A;  1IYU A;  4C3H G;  1MGS A;  1LT5 D;  3NWS A;  3NHH A;  2Q8T A;  2SNM A;  1VF5 C;  1TWA B;  2F0O A;  5E3F A;  1TR5 A;  5ELF A;  3BG3 A;  1YNJ C;  1HQR D;  1IKM A;  2PO4 A;  5C5M A;  1V43 A;  4A3E B;  3V96 A;  1EU4 A;  1AZQ A;  1U4M A;  2XRQ D;  2NN6 G;  3ERO A;  2WB1 B;  4BA1 I;  2F0K A;  1I4P A;  3Q0A A;  3MEH A;  3LWE A;  1UUP A;  5CMD A;  1BO0 A;  3T4A C;  5A35 A;  3K5O A;  5AFW A;  2EY5 A;  1QNU A;  1TWF B;  1STB A;  1LTB D;  3TP7 A;  3NQI A;  3FVQ A;  4QF4 A;  3A55 A;  3RLF A;  1CQV A;  1F2Z A;  3Q24 A;  1TQO A;  1G29 1;  2FMC A;  3OOC A;  1SNO A;  4U67 3;  3GO5 A;  2B2Y A;  3PUW A;  3K57 A;  2JSO A;  1NSN S;  2NVX B;  1JOK A;  3S1R B;  3T56 B;  3RMH A;  5BN3 A;  4CJ0 B;  1R4P B;  4RFB A;  3OSO A;  4XIG S;  1EWC A;  3HOW B;  1GHK A;  2R93 B;  1G2S A;  2JEB I;  3H0G B;  3PMF A;  1PLF A;  2B63 B;  1EIH A;  5J22 A;  3TZU A;  3Q23 A;  2VNU D;  1W6K A;  2HCC A;  1LTG D;  4FXG C;  1E2Z A;  2NN6 H;  3I70 A;  3K5M A;  4ZAI A;  1ENA A;  1PRT B;  4TSS A;  4TKO B;  2F0Q A;  1SYD A;  3QOJ A;  2RSN A;  4DAY A;  5FK9 C;  4RKL A;  2F0E A;  4FYD A;  4RHS A;  3ERQ A;  1TWG B;  3I4M B;  1IL8 A;  3OWF A;  1VMP A;  2EPB A;  4BY1 B;  3DEO A;  4BWG B;  2O4X A;  2DN8 A;  5FO7 B;  4L6T B;  5CR3 A;  4PNY A;  2EYL A;  3TP5 A;  1KDC A;  2A68 D;  3FRP B;  5M5W B;  2G9D A;  3NSW A;  4A3G B;  5T1G A;  1HPC A;  1TS4 A;  1LT3 D;  1O7Y A;  3M4Y A;  1BCP C;  5ELB A;  2MGS A;  3ND8 A;  4CKB A;  1PXU A;  1QE6 A;  1C4Q A;  4DFA A;  4QIW B;  3GTL B;  2LS0 1;  4A3J B;  3HOU B;  3BVZ A;  2EZV A;  3DWQ A;  3MXN A;  1SYE A;  5I6Y A;  5EPK A;  1ENC A;  3PUV A;  1EQT A;  1RJT A;  3NK9 A;  1KDA A;  3K5N A;  4Y7N B;  3KF8 A;  3LWU A;  1ICW A;  2M00 A;  2H1E A;  4ZQ3 A;  3PUZ A;  1CA5 A;  5LL6 X;  3URY A;  3QIA A;  3OIP A;  4HSP A;  3I90 A;  5JJZ A;  4KJO A;  2KQ3 A;  5K36 G;  5FLX E;  4KN4 C;  4IUP A;  4H0L C;  1OXS C;  4C1N I;  2IL8 A;  1T5E A;  1I4H A;  2BOS A;  5COY A;  3NXW A;  1EU3 A;  1Y1W B;  1EYC A;  3GP7 A;  2F0P A;  5K5P A;  1H9J A;  1HHV A;  5KYI A;  3BDO A;  3C3L A;  3T51 B;  4BA2 I;  2HCI A;  1A6X A;  3QG1 A;  5C4J B;  3EVQ A;  4UDU C;  5JPN C;  1HFG A;  4EVO A;  2B2U A;  4CGY B;  1LT6 D;  1QCB D;  2WKC A;  5C0X J;  1TWC B;  4KKT A;  4IUV A;  1SAP A;  1MSG A;  1RHP A;  4EGV A;  3L9A X;  2MJ8 A;  2I07 B;  5CV5 A;  1OXV A;  2K5D A;  3MHB A;  4DNT B;  3JAM L;  1TU2 B;  3R2T A;  2K33 A;  1KLG D;  2XRS D;  1JWS D;  4KTA A;  2KEC A;  2OXP A;  2K1B A;  3EJI A;  4IUU A;  3J81 L;  5CV8 A;  1HTP A;  3O13 A;  1Q1B A;  3P7J A;  5C3X A;  1BDO A;  1QIL A;  2EJG C;  2R92 B;  3TME A;  3DUZ A;  1SSO A;  4QUF A;  5DM6 3;  1B9N A;  3HOZ B;  3CRK C;  4KI0 A;  3HS0 C;  3I72 A;  3D6C A;  3F2U A;  4M1U B;  3HGB A;  5HUR A;  1JB3 A;  3D31 A;  3IL8 A;  1WTW A;  4XQJ A;  3VR5 A;  1DCZ A;  1L0Y B;  3TBI B;  2TMP A;  1CA6 A;  1O80 A;  2ZT9 C;  3E0J A;  5M3M B;  2A74 C;  4C56 C;  1Z6H A;  5D14 A;  5IIF A;  1VCI A;  1UNS A;  2K05 A;  2KHS A;  1OXX K;  4C3H B;  1IHZ A;  4U68 A;  2AUK A;  3NBI A;  1EY6 A;  2EYP A;  4LK1 C;  3GTJ B;  4OIJ A;  2HUG A;  2KJX A;  5C44 B;  4PMW A;  1XX8 A;  3GV3 A;  3PUX A;  3CU7 A;  4KKU A;  4RCO A;  3BVM A;  3KBX A;  5CC4 A;  2IPK D;  2KVM A;  4HSV A;  2ZXR A;  1JIC A;  2F0D A;  1DZ1 A;  2F3V A;  4K6L A;  1BF4 A;  1R9T B;  4NDX A;  5CV6 A;  4BS9 A;  3MC0 B;  2K6A A;  4QCL A;  2RSO A;  2KED A;  2F0N A;  3G7L A;  1TS5 A;  3TP8 A;  4G7H C;  1SDF A;  4C3J B;  1A3V A;  4K2L A;  1AN8 A;  3I8Z A;  2B8F A;  5FOB B;  1EYA A;  4EQN A;  5EBD A;  3PIP 3;  4OGQ C;  5JEA J;  3A56 A;  4L8J A;  1STE A;  4HR7 B;  4HN7 A;  5IGE A;  4FF1 A;  5ELE A;  5G3L D;  2O5J C;  1A2T A;  1STN A;  1BCP B;  2TSS A;  4K2K A;  3MAQ A;  5KNB A;  1QG7 A;  4A3F B;  1TVX A;  2R6G A;  2DY8 A;  1NCV A;  2JA5 B;  1WD1 A;  4V0B A;  3GTM B;  1DOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...