1ZXTA

Crystal structure of a viral chemokine
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
VSYTPNSCCYGFQQHPPPVQILKEWYPTSPACPKPGVILLTKRGRQICADPSKNWVRQLMQRLPAIAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords functional macrophage inflammatory protein 1-alpha homolog
publication title Crystal structure of viral macrophage inflammatory protein I encoded by Kaposi's sarcoma-associated herpesvirus at 1.7A.
pubmed doi rcsb
source organism Human herpesvirus 8
total genus 12
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zxtA01
2XIWA 1DOLA 4ZAIA 2B2WA 1DONA 1SDFA 1BBXC 1MSHA 1O80A 2N88A 3GV3A 1HRJA 2HDLA 5EPKA 3QO2A 4R9WA 1WTPA 1KNAA 2Q8RE 1PFNA 1G2SA 3I3CA 1RTNA 1G2TA 4O42A 5T1IA 1BF4A 4X3TA 2RVLA 1VMPA 3SVMA 2FINB 1X32A 4X3UA 4DN4M 4ZK9B 4QUFA 1U4LA 4OIJA 5E4WC 2DY7A 1IKLA 5E4XA 3HP3A 1HFGA 2KEEA 1M8AA 1JICA 4HAEA 4U68A 1WTOA 1IKMA 2RSNA 2EOTA 4ZKBB 2K01A 2CVRA 2K04A 3G7LA 1WTQA 1F9PA 1AP0A 5D14A 3GV6A 1ML0D 5EPJA 1NCVA 1O7YA 2B2VC 2FHTA 2KEDA 1ESRA 1WTXA 5D65A 1B53A 1B4OA 3P7JA 2B2TC 1RJTA 3IFDA 1NR2A 2L12A 2L4NA 4HSVA 1G6ZA 2D9UA 2R3ZA 4RA8A 4XDXA 1ILQA 3N52A 3D6WA 2NYZD 2RSOA 3UI2A 1AZQA 4MN3A 1WD1A 1J8IA 2B2YC 2MGSA 1SAPA 4IUUA 1F9QA 1HUNA 4QUCA 1XYIA 3TZDA 2K1BA 4LMQD 1EQTA 1HUMA 1DZ1A 1WTRA 1VMCA 2MPMA 2K28A 3DEPA 4MHEA 1MI2A 2FJ2A 3I91A 4HEDA 3KUPA 4IUQA 1X3QA 3H91A 3KBXA 5JJZA 2DY8A 1WTWA 2K03A 1WD0A 1EL0A 2JP1A 1X3PA 1AZPA 3ONAB 1DOKA 1QNKA 4X3KA 1B2TA 1HHVA 1KNEA 1CM9A 2B2VA 3F2UA 3I90A 4ZLTF 1GUWA 1PDQA 2B2TA 2B2UC 2MJ8A 1EOTA 2EE1A 2NWGA 3DM1A 2KUMA 3MWYW 3DEOA 2RA4A 5EJWA 3LWEA 2KOLA 2L1BA 5EQ0A 3IL8A 1E0BA 2VXWA 4IUTA 2NZ1D 1RHPA 5T1GA 1QG7A 1ICWA 2B2YA 2KECA 1S4ZA 1LV9A 5CBAE 1A15A 1CA6A 1SSOA 1TVXA 2X69A 4R8IA 1WVLA 1U4PA 5AFWA 1Q3LA 1MSGA 1G91A 1NR4A 2IL8A 3FDTA 1IL8A 1F9SA 2N55A 2SDFA 4NW2A 2B2WC 4OIKA 1B50A 1U4MA 2FFKB 1PFBA 2L9HA 2L11A 5EPLA 5CORA 2MP1A 2M2LA 1WTVA 2HCIA 5CMDA 1F9RA 1CA5A 5COYA 1DOMA 1MGSA 2JYOA 1BO0A 1ILPA 3I8ZA 1NAPA 4HCSA 4XT3B 3Q6SA 2HUGA 5DNFA 4CJ0B 1JE4A 1BNZA 4X3SA 2X6GA 1ZXTA 4IUPA 2B2UA 2H1EA 2X6LA 4RWSC 3R93A 1PFMA 2BDNA 1B3AA 2HDMA 4CJ2C 1C8CA 1HA6A 3TN2A 5CBEE 1HFNA 2K05A 1U4RA 2J7ZA 1RTOA 2EPBA 1EIHA 2Q8TA 3MTSA 5EKIA 4CJ1B 4UAIA 4ZKCB 1QE6A 2KVMA 4XT1B 3FPUB 4IURA 1J9OA 1XX8A 2HCCA 1PLFA 4RAUC 4IUVA 1EIGA 1O7ZA 1RODA 1F2LA 2FMMA
chains in the Genus database with same CATH superfamily
3T16A 2RDFA 1HNWQ 1CZGA 5K36G 3E9IA 4WJWA 4YWKA 2YU9H 1V1QA 2JA6H 3J80E 1PFNA 2K5WA 1V1PB 3T56B 4UP8A 2R93H 4ZK9B 4CBVA 3S1RB 4CDFC 4DXFA 3VA5A 4N9TA 3HP3A 1ICFB 4KHZA 1GUTA 1JQYD 1D2BA 2UU9Q 1HJPA 4HJ7A 1M90C 1B7YB 1PZJD 2K4KA 4A3BB 4DXGA 4TRDA 3QJYA 4RHRA 5LMNW 1CQVA 1BKBA 4XYQA 1G6PA 5IGEA 4BY7H 3D6WA 3BJUA 5I2YA 5TSSA 4DR2Q 3QOJA 1SAPA 4DV5Q 4JV5Q 2NN6I 1Y1WB 4B9XA 1WTRA 1I94Q 4HMJA 4K5XA 3HOYG 3OWEB 1PTOF 3TDQA 1RD9D 3JAMc 4HEDA 2C35B 2A6HD 2NVQH 3KBXA 5HY6A 4KK7A 1V1PA 2KA7A 2Z4HA 1X3PA 4LW1A 1HQMC 5H1SE 1HHVA 1KNEA 3F2UA 3HOWH 4F88A 1V9PA 1XPRA 2UU9L 2IHFA 4DV6L 1JMCA 2CQOA 1L1OC 2F0HA 1N36Q 4RG1A 3L0OA 2XTIA 5T1GA 1LYLA 2ZTEA 1K3BC 4A3FH 1XMQQ 1U4PA 1Q3LA 4A3DH 1EWIA 4APVA 4KMUC 1I4XA 4DR2L 5CORA 4WRDA 4JI3L 1PZKD 4WFN3 4TQUS 4JV5L 1FD7D 4QGUA 1F9RA 3EQLC 1JE5A 1A6XA 4L63B 5KYIA 1I94L 4AYBE 1DJRD 4CHTB 1SFOH 4LUZA 4XQJA 4CJ0B 4A3JH 5CR3A 2L15A 4C56C 5IODA 2HDMA 1EEFD 2YTXA 1HFNA 2IHEA 4GLAC 3ICEA 4DGZA 4NXML 2AQ1B 1T5XD 3D8GA 1BVSA 1VQLA 5CV8A 2JEAI 3MA2B 3TZUA 1K8GA 1D8LA 4KHPQ 2F0IA 1TWHB 3PMFA 4NPSA 2ZJPA 5C44G 5CC4A 2E75C 4N8FA 3TBIB 3H6MA 2ICEC 3S2HB 1HH2P 1CKMA 4IOCA 1VQKA 3GTGB 3CRKC 1XMQL 4IN3A 2Z6BA 5FKAC 1EY6A 5IGGA 4RFBA 1STEA 3S2DB 3DWQA 5BN4A 4OX9Q 3U9SA 1QUQA 1EYAA 1PH3A 1I6VC 2EY1A 4MTNA 2OXPA 2JQOA 3C1FA 2A69D 4HJAA 2EQSA 2FHTA 2N49A 4BA2I 2TMPA 2B2TC 4RCNA 4G57A 4OONA 3NWSA 4N9PA 3KLSX 2ZM6Q 2YU9B 1ENFA 4KHPL 2JA6B 3K5MA 1C7YA 2QDLA 2R93B 4XTCS 1XYIA 2K5VA 3ND8A 3TP5A 2R92H 5LL6S 2MPMA 1TWGH 4XIGS 1EY5A 5JEAJ 4DR4L 1JC7A 5C0XJ 1NNXA 4NMZA 2F0SA 2R7FA 1PH8A 2F0UA 1Y69U 1PVOA 3MXGA 4LFBL 2FMCA 1SE2A 3STBD 1SE3A 5JJLA 4OX9L 4OWWB 2RHSB 3BYYB 4ZYSA 1DD2A 5EJWA 4BY7B 2E2HH 5HGTA 2UXBQ 1QWYA 3FP9A 5C4JH 2HT1A 4TVAB 1LV9A 1CSQA 2I5MX 5EAYA 3K58A 1H9JA 1IBMQ 3LX0A 4K8JA 2B63G 1N9WA 4J1MA 3RN5A 3RLOA 1PV4A 1G91A 3HKSA 4OIKA 2SDFA 1LTSD 1JORA 1Y8PB 1PRTB 2NVQB 2ZM6L 4BS9A 1EZ6A 5GAHC 3TP8A 3T1HQ 3BS1A 4AYBG 1OO9B 3HOWB 3A54A 4EQOA 3NQTA 4IFDG 1SNCA 2B3GA 2CQAA 4C3JH 3MTSA 3CCJA 2G9HD 1ET9A 2EYPA 1KQSA 4KHVA 1O78A 2ZT9C 4A3FB 1YIJA 3PV0A 4A3DB 2UUBQ 1QOHA 1VQBA 2Z6KA 3E6ZX 2B2WA 1HRJA 5IP7H 1SE4A 2CFMA 4H02A 3I3CA 1G2TA 2Z1CA 4X3UA 1L0WA 1SFOB 4A3JB 3HKZE 1M8AA 1JICA 3GP7A 3AFPA 3HFZB 1PH1A 1A3VA 2EOTA 4WJ3M 3AFQA 1MJCA 5EPJA 1XPUA 2E5LL 2JA5H 4GS3A 5LL6X 5KNBA 1A3UA 2K50A 2NVTH 3IFDA 4Q5VA 2BCOA 2TSSA 2D9UA 1C48A 3ULLA 2E2JH 3N52A 1KIXA 4CKEA 1O7IA 3HOUH 4KKUA 1PYBA 4JW0A 1JOQA 1DYQA 4A3MB 5EBDA 4HTHA 4B3RQ 4DK0A 2UXCL 3A5ZB 2R6GA 3I4LA 4IUQA 3CC4A 1A2TA 4NP5A 4BBRG 1E2WA 3GO5A 5HURA 1I6HH 2FXQA 2PYKA 2QDBA 4ZLTF 4JPBW 4DUYQ 3KF8B 1BCPD 1G8ZD 3A7AB 4A3GB 3NTHA 3OW2A 2GVBA 3LWUA 2JK8A 2KENA 1RHPA 3C1EA 4ILWA 2KECA 4Y7NH 1STYA 4FF3A 2LSSA 2R92B 1ONLA 1CZWA 1WVLA 5AFWA 2WB1B 1TWGB 2BE5D 3PO2H 4NXNL 2PPBC 3CCMA 4P74A 4XQNA 1HR0Q 4LAAA 1X3GA 1IXRA 2LS01 1WTVA 4B3MQ 1TQOA 1S5DD 1GJXA 1OTCA 4HCSA 3I56A 2NZHA 4X66L 3NXWA 1I4GA 3I55A 4B3SQ 4KY6A 2H1EA 1EYGA 2NUCA 4A3KH 2E2HB 1KLGD 2A73B 5C4JB 4LF7Q 3KF8A 1B1ZA 5KNDA 1EQVA 2WAQG 1EWHA 1AE2A 3CCRA 3TP6A 1SNDA 1G51A 2O5JC 3J7AF 5EBCA 1VMPA 4S3SA 4JK1C 4UDUC 1GXDC 5E4WC 1YITA 4U68A 1HR0L 5IGFA 1TXYA 5ISRA 2F0NA 3S1NH 2AUJD 4C3JB 1Z47A 1WTQA 4B3ML 4CGYB 3HRZC 1GD7A 1NCVA 1P16A 3PSIA 1OXXK 3K0YA 2EXDA 4RKBA 2PNHA 4DV4Q 2EYJA 2PZUA 5M3FG 4B3SL 4JI7Q 3BZCA 1H9SB 4MN3A 4DKAC 4FDBA 5C0XH 1IHZA 4P73A 3W5OA 1D5ZC 2IJ0A 2KCMA 4ZCKA 1J5EQ 1EEID 5C4HA 3O13A 4RCOA 1A2UA 2IY5B 3ND9A 3FMCA 1SBBB 4YHHQ 1JB7A 5JJZA 1EY4A 1EL0A 3TP7A 2I46A 2SNMA 3DM3A 2JA5B 1X9NA 1GUNA 2NVTB 1PDQA 2I07B 3T4AC 2E2JB 2P5ZX 1IYJB 3PUVA 2HQEA 2F52A 5CV5A 4K6LA 3HOUB 2D62A 5JOBA 1BCPB 1FJGQ 3PGZA 3RZOH 1A15A 1QJOA 5C3EH 4JI7L 4DR1Q 3U50C 3NBHA 1CTMA 4BWGB 1XMOL 3D4RA 3H3VC 1H9SA 5ELFA 1MHWC 4LF5Q 2R93G 4JOIA 4QMGA 1CA5A 1DOMA 1MGSA 4AH6A 2MNAA 1S40A 4N8X1 3VA7A 1I6HB 4XT3B 5LHY1 2YYZA 3PF5A 1IBKL 2XRSD 4M8AA 4YHHL 2BDNA 3HOZH 4OWTB 3HOVH 3S1MH 2K33A 1X56A 4H13C 2ASBA 5FO7B 4OL7A 4ZKCB 4Y7NB 1QE6A 1NSNS 4QL5A 1GHKA 3SK4A 4OELB 1RODA 2G9DA 3PO2B 3TEHB 5EKKA 4BY7G 4JBMA 4JYAQ 4H44C 3TS0A 2CWPA 3WWVA 2GA4B 3HOXG 5M5XH 3C3LA 1HQRD 4O42A 3NSWA 4K2KA 1BF4A 3I4NG 2ZXRA 4AQYQ 4DR1L 1WI5A 3G6JB 2XVSA 1F2MA 1FNUA 1WTHA 4JCVE 5G3LF 5GQOA 4A3KB 1QILA 1TWFH 4HN7A 4A3BH 4DR3L 3OOCA 3GDEA 1QVFA 2F0JA 3CCLA 2KEDA 2WINB 1E3PA 3SHLA 5KIXA 2VW9A 1KRTA 1EY7A 1A0IA 2KJXA 2L12A 2L4NA 2JA8H 4R8NA 3W1BA 2RSOA 4MNOA 1YNJC 1J8IA 3L9AX 2E76C 5IE8A 5J1ZA 2EXZA 1XNRL 4HJ9A 2M00A 1Y1VG 4A3DG 5ELDA 2R7DA 4A3CG 3SR1A 4EQPA 3BYTB 1UNSA 3A5UA 1S72A 3S1NB 2NVXH 1K0SA 3VR5A 2XN9C 2Y0SB 3K5OA 1SEBD 4YY3Q 4A3JG 1MIUA 1CHPD 2KUMA 3CC2A 3AMUA 1DXMA 4H7BA 2UUAL 1M1KC 2AUKA 2AQ3B 2B2YA 3H15A 4JI4Q 1IL2A 4A4IA 1TVXA 3BG3A 1F9SA 1CFMA 1DGSA 1B50A 3SEBA 3T13A 1PTOC 2BA0A 3A8JE 3OW7A 4G7ZC 2F3IA 3S16H 1VF7A 4QJFA 1MJEA 4F7XA 2GN5A 3FKIH 3F1ZA 4GOPA 4ME3A 1IZ6A 4RGMA 3X3NA 4YCUA 2YTYA 3ZYYX 1TWHH 2F0OA 3TMEA 2KVMA 2KHSA 3RZOB 2Q2HA 3QB3A 5C3EB 2NTSA 3WOEA 1YHBA 1F77A 1V43A 4LF4L 3TRZA 1O80A 3CF5A 3NHHA 1VQFA 4OXPA 3QO2A 4C2MH 5IYBG 4LWCA 4JI4L 1WCMB 1EYCA 3OIQA 2R92G 3J7A5 2WB1G 1VQCA 4JVZA 2MFIA 5IP9G 1IKLA 2K01A 1YI2A 3HOVB 3S1MB 2RCFA 2D0PA 3G48A 1NTGA 3TREA 4C3IH 1B53A 4NB3A 3H3VI 1HR0W 3K6OA 2Z4IA 4XYOA 2WKCA 5CV7A 1LT4D 4GNXB 1YHAA 1VQGA 2MO0A 5IGBA 5J22A 3SK6A 1DM0B 1LO5D 1ZYRC 4P72A 1JWUD 5M5XB 3M4YA 4FF2A 4R1JA 1HUMA 3J7AV 2K28A 3ERSX 3MEFA 3QIAA 4JI5L 4DV6Q 2NN6H 3VYRA 4OO1G 1TWFB 1X3FA 3I70A 3CCSA 1UWVA 1JR0D 3H0GG 1PRTF 3A0JA 3X3MA 1JCKB 2JA8B 2ES2A 2Q2IA 3WDNA 2IW3A 1ENAA 4C3JG 4JI3Q 1E0BA 4LF6L 4EX5A 1S4ZA 1EOVA 3UDIA 3Q0AA 4FXGC 4B3TL 1TWAH 2PO4A 4GNXA 5C4XH 5C3XA 2RBMA 2JA7H 2PQAB 2IX0A 2K5QA 5IP7G 4NXMQ 4KKTA 2M2LA 3GTKH 1AH9A 2NVXB 4I65A 5I9OA 1I4RA 1WYDA 4JG2A 4LJZC 4IUNA 4TKOB 3U9OA 2E2DC 2CW0D 4RWSC 1PFMA 3J81j 2DNEA 1PYWD 1IYVA 4YWMA 1R9TH 5EKIA 3IKJA 3PO3H 3FPPA 2Y0SE 1WFQA 4QY7A 3Q24A 1NBWA 3HKZB 1F2LA 1QUQB 3A7LA 1SYGA 5E7NA 3S16B 3H94A 3HOUG 2RVLA 1HXYD 2QGQA 2QKIC 3FKIB 4FVMA 3G4SA 1VQ8A 2PQAA 3WOFA 4HAEA 4GKJL 1IKMA 3QG1A 3KDFB 1UEAB 5KEEA 2B2VC 1ESRA 1IW7C 1KAAA 2UXDQ 4KJOA 1VF5C 3CC7A 1PTOD 1Y8OB 3T53B 4DR4Q 3C2PA 1C4QA 4DV1L 4J8QA 2N78A 2XWJB 3K80C 1MD2D 2UUCL 1HNXL 4C2MB 3R8BA 4A93G 2O2LD 2QILA 3MXNB 4LFBQ 1D1IA 1HTLD 3I4MB 3TZDA 3K7AH 1QZGA 1VMCA 3PO2G 3ER0A 4A3MH 1SRUA 4RH6A 1GKHA 3VR4A 1HTPA 2VB2X 5FJ8G 1X54A 1M4VA 4BBSH 5L37A 4O2DA 2JP1A 4KN7C 1EU4A 3ONAB 1G291 1TU2B 3HG9A 1LM0A 1QNKA 4C3IB 3KYHC 1Q1EA 3W2DA 2Z9HA 4A3GH 3L3OC 2B2UC 4A3KG 3KDFA 1D1KA 1L2FA 3F2BA 1ASYA 4I7AA 2ZXPA 3VDYA 1ICWA 3CU7A 2EVBA 3W3AA 2UXDL 3HS0C 2IT1A 1GOZA 1FGBD 2KCCA 1JB3A 1B9MA 1I4QA 2EY5A 1OXVA 3HEJA 3KJOA 1YNND 3S15B 5BR8L 2R61A 3DWPA 1E2ZA 1KDAA 3MXNA 1TY0A 2F4IA 4DR5L 1J6QA 3BDOA 2KBNA 1PH4A 1JE4A 1VQ6A 2EY6A 1B3AA 4PMWA 2V1CC 4DR7Q 2RCNA 1I50H 1XPOA 4PZ6A 5HGQA 2EPBA 4QIWB 4ME5A 2JEBI 3IAYA 1TWCH 1FNVA 1TWAB 3MAQA 5C4XB 4PMCA 1PH6A 4K5VA 4NDXA 2JA7B 4GN3B 1JT8A 2OF1A 1TS2A 1OXSC 5JEAG 4DR6Q 1SROA 1DONA 1LTTD 1RKNA 5C0XG 1WTPA 3GTKB 2E5LQ 4C3HH 3IRBA 3CCVA 2DUDA 3KLSA 1U4LA 2ATWA 3S9WA 1KHIA 4GLVB 2ZTCA 3M9BA 2CVRA 3KBGA 2EJMA 1LLRD 4XQQA 1AN8A 3S1QB 1R9TB 1P8LA 1BBWA 1O7YA 3J81c 2F4VL 3PO3B 1LTLA 5D65A 1U0LA 3N6RA 4A3EH 2N3SA 1G6ZA 1S5BD 4CDDC 4RA8A 1LTBD 4DR7L 2UXCQ 1EIFA 4WJ4A 4LFCL 4DK3C 4HIDA 1VQ4A 2MGSA 1F9QA 1Q46A 2EJFC 2F0QA 2K1BA 2EYLA 5C3EG 3I4OA 4X65Q 3D3RA 4OO1I 4C1NK 1NE3A 2AWNA 3I91A 3GTLH 4DR6L 1BCPF 2HIXA 3TSSA 2DY8A 3KLWA 4V0BA 1BQQT 4DPGA 1K83H 1HA5A 3KF6B 1AFPA 1SNOA 4YCVA 2BOSA 2DNCA 1EY9A 4NXNQ 5FLMH 3D6CA 4POFA 2XNAC 3HOZG 3FRPB 3HOVG 4FYDA 5D3DA 1PH2A 4HCEA 4KN4C 1CA6A 3K7AB 1SSOA 5IWAL 4X66Q 1UE5A 5KYLA 5C4ZA 3D4WA 1E22A 5JVH3 4ABNA 2DJGC 3K8AA 3SE0A 4BBSB 2HCIA 2A5HA 1Q8KA 1IW7D 5M3MH 2NZOA 4HIKA 2F0WA 1BO0A 1D6EC 4X65L 1NAPA 1E24A 1GVPA 3A8IE 5M5WH 1XNQL 3C46A 2A1AA 4CJ2C 4A3BG 2OEOA 2F0KA 2Q8TA 5F2DA 4HR7B 4POGA 1XJVA 3KF6A 3P20A 3FEWX 4YWLA 4KLKA 1Y8NB 1QB5D 4DNRB 2MHVA 4LFAL 5FO9B 3VYTA 2JA8G 2XIWA 4LF8L 4KD3A 2JE6I 3KK7A 2PNRC 2Q8RE 4PV1C 1Y1WG 4HJ8A 1RTNA 2A8VA 1E2VA 4PZ7A 5IYDH 4X3TA 2QW7A 3GTQH 4X62Q 2OQKA 4K0KQ 2D5DA 4R4IA 2KEEA 4DF7A 3EFXD 1I50B 1A3TA 2K04A 2BDOA 1GO3E 3OIPA 2Q8IB 4DAYB 3EJIA 1TWCB 1A8VA 2EIFA 2RQXA 1NR2A 4JBWA 3NWTA 2MQHA 1YHQA 1JWMD 4PG3A 3T1YQ 3SK8A 2OTJA 1Z6HA 2ZJRA 1SLJA 5M9OA 2G5DA 2ZTDA 4C3HB 1E1TA 2Z8LA 4QIWE 1I3QH 5ELBA 3HKZG 3MXPA 4P75A 4K8IA 3E5SA 2SNSA 3NTIA 3K5NA 4EGVA 1AE3A 3U58A 1VS0A 1SJED 4L5RC 1AZPA 5ELCA 1L1OB 3KJPA 4GN5A 3FKIG 1U9RA 2YTVA 2AKWB 4X62L 1CM9A 1SMXA 4K0KL 4QF4A 4A3EB 2EYOA 3NBHB 4GKKQ 1XMOQ 1SMYC 3DEOA 5KNCA 2CH4A 2KOLA 1DCZA 2RDHA 1QVGA 1SNQA 4JI0L 2LKVA 5CGKA 3EA6A 4DAYA 1H9KA 1HZCA 5CBAE 5A2QE 2JSOA 5ELOA 1IL8A 3MFGA 3T1YL 1IBKQ 2B63H 3GTLB 1AW7A 2L11A 4JI1Q 1K83B 1JWSD 5IGCA 2E8GA 3SK5A 4PNYA 1HPCA 3P1HA 1AEXA 3R93A 1D5XC 2A6EC 1C8CA 1UE1A 4V190 4LUVA 1EIHA 1L1OA 3G71A 1TS5A 4C3IG 4B08A 1STNA 3CW2C 5DM73 1PLFA 2DGYA 2XSCA 1F2ZA 1O7ZA 3I2ZA 4JI8Q 4GKKL 2IPKD 3URYA 2EYMA 2JA6G 1KC8C 1SDFA 4DR3Q 3CPWA 2RF4A 1WCMH 3OMGA 2CHBD 5M3MB 4IFDI 1HCZA 4IOAA 3CP0A 2R7ZH 3L2PA 5M5WB 2ENBA 1T5EA 2F0GA 4IPHA 4A75A 2SOBA 2NN6G 5BN5A 4JI1L 3G7LA 4BA1I 5CV9A 3CQZH 4A76A 3GV6A 1XNRQ 4OHJA 3OHXC 2A68C 2VZAA 5C5LA 2NBFA 5C44B 4JI6Q 4RGOS 1JJ2A 4K14A 3J81E 4KKSA 4BY1H 1TY2A 3NE5B 3CMAA 3S14H 3GTQB 2F1MA 1DZ1A 4JI8L 1F2YA 1GUSA 2EJGC 3AYHB 4NKLA 2JA7G 1N34L 4ODGA 1MI2A 2FJ2A 2UUAQ 2Q2UA 1RF2D 4IO9A 1WTWA 3A55A 2L0CA 1EFID 3ZJYC 1DOKA 4BBRH 5I4DA 3HOWG 1EUJA 4MIUA 3I90A 2K52A 5FO8B 1I4HA 3G6EA 2J4XA 2KCTA 2B2TA 2NWGA 2EE1A 2B39A 3K7UC 1N32Q 4K6DA 3BVGA 4A3FG 1EFWA 1SJHD 3PO3G 4RGNA 4LF9Q 3LGJA 1I3QB 1HZBA 4LUOA 4GOPB 1UAPA 2IL8A 2Z6KC 1VQAA 2B2WC 1Z9FA 3KFUA 4JI6L 1UE6A 2E2IH 1N33Q 1TS3A 1KABA 2VUMH 1BOSA 2M9VA 3T51B 1QVCA 1VQOA 3PUXA 1XTCD 2A74C 2QCPX 5IIFA 2ICIA 4IALA 4R4TA 4HMIA 4DV2L 1PRTC 4OGQC 2HHHL 3S24A 1V1OA 4LF4Q 1NUCA 4DA2A 1Q82C 2VQEL 2CCZA 2K05A 3MXUA 2AWOA 2HD3A 3Q23A 1BUVT 2F03A 3UDFA 3GTOB 2B63B 4DNIA 5I9PA 3EBEA 1N32L 5A2QL 1W3SA 3V2TA 4CKCA 3E3XA 3AEVA 1VQIA 2F0DA 4LF9L 3GTPH 1E1OA 2I5LX 5IT9c 3I72A 1X32A 4DN4M 3PIOA 4A3MG 1RL2A 4M1UB 3NENA 2F3WA 4ID6A 4R4QA 1N33L 1EYDA 2F0EA 4BBSG 5IOCA 2B29A 1LTGD 3IFTA 2RDGA 1TS4A 1OXUA 4A3GG 4JI5Q 1K3RA 4HSVA 1JOOA 1SYEA 3CKIB 4X64L 5I6YA 3DWAA 1ILQA 5M3FH 3GTMH 4F87A 1WD1A 1X6OA 3H3VH 1V8QA 2PW5A 3I4MH 1EQQA 1Q90A 1K73C 2R7ZB 2A69C 1Z7TA 4L6TB 1NMFA 4LF6Q 1TT2A 1RCVD 1CI3M 4JBKA 1TIID 3CQZB 1K0RA 1KXLA 1CUKA 3CAMA 4B3TQ 2I0QA 1GM5A 2EZVA 2WP8J 3RMHA 2H5XA 1VQ7A 2RA4A 3LWEA 3R3OA 4DU9A 5C3WA 4J6HA 5IY0A 2KCNA 4BY1B 1A62A 4ULLA 3S14B 2QF7A 2X69A 4R8IA 3RLFA 4E6IA 3K5LA 4DUZL 3S15H 1KTKA 1U5KA 1U4MA 5DM63 3J81L 1ZEQX 4UPAA 3STBC 2KHIA 5EPLA 1BBUA 5JVG3 3CMEA 4C3HG 2OTLA 2A68D 4UP7A 1B3QA 1RDPD 1XXGA 4BBRB 3PIO3 1Q86C 1SYDA 1YZ6A 1SN8A 1XTDA 4O1NA 2HUGA 4X3SA 2X6GA 1SE8A 2X6LA 2L55A 4G4KA 2JA9A 5CBEE 4IPGA 1KAWA 1SNPA 1VQMA 2PZTA 3BDLA 5KGUA 1PH7A 2HCCA 4A3EG 1EIGA 5FK9C 1BXTA 1VQNA 4A3LH 3W1GA 4GKJQ 2F0TA 3AB9A 3OWFA 2E2IB 2IWHA 1D7QA 1SXTA 2N88A 3VR6A 1PHJA 2VUMB 2HDLA 3CD6A 1KNAA 3F2CA 1H95A 2WIIB 3HOXH 1CSPA 3I4NH 2XRQD 5I2XA 1ET6A 2JN4A 1W2BA 1YNJD 4JI2L 4DV1Q 3I73A 1WTOA 1CK1A 1HNWL 1S3OA 2UUCQ 1HNXQ 3S1QH 1L0YB 2JA5G 1LT5D 1ML0D 3F8TA 1KL9A 5EKLA 2SEBD 3P7JA 2WACA 5FLMG 4JBJA 2QEXA 1C0AA 2VS1A 2WAQB 1W6JA 4ZQ3A 4CKBA 1AZQA 1PTOH 1EY8A 2LMCB 2BH8A 3UDXA 1HUNA 3GTPB 3PF4A 1K8MA 2KQ3A 1PRTD 1EQTA 3TS2A 1RIPA 4I7ZC 1Y1VH 4CDEC 3DLLA 4A3CH 1YBYA 2CWAA 1UEBA 1WD0A 3D4DA 1XWEA 4JOIC 3UE1A 5M3MG 3J81i 3OYYA 4G7HC 4DV5L 4UHVA 4DAVA 1B2TA 3RZDH 1B44D 4UP9A 3RLNA 3S17H 1LACA 3MWYW 1EOTA 2ALYB 5BR8Q 5M3FB 1SNMA 3GTMB 1UE7A 3IL8A 3J7YW 2N8NA 2LXJA 1VQPA 1QG7A 3M85A 1H9MA 4L5TA 4DR5Q 2PQEA 5FOBB 4H0LC 3Q22A 1MSGA 3CXCA 2N55A 1KDCA 1GHJA 2YV5A 1BR9A 1BCPC 3R2IA 1N36L 4DK6C 5IYDG 3CCEA 3L7ZC 1LUZA 1CQFA 5COYA 4Q0FA 4KD4A 3ULPA 1II3A 3VYSA 5IGDA 2K7VA 3Q6SA 5DNFA 4HSPA 1LT6D 4IUPA 1Q1BA 4TSSA 3TN2A 2NTTA 2BE5C 4K5WA 2J0TD 3RD4A 4FF1A 4BXXH 4G7OC 4A3IH 2GVAA 2BH2A 3CHBD 1CKNB 3DHQA 3NP8A 4LNQA 5J39A 3BVMA 4CDCC 2E74C 3SXHA 3V96A 1C9OA 2PCFB 3RN2A 1Q81C 1FNWA 2OT2A 1MSHA 1Y14B 5NUCA 1EY0A 1SYBA 4J15A 3QWNA 5T1IA 2F4VQ 5IYBH 3NQIA 5FLXc 4KI0A 2WKDA 4RKLA 3U4ZA 1ZYRD 5BN3A 3PCOB 2B8GA 1STBA 1NMGA 2D0OA 4QB4A 4DV0Q 2C5CA 5IP9H 3J80L 4LFCQ 2XGTA 1SYCA 3VR3A 1AP0A 5D14A 2Y0SG 5IT9E 3R2TA 2LFNA 2IX1A 1YJ9A 3I7FA 4JC0A 5IYCH 1Q8IA 3P75A 4L5QA 4RHSA 2HIVA 4IFDJ 1STGA 1W6KA 5K36H 3UI2A 1CKNA 2B2YC 5A35A 3NTKA 4MZ9A 3HOXB 3I4NB 4IPDA 4Z9CB 2EYHA 1YVCA 1FR3A 2CKZB 1E7ZA 3HGBA 4OO1H 1SR3A 2RHQB 4X3KA 5KRUA 5IWAQ 4GOPC 4EVOA 1X3EA 1ASZA 4DV0L 3H0GH 2LY7A 3LNNA 4OWXB 2L1BA 1VQEA 4IUTA 1PTOB 2WV6D 1K8OA 4WORA 3K57A 1LTRD 5AJ3Q 1XNQQ 3HOYH 1Y1VB 4NW2A 4QCLA 3DUZA 2QA4A 2K5HA 3GTJH 2WAQE 2JJQA 1WCMG 2UXBL 5CMDA 5JPMC 2AQ2B 1KRSA 4FO2A 3EIVA 5GAEC 4LFAQ 3RZDB 1N8RC 2R7ZG 3I8ZA 4K2LA 1IBML 3S17B 3M7GA 1H9RA 3V05A 3NPPA 2NVYH 1WJJA 4LF8Q 1OXTA 2PMZB 2J7ZA 1RTOA 2KHJA 3FVQA 5JAVA 4DV3Q 1NY4A 3RNUA 3H09A 1R4QB 3J80i 3T1HL 1J9OA 4R4OA 1XX8A 4IUVA 4ZUJA 2D2CC 5DLQE 2FMMA 3JC66 4DNTB 4PZ8A 2ID0A 3GV3A 3M4OH 4R9WA 4RMFA 2B8FA 2F0VA 4BY1G 2HQLA 2CH4W 3SVMA 5AJ3L 2FINB 1EQRA 2VY3A 2K6AA 3ITPA 1X65A 3EROA 1YEZA 5E4XA 3SGIA 2UUBL 3GQBA 1NJIC 1WOCA 4A3IB 2QEJC 1Q12A 1BDOA 1STAA 1PZID 1PMRA 5C6AA 5C44H 4XDXA 3JAME 3U4VA 2PZWA 3RUZA 4DV3L 4KY5A 2DN8A 4IUUA 2EY2A 1YJWA 4UY8C 4PQXA 3PUZA 4GNXC 4A93H 1L0XB 3AU7A 5ELEA 4HIOA 1S5CD 3DEPA 4FP5D 2F0PA 1PH5A 1TKWB 4JI0Q 2VUMG 1X3QA 1CHQD 1HZAA 3CRLC 5FJ8H 3RR5A 1GUWA 1I4PA 5IT9L 1ENCA 1O7LA 4B3RL 5EQ0A 3PQIA 3K81C 4HJ5A 2NZ1D 3BZDB 3MZ5A 3BU2A 3E0JA 1K8AC 1VQDA 4Y52H 3KLRA 4DUYL 1NR4A 3FDTA 4F8MA 5CYUA 5LMNQ 2Q2TA 2MUYA 1QNUA 2ZXOA 3M4QA 1FYCA 5K5PA 1JJGA 3M3YH 1KDBA 1GUGA 3A56A 1ZKOA 4XXEA 2VQFQ 1IYUA 3NELA 5GROA 3H0GB 2WFWA 3PIPA 1HA6A 1GUOA 4L8JA 4PMBA 3BVZA 3J80c 4IURA 3GTOH 5JPNC 1TR5A 3HOYB 3GTJB 4KJNA 5JEAH 3I4MG 1MBYA 3CPFA 3B6YA 1LABA 4LF7L 1T9HA 3QR8A 1VQHA 2DY7A 5LMNL 2NVYB 4DFAA 1HFGA 3MEHA 3ULJA 4IFDH 4IJHA 5DAUA 5I6WA 1B8AA 1FGUA 5FLXE 5GADC 1B4OA 3NBIA 5C5MA 1RJTA 2VQFL 4KY7A 4P2CB 5C0XI 1N34Q 2K5DA 4KV6A 1PA6A 3UDGA 1IBLQ 1K28A 2Z0SA 2PMZE 4L5SA 2NYZD 4YIJA 3M4OB 4ZRZA 1HZ9A 1MKHA 5E1FA 2K5NA 3K0XA 1JOKA 4QUCA 3J7ZC 2ZJQA 4LMQD 4DV4L 2AHOB 4MHEA 3DXJC 5M5YH 1B70B 4GZYC 1KD1C 2LXKA 4DAPA 1PXUA 2DJFC 3NK9A 2B2VA 1J5EL 2EYFA 2RKSA 2MJ8A 3DM1A 4DK1A 3PIP3 2O4XA 4IPCA 2XWBB 3E9HA 4MTKA 3TQYA 4R4CA 1D5MC 2VXWA 2OQ0A 2H4OA 4O0AA 3A74A 2L5TA 1CKOA 1QCBD 2IX3A 4ALPA 5C4XG 4A93B 1PH9A 4AIMA 3JAML 1EWCA 3E0EA 4DV2Q 2HHHQ 4A3LG 4EQNA 5EGTA 4IZ8A 3NUCA 1IBLL 1SYFA 2FFKB 4YCWA 1PFBA 2VQEQ 2NB0A 1A63A 3DMUA 1KLUD 1Q7YC 5ELNA 3MVVA 1ILPA 1FJGL 1PFSA 3S1RH 1LTID 3BZKA 2BA1A 1I5FA 1YJNA 1JJCB 2WB1E 1ZXTA 1HNZQ 2B2UA 1STHA 5LMUQ 4FF4A 3A8KE 1B9NA 1ESFA 2OWOA 2A6HC 2PI2A 3ERQA 3QOLA 4LF5L 4CJ1B 3EN2A 4KTAA 4RGTA 3OTOQ 4XT1B 1CT1D 3FPUB 3BDCA 5CV4A 4P71A 3VR2A 4U673 4OEMB 5J3BA 3MFYA 2F0MA 1DOLA 4ZAIA 2OCEA 1BBXC 3K59A 3MC0B 1VQ5A 5EPKA 2VL6A 2K32A 1FVIA 2CW0C 1G2SA 1UUPA 3KOJA 3UE0A 3M3YB 1Y1WH 3EVQA 3VYUA 2K75A 4GLXA 3OMCA 1X55A 2F0LA 2VB3X 4FNFA 4QUFA 4OIJA 4X64Q 3PUYA 4FXKC 2RSNA 3AQQA 4ZKBB 2EDGA 4JYAL 1F9PA 5E3FA 1VCIA 2MO1A 1S5ED 1WTXA 3HZXA 4QQBX 2I5HA 2F0FA 2A19A 3F2DA 1PYSB 5G3LD 4AQYL 1HNZL 2R3ZA 5LMUL 4DAMA 4FXDA 3M4PA 1VQJA 2PW7A 1LT3D 2JXMB 3OTOL 3D31A 1R4PB 5D3IB 1EZ8A 2VNUD 1S5FD 1SMYD 2AMCB 4C1NI 3CCUA 3M7NA 4AYBB 3OSOA 1VQ9A 3KUPA 3JAMi 3H91A 2K03A 5CV6A 5GAGC 3CCQA 3MHBA 4DV7Q 4EQ5A 3D0FA 2K14A 4DUZQ 1YNXA 4GN4B 3NEMA 2F3VA 3PUWA 4LK1C 5FLXL 4BXXG 4A3IG 4ZUIA 2O5IC 5JJKA 4B9WA 2C9OA 3SDZA 2A6ED 3OPOA 4X6AH 4YY3L 1LTAD 1VDZA 2V4DA 5M5YB 2L9HA 3S2HH 1FL0A 2MP1A 4HIMA 3GTGH 1EIYB 2JYOA 5DEHA 3GD7A 1BNZA 3S2DH 4IQZA 4IJLA 1K9MC 1U4RA 3HOZB 2PI2E 4UAIA 1YNNC 4DV7L 1QZHA 4RAUC 1EU3A 5IYCG 3Q8DA 3FHWA 4JI2Q 5JJIA
chains in the Genus database with same CATH topology
3T16A 2RDFA 1CZGA 5K36G 4WJWA 3J80E 1PFNA 2K5WA 1V1PB 3T56B 4ZK9B 4CBVA 3S1RB 4DXFA 3VA5A 4N9TA 3HP3A 4KHZA 1GUTA 1JQYD 1D2BA 1PZJD 4A3BB 4DXGA 4TRDA 3QJYA 4RHRA 1CQVA 4XYQA 5IGEA 3D6WA 5I2YA 5TSSA 3QOJA 1SAPA 2NN6I 1Y1WB 4B9XA 1WTRA 4HMJA 4K5XA 3OWEB 1PTOF 3TDQA 1RD9D 4HEDA 2A6HD 3KBXA 4KK7A 1V1PA 2KA7A 2Z4HA 1X3PA 1HQMC 1HHVA 1KNEA 3F2UA 4F88A 2F0HA 5T1GA 1U4PA 1Q3LA 4KMUC 1I4XA 5CORA 4WRDA 1PZKD 4WFN3 4TQUS 1FD7D 1F9RA 3EQLC 1A6XA 4L63B 5KYIA 1DJRD 4CHTB 4XQJA 4CJ0B 5CR3A 4C56C 5IODA 2HDMA 1EEFD 1HFNA 4DGZA 2AQ1B 1T5XD 3D8GA 2JEAI 5CV8A 3MA2B 3TZUA 2F0IA 1TWHB 3PMFA 5CC4A 2E75C 3TBIB 3H6MA 2ICEC 3S2HB 3GTGB 3CRKC 4IN3A 5FKAC 1EY6A 5IGGA 4RFBA 1STEA 3S2DB 3DWQA 5BN4A 3U9SA 1EYAA 1I6VC 2EY1A 2OXPA 3C1FA 2A69D 2FHTA 4BA2I 2TMPA 2B2TC 4RCNA 4G57A 3NWSA 4N9PA 3KLSX 2YU9B 1ENFA 2JA6B 3K5MA 2R93B 4XTCS 1XYIA 3ND8A 3TP5A 5LL6S 2MPMA 4XIGS 1EY5A 5JEAJ 1JC7A 5C0XJ 4NMZA 2F0SA 2F0UA 1Y69U 3MXGA 2FMCA 1SE2A 1SE3A 3BYYB 4ZYSA 1DD2A 5EJWA 4BY7B 5HGTA 1QWYA 1LV9A 3K58A 1H9JA 3LX0A 4K8JA 4J1MA 1G91A 4OIKA 2SDFA 1LTSD 1JORA 1Y8PB 1PRTB 2NVQB 4BS9A 1EZ6A 3TP8A 3BS1A 1OO9B 3HOWB 3A54A 4EQOA 3NQTA 4IFDG 1SNCA 2CQAA 3MTSA 2G9HD 1ET9A 2EYPA 4KHVA 1O78A 2ZT9C 4A3FB 3PV0A 4A3DB 1QOHA 3E6ZX 2B2WA 1HRJA 1SE4A 3I3CA 1G2TA 2Z1CA 4X3UA 1SFOB 4A3JB 1M8AA 1JICA 3GP7A 1A3VA 2EOTA 5EPJA 5LL6X 5KNBA 1A3UA 3IFDA 4Q5VA 2BCOA 2TSSA 2D9UA 1C48A 3N52A 4CKEA 4KKUA 1JOQA 1DYQA 4A3MB 5EBDA 4HTHA 4DK0A 3I4LA 2R6GA 4IUQA 1A2TA 4NP5A 1E2WA 3GO5A 5HURA 2QDBA 2PYKA 4ZLTF 1BCPD 1G8ZD 3A7AB 4A3GB 3NTHA 3LWUA 1RHPA 3C1EA 4ILWA 2KECA 1STYA 4FF3A 2R92B 1ONLA 1CZWA 1WVLA 5AFWA 2WB1B 1TWGB 2BE5D 2PPBC 4XQNA 4LAAA 2LS01 1WTVA 1TQOA 1S5DD 1GJXA 4HCSA 3NXWA 1I4GA 4KY6A 2H1EA 2NUCA 2E2HB 1KLGD 2A73B 5C4JB 3KF8A 1B1ZA 5KNDA 1EQVA 1EWHA 3TP6A 1SNDA 2O5JC 3J7AF 5EBCA 1VMPA 4S3SA 4JK1C 4UDUC 1GXDC 5E4WC 4U68A 5IGFA 5ISRA 2F0NA 2AUJD 4C3JB 1Z47A 1WTQA 4CGYB 3HRZC 1NCVA 1OXXK 3K0YA 4RKBA 2EYJA 2PZUA 1H9SB 4MN3A 5C0XH 1IHZA 1D5ZC 2IJ0A 1EEID 5C4HA 3O13A 4RCOA 1A2UA 3ND9A 3FMCA 1SBBB 5JJZA 1EY4A 1EL0A 3TP7A 2I46A 2SNMA 2JA5B 1GUNA 2NVTB 1PDQA 2I07B 3T4AC 2E2JB 3PUVA 2HQEA 5CV5A 4K6LA 3HOUB 2D62A 5JOBA 1BCPB 1A15A 1QJOA 3NBHA 1CTMA 4BWGB 3D4RA 3H3VC 1H9SA 5ELFA 1CA5A 4QMGA 1DOMA 1MGSA 3VA7A 1I6HB 4XT3B 5LHY1 2YYZA 2XRSD 4M8AA 2BDNA 2K33A 4H13C 5FO7B 4OL7A 4ZKCB 4Y7NB 1QE6A 1NSNS 1GHKA 3SK4A 1RODA 2G9DA 3PO2B 5EKKA 4H44C 2GA4B 3C3LA 1HQRD 4O42A 3NSWA 4K2KA 1BF4A 2ZXRA 3G6JB 2XVSA 1F2MA 1FNUA 5G3LF 4A3KB 1QILA 4HN7A 3OOCA 2F0JA 2KEDA 2WINB 5KIXA 3SHLA 1EY7A 2KJXA 2L12A 2L4NA 4R8NA 2RSOA 1YNJC 1J8IA 3L9AX 2E76C 5J1ZA 2EXZA 2M00A 5ELDA 3SR1A 4EQPA 3BYTB 1UNSA 3S1NB 3VR5A 2XN9C 2Y0SB 3K5OA 1SEBD 1CHPD 2KUMA 3AMUA 1DXMA 4H7BA 2AUKA 2AQ3B 2B2YA 1TVXA 3BG3A 1F9SA 1CFMA 1B50A 3SEBA 3T13A 1PTOC 2BA0A 3A8JE 3OW7A 4G7ZC 1VF7A 4F7XA 4RGMA 3X3NA 3ZYYX 2F0OA 3TMEA 2KVMA 2KHSA 3RZOB 3QB3A 5C3EB 2NTSA 3WOEA 1F77A 1V43A 1O80A 3NHHA 3QO2A 1WCMB 1EYCA 3OIQA 1IKLA 2K01A 3HOVB 3S1MB 1B53A 3K6OA 2Z4IA 4XYOA 2WKCA 5CV7A 1LT4D 5J22A 5IGBA 3SK6A 1DM0B 1LO5D 1ZYRC 1JWUD 5M5XB 3M4YA 4FF2A 1HUMA 3J7AV 2K28A 3QIAA 2NN6H 3VYRA 4OO1G 1TWFB 3I70A 1JR0D 1PRTF 3X3MA 1JCKB 2JA8B 3WDNA 2IW3A 1ENAA 4C3JG 1E0BA 1S4ZA 3Q0AA 4FXGC 2PO4A 5C3XA 2RBMA 2IX0A 2K5QA 4KKTA 2M2LA 2NVXB 4I65A 5I9OA 1I4RA 4LJZC 4IUNA 4TKOB 3U9OA 2E2DC 2CW0D 4RWSC 1PFMA 2DNEA 1PYWD 1IYVA 5EKIA 3IKJA 3FPPA 3Q24A 3HKZB 1F2LA 3A7LA 1SYGA 3S16B 3H94A 2RVLA 1HXYD 2QKIC 3FKIB 4FVMA 3WOFA 4HAEA 1IKMA 3QG1A 1UEAB 5KEEA 2B2VC 1ESRA 1IW7C 1KAAA 4KJOA 1VF5C 1PTOD 1Y8OB 3T53B 3C2PA 1C4QA 4J8QA 2XWJB 1MD2D 4C2MB 3R8BA 2O2LD 2QILA 1D1IA 1HTLD 3I4MB 3TZDA 1VMCA 4RH6A 3VR4A 1HTPA 2VB2X 1M4VA 2JP1A 4KN7C 1EU4A 3ONAB 1G291 1TU2B 3HG9A 1QNKA 4C3IB 3W2DA 1Q1EA 3L3OC 2B2UC 1D1KA 2ZXPA 1ICWA 3CU7A 2EVBA 3W3AA 3HS0C 2IT1A 1GOZA 1FGBD 2KCCA 1JB3A 1B9MA 1I4QA 2EY5A 1OXVA 3HEJA 1YNND 3S15B 2R61A 3DWPA 1E2ZA 1KDAA 3MXNA 1TY0A 2F4IA 3BDOA 1JE4A 2EY6A 1B3AA 4PMWA 2EPBA 4QIWB 4ME5A 2JEBI 3IAYA 1FNVA 1TWAB 3MAQA 5C4XB 4PMCA 4K5VA 4NDXA 2JA7B 2OF1A 1TS2A 1OXSC 5JEAG 1DONA 1LTTD 1RKNA 5C0XG 1WTPA 3GTKB 3KLSA 1U4LA 3S9WA 2CVRA 3KBGA 2EJMA 1LLRD 4XQQA 1AN8A 3S1QB 1R9TB 1O7YA 3PO3B 5D65A 3N6RA 1G6ZA 1S5BD 4RA8A 1LTBD 2MGSA 1F9QA 2EJFC 2F0QA 2K1BA 2EYLA 4OO1I 3D3RA 4C1NK 2AWNA 3I91A 1BCPF 3TSSA 2DY8A 4V0BA 1BQQT 1HA5A 1AFPA 1SNOA 2BOSA 2DNCA 1EY9A 3D6CA 2XNAC 3FRPB 4FYDA 5D3DA 4HCEA 4KN4C 1CA6A 3K7AB 1SSOA 5KYLA 5C4ZA 3D4WA 5JVH3 4ABNA 3SE0A 4BBSB 2HCIA 2A5HA 1IW7D 2F0WA 1BO0A 1D6EC 1NAPA 3A8IE 3C46A 4CJ2C 2OEOA 2F0KA 2Q8TA 5F2DA 4HR7B 3P20A 3FEWX 1Y8NB 1QB5D 4DNRB 2MHVA 5FO9B 3VYTA 2XIWA 4KD3A 2JE6I 3KK7A 2PNRC 2Q8RE 4PV1C 1RTNA 1E2VA 4X3TA 2D5DA 2KEEA 4DF7A 3EFXD 1I50B 1A3TA 2K04A 2BDOA 3OIPA 2Q8IB 3EJIA 1TWCB 2RQXA 1NR2A 4JBWA 3NWTA 1JWMD 3SK8A 1Z6HA 5M9OA 4C3HB 2Z8LA 5ELBA 3MXPA 4K8IA 3E5SA 2SNSA 3NTIA 3K5NA 4EGVA 1SJED 1AZPA 5ELCA 1U9RA 1CM9A 4QF4A 4A3EB 2EYOA 1SMYC 3DEOA 5KNCA 2KOLA 2RDHA 1DCZA 1SNQA 2LKVA 5CGKA 3EA6A 4DAYA 1H9KA 5CBAE 5A2QE 2JSOA 1IL8A 3MFGA 3GTLB 1AW7A 2L11A 1K83B 1JWSD 5IGCA 3SK5A 4PNYA 1HPCA 3P1HA 1AEXA 3R93A 1D5XC 2A6EC 1C8CA 4V190 1EIHA 1TS5A 4C3IG 4B08A 1STNA 5DM73 1PLFA 2XSCA 1F2ZA 1O7ZA 2IPKD 3URYA 2EYMA 1SDFA 3OMGA 2CHBD 5M3MB 4IFDI 1HCZA 5M5WB 2ENBA 1T5EA 2F0GA 2SOBA 2NN6G 5BN5A 3G7LA 4BA1I 5CV9A 3GV6A 4OHJA 3OHXC 2A68C 5C5LA 2NBFA 5C44B 4RGOS 4K14A 3J81E 4KKSA 1TY2A 3NE5B 3GTQB 2F1MA 1DZ1A 1F2YA 1GUSA 2EJGC 4NKLA 4ODGA 1MI2A 2FJ2A 1RF2D 1WTWA 3A55A 2L0CA 1EFID 1DOKA 5I4DA 4MIUA 3I90A 5FO8B 1I4HA 2J4XA 2B2TA 2NWGA 2EE1A 2B39A 4K6DA 3BVGA 1SJHD 4RGNA 1I3QB 1UAPA 2IL8A 2B2WC 1TS3A 1KABA 1BOSA 2M9VA 3T51B 3PUXA 1XTCD 2A74C 2QCPX 5IIFA 2ICIA 4IALA 4HMIA 1PRTC 4OGQC 1V1OA 1NUCA 4DA2A 2K05A 3MXUA 2AWOA 3Q23A 1BUVT 2F03A 3GTOB 2B63B 5I9PA 5A2QL 3V2TA 4CKCA 2F0DA 3I72A 1X32A 4DN4M 4M1UB 2F3WA 4ID6A 1EYDA 2F0EA 5IOCA 1LTGD 3IFTA 2RDGA 1TS4A 1OXUA 4HSVA 1JOOA 1SYEA 3CKIB 5I6YA 3DWAA 1ILQA 4F87A 1WD1A 1V8QA 2PW5A 1Q90A 2R7ZB 2A69C 1Z7TA 4L6TB 1TT2A 1RCVD 1CI3M 1TIID 3CQZB 2EZVA 2WP8J 3RMHA 2RA4A 3LWEA 3R3OA 4DU9A 5C3WA 4J6HA 2KCNA 4BY1B 4ULLA 3S14B 2QF7A 2X69A 4R8IA 3RLFA 4E6IA 3K5LA 1KTKA 3J81L 1U4MA 5DM63 1ZEQX 5EPLA 5JVG3 4C3HG 2A68D 1RDPD 1XXGA 4BBRB 3PIO3 1SYDA 4O1NA 2HUGA 4X3SA 2X6GA 2X6LA 2L55A 4G4KA 5CBEE 1SNPA 2PZTA 3BDLA 5KGUA 2HCCA 1EIGA 5FK9C 1BXTA 2F0TA 3AB9A 3OWFA 2E2IB 2IWHA 1SXTA 2N88A 3VR6A 2VUMB 2HDLA 1KNAA 2WIIB 2XRQD 5I2XA 1ET6A 1YNJD 3I73A 1WTOA 1CK1A 1L0YB 1LT5D 1ML0D 5EKLA 2SEBD 2WACA 3P7JA 2WAQB 1W6JA 4ZQ3A 4CKBA 1AZQA 1PTOH 1EY8A 2LMCB 1HUNA 3GTPB 1K8MA 2KQ3A 1PRTD 1EQTA 4I7ZC 1WD0A 3D4DA 1XWEA 4G7HC 4DAVA 1B2TA 1B44D 1LACA 3MWYW 1EOTA 5M3FB 3GTMB 1SNMA 3IL8A 3J7YW 1QG7A 3M85A 1H9MA 2PQEA 5FOBB 4H0LC 3Q22A 1MSGA 2N55A 1KDCA 1GHJA 1BR9A 1BCPC 3R2IA 3L7ZC 1CQFA 5COYA 4Q0FA 4KD4A 1II3A 3VYSA 5IGDA 2K7VA 3Q6SA 5DNFA 4HSPA 1LT6D 4IUPA 1Q1BA 4TSSA 3TN2A 2NTTA 2BE5C 4K5WA 2J0TD 3RD4A 4FF1A 4G7OC 3CHBD 3DHQA 3NP8A 5J39A 3BVMA 2E74C 3SXHA 3V96A 2PCFB 1FNWA 2OT2A 1MSHA 5NUCA 1EY0A 1SYBA 3QWNA 5T1IA 3NQIA 4KI0A 2WKDA 4RKLA 1ZYRD 5BN3A 2B8GA 1STBA 4QB4A 2C5CA 3J80L 1SYCA 3VR3A 1AP0A 5D14A 5IT9E 3R2TA 2LFNA 2IX1A 1Q8IA 3P75A 4RHSA 4IFDJ 1STGA 1W6KA 5K36H 3UI2A 2B2YC 5A35A 3NTKA 3HOXB 3I4NB 4Z9CB 2EYHA 1FR3A 3HGBA 4OO1H 5KRUA 4X3KA 4EVOA 2LY7A 3LNNA 2L1BA 4IUTA 1PTOB 2WV6D 1K8OA 4WORA 3K57A 1LTRD 1Y1VB 4NW2A 4QCLA 3DUZA 5CMDA 5JPMC 2AQ2B 4FO2A 3RZDB 3I8ZA 4K2LA 3S17B 3M7GA 1H9RA 3V05A 3NPPA 1OXTA 2PMZB 2J7ZA 1RTOA 3FVQA 5JAVA 3H09A 1R4QB 1J9OA 1XX8A 4IUVA 4ZUJA 2D2CC 2FMMA 4DNTB 2ID0A 3GV3A 4R9WA 2B8FA 2F0VA 3SVMA 2FINB 2K6AA 3ITPA 3EROA 5E4XA 3GQBA 4A3IB 2QEJC 1Q12A 1BDOA 1STAA 1PZID 1PMRA 5C6AA 4XDXA 3JAME 2PZWA 3RUZA 4KY5A 2DN8A 4IUUA 2EY2A 4PQXA 3PUZA 1L0XB 3AU7A 5ELEA 1S5CD 3DEPA 4FP5D 2F0PA 1TKWB 1X3QA 1CHQD 3CRLC 1GUWA 1I4PA 5IT9L 1ENCA 1O7LA 5EQ0A 2NZ1D 3BZDB 3MZ5A 3E0JA 3KLRA 1NR4A 3FDTA 4F8MA 5CYUA 2MUYA 1QNUA 2ZXOA 1FYCA 5K5PA 1KDBA 1GUGA 3A56A 1ZKOA 4XXEA 1IYUA 3H0GB 1HA6A 1GUOA 4L8JA 4PMBA 3BVZA 4IURA 5JPNC 1TR5A 3HOYB 3GTJB 4KJNA 5JEAH 1MBYA 1LABA 2DY7A 2NVYB 4DFAA 1HFGA 3MEHA 4IFDH 5DAUA 5I6WA 5FLXE 1B4OA 3NBIA 5C5MA 1RJTA 4KY7A 4P2CB 5C0XI 2K5DA 4KV6A 2NYZD 4YIJA 3M4OB 4ZRZA 5E1FA 1JOKA 4QUCA 4LMQD 4MHEA 3DXJC 4GZYC 4DAPA 1PXUA 3NK9A 2B2VA 2EYFA 2RKSA 2MJ8A 3DM1A 4DK1A 3PIP3 2O4XA 2XWBB 1D5MC 2VXWA 2H4OA 2L5TA 1QCBD 2IX3A 4A93B 3JAML 1EWCA 4EQNA 5EGTA 4IZ8A 3NUCA 1SYFA 2FFKB 1PFBA 2NB0A 3DMUA 1KLUD 3MVVA 1ILPA 1LTID 2BA1A 1ZXTA 2B2UA 1STHA 4FF4A 3A8KE 1B9NA 1ESFA 2A6HC 3ERQA 3QOLA 4CJ1B 4RGTA 4KTAA 4XT1B 1CT1D 3FPUB 3BDCA 5CV4A 3VR2A 4U673 3MFYA 2F0MA 1DOLA 4ZAIA 1BBXC 3K59A 3MC0B 5EPKA 2K32A 2CW0C 1G2SA 1UUPA 3M3YB 3EVQA 3VYUA 3OMCA 2F0LA 2VB3X 4FNFA 4QUFA 4OIJA 3PUYA 4FXKC 2RSNA 4ZKBB 2EDGA 1F9PA 5E3FA 1VCIA 1S5ED 1WTXA 3HZXA 2F0FA 5G3LD 2R3ZA 4FXDA 2PW7A 1LT3D 2JXMB 3D31A 1R4PB 5D3IB 1EZ8A 2VNUD 4C1NI 1S5FD 1SMYD 3M7NA 4AYBB 3OSOA 3KUPA 3H91A 2K03A 5CV6A 3MHBA 2F3VA 3PUWA 4LK1C 5FLXL 4ZUIA 2O5IC 4B9WA 2C9OA 3SDZA 2A6ED 3OPOA 1LTAD 1VDZA 2V4DA 5M5YB 2L9HA 2MP1A 2JYOA 5DEHA 3GD7A 1BNZA 4IQZA 1U4RA 3HOZB 4UAIA 1YNNC 4RAUC 1EU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XIW A;  1DOL A;  4ZAI A;  2B2W A;  1DON A;  1SDF A;  1BBX C;  1MSH A;  1O80 A;  2N88 A;  3GV3 A;  1HRJ A;  2HDL A;  5EPK A;  3QO2 A;  4R9W A;  1WTP A;  1KNA A;  2Q8R E;  1PFN A;  1G2S A;  3I3C A;  1RTN A;  1G2T A;  4O42 A;  5T1I A;  1BF4 A;  4X3T A;  2RVL A;  1VMP A;  3SVM A;  2FIN B;  1X32 A;  4X3U A;  4DN4 M;  4ZK9 B;  4QUF A;  1U4L A;  4OIJ A;  5E4W C;  2DY7 A;  1IKL A;  5E4X A;  3HP3 A;  1HFG A;  2KEE A;  1M8A A;  1JIC A;  4HAE A;  4U68 A;  1WTO A;  1IKM A;  2RSN A;  2EOT A;  4ZKB B;  2K01 A;  2CVR A;  2K04 A;  3G7L A;  1WTQ A;  1F9P A;  1AP0 A;  5D14 A;  3GV6 A;  1ML0 D;  5EPJ A;  1NCV A;  1O7Y A;  2B2V C;  2FHT A;  2KED A;  1ESR A;  1WTX A;  5D65 A;  1B53 A;  1B4O A;  3P7J A;  2B2T C;  1RJT A;  3IFD A;  1NR2 A;  2L12 A;  2L4N A;  4HSV A;  1G6Z A;  2D9U A;  2R3Z A;  4RA8 A;  4XDX A;  1ILQ A;  3N52 A;  3D6W A;  2NYZ D;  2RSO A;  3UI2 A;  1AZQ A;  4MN3 A;  1WD1 A;  1J8I A;  2B2Y C;  2MGS A;  1SAP A;  4IUU A;  1F9Q A;  1HUN A;  4QUC A;  1XYI A;  3TZD A;  2K1B A;  4LMQ D;  1EQT A;  1HUM A;  1DZ1 A;  1WTR A;  1VMC A;  2MPM A;  2K28 A;  3DEP A;  4MHE A;  1MI2 A;  2FJ2 A;  3I91 A;  4HED A;  3KUP A;  4IUQ A;  1X3Q A;  3H91 A;  3KBX A;  5JJZ A;  2DY8 A;  1WTW A;  2K03 A;  1WD0 A;  1EL0 A;  2JP1 A;  1X3P A;  1AZP A;  3ONA B;  1DOK A;  1QNK A;  4X3K A;  1B2T A;  1HHV A;  1KNE A;  1CM9 A;  2B2V A;  3F2U A;  3I90 A;  4ZLT F;  1GUW A;  1PDQ A;  2B2T A;  2B2U C;  2MJ8 A;  1EOT A;  2EE1 A;  2NWG A;  3DM1 A;  2KUM A;  3MWY W;  3DEO A;  2RA4 A;  5EJW A;  3LWE A;  2KOL A;  2L1B A;  5EQ0 A;  3IL8 A;  1E0B A;  2VXW A;  4IUT A;  2NZ1 D;  1RHP A;  5T1G A;  1QG7 A;  1ICW A;  2B2Y A;  2KEC A;  1S4Z A;  1LV9 A;  5CBA E;  1A15 A;  1CA6 A;  1SSO A;  1TVX A;  2X69 A;  4R8I A;  1WVL A;  1U4P A;  5AFW A;  1Q3L A;  1MSG A;  1G91 A;  1NR4 A;  2IL8 A;  3FDT A;  1IL8 A;  1F9S A;  2N55 A;  2SDF A;  4NW2 A;  2B2W C;  4OIK A;  1B50 A;  1U4M A;  2FFK B;  1PFB A;  2L9H A;  2L11 A;  5EPL A;  5COR A;  2MP1 A;  2M2L A;  1WTV A;  2HCI A;  5CMD A;  1F9R A;  1CA5 A;  5COY A;  1DOM A;  1MGS A;  2JYO A;  1BO0 A;  1ILP A;  3I8Z A;  1NAP A;  4HCS A;  4XT3 B;  3Q6S A;  2HUG A;  5DNF A;  4CJ0 B;  1JE4 A;  1BNZ A;  4X3S A;  2X6G A;  1ZXT A;  4IUP A;  2B2U A;  2H1E A;  2X6L A;  4RWS C;  3R93 A;  1PFM A;  2BDN A;  1B3A A;  2HDM A;  4CJ2 C;  1C8C A;  1HA6 A;  3TN2 A;  5CBE E;  1HFN A;  2K05 A;  1U4R A;  2J7Z A;  1RTO A;  2EPB A;  1EIH A;  2Q8T A;  3MTS A;  5EKI A;  4CJ1 B;  4UAI A;  4ZKC B;  1QE6 A;  2KVM A;  4XT1 B;  3FPU B;  4IUR A;  1J9O A;  1XX8 A;  2HCC A;  1PLF A;  4RAU C;  4IUV A;  1EIG A;  1O7Z A;  1ROD A;  1F2L A;  2FMM A; 
#chains in the Genus database with same CATH topology
 3T16 A;  2RDF A;  1HNW Q;  1CZG A;  5K36 G;  3E9I A;  4WJW A;  4YWK A;  2YU9 H;  1V1Q A;  2JA6 H;  3J80 E;  1PFN A;  2K5W A;  1V1P B;  3T56 B;  4UP8 A;  2R93 H;  4ZK9 B;  4CBV A;  3S1R B;  4CDF C;  4DXF A;  3VA5 A;  4N9T A;  3HP3 A;  1ICF B;  4KHZ A;  1GUT A;  1JQY D;  1D2B A;  2UU9 Q;  1HJP A;  4HJ7 A;  1M90 C;  1B7Y B;  1PZJ D;  2K4K A;  4A3B B;  4DXG A;  4TRD A;  3QJY A;  4RHR A;  5LMN W;  1CQV A;  1BKB A;  4XYQ A;  1G6P A;  5IGE A;  4BY7 H;  3D6W A;  3BJU A;  5I2Y A;  5TSS A;  4DR2 Q;  3QOJ A;  1SAP A;  4DV5 Q;  4JV5 Q;  2NN6 I;  1Y1W B;  4B9X A;  1WTR A;  1I94 Q;  4HMJ A;  4K5X A;  3HOY G;  3OWE B;  1PTO F;  3TDQ A;  1RD9 D;  3JAM c;  4HED A;  2C35 B;  2A6H D;  2NVQ H;  3KBX A;  5HY6 A;  4KK7 A;  1V1P A;  2KA7 A;  2Z4H A;  1X3P A;  4LW1 A;  1HQM C;  5H1S E;  1HHV A;  1KNE A;  3F2U A;  3HOW H;  4F88 A;  1V9P A;  1XPR A;  2UU9 L;  2IHF A;  4DV6 L;  1JMC A;  2CQO A;  1L1O C;  2F0H A;  1N36 Q;  4RG1 A;  3L0O A;  2XTI A;  5T1G A;  1LYL A;  2ZTE A;  1K3B C;  4A3F H;  1XMQ Q;  1U4P A;  1Q3L A;  4A3D H;  1EWI A;  4APV A;  4KMU C;  1I4X A;  4DR2 L;  5COR A;  4WRD A;  4JI3 L;  1PZK D;  4WFN 3;  4TQU S;  4JV5 L;  1FD7 D;  4QGU A;  1F9R A;  3EQL C;  1JE5 A;  1A6X A;  4L63 B;  5KYI A;  1I94 L;  4AYB E;  1DJR D;  4CHT B;  1SFO H;  4LUZ A;  4XQJ A;  4CJ0 B;  4A3J H;  5CR3 A;  2L15 A;  4C56 C;  5IOD A;  2HDM A;  1EEF D;  2YTX A;  1HFN A;  2IHE A;  4GLA C;  3ICE A;  4DGZ A;  4NXM L;  2AQ1 B;  1T5X D;  3D8G A;  1BVS A;  1VQL A;  5CV8 A;  2JEA I;  3MA2 B;  3TZU A;  1K8G A;  1D8L A;  4KHP Q;  2F0I A;  1TWH B;  3PMF A;  4NPS A;  2ZJP A;  5C44 G;  5CC4 A;  2E75 C;  4N8F A;  3TBI B;  3H6M A;  2ICE C;  3S2H B;  1HH2 P;  1CKM A;  4IOC A;  1VQK A;  3GTG B;  3CRK C;  1XMQ L;  4IN3 A;  2Z6B A;  5FKA C;  1EY6 A;  5IGG A;  4RFB A;  1STE A;  3S2D B;  3DWQ A;  5BN4 A;  4OX9 Q;  3U9S A;  1QUQ A;  1EYA A;  1PH3 A;  1I6V C;  2EY1 A;  4MTN A;  2OXP A;  2JQO A;  3C1F A;  2A69 D;  4HJA A;  2EQS A;  2FHT A;  2N49 A;  4BA2 I;  2TMP A;  2B2T C;  4RCN A;  4G57 A;  4OON A;  3NWS A;  4N9P A;  3KLS X;  2ZM6 Q;  2YU9 B;  1ENF A;  4KHP L;  2JA6 B;  3K5M A;  1C7Y A;  2QDL A;  2R93 B;  4XTC S;  1XYI A;  2K5V A;  3ND8 A;  3TP5 A;  2R92 H;  5LL6 S;  2MPM A;  1TWG H;  4XIG S;  1EY5 A;  5JEA J;  4DR4 L;  1JC7 A;  5C0X J;  1NNX A;  4NMZ A;  2F0S A;  2R7F A;  1PH8 A;  2F0U A;  1Y69 U;  1PVO A;  3MXG A;  4LFB L;  2FMC A;  1SE2 A;  3STB D;  1SE3 A;  5JJL A;  4OX9 L;  4OWW B;  2RHS B;  3BYY B;  4ZYS A;  1DD2 A;  5EJW A;  4BY7 B;  2E2H H;  5HGT A;  2UXB Q;  1QWY A;  3FP9 A;  5C4J H;  2HT1 A;  4TVA B;  1LV9 A;  1CSQ A;  2I5M X;  5EAY A;  3K58 A;  1H9J A;  1IBM Q;  3LX0 A;  4K8J A;  2B63 G;  1N9W A;  4J1M A;  3RN5 A;  3RLO A;  1PV4 A;  1G91 A;  3HKS A;  4OIK A;  2SDF A;  1LTS D;  1JOR A;  1Y8P B;  1PRT B;  2NVQ B;  2ZM6 L;  4BS9 A;  1EZ6 A;  5GAH C;  3TP8 A;  3T1H Q;  3BS1 A;  4AYB G;  1OO9 B;  3HOW B;  3A54 A;  4EQO A;  3NQT A;  4IFD G;  1SNC A;  2B3G A;  2CQA A;  4C3J H;  3MTS A;  3CCJ A;  2G9H D;  1ET9 A;  2EYP A;  1KQS A;  4KHV A;  1O78 A;  2ZT9 C;  4A3F B;  1YIJ A;  3PV0 A;  4A3D B;  2UUB Q;  1QOH A;  1VQB A;  2Z6K A;  3E6Z X;  2B2W A;  1HRJ A;  5IP7 H;  1SE4 A;  2CFM A;  4H02 A;  3I3C A;  1G2T A;  2Z1C A;  4X3U A;  1L0W A;  1SFO B;  4A3J B;  3HKZ E;  1M8A A;  1JIC A;  3GP7 A;  3AFP A;  3HFZ B;  1PH1 A;  1A3V A;  2EOT A;  4WJ3 M;  3AFQ A;  1MJC A;  5EPJ A;  1XPU A;  2E5L L;  2JA5 H;  4GS3 A;  5LL6 X;  5KNB A;  1A3U A;  2K50 A;  2NVT H;  3IFD A;  4Q5V A;  2BCO A;  2TSS A;  2D9U A;  1C48 A;  3ULL A;  2E2J H;  3N52 A;  1KIX A;  4CKE A;  1O7I A;  3HOU H;  4KKU A;  1PYB A;  4JW0 A;  1JOQ A;  1DYQ A;  4A3M B;  5EBD A;  4HTH A;  4B3R Q;  4DK0 A;  2UXC L;  3A5Z B;  2R6G A;  3I4L A;  4IUQ A;  3CC4 A;  1A2T A;  4NP5 A;  4BBR G;  1E2W A;  3GO5 A;  5HUR A;  1I6H H;  2FXQ A;  2PYK A;  2QDB A;  4ZLT F;  4JPB W;  4DUY Q;  3KF8 B;  1BCP D;  1G8Z D;  3A7A B;  4A3G B;  3NTH A;  3OW2 A;  2GVB A;  3LWU A;  2JK8 A;  2KEN A;  1RHP A;  3C1E A;  4ILW A;  2KEC A;  4Y7N H;  1STY A;  4FF3 A;  2LSS A;  2R92 B;  1ONL A;  1CZW A;  1WVL A;  5AFW A;  2WB1 B;  1TWG B;  2BE5 D;  3PO2 H;  4NXN L;  2PPB C;  3CCM A;  4P74 A;  4XQN A;  1HR0 Q;  4LAA A;  1X3G A;  1IXR A;  2LS0 1;  1WTV A;  4B3M Q;  1TQO A;  1S5D D;  1GJX A;  1OTC A;  4HCS A;  3I56 A;  2NZH A;  4X66 L;  3NXW A;  1I4G A;  3I55 A;  4B3S Q;  4KY6 A;  2H1E A;  1EYG A;  2NUC A;  4A3K H;  2E2H B;  1KLG D;  2A73 B;  5C4J B;  4LF7 Q;  3KF8 A;  1B1Z A;  5KND A;  1EQV A;  2WAQ G;  1EWH A;  1AE2 A;  3CCR A;  3TP6 A;  1SND A;  1G51 A;  2O5J C;  3J7A F;  5EBC A;  1VMP A;  4S3S A;  4JK1 C;  4UDU C;  1GXD C;  5E4W C;  1YIT A;  4U68 A;  1HR0 L;  5IGF A;  1TXY A;  5ISR A;  2F0N A;  3S1N H;  2AUJ D;  4C3J B;  1Z47 A;  1WTQ A;  4B3M L;  4CGY B;  3HRZ C;  1GD7 A;  1NCV A;  1P16 A;  3PSI A;  1OXX K;  3K0Y A;  2EXD A;  4RKB A;  2PNH A;  4DV4 Q;  2EYJ A;  2PZU A;  5M3F G;  4B3S L;  4JI7 Q;  3BZC A;  1H9S B;  4MN3 A;  4DKA C;  4FDB A;  5C0X H;  1IHZ A;  4P73 A;  3W5O A;  1D5Z C;  2IJ0 A;  2KCM A;  4ZCK A;  1J5E Q;  1EEI D;  5C4H A;  3O13 A;  4RCO A;  1A2U A;  2IY5 B;  3ND9 A;  3FMC A;  1SBB B;  4YHH Q;  1JB7 A;  5JJZ A;  1EY4 A;  1EL0 A;  3TP7 A;  2I46 A;  2SNM A;  3DM3 A;  2JA5 B;  1X9N A;  1GUN A;  2NVT B;  1PDQ A;  2I07 B;  3T4A C;  2E2J B;  2P5Z X;  1IYJ B;  3PUV A;  2HQE A;  2F52 A;  5CV5 A;  4K6L A;  3HOU B;  2D62 A;  5JOB A;  1BCP B;  1FJG Q;  3PGZ A;  3RZO H;  1A15 A;  1QJO A;  5C3E H;  4JI7 L;  4DR1 Q;  3U50 C;  3NBH A;  1CTM A;  4BWG B;  1XMO L;  3D4R A;  3H3V C;  1H9S A;  5ELF A;  1MHW C;  4LF5 Q;  2R93 G;  4JOI A;  4QMG A;  1CA5 A;  1DOM A;  1MGS A;  4AH6 A;  2MNA A;  1S40 A;  4N8X 1;  3VA7 A;  1I6H B;  4XT3 B;  5LHY 1;  2YYZ A;  3PF5 A;  1IBK L;  2XRS D;  4M8A A;  4YHH L;  2BDN A;  3HOZ H;  4OWT B;  3HOV H;  3S1M H;  2K33 A;  1X56 A;  4H13 C;  2ASB A;  5FO7 B;  4OL7 A;  4ZKC B;  4Y7N B;  1QE6 A;  1NSN S;  4QL5 A;  1GHK A;  3SK4 A;  4OEL B;  1ROD A;  2G9D A;  3PO2 B;  3TEH B;  5EKK A;  4BY7 G;  4JBM A;  4JYA Q;  4H44 C;  3TS0 A;  2CWP A;  3WWV A;  2GA4 B;  3HOX G;  5M5X H;  3C3L A;  1HQR D;  4O42 A;  3NSW A;  4K2K A;  1BF4 A;  3I4N G;  2ZXR A;  4AQY Q;  4DR1 L;  1WI5 A;  3G6J B;  2XVS A;  1F2M A;  1FNU A;  1WTH A;  4JCV E;  5G3L F;  5GQO A;  4A3K B;  1QIL A;  1TWF H;  4HN7 A;  4A3B H;  4DR3 L;  3OOC A;  3GDE A;  1QVF A;  2F0J A;  3CCL A;  2KED A;  2WIN B;  1E3P A;  3SHL A;  5KIX A;  2VW9 A;  1KRT A;  1EY7 A;  1A0I A;  2KJX A;  2L12 A;  2L4N A;  2JA8 H;  4R8N A;  3W1B A;  2RSO A;  4MNO A;  1YNJ C;  1J8I A;  3L9A X;  2E76 C;  5IE8 A;  5J1Z A;  2EXZ A;  1XNR L;  4HJ9 A;  2M00 A;  1Y1V G;  4A3D G;  5ELD A;  2R7D A;  4A3C G;  3SR1 A;  4EQP A;  3BYT B;  1UNS A;  3A5U A;  1S72 A;  3S1N B;  2NVX H;  1K0S A;  3VR5 A;  2XN9 C;  2Y0S B;  3K5O A;  1SEB D;  4YY3 Q;  4A3J G;  1MIU A;  1CHP D;  2KUM A;  3CC2 A;  3AMU A;  1DXM A;  4H7B A;  2UUA L;  1M1K C;  2AUK A;  2AQ3 B;  2B2Y A;  3H15 A;  4JI4 Q;  1IL2 A;  4A4I A;  1TVX A;  3BG3 A;  1F9S A;  1CFM A;  1DGS A;  1B50 A;  3SEB A;  3T13 A;  1PTO C;  2BA0 A;  3A8J E;  3OW7 A;  4G7Z C;  2F3I A;  3S16 H;  1VF7 A;  4QJF A;  1MJE A;  4F7X A;  2GN5 A;  3FKI H;  3F1Z A;  4GOP A;  4ME3 A;  1IZ6 A;  4RGM A;  3X3N A;  4YCU A;  2YTY A;  3ZYY X;  1TWH H;  2F0O A;  3TME A;  2KVM A;  2KHS A;  3RZO B;  2Q2H A;  3QB3 A;  5C3E B;  2NTS A;  3WOE A;  1YHB A;  1F77 A;  1V43 A;  4LF4 L;  3TRZ A;  1O80 A;  3CF5 A;  3NHH A;  1VQF A;  4OXP A;  3QO2 A;  4C2M H;  5IYB G;  4LWC A;  4JI4 L;  1WCM B;  1EYC A;  3OIQ A;  2R92 G;  3J7A 5;  2WB1 G;  1VQC A;  4JVZ A;  2MFI A;  5IP9 G;  1IKL A;  2K01 A;  1YI2 A;  3HOV B;  3S1M B;  2RCF A;  2D0P A;  3G48 A;  1NTG A;  3TRE A;  4C3I H;  1B53 A;  4NB3 A;  3H3V I;  1HR0 W;  3K6O A;  2Z4I A;  4XYO A;  2WKC A;  5CV7 A;  1LT4 D;  4GNX B;  1YHA A;  1VQG A;  2MO0 A;  5IGB A;  5J22 A;  3SK6 A;  1DM0 B;  1LO5 D;  1ZYR C;  4P72 A;  1JWU D;  5M5X B;  3M4Y A;  4FF2 A;  4R1J A;  1HUM A;  3J7A V;  2K28 A;  3ERS X;  3MEF A;  3QIA A;  4JI5 L;  4DV6 Q;  2NN6 H;  3VYR A;  4OO1 G;  1TWF B;  1X3F A;  3I70 A;  3CCS A;  1UWV A;  1JR0 D;  3H0G G;  1PRT F;  3A0J A;  3X3M A;  1JCK B;  2JA8 B;  2ES2 A;  2Q2I A;  3WDN A;  2IW3 A;  1ENA A;  4C3J G;  4JI3 Q;  1E0B A;  4LF6 L;  4EX5 A;  1S4Z A;  1EOV A;  3UDI A;  3Q0A A;  4FXG C;  4B3T L;  1TWA H;  2PO4 A;  4GNX A;  5C4X H;  5C3X A;  2RBM A;  2JA7 H;  2PQA B;  2IX0 A;  2K5Q A;  5IP7 G;  4NXM Q;  4KKT A;  2M2L A;  3GTK H;  1AH9 A;  2NVX B;  4I65 A;  5I9O A;  1I4R A;  1WYD A;  4JG2 A;  4LJZ C;  4IUN A;  4TKO B;  3U9O A;  2E2D C;  2CW0 D;  4RWS C;  1PFM A;  3J81 j;  2DNE A;  1PYW D;  1IYV A;  4YWM A;  1R9T H;  5EKI A;  3IKJ A;  3PO3 H;  3FPP A;  2Y0S E;  1WFQ A;  4QY7 A;  3Q24 A;  1NBW A;  3HKZ B;  1F2L A;  1QUQ B;  3A7L A;  1SYG A;  5E7N A;  3S16 B;  3H94 A;  3HOU G;  2RVL A;  1HXY D;  2QGQ A;  2QKI C;  3FKI B;  4FVM A;  3G4S A;  1VQ8 A;  2PQA A;  3WOF A;  4HAE A;  4GKJ L;  1IKM A;  3QG1 A;  3KDF B;  1UEA B;  5KEE A;  2B2V C;  1ESR A;  1IW7 C;  1KAA A;  2UXD Q;  4KJO A;  1VF5 C;  3CC7 A;  1PTO D;  1Y8O B;  3T53 B;  4DR4 Q;  3C2P A;  1C4Q A;  4DV1 L;  4J8Q A;  2N78 A;  2XWJ B;  3K80 C;  1MD2 D;  2UUC L;  1HNX L;  4C2M B;  3R8B A;  4A93 G;  2O2L D;  2QIL A;  3MXN B;  4LFB Q;  1D1I A;  1HTL D;  3I4M B;  3TZD A;  3K7A H;  1QZG A;  1VMC A;  3PO2 G;  3ER0 A;  4A3M H;  1SRU A;  4RH6 A;  1GKH A;  3VR4 A;  1HTP A;  2VB2 X;  5FJ8 G;  1X54 A;  1M4V A;  4BBS H;  5L37 A;  4O2D A;  2JP1 A;  4KN7 C;  1EU4 A;  3ONA B;  1G29 1;  1TU2 B;  3HG9 A;  1LM0 A;  1QNK A;  4C3I B;  3KYH C;  1Q1E A;  3W2D A;  2Z9H A;  4A3G H;  3L3O C;  2B2U C;  4A3K G;  3KDF A;  1D1K A;  1L2F A;  3F2B A;  1ASY A;  4I7A A;  2ZXP A;  3VDY A;  1ICW A;  3CU7 A;  2EVB A;  3W3A A;  2UXD L;  3HS0 C;  2IT1 A;  1GOZ A;  1FGB D;  2KCC A;  1JB3 A;  1B9M A;  1I4Q A;  2EY5 A;  1OXV A;  3HEJ A;  3KJO A;  1YNN D;  3S15 B;  5BR8 L;  2R61 A;  3DWP A;  1E2Z A;  1KDA A;  3MXN A;  1TY0 A;  2F4I A;  4DR5 L;  1J6Q A;  3BDO A;  2KBN A;  1PH4 A;  1JE4 A;  1VQ6 A;  2EY6 A;  1B3A A;  4PMW A;  2V1C C;  4DR7 Q;  2RCN A;  1I50 H;  1XPO A;  4PZ6 A;  5HGQ A;  2EPB A;  4QIW B;  4ME5 A;  2JEB I;  3IAY A;  1TWC H;  1FNV A;  1TWA B;  3MAQ A;  5C4X B;  4PMC A;  1PH6 A;  4K5V A;  4NDX A;  2JA7 B;  4GN3 B;  1JT8 A;  2OF1 A;  1TS2 A;  1OXS C;  5JEA G;  4DR6 Q;  1SRO A;  1DON A;  1LTT D;  1RKN A;  5C0X G;  1WTP A;  3GTK B;  2E5L Q;  4C3H H;  3IRB A;  3CCV A;  2DUD A;  3KLS A;  1U4L A;  2ATW A;  3S9W A;  1KHI A;  4GLV B;  2ZTC A;  3M9B A;  2CVR A;  3KBG A;  2EJM A;  1LLR D;  4XQQ A;  1AN8 A;  3S1Q B;  1R9T B;  1P8L A;  1BBW A;  1O7Y A;  3J81 c;  2F4V L;  3PO3 B;  1LTL A;  5D65 A;  1U0L A;  3N6R A;  4A3E H;  2N3S A;  1G6Z A;  1S5B D;  4CDD C;  4RA8 A;  1LTB D;  4DR7 L;  2UXC Q;  1EIF A;  4WJ4 A;  4LFC L;  4DK3 C;  4HID A;  1VQ4 A;  2MGS A;  1F9Q A;  1Q46 A;  2EJF C;  2F0Q A;  2K1B A;  2EYL A;  5C3E G;  3I4O A;  4X65 Q;  3D3R A;  4OO1 I;  4C1N K;  1NE3 A;  2AWN A;  3I91 A;  3GTL H;  4DR6 L;  1BCP F;  2HIX A;  3TSS A;  2DY8 A;  3KLW A;  4V0B A;  1BQQ T;  4DPG A;  1K83 H;  1HA5 A;  3KF6 B;  1AFP A;  1SNO A;  4YCV A;  2BOS A;  2DNC A;  1EY9 A;  4NXN Q;  5FLM H;  3D6C A;  4POF A;  2XNA C;  3HOZ G;  3FRP B;  3HOV G;  4FYD A;  5D3D A;  1PH2 A;  4HCE A;  4KN4 C;  1CA6 A;  3K7A B;  1SSO A;  5IWA L;  4X66 Q;  1UE5 A;  5KYL A;  5C4Z A;  3D4W A;  1E22 A;  5JVH 3;  4ABN A;  2DJG C;  3K8A A;  3SE0 A;  4BBS B;  2HCI A;  2A5H A;  1Q8K A;  1IW7 D;  5M3M H;  2NZO A;  4HIK A;  2F0W A;  1BO0 A;  1D6E C;  4X65 L;  1NAP A;  1E24 A;  1GVP A;  3A8I E;  5M5W H;  1XNQ L;  3C46 A;  2A1A A;  4CJ2 C;  4A3B G;  2OEO A;  2F0K A;  2Q8T A;  5F2D A;  4HR7 B;  4POG A;  1XJV A;  3KF6 A;  3P20 A;  3FEW X;  4YWL A;  4KLK A;  1Y8N B;  1QB5 D;  4DNR B;  2MHV A;  4LFA L;  5FO9 B;  3VYT A;  2JA8 G;  2XIW A;  4LF8 L;  4KD3 A;  2JE6 I;  3KK7 A;  2PNR C;  2Q8R E;  4PV1 C;  1Y1W G;  4HJ8 A;  1RTN A;  2A8V A;  1E2V A;  4PZ7 A;  5IYD H;  4X3T A;  2QW7 A;  3GTQ H;  4X62 Q;  2OQK A;  4K0K Q;  2D5D A;  4R4I A;  2KEE A;  4DF7 A;  3EFX D;  1I50 B;  1A3T A;  2K04 A;  2BDO A;  1GO3 E;  3OIP A;  2Q8I B;  4DAY B;  3EJI A;  1TWC B;  1A8V A;  2EIF A;  2RQX A;  1NR2 A;  4JBW A;  3NWT A;  2MQH A;  1YHQ A;  1JWM D;  4PG3 A;  3T1Y Q;  3SK8 A;  2OTJ A;  1Z6H A;  2ZJR A;  1SLJ A;  5M9O A;  2G5D A;  2ZTD A;  4C3H B;  1E1T A;  2Z8L A;  4QIW E;  1I3Q H;  5ELB A;  3HKZ G;  3MXP A;  4P75 A;  4K8I A;  3E5S A;  2SNS A;  3NTI A;  3K5N A;  4EGV A;  1AE3 A;  3U58 A;  1VS0 A;  1SJE D;  4L5R C;  1AZP A;  5ELC A;  1L1O B;  3KJP A;  4GN5 A;  3FKI G;  1U9R A;  2YTV A;  2AKW B;  4X62 L;  1CM9 A;  1SMX A;  4K0K L;  4QF4 A;  4A3E B;  2EYO A;  3NBH B;  4GKK Q;  1XMO Q;  1SMY C;  3DEO A;  5KNC A;  2CH4 A;  2KOL A;  1DCZ A;  2RDH A;  1QVG A;  1SNQ A;  4JI0 L;  2LKV A;  5CGK A;  3EA6 A;  4DAY A;  1H9K A;  1HZC A;  5CBA E;  5A2Q E;  2JSO A;  5ELO A;  1IL8 A;  3MFG A;  3T1Y L;  1IBK Q;  2B63 H;  3GTL B;  1AW7 A;  2L11 A;  4JI1 Q;  1K83 B;  1JWS D;  5IGC A;  2E8G A;  3SK5 A;  4PNY A;  1HPC A;  3P1H A;  1AEX A;  3R93 A;  1D5X C;  2A6E C;  1C8C A;  1UE1 A;  4V19 0;  4LUV A;  1EIH A;  1L1O A;  3G71 A;  1TS5 A;  4C3I G;  4B08 A;  1STN A;  3CW2 C;  5DM7 3;  1PLF A;  2DGY A;  2XSC A;  1F2Z A;  1O7Z A;  3I2Z A;  4JI8 Q;  4GKK L;  2IPK D;  3URY A;  2EYM A;  2JA6 G;  1KC8 C;  1SDF A;  4DR3 Q;  3CPW A;  2RF4 A;  1WCM H;  3OMG A;  2CHB D;  5M3M B;  4IFD I;  1HCZ A;  4IOA A;  3CP0 A;  2R7Z H;  3L2P A;  5M5W B;  2ENB A;  1T5E A;  2F0G A;  4IPH A;  4A75 A;  2SOB A;  2NN6 G;  5BN5 A;  4JI1 L;  3G7L A;  4BA1 I;  5CV9 A;  3CQZ H;  4A76 A;  3GV6 A;  1XNR Q;  4OHJ A;  3OHX C;  2A68 C;  2VZA A;  5C5L A;  2NBF A;  5C44 B;  4JI6 Q;  4RGO S;  1JJ2 A;  4K14 A;  3J81 E;  4KKS A;  4BY1 H;  1TY2 A;  3NE5 B;  3CMA A;  3S14 H;  3GTQ B;  2F1M A;  1DZ1 A;  4JI8 L;  1F2Y A;  1GUS A;  2EJG C;  3AYH B;  4NKL A;  2JA7 G;  1N34 L;  4ODG A;  1MI2 A;  2FJ2 A;  2UUA Q;  2Q2U A;  1RF2 D;  4IO9 A;  1WTW A;  3A55 A;  2L0C A;  1EFI D;  3ZJY C;  1DOK A;  4BBR H;  5I4D A;  3HOW G;  1EUJ A;  4MIU A;  3I90 A;  2K52 A;  5FO8 B;  1I4H A;  3G6E A;  2J4X A;  2KCT A;  2B2T A;  2NWG A;  2EE1 A;  2B39 A;  3K7U C;  1N32 Q;  4K6D A;  3BVG A;  4A3F G;  1EFW A;  1SJH D;  3PO3 G;  4RGN A;  4LF9 Q;  3LGJ A;  1I3Q B;  1HZB A;  4LUO A;  4GOP B;  1UAP A;  2IL8 A;  2Z6K C;  1VQA A;  2B2W C;  1Z9F A;  3KFU A;  4JI6 L;  1UE6 A;  2E2I H;  1N33 Q;  1TS3 A;  1KAB A;  2VUM H;  1BOS A;  2M9V A;  3T51 B;  1QVC A;  1VQO A;  3PUX A;  1XTC D;  2A74 C;  2QCP X;  5IIF A;  2ICI A;  4IAL A;  4R4T A;  4HMI A;  4DV2 L;  1PRT C;  4OGQ C;  2HHH L;  3S24 A;  1V1O A;  4LF4 Q;  1NUC A;  4DA2 A;  1Q82 C;  2VQE L;  2CCZ A;  2K05 A;  3MXU A;  2AWO A;  2HD3 A;  3Q23 A;  1BUV T;  2F03 A;  3UDF A;  3GTO B;  2B63 B;  4DNI A;  5I9P A;  3EBE A;  1N32 L;  5A2Q L;  1W3S A;  3V2T A;  4CKC A;  3E3X A;  3AEV A;  1VQI A;  2F0D A;  4LF9 L;  3GTP H;  1E1O A;  2I5L X;  5IT9 c;  3I72 A;  1X32 A;  4DN4 M;  3PIO A;  4A3M G;  1RL2 A;  4M1U B;  3NEN A;  2F3W A;  4ID6 A;  4R4Q A;  1N33 L;  1EYD A;  2F0E A;  4BBS G;  5IOC A;  2B29 A;  1LTG D;  3IFT A;  2RDG A;  1TS4 A;  1OXU A;  4A3G G;  4JI5 Q;  1K3R A;  4HSV A;  1JOO A;  1SYE A;  3CKI B;  4X64 L;  5I6Y A;  3DWA A;  1ILQ A;  5M3F H;  3GTM H;  4F87 A;  1WD1 A;  1X6O A;  3H3V H;  1V8Q A;  2PW5 A;  3I4M H;  1EQQ A;  1Q90 A;  1K73 C;  2R7Z B;  2A69 C;  1Z7T A;  4L6T B;  1NMF A;  4LF6 Q;  1TT2 A;  1RCV D;  1CI3 M;  4JBK A;  1TII D;  3CQZ B;  1K0R A;  1KXL A;  1CUK A;  3CAM A;  4B3T Q;  2I0Q A;  1GM5 A;  2EZV A;  2WP8 J;  3RMH A;  2H5X A;  1VQ7 A;  2RA4 A;  3LWE A;  3R3O A;  4DU9 A;  5C3W A;  4J6H A;  5IY0 A;  2KCN A;  4BY1 B;  1A62 A;  4ULL A;  3S14 B;  2QF7 A;  2X69 A;  4R8I A;  3RLF A;  4E6I A;  3K5L A;  4DUZ L;  3S15 H;  1KTK A;  1U5K A;  1U4M A;  5DM6 3;  3J81 L;  1ZEQ X;  4UPA A;  3STB C;  2KHI A;  5EPL A;  1BBU A;  5JVG 3;  3CME A;  4C3H G;  2OTL A;  2A68 D;  4UP7 A;  1B3Q A;  1RDP D;  1XXG A;  4BBR B;  3PIO 3;  1Q86 C;  1SYD A;  1YZ6 A;  1SN8 A;  1XTD A;  4O1N A;  2HUG A;  4X3S A;  2X6G A;  1SE8 A;  2X6L A;  2L55 A;  4G4K A;  2JA9 A;  5CBE E;  4IPG A;  1KAW A;  1SNP A;  1VQM A;  2PZT A;  3BDL A;  5KGU A;  1PH7 A;  2HCC A;  4A3E G;  1EIG A;  5FK9 C;  1BXT A;  1VQN A;  4A3L H;  3W1G A;  4GKJ Q;  2F0T A;  3AB9 A;  3OWF A;  2E2I B;  2IWH A;  1D7Q A;  1SXT A;  2N88 A;  3VR6 A;  1PHJ A;  2VUM B;  2HDL A;  3CD6 A;  1KNA A;  3F2C A;  1H95 A;  2WII B;  3HOX H;  1CSP A;  3I4N H;  2XRQ D;  5I2X A;  1ET6 A;  2JN4 A;  1W2B A;  1YNJ D;  4JI2 L;  4DV1 Q;  3I73 A;  1WTO A;  1CK1 A;  1HNW L;  1S3O A;  2UUC Q;  1HNX Q;  3S1Q H;  1L0Y B;  2JA5 G;  1LT5 D;  1ML0 D;  3F8T A;  1KL9 A;  5EKL A;  2SEB D;  3P7J A;  2WAC A;  5FLM G;  4JBJ A;  2QEX A;  1C0A A;  2VS1 A;  2WAQ B;  1W6J A;  4ZQ3 A;  4CKB A;  1AZQ A;  1PTO H;  1EY8 A;  2LMC B;  2BH8 A;  3UDX A;  1HUN A;  3GTP B;  3PF4 A;  1K8M A;  2KQ3 A;  1PRT D;  1EQT A;  3TS2 A;  1RIP A;  4I7Z C;  1Y1V H;  4CDE C;  3DLL A;  4A3C H;  1YBY A;  2CWA A;  1UEB A;  1WD0 A;  3D4D A;  1XWE A;  4JOI C;  3UE1 A;  5M3M G;  3J81 i;  3OYY A;  4G7H C;  4DV5 L;  4UHV A;  4DAV A;  1B2T A;  3RZD H;  1B44 D;  4UP9 A;  3RLN A;  3S17 H;  1LAC A;  3MWY W;  1EOT A;  2ALY B;  5BR8 Q;  5M3F B;  1SNM A;  3GTM B;  1UE7 A;  3IL8 A;  3J7Y W;  2N8N A;  2LXJ A;  1VQP A;  1QG7 A;  3M85 A;  1H9M A;  4L5T A;  4DR5 Q;  2PQE A;  5FOB B;  4H0L C;  3Q22 A;  1MSG A;  3CXC A;  2N55 A;  1KDC A;  1GHJ A;  2YV5 A;  1BR9 A;  1BCP C;  3R2I A;  1N36 L;  4DK6 C;  5IYD G;  3CCE A;  3L7Z C;  1LUZ A;  1CQF A;  5COY A;  4Q0F A;  4KD4 A;  3ULP A;  1II3 A;  3VYS A;  5IGD A;  2K7V A;  3Q6S A;  5DNF A;  4HSP A;  1LT6 D;  4IUP A;  1Q1B A;  4TSS A;  3TN2 A;  2NTT A;  2BE5 C;  4K5W A;  2J0T D;  3RD4 A;  4FF1 A;  4BXX H;  4G7O C;  4A3I H;  2GVA A;  2BH2 A;  3CHB D;  1CKN B;  3DHQ A;  3NP8 A;  4LNQ A;  5J39 A;  3BVM A;  4CDC C;  2E74 C;  3SXH A;  3V96 A;  1C9O A;  2PCF B;  3RN2 A;  1Q81 C;  1FNW A;  2OT2 A;  1MSH A;  1Y14 B;  5NUC A;  1EY0 A;  1SYB A;  4J15 A;  3QWN A;  5T1I A;  2F4V Q;  5IYB H;  3NQI A;  5FLX c;  4KI0 A;  2WKD A;  4RKL A;  3U4Z A;  1ZYR D;  5BN3 A;  3PCO B;  2B8G A;  1STB A;  1NMG A;  2D0O A;  4QB4 A;  4DV0 Q;  2C5C A;  5IP9 H;  3J80 L;  4LFC Q;  2XGT A;  1SYC A;  3VR3 A;  1AP0 A;  5D14 A;  2Y0S G;  5IT9 E;  3R2T A;  2LFN A;  2IX1 A;  1YJ9 A;  3I7F A;  4JC0 A;  5IYC H;  1Q8I A;  3P75 A;  4L5Q A;  4RHS A;  2HIV A;  4IFD J;  1STG A;  1W6K A;  5K36 H;  3UI2 A;  1CKN A;  2B2Y C;  5A35 A;  3NTK A;  4MZ9 A;  3HOX B;  3I4N B;  4IPD A;  4Z9C B;  2EYH A;  1YVC A;  1FR3 A;  2CKZ B;  1E7Z A;  3HGB A;  4OO1 H;  1SR3 A;  2RHQ B;  4X3K A;  5KRU A;  5IWA Q;  4GOP C;  4EVO A;  1X3E A;  1ASZ A;  4DV0 L;  3H0G H;  2LY7 A;  3LNN A;  4OWX B;  2L1B A;  1VQE A;  4IUT A;  1PTO B;  2WV6 D;  1K8O A;  4WOR A;  3K57 A;  1LTR D;  5AJ3 Q;  1XNQ Q;  3HOY H;  1Y1V B;  4NW2 A;  4QCL A;  3DUZ A;  2QA4 A;  2K5H A;  3GTJ H;  2WAQ E;  2JJQ A;  1WCM G;  2UXB L;  5CMD A;  5JPM C;  2AQ2 B;  1KRS A;  4FO2 A;  3EIV A;  5GAE C;  4LFA Q;  3RZD B;  1N8R C;  2R7Z G;  3I8Z A;  4K2L A;  1IBM L;  3S17 B;  3M7G A;  1H9R A;  3V05 A;  3NPP A;  2NVY H;  1WJJ A;  4LF8 Q;  1OXT A;  2PMZ B;  2J7Z A;  1RTO A;  2KHJ A;  3FVQ A;  5JAV A;  4DV3 Q;  1NY4 A;  3RNU A;  3H09 A;  1R4Q B;  3J80 i;  3T1H L;  1J9O A;  4R4O A;  1XX8 A;  4IUV A;  4ZUJ A;  2D2C C;  5DLQ E;  2FMM A;  3JC6 6;  4DNT B;  4PZ8 A;  2ID0 A;  3GV3 A;  3M4O H;  4R9W A;  4RMF A;  2B8F A;  2F0V A;  4BY1 G;  2HQL A;  2CH4 W;  3SVM A;  5AJ3 L;  2FIN B;  1EQR A;  2VY3 A;  2K6A A;  3ITP A;  1X65 A;  3ERO A;  1YEZ A;  5E4X A;  3SGI A;  2UUB L;  3GQB A;  1NJI C;  1WOC A;  4A3I B;  2QEJ C;  1Q12 A;  1BDO A;  1STA A;  1PZI D;  1PMR A;  5C6A A;  5C44 H;  4XDX A;  3JAM E;  3U4V A;  2PZW A;  3RUZ A;  4DV3 L;  4KY5 A;  2DN8 A;  4IUU A;  2EY2 A;  1YJW A;  4UY8 C;  4PQX A;  3PUZ A;  4GNX C;  4A93 H;  1L0X B;  3AU7 A;  5ELE A;  4HIO A;  1S5C D;  3DEP A;  4FP5 D;  2F0P A;  1PH5 A;  1TKW B;  4JI0 Q;  2VUM G;  1X3Q A;  1CHQ D;  1HZA A;  3CRL C;  5FJ8 H;  3RR5 A;  1GUW A;  1I4P A;  5IT9 L;  1ENC A;  1O7L A;  4B3R L;  5EQ0 A;  3PQI A;  3K81 C;  4HJ5 A;  2NZ1 D;  3BZD B;  3MZ5 A;  3BU2 A;  3E0J A;  1K8A C;  1VQD A;  4Y52 H;  3KLR A;  4DUY L;  1NR4 A;  3FDT A;  4F8M A;  5CYU A;  5LMN Q;  2Q2T A;  2MUY A;  1QNU A;  2ZXO A;  3M4Q A;  1FYC A;  5K5P A;  1JJG A;  3M3Y H;  1KDB A;  1GUG A;  3A56 A;  1ZKO A;  4XXE A;  2VQF Q;  1IYU A;  3NEL A;  5GRO A;  3H0G B;  2WFW A;  3PIP A;  1HA6 A;  1GUO A;  4L8J A;  4PMB A;  3BVZ A;  3J80 c;  4IUR A;  3GTO H;  5JPN C;  1TR5 A;  3HOY B;  3GTJ B;  4KJN A;  5JEA H;  3I4M G;  1MBY A;  3CPF A;  3B6Y A;  1LAB A;  4LF7 L;  1T9H A;  3QR8 A;  1VQH A;  2DY7 A;  5LMN L;  2NVY B;  4DFA A;  1HFG A;  3MEH A;  3ULJ A;  4IFD H;  4IJH A;  5DAU A;  5I6W A;  1B8A A;  1FGU A;  5FLX E;  5GAD C;  1B4O A;  3NBI A;  5C5M A;  1RJT A;  2VQF L;  4KY7 A;  4P2C B;  5C0X I;  1N34 Q;  2K5D A;  4KV6 A;  1PA6 A;  3UDG A;  1IBL Q;  1K28 A;  2Z0S A;  2PMZ E;  4L5S A;  2NYZ D;  4YIJ A;  3M4O B;  4ZRZ A;  1HZ9 A;  1MKH A;  5E1F A;  2K5N A;  3K0X A;  1JOK A;  4QUC A;  3J7Z C;  2ZJQ A;  4LMQ D;  4DV4 L;  2AHO B;  4MHE A;  3DXJ C;  5M5Y H;  1B70 B;  4GZY C;  1KD1 C;  2LXK A;  4DAP A;  1PXU A;  2DJF C;  3NK9 A;  2B2V A;  1J5E L;  2EYF A;  2RKS A;  2MJ8 A;  3DM1 A;  4DK1 A;  3PIP 3;  2O4X A;  4IPC A;  2XWB B;  3E9H A;  4MTK A;  3TQY A;  4R4C A;  1D5M C;  2VXW A;  2OQ0 A;  2H4O A;  4O0A A;  3A74 A;  2L5T A;  1CKO A;  1QCB D;  2IX3 A;  4ALP A;  5C4X G;  4A93 B;  1PH9 A;  4AIM A;  3JAM L;  1EWC A;  3E0E A;  4DV2 Q;  2HHH Q;  4A3L G;  4EQN A;  5EGT A;  4IZ8 A;  3NUC A;  1IBL L;  1SYF A;  2FFK B;  4YCW A;  1PFB A;  2VQE Q;  2NB0 A;  1A63 A;  3DMU A;  1KLU D;  1Q7Y C;  5ELN A;  3MVV A;  1ILP A;  1FJG L;  1PFS A;  3S1R H;  1LTI D;  3BZK A;  2BA1 A;  1I5F A;  1YJN A;  1JJC B;  2WB1 E;  1ZXT A;  1HNZ Q;  2B2U A;  1STH A;  5LMU Q;  4FF4 A;  3A8K E;  1B9N A;  1ESF A;  2OWO A;  2A6H C;  2PI2 A;  3ERQ A;  3QOL A;  4LF5 L;  4CJ1 B;  3EN2 A;  4KTA A;  4RGT A;  3OTO Q;  4XT1 B;  1CT1 D;  3FPU B;  3BDC A;  5CV4 A;  4P71 A;  3VR2 A;  4U67 3;  4OEM B;  5J3B A;  3MFY A;  2F0M A;  1DOL A;  4ZAI A;  2OCE A;  1BBX C;  3K59 A;  3MC0 B;  1VQ5 A;  5EPK A;  2VL6 A;  2K32 A;  1FVI A;  2CW0 C;  1G2S A;  1UUP A;  3KOJ A;  3UE0 A;  3M3Y B;  1Y1W H;  3EVQ A;  3VYU A;  2K75 A;  4GLX A;  3OMC A;  1X55 A;  2F0L A;  2VB3 X;  4FNF A;  4QUF A;  4OIJ A;  4X64 Q;  3PUY A;  4FXK C;  2RSN A;  3AQQ A;  4ZKB B;  2EDG A;  4JYA L;  1F9P A;  5E3F A;  1VCI A;  2MO1 A;  1S5E D;  1WTX A;  3HZX A;  4QQB X;  2I5H A;  2F0F A;  2A19 A;  3F2D A;  1PYS B;  5G3L D;  4AQY L;  1HNZ L;  2R3Z A;  5LMU L;  4DAM A;  4FXD A;  3M4P A;  1VQJ A;  2PW7 A;  1LT3 D;  2JXM B;  3OTO L;  3D31 A;  1R4P B;  5D3I B;  1EZ8 A;  2VNU D;  1S5F D;  1SMY D;  2AMC B;  4C1N I;  3CCU A;  3M7N A;  4AYB B;  3OSO A;  1VQ9 A;  3KUP A;  3JAM i;  3H91 A;  2K03 A;  5CV6 A;  5GAG C;  3CCQ A;  3MHB A;  4DV7 Q;  4EQ5 A;  3D0F A;  2K14 A;  4DUZ Q;  1YNX A;  4GN4 B;  3NEM A;  2F3V A;  3PUW A;  4LK1 C;  5FLX L;  4BXX G;  4A3I G;  4ZUI A;  2O5I C;  5JJK A;  4B9W A;  2C9O A;  3SDZ A;  2A6E D;  3OPO A;  4X6A H;  4YY3 L;  1LTA D;  1VDZ A;  2V4D A;  5M5Y B;  2L9H A;  3S2H H;  1FL0 A;  2MP1 A;  4HIM A;  3GTG H;  1EIY B;  2JYO A;  5DEH A;  3GD7 A;  1BNZ A;  3S2D H;  4IQZ A;  4IJL A;  1K9M C;  1U4R A;  3HOZ B;  2PI2 E;  4UAI A;  1YNN C;  4DV7 L;  1QZH A;  4RAU C;  1EU3 A;  5IYC G;  3Q8D A;  3FHW A;  4JI2 Q;  5JJI A; 
#chains in the Genus database with same CATH homology
 3T16 A;  2RDF A;  1CZG A;  5K36 G;  4WJW A;  3J80 E;  1PFN A;  2K5W A;  1V1P B;  3T56 B;  4ZK9 B;  4CBV A;  3S1R B;  4DXF A;  3VA5 A;  4N9T A;  3HP3 A;  4KHZ A;  1GUT A;  1JQY D;  1D2B A;  1PZJ D;  4A3B B;  4DXG A;  4TRD A;  3QJY A;  4RHR A;  1CQV A;  4XYQ A;  5IGE A;  3D6W A;  5I2Y A;  5TSS A;  3QOJ A;  1SAP A;  2NN6 I;  1Y1W B;  4B9X A;  1WTR A;  4HMJ A;  4K5X A;  3OWE B;  1PTO F;  3TDQ A;  1RD9 D;  4HED A;  2A6H D;  3KBX A;  4KK7 A;  1V1P A;  2KA7 A;  2Z4H A;  1X3P A;  1HQM C;  1HHV A;  1KNE A;  3F2U A;  4F88 A;  2F0H A;  5T1G A;  1U4P A;  1Q3L A;  4KMU C;  1I4X A;  5COR A;  4WRD A;  1PZK D;  4WFN 3;  4TQU S;  1FD7 D;  1F9R A;  3EQL C;  1A6X A;  4L63 B;  5KYI A;  1DJR D;  4CHT B;  4XQJ A;  4CJ0 B;  5CR3 A;  4C56 C;  5IOD A;  2HDM A;  1EEF D;  1HFN A;  4DGZ A;  2AQ1 B;  1T5X D;  3D8G A;  2JEA I;  5CV8 A;  3MA2 B;  3TZU A;  2F0I A;  1TWH B;  3PMF A;  5CC4 A;  2E75 C;  3TBI B;  3H6M A;  2ICE C;  3S2H B;  3GTG B;  3CRK C;  4IN3 A;  5FKA C;  1EY6 A;  5IGG A;  4RFB A;  1STE A;  3S2D B;  3DWQ A;  5BN4 A;  3U9S A;  1EYA A;  1I6V C;  2EY1 A;  2OXP A;  3C1F A;  2A69 D;  2FHT A;  4BA2 I;  2TMP A;  2B2T C;  4RCN A;  4G57 A;  3NWS A;  4N9P A;  3KLS X;  2YU9 B;  1ENF A;  2JA6 B;  3K5M A;  2R93 B;  4XTC S;  1XYI A;  3ND8 A;  3TP5 A;  5LL6 S;  2MPM A;  4XIG S;  1EY5 A;  5JEA J;  1JC7 A;  5C0X J;  4NMZ A;  2F0S A;  2F0U A;  1Y69 U;  3MXG A;  2FMC A;  1SE2 A;  1SE3 A;  3BYY B;  4ZYS A;  1DD2 A;  5EJW A;  4BY7 B;  5HGT A;  1QWY A;  1LV9 A;  3K58 A;  1H9J A;  3LX0 A;  4K8J A;  4J1M A;  1G91 A;  4OIK A;  2SDF A;  1LTS D;  1JOR A;  1Y8P B;  1PRT B;  2NVQ B;  4BS9 A;  1EZ6 A;  3TP8 A;  3BS1 A;  1OO9 B;  3HOW B;  3A54 A;  4EQO A;  3NQT A;  4IFD G;  1SNC A;  2CQA A;  3MTS A;  2G9H D;  1ET9 A;  2EYP A;  4KHV A;  1O78 A;  2ZT9 C;  4A3F B;  3PV0 A;  4A3D B;  1QOH A;  3E6Z X;  2B2W A;  1HRJ A;  1SE4 A;  3I3C A;  1G2T A;  2Z1C A;  4X3U A;  1SFO B;  4A3J B;  1M8A A;  1JIC A;  3GP7 A;  1A3V A;  2EOT A;  5EPJ A;  5LL6 X;  5KNB A;  1A3U A;  3IFD A;  4Q5V A;  2BCO A;  2TSS A;  2D9U A;  1C48 A;  3N52 A;  4CKE A;  4KKU A;  1JOQ A;  1DYQ A;  4A3M B;  5EBD A;  4HTH A;  4DK0 A;  3I4L A;  2R6G A;  4IUQ A;  1A2T A;  4NP5 A;  1E2W A;  3GO5 A;  5HUR A;  2QDB A;  2PYK A;  4ZLT F;  1BCP D;  1G8Z D;  3A7A B;  4A3G B;  3NTH A;  3LWU A;  1RHP A;  3C1E A;  4ILW A;  2KEC A;  1STY A;  4FF3 A;  2R92 B;  1ONL A;  1CZW A;  1WVL A;  5AFW A;  2WB1 B;  1TWG B;  2BE5 D;  2PPB C;  4XQN A;  4LAA A;  2LS0 1;  1WTV A;  1TQO A;  1S5D D;  1GJX A;  4HCS A;  3NXW A;  1I4G A;  4KY6 A;  2H1E A;  2NUC A;  2E2H B;  1KLG D;  2A73 B;  5C4J B;  3KF8 A;  1B1Z A;  5KND A;  1EQV A;  1EWH A;  3TP6 A;  1SND A;  2O5J C;  3J7A F;  5EBC A;  1VMP A;  4S3S A;  4JK1 C;  4UDU C;  1GXD C;  5E4W C;  4U68 A;  5IGF A;  5ISR A;  2F0N A;  2AUJ D;  4C3J B;  1Z47 A;  1WTQ A;  4CGY B;  3HRZ C;  1NCV A;  1OXX K;  3K0Y A;  4RKB A;  2EYJ A;  2PZU A;  1H9S B;  4MN3 A;  5C0X H;  1IHZ A;  1D5Z C;  2IJ0 A;  1EEI D;  5C4H A;  3O13 A;  4RCO A;  1A2U A;  3ND9 A;  3FMC A;  1SBB B;  5JJZ A;  1EY4 A;  1EL0 A;  3TP7 A;  2I46 A;  2SNM A;  2JA5 B;  1GUN A;  2NVT B;  1PDQ A;  2I07 B;  3T4A C;  2E2J B;  3PUV A;  2HQE A;  5CV5 A;  4K6L A;  3HOU B;  2D62 A;  5JOB A;  1BCP B;  1A15 A;  1QJO A;  3NBH A;  1CTM A;  4BWG B;  3D4R A;  3H3V C;  1H9S A;  5ELF A;  1CA5 A;  4QMG A;  1DOM A;  1MGS A;  3VA7 A;  1I6H B;  4XT3 B;  5LHY 1;  2YYZ A;  2XRS D;  4M8A A;  2BDN A;  2K33 A;  4H13 C;  5FO7 B;  4OL7 A;  4ZKC B;  4Y7N B;  1QE6 A;  1NSN S;  1GHK A;  3SK4 A;  1ROD A;  2G9D A;  3PO2 B;  5EKK A;  4H44 C;  2GA4 B;  3C3L A;  1HQR D;  4O42 A;  3NSW A;  4K2K A;  1BF4 A;  2ZXR A;  3G6J B;  2XVS A;  1F2M A;  1FNU A;  5G3L F;  4A3K B;  1QIL A;  4HN7 A;  3OOC A;  2F0J A;  2KED A;  2WIN B;  5KIX A;  3SHL A;  1EY7 A;  2KJX A;  2L12 A;  2L4N A;  4R8N A;  2RSO A;  1YNJ C;  1J8I A;  3L9A X;  2E76 C;  5J1Z A;  2EXZ A;  2M00 A;  5ELD A;  3SR1 A;  4EQP A;  3BYT B;  1UNS A;  3S1N B;  3VR5 A;  2XN9 C;  2Y0S B;  3K5O A;  1SEB D;  1CHP D;  2KUM A;  3AMU A;  1DXM A;  4H7B A;  2AUK A;  2AQ3 B;  2B2Y A;  1TVX A;  3BG3 A;  1F9S A;  1CFM A;  1B50 A;  3SEB A;  3T13 A;  1PTO C;  2BA0 A;  3A8J E;  3OW7 A;  4G7Z C;  1VF7 A;  4F7X A;  4RGM A;  3X3N A;  3ZYY X;  2F0O A;  3TME A;  2KVM A;  2KHS A;  3RZO B;  3QB3 A;  5C3E B;  2NTS A;  3WOE A;  1F77 A;  1V43 A;  1O80 A;  3NHH A;  3QO2 A;  1WCM B;  1EYC A;  3OIQ A;  1IKL A;  2K01 A;  3HOV B;  3S1M B;  1B53 A;  3K6O A;  2Z4I A;  4XYO A;  2WKC A;  5CV7 A;  1LT4 D;  5J22 A;  5IGB A;  3SK6 A;  1DM0 B;  1LO5 D;  1ZYR C;  1JWU D;  5M5X B;  3M4Y A;  4FF2 A;  1HUM A;  3J7A V;  2K28 A;  3QIA A;  2NN6 H;  3VYR A;  4OO1 G;  1TWF B;  3I70 A;  1JR0 D;  1PRT F;  3X3M A;  1JCK B;  2JA8 B;  3WDN A;  2IW3 A;  1ENA A;  4C3J G;  1E0B A;  1S4Z A;  3Q0A A;  4FXG C;  2PO4 A;  5C3X A;  2RBM A;  2IX0 A;  2K5Q A;  4KKT A;  2M2L A;  2NVX B;  4I65 A;  5I9O A;  1I4R A;  4LJZ C;  4IUN A;  4TKO B;  3U9O A;  2E2D C;  2CW0 D;  4RWS C;  1PFM A;  2DNE A;  1PYW D;  1IYV A;  5EKI A;  3IKJ A;  3FPP A;  3Q24 A;  3HKZ B;  1F2L A;  3A7L A;  1SYG A;  3S16 B;  3H94 A;  2RVL A;  1HXY D;  2QKI C;  3FKI B;  4FVM A;  3WOF A;  4HAE A;  1IKM A;  3QG1 A;  1UEA B;  5KEE A;  2B2V C;  1ESR A;  1IW7 C;  1KAA A;  4KJO A;  1VF5 C;  1PTO D;  1Y8O B;  3T53 B;  3C2P A;  1C4Q A;  4J8Q A;  2XWJ B;  1MD2 D;  4C2M B;  3R8B A;  2O2L D;  2QIL A;  1D1I A;  1HTL D;  3I4M B;  3TZD A;  1VMC A;  4RH6 A;  3VR4 A;  1HTP A;  2VB2 X;  1M4V A;  2JP1 A;  4KN7 C;  1EU4 A;  3ONA B;  1G29 1;  1TU2 B;  3HG9 A;  1QNK A;  4C3I B;  3W2D A;  1Q1E A;  3L3O C;  2B2U C;  1D1K A;  2ZXP A;  1ICW A;  3CU7 A;  2EVB A;  3W3A A;  3HS0 C;  2IT1 A;  1GOZ A;  1FGB D;  2KCC A;  1JB3 A;  1B9M A;  1I4Q A;  2EY5 A;  1OXV A;  3HEJ A;  1YNN D;  3S15 B;  2R61 A;  3DWP A;  1E2Z A;  1KDA A;  3MXN A;  1TY0 A;  2F4I A;  3BDO A;  1JE4 A;  2EY6 A;  1B3A A;  4PMW A;  2EPB A;  4QIW B;  4ME5 A;  2JEB I;  3IAY A;  1FNV A;  1TWA B;  3MAQ A;  5C4X B;  4PMC A;  4K5V A;  4NDX A;  2JA7 B;  2OF1 A;  1TS2 A;  1OXS C;  5JEA G;  1DON A;  1LTT D;  1RKN A;  5C0X G;  1WTP A;  3GTK B;  3KLS A;  1U4L A;  3S9W A;  2CVR A;  3KBG A;  2EJM A;  1LLR D;  4XQQ A;  1AN8 A;  3S1Q B;  1R9T B;  1O7Y A;  3PO3 B;  5D65 A;  3N6R A;  1G6Z A;  1S5B D;  4RA8 A;  1LTB D;  2MGS A;  1F9Q A;  2EJF C;  2F0Q A;  2K1B A;  2EYL A;  4OO1 I;  3D3R A;  4C1N K;  2AWN A;  3I91 A;  1BCP F;  3TSS A;  2DY8 A;  4V0B A;  1BQQ T;  1HA5 A;  1AFP A;  1SNO A;  2BOS A;  2DNC A;  1EY9 A;  3D6C A;  2XNA C;  3FRP B;  4FYD A;  5D3D A;  4HCE A;  4KN4 C;  1CA6 A;  3K7A B;  1SSO A;  5KYL A;  5C4Z A;  3D4W A;  5JVH 3;  4ABN A;  3SE0 A;  4BBS B;  2HCI A;  2A5H A;  1IW7 D;  2F0W A;  1BO0 A;  1D6E C;  1NAP A;  3A8I E;  3C46 A;  4CJ2 C;  2OEO A;  2F0K A;  2Q8T A;  5F2D A;  4HR7 B;  3P20 A;  3FEW X;  1Y8N B;  1QB5 D;  4DNR B;  2MHV A;  5FO9 B;  3VYT A;  2XIW A;  4KD3 A;  2JE6 I;  3KK7 A;  2PNR C;  2Q8R E;  4PV1 C;  1RTN A;  1E2V A;  4X3T A;  2D5D A;  2KEE A;  4DF7 A;  3EFX D;  1I50 B;  1A3T A;  2K04 A;  2BDO A;  3OIP A;  2Q8I B;  3EJI A;  1TWC B;  2RQX A;  1NR2 A;  4JBW A;  3NWT A;  1JWM D;  3SK8 A;  1Z6H A;  5M9O A;  4C3H B;  2Z8L A;  5ELB A;  3MXP A;  4K8I A;  3E5S A;  2SNS A;  3NTI A;  3K5N A;  4EGV A;  1SJE D;  1AZP A;  5ELC A;  1U9R A;  1CM9 A;  4QF4 A;  4A3E B;  2EYO A;  1SMY C;  3DEO A;  5KNC A;  2KOL A;  2RDH A;  1DCZ A;  1SNQ A;  2LKV A;  5CGK A;  3EA6 A;  4DAY A;  1H9K A;  5CBA E;  5A2Q E;  2JSO A;  1IL8 A;  3MFG A;  3GTL B;  1AW7 A;  2L11 A;  1K83 B;  1JWS D;  5IGC A;  3SK5 A;  4PNY A;  1HPC A;  3P1H A;  1AEX A;  3R93 A;  1D5X C;  2A6E C;  1C8C A;  4V19 0;  1EIH A;  1TS5 A;  4C3I G;  4B08 A;  1STN A;  5DM7 3;  1PLF A;  2XSC A;  1F2Z A;  1O7Z A;  2IPK D;  3URY A;  2EYM A;  1SDF A;  3OMG A;  2CHB D;  5M3M B;  4IFD I;  1HCZ A;  5M5W B;  2ENB A;  1T5E A;  2F0G A;  2SOB A;  2NN6 G;  5BN5 A;  3G7L A;  4BA1 I;  5CV9 A;  3GV6 A;  4OHJ A;  3OHX C;  2A68 C;  5C5L A;  2NBF A;  5C44 B;  4RGO S;  4K14 A;  3J81 E;  4KKS A;  1TY2 A;  3NE5 B;  3GTQ B;  2F1M A;  1DZ1 A;  1F2Y A;  1GUS A;  2EJG C;  4NKL A;  4ODG A;  1MI2 A;  2FJ2 A;  1RF2 D;  1WTW A;  3A55 A;  2L0C A;  1EFI D;  1DOK A;  5I4D A;  4MIU A;  3I90 A;  5FO8 B;  1I4H A;  2J4X A;  2B2T A;  2NWG A;  2EE1 A;  2B39 A;  4K6D A;  3BVG A;  1SJH D;  4RGN A;  1I3Q B;  1UAP A;  2IL8 A;  2B2W C;  1TS3 A;  1KAB A;  1BOS A;  2M9V A;  3T51 B;  3PUX A;  1XTC D;  2A74 C;  2QCP X;  5IIF A;  2ICI A;  4IAL A;  4HMI A;  1PRT C;  4OGQ C;  1V1O A;  1NUC A;  4DA2 A;  2K05 A;  3MXU A;  2AWO A;  3Q23 A;  1BUV T;  2F03 A;  3GTO B;  2B63 B;  5I9P A;  5A2Q L;  3V2T A;  4CKC A;  2F0D A;  3I72 A;  1X32 A;  4DN4 M;  4M1U B;  2F3W A;  4ID6 A;  1EYD A;  2F0E A;  5IOC A;  1LTG D;  3IFT A;  2RDG A;  1TS4 A;  1OXU A;  4HSV A;  1JOO A;  1SYE A;  3CKI B;  5I6Y A;  3DWA A;  1ILQ A;  4F87 A;  1WD1 A;  1V8Q A;  2PW5 A;  1Q90 A;  2R7Z B;  2A69 C;  1Z7T A;  4L6T B;  1TT2 A;  1RCV D;  1CI3 M;  1TII D;  3CQZ B;  2EZV A;  2WP8 J;  3RMH A;  2RA4 A;  3LWE A;  3R3O A;  4DU9 A;  5C3W A;  4J6H A;  2KCN A;  4BY1 B;  4ULL A;  3S14 B;  2QF7 A;  2X69 A;  4R8I A;  3RLF A;  4E6I A;  3K5L A;  1KTK A;  3J81 L;  1U4M A;  5DM6 3;  1ZEQ X;  5EPL A;  5JVG 3;  4C3H G;  2A68 D;  1RDP D;  1XXG A;  4BBR B;  3PIO 3;  1SYD A;  4O1N A;  2HUG A;  4X3S A;  2X6G A;  2X6L A;  2L55 A;  4G4K A;  5CBE E;  1SNP A;  2PZT A;  3BDL A;  5KGU A;  2HCC A;  1EIG A;  5FK9 C;  1BXT A;  2F0T A;  3AB9 A;  3OWF A;  2E2I B;  2IWH A;  1SXT A;  2N88 A;  3VR6 A;  2VUM B;  2HDL A;  1KNA A;  2WII B;  2XRQ D;  5I2X A;  1ET6 A;  1YNJ D;  3I73 A;  1WTO A;  1CK1 A;  1L0Y B;  1LT5 D;  1ML0 D;  5EKL A;  2SEB D;  2WAC A;  3P7J A;  2WAQ B;  1W6J A;  4ZQ3 A;  4CKB A;  1AZQ A;  1PTO H;  1EY8 A;  2LMC B;  1HUN A;  3GTP B;  1K8M A;  2KQ3 A;  1PRT D;  1EQT A;  4I7Z C;  1WD0 A;  3D4D A;  1XWE A;  4G7H C;  4DAV A;  1B2T A;  1B44 D;  1LAC A;  3MWY W;  1EOT A;  5M3F B;  3GTM B;  1SNM A;  3IL8 A;  3J7Y W;  1QG7 A;  3M85 A;  1H9M A;  2PQE A;  5FOB B;  4H0L C;  3Q22 A;  1MSG A;  2N55 A;  1KDC A;  1GHJ A;  1BR9 A;  1BCP C;  3R2I A;  3L7Z C;  1CQF A;  5COY A;  4Q0F A;  4KD4 A;  1II3 A;  3VYS A;  5IGD A;  2K7V A;  3Q6S A;  5DNF A;  4HSP A;  1LT6 D;  4IUP A;  1Q1B A;  4TSS A;  3TN2 A;  2NTT A;  2BE5 C;  4K5W A;  2J0T D;  3RD4 A;  4FF1 A;  4G7O C;  3CHB D;  3DHQ A;  3NP8 A;  5J39 A;  3BVM A;  2E74 C;  3SXH A;  3V96 A;  2PCF B;  1FNW A;  2OT2 A;  1MSH A;  5NUC A;  1EY0 A;  1SYB A;  3QWN A;  5T1I A;  3NQI A;  4KI0 A;  2WKD A;  4RKL A;  1ZYR D;  5BN3 A;  2B8G A;  1STB A;  4QB4 A;  2C5C A;  3J80 L;  1SYC A;  3VR3 A;  1AP0 A;  5D14 A;  5IT9 E;  3R2T A;  2LFN A;  2IX1 A;  1Q8I A;  3P75 A;  4RHS A;  4IFD J;  1STG A;  1W6K A;  5K36 H;  3UI2 A;  2B2Y C;  5A35 A;  3NTK A;  3HOX B;  3I4N B;  4Z9C B;  2EYH A;  1FR3 A;  3HGB A;  4OO1 H;  5KRU A;  4X3K A;  4EVO A;  2LY7 A;  3LNN A;  2L1B A;  4IUT A;  1PTO B;  2WV6 D;  1K8O A;  4WOR A;  3K57 A;  1LTR D;  1Y1V B;  4NW2 A;  4QCL A;  3DUZ A;  5CMD A;  5JPM C;  2AQ2 B;  4FO2 A;  3RZD B;  3I8Z A;  4K2L A;  3S17 B;  3M7G A;  1H9R A;  3V05 A;  3NPP A;  1OXT A;  2PMZ B;  2J7Z A;  1RTO A;  3FVQ A;  5JAV A;  3H09 A;  1R4Q B;  1J9O A;  1XX8 A;  4IUV A;  4ZUJ A;  2D2C C;  2FMM A;  4DNT B;  2ID0 A;  3GV3 A;  4R9W A;  2B8F A;  2F0V A;  3SVM A;  2FIN B;  2K6A A;  3ITP A;  3ERO A;  5E4X A;  3GQB A;  4A3I B;  2QEJ C;  1Q12 A;  1BDO A;  1STA A;  1PZI D;  1PMR A;  5C6A A;  4XDX A;  3JAM E;  2PZW A;  3RUZ A;  4KY5 A;  2DN8 A;  4IUU A;  2EY2 A;  4PQX A;  3PUZ A;  1L0X B;  3AU7 A;  5ELE A;  1S5C D;  3DEP A;  4FP5 D;  2F0P A;  1TKW B;  1X3Q A;  1CHQ D;  3CRL C;  1GUW A;  1I4P A;  5IT9 L;  1ENC A;  1O7L A;  5EQ0 A;  2NZ1 D;  3BZD B;  3MZ5 A;  3E0J A;  3KLR A;  1NR4 A;  3FDT A;  4F8M A;  5CYU A;  2MUY A;  1QNU A;  2ZXO A;  1FYC A;  5K5P A;  1KDB A;  1GUG A;  3A56 A;  1ZKO A;  4XXE A;  1IYU A;  3H0G B;  1HA6 A;  1GUO A;  4L8J A;  4PMB A;  3BVZ A;  4IUR A;  5JPN C;  1TR5 A;  3HOY B;  3GTJ B;  4KJN A;  5JEA H;  1MBY A;  1LAB A;  2DY7 A;  2NVY B;  4DFA A;  1HFG A;  3MEH A;  4IFD H;  5DAU A;  5I6W A;  5FLX E;  1B4O A;  3NBI A;  5C5M A;  1RJT A;  4KY7 A;  4P2C B;  5C0X I;  2K5D A;  4KV6 A;  2NYZ D;  4YIJ A;  3M4O B;  4ZRZ A;  5E1F A;  1JOK A;  4QUC A;  4LMQ D;  4MHE A;  3DXJ C;  4GZY C;  4DAP A;  1PXU A;  3NK9 A;  2B2V A;  2EYF A;  2RKS A;  2MJ8 A;  3DM1 A;  4DK1 A;  3PIP 3;  2O4X A;  2XWB B;  1D5M C;  2VXW A;  2H4O A;  2L5T A;  1QCB D;  2IX3 A;  4A93 B;  3JAM L;  1EWC A;  4EQN A;  5EGT A;  4IZ8 A;  3NUC A;  1SYF A;  2FFK B;  1PFB A;  2NB0 A;  3DMU A;  1KLU D;  3MVV A;  1ILP A;  1LTI D;  2BA1 A;  1ZXT A;  2B2U A;  1STH A;  4FF4 A;  3A8K E;  1B9N A;  1ESF A;  2A6H C;  3ERQ A;  3QOL A;  4CJ1 B;  4RGT A;  4KTA A;  4XT1 B;  1CT1 D;  3FPU B;  3BDC A;  5CV4 A;  3VR2 A;  4U67 3;  3MFY A;  2F0M A;  1DOL A;  4ZAI A;  1BBX C;  3K59 A;  3MC0 B;  5EPK A;  2K32 A;  2CW0 C;  1G2S A;  1UUP A;  3M3Y B;  3EVQ A;  3VYU A;  3OMC A;  2F0L A;  2VB3 X;  4FNF A;  4QUF A;  4OIJ A;  3PUY A;  4FXK C;  2RSN A;  4ZKB B;  2EDG A;  1F9P A;  5E3F A;  1VCI A;  1S5E D;  1WTX A;  3HZX A;  2F0F A;  5G3L D;  2R3Z A;  4FXD A;  2PW7 A;  1LT3 D;  2JXM B;  3D31 A;  1R4P B;  5D3I B;  1EZ8 A;  2VNU D;  4C1N I;  1S5F D;  1SMY D;  3M7N A;  4AYB B;  3OSO A;  3KUP A;  3H91 A;  2K03 A;  5CV6 A;  3MHB A;  2F3V A;  3PUW A;  4LK1 C;  5FLX L;  4ZUI A;  2O5I C;  4B9W A;  2C9O A;  3SDZ A;  2A6E D;  3OPO A;  1LTA D;  1VDZ A;  2V4D A;  5M5Y B;  2L9H A;  2MP1 A;  2JYO A;  5DEH A;  3GD7 A;  1BNZ A;  4IQZ A;  1U4R A;  3HOZ B;  4UAI A;  1YNN C;  4RAU C;  1EU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...