1ZXTA

Crystal structure of a viral chemokine
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
b'VSYTPNSCCYGFQQHPPPVQILKEWYPTSPACPKPGVILLTKRGRQICADPSKNWVRQLMQRLPAIAHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords functional macrophage inflammatory protein 1-alpha homolog
publication title Crystal structure of viral macrophage inflammatory protein I encoded by Kaposi's sarcoma-associated herpesvirus at 1.7A.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Signaling protein
total genus 12
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1zxtA01
4X3TA 4CJ1B 1BBXC 1DONA 1PFMA 2B2WC 2L11A 1DOMA 2L9HA 5CMDA 1WTOA 1U4MA 5D14A 1WTWA 4DN4M 1EIGA 1G2SA 2EE1A 5E4WC 2K03A 4ZK9B 2K01A 4QUFA 1HRJA 2B2YA 1CM9A 1VMCA 4OIKA 4RAUC 1EQTA 2J7ZA 1NCVA 4X3UA 5EKIA 3FDTA 2JYOA 1IKMA 4CJ0B 4XDXA 1ESRA 2MJ8A 1RTOA 2B2UC 5COYA 1F9QA 2VXWA 2M2LA 1RHPA 3I91A 4XT3B 1KNAA 1U4LA 4X3SA 1O7YA 2L1BA 3ONAB 2KEEA 1MI2A 1RODA 3DEPA 1F9PA 1XX8A 2X6GA 1SAPA 2H1EA 4LMQD 4R9WA 1EIHA 2IL8A 2FHTA 2X6LA 4IUQA 1F9RA 2R3ZA 1HHVA 3FPUB 2BDNA 1E0BA 1ILQA 4ZKBB 1DZ1A 2FINB 1DOKA 1S4ZA 2B2VC 2X69A 2XIWA 1C8CA 2EPBA 2MGSA 5T1GA 2KECA 1ML0D 4HCSA 1XYIA 1HFGA 2FMMA 3TN2A 1JICA 3SVMA 1F9SA 4O42A 4RA8A 4MN3A 4IUPA 4IUVA 2K1BA 2B2UA 3TZDA 1WTXA 1O7ZA 1J8IA 1HUNA 1ICWA 3HP3A 5EPLA 4ZKCB 1A15A 1IKLA 2HUGA 2KVMA 2NYZD 3GV6A 3R93A 1EOTA 2NZ1D 1AZQA 1F2LA 1BNZA 4HAEA 2K04A 1B50A 1JE4A 4OIJA 3P7JA 1J9OA 1ZXTA 2HCCA 4ZLTF 5D65A 2FJ2A 4R8IA 2K28A 3KUPA 1CA5A 1EL0A 1Q3LA 2B2VA 1B53A 2B2WA 5EPKA 5DNFA 1BO0A 4UAIA 1WD0A 3Q6SA 3LWEA 1WTPA 3MWYW 4HSVA 5EQ0A 2L4NA 3IFDA 2N88A 3KBXA 4IUTA 3IL8A 1MGSA 1X3QA 4U68A 1WTVA 1O80A 3MTSA 2B2TC 2KUMA 5CBAE 1WTRA 1SDFA 4X3KA 2CVRA 1PDQA 2NWGA 1CA6A 5AFWA 4IURA 5JJZA 1SSOA 1WTQA 1RTNA 1BF4A 2Q8RE 1NAPA 3N52A 1PFNA 1LV9A 1HFNA 3I90A 3QO2A 1B3AA 1MSHA 1U4PA 1X32A 1WD1A 1IL8A 2EOTA 2N55A 3DM1A 3F2UA 1M8AA 2HDLA 4HEDA 2DY8A 3I3CA 1PFBA 2KEDA 3DEOA 1KNEA 5EPJA 1G2TA 2JP1A 2MP1A 1AP0A 5CORA 1HA6A 2RVLA 4NW2A 3G7LA 1B2TA 1X3PA 2MPMA 2KOLA 5EJWA 5T1IA 1HUMA 2RSNA 1G91A 1WVLA 2B2TA 3I8ZA 4MHEA 5E4XA 2Q8TA 1GUWA 1VMPA 1QG7A 2B2YC 4IUUA 4ZAIA 3D6WA 3UI2A 1NR4A 1DOLA 1G6ZA 3H91A 1QE6A 1TVXA 2L12A 1MSGA 1U4RA 2FFKB 2RA4A 1B4OA 2HDMA 2HCIA 2K05A 1PLFA 4RWSC 4QUCA 2DY7A 1AZPA 1NR2A 2SDFA 5CBEE 1ILPA 1QNKA 2RSOA 1RJTA 2D9UA 3GV3A 4XT1B 4CJ2C
chains in the Genus database with same CATH superfamily
2I0QA 2Z6KC 1ENCA 3P1HA 1DONA 4KKTA 3EA6A 2I5MX 5FKAC 3H3VI 1I6HB 3CCQA 1VQKA 4CDEC 4ABNA 4DR5Q 4LF4L 3DWPA 4GNXB 3S1QB 4JW0A 1O7LA 3B6YA 5IGGA 2GN5A 4DV1Q 1V1PA 4BY7G 1IL2A 1N34L 1TWHH 4WRDA 5HGTA 4BY7H 2YTVA 3BZDB 3ONAB 3S2HH 3J80E 2HQEA 5LMNL 4X65L 4IOAA 2MGSA 4B3TL 1HNZL 4ILWA 5A2QE 3P75A 3UDGA 1IZ6A 4IUPA 1X3FA 2IY5B 2QW7A 5M5YB 2KVMA 2A6HC 2NYZD 3BDOA 4EQNA 5FLXE 2ATWA 1UE1A 1EY5A 1JT8A 3KF6A 3KLRA 3R8BA 3D4RA 3LGJA 4IFDH 1X54A 2YTYA 4NXMQ 1JOKA 4TSSA 5EQ0A 4IUTA 4A76A 5C4XB 2KHIA 1GJXA 2BE5D 5C5LA 4PZ8A 2RCNA 1YZ6A 2CW0C 3NE5B 2H4OA 3MHBA 4LAAA 4Y52H 1A3TA 5FO7B 1I4PA 5DLQE 1LYLA 4KN7C 1S5CD 5ELBA 1PYWD 2VZAA 5T1IA 4CKCA 2JK8A 1PYBA 2A68D 4PMCA 5ELNA 3HFZB 4AYBB 2EVBA 5IYBG 3MEFA 4GN3B 4PZ6A 5IYBH 3NBHB 3LWUA 4DKAC 3KLWA 2E75C 2UXDQ 2A5HA 2CCZA 4C1NI 4RWSC 1RJTA 3CPFA 4X3TA 1GM5A 1JJ2A 4JCVE 4DR1Q 1I94Q 4JI0L 1E7ZA 2F52A 1EIGA 2K03A 3CQZB 2JA5B 4R4OA 2B2YA 3W1GA 4EQPA 1H9SB 2J7ZA 3L7ZC 4NMZA 2NN6G 3RLFA 2NN6H 4BS9A 5FO9B 1A8VA 3J7ZC 3TQYA 1GHJA 4IALA 4GKJL 4R4TA 2M2LA 1VQBA 1HNXQ 4PG3A 4JI3L 3S14B 5CV9A 4LFBQ 2IT1A 4HIDA 1VQ7A 2O5IC 1Q90A 2NVTB 2X6LA 4L5TA 4G57A 1PTOF 4MTNA 4OO1I 3C46A 3MXGA 1EY8A 2E2IH 3TEHB 1I6VC 1ML0D 2V1CC 4YCWA 5ISRA 2WAQB 1F9SA 4GZYC 1TY0A 4S3SA 1L1OC 4JI1L 3RD4A 1VQ9A 3GV6A 2EQSA 4DR3L 1BCPF 1E3PA 4MNOA 2I07B 3J7AV 5JJKA 2F4VQ 4R8IA 3KK7A 4HR7B 1B9MA 3J80c 1HXYD 3A55A 1G51A 1JOQA 2FMCA 2K5QA 2VQEQ 2OQKA 1YITA 4RGTA 3IL8A 1XMOQ 1PH5A 3PGZA 4R1JA 3TP7A 2NWGA 4AH6A 4LF9Q 1Y8PB 4DA2A 1CK1A 2Q8RE 3CCUA 1FGBD 1L1OB 2XGTA 2VB2X 1IL8A 3EROA 1VQAA 1L0XB 3ICEA 4B3MQ 1PH3A 5E1FA 4DGZA 3KDFB 5FLXc 3G48A 2V4DA 1F2ZA 1V9PA 4C2MH 4RKLA 3T1YL 1FL0A 1VQMA 1T5XD 1WYDA 4JI6Q 3ER0A 1JORA 4JI2Q 3PO3G 3PO3H 3NWSA 5M5XH 3TDQA 1G6ZA 3C1FA 3D0FA 3WWVA 1C0AA 2PMZE 2RA4A 2NVXH 1KDBA 5KNDA 1STGA 1B4OA 2JEAI 3QG1A 4X64Q 3HKZE 3SK6A 2PQEA 4CJ2C 1LTRD 4RHRA 4RH6A 4JV5Q 4DV3L 4HJ5A 4G7OC 1SNDA 4DN4M 3CW2C 2EE1A 4YCUA 1XMQQ 2JA7G 1SLJA 1VMCA 1WCMB 3K6OA 2JA7H 4X3UA 4YCVA 4ZUJA 2JYOA 2VUMG 2VUMH 3CAMA 1N36L 1EEFD 1KIXA 2PI2A 4X66Q 1C7YA 2D0OA 4RGOS 4X3SA 3OMCA 2L1BA 4G4KA 4O2DA 4HIKA 3RUZA 1VQJA 1HH2P 2Z6KA 4LFAQ 3TP6A 1SJED 1SE8A 4A3JB 2RKSA 3CMEA 4KKSA 2DN8A 4A3FB 3RNUA 3QR8A 4LFCQ 3BYYB 2P5ZX 4OWXB 5GAHC 1K73C 4IZ8A 4CBVA 1N9WA 2HIVA 1LT6D 1E22A 1LT5D 2VW9A 1SYBA 1A15A 4LUVA 4O0AA 2QA4A 4HMIA 1STEA 1GO3E 2PO4A 2Y0SB 1UWVA 1ZXTA 2MO0A 2UUBL 3KF8B 4HCEA 5M9OA 3GTMH 2FJ2A 4KJOA 1Q81C 3J81j 4DF7A 4A3KB 4LF7Q 4V0BA 2DJFC 1JCKB 3H6MA 4H13C 5EPKA 1K28A 4JI8L 3U4ZA 1IW7C 4POGA 2EJGC 2WB1G 4L5QA 4ZUIA 5C3EG 3KBXA 3S17B 2K5WA 4U68A 1KTKA 5C3EH 3GTGH 2JE6I 1YNJC 1WTRA 1A2UA 2B8FA 1K8OA 1HNWL 1X32A 3PUVA 5M3MG 2EY6A 5I2XA 1CI3M 5M3MH 1D8LA 3HOXB 4OELB 3I3CA 3OWFA 1YHBA 2KEDA 2LSSA 3VYSA 4A3CG 1X55A 1KC8C 3PMFA 4A3CH 1AFPA 2EJFC 3A8KE 4OWTB 1G91A 1MD2D 1EYAA 2G5DA 1I3QB 4JI4L 3I7FA 2CQAA 3O13A 1A63A 5KIXA 3NUCA 4I7ZC 4LUZA 2OTLA 2ASBA 1GUTA 1SNCA 4FDBA 4X62Q 3N6RA 2Z6BA 2ZM6Q 3S16H 4CDDC 5IP9G 5E4WC 4J8QA 5IP9H 2K33A 3C3LA 1TWAB 1K83H 2D5DA 1ESRA 1VQNA 1L2FA 4JI5Q 3TS0A 1JQYD 4APVA 1SR3A 4XT3B 1LTLA 3LNNA 2KA7A 3SGIA 4F7XA 3NQTA 3BVGA 1HZ9A 1EY9A 4XXEA 1I4XA 1I4RA 2F0SA 4LJZC 3G6JB 2E2HH 4C3HB 3HOVB 1UEBA 4KHPQ 4RMFA 1F2MA 1Y1VB 2K6AA 1D5ZC 2IPKD 4DAYA 2CHBD 2NVQB 4JI7L 2ENBA 4FF4A 3BVMA 4DV5Q 2E2JH 3VA7A 5IIFA 1UNSA 2F3WA 4DK3C 4UDUC 3PO2B 3H3VC 1Y14B 1VS0A 4KY7A 3Q6SA 1PH7A 2G9HD 1MGSA 3IKJA 4DR7Q 3MXUA 1NE3A 1STNA 3DUZA 1IBLQ 1V1QA 5JJZA 4Y7NB 1WTQA 1IYVA 3OMGA 1CZWA 3HOWG 1PRTC 1NAPA 3HOWH 4GS3A 1K3RA 3H94A 4DXGA 2EOTA 3QB3A 2AMCB 2DY8A 2EYPA 3DEOA 5EPJA 1CSQA 3FHWA 2MO1A 3ERSX 3AEVA 2ZTDA 4DV1L 2AQ3B 2N8NA 3KLSA 4K5WA 3UDXA 3T1HQ 4BY1B 3T51B 1VQIA 4NDXA 4YWKA 4C1NK 4MHEA 4DAVA 1GUWA 3EBEA 4Q0FA 1XNRQ 2PQAA 5CGKA 3MXPA 3K0YA 4LK1C 3FKIG 5GROA 3MEHA 1U5KA 4QY7A 1XJVA 1TT2A 3I4MB 5LMNW 2AQ1B 1Z47A 2A6EC 1YEZA 3KJOA 3GTLB 4K5VA 4CDCC 1VQCA 5KYLA 1SYEA 2QGQA 3E5SA 2R7ZB 4FXGC 3AU7A 1IBKQ 2LMCB 3I91A 1TS3A 4HJ8A 2UUCL 1P16A 1EYDA 1YI2A 3VR6A 2N49A 4KD4A 4A3GG 4DR6L 2CKZB 2EYJA 4A3GH 1SMYD 2KCTA 1E0BA 1SNQA 1S4ZA 4HCSA 1PVOA 1Y1WB 3PUWA 1EOVA 3K5NA 4B3RL 3NENA 1O7ZA 3HP3A 4DUYQ 1EQRA 3G4SA 1JJGA 3NHHA 3D31A 4K6LA 1EIFA 1QVFA 3P7JA 4F87A 2ZT9C 4MIUA 4DV7Q 5CR3A 5IYDG 4A93G 4LUOA 4DR2Q 2IX1A 1XNQQ 4A93H 5IYDH 1NY4A 3M7NA 3I73A 1XPUA 2EDGA 2LS01 1Q7YC 4BBRH 3OTOL 2UXDL 2N88A 5C44G 1HR0L 2QILA 1FNWA 1ZYRC 3ND9A 2UXBL 3MTSA 4EX5A 5C44H 2OXPA 3Q0AA 2AKWB 4RCOA 1PTOD 2IX3A 4DR1L 3GTKB 3N52A 4YWLA 2ZXPA 3I4NB 1KAWA 4M1UB 2L15A 1ZEQX 2EYLA 1PTOH 2Z0SA 3MXNB 1EWCA 5BN4A 2R92G 3R2IA 2JA8G 2R92H 5AJ3Q 2JA8H 4C3IB 1ENFA 3AFPA 4JOIC 4A3MG 2AWNA 2JJQA 3W1BA 4DV2L 4K8JA 3S15B 4HJ7A 4DR4L 4KMUC 3NTIA 4LFBL 1BCPD 4AYBE 1OXTA 1Z9FA 1EU4A 3VR5A 1BXTA 2MFIA 1NR4A 2NBFA 3U9OA 5I6YA 3GTPH 5BN3A 5C4JH 2OWOA 2RHQB 1G6PA 4QL5A 1QVGA 1JMCA 4IPDA 4KTAA 4K5XA 2EY1A 3AMUA 3FRPB 4DFAA 1TS5A 1YVCA 5I4DA 4IJHA 4A3IB 3CCSA 1EY0A 4OO1G 3MZ5A 2JXMB 4OO1H 4BA1I 4ZYSA 5M3FG 1LLRD 1YBYA 2F4VL 5M3FH 2I5LX 5I2YA 4KY6A 1ET6A 1YNND 1VQLA 2OTJA 2R93H 1VQPA 1STYA 2KEEA 1VQOA 2PNHA 4JPBW 2Z4IA 2ZJPA 3EIVA 3QWNA 3GTJH 3SE0A 1Q86C 4KN4C 2JA6B 5JJLA 1T9HA 5TSSA 1J6QA 2DGYA 1A6XA 3K0XA 2D62A 3DLLA 2WAQE 4B3ML 4L5SA 1R9TH 1B9NA 2E5LL 3M4OH 4MN3A 1WTXA 2B8GA 4WJWA 2C35B 4JBJA 1LTTD 1DXMA 3CCVA 1EY4A 2YTXA 1B1ZA 1ICFB 5KGUA 4QCLA 4JI6L 1RIPA 1O7IA 4P73A 4ZLTF 4N8FA 4L6TB 3FVQA 2PZUA 4PV1C 4P72A 1CA5A 5CC4A 1K0RA 1EYGA 2ZTEA 2AUJD 3H0GG 5KRUA 1I5FA 4R4IA 2LKVA 2WIIB 4PMWA 3H0GH 4HSVA 3CCMA 4TRDA 4U673 5CBAE 1TWHB 3S24A 2PW7A 3GTQH 2CVRA 4BY7B 3K59A 2NB0A 3S2HB 5C3XA 1SNPA 4XQQA 2PPBC 4UP9A 4A3EG 3I55A 1IYUA 4A3EH 3FEWX 1UE7A 1XPRA 3CHBD 5KNCA 2LFNA 3S2DH 4FVMA 1PH4A 2K32A 1AEXA 5CV7A 1EQQA 1HA6A 2OF1A 1PRTF 4BWGB 1N32Q 4PQXA 4OWWB 3SK5A 2Q8TA 5E4XA 3J81i 3P20A 3M4PA 4POFA 3PF5A 2ICEC 2LY7A 4C56C 1YJNA 5C4ZA 1DJRD 4LFAL 1KDAA 3HOUG 1X3GA 4NPSA 4FF3A 3WOEA 2A6HD 3HOUH 3SK4A 1MSGA 1NUCA 1E2ZA 2K05A 4OONA 3K57A 2SDFA 1EFWA 4BBSH 5ELOA 1TWCH 2XN9C 3ND8A 1G291 5D3IB 4G7HC 1Q1EA 2K5NA 1B2TA 3KLSX 2PCFB 5IGBA 2SOBA 2F3VA 5LHY1 4FP5D 4JBMA 1VQFA 1EQTA 2ZXOA 2A74C 1KRTA 1W2BA 1RTOA 2B2UC 4IPGA 1STHA 2UUAQ 1QNUA 1V1OA 1EYCA 3SK8A 1VQ5A 4K0KQ 1GUNA 2UU9Q 1CUKA 4DV6Q 4DK6C 4TKOB 2R3ZA 2BDNA 2HHHQ 3W3AA 1Q46A 2B2VC 5LL6X 5J22A 5CV6A 1HFGA 2UXCL 1YIJA 3C1EA 2JA5G 1U9RA 1A62A 2JA5H 1HZBA 2Y0SE 3EVQA 1CKOA 3VR4A 2NZ1D 2K04A 1JE4A 3TZUA 4DAPA 1J9OA 3F2DA 2HT1A 4RFBA 2B2WA 2Z8LA 4DV4Q 5I9OA 1WD0A 1Z7TA 2NVTH 3GP7A 2RDHA 3DMUA 2QDLA 2WINB 5IGFA 1N8RC 4JYAQ 4X3KA 1XTDA 4X62L 1TS2A 2CWPA 3K7AH 3NQIA 2EXZA 2F0NA 4FNFA 1PA6A 4LF5Q 4ULLA 1STAA 3OPOA 2E2IB 2HDLA 4TVAB 1ASYA 5EKKA 5DM73 2Q2HA 4KHVA 1L0YB 3SEBA 2BA0A 4QMGA 3Q23A 3GQBA 3I8ZA 4I65A 4IUUA 5JOBA 4HIOA 1MKHA 2O5JC 1WTHA 2VB3X 1QUQA 1U4RA 4KHPL 3EJIA 3VR3A 3K8AA 1UAPA 2DY7A 3A8JE 1RF2D 2F0FA 1J5EQ 1PFSA 1YHAA 3UE1A 3CC2A 4TQUS 2EY2A 2L9HA 4LWCA 2RCFA 2KCMA 1K8AC 3BZCA 4DAMA 2XWBB 2F0GA 5HURA 1K0SA 4LF8L 2NTTA 2JN4A 5K36G 1WJJA 5K36H 1SROA 5COYA 1F9QA 3AYHB 3VYUA 1VQEA 1JJCB 1XPOA 2DUDA 3M9BA 1PZJD 4C2MB 4XQNA 1ZKOA 1AE3A 3A7LA 2X6GA 1BUVT 1F9RA 1Q1BA 4KHZA 1TWFH 3MFYA 3PO3B 1N34Q 5BR8Q 4RKBA 2YU9H 4GNXA 5LMNQ 1HZAA 4X65Q 1HUNA 4GOPB 2WFWA 1H9RA 4B3TQ 1HNZQ 1K3BC 1EOTA 3TP8A 4HAEA 1XXGA 1B50A 2F0VA 1C4QA 1W3SA 2SEBD 3EQLC 4F88A 1V43A 4IFDI 1SXTA 3KUPA 1LT4D 2F0DA 5CV5A 4CKEA 1WFQA 2DNCA 3PUYA 2YYZA 2VUMB 1S5ED 2RF4A 4EVOA 1RL2A 1WTVA 3BVZA 4X6AH 2KUMA 1HZCA 1SDFA 5JAVA 2M9VA 3OIPA 1GVPA 2AHOB 3S1MH 3V96A 5E3FA 4UHVA 1UE5A 1HQMC 1CKNB 5CYUA 2Q2TA 2RDFA 4NB3A 5DEHA 1FJGL 4A3BG 1S5BD 4OX9Q 2MP1A 2Y0SG 3PV0A 4A3BH 5FO8B 1H9MA 4QF4A 2CQOA 2C5CA 2KOLA 3RZOH 3AB9A 3K5LA 1WVLA 1E2VA 4FF1A 2BA1A 1Q12A 3PCOB 3TMEA 5IWAQ 1DOLA 3GTMB 3H91A 5JVH3 3X3NA 4PZ7A 3UDFA 4QQBX 1JWSD 2K50A 3E9IA 4OXPA 1AE2A 4FYDA 3J81L 1GD7A 4I7AA 2WB1B 4HIMA 3GTGB 5BN5A 4CJ1B 5C3EB 1EY7A 3TP5A 4WJ3M 1R4PB 3CU7A 1IW7D 1EZ6A 5M5WH 1HRJA 2NN6I 4UPAA 4NXNL 5EKIA 3J7YW 1YNJD 2EIFA 1K8GA 1X3EA 4DR2L 1A3UA 1XNQL 2A69C 4JI0Q 1KXLA 4KKUA 3NBHA 3TBIB 3S1RB 1KNAA 1U4LA 1GOZA 2KCNA 2HD3A 5IGEA 3IRBA 1QVCA 1AN8A 1VQ4A 2A1AA 1MI2A 1CFMA 1F9PA 2EYHA 5EBCA 3T16A 5D3DA 3A56A 4DUZL 4LW1A 1DCZA 5C4HA 1DOKA 4JI3Q 1HR0W 1H9SA 1I4GA 3STBC 3TRZA 1Q8KA 4RA8A 4IPHA 1X56A 2B2UA 3CCEA 2WKCA 1QB5D 2F0TA 3VDYA 1AZQA 4AQYQ 1ASZA 1CQVA 2M00A 3S16B 3J81E 2OEOA 1VQHA 1JR0D 4HTHA 2QEXA 1VQ6A 4J1MA 2B2VA 1K83B 1B53A 1LTSD 4JI1Q 5KEEA 2ZXRA 1JB7A 4NKLA 3PIPA 1KDCA 4DR3Q 1TY2A 3HKZG 2ZJRA 3HKSA 2NUCA 3K5MA 1O80A 1RKNA 2RDGA 2VS1A 2OQ0A 4C3HG 3RN2A 3HOVG 3I2ZA 3CCJA 4K14A 3W2DA 2B29A 1PMRA 1U4PA 3MAQA 1TWGH 2GVBA 3CP0A 1SMXA 2F0WA 4GLVB 4GKKL 2E2HB 2F0UA 2IHFA 3R3OA 3JAMi 1NSNS 4HJ9A 1PFBA 4C3JB 3U58A 1CT1D 3G7LA 4ME3A 3PO2G 2E2JB 4IOCA 3PO2H 4DNRB 4P75A 3D4WA 3Q22A 2QEJC 1JWUD 4OGQC 4ZAIA 2A19A 1TR5A 4B3SQ 3E0EA 2IJ0A 1L1OA 3L3OC 1DD2A 1V1PB 3T1YQ 3NK9A 4AIMA 2HCIA 1PLFA 3HEJA 4P74A 4DR5L 3KDFA 1V8QA 2D9UA 4XT1B 1H9JA 4P2CB 2R7DA 4K6DA 1WTOA 5A35A 4A3DG 4BY1G 4EQ5A 4RAUC 3H3VH 4A3DH 1LTBD 1NCVA 4BY1H 1OXXK 2QKIC 1F77A 4R8NA 4DV3Q 5E7NA 1PRTD 3F1ZA 1HTLD 1STBA 3Q24A 4IN3A 1NBWA 1A2TA 3FKIH 3KF6B 1EIHA 3BU2A 4R4QA 1Y69U 3CPWA 1HCZA 1N36Q 2E2DC 3S1NH 2X69A 1BVSA 5T1GA 3NWTA 1H95A 2H5XA 3ERQA 1OO9B 2JSOA 5FJ8G 3SVMA 1Z6HA 3GTLH 5FJ8H 2HUGA 1IKLA 1S5DD 4ODGA 4NXML 1F2LA 5C5MA 5HGQA 1NNXA 3PIP3 1XWEA 4B9XA 1UEAB 4OHJA 4DNIA 3G6EA 5IT9L 1LABA 1C48A 3VA5A 1SE4A 3ITPA 4LF6Q 1BO0A 2A6ED 3V2TA 3X3MA 3LWEA 2L4NA 1RD9D 1AW7A 2CFMA 2F0QA 2UUBQ 5JVG3 2EYMA 2K7VA 1VQGA 1BF4A 4JI8Q 4A3GB 3I90A 2K5HA 1ET9A 3F2UA 1IBMQ 3A0JA 3KF8A 3W5OA 4CKBA 1KQSA 5ELEA 1FVIA 1AP0A 1GUGA 1IXRA 4HJAA 1HNWQ 3J81c 2B63G 2UUAL 3I4OA 3D3RA 2B63H 3PUXA 3VYTA 2UU9L 4V190 4EGVA 3GTOH 1PXUA 4RG1A 3UI2A 2JQOA 2O4XA 1I94L 3E3XA 2K52A 1HPCA 1YNXA 1FYCA 3BYTB 4H02A 3F2CA 1X9NA 4A93B 2FFKB 2QF7A 4JI4Q 1NR2A 3OSOA 4BBRB 3HRZC 1H9KA 4UP8A 4XYQA 3HOYG 1F2YA 2D2CC 4YY3Q 3HOYH 5C44B 5IT9E 2IHEA 4A3MH 1WTWA 4C3IG 1JOOA 2K14A 4ZK9B 3RZDB 2K01A 1L0WA 4C3IH 1PH6A 1HNXL 3T53B 2XVSA 1ZYRD 3G71A 3S15H 1PTOB 3QJYA 3URYA 1TS4A 4CJ0B 1CQFA 3RLOA 4DV4L 2R92B 4BA2I 2EZVA 2JA8B 1RHPA 2N3SA 2MHVA 1Q82C 1SNOA 1O7YA 3I4LA 3IFTA 4J6HA 3M3YB 3PUZA 4JYAL 2K4KA 4IUQA 2Q2IA 4QB4A 2R61A 1VDZA 3M7GA 2EPBA 3MFGA 5EBDA 1BCPB 5IOCA 3HOZG 4A3IG 3BZKA 3CC4A 4DNTB 1BR9A 3HOZH 1JICA 2WKDA 3E9HA 1SFOH 4L8JA 2K1BA 1D2BA 2NVYH 1OXUA 1VQDA 1EQVA 2XWJB 2VY3A 4K2LA 3SDZA 1DM0B 4NP5A 1CZGA 4A4IA 1BNZA 1I50H 2VQEL 1XMOL 3A8IE 3L0OA 4CHTB 4M8AA 5D65A 4JI7Q 1QOHA 3M4YA 4LF9L 3RN5A 5C0XI 5ELCA 2J0TD 5M3FB 2GA4B 4N9TA 3DHQA 4HMJA 2R93B 2Z4HA 1J5EL 5JPMC 4OEMB 2PNRC 1D1IA 3WOFA 2F0LA 1I6HH 1AH9A 2PW5A 3CF5A 5KYIA 1D6EC 3QO2A 1WD1A 4BBSB 3PIOA 2MNAA 3DM1A 3S1QH 5FOBB 1ONLA 2ICIA 4HEDA 3A7AB 1G2TA 4JI2L 3C2PA 4H0LC 1NJIC 1D7QA 1R9TB 1EWHA 4QIWB 3M4OB 3FPPA 2RVLA 2XNAC 4Z9CB 2MPMA 1HUMA 4X64L 3JAML 5IE8A 2VQFQ 4JV5L 3NP8A 5BR8L 1M1KC 3L9AX 1XMQL 3AQQA 3H0GB 4GLXA 5M5YH 2EYFA 1FGUA 3GTQB 1RCVD 4X66L 2BE5C 3AFQA 4YHHQ 2ZTCA 3FMCA 4A3EB 2OT2A 4XDXA 2MJ8A 5G3LF 4RCNA 1MJCA 3S2DB 2C9OA 5C4XG 5C4XH 2PZTA 1A0IA 5LMUQ 1E1OA 3F2BA 4LMQD 3PF4A 4R9WA 4LFCL 3DXJC 3OIQA 1HHVA 4IFDG 3FPUB 1DYQA 3BDLA 3TSSA 2UUCQ 4ZRZA 1WOCA 5IT9c 3HOUB 4DR6Q 2A68C 3TN2A 3JAME 4IFDJ 5CV8A 4OX9L 4G7ZC 1LM0A 3CRLC 4IUVA 3RR5A 1J8IA 4LF7L 1TWCB 2CW0D 4RHSA 4AYBG 2Q8IB 3CCRA 4DV0Q 3T56B 4ID6A 1SE3A 4B3RQ 1K8MA 5IWAL 5GADC 1SEBD 4IQZA 3DM3A 3HZXA 2KJXA 4IUNA 2WACA 5IP7G 4UAIA 5IP7H 3CRKC 2PZWA 3MWYW 3PIO3 1S3OA 4Q5VA 1LTID 4DK0A 1SYGA 5J39A 3K58A 1LTGD 2AWOA 2F4IA 5J1ZA 4IURA 1SSOA 4JC0A 3CQZH 3OW2A 1HFNA 3OTOQ 2UXBQ 1HR0Q 5H1SE 2WP8J 2TSSA 1IYJB 3KJPA 5DAUA 1P8LA 5CORA 2L55A 3S14H 1CTMA 1SYDA 4XIGS 1CHQD 1I4QA 1D5XC 5EJWA 1SBBB 3Q8DA 4N9PA 1TIID 4FXDA 1N33Q 4KY5A 3D6WA 3WDNA 1BBUA 3H15A 4DV2Q 2MQHA 4ZCKA 3NTHA 2ZM6L 4WFN3 4DR4Q 2L12A 2WAQG 2ZJQA 3K81C 3MXNA 1E1TA 1QZGA 1TQOA 3MA2B 1HQRD 2WB1E 2ES2A 2K5VA 3MC0B 2F0EA 4JI5L 5CMDA 1U4MA 1G2SA 2GVAA 4AQYL 3K7AB 3PSIA 1BOSA 2A8VA 1TKWB 3TREA 4OIKA 3D6CA 3RMHA 3K80C 3CD6A 3FDTA 1MIUA 4KJNA 4DAYB 3SR1A 3UE0A 2YV5A 3H09A 2VXWA 3F8TA 1UE6A 3NSWA 4L63B 3DEPA 1PH2A 4FF2A 3U50C 5JJIA 2H1EA 2PYKA 2D0PA 4JOIA 4H44C 2F0IA 4DV5L 1C8CA 1HA5A 1PH9A 4CDFC 4E6IA 3K5OA 3GDEA 5EGTA 1PHJA 3T4AC 4WJ4A 2K5DA 3KBGA 3BS1A 1ICWA 1B3QA 1QJOA 5EPLA 4GOPC 2R7FA 3PQIA 4A75A 1YJ9A 3T13A 1BKBA 4OIJA 4IJLA 4RGNA 4LF4Q 2E5LQ 4DR7L 5LL6S 2KHSA 4DXFA 1IBLL 4B3SL 2DJGC 3OWEB 4IO9A 1Y8OB 2VNUD 4OL7A 4JVZA 3IFDA 1EWIA 2SNSA 5M5XB 1X3QA 3CCLA 2B2TC 2NVXB 1CA6A 1NMGA 2PQAB 1SYFA 1WCMG 3JAMc 3ZYYX 1QILA 1WCMH 3T1HL 3OOCA 1TWFB 3S9WA 1D5MC 1SJHD 1SN8A 2TMPA 1XNRL 2KHJA 2JP1A 5IY0A 2YU9B 2JA7B 1O78A 2WV6D 1X3PA 2LXKA 1QWYA 3ULLA 1MJEA 1SRUA 2RSNA 1GHKA 4A3JG 2JA9A 1QG7A 2RBMA 4A3JH 5FK9C 1LTAD 1EUJA 4H7BA 1BQQT 1CKMA 4XQJA 4A3FG 4PMBA 2BH2A 5K5PA 4QJFA 4A3FH 3DWAA 1VQ8A 4QUCA 5IGDA 1AZPA 3VYRA 5CBEE 2E74C 3NELA 2Z1CA 1C9OA 1DOMA 5D14A 3EFXD 1IBKL 5HY6A 3S1MB 2EYOA 2BH8A 4A3KG 4YWMA 1KAAA 1CM9A 4KV6A 4A3KH 4LNQA 4IPCA 4XTCS 4KK7A 3S17H 4LF6L 1EY6A 4A3BB 1FD7D 5JEAG 3J7AF 2F0PA 1II3A 5JEAH 5L37A 2F0KA 1XX8A 3RZOB 1VF7A 2FHTA 1B8AA 1OTCA 1Y8NB 2F0HA 2SNMA 2FINB 1LO5D 3HOXG 5JEAJ 4DUYL 1B70B 3HOXH 2KECA 2F0JA 1Q8IA 2OCEA 1IBML 1OXVA 3I56A 1KABA 1QZHA 1A3VA 4DV7L 2L0CA 2RQXA 4O42A 1HJPA 1UUPA 5M3MB 3CKIB 5GQOA 2LXJA 3NXWA 1I3QH 3R93A 1FNUA 2I5HA 3BJUA 3E6ZX 2UXCQ 2HCCA 3OW7A 1GXDC 5M5WB 2AQ2B 3S1RH 2A73B 1NTGA 2K28A 1EL0A 1Q3LA 4GKJQ 5DNFA 3NBIA 4MTKA 4GLAC 1WTPA 1IHZA 3M4QA 1BDOA 1B44D 3RLNA 3J80i 1I4HA 1PV4A 1ENAA 3HG9A 5AJ3L 3UDIA 2A69D 4YY3L 4KI0A 1RTNA 5IGCA 2J4XA 1PFNA 4O1NA 1LV9A 3HGBA 3E0JA 1MSHA 1TWAH 3HS0C 2N55A 2EY5A 4R4CA 1ESFA 3KFUA 1JWMD 1D1KA 3K7UC 3V05A 2ALYB 3NPPA 1R4QB 4L5RC 2EJMA 2F03A 1FR3A 4JG2A 4N8X1 4CGYB 3M85A 1TU2B 1VMPA 2IW3A 4RGMA 3STBD 4K8IA 1PH8A 4JK1C 4C3HH 3GD7A 3HOVH 2AUKA 1Y1VG 3QOJA 2F3IA 1NMFA 2F0MA 1Y1VH 3CXCA 5KNBA 2HDMA 5GAGC 1GUSA 1KLGD 2NVQH 2PMZB 3R2TA 1ILPA 2RSOA 1JC7A 2KCCA 3HKZB 1BBXC 3IAYA 1PFMA 2XSCA 2HQLA 3NEMA 4C3JG 4QUFA 1EZ8A 4WORA 5J3BA 5C3WA 4C3JH 2XTIA 3A54A 1TWGB 2RHSB 3A74A 4JBWA 3ULJA 2IWHA 5FLMG 1IKMA 2Q2UA 1G8ZD 5FLMH 1SNMA 2Z9HA 1X6OA 2JEBI 1S40A 1EEID 3QIAA 3CMAA 5IODA 4Y7NH 2NZHA 4LF8Q 1SAPA 2IL8A 1M90C 1QCBD 4DK1A 4ZKBB 3GO5A 5C0XG 1EIYB 1KRSA 5C0XH 5NUCA 1XYIA 2FMMA 3HOWB 1MBYA 1S72A 4UP7A 4ZQ3A 1M4VA 3TZDA 5C0XJ 3EN2A 4GN5A 2F1MA 1LT3D 3D4DA 4MZ9A 4BXXG 3VR2A 1SYCA 2ID0A 4BXXH 2QCPX 3KYHC 2E76C 1CHPD 5G3LD 3SHLA 4FO2A 4DPGA 2VQFL 1OXSC 4A3DB 1WI5A 4KLKA 2B3GA 2E8GA 2B39A 2BCOA 1MHWC 3I4MG 3I4MH 4F8MA 1PDQA 2KBNA 5AFWA 1PRTB 1DGSA 3FKIB 2BOSA 4GOPA 3BG3A 1B3AA 5EKLA 3KOJA 2R7ZG 1N32L 3S1NB 1W6JA 2R7ZH 1GKHA 1M8AA 4YHHL 1PZID 1LACA 4EQOA 4QIWE 1X65A 1SMYC 4GN4B 4A3LG 2L5TA 3OHXC 4NW2A 4XYOA 4A3LH 1E2WA 1B7YB 3J7A5 3A5ZB 5LMUL 3JC66 1HTPA 2B2TA 1FJGQ 2B2YC 2DNEA 1VF5C 2IX0A 2PI2E 2N78A 2F0OA 2CH4W 1YJWA 1Y1WG 1EU3A 1QE6A 1TVXA 1CKNA 5JPNC 2CH4A 4B9WA 1Y1WH 1EFID 1YHQA 3DWQA 5I9PA 3GV3A 3QOLA 1W6KA 4UY8C 1K9MC 2B2WC 2L11A 2NTSA 3FP9A 1KL9A 4DV0L 4HN7A 1FNVA 3I72A 1SE2A 2KQ3A 4K0KL 1XTCD 1RDPD 3I70A 1PTOC 4DV6L 4KD3A 4J15A 1GUOA 3U9SA 2G9DA 2HHHL 2BDOA 2R6GA 1RODA 4NXNQ 3L2PA 2B63B 5CV4A 3I4NG 3GTKH 4QGUA 1PZKD 3I4NH 3GTOB 1ILQA 4BBRG 1DZ1A 4YIJA 1VCIA 3MVVA 1CSPA 2XIWA 5ELFA 3OYYA 5DM63 1KLUD 2KENA 1BCPC 1LUZA 3D8GA 4DUZQ 3RZDH 1JE5A 2CWAA 4ZKCB 4K2KA 1TXYA 2NZOA 1S5FD 3HOYB 1BBWA 5IYCG 4A3MB 5F2DA 5C6AA 1U0LA 5IYCH 1N33L 1KD1C 3ULPA 1PYSB 4ME5A 1E24A 3CC7A 3M3YH 2VL6A 2HIXA 4LF5L 3GTPB 1T5EA 4A3IH 5C4JB 3LX0A 4FXKC 3TS2A 1YNNC 1PH1A 1QUQB 2I46A 1KHIA 5ELDA 1JB3A 5GAEC 2XRSD 3BDCA 3J80L 1KNEA 2EXDA 2QDBA 3HOZB 4PNYA 1SFOB 4HSPA 2NVYB 3U4VA 3SXHA 4GKKQ 2JA6G 5A2QL 2JA6H 4GNXC 3NTKA 1I50B 2MUYA 2O2LD 4DU9A 4JBKA 5I6WA 2R93G 2K75A 3GTJB 4ALPA 4B08A 5FLXL 2XRQD 1QNKA 4BBSG 2FXQA 4P71A 3ZJYC 5EAYA 3A5UA
chains in the Genus database with same CATH topology
1ENCA 3P1HA 1DONA 4KKTA 3EA6A 5FKAC 1I6HB 4ABNA 3DWPA 3S1QB 1O7LA 5IGGA 1V1PA 4WRDA 5HGTA 3BZDB 3ONAB 3J80E 2HQEA 2MGSA 4ILWA 5A2QE 3P75A 4IUPA 5M5YB 2KVMA 2A6HC 2NYZD 3BDOA 4EQNA 5FLXE 1EY5A 3KLRA 3R8BA 3D4RA 4IFDH 1JOKA 4TSSA 5EQ0A 4IUTA 5C4XB 1GJXA 2BE5D 5C5LA 2CW0C 3NE5B 2H4OA 3MHBA 4LAAA 1A3TA 5FO7B 1I4PA 4KN7C 1S5CD 5ELBA 1PYWD 5T1IA 4CKCA 2A68D 4PMCA 4AYBB 2EVBA 3LWUA 2E75C 2A5HA 4C1NI 4RWSC 1RJTA 4X3TA 1EIGA 2K03A 3CQZB 2JA5B 2B2YA 4EQPA 1H9SB 2J7ZA 3L7ZC 4NMZA 2NN6G 3RLFA 2NN6H 4BS9A 5FO9B 1GHJA 4IALA 2M2LA 3S14B 5CV9A 2IT1A 2O5IC 1Q90A 2NVTB 2X6LA 4G57A 1PTOF 4OO1I 3C46A 3MXGA 1EY8A 1I6VC 1ML0D 5ISRA 2WAQB 1F9SA 4GZYC 1TY0A 4S3SA 3RD4A 3GV6A 1BCPF 2I07B 3J7AV 4R8IA 3KK7A 4HR7B 1B9MA 1HXYD 3A55A 1JOQA 2FMCA 2K5QA 4RGTA 3IL8A 3TP7A 2NWGA 1Y8PB 4DA2A 1CK1A 2Q8RE 1FGBD 2VB2X 1IL8A 3EROA 1L0XB 5E1FA 4DGZA 2V4DA 1F2ZA 4RKLA 1T5XD 1JORA 3NWSA 3TDQA 1G6ZA 3C1FA 2RA4A 1KDBA 5KNDA 1STGA 1B4OA 2JEAI 3QG1A 3SK6A 2PQEA 4CJ2C 1LTRD 4RHRA 4RH6A 4G7OC 1SNDA 4DN4M 2EE1A 1VMCA 1WCMB 3K6OA 4X3UA 4ZUJA 2JYOA 1EEFD 4RGOS 4X3SA 3OMCA 2L1BA 4G4KA 3RUZA 3TP6A 1SJED 4A3JB 2RKSA 4KKSA 2DN8A 4A3FB 3BYYB 4IZ8A 4CBVA 1LT6D 1LT5D 1SYBA 1A15A 4HMIA 1STEA 2PO4A 2Y0SB 1ZXTA 4HCEA 5M9OA 2FJ2A 4KJOA 4DF7A 4A3KB 4V0BA 3H6MA 1JCKB 4H13C 5EPKA 1IW7C 2EJGC 4ZUIA 3S17B 3KBXA 2K5WA 4U68A 1KTKA 2JE6I 1YNJC 1WTRA 1A2UA 2B8FA 1K8OA 1X32A 3PUVA 2EY6A 5I2XA 1CI3M 3HOXB 3I3CA 3OWFA 2KEDA 3VYSA 3PMFA 1AFPA 2EJFC 3A8KE 1G91A 1MD2D 1EYAA 1I3QB 2CQAA 3O13A 5KIXA 3NUCA 4I7ZC 1GUTA 1SNCA 3N6RA 5E4WC 4J8QA 2K33A 3C3LA 1TWAB 2D5DA 1ESRA 1JQYD 4XT3B 3LNNA 2KA7A 4F7XA 3NQTA 3BVGA 1EY9A 4XXEA 1I4XA 1I4RA 2F0SA 4LJZC 3G6JB 4C3HB 3HOVB 1F2MA 1Y1VB 2K6AA 1D5ZC 2IPKD 4DAYA 2CHBD 2NVQB 2ENBA 4FF4A 3BVMA 3VA7A 5IIFA 1UNSA 2F3WA 3PO2B 4UDUC 3H3VC 4KY7A 3Q6SA 2G9HD 1MGSA 3IKJA 3MXUA 1STNA 3DUZA 1IYVA 5JJZA 4Y7NB 1WTQA 3OMGA 1CZWA 1PRTC 1NAPA 3H94A 4DXGA 2EOTA 3QB3A 2DY8A 2EYPA 3DEOA 5EPJA 2AQ3B 3KLSA 4K5WA 4BY1B 3T51B 4NDXA 4C1NK 4MHEA 4DAVA 1GUWA 4Q0FA 5CGKA 3MXPA 3K0YA 4LK1C 3MEHA 1TT2A 3I4MB 2AQ1B 1Z47A 2A6EC 3GTLB 4K5VA 5KYLA 1SYEA 2R7ZB 3E5SA 4FXGC 3AU7A 2LMCB 3I91A 1TS3A 1EYDA 3VR6A 4KD4A 2EYJA 1SMYD 1E0BA 1SNQA 1S4ZA 4HCSA 1Y1WB 3PUWA 3K5NA 1O7ZA 3HP3A 3NHHA 3D31A 4K6LA 3P7JA 4F87A 2ZT9C 4MIUA 5CR3A 2IX1A 3M7NA 3I73A 2EDGA 2LS01 2N88A 2QILA 1FNWA 1ZYRC 3ND9A 3MTSA 2OXPA 3Q0AA 4RCOA 1PTOD 2IX3A 3GTKB 3N52A 2ZXPA 3I4NB 4M1UB 1ZEQX 2EYLA 1PTOH 1EWCA 5BN4A 3R2IA 4C3IB 1ENFA 2AWNA 4K8JA 3S15B 4KMUC 3NTIA 1BCPD 1OXTA 1EU4A 3VR5A 1BXTA 1NR4A 2NBFA 3U9OA 5I6YA 5BN3A 4KTAA 4K5XA 2EY1A 3AMUA 3FRPB 4DFAA 1TS5A 5I4DA 4A3IB 1EY0A 4OO1G 3MZ5A 2JXMB 4OO1H 4BA1I 4ZYSA 1LLRD 5I2YA 4KY6A 1ET6A 1YNND 1STYA 2KEEA 2Z4IA 3QWNA 3SE0A 4KN4C 2JA6B 5TSSA 1A6XA 2D62A 1B9NA 4MN3A 1WTXA 2B8GA 4WJWA 1LTTD 1DXMA 1EY4A 1B1ZA 5KGUA 4QCLA 4ZLTF 4L6TB 3FVQA 2PZUA 4PV1C 1CA5A 5CC4A 2AUJD 5KRUA 2LKVA 2WIIB 4PMWA 4HSVA 4TRDA 4U673 5CBAE 1TWHB 2PW7A 4BY7B 2CVRA 3K59A 2NB0A 3S2HB 5C3XA 1SNPA 4XQQA 2PPBC 1IYUA 3FEWX 3CHBD 5KNCA 2LFNA 4FVMA 2K32A 1AEXA 5CV7A 1HA6A 2OF1A 1PRTF 4BWGB 4PQXA 3SK5A 2Q8TA 5E4XA 3P20A 2ICEC 2LY7A 4C56C 5C4ZA 1DJRD 1KDAA 4FF3A 3WOEA 2A6HD 3SK4A 1MSGA 1NUCA 1E2ZA 2K05A 3K57A 2SDFA 2XN9C 3ND8A 1G291 5D3IB 4G7HC 1Q1EA 1B2TA 3KLSX 2PCFB 5IGBA 2SOBA 2F3VA 5LHY1 4FP5D 1EQTA 2ZXOA 2A74C 1RTOA 2B2UC 1STHA 1QNUA 1V1OA 1EYCA 3SK8A 1GUNA 4TKOB 2R3ZA 2BDNA 3W3AA 2B2VC 5LL6X 5J22A 5CV6A 1HFGA 3C1EA 1U9RA 3EVQA 3VR4A 2NZ1D 2K04A 1JE4A 3TZUA 4DAPA 1J9OA 4RFBA 2B2WA 2Z8LA 5I9OA 1WD0A 1Z7TA 3GP7A 2RDHA 3DMUA 5IGFA 2WINB 4X3KA 1TS2A 3NQIA 2EXZA 2F0NA 4FNFA 4ULLA 1STAA 3OPOA 2E2IB 2HDLA 5EKKA 5DM73 4KHVA 1L0YB 3SEBA 2BA0A 4QMGA 3Q23A 3GQBA 3I8ZA 4I65A 4IUUA 5JOBA 2O5JC 2VB3X 1U4RA 3EJIA 3VR3A 1UAPA 2DY7A 3A8JE 1RF2D 2F0FA 4TQUS 2EY2A 2L9HA 2XWBB 2F0GA 5HURA 2NTTA 5K36G 5K36H 5COYA 1F9QA 3VYUA 1PZJD 4C2MB 4XQNA 1ZKOA 3A7LA 2X6GA 1BUVT 1F9RA 1Q1BA 4KHZA 3MFYA 3PO3B 4RKBA 1HUNA 1H9RA 1EOTA 3TP8A 4HAEA 1XXGA 1B50A 2F0VA 1C4QA 2SEBD 3EQLC 4F88A 1V43A 4IFDI 1SXTA 3KUPA 1LT4D 2F0DA 5CV5A 4CKEA 2DNCA 3PUYA 2YYZA 2VUMB 1S5ED 4EVOA 1WTVA 3BVZA 2KUMA 1SDFA 5JAVA 2M9VA 3OIPA 3V96A 5E3FA 1HQMC 5CYUA 2RDFA 5DEHA 1S5BD 2MP1A 3PV0A 5FO8B 1H9MA 4QF4A 2C5CA 2KOLA 3AB9A 3K5LA 1WVLA 1E2VA 4FF1A 2BA1A 1Q12A 3TMEA 1DOLA 3GTMB 3H91A 5JVH3 3X3NA 1JWSD 4FYDA 3J81L 2WB1B 3GTGB 5BN5A 4CJ1B 5C3EB 1EY7A 3TP5A 1R4PB 3CU7A 1IW7D 1EZ6A 1HRJA 2NN6I 3J7YW 5EKIA 1YNJD 1A3UA 2A69C 4KKUA 3NBHA 3TBIB 3S1RB 1KNAA 1U4LA 1GOZA 2KCNA 5IGEA 1AN8A 1MI2A 1CFMA 1F9PA 2EYHA 5EBCA 3T16A 5D3DA 3A56A 1DCZA 5C4HA 1DOKA 1H9SA 1I4GA 4RA8A 2B2UA 2WKCA 1QB5D 2F0TA 1AZQA 1CQVA 2M00A 3S16B 3J81E 2OEOA 1JR0D 4HTHA 4J1MA 2B2VA 1K83B 1B53A 1LTSD 5KEEA 2ZXRA 4NKLA 1KDCA 1TY2A 2NUCA 3K5MA 1O80A 1RKNA 2RDGA 4C3HG 4K14A 3W2DA 1PMRA 1U4PA 3MAQA 2F0WA 2E2HB 2F0UA 3R3OA 1NSNS 1PFBA 4C3JB 1CT1D 3G7LA 2E2JB 4DNRB 3D4WA 3Q22A 2QEJC 1JWUD 4OGQC 4ZAIA 1TR5A 2IJ0A 3L3OC 1DD2A 1V1PB 3NK9A 2HCIA 1PLFA 3HEJA 1V8QA 2D9UA 4XT1B 1H9JA 4P2CB 4K6DA 1WTOA 5A35A 4RAUC 1LTBD 1NCVA 1OXXK 2QKIC 1F77A 4R8NA 1PRTD 1HTLD 1STBA 3Q24A 4IN3A 1A2TA 1EIHA 1Y69U 1HCZA 2E2DC 2X69A 5T1GA 3NWTA 3ERQA 1OO9B 2JSOA 3SVMA 1Z6HA 2HUGA 1IKLA 1S5DD 4ODGA 1F2LA 5C5MA 3PIP3 1XWEA 4B9XA 1UEAB 4OHJA 5IT9L 1LABA 1C48A 3VA5A 1SE4A 3ITPA 1BO0A 2A6ED 3V2TA 3X3MA 3LWEA 2L4NA 1RD9D 1AW7A 2F0QA 5JVG3 2EYMA 2K7VA 1BF4A 4A3GB 3I90A 1ET9A 3F2UA 3KF8A 4CKBA 5ELEA 1AP0A 1GUGA 3D3RA 3PUXA 3VYTA 4V190 4EGVA 1PXUA 3UI2A 2O4XA 1HPCA 1FYCA 3BYTB 4A93B 2FFKB 2QF7A 1NR2A 3OSOA 4BBRB 3HRZC 1H9KA 4XYQA 1F2YA 2D2CC 5C44B 5IT9E 1WTWA 4C3IG 1JOOA 4ZK9B 3RZDB 2K01A 3T53B 2XVSA 1ZYRD 1PTOB 3QJYA 3URYA 1TS4A 4CJ0B 1CQFA 2R92B 4BA2I 2EZVA 2JA8B 1RHPA 2MHVA 1SNOA 1O7YA 3I4LA 3IFTA 4J6HA 3M3YB 3PUZA 4IUQA 4QB4A 2R61A 1VDZA 3M7GA 2EPBA 3MFGA 5EBDA 1BCPB 5IOCA 4DNTB 1BR9A 1JICA 2WKDA 4L8JA 2K1BA 1D2BA 1OXUA 1EQVA 2XWJB 4K2LA 3SDZA 1DM0B 4NP5A 1CZGA 1BNZA 3A8IE 4CHTB 4M8AA 5D65A 1QOHA 3M4YA 5C0XI 5ELCA 2J0TD 5M3FB 2GA4B 4N9TA 3DHQA 4HMJA 2R93B 2Z4HA 5JPMC 2PNRC 1D1IA 3WOFA 2F0LA 2PW5A 5KYIA 1D6EC 3QO2A 1WD1A 4BBSB 3DM1A 5FOBB 1ONLA 2ICIA 4HEDA 3A7AB 1G2TA 3C2PA 4H0LC 1R9TB 1EWHA 4QIWB 3M4OB 3FPPA 2RVLA 2XNAC 4Z9CB 2MPMA 1HUMA 3JAML 3NP8A 3L9AX 3H0GB 2EYFA 3GTQB 1RCVD 2BE5C 3FMCA 4A3EB 2OT2A 4XDXA 2MJ8A 5G3LF 4RCNA 3S2DB 2C9OA 2PZTA 4LMQD 4R9WA 3DXJC 3OIQA 1HHVA 4IFDG 3FPUB 1DYQA 3BDLA 3TSSA 4ZRZA 3HOUB 2A68C 3TN2A 3JAME 4IFDJ 5CV8A 4G7ZC 3CRLC 4IUVA 1J8IA 1TWCB 2CW0D 4RHSA 2Q8IB 3T56B 4ID6A 1SE3A 1K8MA 1SEBD 4IQZA 4IUNA 3HZXA 2KJXA 2WACA 4UAIA 3CRKC 2PZWA 3MWYW 3PIO3 4Q5VA 1LTID 4DK0A 1SYGA 5J39A 3K58A 1LTGD 2AWOA 2F4IA 5J1ZA 4IURA 1SSOA 1HFNA 2WP8J 2TSSA 5DAUA 5CORA 2L55A 1CTMA 1SYDA 4XIGS 1CHQD 1I4QA 1D5XC 5EJWA 1SBBB 4N9PA 1TIID 4FXDA 4KY5A 3D6WA 3WDNA 3NTHA 4WFN3 2L12A 3MXNA 1TQOA 3MA2B 1HQRD 3MC0B 2F0EA 5CMDA 1U4MA 1G2SA 3K7AB 1BOSA 1TKWB 4OIKA 3D6CA 3RMHA 3FDTA 4KJNA 3SR1A 3H09A 2VXWA 3NSWA 4L63B 3DEPA 4FF2A 2H1EA 2PYKA 4H44C 2F0IA 1C8CA 1HA5A 4E6IA 3K5OA 5EGTA 3T4AC 2K5DA 3KBGA 3BS1A 1ICWA 1QJOA 5EPLA 3T13A 4OIJA 4RGNA 5LL6S 2KHSA 4DXFA 3OWEB 1Y8OB 2VNUD 4OL7A 3IFDA 2SNSA 5M5XB 1X3QA 2B2TC 2NVXB 1CA6A 1SYFA 3ZYYX 1QILA 3OOCA 1TWFB 3S9WA 1D5MC 1SJHD 2TMPA 2JP1A 2YU9B 2JA7B 1O78A 2WV6D 1X3PA 1QWYA 1GHKA 2RSNA 1QG7A 2RBMA 5FK9C 1LTAD 4H7BA 1BQQT 4XQJA 4PMBA 5K5PA 3DWAA 4QUCA 5IGDA 1AZPA 3VYRA 5CBEE 2E74C 2Z1CA 1DOMA 5D14A 3EFXD 3S1MB 2EYOA 1KAAA 1CM9A 4KV6A 4XTCS 4KK7A 1EY6A 4A3BB 1FD7D 5JEAG 3J7AF 2F0PA 1II3A 5JEAH 2F0KA 1XX8A 3RZOB 1VF7A 2FHTA 1Y8NB 2F0HA 2SNMA 2FINB 1LO5D 5JEAJ 2KECA 2F0JA 1Q8IA 1OXVA 1KABA 1A3VA 2L0CA 2RQXA 4O42A 1UUPA 5M3MB 3CKIB 3NXWA 3R93A 1FNUA 3E6ZX 2HCCA 3OW7A 1GXDC 5M5WB 2AQ2B 2A73B 2K28A 1EL0A 1Q3LA 5DNFA 3NBIA 1WTPA 1IHZA 1BDOA 1B44D 1I4HA 1ENAA 3HG9A 2A69D 4KI0A 1RTNA 5IGCA 2J4XA 1PFNA 4O1NA 1LV9A 3HGBA 3E0JA 1MSHA 3HS0C 2N55A 2EY5A 1ESFA 1JWMD 1D1KA 3V05A 3NPPA 1R4QB 2EJMA 2F03A 1FR3A 4CGYB 3M85A 1TU2B 1VMPA 2IW3A 4RGMA 4K8IA 4JK1C 3GD7A 2AUKA 3QOJA 2F0MA 5KNBA 2HDMA 1GUSA 1KLGD 2PMZB 3R2TA 1ILPA 2RSOA 1JC7A 2KCCA 3HKZB 1BBXC 3IAYA 1PFMA 2XSCA 4C3JG 4QUFA 1EZ8A 4WORA 5C3WA 3A54A 1TWGB 4JBWA 2IWHA 1IKMA 1G8ZD 1SNMA 2JEBI 1EEID 3QIAA 5IODA 1SAPA 2IL8A 1QCBD 4DK1A 4ZKBB 3GO5A 5C0XG 5C0XH 5NUCA 1XYIA 2FMMA 3HOWB 1MBYA 4ZQ3A 1M4VA 3TZDA 5C0XJ 2F1MA 1LT3D 3D4DA 3VR2A 1SYCA 2ID0A 2QCPX 2E76C 1CHPD 5G3LD 3SHLA 4FO2A 1OXSC 4A3DB 2B39A 2BCOA 4F8MA 1PDQA 5AFWA 1PRTB 3FKIB 2BOSA 3BG3A 1B3AA 5EKLA 3S1NB 1W6JA 1M8AA 1PZID 1LACA 4EQOA 1SMYC 2L5TA 3OHXC 4NW2A 4XYOA 1E2WA 1HTPA 2B2TA 2B2YC 2DNEA 1VF5C 2IX0A 2F0OA 1EU3A 1QE6A 1TVXA 5JPNC 4B9WA 1EFID 3DWQA 5I9PA 3GV3A 3QOLA 1W6KA 2B2WC 2L11A 2NTSA 4HN7A 1FNVA 3I72A 1SE2A 2KQ3A 1XTCD 1RDPD 3I70A 1PTOC 4KD3A 1GUOA 3U9SA 2G9DA 2BDOA 2R6GA 1RODA 2B63B 5CV4A 1PZKD 3GTOB 1ILQA 1DZ1A 4YIJA 1VCIA 3MVVA 2XIWA 5ELFA 5DM63 1KLUD 1BCPC 3D8GA 4ZKCB 4K2KA 3HOYB 1S5FD 4A3MB 5F2DA 5C6AA 4ME5A 3GTPB 1T5EA 5C4JB 3LX0A 4FXKC 1YNNC 2I46A 5ELDA 1JB3A 2XRSD 3BDCA 3J80L 1KNEA 2QDBA 3HOZB 4PNYA 1SFOB 4HSPA 2NVYB 3SXHA 5A2QL 3NTKA 1I50B 2MUYA 2O2LD 4DU9A 5I6WA 3GTJB 4B08A 5FLXL 2XRQD 1QNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3T A;  4CJ1 B;  1BBX C;  1DON A;  1PFM A;  2B2W C;  2L11 A;  1DOM A;  2L9H A;  5CMD A;  1WTO A;  1U4M A;  5D14 A;  1WTW A;  4DN4 M;  1EIG A;  1G2S A;  2EE1 A;  5E4W C;  2K03 A;  4ZK9 B;  2K01 A;  4QUF A;  1HRJ A;  2B2Y A;  1CM9 A;  1VMC A;  4OIK A;  4RAU C;  1EQT A;  2J7Z A;  1NCV A;  4X3U A;  5EKI A;  3FDT A;  2JYO A;  1IKM A;  4CJ0 B;  4XDX A;  1ESR A;  2MJ8 A;  1RTO A;  2B2U C;  5COY A;  1F9Q A;  2VXW A;  2M2L A;  1RHP A;  3I91 A;  4XT3 B;  1KNA A;  1U4L A;  4X3S A;  1O7Y A;  2L1B A;  3ONA B;  2KEE A;  1MI2 A;  1ROD A;  3DEP A;  1F9P A;  1XX8 A;  2X6G A;  1SAP A;  2H1E A;  4LMQ D;  4R9W A;  1EIH A;  2IL8 A;  2FHT A;  2X6L A;  4IUQ A;  1F9R A;  2R3Z A;  1HHV A;  3FPU B;  2BDN A;  1E0B A;  1ILQ A;  4ZKB B;  1DZ1 A;  2FIN B;  1DOK A;  1S4Z A;  2B2V C;  2X69 A;  2XIW A;  1C8C A;  2EPB A;  2MGS A;  5T1G A;  2KEC A;  1ML0 D;  4HCS A;  1XYI A;  1HFG A;  2FMM A;  3TN2 A;  1JIC A;  3SVM A;  1F9S A;  4O42 A;  4RA8 A;  4MN3 A;  4IUP A;  4IUV A;  2K1B A;  2B2U A;  3TZD A;  1WTX A;  1O7Z A;  1J8I A;  1HUN A;  1ICW A;  3HP3 A;  5EPL A;  4ZKC B;  1A15 A;  1IKL A;  2HUG A;  2KVM A;  2NYZ D;  3GV6 A;  3R93 A;  1EOT A;  2NZ1 D;  1AZQ A;  1F2L A;  1BNZ A;  4HAE A;  2K04 A;  1B50 A;  1JE4 A;  4OIJ A;  3P7J A;  1J9O A;  1ZXT A;  2HCC A;  4ZLT F;  5D65 A;  2FJ2 A;  4R8I A;  2K28 A;  3KUP A;  1CA5 A;  1EL0 A;  1Q3L A;  2B2V A;  1B53 A;  2B2W A;  5EPK A;  5DNF A;  1BO0 A;  4UAI A;  1WD0 A;  3Q6S A;  3LWE A;  1WTP A;  3MWY W;  4HSV A;  5EQ0 A;  2L4N A;  3IFD A;  2N88 A;  3KBX A;  4IUT A;  3IL8 A;  1MGS A;  1X3Q A;  4U68 A;  1WTV A;  1O80 A;  3MTS A;  2B2T C;  2KUM A;  5CBA E;  1WTR A;  1SDF A;  4X3K A;  2CVR A;  1PDQ A;  2NWG A;  1CA6 A;  5AFW A;  4IUR A;  5JJZ A;  1SSO A;  1WTQ A;  1RTN A;  1BF4 A;  2Q8R E;  1NAP A;  3N52 A;  1PFN A;  1LV9 A;  1HFN A;  3I90 A;  3QO2 A;  1B3A A;  1MSH A;  1U4P A;  1X32 A;  1WD1 A;  1IL8 A;  2EOT A;  2N55 A;  3DM1 A;  3F2U A;  1M8A A;  2HDL A;  4HED A;  2DY8 A;  3I3C A;  1PFB A;  2KED A;  3DEO A;  1KNE A;  5EPJ A;  1G2T A;  2JP1 A;  2MP1 A;  1AP0 A;  5COR A;  1HA6 A;  2RVL A;  4NW2 A;  3G7L A;  1B2T A;  1X3P A;  2MPM A;  2KOL A;  5EJW A;  5T1I A;  1HUM A;  2RSN A;  1G91 A;  1WVL A;  2B2T A;  3I8Z A;  4MHE A;  5E4X A;  2Q8T A;  1GUW A;  1VMP A;  1QG7 A;  2B2Y C;  4IUU A;  4ZAI A;  3D6W A;  3UI2 A;  1NR4 A;  1DOL A;  1G6Z A;  3H91 A;  1QE6 A;  1TVX A;  2L12 A;  1MSG A;  1U4R A;  2FFK B;  2RA4 A;  1B4O A;  2HDM A;  2HCI A;  2K05 A;  1PLF A;  4RWS C;  4QUC A;  2DY7 A;  1AZP A;  1NR2 A;  2SDF A;  5CBE E;  1ILP A;  1QNK A;  2RSO A;  1RJT A;  2D9U A;  3GV3 A;  4XT1 B;  4CJ2 C; 
#chains in the Genus database with same CATH topology
 2I0Q A;  2Z6K C;  1ENC A;  3P1H A;  1DON A;  4KKT A;  3EA6 A;  2I5M X;  5FKA C;  3H3V I;  1I6H B;  3CCQ A;  1VQK A;  4CDE C;  4ABN A;  4DR5 Q;  4LF4 L;  3DWP A;  4GNX B;  3S1Q B;  4JW0 A;  1O7L A;  3B6Y A;  5IGG A;  2GN5 A;  4DV1 Q;  1V1P A;  4BY7 G;  1IL2 A;  1N34 L;  1TWH H;  4WRD A;  5HGT A;  4BY7 H;  2YTV A;  3BZD B;  3ONA B;  3S2H H;  3J80 E;  2HQE A;  5LMN L;  4X65 L;  4IOA A;  2MGS A;  4B3T L;  1HNZ L;  4ILW A;  5A2Q E;  3P75 A;  3UDG A;  1IZ6 A;  4IUP A;  1X3F A;  2IY5 B;  2QW7 A;  5M5Y B;  2KVM A;  2A6H C;  2NYZ D;  3BDO A;  4EQN A;  5FLX E;  2ATW A;  1UE1 A;  1EY5 A;  1JT8 A;  3KF6 A;  3KLR A;  3R8B A;  3D4R A;  3LGJ A;  4IFD H;  1X54 A;  2YTY A;  4NXM Q;  1JOK A;  4TSS A;  5EQ0 A;  4IUT A;  4A76 A;  5C4X B;  2KHI A;  1GJX A;  2BE5 D;  5C5L A;  4PZ8 A;  2RCN A;  1YZ6 A;  2CW0 C;  3NE5 B;  2H4O A;  3MHB A;  4LAA A;  4Y52 H;  1A3T A;  5FO7 B;  1I4P A;  5DLQ E;  1LYL A;  4KN7 C;  1S5C D;  5ELB A;  1PYW D;  2VZA A;  5T1I A;  4CKC A;  2JK8 A;  1PYB A;  2A68 D;  4PMC A;  5ELN A;  3HFZ B;  4AYB B;  2EVB A;  5IYB G;  3MEF A;  4GN3 B;  4PZ6 A;  5IYB H;  3NBH B;  3LWU A;  4DKA C;  3KLW A;  2E75 C;  2UXD Q;  2A5H A;  2CCZ A;  4C1N I;  4RWS C;  1RJT A;  3CPF A;  4X3T A;  1GM5 A;  1JJ2 A;  4JCV E;  4DR1 Q;  1I94 Q;  4JI0 L;  1E7Z A;  2F52 A;  1EIG A;  2K03 A;  3CQZ B;  2JA5 B;  4R4O A;  2B2Y A;  3W1G A;  4EQP A;  1H9S B;  2J7Z A;  3L7Z C;  4NMZ A;  2NN6 G;  3RLF A;  2NN6 H;  4BS9 A;  5FO9 B;  1A8V A;  3J7Z C;  3TQY A;  1GHJ A;  4IAL A;  4GKJ L;  4R4T A;  2M2L A;  1VQB A;  1HNX Q;  4PG3 A;  4JI3 L;  3S14 B;  5CV9 A;  4LFB Q;  2IT1 A;  4HID A;  1VQ7 A;  2O5I C;  1Q90 A;  2NVT B;  2X6L A;  4L5T A;  4G57 A;  1PTO F;  4MTN A;  4OO1 I;  3C46 A;  3MXG A;  1EY8 A;  2E2I H;  3TEH B;  1I6V C;  1ML0 D;  2V1C C;  4YCW A;  5ISR A;  2WAQ B;  1F9S A;  4GZY C;  1TY0 A;  4S3S A;  1L1O C;  4JI1 L;  3RD4 A;  1VQ9 A;  3GV6 A;  2EQS A;  4DR3 L;  1BCP F;  1E3P A;  4MNO A;  2I07 B;  3J7A V;  5JJK A;  2F4V Q;  4R8I A;  3KK7 A;  4HR7 B;  1B9M A;  3J80 c;  1HXY D;  3A55 A;  1G51 A;  1JOQ A;  2FMC A;  2K5Q A;  2VQE Q;  2OQK A;  1YIT A;  4RGT A;  3IL8 A;  1XMO Q;  1PH5 A;  3PGZ A;  4R1J A;  3TP7 A;  2NWG A;  4AH6 A;  4LF9 Q;  1Y8P B;  4DA2 A;  1CK1 A;  2Q8R E;  3CCU A;  1FGB D;  1L1O B;  2XGT A;  2VB2 X;  1IL8 A;  3ERO A;  1VQA A;  1L0X B;  3ICE A;  4B3M Q;  1PH3 A;  5E1F A;  4DGZ A;  3KDF B;  5FLX c;  3G48 A;  2V4D A;  1F2Z A;  1V9P A;  4C2M H;  4RKL A;  3T1Y L;  1FL0 A;  1VQM A;  1T5X D;  1WYD A;  4JI6 Q;  3ER0 A;  1JOR A;  4JI2 Q;  3PO3 G;  3PO3 H;  3NWS A;  5M5X H;  3TDQ A;  1G6Z A;  3C1F A;  3D0F A;  3WWV A;  1C0A A;  2PMZ E;  2RA4 A;  2NVX H;  1KDB A;  5KND A;  1STG A;  1B4O A;  2JEA I;  3QG1 A;  4X64 Q;  3HKZ E;  3SK6 A;  2PQE A;  4CJ2 C;  1LTR D;  4RHR A;  4RH6 A;  4JV5 Q;  4DV3 L;  4HJ5 A;  4G7O C;  1SND A;  4DN4 M;  3CW2 C;  2EE1 A;  4YCU A;  1XMQ Q;  2JA7 G;  1SLJ A;  1VMC A;  1WCM B;  3K6O A;  2JA7 H;  4X3U A;  4YCV A;  4ZUJ A;  2JYO A;  2VUM G;  2VUM H;  3CAM A;  1N36 L;  1EEF D;  1KIX A;  2PI2 A;  4X66 Q;  1C7Y A;  2D0O A;  4RGO S;  4X3S A;  3OMC A;  2L1B A;  4G4K A;  4O2D A;  4HIK A;  3RUZ A;  1VQJ A;  1HH2 P;  2Z6K A;  4LFA Q;  3TP6 A;  1SJE D;  1SE8 A;  4A3J B;  2RKS A;  3CME A;  4KKS A;  2DN8 A;  4A3F B;  3RNU A;  3QR8 A;  4LFC Q;  3BYY B;  2P5Z X;  4OWX B;  5GAH C;  1K73 C;  4IZ8 A;  4CBV A;  1N9W A;  2HIV A;  1LT6 D;  1E22 A;  1LT5 D;  2VW9 A;  1SYB A;  1A15 A;  4LUV A;  4O0A A;  2QA4 A;  4HMI A;  1STE A;  1GO3 E;  2PO4 A;  2Y0S B;  1UWV A;  1ZXT A;  2MO0 A;  2UUB L;  3KF8 B;  4HCE A;  5M9O A;  3GTM H;  2FJ2 A;  4KJO A;  1Q81 C;  3J81 j;  4DF7 A;  4A3K B;  4LF7 Q;  4V0B A;  2DJF C;  1JCK B;  3H6M A;  4H13 C;  5EPK A;  1K28 A;  4JI8 L;  3U4Z A;  1IW7 C;  4POG A;  2EJG C;  2WB1 G;  4L5Q A;  4ZUI A;  5C3E G;  3KBX A;  3S17 B;  2K5W A;  4U68 A;  1KTK A;  5C3E H;  3GTG H;  2JE6 I;  1YNJ C;  1WTR A;  1A2U A;  2B8F A;  1K8O A;  1HNW L;  1X32 A;  3PUV A;  5M3M G;  2EY6 A;  5I2X A;  1CI3 M;  5M3M H;  1D8L A;  3HOX B;  4OEL B;  3I3C A;  3OWF A;  1YHB A;  2KED A;  2LSS A;  3VYS A;  4A3C G;  1X55 A;  1KC8 C;  3PMF A;  4A3C H;  1AFP A;  2EJF C;  3A8K E;  4OWT B;  1G91 A;  1MD2 D;  1EYA A;  2G5D A;  1I3Q B;  4JI4 L;  3I7F A;  2CQA A;  3O13 A;  1A63 A;  5KIX A;  3NUC A;  4I7Z C;  4LUZ A;  2OTL A;  2ASB A;  1GUT A;  1SNC A;  4FDB A;  4X62 Q;  3N6R A;  2Z6B A;  2ZM6 Q;  3S16 H;  4CDD C;  5IP9 G;  5E4W C;  4J8Q A;  5IP9 H;  2K33 A;  3C3L A;  1TWA B;  1K83 H;  2D5D A;  1ESR A;  1VQN A;  1L2F A;  4JI5 Q;  3TS0 A;  1JQY D;  4APV A;  1SR3 A;  4XT3 B;  1LTL A;  3LNN A;  2KA7 A;  3SGI A;  4F7X A;  3NQT A;  3BVG A;  1HZ9 A;  1EY9 A;  4XXE A;  1I4X A;  1I4R A;  2F0S A;  4LJZ C;  3G6J B;  2E2H H;  4C3H B;  3HOV B;  1UEB A;  4KHP Q;  4RMF A;  1F2M A;  1Y1V B;  2K6A A;  1D5Z C;  2IPK D;  4DAY A;  2CHB D;  2NVQ B;  4JI7 L;  2ENB A;  4FF4 A;  3BVM A;  4DV5 Q;  2E2J H;  3VA7 A;  5IIF A;  1UNS A;  2F3W A;  4DK3 C;  4UDU C;  3PO2 B;  3H3V C;  1Y14 B;  1VS0 A;  4KY7 A;  3Q6S A;  1PH7 A;  2G9H D;  1MGS A;  3IKJ A;  4DR7 Q;  3MXU A;  1NE3 A;  1STN A;  3DUZ A;  1IBL Q;  1V1Q A;  5JJZ A;  4Y7N B;  1WTQ A;  1IYV A;  3OMG A;  1CZW A;  3HOW G;  1PRT C;  1NAP A;  3HOW H;  4GS3 A;  1K3R A;  3H94 A;  4DXG A;  2EOT A;  3QB3 A;  2AMC B;  2DY8 A;  2EYP A;  3DEO A;  5EPJ A;  1CSQ A;  3FHW A;  2MO1 A;  3ERS X;  3AEV A;  2ZTD A;  4DV1 L;  2AQ3 B;  2N8N A;  3KLS A;  4K5W A;  3UDX A;  3T1H Q;  4BY1 B;  3T51 B;  1VQI A;  4NDX A;  4YWK A;  4C1N K;  4MHE A;  4DAV A;  1GUW A;  3EBE A;  4Q0F A;  1XNR Q;  2PQA A;  5CGK A;  3MXP A;  3K0Y A;  4LK1 C;  3FKI G;  5GRO A;  3MEH A;  1U5K A;  4QY7 A;  1XJV A;  1TT2 A;  3I4M B;  5LMN W;  2AQ1 B;  1Z47 A;  2A6E C;  1YEZ A;  3KJO A;  3GTL B;  4K5V A;  4CDC C;  1VQC A;  5KYL A;  1SYE A;  2QGQ A;  3E5S A;  2R7Z B;  4FXG C;  3AU7 A;  1IBK Q;  2LMC B;  3I91 A;  1TS3 A;  4HJ8 A;  2UUC L;  1P16 A;  1EYD A;  1YI2 A;  3VR6 A;  2N49 A;  4KD4 A;  4A3G G;  4DR6 L;  2CKZ B;  2EYJ A;  4A3G H;  1SMY D;  2KCT A;  1E0B A;  1SNQ A;  1S4Z A;  4HCS A;  1PVO A;  1Y1W B;  3PUW A;  1EOV A;  3K5N A;  4B3R L;  3NEN A;  1O7Z A;  3HP3 A;  4DUY Q;  1EQR A;  3G4S A;  1JJG A;  3NHH A;  3D31 A;  4K6L A;  1EIF A;  1QVF A;  3P7J A;  4F87 A;  2ZT9 C;  4MIU A;  4DV7 Q;  5CR3 A;  5IYD G;  4A93 G;  4LUO A;  4DR2 Q;  2IX1 A;  1XNQ Q;  4A93 H;  5IYD H;  1NY4 A;  3M7N A;  3I73 A;  1XPU A;  2EDG A;  2LS0 1;  1Q7Y C;  4BBR H;  3OTO L;  2UXD L;  2N88 A;  5C44 G;  1HR0 L;  2QIL A;  1FNW A;  1ZYR C;  3ND9 A;  2UXB L;  3MTS A;  4EX5 A;  5C44 H;  2OXP A;  3Q0A A;  2AKW B;  4RCO A;  1PTO D;  2IX3 A;  4DR1 L;  3GTK B;  3N52 A;  4YWL A;  2ZXP A;  3I4N B;  1KAW A;  4M1U B;  2L15 A;  1ZEQ X;  2EYL A;  1PTO H;  2Z0S A;  3MXN B;  1EWC A;  5BN4 A;  2R92 G;  3R2I A;  2JA8 G;  2R92 H;  5AJ3 Q;  2JA8 H;  4C3I B;  1ENF A;  3AFP A;  4JOI C;  4A3M G;  2AWN A;  2JJQ A;  3W1B A;  4DV2 L;  4K8J A;  3S15 B;  4HJ7 A;  4DR4 L;  4KMU C;  3NTI A;  4LFB L;  1BCP D;  4AYB E;  1OXT A;  1Z9F A;  1EU4 A;  3VR5 A;  1BXT A;  2MFI A;  1NR4 A;  2NBF A;  3U9O A;  5I6Y A;  3GTP H;  5BN3 A;  5C4J H;  2OWO A;  2RHQ B;  1G6P A;  4QL5 A;  1QVG A;  1JMC A;  4IPD A;  4KTA A;  4K5X A;  2EY1 A;  3AMU A;  3FRP B;  4DFA A;  1TS5 A;  1YVC A;  5I4D A;  4IJH A;  4A3I B;  3CCS A;  1EY0 A;  4OO1 G;  3MZ5 A;  2JXM B;  4OO1 H;  4BA1 I;  4ZYS A;  5M3F G;  1LLR D;  1YBY A;  2F4V L;  5M3F H;  2I5L X;  5I2Y A;  4KY6 A;  1ET6 A;  1YNN D;  1VQL A;  2OTJ A;  2R93 H;  1VQP A;  1STY A;  2KEE A;  1VQO A;  2PNH A;  4JPB W;  2Z4I A;  2ZJP A;  3EIV A;  3QWN A;  3GTJ H;  3SE0 A;  1Q86 C;  4KN4 C;  2JA6 B;  5JJL A;  1T9H A;  5TSS A;  1J6Q A;  2DGY A;  1A6X A;  3K0X A;  2D62 A;  3DLL A;  2WAQ E;  4B3M L;  4L5S A;  1R9T H;  1B9N A;  2E5L L;  3M4O H;  4MN3 A;  1WTX A;  2B8G A;  4WJW A;  2C35 B;  4JBJ A;  1LTT D;  1DXM A;  3CCV A;  1EY4 A;  2YTX A;  1B1Z A;  1ICF B;  5KGU A;  4QCL A;  4JI6 L;  1RIP A;  1O7I A;  4P73 A;  4ZLT F;  4N8F A;  4L6T B;  3FVQ A;  2PZU A;  4PV1 C;  4P72 A;  1CA5 A;  5CC4 A;  1K0R A;  1EYG A;  2ZTE A;  2AUJ D;  3H0G G;  5KRU A;  1I5F A;  4R4I A;  2LKV A;  2WII B;  4PMW A;  3H0G H;  4HSV A;  3CCM A;  4TRD A;  4U67 3;  5CBA E;  1TWH B;  3S24 A;  2PW7 A;  3GTQ H;  2CVR A;  4BY7 B;  3K59 A;  2NB0 A;  3S2H B;  5C3X A;  1SNP A;  4XQQ A;  2PPB C;  4UP9 A;  4A3E G;  3I55 A;  1IYU A;  4A3E H;  3FEW X;  1UE7 A;  1XPR A;  3CHB D;  5KNC A;  2LFN A;  3S2D H;  4FVM A;  1PH4 A;  2K32 A;  1AEX A;  5CV7 A;  1EQQ A;  1HA6 A;  2OF1 A;  1PRT F;  4BWG B;  1N32 Q;  4PQX A;  4OWW B;  3SK5 A;  2Q8T A;  5E4X A;  3J81 i;  3P20 A;  3M4P A;  4POF A;  3PF5 A;  2ICE C;  2LY7 A;  4C56 C;  1YJN A;  5C4Z A;  1DJR D;  4LFA L;  1KDA A;  3HOU G;  1X3G A;  4NPS A;  4FF3 A;  3WOE A;  2A6H D;  3HOU H;  3SK4 A;  1MSG A;  1NUC A;  1E2Z A;  2K05 A;  4OON A;  3K57 A;  2SDF A;  1EFW A;  4BBS H;  5ELO A;  1TWC H;  2XN9 C;  3ND8 A;  1G29 1;  5D3I B;  4G7H C;  1Q1E A;  2K5N A;  1B2T A;  3KLS X;  2PCF B;  5IGB A;  2SOB A;  2F3V A;  5LHY 1;  4FP5 D;  4JBM A;  1VQF A;  1EQT A;  2ZXO A;  2A74 C;  1KRT A;  1W2B A;  1RTO A;  2B2U C;  4IPG A;  1STH A;  2UUA Q;  1QNU A;  1V1O A;  1EYC A;  3SK8 A;  1VQ5 A;  4K0K Q;  1GUN A;  2UU9 Q;  1CUK A;  4DV6 Q;  4DK6 C;  4TKO B;  2R3Z A;  2BDN A;  2HHH Q;  3W3A A;  1Q46 A;  2B2V C;  5LL6 X;  5J22 A;  5CV6 A;  1HFG A;  2UXC L;  1YIJ A;  3C1E A;  2JA5 G;  1U9R A;  1A62 A;  2JA5 H;  1HZB A;  2Y0S E;  3EVQ A;  1CKO A;  3VR4 A;  2NZ1 D;  2K04 A;  1JE4 A;  3TZU A;  4DAP A;  1J9O A;  3F2D A;  2HT1 A;  4RFB A;  2B2W A;  2Z8L A;  4DV4 Q;  5I9O A;  1WD0 A;  1Z7T A;  2NVT H;  3GP7 A;  2RDH A;  3DMU A;  2QDL A;  2WIN B;  5IGF A;  1N8R C;  4JYA Q;  4X3K A;  1XTD A;  4X62 L;  1TS2 A;  2CWP A;  3K7A H;  3NQI A;  2EXZ A;  2F0N A;  4FNF A;  1PA6 A;  4LF5 Q;  4ULL A;  1STA A;  3OPO A;  2E2I B;  2HDL A;  4TVA B;  1ASY A;  5EKK A;  5DM7 3;  2Q2H A;  4KHV A;  1L0Y B;  3SEB A;  2BA0 A;  4QMG A;  3Q23 A;  3GQB A;  3I8Z A;  4I65 A;  4IUU A;  5JOB A;  4HIO A;  1MKH A;  2O5J C;  1WTH A;  2VB3 X;  1QUQ A;  1U4R A;  4KHP L;  3EJI A;  3VR3 A;  3K8A A;  1UAP A;  2DY7 A;  3A8J E;  1RF2 D;  2F0F A;  1J5E Q;  1PFS A;  1YHA A;  3UE1 A;  3CC2 A;  4TQU S;  2EY2 A;  2L9H A;  4LWC A;  2RCF A;  2KCM A;  1K8A C;  3BZC A;  4DAM A;  2XWB B;  2F0G A;  5HUR A;  1K0S A;  4LF8 L;  2NTT A;  2JN4 A;  5K36 G;  1WJJ A;  5K36 H;  1SRO A;  5COY A;  1F9Q A;  3AYH B;  3VYU A;  1VQE A;  1JJC B;  1XPO A;  2DUD A;  3M9B A;  1PZJ D;  4C2M B;  4XQN A;  1ZKO A;  1AE3 A;  3A7L A;  2X6G A;  1BUV T;  1F9R A;  1Q1B A;  4KHZ A;  1TWF H;  3MFY A;  3PO3 B;  1N34 Q;  5BR8 Q;  4RKB A;  2YU9 H;  4GNX A;  5LMN Q;  1HZA A;  4X65 Q;  1HUN A;  4GOP B;  2WFW A;  1H9R A;  4B3T Q;  1HNZ Q;  1K3B C;  1EOT A;  3TP8 A;  4HAE A;  1XXG A;  1B50 A;  2F0V A;  1C4Q A;  1W3S A;  2SEB D;  3EQL C;  4F88 A;  1V43 A;  4IFD I;  1SXT A;  3KUP A;  1LT4 D;  2F0D A;  5CV5 A;  4CKE A;  1WFQ A;  2DNC A;  3PUY A;  2YYZ A;  2VUM B;  1S5E D;  2RF4 A;  4EVO A;  1RL2 A;  1WTV A;  3BVZ A;  4X6A H;  2KUM A;  1HZC A;  1SDF A;  5JAV A;  2M9V A;  3OIP A;  1GVP A;  2AHO B;  3S1M H;  3V96 A;  5E3F A;  4UHV A;  1UE5 A;  1HQM C;  1CKN B;  5CYU A;  2Q2T A;  2RDF A;  4NB3 A;  5DEH A;  1FJG L;  4A3B G;  1S5B D;  4OX9 Q;  2MP1 A;  2Y0S G;  3PV0 A;  4A3B H;  5FO8 B;  1H9M A;  4QF4 A;  2CQO A;  2C5C A;  2KOL A;  3RZO H;  3AB9 A;  3K5L A;  1WVL A;  1E2V A;  4FF1 A;  2BA1 A;  1Q12 A;  3PCO B;  3TME A;  5IWA Q;  1DOL A;  3GTM B;  3H91 A;  5JVH 3;  3X3N A;  4PZ7 A;  3UDF A;  4QQB X;  1JWS D;  2K50 A;  3E9I A;  4OXP A;  1AE2 A;  4FYD A;  3J81 L;  1GD7 A;  4I7A A;  2WB1 B;  4HIM A;  3GTG B;  5BN5 A;  4CJ1 B;  5C3E B;  1EY7 A;  3TP5 A;  4WJ3 M;  1R4P B;  3CU7 A;  1IW7 D;  1EZ6 A;  5M5W H;  1HRJ A;  2NN6 I;  4UPA A;  4NXN L;  5EKI A;  3J7Y W;  1YNJ D;  2EIF A;  1K8G A;  1X3E A;  4DR2 L;  1A3U A;  1XNQ L;  2A69 C;  4JI0 Q;  1KXL A;  4KKU A;  3NBH A;  3TBI B;  3S1R B;  1KNA A;  1U4L A;  1GOZ A;  2KCN A;  2HD3 A;  5IGE A;  3IRB A;  1QVC A;  1AN8 A;  1VQ4 A;  2A1A A;  1MI2 A;  1CFM A;  1F9P A;  2EYH A;  5EBC A;  3T16 A;  5D3D A;  3A56 A;  4DUZ L;  4LW1 A;  1DCZ A;  5C4H A;  1DOK A;  4JI3 Q;  1HR0 W;  1H9S A;  1I4G A;  3STB C;  3TRZ A;  1Q8K A;  4RA8 A;  4IPH A;  1X56 A;  2B2U A;  3CCE A;  2WKC A;  1QB5 D;  2F0T A;  3VDY A;  1AZQ A;  4AQY Q;  1ASZ A;  1CQV A;  2M00 A;  3S16 B;  3J81 E;  2OEO A;  1VQH A;  1JR0 D;  4HTH A;  2QEX A;  1VQ6 A;  4J1M A;  2B2V A;  1K83 B;  1B53 A;  1LTS D;  4JI1 Q;  5KEE A;  2ZXR A;  1JB7 A;  4NKL A;  3PIP A;  1KDC A;  4DR3 Q;  1TY2 A;  3HKZ G;  2ZJR A;  3HKS A;  2NUC A;  3K5M A;  1O80 A;  1RKN A;  2RDG A;  2VS1 A;  2OQ0 A;  4C3H G;  3RN2 A;  3HOV G;  3I2Z A;  3CCJ A;  4K14 A;  3W2D A;  2B29 A;  1PMR A;  1U4P A;  3MAQ A;  1TWG H;  2GVB A;  3CP0 A;  1SMX A;  2F0W A;  4GLV B;  4GKK L;  2E2H B;  2F0U A;  2IHF A;  3R3O A;  3JAM i;  1NSN S;  4HJ9 A;  1PFB A;  4C3J B;  3U58 A;  1CT1 D;  3G7L A;  4ME3 A;  3PO2 G;  2E2J B;  4IOC A;  3PO2 H;  4DNR B;  4P75 A;  3D4W A;  3Q22 A;  2QEJ C;  1JWU D;  4OGQ C;  4ZAI A;  2A19 A;  1TR5 A;  4B3S Q;  3E0E A;  2IJ0 A;  1L1O A;  3L3O C;  1DD2 A;  1V1P B;  3T1Y Q;  3NK9 A;  4AIM A;  2HCI A;  1PLF A;  3HEJ A;  4P74 A;  4DR5 L;  3KDF A;  1V8Q A;  2D9U A;  4XT1 B;  1H9J A;  4P2C B;  2R7D A;  4K6D A;  1WTO A;  5A35 A;  4A3D G;  4BY1 G;  4EQ5 A;  4RAU C;  3H3V H;  4A3D H;  1LTB D;  1NCV A;  4BY1 H;  1OXX K;  2QKI C;  1F77 A;  4R8N A;  4DV3 Q;  5E7N A;  1PRT D;  3F1Z A;  1HTL D;  1STB A;  3Q24 A;  4IN3 A;  1NBW A;  1A2T A;  3FKI H;  3KF6 B;  1EIH A;  3BU2 A;  4R4Q A;  1Y69 U;  3CPW A;  1HCZ A;  1N36 Q;  2E2D C;  3S1N H;  2X69 A;  1BVS A;  5T1G A;  3NWT A;  1H95 A;  2H5X A;  3ERQ A;  1OO9 B;  2JSO A;  5FJ8 G;  3SVM A;  1Z6H A;  3GTL H;  5FJ8 H;  2HUG A;  1IKL A;  1S5D D;  4ODG A;  4NXM L;  1F2L A;  5C5M A;  5HGQ A;  1NNX A;  3PIP 3;  1XWE A;  4B9X A;  1UEA B;  4OHJ A;  4DNI A;  3G6E A;  5IT9 L;  1LAB A;  1C48 A;  3VA5 A;  1SE4 A;  3ITP A;  4LF6 Q;  1BO0 A;  2A6E D;  3V2T A;  3X3M A;  3LWE A;  2L4N A;  1RD9 D;  1AW7 A;  2CFM A;  2F0Q A;  2UUB Q;  5JVG 3;  2EYM A;  2K7V A;  1VQG A;  1BF4 A;  4JI8 Q;  4A3G B;  3I90 A;  2K5H A;  1ET9 A;  3F2U A;  1IBM Q;  3A0J A;  3KF8 A;  3W5O A;  4CKB A;  1KQS A;  5ELE A;  1FVI A;  1AP0 A;  1GUG A;  1IXR A;  4HJA A;  1HNW Q;  3J81 c;  2B63 G;  2UUA L;  3I4O A;  3D3R A;  2B63 H;  3PUX A;  3VYT A;  2UU9 L;  4V19 0;  4EGV A;  3GTO H;  1PXU A;  4RG1 A;  3UI2 A;  2JQO A;  2O4X A;  1I94 L;  3E3X A;  2K52 A;  1HPC A;  1YNX A;  1FYC A;  3BYT B;  4H02 A;  3F2C A;  1X9N A;  4A93 B;  2FFK B;  2QF7 A;  4JI4 Q;  1NR2 A;  3OSO A;  4BBR B;  3HRZ C;  1H9K A;  4UP8 A;  4XYQ A;  3HOY G;  1F2Y A;  2D2C C;  4YY3 Q;  3HOY H;  5C44 B;  5IT9 E;  2IHE A;  4A3M H;  1WTW A;  4C3I G;  1JOO A;  2K14 A;  4ZK9 B;  3RZD B;  2K01 A;  1L0W A;  4C3I H;  1PH6 A;  1HNX L;  3T53 B;  2XVS A;  1ZYR D;  3G71 A;  3S15 H;  1PTO B;  3QJY A;  3URY A;  1TS4 A;  4CJ0 B;  1CQF A;  3RLO A;  4DV4 L;  2R92 B;  4BA2 I;  2EZV A;  2JA8 B;  1RHP A;  2N3S A;  2MHV A;  1Q82 C;  1SNO A;  1O7Y A;  3I4L A;  3IFT A;  4J6H A;  3M3Y B;  3PUZ A;  4JYA L;  2K4K A;  4IUQ A;  2Q2I A;  4QB4 A;  2R61 A;  1VDZ A;  3M7G A;  2EPB A;  3MFG A;  5EBD A;  1BCP B;  5IOC A;  3HOZ G;  4A3I G;  3BZK A;  3CC4 A;  4DNT B;  1BR9 A;  3HOZ H;  1JIC A;  2WKD A;  3E9H A;  1SFO H;  4L8J A;  2K1B A;  1D2B A;  2NVY H;  1OXU A;  1VQD A;  1EQV A;  2XWJ B;  2VY3 A;  4K2L A;  3SDZ A;  1DM0 B;  4NP5 A;  1CZG A;  4A4I A;  1BNZ A;  1I50 H;  2VQE L;  1XMO L;  3A8I E;  3L0O A;  4CHT B;  4M8A A;  5D65 A;  4JI7 Q;  1QOH A;  3M4Y A;  4LF9 L;  3RN5 A;  5C0X I;  5ELC A;  2J0T D;  5M3F B;  2GA4 B;  4N9T A;  3DHQ A;  4HMJ A;  2R93 B;  2Z4H A;  1J5E L;  5JPM C;  4OEM B;  2PNR C;  1D1I A;  3WOF A;  2F0L A;  1I6H H;  1AH9 A;  2PW5 A;  3CF5 A;  5KYI A;  1D6E C;  3QO2 A;  1WD1 A;  4BBS B;  3PIO A;  2MNA A;  3DM1 A;  3S1Q H;  5FOB B;  1ONL A;  2ICI A;  4HED A;  3A7A B;  1G2T A;  4JI2 L;  3C2P A;  4H0L C;  1NJI C;  1D7Q A;  1R9T B;  1EWH A;  4QIW B;  3M4O B;  3FPP A;  2RVL A;  2XNA C;  4Z9C B;  2MPM A;  1HUM A;  4X64 L;  3JAM L;  5IE8 A;  2VQF Q;  4JV5 L;  3NP8 A;  5BR8 L;  1M1K C;  3L9A X;  1XMQ L;  3AQQ A;  3H0G B;  4GLX A;  5M5Y H;  2EYF A;  1FGU A;  3GTQ B;  1RCV D;  4X66 L;  2BE5 C;  3AFQ A;  4YHH Q;  2ZTC A;  3FMC A;  4A3E B;  2OT2 A;  4XDX A;  2MJ8 A;  5G3L F;  4RCN A;  1MJC A;  3S2D B;  2C9O A;  5C4X G;  5C4X H;  2PZT A;  1A0I A;  5LMU Q;  1E1O A;  3F2B A;  4LMQ D;  3PF4 A;  4R9W A;  4LFC L;  3DXJ C;  3OIQ A;  1HHV A;  4IFD G;  3FPU B;  1DYQ A;  3BDL A;  3TSS A;  2UUC Q;  4ZRZ A;  1WOC A;  5IT9 c;  3HOU B;  4DR6 Q;  2A68 C;  3TN2 A;  3JAM E;  4IFD J;  5CV8 A;  4OX9 L;  4G7Z C;  1LM0 A;  3CRL C;  4IUV A;  3RR5 A;  1J8I A;  4LF7 L;  1TWC B;  2CW0 D;  4RHS A;  4AYB G;  2Q8I B;  3CCR A;  4DV0 Q;  3T56 B;  4ID6 A;  1SE3 A;  4B3R Q;  1K8M A;  5IWA L;  5GAD C;  1SEB D;  4IQZ A;  3DM3 A;  3HZX A;  2KJX A;  4IUN A;  2WAC A;  5IP7 G;  4UAI A;  5IP7 H;  3CRK C;  2PZW A;  3MWY W;  3PIO 3;  1S3O A;  4Q5V A;  1LTI D;  4DK0 A;  1SYG A;  5J39 A;  3K58 A;  1LTG D;  2AWO A;  2F4I A;  5J1Z A;  4IUR A;  1SSO A;  4JC0 A;  3CQZ H;  3OW2 A;  1HFN A;  3OTO Q;  2UXB Q;  1HR0 Q;  5H1S E;  2WP8 J;  2TSS A;  1IYJ B;  3KJP A;  5DAU A;  1P8L A;  5COR A;  2L55 A;  3S14 H;  1CTM A;  1SYD A;  4XIG S;  1CHQ D;  1I4Q A;  1D5X C;  5EJW A;  1SBB B;  3Q8D A;  4N9P A;  1TII D;  4FXD A;  1N33 Q;  4KY5 A;  3D6W A;  3WDN A;  1BBU A;  3H15 A;  4DV2 Q;  2MQH A;  4ZCK A;  3NTH A;  2ZM6 L;  4WFN 3;  4DR4 Q;  2L12 A;  2WAQ G;  2ZJQ A;  3K81 C;  3MXN A;  1E1T A;  1QZG A;  1TQO A;  3MA2 B;  1HQR D;  2WB1 E;  2ES2 A;  2K5V A;  3MC0 B;  2F0E A;  4JI5 L;  5CMD A;  1U4M A;  1G2S A;  2GVA A;  4AQY L;  3K7A B;  3PSI A;  1BOS A;  2A8V A;  1TKW B;  3TRE A;  4OIK A;  3D6C A;  3RMH A;  3K80 C;  3CD6 A;  3FDT A;  1MIU A;  4KJN A;  4DAY B;  3SR1 A;  3UE0 A;  2YV5 A;  3H09 A;  2VXW A;  3F8T A;  1UE6 A;  3NSW A;  4L63 B;  3DEP A;  1PH2 A;  4FF2 A;  3U50 C;  5JJI A;  2H1E A;  2PYK A;  2D0P A;  4JOI A;  4H44 C;  2F0I A;  4DV5 L;  1C8C A;  1HA5 A;  1PH9 A;  4CDF C;  4E6I A;  3K5O A;  3GDE A;  5EGT A;  1PHJ A;  3T4A C;  4WJ4 A;  2K5D A;  3KBG A;  3BS1 A;  1ICW A;  1B3Q A;  1QJO A;  5EPL A;  4GOP C;  2R7F A;  3PQI A;  4A75 A;  1YJ9 A;  3T13 A;  1BKB A;  4OIJ A;  4IJL A;  4RGN A;  4LF4 Q;  2E5L Q;  4DR7 L;  5LL6 S;  2KHS A;  4DXF A;  1IBL L;  4B3S L;  2DJG C;  3OWE B;  4IO9 A;  1Y8O B;  2VNU D;  4OL7 A;  4JVZ A;  3IFD A;  1EWI A;  2SNS A;  5M5X B;  1X3Q A;  3CCL A;  2B2T C;  2NVX B;  1CA6 A;  1NMG A;  2PQA B;  1SYF A;  1WCM G;  3JAM c;  3ZYY X;  1QIL A;  1WCM H;  3T1H L;  3OOC A;  1TWF B;  3S9W A;  1D5M C;  1SJH D;  1SN8 A;  2TMP A;  1XNR L;  2KHJ A;  2JP1 A;  5IY0 A;  2YU9 B;  2JA7 B;  1O78 A;  2WV6 D;  1X3P A;  2LXK A;  1QWY A;  3ULL A;  1MJE A;  1SRU A;  2RSN A;  1GHK A;  4A3J G;  2JA9 A;  1QG7 A;  2RBM A;  4A3J H;  5FK9 C;  1LTA D;  1EUJ A;  4H7B A;  1BQQ T;  1CKM A;  4XQJ A;  4A3F G;  4PMB A;  2BH2 A;  5K5P A;  4QJF A;  4A3F H;  3DWA A;  1VQ8 A;  4QUC A;  5IGD A;  1AZP A;  3VYR A;  5CBE E;  2E74 C;  3NEL A;  2Z1C A;  1C9O A;  1DOM A;  5D14 A;  3EFX D;  1IBK L;  5HY6 A;  3S1M B;  2EYO A;  2BH8 A;  4A3K G;  4YWM A;  1KAA A;  1CM9 A;  4KV6 A;  4A3K H;  4LNQ A;  4IPC A;  4XTC S;  4KK7 A;  3S17 H;  4LF6 L;  1EY6 A;  4A3B B;  1FD7 D;  5JEA G;  3J7A F;  2F0P A;  1II3 A;  5JEA H;  5L37 A;  2F0K A;  1XX8 A;  3RZO B;  1VF7 A;  2FHT A;  1B8A A;  1OTC A;  1Y8N B;  2F0H A;  2SNM A;  2FIN B;  1LO5 D;  3HOX G;  5JEA J;  4DUY L;  1B70 B;  3HOX H;  2KEC A;  2F0J A;  1Q8I A;  2OCE A;  1IBM L;  1OXV A;  3I56 A;  1KAB A;  1QZH A;  1A3V A;  4DV7 L;  2L0C A;  2RQX A;  4O42 A;  1HJP A;  1UUP A;  5M3M B;  3CKI B;  5GQO A;  2LXJ A;  3NXW A;  1I3Q H;  3R93 A;  1FNU A;  2I5H A;  3BJU A;  3E6Z X;  2UXC Q;  2HCC A;  3OW7 A;  1GXD C;  5M5W B;  2AQ2 B;  3S1R H;  2A73 B;  1NTG A;  2K28 A;  1EL0 A;  1Q3L A;  4GKJ Q;  5DNF A;  3NBI A;  4MTK A;  4GLA C;  1WTP A;  1IHZ A;  3M4Q A;  1BDO A;  1B44 D;  3RLN A;  3J80 i;  1I4H A;  1PV4 A;  1ENA A;  3HG9 A;  5AJ3 L;  3UDI A;  2A69 D;  4YY3 L;  4KI0 A;  1RTN A;  5IGC A;  2J4X A;  1PFN A;  4O1N A;  1LV9 A;  3HGB A;  3E0J A;  1MSH A;  1TWA H;  3HS0 C;  2N55 A;  2EY5 A;  4R4C A;  1ESF A;  3KFU A;  1JWM D;  1D1K A;  3K7U C;  3V05 A;  2ALY B;  3NPP A;  1R4Q B;  4L5R C;  2EJM A;  2F03 A;  1FR3 A;  4JG2 A;  4N8X 1;  4CGY B;  3M85 A;  1TU2 B;  1VMP A;  2IW3 A;  4RGM A;  3STB D;  4K8I A;  1PH8 A;  4JK1 C;  4C3H H;  3GD7 A;  3HOV H;  2AUK A;  1Y1V G;  3QOJ A;  2F3I A;  1NMF A;  2F0M A;  1Y1V H;  3CXC A;  5KNB A;  2HDM A;  5GAG C;  1GUS A;  1KLG D;  2NVQ H;  2PMZ B;  3R2T A;  1ILP A;  2RSO A;  1JC7 A;  2KCC A;  3HKZ B;  1BBX C;  3IAY A;  1PFM A;  2XSC A;  2HQL A;  3NEM A;  4C3J G;  4QUF A;  1EZ8 A;  4WOR A;  5J3B A;  5C3W A;  4C3J H;  2XTI A;  3A54 A;  1TWG B;  2RHS B;  3A74 A;  4JBW A;  3ULJ A;  2IWH A;  5FLM G;  1IKM A;  2Q2U A;  1G8Z D;  5FLM H;  1SNM A;  2Z9H A;  1X6O A;  2JEB I;  1S40 A;  1EEI D;  3QIA A;  3CMA A;  5IOD A;  4Y7N H;  2NZH A;  4LF8 Q;  1SAP A;  2IL8 A;  1M90 C;  1QCB D;  4DK1 A;  4ZKB B;  3GO5 A;  5C0X G;  1EIY B;  1KRS A;  5C0X H;  5NUC A;  1XYI A;  2FMM A;  3HOW B;  1MBY A;  1S72 A;  4UP7 A;  4ZQ3 A;  1M4V A;  3TZD A;  5C0X J;  3EN2 A;  4GN5 A;  2F1M A;  1LT3 D;  3D4D A;  4MZ9 A;  4BXX G;  3VR2 A;  1SYC A;  2ID0 A;  4BXX H;  2QCP X;  3KYH C;  2E76 C;  1CHP D;  5G3L D;  3SHL A;  4FO2 A;  4DPG A;  2VQF L;  1OXS C;  4A3D B;  1WI5 A;  4KLK A;  2B3G A;  2E8G A;  2B39 A;  2BCO A;  1MHW C;  3I4M G;  3I4M H;  4F8M A;  1PDQ A;  2KBN A;  5AFW A;  1PRT B;  1DGS A;  3FKI B;  2BOS A;  4GOP A;  3BG3 A;  1B3A A;  5EKL A;  3KOJ A;  2R7Z G;  1N32 L;  3S1N B;  1W6J A;  2R7Z H;  1GKH A;  1M8A A;  4YHH L;  1PZI D;  1LAC A;  4EQO A;  4QIW E;  1X65 A;  1SMY C;  4GN4 B;  4A3L G;  2L5T A;  3OHX C;  4NW2 A;  4XYO A;  4A3L H;  1E2W A;  1B7Y B;  3J7A 5;  3A5Z B;  5LMU L;  3JC6 6;  1HTP A;  2B2T A;  1FJG Q;  2B2Y C;  2DNE A;  1VF5 C;  2IX0 A;  2PI2 E;  2N78 A;  2F0O A;  2CH4 W;  1YJW A;  1Y1W G;  1EU3 A;  1QE6 A;  1TVX A;  1CKN A;  5JPN C;  2CH4 A;  4B9W A;  1Y1W H;  1EFI D;  1YHQ A;  3DWQ A;  5I9P A;  3GV3 A;  3QOL A;  1W6K A;  4UY8 C;  1K9M C;  2B2W C;  2L11 A;  2NTS A;  3FP9 A;  1KL9 A;  4DV0 L;  4HN7 A;  1FNV A;  3I72 A;  1SE2 A;  2KQ3 A;  4K0K L;  1XTC D;  1RDP D;  3I70 A;  1PTO C;  4DV6 L;  4KD3 A;  4J15 A;  1GUO A;  3U9S A;  2G9D A;  2HHH L;  2BDO A;  2R6G A;  1ROD A;  4NXN Q;  3L2P A;  2B63 B;  5CV4 A;  3I4N G;  3GTK H;  4QGU A;  1PZK D;  3I4N H;  3GTO B;  1ILQ A;  4BBR G;  1DZ1 A;  4YIJ A;  1VCI A;  3MVV A;  1CSP A;  2XIW A;  5ELF A;  3OYY A;  5DM6 3;  1KLU D;  2KEN A;  1BCP C;  1LUZ A;  3D8G A;  4DUZ Q;  3RZD H;  1JE5 A;  2CWA A;  4ZKC B;  4K2K A;  1TXY A;  2NZO A;  1S5F D;  3HOY B;  1BBW A;  5IYC G;  4A3M B;  5F2D A;  5C6A A;  1U0L A;  5IYC H;  1N33 L;  1KD1 C;  3ULP A;  1PYS B;  4ME5 A;  1E24 A;  3CC7 A;  3M3Y H;  2VL6 A;  2HIX A;  4LF5 L;  3GTP B;  1T5E A;  4A3I H;  5C4J B;  3LX0 A;  4FXK C;  3TS2 A;  1YNN C;  1PH1 A;  1QUQ B;  2I46 A;  1KHI A;  5ELD A;  1JB3 A;  5GAE C;  2XRS D;  3BDC A;  3J80 L;  1KNE A;  2EXD A;  2QDB A;  3HOZ B;  4PNY A;  1SFO B;  4HSP A;  2NVY B;  3U4V A;  3SXH A;  4GKK Q;  2JA6 G;  5A2Q L;  2JA6 H;  4GNX C;  3NTK A;  1I50 B;  2MUY A;  2O2L D;  4DU9 A;  4JBK A;  5I6W A;  2R93 G;  2K75 A;  3GTJ B;  4ALP A;  4B08 A;  5FLX L;  2XRQ D;  1QNK A;  4BBS G;  2FXQ A;  4P71 A;  3ZJY C;  5EAY A;  3A5U A; 
#chains in the Genus database with same CATH homology
 1ENC A;  3P1H A;  1DON A;  4KKT A;  3EA6 A;  5FKA C;  1I6H B;  4ABN A;  3DWP A;  3S1Q B;  1O7L A;  5IGG A;  1V1P A;  4WRD A;  5HGT A;  3BZD B;  3ONA B;  3J80 E;  2HQE A;  2MGS A;  4ILW A;  5A2Q E;  3P75 A;  4IUP A;  5M5Y B;  2KVM A;  2A6H C;  2NYZ D;  3BDO A;  4EQN A;  5FLX E;  1EY5 A;  3KLR A;  3R8B A;  3D4R A;  4IFD H;  1JOK A;  4TSS A;  5EQ0 A;  4IUT A;  5C4X B;  1GJX A;  2BE5 D;  5C5L A;  2CW0 C;  3NE5 B;  2H4O A;  3MHB A;  4LAA A;  1A3T A;  5FO7 B;  1I4P A;  4KN7 C;  1S5C D;  5ELB A;  1PYW D;  5T1I A;  4CKC A;  2A68 D;  4PMC A;  4AYB B;  2EVB A;  3LWU A;  2E75 C;  2A5H A;  4C1N I;  4RWS C;  1RJT A;  4X3T A;  1EIG A;  2K03 A;  3CQZ B;  2JA5 B;  2B2Y A;  4EQP A;  1H9S B;  2J7Z A;  3L7Z C;  4NMZ A;  2NN6 G;  3RLF A;  2NN6 H;  4BS9 A;  5FO9 B;  1GHJ A;  4IAL A;  2M2L A;  3S14 B;  5CV9 A;  2IT1 A;  2O5I C;  1Q90 A;  2NVT B;  2X6L A;  4G57 A;  1PTO F;  4OO1 I;  3C46 A;  3MXG A;  1EY8 A;  1I6V C;  1ML0 D;  5ISR A;  2WAQ B;  1F9S A;  4GZY C;  1TY0 A;  4S3S A;  3RD4 A;  3GV6 A;  1BCP F;  2I07 B;  3J7A V;  4R8I A;  3KK7 A;  4HR7 B;  1B9M A;  1HXY D;  3A55 A;  1JOQ A;  2FMC A;  2K5Q A;  4RGT A;  3IL8 A;  3TP7 A;  2NWG A;  1Y8P B;  4DA2 A;  1CK1 A;  2Q8R E;  1FGB D;  2VB2 X;  1IL8 A;  3ERO A;  1L0X B;  5E1F A;  4DGZ A;  2V4D A;  1F2Z A;  4RKL A;  1T5X D;  1JOR A;  3NWS A;  3TDQ A;  1G6Z A;  3C1F A;  2RA4 A;  1KDB A;  5KND A;  1STG A;  1B4O A;  2JEA I;  3QG1 A;  3SK6 A;  2PQE A;  4CJ2 C;  1LTR D;  4RHR A;  4RH6 A;  4G7O C;  1SND A;  4DN4 M;  2EE1 A;  1VMC A;  1WCM B;  3K6O A;  4X3U A;  4ZUJ A;  2JYO A;  1EEF D;  4RGO S;  4X3S A;  3OMC A;  2L1B A;  4G4K A;  3RUZ A;  3TP6 A;  1SJE D;  4A3J B;  2RKS A;  4KKS A;  2DN8 A;  4A3F B;  3BYY B;  4IZ8 A;  4CBV A;  1LT6 D;  1LT5 D;  1SYB A;  1A15 A;  4HMI A;  1STE A;  2PO4 A;  2Y0S B;  1ZXT A;  4HCE A;  5M9O A;  2FJ2 A;  4KJO A;  4DF7 A;  4A3K B;  4V0B A;  3H6M A;  1JCK B;  4H13 C;  5EPK A;  1IW7 C;  2EJG C;  4ZUI A;  3S17 B;  3KBX A;  2K5W A;  4U68 A;  1KTK A;  2JE6 I;  1YNJ C;  1WTR A;  1A2U A;  2B8F A;  1K8O A;  1X32 A;  3PUV A;  2EY6 A;  5I2X A;  1CI3 M;  3HOX B;  3I3C A;  3OWF A;  2KED A;  3VYS A;  3PMF A;  1AFP A;  2EJF C;  3A8K E;  1G91 A;  1MD2 D;  1EYA A;  1I3Q B;  2CQA A;  3O13 A;  5KIX A;  3NUC A;  4I7Z C;  1GUT A;  1SNC A;  3N6R A;  5E4W C;  4J8Q A;  2K33 A;  3C3L A;  1TWA B;  2D5D A;  1ESR A;  1JQY D;  4XT3 B;  3LNN A;  2KA7 A;  4F7X A;  3NQT A;  3BVG A;  1EY9 A;  4XXE A;  1I4X A;  1I4R A;  2F0S A;  4LJZ C;  3G6J B;  4C3H B;  3HOV B;  1F2M A;  1Y1V B;  2K6A A;  1D5Z C;  2IPK D;  4DAY A;  2CHB D;  2NVQ B;  2ENB A;  4FF4 A;  3BVM A;  3VA7 A;  5IIF A;  1UNS A;  2F3W A;  3PO2 B;  4UDU C;  3H3V C;  4KY7 A;  3Q6S A;  2G9H D;  1MGS A;  3IKJ A;  3MXU A;  1STN A;  3DUZ A;  1IYV A;  5JJZ A;  4Y7N B;  1WTQ A;  3OMG A;  1CZW A;  1PRT C;  1NAP A;  3H94 A;  4DXG A;  2EOT A;  3QB3 A;  2DY8 A;  2EYP A;  3DEO A;  5EPJ A;  2AQ3 B;  3KLS A;  4K5W A;  4BY1 B;  3T51 B;  4NDX A;  4C1N K;  4MHE A;  4DAV A;  1GUW A;  4Q0F A;  5CGK A;  3MXP A;  3K0Y A;  4LK1 C;  3MEH A;  1TT2 A;  3I4M B;  2AQ1 B;  1Z47 A;  2A6E C;  3GTL B;  4K5V A;  5KYL A;  1SYE A;  2R7Z B;  3E5S A;  4FXG C;  3AU7 A;  2LMC B;  3I91 A;  1TS3 A;  1EYD A;  3VR6 A;  4KD4 A;  2EYJ A;  1SMY D;  1E0B A;  1SNQ A;  1S4Z A;  4HCS A;  1Y1W B;  3PUW A;  3K5N A;  1O7Z A;  3HP3 A;  3NHH A;  3D31 A;  4K6L A;  3P7J A;  4F87 A;  2ZT9 C;  4MIU A;  5CR3 A;  2IX1 A;  3M7N A;  3I73 A;  2EDG A;  2LS0 1;  2N88 A;  2QIL A;  1FNW A;  1ZYR C;  3ND9 A;  3MTS A;  2OXP A;  3Q0A A;  4RCO A;  1PTO D;  2IX3 A;  3GTK B;  3N52 A;  2ZXP A;  3I4N B;  4M1U B;  1ZEQ X;  2EYL A;  1PTO H;  1EWC A;  5BN4 A;  3R2I A;  4C3I B;  1ENF A;  2AWN A;  4K8J A;  3S15 B;  4KMU C;  3NTI A;  1BCP D;  1OXT A;  1EU4 A;  3VR5 A;  1BXT A;  1NR4 A;  2NBF A;  3U9O A;  5I6Y A;  5BN3 A;  4KTA A;  4K5X A;  2EY1 A;  3AMU A;  3FRP B;  4DFA A;  1TS5 A;  5I4D A;  4A3I B;  1EY0 A;  4OO1 G;  3MZ5 A;  2JXM B;  4OO1 H;  4BA1 I;  4ZYS A;  1LLR D;  5I2Y A;  4KY6 A;  1ET6 A;  1YNN D;  1STY A;  2KEE A;  2Z4I A;  3QWN A;  3SE0 A;  4KN4 C;  2JA6 B;  5TSS A;  1A6X A;  2D62 A;  1B9N A;  4MN3 A;  1WTX A;  2B8G A;  4WJW A;  1LTT D;  1DXM A;  1EY4 A;  1B1Z A;  5KGU A;  4QCL A;  4ZLT F;  4L6T B;  3FVQ A;  2PZU A;  4PV1 C;  1CA5 A;  5CC4 A;  2AUJ D;  5KRU A;  2LKV A;  2WII B;  4PMW A;  4HSV A;  4TRD A;  4U67 3;  5CBA E;  1TWH B;  2PW7 A;  4BY7 B;  2CVR A;  3K59 A;  2NB0 A;  3S2H B;  5C3X A;  1SNP A;  4XQQ A;  2PPB C;  1IYU A;  3FEW X;  3CHB D;  5KNC A;  2LFN A;  4FVM A;  2K32 A;  1AEX A;  5CV7 A;  1HA6 A;  2OF1 A;  1PRT F;  4BWG B;  4PQX A;  3SK5 A;  2Q8T A;  5E4X A;  3P20 A;  2ICE C;  2LY7 A;  4C56 C;  5C4Z A;  1DJR D;  1KDA A;  4FF3 A;  3WOE A;  2A6H D;  3SK4 A;  1MSG A;  1NUC A;  1E2Z A;  2K05 A;  3K57 A;  2SDF A;  2XN9 C;  3ND8 A;  1G29 1;  5D3I B;  4G7H C;  1Q1E A;  1B2T A;  3KLS X;  2PCF B;  5IGB A;  2SOB A;  2F3V A;  5LHY 1;  4FP5 D;  1EQT A;  2ZXO A;  2A74 C;  1RTO A;  2B2U C;  1STH A;  1QNU A;  1V1O A;  1EYC A;  3SK8 A;  1GUN A;  4TKO B;  2R3Z A;  2BDN A;  3W3A A;  2B2V C;  5LL6 X;  5J22 A;  5CV6 A;  1HFG A;  3C1E A;  1U9R A;  3EVQ A;  3VR4 A;  2NZ1 D;  2K04 A;  1JE4 A;  3TZU A;  4DAP A;  1J9O A;  4RFB A;  2B2W A;  2Z8L A;  5I9O A;  1WD0 A;  1Z7T A;  3GP7 A;  2RDH A;  3DMU A;  5IGF A;  2WIN B;  4X3K A;  1TS2 A;  3NQI A;  2EXZ A;  2F0N A;  4FNF A;  4ULL A;  1STA A;  3OPO A;  2E2I B;  2HDL A;  5EKK A;  5DM7 3;  4KHV A;  1L0Y B;  3SEB A;  2BA0 A;  4QMG A;  3Q23 A;  3GQB A;  3I8Z A;  4I65 A;  4IUU A;  5JOB A;  2O5J C;  2VB3 X;  1U4R A;  3EJI A;  3VR3 A;  1UAP A;  2DY7 A;  3A8J E;  1RF2 D;  2F0F A;  4TQU S;  2EY2 A;  2L9H A;  2XWB B;  2F0G A;  5HUR A;  2NTT A;  5K36 G;  5K36 H;  5COY A;  1F9Q A;  3VYU A;  1PZJ D;  4C2M B;  4XQN A;  1ZKO A;  3A7L A;  2X6G A;  1BUV T;  1F9R A;  1Q1B A;  4KHZ A;  3MFY A;  3PO3 B;  4RKB A;  1HUN A;  1H9R A;  1EOT A;  3TP8 A;  4HAE A;  1XXG A;  1B50 A;  2F0V A;  1C4Q A;  2SEB D;  3EQL C;  4F88 A;  1V43 A;  4IFD I;  1SXT A;  3KUP A;  1LT4 D;  2F0D A;  5CV5 A;  4CKE A;  2DNC A;  3PUY A;  2YYZ A;  2VUM B;  1S5E D;  4EVO A;  1WTV A;  3BVZ A;  2KUM A;  1SDF A;  5JAV A;  2M9V A;  3OIP A;  3V96 A;  5E3F A;  1HQM C;  5CYU A;  2RDF A;  5DEH A;  1S5B D;  2MP1 A;  3PV0 A;  5FO8 B;  1H9M A;  4QF4 A;  2C5C A;  2KOL A;  3AB9 A;  3K5L A;  1WVL A;  1E2V A;  4FF1 A;  2BA1 A;  1Q12 A;  3TME A;  1DOL A;  3GTM B;  3H91 A;  5JVH 3;  3X3N A;  1JWS D;  4FYD A;  3J81 L;  2WB1 B;  3GTG B;  5BN5 A;  4CJ1 B;  5C3E B;  1EY7 A;  3TP5 A;  1R4P B;  3CU7 A;  1IW7 D;  1EZ6 A;  1HRJ A;  2NN6 I;  3J7Y W;  5EKI A;  1YNJ D;  1A3U A;  2A69 C;  4KKU A;  3NBH A;  3TBI B;  3S1R B;  1KNA A;  1U4L A;  1GOZ A;  2KCN A;  5IGE A;  1AN8 A;  1MI2 A;  1CFM A;  1F9P A;  2EYH A;  5EBC A;  3T16 A;  5D3D A;  3A56 A;  1DCZ A;  5C4H A;  1DOK A;  1H9S A;  1I4G A;  4RA8 A;  2B2U A;  2WKC A;  1QB5 D;  2F0T A;  1AZQ A;  1CQV A;  2M00 A;  3S16 B;  3J81 E;  2OEO A;  1JR0 D;  4HTH A;  4J1M A;  2B2V A;  1K83 B;  1B53 A;  1LTS D;  5KEE A;  2ZXR A;  4NKL A;  1KDC A;  1TY2 A;  2NUC A;  3K5M A;  1O80 A;  1RKN A;  2RDG A;  4C3H G;  4K14 A;  3W2D A;  1PMR A;  1U4P A;  3MAQ A;  2F0W A;  2E2H B;  2F0U A;  3R3O A;  1NSN S;  1PFB A;  4C3J B;  1CT1 D;  3G7L A;  2E2J B;  4DNR B;  3D4W A;  3Q22 A;  2QEJ C;  1JWU D;  4OGQ C;  4ZAI A;  1TR5 A;  2IJ0 A;  3L3O C;  1DD2 A;  1V1P B;  3NK9 A;  2HCI A;  1PLF A;  3HEJ A;  1V8Q A;  2D9U A;  4XT1 B;  1H9J A;  4P2C B;  4K6D A;  1WTO A;  5A35 A;  4RAU C;  1LTB D;  1NCV A;  1OXX K;  2QKI C;  1F77 A;  4R8N A;  1PRT D;  1HTL D;  1STB A;  3Q24 A;  4IN3 A;  1A2T A;  1EIH A;  1Y69 U;  1HCZ A;  2E2D C;  2X69 A;  5T1G A;  3NWT A;  3ERQ A;  1OO9 B;  2JSO A;  3SVM A;  1Z6H A;  2HUG A;  1IKL A;  1S5D D;  4ODG A;  1F2L A;  5C5M A;  3PIP 3;  1XWE A;  4B9X A;  1UEA B;  4OHJ A;  5IT9 L;  1LAB A;  1C48 A;  3VA5 A;  1SE4 A;  3ITP A;  1BO0 A;  2A6E D;  3V2T A;  3X3M A;  3LWE A;  2L4N A;  1RD9 D;  1AW7 A;  2F0Q A;  5JVG 3;  2EYM A;  2K7V A;  1BF4 A;  4A3G B;  3I90 A;  1ET9 A;  3F2U A;  3KF8 A;  4CKB A;  5ELE A;  1AP0 A;  1GUG A;  3D3R A;  3PUX A;  3VYT A;  4V19 0;  4EGV A;  1PXU A;  3UI2 A;  2O4X A;  1HPC A;  1FYC A;  3BYT B;  4A93 B;  2FFK B;  2QF7 A;  1NR2 A;  3OSO A;  4BBR B;  3HRZ C;  1H9K A;  4XYQ A;  1F2Y A;  2D2C C;  5C44 B;  5IT9 E;  1WTW A;  4C3I G;  1JOO A;  4ZK9 B;  3RZD B;  2K01 A;  3T53 B;  2XVS A;  1ZYR D;  1PTO B;  3QJY A;  3URY A;  1TS4 A;  4CJ0 B;  1CQF A;  2R92 B;  4BA2 I;  2EZV A;  2JA8 B;  1RHP A;  2MHV A;  1SNO A;  1O7Y A;  3I4L A;  3IFT A;  4J6H A;  3M3Y B;  3PUZ A;  4IUQ A;  4QB4 A;  2R61 A;  1VDZ A;  3M7G A;  2EPB A;  3MFG A;  5EBD A;  1BCP B;  5IOC A;  4DNT B;  1BR9 A;  1JIC A;  2WKD A;  4L8J A;  2K1B A;  1D2B A;  1OXU A;  1EQV A;  2XWJ B;  4K2L A;  3SDZ A;  1DM0 B;  4NP5 A;  1CZG A;  1BNZ A;  3A8I E;  4CHT B;  4M8A A;  5D65 A;  1QOH A;  3M4Y A;  5C0X I;  5ELC A;  2J0T D;  5M3F B;  2GA4 B;  4N9T A;  3DHQ A;  4HMJ A;  2R93 B;  2Z4H A;  5JPM C;  2PNR C;  1D1I A;  3WOF A;  2F0L A;  2PW5 A;  5KYI A;  1D6E C;  3QO2 A;  1WD1 A;  4BBS B;  3DM1 A;  5FOB B;  1ONL A;  2ICI A;  4HED A;  3A7A B;  1G2T A;  3C2P A;  4H0L C;  1R9T B;  1EWH A;  4QIW B;  3M4O B;  3FPP A;  2RVL A;  2XNA C;  4Z9C B;  2MPM A;  1HUM A;  3JAM L;  3NP8 A;  3L9A X;  3H0G B;  2EYF A;  3GTQ B;  1RCV D;  2BE5 C;  3FMC A;  4A3E B;  2OT2 A;  4XDX A;  2MJ8 A;  5G3L F;  4RCN A;  3S2D B;  2C9O A;  2PZT A;  4LMQ D;  4R9W A;  3DXJ C;  3OIQ A;  1HHV A;  4IFD G;  3FPU B;  1DYQ A;  3BDL A;  3TSS A;  4ZRZ A;  3HOU B;  2A68 C;  3TN2 A;  3JAM E;  4IFD J;  5CV8 A;  4G7Z C;  3CRL C;  4IUV A;  1J8I A;  1TWC B;  2CW0 D;  4RHS A;  2Q8I B;  3T56 B;  4ID6 A;  1SE3 A;  1K8M A;  1SEB D;  4IQZ A;  4IUN A;  3HZX A;  2KJX A;  2WAC A;  4UAI A;  3CRK C;  2PZW A;  3MWY W;  3PIO 3;  4Q5V A;  1LTI D;  4DK0 A;  1SYG A;  5J39 A;  3K58 A;  1LTG D;  2AWO A;  2F4I A;  5J1Z A;  4IUR A;  1SSO A;  1HFN A;  2WP8 J;  2TSS A;  5DAU A;  5COR A;  2L55 A;  1CTM A;  1SYD A;  4XIG S;  1CHQ D;  1I4Q A;  1D5X C;  5EJW A;  1SBB B;  4N9P A;  1TII D;  4FXD A;  4KY5 A;  3D6W A;  3WDN A;  3NTH A;  4WFN 3;  2L12 A;  3MXN A;  1TQO A;  3MA2 B;  1HQR D;  3MC0 B;  2F0E A;  5CMD A;  1U4M A;  1G2S A;  3K7A B;  1BOS A;  1TKW B;  4OIK A;  3D6C A;  3RMH A;  3FDT A;  4KJN A;  3SR1 A;  3H09 A;  2VXW A;  3NSW A;  4L63 B;  3DEP A;  4FF2 A;  2H1E A;  2PYK A;  4H44 C;  2F0I A;  1C8C A;  1HA5 A;  4E6I A;  3K5O A;  5EGT A;  3T4A C;  2K5D A;  3KBG A;  3BS1 A;  1ICW A;  1QJO A;  5EPL A;  3T13 A;  4OIJ A;  4RGN A;  5LL6 S;  2KHS A;  4DXF A;  3OWE B;  1Y8O B;  2VNU D;  4OL7 A;  3IFD A;  2SNS A;  5M5X B;  1X3Q A;  2B2T C;  2NVX B;  1CA6 A;  1SYF A;  3ZYY X;  1QIL A;  3OOC A;  1TWF B;  3S9W A;  1D5M C;  1SJH D;  2TMP A;  2JP1 A;  2YU9 B;  2JA7 B;  1O78 A;  2WV6 D;  1X3P A;  1QWY A;  1GHK A;  2RSN A;  1QG7 A;  2RBM A;  5FK9 C;  1LTA D;  4H7B A;  1BQQ T;  4XQJ A;  4PMB A;  5K5P A;  3DWA A;  4QUC A;  5IGD A;  1AZP A;  3VYR A;  5CBE E;  2E74 C;  2Z1C A;  1DOM A;  5D14 A;  3EFX D;  3S1M B;  2EYO A;  1KAA A;  1CM9 A;  4KV6 A;  4XTC S;  4KK7 A;  1EY6 A;  4A3B B;  1FD7 D;  5JEA G;  3J7A F;  2F0P A;  1II3 A;  5JEA H;  2F0K A;  1XX8 A;  3RZO B;  1VF7 A;  2FHT A;  1Y8N B;  2F0H A;  2SNM A;  2FIN B;  1LO5 D;  5JEA J;  2KEC A;  2F0J A;  1Q8I A;  1OXV A;  1KAB A;  1A3V A;  2L0C A;  2RQX A;  4O42 A;  1UUP A;  5M3M B;  3CKI B;  3NXW A;  3R93 A;  1FNU A;  3E6Z X;  2HCC A;  3OW7 A;  1GXD C;  5M5W B;  2AQ2 B;  2A73 B;  2K28 A;  1EL0 A;  1Q3L A;  5DNF A;  3NBI A;  1WTP A;  1IHZ A;  1BDO A;  1B44 D;  1I4H A;  1ENA A;  3HG9 A;  2A69 D;  4KI0 A;  1RTN A;  5IGC A;  2J4X A;  1PFN A;  4O1N A;  1LV9 A;  3HGB A;  3E0J A;  1MSH A;  3HS0 C;  2N55 A;  2EY5 A;  1ESF A;  1JWM D;  1D1K A;  3V05 A;  3NPP A;  1R4Q B;  2EJM A;  2F03 A;  1FR3 A;  4CGY B;  3M85 A;  1TU2 B;  1VMP A;  2IW3 A;  4RGM A;  4K8I A;  4JK1 C;  3GD7 A;  2AUK A;  3QOJ A;  2F0M A;  5KNB A;  2HDM A;  1GUS A;  1KLG D;  2PMZ B;  3R2T A;  1ILP A;  2RSO A;  1JC7 A;  2KCC A;  3HKZ B;  1BBX C;  3IAY A;  1PFM A;  2XSC A;  4C3J G;  4QUF A;  1EZ8 A;  4WOR A;  5C3W A;  3A54 A;  1TWG B;  4JBW A;  2IWH A;  1IKM A;  1G8Z D;  1SNM A;  2JEB I;  1EEI D;  3QIA A;  5IOD A;  1SAP A;  2IL8 A;  1QCB D;  4DK1 A;  4ZKB B;  3GO5 A;  5C0X G;  5C0X H;  5NUC A;  1XYI A;  2FMM A;  3HOW B;  1MBY A;  4ZQ3 A;  1M4V A;  3TZD A;  5C0X J;  2F1M A;  1LT3 D;  3D4D A;  3VR2 A;  1SYC A;  2ID0 A;  2QCP X;  2E76 C;  1CHP D;  5G3L D;  3SHL A;  4FO2 A;  1OXS C;  4A3D B;  2B39 A;  2BCO A;  4F8M A;  1PDQ A;  5AFW A;  1PRT B;  3FKI B;  2BOS A;  3BG3 A;  1B3A A;  5EKL A;  3S1N B;  1W6J A;  1M8A A;  1PZI D;  1LAC A;  4EQO A;  1SMY C;  2L5T A;  3OHX C;  4NW2 A;  4XYO A;  1E2W A;  1HTP A;  2B2T A;  2B2Y C;  2DNE A;  1VF5 C;  2IX0 A;  2F0O A;  1EU3 A;  1QE6 A;  1TVX A;  5JPN C;  4B9W A;  1EFI D;  3DWQ A;  5I9P A;  3GV3 A;  3QOL A;  1W6K A;  2B2W C;  2L11 A;  2NTS A;  4HN7 A;  1FNV A;  3I72 A;  1SE2 A;  2KQ3 A;  1XTC D;  1RDP D;  3I70 A;  1PTO C;  4KD3 A;  1GUO A;  3U9S A;  2G9D A;  2BDO A;  2R6G A;  1ROD A;  2B63 B;  5CV4 A;  1PZK D;  3GTO B;  1ILQ A;  1DZ1 A;  4YIJ A;  1VCI A;  3MVV A;  2XIW A;  5ELF A;  5DM6 3;  1KLU D;  1BCP C;  3D8G A;  4ZKC B;  4K2K A;  3HOY B;  1S5F D;  4A3M B;  5F2D A;  5C6A A;  4ME5 A;  3GTP B;  1T5E A;  5C4J B;  3LX0 A;  4FXK C;  1YNN C;  2I46 A;  5ELD A;  1JB3 A;  2XRS D;  3BDC A;  3J80 L;  1KNE A;  2QDB A;  3HOZ B;  4PNY A;  1SFO B;  4HSP A;  2NVY B;  3SXH A;  5A2Q L;  3NTK A;  1I50 B;  2MUY A;  2O2L D;  4DU9 A;  5I6W A;  3GTJ B;  4B08 A;  5FLX L;  2XRQ D;  1QNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...