4DV5Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv5Q00
1IBMQ 4A3DH 3BJUA 3HOWG 4BA2I 3UDFA 3RN5A 1I50H 1X3GA 1IZ6A 1YNXA 2B29A 2Q2UA 1VQ6A 1FL0A 1Y1VG 1AE3A 4BY7H 2F4VQ 3F2DA 3NENA 1XPOA 2UXDQ 2YTYA 3U50C 4A3FH 4L5SA 1HNXL 4EQ5A 2D62A 4DPGA 5IYCH 4OX9L 2AKWB 4POGA 4JCVE 3TEHB 4DUZL 1K3RA 3MEFA 2NVYH 1Y1VH 2PI2A 4BY7G 1EQRA 3I7FA 1X3FA 3OTOL 2UUBL 4AIMA 1XMOL 3K7AH 4DK3C 1JJ2A 2E5LQ 2KCTA 1HH2P 1UE6A 1HZCA 4JBJA 1PA6A 4X62Q 2WP8J 3BU2A 4B3RL 3GTJH 4LF4Q 4LUZA 2HHHL 3HOYG 3DM3A 5C3EH 1HNWL 4DR4Q 2QA4A 1QVGA 2R93H 1WFQA 3M4OH 3HOZG 4EX5A 1N34Q 1VQDA 1VQPA 4GN5A 1TWFH 4DR5L 4A3BG 3J81c 2N3SA 4GNXA 2GVBA 4A3GG 1R9TH 2LXJA 3PUWA 3GD7A 4LF9L 3KF6B 2ZM6L 5IY0A 1D7QA 2EQSA 4QQBX 2NVTH 3H15A 4NB3A 1Q86C 2JEAI 4DV3L 4B3TQ 2NZOA 4IJHA 3HKZG 4R4OA 1PH4A 2AHOB 3W1GA 1EWIA 1P8LA 2I0QA 1VQGA 1VQFA 3G48A 4GOPA 4YY3L 3K80C 4JI3L 2JA6G 3GTGH 1YBYA 2R7ZH 1AH9A 2I5MX 5FJ8H 4A3IH 1IBKL 3PV0A 1V1QA 2NN6G 1ASYA 1D8LA 5M5WH 3BZKA 1RL2A 5GAEC 3CC4A 5FLMG 4DR6L 1QZHA 3K81C 4DV4L 2JA7H 1Q46A 3VDYA 1K8AC 4LFBL 3I56A 1JJCB 2DUDA 1VQCA 3CCRA 1HNWQ 1TWCH 1K0RA 2HIVA 1YJNA 1K73C 2PI2E 1O7IA 1A63A 2I5HA 4R4CA 2ZTDA 1X6OA 1WOCA 3AEVA 1GD7A 1P16A 4ALPA 4GLAC 4P72A 1VQNA 3HKSA 4LFAL 4UPAA 1U0LA 3AFPA 2BA1A 4IO9A 4JI5Q 2ZTCA 1NMGA 5IP7H 3D31A 4MNOA 1I94Q 2KBNA 4OWXB 1Q8KA 2Q2HA 3EN2A 3ER0A 3LGJA 4GN4B 1SLJA 4O2DA 4P73A 2JA6H 4K0KQ 1L1OC 2K52A 1PVOA 3CC2A 4YWKA 4WJ3M 1WYDA 2EIFA 2K5VA 1XMOQ 5IYBH 1KD1C 3RLFA 1J5EQ 2OQ0A 3H0GH 2C35B 1VS0A 5IP7G 2UUAQ 1EOVA 3L2PA 1KQSA 2MNAA 4P71A 3L0OA 2ZM6Q 4OX9Q 4A3GH 2CFMA 3J80c 4UP7A 3S24A 1HZBA 1L2FA 3ERSX 1YHAA 2UXCL 2D0OA 4DR2L 1VQ4A 5JEAG 1JB7A 4LF6Q 1UE5A 3GTOH 4X66L 1BKBA 3UDIA 2WB1E 3M3YH 2R93G 3GTQH 2IY5B 2WAQG 4JI2Q 1Z9FA 1GVPA 3GTMH 4OO1G 4YHHQ 3H0GG 3A74A 2K5HA 4GLVB 4DV2L 1I3QH 5GAHC 4A3MH 2RHSB 4IPDA 2BH2A 3A5ZB 3RZOH 4JI4L 3WWVA 3S1MH 2OQKA 2V1CC 4OXPA 4AQYL 2UUAL 4LFAQ 5JJIA 5FLMH 2UU9Q 3PO3G 1WI5A 3M7NA 3S1RH 4LF7Q 4LF8L 1OTCA 3KJOA 1CKOA 1YVCA 5JJLA 2KHIA 4A3IG 3HOXG 5FLXc 4IOCA 4JYAL 1SE8A 3GTPH 2RF4A 2MFIA 2JA5G 2JE6I 1Y1WG 4IFDG 1EFWA 1MJCA 2ID0A 1CKMA 4Y7NH 1UWVA 1L0WA 4B3RQ 5C4XG 4A4IA 1VQ8A 4A3MG 1PYSB 1V43A 3HFZB 2H5XA 3CCEA 1K8GA 2JJQA 2OTLA 3I4MH 3PO2G 4APVA 4QL5A 2VZAA 4IFDI 1BBUA 4NXML 1PV4A 1MKHA 2Q2IA 3PIOA 4DV6L 2VNUD 2XGTA 3D0FA 1CSQA 4DK6C 1HNZL 1HNXQ 3M9BA 4PG3A 4DV1Q 3HOYH 3I4NG 2R7ZG 3ZJYC 1J6QA 2YU9H 4BY1H 2A19A 2CQOA 3FP9A 3G4SA 3OTOQ 3UDGA 1JJGA 1VQ7A 2E2JH 2E2HH 1G291 3CAMA 5DLQE 4YWLA 3KYHC 3JAMi 4TVAB 4AYBG 1OXUA 1XNRQ 4QGUA 2VQEL 1Q82C 1Q12A 2E8GA 1KRTA 1XPUA 1XMQL 4DR7Q 1I6HH 4QIWE 3RN2A 1E3PA 2FXQA 1FGUA 3GO5A 3NEMA 4A3FG 1HR0Q 2UUBQ 2R92H 1SMXA 1VCIA 2UXCQ 4JI8L 2OWOA 1FJGQ 2HT1A 1WCMH 3FHWA 3HOZH 3S1NH 2D0PA 4MTNA 4PZ7A 2IX1A 1KAWA 2VL6A 2Z0SA 3L7ZC 4J15A 5IT9c 3CMEA 1WJJA 2VQFQ 4DV0Q 1C7YA 2NZHA 4L5QA 4X66Q 4OWTB 2BH8A 3J7A5 2VY3A 3F2BA 5GADC 4DUYL 1J5EL 4JI7Q 3TQYA 3AYHB 4JI6Q 2CWPA 1GO3E 1VQIA 3HOUH 1YZ6A 2KCMA 3UE0A 1SROA 1KC8C 4RG1A 2VUMG 2BA0A 2IHFA 3KDFA 3CCSA 2JA7G 3PUXA 2N78A 4LFCL 4UY8C 1KL9A 4IOAA 4BA1I 1N33L 2PNHA 1X54A 4QJFA 5LMUL 4UP8A 4LW1A 2UU9L 1IYJB 1YHBA 5LMNW 1E24A 4QY7A 1LTLA 1XTDA 3HKZE 3RZDH 1EIFA 4LF5Q 5HY6A 5GAGC 4A3LH 2I5LX 4KLKA 1XPRA 4TQUS 1E1OA 2ES2A 4PZ6A 4LF8Q 2OTJA 1TWAH 1X65A 1KRSA 1YJWA 1OXSC 3KDFB 1N33Q 2JA8G 1E22A 1PH6A 1G6PA 5IP9H 2K5NA 4JC0A 4A3BH 1YITA 1ASZA 2F4VL 3A0JA 1VQKA 2B3GA 4X65L 1VQHA 5M3MG 5IYDG 5IE8A 4A3EH 1B70B 1PH8A 2ASBA 3TREA 3S2DH 3EIVA 1HJPA 2AWNA 3T1YL 4GKKQ 4GKJQ 3K7UC 3NBHB 4DNIA 4JOIA 4JI1L 3CCQA 4WJ4A 4DAYB 4OO1I 1X9NA 4YWMA 1HR0L 3G71A 2N49A 4DR1L 4HJ9A 1WCMG 4KHPL 1X56A 2HQLA 3E9IA 5ELNA 3STBD 5LMUQ 4A3LG 1NY4A 4X65Q 2YTXA 1Z47A 3G6EA 4BXXG 1PFSA 4DV1L 4HJ5A 2YV5A 3KOJA 4BXXH 2K50A 2RHQB 3I4OA 4X6AH 2Y0SG 4LUVA 4FDBA 1XJVA 4JV5L 4YCVA 1N36L 4DV5L 2CCZA 4JYAQ 2R7FA 4BBSH 1FVIA 1CSPA 5LMNQ 3EBEA 3RNUA 1JMCA 2AWOA 2MO0A 3HOVH 1SRUA 1XNRL 2F52A 5BR8Q 1OXTA 3S1QH 1T9HA 4GN3B 4JI8Q 4C3JH 4LF6L 5C0XI 1I5FA 3PSIA 3H3VH 2IHEA 4YHHL 1QZGA 2UUCL 4IPHA 4LFCQ 3F1ZA 3PO2H 4C3HH 3JC66 2E5LL 3TS0A 1LYLA 5M5YH 1NBWA 4GLXA 4DR2Q 1G51A 1W3SA 1L1OA 4IPGA 4JBWA 3ULJA 5C4XH 4DUYQ 1PH9A 2GVAA 4JI7L 2HHHQ 4RMFA 2IT1A 4LUOA 3AQQA 3SGIA 4JBMA 3CXCA 2Z6KA 1PHJA 4HJ8A 2CWAA 1JE5A 5C0XJ 2A8VA 3T1YQ 3S16H 4GKKL 3CW2C 2ALYB 3NELA 3STBC 3J7ZC 4HIMA 2B63H 3I4NH 1IL2A 4DV5Q 3W1BA 4HIDA 1E1TA 4JOIC 1Q7YC 3J81j 1CKNA 1HZ9A 2ZJPA 3TS2A 1LM0A 3M85A 4DV6Q 3CCJA 3K0XA 1LUZA 1VQ9A 4JI0Q 4IPCA 4JG2A 4R4IA 3GDEA 4B3ML 3OW2A 1PH7A 1QVFA 3CD6A 4A3KG 1MIUA 3E9HA 3CCMA 3CF5A 3KLWA 4DR5Q 4B3SQ 5C44G 4PZ8A 1YI2A 1Y1WH 2N8NA 1FJGL 3H3VI 1IXRA 1YEZA 1S3OA 1PYBA 1Y14B 2R92G 4DV7L 2IX0A 4L5TA 3T1HL 4A3JG 2JEBI 1S72A 1DGSA 4R4TA 1W2BA 2NVQH 4P74A 3S15H 4GKJL 3U4ZA 4XIGS 3RR5A 1SFOH 2K4KA 3AFQA 1N9WA 2DGYA 2MQHA 3I2ZA 1KHIA 1VQ5A 1Q1EA 1K9MC 1H95A 4JI2L 4DR3L 4PMWA 2XTIA 3ULPA 4BY1G 1N34L 1KXLA 4HJ7A 2OCEA 2PMZE 3GTLH 2NN6I 4A93H 3GTKH 3PCOB 1IBLL 2R7DA 1VQMA 1CUKA 5J3BA 5AJ3L 3ULLA 2WAQE 1Q1BA 1M1KC 4LF5L 1BBWA 5E7NA 1TWGH 3FKIG 2VQFL 3CCVA 1BVSA 4DV0L 4C2MH 4C3IH 1KIXA 1XMQQ 2Q2TA 2ZTEA 3I4MG 3PF4A 4DR7L 5JJKA 2GN5A 2A1AA 2MO1A 4ME3A 4IFDJ 1XNQQ 3PUYA 3E0EA 2JK8A 2LSSA 3PUZA 1C9OA 2WFWA 4MZ9A 4BBRG 3F2CA 4LWCA 1MJEA 1HR0W 2EXDA 4H02A 5GQOA 2JA5H 4BBSG 5IWAQ 3M4PA 1A8VA 5AJ3Q 2HIXA 1EUJA 4DUZQ 3CCLA 1C0AA 3KF8B 5H1SE 2JA9A 3W5OA 3HOXH 2NVXH 3PGZA 5IYCG 2UXDL 2F3IA 3UDXA 2VS1A 3DLLA 4NXNL 3PO3H 2KHJA 3Q8DA 1E7ZA 2YTVA 4X64L 4BBRH 4LF9Q 1GKHA 4A3DG 3CPWA 4LNQA 3OYYA 1TWHH 4GS3A 3RLOA 3IRBA 2AMCB 5LMNL 1UE7A 1M90C 3CPFA 3F8TA 1VQAA 4HIOA 1EIYB 3B6YA 1QUQB 2LXKA 1IBKQ 3FKIH 1EYGA 3BZCA 4KHZA 4JI6L 1QUQA 1GM5A 4LF4L 2QGQA 2R6GA 3CP0A 5M3MH 5GROA 2QEXA 2VQEQ 4A3EG 1S40A 4YY3Q 4LFBQ 3PF5A 3K8AA 1CKNB 5HGQA 4YCUA 3JAMc 5C3EG 4DV4Q 2E2IH 5FJ8G 5IP9G 2B63G 4A93G 4YCWA 1JT8A 2K14A 2Z6KC 3U58A 1NMFA 4DV3Q 4B3TL 2K75A 5IYBG 3HOVG 4DKAC 4AQYQ 1VQLA 2RCNA 4GNXB 3TRZA 5K36G 1OXVA 2Y0SE 4DR4L 5C0XG 1VQEA 4K0KL 4JI1Q 1K83H 1TXYA 4IJLA 4X62L 1EQQA 4NXMQ 1RIPA 3CMAA 2JQOA 1HZAA 2ATWA 4A3JH 2PQAB 5M3FH 1QVCA 4JV5Q 2L15A 3T1HQ 4NXNQ 1NTGA 5BR8L 4OWWB 4OONA 4A75A 1PH5A 5C44H 3RLNA 3MXNB 4A3CG 1N32Q 1PH3A 2YYZA 5M5XH 3HOWH 4A3KH 3CCUA 2VUMH 5EAYA 1N8RC 2ZJQA 4L5RC 1YJ9A 4POFA 1A0IA 1NJIC 1VQOA 4A76A 1YIJA 3PIPA 4B3SL 3S2HH 2KENA 2UXBQ 1X55A 3KJPA 2UUCQ 1XNQL 1SN8A 3I55A 1IBLQ 1HNZQ 4A3CH 4Y52H 1B7YB 4HJAA 3J81i 4DR1Q 4KHPQ 1UE1A 1VQBA 4X64Q 1YHQA 4UP9A 5JEAJ 5IWAL 1OXXK 5M3FG 2CKZB 4JI4Q 1Q81C 4JI3Q 4KI0A 3U4VA 4DV7Q 1NE3A 4GNXC 3KFUA 5IYDH 1V9PA 4DV2Q 3KF6A 3S14H 3M4QA 3J80i 4AH6A 4O0AA 3CC7A 4HIKA 1I94L 5ELOA 1SR3A 1A62A 2WB1G 4DAMA 2UXBL 3PUVA 1N36Q 1VQJA 4B3MQ 2ZJRA 3UE1A 2VW9A 1IBML 3CQZH 1L1OB 3A5UA 4GOPB 4DR6Q 4R4QA 1N32L 3S17H 3ICEA 1U5KA 4GOPC 1PH1A 1X3EA 4LF7L 4NPSA 4JBKA 1UEBA 4JI0L 4XTCS 4JI5L 3HOUG 1B8AA 4DR3Q 2JA8H 4P75A 4AYBE 1PH2A 2PQAA 4R1JA 1AE2A 5C4JH
chains in the Genus database with same CATH superfamily
1IBMQ 4WFN3 4BA2I 1UUPA 3UDFA 3RN5A 1SMYC 3S2HB 4IFDH 1FL0A 1J9OA 1Y1VG 5LHY1 2K33A 2BCOA 3K0YA 3U50C 4L5SA 1WVLA 5IYCH 1BR9A 3TEHB 2EPBA 3MEFA 3OWFA 1T5XD 4BY7G 2PI2A 1TWCB 3I7FA 4G7OC 2HCCA 2VUMB 1F2ZA 1HZCA 1PA6A 4B3RL 2QILA 3GTJH 5DAUA 3DM3A 4RAUC 2R93H 4EX5A 1VQDA 1VQPA 1HQMC 4DR5L 4DFAA 1H9SB 2N3SA 2GVBA 5IGGA 4LF9L 1K3BC 3GD7A 3MVVA 4ZRZA 2A6ED 2NVTH 1EZ6A 1LT5D 5CBAE 1L0XB 1PTOF 1Q86C 3M4OB 1EY7A 2NZOA 1F77A 4IJHA 3HKZG 4R4OA 4RGOS 1KTKA 1A3UA 3K80C 2JA6G 2R7ZH 1C4QA 3A8KE 2NN6G 1FD7D 1SSOA 4IUVA 1Q46A 5CV4A 3VDYA 2I46A 3H6MA 4LFBL 2QCPX 2Z8LA 3I56A 3C46A 2JA5B 1HA5A 2PI2E 1K73C 1O7IA 3I4MB 1EU4A 4IUNA 1X6OA 4DNRB 1B4OA 1GD7A 3GTJB 3HOXB 1P16A 1VQNA 4P72A 2EYFA 1EY5A 4LFAL 1SNMA 1U0LA 3AFPA 5FK9C 4H0LC 2KEEA 2ZTCA 4MNOA 4CDCC 3O13A 2Q2HA 2JA6H 3LGJA 3U9OA 4O2DA 5AFWA 2K52A 3Q0AA 3NTIA 3DHQA 4C3IB 5J39A 2C35B 2XRSD 2KECA 1H9JA 2MNAA 4P71A 3L0OA 3BVGA 3ERSX 1L2FA 2UXCL 2D0OA 2PCFB 1SEBD 1G6ZA 1B53A 2IY5B 1EIGA 1CFMA 4XQNA 4GLVB 4DV2L 1I3QH 1J8IA 1AW7A 2B39A 4OXPA 2K6AA 4LFAQ 1KDBA 4LF7Q 1OTCA 2PZTA 2KHIA 4FYDA 3E5SA 2EY2A 4IOCA 2WAQB 2EE1A 2EZVA 4IFDG 2ID0A 1CKMA 1D5ZC 1UWVA 3SK6A 3QJYA 2A74C 1ILPA 1SYBA 2AQ2B 3HFZB 3CCEA 2OTLA 3PO2G 4H44C 2HQEA 2Q2IA 3PIOA 2VNUD 3OIPA 1CSQA 4DK6C 1HNZL 2V4DA 2VB3X 4PG3A 1F9SA 1BNZA 3ZJYC 3FVQA 4KY7A 4BY1H 2A19A 2L55A 1FR3A 1I6VC 3VA7A 1G291 4G4KA 1UAPA 5DLQE 1TWFB 5A35A 1F9QA 1Q82C 3T53B 3K5MA 2PZWA 1ET6A 1DYQA 3RN2A 2JN4A 3GO5A 1JWUD 4A3FG 2R92H 1VCIA 4JI8L 1FJGQ 2HT1A 1GJXA 1I4XA 3AMUA 1ZYRD 3PMFA 1KAWA 5IT9c 1WJJA 3KBXA 4JI7Q 1A15A 1TY0A 2E2DC 4UAIA 2CWPA 1AZQA 3NP8A 1LT4D 3UE0A 1RD9D 5FOBB 2BA0A 2IHFA 4C3HB 3PUXA 2N78A 4K8IA 4LFCL 4BA1I 1N33L 2MPMA 2XNAC 2UU9L 4HR7B 2FHTA 1YHBA 5LMNW 3AB9A 1E24A 1XWEA 2RQXA 1LTLA 2IWHA 3RZDH 1CI3M 4LF5Q 1GUGA 4A3BB 1SXTA 3H91A 4UHVA 4LF8Q 1O7YA 1TWAH 1YJWA 1RTNA 1A3TA 3OW7A 1N33Q 3WOFA 1PFBA 2PZUA 1QJOA 3K5NA 5IP9H 1QNKA 1YITA 5ELDA 4TSSA 1VQHA 5M3MG 2KOLA 1DXMA 3S2DH 1HJPA 4GKKQ 5JPNC 4GKJQ 2F0MA 3ITPA 3N6RA 2WB1B 1EQTA 1NR2A 4B9XA 4CDDC 4HSPA 4L8JA 1WD0A 1IL8A 5T1IA 3G71A 2HQLA 1MI2A 3STBD 1NY4A 5CR3A 1PFSA 2E2HB 4DV1L 5BN4A 2PPBC 5C4XB 3PQIA 4FDBA 1XJVA 4MN3A 4JV5L 4DV5L 2WACA 1FVIA 4K5XA 1CSPA 3IKJA 2MO0A 3HOVH 1F9PA 2HDMA 2WKCA 5BR8Q 5J22A 1T9HA 4GN3B 3D6WA 4K14A 2KVMA 5C0XI 4U68A 4CKEA 3PO3B 3HP3A 5JEAH 1HRJA 1IYVA 4BY1B 4WORA 3F1ZA 1M8AA 3TS0A 2B2YA 4ZCKA 1G51A 1L1OA 1PH9A 4M8AA 1UNSA 4CHTB 2F0HA 3A55A 4JBMA 3KUPA 1PHJA 1JE5A 3S16H 3J7ZC 2B63B 4DV5Q 2EY5A 3W1BA 1NAPA 1CA6A 1DOMA 1G8ZD 1HZ9A 4UDUC 1LTGD 3M3YB 2J4XA 1LM0A 3M85A 4DV6Q 3SE0A 3K0XA 2PNRC 1LUZA 2AUKA 1VQ9A 4IPCA 4JG2A 4B3ML 3OW2A 1YNNC 1QVFA 1B9MA 2K5QA 3CD6A 1MIUA 3CCMA 2F0UA 5C44G 1YI2A 2N8NA 1FJGL 1Y14B 5I4DA 4FNFA 4NW2A 2L9HA 1S72A 1W2BA 3MFYA 4P74A 3U4ZA 1S4ZA 5I9OA 1Q1EA 1K9MC 5K36H 3ERQA 4PMWA 4DR3L 2XTIA 4DAPA 1VF7A 4OIJA 4HCEA 4EQNA 1F2MA 3GTKB 4KY6A 4OL7A 2EYPA 2QF7A 1V8QA 5AJ3L 2KEDA 1M1KC 5J1ZA 4LF5L 1BVSA 4C2MH 4CDFC 3PF4A 3I4NB 2Q8TA 4QMGA 4DR7L 1CK1A 4C1NI 2B8GA 1TWGB 1MSHA 1QOHA 1XNQQ 2K01A 4MZ9A 3F2CA 3GTQB 4H02A 4LJZC 3M4PA 1A8VA 3GTGB 1YNJC 2HIXA 5AJ3Q 2Q8IB 1EUJA 4DUZQ 1B3AA 4R8IA 1GUSA 1FNWA 2X69A 3PGZA 1D6EC 2G9HD 5IYCG 1CA5A 1JCKB 1LABA 1SJED 3DLLA 4NXNL 5JVG3 3SK5A 2K03A 3LX0A 1PYWD 3OYYA 2WIIB 1TWHH 2VB2X 4XYOA 5C4HA 3CPFA 2SEBD 3F8TA 2H4OA 3B6YA 1QUQB 5I6WA 1EYGA 4JI6L 4LF4L 1QUQA 2QGQA 2R6GA 5GROA 4LFBQ 2DY8A 1CKNB 4DV4Q 1JT8A 1RDPD 5KNCA 3HOYB 4YCWA 2RSOA 2K14A 4DV3Q 4B3TL 3P7JA 3J7AV 2R92B 3NSWA 1OXVA 1KLUD 4R8NA 2K28A 4IJLA 2R61A 4NXMQ 1RIPA 1VMPA 1HCZA 1ESRA 2JQOA 5ELFA 1ICFB 2PQAB 2MHVA 4JV5Q 2L15A 4NXNQ 4OWWB 1STHA 1KLGD 4CKCA 3MXNB 4A3CG 1N32Q 3MXNA 4A3KH 3I72A 2VUMH 1UEAB 4POFA 2BOSA 1YIJA 2N55A 3KJPA 3LWUA 1SN8A 3C3LA 4DA2A 1B7YB 2IW3A 4DR1Q 4KHPQ 1YHQA 1EYAA 3QB3A 2CKZB 4DV7Q 1FNVA 1S5BD 2KJXA 1FGBD 2QDLA 3C1EA 3M4QA 4AH6A 4HIKA 4RCNA 3CC7A 1I94L 5JAVA 5CGKA 3PUVA 1N36Q 1II3A 1SMYD 1VQJA 1ENFA 2N88A 2M9VA 3MEHA 2ZJRA 4B3MQ 1BCPD 4DR6Q 4B9WA 4IQZA 3S17H 1N32L 4DNTB 1X3EA 3DM1A 1EY4A 1LTRD 4JBKA 1UEBA 4JI5L 5E1FA 5E4XA 3P1HA 4DR3Q 3V2TA 4K5VA 5DNFA 1D1IA 1O7ZA 5IGEA 2B29A 1VQ6A 1S5ED 1AE3A 3VR5A 1XPOA 2YTYA 4DK1A 4DPGA 4U673 4OX9L 4POGA 1K3RA 3CQZB 2Q8RE 1B3QA 2NVYH 1EQRA 5M5WB 1TQOA 1JOOA 3OTOL 1EFID 4AIMA 1XMOL 1C8CA 3K7AH 3AU7A 3DEPA 4DK3C 5A2QE 2E5LQ 2KCTA 2PW5A 1HH2P 3BYYB 4X62Q 1RJTA 4WRDA 1HTPA 5C3EH 1QVGA 1WFQA 4IURA 2ICEC 4KHVA 3E0JA 5KYLA 1EEFD 2IPKD 1B50A 1TWFH 1O80A 4GNXA 1K83B 3PUWA 5IY0A 3MHBA 2EQSA 4KKTA 5ELBA 4NB3A 2JEAI 5FO8B 1I6HB 3FRPB 1YNND 3W1GA 1VQGA 1EL0A 1YBYA 2I5MX 1ML0D 5FJ8H 4A3IH 1ASYA 3H94A 3BZKA 1RKNA 1RL2A 1JC7A 3K81C 4DV4L 3R2IA 4NMZA 1JJCB 3OWEB 1TWCH 2XWJB 4OO1H 3EQLC 3DMUA 5JPMC 1A63A 1BCPB 2I5HA 2F0DA 3FEWX 4ALPA 4V0BA 2NVXB 2M2LA 4UPAA 4XXEA 5IP7H 4ZQ3A 5IT9E 3EN2A 3RZOB 3ER0A 4GN4B 3W3AA 3H0GB 1AN8A 5IYBH 3MC0B 1CQVA 3RLFA 3QG1A 2OQ0A 3MXPA 3D8GA 2UUAQ 3L2PA 1I4QA 4A3GH 4Q0FA 1HZBA 3S24A 2VXWA 1PRTC 1B2TA 3R2TA 4DR2L 3CKIB 4HCSA 5JEAG 3GTOH 2NBFA 2Z4HA 4X66L 2WB1E 1ENAA 2XN9C 3GTQH 2WAQG 1Z9FA 3MAQA 3GTMH 3A74A 2K5HA 4A3MH 5GAHC 3RZOH 1X3QA 2F3VA 3WWVA 3S1MH 2UUAL 2V1CC 4AQYL 3TBIB 4I7ZC 5JJIA 5CV6A 5FLMH 1WI5A 1WTVA 3M7NA 4LF8L 1YVCA 2A69C 1SYDA 4KKSA 4JYAL 1SE8A 4F8MA 1CQFA 2JE6I 1X32A 5G3LD 1EFWA 1IW7C 2AUJD 2ZT9C 2Y0SB 1L0WA 4B3RQ 1HQRD 1Q90A 2C5CA 1V43A 3QOLA 1PTOB 4C3IG 4QL5A 4IFDI 2A6HD 4DV6L 2B2UA 1SJHD 3HOYH 3RMHA 2E2IB 2R7ZG 1J6QA 2YU9H 3MZ5A 3FP9A 3H09A 3OTOQ 3G4SA 3NQIA 2E2HH 2DJGC 3TZDA 4AYBG 4ZK9B 4QGUA 2JA8B 3EROA 1TS3A 1E3PA 1SMXA 1ZXTA 4LK1C 5KIXA 2D0PA 4PZ7A 2DY7A 2Z0SA 3L7ZC 3CMEA 1C7YA 2B2UC 2VQFQ 2NZHA 1LTAD 2BH8A 3FPUB 4DUYL 3J7A5 1K0SA 4KD4A 1K8MA 1KC8C 2KCMA 3GTPB 1SROA 3E6ZX 2B2TC 1NCVA 3KDFA 2D2CC 3BZDB 4IOAA 4UY8C 5LMUL 4LW1A 1IYJB 1JICA 5L37A 1XTDA 3HKZE 5HY6A 3P20A 4A3LH 5C0XH 1E1OA 4PZ6A 4A93B 4J6HA 4FF1A 1JOKA 3IFTA 1JWMD 1EOTA 5ISRA 2Z1CA 1E22A 3SR1A 1PH6A 1SNPA 2NUCA 4JC0A 1D2BA 2BDOA 3A0JA 4RGNA 1DJRD 4X65L 2X6LA 5IYDG 4A3EH 2RDGA 3TREA 2KUMA 3EIVA 3MA2B 2FMMA 5FLXE 2EVBA 4WJ4A 4DAYB 4DAVA 4OO1I 5CV8A 1GHJA 4HJ9A 1WCMG 2K04A 1X56A 1TVXA 3E9IA 2HD3A 1EY0A 4ZYSA 5LMUQ 4A3LG 4X65Q 1Z47A 1HXYD 2BE5C 1CTMA 1E2WA 2CH4A 3KOJA 2K50A 2Y0SG 4FXKC 3HOUB 2F0IA 2JP1A 1U4LA 1TWAB 5LMNQ 3EBEA 2AWOA 2L12A 1WCMB 2EYOA 3I91A 3J81E 4C3JH 5LL6S 2EJMA 3NXWA 1BDOA 1SDFA 4WJWA 2QW7A 3NUCA 3PO2B 3JC66 1LYLA 3DWQA 1NBWA 4IPGA 3ULJA 4JI7L 5C4XH 2HHHQ 2DNEA 2IT1A 2F0LA 1PZJD 3AQQA 1KNAA 4CKBA 3CXCA 2Z6KA 1LV9A 2CWAA 3T1YQ 5I2XA 3NELA 5E4WC 3MTSA 4Y7NB 4MIUA 1TWHB 1E1TA 5LL6X 1MD2D 3J81j 4ODGA 2RSNA 1JWSD 4JI0Q 2K7VA 3GDEA 1PH7A 2B2VC 2B2WA 1KDAA 5JVH3 3CF5A 3MXUA 4DR5Q 4B3SQ 4PZ8A 1R4QB 1XTCD 2R92G 3NQTA 2IX0A 2NN6H 3HS0C 4A3JG 5M9OA 4GKJL 5CV7A 4RFBA 1V1PB 1LT6D 5IOCA 3BDCA 1H95A 2CH4W 2M00A 1SBBB 1SE4A 3CRLC 4BY1G 3NTKA 4HJ7A 2PMZE 3GTLH 3VYTA 4IUTA 2PMZB 1QCBD 1IBLL 1VQMA 2EXZA 1CUKA 4N8FA 1Q1BA 3CCVA 3FKIG 2VQFL 1QILA 1XMQQ 3OMCA 3I4MG 3GV3A 2A1AA 1VMCA 3D4WA 3PUYA 3E0EA 4Z9CB 3PIP3 2D5DA 1EEID 1C9OA 3X3MA 3HGBA 4BBRG 4LWCA 1HR0W 1STYA 1DOLA 5GQOA 4BBSG 2JA5H 5IWAQ 2EYMA 1STEA 1IYUA 3C1FA 3KF8B 4J1MA 3W5OA 3HOXH 4FF3A 3T51B 2UXDL 2ZXOA 2F4IA 3UDXA 4CDEC 1KABA 2KHJA 1WTWA 3G6JB 4A3IB 4RCOA 1GKHA 4KY5A 3OHXC 3RLOA 4CBVA 1WTRA 1VQAA 2BDNA 1GXDC 2LXKA 3IAYA 2QEXA 1K8OA 3D6CA 2WINB 3K8AA 5JOBA 3VA5A 3K5OA 5FJ8G 2HUGA 1EYCA 3JAML 2E2IH 3U58A 2K75A 4K6DA 4YIJA 4GNXB 3TRZA 4DR4L 1GUTA 1VQEA 3LNNA 4JI1Q 4EVOA 4ZKBB 1JE4A 1DM0B 2ATWA 4XYQA 4A3JH 4C3HG 2B2TA 5IIFA 1NTGA 3A54A 3RLNA 3I4LA 3GV6A 5M5XH 3HOWH 2FJ2A 3NWSA 2A6HC 4IUPA 1N8RC 1NJIC 3PIPA 4TRDA 2KENA 2XVSA 2UXBQ 1X55A 3I55A 5D3DA 3VR2A 1HNZQ 4H13C 4HJAA 1UE1A 1VQBA 4UP9A 1T5EA 5M3FG 4KI0A 3U4VA 3TN2A 4ID6A 4GNXC 2O4XA 1ZKOA 3KF6A 3S14B 4Q5VA 4ZKCB 3NPPA 5COYA 4DK0A 3A8JE 3D3RA 2UXBL 1U4MA 2AQ1B 1BO0A 1X3PA 5D3IB 3UE1A 1L1OB 5IGCA 4GOPB 1ILQA 1KAAA 1BXTA 3CHBD 2L11A 3ICEA 2Z9HA 2RDFA 2F0KA 4JI0L 4XTCS 4C3JG 2NWGA 5CBEE 4K6LA 4AYBE 3NK9A 1PH2A 4FP5D 4CJ2C 1WTQA 1KNEA 3BDOA 4A3DH 3HOWG 1EIHA 2NVQB 1YNXA 1K28A 3TSSA 4BY7H 2F4VQ 3L3OC 4B08A 3NENA 4A3FH 2D62A 4JCVE 4DUZL 4OEMB 2JA7B 1IKMA 1Y1VH 1JB3A 4P2CB 1ICWA 1B1ZA 5TSSA 1GUWA 1UE6A 4JBJA 3KLSA 3OSOA 1LO5D 4LF4Q 3HOYG 2QA4A 4RWSC 1LTSD 3M4OH 1N34Q 2NVTB 4A3BG 3J81c 4A3FB 5E3FA 1D7QA 1CT1D 5EBCA 4QQBX 4AYBB 3FKIB 4DV3L 4B3TQ 1PZID 3OMGA 1PH4A 2I0QA 1P8LA 1VQFA 2EOTA 3G48A 4GOPA 4XT1B 3RUZA 1PMRA 2JSOA 5C4ZA 3PV0A 1V1QA 5KGUA 5M5WH 1NSNS 1JOQA 1Q8IA 3NBHA 1ET9A 4KD3A 4S3SA 5FLMG 5GAEC 3CC4A 2JA7H 1K8AC 1VQCA 3CCRA 1K0RA 2NTTA 2NTSA 1EWCA 4ILWA 2ZTDA 3AEVA 1WOCA 1OO9B 5T1GA 2JA6B 2QKIC 1NNXA 2O5JC 3HKZB 4JI5Q 1NMGA 1Y69U 3D31A 1I94Q 4OWXB 3CU7A 2TMPA 4X3SA 2SDFA 1SLJA 4P73A 3DUZA 1L1OC 1PVOA 4O1NA 1NR4A 4LMQD 3CC2A 4YWKA 1YNJD 3BDLA 4JVZA 2NB0A 1G2SA 2EIFA 2K5VA 1KD1C 2K05A 1J5EQ 3H0GH 4H7BA 1VS0A 5IP7G 1Z6HA 2ICIA 1SYFA 2EJFC 3GQBA 2ZM6Q 4OX9Q 2CFMA 3ND8A 2DJFC 1RCVD 1YHAA 3DXJC 3TZUA 1I3QB 4PMBA 1VQ4A 1JB7A 1EY6A 1BKBA 3UDIA 5IGFA 4JI2Q 5F2DA 4OO1G 1GVPA 3VYUA 5FO7B 1IHZA 3EJIA 2A5HA 2BH2A 2RHSB 3A5ZB 4JI4L 1BF4A 1R4PB 2UU9Q 3PO3G 4HMJA 3BVMA 1DZ1A 4K5WA 1AZPA 1CKOA 1HA6A 5JJLA 4A3IG 4E6IA 2ENBA 1SAPA 1PFNA 5FLXc 3KLRA 2L5TA 3GTPH 1S5FD 2RF4A 2MFIA 4HEDA 1STBA 4FVMA 2RBMA 4Y7NH 3E3XA 4NKLA 5C4XG 4KN4C 1WTHA 4RA8A 2EYLA 4A3MG 1PYSB 2FMCA 4FO2A 2H5XA 4BBRB 3KLSX 4APVA 3IL8A 4OHJA 2BE5D 4NXML 1MKHA 4IUQA 3D0FA 3HG9A 1WTOA 2R3ZA 1AFPA 3BG3A 3SVMA 1E0BA 3D4DA 2CQOA 3SEBA 2E2JH 4F88A 3CAMA 3W2DA 5CV5A 4TVAB 1XNRQ 2VQEL 1D5MC 1Q12A 2E8GA 2O2LD 5D65A 3S9WA 4DR7Q 2CW0C 4G7HC 2FXQA 3A7AB 5EJWA 3SK4A 5A2QL 2OWOA 3S17B 1WCMH 1WTPA 2F0TA 3FHWA 4N8X1 3HOZH 2L1BA 4C1NK 1CZGA 4MTNA 2IX1A 1E2ZA 4DV0Q 1B9NA 4L5QA 4OWTB 2SNMA 1QG7A 3AYHB 3TP6A 3TQYA 4JI6Q 1GO3E 1VQIA 3HOUH 1PFMA 3CCSA 5ELEA 2JA7G 2H1EA 1CM9A 1KL9A 5DEHA 2LS01 2NYZD 1SYEA 2G5DA 4JK1C 2WKDA 4LAAA 2SNSA 2E75C 2JXMB 4DN4M 2NVYB 5GAGC 3KK7A 2OTJA 2ZXPA 1X65A 1OXSC 1SYGA 5BN5A 2JA8G 5CC4A 2K5NA 4A3BH 1ASZA 1VQKA 2B3GA 1PH8A 2AWNA 2RVLA 3T1YL 5BN3A 3NBHB 3DWPA 4DNIA 4FF4A 1DD2A 1X9NA 1PTOD 1HR0L 1XYIA 3I8ZA 2HCIA 4DR1L 4KHPL 3J80E 5IT9L 1FYCA 5IODA 2LMCB 3UI2A 4BXXH 2RHQB 2CVRA 3NTHA 1N36L 2CCZA 4JYAQ 4BBSH 3S15B 3BS1A 3TP7A 3RNUA 1GOZA 1SRUA 1VDZA 2F52A 1OXTA 1A3VA 3Q23A 4IZ8A 5EGTA 4XQJA 4J8QA 1QZGA 2UUCL 2AQ3B 4G7ZC 4DAYA 4LFCQ 4OIKA 3GP7A 3A7LA 4DUYQ 4KK7A 1HHVA 4QB4A 4C56C 3I3CA 3SGIA 1JQYD 1F2YA 5CYUA 2F0JA 4HJ8A 5C0XJ 1TIID 2ALYB 2F0QA 5D14A 4N9TA 4HIMA 2B63H 2KCCA 5KNBA 4HIDA 4JOIC 1Q7YC 3VYSA 1CKNA 4XDXA 3TMEA 1D1KA 3WDNA 4A3KG 4QUCA 3S1MB 4DXGA 3KLWA 1MHWC 2O5IC 1YEZA 1S3OA 3ZYYX 4L5TA 3T1HL 1W6JA 2NVQH 1DGSA 1EYDA 3S15H 4BBSB 4XIGS 3EA6A 1CHPD 3JAME 3RR5A 1PLFA 4KTAA 1H9MA 1N9WA 4RKLA 1KHIA 1MSGA 3BVZA 2FFKB 2NN6I 1SNQA 2A73B 3S1NB 1STGA 4HAEA 3GTKH 3N52A 3GTLB 3ULLA 2WAQE 1BBWA 5E7NA 4DV0L 2Q2TA 2XRQD 1U9RA 2GN5A 2MO1A 2B2WC 2B2VA 4ME3A 2A68D 2JK8A 2LSSA 2XIWA 2EYHA 3NE5B 5M5YB 4ULLA 1VF5C 1C0AA 3FMCA 1SNCA 5H1SE 2NVXH 5C44B 1SNOA 1QB5D 4I65A 3PO3H 5I6YA 1E7ZA 2YTVA 5FO9B 2E74C 4BBRH 4DGZA 4A3DG 2EY1A 3LWEA 3IRBA 5LMNL 1M90C 1H9RA 1DOKA 2F0PA 2J7ZA 2IL8A 3I90A 4HIOA 5EKIA 1IBKQ 3F2UA 3FKIH 4KMUC 4NP5A 4KJOA 3CP0A 4A3EG 5IYDH 1S40A 2XWBB 3SDZA 4YY3Q 2YU9B 3PF5A 5HGQA 4YCUA 4ZAIA 4MHEA 3JAMc 5C3EG 2B63G 2PYKA 2Z6KC 3HOZB 3HOVG 2SOBA 1D5XC 4DKAC 1XX8A 4AQYQ 3IFDA 4K8JA 1BCPF 2MP1A 5C0XG 4K0KL 1K83H 1TXYA 1EQQA 2C9OA 1QVCA 5M3FH 1F9RA 4XQQA 1SYCA 2X6GA 4ZLTF 2QDBA 3V96A 1PH5A 1Y1VB 5C5LA 5C44H 1JR0D 2LY7A 2EDGA 1PH3A 3HZXA 3J81L 3CCUA 2L4NA 1HUNA 4L5RC 1YJ9A 4CJ0B 4A76A 4B3SL 3QWNA 1PDQA 1DCZA 1IBLQ 4QF4A 2UUCQ 1XNQL 2FINB 2F03A 4X64Q 3BYTB 4XT3B 2F0EA 1OXXK 4JI4Q 1WD1A 3X3NA 1NE3A 1PZKD 3KFUA 5C4JB 1HNWQ 4O0AA 3DEOA 5ELOA 1SR3A 4DAMA 2WB1G 2EY6A 3H3VC 1TS5A 4BWGB 1A6XA 1ESFA 1BQQT 4R4QA 1SFOB 1U5KA 4A3MB 3TDQA 3T56B 1BOSA 2JA8H 1GHKA 1Y1WB 2KCNA 1BCPC 3RZDB 2CHBD 2PQAA 1TR5A 2F0FA 4R1JA 1AE2A 4WJ3M 3BJUA 1I50H 1X3GA 1IZ6A 2Q2UA 3T13A 2CW0D 3F2DA 2UXDQ 2K1BA 1R9TB 5KNDA 4EQ5A 1HNXL 2AKWB 2Z4IA 1TS4A 2F3WA 3T4AC 3TP5A 3URYA 1X3FA 2UUBL 4RHRA 1JJ2A 4GZYC 4PMCA 3WOEA 2WP8J 3BU2A 4LUZA 2HHHL 5C3EB 4DR4Q 5HGTA 2IJ0A 3HOZG 3K6OA 4GN5A 1STNA 4A3GG 1EY8A 2LXJA 1R9TH 3KF6B 2ZM6L 1PTOC 3RD4A 4PV1C 1HTLD 4EGVA 3HRZC 1TKWB 1IW7D 3H15A 1G91A 4IN3A 1I4PA 2RDHA 5EPKA 2R7ZB 4IALA 2AHOB 1EWIA 1IKLA 3GTGH 4YY3L 4JI3L 1FNUA 5HURA 4QUFA 5I2YA 1AH9A 3A8IE 1IBKL 1D8LA 5C3XA 3MWYW 4DR6L 1QZHA 2E76C 4FXGC 2DUDA 2HDLA 1U4PA 2HIVA 5IGBA 4RHSA 2OT2A 2DNCA 1ENCA 1YJNA 3SHLA 4R4CA 1WTXA 4GLAC 3C2PA 3HKSA 2BA1A 1L0YB 4IO9A 1ZEQX 4FF2A 4NDXA 1V1PA 4KKUA 2LKVA 3OOCA 5EPJA 3Q24A 2KBNA 1Q8KA 4K0KQ 2GA4B 2NZ1D 3QOJA 2KA7A 1WYDA 2CQAA 1XMOQ 3S1RB 4KV6A 3J7AF 2MJ8A 1EOVA 1KQSA 3J80c 4UP7A 3V05A 2MUYA 1BBXC 4LF6Q 1UE5A 2R93G 3M3YH 1PRTF 5FKAC 4A3KB 4YHHQ 3H0GG 1HNWL 1S5DD 4IPDA 2OQKA 3L9AX 4K2KA 4MTKA 5C3WA 3S1RH 3KJOA 3HOXG 3HOWB 5EKKA 2JA5G 1Y1WG 1AP0A 1MJCA 1QNUA 5M5XB 3NWTA 2KHSA 1MBYA 4A4IA 5ELCA 1VQ8A 2OEOA 5G3LF 1K8GA 2JJQA 3I4MH 3Q22A 2A69D 1CHQD 2VZAA 1BBUA 1PV4A 2XGTA 2F0VA 1SE3A 1HNXQ 4G57A 1O78A 1B44D 3M9BA 3Q6SA 4DV1Q 3I4NG 1F2LA 3UDGA 1SNDA 1PXUA 1JJGA 1VQ7A 1NUCA 5M3FB 3R3OA 1RF2D 2EYJA 4YWLA 3KYHC 3NHHA 3JAMi 2B2YC 3QIAA 1OXUA 1KRTA 2PQEA 1XPUA 1XMQL 1I6HH 4QIWE 3NEMA 1HR0Q 1FGUA 3R93A 2UUBQ 3ND9A 2OF1A 2RA4A 1H9SA 3S1NH 4F7XA 3K7AB 1EY9A 4J15A 2VL6A 4RGMA 4X66Q 2VY3A 3F2BA 5GADC 1J5EL 4OGQC 1C48A 3DWAA 5FLXL 2UXCQ 1YZ6A 1EQVA 2VUMG 3T16A 4RG1A 3K57A 2Z6BA 2G9DA 4JW0A 4BY7B 2PNHA 1X54A 1MGSA 4QJFA 4UP8A 2I07B 1JORA 2K5WA 4QY7A 1EIFA 3I73A 4A3GB 3HOVB 2I5LX 4KLKA 1XPRA 4TQUS 2ES2A 4HN7A 3SK8A 1KRSA 5NUCA 3KDFB 3FDTA 4A3EB 4PNYA 3KF8A 1DONA 5K5PA 1G6PA 4HTHA 4DXFA 1EWHA 4L63B 1BUVT 4QIWB 1AEXA 2F4VL 5IE8A 1B70B 2ASBA 5EPLA 4DU9A 3K7UC 5DM63 1STAA 3EVQA 1HUMA 4JOIA 4JI1L 3CCQA 4YWMA 4CJ1B 1GUNA 5DM73 2N49A 3M7GA 5ELNA 1Y8PB 3OPOA 2DN8A 2F0OA 3VYRA 2YTXA 4KN7C 3G6EA 4BXXG 1Y8NB 4M1UB 3TP8A 4HJ5A 1KDCA 2YV5A 4X3UA 3I4OA 4X6AH 4LUVA 4YCVA 2R7FA 5C6AA 4HMIA 4X3TA 1PRTB 2JYOA 1TY2A 1JMCA 1XNRL 1G2TA 2RCFA 3S1QH 4RH6A 4JI8Q 1I4RA 3PIO3 4F87A 4LF6L 1I5FA 3PSIA 2IHEA 4YHHL 1TT2A 4IPHA 3PO2H 4C3HH 1I4GA 2E5LL 5M3MB 5M5YH 1CZWA 2EJGC 5JJZA 3K58A 1W3SA 4DR2Q 4GLXA 2R93B 4JBWA 2J0TD 2GVAA 1XXGA 4RMFA 3U9SA 5IGDA 4A3JB 1LLRD 4LUOA 1LT3D 1Z7TA 1M4VA 2KQ3A 2A8VA 4X3KA 4V190 4GKKL 1W6KA 3CW2C 2F0GA 2F0SA 3STBC 4C2MB 3I4NH 3P75A 4OELB 1IL2A 1EZ8A 1U4RA 3OIQA 3VR6A 3MXGA 3GTMB 4PQXA 2ZJPA 3TS2A 2A68C 4CGYB 3HEJA 3CCJA 4N9PA 4R4IA 3MFGA 4ZUJA 2RKSA 4EQOA 4A3DB 2L0CA 3E9HA 5KEEA 1Q3LA 3H3VI 3ONAB 1Y1WH 1IXRA 1PYBA 3K5LA 4DV7L 2IX3A 2JEBI 1I50B 4R4TA 3CRKC 3K59A 1PTOH 4ME5A 4I7AA 1SFOH 2K4KA 3AFQA 2DGYA 2MQHA 3I2ZA 1VQ5A 4JI2L 4ABNA 4O42A 4IUUA 3ULPA 1N34L 1KXLA 2OCEA 3G7LA 3SXHA 3D4RA 4A93H 1Y8OB 3PCOB 5CORA 2R7DA 5J3BA 1TWGH 1KIXA 4C3IH 2ZTEA 1PRTD 5JJKA 1LACA 4JPBW 1ZYRC 4IFDJ 4KJNA 3PUZA 4DF7A 2A6EC 3M4YA 3EFXD 2WFWA 1MJEA 2E2JB 1E2VA 2EXDA 4RGTA 3S2DB 2LFNA 3CCLA 1LTBD 4EQPA 2JA9A 1H9KA 5KYIA 2F3IA 1LTTD 1QWYA 2VS1A 2XSCA 1HFGA 1LTID 5KRUA 3Q8DA 1V1OA 4X64L 3S16B 1GUOA 3S1QB 4LF9Q 2F1MA 3CPWA 4LNQA 4GS3A 2AMCB 3A56A 1UE7A 1EIYB 2MGSA 3H3VH 3BZCA 1TS2A 2P5ZX 4KHZA 1GM5A 1HFNA 2VQEQ 5M3MH 2D9UA 1A2UA 4A93G 5IP9G 1HPCA 1NMFA 5IYBG 3J80L 1RODA 1VQLA 2RCNA 3J7YW 5K36G 2Y0SE 1S5CD 3I70A 4BS9A 1O7LA 4R9WA 2F0WA 3VR4A 4X62L 1EU3A 5EKLA 3CMAA 1HZAA 3NBIA 3GTOB 4TKOB 1TU2B 2WV6D 3T1HQ 5BR8L 4OONA 4A75A 2QEJC 3FPPA 3R8BA 2OXPA 1RHPA 3KBGA 2K5DA 2TSSA 2YYZA 4K2LA 5EAYA 2ZJQA 1A0IA 1VQOA 4ZUIA 3S2HH 2K32A 4L6TB 1A2TA 1QE6A 4C3JB 2PO4A 4A3CH 4Y52H 4QCLA 5CMDA 3J81i 5IWAL 5JEAJ 1Q81C 4JI3Q 5EBDA 1V9PA 4DV2Q 3S14H 3J80i 2PW7A 4RKBA 1ONLA 1A62A 1SE2A 1RTOA 5I9PA 5C5MA 5CV9A 2ZXRA 4FXDA 3QO2A 2B8FA 2VW9A 1IBML 3CQZH 3A5UA 2F0NA 5EQ0A 3VR3A 4GOPC 1PH1A 3QR8A 4LF7L 4NPSA 3HOUG 1B8AA 1I4HA 4P75A 4HSVA 5C4JH
chains in the Genus database with same CATH topology
1IBMQ 4A3DH 3BJUA 3HOWG 4BA2I 3UDFA 3RN5A 1I50H 1X3GA 1IZ6A 1YNXA 2B29A 2Q2UA 1VQ6A 1FL0A 1Y1VG 1AE3A 4BY7H 2F4VQ 3F2DA 3NENA 1XPOA 2UXDQ 2YTYA 3U50C 4A3FH 4L5SA 1HNXL 4EQ5A 2D62A 4DPGA 5IYCH 4OX9L 2AKWB 4POGA 4JCVE 3TEHB 4DUZL 1K3RA 3MEFA 2NVYH 1Y1VH 2PI2A 4BY7G 1EQRA 3I7FA 1X3FA 3OTOL 2UUBL 4AIMA 1XMOL 3K7AH 4DK3C 1JJ2A 2E5LQ 2KCTA 1HH2P 1UE6A 1HZCA 4JBJA 1PA6A 4X62Q 2WP8J 3BU2A 4B3RL 3GTJH 4LF4Q 4LUZA 2HHHL 3HOYG 3DM3A 5C3EH 1HNWL 4DR4Q 2QA4A 1QVGA 2R93H 1WFQA 3M4OH 3HOZG 4EX5A 1N34Q 1VQDA 1VQPA 4GN5A 1TWFH 4DR5L 4A3BG 3J81c 2N3SA 4GNXA 2GVBA 4A3GG 1R9TH 2LXJA 3PUWA 3GD7A 4LF9L 3KF6B 2ZM6L 5IY0A 1D7QA 2EQSA 4QQBX 2NVTH 3H15A 4NB3A 1Q86C 2JEAI 4DV3L 4B3TQ 2NZOA 4IJHA 3HKZG 4R4OA 1PH4A 2AHOB 3W1GA 1EWIA 1P8LA 2I0QA 1VQGA 1VQFA 3G48A 4GOPA 4YY3L 3K80C 4JI3L 2JA6G 3GTGH 1YBYA 2R7ZH 1AH9A 2I5MX 5FJ8H 4A3IH 1IBKL 3PV0A 1V1QA 2NN6G 1ASYA 1D8LA 5M5WH 3BZKA 1RL2A 5GAEC 3CC4A 5FLMG 4DR6L 1QZHA 3K81C 4DV4L 2JA7H 1Q46A 3VDYA 1K8AC 4LFBL 3I56A 1JJCB 2DUDA 1VQCA 3CCRA 1HNWQ 1TWCH 1K0RA 2HIVA 1YJNA 1K73C 2PI2E 1O7IA 1A63A 2I5HA 4R4CA 2ZTDA 1X6OA 1WOCA 3AEVA 1GD7A 1P16A 4ALPA 4GLAC 4P72A 1VQNA 3HKSA 4LFAL 4UPAA 1U0LA 3AFPA 2BA1A 4IO9A 4JI5Q 2ZTCA 1NMGA 5IP7H 3D31A 4MNOA 1I94Q 2KBNA 4OWXB 1Q8KA 2Q2HA 3EN2A 3ER0A 3LGJA 4GN4B 1SLJA 4O2DA 4P73A 2JA6H 4K0KQ 1L1OC 2K52A 1PVOA 3CC2A 4YWKA 4WJ3M 1WYDA 2EIFA 2K5VA 1XMOQ 5IYBH 1KD1C 3RLFA 1J5EQ 2OQ0A 3H0GH 2C35B 1VS0A 5IP7G 2UUAQ 1EOVA 3L2PA 1KQSA 2MNAA 4P71A 3L0OA 2ZM6Q 4OX9Q 4A3GH 2CFMA 3J80c 4UP7A 3S24A 1HZBA 1L2FA 3ERSX 1YHAA 2UXCL 2D0OA 4DR2L 1VQ4A 5JEAG 1JB7A 4LF6Q 1UE5A 3GTOH 4X66L 1BKBA 3UDIA 2WB1E 3M3YH 2R93G 3GTQH 2IY5B 2WAQG 4JI2Q 1Z9FA 1GVPA 3GTMH 4OO1G 4YHHQ 3H0GG 3A74A 2K5HA 4GLVB 4DV2L 1I3QH 5GAHC 4A3MH 2RHSB 4IPDA 2BH2A 3A5ZB 3RZOH 4JI4L 3WWVA 3S1MH 2OQKA 2V1CC 4OXPA 4AQYL 2UUAL 4LFAQ 5JJIA 5FLMH 2UU9Q 3PO3G 1WI5A 3M7NA 3S1RH 4LF7Q 4LF8L 1OTCA 3KJOA 1CKOA 1YVCA 5JJLA 2KHIA 4A3IG 3HOXG 5FLXc 4IOCA 4JYAL 1SE8A 3GTPH 2RF4A 2MFIA 2JA5G 2JE6I 1Y1WG 4IFDG 1EFWA 1MJCA 2ID0A 1CKMA 4Y7NH 1UWVA 1L0WA 4B3RQ 5C4XG 4A4IA 1VQ8A 4A3MG 1PYSB 1V43A 3HFZB 2H5XA 3CCEA 1K8GA 2JJQA 2OTLA 3I4MH 3PO2G 4APVA 4QL5A 2VZAA 4IFDI 1BBUA 4NXML 1PV4A 1MKHA 2Q2IA 3PIOA 4DV6L 2VNUD 2XGTA 3D0FA 1CSQA 4DK6C 1HNZL 1HNXQ 3M9BA 4PG3A 4DV1Q 3HOYH 3I4NG 2R7ZG 3ZJYC 1J6QA 2YU9H 4BY1H 2A19A 2CQOA 3FP9A 3G4SA 3OTOQ 3UDGA 1JJGA 1VQ7A 2E2JH 2E2HH 1G291 3CAMA 5DLQE 4YWLA 3KYHC 3JAMi 4TVAB 4AYBG 1OXUA 1XNRQ 4QGUA 2VQEL 1Q82C 1Q12A 2E8GA 1KRTA 1XPUA 1XMQL 4DR7Q 1I6HH 4QIWE 3RN2A 1E3PA 2FXQA 1FGUA 3GO5A 3NEMA 4A3FG 1HR0Q 2UUBQ 2R92H 1SMXA 1VCIA 2UXCQ 4JI8L 2OWOA 1FJGQ 2HT1A 1WCMH 3FHWA 3HOZH 3S1NH 2D0PA 4MTNA 4PZ7A 2IX1A 1KAWA 2VL6A 2Z0SA 3L7ZC 4J15A 5IT9c 3CMEA 1WJJA 2VQFQ 4DV0Q 1C7YA 2NZHA 4L5QA 4X66Q 4OWTB 2BH8A 3J7A5 2VY3A 3F2BA 5GADC 4DUYL 1J5EL 4JI7Q 3TQYA 3AYHB 4JI6Q 2CWPA 1GO3E 1VQIA 3HOUH 1YZ6A 2KCMA 3UE0A 1SROA 1KC8C 4RG1A 2VUMG 2BA0A 2IHFA 3KDFA 3CCSA 2JA7G 3PUXA 2N78A 4LFCL 4UY8C 1KL9A 4IOAA 4BA1I 1N33L 2PNHA 1X54A 4QJFA 5LMUL 4UP8A 4LW1A 2UU9L 1IYJB 1YHBA 5LMNW 1E24A 4QY7A 1LTLA 1XTDA 3HKZE 3RZDH 1EIFA 4LF5Q 5HY6A 5GAGC 4A3LH 2I5LX 4KLKA 1XPRA 4TQUS 1E1OA 2ES2A 4PZ6A 4LF8Q 2OTJA 1TWAH 1X65A 1KRSA 1YJWA 1OXSC 3KDFB 1N33Q 2JA8G 1E22A 1PH6A 1G6PA 5IP9H 2K5NA 4JC0A 4A3BH 1YITA 1ASZA 2F4VL 3A0JA 1VQKA 2B3GA 4X65L 1VQHA 5M3MG 5IYDG 5IE8A 4A3EH 1B70B 1PH8A 2ASBA 3TREA 3S2DH 3EIVA 1HJPA 2AWNA 3T1YL 4GKKQ 4GKJQ 3K7UC 3NBHB 4DNIA 4JOIA 4JI1L 3CCQA 4WJ4A 4DAYB 4OO1I 1X9NA 4YWMA 1HR0L 3G71A 2N49A 4DR1L 4HJ9A 1WCMG 4KHPL 1X56A 2HQLA 3E9IA 5ELNA 3STBD 5LMUQ 4A3LG 1NY4A 4X65Q 2YTXA 1Z47A 3G6EA 4BXXG 1PFSA 4DV1L 4HJ5A 2YV5A 3KOJA 4BXXH 2K50A 2RHQB 3I4OA 4X6AH 2Y0SG 4LUVA 4FDBA 1XJVA 4JV5L 4YCVA 1N36L 4DV5L 2CCZA 4JYAQ 2R7FA 4BBSH 1FVIA 1CSPA 5LMNQ 3EBEA 3RNUA 1JMCA 2AWOA 2MO0A 3HOVH 1SRUA 1XNRL 2F52A 5BR8Q 1OXTA 3S1QH 1T9HA 4GN3B 4JI8Q 4C3JH 4LF6L 5C0XI 1I5FA 3PSIA 3H3VH 2IHEA 4YHHL 1QZGA 2UUCL 4IPHA 4LFCQ 3F1ZA 3PO2H 4C3HH 3JC66 2E5LL 3TS0A 1LYLA 5M5YH 1NBWA 4GLXA 4DR2Q 1G51A 1W3SA 1L1OA 4IPGA 4JBWA 3ULJA 5C4XH 4DUYQ 1PH9A 2GVAA 4JI7L 2HHHQ 4RMFA 2IT1A 4LUOA 3AQQA 3SGIA 4JBMA 3CXCA 2Z6KA 1PHJA 4HJ8A 2CWAA 1JE5A 5C0XJ 2A8VA 3T1YQ 3S16H 4GKKL 3CW2C 2ALYB 3NELA 3STBC 3J7ZC 4HIMA 2B63H 3I4NH 1IL2A 4DV5Q 3W1BA 4HIDA 1E1TA 4JOIC 1Q7YC 3J81j 1CKNA 1HZ9A 2ZJPA 3TS2A 1LM0A 3M85A 4DV6Q 3CCJA 3K0XA 1LUZA 1VQ9A 4JI0Q 4IPCA 4JG2A 4R4IA 3GDEA 4B3ML 3OW2A 1PH7A 1QVFA 3CD6A 4A3KG 1MIUA 3E9HA 3CCMA 3CF5A 3KLWA 4DR5Q 4B3SQ 5C44G 4PZ8A 1YI2A 1Y1WH 2N8NA 1FJGL 3H3VI 1IXRA 1YEZA 1S3OA 1PYBA 1Y14B 2R92G 4DV7L 2IX0A 4L5TA 3T1HL 4A3JG 2JEBI 1S72A 1DGSA 4R4TA 1W2BA 2NVQH 4P74A 3S15H 4GKJL 3U4ZA 4XIGS 3RR5A 1SFOH 2K4KA 3AFQA 1N9WA 2DGYA 2MQHA 3I2ZA 1KHIA 1VQ5A 1Q1EA 1K9MC 1H95A 4JI2L 4DR3L 4PMWA 2XTIA 3ULPA 4BY1G 1N34L 1KXLA 4HJ7A 2OCEA 2PMZE 3GTLH 2NN6I 4A93H 3GTKH 3PCOB 1IBLL 2R7DA 1VQMA 1CUKA 5J3BA 5AJ3L 3ULLA 2WAQE 1Q1BA 1M1KC 4LF5L 1BBWA 5E7NA 1TWGH 3FKIG 2VQFL 3CCVA 1BVSA 4DV0L 4C2MH 4C3IH 1KIXA 1XMQQ 2Q2TA 2ZTEA 3I4MG 3PF4A 4DR7L 5JJKA 2GN5A 2A1AA 2MO1A 4ME3A 4IFDJ 1XNQQ 3PUYA 3E0EA 2JK8A 2LSSA 3PUZA 1C9OA 2WFWA 4MZ9A 4BBRG 3F2CA 4LWCA 1MJEA 1HR0W 2EXDA 4H02A 5GQOA 2JA5H 4BBSG 5IWAQ 3M4PA 1A8VA 5AJ3Q 2HIXA 1EUJA 4DUZQ 3CCLA 1C0AA 3KF8B 5H1SE 2JA9A 3W5OA 3HOXH 2NVXH 3PGZA 5IYCG 2UXDL 2F3IA 3UDXA 2VS1A 3DLLA 4NXNL 3PO3H 2KHJA 3Q8DA 1E7ZA 2YTVA 4X64L 4BBRH 4LF9Q 1GKHA 4A3DG 3CPWA 4LNQA 3OYYA 1TWHH 4GS3A 3RLOA 3IRBA 2AMCB 5LMNL 1UE7A 1M90C 3CPFA 3F8TA 1VQAA 4HIOA 1EIYB 3B6YA 1QUQB 2LXKA 1IBKQ 3FKIH 1EYGA 3BZCA 4KHZA 4JI6L 1QUQA 1GM5A 4LF4L 2QGQA 2R6GA 3CP0A 5M3MH 5GROA 2QEXA 2VQEQ 4A3EG 1S40A 4YY3Q 4LFBQ 3PF5A 3K8AA 1CKNB 5HGQA 4YCUA 3JAMc 5C3EG 4DV4Q 2E2IH 5FJ8G 5IP9G 2B63G 4A93G 4YCWA 1JT8A 2K14A 2Z6KC 3U58A 1NMFA 4DV3Q 4B3TL 2K75A 5IYBG 3HOVG 4DKAC 4AQYQ 1VQLA 2RCNA 4GNXB 3TRZA 5K36G 1OXVA 2Y0SE 4DR4L 5C0XG 1VQEA 4K0KL 4JI1Q 1K83H 1TXYA 4IJLA 4X62L 1EQQA 4NXMQ 1RIPA 3CMAA 2JQOA 1HZAA 2ATWA 4A3JH 2PQAB 5M3FH 1QVCA 4JV5Q 2L15A 3T1HQ 4NXNQ 1NTGA 5BR8L 4OWWB 4OONA 4A75A 1PH5A 5C44H 3RLNA 3MXNB 4A3CG 1N32Q 1PH3A 2YYZA 5M5XH 3HOWH 4A3KH 3CCUA 2VUMH 5EAYA 1N8RC 2ZJQA 4L5RC 1YJ9A 4POFA 1A0IA 1NJIC 1VQOA 4A76A 1YIJA 3PIPA 4B3SL 3S2HH 2KENA 2UXBQ 1X55A 3KJPA 2UUCQ 1XNQL 1SN8A 3I55A 1IBLQ 1HNZQ 4A3CH 4Y52H 1B7YB 4HJAA 3J81i 4DR1Q 4KHPQ 1UE1A 1VQBA 4X64Q 1YHQA 4UP9A 5JEAJ 5IWAL 1OXXK 5M3FG 2CKZB 4JI4Q 1Q81C 4JI3Q 4KI0A 3U4VA 4DV7Q 1NE3A 4GNXC 3KFUA 5IYDH 1V9PA 4DV2Q 3KF6A 3S14H 3M4QA 3J80i 4AH6A 4O0AA 3CC7A 4HIKA 1I94L 5ELOA 1SR3A 1A62A 2WB1G 4DAMA 2UXBL 3PUVA 1N36Q 1VQJA 4B3MQ 2ZJRA 3UE1A 2VW9A 1IBML 3CQZH 1L1OB 3A5UA 4GOPB 4DR6Q 4R4QA 1N32L 3S17H 3ICEA 1U5KA 4GOPC 1PH1A 1X3EA 4LF7L 4NPSA 4JBKA 1UEBA 4JI0L 4XTCS 4JI5L 3HOUG 1B8AA 4DR3Q 2JA8H 4P75A 4AYBE 1PH2A 2PQAA 4R1JA 1AE2A 5C4JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM Q;  4A3D H;  3BJU A;  3HOW G;  4BA2 I;  3UDF A;  3RN5 A;  1I50 H;  1X3G A;  1IZ6 A;  1YNX A;  2B29 A;  2Q2U A;  1VQ6 A;  1FL0 A;  1Y1V G;  1AE3 A;  4BY7 H;  2F4V Q;  3F2D A;  3NEN A;  1XPO A;  2UXD Q;  2YTY A;  3U50 C;  4A3F H;  4L5S A;  1HNX L;  4EQ5 A;  2D62 A;  4DPG A;  5IYC H;  4OX9 L;  2AKW B;  4POG A;  4JCV E;  3TEH B;  4DUZ L;  1K3R A;  3MEF A;  2NVY H;  1Y1V H;  2PI2 A;  4BY7 G;  1EQR A;  3I7F A;  1X3F A;  3OTO L;  2UUB L;  4AIM A;  1XMO L;  3K7A H;  4DK3 C;  1JJ2 A;  2E5L Q;  2KCT A;  1HH2 P;  1UE6 A;  1HZC A;  4JBJ A;  1PA6 A;  4X62 Q;  2WP8 J;  3BU2 A;  4B3R L;  3GTJ H;  4LF4 Q;  4LUZ A;  2HHH L;  3HOY G;  3DM3 A;  5C3E H;  1HNW L;  4DR4 Q;  2QA4 A;  1QVG A;  2R93 H;  1WFQ A;  3M4O H;  3HOZ G;  4EX5 A;  1N34 Q;  1VQD A;  1VQP A;  4GN5 A;  1TWF H;  4DR5 L;  4A3B G;  3J81 c;  2N3S A;  4GNX A;  2GVB A;  4A3G G;  1R9T H;  2LXJ A;  3PUW A;  3GD7 A;  4LF9 L;  3KF6 B;  2ZM6 L;  5IY0 A;  1D7Q A;  2EQS A;  4QQB X;  2NVT H;  3H15 A;  4NB3 A;  1Q86 C;  2JEA I;  4DV3 L;  4B3T Q;  2NZO A;  4IJH A;  3HKZ G;  4R4O A;  1PH4 A;  2AHO B;  3W1G A;  1EWI A;  1P8L A;  2I0Q A;  1VQG A;  1VQF A;  3G48 A;  4GOP A;  4YY3 L;  3K80 C;  4JI3 L;  2JA6 G;  3GTG H;  1YBY A;  2R7Z H;  1AH9 A;  2I5M X;  5FJ8 H;  4A3I H;  1IBK L;  3PV0 A;  1V1Q A;  2NN6 G;  1ASY A;  1D8L A;  5M5W H;  3BZK A;  1RL2 A;  5GAE C;  3CC4 A;  5FLM G;  4DR6 L;  1QZH A;  3K81 C;  4DV4 L;  2JA7 H;  1Q46 A;  3VDY A;  1K8A C;  4LFB L;  3I56 A;  1JJC B;  2DUD A;  1VQC A;  3CCR A;  1HNW Q;  1TWC H;  1K0R A;  2HIV A;  1YJN A;  1K73 C;  2PI2 E;  1O7I A;  1A63 A;  2I5H A;  4R4C A;  2ZTD A;  1X6O A;  1WOC A;  3AEV A;  1GD7 A;  1P16 A;  4ALP A;  4GLA C;  4P72 A;  1VQN A;  3HKS A;  4LFA L;  4UPA A;  1U0L A;  3AFP A;  2BA1 A;  4IO9 A;  4JI5 Q;  2ZTC A;  1NMG A;  5IP7 H;  3D31 A;  4MNO A;  1I94 Q;  2KBN A;  4OWX B;  1Q8K A;  2Q2H A;  3EN2 A;  3ER0 A;  3LGJ A;  4GN4 B;  1SLJ A;  4O2D A;  4P73 A;  2JA6 H;  4K0K Q;  1L1O C;  2K52 A;  1PVO A;  3CC2 A;  4YWK A;  4WJ3 M;  1WYD A;  2EIF A;  2K5V A;  1XMO Q;  5IYB H;  1KD1 C;  3RLF A;  1J5E Q;  2OQ0 A;  3H0G H;  2C35 B;  1VS0 A;  5IP7 G;  2UUA Q;  1EOV A;  3L2P A;  1KQS A;  2MNA A;  4P71 A;  3L0O A;  2ZM6 Q;  4OX9 Q;  4A3G H;  2CFM A;  3J80 c;  4UP7 A;  3S24 A;  1HZB A;  1L2F A;  3ERS X;  1YHA A;  2UXC L;  2D0O A;  4DR2 L;  1VQ4 A;  5JEA G;  1JB7 A;  4LF6 Q;  1UE5 A;  3GTO H;  4X66 L;  1BKB A;  3UDI A;  2WB1 E;  3M3Y H;  2R93 G;  3GTQ H;  2IY5 B;  2WAQ G;  4JI2 Q;  1Z9F A;  1GVP A;  3GTM H;  4OO1 G;  4YHH Q;  3H0G G;  3A74 A;  2K5H A;  4GLV B;  4DV2 L;  1I3Q H;  5GAH C;  4A3M H;  2RHS B;  4IPD A;  2BH2 A;  3A5Z B;  3RZO H;  4JI4 L;  3WWV A;  3S1M H;  2OQK A;  2V1C C;  4OXP A;  4AQY L;  2UUA L;  4LFA Q;  5JJI A;  5FLM H;  2UU9 Q;  3PO3 G;  1WI5 A;  3M7N A;  3S1R H;  4LF7 Q;  4LF8 L;  1OTC A;  3KJO A;  1CKO A;  1YVC A;  5JJL A;  2KHI A;  4A3I G;  3HOX G;  5FLX c;  4IOC A;  4JYA L;  1SE8 A;  3GTP H;  2RF4 A;  2MFI A;  2JA5 G;  2JE6 I;  1Y1W G;  4IFD G;  1EFW A;  1MJC A;  2ID0 A;  1CKM A;  4Y7N H;  1UWV A;  1L0W A;  4B3R Q;  5C4X G;  4A4I A;  1VQ8 A;  4A3M G;  1PYS B;  1V43 A;  3HFZ B;  2H5X A;  3CCE A;  1K8G A;  2JJQ A;  2OTL A;  3I4M H;  3PO2 G;  4APV A;  4QL5 A;  2VZA A;  4IFD I;  1BBU A;  4NXM L;  1PV4 A;  1MKH A;  2Q2I A;  3PIO A;  4DV6 L;  2VNU D;  2XGT A;  3D0F A;  1CSQ A;  4DK6 C;  1HNZ L;  1HNX Q;  3M9B A;  4PG3 A;  4DV1 Q;  3HOY H;  3I4N G;  2R7Z G;  3ZJY C;  1J6Q A;  2YU9 H;  4BY1 H;  2A19 A;  2CQO A;  3FP9 A;  3G4S A;  3OTO Q;  3UDG A;  1JJG A;  1VQ7 A;  2E2J H;  2E2H H;  1G29 1;  3CAM A;  5DLQ E;  4YWL A;  3KYH C;  3JAM i;  4TVA B;  4AYB G;  1OXU A;  1XNR Q;  4QGU A;  2VQE L;  1Q82 C;  1Q12 A;  2E8G A;  1KRT A;  1XPU A;  1XMQ L;  4DR7 Q;  1I6H H;  4QIW E;  3RN2 A;  1E3P A;  2FXQ A;  1FGU A;  3GO5 A;  3NEM A;  4A3F G;  1HR0 Q;  2UUB Q;  2R92 H;  1SMX A;  1VCI A;  2UXC Q;  4JI8 L;  2OWO A;  1FJG Q;  2HT1 A;  1WCM H;  3FHW A;  3HOZ H;  3S1N H;  2D0P A;  4MTN A;  4PZ7 A;  2IX1 A;  1KAW A;  2VL6 A;  2Z0S A;  3L7Z C;  4J15 A;  5IT9 c;  3CME A;  1WJJ A;  2VQF Q;  4DV0 Q;  1C7Y A;  2NZH A;  4L5Q A;  4X66 Q;  4OWT B;  2BH8 A;  3J7A 5;  2VY3 A;  3F2B A;  5GAD C;  4DUY L;  1J5E L;  4JI7 Q;  3TQY A;  3AYH B;  4JI6 Q;  2CWP A;  1GO3 E;  1VQI A;  3HOU H;  1YZ6 A;  2KCM A;  3UE0 A;  1SRO A;  1KC8 C;  4RG1 A;  2VUM G;  2BA0 A;  2IHF A;  3KDF A;  3CCS A;  2JA7 G;  3PUX A;  2N78 A;  4LFC L;  4UY8 C;  1KL9 A;  4IOA A;  4BA1 I;  1N33 L;  2PNH A;  1X54 A;  4QJF A;  5LMU L;  4UP8 A;  4LW1 A;  2UU9 L;  1IYJ B;  1YHB A;  5LMN W;  1E24 A;  4QY7 A;  1LTL A;  1XTD A;  3HKZ E;  3RZD H;  1EIF A;  4LF5 Q;  5HY6 A;  5GAG C;  4A3L H;  2I5L X;  4KLK A;  1XPR A;  4TQU S;  1E1O A;  2ES2 A;  4PZ6 A;  4LF8 Q;  2OTJ A;  1TWA H;  1X65 A;  1KRS A;  1YJW A;  1OXS C;  3KDF B;  1N33 Q;  2JA8 G;  1E22 A;  1PH6 A;  1G6P A;  5IP9 H;  2K5N A;  4JC0 A;  4A3B H;  1YIT A;  1ASZ A;  2F4V L;  3A0J A;  1VQK A;  2B3G A;  4X65 L;  1VQH A;  5M3M G;  5IYD G;  5IE8 A;  4A3E H;  1B70 B;  1PH8 A;  2ASB A;  3TRE A;  3S2D H;  3EIV A;  1HJP A;  2AWN A;  3T1Y L;  4GKK Q;  4GKJ Q;  3K7U C;  3NBH B;  4DNI A;  4JOI A;  4JI1 L;  3CCQ A;  4WJ4 A;  4DAY B;  4OO1 I;  1X9N A;  4YWM A;  1HR0 L;  3G71 A;  2N49 A;  4DR1 L;  4HJ9 A;  1WCM G;  4KHP L;  1X56 A;  2HQL A;  3E9I A;  5ELN A;  3STB D;  5LMU Q;  4A3L G;  1NY4 A;  4X65 Q;  2YTX A;  1Z47 A;  3G6E A;  4BXX G;  1PFS A;  4DV1 L;  4HJ5 A;  2YV5 A;  3KOJ A;  4BXX H;  2K50 A;  2RHQ B;  3I4O A;  4X6A H;  2Y0S G;  4LUV A;  4FDB A;  1XJV A;  4JV5 L;  4YCV A;  1N36 L;  4DV5 L;  2CCZ A;  4JYA Q;  2R7F A;  4BBS H;  1FVI A;  1CSP A;  5LMN Q;  3EBE A;  3RNU A;  1JMC A;  2AWO A;  2MO0 A;  3HOV H;  1SRU A;  1XNR L;  2F52 A;  5BR8 Q;  1OXT A;  3S1Q H;  1T9H A;  4GN3 B;  4JI8 Q;  4C3J H;  4LF6 L;  5C0X I;  1I5F A;  3PSI A;  3H3V H;  2IHE A;  4YHH L;  1QZG A;  2UUC L;  4IPH A;  4LFC Q;  3F1Z A;  3PO2 H;  4C3H H;  3JC6 6;  2E5L L;  3TS0 A;  1LYL A;  5M5Y H;  1NBW A;  4GLX A;  4DR2 Q;  1G51 A;  1W3S A;  1L1O A;  4IPG A;  4JBW A;  3ULJ A;  5C4X H;  4DUY Q;  1PH9 A;  2GVA A;  4JI7 L;  2HHH Q;  4RMF A;  2IT1 A;  4LUO A;  3AQQ A;  3SGI A;  4JBM A;  3CXC A;  2Z6K A;  1PHJ A;  4HJ8 A;  2CWA A;  1JE5 A;  5C0X J;  2A8V A;  3T1Y Q;  3S16 H;  4GKK L;  3CW2 C;  2ALY B;  3NEL A;  3STB C;  3J7Z C;  4HIM A;  2B63 H;  3I4N H;  1IL2 A;  4DV5 Q;  3W1B A;  4HID A;  1E1T A;  4JOI C;  1Q7Y C;  3J81 j;  1CKN A;  1HZ9 A;  2ZJP A;  3TS2 A;  1LM0 A;  3M85 A;  4DV6 Q;  3CCJ A;  3K0X A;  1LUZ A;  1VQ9 A;  4JI0 Q;  4IPC A;  4JG2 A;  4R4I A;  3GDE A;  4B3M L;  3OW2 A;  1PH7 A;  1QVF A;  3CD6 A;  4A3K G;  1MIU A;  3E9H A;  3CCM A;  3CF5 A;  3KLW A;  4DR5 Q;  4B3S Q;  5C44 G;  4PZ8 A;  1YI2 A;  1Y1W H;  2N8N A;  1FJG L;  3H3V I;  1IXR A;  1YEZ A;  1S3O A;  1PYB A;  1Y14 B;  2R92 G;  4DV7 L;  2IX0 A;  4L5T A;  3T1H L;  4A3J G;  2JEB I;  1S72 A;  1DGS A;  4R4T A;  1W2B A;  2NVQ H;  4P74 A;  3S15 H;  4GKJ L;  3U4Z A;  4XIG S;  3RR5 A;  1SFO H;  2K4K A;  3AFQ A;  1N9W A;  2DGY A;  2MQH A;  3I2Z A;  1KHI A;  1VQ5 A;  1Q1E A;  1K9M C;  1H95 A;  4JI2 L;  4DR3 L;  4PMW A;  2XTI A;  3ULP A;  4BY1 G;  1N34 L;  1KXL A;  4HJ7 A;  2OCE A;  2PMZ E;  3GTL H;  2NN6 I;  4A93 H;  3GTK H;  3PCO B;  1IBL L;  2R7D A;  1VQM A;  1CUK A;  5J3B A;  5AJ3 L;  3ULL A;  2WAQ E;  1Q1B A;  1M1K C;  4LF5 L;  1BBW A;  5E7N A;  1TWG H;  3FKI G;  2VQF L;  3CCV A;  1BVS A;  4DV0 L;  4C2M H;  4C3I H;  1KIX A;  1XMQ Q;  2Q2T A;  2ZTE A;  3I4M G;  3PF4 A;  4DR7 L;  5JJK A;  2GN5 A;  2A1A A;  2MO1 A;  4ME3 A;  4IFD J;  1XNQ Q;  3PUY A;  3E0E A;  2JK8 A;  2LSS A;  3PUZ A;  1C9O A;  2WFW A;  4MZ9 A;  4BBR G;  3F2C A;  4LWC A;  1MJE A;  1HR0 W;  2EXD A;  4H02 A;  5GQO A;  2JA5 H;  4BBS G;  5IWA Q;  3M4P A;  1A8V A;  5AJ3 Q;  2HIX A;  1EUJ A;  4DUZ Q;  3CCL A;  1C0A A;  3KF8 B;  5H1S E;  2JA9 A;  3W5O A;  3HOX H;  2NVX H;  3PGZ A;  5IYC G;  2UXD L;  2F3I A;  3UDX A;  2VS1 A;  3DLL A;  4NXN L;  3PO3 H;  2KHJ A;  3Q8D A;  1E7Z A;  2YTV A;  4X64 L;  4BBR H;  4LF9 Q;  1GKH A;  4A3D G;  3CPW A;  4LNQ A;  3OYY A;  1TWH H;  4GS3 A;  3RLO A;  3IRB A;  2AMC B;  5LMN L;  1UE7 A;  1M90 C;  3CPF A;  3F8T A;  1VQA A;  4HIO A;  1EIY B;  3B6Y A;  1QUQ B;  2LXK A;  1IBK Q;  3FKI H;  1EYG A;  3BZC A;  4KHZ A;  4JI6 L;  1QUQ A;  1GM5 A;  4LF4 L;  2QGQ A;  2R6G A;  3CP0 A;  5M3M H;  5GRO A;  2QEX A;  2VQE Q;  4A3E G;  1S40 A;  4YY3 Q;  4LFB Q;  3PF5 A;  3K8A A;  1CKN B;  5HGQ A;  4YCU A;  3JAM c;  5C3E G;  4DV4 Q;  2E2I H;  5FJ8 G;  5IP9 G;  2B63 G;  4A93 G;  4YCW A;  1JT8 A;  2K14 A;  2Z6K C;  3U58 A;  1NMF A;  4DV3 Q;  4B3T L;  2K75 A;  5IYB G;  3HOV G;  4DKA C;  4AQY Q;  1VQL A;  2RCN A;  4GNX B;  3TRZ A;  5K36 G;  1OXV A;  2Y0S E;  4DR4 L;  5C0X G;  1VQE A;  4K0K L;  4JI1 Q;  1K83 H;  1TXY A;  4IJL A;  4X62 L;  1EQQ A;  4NXM Q;  1RIP A;  3CMA A;  2JQO A;  1HZA A;  2ATW A;  4A3J H;  2PQA B;  5M3F H;  1QVC A;  4JV5 Q;  2L15 A;  3T1H Q;  4NXN Q;  1NTG A;  5BR8 L;  4OWW B;  4OON A;  4A75 A;  1PH5 A;  5C44 H;  3RLN A;  3MXN B;  4A3C G;  1N32 Q;  1PH3 A;  2YYZ A;  5M5X H;  3HOW H;  4A3K H;  3CCU A;  2VUM H;  5EAY A;  1N8R C;  2ZJQ A;  4L5R C;  1YJ9 A;  4POF A;  1A0I A;  1NJI C;  1VQO A;  4A76 A;  1YIJ A;  3PIP A;  4B3S L;  3S2H H;  2KEN A;  2UXB Q;  1X55 A;  3KJP A;  2UUC Q;  1XNQ L;  1SN8 A;  3I55 A;  1IBL Q;  1HNZ Q;  4A3C H;  4Y52 H;  1B7Y B;  4HJA A;  3J81 i;  4DR1 Q;  4KHP Q;  1UE1 A;  1VQB A;  4X64 Q;  1YHQ A;  4UP9 A;  5JEA J;  5IWA L;  1OXX K;  5M3F G;  2CKZ B;  4JI4 Q;  1Q81 C;  4JI3 Q;  4KI0 A;  3U4V A;  4DV7 Q;  1NE3 A;  4GNX C;  3KFU A;  5IYD H;  1V9P A;  4DV2 Q;  3KF6 A;  3S14 H;  3M4Q A;  3J80 i;  4AH6 A;  4O0A A;  3CC7 A;  4HIK A;  1I94 L;  5ELO A;  1SR3 A;  1A62 A;  2WB1 G;  4DAM A;  2UXB L;  3PUV A;  1N36 Q;  1VQJ A;  4B3M Q;  2ZJR A;  3UE1 A;  2VW9 A;  1IBM L;  3CQZ H;  1L1O B;  3A5U A;  4GOP B;  4DR6 Q;  4R4Q A;  1N32 L;  3S17 H;  3ICE A;  1U5K A;  4GOP C;  1PH1 A;  1X3E A;  4LF7 L;  4NPS A;  4JBK A;  1UEB A;  4JI0 L;  4XTC S;  4JI5 L;  3HOU G;  1B8A A;  4DR3 Q;  2JA8 H;  4P75 A;  4AYB E;  1PH2 A;  2PQA A;  4R1J A;  1AE2 A;  5C4J H; 
#chains in the Genus database with same CATH topology
 1IBM Q;  4WFN 3;  4BA2 I;  1UUP A;  3UDF A;  3RN5 A;  1SMY C;  3S2H B;  4IFD H;  1FL0 A;  1J9O A;  1Y1V G;  5LHY 1;  2K33 A;  2BCO A;  3K0Y A;  3U50 C;  4L5S A;  1WVL A;  5IYC H;  1BR9 A;  3TEH B;  2EPB A;  3MEF A;  3OWF A;  1T5X D;  4BY7 G;  2PI2 A;  1TWC B;  3I7F A;  4G7O C;  2HCC A;  2VUM B;  1F2Z A;  1HZC A;  1PA6 A;  4B3R L;  2QIL A;  3GTJ H;  5DAU A;  3DM3 A;  4RAU C;  2R93 H;  4EX5 A;  1VQD A;  1VQP A;  1HQM C;  4DR5 L;  4DFA A;  1H9S B;  2N3S A;  2GVB A;  5IGG A;  4LF9 L;  1K3B C;  3GD7 A;  3MVV A;  4ZRZ A;  2A6E D;  2NVT H;  1EZ6 A;  1LT5 D;  5CBA E;  1L0X B;  1PTO F;  1Q86 C;  3M4O B;  1EY7 A;  2NZO A;  1F77 A;  4IJH A;  3HKZ G;  4R4O A;  4RGO S;  1KTK A;  1A3U A;  3K80 C;  2JA6 G;  2R7Z H;  1C4Q A;  3A8K E;  2NN6 G;  1FD7 D;  1SSO A;  4IUV A;  1Q46 A;  5CV4 A;  3VDY A;  2I46 A;  3H6M A;  4LFB L;  2QCP X;  2Z8L A;  3I56 A;  3C46 A;  2JA5 B;  1HA5 A;  2PI2 E;  1K73 C;  1O7I A;  3I4M B;  1EU4 A;  4IUN A;  1X6O A;  4DNR B;  1B4O A;  1GD7 A;  3GTJ B;  3HOX B;  1P16 A;  1VQN A;  4P72 A;  2EYF A;  1EY5 A;  4LFA L;  1SNM A;  1U0L A;  3AFP A;  5FK9 C;  4H0L C;  2KEE A;  2ZTC A;  4MNO A;  4CDC C;  3O13 A;  2Q2H A;  2JA6 H;  3LGJ A;  3U9O A;  4O2D A;  5AFW A;  2K52 A;  3Q0A A;  3NTI A;  3DHQ A;  4C3I B;  5J39 A;  2C35 B;  2XRS D;  2KEC A;  1H9J A;  2MNA A;  4P71 A;  3L0O A;  3BVG A;  3ERS X;  1L2F A;  2UXC L;  2D0O A;  2PCF B;  1SEB D;  1G6Z A;  1B53 A;  2IY5 B;  1EIG A;  1CFM A;  4XQN A;  4GLV B;  4DV2 L;  1I3Q H;  1J8I A;  1AW7 A;  2B39 A;  4OXP A;  2K6A A;  4LFA Q;  1KDB A;  4LF7 Q;  1OTC A;  2PZT A;  2KHI A;  4FYD A;  3E5S A;  2EY2 A;  4IOC A;  2WAQ B;  2EE1 A;  2EZV A;  4IFD G;  2ID0 A;  1CKM A;  1D5Z C;  1UWV A;  3SK6 A;  3QJY A;  2A74 C;  1ILP A;  1SYB A;  2AQ2 B;  3HFZ B;  3CCE A;  2OTL A;  3PO2 G;  4H44 C;  2HQE A;  2Q2I A;  3PIO A;  2VNU D;  3OIP A;  1CSQ A;  4DK6 C;  1HNZ L;  2V4D A;  2VB3 X;  4PG3 A;  1F9S A;  1BNZ A;  3ZJY C;  3FVQ A;  4KY7 A;  4BY1 H;  2A19 A;  2L55 A;  1FR3 A;  1I6V C;  3VA7 A;  1G29 1;  4G4K A;  1UAP A;  5DLQ E;  1TWF B;  5A35 A;  1F9Q A;  1Q82 C;  3T53 B;  3K5M A;  2PZW A;  1ET6 A;  1DYQ A;  3RN2 A;  2JN4 A;  3GO5 A;  1JWU D;  4A3F G;  2R92 H;  1VCI A;  4JI8 L;  1FJG Q;  2HT1 A;  1GJX A;  1I4X A;  3AMU A;  1ZYR D;  3PMF A;  1KAW A;  5IT9 c;  1WJJ A;  3KBX A;  4JI7 Q;  1A15 A;  1TY0 A;  2E2D C;  4UAI A;  2CWP A;  1AZQ A;  3NP8 A;  1LT4 D;  3UE0 A;  1RD9 D;  5FOB B;  2BA0 A;  2IHF A;  4C3H B;  3PUX A;  2N78 A;  4K8I A;  4LFC L;  4BA1 I;  1N33 L;  2MPM A;  2XNA C;  2UU9 L;  4HR7 B;  2FHT A;  1YHB A;  5LMN W;  3AB9 A;  1E24 A;  1XWE A;  2RQX A;  1LTL A;  2IWH A;  3RZD H;  1CI3 M;  4LF5 Q;  1GUG A;  4A3B B;  1SXT A;  3H91 A;  4UHV A;  4LF8 Q;  1O7Y A;  1TWA H;  1YJW A;  1RTN A;  1A3T A;  3OW7 A;  1N33 Q;  3WOF A;  1PFB A;  2PZU A;  1QJO A;  3K5N A;  5IP9 H;  1QNK A;  1YIT A;  5ELD A;  4TSS A;  1VQH A;  5M3M G;  2KOL A;  1DXM A;  3S2D H;  1HJP A;  4GKK Q;  5JPN C;  4GKJ Q;  2F0M A;  3ITP A;  3N6R A;  2WB1 B;  1EQT A;  1NR2 A;  4B9X A;  4CDD C;  4HSP A;  4L8J A;  1WD0 A;  1IL8 A;  5T1I A;  3G71 A;  2HQL A;  1MI2 A;  3STB D;  1NY4 A;  5CR3 A;  1PFS A;  2E2H B;  4DV1 L;  5BN4 A;  2PPB C;  5C4X B;  3PQI A;  4FDB A;  1XJV A;  4MN3 A;  4JV5 L;  4DV5 L;  2WAC A;  1FVI A;  4K5X A;  1CSP A;  3IKJ A;  2MO0 A;  3HOV H;  1F9P A;  2HDM A;  2WKC A;  5BR8 Q;  5J22 A;  1T9H A;  4GN3 B;  3D6W A;  4K14 A;  2KVM A;  5C0X I;  4U68 A;  4CKE A;  3PO3 B;  3HP3 A;  5JEA H;  1HRJ A;  1IYV A;  4BY1 B;  4WOR A;  3F1Z A;  1M8A A;  3TS0 A;  2B2Y A;  4ZCK A;  1G51 A;  1L1O A;  1PH9 A;  4M8A A;  1UNS A;  4CHT B;  2F0H A;  3A55 A;  4JBM A;  3KUP A;  1PHJ A;  1JE5 A;  3S16 H;  3J7Z C;  2B63 B;  4DV5 Q;  2EY5 A;  3W1B A;  1NAP A;  1CA6 A;  1DOM A;  1G8Z D;  1HZ9 A;  4UDU C;  1LTG D;  3M3Y B;  2J4X A;  1LM0 A;  3M85 A;  4DV6 Q;  3SE0 A;  3K0X A;  2PNR C;  1LUZ A;  2AUK A;  1VQ9 A;  4IPC A;  4JG2 A;  4B3M L;  3OW2 A;  1YNN C;  1QVF A;  1B9M A;  2K5Q A;  3CD6 A;  1MIU A;  3CCM A;  2F0U A;  5C44 G;  1YI2 A;  2N8N A;  1FJG L;  1Y14 B;  5I4D A;  4FNF A;  4NW2 A;  2L9H A;  1S72 A;  1W2B A;  3MFY A;  4P74 A;  3U4Z A;  1S4Z A;  5I9O A;  1Q1E A;  1K9M C;  5K36 H;  3ERQ A;  4PMW A;  4DR3 L;  2XTI A;  4DAP A;  1VF7 A;  4OIJ A;  4HCE A;  4EQN A;  1F2M A;  3GTK B;  4KY6 A;  4OL7 A;  2EYP A;  2QF7 A;  1V8Q A;  5AJ3 L;  2KED A;  1M1K C;  5J1Z A;  4LF5 L;  1BVS A;  4C2M H;  4CDF C;  3PF4 A;  3I4N B;  2Q8T A;  4QMG A;  4DR7 L;  1CK1 A;  4C1N I;  2B8G A;  1TWG B;  1MSH A;  1QOH A;  1XNQ Q;  2K01 A;  4MZ9 A;  3F2C A;  3GTQ B;  4H02 A;  4LJZ C;  3M4P A;  1A8V A;  3GTG B;  1YNJ C;  2HIX A;  5AJ3 Q;  2Q8I B;  1EUJ A;  4DUZ Q;  1B3A A;  4R8I A;  1GUS A;  1FNW A;  2X69 A;  3PGZ A;  1D6E C;  2G9H D;  5IYC G;  1CA5 A;  1JCK B;  1LAB A;  1SJE D;  3DLL A;  4NXN L;  5JVG 3;  3SK5 A;  2K03 A;  3LX0 A;  1PYW D;  3OYY A;  2WII B;  1TWH H;  2VB2 X;  4XYO A;  5C4H A;  3CPF A;  2SEB D;  3F8T A;  2H4O A;  3B6Y A;  1QUQ B;  5I6W A;  1EYG A;  4JI6 L;  4LF4 L;  1QUQ A;  2QGQ A;  2R6G A;  5GRO A;  4LFB Q;  2DY8 A;  1CKN B;  4DV4 Q;  1JT8 A;  1RDP D;  5KNC A;  3HOY B;  4YCW A;  2RSO A;  2K14 A;  4DV3 Q;  4B3T L;  3P7J A;  3J7A V;  2R92 B;  3NSW A;  1OXV A;  1KLU D;  4R8N A;  2K28 A;  4IJL A;  2R61 A;  4NXM Q;  1RIP A;  1VMP A;  1HCZ A;  1ESR A;  2JQO A;  5ELF A;  1ICF B;  2PQA B;  2MHV A;  4JV5 Q;  2L15 A;  4NXN Q;  4OWW B;  1STH A;  1KLG D;  4CKC A;  3MXN B;  4A3C G;  1N32 Q;  3MXN A;  4A3K H;  3I72 A;  2VUM H;  1UEA B;  4POF A;  2BOS A;  1YIJ A;  2N55 A;  3KJP A;  3LWU A;  1SN8 A;  3C3L A;  4DA2 A;  1B7Y B;  2IW3 A;  4DR1 Q;  4KHP Q;  1YHQ A;  1EYA A;  3QB3 A;  2CKZ B;  4DV7 Q;  1FNV A;  1S5B D;  2KJX A;  1FGB D;  2QDL A;  3C1E A;  3M4Q A;  4AH6 A;  4HIK A;  4RCN A;  3CC7 A;  1I94 L;  5JAV A;  5CGK A;  3PUV A;  1N36 Q;  1II3 A;  1SMY D;  1VQJ A;  1ENF A;  2N88 A;  2M9V A;  3MEH A;  2ZJR A;  4B3M Q;  1BCP D;  4DR6 Q;  4B9W A;  4IQZ A;  3S17 H;  1N32 L;  4DNT B;  1X3E A;  3DM1 A;  1EY4 A;  1LTR D;  4JBK A;  1UEB A;  4JI5 L;  5E1F A;  5E4X A;  3P1H A;  4DR3 Q;  3V2T A;  4K5V A;  5DNF A;  1D1I A;  1O7Z A;  5IGE A;  2B29 A;  1VQ6 A;  1S5E D;  1AE3 A;  3VR5 A;  1XPO A;  2YTY A;  4DK1 A;  4DPG A;  4U67 3;  4OX9 L;  4POG A;  1K3R A;  3CQZ B;  2Q8R E;  1B3Q A;  2NVY H;  1EQR A;  5M5W B;  1TQO A;  1JOO A;  3OTO L;  1EFI D;  4AIM A;  1XMO L;  1C8C A;  3K7A H;  3AU7 A;  3DEP A;  4DK3 C;  5A2Q E;  2E5L Q;  2KCT A;  2PW5 A;  1HH2 P;  3BYY B;  4X62 Q;  1RJT A;  4WRD A;  1HTP A;  5C3E H;  1QVG A;  1WFQ A;  4IUR A;  2ICE C;  4KHV A;  3E0J A;  5KYL A;  1EEF D;  2IPK D;  1B50 A;  1TWF H;  1O80 A;  4GNX A;  1K83 B;  3PUW A;  5IY0 A;  3MHB A;  2EQS A;  4KKT A;  5ELB A;  4NB3 A;  2JEA I;  5FO8 B;  1I6H B;  3FRP B;  1YNN D;  3W1G A;  1VQG A;  1EL0 A;  1YBY A;  2I5M X;  1ML0 D;  5FJ8 H;  4A3I H;  1ASY A;  3H94 A;  3BZK A;  1RKN A;  1RL2 A;  1JC7 A;  3K81 C;  4DV4 L;  3R2I A;  4NMZ A;  1JJC B;  3OWE B;  1TWC H;  2XWJ B;  4OO1 H;  3EQL C;  3DMU A;  5JPM C;  1A63 A;  1BCP B;  2I5H A;  2F0D A;  3FEW X;  4ALP A;  4V0B A;  2NVX B;  2M2L A;  4UPA A;  4XXE A;  5IP7 H;  4ZQ3 A;  5IT9 E;  3EN2 A;  3RZO B;  3ER0 A;  4GN4 B;  3W3A A;  3H0G B;  1AN8 A;  5IYB H;  3MC0 B;  1CQV A;  3RLF A;  3QG1 A;  2OQ0 A;  3MXP A;  3D8G A;  2UUA Q;  3L2P A;  1I4Q A;  4A3G H;  4Q0F A;  1HZB A;  3S24 A;  2VXW A;  1PRT C;  1B2T A;  3R2T A;  4DR2 L;  3CKI B;  4HCS A;  5JEA G;  3GTO H;  2NBF A;  2Z4H A;  4X66 L;  2WB1 E;  1ENA A;  2XN9 C;  3GTQ H;  2WAQ G;  1Z9F A;  3MAQ A;  3GTM H;  3A74 A;  2K5H A;  4A3M H;  5GAH C;  3RZO H;  1X3Q A;  2F3V A;  3WWV A;  3S1M H;  2UUA L;  2V1C C;  4AQY L;  3TBI B;  4I7Z C;  5JJI A;  5CV6 A;  5FLM H;  1WI5 A;  1WTV A;  3M7N A;  4LF8 L;  1YVC A;  2A69 C;  1SYD A;  4KKS A;  4JYA L;  1SE8 A;  4F8M A;  1CQF A;  2JE6 I;  1X32 A;  5G3L D;  1EFW A;  1IW7 C;  2AUJ D;  2ZT9 C;  2Y0S B;  1L0W A;  4B3R Q;  1HQR D;  1Q90 A;  2C5C A;  1V43 A;  3QOL A;  1PTO B;  4C3I G;  4QL5 A;  4IFD I;  2A6H D;  4DV6 L;  2B2U A;  1SJH D;  3HOY H;  3RMH A;  2E2I B;  2R7Z G;  1J6Q A;  2YU9 H;  3MZ5 A;  3FP9 A;  3H09 A;  3OTO Q;  3G4S A;  3NQI A;  2E2H H;  2DJG C;  3TZD A;  4AYB G;  4ZK9 B;  4QGU A;  2JA8 B;  3ERO A;  1TS3 A;  1E3P A;  1SMX A;  1ZXT A;  4LK1 C;  5KIX A;  2D0P A;  4PZ7 A;  2DY7 A;  2Z0S A;  3L7Z C;  3CME A;  1C7Y A;  2B2U C;  2VQF Q;  2NZH A;  1LTA D;  2BH8 A;  3FPU B;  4DUY L;  3J7A 5;  1K0S A;  4KD4 A;  1K8M A;  1KC8 C;  2KCM A;  3GTP B;  1SRO A;  3E6Z X;  2B2T C;  1NCV A;  3KDF A;  2D2C C;  3BZD B;  4IOA A;  4UY8 C;  5LMU L;  4LW1 A;  1IYJ B;  1JIC A;  5L37 A;  1XTD A;  3HKZ E;  5HY6 A;  3P20 A;  4A3L H;  5C0X H;  1E1O A;  4PZ6 A;  4A93 B;  4J6H A;  4FF1 A;  1JOK A;  3IFT A;  1JWM D;  1EOT A;  5ISR A;  2Z1C A;  1E22 A;  3SR1 A;  1PH6 A;  1SNP A;  2NUC A;  4JC0 A;  1D2B A;  2BDO A;  3A0J A;  4RGN A;  1DJR D;  4X65 L;  2X6L A;  5IYD G;  4A3E H;  2RDG A;  3TRE A;  2KUM A;  3EIV A;  3MA2 B;  2FMM A;  5FLX E;  2EVB A;  4WJ4 A;  4DAY B;  4DAV A;  4OO1 I;  5CV8 A;  1GHJ A;  4HJ9 A;  1WCM G;  2K04 A;  1X56 A;  1TVX A;  3E9I A;  2HD3 A;  1EY0 A;  4ZYS A;  5LMU Q;  4A3L G;  4X65 Q;  1Z47 A;  1HXY D;  2BE5 C;  1CTM A;  1E2W A;  2CH4 A;  3KOJ A;  2K50 A;  2Y0S G;  4FXK C;  3HOU B;  2F0I A;  2JP1 A;  1U4L A;  1TWA B;  5LMN Q;  3EBE A;  2AWO A;  2L12 A;  1WCM B;  2EYO A;  3I91 A;  3J81 E;  4C3J H;  5LL6 S;  2EJM A;  3NXW A;  1BDO A;  1SDF A;  4WJW A;  2QW7 A;  3NUC A;  3PO2 B;  3JC6 6;  1LYL A;  3DWQ A;  1NBW A;  4IPG A;  3ULJ A;  4JI7 L;  5C4X H;  2HHH Q;  2DNE A;  2IT1 A;  2F0L A;  1PZJ D;  3AQQ A;  1KNA A;  4CKB A;  3CXC A;  2Z6K A;  1LV9 A;  2CWA A;  3T1Y Q;  5I2X A;  3NEL A;  5E4W C;  3MTS A;  4Y7N B;  4MIU A;  1TWH B;  1E1T A;  5LL6 X;  1MD2 D;  3J81 j;  4ODG A;  2RSN A;  1JWS D;  4JI0 Q;  2K7V A;  3GDE A;  1PH7 A;  2B2V C;  2B2W A;  1KDA A;  5JVH 3;  3CF5 A;  3MXU A;  4DR5 Q;  4B3S Q;  4PZ8 A;  1R4Q B;  1XTC D;  2R92 G;  3NQT A;  2IX0 A;  2NN6 H;  3HS0 C;  4A3J G;  5M9O A;  4GKJ L;  5CV7 A;  4RFB A;  1V1P B;  1LT6 D;  5IOC A;  3BDC A;  1H95 A;  2CH4 W;  2M00 A;  1SBB B;  1SE4 A;  3CRL C;  4BY1 G;  3NTK A;  4HJ7 A;  2PMZ E;  3GTL H;  3VYT A;  4IUT A;  2PMZ B;  1QCB D;  1IBL L;  1VQM A;  2EXZ A;  1CUK A;  4N8F A;  1Q1B A;  3CCV A;  3FKI G;  2VQF L;  1QIL A;  1XMQ Q;  3OMC A;  3I4M G;  3GV3 A;  2A1A A;  1VMC A;  3D4W A;  3PUY A;  3E0E A;  4Z9C B;  3PIP 3;  2D5D A;  1EEI D;  1C9O A;  3X3M A;  3HGB A;  4BBR G;  4LWC A;  1HR0 W;  1STY A;  1DOL A;  5GQO A;  4BBS G;  2JA5 H;  5IWA Q;  2EYM A;  1STE A;  1IYU A;  3C1F A;  3KF8 B;  4J1M A;  3W5O A;  3HOX H;  4FF3 A;  3T51 B;  2UXD L;  2ZXO A;  2F4I A;  3UDX A;  4CDE C;  1KAB A;  2KHJ A;  1WTW A;  3G6J B;  4A3I B;  4RCO A;  1GKH A;  4KY5 A;  3OHX C;  3RLO A;  4CBV A;  1WTR A;  1VQA A;  2BDN A;  1GXD C;  2LXK A;  3IAY A;  2QEX A;  1K8O A;  3D6C A;  2WIN B;  3K8A A;  5JOB A;  3VA5 A;  3K5O A;  5FJ8 G;  2HUG A;  1EYC A;  3JAM L;  2E2I H;  3U58 A;  2K75 A;  4K6D A;  4YIJ A;  4GNX B;  3TRZ A;  4DR4 L;  1GUT A;  1VQE A;  3LNN A;  4JI1 Q;  4EVO A;  4ZKB B;  1JE4 A;  1DM0 B;  2ATW A;  4XYQ A;  4A3J H;  4C3H G;  2B2T A;  5IIF A;  1NTG A;  3A54 A;  3RLN A;  3I4L A;  3GV6 A;  5M5X H;  3HOW H;  2FJ2 A;  3NWS A;  2A6H C;  4IUP A;  1N8R C;  1NJI C;  3PIP A;  4TRD A;  2KEN A;  2XVS A;  2UXB Q;  1X55 A;  3I55 A;  5D3D A;  3VR2 A;  1HNZ Q;  4H13 C;  4HJA A;  1UE1 A;  1VQB A;  4UP9 A;  1T5E A;  5M3F G;  4KI0 A;  3U4V A;  3TN2 A;  4ID6 A;  4GNX C;  2O4X A;  1ZKO A;  3KF6 A;  3S14 B;  4Q5V A;  4ZKC B;  3NPP A;  5COY A;  4DK0 A;  3A8J E;  3D3R A;  2UXB L;  1U4M A;  2AQ1 B;  1BO0 A;  1X3P A;  5D3I B;  3UE1 A;  1L1O B;  5IGC A;  4GOP B;  1ILQ A;  1KAA A;  1BXT A;  3CHB D;  2L11 A;  3ICE A;  2Z9H A;  2RDF A;  2F0K A;  4JI0 L;  4XTC S;  4C3J G;  2NWG A;  5CBE E;  4K6L A;  4AYB E;  3NK9 A;  1PH2 A;  4FP5 D;  4CJ2 C;  1WTQ A;  1KNE A;  3BDO A;  4A3D H;  3HOW G;  1EIH A;  2NVQ B;  1YNX A;  1K28 A;  3TSS A;  4BY7 H;  2F4V Q;  3L3O C;  4B08 A;  3NEN A;  4A3F H;  2D62 A;  4JCV E;  4DUZ L;  4OEM B;  2JA7 B;  1IKM A;  1Y1V H;  1JB3 A;  4P2C B;  1ICW A;  1B1Z A;  5TSS A;  1GUW A;  1UE6 A;  4JBJ A;  3KLS A;  3OSO A;  1LO5 D;  4LF4 Q;  3HOY G;  2QA4 A;  4RWS C;  1LTS D;  3M4O H;  1N34 Q;  2NVT B;  4A3B G;  3J81 c;  4A3F B;  5E3F A;  1D7Q A;  1CT1 D;  5EBC A;  4QQB X;  4AYB B;  3FKI B;  4DV3 L;  4B3T Q;  1PZI D;  3OMG A;  1PH4 A;  2I0Q A;  1P8L A;  1VQF A;  2EOT A;  3G48 A;  4GOP A;  4XT1 B;  3RUZ A;  1PMR A;  2JSO A;  5C4Z A;  3PV0 A;  1V1Q A;  5KGU A;  5M5W H;  1NSN S;  1JOQ A;  1Q8I A;  3NBH A;  1ET9 A;  4KD3 A;  4S3S A;  5FLM G;  5GAE C;  3CC4 A;  2JA7 H;  1K8A C;  1VQC A;  3CCR A;  1K0R A;  2NTT A;  2NTS A;  1EWC A;  4ILW A;  2ZTD A;  3AEV A;  1WOC A;  1OO9 B;  5T1G A;  2JA6 B;  2QKI C;  1NNX A;  2O5J C;  3HKZ B;  4JI5 Q;  1NMG A;  1Y69 U;  3D31 A;  1I94 Q;  4OWX B;  3CU7 A;  2TMP A;  4X3S A;  2SDF A;  1SLJ A;  4P73 A;  3DUZ A;  1L1O C;  1PVO A;  4O1N A;  1NR4 A;  4LMQ D;  3CC2 A;  4YWK A;  1YNJ D;  3BDL A;  4JVZ A;  2NB0 A;  1G2S A;  2EIF A;  2K5V A;  1KD1 C;  2K05 A;  1J5E Q;  3H0G H;  4H7B A;  1VS0 A;  5IP7 G;  1Z6H A;  2ICI A;  1SYF A;  2EJF C;  3GQB A;  2ZM6 Q;  4OX9 Q;  2CFM A;  3ND8 A;  2DJF C;  1RCV D;  1YHA A;  3DXJ C;  3TZU A;  1I3Q B;  4PMB A;  1VQ4 A;  1JB7 A;  1EY6 A;  1BKB A;  3UDI A;  5IGF A;  4JI2 Q;  5F2D A;  4OO1 G;  1GVP A;  3VYU A;  5FO7 B;  1IHZ A;  3EJI A;  2A5H A;  2BH2 A;  2RHS B;  3A5Z B;  4JI4 L;  1BF4 A;  1R4P B;  2UU9 Q;  3PO3 G;  4HMJ A;  3BVM A;  1DZ1 A;  4K5W A;  1AZP A;  1CKO A;  1HA6 A;  5JJL A;  4A3I G;  4E6I A;  2ENB A;  1SAP A;  1PFN A;  5FLX c;  3KLR A;  2L5T A;  3GTP H;  1S5F D;  2RF4 A;  2MFI A;  4HED A;  1STB A;  4FVM A;  2RBM A;  4Y7N H;  3E3X A;  4NKL A;  5C4X G;  4KN4 C;  1WTH A;  4RA8 A;  2EYL A;  4A3M G;  1PYS B;  2FMC A;  4FO2 A;  2H5X A;  4BBR B;  3KLS X;  4APV A;  3IL8 A;  4OHJ A;  2BE5 D;  4NXM L;  1MKH A;  4IUQ A;  3D0F A;  3HG9 A;  1WTO A;  2R3Z A;  1AFP A;  3BG3 A;  3SVM A;  1E0B A;  3D4D A;  2CQO A;  3SEB A;  2E2J H;  4F88 A;  3CAM A;  3W2D A;  5CV5 A;  4TVA B;  1XNR Q;  2VQE L;  1D5M C;  1Q12 A;  2E8G A;  2O2L D;  5D65 A;  3S9W A;  4DR7 Q;  2CW0 C;  4G7H C;  2FXQ A;  3A7A B;  5EJW A;  3SK4 A;  5A2Q L;  2OWO A;  3S17 B;  1WCM H;  1WTP A;  2F0T A;  3FHW A;  4N8X 1;  3HOZ H;  2L1B A;  4C1N K;  1CZG A;  4MTN A;  2IX1 A;  1E2Z A;  4DV0 Q;  1B9N A;  4L5Q A;  4OWT B;  2SNM A;  1QG7 A;  3AYH B;  3TP6 A;  3TQY A;  4JI6 Q;  1GO3 E;  1VQI A;  3HOU H;  1PFM A;  3CCS A;  5ELE A;  2JA7 G;  2H1E A;  1CM9 A;  1KL9 A;  5DEH A;  2LS0 1;  2NYZ D;  1SYE A;  2G5D A;  4JK1 C;  2WKD A;  4LAA A;  2SNS A;  2E75 C;  2JXM B;  4DN4 M;  2NVY B;  5GAG C;  3KK7 A;  2OTJ A;  2ZXP A;  1X65 A;  1OXS C;  1SYG A;  5BN5 A;  2JA8 G;  5CC4 A;  2K5N A;  4A3B H;  1ASZ A;  1VQK A;  2B3G A;  1PH8 A;  2AWN A;  2RVL A;  3T1Y L;  5BN3 A;  3NBH B;  3DWP A;  4DNI A;  4FF4 A;  1DD2 A;  1X9N A;  1PTO D;  1HR0 L;  1XYI A;  3I8Z A;  2HCI A;  4DR1 L;  4KHP L;  3J80 E;  5IT9 L;  1FYC A;  5IOD A;  2LMC B;  3UI2 A;  4BXX H;  2RHQ B;  2CVR A;  3NTH A;  1N36 L;  2CCZ A;  4JYA Q;  4BBS H;  3S15 B;  3BS1 A;  3TP7 A;  3RNU A;  1GOZ A;  1SRU A;  1VDZ A;  2F52 A;  1OXT A;  1A3V A;  3Q23 A;  4IZ8 A;  5EGT A;  4XQJ A;  4J8Q A;  1QZG A;  2UUC L;  2AQ3 B;  4G7Z C;  4DAY A;  4LFC Q;  4OIK A;  3GP7 A;  3A7L A;  4DUY Q;  4KK7 A;  1HHV A;  4QB4 A;  4C56 C;  3I3C A;  3SGI A;  1JQY D;  1F2Y A;  5CYU A;  2F0J A;  4HJ8 A;  5C0X J;  1TII D;  2ALY B;  2F0Q A;  5D14 A;  4N9T A;  4HIM A;  2B63 H;  2KCC A;  5KNB A;  4HID A;  4JOI C;  1Q7Y C;  3VYS A;  1CKN A;  4XDX A;  3TME A;  1D1K A;  3WDN A;  4A3K G;  4QUC A;  3S1M B;  4DXG A;  3KLW A;  1MHW C;  2O5I C;  1YEZ A;  1S3O A;  3ZYY X;  4L5T A;  3T1H L;  1W6J A;  2NVQ H;  1DGS A;  1EYD A;  3S15 H;  4BBS B;  4XIG S;  3EA6 A;  1CHP D;  3JAM E;  3RR5 A;  1PLF A;  4KTA A;  1H9M A;  1N9W A;  4RKL A;  1KHI A;  1MSG A;  3BVZ A;  2FFK B;  2NN6 I;  1SNQ A;  2A73 B;  3S1N B;  1STG A;  4HAE A;  3GTK H;  3N52 A;  3GTL B;  3ULL A;  2WAQ E;  1BBW A;  5E7N A;  4DV0 L;  2Q2T A;  2XRQ D;  1U9R A;  2GN5 A;  2MO1 A;  2B2W C;  2B2V A;  4ME3 A;  2A68 D;  2JK8 A;  2LSS A;  2XIW A;  2EYH A;  3NE5 B;  5M5Y B;  4ULL A;  1VF5 C;  1C0A A;  3FMC A;  1SNC A;  5H1S E;  2NVX H;  5C44 B;  1SNO A;  1QB5 D;  4I65 A;  3PO3 H;  5I6Y A;  1E7Z A;  2YTV A;  5FO9 B;  2E74 C;  4BBR H;  4DGZ A;  4A3D G;  2EY1 A;  3LWE A;  3IRB A;  5LMN L;  1M90 C;  1H9R A;  1DOK A;  2F0P A;  2J7Z A;  2IL8 A;  3I90 A;  4HIO A;  5EKI A;  1IBK Q;  3F2U A;  3FKI H;  4KMU C;  4NP5 A;  4KJO A;  3CP0 A;  4A3E G;  5IYD H;  1S40 A;  2XWB B;  3SDZ A;  4YY3 Q;  2YU9 B;  3PF5 A;  5HGQ A;  4YCU A;  4ZAI A;  4MHE A;  3JAM c;  5C3E G;  2B63 G;  2PYK A;  2Z6K C;  3HOZ B;  3HOV G;  2SOB A;  1D5X C;  4DKA C;  1XX8 A;  4AQY Q;  3IFD A;  4K8J A;  1BCP F;  2MP1 A;  5C0X G;  4K0K L;  1K83 H;  1TXY A;  1EQQ A;  2C9O A;  1QVC A;  5M3F H;  1F9R A;  4XQQ A;  1SYC A;  2X6G A;  4ZLT F;  2QDB A;  3V96 A;  1PH5 A;  1Y1V B;  5C5L A;  5C44 H;  1JR0 D;  2LY7 A;  2EDG A;  1PH3 A;  3HZX A;  3J81 L;  3CCU A;  2L4N A;  1HUN A;  4L5R C;  1YJ9 A;  4CJ0 B;  4A76 A;  4B3S L;  3QWN A;  1PDQ A;  1DCZ A;  1IBL Q;  4QF4 A;  2UUC Q;  1XNQ L;  2FIN B;  2F03 A;  4X64 Q;  3BYT B;  4XT3 B;  2F0E A;  1OXX K;  4JI4 Q;  1WD1 A;  3X3N A;  1NE3 A;  1PZK D;  3KFU A;  5C4J B;  1HNW Q;  4O0A A;  3DEO A;  5ELO A;  1SR3 A;  4DAM A;  2WB1 G;  2EY6 A;  3H3V C;  1TS5 A;  4BWG B;  1A6X A;  1ESF A;  1BQQ T;  4R4Q A;  1SFO B;  1U5K A;  4A3M B;  3TDQ A;  3T56 B;  1BOS A;  2JA8 H;  1GHK A;  1Y1W B;  2KCN A;  1BCP C;  3RZD B;  2CHB D;  2PQA A;  1TR5 A;  2F0F A;  4R1J A;  1AE2 A;  4WJ3 M;  3BJU A;  1I50 H;  1X3G A;  1IZ6 A;  2Q2U A;  3T13 A;  2CW0 D;  3F2D A;  2UXD Q;  2K1B A;  1R9T B;  5KND A;  4EQ5 A;  1HNX L;  2AKW B;  2Z4I A;  1TS4 A;  2F3W A;  3T4A C;  3TP5 A;  3URY A;  1X3F A;  2UUB L;  4RHR A;  1JJ2 A;  4GZY C;  4PMC A;  3WOE A;  2WP8 J;  3BU2 A;  4LUZ A;  2HHH L;  5C3E B;  4DR4 Q;  5HGT A;  2IJ0 A;  3HOZ G;  3K6O A;  4GN5 A;  1STN A;  4A3G G;  1EY8 A;  2LXJ A;  1R9T H;  3KF6 B;  2ZM6 L;  1PTO C;  3RD4 A;  4PV1 C;  1HTL D;  4EGV A;  3HRZ C;  1TKW B;  1IW7 D;  3H15 A;  1G91 A;  4IN3 A;  1I4P A;  2RDH A;  5EPK A;  2R7Z B;  4IAL A;  2AHO B;  1EWI A;  1IKL A;  3GTG H;  4YY3 L;  4JI3 L;  1FNU A;  5HUR A;  4QUF A;  5I2Y A;  1AH9 A;  3A8I E;  1IBK L;  1D8L A;  5C3X A;  3MWY W;  4DR6 L;  1QZH A;  2E76 C;  4FXG C;  2DUD A;  2HDL A;  1U4P A;  2HIV A;  5IGB A;  4RHS A;  2OT2 A;  2DNC A;  1ENC A;  1YJN A;  3SHL A;  4R4C A;  1WTX A;  4GLA C;  3C2P A;  3HKS A;  2BA1 A;  1L0Y B;  4IO9 A;  1ZEQ X;  4FF2 A;  4NDX A;  1V1P A;  4KKU A;  2LKV A;  3OOC A;  5EPJ A;  3Q24 A;  2KBN A;  1Q8K A;  4K0K Q;  2GA4 B;  2NZ1 D;  3QOJ A;  2KA7 A;  1WYD A;  2CQA A;  1XMO Q;  3S1R B;  4KV6 A;  3J7A F;  2MJ8 A;  1EOV A;  1KQS A;  3J80 c;  4UP7 A;  3V05 A;  2MUY A;  1BBX C;  4LF6 Q;  1UE5 A;  2R93 G;  3M3Y H;  1PRT F;  5FKA C;  4A3K B;  4YHH Q;  3H0G G;  1HNW L;  1S5D D;  4IPD A;  2OQK A;  3L9A X;  4K2K A;  4MTK A;  5C3W A;  3S1R H;  3KJO A;  3HOX G;  3HOW B;  5EKK A;  2JA5 G;  1Y1W G;  1AP0 A;  1MJC A;  1QNU A;  5M5X B;  3NWT A;  2KHS A;  1MBY A;  4A4I A;  5ELC A;  1VQ8 A;  2OEO A;  5G3L F;  1K8G A;  2JJQ A;  3I4M H;  3Q22 A;  2A69 D;  1CHQ D;  2VZA A;  1BBU A;  1PV4 A;  2XGT A;  2F0V A;  1SE3 A;  1HNX Q;  4G57 A;  1O78 A;  1B44 D;  3M9B A;  3Q6S A;  4DV1 Q;  3I4N G;  1F2L A;  3UDG A;  1SND A;  1PXU A;  1JJG A;  1VQ7 A;  1NUC A;  5M3F B;  3R3O A;  1RF2 D;  2EYJ A;  4YWL A;  3KYH C;  3NHH A;  3JAM i;  2B2Y C;  3QIA A;  1OXU A;  1KRT A;  2PQE A;  1XPU A;  1XMQ L;  1I6H H;  4QIW E;  3NEM A;  1HR0 Q;  1FGU A;  3R93 A;  2UUB Q;  3ND9 A;  2OF1 A;  2RA4 A;  1H9S A;  3S1N H;  4F7X A;  3K7A B;  1EY9 A;  4J15 A;  2VL6 A;  4RGM A;  4X66 Q;  2VY3 A;  3F2B A;  5GAD C;  1J5E L;  4OGQ C;  1C48 A;  3DWA A;  5FLX L;  2UXC Q;  1YZ6 A;  1EQV A;  2VUM G;  3T16 A;  4RG1 A;  3K57 A;  2Z6B A;  2G9D A;  4JW0 A;  4BY7 B;  2PNH A;  1X54 A;  1MGS A;  4QJF A;  4UP8 A;  2I07 B;  1JOR A;  2K5W A;  4QY7 A;  1EIF A;  3I73 A;  4A3G B;  3HOV B;  2I5L X;  4KLK A;  1XPR A;  4TQU S;  2ES2 A;  4HN7 A;  3SK8 A;  1KRS A;  5NUC A;  3KDF B;  3FDT A;  4A3E B;  4PNY A;  3KF8 A;  1DON A;  5K5P A;  1G6P A;  4HTH A;  4DXF A;  1EWH A;  4L63 B;  1BUV T;  4QIW B;  1AEX A;  2F4V L;  5IE8 A;  1B70 B;  2ASB A;  5EPL A;  4DU9 A;  3K7U C;  5DM6 3;  1STA A;  3EVQ A;  1HUM A;  4JOI A;  4JI1 L;  3CCQ A;  4YWM A;  4CJ1 B;  1GUN A;  5DM7 3;  2N49 A;  3M7G A;  5ELN A;  1Y8P B;  3OPO A;  2DN8 A;  2F0O A;  3VYR A;  2YTX A;  4KN7 C;  3G6E A;  4BXX G;  1Y8N B;  4M1U B;  3TP8 A;  4HJ5 A;  1KDC A;  2YV5 A;  4X3U A;  3I4O A;  4X6A H;  4LUV A;  4YCV A;  2R7F A;  5C6A A;  4HMI A;  4X3T A;  1PRT B;  2JYO A;  1TY2 A;  1JMC A;  1XNR L;  1G2T A;  2RCF A;  3S1Q H;  4RH6 A;  4JI8 Q;  1I4R A;  3PIO 3;  4F87 A;  4LF6 L;  1I5F A;  3PSI A;  2IHE A;  4YHH L;  1TT2 A;  4IPH A;  3PO2 H;  4C3H H;  1I4G A;  2E5L L;  5M3M B;  5M5Y H;  1CZW A;  2EJG C;  5JJZ A;  3K58 A;  1W3S A;  4DR2 Q;  4GLX A;  2R93 B;  4JBW A;  2J0T D;  2GVA A;  1XXG A;  4RMF A;  3U9S A;  5IGD A;  4A3J B;  1LLR D;  4LUO A;  1LT3 D;  1Z7T A;  1M4V A;  2KQ3 A;  2A8V A;  4X3K A;  4V19 0;  4GKK L;  1W6K A;  3CW2 C;  2F0G A;  2F0S A;  3STB C;  4C2M B;  3I4N H;  3P75 A;  4OEL B;  1IL2 A;  1EZ8 A;  1U4R A;  3OIQ A;  3VR6 A;  3MXG A;  3GTM B;  4PQX A;  2ZJP A;  3TS2 A;  2A68 C;  4CGY B;  3HEJ A;  3CCJ A;  4N9P A;  4R4I A;  3MFG A;  4ZUJ A;  2RKS A;  4EQO A;  4A3D B;  2L0C A;  3E9H A;  5KEE A;  1Q3L A;  3H3V I;  3ONA B;  1Y1W H;  1IXR A;  1PYB A;  3K5L A;  4DV7 L;  2IX3 A;  2JEB I;  1I50 B;  4R4T A;  3CRK C;  3K59 A;  1PTO H;  4ME5 A;  4I7A A;  1SFO H;  2K4K A;  3AFQ A;  2DGY A;  2MQH A;  3I2Z A;  1VQ5 A;  4JI2 L;  4ABN A;  4O42 A;  4IUU A;  3ULP A;  1N34 L;  1KXL A;  2OCE A;  3G7L A;  3SXH A;  3D4R A;  4A93 H;  1Y8O B;  3PCO B;  5COR A;  2R7D A;  5J3B A;  1TWG H;  1KIX A;  4C3I H;  2ZTE A;  1PRT D;  5JJK A;  1LAC A;  4JPB W;  1ZYR C;  4IFD J;  4KJN A;  3PUZ A;  4DF7 A;  2A6E C;  3M4Y A;  3EFX D;  2WFW A;  1MJE A;  2E2J B;  1E2V A;  2EXD A;  4RGT A;  3S2D B;  2LFN A;  3CCL A;  1LTB D;  4EQP A;  2JA9 A;  1H9K A;  5KYI A;  2F3I A;  1LTT D;  1QWY A;  2VS1 A;  2XSC A;  1HFG A;  1LTI D;  5KRU A;  3Q8D A;  1V1O A;  4X64 L;  3S16 B;  1GUO A;  3S1Q B;  4LF9 Q;  2F1M A;  3CPW A;  4LNQ A;  4GS3 A;  2AMC B;  3A56 A;  1UE7 A;  1EIY B;  2MGS A;  3H3V H;  3BZC A;  1TS2 A;  2P5Z X;  4KHZ A;  1GM5 A;  1HFN A;  2VQE Q;  5M3M H;  2D9U A;  1A2U A;  4A93 G;  5IP9 G;  1HPC A;  1NMF A;  5IYB G;  3J80 L;  1ROD A;  1VQL A;  2RCN A;  3J7Y W;  5K36 G;  2Y0S E;  1S5C D;  3I70 A;  4BS9 A;  1O7L A;  4R9W A;  2F0W A;  3VR4 A;  4X62 L;  1EU3 A;  5EKL A;  3CMA A;  1HZA A;  3NBI A;  3GTO B;  4TKO B;  1TU2 B;  2WV6 D;  3T1H Q;  5BR8 L;  4OON A;  4A75 A;  2QEJ C;  3FPP A;  3R8B A;  2OXP A;  1RHP A;  3KBG A;  2K5D A;  2TSS A;  2YYZ A;  4K2L A;  5EAY A;  2ZJQ A;  1A0I A;  1VQO A;  4ZUI A;  3S2H H;  2K32 A;  4L6T B;  1A2T A;  1QE6 A;  4C3J B;  2PO4 A;  4A3C H;  4Y52 H;  4QCL A;  5CMD A;  3J81 i;  5IWA L;  5JEA J;  1Q81 C;  4JI3 Q;  5EBD A;  1V9P A;  4DV2 Q;  3S14 H;  3J80 i;  2PW7 A;  4RKB A;  1ONL A;  1A62 A;  1SE2 A;  1RTO A;  5I9P A;  5C5M A;  5CV9 A;  2ZXR A;  4FXD A;  3QO2 A;  2B8F A;  2VW9 A;  1IBM L;  3CQZ H;  3A5U A;  2F0N A;  5EQ0 A;  3VR3 A;  4GOP C;  1PH1 A;  3QR8 A;  4LF7 L;  4NPS A;  3HOU G;  1B8A A;  1I4H A;  4P75 A;  4HSV A;  5C4J H; 
#chains in the Genus database with same CATH homology
 1IBM Q;  4A3D H;  3BJU A;  3HOW G;  4BA2 I;  3UDF A;  3RN5 A;  1I50 H;  1X3G A;  1IZ6 A;  1YNX A;  2B29 A;  2Q2U A;  1VQ6 A;  1FL0 A;  1Y1V G;  1AE3 A;  4BY7 H;  2F4V Q;  3F2D A;  3NEN A;  1XPO A;  2UXD Q;  2YTY A;  3U50 C;  4A3F H;  4L5S A;  1HNX L;  4EQ5 A;  2D62 A;  4DPG A;  5IYC H;  4OX9 L;  2AKW B;  4POG A;  4JCV E;  3TEH B;  4DUZ L;  1K3R A;  3MEF A;  2NVY H;  1Y1V H;  2PI2 A;  4BY7 G;  1EQR A;  3I7F A;  1X3F A;  3OTO L;  2UUB L;  4AIM A;  1XMO L;  3K7A H;  4DK3 C;  1JJ2 A;  2E5L Q;  2KCT A;  1HH2 P;  1UE6 A;  1HZC A;  4JBJ A;  1PA6 A;  4X62 Q;  2WP8 J;  3BU2 A;  4B3R L;  3GTJ H;  4LF4 Q;  4LUZ A;  2HHH L;  3HOY G;  3DM3 A;  5C3E H;  1HNW L;  4DR4 Q;  2QA4 A;  1QVG A;  2R93 H;  1WFQ A;  3M4O H;  3HOZ G;  4EX5 A;  1N34 Q;  1VQD A;  1VQP A;  4GN5 A;  1TWF H;  4DR5 L;  4A3B G;  3J81 c;  2N3S A;  4GNX A;  2GVB A;  4A3G G;  1R9T H;  2LXJ A;  3PUW A;  3GD7 A;  4LF9 L;  3KF6 B;  2ZM6 L;  5IY0 A;  1D7Q A;  2EQS A;  4QQB X;  2NVT H;  3H15 A;  4NB3 A;  1Q86 C;  2JEA I;  4DV3 L;  4B3T Q;  2NZO A;  4IJH A;  3HKZ G;  4R4O A;  1PH4 A;  2AHO B;  3W1G A;  1EWI A;  1P8L A;  2I0Q A;  1VQG A;  1VQF A;  3G48 A;  4GOP A;  4YY3 L;  3K80 C;  4JI3 L;  2JA6 G;  3GTG H;  1YBY A;  2R7Z H;  1AH9 A;  2I5M X;  5FJ8 H;  4A3I H;  1IBK L;  3PV0 A;  1V1Q A;  2NN6 G;  1ASY A;  1D8L A;  5M5W H;  3BZK A;  1RL2 A;  5GAE C;  3CC4 A;  5FLM G;  4DR6 L;  1QZH A;  3K81 C;  4DV4 L;  2JA7 H;  1Q46 A;  3VDY A;  1K8A C;  4LFB L;  3I56 A;  1JJC B;  2DUD A;  1VQC A;  3CCR A;  1HNW Q;  1TWC H;  1K0R A;  2HIV A;  1YJN A;  1K73 C;  2PI2 E;  1O7I A;  1A63 A;  2I5H A;  4R4C A;  2ZTD A;  1X6O A;  1WOC A;  3AEV A;  1GD7 A;  1P16 A;  4ALP A;  4GLA C;  4P72 A;  1VQN A;  3HKS A;  4LFA L;  4UPA A;  1U0L A;  3AFP A;  2BA1 A;  4IO9 A;  4JI5 Q;  2ZTC A;  1NMG A;  5IP7 H;  3D31 A;  4MNO A;  1I94 Q;  2KBN A;  4OWX B;  1Q8K A;  2Q2H A;  3EN2 A;  3ER0 A;  3LGJ A;  4GN4 B;  1SLJ A;  4O2D A;  4P73 A;  2JA6 H;  4K0K Q;  1L1O C;  2K52 A;  1PVO A;  3CC2 A;  4YWK A;  4WJ3 M;  1WYD A;  2EIF A;  2K5V A;  1XMO Q;  5IYB H;  1KD1 C;  3RLF A;  1J5E Q;  2OQ0 A;  3H0G H;  2C35 B;  1VS0 A;  5IP7 G;  2UUA Q;  1EOV A;  3L2P A;  1KQS A;  2MNA A;  4P71 A;  3L0O A;  2ZM6 Q;  4OX9 Q;  4A3G H;  2CFM A;  3J80 c;  4UP7 A;  3S24 A;  1HZB A;  1L2F A;  3ERS X;  1YHA A;  2UXC L;  2D0O A;  4DR2 L;  1VQ4 A;  5JEA G;  1JB7 A;  4LF6 Q;  1UE5 A;  3GTO H;  4X66 L;  1BKB A;  3UDI A;  2WB1 E;  3M3Y H;  2R93 G;  3GTQ H;  2IY5 B;  2WAQ G;  4JI2 Q;  1Z9F A;  1GVP A;  3GTM H;  4OO1 G;  4YHH Q;  3H0G G;  3A74 A;  2K5H A;  4GLV B;  4DV2 L;  1I3Q H;  5GAH C;  4A3M H;  2RHS B;  4IPD A;  2BH2 A;  3A5Z B;  3RZO H;  4JI4 L;  3WWV A;  3S1M H;  2OQK A;  2V1C C;  4OXP A;  4AQY L;  2UUA L;  4LFA Q;  5JJI A;  5FLM H;  2UU9 Q;  3PO3 G;  1WI5 A;  3M7N A;  3S1R H;  4LF7 Q;  4LF8 L;  1OTC A;  3KJO A;  1CKO A;  1YVC A;  5JJL A;  2KHI A;  4A3I G;  3HOX G;  5FLX c;  4IOC A;  4JYA L;  1SE8 A;  3GTP H;  2RF4 A;  2MFI A;  2JA5 G;  2JE6 I;  1Y1W G;  4IFD G;  1EFW A;  1MJC A;  2ID0 A;  1CKM A;  4Y7N H;  1UWV A;  1L0W A;  4B3R Q;  5C4X G;  4A4I A;  1VQ8 A;  4A3M G;  1PYS B;  1V43 A;  3HFZ B;  2H5X A;  3CCE A;  1K8G A;  2JJQ A;  2OTL A;  3I4M H;  3PO2 G;  4APV A;  4QL5 A;  2VZA A;  4IFD I;  1BBU A;  4NXM L;  1PV4 A;  1MKH A;  2Q2I A;  3PIO A;  4DV6 L;  2VNU D;  2XGT A;  3D0F A;  1CSQ A;  4DK6 C;  1HNZ L;  1HNX Q;  3M9B A;  4PG3 A;  4DV1 Q;  3HOY H;  3I4N G;  2R7Z G;  3ZJY C;  1J6Q A;  2YU9 H;  4BY1 H;  2A19 A;  2CQO A;  3FP9 A;  3G4S A;  3OTO Q;  3UDG A;  1JJG A;  1VQ7 A;  2E2J H;  2E2H H;  1G29 1;  3CAM A;  5DLQ E;  4YWL A;  3KYH C;  3JAM i;  4TVA B;  4AYB G;  1OXU A;  1XNR Q;  4QGU A;  2VQE L;  1Q82 C;  1Q12 A;  2E8G A;  1KRT A;  1XPU A;  1XMQ L;  4DR7 Q;  1I6H H;  4QIW E;  3RN2 A;  1E3P A;  2FXQ A;  1FGU A;  3GO5 A;  3NEM A;  4A3F G;  1HR0 Q;  2UUB Q;  2R92 H;  1SMX A;  1VCI A;  2UXC Q;  4JI8 L;  2OWO A;  1FJG Q;  2HT1 A;  1WCM H;  3FHW A;  3HOZ H;  3S1N H;  2D0P A;  4MTN A;  4PZ7 A;  2IX1 A;  1KAW A;  2VL6 A;  2Z0S A;  3L7Z C;  4J15 A;  5IT9 c;  3CME A;  1WJJ A;  2VQF Q;  4DV0 Q;  1C7Y A;  2NZH A;  4L5Q A;  4X66 Q;  4OWT B;  2BH8 A;  3J7A 5;  2VY3 A;  3F2B A;  5GAD C;  4DUY L;  1J5E L;  4JI7 Q;  3TQY A;  3AYH B;  4JI6 Q;  2CWP A;  1GO3 E;  1VQI A;  3HOU H;  1YZ6 A;  2KCM A;  3UE0 A;  1SRO A;  1KC8 C;  4RG1 A;  2VUM G;  2BA0 A;  2IHF A;  3KDF A;  3CCS A;  2JA7 G;  3PUX A;  2N78 A;  4LFC L;  4UY8 C;  1KL9 A;  4IOA A;  4BA1 I;  1N33 L;  2PNH A;  1X54 A;  4QJF A;  5LMU L;  4UP8 A;  4LW1 A;  2UU9 L;  1IYJ B;  1YHB A;  5LMN W;  1E24 A;  4QY7 A;  1LTL A;  1XTD A;  3HKZ E;  3RZD H;  1EIF A;  4LF5 Q;  5HY6 A;  5GAG C;  4A3L H;  2I5L X;  4KLK A;  1XPR A;  4TQU S;  1E1O A;  2ES2 A;  4PZ6 A;  4LF8 Q;  2OTJ A;  1TWA H;  1X65 A;  1KRS A;  1YJW A;  1OXS C;  3KDF B;  1N33 Q;  2JA8 G;  1E22 A;  1PH6 A;  1G6P A;  5IP9 H;  2K5N A;  4JC0 A;  4A3B H;  1YIT A;  1ASZ A;  2F4V L;  3A0J A;  1VQK A;  2B3G A;  4X65 L;  1VQH A;  5M3M G;  5IYD G;  5IE8 A;  4A3E H;  1B70 B;  1PH8 A;  2ASB A;  3TRE A;  3S2D H;  3EIV A;  1HJP A;  2AWN A;  3T1Y L;  4GKK Q;  4GKJ Q;  3K7U C;  3NBH B;  4DNI A;  4JOI A;  4JI1 L;  3CCQ A;  4WJ4 A;  4DAY B;  4OO1 I;  1X9N A;  4YWM A;  1HR0 L;  3G71 A;  2N49 A;  4DR1 L;  4HJ9 A;  1WCM G;  4KHP L;  1X56 A;  2HQL A;  3E9I A;  5ELN A;  3STB D;  5LMU Q;  4A3L G;  1NY4 A;  4X65 Q;  2YTX A;  1Z47 A;  3G6E A;  4BXX G;  1PFS A;  4DV1 L;  4HJ5 A;  2YV5 A;  3KOJ A;  4BXX H;  2K50 A;  2RHQ B;  3I4O A;  4X6A H;  2Y0S G;  4LUV A;  4FDB A;  1XJV A;  4JV5 L;  4YCV A;  1N36 L;  4DV5 L;  2CCZ A;  4JYA Q;  2R7F A;  4BBS H;  1FVI A;  1CSP A;  5LMN Q;  3EBE A;  3RNU A;  1JMC A;  2AWO A;  2MO0 A;  3HOV H;  1SRU A;  1XNR L;  2F52 A;  5BR8 Q;  1OXT A;  3S1Q H;  1T9H A;  4GN3 B;  4JI8 Q;  4C3J H;  4LF6 L;  5C0X I;  1I5F A;  3PSI A;  3H3V H;  2IHE A;  4YHH L;  1QZG A;  2UUC L;  4IPH A;  4LFC Q;  3F1Z A;  3PO2 H;  4C3H H;  3JC6 6;  2E5L L;  3TS0 A;  1LYL A;  5M5Y H;  1NBW A;  4GLX A;  4DR2 Q;  1G51 A;  1W3S A;  1L1O A;  4IPG A;  4JBW A;  3ULJ A;  5C4X H;  4DUY Q;  1PH9 A;  2GVA A;  4JI7 L;  2HHH Q;  4RMF A;  2IT1 A;  4LUO A;  3AQQ A;  3SGI A;  4JBM A;  3CXC A;  2Z6K A;  1PHJ A;  4HJ8 A;  2CWA A;  1JE5 A;  5C0X J;  2A8V A;  3T1Y Q;  3S16 H;  4GKK L;  3CW2 C;  2ALY B;  3NEL A;  3STB C;  3J7Z C;  4HIM A;  2B63 H;  3I4N H;  1IL2 A;  4DV5 Q;  3W1B A;  4HID A;  1E1T A;  4JOI C;  1Q7Y C;  3J81 j;  1CKN A;  1HZ9 A;  2ZJP A;  3TS2 A;  1LM0 A;  3M85 A;  4DV6 Q;  3CCJ A;  3K0X A;  1LUZ A;  1VQ9 A;  4JI0 Q;  4IPC A;  4JG2 A;  4R4I A;  3GDE A;  4B3M L;  3OW2 A;  1PH7 A;  1QVF A;  3CD6 A;  4A3K G;  1MIU A;  3E9H A;  3CCM A;  3CF5 A;  3KLW A;  4DR5 Q;  4B3S Q;  5C44 G;  4PZ8 A;  1YI2 A;  1Y1W H;  2N8N A;  1FJG L;  3H3V I;  1IXR A;  1YEZ A;  1S3O A;  1PYB A;  1Y14 B;  2R92 G;  4DV7 L;  2IX0 A;  4L5T A;  3T1H L;  4A3J G;  2JEB I;  1S72 A;  1DGS A;  4R4T A;  1W2B A;  2NVQ H;  4P74 A;  3S15 H;  4GKJ L;  3U4Z A;  4XIG S;  3RR5 A;  1SFO H;  2K4K A;  3AFQ A;  1N9W A;  2DGY A;  2MQH A;  3I2Z A;  1KHI A;  1VQ5 A;  1Q1E A;  1K9M C;  1H95 A;  4JI2 L;  4DR3 L;  4PMW A;  2XTI A;  3ULP A;  4BY1 G;  1N34 L;  1KXL A;  4HJ7 A;  2OCE A;  2PMZ E;  3GTL H;  2NN6 I;  4A93 H;  3GTK H;  3PCO B;  1IBL L;  2R7D A;  1VQM A;  1CUK A;  5J3B A;  5AJ3 L;  3ULL A;  2WAQ E;  1Q1B A;  1M1K C;  4LF5 L;  1BBW A;  5E7N A;  1TWG H;  3FKI G;  2VQF L;  3CCV A;  1BVS A;  4DV0 L;  4C2M H;  4C3I H;  1KIX A;  1XMQ Q;  2Q2T A;  2ZTE A;  3I4M G;  3PF4 A;  4DR7 L;  5JJK A;  2GN5 A;  2A1A A;  2MO1 A;  4ME3 A;  4IFD J;  1XNQ Q;  3PUY A;  3E0E A;  2JK8 A;  2LSS A;  3PUZ A;  1C9O A;  2WFW A;  4MZ9 A;  4BBR G;  3F2C A;  4LWC A;  1MJE A;  1HR0 W;  2EXD A;  4H02 A;  5GQO A;  2JA5 H;  4BBS G;  5IWA Q;  3M4P A;  1A8V A;  5AJ3 Q;  2HIX A;  1EUJ A;  4DUZ Q;  3CCL A;  1C0A A;  3KF8 B;  5H1S E;  2JA9 A;  3W5O A;  3HOX H;  2NVX H;  3PGZ A;  5IYC G;  2UXD L;  2F3I A;  3UDX A;  2VS1 A;  3DLL A;  4NXN L;  3PO3 H;  2KHJ A;  3Q8D A;  1E7Z A;  2YTV A;  4X64 L;  4BBR H;  4LF9 Q;  1GKH A;  4A3D G;  3CPW A;  4LNQ A;  3OYY A;  1TWH H;  4GS3 A;  3RLO A;  3IRB A;  2AMC B;  5LMN L;  1UE7 A;  1M90 C;  3CPF A;  3F8T A;  1VQA A;  4HIO A;  1EIY B;  3B6Y A;  1QUQ B;  2LXK A;  1IBK Q;  3FKI H;  1EYG A;  3BZC A;  4KHZ A;  4JI6 L;  1QUQ A;  1GM5 A;  4LF4 L;  2QGQ A;  2R6G A;  3CP0 A;  5M3M H;  5GRO A;  2QEX A;  2VQE Q;  4A3E G;  1S40 A;  4YY3 Q;  4LFB Q;  3PF5 A;  3K8A A;  1CKN B;  5HGQ A;  4YCU A;  3JAM c;  5C3E G;  4DV4 Q;  2E2I H;  5FJ8 G;  5IP9 G;  2B63 G;  4A93 G;  4YCW A;  1JT8 A;  2K14 A;  2Z6K C;  3U58 A;  1NMF A;  4DV3 Q;  4B3T L;  2K75 A;  5IYB G;  3HOV G;  4DKA C;  4AQY Q;  1VQL A;  2RCN A;  4GNX B;  3TRZ A;  5K36 G;  1OXV A;  2Y0S E;  4DR4 L;  5C0X G;  1VQE A;  4K0K L;  4JI1 Q;  1K83 H;  1TXY A;  4IJL A;  4X62 L;  1EQQ A;  4NXM Q;  1RIP A;  3CMA A;  2JQO A;  1HZA A;  2ATW A;  4A3J H;  2PQA B;  5M3F H;  1QVC A;  4JV5 Q;  2L15 A;  3T1H Q;  4NXN Q;  1NTG A;  5BR8 L;  4OWW B;  4OON A;  4A75 A;  1PH5 A;  5C44 H;  3RLN A;  3MXN B;  4A3C G;  1N32 Q;  1PH3 A;  2YYZ A;  5M5X H;  3HOW H;  4A3K H;  3CCU A;  2VUM H;  5EAY A;  1N8R C;  2ZJQ A;  4L5R C;  1YJ9 A;  4POF A;  1A0I A;  1NJI C;  1VQO A;  4A76 A;  1YIJ A;  3PIP A;  4B3S L;  3S2H H;  2KEN A;  2UXB Q;  1X55 A;  3KJP A;  2UUC Q;  1XNQ L;  1SN8 A;  3I55 A;  1IBL Q;  1HNZ Q;  4A3C H;  4Y52 H;  1B7Y B;  4HJA A;  3J81 i;  4DR1 Q;  4KHP Q;  1UE1 A;  1VQB A;  4X64 Q;  1YHQ A;  4UP9 A;  5JEA J;  5IWA L;  1OXX K;  5M3F G;  2CKZ B;  4JI4 Q;  1Q81 C;  4JI3 Q;  4KI0 A;  3U4V A;  4DV7 Q;  1NE3 A;  4GNX C;  3KFU A;  5IYD H;  1V9P A;  4DV2 Q;  3KF6 A;  3S14 H;  3M4Q A;  3J80 i;  4AH6 A;  4O0A A;  3CC7 A;  4HIK A;  1I94 L;  5ELO A;  1SR3 A;  1A62 A;  2WB1 G;  4DAM A;  2UXB L;  3PUV A;  1N36 Q;  1VQJ A;  4B3M Q;  2ZJR A;  3UE1 A;  2VW9 A;  1IBM L;  3CQZ H;  1L1O B;  3A5U A;  4GOP B;  4DR6 Q;  4R4Q A;  1N32 L;  3S17 H;  3ICE A;  1U5K A;  4GOP C;  1PH1 A;  1X3E A;  4LF7 L;  4NPS A;  4JBK A;  1UEB A;  4JI0 L;  4XTC S;  4JI5 L;  3HOU G;  1B8A A;  4DR3 Q;  2JA8 H;  4P75 A;  4AYB E;  1PH2 A;  2PQA A;  4R1J A;  1AE2 A;  5C4J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...