4DV5Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv5Q00
1E7ZA 1WFQA 2NZHA 2UXBL 3S1RH 1MKHA 3PUZA 4A3JG 4GKKL 1KQSA 3DM3A 4AQYL 3HOUH 1PFSA 2EIFA 2JE6I 4R1JA 3F1ZA 3W1GA 4JI6L 2Z6KC 4L5TA 5AJ3Q 1JE5A 1K83H 2WB1G 4UPAA 4A3EH 4C2MH 5LMUL 2WB1E 1Y1WH 1JMCA 2D62A 3HOUG 3JAMc 2E5LQ 4UY8C 4GKJL 4HJAA 1Y1WG 3MXNB 4LF7L 1NY4A 3GTGH 1X56A 4PZ7A 4C3IH 3PGZA 1L2FA 3H0GG 4B3SQ 1Y1VG 2F3IA 4OO1I 3L0OA 4QY7A 4B3ML 2OCEA 4KI0A 2NVTH 1CKNA 3E9HA 3L7ZC 3PV0A 4IJHA 4JOIC 4P73A 1H95A 3CCJA 3UDXA 4DV1Q 1L1OB 2VUMH 4LF5L 4JCVE 4DR2L 4DNIA 4YY3Q 3BU2A 4BA2I 3BJUA 3BZCA 4R4TA 3VDYA 1K9MC 5IYDG 1IZ6A 4YWKA 4QIWE 4DR5L 3UDGA 2JA5H 3I7FA 3M7NA 2IHFA 1BBUA 1AE3A 1D7QA 3ULJA 2UU9Q 1KRTA 4GLXA 4A3KH 4R4QA 4IO9A 2R7ZG 4A3IG 1VQFA 2MFIA 1PA6A 4J15A 1BKBA 2D0PA 1K8GA 1VQPA 3T1YQ 3KOJA 4JI0L 3EIVA 2KCTA 1O7IA 3PUVA 1SMXA 3OTOQ 2DUDA 1W2BA 3S16H 1JJGA 2I5HA 4OWTB 3OYYA 4QL5A 3S15H 4TVAB 1VS0A 4PMWA 3HKSA 4DR1L 2JEAI 2B63H 4OXPA 3HOWH 5GAEC 4R4IA 4LF8L 4IOAA 3M3YH 4RG1A 4GOPB 2IY5B 4DR5Q 2HT1A 3CAMA 3CXCA 4DR7L 3S17H 3F2CA 2MO0A 4DUYL 2RCNA 2VS1A 5C4XG 4L5QA 1CKMA 4JG2A 3I55A 4DV7Q 1QVFA 3PCOB 4JYAL 5C4XH 2NN6G 2IX0A 5C3EH 4MTNA 2K52A 2RHQB 3S14H 1PHJA 1XNQL 5C0XJ 2JQOA 4ALPA 4X66Q 3D31A 3AFQA 4A3GG 3M85A 5HY6A 4KLKA 1YHQA 1VQ6A 4IFDJ 2E5LL 1XNRL 1YHAA 4JI3Q 2AKWB 2V1CC 1IBKQ 2VY3A 4LF6Q 4DAMA 2HQLA 5FJ8G 1A62A 4DAYB 2VNUD 1OXXK 4LF9L 3F2BA 3CD6A 3S1QH 3CCQA 1E24A 5DLQE 1UWVA 2PQAB 4A3DH 4GKKQ 2R7DA 5IP9H 4A3BH 1U0LA 3A0JA 1T9HA 1LM0A 1Q86C 3PO2H 4DR6Q 4LF7Q 3SGIA 3U50C 1IBLL 1ASZA 3GTQH 4GKJQ 1WOCA 3RLNA 5C4JH 3AEVA 2OQ0A 2K5VA 5J3BA 4FDBA 4LF4L 1FJGL 4A3LH 1EQQA 4HJ5A 4A93G 2LSSA 1TWHH 3G4SA 5JEAJ 4GN5A 1EYGA 2UU9L 2LXKA 1WI5A 3UE1A 1OTCA 3PO3H 3Q8DA 4BXXH 2CCZA 1VQIA 1I3QH 2N3SA 4HJ9A 4BBRH 1UE5A 4JI7L 4OWXB 2WAQE 1TWGH 4NB3A 3J81c 2YV5A 1G291 1Q46A 3ER0A 3I2ZA 4O2DA 1PH5A 1XNQQ 1YEZA 1PH7A 1PVOA 3H15A 3PF5A 3CMEA 1VQEA 3W5OA 1N34L 4AYBE 4B3SL 4DV4Q 4B3TQ 1QZGA 1IL2A 4DK6C 1N36Q 2HIXA 1CKNB 5EAYA 2ZJQA 2IT1A 2Z6KA 4JI5Q 2JA6H 3I4MG 4DR7Q 2B63G 4B3RL 1U5KA 4LFBL 3TRZA 4NXNL 4LFAQ 1SLJA 2KCMA 3UE0A 1I94Q 3BZKA 2JEBI 3T1HQ 2MO1A 1Z9FA 4X62L 1VQAA 2PI2E 4IFDI 1V43A 4JI1L 1Q12A 3G6EA 2R93G 2WFWA 4YCWA 1FJGQ 2R7FA 3M4OH 4QGUA 3E0EA 3KYHC 4YWLA 1PH6A 1VQBA 4AH6A 3GDEA 4YCVA 1Q8KA 4P75A 1AH9A 3FP9A 1TWCH 4JI4L 2ZTEA 3NELA 5M3MH 2ID0A 1VQDA 2MNAA 3KFUA 1L1OC 4DV2L 2NVYH 1NE3A 1FGUA 3L2PA 2XGTA 2NZOA 2UUAQ 1SR3A 1N9WA 2BH8A 1WCMH 2JJQA 4A3CH 3I4OA 1L1OA 3FHWA 2Q2IA 3K7AH 5M3FG 3STBC 4BY7H 2PI2A 2Q2TA 2F4VQ 3TREA 3KLWA 2F52A 3IRBA 5GROA 4HIOA 1J5EQ 1VQKA 1GVPA 1NMGA 1E3PA 2VQFL 1K8AC 1VQ5A 5GAGC 2YTVA 2VQFQ 1D8LA 1MIUA 3CC4A 1XNRQ 2JA8G 3S24A 1Q1BA 3S1MH 1NBWA 3K81C 1PYSB 1BVSA 2VL6A 4X66L 3U58A 1HZBA 1KD1C 4A4IA 2UXCL 4DV5Q 2E2HH 2K5NA 2WAQG 2QEXA 2D0OA 5H1SE 1SFOH 1VQ7A 1LTLA 4JI8L 2HHHL 1VQMA 2AHOB 4PZ6A 1A0IA 1HNXL 1P8LA 2XTIA 4DV7L 1Q81C 1HNZQ 2E2IH 2UUCL 2QA4A 1PV4A 4BA1I 4DV3Q 1XJVA 2MQHA 2K14A 3CC2A 2NVQH 3RN2A 1OXUA 3GO5A 4YY3L 3PUWA 1VCIA 2BH2A 5IYBH 1HNWL 4DR4Q 1VQOA 3PO3G 4DV1L 1PH3A 1VQ8A 1EOVA 4A3BG 4OX9L 1TWAH 4JI1Q 3J7A5 1UE6A 3G48A 1KXLA 2Z0SA 3CCLA 1C9OA 4A3JH 3KF8B 4L5RC 1X3FA 1PH9A 2OTLA 1YVCA 3F8TA 4A3KG 3HOYH 3CCRA 4DR4L 4JBJA 4A3MG 1N32Q 1A8VA 3CMAA 1VQ9A 1CUKA 1JB7A 1QUQB 4YCUA 3HKZE 2UUCQ 3ICEA 5JJKA 1HZCA 3J80i 3GTJH 1WJJA 5GADC 4R4OA 3F2DA 1YZ6A 3S1NH 1W3SA 1YHBA 3CCUA 2YU9H 1B7YB 4X6AH 1KAWA 4YWMA 3HOXH 4DV6L 3PSIA 1TXYA 5IT9c 4A75A 1VQNA 4DR1Q 1Q1EA 2UUBL 4JV5L 4JI4Q 1Y1VH 3HOXG 1FVIA 4A3IH 2RF4A 3CP0A 4PG3A 4APVA 3S2HH 1VQHA 2VUMG 4X64L 3J7ZC 3ERSX 3GTPH 1SN8A 1QZHA 5M5XH 2AMCB 1HNWQ 1CKOA 2R6GA 1HZ9A 2F4VL 5ELOA 1YJNA 3E9IA 4P74A 1QVCA 4POGA 2VW9A 1KIXA 3I4NH 1LUZA 1IBLQ 4LNQA 1JJ2A 3A5ZB 3PUYA 3HFZB 1PYBA 2BA1A 3WWVA 5FLXc 3HOZG 5LMUQ 2GN5A 5M5WH 4DV0Q 3NEMA 4XIGS 2E8GA 3FKIG 3GD7A 4JBWA 4JI2L 4IPCA 4A76A 4LF9Q 1I6HH 1HZAA 4Y52H 2AWNA 3U4VA 5GAHC 1NTGA 4X62Q 4DUZL 1QUQA 2KHJA 1WCMG 1KC8C 2ZJRA 1J5EL 2E2JH 4A3CG 2JA9A 1PH2A 1YI2A 2ZTCA 2EQSA 3EN2A 1EIYB 1S3OA 3CC7A 1YNXA 2KHIA 4AIMA 1PH4A 3PUXA 4TQUS 1GO3E 1N8RC 2UXDQ 4X65L 3TS0A 3RNUA 3J81i 3DLLA 4KHPQ 5FJ8H 4PZ8A 3RZDH 4YHHQ 5IYBG 4A3FH 1SRUA 4LW1A 4LF4Q 1E1TA 3ULLA 1M1KC 4A3LG 3AFPA 3T1YL 5BR8Q 1YITA 2K50A 5BR8L 4IOCA 2L15A 3NENA 4DUYQ 1Q82C 4HJ8A 2UXBQ 4BY1G 1CSPA 3GTKH 1DGSA 5JEAG 1IBMQ 1TWFH 2A8VA 2ZM6Q 3H3VH 2N8NA 4EQ5A 1S40A 3CF5A 5IYDH 1X6OA 3OW2A 4BBSG 1J6QA 4IPGA 1IYJB 3I56A 2A19A 4UP9A 1YJWA 2ZTDA 4A3MH 1E22A 1X65A 5C44H 4B3RQ 5C0XG 4LF6L 3KJPA 1IBKL 1N33Q 3K80C 1ASYA 1X55A 5GQOA 1BBWA 4LFCL 1G51A 2JA7H 4DR3L 3PIPA 2DGYA 1KL9A 1L0WA 5C0XI 1UE7A 4H02A 3TEHB 4HIMA 3EBEA 4NXMQ 3KDFB 4XTCS 4GN4B 5C44G 4B3MQ 4DR6L 4WJ3M 4GN3B 4GS3A 2ES2A 1MJCA 1I5FA 1V9PA 3HOVH 1EIFA 2JA7G 2OWOA 3STBD 2JA5G 3H0GH 4WJ4A 3HOVG 4JBKA 3RLFA 2NN6I 5HGQA 2ATWA 3S2DH 4JC0A 3ZJYC 1K3RA 4GOPA 3PIOA 4A93H 5FLMG 3GTMH 4DV4L 1NMFA 1P16A 2JK8A 3M4QA 4JI3L 3UDIA 3RLOA 3KJOA 3CW2C 4GNXC 3G71A 4DR2Q 4LF5Q 3I4MH 1PH1A 1OXTA 2CKZB 2R7ZH 3I4NG 2B3GA 1GKHA 4JI2Q 2B29A 4GNXA 2I5MX 1HR0L 4IJLA 2Q2UA 1C7YA 1Q7YC 4GNXB 4DV2Q 4C3HH 3D0FA 2CWAA 2R93H 4C3JH 4LUZA 4NXML 1K0RA 4KHZA 3M4PA 3K0XA 3OTOL 1X3EA 5M3FH 3FKIH 1EWIA 1HH2P 1K73C 2Y0SE 2NVXH 1JT8A 4X65Q 5LMNL 2A1AA 4NPSA 3KF6B 3CCVA 1XPUA 3HOZH 4QQBX 4HIDA 5IY0A 4AYBG 4AQYQ 3U4ZA 3KF6A 2VQEQ 1NJIC 2CQOA 1I94L 2UUAL 4GLAC 4IPHA 4BY7G 4A3DG 2OQKA 2PQAA 5M5YH 1XPOA 4JV5Q 5IP9G 5IYCH 4R4CA 1KHIA 4QJFA 3UDFA 1V1QA 2HIVA 1SE8A 4A3FG 4L5SA 2PNHA 4IFDG 4OX9Q 1SROA 1M90C 1KRSA 4YHHL 4O0AA 2I0QA 3CPFA 4KHPL 4DV0L 4HJ7A 5JJIA 5ELNA 3AQQA 1N33L 3JC66 4DV3L 2WP8J 4GLVB 1HJPA 5E7NA 1XMOL 4LWCA 1CSQA 4DK3C 4BBRG 3HKZG 5IWAL 1X3GA 2YTYA 3CQZH 1N36L 2ASBA 4OO1G 3CCEA 2UXCQ 1VQCA 2ALYB 4HIKA 2IX1A 1N34Q 1IXRA 3A74A 4P72A 1XMQQ 4K0KL 3JAMi 3RN5A 2FXQA 2BA0A 2GVBA 4P71A 4LFCQ 1XPRA 3H3VI 4JOIA 3J81j 1Y14B 3M9BA 1HR0W 2I5LX 3RR5A 1WYDA 2K75A 3LGJA 1VQJA 5LMNW 3GTLH 4BXXG 4DV6Q 1HNXQ 3RZOH 4A3EG 3PO2G 4LUVA 4LF8Q 3W1BA 5IE8A 1EUJA 2HHHQ 2VZAA 3HOYG 1X54A 1MJEA 5LMNQ 1UEBA 1VQGA 5AJ3L 1IBML 3ULPA 1I50H 4A3GH 4DUZQ 1Z47A 4X64Q 2EXDA 3TQYA 4UP7A 1VQ4A 2K4KA 3CCMA 1FL0A 1XMQL 4K0KQ 1R9TH 5K36G 1B70B 2AWOA 4ME3A 2Q2HA 2UXDL 1GD7A 4GOPC 5FLMH 1HR0Q 2JA6G 2H5XA 5JJLA 2R92H 5IWAQ 4DPGA 2KENA 4LFAL 1JJCB 2RHSB 3CPWA 2OTJA 1EFWA 3GTOH 2K5HA 1OXVA 2C35B 2CFMA 2KBNA 3K8AA 4JI5L 1YIJA 2R92G 4LUOA 1EQRA 2Y0SG 1N32L 3MEFA 1A63A 2N49A 1HNZL 3PF4A 4OONA 2GVAA 5IYCG 3A5UA 2N78A 1AE2A 2QGQA 4MNOA 1PH8A 3CCSA 5IP7H 1B8AA 4JI8Q 2JA8H 1UE1A 1RIPA 4B3TL 1S72A 4IPDA 1RL2A 3T1HL 1YJ9A 4JYAQ 2IHEA 3HOWG 4Y7NH 4JBMA 1X9NA 2ZJPA 4JI0Q 2VQEL 1XMOQ 4JI7Q 5C3EG 4NXNQ 4DR3Q 4LFBQ 2YYZA 5IP7G 1OXSC 4OWWB 2CWPA 3NBHB 1YBYA 3K7UC 3KDFA 4RMFA 1E1OA 4MZ9A 1XTDA 1LYLA 3AYHB 1QVGA 4EX5A 1GM5A 4JI6Q 1VQLA 4BY1H 3TS2A 2YTXA 4DKAC 5M3MG 4POFA 4UP8A 2LXJA 2ZM6L 1C0AA 4DV5L 3B6YA 2PMZE 1G6PA 4BBSH 2UUBQ 3J80c
chains in the Genus database with same CATH superfamily
2UXBL 4GKKL 1CFMA 1VF5C 3HOUH 3WOEA 3FPUB 4NKLA 4R1JA 3W1GA 1DCZA 2X6LA 5AFWA 2PYKA 1F2MA 4E6IA 2WB1G 4UPAA 1Y1WH 5LMUL 2XVSA 2D62A 5KYIA 2E5LQ 1IYVA 1STHA 3MXNB 1Y1WG 1BF4A 1EEFD 1X56A 4PZ7A 5C3WA 3R3OA 1H95A 3E9HA 4JOIC 1S5BD 4A3GB 4LF5L 4JCVE 1H9KA 4DNIA 4RKLA 3FEWX 4CDEC 4YY3Q 3BU2A 3BJUA 4R4TA 3V96A 1K9MC 2JA5B 4RKBA 3M7NA 2A6HC 2SOBA 2IHFA 3K6OA 1W6KA 5JVH3 2EVBA 3O13A 1VQFA 4KY5A 4A3IG 3I90A 2F0QA 2D0PA 3KOJA 2KCTA 3PUVA 3OTOQ 3HOVB 1W2BA 4RGTA 3OYYA 4G57A 3S15H 4DR1L 1CK1A 4OXPA 4R4IA 4LF8L 3M3YH 4GOPB 4DR5Q 1PFBA 2HT1A 4DR7L 2E2DC 1H9RA 1MGSA 4BS9A 2MO0A 4KHVA 4DUYL 2RCNA 1HQMC 4IUQA 5C4XG 4X3TA 4DV7Q 4R8NA 5C4XH 3BDLA 5IT9L 2IX0A 1V1PB 4MTNA 3BDCA 4X66Q 2NN6H 3DWQA 2J0TD 1XYIA 3M85A 4KLKA 3U9OA 1VQ6A 4FF1A 1YHAA 2F0HA 5DM73 2NVYB 1RKNA 5FJ8G 3OHXC 5EPKA 5M9OA 4IURA 1CHPD 3F2BA 2P5ZX 1TY0A 1UWVA 2R7DA 3OMCA 1H9JA 1Q86C 1LM0A 5IGCA 5F2DA 4LF7Q 3SGIA 1IBLL 3P1HA 3GTJB 3DWAA 4XT1B 3AEVA 5D3IB 4LF4L 2PW7A 3NHHA 3G4SA 5JEAJ 4KY6A 1I4RA 5E3FA 2CCZA 1BXTA 2YV5A 4PNYA 1PVOA 1WTVA 3S9WA 1EZ6A 2A6ED 1H9MA 1CA5A 2EE1A 3MZ5A 1S5FD 1SNMA 1IL2A 3DWPA 2IT1A 4B3RL 1TWHB 1U5KA 3I91A 4KJOA 3TN2A 4LFAQ 1TWFB 3BZKA 2JEBI 4TKOB 4DAVA 3T1HQ 4CBVA 4KMUC 4X62L 2PI2E 1RCVD 1V43A 1VMCA 1KNAA 2JP1A 4QGUA 1Q8IA 1ICWA 1PTOD 1AH9A 3FP9A 2PMZB 2ID0A 4G7OC 2MNAA 1L1OC 2EYMA 2XGTA 3VYSA 1L0YB 4BY7H 2Z9HA 1BBXC 2PI2A 2F4VQ 2F52A 1U4RA 4HIOA 1S5ED 1GVPA 3BG3A 3NWTA 2YTVA 1PFNA 1QNUA 2JA8G 4RHSA 3S1MB 5EPJA 3K81C 4FF2A 2NZ1D 2UXCL 1ZEQX 2WAQG 1BCPD 1GHKA 3A54A 4FP5D 4O42A 2AHOB 2K5WA 2QILA 3OSOA 1GUWA 3CRKC 2UUCL 1E0BA 1YNND 1VCIA 2HCCA 1HNWL 1CQVA 3TP5A 3J7AV 1JOQA 2D9UA 4JI1Q 4CKEA 1DD2A 2OTLA 3F8TA 3NTKA 4DR4L 4U673 5I2XA 3CMAA 2QDLA 3I4NB 1QUQB 4CJ0B 3S1NH 3F2DA 3A56A 1W3SA 4UAIA 1B7YB 3PSIA 1TXYA 4A75A 4DR1Q 1UNSA 2EY2A 2BE5C 5DAUA 4PG3A 3AB9A 4APVA 4C3HG 2VUMG 2LKVA 2Z4HA 3LNNA 3J7ZC 1CKOA 1HZ9A 2SNMA 4P74A 5J1ZA 3P20A 1SXTA 1LUZA 5C4HA 3HFZB 2BA1A 3WWVA 5NUCA 2GN5A 2E8GA 1K8MA 4JBWA 4JI2L 1HZAA 4Y52H 4PMCA 5EBDA 5ELCA 1NTGA 3CQZB 4A3CG 2ZJRA 1JWSD 1EYAA 2JA9A 1MBYA 2ZTCA 3EN2A 2F0PA 4AIMA 4UHVA 4TQUS 4Q0FA 1SMYC 5IOCA 3J81i 3RZDH 2PCFB 1SRUA 4LW1A 4ZCKA 5FO9B 5BR8Q 1YITA 2K50A 3S14B 2UXBQ 3GTKH 1X6OA 4IPGA 4UP9A 2ZTDA 1N33Q 4S3SA 2EDGA 1X55A 2CQAA 1BBWA 1EY0A 4C1NI 1G51A 2DGYA 1UE7A 3S2HB 3KDFB 1D1IA 4GN4B 5C44G 5I6YA 4GS3A 2K03A 3TP8A 3Q0AA 5C44B 2OWOA 4QUCA 2ZT9C 1SEBD 2Q8IB 4CHTB 1K3RA 2F0SA 4A93H 5LHY1 1X3QA 2CW0C 3S1NB 2JK8A 4GNXC 4DR2Q 1PH1A 2CKZB 4L6TB 4DK1A 4L63B 4GNXA 4QUFA 4OL7A 4GNXB 2CWAA 2R93H 4RGOS 4LUZA 1HRJA 4OELB 3K0XA 5M3FH 4ZUJA 2FMCA 3AU7A 4B9XA 1K73C 1F9PA 2NVXH 3HZXA 1O7YA 5LMNL 2VXWA 1F9SA 4IUPA 1I94L 5IY0A 1NJIC 1TU2B 1I4PA 4IPHA 1GUSA 4HN7A 5C3EB 2PZTA 5IP9G 1E2VA 5E1FA 2WINB 1KHIA 1V1QA 4A3FG 3LWUA 4CDFC 4IFDG 1EOTA 2V4DA 2FFKB 3CPFA 1X32A 4DV0L 4KKSA 4DV3L 4PQXA 5M5XB 2DNCA 4BY7B 1CSQA 3BVZA 5IWAL 4OO1G 2RDFA 1EZ8A 3CCEA 1SNDA 2ALYB 5EPLA 3M4OB 1IL8A 1IXRA 3A74A 3EA6A 3FKIB 1N34Q 3JAMi 1I50B 3OWFA 1U4PA 2GVBA 2L5TA 4P71A 2FINB 5C4ZA 3C1FA 1XPRA 4OIJA 1VQJA 1PTOH 1NCVA 2NBFA 5LMNW 2MGSA 4DV6Q 1HNXQ 4C56C 4A3EG 2D2CC 4LF8Q 3HOYG 1EUJA 2HHHQ 1RTNA 2VZAA 3D8GA 4OEMB 1SSOA 1EIGA 1KNEA 2X69A 4A3GH 3EJIA 1HTLD 2LS01 4RAUC 4V190 1EL0A 2K4KA 1XMQL 4K0KQ 1F9QA 2UXDL 2EY5A 3CU7A 1KLUD 5EBCA 2JA6G 5JJLA 1VMPA 2CH4A 4DPGA 3NTHA 2JXMB 2KQ3A 1HA5A 1K3BC 1EFWA 5COYA 2C35B 2R92G 1LT3D 1FNVA 1EQRA 1O7LA 1K83B 4L8JA 3GTKB 1GXDC 1B1ZA 3V05A 1HNZL 3PF4A 2JA8H 1AE2A 4DA2A 1PH8A 4BBSB 2IJ0A 3CCSA 1B8AA 1S72A 4IPDA 5EKKA 2O2LD 1RD9D 2RKSA 3HOWG 1ET9A 1OXSC 4OWWB 1J8IA 2CWPA 3K7UC 1E1OA 4MZ9A 3R8BA 1VQLA 1HCZA 3TS2A 1T5XD 2YTXA 2WACA 3HEJA 1SNQA 2ZM6L 3MXPA 2CQOA 2NZHA 1STGA 1KQSA 3DM3A 2JE6I 2Z6KC 2A74C 1JE5A 1K83H 1SNCA 1MD2D 3JAMc 2BE5D 4YIJA 4GKJL 4HJAA 4EQPA 2QKIC 3D3RA 1MSGA 1G91A 1NY4A 3PGZA 1L2FA 2LY7A 5CORA 4B3SQ 2F3IA 4OO1I 4XYOA 4QY7A 1WTOA 2NVTH 4IJHA 4X3KA 3IFTA 3PMFA 1Z6HA 5IGEA 2XRQD 2PNRC 1T5EA 4BA2I 3VDYA 2YU9B 4HMJA 4YWKA 3W2DA 1D7QA 3ULJA 1KRTA 4A3KH 3GV3A 4IN3A 2O5JC 1ESFA 4WRDA 4J15A 1BKBA 2WIIB 3T1YQ 1O7IA 1SE4A 4ZRZA 1JJGA 1K28A 3J80E 2I5HA 4OWTB 1AFPA 4PMWA 1SE2A 4RA8A 2JEAI 1TWAB 2B2WA 2B63H 3HOWH 2NVQB 3NSWA 4FXDA 2IY5B 3CAMA 3CXCA 3F2CA 2FHTA 1CKMA 2DY7A 4JG2A 4ODGA 4KTAA 3S1RB 1XTCD 3T56B 5CMDA 3C46A 3PO2B 1QE6A 2N55A 2SDFA 2RHQB 1XNQL 1HUMA 4G7HC 3DHQA 3SVMA 5HY6A 1YHQA 3C1EA 4IUNA 4EGVA 1EU4A 1TT2A 1E2ZA 1A62A 2NTTA 2VNUD 2NVXB 1OXXK 4C3IG 2ZXRA 2EY6A 2F0NA 1G2SA 1M8AA 1PMRA 5KNBA 1NNXA 1U0LA 4F7XA 5G3LD 4GKJQ 1WOCA 5EQ0A 5C4JH 2OQ0A 2K5VA 2MJ8A 3L9AX 2Q8RE 4WJWA 1WI5A 4BXXH 1R4QB 2AQ1B 1NR2A 1STBA 1BDOA 1TWGH 1WCMB 3OIPA 4RH6A 2NVTB 3ER0A 1PH5A 4O2DA 3MXGA 1YEZA 5DNFA 3H15A 3FMCA 1QCBD 4HMIA 2PO4A 3CMEA 3HP3A 4C3IB 1I3QB 4EQOA 4DV4Q 1CKNB 2ICEC 2Z6KA 1A2UA 3I4MG 1A3TA 4KKTA 3TRZA 1G8ZD 1Y1WB 1WVLA 3QG1A 5CC4A 4KN4C 2L55A 2F0TA 2XWJB 2R7FA 3MXUA 1ZYRC 4AH6A 1HQRD 3GDEA 1Q8KA 4P75A 2QEJC 2ZTEA 5JOBA 2SNSA 5M3MH 4HSVA 1Q3LA 5I2YA 4DV2L 2NVYH 1FGUA 2TMPA 2UUAQ 1SR3A 3I4OA 1WD0A 1L1OA 3FHWA 3I70A 3STBC 2KOLA 3ERQA 3IRBA 3MC0B 5C4XB 1VQ5A 2VQFQ 4KV6A 1D8LA 4Z9CB 3QOLA 2VL6A 1BVSA 4X66L 1KD1C 1HZBA 3IKJA 2KCNA 2K5NA 1VQ7A 2HHHL 2JSOA 4JK1C 3HOZB 1A0IA 1HNXL 4XDXA 4DV7L 2E2IH 3GV6A 4BA1I 4DV3Q 3CC2A 1D2BA 4DF7A 3RN2A 3SEBA 4OO1H 2BH2A 2F0DA 4DR4Q 4DV1L 2L0CA 1TWAH 3GQBA 4RCOA 3J7A5 3T16A 4MTKA 3G48A 4G7ZC 3CCLA 3J81E 4K6LA 4A3JH 2RBMA 3QWNA 3KF8B 1AEXA 1X3FA 3K57A 4A3KG 1N32Q 1JOOA 1CUKA 4YCUA 1S5DD 2UUCQ 3VR3A 3GTJH 3W3AA 4R4OA 5CV7A 3GTMB 2YU9H 3CCUA 1KDBA 4YWMA 2UUBL 2RVLA 4A3IH 1BCPB 3E0JA 2AQ3B 3MVVA 3VYUA 2RF4A 4J6HA 1SN8A 1A3VA 5LL6S 1HNWQ 1PTOF 2F4VL 5ELOA 1YJNA 3E9IA 1GUOA 4DAPA 3HOXB 2VW9A 3TMEA 1J9OA 3N52A 1KIXA 1C48A 1JJ2A 2RSNA 3RD4A 1EWCA 2Z1CA 1HPCA 5LMUQ 2E2HB 4XIGS 4AYBB 3KLSX 5M5YB 4A76A 4LF9Q 2F0LA 4C3JG 2F0MA 4CDDC 4K6DA 5GAHC 4X62Q 1LT6D 1WCMG 1LT5D 4CJ2C 4RHRA 1PH2A 3IL8A 1H9SA 1EIYB 2BDOA 3RMHA 2KHIA 3K59A 5KNDA 1GO3E 1TR5A 3G6JB 1N8RC 4X65L 3FDTA 4KHPQ 4QCLA 5FJ8H 1TWCB 4IUTA 3SK4A 4LF4Q 1E1TA 4A3LG 5BR8L 2L15A 3NENA 1QNKA 2DN8A 1BO0A 1DGSA 5IGBA 1ILQA 1GHJA 1S40A 1STNA 3CF5A 4BBSG 5G3LF 4V0BA 3VR4A 1X65A 5C44H 4B3RQ 5C0XG 3JAML 1F9RA 2L12A 3E5SA 2KEEA 4DAYA 2R92B 5C0XH 4DR3L 3PIPA 1L0WA 3TEHB 3EBEA 4B3MQ 1MJCA 1I5FA 2KECA 1EIFA 4HAEA 2JA7G 1SAPA 3H0GH 1SYBA 2ATWA 3S2DH 4GOPA 2ZXOA 2X6GA 3GTMH 1NMFA 1P16A 3UDIA 2DJGC 4XT3B 3WDNA 3G71A 1SDFA 5HURA 2R7ZH 3I4NG 1JB3A 4JI2Q 3HOYB 3N6RA 2MHVA 1Q7YC 1C7YA 4DV2Q 4C3HH 1V1PA 4FXKC 2EYLA 3M4PA 3OTOL 3FKIH 4IALA 5FO8B 4WFN3 3PQIA 3QR8A 3NQIA 1TS4A 3BYYB 2Y0SE 1A6XA 1JT8A 5EGTA 1PFMA 3NBIA 1AP0A 3NE5B 2A1AA 2HDMA 3OMGA 3KF6B 3CCVA 2H4OA 4QQBX 2EY1A 4AQYQ 2UUAL 3KF6A 2VQEQ 2RCFA 4GLAC 4BY7G 2H1EA 4ILWA 1DXMA 5FOBB 3MHBA 1PRTF 4QJFA 1FR3A 2B8FA 2HIVA 4ZUIA 3K5LA 4L5SA 2BOSA 1O78A 2PNHA 2TSSA 1ZXTA 3KBXA 4DXGA 4DU9A 4ZKCB 4KHPL 4HJ7A 5ELNA 3S17B 3CHBD 2N88A 3JC66 4H7BA 2WP8J 4DNTB 3S1QB 3I8ZA 5E7NA 1XMOL 3F2UA 3UI2A 2F0GA 1EY6A 4BBRG 4DK3C 3NBHA 2ASBA 3SHLA 2KEDA 4P72A 2K33A 1FYCA 2Z6BA 3M9BA 4HCEA 3VA7A 3RR5A 3LGJA 2Z4IA 3NUCA 4BXXG 2EZVA 4ME5A 4LUVA 2JA6B 2K5DA 3ULPA 2A69C 1KLGD 4UP7A 4CGYB 3HOWB 4OGQC 1F2LA 3CCMA 2HCIA 5K36G 1B70B 1EY9A 2Q2HA 3S16B 3D4DA 1GD7A 1HR0Q 3X3NA 2H5XA 3J7AF 1AZQA 4LFAL 1RODA 2HQEA 2RHSB 3CPWA 1PDQA 4BBRB 1QILA 3GTOH 2K5HA 4CDCC 1O80A 2Y0SG 1YNJC 1N32L 2N49A 2IW3A 2WKCA 2N78A 3S2DB 4QB4A 5IP7H 4JI8Q 1UE1A 4MIUA 3T1HL 4N8FA 5KYLA 1X9NA 1XMOQ 2EYPA 2E75C 5IGFA 3A7LA 2EYFA 3NBHB 5LL6X 1LYLA 1TS2A 3AYHB 3OIQA 2E2IB 3K5MA 3QO2A 3J80L 4IUUA 4JI6Q 1WTHA 5FLXL 2DNEA 1JICA 4DKAC 4POFA 2LXJA 3I72A 2EYHA 1HA6A 2PMZE 4BBSH 2UUBQ 3J80c 1WFQA 5IGGA 1GOZA 3PUZA 4A3JG 1NAPA 3TP7A 5ELBA 1JC7A 4AQYL 5I6WA 3CKIB 3F1ZA 3D6WA 4DGZA 3SK8A 5AJ3Q 4A3EH 4C2MH 4EVOA 5EKLA 4KY7A 4LF7L 2B2YC 5M3MB 3GTGH 1SYFA 4C3IH 3H0GG 3E3XA 1Y1VG 3L0OA 1WD1A 4KI0A 3VYRA 1CKNA 4P73A 1PYWD 3CCJA 3UDXA 4DV1Q 1FNUA 5FLXE 1RF2D 3VR6A 4CKBA 5CYUA 4QIWE 4DR5L 2JA5H 2I46A 3I7FA 1ENFA 1CA6A 2KCCA 4C1NK 1PLFA 2NWGA 1AE3A 2EJMA 3KUPA 2UU9Q 4GLXA 1LTSD 3FRPB 4R4QA 1WTWA 3QB3A 1K8GA 1VQPA 3EIVA 1DZ1A 1S4ZA 1SMXA 1EY5A 2DUDA 3A8IE 2IPKD 1GUNA 4TVAB 1VS0A 4FXGC 3MTSA 1TY2A 1G2TA 4XXEA 1RJTA 5GAEC 4IOAA 1ICFB 5JPNC 1SNOA 4LJZC 5I4DA 1B9NA 1FGBD 3ONAB 4A3MB 3S17H 4R8IA 1SFOB 2VS1A 1KAAA 3C3LA 4WORA 3GTLB 1QVFA 2EJGC 4HTHA 2NN6G 5C3EH 2K52A 5C0XJ 4ALPA 3D31A 3H6MA 5A2QE 3TBIB 2E5LL 1K0SA 4HR7B 1NSNS 4JI3Q 1PRTD 1ZKOA 4RFBA 2Q8TA 1B4OA 1IBKQ 4LF6Q 1QJOA 2HQLA 4DAMA 4LF9L 3CD6A 2L1BA 3CCQA 1LTGD 3HKZB 3KF8A 2PQAB 4GKKQ 5IP9H 2EJFC 4A3BH 1T9HA 3SXHA 3PO2H 2BDNA 3I3CA 1JWMD 4XQJA 1ML0D 3U50C 1ASZA 3FVQA 1CZGA 2J7ZA 3RLNA 5J3BA 4FDBA 3NWSA 2R7ZB 1EQQA 2LSSA 5EJWA 4GN5A 2UU9L 1OTCA 3PO3H 1VQIA 1I3QH 2Z8LA 1BUVT 2N3SA 4HJ9A 2XRSD 3T53B 1UE5A 1SYEA 2WAQE 4NB3A 1Q46A 1XNQQ 3EVQA 1KDAA 2XNAC 3NXWA 3DMUA 5JPMC 3W5OA 1N34L 1CT1D 4Q5VA 5CV8A 4B3TQ 5FO7B 3SR1A 2ZJQA 5EAYA 4JI5Q 2JA6H 4LFBL 1VDZA 4NXNL 1HFNA 3UE0A 1I94Q 5ISRA 2B8GA 1Z9FA 1I4XA 1VQAA 3G6EA 1Q12A 4ZK9B 5HGTA 4JPBW 4YCWA 4F8MA 1FJGQ 2QCPX 3KYHC 1PH6A 4YCVA 3H91A 4JI4L 1TWCH 3NELA 3NQTA 2R3ZA 2DJFC 3G7LA 3L2PA 1R4PB 2KVMA 2NZOA 1WCMH 4FF3A 3E6ZX 3K7AH 5M3FG 5T1IA 2Q2TA 3KLWA 5BN4A 1SJED 1I4GA 1J5EQ 1JWUD 1NMGA 5JVG3 3Q24A 1B2TA 2VQFL 1K8AC 3H94A 5GAGC 3CC4A 1XNRQ 4X6AH 1MIUA 3S24A 1Q1BA 3MFGA 3S1MH 1NBWA 1PYSB 3U58A 4A4IA 2E2HH 3KK7A 5EKIA 3MAQA 2BCOA 2D0OA 5H1SE 1TVXA 4JI8L 4JW0A 4PZ6A 5DEHA 2XTIA 1Q81C 3C2PA 4QIWB 1PV4A 2A68D 2NVQH 3OWEB 1LABA 1OXUA 3GO5A 3BYTB 4HCSA 3PO3G 1EOVA 2EYJA 4OX9L 1SJHD 2K6AA 2PZUA 2EXZA 2OEOA 1KXLA 4NP5A 2Z0SA 1C9OA 1ONLA 1PZID 1PH9A 4KJNA 1STAA 1YVCA 3CCRA 1BCPF 5KGUA 4M1UB 4DXFA 3HKZE 5JJKA 1HZCA 3J80i 2HD3A 1WJJA 5GADC 1YZ6A 3R93A 1YHBA 3MXNA 3VA5A 1FNWA 3KLRA 5IT9c 3BVMA 5FKAC 1Q1EA 2G9DA 1NR4A 1DOMA 4ZAIA 5TSSA 1UUPA 4K5WA 3CP0A 3S2HH 1VQHA 4N9TA 3ERSX 3GTPH 4KD4A 1QZHA 2PW5A 4NMZA 2R6GA 1CTMA 1EIHA 1LT4D 1EY8A 1QVCA 4POGA 2L9HA 1QWYA 4LNQA 4KD3A 5C5MA 3T4AC 3A5ZB 5CV4A 1PYBA 1G6ZA 3MA2B 4B9WA 1BR9A 2F0OA 2CH4W 3GD7A 4IPCA 1PTOC 3Q23A 1I6HH 2AWNA 4K5VA 5D14A 4K2KA 3SK6A 1STEA 4ZKBB 1PRTC 2EQSA 1F2YA 1S3OA 3L3OC 3CC7A 3I4LA 3DM1A 3BDOA 2RSOA 1SBBB 2UXDQ 4H13C 3HRZC 4PZ8A 1DM0B 4A3FH 1LACA 1D1KA 4Y7NB 1HXYD 3NTIA 4IOCA 2JYOA 1EY4A 4BY1G 1TWFH 2A8VA 1YNJD 3X3MA 1WTPA 3R2IA 3J81L 1TQOA 1LTRD 3TSSA 2M9VA 3M3YB 3KJPA 1LTAD 3K80C 1JE4A 2JA7H 1KL9A 4I7ZC 2MPMA 4A3IB 5D65A 4DR6L 4WJ3M 3K58A 1V9PA 2A6EC 3K5OA 4RWSC 2K32A 1X3PA 3STBD 3ND8A 3A8KE 2JA5G 4JBKA 1DOKA 2NN6I 4JC0A 3ZJYC 4MHEA 1LTBD 4B3TL 5IODA 4PV1C 3KJOA 2M2LA 3RLOA 3I4MH 1OXTA 1SNPA 4M8AA 2PZWA 4GZYC 2FMMA 1EQTA 1HR0L 2C5CA 2XSCA 3D0FA 3D4WA 4C3JH 4KHZA 4OHJA 4BY1B 2OF1A 5K5PA 3EFXD 4X65Q 4NPSA 3WOFA 3HOZH 4AYBG 1AN8A 3U4ZA 5IIFA 1B53A 3DEOA 5M5YH 4JV5Q 5IYCH 4R4CA 1I6HB 1TS3A 4OIKA 1D5MC 3UDFA 5A2QL 1SE3A 4I7AA 2OXPA 4O0AA 1BCPC 5JJIA 2MP1A 3AQQA 2IWHA 3IAYA 1N33L 4GLVB 1HJPA 1QOHA 3Q22A 3HKZG 2F0WA 1X3GA 1YNNC 3CQZH 1A3UA 1IKMA 3HGBA 4C3JB 4HIKA 2IX1A 2B2TC 2G9HD 3EQLC 2R61A 1PRTB 3H3VI 4JOIA 4DNRB 1Y14B 3J81j 1WYDA 2K75A 4A3KB 3P7JA 3RZOB 3GTLH 3RZOH 3W1BA 2A69D 4EQNA 1MJEA 3PIO3 3Q6SA 1STYA 4HSPA 2K04A 1WTXA 3LWEA 1I50H 5JAVA 2B63B 1A2TA 1RHPA 1EY7A 1D5ZC 3TQYA 1KTKA 4K8JA 5CBEE 1FL0A 2B39A 4TSSA 3DEPA 3GTGB 2AWOA 2L11A 1Y1VB 4GOPC 5FLMH 2R92H 4B08A 2KENA 2PPBC 1AZPA 3VR5A 2FJ2A 1OXVA 2CFMA 2KBNA 2XIWA 2KA7A 4LUOA 3A7AB 5C6AA 3QOJA 1HTPA 2SEBD 4OONA 2CHBD 4A93B 1RIPA 4A3FB 4A3JB 3RZDB 1YJ9A 1TKWB 4KKUA 1PXUA 2IHEA 1SYGA 3ITPA 1ENAA 4JI7Q 2VQEL 1Q90A 2M00A 5C3EG 4DR3Q 2YYZA 5IP7G 4RMFA 3KDFA 1W6JA 1XTDA 1I6VC 1BQQT 4KK7A 4EX5A 1KDCA 5M3FB 4BY1H 5M3MG 4XQQA 4C2MB 1LV9A 4K8IA 1C0AA 4XYQA 2F0VA 2UXCQ 2IX3A 1E7ZA 1VF7A 3S1RH 1MKHA 2AUKA 5CR3A 2WV6D 3SE0A 4CKCA 1PFSA 3I4MB 3OOCA 2EIFA 2JN4A 3MWYW 5M5WB 4JI6L 2CVRA 4L5TA 2I07B 3RUZA 2E74C 2WB1E 1JMCA 3HOUG 4H0LC 1KABA 4UY8C 1R9TB 5T1GA 4B3ML 2OCEA 4TRDA 2VB3X 3L7ZC 3PV0A 2ZXPA 3FPPA 2VUMH 1BNZA 1L1OB 4DR2L 1EQVA 1EYDA 1TS5A 3BZCA 3LX0A 5IYDG 1IZ6A 3UDGA 2K1BA 1Y8OB 2XN9C 1MHWC 1IKLA 1BBUA 5KRUA 1PTOB 1EFID 4RCNA 2Y0SB 4IO9A 2R7ZG 2MFIA 1PA6A 1EU3A 2F0KA 4JI0L 3GTPB 3S16H 3TZUA 4QL5A 3OW7A 3PIP3 3HKSA 4G4KA 2AUJD 1EYCA 1WTRA 1DONA 4RG1A 1IW7C 2O4XA 3H3VC 4IFDH 4L5QA 2F0UA 3I55A 2B2TA 1M4VA 1XX8A 3PCOB 4JYAL 1QG7A 3GTQB 3S14H 1PHJA 2JQOA 4FVMA 3H09A 3AFQA 1F2ZA 2F4IA 4IFDJ 2O5IC 1XNRL 2F3WA 1IHZA 2AKWB 1SYCA 2V1CC 2VY3A 1EEID 4DAYB 3BS1A 1MI2A 3S1QH 3M4YA 1E24A 5DLQE 4A3DH 4C3HB 3IFDA 3NPPA 4DN4M 3A0JA 4DR6Q 5CGKA 1ESRA 3TDQA 3GTQH 1LO5D 1FJGL 1MSHA 4A3LH 4A93G 4HJ5A 1TWHH 3VR2A 1EYGA 5KEEA 2MUYA 3M7GA 2LXKA 3UE1A 3Q8DA 1HHVA 1TIID 4BBRH 3T51B 4JI7L 2KHSA 4OWXB 3J81c 1G291 3HS0C 3I2ZA 4LMQD 1PH7A 2A73B 1CI3M 1H9SB 3PF5A 4K5XA 4MN3A 2C9OA 5BN5A 1VQEA 4AYBE 3MFYA 4B3SL 2D5DA 3BZDB 1QZGA 4DK6C 5I9OA 2HIXA 1N36Q 4DR7Q 4UDUC 2B63G 2K01A 1FD7D 1SLJA 1LTID 2KCMA 5E4WC 3JAME 4ZYSA 3HG9A 2QW7A 3I73A 2OT2A 2MO1A 4IFDI 4JI1L 2R93G 5C4JB 2WAQB 2WFWA 3CRLC 4QMGA 2NYZD 3M4OH 3ZYYX 3E0EA 4YWLA 1WTQA 1VQBA 2HDLA 5K36H 2RDGA 2JA7B 3KBGA 1VQDA 3ND9A 3KFUA 1NE3A 4DK0A 2JJQA 1N9WA 2BH8A 4A3CH 3J7YW 3SK5A 1HUNA 2G5DA 2Q2IA 2JA8B 3TREA 5GROA 1VQKA 4KN7C 1K8OA 1C8CA 1ET6A 1E3PA 3TP6A 1CM9A 1JCKB 5ELFA 1PZJD 1DJRD 2A5HA 4LK1C 1B3AA 4J8QA 1V1OA 4DV5Q 2QEXA 5J39A 1SFOH 1LTLA 2F03A 1VQMA 2K05A 1P8LA 1BOSA 4J1MA 1HNZQ 2RQXA 2NUCA 2QA4A 1GUTA 2F1MA 1XJVA 2MQHA 2K14A 3GTOB 5ELDA 4YY3L 3PUWA 1DOLA 5IYBH 5E4XA 1VQOA 3S15B 1PH3A 1VQ8A 4A3BG 2R93B 1UE6A 4QF4A 1I4QA 5A35A 4IUVA 3D6CA 3HOYH 4JBJA 4A3MG 1A8VA 1VQ9A 5FK9C 3T13A 1JB7A 1A15A 4X3SA 3ICEA 4NW2A 2QF7A 1KAWA 4XQNA 3HOXH 4DV6L 3H0GB 1VQNA 2DY8A 2QDBA 1E2WA 4JI4Q 4JV5L 1Y1VH 3HOXG 1FVIA 2J4XA 2RDHA 1QB5D 1F77A 4X64L 3NP8A 3K0YA 5L37A 2AMCB 5M5XH 1IW7D 3MEHA 4A3EB 2B2YA 1D6EC 3I4NH 4IZ8A 3TZDA 2E76C 1IBLQ 3PUYA 3HOUB 5FLXc 1Y69U 3HOZG 5M5WH 4DV0Q 3NEMA 3QJYA 5C3XA 3FKIG 1ZYRD 4ZLTF 4FYDA 3U4VA 3VYTA 4L5RC 4DUZL 1QUQA 2KHJA 1J5EL 1KC8C 2E2JH 3DUZA 2HUGA 1YI2A 3K7AB 3SDZA 1YNXA 4R9WA 4N9PA 2B2VC 2F0JA 3PUXA 1PH4A 4FNFA 3TS0A 3RNUA 3DLLA 4YHHQ 5IYBG 2VB2X 3ULLA 1M1KC 3AFPA 3T1YL 1Q82C 4DUYQ 3QIAA 2B2WC 4HJ8A 1CSPA 3D4RA 5JEAG 1IBMQ 2ZM6Q 3H3VH 2N8NA 4EQ5A 4HEDA 5IYDH 5JEAH 1PZKD 3OW2A 1J6QA 3I56A 1IYJB 1YJWA 2A19A 4X3UA 2K28A 4A3MH 1E22A 3AMUA 4LF6L 5J22A 1L0XB 1IBKL 1CQFA 1ASYA 5GQOA 4LFCL 5C5LA 4U68A 4H02A 1Y8PB 5C0XI 4HIMA 4NXMQ 4A3GG 4XTCS 4GN3B 1IYUA 1TWGB 4ABNA 2ES2A 3HOVH 4N8X1 4RGMA 1JQYD 1B44D 4WJ4A 3HOVG 2KUMA 4NDXA 4RGNA 3RLFA 4F88A 5HGQA 5DM63 4FO2A 3PIOA 2F0FA 5FLMG 3A8JE 4DV4L 3M4QA 4JI3L 3K5NA 1GM5A 3P75A 4LF5Q 2EOTA 2CW0D 3CW2C 2LFNA 3URYA 2B3GA 1GKHA 2B29A 2L4NA 4BWGB 3R2TA 2I5MX 4PMBA 1II3A 4IJLA 2Q2UA 1B3QA 5CV5A 1GUGA 4NXML 4A3BB 1K0RA 1Z7TA 3KLSA 5IT9E 2A68C 1X3EA 1EWIA 1RTOA 1HH2P 4H44C 1XXGA 1UAPA 4JVZA 3V2TA 1JOKA 1ENCA 4F87A 3PO3B 4K14A 1DYQA 1XPUA 4HIDA 1C4QA 1B9MA 2F0IA 4A3DG 2OQKA 2PQAA 1CZWA 2F3VA 4FF4A 1JORA 1XPOA 3A55A 4ZQ3A 2K5QA 2XWBB 1SE8A 1O7ZA 1JR0D 5I9PA 3U9SA 4OX9Q 1SROA 1U9RA 1M90C 1OO9B 1KRSA 1LLRD 4YHHL 2I0QA 4K2LA 3GP7A 5CV9A 1RDPD 4LWCA 5KNCA 5BN3A 2YTYA 2ICIA 2NB0A 1N36L 4LAAA 1VQCA 1U4MA 1XMQQ 4K0KL 3RN5A 2FXQA 1UEAB 2BA0A 2GA4B 4LFCQ 1HR0W 1NUCA 2I5LX 4DFAA 1V8QA 2AQ2B 2LMCB 3NK9A 1S5CD 3PO2G 5IE8A 5IGDA 1X54A 5LMNQ 1UEBA 1LTTD 1VQGA 2K7VA 5CBAE 5AJ3L 1IBML 2VUMB 5JJZA 2B2VA 4DUZQ 1Z47A 2B2UA 2EXDA 4X64Q 1Y8NB 5CV6A 1VQ4A 1R9TH 2B2UC 1ILPA 1SMYD 2WKDA 1B50A 1HFGA 4ME3A 1D5XC 2EPBA 3BVGA 5D3DA 5IWAQ 1JJCB 2OTJA 3K8AA 4JI5L 1YIJA 3EROA 3MEFA 4P2CB 4O1NA 1A63A 4ID6A 1XWEA 2GVAA 5IYCG 3A5UA 1I4HA 2QGQA 4MNOA 2PQEA 5ELEA 4CJ1B 2F0EA 1RL2A 4JYAQ 2RA4A 4Y7NH 4JBMA 2KJXA 2ZJPA 4JI0Q 4NXNQ 2EYOA 4A3DB 4LFBQ 1U4LA 1SYDA 3OPOA 1AW7A 1YBYA 2WB1B 3DXJC 4I65A 1QVGA 4ULLA 2IL8A 2E2JB 1CHQD 2ENBA 5KIXA 4UP8A 1EWHA 1GJXA 4DV5L 3B6YA 4IQZA 1G6PA 2NTSA 2A6HD
chains in the Genus database with same CATH topology
1E7ZA 1WFQA 2NZHA 2UXBL 3S1RH 1MKHA 3PUZA 4A3JG 4GKKL 1KQSA 3DM3A 4AQYL 3HOUH 1PFSA 2EIFA 2JE6I 4R1JA 3F1ZA 3W1GA 4JI6L 2Z6KC 4L5TA 5AJ3Q 1JE5A 1K83H 2WB1G 4UPAA 4A3EH 4C2MH 5LMUL 2WB1E 1Y1WH 1JMCA 2D62A 3HOUG 3JAMc 2E5LQ 4UY8C 4GKJL 4HJAA 1Y1WG 3MXNB 4LF7L 1NY4A 3GTGH 1X56A 4PZ7A 4C3IH 3PGZA 1L2FA 3H0GG 4B3SQ 1Y1VG 2F3IA 4OO1I 3L0OA 4QY7A 4B3ML 2OCEA 4KI0A 2NVTH 1CKNA 3E9HA 3L7ZC 3PV0A 4IJHA 4JOIC 4P73A 1H95A 3CCJA 3UDXA 4DV1Q 1L1OB 2VUMH 4LF5L 4JCVE 4DR2L 4DNIA 4YY3Q 3BU2A 4BA2I 3BJUA 3BZCA 4R4TA 3VDYA 1K9MC 5IYDG 1IZ6A 4YWKA 4QIWE 4DR5L 3UDGA 2JA5H 3I7FA 3M7NA 2IHFA 1BBUA 1AE3A 1D7QA 3ULJA 2UU9Q 1KRTA 4GLXA 4A3KH 4R4QA 4IO9A 2R7ZG 4A3IG 1VQFA 2MFIA 1PA6A 4J15A 1BKBA 2D0PA 1K8GA 1VQPA 3T1YQ 3KOJA 4JI0L 3EIVA 2KCTA 1O7IA 3PUVA 1SMXA 3OTOQ 2DUDA 1W2BA 3S16H 1JJGA 2I5HA 4OWTB 3OYYA 4QL5A 3S15H 4TVAB 1VS0A 4PMWA 3HKSA 4DR1L 2JEAI 2B63H 4OXPA 3HOWH 5GAEC 4R4IA 4LF8L 4IOAA 3M3YH 4RG1A 4GOPB 2IY5B 4DR5Q 2HT1A 3CAMA 3CXCA 4DR7L 3S17H 3F2CA 2MO0A 4DUYL 2RCNA 2VS1A 5C4XG 4L5QA 1CKMA 4JG2A 3I55A 4DV7Q 1QVFA 3PCOB 4JYAL 5C4XH 2NN6G 2IX0A 5C3EH 4MTNA 2K52A 2RHQB 3S14H 1PHJA 1XNQL 5C0XJ 2JQOA 4ALPA 4X66Q 3D31A 3AFQA 4A3GG 3M85A 5HY6A 4KLKA 1YHQA 1VQ6A 4IFDJ 2E5LL 1XNRL 1YHAA 4JI3Q 2AKWB 2V1CC 1IBKQ 2VY3A 4LF6Q 4DAMA 2HQLA 5FJ8G 1A62A 4DAYB 2VNUD 1OXXK 4LF9L 3F2BA 3CD6A 3S1QH 3CCQA 1E24A 5DLQE 1UWVA 2PQAB 4A3DH 4GKKQ 2R7DA 5IP9H 4A3BH 1U0LA 3A0JA 1T9HA 1LM0A 1Q86C 3PO2H 4DR6Q 4LF7Q 3SGIA 3U50C 1IBLL 1ASZA 3GTQH 4GKJQ 1WOCA 3RLNA 5C4JH 3AEVA 2OQ0A 2K5VA 5J3BA 4FDBA 4LF4L 1FJGL 4A3LH 1EQQA 4HJ5A 4A93G 2LSSA 1TWHH 3G4SA 5JEAJ 4GN5A 1EYGA 2UU9L 2LXKA 1WI5A 3UE1A 1OTCA 3PO3H 3Q8DA 4BXXH 2CCZA 1VQIA 1I3QH 2N3SA 4HJ9A 4BBRH 1UE5A 4JI7L 4OWXB 2WAQE 1TWGH 4NB3A 3J81c 2YV5A 1G291 1Q46A 3ER0A 3I2ZA 4O2DA 1PH5A 1XNQQ 1YEZA 1PH7A 1PVOA 3H15A 3PF5A 3CMEA 1VQEA 3W5OA 1N34L 4AYBE 4B3SL 4DV4Q 4B3TQ 1QZGA 1IL2A 4DK6C 1N36Q 2HIXA 1CKNB 5EAYA 2ZJQA 2IT1A 2Z6KA 4JI5Q 2JA6H 3I4MG 4DR7Q 2B63G 4B3RL 1U5KA 4LFBL 3TRZA 4NXNL 4LFAQ 1SLJA 2KCMA 3UE0A 1I94Q 3BZKA 2JEBI 3T1HQ 2MO1A 1Z9FA 4X62L 1VQAA 2PI2E 4IFDI 1V43A 4JI1L 1Q12A 3G6EA 2R93G 2WFWA 4YCWA 1FJGQ 2R7FA 3M4OH 4QGUA 3E0EA 3KYHC 4YWLA 1PH6A 1VQBA 4AH6A 3GDEA 4YCVA 1Q8KA 4P75A 1AH9A 3FP9A 1TWCH 4JI4L 2ZTEA 3NELA 5M3MH 2ID0A 1VQDA 2MNAA 3KFUA 1L1OC 4DV2L 2NVYH 1NE3A 1FGUA 3L2PA 2XGTA 2NZOA 2UUAQ 1SR3A 1N9WA 2BH8A 1WCMH 2JJQA 4A3CH 3I4OA 1L1OA 3FHWA 2Q2IA 3K7AH 5M3FG 3STBC 4BY7H 2PI2A 2Q2TA 2F4VQ 3TREA 3KLWA 2F52A 3IRBA 5GROA 4HIOA 1J5EQ 1VQKA 1GVPA 1NMGA 1E3PA 2VQFL 1K8AC 1VQ5A 5GAGC 2YTVA 2VQFQ 1D8LA 1MIUA 3CC4A 1XNRQ 2JA8G 3S24A 1Q1BA 3S1MH 1NBWA 3K81C 1PYSB 1BVSA 2VL6A 4X66L 3U58A 1HZBA 1KD1C 4A4IA 2UXCL 4DV5Q 2E2HH 2K5NA 2WAQG 2QEXA 2D0OA 5H1SE 1SFOH 1VQ7A 1LTLA 4JI8L 2HHHL 1VQMA 2AHOB 4PZ6A 1A0IA 1HNXL 1P8LA 2XTIA 4DV7L 1Q81C 1HNZQ 2E2IH 2UUCL 2QA4A 1PV4A 4BA1I 4DV3Q 1XJVA 2MQHA 2K14A 3CC2A 2NVQH 3RN2A 1OXUA 3GO5A 4YY3L 3PUWA 1VCIA 2BH2A 5IYBH 1HNWL 4DR4Q 1VQOA 3PO3G 4DV1L 1PH3A 1VQ8A 1EOVA 4A3BG 4OX9L 1TWAH 4JI1Q 3J7A5 1UE6A 3G48A 1KXLA 2Z0SA 3CCLA 1C9OA 4A3JH 3KF8B 4L5RC 1X3FA 1PH9A 2OTLA 1YVCA 3F8TA 4A3KG 3HOYH 3CCRA 4DR4L 4JBJA 4A3MG 1N32Q 1A8VA 3CMAA 1VQ9A 1CUKA 1JB7A 1QUQB 4YCUA 3HKZE 2UUCQ 3ICEA 5JJKA 1HZCA 3J80i 3GTJH 1WJJA 5GADC 4R4OA 3F2DA 1YZ6A 3S1NH 1W3SA 1YHBA 3CCUA 2YU9H 1B7YB 4X6AH 1KAWA 4YWMA 3HOXH 4DV6L 3PSIA 1TXYA 5IT9c 4A75A 1VQNA 4DR1Q 1Q1EA 2UUBL 4JV5L 4JI4Q 1Y1VH 3HOXG 1FVIA 4A3IH 2RF4A 3CP0A 4PG3A 4APVA 3S2HH 1VQHA 2VUMG 4X64L 3J7ZC 3ERSX 3GTPH 1SN8A 1QZHA 5M5XH 2AMCB 1HNWQ 1CKOA 2R6GA 1HZ9A 2F4VL 5ELOA 1YJNA 3E9IA 4P74A 1QVCA 4POGA 2VW9A 1KIXA 3I4NH 1LUZA 1IBLQ 4LNQA 1JJ2A 3A5ZB 3PUYA 3HFZB 1PYBA 2BA1A 3WWVA 5FLXc 3HOZG 5LMUQ 2GN5A 5M5WH 4DV0Q 3NEMA 4XIGS 2E8GA 3FKIG 3GD7A 4JBWA 4JI2L 4IPCA 4A76A 4LF9Q 1I6HH 1HZAA 4Y52H 2AWNA 3U4VA 5GAHC 1NTGA 4X62Q 4DUZL 1QUQA 2KHJA 1WCMG 1KC8C 2ZJRA 1J5EL 2E2JH 4A3CG 2JA9A 1PH2A 1YI2A 2ZTCA 2EQSA 3EN2A 1EIYB 1S3OA 3CC7A 1YNXA 2KHIA 4AIMA 1PH4A 3PUXA 4TQUS 1GO3E 1N8RC 2UXDQ 4X65L 3TS0A 3RNUA 3J81i 3DLLA 4KHPQ 5FJ8H 4PZ8A 3RZDH 4YHHQ 5IYBG 4A3FH 1SRUA 4LW1A 4LF4Q 1E1TA 3ULLA 1M1KC 4A3LG 3AFPA 3T1YL 5BR8Q 1YITA 2K50A 5BR8L 4IOCA 2L15A 3NENA 4DUYQ 1Q82C 4HJ8A 2UXBQ 4BY1G 1CSPA 3GTKH 1DGSA 5JEAG 1IBMQ 1TWFH 2A8VA 2ZM6Q 3H3VH 2N8NA 4EQ5A 1S40A 3CF5A 5IYDH 1X6OA 3OW2A 4BBSG 1J6QA 4IPGA 1IYJB 3I56A 2A19A 4UP9A 1YJWA 2ZTDA 4A3MH 1E22A 1X65A 5C44H 4B3RQ 5C0XG 4LF6L 3KJPA 1IBKL 1N33Q 3K80C 1ASYA 1X55A 5GQOA 1BBWA 4LFCL 1G51A 2JA7H 4DR3L 3PIPA 2DGYA 1KL9A 1L0WA 5C0XI 1UE7A 4H02A 3TEHB 4HIMA 3EBEA 4NXMQ 3KDFB 4XTCS 4GN4B 5C44G 4B3MQ 4DR6L 4WJ3M 4GN3B 4GS3A 2ES2A 1MJCA 1I5FA 1V9PA 3HOVH 1EIFA 2JA7G 2OWOA 3STBD 2JA5G 3H0GH 4WJ4A 3HOVG 4JBKA 3RLFA 2NN6I 5HGQA 2ATWA 3S2DH 4JC0A 3ZJYC 1K3RA 4GOPA 3PIOA 4A93H 5FLMG 3GTMH 4DV4L 1NMFA 1P16A 2JK8A 3M4QA 4JI3L 3UDIA 3RLOA 3KJOA 3CW2C 4GNXC 3G71A 4DR2Q 4LF5Q 3I4MH 1PH1A 1OXTA 2CKZB 2R7ZH 3I4NG 2B3GA 1GKHA 4JI2Q 2B29A 4GNXA 2I5MX 1HR0L 4IJLA 2Q2UA 1C7YA 1Q7YC 4GNXB 4DV2Q 4C3HH 3D0FA 2CWAA 2R93H 4C3JH 4LUZA 4NXML 1K0RA 4KHZA 3M4PA 3K0XA 3OTOL 1X3EA 5M3FH 3FKIH 1EWIA 1HH2P 1K73C 2Y0SE 2NVXH 1JT8A 4X65Q 5LMNL 2A1AA 4NPSA 3KF6B 3CCVA 1XPUA 3HOZH 4QQBX 4HIDA 5IY0A 4AYBG 4AQYQ 3U4ZA 3KF6A 2VQEQ 1NJIC 2CQOA 1I94L 2UUAL 4GLAC 4IPHA 4BY7G 4A3DG 2OQKA 2PQAA 5M5YH 1XPOA 4JV5Q 5IP9G 5IYCH 4R4CA 1KHIA 4QJFA 3UDFA 1V1QA 2HIVA 1SE8A 4A3FG 4L5SA 2PNHA 4IFDG 4OX9Q 1SROA 1M90C 1KRSA 4YHHL 4O0AA 2I0QA 3CPFA 4KHPL 4DV0L 4HJ7A 5JJIA 5ELNA 3AQQA 1N33L 3JC66 4DV3L 2WP8J 4GLVB 1HJPA 5E7NA 1XMOL 4LWCA 1CSQA 4DK3C 4BBRG 3HKZG 5IWAL 1X3GA 2YTYA 3CQZH 1N36L 2ASBA 4OO1G 3CCEA 2UXCQ 1VQCA 2ALYB 4HIKA 2IX1A 1N34Q 1IXRA 3A74A 4P72A 1XMQQ 4K0KL 3JAMi 3RN5A 2FXQA 2BA0A 2GVBA 4P71A 4LFCQ 1XPRA 3H3VI 4JOIA 3J81j 1Y14B 3M9BA 1HR0W 2I5LX 3RR5A 1WYDA 2K75A 3LGJA 1VQJA 5LMNW 3GTLH 4BXXG 4DV6Q 1HNXQ 3RZOH 4A3EG 3PO2G 4LUVA 4LF8Q 3W1BA 5IE8A 1EUJA 2HHHQ 2VZAA 3HOYG 1X54A 1MJEA 5LMNQ 1UEBA 1VQGA 5AJ3L 1IBML 3ULPA 1I50H 4A3GH 4DUZQ 1Z47A 4X64Q 2EXDA 3TQYA 4UP7A 1VQ4A 2K4KA 3CCMA 1FL0A 1XMQL 4K0KQ 1R9TH 5K36G 1B70B 2AWOA 4ME3A 2Q2HA 2UXDL 1GD7A 4GOPC 5FLMH 1HR0Q 2JA6G 2H5XA 5JJLA 2R92H 5IWAQ 4DPGA 2KENA 4LFAL 1JJCB 2RHSB 3CPWA 2OTJA 1EFWA 3GTOH 2K5HA 1OXVA 2C35B 2CFMA 2KBNA 3K8AA 4JI5L 1YIJA 2R92G 4LUOA 1EQRA 2Y0SG 1N32L 3MEFA 1A63A 2N49A 1HNZL 3PF4A 4OONA 2GVAA 5IYCG 3A5UA 2N78A 1AE2A 2QGQA 4MNOA 1PH8A 3CCSA 5IP7H 1B8AA 4JI8Q 2JA8H 1UE1A 1RIPA 4B3TL 1S72A 4IPDA 1RL2A 3T1HL 1YJ9A 4JYAQ 2IHEA 3HOWG 4Y7NH 4JBMA 1X9NA 2ZJPA 4JI0Q 2VQEL 1XMOQ 4JI7Q 5C3EG 4NXNQ 4DR3Q 4LFBQ 2YYZA 5IP7G 1OXSC 4OWWB 2CWPA 3NBHB 1YBYA 3K7UC 3KDFA 4RMFA 1E1OA 4MZ9A 1XTDA 1LYLA 3AYHB 1QVGA 4EX5A 1GM5A 4JI6Q 1VQLA 4BY1H 3TS2A 2YTXA 4DKAC 5M3MG 4POFA 4UP8A 2LXJA 2ZM6L 1C0AA 4DV5L 3B6YA 2PMZE 1G6PA 4BBSH 2UUBQ 3J80c
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7Z A;  1WFQ A;  2NZH A;  2UXB L;  3S1R H;  1MKH A;  3PUZ A;  4A3J G;  4GKK L;  1KQS A;  3DM3 A;  4AQY L;  3HOU H;  1PFS A;  2EIF A;  2JE6 I;  4R1J A;  3F1Z A;  3W1G A;  4JI6 L;  2Z6K C;  4L5T A;  5AJ3 Q;  1JE5 A;  1K83 H;  2WB1 G;  4UPA A;  4A3E H;  4C2M H;  5LMU L;  2WB1 E;  1Y1W H;  1JMC A;  2D62 A;  3HOU G;  3JAM c;  2E5L Q;  4UY8 C;  4GKJ L;  4HJA A;  1Y1W G;  3MXN B;  4LF7 L;  1NY4 A;  3GTG H;  1X56 A;  4PZ7 A;  4C3I H;  3PGZ A;  1L2F A;  3H0G G;  4B3S Q;  1Y1V G;  2F3I A;  4OO1 I;  3L0O A;  4QY7 A;  4B3M L;  2OCE A;  4KI0 A;  2NVT H;  1CKN A;  3E9H A;  3L7Z C;  3PV0 A;  4IJH A;  4JOI C;  4P73 A;  1H95 A;  3CCJ A;  3UDX A;  4DV1 Q;  1L1O B;  2VUM H;  4LF5 L;  4JCV E;  4DR2 L;  4DNI A;  4YY3 Q;  3BU2 A;  4BA2 I;  3BJU A;  3BZC A;  4R4T A;  3VDY A;  1K9M C;  5IYD G;  1IZ6 A;  4YWK A;  4QIW E;  4DR5 L;  3UDG A;  2JA5 H;  3I7F A;  3M7N A;  2IHF A;  1BBU A;  1AE3 A;  1D7Q A;  3ULJ A;  2UU9 Q;  1KRT A;  4GLX A;  4A3K H;  4R4Q A;  4IO9 A;  2R7Z G;  4A3I G;  1VQF A;  2MFI A;  1PA6 A;  4J15 A;  1BKB A;  2D0P A;  1K8G A;  1VQP A;  3T1Y Q;  3KOJ A;  4JI0 L;  3EIV A;  2KCT A;  1O7I A;  3PUV A;  1SMX A;  3OTO Q;  2DUD A;  1W2B A;  3S16 H;  1JJG A;  2I5H A;  4OWT B;  3OYY A;  4QL5 A;  3S15 H;  4TVA B;  1VS0 A;  4PMW A;  3HKS A;  4DR1 L;  2JEA I;  2B63 H;  4OXP A;  3HOW H;  5GAE C;  4R4I A;  4LF8 L;  4IOA A;  3M3Y H;  4RG1 A;  4GOP B;  2IY5 B;  4DR5 Q;  2HT1 A;  3CAM A;  3CXC A;  4DR7 L;  3S17 H;  3F2C A;  2MO0 A;  4DUY L;  2RCN A;  2VS1 A;  5C4X G;  4L5Q A;  1CKM A;  4JG2 A;  3I55 A;  4DV7 Q;  1QVF A;  3PCO B;  4JYA L;  5C4X H;  2NN6 G;  2IX0 A;  5C3E H;  4MTN A;  2K52 A;  2RHQ B;  3S14 H;  1PHJ A;  1XNQ L;  5C0X J;  2JQO A;  4ALP A;  4X66 Q;  3D31 A;  3AFQ A;  4A3G G;  3M85 A;  5HY6 A;  4KLK A;  1YHQ A;  1VQ6 A;  4IFD J;  2E5L L;  1XNR L;  1YHA A;  4JI3 Q;  2AKW B;  2V1C C;  1IBK Q;  2VY3 A;  4LF6 Q;  4DAM A;  2HQL A;  5FJ8 G;  1A62 A;  4DAY B;  2VNU D;  1OXX K;  4LF9 L;  3F2B A;  3CD6 A;  3S1Q H;  3CCQ A;  1E24 A;  5DLQ E;  1UWV A;  2PQA B;  4A3D H;  4GKK Q;  2R7D A;  5IP9 H;  4A3B H;  1U0L A;  3A0J A;  1T9H A;  1LM0 A;  1Q86 C;  3PO2 H;  4DR6 Q;  4LF7 Q;  3SGI A;  3U50 C;  1IBL L;  1ASZ A;  3GTQ H;  4GKJ Q;  1WOC A;  3RLN A;  5C4J H;  3AEV A;  2OQ0 A;  2K5V A;  5J3B A;  4FDB A;  4LF4 L;  1FJG L;  4A3L H;  1EQQ A;  4HJ5 A;  4A93 G;  2LSS A;  1TWH H;  3G4S A;  5JEA J;  4GN5 A;  1EYG A;  2UU9 L;  2LXK A;  1WI5 A;  3UE1 A;  1OTC A;  3PO3 H;  3Q8D A;  4BXX H;  2CCZ A;  1VQI A;  1I3Q H;  2N3S A;  4HJ9 A;  4BBR H;  1UE5 A;  4JI7 L;  4OWX B;  2WAQ E;  1TWG H;  4NB3 A;  3J81 c;  2YV5 A;  1G29 1;  1Q46 A;  3ER0 A;  3I2Z A;  4O2D A;  1PH5 A;  1XNQ Q;  1YEZ A;  1PH7 A;  1PVO A;  3H15 A;  3PF5 A;  3CME A;  1VQE A;  3W5O A;  1N34 L;  4AYB E;  4B3S L;  4DV4 Q;  4B3T Q;  1QZG A;  1IL2 A;  4DK6 C;  1N36 Q;  2HIX A;  1CKN B;  5EAY A;  2ZJQ A;  2IT1 A;  2Z6K A;  4JI5 Q;  2JA6 H;  3I4M G;  4DR7 Q;  2B63 G;  4B3R L;  1U5K A;  4LFB L;  3TRZ A;  4NXN L;  4LFA Q;  1SLJ A;  2KCM A;  3UE0 A;  1I94 Q;  3BZK A;  2JEB I;  3T1H Q;  2MO1 A;  1Z9F A;  4X62 L;  1VQA A;  2PI2 E;  4IFD I;  1V43 A;  4JI1 L;  1Q12 A;  3G6E A;  2R93 G;  2WFW A;  4YCW A;  1FJG Q;  2R7F A;  3M4O H;  4QGU A;  3E0E A;  3KYH C;  4YWL A;  1PH6 A;  1VQB A;  4AH6 A;  3GDE A;  4YCV A;  1Q8K A;  4P75 A;  1AH9 A;  3FP9 A;  1TWC H;  4JI4 L;  2ZTE A;  3NEL A;  5M3M H;  2ID0 A;  1VQD A;  2MNA A;  3KFU A;  1L1O C;  4DV2 L;  2NVY H;  1NE3 A;  1FGU A;  3L2P A;  2XGT A;  2NZO A;  2UUA Q;  1SR3 A;  1N9W A;  2BH8 A;  1WCM H;  2JJQ A;  4A3C H;  3I4O A;  1L1O A;  3FHW A;  2Q2I A;  3K7A H;  5M3F G;  3STB C;  4BY7 H;  2PI2 A;  2Q2T A;  2F4V Q;  3TRE A;  3KLW A;  2F52 A;  3IRB A;  5GRO A;  4HIO A;  1J5E Q;  1VQK A;  1GVP A;  1NMG A;  1E3P A;  2VQF L;  1K8A C;  1VQ5 A;  5GAG C;  2YTV A;  2VQF Q;  1D8L A;  1MIU A;  3CC4 A;  1XNR Q;  2JA8 G;  3S24 A;  1Q1B A;  3S1M H;  1NBW A;  3K81 C;  1PYS B;  1BVS A;  2VL6 A;  4X66 L;  3U58 A;  1HZB A;  1KD1 C;  4A4I A;  2UXC L;  4DV5 Q;  2E2H H;  2K5N A;  2WAQ G;  2QEX A;  2D0O A;  5H1S E;  1SFO H;  1VQ7 A;  1LTL A;  4JI8 L;  2HHH L;  1VQM A;  2AHO B;  4PZ6 A;  1A0I A;  1HNX L;  1P8L A;  2XTI A;  4DV7 L;  1Q81 C;  1HNZ Q;  2E2I H;  2UUC L;  2QA4 A;  1PV4 A;  4BA1 I;  4DV3 Q;  1XJV A;  2MQH A;  2K14 A;  3CC2 A;  2NVQ H;  3RN2 A;  1OXU A;  3GO5 A;  4YY3 L;  3PUW A;  1VCI A;  2BH2 A;  5IYB H;  1HNW L;  4DR4 Q;  1VQO A;  3PO3 G;  4DV1 L;  1PH3 A;  1VQ8 A;  1EOV A;  4A3B G;  4OX9 L;  1TWA H;  4JI1 Q;  3J7A 5;  1UE6 A;  3G48 A;  1KXL A;  2Z0S A;  3CCL A;  1C9O A;  4A3J H;  3KF8 B;  4L5R C;  1X3F A;  1PH9 A;  2OTL A;  1YVC A;  3F8T A;  4A3K G;  3HOY H;  3CCR A;  4DR4 L;  4JBJ A;  4A3M G;  1N32 Q;  1A8V A;  3CMA A;  1VQ9 A;  1CUK A;  1JB7 A;  1QUQ B;  4YCU A;  3HKZ E;  2UUC Q;  3ICE A;  5JJK A;  1HZC A;  3J80 i;  3GTJ H;  1WJJ A;  5GAD C;  4R4O A;  3F2D A;  1YZ6 A;  3S1N H;  1W3S A;  1YHB A;  3CCU A;  2YU9 H;  1B7Y B;  4X6A H;  1KAW A;  4YWM A;  3HOX H;  4DV6 L;  3PSI A;  1TXY A;  5IT9 c;  4A75 A;  1VQN A;  4DR1 Q;  1Q1E A;  2UUB L;  4JV5 L;  4JI4 Q;  1Y1V H;  3HOX G;  1FVI A;  4A3I H;  2RF4 A;  3CP0 A;  4PG3 A;  4APV A;  3S2H H;  1VQH A;  2VUM G;  4X64 L;  3J7Z C;  3ERS X;  3GTP H;  1SN8 A;  1QZH A;  5M5X H;  2AMC B;  1HNW Q;  1CKO A;  2R6G A;  1HZ9 A;  2F4V L;  5ELO A;  1YJN A;  3E9I A;  4P74 A;  1QVC A;  4POG A;  2VW9 A;  1KIX A;  3I4N H;  1LUZ A;  1IBL Q;  4LNQ A;  1JJ2 A;  3A5Z B;  3PUY A;  3HFZ B;  1PYB A;  2BA1 A;  3WWV A;  5FLX c;  3HOZ G;  5LMU Q;  2GN5 A;  5M5W H;  4DV0 Q;  3NEM A;  4XIG S;  2E8G A;  3FKI G;  3GD7 A;  4JBW A;  4JI2 L;  4IPC A;  4A76 A;  4LF9 Q;  1I6H H;  1HZA A;  4Y52 H;  2AWN A;  3U4V A;  5GAH C;  1NTG A;  4X62 Q;  4DUZ L;  1QUQ A;  2KHJ A;  1WCM G;  1KC8 C;  2ZJR A;  1J5E L;  2E2J H;  4A3C G;  2JA9 A;  1PH2 A;  1YI2 A;  2ZTC A;  2EQS A;  3EN2 A;  1EIY B;  1S3O A;  3CC7 A;  1YNX A;  2KHI A;  4AIM A;  1PH4 A;  3PUX A;  4TQU S;  1GO3 E;  1N8R C;  2UXD Q;  4X65 L;  3TS0 A;  3RNU A;  3J81 i;  3DLL A;  4KHP Q;  5FJ8 H;  4PZ8 A;  3RZD H;  4YHH Q;  5IYB G;  4A3F H;  1SRU A;  4LW1 A;  4LF4 Q;  1E1T A;  3ULL A;  1M1K C;  4A3L G;  3AFP A;  3T1Y L;  5BR8 Q;  1YIT A;  2K50 A;  5BR8 L;  4IOC A;  2L15 A;  3NEN A;  4DUY Q;  1Q82 C;  4HJ8 A;  2UXB Q;  4BY1 G;  1CSP A;  3GTK H;  1DGS A;  5JEA G;  1IBM Q;  1TWF H;  2A8V A;  2ZM6 Q;  3H3V H;  2N8N A;  4EQ5 A;  1S40 A;  3CF5 A;  5IYD H;  1X6O A;  3OW2 A;  4BBS G;  1J6Q A;  4IPG A;  1IYJ B;  3I56 A;  2A19 A;  4UP9 A;  1YJW A;  2ZTD A;  4A3M H;  1E22 A;  1X65 A;  5C44 H;  4B3R Q;  5C0X G;  4LF6 L;  3KJP A;  1IBK L;  1N33 Q;  3K80 C;  1ASY A;  1X55 A;  5GQO A;  1BBW A;  4LFC L;  1G51 A;  2JA7 H;  4DR3 L;  3PIP A;  2DGY A;  1KL9 A;  1L0W A;  5C0X I;  1UE7 A;  4H02 A;  3TEH B;  4HIM A;  3EBE A;  4NXM Q;  3KDF B;  4XTC S;  4GN4 B;  5C44 G;  4B3M Q;  4DR6 L;  4WJ3 M;  4GN3 B;  4GS3 A;  2ES2 A;  1MJC A;  1I5F A;  1V9P A;  3HOV H;  1EIF A;  2JA7 G;  2OWO A;  3STB D;  2JA5 G;  3H0G H;  4WJ4 A;  3HOV G;  4JBK A;  3RLF A;  2NN6 I;  5HGQ A;  2ATW A;  3S2D H;  4JC0 A;  3ZJY C;  1K3R A;  4GOP A;  3PIO A;  4A93 H;  5FLM G;  3GTM H;  4DV4 L;  1NMF A;  1P16 A;  2JK8 A;  3M4Q A;  4JI3 L;  3UDI A;  3RLO A;  3KJO A;  3CW2 C;  4GNX C;  3G71 A;  4DR2 Q;  4LF5 Q;  3I4M H;  1PH1 A;  1OXT A;  2CKZ B;  2R7Z H;  3I4N G;  2B3G A;  1GKH A;  4JI2 Q;  2B29 A;  4GNX A;  2I5M X;  1HR0 L;  4IJL A;  2Q2U A;  1C7Y A;  1Q7Y C;  4GNX B;  4DV2 Q;  4C3H H;  3D0F A;  2CWA A;  2R93 H;  4C3J H;  4LUZ A;  4NXM L;  1K0R A;  4KHZ A;  3M4P A;  3K0X A;  3OTO L;  1X3E A;  5M3F H;  3FKI H;  1EWI A;  1HH2 P;  1K73 C;  2Y0S E;  2NVX H;  1JT8 A;  4X65 Q;  5LMN L;  2A1A A;  4NPS A;  3KF6 B;  3CCV A;  1XPU A;  3HOZ H;  4QQB X;  4HID A;  5IY0 A;  4AYB G;  4AQY Q;  3U4Z A;  3KF6 A;  2VQE Q;  1NJI C;  2CQO A;  1I94 L;  2UUA L;  4GLA C;  4IPH A;  4BY7 G;  4A3D G;  2OQK A;  2PQA A;  5M5Y H;  1XPO A;  4JV5 Q;  5IP9 G;  5IYC H;  4R4C A;  1KHI A;  4QJF A;  3UDF A;  1V1Q A;  2HIV A;  1SE8 A;  4A3F G;  4L5S A;  2PNH A;  4IFD G;  4OX9 Q;  1SRO A;  1M90 C;  1KRS A;  4YHH L;  4O0A A;  2I0Q A;  3CPF A;  4KHP L;  4DV0 L;  4HJ7 A;  5JJI A;  5ELN A;  3AQQ A;  1N33 L;  3JC6 6;  4DV3 L;  2WP8 J;  4GLV B;  1HJP A;  5E7N A;  1XMO L;  4LWC A;  1CSQ A;  4DK3 C;  4BBR G;  3HKZ G;  5IWA L;  1X3G A;  2YTY A;  3CQZ H;  1N36 L;  2ASB A;  4OO1 G;  3CCE A;  2UXC Q;  1VQC A;  2ALY B;  4HIK A;  2IX1 A;  1N34 Q;  1IXR A;  3A74 A;  4P72 A;  1XMQ Q;  4K0K L;  3JAM i;  3RN5 A;  2FXQ A;  2BA0 A;  2GVB A;  4P71 A;  4LFC Q;  1XPR A;  3H3V I;  4JOI A;  3J81 j;  1Y14 B;  3M9B A;  1HR0 W;  2I5L X;  3RR5 A;  1WYD A;  2K75 A;  3LGJ A;  1VQJ A;  5LMN W;  3GTL H;  4BXX G;  4DV6 Q;  1HNX Q;  3RZO H;  4A3E G;  3PO2 G;  4LUV A;  4LF8 Q;  3W1B A;  5IE8 A;  1EUJ A;  2HHH Q;  2VZA A;  3HOY G;  1X54 A;  1MJE A;  5LMN Q;  1UEB A;  1VQG A;  5AJ3 L;  1IBM L;  3ULP A;  1I50 H;  4A3G H;  4DUZ Q;  1Z47 A;  4X64 Q;  2EXD A;  3TQY A;  4UP7 A;  1VQ4 A;  2K4K A;  3CCM A;  1FL0 A;  1XMQ L;  4K0K Q;  1R9T H;  5K36 G;  1B70 B;  2AWO A;  4ME3 A;  2Q2H A;  2UXD L;  1GD7 A;  4GOP C;  5FLM H;  1HR0 Q;  2JA6 G;  2H5X A;  5JJL A;  2R92 H;  5IWA Q;  4DPG A;  2KEN A;  4LFA L;  1JJC B;  2RHS B;  3CPW A;  2OTJ A;  1EFW A;  3GTO H;  2K5H A;  1OXV A;  2C35 B;  2CFM A;  2KBN A;  3K8A A;  4JI5 L;  1YIJ A;  2R92 G;  4LUO A;  1EQR A;  2Y0S G;  1N32 L;  3MEF A;  1A63 A;  2N49 A;  1HNZ L;  3PF4 A;  4OON A;  2GVA A;  5IYC G;  3A5U A;  2N78 A;  1AE2 A;  2QGQ A;  4MNO A;  1PH8 A;  3CCS A;  5IP7 H;  1B8A A;  4JI8 Q;  2JA8 H;  1UE1 A;  1RIP A;  4B3T L;  1S72 A;  4IPD A;  1RL2 A;  3T1H L;  1YJ9 A;  4JYA Q;  2IHE A;  3HOW G;  4Y7N H;  4JBM A;  1X9N A;  2ZJP A;  4JI0 Q;  2VQE L;  1XMO Q;  4JI7 Q;  5C3E G;  4NXN Q;  4DR3 Q;  4LFB Q;  2YYZ A;  5IP7 G;  1OXS C;  4OWW B;  2CWP A;  3NBH B;  1YBY A;  3K7U C;  3KDF A;  4RMF A;  1E1O A;  4MZ9 A;  1XTD A;  1LYL A;  3AYH B;  1QVG A;  4EX5 A;  1GM5 A;  4JI6 Q;  1VQL A;  4BY1 H;  3TS2 A;  2YTX A;  4DKA C;  5M3M G;  4POF A;  4UP8 A;  2LXJ A;  2ZM6 L;  1C0A A;  4DV5 L;  3B6Y A;  2PMZ E;  1G6P A;  4BBS H;  2UUB Q;  3J80 c; 
#chains in the Genus database with same CATH topology
 2UXB L;  4GKK L;  1CFM A;  1VF5 C;  3HOU H;  3WOE A;  3FPU B;  4NKL A;  4R1J A;  3W1G A;  1DCZ A;  2X6L A;  5AFW A;  2PYK A;  1F2M A;  4E6I A;  2WB1 G;  4UPA A;  1Y1W H;  5LMU L;  2XVS A;  2D62 A;  5KYI A;  2E5L Q;  1IYV A;  1STH A;  3MXN B;  1Y1W G;  1BF4 A;  1EEF D;  1X56 A;  4PZ7 A;  5C3W A;  3R3O A;  1H95 A;  3E9H A;  4JOI C;  1S5B D;  4A3G B;  4LF5 L;  4JCV E;  1H9K A;  4DNI A;  4RKL A;  3FEW X;  4CDE C;  4YY3 Q;  3BU2 A;  3BJU A;  4R4T A;  3V96 A;  1K9M C;  2JA5 B;  4RKB A;  3M7N A;  2A6H C;  2SOB A;  2IHF A;  3K6O A;  1W6K A;  5JVH 3;  2EVB A;  3O13 A;  1VQF A;  4KY5 A;  4A3I G;  3I90 A;  2F0Q A;  2D0P A;  3KOJ A;  2KCT A;  3PUV A;  3OTO Q;  3HOV B;  1W2B A;  4RGT A;  3OYY A;  4G57 A;  3S15 H;  4DR1 L;  1CK1 A;  4OXP A;  4R4I A;  4LF8 L;  3M3Y H;  4GOP B;  4DR5 Q;  1PFB A;  2HT1 A;  4DR7 L;  2E2D C;  1H9R A;  1MGS A;  4BS9 A;  2MO0 A;  4KHV A;  4DUY L;  2RCN A;  1HQM C;  4IUQ A;  5C4X G;  4X3T A;  4DV7 Q;  4R8N A;  5C4X H;  3BDL A;  5IT9 L;  2IX0 A;  1V1P B;  4MTN A;  3BDC A;  4X66 Q;  2NN6 H;  3DWQ A;  2J0T D;  1XYI A;  3M85 A;  4KLK A;  3U9O A;  1VQ6 A;  4FF1 A;  1YHA A;  2F0H A;  5DM7 3;  2NVY B;  1RKN A;  5FJ8 G;  3OHX C;  5EPK A;  5M9O A;  4IUR A;  1CHP D;  3F2B A;  2P5Z X;  1TY0 A;  1UWV A;  2R7D A;  3OMC A;  1H9J A;  1Q86 C;  1LM0 A;  5IGC A;  5F2D A;  4LF7 Q;  3SGI A;  1IBL L;  3P1H A;  3GTJ B;  3DWA A;  4XT1 B;  3AEV A;  5D3I B;  4LF4 L;  2PW7 A;  3NHH A;  3G4S A;  5JEA J;  4KY6 A;  1I4R A;  5E3F A;  2CCZ A;  1BXT A;  2YV5 A;  4PNY A;  1PVO A;  1WTV A;  3S9W A;  1EZ6 A;  2A6E D;  1H9M A;  1CA5 A;  2EE1 A;  3MZ5 A;  1S5F D;  1SNM A;  1IL2 A;  3DWP A;  2IT1 A;  4B3R L;  1TWH B;  1U5K A;  3I91 A;  4KJO A;  3TN2 A;  4LFA Q;  1TWF B;  3BZK A;  2JEB I;  4TKO B;  4DAV A;  3T1H Q;  4CBV A;  4KMU C;  4X62 L;  2PI2 E;  1RCV D;  1V43 A;  1VMC A;  1KNA A;  2JP1 A;  4QGU A;  1Q8I A;  1ICW A;  1PTO D;  1AH9 A;  3FP9 A;  2PMZ B;  2ID0 A;  4G7O C;  2MNA A;  1L1O C;  2EYM A;  2XGT A;  3VYS A;  1L0Y B;  4BY7 H;  2Z9H A;  1BBX C;  2PI2 A;  2F4V Q;  2F52 A;  1U4R A;  4HIO A;  1S5E D;  1GVP A;  3BG3 A;  3NWT A;  2YTV A;  1PFN A;  1QNU A;  2JA8 G;  4RHS A;  3S1M B;  5EPJ A;  3K81 C;  4FF2 A;  2NZ1 D;  2UXC L;  1ZEQ X;  2WAQ G;  1BCP D;  1GHK A;  3A54 A;  4FP5 D;  4O42 A;  2AHO B;  2K5W A;  2QIL A;  3OSO A;  1GUW A;  3CRK C;  2UUC L;  1E0B A;  1YNN D;  1VCI A;  2HCC A;  1HNW L;  1CQV A;  3TP5 A;  3J7A V;  1JOQ A;  2D9U A;  4JI1 Q;  4CKE A;  1DD2 A;  2OTL A;  3F8T A;  3NTK A;  4DR4 L;  4U67 3;  5I2X A;  3CMA A;  2QDL A;  3I4N B;  1QUQ B;  4CJ0 B;  3S1N H;  3F2D A;  3A56 A;  1W3S A;  4UAI A;  1B7Y B;  3PSI A;  1TXY A;  4A75 A;  4DR1 Q;  1UNS A;  2EY2 A;  2BE5 C;  5DAU A;  4PG3 A;  3AB9 A;  4APV A;  4C3H G;  2VUM G;  2LKV A;  2Z4H A;  3LNN A;  3J7Z C;  1CKO A;  1HZ9 A;  2SNM A;  4P74 A;  5J1Z A;  3P20 A;  1SXT A;  1LUZ A;  5C4H A;  3HFZ B;  2BA1 A;  3WWV A;  5NUC A;  2GN5 A;  2E8G A;  1K8M A;  4JBW A;  4JI2 L;  1HZA A;  4Y52 H;  4PMC A;  5EBD A;  5ELC A;  1NTG A;  3CQZ B;  4A3C G;  2ZJR A;  1JWS D;  1EYA A;  2JA9 A;  1MBY A;  2ZTC A;  3EN2 A;  2F0P A;  4AIM A;  4UHV A;  4TQU S;  4Q0F A;  1SMY C;  5IOC A;  3J81 i;  3RZD H;  2PCF B;  1SRU A;  4LW1 A;  4ZCK A;  5FO9 B;  5BR8 Q;  1YIT A;  2K50 A;  3S14 B;  2UXB Q;  3GTK H;  1X6O A;  4IPG A;  4UP9 A;  2ZTD A;  1N33 Q;  4S3S A;  2EDG A;  1X55 A;  2CQA A;  1BBW A;  1EY0 A;  4C1N I;  1G51 A;  2DGY A;  1UE7 A;  3S2H B;  3KDF B;  1D1I A;  4GN4 B;  5C44 G;  5I6Y A;  4GS3 A;  2K03 A;  3TP8 A;  3Q0A A;  5C44 B;  2OWO A;  4QUC A;  2ZT9 C;  1SEB D;  2Q8I B;  4CHT B;  1K3R A;  2F0S A;  4A93 H;  5LHY 1;  1X3Q A;  2CW0 C;  3S1N B;  2JK8 A;  4GNX C;  4DR2 Q;  1PH1 A;  2CKZ B;  4L6T B;  4DK1 A;  4L63 B;  4GNX A;  4QUF A;  4OL7 A;  4GNX B;  2CWA A;  2R93 H;  4RGO S;  4LUZ A;  1HRJ A;  4OEL B;  3K0X A;  5M3F H;  4ZUJ A;  2FMC A;  3AU7 A;  4B9X A;  1K73 C;  1F9P A;  2NVX H;  3HZX A;  1O7Y A;  5LMN L;  2VXW A;  1F9S A;  4IUP A;  1I94 L;  5IY0 A;  1NJI C;  1TU2 B;  1I4P A;  4IPH A;  1GUS A;  4HN7 A;  5C3E B;  2PZT A;  5IP9 G;  1E2V A;  5E1F A;  2WIN B;  1KHI A;  1V1Q A;  4A3F G;  3LWU A;  4CDF C;  4IFD G;  1EOT A;  2V4D A;  2FFK B;  3CPF A;  1X32 A;  4DV0 L;  4KKS A;  4DV3 L;  4PQX A;  5M5X B;  2DNC A;  4BY7 B;  1CSQ A;  3BVZ A;  5IWA L;  4OO1 G;  2RDF A;  1EZ8 A;  3CCE A;  1SND A;  2ALY B;  5EPL A;  3M4O B;  1IL8 A;  1IXR A;  3A74 A;  3EA6 A;  3FKI B;  1N34 Q;  3JAM i;  1I50 B;  3OWF A;  1U4P A;  2GVB A;  2L5T A;  4P71 A;  2FIN B;  5C4Z A;  3C1F A;  1XPR A;  4OIJ A;  1VQJ A;  1PTO H;  1NCV A;  2NBF A;  5LMN W;  2MGS A;  4DV6 Q;  1HNX Q;  4C56 C;  4A3E G;  2D2C C;  4LF8 Q;  3HOY G;  1EUJ A;  2HHH Q;  1RTN A;  2VZA A;  3D8G A;  4OEM B;  1SSO A;  1EIG A;  1KNE A;  2X69 A;  4A3G H;  3EJI A;  1HTL D;  2LS0 1;  4RAU C;  4V19 0;  1EL0 A;  2K4K A;  1XMQ L;  4K0K Q;  1F9Q A;  2UXD L;  2EY5 A;  3CU7 A;  1KLU D;  5EBC A;  2JA6 G;  5JJL A;  1VMP A;  2CH4 A;  4DPG A;  3NTH A;  2JXM B;  2KQ3 A;  1HA5 A;  1K3B C;  1EFW A;  5COY A;  2C35 B;  2R92 G;  1LT3 D;  1FNV A;  1EQR A;  1O7L A;  1K83 B;  4L8J A;  3GTK B;  1GXD C;  1B1Z A;  3V05 A;  1HNZ L;  3PF4 A;  2JA8 H;  1AE2 A;  4DA2 A;  1PH8 A;  4BBS B;  2IJ0 A;  3CCS A;  1B8A A;  1S72 A;  4IPD A;  5EKK A;  2O2L D;  1RD9 D;  2RKS A;  3HOW G;  1ET9 A;  1OXS C;  4OWW B;  1J8I A;  2CWP A;  3K7U C;  1E1O A;  4MZ9 A;  3R8B A;  1VQL A;  1HCZ A;  3TS2 A;  1T5X D;  2YTX A;  2WAC A;  3HEJ A;  1SNQ A;  2ZM6 L;  3MXP A;  2CQO A;  2NZH A;  1STG A;  1KQS A;  3DM3 A;  2JE6 I;  2Z6K C;  2A74 C;  1JE5 A;  1K83 H;  1SNC A;  1MD2 D;  3JAM c;  2BE5 D;  4YIJ A;  4GKJ L;  4HJA A;  4EQP A;  2QKI C;  3D3R A;  1MSG A;  1G91 A;  1NY4 A;  3PGZ A;  1L2F A;  2LY7 A;  5COR A;  4B3S Q;  2F3I A;  4OO1 I;  4XYO A;  4QY7 A;  1WTO A;  2NVT H;  4IJH A;  4X3K A;  3IFT A;  3PMF A;  1Z6H A;  5IGE A;  2XRQ D;  2PNR C;  1T5E A;  4BA2 I;  3VDY A;  2YU9 B;  4HMJ A;  4YWK A;  3W2D A;  1D7Q A;  3ULJ A;  1KRT A;  4A3K H;  3GV3 A;  4IN3 A;  2O5J C;  1ESF A;  4WRD A;  4J15 A;  1BKB A;  2WII B;  3T1Y Q;  1O7I A;  1SE4 A;  4ZRZ A;  1JJG A;  1K28 A;  3J80 E;  2I5H A;  4OWT B;  1AFP A;  4PMW A;  1SE2 A;  4RA8 A;  2JEA I;  1TWA B;  2B2W A;  2B63 H;  3HOW H;  2NVQ B;  3NSW A;  4FXD A;  2IY5 B;  3CAM A;  3CXC A;  3F2C A;  2FHT A;  1CKM A;  2DY7 A;  4JG2 A;  4ODG A;  4KTA A;  3S1R B;  1XTC D;  3T56 B;  5CMD A;  3C46 A;  3PO2 B;  1QE6 A;  2N55 A;  2SDF A;  2RHQ B;  1XNQ L;  1HUM A;  4G7H C;  3DHQ A;  3SVM A;  5HY6 A;  1YHQ A;  3C1E A;  4IUN A;  4EGV A;  1EU4 A;  1TT2 A;  1E2Z A;  1A62 A;  2NTT A;  2VNU D;  2NVX B;  1OXX K;  4C3I G;  2ZXR A;  2EY6 A;  2F0N A;  1G2S A;  1M8A A;  1PMR A;  5KNB A;  1NNX A;  1U0L A;  4F7X A;  5G3L D;  4GKJ Q;  1WOC A;  5EQ0 A;  5C4J H;  2OQ0 A;  2K5V A;  2MJ8 A;  3L9A X;  2Q8R E;  4WJW A;  1WI5 A;  4BXX H;  1R4Q B;  2AQ1 B;  1NR2 A;  1STB A;  1BDO A;  1TWG H;  1WCM B;  3OIP A;  4RH6 A;  2NVT B;  3ER0 A;  1PH5 A;  4O2D A;  3MXG A;  1YEZ A;  5DNF A;  3H15 A;  3FMC A;  1QCB D;  4HMI A;  2PO4 A;  3CME A;  3HP3 A;  4C3I B;  1I3Q B;  4EQO A;  4DV4 Q;  1CKN B;  2ICE C;  2Z6K A;  1A2U A;  3I4M G;  1A3T A;  4KKT A;  3TRZ A;  1G8Z D;  1Y1W B;  1WVL A;  3QG1 A;  5CC4 A;  4KN4 C;  2L55 A;  2F0T A;  2XWJ B;  2R7F A;  3MXU A;  1ZYR C;  4AH6 A;  1HQR D;  3GDE A;  1Q8K A;  4P75 A;  2QEJ C;  2ZTE A;  5JOB A;  2SNS A;  5M3M H;  4HSV A;  1Q3L A;  5I2Y A;  4DV2 L;  2NVY H;  1FGU A;  2TMP A;  2UUA Q;  1SR3 A;  3I4O A;  1WD0 A;  1L1O A;  3FHW A;  3I70 A;  3STB C;  2KOL A;  3ERQ A;  3IRB A;  3MC0 B;  5C4X B;  1VQ5 A;  2VQF Q;  4KV6 A;  1D8L A;  4Z9C B;  3QOL A;  2VL6 A;  1BVS A;  4X66 L;  1KD1 C;  1HZB A;  3IKJ A;  2KCN A;  2K5N A;  1VQ7 A;  2HHH L;  2JSO A;  4JK1 C;  3HOZ B;  1A0I A;  1HNX L;  4XDX A;  4DV7 L;  2E2I H;  3GV6 A;  4BA1 I;  4DV3 Q;  3CC2 A;  1D2B A;  4DF7 A;  3RN2 A;  3SEB A;  4OO1 H;  2BH2 A;  2F0D A;  4DR4 Q;  4DV1 L;  2L0C A;  1TWA H;  3GQB A;  4RCO A;  3J7A 5;  3T16 A;  4MTK A;  3G48 A;  4G7Z C;  3CCL A;  3J81 E;  4K6L A;  4A3J H;  2RBM A;  3QWN A;  3KF8 B;  1AEX A;  1X3F A;  3K57 A;  4A3K G;  1N32 Q;  1JOO A;  1CUK A;  4YCU A;  1S5D D;  2UUC Q;  3VR3 A;  3GTJ H;  3W3A A;  4R4O A;  5CV7 A;  3GTM B;  2YU9 H;  3CCU A;  1KDB A;  4YWM A;  2UUB L;  2RVL A;  4A3I H;  1BCP B;  3E0J A;  2AQ3 B;  3MVV A;  3VYU A;  2RF4 A;  4J6H A;  1SN8 A;  1A3V A;  5LL6 S;  1HNW Q;  1PTO F;  2F4V L;  5ELO A;  1YJN A;  3E9I A;  1GUO A;  4DAP A;  3HOX B;  2VW9 A;  3TME A;  1J9O A;  3N52 A;  1KIX A;  1C48 A;  1JJ2 A;  2RSN A;  3RD4 A;  1EWC A;  2Z1C A;  1HPC A;  5LMU Q;  2E2H B;  4XIG S;  4AYB B;  3KLS X;  5M5Y B;  4A76 A;  4LF9 Q;  2F0L A;  4C3J G;  2F0M A;  4CDD C;  4K6D A;  5GAH C;  4X62 Q;  1LT6 D;  1WCM G;  1LT5 D;  4CJ2 C;  4RHR A;  1PH2 A;  3IL8 A;  1H9S A;  1EIY B;  2BDO A;  3RMH A;  2KHI A;  3K59 A;  5KND A;  1GO3 E;  1TR5 A;  3G6J B;  1N8R C;  4X65 L;  3FDT A;  4KHP Q;  4QCL A;  5FJ8 H;  1TWC B;  4IUT A;  3SK4 A;  4LF4 Q;  1E1T A;  4A3L G;  5BR8 L;  2L15 A;  3NEN A;  1QNK A;  2DN8 A;  1BO0 A;  1DGS A;  5IGB A;  1ILQ A;  1GHJ A;  1S40 A;  1STN A;  3CF5 A;  4BBS G;  5G3L F;  4V0B A;  3VR4 A;  1X65 A;  5C44 H;  4B3R Q;  5C0X G;  3JAM L;  1F9R A;  2L12 A;  3E5S A;  2KEE A;  4DAY A;  2R92 B;  5C0X H;  4DR3 L;  3PIP A;  1L0W A;  3TEH B;  3EBE A;  4B3M Q;  1MJC A;  1I5F A;  2KEC A;  1EIF A;  4HAE A;  2JA7 G;  1SAP A;  3H0G H;  1SYB A;  2ATW A;  3S2D H;  4GOP A;  2ZXO A;  2X6G A;  3GTM H;  1NMF A;  1P16 A;  3UDI A;  2DJG C;  4XT3 B;  3WDN A;  3G71 A;  1SDF A;  5HUR A;  2R7Z H;  3I4N G;  1JB3 A;  4JI2 Q;  3HOY B;  3N6R A;  2MHV A;  1Q7Y C;  1C7Y A;  4DV2 Q;  4C3H H;  1V1P A;  4FXK C;  2EYL A;  3M4P A;  3OTO L;  3FKI H;  4IAL A;  5FO8 B;  4WFN 3;  3PQI A;  3QR8 A;  3NQI A;  1TS4 A;  3BYY B;  2Y0S E;  1A6X A;  1JT8 A;  5EGT A;  1PFM A;  3NBI A;  1AP0 A;  3NE5 B;  2A1A A;  2HDM A;  3OMG A;  3KF6 B;  3CCV A;  2H4O A;  4QQB X;  2EY1 A;  4AQY Q;  2UUA L;  3KF6 A;  2VQE Q;  2RCF A;  4GLA C;  4BY7 G;  2H1E A;  4ILW A;  1DXM A;  5FOB B;  3MHB A;  1PRT F;  4QJF A;  1FR3 A;  2B8F A;  2HIV A;  4ZUI A;  3K5L A;  4L5S A;  2BOS A;  1O78 A;  2PNH A;  2TSS A;  1ZXT A;  3KBX A;  4DXG A;  4DU9 A;  4ZKC B;  4KHP L;  4HJ7 A;  5ELN A;  3S17 B;  3CHB D;  2N88 A;  3JC6 6;  4H7B A;  2WP8 J;  4DNT B;  3S1Q B;  3I8Z A;  5E7N A;  1XMO L;  3F2U A;  3UI2 A;  2F0G A;  1EY6 A;  4BBR G;  4DK3 C;  3NBH A;  2ASB A;  3SHL A;  2KED A;  4P72 A;  2K33 A;  1FYC A;  2Z6B A;  3M9B A;  4HCE A;  3VA7 A;  3RR5 A;  3LGJ A;  2Z4I A;  3NUC A;  4BXX G;  2EZV A;  4ME5 A;  4LUV A;  2JA6 B;  2K5D A;  3ULP A;  2A69 C;  1KLG D;  4UP7 A;  4CGY B;  3HOW B;  4OGQ C;  1F2L A;  3CCM A;  2HCI A;  5K36 G;  1B70 B;  1EY9 A;  2Q2H A;  3S16 B;  3D4D A;  1GD7 A;  1HR0 Q;  3X3N A;  2H5X A;  3J7A F;  1AZQ A;  4LFA L;  1ROD A;  2HQE A;  2RHS B;  3CPW A;  1PDQ A;  4BBR B;  1QIL A;  3GTO H;  2K5H A;  4CDC C;  1O80 A;  2Y0S G;  1YNJ C;  1N32 L;  2N49 A;  2IW3 A;  2WKC A;  2N78 A;  3S2D B;  4QB4 A;  5IP7 H;  4JI8 Q;  1UE1 A;  4MIU A;  3T1H L;  4N8F A;  5KYL A;  1X9N A;  1XMO Q;  2EYP A;  2E75 C;  5IGF A;  3A7L A;  2EYF A;  3NBH B;  5LL6 X;  1LYL A;  1TS2 A;  3AYH B;  3OIQ A;  2E2I B;  3K5M A;  3QO2 A;  3J80 L;  4IUU A;  4JI6 Q;  1WTH A;  5FLX L;  2DNE A;  1JIC A;  4DKA C;  4POF A;  2LXJ A;  3I72 A;  2EYH A;  1HA6 A;  2PMZ E;  4BBS H;  2UUB Q;  3J80 c;  1WFQ A;  5IGG A;  1GOZ A;  3PUZ A;  4A3J G;  1NAP A;  3TP7 A;  5ELB A;  1JC7 A;  4AQY L;  5I6W A;  3CKI B;  3F1Z A;  3D6W A;  4DGZ A;  3SK8 A;  5AJ3 Q;  4A3E H;  4C2M H;  4EVO A;  5EKL A;  4KY7 A;  4LF7 L;  2B2Y C;  5M3M B;  3GTG H;  1SYF A;  4C3I H;  3H0G G;  3E3X A;  1Y1V G;  3L0O A;  1WD1 A;  4KI0 A;  3VYR A;  1CKN A;  4P73 A;  1PYW D;  3CCJ A;  3UDX A;  4DV1 Q;  1FNU A;  5FLX E;  1RF2 D;  3VR6 A;  4CKB A;  5CYU A;  4QIW E;  4DR5 L;  2JA5 H;  2I46 A;  3I7F A;  1ENF A;  1CA6 A;  2KCC A;  4C1N K;  1PLF A;  2NWG A;  1AE3 A;  2EJM A;  3KUP A;  2UU9 Q;  4GLX A;  1LTS D;  3FRP B;  4R4Q A;  1WTW A;  3QB3 A;  1K8G A;  1VQP A;  3EIV A;  1DZ1 A;  1S4Z A;  1SMX A;  1EY5 A;  2DUD A;  3A8I E;  2IPK D;  1GUN A;  4TVA B;  1VS0 A;  4FXG C;  3MTS A;  1TY2 A;  1G2T A;  4XXE A;  1RJT A;  5GAE C;  4IOA A;  1ICF B;  5JPN C;  1SNO A;  4LJZ C;  5I4D A;  1B9N A;  1FGB D;  3ONA B;  4A3M B;  3S17 H;  4R8I A;  1SFO B;  2VS1 A;  1KAA A;  3C3L A;  4WOR A;  3GTL B;  1QVF A;  2EJG C;  4HTH A;  2NN6 G;  5C3E H;  2K52 A;  5C0X J;  4ALP A;  3D31 A;  3H6M A;  5A2Q E;  3TBI B;  2E5L L;  1K0S A;  4HR7 B;  1NSN S;  4JI3 Q;  1PRT D;  1ZKO A;  4RFB A;  2Q8T A;  1B4O A;  1IBK Q;  4LF6 Q;  1QJO A;  2HQL A;  4DAM A;  4LF9 L;  3CD6 A;  2L1B A;  3CCQ A;  1LTG D;  3HKZ B;  3KF8 A;  2PQA B;  4GKK Q;  5IP9 H;  2EJF C;  4A3B H;  1T9H A;  3SXH A;  3PO2 H;  2BDN A;  3I3C A;  1JWM D;  4XQJ A;  1ML0 D;  3U50 C;  1ASZ A;  3FVQ A;  1CZG A;  2J7Z A;  3RLN A;  5J3B A;  4FDB A;  3NWS A;  2R7Z B;  1EQQ A;  2LSS A;  5EJW A;  4GN5 A;  2UU9 L;  1OTC A;  3PO3 H;  1VQI A;  1I3Q H;  2Z8L A;  1BUV T;  2N3S A;  4HJ9 A;  2XRS D;  3T53 B;  1UE5 A;  1SYE A;  2WAQ E;  4NB3 A;  1Q46 A;  1XNQ Q;  3EVQ A;  1KDA A;  2XNA C;  3NXW A;  3DMU A;  5JPM C;  3W5O A;  1N34 L;  1CT1 D;  4Q5V A;  5CV8 A;  4B3T Q;  5FO7 B;  3SR1 A;  2ZJQ A;  5EAY A;  4JI5 Q;  2JA6 H;  4LFB L;  1VDZ A;  4NXN L;  1HFN A;  3UE0 A;  1I94 Q;  5ISR A;  2B8G A;  1Z9F A;  1I4X A;  1VQA A;  3G6E A;  1Q12 A;  4ZK9 B;  5HGT A;  4JPB W;  4YCW A;  4F8M A;  1FJG Q;  2QCP X;  3KYH C;  1PH6 A;  4YCV A;  3H91 A;  4JI4 L;  1TWC H;  3NEL A;  3NQT A;  2R3Z A;  2DJF C;  3G7L A;  3L2P A;  1R4P B;  2KVM A;  2NZO A;  1WCM H;  4FF3 A;  3E6Z X;  3K7A H;  5M3F G;  5T1I A;  2Q2T A;  3KLW A;  5BN4 A;  1SJE D;  1I4G A;  1J5E Q;  1JWU D;  1NMG A;  5JVG 3;  3Q24 A;  1B2T A;  2VQF L;  1K8A C;  3H94 A;  5GAG C;  3CC4 A;  1XNR Q;  4X6A H;  1MIU A;  3S24 A;  1Q1B A;  3MFG A;  3S1M H;  1NBW A;  1PYS B;  3U58 A;  4A4I A;  2E2H H;  3KK7 A;  5EKI A;  3MAQ A;  2BCO A;  2D0O A;  5H1S E;  1TVX A;  4JI8 L;  4JW0 A;  4PZ6 A;  5DEH A;  2XTI A;  1Q81 C;  3C2P A;  4QIW B;  1PV4 A;  2A68 D;  2NVQ H;  3OWE B;  1LAB A;  1OXU A;  3GO5 A;  3BYT B;  4HCS A;  3PO3 G;  1EOV A;  2EYJ A;  4OX9 L;  1SJH D;  2K6A A;  2PZU A;  2EXZ A;  2OEO A;  1KXL A;  4NP5 A;  2Z0S A;  1C9O A;  1ONL A;  1PZI D;  1PH9 A;  4KJN A;  1STA A;  1YVC A;  3CCR A;  1BCP F;  5KGU A;  4M1U B;  4DXF A;  3HKZ E;  5JJK A;  1HZC A;  3J80 i;  2HD3 A;  1WJJ A;  5GAD C;  1YZ6 A;  3R93 A;  1YHB A;  3MXN A;  3VA5 A;  1FNW A;  3KLR A;  5IT9 c;  3BVM A;  5FKA C;  1Q1E A;  2G9D A;  1NR4 A;  1DOM A;  4ZAI A;  5TSS A;  1UUP A;  4K5W A;  3CP0 A;  3S2H H;  1VQH A;  4N9T A;  3ERS X;  3GTP H;  4KD4 A;  1QZH A;  2PW5 A;  4NMZ A;  2R6G A;  1CTM A;  1EIH A;  1LT4 D;  1EY8 A;  1QVC A;  4POG A;  2L9H A;  1QWY A;  4LNQ A;  4KD3 A;  5C5M A;  3T4A C;  3A5Z B;  5CV4 A;  1PYB A;  1G6Z A;  3MA2 B;  4B9W A;  1BR9 A;  2F0O A;  2CH4 W;  3GD7 A;  4IPC A;  1PTO C;  3Q23 A;  1I6H H;  2AWN A;  4K5V A;  5D14 A;  4K2K A;  3SK6 A;  1STE A;  4ZKB B;  1PRT C;  2EQS A;  1F2Y A;  1S3O A;  3L3O C;  3CC7 A;  3I4L A;  3DM1 A;  3BDO A;  2RSO A;  1SBB B;  2UXD Q;  4H13 C;  3HRZ C;  4PZ8 A;  1DM0 B;  4A3F H;  1LAC A;  1D1K A;  4Y7N B;  1HXY D;  3NTI A;  4IOC A;  2JYO A;  1EY4 A;  4BY1 G;  1TWF H;  2A8V A;  1YNJ D;  3X3M A;  1WTP A;  3R2I A;  3J81 L;  1TQO A;  1LTR D;  3TSS A;  2M9V A;  3M3Y B;  3KJP A;  1LTA D;  3K80 C;  1JE4 A;  2JA7 H;  1KL9 A;  4I7Z C;  2MPM A;  4A3I B;  5D65 A;  4DR6 L;  4WJ3 M;  3K58 A;  1V9P A;  2A6E C;  3K5O A;  4RWS C;  2K32 A;  1X3P A;  3STB D;  3ND8 A;  3A8K E;  2JA5 G;  4JBK A;  1DOK A;  2NN6 I;  4JC0 A;  3ZJY C;  4MHE A;  1LTB D;  4B3T L;  5IOD A;  4PV1 C;  3KJO A;  2M2L A;  3RLO A;  3I4M H;  1OXT A;  1SNP A;  4M8A A;  2PZW A;  4GZY C;  2FMM A;  1EQT A;  1HR0 L;  2C5C A;  2XSC A;  3D0F A;  3D4W A;  4C3J H;  4KHZ A;  4OHJ A;  4BY1 B;  2OF1 A;  5K5P A;  3EFX D;  4X65 Q;  4NPS A;  3WOF A;  3HOZ H;  4AYB G;  1AN8 A;  3U4Z A;  5IIF A;  1B53 A;  3DEO A;  5M5Y H;  4JV5 Q;  5IYC H;  4R4C A;  1I6H B;  1TS3 A;  4OIK A;  1D5M C;  3UDF A;  5A2Q L;  1SE3 A;  4I7A A;  2OXP A;  4O0A A;  1BCP C;  5JJI A;  2MP1 A;  3AQQ A;  2IWH A;  3IAY A;  1N33 L;  4GLV B;  1HJP A;  1QOH A;  3Q22 A;  3HKZ G;  2F0W A;  1X3G A;  1YNN C;  3CQZ H;  1A3U A;  1IKM A;  3HGB A;  4C3J B;  4HIK A;  2IX1 A;  2B2T C;  2G9H D;  3EQL C;  2R61 A;  1PRT B;  3H3V I;  4JOI A;  4DNR B;  1Y14 B;  3J81 j;  1WYD A;  2K75 A;  4A3K B;  3P7J A;  3RZO B;  3GTL H;  3RZO H;  3W1B A;  2A69 D;  4EQN A;  1MJE A;  3PIO 3;  3Q6S A;  1STY A;  4HSP A;  2K04 A;  1WTX A;  3LWE A;  1I50 H;  5JAV A;  2B63 B;  1A2T A;  1RHP A;  1EY7 A;  1D5Z C;  3TQY A;  1KTK A;  4K8J A;  5CBE E;  1FL0 A;  2B39 A;  4TSS A;  3DEP A;  3GTG B;  2AWO A;  2L11 A;  1Y1V B;  4GOP C;  5FLM H;  2R92 H;  4B08 A;  2KEN A;  2PPB C;  1AZP A;  3VR5 A;  2FJ2 A;  1OXV A;  2CFM A;  2KBN A;  2XIW A;  2KA7 A;  4LUO A;  3A7A B;  5C6A A;  3QOJ A;  1HTP A;  2SEB D;  4OON A;  2CHB D;  4A93 B;  1RIP A;  4A3F B;  4A3J B;  3RZD B;  1YJ9 A;  1TKW B;  4KKU A;  1PXU A;  2IHE A;  1SYG A;  3ITP A;  1ENA A;  4JI7 Q;  2VQE L;  1Q90 A;  2M00 A;  5C3E G;  4DR3 Q;  2YYZ A;  5IP7 G;  4RMF A;  3KDF A;  1W6J A;  1XTD A;  1I6V C;  1BQQ T;  4KK7 A;  4EX5 A;  1KDC A;  5M3F B;  4BY1 H;  5M3M G;  4XQQ A;  4C2M B;  1LV9 A;  4K8I A;  1C0A A;  4XYQ A;  2F0V A;  2UXC Q;  2IX3 A;  1E7Z A;  1VF7 A;  3S1R H;  1MKH A;  2AUK A;  5CR3 A;  2WV6 D;  3SE0 A;  4CKC A;  1PFS A;  3I4M B;  3OOC A;  2EIF A;  2JN4 A;  3MWY W;  5M5W B;  4JI6 L;  2CVR A;  4L5T A;  2I07 B;  3RUZ A;  2E74 C;  2WB1 E;  1JMC A;  3HOU G;  4H0L C;  1KAB A;  4UY8 C;  1R9T B;  5T1G A;  4B3M L;  2OCE A;  4TRD A;  2VB3 X;  3L7Z C;  3PV0 A;  2ZXP A;  3FPP A;  2VUM H;  1BNZ A;  1L1O B;  4DR2 L;  1EQV A;  1EYD A;  1TS5 A;  3BZC A;  3LX0 A;  5IYD G;  1IZ6 A;  3UDG A;  2K1B A;  1Y8O B;  2XN9 C;  1MHW C;  1IKL A;  1BBU A;  5KRU A;  1PTO B;  1EFI D;  4RCN A;  2Y0S B;  4IO9 A;  2R7Z G;  2MFI A;  1PA6 A;  1EU3 A;  2F0K A;  4JI0 L;  3GTP B;  3S16 H;  3TZU A;  4QL5 A;  3OW7 A;  3PIP 3;  3HKS A;  4G4K A;  2AUJ D;  1EYC A;  1WTR A;  1DON A;  4RG1 A;  1IW7 C;  2O4X A;  3H3V C;  4IFD H;  4L5Q A;  2F0U A;  3I55 A;  2B2T A;  1M4V A;  1XX8 A;  3PCO B;  4JYA L;  1QG7 A;  3GTQ B;  3S14 H;  1PHJ A;  2JQO A;  4FVM A;  3H09 A;  3AFQ A;  1F2Z A;  2F4I A;  4IFD J;  2O5I C;  1XNR L;  2F3W A;  1IHZ A;  2AKW B;  1SYC A;  2V1C C;  2VY3 A;  1EEI D;  4DAY B;  3BS1 A;  1MI2 A;  3S1Q H;  3M4Y A;  1E24 A;  5DLQ E;  4A3D H;  4C3H B;  3IFD A;  3NPP A;  4DN4 M;  3A0J A;  4DR6 Q;  5CGK A;  1ESR A;  3TDQ A;  3GTQ H;  1LO5 D;  1FJG L;  1MSH A;  4A3L H;  4A93 G;  4HJ5 A;  1TWH H;  3VR2 A;  1EYG A;  5KEE A;  2MUY A;  3M7G A;  2LXK A;  3UE1 A;  3Q8D A;  1HHV A;  1TII D;  4BBR H;  3T51 B;  4JI7 L;  2KHS A;  4OWX B;  3J81 c;  1G29 1;  3HS0 C;  3I2Z A;  4LMQ D;  1PH7 A;  2A73 B;  1CI3 M;  1H9S B;  3PF5 A;  4K5X A;  4MN3 A;  2C9O A;  5BN5 A;  1VQE A;  4AYB E;  3MFY A;  4B3S L;  2D5D A;  3BZD B;  1QZG A;  4DK6 C;  5I9O A;  2HIX A;  1N36 Q;  4DR7 Q;  4UDU C;  2B63 G;  2K01 A;  1FD7 D;  1SLJ A;  1LTI D;  2KCM A;  5E4W C;  3JAM E;  4ZYS A;  3HG9 A;  2QW7 A;  3I73 A;  2OT2 A;  2MO1 A;  4IFD I;  4JI1 L;  2R93 G;  5C4J B;  2WAQ B;  2WFW A;  3CRL C;  4QMG A;  2NYZ D;  3M4O H;  3ZYY X;  3E0E A;  4YWL A;  1WTQ A;  1VQB A;  2HDL A;  5K36 H;  2RDG A;  2JA7 B;  3KBG A;  1VQD A;  3ND9 A;  3KFU A;  1NE3 A;  4DK0 A;  2JJQ A;  1N9W A;  2BH8 A;  4A3C H;  3J7Y W;  3SK5 A;  1HUN A;  2G5D A;  2Q2I A;  2JA8 B;  3TRE A;  5GRO A;  1VQK A;  4KN7 C;  1K8O A;  1C8C A;  1ET6 A;  1E3P A;  3TP6 A;  1CM9 A;  1JCK B;  5ELF A;  1PZJ D;  1DJR D;  2A5H A;  4LK1 C;  1B3A A;  4J8Q A;  1V1O A;  4DV5 Q;  2QEX A;  5J39 A;  1SFO H;  1LTL A;  2F03 A;  1VQM A;  2K05 A;  1P8L A;  1BOS A;  4J1M A;  1HNZ Q;  2RQX A;  2NUC A;  2QA4 A;  1GUT A;  2F1M A;  1XJV A;  2MQH A;  2K14 A;  3GTO B;  5ELD A;  4YY3 L;  3PUW A;  1DOL A;  5IYB H;  5E4X A;  1VQO A;  3S15 B;  1PH3 A;  1VQ8 A;  4A3B G;  2R93 B;  1UE6 A;  4QF4 A;  1I4Q A;  5A35 A;  4IUV A;  3D6C A;  3HOY H;  4JBJ A;  4A3M G;  1A8V A;  1VQ9 A;  5FK9 C;  3T13 A;  1JB7 A;  1A15 A;  4X3S A;  3ICE A;  4NW2 A;  2QF7 A;  1KAW A;  4XQN A;  3HOX H;  4DV6 L;  3H0G B;  1VQN A;  2DY8 A;  2QDB A;  1E2W A;  4JI4 Q;  4JV5 L;  1Y1V H;  3HOX G;  1FVI A;  2J4X A;  2RDH A;  1QB5 D;  1F77 A;  4X64 L;  3NP8 A;  3K0Y A;  5L37 A;  2AMC B;  5M5X H;  1IW7 D;  3MEH A;  4A3E B;  2B2Y A;  1D6E C;  3I4N H;  4IZ8 A;  3TZD A;  2E76 C;  1IBL Q;  3PUY A;  3HOU B;  5FLX c;  1Y69 U;  3HOZ G;  5M5W H;  4DV0 Q;  3NEM A;  3QJY A;  5C3X A;  3FKI G;  1ZYR D;  4ZLT F;  4FYD A;  3U4V A;  3VYT A;  4L5R C;  4DUZ L;  1QUQ A;  2KHJ A;  1J5E L;  1KC8 C;  2E2J H;  3DUZ A;  2HUG A;  1YI2 A;  3K7A B;  3SDZ A;  1YNX A;  4R9W A;  4N9P A;  2B2V C;  2F0J A;  3PUX A;  1PH4 A;  4FNF A;  3TS0 A;  3RNU A;  3DLL A;  4YHH Q;  5IYB G;  2VB2 X;  3ULL A;  1M1K C;  3AFP A;  3T1Y L;  1Q82 C;  4DUY Q;  3QIA A;  2B2W C;  4HJ8 A;  1CSP A;  3D4R A;  5JEA G;  1IBM Q;  2ZM6 Q;  3H3V H;  2N8N A;  4EQ5 A;  4HED A;  5IYD H;  5JEA H;  1PZK D;  3OW2 A;  1J6Q A;  3I56 A;  1IYJ B;  1YJW A;  2A19 A;  4X3U A;  2K28 A;  4A3M H;  1E22 A;  3AMU A;  4LF6 L;  5J22 A;  1L0X B;  1IBK L;  1CQF A;  1ASY A;  5GQO A;  4LFC L;  5C5L A;  4U68 A;  4H02 A;  1Y8P B;  5C0X I;  4HIM A;  4NXM Q;  4A3G G;  4XTC S;  4GN3 B;  1IYU A;  1TWG B;  4ABN A;  2ES2 A;  3HOV H;  4N8X 1;  4RGM A;  1JQY D;  1B44 D;  4WJ4 A;  3HOV G;  2KUM A;  4NDX A;  4RGN A;  3RLF A;  4F88 A;  5HGQ A;  5DM6 3;  4FO2 A;  3PIO A;  2F0F A;  5FLM G;  3A8J E;  4DV4 L;  3M4Q A;  4JI3 L;  3K5N A;  1GM5 A;  3P75 A;  4LF5 Q;  2EOT A;  2CW0 D;  3CW2 C;  2LFN A;  3URY A;  2B3G A;  1GKH A;  2B29 A;  2L4N A;  4BWG B;  3R2T A;  2I5M X;  4PMB A;  1II3 A;  4IJL A;  2Q2U A;  1B3Q A;  5CV5 A;  1GUG A;  4NXM L;  4A3B B;  1K0R A;  1Z7T A;  3KLS A;  5IT9 E;  2A68 C;  1X3E A;  1EWI A;  1RTO A;  1HH2 P;  4H44 C;  1XXG A;  1UAP A;  4JVZ A;  3V2T A;  1JOK A;  1ENC A;  4F87 A;  3PO3 B;  4K14 A;  1DYQ A;  1XPU A;  4HID A;  1C4Q A;  1B9M A;  2F0I A;  4A3D G;  2OQK A;  2PQA A;  1CZW A;  2F3V A;  4FF4 A;  1JOR A;  1XPO A;  3A55 A;  4ZQ3 A;  2K5Q A;  2XWB B;  1SE8 A;  1O7Z A;  1JR0 D;  5I9P A;  3U9S A;  4OX9 Q;  1SRO A;  1U9R A;  1M90 C;  1OO9 B;  1KRS A;  1LLR D;  4YHH L;  2I0Q A;  4K2L A;  3GP7 A;  5CV9 A;  1RDP D;  4LWC A;  5KNC A;  5BN3 A;  2YTY A;  2ICI A;  2NB0 A;  1N36 L;  4LAA A;  1VQC A;  1U4M A;  1XMQ Q;  4K0K L;  3RN5 A;  2FXQ A;  1UEA B;  2BA0 A;  2GA4 B;  4LFC Q;  1HR0 W;  1NUC A;  2I5L X;  4DFA A;  1V8Q A;  2AQ2 B;  2LMC B;  3NK9 A;  1S5C D;  3PO2 G;  5IE8 A;  5IGD A;  1X54 A;  5LMN Q;  1UEB A;  1LTT D;  1VQG A;  2K7V A;  5CBA E;  5AJ3 L;  1IBM L;  2VUM B;  5JJZ A;  2B2V A;  4DUZ Q;  1Z47 A;  2B2U A;  2EXD A;  4X64 Q;  1Y8N B;  5CV6 A;  1VQ4 A;  1R9T H;  2B2U C;  1ILP A;  1SMY D;  2WKD A;  1B50 A;  1HFG A;  4ME3 A;  1D5X C;  2EPB A;  3BVG A;  5D3D A;  5IWA Q;  1JJC B;  2OTJ A;  3K8A A;  4JI5 L;  1YIJ A;  3ERO A;  3MEF A;  4P2C B;  4O1N A;  1A63 A;  4ID6 A;  1XWE A;  2GVA A;  5IYC G;  3A5U A;  1I4H A;  2QGQ A;  4MNO A;  2PQE A;  5ELE A;  4CJ1 B;  2F0E A;  1RL2 A;  4JYA Q;  2RA4 A;  4Y7N H;  4JBM A;  2KJX A;  2ZJP A;  4JI0 Q;  4NXN Q;  2EYO A;  4A3D B;  4LFB Q;  1U4L A;  1SYD A;  3OPO A;  1AW7 A;  1YBY A;  2WB1 B;  3DXJ C;  4I65 A;  1QVG A;  4ULL A;  2IL8 A;  2E2J B;  1CHQ D;  2ENB A;  5KIX A;  4UP8 A;  1EWH A;  1GJX A;  4DV5 L;  3B6Y A;  4IQZ A;  1G6P A;  2NTS A;  2A6H D; 
#chains in the Genus database with same CATH homology
 1E7Z A;  1WFQ A;  2NZH A;  2UXB L;  3S1R H;  1MKH A;  3PUZ A;  4A3J G;  4GKK L;  1KQS A;  3DM3 A;  4AQY L;  3HOU H;  1PFS A;  2EIF A;  2JE6 I;  4R1J A;  3F1Z A;  3W1G A;  4JI6 L;  2Z6K C;  4L5T A;  5AJ3 Q;  1JE5 A;  1K83 H;  2WB1 G;  4UPA A;  4A3E H;  4C2M H;  5LMU L;  2WB1 E;  1Y1W H;  1JMC A;  2D62 A;  3HOU G;  3JAM c;  2E5L Q;  4UY8 C;  4GKJ L;  4HJA A;  1Y1W G;  3MXN B;  4LF7 L;  1NY4 A;  3GTG H;  1X56 A;  4PZ7 A;  4C3I H;  3PGZ A;  1L2F A;  3H0G G;  4B3S Q;  1Y1V G;  2F3I A;  4OO1 I;  3L0O A;  4QY7 A;  4B3M L;  2OCE A;  4KI0 A;  2NVT H;  1CKN A;  3E9H A;  3L7Z C;  3PV0 A;  4IJH A;  4JOI C;  4P73 A;  1H95 A;  3CCJ A;  3UDX A;  4DV1 Q;  1L1O B;  2VUM H;  4LF5 L;  4JCV E;  4DR2 L;  4DNI A;  4YY3 Q;  3BU2 A;  4BA2 I;  3BJU A;  3BZC A;  4R4T A;  3VDY A;  1K9M C;  5IYD G;  1IZ6 A;  4YWK A;  4QIW E;  4DR5 L;  3UDG A;  2JA5 H;  3I7F A;  3M7N A;  2IHF A;  1BBU A;  1AE3 A;  1D7Q A;  3ULJ A;  2UU9 Q;  1KRT A;  4GLX A;  4A3K H;  4R4Q A;  4IO9 A;  2R7Z G;  4A3I G;  1VQF A;  2MFI A;  1PA6 A;  4J15 A;  1BKB A;  2D0P A;  1K8G A;  1VQP A;  3T1Y Q;  3KOJ A;  4JI0 L;  3EIV A;  2KCT A;  1O7I A;  3PUV A;  1SMX A;  3OTO Q;  2DUD A;  1W2B A;  3S16 H;  1JJG A;  2I5H A;  4OWT B;  3OYY A;  4QL5 A;  3S15 H;  4TVA B;  1VS0 A;  4PMW A;  3HKS A;  4DR1 L;  2JEA I;  2B63 H;  4OXP A;  3HOW H;  5GAE C;  4R4I A;  4LF8 L;  4IOA A;  3M3Y H;  4RG1 A;  4GOP B;  2IY5 B;  4DR5 Q;  2HT1 A;  3CAM A;  3CXC A;  4DR7 L;  3S17 H;  3F2C A;  2MO0 A;  4DUY L;  2RCN A;  2VS1 A;  5C4X G;  4L5Q A;  1CKM A;  4JG2 A;  3I55 A;  4DV7 Q;  1QVF A;  3PCO B;  4JYA L;  5C4X H;  2NN6 G;  2IX0 A;  5C3E H;  4MTN A;  2K52 A;  2RHQ B;  3S14 H;  1PHJ A;  1XNQ L;  5C0X J;  2JQO A;  4ALP A;  4X66 Q;  3D31 A;  3AFQ A;  4A3G G;  3M85 A;  5HY6 A;  4KLK A;  1YHQ A;  1VQ6 A;  4IFD J;  2E5L L;  1XNR L;  1YHA A;  4JI3 Q;  2AKW B;  2V1C C;  1IBK Q;  2VY3 A;  4LF6 Q;  4DAM A;  2HQL A;  5FJ8 G;  1A62 A;  4DAY B;  2VNU D;  1OXX K;  4LF9 L;  3F2B A;  3CD6 A;  3S1Q H;  3CCQ A;  1E24 A;  5DLQ E;  1UWV A;  2PQA B;  4A3D H;  4GKK Q;  2R7D A;  5IP9 H;  4A3B H;  1U0L A;  3A0J A;  1T9H A;  1LM0 A;  1Q86 C;  3PO2 H;  4DR6 Q;  4LF7 Q;  3SGI A;  3U50 C;  1IBL L;  1ASZ A;  3GTQ H;  4GKJ Q;  1WOC A;  3RLN A;  5C4J H;  3AEV A;  2OQ0 A;  2K5V A;  5J3B A;  4FDB A;  4LF4 L;  1FJG L;  4A3L H;  1EQQ A;  4HJ5 A;  4A93 G;  2LSS A;  1TWH H;  3G4S A;  5JEA J;  4GN5 A;  1EYG A;  2UU9 L;  2LXK A;  1WI5 A;  3UE1 A;  1OTC A;  3PO3 H;  3Q8D A;  4BXX H;  2CCZ A;  1VQI A;  1I3Q H;  2N3S A;  4HJ9 A;  4BBR H;  1UE5 A;  4JI7 L;  4OWX B;  2WAQ E;  1TWG H;  4NB3 A;  3J81 c;  2YV5 A;  1G29 1;  1Q46 A;  3ER0 A;  3I2Z A;  4O2D A;  1PH5 A;  1XNQ Q;  1YEZ A;  1PH7 A;  1PVO A;  3H15 A;  3PF5 A;  3CME A;  1VQE A;  3W5O A;  1N34 L;  4AYB E;  4B3S L;  4DV4 Q;  4B3T Q;  1QZG A;  1IL2 A;  4DK6 C;  1N36 Q;  2HIX A;  1CKN B;  5EAY A;  2ZJQ A;  2IT1 A;  2Z6K A;  4JI5 Q;  2JA6 H;  3I4M G;  4DR7 Q;  2B63 G;  4B3R L;  1U5K A;  4LFB L;  3TRZ A;  4NXN L;  4LFA Q;  1SLJ A;  2KCM A;  3UE0 A;  1I94 Q;  3BZK A;  2JEB I;  3T1H Q;  2MO1 A;  1Z9F A;  4X62 L;  1VQA A;  2PI2 E;  4IFD I;  1V43 A;  4JI1 L;  1Q12 A;  3G6E A;  2R93 G;  2WFW A;  4YCW A;  1FJG Q;  2R7F A;  3M4O H;  4QGU A;  3E0E A;  3KYH C;  4YWL A;  1PH6 A;  1VQB A;  4AH6 A;  3GDE A;  4YCV A;  1Q8K A;  4P75 A;  1AH9 A;  3FP9 A;  1TWC H;  4JI4 L;  2ZTE A;  3NEL A;  5M3M H;  2ID0 A;  1VQD A;  2MNA A;  3KFU A;  1L1O C;  4DV2 L;  2NVY H;  1NE3 A;  1FGU A;  3L2P A;  2XGT A;  2NZO A;  2UUA Q;  1SR3 A;  1N9W A;  2BH8 A;  1WCM H;  2JJQ A;  4A3C H;  3I4O A;  1L1O A;  3FHW A;  2Q2I A;  3K7A H;  5M3F G;  3STB C;  4BY7 H;  2PI2 A;  2Q2T A;  2F4V Q;  3TRE A;  3KLW A;  2F52 A;  3IRB A;  5GRO A;  4HIO A;  1J5E Q;  1VQK A;  1GVP A;  1NMG A;  1E3P A;  2VQF L;  1K8A C;  1VQ5 A;  5GAG C;  2YTV A;  2VQF Q;  1D8L A;  1MIU A;  3CC4 A;  1XNR Q;  2JA8 G;  3S24 A;  1Q1B A;  3S1M H;  1NBW A;  3K81 C;  1PYS B;  1BVS A;  2VL6 A;  4X66 L;  3U58 A;  1HZB A;  1KD1 C;  4A4I A;  2UXC L;  4DV5 Q;  2E2H H;  2K5N A;  2WAQ G;  2QEX A;  2D0O A;  5H1S E;  1SFO H;  1VQ7 A;  1LTL A;  4JI8 L;  2HHH L;  1VQM A;  2AHO B;  4PZ6 A;  1A0I A;  1HNX L;  1P8L A;  2XTI A;  4DV7 L;  1Q81 C;  1HNZ Q;  2E2I H;  2UUC L;  2QA4 A;  1PV4 A;  4BA1 I;  4DV3 Q;  1XJV A;  2MQH A;  2K14 A;  3CC2 A;  2NVQ H;  3RN2 A;  1OXU A;  3GO5 A;  4YY3 L;  3PUW A;  1VCI A;  2BH2 A;  5IYB H;  1HNW L;  4DR4 Q;  1VQO A;  3PO3 G;  4DV1 L;  1PH3 A;  1VQ8 A;  1EOV A;  4A3B G;  4OX9 L;  1TWA H;  4JI1 Q;  3J7A 5;  1UE6 A;  3G48 A;  1KXL A;  2Z0S A;  3CCL A;  1C9O A;  4A3J H;  3KF8 B;  4L5R C;  1X3F A;  1PH9 A;  2OTL A;  1YVC A;  3F8T A;  4A3K G;  3HOY H;  3CCR A;  4DR4 L;  4JBJ A;  4A3M G;  1N32 Q;  1A8V A;  3CMA A;  1VQ9 A;  1CUK A;  1JB7 A;  1QUQ B;  4YCU A;  3HKZ E;  2UUC Q;  3ICE A;  5JJK A;  1HZC A;  3J80 i;  3GTJ H;  1WJJ A;  5GAD C;  4R4O A;  3F2D A;  1YZ6 A;  3S1N H;  1W3S A;  1YHB A;  3CCU A;  2YU9 H;  1B7Y B;  4X6A H;  1KAW A;  4YWM A;  3HOX H;  4DV6 L;  3PSI A;  1TXY A;  5IT9 c;  4A75 A;  1VQN A;  4DR1 Q;  1Q1E A;  2UUB L;  4JV5 L;  4JI4 Q;  1Y1V H;  3HOX G;  1FVI A;  4A3I H;  2RF4 A;  3CP0 A;  4PG3 A;  4APV A;  3S2H H;  1VQH A;  2VUM G;  4X64 L;  3J7Z C;  3ERS X;  3GTP H;  1SN8 A;  1QZH A;  5M5X H;  2AMC B;  1HNW Q;  1CKO A;  2R6G A;  1HZ9 A;  2F4V L;  5ELO A;  1YJN A;  3E9I A;  4P74 A;  1QVC A;  4POG A;  2VW9 A;  1KIX A;  3I4N H;  1LUZ A;  1IBL Q;  4LNQ A;  1JJ2 A;  3A5Z B;  3PUY A;  3HFZ B;  1PYB A;  2BA1 A;  3WWV A;  5FLX c;  3HOZ G;  5LMU Q;  2GN5 A;  5M5W H;  4DV0 Q;  3NEM A;  4XIG S;  2E8G A;  3FKI G;  3GD7 A;  4JBW A;  4JI2 L;  4IPC A;  4A76 A;  4LF9 Q;  1I6H H;  1HZA A;  4Y52 H;  2AWN A;  3U4V A;  5GAH C;  1NTG A;  4X62 Q;  4DUZ L;  1QUQ A;  2KHJ A;  1WCM G;  1KC8 C;  2ZJR A;  1J5E L;  2E2J H;  4A3C G;  2JA9 A;  1PH2 A;  1YI2 A;  2ZTC A;  2EQS A;  3EN2 A;  1EIY B;  1S3O A;  3CC7 A;  1YNX A;  2KHI A;  4AIM A;  1PH4 A;  3PUX A;  4TQU S;  1GO3 E;  1N8R C;  2UXD Q;  4X65 L;  3TS0 A;  3RNU A;  3J81 i;  3DLL A;  4KHP Q;  5FJ8 H;  4PZ8 A;  3RZD H;  4YHH Q;  5IYB G;  4A3F H;  1SRU A;  4LW1 A;  4LF4 Q;  1E1T A;  3ULL A;  1M1K C;  4A3L G;  3AFP A;  3T1Y L;  5BR8 Q;  1YIT A;  2K50 A;  5BR8 L;  4IOC A;  2L15 A;  3NEN A;  4DUY Q;  1Q82 C;  4HJ8 A;  2UXB Q;  4BY1 G;  1CSP A;  3GTK H;  1DGS A;  5JEA G;  1IBM Q;  1TWF H;  2A8V A;  2ZM6 Q;  3H3V H;  2N8N A;  4EQ5 A;  1S40 A;  3CF5 A;  5IYD H;  1X6O A;  3OW2 A;  4BBS G;  1J6Q A;  4IPG A;  1IYJ B;  3I56 A;  2A19 A;  4UP9 A;  1YJW A;  2ZTD A;  4A3M H;  1E22 A;  1X65 A;  5C44 H;  4B3R Q;  5C0X G;  4LF6 L;  3KJP A;  1IBK L;  1N33 Q;  3K80 C;  1ASY A;  1X55 A;  5GQO A;  1BBW A;  4LFC L;  1G51 A;  2JA7 H;  4DR3 L;  3PIP A;  2DGY A;  1KL9 A;  1L0W A;  5C0X I;  1UE7 A;  4H02 A;  3TEH B;  4HIM A;  3EBE A;  4NXM Q;  3KDF B;  4XTC S;  4GN4 B;  5C44 G;  4B3M Q;  4DR6 L;  4WJ3 M;  4GN3 B;  4GS3 A;  2ES2 A;  1MJC A;  1I5F A;  1V9P A;  3HOV H;  1EIF A;  2JA7 G;  2OWO A;  3STB D;  2JA5 G;  3H0G H;  4WJ4 A;  3HOV G;  4JBK A;  3RLF A;  2NN6 I;  5HGQ A;  2ATW A;  3S2D H;  4JC0 A;  3ZJY C;  1K3R A;  4GOP A;  3PIO A;  4A93 H;  5FLM G;  3GTM H;  4DV4 L;  1NMF A;  1P16 A;  2JK8 A;  3M4Q A;  4JI3 L;  3UDI A;  3RLO A;  3KJO A;  3CW2 C;  4GNX C;  3G71 A;  4DR2 Q;  4LF5 Q;  3I4M H;  1PH1 A;  1OXT A;  2CKZ B;  2R7Z H;  3I4N G;  2B3G A;  1GKH A;  4JI2 Q;  2B29 A;  4GNX A;  2I5M X;  1HR0 L;  4IJL A;  2Q2U A;  1C7Y A;  1Q7Y C;  4GNX B;  4DV2 Q;  4C3H H;  3D0F A;  2CWA A;  2R93 H;  4C3J H;  4LUZ A;  4NXM L;  1K0R A;  4KHZ A;  3M4P A;  3K0X A;  3OTO L;  1X3E A;  5M3F H;  3FKI H;  1EWI A;  1HH2 P;  1K73 C;  2Y0S E;  2NVX H;  1JT8 A;  4X65 Q;  5LMN L;  2A1A A;  4NPS A;  3KF6 B;  3CCV A;  1XPU A;  3HOZ H;  4QQB X;  4HID A;  5IY0 A;  4AYB G;  4AQY Q;  3U4Z A;  3KF6 A;  2VQE Q;  1NJI C;  2CQO A;  1I94 L;  2UUA L;  4GLA C;  4IPH A;  4BY7 G;  4A3D G;  2OQK A;  2PQA A;  5M5Y H;  1XPO A;  4JV5 Q;  5IP9 G;  5IYC H;  4R4C A;  1KHI A;  4QJF A;  3UDF A;  1V1Q A;  2HIV A;  1SE8 A;  4A3F G;  4L5S A;  2PNH A;  4IFD G;  4OX9 Q;  1SRO A;  1M90 C;  1KRS A;  4YHH L;  4O0A A;  2I0Q A;  3CPF A;  4KHP L;  4DV0 L;  4HJ7 A;  5JJI A;  5ELN A;  3AQQ A;  1N33 L;  3JC6 6;  4DV3 L;  2WP8 J;  4GLV B;  1HJP A;  5E7N A;  1XMO L;  4LWC A;  1CSQ A;  4DK3 C;  4BBR G;  3HKZ G;  5IWA L;  1X3G A;  2YTY A;  3CQZ H;  1N36 L;  2ASB A;  4OO1 G;  3CCE A;  2UXC Q;  1VQC A;  2ALY B;  4HIK A;  2IX1 A;  1N34 Q;  1IXR A;  3A74 A;  4P72 A;  1XMQ Q;  4K0K L;  3JAM i;  3RN5 A;  2FXQ A;  2BA0 A;  2GVB A;  4P71 A;  4LFC Q;  1XPR A;  3H3V I;  4JOI A;  3J81 j;  1Y14 B;  3M9B A;  1HR0 W;  2I5L X;  3RR5 A;  1WYD A;  2K75 A;  3LGJ A;  1VQJ A;  5LMN W;  3GTL H;  4BXX G;  4DV6 Q;  1HNX Q;  3RZO H;  4A3E G;  3PO2 G;  4LUV A;  4LF8 Q;  3W1B A;  5IE8 A;  1EUJ A;  2HHH Q;  2VZA A;  3HOY G;  1X54 A;  1MJE A;  5LMN Q;  1UEB A;  1VQG A;  5AJ3 L;  1IBM L;  3ULP A;  1I50 H;  4A3G H;  4DUZ Q;  1Z47 A;  4X64 Q;  2EXD A;  3TQY A;  4UP7 A;  1VQ4 A;  2K4K A;  3CCM A;  1FL0 A;  1XMQ L;  4K0K Q;  1R9T H;  5K36 G;  1B70 B;  2AWO A;  4ME3 A;  2Q2H A;  2UXD L;  1GD7 A;  4GOP C;  5FLM H;  1HR0 Q;  2JA6 G;  2H5X A;  5JJL A;  2R92 H;  5IWA Q;  4DPG A;  2KEN A;  4LFA L;  1JJC B;  2RHS B;  3CPW A;  2OTJ A;  1EFW A;  3GTO H;  2K5H A;  1OXV A;  2C35 B;  2CFM A;  2KBN A;  3K8A A;  4JI5 L;  1YIJ A;  2R92 G;  4LUO A;  1EQR A;  2Y0S G;  1N32 L;  3MEF A;  1A63 A;  2N49 A;  1HNZ L;  3PF4 A;  4OON A;  2GVA A;  5IYC G;  3A5U A;  2N78 A;  1AE2 A;  2QGQ A;  4MNO A;  1PH8 A;  3CCS A;  5IP7 H;  1B8A A;  4JI8 Q;  2JA8 H;  1UE1 A;  1RIP A;  4B3T L;  1S72 A;  4IPD A;  1RL2 A;  3T1H L;  1YJ9 A;  4JYA Q;  2IHE A;  3HOW G;  4Y7N H;  4JBM A;  1X9N A;  2ZJP A;  4JI0 Q;  2VQE L;  1XMO Q;  4JI7 Q;  5C3E G;  4NXN Q;  4DR3 Q;  4LFB Q;  2YYZ A;  5IP7 G;  1OXS C;  4OWW B;  2CWP A;  3NBH B;  1YBY A;  3K7U C;  3KDF A;  4RMF A;  1E1O A;  4MZ9 A;  1XTD A;  1LYL A;  3AYH B;  1QVG A;  4EX5 A;  1GM5 A;  4JI6 Q;  1VQL A;  4BY1 H;  3TS2 A;  2YTX A;  4DKA C;  5M3M G;  4POF A;  4UP8 A;  2LXJ A;  2ZM6 L;  1C0A A;  4DV5 L;  3B6Y A;  2PMZ E;  1G6P A;  4BBS H;  2UUB Q;  3J80 c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...