4DV5Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv5Q00
3CXCA 3CCEA 3OW2A 4TQUS 3BU2A 5GAEC 1VQ4A 2A1AA 1D8LA 4BY1H 3S17H 3RLNA 1I5FA 1W3SA 1AH9A 1PYSB 2E2JH 4JOIA 2CFMA 1XNQQ 4IOAA 1I6HH 4JI2L 1CSPA 4A3FH 1B8AA 2MFIA 3NBHB 3KF8B 1PFSA 3A5UA 4JYAQ 1PH7A 2K52A 3AYHB 2F4VL 2KENA 3TQYA 4YCUA 3OTOL 4B3ML 3IRBA 3GTOH 3UE1A 1HZ9A 4GN4B 1HNZL 1IYJB 1PVOA 3K80C 4A3GH 4HIDA 3Q8DA 1SROA 1A0IA 2N49A 1HH2P 4K0KL 2VUMG 1WCMH 2ZTDA 4AQYQ 3HOWG 3S14H 2I5LX 1A8VA 3FHWA 1LUZA 2DGYA 2D0OA 1PV4A 5IYDG 2F52A 3A5ZB 1IBKQ 2AMCB 3G48A 3UDXA 4KI0A 4QIWE 2HIVA 3CF5A 3T1YQ 1KD1C 3HOUG 1J5EL 2E2HH 1JJ2A 2BA0A 3HOXH 2JA6G 1JB7A 1NE3A 2JE6I 3PF5A 2I5MX 3JC66 4B3TQ 4LF9L 1E22A 3PCOB 2AHOB 5C4JH 2VNUD 4JI1L 2LXKA 3K81C 3NEMA 3ULLA 3CMAA 3K7AH 4IJHA 4JG2A 2PI2A 2WAQE 4NXMQ 3RLFA 4LFBQ 4A93G 4NB3A 1VQOA 1VQFA 5JJKA 3S1RH 2NVYH 2F3IA 1CKNA 3M9BA 4GOPC 1L1OB 2IHEA 1P8LA 4JI3L 1X3GA 2MQHA 2N3SA 1TWCH 2NZOA 2CKZB 2ZJPA 5C44G 4JI6L 3KJPA 2Q2IA 4IFDJ 5C0XJ 4IPGA 4GKJQ 4B3SQ 1BBUA 2NN6G 5M3MH 2QGQA 2GVAA 4UP8A 2UU9Q 2Z6KC 4C3HH 1HR0Q 2VL6A 1Q12A 2KBNA 4AH6A 1Q86C 5LMNW 4MZ9A 1SRUA 2NZHA 4O0AA 4DUYL 5GROA 1XPUA 4DR6Q 3D31A 4LUOA 2UUAL 1VQDA 1VS0A 2Q2TA 2E5LQ 4JI7L 3U4VA 3I4NH 4KHPQ 1A63A 3CAMA 1EYGA 3JAMi 3H3VI 3TS2A 4MTNA 1EQQA 3KF6B 4JI5L 5IWAL 1KQSA 3J7ZC 2VQFQ 4LFCL 1C7YA 3U50C 1CUKA 4DV0Q 1XPOA 2Q2HA 5IYCG 2JA5G 4LF4Q 5M3FG 4DV3Q 1YJ9A 3I4OA 4JI2Q 2K4KA 4UY8C 3CCRA 1IXRA 4A3JH 1CSQA 3M85A 3K8AA 4QY7A 2UUBQ 2VQEL 1FGUA 1S3OA 2F4VQ 2A8VA 3OTOQ 4B3MQ 1VQKA 4B3RQ 3HOZG 1MJCA 1HNZQ 1VQ7A 4OWWB 2B63H 1G6PA 1EUJA 2OQ0A 3TRZA 4IPCA 4JI0L 3J80c 4POFA 2ASBA 1JT8A 1LM0A 1J6QA 1NBWA 2LXJA 3ER0A 3U4ZA 3NENA 2RCNA 1YVCA 4NXNL 3CCVA 1N33L 5IYDH 3PUVA 3DM3A 1K83H 1X54A 1XMQL 2OQKA 3T1HL 1BVSA 2K50A 1HZCA 3CW2C 2I5HA 3PIPA 4BXXG 5IP9G 1X56A 4GLAC 4UPAA 4DR7L 4R4IA 1KRTA 4H02A 2IHFA 1UE5A 4APVA 4DV2L 1VQMA 3HOYH 3CPFA 3J81c 1ASZA 4A93H 4X66Q 4JI1Q 1YBYA 1GKHA 5M5YH 2UXBL 1L0WA 5ELNA 3CMEA 1N34L 5IYBG 5K36G 3S24A 4BBSG 3F2BA 3W1GA 1U0LA 1S72A 4YY3L 1FL0A 4A3BG 1M1KC 2Z0SA 5C44H 1VQ5A 1YHBA 3CP0A 4IFDG 4JI6Q 1X3EA 5C0XG 2KCTA 5IP7H 1FVIA 3E9IA 3U58A 4HIOA 3GO5A 1IBML 3I4MH 3DLLA 2D0PA 2WFWA 2RHSB 1YNXA 4DV4Q 1VQ9A 3J7A5 4Y52H 4LUVA 1TWGH 1PH1A 4DR1L 4AYBG 5FJ8G 4L5QA 2ALYB 4GOPB 4QQBX 4OONA 4BBRG 4DUYQ 1P16A 3W5OA 1VQ6A 1CKOA 1QUQB 1L1OA 2UUAQ 4DPGA 4X65L 1IBLL 1OXUA 4DV7L 1D7QA 3L0OA 5JJLA 4LF8L 3STBD 4C3IH 4JI5Q 5IWAQ 5IYCH 1EIFA 2VS1A 3K0XA 1BBWA 3FKIG 3RLOA 5H1SE 5M3FH 4LFCQ 1FJGQ 1K3RA 3CCSA 2ES2A 1WFQA 3F1ZA 1E1OA 5GADC 1Q1EA 1HR0W 2R93G 4BY7H 3JAMc 1RL2A 4LUZA 4YCVA 4LNQA 3KFUA 3M7NA 4GKKL 2R7ZH 4A3LG 2VQEQ 4GNXC 3NELA 2ZM6L 3HOZH 2UXDL 2HHHL 5GAGC 1YHAA 1YIJA 3D0FA 2LSSA 5FLXc 2BH8A 4JI0Q 3PUZA 3E9HA 1G291 3KF6A 4JBJA 2K5VA 4EQ5A 1K9MC 1ASYA 5BR8L 4OO1G 2B3GA 1HZAA 1EQRA 4HJAA 4NXNQ 1N33Q 1WJJA 3RZOH 1EIYB 4DNIA 3BZCA 1XMQQ 1VQNA 2L15A 4BXXH 2K5NA 5IP9H 4DAMA 2AWNA 3EIVA 4IJLA 3RNUA 1PH2A 4DR7Q 3HOVH 1TWFH 4P74A 1RIPA 4DV2Q 1XMOQ 1PYBA 3PO3H 1PA6A 5M5WH 2GVBA 2R92G 4DV6L 3TS0A 4XIGS 1TXYA 3AFPA 2UXBQ 3RZDH 3PV0A 4L5TA 4HJ9A 1N34Q 1QVFA 5LMNL 1UEBA 4A3BH 1PH5A 2NVXH 5C4XH 4YY3Q 1YHQA 2NVTH 1KHIA 3CCUA 1W2BA 1V43A 3I2ZA 3CCJA 2XGTA 1IL2A 4YHHL 5HY6A 2QA4A 1SLJA 1Y1WH 2UXCL 1KXLA 1GO3E 1UE7A 2YV5A 2I0QA 3HKSA 3G4SA 1HNWL 4DR4L 2E2IH 4DUZL 4XTCS 4IO9A 4JI8L 3F2CA 2KCMA 5FJ8H 4DR5L 4A3EG 3PUXA 1YZ6A 1XTDA 3W1BA 3SGIA 4BBRH 3GTPH 2QEXA 4JV5L 4LFAL 5C3EG 3ZJYC 3H15A 4A3IG 3CC4A 5FLMG 2MO0A 2BH2A 2ID0A 1VQAA 1IBLQ 4PZ8A 4DV7Q 1EOVA 2MNAA 4LF8Q 3CD6A 2B29A 3FKIH 4J15A 3RN5A 1KC8C 4DK3C 3GTGH 1M90C 2MO1A 4R4QA 3CC2A 2R93H 1VQ8A 1QVCA 5JEAJ 2VUMH 1MIUA 2IX1A 1XNRL 1WI5A 3OYYA 4OXPA 4YWKA 2EIFA 2R7FA 4EX5A 4GOPA 3ULPA 4A3FG 4YWLA 4JYAL 4GKKQ 4K0KQ 1SN8A 2UXDQ 1NTGA 5IY0A 4IOCA 4X6AH 1S40A 2HHHQ 1VQBA 1VQIA 2NN6I 1LYLA 1OXSC 1NJIC 3HOUH 3VDYA 4L5SA 1E7ZA 3H0GG 3LGJA 1J5EQ 2JA6H 2Z6KA 5BR8Q 2ZTCA 1O7IA 3M4PA 4AQYL 4A3CG 1G51A 1Q46A 2A19A 4LF6L 3UDIA 4GNXB 1N32L 3S2DH 3CCQA 4LF7L 4LF9Q 1MKHA 1U5KA 3AFQA 2JEAI 5IT9c 1TWHH 4JOIC 3ULJA 3BZKA 1YEZA 2YTXA 4AYBE 1BKBA 1L1OC 1JJCB 4LF5L 2DUDA 3STBC 5GAHC 3K7UC 1GD7A 4O2DA 5ELOA 3HOXG 1VQCA 1YJNA 3EN2A 2R92H 1C9OA 2AWOA 2K5HA 1E1TA 4DV6Q 2Y0SE 2K14A 4X62L 4JI3Q 1TWAH 4OX9L 4POGA 3L2PA 1KAWA 4NXML 2ATWA 5DLQE 3UDGA 2WP8J 1UWVA 1Q81C 4R1JA 1UE6A 5LMNQ 1Q8KA 1K8AC 1I94L 1VQJA 2VZAA 1WYDA 5LMUL 3GTLH 3F2DA 1H95A 1PH4A 4DK6C 4JBWA 3M4OH 5J3BA 1Q1BA 3PUWA 4KLKA 1HJPA 1YI2A 1HNWQ 4GN5A 2UXCQ 4R4OA 2JA7G 3WWVA 2Y0SG 1PH6A 4JI7Q 2V1CC 3GDEA 4GS3A 4PG3A 4DUZQ 1I50H 4HIMA 1K73C 1JMCA 4B3SL 3PO2G 2PNHA 4DR5Q 1PH9A 1HR0L 5C3EH 1GM5A 3F8TA 4R4CA 2JA5H 2H5XA 4JV5Q 1R9TH 4LFAQ 4JCVE 1V9PA 5FLMH 1Y1VG 2JJQA 3J81j 2N78A 3S1MH 3G71A 2OTLA 3PUYA 1N36L 1B7YB 2E5LL 3PF4A 3CCLA 3I4NG 1OXXK 1NMFA 2VQFL 5JEAG 4DV0L 1PHJA 4LF4L 1KRSA 4QGUA 4PZ7A 4DV3L 3GTJH 4IFDI 1Y14B 1Z9FA 2PQAB 5C0XI 3J80i 4JI4L 2BA1A 2FXQA 1XNRQ 1OXTA 3TEHB 3HKZG 4A3KG 1L2FA 1SE8A 4A3DG 2UUBL 4DV5L 3S1QH 4WJ3M 4WJ4A 2CQOA 1Z47A 4A3JG 3BJUA 3S16H 4B3RL 4UP9A 3E0EA 2IX0A 3T1HQ 4DR2L 4DAYB 3H0GH 3KDFB 2B63G 1VQEA 3A74A 2WB1E 4GN3B 1X9NA 4DV1L 2E8GA 4P72A 4DR3L 2YU9H 1KL9A 4A3CH 4YCWA 1JE5A 3GD7A 4C2MH 1K8GA 4A76A 2HIXA 4QL5A 2JA9A 2RHQB 4LF6Q 1C0AA 4MNOA 3KLWA 4ALPA 3AEVA 1N32Q 2OTJA 2EXDA 3S2HH 2CWPA 4LF7Q 1SMXA 3L7ZC 3J81i 3MEFA 5IYBH 4OWXB 4YWMA 3A0JA 4BBSH 1N8RC 3CPWA 5M5XH 4LF5Q 2PMZE 2WB1G 4NPSA 2UUCL 2JEBI 2EQSA 4A4IA 4JC0A 4A75A 2XTIA 3HOYG 1HZBA 1VQHA 1X65A 2JA8G 4OX9Q 4X62Q 2CCZA 4X66L 4RG1A 5HGQA 1HNXL 1VQGA 3M4QA 4A3MG 4GNXA 2GN5A 1IBMQ 2JQOA 4X64L 3G6EA 1I94Q 2KHIA 3TREA 3CCMA 5LMUQ 1Q82C 3HFZB 4OO1I 1E24A 1N9WA 4DR1Q 2D62A 5AJ3L 5IE8A 4AIMA 2JA7H 1YJWA 2YYZA 1X55A 2JK8A 2YTYA 5IP7G 3PO2H 1NY4A 1OXVA 4ME3A 4X65Q 4DV4L 3I4MG 3I56A 2C35B 2WAQG 3GTQH 3HOWH 2IY5B 3CC7A 1Y1VH 3KYHC 4BY1G 1WOCA 1A62A 1XNQL 4DKAC 2ZJRA 4IPHA 1EWIA 4P73A 1N36Q 1QZGA 3PGZA 4A3LH 1VQLA 1K0RA 1B70B 3CQZH 2ZTEA 4IPDA 1XPRA 2ZJQA 2OCEA 2ZM6Q 4OWTB 5JJIA 1QUQA 1SFOH 1FJGL 1OTCA 4BA2I 1CKMA 4A3KH 1X3FA 4JI4Q 3B6YA 4A3DH 4A3GG 3I7FA 4DV5Q 4GLXA 1QVGA 3ICEA 4BY7G 4PMWA 3PIOA 1WCMG 4L5RC 4QJFA 2R7ZG 4LW1A 4Y7NH 1JJGA 4LWCA 4DR2Q 1T9HA 2VY3A 3KOJA 3AQQA 1IBKL 4HJ8A 2OWOA 4FDBA 5E7NA 1XJVA 1CKNB 3T1YL 3MXNB 4DV1Q 4DR3Q 1YITA 2PI2E 2CWAA 1QZHA 2RF4A 4JBMA 1AE3A 1X6OA 4PZ6A 2PQAA 4RMFA 4UP7A 3UDFA 3FP9A 4R4TA 2AKWB 1AE2A 1VCIA 2VW9A 4B3TL 5GQOA 1NMGA 2N8NA 1PH3A 3S15H 3ERSX 3UE0A 3H3VH 4P75A 1UE1A 3M3YH 1SR3A 4C3JH 4LFBL 4P71A 2IT1A 2UUCQ 1IZ6A 3KDFA 2NVQH 1XMOL 2HT1A 3GTKH 3HOVG 2JA8H 4JBKA 4BA1I 4GLVB 1Q7YC 3PO3G 2KHJA 3I55A 4YHHQ 4HJ7A 3GTMH 4A3MH 3PSIA 3S1NH 3RR5A 1HNXQ 2R6GA 1DGSA 4HIKA 1KIXA 2HQLA 4DR4Q 4X64Q 2Q2UA 4GKJL 4KHZA 3RN2A 4JI8Q 1LTLA 4TVAB 4HJ5A 4A3EH 1VQPA 2UU9L 1E3PA 3KJOA 1EFWA 5C4XG 5M3MG 5AJ3Q 1PH8A 2R7DA 1I3QH 2YTVA 5EAYA 4A3IH 3HKZE 4DR6L 1GVPA 2K75A 3EBEA 4KHPL 1V1QA 1Y1WG 1MJEA
chains in the Genus database with same CATH superfamily
2EE1A 2O5IC 1JWUD 1D8LA 5CV6A 3D4DA 1HPCA 2E2JH 1KABA 1K83B 1CSPA 2IPKD 1B8AA 3A5UA 3DEOA 1XYIA 2K52A 4LJZC 3TQYA 3GTOH 4GN4B 5EPJA 1J8IA 1PVOA 4A3GH 1A0IA 4NKLA 2V4DA 3I8ZA 3S14H 1A8VA 1LUZA 2DGYA 2F52A 3FPUB 2F0EA 1IKLA 2F1MA 1CHPD 4KI0A 1U4LA 3T1YQ 1PTOB 3CF5A 1KD1C 2E2HH 4RGNA 3BYTB 3HOXH 4IZ8A 2JA6G 4CBVA 3I4MB 3UI2A 1TWGB 3PCOB 2AHOB 4KJNA 5JAVA 4IJHA 4G7OC 2A73B 4KHVA 1VQOA 1VQFA 4DFAA 3ERQA 1F9PA 3EQLC 2ENBA 1JC7A 1AFPA 2LMCB 1L1OB 2K1BA 2IHEA 1F2LA 2MQHA 2N3SA 4JI6L 1I4QA 1KDBA 1E2ZA 4IPGA 3V2TA 4GKJQ 4B3SQ 1U9RA 3NQTA 5M3MH 3LWEA 2KBNA 5DM73 5LMNW 1EEFD 2NZHA 2K5QA 4DR6Q 1MBYA 2VB3X 2UUAL 2Q2TA 1LLRD 2EOTA 3H3VI 4CGYB 4DK1A 3K0YA 3KF6B 4JI5L 5JEAH 5IWAL 3J7ZC 5DAUA 1XPOA 1CUKA 2JA5G 5IYCG 2Q8TA 2XRQD 4JI2Q 1NCVA 2F0UA 4UY8C 1CQVA 3CCRA 1IXRA 3Q6SA 2UUBQ 3MVVA 3HOVB 2A8VA 1TKWB 3VYUA 1HNZQ 1G6PA 1KNEA 2OQ0A 2Z4IA 3TRZA 5IGCA 1F77A 2ASBA 5M5WB 4DF7A 3NENA 2F0KA 4QF4A 4DAPA 1BVSA 3ITPA 5I4DA 1BF4A 3PIPA 4UPAA 4R4IA 2IHFA 3E5SA 1CZGA 2E2IB 3GV6A 3VR2A 2F3WA 3I70A 1HA5A 4JI1Q 3CMEA 3S24A 1EU3A 3ND9A 3F2BA 4RA8A 1R4QB 1VQ5A 3FKIB 1X3EA 2EJMA 2L5TA 1PRTD 2EYFA 1SE4A 4L63B 4K8JA 2HCCA 3DLLA 1VQ9A 4FF1A 1H9SB 2TMPA 1BOSA 1QWYA 1WTQA 3KLSA 4L5QA 5I9PA 4QQBX 4OIJA 1EY0A 2KUMA 3AMUA 4HAEA 1D7QA 4IURA 3L0OA 5JJLA 3X3MA 1E0BA 4C3IH 2NBFA 1EIFA 2EPBA 2VS1A 3K0XA 3FKIG 4LFCQ 3SK8A 1JORA 3CCSA 2ES2A 2B2WA 1ENAA 5C5MA 1E1OA 2B8GA 3S2DB 2CVRA 3I90A 1W6KA 1HCZA 3WOFA 3KFUA 4YCVA 3M7NA 1I4GA 2L12A 4GKKL 2BE5C 2R7ZH 1V1OA 2RDFA 1YHAA 1YIJA 1AEXA 2R92B 4JI0Q 2BH8A 4JBJA 1ASYA 3SR1A 4OL7A 1WJJA 4DGZA 1X3QA 3BZCA 4I7ZC 2D5DA 4BXXH 2K5NA 4DA2A 4DU9A 3Q0AA 1S5BD 2RA4A 2F0HA 3NWTA 1RIPA 5IOCA 4DV2Q 1LABA 1PYBA 2NB0A 2A69C 1PA6A 2ZXPA 2R92G 1HRJA 2UXBQ 5EJWA 1R9TB 1N34Q 1KDCA 2A6HD 4C3JG 1PH5A 2NVXH 3K6OA 2NVTH 1BCPC 3OIPA 4DNTB 4YHHL 2QA4A 3HGBA 1Y1WH 1GO3E 1UE7A 2H4OA 2I0QA 1HNWL 2F0JA 4XTCS 3DWPA 4IO9A 4ME5A 3F2CA 2KCMA 5FJ8H 4BBRH 2A69D 2Q8RE 5L37A 2F0MA 5E4WC 2KECA 2HUGA 1CHQD 2BH2A 1IBLQ 1VQAA 1GHKA 1K8OA 2MNAA 3CD6A 3K5MA 3HRZC 2MO1A 4I65A 1Y8OB 2G5DA 2Q8IB 3CC2A 1QVCA 3MWYW 3S2HB 2SDFA 2IX1A 4CKCA 4YWKA 4A3LH 1O7ZA 2SNMA 4YWLA 1PZID 1SN8A 4BBSB 1RKNA 1Q3LA 4XDXA 4IOCA 4X6AH 2NN6I 4PV1C 1NJIC 1S4ZA 1HUNA 3VA5A 4L5SA 3W3AA 2ZTCA 1B9MA 4IN3A 1NR4A 2DJGC 1II3A 2BCOA 3CCQA 1B4OA 4ZQ3A 2CW0C 3AFQA 2JEAI 5C3WA 5G3LD 5IGEA 1GUGA 3IFDA 4LF5L 1L1OC 3FRPB 1YJNA 3STBC 5GAHC 4ZUIA 5ELOA 5C4HA 2AWOA 3NQIA 2Y0SE 1PTOD 5I9OA 1Y1VB 2ATWA 4G4KA 1CTMA 1UE6A 5LMNQ 2F0LA 2VZAA 1H9MA 2PZWA 1YNNC 1PH4A 1K3BC 4KY6A 4JBWA 3CQZB 2I46A 1SFOB 5J3BA 2CW0D 2UXCQ 1YI2A 5KYLA 1JMCA 1K73C 4A3DB 5FK9C 4DR5Q 2DN8A 1D1IA 4O1NA 1WVLA 1GJXA 5FLMH 1Y1VG 4Y7NB 2JJQA 3J81j 3P1HA 5CBAE 2X69A 3G71A 2OTLA 1B7YB 2EYHA 4PMCA 3PMFA 2VQFL 4DV0L 2E2DC 2F0TA 1JOQA 1KRSA 2MJ8A 3D3RA 4ZRZA 4IFDI 1Y14B 5C0XI 4JI4L 2FXQA 1XNRQ 1OXTA 1KLUD 3HKZG 4A3DG 1SJED 4DV5L 3S1QH 1Z47A 3S16H 3E0EA 1EIHA 1I6VC 2IX0A 4DR2L 2JA8B 1V1PA 1X9NA 1RDPD 2E8GA 4P72A 4DR3L 4ABNA 2YU9H 2XRSD 3C3LA 4A3CH 1O7LA 3S1NB 1ESFA 1K8GA 4QL5A 1EEID 1C0AA 3KLWA 5KNCA 2CWPA 4FO2A 3MEFA 5IYBH 4OWXB 5EQ0A 1I3QB 1N8RC 4A3IB 1LTAD 3TN2A 2PMZE 2JEBI 4A4IA 4P2CB 1DD2A 1ENCA 1LACA 1VQHA 2JA8G 2F0FA 4RG1A 5HGQA 3NTKA 3H6MA 1HNXL 1B50A 4GNXA 2GN5A 1JE4A 2IW3A 4CKBA 1I6HB 1PYWD 1I94Q 3A7LA 3CCMA 3HFZB 4OO1I 3TZUA 4DR1Q 1RD9D 2DNEA 2JN4A 5AJ3L 1SSOA 3OWEB 2J0TD 1YJWA 4EVOA 1X55A 2JK8A 2YTYA 3K59A 4DV4L 1STNA 2IY5B 1TS3A 3D4WA 2AQ3B 1PFNA 4CDDC 2ZJRA 3CRLC 1QZGA 2QF7A 5JJIA 1DOLA 2FJ2A 3RD4A 1CKMA 4CDCC 3TP7A 3I7FA 4RCNA 4GLXA 4U68A 1QB5D 3FVQA 1QVGA 4BY7G 4QJFA 3S1RB 1JJGA 1BUVT 4PMBA 4CJ1B 2PYKA 4K5VA 1ET9A 4G57A 1BR9A 3ONAB 2PI2E 1TWCB 1QZHA 4EQOA 5EGTA 5CC4A 2PQAA 3SEBA 4R4TA 1QCBD 4B3TL 4C3HB 1NMGA 2N8NA 1H9RA 2A5HA 4ULLA 1SNDA 3ERSX 1UE1A 4XYQA 1CA6A 1I4HA 2UUCQ 4DAYA 2NVQH 2HT1A 2RKSA 3I4NB 3CRKC 3NP8A 1A6XA 1Q7YC 2F0IA 3PO3G 1L0YB 3I55A 2EDGA 3RR5A 5DM63 2R6GA 1DGSA 1KIXA 3Q24A 3P20A 1Y8PB 4JI8Q 5C4XG 1SNMA 1PH8A 1D1KA 2YTVA 2LY7A 2K7VA 5BN4A 4KHPL 1MJEA 1SYCA 3CXCA 4TQUS 4BY1H 1I5FA 1AH9A 5FO9B 5D65A 1SYGA 2M00A 4JOIA 5COYA 2CFMA 1EZ8A 2KJXA 4A3FH 1WTHA 4BWGB 1STGA 2B2VA 4JYAQ 1FYCA 2AQ2B 4EGVA 5J39A 3OTOL 2B2TC 3HOYB 3Q23A 2K33A 2N49A 1HH2P 3A8JE 5J22A 1Y69U 2VUMG 4K0KL 5M5YB 4QIWB 1PLFA 1I4RA 3FHWA 2D0OA 1EY6A 2F0DA 1IBKQ 4FVMA 3HOUG 2HIVA 1J5EL 2XWJB 1JJ2A 3NSWA 1YNJD 3OOCA 2JE6I 1XTCD 3PF5A 2L1BA 4S3SA 1E22A 1XX8A 5C4JH 3TS0A 3ULLA 3K7AH 4JG2A 2WAQE 1G2TA 4NB3A 2NVYH 2D9UA 5CV8A 3MXNA 4GOPC 4GZYC 2QEJC 1P8LA 2ZJPA 1X3GA 5M3FB 1WD1A 2Q2IA 1KAAA 4IFDJ 1LTTD 5C0XJ 2CQAA 2NN6G 2UU9Q 5EPKA 2Z6KC 1HR0Q 1AZPA 4AH6A 4MZ9A 1SRUA 4DUYL 3D31A 2B2YA 2RSOA 1A63A 1VS0A 2E5LQ 3U4VA 4ID6A 3JAMi 4MTNA 1EQTA 3U50C 2B2UA 2Q2HA 2I07B 5M3FG 1TR5A 3I4OA 1MHWC 2K4KA 4F7XA 1GUOA 3VA7A 5EKLA 3M85A 4A3JH 3K8AA 1A3VA 1S3OA 4OGQC 1B3QA 1MJCA 4U673 3K5LA 4OWWB 2B63H 1EUJA 3J7AV 3J80c 4POFA 1SYEA 1HTLD 4NMZA 1K28A 4NXNL 1N33L 1ZXTA 1F9RA 3DM3A 3N52A 3NBHA 4A3BB 1K83H 1XMQL 3CW2C 2P5ZX 2ZT9C 4GLAC 3DWAA 2K32A 4DR7L 4IUTA 3FMCA 4H02A 3BVZA 3JAME 1UE5A 5IIFA 5LL6X 3J81c 5JPNC 3TMEA 1YBYA 1GKHA 5FLXE 3GTPB 2MP1A 1A2UA 3QOLA 4IUVA 1U0LA 4A3BG 1X32A 2NYZD 1PTOH 2Z0SA 4IFDG 2WIIB 4JI6Q 5C0XG 1FVIA 2QILA 2RVLA 4HIOA 1IBML 3I4MH 4LUVA 1TWGH 4K14A 4AYBG 1GHJA 2ALYB 1P16A 4HCEA 4EQNA 1BCPF 2QCPX 5D14A 1QUQB 2UUAQ 4DPGA 4X65L 4K5XA 1XXGA 2JA6B 4JI5Q 5IWAQ 5IYCH 3HOWG 1FJGQ 1JWSD 1K3RA 3MZ5A 1WFQA 5I6YA 3WOEA 1NR2A 1IW7C 1RL2A 1E2WA 5ELCA 4LNQA 1Q90A 2UXDL 3NELA 2HHHL 5GAGC 2LSSA 1LTGD 3E9HA 1FR3A 3QR8A 3TBIB 2K5VA 3VYSA 4G7HC 1WTVA 1WD0A 4OO1G 2B3GA 1HZAA 1EQRA 5KIXA 4HJAA 5G3LF 4H7BA 1DJRD 4DNIA 2F3VA 2K5WA 3BYYB 3MTSA 2QKIC 1JWMD 2AWNA 3M4OB 4LMQD 2CH4W 4IJLA 4QUFA 1PH2A 4KK7A 3HOVH 1RHPA 1IW7D 1K8MA 1U4MA 2KHSA 3A54A 5M5WH 3SVMA 1U4RA 3AFPA 2JA5B 4HJ9A 1CI3M 1UEAB 3A7AB 3S1MB 4IUNA 1PMRA 2XGTA 3SK6A 4CDEC 2B63B 3HKSA 3E3XA 3D6CA 3GTJB 2E2IH 4A3EG 3W1BA 1YZ6A 1XTDA 2EZVA 3SGIA 1V1PB 3DHQA 1D2BA 1A3UA 2B29A 3FKIH 5T1GA 4C2MB 4DK3C 3J7AF 1M90C 4HSVA 4R4QA 1BDOA 5JOBA 1AN8A 1VQ8A 5HURA 3BDOA 3HG9A 5JEAJ 4J6HA 1WI5A 3OYYA 2R7FA 4EX5A 3ULPA 4GKKQ 5IY0A 1S40A 1OO9B 1VQBA 4H44C 1OXSC 1A3TA 1PRTC 2OEOA 1Z7TA 4X3UA 4PQXA 3TDQA 2QW7A 1DXMA 1O7IA 3M4PA 1W6JA 4IALA 4LF6L 4Q5VA 4GNXB 1N32L 4QMGA 3RUZA 3S2DH 1F2YA 4LF7L 2PW7A 4LF9Q 1MKHA 3L3OC 3T4AC 5IT9c 1F2ZA 3CU7A 1BKBA 1JJCB 3PO2B 1GOZA 3HOXG 1GD7A 2R92H 4EQPA 1C9OA 3GTQB 2K5HA 4JI3Q 4POGA 3L2PA 5CV5A 1PFMA 4RAUC 1VQJA 5LMUL 2QDLA 1NAPA 1Q1BA 3PUWA 5ELFA 2L0CA 4KLKA 1HNWQ 4GN5A 4R4OA 2RDGA 4JI7Q 1QE6A 3GDEA 3JAML 4B3SL 3PO2G 4A3KB 1BQQT 4R4CA 2FMCA 2H5XA 1R9TH 3NTIA 1G6ZA 1V9PA 5FLXL 1IKMA 2N78A 1LT6D 4PNYA 5CORA 3IFTA 2R61A 2ICIA 3C1EA 5JEAG 1PHJA 4QGUA 2PQAB 3J80i 2A6HC 1IL8A 1ZYRC 4A3KG 1FNVA 3VR4A 2UUBL 4WJ3M 2CQOA 4C3JB 2WB1B 3HZXA 3QG1A 3FPPA 3T1HQ 5D3IB 4DAYB 4GN3B 1K0SA 4KKSA 3GTMB 4A3MB 4A76A 3QO2A 2L11A 2E75C 4MNOA 5KYIA 3S2HH 1SMXA 3L7ZC 3J81i 2MHVA 4YWMA 4BBSH 4LF5Q 2WB1G 1ZYRD 3E6ZX 4A75A 4HMIA 3S17B 2EYJA 4O42A 1ICWA 1BXTA 3M4QA 4A3MG 3G6EA 1QG7A 2KHIA 4RKLA 1LTSD 2D2CC 2KEEA 2Z9HA 4AIMA 5FOBB 4R9WA 2FMMA 5C6AA 2C35B 2JP1A 3HS0C 1WCMB 3OPOA 1Y1VH 1EYCA 3G6JB 1A62A 3GQBA 4WRDA 2FFKB 1XNQL 1ONLA 4P73A 3PGZA 4DK0A 1Z6HA 4LK1C 1F9SA 3CQZH 2OCEA 2ZM6Q 4OWTB 1QUQA 1SFOH 1JCKB 1PTOC 3MXGA 3TP8A 2EY1A 4JI4Q 2EXZA 2KCCA 4A3DH 1QILA 4DV5Q 2JYOA 4ZKCB 3DXJC 4PMWA 1WCMG 3PIOA 4L5RC 2R7ZG 4Y7NH 4DR2Q 1T9HA 3AQQA 4MN3A 3MXNB 4DR3Q 3FDTA 4ZAIA 3DM1A 5KRUA 4IQZA 3R93A 2HD3A 2OT2A 3A56A 1CK1A 4FYDA 1PH3A 1HQMC 5DNFA 3H3VH 4LFBL 4CHTB 3T51B 4P71A 2BDOA 3KDFA 2JA8H 4BA1I 4KN7C 3S1NH 1HNXQ 1STYA 1UNSA 4DR4Q 4B9WA 3RN2A 3HKZB 2A68C 4MHEA 4TVAB 2G9DA 1DM0B 3ZYYX 3Q22A 3W2DA 5AJ3Q 2R7DA 1I3QH 5EAYA 4A3IH 4KD4A 1GVPA 2K75A 1V1QA 1Y1WG 3CCEA 3BU2A 5GAEC 2B39A 1SYFA 3A8IE 2RQXA 4NDXA 4FP5D 1W3SA 1G91A 3IAYA 3MXPA 1I6HH 3BG3A 3NBHB 4N9TA 1O7YA 2K01A 1NNXA 4FF3A 2E74C 5E1FA 2F4VL 2A68D 1C8CA 2IJ0A 3I73A 4B3ML 3UE1A 4RCOA 3I3CA 2Z4HA 1IYJB 3K80C 4HIDA 3Q8DA 4A93B 5IGFA 1QNKA 5J1ZA 3TZDA 4C1NK 5BN5A 1T5EA 4UHVA 4AQYQ 2E76C 1PV4A 5FKAC 5IYDG 3A5ZB 1WTPA 4X3KA 3UDXA 1PXUA 4QIWE 5C44B 1EZ6A 2G9HD 2K04A 1D6EC 4OHJA 3JC66 1SBBB 4B3TQ 4RWSC 3K81C 4NXMQ 1QOHA 2VNUD 2JXMB 4A93G 5AFWA 4N8FA 5JJKA 3S1RH 5JVG3 2F3IA 1CKNA 2F0QA 3KLRA 3J7YW 2NZOA 1B1ZA 1TWCH 2CKZB 2L9HA 5C44G 5ELDA 3KJPA 5TSSA 5DEHA 3R3OA 1LV9A 2DNCA 3NK9A 4H13C 2QGQA 4BY7B 4KV6A 4C3HH 3T56B 2IL8A 1JR0D 3D8GA 1Q86C 1XPUA 3HOZB 4O0AA 5GROA 4KTAA 4LUOA 4CJ2C 4KHPQ 1VQDA 3I4NH 1EYGA 1EQQA 4RFBA 4UAIA 3RZOB 4LF4Q 4DV3Q 1YJ9A 1GUNA 3EVQA 2EJGC 4QY7A 5BN3A 2VQEL 1TWFB 3OTOQ 4B3RQ 1ML0D 4F88A 3HOZG 4KN4C 4IPCA 2CHBD 3PO3B 3NE5B 1JT8A 1PFBA 5EBDA 4XT3B 1J6QA 1LM0A 4HEDA 1NBWA 3ER0A 3RZDB 2RCNA 1YVCA 4K2LA 3K5NA 3KF8A 2K05A 1TQOA 4FF4A 2J4XA 5C4XB 3D6WA 1B9NA 2I5HA 5IP9G 4ZUJA 4J1MA 3BDCA 3QJYA 1KRTA 4CDFC 2L4NA 1VQMA 4APVA 3HOYH 3MFYA 1Q8IA 1TIID 4X66Q 1EFID 5M5YH 1V8QA 1L0WA 5IYBG 5K36G 2O2LD 3DMUA 5I6WA 3W1GA 1S72A 4YY3L 1FL0A 5CGKA 1M1KC 1UAPA 1YHBA 3CP0A 3N6RA 5A2QE 3SXHA 2X6GA 3FEWX 1T5XD 2KCTA 5IP7H 3GTGB 2DY8A 1DONA 2NN6H 2R93B 2D0PA 2WFWA 2EY6A 3J7A5 2WACA 2VUMB 4DR1L 4OIKA 3TSSA 4M8AA 4DUYQ 3W5OA 1VQ6A 1CKOA 1ZKOA 2K5DA 3HOUB 3PIP3 2KVMA 4KJOA 1YNJC 4DV7L 1LTBD 4LF8L 1NSNS 5EPLA 2C5CA 5M3FH 3OMCA 5H1SE 5NUCA 2BOSA 2F03A 1SMYD 5GADC 2R93G 1EYAA 2J7ZA 1TWHB 3QB3A 3KBXA 3OSOA 4K6DA 2EVBA 1MGSA 3BVMA 4HCSA 1TY0A 3PUZA 1K9MC 1TWAB 4EQ5A 1HHVA 5BR8L 4NXNQ 1N33Q 1B2TA 2GA4B 1XMQQ 3GTLB 1VQNA 2L15A 2F0NA 4Q0FA 2SNSA 3EIVA 3BS1A 2XN9C 1KLGD 1TU2B 4DR7Q 3NPPA 2PQEA 2B2YC 5CV7A 1FNWA 1XMOQ 1PRTF 2RCFA 1I50B 3SE0A 4DV6L 4XIGS 5C3EB 3PV0A 1ICFB 5T1IA 1QVFA 1UEBA 2SEBD 4A3BH 1VDZA 1YHQA 2F0PA 3VYTA 3U9SA 3CCUA 1CFMA 1W2BA 4IFDH 3CCJA 5HY6A 4B9XA 3PQIA 1MI2A 1S5DD 1KXLA 2YV5A 1DZ1A 4WJWA 4DUZL 4JI8L 5IGGA 3SHLA 2K03A 1KTKA 4JV5L 5FO8B 3GTPH 4LFAL 5C3EG 1HQRD 4ZKBB 3CHBD 3H15A 4HN7A 5E4XA 3SDZA 3H0GB 3H3VC 4PZ8A 1SJHD 1L0XB 4HTHA 1KC8C 3RN5A 2A6EC 2CH4A 2L55A 3R8BA 3I91A 4DNRB 3URYA 1LTID 4F8MA 5C3XA 4OXPA 4A3FG 2EIFA 4JYAL 4GOPA 1AP0A 2HCIA 2UXDQ 1NTGA 1SNOA 5M5XB 2HHHQ 2AUJD 1VQIA 4ZK9B 4RHSA 5LHY1 3KUPA 4J8QA 1S5FD 3H0GG 4OO1H 1M4VA 2JA6H 3ND8A 2Z6KA 1G51A 1Q46A 2A19A 3UDIA 2ZXOA 5ELBA 3NBIA 2A6ED 4AYBB 1U5KA 4TSSA 2PZUA 3BZKA 1YEZA 2JA7B 4JW0A 2DUDA 1VQCA 3EN2A 4MIUA 4OX9L 3HOWB 4X62L 1KAWA 1UUPA 2KQ3A 5DLQE 3UDGA 3EJIA 4R1JA 1Q8KA 3KLSX 1K8AC 3TP5A 5D3DA 1H95A 3K58A 4RHRA 5KNDA 4DK6C 3LWUA 4TRDA 3M4OH 2PZTA 1JQYD 2JA7G 3WWVA 4XQQA 4DXFA 4HIMA 4GS3A 4PG3A 4LAAA 1SEBD 5IGBA 1HR0L 2JA5H 1BCPB 4RGOS 3VR3A 3S1MH 3PUYA 1N36L 2E5LL 3NWSA 5CBEE 1OXXK 5E3FA 1EL0A 3OMGA 1NMFA 3CKIB 1EIGA 2OF1A 5A2QL 4PZ7A 3GTJH 1Z9FA 3S15B 4FXKC 3MXUA 3M3YB 4A3JG 2XVSA 3BJUA 1U4PA 2Z1CA 4KY7A 1TS5A 3QIAA 4UP9A 3GTKB 4XYOA 4E6IA 1RTNA 3KDFB 5CMDA 4FNFA 1VQEA 3A74A 2WB1E 2EYLA 1B44D 3D4RA 4DV1L 2B63G 2KA7A 1DOMA 4YCWA 1JE5A 1SNPA 2MPMA 3U9OA 1PTOF 4QB4A 4C2MH 3NXWA 2HIXA 4LF6Q 1D5ZC 2JA9A 1CZWA 3AEVA 2NTSA 1N32Q 2EXDA 4A3EB 5CYUA 4LF7Q 4IUQA 1LTRD 1TT2A 2FHTA 5M9OA 4NPSA 4JC0A 2WAQB 1QJOA 1X65A 4C1NI 4I7AA 2E2JB 1VQGA 3M7GA 2JQOA 4X64L 3EA6A 5LMUQ 2O4XA 1E24A 1N9WA 1EWHA 2D62A 5IE8A 3GTOB 3PO2H 1NY4A 1OXVA 3IL8A 4ME3A 4A3GB 3I4MG 1TVXA 3I56A 3GTQH 2WAQG 2PCFB 1ESRA 1MD2D 1FD7D 3S14B 1WOCA 1WTXA 2HDMA 4WORA 4IPHA 1SYBA 1EY9A 1B70B 4KY5A 2E2HB 4IPDA 2PNRC 5EKIA 3HOXB 1FJGL 5KNBA 4BA2I 4KKTA 3I4LA 2WV6D 1I4XA 4ZCKA 1X3FA 4A3KH 3IKJA 1D5XC 4Z9CB 4A3GG 4HR7B 1GUWA 1RCVD 1PDQA 2NWGA 4LW1A 1VF7A 2WKDA 3G7LA 3KOJA 4FDBA 1CKNB 3T1YL 2NZ1D 5JJZA 3NHHA 1AE3A 1X6OA 3DEPA 4K2KA 4PZ6A 4DAVA 3FP9A 1CM9A 2AKWB 1AE2A 1VCIA 5M3MB 2EY2A 5GQOA 2K28A 1A2TA 3UE0A 4C3JH 2B2WC 4K8IA 1IZ6A 3HOVG 3NTHA 4G7ZC 4HMJA 2KHJA 3R2IA 4YHHQ 3GTMH 2DJFC 4RH6A 4A3MH 1STEA 4HIKA 3NUCA 1VF5C 4N9PA 4GKJL 4KHZA 4HJ5A 1LTLA 3O13A 1E3PA 1EFWA 5M3MG 1J9OA 3T53B 3HKZE 1HUMA 2HDLA 4DR6L 3EBEA 3AB9A 1GUSA 3R2TA 3OW2A 1IHZA 1R4PB 5K5PA 2A1AA 1VQ4A 5IODA 1A15A 3S17H 3RLNA 3V96A 1PYSB 5ELEA 3RMHA 5KGUA 1XNQQ 4IOAA 3LX0A 4JI2L 2MFIA 3MAQA 3KF8B 3BVGA 1PFSA 1GXDC 1PH7A 3AYHB 1CT1D 2KENA 4YCUA 3IRBA 1DCZA 1HZ9A 4RGMA 1HNZL 2RBMA 3A55A 2MUYA 1SROA 3S9WA 3KBGA 2LFNA 1WCMH 2ZTDA 1TS2A 2I5LX 4V190 5C4ZA 2AMCB 3G48A 3KK7A 2AUKA 4H0LC 4QUCA 2BA0A 2ZXRA 4MTKA 5C5LA 1JB7A 1NE3A 1F2MA 2I5MX 4LF9L 2SOBA 3E0JA 4L6TB 4X3SA 4JI1L 2LXKA 3NEMA 3J80E 4LFBQ 3CMAA 2PI2A 3RLFA 1ILPA 2BE5D 3M9BA 4XQJA 3T13A 2F0WA 1STAA 4JI3L 4C3IB 4TKOB 1M8AA 3X3NA 4FXGC 1SE2A 1TS4A 1EU4A 1ILQA 4FF2A 2PO4A 1BBUA 1D5MC 2XSCA 2GVAA 4UP8A 2HQEA 2VL6A 1Q12A 2R7ZB 3T16A 2LKVA 3GV3A 3J81E 4HSPA 1SAPA 4JI7L 3I72A 3CAMA 1EY5A 3TP6A 3TS2A 1KQSA 2VQFQ 4LFCL 1C7YA 4C3IG 4DV0Q 1F9QA 1KDAA 4XQNA 1CSQA 1RF2D 3QOJA 1FGUA 2F4VQ 1BCPD 4B3MQ 1VQKA 1VQ7A 4JI0L 1S5ED 2QDBA 2LS01 2O5JC 1EWCA 2LXJA 3U4ZA 3CCVA 3H94A 2EYOA 5IYDH 1X54A 4WFN3 2OQKA 3T1HL 2NVXB 2NVTB 2OXPA 1JB3A 2K50A 1HZCA 3F2UA 4JPBW 1O78A 4BXXG 1IYVA 1ET6A 1X56A 1Y1WB 4DV2L 4QCLA 3CPFA 3K5OA 5A35A 1BBXC 1VMPA 4KKUA 1ASZA 4A93H 1H9KA 4BBRB 2UXBL 5ELNA 1N34L 5I2XA 1E2VA 4BBSG 1DOKA 2ICEC 4F87A 2F0GA 5C44H 1RTOA 1JICA 3C2PA 3E9IA 1C4QA 4C56C 2C9OA 3GO5A 3U58A 2NTTA 4DV4Q 2RHSB 1YNXA 4R8IA 4Y52H 1PH1A 1KNAA 5FJ8G 2JSOA 4GOPB 2XIWA 4OONA 4BBRG 1HXYD 1L1OA 1IBLL 1OXUA 3STBD 4FXDA 4JVZA 4DXGA 1BBWA 3RLOA 1EOTA 3F1ZA 1Q1EA 2Z6BA 1HR0W 3MA2B 4BY7H 3JAMc 3EFXD 4LUZA 1RJTA 5JPMC 4A3LG 2VQEQ 4L8JA 4GNXC 2ZM6L 1WTWA 3HOZH 1YNND 1I4PA 3MEHA 3D0FA 5FLXc 1EY8A 3OHXC 3P7JA 4YIJA 1G291 1MSHA 1SYDA 3KF6A 4M1UB 2F0OA 4NP5A 4ODGA 2IWHA 3RZOH 1EIYB 3DUZA 4XXEA 3V05A 4ILWA 3VYRA 2KCNA 1STBA 3VR6A 5IP9H 4DAMA 1Y8NB 3DWQA 2PW5A 1WTOA 3RNUA 1TWFH 4P74A 2KEDA 4XT1B 3PO3H 1EY4A 2GVBA 2R3ZA 1TXYA 2NUCA 5K36H 3RZDH 1AZQA 4L5TA 2WINB 3H91A 1DYQA 5LMNL 2EYPA 3SK4A 5C4XH 1PZJD 5ISRA 1IYUA 1KHIA 4YY3Q 4OELB 5CV4A 1V43A 3I2ZA 2EYMA 1IL2A 5KEEA 3AU7A 4RKBA 2H1EA 2N88A 1SLJA 2UXCL 2F4IA 5IT9E 3G4SA 4DR4L 1EYDA 3LNNA 4DR5L 3PUXA 3S1QB 2VXWA 2QEXA 1FNUA 3ZJYC 3S16B 3J80L 4A3IG 3CC4A 5FLMG 2MO0A 2ID0A 2EJFC 4DV7Q 1EOVA 1B3AA 1MSGA 2X6LA 2YU9B 4LF8Q 4J15A 4OEMB 4X3TA 3GTGH 1H9SA 2R93H 4CJ0B 2VUMH 1MIUA 2N55A 1XNRL 4KMUC 4K0KQ 3L9AX 4NW2A 1HTPA 5FO7B 2M2LA 1CQFA 3MC0B 4UDUC 1LYLA 3J81L 3HOUH 3VDYA 1E7ZA 3LGJA 1J5EQ 5BR8Q 2MGSA 1LT3D 4AQYL 4A3CG 1EY7A 1G8ZD 1TWHH 4JOIC 3ULJA 1ZEQX 5F2DA 2YTXA 4AYBE 2Y0SB 2Z8LA 1CA5A 3K7UC 4O2DA 1SE3A 2B2VC 4DV6Q 1E1TA 2K14A 3GP7A 3OIQA 1TWAH 1SMYC 4IUPA 4NXML 1SXTA 1TY2A 1Q81C 2WP8J 1UWVA 1HA6A 3P75A 1I94L 3GTLH 1WYDA 3F2DA 2PPBC 4BS9A 5I2YA 1PZKD 5JVH3 1HJPA 4KD3A 1PH6A 2Y0SG 2V1CC 4DUZQ 4IUUA 1I50H 1STHA 2EY5A 3WDNA 2PNHA 2RDHA 1PH9A 5C3EH 1GM5A 3F8TA 4JV5Q 4C3HG 5CV9A 4LFAQ 4JCVE 1QNUA 1VMCA 1LO5D 1SDFA 3OWFA 4ZYSA 1AW7A 3PF4A 3CCLA 5CR3A 3I4NG 1C48A 4B08A 4LF4L 4DV3L 4DN4M 2BA1A 2XNAC 3TEHB 4WJ4A 1L2FA 1SE8A 1EQVA 5HGTA 3OW7A 4B3RL 2NVQB 1HFNA 1LT4D 4RGTA 2F0SA 3H0GH 1NUCA 3MHBA 3HP3A 1KL9A 1JOKA 1JOOA 2TSSA 3GD7A 4K5WA 1H9JA 2A74C 1X3PA 2RHQB 3VR5A 4ALPA 2OTJA 2PMZB 5LL6S 2B2UC 3MFGA 3A0JA 1PRTB 3CPWA 5M5XH 2M9VA 2UUCL 3QWNA 2B2TA 2B8FA 2EQSA 2XTIA 3HOYG 1HZBA 5C0XH 4OX9Q 4BY1B 4X62Q 4R8NA 2CCZA 4X66L 2RSNA 2VB2X 1IBMQ 3C46A 4A3FB 3TREA 1Q82C 2AQ1B 1G2SA 3C1FA 2JA7H 2YYZA 5IP7G 4X65Q 3HOWH 3CC7A 3KYHC 3K57A 4BY1G 2FINB 2WKCA 4DKAC 3A8KE 1WTRA 1N36Q 1EWIA 1VQLA 1K0RA 4CKEA 4ZLTF 2ZTEA 1XPRA 2ZJQA 2F0VA 3H09A 1RODA 1S5CD 1OTCA 3SK5A 1XWEA 5IT9L 3B6YA 5C4JB 3K7AB 3ICEA 1SNQA 4K6LA 4JK1C 2IX3A 2DY7A 2NVYB 4LWCA 2VY3A 1IBKL 4HJ8A 2OWOA 1XJVA 5E7NA 1YITA 4DV1Q 2CWAA 2RF4A 4JBMA 4N8X1 1B53A 2BDNA 4RMFA 4UP7A 3UDFA 2VW9A 2XWBB 3S15H 4P75A 3M3YH 3HEJA 1SR3A 1ENFA 2IT1A 3GTKH 1XMOL 4JBKA 4GLVB 5IGDA 4HJ7A 2K6AA 3PSIA 5EBCA 1BO0A 5EKKA 2HQLA 1HFGA 4X64Q 2Q2UA 1FGBD 3EROA 4A3EH 1BNZA 1VQPA 2UU9L 3KJOA 4A3JB 1LT5D 3PIO3 1SNCA 3BZDB 4V0BA 1O80A 1GUTA 2KOLA 3M4YA 3BDLA 3PUVA
chains in the Genus database with same CATH topology
3CXCA 3CCEA 3OW2A 4TQUS 3BU2A 5GAEC 1VQ4A 2A1AA 1D8LA 4BY1H 3S17H 3RLNA 1I5FA 1W3SA 1AH9A 1PYSB 2E2JH 4JOIA 2CFMA 1XNQQ 4IOAA 1I6HH 4JI2L 1CSPA 4A3FH 1B8AA 2MFIA 3NBHB 3KF8B 1PFSA 3A5UA 4JYAQ 1PH7A 2K52A 3AYHB 2F4VL 2KENA 3TQYA 4YCUA 3OTOL 4B3ML 3IRBA 3GTOH 3UE1A 1HZ9A 4GN4B 1HNZL 1IYJB 1PVOA 3K80C 4A3GH 4HIDA 3Q8DA 1SROA 1A0IA 2N49A 1HH2P 4K0KL 2VUMG 1WCMH 2ZTDA 4AQYQ 3HOWG 3S14H 2I5LX 1A8VA 3FHWA 1LUZA 2DGYA 2D0OA 1PV4A 5IYDG 2F52A 3A5ZB 1IBKQ 2AMCB 3G48A 3UDXA 4KI0A 4QIWE 2HIVA 3CF5A 3T1YQ 1KD1C 3HOUG 1J5EL 2E2HH 1JJ2A 2BA0A 3HOXH 2JA6G 1JB7A 1NE3A 2JE6I 3PF5A 2I5MX 3JC66 4B3TQ 4LF9L 1E22A 3PCOB 2AHOB 5C4JH 2VNUD 4JI1L 2LXKA 3K81C 3NEMA 3ULLA 3CMAA 3K7AH 4IJHA 4JG2A 2PI2A 2WAQE 4NXMQ 3RLFA 4LFBQ 4A93G 4NB3A 1VQOA 1VQFA 5JJKA 3S1RH 2NVYH 2F3IA 1CKNA 3M9BA 4GOPC 1L1OB 2IHEA 1P8LA 4JI3L 1X3GA 2MQHA 2N3SA 1TWCH 2NZOA 2CKZB 2ZJPA 5C44G 4JI6L 3KJPA 2Q2IA 4IFDJ 5C0XJ 4IPGA 4GKJQ 4B3SQ 1BBUA 2NN6G 5M3MH 2QGQA 2GVAA 4UP8A 2UU9Q 2Z6KC 4C3HH 1HR0Q 2VL6A 1Q12A 2KBNA 4AH6A 1Q86C 5LMNW 4MZ9A 1SRUA 2NZHA 4O0AA 4DUYL 5GROA 1XPUA 4DR6Q 3D31A 4LUOA 2UUAL 1VQDA 1VS0A 2Q2TA 2E5LQ 4JI7L 3U4VA 3I4NH 4KHPQ 1A63A 3CAMA 1EYGA 3JAMi 3H3VI 3TS2A 4MTNA 1EQQA 3KF6B 4JI5L 5IWAL 1KQSA 3J7ZC 2VQFQ 4LFCL 1C7YA 3U50C 1CUKA 4DV0Q 1XPOA 2Q2HA 5IYCG 2JA5G 4LF4Q 5M3FG 4DV3Q 1YJ9A 3I4OA 4JI2Q 2K4KA 4UY8C 3CCRA 1IXRA 4A3JH 1CSQA 3M85A 3K8AA 4QY7A 2UUBQ 2VQEL 1FGUA 1S3OA 2F4VQ 2A8VA 3OTOQ 4B3MQ 1VQKA 4B3RQ 3HOZG 1MJCA 1HNZQ 1VQ7A 4OWWB 2B63H 1G6PA 1EUJA 2OQ0A 3TRZA 4IPCA 4JI0L 3J80c 4POFA 2ASBA 1JT8A 1LM0A 1J6QA 1NBWA 2LXJA 3ER0A 3U4ZA 3NENA 2RCNA 1YVCA 4NXNL 3CCVA 1N33L 5IYDH 3PUVA 3DM3A 1K83H 1X54A 1XMQL 2OQKA 3T1HL 1BVSA 2K50A 1HZCA 3CW2C 2I5HA 3PIPA 4BXXG 5IP9G 1X56A 4GLAC 4UPAA 4DR7L 4R4IA 1KRTA 4H02A 2IHFA 1UE5A 4APVA 4DV2L 1VQMA 3HOYH 3CPFA 3J81c 1ASZA 4A93H 4X66Q 4JI1Q 1YBYA 1GKHA 5M5YH 2UXBL 1L0WA 5ELNA 3CMEA 1N34L 5IYBG 5K36G 3S24A 4BBSG 3F2BA 3W1GA 1U0LA 1S72A 4YY3L 1FL0A 4A3BG 1M1KC 2Z0SA 5C44H 1VQ5A 1YHBA 3CP0A 4IFDG 4JI6Q 1X3EA 5C0XG 2KCTA 5IP7H 1FVIA 3E9IA 3U58A 4HIOA 3GO5A 1IBML 3I4MH 3DLLA 2D0PA 2WFWA 2RHSB 1YNXA 4DV4Q 1VQ9A 3J7A5 4Y52H 4LUVA 1TWGH 1PH1A 4DR1L 4AYBG 5FJ8G 4L5QA 2ALYB 4GOPB 4QQBX 4OONA 4BBRG 4DUYQ 1P16A 3W5OA 1VQ6A 1CKOA 1QUQB 1L1OA 2UUAQ 4DPGA 4X65L 1IBLL 1OXUA 4DV7L 1D7QA 3L0OA 5JJLA 4LF8L 3STBD 4C3IH 4JI5Q 5IWAQ 5IYCH 1EIFA 2VS1A 3K0XA 1BBWA 3FKIG 3RLOA 5H1SE 5M3FH 4LFCQ 1FJGQ 1K3RA 3CCSA 2ES2A 1WFQA 3F1ZA 1E1OA 5GADC 1Q1EA 1HR0W 2R93G 4BY7H 3JAMc 1RL2A 4LUZA 4YCVA 4LNQA 3KFUA 3M7NA 4GKKL 2R7ZH 4A3LG 2VQEQ 4GNXC 3NELA 2ZM6L 3HOZH 2UXDL 2HHHL 5GAGC 1YHAA 1YIJA 3D0FA 2LSSA 5FLXc 2BH8A 4JI0Q 3PUZA 3E9HA 1G291 3KF6A 4JBJA 2K5VA 4EQ5A 1K9MC 1ASYA 5BR8L 4OO1G 2B3GA 1HZAA 1EQRA 4HJAA 4NXNQ 1N33Q 1WJJA 3RZOH 1EIYB 4DNIA 3BZCA 1XMQQ 1VQNA 2L15A 4BXXH 2K5NA 5IP9H 4DAMA 2AWNA 3EIVA 4IJLA 3RNUA 1PH2A 4DR7Q 3HOVH 1TWFH 4P74A 1RIPA 4DV2Q 1XMOQ 1PYBA 3PO3H 1PA6A 5M5WH 2GVBA 2R92G 4DV6L 3TS0A 4XIGS 1TXYA 3AFPA 2UXBQ 3RZDH 3PV0A 4L5TA 4HJ9A 1N34Q 1QVFA 5LMNL 1UEBA 4A3BH 1PH5A 2NVXH 5C4XH 4YY3Q 1YHQA 2NVTH 1KHIA 3CCUA 1W2BA 1V43A 3I2ZA 3CCJA 2XGTA 1IL2A 4YHHL 5HY6A 2QA4A 1SLJA 1Y1WH 2UXCL 1KXLA 1GO3E 1UE7A 2YV5A 2I0QA 3HKSA 3G4SA 1HNWL 4DR4L 2E2IH 4DUZL 4XTCS 4IO9A 4JI8L 3F2CA 2KCMA 5FJ8H 4DR5L 4A3EG 3PUXA 1YZ6A 1XTDA 3W1BA 3SGIA 4BBRH 3GTPH 2QEXA 4JV5L 4LFAL 5C3EG 3ZJYC 3H15A 4A3IG 3CC4A 5FLMG 2MO0A 2BH2A 2ID0A 1VQAA 1IBLQ 4PZ8A 4DV7Q 1EOVA 2MNAA 4LF8Q 3CD6A 2B29A 3FKIH 4J15A 3RN5A 1KC8C 4DK3C 3GTGH 1M90C 2MO1A 4R4QA 3CC2A 2R93H 1VQ8A 1QVCA 5JEAJ 2VUMH 1MIUA 2IX1A 1XNRL 1WI5A 3OYYA 4OXPA 4YWKA 2EIFA 2R7FA 4EX5A 4GOPA 3ULPA 4A3FG 4YWLA 4JYAL 4GKKQ 4K0KQ 1SN8A 2UXDQ 1NTGA 5IY0A 4IOCA 4X6AH 1S40A 2HHHQ 1VQBA 1VQIA 2NN6I 1LYLA 1OXSC 1NJIC 3HOUH 3VDYA 4L5SA 1E7ZA 3H0GG 3LGJA 1J5EQ 2JA6H 2Z6KA 5BR8Q 2ZTCA 1O7IA 3M4PA 4AQYL 4A3CG 1G51A 1Q46A 2A19A 4LF6L 3UDIA 4GNXB 1N32L 3S2DH 3CCQA 4LF7L 4LF9Q 1MKHA 1U5KA 3AFQA 2JEAI 5IT9c 1TWHH 4JOIC 3ULJA 3BZKA 1YEZA 2YTXA 4AYBE 1BKBA 1L1OC 1JJCB 4LF5L 2DUDA 3STBC 5GAHC 3K7UC 1GD7A 4O2DA 5ELOA 3HOXG 1VQCA 1YJNA 3EN2A 2R92H 1C9OA 2AWOA 2K5HA 1E1TA 4DV6Q 2Y0SE 2K14A 4X62L 4JI3Q 1TWAH 4OX9L 4POGA 3L2PA 1KAWA 4NXML 2ATWA 5DLQE 3UDGA 2WP8J 1UWVA 1Q81C 4R1JA 1UE6A 5LMNQ 1Q8KA 1K8AC 1I94L 1VQJA 2VZAA 1WYDA 5LMUL 3GTLH 3F2DA 1H95A 1PH4A 4DK6C 4JBWA 3M4OH 5J3BA 1Q1BA 3PUWA 4KLKA 1HJPA 1YI2A 1HNWQ 4GN5A 2UXCQ 4R4OA 2JA7G 3WWVA 2Y0SG 1PH6A 4JI7Q 2V1CC 3GDEA 4GS3A 4PG3A 4DUZQ 1I50H 4HIMA 1K73C 1JMCA 4B3SL 3PO2G 2PNHA 4DR5Q 1PH9A 1HR0L 5C3EH 1GM5A 3F8TA 4R4CA 2JA5H 2H5XA 4JV5Q 1R9TH 4LFAQ 4JCVE 1V9PA 5FLMH 1Y1VG 2JJQA 3J81j 2N78A 3S1MH 3G71A 2OTLA 3PUYA 1N36L 1B7YB 2E5LL 3PF4A 3CCLA 3I4NG 1OXXK 1NMFA 2VQFL 5JEAG 4DV0L 1PHJA 4LF4L 1KRSA 4QGUA 4PZ7A 4DV3L 3GTJH 4IFDI 1Y14B 1Z9FA 2PQAB 5C0XI 3J80i 4JI4L 2BA1A 2FXQA 1XNRQ 1OXTA 3TEHB 3HKZG 4A3KG 1L2FA 1SE8A 4A3DG 2UUBL 4DV5L 3S1QH 4WJ3M 4WJ4A 2CQOA 1Z47A 4A3JG 3BJUA 3S16H 4B3RL 4UP9A 3E0EA 2IX0A 3T1HQ 4DR2L 4DAYB 3H0GH 3KDFB 2B63G 1VQEA 3A74A 2WB1E 4GN3B 1X9NA 4DV1L 2E8GA 4P72A 4DR3L 2YU9H 1KL9A 4A3CH 4YCWA 1JE5A 3GD7A 4C2MH 1K8GA 4A76A 2HIXA 4QL5A 2JA9A 2RHQB 4LF6Q 1C0AA 4MNOA 3KLWA 4ALPA 3AEVA 1N32Q 2OTJA 2EXDA 3S2HH 2CWPA 4LF7Q 1SMXA 3L7ZC 3J81i 3MEFA 5IYBH 4OWXB 4YWMA 3A0JA 4BBSH 1N8RC 3CPWA 5M5XH 4LF5Q 2PMZE 2WB1G 4NPSA 2UUCL 2JEBI 2EQSA 4A4IA 4JC0A 4A75A 2XTIA 3HOYG 1HZBA 1VQHA 1X65A 2JA8G 4OX9Q 4X62Q 2CCZA 4X66L 4RG1A 5HGQA 1HNXL 1VQGA 3M4QA 4A3MG 4GNXA 2GN5A 1IBMQ 2JQOA 4X64L 3G6EA 1I94Q 2KHIA 3TREA 3CCMA 5LMUQ 1Q82C 3HFZB 4OO1I 1E24A 1N9WA 4DR1Q 2D62A 5AJ3L 5IE8A 4AIMA 2JA7H 1YJWA 2YYZA 1X55A 2JK8A 2YTYA 5IP7G 3PO2H 1NY4A 1OXVA 4ME3A 4X65Q 4DV4L 3I4MG 3I56A 2C35B 2WAQG 3GTQH 3HOWH 2IY5B 3CC7A 1Y1VH 3KYHC 4BY1G 1WOCA 1A62A 1XNQL 4DKAC 2ZJRA 4IPHA 1EWIA 4P73A 1N36Q 1QZGA 3PGZA 4A3LH 1VQLA 1K0RA 1B70B 3CQZH 2ZTEA 4IPDA 1XPRA 2ZJQA 2OCEA 2ZM6Q 4OWTB 5JJIA 1QUQA 1SFOH 1FJGL 1OTCA 4BA2I 1CKMA 4A3KH 1X3FA 4JI4Q 3B6YA 4A3DH 4A3GG 3I7FA 4DV5Q 4GLXA 1QVGA 3ICEA 4BY7G 4PMWA 3PIOA 1WCMG 4L5RC 4QJFA 2R7ZG 4LW1A 4Y7NH 1JJGA 4LWCA 4DR2Q 1T9HA 2VY3A 3KOJA 3AQQA 1IBKL 4HJ8A 2OWOA 4FDBA 5E7NA 1XJVA 1CKNB 3T1YL 3MXNB 4DV1Q 4DR3Q 1YITA 2PI2E 2CWAA 1QZHA 2RF4A 4JBMA 1AE3A 1X6OA 4PZ6A 2PQAA 4RMFA 4UP7A 3UDFA 3FP9A 4R4TA 2AKWB 1AE2A 1VCIA 2VW9A 4B3TL 5GQOA 1NMGA 2N8NA 1PH3A 3S15H 3ERSX 3UE0A 3H3VH 4P75A 1UE1A 3M3YH 1SR3A 4C3JH 4LFBL 4P71A 2IT1A 2UUCQ 1IZ6A 3KDFA 2NVQH 1XMOL 2HT1A 3GTKH 3HOVG 2JA8H 4JBKA 4BA1I 4GLVB 1Q7YC 3PO3G 2KHJA 3I55A 4YHHQ 4HJ7A 3GTMH 4A3MH 3PSIA 3S1NH 3RR5A 1HNXQ 2R6GA 1DGSA 4HIKA 1KIXA 2HQLA 4DR4Q 4X64Q 2Q2UA 4GKJL 4KHZA 3RN2A 4JI8Q 1LTLA 4TVAB 4HJ5A 4A3EH 1VQPA 2UU9L 1E3PA 3KJOA 1EFWA 5C4XG 5M3MG 5AJ3Q 1PH8A 2R7DA 1I3QH 2YTVA 5EAYA 4A3IH 3HKZE 4DR6L 1GVPA 2K75A 3EBEA 4KHPL 1V1QA 1Y1WG 1MJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC A;  3CCE A;  3OW2 A;  4TQU S;  3BU2 A;  5GAE C;  1VQ4 A;  2A1A A;  1D8L A;  4BY1 H;  3S17 H;  3RLN A;  1I5F A;  1W3S A;  1AH9 A;  1PYS B;  2E2J H;  4JOI A;  2CFM A;  1XNQ Q;  4IOA A;  1I6H H;  4JI2 L;  1CSP A;  4A3F H;  1B8A A;  2MFI A;  3NBH B;  3KF8 B;  1PFS A;  3A5U A;  4JYA Q;  1PH7 A;  2K52 A;  3AYH B;  2F4V L;  2KEN A;  3TQY A;  4YCU A;  3OTO L;  4B3M L;  3IRB A;  3GTO H;  3UE1 A;  1HZ9 A;  4GN4 B;  1HNZ L;  1IYJ B;  1PVO A;  3K80 C;  4A3G H;  4HID A;  3Q8D A;  1SRO A;  1A0I A;  2N49 A;  1HH2 P;  4K0K L;  2VUM G;  1WCM H;  2ZTD A;  4AQY Q;  3HOW G;  3S14 H;  2I5L X;  1A8V A;  3FHW A;  1LUZ A;  2DGY A;  2D0O A;  1PV4 A;  5IYD G;  2F52 A;  3A5Z B;  1IBK Q;  2AMC B;  3G48 A;  3UDX A;  4KI0 A;  4QIW E;  2HIV A;  3CF5 A;  3T1Y Q;  1KD1 C;  3HOU G;  1J5E L;  2E2H H;  1JJ2 A;  2BA0 A;  3HOX H;  2JA6 G;  1JB7 A;  1NE3 A;  2JE6 I;  3PF5 A;  2I5M X;  3JC6 6;  4B3T Q;  4LF9 L;  1E22 A;  3PCO B;  2AHO B;  5C4J H;  2VNU D;  4JI1 L;  2LXK A;  3K81 C;  3NEM A;  3ULL A;  3CMA A;  3K7A H;  4IJH A;  4JG2 A;  2PI2 A;  2WAQ E;  4NXM Q;  3RLF A;  4LFB Q;  4A93 G;  4NB3 A;  1VQO A;  1VQF A;  5JJK A;  3S1R H;  2NVY H;  2F3I A;  1CKN A;  3M9B A;  4GOP C;  1L1O B;  2IHE A;  1P8L A;  4JI3 L;  1X3G A;  2MQH A;  2N3S A;  1TWC H;  2NZO A;  2CKZ B;  2ZJP A;  5C44 G;  4JI6 L;  3KJP A;  2Q2I A;  4IFD J;  5C0X J;  4IPG A;  4GKJ Q;  4B3S Q;  1BBU A;  2NN6 G;  5M3M H;  2QGQ A;  2GVA A;  4UP8 A;  2UU9 Q;  2Z6K C;  4C3H H;  1HR0 Q;  2VL6 A;  1Q12 A;  2KBN A;  4AH6 A;  1Q86 C;  5LMN W;  4MZ9 A;  1SRU A;  2NZH A;  4O0A A;  4DUY L;  5GRO A;  1XPU A;  4DR6 Q;  3D31 A;  4LUO A;  2UUA L;  1VQD A;  1VS0 A;  2Q2T A;  2E5L Q;  4JI7 L;  3U4V A;  3I4N H;  4KHP Q;  1A63 A;  3CAM A;  1EYG A;  3JAM i;  3H3V I;  3TS2 A;  4MTN A;  1EQQ A;  3KF6 B;  4JI5 L;  5IWA L;  1KQS A;  3J7Z C;  2VQF Q;  4LFC L;  1C7Y A;  3U50 C;  1CUK A;  4DV0 Q;  1XPO A;  2Q2H A;  5IYC G;  2JA5 G;  4LF4 Q;  5M3F G;  4DV3 Q;  1YJ9 A;  3I4O A;  4JI2 Q;  2K4K A;  4UY8 C;  3CCR A;  1IXR A;  4A3J H;  1CSQ A;  3M85 A;  3K8A A;  4QY7 A;  2UUB Q;  2VQE L;  1FGU A;  1S3O A;  2F4V Q;  2A8V A;  3OTO Q;  4B3M Q;  1VQK A;  4B3R Q;  3HOZ G;  1MJC A;  1HNZ Q;  1VQ7 A;  4OWW B;  2B63 H;  1G6P A;  1EUJ A;  2OQ0 A;  3TRZ A;  4IPC A;  4JI0 L;  3J80 c;  4POF A;  2ASB A;  1JT8 A;  1LM0 A;  1J6Q A;  1NBW A;  2LXJ A;  3ER0 A;  3U4Z A;  3NEN A;  2RCN A;  1YVC A;  4NXN L;  3CCV A;  1N33 L;  5IYD H;  3PUV A;  3DM3 A;  1K83 H;  1X54 A;  1XMQ L;  2OQK A;  3T1H L;  1BVS A;  2K50 A;  1HZC A;  3CW2 C;  2I5H A;  3PIP A;  4BXX G;  5IP9 G;  1X56 A;  4GLA C;  4UPA A;  4DR7 L;  4R4I A;  1KRT A;  4H02 A;  2IHF A;  1UE5 A;  4APV A;  4DV2 L;  1VQM A;  3HOY H;  3CPF A;  3J81 c;  1ASZ A;  4A93 H;  4X66 Q;  4JI1 Q;  1YBY A;  1GKH A;  5M5Y H;  2UXB L;  1L0W A;  5ELN A;  3CME A;  1N34 L;  5IYB G;  5K36 G;  3S24 A;  4BBS G;  3F2B A;  3W1G A;  1U0L A;  1S72 A;  4YY3 L;  1FL0 A;  4A3B G;  1M1K C;  2Z0S A;  5C44 H;  1VQ5 A;  1YHB A;  3CP0 A;  4IFD G;  4JI6 Q;  1X3E A;  5C0X G;  2KCT A;  5IP7 H;  1FVI A;  3E9I A;  3U58 A;  4HIO A;  3GO5 A;  1IBM L;  3I4M H;  3DLL A;  2D0P A;  2WFW A;  2RHS B;  1YNX A;  4DV4 Q;  1VQ9 A;  3J7A 5;  4Y52 H;  4LUV A;  1TWG H;  1PH1 A;  4DR1 L;  4AYB G;  5FJ8 G;  4L5Q A;  2ALY B;  4GOP B;  4QQB X;  4OON A;  4BBR G;  4DUY Q;  1P16 A;  3W5O A;  1VQ6 A;  1CKO A;  1QUQ B;  1L1O A;  2UUA Q;  4DPG A;  4X65 L;  1IBL L;  1OXU A;  4DV7 L;  1D7Q A;  3L0O A;  5JJL A;  4LF8 L;  3STB D;  4C3I H;  4JI5 Q;  5IWA Q;  5IYC H;  1EIF A;  2VS1 A;  3K0X A;  1BBW A;  3FKI G;  3RLO A;  5H1S E;  5M3F H;  4LFC Q;  1FJG Q;  1K3R A;  3CCS A;  2ES2 A;  1WFQ A;  3F1Z A;  1E1O A;  5GAD C;  1Q1E A;  1HR0 W;  2R93 G;  4BY7 H;  3JAM c;  1RL2 A;  4LUZ A;  4YCV A;  4LNQ A;  3KFU A;  3M7N A;  4GKK L;  2R7Z H;  4A3L G;  2VQE Q;  4GNX C;  3NEL A;  2ZM6 L;  3HOZ H;  2UXD L;  2HHH L;  5GAG C;  1YHA A;  1YIJ A;  3D0F A;  2LSS A;  5FLX c;  2BH8 A;  4JI0 Q;  3PUZ A;  3E9H A;  1G29 1;  3KF6 A;  4JBJ A;  2K5V A;  4EQ5 A;  1K9M C;  1ASY A;  5BR8 L;  4OO1 G;  2B3G A;  1HZA A;  1EQR A;  4HJA A;  4NXN Q;  1N33 Q;  1WJJ A;  3RZO H;  1EIY B;  4DNI A;  3BZC A;  1XMQ Q;  1VQN A;  2L15 A;  4BXX H;  2K5N A;  5IP9 H;  4DAM A;  2AWN A;  3EIV A;  4IJL A;  3RNU A;  1PH2 A;  4DR7 Q;  3HOV H;  1TWF H;  4P74 A;  1RIP A;  4DV2 Q;  1XMO Q;  1PYB A;  3PO3 H;  1PA6 A;  5M5W H;  2GVB A;  2R92 G;  4DV6 L;  3TS0 A;  4XIG S;  1TXY A;  3AFP A;  2UXB Q;  3RZD H;  3PV0 A;  4L5T A;  4HJ9 A;  1N34 Q;  1QVF A;  5LMN L;  1UEB A;  4A3B H;  1PH5 A;  2NVX H;  5C4X H;  4YY3 Q;  1YHQ A;  2NVT H;  1KHI A;  3CCU A;  1W2B A;  1V43 A;  3I2Z A;  3CCJ A;  2XGT A;  1IL2 A;  4YHH L;  5HY6 A;  2QA4 A;  1SLJ A;  1Y1W H;  2UXC L;  1KXL A;  1GO3 E;  1UE7 A;  2YV5 A;  2I0Q A;  3HKS A;  3G4S A;  1HNW L;  4DR4 L;  2E2I H;  4DUZ L;  4XTC S;  4IO9 A;  4JI8 L;  3F2C A;  2KCM A;  5FJ8 H;  4DR5 L;  4A3E G;  3PUX A;  1YZ6 A;  1XTD A;  3W1B A;  3SGI A;  4BBR H;  3GTP H;  2QEX A;  4JV5 L;  4LFA L;  5C3E G;  3ZJY C;  3H15 A;  4A3I G;  3CC4 A;  5FLM G;  2MO0 A;  2BH2 A;  2ID0 A;  1VQA A;  1IBL Q;  4PZ8 A;  4DV7 Q;  1EOV A;  2MNA A;  4LF8 Q;  3CD6 A;  2B29 A;  3FKI H;  4J15 A;  3RN5 A;  1KC8 C;  4DK3 C;  3GTG H;  1M90 C;  2MO1 A;  4R4Q A;  3CC2 A;  2R93 H;  1VQ8 A;  1QVC A;  5JEA J;  2VUM H;  1MIU A;  2IX1 A;  1XNR L;  1WI5 A;  3OYY A;  4OXP A;  4YWK A;  2EIF A;  2R7F A;  4EX5 A;  4GOP A;  3ULP A;  4A3F G;  4YWL A;  4JYA L;  4GKK Q;  4K0K Q;  1SN8 A;  2UXD Q;  1NTG A;  5IY0 A;  4IOC A;  4X6A H;  1S40 A;  2HHH Q;  1VQB A;  1VQI A;  2NN6 I;  1LYL A;  1OXS C;  1NJI C;  3HOU H;  3VDY A;  4L5S A;  1E7Z A;  3H0G G;  3LGJ A;  1J5E Q;  2JA6 H;  2Z6K A;  5BR8 Q;  2ZTC A;  1O7I A;  3M4P A;  4AQY L;  4A3C G;  1G51 A;  1Q46 A;  2A19 A;  4LF6 L;  3UDI A;  4GNX B;  1N32 L;  3S2D H;  3CCQ A;  4LF7 L;  4LF9 Q;  1MKH A;  1U5K A;  3AFQ A;  2JEA I;  5IT9 c;  1TWH H;  4JOI C;  3ULJ A;  3BZK A;  1YEZ A;  2YTX A;  4AYB E;  1BKB A;  1L1O C;  1JJC B;  4LF5 L;  2DUD A;  3STB C;  5GAH C;  3K7U C;  1GD7 A;  4O2D A;  5ELO A;  3HOX G;  1VQC A;  1YJN A;  3EN2 A;  2R92 H;  1C9O A;  2AWO A;  2K5H A;  1E1T A;  4DV6 Q;  2Y0S E;  2K14 A;  4X62 L;  4JI3 Q;  1TWA H;  4OX9 L;  4POG A;  3L2P A;  1KAW A;  4NXM L;  2ATW A;  5DLQ E;  3UDG A;  2WP8 J;  1UWV A;  1Q81 C;  4R1J A;  1UE6 A;  5LMN Q;  1Q8K A;  1K8A C;  1I94 L;  1VQJ A;  2VZA A;  1WYD A;  5LMU L;  3GTL H;  3F2D A;  1H95 A;  1PH4 A;  4DK6 C;  4JBW A;  3M4O H;  5J3B A;  1Q1B A;  3PUW A;  4KLK A;  1HJP A;  1YI2 A;  1HNW Q;  4GN5 A;  2UXC Q;  4R4O A;  2JA7 G;  3WWV A;  2Y0S G;  1PH6 A;  4JI7 Q;  2V1C C;  3GDE A;  4GS3 A;  4PG3 A;  4DUZ Q;  1I50 H;  4HIM A;  1K73 C;  1JMC A;  4B3S L;  3PO2 G;  2PNH A;  4DR5 Q;  1PH9 A;  1HR0 L;  5C3E H;  1GM5 A;  3F8T A;  4R4C A;  2JA5 H;  2H5X A;  4JV5 Q;  1R9T H;  4LFA Q;  4JCV E;  1V9P A;  5FLM H;  1Y1V G;  2JJQ A;  3J81 j;  2N78 A;  3S1M H;  3G71 A;  2OTL A;  3PUY A;  1N36 L;  1B7Y B;  2E5L L;  3PF4 A;  3CCL A;  3I4N G;  1OXX K;  1NMF A;  2VQF L;  5JEA G;  4DV0 L;  1PHJ A;  4LF4 L;  1KRS A;  4QGU A;  4PZ7 A;  4DV3 L;  3GTJ H;  4IFD I;  1Y14 B;  1Z9F A;  2PQA B;  5C0X I;  3J80 i;  4JI4 L;  2BA1 A;  2FXQ A;  1XNR Q;  1OXT A;  3TEH B;  3HKZ G;  4A3K G;  1L2F A;  1SE8 A;  4A3D G;  2UUB L;  4DV5 L;  3S1Q H;  4WJ3 M;  4WJ4 A;  2CQO A;  1Z47 A;  4A3J G;  3BJU A;  3S16 H;  4B3R L;  4UP9 A;  3E0E A;  2IX0 A;  3T1H Q;  4DR2 L;  4DAY B;  3H0G H;  3KDF B;  2B63 G;  1VQE A;  3A74 A;  2WB1 E;  4GN3 B;  1X9N A;  4DV1 L;  2E8G A;  4P72 A;  4DR3 L;  2YU9 H;  1KL9 A;  4A3C H;  4YCW A;  1JE5 A;  3GD7 A;  4C2M H;  1K8G A;  4A76 A;  2HIX A;  4QL5 A;  2JA9 A;  2RHQ B;  4LF6 Q;  1C0A A;  4MNO A;  3KLW A;  4ALP A;  3AEV A;  1N32 Q;  2OTJ A;  2EXD A;  3S2H H;  2CWP A;  4LF7 Q;  1SMX A;  3L7Z C;  3J81 i;  3MEF A;  5IYB H;  4OWX B;  4YWM A;  3A0J A;  4BBS H;  1N8R C;  3CPW A;  5M5X H;  4LF5 Q;  2PMZ E;  2WB1 G;  4NPS A;  2UUC L;  2JEB I;  2EQS A;  4A4I A;  4JC0 A;  4A75 A;  2XTI A;  3HOY G;  1HZB A;  1VQH A;  1X65 A;  2JA8 G;  4OX9 Q;  4X62 Q;  2CCZ A;  4X66 L;  4RG1 A;  5HGQ A;  1HNX L;  1VQG A;  3M4Q A;  4A3M G;  4GNX A;  2GN5 A;  1IBM Q;  2JQO A;  4X64 L;  3G6E A;  1I94 Q;  2KHI A;  3TRE A;  3CCM A;  5LMU Q;  1Q82 C;  3HFZ B;  4OO1 I;  1E24 A;  1N9W A;  4DR1 Q;  2D62 A;  5AJ3 L;  5IE8 A;  4AIM A;  2JA7 H;  1YJW A;  2YYZ A;  1X55 A;  2JK8 A;  2YTY A;  5IP7 G;  3PO2 H;  1NY4 A;  1OXV A;  4ME3 A;  4X65 Q;  4DV4 L;  3I4M G;  3I56 A;  2C35 B;  2WAQ G;  3GTQ H;  3HOW H;  2IY5 B;  3CC7 A;  1Y1V H;  3KYH C;  4BY1 G;  1WOC A;  1A62 A;  1XNQ L;  4DKA C;  2ZJR A;  4IPH A;  1EWI A;  4P73 A;  1N36 Q;  1QZG A;  3PGZ A;  4A3L H;  1VQL A;  1K0R A;  1B70 B;  3CQZ H;  2ZTE A;  4IPD A;  1XPR A;  2ZJQ A;  2OCE A;  2ZM6 Q;  4OWT B;  5JJI A;  1QUQ A;  1SFO H;  1FJG L;  1OTC A;  4BA2 I;  1CKM A;  4A3K H;  1X3F A;  4JI4 Q;  3B6Y A;  4A3D H;  4A3G G;  3I7F A;  4DV5 Q;  4GLX A;  1QVG A;  3ICE A;  4BY7 G;  4PMW A;  3PIO A;  1WCM G;  4L5R C;  4QJF A;  2R7Z G;  4LW1 A;  4Y7N H;  1JJG A;  4LWC A;  4DR2 Q;  1T9H A;  2VY3 A;  3KOJ A;  3AQQ A;  1IBK L;  4HJ8 A;  2OWO A;  4FDB A;  5E7N A;  1XJV A;  1CKN B;  3T1Y L;  3MXN B;  4DV1 Q;  4DR3 Q;  1YIT A;  2PI2 E;  2CWA A;  1QZH A;  2RF4 A;  4JBM A;  1AE3 A;  1X6O A;  4PZ6 A;  2PQA A;  4RMF A;  4UP7 A;  3UDF A;  3FP9 A;  4R4T A;  2AKW B;  1AE2 A;  1VCI A;  2VW9 A;  4B3T L;  5GQO A;  1NMG A;  2N8N A;  1PH3 A;  3S15 H;  3ERS X;  3UE0 A;  3H3V H;  4P75 A;  1UE1 A;  3M3Y H;  1SR3 A;  4C3J H;  4LFB L;  4P71 A;  2IT1 A;  2UUC Q;  1IZ6 A;  3KDF A;  2NVQ H;  1XMO L;  2HT1 A;  3GTK H;  3HOV G;  2JA8 H;  4JBK A;  4BA1 I;  4GLV B;  1Q7Y C;  3PO3 G;  2KHJ A;  3I55 A;  4YHH Q;  4HJ7 A;  3GTM H;  4A3M H;  3PSI A;  3S1N H;  3RR5 A;  1HNX Q;  2R6G A;  1DGS A;  4HIK A;  1KIX A;  2HQL A;  4DR4 Q;  4X64 Q;  2Q2U A;  4GKJ L;  4KHZ A;  3RN2 A;  4JI8 Q;  1LTL A;  4TVA B;  4HJ5 A;  4A3E H;  1VQP A;  2UU9 L;  1E3P A;  3KJO A;  1EFW A;  5C4X G;  5M3M G;  5AJ3 Q;  1PH8 A;  2R7D A;  1I3Q H;  2YTV A;  5EAY A;  4A3I H;  3HKZ E;  4DR6 L;  1GVP A;  2K75 A;  3EBE A;  4KHP L;  1V1Q A;  1Y1W G;  1MJE A; 
#chains in the Genus database with same CATH topology
 2EE1 A;  2O5I C;  1JWU D;  1D8L A;  5CV6 A;  3D4D A;  1HPC A;  2E2J H;  1KAB A;  1K83 B;  1CSP A;  2IPK D;  1B8A A;  3A5U A;  3DEO A;  1XYI A;  2K52 A;  4LJZ C;  3TQY A;  3GTO H;  4GN4 B;  5EPJ A;  1J8I A;  1PVO A;  4A3G H;  1A0I A;  4NKL A;  2V4D A;  3I8Z A;  3S14 H;  1A8V A;  1LUZ A;  2DGY A;  2F52 A;  3FPU B;  2F0E A;  1IKL A;  2F1M A;  1CHP D;  4KI0 A;  1U4L A;  3T1Y Q;  1PTO B;  3CF5 A;  1KD1 C;  2E2H H;  4RGN A;  3BYT B;  3HOX H;  4IZ8 A;  2JA6 G;  4CBV A;  3I4M B;  3UI2 A;  1TWG B;  3PCO B;  2AHO B;  4KJN A;  5JAV A;  4IJH A;  4G7O C;  2A73 B;  4KHV A;  1VQO A;  1VQF A;  4DFA A;  3ERQ A;  1F9P A;  3EQL C;  2ENB A;  1JC7 A;  1AFP A;  2LMC B;  1L1O B;  2K1B A;  2IHE A;  1F2L A;  2MQH A;  2N3S A;  4JI6 L;  1I4Q A;  1KDB A;  1E2Z A;  4IPG A;  3V2T A;  4GKJ Q;  4B3S Q;  1U9R A;  3NQT A;  5M3M H;  3LWE A;  2KBN A;  5DM7 3;  5LMN W;  1EEF D;  2NZH A;  2K5Q A;  4DR6 Q;  1MBY A;  2VB3 X;  2UUA L;  2Q2T A;  1LLR D;  2EOT A;  3H3V I;  4CGY B;  4DK1 A;  3K0Y A;  3KF6 B;  4JI5 L;  5JEA H;  5IWA L;  3J7Z C;  5DAU A;  1XPO A;  1CUK A;  2JA5 G;  5IYC G;  2Q8T A;  2XRQ D;  4JI2 Q;  1NCV A;  2F0U A;  4UY8 C;  1CQV A;  3CCR A;  1IXR A;  3Q6S A;  2UUB Q;  3MVV A;  3HOV B;  2A8V A;  1TKW B;  3VYU A;  1HNZ Q;  1G6P A;  1KNE A;  2OQ0 A;  2Z4I A;  3TRZ A;  5IGC A;  1F77 A;  2ASB A;  5M5W B;  4DF7 A;  3NEN A;  2F0K A;  4QF4 A;  4DAP A;  1BVS A;  3ITP A;  5I4D A;  1BF4 A;  3PIP A;  4UPA A;  4R4I A;  2IHF A;  3E5S A;  1CZG A;  2E2I B;  3GV6 A;  3VR2 A;  2F3W A;  3I70 A;  1HA5 A;  4JI1 Q;  3CME A;  3S24 A;  1EU3 A;  3ND9 A;  3F2B A;  4RA8 A;  1R4Q B;  1VQ5 A;  3FKI B;  1X3E A;  2EJM A;  2L5T A;  1PRT D;  2EYF A;  1SE4 A;  4L63 B;  4K8J A;  2HCC A;  3DLL A;  1VQ9 A;  4FF1 A;  1H9S B;  2TMP A;  1BOS A;  1QWY A;  1WTQ A;  3KLS A;  4L5Q A;  5I9P A;  4QQB X;  4OIJ A;  1EY0 A;  2KUM A;  3AMU A;  4HAE A;  1D7Q A;  4IUR A;  3L0O A;  5JJL A;  3X3M A;  1E0B A;  4C3I H;  2NBF A;  1EIF A;  2EPB A;  2VS1 A;  3K0X A;  3FKI G;  4LFC Q;  3SK8 A;  1JOR A;  3CCS A;  2ES2 A;  2B2W A;  1ENA A;  5C5M A;  1E1O A;  2B8G A;  3S2D B;  2CVR A;  3I90 A;  1W6K A;  1HCZ A;  3WOF A;  3KFU A;  4YCV A;  3M7N A;  1I4G A;  2L12 A;  4GKK L;  2BE5 C;  2R7Z H;  1V1O A;  2RDF A;  1YHA A;  1YIJ A;  1AEX A;  2R92 B;  4JI0 Q;  2BH8 A;  4JBJ A;  1ASY A;  3SR1 A;  4OL7 A;  1WJJ A;  4DGZ A;  1X3Q A;  3BZC A;  4I7Z C;  2D5D A;  4BXX H;  2K5N A;  4DA2 A;  4DU9 A;  3Q0A A;  1S5B D;  2RA4 A;  2F0H A;  3NWT A;  1RIP A;  5IOC A;  4DV2 Q;  1LAB A;  1PYB A;  2NB0 A;  2A69 C;  1PA6 A;  2ZXP A;  2R92 G;  1HRJ A;  2UXB Q;  5EJW A;  1R9T B;  1N34 Q;  1KDC A;  2A6H D;  4C3J G;  1PH5 A;  2NVX H;  3K6O A;  2NVT H;  1BCP C;  3OIP A;  4DNT B;  4YHH L;  2QA4 A;  3HGB A;  1Y1W H;  1GO3 E;  1UE7 A;  2H4O A;  2I0Q A;  1HNW L;  2F0J A;  4XTC S;  3DWP A;  4IO9 A;  4ME5 A;  3F2C A;  2KCM A;  5FJ8 H;  4BBR H;  2A69 D;  2Q8R E;  5L37 A;  2F0M A;  5E4W C;  2KEC A;  2HUG A;  1CHQ D;  2BH2 A;  1IBL Q;  1VQA A;  1GHK A;  1K8O A;  2MNA A;  3CD6 A;  3K5M A;  3HRZ C;  2MO1 A;  4I65 A;  1Y8O B;  2G5D A;  2Q8I B;  3CC2 A;  1QVC A;  3MWY W;  3S2H B;  2SDF A;  2IX1 A;  4CKC A;  4YWK A;  4A3L H;  1O7Z A;  2SNM A;  4YWL A;  1PZI D;  1SN8 A;  4BBS B;  1RKN A;  1Q3L A;  4XDX A;  4IOC A;  4X6A H;  2NN6 I;  4PV1 C;  1NJI C;  1S4Z A;  1HUN A;  3VA5 A;  4L5S A;  3W3A A;  2ZTC A;  1B9M A;  4IN3 A;  1NR4 A;  2DJG C;  1II3 A;  2BCO A;  3CCQ A;  1B4O A;  4ZQ3 A;  2CW0 C;  3AFQ A;  2JEA I;  5C3W A;  5G3L D;  5IGE A;  1GUG A;  3IFD A;  4LF5 L;  1L1O C;  3FRP B;  1YJN A;  3STB C;  5GAH C;  4ZUI A;  5ELO A;  5C4H A;  2AWO A;  3NQI A;  2Y0S E;  1PTO D;  5I9O A;  1Y1V B;  2ATW A;  4G4K A;  1CTM A;  1UE6 A;  5LMN Q;  2F0L A;  2VZA A;  1H9M A;  2PZW A;  1YNN C;  1PH4 A;  1K3B C;  4KY6 A;  4JBW A;  3CQZ B;  2I46 A;  1SFO B;  5J3B A;  2CW0 D;  2UXC Q;  1YI2 A;  5KYL A;  1JMC A;  1K73 C;  4A3D B;  5FK9 C;  4DR5 Q;  2DN8 A;  1D1I A;  4O1N A;  1WVL A;  1GJX A;  5FLM H;  1Y1V G;  4Y7N B;  2JJQ A;  3J81 j;  3P1H A;  5CBA E;  2X69 A;  3G71 A;  2OTL A;  1B7Y B;  2EYH A;  4PMC A;  3PMF A;  2VQF L;  4DV0 L;  2E2D C;  2F0T A;  1JOQ A;  1KRS A;  2MJ8 A;  3D3R A;  4ZRZ A;  4IFD I;  1Y14 B;  5C0X I;  4JI4 L;  2FXQ A;  1XNR Q;  1OXT A;  1KLU D;  3HKZ G;  4A3D G;  1SJE D;  4DV5 L;  3S1Q H;  1Z47 A;  3S16 H;  3E0E A;  1EIH A;  1I6V C;  2IX0 A;  4DR2 L;  2JA8 B;  1V1P A;  1X9N A;  1RDP D;  2E8G A;  4P72 A;  4DR3 L;  4ABN A;  2YU9 H;  2XRS D;  3C3L A;  4A3C H;  1O7L A;  3S1N B;  1ESF A;  1K8G A;  4QL5 A;  1EEI D;  1C0A A;  3KLW A;  5KNC A;  2CWP A;  4FO2 A;  3MEF A;  5IYB H;  4OWX B;  5EQ0 A;  1I3Q B;  1N8R C;  4A3I B;  1LTA D;  3TN2 A;  2PMZ E;  2JEB I;  4A4I A;  4P2C B;  1DD2 A;  1ENC A;  1LAC A;  1VQH A;  2JA8 G;  2F0F A;  4RG1 A;  5HGQ A;  3NTK A;  3H6M A;  1HNX L;  1B50 A;  4GNX A;  2GN5 A;  1JE4 A;  2IW3 A;  4CKB A;  1I6H B;  1PYW D;  1I94 Q;  3A7L A;  3CCM A;  3HFZ B;  4OO1 I;  3TZU A;  4DR1 Q;  1RD9 D;  2DNE A;  2JN4 A;  5AJ3 L;  1SSO A;  3OWE B;  2J0T D;  1YJW A;  4EVO A;  1X55 A;  2JK8 A;  2YTY A;  3K59 A;  4DV4 L;  1STN A;  2IY5 B;  1TS3 A;  3D4W A;  2AQ3 B;  1PFN A;  4CDD C;  2ZJR A;  3CRL C;  1QZG A;  2QF7 A;  5JJI A;  1DOL A;  2FJ2 A;  3RD4 A;  1CKM A;  4CDC C;  3TP7 A;  3I7F A;  4RCN A;  4GLX A;  4U68 A;  1QB5 D;  3FVQ A;  1QVG A;  4BY7 G;  4QJF A;  3S1R B;  1JJG A;  1BUV T;  4PMB A;  4CJ1 B;  2PYK A;  4K5V A;  1ET9 A;  4G57 A;  1BR9 A;  3ONA B;  2PI2 E;  1TWC B;  1QZH A;  4EQO A;  5EGT A;  5CC4 A;  2PQA A;  3SEB A;  4R4T A;  1QCB D;  4B3T L;  4C3H B;  1NMG A;  2N8N A;  1H9R A;  2A5H A;  4ULL A;  1SND A;  3ERS X;  1UE1 A;  4XYQ A;  1CA6 A;  1I4H A;  2UUC Q;  4DAY A;  2NVQ H;  2HT1 A;  2RKS A;  3I4N B;  3CRK C;  3NP8 A;  1A6X A;  1Q7Y C;  2F0I A;  3PO3 G;  1L0Y B;  3I55 A;  2EDG A;  3RR5 A;  5DM6 3;  2R6G A;  1DGS A;  1KIX A;  3Q24 A;  3P20 A;  1Y8P B;  4JI8 Q;  5C4X G;  1SNM A;  1PH8 A;  1D1K A;  2YTV A;  2LY7 A;  2K7V A;  5BN4 A;  4KHP L;  1MJE A;  1SYC A;  3CXC A;  4TQU S;  4BY1 H;  1I5F A;  1AH9 A;  5FO9 B;  5D65 A;  1SYG A;  2M00 A;  4JOI A;  5COY A;  2CFM A;  1EZ8 A;  2KJX A;  4A3F H;  1WTH A;  4BWG B;  1STG A;  2B2V A;  4JYA Q;  1FYC A;  2AQ2 B;  4EGV A;  5J39 A;  3OTO L;  2B2T C;  3HOY B;  3Q23 A;  2K33 A;  2N49 A;  1HH2 P;  3A8J E;  5J22 A;  1Y69 U;  2VUM G;  4K0K L;  5M5Y B;  4QIW B;  1PLF A;  1I4R A;  3FHW A;  2D0O A;  1EY6 A;  2F0D A;  1IBK Q;  4FVM A;  3HOU G;  2HIV A;  1J5E L;  2XWJ B;  1JJ2 A;  3NSW A;  1YNJ D;  3OOC A;  2JE6 I;  1XTC D;  3PF5 A;  2L1B A;  4S3S A;  1E22 A;  1XX8 A;  5C4J H;  3TS0 A;  3ULL A;  3K7A H;  4JG2 A;  2WAQ E;  1G2T A;  4NB3 A;  2NVY H;  2D9U A;  5CV8 A;  3MXN A;  4GOP C;  4GZY C;  2QEJ C;  1P8L A;  2ZJP A;  1X3G A;  5M3F B;  1WD1 A;  2Q2I A;  1KAA A;  4IFD J;  1LTT D;  5C0X J;  2CQA A;  2NN6 G;  2UU9 Q;  5EPK A;  2Z6K C;  1HR0 Q;  1AZP A;  4AH6 A;  4MZ9 A;  1SRU A;  4DUY L;  3D31 A;  2B2Y A;  2RSO A;  1A63 A;  1VS0 A;  2E5L Q;  3U4V A;  4ID6 A;  3JAM i;  4MTN A;  1EQT A;  3U50 C;  2B2U A;  2Q2H A;  2I07 B;  5M3F G;  1TR5 A;  3I4O A;  1MHW C;  2K4K A;  4F7X A;  1GUO A;  3VA7 A;  5EKL A;  3M85 A;  4A3J H;  3K8A A;  1A3V A;  1S3O A;  4OGQ C;  1B3Q A;  1MJC A;  4U67 3;  3K5L A;  4OWW B;  2B63 H;  1EUJ A;  3J7A V;  3J80 c;  4POF A;  1SYE A;  1HTL D;  4NMZ A;  1K28 A;  4NXN L;  1N33 L;  1ZXT A;  1F9R A;  3DM3 A;  3N52 A;  3NBH A;  4A3B B;  1K83 H;  1XMQ L;  3CW2 C;  2P5Z X;  2ZT9 C;  4GLA C;  3DWA A;  2K32 A;  4DR7 L;  4IUT A;  3FMC A;  4H02 A;  3BVZ A;  3JAM E;  1UE5 A;  5IIF A;  5LL6 X;  3J81 c;  5JPN C;  3TME A;  1YBY A;  1GKH A;  5FLX E;  3GTP B;  2MP1 A;  1A2U A;  3QOL A;  4IUV A;  1U0L A;  4A3B G;  1X32 A;  2NYZ D;  1PTO H;  2Z0S A;  4IFD G;  2WII B;  4JI6 Q;  5C0X G;  1FVI A;  2QIL A;  2RVL A;  4HIO A;  1IBM L;  3I4M H;  4LUV A;  1TWG H;  4K14 A;  4AYB G;  1GHJ A;  2ALY B;  1P16 A;  4HCE A;  4EQN A;  1BCP F;  2QCP X;  5D14 A;  1QUQ B;  2UUA Q;  4DPG A;  4X65 L;  4K5X A;  1XXG A;  2JA6 B;  4JI5 Q;  5IWA Q;  5IYC H;  3HOW G;  1FJG Q;  1JWS D;  1K3R A;  3MZ5 A;  1WFQ A;  5I6Y A;  3WOE A;  1NR2 A;  1IW7 C;  1RL2 A;  1E2W A;  5ELC A;  4LNQ A;  1Q90 A;  2UXD L;  3NEL A;  2HHH L;  5GAG C;  2LSS A;  1LTG D;  3E9H A;  1FR3 A;  3QR8 A;  3TBI B;  2K5V A;  3VYS A;  4G7H C;  1WTV A;  1WD0 A;  4OO1 G;  2B3G A;  1HZA A;  1EQR A;  5KIX A;  4HJA A;  5G3L F;  4H7B A;  1DJR D;  4DNI A;  2F3V A;  2K5W A;  3BYY B;  3MTS A;  2QKI C;  1JWM D;  2AWN A;  3M4O B;  4LMQ D;  2CH4 W;  4IJL A;  4QUF A;  1PH2 A;  4KK7 A;  3HOV H;  1RHP A;  1IW7 D;  1K8M A;  1U4M A;  2KHS A;  3A54 A;  5M5W H;  3SVM A;  1U4R A;  3AFP A;  2JA5 B;  4HJ9 A;  1CI3 M;  1UEA B;  3A7A B;  3S1M B;  4IUN A;  1PMR A;  2XGT A;  3SK6 A;  4CDE C;  2B63 B;  3HKS A;  3E3X A;  3D6C A;  3GTJ B;  2E2I H;  4A3E G;  3W1B A;  1YZ6 A;  1XTD A;  2EZV A;  3SGI A;  1V1P B;  3DHQ A;  1D2B A;  1A3U A;  2B29 A;  3FKI H;  5T1G A;  4C2M B;  4DK3 C;  3J7A F;  1M90 C;  4HSV A;  4R4Q A;  1BDO A;  5JOB A;  1AN8 A;  1VQ8 A;  5HUR A;  3BDO A;  3HG9 A;  5JEA J;  4J6H A;  1WI5 A;  3OYY A;  2R7F A;  4EX5 A;  3ULP A;  4GKK Q;  5IY0 A;  1S40 A;  1OO9 B;  1VQB A;  4H44 C;  1OXS C;  1A3T A;  1PRT C;  2OEO A;  1Z7T A;  4X3U A;  4PQX A;  3TDQ A;  2QW7 A;  1DXM A;  1O7I A;  3M4P A;  1W6J A;  4IAL A;  4LF6 L;  4Q5V A;  4GNX B;  1N32 L;  4QMG A;  3RUZ A;  3S2D H;  1F2Y A;  4LF7 L;  2PW7 A;  4LF9 Q;  1MKH A;  3L3O C;  3T4A C;  5IT9 c;  1F2Z A;  3CU7 A;  1BKB A;  1JJC B;  3PO2 B;  1GOZ A;  3HOX G;  1GD7 A;  2R92 H;  4EQP A;  1C9O A;  3GTQ B;  2K5H A;  4JI3 Q;  4POG A;  3L2P A;  5CV5 A;  1PFM A;  4RAU C;  1VQJ A;  5LMU L;  2QDL A;  1NAP A;  1Q1B A;  3PUW A;  5ELF A;  2L0C A;  4KLK A;  1HNW Q;  4GN5 A;  4R4O A;  2RDG A;  4JI7 Q;  1QE6 A;  3GDE A;  3JAM L;  4B3S L;  3PO2 G;  4A3K B;  1BQQ T;  4R4C A;  2FMC A;  2H5X A;  1R9T H;  3NTI A;  1G6Z A;  1V9P A;  5FLX L;  1IKM A;  2N78 A;  1LT6 D;  4PNY A;  5COR A;  3IFT A;  2R61 A;  2ICI A;  3C1E A;  5JEA G;  1PHJ A;  4QGU A;  2PQA B;  3J80 i;  2A6H C;  1IL8 A;  1ZYR C;  4A3K G;  1FNV A;  3VR4 A;  2UUB L;  4WJ3 M;  2CQO A;  4C3J B;  2WB1 B;  3HZX A;  3QG1 A;  3FPP A;  3T1H Q;  5D3I B;  4DAY B;  4GN3 B;  1K0S A;  4KKS A;  3GTM B;  4A3M B;  4A76 A;  3QO2 A;  2L11 A;  2E75 C;  4MNO A;  5KYI A;  3S2H H;  1SMX A;  3L7Z C;  3J81 i;  2MHV A;  4YWM A;  4BBS H;  4LF5 Q;  2WB1 G;  1ZYR D;  3E6Z X;  4A75 A;  4HMI A;  3S17 B;  2EYJ A;  4O42 A;  1ICW A;  1BXT A;  3M4Q A;  4A3M G;  3G6E A;  1QG7 A;  2KHI A;  4RKL A;  1LTS D;  2D2C C;  2KEE A;  2Z9H A;  4AIM A;  5FOB B;  4R9W A;  2FMM A;  5C6A A;  2C35 B;  2JP1 A;  3HS0 C;  1WCM B;  3OPO A;  1Y1V H;  1EYC A;  3G6J B;  1A62 A;  3GQB A;  4WRD A;  2FFK B;  1XNQ L;  1ONL A;  4P73 A;  3PGZ A;  4DK0 A;  1Z6H A;  4LK1 C;  1F9S A;  3CQZ H;  2OCE A;  2ZM6 Q;  4OWT B;  1QUQ A;  1SFO H;  1JCK B;  1PTO C;  3MXG A;  3TP8 A;  2EY1 A;  4JI4 Q;  2EXZ A;  2KCC A;  4A3D H;  1QIL A;  4DV5 Q;  2JYO A;  4ZKC B;  3DXJ C;  4PMW A;  1WCM G;  3PIO A;  4L5R C;  2R7Z G;  4Y7N H;  4DR2 Q;  1T9H A;  3AQQ A;  4MN3 A;  3MXN B;  4DR3 Q;  3FDT A;  4ZAI A;  3DM1 A;  5KRU A;  4IQZ A;  3R93 A;  2HD3 A;  2OT2 A;  3A56 A;  1CK1 A;  4FYD A;  1PH3 A;  1HQM C;  5DNF A;  3H3V H;  4LFB L;  4CHT B;  3T51 B;  4P71 A;  2BDO A;  3KDF A;  2JA8 H;  4BA1 I;  4KN7 C;  3S1N H;  1HNX Q;  1STY A;  1UNS A;  4DR4 Q;  4B9W A;  3RN2 A;  3HKZ B;  2A68 C;  4MHE A;  4TVA B;  2G9D A;  1DM0 B;  3ZYY X;  3Q22 A;  3W2D A;  5AJ3 Q;  2R7D A;  1I3Q H;  5EAY A;  4A3I H;  4KD4 A;  1GVP A;  2K75 A;  1V1Q A;  1Y1W G;  3CCE A;  3BU2 A;  5GAE C;  2B39 A;  1SYF A;  3A8I E;  2RQX A;  4NDX A;  4FP5 D;  1W3S A;  1G91 A;  3IAY A;  3MXP A;  1I6H H;  3BG3 A;  3NBH B;  4N9T A;  1O7Y A;  2K01 A;  1NNX A;  4FF3 A;  2E74 C;  5E1F A;  2F4V L;  2A68 D;  1C8C A;  2IJ0 A;  3I73 A;  4B3M L;  3UE1 A;  4RCO A;  3I3C A;  2Z4H A;  1IYJ B;  3K80 C;  4HID A;  3Q8D A;  4A93 B;  5IGF A;  1QNK A;  5J1Z A;  3TZD A;  4C1N K;  5BN5 A;  1T5E A;  4UHV A;  4AQY Q;  2E76 C;  1PV4 A;  5FKA C;  5IYD G;  3A5Z B;  1WTP A;  4X3K A;  3UDX A;  1PXU A;  4QIW E;  5C44 B;  1EZ6 A;  2G9H D;  2K04 A;  1D6E C;  4OHJ A;  3JC6 6;  1SBB B;  4B3T Q;  4RWS C;  3K81 C;  4NXM Q;  1QOH A;  2VNU D;  2JXM B;  4A93 G;  5AFW A;  4N8F A;  5JJK A;  3S1R H;  5JVG 3;  2F3I A;  1CKN A;  2F0Q A;  3KLR A;  3J7Y W;  2NZO A;  1B1Z A;  1TWC H;  2CKZ B;  2L9H A;  5C44 G;  5ELD A;  3KJP A;  5TSS A;  5DEH A;  3R3O A;  1LV9 A;  2DNC A;  3NK9 A;  4H13 C;  2QGQ A;  4BY7 B;  4KV6 A;  4C3H H;  3T56 B;  2IL8 A;  1JR0 D;  3D8G A;  1Q86 C;  1XPU A;  3HOZ B;  4O0A A;  5GRO A;  4KTA A;  4LUO A;  4CJ2 C;  4KHP Q;  1VQD A;  3I4N H;  1EYG A;  1EQQ A;  4RFB A;  4UAI A;  3RZO B;  4LF4 Q;  4DV3 Q;  1YJ9 A;  1GUN A;  3EVQ A;  2EJG C;  4QY7 A;  5BN3 A;  2VQE L;  1TWF B;  3OTO Q;  4B3R Q;  1ML0 D;  4F88 A;  3HOZ G;  4KN4 C;  4IPC A;  2CHB D;  3PO3 B;  3NE5 B;  1JT8 A;  1PFB A;  5EBD A;  4XT3 B;  1J6Q A;  1LM0 A;  4HED A;  1NBW A;  3ER0 A;  3RZD B;  2RCN A;  1YVC A;  4K2L A;  3K5N A;  3KF8 A;  2K05 A;  1TQO A;  4FF4 A;  2J4X A;  5C4X B;  3D6W A;  1B9N A;  2I5H A;  5IP9 G;  4ZUJ A;  4J1M A;  3BDC A;  3QJY A;  1KRT A;  4CDF C;  2L4N A;  1VQM A;  4APV A;  3HOY H;  3MFY A;  1Q8I A;  1TII D;  4X66 Q;  1EFI D;  5M5Y H;  1V8Q A;  1L0W A;  5IYB G;  5K36 G;  2O2L D;  3DMU A;  5I6W A;  3W1G A;  1S72 A;  4YY3 L;  1FL0 A;  5CGK A;  1M1K C;  1UAP A;  1YHB A;  3CP0 A;  3N6R A;  5A2Q E;  3SXH A;  2X6G A;  3FEW X;  1T5X D;  2KCT A;  5IP7 H;  3GTG B;  2DY8 A;  1DON A;  2NN6 H;  2R93 B;  2D0P A;  2WFW A;  2EY6 A;  3J7A 5;  2WAC A;  2VUM B;  4DR1 L;  4OIK A;  3TSS A;  4M8A A;  4DUY Q;  3W5O A;  1VQ6 A;  1CKO A;  1ZKO A;  2K5D A;  3HOU B;  3PIP 3;  2KVM A;  4KJO A;  1YNJ C;  4DV7 L;  1LTB D;  4LF8 L;  1NSN S;  5EPL A;  2C5C A;  5M3F H;  3OMC A;  5H1S E;  5NUC A;  2BOS A;  2F03 A;  1SMY D;  5GAD C;  2R93 G;  1EYA A;  2J7Z A;  1TWH B;  3QB3 A;  3KBX A;  3OSO A;  4K6D A;  2EVB A;  1MGS A;  3BVM A;  4HCS A;  1TY0 A;  3PUZ A;  1K9M C;  1TWA B;  4EQ5 A;  1HHV A;  5BR8 L;  4NXN Q;  1N33 Q;  1B2T A;  2GA4 B;  1XMQ Q;  3GTL B;  1VQN A;  2L15 A;  2F0N A;  4Q0F A;  2SNS A;  3EIV A;  3BS1 A;  2XN9 C;  1KLG D;  1TU2 B;  4DR7 Q;  3NPP A;  2PQE A;  2B2Y C;  5CV7 A;  1FNW A;  1XMO Q;  1PRT F;  2RCF A;  1I50 B;  3SE0 A;  4DV6 L;  4XIG S;  5C3E B;  3PV0 A;  1ICF B;  5T1I A;  1QVF A;  1UEB A;  2SEB D;  4A3B H;  1VDZ A;  1YHQ A;  2F0P A;  3VYT A;  3U9S A;  3CCU A;  1CFM A;  1W2B A;  4IFD H;  3CCJ A;  5HY6 A;  4B9X A;  3PQI A;  1MI2 A;  1S5D D;  1KXL A;  2YV5 A;  1DZ1 A;  4WJW A;  4DUZ L;  4JI8 L;  5IGG A;  3SHL A;  2K03 A;  1KTK A;  4JV5 L;  5FO8 B;  3GTP H;  4LFA L;  5C3E G;  1HQR D;  4ZKB B;  3CHB D;  3H15 A;  4HN7 A;  5E4X A;  3SDZ A;  3H0G B;  3H3V C;  4PZ8 A;  1SJH D;  1L0X B;  4HTH A;  1KC8 C;  3RN5 A;  2A6E C;  2CH4 A;  2L55 A;  3R8B A;  3I91 A;  4DNR B;  3URY A;  1LTI D;  4F8M A;  5C3X A;  4OXP A;  4A3F G;  2EIF A;  4JYA L;  4GOP A;  1AP0 A;  2HCI A;  2UXD Q;  1NTG A;  1SNO A;  5M5X B;  2HHH Q;  2AUJ D;  1VQI A;  4ZK9 B;  4RHS A;  5LHY 1;  3KUP A;  4J8Q A;  1S5F D;  3H0G G;  4OO1 H;  1M4V A;  2JA6 H;  3ND8 A;  2Z6K A;  1G51 A;  1Q46 A;  2A19 A;  3UDI A;  2ZXO A;  5ELB A;  3NBI A;  2A6E D;  4AYB B;  1U5K A;  4TSS A;  2PZU A;  3BZK A;  1YEZ A;  2JA7 B;  4JW0 A;  2DUD A;  1VQC A;  3EN2 A;  4MIU A;  4OX9 L;  3HOW B;  4X62 L;  1KAW A;  1UUP A;  2KQ3 A;  5DLQ E;  3UDG A;  3EJI A;  4R1J A;  1Q8K A;  3KLS X;  1K8A C;  3TP5 A;  5D3D A;  1H95 A;  3K58 A;  4RHR A;  5KND A;  4DK6 C;  3LWU A;  4TRD A;  3M4O H;  2PZT A;  1JQY D;  2JA7 G;  3WWV A;  4XQQ A;  4DXF A;  4HIM A;  4GS3 A;  4PG3 A;  4LAA A;  1SEB D;  5IGB A;  1HR0 L;  2JA5 H;  1BCP B;  4RGO S;  3VR3 A;  3S1M H;  3PUY A;  1N36 L;  2E5L L;  3NWS A;  5CBE E;  1OXX K;  5E3F A;  1EL0 A;  3OMG A;  1NMF A;  3CKI B;  1EIG A;  2OF1 A;  5A2Q L;  4PZ7 A;  3GTJ H;  1Z9F A;  3S15 B;  4FXK C;  3MXU A;  3M3Y B;  4A3J G;  2XVS A;  3BJU A;  1U4P A;  2Z1C A;  4KY7 A;  1TS5 A;  3QIA A;  4UP9 A;  3GTK B;  4XYO A;  4E6I A;  1RTN A;  3KDF B;  5CMD A;  4FNF A;  1VQE A;  3A74 A;  2WB1 E;  2EYL A;  1B44 D;  3D4R A;  4DV1 L;  2B63 G;  2KA7 A;  1DOM A;  4YCW A;  1JE5 A;  1SNP A;  2MPM A;  3U9O A;  1PTO F;  4QB4 A;  4C2M H;  3NXW A;  2HIX A;  4LF6 Q;  1D5Z C;  2JA9 A;  1CZW A;  3AEV A;  2NTS A;  1N32 Q;  2EXD A;  4A3E B;  5CYU A;  4LF7 Q;  4IUQ A;  1LTR D;  1TT2 A;  2FHT A;  5M9O A;  4NPS A;  4JC0 A;  2WAQ B;  1QJO A;  1X65 A;  4C1N I;  4I7A A;  2E2J B;  1VQG A;  3M7G A;  2JQO A;  4X64 L;  3EA6 A;  5LMU Q;  2O4X A;  1E24 A;  1N9W A;  1EWH A;  2D62 A;  5IE8 A;  3GTO B;  3PO2 H;  1NY4 A;  1OXV A;  3IL8 A;  4ME3 A;  4A3G B;  3I4M G;  1TVX A;  3I56 A;  3GTQ H;  2WAQ G;  2PCF B;  1ESR A;  1MD2 D;  1FD7 D;  3S14 B;  1WOC A;  1WTX A;  2HDM A;  4WOR A;  4IPH A;  1SYB A;  1EY9 A;  1B70 B;  4KY5 A;  2E2H B;  4IPD A;  2PNR C;  5EKI A;  3HOX B;  1FJG L;  5KNB A;  4BA2 I;  4KKT A;  3I4L A;  2WV6 D;  1I4X A;  4ZCK A;  1X3F A;  4A3K H;  3IKJ A;  1D5X C;  4Z9C B;  4A3G G;  4HR7 B;  1GUW A;  1RCV D;  1PDQ A;  2NWG A;  4LW1 A;  1VF7 A;  2WKD A;  3G7L A;  3KOJ A;  4FDB A;  1CKN B;  3T1Y L;  2NZ1 D;  5JJZ A;  3NHH A;  1AE3 A;  1X6O A;  3DEP A;  4K2K A;  4PZ6 A;  4DAV A;  3FP9 A;  1CM9 A;  2AKW B;  1AE2 A;  1VCI A;  5M3M B;  2EY2 A;  5GQO A;  2K28 A;  1A2T A;  3UE0 A;  4C3J H;  2B2W C;  4K8I A;  1IZ6 A;  3HOV G;  3NTH A;  4G7Z C;  4HMJ A;  2KHJ A;  3R2I A;  4YHH Q;  3GTM H;  2DJF C;  4RH6 A;  4A3M H;  1STE A;  4HIK A;  3NUC A;  1VF5 C;  4N9P A;  4GKJ L;  4KHZ A;  4HJ5 A;  1LTL A;  3O13 A;  1E3P A;  1EFW A;  5M3M G;  1J9O A;  3T53 B;  3HKZ E;  1HUM A;  2HDL A;  4DR6 L;  3EBE A;  3AB9 A;  1GUS A;  3R2T A;  3OW2 A;  1IHZ A;  1R4P B;  5K5P A;  2A1A A;  1VQ4 A;  5IOD A;  1A15 A;  3S17 H;  3RLN A;  3V96 A;  1PYS B;  5ELE A;  3RMH A;  5KGU A;  1XNQ Q;  4IOA A;  3LX0 A;  4JI2 L;  2MFI A;  3MAQ A;  3KF8 B;  3BVG A;  1PFS A;  1GXD C;  1PH7 A;  3AYH B;  1CT1 D;  2KEN A;  4YCU A;  3IRB A;  1DCZ A;  1HZ9 A;  4RGM A;  1HNZ L;  2RBM A;  3A55 A;  2MUY A;  1SRO A;  3S9W A;  3KBG A;  2LFN A;  1WCM H;  2ZTD A;  1TS2 A;  2I5L X;  4V19 0;  5C4Z A;  2AMC B;  3G48 A;  3KK7 A;  2AUK A;  4H0L C;  4QUC A;  2BA0 A;  2ZXR A;  4MTK A;  5C5L A;  1JB7 A;  1NE3 A;  1F2M A;  2I5M X;  4LF9 L;  2SOB A;  3E0J A;  4L6T B;  4X3S A;  4JI1 L;  2LXK A;  3NEM A;  3J80 E;  4LFB Q;  3CMA A;  2PI2 A;  3RLF A;  1ILP A;  2BE5 D;  3M9B A;  4XQJ A;  3T13 A;  2F0W A;  1STA A;  4JI3 L;  4C3I B;  4TKO B;  1M8A A;  3X3N A;  4FXG C;  1SE2 A;  1TS4 A;  1EU4 A;  1ILQ A;  4FF2 A;  2PO4 A;  1BBU A;  1D5M C;  2XSC A;  2GVA A;  4UP8 A;  2HQE A;  2VL6 A;  1Q12 A;  2R7Z B;  3T16 A;  2LKV A;  3GV3 A;  3J81 E;  4HSP A;  1SAP A;  4JI7 L;  3I72 A;  3CAM A;  1EY5 A;  3TP6 A;  3TS2 A;  1KQS A;  2VQF Q;  4LFC L;  1C7Y A;  4C3I G;  4DV0 Q;  1F9Q A;  1KDA A;  4XQN A;  1CSQ A;  1RF2 D;  3QOJ A;  1FGU A;  2F4V Q;  1BCP D;  4B3M Q;  1VQK A;  1VQ7 A;  4JI0 L;  1S5E D;  2QDB A;  2LS0 1;  2O5J C;  1EWC A;  2LXJ A;  3U4Z A;  3CCV A;  3H94 A;  2EYO A;  5IYD H;  1X54 A;  4WFN 3;  2OQK A;  3T1H L;  2NVX B;  2NVT B;  2OXP A;  1JB3 A;  2K50 A;  1HZC A;  3F2U A;  4JPB W;  1O78 A;  4BXX G;  1IYV A;  1ET6 A;  1X56 A;  1Y1W B;  4DV2 L;  4QCL A;  3CPF A;  3K5O A;  5A35 A;  1BBX C;  1VMP A;  4KKU A;  1ASZ A;  4A93 H;  1H9K A;  4BBR B;  2UXB L;  5ELN A;  1N34 L;  5I2X A;  1E2V A;  4BBS G;  1DOK A;  2ICE C;  4F87 A;  2F0G A;  5C44 H;  1RTO A;  1JIC A;  3C2P A;  3E9I A;  1C4Q A;  4C56 C;  2C9O A;  3GO5 A;  3U58 A;  2NTT A;  4DV4 Q;  2RHS B;  1YNX A;  4R8I A;  4Y52 H;  1PH1 A;  1KNA A;  5FJ8 G;  2JSO A;  4GOP B;  2XIW A;  4OON A;  4BBR G;  1HXY D;  1L1O A;  1IBL L;  1OXU A;  3STB D;  4FXD A;  4JVZ A;  4DXG A;  1BBW A;  3RLO A;  1EOT A;  3F1Z A;  1Q1E A;  2Z6B A;  1HR0 W;  3MA2 B;  4BY7 H;  3JAM c;  3EFX D;  4LUZ A;  1RJT A;  5JPM C;  4A3L G;  2VQE Q;  4L8J A;  4GNX C;  2ZM6 L;  1WTW A;  3HOZ H;  1YNN D;  1I4P A;  3MEH A;  3D0F A;  5FLX c;  1EY8 A;  3OHX C;  3P7J A;  4YIJ A;  1G29 1;  1MSH A;  1SYD A;  3KF6 A;  4M1U B;  2F0O A;  4NP5 A;  4ODG A;  2IWH A;  3RZO H;  1EIY B;  3DUZ A;  4XXE A;  3V05 A;  4ILW A;  3VYR A;  2KCN A;  1STB A;  3VR6 A;  5IP9 H;  4DAM A;  1Y8N B;  3DWQ A;  2PW5 A;  1WTO A;  3RNU A;  1TWF H;  4P74 A;  2KED A;  4XT1 B;  3PO3 H;  1EY4 A;  2GVB A;  2R3Z A;  1TXY A;  2NUC A;  5K36 H;  3RZD H;  1AZQ A;  4L5T A;  2WIN B;  3H91 A;  1DYQ A;  5LMN L;  2EYP A;  3SK4 A;  5C4X H;  1PZJ D;  5ISR A;  1IYU A;  1KHI A;  4YY3 Q;  4OEL B;  5CV4 A;  1V43 A;  3I2Z A;  2EYM A;  1IL2 A;  5KEE A;  3AU7 A;  4RKB A;  2H1E A;  2N88 A;  1SLJ A;  2UXC L;  2F4I A;  5IT9 E;  3G4S A;  4DR4 L;  1EYD A;  3LNN A;  4DR5 L;  3PUX A;  3S1Q B;  2VXW A;  2QEX A;  1FNU A;  3ZJY C;  3S16 B;  3J80 L;  4A3I G;  3CC4 A;  5FLM G;  2MO0 A;  2ID0 A;  2EJF C;  4DV7 Q;  1EOV A;  1B3A A;  1MSG A;  2X6L A;  2YU9 B;  4LF8 Q;  4J15 A;  4OEM B;  4X3T A;  3GTG H;  1H9S A;  2R93 H;  4CJ0 B;  2VUM H;  1MIU A;  2N55 A;  1XNR L;  4KMU C;  4K0K Q;  3L9A X;  4NW2 A;  1HTP A;  5FO7 B;  2M2L A;  1CQF A;  3MC0 B;  4UDU C;  1LYL A;  3J81 L;  3HOU H;  3VDY A;  1E7Z A;  3LGJ A;  1J5E Q;  5BR8 Q;  2MGS A;  1LT3 D;  4AQY L;  4A3C G;  1EY7 A;  1G8Z D;  1TWH H;  4JOI C;  3ULJ A;  1ZEQ X;  5F2D A;  2YTX A;  4AYB E;  2Y0S B;  2Z8L A;  1CA5 A;  3K7U C;  4O2D A;  1SE3 A;  2B2V C;  4DV6 Q;  1E1T A;  2K14 A;  3GP7 A;  3OIQ A;  1TWA H;  1SMY C;  4IUP A;  4NXM L;  1SXT A;  1TY2 A;  1Q81 C;  2WP8 J;  1UWV A;  1HA6 A;  3P75 A;  1I94 L;  3GTL H;  1WYD A;  3F2D A;  2PPB C;  4BS9 A;  5I2Y A;  1PZK D;  5JVH 3;  1HJP A;  4KD3 A;  1PH6 A;  2Y0S G;  2V1C C;  4DUZ Q;  4IUU A;  1I50 H;  1STH A;  2EY5 A;  3WDN A;  2PNH A;  2RDH A;  1PH9 A;  5C3E H;  1GM5 A;  3F8T A;  4JV5 Q;  4C3H G;  5CV9 A;  4LFA Q;  4JCV E;  1QNU A;  1VMC A;  1LO5 D;  1SDF A;  3OWF A;  4ZYS A;  1AW7 A;  3PF4 A;  3CCL A;  5CR3 A;  3I4N G;  1C48 A;  4B08 A;  4LF4 L;  4DV3 L;  4DN4 M;  2BA1 A;  2XNA C;  3TEH B;  4WJ4 A;  1L2F A;  1SE8 A;  1EQV A;  5HGT A;  3OW7 A;  4B3R L;  2NVQ B;  1HFN A;  1LT4 D;  4RGT A;  2F0S A;  3H0G H;  1NUC A;  3MHB A;  3HP3 A;  1KL9 A;  1JOK A;  1JOO A;  2TSS A;  3GD7 A;  4K5W A;  1H9J A;  2A74 C;  1X3P A;  2RHQ B;  3VR5 A;  4ALP A;  2OTJ A;  2PMZ B;  5LL6 S;  2B2U C;  3MFG A;  3A0J A;  1PRT B;  3CPW A;  5M5X H;  2M9V A;  2UUC L;  3QWN A;  2B2T A;  2B8F A;  2EQS A;  2XTI A;  3HOY G;  1HZB A;  5C0X H;  4OX9 Q;  4BY1 B;  4X62 Q;  4R8N A;  2CCZ A;  4X66 L;  2RSN A;  2VB2 X;  1IBM Q;  3C46 A;  4A3F B;  3TRE A;  1Q82 C;  2AQ1 B;  1G2S A;  3C1F A;  2JA7 H;  2YYZ A;  5IP7 G;  4X65 Q;  3HOW H;  3CC7 A;  3KYH C;  3K57 A;  4BY1 G;  2FIN B;  2WKC A;  4DKA C;  3A8K E;  1WTR A;  1N36 Q;  1EWI A;  1VQL A;  1K0R A;  4CKE A;  4ZLT F;  2ZTE A;  1XPR A;  2ZJQ A;  2F0V A;  3H09 A;  1ROD A;  1S5C D;  1OTC A;  3SK5 A;  1XWE A;  5IT9 L;  3B6Y A;  5C4J B;  3K7A B;  3ICE A;  1SNQ A;  4K6L A;  4JK1 C;  2IX3 A;  2DY7 A;  2NVY B;  4LWC A;  2VY3 A;  1IBK L;  4HJ8 A;  2OWO A;  1XJV A;  5E7N A;  1YIT A;  4DV1 Q;  2CWA A;  2RF4 A;  4JBM A;  4N8X 1;  1B53 A;  2BDN A;  4RMF A;  4UP7 A;  3UDF A;  2VW9 A;  2XWB B;  3S15 H;  4P75 A;  3M3Y H;  3HEJ A;  1SR3 A;  1ENF A;  2IT1 A;  3GTK H;  1XMO L;  4JBK A;  4GLV B;  5IGD A;  4HJ7 A;  2K6A A;  3PSI A;  5EBC A;  1BO0 A;  5EKK A;  2HQL A;  1HFG A;  4X64 Q;  2Q2U A;  1FGB D;  3ERO A;  4A3E H;  1BNZ A;  1VQP A;  2UU9 L;  3KJO A;  4A3J B;  1LT5 D;  3PIO 3;  1SNC A;  3BZD B;  4V0B A;  1O80 A;  1GUT A;  2KOL A;  3M4Y A;  3BDL A;  3PUV A; 
#chains in the Genus database with same CATH homology
 3CXC A;  3CCE A;  3OW2 A;  4TQU S;  3BU2 A;  5GAE C;  1VQ4 A;  2A1A A;  1D8L A;  4BY1 H;  3S17 H;  3RLN A;  1I5F A;  1W3S A;  1AH9 A;  1PYS B;  2E2J H;  4JOI A;  2CFM A;  1XNQ Q;  4IOA A;  1I6H H;  4JI2 L;  1CSP A;  4A3F H;  1B8A A;  2MFI A;  3NBH B;  3KF8 B;  1PFS A;  3A5U A;  4JYA Q;  1PH7 A;  2K52 A;  3AYH B;  2F4V L;  2KEN A;  3TQY A;  4YCU A;  3OTO L;  4B3M L;  3IRB A;  3GTO H;  3UE1 A;  1HZ9 A;  4GN4 B;  1HNZ L;  1IYJ B;  1PVO A;  3K80 C;  4A3G H;  4HID A;  3Q8D A;  1SRO A;  1A0I A;  2N49 A;  1HH2 P;  4K0K L;  2VUM G;  1WCM H;  2ZTD A;  4AQY Q;  3HOW G;  3S14 H;  2I5L X;  1A8V A;  3FHW A;  1LUZ A;  2DGY A;  2D0O A;  1PV4 A;  5IYD G;  2F52 A;  3A5Z B;  1IBK Q;  2AMC B;  3G48 A;  3UDX A;  4KI0 A;  4QIW E;  2HIV A;  3CF5 A;  3T1Y Q;  1KD1 C;  3HOU G;  1J5E L;  2E2H H;  1JJ2 A;  2BA0 A;  3HOX H;  2JA6 G;  1JB7 A;  1NE3 A;  2JE6 I;  3PF5 A;  2I5M X;  3JC6 6;  4B3T Q;  4LF9 L;  1E22 A;  3PCO B;  2AHO B;  5C4J H;  2VNU D;  4JI1 L;  2LXK A;  3K81 C;  3NEM A;  3ULL A;  3CMA A;  3K7A H;  4IJH A;  4JG2 A;  2PI2 A;  2WAQ E;  4NXM Q;  3RLF A;  4LFB Q;  4A93 G;  4NB3 A;  1VQO A;  1VQF A;  5JJK A;  3S1R H;  2NVY H;  2F3I A;  1CKN A;  3M9B A;  4GOP C;  1L1O B;  2IHE A;  1P8L A;  4JI3 L;  1X3G A;  2MQH A;  2N3S A;  1TWC H;  2NZO A;  2CKZ B;  2ZJP A;  5C44 G;  4JI6 L;  3KJP A;  2Q2I A;  4IFD J;  5C0X J;  4IPG A;  4GKJ Q;  4B3S Q;  1BBU A;  2NN6 G;  5M3M H;  2QGQ A;  2GVA A;  4UP8 A;  2UU9 Q;  2Z6K C;  4C3H H;  1HR0 Q;  2VL6 A;  1Q12 A;  2KBN A;  4AH6 A;  1Q86 C;  5LMN W;  4MZ9 A;  1SRU A;  2NZH A;  4O0A A;  4DUY L;  5GRO A;  1XPU A;  4DR6 Q;  3D31 A;  4LUO A;  2UUA L;  1VQD A;  1VS0 A;  2Q2T A;  2E5L Q;  4JI7 L;  3U4V A;  3I4N H;  4KHP Q;  1A63 A;  3CAM A;  1EYG A;  3JAM i;  3H3V I;  3TS2 A;  4MTN A;  1EQQ A;  3KF6 B;  4JI5 L;  5IWA L;  1KQS A;  3J7Z C;  2VQF Q;  4LFC L;  1C7Y A;  3U50 C;  1CUK A;  4DV0 Q;  1XPO A;  2Q2H A;  5IYC G;  2JA5 G;  4LF4 Q;  5M3F G;  4DV3 Q;  1YJ9 A;  3I4O A;  4JI2 Q;  2K4K A;  4UY8 C;  3CCR A;  1IXR A;  4A3J H;  1CSQ A;  3M85 A;  3K8A A;  4QY7 A;  2UUB Q;  2VQE L;  1FGU A;  1S3O A;  2F4V Q;  2A8V A;  3OTO Q;  4B3M Q;  1VQK A;  4B3R Q;  3HOZ G;  1MJC A;  1HNZ Q;  1VQ7 A;  4OWW B;  2B63 H;  1G6P A;  1EUJ A;  2OQ0 A;  3TRZ A;  4IPC A;  4JI0 L;  3J80 c;  4POF A;  2ASB A;  1JT8 A;  1LM0 A;  1J6Q A;  1NBW A;  2LXJ A;  3ER0 A;  3U4Z A;  3NEN A;  2RCN A;  1YVC A;  4NXN L;  3CCV A;  1N33 L;  5IYD H;  3PUV A;  3DM3 A;  1K83 H;  1X54 A;  1XMQ L;  2OQK A;  3T1H L;  1BVS A;  2K50 A;  1HZC A;  3CW2 C;  2I5H A;  3PIP A;  4BXX G;  5IP9 G;  1X56 A;  4GLA C;  4UPA A;  4DR7 L;  4R4I A;  1KRT A;  4H02 A;  2IHF A;  1UE5 A;  4APV A;  4DV2 L;  1VQM A;  3HOY H;  3CPF A;  3J81 c;  1ASZ A;  4A93 H;  4X66 Q;  4JI1 Q;  1YBY A;  1GKH A;  5M5Y H;  2UXB L;  1L0W A;  5ELN A;  3CME A;  1N34 L;  5IYB G;  5K36 G;  3S24 A;  4BBS G;  3F2B A;  3W1G A;  1U0L A;  1S72 A;  4YY3 L;  1FL0 A;  4A3B G;  1M1K C;  2Z0S A;  5C44 H;  1VQ5 A;  1YHB A;  3CP0 A;  4IFD G;  4JI6 Q;  1X3E A;  5C0X G;  2KCT A;  5IP7 H;  1FVI A;  3E9I A;  3U58 A;  4HIO A;  3GO5 A;  1IBM L;  3I4M H;  3DLL A;  2D0P A;  2WFW A;  2RHS B;  1YNX A;  4DV4 Q;  1VQ9 A;  3J7A 5;  4Y52 H;  4LUV A;  1TWG H;  1PH1 A;  4DR1 L;  4AYB G;  5FJ8 G;  4L5Q A;  2ALY B;  4GOP B;  4QQB X;  4OON A;  4BBR G;  4DUY Q;  1P16 A;  3W5O A;  1VQ6 A;  1CKO A;  1QUQ B;  1L1O A;  2UUA Q;  4DPG A;  4X65 L;  1IBL L;  1OXU A;  4DV7 L;  1D7Q A;  3L0O A;  5JJL A;  4LF8 L;  3STB D;  4C3I H;  4JI5 Q;  5IWA Q;  5IYC H;  1EIF A;  2VS1 A;  3K0X A;  1BBW A;  3FKI G;  3RLO A;  5H1S E;  5M3F H;  4LFC Q;  1FJG Q;  1K3R A;  3CCS A;  2ES2 A;  1WFQ A;  3F1Z A;  1E1O A;  5GAD C;  1Q1E A;  1HR0 W;  2R93 G;  4BY7 H;  3JAM c;  1RL2 A;  4LUZ A;  4YCV A;  4LNQ A;  3KFU A;  3M7N A;  4GKK L;  2R7Z H;  4A3L G;  2VQE Q;  4GNX C;  3NEL A;  2ZM6 L;  3HOZ H;  2UXD L;  2HHH L;  5GAG C;  1YHA A;  1YIJ A;  3D0F A;  2LSS A;  5FLX c;  2BH8 A;  4JI0 Q;  3PUZ A;  3E9H A;  1G29 1;  3KF6 A;  4JBJ A;  2K5V A;  4EQ5 A;  1K9M C;  1ASY A;  5BR8 L;  4OO1 G;  2B3G A;  1HZA A;  1EQR A;  4HJA A;  4NXN Q;  1N33 Q;  1WJJ A;  3RZO H;  1EIY B;  4DNI A;  3BZC A;  1XMQ Q;  1VQN A;  2L15 A;  4BXX H;  2K5N A;  5IP9 H;  4DAM A;  2AWN A;  3EIV A;  4IJL A;  3RNU A;  1PH2 A;  4DR7 Q;  3HOV H;  1TWF H;  4P74 A;  1RIP A;  4DV2 Q;  1XMO Q;  1PYB A;  3PO3 H;  1PA6 A;  5M5W H;  2GVB A;  2R92 G;  4DV6 L;  3TS0 A;  4XIG S;  1TXY A;  3AFP A;  2UXB Q;  3RZD H;  3PV0 A;  4L5T A;  4HJ9 A;  1N34 Q;  1QVF A;  5LMN L;  1UEB A;  4A3B H;  1PH5 A;  2NVX H;  5C4X H;  4YY3 Q;  1YHQ A;  2NVT H;  1KHI A;  3CCU A;  1W2B A;  1V43 A;  3I2Z A;  3CCJ A;  2XGT A;  1IL2 A;  4YHH L;  5HY6 A;  2QA4 A;  1SLJ A;  1Y1W H;  2UXC L;  1KXL A;  1GO3 E;  1UE7 A;  2YV5 A;  2I0Q A;  3HKS A;  3G4S A;  1HNW L;  4DR4 L;  2E2I H;  4DUZ L;  4XTC S;  4IO9 A;  4JI8 L;  3F2C A;  2KCM A;  5FJ8 H;  4DR5 L;  4A3E G;  3PUX A;  1YZ6 A;  1XTD A;  3W1B A;  3SGI A;  4BBR H;  3GTP H;  2QEX A;  4JV5 L;  4LFA L;  5C3E G;  3ZJY C;  3H15 A;  4A3I G;  3CC4 A;  5FLM G;  2MO0 A;  2BH2 A;  2ID0 A;  1VQA A;  1IBL Q;  4PZ8 A;  4DV7 Q;  1EOV A;  2MNA A;  4LF8 Q;  3CD6 A;  2B29 A;  3FKI H;  4J15 A;  3RN5 A;  1KC8 C;  4DK3 C;  3GTG H;  1M90 C;  2MO1 A;  4R4Q A;  3CC2 A;  2R93 H;  1VQ8 A;  1QVC A;  5JEA J;  2VUM H;  1MIU A;  2IX1 A;  1XNR L;  1WI5 A;  3OYY A;  4OXP A;  4YWK A;  2EIF A;  2R7F A;  4EX5 A;  4GOP A;  3ULP A;  4A3F G;  4YWL A;  4JYA L;  4GKK Q;  4K0K Q;  1SN8 A;  2UXD Q;  1NTG A;  5IY0 A;  4IOC A;  4X6A H;  1S40 A;  2HHH Q;  1VQB A;  1VQI A;  2NN6 I;  1LYL A;  1OXS C;  1NJI C;  3HOU H;  3VDY A;  4L5S A;  1E7Z A;  3H0G G;  3LGJ A;  1J5E Q;  2JA6 H;  2Z6K A;  5BR8 Q;  2ZTC A;  1O7I A;  3M4P A;  4AQY L;  4A3C G;  1G51 A;  1Q46 A;  2A19 A;  4LF6 L;  3UDI A;  4GNX B;  1N32 L;  3S2D H;  3CCQ A;  4LF7 L;  4LF9 Q;  1MKH A;  1U5K A;  3AFQ A;  2JEA I;  5IT9 c;  1TWH H;  4JOI C;  3ULJ A;  3BZK A;  1YEZ A;  2YTX A;  4AYB E;  1BKB A;  1L1O C;  1JJC B;  4LF5 L;  2DUD A;  3STB C;  5GAH C;  3K7U C;  1GD7 A;  4O2D A;  5ELO A;  3HOX G;  1VQC A;  1YJN A;  3EN2 A;  2R92 H;  1C9O A;  2AWO A;  2K5H A;  1E1T A;  4DV6 Q;  2Y0S E;  2K14 A;  4X62 L;  4JI3 Q;  1TWA H;  4OX9 L;  4POG A;  3L2P A;  1KAW A;  4NXM L;  2ATW A;  5DLQ E;  3UDG A;  2WP8 J;  1UWV A;  1Q81 C;  4R1J A;  1UE6 A;  5LMN Q;  1Q8K A;  1K8A C;  1I94 L;  1VQJ A;  2VZA A;  1WYD A;  5LMU L;  3GTL H;  3F2D A;  1H95 A;  1PH4 A;  4DK6 C;  4JBW A;  3M4O H;  5J3B A;  1Q1B A;  3PUW A;  4KLK A;  1HJP A;  1YI2 A;  1HNW Q;  4GN5 A;  2UXC Q;  4R4O A;  2JA7 G;  3WWV A;  2Y0S G;  1PH6 A;  4JI7 Q;  2V1C C;  3GDE A;  4GS3 A;  4PG3 A;  4DUZ Q;  1I50 H;  4HIM A;  1K73 C;  1JMC A;  4B3S L;  3PO2 G;  2PNH A;  4DR5 Q;  1PH9 A;  1HR0 L;  5C3E H;  1GM5 A;  3F8T A;  4R4C A;  2JA5 H;  2H5X A;  4JV5 Q;  1R9T H;  4LFA Q;  4JCV E;  1V9P A;  5FLM H;  1Y1V G;  2JJQ A;  3J81 j;  2N78 A;  3S1M H;  3G71 A;  2OTL A;  3PUY A;  1N36 L;  1B7Y B;  2E5L L;  3PF4 A;  3CCL A;  3I4N G;  1OXX K;  1NMF A;  2VQF L;  5JEA G;  4DV0 L;  1PHJ A;  4LF4 L;  1KRS A;  4QGU A;  4PZ7 A;  4DV3 L;  3GTJ H;  4IFD I;  1Y14 B;  1Z9F A;  2PQA B;  5C0X I;  3J80 i;  4JI4 L;  2BA1 A;  2FXQ A;  1XNR Q;  1OXT A;  3TEH B;  3HKZ G;  4A3K G;  1L2F A;  1SE8 A;  4A3D G;  2UUB L;  4DV5 L;  3S1Q H;  4WJ3 M;  4WJ4 A;  2CQO A;  1Z47 A;  4A3J G;  3BJU A;  3S16 H;  4B3R L;  4UP9 A;  3E0E A;  2IX0 A;  3T1H Q;  4DR2 L;  4DAY B;  3H0G H;  3KDF B;  2B63 G;  1VQE A;  3A74 A;  2WB1 E;  4GN3 B;  1X9N A;  4DV1 L;  2E8G A;  4P72 A;  4DR3 L;  2YU9 H;  1KL9 A;  4A3C H;  4YCW A;  1JE5 A;  3GD7 A;  4C2M H;  1K8G A;  4A76 A;  2HIX A;  4QL5 A;  2JA9 A;  2RHQ B;  4LF6 Q;  1C0A A;  4MNO A;  3KLW A;  4ALP A;  3AEV A;  1N32 Q;  2OTJ A;  2EXD A;  3S2H H;  2CWP A;  4LF7 Q;  1SMX A;  3L7Z C;  3J81 i;  3MEF A;  5IYB H;  4OWX B;  4YWM A;  3A0J A;  4BBS H;  1N8R C;  3CPW A;  5M5X H;  4LF5 Q;  2PMZ E;  2WB1 G;  4NPS A;  2UUC L;  2JEB I;  2EQS A;  4A4I A;  4JC0 A;  4A75 A;  2XTI A;  3HOY G;  1HZB A;  1VQH A;  1X65 A;  2JA8 G;  4OX9 Q;  4X62 Q;  2CCZ A;  4X66 L;  4RG1 A;  5HGQ A;  1HNX L;  1VQG A;  3M4Q A;  4A3M G;  4GNX A;  2GN5 A;  1IBM Q;  2JQO A;  4X64 L;  3G6E A;  1I94 Q;  2KHI A;  3TRE A;  3CCM A;  5LMU Q;  1Q82 C;  3HFZ B;  4OO1 I;  1E24 A;  1N9W A;  4DR1 Q;  2D62 A;  5AJ3 L;  5IE8 A;  4AIM A;  2JA7 H;  1YJW A;  2YYZ A;  1X55 A;  2JK8 A;  2YTY A;  5IP7 G;  3PO2 H;  1NY4 A;  1OXV A;  4ME3 A;  4X65 Q;  4DV4 L;  3I4M G;  3I56 A;  2C35 B;  2WAQ G;  3GTQ H;  3HOW H;  2IY5 B;  3CC7 A;  1Y1V H;  3KYH C;  4BY1 G;  1WOC A;  1A62 A;  1XNQ L;  4DKA C;  2ZJR A;  4IPH A;  1EWI A;  4P73 A;  1N36 Q;  1QZG A;  3PGZ A;  4A3L H;  1VQL A;  1K0R A;  1B70 B;  3CQZ H;  2ZTE A;  4IPD A;  1XPR A;  2ZJQ A;  2OCE A;  2ZM6 Q;  4OWT B;  5JJI A;  1QUQ A;  1SFO H;  1FJG L;  1OTC A;  4BA2 I;  1CKM A;  4A3K H;  1X3F A;  4JI4 Q;  3B6Y A;  4A3D H;  4A3G G;  3I7F A;  4DV5 Q;  4GLX A;  1QVG A;  3ICE A;  4BY7 G;  4PMW A;  3PIO A;  1WCM G;  4L5R C;  4QJF A;  2R7Z G;  4LW1 A;  4Y7N H;  1JJG A;  4LWC A;  4DR2 Q;  1T9H A;  2VY3 A;  3KOJ A;  3AQQ A;  1IBK L;  4HJ8 A;  2OWO A;  4FDB A;  5E7N A;  1XJV A;  1CKN B;  3T1Y L;  3MXN B;  4DV1 Q;  4DR3 Q;  1YIT A;  2PI2 E;  2CWA A;  1QZH A;  2RF4 A;  4JBM A;  1AE3 A;  1X6O A;  4PZ6 A;  2PQA A;  4RMF A;  4UP7 A;  3UDF A;  3FP9 A;  4R4T A;  2AKW B;  1AE2 A;  1VCI A;  2VW9 A;  4B3T L;  5GQO A;  1NMG A;  2N8N A;  1PH3 A;  3S15 H;  3ERS X;  3UE0 A;  3H3V H;  4P75 A;  1UE1 A;  3M3Y H;  1SR3 A;  4C3J H;  4LFB L;  4P71 A;  2IT1 A;  2UUC Q;  1IZ6 A;  3KDF A;  2NVQ H;  1XMO L;  2HT1 A;  3GTK H;  3HOV G;  2JA8 H;  4JBK A;  4BA1 I;  4GLV B;  1Q7Y C;  3PO3 G;  2KHJ A;  3I55 A;  4YHH Q;  4HJ7 A;  3GTM H;  4A3M H;  3PSI A;  3S1N H;  3RR5 A;  1HNX Q;  2R6G A;  1DGS A;  4HIK A;  1KIX A;  2HQL A;  4DR4 Q;  4X64 Q;  2Q2U A;  4GKJ L;  4KHZ A;  3RN2 A;  4JI8 Q;  1LTL A;  4TVA B;  4HJ5 A;  4A3E H;  1VQP A;  2UU9 L;  1E3P A;  3KJO A;  1EFW A;  5C4X G;  5M3M G;  5AJ3 Q;  1PH8 A;  2R7D A;  1I3Q H;  2YTV A;  5EAY A;  4A3I H;  3HKZ E;  4DR6 L;  1GVP A;  2K75 A;  3EBE A;  4KHP L;  1V1Q A;  1Y1W G;  1MJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...