4DV5Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv5Q00
4OXPA 2PQAA 4POFA 5GROA 1L1OA 1PH5A 4A76A 4BBSG 3Q8DA 1GO3E 4MNOA 3PSIA 4R1JA 2PI2E 1WJJA 3UDXA 3ERSX 2VY3A 3B6YA 1Q7YC 1VQFA 2BA0A 1SR3A 1Z9FA 3GTJH 4JI7Q 3J7A5 1MIUA 4YWMA 5H1SE 1NJIC 4A3GG 4IFDJ 1I3QH 1B8AA 1S40A 2I5LX 2KBNA 2KCMA 4JI7L 4LF9Q 4UPAA 4LF9L 2K4KA 1YZ6A 1SN8A 4A3LG 2JK8A 3S2HH 4JCVE 1YITA 4P75A 1Q82C 3HKZE 1MJCA 4DR1Q 3TEHB 3J81i 3NBHB 4DR1L 4R4TA 4EX5A 2UUCQ 3AYHB 1IZ6A 1PFSA 1P8LA 4R4OA 1UE1A 3CMEA 2UUCL 4DR4Q 4A3KG 1GM5A 5JEAG 4DR4L 4OO1I 1HH2P 3A5ZB 4DR3Q 4YHHQ 3AQQA 3T1HQ 2K52A 4DR3L 2R92G 4YHHL 4GNXC 3T1HL 4QJFA 5FLMG 2DGYA 2E5LQ 4QQBX 4FDBA 2E5LL 4UP8A 1YNXA 4GS3A 3S1RH 3WWVA 2JA5G 3JAMi 4QGUA 1IBMQ 1X3EA 1HJPA 4X66Q 1Y1WH 2ASBA 3LGJA 2UUBQ 3GD7A 1IYJB 1T9HA 1IBML 4JI0Q 2PNHA 4YCVA 4MTNA 3PGZA 5EAYA 4X66L 2UUBL 3HOYG 4JI0L 1G291 2Z0SA 4A3EG 1HR0W 2D0PA 3RN2A 4AQYQ 1N34Q 4BBRH 3PO3H 3AFQA 3MEFA 1KIXA 1N34L 4AQYL 1XPUA 2AMCB 1X9NA 3HOVH 4DR5Q 3VDYA 3TS2A 4R4IA 5M5YH 2Z6KA 3HOXH 4DUYQ 3EIVA 4DR5L 3K7AH 3GTLH 3GTQH 2VL6A 5LMNW 1VQPA 2YTVA 1X55A 4DUYL 2MO0A 1JMCA 3K7UC 1OXVA 2JEAI 3H0GH 3G6EA 1N33Q 1EFWA 3NELA 3HOUH 4R4CA 1DGSA 1YVCA 1N33L 1OXUA 4LWCA 2JA7H 4IPDA 3CPFA 3G4SA 2ATWA 2ZTDA 5JJLA 1NY4A 5IP7G 1PA6A 2IHFA 4DPGA 2JA6H 3K0XA 3RZDH 3UE0A 3F2CA 3PO2H 3L7ZC 2UXDQ 3HFZB 4YCWA 3PUWA 4GOPB 2CWAA 2UXDL 1TWHH 4LUZA 2VS1A 3KF6B 3PIOA 1SRUA 2GN5A 4LF5Q 1P16A 1XPOA 1PH9A 4DAYB 4LF5L 2BA1A 4QL5A 3CCMA 4BY7H 1LTLA 2K14A 1CKMA 5M3FG 1VQKA 2RHSB 3CW2C 3A0JA 3UE1A 3S1MH 2XGTA 2PMZE 4BA2I 5FJ8H 3PCOB 4IOCA 2HQLA 5GADC 1IXRA 2XTIA 3PUVA 3M4PA 3TREA 5C44H 1VCIA 2ID0A 5HY6A 1GVPA 3KF6A 2OQ0A 4QY7A 4DV5Q 5JJKA 3U4ZA 1Y1VH 5C4XG 2Q2IA 4P73A 4DV5L 1NBWA 2HT1A 1KRSA 4IFDG 4X64Q 2N78A 1KD1C 2IY5B 1WFQA 1V1QA 4X64L 2NVTH 2WB1G 3CXCA 4JYAQ 1CSQA 1FGUA 5GAGC 1N32Q 3GDEA 3I2ZA 5ELOA 5C0XJ 4JYAL 1OXSC 1N32L 3H15A 5JJIA 4A4IA 1RL2A 2B63G 2NVQH 5M5WH 4LW1A 3TQYA 1YBYA 4NB3A 1B70B 1VQ7A 4UP9A 1CUKA 4A3IH 1QVGA 2Y0SE 4HJ5A 4PG3A 1VQLA 2YTXA 4DUZQ 4DR7Q 1JJCB 1YHAA 1SROA 4DUZL 4DR7L 4H02A 3KFUA 2N8NA 2CFMA 3UDFA 3J81j 4AYBE 4QIWE 1VQ4A 3PUXA 4A3FH 4IJHA 1E24A 1OTCA 4AIMA 5IE8A 1QUQB 4EQ5A 1UE7A 1QVCA 3KOJA 3DM3A 4OWTB 4DV3Q 3F2DA 3KJOA 3PUYA 4DV3L 4B3TQ 1LUZA 3F2BA 3W5OA 2CQOA 1XJVA 4B3TL 1B7YB 2Q2TA 4LUVA 2CCZA 2OTLA 3ULPA 2A8VA 1UWVA 4IO9A 1N9WA 1QZHA 2V1CC 2CKZB 1EQRA 5FLXc 2OCEA 3OW2A 2YU9H 4DR6Q 5LMUQ 4DR6L 1U0LA 5LMUL 4PZ6A 4A3DH 2YTYA 1XTDA 1QUQA 2E8GA 4L5QA 1K83H 1W2BA 2E2HH 4C3HH 1HZAA 2LSSA 5GAHC 5GAEC 3W1BA 3H3VI 3NEMA 3RLNA 1IBLQ 4A3DG 1K3RA 1WYDA 4DV6Q 1IBLL 3CPWA 1FJGQ 1X65A 4DV6L 1FJGL 1C7YA 1VQMA 2Q2UA 3HOWH 4XIGS 4L5RC 4LNQA 4PMWA 4DV2Q 3G48A 2VZAA 4LF4Q 2AWNA 1TWAH 4JI8Q 1A0IA 4APVA 4R4QA 4DV2L 1I50H 1TWFH 4LF4L 2B3GA 4JI8L 3CD6A 4KI0A 4JI2Q 4DV7Q 4HJ9A 1L1OC 3RLOA 1EUJA 1ASYA 3IRBA 4DV7L 4JI2L 4JI6Q 3CCUA 2FXQA 4JI6L 4NXMQ 3CCJA 1XMOQ 4A3MH 4NXML 5IY0A 3E0EA 2KHJA 1XMOL 3CCQA 4HIKA 2IT1A 4IFDI 1TWGH 1Q8KA 4A93H 1SLJA 1EQQA 1K73C 2OWOA 1JJGA 3KJPA 4P74A 2QGQA 3M85A 1PH4A 4B3RQ 4DV1Q 1Y1WG 4JI4Q 4A93G 4B3RL 2KENA 4IPHA 4LUOA 4DV1L 4J15A 4JI4L 4JOIA 1G6PA 4HJ7A 3I7FA 3PO3G 2MQHA 1G51A 4BBRG 1WCMH 1A62A 1GKHA 3RLFA 1CSPA 3ZJYC 3HOVG 1E1TA 2R7FA 1YEZA 5M5XH 3HKZG 1M1KC 1VQEA 1K8GA 2R7ZH 1VQBA 3D31A 3HOXG 4GN4B 5IYCH 4L5SA 2UUAQ 1YHBA 5IYBH 2K5VA 3H0GG 2UUAL 3BJUA 3HOUG 3K8AA 4C2MH 3J81c 2JA7G 2WFWA 3GTOH 4BA1I 2JA8H 1YIJA 3I55A 4UY8C 3E9HA 4JI5Q 2KCTA 1QVFA 2JA6G 4JI5L 3J80i 3CCVA 3PO2G 1MJEA 2HIVA 1H95A 1X3FA 4OWXB 1TXYA 1JJ2A 1VQHA 4DK6C 2AKWB 2RHQB 1TWCH 2Z6KC 2RCNA 1J6QA 3FKIH 4RG1A 4A3JH 4A3BH 4A3CH 3CMAA 2NZOA 3HKSA 4BY7G 3S2DH 3MXNB 1VQOA 3JAMc 1VQJA 1IBKQ 2QEXA 4L5TA 1HNZQ 1VQ8A 1NMFA 4TVAB 3JC66 5C3EH 1IBKL 4ALPA 3RN5A 3S16H 3M9BA 1E22A 1HNZL 3FP9A 3K80C 3CP0A 2RF4A 1AE3A 5M3MH 1VQIA 5FJ8G 4K0KQ 5ELNA 4K0KL 3M7NA 4UP7A 3TS0A 1KRTA 5C44G 3TRZA 4DR2Q 1EWIA 1JT8A 1HNXQ 1Y1VG 1SE8A 4DR2L 1HNXL 2R6GA 2ALYB 1X6OA 1ASZA 3STBC 2WAQE 3I4MH 3GTMH 5DLQE 1BKBA 2NN6G 4OO1G 1WOCA 2R7DA 4B3SQ 1OXTA 4JBWA 1L0WA 1HR0Q 4P72A 4B3SL 3PF4A 2AHOB 4PZ8A 4XTCS 1HR0L 4BXXH 4HIDA 1EIYB 4LFBQ 3EN2A 4LFBL 4GOPC 2VUMH 2EXDA 1KXLA 1UE5A 2HHHQ 5HGQA 4YCUA 3E9IA 5LMNQ 5IT9c 3I4NH 1XPRA 2HHHL 4A3IG 3S24A 4C3JH 5LMNL 1UEBA 1BBWA 1NMGA 2ZJQA 5IP9H 4LFAQ 1VQ9A 3M4QA 2LXJA 5C4JH 3U58A 4A3FG 4LFAL 1HZBA 2K5HA 2AWOA 3HOZH 2R93H 1VQGA 4RMFA 1XNRQ 4YY3Q 1PHJA 5IYDH 4GKKQ 1XNRL 4YY3L 1KAWA 4GKKL 1OXXK 4ME3A 4GN5A 3DLLA 1AH9A 4DV0Q 5E7NA 2A1AA 1VQAA 4NPSA 4DV0L 4GNXB 3CF5A 1E7ZA 1I5FA 1PYBA 4P71A 4C3IH 3S14H 1YJWA 1PH7A 1E1OA 4GKJQ 4GKJL 3PIPA 1PH6A 3M4OH 1RIPA 3RNUA 1N8RC 3KDFB 2UXBQ 1X56A 3CQZH 1Z47A 4BBSH 2GVAA 2UXBL 4DNIA 4NXNQ 5BR8Q 3BU2A 3BZCA 1NTGA 4NXNL 5BR8L 2L15A 3F8TA 1I6HH 2KHIA 2UXCQ 2N49A 1LYLA 4A3GH 1GD7A 4JBMA 1CKOA 4GNXA 2UXCL 2D0OA 2JQOA 3HOWG 4IJLA 2K5NA 1PV4A 4OWWB 4A3LH 1PH3A 3UDIA 3OYYA 1D7QA 4WJ3M 3KDFA 1XNQQ 3GO5A 4Y52H 1XNQL 1A8VA 1PYSB 2ZTCA 2HIXA 2BH8A 4OONA 1PH1A 1KQSA 2N3SA 4MZ9A 5IWAQ 4A3KH 4A3MG 1E3PA 3GTGH 5IWAL 4KHZA 2D62A 4HJ8A 2R92H 1W3SA 4JC0A 3KYHC 5FLMH 2F4VQ 5K36G 5C0XG 1K9MC 1KL9A 3U4VA 2NN6I 2F4VL 4DV4Q 1M90C 3CC2A 4IOAA 2JA5H 4DV4L 3SGIA 1Q1BA 3HOYH 4POGA 1O7IA 4GN3B 1EYGA 4GLXA 4A3EH 3ER0A 1WCMG 2K50A 1N36Q 1HZ9A 1XMQQ 4WJ4A 3S1QH 1Q86C 1N36L 1XMQL 1YJ9A 3S1NH 2R7ZG 4JG2A 1EOVA 1QZGA 2DUDA 5IYCG 1C9OA 4B3MQ 5IYBG 2K75A 2PI2A 1SMXA 1VQDA 4B3ML 4X6AH 3CCRA 2GVBA 1U5KA 1VS0A 1R9TH 2OTJA 3CCSA 4KHPQ 3KLWA 1WI5A 1L2FA 3F1ZA 3L2PA 1JB7A 2JA8G 4KHPL 5IP7H 5J3BA 4LF8Q 2I5HA 4JOIC 2IHEA 1LM0A 4LF8L 1VQCA 1IL2A 4LFCQ 3CC4A 1BBUA 2WB1E 2ZTEA 2NVXH 3S17H 4LFCL 4A3JG 3H3VH 1FL0A 3A74A 3FKIG 1X3GA 2ZM6Q 1CKNB 4A3BG 4A3CG 3CCLA 2ZM6L 3CC7A 5M3FH 1UE6A 1X54A 4YWLA 2F3IA 1KC8C 1HZCA 1C0AA 2JJQA 5C3EG 1S3OA 2MFIA 3G71A 1SFOH 3PUZA 2JE6I 3K81C 5M3MG 3GTPH 3RZOH 1VQ5A 3EBEA 4A75A 2CWPA 4PZ7A 3GTKH 2A19A 4GLAC 3CCEA 2C35B 2YV5A 2ZJRA 1I94Q 3RR5A 4TQUS 5JEAJ 3ULJA 3M3YH 1I94L 1V43A 1J5EQ 4DAMA 4HIOA 3L0OA 2JEBI 3I4OA 2MO1A 1J5EL 5C4XH 2E2JH 2B29A 1Q1EA 1CKNA 2ZJPA 1A63A 1PH2A 4KLKA 4GOPA 3I4MG 2NZHA 1PH8A 4BY1H 1HNWQ 3T1YQ 3ICEA 2ES2A 1K0RA 1HNWL 2I0QA 4JBJA 3T1YL 1YI2A 2QA4A 3J80c 2NVYH 1K8AC 2EQSA 1YHQA 4GLVB 3NENA 2B63H 4BY1G 4BXXG 1EIFA 3STBD 4JV5Q 3AEVA 3ULLA 3A5UA 4HJAA 4JV5L 3D0FA 2VUMG 4LF7Q 2VQEQ 1Q46A 3PF5A 3I4NG 4IPCA 4LF7L 2VQEL 3BZKA 2H5XA 2YYZA 3PV0A 4AH6A 5C0XI 3U50C 3W1GA 5AJ3Q 5GQOA 2JA9A 3CAMA 5AJ3L 1PVOA 5IP9G 1V9PA 2WP8J 4JI1Q 2MNAA 4OX9Q 2UU9Q 4X62Q 4JI1L 2BH2A 3KF8B 4OX9L 2UU9L 4X62L 1AE2A 4DKAC 2WAQG 1KHIA 4YWKA 4DK3C 2PQAB 3AFPA 2VQFQ 1L1OB 4LF6Q 2IX0A 2VQFL 3FHWA 3HOZG 2E2IH 2F52A 5IYDG 2R93G 4JI3Q 4LF6L 2IX1A 1D8LA 4JI3L 2OQKA 3OTOQ 2Q2HA 1VQNA 1BVSA 1Y14B 4O0AA 3J7ZC 3I56A 3OTOL 1NE3A 1VQ6A 2EIFA 2I5MX 3UDGA 1YJNA 2Y0SG 4X65Q 4O2DA 1S72A 1Q81C 4X65L 2VNUD 3S15H 1JE5A 4JBKA 1FVIA 2LXKA 4Y7NH 4IPGA 4AYBG 4HIMA 1MKHA 2VW9A 1Q12A
chains in the Genus database with same CATH superfamily
2F0PA 2PQAA 4POFA 1TY0A 4MNOA 1GO3E 4FP5D 3A54A 4R1JA 2PI2E 3N52A 3ERSX 1Z9FA 1PFMA 2F3WA 1I3QH 1B8AA 2KCMA 4UPAA 4LF9L 1BCPD 2G9DA 4A3LG 3S2HH 5COYA 4JCVE 5IGFA 4P75A 3HKZE 3TEHB 1NUCA 1H9JA 1QOHA 1QJOA 2RVLA 5JAVA 1F2YA 3AYHB 1STGA 1UE1A 1GM5A 5JEAG 4DR3Q 1AFPA 5FO8B 4YHHL 2Q8RE 4KMUC 2E5LL 3MFGA 4GS3A 3CRLC 2KOLA 2ASBA 3JAMi 2B8FA 1A2UA 1IBMQ 4QQBX 3LGJA 2UUBQ 1Z6HA 5JVH3 2PNHA 4JI0Q 4MTNA 3AMUA 1LTTD 3K5MA 4A3EG 3PO3H 4BBRH 3AFQA 4IUVA 1XPUA 1U9RA 4AQYL 1N34L 2R61A 3HOVH 5J22A 4R4IA 2A69C 4KJOA 3VR6A 3SVMA 4DUYQ 1Q90A 4KHVA 1XWEA 2KJXA 1SNCA 1SJHD 3G6EA 1I4HA 3HOUH 4DAPA 4R4CA 1DGSA 4L8JA 2L4NA 3C46A 1ENAA 1FNVA 5JJLA 2ZTDA 2D5DA 5IP7G 4RH6A 4FO2A 3UE0A 3L7ZC 1V1OA 4YCWA 1X32A 1SSOA 3IAYA 5I9PA 4DAVA 1ML0D 5CYUA 4H44C 3WOEA 4A3JB 4LF5L 1MD2D 2K28A 1CKMA 5M3FG 3S1MH 2SEBD 3HP3A 4RA8A 2RQXA 2X6GA 5HY6A 1F9PA 2TMPA 5JJKA 1Y1VH 2OF1A 3LWUA 4DAYA 3MXGA 4P73A 4DV5L 2WKDA 3I4MB 1V1PA 2WB1G 2B2UC 2CH4W 1CSQA 1OXSC 5JJIA 1BCPB 3TQYA 1BQQT 1WTRA 2VUMB 3J81L 1SNMA 4RCNA 4PG3A 5CBEE 3VA7A 2YTXA 4DR7Q 1EY5A 5EKKA 1JJCB 4DUZL 4AYBE 1WD1A 1VQ4A 2FFKB 3N6RA 1OTCA 1QUQB 3CRKC 4DV3Q 4GZYC 1CHQD 4HSVA 1B2TA 2K1BA 1ENFA 4B3TL 4LUVA 1UWVA 4IO9A 1QZHA 1U4LA 5FLXc 4DR6Q 1EQRA 2OCEA 3HRZC 4C3IB 2YU9H 2D9UA 2F0IA 2ZXOA 1HTPA 1W6JA 1LT5D 2E8GA 2RSNA 3S15B 4BBSB 1EQVA 3NTIA 1O78A 2F0UA 3J81E 4A3DG 3NEMA 1RCVD 4DV6Q 2EXZA 4CHTB 1I6HB 1I4PA 1FJGL 3NP8A 4U673 3I73A 1OO9B 4LNQA 4PMWA 3G48A 1FYCA 5ELBA 1TWAH 4JI8Q 4MIUA 4DV2L 4R4QA 1TWFH 2B3GA 5IT9L 3A8IE 1LTRD 5L37A 4JI2Q 4DV7Q 1EUJA 2LFNA 4F7XA 1H9SB 3I8ZA 3S2HB 1XMOQ 4A3MH 4OIJA 2AUJD 1A3TA 3E0EA 5IY0A 3CCQA 3GTGB 1TWGH 4IFDI 2MGSA 4A93H 1SMYC 5K36H 3EQLC 2PO4A 4CGYB 3FDTA 3KJPA 5EPKA 2E76C 2Q8IB 1Y1WG 2JA5B 4B3RL 2Z6BA 4LUOA 4IPHA 4JI4L 1IYUA 4HJ7A 1G51A 1V8QA 3G6JB 1E1TA 5M5XH 1VQBA 2J7ZA 3D31A 3S1NB 4FXDA 4ZYSA 2QKIC 4GN4B 2KVMA 3T13A 3PMFA 4I7AA 4OIKA 3HOVB 2AQ2B 3NK9A 4KV6A 4HMIA 2A69D 1R9TB 4UY8C 3TP6A 3E9HA 4JI5Q 2KCTA 4PNYA 1O7ZA 5NUCA 1SJED 3CCVA 1H95A 3SEBA 3OOCA 1STHA 1B3QA 2NVXB 1J6QA 3S17B 2NZOA 3HKSA 3Q22A 4BY7G 4R8NA 3MXNB 1VMCA 1VQJA 2QEXA 1VQ8A 3QO2A 1E22A 3MEHA 1SE3A 1HNZL 2SNSA 5FJ8G 3H91A 5M3MH 1VQIA 4K0KQ 1SFOB 1EIHA 2QILA 1KRTA 5C44G 3TRZA 4CDEC 4L63B 2IL8A 3H09A 1HNXQ 1JT8A 1ET6A 3NBIA 4NP5A 2ALYB 1CM9A 1TS5A 3NPPA 4IUQA 1PTOC 3GTMH 2EYLA 5DLQE 2FINB 3GV6A 2NN6G 1Y1VB 1OXTA 4JBWA 1L0WA 3PF4A 4PZ8A 2B63B 4LFBL 4GOPC 1GUOA 5HGQA 3E9IA 2F0JA 2HHHL 3S24A 4C3JH 5LMNL 1TIID 1RD9D 3A8KE 2DJGC 5IP9H 4H0LC 2FMMA 2LXJA 2L12A 1HZBA 4LAAA 4JVZA 5E3FA 3J7AF 2AWOA 3DEOA 1XNRQ 1XXGA 4YY3L 4GKKL 1OXXK 3D4WA 1TU2B 4DV0L 2DY8A 3OIQA 3CF5A 2R3ZA 3S14H 4EGVA 3MFYA 4NDXA 1RIPA 3SK6A 4KK7A 1X56A 3CQZH 1Z47A 3IL8A 4C3HG 2VXWA 1DCZA 3DHQA 2XRSD 2UXCQ 3J80L 1CKOA 4QF4A 2MUYA 1PV4A 4A3LH 1CZWA 1PH3A 1BF4A 3OYYA 2IJ0A 3FPUB 1D7QA 1XNQQ 1A8VA 3R2IA 5CV6A 3MC0B 4KY5A 4MZ9A 5JEAH 2F0QA 2NZ1D 5IWAL 3J7AV 1FD7D 3D4DA 4JC0A 4QB4A 2K01A 1EQTA 3NXWA 4DV4Q 3DM1A 3U9SA 4IUPA 4RKBA 1JORA 3M4YA 3SGIA 1Q1BA 2JYOA 4A93B 3V2TA 5C5LA 1SMYD 4GN3B 3T56B 5BN5A 4A3EH 1SE2A 3ER0A 4KD3A 3EVQA 4ULLA 1FR3A 5CMDA 1I4RA 1XMQL 1YJ9A 3J80E 2R7ZG 4JG2A 3GTLB 3GTQB 2K75A 2PI2A 3ND9A 2QDLA 3CCRA 3CCSA 3KLWA 3ERQA 4XQJA 1WI5A 1L2FA 3TSSA 2PYKA 1JB7A 2A6HC 5IP7H 2JA8G 4K2LA 4KHPL 1I6VC 4LFCQ 2WB1E 1TWHB 1STEA 2K03A 4XXEA 1FL0A 3A74A 3FKIG 5CC4A 2LS01 5M3FH 1ILPA 1CHPD 4YWLA 2F3IA 3SDZA 5C3EG 2PQEA 2F0FA 4A75A 4PZ7A 5CBAE 1HHVA 1JB3A 2C35B 2YV5A 4H7BA 5JEAJ 1I94L 4DAMA 2JEBI 3KUPA 2E2JH 2RKSA 1Q1EA 1F9SA 2ZJPA 1A63A 1A3VA 4G7ZC 2GA4B 1HNWQ 2JP1A 1DXMA 2EYFA 4LK1C 1BR9A 2NVTB 3U9OA 2VB3X 2NVYH 4GLVB 3NENA 4BY1G 1L0XB 1PTOD 3ULLA 4JV5L 3D0FA 1VDZA 1FNWA 1Q46A 3PF5A 1QNKA 2VQEL 3H3VC 3W1GA 5AJ3Q 1SYBA 3CAMA 4N8FA 5JJZA 2MNAA 1ZYRC 2FMCA 1STNA 4DNRB 5D3DA 4A3FB 3QWNA 4X62L 1AE2A 3OWEB 1D1IA 2PQAB 1ENCA 4LF6Q 2VQFL 3FHWA 2R93G 3SK4A 4JI3Q 2IX1A 1D8LA 3OTOQ 1Y14B 4M8AA 1STYA 1VQ6A 2I5MX 3EA6A 4PMBA 4Q0FA 4X65L 1SBBB 2B2VA 1A3UA 1JE5A 1FVIA 1JWMD 1TS3A 2LXKA 1MI2A 4RAUC 4AYBG 4B9WA 4HIMA 5FO9B 2Y0SB 5I2XA 5KRUA 1KLUD 2MJ8A 4OXPA 5GROA 3I72A 4X3TA 4A76A 1K83B 3PSIA 2E2HB 1S5CD 1WJJA 4XQNA 3UDXA 3B6YA 4RKLA 1VQFA 1SR3A 3GTJH 1MIUA 5H1SE 4JI7L 2I5LX 4P2CB 1YZ6A 1SN8A 3HOWB 5KIXA 1YITA 3V05A 1D1KA 1MJCA 1PZKD 3J81i 4DR1L 3HG9A 5J39A 3OWFA 4EX5A 2UUCQ 1PFSA 1P8LA 4R4OA 1D5XC 3CMEA 1STBA 4DR4Q 1G6ZA 2PCFB 1PZJD 4PQXA 1WTXA 2LMCB 3T1HQ 2K52A 2R92G 2BDOA 2RSOA 4FDBA 4KY6A 4F88A 1X3EA 1Y1WH 3GD7A 5ELEA 4X66L 4YCVA 5EAYA 3NBHA 2HCCA 1G291 3L9AX 1EYCA 5FLXL 1KIXA 3TS2A 3VDYA 1LT4D 5M5YH 4DR5L 2VL6A 5BN3A 5LMNW 1VQPA 3NUCA 2KEDA 1JMCA 3TZUA 2JEAI 1PTOB 2CW0D 3NELA 1LT3D 1YVCA 1N33L 1OXUA 3CPFA 1PXUA 2IHFA 4DPGA 3K0XA 3RZDH 1DOLA 5JPNC 4GOPB 2CWAA 2UXDL 1SRUA 5CV5A 1P16A 4DAYB 2O2LD 2BA1A 4QL5A 4XYQA 4BY7H 2K14A 4A3BB 1VQKA 3CW2C 4HR7B 1V1PB 3A0JA 1A2TA 5FJ8H 1QWYA 3FPPA 3GQBA 3PCOB 2EJMA 3MA2B 5GADC 1IXRA 1HQRD 4RHSA 5EBCA 3M4PA 5C44H 1VCIA 2EYHA 2ID0A 3A56A 3KF6A 1BXTA 5C4XG 1E2ZA 2Q2IA 3MAQA 2EYMA 2X6LA 1EY0A 1KRSA 3NSWA 4X64Q 1G2SA 2IY5B 4JYAQ 1FGUA 2NN6H 5GAGC 3I2ZA 4O42A 5C0XJ 1N32L 4KTAA 1RL2A 3HZXA 4WORA 4LW1A 2KUMA 4IUNA 3P75A 4UP9A 1QVGA 2F0VA 3I4NB 4HJ5A 1O80A 4ILWA 1VQLA 1SROA 3UDFA 1D6EC 1O7LA 5C4JB 5I6YA 4YIJA 2WAQB 4DXGA 3HOZB 3QG1A 3BYTB 1LUZA 4IURA 3K0YA 3T16A 1B7YB 2Q2TA 2CCZA 3OHXC 2L0CA 2XN9C 3ULPA 1EY4A 1N9WA 4O1NA 2V1CC 2CKZB 1E0BA 4FF1A 3P20A 3SR1A 5LMUL 2YTYA 1EY7A 5E4XA 4L5QA 1W2BA 4C3HH 3VR3A 4KKUA 1JWSD 3H3VI 3RLNA 1IBLQ 2QW7A 5I2YA 2WIIB 4A3GB 1MBYA 1VQMA 1C7YA 1LTSD 2EYPA 3Q0AA 2B2VC 3OMCA 5EJWA 2F4IA 4JK1C 4LF4Q 4APVA 1I50H 3CD6A 3C2PA 4KI0A 3KLSX 4EQPA 3ITPA 3IRBA 3ONAB 1ASYA 4JI6L 4J6HA 1U4PA 4NXML 1UUPA 2KHJA 4A3KB 2XNAC 1DOKA 2DY7A 5FK9C 1EQQA 1CTMA 4P74A 1PH4A 2KENA 1PFBA 4DV1L 1H9KA 3HOYB 2C9OA 3X3NA 3I7FA 1L0YB 1KTKA 1CSPA 2NTTA 2R7FA 1YEZA 1B53A 4K2KA 1VQEA 3S1QB 2EPBA 2R7ZH 3HOXG 4BWGB 5DM73 4L5SA 4ZUJA 2K5VA 3H0GG 2UUAL 3BJUA 4C2MH 3BDOA 1DONA 2JA7G 3NHHA 3GTOH 2JA8H 3I55A 2JA6G 3J80i 4BS9A 3PO2G 1MJEA 2HIVA 2K5DA 1KAAA 1VQHA 4QCLA 1J8IA 1JOQA 2AKWB 4I7ZC 4DXFA 1C8CA 3TP5A 1BDOA 1TWCH 1HUNA 3FKIH 4UAIA 2A74C 3S2DH 2FHTA 3S16H 1IBKL 5C3EH 4CDFC 3CU7A 4DK0A 5ELNA 5ELCA 5HURA 3GTPB 3TS0A 3J7YW 2EY1A 1EU4A 1EWIA 3M3YB 3QOJA 4B9XA 1SE8A 4DR2L 3LNNA 4OO1H 3OW7A 3STBC 4FYDA 2F3VA 1JOOA 1DD2A 2F1MA 1ICWA 4I65A 1BKBA 2RDGA 3E3XA 3TP7A 2R7DA 3GP7A 4B3SL 4RFBA 2XVSA 2AHOB 3OSOA 1HR0L 1EIYB 3IFTA 3K59A 1KXLA 2EXDA 2XWBB 5C3WA 5KYIA 4A3IG 3BVZA 1JQYD 1T5EA 3OMGA 1CA6A 2ZJQA 1AN8A 3A7AB 4EQNA 2NUCA 3M4QA 3U58A 4LFAL 1IHZA 1QILA 5DM63 4HEDA 2K5HA 2R93H 1PHJA 1HFGA 1B9MA 5IGGA 4ME3A 1AH9A 5KNBA 1CQVA 5E7NA 1C4QA 2F0LA 2K5QA 1E7ZA 1I5FA 1PYBA 4P71A 4IALA 1E1OA 4GKJL 3PIPA 3M4OH 3T51B 3RNUA 2X69A 4OEMB 2UXBQ 1FGBD 3MHBA 3Q23A 4DNIA 4NXNQ 2IW3A 5I4DA 4OGQC 1WTPA 1YNJD 3BZCA 5BR8L 2OT2A 1LTGD 3KBXA 2DNEA 2KHIA 1DJRD 4DFAA 2N49A 1YNND 1GD7A 2AQ1B 4GNXA 1I3QB 2D0OA 2JQOA 2ZXPA 4IJLA 1HCZA 1PLFA 2K5NA 2XWJB 4FF2A 5C5MA 4IQZA 1SYCA 2LKVA 2ZTCA 4RWSC 5A35A 3E6ZX 2VB2X 4KHZA 2R92H 1CZGA 1W3SA 4N9TA 5C0XG 1K9MC 3U4VA 1U4RA 4ID6A 2F4VL 3CC2A 4R9WA 4K14A 4CDDC 4GLXA 3PO3B 1N36Q 1HA5A 2F0NA 4BBRB 1Q86C 3HKZB 1G8ZD 1QZGA 1D2BA 5IYCG 1C9OA 4CJ2C 4B3MQ 1IKLA 4ZUIA 1BOSA 4X6AH 1VQDA 1SXTA 5IGEA 1VS0A 3HOUB 1F77A 3F1ZA 3L2PA 1M4VA 2K33A 4DK1A 4FF3A 4LF8L 3D3RA 5M9OA 3GTOB 3MWYW 1BBUA 3RMHA 4A3JG 2ZM6Q 5LHY1 3CCLA 3CC7A 1UE6A 1JWUD 4FXGC 5KNDA 3E5SA 3S1MB 1S3OA 1Q8IA 4RGMA 3URYA 5KNCA 3RZOH 3GTKH 2B8GA 4UHVA 2CHBD 4K5WA 1V43A 1J5EL 2MHVA 2PW7A 5C4XH 4KD4A 2L11A 3I4MG 4J1MA 2B2TA 2NZHA 4ME5A 5D3IB 5A2QE 1I4XA 4JBJA 3T1YL 1S5FD 2QA4A 1EY8A 1STAA 1RODA 4CDCC 3KLSA 3STBD 5C6AA 3ND8A 1HFNA 2VUMG 4K8IA 2L55A 2J0TD 4LF7L 2EJGC 1GXDC 1UAPA 2A68C 2YYZA 4J8QA 5GQOA 2JA9A 5AFWA 3CKIB 3VA5A 5KEEA 4JI1L 4OX9L 2UU9L 4YWKA 3AFPA 2F0TA 2IX0A 2E2IH 2Q2HA 1VQNA 4O0AA 3I56A 3J7ZC 4IUTA 3W3AA 1S72A 2R93B 2A5HA 4C3IG 3SK5A 3VYTA 4JBKA 4Y7NH 2YU9B 4IPGA 1Q12A 5E1FA 3KF8A 4QUFA 4RHRA 1X3PA 4BBSG 2O5IC 1L1OA 1PH5A 2SDFA 1SYGA 3Q8DA 3K5NA 1NNXA 1Y8OB 2WV6D 4DU9A 2VY3A 5IOCA 4KJNA 1SNQA 3J7A5 2WINB 1NJIC 3MXUA 1S40A 4LF9Q 1PZID 5J1ZA 1SDFA 4DN4M 1EIGA 1TWAB 1TWFB 3NBHB 3DEPA 1SNPA 1PDQA 1IZ6A 5CV4A 1RHPA 2RBMA 1TR5A 1B3AA 1QB5D 3O13A 1HH2P 3A5ZB 4A3MB 3JAME 4YHHQ 3AQQA 4DR3L 1TWGB 4GNXC 1RTOA 2E5LQ 4ZK9B 3C3LA 2ENBA 4UP8A 3S1RH 1R4PB 5EKLA 3R93A 2CW0C 3WWVA 5I9OA 3G7LA 4QGUA 1HJPA 1M8AA 2JA5G 3OIPA 1IBML 1T9HA 2UUBL 4JI0L 1GJXA 2Z0SA 1HR0W 1EWCA 4AQYQ 1N34Q 3MEFA 2EZVA 5M5XB 2Z6KA 3HOXH 3BDCA 3EIVA 3K7AH 3SK8A 2XSCA 1BBXC 4DUYL 1X55A 1SYDA 3P1HA 1OXVA 3H0GH 1KDBA 4WJWA 2KA7A 2JA7H 2HDLA 4RGTA 4IPDA 4X3KA 4IN3A 4Q5VA 1JCKB 2ATWA 4RGNA 2JA6H 3I91A 3PO2H 3HFZB 2DNCA 2Z4HA 2EY2A 3KF6B 3L3OC 2PPBC 4LF5Q 1PH9A 1XPOA 1LTLA 3E0JA 3UE1A 2XGTA 4BA2I 1F9QA 4IOCA 5M3MB 2HQLA 2XTIA 5CV7A 1G91A 3ZYYX 3X3MA 1GVPA 4QY7A 4DV5Q 3U4ZA 1EY6A 5D14A 4IFDG 2Z9HA 1KD1C 5CR3A 1V1QA 4MHEA 3BZDB 3CXCA 3GTMB 5IGDA 2PMZB 4C1NK 3H15A 2B2WA 2B63G 2NVQH 4XDXA 3R8BA 5M5WH 4NB3A 3NQIA 1B70B 3DWAA 5FOBB 1VQ7A 4A3IH 3MZ5A 4RGOS 4C3JB 2QCPX 4DUZQ 1TS2A 2B2TC 4DR7L 3KLRA 2CFMA 3PUXA 4OHJA 2G9HD 4IJHA 1E24A 4AIMA 4LJZC 5EBDA 2BCOA 4EQ5A 5IE8A 2A68D 1QVCA 3DM3A 2XIWA 4FF4A 3PUYA 4DV3L 4B3TQ 5EKIA 3F2BA 2OTLA 2JN4A 4V190 4EQOA 1SNDA 3S14B 1Y69U 4DR6L 1U0LA 1F2ZA 4PZ6A 4QIWB 1ZKOA 4A3DH 1XTDA 1NCVA 2EE1A 1CQFA 3CQZB 1HZAA 2LSSA 2SNMA 3W1BA 2IWHA 1WYDA 1FJGQ 3CPWA 1U4MA 1GUGA 2FJ2A 1X65A 4DV6L 1RJTA 4HTHA 4L5RC 4DV2Q 4ODGA 1A0IA 1Y8NB 4JI8L 1L1OC 3RLOA 1WTWA 4JI2L 4DV7L 1RDPD 2K5WA 3I90A 2KHSA 1XMOL 5T1IA 4HIKA 3NE5B 1LTBD 5KYLA 2JSOA 3K6OA 1Q3LA 3SXHA 5IODA 5C0XH 4G7OC 2OWOA 3NWTA 1JJGA 1EZ8A 2F0WA 3M85A 2QGQA 4B3RQ 1GUNA 4JI4Q 4A93G 1H9MA 3TMEA 4XYOA 4RCOA 4JOIA 2LY7A 4A3EB 1A62A 1GKHA 1MGSA 1M1KC 2K32A 3DUZA 4IZ8A 3BS1A 5IYCH 1KNEA 4ZRZA 1YHBA 5EQ0A 2K04A 2Z8LA 3TBIB 1K8MA 3K8AA 2WFWA 2SOBA 1UNSA 4BA1I 1DZ1A 1K3BC 1XX8A 1YIJA 1QVFA 2BOSA 4JI5L 1QE6A 1X3FA 4OWXB 1TXYA 1JJ2A 5ELDA 1XTCD 2TSSA 4A3JH 2Z6KC 4RG1A 3CMAA 1VQOA 3JAMc 4EVOA 5M3FB 1RF2D 3IKJA 1HNZQ 3KBGA 4TVAB 3GV3A 1PYWD 3M9BA 4CKCA 3K80C 3CP0A 4ZCKA 1AE3A 3AU7A 4K0KL 3M7NA 4UP7A 1PRTF 2KQ3A 4XT1B 3TN2A 1UEAB 1HNXL 1RKNA 2R6GA 2E2JB 2NYZD 1X6OA 1HPCA 5EGTA 1ASZA 3I4MH 2AUKA 1IL8A 4FNFA 3IFDA 5IGCA 1XYIA 3A55A 2KECA 2WB1B 4HCSA 5HGTA 1EL0A 1WOCA 4M1UB 2NVYB 4XTCS 4HIDA 3FRPB 4HSPA 3EN2A 4LFBQ 3HEJA 4DGZA 2VUMH 2HHHQ 1DYQA 2M2LA 5LMNQ 1XPRA 4TKOB 2PNRC 3QB3A 1IKMA 1BBWA 1NMGA 1ESRA 3I3CA 4A3FG 1EEID 5LL6S 1D5MC 3QJYA 1VF5C 4YY3Q 4GKKQ 1HA6A 1XNRL 1KAWA 5JOBA 1YNJC 1BUVT 1I4GA 4DV0Q 2A1AA 1W6KA 4GNXB 1YNNC 4C3IH 1AEXA 2OXPA 1IW7C 1YJWA 3TP8A 4C56C 4BBSH 2GVAA 3BU2A 1LT6D 1NTGA 2L15A 3F8TA 1I6HH 4A3DB 2AQ3B 4TSSA 4JBMA 3GTJB 2UXCL 3VYUA 3HOWG 2F0DA 4E6IA 2HUGA 3KDFA 4G4KA 3GO5A 3UI2A 4PV1C 1XNQL 1PYSB 3BVMA 5IGBA 2BH8A 1PH1A 5I6WA 5IWAQ 3GTGH 2J4XA 2D62A 1Y8PB 5DNFA 2EY6A 1IYVA 2NN6I 1LTAD 3A8JE 2JA5H 2ZT9C 4DV4L 2F03A 3D6WA 1Y1WB 4POGA 2P5ZX 1O7IA 1DM0B 4CJ1B 1NR2A 1WCMG 1HZ9A 1XMQQ 1C48A 3S1NH 5KGUA 1EOVA 2BDNA 5M5YB 4F8MA 2DUDA 3D4RA 5CV8A 3NTKA 5IYBG 1SMXA 2RDHA 2XRQD 1R9TH 4KHPQ 1KLGD 5J3BA 1WVLA 2I5HA 4JOIC 2IHEA 3BG3A 4U68A 1LLRD 4X3UA 3RZDB 3K58A 1VQCA 4ABNA 3CC4A 2NVXH 3S17H 4LFCL 4DNTB 4A3BG 4A3CG 1X54A 4BY7B 1KC8C 1HZCA 1C0AA 1GUTA 2JJQA 5C4HA 1TT2A 2MFIA 4KKSA 1SFOH 2JE6I 1VQ5A 1PFNA 2A19A 3CCEA 2ZJRA 2B2YA 1I94Q 1EWHA 3FMCA 5C44B 2MO1A 1ZXTA 3NTHA 1CKNA 4KLKA 4GOPA 4IFDH 4BY1H 1JICA 2F0HA 1K0RA 1AZQA 1HNWL 1YI2A 1JE4A 5C4ZA 1K8AC 2EQSA 2E2DC 2B63H 4BXXG 1EIFA 1S5ED 4JV5Q 2WACA 3AEVA 3Q24A 2KCNA 3A5UA 4HJAA 2VQEQ 4ZQ3A 4IPCA 3I4NG 3PV0A 4AH6A 1CK1A 4LMQD 5AJ3L 1PVOA 3H6MA 2WP8J 1GHKA 3EJIA 3NWSA 4NW2A 4X62Q 2BH2A 1BCPF 3KF8B 4DKAC 2WAQG 1NSNS 1VF7A 2VQFQ 1ZEQX 2F0EA 1L1OB 3HOZG 2F52A 1LACA 5IYDG 4LF6L 1S4ZA 4JI3L 5TSSA 3OTOL 2EIFA 4X65Q 4O2DA 5E4WC 2VNUD 1S5BD 4KN4C 5CV9A 3W2DA 1VMPA 1SEBD 3AB9A 1BO0A 4C3HB 1IW7D 1A6XA 2WKCA 1Q7YC 2BA0A 4IFDJ 4JI7Q 1TVXA 4YWMA 4A3GG 2KBNA 2K4KA 1MSHA 3K5OA 2JK8A 1Q82C 2CQAA 2M00A 2MPMA 4DR1Q 1K0SA 1I50B 4K6LA 1B4OA 3Q6SA 4R4TA 1HTLD 3EFXD 2UUCL 4A3KG 4HCEA 2EDGA 4DR4L 4OO1I 4UDUC 1PMRA 3T1HL 4QJFA 3QIAA 2DGYA 3DWQA 5FLMG 1YNXA 1FNUA 3FEWX 4X66Q 1IYJB 2I07B 3HOYG 3PGZA 1K28A 4ZKBB 2JXMB 2D0PA 3RN2A 1S5DD 3BDLA 2AMCB 1X9NA 4DR5Q 1ET9A 3GTLH 1K8OA 5LL6X 3GTQH 2R7ZB 4F87A 3TZDA 2YTVA 4MTKA 5A2QL 2MO0A 3K7UC 3I4LA 3C1EA 3I70A 1EFWA 1N33Q 2A6EC 4LWCA 4C2MB 3G4SA 1NY4A 1PA6A 3R2TA 3BYYB 2JA8B 3F2CA 2UXDQ 5IT9E 1A15A 3PUWA 1TWHH 4KKTA 2H1EA 2VS1A 4LUZA 3PIOA 2GN5A 2O4XA 1QNUA 1TWCB 3FKIB 5T1GA 3CCMA 4L6TB 2RHSB 3S2DB 3P7JA 2RA4A 2PMZE 3S16B 1NAPA 5C3EB 3R3OA 2HCIA 3PUVA 1JR0D 1ESFA 4PMCA 3TREA 1EYAA 2F0SA 3KK7A 1SAPA 2OQ0A 2ICEC 1NBWA 5BN4A 5ISRA 2HT1A 2N78A 1WFQA 1AW7A 1LV9A 4XT3B 4X64L 2NVTH 3OPOA 1N32Q 3GDEA 4JYAL 5ELOA 4KN7C 4A4IA 4BY1B 1SYEA 2DJFC 2B2YC 1YBYA 2A73B 3H94A 3S9WA 4NMZA 1PRTC 1CUKA 3RD4A 2Y0SE 4DA2A 2CH4A 1YHAA 4H02A 3KFUA 2N8NA 3J81j 1HRJA 4QIWE 4A3FH 4G7HC 1G2TA 1UE7A 3KOJA 1GUSA 2EYJA 4OWTB 3F2DA 2K05A 3VR5A 3JAML 5JVG3 3KJOA 3HS0C 1GOZA 3W5OA 2CQOA 1XJVA 1D5ZC 2EY5A 4ZAIA 2A8VA 2NWGA 3V96A 3OW2A 5LMUQ 2N55A 1KNAA 2NB0A 3SE0A 4AYBB 3VR2A 3M4OB 4K5VA 4KY7A 1WTQA 3QOLA 3LX0A 1QUQA 5CGKA 1K83H 3VYSA 2E2HH 2F0OA 3NQTA 5JPMC 5GAHC 5GAEC 1K3RA 2G5DA 2MP1A 2F0KA 1WD0A 1QG7A 1IBLL 4H13C 5IIFA 1O7YA 2Q2UA 1H9RA 3HOWH 4XIGS 1CFMA 2VZAA 2AWNA 2F0MA 4LF4L 1KABA 4HJ9A 4JI6Q 4JW0A 3CCUA 2FXQA 4NXMQ 3CCJA 4WFN3 1KDCA 1CI3M 4OELB 2IT1A 4Z9CB 3C1FA 1Q8KA 2O5JC 2NTSA 1SLJA 2R92B 4WRDA 1HQMC 1ILQA 1K73C 2RDFA 4DV1Q 2Z4IA 4J15A 1SYFA 2PZWA 1G6PA 3PO3G 2MQHA 1Z7TA 1WCMH 1H9SA 3RLFA 4BBRG 3ZJYC 3HOVG 4QMGA 1K8GA 3HKZG 2C5CA 2PZTA 4HAEA 1PTOH 2UUAQ 5IYBH 3HOUG 3MTSA 3J81c 4G57A 5FKAC 1DOMA 4JPBW 4NKLA 4C1NI 4CJ0B 3LWEA 2Q8TA 2QDBA 4K5XA 2A6ED 4DK6C 2RHQB 3D8GA 4CBVA 1SNOA 2RCNA 4A3BH 4A3CH 4QUCA 1HXYD 4XQQA 1IBKQ 4L5TA 1NMFA 3T4AC 3JC66 1WTHA 4ALPA 3RN5A 2E75C 3FP9A 5G3LD 2RF4A 1II3A 2EOTA 2HDMA 2L5TA 3RZOB 1TS4A 1F9RA 3GTKB 4DR2Q 4V0BA 1Y1VG 3HGBA 5C4XB 1AZPA 1AP0A 1EFID 2WAQE 3MXNA 2PZUA 2KCCA 4HN7A 5EPLA 1E2WA 4OO1G 4B3SQ 1I4QA 1HR0Q 1TKWB 4P72A 4FVMA 4BXXH 1EU3A 2IX3A 3WDNA 1UE5A 3PQIA 1F2MA 4YCUA 5DEHA 5IT9c 3I4NH 1B50A 2KEEA 2NBFA 1B1ZA 1UEBA 1J9OA 2QEJC 4LFAQ 1VQ9A 1JOKA 5C4JH 4OL7A 1PRTD 2V4DA 1QCBD 3HOZH 4ZKCB 1T5XD 2BE5C 1VQGA 4RMFA 5IYDH 4B08A 2E2IB 1EOTA 3CHBD 4GN5A 3DLLA 1R4QB 1VQAA 4IUUA 4NPSA 2EJFC 4GKJQ 4K8JA 1EZ6A 1ONLA 1PH7A 1PH6A 4Y7NB 1N8RC 2DN8A 3KDFB 2Z1CA 4K6DA 4N9PA 2UXBL 1BCPC 5BR8Q 4NXNL 1B9NA 2HD3A 5D65A 1LYLA 4A3GH 5DAUA 1X3QA 2EYOA 3MVVA 4OWWB 3UDIA 3PIP3 1WTVA 4X3SA 4WJ3M 5EPJA 1EYDA 4Y52H 2HQEA 2HIXA 4OONA 1KQSA 3D6CA 2N3SA 1MHWC 4A3KH 4A3MG 1E3PA 4HJ8A 5FLMH 3KYHC 5K36G 4CKEA 2F4VQ 1KL9A 3A7LA 4N8X1 5G3LF 4CKBA 1M90C 4IOAA 3S1RB 3BVGA 1EEFD 3HOYH 2D2CC 1EYGA 1CT1D 1MSGA 1TQOA 3EROA 5CORA 2K50A 1TY2A 3VR4A 3WOFA 4WJ4A 3S1QH 1N36L 3MXPA 1WTOA 3HOXB 3K7AB 1GUWA 2B39A 2PW5A 1WCMB 2K6AA 4B3ML 3H0GB 2GVBA 3K57A 3F2UA 1U5KA 2OTJA 2JA7B 4LF8Q 3TDQA 2JA6B 1LM0A 4MN3A 4ZLTF 3PO2B 1SE4A 4TRDA 1IL2A 2CVRA 2ZTEA 1PRTB 1PTOF 2E74C 5K5PA 3H3VH 2H4OA 1X3GA 1CKNB 4FXKC 2ZM6L 2OEOA 2L9HA 2F0GA 2IPKD 1LO5D 2B2UA 2ICIA 2A6HD 3G71A 3DMUA 3PUZA 3K81C 5M3MG 3GTPH 3EBEA 2EVBA 2CWPA 4GLAC 4HMJA 3RR5A 4TQUS 3ULJA 3M3YH 5ELFA 1ICFB 1J5EQ 1CA5A 4HIOA 1KDAA 3L0OA 2K7VA 1LABA 5F2DA 3I4OA 2B29A 3M7GA 1NR4A 5FLXE 5FO7B 1PH2A 1PH8A 1LTID 3PIO3 3T1YQ 3ICEA 2ES2A 2I0QA 1BNZA 2N88A 3J80c 1YHQA 3DXJC 2NVQB 1GHJA 2QF7A 5M5WB 2I46A 3FVQA 4LF7Q 3SHLA 1RTNA 1B44D 3BZKA 3DWPA 4C3JG 2H5XA 4DF7A 4A3IB 5C0XI 2ZXRA 3U50C 2B2WC 5IP9G 1V9PA 4JI1Q 4OX9Q 2UU9Q 3VYRA 3K5LA 2M9VA 1KHIA 4DK3C 2RCFA 5C3XA 4S3SA 1E2VA 1F2LA 3QR8A 2OQKA 1BVSA 1NE3A 3T53B 1EY9A 3UDGA 1HUMA 1YJNA 2L1BA 2Y0SG 1JC7A 1Q81C 3RUZA 2BE5D 3S15H 1ZYRD 4R8IA 1MKHA 2VW9A
chains in the Genus database with same CATH topology
4OXPA 2PQAA 4POFA 5GROA 1L1OA 1PH5A 4A76A 4BBSG 3Q8DA 1GO3E 4MNOA 3PSIA 4R1JA 2PI2E 1WJJA 3UDXA 3ERSX 2VY3A 3B6YA 1Q7YC 1VQFA 2BA0A 1SR3A 1Z9FA 3GTJH 4JI7Q 3J7A5 1MIUA 4YWMA 5H1SE 1NJIC 4A3GG 4IFDJ 1I3QH 1B8AA 1S40A 2I5LX 2KBNA 2KCMA 4JI7L 4LF9Q 4UPAA 4LF9L 2K4KA 1YZ6A 1SN8A 4A3LG 2JK8A 3S2HH 4JCVE 1YITA 4P75A 1Q82C 3HKZE 1MJCA 4DR1Q 3TEHB 3J81i 3NBHB 4DR1L 4R4TA 4EX5A 2UUCQ 3AYHB 1IZ6A 1PFSA 1P8LA 4R4OA 1UE1A 3CMEA 2UUCL 4DR4Q 4A3KG 1GM5A 5JEAG 4DR4L 4OO1I 1HH2P 3A5ZB 4DR3Q 4YHHQ 3AQQA 3T1HQ 2K52A 4DR3L 2R92G 4YHHL 4GNXC 3T1HL 4QJFA 5FLMG 2DGYA 2E5LQ 4QQBX 4FDBA 2E5LL 4UP8A 1YNXA 4GS3A 3S1RH 3WWVA 2JA5G 3JAMi 4QGUA 1IBMQ 1X3EA 1HJPA 4X66Q 1Y1WH 2ASBA 3LGJA 2UUBQ 3GD7A 1IYJB 1T9HA 1IBML 4JI0Q 2PNHA 4YCVA 4MTNA 3PGZA 5EAYA 4X66L 2UUBL 3HOYG 4JI0L 1G291 2Z0SA 4A3EG 1HR0W 2D0PA 3RN2A 4AQYQ 1N34Q 4BBRH 3PO3H 3AFQA 3MEFA 1KIXA 1N34L 4AQYL 1XPUA 2AMCB 1X9NA 3HOVH 4DR5Q 3VDYA 3TS2A 4R4IA 5M5YH 2Z6KA 3HOXH 4DUYQ 3EIVA 4DR5L 3K7AH 3GTLH 3GTQH 2VL6A 5LMNW 1VQPA 2YTVA 1X55A 4DUYL 2MO0A 1JMCA 3K7UC 1OXVA 2JEAI 3H0GH 3G6EA 1N33Q 1EFWA 3NELA 3HOUH 4R4CA 1DGSA 1YVCA 1N33L 1OXUA 4LWCA 2JA7H 4IPDA 3CPFA 3G4SA 2ATWA 2ZTDA 5JJLA 1NY4A 5IP7G 1PA6A 2IHFA 4DPGA 2JA6H 3K0XA 3RZDH 3UE0A 3F2CA 3PO2H 3L7ZC 2UXDQ 3HFZB 4YCWA 3PUWA 4GOPB 2CWAA 2UXDL 1TWHH 4LUZA 2VS1A 3KF6B 3PIOA 1SRUA 2GN5A 4LF5Q 1P16A 1XPOA 1PH9A 4DAYB 4LF5L 2BA1A 4QL5A 3CCMA 4BY7H 1LTLA 2K14A 1CKMA 5M3FG 1VQKA 2RHSB 3CW2C 3A0JA 3UE1A 3S1MH 2XGTA 2PMZE 4BA2I 5FJ8H 3PCOB 4IOCA 2HQLA 5GADC 1IXRA 2XTIA 3PUVA 3M4PA 3TREA 5C44H 1VCIA 2ID0A 5HY6A 1GVPA 3KF6A 2OQ0A 4QY7A 4DV5Q 5JJKA 3U4ZA 1Y1VH 5C4XG 2Q2IA 4P73A 4DV5L 1NBWA 2HT1A 1KRSA 4IFDG 4X64Q 2N78A 1KD1C 2IY5B 1WFQA 1V1QA 4X64L 2NVTH 2WB1G 3CXCA 4JYAQ 1CSQA 1FGUA 5GAGC 1N32Q 3GDEA 3I2ZA 5ELOA 5C0XJ 4JYAL 1OXSC 1N32L 3H15A 5JJIA 4A4IA 1RL2A 2B63G 2NVQH 5M5WH 4LW1A 3TQYA 1YBYA 4NB3A 1B70B 1VQ7A 4UP9A 1CUKA 4A3IH 1QVGA 2Y0SE 4HJ5A 4PG3A 1VQLA 2YTXA 4DUZQ 4DR7Q 1JJCB 1YHAA 1SROA 4DUZL 4DR7L 4H02A 3KFUA 2N8NA 2CFMA 3UDFA 3J81j 4AYBE 4QIWE 1VQ4A 3PUXA 4A3FH 4IJHA 1E24A 1OTCA 4AIMA 5IE8A 1QUQB 4EQ5A 1UE7A 1QVCA 3KOJA 3DM3A 4OWTB 4DV3Q 3F2DA 3KJOA 3PUYA 4DV3L 4B3TQ 1LUZA 3F2BA 3W5OA 2CQOA 1XJVA 4B3TL 1B7YB 2Q2TA 4LUVA 2CCZA 2OTLA 3ULPA 2A8VA 1UWVA 4IO9A 1N9WA 1QZHA 2V1CC 2CKZB 1EQRA 5FLXc 2OCEA 3OW2A 2YU9H 4DR6Q 5LMUQ 4DR6L 1U0LA 5LMUL 4PZ6A 4A3DH 2YTYA 1XTDA 1QUQA 2E8GA 4L5QA 1K83H 1W2BA 2E2HH 4C3HH 1HZAA 2LSSA 5GAHC 5GAEC 3W1BA 3H3VI 3NEMA 3RLNA 1IBLQ 4A3DG 1K3RA 1WYDA 4DV6Q 1IBLL 3CPWA 1FJGQ 1X65A 4DV6L 1FJGL 1C7YA 1VQMA 2Q2UA 3HOWH 4XIGS 4L5RC 4LNQA 4PMWA 4DV2Q 3G48A 2VZAA 4LF4Q 2AWNA 1TWAH 4JI8Q 1A0IA 4APVA 4R4QA 4DV2L 1I50H 1TWFH 4LF4L 2B3GA 4JI8L 3CD6A 4KI0A 4JI2Q 4DV7Q 4HJ9A 1L1OC 3RLOA 1EUJA 1ASYA 3IRBA 4DV7L 4JI2L 4JI6Q 3CCUA 2FXQA 4JI6L 4NXMQ 3CCJA 1XMOQ 4A3MH 4NXML 5IY0A 3E0EA 2KHJA 1XMOL 3CCQA 4HIKA 2IT1A 4IFDI 1TWGH 1Q8KA 4A93H 1SLJA 1EQQA 1K73C 2OWOA 1JJGA 3KJPA 4P74A 2QGQA 3M85A 1PH4A 4B3RQ 4DV1Q 1Y1WG 4JI4Q 4A93G 4B3RL 2KENA 4IPHA 4LUOA 4DV1L 4J15A 4JI4L 4JOIA 1G6PA 4HJ7A 3I7FA 3PO3G 2MQHA 1G51A 4BBRG 1WCMH 1A62A 1GKHA 3RLFA 1CSPA 3ZJYC 3HOVG 1E1TA 2R7FA 1YEZA 5M5XH 3HKZG 1M1KC 1VQEA 1K8GA 2R7ZH 1VQBA 3D31A 3HOXG 4GN4B 5IYCH 4L5SA 2UUAQ 1YHBA 5IYBH 2K5VA 3H0GG 2UUAL 3BJUA 3HOUG 3K8AA 4C2MH 3J81c 2JA7G 2WFWA 3GTOH 4BA1I 2JA8H 1YIJA 3I55A 4UY8C 3E9HA 4JI5Q 2KCTA 1QVFA 2JA6G 4JI5L 3J80i 3CCVA 3PO2G 1MJEA 2HIVA 1H95A 1X3FA 4OWXB 1TXYA 1JJ2A 1VQHA 4DK6C 2AKWB 2RHQB 1TWCH 2Z6KC 2RCNA 1J6QA 3FKIH 4RG1A 4A3JH 4A3BH 4A3CH 3CMAA 2NZOA 3HKSA 4BY7G 3S2DH 3MXNB 1VQOA 3JAMc 1VQJA 1IBKQ 2QEXA 4L5TA 1HNZQ 1VQ8A 1NMFA 4TVAB 3JC66 5C3EH 1IBKL 4ALPA 3RN5A 3S16H 3M9BA 1E22A 1HNZL 3FP9A 3K80C 3CP0A 2RF4A 1AE3A 5M3MH 1VQIA 5FJ8G 4K0KQ 5ELNA 4K0KL 3M7NA 4UP7A 3TS0A 1KRTA 5C44G 3TRZA 4DR2Q 1EWIA 1JT8A 1HNXQ 1Y1VG 1SE8A 4DR2L 1HNXL 2R6GA 2ALYB 1X6OA 1ASZA 3STBC 2WAQE 3I4MH 3GTMH 5DLQE 1BKBA 2NN6G 4OO1G 1WOCA 2R7DA 4B3SQ 1OXTA 4JBWA 1L0WA 1HR0Q 4P72A 4B3SL 3PF4A 2AHOB 4PZ8A 4XTCS 1HR0L 4BXXH 4HIDA 1EIYB 4LFBQ 3EN2A 4LFBL 4GOPC 2VUMH 2EXDA 1KXLA 1UE5A 2HHHQ 5HGQA 4YCUA 3E9IA 5LMNQ 5IT9c 3I4NH 1XPRA 2HHHL 4A3IG 3S24A 4C3JH 5LMNL 1UEBA 1BBWA 1NMGA 2ZJQA 5IP9H 4LFAQ 1VQ9A 3M4QA 2LXJA 5C4JH 3U58A 4A3FG 4LFAL 1HZBA 2K5HA 2AWOA 3HOZH 2R93H 1VQGA 4RMFA 1XNRQ 4YY3Q 1PHJA 5IYDH 4GKKQ 1XNRL 4YY3L 1KAWA 4GKKL 1OXXK 4ME3A 4GN5A 3DLLA 1AH9A 4DV0Q 5E7NA 2A1AA 1VQAA 4NPSA 4DV0L 4GNXB 3CF5A 1E7ZA 1I5FA 1PYBA 4P71A 4C3IH 3S14H 1YJWA 1PH7A 1E1OA 4GKJQ 4GKJL 3PIPA 1PH6A 3M4OH 1RIPA 3RNUA 1N8RC 3KDFB 2UXBQ 1X56A 3CQZH 1Z47A 4BBSH 2GVAA 2UXBL 4DNIA 4NXNQ 5BR8Q 3BU2A 3BZCA 1NTGA 4NXNL 5BR8L 2L15A 3F8TA 1I6HH 2KHIA 2UXCQ 2N49A 1LYLA 4A3GH 1GD7A 4JBMA 1CKOA 4GNXA 2UXCL 2D0OA 2JQOA 3HOWG 4IJLA 2K5NA 1PV4A 4OWWB 4A3LH 1PH3A 3UDIA 3OYYA 1D7QA 4WJ3M 3KDFA 1XNQQ 3GO5A 4Y52H 1XNQL 1A8VA 1PYSB 2ZTCA 2HIXA 2BH8A 4OONA 1PH1A 1KQSA 2N3SA 4MZ9A 5IWAQ 4A3KH 4A3MG 1E3PA 3GTGH 5IWAL 4KHZA 2D62A 4HJ8A 2R92H 1W3SA 4JC0A 3KYHC 5FLMH 2F4VQ 5K36G 5C0XG 1K9MC 1KL9A 3U4VA 2NN6I 2F4VL 4DV4Q 1M90C 3CC2A 4IOAA 2JA5H 4DV4L 3SGIA 1Q1BA 3HOYH 4POGA 1O7IA 4GN3B 1EYGA 4GLXA 4A3EH 3ER0A 1WCMG 2K50A 1N36Q 1HZ9A 1XMQQ 4WJ4A 3S1QH 1Q86C 1N36L 1XMQL 1YJ9A 3S1NH 2R7ZG 4JG2A 1EOVA 1QZGA 2DUDA 5IYCG 1C9OA 4B3MQ 5IYBG 2K75A 2PI2A 1SMXA 1VQDA 4B3ML 4X6AH 3CCRA 2GVBA 1U5KA 1VS0A 1R9TH 2OTJA 3CCSA 4KHPQ 3KLWA 1WI5A 1L2FA 3F1ZA 3L2PA 1JB7A 2JA8G 4KHPL 5IP7H 5J3BA 4LF8Q 2I5HA 4JOIC 2IHEA 1LM0A 4LF8L 1VQCA 1IL2A 4LFCQ 3CC4A 1BBUA 2WB1E 2ZTEA 2NVXH 3S17H 4LFCL 4A3JG 3H3VH 1FL0A 3A74A 3FKIG 1X3GA 2ZM6Q 1CKNB 4A3BG 4A3CG 3CCLA 2ZM6L 3CC7A 5M3FH 1UE6A 1X54A 4YWLA 2F3IA 1KC8C 1HZCA 1C0AA 2JJQA 5C3EG 1S3OA 2MFIA 3G71A 1SFOH 3PUZA 2JE6I 3K81C 5M3MG 3GTPH 3RZOH 1VQ5A 3EBEA 4A75A 2CWPA 4PZ7A 3GTKH 2A19A 4GLAC 3CCEA 2C35B 2YV5A 2ZJRA 1I94Q 3RR5A 4TQUS 5JEAJ 3ULJA 3M3YH 1I94L 1V43A 1J5EQ 4DAMA 4HIOA 3L0OA 2JEBI 3I4OA 2MO1A 1J5EL 5C4XH 2E2JH 2B29A 1Q1EA 1CKNA 2ZJPA 1A63A 1PH2A 4KLKA 4GOPA 3I4MG 2NZHA 1PH8A 4BY1H 1HNWQ 3T1YQ 3ICEA 2ES2A 1K0RA 1HNWL 2I0QA 4JBJA 3T1YL 1YI2A 2QA4A 3J80c 2NVYH 1K8AC 2EQSA 1YHQA 4GLVB 3NENA 2B63H 4BY1G 4BXXG 1EIFA 3STBD 4JV5Q 3AEVA 3ULLA 3A5UA 4HJAA 4JV5L 3D0FA 2VUMG 4LF7Q 2VQEQ 1Q46A 3PF5A 3I4NG 4IPCA 4LF7L 2VQEL 3BZKA 2H5XA 2YYZA 3PV0A 4AH6A 5C0XI 3U50C 3W1GA 5AJ3Q 5GQOA 2JA9A 3CAMA 5AJ3L 1PVOA 5IP9G 1V9PA 2WP8J 4JI1Q 2MNAA 4OX9Q 2UU9Q 4X62Q 4JI1L 2BH2A 3KF8B 4OX9L 2UU9L 4X62L 1AE2A 4DKAC 2WAQG 1KHIA 4YWKA 4DK3C 2PQAB 3AFPA 2VQFQ 1L1OB 4LF6Q 2IX0A 2VQFL 3FHWA 3HOZG 2E2IH 2F52A 5IYDG 2R93G 4JI3Q 4LF6L 2IX1A 1D8LA 4JI3L 2OQKA 3OTOQ 2Q2HA 1VQNA 1BVSA 1Y14B 4O0AA 3J7ZC 3I56A 3OTOL 1NE3A 1VQ6A 2EIFA 2I5MX 3UDGA 1YJNA 2Y0SG 4X65Q 4O2DA 1S72A 1Q81C 4X65L 2VNUD 3S15H 1JE5A 4JBKA 1FVIA 2LXKA 4Y7NH 4IPGA 4AYBG 4HIMA 1MKHA 2VW9A 1Q12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OXP A;  2PQA A;  4POF A;  5GRO A;  1L1O A;  1PH5 A;  4A76 A;  4BBS G;  3Q8D A;  1GO3 E;  4MNO A;  3PSI A;  4R1J A;  2PI2 E;  1WJJ A;  3UDX A;  3ERS X;  2VY3 A;  3B6Y A;  1Q7Y C;  1VQF A;  2BA0 A;  1SR3 A;  1Z9F A;  3GTJ H;  4JI7 Q;  3J7A 5;  1MIU A;  4YWM A;  5H1S E;  1NJI C;  4A3G G;  4IFD J;  1I3Q H;  1B8A A;  1S40 A;  2I5L X;  2KBN A;  2KCM A;  4JI7 L;  4LF9 Q;  4UPA A;  4LF9 L;  2K4K A;  1YZ6 A;  1SN8 A;  4A3L G;  2JK8 A;  3S2H H;  4JCV E;  1YIT A;  4P75 A;  1Q82 C;  3HKZ E;  1MJC A;  4DR1 Q;  3TEH B;  3J81 i;  3NBH B;  4DR1 L;  4R4T A;  4EX5 A;  2UUC Q;  3AYH B;  1IZ6 A;  1PFS A;  1P8L A;  4R4O A;  1UE1 A;  3CME A;  2UUC L;  4DR4 Q;  4A3K G;  1GM5 A;  5JEA G;  4DR4 L;  4OO1 I;  1HH2 P;  3A5Z B;  4DR3 Q;  4YHH Q;  3AQQ A;  3T1H Q;  2K52 A;  4DR3 L;  2R92 G;  4YHH L;  4GNX C;  3T1H L;  4QJF A;  5FLM G;  2DGY A;  2E5L Q;  4QQB X;  4FDB A;  2E5L L;  4UP8 A;  1YNX A;  4GS3 A;  3S1R H;  3WWV A;  2JA5 G;  3JAM i;  4QGU A;  1IBM Q;  1X3E A;  1HJP A;  4X66 Q;  1Y1W H;  2ASB A;  3LGJ A;  2UUB Q;  3GD7 A;  1IYJ B;  1T9H A;  1IBM L;  4JI0 Q;  2PNH A;  4YCV A;  4MTN A;  3PGZ A;  5EAY A;  4X66 L;  2UUB L;  3HOY G;  4JI0 L;  1G29 1;  2Z0S A;  4A3E G;  1HR0 W;  2D0P A;  3RN2 A;  4AQY Q;  1N34 Q;  4BBR H;  3PO3 H;  3AFQ A;  3MEF A;  1KIX A;  1N34 L;  4AQY L;  1XPU A;  2AMC B;  1X9N A;  3HOV H;  4DR5 Q;  3VDY A;  3TS2 A;  4R4I A;  5M5Y H;  2Z6K A;  3HOX H;  4DUY Q;  3EIV A;  4DR5 L;  3K7A H;  3GTL H;  3GTQ H;  2VL6 A;  5LMN W;  1VQP A;  2YTV A;  1X55 A;  4DUY L;  2MO0 A;  1JMC A;  3K7U C;  1OXV A;  2JEA I;  3H0G H;  3G6E A;  1N33 Q;  1EFW A;  3NEL A;  3HOU H;  4R4C A;  1DGS A;  1YVC A;  1N33 L;  1OXU A;  4LWC A;  2JA7 H;  4IPD A;  3CPF A;  3G4S A;  2ATW A;  2ZTD A;  5JJL A;  1NY4 A;  5IP7 G;  1PA6 A;  2IHF A;  4DPG A;  2JA6 H;  3K0X A;  3RZD H;  3UE0 A;  3F2C A;  3PO2 H;  3L7Z C;  2UXD Q;  3HFZ B;  4YCW A;  3PUW A;  4GOP B;  2CWA A;  2UXD L;  1TWH H;  4LUZ A;  2VS1 A;  3KF6 B;  3PIO A;  1SRU A;  2GN5 A;  4LF5 Q;  1P16 A;  1XPO A;  1PH9 A;  4DAY B;  4LF5 L;  2BA1 A;  4QL5 A;  3CCM A;  4BY7 H;  1LTL A;  2K14 A;  1CKM A;  5M3F G;  1VQK A;  2RHS B;  3CW2 C;  3A0J A;  3UE1 A;  3S1M H;  2XGT A;  2PMZ E;  4BA2 I;  5FJ8 H;  3PCO B;  4IOC A;  2HQL A;  5GAD C;  1IXR A;  2XTI A;  3PUV A;  3M4P A;  3TRE A;  5C44 H;  1VCI A;  2ID0 A;  5HY6 A;  1GVP A;  3KF6 A;  2OQ0 A;  4QY7 A;  4DV5 Q;  5JJK A;  3U4Z A;  1Y1V H;  5C4X G;  2Q2I A;  4P73 A;  4DV5 L;  1NBW A;  2HT1 A;  1KRS A;  4IFD G;  4X64 Q;  2N78 A;  1KD1 C;  2IY5 B;  1WFQ A;  1V1Q A;  4X64 L;  2NVT H;  2WB1 G;  3CXC A;  4JYA Q;  1CSQ A;  1FGU A;  5GAG C;  1N32 Q;  3GDE A;  3I2Z A;  5ELO A;  5C0X J;  4JYA L;  1OXS C;  1N32 L;  3H15 A;  5JJI A;  4A4I A;  1RL2 A;  2B63 G;  2NVQ H;  5M5W H;  4LW1 A;  3TQY A;  1YBY A;  4NB3 A;  1B70 B;  1VQ7 A;  4UP9 A;  1CUK A;  4A3I H;  1QVG A;  2Y0S E;  4HJ5 A;  4PG3 A;  1VQL A;  2YTX A;  4DUZ Q;  4DR7 Q;  1JJC B;  1YHA A;  1SRO A;  4DUZ L;  4DR7 L;  4H02 A;  3KFU A;  2N8N A;  2CFM A;  3UDF A;  3J81 j;  4AYB E;  4QIW E;  1VQ4 A;  3PUX A;  4A3F H;  4IJH A;  1E24 A;  1OTC A;  4AIM A;  5IE8 A;  1QUQ B;  4EQ5 A;  1UE7 A;  1QVC A;  3KOJ A;  3DM3 A;  4OWT B;  4DV3 Q;  3F2D A;  3KJO A;  3PUY A;  4DV3 L;  4B3T Q;  1LUZ A;  3F2B A;  3W5O A;  2CQO A;  1XJV A;  4B3T L;  1B7Y B;  2Q2T A;  4LUV A;  2CCZ A;  2OTL A;  3ULP A;  2A8V A;  1UWV A;  4IO9 A;  1N9W A;  1QZH A;  2V1C C;  2CKZ B;  1EQR A;  5FLX c;  2OCE A;  3OW2 A;  2YU9 H;  4DR6 Q;  5LMU Q;  4DR6 L;  1U0L A;  5LMU L;  4PZ6 A;  4A3D H;  2YTY A;  1XTD A;  1QUQ A;  2E8G A;  4L5Q A;  1K83 H;  1W2B A;  2E2H H;  4C3H H;  1HZA A;  2LSS A;  5GAH C;  5GAE C;  3W1B A;  3H3V I;  3NEM A;  3RLN A;  1IBL Q;  4A3D G;  1K3R A;  1WYD A;  4DV6 Q;  1IBL L;  3CPW A;  1FJG Q;  1X65 A;  4DV6 L;  1FJG L;  1C7Y A;  1VQM A;  2Q2U A;  3HOW H;  4XIG S;  4L5R C;  4LNQ A;  4PMW A;  4DV2 Q;  3G48 A;  2VZA A;  4LF4 Q;  2AWN A;  1TWA H;  4JI8 Q;  1A0I A;  4APV A;  4R4Q A;  4DV2 L;  1I50 H;  1TWF H;  4LF4 L;  2B3G A;  4JI8 L;  3CD6 A;  4KI0 A;  4JI2 Q;  4DV7 Q;  4HJ9 A;  1L1O C;  3RLO A;  1EUJ A;  1ASY A;  3IRB A;  4DV7 L;  4JI2 L;  4JI6 Q;  3CCU A;  2FXQ A;  4JI6 L;  4NXM Q;  3CCJ A;  1XMO Q;  4A3M H;  4NXM L;  5IY0 A;  3E0E A;  2KHJ A;  1XMO L;  3CCQ A;  4HIK A;  2IT1 A;  4IFD I;  1TWG H;  1Q8K A;  4A93 H;  1SLJ A;  1EQQ A;  1K73 C;  2OWO A;  1JJG A;  3KJP A;  4P74 A;  2QGQ A;  3M85 A;  1PH4 A;  4B3R Q;  4DV1 Q;  1Y1W G;  4JI4 Q;  4A93 G;  4B3R L;  2KEN A;  4IPH A;  4LUO A;  4DV1 L;  4J15 A;  4JI4 L;  4JOI A;  1G6P A;  4HJ7 A;  3I7F A;  3PO3 G;  2MQH A;  1G51 A;  4BBR G;  1WCM H;  1A62 A;  1GKH A;  3RLF A;  1CSP A;  3ZJY C;  3HOV G;  1E1T A;  2R7F A;  1YEZ A;  5M5X H;  3HKZ G;  1M1K C;  1VQE A;  1K8G A;  2R7Z H;  1VQB A;  3D31 A;  3HOX G;  4GN4 B;  5IYC H;  4L5S A;  2UUA Q;  1YHB A;  5IYB H;  2K5V A;  3H0G G;  2UUA L;  3BJU A;  3HOU G;  3K8A A;  4C2M H;  3J81 c;  2JA7 G;  2WFW A;  3GTO H;  4BA1 I;  2JA8 H;  1YIJ A;  3I55 A;  4UY8 C;  3E9H A;  4JI5 Q;  2KCT A;  1QVF A;  2JA6 G;  4JI5 L;  3J80 i;  3CCV A;  3PO2 G;  1MJE A;  2HIV A;  1H95 A;  1X3F A;  4OWX B;  1TXY A;  1JJ2 A;  1VQH A;  4DK6 C;  2AKW B;  2RHQ B;  1TWC H;  2Z6K C;  2RCN A;  1J6Q A;  3FKI H;  4RG1 A;  4A3J H;  4A3B H;  4A3C H;  3CMA A;  2NZO A;  3HKS A;  4BY7 G;  3S2D H;  3MXN B;  1VQO A;  3JAM c;  1VQJ A;  1IBK Q;  2QEX A;  4L5T A;  1HNZ Q;  1VQ8 A;  1NMF A;  4TVA B;  3JC6 6;  5C3E H;  1IBK L;  4ALP A;  3RN5 A;  3S16 H;  3M9B A;  1E22 A;  1HNZ L;  3FP9 A;  3K80 C;  3CP0 A;  2RF4 A;  1AE3 A;  5M3M H;  1VQI A;  5FJ8 G;  4K0K Q;  5ELN A;  4K0K L;  3M7N A;  4UP7 A;  3TS0 A;  1KRT A;  5C44 G;  3TRZ A;  4DR2 Q;  1EWI A;  1JT8 A;  1HNX Q;  1Y1V G;  1SE8 A;  4DR2 L;  1HNX L;  2R6G A;  2ALY B;  1X6O A;  1ASZ A;  3STB C;  2WAQ E;  3I4M H;  3GTM H;  5DLQ E;  1BKB A;  2NN6 G;  4OO1 G;  1WOC A;  2R7D A;  4B3S Q;  1OXT A;  4JBW A;  1L0W A;  1HR0 Q;  4P72 A;  4B3S L;  3PF4 A;  2AHO B;  4PZ8 A;  4XTC S;  1HR0 L;  4BXX H;  4HID A;  1EIY B;  4LFB Q;  3EN2 A;  4LFB L;  4GOP C;  2VUM H;  2EXD A;  1KXL A;  1UE5 A;  2HHH Q;  5HGQ A;  4YCU A;  3E9I A;  5LMN Q;  5IT9 c;  3I4N H;  1XPR A;  2HHH L;  4A3I G;  3S24 A;  4C3J H;  5LMN L;  1UEB A;  1BBW A;  1NMG A;  2ZJQ A;  5IP9 H;  4LFA Q;  1VQ9 A;  3M4Q A;  2LXJ A;  5C4J H;  3U58 A;  4A3F G;  4LFA L;  1HZB A;  2K5H A;  2AWO A;  3HOZ H;  2R93 H;  1VQG A;  4RMF A;  1XNR Q;  4YY3 Q;  1PHJ A;  5IYD H;  4GKK Q;  1XNR L;  4YY3 L;  1KAW A;  4GKK L;  1OXX K;  4ME3 A;  4GN5 A;  3DLL A;  1AH9 A;  4DV0 Q;  5E7N A;  2A1A A;  1VQA A;  4NPS A;  4DV0 L;  4GNX B;  3CF5 A;  1E7Z A;  1I5F A;  1PYB A;  4P71 A;  4C3I H;  3S14 H;  1YJW A;  1PH7 A;  1E1O A;  4GKJ Q;  4GKJ L;  3PIP A;  1PH6 A;  3M4O H;  1RIP A;  3RNU A;  1N8R C;  3KDF B;  2UXB Q;  1X56 A;  3CQZ H;  1Z47 A;  4BBS H;  2GVA A;  2UXB L;  4DNI A;  4NXN Q;  5BR8 Q;  3BU2 A;  3BZC A;  1NTG A;  4NXN L;  5BR8 L;  2L15 A;  3F8T A;  1I6H H;  2KHI A;  2UXC Q;  2N49 A;  1LYL A;  4A3G H;  1GD7 A;  4JBM A;  1CKO A;  4GNX A;  2UXC L;  2D0O A;  2JQO A;  3HOW G;  4IJL A;  2K5N A;  1PV4 A;  4OWW B;  4A3L H;  1PH3 A;  3UDI A;  3OYY A;  1D7Q A;  4WJ3 M;  3KDF A;  1XNQ Q;  3GO5 A;  4Y52 H;  1XNQ L;  1A8V A;  1PYS B;  2ZTC A;  2HIX A;  2BH8 A;  4OON A;  1PH1 A;  1KQS A;  2N3S A;  4MZ9 A;  5IWA Q;  4A3K H;  4A3M G;  1E3P A;  3GTG H;  5IWA L;  4KHZ A;  2D62 A;  4HJ8 A;  2R92 H;  1W3S A;  4JC0 A;  3KYH C;  5FLM H;  2F4V Q;  5K36 G;  5C0X G;  1K9M C;  1KL9 A;  3U4V A;  2NN6 I;  2F4V L;  4DV4 Q;  1M90 C;  3CC2 A;  4IOA A;  2JA5 H;  4DV4 L;  3SGI A;  1Q1B A;  3HOY H;  4POG A;  1O7I A;  4GN3 B;  1EYG A;  4GLX A;  4A3E H;  3ER0 A;  1WCM G;  2K50 A;  1N36 Q;  1HZ9 A;  1XMQ Q;  4WJ4 A;  3S1Q H;  1Q86 C;  1N36 L;  1XMQ L;  1YJ9 A;  3S1N H;  2R7Z G;  4JG2 A;  1EOV A;  1QZG A;  2DUD A;  5IYC G;  1C9O A;  4B3M Q;  5IYB G;  2K75 A;  2PI2 A;  1SMX A;  1VQD A;  4B3M L;  4X6A H;  3CCR A;  2GVB A;  1U5K A;  1VS0 A;  1R9T H;  2OTJ A;  3CCS A;  4KHP Q;  3KLW A;  1WI5 A;  1L2F A;  3F1Z A;  3L2P A;  1JB7 A;  2JA8 G;  4KHP L;  5IP7 H;  5J3B A;  4LF8 Q;  2I5H A;  4JOI C;  2IHE A;  1LM0 A;  4LF8 L;  1VQC A;  1IL2 A;  4LFC Q;  3CC4 A;  1BBU A;  2WB1 E;  2ZTE A;  2NVX H;  3S17 H;  4LFC L;  4A3J G;  3H3V H;  1FL0 A;  3A74 A;  3FKI G;  1X3G A;  2ZM6 Q;  1CKN B;  4A3B G;  4A3C G;  3CCL A;  2ZM6 L;  3CC7 A;  5M3F H;  1UE6 A;  1X54 A;  4YWL A;  2F3I A;  1KC8 C;  1HZC A;  1C0A A;  2JJQ A;  5C3E G;  1S3O A;  2MFI A;  3G71 A;  1SFO H;  3PUZ A;  2JE6 I;  3K81 C;  5M3M G;  3GTP H;  3RZO H;  1VQ5 A;  3EBE A;  4A75 A;  2CWP A;  4PZ7 A;  3GTK H;  2A19 A;  4GLA C;  3CCE A;  2C35 B;  2YV5 A;  2ZJR A;  1I94 Q;  3RR5 A;  4TQU S;  5JEA J;  3ULJ A;  3M3Y H;  1I94 L;  1V43 A;  1J5E Q;  4DAM A;  4HIO A;  3L0O A;  2JEB I;  3I4O A;  2MO1 A;  1J5E L;  5C4X H;  2E2J H;  2B29 A;  1Q1E A;  1CKN A;  2ZJP A;  1A63 A;  1PH2 A;  4KLK A;  4GOP A;  3I4M G;  2NZH A;  1PH8 A;  4BY1 H;  1HNW Q;  3T1Y Q;  3ICE A;  2ES2 A;  1K0R A;  1HNW L;  2I0Q A;  4JBJ A;  3T1Y L;  1YI2 A;  2QA4 A;  3J80 c;  2NVY H;  1K8A C;  2EQS A;  1YHQ A;  4GLV B;  3NEN A;  2B63 H;  4BY1 G;  4BXX G;  1EIF A;  3STB D;  4JV5 Q;  3AEV A;  3ULL A;  3A5U A;  4HJA A;  4JV5 L;  3D0F A;  2VUM G;  4LF7 Q;  2VQE Q;  1Q46 A;  3PF5 A;  3I4N G;  4IPC A;  4LF7 L;  2VQE L;  3BZK A;  2H5X A;  2YYZ A;  3PV0 A;  4AH6 A;  5C0X I;  3U50 C;  3W1G A;  5AJ3 Q;  5GQO A;  2JA9 A;  3CAM A;  5AJ3 L;  1PVO A;  5IP9 G;  1V9P A;  2WP8 J;  4JI1 Q;  2MNA A;  4OX9 Q;  2UU9 Q;  4X62 Q;  4JI1 L;  2BH2 A;  3KF8 B;  4OX9 L;  2UU9 L;  4X62 L;  1AE2 A;  4DKA C;  2WAQ G;  1KHI A;  4YWK A;  4DK3 C;  2PQA B;  3AFP A;  2VQF Q;  1L1O B;  4LF6 Q;  2IX0 A;  2VQF L;  3FHW A;  3HOZ G;  2E2I H;  2F52 A;  5IYD G;  2R93 G;  4JI3 Q;  4LF6 L;  2IX1 A;  1D8L A;  4JI3 L;  2OQK A;  3OTO Q;  2Q2H A;  1VQN A;  1BVS A;  1Y14 B;  4O0A A;  3J7Z C;  3I56 A;  3OTO L;  1NE3 A;  1VQ6 A;  2EIF A;  2I5M X;  3UDG A;  1YJN A;  2Y0S G;  4X65 Q;  4O2D A;  1S72 A;  1Q81 C;  4X65 L;  2VNU D;  3S15 H;  1JE5 A;  4JBK A;  1FVI A;  2LXK A;  4Y7N H;  4IPG A;  4AYB G;  4HIM A;  1MKH A;  2VW9 A;  1Q12 A; 
#chains in the Genus database with same CATH topology
 2F0P A;  2PQA A;  4POF A;  1TY0 A;  4MNO A;  1GO3 E;  4FP5 D;  3A54 A;  4R1J A;  2PI2 E;  3N52 A;  3ERS X;  1Z9F A;  1PFM A;  2F3W A;  1I3Q H;  1B8A A;  2KCM A;  4UPA A;  4LF9 L;  1BCP D;  2G9D A;  4A3L G;  3S2H H;  5COY A;  4JCV E;  5IGF A;  4P75 A;  3HKZ E;  3TEH B;  1NUC A;  1H9J A;  1QOH A;  1QJO A;  2RVL A;  5JAV A;  1F2Y A;  3AYH B;  1STG A;  1UE1 A;  1GM5 A;  5JEA G;  4DR3 Q;  1AFP A;  5FO8 B;  4YHH L;  2Q8R E;  4KMU C;  2E5L L;  3MFG A;  4GS3 A;  3CRL C;  2KOL A;  2ASB A;  3JAM i;  2B8F A;  1A2U A;  1IBM Q;  4QQB X;  3LGJ A;  2UUB Q;  1Z6H A;  5JVH 3;  2PNH A;  4JI0 Q;  4MTN A;  3AMU A;  1LTT D;  3K5M A;  4A3E G;  3PO3 H;  4BBR H;  3AFQ A;  4IUV A;  1XPU A;  1U9R A;  4AQY L;  1N34 L;  2R61 A;  3HOV H;  5J22 A;  4R4I A;  2A69 C;  4KJO A;  3VR6 A;  3SVM A;  4DUY Q;  1Q90 A;  4KHV A;  1XWE A;  2KJX A;  1SNC A;  1SJH D;  3G6E A;  1I4H A;  3HOU H;  4DAP A;  4R4C A;  1DGS A;  4L8J A;  2L4N A;  3C46 A;  1ENA A;  1FNV A;  5JJL A;  2ZTD A;  2D5D A;  5IP7 G;  4RH6 A;  4FO2 A;  3UE0 A;  3L7Z C;  1V1O A;  4YCW A;  1X32 A;  1SSO A;  3IAY A;  5I9P A;  4DAV A;  1ML0 D;  5CYU A;  4H44 C;  3WOE A;  4A3J B;  4LF5 L;  1MD2 D;  2K28 A;  1CKM A;  5M3F G;  3S1M H;  2SEB D;  3HP3 A;  4RA8 A;  2RQX A;  2X6G A;  5HY6 A;  1F9P A;  2TMP A;  5JJK A;  1Y1V H;  2OF1 A;  3LWU A;  4DAY A;  3MXG A;  4P73 A;  4DV5 L;  2WKD A;  3I4M B;  1V1P A;  2WB1 G;  2B2U C;  2CH4 W;  1CSQ A;  1OXS C;  5JJI A;  1BCP B;  3TQY A;  1BQQ T;  1WTR A;  2VUM B;  3J81 L;  1SNM A;  4RCN A;  4PG3 A;  5CBE E;  3VA7 A;  2YTX A;  4DR7 Q;  1EY5 A;  5EKK A;  1JJC B;  4DUZ L;  4AYB E;  1WD1 A;  1VQ4 A;  2FFK B;  3N6R A;  1OTC A;  1QUQ B;  3CRK C;  4DV3 Q;  4GZY C;  1CHQ D;  4HSV A;  1B2T A;  2K1B A;  1ENF A;  4B3T L;  4LUV A;  1UWV A;  4IO9 A;  1QZH A;  1U4L A;  5FLX c;  4DR6 Q;  1EQR A;  2OCE A;  3HRZ C;  4C3I B;  2YU9 H;  2D9U A;  2F0I A;  2ZXO A;  1HTP A;  1W6J A;  1LT5 D;  2E8G A;  2RSN A;  3S15 B;  4BBS B;  1EQV A;  3NTI A;  1O78 A;  2F0U A;  3J81 E;  4A3D G;  3NEM A;  1RCV D;  4DV6 Q;  2EXZ A;  4CHT B;  1I6H B;  1I4P A;  1FJG L;  3NP8 A;  4U67 3;  3I73 A;  1OO9 B;  4LNQ A;  4PMW A;  3G48 A;  1FYC A;  5ELB A;  1TWA H;  4JI8 Q;  4MIU A;  4DV2 L;  4R4Q A;  1TWF H;  2B3G A;  5IT9 L;  3A8I E;  1LTR D;  5L37 A;  4JI2 Q;  4DV7 Q;  1EUJ A;  2LFN A;  4F7X A;  1H9S B;  3I8Z A;  3S2H B;  1XMO Q;  4A3M H;  4OIJ A;  2AUJ D;  1A3T A;  3E0E A;  5IY0 A;  3CCQ A;  3GTG B;  1TWG H;  4IFD I;  2MGS A;  4A93 H;  1SMY C;  5K36 H;  3EQL C;  2PO4 A;  4CGY B;  3FDT A;  3KJP A;  5EPK A;  2E76 C;  2Q8I B;  1Y1W G;  2JA5 B;  4B3R L;  2Z6B A;  4LUO A;  4IPH A;  4JI4 L;  1IYU A;  4HJ7 A;  1G51 A;  1V8Q A;  3G6J B;  1E1T A;  5M5X H;  1VQB A;  2J7Z A;  3D31 A;  3S1N B;  4FXD A;  4ZYS A;  2QKI C;  4GN4 B;  2KVM A;  3T13 A;  3PMF A;  4I7A A;  4OIK A;  3HOV B;  2AQ2 B;  3NK9 A;  4KV6 A;  4HMI A;  2A69 D;  1R9T B;  4UY8 C;  3TP6 A;  3E9H A;  4JI5 Q;  2KCT A;  4PNY A;  1O7Z A;  5NUC A;  1SJE D;  3CCV A;  1H95 A;  3SEB A;  3OOC A;  1STH A;  1B3Q A;  2NVX B;  1J6Q A;  3S17 B;  2NZO A;  3HKS A;  3Q22 A;  4BY7 G;  4R8N A;  3MXN B;  1VMC A;  1VQJ A;  2QEX A;  1VQ8 A;  3QO2 A;  1E22 A;  3MEH A;  1SE3 A;  1HNZ L;  2SNS A;  5FJ8 G;  3H91 A;  5M3M H;  1VQI A;  4K0K Q;  1SFO B;  1EIH A;  2QIL A;  1KRT A;  5C44 G;  3TRZ A;  4CDE C;  4L63 B;  2IL8 A;  3H09 A;  1HNX Q;  1JT8 A;  1ET6 A;  3NBI A;  4NP5 A;  2ALY B;  1CM9 A;  1TS5 A;  3NPP A;  4IUQ A;  1PTO C;  3GTM H;  2EYL A;  5DLQ E;  2FIN B;  3GV6 A;  2NN6 G;  1Y1V B;  1OXT A;  4JBW A;  1L0W A;  3PF4 A;  4PZ8 A;  2B63 B;  4LFB L;  4GOP C;  1GUO A;  5HGQ A;  3E9I A;  2F0J A;  2HHH L;  3S24 A;  4C3J H;  5LMN L;  1TII D;  1RD9 D;  3A8K E;  2DJG C;  5IP9 H;  4H0L C;  2FMM A;  2LXJ A;  2L12 A;  1HZB A;  4LAA A;  4JVZ A;  5E3F A;  3J7A F;  2AWO A;  3DEO A;  1XNR Q;  1XXG A;  4YY3 L;  4GKK L;  1OXX K;  3D4W A;  1TU2 B;  4DV0 L;  2DY8 A;  3OIQ A;  3CF5 A;  2R3Z A;  3S14 H;  4EGV A;  3MFY A;  4NDX A;  1RIP A;  3SK6 A;  4KK7 A;  1X56 A;  3CQZ H;  1Z47 A;  3IL8 A;  4C3H G;  2VXW A;  1DCZ A;  3DHQ A;  2XRS D;  2UXC Q;  3J80 L;  1CKO A;  4QF4 A;  2MUY A;  1PV4 A;  4A3L H;  1CZW A;  1PH3 A;  1BF4 A;  3OYY A;  2IJ0 A;  3FPU B;  1D7Q A;  1XNQ Q;  1A8V A;  3R2I A;  5CV6 A;  3MC0 B;  4KY5 A;  4MZ9 A;  5JEA H;  2F0Q A;  2NZ1 D;  5IWA L;  3J7A V;  1FD7 D;  3D4D A;  4JC0 A;  4QB4 A;  2K01 A;  1EQT A;  3NXW A;  4DV4 Q;  3DM1 A;  3U9S A;  4IUP A;  4RKB A;  1JOR A;  3M4Y A;  3SGI A;  1Q1B A;  2JYO A;  4A93 B;  3V2T A;  5C5L A;  1SMY D;  4GN3 B;  3T56 B;  5BN5 A;  4A3E H;  1SE2 A;  3ER0 A;  4KD3 A;  3EVQ A;  4ULL A;  1FR3 A;  5CMD A;  1I4R A;  1XMQ L;  1YJ9 A;  3J80 E;  2R7Z G;  4JG2 A;  3GTL B;  3GTQ B;  2K75 A;  2PI2 A;  3ND9 A;  2QDL A;  3CCR A;  3CCS A;  3KLW A;  3ERQ A;  4XQJ A;  1WI5 A;  1L2F A;  3TSS A;  2PYK A;  1JB7 A;  2A6H C;  5IP7 H;  2JA8 G;  4K2L A;  4KHP L;  1I6V C;  4LFC Q;  2WB1 E;  1TWH B;  1STE A;  2K03 A;  4XXE A;  1FL0 A;  3A74 A;  3FKI G;  5CC4 A;  2LS0 1;  5M3F H;  1ILP A;  1CHP D;  4YWL A;  2F3I A;  3SDZ A;  5C3E G;  2PQE A;  2F0F A;  4A75 A;  4PZ7 A;  5CBA E;  1HHV A;  1JB3 A;  2C35 B;  2YV5 A;  4H7B A;  5JEA J;  1I94 L;  4DAM A;  2JEB I;  3KUP A;  2E2J H;  2RKS A;  1Q1E A;  1F9S A;  2ZJP A;  1A63 A;  1A3V A;  4G7Z C;  2GA4 B;  1HNW Q;  2JP1 A;  1DXM A;  2EYF A;  4LK1 C;  1BR9 A;  2NVT B;  3U9O A;  2VB3 X;  2NVY H;  4GLV B;  3NEN A;  4BY1 G;  1L0X B;  1PTO D;  3ULL A;  4JV5 L;  3D0F A;  1VDZ A;  1FNW A;  1Q46 A;  3PF5 A;  1QNK A;  2VQE L;  3H3V C;  3W1G A;  5AJ3 Q;  1SYB A;  3CAM A;  4N8F A;  5JJZ A;  2MNA A;  1ZYR C;  2FMC A;  1STN A;  4DNR B;  5D3D A;  4A3F B;  3QWN A;  4X62 L;  1AE2 A;  3OWE B;  1D1I A;  2PQA B;  1ENC A;  4LF6 Q;  2VQF L;  3FHW A;  2R93 G;  3SK4 A;  4JI3 Q;  2IX1 A;  1D8L A;  3OTO Q;  1Y14 B;  4M8A A;  1STY A;  1VQ6 A;  2I5M X;  3EA6 A;  4PMB A;  4Q0F A;  4X65 L;  1SBB B;  2B2V A;  1A3U A;  1JE5 A;  1FVI A;  1JWM D;  1TS3 A;  2LXK A;  1MI2 A;  4RAU C;  4AYB G;  4B9W A;  4HIM A;  5FO9 B;  2Y0S B;  5I2X A;  5KRU A;  1KLU D;  2MJ8 A;  4OXP A;  5GRO A;  3I72 A;  4X3T A;  4A76 A;  1K83 B;  3PSI A;  2E2H B;  1S5C D;  1WJJ A;  4XQN A;  3UDX A;  3B6Y A;  4RKL A;  1VQF A;  1SR3 A;  3GTJ H;  1MIU A;  5H1S E;  4JI7 L;  2I5L X;  4P2C B;  1YZ6 A;  1SN8 A;  3HOW B;  5KIX A;  1YIT A;  3V05 A;  1D1K A;  1MJC A;  1PZK D;  3J81 i;  4DR1 L;  3HG9 A;  5J39 A;  3OWF A;  4EX5 A;  2UUC Q;  1PFS A;  1P8L A;  4R4O A;  1D5X C;  3CME A;  1STB A;  4DR4 Q;  1G6Z A;  2PCF B;  1PZJ D;  4PQX A;  1WTX A;  2LMC B;  3T1H Q;  2K52 A;  2R92 G;  2BDO A;  2RSO A;  4FDB A;  4KY6 A;  4F88 A;  1X3E A;  1Y1W H;  3GD7 A;  5ELE A;  4X66 L;  4YCV A;  5EAY A;  3NBH A;  2HCC A;  1G29 1;  3L9A X;  1EYC A;  5FLX L;  1KIX A;  3TS2 A;  3VDY A;  1LT4 D;  5M5Y H;  4DR5 L;  2VL6 A;  5BN3 A;  5LMN W;  1VQP A;  3NUC A;  2KED A;  1JMC A;  3TZU A;  2JEA I;  1PTO B;  2CW0 D;  3NEL A;  1LT3 D;  1YVC A;  1N33 L;  1OXU A;  3CPF A;  1PXU A;  2IHF A;  4DPG A;  3K0X A;  3RZD H;  1DOL A;  5JPN C;  4GOP B;  2CWA A;  2UXD L;  1SRU A;  5CV5 A;  1P16 A;  4DAY B;  2O2L D;  2BA1 A;  4QL5 A;  4XYQ A;  4BY7 H;  2K14 A;  4A3B B;  1VQK A;  3CW2 C;  4HR7 B;  1V1P B;  3A0J A;  1A2T A;  5FJ8 H;  1QWY A;  3FPP A;  3GQB A;  3PCO B;  2EJM A;  3MA2 B;  5GAD C;  1IXR A;  1HQR D;  4RHS A;  5EBC A;  3M4P A;  5C44 H;  1VCI A;  2EYH A;  2ID0 A;  3A56 A;  3KF6 A;  1BXT A;  5C4X G;  1E2Z A;  2Q2I A;  3MAQ A;  2EYM A;  2X6L A;  1EY0 A;  1KRS A;  3NSW A;  4X64 Q;  1G2S A;  2IY5 B;  4JYA Q;  1FGU A;  2NN6 H;  5GAG C;  3I2Z A;  4O42 A;  5C0X J;  1N32 L;  4KTA A;  1RL2 A;  3HZX A;  4WOR A;  4LW1 A;  2KUM A;  4IUN A;  3P75 A;  4UP9 A;  1QVG A;  2F0V A;  3I4N B;  4HJ5 A;  1O80 A;  4ILW A;  1VQL A;  1SRO A;  3UDF A;  1D6E C;  1O7L A;  5C4J B;  5I6Y A;  4YIJ A;  2WAQ B;  4DXG A;  3HOZ B;  3QG1 A;  3BYT B;  1LUZ A;  4IUR A;  3K0Y A;  3T16 A;  1B7Y B;  2Q2T A;  2CCZ A;  3OHX C;  2L0C A;  2XN9 C;  3ULP A;  1EY4 A;  1N9W A;  4O1N A;  2V1C C;  2CKZ B;  1E0B A;  4FF1 A;  3P20 A;  3SR1 A;  5LMU L;  2YTY A;  1EY7 A;  5E4X A;  4L5Q A;  1W2B A;  4C3H H;  3VR3 A;  4KKU A;  1JWS D;  3H3V I;  3RLN A;  1IBL Q;  2QW7 A;  5I2Y A;  2WII B;  4A3G B;  1MBY A;  1VQM A;  1C7Y A;  1LTS D;  2EYP A;  3Q0A A;  2B2V C;  3OMC A;  5EJW A;  2F4I A;  4JK1 C;  4LF4 Q;  4APV A;  1I50 H;  3CD6 A;  3C2P A;  4KI0 A;  3KLS X;  4EQP A;  3ITP A;  3IRB A;  3ONA B;  1ASY A;  4JI6 L;  4J6H A;  1U4P A;  4NXM L;  1UUP A;  2KHJ A;  4A3K B;  2XNA C;  1DOK A;  2DY7 A;  5FK9 C;  1EQQ A;  1CTM A;  4P74 A;  1PH4 A;  2KEN A;  1PFB A;  4DV1 L;  1H9K A;  3HOY B;  2C9O A;  3X3N A;  3I7F A;  1L0Y B;  1KTK A;  1CSP A;  2NTT A;  2R7F A;  1YEZ A;  1B53 A;  4K2K A;  1VQE A;  3S1Q B;  2EPB A;  2R7Z H;  3HOX G;  4BWG B;  5DM7 3;  4L5S A;  4ZUJ A;  2K5V A;  3H0G G;  2UUA L;  3BJU A;  4C2M H;  3BDO A;  1DON A;  2JA7 G;  3NHH A;  3GTO H;  2JA8 H;  3I55 A;  2JA6 G;  3J80 i;  4BS9 A;  3PO2 G;  1MJE A;  2HIV A;  2K5D A;  1KAA A;  1VQH A;  4QCL A;  1J8I A;  1JOQ A;  2AKW B;  4I7Z C;  4DXF A;  1C8C A;  3TP5 A;  1BDO A;  1TWC H;  1HUN A;  3FKI H;  4UAI A;  2A74 C;  3S2D H;  2FHT A;  3S16 H;  1IBK L;  5C3E H;  4CDF C;  3CU7 A;  4DK0 A;  5ELN A;  5ELC A;  5HUR A;  3GTP B;  3TS0 A;  3J7Y W;  2EY1 A;  1EU4 A;  1EWI A;  3M3Y B;  3QOJ A;  4B9X A;  1SE8 A;  4DR2 L;  3LNN A;  4OO1 H;  3OW7 A;  3STB C;  4FYD A;  2F3V A;  1JOO A;  1DD2 A;  2F1M A;  1ICW A;  4I65 A;  1BKB A;  2RDG A;  3E3X A;  3TP7 A;  2R7D A;  3GP7 A;  4B3S L;  4RFB A;  2XVS A;  2AHO B;  3OSO A;  1HR0 L;  1EIY B;  3IFT A;  3K59 A;  1KXL A;  2EXD A;  2XWB B;  5C3W A;  5KYI A;  4A3I G;  3BVZ A;  1JQY D;  1T5E A;  3OMG A;  1CA6 A;  2ZJQ A;  1AN8 A;  3A7A B;  4EQN A;  2NUC A;  3M4Q A;  3U58 A;  4LFA L;  1IHZ A;  1QIL A;  5DM6 3;  4HED A;  2K5H A;  2R93 H;  1PHJ A;  1HFG A;  1B9M A;  5IGG A;  4ME3 A;  1AH9 A;  5KNB A;  1CQV A;  5E7N A;  1C4Q A;  2F0L A;  2K5Q A;  1E7Z A;  1I5F A;  1PYB A;  4P71 A;  4IAL A;  1E1O A;  4GKJ L;  3PIP A;  3M4O H;  3T51 B;  3RNU A;  2X69 A;  4OEM B;  2UXB Q;  1FGB D;  3MHB A;  3Q23 A;  4DNI A;  4NXN Q;  2IW3 A;  5I4D A;  4OGQ C;  1WTP A;  1YNJ D;  3BZC A;  5BR8 L;  2OT2 A;  1LTG D;  3KBX A;  2DNE A;  2KHI A;  1DJR D;  4DFA A;  2N49 A;  1YNN D;  1GD7 A;  2AQ1 B;  4GNX A;  1I3Q B;  2D0O A;  2JQO A;  2ZXP A;  4IJL A;  1HCZ A;  1PLF A;  2K5N A;  2XWJ B;  4FF2 A;  5C5M A;  4IQZ A;  1SYC A;  2LKV A;  2ZTC A;  4RWS C;  5A35 A;  3E6Z X;  2VB2 X;  4KHZ A;  2R92 H;  1CZG A;  1W3S A;  4N9T A;  5C0X G;  1K9M C;  3U4V A;  1U4R A;  4ID6 A;  2F4V L;  3CC2 A;  4R9W A;  4K14 A;  4CDD C;  4GLX A;  3PO3 B;  1N36 Q;  1HA5 A;  2F0N A;  4BBR B;  1Q86 C;  3HKZ B;  1G8Z D;  1QZG A;  1D2B A;  5IYC G;  1C9O A;  4CJ2 C;  4B3M Q;  1IKL A;  4ZUI A;  1BOS A;  4X6A H;  1VQD A;  1SXT A;  5IGE A;  1VS0 A;  3HOU B;  1F77 A;  3F1Z A;  3L2P A;  1M4V A;  2K33 A;  4DK1 A;  4FF3 A;  4LF8 L;  3D3R A;  5M9O A;  3GTO B;  3MWY W;  1BBU A;  3RMH A;  4A3J G;  2ZM6 Q;  5LHY 1;  3CCL A;  3CC7 A;  1UE6 A;  1JWU D;  4FXG C;  5KND A;  3E5S A;  3S1M B;  1S3O A;  1Q8I A;  4RGM A;  3URY A;  5KNC A;  3RZO H;  3GTK H;  2B8G A;  4UHV A;  2CHB D;  4K5W A;  1V43 A;  1J5E L;  2MHV A;  2PW7 A;  5C4X H;  4KD4 A;  2L11 A;  3I4M G;  4J1M A;  2B2T A;  2NZH A;  4ME5 A;  5D3I B;  5A2Q E;  1I4X A;  4JBJ A;  3T1Y L;  1S5F D;  2QA4 A;  1EY8 A;  1STA A;  1ROD A;  4CDC C;  3KLS A;  3STB D;  5C6A A;  3ND8 A;  1HFN A;  2VUM G;  4K8I A;  2L55 A;  2J0T D;  4LF7 L;  2EJG C;  1GXD C;  1UAP A;  2A68 C;  2YYZ A;  4J8Q A;  5GQO A;  2JA9 A;  5AFW A;  3CKI B;  3VA5 A;  5KEE A;  4JI1 L;  4OX9 L;  2UU9 L;  4YWK A;  3AFP A;  2F0T A;  2IX0 A;  2E2I H;  2Q2H A;  1VQN A;  4O0A A;  3I56 A;  3J7Z C;  4IUT A;  3W3A A;  1S72 A;  2R93 B;  2A5H A;  4C3I G;  3SK5 A;  3VYT A;  4JBK A;  4Y7N H;  2YU9 B;  4IPG A;  1Q12 A;  5E1F A;  3KF8 A;  4QUF A;  4RHR A;  1X3P A;  4BBS G;  2O5I C;  1L1O A;  1PH5 A;  2SDF A;  1SYG A;  3Q8D A;  3K5N A;  1NNX A;  1Y8O B;  2WV6 D;  4DU9 A;  2VY3 A;  5IOC A;  4KJN A;  1SNQ A;  3J7A 5;  2WIN B;  1NJI C;  3MXU A;  1S40 A;  4LF9 Q;  1PZI D;  5J1Z A;  1SDF A;  4DN4 M;  1EIG A;  1TWA B;  1TWF B;  3NBH B;  3DEP A;  1SNP A;  1PDQ A;  1IZ6 A;  5CV4 A;  1RHP A;  2RBM A;  1TR5 A;  1B3A A;  1QB5 D;  3O13 A;  1HH2 P;  3A5Z B;  4A3M B;  3JAM E;  4YHH Q;  3AQQ A;  4DR3 L;  1TWG B;  4GNX C;  1RTO A;  2E5L Q;  4ZK9 B;  3C3L A;  2ENB A;  4UP8 A;  3S1R H;  1R4P B;  5EKL A;  3R93 A;  2CW0 C;  3WWV A;  5I9O A;  3G7L A;  4QGU A;  1HJP A;  1M8A A;  2JA5 G;  3OIP A;  1IBM L;  1T9H A;  2UUB L;  4JI0 L;  1GJX A;  2Z0S A;  1HR0 W;  1EWC A;  4AQY Q;  1N34 Q;  3MEF A;  2EZV A;  5M5X B;  2Z6K A;  3HOX H;  3BDC A;  3EIV A;  3K7A H;  3SK8 A;  2XSC A;  1BBX C;  4DUY L;  1X55 A;  1SYD A;  3P1H A;  1OXV A;  3H0G H;  1KDB A;  4WJW A;  2KA7 A;  2JA7 H;  2HDL A;  4RGT A;  4IPD A;  4X3K A;  4IN3 A;  4Q5V A;  1JCK B;  2ATW A;  4RGN A;  2JA6 H;  3I91 A;  3PO2 H;  3HFZ B;  2DNC A;  2Z4H A;  2EY2 A;  3KF6 B;  3L3O C;  2PPB C;  4LF5 Q;  1PH9 A;  1XPO A;  1LTL A;  3E0J A;  3UE1 A;  2XGT A;  4BA2 I;  1F9Q A;  4IOC A;  5M3M B;  2HQL A;  2XTI A;  5CV7 A;  1G91 A;  3ZYY X;  3X3M A;  1GVP A;  4QY7 A;  4DV5 Q;  3U4Z A;  1EY6 A;  5D14 A;  4IFD G;  2Z9H A;  1KD1 C;  5CR3 A;  1V1Q A;  4MHE A;  3BZD B;  3CXC A;  3GTM B;  5IGD A;  2PMZ B;  4C1N K;  3H15 A;  2B2W A;  2B63 G;  2NVQ H;  4XDX A;  3R8B A;  5M5W H;  4NB3 A;  3NQI A;  1B70 B;  3DWA A;  5FOB B;  1VQ7 A;  4A3I H;  3MZ5 A;  4RGO S;  4C3J B;  2QCP X;  4DUZ Q;  1TS2 A;  2B2T C;  4DR7 L;  3KLR A;  2CFM A;  3PUX A;  4OHJ A;  2G9H D;  4IJH A;  1E24 A;  4AIM A;  4LJZ C;  5EBD A;  2BCO A;  4EQ5 A;  5IE8 A;  2A68 D;  1QVC A;  3DM3 A;  2XIW A;  4FF4 A;  3PUY A;  4DV3 L;  4B3T Q;  5EKI A;  3F2B A;  2OTL A;  2JN4 A;  4V19 0;  4EQO A;  1SND A;  3S14 B;  1Y69 U;  4DR6 L;  1U0L A;  1F2Z A;  4PZ6 A;  4QIW B;  1ZKO A;  4A3D H;  1XTD A;  1NCV A;  2EE1 A;  1CQF A;  3CQZ B;  1HZA A;  2LSS A;  2SNM A;  3W1B A;  2IWH A;  1WYD A;  1FJG Q;  3CPW A;  1U4M A;  1GUG A;  2FJ2 A;  1X65 A;  4DV6 L;  1RJT A;  4HTH A;  4L5R C;  4DV2 Q;  4ODG A;  1A0I A;  1Y8N B;  4JI8 L;  1L1O C;  3RLO A;  1WTW A;  4JI2 L;  4DV7 L;  1RDP D;  2K5W A;  3I90 A;  2KHS A;  1XMO L;  5T1I A;  4HIK A;  3NE5 B;  1LTB D;  5KYL A;  2JSO A;  3K6O A;  1Q3L A;  3SXH A;  5IOD A;  5C0X H;  4G7O C;  2OWO A;  3NWT A;  1JJG A;  1EZ8 A;  2F0W A;  3M85 A;  2QGQ A;  4B3R Q;  1GUN A;  4JI4 Q;  4A93 G;  1H9M A;  3TME A;  4XYO A;  4RCO A;  4JOI A;  2LY7 A;  4A3E B;  1A62 A;  1GKH A;  1MGS A;  1M1K C;  2K32 A;  3DUZ A;  4IZ8 A;  3BS1 A;  5IYC H;  1KNE A;  4ZRZ A;  1YHB A;  5EQ0 A;  2K04 A;  2Z8L A;  3TBI B;  1K8M A;  3K8A A;  2WFW A;  2SOB A;  1UNS A;  4BA1 I;  1DZ1 A;  1K3B C;  1XX8 A;  1YIJ A;  1QVF A;  2BOS A;  4JI5 L;  1QE6 A;  1X3F A;  4OWX B;  1TXY A;  1JJ2 A;  5ELD A;  1XTC D;  2TSS A;  4A3J H;  2Z6K C;  4RG1 A;  3CMA A;  1VQO A;  3JAM c;  4EVO A;  5M3F B;  1RF2 D;  3IKJ A;  1HNZ Q;  3KBG A;  4TVA B;  3GV3 A;  1PYW D;  3M9B A;  4CKC A;  3K80 C;  3CP0 A;  4ZCK A;  1AE3 A;  3AU7 A;  4K0K L;  3M7N A;  4UP7 A;  1PRT F;  2KQ3 A;  4XT1 B;  3TN2 A;  1UEA B;  1HNX L;  1RKN A;  2R6G A;  2E2J B;  2NYZ D;  1X6O A;  1HPC A;  5EGT A;  1ASZ A;  3I4M H;  2AUK A;  1IL8 A;  4FNF A;  3IFD A;  5IGC A;  1XYI A;  3A55 A;  2KEC A;  2WB1 B;  4HCS A;  5HGT A;  1EL0 A;  1WOC A;  4M1U B;  2NVY B;  4XTC S;  4HID A;  3FRP B;  4HSP A;  3EN2 A;  4LFB Q;  3HEJ A;  4DGZ A;  2VUM H;  2HHH Q;  1DYQ A;  2M2L A;  5LMN Q;  1XPR A;  4TKO B;  2PNR C;  3QB3 A;  1IKM A;  1BBW A;  1NMG A;  1ESR A;  3I3C A;  4A3F G;  1EEI D;  5LL6 S;  1D5M C;  3QJY A;  1VF5 C;  4YY3 Q;  4GKK Q;  1HA6 A;  1XNR L;  1KAW A;  5JOB A;  1YNJ C;  1BUV T;  1I4G A;  4DV0 Q;  2A1A A;  1W6K A;  4GNX B;  1YNN C;  4C3I H;  1AEX A;  2OXP A;  1IW7 C;  1YJW A;  3TP8 A;  4C56 C;  4BBS H;  2GVA A;  3BU2 A;  1LT6 D;  1NTG A;  2L15 A;  3F8T A;  1I6H H;  4A3D B;  2AQ3 B;  4TSS A;  4JBM A;  3GTJ B;  2UXC L;  3VYU A;  3HOW G;  2F0D A;  4E6I A;  2HUG A;  3KDF A;  4G4K A;  3GO5 A;  3UI2 A;  4PV1 C;  1XNQ L;  1PYS B;  3BVM A;  5IGB A;  2BH8 A;  1PH1 A;  5I6W A;  5IWA Q;  3GTG H;  2J4X A;  2D62 A;  1Y8P B;  5DNF A;  2EY6 A;  1IYV A;  2NN6 I;  1LTA D;  3A8J E;  2JA5 H;  2ZT9 C;  4DV4 L;  2F03 A;  3D6W A;  1Y1W B;  4POG A;  2P5Z X;  1O7I A;  1DM0 B;  4CJ1 B;  1NR2 A;  1WCM G;  1HZ9 A;  1XMQ Q;  1C48 A;  3S1N H;  5KGU A;  1EOV A;  2BDN A;  5M5Y B;  4F8M A;  2DUD A;  3D4R A;  5CV8 A;  3NTK A;  5IYB G;  1SMX A;  2RDH A;  2XRQ D;  1R9T H;  4KHP Q;  1KLG D;  5J3B A;  1WVL A;  2I5H A;  4JOI C;  2IHE A;  3BG3 A;  4U68 A;  1LLR D;  4X3U A;  3RZD B;  3K58 A;  1VQC A;  4ABN A;  3CC4 A;  2NVX H;  3S17 H;  4LFC L;  4DNT B;  4A3B G;  4A3C G;  1X54 A;  4BY7 B;  1KC8 C;  1HZC A;  1C0A A;  1GUT A;  2JJQ A;  5C4H A;  1TT2 A;  2MFI A;  4KKS A;  1SFO H;  2JE6 I;  1VQ5 A;  1PFN A;  2A19 A;  3CCE A;  2ZJR A;  2B2Y A;  1I94 Q;  1EWH A;  3FMC A;  5C44 B;  2MO1 A;  1ZXT A;  3NTH A;  1CKN A;  4KLK A;  4GOP A;  4IFD H;  4BY1 H;  1JIC A;  2F0H A;  1K0R A;  1AZQ A;  1HNW L;  1YI2 A;  1JE4 A;  5C4Z A;  1K8A C;  2EQS A;  2E2D C;  2B63 H;  4BXX G;  1EIF A;  1S5E D;  4JV5 Q;  2WAC A;  3AEV A;  3Q24 A;  2KCN A;  3A5U A;  4HJA A;  2VQE Q;  4ZQ3 A;  4IPC A;  3I4N G;  3PV0 A;  4AH6 A;  1CK1 A;  4LMQ D;  5AJ3 L;  1PVO A;  3H6M A;  2WP8 J;  1GHK A;  3EJI A;  3NWS A;  4NW2 A;  4X62 Q;  2BH2 A;  1BCP F;  3KF8 B;  4DKA C;  2WAQ G;  1NSN S;  1VF7 A;  2VQF Q;  1ZEQ X;  2F0E A;  1L1O B;  3HOZ G;  2F52 A;  1LAC A;  5IYD G;  4LF6 L;  1S4Z A;  4JI3 L;  5TSS A;  3OTO L;  2EIF A;  4X65 Q;  4O2D A;  5E4W C;  2VNU D;  1S5B D;  4KN4 C;  5CV9 A;  3W2D A;  1VMP A;  1SEB D;  3AB9 A;  1BO0 A;  4C3H B;  1IW7 D;  1A6X A;  2WKC A;  1Q7Y C;  2BA0 A;  4IFD J;  4JI7 Q;  1TVX A;  4YWM A;  4A3G G;  2KBN A;  2K4K A;  1MSH A;  3K5O A;  2JK8 A;  1Q82 C;  2CQA A;  2M00 A;  2MPM A;  4DR1 Q;  1K0S A;  1I50 B;  4K6L A;  1B4O A;  3Q6S A;  4R4T A;  1HTL D;  3EFX D;  2UUC L;  4A3K G;  4HCE A;  2EDG A;  4DR4 L;  4OO1 I;  4UDU C;  1PMR A;  3T1H L;  4QJF A;  3QIA A;  2DGY A;  3DWQ A;  5FLM G;  1YNX A;  1FNU A;  3FEW X;  4X66 Q;  1IYJ B;  2I07 B;  3HOY G;  3PGZ A;  1K28 A;  4ZKB B;  2JXM B;  2D0P A;  3RN2 A;  1S5D D;  3BDL A;  2AMC B;  1X9N A;  4DR5 Q;  1ET9 A;  3GTL H;  1K8O A;  5LL6 X;  3GTQ H;  2R7Z B;  4F87 A;  3TZD A;  2YTV A;  4MTK A;  5A2Q L;  2MO0 A;  3K7U C;  3I4L A;  3C1E A;  3I70 A;  1EFW A;  1N33 Q;  2A6E C;  4LWC A;  4C2M B;  3G4S A;  1NY4 A;  1PA6 A;  3R2T A;  3BYY B;  2JA8 B;  3F2C A;  2UXD Q;  5IT9 E;  1A15 A;  3PUW A;  1TWH H;  4KKT A;  2H1E A;  2VS1 A;  4LUZ A;  3PIO A;  2GN5 A;  2O4X A;  1QNU A;  1TWC B;  3FKI B;  5T1G A;  3CCM A;  4L6T B;  2RHS B;  3S2D B;  3P7J A;  2RA4 A;  2PMZ E;  3S16 B;  1NAP A;  5C3E B;  3R3O A;  2HCI A;  3PUV A;  1JR0 D;  1ESF A;  4PMC A;  3TRE A;  1EYA A;  2F0S A;  3KK7 A;  1SAP A;  2OQ0 A;  2ICE C;  1NBW A;  5BN4 A;  5ISR A;  2HT1 A;  2N78 A;  1WFQ A;  1AW7 A;  1LV9 A;  4XT3 B;  4X64 L;  2NVT H;  3OPO A;  1N32 Q;  3GDE A;  4JYA L;  5ELO A;  4KN7 C;  4A4I A;  4BY1 B;  1SYE A;  2DJF C;  2B2Y C;  1YBY A;  2A73 B;  3H94 A;  3S9W A;  4NMZ A;  1PRT C;  1CUK A;  3RD4 A;  2Y0S E;  4DA2 A;  2CH4 A;  1YHA A;  4H02 A;  3KFU A;  2N8N A;  3J81 j;  1HRJ A;  4QIW E;  4A3F H;  4G7H C;  1G2T A;  1UE7 A;  3KOJ A;  1GUS A;  2EYJ A;  4OWT B;  3F2D A;  2K05 A;  3VR5 A;  3JAM L;  5JVG 3;  3KJO A;  3HS0 C;  1GOZ A;  3W5O A;  2CQO A;  1XJV A;  1D5Z C;  2EY5 A;  4ZAI A;  2A8V A;  2NWG A;  3V96 A;  3OW2 A;  5LMU Q;  2N55 A;  1KNA A;  2NB0 A;  3SE0 A;  4AYB B;  3VR2 A;  3M4O B;  4K5V A;  4KY7 A;  1WTQ A;  3QOL A;  3LX0 A;  1QUQ A;  5CGK A;  1K83 H;  3VYS A;  2E2H H;  2F0O A;  3NQT A;  5JPM C;  5GAH C;  5GAE C;  1K3R A;  2G5D A;  2MP1 A;  2F0K A;  1WD0 A;  1QG7 A;  1IBL L;  4H13 C;  5IIF A;  1O7Y A;  2Q2U A;  1H9R A;  3HOW H;  4XIG S;  1CFM A;  2VZA A;  2AWN A;  2F0M A;  4LF4 L;  1KAB A;  4HJ9 A;  4JI6 Q;  4JW0 A;  3CCU A;  2FXQ A;  4NXM Q;  3CCJ A;  4WFN 3;  1KDC A;  1CI3 M;  4OEL B;  2IT1 A;  4Z9C B;  3C1F A;  1Q8K A;  2O5J C;  2NTS A;  1SLJ A;  2R92 B;  4WRD A;  1HQM C;  1ILQ A;  1K73 C;  2RDF A;  4DV1 Q;  2Z4I A;  4J15 A;  1SYF A;  2PZW A;  1G6P A;  3PO3 G;  2MQH A;  1Z7T A;  1WCM H;  1H9S A;  3RLF A;  4BBR G;  3ZJY C;  3HOV G;  4QMG A;  1K8G A;  3HKZ G;  2C5C A;  2PZT A;  4HAE A;  1PTO H;  2UUA Q;  5IYB H;  3HOU G;  3MTS A;  3J81 c;  4G57 A;  5FKA C;  1DOM A;  4JPB W;  4NKL A;  4C1N I;  4CJ0 B;  3LWE A;  2Q8T A;  2QDB A;  4K5X A;  2A6E D;  4DK6 C;  2RHQ B;  3D8G A;  4CBV A;  1SNO A;  2RCN A;  4A3B H;  4A3C H;  4QUC A;  1HXY D;  4XQQ A;  1IBK Q;  4L5T A;  1NMF A;  3T4A C;  3JC6 6;  1WTH A;  4ALP A;  3RN5 A;  2E75 C;  3FP9 A;  5G3L D;  2RF4 A;  1II3 A;  2EOT A;  2HDM A;  2L5T A;  3RZO B;  1TS4 A;  1F9R A;  3GTK B;  4DR2 Q;  4V0B A;  1Y1V G;  3HGB A;  5C4X B;  1AZP A;  1AP0 A;  1EFI D;  2WAQ E;  3MXN A;  2PZU A;  2KCC A;  4HN7 A;  5EPL A;  1E2W A;  4OO1 G;  4B3S Q;  1I4Q A;  1HR0 Q;  1TKW B;  4P72 A;  4FVM A;  4BXX H;  1EU3 A;  2IX3 A;  3WDN A;  1UE5 A;  3PQI A;  1F2M A;  4YCU A;  5DEH A;  5IT9 c;  3I4N H;  1B50 A;  2KEE A;  2NBF A;  1B1Z A;  1UEB A;  1J9O A;  2QEJ C;  4LFA Q;  1VQ9 A;  1JOK A;  5C4J H;  4OL7 A;  1PRT D;  2V4D A;  1QCB D;  3HOZ H;  4ZKC B;  1T5X D;  2BE5 C;  1VQG A;  4RMF A;  5IYD H;  4B08 A;  2E2I B;  1EOT A;  3CHB D;  4GN5 A;  3DLL A;  1R4Q B;  1VQA A;  4IUU A;  4NPS A;  2EJF C;  4GKJ Q;  4K8J A;  1EZ6 A;  1ONL A;  1PH7 A;  1PH6 A;  4Y7N B;  1N8R C;  2DN8 A;  3KDF B;  2Z1C A;  4K6D A;  4N9P A;  2UXB L;  1BCP C;  5BR8 Q;  4NXN L;  1B9N A;  2HD3 A;  5D65 A;  1LYL A;  4A3G H;  5DAU A;  1X3Q A;  2EYO A;  3MVV A;  4OWW B;  3UDI A;  3PIP 3;  1WTV A;  4X3S A;  4WJ3 M;  5EPJ A;  1EYD A;  4Y52 H;  2HQE A;  2HIX A;  4OON A;  1KQS A;  3D6C A;  2N3S A;  1MHW C;  4A3K H;  4A3M G;  1E3P A;  4HJ8 A;  5FLM H;  3KYH C;  5K36 G;  4CKE A;  2F4V Q;  1KL9 A;  3A7L A;  4N8X 1;  5G3L F;  4CKB A;  1M90 C;  4IOA A;  3S1R B;  3BVG A;  1EEF D;  3HOY H;  2D2C C;  1EYG A;  1CT1 D;  1MSG A;  1TQO A;  3ERO A;  5COR A;  2K50 A;  1TY2 A;  3VR4 A;  3WOF A;  4WJ4 A;  3S1Q H;  1N36 L;  3MXP A;  1WTO A;  3HOX B;  3K7A B;  1GUW A;  2B39 A;  2PW5 A;  1WCM B;  2K6A A;  4B3M L;  3H0G B;  2GVB A;  3K57 A;  3F2U A;  1U5K A;  2OTJ A;  2JA7 B;  4LF8 Q;  3TDQ A;  2JA6 B;  1LM0 A;  4MN3 A;  4ZLT F;  3PO2 B;  1SE4 A;  4TRD A;  1IL2 A;  2CVR A;  2ZTE A;  1PRT B;  1PTO F;  2E74 C;  5K5P A;  3H3V H;  2H4O A;  1X3G A;  1CKN B;  4FXK C;  2ZM6 L;  2OEO A;  2L9H A;  2F0G A;  2IPK D;  1LO5 D;  2B2U A;  2ICI A;  2A6H D;  3G71 A;  3DMU A;  3PUZ A;  3K81 C;  5M3M G;  3GTP H;  3EBE A;  2EVB A;  2CWP A;  4GLA C;  4HMJ A;  3RR5 A;  4TQU S;  3ULJ A;  3M3Y H;  5ELF A;  1ICF B;  1J5E Q;  1CA5 A;  4HIO A;  1KDA A;  3L0O A;  2K7V A;  1LAB A;  5F2D A;  3I4O A;  2B29 A;  3M7G A;  1NR4 A;  5FLX E;  5FO7 B;  1PH2 A;  1PH8 A;  1LTI D;  3PIO 3;  3T1Y Q;  3ICE A;  2ES2 A;  2I0Q A;  1BNZ A;  2N88 A;  3J80 c;  1YHQ A;  3DXJ C;  2NVQ B;  1GHJ A;  2QF7 A;  5M5W B;  2I46 A;  3FVQ A;  4LF7 Q;  3SHL A;  1RTN A;  1B44 D;  3BZK A;  3DWP A;  4C3J G;  2H5X A;  4DF7 A;  4A3I B;  5C0X I;  2ZXR A;  3U50 C;  2B2W C;  5IP9 G;  1V9P A;  4JI1 Q;  4OX9 Q;  2UU9 Q;  3VYR A;  3K5L A;  2M9V A;  1KHI A;  4DK3 C;  2RCF A;  5C3X A;  4S3S A;  1E2V A;  1F2L A;  3QR8 A;  2OQK A;  1BVS A;  1NE3 A;  3T53 B;  1EY9 A;  3UDG A;  1HUM A;  1YJN A;  2L1B A;  2Y0S G;  1JC7 A;  1Q81 C;  3RUZ A;  2BE5 D;  3S15 H;  1ZYR D;  4R8I A;  1MKH A;  2VW9 A; 
#chains in the Genus database with same CATH homology
 4OXP A;  2PQA A;  4POF A;  5GRO A;  1L1O A;  1PH5 A;  4A76 A;  4BBS G;  3Q8D A;  1GO3 E;  4MNO A;  3PSI A;  4R1J A;  2PI2 E;  1WJJ A;  3UDX A;  3ERS X;  2VY3 A;  3B6Y A;  1Q7Y C;  1VQF A;  2BA0 A;  1SR3 A;  1Z9F A;  3GTJ H;  4JI7 Q;  3J7A 5;  1MIU A;  4YWM A;  5H1S E;  1NJI C;  4A3G G;  4IFD J;  1I3Q H;  1B8A A;  1S40 A;  2I5L X;  2KBN A;  2KCM A;  4JI7 L;  4LF9 Q;  4UPA A;  4LF9 L;  2K4K A;  1YZ6 A;  1SN8 A;  4A3L G;  2JK8 A;  3S2H H;  4JCV E;  1YIT A;  4P75 A;  1Q82 C;  3HKZ E;  1MJC A;  4DR1 Q;  3TEH B;  3J81 i;  3NBH B;  4DR1 L;  4R4T A;  4EX5 A;  2UUC Q;  3AYH B;  1IZ6 A;  1PFS A;  1P8L A;  4R4O A;  1UE1 A;  3CME A;  2UUC L;  4DR4 Q;  4A3K G;  1GM5 A;  5JEA G;  4DR4 L;  4OO1 I;  1HH2 P;  3A5Z B;  4DR3 Q;  4YHH Q;  3AQQ A;  3T1H Q;  2K52 A;  4DR3 L;  2R92 G;  4YHH L;  4GNX C;  3T1H L;  4QJF A;  5FLM G;  2DGY A;  2E5L Q;  4QQB X;  4FDB A;  2E5L L;  4UP8 A;  1YNX A;  4GS3 A;  3S1R H;  3WWV A;  2JA5 G;  3JAM i;  4QGU A;  1IBM Q;  1X3E A;  1HJP A;  4X66 Q;  1Y1W H;  2ASB A;  3LGJ A;  2UUB Q;  3GD7 A;  1IYJ B;  1T9H A;  1IBM L;  4JI0 Q;  2PNH A;  4YCV A;  4MTN A;  3PGZ A;  5EAY A;  4X66 L;  2UUB L;  3HOY G;  4JI0 L;  1G29 1;  2Z0S A;  4A3E G;  1HR0 W;  2D0P A;  3RN2 A;  4AQY Q;  1N34 Q;  4BBR H;  3PO3 H;  3AFQ A;  3MEF A;  1KIX A;  1N34 L;  4AQY L;  1XPU A;  2AMC B;  1X9N A;  3HOV H;  4DR5 Q;  3VDY A;  3TS2 A;  4R4I A;  5M5Y H;  2Z6K A;  3HOX H;  4DUY Q;  3EIV A;  4DR5 L;  3K7A H;  3GTL H;  3GTQ H;  2VL6 A;  5LMN W;  1VQP A;  2YTV A;  1X55 A;  4DUY L;  2MO0 A;  1JMC A;  3K7U C;  1OXV A;  2JEA I;  3H0G H;  3G6E A;  1N33 Q;  1EFW A;  3NEL A;  3HOU H;  4R4C A;  1DGS A;  1YVC A;  1N33 L;  1OXU A;  4LWC A;  2JA7 H;  4IPD A;  3CPF A;  3G4S A;  2ATW A;  2ZTD A;  5JJL A;  1NY4 A;  5IP7 G;  1PA6 A;  2IHF A;  4DPG A;  2JA6 H;  3K0X A;  3RZD H;  3UE0 A;  3F2C A;  3PO2 H;  3L7Z C;  2UXD Q;  3HFZ B;  4YCW A;  3PUW A;  4GOP B;  2CWA A;  2UXD L;  1TWH H;  4LUZ A;  2VS1 A;  3KF6 B;  3PIO A;  1SRU A;  2GN5 A;  4LF5 Q;  1P16 A;  1XPO A;  1PH9 A;  4DAY B;  4LF5 L;  2BA1 A;  4QL5 A;  3CCM A;  4BY7 H;  1LTL A;  2K14 A;  1CKM A;  5M3F G;  1VQK A;  2RHS B;  3CW2 C;  3A0J A;  3UE1 A;  3S1M H;  2XGT A;  2PMZ E;  4BA2 I;  5FJ8 H;  3PCO B;  4IOC A;  2HQL A;  5GAD C;  1IXR A;  2XTI A;  3PUV A;  3M4P A;  3TRE A;  5C44 H;  1VCI A;  2ID0 A;  5HY6 A;  1GVP A;  3KF6 A;  2OQ0 A;  4QY7 A;  4DV5 Q;  5JJK A;  3U4Z A;  1Y1V H;  5C4X G;  2Q2I A;  4P73 A;  4DV5 L;  1NBW A;  2HT1 A;  1KRS A;  4IFD G;  4X64 Q;  2N78 A;  1KD1 C;  2IY5 B;  1WFQ A;  1V1Q A;  4X64 L;  2NVT H;  2WB1 G;  3CXC A;  4JYA Q;  1CSQ A;  1FGU A;  5GAG C;  1N32 Q;  3GDE A;  3I2Z A;  5ELO A;  5C0X J;  4JYA L;  1OXS C;  1N32 L;  3H15 A;  5JJI A;  4A4I A;  1RL2 A;  2B63 G;  2NVQ H;  5M5W H;  4LW1 A;  3TQY A;  1YBY A;  4NB3 A;  1B70 B;  1VQ7 A;  4UP9 A;  1CUK A;  4A3I H;  1QVG A;  2Y0S E;  4HJ5 A;  4PG3 A;  1VQL A;  2YTX A;  4DUZ Q;  4DR7 Q;  1JJC B;  1YHA A;  1SRO A;  4DUZ L;  4DR7 L;  4H02 A;  3KFU A;  2N8N A;  2CFM A;  3UDF A;  3J81 j;  4AYB E;  4QIW E;  1VQ4 A;  3PUX A;  4A3F H;  4IJH A;  1E24 A;  1OTC A;  4AIM A;  5IE8 A;  1QUQ B;  4EQ5 A;  1UE7 A;  1QVC A;  3KOJ A;  3DM3 A;  4OWT B;  4DV3 Q;  3F2D A;  3KJO A;  3PUY A;  4DV3 L;  4B3T Q;  1LUZ A;  3F2B A;  3W5O A;  2CQO A;  1XJV A;  4B3T L;  1B7Y B;  2Q2T A;  4LUV A;  2CCZ A;  2OTL A;  3ULP A;  2A8V A;  1UWV A;  4IO9 A;  1N9W A;  1QZH A;  2V1C C;  2CKZ B;  1EQR A;  5FLX c;  2OCE A;  3OW2 A;  2YU9 H;  4DR6 Q;  5LMU Q;  4DR6 L;  1U0L A;  5LMU L;  4PZ6 A;  4A3D H;  2YTY A;  1XTD A;  1QUQ A;  2E8G A;  4L5Q A;  1K83 H;  1W2B A;  2E2H H;  4C3H H;  1HZA A;  2LSS A;  5GAH C;  5GAE C;  3W1B A;  3H3V I;  3NEM A;  3RLN A;  1IBL Q;  4A3D G;  1K3R A;  1WYD A;  4DV6 Q;  1IBL L;  3CPW A;  1FJG Q;  1X65 A;  4DV6 L;  1FJG L;  1C7Y A;  1VQM A;  2Q2U A;  3HOW H;  4XIG S;  4L5R C;  4LNQ A;  4PMW A;  4DV2 Q;  3G48 A;  2VZA A;  4LF4 Q;  2AWN A;  1TWA H;  4JI8 Q;  1A0I A;  4APV A;  4R4Q A;  4DV2 L;  1I50 H;  1TWF H;  4LF4 L;  2B3G A;  4JI8 L;  3CD6 A;  4KI0 A;  4JI2 Q;  4DV7 Q;  4HJ9 A;  1L1O C;  3RLO A;  1EUJ A;  1ASY A;  3IRB A;  4DV7 L;  4JI2 L;  4JI6 Q;  3CCU A;  2FXQ A;  4JI6 L;  4NXM Q;  3CCJ A;  1XMO Q;  4A3M H;  4NXM L;  5IY0 A;  3E0E A;  2KHJ A;  1XMO L;  3CCQ A;  4HIK A;  2IT1 A;  4IFD I;  1TWG H;  1Q8K A;  4A93 H;  1SLJ A;  1EQQ A;  1K73 C;  2OWO A;  1JJG A;  3KJP A;  4P74 A;  2QGQ A;  3M85 A;  1PH4 A;  4B3R Q;  4DV1 Q;  1Y1W G;  4JI4 Q;  4A93 G;  4B3R L;  2KEN A;  4IPH A;  4LUO A;  4DV1 L;  4J15 A;  4JI4 L;  4JOI A;  1G6P A;  4HJ7 A;  3I7F A;  3PO3 G;  2MQH A;  1G51 A;  4BBR G;  1WCM H;  1A62 A;  1GKH A;  3RLF A;  1CSP A;  3ZJY C;  3HOV G;  1E1T A;  2R7F A;  1YEZ A;  5M5X H;  3HKZ G;  1M1K C;  1VQE A;  1K8G A;  2R7Z H;  1VQB A;  3D31 A;  3HOX G;  4GN4 B;  5IYC H;  4L5S A;  2UUA Q;  1YHB A;  5IYB H;  2K5V A;  3H0G G;  2UUA L;  3BJU A;  3HOU G;  3K8A A;  4C2M H;  3J81 c;  2JA7 G;  2WFW A;  3GTO H;  4BA1 I;  2JA8 H;  1YIJ A;  3I55 A;  4UY8 C;  3E9H A;  4JI5 Q;  2KCT A;  1QVF A;  2JA6 G;  4JI5 L;  3J80 i;  3CCV A;  3PO2 G;  1MJE A;  2HIV A;  1H95 A;  1X3F A;  4OWX B;  1TXY A;  1JJ2 A;  1VQH A;  4DK6 C;  2AKW B;  2RHQ B;  1TWC H;  2Z6K C;  2RCN A;  1J6Q A;  3FKI H;  4RG1 A;  4A3J H;  4A3B H;  4A3C H;  3CMA A;  2NZO A;  3HKS A;  4BY7 G;  3S2D H;  3MXN B;  1VQO A;  3JAM c;  1VQJ A;  1IBK Q;  2QEX A;  4L5T A;  1HNZ Q;  1VQ8 A;  1NMF A;  4TVA B;  3JC6 6;  5C3E H;  1IBK L;  4ALP A;  3RN5 A;  3S16 H;  3M9B A;  1E22 A;  1HNZ L;  3FP9 A;  3K80 C;  3CP0 A;  2RF4 A;  1AE3 A;  5M3M H;  1VQI A;  5FJ8 G;  4K0K Q;  5ELN A;  4K0K L;  3M7N A;  4UP7 A;  3TS0 A;  1KRT A;  5C44 G;  3TRZ A;  4DR2 Q;  1EWI A;  1JT8 A;  1HNX Q;  1Y1V G;  1SE8 A;  4DR2 L;  1HNX L;  2R6G A;  2ALY B;  1X6O A;  1ASZ A;  3STB C;  2WAQ E;  3I4M H;  3GTM H;  5DLQ E;  1BKB A;  2NN6 G;  4OO1 G;  1WOC A;  2R7D A;  4B3S Q;  1OXT A;  4JBW A;  1L0W A;  1HR0 Q;  4P72 A;  4B3S L;  3PF4 A;  2AHO B;  4PZ8 A;  4XTC S;  1HR0 L;  4BXX H;  4HID A;  1EIY B;  4LFB Q;  3EN2 A;  4LFB L;  4GOP C;  2VUM H;  2EXD A;  1KXL A;  1UE5 A;  2HHH Q;  5HGQ A;  4YCU A;  3E9I A;  5LMN Q;  5IT9 c;  3I4N H;  1XPR A;  2HHH L;  4A3I G;  3S24 A;  4C3J H;  5LMN L;  1UEB A;  1BBW A;  1NMG A;  2ZJQ A;  5IP9 H;  4LFA Q;  1VQ9 A;  3M4Q A;  2LXJ A;  5C4J H;  3U58 A;  4A3F G;  4LFA L;  1HZB A;  2K5H A;  2AWO A;  3HOZ H;  2R93 H;  1VQG A;  4RMF A;  1XNR Q;  4YY3 Q;  1PHJ A;  5IYD H;  4GKK Q;  1XNR L;  4YY3 L;  1KAW A;  4GKK L;  1OXX K;  4ME3 A;  4GN5 A;  3DLL A;  1AH9 A;  4DV0 Q;  5E7N A;  2A1A A;  1VQA A;  4NPS A;  4DV0 L;  4GNX B;  3CF5 A;  1E7Z A;  1I5F A;  1PYB A;  4P71 A;  4C3I H;  3S14 H;  1YJW A;  1PH7 A;  1E1O A;  4GKJ Q;  4GKJ L;  3PIP A;  1PH6 A;  3M4O H;  1RIP A;  3RNU A;  1N8R C;  3KDF B;  2UXB Q;  1X56 A;  3CQZ H;  1Z47 A;  4BBS H;  2GVA A;  2UXB L;  4DNI A;  4NXN Q;  5BR8 Q;  3BU2 A;  3BZC A;  1NTG A;  4NXN L;  5BR8 L;  2L15 A;  3F8T A;  1I6H H;  2KHI A;  2UXC Q;  2N49 A;  1LYL A;  4A3G H;  1GD7 A;  4JBM A;  1CKO A;  4GNX A;  2UXC L;  2D0O A;  2JQO A;  3HOW G;  4IJL A;  2K5N A;  1PV4 A;  4OWW B;  4A3L H;  1PH3 A;  3UDI A;  3OYY A;  1D7Q A;  4WJ3 M;  3KDF A;  1XNQ Q;  3GO5 A;  4Y52 H;  1XNQ L;  1A8V A;  1PYS B;  2ZTC A;  2HIX A;  2BH8 A;  4OON A;  1PH1 A;  1KQS A;  2N3S A;  4MZ9 A;  5IWA Q;  4A3K H;  4A3M G;  1E3P A;  3GTG H;  5IWA L;  4KHZ A;  2D62 A;  4HJ8 A;  2R92 H;  1W3S A;  4JC0 A;  3KYH C;  5FLM H;  2F4V Q;  5K36 G;  5C0X G;  1K9M C;  1KL9 A;  3U4V A;  2NN6 I;  2F4V L;  4DV4 Q;  1M90 C;  3CC2 A;  4IOA A;  2JA5 H;  4DV4 L;  3SGI A;  1Q1B A;  3HOY H;  4POG A;  1O7I A;  4GN3 B;  1EYG A;  4GLX A;  4A3E H;  3ER0 A;  1WCM G;  2K50 A;  1N36 Q;  1HZ9 A;  1XMQ Q;  4WJ4 A;  3S1Q H;  1Q86 C;  1N36 L;  1XMQ L;  1YJ9 A;  3S1N H;  2R7Z G;  4JG2 A;  1EOV A;  1QZG A;  2DUD A;  5IYC G;  1C9O A;  4B3M Q;  5IYB G;  2K75 A;  2PI2 A;  1SMX A;  1VQD A;  4B3M L;  4X6A H;  3CCR A;  2GVB A;  1U5K A;  1VS0 A;  1R9T H;  2OTJ A;  3CCS A;  4KHP Q;  3KLW A;  1WI5 A;  1L2F A;  3F1Z A;  3L2P A;  1JB7 A;  2JA8 G;  4KHP L;  5IP7 H;  5J3B A;  4LF8 Q;  2I5H A;  4JOI C;  2IHE A;  1LM0 A;  4LF8 L;  1VQC A;  1IL2 A;  4LFC Q;  3CC4 A;  1BBU A;  2WB1 E;  2ZTE A;  2NVX H;  3S17 H;  4LFC L;  4A3J G;  3H3V H;  1FL0 A;  3A74 A;  3FKI G;  1X3G A;  2ZM6 Q;  1CKN B;  4A3B G;  4A3C G;  3CCL A;  2ZM6 L;  3CC7 A;  5M3F H;  1UE6 A;  1X54 A;  4YWL A;  2F3I A;  1KC8 C;  1HZC A;  1C0A A;  2JJQ A;  5C3E G;  1S3O A;  2MFI A;  3G71 A;  1SFO H;  3PUZ A;  2JE6 I;  3K81 C;  5M3M G;  3GTP H;  3RZO H;  1VQ5 A;  3EBE A;  4A75 A;  2CWP A;  4PZ7 A;  3GTK H;  2A19 A;  4GLA C;  3CCE A;  2C35 B;  2YV5 A;  2ZJR A;  1I94 Q;  3RR5 A;  4TQU S;  5JEA J;  3ULJ A;  3M3Y H;  1I94 L;  1V43 A;  1J5E Q;  4DAM A;  4HIO A;  3L0O A;  2JEB I;  3I4O A;  2MO1 A;  1J5E L;  5C4X H;  2E2J H;  2B29 A;  1Q1E A;  1CKN A;  2ZJP A;  1A63 A;  1PH2 A;  4KLK A;  4GOP A;  3I4M G;  2NZH A;  1PH8 A;  4BY1 H;  1HNW Q;  3T1Y Q;  3ICE A;  2ES2 A;  1K0R A;  1HNW L;  2I0Q A;  4JBJ A;  3T1Y L;  1YI2 A;  2QA4 A;  3J80 c;  2NVY H;  1K8A C;  2EQS A;  1YHQ A;  4GLV B;  3NEN A;  2B63 H;  4BY1 G;  4BXX G;  1EIF A;  3STB D;  4JV5 Q;  3AEV A;  3ULL A;  3A5U A;  4HJA A;  4JV5 L;  3D0F A;  2VUM G;  4LF7 Q;  2VQE Q;  1Q46 A;  3PF5 A;  3I4N G;  4IPC A;  4LF7 L;  2VQE L;  3BZK A;  2H5X A;  2YYZ A;  3PV0 A;  4AH6 A;  5C0X I;  3U50 C;  3W1G A;  5AJ3 Q;  5GQO A;  2JA9 A;  3CAM A;  5AJ3 L;  1PVO A;  5IP9 G;  1V9P A;  2WP8 J;  4JI1 Q;  2MNA A;  4OX9 Q;  2UU9 Q;  4X62 Q;  4JI1 L;  2BH2 A;  3KF8 B;  4OX9 L;  2UU9 L;  4X62 L;  1AE2 A;  4DKA C;  2WAQ G;  1KHI A;  4YWK A;  4DK3 C;  2PQA B;  3AFP A;  2VQF Q;  1L1O B;  4LF6 Q;  2IX0 A;  2VQF L;  3FHW A;  3HOZ G;  2E2I H;  2F52 A;  5IYD G;  2R93 G;  4JI3 Q;  4LF6 L;  2IX1 A;  1D8L A;  4JI3 L;  2OQK A;  3OTO Q;  2Q2H A;  1VQN A;  1BVS A;  1Y14 B;  4O0A A;  3J7Z C;  3I56 A;  3OTO L;  1NE3 A;  1VQ6 A;  2EIF A;  2I5M X;  3UDG A;  1YJN A;  2Y0S G;  4X65 Q;  4O2D A;  1S72 A;  1Q81 C;  4X65 L;  2VNU D;  3S15 H;  1JE5 A;  4JBK A;  1FVI A;  2LXK A;  4Y7N H;  4IPG A;  4AYB G;  4HIM A;  1MKH A;  2VW9 A;  1Q12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...