4DV5Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv5Q00
3RN2A 4NXML 1G291 4P74A 5LMNQ 1NMFA 1XMOL 1XPRA 4KI0A 4DV6Q 2R7ZH 4BBSG 3CAMA 1BKBA 1E1TA 3GD7A 1BVSA 1K9MC 2CCZA 4DAYB 1W2BA 1HNXL 2VNUD 2C35B 2IT1A 4APVA 1M90C 2YTVA 4RG1A 4DPGA 5GROA 1SROA 1N33L 4DR7L 4A3JH 3HOUH 2UXCQ 1WCMG 4DAMA 3ULPA 2LXKA 1PH4A 2Y0SE 5LMUQ 4JBKA 3J81j 3RLNA 1R9TH 2MNAA 1HR0W 4JI8Q 5JEAJ 1MJCA 3FKIH 3F2BA 1HZ9A 1K3RA 1WOCA 3E0EA 1KHIA 3K81C 5IP7G 3T1HL 4YCUA 3NEMA 3ZJYC 4A3GG 1X3EA 5DLQE 1N33Q 4DR7Q 4A93G 3J80c 3K7UC 3M4OH 3GTPH 2Z6KC 3PIOA 1VQHA 1X65A 5M3MG 3I56A 4GOPC 4A3IH 5IYDH 3K7AH 3BZCA 4DV1Q 2KCMA 4DV2Q 3GO5A 4HJ5A 5GAHC 4PG3A 1WYDA 5FLMH 1YIJA 3HKZE 2JA5G 4IOCA 5M5YH 5C0XJ 4JYAQ 2R93H 3GTLH 3M4PA 3S1NH 2CFMA 4GOPB 4YCWA 4O2DA 3ULLA 1SLJA 1QVGA 2JA6G 1K0RA 3KJOA 2B63G 2R92H 1VQ5A 5M5XH 4FDBA 4J15A 3UDIA 1GVPA 2D0PA 3W1BA 4Y7NH 1HZBA 3RNUA 1JB7A 2WAQE 4JBWA 4MNOA 5GAEC 3M4QA 2WP8J 3PV0A 4JOIA 1VQ4A 3CP0A 2GVAA 4X65L 3CCJA 4OONA 1PH6A 1K8GA 4LFBL 2HIXA 3W5OA 2UU9Q 1W3SA 4DK6C 4DV5L 1UEBA 2OCEA 3I4NG 4BY7G 2A1AA 2PQAB 4DV7L 3KLWA 3MXNB 4B3ML 4K0KQ 2E5LQ 4LW1A 4AYBE 1QUQA 2EXDA 4QY7A 4X64Q 4BY1G 1YHQA 1K73C 1KAWA 2UUAL 1QVFA 1J5EQ 3PO3G 2VZAA 4LF4L 1YJWA 2ID0A 4R4QA 2E2JH 4DV5Q 3PUYA 4HJ7A 1VQ8A 4A3MH 3PF5A 3RR5A 4IPGA 2VQEL 2HT1A 4B3MQ 1YEZA 3KF8B 2ZJQA 4B3RQ 4IPDA 1QVCA 2CQOA 3F8TA 2UXDL 5IYCG 3HKZG 2UUAQ 3RZOH 3CF5A 1NTGA 4NB3A 1S40A 1XNRL 4LF4Q 4H02A 3CC4A 2MO1A 5JEAG 3G6EA 1I3QH 1SRUA 2HQLA 1N36Q 1KIXA 1CSPA 3FKIG 3CCVA 1HR0L 3M7NA 3EBEA 1A8VA 3S17H 4LFAQ 1CKNA 4BBRH 4LF5L 1I6HH 4WJ4A 4JI5L 4POGA 1X6OA 4GLXA 1YI2A 1VQ7A 4R4OA 4A3BH 3PUZA 1Q1EA 1VQEA 3I55A 4JOIC 2OQKA 3TS0A 2E8GA 4QL5A 1XNRQ 4YCVA 1HH2P 1Y1VH 1PA6A 4AQYL 1Z47A 5C4XH 3OW2A 4DR2L 4A3IG 1HR0Q 1UE5A 1WI5A 3B6YA 1V9PA 1VQNA 4LF5Q 2WFWA 3I4MH 2DGYA 3HOZH 1OXSC 2V1CC 2IHFA 5C0XG 2R93G 1XNQL 3CQZH 1KQSA 4AYBG 4C3JH 3CD6A 2AKWB 1GD7A 2JEBI 1OXUA 3F2DA 2RHSB 4DR2Q 5M5WH 3AYHB 5JJLA 1C7YA 4AIMA 3PSIA 5EAYA 3G48A 1HNZL 2RF4A 4A75A 2ZTDA 1IBLL 1XNQQ 1SMXA 1QUQB 2R7FA 5M3FH 3PGZA 4LUZA 4YWMA 2F3IA 1O7IA 4QQBX 3GTJH 1SE8A 3J81i 2K5VA 3Q8DA 1PYSB 1TWCH 1NBWA 1KRSA 1UE1A 2JA7G 2Z6KA 3TEHB 1HNZQ 5C0XI 2K4KA 1IBLQ 3K80C 3GTGH 3PF4A 2JE6I 4O0AA 1I94L 4DR4L 2K5HA 3HOYG 1FGUA 3GTQH 4LFCL 4QJFA 3S1QH 1QZHA 1VCIA 3STBD 4A3FH 3S14H 1CKNB 1N34L 2R7DA 3PO2H 2EQSA 2VUMH 1TWAH 1VQGA 1AE3A 2F4VL 4BXXG 1IBKQ 1FVIA 1PVOA 2PQAA 2NVXH 1P8LA 5HGQA 5GADC 4QIWE 3W1GA 3KJPA 2YU9H 4NXMQ 4LFCQ 2JA8H 3TS2A 1Z9FA 3GDEA 3L2PA 1Q81C 1XMOQ 1E7ZA 2OQ0A 3VDYA 2OTLA 4YY3L 4YWLA 2QA4A 3HOVH 2VY3A 4MZ9A 1HNXQ 5JJIA 2UXBL 1YZ6A 2MQHA 3CPFA 1YITA 2IY5B 1OXTA 3UE0A 5C4XG 3CXCA 1MJEA 1Y14B 1X9NA 4P72A 4DV3L 4OWWB 1T9HA 3I7FA 1GO3E 3S16H 2GVBA 4POFA 3CCEA 1PHJA 2QGQA 4JBJA 4P73A 2LSSA 1V43A 3KF6A 1PV4A 2UXBQ 3T1HQ 4A3EH 3GTOH 3AFQA 1PH2A 1AE2A 1NY4A 1K8AC 1PH1A 2I0QA 3BU2A 2ZTEA 3M3YH 3H0GG 3E9IA 4C3HH 4JI4L 4JC0A 2YYZA 1EUJA 1V1QA 2AHOB 4HJ9A 1FL0A 4XIGS 5GQOA 5M3FG 1IXRA 2WB1E 2PI2E 3OYYA 4A3KH 2UUCL 2K14A 3U4VA 3M85A 1Y1WH 2EIFA 4HJAA 2NVTH 3DLLA 4JI4Q 1BBUA 5IY0A 4IPHA 3CC7A 3S1MH 3PIPA 3FHWA 4A3CH 4P71A 1BBWA 4A3LH 4JI0L 1Q12A 2BA0A 2K75A 1WFQA 2CWAA 1VQLA 3A5UA 1RL2A 4A3FG 1PH3A 3CC2A 4OO1G 3SGIA 3RZDH 1L2FA 4WJ3M 1G51A 1P16A 3PO2G 2UUBL 2R7ZG 1MKHA 2KENA 4X65Q 4IFDJ 1I50H 4X62L 4LFBQ 1JJ2A 1C0AA 2B29A 1SFOH 5FLXc 3I2ZA 4JI0Q 4GKKL 1G6PA 3UDFA 2XTIA 4GN4B 2VW9A 4DV7Q 2Q2TA 4DUZL 5K36G 1DGSA 3F1ZA 4YHHL 4A3JG 1VQ6A 3HOUG 1B7YB 1VQCA 2RHQB 1VQBA 2UUBQ 3HOWH 4JBMA 3CPWA 4JI1L 1YHAA 2JEAI 3KF6B 4LWCA 4YWKA 3TREA 4PMWA 1KC8C 2XGTA 3AFPA 4DR5L 4R4IA 1XPOA 2VQEQ 4DUZQ 5HY6A 2JA9A 2NZOA 2WB1G 4R1JA 2HIVA 4L5QA 5GAGC 5IWAL 1HZAA 1PH8A 4GLAC 2KHJA 2ATWA 4IOAA 4LUOA 4OO1I 2K5NA 2A19A 4UP7A 4Y52H 4JI7L 1M1KC 4A3DG 5IYDG 4OWXB 1QZGA 1IBML 4LF6L 4UP9A 4DR5Q 4A4IA 2BH2A 4DR6L 1PFSA 1VS0A 5FLMG 4JI5Q 5IWAQ 4BBSH 4MTNA 1WJJA 2NVQH 1PYBA 2N8NA 3D31A 4JI7Q 3S24A 3J81c 4AQYQ 2YV5A 4K0KL 1J6QA 1E3PA 2R92G 3H3VH 1IBMQ 1D7QA 1C9OA 1YVCA 4DR6Q 2Q2HA 5JJKA 1Y1WG 3S2HH 3M9BA 3ULJA 4NPSA 3RLFA 3U4ZA 4JV5L 4A3DH 4EX5A 1E24A 4PZ6A 1N32L 2PI2A 4A3GH 2ALYB 2N49A 4C2MH 4A3CG 4DUYL 1X3GA 1EQQA 2D62A 3S15H 3KYHC 1JJCB 2IX1A 3WWVA 1CSQA 1I5FA 3T1YL 5H1SE 1N9WA 4JI3L 2E2IH 4GKJL 1N32Q 2L15A 2I5HA 4IFDG 2KBNA 1MIUA 3NBHB 1EIYB 3STBC 2IX0A 4AH6A 4A3MG 4HIDA 1LTLA 4DK3C 2DUDA 3FP9A 1PH7A 3UE1A 2JA6H 1VQJA 3T1YQ 2PNHA 4JI3Q 1CKMA 1X56A 4GKJQ 1PH9A 1NE3A 3HOWG 4OXPA 2VS1A 2H5XA 2N78A 3K8AA 4LUVA 2ZTCA 4UPAA 1I94Q 2HHHL 3AEVA 4DR4Q 3GTKH 3UDGA 2ASBA 3CCMA 1JE5A 1KXLA 1YNXA 4BBRG 5IT9c 4DV6L 1N34Q 3TRZA 3PUWA 3D0FA 1CKOA 2KCTA 4A3BG 2K52A 4DNIA 1A62A 4DV0L 4ALPA 3I4NH 5C44H 3J7A5 4BY7H 1VQFA 4IPCA 4DR1L 3U50C 1Y1VG 2HHHQ 1VQPA 2NZHA 1SN8A 4BY1H 1FJGL 1B70B 1CUKA 5ELOA 2UXCL 1Q82C 3I4MG 1Q46A 3PO3H 3F2CA 3CCUA 5LMUL 2OTJA 3CMEA 1L1OC 3PUVA 3HOZG 4YY3Q 4JI8L 5FJ8H 2D0OA 1L0WA 4DV0Q 3BJUA 3OTOL 1PH5A 3J7ZC 4DR1Q 1VQKA 4JI6L 3L7ZC 3I4OA 1EOVA 3U58A 1YJ9A 1EYGA 4LF8L 4GLVB 1FJGQ 2JJQA 1A0IA 5IYCH 1UE7A 4DV3Q 2ES2A 4OX9L 1VQMA 1L1OB 1K83H 2MO0A 4HJ8A 3AQQA 3OTOQ 2B3GA 4GN5A 2JQOA 2A8VA 4DV1L 4GNXA 2JK8A 2BH8A 4DV2L 1VQOA 4JI6Q 4TVAB 1VQDA 4LF8Q 1N8RC 2K50A 4BA1I 5IP9H 4JYAL 2MFIA 4OWTB 3S1RH 1TXYA 2N3SA 1GM5A 4OX9Q 3KDFB 4TQUS 4JCVE 2VQFL 2ZJRA 3NENA 3L0OA 2AWNA 4R4CA 2ZM6L 2FXQA 5IYBH 1VQIA 1VQAA 4DKAC 2UUCQ 1S72A 2ZJPA 1OTCA 3H3VI 1NMGA 2PMZE 1X3FA 3CMAA 5BR8L 1B8AA 4A76A 3J80i 3DM3A 4GS3A 1VQ9A 1HNWL 3CCSA 3RN5A 1YJNA 1JJGA 2VQFQ 2Q2UA 2VUMG 1OXVA 1XPUA 2UU9L 4P75A 4LF9L 2ZM6Q 2AMCB 4IO9A 3A5ZB 2E5LL 4X6AH 1U5KA 4BA2I 1UE6A 5BR8Q 4X64L 3JAMc 2QEXA 2JA8G 1ASYA 4X66L 3HOXH 4RMFA 1J5EL 3A74A 1HNWQ 5C3EH 1LYLA 1TWGH 2Y0SG 4LF9Q 3HOVG 4X62Q 5C44G 5LMNW 4LF7L 2JA7H 2LXJA 3IRBA 3GTMH 1GKHA 3G71A 4GNXC 4HIKA 3KFUA 1YBYA 4GKKQ 4DV4L 4B3RL 3BZKA 3E9HA 1HZCA 4X66Q 1X55A 4YHHQ 4PZ7A 2CWPA 3JAMi 2CKZB 1N36L 1KD1C 3HOYH 5FJ8G 3CCQA 4UY8C 3HKSA 3K0XA 1EWIA 4JI1Q 1SR3A 3KOJA 1XMQL 1IL2A 4GNXB 4LFAL 1S3OA 2E2HH 4A3EG 5J3BA 4DV4Q 1Q1BA 4HIMA 1HJPA 1JT8A 4NXNL 3EIVA 4LF7Q 2F4VQ 3LGJA 4BXXH 1TWHH 5ELNA 3RLOA 1UWVA 1EIFA 3MEFA 4R4TA 4B3SL 1XMQQ 4B3TL 4IJLA 1YHBA 2F52A 1U0LA 2YTYA 1XJVA 2IHEA 1RIPA 5AJ3L 1X54A 3PUXA 1IYJB 4XTCS 1WCMH 1E1OA 4L5RC 4LF6Q 4A3KG 1JMCA 4NXNQ 4C3IH 5IP9G 3H15A 2I5LX 2WAQG 1TWFH 3ER0A 1Q7YC 4JI2L 1KL9A 5IP7H 1EQRA 4L5TA 1Q86C 4B3SQ 4B3TQ 4KHZA 4HIOA 4A93H 5AJ3Q 3UDXA 4UP8A 4L5SA 2AWOA 2NN6G 5IYBG 5C4JH 2OWOA 4A3LG 1H95A 1IZ6A 1L1OA 3JC66 2Q2IA 4GN3B 1Q8KA 4ME3A 4DR3L 5M3MH 4JI2Q 4JV5Q 2VL6A 2GN5A 3G4SA 3TQYA 3S2DH 3A0JA 2NVYH 1EFWA 1A63A 2JA5H 1KRTA 3HFZB 4LNQA 4DUYQ 3H0GH 1OXXK 3EN2A 3ERSX 1ASZA 4PZ8A 4DR3Q 3KDFA 3CCRA 3NELA 1E22A 1LUZA 1NJIC 4KHPL 2B63H 3HOXG 3CCLA 5E7NA 2KHIA 2R6GA 5C3EG 3ICEA 1AH9A 3PCOB 2UXDQ 2Z0SA 1LM0A 2NN6I 4JG2A 4EQ5A 5LMNL 4GOPA 5IE8A 1D8LA 2I5MX 4IJHA 4KHPQ 2RCNA 3CW2C 1IBKL 2YTXA 2BA1A 4QGUA 4IFDI 4KLKA 1XTDA
chains in the Genus database with same CATH superfamily
5C5MA 1GUOA 2EYLA 4XQJA 2K6AA 4FXGC 1JR0D 2KECA 4DV6Q 3L9AX 2CCZA 3GD7A 1B2TA 3EQLC 2K5WA 3MXNA 4APVA 1BCPC 4M1UB 4KHVA 1N33L 1HCZA 2BDNA 2MNAA 4UDUC 4JI8Q 5JEAJ 1HZ9A 3ITPA 1K3RA 4DAVA 1KHIA 2L4NA 3K81C 5CV6A 5E4XA 5DLQE 3M3YB 3K5NA 4A93G 4LJZC 3J80c 2LS01 1F9RA 1WTQA 2Z6KC 3PIOA 5IYDH 1IW7D 4R8NA 1Y1WB 1HFNA 1VMPA 1WYDA 5CYUA 1YIJA 4JK1C 4IUUA 5C0XJ 5I4DA 1BR9A 4IUVA 1ESFA 5CC4A 3S1NH 1QVGA 3KJOA 4IURA 2B63G 4KKSA 2R92H 2D0PA 1RKNA 5FO9B 1JB7A 4X3SA 3PV0A 1VQ4A 2AQ3B 1JWUD 3OHXC 4X65L 4LFBL 4A3MB 1STYA 1UEBA 4DV7L 1TQOA 4K0KQ 2E5LQ 1NNXA 4G7OC 1VDZA 1BQQT 1PTOD 1JCKB 4M8AA 4QY7A 3RZOB 3HOWB 2D5DA 2KOLA 1DONA 2ID0A 3AB9A 4R4QA 4DV5Q 1GXDC 1VQ8A 5AFWA 3PF5A 3RR5A 2VQEL 4B3MQ 1YEZA 2F0HA 3KF8B 2CQOA 1B44D 2UXDL 1GUNA 2UUAQ 4FF3A 1S40A 4LF4Q 2MO1A 3H3VC 3NPPA 3CCVA 1HR0L 3S17H 1A8VA 2KUMA 1T5EA 1JOOA 2L55A 5IGDA 1CKNA 1X6OA 1VQ7A 4A3BH 3ZYYX 5IGBA 4HSPA 3WOEA 2BOSA 4G57A 4QL5A 1Y1VH 2LMCB 5C4XH 3FMCA 3S2HB 3I4MH 1SYDA 4LF5Q 2WFWA 3K5OA 5FO7B 1VQNA 2DGYA 3HOZH 1SDFA 3NBIA 2X6LA 1SSOA 4AYBG 4C3JH 2AKWB 4PMBA 2JEBI 2M2LA 3F2DA 2RHSB 4DR2Q 5EGTA 1IL8A 1STHA 5A35A 2KQ3A 2AQ1B 4CDFC 1LV9A 2RF4A 1XNQQ 3QJYA 1JORA 4YWMA 2F3IA 1GUGA 2RSOA 1O7IA 1Q90A 3CHBD 3DEPA 1SE8A 2A6HD 4EQPA 1Y8NB 1ZYRC 3S14B 1EU4A 2A6EC 2Z6KA 3TEHB 1IBLQ 1TWAB 3K80C 4CKCA 2B2VC 3F2UA 3PF4A 2JE6I 3CRKC 1SNCA 2CHBD 2JA8B 1QB5D 1STEA 2DY7A 2EXZA 2R7DA 1WTPA 4L8JA 4FYDA 2PQAA 1P8LA 3QR8A 4NXMQ 4LFCQ 3K58A 1SJED 1F9PA 4CKEA 1XMOQ 2E2DC 3OSOA 2OTLA 2VB2X 1B1ZA 3DWPA 3CU7A 2MQHA 3CPFA 1YITA 2IY5B 3UE0A 3PIP3 1MJEA 2B2YA 4OIJA 2F0DA 3A56A 1ZXTA 3I7FA 2RVLA 3S16H 2GVBA 3S1QB 2O5JC 1ICWA 2QGQA 2LSSA 1V43A 2J0TD 3T1HQ 4A3EH 3AFQA 1AE2A 1JC7A 2OF1A 3M3YH 5CORA 1HA6A 3N52A 4LMQD 1D5ZC 2YYZA 1EUJA 4HJ9A 2AHOB 5I2XA 5T1IA 4X3UA 2WB1E 1AW7A 3OYYA 2LKVA 4A3KH 1Y1WH 3FPUB 1XXGA 3RMHA 3DLLA 3RZDB 1BBUA 5IY0A 2TMPA 3CC7A 1PTOF 4DXFA 1RTNA 3MFYA 4A3CH 5JVG3 1BBWA 1PRTD 4A3LH 1Q12A 2K75A 3VYRA 2WKCA 2M00A 2CWAA 2K01A 1OO9B 1KABA 1RL2A 1PH3A 4OO1G 4OHJA 3SGIA 3PO2G 1P16A 2UUBL 2R7ZG 1MKHA 4IFDH 3GTMB 1HRJA 1EYDA 4JI0Q 2NTTA 3I2ZA 4GKKL 4GN4B 2VW9A 4DUZL 1DGSA 3F1ZA 4C56C 4A3JG 1B7YB 2QCPX 1MSGA 3HOWH 3SXHA 3MA2B 1BDOA 3NBHA 2F0PA 2LFNA 4JI1L 4LWCA 4YWKA 4BBSB 4Z9CB 1XPOA 1D6EC 2JA9A 4R1JA 1PH8A 2HIVA 4CHTB 5CV5A 1TIID 4UP7A 4DFAA 5DNFA 4JI7L 3MWYW 3NP8A 4UP9A 3A7LA 4C3IB 2BH2A 1PFSA 1VS0A 5HURA 5FLMG 1HPCA 3M7GA 1A2TA 2N8NA 4RH6A 3S24A 1E3PA 3E5SA 2F0GA 4DR6Q 5M3MB 3A8IE 5EPKA 5JJKA 3S2HH 3U4ZA 1N32L 2PI2A 2ALYB 1LTSD 4C2MH 1NAPA 4I65A 1UNSA 3T1YL 1CSQA 3EVQA 3HP3A 1BOSA 2EYPA 3NTHA 2IX0A 4AH6A 2G9HD 4HIDA 1LTLA 2L12A 3QO2A 2PNHA 5I6WA 2RDHA 1PH9A 1BUVT 1LT5D 2M9VA 2JYOA 1I94Q 1F2LA 2ZXPA 4DK0A 3UDGA 3CCMA 5CV9A 5IT9c 2K28A 3PUWA 2KCTA 2WACA 2F0QA 2RSNA 1SNDA 1VQPA 3HKZB 1SN8A 5KIXA 4HTHA 1RJTA 2OTJA 3CMEA 1VF5C 5FJ8H 3BJUA 3Q0AA 1PH5A 1AN8A 4ZRZA 3J7ZC 3IAYA 4DR1Q 2WIIB 1EYGA 2K03A 2A68D 1ENAA 4A3IB 3G7LA 4L6TB 4HJ8A 2RA4A 3OTOQ 1PZKD 2A8VA 3S1QH 4DV1L 4GNXA 4DV2L 1SYEA 2MUYA 4TVAB 5M5YB 2R93B 3C1EA 1PRTF 1DD2A 1SE3A 1TXYA 1GM5A 4OX9Q 3KDFB 1EY9A 5CBAE 1U4RA 2ZJRA 2ZXRA 3C46A 2OT2A 3NENA 2ZM6L 5JPNC 3H3VI 1VQAA 1LTRD 1S72A 1S5FD 1DZ1A 5BR8L 1B8AA 3DM3A 1HNWL 1EEFD 2VUMG 1X32A 4LF9L 5CV7A 4IO9A 3ND8A 2PYKA 4X6AH 1ASYA 3R8BA 1WTWA 3JAML 1EY5A 1LYLA 2Y0SG 2K33A 4X62Q 2JN4A 3GTMH 3G71A 4RCNA 1DCZA 3BZKA 3E9HA 3HGBA 1TWHB 5A2QL 1JWMD 4OEMB 1N36L 3CCQA 3J80E 3K0XA 1EWIA 2A69C 2MP1A 4LFAL 1R4PB 4HIMA 3TZUA 3FVQA 1C48A 3EIVA 4LF7Q 2F4VQ 4XT3B 3NSWA 3I70A 1EIHA 4ULLA 2QW7A 1O7YA 1KNAA 1YHBA 5C4JB 1RIPA 5AJ3L 4LF6Q 2B2WC 5LL6X 4C3IH 2NBFA 3K57A 3CQZB 3BS1A 4OELB 4B08A 1Q7YC 5IP7H 4L5TA 5J39A 3E6ZX 1H95A 5IYBG 4DR3L 3JC66 2WV6D 4GN3B 1Q8KA 2XWBB 5M3MH 4EQOA 5M3FB 2JXMB 1ENFA 4JI2Q 4JV5Q 2VL6A 5K5PA 5M9OA 1B4OA 1KRTA 4QIWB 4LNQA 3H09A 4KD3A 4DUYQ 5ELFA 4U673 5JJZA 1PZID 3HOXG 3DUZA 2KA7A 5E7NA 2R6GA 4O1NA 1TY0A 1FR3A 3BZDB 3PCOB 1CI3M 3GTQB 5E1FA 2Z0SA 4A3FB 1H9SA 4HN7A 3IFDA 1GUTA 1PFNA 2I5MX 5KNBA 1IBKL 2KEEA 3Q6SA 4IFDI 4TKOB 1A6XA 1XTDA 2JP1A 3RN2A 1JOQA 2FHTA 3V2TA 4P74A 1C8CA 4OO1H 4KI0A 2R7ZH 4ZCKA 3CAMA 1BKBA 1E1TA 1BVSA 4DAYB 1W2BA 1HNXL 2SNMA 1H9MA 3KK7A 1O80A 2YTVA 4ZYSA 4FXKC 4KMUC 4A3JH 4CJ0B 1WCMG 1A3VA 1PH4A 2Y0SE 3VYSA 2F0MA 4JBKA 1R9TH 4XQNA 4QB4A 4C1NI 3GTOB 1WOCA 3E0EA 1BCPB 1E2ZA 3ZJYC 1IKLA 1V8QA 1PYWD 3DHQA 4FVMA 1N33Q 2PMZB 4FP5D 4KY7A 4NDXA 1XTCD 3SK8A 1VQHA 1X65A 4GOPC 2R92B 3OPOA 3I72A 4A3IH 3K7AH 3BZCA 2EYMA 1SYCA 3GO5A 4PG3A 5FLMH 2ENBA 2K05A 5M5YH 2R93H 3M4PA 2CFMA 2JA6G 3ULLA 4F7XA 1K0RA 4F87A 5J1ZA 4KKUA 4XT1B 3TN2A 3A54A 4FDBA 3W1BA 3RNUA 3ND9A 3OIPA 4OONA 4H13C 1K8GA 1SFOB 2HIXA 3W5OA 1W3SA 2OCEA 3I4NG 3VR6A 2PQAB 4MHEA 1S5ED 1QUQA 4BY1G 1K73C 4IUPA 2F03A 4WRDA 1I4PA 2BCOA 4HJ7A 3RD4A 3I4LA 3QWNA 4IPGA 2A5HA 3N6RA 1WTRA 3RUZA 2Z4IA 1W6JA 4A3BB 4B3RQ 1QVCA 1LTBD 1TU2B 5IYCG 4DK1A 3CF5A 1L0YB 1NTGA 1Y1VB 4NB3A 1XNRL 1D2BA 4H02A 1SJHD 5JEAG 2HQLA 5IODA 1KIXA 4WORA 1CSPA 3FKIG 3I4MB 1RDPD 1QOHA 3HOZB 4WJ4A 4J8QA 4R4OA 2QDLA 2OQKA 2E8GA 4YCVA 1HR0Q 1WI5A 3B6YA 2F0KA 3T51B 4NMZA 4A3DB 5C0XG 4HR7B 3CQZH 1KQSA 1EQTA 3CD6A 2Q8RE 5M5WH 2NB0A 2AQ2B 5JJLA 1C7YA 4K8IA 2E2IB 1X3PA 3G48A 4N9PA 4B9WA 4A75A 2ZTDA 1SMXA 1U4PA 3LWEA 2R7FA 5M3FH 4QQBX 5EBDA 1PYSB 2JA6B 1TWCH 3MEHA 1NBWA 1UE1A 2JA7G 1LTGD 3J7AV 2L0CA 1O7LA 3K6OA 3GTGH 3NE5B 3HOYG 1HFGA 3GTQH 1F2MA 4DNTB 4QJFA 1B3AA 4A3FH 2EVBA 1PXUA 4QMGA 3IL8A 1LT6D 4IUQA 2VUMH 1AE3A 4BXXG 1LACA 4ZUIA 4BY1B 5K36H 1FD7D 3S16B 3GDEA 1Z9FA 3L2PA 3D4DA 1Q81C 2QILA 1E7ZA 1MGSA 4YY3L 3A8JE 4ZK9B 2NZ1D 4RHRA 4A3EB 3FPPA 1WVLA 4PNYA 1I4HA 1Y14B 4DV3L 2BE5C 4OWWB 5FOBB 1T9HA 1GO3E 1G6ZA 2L5TA 3CCEA 4LK1C 2N55A 3KF6A 1MD2D 3Q22A 4A3KB 1BF4A 3GTOH 5KNCA 4KN4C 3BVGA 1I4RA 4XIGS 2I07B 3MFGA 1K8MA 4N8FA 2PI2E 2UUCL 2EIFA 3VR3A 1CT1D 4UHVA 2ICIA 4JW0A 1FNUA 5IGGA 1CK1A 3BDLA 4P71A 5IT9E 3VR4A 1ET9A 2BA0A 1PTOC 5DM73 2G9DA 1EY8A 3CC2A 1QE6A 2B2YC 4WJ3M 1G51A 4IFDJ 1I50H 1C0AA 1JJ2A 3DEOA 3NWSA 3R2IA 1SFOH 2Q2TA 1SE4A 3OIQA 5FLXL 3LWUA 4YHHL 1VQCA 3HOYB 1VQBA 2UUBQ 5IOCA 4ZKBB 2XGTA 3AFPA 4DUZQ 5IWAL 2WB1G 4IOAA 4OO1I 4GLAC 2KHJA 4Y52H 4EVOA 2X6GA 5JPMC 2MGSA 4F88A 1RHPA 3ONAB 4A4IA 2B39A 2MPMA 4JI5Q 4L63B 4KJNA 2NVQH 1I4GA 1PYBA 2IJ0A 1Q8IA 4JI7Q 4A93B 4C2MB 1GHJA 3A55A 2YV5A 2HDMA 4AQYQ 1IKMA 3H3VH 1D7QA 4LAAA 4RGOS 1C9OA 3KBXA 3U9SA 2XRSD 2Q2HA 4PV1C 1EFID 4RCOA 3RLFA 3S2DB 4A3DH 1ML0D 1E24A 2K1BA 2L1BA 5ELCA 2A6HC 4RGTA 4HMIA 2K7VA 1I6VC 5EJWA 3WWVA 2B63B 1N9WA 4JI3L 2E2IH 4JPBW 1N32Q 2I5HA 4ZAIA 1AZPA 1EIYB 4K6LA 1SMYC 2HD3A 4KN7C 1QWYA 3FP9A 1PH7A 3UE1A 2JA6H 1VQJA 3T1YQ 2KCCA 1U4LA 1CKMA 1O7ZA 4I7AA 2SOBA 1NE3A 1W6KA 1AEXA 2EJMA 1TT2A 2H5XA 3K5MA 4UPAA 4DR4Q 2B8GA 2D9UA 2ASBA 1RTOA 1JE5A 2A6ED 5LL6S 4BBRG 4DV6L 1N34Q 2SNSA 3D0FA 1CKOA 4V0BA 1SE2A 2K52A 3DWQA 4DV0L 4ALPA 3I4NH 2DJFC 1VQFA 3H91A 4IPCA 5L37A 3AMUA 1BO0A 5ELDA 1FJGL 4BY1H 4IUTA 1CA5A 2DY8A 2AUJD 4XDXA 4JI8L 1L0WA 2E74C 4JI6L 3U58A 1EOVA 4KKTA 3M4OB 4GLVB 3GTPB 3MXPA 5IYCH 1K0SA 1VQMA 5T1GA 3TMEA 3C1FA 3AQQA 4GN5A 2JQOA 3G6JB 3TP8A 1K28A 2HCCA 1VQOA 1VQDA 3HS0C 3GTLB 4BA1I 5IGEA 4AYBB 4FF2A 1CQVA 2PPBC 2K5DA 5M5XB 2ICEC 1PRTC 1UUPA 3K59A 4KY5A 3L0OA 2AWNA 2P5ZX 1OTCA 1HQRD 5C0XH 3VA7A 5JVH3 1E0BA 4A76A 1VQ9A 3CCSA 1JJGA 3T56B 1OXVA 3C3LA 2ZM6Q 3S9WA 3K5LA 4TRDA 3A5ZB 1S5DD 2E5LL 4S3SA 4BA2I 5BR8Q 3JAMc 4X66L 1JWSD 3A74A 1HNWQ 3GV3A 3MZ5A 3TP6A 4X3TA 1G2SA 5IGCA 4LF9Q 3HOVG 3DMUA 4CJ2C 5C44G 2JA7H 2LXJA 3IRBA 1GKHA 4GNXC 3KFUA 4KK7A 1HZCA 1X55A 2CWPA 2KVMA 1ZKOA 1KD1C 3HOYH 1LLRD 1SR3A 1XMQL 1I6HB 1KLUD 1IL2A 1S3OA 3MAQA 1ILPA 1HJPA 4NXNL 4BXXH 1JB3A 4C3HG 3NHHA 1EIFA 3MEFA 4R4TA 5EKLA 3V96A 2F0SA 3X3MA 4B3TL 1H9RA 2YTYA 3PUXA 1IYJB 4PQXA 4XTCS 1E1OA 3NXWA 5IP9G 2WAQG 3ER0A 4QCLA 1CZGA 1HHVA 1S5CD 2H4OA 4KHZA 4A93H 5IGFA 5AJ3Q 1SNPA 4UP8A 3T16A 2NN6G 2Z8LA 2OWOA 2E76C 2X69A 4IALA 3OOCA 5ELEA 3EA6A 3NQIA 3S2DH 1LT3D 2CH4A 5ELBA 3SE0A 3HFZB 1OXXK 1ASZA 3ERSX 1T5XD 4O42A 4DR3Q 1DOKA 1EY7A 1NJIC 3MTSA 2B63H 3MXUA 4E6IA 4KY6A 3V05A 5C3EG 1LM0A 1LTAD 3PO2B 5LMNL 2R7ZB 5IE8A 3QIAA 5CGKA 1SXTA 4IJHA 2F0LA 2RCNA 1A2UA 3CW2C 3PQIA 2NVXB 1Y69U 1EIGA 2BA1A 4QGUA 2YU9B 1AP0A 4NXML 5EPLA 4A3JB 3SVMA 1XMOL 1R9TB 4H0LC 1TVXA 1K9MC 1SNMA 2VNUD 2C35B 2IT1A 1M90C 4DPGA 5GROA 1SROA 1A15A 2A68C 4DR7L 4ABNA 2UXCQ 3ULPA 1SNOA 1WTXA 1KNEA 3VYTA 5LMUQ 3J81j 1HR0W 1O78A 3K7AB 2FFKB 1MJCA 3T1HL 1EZ6A 2SEBD 3URYA 1EWCA 4A3GG 4C3HB 3BVMA 3K7UC 3M4OH 3GTPH 3T13A 3I56A 4OIKA 4HSVA 5EBCA 2PZUA 2JA5G 2NVTB 3HKZE 4JYAQ 3GTLH 3A7AB 3S1MB 1LTTD 4YCWA 4GOPB 1TS3A 1SLJA 4EGVA 1STGA 5COYA 3DXJC 5M5XH 4J15A 4RHSA 4Y7NH 2WAQE 5GAEC 1CA6A 4JOIA 2DN8A 1TY2A 2K04A 2GVAA 2KCNA 2F0UA 3LX0A 3CCJA 1TKWB 2UU9Q 4QUFA 3BDCA 4BY7G 4KV6A 3I90A 3MXNB 4LW1A 1SBBB 5ISRA 4X64Q 1YHQA 3K0YA 1QVFA 1J5EQ 2EYFA 1YJWA 2E2JH 5DM63 3PUYA 2PZTA 2ZJQA 4IPDA 1EEID 3MHBA 1J8IA 3F8TA 4G7ZC 1KDAA 3CC4A 5LHY1 1KTKA 3G6EA 1EL0A 4K2KA 3EBEA 1DM0B 3KUPA 3TP5A 4BBRH 1I6HH 1YI2A 4B9XA 1Q1EA 4C1NK 4FNFA 1XNRQ 1HH2P 3J7YW 5M5WB 3IKJA 4CKBA 3OW2A 1SNQA 3VYUA 3P7JA 2A69D 1OXSC 2V1CC 2IHFA 5I9PA 1OXUA 1PFBA 3HRZC 1SYBA 1TWCB 2PQEA 3EROA 3GTGB 4ME5A 1HNZL 3KLRA 5BN5A 3Q23A 3PGZA 4LUZA 4EQNA 2NWGA 2F0FA 4K8JA 3BYTB 3NUCA 3Q8DA 3SK6A 1CFMA 5C0XI 2VUMB 2F4IA 4IN3A 4DAPA 1QNUA 4O0AA 1I94L 2K5HA 1FGUA 3T53B 1IYUA 2EY1A 3STBD 3VR5A 4RWSC 1CKNB 2Y0SB 4RA8A 3PO2H 2EQSA 3GV6A 3Q24A 2NVXH 5GADC 4QIWE 2YU9H 1K8OA 2A73B 3I91A 5I9OA 2DNCA 1GHKA 1YNJC 2H1EA 2FMMA 3HOVH 1CHQD 2HQEA 2UXBL 5C4XG 1LABA 1HXYD 1FNWA 1K83B 4J1MA 4XXEA 5FO8B 4F8MA 3R2TA 1V1PA 2EJFC 1E2VA 5FK9C 4G4KA 4POFA 2CVRA 4JBJA 4P73A 4C3JG 2F3VA 1GOZA 3H6MA 2I0QA 2ZTEA 3H0GG 3E9IA 4C3HH 4JI4L 4JC0A 1V1QA 1FL0A 1PZJD 4XYOA 1Z6HA 3A8KE 5JOBA 4BS9A 2OXPA 4HJAA 2NVTH 3DM1A 4IPHA 3I3CA 1I50B 3D4RA 3S1MH 3FHWA 2NN6H 3OMCA 2EJGC 1L0XB 1YNNC 3HOXB 2R61A 1VQLA 2XWJB 4ZLTF 1TWGB 1L2FA 4X65Q 4X62L 4LFBQ 4Q0FA 2F0VA 1XWEA 5FLXc 4DV7Q 2XTIA 1PTOB 3P75A 4K14A 3BYYB 2HDLA 5C5LA 1STNA 1ENCA 3OW7A 3LNNA 1VQ6A 3HOUG 4CDCC 2IW3A 4JBMA 1CM9A 4IQZA 1YHAA 1K3BC 3NWTA 5D65A 4CBVA 2JEAI 3TREA 2E2HB 4PMWA 1KC8C 3HZXA 4DR5L 4R4IA 1WTOA 2VQEQ 2NZOA 5GAGC 4LF7L 2F4VL 4L5QA 2NVQB 1HZAA 1M8AA 1STBA 3P1HA 2UXDQ 4LUOA 1ESRA 2B2UA 4ODGA 1M1KC 3TZDA 2C9OA 1QZGA 1WCMB 3EFXD 1IBML 4LF6L 2XIWA 4CDEC 5IWAQ 4ZUJA 4MTNA 1SEBD 3D31A 3SK5A 1PMRA 2RKSA 1J6QA 2V4DA 3J81L 1GJXA 3R93A 1Y1WG 2B2TA 1GUSA 3D4WA 2F0NA 2R3ZA 2KEDA 4JV5L 1XX8A 4A3GH 1QJOA 1KLGD 4N8X1 3JAME 2N49A 1TS5A 4MIUA 4A3CG 4DUYL 4RGNA 3PMFA 3KYHC 4WFN3 2DNEA 4G7HC 1MBYA 2CW0D 1WTHA 4GKJL 5A2QE 4IFDG 1MIUA 3NBHB 1EY6A 4A3MG 4HEDA 2MHVA 1B9NA 3MXGA 3BDOA 1B50A 1DOLA 1B3QA 4JI3Q 3I4NB 1X56A 1BBXC 3HOWG 4UAIA 4OXPA 3K8AA 2RDFA 2VS1A 4LUVA 2HHHL 5CR3A 1YNXA 3KLSX 1A62A 4BY7H 4R8IA 3QG1A 3U50C 4J6HA 3HOUB 1V1OA 1B70B 5ELOA 2EY5A 1L1OC 3FKIB 1IW7C 1DXMA 4CDDC 4ZKCB 4Q5VA 4DV0Q 2Z4HA 2K5QA 2J7ZA 3D8GA 1H9KA 3L7ZC 2IX3A 3I4OA 3L3OC 4LF8L 1FJGQ 1BCPD 1A0IA 1D1IA 2I46A 1EQVA 3NTKA 1K83H 2B8FA 5KGUA 1D1KA 2B3GA 1VMCA 4JI6Q 3CRLC 1II3A 5G3LD 1N8RC 3J7AF 2MFIA 4YIJA 3SDZA 2BE5D 4NW2A 1NR4A 1TR5A 4JCVE 2VQFL 5C6AA 1R4QB 1U9RA 5DAUA 4R4CA 1M4VA 2FXQA 5IYBH 2MJ8A 4DKAC 2ZJPA 2O5IC 3H94A 3CMAA 3R3OA 5IIFA 2FMCA 2F0EA 4GS3A 1PRTB 3RN5A 1YJNA 3SEBA 1XPUA 3VA5A 4P75A 1HUNA 2JA7B 1NSNS 2TSSA 2WKDA 2AMCB 5JAVA 5EKIA 1UE6A 2JA8G 1B53A 3HOXH 1TWGH 2PNRC 1QNKA 4GKKQ 4HIKA 1YBYA 4DV4L 4B3RL 1RF2D 1PTOH 2RDGA 5D3DA 4X66Q 2CH4W 4PZ7A 1I3QB 3JAMi 5FJ8G 3HKSA 5KRUA 1HTPA 4JI1Q 2IPKD 3KOJA 1ZEQX 4GNXB 1FNVA 2E2HH 5J3BA 1Q1BA 3KBGA 2KJXA 1JT8A 1DYQA 3LGJA 1EY0A 3OWFA 1ILQA 1UWVA 1U4MA 4B3SL 1XMQQ 2F52A 1XJVA 1X54A 1WCMH 1JMCA 2ZXOA 4NXNQ 4HCEA 5J22A 2I5LX 1D5XC 3UI2A 4DAYA 1WTVA 1KL9A 2L9HA 4B3TQ 4HIOA 3UDXA 4L5SA 1WD0A 1L1OA 4CJ1B 3TQYA 3GTJB 3A0JA 1MI2A 1PFMA 2NVYH 1A63A 2Z6BA 4X3KA 1QCBD 3OMGA 3H0GH 1H9JA 3EN2A 4GZYC 1F9SA 1QILA 3NELA 1E22A 1LUZA 4KHPL 3NTIA 1SAPA 3TDQA 3P20A 5KYIA 3ICEA 3D6WA 3TSSA 2EYHA 4DGZA 3QB3A 2NN6I 3MC0B 2Z9HA 1ZYRD 2EPBA 2Q8IB 1NCVA 2QEJC 2YTXA 3SHLA 4KLKA 1RCVD 2NUCA 1G291 1EOTA 1Y8OB 1IYVA 1SMYD 5LMNQ 1C4QA 1NMFA 1XPRA 4XYQA 4BBSG 1BCPF 1JQYD 5FKAC 3FRPB 2Q8TA 5C3WA 3E0JA 4IUNA 4RG1A 2WB1B 4V190 2EZVA 2G5DA 2F0WA 3HOUH 3J81E 1CHPD 4DAMA 2LXKA 5G3LF 4FF1A 4C3IG 3RLNA 5JEAH 1G8ZD 3FKIH 1GUWA 3F2BA 5IP7G 4YCUA 2PO4A 3NEMA 4KTAA 1X3EA 2IWHA 4DR7Q 3W3AA 1EY4A 4DNRB 5D3IB 3J80L 1JICA 1RODA 5M3MG 2VB3X 4Y7NB 4DV1Q 2KCMA 4DV2Q 4HJ5A 5GAHC 1SYFA 4PMCA 5C3XA 2VXWA 4IOCA 1TS4A 1H9SB 4O2DA 4DF7A 4FF4A 1VQ5A 3UDIA 1GVPA 1HZBA 1EWHA 4RKLA 4JBWA 4MNOA 4K0KL 3M4QA 2WP8J 3CP0A 2E2JB 1PH6A 1XYIA 4DV5L 4DK6C 2A1AA 3FDTA 3KLWA 4B3ML 4AYBE 2EXDA 1KAWA 2UUAL 3PO3G 2VZAA 3SR1A 4LF4L 4A3MH 4BBRB 2HT1A 3VR2A 1EYCA 4KJOA 4P2CB 3RZOH 3HKZG 1X3QA 1V1PB 1N36Q 1I3QH 1SRUA 3M7NA 4LFAQ 4LF5L 4JI5L 3BG3A 4POGA 2B2VA 4GLXA 4QF4A 2HCIA 3PUZA 1VQEA 3I55A 4N9TA 4JOIC 1MSHA 3TS0A 1PA6A 1ICFB 4AQYL 1Z47A 4A3IG 4DR2L 1QG7A 2EOTA 1UE5A 4OL7A 1V9PA 1MHWC 3MVVA 3T4AC 3E3XA 2R93G 1B9MA 1XNQL 5BN3A 1GD7A 1HQMC 2O4XA 3AYHB 4FXDA 3S15B 4H7BA 4ID6A 2PW7A 4AIMA 3PSIA 3I8ZA 5EAYA 1IBLL 1QUQB 5FLXE 2C5CA 1DJRD 3CKIB 3GTJH 3J81i 2K5VA 1FGBD 1KRSA 1HNZQ 2K4KA 3HG9A 1JE4A 5EQ0A 2E75C 1F2YA 2PW5A 2RCFA 3GTKB 4DR4L 1G91A 4DN4M 4LFCL 1QZHA 1VCIA 2BDOA 3S14H 1N34L 3HOVB 4QUCA 1TWAH 1VQGA 3WOFA 5C44B 2F0JA 2XVSA 1IBKQ 1F77A 5NUCA 3TBIB 1FVIA 3NQTA 4K5VA 1PVOA 5HGQA 3W1GA 3KJPA 1I4QA 5KEEA 2JA8H 3TS2A 3PO3B 2FJ2A 1UAPA 1TS2A 2OQ0A 3VDYA 2QA4A 4YWLA 2VY3A 4MZ9A 2NTSA 3I73A 5E3FA 2XSCA 1HNXQ 5JJIA 1NUCA 1YZ6A 1OXTA 5I6YA 3KF8A 4FO2A 3CXCA 1X9NA 4P72A 1KDBA 1PHJA 1EYAA 2A74C 2IL8A 1PV4A 2UXBQ 1PH2A 1NY4A 3S1RB 1K8AC 2WAQB 1PH1A 3BU2A 2CQAA 3ERQA 5GQOA 5M3FG 1IXRA 4ZQ3A 2K14A 3QOJA 3U4VA 3M85A 5EPJA 2RBMA 4XQQA 4JI4Q 4HAEA 2F0TA 4H44C 3PIPA 4JI0L 2L11A 4MTKA 1WFQA 1ET6A 5C3EB 3A5UA 4A3FG 3RZDH 2QF7A 2KENA 3FEWX 3X3NA 2B29A 2K32A 2AUKA 1G6PA 3UDFA 2EYOA 3M4YA 5K36G 1NR2A 2N88A 4NKLA 2RHQB 1IHZA 4HMJA 2F0IA 3DWAA 4K5XA 3CPWA 3KF6B 1CQFA 3QOLA 1Q3LA 4RGMA 5HY6A 2EE1A 2ATWA 1I4XA 2K5NA 2A19A 2NYZD 1STAA 4RFBA 5EKKA 5IYDG 4OWXB 3KLSA 4DR5Q 4DR6L 1PLFA 4BBSH 1TWFB 3SK4A 4U68A 1PDQA 1WJJA 4A3GB 3J81c 2EY6A 2R92G 5CBEE 1IBMQ 2J4XA 5C4HA 1YVCA 1BNZA 4I7ZC 2KHSA 3M9BA 3ULJA 4NPSA 4HCSA 4EX5A 4PZ6A 2JA5B 3EJIA 1VF7A 1DOMA 1EZ8A 1X3GA 3C2PA 1EQQA 2D62A 3S15H 1JJCB 2IX1A 1I5FA 3GP7A 4RAUC 5H1SE 1KDCA 2EYJA 2L15A 1UEAB 2B2UC 2KBNA 5C4ZA 1LTID 3STBC 4DK3C 1HTLD 2DUDA 2JSOA 4WJWA 1F9QA 3U9OA 2OEOA 4BY7B 4GKJQ 2HUGA 1Y8PB 1AFPA 2N78A 2ZTCA 3AEVA 3GTKH 3O13A 2RQXA 5BN4A 2F0OA 1KXLA 2PZWA 3TRZA 4A3BG 2B2TC 5IT9L 4DNIA 3PIO3 1G2TA 5C44H 3J7A5 3HEJA 4JVZA 2GA4B 4DR1L 1Y1VG 2HHHQ 1E2WA 3IFTA 3WDNA 5DEHA 2NZHA 2UXCL 1CUKA 1Q82C 3I4MG 1Q46A 3PO3H 3F2CA 3CCUA 5LMUL 2DJGC 3PUVA 3HOZG 4YY3Q 2D0OA 3OTOL 2LY7A 1VQKA 1BXTA 1YJ9A 1CTMA 2JJQA 2Z1CA 5TSSA 1UE7A 2EDGA 4DV3Q 2ES2A 1A3TA 4OX9L 1JOKA 1L1OB 5CMDA 1AZQA 2MO0A 5KYLA 1YNJD 4A3DG 3NK9A 4CGYB 2JK8A 2BH8A 2PCFB 2WINB 4IZ8A 4LF8Q 2K50A 1FYCA 5IP9H 1S5BD 3S1NB 4OWTB 3S1RH 4JYAL 2N3SA 4TQUS 4NP5A 4DA2A 5I2YA 1VQIA 5CV4A 2UUCQ 1NMGA 2PMZE 1X3FA 1RD9D 2XN9C 3J80i 4K6DA 2VQFQ 2Q2UA 2UU9L 2QDBA 2B2WA 3AU7A 1U5KA 4X64L 2QEXA 1D5MC 4R9WA 4RMFA 1J5EL 1EU3A 5C3EH 4TSSA 1CZWA 5LMNW 4MN3A 1YNND 2XNAC 3D6CA 1ONLA 4YHHQ 5F2DA 2CKZB 4DU9A 3S17B 5E4WC 3W2DA 4UY8C 1S4ZA 4A3EG 5KNDA 4DV4Q 1TWHH 5ELNA 3RLOA 4K5WA 5C4XB 2F1MA 1HA5A 4IJLA 1U0LA 2IHEA 1LT4D 3BVZA 4L5RC 4A3KG 3H15A 4C3JB 1TWFH 4JI2L 5HGTA 2NVYB 2FINB 1Q86C 1EQRA 3OWEB 4B3SQ 1LO5D 3H0GB 3D3RA 2O2LD 4K2LA 2AWOA 5C4JH 4A3LG 2CW0C 1IZ6A 2D2CC 4ME3A 2Q2IA 1F2ZA 2XRQD 1HUMA 4DXGA 4OGQC 1SYGA 1J9OA 2GN5A 3G4SA 1EFWA 2JA5H 4BWGB 1KAAA 2QKIC 4PZ8A 3GQBA 4RKBA 3KDFA 3CCRA 3CCLA 2KHIA 3TP7A 1AH9A 4ILWA 2EY2A 4KD4A 1A3UA 4JG2A 4EQ5A 4GOPA 1Z7TA 1D8LA 1WD1A 2ZT9C 4KHPQ 2SDFA 5CV8A 5D14A 2F3WA
chains in the Genus database with same CATH topology
3RN2A 4NXML 1G291 4P74A 5LMNQ 1NMFA 1XMOL 1XPRA 4KI0A 4DV6Q 2R7ZH 4BBSG 3CAMA 1BKBA 1E1TA 3GD7A 1BVSA 1K9MC 2CCZA 4DAYB 1W2BA 1HNXL 2VNUD 2C35B 2IT1A 4APVA 1M90C 2YTVA 4RG1A 4DPGA 5GROA 1SROA 1N33L 4DR7L 4A3JH 3HOUH 2UXCQ 1WCMG 4DAMA 3ULPA 2LXKA 1PH4A 2Y0SE 5LMUQ 4JBKA 3J81j 3RLNA 1R9TH 2MNAA 1HR0W 4JI8Q 5JEAJ 1MJCA 3FKIH 3F2BA 1HZ9A 1K3RA 1WOCA 3E0EA 1KHIA 3K81C 5IP7G 3T1HL 4YCUA 3NEMA 3ZJYC 4A3GG 1X3EA 5DLQE 1N33Q 4DR7Q 4A93G 3J80c 3K7UC 3M4OH 3GTPH 2Z6KC 3PIOA 1VQHA 1X65A 5M3MG 3I56A 4GOPC 4A3IH 5IYDH 3K7AH 3BZCA 4DV1Q 2KCMA 4DV2Q 3GO5A 4HJ5A 5GAHC 4PG3A 1WYDA 5FLMH 1YIJA 3HKZE 2JA5G 4IOCA 5M5YH 5C0XJ 4JYAQ 2R93H 3GTLH 3M4PA 3S1NH 2CFMA 4GOPB 4YCWA 4O2DA 3ULLA 1SLJA 1QVGA 2JA6G 1K0RA 3KJOA 2B63G 2R92H 1VQ5A 5M5XH 4FDBA 4J15A 3UDIA 1GVPA 2D0PA 3W1BA 4Y7NH 1HZBA 3RNUA 1JB7A 2WAQE 4JBWA 4MNOA 5GAEC 3M4QA 2WP8J 3PV0A 4JOIA 1VQ4A 3CP0A 2GVAA 4X65L 3CCJA 4OONA 1PH6A 1K8GA 4LFBL 2HIXA 3W5OA 2UU9Q 1W3SA 4DK6C 4DV5L 1UEBA 2OCEA 3I4NG 4BY7G 2A1AA 2PQAB 4DV7L 3KLWA 3MXNB 4B3ML 4K0KQ 2E5LQ 4LW1A 4AYBE 1QUQA 2EXDA 4QY7A 4X64Q 4BY1G 1YHQA 1K73C 1KAWA 2UUAL 1QVFA 1J5EQ 3PO3G 2VZAA 4LF4L 1YJWA 2ID0A 4R4QA 2E2JH 4DV5Q 3PUYA 4HJ7A 1VQ8A 4A3MH 3PF5A 3RR5A 4IPGA 2VQEL 2HT1A 4B3MQ 1YEZA 3KF8B 2ZJQA 4B3RQ 4IPDA 1QVCA 2CQOA 3F8TA 2UXDL 5IYCG 3HKZG 2UUAQ 3RZOH 3CF5A 1NTGA 4NB3A 1S40A 1XNRL 4LF4Q 4H02A 3CC4A 2MO1A 5JEAG 3G6EA 1I3QH 1SRUA 2HQLA 1N36Q 1KIXA 1CSPA 3FKIG 3CCVA 1HR0L 3M7NA 3EBEA 1A8VA 3S17H 4LFAQ 1CKNA 4BBRH 4LF5L 1I6HH 4WJ4A 4JI5L 4POGA 1X6OA 4GLXA 1YI2A 1VQ7A 4R4OA 4A3BH 3PUZA 1Q1EA 1VQEA 3I55A 4JOIC 2OQKA 3TS0A 2E8GA 4QL5A 1XNRQ 4YCVA 1HH2P 1Y1VH 1PA6A 4AQYL 1Z47A 5C4XH 3OW2A 4DR2L 4A3IG 1HR0Q 1UE5A 1WI5A 3B6YA 1V9PA 1VQNA 4LF5Q 2WFWA 3I4MH 2DGYA 3HOZH 1OXSC 2V1CC 2IHFA 5C0XG 2R93G 1XNQL 3CQZH 1KQSA 4AYBG 4C3JH 3CD6A 2AKWB 1GD7A 2JEBI 1OXUA 3F2DA 2RHSB 4DR2Q 5M5WH 3AYHB 5JJLA 1C7YA 4AIMA 3PSIA 5EAYA 3G48A 1HNZL 2RF4A 4A75A 2ZTDA 1IBLL 1XNQQ 1SMXA 1QUQB 2R7FA 5M3FH 3PGZA 4LUZA 4YWMA 2F3IA 1O7IA 4QQBX 3GTJH 1SE8A 3J81i 2K5VA 3Q8DA 1PYSB 1TWCH 1NBWA 1KRSA 1UE1A 2JA7G 2Z6KA 3TEHB 1HNZQ 5C0XI 2K4KA 1IBLQ 3K80C 3GTGH 3PF4A 2JE6I 4O0AA 1I94L 4DR4L 2K5HA 3HOYG 1FGUA 3GTQH 4LFCL 4QJFA 3S1QH 1QZHA 1VCIA 3STBD 4A3FH 3S14H 1CKNB 1N34L 2R7DA 3PO2H 2EQSA 2VUMH 1TWAH 1VQGA 1AE3A 2F4VL 4BXXG 1IBKQ 1FVIA 1PVOA 2PQAA 2NVXH 1P8LA 5HGQA 5GADC 4QIWE 3W1GA 3KJPA 2YU9H 4NXMQ 4LFCQ 2JA8H 3TS2A 1Z9FA 3GDEA 3L2PA 1Q81C 1XMOQ 1E7ZA 2OQ0A 3VDYA 2OTLA 4YY3L 4YWLA 2QA4A 3HOVH 2VY3A 4MZ9A 1HNXQ 5JJIA 2UXBL 1YZ6A 2MQHA 3CPFA 1YITA 2IY5B 1OXTA 3UE0A 5C4XG 3CXCA 1MJEA 1Y14B 1X9NA 4P72A 4DV3L 4OWWB 1T9HA 3I7FA 1GO3E 3S16H 2GVBA 4POFA 3CCEA 1PHJA 2QGQA 4JBJA 4P73A 2LSSA 1V43A 3KF6A 1PV4A 2UXBQ 3T1HQ 4A3EH 3GTOH 3AFQA 1PH2A 1AE2A 1NY4A 1K8AC 1PH1A 2I0QA 3BU2A 2ZTEA 3M3YH 3H0GG 3E9IA 4C3HH 4JI4L 4JC0A 2YYZA 1EUJA 1V1QA 2AHOB 4HJ9A 1FL0A 4XIGS 5GQOA 5M3FG 1IXRA 2WB1E 2PI2E 3OYYA 4A3KH 2UUCL 2K14A 3U4VA 3M85A 1Y1WH 2EIFA 4HJAA 2NVTH 3DLLA 4JI4Q 1BBUA 5IY0A 4IPHA 3CC7A 3S1MH 3PIPA 3FHWA 4A3CH 4P71A 1BBWA 4A3LH 4JI0L 1Q12A 2BA0A 2K75A 1WFQA 2CWAA 1VQLA 3A5UA 1RL2A 4A3FG 1PH3A 3CC2A 4OO1G 3SGIA 3RZDH 1L2FA 4WJ3M 1G51A 1P16A 3PO2G 2UUBL 2R7ZG 1MKHA 2KENA 4X65Q 4IFDJ 1I50H 4X62L 4LFBQ 1JJ2A 1C0AA 2B29A 1SFOH 5FLXc 3I2ZA 4JI0Q 4GKKL 1G6PA 3UDFA 2XTIA 4GN4B 2VW9A 4DV7Q 2Q2TA 4DUZL 5K36G 1DGSA 3F1ZA 4YHHL 4A3JG 1VQ6A 3HOUG 1B7YB 1VQCA 2RHQB 1VQBA 2UUBQ 3HOWH 4JBMA 3CPWA 4JI1L 1YHAA 2JEAI 3KF6B 4LWCA 4YWKA 3TREA 4PMWA 1KC8C 2XGTA 3AFPA 4DR5L 4R4IA 1XPOA 2VQEQ 4DUZQ 5HY6A 2JA9A 2NZOA 2WB1G 4R1JA 2HIVA 4L5QA 5GAGC 5IWAL 1HZAA 1PH8A 4GLAC 2KHJA 2ATWA 4IOAA 4LUOA 4OO1I 2K5NA 2A19A 4UP7A 4Y52H 4JI7L 1M1KC 4A3DG 5IYDG 4OWXB 1QZGA 1IBML 4LF6L 4UP9A 4DR5Q 4A4IA 2BH2A 4DR6L 1PFSA 1VS0A 5FLMG 4JI5Q 5IWAQ 4BBSH 4MTNA 1WJJA 2NVQH 1PYBA 2N8NA 3D31A 4JI7Q 3S24A 3J81c 4AQYQ 2YV5A 4K0KL 1J6QA 1E3PA 2R92G 3H3VH 1IBMQ 1D7QA 1C9OA 1YVCA 4DR6Q 2Q2HA 5JJKA 1Y1WG 3S2HH 3M9BA 3ULJA 4NPSA 3RLFA 3U4ZA 4JV5L 4A3DH 4EX5A 1E24A 4PZ6A 1N32L 2PI2A 4A3GH 2ALYB 2N49A 4C2MH 4A3CG 4DUYL 1X3GA 1EQQA 2D62A 3S15H 3KYHC 1JJCB 2IX1A 3WWVA 1CSQA 1I5FA 3T1YL 5H1SE 1N9WA 4JI3L 2E2IH 4GKJL 1N32Q 2L15A 2I5HA 4IFDG 2KBNA 1MIUA 3NBHB 1EIYB 3STBC 2IX0A 4AH6A 4A3MG 4HIDA 1LTLA 4DK3C 2DUDA 3FP9A 1PH7A 3UE1A 2JA6H 1VQJA 3T1YQ 2PNHA 4JI3Q 1CKMA 1X56A 4GKJQ 1PH9A 1NE3A 3HOWG 4OXPA 2VS1A 2H5XA 2N78A 3K8AA 4LUVA 2ZTCA 4UPAA 1I94Q 2HHHL 3AEVA 4DR4Q 3GTKH 3UDGA 2ASBA 3CCMA 1JE5A 1KXLA 1YNXA 4BBRG 5IT9c 4DV6L 1N34Q 3TRZA 3PUWA 3D0FA 1CKOA 2KCTA 4A3BG 2K52A 4DNIA 1A62A 4DV0L 4ALPA 3I4NH 5C44H 3J7A5 4BY7H 1VQFA 4IPCA 4DR1L 3U50C 1Y1VG 2HHHQ 1VQPA 2NZHA 1SN8A 4BY1H 1FJGL 1B70B 1CUKA 5ELOA 2UXCL 1Q82C 3I4MG 1Q46A 3PO3H 3F2CA 3CCUA 5LMUL 2OTJA 3CMEA 1L1OC 3PUVA 3HOZG 4YY3Q 4JI8L 5FJ8H 2D0OA 1L0WA 4DV0Q 3BJUA 3OTOL 1PH5A 3J7ZC 4DR1Q 1VQKA 4JI6L 3L7ZC 3I4OA 1EOVA 3U58A 1YJ9A 1EYGA 4LF8L 4GLVB 1FJGQ 2JJQA 1A0IA 5IYCH 1UE7A 4DV3Q 2ES2A 4OX9L 1VQMA 1L1OB 1K83H 2MO0A 4HJ8A 3AQQA 3OTOQ 2B3GA 4GN5A 2JQOA 2A8VA 4DV1L 4GNXA 2JK8A 2BH8A 4DV2L 1VQOA 4JI6Q 4TVAB 1VQDA 4LF8Q 1N8RC 2K50A 4BA1I 5IP9H 4JYAL 2MFIA 4OWTB 3S1RH 1TXYA 2N3SA 1GM5A 4OX9Q 3KDFB 4TQUS 4JCVE 2VQFL 2ZJRA 3NENA 3L0OA 2AWNA 4R4CA 2ZM6L 2FXQA 5IYBH 1VQIA 1VQAA 4DKAC 2UUCQ 1S72A 2ZJPA 1OTCA 3H3VI 1NMGA 2PMZE 1X3FA 3CMAA 5BR8L 1B8AA 4A76A 3J80i 3DM3A 4GS3A 1VQ9A 1HNWL 3CCSA 3RN5A 1YJNA 1JJGA 2VQFQ 2Q2UA 2VUMG 1OXVA 1XPUA 2UU9L 4P75A 4LF9L 2ZM6Q 2AMCB 4IO9A 3A5ZB 2E5LL 4X6AH 1U5KA 4BA2I 1UE6A 5BR8Q 4X64L 3JAMc 2QEXA 2JA8G 1ASYA 4X66L 3HOXH 4RMFA 1J5EL 3A74A 1HNWQ 5C3EH 1LYLA 1TWGH 2Y0SG 4LF9Q 3HOVG 4X62Q 5C44G 5LMNW 4LF7L 2JA7H 2LXJA 3IRBA 3GTMH 1GKHA 3G71A 4GNXC 4HIKA 3KFUA 1YBYA 4GKKQ 4DV4L 4B3RL 3BZKA 3E9HA 1HZCA 4X66Q 1X55A 4YHHQ 4PZ7A 2CWPA 3JAMi 2CKZB 1N36L 1KD1C 3HOYH 5FJ8G 3CCQA 4UY8C 3HKSA 3K0XA 1EWIA 4JI1Q 1SR3A 3KOJA 1XMQL 1IL2A 4GNXB 4LFAL 1S3OA 2E2HH 4A3EG 5J3BA 4DV4Q 1Q1BA 4HIMA 1HJPA 1JT8A 4NXNL 3EIVA 4LF7Q 2F4VQ 3LGJA 4BXXH 1TWHH 5ELNA 3RLOA 1UWVA 1EIFA 3MEFA 4R4TA 4B3SL 1XMQQ 4B3TL 4IJLA 1YHBA 2F52A 1U0LA 2YTYA 1XJVA 2IHEA 1RIPA 5AJ3L 1X54A 3PUXA 1IYJB 4XTCS 1WCMH 1E1OA 4L5RC 4LF6Q 4A3KG 1JMCA 4NXNQ 4C3IH 5IP9G 3H15A 2I5LX 2WAQG 1TWFH 3ER0A 1Q7YC 4JI2L 1KL9A 5IP7H 1EQRA 4L5TA 1Q86C 4B3SQ 4B3TQ 4KHZA 4HIOA 4A93H 5AJ3Q 3UDXA 4UP8A 4L5SA 2AWOA 2NN6G 5IYBG 5C4JH 2OWOA 4A3LG 1H95A 1IZ6A 1L1OA 3JC66 2Q2IA 4GN3B 1Q8KA 4ME3A 4DR3L 5M3MH 4JI2Q 4JV5Q 2VL6A 2GN5A 3G4SA 3TQYA 3S2DH 3A0JA 2NVYH 1EFWA 1A63A 2JA5H 1KRTA 3HFZB 4LNQA 4DUYQ 3H0GH 1OXXK 3EN2A 3ERSX 1ASZA 4PZ8A 4DR3Q 3KDFA 3CCRA 3NELA 1E22A 1LUZA 1NJIC 4KHPL 2B63H 3HOXG 3CCLA 5E7NA 2KHIA 2R6GA 5C3EG 3ICEA 1AH9A 3PCOB 2UXDQ 2Z0SA 1LM0A 2NN6I 4JG2A 4EQ5A 5LMNL 4GOPA 5IE8A 1D8LA 2I5MX 4IJHA 4KHPQ 2RCNA 3CW2C 1IBKL 2YTXA 2BA1A 4QGUA 4IFDI 4KLKA 1XTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN2 A;  4NXM L;  1G29 1;  4P74 A;  5LMN Q;  1NMF A;  1XMO L;  1XPR A;  4KI0 A;  4DV6 Q;  2R7Z H;  4BBS G;  3CAM A;  1BKB A;  1E1T A;  3GD7 A;  1BVS A;  1K9M C;  2CCZ A;  4DAY B;  1W2B A;  1HNX L;  2VNU D;  2C35 B;  2IT1 A;  4APV A;  1M90 C;  2YTV A;  4RG1 A;  4DPG A;  5GRO A;  1SRO A;  1N33 L;  4DR7 L;  4A3J H;  3HOU H;  2UXC Q;  1WCM G;  4DAM A;  3ULP A;  2LXK A;  1PH4 A;  2Y0S E;  5LMU Q;  4JBK A;  3J81 j;  3RLN A;  1R9T H;  2MNA A;  1HR0 W;  4JI8 Q;  5JEA J;  1MJC A;  3FKI H;  3F2B A;  1HZ9 A;  1K3R A;  1WOC A;  3E0E A;  1KHI A;  3K81 C;  5IP7 G;  3T1H L;  4YCU A;  3NEM A;  3ZJY C;  4A3G G;  1X3E A;  5DLQ E;  1N33 Q;  4DR7 Q;  4A93 G;  3J80 c;  3K7U C;  3M4O H;  3GTP H;  2Z6K C;  3PIO A;  1VQH A;  1X65 A;  5M3M G;  3I56 A;  4GOP C;  4A3I H;  5IYD H;  3K7A H;  3BZC A;  4DV1 Q;  2KCM A;  4DV2 Q;  3GO5 A;  4HJ5 A;  5GAH C;  4PG3 A;  1WYD A;  5FLM H;  1YIJ A;  3HKZ E;  2JA5 G;  4IOC A;  5M5Y H;  5C0X J;  4JYA Q;  2R93 H;  3GTL H;  3M4P A;  3S1N H;  2CFM A;  4GOP B;  4YCW A;  4O2D A;  3ULL A;  1SLJ A;  1QVG A;  2JA6 G;  1K0R A;  3KJO A;  2B63 G;  2R92 H;  1VQ5 A;  5M5X H;  4FDB A;  4J15 A;  3UDI A;  1GVP A;  2D0P A;  3W1B A;  4Y7N H;  1HZB A;  3RNU A;  1JB7 A;  2WAQ E;  4JBW A;  4MNO A;  5GAE C;  3M4Q A;  2WP8 J;  3PV0 A;  4JOI A;  1VQ4 A;  3CP0 A;  2GVA A;  4X65 L;  3CCJ A;  4OON A;  1PH6 A;  1K8G A;  4LFB L;  2HIX A;  3W5O A;  2UU9 Q;  1W3S A;  4DK6 C;  4DV5 L;  1UEB A;  2OCE A;  3I4N G;  4BY7 G;  2A1A A;  2PQA B;  4DV7 L;  3KLW A;  3MXN B;  4B3M L;  4K0K Q;  2E5L Q;  4LW1 A;  4AYB E;  1QUQ A;  2EXD A;  4QY7 A;  4X64 Q;  4BY1 G;  1YHQ A;  1K73 C;  1KAW A;  2UUA L;  1QVF A;  1J5E Q;  3PO3 G;  2VZA A;  4LF4 L;  1YJW A;  2ID0 A;  4R4Q A;  2E2J H;  4DV5 Q;  3PUY A;  4HJ7 A;  1VQ8 A;  4A3M H;  3PF5 A;  3RR5 A;  4IPG A;  2VQE L;  2HT1 A;  4B3M Q;  1YEZ A;  3KF8 B;  2ZJQ A;  4B3R Q;  4IPD A;  1QVC A;  2CQO A;  3F8T A;  2UXD L;  5IYC G;  3HKZ G;  2UUA Q;  3RZO H;  3CF5 A;  1NTG A;  4NB3 A;  1S40 A;  1XNR L;  4LF4 Q;  4H02 A;  3CC4 A;  2MO1 A;  5JEA G;  3G6E A;  1I3Q H;  1SRU A;  2HQL A;  1N36 Q;  1KIX A;  1CSP A;  3FKI G;  3CCV A;  1HR0 L;  3M7N A;  3EBE A;  1A8V A;  3S17 H;  4LFA Q;  1CKN A;  4BBR H;  4LF5 L;  1I6H H;  4WJ4 A;  4JI5 L;  4POG A;  1X6O A;  4GLX A;  1YI2 A;  1VQ7 A;  4R4O A;  4A3B H;  3PUZ A;  1Q1E A;  1VQE A;  3I55 A;  4JOI C;  2OQK A;  3TS0 A;  2E8G A;  4QL5 A;  1XNR Q;  4YCV A;  1HH2 P;  1Y1V H;  1PA6 A;  4AQY L;  1Z47 A;  5C4X H;  3OW2 A;  4DR2 L;  4A3I G;  1HR0 Q;  1UE5 A;  1WI5 A;  3B6Y A;  1V9P A;  1VQN A;  4LF5 Q;  2WFW A;  3I4M H;  2DGY A;  3HOZ H;  1OXS C;  2V1C C;  2IHF A;  5C0X G;  2R93 G;  1XNQ L;  3CQZ H;  1KQS A;  4AYB G;  4C3J H;  3CD6 A;  2AKW B;  1GD7 A;  2JEB I;  1OXU A;  3F2D A;  2RHS B;  4DR2 Q;  5M5W H;  3AYH B;  5JJL A;  1C7Y A;  4AIM A;  3PSI A;  5EAY A;  3G48 A;  1HNZ L;  2RF4 A;  4A75 A;  2ZTD A;  1IBL L;  1XNQ Q;  1SMX A;  1QUQ B;  2R7F A;  5M3F H;  3PGZ A;  4LUZ A;  4YWM A;  2F3I A;  1O7I A;  4QQB X;  3GTJ H;  1SE8 A;  3J81 i;  2K5V A;  3Q8D A;  1PYS B;  1TWC H;  1NBW A;  1KRS A;  1UE1 A;  2JA7 G;  2Z6K A;  3TEH B;  1HNZ Q;  5C0X I;  2K4K A;  1IBL Q;  3K80 C;  3GTG H;  3PF4 A;  2JE6 I;  4O0A A;  1I94 L;  4DR4 L;  2K5H A;  3HOY G;  1FGU A;  3GTQ H;  4LFC L;  4QJF A;  3S1Q H;  1QZH A;  1VCI A;  3STB D;  4A3F H;  3S14 H;  1CKN B;  1N34 L;  2R7D A;  3PO2 H;  2EQS A;  2VUM H;  1TWA H;  1VQG A;  1AE3 A;  2F4V L;  4BXX G;  1IBK Q;  1FVI A;  1PVO A;  2PQA A;  2NVX H;  1P8L A;  5HGQ A;  5GAD C;  4QIW E;  3W1G A;  3KJP A;  2YU9 H;  4NXM Q;  4LFC Q;  2JA8 H;  3TS2 A;  1Z9F A;  3GDE A;  3L2P A;  1Q81 C;  1XMO Q;  1E7Z A;  2OQ0 A;  3VDY A;  2OTL A;  4YY3 L;  4YWL A;  2QA4 A;  3HOV H;  2VY3 A;  4MZ9 A;  1HNX Q;  5JJI A;  2UXB L;  1YZ6 A;  2MQH A;  3CPF A;  1YIT A;  2IY5 B;  1OXT A;  3UE0 A;  5C4X G;  3CXC A;  1MJE A;  1Y14 B;  1X9N A;  4P72 A;  4DV3 L;  4OWW B;  1T9H A;  3I7F A;  1GO3 E;  3S16 H;  2GVB A;  4POF A;  3CCE A;  1PHJ A;  2QGQ A;  4JBJ A;  4P73 A;  2LSS A;  1V43 A;  3KF6 A;  1PV4 A;  2UXB Q;  3T1H Q;  4A3E H;  3GTO H;  3AFQ A;  1PH2 A;  1AE2 A;  1NY4 A;  1K8A C;  1PH1 A;  2I0Q A;  3BU2 A;  2ZTE A;  3M3Y H;  3H0G G;  3E9I A;  4C3H H;  4JI4 L;  4JC0 A;  2YYZ A;  1EUJ A;  1V1Q A;  2AHO B;  4HJ9 A;  1FL0 A;  4XIG S;  5GQO A;  5M3F G;  1IXR A;  2WB1 E;  2PI2 E;  3OYY A;  4A3K H;  2UUC L;  2K14 A;  3U4V A;  3M85 A;  1Y1W H;  2EIF A;  4HJA A;  2NVT H;  3DLL A;  4JI4 Q;  1BBU A;  5IY0 A;  4IPH A;  3CC7 A;  3S1M H;  3PIP A;  3FHW A;  4A3C H;  4P71 A;  1BBW A;  4A3L H;  4JI0 L;  1Q12 A;  2BA0 A;  2K75 A;  1WFQ A;  2CWA A;  1VQL A;  3A5U A;  1RL2 A;  4A3F G;  1PH3 A;  3CC2 A;  4OO1 G;  3SGI A;  3RZD H;  1L2F A;  4WJ3 M;  1G51 A;  1P16 A;  3PO2 G;  2UUB L;  2R7Z G;  1MKH A;  2KEN A;  4X65 Q;  4IFD J;  1I50 H;  4X62 L;  4LFB Q;  1JJ2 A;  1C0A A;  2B29 A;  1SFO H;  5FLX c;  3I2Z A;  4JI0 Q;  4GKK L;  1G6P A;  3UDF A;  2XTI A;  4GN4 B;  2VW9 A;  4DV7 Q;  2Q2T A;  4DUZ L;  5K36 G;  1DGS A;  3F1Z A;  4YHH L;  4A3J G;  1VQ6 A;  3HOU G;  1B7Y B;  1VQC A;  2RHQ B;  1VQB A;  2UUB Q;  3HOW H;  4JBM A;  3CPW A;  4JI1 L;  1YHA A;  2JEA I;  3KF6 B;  4LWC A;  4YWK A;  3TRE A;  4PMW A;  1KC8 C;  2XGT A;  3AFP A;  4DR5 L;  4R4I A;  1XPO A;  2VQE Q;  4DUZ Q;  5HY6 A;  2JA9 A;  2NZO A;  2WB1 G;  4R1J A;  2HIV A;  4L5Q A;  5GAG C;  5IWA L;  1HZA A;  1PH8 A;  4GLA C;  2KHJ A;  2ATW A;  4IOA A;  4LUO A;  4OO1 I;  2K5N A;  2A19 A;  4UP7 A;  4Y52 H;  4JI7 L;  1M1K C;  4A3D G;  5IYD G;  4OWX B;  1QZG A;  1IBM L;  4LF6 L;  4UP9 A;  4DR5 Q;  4A4I A;  2BH2 A;  4DR6 L;  1PFS A;  1VS0 A;  5FLM G;  4JI5 Q;  5IWA Q;  4BBS H;  4MTN A;  1WJJ A;  2NVQ H;  1PYB A;  2N8N A;  3D31 A;  4JI7 Q;  3S24 A;  3J81 c;  4AQY Q;  2YV5 A;  4K0K L;  1J6Q A;  1E3P A;  2R92 G;  3H3V H;  1IBM Q;  1D7Q A;  1C9O A;  1YVC A;  4DR6 Q;  2Q2H A;  5JJK A;  1Y1W G;  3S2H H;  3M9B A;  3ULJ A;  4NPS A;  3RLF A;  3U4Z A;  4JV5 L;  4A3D H;  4EX5 A;  1E24 A;  4PZ6 A;  1N32 L;  2PI2 A;  4A3G H;  2ALY B;  2N49 A;  4C2M H;  4A3C G;  4DUY L;  1X3G A;  1EQQ A;  2D62 A;  3S15 H;  3KYH C;  1JJC B;  2IX1 A;  3WWV A;  1CSQ A;  1I5F A;  3T1Y L;  5H1S E;  1N9W A;  4JI3 L;  2E2I H;  4GKJ L;  1N32 Q;  2L15 A;  2I5H A;  4IFD G;  2KBN A;  1MIU A;  3NBH B;  1EIY B;  3STB C;  2IX0 A;  4AH6 A;  4A3M G;  4HID A;  1LTL A;  4DK3 C;  2DUD A;  3FP9 A;  1PH7 A;  3UE1 A;  2JA6 H;  1VQJ A;  3T1Y Q;  2PNH A;  4JI3 Q;  1CKM A;  1X56 A;  4GKJ Q;  1PH9 A;  1NE3 A;  3HOW G;  4OXP A;  2VS1 A;  2H5X A;  2N78 A;  3K8A A;  4LUV A;  2ZTC A;  4UPA A;  1I94 Q;  2HHH L;  3AEV A;  4DR4 Q;  3GTK H;  3UDG A;  2ASB A;  3CCM A;  1JE5 A;  1KXL A;  1YNX A;  4BBR G;  5IT9 c;  4DV6 L;  1N34 Q;  3TRZ A;  3PUW A;  3D0F A;  1CKO A;  2KCT A;  4A3B G;  2K52 A;  4DNI A;  1A62 A;  4DV0 L;  4ALP A;  3I4N H;  5C44 H;  3J7A 5;  4BY7 H;  1VQF A;  4IPC A;  4DR1 L;  3U50 C;  1Y1V G;  2HHH Q;  1VQP A;  2NZH A;  1SN8 A;  4BY1 H;  1FJG L;  1B70 B;  1CUK A;  5ELO A;  2UXC L;  1Q82 C;  3I4M G;  1Q46 A;  3PO3 H;  3F2C A;  3CCU A;  5LMU L;  2OTJ A;  3CME A;  1L1O C;  3PUV A;  3HOZ G;  4YY3 Q;  4JI8 L;  5FJ8 H;  2D0O A;  1L0W A;  4DV0 Q;  3BJU A;  3OTO L;  1PH5 A;  3J7Z C;  4DR1 Q;  1VQK A;  4JI6 L;  3L7Z C;  3I4O A;  1EOV A;  3U58 A;  1YJ9 A;  1EYG A;  4LF8 L;  4GLV B;  1FJG Q;  2JJQ A;  1A0I A;  5IYC H;  1UE7 A;  4DV3 Q;  2ES2 A;  4OX9 L;  1VQM A;  1L1O B;  1K83 H;  2MO0 A;  4HJ8 A;  3AQQ A;  3OTO Q;  2B3G A;  4GN5 A;  2JQO A;  2A8V A;  4DV1 L;  4GNX A;  2JK8 A;  2BH8 A;  4DV2 L;  1VQO A;  4JI6 Q;  4TVA B;  1VQD A;  4LF8 Q;  1N8R C;  2K50 A;  4BA1 I;  5IP9 H;  4JYA L;  2MFI A;  4OWT B;  3S1R H;  1TXY A;  2N3S A;  1GM5 A;  4OX9 Q;  3KDF B;  4TQU S;  4JCV E;  2VQF L;  2ZJR A;  3NEN A;  3L0O A;  2AWN A;  4R4C A;  2ZM6 L;  2FXQ A;  5IYB H;  1VQI A;  1VQA A;  4DKA C;  2UUC Q;  1S72 A;  2ZJP A;  1OTC A;  3H3V I;  1NMG A;  2PMZ E;  1X3F A;  3CMA A;  5BR8 L;  1B8A A;  4A76 A;  3J80 i;  3DM3 A;  4GS3 A;  1VQ9 A;  1HNW L;  3CCS A;  3RN5 A;  1YJN A;  1JJG A;  2VQF Q;  2Q2U A;  2VUM G;  1OXV A;  1XPU A;  2UU9 L;  4P75 A;  4LF9 L;  2ZM6 Q;  2AMC B;  4IO9 A;  3A5Z B;  2E5L L;  4X6A H;  1U5K A;  4BA2 I;  1UE6 A;  5BR8 Q;  4X64 L;  3JAM c;  2QEX A;  2JA8 G;  1ASY A;  4X66 L;  3HOX H;  4RMF A;  1J5E L;  3A74 A;  1HNW Q;  5C3E H;  1LYL A;  1TWG H;  2Y0S G;  4LF9 Q;  3HOV G;  4X62 Q;  5C44 G;  5LMN W;  4LF7 L;  2JA7 H;  2LXJ A;  3IRB A;  3GTM H;  1GKH A;  3G71 A;  4GNX C;  4HIK A;  3KFU A;  1YBY A;  4GKK Q;  4DV4 L;  4B3R L;  3BZK A;  3E9H A;  1HZC A;  4X66 Q;  1X55 A;  4YHH Q;  4PZ7 A;  2CWP A;  3JAM i;  2CKZ B;  1N36 L;  1KD1 C;  3HOY H;  5FJ8 G;  3CCQ A;  4UY8 C;  3HKS A;  3K0X A;  1EWI A;  4JI1 Q;  1SR3 A;  3KOJ A;  1XMQ L;  1IL2 A;  4GNX B;  4LFA L;  1S3O A;  2E2H H;  4A3E G;  5J3B A;  4DV4 Q;  1Q1B A;  4HIM A;  1HJP A;  1JT8 A;  4NXN L;  3EIV A;  4LF7 Q;  2F4V Q;  3LGJ A;  4BXX H;  1TWH H;  5ELN A;  3RLO A;  1UWV A;  1EIF A;  3MEF A;  4R4T A;  4B3S L;  1XMQ Q;  4B3T L;  4IJL A;  1YHB A;  2F52 A;  1U0L A;  2YTY A;  1XJV A;  2IHE A;  1RIP A;  5AJ3 L;  1X54 A;  3PUX A;  1IYJ B;  4XTC S;  1WCM H;  1E1O A;  4L5R C;  4LF6 Q;  4A3K G;  1JMC A;  4NXN Q;  4C3I H;  5IP9 G;  3H15 A;  2I5L X;  2WAQ G;  1TWF H;  3ER0 A;  1Q7Y C;  4JI2 L;  1KL9 A;  5IP7 H;  1EQR A;  4L5T A;  1Q86 C;  4B3S Q;  4B3T Q;  4KHZ A;  4HIO A;  4A93 H;  5AJ3 Q;  3UDX A;  4UP8 A;  4L5S A;  2AWO A;  2NN6 G;  5IYB G;  5C4J H;  2OWO A;  4A3L G;  1H95 A;  1IZ6 A;  1L1O A;  3JC6 6;  2Q2I A;  4GN3 B;  1Q8K A;  4ME3 A;  4DR3 L;  5M3M H;  4JI2 Q;  4JV5 Q;  2VL6 A;  2GN5 A;  3G4S A;  3TQY A;  3S2D H;  3A0J A;  2NVY H;  1EFW A;  1A63 A;  2JA5 H;  1KRT A;  3HFZ B;  4LNQ A;  4DUY Q;  3H0G H;  1OXX K;  3EN2 A;  3ERS X;  1ASZ A;  4PZ8 A;  4DR3 Q;  3KDF A;  3CCR A;  3NEL A;  1E22 A;  1LUZ A;  1NJI C;  4KHP L;  2B63 H;  3HOX G;  3CCL A;  5E7N A;  2KHI A;  2R6G A;  5C3E G;  3ICE A;  1AH9 A;  3PCO B;  2UXD Q;  2Z0S A;  1LM0 A;  2NN6 I;  4JG2 A;  4EQ5 A;  5LMN L;  4GOP A;  5IE8 A;  1D8L A;  2I5M X;  4IJH A;  4KHP Q;  2RCN A;  3CW2 C;  1IBK L;  2YTX A;  2BA1 A;  4QGU A;  4IFD I;  4KLK A;  1XTD A; 
#chains in the Genus database with same CATH topology
 5C5M A;  1GUO A;  2EYL A;  4XQJ A;  2K6A A;  4FXG C;  1JR0 D;  2KEC A;  4DV6 Q;  3L9A X;  2CCZ A;  3GD7 A;  1B2T A;  3EQL C;  2K5W A;  3MXN A;  4APV A;  1BCP C;  4M1U B;  4KHV A;  1N33 L;  1HCZ A;  2BDN A;  2MNA A;  4UDU C;  4JI8 Q;  5JEA J;  1HZ9 A;  3ITP A;  1K3R A;  4DAV A;  1KHI A;  2L4N A;  3K81 C;  5CV6 A;  5E4X A;  5DLQ E;  3M3Y B;  3K5N A;  4A93 G;  4LJZ C;  3J80 c;  2LS0 1;  1F9R A;  1WTQ A;  2Z6K C;  3PIO A;  5IYD H;  1IW7 D;  4R8N A;  1Y1W B;  1HFN A;  1VMP A;  1WYD A;  5CYU A;  1YIJ A;  4JK1 C;  4IUU A;  5C0X J;  5I4D A;  1BR9 A;  4IUV A;  1ESF A;  5CC4 A;  3S1N H;  1QVG A;  3KJO A;  4IUR A;  2B63 G;  4KKS A;  2R92 H;  2D0P A;  1RKN A;  5FO9 B;  1JB7 A;  4X3S A;  3PV0 A;  1VQ4 A;  2AQ3 B;  1JWU D;  3OHX C;  4X65 L;  4LFB L;  4A3M B;  1STY A;  1UEB A;  4DV7 L;  1TQO A;  4K0K Q;  2E5L Q;  1NNX A;  4G7O C;  1VDZ A;  1BQQ T;  1PTO D;  1JCK B;  4M8A A;  4QY7 A;  3RZO B;  3HOW B;  2D5D A;  2KOL A;  1DON A;  2ID0 A;  3AB9 A;  4R4Q A;  4DV5 Q;  1GXD C;  1VQ8 A;  5AFW A;  3PF5 A;  3RR5 A;  2VQE L;  4B3M Q;  1YEZ A;  2F0H A;  3KF8 B;  2CQO A;  1B44 D;  2UXD L;  1GUN A;  2UUA Q;  4FF3 A;  1S40 A;  4LF4 Q;  2MO1 A;  3H3V C;  3NPP A;  3CCV A;  1HR0 L;  3S17 H;  1A8V A;  2KUM A;  1T5E A;  1JOO A;  2L55 A;  5IGD A;  1CKN A;  1X6O A;  1VQ7 A;  4A3B H;  3ZYY X;  5IGB A;  4HSP A;  3WOE A;  2BOS A;  4G57 A;  4QL5 A;  1Y1V H;  2LMC B;  5C4X H;  3FMC A;  3S2H B;  3I4M H;  1SYD A;  4LF5 Q;  2WFW A;  3K5O A;  5FO7 B;  1VQN A;  2DGY A;  3HOZ H;  1SDF A;  3NBI A;  2X6L A;  1SSO A;  4AYB G;  4C3J H;  2AKW B;  4PMB A;  2JEB I;  2M2L A;  3F2D A;  2RHS B;  4DR2 Q;  5EGT A;  1IL8 A;  1STH A;  5A35 A;  2KQ3 A;  2AQ1 B;  4CDF C;  1LV9 A;  2RF4 A;  1XNQ Q;  3QJY A;  1JOR A;  4YWM A;  2F3I A;  1GUG A;  2RSO A;  1O7I A;  1Q90 A;  3CHB D;  3DEP A;  1SE8 A;  2A6H D;  4EQP A;  1Y8N B;  1ZYR C;  3S14 B;  1EU4 A;  2A6E C;  2Z6K A;  3TEH B;  1IBL Q;  1TWA B;  3K80 C;  4CKC A;  2B2V C;  3F2U A;  3PF4 A;  2JE6 I;  3CRK C;  1SNC A;  2CHB D;  2JA8 B;  1QB5 D;  1STE A;  2DY7 A;  2EXZ A;  2R7D A;  1WTP A;  4L8J A;  4FYD A;  2PQA A;  1P8L A;  3QR8 A;  4NXM Q;  4LFC Q;  3K58 A;  1SJE D;  1F9P A;  4CKE A;  1XMO Q;  2E2D C;  3OSO A;  2OTL A;  2VB2 X;  1B1Z A;  3DWP A;  3CU7 A;  2MQH A;  3CPF A;  1YIT A;  2IY5 B;  3UE0 A;  3PIP 3;  1MJE A;  2B2Y A;  4OIJ A;  2F0D A;  3A56 A;  1ZXT A;  3I7F A;  2RVL A;  3S16 H;  2GVB A;  3S1Q B;  2O5J C;  1ICW A;  2QGQ A;  2LSS A;  1V43 A;  2J0T D;  3T1H Q;  4A3E H;  3AFQ A;  1AE2 A;  1JC7 A;  2OF1 A;  3M3Y H;  5COR A;  1HA6 A;  3N52 A;  4LMQ D;  1D5Z C;  2YYZ A;  1EUJ A;  4HJ9 A;  2AHO B;  5I2X A;  5T1I A;  4X3U A;  2WB1 E;  1AW7 A;  3OYY A;  2LKV A;  4A3K H;  1Y1W H;  3FPU B;  1XXG A;  3RMH A;  3DLL A;  3RZD B;  1BBU A;  5IY0 A;  2TMP A;  3CC7 A;  1PTO F;  4DXF A;  1RTN A;  3MFY A;  4A3C H;  5JVG 3;  1BBW A;  1PRT D;  4A3L H;  1Q12 A;  2K75 A;  3VYR A;  2WKC A;  2M00 A;  2CWA A;  2K01 A;  1OO9 B;  1KAB A;  1RL2 A;  1PH3 A;  4OO1 G;  4OHJ A;  3SGI A;  3PO2 G;  1P16 A;  2UUB L;  2R7Z G;  1MKH A;  4IFD H;  3GTM B;  1HRJ A;  1EYD A;  4JI0 Q;  2NTT A;  3I2Z A;  4GKK L;  4GN4 B;  2VW9 A;  4DUZ L;  1DGS A;  3F1Z A;  4C56 C;  4A3J G;  1B7Y B;  2QCP X;  1MSG A;  3HOW H;  3SXH A;  3MA2 B;  1BDO A;  3NBH A;  2F0P A;  2LFN A;  4JI1 L;  4LWC A;  4YWK A;  4BBS B;  4Z9C B;  1XPO A;  1D6E C;  2JA9 A;  4R1J A;  1PH8 A;  2HIV A;  4CHT B;  5CV5 A;  1TII D;  4UP7 A;  4DFA A;  5DNF A;  4JI7 L;  3MWY W;  3NP8 A;  4UP9 A;  3A7L A;  4C3I B;  2BH2 A;  1PFS A;  1VS0 A;  5HUR A;  5FLM G;  1HPC A;  3M7G A;  1A2T A;  2N8N A;  4RH6 A;  3S24 A;  1E3P A;  3E5S A;  2F0G A;  4DR6 Q;  5M3M B;  3A8I E;  5EPK A;  5JJK A;  3S2H H;  3U4Z A;  1N32 L;  2PI2 A;  2ALY B;  1LTS D;  4C2M H;  1NAP A;  4I65 A;  1UNS A;  3T1Y L;  1CSQ A;  3EVQ A;  3HP3 A;  1BOS A;  2EYP A;  3NTH A;  2IX0 A;  4AH6 A;  2G9H D;  4HID A;  1LTL A;  2L12 A;  3QO2 A;  2PNH A;  5I6W A;  2RDH A;  1PH9 A;  1BUV T;  1LT5 D;  2M9V A;  2JYO A;  1I94 Q;  1F2L A;  2ZXP A;  4DK0 A;  3UDG A;  3CCM A;  5CV9 A;  5IT9 c;  2K28 A;  3PUW A;  2KCT A;  2WAC A;  2F0Q A;  2RSN A;  1SND A;  1VQP A;  3HKZ B;  1SN8 A;  5KIX A;  4HTH A;  1RJT A;  2OTJ A;  3CME A;  1VF5 C;  5FJ8 H;  3BJU A;  3Q0A A;  1PH5 A;  1AN8 A;  4ZRZ A;  3J7Z C;  3IAY A;  4DR1 Q;  2WII B;  1EYG A;  2K03 A;  2A68 D;  1ENA A;  4A3I B;  3G7L A;  4L6T B;  4HJ8 A;  2RA4 A;  3OTO Q;  1PZK D;  2A8V A;  3S1Q H;  4DV1 L;  4GNX A;  4DV2 L;  1SYE A;  2MUY A;  4TVA B;  5M5Y B;  2R93 B;  3C1E A;  1PRT F;  1DD2 A;  1SE3 A;  1TXY A;  1GM5 A;  4OX9 Q;  3KDF B;  1EY9 A;  5CBA E;  1U4R A;  2ZJR A;  2ZXR A;  3C46 A;  2OT2 A;  3NEN A;  2ZM6 L;  5JPN C;  3H3V I;  1VQA A;  1LTR D;  1S72 A;  1S5F D;  1DZ1 A;  5BR8 L;  1B8A A;  3DM3 A;  1HNW L;  1EEF D;  2VUM G;  1X32 A;  4LF9 L;  5CV7 A;  4IO9 A;  3ND8 A;  2PYK A;  4X6A H;  1ASY A;  3R8B A;  1WTW A;  3JAM L;  1EY5 A;  1LYL A;  2Y0S G;  2K33 A;  4X62 Q;  2JN4 A;  3GTM H;  3G71 A;  4RCN A;  1DCZ A;  3BZK A;  3E9H A;  3HGB A;  1TWH B;  5A2Q L;  1JWM D;  4OEM B;  1N36 L;  3CCQ A;  3J80 E;  3K0X A;  1EWI A;  2A69 C;  2MP1 A;  4LFA L;  1R4P B;  4HIM A;  3TZU A;  3FVQ A;  1C48 A;  3EIV A;  4LF7 Q;  2F4V Q;  4XT3 B;  3NSW A;  3I70 A;  1EIH A;  4ULL A;  2QW7 A;  1O7Y A;  1KNA A;  1YHB A;  5C4J B;  1RIP A;  5AJ3 L;  4LF6 Q;  2B2W C;  5LL6 X;  4C3I H;  2NBF A;  3K57 A;  3CQZ B;  3BS1 A;  4OEL B;  4B08 A;  1Q7Y C;  5IP7 H;  4L5T A;  5J39 A;  3E6Z X;  1H95 A;  5IYB G;  4DR3 L;  3JC6 6;  2WV6 D;  4GN3 B;  1Q8K A;  2XWB B;  5M3M H;  4EQO A;  5M3F B;  2JXM B;  1ENF A;  4JI2 Q;  4JV5 Q;  2VL6 A;  5K5P A;  5M9O A;  1B4O A;  1KRT A;  4QIW B;  4LNQ A;  3H09 A;  4KD3 A;  4DUY Q;  5ELF A;  4U67 3;  5JJZ A;  1PZI D;  3HOX G;  3DUZ A;  2KA7 A;  5E7N A;  2R6G A;  4O1N A;  1TY0 A;  1FR3 A;  3BZD B;  3PCO B;  1CI3 M;  3GTQ B;  5E1F A;  2Z0S A;  4A3F B;  1H9S A;  4HN7 A;  3IFD A;  1GUT A;  1PFN A;  2I5M X;  5KNB A;  1IBK L;  2KEE A;  3Q6S A;  4IFD I;  4TKO B;  1A6X A;  1XTD A;  2JP1 A;  3RN2 A;  1JOQ A;  2FHT A;  3V2T A;  4P74 A;  1C8C A;  4OO1 H;  4KI0 A;  2R7Z H;  4ZCK A;  3CAM A;  1BKB A;  1E1T A;  1BVS A;  4DAY B;  1W2B A;  1HNX L;  2SNM A;  1H9M A;  3KK7 A;  1O80 A;  2YTV A;  4ZYS A;  4FXK C;  4KMU C;  4A3J H;  4CJ0 B;  1WCM G;  1A3V A;  1PH4 A;  2Y0S E;  3VYS A;  2F0M A;  4JBK A;  1R9T H;  4XQN A;  4QB4 A;  4C1N I;  3GTO B;  1WOC A;  3E0E A;  1BCP B;  1E2Z A;  3ZJY C;  1IKL A;  1V8Q A;  1PYW D;  3DHQ A;  4FVM A;  1N33 Q;  2PMZ B;  4FP5 D;  4KY7 A;  4NDX A;  1XTC D;  3SK8 A;  1VQH A;  1X65 A;  4GOP C;  2R92 B;  3OPO A;  3I72 A;  4A3I H;  3K7A H;  3BZC A;  2EYM A;  1SYC A;  3GO5 A;  4PG3 A;  5FLM H;  2ENB A;  2K05 A;  5M5Y H;  2R93 H;  3M4P A;  2CFM A;  2JA6 G;  3ULL A;  4F7X A;  1K0R A;  4F87 A;  5J1Z A;  4KKU A;  4XT1 B;  3TN2 A;  3A54 A;  4FDB A;  3W1B A;  3RNU A;  3ND9 A;  3OIP A;  4OON A;  4H13 C;  1K8G A;  1SFO B;  2HIX A;  3W5O A;  1W3S A;  2OCE A;  3I4N G;  3VR6 A;  2PQA B;  4MHE A;  1S5E D;  1QUQ A;  4BY1 G;  1K73 C;  4IUP A;  2F03 A;  4WRD A;  1I4P A;  2BCO A;  4HJ7 A;  3RD4 A;  3I4L A;  3QWN A;  4IPG A;  2A5H A;  3N6R A;  1WTR A;  3RUZ A;  2Z4I A;  1W6J A;  4A3B B;  4B3R Q;  1QVC A;  1LTB D;  1TU2 B;  5IYC G;  4DK1 A;  3CF5 A;  1L0Y B;  1NTG A;  1Y1V B;  4NB3 A;  1XNR L;  1D2B A;  4H02 A;  1SJH D;  5JEA G;  2HQL A;  5IOD A;  1KIX A;  4WOR A;  1CSP A;  3FKI G;  3I4M B;  1RDP D;  1QOH A;  3HOZ B;  4WJ4 A;  4J8Q A;  4R4O A;  2QDL A;  2OQK A;  2E8G A;  4YCV A;  1HR0 Q;  1WI5 A;  3B6Y A;  2F0K A;  3T51 B;  4NMZ A;  4A3D B;  5C0X G;  4HR7 B;  3CQZ H;  1KQS A;  1EQT A;  3CD6 A;  2Q8R E;  5M5W H;  2NB0 A;  2AQ2 B;  5JJL A;  1C7Y A;  4K8I A;  2E2I B;  1X3P A;  3G48 A;  4N9P A;  4B9W A;  4A75 A;  2ZTD A;  1SMX A;  1U4P A;  3LWE A;  2R7F A;  5M3F H;  4QQB X;  5EBD A;  1PYS B;  2JA6 B;  1TWC H;  3MEH A;  1NBW A;  1UE1 A;  2JA7 G;  1LTG D;  3J7A V;  2L0C A;  1O7L A;  3K6O A;  3GTG H;  3NE5 B;  3HOY G;  1HFG A;  3GTQ H;  1F2M A;  4DNT B;  4QJF A;  1B3A A;  4A3F H;  2EVB A;  1PXU A;  4QMG A;  3IL8 A;  1LT6 D;  4IUQ A;  2VUM H;  1AE3 A;  4BXX G;  1LAC A;  4ZUI A;  4BY1 B;  5K36 H;  1FD7 D;  3S16 B;  3GDE A;  1Z9F A;  3L2P A;  3D4D A;  1Q81 C;  2QIL A;  1E7Z A;  1MGS A;  4YY3 L;  3A8J E;  4ZK9 B;  2NZ1 D;  4RHR A;  4A3E B;  3FPP A;  1WVL A;  4PNY A;  1I4H A;  1Y14 B;  4DV3 L;  2BE5 C;  4OWW B;  5FOB B;  1T9H A;  1GO3 E;  1G6Z A;  2L5T A;  3CCE A;  4LK1 C;  2N55 A;  3KF6 A;  1MD2 D;  3Q22 A;  4A3K B;  1BF4 A;  3GTO H;  5KNC A;  4KN4 C;  3BVG A;  1I4R A;  4XIG S;  2I07 B;  3MFG A;  1K8M A;  4N8F A;  2PI2 E;  2UUC L;  2EIF A;  3VR3 A;  1CT1 D;  4UHV A;  2ICI A;  4JW0 A;  1FNU A;  5IGG A;  1CK1 A;  3BDL A;  4P71 A;  5IT9 E;  3VR4 A;  1ET9 A;  2BA0 A;  1PTO C;  5DM7 3;  2G9D A;  1EY8 A;  3CC2 A;  1QE6 A;  2B2Y C;  4WJ3 M;  1G51 A;  4IFD J;  1I50 H;  1C0A A;  1JJ2 A;  3DEO A;  3NWS A;  3R2I A;  1SFO H;  2Q2T A;  1SE4 A;  3OIQ A;  5FLX L;  3LWU A;  4YHH L;  1VQC A;  3HOY B;  1VQB A;  2UUB Q;  5IOC A;  4ZKB B;  2XGT A;  3AFP A;  4DUZ Q;  5IWA L;  2WB1 G;  4IOA A;  4OO1 I;  4GLA C;  2KHJ A;  4Y52 H;  4EVO A;  2X6G A;  5JPM C;  2MGS A;  4F88 A;  1RHP A;  3ONA B;  4A4I A;  2B39 A;  2MPM A;  4JI5 Q;  4L63 B;  4KJN A;  2NVQ H;  1I4G A;  1PYB A;  2IJ0 A;  1Q8I A;  4JI7 Q;  4A93 B;  4C2M B;  1GHJ A;  3A55 A;  2YV5 A;  2HDM A;  4AQY Q;  1IKM A;  3H3V H;  1D7Q A;  4LAA A;  4RGO S;  1C9O A;  3KBX A;  3U9S A;  2XRS D;  2Q2H A;  4PV1 C;  1EFI D;  4RCO A;  3RLF A;  3S2D B;  4A3D H;  1ML0 D;  1E24 A;  2K1B A;  2L1B A;  5ELC A;  2A6H C;  4RGT A;  4HMI A;  2K7V A;  1I6V C;  5EJW A;  3WWV A;  2B63 B;  1N9W A;  4JI3 L;  2E2I H;  4JPB W;  1N32 Q;  2I5H A;  4ZAI A;  1AZP A;  1EIY B;  4K6L A;  1SMY C;  2HD3 A;  4KN7 C;  1QWY A;  3FP9 A;  1PH7 A;  3UE1 A;  2JA6 H;  1VQJ A;  3T1Y Q;  2KCC A;  1U4L A;  1CKM A;  1O7Z A;  4I7A A;  2SOB A;  1NE3 A;  1W6K A;  1AEX A;  2EJM A;  1TT2 A;  2H5X A;  3K5M A;  4UPA A;  4DR4 Q;  2B8G A;  2D9U A;  2ASB A;  1RTO A;  1JE5 A;  2A6E D;  5LL6 S;  4BBR G;  4DV6 L;  1N34 Q;  2SNS A;  3D0F A;  1CKO A;  4V0B A;  1SE2 A;  2K52 A;  3DWQ A;  4DV0 L;  4ALP A;  3I4N H;  2DJF C;  1VQF A;  3H91 A;  4IPC A;  5L37 A;  3AMU A;  1BO0 A;  5ELD A;  1FJG L;  4BY1 H;  4IUT A;  1CA5 A;  2DY8 A;  2AUJ D;  4XDX A;  4JI8 L;  1L0W A;  2E74 C;  4JI6 L;  3U58 A;  1EOV A;  4KKT A;  3M4O B;  4GLV B;  3GTP B;  3MXP A;  5IYC H;  1K0S A;  1VQM A;  5T1G A;  3TME A;  3C1F A;  3AQQ A;  4GN5 A;  2JQO A;  3G6J B;  3TP8 A;  1K28 A;  2HCC A;  1VQO A;  1VQD A;  3HS0 C;  3GTL B;  4BA1 I;  5IGE A;  4AYB B;  4FF2 A;  1CQV A;  2PPB C;  2K5D A;  5M5X B;  2ICE C;  1PRT C;  1UUP A;  3K59 A;  4KY5 A;  3L0O A;  2AWN A;  2P5Z X;  1OTC A;  1HQR D;  5C0X H;  3VA7 A;  5JVH 3;  1E0B A;  4A76 A;  1VQ9 A;  3CCS A;  1JJG A;  3T56 B;  1OXV A;  3C3L A;  2ZM6 Q;  3S9W A;  3K5L A;  4TRD A;  3A5Z B;  1S5D D;  2E5L L;  4S3S A;  4BA2 I;  5BR8 Q;  3JAM c;  4X66 L;  1JWS D;  3A74 A;  1HNW Q;  3GV3 A;  3MZ5 A;  3TP6 A;  4X3T A;  1G2S A;  5IGC A;  4LF9 Q;  3HOV G;  3DMU A;  4CJ2 C;  5C44 G;  2JA7 H;  2LXJ A;  3IRB A;  1GKH A;  4GNX C;  3KFU A;  4KK7 A;  1HZC A;  1X55 A;  2CWP A;  2KVM A;  1ZKO A;  1KD1 C;  3HOY H;  1LLR D;  1SR3 A;  1XMQ L;  1I6H B;  1KLU D;  1IL2 A;  1S3O A;  3MAQ A;  1ILP A;  1HJP A;  4NXN L;  4BXX H;  1JB3 A;  4C3H G;  3NHH A;  1EIF A;  3MEF A;  4R4T A;  5EKL A;  3V96 A;  2F0S A;  3X3M A;  4B3T L;  1H9R A;  2YTY A;  3PUX A;  1IYJ B;  4PQX A;  4XTC S;  1E1O A;  3NXW A;  5IP9 G;  2WAQ G;  3ER0 A;  4QCL A;  1CZG A;  1HHV A;  1S5C D;  2H4O A;  4KHZ A;  4A93 H;  5IGF A;  5AJ3 Q;  1SNP A;  4UP8 A;  3T16 A;  2NN6 G;  2Z8L A;  2OWO A;  2E76 C;  2X69 A;  4IAL A;  3OOC A;  5ELE A;  3EA6 A;  3NQI A;  3S2D H;  1LT3 D;  2CH4 A;  5ELB A;  3SE0 A;  3HFZ B;  1OXX K;  1ASZ A;  3ERS X;  1T5X D;  4O42 A;  4DR3 Q;  1DOK A;  1EY7 A;  1NJI C;  3MTS A;  2B63 H;  3MXU A;  4E6I A;  4KY6 A;  3V05 A;  5C3E G;  1LM0 A;  1LTA D;  3PO2 B;  5LMN L;  2R7Z B;  5IE8 A;  3QIA A;  5CGK A;  1SXT A;  4IJH A;  2F0L A;  2RCN A;  1A2U A;  3CW2 C;  3PQI A;  2NVX B;  1Y69 U;  1EIG A;  2BA1 A;  4QGU A;  2YU9 B;  1AP0 A;  4NXM L;  5EPL A;  4A3J B;  3SVM A;  1XMO L;  1R9T B;  4H0L C;  1TVX A;  1K9M C;  1SNM A;  2VNU D;  2C35 B;  2IT1 A;  1M90 C;  4DPG A;  5GRO A;  1SRO A;  1A15 A;  2A68 C;  4DR7 L;  4ABN A;  2UXC Q;  3ULP A;  1SNO A;  1WTX A;  1KNE A;  3VYT A;  5LMU Q;  3J81 j;  1HR0 W;  1O78 A;  3K7A B;  2FFK B;  1MJC A;  3T1H L;  1EZ6 A;  2SEB D;  3URY A;  1EWC A;  4A3G G;  4C3H B;  3BVM A;  3K7U C;  3M4O H;  3GTP H;  3T13 A;  3I56 A;  4OIK A;  4HSV A;  5EBC A;  2PZU A;  2JA5 G;  2NVT B;  3HKZ E;  4JYA Q;  3GTL H;  3A7A B;  3S1M B;  1LTT D;  4YCW A;  4GOP B;  1TS3 A;  1SLJ A;  4EGV A;  1STG A;  5COY A;  3DXJ C;  5M5X H;  4J15 A;  4RHS A;  4Y7N H;  2WAQ E;  5GAE C;  1CA6 A;  4JOI A;  2DN8 A;  1TY2 A;  2K04 A;  2GVA A;  2KCN A;  2F0U A;  3LX0 A;  3CCJ A;  1TKW B;  2UU9 Q;  4QUF A;  3BDC A;  4BY7 G;  4KV6 A;  3I90 A;  3MXN B;  4LW1 A;  1SBB B;  5ISR A;  4X64 Q;  1YHQ A;  3K0Y A;  1QVF A;  1J5E Q;  2EYF A;  1YJW A;  2E2J H;  5DM6 3;  3PUY A;  2PZT A;  2ZJQ A;  4IPD A;  1EEI D;  3MHB A;  1J8I A;  3F8T A;  4G7Z C;  1KDA A;  3CC4 A;  5LHY 1;  1KTK A;  3G6E A;  1EL0 A;  4K2K A;  3EBE A;  1DM0 B;  3KUP A;  3TP5 A;  4BBR H;  1I6H H;  1YI2 A;  4B9X A;  1Q1E A;  4C1N K;  4FNF A;  1XNR Q;  1HH2 P;  3J7Y W;  5M5W B;  3IKJ A;  4CKB A;  3OW2 A;  1SNQ A;  3VYU A;  3P7J A;  2A69 D;  1OXS C;  2V1C C;  2IHF A;  5I9P A;  1OXU A;  1PFB A;  3HRZ C;  1SYB A;  1TWC B;  2PQE A;  3ERO A;  3GTG B;  4ME5 A;  1HNZ L;  3KLR A;  5BN5 A;  3Q23 A;  3PGZ A;  4LUZ A;  4EQN A;  2NWG A;  2F0F A;  4K8J A;  3BYT B;  3NUC A;  3Q8D A;  3SK6 A;  1CFM A;  5C0X I;  2VUM B;  2F4I A;  4IN3 A;  4DAP A;  1QNU A;  4O0A A;  1I94 L;  2K5H A;  1FGU A;  3T53 B;  1IYU A;  2EY1 A;  3STB D;  3VR5 A;  4RWS C;  1CKN B;  2Y0S B;  4RA8 A;  3PO2 H;  2EQS A;  3GV6 A;  3Q24 A;  2NVX H;  5GAD C;  4QIW E;  2YU9 H;  1K8O A;  2A73 B;  3I91 A;  5I9O A;  2DNC A;  1GHK A;  1YNJ C;  2H1E A;  2FMM A;  3HOV H;  1CHQ D;  2HQE A;  2UXB L;  5C4X G;  1LAB A;  1HXY D;  1FNW A;  1K83 B;  4J1M A;  4XXE A;  5FO8 B;  4F8M A;  3R2T A;  1V1P A;  2EJF C;  1E2V A;  5FK9 C;  4G4K A;  4POF A;  2CVR A;  4JBJ A;  4P73 A;  4C3J G;  2F3V A;  1GOZ A;  3H6M A;  2I0Q A;  2ZTE A;  3H0G G;  3E9I A;  4C3H H;  4JI4 L;  4JC0 A;  1V1Q A;  1FL0 A;  1PZJ D;  4XYO A;  1Z6H A;  3A8K E;  5JOB A;  4BS9 A;  2OXP A;  4HJA A;  2NVT H;  3DM1 A;  4IPH A;  3I3C A;  1I50 B;  3D4R A;  3S1M H;  3FHW A;  2NN6 H;  3OMC A;  2EJG C;  1L0X B;  1YNN C;  3HOX B;  2R61 A;  1VQL A;  2XWJ B;  4ZLT F;  1TWG B;  1L2F A;  4X65 Q;  4X62 L;  4LFB Q;  4Q0F A;  2F0V A;  1XWE A;  5FLX c;  4DV7 Q;  2XTI A;  1PTO B;  3P75 A;  4K14 A;  3BYY B;  2HDL A;  5C5L A;  1STN A;  1ENC A;  3OW7 A;  3LNN A;  1VQ6 A;  3HOU G;  4CDC C;  2IW3 A;  4JBM A;  1CM9 A;  4IQZ A;  1YHA A;  1K3B C;  3NWT A;  5D65 A;  4CBV A;  2JEA I;  3TRE A;  2E2H B;  4PMW A;  1KC8 C;  3HZX A;  4DR5 L;  4R4I A;  1WTO A;  2VQE Q;  2NZO A;  5GAG C;  4LF7 L;  2F4V L;  4L5Q A;  2NVQ B;  1HZA A;  1M8A A;  1STB A;  3P1H A;  2UXD Q;  4LUO A;  1ESR A;  2B2U A;  4ODG A;  1M1K C;  3TZD A;  2C9O A;  1QZG A;  1WCM B;  3EFX D;  1IBM L;  4LF6 L;  2XIW A;  4CDE C;  5IWA Q;  4ZUJ A;  4MTN A;  1SEB D;  3D31 A;  3SK5 A;  1PMR A;  2RKS A;  1J6Q A;  2V4D A;  3J81 L;  1GJX A;  3R93 A;  1Y1W G;  2B2T A;  1GUS A;  3D4W A;  2F0N A;  2R3Z A;  2KED A;  4JV5 L;  1XX8 A;  4A3G H;  1QJO A;  1KLG D;  4N8X 1;  3JAM E;  2N49 A;  1TS5 A;  4MIU A;  4A3C G;  4DUY L;  4RGN A;  3PMF A;  3KYH C;  4WFN 3;  2DNE A;  4G7H C;  1MBY A;  2CW0 D;  1WTH A;  4GKJ L;  5A2Q E;  4IFD G;  1MIU A;  3NBH B;  1EY6 A;  4A3M G;  4HED A;  2MHV A;  1B9N A;  3MXG A;  3BDO A;  1B50 A;  1DOL A;  1B3Q A;  4JI3 Q;  3I4N B;  1X56 A;  1BBX C;  3HOW G;  4UAI A;  4OXP A;  3K8A A;  2RDF A;  2VS1 A;  4LUV A;  2HHH L;  5CR3 A;  1YNX A;  3KLS X;  1A62 A;  4BY7 H;  4R8I A;  3QG1 A;  3U50 C;  4J6H A;  3HOU B;  1V1O A;  1B70 B;  5ELO A;  2EY5 A;  1L1O C;  3FKI B;  1IW7 C;  1DXM A;  4CDD C;  4ZKC B;  4Q5V A;  4DV0 Q;  2Z4H A;  2K5Q A;  2J7Z A;  3D8G A;  1H9K A;  3L7Z C;  2IX3 A;  3I4O A;  3L3O C;  4LF8 L;  1FJG Q;  1BCP D;  1A0I A;  1D1I A;  2I46 A;  1EQV A;  3NTK A;  1K83 H;  2B8F A;  5KGU A;  1D1K A;  2B3G A;  1VMC A;  4JI6 Q;  3CRL C;  1II3 A;  5G3L D;  1N8R C;  3J7A F;  2MFI A;  4YIJ A;  3SDZ A;  2BE5 D;  4NW2 A;  1NR4 A;  1TR5 A;  4JCV E;  2VQF L;  5C6A A;  1R4Q B;  1U9R A;  5DAU A;  4R4C A;  1M4V A;  2FXQ A;  5IYB H;  2MJ8 A;  4DKA C;  2ZJP A;  2O5I C;  3H94 A;  3CMA A;  3R3O A;  5IIF A;  2FMC A;  2F0E A;  4GS3 A;  1PRT B;  3RN5 A;  1YJN A;  3SEB A;  1XPU A;  3VA5 A;  4P75 A;  1HUN A;  2JA7 B;  1NSN S;  2TSS A;  2WKD A;  2AMC B;  5JAV A;  5EKI A;  1UE6 A;  2JA8 G;  1B53 A;  3HOX H;  1TWG H;  2PNR C;  1QNK A;  4GKK Q;  4HIK A;  1YBY A;  4DV4 L;  4B3R L;  1RF2 D;  1PTO H;  2RDG A;  5D3D A;  4X66 Q;  2CH4 W;  4PZ7 A;  1I3Q B;  3JAM i;  5FJ8 G;  3HKS A;  5KRU A;  1HTP A;  4JI1 Q;  2IPK D;  3KOJ A;  1ZEQ X;  4GNX B;  1FNV A;  2E2H H;  5J3B A;  1Q1B A;  3KBG A;  2KJX A;  1JT8 A;  1DYQ A;  3LGJ A;  1EY0 A;  3OWF A;  1ILQ A;  1UWV A;  1U4M A;  4B3S L;  1XMQ Q;  2F52 A;  1XJV A;  1X54 A;  1WCM H;  1JMC A;  2ZXO A;  4NXN Q;  4HCE A;  5J22 A;  2I5L X;  1D5X C;  3UI2 A;  4DAY A;  1WTV A;  1KL9 A;  2L9H A;  4B3T Q;  4HIO A;  3UDX A;  4L5S A;  1WD0 A;  1L1O A;  4CJ1 B;  3TQY A;  3GTJ B;  3A0J A;  1MI2 A;  1PFM A;  2NVY H;  1A63 A;  2Z6B A;  4X3K A;  1QCB D;  3OMG A;  3H0G H;  1H9J A;  3EN2 A;  4GZY C;  1F9S A;  1QIL A;  3NEL A;  1E22 A;  1LUZ A;  4KHP L;  3NTI A;  1SAP A;  3TDQ A;  3P20 A;  5KYI A;  3ICE A;  3D6W A;  3TSS A;  2EYH A;  4DGZ A;  3QB3 A;  2NN6 I;  3MC0 B;  2Z9H A;  1ZYR D;  2EPB A;  2Q8I B;  1NCV A;  2QEJ C;  2YTX A;  3SHL A;  4KLK A;  1RCV D;  2NUC A;  1G29 1;  1EOT A;  1Y8O B;  1IYV A;  1SMY D;  5LMN Q;  1C4Q A;  1NMF A;  1XPR A;  4XYQ A;  4BBS G;  1BCP F;  1JQY D;  5FKA C;  3FRP B;  2Q8T A;  5C3W A;  3E0J A;  4IUN A;  4RG1 A;  2WB1 B;  4V19 0;  2EZV A;  2G5D A;  2F0W A;  3HOU H;  3J81 E;  1CHP D;  4DAM A;  2LXK A;  5G3L F;  4FF1 A;  4C3I G;  3RLN A;  5JEA H;  1G8Z D;  3FKI H;  1GUW A;  3F2B A;  5IP7 G;  4YCU A;  2PO4 A;  3NEM A;  4KTA A;  1X3E A;  2IWH A;  4DR7 Q;  3W3A A;  1EY4 A;  4DNR B;  5D3I B;  3J80 L;  1JIC A;  1ROD A;  5M3M G;  2VB3 X;  4Y7N B;  4DV1 Q;  2KCM A;  4DV2 Q;  4HJ5 A;  5GAH C;  1SYF A;  4PMC A;  5C3X A;  2VXW A;  4IOC A;  1TS4 A;  1H9S B;  4O2D A;  4DF7 A;  4FF4 A;  1VQ5 A;  3UDI A;  1GVP A;  1HZB A;  1EWH A;  4RKL A;  4JBW A;  4MNO A;  4K0K L;  3M4Q A;  2WP8 J;  3CP0 A;  2E2J B;  1PH6 A;  1XYI A;  4DV5 L;  4DK6 C;  2A1A A;  3FDT A;  3KLW A;  4B3M L;  4AYB E;  2EXD A;  1KAW A;  2UUA L;  3PO3 G;  2VZA A;  3SR1 A;  4LF4 L;  4A3M H;  4BBR B;  2HT1 A;  3VR2 A;  1EYC A;  4KJO A;  4P2C B;  3RZO H;  3HKZ G;  1X3Q A;  1V1P B;  1N36 Q;  1I3Q H;  1SRU A;  3M7N A;  4LFA Q;  4LF5 L;  4JI5 L;  3BG3 A;  4POG A;  2B2V A;  4GLX A;  4QF4 A;  2HCI A;  3PUZ A;  1VQE A;  3I55 A;  4N9T A;  4JOI C;  1MSH A;  3TS0 A;  1PA6 A;  1ICF B;  4AQY L;  1Z47 A;  4A3I G;  4DR2 L;  1QG7 A;  2EOT A;  1UE5 A;  4OL7 A;  1V9P A;  1MHW C;  3MVV A;  3T4A C;  3E3X A;  2R93 G;  1B9M A;  1XNQ L;  5BN3 A;  1GD7 A;  1HQM C;  2O4X A;  3AYH B;  4FXD A;  3S15 B;  4H7B A;  4ID6 A;  2PW7 A;  4AIM A;  3PSI A;  3I8Z A;  5EAY A;  1IBL L;  1QUQ B;  5FLX E;  2C5C A;  1DJR D;  3CKI B;  3GTJ H;  3J81 i;  2K5V A;  1FGB D;  1KRS A;  1HNZ Q;  2K4K A;  3HG9 A;  1JE4 A;  5EQ0 A;  2E75 C;  1F2Y A;  2PW5 A;  2RCF A;  3GTK B;  4DR4 L;  1G91 A;  4DN4 M;  4LFC L;  1QZH A;  1VCI A;  2BDO A;  3S14 H;  1N34 L;  3HOV B;  4QUC A;  1TWA H;  1VQG A;  3WOF A;  5C44 B;  2F0J A;  2XVS A;  1IBK Q;  1F77 A;  5NUC A;  3TBI B;  1FVI A;  3NQT A;  4K5V A;  1PVO A;  5HGQ A;  3W1G A;  3KJP A;  1I4Q A;  5KEE A;  2JA8 H;  3TS2 A;  3PO3 B;  2FJ2 A;  1UAP A;  1TS2 A;  2OQ0 A;  3VDY A;  2QA4 A;  4YWL A;  2VY3 A;  4MZ9 A;  2NTS A;  3I73 A;  5E3F A;  2XSC A;  1HNX Q;  5JJI A;  1NUC A;  1YZ6 A;  1OXT A;  5I6Y A;  3KF8 A;  4FO2 A;  3CXC A;  1X9N A;  4P72 A;  1KDB A;  1PHJ A;  1EYA A;  2A74 C;  2IL8 A;  1PV4 A;  2UXB Q;  1PH2 A;  1NY4 A;  3S1R B;  1K8A C;  2WAQ B;  1PH1 A;  3BU2 A;  2CQA A;  3ERQ A;  5GQO A;  5M3F G;  1IXR A;  4ZQ3 A;  2K14 A;  3QOJ A;  3U4V A;  3M85 A;  5EPJ A;  2RBM A;  4XQQ A;  4JI4 Q;  4HAE A;  2F0T A;  4H44 C;  3PIP A;  4JI0 L;  2L11 A;  4MTK A;  1WFQ A;  1ET6 A;  5C3E B;  3A5U A;  4A3F G;  3RZD H;  2QF7 A;  2KEN A;  3FEW X;  3X3N A;  2B29 A;  2K32 A;  2AUK A;  1G6P A;  3UDF A;  2EYO A;  3M4Y A;  5K36 G;  1NR2 A;  2N88 A;  4NKL A;  2RHQ B;  1IHZ A;  4HMJ A;  2F0I A;  3DWA A;  4K5X A;  3CPW A;  3KF6 B;  1CQF A;  3QOL A;  1Q3L A;  4RGM A;  5HY6 A;  2EE1 A;  2ATW A;  1I4X A;  2K5N A;  2A19 A;  2NYZ D;  1STA A;  4RFB A;  5EKK A;  5IYD G;  4OWX B;  3KLS A;  4DR5 Q;  4DR6 L;  1PLF A;  4BBS H;  1TWF B;  3SK4 A;  4U68 A;  1PDQ A;  1WJJ A;  4A3G B;  3J81 c;  2EY6 A;  2R92 G;  5CBE E;  1IBM Q;  2J4X A;  5C4H A;  1YVC A;  1BNZ A;  4I7Z C;  2KHS A;  3M9B A;  3ULJ A;  4NPS A;  4HCS A;  4EX5 A;  4PZ6 A;  2JA5 B;  3EJI A;  1VF7 A;  1DOM A;  1EZ8 A;  1X3G A;  3C2P A;  1EQQ A;  2D62 A;  3S15 H;  1JJC B;  2IX1 A;  1I5F A;  3GP7 A;  4RAU C;  5H1S E;  1KDC A;  2EYJ A;  2L15 A;  1UEA B;  2B2U C;  2KBN A;  5C4Z A;  1LTI D;  3STB C;  4DK3 C;  1HTL D;  2DUD A;  2JSO A;  4WJW A;  1F9Q A;  3U9O A;  2OEO A;  4BY7 B;  4GKJ Q;  2HUG A;  1Y8P B;  1AFP A;  2N78 A;  2ZTC A;  3AEV A;  3GTK H;  3O13 A;  2RQX A;  5BN4 A;  2F0O A;  1KXL A;  2PZW A;  3TRZ A;  4A3B G;  2B2T C;  5IT9 L;  4DNI A;  3PIO 3;  1G2T A;  5C44 H;  3J7A 5;  3HEJ A;  4JVZ A;  2GA4 B;  4DR1 L;  1Y1V G;  2HHH Q;  1E2W A;  3IFT A;  3WDN A;  5DEH A;  2NZH A;  2UXC L;  1CUK A;  1Q82 C;  3I4M G;  1Q46 A;  3PO3 H;  3F2C A;  3CCU A;  5LMU L;  2DJG C;  3PUV A;  3HOZ G;  4YY3 Q;  2D0O A;  3OTO L;  2LY7 A;  1VQK A;  1BXT A;  1YJ9 A;  1CTM A;  2JJQ A;  2Z1C A;  5TSS A;  1UE7 A;  2EDG A;  4DV3 Q;  2ES2 A;  1A3T A;  4OX9 L;  1JOK A;  1L1O B;  5CMD A;  1AZQ A;  2MO0 A;  5KYL A;  1YNJ D;  4A3D G;  3NK9 A;  4CGY B;  2JK8 A;  2BH8 A;  2PCF B;  2WIN B;  4IZ8 A;  4LF8 Q;  2K50 A;  1FYC A;  5IP9 H;  1S5B D;  3S1N B;  4OWT B;  3S1R H;  4JYA L;  2N3S A;  4TQU S;  4NP5 A;  4DA2 A;  5I2Y A;  1VQI A;  5CV4 A;  2UUC Q;  1NMG A;  2PMZ E;  1X3F A;  1RD9 D;  2XN9 C;  3J80 i;  4K6D A;  2VQF Q;  2Q2U A;  2UU9 L;  2QDB A;  2B2W A;  3AU7 A;  1U5K A;  4X64 L;  2QEX A;  1D5M C;  4R9W A;  4RMF A;  1J5E L;  1EU3 A;  5C3E H;  4TSS A;  1CZW A;  5LMN W;  4MN3 A;  1YNN D;  2XNA C;  3D6C A;  1ONL A;  4YHH Q;  5F2D A;  2CKZ B;  4DU9 A;  3S17 B;  5E4W C;  3W2D A;  4UY8 C;  1S4Z A;  4A3E G;  5KND A;  4DV4 Q;  1TWH H;  5ELN A;  3RLO A;  4K5W A;  5C4X B;  2F1M A;  1HA5 A;  4IJL A;  1U0L A;  2IHE A;  1LT4 D;  3BVZ A;  4L5R C;  4A3K G;  3H15 A;  4C3J B;  1TWF H;  4JI2 L;  5HGT A;  2NVY B;  2FIN B;  1Q86 C;  1EQR A;  3OWE B;  4B3S Q;  1LO5 D;  3H0G B;  3D3R A;  2O2L D;  4K2L A;  2AWO A;  5C4J H;  4A3L G;  2CW0 C;  1IZ6 A;  2D2C C;  4ME3 A;  2Q2I A;  1F2Z A;  2XRQ D;  1HUM A;  4DXG A;  4OGQ C;  1SYG A;  1J9O A;  2GN5 A;  3G4S A;  1EFW A;  2JA5 H;  4BWG B;  1KAA A;  2QKI C;  4PZ8 A;  3GQB A;  4RKB A;  3KDF A;  3CCR A;  3CCL A;  2KHI A;  3TP7 A;  1AH9 A;  4ILW A;  2EY2 A;  4KD4 A;  1A3U A;  4JG2 A;  4EQ5 A;  4GOP A;  1Z7T A;  1D8L A;  1WD1 A;  2ZT9 C;  4KHP Q;  2SDF A;  5CV8 A;  5D14 A;  2F3W A; 
#chains in the Genus database with same CATH homology
 3RN2 A;  4NXM L;  1G29 1;  4P74 A;  5LMN Q;  1NMF A;  1XMO L;  1XPR A;  4KI0 A;  4DV6 Q;  2R7Z H;  4BBS G;  3CAM A;  1BKB A;  1E1T A;  3GD7 A;  1BVS A;  1K9M C;  2CCZ A;  4DAY B;  1W2B A;  1HNX L;  2VNU D;  2C35 B;  2IT1 A;  4APV A;  1M90 C;  2YTV A;  4RG1 A;  4DPG A;  5GRO A;  1SRO A;  1N33 L;  4DR7 L;  4A3J H;  3HOU H;  2UXC Q;  1WCM G;  4DAM A;  3ULP A;  2LXK A;  1PH4 A;  2Y0S E;  5LMU Q;  4JBK A;  3J81 j;  3RLN A;  1R9T H;  2MNA A;  1HR0 W;  4JI8 Q;  5JEA J;  1MJC A;  3FKI H;  3F2B A;  1HZ9 A;  1K3R A;  1WOC A;  3E0E A;  1KHI A;  3K81 C;  5IP7 G;  3T1H L;  4YCU A;  3NEM A;  3ZJY C;  4A3G G;  1X3E A;  5DLQ E;  1N33 Q;  4DR7 Q;  4A93 G;  3J80 c;  3K7U C;  3M4O H;  3GTP H;  2Z6K C;  3PIO A;  1VQH A;  1X65 A;  5M3M G;  3I56 A;  4GOP C;  4A3I H;  5IYD H;  3K7A H;  3BZC A;  4DV1 Q;  2KCM A;  4DV2 Q;  3GO5 A;  4HJ5 A;  5GAH C;  4PG3 A;  1WYD A;  5FLM H;  1YIJ A;  3HKZ E;  2JA5 G;  4IOC A;  5M5Y H;  5C0X J;  4JYA Q;  2R93 H;  3GTL H;  3M4P A;  3S1N H;  2CFM A;  4GOP B;  4YCW A;  4O2D A;  3ULL A;  1SLJ A;  1QVG A;  2JA6 G;  1K0R A;  3KJO A;  2B63 G;  2R92 H;  1VQ5 A;  5M5X H;  4FDB A;  4J15 A;  3UDI A;  1GVP A;  2D0P A;  3W1B A;  4Y7N H;  1HZB A;  3RNU A;  1JB7 A;  2WAQ E;  4JBW A;  4MNO A;  5GAE C;  3M4Q A;  2WP8 J;  3PV0 A;  4JOI A;  1VQ4 A;  3CP0 A;  2GVA A;  4X65 L;  3CCJ A;  4OON A;  1PH6 A;  1K8G A;  4LFB L;  2HIX A;  3W5O A;  2UU9 Q;  1W3S A;  4DK6 C;  4DV5 L;  1UEB A;  2OCE A;  3I4N G;  4BY7 G;  2A1A A;  2PQA B;  4DV7 L;  3KLW A;  3MXN B;  4B3M L;  4K0K Q;  2E5L Q;  4LW1 A;  4AYB E;  1QUQ A;  2EXD A;  4QY7 A;  4X64 Q;  4BY1 G;  1YHQ A;  1K73 C;  1KAW A;  2UUA L;  1QVF A;  1J5E Q;  3PO3 G;  2VZA A;  4LF4 L;  1YJW A;  2ID0 A;  4R4Q A;  2E2J H;  4DV5 Q;  3PUY A;  4HJ7 A;  1VQ8 A;  4A3M H;  3PF5 A;  3RR5 A;  4IPG A;  2VQE L;  2HT1 A;  4B3M Q;  1YEZ A;  3KF8 B;  2ZJQ A;  4B3R Q;  4IPD A;  1QVC A;  2CQO A;  3F8T A;  2UXD L;  5IYC G;  3HKZ G;  2UUA Q;  3RZO H;  3CF5 A;  1NTG A;  4NB3 A;  1S40 A;  1XNR L;  4LF4 Q;  4H02 A;  3CC4 A;  2MO1 A;  5JEA G;  3G6E A;  1I3Q H;  1SRU A;  2HQL A;  1N36 Q;  1KIX A;  1CSP A;  3FKI G;  3CCV A;  1HR0 L;  3M7N A;  3EBE A;  1A8V A;  3S17 H;  4LFA Q;  1CKN A;  4BBR H;  4LF5 L;  1I6H H;  4WJ4 A;  4JI5 L;  4POG A;  1X6O A;  4GLX A;  1YI2 A;  1VQ7 A;  4R4O A;  4A3B H;  3PUZ A;  1Q1E A;  1VQE A;  3I55 A;  4JOI C;  2OQK A;  3TS0 A;  2E8G A;  4QL5 A;  1XNR Q;  4YCV A;  1HH2 P;  1Y1V H;  1PA6 A;  4AQY L;  1Z47 A;  5C4X H;  3OW2 A;  4DR2 L;  4A3I G;  1HR0 Q;  1UE5 A;  1WI5 A;  3B6Y A;  1V9P A;  1VQN A;  4LF5 Q;  2WFW A;  3I4M H;  2DGY A;  3HOZ H;  1OXS C;  2V1C C;  2IHF A;  5C0X G;  2R93 G;  1XNQ L;  3CQZ H;  1KQS A;  4AYB G;  4C3J H;  3CD6 A;  2AKW B;  1GD7 A;  2JEB I;  1OXU A;  3F2D A;  2RHS B;  4DR2 Q;  5M5W H;  3AYH B;  5JJL A;  1C7Y A;  4AIM A;  3PSI A;  5EAY A;  3G48 A;  1HNZ L;  2RF4 A;  4A75 A;  2ZTD A;  1IBL L;  1XNQ Q;  1SMX A;  1QUQ B;  2R7F A;  5M3F H;  3PGZ A;  4LUZ A;  4YWM A;  2F3I A;  1O7I A;  4QQB X;  3GTJ H;  1SE8 A;  3J81 i;  2K5V A;  3Q8D A;  1PYS B;  1TWC H;  1NBW A;  1KRS A;  1UE1 A;  2JA7 G;  2Z6K A;  3TEH B;  1HNZ Q;  5C0X I;  2K4K A;  1IBL Q;  3K80 C;  3GTG H;  3PF4 A;  2JE6 I;  4O0A A;  1I94 L;  4DR4 L;  2K5H A;  3HOY G;  1FGU A;  3GTQ H;  4LFC L;  4QJF A;  3S1Q H;  1QZH A;  1VCI A;  3STB D;  4A3F H;  3S14 H;  1CKN B;  1N34 L;  2R7D A;  3PO2 H;  2EQS A;  2VUM H;  1TWA H;  1VQG A;  1AE3 A;  2F4V L;  4BXX G;  1IBK Q;  1FVI A;  1PVO A;  2PQA A;  2NVX H;  1P8L A;  5HGQ A;  5GAD C;  4QIW E;  3W1G A;  3KJP A;  2YU9 H;  4NXM Q;  4LFC Q;  2JA8 H;  3TS2 A;  1Z9F A;  3GDE A;  3L2P A;  1Q81 C;  1XMO Q;  1E7Z A;  2OQ0 A;  3VDY A;  2OTL A;  4YY3 L;  4YWL A;  2QA4 A;  3HOV H;  2VY3 A;  4MZ9 A;  1HNX Q;  5JJI A;  2UXB L;  1YZ6 A;  2MQH A;  3CPF A;  1YIT A;  2IY5 B;  1OXT A;  3UE0 A;  5C4X G;  3CXC A;  1MJE A;  1Y14 B;  1X9N A;  4P72 A;  4DV3 L;  4OWW B;  1T9H A;  3I7F A;  1GO3 E;  3S16 H;  2GVB A;  4POF A;  3CCE A;  1PHJ A;  2QGQ A;  4JBJ A;  4P73 A;  2LSS A;  1V43 A;  3KF6 A;  1PV4 A;  2UXB Q;  3T1H Q;  4A3E H;  3GTO H;  3AFQ A;  1PH2 A;  1AE2 A;  1NY4 A;  1K8A C;  1PH1 A;  2I0Q A;  3BU2 A;  2ZTE A;  3M3Y H;  3H0G G;  3E9I A;  4C3H H;  4JI4 L;  4JC0 A;  2YYZ A;  1EUJ A;  1V1Q A;  2AHO B;  4HJ9 A;  1FL0 A;  4XIG S;  5GQO A;  5M3F G;  1IXR A;  2WB1 E;  2PI2 E;  3OYY A;  4A3K H;  2UUC L;  2K14 A;  3U4V A;  3M85 A;  1Y1W H;  2EIF A;  4HJA A;  2NVT H;  3DLL A;  4JI4 Q;  1BBU A;  5IY0 A;  4IPH A;  3CC7 A;  3S1M H;  3PIP A;  3FHW A;  4A3C H;  4P71 A;  1BBW A;  4A3L H;  4JI0 L;  1Q12 A;  2BA0 A;  2K75 A;  1WFQ A;  2CWA A;  1VQL A;  3A5U A;  1RL2 A;  4A3F G;  1PH3 A;  3CC2 A;  4OO1 G;  3SGI A;  3RZD H;  1L2F A;  4WJ3 M;  1G51 A;  1P16 A;  3PO2 G;  2UUB L;  2R7Z G;  1MKH A;  2KEN A;  4X65 Q;  4IFD J;  1I50 H;  4X62 L;  4LFB Q;  1JJ2 A;  1C0A A;  2B29 A;  1SFO H;  5FLX c;  3I2Z A;  4JI0 Q;  4GKK L;  1G6P A;  3UDF A;  2XTI A;  4GN4 B;  2VW9 A;  4DV7 Q;  2Q2T A;  4DUZ L;  5K36 G;  1DGS A;  3F1Z A;  4YHH L;  4A3J G;  1VQ6 A;  3HOU G;  1B7Y B;  1VQC A;  2RHQ B;  1VQB A;  2UUB Q;  3HOW H;  4JBM A;  3CPW A;  4JI1 L;  1YHA A;  2JEA I;  3KF6 B;  4LWC A;  4YWK A;  3TRE A;  4PMW A;  1KC8 C;  2XGT A;  3AFP A;  4DR5 L;  4R4I A;  1XPO A;  2VQE Q;  4DUZ Q;  5HY6 A;  2JA9 A;  2NZO A;  2WB1 G;  4R1J A;  2HIV A;  4L5Q A;  5GAG C;  5IWA L;  1HZA A;  1PH8 A;  4GLA C;  2KHJ A;  2ATW A;  4IOA A;  4LUO A;  4OO1 I;  2K5N A;  2A19 A;  4UP7 A;  4Y52 H;  4JI7 L;  1M1K C;  4A3D G;  5IYD G;  4OWX B;  1QZG A;  1IBM L;  4LF6 L;  4UP9 A;  4DR5 Q;  4A4I A;  2BH2 A;  4DR6 L;  1PFS A;  1VS0 A;  5FLM G;  4JI5 Q;  5IWA Q;  4BBS H;  4MTN A;  1WJJ A;  2NVQ H;  1PYB A;  2N8N A;  3D31 A;  4JI7 Q;  3S24 A;  3J81 c;  4AQY Q;  2YV5 A;  4K0K L;  1J6Q A;  1E3P A;  2R92 G;  3H3V H;  1IBM Q;  1D7Q A;  1C9O A;  1YVC A;  4DR6 Q;  2Q2H A;  5JJK A;  1Y1W G;  3S2H H;  3M9B A;  3ULJ A;  4NPS A;  3RLF A;  3U4Z A;  4JV5 L;  4A3D H;  4EX5 A;  1E24 A;  4PZ6 A;  1N32 L;  2PI2 A;  4A3G H;  2ALY B;  2N49 A;  4C2M H;  4A3C G;  4DUY L;  1X3G A;  1EQQ A;  2D62 A;  3S15 H;  3KYH C;  1JJC B;  2IX1 A;  3WWV A;  1CSQ A;  1I5F A;  3T1Y L;  5H1S E;  1N9W A;  4JI3 L;  2E2I H;  4GKJ L;  1N32 Q;  2L15 A;  2I5H A;  4IFD G;  2KBN A;  1MIU A;  3NBH B;  1EIY B;  3STB C;  2IX0 A;  4AH6 A;  4A3M G;  4HID A;  1LTL A;  4DK3 C;  2DUD A;  3FP9 A;  1PH7 A;  3UE1 A;  2JA6 H;  1VQJ A;  3T1Y Q;  2PNH A;  4JI3 Q;  1CKM A;  1X56 A;  4GKJ Q;  1PH9 A;  1NE3 A;  3HOW G;  4OXP A;  2VS1 A;  2H5X A;  2N78 A;  3K8A A;  4LUV A;  2ZTC A;  4UPA A;  1I94 Q;  2HHH L;  3AEV A;  4DR4 Q;  3GTK H;  3UDG A;  2ASB A;  3CCM A;  1JE5 A;  1KXL A;  1YNX A;  4BBR G;  5IT9 c;  4DV6 L;  1N34 Q;  3TRZ A;  3PUW A;  3D0F A;  1CKO A;  2KCT A;  4A3B G;  2K52 A;  4DNI A;  1A62 A;  4DV0 L;  4ALP A;  3I4N H;  5C44 H;  3J7A 5;  4BY7 H;  1VQF A;  4IPC A;  4DR1 L;  3U50 C;  1Y1V G;  2HHH Q;  1VQP A;  2NZH A;  1SN8 A;  4BY1 H;  1FJG L;  1B70 B;  1CUK A;  5ELO A;  2UXC L;  1Q82 C;  3I4M G;  1Q46 A;  3PO3 H;  3F2C A;  3CCU A;  5LMU L;  2OTJ A;  3CME A;  1L1O C;  3PUV A;  3HOZ G;  4YY3 Q;  4JI8 L;  5FJ8 H;  2D0O A;  1L0W A;  4DV0 Q;  3BJU A;  3OTO L;  1PH5 A;  3J7Z C;  4DR1 Q;  1VQK A;  4JI6 L;  3L7Z C;  3I4O A;  1EOV A;  3U58 A;  1YJ9 A;  1EYG A;  4LF8 L;  4GLV B;  1FJG Q;  2JJQ A;  1A0I A;  5IYC H;  1UE7 A;  4DV3 Q;  2ES2 A;  4OX9 L;  1VQM A;  1L1O B;  1K83 H;  2MO0 A;  4HJ8 A;  3AQQ A;  3OTO Q;  2B3G A;  4GN5 A;  2JQO A;  2A8V A;  4DV1 L;  4GNX A;  2JK8 A;  2BH8 A;  4DV2 L;  1VQO A;  4JI6 Q;  4TVA B;  1VQD A;  4LF8 Q;  1N8R C;  2K50 A;  4BA1 I;  5IP9 H;  4JYA L;  2MFI A;  4OWT B;  3S1R H;  1TXY A;  2N3S A;  1GM5 A;  4OX9 Q;  3KDF B;  4TQU S;  4JCV E;  2VQF L;  2ZJR A;  3NEN A;  3L0O A;  2AWN A;  4R4C A;  2ZM6 L;  2FXQ A;  5IYB H;  1VQI A;  1VQA A;  4DKA C;  2UUC Q;  1S72 A;  2ZJP A;  1OTC A;  3H3V I;  1NMG A;  2PMZ E;  1X3F A;  3CMA A;  5BR8 L;  1B8A A;  4A76 A;  3J80 i;  3DM3 A;  4GS3 A;  1VQ9 A;  1HNW L;  3CCS A;  3RN5 A;  1YJN A;  1JJG A;  2VQF Q;  2Q2U A;  2VUM G;  1OXV A;  1XPU A;  2UU9 L;  4P75 A;  4LF9 L;  2ZM6 Q;  2AMC B;  4IO9 A;  3A5Z B;  2E5L L;  4X6A H;  1U5K A;  4BA2 I;  1UE6 A;  5BR8 Q;  4X64 L;  3JAM c;  2QEX A;  2JA8 G;  1ASY A;  4X66 L;  3HOX H;  4RMF A;  1J5E L;  3A74 A;  1HNW Q;  5C3E H;  1LYL A;  1TWG H;  2Y0S G;  4LF9 Q;  3HOV G;  4X62 Q;  5C44 G;  5LMN W;  4LF7 L;  2JA7 H;  2LXJ A;  3IRB A;  3GTM H;  1GKH A;  3G71 A;  4GNX C;  4HIK A;  3KFU A;  1YBY A;  4GKK Q;  4DV4 L;  4B3R L;  3BZK A;  3E9H A;  1HZC A;  4X66 Q;  1X55 A;  4YHH Q;  4PZ7 A;  2CWP A;  3JAM i;  2CKZ B;  1N36 L;  1KD1 C;  3HOY H;  5FJ8 G;  3CCQ A;  4UY8 C;  3HKS A;  3K0X A;  1EWI A;  4JI1 Q;  1SR3 A;  3KOJ A;  1XMQ L;  1IL2 A;  4GNX B;  4LFA L;  1S3O A;  2E2H H;  4A3E G;  5J3B A;  4DV4 Q;  1Q1B A;  4HIM A;  1HJP A;  1JT8 A;  4NXN L;  3EIV A;  4LF7 Q;  2F4V Q;  3LGJ A;  4BXX H;  1TWH H;  5ELN A;  3RLO A;  1UWV A;  1EIF A;  3MEF A;  4R4T A;  4B3S L;  1XMQ Q;  4B3T L;  4IJL A;  1YHB A;  2F52 A;  1U0L A;  2YTY A;  1XJV A;  2IHE A;  1RIP A;  5AJ3 L;  1X54 A;  3PUX A;  1IYJ B;  4XTC S;  1WCM H;  1E1O A;  4L5R C;  4LF6 Q;  4A3K G;  1JMC A;  4NXN Q;  4C3I H;  5IP9 G;  3H15 A;  2I5L X;  2WAQ G;  1TWF H;  3ER0 A;  1Q7Y C;  4JI2 L;  1KL9 A;  5IP7 H;  1EQR A;  4L5T A;  1Q86 C;  4B3S Q;  4B3T Q;  4KHZ A;  4HIO A;  4A93 H;  5AJ3 Q;  3UDX A;  4UP8 A;  4L5S A;  2AWO A;  2NN6 G;  5IYB G;  5C4J H;  2OWO A;  4A3L G;  1H95 A;  1IZ6 A;  1L1O A;  3JC6 6;  2Q2I A;  4GN3 B;  1Q8K A;  4ME3 A;  4DR3 L;  5M3M H;  4JI2 Q;  4JV5 Q;  2VL6 A;  2GN5 A;  3G4S A;  3TQY A;  3S2D H;  3A0J A;  2NVY H;  1EFW A;  1A63 A;  2JA5 H;  1KRT A;  3HFZ B;  4LNQ A;  4DUY Q;  3H0G H;  1OXX K;  3EN2 A;  3ERS X;  1ASZ A;  4PZ8 A;  4DR3 Q;  3KDF A;  3CCR A;  3NEL A;  1E22 A;  1LUZ A;  1NJI C;  4KHP L;  2B63 H;  3HOX G;  3CCL A;  5E7N A;  2KHI A;  2R6G A;  5C3E G;  3ICE A;  1AH9 A;  3PCO B;  2UXD Q;  2Z0S A;  1LM0 A;  2NN6 I;  4JG2 A;  4EQ5 A;  5LMN L;  4GOP A;  5IE8 A;  1D8L A;  2I5M X;  4IJH A;  4KHP Q;  2RCN A;  3CW2 C;  1IBK L;  2YTX A;  2BA1 A;  4QGU A;  4IFD I;  4KLK A;  1XTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...