4UAIA

Crystal structure of cxcl12 in complex with inhibitor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/cytokine inhibitor
molecule keywords Stromal cell-derived factor 1
publication title Structural Analysis of a Novel Small Molecule Ligand Bound to the CXCL12 Chemokine.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4uaiA00
4MN3A 1J9OA 1BO0A 1RTOA 2L1BA 5T1IA 1BBXC 1G91A 4ZAIA 1DZ1A 1IL8A 5T1GA 1MSHA 1HA6A 1PDQA 1WTWA 1XX8A 4CJ2C 2Q8TA 2EE1A 3KBXA 1ML0D 1RJTA 4CJ0B 1WD1A 2MJ8A 3I8ZA 1QE6A 2K28A 4OIKA 2B2YA 4OIJA 1EIHA 3QO2A 5EPJA 2FHTA 1HUNA 1WVLA 1HHVA 2L4NA 3IFDA 1B4OA 3LWEA 1VMCA 2KEEA 2MP1A 3MTSA 2MPMA 4IUUA 2D9UA 1VMPA 1S4ZA 2IL8A 1NR2A 2KUMA 1JE4A 3GV6A 3I90A 4LMQD 5EPKA 1MI2A 1O7ZA 1M8AA 2K03A 1F9QA 1E0BA 1EOTA 2NZ1D 2B2TC 1U4PA 2B2WC 1F2LA 2JYOA 3FDTA 3IL8A 4RWSC 4U68A 5CBEE 1WTPA 1J8IA 1TVXA 4IUQA 1SSOA 2HDMA 4R9WA 5AFWA 5E4WC 1PLFA 2DY7A 1B53A 2EPBA 1XYIA 4RA8A 1AZQA 1WTXA 4RAUC 3Q6SA 4IUTA 1NAPA 5E4XA 4NW2A 4XT1B 1LV9A 2DY8A 4HEDA 4UAIA 1U4RA 1ILQA 2HCIA 2VXWA 3DEPA 1G2SA 5D14A 4R8IA 1HUMA 2N55A 4HCSA 1SAPA 3TZDA 1AZPA 1CA6A 1DOKA 2B2UC 1KNAA 1MSGA 2FINB 3I91A 2K05A 2RA4A 4IURA 5CMDA 4IUVA 2RSOA 1Q3LA 4DN4M 2N88A 2KECA 1X32A 2B2TA 2B2WA 4O42A 1IKLA 1F9SA 2J7ZA 2Q8RE 4X3TA 2H1EA 2FJ2A 2MGSA 2XIWA 2X6GA 5COYA 1NR4A 2X6LA 4XDXA 5EJWA 5JJZA 1HFNA 4X3KA 1ILPA 1ZXTA 1AP0A 2B2VC 1CM9A 3R93A 2HCCA 3FPUB 2FMMA 1WTOA 3MWYW 2K1BA 5EKIA 2L11A 3UI2A 2HDLA 1B2TA 4ZLTF 1GUWA 3SVMA 1QG7A 1RHPA 1PFNA 1G2TA 2KOLA 4CJ1B 3DM1A 1U4LA 3ONAB 3TN2A 2HUGA 3P7JA 1EQTA 1IKMA 1CA5A 2B2UA 1DONA 3GV3A 2KEDA 5EQ0A 1A15A 2NWGA 4XT3B 1F9RA 4ZKCB 2R3ZA 1B3AA 1RODA 1G6ZA 1PFBA 2L9HA 3D6WA 2K01A 1JICA 5D65A 1X3QA 1BNZA 2KVMA 2SDFA 4HSVA 1KNEA 2M2LA 4X3SA 4X3UA 2L12A 4IUPA 2RSNA 1QNKA 2EOTA 4ZKBB 2CVRA 1NCVA 1WTQA 1ESRA 1PFMA 1U4MA 2B2VA 2FFKB 2X69A 4MHEA 5EPLA 1O80A 1DOLA 1X3PA 3N52A 1MGSA 1O7YA 2B2YC 3KUPA 5CBAE 3HP3A 1WTRA 2K04A 1WTVA 5DNFA 2BDNA 1RTNA 3F2UA 3H91A 1EL0A 4ZK9B 4HAEA 1F9PA 3G7LA 1DOMA 3I3CA 1B50A 1C8CA 1SDFA 1ICWA 4QUFA 1BF4A 1WD0A 1EIGA 1HRJA 5CORA 2JP1A 2RVLA 1HFGA 2NYZD 3DEOA 4QUCA
chains in the Genus database with same CATH superfamily
1J9OA 4DAPA 4RKLA 4A3JG 3I4MB 1MSHA 4V190 1VQNA 1JQYD 3PO2H 3TS0A 2KCCA 1RDPD 5EBDA 3S16H 1E24A 4PQXA 1SYFA 2CW0D 1S5BD 4JC0A 5BR8Q 1VMCA 4JI7Q 4DR5L 1XMQQ 3A7LA 1LABA 3GTLH 3MTSA 1ENAA 4JG2A 1WTHA 4QQBX 4BBSH 5ELEA 2R7DA 2RDGA 4PZ7A 4XQNA 4LF4Q 1QVFA 1KTKA 1TT2A 4LF6Q 1EU3A 4MTNA 4IPHA 1U5KA 2PQEA 1PH1A 1HTPA 3K5OA 3LWUA 4RAUC 4DV1L 4KY6A 3OTOQ 4NW2A 3I4MG 1LUZA 3OW2A 2O5JC 1RIPA 1MD2D 2N55A 3TZDA 4AQYL 4P73A 2KJXA 1QNUA 2GVAA 2XWJB 4JI3L 1YVCA 2B2WA 4O42A 2Q8RE 3TBIB 2I0QA 2O4XA 1HFNA 4YCVA 4X3KA 2EY5A 2B2VC 2SEBD 4QIWB 1I3QH 1JJCB 4M8AA 2EY6A 3DWPA 4JBWA 4RKBA 3F2CA 1G6PA 1Z6HA 4DV5Q 2Q8IB 3SVMA 3QIAA 1AH9A 1PFNA 3PO3B 1G2TA 5GAEC 1I4HA 4A3GB 4DV4Q 3HFZB 4JBMA 4JYAQ 2JK8A 3JC66 3TSSA 5IGGA 4RFBA 1RD9D 2WAQE 4X3SA 5JJKA 4MNOA 1JWUD 1HR0L 4B3RL 5KGUA 2QEXA 2E76C 1NCVA 5I9PA 2OCEA 4HCEA 3A54A 3J7YW 4KN4C 3J80i 2VQFL 3S1NB 3GD7A 2UUCL 2Z6KA 3I73A 1ZYRD 3SK5A 3CP0A 1F9PA 1DOMA 5J1ZA 3H0GH 1TWAB 2TMPA 2RVLA 1OXUA 1TQOA 2A6ED 1PZID 3PO3G 2J4XA 4A3GG 2PCFB 3OPOA 3TZUA 2ZJQA 3VA5A 4DR7L 1KDAA 2LFNA 4LF7L 3KJPA 3K80C 1XWEA 1N8RC 1QVCA 3EFXD 3GO5A 3QO2A 4NP5A 1JJGA 3BG3A 5C0XH 2JA8G 2BE5C 1Y69U 4IALA 4L63B 3LWEA 2YTXA 2OT2A 4R1JA 3T53B 3D31A 2KHJA 2WACA 4ALPA 2ZXRA 3G4SA 5J3BA 1A8VA 5FLXL 4BA2I 2K5NA 1O78A 2BCOA 2WB1B 3OMCA 1Q86C 2JA8H 2WFWA 1PA6A 4V0BA 5ISRA 3PUXA 1I5FA 4PZ6A 5E4XA 1I94L 1EYCA 1HQRD 1JB7A 1Y8NB 1NE3A 4IN3A 5CV6A 5IP9G 3CMEA 3T1HL 4HCSA 3S2HH 5KEEA 2FINB 3NQTA 1BCPB 1H9MA 2A73B 3D8GA 4IUVA 1FNUA 3B6YA 4NB3A 4QY7A 2F1MA 1K0SA 1LLRD 2D5DA 1CUKA 3X3MA 3BZCA 4DK6C 4GOPC 5M5WH 4A3CG 2HCCA 2UUBL 4DR2Q 4R4QA 2HHHL 2EZVA 5DAUA 4DV7Q 2PNHA 5M5XH 3J81i 4OWXB 1SR3A 4CDCC 1RODA 1EWCA 4LFBL 4IFDI 1TWCH 5I4DA 1VQOA 3AFPA 4P72A 4C56C 2KCMA 2Z4IA 3H09A 5CC4A 4A3IH 3J80c 3KUPA 1II3A 2RDFA 3MC0B 5IODA 3CCRA 1ENCA 3H3VI 4JW0A 5KYLA 1KAWA 3JAML 2WP8J 1BDOA 2CW0C 2N49A 2D0PA 1SEBD 3EROA 4MN3A 1UWVA 1IYUA 3E9IA 3SGIA 2E5LL 4B08A 4JI4L 3IAYA 2A69C 4DUZQ 2OWOA 3GTGH 1E22A 1I4QA 3I4NH 4LFCL 3HOXH 4DU9A 2MJ8A 5IYDG 1CI3M 1H9JA 3IFDA 1YIJA 1CT1D 1EEID 3S1QH 1VQ4A 3KDFA 2VW9A 4DV6L 2F0KA 1HQMC 2PO4A 2F0SA 5L37A 4IUPA 1U4PA 4U68A 1F2MA 5I2YA 4KHPL 1J8IA 1SFOH 4A3EG 4GN5A 5IYDH 1PLFA 3I55A 4RG1A 1A3TA 1YEZA 5GADC 1AZQA 4JI2L 2JA6B 4GZYC 1O7IA 3T56B 1VDZA 1FVIA 1CSQA 4UP7A 1P8LA 2H4OA 1CZGA 2UU9L 1VQLA 4HR7B 4POFA 5JJIA 2MFIA 4IURA 2XTIA 4A3EH 2PNRC 5CYUA 4Y7NB 1IKLA 4C3HB 3VYTA 1LTID 2NZOA 1W6KA 3G48A 4R4OA 2A8VA 1WTOA 1MHWC 2ENBA 3C3LA 1QG7A 2NVXH 4FF2A 1TWGH 1NMFA 4OXPA 2E75C 1EFID 2JA6G 5JEAJ 2KHIA 3CPWA 1HJPA 3J81c 4BY1B 3RLNA 3VA7A 1SN8A 2K7VA 4K5VA 4C3IB 1PTOB 3BDLA 3K5LA 1X3QA 1R9TH 1BNZA 1EWIA 1KNEA 5KNBA 4RH6A 1PH2A 1V8QA 4JI0L 2EOTA 2RBMA 2X69A 1KD1C 1VQ6A 2UXDQ 1SJHD 4C3HG 1GUNA 2IW3A 1X3PA 5IGCA 2F0FA 2JSOA 2JN4A 1WTRA 1J6QA 1LO5D 1RTNA 1ZEQX 2PMZE 3RZDB 4B3MQ 1D5MC 4YCUA 1ET9A 4EGVA 1CZWA 3DMUA 4IPDA 2N3SA 1STEA 3NENA 1PDQA 4I7AA 4BY1G 3STBD 4C3IG 2DNEA 1PRTF 3I8ZA 3F2DA 2K28A 1LTRD 2R93G 5EPJA 1PYSB 5C4XG 2YTVA 4GKKL 1EZ6A 1N9WA 5IT9L 1WVLA 2L4NA 1D1KA 4CKBA 1VF5C 1VQ9A 3QOLA 2MP1A 4LFAQ 4EX5A 3S1RB 4YHHQ 3CC4A 3GV6A 3ICEA 3K81C 1IBLL 2A74C 3MEHA 1DYQA 2B2WC 2F3VA 4NXNL 3R2TA 1TVXA 2AUJD 3DWAA 5EAYA 1IBML 2R93H 1PHJA 4P75A 3HKSA 1IW7D 5C4XH 2K32A 1MBYA 3Q6SA 2P5ZX 1M1KC 2EYHA 5FLXE 5J22A 5A2QE 3GTPB 1RKNA 1B44D 3GTQB 5A35A 2Y0SE 2NTSA 5J39A 2E2HB 1TY0A 4PG3A 3DLLA 4UP8A 2K05A 5FO9B 4DN4M 1BCPC 1D8LA 2KHSA 1PH7A 2DN8A 3CQZB 4C1NI 1YI2A 2JE6I 4LF9Q 1IHZA 1IBKL 5JJZA 1ILPA 1PMRA 1AP0A 1TWFB 5C3EB 1EIYB 4OX9L 1E3PA 2EIFA 3PIO3 4KJNA 2LXJA 2L0CA 1D6EC 1PVOA 3PSIA 1TS2A 5C0XI 1S5DD 2K01A 4BWGB 1X6OA 4P74A 2MO0A 3Q23A 1PFMA 4IOCA 3L7ZC 2AQ1B 1GUTA 3UDXA 4MHEA 2G9HD 3P1HA 3HOUG 3ERSX 3FEWX 2E74C 5CBAE 2OXPA 3HP3A 2JJQA 2YV5A 2ASBA 1SYBA 4BXXG 3K0YA 1S40A 1HRJA 1EIGA 5CORA 3D3RA 1N36L 3D4DA 2UUAL 3QJYA 2NBFA 4QUCA 3SHLA 3E5SA 1DZ1A 1HA6A 3HOUH 1KHIA 2G9DA 5IP7G 1IYVA 5JEAG 2F0IA 1ASZA 4FXGC 4BXXH 2R92H 2B2YA 2FMCA 4DUYQ 2PW5A 1NMGA 4LK1C 1OXXK 1E2WA 3K5MA 3I90A 3PIP3 3CU7A 3TP8A 3MXUA 4A3DB 5C44B 4DR5Q 5IP7H 1XNQL 4IOAA 3NWTA 1EYAA 4IUQA 1MJCA 4B3TL 5AFWA 4CGYB 1WCMH 1EY7A 3S1MH 3I2ZA 4H7BA 2O2LD 2OF1A 4QJFA 1FNWA 3H6MA 3S9WA 3O13A 3BYYB 4A4IA 4A93B 1U4RA 2XSCA 1G2SA 2ZT9C 4YIJA 2JA7H 4DR6L 3MXNA 2ZXOA 1N34L 3AB9A 1JE5A 2ZTEA 1KIXA 2F0DA 2RSOA 1KL9A 2JA5B 4AIMA 1B1ZA 4X3TA 2SNMA 4JI8L 2MGSA 2NVTB 3DUZA 4A3DG 2BE5D 2J0TD 4JI1L 4N8FA 4A3KB 3KF8A 1KLUD 2A68C 5EKIA 2NVYB 4CDEC 1H9KA 1CK1A 2HDLA 1YITA 3PUVA 1RHPA 2YTYA 3KJOA 3S14H 1LTTD 1BBWA 2ES2A 4Z9CB 1EYDA 3HOYB 3A5UA 1B70B 1F9RA 2IX0A 2M00A 3NUCA 1G6ZA 3RZOH 3D6WA 2M2LA 3VYRA 2MHVA 1PTOC 3ND9A 1PH3A 2F0PA 2PZUA 1SNCA 2K14A 2JA5G 3I72A 4EQOA 4DNRB 4GNXA 4B3RQ 5CV7A 1FD7D 3TP7A 3W1GA 4DK0A 4ZK9B 3U4ZA 1EYGA 1AW7A 1CQFA 4A3KG 1ICFB 1TXYA 4BS9A 4C2MB 3GQBA 4HJAA 2JP1A 3RMHA 2LSSA 3CCUA 1SBBB 1KDCA 2VL6A 4TSSA 1EFWA 3HOYG 1QCBD 4RGOS 1EEFD 4GLVB 2JXMB 4RMFA 1Q82C 3NTKA 5C6AA 4ZUJA 3G71A 1SNMA 1NUCA 1I6HH 4OIJA 4C3JB 3MXNB 4E6IA 5ELBA 1HUNA 1GHJA 3QWNA 3M4QA 4DAYB 3BJUA 1U0LA 4IUUA 3M4OH 1VQ5A 4IO9A 4DNTB 2EYFA 5IT9E 5LMUL 4RWSC 2XVSA 2VS1A 1GKHA 4S3SA 1QWYA 4R9WA 5M3FB 3J80L 3KF8B 3R2IA 2KA7A 4XT1B 1TWHH 3A56A 4UAIA 3WOFA 2BA1A 2HIVA 2QILA 1XPOA 1EWHA 1I94Q 3QR8A 1ET6A 4C3JG 3OYYA 2AQ2B 2A69D 1DCZA 5C4JB 5C5MA 1UE7A 4A3JH 4AYBE 4L8JA 5I2XA 2V4DA 1T5EA 5IIFA 1PYBA 4GNXB 5IY0A 5FLMG 3FPUB 4DR3Q 4DR4Q 3MWYW 4J1MA 4A3BB 4WORA 5M3FG 1FJGL 1JOKA 4DV3Q 3P7JA 1EQTA 2PQAB 1EOVA 1E2ZA 3LGJA 2SNSA 2V1CC 3K7AB 2NWGA 4FVMA 2OTJA 1YNJC 4NXML 3TMEA 2WIIB 1Y14B 1DD2A 3CPFA 4RCNA 1U4MA 5IWAQ 3I4MH 3NBIA 2RCNA 4OWTB 1O80A 3VR6A 2EXZA 2Q2HA 2ZXPA 2IWHA 1WTVA 2UXCL 2N8NA 2MO1A 4BBRB 1MKHA 1XTCD 3ER0A 1SDFA 4QUFA 4A3BG 2F4VL 1X9NA 4H13C 4K5WA 4LF5L 4DXGA 3NQIA 4F87A 4Q5VA 2LKVA 1PH5A 5JAVA 4ZAIA 5T1GA 5E1FA 1R4PB 2EE1A 4X62Q 1RJTA 3U9SA 2I5HA 4X64L 4L6TB 4NDXA 4NPSA 1J5EL 5JVH3 2OQKA 1HHVA 1C48A 1A3UA 1EY5A 2MPMA 3J81L 1SXTA 5M5YB 1JE4A 2F0OA 3OHXC 1MI2A 4GKJL 1KC8C 2I46A 4BBRG 3OW7A 1IL2A 4PMBA 4JV5Q 4DPGA 2A5HA 1KAAA 1EY4A 2NVQB 2Z6BA 4HJ8A 2XRQD 5NUCA 3D6CA 1PZJD 1IZ6A 4KY7A 3DEPA 3KBGA 4BY7B 3WDNA 1X56A 1VQEA 3PO3H 1KNAA 1MSGA 4H0LC 4HIOA 4N8X1 4A3GH 2F4IA 4KKTA 3UE1A 1AEXA 1W6JA 1X32A 1T5XD 2AKWB 3IRBA 4DF7A 3WWVA 1JORA 3D0FA 4XDXA 1EQRA 2EJFC 5LL6X 1QVGA 5LHY1 1SRUA 3J7A5 2QDLA 5ELCA 2XGTA 4WRDA 4KLKA 1YZ6A 2R61A 3TP5A 1A3VA 2YU9B 3NK9A 3Q24A 4QMGA 3S1NH 1PFSA 2KOLA 3TREA 3DM1A 3E6ZX 3S2DB 2BDOA 3GV3A 1A15A 4A3MB 1TS3A 3PF4A 4BY7G 2AMCB 1TWAH 2F03A 2YYZA 2KVMA 1FYCA 4DV2Q 1SMYC 1V1OA 2L55A 3EQLC 2E8GA 3CHBD 1Q8IA 4OHJA 5BR8L 1GUGA 4JI7L 3W2DA 1XMQL 2B63B 5IP9H 1Z47A 2B2YC 1MJEA 1GM5A 3OSOA 4UY8C 2WB1G 2K5VA 3F2UA 4G4KA 4LF4L 4JPBW 1SE8A 4HAEA 1BCPD 3E0JA 1VQMA 4LF6L 2CH4A 5IYBG 3PF5A 1OXSC 2NYZD 2R7ZB 3HOWB 4A3CH 3OTOL 3I7FA 1UE1A 4KHZA 1E1OA 3PUYA 4A3MG 1K0RA 4OO1G 3C1EA 4CJ0B 1N32Q 1HNXL 3A8KE 4YY3Q 1Y1WB 1A63A 4IZ8A 4JI5Q 2XN9C 1O7LA 1M8AA 3E9HA 5KIXA 1TIID 5JPMC 2PI2E 1HR0W 3RR5A 4FP5D 4LUVA 4OL7A 3GTOB 2VQEQ 3SK4A 4APVA 1IBLQ 2F0EA 1VQIA 4RA8A 1HXYD 4NXNQ 3EBEA 3HOWG 2R7ZG 4DAVA 1TR5A 3T13A 4IUTA 4RCOA 4DV4L 1QZHA 3HOVB 1IBMQ 4HEDA 3OMGA 3A74A 4JYAL 2LY7A 2I5MX 1V1PA 2BH8A 4IJLA 3HG9A 3SK6A 5C4ZA 4R4IA 3A8JE 2BA0A 3MZ5A 1NBWA 2ZM6Q 2L15A 1Y1WG 4PMWA 4C1NK 1YHBA 3NXWA 1NSNS 3M9BA 4XQJA 4J8QA 1GO3E 2PZWA 4ZYSA 3J7AV 5EJWA 4A3FB 3AEVA 1CKNA 3BU2A 4GNXC 1RL2A 2L11A 3OWEB 4DNIA 2PPBC 1XPRA 3HOZB 2K4KA 1HNZQ 1CHQD 2F3WA 1U4LA 2RCFA 2NN6G 3MEFA 3EA6A 3HOVG 2KEDA 4UHVA 1YJNA 2AWOA 4QGUA 4RGTA 2ID0A 1JICA 1SNQA 3J81j 1XNRQ 3CC2A 1Y1VB 1LT6D 1WTQA 2ATWA 5EKKA 2CQOA 2FFKB 3A8IE 2HQLA 3N52A 3GTMB 4A3FG 3MA2B 3TDQA 3PV0A 1A2TA 2KBNA 1GUSA 4LWCA 2CQAA 3KK7A 3HGBA 3HKZB 3Q22A 1FL0A 3I3CA 3M3YB 1H95A 1YHAA 1VQKA 1B3QA 5IGEA 4POGA 5D3DA 3HOZG 1JCKB 4JCVE 1L0YB 4DV0Q 2IJ0A 1XMOQ 5EQ0A 4XTCS 3GTJB 3FPPA 1YNXA 1RTOA 2A68D 5T1IA 4DR1Q 1W3SA 3PIOA 1PH9A 1ML0D 4LF8Q 5DEHA 1I6VC 2EDGA 4KY5A 4OONA 4QIWE 5C5LA 5GAGC 5FO7B 2JA6H 2FHTA 1V1PB 1VQFA 2EYPA 2RDHA 5FOBB 2CKZB 3VYUA 2E2IB 2D9UA 2KUMA 1Q12A 1HTLD 1PTOD 1STHA 2K33A 1EOTA 5CBEE 3HKZG 1VF7A 1WYDA 4DR2L 1JWMD 1CTMA 1JR0D 1CKNB 1UE5A 2PYKA 4Y7NH 1STNA 4DV7L 4C3HH 5D3IB 3ITPA 1I50B 1HZ9A 1WTXA 4WFN3 1PH6A 1S5FD 1RF2D 3U50C 3R3OA 1AZPA 4EQ5A 3CXCA 4ZRZA 2VZAA 2KECA 2WV6D 5GQOA 4BY1H 4LW1A 1L1OB 1SE4A 4C3IH 2HIXA 1PTOH 2ZTDA 1EY6A 4M1UB 4RHRA 2FMMA 1STAA 1AFPA 1B2TA 2HT1A 1GD7A 4TKOB 4H02A 1F2ZA 4KN7C 3PIPA 4CJ1B 4JI6L 2HD3A 3S15B 2VUMB 3RZDH 2B2UA 2RHQB 4DUZL 5H1SE 3T16A 4P2CB 1I4RA 3M7GA 5K5PA 1CKOA 4HSVA 1KRTA 1JJ2A 1K83B 1LTLA 1SYCA 1UEAB 5FKAC 3I70A 2VY3A 2KENA 1TS5A 1Q8KA 1EQQA 5I9OA 1R4QB 3L2PA 2BDNA 2F0LA 5AJ3Q 1BOSA 4P71A 3K59A 4A75A 1Q1BA 4O1NA 1WD0A 3AYHB 4GN3B 1N33L 2PW7A 4X66Q 3S1RH 1VCIA 2DNCA 3L3OC 1LT4D 4QB4A 2VUMG 2EXDA 2CH4W 3CCEA 1BXTA 3GTKB 3URYA 4FNFA 4TVAB 5K36G 3VR3A 1XX8A 3HS0C 3KBXA 1X3GA 3PMFA 1WD1A 4LAAA 4DK1A 1HZCA 3QB3A 2NZHA 3GTPH 1YNJD 3A5ZB 1W2BA 1PRTB 5C3EG 4FYDA 5D14A 3GTQH 5BN4A 2IY5B 2C9OA 5EPKA 2E2HH 2E2JB 2WAQB 2DJGC 5I6YA 1SSOA 3CQZH 4RHSA 3JAME 1TY2A 1EU4A 1X65A 3K58A 1B9NA 1ESFA 2AWNA 3T1YL 5EBCA 2EJGC 4ZQ3A 1TWFH 5C3EH 3K6OA 1HZAA 1QOHA 4DFAA 4IPGA 1XTDA 4HN7A 1TU2B 1Y8PB 3DM3A 3MAQA 4XYOA 1PXUA 5CMDA 3AU7A 2UXDL 3DWQA 2ZJPA 3QG1A 5JEAH 5JVG3 3MVVA 3V05A 4B3ML 1ZXTA 1VQ7A 2WAQG 2MUYA 4CKCA 1M4VA 4ME5A 4ZLTF 2PZTA 5C4HA 5FJ8G 3S24A 3SR1A 4R8NA 3BVMA 3TEHB 4DKAC 4DV1Q 2DGYA 4G7OC 3ULPA 2TSSA 3RLFA 4DAYA 2KCTA 5CR3A 1QB5D 2F0QA 1PFBA 1HPCA 5CV4A 4FXKC 4H44C 3SDZA 2L12A 4AQYQ 3FP9A 1C4QA 2CVRA 3U4VA 4OEMB 3TQYA 4JI3Q 5C44G 4LFAL 5FJ8H 1I4XA 4R4TA 4QL5A 4KJOA 3I56A 5IYCG 3C2PA 3CW2C 1DXMA 3FKIB 3K57A 1KDBA 3S17B 4A93G 3W3AA 3VDYA 3GP7A 4DAMA 4DGZA 1C0AA 3KYHC 4KV6A 1OXVA 4YWKA 4A3DH 1G91A 2B39A 5C44H 1IL8A 3CD6A 1WTWA 4JOIA 3BYTB 3OOCA 3CF5A 1C7YA 4JVZA 1EIHA 4A76A 1HR0Q 3KLRA 2VQFQ 5M3MB 1YBYA 2KEEA 4A93H 1PV4A 4XQQA 2UUCQ 2WINB 4LF9L 1SMYD 1HNWL 1SROA 1Q1EA 2PQAA 1SE3A 2AUKA 4QF4A 3FKIG 4KD4A 3PO2B 5C0XJ 2JA5H 2EQSA 2EY1A 5DLQE 4HIDA 1YJ9A 3BS1A 3S16B 2IT1A 2Z8LA 3HEJA 2NVTH 2F52A 1NAPA 3I4LA 1L2FA 2WKCA 3PQIA 4DR7Q 4A3KH 1NTGA 3GTLB 2A6HC 2NVYH 2QGQA 1FR3A 4BBSB 4LF7Q 3G6JB 3F2BA 5KRUA 3NBHA 3FMCA 1DOKA 3NHHA 2RA4A 4L5TA 4DA2A 2ZJRA 1D2BA 3HOYH 2B2TA 5M3MG 3VR5A 4RGMA 1YNNC 4KI0A 4GN4B 2FJ2A 4K5XA 3NE5B 2QDBA 2X6GA 1KABA 2VNUD 1I4GA 4K6LA 4F7XA 1JMCA 4YWLA 1UEBA 4LNQA 2RHSB 4NKLA 4Y52H 1GUWA 4HIKA 3PO2G 3OIPA 3ONAB 1DONA 4MTKA 2NTTA 1B3AA 4C2MH 4BBSG 2F3IA 3T1HQ 3CCJA 1FNVA 4X3UA 4DUYL 1I3QB 4HSPA 1DJRD 1LTAD 4FF1A 2QKIC 1P16A 5EPLA 5TSSA 4G7ZC 2K75A 2QA4A 1GVPA 1D7QA 4MIUA 3ERQA 1WI5A 4C3JH 2UUBQ 3QOJA 2O5IC 4K0KL 1G291 5G3LF 3MFGA 2HHHQ 1NNXA 4ABNA 3A0JA 3UE0A 1WFQA 5JJLA 4DK3C 2GA4B 4O0AA 2AHOB 1L0WA 4GLAC 2NB0A 2Q2IA 4AH6A 3CCQA 1LTSD 5FLMH 2UXBL 5GAHC 3GDEA 3BZDB 1UAPA 3U58A 4FO2A 4LFBQ 5M3FH 4HMJA 1UNSA 5C3WA 2Z1CA 1ZKOA 3NBHB 4K6DA 4X65L 3H0GB 1K73C 4J15A 3EJIA 1HNXQ 2BOSA 1KQSA 2R6GA 1PRTC 4B3SL 5HURA 1WTPA 1RCVD 5C4JH 5E4WC 3NPPA 2DY7A 4CDDC 1DGSA 5IOCA 3NELA 4WJ3M 1K8GA 3M4PA 3L0OA 2C5CA 2E5LQ 1Q46A 2PMZB 1A2UA 5EGTA 1BCPF 1YJWA 4JI4Q 1LT3D 3K5NA 1IXRA 4A3BH 4LFCQ 1HUMA 1SAPA 5BN5A 4F88A 3J7ZC 2B2UC 1Q3LA 5I6WA 2NUCA 3CMAA 1H9SA 5ELNA 3H0GG 2VB2X 3K7AH 4KD3A 3KLSX 2XRSD 1SE2A 2K6AA 2XIWA 4DV6Q 2QF7A 2JA8B 5DM63 5CV8A 3H3VC 4LJZC 2I5LX 3EIVA 5IE8A 3OIQA 4KHPQ 2K1BA 1JT8A 1IYJB 1OTCA 1Y8OB 3S2HB 5CGKA 4JI2Q 2IX3A 5C0XG 3KLWA 1GXDC 1Z9FA 2R3ZA 4PMCA 4BBRH 3BDCA 3K8AA 5IGFA 5G3LD 4WJWA 1CHPD 3M85A 5M5WB 2UU9Q 1VQCA 3KOJA 1SMXA 2K5WA 1DOLA 1PYWD 2ICIA 5M5XB 5LMNL 2Y0SB 1QILA 1F77A 3V96A 3BVZA 4KTAA 1B50A 3SE0A 3LNNA 1Q81C 4FF3A 2QEJC 5JOBA 1TWCB 1C9OA 3CRLC 1U9RA 3ULJA 3MXPA 2D0OA 5M5YH 5A2QL 3P20A 3V2TA 5HGTA 1BO0A 4A3IB 4UPAA 1ONLA 3MXGA 2EY2A 3ZYYX 1S5ED 3AMUA 4CJ2C 4I7ZC 2Q8TA 4QCLA 2IHEA 3IFTA 3FRPB 3ULLA 3H94A 4JI0Q 2NVQH 2Z4HA 4KHVA 4L5SA 4R4CA 1LTBD 4BY7H 1BBUA 1VMPA 2Y0SG 1H9SB 2KCNA 4NMZA 1I4PA 1JWSD 3BVGA 3U9OA 1E0BA 3FDTA 2I07B 3GTGB 4DR3L 4DR4L 3I4NB 2HDMA 3HOXB 3EN2A 3D4WA 1V43A 3FHWA 4LUOA 4HJ9A 3NSWA 1MIUA 2D2CC 3OWFA 4DV3L 2LMCB 3ND8A 2F0TA 1TKWB 4A3IG 4HTHA 1B8AA 1BUVT 1ILQA 1SJED 4I65A 3S1QB 3CC7A 2YU9H 5IYBH 4J6HA 4YCWA 4ODGA 1E7ZA 1S72A 4HIMA 2F0GA 2B63G 3M7NA 4KKUA 3RLOA 4B9XA 1LT5D 3RN2A 4GKKQ 1D5XC 3S2DH 1SFOB 4BA1I 1HH2P 2AQ3B 2QW7A 5IWAL 3UDIA 1V9PA 4A3MH 3IKJA 4OO1H 2GN5A 3H15A 5HGQA 4ILWA 4DV5L 5CV9A 4EQNA 2ICEC 3I4NG 3HOXG 3K7UC 2B63H 4U673 2K5QA 5GROA 1PTOF 2H5XA 1V1QA 3J80E 1IKMA 2HUGA 4A3EB 1X3EA 3WOEA 1GHKA 1S3OA 2M9VA 4JI6Q 2F0HA 4X62L 1STYA 2R7ZH 3HOWH 5LL6S 1QNKA 2ALYB 3PGZA 2IPKD 3UDGA 1SYDA 1SLJA 4JOIC 1ENFA 2NVXB 2B8GA 1TWGB 4HMIA 1IBKQ 1VQPA 4ULLA 3H91A 4A3LG 2L5TA 4CHTB 4OX9Q 1LACA 1VQHA 1EY8A 2ZTCA 1Y1WH 3TS2A 1EUJA 1R9TB 4JV5L 3RNUA 4ZUIA 3AFQA 1QZGA 3SK8A 4EVOA 2L1BA 1N33Q 1S5CD 2SOBA 5LMNW 1L1OA 3GTOH 3CCVA 4WJ4A 3BZKA 4A3LH 4OIKA 1SNPA 1VQ8A 1EY9A 4CBVA 2K52A 4HJ5A 2NN6H 1WJJA 3HOVH 1NY4A 1K28A 1HA5A 2IL8A 4R8IA 5KNCA 4JBKA 3NP8A 3DXJC 2B8FA 4B9WA 2NZ1D 3IL8A 2B2TC 2F0WA 1F2LA 2JA9A 1XPUA 5ELFA 5KNDA 3Q0AA 3HRZC 2B3GA 1N36Q 1B53A 1XYIA 2UUAQ 1CQVA 4A3FH 2DJFC 2F0NA 1VS0A 1LV9A 1JOOA 2VXWA 1Y1VG 2MQHA 2EYOA 2CWAA 3T1YQ 4ZCKA 3HOZH 1E1TA 4PZ8A 4DV2L 1ZYRC 1BQQT 3JAMi 4GLXA 5F2DA 3NTIA 2Z0SA 2R93B 5C4XB 2A1AA 1NR4A 2X6LA 2A6EC 3J81E 4HJ7A 1FGUA 1HCZA 4O2DA 1X3FA 1CM9A 4IFDJ 1XNQQ 1Y1VH 4YWMA 2EYJA 4B3TQ 2JEBI 2GVBA 3F1ZA 1PZKD 2K50A 3KDFB 3GTMH 2FXQA 3X3NA 4X6AH 1CA5A 3KFUA 4ZKCB 3NEMA 4XT3B 2CWPA 2Q2TA 3M3YH 4DR6Q 1VQJA 5D65A 1N34Q 2EVBA 1N32L 5FLXc 4IJHA 4ME3A 3GTJH 4YY3L 4K2LA 2A6HD 2B2VA 3BDOA 4JI5L 1QUQA 1MGSA 5FK9C 5KYIA 1O7YA 3T51B 4JI8Q 1SYGA 3CRKC 1LTGD 3C1FA 1JB3A 1CFMA 1YHQA 4JI1Q 3RUZA 1YNND 1PH4A 1ICWA 1A62A 2VQEL 4AYBB 2E2IH 2Z9HA 3DEOA 3VYSA 1BBXC 1UE6A 1SNOA 1G8ZD 3LX0A 1K9MC 4KMUC 2WB1E 1WOCA 3W1BA 1QE6A 1I50H 1OO9B 3NTHA 3NWSA 1CSPA 1X55A 2F0UA 2CCZA 2ZM6L 1CKMA 1B4OA 5CV5A 4F8MA 5IGDA 1QJOA 3J7AF 4KK7A 1S4ZA 4FDBA 4K8IA 1F2YA 1F9QA 3D4RA 3HOUB 1HZBA 1Z7TA 3KF6A 1UUPA 2KQ3A 4FF4A 3RN5A 1HNWQ 1Q90A 4LUZA 4AYBG 1D5ZC 1SNDA 1JC7A 2R92B 1HNZL 1VQBA 1AN8A 3CCSA 2Z6KC 1LM0A 1OXTA 2Q2UA 1EQVA 2DY8A 4OELB 3G6EA 4UP9A 1VQGA 1XNRL 3I91A 4CDFC 3P75A 4TRDA 3S15H 2VUMH 3M4YA 3JAMc 1VQAA 4IPCA 3VR2A 2N88A 4UDUC 5BN3A 1KXLA 1WCMB 4XYQA 5K36H 2K5HA 1BR9A 3FVQA 2J7ZA 2BH2A 1ASYA 3S1MB 3EVQA 1G51A 2F0VA 1QUQB 1K83H 4FXDA 3R93A 5LMUQ 3R8BA 3A55A 3UDFA 4OWWB 2JA7B 4XIGS 3Q8DA 1PRTD 3KLSA 1XMOL 4DV0L 2CHBD 5E3FA 2R92G 5FO8B 2WKDA 4JK1C 4EQPA 1NJIC 3TN2A 5HY6A 4L5QA 2A19A 2OEOA 4K8JA 4DR1L 1K3BC 2IHFA 3VR4A 2L9HA 4XXEA 4IUNA 4LF8L 1H9RA 2XNAC 3DHQA 2SDFA 4PNYA 1XXGA 2EJMA 4ZKBB 1X54A 3MHBA 2LS01 4GOPA 1ESRA 3GTKH 1WCMG 3S14B 2XWBB 2K04A 5DNFA 1EL0A 2DUDA 1BF4A 2JA7G 2IX1A 3RZOB 4N9PA 1T9HA 1EIFA 4IFDG 3HZXA 2EYMA 3KF6B 1FJGQ 2PI2A 4OGQC 4RGNA 2D62A 1STBA 4G57A 4K0KQ 3A7AB 2JQOA 4GS3A 2E2JH 1AE2A 1Q7YC 5E7NA 4NXMQ 4OO1I 3E0EA 4YHHL 2RF4A 2UXBQ 2OQ0A 1BKBA 1TS4A 3E3XA 3F8TA 3PUWA 4IFDH 2CFMA 5M9OA 2VB3X 4TQUS 1CA6A 2R7FA 1NR2A 2B29A 4LMQD 1VQDA 2K5DA 1O7ZA 2UXCQ 4X65Q 2K03A 3L9AX 2JYOA 3PCOB 1D1IA 1AE3A 2F4VQ 4PV1C 2EPBA 1I6HB 2RQXA 1A0IA 4LF5Q 4B3SQ 3PUZA 3H3VH 3AQQA 4K2KA 4ID6A 2G5DA 2C35B 2HQEA 3MFYA 5IYCH 4JBJA 1GJXA 2HCIA 3RD4A 3M4OB 2E2DC 2MNAA 4X64Q 1GUOA 5JPNC 1BVSA 1J5EQ 3HKZE 2RKSA 4Q0FA 5IGBA 1E2VA 3I4OA 2QCPX 1F9SA 4G7HC 3N6RA 4GOPB 3C46A 2H1EA 1B7YB 4MZ9A 1EY0A 5COYA 3K0XA 1M90C 5AJ3L 5EKLA 4GKJQ 4CKEA 1TWHB 2OTLA 1JOQA 1KRSA 4L5RC 5ELOA 3UI2A 1A6XA 3SXHA 4X66L 2F0JA 2F0MA 3TP6A 3STBC 2N78A 3W5OA 5IT9c 4N9TA 1FGBD 4IQZA 4DXFA 4KKSA 1B9MA 3ZJYC 5C3XA 4A3JB 1DM0B 1KLGD 1STGA 2NN6I 3FKIH 1XJVA 2JEAI 1SYEA 3S17H 3T4AC 5DM73 3SEBA 1K8OA 1LYLA 5ELDA 2LXKA 2RSNA 1K8AC 1PH8A 1K8MA 1L1OC 3TRZA 3CCLA 3CCMA 1IW7C 1K3RA 2EYLA 3G7LA 4K14A 1GOZA 5LMNQ 1L0XB 1C8CA 5M3MH 1HFGA 3CAMA 3CKIB 1EZ8A
chains in the Genus database with same CATH topology
1J9OA 4DAPA 4RKLA 3I4MB 1MSHA 4V190 1JQYD 2KCCA 1RDPD 5EBDA 4PQXA 1SYFA 2CW0D 1S5BD 1VMCA 3A7LA 1LABA 3MTSA 1ENAA 5ELEA 2RDGA 4XQNA 1KTKA 1TT2A 1EU3A 2PQEA 1HTPA 3K5OA 3LWUA 4RAUC 4KY6A 4NW2A 2O5JC 1MD2D 2N55A 3TZDA 2KJXA 1QNUA 2XWJB 2B2WA 4O42A 2Q8RE 3TBIB 2O4XA 1HFNA 4X3KA 2EY5A 2B2VC 2SEBD 4QIWB 4M8AA 2EY6A 3DWPA 4JBWA 4RKBA 1Z6HA 2Q8IB 3SVMA 3QIAA 1PFNA 3PO3B 1G2TA 1I4HA 4A3GB 3TSSA 5IGGA 4RFBA 1RD9D 4X3SA 1JWUD 5KGUA 2E76C 1NCVA 5I9PA 4HCEA 3A54A 3J7YW 4KN4C 3S1NB 3GD7A 3I73A 1ZYRD 3SK5A 1F9PA 1DOMA 5J1ZA 1TWAB 2TMPA 2RVLA 1OXUA 1TQOA 2A6ED 1PZID 2J4XA 2PCFB 3OPOA 3TZUA 3VA5A 1KDAA 2LFNA 1XWEA 3EFXD 3GO5A 3QO2A 4NP5A 3BG3A 5C0XH 2BE5C 1Y69U 4IALA 4L63B 3LWEA 2OT2A 3T53B 3D31A 2WACA 2ZXRA 5FLXL 4BA2I 1O78A 2BCOA 2WB1B 3OMCA 4V0BA 5ISRA 3PUXA 5E4XA 1EYCA 1HQRD 1Y8NB 4IN3A 5CV6A 4HCSA 5KEEA 2FINB 3NQTA 1BCPB 1H9MA 2A73B 3D8GA 4IUVA 1FNUA 2F1MA 1LLRD 2D5DA 3X3MA 2HCCA 2EZVA 5DAUA 1RODA 1EWCA 4IFDI 5I4DA 4C56C 2Z4IA 3H09A 5CC4A 3KUPA 1II3A 2RDFA 3MC0B 5IODA 1ENCA 5KYLA 3JAML 2WP8J 1BDOA 2CW0C 1SEBD 3EROA 4MN3A 1IYUA 4B08A 3IAYA 2A69C 1I4QA 4DU9A 2MJ8A 1CI3M 1H9JA 3IFDA 1CT1D 1EEID 2F0KA 1HQMC 2PO4A 2F0SA 4IUPA 1U4PA 4U68A 1F2MA 5I2YA 1J8IA 1PLFA 1A3TA 1AZQA 2JA6B 4GZYC 3T56B 1VDZA 2H4OA 1CZGA 4HR7B 4IURA 2PNRC 5CYUA 4Y7NB 1IKLA 4C3HB 3VYTA 1LTID 1W6KA 1WTOA 2ENBA 3C3LA 1QG7A 4FF2A 2E75C 1EFID 5JEAJ 4BY1B 3VA7A 2K7VA 4K5VA 4C3IB 1PTOB 3BDLA 3K5LA 1X3QA 1BNZA 1KNEA 5KNBA 4RH6A 1V8QA 2EOTA 2RBMA 2X69A 1SJHD 4C3HG 1GUNA 2IW3A 1X3PA 5IGCA 2F0FA 2JSOA 1WTRA 1LO5D 1RTNA 1ZEQX 3RZDB 1D5MC 1ET9A 4EGVA 1CZWA 3DMUA 1STEA 1PDQA 4C3IG 2DNEA 1PRTF 3I8ZA 2K28A 1LTRD 5EPJA 1EZ6A 5IT9L 1WVLA 2L4NA 1D1KA 4CKBA 1VF5C 3QOLA 2MP1A 3S1RB 3GV6A 2A74C 3MEHA 1DYQA 2B2WC 2F3VA 3R2TA 1TVXA 2AUJD 3DWAA 1IW7D 2K32A 1MBYA 3Q6SA 2EYHA 5FLXE 5J22A 5A2QE 3GTPB 1RKNA 1B44D 3GTQB 5A35A 2NTSA 5J39A 2E2HB 1TY0A 2K05A 5FO9B 4DN4M 1BCPC 2KHSA 2DN8A 3CQZB 4C1NI 2JE6I 1IHZA 5JJZA 1ILPA 1PMRA 1AP0A 1TWFB 5C3EB 3PIO3 4KJNA 2L0CA 1D6EC 1TS2A 5C0XI 1S5DD 2K01A 4BWGB 3Q23A 1PFMA 3L7ZC 2AQ1B 1GUTA 4MHEA 2G9HD 3P1HA 3FEWX 2E74C 5CBAE 2OXPA 3HP3A 1SYBA 3K0YA 1HRJA 1EIGA 5CORA 3D3RA 3D4DA 3QJYA 4QUCA 3SHLA 2NBFA 3E5SA 1DZ1A 1HA6A 2G9DA 1IYVA 5JEAG 2F0IA 4FXGC 2B2YA 2FMCA 2PW5A 4LK1C 1OXXK 1E2WA 3K5MA 3I90A 3PIP3 3CU7A 3TP8A 3MXUA 4A3DB 5C44B 3NWTA 1EYAA 4IUQA 5AFWA 4CGYB 1EY7A 4H7BA 2O2LD 2OF1A 1FNWA 3H6MA 3S9WA 3O13A 3BYYB 4A93B 1U4RA 2XSCA 1G2SA 2ZT9C 4YIJA 3MXNA 2ZXOA 3AB9A 2F0DA 2RSOA 2JA5B 1B1ZA 4X3TA 2SNMA 2MGSA 2NVTB 3DUZA 2BE5D 2J0TD 4A3KB 3KF8A 1KLUD 2A68C 5EKIA 2NVYB 1H9KA 1CK1A 2HDLA 3PUVA 1RHPA 1LTTD 4Z9CB 1EYDA 3HOYB 1F9RA 3NUCA 2IX0A 2M00A 1G6ZA 3D6WA 2M2LA 3VYRA 2MHVA 1PTOC 3ND9A 2F0PA 2PZUA 1SNCA 3I72A 4EQOA 4DNRB 5CV7A 1FD7D 3TP7A 4DK0A 4ZK9B 1AW7A 1CQFA 4BS9A 4C2MB 3GQBA 2JP1A 3RMHA 1SBBB 1KDCA 4TSSA 1QCBD 4RGOS 1EEFD 2JXMB 3NTKA 5C6AA 4ZUJA 1SNMA 1NUCA 4OIJA 4C3JB 4E6IA 5ELBA 1HUNA 1GHJA 3QWNA 4IUUA 4DNTB 2EYFA 5IT9E 4RWSC 2XVSA 4S3SA 1QWYA 4R9WA 5M3FB 3J80L 3R2IA 2KA7A 4XT1B 3A56A 3WOFA 4UAIA 2BA1A 2QILA 1EWHA 1ET6A 4C3JG 2AQ2B 2A69D 1DCZA 5C4JB 5C5MA 4L8JA 5I2XA 2V4DA 1T5EA 5IIFA 3FPUB 3MWYW 4J1MA 4A3BB 4WORA 1JOKA 3P7JA 1EQTA 1E2ZA 2SNSA 3K7AB 2NWGA 4FVMA 1YNJC 3TMEA 2WIIB 1DD2A 4RCNA 1U4MA 3NBIA 1O80A 3VR6A 2EXZA 2ZXPA 2IWHA 1WTVA 4BBRB 1XTCD 1SDFA 4QUFA 4H13C 4K5WA 4DXGA 3NQIA 4F87A 4Q5VA 2LKVA 5JAVA 4ZAIA 5T1GA 5E1FA 1R4PB 2EE1A 1RJTA 3U9SA 4L6TB 4NDXA 5JVH3 1HHVA 1C48A 1A3UA 1EY5A 2MPMA 3J81L 1SXTA 5M5YB 1JE4A 2F0OA 3OHXC 1MI2A 2I46A 3OW7A 4PMBA 2A5HA 1KAAA 1EY4A 2NVQB 2XRQD 5NUCA 1PZJD 3D6CA 4KY7A 3DEPA 3KBGA 4BY7B 3WDNA 1KNAA 1MSGA 4H0LC 2F4IA 4KKTA 1AEXA 1W6JA 1X32A 1T5XD 4DF7A 1JORA 4XDXA 2EJFC 5LL6X 5LHY1 5ELCA 4WRDA 2R61A 3TP5A 1A3VA 2YU9B 3NK9A 3Q24A 4QMGA 2KOLA 3DM1A 3E6ZX 3S2DB 2BDOA 3GV3A 1A15A 4A3MB 1TS3A 2F03A 2YYZA 2KVMA 1FYCA 1SMYC 1V1OA 2L55A 3EQLC 3CHBD 1Q8IA 4OHJA 1GUGA 3W2DA 2B63B 1Z47A 2B2YC 3OSOA 3F2UA 4G4KA 4HAEA 1BCPD 3E0JA 1OXSC 2NYZD 2R7ZB 3HOWB 4KHZA 3PUYA 4OO1G 3C1EA 4CJ0B 3A8KE 1Y1WB 4IZ8A 2XN9C 1O7LA 1M8AA 5KIXA 1TIID 5JPMC 4FP5D 4OL7A 3GTOB 3SK4A 2F0EA 4RA8A 1HXYD 4DAVA 1TR5A 3T13A 4IUTA 4RCOA 3HOVB 4HEDA 3OMGA 2LY7A 1V1PA 5C4ZA 3HG9A 3SK6A 3A8JE 2BA0A 3MZ5A 4PMWA 4C1NK 3NXWA 1NSNS 4XQJA 4J8QA 2PZWA 4ZYSA 3J7AV 5EJWA 4A3FB 2L11A 3OWEB 2PPBC 3HOZB 1CHQD 2F3WA 1U4LA 2NN6G 3EA6A 2KEDA 2AWOA 4RGTA 2ID0A 1JICA 1SNQA 1Y1VB 1LT6D 1WTQA 5EKKA 2FFKB 3A8IE 3N52A 3GTMB 3MA2B 3TDQA 3PV0A 1A2TA 1GUSA 2CQAA 3KK7A 3HGBA 3HKZB 3Q22A 3I3CA 3M3YB 5IGEA 5D3DA 1JCKB 1L0YB 2IJ0A 5EQ0A 4XTCS 3GTJB 3FPPA 2A68D 1RTOA 5T1IA 1ML0D 5DEHA 1I6VC 2EDGA 4KY5A 5C5LA 5FO7B 2FHTA 1V1PB 2EYPA 2RDHA 5FOBB 3VYUA 2E2IB 2D9UA 2KUMA 1Q12A 1HTLD 1PTOD 1STHA 2K33A 1EOTA 5CBEE 1VF7A 1JWMD 1CTMA 1JR0D 2PYKA 1STNA 5D3IB 3ITPA 1I50B 1WTXA 4WFN3 1S5FD 1RF2D 3R3OA 1AZPA 4ZRZA 2KECA 2WV6D 1SE4A 1PTOH 1EY6A 4M1UB 4RHRA 2FMMA 1STAA 1AFPA 1B2TA 4TKOB 1F2ZA 4KN7C 4CJ1B 3S15B 2VUMB 2B2UA 3T16A 4P2CB 1I4RA 3M7GA 5K5PA 4HSVA 1K83B 1SYCA 1UEAB 5FKAC 3I70A 1TS5A 5I9OA 1R4QB 2BDNA 2F0LA 1BOSA 3K59A 1Q1BA 4O1NA 1WD0A 2PW7A 1VCIA 2DNCA 3L3OC 1LT4D 4QB4A 3GTKB 1BXTA 3URYA 4FNFA 5K36G 3VR3A 1XX8A 3HS0C 3KBXA 3PMFA 1WD1A 4LAAA 4DK1A 3QB3A 1YNJD 1PRTB 4FYDA 5D14A 5BN4A 2C9OA 5EPKA 2E2JB 2WAQB 5I6YA 1SSOA 4RHSA 3JAME 1TY2A 1EU4A 3K58A 1B9NA 1ESFA 2AWNA 5EBCA 2EJGC 4ZQ3A 1QOHA 3K6OA 4DFAA 4HN7A 1TU2B 1Y8PB 3MAQA 4XYOA 1PXUA 5CMDA 3AU7A 3DWQA 3QG1A 5JEAH 5JVG3 3MVVA 3V05A 1ZXTA 2MUYA 4CKCA 1M4VA 4ME5A 4ZLTF 2PZTA 5C4HA 3SR1A 4R8NA 3BVMA 4G7OC 2TSSA 3RLFA 4DAYA 5CR3A 1QB5D 2F0QA 1PFBA 1HPCA 5CV4A 4FXKC 4H44C 3SDZA 2L12A 1C4QA 2CVRA 1I4XA 4KJOA 3C2PA 1DXMA 3FKIB 3K57A 1KDBA 3S17B 3W3AA 3GP7A 4DGZA 4KV6A 1OXVA 1G91A 2B39A 1IL8A 1WTWA 3BYTB 3OOCA 1EIHA 3KLRA 5M3MB 2KEEA 4XQQA 2WINB 1SMYD 1Q1EA 1SE3A 2AUKA 4QF4A 4KD4A 3PO2B 5C0XJ 2EY1A 3BS1A 3S16B 2IT1A 2Z8LA 3HEJA 1NAPA 3I4LA 2WKCA 3GTLB 2A6HC 4BBSB 1FR3A 3G6JB 5KRUA 3NBHA 3FMCA 1DOKA 3NHHA 2RA4A 4DA2A 1D2BA 2B2TA 3VR5A 4RGMA 1YNNC 4KI0A 2FJ2A 4K5XA 3NE5B 2QDBA 2X6GA 1KABA 2VNUD 1I4GA 4K6LA 4F7XA 4NKLA 1GUWA 3OIPA 3ONAB 1DONA 2NTTA 1B3AA 1FNVA 4X3UA 1I3QB 4HSPA 1DJRD 1LTAD 4FF1A 2QKIC 5EPLA 5TSSA 4G7ZC 4MIUA 3ERQA 2O5IC 3QOJA 1G291 5G3LF 3MFGA 4ABNA 2GA4B 2NB0A 1LTSD 3BZDB 1UAPA 4FO2A 4HMJA 1UNSA 5C3WA 2Z1CA 1ZKOA 4K6DA 3H0GB 3EJIA 2BOSA 2R6GA 1PRTC 5HURA 1WTPA 1RCVD 5E4WC 2DY7A 3NPPA 5IOCA 2C5CA 2PMZB 1A2UA 5EGTA 1BCPF 1LT3D 3K5NA 1HUMA 1SAPA 5BN5A 4F88A 2B2UC 5I6WA 1Q3LA 2NUCA 1H9SA 2VB2X 4KD3A 3KLSX 2XRSD 1SE2A 2K6AA 2XIWA 2QF7A 2JA8B 5DM63 5CV8A 3H3VC 4LJZC 3OIQA 2K1BA 1Y8OB 3S2HB 5CGKA 2IX3A 5C0XG 1GXDC 2R3ZA 4PMCA 3BDCA 5IGFA 5G3LD 4WJWA 1CHPD 3M85A 5M5WB 2K5WA 1DOLA 1PYWD 2ICIA 5M5XB 2Y0SB 1QILA 1F77A 3V96A 3BVZA 4KTAA 1B50A 3SE0A 3LNNA 4FF3A 2QEJC 5JOBA 1TWCB 3CRLC 1U9RA 3MXPA 5A2QL 3P20A 3V2TA 5HGTA 1BO0A 4A3IB 1ONLA 3MXGA 2EY2A 3ZYYX 1S5ED 3AMUA 4CJ2C 4I7ZC 2Q8TA 4QCLA 3IFTA 3FRPB 3H94A 2Z4HA 4KHVA 1LTBD 1VMPA 1H9SB 2KCNA 4NMZA 1I4PA 1JWSD 3BVGA 3U9OA 1E0BA 3FDTA 2I07B 3GTGB 3I4NB 2HDMA 3HOXB 3D4WA 1V43A 3NSWA 2D2CC 3OWFA 2LMCB 3ND8A 2F0TA 1TKWB 4HTHA 1BUVT 1ILQA 1SJED 4I65A 3S1QB 4J6HA 4ODGA 2F0GA 3M7NA 4KKUA 4B9XA 1LT5D 1D5XC 1SFOB 4BA1I 2AQ3B 3IKJA 4OO1H 4ILWA 5CV9A 4EQNA 2ICEC 4U673 2K5QA 1PTOF 3J80E 1IKMA 2HUGA 4A3EB 3WOEA 1GHKA 2M9VA 2F0HA 1STYA 5LL6S 1QNKA 2IPKD 1SYDA 1ENFA 2NVXB 2B8GA 1TWGB 4HMIA 4ULLA 3H91A 2L5TA 4CHTB 1LACA 1EY8A 1R9TB 4ZUIA 3SK8A 4EVOA 2L1BA 1S5CD 2SOBA 4OIKA 1SNPA 1EY9A 4CBVA 2NN6H 1HA5A 2IL8A 4R8IA 5KNCA 3NP8A 3DXJC 2B8FA 4B9WA 2NZ1D 3IL8A 2B2TC 2F0WA 1F2LA 5ELFA 5KNDA 3Q0AA 3HRZC 1B53A 1XYIA 1CQVA 2F0NA 1LV9A 1JOOA 2VXWA 2EYOA 1ZYRC 1BQQT 5F2DA 3NTIA 2R93B 5C4XB 1NR4A 2X6LA 2A6EC 3J81E 1HCZA 1CM9A 4IFDJ 2EYJA 2JEBI 1PZKD 3X3NA 1CA5A 4ZKCB 4XT3B 5D65A 2EVBA 4K2LA 2A6HD 2B2VA 3BDOA 1MGSA 5FK9C 5KYIA 1O7YA 3T51B 1SYGA 3CRKC 1LTGD 3C1FA 1JB3A 1CFMA 3RUZA 1YNND 1ICWA 4AYBB 3DEOA 3VYSA 1BBXC 1SNOA 1G8ZD 3LX0A 4KMUC 1QE6A 1OO9B 3NTHA 3NWSA 2F0UA 1B4OA 5CV5A 4F8MA 5IGDA 1QJOA 3J7AF 4KK7A 1S4ZA 4K8IA 1F2YA 1F9QA 3D4RA 3HOUB 1Z7TA 1UUPA 2KQ3A 4FF4A 1Q90A 1D5ZC 1SNDA 1JC7A 2R92B 1AN8A 1OXTA 1EQVA 2DY8A 3I91A 3P75A 4TRDA 3M4YA 3VR2A 2N88A 4UDUC 5BN3A 1WCMB 4XYQA 5K36H 1BR9A 3FVQA 2J7ZA 3S1MB 3EVQA 2F0VA 4FXDA 3R93A 3R8BA 3A55A 2JA7B 4XIGS 1PRTD 3KLSA 2CHBD 5E3FA 5FO8B 2WKDA 4JK1C 4EQPA 3TN2A 4K8JA 2OEOA 3VR4A 2L9HA 4XXEA 4IUNA 1H9RA 2XNAC 3DHQA 2SDFA 4PNYA 1XXGA 2EJMA 4ZKBB 3MHBA 2LS01 1ESRA 3S14B 2XWBB 2K04A 5DNFA 1EL0A 1BF4A 2IX1A 3RZOB 4N9PA 4IFDG 3HZXA 2EYMA 4RGNA 4OGQC 2D62A 1STBA 4G57A 3A7AB 4OO1I 1TS4A 3PUWA 4IFDH 5M9OA 2VB3X 4TQUS 1CA6A 1NR2A 4LMQD 2K5DA 1O7ZA 2K03A 3L9AX 2JYOA 1D1IA 4PV1C 2EPBA 1I6HB 2RQXA 3PUZA 4K2KA 4ID6A 2HQEA 3MFYA 1GJXA 2HCIA 3RD4A 3M4OB 2E2DC 1GUOA 5JPNC 2RKSA 4Q0FA 5IGBA 1E2VA 2QCPX 1F9SA 4G7HC 3N6RA 3C46A 2H1EA 1EY0A 5COYA 5EKLA 4CKEA 1TWHB 1JOQA 3UI2A 1A6XA 3SXHA 2F0JA 2F0MA 3TP6A 4N9TA 1FGBD 4IQZA 4DXFA 4KKSA 1B9MA 5C3XA 4A3JB 1DM0B 1KLGD 1STGA 2NN6I 2JEAI 1SYEA 3T4AC 5DM73 3SEBA 1K8OA 5ELDA 2RSNA 1K8MA 1IW7C 2EYLA 3G7LA 4K14A 1GOZA 1L0XB 1C8CA 1HFGA 3CKIB 1EZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN3 A;  1J9O A;  1BO0 A;  1RTO A;  2L1B A;  5T1I A;  1BBX C;  1G91 A;  4ZAI A;  1DZ1 A;  1IL8 A;  5T1G A;  1MSH A;  1HA6 A;  1PDQ A;  1WTW A;  1XX8 A;  4CJ2 C;  2Q8T A;  2EE1 A;  3KBX A;  1ML0 D;  1RJT A;  4CJ0 B;  1WD1 A;  2MJ8 A;  3I8Z A;  1QE6 A;  2K28 A;  4OIK A;  2B2Y A;  4OIJ A;  1EIH A;  3QO2 A;  5EPJ A;  2FHT A;  1HUN A;  1WVL A;  1HHV A;  2L4N A;  3IFD A;  1B4O A;  3LWE A;  1VMC A;  2KEE A;  2MP1 A;  3MTS A;  2MPM A;  4IUU A;  2D9U A;  1VMP A;  1S4Z A;  2IL8 A;  1NR2 A;  2KUM A;  1JE4 A;  3GV6 A;  3I90 A;  4LMQ D;  5EPK A;  1MI2 A;  1O7Z A;  1M8A A;  2K03 A;  1F9Q A;  1E0B A;  1EOT A;  2NZ1 D;  2B2T C;  1U4P A;  2B2W C;  1F2L A;  2JYO A;  3FDT A;  3IL8 A;  4RWS C;  4U68 A;  5CBE E;  1WTP A;  1J8I A;  1TVX A;  4IUQ A;  1SSO A;  2HDM A;  4R9W A;  5AFW A;  5E4W C;  1PLF A;  2DY7 A;  1B53 A;  2EPB A;  1XYI A;  4RA8 A;  1AZQ A;  1WTX A;  4RAU C;  3Q6S A;  4IUT A;  1NAP A;  5E4X A;  4NW2 A;  4XT1 B;  1LV9 A;  2DY8 A;  4HED A;  4UAI A;  1U4R A;  1ILQ A;  2HCI A;  2VXW A;  3DEP A;  1G2S A;  5D14 A;  4R8I A;  1HUM A;  2N55 A;  4HCS A;  1SAP A;  3TZD A;  1AZP A;  1CA6 A;  1DOK A;  2B2U C;  1KNA A;  1MSG A;  2FIN B;  3I91 A;  2K05 A;  2RA4 A;  4IUR A;  5CMD A;  4IUV A;  2RSO A;  1Q3L A;  4DN4 M;  2N88 A;  2KEC A;  1X32 A;  2B2T A;  2B2W A;  4O42 A;  1IKL A;  1F9S A;  2J7Z A;  2Q8R E;  4X3T A;  2H1E A;  2FJ2 A;  2MGS A;  2XIW A;  2X6G A;  5COY A;  1NR4 A;  2X6L A;  4XDX A;  5EJW A;  5JJZ A;  1HFN A;  4X3K A;  1ILP A;  1ZXT A;  1AP0 A;  2B2V C;  1CM9 A;  3R93 A;  2HCC A;  3FPU B;  2FMM A;  1WTO A;  3MWY W;  2K1B A;  5EKI A;  2L11 A;  3UI2 A;  2HDL A;  1B2T A;  4ZLT F;  1GUW A;  3SVM A;  1QG7 A;  1RHP A;  1PFN A;  1G2T A;  2KOL A;  4CJ1 B;  3DM1 A;  1U4L A;  3ONA B;  3TN2 A;  2HUG A;  3P7J A;  1EQT A;  1IKM A;  1CA5 A;  2B2U A;  1DON A;  3GV3 A;  2KED A;  5EQ0 A;  1A15 A;  2NWG A;  4XT3 B;  1F9R A;  4ZKC B;  2R3Z A;  1B3A A;  1ROD A;  1G6Z A;  1PFB A;  2L9H A;  3D6W A;  2K01 A;  1JIC A;  5D65 A;  1X3Q A;  1BNZ A;  2KVM A;  2SDF A;  4HSV A;  1KNE A;  2M2L A;  4X3S A;  4X3U A;  2L12 A;  4IUP A;  2RSN A;  1QNK A;  2EOT A;  4ZKB B;  2CVR A;  1NCV A;  1WTQ A;  1ESR A;  1PFM A;  1U4M A;  2B2V A;  2FFK B;  2X69 A;  4MHE A;  5EPL A;  1O80 A;  1DOL A;  1X3P A;  3N52 A;  1MGS A;  1O7Y A;  2B2Y C;  3KUP A;  5CBA E;  3HP3 A;  1WTR A;  2K04 A;  1WTV A;  5DNF A;  2BDN A;  1RTN A;  3F2U A;  3H91 A;  1EL0 A;  4ZK9 B;  4HAE A;  1F9P A;  3G7L A;  1DOM A;  3I3C A;  1B50 A;  1C8C A;  1SDF A;  1ICW A;  4QUF A;  1BF4 A;  1WD0 A;  1EIG A;  1HRJ A;  5COR A;  2JP1 A;  2RVL A;  1HFG A;  2NYZ D;  3DEO A;  4QUC A; 
#chains in the Genus database with same CATH topology
 1J9O A;  4DAP A;  4RKL A;  4A3J G;  3I4M B;  1MSH A;  4V19 0;  1VQN A;  1JQY D;  3PO2 H;  3TS0 A;  2KCC A;  1RDP D;  5EBD A;  3S16 H;  1E24 A;  4PQX A;  1SYF A;  2CW0 D;  1S5B D;  4JC0 A;  5BR8 Q;  1VMC A;  4JI7 Q;  4DR5 L;  1XMQ Q;  3A7L A;  1LAB A;  3GTL H;  3MTS A;  1ENA A;  4JG2 A;  1WTH A;  4QQB X;  4BBS H;  5ELE A;  2R7D A;  2RDG A;  4PZ7 A;  4XQN A;  4LF4 Q;  1QVF A;  1KTK A;  1TT2 A;  4LF6 Q;  1EU3 A;  4MTN A;  4IPH A;  1U5K A;  2PQE A;  1PH1 A;  1HTP A;  3K5O A;  3LWU A;  4RAU C;  4DV1 L;  4KY6 A;  3OTO Q;  4NW2 A;  3I4M G;  1LUZ A;  3OW2 A;  2O5J C;  1RIP A;  1MD2 D;  2N55 A;  3TZD A;  4AQY L;  4P73 A;  2KJX A;  1QNU A;  2GVA A;  2XWJ B;  4JI3 L;  1YVC A;  2B2W A;  4O42 A;  2Q8R E;  3TBI B;  2I0Q A;  2O4X A;  1HFN A;  4YCV A;  4X3K A;  2EY5 A;  2B2V C;  2SEB D;  4QIW B;  1I3Q H;  1JJC B;  4M8A A;  2EY6 A;  3DWP A;  4JBW A;  4RKB A;  3F2C A;  1G6P A;  1Z6H A;  4DV5 Q;  2Q8I B;  3SVM A;  3QIA A;  1AH9 A;  1PFN A;  3PO3 B;  1G2T A;  5GAE C;  1I4H A;  4A3G B;  4DV4 Q;  3HFZ B;  4JBM A;  4JYA Q;  2JK8 A;  3JC6 6;  3TSS A;  5IGG A;  4RFB A;  1RD9 D;  2WAQ E;  4X3S A;  5JJK A;  4MNO A;  1JWU D;  1HR0 L;  4B3R L;  5KGU A;  2QEX A;  2E76 C;  1NCV A;  5I9P A;  2OCE A;  4HCE A;  3A54 A;  3J7Y W;  4KN4 C;  3J80 i;  2VQF L;  3S1N B;  3GD7 A;  2UUC L;  2Z6K A;  3I73 A;  1ZYR D;  3SK5 A;  3CP0 A;  1F9P A;  1DOM A;  5J1Z A;  3H0G H;  1TWA B;  2TMP A;  2RVL A;  1OXU A;  1TQO A;  2A6E D;  1PZI D;  3PO3 G;  2J4X A;  4A3G G;  2PCF B;  3OPO A;  3TZU A;  2ZJQ A;  3VA5 A;  4DR7 L;  1KDA A;  2LFN A;  4LF7 L;  3KJP A;  3K80 C;  1XWE A;  1N8R C;  1QVC A;  3EFX D;  3GO5 A;  3QO2 A;  4NP5 A;  1JJG A;  3BG3 A;  5C0X H;  2JA8 G;  2BE5 C;  1Y69 U;  4IAL A;  4L63 B;  3LWE A;  2YTX A;  2OT2 A;  4R1J A;  3T53 B;  3D31 A;  2KHJ A;  2WAC A;  4ALP A;  2ZXR A;  3G4S A;  5J3B A;  1A8V A;  5FLX L;  4BA2 I;  2K5N A;  1O78 A;  2BCO A;  2WB1 B;  3OMC A;  1Q86 C;  2JA8 H;  2WFW A;  1PA6 A;  4V0B A;  5ISR A;  3PUX A;  1I5F A;  4PZ6 A;  5E4X A;  1I94 L;  1EYC A;  1HQR D;  1JB7 A;  1Y8N B;  1NE3 A;  4IN3 A;  5CV6 A;  5IP9 G;  3CME A;  3T1H L;  4HCS A;  3S2H H;  5KEE A;  2FIN B;  3NQT A;  1BCP B;  1H9M A;  2A73 B;  3D8G A;  4IUV A;  1FNU A;  3B6Y A;  4NB3 A;  4QY7 A;  2F1M A;  1K0S A;  1LLR D;  2D5D A;  1CUK A;  3X3M A;  3BZC A;  4DK6 C;  4GOP C;  5M5W H;  4A3C G;  2HCC A;  2UUB L;  4DR2 Q;  4R4Q A;  2HHH L;  2EZV A;  5DAU A;  4DV7 Q;  2PNH A;  5M5X H;  3J81 i;  4OWX B;  1SR3 A;  4CDC C;  1ROD A;  1EWC A;  4LFB L;  4IFD I;  1TWC H;  5I4D A;  1VQO A;  3AFP A;  4P72 A;  4C56 C;  2KCM A;  2Z4I A;  3H09 A;  5CC4 A;  4A3I H;  3J80 c;  3KUP A;  1II3 A;  2RDF A;  3MC0 B;  5IOD A;  3CCR A;  1ENC A;  3H3V I;  4JW0 A;  5KYL A;  1KAW A;  3JAM L;  2WP8 J;  1BDO A;  2CW0 C;  2N49 A;  2D0P A;  1SEB D;  3ERO A;  4MN3 A;  1UWV A;  1IYU A;  3E9I A;  3SGI A;  2E5L L;  4B08 A;  4JI4 L;  3IAY A;  2A69 C;  4DUZ Q;  2OWO A;  3GTG H;  1E22 A;  1I4Q A;  3I4N H;  4LFC L;  3HOX H;  4DU9 A;  2MJ8 A;  5IYD G;  1CI3 M;  1H9J A;  3IFD A;  1YIJ A;  1CT1 D;  1EEI D;  3S1Q H;  1VQ4 A;  3KDF A;  2VW9 A;  4DV6 L;  2F0K A;  1HQM C;  2PO4 A;  2F0S A;  5L37 A;  4IUP A;  1U4P A;  4U68 A;  1F2M A;  5I2Y A;  4KHP L;  1J8I A;  1SFO H;  4A3E G;  4GN5 A;  5IYD H;  1PLF A;  3I55 A;  4RG1 A;  1A3T A;  1YEZ A;  5GAD C;  1AZQ A;  4JI2 L;  2JA6 B;  4GZY C;  1O7I A;  3T56 B;  1VDZ A;  1FVI A;  1CSQ A;  4UP7 A;  1P8L A;  2H4O A;  1CZG A;  2UU9 L;  1VQL A;  4HR7 B;  4POF A;  5JJI A;  2MFI A;  4IUR A;  2XTI A;  4A3E H;  2PNR C;  5CYU A;  4Y7N B;  1IKL A;  4C3H B;  3VYT A;  1LTI D;  2NZO A;  1W6K A;  3G48 A;  4R4O A;  2A8V A;  1WTO A;  1MHW C;  2ENB A;  3C3L A;  1QG7 A;  2NVX H;  4FF2 A;  1TWG H;  1NMF A;  4OXP A;  2E75 C;  1EFI D;  2JA6 G;  5JEA J;  2KHI A;  3CPW A;  1HJP A;  3J81 c;  4BY1 B;  3RLN A;  3VA7 A;  1SN8 A;  2K7V A;  4K5V A;  4C3I B;  1PTO B;  3BDL A;  3K5L A;  1X3Q A;  1R9T H;  1BNZ A;  1EWI A;  1KNE A;  5KNB A;  4RH6 A;  1PH2 A;  1V8Q A;  4JI0 L;  2EOT A;  2RBM A;  2X69 A;  1KD1 C;  1VQ6 A;  2UXD Q;  1SJH D;  4C3H G;  1GUN A;  2IW3 A;  1X3P A;  5IGC A;  2F0F A;  2JSO A;  2JN4 A;  1WTR A;  1J6Q A;  1LO5 D;  1RTN A;  1ZEQ X;  2PMZ E;  3RZD B;  4B3M Q;  1D5M C;  4YCU A;  1ET9 A;  4EGV A;  1CZW A;  3DMU A;  4IPD A;  2N3S A;  1STE A;  3NEN A;  1PDQ A;  4I7A A;  4BY1 G;  3STB D;  4C3I G;  2DNE A;  1PRT F;  3I8Z A;  3F2D A;  2K28 A;  1LTR D;  2R93 G;  5EPJ A;  1PYS B;  5C4X G;  2YTV A;  4GKK L;  1EZ6 A;  1N9W A;  5IT9 L;  1WVL A;  2L4N A;  1D1K A;  4CKB A;  1VF5 C;  1VQ9 A;  3QOL A;  2MP1 A;  4LFA Q;  4EX5 A;  3S1R B;  4YHH Q;  3CC4 A;  3GV6 A;  3ICE A;  3K81 C;  1IBL L;  2A74 C;  3MEH A;  1DYQ A;  2B2W C;  2F3V A;  4NXN L;  3R2T A;  1TVX A;  2AUJ D;  3DWA A;  5EAY A;  1IBM L;  2R93 H;  1PHJ A;  4P75 A;  3HKS A;  1IW7 D;  5C4X H;  2K32 A;  1MBY A;  3Q6S A;  2P5Z X;  1M1K C;  2EYH A;  5FLX E;  5J22 A;  5A2Q E;  3GTP B;  1RKN A;  1B44 D;  3GTQ B;  5A35 A;  2Y0S E;  2NTS A;  5J39 A;  2E2H B;  1TY0 A;  4PG3 A;  3DLL A;  4UP8 A;  2K05 A;  5FO9 B;  4DN4 M;  1BCP C;  1D8L A;  2KHS A;  1PH7 A;  2DN8 A;  3CQZ B;  4C1N I;  1YI2 A;  2JE6 I;  4LF9 Q;  1IHZ A;  1IBK L;  5JJZ A;  1ILP A;  1PMR A;  1AP0 A;  1TWF B;  5C3E B;  1EIY B;  4OX9 L;  1E3P A;  2EIF A;  3PIO 3;  4KJN A;  2LXJ A;  2L0C A;  1D6E C;  1PVO A;  3PSI A;  1TS2 A;  5C0X I;  1S5D D;  2K01 A;  4BWG B;  1X6O A;  4P74 A;  2MO0 A;  3Q23 A;  1PFM A;  4IOC A;  3L7Z C;  2AQ1 B;  1GUT A;  3UDX A;  4MHE A;  2G9H D;  3P1H A;  3HOU G;  3ERS X;  3FEW X;  2E74 C;  5CBA E;  2OXP A;  3HP3 A;  2JJQ A;  2YV5 A;  2ASB A;  1SYB A;  4BXX G;  3K0Y A;  1S40 A;  1HRJ A;  1EIG A;  5COR A;  3D3R A;  1N36 L;  3D4D A;  2UUA L;  3QJY A;  2NBF A;  4QUC A;  3SHL A;  3E5S A;  1DZ1 A;  1HA6 A;  3HOU H;  1KHI A;  2G9D A;  5IP7 G;  1IYV A;  5JEA G;  2F0I A;  1ASZ A;  4FXG C;  4BXX H;  2R92 H;  2B2Y A;  2FMC A;  4DUY Q;  2PW5 A;  1NMG A;  4LK1 C;  1OXX K;  1E2W A;  3K5M A;  3I90 A;  3PIP 3;  3CU7 A;  3TP8 A;  3MXU A;  4A3D B;  5C44 B;  4DR5 Q;  5IP7 H;  1XNQ L;  4IOA A;  3NWT A;  1EYA A;  4IUQ A;  1MJC A;  4B3T L;  5AFW A;  4CGY B;  1WCM H;  1EY7 A;  3S1M H;  3I2Z A;  4H7B A;  2O2L D;  2OF1 A;  4QJF A;  1FNW A;  3H6M A;  3S9W A;  3O13 A;  3BYY B;  4A4I A;  4A93 B;  1U4R A;  2XSC A;  1G2S A;  2ZT9 C;  4YIJ A;  2JA7 H;  4DR6 L;  3MXN A;  2ZXO A;  1N34 L;  3AB9 A;  1JE5 A;  2ZTE A;  1KIX A;  2F0D A;  2RSO A;  1KL9 A;  2JA5 B;  4AIM A;  1B1Z A;  4X3T A;  2SNM A;  4JI8 L;  2MGS A;  2NVT B;  3DUZ A;  4A3D G;  2BE5 D;  2J0T D;  4JI1 L;  4N8F A;  4A3K B;  3KF8 A;  1KLU D;  2A68 C;  5EKI A;  2NVY B;  4CDE C;  1H9K A;  1CK1 A;  2HDL A;  1YIT A;  3PUV A;  1RHP A;  2YTY A;  3KJO A;  3S14 H;  1LTT D;  1BBW A;  2ES2 A;  4Z9C B;  1EYD A;  3HOY B;  3A5U A;  1B70 B;  1F9R A;  2IX0 A;  2M00 A;  3NUC A;  1G6Z A;  3RZO H;  3D6W A;  2M2L A;  3VYR A;  2MHV A;  1PTO C;  3ND9 A;  1PH3 A;  2F0P A;  2PZU A;  1SNC A;  2K14 A;  2JA5 G;  3I72 A;  4EQO A;  4DNR B;  4GNX A;  4B3R Q;  5CV7 A;  1FD7 D;  3TP7 A;  3W1G A;  4DK0 A;  4ZK9 B;  3U4Z A;  1EYG A;  1AW7 A;  1CQF A;  4A3K G;  1ICF B;  1TXY A;  4BS9 A;  4C2M B;  3GQB A;  4HJA A;  2JP1 A;  3RMH A;  2LSS A;  3CCU A;  1SBB B;  1KDC A;  2VL6 A;  4TSS A;  1EFW A;  3HOY G;  1QCB D;  4RGO S;  1EEF D;  4GLV B;  2JXM B;  4RMF A;  1Q82 C;  3NTK A;  5C6A A;  4ZUJ A;  3G71 A;  1SNM A;  1NUC A;  1I6H H;  4OIJ A;  4C3J B;  3MXN B;  4E6I A;  5ELB A;  1HUN A;  1GHJ A;  3QWN A;  3M4Q A;  4DAY B;  3BJU A;  1U0L A;  4IUU A;  3M4O H;  1VQ5 A;  4IO9 A;  4DNT B;  2EYF A;  5IT9 E;  5LMU L;  4RWS C;  2XVS A;  2VS1 A;  1GKH A;  4S3S A;  1QWY A;  4R9W A;  5M3F B;  3J80 L;  3KF8 B;  3R2I A;  2KA7 A;  4XT1 B;  1TWH H;  3A56 A;  4UAI A;  3WOF A;  2BA1 A;  2HIV A;  2QIL A;  1XPO A;  1EWH A;  1I94 Q;  3QR8 A;  1ET6 A;  4C3J G;  3OYY A;  2AQ2 B;  2A69 D;  1DCZ A;  5C4J B;  5C5M A;  1UE7 A;  4A3J H;  4AYB E;  4L8J A;  5I2X A;  2V4D A;  1T5E A;  5IIF A;  1PYB A;  4GNX B;  5IY0 A;  5FLM G;  3FPU B;  4DR3 Q;  4DR4 Q;  3MWY W;  4J1M A;  4A3B B;  4WOR A;  5M3F G;  1FJG L;  1JOK A;  4DV3 Q;  3P7J A;  1EQT A;  2PQA B;  1EOV A;  1E2Z A;  3LGJ A;  2SNS A;  2V1C C;  3K7A B;  2NWG A;  4FVM A;  2OTJ A;  1YNJ C;  4NXM L;  3TME A;  2WII B;  1Y14 B;  1DD2 A;  3CPF A;  4RCN A;  1U4M A;  5IWA Q;  3I4M H;  3NBI A;  2RCN A;  4OWT B;  1O80 A;  3VR6 A;  2EXZ A;  2Q2H A;  2ZXP A;  2IWH A;  1WTV A;  2UXC L;  2N8N A;  2MO1 A;  4BBR B;  1MKH A;  1XTC D;  3ER0 A;  1SDF A;  4QUF A;  4A3B G;  2F4V L;  1X9N A;  4H13 C;  4K5W A;  4LF5 L;  4DXG A;  3NQI A;  4F87 A;  4Q5V A;  2LKV A;  1PH5 A;  5JAV A;  4ZAI A;  5T1G A;  5E1F A;  1R4P B;  2EE1 A;  4X62 Q;  1RJT A;  3U9S A;  2I5H A;  4X64 L;  4L6T B;  4NDX A;  4NPS A;  1J5E L;  5JVH 3;  2OQK A;  1HHV A;  1C48 A;  1A3U A;  1EY5 A;  2MPM A;  3J81 L;  1SXT A;  5M5Y B;  1JE4 A;  2F0O A;  3OHX C;  1MI2 A;  4GKJ L;  1KC8 C;  2I46 A;  4BBR G;  3OW7 A;  1IL2 A;  4PMB A;  4JV5 Q;  4DPG A;  2A5H A;  1KAA A;  1EY4 A;  2NVQ B;  2Z6B A;  4HJ8 A;  2XRQ D;  5NUC A;  3D6C A;  1PZJ D;  1IZ6 A;  4KY7 A;  3DEP A;  3KBG A;  4BY7 B;  3WDN A;  1X56 A;  1VQE A;  3PO3 H;  1KNA A;  1MSG A;  4H0L C;  4HIO A;  4N8X 1;  4A3G H;  2F4I A;  4KKT A;  3UE1 A;  1AEX A;  1W6J A;  1X32 A;  1T5X D;  2AKW B;  3IRB A;  4DF7 A;  3WWV A;  1JOR A;  3D0F A;  4XDX A;  1EQR A;  2EJF C;  5LL6 X;  1QVG A;  5LHY 1;  1SRU A;  3J7A 5;  2QDL A;  5ELC A;  2XGT A;  4WRD A;  4KLK A;  1YZ6 A;  2R61 A;  3TP5 A;  1A3V A;  2YU9 B;  3NK9 A;  3Q24 A;  4QMG A;  3S1N H;  1PFS A;  2KOL A;  3TRE A;  3DM1 A;  3E6Z X;  3S2D B;  2BDO A;  3GV3 A;  1A15 A;  4A3M B;  1TS3 A;  3PF4 A;  4BY7 G;  2AMC B;  1TWA H;  2F03 A;  2YYZ A;  2KVM A;  1FYC A;  4DV2 Q;  1SMY C;  1V1O A;  2L55 A;  3EQL C;  2E8G A;  3CHB D;  1Q8I A;  4OHJ A;  5BR8 L;  1GUG A;  4JI7 L;  3W2D A;  1XMQ L;  2B63 B;  5IP9 H;  1Z47 A;  2B2Y C;  1MJE A;  1GM5 A;  3OSO A;  4UY8 C;  2WB1 G;  2K5V A;  3F2U A;  4G4K A;  4LF4 L;  4JPB W;  1SE8 A;  4HAE A;  1BCP D;  3E0J A;  1VQM A;  4LF6 L;  2CH4 A;  5IYB G;  3PF5 A;  1OXS C;  2NYZ D;  2R7Z B;  3HOW B;  4A3C H;  3OTO L;  3I7F A;  1UE1 A;  4KHZ A;  1E1O A;  3PUY A;  4A3M G;  1K0R A;  4OO1 G;  3C1E A;  4CJ0 B;  1N32 Q;  1HNX L;  3A8K E;  4YY3 Q;  1Y1W B;  1A63 A;  4IZ8 A;  4JI5 Q;  2XN9 C;  1O7L A;  1M8A A;  3E9H A;  5KIX A;  1TII D;  5JPM C;  2PI2 E;  1HR0 W;  3RR5 A;  4FP5 D;  4LUV A;  4OL7 A;  3GTO B;  2VQE Q;  3SK4 A;  4APV A;  1IBL Q;  2F0E A;  1VQI A;  4RA8 A;  1HXY D;  4NXN Q;  3EBE A;  3HOW G;  2R7Z G;  4DAV A;  1TR5 A;  3T13 A;  4IUT A;  4RCO A;  4DV4 L;  1QZH A;  3HOV B;  1IBM Q;  4HED A;  3OMG A;  3A74 A;  4JYA L;  2LY7 A;  2I5M X;  1V1P A;  2BH8 A;  4IJL A;  3HG9 A;  3SK6 A;  5C4Z A;  4R4I A;  3A8J E;  2BA0 A;  3MZ5 A;  1NBW A;  2ZM6 Q;  2L15 A;  1Y1W G;  4PMW A;  4C1N K;  1YHB A;  3NXW A;  1NSN S;  3M9B A;  4XQJ A;  4J8Q A;  1GO3 E;  2PZW A;  4ZYS A;  3J7A V;  5EJW A;  4A3F B;  3AEV A;  1CKN A;  3BU2 A;  4GNX C;  1RL2 A;  2L11 A;  3OWE B;  4DNI A;  2PPB C;  1XPR A;  3HOZ B;  2K4K A;  1HNZ Q;  1CHQ D;  2F3W A;  1U4L A;  2RCF A;  2NN6 G;  3MEF A;  3EA6 A;  3HOV G;  2KED A;  4UHV A;  1YJN A;  2AWO A;  4QGU A;  4RGT A;  2ID0 A;  1JIC A;  1SNQ A;  3J81 j;  1XNR Q;  3CC2 A;  1Y1V B;  1LT6 D;  1WTQ A;  2ATW A;  5EKK A;  2CQO A;  2FFK B;  3A8I E;  2HQL A;  3N52 A;  3GTM B;  4A3F G;  3MA2 B;  3TDQ A;  3PV0 A;  1A2T A;  2KBN A;  1GUS A;  4LWC A;  2CQA A;  3KK7 A;  3HGB A;  3HKZ B;  3Q22 A;  1FL0 A;  3I3C A;  3M3Y B;  1H95 A;  1YHA A;  1VQK A;  1B3Q A;  5IGE A;  4POG A;  5D3D A;  3HOZ G;  1JCK B;  4JCV E;  1L0Y B;  4DV0 Q;  2IJ0 A;  1XMO Q;  5EQ0 A;  4XTC S;  3GTJ B;  3FPP A;  1YNX A;  1RTO A;  2A68 D;  5T1I A;  4DR1 Q;  1W3S A;  3PIO A;  1PH9 A;  1ML0 D;  4LF8 Q;  5DEH A;  1I6V C;  2EDG A;  4KY5 A;  4OON A;  4QIW E;  5C5L A;  5GAG C;  5FO7 B;  2JA6 H;  2FHT A;  1V1P B;  1VQF A;  2EYP A;  2RDH A;  5FOB B;  2CKZ B;  3VYU A;  2E2I B;  2D9U A;  2KUM A;  1Q12 A;  1HTL D;  1PTO D;  1STH A;  2K33 A;  1EOT A;  5CBE E;  3HKZ G;  1VF7 A;  1WYD A;  4DR2 L;  1JWM D;  1CTM A;  1JR0 D;  1CKN B;  1UE5 A;  2PYK A;  4Y7N H;  1STN A;  4DV7 L;  4C3H H;  5D3I B;  3ITP A;  1I50 B;  1HZ9 A;  1WTX A;  4WFN 3;  1PH6 A;  1S5F D;  1RF2 D;  3U50 C;  3R3O A;  1AZP A;  4EQ5 A;  3CXC A;  4ZRZ A;  2VZA A;  2KEC A;  2WV6 D;  5GQO A;  4BY1 H;  4LW1 A;  1L1O B;  1SE4 A;  4C3I H;  2HIX A;  1PTO H;  2ZTD A;  1EY6 A;  4M1U B;  4RHR A;  2FMM A;  1STA A;  1AFP A;  1B2T A;  2HT1 A;  1GD7 A;  4TKO B;  4H02 A;  1F2Z A;  4KN7 C;  3PIP A;  4CJ1 B;  4JI6 L;  2HD3 A;  3S15 B;  2VUM B;  3RZD H;  2B2U A;  2RHQ B;  4DUZ L;  5H1S E;  3T16 A;  4P2C B;  1I4R A;  3M7G A;  5K5P A;  1CKO A;  4HSV A;  1KRT A;  1JJ2 A;  1K83 B;  1LTL A;  1SYC A;  1UEA B;  5FKA C;  3I70 A;  2VY3 A;  2KEN A;  1TS5 A;  1Q8K A;  1EQQ A;  5I9O A;  1R4Q B;  3L2P A;  2BDN A;  2F0L A;  5AJ3 Q;  1BOS A;  4P71 A;  3K59 A;  4A75 A;  1Q1B A;  4O1N A;  1WD0 A;  3AYH B;  4GN3 B;  1N33 L;  2PW7 A;  4X66 Q;  3S1R H;  1VCI A;  2DNC A;  3L3O C;  1LT4 D;  4QB4 A;  2VUM G;  2EXD A;  2CH4 W;  3CCE A;  1BXT A;  3GTK B;  3URY A;  4FNF A;  4TVA B;  5K36 G;  3VR3 A;  1XX8 A;  3HS0 C;  3KBX A;  1X3G A;  3PMF A;  1WD1 A;  4LAA A;  4DK1 A;  1HZC A;  3QB3 A;  2NZH A;  3GTP H;  1YNJ D;  3A5Z B;  1W2B A;  1PRT B;  5C3E G;  4FYD A;  5D14 A;  3GTQ H;  5BN4 A;  2IY5 B;  2C9O A;  5EPK A;  2E2H H;  2E2J B;  2WAQ B;  2DJG C;  5I6Y A;  1SSO A;  3CQZ H;  4RHS A;  3JAM E;  1TY2 A;  1EU4 A;  1X65 A;  3K58 A;  1B9N A;  1ESF A;  2AWN A;  3T1Y L;  5EBC A;  2EJG C;  4ZQ3 A;  1TWF H;  5C3E H;  3K6O A;  1HZA A;  1QOH A;  4DFA A;  4IPG A;  1XTD A;  4HN7 A;  1TU2 B;  1Y8P B;  3DM3 A;  3MAQ A;  4XYO A;  1PXU A;  5CMD A;  3AU7 A;  2UXD L;  3DWQ A;  2ZJP A;  3QG1 A;  5JEA H;  5JVG 3;  3MVV A;  3V05 A;  4B3M L;  1ZXT A;  1VQ7 A;  2WAQ G;  2MUY A;  4CKC A;  1M4V A;  4ME5 A;  4ZLT F;  2PZT A;  5C4H A;  5FJ8 G;  3S24 A;  3SR1 A;  4R8N A;  3BVM A;  3TEH B;  4DKA C;  4DV1 Q;  2DGY A;  4G7O C;  3ULP A;  2TSS A;  3RLF A;  4DAY A;  2KCT A;  5CR3 A;  1QB5 D;  2F0Q A;  1PFB A;  1HPC A;  5CV4 A;  4FXK C;  4H44 C;  3SDZ A;  2L12 A;  4AQY Q;  3FP9 A;  1C4Q A;  2CVR A;  3U4V A;  4OEM B;  3TQY A;  4JI3 Q;  5C44 G;  4LFA L;  5FJ8 H;  1I4X A;  4R4T A;  4QL5 A;  4KJO A;  3I56 A;  5IYC G;  3C2P A;  3CW2 C;  1DXM A;  3FKI B;  3K57 A;  1KDB A;  3S17 B;  4A93 G;  3W3A A;  3VDY A;  3GP7 A;  4DAM A;  4DGZ A;  1C0A A;  3KYH C;  4KV6 A;  1OXV A;  4YWK A;  4A3D H;  1G91 A;  2B39 A;  5C44 H;  1IL8 A;  3CD6 A;  1WTW A;  4JOI A;  3BYT B;  3OOC A;  3CF5 A;  1C7Y A;  4JVZ A;  1EIH A;  4A76 A;  1HR0 Q;  3KLR A;  2VQF Q;  5M3M B;  1YBY A;  2KEE A;  4A93 H;  1PV4 A;  4XQQ A;  2UUC Q;  2WIN B;  4LF9 L;  1SMY D;  1HNW L;  1SRO A;  1Q1E A;  2PQA A;  1SE3 A;  2AUK A;  4QF4 A;  3FKI G;  4KD4 A;  3PO2 B;  5C0X J;  2JA5 H;  2EQS A;  2EY1 A;  5DLQ E;  4HID A;  1YJ9 A;  3BS1 A;  3S16 B;  2IT1 A;  2Z8L A;  3HEJ A;  2NVT H;  2F52 A;  1NAP A;  3I4L A;  1L2F A;  2WKC A;  3PQI A;  4DR7 Q;  4A3K H;  1NTG A;  3GTL B;  2A6H C;  2NVY H;  2QGQ A;  1FR3 A;  4BBS B;  4LF7 Q;  3G6J B;  3F2B A;  5KRU A;  3NBH A;  3FMC A;  1DOK A;  3NHH A;  2RA4 A;  4L5T A;  4DA2 A;  2ZJR A;  1D2B A;  3HOY H;  2B2T A;  5M3M G;  3VR5 A;  4RGM A;  1YNN C;  4KI0 A;  4GN4 B;  2FJ2 A;  4K5X A;  3NE5 B;  2QDB A;  2X6G A;  1KAB A;  2VNU D;  1I4G A;  4K6L A;  4F7X A;  1JMC A;  4YWL A;  1UEB A;  4LNQ A;  2RHS B;  4NKL A;  4Y52 H;  1GUW A;  4HIK A;  3PO2 G;  3OIP A;  3ONA B;  1DON A;  4MTK A;  2NTT A;  1B3A A;  4C2M H;  4BBS G;  2F3I A;  3T1H Q;  3CCJ A;  1FNV A;  4X3U A;  4DUY L;  1I3Q B;  4HSP A;  1DJR D;  1LTA D;  4FF1 A;  2QKI C;  1P16 A;  5EPL A;  5TSS A;  4G7Z C;  2K75 A;  2QA4 A;  1GVP A;  1D7Q A;  4MIU A;  3ERQ A;  1WI5 A;  4C3J H;  2UUB Q;  3QOJ A;  2O5I C;  4K0K L;  1G29 1;  5G3L F;  3MFG A;  2HHH Q;  1NNX A;  4ABN A;  3A0J A;  3UE0 A;  1WFQ A;  5JJL A;  4DK3 C;  2GA4 B;  4O0A A;  2AHO B;  1L0W A;  4GLA C;  2NB0 A;  2Q2I A;  4AH6 A;  3CCQ A;  1LTS D;  5FLM H;  2UXB L;  5GAH C;  3GDE A;  3BZD B;  1UAP A;  3U58 A;  4FO2 A;  4LFB Q;  5M3F H;  4HMJ A;  1UNS A;  5C3W A;  2Z1C A;  1ZKO A;  3NBH B;  4K6D A;  4X65 L;  3H0G B;  1K73 C;  4J15 A;  3EJI A;  1HNX Q;  2BOS A;  1KQS A;  2R6G A;  1PRT C;  4B3S L;  5HUR A;  1WTP A;  1RCV D;  5C4J H;  5E4W C;  3NPP A;  2DY7 A;  4CDD C;  1DGS A;  5IOC A;  3NEL A;  4WJ3 M;  1K8G A;  3M4P A;  3L0O A;  2C5C A;  2E5L Q;  1Q46 A;  2PMZ B;  1A2U A;  5EGT A;  1BCP F;  1YJW A;  4JI4 Q;  1LT3 D;  3K5N A;  1IXR A;  4A3B H;  4LFC Q;  1HUM A;  1SAP A;  5BN5 A;  4F88 A;  3J7Z C;  2B2U C;  1Q3L A;  5I6W A;  2NUC A;  3CMA A;  1H9S A;  5ELN A;  3H0G G;  2VB2 X;  3K7A H;  4KD3 A;  3KLS X;  2XRS D;  1SE2 A;  2K6A A;  2XIW A;  4DV6 Q;  2QF7 A;  2JA8 B;  5DM6 3;  5CV8 A;  3H3V C;  4LJZ C;  2I5L X;  3EIV A;  5IE8 A;  3OIQ A;  4KHP Q;  2K1B A;  1JT8 A;  1IYJ B;  1OTC A;  1Y8O B;  3S2H B;  5CGK A;  4JI2 Q;  2IX3 A;  5C0X G;  3KLW A;  1GXD C;  1Z9F A;  2R3Z A;  4PMC A;  4BBR H;  3BDC A;  3K8A A;  5IGF A;  5G3L D;  4WJW A;  1CHP D;  3M85 A;  5M5W B;  2UU9 Q;  1VQC A;  3KOJ A;  1SMX A;  2K5W A;  1DOL A;  1PYW D;  2ICI A;  5M5X B;  5LMN L;  2Y0S B;  1QIL A;  1F77 A;  3V96 A;  3BVZ A;  4KTA A;  1B50 A;  3SE0 A;  3LNN A;  1Q81 C;  4FF3 A;  2QEJ C;  5JOB A;  1TWC B;  1C9O A;  3CRL C;  1U9R A;  3ULJ A;  3MXP A;  2D0O A;  5M5Y H;  5A2Q L;  3P20 A;  3V2T A;  5HGT A;  1BO0 A;  4A3I B;  4UPA A;  1ONL A;  3MXG A;  2EY2 A;  3ZYY X;  1S5E D;  3AMU A;  4CJ2 C;  4I7Z C;  2Q8T A;  4QCL A;  2IHE A;  3IFT A;  3FRP B;  3ULL A;  3H94 A;  4JI0 Q;  2NVQ H;  2Z4H A;  4KHV A;  4L5S A;  4R4C A;  1LTB D;  4BY7 H;  1BBU A;  1VMP A;  2Y0S G;  1H9S B;  2KCN A;  4NMZ A;  1I4P A;  1JWS D;  3BVG A;  3U9O A;  1E0B A;  3FDT A;  2I07 B;  3GTG B;  4DR3 L;  4DR4 L;  3I4N B;  2HDM A;  3HOX B;  3EN2 A;  3D4W A;  1V43 A;  3FHW A;  4LUO A;  4HJ9 A;  3NSW A;  1MIU A;  2D2C C;  3OWF A;  4DV3 L;  2LMC B;  3ND8 A;  2F0T A;  1TKW B;  4A3I G;  4HTH A;  1B8A A;  1BUV T;  1ILQ A;  1SJE D;  4I65 A;  3S1Q B;  3CC7 A;  2YU9 H;  5IYB H;  4J6H A;  4YCW A;  4ODG A;  1E7Z A;  1S72 A;  4HIM A;  2F0G A;  2B63 G;  3M7N A;  4KKU A;  3RLO A;  4B9X A;  1LT5 D;  3RN2 A;  4GKK Q;  1D5X C;  3S2D H;  1SFO B;  4BA1 I;  1HH2 P;  2AQ3 B;  2QW7 A;  5IWA L;  3UDI A;  1V9P A;  4A3M H;  3IKJ A;  4OO1 H;  2GN5 A;  3H15 A;  5HGQ A;  4ILW A;  4DV5 L;  5CV9 A;  4EQN A;  2ICE C;  3I4N G;  3HOX G;  3K7U C;  2B63 H;  4U67 3;  2K5Q A;  5GRO A;  1PTO F;  2H5X A;  1V1Q A;  3J80 E;  1IKM A;  2HUG A;  4A3E B;  1X3E A;  3WOE A;  1GHK A;  1S3O A;  2M9V A;  4JI6 Q;  2F0H A;  4X62 L;  1STY A;  2R7Z H;  3HOW H;  5LL6 S;  1QNK A;  2ALY B;  3PGZ A;  2IPK D;  3UDG A;  1SYD A;  1SLJ A;  4JOI C;  1ENF A;  2NVX B;  2B8G A;  1TWG B;  4HMI A;  1IBK Q;  1VQP A;  4ULL A;  3H91 A;  4A3L G;  2L5T A;  4CHT B;  4OX9 Q;  1LAC A;  1VQH A;  1EY8 A;  2ZTC A;  1Y1W H;  3TS2 A;  1EUJ A;  1R9T B;  4JV5 L;  3RNU A;  4ZUI A;  3AFQ A;  1QZG A;  3SK8 A;  4EVO A;  2L1B A;  1N33 Q;  1S5C D;  2SOB A;  5LMN W;  1L1O A;  3GTO H;  3CCV A;  4WJ4 A;  3BZK A;  4A3L H;  4OIK A;  1SNP A;  1VQ8 A;  1EY9 A;  4CBV A;  2K52 A;  4HJ5 A;  2NN6 H;  1WJJ A;  3HOV H;  1NY4 A;  1K28 A;  1HA5 A;  2IL8 A;  4R8I A;  5KNC A;  4JBK A;  3NP8 A;  3DXJ C;  2B8F A;  4B9W A;  2NZ1 D;  3IL8 A;  2B2T C;  2F0W A;  1F2L A;  2JA9 A;  1XPU A;  5ELF A;  5KND A;  3Q0A A;  3HRZ C;  2B3G A;  1N36 Q;  1B53 A;  1XYI A;  2UUA Q;  1CQV A;  4A3F H;  2DJF C;  2F0N A;  1VS0 A;  1LV9 A;  1JOO A;  2VXW A;  1Y1V G;  2MQH A;  2EYO A;  2CWA A;  3T1Y Q;  4ZCK A;  3HOZ H;  1E1T A;  4PZ8 A;  4DV2 L;  1ZYR C;  1BQQ T;  3JAM i;  4GLX A;  5F2D A;  3NTI A;  2Z0S A;  2R93 B;  5C4X B;  2A1A A;  1NR4 A;  2X6L A;  2A6E C;  3J81 E;  4HJ7 A;  1FGU A;  1HCZ A;  4O2D A;  1X3F A;  1CM9 A;  4IFD J;  1XNQ Q;  1Y1V H;  4YWM A;  2EYJ A;  4B3T Q;  2JEB I;  2GVB A;  3F1Z A;  1PZK D;  2K50 A;  3KDF B;  3GTM H;  2FXQ A;  3X3N A;  4X6A H;  1CA5 A;  3KFU A;  4ZKC B;  3NEM A;  4XT3 B;  2CWP A;  2Q2T A;  3M3Y H;  4DR6 Q;  1VQJ A;  5D65 A;  1N34 Q;  2EVB A;  1N32 L;  5FLX c;  4IJH A;  4ME3 A;  3GTJ H;  4YY3 L;  4K2L A;  2A6H D;  2B2V A;  3BDO A;  4JI5 L;  1QUQ A;  1MGS A;  5FK9 C;  5KYI A;  1O7Y A;  3T51 B;  4JI8 Q;  1SYG A;  3CRK C;  1LTG D;  3C1F A;  1JB3 A;  1CFM A;  1YHQ A;  4JI1 Q;  3RUZ A;  1YNN D;  1PH4 A;  1ICW A;  1A62 A;  2VQE L;  4AYB B;  2E2I H;  2Z9H A;  3DEO A;  3VYS A;  1BBX C;  1UE6 A;  1SNO A;  1G8Z D;  3LX0 A;  1K9M C;  4KMU C;  2WB1 E;  1WOC A;  3W1B A;  1QE6 A;  1I50 H;  1OO9 B;  3NTH A;  3NWS A;  1CSP A;  1X55 A;  2F0U A;  2CCZ A;  2ZM6 L;  1CKM A;  1B4O A;  5CV5 A;  4F8M A;  5IGD A;  1QJO A;  3J7A F;  4KK7 A;  1S4Z A;  4FDB A;  4K8I A;  1F2Y A;  1F9Q A;  3D4R A;  3HOU B;  1HZB A;  1Z7T A;  3KF6 A;  1UUP A;  2KQ3 A;  4FF4 A;  3RN5 A;  1HNW Q;  1Q90 A;  4LUZ A;  4AYB G;  1D5Z C;  1SND A;  1JC7 A;  2R92 B;  1HNZ L;  1VQB A;  1AN8 A;  3CCS A;  2Z6K C;  1LM0 A;  1OXT A;  2Q2U A;  1EQV A;  2DY8 A;  4OEL B;  3G6E A;  4UP9 A;  1VQG A;  1XNR L;  3I91 A;  4CDF C;  3P75 A;  4TRD A;  3S15 H;  2VUM H;  3M4Y A;  3JAM c;  1VQA A;  4IPC A;  3VR2 A;  2N88 A;  4UDU C;  5BN3 A;  1KXL A;  1WCM B;  4XYQ A;  5K36 H;  2K5H A;  1BR9 A;  3FVQ A;  2J7Z A;  2BH2 A;  1ASY A;  3S1M B;  3EVQ A;  1G51 A;  2F0V A;  1QUQ B;  1K83 H;  4FXD A;  3R93 A;  5LMU Q;  3R8B A;  3A55 A;  3UDF A;  4OWW B;  2JA7 B;  4XIG S;  3Q8D A;  1PRT D;  3KLS A;  1XMO L;  4DV0 L;  2CHB D;  5E3F A;  2R92 G;  5FO8 B;  2WKD A;  4JK1 C;  4EQP A;  1NJI C;  3TN2 A;  5HY6 A;  4L5Q A;  2A19 A;  2OEO A;  4K8J A;  4DR1 L;  1K3B C;  2IHF A;  3VR4 A;  2L9H A;  4XXE A;  4IUN A;  4LF8 L;  1H9R A;  2XNA C;  3DHQ A;  2SDF A;  4PNY A;  1XXG A;  2EJM A;  4ZKB B;  1X54 A;  3MHB A;  2LS0 1;  4GOP A;  1ESR A;  3GTK H;  1WCM G;  3S14 B;  2XWB B;  2K04 A;  5DNF A;  1EL0 A;  2DUD A;  1BF4 A;  2JA7 G;  2IX1 A;  3RZO B;  4N9P A;  1T9H A;  1EIF A;  4IFD G;  3HZX A;  2EYM A;  3KF6 B;  1FJG Q;  2PI2 A;  4OGQ C;  4RGN A;  2D62 A;  1STB A;  4G57 A;  4K0K Q;  3A7A B;  2JQO A;  4GS3 A;  2E2J H;  1AE2 A;  1Q7Y C;  5E7N A;  4NXM Q;  4OO1 I;  3E0E A;  4YHH L;  2RF4 A;  2UXB Q;  2OQ0 A;  1BKB A;  1TS4 A;  3E3X A;  3F8T A;  3PUW A;  4IFD H;  2CFM A;  5M9O A;  2VB3 X;  4TQU S;  1CA6 A;  2R7F A;  1NR2 A;  2B29 A;  4LMQ D;  1VQD A;  2K5D A;  1O7Z A;  2UXC Q;  4X65 Q;  2K03 A;  3L9A X;  2JYO A;  3PCO B;  1D1I A;  1AE3 A;  2F4V Q;  4PV1 C;  2EPB A;  1I6H B;  2RQX A;  1A0I A;  4LF5 Q;  4B3S Q;  3PUZ A;  3H3V H;  3AQQ A;  4K2K A;  4ID6 A;  2G5D A;  2C35 B;  2HQE A;  3MFY A;  5IYC H;  4JBJ A;  1GJX A;  2HCI A;  3RD4 A;  3M4O B;  2E2D C;  2MNA A;  4X64 Q;  1GUO A;  5JPN C;  1BVS A;  1J5E Q;  3HKZ E;  2RKS A;  4Q0F A;  5IGB A;  1E2V A;  3I4O A;  2QCP X;  1F9S A;  4G7H C;  3N6R A;  4GOP B;  3C46 A;  2H1E A;  1B7Y B;  4MZ9 A;  1EY0 A;  5COY A;  3K0X A;  1M90 C;  5AJ3 L;  5EKL A;  4GKJ Q;  4CKE A;  1TWH B;  2OTL A;  1JOQ A;  1KRS A;  4L5R C;  5ELO A;  3UI2 A;  1A6X A;  3SXH A;  4X66 L;  2F0J A;  2F0M A;  3TP6 A;  3STB C;  2N78 A;  3W5O A;  5IT9 c;  4N9T A;  1FGB D;  4IQZ A;  4DXF A;  4KKS A;  1B9M A;  3ZJY C;  5C3X A;  4A3J B;  1DM0 B;  1KLG D;  1STG A;  2NN6 I;  3FKI H;  1XJV A;  2JEA I;  1SYE A;  3S17 H;  3T4A C;  5DM7 3;  3SEB A;  1K8O A;  1LYL A;  5ELD A;  2LXK A;  2RSN A;  1K8A C;  1PH8 A;  1K8M A;  1L1O C;  3TRZ A;  3CCL A;  3CCM A;  1IW7 C;  1K3R A;  2EYL A;  3G7L A;  4K14 A;  1GOZ A;  5LMN Q;  1L0X B;  1C8C A;  5M3M H;  1HFG A;  3CAM A;  3CKI B;  1EZ8 A; 
#chains in the Genus database with same CATH homology
 1J9O A;  4DAP A;  4RKL A;  3I4M B;  1MSH A;  4V19 0;  1JQY D;  2KCC A;  1RDP D;  5EBD A;  4PQX A;  1SYF A;  2CW0 D;  1S5B D;  1VMC A;  3A7L A;  1LAB A;  3MTS A;  1ENA A;  5ELE A;  2RDG A;  4XQN A;  1KTK A;  1TT2 A;  1EU3 A;  2PQE A;  1HTP A;  3K5O A;  3LWU A;  4RAU C;  4KY6 A;  4NW2 A;  2O5J C;  1MD2 D;  2N55 A;  3TZD A;  2KJX A;  1QNU A;  2XWJ B;  2B2W A;  4O42 A;  2Q8R E;  3TBI B;  2O4X A;  1HFN A;  4X3K A;  2EY5 A;  2B2V C;  2SEB D;  4QIW B;  4M8A A;  2EY6 A;  3DWP A;  4JBW A;  4RKB A;  1Z6H A;  2Q8I B;  3SVM A;  3QIA A;  1PFN A;  3PO3 B;  1G2T A;  1I4H A;  4A3G B;  3TSS A;  5IGG A;  4RFB A;  1RD9 D;  4X3S A;  1JWU D;  5KGU A;  2E76 C;  1NCV A;  5I9P A;  4HCE A;  3A54 A;  3J7Y W;  4KN4 C;  3S1N B;  3GD7 A;  3I73 A;  1ZYR D;  3SK5 A;  1F9P A;  1DOM A;  5J1Z A;  1TWA B;  2TMP A;  2RVL A;  1OXU A;  1TQO A;  2A6E D;  1PZI D;  2J4X A;  2PCF B;  3OPO A;  3TZU A;  3VA5 A;  1KDA A;  2LFN A;  1XWE A;  3EFX D;  3GO5 A;  3QO2 A;  4NP5 A;  3BG3 A;  5C0X H;  2BE5 C;  1Y69 U;  4IAL A;  4L63 B;  3LWE A;  2OT2 A;  3T53 B;  3D31 A;  2WAC A;  2ZXR A;  5FLX L;  4BA2 I;  1O78 A;  2BCO A;  2WB1 B;  3OMC A;  4V0B A;  5ISR A;  3PUX A;  5E4X A;  1EYC A;  1HQR D;  1Y8N B;  4IN3 A;  5CV6 A;  4HCS A;  5KEE A;  2FIN B;  3NQT A;  1BCP B;  1H9M A;  2A73 B;  3D8G A;  4IUV A;  1FNU A;  2F1M A;  1LLR D;  2D5D A;  3X3M A;  2HCC A;  2EZV A;  5DAU A;  1ROD A;  1EWC A;  4IFD I;  5I4D A;  4C56 C;  2Z4I A;  3H09 A;  5CC4 A;  3KUP A;  1II3 A;  2RDF A;  3MC0 B;  5IOD A;  1ENC A;  5KYL A;  3JAM L;  2WP8 J;  1BDO A;  2CW0 C;  1SEB D;  3ERO A;  4MN3 A;  1IYU A;  4B08 A;  3IAY A;  2A69 C;  1I4Q A;  4DU9 A;  2MJ8 A;  1CI3 M;  1H9J A;  3IFD A;  1CT1 D;  1EEI D;  2F0K A;  1HQM C;  2PO4 A;  2F0S A;  4IUP A;  1U4P A;  4U68 A;  1F2M A;  5I2Y A;  1J8I A;  1PLF A;  1A3T A;  1AZQ A;  2JA6 B;  4GZY C;  3T56 B;  1VDZ A;  2H4O A;  1CZG A;  4HR7 B;  4IUR A;  2PNR C;  5CYU A;  4Y7N B;  1IKL A;  4C3H B;  3VYT A;  1LTI D;  1W6K A;  1WTO A;  2ENB A;  3C3L A;  1QG7 A;  4FF2 A;  2E75 C;  1EFI D;  5JEA J;  4BY1 B;  3VA7 A;  2K7V A;  4K5V A;  4C3I B;  1PTO B;  3BDL A;  3K5L A;  1X3Q A;  1BNZ A;  1KNE A;  5KNB A;  4RH6 A;  1V8Q A;  2EOT A;  2RBM A;  2X69 A;  1SJH D;  4C3H G;  1GUN A;  2IW3 A;  1X3P A;  5IGC A;  2F0F A;  2JSO A;  1WTR A;  1LO5 D;  1RTN A;  1ZEQ X;  3RZD B;  1D5M C;  1ET9 A;  4EGV A;  1CZW A;  3DMU A;  1STE A;  1PDQ A;  4C3I G;  2DNE A;  1PRT F;  3I8Z A;  2K28 A;  1LTR D;  5EPJ A;  1EZ6 A;  5IT9 L;  1WVL A;  2L4N A;  1D1K A;  4CKB A;  1VF5 C;  3QOL A;  2MP1 A;  3S1R B;  3GV6 A;  2A74 C;  3MEH A;  1DYQ A;  2B2W C;  2F3V A;  3R2T A;  1TVX A;  2AUJ D;  3DWA A;  1IW7 D;  2K32 A;  1MBY A;  3Q6S A;  2EYH A;  5FLX E;  5J22 A;  5A2Q E;  3GTP B;  1RKN A;  1B44 D;  3GTQ B;  5A35 A;  2NTS A;  5J39 A;  2E2H B;  1TY0 A;  2K05 A;  5FO9 B;  4DN4 M;  1BCP C;  2KHS A;  2DN8 A;  3CQZ B;  4C1N I;  2JE6 I;  1IHZ A;  5JJZ A;  1ILP A;  1PMR A;  1AP0 A;  1TWF B;  5C3E B;  3PIO 3;  4KJN A;  2L0C A;  1D6E C;  1TS2 A;  5C0X I;  1S5D D;  2K01 A;  4BWG B;  3Q23 A;  1PFM A;  3L7Z C;  2AQ1 B;  1GUT A;  4MHE A;  2G9H D;  3P1H A;  3FEW X;  2E74 C;  5CBA E;  2OXP A;  3HP3 A;  1SYB A;  3K0Y A;  1HRJ A;  1EIG A;  5COR A;  3D3R A;  3D4D A;  3QJY A;  4QUC A;  3SHL A;  2NBF A;  3E5S A;  1DZ1 A;  1HA6 A;  2G9D A;  1IYV A;  5JEA G;  2F0I A;  4FXG C;  2B2Y A;  2FMC A;  2PW5 A;  4LK1 C;  1OXX K;  1E2W A;  3K5M A;  3I90 A;  3PIP 3;  3CU7 A;  3TP8 A;  3MXU A;  4A3D B;  5C44 B;  3NWT A;  1EYA A;  4IUQ A;  5AFW A;  4CGY B;  1EY7 A;  4H7B A;  2O2L D;  2OF1 A;  1FNW A;  3H6M A;  3S9W A;  3O13 A;  3BYY B;  4A93 B;  1U4R A;  2XSC A;  1G2S A;  2ZT9 C;  4YIJ A;  3MXN A;  2ZXO A;  3AB9 A;  2F0D A;  2RSO A;  2JA5 B;  1B1Z A;  4X3T A;  2SNM A;  2MGS A;  2NVT B;  3DUZ A;  2BE5 D;  2J0T D;  4A3K B;  3KF8 A;  1KLU D;  2A68 C;  5EKI A;  2NVY B;  1H9K A;  1CK1 A;  2HDL A;  3PUV A;  1RHP A;  1LTT D;  4Z9C B;  1EYD A;  3HOY B;  1F9R A;  3NUC A;  2IX0 A;  2M00 A;  1G6Z A;  3D6W A;  2M2L A;  3VYR A;  2MHV A;  1PTO C;  3ND9 A;  2F0P A;  2PZU A;  1SNC A;  3I72 A;  4EQO A;  4DNR B;  5CV7 A;  1FD7 D;  3TP7 A;  4DK0 A;  4ZK9 B;  1AW7 A;  1CQF A;  4BS9 A;  4C2M B;  3GQB A;  2JP1 A;  3RMH A;  1SBB B;  1KDC A;  4TSS A;  1QCB D;  4RGO S;  1EEF D;  2JXM B;  3NTK A;  5C6A A;  4ZUJ A;  1SNM A;  1NUC A;  4OIJ A;  4C3J B;  4E6I A;  5ELB A;  1HUN A;  1GHJ A;  3QWN A;  4IUU A;  4DNT B;  2EYF A;  5IT9 E;  4RWS C;  2XVS A;  4S3S A;  1QWY A;  4R9W A;  5M3F B;  3J80 L;  3R2I A;  2KA7 A;  4XT1 B;  3A56 A;  3WOF A;  4UAI A;  2BA1 A;  2QIL A;  1EWH A;  1ET6 A;  4C3J G;  2AQ2 B;  2A69 D;  1DCZ A;  5C4J B;  5C5M A;  4L8J A;  5I2X A;  2V4D A;  1T5E A;  5IIF A;  3FPU B;  3MWY W;  4J1M A;  4A3B B;  4WOR A;  1JOK A;  3P7J A;  1EQT A;  1E2Z A;  2SNS A;  3K7A B;  2NWG A;  4FVM A;  1YNJ C;  3TME A;  2WII B;  1DD2 A;  4RCN A;  1U4M A;  3NBI A;  1O80 A;  3VR6 A;  2EXZ A;  2ZXP A;  2IWH A;  1WTV A;  4BBR B;  1XTC D;  1SDF A;  4QUF A;  4H13 C;  4K5W A;  4DXG A;  3NQI A;  4F87 A;  4Q5V A;  2LKV A;  5JAV A;  4ZAI A;  5T1G A;  5E1F A;  1R4P B;  2EE1 A;  1RJT A;  3U9S A;  4L6T B;  4NDX A;  5JVH 3;  1HHV A;  1C48 A;  1A3U A;  1EY5 A;  2MPM A;  3J81 L;  1SXT A;  5M5Y B;  1JE4 A;  2F0O A;  3OHX C;  1MI2 A;  2I46 A;  3OW7 A;  4PMB A;  2A5H A;  1KAA A;  1EY4 A;  2NVQ B;  2XRQ D;  5NUC A;  1PZJ D;  3D6C A;  4KY7 A;  3DEP A;  3KBG A;  4BY7 B;  3WDN A;  1KNA A;  1MSG A;  4H0L C;  2F4I A;  4KKT A;  1AEX A;  1W6J A;  1X32 A;  1T5X D;  4DF7 A;  1JOR A;  4XDX A;  2EJF C;  5LL6 X;  5LHY 1;  5ELC A;  4WRD A;  2R61 A;  3TP5 A;  1A3V A;  2YU9 B;  3NK9 A;  3Q24 A;  4QMG A;  2KOL A;  3DM1 A;  3E6Z X;  3S2D B;  2BDO A;  3GV3 A;  1A15 A;  4A3M B;  1TS3 A;  2F03 A;  2YYZ A;  2KVM A;  1FYC A;  1SMY C;  1V1O A;  2L55 A;  3EQL C;  3CHB D;  1Q8I A;  4OHJ A;  1GUG A;  3W2D A;  2B63 B;  1Z47 A;  2B2Y C;  3OSO A;  3F2U A;  4G4K A;  4HAE A;  1BCP D;  3E0J A;  1OXS C;  2NYZ D;  2R7Z B;  3HOW B;  4KHZ A;  3PUY A;  4OO1 G;  3C1E A;  4CJ0 B;  3A8K E;  1Y1W B;  4IZ8 A;  2XN9 C;  1O7L A;  1M8A A;  5KIX A;  1TII D;  5JPM C;  4FP5 D;  4OL7 A;  3GTO B;  3SK4 A;  2F0E A;  4RA8 A;  1HXY D;  4DAV A;  1TR5 A;  3T13 A;  4IUT A;  4RCO A;  3HOV B;  4HED A;  3OMG A;  2LY7 A;  1V1P A;  5C4Z A;  3HG9 A;  3SK6 A;  3A8J E;  2BA0 A;  3MZ5 A;  4PMW A;  4C1N K;  3NXW A;  1NSN S;  4XQJ A;  4J8Q A;  2PZW A;  4ZYS A;  3J7A V;  5EJW A;  4A3F B;  2L11 A;  3OWE B;  2PPB C;  3HOZ B;  1CHQ D;  2F3W A;  1U4L A;  2NN6 G;  3EA6 A;  2KED A;  2AWO A;  4RGT A;  2ID0 A;  1JIC A;  1SNQ A;  1Y1V B;  1LT6 D;  1WTQ A;  5EKK A;  2FFK B;  3A8I E;  3N52 A;  3GTM B;  3MA2 B;  3TDQ A;  3PV0 A;  1A2T A;  1GUS A;  2CQA A;  3KK7 A;  3HGB A;  3HKZ B;  3Q22 A;  3I3C A;  3M3Y B;  5IGE A;  5D3D A;  1JCK B;  1L0Y B;  2IJ0 A;  5EQ0 A;  4XTC S;  3GTJ B;  3FPP A;  2A68 D;  1RTO A;  5T1I A;  1ML0 D;  5DEH A;  1I6V C;  2EDG A;  4KY5 A;  5C5L A;  5FO7 B;  2FHT A;  1V1P B;  2EYP A;  2RDH A;  5FOB B;  3VYU A;  2E2I B;  2D9U A;  2KUM A;  1Q12 A;  1HTL D;  1PTO D;  1STH A;  2K33 A;  1EOT A;  5CBE E;  1VF7 A;  1JWM D;  1CTM A;  1JR0 D;  2PYK A;  1STN A;  5D3I B;  3ITP A;  1I50 B;  1WTX A;  4WFN 3;  1S5F D;  1RF2 D;  3R3O A;  1AZP A;  4ZRZ A;  2KEC A;  2WV6 D;  1SE4 A;  1PTO H;  1EY6 A;  4M1U B;  4RHR A;  2FMM A;  1STA A;  1AFP A;  1B2T A;  4TKO B;  1F2Z A;  4KN7 C;  4CJ1 B;  3S15 B;  2VUM B;  2B2U A;  3T16 A;  4P2C B;  1I4R A;  3M7G A;  5K5P A;  4HSV A;  1K83 B;  1SYC A;  1UEA B;  5FKA C;  3I70 A;  1TS5 A;  5I9O A;  1R4Q B;  2BDN A;  2F0L A;  1BOS A;  3K59 A;  1Q1B A;  4O1N A;  1WD0 A;  2PW7 A;  1VCI A;  2DNC A;  3L3O C;  1LT4 D;  4QB4 A;  3GTK B;  1BXT A;  3URY A;  4FNF A;  5K36 G;  3VR3 A;  1XX8 A;  3HS0 C;  3KBX A;  3PMF A;  1WD1 A;  4LAA A;  4DK1 A;  3QB3 A;  1YNJ D;  1PRT B;  4FYD A;  5D14 A;  5BN4 A;  2C9O A;  5EPK A;  2E2J B;  2WAQ B;  5I6Y A;  1SSO A;  4RHS A;  3JAM E;  1TY2 A;  1EU4 A;  3K58 A;  1B9N A;  1ESF A;  2AWN A;  5EBC A;  2EJG C;  4ZQ3 A;  1QOH A;  3K6O A;  4DFA A;  4HN7 A;  1TU2 B;  1Y8P B;  3MAQ A;  4XYO A;  1PXU A;  5CMD A;  3AU7 A;  3DWQ A;  3QG1 A;  5JEA H;  5JVG 3;  3MVV A;  3V05 A;  1ZXT A;  2MUY A;  4CKC A;  1M4V A;  4ME5 A;  4ZLT F;  2PZT A;  5C4H A;  3SR1 A;  4R8N A;  3BVM A;  4G7O C;  2TSS A;  3RLF A;  4DAY A;  5CR3 A;  1QB5 D;  2F0Q A;  1PFB A;  1HPC A;  5CV4 A;  4FXK C;  4H44 C;  3SDZ A;  2L12 A;  1C4Q A;  2CVR A;  1I4X A;  4KJO A;  3C2P A;  1DXM A;  3FKI B;  3K57 A;  1KDB A;  3S17 B;  3W3A A;  3GP7 A;  4DGZ A;  4KV6 A;  1OXV A;  1G91 A;  2B39 A;  1IL8 A;  1WTW A;  3BYT B;  3OOC A;  1EIH A;  3KLR A;  5M3M B;  2KEE A;  4XQQ A;  2WIN B;  1SMY D;  1Q1E A;  1SE3 A;  2AUK A;  4QF4 A;  4KD4 A;  3PO2 B;  5C0X J;  2EY1 A;  3BS1 A;  3S16 B;  2IT1 A;  2Z8L A;  3HEJ A;  1NAP A;  3I4L A;  2WKC A;  3GTL B;  2A6H C;  4BBS B;  1FR3 A;  3G6J B;  5KRU A;  3NBH A;  3FMC A;  1DOK A;  3NHH A;  2RA4 A;  4DA2 A;  1D2B A;  2B2T A;  3VR5 A;  4RGM A;  1YNN C;  4KI0 A;  2FJ2 A;  4K5X A;  3NE5 B;  2QDB A;  2X6G A;  1KAB A;  2VNU D;  1I4G A;  4K6L A;  4F7X A;  4NKL A;  1GUW A;  3OIP A;  3ONA B;  1DON A;  2NTT A;  1B3A A;  1FNV A;  4X3U A;  1I3Q B;  4HSP A;  1DJR D;  1LTA D;  4FF1 A;  2QKI C;  5EPL A;  5TSS A;  4G7Z C;  4MIU A;  3ERQ A;  2O5I C;  3QOJ A;  1G29 1;  5G3L F;  3MFG A;  4ABN A;  2GA4 B;  2NB0 A;  1LTS D;  3BZD B;  1UAP A;  4FO2 A;  4HMJ A;  1UNS A;  5C3W A;  2Z1C A;  1ZKO A;  4K6D A;  3H0G B;  3EJI A;  2BOS A;  2R6G A;  1PRT C;  5HUR A;  1WTP A;  1RCV D;  5E4W C;  2DY7 A;  3NPP A;  5IOC A;  2C5C A;  2PMZ B;  1A2U A;  5EGT A;  1BCP F;  1LT3 D;  3K5N A;  1HUM A;  1SAP A;  5BN5 A;  4F88 A;  2B2U C;  5I6W A;  1Q3L A;  2NUC A;  1H9S A;  2VB2 X;  4KD3 A;  3KLS X;  2XRS D;  1SE2 A;  2K6A A;  2XIW A;  2QF7 A;  2JA8 B;  5DM6 3;  5CV8 A;  3H3V C;  4LJZ C;  3OIQ A;  2K1B A;  1Y8O B;  3S2H B;  5CGK A;  2IX3 A;  5C0X G;  1GXD C;  2R3Z A;  4PMC A;  3BDC A;  5IGF A;  5G3L D;  4WJW A;  1CHP D;  3M85 A;  5M5W B;  2K5W A;  1DOL A;  1PYW D;  2ICI A;  5M5X B;  2Y0S B;  1QIL A;  1F77 A;  3V96 A;  3BVZ A;  4KTA A;  1B50 A;  3SE0 A;  3LNN A;  4FF3 A;  2QEJ C;  5JOB A;  1TWC B;  3CRL C;  1U9R A;  3MXP A;  5A2Q L;  3P20 A;  3V2T A;  5HGT A;  1BO0 A;  4A3I B;  1ONL A;  3MXG A;  2EY2 A;  3ZYY X;  1S5E D;  3AMU A;  4CJ2 C;  4I7Z C;  2Q8T A;  4QCL A;  3IFT A;  3FRP B;  3H94 A;  2Z4H A;  4KHV A;  1LTB D;  1VMP A;  1H9S B;  2KCN A;  4NMZ A;  1I4P A;  1JWS D;  3BVG A;  3U9O A;  1E0B A;  3FDT A;  2I07 B;  3GTG B;  3I4N B;  2HDM A;  3HOX B;  3D4W A;  1V43 A;  3NSW A;  2D2C C;  3OWF A;  2LMC B;  3ND8 A;  2F0T A;  1TKW B;  4HTH A;  1BUV T;  1ILQ A;  1SJE D;  4I65 A;  3S1Q B;  4J6H A;  4ODG A;  2F0G A;  3M7N A;  4KKU A;  4B9X A;  1LT5 D;  1D5X C;  1SFO B;  4BA1 I;  2AQ3 B;  3IKJ A;  4OO1 H;  4ILW A;  5CV9 A;  4EQN A;  2ICE C;  4U67 3;  2K5Q A;  1PTO F;  3J80 E;  1IKM A;  2HUG A;  4A3E B;  3WOE A;  1GHK A;  2M9V A;  2F0H A;  1STY A;  5LL6 S;  1QNK A;  2IPK D;  1SYD A;  1ENF A;  2NVX B;  2B8G A;  1TWG B;  4HMI A;  4ULL A;  3H91 A;  2L5T A;  4CHT B;  1LAC A;  1EY8 A;  1R9T B;  4ZUI A;  3SK8 A;  4EVO A;  2L1B A;  1S5C D;  2SOB A;  4OIK A;  1SNP A;  1EY9 A;  4CBV A;  2NN6 H;  1HA5 A;  2IL8 A;  4R8I A;  5KNC A;  3NP8 A;  3DXJ C;  2B8F A;  4B9W A;  2NZ1 D;  3IL8 A;  2B2T C;  2F0W A;  1F2L A;  5ELF A;  5KND A;  3Q0A A;  3HRZ C;  1B53 A;  1XYI A;  1CQV A;  2F0N A;  1LV9 A;  1JOO A;  2VXW A;  2EYO A;  1ZYR C;  1BQQ T;  5F2D A;  3NTI A;  2R93 B;  5C4X B;  1NR4 A;  2X6L A;  2A6E C;  3J81 E;  1HCZ A;  1CM9 A;  4IFD J;  2EYJ A;  2JEB I;  1PZK D;  3X3N A;  1CA5 A;  4ZKC B;  4XT3 B;  5D65 A;  2EVB A;  4K2L A;  2A6H D;  2B2V A;  3BDO A;  1MGS A;  5FK9 C;  5KYI A;  1O7Y A;  3T51 B;  1SYG A;  3CRK C;  1LTG D;  3C1F A;  1JB3 A;  1CFM A;  3RUZ A;  1YNN D;  1ICW A;  4AYB B;  3DEO A;  3VYS A;  1BBX C;  1SNO A;  1G8Z D;  3LX0 A;  4KMU C;  1QE6 A;  1OO9 B;  3NTH A;  3NWS A;  2F0U A;  1B4O A;  5CV5 A;  4F8M A;  5IGD A;  1QJO A;  3J7A F;  4KK7 A;  1S4Z A;  4K8I A;  1F2Y A;  1F9Q A;  3D4R A;  3HOU B;  1Z7T A;  1UUP A;  2KQ3 A;  4FF4 A;  1Q90 A;  1D5Z C;  1SND A;  1JC7 A;  2R92 B;  1AN8 A;  1OXT A;  1EQV A;  2DY8 A;  3I91 A;  3P75 A;  4TRD A;  3M4Y A;  3VR2 A;  2N88 A;  4UDU C;  5BN3 A;  1WCM B;  4XYQ A;  5K36 H;  1BR9 A;  3FVQ A;  2J7Z A;  3S1M B;  3EVQ A;  2F0V A;  4FXD A;  3R93 A;  3R8B A;  3A55 A;  2JA7 B;  4XIG S;  1PRT D;  3KLS A;  2CHB D;  5E3F A;  5FO8 B;  2WKD A;  4JK1 C;  4EQP A;  3TN2 A;  4K8J A;  2OEO A;  3VR4 A;  2L9H A;  4XXE A;  4IUN A;  1H9R A;  2XNA C;  3DHQ A;  2SDF A;  4PNY A;  1XXG A;  2EJM A;  4ZKB B;  3MHB A;  2LS0 1;  1ESR A;  3S14 B;  2XWB B;  2K04 A;  5DNF A;  1EL0 A;  1BF4 A;  2IX1 A;  3RZO B;  4N9P A;  4IFD G;  3HZX A;  2EYM A;  4RGN A;  4OGQ C;  2D62 A;  1STB A;  4G57 A;  3A7A B;  4OO1 I;  1TS4 A;  3PUW A;  4IFD H;  5M9O A;  2VB3 X;  4TQU S;  1CA6 A;  1NR2 A;  4LMQ D;  2K5D A;  1O7Z A;  2K03 A;  3L9A X;  2JYO A;  1D1I A;  4PV1 C;  2EPB A;  1I6H B;  2RQX A;  3PUZ A;  4K2K A;  4ID6 A;  2HQE A;  3MFY A;  1GJX A;  2HCI A;  3RD4 A;  3M4O B;  2E2D C;  1GUO A;  5JPN C;  2RKS A;  4Q0F A;  5IGB A;  1E2V A;  2QCP X;  1F9S A;  4G7H C;  3N6R A;  3C46 A;  2H1E A;  1EY0 A;  5COY A;  5EKL A;  4CKE A;  1TWH B;  1JOQ A;  3UI2 A;  1A6X A;  3SXH A;  2F0J A;  2F0M A;  3TP6 A;  4N9T A;  1FGB D;  4IQZ A;  4DXF A;  4KKS A;  1B9M A;  5C3X A;  4A3J B;  1DM0 B;  1KLG D;  1STG A;  2NN6 I;  2JEA I;  1SYE A;  3T4A C;  5DM7 3;  3SEB A;  1K8O A;  5ELD A;  2RSN A;  1K8M A;  1IW7 C;  2EYL A;  3G7L A;  4K14 A;  1GOZ A;  1L0X B;  1C8C A;  1HFG A;  3CKI B;  1EZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...