2UU9Q

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uu9Q00
1ASYA 3KF6A 2NVTH 3CCSA 4ALPA 4JI4L 2Q2TA 4DR1L 4GNXA 4NXNQ 4A3IG 3I4NG 2MNAA 3OW2A 1X3GA 1HNZL 2ATWA 1C0AA 4A3CH 2KCTA 1KRTA 2R7DA 3PIOA 4JV5L 1FVIA 2UUBQ 1TWAH 1NJIC 4JI2L 3KF8B 1X55A 1PH7A 2B63H 3PSIA 3RR5A 4A3BH 3F8TA 4DUYL 3RNUA 3PGZA 2UU9Q 3GTPH 4BY7G 4IFDJ 3G71A 5IP9H 4DV4Q 3ICEA 1VS0A 3W1BA 5C44G 4LF6Q 4IFDG 1RL2A 3RN5A 5C4XG 1PYSB 4PG3A 4DK3C 4OXPA 5IP7H 2YU9H 5M3MH 5LMNW 2UXCQ 1Q82C 2IHFA 3HOYH 3ULPA 3G48A 1IXRA 2K52A 3M9BA 4BY1G 3UE1A 1HH2P 3BZCA 3UDIA 4X66Q 3F2BA 1VQ4A 2ASBA 3GTGH 1YZ6A 5GQOA 5IYDG 4DV6Q 4IOCA 1KRSA 4DUZQ 1GD7A 1N8RC 3JC66 1PHJA 5IP9G 1ASZA 1XPRA 2ES2A 1N34Q 3CC4A 1N32Q 1IZ6A 1VQHA 1QVFA 4JYAQ 4DV3L 4K0KQ 1NMFA 2NZHA 1YI2A 1AE3A 4OWWB 5IWAQ 5IYBG 1XNQQ 2AWOA 2ZJRA 3E9IA 4JCVE 2R7FA 5IT9c 4BY1H 1SROA 4IOAA 2L15A 3OYYA 4JI8L 3HOXG 4GOPC 1HNXL 2ZM6L 4DR5Q 1FJGL 2NN6G 3GTMH 2F4VQ 1L1OA 5JEAJ 1VQLA 4KLKA 1X3EA 5LMNL 5FLMG 4JI3Q 1WFQA 4GN4B 1WCMH 3AEVA 1N9WA 1K3RA 3UDXA 1PH2A 2NVQH 2R92H 1Q7YC 4DV2L 2B29A 1IBKQ 2PI2A 3PUWA 4DV7Q 5IWAL 3HOUG 2A19A 3FHWA 3J81c 2I5LX 4DV5Q 3T1HL 1TWGH 1WYDA 3JAMc 1LYLA 1B8AA 1XPOA 3T1YL 4KHPQ 4A3MG 3S24A 5ELOA 1VQJA 2VL6A 3OTOL 1VQ7A 4LFCQ 1MJCA 2UXDL 4QL5A 2Z6KA 1A62A 1XNRL 4JBJA 4AQYL 1KAWA 4B3RQ 1YVCA 5C0XI 1G51A 1GKHA 1I94L 4JI1Q 1I3QH 4X66L 4P71A 1EQQA 4LW1A 1L1OC 2R93H 2JK8A 2ZJPA 1E7ZA 3AFQA 4KHZA 4UP7A 4J15A 3JAMi 3M4OH 1U0LA 4DV1L 4DK6C 2I5MX 3CCVA 4YWLA 1KC8C 4WJ3M 4X64L 5DLQE 2DUDA 2VUMH 4A3MH 3I4MH 4JI8Q 2K75A 3A0JA 1VQ6A 3RN2A 1R9TH 2K5VA 2UU9L 3A74A 2Y0SG 3L7ZC 2NVXH 5JJLA 1Y14B 1KIXA 2VQFQ 1OXVA 1OTCA 2OTLA 4AH6A 5IE8A 4PZ6A 1IYJB 1CKMA 2A1AA 1Q8KA 2MQHA 4JV5Q 2CWPA 2IY5B 1Y1WG 3BJUA 3HKZE 4GN3B 5FJ8H 4QY7A 2HHHL 2BH2A 3F2DA 5HY6A 4OO1I 3HKZG 1D8LA 1P16A 2VQEQ 4BBRH 4EX5A 5K36G 4NB3A 2R7ZH 4TQUS 5C4JH 1IBLL 4A3EH 3S2HH 4NXMQ 3NELA 1BBUA 4JBWA 2PNHA 4JG2A 5J3BA 5IY0A 4OO1G 3ER0A 4LFAL 2VNUD 1C9OA 1HZCA 2WAQE 3S1MH 2WFWA 1XMQL 2XTIA 3CCEA 3CCUA 1N36L 1Y1VH 4C3JH 1KL9A 1YEZA 4LF7L 5H1SE 3L2PA 4DV4L 2F52A 4P75A 4A3DG 4WJ4A 1EUJA 1VQDA 4A3LG 1VQ8A 1I94Q 1J5EL 1TWCH 4GN5A 4APVA 1AE2A 1VQAA 4IPGA 2IHEA 3J80c 1XJVA 4R4OA 2ZTCA 5C0XG 1L2FA 2UUAQ 2UUBL 4GLAC 4A3FG 4R1JA 5GAEC 1V43A 1YITA 1VQIA 1QUQA 4A3IH 3PUXA 3HKSA 4IJLA 2QEXA 1Q12A 4DV0L 1Y1VG 5M5YH 2UUCQ 1Q1BA 2H5XA 3PO3G 4A75A 2OTJA 1X54A 2HIVA 4AYBG 3TRZA 3CD6A 5EAYA 3S17H 1LTLA 1EIFA 1PH1A 2JA5G 2DGYA 1VQNA 1VQFA 2I0QA 3G4SA 4LUVA 1JMCA 5LMNQ 1EFWA 1L1OB 4GKKL 2Q2UA 1WOCA 3TQYA 4QJFA 5GAGC 1K9MC 4LF4L 4A3CG 2IX1A 4X6AH 1HR0L 1I5FA 2JJQA 2K14A 4BA1I 4JI7L 5M3MG 1W2BA 3ZJYC 3S1NH 2NN6I 3GTLH 4A3JG 4JC0A 3U50C 1UE6A 1N32L 5LMUL 4POGA 4R4QA 3UDFA 4L5SA 1XTDA 3HOUH 3BZKA 1YHBA 4Y7NH 1HZBA 4A3KH 2YV5A 1CUKA 4HIKA 4DR6L 4C3IH 2CCZA 2JA8G 5AJ3Q 3CXCA 3K7AH 1UE7A 1YBYA 4IJHA 1UWVA 4R4TA 1HZAA 3H0GH 5M3FH 3GTOH 4LF5Q 3H3VI 1NMGA 1XMOQ 1YNXA 4JI6Q 3E9HA 4HJ8A 4A93H 2JA9A 1X65A 4UY8C 2FXQA 4DAYB 1QUQB 4HJAA 2JA7G 4RMFA 2N3SA 1KQSA 2KHIA 3DLLA 2QGQA 4GLXA 4B3ML 2C35B 2CFMA 3PV0A 4JI5L 4EQ5A 1YHAA 1YHQA 4DV1Q 2B63G 2HQLA 4A3FH 1M1KC 1WCMG 3RZOH 5JJKA 2D0OA 3TEHB 1SN8A 4R4IA 2JEAI 1YJ9A 4JI0L 3G6EA 5C44H 1HNZQ 1EQRA 2R6GA 3K0XA 1JB7A 4JBMA 1N33L 2KBNA 4AQYQ 3CCQA 3D31A 4A4IA 2K5HA 1VQEA 1E1OA 2ALYB 1A0IA 3M85A 4A3GH 1HNWL 1CKNB 4C2MH 4JI4Q 1YIJA 1GM5A 4KHPL 2RHSB 4X65L 3W5OA 4MTNA 3GTQH 3KLWA 1YJNA 2K50A 2JQOA 3PCOB 3PIPA 3CC7A 1VQ5A 1XMOL 1EIYB 3AYHB 1EOVA 4DV7L 2R7ZG 2CWAA 4AYBE 5HGQA 4JBKA 1B70B 3AFPA 5IYCH 4OX9L 1A63A 2LXKA 4BXXG 2NZOA 4QIWE 2KCMA 4IPDA 4HIMA 1PH4A 2AWNA 4GNXB 3HOVG 2VS1A 3A5ZB 4TVAB 4JI3L 3CCJA 5FLXc 1K8AC 5JJIA 2MO1A 1KHIA 4O2DA 1X56A 5LMUQ 1E3PA 1BKBA 4YCWA 1XNQL 1DGSA 3W1GA 3EIVA 4B3SL 4P72A 4K0KL 3CAMA 1K0RA 4YY3Q 3F1ZA 4JYAL 3CF5A 5ELNA 4YWKA 1HR0Q 1N34L 2EIFA 3MXNB 4LUZA 3K8AA 2JA6G 1RIPA 4HIOA 2JE6I 4UPAA 4DR4Q 4OWXB 1UEBA 3E0EA 1Q86C 4B3RL 2GN5A 4DR2L 4DV6L 3L0OA 4DR4L 3KOJA 4YHHL 1HZ9A 1JJGA 2D62A 4JOIA 4UP9A 1VQGA 1PA6A 4PZ7A 4LF8L 1D7QA 2Y0SE 5C3EG 3H15A 3KDFB 3CP0A 1N33Q 5IYDH 4DV0Q 1J6QA 2N8NA 2PQAB 1CKNA 4DV2Q 2UUCL 4A3DH 2R92G 2HIXA 2E8GA 1XPUA 2R93G 1NTGA 2NVYH 3CW2C 1Q81C 3NBHB 4L5QA 4A3GG 3NEMA 3I4MG 2GVBA 1OXTA 4OX9Q 1PH3A 4IFDI 3J81j 4LF7Q 3WWVA 2WAQG 1GO3E 4HIDA 1VQCA 1WI5A 1PH5A 3I2ZA 4LWCA 1QVGA 4B3TL 1EWIA 1W3SA 2YTVA 4NXNL 2E5LQ 2BA1A 4DR1Q 3KF6B 4LFAQ 1IBMQ 3S1QH 4DR3L 1I50H 4PZ8A 1S3OA 4GLVB 5AJ3L 4DR6Q 4DUZL 3HFZB 4GKJL 3K7UC 3PUZA 3I55A 2VQEL 1P8LA 2BH8A 2D0PA 3F2CA 3PF5A 2OWOA 3GTKH 2Q2IA 2HT1A 3EN2A 1Q1EA 3CPFA 4FDBA 2QA4A 2UXCL 4PMWA 4IPHA 4X62L 3S16H 4B3TQ 4JI5Q 1MKHA 4RG1A 3BU2A 1K73C 1PH6A 2E2HH 1VQMA 1PYBA 3M7NA 1LM0A 1YJWA 2JA6H 4DR7L 3RLNA 2OQKA 1E1TA 4LNQA 2UXBL 3HOZH 3STBC 2LSSA 1BBWA 2VUMG 3FP9A 1UE1A 2ZTDA 1E24A 3ULJA 2YTYA 2WP8J 2OQ0A 3KJPA 4LF9L 4XTCS 4GOPB 2KHJA 1SFOH 4DPGA 4QQBX 3FKIG 2N49A 5M5WH 1E22A 1CSQA 4O0AA 4NPSA 1Z9FA 3CCMA 2K4KA 5GROA 3OTOQ 1JJ2A 4A3LH 5IYCG 3T1YQ 1UE5A 4BXXH 2RHQB 1O7IA 3KYHC 4P73A 1BVSA 4BY7H 3M3YH 2WB1E 1G291 2AHOB 3D0FA 4L5TA 2MO0A 3U4ZA 4BBRG 3HOWG 1JE5A 1IBKL 2VW9A 3SGIA 1X9NA 2GVAA 5C4XH 1GVPA 4GKKQ 4QGUA 5IP7G 1OXXK 2A8VA 1WJJA 5BR8Q 1IBLQ 3MEFA 3TREA 1QZHA 3B6YA 1N36Q 2WB1G 3HOYG 4B3SQ 2IX0A 2XGTA 1FL0A 4IPCA 2JA5H 4A3BG 3S14H 1M90C 3Q8DA 4YCVA 5FJ8G 4BBSG 1S40A 4NXML 1SLJA 1SR3A 3KJOA 2CQOA 3M4QA 3NENA 4YCUA 4A3KG 3GTJH 4LUOA 1NBWA 2LXJA 4GS3A 4A76A 3CCLA 1PVOA 1LUZA 4DV3Q 2JEBI 4H02A 4A3EG 3S1RH 2E2IH 1AH9A 2HHHQ 2Z0SA 1IL2A 3VDYA 3HOVH 4HJ7A 2OCEA 4YHHQ 1X3FA 3I7FA 3KDFA 5C3EH 1CKOA 4DAMA 2UUAL 2CKZB 3RLOA 1VQ9A 4YWMA 1HR0W 2VQFL 1KD1C 4X65Q 3HOXH 4DR7Q 1PFSA 1KXLA 4Y52H 3UDGA 3U4VA 1VQKA 4GOPA 4LFBQ 1HNWQ 2ZTEA 3AQQA 3LGJA 3K80C 4BA2I 1QZGA 1C7YA 1L0WA 2Q2HA 3CMEA 5JEAG 2ZJQA 4JI0Q 2MFIA 3H0GG 5M3FG 2IT1A 4JI1L 3U58A 2E2JH 3S15H 1T9HA 2KENA 3CQZH 2F3IA 3CC2A 3PO3H 4GKJQ 1PV4A 4JI2Q 1FGUA 1SMXA 3J81i 3TS2A 2K5NA 4HJ5A 2PI2E 4POFA 4OONA 1NE3A 4LFCL 4DR3Q 4P74A 2RCNA 1K8GA 1IBML 5GADC 2V1CC 2E5LL 3T1HQ 1G6PA 4JI6L 1TWHH 3KFUA 1SRUA 1Z47A 1K83H 4IO9A 4LF5L 3GD7A 1PH8A 1U5KA 2I5HA 3GDEA 4DNIA 3J7A5 2Z6KC 4X64Q 1VCIA 4JOIC 3PO2G 1TXYA 2RF4A 1Q46A 3UE0A 5BR8L 5IYBH 2ID0A 1QVCA 3J7ZC 2B3GA 2EQSA 1VQOA 1JJCB 4XIGS 3RLFA 1MJEA 2ZM6Q 4DR5L 1HNXQ 4BBSH 2VY3A 2VZAA 2BA0A 5GAHC 2JA7H 4L5RC 4B3MQ 5FLMH 2EXDA 1XNRQ 1JT8A 4JI7Q 4LFBL 1NY4A 2UXDQ 2JA8H 1Y1WH 1HJPA 4LF8Q 1VQPA 3DM3A 1B7YB 3J80i 4GNXC 4LF4Q 3CCRA 4OWTB 3PO2H 1H95A 4DV5L 1TWFH 3FKIH 1CSPA 4DR2Q 1S72A 3ULLA 3TS0A 2PQAA 2YYZA 4A93G 4LF9Q 1SE8A 4ME3A 3H3VH 4A3JH 1X6OA 2PMZE 1PH9A 5M5XH 4MZ9A 3M4PA 3IRBA 4UP8A 4YY3L 2AKWB 3ERSX 4KI0A 3PUYA 2N78A 2UXBQ 1OXSC 2YTXA 2F4VL 3HOWH 4MNOA 4LF6L 1V9PA 1FJGQ 1V1QA 3A5UA 1A8VA 4C3HH 4DUYQ 4HJ9A 3HOZG 3EBEA 2AMCB 1VQBA 4X62Q 3GO5A 3K81C 5C0XJ 3I56A 1J5EQ 3I4NH 1MIUA 5E7NA 3CPWA 4AIMA 4R4CA 3S2DH 3PUVA 3PF4A 1EYGA 3STBD 3RZDH 4DKAC 1OXUA 3I4OA 1XMQQ 3CMAA 1I6HH
chains in the Genus database with same CATH superfamily
2EOTA 4C3IG 4KY5A 4ALPA 4CDEC 4DR1L 4F88A 3S16B 3H91A 1C0AA 1QNKA 1STAA 4XQQA 2KCTA 4JV5L 5NUCA 3VYRA 4A3EB 5LL6S 1NJIC 1X55A 3PSIA 2WKDA 3F8TA 3GTPH 5CORA 4DAYA 5IP9H 3V96A 5D65A 2O4XA 4XDXA 1A3UA 4N8FA 5C4XG 1K8MA 1PYSB 2YU9H 5LMNW 1XWEA 2UXCQ 3K59A 1PZID 3M9BA 4FF2A 1TWGB 1GXDC 1VQ4A 3S1RB 3NWTA 2DNEA 5GQOA 4DV6Q 1GD7A 3V05A 2ES2A 2EJMA 4DV3L 5KIXA 2NZHA 3R8BA 1AE3A 4OWWB 2NYZD 1LTSD 1XNQQ 1MSGA 1SYGA 2AWOA 4BY1H 4JCVE 2R7FA 2HD3A 3OYYA 3HOXG 4JI8L 1C4QA 2ZM6L 2F4VQ 4X3TA 1I4RA 5JEAJ 3NTIA 1X3EA 4KLKA 4JI3Q 1NSNS 3QB3A 4GN4B 3AEVA 3MXPA 1JORA 2PI2A 3FHWA 4K8IA 3VYUA 1WYDA 3HOUB 4B08A 3T1YL 3FPUB 2UXDL 1F2YA 3C2PA 2XNAC 1YVCA 5HURA 2JK8A 1E7ZA 2A68D 4UP7A 4J15A 1U0LA 4DK6C 1B4OA 3CCVA 4YWLA 4WJ3M 3OWEB 1ZXTA 2JA7B 1G2TA 3A0JA 1FNUA 1Y8NB 2NVYB 2K5VA 1JE4A 1PFNA 2Y0SG 2GA4B 1Y14B 2XSCA 1KIXA 1IYUA 4ZRZA 1SYFA 5IE8A 1SE4A 5CR3A 4JV5Q 1Y1WG 4GN3B 2K1BA 3FKIB 2HHHL 4ABNA 1DZ1A 3HKZG 1P16A 2F4IA 4PMCA 4BBRH 4A3EH 3NELA 1BXTA 4LFAL 4G4KA 5HGTA 1HZCA 4M8AA 3S1MH 2WFWA 2XN9C 2XTIA 4XQJA 3CCUA 1CA6A 2K32A 4IUPA 5H1SE 1XTCD 4DV4L 2L11A 1IL8A 5CV8A 1VQDA 1NAPA 1VQ8A 1TWCH 1XJVA 2IHEA 4R4OA 2ZTCA 4K2KA 2UUBL 1I4GA 2AUKA 1YITA 1VQIA 1UAPA 3I72A 3PUXA 2EVBA 4IJLA 1Y1VG 4HMIA 2H5XA 2OTJA 5EAYA 3OWFA 1EIFA 5EGTA 1HFNA 1VQNA 1E2VA 2SEBD 1VMCA 3CHBD 1EFWA 1E2ZA 2Q2UA 1VDZA 5GAGC 4A3CG 2JJQA 4BA1I 4J1MA 1W2BA 2NN6I 2RVLA 4A3JG 5I4DA 2AQ1B 1UE6A 3S1NB 4KY6A 1CHQD 4A3KH 2J0TD 1H9JA 4C3IH 2CCZA 2SNMA 1S4ZA 4K5WA 1CT1D 3O13A 2H1EA 2N55A 4JI6Q 2KJXA 1G2SA 4UY8C 4JW0A 5D3IB 1D5MC 2EYOA 4QF4A 2K03A 4N9TA 4JI5L 2B39A 3MFGA 4EQ5A 3ITPA 4DV1Q 4BY1B 2HQLA 1EZ8A 3RZOH 2D0OA 1SN8A 1RTNA 3G6EA 3Q6SA 2RQXA 3J80L 4JBMA 1AEXA 3E5SA 3QWNA 4ZUIA 3P1HA 2ALYB 2F0IA 3J81L 1S5BD 2QDLA 4XXEA 4KHPL 4MTNA 4KJNA 2EY2A 1VQ5A 1EIYB 1ICWA 5HGQA 4JBKA 1A63A 2LXKA 4IPDA 1PH4A 3DUZA 1TKWB 5AFWA 4O42A 1BOSA 1TWAB 2ICIA 1STEA 1TY0A 5JJIA 2MO1A 4U673 2QF7A 2ICEC 2JP1A 2B63B 5LMUQ 3NP8A 1E3PA 4YCWA 2HQEA 3OPOA 1DGSA 4HTHA 3KBXA 5FO8B 3FDTA 3CRLC 3F1ZA 1CTMA 2MHVA 2L1BA 4C3IB 4DR2L 5M5YB 4YHHL 1QJOA 2D62A 2NN6H 4LF8L 2F3VA 2K01A 3EQLC 1PYWD 3BG3A 3C1FA 3CP0A 1SNMA 1N33Q 5IYDH 1EL0A 2PQAB 4A3DH 1HCZA 3JAML 3NQTA 4CDCC 1KNEA 4OL7A 5EJWA 5DM63 3HOWB 3NBHB 2CH4W 1JWUD 1TS5A 2F0KA 3DEPA 1SMYD 2Y0SB 1ICFB 2YU9B 1A15A 2A6HC 4XT3B 2CVRA 1VQCA 2B2TC 2SNSA 4O1NA 1IHZA 1I50H 5AJ3L 4XYOA 4UAIA 1HA6A 4G7HC 1AZQA 3TP7A 3F2CA 1JWSD 5G3LF 4L63B 4C3JB 4FDBA 2QA4A 1LO5D 3TMEA 3A56A 3KUPA 4BBSB 3E6ZX 5C44B 1PYBA 3GTMB 3DM1A 2JA6H 4CGYB 4LNQA 1ONLA 3NWSA 1BO0A 3AMUA 1BBWA 3SR1A 3MXUA 1AW7A 2B2TA 1E24A 2XRSD 3EVQA 4EGVA 1UUPA 2HDMA 1GUOA 4XTCS 4DPGA 4C3JG 5M5WH 1RKNA 1CSQA 4MN3A 3BVGA 3OTOQ 2TSSA 2RHQB 1BVSA 4M1UB 2WB1E 1IBKL 2NWGA 3SGIA 4C3HG 1X9NA 5C4XH 4GKKQ 1OXXK 1WJJA 2NTSA 5J39A 2M9VA 1QWYA 2WB1G 5C4XB 3WOFA 2JA5H 1O7LA 2WINB 2WIIB 4KMUC 1I4PA 2XVSA 3M4QA 4IN3A 3NENA 5C4ZA 4A3KG 1NBWA 3CCLA 3GTOB 1D1IA 3R2TA 2NZ1D 4A3EG 2E2IH 2BDOA 1IL2A 3HOVH 2B2VA 2OCEA 1ZEQX 5E4XA 1CKOA 4I7ZC 1R4PB 4YWMA 1HR0W 3HOXH 1KXLA 1VQKA 3U4VA 1NR4A 5EPLA 2KVMA 4LFBQ 1HNWQ 2ZTEA 2HCIA 3AQQA 2ZXRA 3K80C 4FO2A 1KDBA 4K5XA 3SDZA 4FXGC 1C7YA 4PNYA 4IUUA 2MFIA 3H0GG 5M3FG 3U58A 4A3MB 1PV4A 4JI2Q 1SMXA 1DOMA 2K5NA 4POFA 3BZDB 5G3LD 3GTKB 1SNOA 1JICA 1IKMA 2MUYA 2FHTA 4JI6L 3BDOA 4H44C 4LF5L 5IT9L 2Q8RE 2CW0C 2Z6KC 1LTID 3PO2G 4F87A 2RF4A 1F77A 1Q82C 3J7ZC 3RLFA 2EY1A 4DR5L 2L12A 1O7ZA 2VY3A 2BA0A 2OEOA 1B2TA 2A69C 1BUVT 5IGEA 4ID6A 3QOJA 2J4XA 5FLMH 4JI7Q 4LFBL 2AQ2B 5CV9A 5I6YA 2F0WA 1Y1WH 2EYMA 4GNXC 1WTXA 3CCRA 4OWTB 4QB4A 1S72A 1LT4D 1PRTF 2PQAA 4LF9Q 1SE8A 5I2YA 2K5WA 4UP8A 2YTXA 4MNOA 3M3YB 3SEBA 1SYBA 1EY0A 4C3HH 1TS3A 3M4YA 1EQTA 3QG1A 4XT1B 1IW7D 5L37A 4X62Q 3K81C 2OF1A 5E7NA 3S2DH 2JXMB 4AIMA 3PF4A 5IGBA 5KNBA 4DKAC 1OXUA 3L9AX 3I4OA 2G9HD 1JOOA 3HRZC 3Q23A 1I6HH 1ASYA 1SNPA 2NVTH 1DCZA 4J6HA 4JI4L 2Q2TA 2L0CA 5EQ0A 2F0HA 4A3IG 4NXNQ 2CH4A 2ZT9C 2FFKB 3I4NG 2MNAA 2EYJA 3OW2A 1X3GA 4A3CH 2R7DA 1Y1VB 2FMCA 3EROA 1LT3D 4JI2L 1U4PA 3KF8B 2QKIC 4H0LC 2B63H 3RR5A 2RDHA 2LFNA 1FYCA 3ICEA 3W1BA 1KLUD 5C44G 4IFDG 2SOBA 5I2XA 2Z9HA 4HR7B 4NMZA 4DK3C 1JOQA 4JVZA 4DXFA 5M3MH 1MBYA 3HOYH 3G48A 2PPBC 3UDIA 4X66Q 1U4MA 1LTGD 3GTGH 5IYDG 3TP6A 1KRSA 1ILQA 1IW7C 3JC66 4DF7A 3N6RA 4ULLA 3H3VC 1N34Q 2FINB 3CC4A 3RMHA 3NK9A 1YI2A 3S2HB 2L55A 1V1OA 4IUTA 1E2WA 5IT9c 1HNXL 1FJGL 1BCPF 3VYSA 3GTMH 1CQFA 3HEJA 1L1OA 5FLMG 4DA2A 1WCMH 1PH2A 4FF4A 1WTVA 1Q7YC 4HSVA 2B29A 1IBKQ 4DV7Q 5IWAL 1H9KA 2NVQB 4DV5Q 5FLXE 3AU7A 5ELOA 1VQJA 2VL6A 3OTOL 1VQ7A 1ENAA 1G8ZD 2Z6KA 1A62A 4JBJA 3ZYYX 4P71A 4IQZA 4LW1A 1L1OC 2R93H 1DONA 3M4OH 4NP5A 4DV1L 1ML0D 1NNXA 4KKTA 1WVLA 4C3HB 3D6WA 4OELB 1XXGA 1PTOF 4X64L 5DLQE 5K36H 2DNCA 1MSHA 4A3MH 3I4MH 2K75A 1FGBD 1R9TH 2RBMA 2UU9L 3A74A 3L7ZC 5JJLA 4DK1A 1F9PA 1DD2A 2WV6D 1OXVA 2LY7A 2OTLA 4AH6A 1IYJB 2MQHA 1Q8KA 2FMMA 2IY5B 2CWPA 3HKZE 5FJ8H 2IX3A 4QY7A 1EYDA 4OO1I 1D8LA 1QCBD 2VQEQ 5KYIA 4TQUS 5C3EB 3K0YA 5IY0A 1BBUA 3D3RA 4JBWA 2MP1A 4OO1G 1EU3A 1S5DD 1V1PB 3CCEA 2KHSA 5FK9C 4WJ4A 2K5QA 1YNNC 4APVA 3HOYB 4IPGA 1L2FA 2UUAQ 5I9PA 1V43A 3I91A 3F2UA 4FP5D 3RZDB 4IZ8A 1Q12A 2UUCQ 1Q1BA 3PO3G 4A75A 1HA5A 3S17H 4OEMB 1VQFA 2KEEA 2I0QA 3G4SA 1T5XD 2BOSA 3DMUA 4LUVA 4PV1C 3T56B 1L1OB 4EQOA 3TQYA 1K9MC 2IX1A 2VUMB 2Z8LA 1HR0L 2AUJD 4JI7L 3S1NH 1PXUA 4G7OC 3U50C 5CV6A 5LL6X 1N32L 4POGA 3C3LA 3UDFA 4F8MA 1FNVA 3I70A 4RGOS 4KY7A 2YV5A 3T13A 2D9UA 2OT2A 1EYCA 1UE7A 4Q5VA 4IJHA 1UWVA 4TSSA 5KEEA 5IT9E 1NMGA 1XMOQ 2F03A 1B1ZA 3X3NA 4XYQA 2FXQA 1DYQA 2KHIA 3DLLA 4GLXA 2CFMA 4BY7G 3KF8A 2B63G 4R4IA 2JEAI 3FRPB 1YJ9A 5C44H 1SMYC 3BYYB 2N88A 3HZXA 3K0XA 4S3SA 2KBNA 1AN8A 1HTLD 3IL8A 3M85A 4A3GH 1A0IA 3UI2A 1PRTD 1WTPA 1SJED 1GM5A 4X65L 1GHKA 3I4LA 2K50A 3MEHA 3PIPA 3D4WA 1XMOL 4WORA 4G57A 3AYHB 4DFAA 1EOVA 5M5XB 1DJRD 2RSOA 5IYCH 2WACA 4HIMA 3VR2A 3A5ZB 3FVQA 4TVAB 5FLXc 1KHIA 1Z6HA 1EIHA 1PMRA 3C46A 1I6VC 4P72A 4K0KL 3CAMA 4YY3Q 5ELNA 5CBAE 1HR0Q 3PO3B 3MXNB 5KYLA 1D2BA 4LUZA 1EY6A 1CZWA 2D5DA 1RIPA 2JE6I 4DR4Q 5BN5A 5CC4A 4B3RL 2GN5A 1RJTA 2F0PA 1EWCA 1G6ZA 1E0BA 1K83B 1B50A 1VQGA 1PA6A 3D6CA 4EVOA 3SK4A 1PDQA 2VB3X 2N8NA 3J7YW 4DV0Q 2R93G 3OHXC 1A2UA 1F9QA 3I4MG 1Y8PB 2GVBA 5JVG3 4OX9Q 1PH3A 3J81j 1PFMA 2PCFB 2WAQG 4LF7Q 4LWCA 4B9WA 4BBRB 1G91A 2BA1A 4PZ8A 1S3OA 2FJ2A 2C9OA 1B9NA 2DY8A 3HFZB 2EDGA 3K7UC 3I55A 1P8LA 2Q2IA 2HT1A 3EN2A 2BE5C 4B9XA 2M2LA 3S16H 4B3TQ 4JI5Q 4CKEA 4RG1A 3BU2A 4FYDA 1B9MA 2DY7A 3RZOB 3OMGA 2OQKA 1I4XA 3VYTA 1X3PA 2VUMG 3ULJA 2A6ED 2YTYA 2OQ0A 4LF9L 4GOPB 2F0LA 4QQBX 4KHVA 3FKIG 3G6JB 5F2DA 1E22A 5EBDA 5C5LA 3PIO3 3CCMA 5GROA 4ZK9B 4NDXA 5IYCG 3T1YQ 4IUVA 1O7IA 4CKCA 3J80E 3HOWG 1JE5A 5I6WA 3CKIB 4CKBA 1VF7A 2SDFA 1ILPA 1WTOA 1HTPA 4QGUA 4DXGA 3MEFA 1ESFA 3B6YA 1EWHA 1N36Q 3HOYG 3S2DB 4B3SQ 1LTTD 3CU7A 4QMGA 4IUQA 4A3BG 1KAAA 3Q8DA 1M90C 2XRQD 5FJ8G 4NXML 3KJOA 3AB9A 5E1FA 1V1PA 2E2IB 4YCUA 1EY5A 1T5EA 2LXJA 1LUZA 2NTTA 4NKLA 4DV3Q 2JEBI 3V2TA 2F0NA 3OOCA 2Z0SA 2HHHQ 1RF2D 4YHHQ 3IFDA 1X3FA 3S17B 1HUMA 2VQFL 2I07B 4G7ZC 3RD4A 4DR7Q 2CW0D 1DOLA 4ZUJA 3UDGA 3LX0A 2A74C 2JA6B 4BA2I 2QW7A 3NHHA 2Q2HA 5C6AA 5JEAG 2CHBD 3R93A 4JI1L 2E2JH 2KENA 4RGNA 5C3XA 3PO3H 4RGMA 3TS2A 1S5ED 1FGUA 4GKJQ 4HJ5A 1BQQT 4OONA 1NE3A 4LFCL 3K5NA 1D6EC 2V1CC 2E5LL 2EZVA 3LWEA 3MZ5A 5FLXL 3U9SA 3LWUA 1STYA 3VR4A 2I5HA 2Z4HA 3GDEA 3QOLA 4DNIA 1PTOD 1STBA 4JOIC 3VR6A 4CJ0B 1BF4A 4CJ2C 1VQOA 2EQSA 1MJEA 2ZM6Q 1HNXQ 2E2HB 5GAHC 1K0SA 2RDFA 3MHBA 4B3MQ 2F0EA 2R3ZA 2O5IC 2UXDQ 1SFOB 5BN4A 1VQPA 4Y7NB 5K5PA 3J80i 2VXWA 4LF4Q 4ODGA 1H95A 3FKIH 5C4HA 2PYKA 2EJGC 4U68A 3ULLA 2CQAA 3H3VH 1X6OA 1PH9A 1TQOA 2IL8A 5M5XH 4YY3L 2AKWB 4XQNA 1BCPC 1OXSC 3BDLA 3HOWH 4I7AA 1FJGQ 1V1QA 3QIAA 1KNAA 4RA8A 4DUYQ 1ET9A 2BCOA 3KLSX 3EBEA 4TKOB 1F2ZA 3QR8A 4ILWA 2E74C 1I50B 2F0UA 2P5ZX 2EJFC 2HUGA 4FF3A 4UHVA 3CMAA 3KF6A 3CCSA 2PW7A 4GNXA 2B2VC 3A8IE 2HCCA 2B2YA 3SK5A 4K8JA 2UUBQ 1TWAH 3MXGA 5KNDA 3RNUA 2UU9Q 2F0TA 1STNA 1VS0A 1TIID 5EKKA 1RL2A 3RN5A 5DM73 4OXPA 5ELDA 3HKZB 2A6HD 3HP3A 2IHFA 3ULPA 2ENBA 1IXRA 2K52A 4BY1G 3F2BA 1KDAA 2B2YC 1GUTA 5JVH3 5IGCA 1RDPD 3NSWA 1KLGD 4DUZQ 4C2MB 2PW5A 1X3QA 5IP9G 1ASZA 4ZYSA 1N32Q 2E2DC 1IZ6A 4K0KQ 1NMFA 5IWAQ 2ZJRA 3E9IA 1SROA 3L3OC 4P2CB 4ZLTF 2KOLA 1Y8OB 3K57A 1N9WA 2B2WA 1K3RA 1SNQA 2NVQH 2R92H 4DV2L 3KLSA 3HOUG 2A19A 4H13C 3J81c 3H09A 3T1HL 1QB5D 1TWGH 1LYLA 1MI2A 1XPOA 3H6MA 4LFCQ 5J22A 4DAPA 4QL5A 1W6JA 1XNRL 1KDCA 1UEAB 1KAWA 4B3RQ 5DNFA 1G51A 1GKHA 1II3A 4X66L 2F0FA 2RDGA 1EQQA 1F9RA 4KHZA 4WFN3 4A93B 3I4NB 1MD2D 3D8GA 1SYDA 2DUDA 2VUMH 1SDFA 4JI8Q 5KNCA 1VQ6A 3RN2A 1TT2A 2JSOA 5IGDA 2NVXH 2NVTB 1R4QB 1OTCA 5EBCA 3H94A 2A1AA 1WTHA 2QILA 2BH2A 1ZYRD 3F2DA 2F0OA 4C56C 4EX5A 2R7ZH 2EY5A 4RKLA 5C4JH 1EYAA 3S2HH 5J3BA 2PNHA 2F0VA 3P75A 2VNUD 3PIP3 3ONAB 2WAQE 1BCPD 1IYVA 1N36L 1Y1VH 2BDNA 1YEZA 3S1MB 3L2PA 1EUJA 4A3LG 5DAUA 2KEDA 4GN5A 1VQAA 1GUNA 4GLAC 4A3FG 5E4WC 3TZDA 1QUQA 4A3IH 4H7BA 3SHLA 2KA7A 2QEXA 3SK8A 5DEHA 5TSSA 3N52A 2A68C 4X3SA 4DNTB 3TRZA 1LTLA 1I4QA 3D4RA 1JMCA 4HEDA 1FD7D 1TY2A 4GKKL 1WOCA 4QJFA 1A3VA 4X6AH 4L8JA 2EYLA 1XYIA 3GV3A 2K14A 3C1EA 4RCOA 5M3MG 3ZJYC 1TU2B 3GTLH 4JC0A 1BNZA 5LMUL 2A6EC 1XTDA 3HOUH 3BZKA 1SNCA 4RCNA 1CUKA 1EY4A 3H0GB 5M3FB 5AJ3Q 3CXCA 3KK7A 4K14A 1YBYA 3GTJB 4AYBB 4DK0A 1HZAA 3EJIA 4LF5Q 1SE3A 1YNXA 3VA5A 3E9HA 4HJ8A 1U9RA 1SYCA 4DAYB 2F0GA 1QUQB 1TVXA 2N3SA 1I3QB 4RMFA 1KQSA 1WTQA 2C35B 4B3ML 2R93B 1YHQA 1YHAA 1MGSA 3NTHA 1M1KC 1ZYRC 1WCMG 5JJKA 4EQPA 3TEHB 1EZ6A 1EIGA 2G9DA 1JB7A 1N33L 3CCQA 4YIJA 1E1OA 1KTKA 1RHPA 1V8QA 1CKNB 2B2WC 1YIJA 1SJHD 2EPBA 2RHSB 4HCEA 4JK1C 3A54A 3GTQH 3KLWA 3CC7A 3A7LA 4DV7L 2R7ZG 4AYBE 1CI3M 4HAEA 1HPCA 2NZOA 3EFXD 4QIWE 5T1GA 2KCMA 3QJYA 4IFDH 2AWNA 4DGZA 1JQYD 2VS1A 1JOKA 3GV6A 1CK1A 4RFBA 4O2DA 1A3TA 1EY8A 2KECA 1BKBA 3K5LA 1XNQL 1QG7A 2E75C 2F1MA 3CQZB 3DWAA 5IGGA 4YWKA 1N34L 2EIFA 4UPAA 3K7AB 3E0EA 4DV6L 2Z1CA 3W3AA 4FNFA 4OO1H 1EY9A 2EE1A 1JJGA 4JOIA 4UP9A 2PO4A 5CV7A 4HMJA 5C5MA 1RTOA 5A2QL 2KUMA 2JYOA 4DV2Q 2O5JC 2E8GA 1XPUA 4BY7B 1EFID 3CW2C 2JN4A 4KTAA 1Q81C 1U4LA 4A3GG 1DXMA 3NEMA 2E2JB 2F0MA 3WWVA 1AP0A 1J9OA 1WI5A 1PH5A 2JA5B 4Z9CB 2E5LQ 4NXNL 4A3IB 1TWHB 3S1QH 4DR3L 1LV9A 3T16A 4DR6Q 3PUZA 4OIJA 3GTKH 3PF5A 2BH8A 2OWOA 3I8ZA 3HOVB 1Q1EA 2UXCL 4OHJA 4PMWA 4IPHA 1IKLA 4A3DB 3NQIA 3MFYA 3M4OB 2WB1B 1LTAD 3A8JE 3M7NA 3RLNA 4CBVA 1RCVD 2UXBL 3HOZH 2QEJC 1H9SB 2LSSA 2PZWA 5FO9B 1UE1A 2ZTDA 1HQMC 1QILA 3KJPA 2KHJA 4DN4M 2N49A 3OIQA 2KCCA 4MIUA 4O0AA 3GTQB 4K6LA 2K4KA 1JJ2A 2EYFA 3GTGB 1EU4A 2LKVA 3KYHC 4BY7H 3J81E 2O2LD 3M3YH 1G291 2AHOB 4CJ1B 2K05A 2VW9A 3K58A 3X3MA 2QDBA 4GZYC 5EPJA 2K7VA 3TREA 1QZHA 1C48A 1M4VA 2IX0A 2XGTA 4QUFA 1FL0A 1XX8A 3S14H 4BBSG 1S40A 3ERQA 1SLJA 2CQOA 4ZKCB 2F3WA 1SEBD 4LUOA 5E3FA 2MGSA 3I7FA 2UUAL 5C4JB 2B2UC 4DAMA 4KV6A 1VQ9A 5I9OA 5CMDA 1GUSA 2NB0A 4GOPA 3MVVA 3LGJA 2K6AA 4OIKA 5JOBA 4RH6A 5IOCA 1HQRD 3CMEA 1TWCB 3A55A 2ZJQA 3PQIA 2IT1A 1LACA 3CC2A 3J81i 2X6GA 1L0YB 1U4RA 3EA6A 2RCNA 1K8GA 1IBML 5GADC 4A3JB 4KK7A 3T1HQ 1G6PA 4QCLA 1K8OA 1Z47A 5A2QE 4IO9A 2PQEA 4F7XA 3GD7A 2XWJB 3TDQA 1U5KA 4DAVA 2NBFA 2LS01 1WTRA 1VCIA 1EQVA 5BR8L 1IBLL 5IYBH 2ID0A 4L5SA 2B3GA 1JJCB 2VZAA 2K04A 2JA7H 1B3QA 3IKJA 4L5RC 2PMZB 4FVMA 5FO7B 2EXDA 5C0XH 1EOTA 1XNRQ 2IWHA 1JCKB 1JT8A 1NY4A 1AFPA 3A8KE 2TMPA 3PO2H 4DV5L 1O7YA 4IURA 1TWFH 3P20A 5EKIA 1CSPA 4DR2Q 5CBEE 2WAQB 2YYZA 1YNND 5COYA 4ME3A 4A3JH 1LABA 1F2MA 4RAUC 3IRBA 1GUWA 4KKSA 4KI0A 3PUYA 1VF5C 4KD3A 2UXBQ 1PLFA 3HG9A 5JEAH 1KABA 1V9PA 4LF6L 2HDLA 3A5UA 4WRDA 3MAQA 3S14B 3S15B 1EEFD 3QO2A 3GO5A 5C0XJ 3I56A 3I4NH 1MIUA 5M3MB 3CPWA 3PUVA 1EYGA 1Q8IA 3STBD 2G5DA 4DNRB 4J8QA 3DEOA 1BR9A 3MXNA 5M9OA 1TS4A 4WJWA 1GJXA 1HNZL 2ATWA 5KGUA 2IPKD 5D3DA 1KRTA 3PIOA 1X32A 1FVIA 1PH7A 1H9SA 4A3BH 3NXWA 2L4NA 1HXYD 3PGZA 4DUYL 4RHSA 4IFDJ 3G71A 4DV4Q 3PMFA 3VA7A 4A3BB 4LF6Q 3T53B 3GTPB 4PG3A 5IP7H 3S9WA 1JC7A 1CFMA 2ZXOA 4HN7A 4ZKBB 4K2LA 1EY7A 1PTOB 1HH2P 3BZCA 3UE1A 2NVXB 2ASBA 3I73A 1YZ6A 1PTOH 4IOCA 4JPBW 1SNDA 2MPMA 1N8RC 1PHJA 2Z6BA 1GUGA 2L9HA 1XPRA 2K33A 1VQHA 4JYAQ 1QVFA 4RWSC 2I46A 1CQVA 5IYBG 1TS2A 3TBIB 1S5FD 4Y52H 4IOAA 2L15A 4EQNA 4GOPC 4DR5Q 3GTLB 2NN6G 1AZPA 1VQLA 5LMNL 1WFQA 3U9OA 3UDXA 3ND9A 3PUWA 1DOKA 2I5LX 4RKBA 1M8AA 3JAMc 2EXZA 1B8AA 4KHPQ 1SE2A 4A3MG 3S24A 3LNNA 1MJCA 3J7AV 4AQYL 5C0XI 1HHVA 3HGBA 1I94L 4JI1Q 2RA4A 1I3QH 1J8IA 2ZJPA 2X6LA 3AFQA 3JAMi 3A7AB 2I5MX 1KC8C 1NCVA 1GHJA 2C5CA 5T1IA 3I4MB 2VQFQ 2PZTA 4X3UA 4PZ6A 1CKMA 4PQXA 3I90A 3SVMA 5ISRA 3BJUA 3TP8A 4A3KB 2R7ZB 3J7AF 5HY6A 5JPMC 2DJFC 5IIFA 1ESRA 5K36G 4NB3A 4KD4A 1PTOC 1BCPB 4K5VA 4NXMQ 4JG2A 3WOEA 3ER0A 1C9OA 4FXDA 1HUNA 1XMQL 3R2IA 2EY6A 4C3JH 3IFTA 1KL9A 4LF7L 2F52A 2H4OA 3DXJC 4P75A 1GOZA 4A3DG 5IGFA 1WCMB 1J5EL 1I94Q 1AE2A 5CV5A 3J80c 3NBHA 5C0XG 1F2LA 4R1JA 5C3WA 5GAEC 2B8GA 3HKSA 2KCNA 4DV0L 5M5YH 2E76C 1X54A 2HIVA 4AYBG 1H9RA 2F0QA 3CD6A 4BS9A 3FMCA 2Q8TA 2RCFA 3T51B 3BS1A 1PH1A 2JA5G 1HRJA 2DGYA 1OO9B 5LMNQ 3IAYA 3R3OA 2DN8A 3HS0C 3KLRA 2F0JA 3NTKA 4LF4L 4C1NI 2NUCA 3JAME 3OW7A 1I5FA 1O80A 3TP5A 2L5TA 1ZKOA 4R4QA 1PRTC 4R8IA 3E0JA 1YHBA 4Y7NH 5JJZA 1HZBA 1LT5D 4HIKA 4DR6L 1L0XB 1RODA 4ME5A 2JA8G 3K7AH 3P7JA 3KBGA 1NUCA 2A73B 4R4TA 3H0GH 5M3FH 3GTOH 3H3VI 4HSPA 4A93H 2JA9A 1X65A 4HJAA 2JA7G 4A3FB 4R9WA 2QGQA 1STGA 2F0DA 2WKCA 3PV0A 4A3FH 4JI0L 3HOZB 2B8FA 3BYTB 1STHA 3GQBA 4KKUA 1EQRA 1PRTB 1I4HA 3VR3A 1HNZQ 2R6GA 4AQYQ 3D31A 4A4IA 1VQEA 2K5HA 3Q22A 3Q24A 2LMCB 1HNWL 1ENFA 4C2MH 4JI4Q 3MWYW 4UDUC 2QCPX 1CM9A 3W5OA 2RSNA 1YJNA 2JQOA 2OXPA 3PCOB 4QIWB 1YNJD 5J1ZA 2CWAA 1B70B 3AFPA 4OX9L 4LMQD 4BXXG 4GNXB 3HOVG 2IJ0A 5CYUA 2V4DA 4JI3L 5A35A 3CCJA 1DM0B 1WD0A 1K8AC 3ND8A 1X56A 1SSOA 4V0BA 4I65A 3W1GA 4B3SL 3EIVA 1K0RA 4JYAL 5CGKA 3CF5A 1QOHA 2EYPA 3K8AA 2JA6G 4HIOA 5EPKA 4OWXB 1UEBA 1Q86C 1LTBD 5FKAC 2MJ8A 3D4DA 3WDNA 4LAAA 5ELBA 3L0OA 4DR4L 3KOJA 1HZ9A 3DHQA 4CDDC 4PZ7A 3MA2B 1D7QA 2Y0SE 5C3EG 3H15A 3KDFB 1FR3A 5KRUA 3NPPA 3NUCA 1J6QA 3FPPA 1F9SA 1CHPD 1CKNA 3URYA 2UUCL 2R92G 2HIXA 5EKLA 1B44D 1SAPA 1ENCA 1JWMD 1NTGA 2NVYH 1TR5A 4L5QA 3RUZA 1OXTA 2IW3A 3SXHA 3TZUA 2AQ3B 4IFDI 1NR2A 1D5ZC 4HIDA 1GO3E 4TRDA 2A5HA 3CRKC 3I2ZA 1QVGA 4B3TL 1EWIA 1W3SA 2YTVA 3K5OA 3GP7A 4DR1Q 1IBMQ 3KF6B 4LFAQ 4GLVB 5ELFA 1PZJD 4DUZL 4N9PA 1H9MA 4K6DA 4GKJL 2VQEL 3NE5B 2D0PA 1ET6A 3CPFA 3Q0AA 4OGQC 4X62L 5CV4A 1MKHA 2R61A 2KQ3A 1K73C 1PH6A 2E2HH 3T4AC 1VQMA 1LM0A 4LK1C 1YJWA 4DR7L 1CZGA 3SE0A 1E1TA 3TSSA 3STBC 1UNSA 1B3AA 3FP9A 2Q8IB 1TWFB 3OMCA 2Z4IA 2WP8J 4KJOA 5ELCA 1SFOH 1A6XA 2D2CC 1Y69U 1C8CA 4L6TB 1Q3LA 4NPSA 1Z9FA 2J7ZA 3BDCA 4A3LH 4Q0FA 1UE5A 4BXXH 3DWPA 1QNUA 4P73A 4FXKC 3OSOA 3D0FA 1SYEA 3BVMA 4L5TA 2MO0A 2K5DA 3U4ZA 4BBRG 2XWBB 4IUNA 3BVZA 2XIWA 1EEID 2GVAA 1GVPA 4CHTB 5IP7G 2A8VA 5BR8Q 1IBLQ 2X69A 3W2DA 2RKSA 3I3CA 4IPCA 5LHY1 1LT6D 4YCVA 1CA5A 4PMBA 1SR3A 4RHRA 3GTJH 4GS3A 4ZCKA 4A76A 1Y1WB 1PVOA 3NBIA 2BE5D 4H02A 5IODA 2A69D 3S1RH 1AH9A 1B53A 3DWQA 4C1NK 4N8X1 3VDYA 4MTKA 4HJ7A 4KN7C 1S5CD 3KDFA 5C3EH 2CKZB 3RLOA 2EYHA 2M00A 1VMPA 1KD1C 1LTRD 4X65Q 1K28A 1PFBA 1PFSA 1K3BC 1D1KA 1SBBB 3M7GA 1L0WA 1QZGA 1BBXC 1A2TA 4RGTA 4JI0Q 3MTSA 2JA8B 3S15H 1T9HA 1MHWC 3CQZH 2F3IA 2R92B 4KN4C 1O78A 2PI2E 5M5WB 1W6KA 1R9TB 4DR3Q 4P74A 3K6OA 3SK6A 4X3KA 2B2UA 3TN2A 1TWHH 4NW2A 1SRUA 3KFUA 3S1QB 1QE6A 1K83H 1PH8A 4V190 1FNWA 5BN3A 1BDOA 3J7A5 4X64Q 1PZKD 1TXYA 3HOXB 4QUCA 1Q46A 4R8NA 3UE0A 1Q90A 1QVCA 3K5MA 4XIGS 4BBSH 1JR0D 3OIPA 1WTWA 5JAVA 1D5XC 4E6IA 2JA8H 1HJPA 4LF8Q 2PNRC 4MHEA 3DM3A 1B7YB 4A3GB 1I6HB 3VR5A 4DU9A 1Z7TA 2PZUA 5D14A 3PO2B 3TS0A 1HFGA 4A93G 4BWGB 4ZAIA 2PMZE 2VB2X 4MZ9A 1JB3A 3M4PA 1YNJC 5JPNC 1LLRD 3ERSX 3G7LA 2N78A 3MC0B 3E3XA 2ZXPA 3FEWX 2F4VL 1A8VA 4HCSA 1SXTA 5FOBB 2DJGC 4HJ9A 3HOZG 2AMCB 1VQBA 1J5EQ 5ELEA 4FF1A 2F0SA 4ZQ3A 4R4CA 1WD1A 2K28A 3RZDH 1RD9D 1XMQQ 4LJZC 4CDFC 4IALA
chains in the Genus database with same CATH topology
1ASYA 3KF6A 2NVTH 3CCSA 4ALPA 4JI4L 2Q2TA 4DR1L 4GNXA 4NXNQ 4A3IG 3I4NG 2MNAA 3OW2A 1X3GA 1HNZL 2ATWA 1C0AA 4A3CH 2KCTA 1KRTA 2R7DA 3PIOA 4JV5L 1FVIA 2UUBQ 1TWAH 1NJIC 4JI2L 3KF8B 1X55A 1PH7A 2B63H 3PSIA 3RR5A 4A3BH 3F8TA 4DUYL 3RNUA 3PGZA 2UU9Q 3GTPH 4BY7G 4IFDJ 3G71A 5IP9H 4DV4Q 3ICEA 1VS0A 3W1BA 5C44G 4LF6Q 4IFDG 1RL2A 3RN5A 5C4XG 1PYSB 4PG3A 4DK3C 4OXPA 5IP7H 2YU9H 5M3MH 5LMNW 2UXCQ 1Q82C 2IHFA 3HOYH 3ULPA 3G48A 1IXRA 2K52A 3M9BA 4BY1G 3UE1A 1HH2P 3BZCA 3UDIA 4X66Q 3F2BA 1VQ4A 2ASBA 3GTGH 1YZ6A 5GQOA 5IYDG 4DV6Q 4IOCA 1KRSA 4DUZQ 1GD7A 1N8RC 3JC66 1PHJA 5IP9G 1ASZA 1XPRA 2ES2A 1N34Q 3CC4A 1N32Q 1IZ6A 1VQHA 1QVFA 4JYAQ 4DV3L 4K0KQ 1NMFA 2NZHA 1YI2A 1AE3A 4OWWB 5IWAQ 5IYBG 1XNQQ 2AWOA 2ZJRA 3E9IA 4JCVE 2R7FA 5IT9c 4BY1H 1SROA 4IOAA 2L15A 3OYYA 4JI8L 3HOXG 4GOPC 1HNXL 2ZM6L 4DR5Q 1FJGL 2NN6G 3GTMH 2F4VQ 1L1OA 5JEAJ 1VQLA 4KLKA 1X3EA 5LMNL 5FLMG 4JI3Q 1WFQA 4GN4B 1WCMH 3AEVA 1N9WA 1K3RA 3UDXA 1PH2A 2NVQH 2R92H 1Q7YC 4DV2L 2B29A 1IBKQ 2PI2A 3PUWA 4DV7Q 5IWAL 3HOUG 2A19A 3FHWA 3J81c 2I5LX 4DV5Q 3T1HL 1TWGH 1WYDA 3JAMc 1LYLA 1B8AA 1XPOA 3T1YL 4KHPQ 4A3MG 3S24A 5ELOA 1VQJA 2VL6A 3OTOL 1VQ7A 4LFCQ 1MJCA 2UXDL 4QL5A 2Z6KA 1A62A 1XNRL 4JBJA 4AQYL 1KAWA 4B3RQ 1YVCA 5C0XI 1G51A 1GKHA 1I94L 4JI1Q 1I3QH 4X66L 4P71A 1EQQA 4LW1A 1L1OC 2R93H 2JK8A 2ZJPA 1E7ZA 3AFQA 4KHZA 4UP7A 4J15A 3JAMi 3M4OH 1U0LA 4DV1L 4DK6C 2I5MX 3CCVA 4YWLA 1KC8C 4WJ3M 4X64L 5DLQE 2DUDA 2VUMH 4A3MH 3I4MH 4JI8Q 2K75A 3A0JA 1VQ6A 3RN2A 1R9TH 2K5VA 2UU9L 3A74A 2Y0SG 3L7ZC 2NVXH 5JJLA 1Y14B 1KIXA 2VQFQ 1OXVA 1OTCA 2OTLA 4AH6A 5IE8A 4PZ6A 1IYJB 1CKMA 2A1AA 1Q8KA 2MQHA 4JV5Q 2CWPA 2IY5B 1Y1WG 3BJUA 3HKZE 4GN3B 5FJ8H 4QY7A 2HHHL 2BH2A 3F2DA 5HY6A 4OO1I 3HKZG 1D8LA 1P16A 2VQEQ 4BBRH 4EX5A 5K36G 4NB3A 2R7ZH 4TQUS 5C4JH 1IBLL 4A3EH 3S2HH 4NXMQ 3NELA 1BBUA 4JBWA 2PNHA 4JG2A 5J3BA 5IY0A 4OO1G 3ER0A 4LFAL 2VNUD 1C9OA 1HZCA 2WAQE 3S1MH 2WFWA 1XMQL 2XTIA 3CCEA 3CCUA 1N36L 1Y1VH 4C3JH 1KL9A 1YEZA 4LF7L 5H1SE 3L2PA 4DV4L 2F52A 4P75A 4A3DG 4WJ4A 1EUJA 1VQDA 4A3LG 1VQ8A 1I94Q 1J5EL 1TWCH 4GN5A 4APVA 1AE2A 1VQAA 4IPGA 2IHEA 3J80c 1XJVA 4R4OA 2ZTCA 5C0XG 1L2FA 2UUAQ 2UUBL 4GLAC 4A3FG 4R1JA 5GAEC 1V43A 1YITA 1VQIA 1QUQA 4A3IH 3PUXA 3HKSA 4IJLA 2QEXA 1Q12A 4DV0L 1Y1VG 5M5YH 2UUCQ 1Q1BA 2H5XA 3PO3G 4A75A 2OTJA 1X54A 2HIVA 4AYBG 3TRZA 3CD6A 5EAYA 3S17H 1LTLA 1EIFA 1PH1A 2JA5G 2DGYA 1VQNA 1VQFA 2I0QA 3G4SA 4LUVA 1JMCA 5LMNQ 1EFWA 1L1OB 4GKKL 2Q2UA 1WOCA 3TQYA 4QJFA 5GAGC 1K9MC 4LF4L 4A3CG 2IX1A 4X6AH 1HR0L 1I5FA 2JJQA 2K14A 4BA1I 4JI7L 5M3MG 1W2BA 3ZJYC 3S1NH 2NN6I 3GTLH 4A3JG 4JC0A 3U50C 1UE6A 1N32L 5LMUL 4POGA 4R4QA 3UDFA 4L5SA 1XTDA 3HOUH 3BZKA 1YHBA 4Y7NH 1HZBA 4A3KH 2YV5A 1CUKA 4HIKA 4DR6L 4C3IH 2CCZA 2JA8G 5AJ3Q 3CXCA 3K7AH 1UE7A 1YBYA 4IJHA 1UWVA 4R4TA 1HZAA 3H0GH 5M3FH 3GTOH 4LF5Q 3H3VI 1NMGA 1XMOQ 1YNXA 4JI6Q 3E9HA 4HJ8A 4A93H 2JA9A 1X65A 4UY8C 2FXQA 4DAYB 1QUQB 4HJAA 2JA7G 4RMFA 2N3SA 1KQSA 2KHIA 3DLLA 2QGQA 4GLXA 4B3ML 2C35B 2CFMA 3PV0A 4JI5L 4EQ5A 1YHAA 1YHQA 4DV1Q 2B63G 2HQLA 4A3FH 1M1KC 1WCMG 3RZOH 5JJKA 2D0OA 3TEHB 1SN8A 4R4IA 2JEAI 1YJ9A 4JI0L 3G6EA 5C44H 1HNZQ 1EQRA 2R6GA 3K0XA 1JB7A 4JBMA 1N33L 2KBNA 4AQYQ 3CCQA 3D31A 4A4IA 2K5HA 1VQEA 1E1OA 2ALYB 1A0IA 3M85A 4A3GH 1HNWL 1CKNB 4C2MH 4JI4Q 1YIJA 1GM5A 4KHPL 2RHSB 4X65L 3W5OA 4MTNA 3GTQH 3KLWA 1YJNA 2K50A 2JQOA 3PCOB 3PIPA 3CC7A 1VQ5A 1XMOL 1EIYB 3AYHB 1EOVA 4DV7L 2R7ZG 2CWAA 4AYBE 5HGQA 4JBKA 1B70B 3AFPA 5IYCH 4OX9L 1A63A 2LXKA 4BXXG 2NZOA 4QIWE 2KCMA 4IPDA 4HIMA 1PH4A 2AWNA 4GNXB 3HOVG 2VS1A 3A5ZB 4TVAB 4JI3L 3CCJA 5FLXc 1K8AC 5JJIA 2MO1A 1KHIA 4O2DA 1X56A 5LMUQ 1E3PA 1BKBA 4YCWA 1XNQL 1DGSA 3W1GA 3EIVA 4B3SL 4P72A 4K0KL 3CAMA 1K0RA 4YY3Q 3F1ZA 4JYAL 3CF5A 5ELNA 4YWKA 1HR0Q 1N34L 2EIFA 3MXNB 4LUZA 3K8AA 2JA6G 1RIPA 4HIOA 2JE6I 4UPAA 4DR4Q 4OWXB 1UEBA 3E0EA 1Q86C 4B3RL 2GN5A 4DR2L 4DV6L 3L0OA 4DR4L 3KOJA 4YHHL 1HZ9A 1JJGA 2D62A 4JOIA 4UP9A 1VQGA 1PA6A 4PZ7A 4LF8L 1D7QA 2Y0SE 5C3EG 3H15A 3KDFB 3CP0A 1N33Q 5IYDH 4DV0Q 1J6QA 2N8NA 2PQAB 1CKNA 4DV2Q 2UUCL 4A3DH 2R92G 2HIXA 2E8GA 1XPUA 2R93G 1NTGA 2NVYH 3CW2C 1Q81C 3NBHB 4L5QA 4A3GG 3NEMA 3I4MG 2GVBA 1OXTA 4OX9Q 1PH3A 4IFDI 3J81j 4LF7Q 3WWVA 2WAQG 1GO3E 4HIDA 1VQCA 1WI5A 1PH5A 3I2ZA 4LWCA 1QVGA 4B3TL 1EWIA 1W3SA 2YTVA 4NXNL 2E5LQ 2BA1A 4DR1Q 3KF6B 4LFAQ 1IBMQ 3S1QH 4DR3L 1I50H 4PZ8A 1S3OA 4GLVB 5AJ3L 4DR6Q 4DUZL 3HFZB 4GKJL 3K7UC 3PUZA 3I55A 2VQEL 1P8LA 2BH8A 2D0PA 3F2CA 3PF5A 2OWOA 3GTKH 2Q2IA 2HT1A 3EN2A 1Q1EA 3CPFA 4FDBA 2QA4A 2UXCL 4PMWA 4IPHA 4X62L 3S16H 4B3TQ 4JI5Q 1MKHA 4RG1A 3BU2A 1K73C 1PH6A 2E2HH 1VQMA 1PYBA 3M7NA 1LM0A 1YJWA 2JA6H 4DR7L 3RLNA 2OQKA 1E1TA 4LNQA 2UXBL 3HOZH 3STBC 2LSSA 1BBWA 2VUMG 3FP9A 1UE1A 2ZTDA 1E24A 3ULJA 2YTYA 2WP8J 2OQ0A 3KJPA 4LF9L 4XTCS 4GOPB 2KHJA 1SFOH 4DPGA 4QQBX 3FKIG 2N49A 5M5WH 1E22A 1CSQA 4O0AA 4NPSA 1Z9FA 3CCMA 2K4KA 5GROA 3OTOQ 1JJ2A 4A3LH 5IYCG 3T1YQ 1UE5A 4BXXH 2RHQB 1O7IA 3KYHC 4P73A 1BVSA 4BY7H 3M3YH 2WB1E 1G291 2AHOB 3D0FA 4L5TA 2MO0A 3U4ZA 4BBRG 3HOWG 1JE5A 1IBKL 2VW9A 3SGIA 1X9NA 2GVAA 5C4XH 1GVPA 4GKKQ 4QGUA 5IP7G 1OXXK 2A8VA 1WJJA 5BR8Q 1IBLQ 3MEFA 3TREA 1QZHA 3B6YA 1N36Q 2WB1G 3HOYG 4B3SQ 2IX0A 2XGTA 1FL0A 4IPCA 2JA5H 4A3BG 3S14H 1M90C 3Q8DA 4YCVA 5FJ8G 4BBSG 1S40A 4NXML 1SLJA 1SR3A 3KJOA 2CQOA 3M4QA 3NENA 4YCUA 4A3KG 3GTJH 4LUOA 1NBWA 2LXJA 4GS3A 4A76A 3CCLA 1PVOA 1LUZA 4DV3Q 2JEBI 4H02A 4A3EG 3S1RH 2E2IH 1AH9A 2HHHQ 2Z0SA 1IL2A 3VDYA 3HOVH 4HJ7A 2OCEA 4YHHQ 1X3FA 3I7FA 3KDFA 5C3EH 1CKOA 4DAMA 2UUAL 2CKZB 3RLOA 1VQ9A 4YWMA 1HR0W 2VQFL 1KD1C 4X65Q 3HOXH 4DR7Q 1PFSA 1KXLA 4Y52H 3UDGA 3U4VA 1VQKA 4GOPA 4LFBQ 1HNWQ 2ZTEA 3AQQA 3LGJA 3K80C 4BA2I 1QZGA 1C7YA 1L0WA 2Q2HA 3CMEA 5JEAG 2ZJQA 4JI0Q 2MFIA 3H0GG 5M3FG 2IT1A 4JI1L 3U58A 2E2JH 3S15H 1T9HA 2KENA 3CQZH 2F3IA 3CC2A 3PO3H 4GKJQ 1PV4A 4JI2Q 1FGUA 1SMXA 3J81i 3TS2A 2K5NA 4HJ5A 2PI2E 4POFA 4OONA 1NE3A 4LFCL 4DR3Q 4P74A 2RCNA 1K8GA 1IBML 5GADC 2V1CC 2E5LL 3T1HQ 1G6PA 4JI6L 1TWHH 3KFUA 1SRUA 1Z47A 1K83H 4IO9A 4LF5L 3GD7A 1PH8A 1U5KA 2I5HA 3GDEA 4DNIA 3J7A5 2Z6KC 4X64Q 1VCIA 4JOIC 3PO2G 1TXYA 2RF4A 1Q46A 3UE0A 5BR8L 5IYBH 2ID0A 1QVCA 3J7ZC 2B3GA 2EQSA 1VQOA 1JJCB 4XIGS 3RLFA 1MJEA 2ZM6Q 4DR5L 1HNXQ 4BBSH 2VY3A 2VZAA 2BA0A 5GAHC 2JA7H 4L5RC 4B3MQ 5FLMH 2EXDA 1XNRQ 1JT8A 4JI7Q 4LFBL 1NY4A 2UXDQ 2JA8H 1Y1WH 1HJPA 4LF8Q 1VQPA 3DM3A 1B7YB 3J80i 4GNXC 4LF4Q 3CCRA 4OWTB 3PO2H 1H95A 4DV5L 1TWFH 3FKIH 1CSPA 4DR2Q 1S72A 3ULLA 3TS0A 2PQAA 2YYZA 4A93G 4LF9Q 1SE8A 4ME3A 3H3VH 4A3JH 1X6OA 2PMZE 1PH9A 5M5XH 4MZ9A 3M4PA 3IRBA 4UP8A 4YY3L 2AKWB 3ERSX 4KI0A 3PUYA 2N78A 2UXBQ 1OXSC 2YTXA 2F4VL 3HOWH 4MNOA 4LF6L 1V9PA 1FJGQ 1V1QA 3A5UA 1A8VA 4C3HH 4DUYQ 4HJ9A 3HOZG 3EBEA 2AMCB 1VQBA 4X62Q 3GO5A 3K81C 5C0XJ 3I56A 1J5EQ 3I4NH 1MIUA 5E7NA 3CPWA 4AIMA 4R4CA 3S2DH 3PUVA 3PF4A 1EYGA 3STBD 3RZDH 4DKAC 1OXUA 3I4OA 1XMQQ 3CMAA 1I6HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASY A;  3KF6 A;  2NVT H;  3CCS A;  4ALP A;  4JI4 L;  2Q2T A;  4DR1 L;  4GNX A;  4NXN Q;  4A3I G;  3I4N G;  2MNA A;  3OW2 A;  1X3G A;  1HNZ L;  2ATW A;  1C0A A;  4A3C H;  2KCT A;  1KRT A;  2R7D A;  3PIO A;  4JV5 L;  1FVI A;  2UUB Q;  1TWA H;  1NJI C;  4JI2 L;  3KF8 B;  1X55 A;  1PH7 A;  2B63 H;  3PSI A;  3RR5 A;  4A3B H;  3F8T A;  4DUY L;  3RNU A;  3PGZ A;  2UU9 Q;  3GTP H;  4BY7 G;  4IFD J;  3G71 A;  5IP9 H;  4DV4 Q;  3ICE A;  1VS0 A;  3W1B A;  5C44 G;  4LF6 Q;  4IFD G;  1RL2 A;  3RN5 A;  5C4X G;  1PYS B;  4PG3 A;  4DK3 C;  4OXP A;  5IP7 H;  2YU9 H;  5M3M H;  5LMN W;  2UXC Q;  1Q82 C;  2IHF A;  3HOY H;  3ULP A;  3G48 A;  1IXR A;  2K52 A;  3M9B A;  4BY1 G;  3UE1 A;  1HH2 P;  3BZC A;  3UDI A;  4X66 Q;  3F2B A;  1VQ4 A;  2ASB A;  3GTG H;  1YZ6 A;  5GQO A;  5IYD G;  4DV6 Q;  4IOC A;  1KRS A;  4DUZ Q;  1GD7 A;  1N8R C;  3JC6 6;  1PHJ A;  5IP9 G;  1ASZ A;  1XPR A;  2ES2 A;  1N34 Q;  3CC4 A;  1N32 Q;  1IZ6 A;  1VQH A;  1QVF A;  4JYA Q;  4DV3 L;  4K0K Q;  1NMF A;  2NZH A;  1YI2 A;  1AE3 A;  4OWW B;  5IWA Q;  5IYB G;  1XNQ Q;  2AWO A;  2ZJR A;  3E9I A;  4JCV E;  2R7F A;  5IT9 c;  4BY1 H;  1SRO A;  4IOA A;  2L15 A;  3OYY A;  4JI8 L;  3HOX G;  4GOP C;  1HNX L;  2ZM6 L;  4DR5 Q;  1FJG L;  2NN6 G;  3GTM H;  2F4V Q;  1L1O A;  5JEA J;  1VQL A;  4KLK A;  1X3E A;  5LMN L;  5FLM G;  4JI3 Q;  1WFQ A;  4GN4 B;  1WCM H;  3AEV A;  1N9W A;  1K3R A;  3UDX A;  1PH2 A;  2NVQ H;  2R92 H;  1Q7Y C;  4DV2 L;  2B29 A;  1IBK Q;  2PI2 A;  3PUW A;  4DV7 Q;  5IWA L;  3HOU G;  2A19 A;  3FHW A;  3J81 c;  2I5L X;  4DV5 Q;  3T1H L;  1TWG H;  1WYD A;  3JAM c;  1LYL A;  1B8A A;  1XPO A;  3T1Y L;  4KHP Q;  4A3M G;  3S24 A;  5ELO A;  1VQJ A;  2VL6 A;  3OTO L;  1VQ7 A;  4LFC Q;  1MJC A;  2UXD L;  4QL5 A;  2Z6K A;  1A62 A;  1XNR L;  4JBJ A;  4AQY L;  1KAW A;  4B3R Q;  1YVC A;  5C0X I;  1G51 A;  1GKH A;  1I94 L;  4JI1 Q;  1I3Q H;  4X66 L;  4P71 A;  1EQQ A;  4LW1 A;  1L1O C;  2R93 H;  2JK8 A;  2ZJP A;  1E7Z A;  3AFQ A;  4KHZ A;  4UP7 A;  4J15 A;  3JAM i;  3M4O H;  1U0L A;  4DV1 L;  4DK6 C;  2I5M X;  3CCV A;  4YWL A;  1KC8 C;  4WJ3 M;  4X64 L;  5DLQ E;  2DUD A;  2VUM H;  4A3M H;  3I4M H;  4JI8 Q;  2K75 A;  3A0J A;  1VQ6 A;  3RN2 A;  1R9T H;  2K5V A;  2UU9 L;  3A74 A;  2Y0S G;  3L7Z C;  2NVX H;  5JJL A;  1Y14 B;  1KIX A;  2VQF Q;  1OXV A;  1OTC A;  2OTL A;  4AH6 A;  5IE8 A;  4PZ6 A;  1IYJ B;  1CKM A;  2A1A A;  1Q8K A;  2MQH A;  4JV5 Q;  2CWP A;  2IY5 B;  1Y1W G;  3BJU A;  3HKZ E;  4GN3 B;  5FJ8 H;  4QY7 A;  2HHH L;  2BH2 A;  3F2D A;  5HY6 A;  4OO1 I;  3HKZ G;  1D8L A;  1P16 A;  2VQE Q;  4BBR H;  4EX5 A;  5K36 G;  4NB3 A;  2R7Z H;  4TQU S;  5C4J H;  1IBL L;  4A3E H;  3S2H H;  4NXM Q;  3NEL A;  1BBU A;  4JBW A;  2PNH A;  4JG2 A;  5J3B A;  5IY0 A;  4OO1 G;  3ER0 A;  4LFA L;  2VNU D;  1C9O A;  1HZC A;  2WAQ E;  3S1M H;  2WFW A;  1XMQ L;  2XTI A;  3CCE A;  3CCU A;  1N36 L;  1Y1V H;  4C3J H;  1KL9 A;  1YEZ A;  4LF7 L;  5H1S E;  3L2P A;  4DV4 L;  2F52 A;  4P75 A;  4A3D G;  4WJ4 A;  1EUJ A;  1VQD A;  4A3L G;  1VQ8 A;  1I94 Q;  1J5E L;  1TWC H;  4GN5 A;  4APV A;  1AE2 A;  1VQA A;  4IPG A;  2IHE A;  3J80 c;  1XJV A;  4R4O A;  2ZTC A;  5C0X G;  1L2F A;  2UUA Q;  2UUB L;  4GLA C;  4A3F G;  4R1J A;  5GAE C;  1V43 A;  1YIT A;  1VQI A;  1QUQ A;  4A3I H;  3PUX A;  3HKS A;  4IJL A;  2QEX A;  1Q12 A;  4DV0 L;  1Y1V G;  5M5Y H;  2UUC Q;  1Q1B A;  2H5X A;  3PO3 G;  4A75 A;  2OTJ A;  1X54 A;  2HIV A;  4AYB G;  3TRZ A;  3CD6 A;  5EAY A;  3S17 H;  1LTL A;  1EIF A;  1PH1 A;  2JA5 G;  2DGY A;  1VQN A;  1VQF A;  2I0Q A;  3G4S A;  4LUV A;  1JMC A;  5LMN Q;  1EFW A;  1L1O B;  4GKK L;  2Q2U A;  1WOC A;  3TQY A;  4QJF A;  5GAG C;  1K9M C;  4LF4 L;  4A3C G;  2IX1 A;  4X6A H;  1HR0 L;  1I5F A;  2JJQ A;  2K14 A;  4BA1 I;  4JI7 L;  5M3M G;  1W2B A;  3ZJY C;  3S1N H;  2NN6 I;  3GTL H;  4A3J G;  4JC0 A;  3U50 C;  1UE6 A;  1N32 L;  5LMU L;  4POG A;  4R4Q A;  3UDF A;  4L5S A;  1XTD A;  3HOU H;  3BZK A;  1YHB A;  4Y7N H;  1HZB A;  4A3K H;  2YV5 A;  1CUK A;  4HIK A;  4DR6 L;  4C3I H;  2CCZ A;  2JA8 G;  5AJ3 Q;  3CXC A;  3K7A H;  1UE7 A;  1YBY A;  4IJH A;  1UWV A;  4R4T A;  1HZA A;  3H0G H;  5M3F H;  3GTO H;  4LF5 Q;  3H3V I;  1NMG A;  1XMO Q;  1YNX A;  4JI6 Q;  3E9H A;  4HJ8 A;  4A93 H;  2JA9 A;  1X65 A;  4UY8 C;  2FXQ A;  4DAY B;  1QUQ B;  4HJA A;  2JA7 G;  4RMF A;  2N3S A;  1KQS A;  2KHI A;  3DLL A;  2QGQ A;  4GLX A;  4B3M L;  2C35 B;  2CFM A;  3PV0 A;  4JI5 L;  4EQ5 A;  1YHA A;  1YHQ A;  4DV1 Q;  2B63 G;  2HQL A;  4A3F H;  1M1K C;  1WCM G;  3RZO H;  5JJK A;  2D0O A;  3TEH B;  1SN8 A;  4R4I A;  2JEA I;  1YJ9 A;  4JI0 L;  3G6E A;  5C44 H;  1HNZ Q;  1EQR A;  2R6G A;  3K0X A;  1JB7 A;  4JBM A;  1N33 L;  2KBN A;  4AQY Q;  3CCQ A;  3D31 A;  4A4I A;  2K5H A;  1VQE A;  1E1O A;  2ALY B;  1A0I A;  3M85 A;  4A3G H;  1HNW L;  1CKN B;  4C2M H;  4JI4 Q;  1YIJ A;  1GM5 A;  4KHP L;  2RHS B;  4X65 L;  3W5O A;  4MTN A;  3GTQ H;  3KLW A;  1YJN A;  2K50 A;  2JQO A;  3PCO B;  3PIP A;  3CC7 A;  1VQ5 A;  1XMO L;  1EIY B;  3AYH B;  1EOV A;  4DV7 L;  2R7Z G;  2CWA A;  4AYB E;  5HGQ A;  4JBK A;  1B70 B;  3AFP A;  5IYC H;  4OX9 L;  1A63 A;  2LXK A;  4BXX G;  2NZO A;  4QIW E;  2KCM A;  4IPD A;  4HIM A;  1PH4 A;  2AWN A;  4GNX B;  3HOV G;  2VS1 A;  3A5Z B;  4TVA B;  4JI3 L;  3CCJ A;  5FLX c;  1K8A C;  5JJI A;  2MO1 A;  1KHI A;  4O2D A;  1X56 A;  5LMU Q;  1E3P A;  1BKB A;  4YCW A;  1XNQ L;  1DGS A;  3W1G A;  3EIV A;  4B3S L;  4P72 A;  4K0K L;  3CAM A;  1K0R A;  4YY3 Q;  3F1Z A;  4JYA L;  3CF5 A;  5ELN A;  4YWK A;  1HR0 Q;  1N34 L;  2EIF A;  3MXN B;  4LUZ A;  3K8A A;  2JA6 G;  1RIP A;  4HIO A;  2JE6 I;  4UPA A;  4DR4 Q;  4OWX B;  1UEB A;  3E0E A;  1Q86 C;  4B3R L;  2GN5 A;  4DR2 L;  4DV6 L;  3L0O A;  4DR4 L;  3KOJ A;  4YHH L;  1HZ9 A;  1JJG A;  2D62 A;  4JOI A;  4UP9 A;  1VQG A;  1PA6 A;  4PZ7 A;  4LF8 L;  1D7Q A;  2Y0S E;  5C3E G;  3H15 A;  3KDF B;  3CP0 A;  1N33 Q;  5IYD H;  4DV0 Q;  1J6Q A;  2N8N A;  2PQA B;  1CKN A;  4DV2 Q;  2UUC L;  4A3D H;  2R92 G;  2HIX A;  2E8G A;  1XPU A;  2R93 G;  1NTG A;  2NVY H;  3CW2 C;  1Q81 C;  3NBH B;  4L5Q A;  4A3G G;  3NEM A;  3I4M G;  2GVB A;  1OXT A;  4OX9 Q;  1PH3 A;  4IFD I;  3J81 j;  4LF7 Q;  3WWV A;  2WAQ G;  1GO3 E;  4HID A;  1VQC A;  1WI5 A;  1PH5 A;  3I2Z A;  4LWC A;  1QVG A;  4B3T L;  1EWI A;  1W3S A;  2YTV A;  4NXN L;  2E5L Q;  2BA1 A;  4DR1 Q;  3KF6 B;  4LFA Q;  1IBM Q;  3S1Q H;  4DR3 L;  1I50 H;  4PZ8 A;  1S3O A;  4GLV B;  5AJ3 L;  4DR6 Q;  4DUZ L;  3HFZ B;  4GKJ L;  3K7U C;  3PUZ A;  3I55 A;  2VQE L;  1P8L A;  2BH8 A;  2D0P A;  3F2C A;  3PF5 A;  2OWO A;  3GTK H;  2Q2I A;  2HT1 A;  3EN2 A;  1Q1E A;  3CPF A;  4FDB A;  2QA4 A;  2UXC L;  4PMW A;  4IPH A;  4X62 L;  3S16 H;  4B3T Q;  4JI5 Q;  1MKH A;  4RG1 A;  3BU2 A;  1K73 C;  1PH6 A;  2E2H H;  1VQM A;  1PYB A;  3M7N A;  1LM0 A;  1YJW A;  2JA6 H;  4DR7 L;  3RLN A;  2OQK A;  1E1T A;  4LNQ A;  2UXB L;  3HOZ H;  3STB C;  2LSS A;  1BBW A;  2VUM G;  3FP9 A;  1UE1 A;  2ZTD A;  1E24 A;  3ULJ A;  2YTY A;  2WP8 J;  2OQ0 A;  3KJP A;  4LF9 L;  4XTC S;  4GOP B;  2KHJ A;  1SFO H;  4DPG A;  4QQB X;  3FKI G;  2N49 A;  5M5W H;  1E22 A;  1CSQ A;  4O0A A;  4NPS A;  1Z9F A;  3CCM A;  2K4K A;  5GRO A;  3OTO Q;  1JJ2 A;  4A3L H;  5IYC G;  3T1Y Q;  1UE5 A;  4BXX H;  2RHQ B;  1O7I A;  3KYH C;  4P73 A;  1BVS A;  4BY7 H;  3M3Y H;  2WB1 E;  1G29 1;  2AHO B;  3D0F A;  4L5T A;  2MO0 A;  3U4Z A;  4BBR G;  3HOW G;  1JE5 A;  1IBK L;  2VW9 A;  3SGI A;  1X9N A;  2GVA A;  5C4X H;  1GVP A;  4GKK Q;  4QGU A;  5IP7 G;  1OXX K;  2A8V A;  1WJJ A;  5BR8 Q;  1IBL Q;  3MEF A;  3TRE A;  1QZH A;  3B6Y A;  1N36 Q;  2WB1 G;  3HOY G;  4B3S Q;  2IX0 A;  2XGT A;  1FL0 A;  4IPC A;  2JA5 H;  4A3B G;  3S14 H;  1M90 C;  3Q8D A;  4YCV A;  5FJ8 G;  4BBS G;  1S40 A;  4NXM L;  1SLJ A;  1SR3 A;  3KJO A;  2CQO A;  3M4Q A;  3NEN A;  4YCU A;  4A3K G;  3GTJ H;  4LUO A;  1NBW A;  2LXJ A;  4GS3 A;  4A76 A;  3CCL A;  1PVO A;  1LUZ A;  4DV3 Q;  2JEB I;  4H02 A;  4A3E G;  3S1R H;  2E2I H;  1AH9 A;  2HHH Q;  2Z0S A;  1IL2 A;  3VDY A;  3HOV H;  4HJ7 A;  2OCE A;  4YHH Q;  1X3F A;  3I7F A;  3KDF A;  5C3E H;  1CKO A;  4DAM A;  2UUA L;  2CKZ B;  3RLO A;  1VQ9 A;  4YWM A;  1HR0 W;  2VQF L;  1KD1 C;  4X65 Q;  3HOX H;  4DR7 Q;  1PFS A;  1KXL A;  4Y52 H;  3UDG A;  3U4V A;  1VQK A;  4GOP A;  4LFB Q;  1HNW Q;  2ZTE A;  3AQQ A;  3LGJ A;  3K80 C;  4BA2 I;  1QZG A;  1C7Y A;  1L0W A;  2Q2H A;  3CME A;  5JEA G;  2ZJQ A;  4JI0 Q;  2MFI A;  3H0G G;  5M3F G;  2IT1 A;  4JI1 L;  3U58 A;  2E2J H;  3S15 H;  1T9H A;  2KEN A;  3CQZ H;  2F3I A;  3CC2 A;  3PO3 H;  4GKJ Q;  1PV4 A;  4JI2 Q;  1FGU A;  1SMX A;  3J81 i;  3TS2 A;  2K5N A;  4HJ5 A;  2PI2 E;  4POF A;  4OON A;  1NE3 A;  4LFC L;  4DR3 Q;  4P74 A;  2RCN A;  1K8G A;  1IBM L;  5GAD C;  2V1C C;  2E5L L;  3T1H Q;  1G6P A;  4JI6 L;  1TWH H;  3KFU A;  1SRU A;  1Z47 A;  1K83 H;  4IO9 A;  4LF5 L;  3GD7 A;  1PH8 A;  1U5K A;  2I5H A;  3GDE A;  4DNI A;  3J7A 5;  2Z6K C;  4X64 Q;  1VCI A;  4JOI C;  3PO2 G;  1TXY A;  2RF4 A;  1Q46 A;  3UE0 A;  5BR8 L;  5IYB H;  2ID0 A;  1QVC A;  3J7Z C;  2B3G A;  2EQS A;  1VQO A;  1JJC B;  4XIG S;  3RLF A;  1MJE A;  2ZM6 Q;  4DR5 L;  1HNX Q;  4BBS H;  2VY3 A;  2VZA A;  2BA0 A;  5GAH C;  2JA7 H;  4L5R C;  4B3M Q;  5FLM H;  2EXD A;  1XNR Q;  1JT8 A;  4JI7 Q;  4LFB L;  1NY4 A;  2UXD Q;  2JA8 H;  1Y1W H;  1HJP A;  4LF8 Q;  1VQP A;  3DM3 A;  1B7Y B;  3J80 i;  4GNX C;  4LF4 Q;  3CCR A;  4OWT B;  3PO2 H;  1H95 A;  4DV5 L;  1TWF H;  3FKI H;  1CSP A;  4DR2 Q;  1S72 A;  3ULL A;  3TS0 A;  2PQA A;  2YYZ A;  4A93 G;  4LF9 Q;  1SE8 A;  4ME3 A;  3H3V H;  4A3J H;  1X6O A;  2PMZ E;  1PH9 A;  5M5X H;  4MZ9 A;  3M4P A;  3IRB A;  4UP8 A;  4YY3 L;  2AKW B;  3ERS X;  4KI0 A;  3PUY A;  2N78 A;  2UXB Q;  1OXS C;  2YTX A;  2F4V L;  3HOW H;  4MNO A;  4LF6 L;  1V9P A;  1FJG Q;  1V1Q A;  3A5U A;  1A8V A;  4C3H H;  4DUY Q;  4HJ9 A;  3HOZ G;  3EBE A;  2AMC B;  1VQB A;  4X62 Q;  3GO5 A;  3K81 C;  5C0X J;  3I56 A;  1J5E Q;  3I4N H;  1MIU A;  5E7N A;  3CPW A;  4AIM A;  4R4C A;  3S2D H;  3PUV A;  3PF4 A;  1EYG A;  3STB D;  3RZD H;  4DKA C;  1OXU A;  3I4O A;  1XMQ Q;  3CMA A;  1I6H H; 
#chains in the Genus database with same CATH topology
 2EOT A;  4C3I G;  4KY5 A;  4ALP A;  4CDE C;  4DR1 L;  4F88 A;  3S16 B;  3H91 A;  1C0A A;  1QNK A;  1STA A;  4XQQ A;  2KCT A;  4JV5 L;  5NUC A;  3VYR A;  4A3E B;  5LL6 S;  1NJI C;  1X55 A;  3PSI A;  2WKD A;  3F8T A;  3GTP H;  5COR A;  4DAY A;  5IP9 H;  3V96 A;  5D65 A;  2O4X A;  4XDX A;  1A3U A;  4N8F A;  5C4X G;  1K8M A;  1PYS B;  2YU9 H;  5LMN W;  1XWE A;  2UXC Q;  3K59 A;  1PZI D;  3M9B A;  4FF2 A;  1TWG B;  1GXD C;  1VQ4 A;  3S1R B;  3NWT A;  2DNE A;  5GQO A;  4DV6 Q;  1GD7 A;  3V05 A;  2ES2 A;  2EJM A;  4DV3 L;  5KIX A;  2NZH A;  3R8B A;  1AE3 A;  4OWW B;  2NYZ D;  1LTS D;  1XNQ Q;  1MSG A;  1SYG A;  2AWO A;  4BY1 H;  4JCV E;  2R7F A;  2HD3 A;  3OYY A;  3HOX G;  4JI8 L;  1C4Q A;  2ZM6 L;  2F4V Q;  4X3T A;  1I4R A;  5JEA J;  3NTI A;  1X3E A;  4KLK A;  4JI3 Q;  1NSN S;  3QB3 A;  4GN4 B;  3AEV A;  3MXP A;  1JOR A;  2PI2 A;  3FHW A;  4K8I A;  3VYU A;  1WYD A;  3HOU B;  4B08 A;  3T1Y L;  3FPU B;  2UXD L;  1F2Y A;  3C2P A;  2XNA C;  1YVC A;  5HUR A;  2JK8 A;  1E7Z A;  2A68 D;  4UP7 A;  4J15 A;  1U0L A;  4DK6 C;  1B4O A;  3CCV A;  4YWL A;  4WJ3 M;  3OWE B;  1ZXT A;  2JA7 B;  1G2T A;  3A0J A;  1FNU A;  1Y8N B;  2NVY B;  2K5V A;  1JE4 A;  1PFN A;  2Y0S G;  2GA4 B;  1Y14 B;  2XSC A;  1KIX A;  1IYU A;  4ZRZ A;  1SYF A;  5IE8 A;  1SE4 A;  5CR3 A;  4JV5 Q;  1Y1W G;  4GN3 B;  2K1B A;  3FKI B;  2HHH L;  4ABN A;  1DZ1 A;  3HKZ G;  1P16 A;  2F4I A;  4PMC A;  4BBR H;  4A3E H;  3NEL A;  1BXT A;  4LFA L;  4G4K A;  5HGT A;  1HZC A;  4M8A A;  3S1M H;  2WFW A;  2XN9 C;  2XTI A;  4XQJ A;  3CCU A;  1CA6 A;  2K32 A;  4IUP A;  5H1S E;  1XTC D;  4DV4 L;  2L11 A;  1IL8 A;  5CV8 A;  1VQD A;  1NAP A;  1VQ8 A;  1TWC H;  1XJV A;  2IHE A;  4R4O A;  2ZTC A;  4K2K A;  2UUB L;  1I4G A;  2AUK A;  1YIT A;  1VQI A;  1UAP A;  3I72 A;  3PUX A;  2EVB A;  4IJL A;  1Y1V G;  4HMI A;  2H5X A;  2OTJ A;  5EAY A;  3OWF A;  1EIF A;  5EGT A;  1HFN A;  1VQN A;  1E2V A;  2SEB D;  1VMC A;  3CHB D;  1EFW A;  1E2Z A;  2Q2U A;  1VDZ A;  5GAG C;  4A3C G;  2JJQ A;  4BA1 I;  4J1M A;  1W2B A;  2NN6 I;  2RVL A;  4A3J G;  5I4D A;  2AQ1 B;  1UE6 A;  3S1N B;  4KY6 A;  1CHQ D;  4A3K H;  2J0T D;  1H9J A;  4C3I H;  2CCZ A;  2SNM A;  1S4Z A;  4K5W A;  1CT1 D;  3O13 A;  2H1E A;  2N55 A;  4JI6 Q;  2KJX A;  1G2S A;  4UY8 C;  4JW0 A;  5D3I B;  1D5M C;  2EYO A;  4QF4 A;  2K03 A;  4N9T A;  4JI5 L;  2B39 A;  3MFG A;  4EQ5 A;  3ITP A;  4DV1 Q;  4BY1 B;  2HQL A;  1EZ8 A;  3RZO H;  2D0O A;  1SN8 A;  1RTN A;  3G6E A;  3Q6S A;  2RQX A;  3J80 L;  4JBM A;  1AEX A;  3E5S A;  3QWN A;  4ZUI A;  3P1H A;  2ALY B;  2F0I A;  3J81 L;  1S5B D;  2QDL A;  4XXE A;  4KHP L;  4MTN A;  4KJN A;  2EY2 A;  1VQ5 A;  1EIY B;  1ICW A;  5HGQ A;  4JBK A;  1A63 A;  2LXK A;  4IPD A;  1PH4 A;  3DUZ A;  1TKW B;  5AFW A;  4O42 A;  1BOS A;  1TWA B;  2ICI A;  1STE A;  1TY0 A;  5JJI A;  2MO1 A;  4U67 3;  2QF7 A;  2ICE C;  2JP1 A;  2B63 B;  5LMU Q;  3NP8 A;  1E3P A;  4YCW A;  2HQE A;  3OPO A;  1DGS A;  4HTH A;  3KBX A;  5FO8 B;  3FDT A;  3CRL C;  3F1Z A;  1CTM A;  2MHV A;  2L1B A;  4C3I B;  4DR2 L;  5M5Y B;  4YHH L;  1QJO A;  2D62 A;  2NN6 H;  4LF8 L;  2F3V A;  2K01 A;  3EQL C;  1PYW D;  3BG3 A;  3C1F A;  3CP0 A;  1SNM A;  1N33 Q;  5IYD H;  1EL0 A;  2PQA B;  4A3D H;  1HCZ A;  3JAM L;  3NQT A;  4CDC C;  1KNE A;  4OL7 A;  5EJW A;  5DM6 3;  3HOW B;  3NBH B;  2CH4 W;  1JWU D;  1TS5 A;  2F0K A;  3DEP A;  1SMY D;  2Y0S B;  1ICF B;  2YU9 B;  1A15 A;  2A6H C;  4XT3 B;  2CVR A;  1VQC A;  2B2T C;  2SNS A;  4O1N A;  1IHZ A;  1I50 H;  5AJ3 L;  4XYO A;  4UAI A;  1HA6 A;  4G7H C;  1AZQ A;  3TP7 A;  3F2C A;  1JWS D;  5G3L F;  4L63 B;  4C3J B;  4FDB A;  2QA4 A;  1LO5 D;  3TME A;  3A56 A;  3KUP A;  4BBS B;  3E6Z X;  5C44 B;  1PYB A;  3GTM B;  3DM1 A;  2JA6 H;  4CGY B;  4LNQ A;  1ONL A;  3NWS A;  1BO0 A;  3AMU A;  1BBW A;  3SR1 A;  3MXU A;  1AW7 A;  2B2T A;  1E24 A;  2XRS D;  3EVQ A;  4EGV A;  1UUP A;  2HDM A;  1GUO A;  4XTC S;  4DPG A;  4C3J G;  5M5W H;  1RKN A;  1CSQ A;  4MN3 A;  3BVG A;  3OTO Q;  2TSS A;  2RHQ B;  1BVS A;  4M1U B;  2WB1 E;  1IBK L;  2NWG A;  3SGI A;  4C3H G;  1X9N A;  5C4X H;  4GKK Q;  1OXX K;  1WJJ A;  2NTS A;  5J39 A;  2M9V A;  1QWY A;  2WB1 G;  5C4X B;  3WOF A;  2JA5 H;  1O7L A;  2WIN B;  2WII B;  4KMU C;  1I4P A;  2XVS A;  3M4Q A;  4IN3 A;  3NEN A;  5C4Z A;  4A3K G;  1NBW A;  3CCL A;  3GTO B;  1D1I A;  3R2T A;  2NZ1 D;  4A3E G;  2E2I H;  2BDO A;  1IL2 A;  3HOV H;  2B2V A;  2OCE A;  1ZEQ X;  5E4X A;  1CKO A;  4I7Z C;  1R4P B;  4YWM A;  1HR0 W;  3HOX H;  1KXL A;  1VQK A;  3U4V A;  1NR4 A;  5EPL A;  2KVM A;  4LFB Q;  1HNW Q;  2ZTE A;  2HCI A;  3AQQ A;  2ZXR A;  3K80 C;  4FO2 A;  1KDB A;  4K5X A;  3SDZ A;  4FXG C;  1C7Y A;  4PNY A;  4IUU A;  2MFI A;  3H0G G;  5M3F G;  3U58 A;  4A3M B;  1PV4 A;  4JI2 Q;  1SMX A;  1DOM A;  2K5N A;  4POF A;  3BZD B;  5G3L D;  3GTK B;  1SNO A;  1JIC A;  1IKM A;  2MUY A;  2FHT A;  4JI6 L;  3BDO A;  4H44 C;  4LF5 L;  5IT9 L;  2Q8R E;  2CW0 C;  2Z6K C;  1LTI D;  3PO2 G;  4F87 A;  2RF4 A;  1F77 A;  1Q82 C;  3J7Z C;  3RLF A;  2EY1 A;  4DR5 L;  2L12 A;  1O7Z A;  2VY3 A;  2BA0 A;  2OEO A;  1B2T A;  2A69 C;  1BUV T;  5IGE A;  4ID6 A;  3QOJ A;  2J4X A;  5FLM H;  4JI7 Q;  4LFB L;  2AQ2 B;  5CV9 A;  5I6Y A;  2F0W A;  1Y1W H;  2EYM A;  4GNX C;  1WTX A;  3CCR A;  4OWT B;  4QB4 A;  1S72 A;  1LT4 D;  1PRT F;  2PQA A;  4LF9 Q;  1SE8 A;  5I2Y A;  2K5W A;  4UP8 A;  2YTX A;  4MNO A;  3M3Y B;  3SEB A;  1SYB A;  1EY0 A;  4C3H H;  1TS3 A;  3M4Y A;  1EQT A;  3QG1 A;  4XT1 B;  1IW7 D;  5L37 A;  4X62 Q;  3K81 C;  2OF1 A;  5E7N A;  3S2D H;  2JXM B;  4AIM A;  3PF4 A;  5IGB A;  5KNB A;  4DKA C;  1OXU A;  3L9A X;  3I4O A;  2G9H D;  1JOO A;  3HRZ C;  3Q23 A;  1I6H H;  1ASY A;  1SNP A;  2NVT H;  1DCZ A;  4J6H A;  4JI4 L;  2Q2T A;  2L0C A;  5EQ0 A;  2F0H A;  4A3I G;  4NXN Q;  2CH4 A;  2ZT9 C;  2FFK B;  3I4N G;  2MNA A;  2EYJ A;  3OW2 A;  1X3G A;  4A3C H;  2R7D A;  1Y1V B;  2FMC A;  3ERO A;  1LT3 D;  4JI2 L;  1U4P A;  3KF8 B;  2QKI C;  4H0L C;  2B63 H;  3RR5 A;  2RDH A;  2LFN A;  1FYC A;  3ICE A;  3W1B A;  1KLU D;  5C44 G;  4IFD G;  2SOB A;  5I2X A;  2Z9H A;  4HR7 B;  4NMZ A;  4DK3 C;  1JOQ A;  4JVZ A;  4DXF A;  5M3M H;  1MBY A;  3HOY H;  3G48 A;  2PPB C;  3UDI A;  4X66 Q;  1U4M A;  1LTG D;  3GTG H;  5IYD G;  3TP6 A;  1KRS A;  1ILQ A;  1IW7 C;  3JC6 6;  4DF7 A;  3N6R A;  4ULL A;  3H3V C;  1N34 Q;  2FIN B;  3CC4 A;  3RMH A;  3NK9 A;  1YI2 A;  3S2H B;  2L55 A;  1V1O A;  4IUT A;  1E2W A;  5IT9 c;  1HNX L;  1FJG L;  1BCP F;  3VYS A;  3GTM H;  1CQF A;  3HEJ A;  1L1O A;  5FLM G;  4DA2 A;  1WCM H;  1PH2 A;  4FF4 A;  1WTV A;  1Q7Y C;  4HSV A;  2B29 A;  1IBK Q;  4DV7 Q;  5IWA L;  1H9K A;  2NVQ B;  4DV5 Q;  5FLX E;  3AU7 A;  5ELO A;  1VQJ A;  2VL6 A;  3OTO L;  1VQ7 A;  1ENA A;  1G8Z D;  2Z6K A;  1A62 A;  4JBJ A;  3ZYY X;  4P71 A;  4IQZ A;  4LW1 A;  1L1O C;  2R93 H;  1DON A;  3M4O H;  4NP5 A;  4DV1 L;  1ML0 D;  1NNX A;  4KKT A;  1WVL A;  4C3H B;  3D6W A;  4OEL B;  1XXG A;  1PTO F;  4X64 L;  5DLQ E;  5K36 H;  2DNC A;  1MSH A;  4A3M H;  3I4M H;  2K75 A;  1FGB D;  1R9T H;  2RBM A;  2UU9 L;  3A74 A;  3L7Z C;  5JJL A;  4DK1 A;  1F9P A;  1DD2 A;  2WV6 D;  1OXV A;  2LY7 A;  2OTL A;  4AH6 A;  1IYJ B;  2MQH A;  1Q8K A;  2FMM A;  2IY5 B;  2CWP A;  3HKZ E;  5FJ8 H;  2IX3 A;  4QY7 A;  1EYD A;  4OO1 I;  1D8L A;  1QCB D;  2VQE Q;  5KYI A;  4TQU S;  5C3E B;  3K0Y A;  5IY0 A;  1BBU A;  3D3R A;  4JBW A;  2MP1 A;  4OO1 G;  1EU3 A;  1S5D D;  1V1P B;  3CCE A;  2KHS A;  5FK9 C;  4WJ4 A;  2K5Q A;  1YNN C;  4APV A;  3HOY B;  4IPG A;  1L2F A;  2UUA Q;  5I9P A;  1V43 A;  3I91 A;  3F2U A;  4FP5 D;  3RZD B;  4IZ8 A;  1Q12 A;  2UUC Q;  1Q1B A;  3PO3 G;  4A75 A;  1HA5 A;  3S17 H;  4OEM B;  1VQF A;  2KEE A;  2I0Q A;  3G4S A;  1T5X D;  2BOS A;  3DMU A;  4LUV A;  4PV1 C;  3T56 B;  1L1O B;  4EQO A;  3TQY A;  1K9M C;  2IX1 A;  2VUM B;  2Z8L A;  1HR0 L;  2AUJ D;  4JI7 L;  3S1N H;  1PXU A;  4G7O C;  3U50 C;  5CV6 A;  5LL6 X;  1N32 L;  4POG A;  3C3L A;  3UDF A;  4F8M A;  1FNV A;  3I70 A;  4RGO S;  4KY7 A;  2YV5 A;  3T13 A;  2D9U A;  2OT2 A;  1EYC A;  1UE7 A;  4Q5V A;  4IJH A;  1UWV A;  4TSS A;  5KEE A;  5IT9 E;  1NMG A;  1XMO Q;  2F03 A;  1B1Z A;  3X3N A;  4XYQ A;  2FXQ A;  1DYQ A;  2KHI A;  3DLL A;  4GLX A;  2CFM A;  4BY7 G;  3KF8 A;  2B63 G;  4R4I A;  2JEA I;  3FRP B;  1YJ9 A;  5C44 H;  1SMY C;  3BYY B;  2N88 A;  3HZX A;  3K0X A;  4S3S A;  2KBN A;  1AN8 A;  1HTL D;  3IL8 A;  3M85 A;  4A3G H;  1A0I A;  3UI2 A;  1PRT D;  1WTP A;  1SJE D;  1GM5 A;  4X65 L;  1GHK A;  3I4L A;  2K50 A;  3MEH A;  3PIP A;  3D4W A;  1XMO L;  4WOR A;  4G57 A;  3AYH B;  4DFA A;  1EOV A;  5M5X B;  1DJR D;  2RSO A;  5IYC H;  2WAC A;  4HIM A;  3VR2 A;  3A5Z B;  3FVQ A;  4TVA B;  5FLX c;  1KHI A;  1Z6H A;  1EIH A;  1PMR A;  3C46 A;  1I6V C;  4P72 A;  4K0K L;  3CAM A;  4YY3 Q;  5ELN A;  5CBA E;  1HR0 Q;  3PO3 B;  3MXN B;  5KYL A;  1D2B A;  4LUZ A;  1EY6 A;  1CZW A;  2D5D A;  1RIP A;  2JE6 I;  4DR4 Q;  5BN5 A;  5CC4 A;  4B3R L;  2GN5 A;  1RJT A;  2F0P A;  1EWC A;  1G6Z A;  1E0B A;  1K83 B;  1B50 A;  1VQG A;  1PA6 A;  3D6C A;  4EVO A;  3SK4 A;  1PDQ A;  2VB3 X;  2N8N A;  3J7Y W;  4DV0 Q;  2R93 G;  3OHX C;  1A2U A;  1F9Q A;  3I4M G;  1Y8P B;  2GVB A;  5JVG 3;  4OX9 Q;  1PH3 A;  3J81 j;  1PFM A;  2PCF B;  2WAQ G;  4LF7 Q;  4LWC A;  4B9W A;  4BBR B;  1G91 A;  2BA1 A;  4PZ8 A;  1S3O A;  2FJ2 A;  2C9O A;  1B9N A;  2DY8 A;  3HFZ B;  2EDG A;  3K7U C;  3I55 A;  1P8L A;  2Q2I A;  2HT1 A;  3EN2 A;  2BE5 C;  4B9X A;  2M2L A;  3S16 H;  4B3T Q;  4JI5 Q;  4CKE A;  4RG1 A;  3BU2 A;  4FYD A;  1B9M A;  2DY7 A;  3RZO B;  3OMG A;  2OQK A;  1I4X A;  3VYT A;  1X3P A;  2VUM G;  3ULJ A;  2A6E D;  2YTY A;  2OQ0 A;  4LF9 L;  4GOP B;  2F0L A;  4QQB X;  4KHV A;  3FKI G;  3G6J B;  5F2D A;  1E22 A;  5EBD A;  5C5L A;  3PIO 3;  3CCM A;  5GRO A;  4ZK9 B;  4NDX A;  5IYC G;  3T1Y Q;  4IUV A;  1O7I A;  4CKC A;  3J80 E;  3HOW G;  1JE5 A;  5I6W A;  3CKI B;  4CKB A;  1VF7 A;  2SDF A;  1ILP A;  1WTO A;  1HTP A;  4QGU A;  4DXG A;  3MEF A;  1ESF A;  3B6Y A;  1EWH A;  1N36 Q;  3HOY G;  3S2D B;  4B3S Q;  1LTT D;  3CU7 A;  4QMG A;  4IUQ A;  4A3B G;  1KAA A;  3Q8D A;  1M90 C;  2XRQ D;  5FJ8 G;  4NXM L;  3KJO A;  3AB9 A;  5E1F A;  1V1P A;  2E2I B;  4YCU A;  1EY5 A;  1T5E A;  2LXJ A;  1LUZ A;  2NTT A;  4NKL A;  4DV3 Q;  2JEB I;  3V2T A;  2F0N A;  3OOC A;  2Z0S A;  2HHH Q;  1RF2 D;  4YHH Q;  3IFD A;  1X3F A;  3S17 B;  1HUM A;  2VQF L;  2I07 B;  4G7Z C;  3RD4 A;  4DR7 Q;  2CW0 D;  1DOL A;  4ZUJ A;  3UDG A;  3LX0 A;  2A74 C;  2JA6 B;  4BA2 I;  2QW7 A;  3NHH A;  2Q2H A;  5C6A A;  5JEA G;  2CHB D;  3R93 A;  4JI1 L;  2E2J H;  2KEN A;  4RGN A;  5C3X A;  3PO3 H;  4RGM A;  3TS2 A;  1S5E D;  1FGU A;  4GKJ Q;  4HJ5 A;  1BQQ T;  4OON A;  1NE3 A;  4LFC L;  3K5N A;  1D6E C;  2V1C C;  2E5L L;  2EZV A;  3LWE A;  3MZ5 A;  5FLX L;  3U9S A;  3LWU A;  1STY A;  3VR4 A;  2I5H A;  2Z4H A;  3GDE A;  3QOL A;  4DNI A;  1PTO D;  1STB A;  4JOI C;  3VR6 A;  4CJ0 B;  1BF4 A;  4CJ2 C;  1VQO A;  2EQS A;  1MJE A;  2ZM6 Q;  1HNX Q;  2E2H B;  5GAH C;  1K0S A;  2RDF A;  3MHB A;  4B3M Q;  2F0E A;  2R3Z A;  2O5I C;  2UXD Q;  1SFO B;  5BN4 A;  1VQP A;  4Y7N B;  5K5P A;  3J80 i;  2VXW A;  4LF4 Q;  4ODG A;  1H95 A;  3FKI H;  5C4H A;  2PYK A;  2EJG C;  4U68 A;  3ULL A;  2CQA A;  3H3V H;  1X6O A;  1PH9 A;  1TQO A;  2IL8 A;  5M5X H;  4YY3 L;  2AKW B;  4XQN A;  1BCP C;  1OXS C;  3BDL A;  3HOW H;  4I7A A;  1FJG Q;  1V1Q A;  3QIA A;  1KNA A;  4RA8 A;  4DUY Q;  1ET9 A;  2BCO A;  3KLS X;  3EBE A;  4TKO B;  1F2Z A;  3QR8 A;  4ILW A;  2E74 C;  1I50 B;  2F0U A;  2P5Z X;  2EJF C;  2HUG A;  4FF3 A;  4UHV A;  3CMA A;  3KF6 A;  3CCS A;  2PW7 A;  4GNX A;  2B2V C;  3A8I E;  2HCC A;  2B2Y A;  3SK5 A;  4K8J A;  2UUB Q;  1TWA H;  3MXG A;  5KND A;  3RNU A;  2UU9 Q;  2F0T A;  1STN A;  1VS0 A;  1TII D;  5EKK A;  1RL2 A;  3RN5 A;  5DM7 3;  4OXP A;  5ELD A;  3HKZ B;  2A6H D;  3HP3 A;  2IHF A;  3ULP A;  2ENB A;  1IXR A;  2K52 A;  4BY1 G;  3F2B A;  1KDA A;  2B2Y C;  1GUT A;  5JVH 3;  5IGC A;  1RDP D;  3NSW A;  1KLG D;  4DUZ Q;  4C2M B;  2PW5 A;  1X3Q A;  5IP9 G;  1ASZ A;  4ZYS A;  1N32 Q;  2E2D C;  1IZ6 A;  4K0K Q;  1NMF A;  5IWA Q;  2ZJR A;  3E9I A;  1SRO A;  3L3O C;  4P2C B;  4ZLT F;  2KOL A;  1Y8O B;  3K57 A;  1N9W A;  2B2W A;  1K3R A;  1SNQ A;  2NVQ H;  2R92 H;  4DV2 L;  3KLS A;  3HOU G;  2A19 A;  4H13 C;  3J81 c;  3H09 A;  3T1H L;  1QB5 D;  1TWG H;  1LYL A;  1MI2 A;  1XPO A;  3H6M A;  4LFC Q;  5J22 A;  4DAP A;  4QL5 A;  1W6J A;  1XNR L;  1KDC A;  1UEA B;  1KAW A;  4B3R Q;  5DNF A;  1G51 A;  1GKH A;  1II3 A;  4X66 L;  2F0F A;  2RDG A;  1EQQ A;  1F9R A;  4KHZ A;  4WFN 3;  4A93 B;  3I4N B;  1MD2 D;  3D8G A;  1SYD A;  2DUD A;  2VUM H;  1SDF A;  4JI8 Q;  5KNC A;  1VQ6 A;  3RN2 A;  1TT2 A;  2JSO A;  5IGD A;  2NVX H;  2NVT B;  1R4Q B;  1OTC A;  5EBC A;  3H94 A;  2A1A A;  1WTH A;  2QIL A;  2BH2 A;  1ZYR D;  3F2D A;  2F0O A;  4C56 C;  4EX5 A;  2R7Z H;  2EY5 A;  4RKL A;  5C4J H;  1EYA A;  3S2H H;  5J3B A;  2PNH A;  2F0V A;  3P75 A;  2VNU D;  3PIP 3;  3ONA B;  2WAQ E;  1BCP D;  1IYV A;  1N36 L;  1Y1V H;  2BDN A;  1YEZ A;  3S1M B;  3L2P A;  1EUJ A;  4A3L G;  5DAU A;  2KED A;  4GN5 A;  1VQA A;  1GUN A;  4GLA C;  4A3F G;  5E4W C;  3TZD A;  1QUQ A;  4A3I H;  4H7B A;  3SHL A;  2KA7 A;  2QEX A;  3SK8 A;  5DEH A;  5TSS A;  3N52 A;  2A68 C;  4X3S A;  4DNT B;  3TRZ A;  1LTL A;  1I4Q A;  3D4R A;  1JMC A;  4HED A;  1FD7 D;  1TY2 A;  4GKK L;  1WOC A;  4QJF A;  1A3V A;  4X6A H;  4L8J A;  2EYL A;  1XYI A;  3GV3 A;  2K14 A;  3C1E A;  4RCO A;  5M3M G;  3ZJY C;  1TU2 B;  3GTL H;  4JC0 A;  1BNZ A;  5LMU L;  2A6E C;  1XTD A;  3HOU H;  3BZK A;  1SNC A;  4RCN A;  1CUK A;  1EY4 A;  3H0G B;  5M3F B;  5AJ3 Q;  3CXC A;  3KK7 A;  4K14 A;  1YBY A;  3GTJ B;  4AYB B;  4DK0 A;  1HZA A;  3EJI A;  4LF5 Q;  1SE3 A;  1YNX A;  3VA5 A;  3E9H A;  4HJ8 A;  1U9R A;  1SYC A;  4DAY B;  2F0G A;  1QUQ B;  1TVX A;  2N3S A;  1I3Q B;  4RMF A;  1KQS A;  1WTQ A;  2C35 B;  4B3M L;  2R93 B;  1YHQ A;  1YHA A;  1MGS A;  3NTH A;  1M1K C;  1ZYR C;  1WCM G;  5JJK A;  4EQP A;  3TEH B;  1EZ6 A;  1EIG A;  2G9D A;  1JB7 A;  1N33 L;  3CCQ A;  4YIJ A;  1E1O A;  1KTK A;  1RHP A;  1V8Q A;  1CKN B;  2B2W C;  1YIJ A;  1SJH D;  2EPB A;  2RHS B;  4HCE A;  4JK1 C;  3A54 A;  3GTQ H;  3KLW A;  3CC7 A;  3A7L A;  4DV7 L;  2R7Z G;  4AYB E;  1CI3 M;  4HAE A;  1HPC A;  2NZO A;  3EFX D;  4QIW E;  5T1G A;  2KCM A;  3QJY A;  4IFD H;  2AWN A;  4DGZ A;  1JQY D;  2VS1 A;  1JOK A;  3GV6 A;  1CK1 A;  4RFB A;  4O2D A;  1A3T A;  1EY8 A;  2KEC A;  1BKB A;  3K5L A;  1XNQ L;  1QG7 A;  2E75 C;  2F1M A;  3CQZ B;  3DWA A;  5IGG A;  4YWK A;  1N34 L;  2EIF A;  4UPA A;  3K7A B;  3E0E A;  4DV6 L;  2Z1C A;  3W3A A;  4FNF A;  4OO1 H;  1EY9 A;  2EE1 A;  1JJG A;  4JOI A;  4UP9 A;  2PO4 A;  5CV7 A;  4HMJ A;  5C5M A;  1RTO A;  5A2Q L;  2KUM A;  2JYO A;  4DV2 Q;  2O5J C;  2E8G A;  1XPU A;  4BY7 B;  1EFI D;  3CW2 C;  2JN4 A;  4KTA A;  1Q81 C;  1U4L A;  4A3G G;  1DXM A;  3NEM A;  2E2J B;  2F0M A;  3WWV A;  1AP0 A;  1J9O A;  1WI5 A;  1PH5 A;  2JA5 B;  4Z9C B;  2E5L Q;  4NXN L;  4A3I B;  1TWH B;  3S1Q H;  4DR3 L;  1LV9 A;  3T16 A;  4DR6 Q;  3PUZ A;  4OIJ A;  3GTK H;  3PF5 A;  2BH8 A;  2OWO A;  3I8Z A;  3HOV B;  1Q1E A;  2UXC L;  4OHJ A;  4PMW A;  4IPH A;  1IKL A;  4A3D B;  3NQI A;  3MFY A;  3M4O B;  2WB1 B;  1LTA D;  3A8J E;  3M7N A;  3RLN A;  4CBV A;  1RCV D;  2UXB L;  3HOZ H;  2QEJ C;  1H9S B;  2LSS A;  2PZW A;  5FO9 B;  1UE1 A;  2ZTD A;  1HQM C;  1QIL A;  3KJP A;  2KHJ A;  4DN4 M;  2N49 A;  3OIQ A;  2KCC A;  4MIU A;  4O0A A;  3GTQ B;  4K6L A;  2K4K A;  1JJ2 A;  2EYF A;  3GTG B;  1EU4 A;  2LKV A;  3KYH C;  4BY7 H;  3J81 E;  2O2L D;  3M3Y H;  1G29 1;  2AHO B;  4CJ1 B;  2K05 A;  2VW9 A;  3K58 A;  3X3M A;  2QDB A;  4GZY C;  5EPJ A;  2K7V A;  3TRE A;  1QZH A;  1C48 A;  1M4V A;  2IX0 A;  2XGT A;  4QUF A;  1FL0 A;  1XX8 A;  3S14 H;  4BBS G;  1S40 A;  3ERQ A;  1SLJ A;  2CQO A;  4ZKC B;  2F3W A;  1SEB D;  4LUO A;  5E3F A;  2MGS A;  3I7F A;  2UUA L;  5C4J B;  2B2U C;  4DAM A;  4KV6 A;  1VQ9 A;  5I9O A;  5CMD A;  1GUS A;  2NB0 A;  4GOP A;  3MVV A;  3LGJ A;  2K6A A;  4OIK A;  5JOB A;  4RH6 A;  5IOC A;  1HQR D;  3CME A;  1TWC B;  3A55 A;  2ZJQ A;  3PQI A;  2IT1 A;  1LAC A;  3CC2 A;  3J81 i;  2X6G A;  1L0Y B;  1U4R A;  3EA6 A;  2RCN A;  1K8G A;  1IBM L;  5GAD C;  4A3J B;  4KK7 A;  3T1H Q;  1G6P A;  4QCL A;  1K8O A;  1Z47 A;  5A2Q E;  4IO9 A;  2PQE A;  4F7X A;  3GD7 A;  2XWJ B;  3TDQ A;  1U5K A;  4DAV A;  2NBF A;  2LS0 1;  1WTR A;  1VCI A;  1EQV A;  5BR8 L;  1IBL L;  5IYB H;  2ID0 A;  4L5S A;  2B3G A;  1JJC B;  2VZA A;  2K04 A;  2JA7 H;  1B3Q A;  3IKJ A;  4L5R C;  2PMZ B;  4FVM A;  5FO7 B;  2EXD A;  5C0X H;  1EOT A;  1XNR Q;  2IWH A;  1JCK B;  1JT8 A;  1NY4 A;  1AFP A;  3A8K E;  2TMP A;  3PO2 H;  4DV5 L;  1O7Y A;  4IUR A;  1TWF H;  3P20 A;  5EKI A;  1CSP A;  4DR2 Q;  5CBE E;  2WAQ B;  2YYZ A;  1YNN D;  5COY A;  4ME3 A;  4A3J H;  1LAB A;  1F2M A;  4RAU C;  3IRB A;  1GUW A;  4KKS A;  4KI0 A;  3PUY A;  1VF5 C;  4KD3 A;  2UXB Q;  1PLF A;  3HG9 A;  5JEA H;  1KAB A;  1V9P A;  4LF6 L;  2HDL A;  3A5U A;  4WRD A;  3MAQ A;  3S14 B;  3S15 B;  1EEF D;  3QO2 A;  3GO5 A;  5C0X J;  3I56 A;  3I4N H;  1MIU A;  5M3M B;  3CPW A;  3PUV A;  1EYG A;  1Q8I A;  3STB D;  2G5D A;  4DNR B;  4J8Q A;  3DEO A;  1BR9 A;  3MXN A;  5M9O A;  1TS4 A;  4WJW A;  1GJX A;  1HNZ L;  2ATW A;  5KGU A;  2IPK D;  5D3D A;  1KRT A;  3PIO A;  1X32 A;  1FVI A;  1PH7 A;  1H9S A;  4A3B H;  3NXW A;  2L4N A;  1HXY D;  3PGZ A;  4DUY L;  4RHS A;  4IFD J;  3G71 A;  4DV4 Q;  3PMF A;  3VA7 A;  4A3B B;  4LF6 Q;  3T53 B;  3GTP B;  4PG3 A;  5IP7 H;  3S9W A;  1JC7 A;  1CFM A;  2ZXO A;  4HN7 A;  4ZKB B;  4K2L A;  1EY7 A;  1PTO B;  1HH2 P;  3BZC A;  3UE1 A;  2NVX B;  2ASB A;  3I73 A;  1YZ6 A;  1PTO H;  4IOC A;  4JPB W;  1SND A;  2MPM A;  1N8R C;  1PHJ A;  2Z6B A;  1GUG A;  2L9H A;  1XPR A;  2K33 A;  1VQH A;  4JYA Q;  1QVF A;  4RWS C;  2I46 A;  1CQV A;  5IYB G;  1TS2 A;  3TBI B;  1S5F D;  4Y52 H;  4IOA A;  2L15 A;  4EQN A;  4GOP C;  4DR5 Q;  3GTL B;  2NN6 G;  1AZP A;  1VQL A;  5LMN L;  1WFQ A;  3U9O A;  3UDX A;  3ND9 A;  3PUW A;  1DOK A;  2I5L X;  4RKB A;  1M8A A;  3JAM c;  2EXZ A;  1B8A A;  4KHP Q;  1SE2 A;  4A3M G;  3S24 A;  3LNN A;  1MJC A;  3J7A V;  4AQY L;  5C0X I;  1HHV A;  3HGB A;  1I94 L;  4JI1 Q;  2RA4 A;  1I3Q H;  1J8I A;  2ZJP A;  2X6L A;  3AFQ A;  3JAM i;  3A7A B;  2I5M X;  1KC8 C;  1NCV A;  1GHJ A;  2C5C A;  5T1I A;  3I4M B;  2VQF Q;  2PZT A;  4X3U A;  4PZ6 A;  1CKM A;  4PQX A;  3I90 A;  3SVM A;  5ISR A;  3BJU A;  3TP8 A;  4A3K B;  2R7Z B;  3J7A F;  5HY6 A;  5JPM C;  2DJF C;  5IIF A;  1ESR A;  5K36 G;  4NB3 A;  4KD4 A;  1PTO C;  1BCP B;  4K5V A;  4NXM Q;  4JG2 A;  3WOE A;  3ER0 A;  1C9O A;  4FXD A;  1HUN A;  1XMQ L;  3R2I A;  2EY6 A;  4C3J H;  3IFT A;  1KL9 A;  4LF7 L;  2F52 A;  2H4O A;  3DXJ C;  4P75 A;  1GOZ A;  4A3D G;  5IGF A;  1WCM B;  1J5E L;  1I94 Q;  1AE2 A;  5CV5 A;  3J80 c;  3NBH A;  5C0X G;  1F2L A;  4R1J A;  5C3W A;  5GAE C;  2B8G A;  3HKS A;  2KCN A;  4DV0 L;  5M5Y H;  2E76 C;  1X54 A;  2HIV A;  4AYB G;  1H9R A;  2F0Q A;  3CD6 A;  4BS9 A;  3FMC A;  2Q8T A;  2RCF A;  3T51 B;  3BS1 A;  1PH1 A;  2JA5 G;  1HRJ A;  2DGY A;  1OO9 B;  5LMN Q;  3IAY A;  3R3O A;  2DN8 A;  3HS0 C;  3KLR A;  2F0J A;  3NTK A;  4LF4 L;  4C1N I;  2NUC A;  3JAM E;  3OW7 A;  1I5F A;  1O80 A;  3TP5 A;  2L5T A;  1ZKO A;  4R4Q A;  1PRT C;  4R8I A;  3E0J A;  1YHB A;  4Y7N H;  5JJZ A;  1HZB A;  1LT5 D;  4HIK A;  4DR6 L;  1L0X B;  1ROD A;  4ME5 A;  2JA8 G;  3K7A H;  3P7J A;  3KBG A;  1NUC A;  2A73 B;  4R4T A;  3H0G H;  5M3F H;  3GTO H;  3H3V I;  4HSP A;  4A93 H;  2JA9 A;  1X65 A;  4HJA A;  2JA7 G;  4A3F B;  4R9W A;  2QGQ A;  1STG A;  2F0D A;  2WKC A;  3PV0 A;  4A3F H;  4JI0 L;  3HOZ B;  2B8F A;  3BYT B;  1STH A;  3GQB A;  4KKU A;  1EQR A;  1PRT B;  1I4H A;  3VR3 A;  1HNZ Q;  2R6G A;  4AQY Q;  3D31 A;  4A4I A;  1VQE A;  2K5H A;  3Q22 A;  3Q24 A;  2LMC B;  1HNW L;  1ENF A;  4C2M H;  4JI4 Q;  3MWY W;  4UDU C;  2QCP X;  1CM9 A;  3W5O A;  2RSN A;  1YJN A;  2JQO A;  2OXP A;  3PCO B;  4QIW B;  1YNJ D;  5J1Z A;  2CWA A;  1B70 B;  3AFP A;  4OX9 L;  4LMQ D;  4BXX G;  4GNX B;  3HOV G;  2IJ0 A;  5CYU A;  2V4D A;  4JI3 L;  5A35 A;  3CCJ A;  1DM0 B;  1WD0 A;  1K8A C;  3ND8 A;  1X56 A;  1SSO A;  4V0B A;  4I65 A;  3W1G A;  4B3S L;  3EIV A;  1K0R A;  4JYA L;  5CGK A;  3CF5 A;  1QOH A;  2EYP A;  3K8A A;  2JA6 G;  4HIO A;  5EPK A;  4OWX B;  1UEB A;  1Q86 C;  1LTB D;  5FKA C;  2MJ8 A;  3D4D A;  3WDN A;  4LAA A;  5ELB A;  3L0O A;  4DR4 L;  3KOJ A;  1HZ9 A;  3DHQ A;  4CDD C;  4PZ7 A;  3MA2 B;  1D7Q A;  2Y0S E;  5C3E G;  3H15 A;  3KDF B;  1FR3 A;  5KRU A;  3NPP A;  3NUC A;  1J6Q A;  3FPP A;  1F9S A;  1CHP D;  1CKN A;  3URY A;  2UUC L;  2R92 G;  2HIX A;  5EKL A;  1B44 D;  1SAP A;  1ENC A;  1JWM D;  1NTG A;  2NVY H;  1TR5 A;  4L5Q A;  3RUZ A;  1OXT A;  2IW3 A;  3SXH A;  3TZU A;  2AQ3 B;  4IFD I;  1NR2 A;  1D5Z C;  4HID A;  1GO3 E;  4TRD A;  2A5H A;  3CRK C;  3I2Z A;  1QVG A;  4B3T L;  1EWI A;  1W3S A;  2YTV A;  3K5O A;  3GP7 A;  4DR1 Q;  1IBM Q;  3KF6 B;  4LFA Q;  4GLV B;  5ELF A;  1PZJ D;  4DUZ L;  4N9P A;  1H9M A;  4K6D A;  4GKJ L;  2VQE L;  3NE5 B;  2D0P A;  1ET6 A;  3CPF A;  3Q0A A;  4OGQ C;  4X62 L;  5CV4 A;  1MKH A;  2R61 A;  2KQ3 A;  1K73 C;  1PH6 A;  2E2H H;  3T4A C;  1VQM A;  1LM0 A;  4LK1 C;  1YJW A;  4DR7 L;  1CZG A;  3SE0 A;  1E1T A;  3TSS A;  3STB C;  1UNS A;  1B3A A;  3FP9 A;  2Q8I B;  1TWF B;  3OMC A;  2Z4I A;  2WP8 J;  4KJO A;  5ELC A;  1SFO H;  1A6X A;  2D2C C;  1Y69 U;  1C8C A;  4L6T B;  1Q3L A;  4NPS A;  1Z9F A;  2J7Z A;  3BDC A;  4A3L H;  4Q0F A;  1UE5 A;  4BXX H;  3DWP A;  1QNU A;  4P73 A;  4FXK C;  3OSO A;  3D0F A;  1SYE A;  3BVM A;  4L5T A;  2MO0 A;  2K5D A;  3U4Z A;  4BBR G;  2XWB B;  4IUN A;  3BVZ A;  2XIW A;  1EEI D;  2GVA A;  1GVP A;  4CHT B;  5IP7 G;  2A8V A;  5BR8 Q;  1IBL Q;  2X69 A;  3W2D A;  2RKS A;  3I3C A;  4IPC A;  5LHY 1;  1LT6 D;  4YCV A;  1CA5 A;  4PMB A;  1SR3 A;  4RHR A;  3GTJ H;  4GS3 A;  4ZCK A;  4A76 A;  1Y1W B;  1PVO A;  3NBI A;  2BE5 D;  4H02 A;  5IOD A;  2A69 D;  3S1R H;  1AH9 A;  1B53 A;  3DWQ A;  4C1N K;  4N8X 1;  3VDY A;  4MTK A;  4HJ7 A;  4KN7 C;  1S5C D;  3KDF A;  5C3E H;  2CKZ B;  3RLO A;  2EYH A;  2M00 A;  1VMP A;  1KD1 C;  1LTR D;  4X65 Q;  1K28 A;  1PFB A;  1PFS A;  1K3B C;  1D1K A;  1SBB B;  3M7G A;  1L0W A;  1QZG A;  1BBX C;  1A2T A;  4RGT A;  4JI0 Q;  3MTS A;  2JA8 B;  3S15 H;  1T9H A;  1MHW C;  3CQZ H;  2F3I A;  2R92 B;  4KN4 C;  1O78 A;  2PI2 E;  5M5W B;  1W6K A;  1R9T B;  4DR3 Q;  4P74 A;  3K6O A;  3SK6 A;  4X3K A;  2B2U A;  3TN2 A;  1TWH H;  4NW2 A;  1SRU A;  3KFU A;  3S1Q B;  1QE6 A;  1K83 H;  1PH8 A;  4V19 0;  1FNW A;  5BN3 A;  1BDO A;  3J7A 5;  4X64 Q;  1PZK D;  1TXY A;  3HOX B;  4QUC A;  1Q46 A;  4R8N A;  3UE0 A;  1Q90 A;  1QVC A;  3K5M A;  4XIG S;  4BBS H;  1JR0 D;  3OIP A;  1WTW A;  5JAV A;  1D5X C;  4E6I A;  2JA8 H;  1HJP A;  4LF8 Q;  2PNR C;  4MHE A;  3DM3 A;  1B7Y B;  4A3G B;  1I6H B;  3VR5 A;  4DU9 A;  1Z7T A;  2PZU A;  5D14 A;  3PO2 B;  3TS0 A;  1HFG A;  4A93 G;  4BWG B;  4ZAI A;  2PMZ E;  2VB2 X;  4MZ9 A;  1JB3 A;  3M4P A;  1YNJ C;  5JPN C;  1LLR D;  3ERS X;  3G7L A;  2N78 A;  3MC0 B;  3E3X A;  2ZXP A;  3FEW X;  2F4V L;  1A8V A;  4HCS A;  1SXT A;  5FOB B;  2DJG C;  4HJ9 A;  3HOZ G;  2AMC B;  1VQB A;  1J5E Q;  5ELE A;  4FF1 A;  2F0S A;  4ZQ3 A;  4R4C A;  1WD1 A;  2K28 A;  3RZD H;  1RD9 D;  1XMQ Q;  4LJZ C;  4CDF C;  4IAL A; 
#chains in the Genus database with same CATH homology
 1ASY A;  3KF6 A;  2NVT H;  3CCS A;  4ALP A;  4JI4 L;  2Q2T A;  4DR1 L;  4GNX A;  4NXN Q;  4A3I G;  3I4N G;  2MNA A;  3OW2 A;  1X3G A;  1HNZ L;  2ATW A;  1C0A A;  4A3C H;  2KCT A;  1KRT A;  2R7D A;  3PIO A;  4JV5 L;  1FVI A;  2UUB Q;  1TWA H;  1NJI C;  4JI2 L;  3KF8 B;  1X55 A;  1PH7 A;  2B63 H;  3PSI A;  3RR5 A;  4A3B H;  3F8T A;  4DUY L;  3RNU A;  3PGZ A;  2UU9 Q;  3GTP H;  4BY7 G;  4IFD J;  3G71 A;  5IP9 H;  4DV4 Q;  3ICE A;  1VS0 A;  3W1B A;  5C44 G;  4LF6 Q;  4IFD G;  1RL2 A;  3RN5 A;  5C4X G;  1PYS B;  4PG3 A;  4DK3 C;  4OXP A;  5IP7 H;  2YU9 H;  5M3M H;  5LMN W;  2UXC Q;  1Q82 C;  2IHF A;  3HOY H;  3ULP A;  3G48 A;  1IXR A;  2K52 A;  3M9B A;  4BY1 G;  3UE1 A;  1HH2 P;  3BZC A;  3UDI A;  4X66 Q;  3F2B A;  1VQ4 A;  2ASB A;  3GTG H;  1YZ6 A;  5GQO A;  5IYD G;  4DV6 Q;  4IOC A;  1KRS A;  4DUZ Q;  1GD7 A;  1N8R C;  3JC6 6;  1PHJ A;  5IP9 G;  1ASZ A;  1XPR A;  2ES2 A;  1N34 Q;  3CC4 A;  1N32 Q;  1IZ6 A;  1VQH A;  1QVF A;  4JYA Q;  4DV3 L;  4K0K Q;  1NMF A;  2NZH A;  1YI2 A;  1AE3 A;  4OWW B;  5IWA Q;  5IYB G;  1XNQ Q;  2AWO A;  2ZJR A;  3E9I A;  4JCV E;  2R7F A;  5IT9 c;  4BY1 H;  1SRO A;  4IOA A;  2L15 A;  3OYY A;  4JI8 L;  3HOX G;  4GOP C;  1HNX L;  2ZM6 L;  4DR5 Q;  1FJG L;  2NN6 G;  3GTM H;  2F4V Q;  1L1O A;  5JEA J;  1VQL A;  4KLK A;  1X3E A;  5LMN L;  5FLM G;  4JI3 Q;  1WFQ A;  4GN4 B;  1WCM H;  3AEV A;  1N9W A;  1K3R A;  3UDX A;  1PH2 A;  2NVQ H;  2R92 H;  1Q7Y C;  4DV2 L;  2B29 A;  1IBK Q;  2PI2 A;  3PUW A;  4DV7 Q;  5IWA L;  3HOU G;  2A19 A;  3FHW A;  3J81 c;  2I5L X;  4DV5 Q;  3T1H L;  1TWG H;  1WYD A;  3JAM c;  1LYL A;  1B8A A;  1XPO A;  3T1Y L;  4KHP Q;  4A3M G;  3S24 A;  5ELO A;  1VQJ A;  2VL6 A;  3OTO L;  1VQ7 A;  4LFC Q;  1MJC A;  2UXD L;  4QL5 A;  2Z6K A;  1A62 A;  1XNR L;  4JBJ A;  4AQY L;  1KAW A;  4B3R Q;  1YVC A;  5C0X I;  1G51 A;  1GKH A;  1I94 L;  4JI1 Q;  1I3Q H;  4X66 L;  4P71 A;  1EQQ A;  4LW1 A;  1L1O C;  2R93 H;  2JK8 A;  2ZJP A;  1E7Z A;  3AFQ A;  4KHZ A;  4UP7 A;  4J15 A;  3JAM i;  3M4O H;  1U0L A;  4DV1 L;  4DK6 C;  2I5M X;  3CCV A;  4YWL A;  1KC8 C;  4WJ3 M;  4X64 L;  5DLQ E;  2DUD A;  2VUM H;  4A3M H;  3I4M H;  4JI8 Q;  2K75 A;  3A0J A;  1VQ6 A;  3RN2 A;  1R9T H;  2K5V A;  2UU9 L;  3A74 A;  2Y0S G;  3L7Z C;  2NVX H;  5JJL A;  1Y14 B;  1KIX A;  2VQF Q;  1OXV A;  1OTC A;  2OTL A;  4AH6 A;  5IE8 A;  4PZ6 A;  1IYJ B;  1CKM A;  2A1A A;  1Q8K A;  2MQH A;  4JV5 Q;  2CWP A;  2IY5 B;  1Y1W G;  3BJU A;  3HKZ E;  4GN3 B;  5FJ8 H;  4QY7 A;  2HHH L;  2BH2 A;  3F2D A;  5HY6 A;  4OO1 I;  3HKZ G;  1D8L A;  1P16 A;  2VQE Q;  4BBR H;  4EX5 A;  5K36 G;  4NB3 A;  2R7Z H;  4TQU S;  5C4J H;  1IBL L;  4A3E H;  3S2H H;  4NXM Q;  3NEL A;  1BBU A;  4JBW A;  2PNH A;  4JG2 A;  5J3B A;  5IY0 A;  4OO1 G;  3ER0 A;  4LFA L;  2VNU D;  1C9O A;  1HZC A;  2WAQ E;  3S1M H;  2WFW A;  1XMQ L;  2XTI A;  3CCE A;  3CCU A;  1N36 L;  1Y1V H;  4C3J H;  1KL9 A;  1YEZ A;  4LF7 L;  5H1S E;  3L2P A;  4DV4 L;  2F52 A;  4P75 A;  4A3D G;  4WJ4 A;  1EUJ A;  1VQD A;  4A3L G;  1VQ8 A;  1I94 Q;  1J5E L;  1TWC H;  4GN5 A;  4APV A;  1AE2 A;  1VQA A;  4IPG A;  2IHE A;  3J80 c;  1XJV A;  4R4O A;  2ZTC A;  5C0X G;  1L2F A;  2UUA Q;  2UUB L;  4GLA C;  4A3F G;  4R1J A;  5GAE C;  1V43 A;  1YIT A;  1VQI A;  1QUQ A;  4A3I H;  3PUX A;  3HKS A;  4IJL A;  2QEX A;  1Q12 A;  4DV0 L;  1Y1V G;  5M5Y H;  2UUC Q;  1Q1B A;  2H5X A;  3PO3 G;  4A75 A;  2OTJ A;  1X54 A;  2HIV A;  4AYB G;  3TRZ A;  3CD6 A;  5EAY A;  3S17 H;  1LTL A;  1EIF A;  1PH1 A;  2JA5 G;  2DGY A;  1VQN A;  1VQF A;  2I0Q A;  3G4S A;  4LUV A;  1JMC A;  5LMN Q;  1EFW A;  1L1O B;  4GKK L;  2Q2U A;  1WOC A;  3TQY A;  4QJF A;  5GAG C;  1K9M C;  4LF4 L;  4A3C G;  2IX1 A;  4X6A H;  1HR0 L;  1I5F A;  2JJQ A;  2K14 A;  4BA1 I;  4JI7 L;  5M3M G;  1W2B A;  3ZJY C;  3S1N H;  2NN6 I;  3GTL H;  4A3J G;  4JC0 A;  3U50 C;  1UE6 A;  1N32 L;  5LMU L;  4POG A;  4R4Q A;  3UDF A;  4L5S A;  1XTD A;  3HOU H;  3BZK A;  1YHB A;  4Y7N H;  1HZB A;  4A3K H;  2YV5 A;  1CUK A;  4HIK A;  4DR6 L;  4C3I H;  2CCZ A;  2JA8 G;  5AJ3 Q;  3CXC A;  3K7A H;  1UE7 A;  1YBY A;  4IJH A;  1UWV A;  4R4T A;  1HZA A;  3H0G H;  5M3F H;  3GTO H;  4LF5 Q;  3H3V I;  1NMG A;  1XMO Q;  1YNX A;  4JI6 Q;  3E9H A;  4HJ8 A;  4A93 H;  2JA9 A;  1X65 A;  4UY8 C;  2FXQ A;  4DAY B;  1QUQ B;  4HJA A;  2JA7 G;  4RMF A;  2N3S A;  1KQS A;  2KHI A;  3DLL A;  2QGQ A;  4GLX A;  4B3M L;  2C35 B;  2CFM A;  3PV0 A;  4JI5 L;  4EQ5 A;  1YHA A;  1YHQ A;  4DV1 Q;  2B63 G;  2HQL A;  4A3F H;  1M1K C;  1WCM G;  3RZO H;  5JJK A;  2D0O A;  3TEH B;  1SN8 A;  4R4I A;  2JEA I;  1YJ9 A;  4JI0 L;  3G6E A;  5C44 H;  1HNZ Q;  1EQR A;  2R6G A;  3K0X A;  1JB7 A;  4JBM A;  1N33 L;  2KBN A;  4AQY Q;  3CCQ A;  3D31 A;  4A4I A;  2K5H A;  1VQE A;  1E1O A;  2ALY B;  1A0I A;  3M85 A;  4A3G H;  1HNW L;  1CKN B;  4C2M H;  4JI4 Q;  1YIJ A;  1GM5 A;  4KHP L;  2RHS B;  4X65 L;  3W5O A;  4MTN A;  3GTQ H;  3KLW A;  1YJN A;  2K50 A;  2JQO A;  3PCO B;  3PIP A;  3CC7 A;  1VQ5 A;  1XMO L;  1EIY B;  3AYH B;  1EOV A;  4DV7 L;  2R7Z G;  2CWA A;  4AYB E;  5HGQ A;  4JBK A;  1B70 B;  3AFP A;  5IYC H;  4OX9 L;  1A63 A;  2LXK A;  4BXX G;  2NZO A;  4QIW E;  2KCM A;  4IPD A;  4HIM A;  1PH4 A;  2AWN A;  4GNX B;  3HOV G;  2VS1 A;  3A5Z B;  4TVA B;  4JI3 L;  3CCJ A;  5FLX c;  1K8A C;  5JJI A;  2MO1 A;  1KHI A;  4O2D A;  1X56 A;  5LMU Q;  1E3P A;  1BKB A;  4YCW A;  1XNQ L;  1DGS A;  3W1G A;  3EIV A;  4B3S L;  4P72 A;  4K0K L;  3CAM A;  1K0R A;  4YY3 Q;  3F1Z A;  4JYA L;  3CF5 A;  5ELN A;  4YWK A;  1HR0 Q;  1N34 L;  2EIF A;  3MXN B;  4LUZ A;  3K8A A;  2JA6 G;  1RIP A;  4HIO A;  2JE6 I;  4UPA A;  4DR4 Q;  4OWX B;  1UEB A;  3E0E A;  1Q86 C;  4B3R L;  2GN5 A;  4DR2 L;  4DV6 L;  3L0O A;  4DR4 L;  3KOJ A;  4YHH L;  1HZ9 A;  1JJG A;  2D62 A;  4JOI A;  4UP9 A;  1VQG A;  1PA6 A;  4PZ7 A;  4LF8 L;  1D7Q A;  2Y0S E;  5C3E G;  3H15 A;  3KDF B;  3CP0 A;  1N33 Q;  5IYD H;  4DV0 Q;  1J6Q A;  2N8N A;  2PQA B;  1CKN A;  4DV2 Q;  2UUC L;  4A3D H;  2R92 G;  2HIX A;  2E8G A;  1XPU A;  2R93 G;  1NTG A;  2NVY H;  3CW2 C;  1Q81 C;  3NBH B;  4L5Q A;  4A3G G;  3NEM A;  3I4M G;  2GVB A;  1OXT A;  4OX9 Q;  1PH3 A;  4IFD I;  3J81 j;  4LF7 Q;  3WWV A;  2WAQ G;  1GO3 E;  4HID A;  1VQC A;  1WI5 A;  1PH5 A;  3I2Z A;  4LWC A;  1QVG A;  4B3T L;  1EWI A;  1W3S A;  2YTV A;  4NXN L;  2E5L Q;  2BA1 A;  4DR1 Q;  3KF6 B;  4LFA Q;  1IBM Q;  3S1Q H;  4DR3 L;  1I50 H;  4PZ8 A;  1S3O A;  4GLV B;  5AJ3 L;  4DR6 Q;  4DUZ L;  3HFZ B;  4GKJ L;  3K7U C;  3PUZ A;  3I55 A;  2VQE L;  1P8L A;  2BH8 A;  2D0P A;  3F2C A;  3PF5 A;  2OWO A;  3GTK H;  2Q2I A;  2HT1 A;  3EN2 A;  1Q1E A;  3CPF A;  4FDB A;  2QA4 A;  2UXC L;  4PMW A;  4IPH A;  4X62 L;  3S16 H;  4B3T Q;  4JI5 Q;  1MKH A;  4RG1 A;  3BU2 A;  1K73 C;  1PH6 A;  2E2H H;  1VQM A;  1PYB A;  3M7N A;  1LM0 A;  1YJW A;  2JA6 H;  4DR7 L;  3RLN A;  2OQK A;  1E1T A;  4LNQ A;  2UXB L;  3HOZ H;  3STB C;  2LSS A;  1BBW A;  2VUM G;  3FP9 A;  1UE1 A;  2ZTD A;  1E24 A;  3ULJ A;  2YTY A;  2WP8 J;  2OQ0 A;  3KJP A;  4LF9 L;  4XTC S;  4GOP B;  2KHJ A;  1SFO H;  4DPG A;  4QQB X;  3FKI G;  2N49 A;  5M5W H;  1E22 A;  1CSQ A;  4O0A A;  4NPS A;  1Z9F A;  3CCM A;  2K4K A;  5GRO A;  3OTO Q;  1JJ2 A;  4A3L H;  5IYC G;  3T1Y Q;  1UE5 A;  4BXX H;  2RHQ B;  1O7I A;  3KYH C;  4P73 A;  1BVS A;  4BY7 H;  3M3Y H;  2WB1 E;  1G29 1;  2AHO B;  3D0F A;  4L5T A;  2MO0 A;  3U4Z A;  4BBR G;  3HOW G;  1JE5 A;  1IBK L;  2VW9 A;  3SGI A;  1X9N A;  2GVA A;  5C4X H;  1GVP A;  4GKK Q;  4QGU A;  5IP7 G;  1OXX K;  2A8V A;  1WJJ A;  5BR8 Q;  1IBL Q;  3MEF A;  3TRE A;  1QZH A;  3B6Y A;  1N36 Q;  2WB1 G;  3HOY G;  4B3S Q;  2IX0 A;  2XGT A;  1FL0 A;  4IPC A;  2JA5 H;  4A3B G;  3S14 H;  1M90 C;  3Q8D A;  4YCV A;  5FJ8 G;  4BBS G;  1S40 A;  4NXM L;  1SLJ A;  1SR3 A;  3KJO A;  2CQO A;  3M4Q A;  3NEN A;  4YCU A;  4A3K G;  3GTJ H;  4LUO A;  1NBW A;  2LXJ A;  4GS3 A;  4A76 A;  3CCL A;  1PVO A;  1LUZ A;  4DV3 Q;  2JEB I;  4H02 A;  4A3E G;  3S1R H;  2E2I H;  1AH9 A;  2HHH Q;  2Z0S A;  1IL2 A;  3VDY A;  3HOV H;  4HJ7 A;  2OCE A;  4YHH Q;  1X3F A;  3I7F A;  3KDF A;  5C3E H;  1CKO A;  4DAM A;  2UUA L;  2CKZ B;  3RLO A;  1VQ9 A;  4YWM A;  1HR0 W;  2VQF L;  1KD1 C;  4X65 Q;  3HOX H;  4DR7 Q;  1PFS A;  1KXL A;  4Y52 H;  3UDG A;  3U4V A;  1VQK A;  4GOP A;  4LFB Q;  1HNW Q;  2ZTE A;  3AQQ A;  3LGJ A;  3K80 C;  4BA2 I;  1QZG A;  1C7Y A;  1L0W A;  2Q2H A;  3CME A;  5JEA G;  2ZJQ A;  4JI0 Q;  2MFI A;  3H0G G;  5M3F G;  2IT1 A;  4JI1 L;  3U58 A;  2E2J H;  3S15 H;  1T9H A;  2KEN A;  3CQZ H;  2F3I A;  3CC2 A;  3PO3 H;  4GKJ Q;  1PV4 A;  4JI2 Q;  1FGU A;  1SMX A;  3J81 i;  3TS2 A;  2K5N A;  4HJ5 A;  2PI2 E;  4POF A;  4OON A;  1NE3 A;  4LFC L;  4DR3 Q;  4P74 A;  2RCN A;  1K8G A;  1IBM L;  5GAD C;  2V1C C;  2E5L L;  3T1H Q;  1G6P A;  4JI6 L;  1TWH H;  3KFU A;  1SRU A;  1Z47 A;  1K83 H;  4IO9 A;  4LF5 L;  3GD7 A;  1PH8 A;  1U5K A;  2I5H A;  3GDE A;  4DNI A;  3J7A 5;  2Z6K C;  4X64 Q;  1VCI A;  4JOI C;  3PO2 G;  1TXY A;  2RF4 A;  1Q46 A;  3UE0 A;  5BR8 L;  5IYB H;  2ID0 A;  1QVC A;  3J7Z C;  2B3G A;  2EQS A;  1VQO A;  1JJC B;  4XIG S;  3RLF A;  1MJE A;  2ZM6 Q;  4DR5 L;  1HNX Q;  4BBS H;  2VY3 A;  2VZA A;  2BA0 A;  5GAH C;  2JA7 H;  4L5R C;  4B3M Q;  5FLM H;  2EXD A;  1XNR Q;  1JT8 A;  4JI7 Q;  4LFB L;  1NY4 A;  2UXD Q;  2JA8 H;  1Y1W H;  1HJP A;  4LF8 Q;  1VQP A;  3DM3 A;  1B7Y B;  3J80 i;  4GNX C;  4LF4 Q;  3CCR A;  4OWT B;  3PO2 H;  1H95 A;  4DV5 L;  1TWF H;  3FKI H;  1CSP A;  4DR2 Q;  1S72 A;  3ULL A;  3TS0 A;  2PQA A;  2YYZ A;  4A93 G;  4LF9 Q;  1SE8 A;  4ME3 A;  3H3V H;  4A3J H;  1X6O A;  2PMZ E;  1PH9 A;  5M5X H;  4MZ9 A;  3M4P A;  3IRB A;  4UP8 A;  4YY3 L;  2AKW B;  3ERS X;  4KI0 A;  3PUY A;  2N78 A;  2UXB Q;  1OXS C;  2YTX A;  2F4V L;  3HOW H;  4MNO A;  4LF6 L;  1V9P A;  1FJG Q;  1V1Q A;  3A5U A;  1A8V A;  4C3H H;  4DUY Q;  4HJ9 A;  3HOZ G;  3EBE A;  2AMC B;  1VQB A;  4X62 Q;  3GO5 A;  3K81 C;  5C0X J;  3I56 A;  1J5E Q;  3I4N H;  1MIU A;  5E7N A;  3CPW A;  4AIM A;  4R4C A;  3S2D H;  3PUV A;  3PF4 A;  1EYG A;  3STB D;  3RZD H;  4DKA C;  1OXU A;  3I4O A;  1XMQ Q;  3CMA A;  1I6H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...