2UU9Q

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uu9Q00
4C2MH 4AIMA 3DLLA 1PH4A 1A62A 2KHIA 4B3ML 3CD6A 1EYGA 2E2HH 1QVGA 4GN5A 2ES2A 2LXKA 3F2CA 2VQEQ 1Q1EA 4PG3A 4DK3C 3FKIG 1X54A 4GNXA 3F1ZA 2ALYB 1TWCH 3JAMi 3G4SA 4DK6C 4JI6L 2R7ZH 1XTDA 4MTNA 4A93H 3D0FA 4A3FH 4XIGS 2CFMA 4YWKA 3KDFA 2WFWA 4LF6L 4C3HH 1KXLA 1Q86C 2Y0SG 3LGJA 3Q8DA 5AJ3L 2NZOA 1FL0A 3KYHC 2IHEA 3G6EA 4LNQA 1Q46A 1IBLL 1L1OC 3I55A 4DR7Q 2Z0SA 1OXUA 1X3FA 1KRTA 4IOCA 1IYJB 5E7NA 1VQMA 5BR8L 2E2JH 2PQAA 2D62A 4LFCL 3CCQA 4AQYQ 4B3SQ 1E1OA 3PIPA 3GTJH 3PV0A 4DV4L 4EQ5A 4Y7NH 4JYAQ 3K7UC 4OWTB 3HOXG 5LMNL 4B3RL 4MZ9A 4DV5Q 1U5KA 3PGZA 2NVYH 1VQOA 2UUAL 1WOCA 5IYDG 4JI5L 4YY3Q 4R1JA 4BBSH 3FHWA 4IPHA 4R4OA 4X62Q 1NMFA 2K5NA 3CCSA 3BZCA 3HOVG 4O0AA 2VW9A 3CXCA 1MJEA 1QUQB 5IYCH 1EOVA 1Q8KA 4FDBA 1YBYA 1YEZA 4H02A 2JA8H 3UE1A 3GD7A 4LFBL 3J7ZC 1PH9A 1A0IA 2VL6A 5H1SE 3HKZG 2HHHQ 1FJGQ 1IXRA 1G51A 1S40A 5JJLA 2F52A 1UE1A 5FLMH 3S17H 1WYDA 1WI5A 3CCRA 4HJ5A 1B8AA 1NY4A 1AE2A 1WCMH 3JAMc 2Y0SE 5FJ8G 3AYHB 4PMWA 4YCWA 3RLOA 2C35B 1MKHA 2JK8A 3KJPA 1VQ7A 1QVFA 2B29A 1SE8A 2ZM6L 2UXCL 4LUOA 2AKWB 4A3LH 2R7FA 3IRBA 4GN4B 4DUYL 3U58A 5IP7G 3F2BA 3ICEA 5JJKA 1JJGA 2JA7G 3J7A5 2BA0A 2K4KA 2N49A 4JBJA 2ATWA 1VQDA 4JI3L 1O7IA 3M4OH 3J81c 4GNXB 1JJCB 1PV4A 1Q82C 3H0GG 4P74A 2LSSA 2E8GA 5ELNA 4DR1L 1SLJA 2IHFA 4DR3Q 3KDFB 3FKIH 1I3QH 5FLXc 2VQFL 2AWNA 1EQRA 3L0OA 1L0WA 1HZAA 2VZAA 3EIVA 3W5OA 4K0KL 3RN5A 1H95A 2ZJQA 3GTPH 2PNHA 4QL5A 1VCIA 1IBKL 1ASYA 2KBNA 1XMOL 3TRZA 1UEBA 1W3SA 2L15A 5JJIA 1VQ8A 3HKZE 2K5HA 4JI2L 1N33Q 3GTMH 4YCVA 5GADC 2PQAB 4LF7L 1YNXA 2ID0A 3PSIA 5M3MG 4L5RC 2NN6G 1NMGA 1OXTA 4RG1A 3CP0A 4DUZL 1C7YA 1M1KC 5IYCG 2OQ0A 3HOZG 3CCJA 1BBWA 2IT1A 1UE6A 4PZ6A 1Y1WG 2F4VQ 4DAMA 3S1NH 2JQOA 4IFDJ 4R4IA 5GAHC 2YU9H 1S3OA 3HOXH 4HJ7A 2VQEL 3GTLH 1T9HA 4P73A 5M3FG 4DV3Q 1YITA 3GTKH 1PVOA 5IYDH 1M90C 1E22A 1KAWA 4GN3B 1X65A 3UDXA 1D7QA 1I5FA 3G71A 3D31A 1A63A 5C3EG 2K52A 2PI2A 4DR4Q 3I2ZA 1HNXQ 2JEBI 4UP7A 1S72A 4GNXC 1E1TA 2MNAA 2MQHA 1OXXK 1KIXA 4A3JG 2KCTA 4DR7L 3S2HH 4X6AH 3HOUG 3I4OA 4OX9Q 4B3TQ 2OWOA 2HIVA 1CKNA 4LFAQ 2UU9Q 4B3SL 4AQYL 5FJ8H 4DV0Q 3T1YQ 1ASZA 4BBRG 4UY8C 4JYAL 3S1QH 4EX5A 1TWFH 4GOPA 4DV5L 1OXVA 4POFA 1X6OA 5C0XG 4A3EG 3PO2G 1YVCA 3G48A 5IP7H 3PIOA 4YY3L 5M5XH 2JA7H 3OYYA 1HR0W 4X62L 1N32Q 2NN6I 2ZTEA 3K81C 3H0GH 4IPCA 1CSQA 1MIUA 4R4QA 3J81i 1X3EA 4LF4Q 1YHAA 3PO3G 1XPRA 4TVAB 1U0LA 4AH6A 1VQ9A 4DV1Q 2HHHL 1FJGL 2A1AA 3BZKA 1V43A 4A3IG 3J81j 1KL9A 1K83H 3RR5A 1P16A 1NJIC 3H3VH 1EUJA 4YHHQ 3NEMA 3DM3A 4KHPQ 3PUZA 4DV2Q 4L5QA 1PA6A 1G291 3PUXA 4DKAC 3K0XA 4APVA 2GVAA 2K5VA 4DV7Q 4LW1A 5IY0A 4JI8Q 3CCLA 1Y1VG 2EIFA 2YV5A 2H5XA 2D0OA 2I5LX 4GS3A 5M3MH 1JB7A 1SRUA 3KF8B 1K8GA 1IL2A 1A8VA 2DUDA 4LF8Q 1YHBA 1XNQQ 3NENA 3HOZH 3T1HQ 1DGSA 4L5SA 4L5TA 1Y1WH 4DAYB 1SFOH 1LYLA 4DV6Q 4IFDG 1QZHA 4DR3L 5IWAQ 5HGQA 3L2PA 1HZBA 1PH1A 1K0RA 4ALPA 5M3FH 2N8NA 2R7DA 4DPGA 1V9PA 4GLAC 5C0XI 4LF9Q 4NXNQ 1I6HH 1PH2A 5C3EH 1EQQA 1YIJA 4GKJQ 4JOIA 1N33L 1HNWQ 3B6YA 1Q7YC 1CKNB 3RLNA 4NPSA 4DR6Q 1J5EQ 1I94Q 4LF5Q 1D8LA 2ZTDA 3K80C 4KLKA 3UE0A 1TWGH 4A3JH 1SROA 1CUKA 1UE5A 4JBWA 1JE5A 3HOUH 1Z9FA 1MJCA 4KHZA 5JEAJ 4GOPB 3W1GA 1N36Q 2ASBA 1XJVA 4A3KG 4PZ8A 1HZCA 3EBEA 3MEFA 1PH7A 1K9MC 2YTXA 1XNRQ 1PH8A 3CC2A 1VQPA 2F4VL 3TS2A 4OWWB 2R92G 2UXDQ 4BBRH 4HIDA 4BA2I 1HJPA 4C3IH 4JC0A 3GO5A 3OTOQ 1BBUA 3KF6A 1JMCA 2R6GA 3HFZB 5GROA 1TWHH 4A3EH 3PO2H 4DV3L 3OW2A 3U4VA 1K73C 3RLFA 3EN2A 5IYBG 3K8AA 2JA6G 5LMNW 4DNIA 4R4TA 3GTOH 4Y52H 2IY5B 1VQCA 2D0PA 3S24A 1VQJA 4DR4L 1N34Q 2VNUD 5M5YH 1K8AC 5K36G 1HNXL 1VQGA 4JI7L 3PO3H 4OXPA 2I5HA 4NXMQ 4OONA 4UPAA 1VQKA 4R4CA 1N9WA 4QY7A 4A3IH 2AMCB 4OX9L 5C4JH 4B3TL 1PYBA 3VDYA 1BVSA 1VQ5A 1V1QA 2UU9L 4LFAL 1K3RA 4QIWE 3J80i 3STBC 4DV0L 1G6PA 2QEXA 3T1YL 1E24A 1KQSA 3BU2A 1CKMA 1SMXA 2UUBQ 4JI0Q 2DGYA 1X9NA 1C9OA 1TWAH 1UWVA 4IPDA 2B63G 1SR3A 1RIPA 2N3SA 2Q2IA 4JI1Q 2I5MX 3M4QA 2JA5G 2BA1A 1Y1VH 2JJQA 3M9BA 4IO9A 1VQLA 3S14H 4BY1G 3FP9A 3BJUA 1GVPA 4LUVA 4NB3A 2JEAI 2Q2HA 3I7FA 1NE3A 1N32L 2CWPA 5J3BA 3RZOH 5C44H 3M4PA 1VQBA 3CCEA 2ZTCA 1J6QA 4GOPC 1GM5A 1P8LA 4LF4L 3CCUA 2E5LQ 4IJHA 3RZDH 1Q81C 1VQAA 3ULLA 4C3JH 2IX1A 2CKZB 2HT1A 4DV1L 1VQ6A 1QUQA 4X65Q 4JV5Q 1AH9A 2JE6I 2E2IH 1Q1BA 1KRSA 3HOYG 2I0QA 4YCUA 1HR0Q 2KENA 1VQNA 3H3VI 4YHHL 1PHJA 4KHPL 1WJJA 4DV2L 5IE8A 1E3PA 4A4IA 1XMQQ 4JI4Q 3CQZH 4O2DA 4P71A 4RMFA 4DR2Q 3AFPA 4LF7Q 2EXDA 3KOJA 3UDFA 4A3MH 4AYBG 1W2BA 1NTGA 4LUZA 2CQOA 4DV7L 4HIMA 2VUMG 1XPOA 1B70B 4JI8L 1PYSB 1QVCA 3TREA 3ZJYC 3CC7A 1RL2A 1VQ4A 1E7ZA 2LXJA 3F2DA 4LF8L 3PUVA 1OTCA 1VQFA 5JEAG 3KF6B 1XNQL 1FVIA 3T1HL 4A3KH 4QGUA 1PH3A 3AQQA 1XPUA 3CMEA 3RNUA 2Z6KA 2R92H 4DV6L 1EWIA 3RN2A 1AE3A 2Q2TA 4A3CG 2UXBQ 4WJ3M 4X64Q 1R9TH 2ZJPA 3J80c 4JBKA 5LMUQ 4DR5Q 5IWAL 1GO3E 1YI2A 3HOWG 5C4XG 2WB1E 3UDIA 5IYBH 4NXNL 2UUCQ 4LF9L 2JA6H 4HIOA 3I4MG 3A5ZB 4XTCS 1EFWA 4BY7G 2AHOB 2GVBA 1YHQA 4GKJL 1IBMQ 1HNWL 4DR6L 1LUZA 4YWLA 2OTLA 1WFQA 4X66Q 1HNZQ 1FGUA 4IJLA 3AEVA 2K14A 2K75A 4IPGA 4MNOA 4QJFA 1YJNA 1SN8A 1J5EL 1I94L 4LF5L 4BXXH 5C44G 2YTYA 4B3MQ 4GKKL 3E0EA 4OWXB 1N36L 4JG2A 2RCNA 3CCVA 1UE7A 1XNRL 2OQKA 4A3DG 4UP8A 3CPFA 4LWCA 4AYBE 4JOIC 4HJ8A 2UXDL 3MXNB 5M5WH 2R93G 3NELA 4JI6Q 1C0AA 1L1OA 4HJ9A 3A74A 3CAMA 5IP9G 2VY3A 4P75A 2NVTH 2RHQB 3OTOL 2IX0A 2B63H 4ME3A 4LF6Q 1KHIA 2JA5H 3CC4A 3PF4A 4A3BG 4POGA 4HIKA 1B7YB 1GKHA 2A19A 4BY1H 2MFIA 2VS1A 3ER0A 5AJ3Q 3CF5A 4A3MG 3I4NH 1VQIA 1YJWA 5EAYA 1IBLQ 2KCMA 2WAQG 2RHSB 1CKOA 1N34L 3TEHB 4JBMA 2BH2A 2V1CC 1JT8A 4A3GG 4OO1G 4BA1I 3UDGA 3STBD 1LM0A 5BR8Q 4NXML 4LFCQ 3L7ZC 1VS0A 2EQSA 4YWMA 1EIFA 4J15A 2BH8A 4DV4Q 3U50C 3F8TA 5LMNQ 3HOYH 4B3RQ 3PF5A 4QQBX 3W1BA 2XTIA 2HQLA 2UUAQ 4GKKQ 5C0XJ 4JI5Q 2UUBL 4JI0L 2R7ZG 3S2DH 4A93G 3CPWA 4A3FG 2PMZE 2VUMH 1I50H 4JI1L 2KHJA 4GLXA 3PCOB 4UP9A 2JA9A 3ULPA 3I56A 1NBWA 4LFBQ 2QGQA 1PFSA 2MO0A 4P72A 3NBHB 3GDEA 3S16H 1OXSC 4BXXG 3E9HA 2MO1A 1HZ9A 3ERSX 4A3CH 3AFQA 4PZ7A 2E5LL 2AWOA 4IFDI 1EIYB 1TXYA 5IT9c 2XGTA 1Q12A 1PH5A 3JC66 3M85A 3KFUA 4X65L 2N78A 4JV5L 3HOWH 5C4XH 2ZM6Q 2UXCQ 1HR0L 2B3GA 2WAQE 3A0JA 2RF4A 3ULJA 4TQUS 5GAGC 5HY6A 3A5UA 4DUYQ 3K7AH 1XMQL 3S15H 3H15A 2WP8J 3I4MH 2QA4A 1X3GA 2F3IA 4JI4L 3GTQH 1L2FA 4DR2L 4BY7H 3GTGH 4BBSG 2YTVA 3WWVA 4JI3Q 4A76A 3PUYA 3U4ZA 5ELOA 2NZHA 1JJ2A 2A8VA 1BKBA 2WB1G 3I4NG 1L1OB 1VQEA 5DLQE 2JA8G 4OO1I 3PUWA 4DR1Q 3S1RH 3M7NA 1IZ6A 2PI2E 4A3DH 2VQFQ 1HH2P 1CSPA 5FLMG 2CCZA 3KJOA 2NVQH 1KC8C 2R93H 1Y14B 4KI0A 5GQOA 2UXBL 4K0KQ 5IP9H 4X64L 2GN5A 3TS0A 1PH6A 1WCMG 5LMUL 4DR5L 2NVXH 2YYZA 1IBKQ 2Q2UA 4HJAA 1XMOQ 3CMAA 4A3BH 1X55A 4IOAA 2HIXA 3CW2C 4WJ4A 2FXQA 4JI2Q 1VQHA 4A3LG 2UUCL 3HOVH 2Z6KC 1YJ9A 4A75A 1X56A 1YZ6A 2OCEA 4GLVB 5GAEC 3CCMA 1GD7A 3S1MH 1Z47A 3M3YH 3KLWA 4DUZQ 2ZJRA 4JI7Q 1QZGA 2K50A 3SGIA 3E9IA 1KD1C 1IBML 4A3GH 3TQYA 3HKSA 4JCVE 4X66L 1HNZL 1N8RC 2CWAA 1LTLA 2OTJA
chains in the Genus database with same CATH superfamily
1TR5A 2DNEA 3CD6A 4GN5A 3DWQA 3KK7A 1J8IA 1VF7A 4PG3A 2XNAC 1LT5D 4KV6A 2F0JA 1IW7C 1TWCH 3JAMi 2A6HC 3P7JA 4DK6C 5CC4A 2AUJD 4CJ0B 2M00A 4A3FH 1C48A 2CFMA 3IAYA 2F0PA 4MHEA 1H9MA 3QG1A 5I9PA 3Q8DA 5AJ3L 3HRZC 3G6EA 1L1OC 3I55A 4LAAA 3T53B 1CQFA 3QJYA 2E2JH 2E2IB 2PQAA 1O80A 2D62A 5HGTA 2NVXB 3U9SA 3PIPA 2VB3X 2K1BA 3K7UC 4OWTB 3K5OA 4JYAQ 1U5KA 3W2DA 1GOZA 4L6TB 5IIFA 2OF1A 5IYDG 4IUNA 3HP3A 2K5NA 3HOVG 2KECA 4KN7C 2CW0D 3CXCA 2K32A 3TN2A 4RCNA 1Q8KA 4FDBA 4N8FA 2JA8H 3MXUA 3UE1A 1JCKB 3GD7A 3J7ZC 1BNZA 5JJLA 4XT3B 1S40A 1R9TB 1F9QA 4FF1A 4J6HA 1K8MA 2R7ZB 1NY4A 1AE2A 3RLOA 1QVFA 1Y8PB 4A3LH 3AU7A 3NWSA 5CYUA 5IP7G 2BA0A 2K4KA 2N49A 1Y69U 2ATWA 4JI3L 1O7IA 1KABA 4DXFA 1O7ZA 4GNXB 3M4OH 1JJCB 2E8GA 3D6WA 1SE4A 2R61A 1QCBD 1HUMA 4DR3Q 1EQRA 4DXGA 1L0WA 1CFMA 2ENBA 2VZAA 3EIVA 4K0KL 5IGFA 3RN5A 2ZJQA 3GTPH 1XTCD 1ASYA 2KEEA 2I07B 3I4NB 1UEBA 3HKZE 1JE4A 3BYYB 4ZK9B 1N33Q 4XYOA 3NUCA 2ID0A 3I72A 3PSIA 5TSSA 4FXGC 5M3MG 5J39A 1M1KC 5IYCG 1GHKA 1SE2A 2Q8IB 4PZ6A 1UE6A 1WCMB 3K0YA 1BCPB 1Q3LA 3SEBA 1Q8IA 4PMCA 1JOOA 2JQOA 2Q8RE 5CV6A 4TRDA 4HJ7A 2PZWA 1SJED 5IT9L 2CHBD 5EPJA 5M3FG 4DAYA 3GTKH 1PVOA 5IYDH 2F0SA 4GN3B 3K5NA 1HA5A 2FHTA 3A8KE 2PNRC 5NUCA 3MXPA 2JEBI 4HSVA 5ELFA 3C3LA 1SEBD 3VYTA 4A3JG 1IL8A 1B3QA 4B3TQ 1B50A 4MTKA 2UU9Q 2RKSA 2RSOA 1ASZA 5G3LF 1ZYRC 3S15B 2NZ1D 1DM0B 4EX5A 3I4MB 2Y0SB 4POFA 1X6OA 3BVGA 5C0XG 1GUTA 5IP7H 1GUOA 3MAQA 2B2TC 3OYYA 2PYKA 1HR0W 2EJFC 1EYCA 3S1RB 1S5FD 1X32A 2ZTEA 5J22A 4LF4Q 2JXMB 4A3DB 2HDLA 1XPRA 4IURA 1VQ9A 3DM1A 2R93B 2A1AA 4RH6A 3RR5A 5C5LA 3PUZA 3VR4A 1Q90A 1AFPA 1PA6A 3ND8A 1G291 3R8BA 4ZUJA 4APVA 4K14A 1AEXA 5FLXE 2EIFA 4GS3A 5M3MH 3I4LA 5JPNC 1QB5D 3BDCA 3Q6SA 2A5HA 4J1MA 4L5TA 1NUCA 1SFOH 2QKIC 4WFN3 1TWCB 4DNRB 4C3JG 1V1PB 4H0LC 1PH1A 1K0RA 2B8GA 1PMRA 2L0CA 5M3FH 2JA7B 1IYUA 1V9PA 4NXNQ 1CTMA 5AFWA 5C0XI 1YNND 3H0GB 5JOBA 3B6YA 1JORA 3R3OA 1S4ZA 1EQVA 2E76C 1J5EQ 1I94Q 4LF5Q 3UE0A 2ZTDA 4KLKA 4A3JH 1TWGH 1AP0A 1CUKA 1UE5A 2XSCA 1Z9FA 1N36Q 3EBEA 5I2YA 2CVRA 2YTXA 1PH8A 1WD0A 2UXDQ 4ZQ3A 4BA2I 1HJPA 2EOTA 2F0HA 2RQXA 5C0XH 5GROA 3JAML 4DV3L 4ME5A 3U4VA 1K73C 5LMNW 4DNIA 3HOZB 1Y1WB 2KUMA 1UEAB 1VQCA 3S24A 1N34Q 5M5YH 1HNXL 1UNSA 3LNNA 4OONA 3E5SA 2CW0C 2L9HA 4QY7A 2AMCB 2SOBA 1BVSA 1VQ5A 1V1QA 4LFAL 1K3RA 1SNQA 4DV0L 1LTRD 3QR8A 3BU2A 1SMXA 2DGYA 1X9NA 2PPBC 3C1EA 2B63G 1SR3A 2BE5C 2Q2IA 4XQJA 3M4QA 2DY8A 3MXNA 4NB3A 4LUVA 1AZPA 4N9PA 1N32L 2CWPA 5J3BA 4O42A 4EQOA 2N88A 4BBRB 3CCUA 1VQAA 4C3JH 2CKZB 2D5DA 1A3UA 1PZKD 5EKKA 4X65Q 2DNCA 3GTPB 2JE6I 2I0QA 4YCUA 1HR0Q 2QEJC 1PHJA 4KHPL 3C46A 5IE8A 1E3PA 2RBMA 4JI4Q 4P71A 3NE5B 4KK7A 3AFPA 3KOJA 3QIAA 4A3MH 3W3AA 1NTGA 4DV7L 4HIMA 3PO3B 3C1FA 1X3QA 2KVMA 3TREA 3CC7A 3CRKC 3A8JE 1LV9A 3V96A 3PUVA 3TDQA 1VQFA 3KF6B 2ZT9C 1PH3A 3A7LA 3F2UA 3RN2A 1EWIA 2Q2TA 5KYIA 1G6ZA 2AQ1B 2EPBA 4X64Q 2A68D 3NBHA 4HN7A 5EBDA 2WB1E 1LTID 1EFWA 3GV3A 4QMGA 2ICIA 4DR6L 1EWHA 4YWLA 4X66Q 3AEVA 2K75A 4OELB 5CV8A 1YJNA 2A6EC 1KAAA 3HEJA 4GKKL 2MUYA 2IL8A 4LK1C 2B2WC 1VMCA 2NTTA 1LTSD 5IP9G 2NVTH 4P75A 2RHQB 3J7AF 2B63H 1A6XA 1W6JA 3NTKA 4POGA 4RWSC 2A19A 1CK1A 3BDOA 4ZRZA 4A3KB 3K58A 1PTOB 5EAYA 4JBMA 3OIQA 1U9RA 4A3GG 2Z4HA 2FMCA 2F0QA 5E3FA 1HTLD 4U673 1LM0A 4NXML 4LFCQ 3L7ZC 5CMDA 2O2LD 4XXEA 4I65A 4RGTA 1H9RA 1WVLA 5LMNQ 3PF5A 3W1BA 2JA6B 2F0DA 2HQLA 2DY7A 4IUUA 2LKVA 5C0XJ 2R7ZG 2UUBL 4JI0L 5ELCA 3S2DH 2L11A 4S3SA 3SHLA 1PDQA 1DOLA 3SK4A 1I50H 5COYA 4C3HG 2JA9A 3I56A 4CKCA 5CBEE 1PFSA 2MO0A 2F1MA 4I7AA 1Z6HA 5M5WB 1HA6A 2SDFA 2E5LL 4LJZC 1I4RA 1TXYA 2XGTA 3M85A 2N78A 2QF7A 5EJWA 1HTPA 2JA5B 5CV9A 2UXCQ 5E4XA 2B3GA 2WKDA 1KLUD 5FO8B 3ULJA 3FDTA 4DU9A 1MD2D 4EVOA 2QA4A 4DR2L 1EZ6A 4BBSG 3J80E 1CHQD 1YNNC 5KNCA 3I4NG 1EY0A 1TS2A 1L1OB 1CZWA 4X3SA 1IZ6A 1CSPA 5FLMG 3KJOA 3SE0A 4KI0A 2X6GA 3NWTA 5IP9H 4TKOB 1WCMG 2NVXH 3MZ5A 3I91A 4HJAA 1X55A 1T5XD 4H13C 2FXQA 4KY5A 2F3VA 5M5YB 1YJ9A 3CCMA 1Z47A 4JI7Q 3EQLC 3E9IA 1IBML 4A3GH 1N8RC 1FNVA 3WOEA 1D2BA 2SEBD 3I90A 5CV4A 3HOWB 1QVGA 2ES2A 3FPPA 2VQEQ 1X54A 3ND9A 2EYPA 3G4SA 3H91A 4JI6L 2R7ZH 3GTGB 3D0FA 4XIGS 1YNJD 4YWKA 3KDFA 2WFWA 4C3HH 2Y0SG 3N52A 2G9HD 3KYHC 2IHEA 1Q46A 4DR7Q 2JYOA 1QG7A 1OXUA 1X3FA 2RCFA 1K3BC 1RKNA 4IOCA 1TT2A 4R8NA 5E7NA 1VQMA 4B3SQ 4AQYQ 4MIUA 3GTJH 4DV4L 1SJHD 3EA6A 4K6DA 1ZKOA 4IUQA 1IKMA 4B3RL 1JB3A 4A3MB 5KEEA 1VQOA 2UUAL 2EXZA 3M3YB 1I4PA 3MHBA 1LACA 3AB9A 4JI5L 4G7HC 4R1JA 4BBSH 3FHWA 3MVVA 4X62Q 1NMFA 1RODA 4C2MB 1HCZA 1YEZA 2DN8A 2F0GA 4RA8A 3IKJA 1PH9A 5H1SE 2HHHQ 5FLMH 2F0WA 2ZXOA 1B8AA 3OOCA 1WCMH 4F88A 5FJ8G 2ZM6L 1ML0D 2AKWB 4HCEA 4DUYL 2HUGA 1WTHA 1JJGA 2ICEC 2JA7G 3J7A5 4JBJA 1VQDA 4QUFA 1HUNA 1PV4A 1Q82C 3H0GG 1WTWA 4P74A 3VR2A 4DR1L 1EY9A 1SLJA 3DUZA 3DEOA 1HFGA 2NVYB 4B9XA 2H4OA 2TMPA 4H7BA 1HZAA 4R9WA 3Q22A 3W5OA 1H9KA 1R4QB 1VCIA 1K28A 2ZXRA 4ZCKA 1W3SA 3D4RA 2K5HA 3GTMH 4YCVA 4LF7L 4IUPA 4ULLA 4K2LA 4DUZL 3QOJA 3CP0A 4RG1A 4XYQA 3N6RA 3IFTA 3HOZG 4QUCA 1BBWA 1Y1WG 3OMGA 2F4VQ 2EYLA 4DAMA 1A2UA 2F0MA 5GAHC 1MSHA 3KBXA 1S3OA 3KF8A 1IKLA 1XYIA 1RF2D 1PZID 1SYCA 3S2DB 1T9HA 1CA6A 1DYQA 1I50B 1M90C 3M7GA 4XDXA 1I5FA 3G71A 1LABA 2K52A 1QILA 4DR4Q 1TVXA 3EFXD 3I2ZA 1DD2A 3FKIB 4X6AH 4OX9Q 3D4WA 1CKNA 2C9OA 2MPMA 4HR7B 5FJ8H 3T1YQ 4BBRG 5F2DA 4ID6A 4JYAL 1TWFH 1RTOA 4GOPA 2L4NA 2F0IA 4A3EG 4HMIA 3PO2G 4IALA 2JA7H 1HRJA 1VF5C 3K81C 1X3PA 3H0GH 3DMUA 4IPCA 1CSQA 2YU9B 3J81i 1TS4A 1X3EA 3PO3G 4TVAB 4AH6A 1S5BD 4DV1Q 5ELEA 5CV7A 5EBCA 3J81j 1KL9A 2B2YA 2WINB 3H3VH 1MGSA 1EUJA 4YHHQ 4R8IA 4DV2Q 4L5QA 3PUXA 1II3A 4NW2A 4RKBA 4A3GB 2I5LX 2ZXPA 1K8GA 1IL2A 1IYVA 4LF8Q 3UI2A 1YHBA 4QF4A 3MXGA 3NENA 3HOZH 3T1HQ 1Y1WH 3FRPB 3IFDA 1ILQA 4FVMA 1ENCA 1LYLA 4IFDG 1AZQA 4DR3L 3OWEB 5IWAQ 4K8IA 4ALPA 5M5XB 2R7DA 2FMMA 4GLAC 4LF9Q 4C3HB 2FFKB 3DEPA 3DWPA 1YIJA 4GKJQ 4JOIA 1N33L 1HNWQ 1Q7YC 3DXJC 4NPSA 1K8OA 1D8LA 3K80C 1SROA 1SYFA 1JE5A 2JN4A 2B8FA 3GTJB 3W1GA 4CJ2C 1XJVA 4A3KG 4PZ8A 1SNDA 1HZCA 3MEFA 1XNRQ 1PH7A 1VQPA 4BBRH 4HIDA 3OTOQ 1KDBA 2EJMA 3VA7A 4BBSB 3HFZB 3VR3A 4A3EH 3PO2H 1J9OA 3OW2A 3RLFA 3EN2A 1BXTA 3K8AA 2JA6G 3GTOH 2F03A 1VQJA 1BF4A 1VQGA 2XWJB 1STYA 3ZYYX 3PO3H 2I5HA 2RDFA 1C4QA 1F2ZA 4KHVA 4B3TL 4MN3A 4QCLA 2IX3A 2UU9L 3Q24A 3J80i 2QEXA 1QE6A 2E75C 3V05A 1CKMA 2O5JC 1RTNA 1TWAH 4IPDA 2N3SA 4JI1Q 2I5MX 2JA5G 5ISRA 5A2QL 3D8GA 3BJUA 1GVPA 3I7FA 3RMHA 4FF4A 3PIO3 4LF4L 4IUVA 4IFDH 1PRTF 4C3IB 1Q81C 1VQ6A 1T5EA 4JV5Q 5JVH3 1AH9A 1KDCA 5KNDA 1VQNA 4FNFA 3I8ZA 3WOFA 3E3XA 3GTMB 1SYGA 4F8MA 2EXDA 3UDFA 1B9NA 2RDGA 4AYBG 1W2BA 4LUZA 5DAUA 1B70B 2EY2A 1QVCA 4RGOS 3F2DA 3NBIA 1FGBD 5JEAG 1H9SA 4A3KH 4DN4M 4BWGB 1PTOH 3AQQA 1XPUA 3CMEA 2Z8LA 1WTQA 1KTKA 2UXBQ 3I70A 2K04A 1GO3E 3HOWG 1F9SA 1LO5D 1MI2A 1Y1VB 2PW7A 4PMBA 2KCNA 2UUCQ 4NXNL 2JA6H 3MTSA 1DOKA 2B2UC 1LT6D 4OL7A 3SDZA 2BOSA 2K14A 4IPGA 1J5EL 4BXXH 2B39A 1I94L 4LF5L 1LTBD 2L1BA 4B3MQ 3E0EA 4DF7A 1N36L 3E6ZX 5C3WA 2B2UA 2OQKA 4RKLA 3BS1A 1TWFB 2UXDL 5LL6S 5M5WH 3NELA 3A74A 3CAMA 3HS0C 5JAVA 5BN3A 3H6MA 1TS5A 1SXTA 1EEID 4ME3A 1KHIA 2JA5H 3CC4A 4LF6Q 1B7YB 1GKHA 3MWYW 2MFIA 1ESRA 3ER0A 3FPUB 3CF5A 4A3MG 1QJOA 1IBLQ 2RHSB 1CKOA 1N34L 3TEHB 1JT8A 2V1CC 2R92B 1SYBA 2F0FA 4BA1I 3STBD 1HXYD 5BR8Q 3DHQA 1I4QA 2E74C 1OO9B 2Z4IA 1EFID 1EIFA 4J15A 3U50C 3F8TA 4QQBX 1SNMA 3OPOA 3K5MA 3OSOA 1L0XB 4KTAA 4X3KA 2B2VA 2MJ8A 4I7ZC 5DM73 4GLXA 2X69A 4UP9A 3R93A 1IHZA 4BS9A 4LFBQ 2QGQA 2OT2A 2NTSA 1B4OA 5JEAH 4OGQC 1SNPA 1TY2A 2NWGA 1FNWA 5KYLA 1HZ9A 3NQIA 3J81L 2AWOA 5IT9c 3KFUA 4X65L 2LFNA 1F77A 3HOWH 1MSGA 3NTHA 1TIID 3Q23A 1HR0L 1CI3M 2HDMA 2WAQE 4JW0A 4KKSA 2RF4A 4TQUS 5GAGC 2WP8J 4NDXA 4JI4L 2SNMA 1I4GA 3GTGH 1JR0D 4K5VA 5I2XA 2K33A 3PUYA 4A76A 1SYEA 3MFYA 3QOLA 5DLQE 3PUWA 3HOYB 5CORA 2PI2E 2VQFQ 2CCZA 3QWNA 2NVQH 1D1IA 5GQOA 2F0UA 4A3EB 4RGNA 3PO2B 4X64L 1FR3A 3NSWA 1PH6A 1F9RA 4OEMB 5IGBA 3SR1A 1IBKQ 2Q2UA 1XMOQ 3GTOB 4DAPA 4WJWA 4IOAA 4WJ4A 2HIXA 3CW2C 1XWEA 1D6EC 2NYZD 4JI2Q 5BN5A 1VQHA 1YZ6A 2OCEA 1SE3A 5FO7B 5HURA 1GD7A 2L5TA 3M3YH 2ZJRA 3CU7A 4ZKBB 1BOSA 3KLRA 4KD4A 1EY4A 5DNFA 3TQYA 3K6OA 4X66L 1LTLA 1EOTA 4C2MH 1A62A 4RGMA 1EYDA 3P75A 5C4XB 2EY1A 3EJIA 3FKIG 4GNXA 1TWAB 1EY8A 2ALYB 4XQNA 4MTNA 2FINB 3R2IA 2MP1A 1KXLA 1VMPA 1EWCA 2O5IC 2NZOA 2NBFA 2G9DA 2Z0SA 1IYJB 2F3WA 5I4DA 3HZXA 4LFCL 3CCQA 3LWUA 3T56B 4A3BB 4EQ5A 4OIKA 4Y7NH 5LMNL 1VDZA 2H1EA 3T16A 4MZ9A 4DV5Q 5FKAC 4DGZA 4QIWB 2D9UA 2NVYH 4KY7A 3MC0B 4YY3Q 4K2KA 3CCSA 3BZCA 1MJEA 1QUQB 1EOVA 4K8JA 1STAA 4H02A 1YBYA 4KY6A 1G91A 2VL6A 3HKZG 1FJGQ 1IXRA 1G51A 2F52A 4EQNA 1UE1A 5EPKA 2HCCA 1WYDA 4A93B 4HJ5A 3JAMc 3VA5A 3KJPA 4PMWA 4YCWA 1MKHA 2JSOA 1VQ7A 2B29A 3TP6A 2RDHA 3A54A 2UXCL 3TBIB 1F9PA 5T1IA 3NXWA 3U58A 1S5DD 3F2BA 1I4XA 3C2PA 4ZAIA 3J81c 1PRTD 1HQMC 2EYHA 1EU4A 4PNYA 4V190 2TSSA 2IHFA 2C5CA 3FKIH 3VR5A 2AWNA 1H95A 2SNSA 1TQOA 5C4ZA 5K5PA 5CBAE 3TRZA 5JJIA 1QNKA 2F0VA 4ABNA 5GADC 2PQAB 2NN6G 1EY6A 1OXTA 1C7YA 1S5CD 3S17B 1KNEA 3CCJA 1IW7D 4F7XA 1GUSA 1U4PA 4R4IA 2YU9H 2HCIA 2VQEL 2EZVA 3P1HA 4AYBB 4UDUC 1F2LA 1E22A 1SSOA 1X65A 1V1PA 2PI2A 2K5QA 3J7AV 1S72A 1E1TA 3A7AB 5JPMC 1OXXK 2JP1A 4DR7L 1FYCA 1E2ZA 3I4OA 2RVLA 2HIVA 1GUNA 4HSPA 4B3SL 4AQYL 2EYJA 4UY8C 4C56C 4C3IG 1OXVA 2NB0A 4DK1A 4ODGA 3PIOA 5M5XH 1WTXA 1U4MA 4X62L 4C1NI 2PMZB 2NN6I 2M9VA 3V2TA 3S1NB 2WACA 2A74C 1BCPF 4R4QA 2NVQB 5J1ZA 1U0LA 1BUVT 4M8AA 2HHHL 5CGKA 3BZKA 1D5MC 5JJZA 3NEMA 4F87A 3DM3A 4IQZA 1W6KA 5EQ0A 3M4YA 4DKAC 2IJ0A 4CHTB 3FVQA 4E6IA 2GVAA 2K5VA 4LW1A 5IY0A 3QB3A 4JI8Q 3CCLA 4L63B 1Y1VG 2BH2A 2NN6H 1SRUA 2DUDA 1XNQQ 4L5SA 1DGSA 1LT3D 4DAYB 2D2CC 3TP7A 3I73A 4DV6Q 2XRQD 3S1QB 4RCOA 3L2PA 1HZBA 1WTPA 4ZKCB 2N8NA 5D14A 1PH2A 4CDCC 1RCVD 1EQQA 4P2CB 2A68C 5FK9C 1L0YB 4G57A 1STEA 4KHZA 1KLGD 4Y7NB 1K9MC 3TS2A 2F4VL 2R92G 4KMUC 2J4XA 1EU3A 1TU2B 1TS3A 4C3IH 3GO5A 1BBUA 3KF6A 2LY7A 1JMCA 1DXMA 2IW3A 5IYBG 5M9OA 4R4TA 4KD3A 4KKTA 4DR4L 5EPLA 5K36G 4J8QA 4UPAA 1ZYRD 3CRLC 4R4CA 4HAEA 4OX9L 1I6HB 1PFNA 3T1YL 1M8AA 1V1OA 2HQEA 1UWVA 2HD3A 3BZDB 4N8X1 1WTOA 1FNUA 1Y1VH 3M9BA 3RD4A 4IO9A 1VQLA 3FP9A 1NR2A 5IGCA 3HOUB 2JEAI 1NE3A 3A55A 3MFGA 5C44H 1VQBA 3CCEA 2ZTCA 1J6QA 2LS01 4GOPC 1GM5A 1P8LA 2Z6BA 3RZDH 3ULLA 4K5WA 4DV1L 1QUQA 2EY5A 1PRTC 4CDEC 1HFNA 3O13A 2F0EA 3HOYG 4B9WA 2KENA 1UUPA 3H3VI 4YHHL 4DV2L 1XMQQ 4A4IA 2BDOA 3CQZH 4O2DA 1DONA 4LF7Q 1BBXC 5C5MA 1XPOA 3ZJYC 1VQ4A 1RL2A 2B2YC 3FEWX 2CQAA 2QCPX 1E7ZA 2LXJA 2XWBB 4A3IB 4LF8L 2EVBA 5C4JB 3SK6A 1FVIA 3T1HL 1AW7A 2R3ZA 3RNUA 2Z6KA 4IUTA 2R92H 4A3CG 1AE3A 2A69D 4WJ3M 2J0TD 2EY6A 5LMUQ 1O78A 5IWAL 4DR5Q 1YI2A 4NMZA 1CQVA 5C4XG 3S14B 2GA4B 4XT1B 1UAPA 5IYBH 4LF9L 1ENAA 4HIOA 3RZOB 1RJTA 5L37A 2CH4A 3A5ZB 4FP5D 1JOQA 2GVBA 1YHQA 4GKJL 3HKZB 5K36H 1HNWL 1WFQA 1SBBB 2RA4A 5IODA 4IJLA 1HNZQ 1ZEQX 3KUPA 1SN8A 2YTYA 5I9OA 1UE7A 1XNRL 3CPFA 4L8JA 4CKEA 4JOIC 4HEDA 3MXNB 1L1OA 2K03A 1FD7D 4HJ9A 2VY3A 3U9OA 3OTOL 1XXGA 2IX0A 4OIJA 3ITPA 3SK8A 3PF4A 4A3BG 3GP7A 1WTRA 2VS1A 5AJ3Q 4YIJA 1VQIA 1YJWA 2KCMA 1YNJC 3LWEA 5DEHA 3UDGA 3OIPA 3KLSX 1KNAA 1M4VA 2EQSA 4YWMA 3Q0AA 2EDGA 2BE5D 3HOYH 1G8ZD 4HMJA 2XTIA 2EYFA 3T4AC 4A93G 5KGUA 1ZXTA 3VYUA 2E2DC 4PV1C 4JI1L 2KHJA 3A56A 3BVZA 5D3IB 3ULPA 3VYSA 4XQQA 4P72A 4JVZA 3NBHB 4WRDA 3GDEA 5IGEA 3S16H 1ICWA 1JWUD 1E2WA 4BXXG 1EIGA 3E9HA 2MO1A 4A3CH 3AFQA 4PZ7A 3H09A 4K6LA 1SNOA 1EIYB 4IFDI 1Q12A 3JC66 3L9AX 2MGSA 4X3UA 4JV5L 1B1ZA 1I4HA 3EROA 5LHY1 5C4XH 4BY1B 1LTTD 5FLXL 5HY6A 3H15A 2X6LA 1E2VA 4UHVA 1PTOF 5ELDA 3NK9A 3OMCA 1G2TA 3WWVA 4G7ZC 2K01A 4JI3Q 1BCPD 2XN9C 5ELOA 2BDNA 2NZHA 1JJ2A 2KA7A 3DWAA 4G7OC 3M7NA 5IGDA 1HH2P 1LLRD 1KC8C 2UXBL 4K0KQ 3HGBA 3TS0A 2GN5A 4EQPA 1ET6A 4G4KA 4FF3A 2VUMB 2YYZA 4NP5A 4K5XA 3OW7A 1WD1A 3CMAA 4A3BH 1HPCA 3KLSA 2UUCL 3NTIA 3K59A 3HOVH 1BQQT 2A6ED 3GV6A 1X56A 3KLWA 1QZGA 3SGIA 2DJFC 2QILA 3NQTA 3HKSA 5ELBA 2CWAA 2Q8TA 2K28A 4AIMA 3DLLA 1PH4A 2KHIA 4B3ML 3URYA 1EYGA 2E2HH 2LXKA 5DM63 2PQEA 4KJOA 4RAUC 3F2CA 1Q1EA 4DK3C 1HHVA 3F1ZA 3K7AB 3SK5A 3GTQB 4BY7B 1LTAD 4OHJA 1XTDA 3G6JB 4A93H 1EQTA 1EEFD 3TP5A 2L55A 4LF6L 2F0LA 4CBVA 5C44B 1Q86C 3LGJA 3ONAB 1FL0A 3K57A 4LNQA 2OXPA 1IBLL 3P20A 3RZDB 4KJNA 1KRTA 5KNBA 1LTGD 3IL8A 5BR8L 5FO9B 2PO4A 2B2TA 2J7ZA 1E1OA 3T51B 3PV0A 4ZLTF 2Z1CA 3HOXG 3CQZB 3PGZA 2EYMA 3S1MB 3TZDA 3I3CA 1F2YA 1WOCA 2WAQB 1ICFB 5IT9E 4IPHA 4R4OA 4O0AA 2VW9A 5IYCH 5A2QE 1SMYD 1ET9A 4LFBL 2FJ2A 1U4RA 1A0IA 2G5DA 3QO2A 2B2VC 1CT1D 1V8QA 1BR9A 2XIWA 1SYDA 3S17H 1WI5A 3CCRA 2L12A 4A3FB 2AUKA 2Y0SE 3AYHB 3J7YW 2C35B 2JK8A 1LT4D 1SE8A 2A69C 4FXDA 4LUOA 1B2TA 2R7FA 3IRBA 4GN4B 2V4DA 3ICEA 5JJKA 1JWSD 3PMFA 3BG3A 4U68A 2E2JB 1PFBA 2LSSA 5ELNA 4IZ8A 2IWHA 3BVMA 3KDFB 5FLXc 1I3QH 2VQFL 1CHPD 2DJGC 3L0OA 3BYTB 1STBA 2VB2X 4C1NK 1JOKA 2P5ZX 2PNHA 4QL5A 1IBKL 2KBNA 2KJXA 1XMOL 2WB1B 2L15A 1VQ8A 2JA8B 4JI2L 1YNXA 5T1GA 1STGA 2KOLA 1NMGA 5CV5A 3SXHA 5IGGA 4L5RC 2OQ0A 2BCOA 4GZYC 5EGTA 2IT1A 5IOCA 3S1NH 4IFDJ 2IPKD 3VYRA 1GJXA 3WDNA 3HOXH 3GTLH 1ENFA 1A2TA 4P73A 4DAVA 1BDOA 4DV3Q 1YITA 2OEOA 1KAWA 1D7QA 3UDXA 3D31A 3M4OB 1A63A 5C3EG 5FOBB 3NPPA 3S16B 1ESFA 2KEDA 5C3XA 1HNXQ 4UP7A 2KCCA 4GNXC 2MNAA 1PZJD 2MQHA 1KIXA 2KCTA 2F0OA 1I6VC 3S2HH 1O7YA 2K5WA 2XRSD 3L3OC 3HOUG 1RD9D 4WORA 2OWOA 4LFAQ 4DNTB 2CH4W 2N55A 4DV0Q 2LMCB 3S1QH 1STNA 4DV5L 3TMEA 2EJGC 1H9JA 1YVCA 3G48A 3PIP3 1F2MA 4YY3L 3JAME 1N32Q 3D6CA 1O7LA 3A8IE 1MIUA 1B9MA 1YHAA 3AMUA 1BCPC 1A15A 4FF2A 4KKUA 1FJGL 2EYOA 2QDBA 1V43A 4A3IG 3GTKB 1CM9A 2K7VA 1K83H 1P16A 1NJIC 4IN3A 3J81E 4KHPQ 3HOVB 4Q5VA 2WV6D 5C6AA 1Z7TA 1GUGA 1PYWD 1PXUA 3E0JA 3K0XA 5KRUA 3J80L 3TZUA 5D3DA 4DV7Q 2WKCA 1JB7A 2H5XA 2YV5A 3LX0A 2D0OA 2PCFB 2VXWA 3KF8B 1A8VA 1RDPD 2E2HB 1STHA 1QZHA 4M1UB 5HGQA 3NHHA 1RHPA 1SAPA 4DPGA 1PLFA 3D4DA 1I6HH 1PTOD 5C3EH 1NAPA 1QWYA 4RFBA 1JQYD 2B2WA 2F0KA 1C8CA 4FYDA 1EIHA 4DR6Q 1CKNB 1DJRD 3RLNA 4RHSA 3PQIA 4GKKQ 4JBWA 3HOUH 5JEAJ 1MJCA 1S5ED 4GOPB 2ASBA 1NCVA 1NR4A 1B3AA 3CC2A 3OWFA 4OWWB 2QW7A 1WTVA 1PRTB 4CJ1B 5LL6X 4X3TA 4H44C 4JC0A 3MA2B 1D1KA 2EE1A 2R6GA 1TWHH 5M3MB 4QB4A 1TY0A 1NNXA 1XX8A 4Y52H 2M2LA 2IY5B 2D0PA 4DK0A 1JC7A 1JICA 2VNUD 1SFOB 1K8AC 1ILPA 4JI7L 4OXPA 4ZYSA 4NXMQ 1VQKA 4TSSA 3TP8A 2A6HD 1N9WA 1SMYC 2K5DA 4A3IH 5G3LD 5M3FB 5C4JH 1PYBA 3VDYA 1A3VA 1EZ8A 1SNCA 4QIWE 4FXKC 3STBC 4KN4C 1G6PA 2A73B 1E24A 1KQSA 2UUBQ 4JI0Q 1C9OA 2K6AA 1RIPA 5BN4A 2BA1A 2JJQA 2AQ2B 4A3JB 1GUWA 1TWGB 3S14H 1TKWB 4BY1G 2Q2HA 1AN8A 3RZOH 3M4PA 1QNUA 3H3VC 1I3QB 2E5LQ 4IJHA 2IX1A 2HT1A 4NKLA 1D5XC 2E2IH 1Q1BA 1KRSA 4HCSA 5CR3A 4DA2A 3MEHA 1R4PB 1ONLA 1WJJA 1SDFA 3GQBA 4RMFA 4DR2Q 3CHBD 2O4XA 2VUMG 2CQOA 1K0SA 4JI8L 1PYSB 4FO2A 5C4HA 1OTCA 4LMQD 1XNQL 4CDDC 1JWMD 4O1NA 4QGUA 3HOXB 2Z9HA 3GTLB 4DV6L 3TSSA 3FMCA 1Y8NB 2I46A 1R9TH 2ZJPA 3J80c 4JBKA 1EY7A 1PFMA 1HQRD 3S9WA 1U4LA 3UDIA 4N9TA 1DZ1A 3H94A 3I4MG 4XTCS 3NP8A 4BY7G 3R2TA 2AHOB 1D5ZC 1IBMQ 1G2SA 4Q0FA 1LUZA 2OTLA 3S2HB 4ZUIA 1DOMA 1FGUA 4C3JB 4MNOA 4QJFA 5C44G 4OWXB 4JG2A 3VR6A 2RCNA 1EY5A 3CCVA 5I6WA 4A3DG 4UP8A 1EYAA 4LWCA 4V0BA 4AYBE 4HJ8A 3KBGA 4UAIA 2R93G 4JI6Q 3BDLA 1C0AA 3D3RA 3ERQA 4JPBW 4HIKA 2PZTA 5EKIA 4BY1H 1GHJA 3CKIB 3I4NH 4B08A 2WAQG 4PQXA 1E0BA 1B53A 4CKBA 1A3TA 1B44D 4OO1G 5E1FA 1MHWC 2K05A 1K83B 1VS0A 4DV4Q 2BH8A 3T13A 2PZUA 4B3RQ 3EVQA 4JK1C 3X3NA 1CA5A 2PW5A 2UUAQ 4EGVA 4CDFC 2AQ3B 4JI5Q 2F0NA 2RSNA 1H9SB 3CPWA 4DFAA 4A3FG 2PMZE 2VUMH 1QOHA 3PCOB 1Y8OB 1NBWA 2F0TA 5D65A 2XVSA 1MBYA 4RHRA 4HTHA 1OXSC 5I6YA 3ERSX 3G7LA 3OHXC 2NVTB 2WIIB 1PH5A 2F4IA 5KIXA 2B63B 1NSNS 1KDAA 2KQ3A 3K5LA 5JVG3 3HG9A 4ILWA 5C3EB 2ZM6Q 3A0JA 2KHSA 4DUYQ 3A5UA 3S15H 3K7AH 4Z9CB 1XMQL 3I4MH 3GTQH 1X3GA 1DCZA 2F3IA 1L2FA 4BY7H 2YTVA 3SVMA 3U4ZA 1PTOC 2A8VA 1BKBA 2WB1G 5E4WC 1VQEA 2JA8G 4OO1I 1EL0A 4DR1Q 3S1RH 2NUCA 4A3DH 2R93H 1Y14B 3RUZA 1TWHB 2MHVA 5LMUL 4DR5L 1GXDC 3X3MA 4A3LG 5EKLA 1BO0A 2Z6KC 4CGYB 4A75A 5GAEC 4GLVB 3S1MH 5A35A 4DUZQ 2K50A 1CZGA 1KD1C 2QDLA 4OO1H 4JCVE 1HNZL 2OTJA
chains in the Genus database with same CATH topology
4C2MH 4AIMA 3DLLA 1PH4A 1A62A 2KHIA 4B3ML 3CD6A 1EYGA 2E2HH 1QVGA 4GN5A 2ES2A 2LXKA 3F2CA 2VQEQ 1Q1EA 4PG3A 4DK3C 3FKIG 1X54A 4GNXA 3F1ZA 2ALYB 1TWCH 3JAMi 3G4SA 4DK6C 4JI6L 2R7ZH 1XTDA 4MTNA 4A93H 3D0FA 4A3FH 4XIGS 2CFMA 4YWKA 3KDFA 2WFWA 4LF6L 4C3HH 1KXLA 1Q86C 2Y0SG 3LGJA 3Q8DA 5AJ3L 2NZOA 1FL0A 3KYHC 2IHEA 3G6EA 4LNQA 1Q46A 1IBLL 1L1OC 3I55A 4DR7Q 2Z0SA 1OXUA 1X3FA 1KRTA 4IOCA 1IYJB 5E7NA 1VQMA 5BR8L 2E2JH 2PQAA 2D62A 4LFCL 3CCQA 4AQYQ 4B3SQ 1E1OA 3PIPA 3GTJH 3PV0A 4DV4L 4EQ5A 4Y7NH 4JYAQ 3K7UC 4OWTB 3HOXG 5LMNL 4B3RL 4MZ9A 4DV5Q 1U5KA 3PGZA 2NVYH 1VQOA 2UUAL 1WOCA 5IYDG 4JI5L 4YY3Q 4R1JA 4BBSH 3FHWA 4IPHA 4R4OA 4X62Q 1NMFA 2K5NA 3CCSA 3BZCA 3HOVG 4O0AA 2VW9A 3CXCA 1MJEA 1QUQB 5IYCH 1EOVA 1Q8KA 4FDBA 1YBYA 1YEZA 4H02A 2JA8H 3UE1A 3GD7A 4LFBL 3J7ZC 1PH9A 1A0IA 2VL6A 5H1SE 3HKZG 2HHHQ 1FJGQ 1IXRA 1G51A 1S40A 5JJLA 2F52A 1UE1A 5FLMH 3S17H 1WYDA 1WI5A 3CCRA 4HJ5A 1B8AA 1NY4A 1AE2A 1WCMH 3JAMc 2Y0SE 5FJ8G 3AYHB 4PMWA 4YCWA 3RLOA 2C35B 1MKHA 2JK8A 3KJPA 1VQ7A 1QVFA 2B29A 1SE8A 2ZM6L 2UXCL 4LUOA 2AKWB 4A3LH 2R7FA 3IRBA 4GN4B 4DUYL 3U58A 5IP7G 3F2BA 3ICEA 5JJKA 1JJGA 2JA7G 3J7A5 2BA0A 2K4KA 2N49A 4JBJA 2ATWA 1VQDA 4JI3L 1O7IA 3M4OH 3J81c 4GNXB 1JJCB 1PV4A 1Q82C 3H0GG 4P74A 2LSSA 2E8GA 5ELNA 4DR1L 1SLJA 2IHFA 4DR3Q 3KDFB 3FKIH 1I3QH 5FLXc 2VQFL 2AWNA 1EQRA 3L0OA 1L0WA 1HZAA 2VZAA 3EIVA 3W5OA 4K0KL 3RN5A 1H95A 2ZJQA 3GTPH 2PNHA 4QL5A 1VCIA 1IBKL 1ASYA 2KBNA 1XMOL 3TRZA 1UEBA 1W3SA 2L15A 5JJIA 1VQ8A 3HKZE 2K5HA 4JI2L 1N33Q 3GTMH 4YCVA 5GADC 2PQAB 4LF7L 1YNXA 2ID0A 3PSIA 5M3MG 4L5RC 2NN6G 1NMGA 1OXTA 4RG1A 3CP0A 4DUZL 1C7YA 1M1KC 5IYCG 2OQ0A 3HOZG 3CCJA 1BBWA 2IT1A 1UE6A 4PZ6A 1Y1WG 2F4VQ 4DAMA 3S1NH 2JQOA 4IFDJ 4R4IA 5GAHC 2YU9H 1S3OA 3HOXH 4HJ7A 2VQEL 3GTLH 1T9HA 4P73A 5M3FG 4DV3Q 1YITA 3GTKH 1PVOA 5IYDH 1M90C 1E22A 1KAWA 4GN3B 1X65A 3UDXA 1D7QA 1I5FA 3G71A 3D31A 1A63A 5C3EG 2K52A 2PI2A 4DR4Q 3I2ZA 1HNXQ 2JEBI 4UP7A 1S72A 4GNXC 1E1TA 2MNAA 2MQHA 1OXXK 1KIXA 4A3JG 2KCTA 4DR7L 3S2HH 4X6AH 3HOUG 3I4OA 4OX9Q 4B3TQ 2OWOA 2HIVA 1CKNA 4LFAQ 2UU9Q 4B3SL 4AQYL 5FJ8H 4DV0Q 3T1YQ 1ASZA 4BBRG 4UY8C 4JYAL 3S1QH 4EX5A 1TWFH 4GOPA 4DV5L 1OXVA 4POFA 1X6OA 5C0XG 4A3EG 3PO2G 1YVCA 3G48A 5IP7H 3PIOA 4YY3L 5M5XH 2JA7H 3OYYA 1HR0W 4X62L 1N32Q 2NN6I 2ZTEA 3K81C 3H0GH 4IPCA 1CSQA 1MIUA 4R4QA 3J81i 1X3EA 4LF4Q 1YHAA 3PO3G 1XPRA 4TVAB 1U0LA 4AH6A 1VQ9A 4DV1Q 2HHHL 1FJGL 2A1AA 3BZKA 1V43A 4A3IG 3J81j 1KL9A 1K83H 3RR5A 1P16A 1NJIC 3H3VH 1EUJA 4YHHQ 3NEMA 3DM3A 4KHPQ 3PUZA 4DV2Q 4L5QA 1PA6A 1G291 3PUXA 4DKAC 3K0XA 4APVA 2GVAA 2K5VA 4DV7Q 4LW1A 5IY0A 4JI8Q 3CCLA 1Y1VG 2EIFA 2YV5A 2H5XA 2D0OA 2I5LX 4GS3A 5M3MH 1JB7A 1SRUA 3KF8B 1K8GA 1IL2A 1A8VA 2DUDA 4LF8Q 1YHBA 1XNQQ 3NENA 3HOZH 3T1HQ 1DGSA 4L5SA 4L5TA 1Y1WH 4DAYB 1SFOH 1LYLA 4DV6Q 4IFDG 1QZHA 4DR3L 5IWAQ 5HGQA 3L2PA 1HZBA 1PH1A 1K0RA 4ALPA 5M3FH 2N8NA 2R7DA 4DPGA 1V9PA 4GLAC 5C0XI 4LF9Q 4NXNQ 1I6HH 1PH2A 5C3EH 1EQQA 1YIJA 4GKJQ 4JOIA 1N33L 1HNWQ 3B6YA 1Q7YC 1CKNB 3RLNA 4NPSA 4DR6Q 1J5EQ 1I94Q 4LF5Q 1D8LA 2ZTDA 3K80C 4KLKA 3UE0A 1TWGH 4A3JH 1SROA 1CUKA 1UE5A 4JBWA 1JE5A 3HOUH 1Z9FA 1MJCA 4KHZA 5JEAJ 4GOPB 3W1GA 1N36Q 2ASBA 1XJVA 4A3KG 4PZ8A 1HZCA 3EBEA 3MEFA 1PH7A 1K9MC 2YTXA 1XNRQ 1PH8A 3CC2A 1VQPA 2F4VL 3TS2A 4OWWB 2R92G 2UXDQ 4BBRH 4HIDA 4BA2I 1HJPA 4C3IH 4JC0A 3GO5A 3OTOQ 1BBUA 3KF6A 1JMCA 2R6GA 3HFZB 5GROA 1TWHH 4A3EH 3PO2H 4DV3L 3OW2A 3U4VA 1K73C 3RLFA 3EN2A 5IYBG 3K8AA 2JA6G 5LMNW 4DNIA 4R4TA 3GTOH 4Y52H 2IY5B 1VQCA 2D0PA 3S24A 1VQJA 4DR4L 1N34Q 2VNUD 5M5YH 1K8AC 5K36G 1HNXL 1VQGA 4JI7L 3PO3H 4OXPA 2I5HA 4NXMQ 4OONA 4UPAA 1VQKA 4R4CA 1N9WA 4QY7A 4A3IH 2AMCB 4OX9L 5C4JH 4B3TL 1PYBA 3VDYA 1BVSA 1VQ5A 1V1QA 2UU9L 4LFAL 1K3RA 4QIWE 3J80i 3STBC 4DV0L 1G6PA 2QEXA 3T1YL 1E24A 1KQSA 3BU2A 1CKMA 1SMXA 2UUBQ 4JI0Q 2DGYA 1X9NA 1C9OA 1TWAH 1UWVA 4IPDA 2B63G 1SR3A 1RIPA 2N3SA 2Q2IA 4JI1Q 2I5MX 3M4QA 2JA5G 2BA1A 1Y1VH 2JJQA 3M9BA 4IO9A 1VQLA 3S14H 4BY1G 3FP9A 3BJUA 1GVPA 4LUVA 4NB3A 2JEAI 2Q2HA 3I7FA 1NE3A 1N32L 2CWPA 5J3BA 3RZOH 5C44H 3M4PA 1VQBA 3CCEA 2ZTCA 1J6QA 4GOPC 1GM5A 1P8LA 4LF4L 3CCUA 2E5LQ 4IJHA 3RZDH 1Q81C 1VQAA 3ULLA 4C3JH 2IX1A 2CKZB 2HT1A 4DV1L 1VQ6A 1QUQA 4X65Q 4JV5Q 1AH9A 2JE6I 2E2IH 1Q1BA 1KRSA 3HOYG 2I0QA 4YCUA 1HR0Q 2KENA 1VQNA 3H3VI 4YHHL 1PHJA 4KHPL 1WJJA 4DV2L 5IE8A 1E3PA 4A4IA 1XMQQ 4JI4Q 3CQZH 4O2DA 4P71A 4RMFA 4DR2Q 3AFPA 4LF7Q 2EXDA 3KOJA 3UDFA 4A3MH 4AYBG 1W2BA 1NTGA 4LUZA 2CQOA 4DV7L 4HIMA 2VUMG 1XPOA 1B70B 4JI8L 1PYSB 1QVCA 3TREA 3ZJYC 3CC7A 1RL2A 1VQ4A 1E7ZA 2LXJA 3F2DA 4LF8L 3PUVA 1OTCA 1VQFA 5JEAG 3KF6B 1XNQL 1FVIA 3T1HL 4A3KH 4QGUA 1PH3A 3AQQA 1XPUA 3CMEA 3RNUA 2Z6KA 2R92H 4DV6L 1EWIA 3RN2A 1AE3A 2Q2TA 4A3CG 2UXBQ 4WJ3M 4X64Q 1R9TH 2ZJPA 3J80c 4JBKA 5LMUQ 4DR5Q 5IWAL 1GO3E 1YI2A 3HOWG 5C4XG 2WB1E 3UDIA 5IYBH 4NXNL 2UUCQ 4LF9L 2JA6H 4HIOA 3I4MG 3A5ZB 4XTCS 1EFWA 4BY7G 2AHOB 2GVBA 1YHQA 4GKJL 1IBMQ 1HNWL 4DR6L 1LUZA 4YWLA 2OTLA 1WFQA 4X66Q 1HNZQ 1FGUA 4IJLA 3AEVA 2K14A 2K75A 4IPGA 4MNOA 4QJFA 1YJNA 1SN8A 1J5EL 1I94L 4LF5L 4BXXH 5C44G 2YTYA 4B3MQ 4GKKL 3E0EA 4OWXB 1N36L 4JG2A 2RCNA 3CCVA 1UE7A 1XNRL 2OQKA 4A3DG 4UP8A 3CPFA 4LWCA 4AYBE 4JOIC 4HJ8A 2UXDL 3MXNB 5M5WH 2R93G 3NELA 4JI6Q 1C0AA 1L1OA 4HJ9A 3A74A 3CAMA 5IP9G 2VY3A 4P75A 2NVTH 2RHQB 3OTOL 2IX0A 2B63H 4ME3A 4LF6Q 1KHIA 2JA5H 3CC4A 3PF4A 4A3BG 4POGA 4HIKA 1B7YB 1GKHA 2A19A 4BY1H 2MFIA 2VS1A 3ER0A 5AJ3Q 3CF5A 4A3MG 3I4NH 1VQIA 1YJWA 5EAYA 1IBLQ 2KCMA 2WAQG 2RHSB 1CKOA 1N34L 3TEHB 4JBMA 2BH2A 2V1CC 1JT8A 4A3GG 4OO1G 4BA1I 3UDGA 3STBD 1LM0A 5BR8Q 4NXML 4LFCQ 3L7ZC 1VS0A 2EQSA 4YWMA 1EIFA 4J15A 2BH8A 4DV4Q 3U50C 3F8TA 5LMNQ 3HOYH 4B3RQ 3PF5A 4QQBX 3W1BA 2XTIA 2HQLA 2UUAQ 4GKKQ 5C0XJ 4JI5Q 2UUBL 4JI0L 2R7ZG 3S2DH 4A93G 3CPWA 4A3FG 2PMZE 2VUMH 1I50H 4JI1L 2KHJA 4GLXA 3PCOB 4UP9A 2JA9A 3ULPA 3I56A 1NBWA 4LFBQ 2QGQA 1PFSA 2MO0A 4P72A 3NBHB 3GDEA 3S16H 1OXSC 4BXXG 3E9HA 2MO1A 1HZ9A 3ERSX 4A3CH 3AFQA 4PZ7A 2E5LL 2AWOA 4IFDI 1EIYB 1TXYA 5IT9c 2XGTA 1Q12A 1PH5A 3JC66 3M85A 3KFUA 4X65L 2N78A 4JV5L 3HOWH 5C4XH 2ZM6Q 2UXCQ 1HR0L 2B3GA 2WAQE 3A0JA 2RF4A 3ULJA 4TQUS 5GAGC 5HY6A 3A5UA 4DUYQ 3K7AH 1XMQL 3S15H 3H15A 2WP8J 3I4MH 2QA4A 1X3GA 2F3IA 4JI4L 3GTQH 1L2FA 4DR2L 4BY7H 3GTGH 4BBSG 2YTVA 3WWVA 4JI3Q 4A76A 3PUYA 3U4ZA 5ELOA 2NZHA 1JJ2A 2A8VA 1BKBA 2WB1G 3I4NG 1L1OB 1VQEA 5DLQE 2JA8G 4OO1I 3PUWA 4DR1Q 3S1RH 3M7NA 1IZ6A 2PI2E 4A3DH 2VQFQ 1HH2P 1CSPA 5FLMG 2CCZA 3KJOA 2NVQH 1KC8C 2R93H 1Y14B 4KI0A 5GQOA 2UXBL 4K0KQ 5IP9H 4X64L 2GN5A 3TS0A 1PH6A 1WCMG 5LMUL 4DR5L 2NVXH 2YYZA 1IBKQ 2Q2UA 4HJAA 1XMOQ 3CMAA 4A3BH 1X55A 4IOAA 2HIXA 3CW2C 4WJ4A 2FXQA 4JI2Q 1VQHA 4A3LG 2UUCL 3HOVH 2Z6KC 1YJ9A 4A75A 1X56A 1YZ6A 2OCEA 4GLVB 5GAEC 3CCMA 1GD7A 3S1MH 1Z47A 3M3YH 3KLWA 4DUZQ 2ZJRA 4JI7Q 1QZGA 2K50A 3SGIA 3E9IA 1KD1C 1IBML 4A3GH 3TQYA 3HKSA 4JCVE 4X66L 1HNZL 1N8RC 2CWAA 1LTLA 2OTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2M H;  4AIM A;  3DLL A;  1PH4 A;  1A62 A;  2KHI A;  4B3M L;  3CD6 A;  1EYG A;  2E2H H;  1QVG A;  4GN5 A;  2ES2 A;  2LXK A;  3F2C A;  2VQE Q;  1Q1E A;  4PG3 A;  4DK3 C;  3FKI G;  1X54 A;  4GNX A;  3F1Z A;  2ALY B;  1TWC H;  3JAM i;  3G4S A;  4DK6 C;  4JI6 L;  2R7Z H;  1XTD A;  4MTN A;  4A93 H;  3D0F A;  4A3F H;  4XIG S;  2CFM A;  4YWK A;  3KDF A;  2WFW A;  4LF6 L;  4C3H H;  1KXL A;  1Q86 C;  2Y0S G;  3LGJ A;  3Q8D A;  5AJ3 L;  2NZO A;  1FL0 A;  3KYH C;  2IHE A;  3G6E A;  4LNQ A;  1Q46 A;  1IBL L;  1L1O C;  3I55 A;  4DR7 Q;  2Z0S A;  1OXU A;  1X3F A;  1KRT A;  4IOC A;  1IYJ B;  5E7N A;  1VQM A;  5BR8 L;  2E2J H;  2PQA A;  2D62 A;  4LFC L;  3CCQ A;  4AQY Q;  4B3S Q;  1E1O A;  3PIP A;  3GTJ H;  3PV0 A;  4DV4 L;  4EQ5 A;  4Y7N H;  4JYA Q;  3K7U C;  4OWT B;  3HOX G;  5LMN L;  4B3R L;  4MZ9 A;  4DV5 Q;  1U5K A;  3PGZ A;  2NVY H;  1VQO A;  2UUA L;  1WOC A;  5IYD G;  4JI5 L;  4YY3 Q;  4R1J A;  4BBS H;  3FHW A;  4IPH A;  4R4O A;  4X62 Q;  1NMF A;  2K5N A;  3CCS A;  3BZC A;  3HOV G;  4O0A A;  2VW9 A;  3CXC A;  1MJE A;  1QUQ B;  5IYC H;  1EOV A;  1Q8K A;  4FDB A;  1YBY A;  1YEZ A;  4H02 A;  2JA8 H;  3UE1 A;  3GD7 A;  4LFB L;  3J7Z C;  1PH9 A;  1A0I A;  2VL6 A;  5H1S E;  3HKZ G;  2HHH Q;  1FJG Q;  1IXR A;  1G51 A;  1S40 A;  5JJL A;  2F52 A;  1UE1 A;  5FLM H;  3S17 H;  1WYD A;  1WI5 A;  3CCR A;  4HJ5 A;  1B8A A;  1NY4 A;  1AE2 A;  1WCM H;  3JAM c;  2Y0S E;  5FJ8 G;  3AYH B;  4PMW A;  4YCW A;  3RLO A;  2C35 B;  1MKH A;  2JK8 A;  3KJP A;  1VQ7 A;  1QVF A;  2B29 A;  1SE8 A;  2ZM6 L;  2UXC L;  4LUO A;  2AKW B;  4A3L H;  2R7F A;  3IRB A;  4GN4 B;  4DUY L;  3U58 A;  5IP7 G;  3F2B A;  3ICE A;  5JJK A;  1JJG A;  2JA7 G;  3J7A 5;  2BA0 A;  2K4K A;  2N49 A;  4JBJ A;  2ATW A;  1VQD A;  4JI3 L;  1O7I A;  3M4O H;  3J81 c;  4GNX B;  1JJC B;  1PV4 A;  1Q82 C;  3H0G G;  4P74 A;  2LSS A;  2E8G A;  5ELN A;  4DR1 L;  1SLJ A;  2IHF A;  4DR3 Q;  3KDF B;  3FKI H;  1I3Q H;  5FLX c;  2VQF L;  2AWN A;  1EQR A;  3L0O A;  1L0W A;  1HZA A;  2VZA A;  3EIV A;  3W5O A;  4K0K L;  3RN5 A;  1H95 A;  2ZJQ A;  3GTP H;  2PNH A;  4QL5 A;  1VCI A;  1IBK L;  1ASY A;  2KBN A;  1XMO L;  3TRZ A;  1UEB A;  1W3S A;  2L15 A;  5JJI A;  1VQ8 A;  3HKZ E;  2K5H A;  4JI2 L;  1N33 Q;  3GTM H;  4YCV A;  5GAD C;  2PQA B;  4LF7 L;  1YNX A;  2ID0 A;  3PSI A;  5M3M G;  4L5R C;  2NN6 G;  1NMG A;  1OXT A;  4RG1 A;  3CP0 A;  4DUZ L;  1C7Y A;  1M1K C;  5IYC G;  2OQ0 A;  3HOZ G;  3CCJ A;  1BBW A;  2IT1 A;  1UE6 A;  4PZ6 A;  1Y1W G;  2F4V Q;  4DAM A;  3S1N H;  2JQO A;  4IFD J;  4R4I A;  5GAH C;  2YU9 H;  1S3O A;  3HOX H;  4HJ7 A;  2VQE L;  3GTL H;  1T9H A;  4P73 A;  5M3F G;  4DV3 Q;  1YIT A;  3GTK H;  1PVO A;  5IYD H;  1M90 C;  1E22 A;  1KAW A;  4GN3 B;  1X65 A;  3UDX A;  1D7Q A;  1I5F A;  3G71 A;  3D31 A;  1A63 A;  5C3E G;  2K52 A;  2PI2 A;  4DR4 Q;  3I2Z A;  1HNX Q;  2JEB I;  4UP7 A;  1S72 A;  4GNX C;  1E1T A;  2MNA A;  2MQH A;  1OXX K;  1KIX A;  4A3J G;  2KCT A;  4DR7 L;  3S2H H;  4X6A H;  3HOU G;  3I4O A;  4OX9 Q;  4B3T Q;  2OWO A;  2HIV A;  1CKN A;  4LFA Q;  2UU9 Q;  4B3S L;  4AQY L;  5FJ8 H;  4DV0 Q;  3T1Y Q;  1ASZ A;  4BBR G;  4UY8 C;  4JYA L;  3S1Q H;  4EX5 A;  1TWF H;  4GOP A;  4DV5 L;  1OXV A;  4POF A;  1X6O A;  5C0X G;  4A3E G;  3PO2 G;  1YVC A;  3G48 A;  5IP7 H;  3PIO A;  4YY3 L;  5M5X H;  2JA7 H;  3OYY A;  1HR0 W;  4X62 L;  1N32 Q;  2NN6 I;  2ZTE A;  3K81 C;  3H0G H;  4IPC A;  1CSQ A;  1MIU A;  4R4Q A;  3J81 i;  1X3E A;  4LF4 Q;  1YHA A;  3PO3 G;  1XPR A;  4TVA B;  1U0L A;  4AH6 A;  1VQ9 A;  4DV1 Q;  2HHH L;  1FJG L;  2A1A A;  3BZK A;  1V43 A;  4A3I G;  3J81 j;  1KL9 A;  1K83 H;  3RR5 A;  1P16 A;  1NJI C;  3H3V H;  1EUJ A;  4YHH Q;  3NEM A;  3DM3 A;  4KHP Q;  3PUZ A;  4DV2 Q;  4L5Q A;  1PA6 A;  1G29 1;  3PUX A;  4DKA C;  3K0X A;  4APV A;  2GVA A;  2K5V A;  4DV7 Q;  4LW1 A;  5IY0 A;  4JI8 Q;  3CCL A;  1Y1V G;  2EIF A;  2YV5 A;  2H5X A;  2D0O A;  2I5L X;  4GS3 A;  5M3M H;  1JB7 A;  1SRU A;  3KF8 B;  1K8G A;  1IL2 A;  1A8V A;  2DUD A;  4LF8 Q;  1YHB A;  1XNQ Q;  3NEN A;  3HOZ H;  3T1H Q;  1DGS A;  4L5S A;  4L5T A;  1Y1W H;  4DAY B;  1SFO H;  1LYL A;  4DV6 Q;  4IFD G;  1QZH A;  4DR3 L;  5IWA Q;  5HGQ A;  3L2P A;  1HZB A;  1PH1 A;  1K0R A;  4ALP A;  5M3F H;  2N8N A;  2R7D A;  4DPG A;  1V9P A;  4GLA C;  5C0X I;  4LF9 Q;  4NXN Q;  1I6H H;  1PH2 A;  5C3E H;  1EQQ A;  1YIJ A;  4GKJ Q;  4JOI A;  1N33 L;  1HNW Q;  3B6Y A;  1Q7Y C;  1CKN B;  3RLN A;  4NPS A;  4DR6 Q;  1J5E Q;  1I94 Q;  4LF5 Q;  1D8L A;  2ZTD A;  3K80 C;  4KLK A;  3UE0 A;  1TWG H;  4A3J H;  1SRO A;  1CUK A;  1UE5 A;  4JBW A;  1JE5 A;  3HOU H;  1Z9F A;  1MJC A;  4KHZ A;  5JEA J;  4GOP B;  3W1G A;  1N36 Q;  2ASB A;  1XJV A;  4A3K G;  4PZ8 A;  1HZC A;  3EBE A;  3MEF A;  1PH7 A;  1K9M C;  2YTX A;  1XNR Q;  1PH8 A;  3CC2 A;  1VQP A;  2F4V L;  3TS2 A;  4OWW B;  2R92 G;  2UXD Q;  4BBR H;  4HID A;  4BA2 I;  1HJP A;  4C3I H;  4JC0 A;  3GO5 A;  3OTO Q;  1BBU A;  3KF6 A;  1JMC A;  2R6G A;  3HFZ B;  5GRO A;  1TWH H;  4A3E H;  3PO2 H;  4DV3 L;  3OW2 A;  3U4V A;  1K73 C;  3RLF A;  3EN2 A;  5IYB G;  3K8A A;  2JA6 G;  5LMN W;  4DNI A;  4R4T A;  3GTO H;  4Y52 H;  2IY5 B;  1VQC A;  2D0P A;  3S24 A;  1VQJ A;  4DR4 L;  1N34 Q;  2VNU D;  5M5Y H;  1K8A C;  5K36 G;  1HNX L;  1VQG A;  4JI7 L;  3PO3 H;  4OXP A;  2I5H A;  4NXM Q;  4OON A;  4UPA A;  1VQK A;  4R4C A;  1N9W A;  4QY7 A;  4A3I H;  2AMC B;  4OX9 L;  5C4J H;  4B3T L;  1PYB A;  3VDY A;  1BVS A;  1VQ5 A;  1V1Q A;  2UU9 L;  4LFA L;  1K3R A;  4QIW E;  3J80 i;  3STB C;  4DV0 L;  1G6P A;  2QEX A;  3T1Y L;  1E24 A;  1KQS A;  3BU2 A;  1CKM A;  1SMX A;  2UUB Q;  4JI0 Q;  2DGY A;  1X9N A;  1C9O A;  1TWA H;  1UWV A;  4IPD A;  2B63 G;  1SR3 A;  1RIP A;  2N3S A;  2Q2I A;  4JI1 Q;  2I5M X;  3M4Q A;  2JA5 G;  2BA1 A;  1Y1V H;  2JJQ A;  3M9B A;  4IO9 A;  1VQL A;  3S14 H;  4BY1 G;  3FP9 A;  3BJU A;  1GVP A;  4LUV A;  4NB3 A;  2JEA I;  2Q2H A;  3I7F A;  1NE3 A;  1N32 L;  2CWP A;  5J3B A;  3RZO H;  5C44 H;  3M4P A;  1VQB A;  3CCE A;  2ZTC A;  1J6Q A;  4GOP C;  1GM5 A;  1P8L A;  4LF4 L;  3CCU A;  2E5L Q;  4IJH A;  3RZD H;  1Q81 C;  1VQA A;  3ULL A;  4C3J H;  2IX1 A;  2CKZ B;  2HT1 A;  4DV1 L;  1VQ6 A;  1QUQ A;  4X65 Q;  4JV5 Q;  1AH9 A;  2JE6 I;  2E2I H;  1Q1B A;  1KRS A;  3HOY G;  2I0Q A;  4YCU A;  1HR0 Q;  2KEN A;  1VQN A;  3H3V I;  4YHH L;  1PHJ A;  4KHP L;  1WJJ A;  4DV2 L;  5IE8 A;  1E3P A;  4A4I A;  1XMQ Q;  4JI4 Q;  3CQZ H;  4O2D A;  4P71 A;  4RMF A;  4DR2 Q;  3AFP A;  4LF7 Q;  2EXD A;  3KOJ A;  3UDF A;  4A3M H;  4AYB G;  1W2B A;  1NTG A;  4LUZ A;  2CQO A;  4DV7 L;  4HIM A;  2VUM G;  1XPO A;  1B70 B;  4JI8 L;  1PYS B;  1QVC A;  3TRE A;  3ZJY C;  3CC7 A;  1RL2 A;  1VQ4 A;  1E7Z A;  2LXJ A;  3F2D A;  4LF8 L;  3PUV A;  1OTC A;  1VQF A;  5JEA G;  3KF6 B;  1XNQ L;  1FVI A;  3T1H L;  4A3K H;  4QGU A;  1PH3 A;  3AQQ A;  1XPU A;  3CME A;  3RNU A;  2Z6K A;  2R92 H;  4DV6 L;  1EWI A;  3RN2 A;  1AE3 A;  2Q2T A;  4A3C G;  2UXB Q;  4WJ3 M;  4X64 Q;  1R9T H;  2ZJP A;  3J80 c;  4JBK A;  5LMU Q;  4DR5 Q;  5IWA L;  1GO3 E;  1YI2 A;  3HOW G;  5C4X G;  2WB1 E;  3UDI A;  5IYB H;  4NXN L;  2UUC Q;  4LF9 L;  2JA6 H;  4HIO A;  3I4M G;  3A5Z B;  4XTC S;  1EFW A;  4BY7 G;  2AHO B;  2GVB A;  1YHQ A;  4GKJ L;  1IBM Q;  1HNW L;  4DR6 L;  1LUZ A;  4YWL A;  2OTL A;  1WFQ A;  4X66 Q;  1HNZ Q;  1FGU A;  4IJL A;  3AEV A;  2K14 A;  2K75 A;  4IPG A;  4MNO A;  4QJF A;  1YJN A;  1SN8 A;  1J5E L;  1I94 L;  4LF5 L;  4BXX H;  5C44 G;  2YTY A;  4B3M Q;  4GKK L;  3E0E A;  4OWX B;  1N36 L;  4JG2 A;  2RCN A;  3CCV A;  1UE7 A;  1XNR L;  2OQK A;  4A3D G;  4UP8 A;  3CPF A;  4LWC A;  4AYB E;  4JOI C;  4HJ8 A;  2UXD L;  3MXN B;  5M5W H;  2R93 G;  3NEL A;  4JI6 Q;  1C0A A;  1L1O A;  4HJ9 A;  3A74 A;  3CAM A;  5IP9 G;  2VY3 A;  4P75 A;  2NVT H;  2RHQ B;  3OTO L;  2IX0 A;  2B63 H;  4ME3 A;  4LF6 Q;  1KHI A;  2JA5 H;  3CC4 A;  3PF4 A;  4A3B G;  4POG A;  4HIK A;  1B7Y B;  1GKH A;  2A19 A;  4BY1 H;  2MFI A;  2VS1 A;  3ER0 A;  5AJ3 Q;  3CF5 A;  4A3M G;  3I4N H;  1VQI A;  1YJW A;  5EAY A;  1IBL Q;  2KCM A;  2WAQ G;  2RHS B;  1CKO A;  1N34 L;  3TEH B;  4JBM A;  2BH2 A;  2V1C C;  1JT8 A;  4A3G G;  4OO1 G;  4BA1 I;  3UDG A;  3STB D;  1LM0 A;  5BR8 Q;  4NXM L;  4LFC Q;  3L7Z C;  1VS0 A;  2EQS A;  4YWM A;  1EIF A;  4J15 A;  2BH8 A;  4DV4 Q;  3U50 C;  3F8T A;  5LMN Q;  3HOY H;  4B3R Q;  3PF5 A;  4QQB X;  3W1B A;  2XTI A;  2HQL A;  2UUA Q;  4GKK Q;  5C0X J;  4JI5 Q;  2UUB L;  4JI0 L;  2R7Z G;  3S2D H;  4A93 G;  3CPW A;  4A3F G;  2PMZ E;  2VUM H;  1I50 H;  4JI1 L;  2KHJ A;  4GLX A;  3PCO B;  4UP9 A;  2JA9 A;  3ULP A;  3I56 A;  1NBW A;  4LFB Q;  2QGQ A;  1PFS A;  2MO0 A;  4P72 A;  3NBH B;  3GDE A;  3S16 H;  1OXS C;  4BXX G;  3E9H A;  2MO1 A;  1HZ9 A;  3ERS X;  4A3C H;  3AFQ A;  4PZ7 A;  2E5L L;  2AWO A;  4IFD I;  1EIY B;  1TXY A;  5IT9 c;  2XGT A;  1Q12 A;  1PH5 A;  3JC6 6;  3M85 A;  3KFU A;  4X65 L;  2N78 A;  4JV5 L;  3HOW H;  5C4X H;  2ZM6 Q;  2UXC Q;  1HR0 L;  2B3G A;  2WAQ E;  3A0J A;  2RF4 A;  3ULJ A;  4TQU S;  5GAG C;  5HY6 A;  3A5U A;  4DUY Q;  3K7A H;  1XMQ L;  3S15 H;  3H15 A;  2WP8 J;  3I4M H;  2QA4 A;  1X3G A;  2F3I A;  4JI4 L;  3GTQ H;  1L2F A;  4DR2 L;  4BY7 H;  3GTG H;  4BBS G;  2YTV A;  3WWV A;  4JI3 Q;  4A76 A;  3PUY A;  3U4Z A;  5ELO A;  2NZH A;  1JJ2 A;  2A8V A;  1BKB A;  2WB1 G;  3I4N G;  1L1O B;  1VQE A;  5DLQ E;  2JA8 G;  4OO1 I;  3PUW A;  4DR1 Q;  3S1R H;  3M7N A;  1IZ6 A;  2PI2 E;  4A3D H;  2VQF Q;  1HH2 P;  1CSP A;  5FLM G;  2CCZ A;  3KJO A;  2NVQ H;  1KC8 C;  2R93 H;  1Y14 B;  4KI0 A;  5GQO A;  2UXB L;  4K0K Q;  5IP9 H;  4X64 L;  2GN5 A;  3TS0 A;  1PH6 A;  1WCM G;  5LMU L;  4DR5 L;  2NVX H;  2YYZ A;  1IBK Q;  2Q2U A;  4HJA A;  1XMO Q;  3CMA A;  4A3B H;  1X55 A;  4IOA A;  2HIX A;  3CW2 C;  4WJ4 A;  2FXQ A;  4JI2 Q;  1VQH A;  4A3L G;  2UUC L;  3HOV H;  2Z6K C;  1YJ9 A;  4A75 A;  1X56 A;  1YZ6 A;  2OCE A;  4GLV B;  5GAE C;  3CCM A;  1GD7 A;  3S1M H;  1Z47 A;  3M3Y H;  3KLW A;  4DUZ Q;  2ZJR A;  4JI7 Q;  1QZG A;  2K50 A;  3SGI A;  3E9I A;  1KD1 C;  1IBM L;  4A3G H;  3TQY A;  3HKS A;  4JCV E;  4X66 L;  1HNZ L;  1N8R C;  2CWA A;  1LTL A;  2OTJ A; 
#chains in the Genus database with same CATH topology
 1TR5 A;  2DNE A;  3CD6 A;  4GN5 A;  3DWQ A;  3KK7 A;  1J8I A;  1VF7 A;  4PG3 A;  2XNA C;  1LT5 D;  4KV6 A;  2F0J A;  1IW7 C;  1TWC H;  3JAM i;  2A6H C;  3P7J A;  4DK6 C;  5CC4 A;  2AUJ D;  4CJ0 B;  2M00 A;  4A3F H;  1C48 A;  2CFM A;  3IAY A;  2F0P A;  4MHE A;  1H9M A;  3QG1 A;  5I9P A;  3Q8D A;  5AJ3 L;  3HRZ C;  3G6E A;  1L1O C;  3I55 A;  4LAA A;  3T53 B;  1CQF A;  3QJY A;  2E2J H;  2E2I B;  2PQA A;  1O80 A;  2D62 A;  5HGT A;  2NVX B;  3U9S A;  3PIP A;  2VB3 X;  2K1B A;  3K7U C;  4OWT B;  3K5O A;  4JYA Q;  1U5K A;  3W2D A;  1GOZ A;  4L6T B;  5IIF A;  2OF1 A;  5IYD G;  4IUN A;  3HP3 A;  2K5N A;  3HOV G;  2KEC A;  4KN7 C;  2CW0 D;  3CXC A;  2K32 A;  3TN2 A;  4RCN A;  1Q8K A;  4FDB A;  4N8F A;  2JA8 H;  3MXU A;  3UE1 A;  1JCK B;  3GD7 A;  3J7Z C;  1BNZ A;  5JJL A;  4XT3 B;  1S40 A;  1R9T B;  1F9Q A;  4FF1 A;  4J6H A;  1K8M A;  2R7Z B;  1NY4 A;  1AE2 A;  3RLO A;  1QVF A;  1Y8P B;  4A3L H;  3AU7 A;  3NWS A;  5CYU A;  5IP7 G;  2BA0 A;  2K4K A;  2N49 A;  1Y69 U;  2ATW A;  4JI3 L;  1O7I A;  1KAB A;  4DXF A;  1O7Z A;  4GNX B;  3M4O H;  1JJC B;  2E8G A;  3D6W A;  1SE4 A;  2R61 A;  1QCB D;  1HUM A;  4DR3 Q;  1EQR A;  4DXG A;  1L0W A;  1CFM A;  2ENB A;  2VZA A;  3EIV A;  4K0K L;  5IGF A;  3RN5 A;  2ZJQ A;  3GTP H;  1XTC D;  1ASY A;  2KEE A;  2I07 B;  3I4N B;  1UEB A;  3HKZ E;  1JE4 A;  3BYY B;  4ZK9 B;  1N33 Q;  4XYO A;  3NUC A;  2ID0 A;  3I72 A;  3PSI A;  5TSS A;  4FXG C;  5M3M G;  5J39 A;  1M1K C;  5IYC G;  1GHK A;  1SE2 A;  2Q8I B;  4PZ6 A;  1UE6 A;  1WCM B;  3K0Y A;  1BCP B;  1Q3L A;  3SEB A;  1Q8I A;  4PMC A;  1JOO A;  2JQO A;  2Q8R E;  5CV6 A;  4TRD A;  4HJ7 A;  2PZW A;  1SJE D;  5IT9 L;  2CHB D;  5EPJ A;  5M3F G;  4DAY A;  3GTK H;  1PVO A;  5IYD H;  2F0S A;  4GN3 B;  3K5N A;  1HA5 A;  2FHT A;  3A8K E;  2PNR C;  5NUC A;  3MXP A;  2JEB I;  4HSV A;  5ELF A;  3C3L A;  1SEB D;  3VYT A;  4A3J G;  1IL8 A;  1B3Q A;  4B3T Q;  1B50 A;  4MTK A;  2UU9 Q;  2RKS A;  2RSO A;  1ASZ A;  5G3L F;  1ZYR C;  3S15 B;  2NZ1 D;  1DM0 B;  4EX5 A;  3I4M B;  2Y0S B;  4POF A;  1X6O A;  3BVG A;  5C0X G;  1GUT A;  5IP7 H;  1GUO A;  3MAQ A;  2B2T C;  3OYY A;  2PYK A;  1HR0 W;  2EJF C;  1EYC A;  3S1R B;  1S5F D;  1X32 A;  2ZTE A;  5J22 A;  4LF4 Q;  2JXM B;  4A3D B;  2HDL A;  1XPR A;  4IUR A;  1VQ9 A;  3DM1 A;  2R93 B;  2A1A A;  4RH6 A;  3RR5 A;  5C5L A;  3PUZ A;  3VR4 A;  1Q90 A;  1AFP A;  1PA6 A;  3ND8 A;  1G29 1;  3R8B A;  4ZUJ A;  4APV A;  4K14 A;  1AEX A;  5FLX E;  2EIF A;  4GS3 A;  5M3M H;  3I4L A;  5JPN C;  1QB5 D;  3BDC A;  3Q6S A;  2A5H A;  4J1M A;  4L5T A;  1NUC A;  1SFO H;  2QKI C;  4WFN 3;  1TWC B;  4DNR B;  4C3J G;  1V1P B;  4H0L C;  1PH1 A;  1K0R A;  2B8G A;  1PMR A;  2L0C A;  5M3F H;  2JA7 B;  1IYU A;  1V9P A;  4NXN Q;  1CTM A;  5AFW A;  5C0X I;  1YNN D;  3H0G B;  5JOB A;  3B6Y A;  1JOR A;  3R3O A;  1S4Z A;  1EQV A;  2E76 C;  1J5E Q;  1I94 Q;  4LF5 Q;  3UE0 A;  2ZTD A;  4KLK A;  4A3J H;  1TWG H;  1AP0 A;  1CUK A;  1UE5 A;  2XSC A;  1Z9F A;  1N36 Q;  3EBE A;  5I2Y A;  2CVR A;  2YTX A;  1PH8 A;  1WD0 A;  2UXD Q;  4ZQ3 A;  4BA2 I;  1HJP A;  2EOT A;  2F0H A;  2RQX A;  5C0X H;  5GRO A;  3JAM L;  4DV3 L;  4ME5 A;  3U4V A;  1K73 C;  5LMN W;  4DNI A;  3HOZ B;  1Y1W B;  2KUM A;  1UEA B;  1VQC A;  3S24 A;  1N34 Q;  5M5Y H;  1HNX L;  1UNS A;  3LNN A;  4OON A;  3E5S A;  2CW0 C;  2L9H A;  4QY7 A;  2AMC B;  2SOB A;  1BVS A;  1VQ5 A;  1V1Q A;  4LFA L;  1K3R A;  1SNQ A;  4DV0 L;  1LTR D;  3QR8 A;  3BU2 A;  1SMX A;  2DGY A;  1X9N A;  2PPB C;  3C1E A;  2B63 G;  1SR3 A;  2BE5 C;  2Q2I A;  4XQJ A;  3M4Q A;  2DY8 A;  3MXN A;  4NB3 A;  4LUV A;  1AZP A;  4N9P A;  1N32 L;  2CWP A;  5J3B A;  4O42 A;  4EQO A;  2N88 A;  4BBR B;  3CCU A;  1VQA A;  4C3J H;  2CKZ B;  2D5D A;  1A3U A;  1PZK D;  5EKK A;  4X65 Q;  2DNC A;  3GTP B;  2JE6 I;  2I0Q A;  4YCU A;  1HR0 Q;  2QEJ C;  1PHJ A;  4KHP L;  3C46 A;  5IE8 A;  1E3P A;  2RBM A;  4JI4 Q;  4P71 A;  3NE5 B;  4KK7 A;  3AFP A;  3KOJ A;  3QIA A;  4A3M H;  3W3A A;  1NTG A;  4DV7 L;  4HIM A;  3PO3 B;  3C1F A;  1X3Q A;  2KVM A;  3TRE A;  3CC7 A;  3CRK C;  3A8J E;  1LV9 A;  3V96 A;  3PUV A;  3TDQ A;  1VQF A;  3KF6 B;  2ZT9 C;  1PH3 A;  3A7L A;  3F2U A;  3RN2 A;  1EWI A;  2Q2T A;  5KYI A;  1G6Z A;  2AQ1 B;  2EPB A;  4X64 Q;  2A68 D;  3NBH A;  4HN7 A;  5EBD A;  2WB1 E;  1LTI D;  1EFW A;  3GV3 A;  4QMG A;  2ICI A;  4DR6 L;  1EWH A;  4YWL A;  4X66 Q;  3AEV A;  2K75 A;  4OEL B;  5CV8 A;  1YJN A;  2A6E C;  1KAA A;  3HEJ A;  4GKK L;  2MUY A;  2IL8 A;  4LK1 C;  2B2W C;  1VMC A;  2NTT A;  1LTS D;  5IP9 G;  2NVT H;  4P75 A;  2RHQ B;  3J7A F;  2B63 H;  1A6X A;  1W6J A;  3NTK A;  4POG A;  4RWS C;  2A19 A;  1CK1 A;  3BDO A;  4ZRZ A;  4A3K B;  3K58 A;  1PTO B;  5EAY A;  4JBM A;  3OIQ A;  1U9R A;  4A3G G;  2Z4H A;  2FMC A;  2F0Q A;  5E3F A;  1HTL D;  4U67 3;  1LM0 A;  4NXM L;  4LFC Q;  3L7Z C;  5CMD A;  2O2L D;  4XXE A;  4I65 A;  4RGT A;  1H9R A;  1WVL A;  5LMN Q;  3PF5 A;  3W1B A;  2JA6 B;  2F0D A;  2HQL A;  2DY7 A;  4IUU A;  2LKV A;  5C0X J;  2R7Z G;  2UUB L;  4JI0 L;  5ELC A;  3S2D H;  2L11 A;  4S3S A;  3SHL A;  1PDQ A;  1DOL A;  3SK4 A;  1I50 H;  5COY A;  4C3H G;  2JA9 A;  3I56 A;  4CKC A;  5CBE E;  1PFS A;  2MO0 A;  2F1M A;  4I7A A;  1Z6H A;  5M5W B;  1HA6 A;  2SDF A;  2E5L L;  4LJZ C;  1I4R A;  1TXY A;  2XGT A;  3M85 A;  2N78 A;  2QF7 A;  5EJW A;  1HTP A;  2JA5 B;  5CV9 A;  2UXC Q;  5E4X A;  2B3G A;  2WKD A;  1KLU D;  5FO8 B;  3ULJ A;  3FDT A;  4DU9 A;  1MD2 D;  4EVO A;  2QA4 A;  4DR2 L;  1EZ6 A;  4BBS G;  3J80 E;  1CHQ D;  1YNN C;  5KNC A;  3I4N G;  1EY0 A;  1TS2 A;  1L1O B;  1CZW A;  4X3S A;  1IZ6 A;  1CSP A;  5FLM G;  3KJO A;  3SE0 A;  4KI0 A;  2X6G A;  3NWT A;  5IP9 H;  4TKO B;  1WCM G;  2NVX H;  3MZ5 A;  3I91 A;  4HJA A;  1X55 A;  1T5X D;  4H13 C;  2FXQ A;  4KY5 A;  2F3V A;  5M5Y B;  1YJ9 A;  3CCM A;  1Z47 A;  4JI7 Q;  3EQL C;  3E9I A;  1IBM L;  4A3G H;  1N8R C;  1FNV A;  3WOE A;  1D2B A;  2SEB D;  3I90 A;  5CV4 A;  3HOW B;  1QVG A;  2ES2 A;  3FPP A;  2VQE Q;  1X54 A;  3ND9 A;  2EYP A;  3G4S A;  3H91 A;  4JI6 L;  2R7Z H;  3GTG B;  3D0F A;  4XIG S;  1YNJ D;  4YWK A;  3KDF A;  2WFW A;  4C3H H;  2Y0S G;  3N52 A;  2G9H D;  3KYH C;  2IHE A;  1Q46 A;  4DR7 Q;  2JYO A;  1QG7 A;  1OXU A;  1X3F A;  2RCF A;  1K3B C;  1RKN A;  4IOC A;  1TT2 A;  4R8N A;  5E7N A;  1VQM A;  4B3S Q;  4AQY Q;  4MIU A;  3GTJ H;  4DV4 L;  1SJH D;  3EA6 A;  4K6D A;  1ZKO A;  4IUQ A;  1IKM A;  4B3R L;  1JB3 A;  4A3M B;  5KEE A;  1VQO A;  2UUA L;  2EXZ A;  3M3Y B;  1I4P A;  3MHB A;  1LAC A;  3AB9 A;  4JI5 L;  4G7H C;  4R1J A;  4BBS H;  3FHW A;  3MVV A;  4X62 Q;  1NMF A;  1ROD A;  4C2M B;  1HCZ A;  1YEZ A;  2DN8 A;  2F0G A;  4RA8 A;  3IKJ A;  1PH9 A;  5H1S E;  2HHH Q;  5FLM H;  2F0W A;  2ZXO A;  1B8A A;  3OOC A;  1WCM H;  4F88 A;  5FJ8 G;  2ZM6 L;  1ML0 D;  2AKW B;  4HCE A;  4DUY L;  2HUG A;  1WTH A;  1JJG A;  2ICE C;  2JA7 G;  3J7A 5;  4JBJ A;  1VQD A;  4QUF A;  1HUN A;  1PV4 A;  1Q82 C;  3H0G G;  1WTW A;  4P74 A;  3VR2 A;  4DR1 L;  1EY9 A;  1SLJ A;  3DUZ A;  3DEO A;  1HFG A;  2NVY B;  4B9X A;  2H4O A;  2TMP A;  4H7B A;  1HZA A;  4R9W A;  3Q22 A;  3W5O A;  1H9K A;  1R4Q B;  1VCI A;  1K28 A;  2ZXR A;  4ZCK A;  1W3S A;  3D4R A;  2K5H A;  3GTM H;  4YCV A;  4LF7 L;  4IUP A;  4ULL A;  4K2L A;  4DUZ L;  3QOJ A;  3CP0 A;  4RG1 A;  4XYQ A;  3N6R A;  3IFT A;  3HOZ G;  4QUC A;  1BBW A;  1Y1W G;  3OMG A;  2F4V Q;  2EYL A;  4DAM A;  1A2U A;  2F0M A;  5GAH C;  1MSH A;  3KBX A;  1S3O A;  3KF8 A;  1IKL A;  1XYI A;  1RF2 D;  1PZI D;  1SYC A;  3S2D B;  1T9H A;  1CA6 A;  1DYQ A;  1I50 B;  1M90 C;  3M7G A;  4XDX A;  1I5F A;  3G71 A;  1LAB A;  2K52 A;  1QIL A;  4DR4 Q;  1TVX A;  3EFX D;  3I2Z A;  1DD2 A;  3FKI B;  4X6A H;  4OX9 Q;  3D4W A;  1CKN A;  2C9O A;  2MPM A;  4HR7 B;  5FJ8 H;  3T1Y Q;  4BBR G;  5F2D A;  4ID6 A;  4JYA L;  1TWF H;  1RTO A;  4GOP A;  2L4N A;  2F0I A;  4A3E G;  4HMI A;  3PO2 G;  4IAL A;  2JA7 H;  1HRJ A;  1VF5 C;  3K81 C;  1X3P A;  3H0G H;  3DMU A;  4IPC A;  1CSQ A;  2YU9 B;  3J81 i;  1TS4 A;  1X3E A;  3PO3 G;  4TVA B;  4AH6 A;  1S5B D;  4DV1 Q;  5ELE A;  5CV7 A;  5EBC A;  3J81 j;  1KL9 A;  2B2Y A;  2WIN B;  3H3V H;  1MGS A;  1EUJ A;  4YHH Q;  4R8I A;  4DV2 Q;  4L5Q A;  3PUX A;  1II3 A;  4NW2 A;  4RKB A;  4A3G B;  2I5L X;  2ZXP A;  1K8G A;  1IL2 A;  1IYV A;  4LF8 Q;  3UI2 A;  1YHB A;  4QF4 A;  3MXG A;  3NEN A;  3HOZ H;  3T1H Q;  1Y1W H;  3FRP B;  3IFD A;  1ILQ A;  4FVM A;  1ENC A;  1LYL A;  4IFD G;  1AZQ A;  4DR3 L;  3OWE B;  5IWA Q;  4K8I A;  4ALP A;  5M5X B;  2R7D A;  2FMM A;  4GLA C;  4LF9 Q;  4C3H B;  2FFK B;  3DEP A;  3DWP A;  1YIJ A;  4GKJ Q;  4JOI A;  1N33 L;  1HNW Q;  1Q7Y C;  3DXJ C;  4NPS A;  1K8O A;  1D8L A;  3K80 C;  1SRO A;  1SYF A;  1JE5 A;  2JN4 A;  2B8F A;  3GTJ B;  3W1G A;  4CJ2 C;  1XJV A;  4A3K G;  4PZ8 A;  1SND A;  1HZC A;  3MEF A;  1XNR Q;  1PH7 A;  1VQP A;  4BBR H;  4HID A;  3OTO Q;  1KDB A;  2EJM A;  3VA7 A;  4BBS B;  3HFZ B;  3VR3 A;  4A3E H;  3PO2 H;  1J9O A;  3OW2 A;  3RLF A;  3EN2 A;  1BXT A;  3K8A A;  2JA6 G;  3GTO H;  2F03 A;  1VQJ A;  1BF4 A;  1VQG A;  2XWJ B;  1STY A;  3ZYY X;  3PO3 H;  2I5H A;  2RDF A;  1C4Q A;  1F2Z A;  4KHV A;  4B3T L;  4MN3 A;  4QCL A;  2IX3 A;  2UU9 L;  3Q24 A;  3J80 i;  2QEX A;  1QE6 A;  2E75 C;  3V05 A;  1CKM A;  2O5J C;  1RTN A;  1TWA H;  4IPD A;  2N3S A;  4JI1 Q;  2I5M X;  2JA5 G;  5ISR A;  5A2Q L;  3D8G A;  3BJU A;  1GVP A;  3I7F A;  3RMH A;  4FF4 A;  3PIO 3;  4LF4 L;  4IUV A;  4IFD H;  1PRT F;  4C3I B;  1Q81 C;  1VQ6 A;  1T5E A;  4JV5 Q;  5JVH 3;  1AH9 A;  1KDC A;  5KND A;  1VQN A;  4FNF A;  3I8Z A;  3WOF A;  3E3X A;  3GTM B;  1SYG A;  4F8M A;  2EXD A;  3UDF A;  1B9N A;  2RDG A;  4AYB G;  1W2B A;  4LUZ A;  5DAU A;  1B70 B;  2EY2 A;  1QVC A;  4RGO S;  3F2D A;  3NBI A;  1FGB D;  5JEA G;  1H9S A;  4A3K H;  4DN4 M;  4BWG B;  1PTO H;  3AQQ A;  1XPU A;  3CME A;  2Z8L A;  1WTQ A;  1KTK A;  2UXB Q;  3I70 A;  2K04 A;  1GO3 E;  3HOW G;  1F9S A;  1LO5 D;  1MI2 A;  1Y1V B;  2PW7 A;  4PMB A;  2KCN A;  2UUC Q;  4NXN L;  2JA6 H;  3MTS A;  1DOK A;  2B2U C;  1LT6 D;  4OL7 A;  3SDZ A;  2BOS A;  2K14 A;  4IPG A;  1J5E L;  4BXX H;  2B39 A;  1I94 L;  4LF5 L;  1LTB D;  2L1B A;  4B3M Q;  3E0E A;  4DF7 A;  1N36 L;  3E6Z X;  5C3W A;  2B2U A;  2OQK A;  4RKL A;  3BS1 A;  1TWF B;  2UXD L;  5LL6 S;  5M5W H;  3NEL A;  3A74 A;  3CAM A;  3HS0 C;  5JAV A;  5BN3 A;  3H6M A;  1TS5 A;  1SXT A;  1EEI D;  4ME3 A;  1KHI A;  2JA5 H;  3CC4 A;  4LF6 Q;  1B7Y B;  1GKH A;  3MWY W;  2MFI A;  1ESR A;  3ER0 A;  3FPU B;  3CF5 A;  4A3M G;  1QJO A;  1IBL Q;  2RHS B;  1CKO A;  1N34 L;  3TEH B;  1JT8 A;  2V1C C;  2R92 B;  1SYB A;  2F0F A;  4BA1 I;  3STB D;  1HXY D;  5BR8 Q;  3DHQ A;  1I4Q A;  2E74 C;  1OO9 B;  2Z4I A;  1EFI D;  1EIF A;  4J15 A;  3U50 C;  3F8T A;  4QQB X;  1SNM A;  3OPO A;  3K5M A;  3OSO A;  1L0X B;  4KTA A;  4X3K A;  2B2V A;  2MJ8 A;  4I7Z C;  5DM7 3;  4GLX A;  2X69 A;  4UP9 A;  3R93 A;  1IHZ A;  4BS9 A;  4LFB Q;  2QGQ A;  2OT2 A;  2NTS A;  1B4O A;  5JEA H;  4OGQ C;  1SNP A;  1TY2 A;  2NWG A;  1FNW A;  5KYL A;  1HZ9 A;  3NQI A;  3J81 L;  2AWO A;  5IT9 c;  3KFU A;  4X65 L;  2LFN A;  1F77 A;  3HOW H;  1MSG A;  3NTH A;  1TII D;  3Q23 A;  1HR0 L;  1CI3 M;  2HDM A;  2WAQ E;  4JW0 A;  4KKS A;  2RF4 A;  4TQU S;  5GAG C;  2WP8 J;  4NDX A;  4JI4 L;  2SNM A;  1I4G A;  3GTG H;  1JR0 D;  4K5V A;  5I2X A;  2K33 A;  3PUY A;  4A76 A;  1SYE A;  3MFY A;  3QOL A;  5DLQ E;  3PUW A;  3HOY B;  5COR A;  2PI2 E;  2VQF Q;  2CCZ A;  3QWN A;  2NVQ H;  1D1I A;  5GQO A;  2F0U A;  4A3E B;  4RGN A;  3PO2 B;  4X64 L;  1FR3 A;  3NSW A;  1PH6 A;  1F9R A;  4OEM B;  5IGB A;  3SR1 A;  1IBK Q;  2Q2U A;  1XMO Q;  3GTO B;  4DAP A;  4WJW A;  4IOA A;  4WJ4 A;  2HIX A;  3CW2 C;  1XWE A;  1D6E C;  2NYZ D;  4JI2 Q;  5BN5 A;  1VQH A;  1YZ6 A;  2OCE A;  1SE3 A;  5FO7 B;  5HUR A;  1GD7 A;  2L5T A;  3M3Y H;  2ZJR A;  3CU7 A;  4ZKB B;  1BOS A;  3KLR A;  4KD4 A;  1EY4 A;  5DNF A;  3TQY A;  3K6O A;  4X66 L;  1LTL A;  1EOT A;  4C2M H;  1A62 A;  4RGM A;  1EYD A;  3P75 A;  5C4X B;  2EY1 A;  3EJI A;  3FKI G;  4GNX A;  1TWA B;  1EY8 A;  2ALY B;  4XQN A;  4MTN A;  2FIN B;  3R2I A;  2MP1 A;  1KXL A;  1VMP A;  1EWC A;  2O5I C;  2NZO A;  2NBF A;  2G9D A;  2Z0S A;  1IYJ B;  2F3W A;  5I4D A;  3HZX A;  4LFC L;  3CCQ A;  3LWU A;  3T56 B;  4A3B B;  4EQ5 A;  4OIK A;  4Y7N H;  5LMN L;  1VDZ A;  2H1E A;  3T16 A;  4MZ9 A;  4DV5 Q;  5FKA C;  4DGZ A;  4QIW B;  2D9U A;  2NVY H;  4KY7 A;  3MC0 B;  4YY3 Q;  4K2K A;  3CCS A;  3BZC A;  1MJE A;  1QUQ B;  1EOV A;  4K8J A;  1STA A;  4H02 A;  1YBY A;  4KY6 A;  1G91 A;  2VL6 A;  3HKZ G;  1FJG Q;  1IXR A;  1G51 A;  2F52 A;  4EQN A;  1UE1 A;  5EPK A;  2HCC A;  1WYD A;  4A93 B;  4HJ5 A;  3JAM c;  3VA5 A;  3KJP A;  4PMW A;  4YCW A;  1MKH A;  2JSO A;  1VQ7 A;  2B29 A;  3TP6 A;  2RDH A;  3A54 A;  2UXC L;  3TBI B;  1F9P A;  5T1I A;  3NXW A;  3U58 A;  1S5D D;  3F2B A;  1I4X A;  3C2P A;  4ZAI A;  3J81 c;  1PRT D;  1HQM C;  2EYH A;  1EU4 A;  4PNY A;  4V19 0;  2TSS A;  2IHF A;  2C5C A;  3FKI H;  3VR5 A;  2AWN A;  1H95 A;  2SNS A;  1TQO A;  5C4Z A;  5K5P A;  5CBA E;  3TRZ A;  5JJI A;  1QNK A;  2F0V A;  4ABN A;  5GAD C;  2PQA B;  2NN6 G;  1EY6 A;  1OXT A;  1C7Y A;  1S5C D;  3S17 B;  1KNE A;  3CCJ A;  1IW7 D;  4F7X A;  1GUS A;  1U4P A;  4R4I A;  2YU9 H;  2HCI A;  2VQE L;  2EZV A;  3P1H A;  4AYB B;  4UDU C;  1F2L A;  1E22 A;  1SSO A;  1X65 A;  1V1P A;  2PI2 A;  2K5Q A;  3J7A V;  1S72 A;  1E1T A;  3A7A B;  5JPM C;  1OXX K;  2JP1 A;  4DR7 L;  1FYC A;  1E2Z A;  3I4O A;  2RVL A;  2HIV A;  1GUN A;  4HSP A;  4B3S L;  4AQY L;  2EYJ A;  4UY8 C;  4C56 C;  4C3I G;  1OXV A;  2NB0 A;  4DK1 A;  4ODG A;  3PIO A;  5M5X H;  1WTX A;  1U4M A;  4X62 L;  4C1N I;  2PMZ B;  2NN6 I;  2M9V A;  3V2T A;  3S1N B;  2WAC A;  2A74 C;  1BCP F;  4R4Q A;  2NVQ B;  5J1Z A;  1U0L A;  1BUV T;  4M8A A;  2HHH L;  5CGK A;  3BZK A;  1D5M C;  5JJZ A;  3NEM A;  4F87 A;  3DM3 A;  4IQZ A;  1W6K A;  5EQ0 A;  3M4Y A;  4DKA C;  2IJ0 A;  4CHT B;  3FVQ A;  4E6I A;  2GVA A;  2K5V A;  4LW1 A;  5IY0 A;  3QB3 A;  4JI8 Q;  3CCL A;  4L63 B;  1Y1V G;  2BH2 A;  2NN6 H;  1SRU A;  2DUD A;  1XNQ Q;  4L5S A;  1DGS A;  1LT3 D;  4DAY B;  2D2C C;  3TP7 A;  3I73 A;  4DV6 Q;  2XRQ D;  3S1Q B;  4RCO A;  3L2P A;  1HZB A;  1WTP A;  4ZKC B;  2N8N A;  5D14 A;  1PH2 A;  4CDC C;  1RCV D;  1EQQ A;  4P2C B;  2A68 C;  5FK9 C;  1L0Y B;  4G57 A;  1STE A;  4KHZ A;  1KLG D;  4Y7N B;  1K9M C;  3TS2 A;  2F4V L;  2R92 G;  4KMU C;  2J4X A;  1EU3 A;  1TU2 B;  1TS3 A;  4C3I H;  3GO5 A;  1BBU A;  3KF6 A;  2LY7 A;  1JMC A;  1DXM A;  2IW3 A;  5IYB G;  5M9O A;  4R4T A;  4KD3 A;  4KKT A;  4DR4 L;  5EPL A;  5K36 G;  4J8Q A;  4UPA A;  1ZYR D;  3CRL C;  4R4C A;  4HAE A;  4OX9 L;  1I6H B;  1PFN A;  3T1Y L;  1M8A A;  1V1O A;  2HQE A;  1UWV A;  2HD3 A;  3BZD B;  4N8X 1;  1WTO A;  1FNU A;  1Y1V H;  3M9B A;  3RD4 A;  4IO9 A;  1VQL A;  3FP9 A;  1NR2 A;  5IGC A;  3HOU B;  2JEA I;  1NE3 A;  3A55 A;  3MFG A;  5C44 H;  1VQB A;  3CCE A;  2ZTC A;  1J6Q A;  2LS0 1;  4GOP C;  1GM5 A;  1P8L A;  2Z6B A;  3RZD H;  3ULL A;  4K5W A;  4DV1 L;  1QUQ A;  2EY5 A;  1PRT C;  4CDE C;  1HFN A;  3O13 A;  2F0E A;  3HOY G;  4B9W A;  2KEN A;  1UUP A;  3H3V I;  4YHH L;  4DV2 L;  1XMQ Q;  4A4I A;  2BDO A;  3CQZ H;  4O2D A;  1DON A;  4LF7 Q;  1BBX C;  5C5M A;  1XPO A;  3ZJY C;  1VQ4 A;  1RL2 A;  2B2Y C;  3FEW X;  2CQA A;  2QCP X;  1E7Z A;  2LXJ A;  2XWB B;  4A3I B;  4LF8 L;  2EVB A;  5C4J B;  3SK6 A;  1FVI A;  3T1H L;  1AW7 A;  2R3Z A;  3RNU A;  2Z6K A;  4IUT A;  2R92 H;  4A3C G;  1AE3 A;  2A69 D;  4WJ3 M;  2J0T D;  2EY6 A;  5LMU Q;  1O78 A;  5IWA L;  4DR5 Q;  1YI2 A;  4NMZ A;  1CQV A;  5C4X G;  3S14 B;  2GA4 B;  4XT1 B;  1UAP A;  5IYB H;  4LF9 L;  1ENA A;  4HIO A;  3RZO B;  1RJT A;  5L37 A;  2CH4 A;  3A5Z B;  4FP5 D;  1JOQ A;  2GVB A;  1YHQ A;  4GKJ L;  3HKZ B;  5K36 H;  1HNW L;  1WFQ A;  1SBB B;  2RA4 A;  5IOD A;  4IJL A;  1HNZ Q;  1ZEQ X;  3KUP A;  1SN8 A;  2YTY A;  5I9O A;  1UE7 A;  1XNR L;  3CPF A;  4L8J A;  4CKE A;  4JOI C;  4HED A;  3MXN B;  1L1O A;  2K03 A;  1FD7 D;  4HJ9 A;  2VY3 A;  3U9O A;  3OTO L;  1XXG A;  2IX0 A;  4OIJ A;  3ITP A;  3SK8 A;  3PF4 A;  4A3B G;  3GP7 A;  1WTR A;  2VS1 A;  5AJ3 Q;  4YIJ A;  1VQI A;  1YJW A;  2KCM A;  1YNJ C;  3LWE A;  5DEH A;  3UDG A;  3OIP A;  3KLS X;  1KNA A;  1M4V A;  2EQS A;  4YWM A;  3Q0A A;  2EDG A;  2BE5 D;  3HOY H;  1G8Z D;  4HMJ A;  2XTI A;  2EYF A;  3T4A C;  4A93 G;  5KGU A;  1ZXT A;  3VYU A;  2E2D C;  4PV1 C;  4JI1 L;  2KHJ A;  3A56 A;  3BVZ A;  5D3I B;  3ULP A;  3VYS A;  4XQQ A;  4P72 A;  4JVZ A;  3NBH B;  4WRD A;  3GDE A;  5IGE A;  3S16 H;  1ICW A;  1JWU D;  1E2W A;  4BXX G;  1EIG A;  3E9H A;  2MO1 A;  4A3C H;  3AFQ A;  4PZ7 A;  3H09 A;  4K6L A;  1SNO A;  1EIY B;  4IFD I;  1Q12 A;  3JC6 6;  3L9A X;  2MGS A;  4X3U A;  4JV5 L;  1B1Z A;  1I4H A;  3ERO A;  5LHY 1;  5C4X H;  4BY1 B;  1LTT D;  5FLX L;  5HY6 A;  3H15 A;  2X6L A;  1E2V A;  4UHV A;  1PTO F;  5ELD A;  3NK9 A;  3OMC A;  1G2T A;  3WWV A;  4G7Z C;  2K01 A;  4JI3 Q;  1BCP D;  2XN9 C;  5ELO A;  2BDN A;  2NZH A;  1JJ2 A;  2KA7 A;  3DWA A;  4G7O C;  3M7N A;  5IGD A;  1HH2 P;  1LLR D;  1KC8 C;  2UXB L;  4K0K Q;  3HGB A;  3TS0 A;  2GN5 A;  4EQP A;  1ET6 A;  4G4K A;  4FF3 A;  2VUM B;  2YYZ A;  4NP5 A;  4K5X A;  3OW7 A;  1WD1 A;  3CMA A;  4A3B H;  1HPC A;  3KLS A;  2UUC L;  3NTI A;  3K59 A;  3HOV H;  1BQQ T;  2A6E D;  3GV6 A;  1X56 A;  3KLW A;  1QZG A;  3SGI A;  2DJF C;  2QIL A;  3NQT A;  3HKS A;  5ELB A;  2CWA A;  2Q8T A;  2K28 A;  4AIM A;  3DLL A;  1PH4 A;  2KHI A;  4B3M L;  3URY A;  1EYG A;  2E2H H;  2LXK A;  5DM6 3;  2PQE A;  4KJO A;  4RAU C;  3F2C A;  1Q1E A;  4DK3 C;  1HHV A;  3F1Z A;  3K7A B;  3SK5 A;  3GTQ B;  4BY7 B;  1LTA D;  4OHJ A;  1XTD A;  3G6J B;  4A93 H;  1EQT A;  1EEF D;  3TP5 A;  2L55 A;  4LF6 L;  2F0L A;  4CBV A;  5C44 B;  1Q86 C;  3LGJ A;  3ONA B;  1FL0 A;  3K57 A;  4LNQ A;  2OXP A;  1IBL L;  3P20 A;  3RZD B;  4KJN A;  1KRT A;  5KNB A;  1LTG D;  3IL8 A;  5BR8 L;  5FO9 B;  2PO4 A;  2B2T A;  2J7Z A;  1E1O A;  3T51 B;  3PV0 A;  4ZLT F;  2Z1C A;  3HOX G;  3CQZ B;  3PGZ A;  2EYM A;  3S1M B;  3TZD A;  3I3C A;  1F2Y A;  1WOC A;  2WAQ B;  1ICF B;  5IT9 E;  4IPH A;  4R4O A;  4O0A A;  2VW9 A;  5IYC H;  5A2Q E;  1SMY D;  1ET9 A;  4LFB L;  2FJ2 A;  1U4R A;  1A0I A;  2G5D A;  3QO2 A;  2B2V C;  1CT1 D;  1V8Q A;  1BR9 A;  2XIW A;  1SYD A;  3S17 H;  1WI5 A;  3CCR A;  2L12 A;  4A3F B;  2AUK A;  2Y0S E;  3AYH B;  3J7Y W;  2C35 B;  2JK8 A;  1LT4 D;  1SE8 A;  2A69 C;  4FXD A;  4LUO A;  1B2T A;  2R7F A;  3IRB A;  4GN4 B;  2V4D A;  3ICE A;  5JJK A;  1JWS D;  3PMF A;  3BG3 A;  4U68 A;  2E2J B;  1PFB A;  2LSS A;  5ELN A;  4IZ8 A;  2IWH A;  3BVM A;  3KDF B;  5FLX c;  1I3Q H;  2VQF L;  1CHP D;  2DJG C;  3L0O A;  3BYT B;  1STB A;  2VB2 X;  4C1N K;  1JOK A;  2P5Z X;  2PNH A;  4QL5 A;  1IBK L;  2KBN A;  2KJX A;  1XMO L;  2WB1 B;  2L15 A;  1VQ8 A;  2JA8 B;  4JI2 L;  1YNX A;  5T1G A;  1STG A;  2KOL A;  1NMG A;  5CV5 A;  3SXH A;  5IGG A;  4L5R C;  2OQ0 A;  2BCO A;  4GZY C;  5EGT A;  2IT1 A;  5IOC A;  3S1N H;  4IFD J;  2IPK D;  3VYR A;  1GJX A;  3WDN A;  3HOX H;  3GTL H;  1ENF A;  1A2T A;  4P73 A;  4DAV A;  1BDO A;  4DV3 Q;  1YIT A;  2OEO A;  1KAW A;  1D7Q A;  3UDX A;  3D31 A;  3M4O B;  1A63 A;  5C3E G;  5FOB B;  3NPP A;  3S16 B;  1ESF A;  2KED A;  5C3X A;  1HNX Q;  4UP7 A;  2KCC A;  4GNX C;  2MNA A;  1PZJ D;  2MQH A;  1KIX A;  2KCT A;  2F0O A;  1I6V C;  3S2H H;  1O7Y A;  2K5W A;  2XRS D;  3L3O C;  3HOU G;  1RD9 D;  4WOR A;  2OWO A;  4LFA Q;  4DNT B;  2CH4 W;  2N55 A;  4DV0 Q;  2LMC B;  3S1Q H;  1STN A;  4DV5 L;  3TME A;  2EJG C;  1H9J A;  1YVC A;  3G48 A;  3PIP 3;  1F2M A;  4YY3 L;  3JAM E;  1N32 Q;  3D6C A;  1O7L A;  3A8I E;  1MIU A;  1B9M A;  1YHA A;  3AMU A;  1BCP C;  1A15 A;  4FF2 A;  4KKU A;  1FJG L;  2EYO A;  2QDB A;  1V43 A;  4A3I G;  3GTK B;  1CM9 A;  2K7V A;  1K83 H;  1P16 A;  1NJI C;  4IN3 A;  3J81 E;  4KHP Q;  3HOV B;  4Q5V A;  2WV6 D;  5C6A A;  1Z7T A;  1GUG A;  1PYW D;  1PXU A;  3E0J A;  3K0X A;  5KRU A;  3J80 L;  3TZU A;  5D3D A;  4DV7 Q;  2WKC A;  1JB7 A;  2H5X A;  2YV5 A;  3LX0 A;  2D0O A;  2PCF B;  2VXW A;  3KF8 B;  1A8V A;  1RDP D;  2E2H B;  1STH A;  1QZH A;  4M1U B;  5HGQ A;  3NHH A;  1RHP A;  1SAP A;  4DPG A;  1PLF A;  3D4D A;  1I6H H;  1PTO D;  5C3E H;  1NAP A;  1QWY A;  4RFB A;  1JQY D;  2B2W A;  2F0K A;  1C8C A;  4FYD A;  1EIH A;  4DR6 Q;  1CKN B;  1DJR D;  3RLN A;  4RHS A;  3PQI A;  4GKK Q;  4JBW A;  3HOU H;  5JEA J;  1MJC A;  1S5E D;  4GOP B;  2ASB A;  1NCV A;  1NR4 A;  1B3A A;  3CC2 A;  3OWF A;  4OWW B;  2QW7 A;  1WTV A;  1PRT B;  4CJ1 B;  5LL6 X;  4X3T A;  4H44 C;  4JC0 A;  3MA2 B;  1D1K A;  2EE1 A;  2R6G A;  1TWH H;  5M3M B;  4QB4 A;  1TY0 A;  1NNX A;  1XX8 A;  4Y52 H;  2M2L A;  2IY5 B;  2D0P A;  4DK0 A;  1JC7 A;  1JIC A;  2VNU D;  1SFO B;  1K8A C;  1ILP A;  4JI7 L;  4OXP A;  4ZYS A;  4NXM Q;  1VQK A;  4TSS A;  3TP8 A;  2A6H D;  1N9W A;  1SMY C;  2K5D A;  4A3I H;  5G3L D;  5M3F B;  5C4J H;  1PYB A;  3VDY A;  1A3V A;  1EZ8 A;  1SNC A;  4QIW E;  4FXK C;  3STB C;  4KN4 C;  1G6P A;  2A73 B;  1E24 A;  1KQS A;  2UUB Q;  4JI0 Q;  1C9O A;  2K6A A;  1RIP A;  5BN4 A;  2BA1 A;  2JJQ A;  2AQ2 B;  4A3J B;  1GUW A;  1TWG B;  3S14 H;  1TKW B;  4BY1 G;  2Q2H A;  1AN8 A;  3RZO H;  3M4P A;  1QNU A;  3H3V C;  1I3Q B;  2E5L Q;  4IJH A;  2IX1 A;  2HT1 A;  4NKL A;  1D5X C;  2E2I H;  1Q1B A;  1KRS A;  4HCS A;  5CR3 A;  4DA2 A;  3MEH A;  1R4P B;  1ONL A;  1WJJ A;  1SDF A;  3GQB A;  4RMF A;  4DR2 Q;  3CHB D;  2O4X A;  2VUM G;  2CQO A;  1K0S A;  4JI8 L;  1PYS B;  4FO2 A;  5C4H A;  1OTC A;  4LMQ D;  1XNQ L;  4CDD C;  1JWM D;  4O1N A;  4QGU A;  3HOX B;  2Z9H A;  3GTL B;  4DV6 L;  3TSS A;  3FMC A;  1Y8N B;  2I46 A;  1R9T H;  2ZJP A;  3J80 c;  4JBK A;  1EY7 A;  1PFM A;  1HQR D;  3S9W A;  1U4L A;  3UDI A;  4N9T A;  1DZ1 A;  3H94 A;  3I4M G;  4XTC S;  3NP8 A;  4BY7 G;  3R2T A;  2AHO B;  1D5Z C;  1IBM Q;  1G2S A;  4Q0F A;  1LUZ A;  2OTL A;  3S2H B;  4ZUI A;  1DOM A;  1FGU A;  4C3J B;  4MNO A;  4QJF A;  5C44 G;  4OWX B;  4JG2 A;  3VR6 A;  2RCN A;  1EY5 A;  3CCV A;  5I6W A;  4A3D G;  4UP8 A;  1EYA A;  4LWC A;  4V0B A;  4AYB E;  4HJ8 A;  3KBG A;  4UAI A;  2R93 G;  4JI6 Q;  3BDL A;  1C0A A;  3D3R A;  3ERQ A;  4JPB W;  4HIK A;  2PZT A;  5EKI A;  4BY1 H;  1GHJ A;  3CKI B;  3I4N H;  4B08 A;  2WAQ G;  4PQX A;  1E0B A;  1B53 A;  4CKB A;  1A3T A;  1B44 D;  4OO1 G;  5E1F A;  1MHW C;  2K05 A;  1K83 B;  1VS0 A;  4DV4 Q;  2BH8 A;  3T13 A;  2PZU A;  4B3R Q;  3EVQ A;  4JK1 C;  3X3N A;  1CA5 A;  2PW5 A;  2UUA Q;  4EGV A;  4CDF C;  2AQ3 B;  4JI5 Q;  2F0N A;  2RSN A;  1H9S B;  3CPW A;  4DFA A;  4A3F G;  2PMZ E;  2VUM H;  1QOH A;  3PCO B;  1Y8O B;  1NBW A;  2F0T A;  5D65 A;  2XVS A;  1MBY A;  4RHR A;  4HTH A;  1OXS C;  5I6Y A;  3ERS X;  3G7L A;  3OHX C;  2NVT B;  2WII B;  1PH5 A;  2F4I A;  5KIX A;  2B63 B;  1NSN S;  1KDA A;  2KQ3 A;  3K5L A;  5JVG 3;  3HG9 A;  4ILW A;  5C3E B;  2ZM6 Q;  3A0J A;  2KHS A;  4DUY Q;  3A5U A;  3S15 H;  3K7A H;  4Z9C B;  1XMQ L;  3I4M H;  3GTQ H;  1X3G A;  1DCZ A;  2F3I A;  1L2F A;  4BY7 H;  2YTV A;  3SVM A;  3U4Z A;  1PTO C;  2A8V A;  1BKB A;  2WB1 G;  5E4W C;  1VQE A;  2JA8 G;  4OO1 I;  1EL0 A;  4DR1 Q;  3S1R H;  2NUC A;  4A3D H;  2R93 H;  1Y14 B;  3RUZ A;  1TWH B;  2MHV A;  5LMU L;  4DR5 L;  1GXD C;  3X3M A;  4A3L G;  5EKL A;  1BO0 A;  2Z6K C;  4CGY B;  4A75 A;  5GAE C;  4GLV B;  3S1M H;  5A35 A;  4DUZ Q;  2K50 A;  1CZG A;  1KD1 C;  2QDL A;  4OO1 H;  4JCV E;  1HNZ L;  2OTJ A; 
#chains in the Genus database with same CATH homology
 4C2M H;  4AIM A;  3DLL A;  1PH4 A;  1A62 A;  2KHI A;  4B3M L;  3CD6 A;  1EYG A;  2E2H H;  1QVG A;  4GN5 A;  2ES2 A;  2LXK A;  3F2C A;  2VQE Q;  1Q1E A;  4PG3 A;  4DK3 C;  3FKI G;  1X54 A;  4GNX A;  3F1Z A;  2ALY B;  1TWC H;  3JAM i;  3G4S A;  4DK6 C;  4JI6 L;  2R7Z H;  1XTD A;  4MTN A;  4A93 H;  3D0F A;  4A3F H;  4XIG S;  2CFM A;  4YWK A;  3KDF A;  2WFW A;  4LF6 L;  4C3H H;  1KXL A;  1Q86 C;  2Y0S G;  3LGJ A;  3Q8D A;  5AJ3 L;  2NZO A;  1FL0 A;  3KYH C;  2IHE A;  3G6E A;  4LNQ A;  1Q46 A;  1IBL L;  1L1O C;  3I55 A;  4DR7 Q;  2Z0S A;  1OXU A;  1X3F A;  1KRT A;  4IOC A;  1IYJ B;  5E7N A;  1VQM A;  5BR8 L;  2E2J H;  2PQA A;  2D62 A;  4LFC L;  3CCQ A;  4AQY Q;  4B3S Q;  1E1O A;  3PIP A;  3GTJ H;  3PV0 A;  4DV4 L;  4EQ5 A;  4Y7N H;  4JYA Q;  3K7U C;  4OWT B;  3HOX G;  5LMN L;  4B3R L;  4MZ9 A;  4DV5 Q;  1U5K A;  3PGZ A;  2NVY H;  1VQO A;  2UUA L;  1WOC A;  5IYD G;  4JI5 L;  4YY3 Q;  4R1J A;  4BBS H;  3FHW A;  4IPH A;  4R4O A;  4X62 Q;  1NMF A;  2K5N A;  3CCS A;  3BZC A;  3HOV G;  4O0A A;  2VW9 A;  3CXC A;  1MJE A;  1QUQ B;  5IYC H;  1EOV A;  1Q8K A;  4FDB A;  1YBY A;  1YEZ A;  4H02 A;  2JA8 H;  3UE1 A;  3GD7 A;  4LFB L;  3J7Z C;  1PH9 A;  1A0I A;  2VL6 A;  5H1S E;  3HKZ G;  2HHH Q;  1FJG Q;  1IXR A;  1G51 A;  1S40 A;  5JJL A;  2F52 A;  1UE1 A;  5FLM H;  3S17 H;  1WYD A;  1WI5 A;  3CCR A;  4HJ5 A;  1B8A A;  1NY4 A;  1AE2 A;  1WCM H;  3JAM c;  2Y0S E;  5FJ8 G;  3AYH B;  4PMW A;  4YCW A;  3RLO A;  2C35 B;  1MKH A;  2JK8 A;  3KJP A;  1VQ7 A;  1QVF A;  2B29 A;  1SE8 A;  2ZM6 L;  2UXC L;  4LUO A;  2AKW B;  4A3L H;  2R7F A;  3IRB A;  4GN4 B;  4DUY L;  3U58 A;  5IP7 G;  3F2B A;  3ICE A;  5JJK A;  1JJG A;  2JA7 G;  3J7A 5;  2BA0 A;  2K4K A;  2N49 A;  4JBJ A;  2ATW A;  1VQD A;  4JI3 L;  1O7I A;  3M4O H;  3J81 c;  4GNX B;  1JJC B;  1PV4 A;  1Q82 C;  3H0G G;  4P74 A;  2LSS A;  2E8G A;  5ELN A;  4DR1 L;  1SLJ A;  2IHF A;  4DR3 Q;  3KDF B;  3FKI H;  1I3Q H;  5FLX c;  2VQF L;  2AWN A;  1EQR A;  3L0O A;  1L0W A;  1HZA A;  2VZA A;  3EIV A;  3W5O A;  4K0K L;  3RN5 A;  1H95 A;  2ZJQ A;  3GTP H;  2PNH A;  4QL5 A;  1VCI A;  1IBK L;  1ASY A;  2KBN A;  1XMO L;  3TRZ A;  1UEB A;  1W3S A;  2L15 A;  5JJI A;  1VQ8 A;  3HKZ E;  2K5H A;  4JI2 L;  1N33 Q;  3GTM H;  4YCV A;  5GAD C;  2PQA B;  4LF7 L;  1YNX A;  2ID0 A;  3PSI A;  5M3M G;  4L5R C;  2NN6 G;  1NMG A;  1OXT A;  4RG1 A;  3CP0 A;  4DUZ L;  1C7Y A;  1M1K C;  5IYC G;  2OQ0 A;  3HOZ G;  3CCJ A;  1BBW A;  2IT1 A;  1UE6 A;  4PZ6 A;  1Y1W G;  2F4V Q;  4DAM A;  3S1N H;  2JQO A;  4IFD J;  4R4I A;  5GAH C;  2YU9 H;  1S3O A;  3HOX H;  4HJ7 A;  2VQE L;  3GTL H;  1T9H A;  4P73 A;  5M3F G;  4DV3 Q;  1YIT A;  3GTK H;  1PVO A;  5IYD H;  1M90 C;  1E22 A;  1KAW A;  4GN3 B;  1X65 A;  3UDX A;  1D7Q A;  1I5F A;  3G71 A;  3D31 A;  1A63 A;  5C3E G;  2K52 A;  2PI2 A;  4DR4 Q;  3I2Z A;  1HNX Q;  2JEB I;  4UP7 A;  1S72 A;  4GNX C;  1E1T A;  2MNA A;  2MQH A;  1OXX K;  1KIX A;  4A3J G;  2KCT A;  4DR7 L;  3S2H H;  4X6A H;  3HOU G;  3I4O A;  4OX9 Q;  4B3T Q;  2OWO A;  2HIV A;  1CKN A;  4LFA Q;  2UU9 Q;  4B3S L;  4AQY L;  5FJ8 H;  4DV0 Q;  3T1Y Q;  1ASZ A;  4BBR G;  4UY8 C;  4JYA L;  3S1Q H;  4EX5 A;  1TWF H;  4GOP A;  4DV5 L;  1OXV A;  4POF A;  1X6O A;  5C0X G;  4A3E G;  3PO2 G;  1YVC A;  3G48 A;  5IP7 H;  3PIO A;  4YY3 L;  5M5X H;  2JA7 H;  3OYY A;  1HR0 W;  4X62 L;  1N32 Q;  2NN6 I;  2ZTE A;  3K81 C;  3H0G H;  4IPC A;  1CSQ A;  1MIU A;  4R4Q A;  3J81 i;  1X3E A;  4LF4 Q;  1YHA A;  3PO3 G;  1XPR A;  4TVA B;  1U0L A;  4AH6 A;  1VQ9 A;  4DV1 Q;  2HHH L;  1FJG L;  2A1A A;  3BZK A;  1V43 A;  4A3I G;  3J81 j;  1KL9 A;  1K83 H;  3RR5 A;  1P16 A;  1NJI C;  3H3V H;  1EUJ A;  4YHH Q;  3NEM A;  3DM3 A;  4KHP Q;  3PUZ A;  4DV2 Q;  4L5Q A;  1PA6 A;  1G29 1;  3PUX A;  4DKA C;  3K0X A;  4APV A;  2GVA A;  2K5V A;  4DV7 Q;  4LW1 A;  5IY0 A;  4JI8 Q;  3CCL A;  1Y1V G;  2EIF A;  2YV5 A;  2H5X A;  2D0O A;  2I5L X;  4GS3 A;  5M3M H;  1JB7 A;  1SRU A;  3KF8 B;  1K8G A;  1IL2 A;  1A8V A;  2DUD A;  4LF8 Q;  1YHB A;  1XNQ Q;  3NEN A;  3HOZ H;  3T1H Q;  1DGS A;  4L5S A;  4L5T A;  1Y1W H;  4DAY B;  1SFO H;  1LYL A;  4DV6 Q;  4IFD G;  1QZH A;  4DR3 L;  5IWA Q;  5HGQ A;  3L2P A;  1HZB A;  1PH1 A;  1K0R A;  4ALP A;  5M3F H;  2N8N A;  2R7D A;  4DPG A;  1V9P A;  4GLA C;  5C0X I;  4LF9 Q;  4NXN Q;  1I6H H;  1PH2 A;  5C3E H;  1EQQ A;  1YIJ A;  4GKJ Q;  4JOI A;  1N33 L;  1HNW Q;  3B6Y A;  1Q7Y C;  1CKN B;  3RLN A;  4NPS A;  4DR6 Q;  1J5E Q;  1I94 Q;  4LF5 Q;  1D8L A;  2ZTD A;  3K80 C;  4KLK A;  3UE0 A;  1TWG H;  4A3J H;  1SRO A;  1CUK A;  1UE5 A;  4JBW A;  1JE5 A;  3HOU H;  1Z9F A;  1MJC A;  4KHZ A;  5JEA J;  4GOP B;  3W1G A;  1N36 Q;  2ASB A;  1XJV A;  4A3K G;  4PZ8 A;  1HZC A;  3EBE A;  3MEF A;  1PH7 A;  1K9M C;  2YTX A;  1XNR Q;  1PH8 A;  3CC2 A;  1VQP A;  2F4V L;  3TS2 A;  4OWW B;  2R92 G;  2UXD Q;  4BBR H;  4HID A;  4BA2 I;  1HJP A;  4C3I H;  4JC0 A;  3GO5 A;  3OTO Q;  1BBU A;  3KF6 A;  1JMC A;  2R6G A;  3HFZ B;  5GRO A;  1TWH H;  4A3E H;  3PO2 H;  4DV3 L;  3OW2 A;  3U4V A;  1K73 C;  3RLF A;  3EN2 A;  5IYB G;  3K8A A;  2JA6 G;  5LMN W;  4DNI A;  4R4T A;  3GTO H;  4Y52 H;  2IY5 B;  1VQC A;  2D0P A;  3S24 A;  1VQJ A;  4DR4 L;  1N34 Q;  2VNU D;  5M5Y H;  1K8A C;  5K36 G;  1HNX L;  1VQG A;  4JI7 L;  3PO3 H;  4OXP A;  2I5H A;  4NXM Q;  4OON A;  4UPA A;  1VQK A;  4R4C A;  1N9W A;  4QY7 A;  4A3I H;  2AMC B;  4OX9 L;  5C4J H;  4B3T L;  1PYB A;  3VDY A;  1BVS A;  1VQ5 A;  1V1Q A;  2UU9 L;  4LFA L;  1K3R A;  4QIW E;  3J80 i;  3STB C;  4DV0 L;  1G6P A;  2QEX A;  3T1Y L;  1E24 A;  1KQS A;  3BU2 A;  1CKM A;  1SMX A;  2UUB Q;  4JI0 Q;  2DGY A;  1X9N A;  1C9O A;  1TWA H;  1UWV A;  4IPD A;  2B63 G;  1SR3 A;  1RIP A;  2N3S A;  2Q2I A;  4JI1 Q;  2I5M X;  3M4Q A;  2JA5 G;  2BA1 A;  1Y1V H;  2JJQ A;  3M9B A;  4IO9 A;  1VQL A;  3S14 H;  4BY1 G;  3FP9 A;  3BJU A;  1GVP A;  4LUV A;  4NB3 A;  2JEA I;  2Q2H A;  3I7F A;  1NE3 A;  1N32 L;  2CWP A;  5J3B A;  3RZO H;  5C44 H;  3M4P A;  1VQB A;  3CCE A;  2ZTC A;  1J6Q A;  4GOP C;  1GM5 A;  1P8L A;  4LF4 L;  3CCU A;  2E5L Q;  4IJH A;  3RZD H;  1Q81 C;  1VQA A;  3ULL A;  4C3J H;  2IX1 A;  2CKZ B;  2HT1 A;  4DV1 L;  1VQ6 A;  1QUQ A;  4X65 Q;  4JV5 Q;  1AH9 A;  2JE6 I;  2E2I H;  1Q1B A;  1KRS A;  3HOY G;  2I0Q A;  4YCU A;  1HR0 Q;  2KEN A;  1VQN A;  3H3V I;  4YHH L;  1PHJ A;  4KHP L;  1WJJ A;  4DV2 L;  5IE8 A;  1E3P A;  4A4I A;  1XMQ Q;  4JI4 Q;  3CQZ H;  4O2D A;  4P71 A;  4RMF A;  4DR2 Q;  3AFP A;  4LF7 Q;  2EXD A;  3KOJ A;  3UDF A;  4A3M H;  4AYB G;  1W2B A;  1NTG A;  4LUZ A;  2CQO A;  4DV7 L;  4HIM A;  2VUM G;  1XPO A;  1B70 B;  4JI8 L;  1PYS B;  1QVC A;  3TRE A;  3ZJY C;  3CC7 A;  1RL2 A;  1VQ4 A;  1E7Z A;  2LXJ A;  3F2D A;  4LF8 L;  3PUV A;  1OTC A;  1VQF A;  5JEA G;  3KF6 B;  1XNQ L;  1FVI A;  3T1H L;  4A3K H;  4QGU A;  1PH3 A;  3AQQ A;  1XPU A;  3CME A;  3RNU A;  2Z6K A;  2R92 H;  4DV6 L;  1EWI A;  3RN2 A;  1AE3 A;  2Q2T A;  4A3C G;  2UXB Q;  4WJ3 M;  4X64 Q;  1R9T H;  2ZJP A;  3J80 c;  4JBK A;  5LMU Q;  4DR5 Q;  5IWA L;  1GO3 E;  1YI2 A;  3HOW G;  5C4X G;  2WB1 E;  3UDI A;  5IYB H;  4NXN L;  2UUC Q;  4LF9 L;  2JA6 H;  4HIO A;  3I4M G;  3A5Z B;  4XTC S;  1EFW A;  4BY7 G;  2AHO B;  2GVB A;  1YHQ A;  4GKJ L;  1IBM Q;  1HNW L;  4DR6 L;  1LUZ A;  4YWL A;  2OTL A;  1WFQ A;  4X66 Q;  1HNZ Q;  1FGU A;  4IJL A;  3AEV A;  2K14 A;  2K75 A;  4IPG A;  4MNO A;  4QJF A;  1YJN A;  1SN8 A;  1J5E L;  1I94 L;  4LF5 L;  4BXX H;  5C44 G;  2YTY A;  4B3M Q;  4GKK L;  3E0E A;  4OWX B;  1N36 L;  4JG2 A;  2RCN A;  3CCV A;  1UE7 A;  1XNR L;  2OQK A;  4A3D G;  4UP8 A;  3CPF A;  4LWC A;  4AYB E;  4JOI C;  4HJ8 A;  2UXD L;  3MXN B;  5M5W H;  2R93 G;  3NEL A;  4JI6 Q;  1C0A A;  1L1O A;  4HJ9 A;  3A74 A;  3CAM A;  5IP9 G;  2VY3 A;  4P75 A;  2NVT H;  2RHQ B;  3OTO L;  2IX0 A;  2B63 H;  4ME3 A;  4LF6 Q;  1KHI A;  2JA5 H;  3CC4 A;  3PF4 A;  4A3B G;  4POG A;  4HIK A;  1B7Y B;  1GKH A;  2A19 A;  4BY1 H;  2MFI A;  2VS1 A;  3ER0 A;  5AJ3 Q;  3CF5 A;  4A3M G;  3I4N H;  1VQI A;  1YJW A;  5EAY A;  1IBL Q;  2KCM A;  2WAQ G;  2RHS B;  1CKO A;  1N34 L;  3TEH B;  4JBM A;  2BH2 A;  2V1C C;  1JT8 A;  4A3G G;  4OO1 G;  4BA1 I;  3UDG A;  3STB D;  1LM0 A;  5BR8 Q;  4NXM L;  4LFC Q;  3L7Z C;  1VS0 A;  2EQS A;  4YWM A;  1EIF A;  4J15 A;  2BH8 A;  4DV4 Q;  3U50 C;  3F8T A;  5LMN Q;  3HOY H;  4B3R Q;  3PF5 A;  4QQB X;  3W1B A;  2XTI A;  2HQL A;  2UUA Q;  4GKK Q;  5C0X J;  4JI5 Q;  2UUB L;  4JI0 L;  2R7Z G;  3S2D H;  4A93 G;  3CPW A;  4A3F G;  2PMZ E;  2VUM H;  1I50 H;  4JI1 L;  2KHJ A;  4GLX A;  3PCO B;  4UP9 A;  2JA9 A;  3ULP A;  3I56 A;  1NBW A;  4LFB Q;  2QGQ A;  1PFS A;  2MO0 A;  4P72 A;  3NBH B;  3GDE A;  3S16 H;  1OXS C;  4BXX G;  3E9H A;  2MO1 A;  1HZ9 A;  3ERS X;  4A3C H;  3AFQ A;  4PZ7 A;  2E5L L;  2AWO A;  4IFD I;  1EIY B;  1TXY A;  5IT9 c;  2XGT A;  1Q12 A;  1PH5 A;  3JC6 6;  3M85 A;  3KFU A;  4X65 L;  2N78 A;  4JV5 L;  3HOW H;  5C4X H;  2ZM6 Q;  2UXC Q;  1HR0 L;  2B3G A;  2WAQ E;  3A0J A;  2RF4 A;  3ULJ A;  4TQU S;  5GAG C;  5HY6 A;  3A5U A;  4DUY Q;  3K7A H;  1XMQ L;  3S15 H;  3H15 A;  2WP8 J;  3I4M H;  2QA4 A;  1X3G A;  2F3I A;  4JI4 L;  3GTQ H;  1L2F A;  4DR2 L;  4BY7 H;  3GTG H;  4BBS G;  2YTV A;  3WWV A;  4JI3 Q;  4A76 A;  3PUY A;  3U4Z A;  5ELO A;  2NZH A;  1JJ2 A;  2A8V A;  1BKB A;  2WB1 G;  3I4N G;  1L1O B;  1VQE A;  5DLQ E;  2JA8 G;  4OO1 I;  3PUW A;  4DR1 Q;  3S1R H;  3M7N A;  1IZ6 A;  2PI2 E;  4A3D H;  2VQF Q;  1HH2 P;  1CSP A;  5FLM G;  2CCZ A;  3KJO A;  2NVQ H;  1KC8 C;  2R93 H;  1Y14 B;  4KI0 A;  5GQO A;  2UXB L;  4K0K Q;  5IP9 H;  4X64 L;  2GN5 A;  3TS0 A;  1PH6 A;  1WCM G;  5LMU L;  4DR5 L;  2NVX H;  2YYZ A;  1IBK Q;  2Q2U A;  4HJA A;  1XMO Q;  3CMA A;  4A3B H;  1X55 A;  4IOA A;  2HIX A;  3CW2 C;  4WJ4 A;  2FXQ A;  4JI2 Q;  1VQH A;  4A3L G;  2UUC L;  3HOV H;  2Z6K C;  1YJ9 A;  4A75 A;  1X56 A;  1YZ6 A;  2OCE A;  4GLV B;  5GAE C;  3CCM A;  1GD7 A;  3S1M H;  1Z47 A;  3M3Y H;  3KLW A;  4DUZ Q;  2ZJR A;  4JI7 Q;  1QZG A;  2K50 A;  3SGI A;  3E9I A;  1KD1 C;  1IBM L;  4A3G H;  3TQY A;  3HKS A;  4JCV E;  4X66 L;  1HNZ L;  1N8R C;  2CWA A;  1LTL A;  2OTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...