2UU9Q

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uu9Q00
3OW2A 1E1TA 1PH1A 4JV5Q 1KQSA 3NEMA 3HFZB 2LXJA 1I6HH 1WFQA 2E2JH 5M5XH 4A3KH 3STBD 4YCWA 1E22A 4J15A 4LF7Q 4KHZA 2N3SA 3PO3G 5JEAJ 4A3FH 2JA5G 2VW9A 3KYHC 4A3DG 1HH2P 1YZ6A 5BR8L 4DV1Q 2EXDA 2K52A 1I5FA 1SFOH 3NELA 1PH3A 2I5MX 1VQ8A 3CCSA 4LF5Q 3PIPA 5IYDG 4A4IA 1LTLA 1JB7A 3HOVH 2CQOA 5FJ8H 3J81i 2IHEA 3W1GA 3PIOA 1UWVA 1IBKQ 5IT9c 2E2HH 1Q81C 1XNQL 3A0JA 1PH4A 4KLKA 2I5LX 2Y0SG 2YV5A 3U50C 3RZDH 5IYCH 4BXXH 3I4NH 2UXCL 4Y52H 3PV0A 3J81c 4DV0L 4L5QA 3JAMc 2ATWA 1X6OA 1X3EA 3CCJA 4B3MQ 1EWIA 1PA6A 1N34L 3ULJA 4DR3Q 5C4XG 1D8LA 4PZ7A 1MJEA 1K8GA 2BH8A 1KHIA 3OYYA 4LFCL 2ALYB 1S72A 4DV5Q 4JI5L 2N8NA 4DV7L 1FVIA 1EFWA 4DR4L 2WP8J 3KOJA 2KCTA 2VY3A 5IP7H 4LUZA 4GNXA 4RMFA 4PZ6A 4DV2Q 3UE1A 1L1OA 1NE3A 1VQGA 2CFMA 4IOCA 4JYAQ 3K7AH 4A76A 2K5HA 2Z6KA 2K4KA 4X65L 3F1ZA 2K5NA 5M5WH 3S15H 3KF6A 1SN8A 4DV3Q 5FLMG 3S1MH 3NENA 4HJ8A 2D62A 1IXRA 1VQCA 2KBNA 3RR5A 4B3RQ 2VUMG 2GN5A 3ICEA 2B63G 2VZAA 2YYZA 1Y14B 4B3SQ 1C9OA 1K0RA 3EIVA 3B6YA 1X55A 3RN5A 1N8RC 3CC2A 2AHOB 2YTVA 4IPCA 1P16A 1XMQL 2ZJPA 2ZTEA 3ERSX 4RG1A 1GKHA 1J5EL 2CWPA 4A3IH 1HZAA 5C44G 2XTIA 1I94Q 4JG2A 3AYHB 3ULLA 1XPUA 4A3BG 4LFBL 1X54A 1D7QA 1G6PA 4P72A 4XTCS 3D31A 1QUQB 1VQ9A 4A75A 3ER0A 1YJ9A 4KHPQ 2ZTDA 4JV5L 2Y0SE 4AIMA 2VQFQ 2V1CC 2F52A 2RF4A 5J3BA 5LMNL 2JA6H 4GN5A 4YWMA 3CCLA 1Z47A 3HOUG 4A93H 1YBYA 1L0WA 2B63H 4C2MH 5M3MG 4LF7L 3PF4A 2GVAA 4DUZQ 2LXKA 4A3EG 1Q7YC 4GOPB 3HKZG 4DV1L 1DGSA 4DR1L 1ASZA 2R6GA 2IX0A 2QGQA 1XNRQ 4HJAA 1GM5A 4A3MG 1V1QA 1KRTA 4DR5Q 2UUCQ 4JBKA 5M5YH 1MKHA 5C44H 1X3GA 2JA7H 4A3BH 2YTXA 5GADC 2F4VQ 1X9NA 1UE6A 4AQYQ 2PQAA 3HOXG 1KAWA 1R9TH 1P8LA 2ZJRA 4DR6Q 3F8TA 2EIFA 4A3LH 4X62L 1WOCA 1IBLQ 2LSSA 1Y1WH 5HY6A 1KC8C 2E2IH 2NVYH 2A8VA 1AH9A 3CCMA 2AWOA 4YWKA 4OX9L 3E0EA 1K8AC 4X66L 4DV6L 1U5KA 1NJIC 2JJQA 3S16H 4X64L 3PO2G 4LF4Q 2E5LL 2HT1A 1YIJA 2A1AA 2NN6G 4LUVA 4BY7H 1XMOL 1IBML 3AQQA 2R92G 3G6EA 1JJ2A 1HZCA 4DV4Q 4GKJQ 3GTMH 3TREA 4MNOA 1EQRA 4R4CA 4BY1H 3S2DH 1TWCH 1W2BA 2UU9Q 3TRZA 3RLOA 3TQYA 2VNUD 4UP9A 4O0AA 4PZ8A 4BBRH 3MXNB 5HGQA 5IP9G 3OTOL 3GTJH 3PUWA 4BBSH 1HNWQ 2BA1A 4YCVA 1CKMA 5EAYA 1E7ZA 5AJ3Q 1EQQA 1N36L 1HNXL 1PH2A 1QVCA 3I4MH 4YY3Q 3J7ZC 1O7IA 2UUAQ 1A8VA 3CD6A 4P71A 4B3SL 3FKIG 4JI4Q 3DLLA 3IRBA 2JA8G 3PO2H 5IWAL 1Y1VG 1I50H 1VQOA 1EOVA 1UE7A 1Q8KA 3T1YQ 1JJGA 4DUYQ 4NXMQ 4JI3Q 3HKZE 3PCOB 3PGZA 4B3TL 3GTPH 4K0KQ 2R7ZG 1K73C 3H3VI 4JOIC 1E1OA 2WFWA 3S17H 4IPHA 4HIKA 3L7ZC 5GROA 4IPDA 4QGUA 4FDBA 1HNZL 1NY4A 4X6AH 1VQMA 4GOPC 3I56A 1CUKA 3T1HL 3S1QH 1VQHA 2ZM6Q 1S3OA 3U4ZA 3CCQA 4GLAC 4GNXB 2L15A 3K0XA 2CKZB 3FKIH 3H0GH 1YITA 1N33Q 3W5OA 1AE2A 3AFPA 4PMWA 3FHWA 4A3DH 1EIFA 4OO1G 3E9HA 2MQHA 1MJCA 1Q1BA 4JI1Q 4LF9Q 3HOWG 4UP8A 1B70B 3BJUA 2ID0A 4MZ9A 4QIWE 4JI6L 4LF6Q 1JE5A 2K50A 3RZOH 3M4PA 3PO3H 3EBEA 2JA5H 1PVOA 1B7YB 4AQYL 3ULPA 4UP7A 3S1NH 1IZ6A 5JEAG 4R4TA 5C0XJ 3CC7A 4DR7Q 2IY5B 3GO5A 3I4OA 1KXLA 2NVQH 3KDFA 5IYDH 2NZHA 2GVBA 4JI7L 1PV4A 1Z9FA 4DKAC 1PHJA 4HIMA 1ASYA 4GKKQ 4DR2Q 2PI2A 2UXDL 4APVA 1K3RA 3CW2C 4R1JA 4YWLA 4LFAQ 4JI8Q 1OTCA 1A63A 1TWGH 3H3VH 2VQEQ 2KHIA 1TWAH 2QA4A 3G4SA 2N78A 3G71A 1IYJB 3HOYG 2K5VA 2ZTCA 5C4XH 3DM3A 1WYDA 5JJIA 5GAHC 1G291 5LMUL 1OXSC 4DV4L 3TEHB 1RIPA 1PYSB 2RCNA 3PUXA 2D0PA 3STBC 4ALPA 3CAMA 3BZKA 1G51A 4A3CG 1SR3A 5FLXc 2UXBL 2JE6I 1KRSA 3K8AA 1KL9A 2HHHQ 4DAYB 4GLVB 1YJNA 2IT1A 1YHAA 2NZOA 2OTJA 4DAMA 5C3EG 3M9BA 1CKNB 2A19A 2VS1A 1PH7A 2NVXH 4NXNQ 5IE8A 5M3FG 1A0IA 3GTQH 2PQAB 1HR0Q 3VDYA 1VQKA 1XPOA 2NVTH 5FLMH 3I2ZA 4YHHQ 1UEBA 3M4QA 2KENA 3UE0A 2VUMH 1FJGQ 4LF8Q 1WCMG 5K36G 3RLNA 4GNXC 3UDFA 2UUBL 4JI2Q 4R4QA 4A3GG 4OXPA 4AYBG 2JEBI 1C0AA 4LF5L 1YVCA 2Z6KC 4EQ5A 2K14A 4R4IA 3I55A 4P75A 2ZM6L 1OXTA 3AFQA 1IBKL 1VQ5A 1EIYB 2JK8A 5BR8Q 3D0FA 4BA2I 1VQ4A 2NN6I 2DGYA 2PI2E 4BA1I 3WWVA 3F2DA 1Q12A 1HR0W 1NMGA 4B3ML 4HIDA 1NTGA 4IFDJ 3HOUH 2KHJA 3L0OA 4DR3L 3GTLH 4GN3B 4H02A 2UXCQ 5M3MH 4A3JG 4PG3A 5IYBG 1E24A 2C35B 4A3EH 3RN2A 2IX1A 4DV5L 4DV0Q 1C7YA 4DR7L 1A62A 2OCEA 1Q82C 2I0QA 1N34Q 2I5HA 2H5XA 3EN2A 4UY8C 2R7DA 4HJ7A 1LUZA 3F2BA 2B3GA 4A3MH 1PH9A 1NMFA 4MTNA 3H15A 3CCRA 4LFCQ 3M7NA 1QUQA 2E8GA 4DV2L 3F2CA 3CCVA 1TWHH 1YEZA 4JI5Q 1WJJA 4JYAL 4WJ3M 4LNQA 2OTLA 4DV7Q 4LFAL 4JI8L 4DR4Q 3HOXH 5E7NA 5GAEC 2UUBQ 2ES2A 3CC4A 3HOZG 1VQBA 1X3FA 4NB3A 4DV3L 2JQOA 4B3RL 1VQLA 5IY0A 2CCZA 3CPWA 3A5ZB 4GOPA 4L5SA 1HZ9A 1VCIA 5JJKA 1U0LA 4X65Q 1OXXK 2FXQA 1S40A 4A3KG 4TQUS 3KJOA 2BA0A 3LGJA 2R92H 2HHHL 3U4VA 4DK3C 4NPSA 2Q2IA 4AYBE 4A3FG 1I94L 1OXVA 3TS2A 1SMXA 2MNAA 4OO1I 1HJPA 3A5UA 4IPGA 1VQNA 2OQ0A 1XMQQ 1BBWA 3CPFA 4C3JH 1GD7A 5IP9H 1J5EQ 4KHPL 3HOVG 2VQFL 3CP0A 1SRUA 2WB1G 4TVAB 5FJ8G 4WJ4A 1YI2A 4LFBQ 2R93G 3I7FA 3CF5A 4BXXG 1L1OB 3K81C 5IYCG 1PH5A 4DUZL 2JA8H 5H1SE 4IOAA 1H95A 1PYBA 1X65A 1Y1VH 2PNHA 4KI0A 1FL0A 2RHSB 5LMNQ 4JI2L 1JMCA 2ZJQA 1IL2A 2B29A 4IJLA 3KF6B 1XNRL 4DR5L 2UUCL 1YNXA 2D0OA 2R7ZH 1VQFA 4AH6A 3TS0A 3CCEA 3CCUA 2JEAI 3U58A 4QL5A 4DR1Q 2F4VL 1VQJA 4IO9A 3RNUA 4DPGA 1K83H 4UPAA 5IP7G 3PF5A 5GAGC 4DR6L 2PMZE 3UDGA 3S2HH 1QVFA 4YCUA 3PUVA 3JAMi 1IBLL 2R93H 1XPRA 4OONA 3SGIA 4XIGS 3KFUA 1JJCB 1FGUA 5C0XI 3PUZA 4HJ9A 4LWCA 1JT8A 3L2PA 3UDXA 4LF4L 4X62Q 2MFIA 2JA9A 4Y7NH 3HOWH 2OQKA 1VQDA 4JCVE 2QEXA 2AMCB 3FP9A 5LMNW 1TWFH 4OX9Q 1E3PA 2Q2TA 4GN4B 2AKWB 4GKJL 1LYLA 1GVPA 4X66Q 3Q8DA 4DV6Q 4X64Q 1VQ6A 2E5LQ 2YU9H 2HIVA 1CSPA 2UU9L 1BKBA 1UE5A 1XMOQ 1IBMQ 5C0XG 4A3IG 1HNWL 2YTYA 4OWWB 4JI0Q 1V9PA 5AJ3L 1I3QH 1XTDA 1T9HA 2WAQG 4LUOA 1K9MC 1N32Q 4YY3L 3S24A 2UUAL 2WB1E 4POGA 4JBJA 1RL2A 1UE1A 4ME3A 4OWXB 1M1KC 1QZGA 4JI4L 3OTOQ 5JJLA 1HNXQ 1CSQA 1N36Q 1VQIA 3T1YL 1Q1EA 4POFA 2R7FA 4JI3L 1L2FA 4DUYL 3CMAA 1PH8A 4NXML 2JA6G 1YHBA 3HKSA 3GTGH 3HOYH 4A93G 2HIXA 1SE8A 4K0KL 1J6QA 1EYGA 1YHQA 3KLWA 5IWAQ 2N49A 2KCMA 1VQPA 3BU2A 2OWOA 1Q86C 1L1OC 1PFSA 2XGTA 4P74A 1PH6A 4A3CH 1CKOA 2HQLA 3RLFA 5GQOA 3GTKH 4B3TQ 1OXUA 3KJPA 1AE3A 2K75A 2JA7G 4C3HH 3GD7A 5C3EH 2Q2HA 1HNZQ 4DNIA 2Q2UA 1V43A 2ASBA 5M3FH 2MO0A 3G48A 3KF8B 4L5TA 3UDIA 3CXCA 1N33L 3J7A5 3T1HQ 4QY7A 4A3LG 4JI1L 4LF9L 1Y1WG 5DLQE 1XNQQ 3GDEA 1TXYA 1XJVA 1B8AA 1W3SA 1BVSA 1MIUA 4LF6L 1WCMH 2DUDA 2RHQB 3A74A 1QZHA 1EUJA 1SROA 2F3IA 4P73A 3K7UC 4HIOA 1VQAA 4BY7G 1Q46A 4A3GH 4HJ5A 2Z0SA 1KIXA 4JI6Q 4IFDI 1KD1C 1CKNA 2MO1A 5C4JH 1M90C 3S1RH 4IJHA 4GLXA 4QQBX 4GKKL 1QVGA 4DR2L 4BY1G 4L5RC 3M3YH 1WI5A 2WAQE 1NBWA 3BZCA 4BBRG 4BBSG 1LM0A 2CWAA 4JOIA 4JI7Q 2VQEL 3M4OH 3I4MG 4C3IH 3M85A 4JC0A 2BH2A 1GO3E 1VQEA 2VL6A 4LW1A 1YJWA 2UXDQ 3NBHB 3PSIA 3AEVA 2IHFA 1BBUA 4IFDG 4A3JH 5IYBH 1VS0A 4QJFA 5ELOA 5ELNA 2EQSA 4DK6C 1VQ7A 1X56A 5LMUQ 4JI0L 4OWTB 3J80i 3GTOH 3E9IA 3K80C 1N32L 3JC66 4O2DA 4JBWA 4NXNL 3MEFA 3PUYA 2UXBQ 3CQZH 3J80c 3CMEA 3ZJYC 1HR0L 1HZBA 3HOZH 4EX5A 4GS3A 4JBMA 1SLJA 3W1BA 4YHHL 3KDFB 3J81j 1N9WA 1FJGL 4LF8L 3S14H 3H0GG 4R4OA 3I4NG 2AWNA
chains in the Genus database with same CATH superfamily
2XWBB 1PH1A 2M00A 2PZUA 2LXJA 2E2JH 4MIUA 2KUMA 1FNVA 4YCWA 1E22A 2D9UA 4KHZA 4A3FH 3LX0A 5JVG3 2K52A 1I5FA 1PFMA 3NELA 1PH3A 5M9OA 2I5MX 1VQ8A 1IW7D 4LF5Q 5ELDA 2EYFA 5FJ8H 2RSNA 2IHEA 3J81i 3GTKB 2J0TD 1PH4A 3RZDH 2YV5A 3I4NH 3PV0A 5CGKA 1EU3A 2EYHA 1QCBD 1X6OA 2R3ZA 1PA6A 1SYFA 4PZ7A 3JAME 2RBMA 3BDOA 4NDXA 1UUPA 2H4OA 4DV5Q 1S72A 4OIJA 1MSGA 1WCMB 4DF7A 2WP8J 3KOJA 2C5CA 1STAA 3A54A 4RMFA 4DV2Q 1DJRD 5KNCA 4A3GB 1SYEA 2K5HA 3OW7A 2K4KA 4IUPA 1Z7TA 1C8CA 1K0SA 4RGNA 3S15H 1SN8A 3S1MH 3NENA 2KBNA 5CBEE 2QILA 2NZ1D 2B63G 3P75A 2YYZA 1V1PB 5HURA 3RN5A 4CJ2C 4IPCA 1AFPA 3ERSX 4RG1A 2CWPA 2EYOA 2XTIA 2QKIC 4P72A 5DM73 3OMCA 3GTOB 3ER0A 1ESRA 2F0MA 3CKIB 3NP8A 4O1NA 3NXWA 3OOCA 2RF4A 5J3BA 5LMNL 3HOUG 1DOLA 1Z47A 3LWUA 3PF4A 4DUZQ 1SNPA 1ASZA 2R6GA 1TQOA 1PYWD 4HJAA 1KRTA 5C44H 1VDZA 1I6HB 1X3GA 2YTXA 5GADC 1UE6A 3Q23A 3TZDA 4DNRB 3NHHA 1R9TH 1P8LA 4DR6Q 2EIFA 3PQIA 1IKLA 2WKDA 4FXKC 4A3LH 2LSSA 1Y1WH 5HY6A 3MXGA 1KC8C 2NVYH 2E2IH 1RDPD 4FNFA 1SMYC 4YWKA 4OX9L 3J7AV 3E0JA 1K8AC 2WB1B 4L8JA 3PO2G 2MGSA 4LF4Q 2HT1A 4U673 1LTGD 2A1AA 1A3VA 1YIJA 3D4WA 2EY2A 3G6EA 1SSOA 2L9HA 4KTAA 3TREA 4MNOA 5JAVA 2QDBA 1TWCH 2UU9Q 3TRZA 1PFNA 3HP3A 2F0EA 3GTJH 4ID6A 3MXNB 5HGQA 1HNWQ 3PUWA 2F0IA 4YCVA 5EAYA 1T5XD 4YY3Q 3DXJC 2BE5C 2F0SA 4IFDH 3FKIG 2JA8G 4E6IA 5IWAL 1VQOA 5KEEA 1ONLA 1RHPA 1JE4A 4NXMQ 4JI3Q 3PCOB 1QNKA 3KBGA 3PGZA 3NK9A 3GTPH 1QNUA 2EYPA 1K73C 2R7ZG 1IHZA 1A15A 2A68C 3H3VI 1EY9A 1JR0D 2B2UA 5JPMC 4QGUA 4X6AH 1NY4A 4Z9CB 4GOPC 3I56A 3C46A 3OMGA 1VQHA 4O42A 4GNXB 4A3IB 2F0VA 2HDMA 2CKZB 1N33Q 3W5OA 4J8QA 3AFPA 1DD2A 3E9HA 2MQHA 2E74C 4N9TA 3A7AB 3RD4A 4UP8A 3ZYYX 4JK1C 4DK0A 1XYIA 2TSSA 2JA6B 3M4PA 2F0UA 2JA5H 1G8ZD 3KLSX 3ULPA 2EY1A 1S5CD 1IZ6A 2EYJA 1A3TA 1RTNA 3GO5A 2RQXA 2QCPX 1KXLA 3KDFA 2GVBA 4JI7L 1Z9FA 1PHJA 3J7YW 5IGDA 4APVA 1K3RA 4A3BB 4RHRA 3UI2A 3BVZA 1YNND 2QA4A 2N78A 3G71A 2RKSA 3DM3A 5LMUL 1RIPA 3DUZA 4A3CG 2JE6I 4N8X1 1KRSA 1JQYD 1KL9A 3G6JB 5FLXE 1IW7C 1ENCA 1YHAA 2NZOA 4PNYA 1NCVA 2PQAB 1HR0Q 3VDYA 2KECA 3F2UA 1XPOA 5FLMH 3BS1A 4HR7B 4DGZA 4BBSB 1R4QB 3M4QA 2VUMH 3UE0A 1RCVD 2A69D 1WCMG 3RLNA 1TT2A 1NUCA 4ZAIA 2UUBL 1RKNA 1EEID 4A3GG 4OXPA 1I50B 2Z6KC 4EQ5A 2CVRA 5I2YA 2Q8RE 1HTLD 4R4IA 4P75A 1IBKL 2JK8A 1VQ4A 2PI2E 3S17B 1PRTB 1HR0W 1NMGA 2FHTA 4CKCA 4HIDA 1D5MC 2G9HD 1V1PA 4GN3B 5M3MH 4PG3A 3P7JA 1E24A 2IX1A 1S5DD 2IWHA 1CI3M 1VMPA 1U4LA 3K6OA 4A3DB 4UY8C 4XXEA 1CQFA 4MTNA 1QG7A 3M7NA 3F2CA 4JYAL 5DAUA 3HOXH 5E7NA 1ICFB 4B3RL 2NVQB 3A5ZB 3NE5B 4CDCC 4IUUA 4X65Q 4U68A 3K5NA 1NR4A 1OXXK 1KLUD 1TY2A 1QWYA 2Y0SB 2NN6H 4TQUS 5IODA 2WV6D 4NPSA 1I94L 1TR5A 3NWTA 2OQ0A 1XMQQ 1TKWB 2F0TA 1GD7A 3R3OA 2VQFL 2WB1G 1ZKOA 4LFBQ 3FRPB 4QB4A 4BXXG 5H1SE 2BDOA 2EJMA 1JMCA 4IJLA 4DR5L 1KDAA 5NUCA 3MA2B 2KHSA 2JEAI 3U58A 4QL5A 4KV6A 3MXNA 4ZQ3A 5IP7G 1LT4D 5ELFA 4EQOA 3JAMi 2R93H 4JW0A 4H0LC 3SGIA 1S5BD 1SYDA 1FGUA 4MTKA 3PUZA 1JT8A 4CBVA 4OO1H 3UDXA 4NMZA 4X62Q 1LTRD 4Y7NH 1TWFH 2Q2TA 4DV6Q 2O5IC 3GTLB 2K6AA 5JEAH 5BN4A 4A3EB 1XMOQ 4A3IG 4OWWB 2IPKD 3HG9A 1F9RA 1STYA 4LUOA 4AYBB 3A7LA 2EZVA 2DY8A 1GUTA 5IT9L 4JI4L 1C48A 1QZGA 3OTOQ 5JJLA 4WRDA 1TWHB 1EQTA 1BCPC 1XWEA 2JA6G 3J81L 3GTGH 1B53A 1YHBA 3HKSA 3CU7A 2XN9C 3QIAA 1EYGA 2XWJB 1YHQA 3VR4A 3KLWA 1VQPA 2KCMA 3K5OA 1A6XA 5DM63 2XGTA 1PFSA 1PH6A 2EE1A 1CKOA 3RLFA 3OIQA 1U4PA 5GQOA 3EFXD 2AUKA 3GD7A 2R92B 2CH4A 3U9OA 1V43A 5M3FH 2MO0A 3G48A 3KF8B 5EBDA 2JXMB 3J7A5 1M4VA 1LTID 1STGA 4JI1L 1DCZA 4OHJA 1TXYA 1XJVA 1MIUA 2FMCA 4KY6A 5DNFA 3BDCA 1QZHA 1B44D 1FD7D 2EYLA 2RDFA 3MTSA 4HJ5A 4JI6Q 3VR5A 4HCEA 1M90C 3S1RH 4QQBX 3M3YH 1J8IA 1WI5A 3BZCA 4BBSG 2CWAA 5JJZA 1K83B 4XT1B 2VL6A 3NBHB 4HSVA 1GHJA 4K2KA 2L1BA 3MC0B 2A69C 2K5DA 1SNQA 3NPPA 4OWTB 3J80i 4NXNL 3MEFA 1HA6A 2UXBQ 1L0XB 3CQZH 3FVQA 4RGTA 4BS9A 1F2ZA 1HA5A 2EJFC 2M9VA 1EYCA 1N9WA 1B9MA 4R4OA 1AEXA 4A3DG 3H09A 3VR3A 1H9RA 4H44C 3TMEA 3MEHA 2F0LA 3HFZB 5CMDA 1HRJA 3E5SA 3CRLC 4FVMA 3HOYB 1RF2D 1HH2P 3ND9A 1SFOH 3CCSA 1JOQA 5IYDG 4A4IA 1JB7A 3R8BA 5ISRA 2EJGC 2E2HH 2F0NA 5IT9c 4G57A 1HUNA 2DNEA 3U50C 2I5LX 2Y0SG 2UXCL 4MN3A 5IYCH 1D5XC 4C3HB 5CYUA 2NYZD 4FF3A 3J81c 4L5QA 1BNZA 1X3EA 3CCJA 1EWIA 4BWGB 3ULJA 4DR3Q 1MJEA 1PTOB 3OYYA 3DWAA 2ALYB 3X3MA 3FDTA 4JI5L 2XIWA 3SK8A 1I4GA 1FVIA 3LWEA 2B2YC 4PMCA 4PZ6A 4IOCA 2BOSA 2Z6KA 4DNTB 2K5NA 3MVVA 4DV3Q 3N6RA 1GOZA 3R93A 1SMYD 4HJ8A 2LY7A 3SK6A 3M4OB 3E3XA 4C3IB 4B3SQ 2OT2A 1VF7A 3B6YA 1X55A 5CV6A 2ZJPA 1WTWA 1GKHA 3MHBA 5IGCA 1J5EL 1F77A 4RFBA 1XPUA 3ULLA 1G6PA 1D7QA 3HGBA 1VQ9A 2HDLA 4IZ8A 2LS01 2PMZB 4GN5A 1XTCD 1GUSA 2X69A 1YBYA 5CV9A 2B63H 1A2UA 2GVAA 1BBXC 4A3EG 1WTQA 3S9WA 5KYIA 2NTSA 2IX0A 2PO4A 4DAYA 3EA6A 1F2LA 1SNOA 2GA4B 2A68D 2UUCQ 1EY8A 4JBKA 5M5YH 1MKHA 2E2JB 5G3LD 2F4VQ 1O78A 4A3FB 1MD2D 3D3RA 4RHSA 1IL8A 3F8TA 4DAVA 1TS2A 1WOCA 1IBLQ 2AQ3B 2AWOA 3S16H 2JJQA 4NP5A 2E5LL 3RZDB 2RDHA 3QO2A 3I4NB 4LUVA 4BY7H 1KAAA 2R92G 1RJTA 3GTMH 1SNCA 1EQRA 4F7XA 1Q3LA 3KF8A 1U4MA 3S2DH 3RLOA 3DEOA 4ULLA 2EY6A 4PZ8A 5IP9G 5AJ3Q 1EQQA 1E7ZA 1HNXL 3I4MH 3J7ZC 3QR8A 2KQ3A 4ODGA 4KN7C 4B3SL 1SE3A 3PO2H 3SK5A 2DJFC 1EOVA 2WIIB 3T1YQ 2DN8A 3I90A 4LMQD 1HFGA 4B3TL 3S15B 4K0KQ 4HN7A 3S1MB 4JOIC 3L7ZC 4IUTA 4FDBA 3NBHA 2ZM6Q 3CCQA 3U4ZA 1DOMA 5EPKA 5IGGA 2L15A 2D5DA 3W2DA 1JWUD 3FKIH 1B3AA 3H0GH 4HAEA 1H9JA 2AQ2B 3HOWG 3Q0AA 1B70B 1PMRA 2ID0A 4MZ9A 1JE5A 2K50A 3RZOH 3PO3H 2F0DA 1PVOA 3A8JE 4UP7A 3S1NH 3TN2A 4R4TA 2E2DC 3I4OA 2NZHA 4IALA 4GKKQ 3DMUA 3Q22A 2UXDL 5C44B 3CW2C 1SJED 3SDZA 5I6WA 1JC7A 4YWLA 4LFAQ 1OTCA 3H3VH 1TWAH 3G4SA 3HOYG 2K5VA 1R9TB 5C4XH 5KGUA 5GAHC 1OXSC 3SHLA 1G2TA 3M7GA 1Y1WB 1PYSB 3OPOA 2E2IB 2D0PA 2NVYB 1SBBB 4K5VA 2EYMA 3BZKA 1G51A 3FPUB 1SR3A 4OEMB 1FYCA 2NWGA 3K8AA 2IT1A 4C3HG 4A3MB 2G5DA 1GUWA 2A19A 3LNNA 3Q6SA 3TDQA 5IE8A 1SE4A 1A0IA 2RA4A 2KVMA 1TWCB 4L63B 5ELCA 4YHHQ 2RSOA 1STBA 3BYTB 3GTJB 2E76C 4ZYSA 3BDLA 1FJGQ 4K14A 4KY7A 1SYGA 5K36G 4GNXC 4RA8A 2PNRC 4R4QA 3FMCA 4LF5L 2F0KA 1CZGA 2ZM6L 1EIYB 1VQ5A 3OWEB 3GTPB 5BR8Q 2RCFA 2DGYA 2XVSA 3WWVA 3T13A 1Q12A 2N88A 4C3IG 4DAPA 1CZWA 1SAPA 2KHJA 3K57A 3CHBD 5T1IA 1TY0A 5IYBG 1X3QA 4DV5L 1BCPF 4DV0Q 3ITPA 4K5XA 1A62A 3MFYA 2KA7A 1CQVA 1N34Q 4HJ7A 1LUZA 4A3MH 1GJXA 5C4ZA 3H15A 3CCRA 4F88A 4LFCQ 3K5MA 4DV2L 1YEZA 1WJJA 4WJ3M 1OO9B 4DV7Q 4LFAL 4DR4Q 4ZUIA 2JA5B 4C3JG 5FO8B 3CC4A 3HOZG 4NB3A 1XX8A 2I07B 1HZ9A 1VCIA 1IYUA 1AZPA 4KKTA 3HEJA 1DZ1A 5KNBA 4CGYB 2BA0A 4DFAA 4GZYC 2HCIA 3U4VA 4Q5VA 4A3FG 5IGEA 2EY5A 3TS2A 1HJPA 1O7ZA 4FYDA 3CPFA 1UNSA 1SRUA 2VXWA 5FJ8G 4HTHA 1YI2A 4G7ZC 1WTRA 2B2YA 4I7AA 3ERQA 1LABA 4DUZL 1BCPD 4IOAA 1H95A 1Y1VH 4XYOA 3V05A 5I6YA 1X32A 3HS0C 4HMIA 1PRTC 4AH6A 3TS0A 3CCUA 4X3TA 2F0QA 2VUMB 1FR3A 4DR1Q 1GUOA 2WINB 4N8FA 3RNUA 1X3PA 3PF5A 4DR6L 4S3SA 3J80L 3S2HH 4YCUA 3PUVA 4KMUC 2FINB 4ZKCB 1HXYD 3OSOA 2QW7A 5C0XI 4LF4L 1K8OA 2MFIA 2JA9A 3URYA 4GN4B 2AKWB 4X66Q 1GVPA 3Q8DA 1ZYRC 1WD1A 4X64Q 2YU9H 2VB2X 5M3MB 2UU9L 1BKBA 1UE5A 3HKZB 1IBMQ 5C0XG 1HNWL 1PTOD 1V9PA 4FF4A 1PZKD 1T9HA 5A2QL 1K9MC 1N32Q 4YY3L 2EDGA 2WB1E 4HEDA 4POGA 1RL2A 5C3XA 3TP7A 4RKLA 1LT6D 5LHY1 5FO9B 4XDXA 1N36Q 1STEA 4DXFA 2R7FA 4JI3L 4NXML 3HOXB 3CMAA 2M2LA 1Y8OB 3NQTA 4KN4C 1D6EC 2F4IA 2OWOA 2N49A 4IUVA 1Q86C 1D5ZC 4WFN3 5LL6S 2FFKB 1OXUA 4B08A 1STNA 3KJPA 4QIWB 4ZUJA 2WACA 5C3EH 5L37A 1HNZQ 1N33L 2ZXOA 1C4QA 2OEOA 3T1HQ 2EPBA 4QY7A 1SYCA 4A3LG 2C9OA 3FEWX 1Y1WG 1XNQQ 1DXMA 1W3SA 2B2WC 2Z6BA 3SR1A 2DUDA 2RHQB 3A74A 1EUJA 1SROA 3K7UC 4WJWA 1KDCA 1Q46A 4IFDI 3I3CA 4CJ0B 4H7BA 2MO1A 3IL8A 5C4JH 3A55A 4HSPA 3U9SA 3WDNA 4K6DA 5C4HA 1GXDC 1NBWA 1LM0A 4JOIA 4JC0A 2L5TA 1YJWA 2KCNA 4IFDG 2IHFA 1BBUA 2PYKA 4A3JH 2R93B 5EKKA 1UAPA 2SDFA 5ELOA 3WOFA 1SXTA 1SDFA 1RTOA 4Y7NB 4EQNA 1N32L 4C1NK 4ZK9B 1F9PA 1JOKA 1F9SA 1TWFB 1CT1D 1EWHA 1MBYA 3J80c 3CMEA 1HR0L 1STHA 4EX5A 1WTOA 4JBMA 1SLJA 3BYYB 4K2LA 3J81j 2R61A 3S14H 4PMBA 1SE2A 1B9NA 3VA5A 2AWNA 3CCLA 1E1TA 4JV5Q 1KQSA 3NEMA 2JYOA 5M5XH 4A3KH 1ILQA 2B8GA 3GP7A 4LF7Q 2N3SA 3GTGB 2JA5G 4V190 2VW9A 3KYHC 3NUCA 2EXDA 1CFMA 1Y8PB 3KBXA 4KK7A 1PZJD 3PIPA 1LTLA 3NTKA 3HOVH 2JP1A 1XNQL 3PIOA 1Q81C 1CA5A 4KLKA 4Y52H 5E1FA 2KEEA 5IT9E 1EYAA 2HD3A 4B3MQ 5M3FB 3MWYW 3J81E 4DU9A 2BH8A 4XQJA 1CHPD 4PV1C 2N8NA 1EFWA 2KCTA 2VY3A 3QOLA 5JOBA 4LUZA 2XSCA 4GNXA 1NE3A 2CFMA 2B2TA 3K7AH 3S1RB 4X65L 1ZXTA 3M3YB 1QJOA 5M5WH 2O4XA 5FLMG 1SJHD 1IXRA 2D62A 2VUMG 2GN5A 2F3VA 2VZAA 1G2SA 5FK9C 1C9OA 1K0RA 1LTAD 3BZDB 4XQQA 4CJ1B 2YTVA 1XMQL 2ZTEA 1V1OA 2V4DA 3OHXC 4JG2A 3AYHB 4A3BG 4LFBL 1ZEQX 3R2IA 1PLFA 3L3OC 3D31A 2Q8TA 2PQEA 3C1EA 1YJ9A 2A73B 4KHPQ 4JV5L 2Y0SE 4AIMA 2V1CC 2F52A 3CQZB 4JVZA 5CV8A 4I65A 4J6HA 4A93H 3I70A 1L0WA 4C2MH 5M3MG 4LF7L 2LFNA 2LXKA 3HKZG 1DGSA 1TU2B 3MXPA 5EJWA 1MSHA 2QGQA 4P2CB 4OIKA 1GM5A 4QMGA 1EFID 1V1QA 4KJNA 1XNRQ 1O7LA 2JA7H 1PTOC 4AQYQ 2PQAA 1LLRD 1NSNS 3HRZC 3HOXG 1KAWA 5BN3A 3OIPA 1WTPA 1SFOB 1B4OA 1NNXA 4JPBW 4X62L 2A8VA 3AMUA 1EZ8A 3CCMA 2KEDA 2E2HB 4DV6L 1U5KA 1NJIC 2O2LD 2NN6G 3IKJA 1XMOL 4QUFA 1Q90A 1A2TA 1JJ2A 4GKJQ 1HZCA 4DV4Q 2A5HA 3K59A 4R4CA 4BY1H 1Q8IA 5CV5A 1B3QA 1W2BA 2VNUD 3TQYA 4UP9A 4BBRH 3OTOL 3NBIA 1KTKA 1WTHA 2BA1A 2F0JA 1CKMA 4G7HC 3T53B 1QVCA 1LTTD 1O7IA 2UUAQ 3IRBA 2F3WA 3D8GA 3V96A 1Q8KA 1JJGA 4DUYQ 5CV7A 3TSSA 1E1OA 2WFWA 1DM0B 4DXGA 2PZTA 4IPHA 4IPDA 2A74C 5I4DA 1LT3D 4IN3A 3S1QH 2HQEA 1S3OA 3M4YA 4GLAC 3AB9A 2E75C 2WAQB 1AE2A 4PMWA 3K58A 4CKBA 4OO1G 1MJCA 1Q1BA 4LF9Q 1NR2A 3BJUA 4JI6L 4LF6Q 3DHQA 4XT3B 4AQYL 2B63B 5JEAG 5C0XJ 1EY5A 2IY5B 4YIJA 3GQBA 1HPCA 4F8MA 1PV4A 4HIMA 4DR2Q 5M5YB 5G3LF 5I2XA 3GV6A 1A63A 2VQEQ 1IYVA 2KHIA 1WD0A 5JJIA 3C1FA 5FO7B 4DV4L 4FXGC 3SE0A 3TEHB 2RCNA 4ALPA 2NB0A 3CAMA 3I8ZA 2UXBL 2B2WA 1PRTF 1LACA 3S16B 4GLVB 1YJNA 5DEHA 4BY7B 1YNJD 2PPBC 4DAMA 3NQIA 3M9BA 2NVXH 4EGVA 3VA7A 5M3FG 3GTMB 3GTQH 2DNCA 1EY7A 1SNDA 1VQKA 3S2DB 2NVTH 2LMCB 3EQLC 1A3UA 4LF8Q 3I4MB 1AN8A 3VR6A 4EVOA 4MHEA 1T5EA 1MHWC 4LK1C 1DOKA 3UDFA 3A8IE 1K8MA 1G6ZA 3PO2B 4AYBG 2JEBI 1YVCA 1F2YA 3I4LA 4KKSA 4CDDC 5HGTA 2Q8IB 2K14A 2IX3A 1QILA 3D0FA 4CHTB 5T1GA 3C3LA 2I46A 5KYLA 5J22A 2JN4A 4R8NA 4IFDJ 2Z9HA 3HOUH 4DR3L 3L0OA 1EQVA 3QWNA 4H02A 2AUJD 5K36H 5CORA 2F0HA 3RN2A 2X6LA 4NW2A 3RUZA 3FKIB 4UAIA 3H0GB 1PRTD 2EXZA 2I5HA 3EN2A 2R7DA 1ESFA 2Z4HA 1PH9A 1NMFA 1B2TA 1JWMD 2E8GA 1VF5C 4FF2A 4LNQA 3RZOB 2FJ2A 3MZ5A 4FF1A 3PO3B 3I91A 2Z8LA 1VQBA 1X3FA 3S1NB 4DV3L 5E4XA 2JQOA 4L5SA 4X3UA 3CPWA 4RGMA 5JJKA 4ME5A 2FXQA 3W3AA 1ZYRD 1TWAB 2EOTA 2PZWA 4B9XA 1SMXA 2MNAA 5C4XB 2B2VA 1QE6A 4IPGA 2OF1A 1L0YB 4ILWA 1LO5D 4C3JH 5CV4A 4QF4A 5I9OA 3CF5A 1L1OB 3K81C 5IYCG 1PH5A 2K5QA 2JA8H 1PYBA 1X65A 2PNHA 2WKCA 3K5LA 4KI0A 5LMNQ 3N52A 3KLRA 4KJOA 2ZJQA 2B29A 1IL2A 3KF6B 3ONAB 2UUCL 2D0OA 2R7ZH 1VQFA 4RWSC 1O80A 3CCEA 3D6WA 2F4VL 1HTPA 1VQJA 5C5MA 4IO9A 1ENAA 4DPGA 4N9PA 5GAGC 2PMZE 3P20A 3UDGA 3NSWA 1QVFA 3TP8A 4DA2A 1IBLL 4OONA 4XIGS 1SYBA 2K28A 4OGQC 4HJ9A 2HUGA 2QEXA 1VQDA 2IL8A 5LMNW 3FP9A 4OX9Q 4EQPA 1E3PA 4ZLTF 1BDOA 3MAQA 1CA6A 2ZT9C 1HFNA 1HHVA 1CSPA 2SEBD 2YTYA 5AJ3L 1CTMA 2WAQG 2K33A 2L0CA 1EIGA 1R4PB 1JCKB 1H9SB 1EIHA 1UE1A 4ME3A 4OWXB 2BDNA 3K0YA 4I7ZC 2A6ED 1VQIA 3T1YL 1Q1EA 4POFA 3JAML 4UDUC 1Y8NB 3VYSA 2HIXA 1SE8A 1O7YA 4K0KL 5IWAQ 3PIP3 3V2TA 2KOLA 2B2TC 4A3CH 1JWSD 3GTKH 5C0XH 3PIO3 2XNAC 4KD4A 1VMCA 3TBIB 2Q2HA 1KLGD 2LKVA 3UDIA 4L5TA 4UHVA 3T16A 4R9WA 5A35A 3GV3A 4Q0FA 3TP6A 1WCMH 4X3SA 1MI2A 2FMMA 3A56A 4QCLA 2F0PA 2F3IA 1CK1A 1KABA 4BY7G 2L55A 4A3GH 4KD3A 1Y1VB 2Z0SA 1KIXA 1KD1C 3SEBA 4GKKL 5TSSA 3X3NA 1QVGA 5D3DA 1YNJC 1WVLA 1DYQA 4JI7Q 3I4MG 5K5PA 4CDEC 3P1HA 2BH2A 1VQEA 4LW1A 1M8AA 1Y69U 1K3BC 3QOJA 1DONA 3PSIA 5D3IB 3S2HB 1VS0A 3IFDA 1X56A 5LMUQ 5F2DA 3GTOH 3D6CA 3JC66 1PZID 3KUPA 5EKLA 1FGBD 3ZJYC 2YU9B 1HZBA 1ET6A 4GS3A 3J80E 1PFBA 4H13C 3W1BA 1PTOF 5FOBB 4YHHL 4IUNA 4QUCA 3IAYA 1FJGL 3H0GG 3I4NG 3OW2A 2K1BA 2QDLA 4DN4M 1I6HH 1WFQA 1EWCA 3STBD 4KKUA 4J15A 3PO3G 5JEAJ 1WTXA 3MFGA 4OL7A 1YZ6A 5BR8L 4DV1Q 2UUBQ 1D1KA 1XXGA 3T56B 2CW0D 1S4ZA 2QEJC 1EZ6A 2CQOA 2KJXA 1IBKQ 3W1GA 1UWVA 1GUNA 2H1EA 5A2QE 3A0JA 4BXXH 2F03A 5C3EB 4DV0L 3JAMc 2ATWA 1EEFD 2K01A 1N34L 5C4XG 1D8LA 1K8GA 1EY4A 1KHIA 5BN5A 5ELEA 4LFCL 2SNMA 4RGOS 1E2WA 1SNMA 4DV7L 4DR4L 2NUCA 5IP7H 2XRQD 3QB3A 3UE1A 1L1OA 1VQGA 4JYAQ 1I4HA 3EJIA 5E3FA 4F87A 5C4JB 4A76A 3F1ZA 3KF6A 2MUYA 4B3RQ 1VQCA 3RR5A 4KY5A 4FO2A 3ICEA 5EKIA 1U9RA 1Y14B 2F0OA 4M1UB 3EIVA 4CKEA 2MP1A 4K8JA 1N8RC 3CC2A 2AHOB 1Z6HA 4A3JB 1P16A 2NBFA 4A3IH 1HZAA 2EVBA 3H6MA 4RCOA 4CDFC 5C44G 3DWQA 1I94Q 2IJ0A 3C2PA 1FNWA 1X54A 4XTCS 2L12A 3AU7A 1QUQB 4A75A 2ZTDA 1ICWA 2VQFQ 3SK4A 2JA6H 1BOSA 4YWMA 2O5JC 2J4XA 1BQQT 5C6AA 3NTHA 1Q7YC 4GOPB 3H94A 4DV1L 4DR1L 3S14B 1JICA 3VYUA 5IOCA 1WTVA 1K28A 3EROA 1PXUA 4A3MG 5FLXL 4DR5Q 3BVGA 1J9OA 4A3BH 1H9SA 5M5XB 4A3KB 1X9NA 3BVMA 1BR9A 2ZJRA 5J1ZA 1S5FD 1AH9A 2A6EC 3HOVB 3E0EA 4HMJA 3QJYA 4X66L 1D1IA 4X64L 2ZXPA 4TRDA 2K32A 3OWFA 3T51B 4G4KA 1HQMC 3J7AF 1IBML 3AQQA 4FXDA 5C3WA 2AQ1B 2CH4W 4O0AA 5C5LA 4BBSH 1N36L 2MJ8A 1PH2A 1A8VA 1SEBD 3CD6A 4C1NI 4P71A 4DK1A 4JI4Q 3DLLA 5CR3A 1Y1VG 1I50H 3K7AB 1UE7A 4ZRZA 4B9WA 4G7OC 3HKZE 1TWGB 3NWSA 5AFWA 5EBCA 2F0GA 5M5WB 4K6LA 4RKBA 3S17H 4HIKA 5GROA 1CHQD 1HNZL 1H9KA 1VQMA 5D14A 1CUKA 3T1HL 1TS4A 1D2BA 4IURA 1IKMA 3SVMA 3HZXA 3K0XA 1YITA 4V0BA 1RD9D 4RAUC 1I6VC 4A3DH 3FHWA 1EIFA 3ND8A 4HCSA 3I73A 1EY6A 1F9QA 4JI1Q 3VR2A 2B2VC 2K04A 1BO0A 4QIWE 2N55A 1S5ED 2JSOA 3EBEA 1AZQA 4A93B 1AW7A 1B7YB 4PQXA 4C2MB 1I4XA 2Z1CA 4DR7Q 3CC7A 2F0WA 2A6HD 3PMFA 2SNSA 2J7ZA 2NVQH 5IYDH 1EU4A 1KNEA 3E6ZX 4DKAC 1LT5D 1ASYA 2PI2A 4FP5D 2QF7A 1EY0A 4R1JA 2JA7B 4JI8Q 1TWGH 1IYJB 2ZTCA 5KRUA 1WYDA 4KHVA 1G291 2ZXRA 3PUXA 3STBC 1KNAA 1LTBD 1ILPA 5FLXc 3A8KE 1NAPA 2MHVA 2SOBA 2HHHQ 4DAYB 2CW0C 3KK7A 2OTJA 5C3EG 4NXNQ 1CKNB 2VS1A 1PH7A 4BY1B 2B39A 4ZCKA 2CQAA 3I2ZA 3KLSA 4OELB 4BBRB 1UEBA 1JORA 2KENA 2IW3A 1HQRD 4RH6A 3MXUA 1G91A 4JI2Q 1C0AA 5COYA 3I55A 1OXTA 2K05A 3AFQA 1ET9A 5I9PA 2Z4IA 1W6JA 4BA2I 1RODA 1E0BA 2NN6I 1HUMA 1U4RA 4BA1I 2KCCA 3F2DA 1YNNC 3QG1A 1JOOA 4B3ML 1NTGA 1EYDA 2NTTA 3GTLH 2UXCQ 3EVQA 4A3JG 3S1QB 4A3EH 2C35B 2DY7A 2BCOA 1C7YA 4DR7L 2OCEA 1Q82C 2I0QA 2H5XA 1H9MA 2PW7A 3F2BA 2B3GA 1TVXA 5EGTA 5CC4A 5KNDA 1QUQA 5E4WC 4L6TB 3CCVA 1TWHH 4JI5Q 3TZUA 1II3A 2OTLA 5FKAC 4JI8L 1ENFA 5GAEC 2ES2A 2DJGC 4J1MA 1ML0D 1VQLA 5IY0A 2CCZA 4GOPA 1U0LA 3BG3A 3O13A 1S40A 4A3KG 3KJOA 3D4DA 3LGJA 2R92H 2HHHL 4DK3C 2L4NA 2Q2IA 4AYBE 3HOWB 1OXVA 1HCZA 4OO1I 3A5UA 2RDGA 1VQNA 1JB3A 1BCPB 2K03A 1BBWA 1E2VA 1J5EQ 5IP9H 4KHPL 3HOVG 3CP0A 4TVAB 4WJ4A 4LJZC 3FPPA 2R93G 4NKLA 3I7FA 1I3QB 1I4RA 3DM1A 5D65A 1GUGA 5CBAE 3G7LA 3VYRA 2NVXB 1FL0A 2RHSB 4JI2L 3GTQB 1XNRL 1KDBA 2NVTB 1YNXA 2CHBD 5JPNC 1E2ZA 2OXPA 4WORA 1K83H 4UPAA 3TP5A 1BXTA 2X6GA 4C56C 1XPRA 2XRSD 3KFUA 2RVLA 1JJCB 4LAAA 2ENBA 4LWCA 3L2PA 1MGSA 2B2UC 3HOWH 3IFTA 2OQKA 4JCVE 2AMCB 1LV9A 2K5WA 4GKJL 1QB5D 1LYLA 3HOUB 1VQ6A 1GHKA 2E5LQ 2P5ZX 5EPLA 2HIVA 2L11A 5JVH3 4JI0Q 2D2CC 2TMPA 1I3QH 1XTDA 1FNUA 4IUQA 3H3VC 3S24A 4ZKBB 2UUAL 4JBJA 4X3KA 1M1KC 1TS3A 4TKOB 5LL6X 1HNXQ 1CSQA 1BUVT 4DUYL 1L2FA 1PH8A 4A93G 2G9DA 3HOYH 2K7VA 5EPJA 1B50A 4M8AA 1J6QA 3BU2A 4K5WA 3RMHA 1L1OC 4P74A 2HQLA 3DEPA 1LTSD 1I4QA 4IQZA 1EL0A 4B3TQ 1PDQA 1AE3A 2A6HC 1CM9A 4ABNA 2K75A 2JA7G 2F0FA 4C3HH 1V8QA 4DNIA 2Q2UA 3D4RA 2ASBA 3CXCA 5KIXA 1TS5A 2HCCA 1PTOH 1TIID 2BE5D 4LF9L 5DLQE 4C3JB 3GDEA 3HOZB 1B8AA 1BVSA 3H91A 4LF6L 5IGFA 4P73A 4HIOA 1VQAA 2JA8B 3T4AC 5EQ0A 2F1MA 3I72A 3Q24A 2B8FA 1CKNA 1EOTA 4IJHA 2PCFB 4GLXA 4DR2L 4BY1G 1I4PA 5J39A 4L5RC 2WAQE 2R7ZB 1W6KA 4BBRG 2ICEC 2VB3X 4K8IA 5IGBA 2VQEL 3M4OH 4C3IH 1B1ZA 3M85A 3DWPA 1BF4A 1GO3E 2UXDQ 3AEVA 4R8IA 3SXHA 1AP0A 5IYBH 5IIFA 1UEAB 4QJFA 5ELNA 2MPMA 2EQSA 4DK6C 1VQ7A 3WOEA 4JI0L 5ELBA 2PW5A 3E9IA 1QOHA 3K80C 3L9AX 3VYTA 4O2DA 4JBWA 3PUYA 4RCNA 4XYQA 4XQNA 3HOZH 3R2TA 4TSSA 3NTIA 3KDFB 2ICIA 3CRKC 4LF8L 1F2MA
chains in the Genus database with same CATH topology
3OW2A 1E1TA 1PH1A 4JV5Q 1KQSA 3NEMA 3HFZB 2LXJA 1I6HH 1WFQA 2E2JH 5M5XH 4A3KH 3STBD 4YCWA 1E22A 4J15A 4LF7Q 4KHZA 2N3SA 3PO3G 5JEAJ 4A3FH 2JA5G 2VW9A 3KYHC 4A3DG 1HH2P 1YZ6A 5BR8L 4DV1Q 2EXDA 2K52A 1I5FA 1SFOH 3NELA 1PH3A 2I5MX 1VQ8A 3CCSA 4LF5Q 3PIPA 5IYDG 4A4IA 1LTLA 1JB7A 3HOVH 2CQOA 5FJ8H 3J81i 2IHEA 3W1GA 3PIOA 1UWVA 1IBKQ 5IT9c 2E2HH 1Q81C 1XNQL 3A0JA 1PH4A 4KLKA 2I5LX 2Y0SG 2YV5A 3U50C 3RZDH 5IYCH 4BXXH 3I4NH 2UXCL 4Y52H 3PV0A 3J81c 4DV0L 4L5QA 3JAMc 2ATWA 1X6OA 1X3EA 3CCJA 4B3MQ 1EWIA 1PA6A 1N34L 3ULJA 4DR3Q 5C4XG 1D8LA 4PZ7A 1MJEA 1K8GA 2BH8A 1KHIA 3OYYA 4LFCL 2ALYB 1S72A 4DV5Q 4JI5L 2N8NA 4DV7L 1FVIA 1EFWA 4DR4L 2WP8J 3KOJA 2KCTA 2VY3A 5IP7H 4LUZA 4GNXA 4RMFA 4PZ6A 4DV2Q 3UE1A 1L1OA 1NE3A 1VQGA 2CFMA 4IOCA 4JYAQ 3K7AH 4A76A 2K5HA 2Z6KA 2K4KA 4X65L 3F1ZA 2K5NA 5M5WH 3S15H 3KF6A 1SN8A 4DV3Q 5FLMG 3S1MH 3NENA 4HJ8A 2D62A 1IXRA 1VQCA 2KBNA 3RR5A 4B3RQ 2VUMG 2GN5A 3ICEA 2B63G 2VZAA 2YYZA 1Y14B 4B3SQ 1C9OA 1K0RA 3EIVA 3B6YA 1X55A 3RN5A 1N8RC 3CC2A 2AHOB 2YTVA 4IPCA 1P16A 1XMQL 2ZJPA 2ZTEA 3ERSX 4RG1A 1GKHA 1J5EL 2CWPA 4A3IH 1HZAA 5C44G 2XTIA 1I94Q 4JG2A 3AYHB 3ULLA 1XPUA 4A3BG 4LFBL 1X54A 1D7QA 1G6PA 4P72A 4XTCS 3D31A 1QUQB 1VQ9A 4A75A 3ER0A 1YJ9A 4KHPQ 2ZTDA 4JV5L 2Y0SE 4AIMA 2VQFQ 2V1CC 2F52A 2RF4A 5J3BA 5LMNL 2JA6H 4GN5A 4YWMA 3CCLA 1Z47A 3HOUG 4A93H 1YBYA 1L0WA 2B63H 4C2MH 5M3MG 4LF7L 3PF4A 2GVAA 4DUZQ 2LXKA 4A3EG 1Q7YC 4GOPB 3HKZG 4DV1L 1DGSA 4DR1L 1ASZA 2R6GA 2IX0A 2QGQA 1XNRQ 4HJAA 1GM5A 4A3MG 1V1QA 1KRTA 4DR5Q 2UUCQ 4JBKA 5M5YH 1MKHA 5C44H 1X3GA 2JA7H 4A3BH 2YTXA 5GADC 2F4VQ 1X9NA 1UE6A 4AQYQ 2PQAA 3HOXG 1KAWA 1R9TH 1P8LA 2ZJRA 4DR6Q 3F8TA 2EIFA 4A3LH 4X62L 1WOCA 1IBLQ 2LSSA 1Y1WH 5HY6A 1KC8C 2E2IH 2NVYH 2A8VA 1AH9A 3CCMA 2AWOA 4YWKA 4OX9L 3E0EA 1K8AC 4X66L 4DV6L 1U5KA 1NJIC 2JJQA 3S16H 4X64L 3PO2G 4LF4Q 2E5LL 2HT1A 1YIJA 2A1AA 2NN6G 4LUVA 4BY7H 1XMOL 1IBML 3AQQA 2R92G 3G6EA 1JJ2A 1HZCA 4DV4Q 4GKJQ 3GTMH 3TREA 4MNOA 1EQRA 4R4CA 4BY1H 3S2DH 1TWCH 1W2BA 2UU9Q 3TRZA 3RLOA 3TQYA 2VNUD 4UP9A 4O0AA 4PZ8A 4BBRH 3MXNB 5HGQA 5IP9G 3OTOL 3GTJH 3PUWA 4BBSH 1HNWQ 2BA1A 4YCVA 1CKMA 5EAYA 1E7ZA 5AJ3Q 1EQQA 1N36L 1HNXL 1PH2A 1QVCA 3I4MH 4YY3Q 3J7ZC 1O7IA 2UUAQ 1A8VA 3CD6A 4P71A 4B3SL 3FKIG 4JI4Q 3DLLA 3IRBA 2JA8G 3PO2H 5IWAL 1Y1VG 1I50H 1VQOA 1EOVA 1UE7A 1Q8KA 3T1YQ 1JJGA 4DUYQ 4NXMQ 4JI3Q 3HKZE 3PCOB 3PGZA 4B3TL 3GTPH 4K0KQ 2R7ZG 1K73C 3H3VI 4JOIC 1E1OA 2WFWA 3S17H 4IPHA 4HIKA 3L7ZC 5GROA 4IPDA 4QGUA 4FDBA 1HNZL 1NY4A 4X6AH 1VQMA 4GOPC 3I56A 1CUKA 3T1HL 3S1QH 1VQHA 2ZM6Q 1S3OA 3U4ZA 3CCQA 4GLAC 4GNXB 2L15A 3K0XA 2CKZB 3FKIH 3H0GH 1YITA 1N33Q 3W5OA 1AE2A 3AFPA 4PMWA 3FHWA 4A3DH 1EIFA 4OO1G 3E9HA 2MQHA 1MJCA 1Q1BA 4JI1Q 4LF9Q 3HOWG 4UP8A 1B70B 3BJUA 2ID0A 4MZ9A 4QIWE 4JI6L 4LF6Q 1JE5A 2K50A 3RZOH 3M4PA 3PO3H 3EBEA 2JA5H 1PVOA 1B7YB 4AQYL 3ULPA 4UP7A 3S1NH 1IZ6A 5JEAG 4R4TA 5C0XJ 3CC7A 4DR7Q 2IY5B 3GO5A 3I4OA 1KXLA 2NVQH 3KDFA 5IYDH 2NZHA 2GVBA 4JI7L 1PV4A 1Z9FA 4DKAC 1PHJA 4HIMA 1ASYA 4GKKQ 4DR2Q 2PI2A 2UXDL 4APVA 1K3RA 3CW2C 4R1JA 4YWLA 4LFAQ 4JI8Q 1OTCA 1A63A 1TWGH 3H3VH 2VQEQ 2KHIA 1TWAH 2QA4A 3G4SA 2N78A 3G71A 1IYJB 3HOYG 2K5VA 2ZTCA 5C4XH 3DM3A 1WYDA 5JJIA 5GAHC 1G291 5LMUL 1OXSC 4DV4L 3TEHB 1RIPA 1PYSB 2RCNA 3PUXA 2D0PA 3STBC 4ALPA 3CAMA 3BZKA 1G51A 4A3CG 1SR3A 5FLXc 2UXBL 2JE6I 1KRSA 3K8AA 1KL9A 2HHHQ 4DAYB 4GLVB 1YJNA 2IT1A 1YHAA 2NZOA 2OTJA 4DAMA 5C3EG 3M9BA 1CKNB 2A19A 2VS1A 1PH7A 2NVXH 4NXNQ 5IE8A 5M3FG 1A0IA 3GTQH 2PQAB 1HR0Q 3VDYA 1VQKA 1XPOA 2NVTH 5FLMH 3I2ZA 4YHHQ 1UEBA 3M4QA 2KENA 3UE0A 2VUMH 1FJGQ 4LF8Q 1WCMG 5K36G 3RLNA 4GNXC 3UDFA 2UUBL 4JI2Q 4R4QA 4A3GG 4OXPA 4AYBG 2JEBI 1C0AA 4LF5L 1YVCA 2Z6KC 4EQ5A 2K14A 4R4IA 3I55A 4P75A 2ZM6L 1OXTA 3AFQA 1IBKL 1VQ5A 1EIYB 2JK8A 5BR8Q 3D0FA 4BA2I 1VQ4A 2NN6I 2DGYA 2PI2E 4BA1I 3WWVA 3F2DA 1Q12A 1HR0W 1NMGA 4B3ML 4HIDA 1NTGA 4IFDJ 3HOUH 2KHJA 3L0OA 4DR3L 3GTLH 4GN3B 4H02A 2UXCQ 5M3MH 4A3JG 4PG3A 5IYBG 1E24A 2C35B 4A3EH 3RN2A 2IX1A 4DV5L 4DV0Q 1C7YA 4DR7L 1A62A 2OCEA 1Q82C 2I0QA 1N34Q 2I5HA 2H5XA 3EN2A 4UY8C 2R7DA 4HJ7A 1LUZA 3F2BA 2B3GA 4A3MH 1PH9A 1NMFA 4MTNA 3H15A 3CCRA 4LFCQ 3M7NA 1QUQA 2E8GA 4DV2L 3F2CA 3CCVA 1TWHH 1YEZA 4JI5Q 1WJJA 4JYAL 4WJ3M 4LNQA 2OTLA 4DV7Q 4LFAL 4JI8L 4DR4Q 3HOXH 5E7NA 5GAEC 2UUBQ 2ES2A 3CC4A 3HOZG 1VQBA 1X3FA 4NB3A 4DV3L 2JQOA 4B3RL 1VQLA 5IY0A 2CCZA 3CPWA 3A5ZB 4GOPA 4L5SA 1HZ9A 1VCIA 5JJKA 1U0LA 4X65Q 1OXXK 2FXQA 1S40A 4A3KG 4TQUS 3KJOA 2BA0A 3LGJA 2R92H 2HHHL 3U4VA 4DK3C 4NPSA 2Q2IA 4AYBE 4A3FG 1I94L 1OXVA 3TS2A 1SMXA 2MNAA 4OO1I 1HJPA 3A5UA 4IPGA 1VQNA 2OQ0A 1XMQQ 1BBWA 3CPFA 4C3JH 1GD7A 5IP9H 1J5EQ 4KHPL 3HOVG 2VQFL 3CP0A 1SRUA 2WB1G 4TVAB 5FJ8G 4WJ4A 1YI2A 4LFBQ 2R93G 3I7FA 3CF5A 4BXXG 1L1OB 3K81C 5IYCG 1PH5A 4DUZL 2JA8H 5H1SE 4IOAA 1H95A 1PYBA 1X65A 1Y1VH 2PNHA 4KI0A 1FL0A 2RHSB 5LMNQ 4JI2L 1JMCA 2ZJQA 1IL2A 2B29A 4IJLA 3KF6B 1XNRL 4DR5L 2UUCL 1YNXA 2D0OA 2R7ZH 1VQFA 4AH6A 3TS0A 3CCEA 3CCUA 2JEAI 3U58A 4QL5A 4DR1Q 2F4VL 1VQJA 4IO9A 3RNUA 4DPGA 1K83H 4UPAA 5IP7G 3PF5A 5GAGC 4DR6L 2PMZE 3UDGA 3S2HH 1QVFA 4YCUA 3PUVA 3JAMi 1IBLL 2R93H 1XPRA 4OONA 3SGIA 4XIGS 3KFUA 1JJCB 1FGUA 5C0XI 3PUZA 4HJ9A 4LWCA 1JT8A 3L2PA 3UDXA 4LF4L 4X62Q 2MFIA 2JA9A 4Y7NH 3HOWH 2OQKA 1VQDA 4JCVE 2QEXA 2AMCB 3FP9A 5LMNW 1TWFH 4OX9Q 1E3PA 2Q2TA 4GN4B 2AKWB 4GKJL 1LYLA 1GVPA 4X66Q 3Q8DA 4DV6Q 4X64Q 1VQ6A 2E5LQ 2YU9H 2HIVA 1CSPA 2UU9L 1BKBA 1UE5A 1XMOQ 1IBMQ 5C0XG 4A3IG 1HNWL 2YTYA 4OWWB 4JI0Q 1V9PA 5AJ3L 1I3QH 1XTDA 1T9HA 2WAQG 4LUOA 1K9MC 1N32Q 4YY3L 3S24A 2UUAL 2WB1E 4POGA 4JBJA 1RL2A 1UE1A 4ME3A 4OWXB 1M1KC 1QZGA 4JI4L 3OTOQ 5JJLA 1HNXQ 1CSQA 1N36Q 1VQIA 3T1YL 1Q1EA 4POFA 2R7FA 4JI3L 1L2FA 4DUYL 3CMAA 1PH8A 4NXML 2JA6G 1YHBA 3HKSA 3GTGH 3HOYH 4A93G 2HIXA 1SE8A 4K0KL 1J6QA 1EYGA 1YHQA 3KLWA 5IWAQ 2N49A 2KCMA 1VQPA 3BU2A 2OWOA 1Q86C 1L1OC 1PFSA 2XGTA 4P74A 1PH6A 4A3CH 1CKOA 2HQLA 3RLFA 5GQOA 3GTKH 4B3TQ 1OXUA 3KJPA 1AE3A 2K75A 2JA7G 4C3HH 3GD7A 5C3EH 2Q2HA 1HNZQ 4DNIA 2Q2UA 1V43A 2ASBA 5M3FH 2MO0A 3G48A 3KF8B 4L5TA 3UDIA 3CXCA 1N33L 3J7A5 3T1HQ 4QY7A 4A3LG 4JI1L 4LF9L 1Y1WG 5DLQE 1XNQQ 3GDEA 1TXYA 1XJVA 1B8AA 1W3SA 1BVSA 1MIUA 4LF6L 1WCMH 2DUDA 2RHQB 3A74A 1QZHA 1EUJA 1SROA 2F3IA 4P73A 3K7UC 4HIOA 1VQAA 4BY7G 1Q46A 4A3GH 4HJ5A 2Z0SA 1KIXA 4JI6Q 4IFDI 1KD1C 1CKNA 2MO1A 5C4JH 1M90C 3S1RH 4IJHA 4GLXA 4QQBX 4GKKL 1QVGA 4DR2L 4BY1G 4L5RC 3M3YH 1WI5A 2WAQE 1NBWA 3BZCA 4BBRG 4BBSG 1LM0A 2CWAA 4JOIA 4JI7Q 2VQEL 3M4OH 3I4MG 4C3IH 3M85A 4JC0A 2BH2A 1GO3E 1VQEA 2VL6A 4LW1A 1YJWA 2UXDQ 3NBHB 3PSIA 3AEVA 2IHFA 1BBUA 4IFDG 4A3JH 5IYBH 1VS0A 4QJFA 5ELOA 5ELNA 2EQSA 4DK6C 1VQ7A 1X56A 5LMUQ 4JI0L 4OWTB 3J80i 3GTOH 3E9IA 3K80C 1N32L 3JC66 4O2DA 4JBWA 4NXNL 3MEFA 3PUYA 2UXBQ 3CQZH 3J80c 3CMEA 3ZJYC 1HR0L 1HZBA 3HOZH 4EX5A 4GS3A 4JBMA 1SLJA 3W1BA 4YHHL 3KDFB 3J81j 1N9WA 1FJGL 4LF8L 3S14H 3H0GG 4R4OA 3I4NG 2AWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 A;  1E1T A;  1PH1 A;  4JV5 Q;  1KQS A;  3NEM A;  3HFZ B;  2LXJ A;  1I6H H;  1WFQ A;  2E2J H;  5M5X H;  4A3K H;  3STB D;  4YCW A;  1E22 A;  4J15 A;  4LF7 Q;  4KHZ A;  2N3S A;  3PO3 G;  5JEA J;  4A3F H;  2JA5 G;  2VW9 A;  3KYH C;  4A3D G;  1HH2 P;  1YZ6 A;  5BR8 L;  4DV1 Q;  2EXD A;  2K52 A;  1I5F A;  1SFO H;  3NEL A;  1PH3 A;  2I5M X;  1VQ8 A;  3CCS A;  4LF5 Q;  3PIP A;  5IYD G;  4A4I A;  1LTL A;  1JB7 A;  3HOV H;  2CQO A;  5FJ8 H;  3J81 i;  2IHE A;  3W1G A;  3PIO A;  1UWV A;  1IBK Q;  5IT9 c;  2E2H H;  1Q81 C;  1XNQ L;  3A0J A;  1PH4 A;  4KLK A;  2I5L X;  2Y0S G;  2YV5 A;  3U50 C;  3RZD H;  5IYC H;  4BXX H;  3I4N H;  2UXC L;  4Y52 H;  3PV0 A;  3J81 c;  4DV0 L;  4L5Q A;  3JAM c;  2ATW A;  1X6O A;  1X3E A;  3CCJ A;  4B3M Q;  1EWI A;  1PA6 A;  1N34 L;  3ULJ A;  4DR3 Q;  5C4X G;  1D8L A;  4PZ7 A;  1MJE A;  1K8G A;  2BH8 A;  1KHI A;  3OYY A;  4LFC L;  2ALY B;  1S72 A;  4DV5 Q;  4JI5 L;  2N8N A;  4DV7 L;  1FVI A;  1EFW A;  4DR4 L;  2WP8 J;  3KOJ A;  2KCT A;  2VY3 A;  5IP7 H;  4LUZ A;  4GNX A;  4RMF A;  4PZ6 A;  4DV2 Q;  3UE1 A;  1L1O A;  1NE3 A;  1VQG A;  2CFM A;  4IOC A;  4JYA Q;  3K7A H;  4A76 A;  2K5H A;  2Z6K A;  2K4K A;  4X65 L;  3F1Z A;  2K5N A;  5M5W H;  3S15 H;  3KF6 A;  1SN8 A;  4DV3 Q;  5FLM G;  3S1M H;  3NEN A;  4HJ8 A;  2D62 A;  1IXR A;  1VQC A;  2KBN A;  3RR5 A;  4B3R Q;  2VUM G;  2GN5 A;  3ICE A;  2B63 G;  2VZA A;  2YYZ A;  1Y14 B;  4B3S Q;  1C9O A;  1K0R A;  3EIV A;  3B6Y A;  1X55 A;  3RN5 A;  1N8R C;  3CC2 A;  2AHO B;  2YTV A;  4IPC A;  1P16 A;  1XMQ L;  2ZJP A;  2ZTE A;  3ERS X;  4RG1 A;  1GKH A;  1J5E L;  2CWP A;  4A3I H;  1HZA A;  5C44 G;  2XTI A;  1I94 Q;  4JG2 A;  3AYH B;  3ULL A;  1XPU A;  4A3B G;  4LFB L;  1X54 A;  1D7Q A;  1G6P A;  4P72 A;  4XTC S;  3D31 A;  1QUQ B;  1VQ9 A;  4A75 A;  3ER0 A;  1YJ9 A;  4KHP Q;  2ZTD A;  4JV5 L;  2Y0S E;  4AIM A;  2VQF Q;  2V1C C;  2F52 A;  2RF4 A;  5J3B A;  5LMN L;  2JA6 H;  4GN5 A;  4YWM A;  3CCL A;  1Z47 A;  3HOU G;  4A93 H;  1YBY A;  1L0W A;  2B63 H;  4C2M H;  5M3M G;  4LF7 L;  3PF4 A;  2GVA A;  4DUZ Q;  2LXK A;  4A3E G;  1Q7Y C;  4GOP B;  3HKZ G;  4DV1 L;  1DGS A;  4DR1 L;  1ASZ A;  2R6G A;  2IX0 A;  2QGQ A;  1XNR Q;  4HJA A;  1GM5 A;  4A3M G;  1V1Q A;  1KRT A;  4DR5 Q;  2UUC Q;  4JBK A;  5M5Y H;  1MKH A;  5C44 H;  1X3G A;  2JA7 H;  4A3B H;  2YTX A;  5GAD C;  2F4V Q;  1X9N A;  1UE6 A;  4AQY Q;  2PQA A;  3HOX G;  1KAW A;  1R9T H;  1P8L A;  2ZJR A;  4DR6 Q;  3F8T A;  2EIF A;  4A3L H;  4X62 L;  1WOC A;  1IBL Q;  2LSS A;  1Y1W H;  5HY6 A;  1KC8 C;  2E2I H;  2NVY H;  2A8V A;  1AH9 A;  3CCM A;  2AWO A;  4YWK A;  4OX9 L;  3E0E A;  1K8A C;  4X66 L;  4DV6 L;  1U5K A;  1NJI C;  2JJQ A;  3S16 H;  4X64 L;  3PO2 G;  4LF4 Q;  2E5L L;  2HT1 A;  1YIJ A;  2A1A A;  2NN6 G;  4LUV A;  4BY7 H;  1XMO L;  1IBM L;  3AQQ A;  2R92 G;  3G6E A;  1JJ2 A;  1HZC A;  4DV4 Q;  4GKJ Q;  3GTM H;  3TRE A;  4MNO A;  1EQR A;  4R4C A;  4BY1 H;  3S2D H;  1TWC H;  1W2B A;  2UU9 Q;  3TRZ A;  3RLO A;  3TQY A;  2VNU D;  4UP9 A;  4O0A A;  4PZ8 A;  4BBR H;  3MXN B;  5HGQ A;  5IP9 G;  3OTO L;  3GTJ H;  3PUW A;  4BBS H;  1HNW Q;  2BA1 A;  4YCV A;  1CKM A;  5EAY A;  1E7Z A;  5AJ3 Q;  1EQQ A;  1N36 L;  1HNX L;  1PH2 A;  1QVC A;  3I4M H;  4YY3 Q;  3J7Z C;  1O7I A;  2UUA Q;  1A8V A;  3CD6 A;  4P71 A;  4B3S L;  3FKI G;  4JI4 Q;  3DLL A;  3IRB A;  2JA8 G;  3PO2 H;  5IWA L;  1Y1V G;  1I50 H;  1VQO A;  1EOV A;  1UE7 A;  1Q8K A;  3T1Y Q;  1JJG A;  4DUY Q;  4NXM Q;  4JI3 Q;  3HKZ E;  3PCO B;  3PGZ A;  4B3T L;  3GTP H;  4K0K Q;  2R7Z G;  1K73 C;  3H3V I;  4JOI C;  1E1O A;  2WFW A;  3S17 H;  4IPH A;  4HIK A;  3L7Z C;  5GRO A;  4IPD A;  4QGU A;  4FDB A;  1HNZ L;  1NY4 A;  4X6A H;  1VQM A;  4GOP C;  3I56 A;  1CUK A;  3T1H L;  3S1Q H;  1VQH A;  2ZM6 Q;  1S3O A;  3U4Z A;  3CCQ A;  4GLA C;  4GNX B;  2L15 A;  3K0X A;  2CKZ B;  3FKI H;  3H0G H;  1YIT A;  1N33 Q;  3W5O A;  1AE2 A;  3AFP A;  4PMW A;  3FHW A;  4A3D H;  1EIF A;  4OO1 G;  3E9H A;  2MQH A;  1MJC A;  1Q1B A;  4JI1 Q;  4LF9 Q;  3HOW G;  4UP8 A;  1B70 B;  3BJU A;  2ID0 A;  4MZ9 A;  4QIW E;  4JI6 L;  4LF6 Q;  1JE5 A;  2K50 A;  3RZO H;  3M4P A;  3PO3 H;  3EBE A;  2JA5 H;  1PVO A;  1B7Y B;  4AQY L;  3ULP A;  4UP7 A;  3S1N H;  1IZ6 A;  5JEA G;  4R4T A;  5C0X J;  3CC7 A;  4DR7 Q;  2IY5 B;  3GO5 A;  3I4O A;  1KXL A;  2NVQ H;  3KDF A;  5IYD H;  2NZH A;  2GVB A;  4JI7 L;  1PV4 A;  1Z9F A;  4DKA C;  1PHJ A;  4HIM A;  1ASY A;  4GKK Q;  4DR2 Q;  2PI2 A;  2UXD L;  4APV A;  1K3R A;  3CW2 C;  4R1J A;  4YWL A;  4LFA Q;  4JI8 Q;  1OTC A;  1A63 A;  1TWG H;  3H3V H;  2VQE Q;  2KHI A;  1TWA H;  2QA4 A;  3G4S A;  2N78 A;  3G71 A;  1IYJ B;  3HOY G;  2K5V A;  2ZTC A;  5C4X H;  3DM3 A;  1WYD A;  5JJI A;  5GAH C;  1G29 1;  5LMU L;  1OXS C;  4DV4 L;  3TEH B;  1RIP A;  1PYS B;  2RCN A;  3PUX A;  2D0P A;  3STB C;  4ALP A;  3CAM A;  3BZK A;  1G51 A;  4A3C G;  1SR3 A;  5FLX c;  2UXB L;  2JE6 I;  1KRS A;  3K8A A;  1KL9 A;  2HHH Q;  4DAY B;  4GLV B;  1YJN A;  2IT1 A;  1YHA A;  2NZO A;  2OTJ A;  4DAM A;  5C3E G;  3M9B A;  1CKN B;  2A19 A;  2VS1 A;  1PH7 A;  2NVX H;  4NXN Q;  5IE8 A;  5M3F G;  1A0I A;  3GTQ H;  2PQA B;  1HR0 Q;  3VDY A;  1VQK A;  1XPO A;  2NVT H;  5FLM H;  3I2Z A;  4YHH Q;  1UEB A;  3M4Q A;  2KEN A;  3UE0 A;  2VUM H;  1FJG Q;  4LF8 Q;  1WCM G;  5K36 G;  3RLN A;  4GNX C;  3UDF A;  2UUB L;  4JI2 Q;  4R4Q A;  4A3G G;  4OXP A;  4AYB G;  2JEB I;  1C0A A;  4LF5 L;  1YVC A;  2Z6K C;  4EQ5 A;  2K14 A;  4R4I A;  3I55 A;  4P75 A;  2ZM6 L;  1OXT A;  3AFQ A;  1IBK L;  1VQ5 A;  1EIY B;  2JK8 A;  5BR8 Q;  3D0F A;  4BA2 I;  1VQ4 A;  2NN6 I;  2DGY A;  2PI2 E;  4BA1 I;  3WWV A;  3F2D A;  1Q12 A;  1HR0 W;  1NMG A;  4B3M L;  4HID A;  1NTG A;  4IFD J;  3HOU H;  2KHJ A;  3L0O A;  4DR3 L;  3GTL H;  4GN3 B;  4H02 A;  2UXC Q;  5M3M H;  4A3J G;  4PG3 A;  5IYB G;  1E24 A;  2C35 B;  4A3E H;  3RN2 A;  2IX1 A;  4DV5 L;  4DV0 Q;  1C7Y A;  4DR7 L;  1A62 A;  2OCE A;  1Q82 C;  2I0Q A;  1N34 Q;  2I5H A;  2H5X A;  3EN2 A;  4UY8 C;  2R7D A;  4HJ7 A;  1LUZ A;  3F2B A;  2B3G A;  4A3M H;  1PH9 A;  1NMF A;  4MTN A;  3H15 A;  3CCR A;  4LFC Q;  3M7N A;  1QUQ A;  2E8G A;  4DV2 L;  3F2C A;  3CCV A;  1TWH H;  1YEZ A;  4JI5 Q;  1WJJ A;  4JYA L;  4WJ3 M;  4LNQ A;  2OTL A;  4DV7 Q;  4LFA L;  4JI8 L;  4DR4 Q;  3HOX H;  5E7N A;  5GAE C;  2UUB Q;  2ES2 A;  3CC4 A;  3HOZ G;  1VQB A;  1X3F A;  4NB3 A;  4DV3 L;  2JQO A;  4B3R L;  1VQL A;  5IY0 A;  2CCZ A;  3CPW A;  3A5Z B;  4GOP A;  4L5S A;  1HZ9 A;  1VCI A;  5JJK A;  1U0L A;  4X65 Q;  1OXX K;  2FXQ A;  1S40 A;  4A3K G;  4TQU S;  3KJO A;  2BA0 A;  3LGJ A;  2R92 H;  2HHH L;  3U4V A;  4DK3 C;  4NPS A;  2Q2I A;  4AYB E;  4A3F G;  1I94 L;  1OXV A;  3TS2 A;  1SMX A;  2MNA A;  4OO1 I;  1HJP A;  3A5U A;  4IPG A;  1VQN A;  2OQ0 A;  1XMQ Q;  1BBW A;  3CPF A;  4C3J H;  1GD7 A;  5IP9 H;  1J5E Q;  4KHP L;  3HOV G;  2VQF L;  3CP0 A;  1SRU A;  2WB1 G;  4TVA B;  5FJ8 G;  4WJ4 A;  1YI2 A;  4LFB Q;  2R93 G;  3I7F A;  3CF5 A;  4BXX G;  1L1O B;  3K81 C;  5IYC G;  1PH5 A;  4DUZ L;  2JA8 H;  5H1S E;  4IOA A;  1H95 A;  1PYB A;  1X65 A;  1Y1V H;  2PNH A;  4KI0 A;  1FL0 A;  2RHS B;  5LMN Q;  4JI2 L;  1JMC A;  2ZJQ A;  1IL2 A;  2B29 A;  4IJL A;  3KF6 B;  1XNR L;  4DR5 L;  2UUC L;  1YNX A;  2D0O A;  2R7Z H;  1VQF A;  4AH6 A;  3TS0 A;  3CCE A;  3CCU A;  2JEA I;  3U58 A;  4QL5 A;  4DR1 Q;  2F4V L;  1VQJ A;  4IO9 A;  3RNU A;  4DPG A;  1K83 H;  4UPA A;  5IP7 G;  3PF5 A;  5GAG C;  4DR6 L;  2PMZ E;  3UDG A;  3S2H H;  1QVF A;  4YCU A;  3PUV A;  3JAM i;  1IBL L;  2R93 H;  1XPR A;  4OON A;  3SGI A;  4XIG S;  3KFU A;  1JJC B;  1FGU A;  5C0X I;  3PUZ A;  4HJ9 A;  4LWC A;  1JT8 A;  3L2P A;  3UDX A;  4LF4 L;  4X62 Q;  2MFI A;  2JA9 A;  4Y7N H;  3HOW H;  2OQK A;  1VQD A;  4JCV E;  2QEX A;  2AMC B;  3FP9 A;  5LMN W;  1TWF H;  4OX9 Q;  1E3P A;  2Q2T A;  4GN4 B;  2AKW B;  4GKJ L;  1LYL A;  1GVP A;  4X66 Q;  3Q8D A;  4DV6 Q;  4X64 Q;  1VQ6 A;  2E5L Q;  2YU9 H;  2HIV A;  1CSP A;  2UU9 L;  1BKB A;  1UE5 A;  1XMO Q;  1IBM Q;  5C0X G;  4A3I G;  1HNW L;  2YTY A;  4OWW B;  4JI0 Q;  1V9P A;  5AJ3 L;  1I3Q H;  1XTD A;  1T9H A;  2WAQ G;  4LUO A;  1K9M C;  1N32 Q;  4YY3 L;  3S24 A;  2UUA L;  2WB1 E;  4POG A;  4JBJ A;  1RL2 A;  1UE1 A;  4ME3 A;  4OWX B;  1M1K C;  1QZG A;  4JI4 L;  3OTO Q;  5JJL A;  1HNX Q;  1CSQ A;  1N36 Q;  1VQI A;  3T1Y L;  1Q1E A;  4POF A;  2R7F A;  4JI3 L;  1L2F A;  4DUY L;  3CMA A;  1PH8 A;  4NXM L;  2JA6 G;  1YHB A;  3HKS A;  3GTG H;  3HOY H;  4A93 G;  2HIX A;  1SE8 A;  4K0K L;  1J6Q A;  1EYG A;  1YHQ A;  3KLW A;  5IWA Q;  2N49 A;  2KCM A;  1VQP A;  3BU2 A;  2OWO A;  1Q86 C;  1L1O C;  1PFS A;  2XGT A;  4P74 A;  1PH6 A;  4A3C H;  1CKO A;  2HQL A;  3RLF A;  5GQO A;  3GTK H;  4B3T Q;  1OXU A;  3KJP A;  1AE3 A;  2K75 A;  2JA7 G;  4C3H H;  3GD7 A;  5C3E H;  2Q2H A;  1HNZ Q;  4DNI A;  2Q2U A;  1V43 A;  2ASB A;  5M3F H;  2MO0 A;  3G48 A;  3KF8 B;  4L5T A;  3UDI A;  3CXC A;  1N33 L;  3J7A 5;  3T1H Q;  4QY7 A;  4A3L G;  4JI1 L;  4LF9 L;  1Y1W G;  5DLQ E;  1XNQ Q;  3GDE A;  1TXY A;  1XJV A;  1B8A A;  1W3S A;  1BVS A;  1MIU A;  4LF6 L;  1WCM H;  2DUD A;  2RHQ B;  3A74 A;  1QZH A;  1EUJ A;  1SRO A;  2F3I A;  4P73 A;  3K7U C;  4HIO A;  1VQA A;  4BY7 G;  1Q46 A;  4A3G H;  4HJ5 A;  2Z0S A;  1KIX A;  4JI6 Q;  4IFD I;  1KD1 C;  1CKN A;  2MO1 A;  5C4J H;  1M90 C;  3S1R H;  4IJH A;  4GLX A;  4QQB X;  4GKK L;  1QVG A;  4DR2 L;  4BY1 G;  4L5R C;  3M3Y H;  1WI5 A;  2WAQ E;  1NBW A;  3BZC A;  4BBR G;  4BBS G;  1LM0 A;  2CWA A;  4JOI A;  4JI7 Q;  2VQE L;  3M4O H;  3I4M G;  4C3I H;  3M85 A;  4JC0 A;  2BH2 A;  1GO3 E;  1VQE A;  2VL6 A;  4LW1 A;  1YJW A;  2UXD Q;  3NBH B;  3PSI A;  3AEV A;  2IHF A;  1BBU A;  4IFD G;  4A3J H;  5IYB H;  1VS0 A;  4QJF A;  5ELO A;  5ELN A;  2EQS A;  4DK6 C;  1VQ7 A;  1X56 A;  5LMU Q;  4JI0 L;  4OWT B;  3J80 i;  3GTO H;  3E9I A;  3K80 C;  1N32 L;  3JC6 6;  4O2D A;  4JBW A;  4NXN L;  3MEF A;  3PUY A;  2UXB Q;  3CQZ H;  3J80 c;  3CME A;  3ZJY C;  1HR0 L;  1HZB A;  3HOZ H;  4EX5 A;  4GS3 A;  4JBM A;  1SLJ A;  3W1B A;  4YHH L;  3KDF B;  3J81 j;  1N9W A;  1FJG L;  4LF8 L;  3S14 H;  3H0G G;  4R4O A;  3I4N G;  2AWN A; 
#chains in the Genus database with same CATH topology
 2XWB B;  1PH1 A;  2M00 A;  2PZU A;  2LXJ A;  2E2J H;  4MIU A;  2KUM A;  1FNV A;  4YCW A;  1E22 A;  2D9U A;  4KHZ A;  4A3F H;  3LX0 A;  5JVG 3;  2K52 A;  1I5F A;  1PFM A;  3NEL A;  1PH3 A;  5M9O A;  2I5M X;  1VQ8 A;  1IW7 D;  4LF5 Q;  5ELD A;  2EYF A;  5FJ8 H;  2RSN A;  2IHE A;  3J81 i;  3GTK B;  2J0T D;  1PH4 A;  3RZD H;  2YV5 A;  3I4N H;  3PV0 A;  5CGK A;  1EU3 A;  2EYH A;  1QCB D;  1X6O A;  2R3Z A;  1PA6 A;  1SYF A;  4PZ7 A;  3JAM E;  2RBM A;  3BDO A;  4NDX A;  1UUP A;  2H4O A;  4DV5 Q;  1S72 A;  4OIJ A;  1MSG A;  1WCM B;  4DF7 A;  2WP8 J;  3KOJ A;  2C5C A;  1STA A;  3A54 A;  4RMF A;  4DV2 Q;  1DJR D;  5KNC A;  4A3G B;  1SYE A;  2K5H A;  3OW7 A;  2K4K A;  4IUP A;  1Z7T A;  1C8C A;  1K0S A;  4RGN A;  3S15 H;  1SN8 A;  3S1M H;  3NEN A;  2KBN A;  5CBE E;  2QIL A;  2NZ1 D;  2B63 G;  3P75 A;  2YYZ A;  1V1P B;  5HUR A;  3RN5 A;  4CJ2 C;  4IPC A;  1AFP A;  3ERS X;  4RG1 A;  2CWP A;  2EYO A;  2XTI A;  2QKI C;  4P72 A;  5DM7 3;  3OMC A;  3GTO B;  3ER0 A;  1ESR A;  2F0M A;  3CKI B;  3NP8 A;  4O1N A;  3NXW A;  3OOC A;  2RF4 A;  5J3B A;  5LMN L;  3HOU G;  1DOL A;  1Z47 A;  3LWU A;  3PF4 A;  4DUZ Q;  1SNP A;  1ASZ A;  2R6G A;  1TQO A;  1PYW D;  4HJA A;  1KRT A;  5C44 H;  1VDZ A;  1I6H B;  1X3G A;  2YTX A;  5GAD C;  1UE6 A;  3Q23 A;  3TZD A;  4DNR B;  3NHH A;  1R9T H;  1P8L A;  4DR6 Q;  2EIF A;  3PQI A;  1IKL A;  2WKD A;  4FXK C;  4A3L H;  2LSS A;  1Y1W H;  5HY6 A;  3MXG A;  1KC8 C;  2NVY H;  2E2I H;  1RDP D;  4FNF A;  1SMY C;  4YWK A;  4OX9 L;  3J7A V;  3E0J A;  1K8A C;  2WB1 B;  4L8J A;  3PO2 G;  2MGS A;  4LF4 Q;  2HT1 A;  4U67 3;  1LTG D;  2A1A A;  1A3V A;  1YIJ A;  3D4W A;  2EY2 A;  3G6E A;  1SSO A;  2L9H A;  4KTA A;  3TRE A;  4MNO A;  5JAV A;  2QDB A;  1TWC H;  2UU9 Q;  3TRZ A;  1PFN A;  3HP3 A;  2F0E A;  3GTJ H;  4ID6 A;  3MXN B;  5HGQ A;  1HNW Q;  3PUW A;  2F0I A;  4YCV A;  5EAY A;  1T5X D;  4YY3 Q;  3DXJ C;  2BE5 C;  2F0S A;  4IFD H;  3FKI G;  2JA8 G;  4E6I A;  5IWA L;  1VQO A;  5KEE A;  1ONL A;  1RHP A;  1JE4 A;  4NXM Q;  4JI3 Q;  3PCO B;  1QNK A;  3KBG A;  3PGZ A;  3NK9 A;  3GTP H;  1QNU A;  2EYP A;  1K73 C;  2R7Z G;  1IHZ A;  1A15 A;  2A68 C;  3H3V I;  1EY9 A;  1JR0 D;  2B2U A;  5JPM C;  4QGU A;  4X6A H;  1NY4 A;  4Z9C B;  4GOP C;  3I56 A;  3C46 A;  3OMG A;  1VQH A;  4O42 A;  4GNX B;  4A3I B;  2F0V A;  2HDM A;  2CKZ B;  1N33 Q;  3W5O A;  4J8Q A;  3AFP A;  1DD2 A;  3E9H A;  2MQH A;  2E74 C;  4N9T A;  3A7A B;  3RD4 A;  4UP8 A;  3ZYY X;  4JK1 C;  4DK0 A;  1XYI A;  2TSS A;  2JA6 B;  3M4P A;  2F0U A;  2JA5 H;  1G8Z D;  3KLS X;  3ULP A;  2EY1 A;  1S5C D;  1IZ6 A;  2EYJ A;  1A3T A;  1RTN A;  3GO5 A;  2RQX A;  2QCP X;  1KXL A;  3KDF A;  2GVB A;  4JI7 L;  1Z9F A;  1PHJ A;  3J7Y W;  5IGD A;  4APV A;  1K3R A;  4A3B B;  4RHR A;  3UI2 A;  3BVZ A;  1YNN D;  2QA4 A;  2N78 A;  3G71 A;  2RKS A;  3DM3 A;  5LMU L;  1RIP A;  3DUZ A;  4A3C G;  2JE6 I;  4N8X 1;  1KRS A;  1JQY D;  1KL9 A;  3G6J B;  5FLX E;  1IW7 C;  1ENC A;  1YHA A;  2NZO A;  4PNY A;  1NCV A;  2PQA B;  1HR0 Q;  3VDY A;  2KEC A;  3F2U A;  1XPO A;  5FLM H;  3BS1 A;  4HR7 B;  4DGZ A;  4BBS B;  1R4Q B;  3M4Q A;  2VUM H;  3UE0 A;  1RCV D;  2A69 D;  1WCM G;  3RLN A;  1TT2 A;  1NUC A;  4ZAI A;  2UUB L;  1RKN A;  1EEI D;  4A3G G;  4OXP A;  1I50 B;  2Z6K C;  4EQ5 A;  2CVR A;  5I2Y A;  2Q8R E;  1HTL D;  4R4I A;  4P75 A;  1IBK L;  2JK8 A;  1VQ4 A;  2PI2 E;  3S17 B;  1PRT B;  1HR0 W;  1NMG A;  2FHT A;  4CKC A;  4HID A;  1D5M C;  2G9H D;  1V1P A;  4GN3 B;  5M3M H;  4PG3 A;  3P7J A;  1E24 A;  2IX1 A;  1S5D D;  2IWH A;  1CI3 M;  1VMP A;  1U4L A;  3K6O A;  4A3D B;  4UY8 C;  4XXE A;  1CQF A;  4MTN A;  1QG7 A;  3M7N A;  3F2C A;  4JYA L;  5DAU A;  3HOX H;  5E7N A;  1ICF B;  4B3R L;  2NVQ B;  3A5Z B;  3NE5 B;  4CDC C;  4IUU A;  4X65 Q;  4U68 A;  3K5N A;  1NR4 A;  1OXX K;  1KLU D;  1TY2 A;  1QWY A;  2Y0S B;  2NN6 H;  4TQU S;  5IOD A;  2WV6 D;  4NPS A;  1I94 L;  1TR5 A;  3NWT A;  2OQ0 A;  1XMQ Q;  1TKW B;  2F0T A;  1GD7 A;  3R3O A;  2VQF L;  2WB1 G;  1ZKO A;  4LFB Q;  3FRP B;  4QB4 A;  4BXX G;  5H1S E;  2BDO A;  2EJM A;  1JMC A;  4IJL A;  4DR5 L;  1KDA A;  5NUC A;  3MA2 B;  2KHS A;  2JEA I;  3U58 A;  4QL5 A;  4KV6 A;  3MXN A;  4ZQ3 A;  5IP7 G;  1LT4 D;  5ELF A;  4EQO A;  3JAM i;  2R93 H;  4JW0 A;  4H0L C;  3SGI A;  1S5B D;  1SYD A;  1FGU A;  4MTK A;  3PUZ A;  1JT8 A;  4CBV A;  4OO1 H;  3UDX A;  4NMZ A;  4X62 Q;  1LTR D;  4Y7N H;  1TWF H;  2Q2T A;  4DV6 Q;  2O5I C;  3GTL B;  2K6A A;  5JEA H;  5BN4 A;  4A3E B;  1XMO Q;  4A3I G;  4OWW B;  2IPK D;  3HG9 A;  1F9R A;  1STY A;  4LUO A;  4AYB B;  3A7L A;  2EZV A;  2DY8 A;  1GUT A;  5IT9 L;  4JI4 L;  1C48 A;  1QZG A;  3OTO Q;  5JJL A;  4WRD A;  1TWH B;  1EQT A;  1BCP C;  1XWE A;  2JA6 G;  3J81 L;  3GTG H;  1B53 A;  1YHB A;  3HKS A;  3CU7 A;  2XN9 C;  3QIA A;  1EYG A;  2XWJ B;  1YHQ A;  3VR4 A;  3KLW A;  1VQP A;  2KCM A;  3K5O A;  1A6X A;  5DM6 3;  2XGT A;  1PFS A;  1PH6 A;  2EE1 A;  1CKO A;  3RLF A;  3OIQ A;  1U4P A;  5GQO A;  3EFX D;  2AUK A;  3GD7 A;  2R92 B;  2CH4 A;  3U9O A;  1V43 A;  5M3F H;  2MO0 A;  3G48 A;  3KF8 B;  5EBD A;  2JXM B;  3J7A 5;  1M4V A;  1LTI D;  1STG A;  4JI1 L;  1DCZ A;  4OHJ A;  1TXY A;  1XJV A;  1MIU A;  2FMC A;  4KY6 A;  5DNF A;  3BDC A;  1QZH A;  1B44 D;  1FD7 D;  2EYL A;  2RDF A;  3MTS A;  4HJ5 A;  4JI6 Q;  3VR5 A;  4HCE A;  1M90 C;  3S1R H;  4QQB X;  3M3Y H;  1J8I A;  1WI5 A;  3BZC A;  4BBS G;  2CWA A;  5JJZ A;  1K83 B;  4XT1 B;  2VL6 A;  3NBH B;  4HSV A;  1GHJ A;  4K2K A;  2L1B A;  3MC0 B;  2A69 C;  2K5D A;  1SNQ A;  3NPP A;  4OWT B;  3J80 i;  4NXN L;  3MEF A;  1HA6 A;  2UXB Q;  1L0X B;  3CQZ H;  3FVQ A;  4RGT A;  4BS9 A;  1F2Z A;  1HA5 A;  2EJF C;  2M9V A;  1EYC A;  1N9W A;  1B9M A;  4R4O A;  1AEX A;  4A3D G;  3H09 A;  3VR3 A;  1H9R A;  4H44 C;  3TME A;  3MEH A;  2F0L A;  3HFZ B;  5CMD A;  1HRJ A;  3E5S A;  3CRL C;  4FVM A;  3HOY B;  1RF2 D;  1HH2 P;  3ND9 A;  1SFO H;  3CCS A;  1JOQ A;  5IYD G;  4A4I A;  1JB7 A;  3R8B A;  5ISR A;  2EJG C;  2E2H H;  2F0N A;  5IT9 c;  4G57 A;  1HUN A;  2DNE A;  3U50 C;  2I5L X;  2Y0S G;  2UXC L;  4MN3 A;  5IYC H;  1D5X C;  4C3H B;  5CYU A;  2NYZ D;  4FF3 A;  3J81 c;  4L5Q A;  1BNZ A;  1X3E A;  3CCJ A;  1EWI A;  4BWG B;  3ULJ A;  4DR3 Q;  1MJE A;  1PTO B;  3OYY A;  3DWA A;  2ALY B;  3X3M A;  3FDT A;  4JI5 L;  2XIW A;  3SK8 A;  1I4G A;  1FVI A;  3LWE A;  2B2Y C;  4PMC A;  4PZ6 A;  4IOC A;  2BOS A;  2Z6K A;  4DNT B;  2K5N A;  3MVV A;  4DV3 Q;  3N6R A;  1GOZ A;  3R93 A;  1SMY D;  4HJ8 A;  2LY7 A;  3SK6 A;  3M4O B;  3E3X A;  4C3I B;  4B3S Q;  2OT2 A;  1VF7 A;  3B6Y A;  1X55 A;  5CV6 A;  2ZJP A;  1WTW A;  1GKH A;  3MHB A;  5IGC A;  1J5E L;  1F77 A;  4RFB A;  1XPU A;  3ULL A;  1G6P A;  1D7Q A;  3HGB A;  1VQ9 A;  2HDL A;  4IZ8 A;  2LS0 1;  2PMZ B;  4GN5 A;  1XTC D;  1GUS A;  2X69 A;  1YBY A;  5CV9 A;  2B63 H;  1A2U A;  2GVA A;  1BBX C;  4A3E G;  1WTQ A;  3S9W A;  5KYI A;  2NTS A;  2IX0 A;  2PO4 A;  4DAY A;  3EA6 A;  1F2L A;  1SNO A;  2GA4 B;  2A68 D;  2UUC Q;  1EY8 A;  4JBK A;  5M5Y H;  1MKH A;  2E2J B;  5G3L D;  2F4V Q;  1O78 A;  4A3F B;  1MD2 D;  3D3R A;  4RHS A;  1IL8 A;  3F8T A;  4DAV A;  1TS2 A;  1WOC A;  1IBL Q;  2AQ3 B;  2AWO A;  3S16 H;  2JJQ A;  4NP5 A;  2E5L L;  3RZD B;  2RDH A;  3QO2 A;  3I4N B;  4LUV A;  4BY7 H;  1KAA A;  2R92 G;  1RJT A;  3GTM H;  1SNC A;  1EQR A;  4F7X A;  1Q3L A;  3KF8 A;  1U4M A;  3S2D H;  3RLO A;  3DEO A;  4ULL A;  2EY6 A;  4PZ8 A;  5IP9 G;  5AJ3 Q;  1EQQ A;  1E7Z A;  1HNX L;  3I4M H;  3J7Z C;  3QR8 A;  2KQ3 A;  4ODG A;  4KN7 C;  4B3S L;  1SE3 A;  3PO2 H;  3SK5 A;  2DJF C;  1EOV A;  2WII B;  3T1Y Q;  2DN8 A;  3I90 A;  4LMQ D;  1HFG A;  4B3T L;  3S15 B;  4K0K Q;  4HN7 A;  3S1M B;  4JOI C;  3L7Z C;  4IUT A;  4FDB A;  3NBH A;  2ZM6 Q;  3CCQ A;  3U4Z A;  1DOM A;  5EPK A;  5IGG A;  2L15 A;  2D5D A;  3W2D A;  1JWU D;  3FKI H;  1B3A A;  3H0G H;  4HAE A;  1H9J A;  2AQ2 B;  3HOW G;  3Q0A A;  1B70 B;  1PMR A;  2ID0 A;  4MZ9 A;  1JE5 A;  2K50 A;  3RZO H;  3PO3 H;  2F0D A;  1PVO A;  3A8J E;  4UP7 A;  3S1N H;  3TN2 A;  4R4T A;  2E2D C;  3I4O A;  2NZH A;  4IAL A;  4GKK Q;  3DMU A;  3Q22 A;  2UXD L;  5C44 B;  3CW2 C;  1SJE D;  3SDZ A;  5I6W A;  1JC7 A;  4YWL A;  4LFA Q;  1OTC A;  3H3V H;  1TWA H;  3G4S A;  3HOY G;  2K5V A;  1R9T B;  5C4X H;  5KGU A;  5GAH C;  1OXS C;  3SHL A;  1G2T A;  3M7G A;  1Y1W B;  1PYS B;  3OPO A;  2E2I B;  2D0P A;  2NVY B;  1SBB B;  4K5V A;  2EYM A;  3BZK A;  1G51 A;  3FPU B;  1SR3 A;  4OEM B;  1FYC A;  2NWG A;  3K8A A;  2IT1 A;  4C3H G;  4A3M B;  2G5D A;  1GUW A;  2A19 A;  3LNN A;  3Q6S A;  3TDQ A;  5IE8 A;  1SE4 A;  1A0I A;  2RA4 A;  2KVM A;  1TWC B;  4L63 B;  5ELC A;  4YHH Q;  2RSO A;  1STB A;  3BYT B;  3GTJ B;  2E76 C;  4ZYS A;  3BDL A;  1FJG Q;  4K14 A;  4KY7 A;  1SYG A;  5K36 G;  4GNX C;  4RA8 A;  2PNR C;  4R4Q A;  3FMC A;  4LF5 L;  2F0K A;  1CZG A;  2ZM6 L;  1EIY B;  1VQ5 A;  3OWE B;  3GTP B;  5BR8 Q;  2RCF A;  2DGY A;  2XVS A;  3WWV A;  3T13 A;  1Q12 A;  2N88 A;  4C3I G;  4DAP A;  1CZW A;  1SAP A;  2KHJ A;  3K57 A;  3CHB D;  5T1I A;  1TY0 A;  5IYB G;  1X3Q A;  4DV5 L;  1BCP F;  4DV0 Q;  3ITP A;  4K5X A;  1A62 A;  3MFY A;  2KA7 A;  1CQV A;  1N34 Q;  4HJ7 A;  1LUZ A;  4A3M H;  1GJX A;  5C4Z A;  3H15 A;  3CCR A;  4F88 A;  4LFC Q;  3K5M A;  4DV2 L;  1YEZ A;  1WJJ A;  4WJ3 M;  1OO9 B;  4DV7 Q;  4LFA L;  4DR4 Q;  4ZUI A;  2JA5 B;  4C3J G;  5FO8 B;  3CC4 A;  3HOZ G;  4NB3 A;  1XX8 A;  2I07 B;  1HZ9 A;  1VCI A;  1IYU A;  1AZP A;  4KKT A;  3HEJ A;  1DZ1 A;  5KNB A;  4CGY B;  2BA0 A;  4DFA A;  4GZY C;  2HCI A;  3U4V A;  4Q5V A;  4A3F G;  5IGE A;  2EY5 A;  3TS2 A;  1HJP A;  1O7Z A;  4FYD A;  3CPF A;  1UNS A;  1SRU A;  2VXW A;  5FJ8 G;  4HTH A;  1YI2 A;  4G7Z C;  1WTR A;  2B2Y A;  4I7A A;  3ERQ A;  1LAB A;  4DUZ L;  1BCP D;  4IOA A;  1H95 A;  1Y1V H;  4XYO A;  3V05 A;  5I6Y A;  1X32 A;  3HS0 C;  4HMI A;  1PRT C;  4AH6 A;  3TS0 A;  3CCU A;  4X3T A;  2F0Q A;  2VUM B;  1FR3 A;  4DR1 Q;  1GUO A;  2WIN B;  4N8F A;  3RNU A;  1X3P A;  3PF5 A;  4DR6 L;  4S3S A;  3J80 L;  3S2H H;  4YCU A;  3PUV A;  4KMU C;  2FIN B;  4ZKC B;  1HXY D;  3OSO A;  2QW7 A;  5C0X I;  4LF4 L;  1K8O A;  2MFI A;  2JA9 A;  3URY A;  4GN4 B;  2AKW B;  4X66 Q;  1GVP A;  3Q8D A;  1ZYR C;  1WD1 A;  4X64 Q;  2YU9 H;  2VB2 X;  5M3M B;  2UU9 L;  1BKB A;  1UE5 A;  3HKZ B;  1IBM Q;  5C0X G;  1HNW L;  1PTO D;  1V9P A;  4FF4 A;  1PZK D;  1T9H A;  5A2Q L;  1K9M C;  1N32 Q;  4YY3 L;  2EDG A;  2WB1 E;  4HED A;  4POG A;  1RL2 A;  5C3X A;  3TP7 A;  4RKL A;  1LT6 D;  5LHY 1;  5FO9 B;  4XDX A;  1N36 Q;  1STE A;  4DXF A;  2R7F A;  4JI3 L;  4NXM L;  3HOX B;  3CMA A;  2M2L A;  1Y8O B;  3NQT A;  4KN4 C;  1D6E C;  2F4I A;  2OWO A;  2N49 A;  4IUV A;  1Q86 C;  1D5Z C;  4WFN 3;  5LL6 S;  2FFK B;  1OXU A;  4B08 A;  1STN A;  3KJP A;  4QIW B;  4ZUJ A;  2WAC A;  5C3E H;  5L37 A;  1HNZ Q;  1N33 L;  2ZXO A;  1C4Q A;  2OEO A;  3T1H Q;  2EPB A;  4QY7 A;  1SYC A;  4A3L G;  2C9O A;  3FEW X;  1Y1W G;  1XNQ Q;  1DXM A;  1W3S A;  2B2W C;  2Z6B A;  3SR1 A;  2DUD A;  2RHQ B;  3A74 A;  1EUJ A;  1SRO A;  3K7U C;  4WJW A;  1KDC A;  1Q46 A;  4IFD I;  3I3C A;  4CJ0 B;  4H7B A;  2MO1 A;  3IL8 A;  5C4J H;  3A55 A;  4HSP A;  3U9S A;  3WDN A;  4K6D A;  5C4H A;  1GXD C;  1NBW A;  1LM0 A;  4JOI A;  4JC0 A;  2L5T A;  1YJW A;  2KCN A;  4IFD G;  2IHF A;  1BBU A;  2PYK A;  4A3J H;  2R93 B;  5EKK A;  1UAP A;  2SDF A;  5ELO A;  3WOF A;  1SXT A;  1SDF A;  1RTO A;  4Y7N B;  4EQN A;  1N32 L;  4C1N K;  4ZK9 B;  1F9P A;  1JOK A;  1F9S A;  1TWF B;  1CT1 D;  1EWH A;  1MBY A;  3J80 c;  3CME A;  1HR0 L;  1STH A;  4EX5 A;  1WTO A;  4JBM A;  1SLJ A;  3BYY B;  4K2L A;  3J81 j;  2R61 A;  3S14 H;  4PMB A;  1SE2 A;  1B9N A;  3VA5 A;  2AWN A;  3CCL A;  1E1T A;  4JV5 Q;  1KQS A;  3NEM A;  2JYO A;  5M5X H;  4A3K H;  1ILQ A;  2B8G A;  3GP7 A;  4LF7 Q;  2N3S A;  3GTG B;  2JA5 G;  4V19 0;  2VW9 A;  3KYH C;  3NUC A;  2EXD A;  1CFM A;  1Y8P B;  3KBX A;  4KK7 A;  1PZJ D;  3PIP A;  1LTL A;  3NTK A;  3HOV H;  2JP1 A;  1XNQ L;  3PIO A;  1Q81 C;  1CA5 A;  4KLK A;  4Y52 H;  5E1F A;  2KEE A;  5IT9 E;  1EYA A;  2HD3 A;  4B3M Q;  5M3F B;  3MWY W;  3J81 E;  4DU9 A;  2BH8 A;  4XQJ A;  1CHP D;  4PV1 C;  2N8N A;  1EFW A;  2KCT A;  2VY3 A;  3QOL A;  5JOB A;  4LUZ A;  2XSC A;  4GNX A;  1NE3 A;  2CFM A;  2B2T A;  3K7A H;  3S1R B;  4X65 L;  1ZXT A;  3M3Y B;  1QJO A;  5M5W H;  2O4X A;  5FLM G;  1SJH D;  1IXR A;  2D62 A;  2VUM G;  2GN5 A;  2F3V A;  2VZA A;  1G2S A;  5FK9 C;  1C9O A;  1K0R A;  1LTA D;  3BZD B;  4XQQ A;  4CJ1 B;  2YTV A;  1XMQ L;  2ZTE A;  1V1O A;  2V4D A;  3OHX C;  4JG2 A;  3AYH B;  4A3B G;  4LFB L;  1ZEQ X;  3R2I A;  1PLF A;  3L3O C;  3D31 A;  2Q8T A;  2PQE A;  3C1E A;  1YJ9 A;  2A73 B;  4KHP Q;  4JV5 L;  2Y0S E;  4AIM A;  2V1C C;  2F52 A;  3CQZ B;  4JVZ A;  5CV8 A;  4I65 A;  4J6H A;  4A93 H;  3I70 A;  1L0W A;  4C2M H;  5M3M G;  4LF7 L;  2LFN A;  2LXK A;  3HKZ G;  1DGS A;  1TU2 B;  3MXP A;  5EJW A;  1MSH A;  2QGQ A;  4P2C B;  4OIK A;  1GM5 A;  4QMG A;  1EFI D;  1V1Q A;  4KJN A;  1XNR Q;  1O7L A;  2JA7 H;  1PTO C;  4AQY Q;  2PQA A;  1LLR D;  1NSN S;  3HRZ C;  3HOX G;  1KAW A;  5BN3 A;  3OIP A;  1WTP A;  1SFO B;  1B4O A;  1NNX A;  4JPB W;  4X62 L;  2A8V A;  3AMU A;  1EZ8 A;  3CCM A;  2KED A;  2E2H B;  4DV6 L;  1U5K A;  1NJI C;  2O2L D;  2NN6 G;  3IKJ A;  1XMO L;  4QUF A;  1Q90 A;  1A2T A;  1JJ2 A;  4GKJ Q;  1HZC A;  4DV4 Q;  2A5H A;  3K59 A;  4R4C A;  4BY1 H;  1Q8I A;  5CV5 A;  1B3Q A;  1W2B A;  2VNU D;  3TQY A;  4UP9 A;  4BBR H;  3OTO L;  3NBI A;  1KTK A;  1WTH A;  2BA1 A;  2F0J A;  1CKM A;  4G7H C;  3T53 B;  1QVC A;  1LTT D;  1O7I A;  2UUA Q;  3IRB A;  2F3W A;  3D8G A;  3V96 A;  1Q8K A;  1JJG A;  4DUY Q;  5CV7 A;  3TSS A;  1E1O A;  2WFW A;  1DM0 B;  4DXG A;  2PZT A;  4IPH A;  4IPD A;  2A74 C;  5I4D A;  1LT3 D;  4IN3 A;  3S1Q H;  2HQE A;  1S3O A;  3M4Y A;  4GLA C;  3AB9 A;  2E75 C;  2WAQ B;  1AE2 A;  4PMW A;  3K58 A;  4CKB A;  4OO1 G;  1MJC A;  1Q1B A;  4LF9 Q;  1NR2 A;  3BJU A;  4JI6 L;  4LF6 Q;  3DHQ A;  4XT3 B;  4AQY L;  2B63 B;  5JEA G;  5C0X J;  1EY5 A;  2IY5 B;  4YIJ A;  3GQB A;  1HPC A;  4F8M A;  1PV4 A;  4HIM A;  4DR2 Q;  5M5Y B;  5G3L F;  5I2X A;  3GV6 A;  1A63 A;  2VQE Q;  1IYV A;  2KHI A;  1WD0 A;  5JJI A;  3C1F A;  5FO7 B;  4DV4 L;  4FXG C;  3SE0 A;  3TEH B;  2RCN A;  4ALP A;  2NB0 A;  3CAM A;  3I8Z A;  2UXB L;  2B2W A;  1PRT F;  1LAC A;  3S16 B;  4GLV B;  1YJN A;  5DEH A;  4BY7 B;  1YNJ D;  2PPB C;  4DAM A;  3NQI A;  3M9B A;  2NVX H;  4EGV A;  3VA7 A;  5M3F G;  3GTM B;  3GTQ H;  2DNC A;  1EY7 A;  1SND A;  1VQK A;  3S2D B;  2NVT H;  2LMC B;  3EQL C;  1A3U A;  4LF8 Q;  3I4M B;  1AN8 A;  3VR6 A;  4EVO A;  4MHE A;  1T5E A;  1MHW C;  4LK1 C;  1DOK A;  3UDF A;  3A8I E;  1K8M A;  1G6Z A;  3PO2 B;  4AYB G;  2JEB I;  1YVC A;  1F2Y A;  3I4L A;  4KKS A;  4CDD C;  5HGT A;  2Q8I B;  2K14 A;  2IX3 A;  1QIL A;  3D0F A;  4CHT B;  5T1G A;  3C3L A;  2I46 A;  5KYL A;  5J22 A;  2JN4 A;  4R8N A;  4IFD J;  2Z9H A;  3HOU H;  4DR3 L;  3L0O A;  1EQV A;  3QWN A;  4H02 A;  2AUJ D;  5K36 H;  5COR A;  2F0H A;  3RN2 A;  2X6L A;  4NW2 A;  3RUZ A;  3FKI B;  4UAI A;  3H0G B;  1PRT D;  2EXZ A;  2I5H A;  3EN2 A;  2R7D A;  1ESF A;  2Z4H A;  1PH9 A;  1NMF A;  1B2T A;  1JWM D;  2E8G A;  1VF5 C;  4FF2 A;  4LNQ A;  3RZO B;  2FJ2 A;  3MZ5 A;  4FF1 A;  3PO3 B;  3I91 A;  2Z8L A;  1VQB A;  1X3F A;  3S1N B;  4DV3 L;  5E4X A;  2JQO A;  4L5S A;  4X3U A;  3CPW A;  4RGM A;  5JJK A;  4ME5 A;  2FXQ A;  3W3A A;  1ZYR D;  1TWA B;  2EOT A;  2PZW A;  4B9X A;  1SMX A;  2MNA A;  5C4X B;  2B2V A;  1QE6 A;  4IPG A;  2OF1 A;  1L0Y B;  4ILW A;  1LO5 D;  4C3J H;  5CV4 A;  4QF4 A;  5I9O A;  3CF5 A;  1L1O B;  3K81 C;  5IYC G;  1PH5 A;  2K5Q A;  2JA8 H;  1PYB A;  1X65 A;  2PNH A;  2WKC A;  3K5L A;  4KI0 A;  5LMN Q;  3N52 A;  3KLR A;  4KJO A;  2ZJQ A;  2B29 A;  1IL2 A;  3KF6 B;  3ONA B;  2UUC L;  2D0O A;  2R7Z H;  1VQF A;  4RWS C;  1O80 A;  3CCE A;  3D6W A;  2F4V L;  1HTP A;  1VQJ A;  5C5M A;  4IO9 A;  1ENA A;  4DPG A;  4N9P A;  5GAG C;  2PMZ E;  3P20 A;  3UDG A;  3NSW A;  1QVF A;  3TP8 A;  4DA2 A;  1IBL L;  4OON A;  4XIG S;  1SYB A;  2K28 A;  4OGQ C;  4HJ9 A;  2HUG A;  2QEX A;  1VQD A;  2IL8 A;  5LMN W;  3FP9 A;  4OX9 Q;  4EQP A;  1E3P A;  4ZLT F;  1BDO A;  3MAQ A;  1CA6 A;  2ZT9 C;  1HFN A;  1HHV A;  1CSP A;  2SEB D;  2YTY A;  5AJ3 L;  1CTM A;  2WAQ G;  2K33 A;  2L0C A;  1EIG A;  1R4P B;  1JCK B;  1H9S B;  1EIH A;  1UE1 A;  4ME3 A;  4OWX B;  2BDN A;  3K0Y A;  4I7Z C;  2A6E D;  1VQI A;  3T1Y L;  1Q1E A;  4POF A;  3JAM L;  4UDU C;  1Y8N B;  3VYS A;  2HIX A;  1SE8 A;  1O7Y A;  4K0K L;  5IWA Q;  3PIP 3;  3V2T A;  2KOL A;  2B2T C;  4A3C H;  1JWS D;  3GTK H;  5C0X H;  3PIO 3;  2XNA C;  4KD4 A;  1VMC A;  3TBI B;  2Q2H A;  1KLG D;  2LKV A;  3UDI A;  4L5T A;  4UHV A;  3T16 A;  4R9W A;  5A35 A;  3GV3 A;  4Q0F A;  3TP6 A;  1WCM H;  4X3S A;  1MI2 A;  2FMM A;  3A56 A;  4QCL A;  2F0P A;  2F3I A;  1CK1 A;  1KAB A;  4BY7 G;  2L55 A;  4A3G H;  4KD3 A;  1Y1V B;  2Z0S A;  1KIX A;  1KD1 C;  3SEB A;  4GKK L;  5TSS A;  3X3N A;  1QVG A;  5D3D A;  1YNJ C;  1WVL A;  1DYQ A;  4JI7 Q;  3I4M G;  5K5P A;  4CDE C;  3P1H A;  2BH2 A;  1VQE A;  4LW1 A;  1M8A A;  1Y69 U;  1K3B C;  3QOJ A;  1DON A;  3PSI A;  5D3I B;  3S2H B;  1VS0 A;  3IFD A;  1X56 A;  5LMU Q;  5F2D A;  3GTO H;  3D6C A;  3JC6 6;  1PZI D;  3KUP A;  5EKL A;  1FGB D;  3ZJY C;  2YU9 B;  1HZB A;  1ET6 A;  4GS3 A;  3J80 E;  1PFB A;  4H13 C;  3W1B A;  1PTO F;  5FOB B;  4YHH L;  4IUN A;  4QUC A;  3IAY A;  1FJG L;  3H0G G;  3I4N G;  3OW2 A;  2K1B A;  2QDL A;  4DN4 M;  1I6H H;  1WFQ A;  1EWC A;  3STB D;  4KKU A;  4J15 A;  3PO3 G;  5JEA J;  1WTX A;  3MFG A;  4OL7 A;  1YZ6 A;  5BR8 L;  4DV1 Q;  2UUB Q;  1D1K A;  1XXG A;  3T56 B;  2CW0 D;  1S4Z A;  2QEJ C;  1EZ6 A;  2CQO A;  2KJX A;  1IBK Q;  3W1G A;  1UWV A;  1GUN A;  2H1E A;  5A2Q E;  3A0J A;  4BXX H;  2F03 A;  5C3E B;  4DV0 L;  3JAM c;  2ATW A;  1EEF D;  2K01 A;  1N34 L;  5C4X G;  1D8L A;  1K8G A;  1EY4 A;  1KHI A;  5BN5 A;  5ELE A;  4LFC L;  2SNM A;  4RGO S;  1E2W A;  1SNM A;  4DV7 L;  4DR4 L;  2NUC A;  5IP7 H;  2XRQ D;  3QB3 A;  3UE1 A;  1L1O A;  1VQG A;  4JYA Q;  1I4H A;  3EJI A;  5E3F A;  4F87 A;  5C4J B;  4A76 A;  3F1Z A;  3KF6 A;  2MUY A;  4B3R Q;  1VQC A;  3RR5 A;  4KY5 A;  4FO2 A;  3ICE A;  5EKI A;  1U9R A;  1Y14 B;  2F0O A;  4M1U B;  3EIV A;  4CKE A;  2MP1 A;  4K8J A;  1N8R C;  3CC2 A;  2AHO B;  1Z6H A;  4A3J B;  1P16 A;  2NBF A;  4A3I H;  1HZA A;  2EVB A;  3H6M A;  4RCO A;  4CDF C;  5C44 G;  3DWQ A;  1I94 Q;  2IJ0 A;  3C2P A;  1FNW A;  1X54 A;  4XTC S;  2L12 A;  3AU7 A;  1QUQ B;  4A75 A;  2ZTD A;  1ICW A;  2VQF Q;  3SK4 A;  2JA6 H;  1BOS A;  4YWM A;  2O5J C;  2J4X A;  1BQQ T;  5C6A A;  3NTH A;  1Q7Y C;  4GOP B;  3H94 A;  4DV1 L;  4DR1 L;  3S14 B;  1JIC A;  3VYU A;  5IOC A;  1WTV A;  1K28 A;  3ERO A;  1PXU A;  4A3M G;  5FLX L;  4DR5 Q;  3BVG A;  1J9O A;  4A3B H;  1H9S A;  5M5X B;  4A3K B;  1X9N A;  3BVM A;  1BR9 A;  2ZJR A;  5J1Z A;  1S5F D;  1AH9 A;  2A6E C;  3HOV B;  3E0E A;  4HMJ A;  3QJY A;  4X66 L;  1D1I A;  4X64 L;  2ZXP A;  4TRD A;  2K32 A;  3OWF A;  3T51 B;  4G4K A;  1HQM C;  3J7A F;  1IBM L;  3AQQ A;  4FXD A;  5C3W A;  2AQ1 B;  2CH4 W;  4O0A A;  5C5L A;  4BBS H;  1N36 L;  2MJ8 A;  1PH2 A;  1A8V A;  1SEB D;  3CD6 A;  4C1N I;  4P71 A;  4DK1 A;  4JI4 Q;  3DLL A;  5CR3 A;  1Y1V G;  1I50 H;  3K7A B;  1UE7 A;  4ZRZ A;  4B9W A;  4G7O C;  3HKZ E;  1TWG B;  3NWS A;  5AFW A;  5EBC A;  2F0G A;  5M5W B;  4K6L A;  4RKB A;  3S17 H;  4HIK A;  5GRO A;  1CHQ D;  1HNZ L;  1H9K A;  1VQM A;  5D14 A;  1CUK A;  3T1H L;  1TS4 A;  1D2B A;  4IUR A;  1IKM A;  3SVM A;  3HZX A;  3K0X A;  1YIT A;  4V0B A;  1RD9 D;  4RAU C;  1I6V C;  4A3D H;  3FHW A;  1EIF A;  3ND8 A;  4HCS A;  3I73 A;  1EY6 A;  1F9Q A;  4JI1 Q;  3VR2 A;  2B2V C;  2K04 A;  1BO0 A;  4QIW E;  2N55 A;  1S5E D;  2JSO A;  3EBE A;  1AZQ A;  4A93 B;  1AW7 A;  1B7Y B;  4PQX A;  4C2M B;  1I4X A;  2Z1C A;  4DR7 Q;  3CC7 A;  2F0W A;  2A6H D;  3PMF A;  2SNS A;  2J7Z A;  2NVQ H;  5IYD H;  1EU4 A;  1KNE A;  3E6Z X;  4DKA C;  1LT5 D;  1ASY A;  2PI2 A;  4FP5 D;  2QF7 A;  1EY0 A;  4R1J A;  2JA7 B;  4JI8 Q;  1TWG H;  1IYJ B;  2ZTC A;  5KRU A;  1WYD A;  4KHV A;  1G29 1;  2ZXR A;  3PUX A;  3STB C;  1KNA A;  1LTB D;  1ILP A;  5FLX c;  3A8K E;  1NAP A;  2MHV A;  2SOB A;  2HHH Q;  4DAY B;  2CW0 C;  3KK7 A;  2OTJ A;  5C3E G;  4NXN Q;  1CKN B;  2VS1 A;  1PH7 A;  4BY1 B;  2B39 A;  4ZCK A;  2CQA A;  3I2Z A;  3KLS A;  4OEL B;  4BBR B;  1UEB A;  1JOR A;  2KEN A;  2IW3 A;  1HQR D;  4RH6 A;  3MXU A;  1G91 A;  4JI2 Q;  1C0A A;  5COY A;  3I55 A;  1OXT A;  2K05 A;  3AFQ A;  1ET9 A;  5I9P A;  2Z4I A;  1W6J A;  4BA2 I;  1ROD A;  1E0B A;  2NN6 I;  1HUM A;  1U4R A;  4BA1 I;  2KCC A;  3F2D A;  1YNN C;  3QG1 A;  1JOO A;  4B3M L;  1NTG A;  1EYD A;  2NTT A;  3GTL H;  2UXC Q;  3EVQ A;  4A3J G;  3S1Q B;  4A3E H;  2C35 B;  2DY7 A;  2BCO A;  1C7Y A;  4DR7 L;  2OCE A;  1Q82 C;  2I0Q A;  2H5X A;  1H9M A;  2PW7 A;  3F2B A;  2B3G A;  1TVX A;  5EGT A;  5CC4 A;  5KND A;  1QUQ A;  5E4W C;  4L6T B;  3CCV A;  1TWH H;  4JI5 Q;  3TZU A;  1II3 A;  2OTL A;  5FKA C;  4JI8 L;  1ENF A;  5GAE C;  2ES2 A;  2DJG C;  4J1M A;  1ML0 D;  1VQL A;  5IY0 A;  2CCZ A;  4GOP A;  1U0L A;  3BG3 A;  3O13 A;  1S40 A;  4A3K G;  3KJO A;  3D4D A;  3LGJ A;  2R92 H;  2HHH L;  4DK3 C;  2L4N A;  2Q2I A;  4AYB E;  3HOW B;  1OXV A;  1HCZ A;  4OO1 I;  3A5U A;  2RDG A;  1VQN A;  1JB3 A;  1BCP B;  2K03 A;  1BBW A;  1E2V A;  1J5E Q;  5IP9 H;  4KHP L;  3HOV G;  3CP0 A;  4TVA B;  4WJ4 A;  4LJZ C;  3FPP A;  2R93 G;  4NKL A;  3I7F A;  1I3Q B;  1I4R A;  3DM1 A;  5D65 A;  1GUG A;  5CBA E;  3G7L A;  3VYR A;  2NVX B;  1FL0 A;  2RHS B;  4JI2 L;  3GTQ B;  1XNR L;  1KDB A;  2NVT B;  1YNX A;  2CHB D;  5JPN C;  1E2Z A;  2OXP A;  4WOR A;  1K83 H;  4UPA A;  3TP5 A;  1BXT A;  2X6G A;  4C56 C;  1XPR A;  2XRS D;  3KFU A;  2RVL A;  1JJC B;  4LAA A;  2ENB A;  4LWC A;  3L2P A;  1MGS A;  2B2U C;  3HOW H;  3IFT A;  2OQK A;  4JCV E;  2AMC B;  1LV9 A;  2K5W A;  4GKJ L;  1QB5 D;  1LYL A;  3HOU B;  1VQ6 A;  1GHK A;  2E5L Q;  2P5Z X;  5EPL A;  2HIV A;  2L11 A;  5JVH 3;  4JI0 Q;  2D2C C;  2TMP A;  1I3Q H;  1XTD A;  1FNU A;  4IUQ A;  3H3V C;  3S24 A;  4ZKB B;  2UUA L;  4JBJ A;  4X3K A;  1M1K C;  1TS3 A;  4TKO B;  5LL6 X;  1HNX Q;  1CSQ A;  1BUV T;  4DUY L;  1L2F A;  1PH8 A;  4A93 G;  2G9D A;  3HOY H;  2K7V A;  5EPJ A;  1B50 A;  4M8A A;  1J6Q A;  3BU2 A;  4K5W A;  3RMH A;  1L1O C;  4P74 A;  2HQL A;  3DEP A;  1LTS D;  1I4Q A;  4IQZ A;  1EL0 A;  4B3T Q;  1PDQ A;  1AE3 A;  2A6H C;  1CM9 A;  4ABN A;  2K75 A;  2JA7 G;  2F0F A;  4C3H H;  1V8Q A;  4DNI A;  2Q2U A;  3D4R A;  2ASB A;  3CXC A;  5KIX A;  1TS5 A;  2HCC A;  1PTO H;  1TII D;  2BE5 D;  4LF9 L;  5DLQ E;  4C3J B;  3GDE A;  3HOZ B;  1B8A A;  1BVS A;  3H91 A;  4LF6 L;  5IGF A;  4P73 A;  4HIO A;  1VQA A;  2JA8 B;  3T4A C;  5EQ0 A;  2F1M A;  3I72 A;  3Q24 A;  2B8F A;  1CKN A;  1EOT A;  4IJH A;  2PCF B;  4GLX A;  4DR2 L;  4BY1 G;  1I4P A;  5J39 A;  4L5R C;  2WAQ E;  2R7Z B;  1W6K A;  4BBR G;  2ICE C;  2VB3 X;  4K8I A;  5IGB A;  2VQE L;  3M4O H;  4C3I H;  1B1Z A;  3M85 A;  3DWP A;  1BF4 A;  1GO3 E;  2UXD Q;  3AEV A;  4R8I A;  3SXH A;  1AP0 A;  5IYB H;  5IIF A;  1UEA B;  4QJF A;  5ELN A;  2MPM A;  2EQS A;  4DK6 C;  1VQ7 A;  3WOE A;  4JI0 L;  5ELB A;  2PW5 A;  3E9I A;  1QOH A;  3K80 C;  3L9A X;  3VYT A;  4O2D A;  4JBW A;  3PUY A;  4RCN A;  4XYQ A;  4XQN A;  3HOZ H;  3R2T A;  4TSS A;  3NTI A;  3KDF B;  2ICI A;  3CRK C;  4LF8 L;  1F2M A; 
#chains in the Genus database with same CATH homology
 3OW2 A;  1E1T A;  1PH1 A;  4JV5 Q;  1KQS A;  3NEM A;  3HFZ B;  2LXJ A;  1I6H H;  1WFQ A;  2E2J H;  5M5X H;  4A3K H;  3STB D;  4YCW A;  1E22 A;  4J15 A;  4LF7 Q;  4KHZ A;  2N3S A;  3PO3 G;  5JEA J;  4A3F H;  2JA5 G;  2VW9 A;  3KYH C;  4A3D G;  1HH2 P;  1YZ6 A;  5BR8 L;  4DV1 Q;  2EXD A;  2K52 A;  1I5F A;  1SFO H;  3NEL A;  1PH3 A;  2I5M X;  1VQ8 A;  3CCS A;  4LF5 Q;  3PIP A;  5IYD G;  4A4I A;  1LTL A;  1JB7 A;  3HOV H;  2CQO A;  5FJ8 H;  3J81 i;  2IHE A;  3W1G A;  3PIO A;  1UWV A;  1IBK Q;  5IT9 c;  2E2H H;  1Q81 C;  1XNQ L;  3A0J A;  1PH4 A;  4KLK A;  2I5L X;  2Y0S G;  2YV5 A;  3U50 C;  3RZD H;  5IYC H;  4BXX H;  3I4N H;  2UXC L;  4Y52 H;  3PV0 A;  3J81 c;  4DV0 L;  4L5Q A;  3JAM c;  2ATW A;  1X6O A;  1X3E A;  3CCJ A;  4B3M Q;  1EWI A;  1PA6 A;  1N34 L;  3ULJ A;  4DR3 Q;  5C4X G;  1D8L A;  4PZ7 A;  1MJE A;  1K8G A;  2BH8 A;  1KHI A;  3OYY A;  4LFC L;  2ALY B;  1S72 A;  4DV5 Q;  4JI5 L;  2N8N A;  4DV7 L;  1FVI A;  1EFW A;  4DR4 L;  2WP8 J;  3KOJ A;  2KCT A;  2VY3 A;  5IP7 H;  4LUZ A;  4GNX A;  4RMF A;  4PZ6 A;  4DV2 Q;  3UE1 A;  1L1O A;  1NE3 A;  1VQG A;  2CFM A;  4IOC A;  4JYA Q;  3K7A H;  4A76 A;  2K5H A;  2Z6K A;  2K4K A;  4X65 L;  3F1Z A;  2K5N A;  5M5W H;  3S15 H;  3KF6 A;  1SN8 A;  4DV3 Q;  5FLM G;  3S1M H;  3NEN A;  4HJ8 A;  2D62 A;  1IXR A;  1VQC A;  2KBN A;  3RR5 A;  4B3R Q;  2VUM G;  2GN5 A;  3ICE A;  2B63 G;  2VZA A;  2YYZ A;  1Y14 B;  4B3S Q;  1C9O A;  1K0R A;  3EIV A;  3B6Y A;  1X55 A;  3RN5 A;  1N8R C;  3CC2 A;  2AHO B;  2YTV A;  4IPC A;  1P16 A;  1XMQ L;  2ZJP A;  2ZTE A;  3ERS X;  4RG1 A;  1GKH A;  1J5E L;  2CWP A;  4A3I H;  1HZA A;  5C44 G;  2XTI A;  1I94 Q;  4JG2 A;  3AYH B;  3ULL A;  1XPU A;  4A3B G;  4LFB L;  1X54 A;  1D7Q A;  1G6P A;  4P72 A;  4XTC S;  3D31 A;  1QUQ B;  1VQ9 A;  4A75 A;  3ER0 A;  1YJ9 A;  4KHP Q;  2ZTD A;  4JV5 L;  2Y0S E;  4AIM A;  2VQF Q;  2V1C C;  2F52 A;  2RF4 A;  5J3B A;  5LMN L;  2JA6 H;  4GN5 A;  4YWM A;  3CCL A;  1Z47 A;  3HOU G;  4A93 H;  1YBY A;  1L0W A;  2B63 H;  4C2M H;  5M3M G;  4LF7 L;  3PF4 A;  2GVA A;  4DUZ Q;  2LXK A;  4A3E G;  1Q7Y C;  4GOP B;  3HKZ G;  4DV1 L;  1DGS A;  4DR1 L;  1ASZ A;  2R6G A;  2IX0 A;  2QGQ A;  1XNR Q;  4HJA A;  1GM5 A;  4A3M G;  1V1Q A;  1KRT A;  4DR5 Q;  2UUC Q;  4JBK A;  5M5Y H;  1MKH A;  5C44 H;  1X3G A;  2JA7 H;  4A3B H;  2YTX A;  5GAD C;  2F4V Q;  1X9N A;  1UE6 A;  4AQY Q;  2PQA A;  3HOX G;  1KAW A;  1R9T H;  1P8L A;  2ZJR A;  4DR6 Q;  3F8T A;  2EIF A;  4A3L H;  4X62 L;  1WOC A;  1IBL Q;  2LSS A;  1Y1W H;  5HY6 A;  1KC8 C;  2E2I H;  2NVY H;  2A8V A;  1AH9 A;  3CCM A;  2AWO A;  4YWK A;  4OX9 L;  3E0E A;  1K8A C;  4X66 L;  4DV6 L;  1U5K A;  1NJI C;  2JJQ A;  3S16 H;  4X64 L;  3PO2 G;  4LF4 Q;  2E5L L;  2HT1 A;  1YIJ A;  2A1A A;  2NN6 G;  4LUV A;  4BY7 H;  1XMO L;  1IBM L;  3AQQ A;  2R92 G;  3G6E A;  1JJ2 A;  1HZC A;  4DV4 Q;  4GKJ Q;  3GTM H;  3TRE A;  4MNO A;  1EQR A;  4R4C A;  4BY1 H;  3S2D H;  1TWC H;  1W2B A;  2UU9 Q;  3TRZ A;  3RLO A;  3TQY A;  2VNU D;  4UP9 A;  4O0A A;  4PZ8 A;  4BBR H;  3MXN B;  5HGQ A;  5IP9 G;  3OTO L;  3GTJ H;  3PUW A;  4BBS H;  1HNW Q;  2BA1 A;  4YCV A;  1CKM A;  5EAY A;  1E7Z A;  5AJ3 Q;  1EQQ A;  1N36 L;  1HNX L;  1PH2 A;  1QVC A;  3I4M H;  4YY3 Q;  3J7Z C;  1O7I A;  2UUA Q;  1A8V A;  3CD6 A;  4P71 A;  4B3S L;  3FKI G;  4JI4 Q;  3DLL A;  3IRB A;  2JA8 G;  3PO2 H;  5IWA L;  1Y1V G;  1I50 H;  1VQO A;  1EOV A;  1UE7 A;  1Q8K A;  3T1Y Q;  1JJG A;  4DUY Q;  4NXM Q;  4JI3 Q;  3HKZ E;  3PCO B;  3PGZ A;  4B3T L;  3GTP H;  4K0K Q;  2R7Z G;  1K73 C;  3H3V I;  4JOI C;  1E1O A;  2WFW A;  3S17 H;  4IPH A;  4HIK A;  3L7Z C;  5GRO A;  4IPD A;  4QGU A;  4FDB A;  1HNZ L;  1NY4 A;  4X6A H;  1VQM A;  4GOP C;  3I56 A;  1CUK A;  3T1H L;  3S1Q H;  1VQH A;  2ZM6 Q;  1S3O A;  3U4Z A;  3CCQ A;  4GLA C;  4GNX B;  2L15 A;  3K0X A;  2CKZ B;  3FKI H;  3H0G H;  1YIT A;  1N33 Q;  3W5O A;  1AE2 A;  3AFP A;  4PMW A;  3FHW A;  4A3D H;  1EIF A;  4OO1 G;  3E9H A;  2MQH A;  1MJC A;  1Q1B A;  4JI1 Q;  4LF9 Q;  3HOW G;  4UP8 A;  1B70 B;  3BJU A;  2ID0 A;  4MZ9 A;  4QIW E;  4JI6 L;  4LF6 Q;  1JE5 A;  2K50 A;  3RZO H;  3M4P A;  3PO3 H;  3EBE A;  2JA5 H;  1PVO A;  1B7Y B;  4AQY L;  3ULP A;  4UP7 A;  3S1N H;  1IZ6 A;  5JEA G;  4R4T A;  5C0X J;  3CC7 A;  4DR7 Q;  2IY5 B;  3GO5 A;  3I4O A;  1KXL A;  2NVQ H;  3KDF A;  5IYD H;  2NZH A;  2GVB A;  4JI7 L;  1PV4 A;  1Z9F A;  4DKA C;  1PHJ A;  4HIM A;  1ASY A;  4GKK Q;  4DR2 Q;  2PI2 A;  2UXD L;  4APV A;  1K3R A;  3CW2 C;  4R1J A;  4YWL A;  4LFA Q;  4JI8 Q;  1OTC A;  1A63 A;  1TWG H;  3H3V H;  2VQE Q;  2KHI A;  1TWA H;  2QA4 A;  3G4S A;  2N78 A;  3G71 A;  1IYJ B;  3HOY G;  2K5V A;  2ZTC A;  5C4X H;  3DM3 A;  1WYD A;  5JJI A;  5GAH C;  1G29 1;  5LMU L;  1OXS C;  4DV4 L;  3TEH B;  1RIP A;  1PYS B;  2RCN A;  3PUX A;  2D0P A;  3STB C;  4ALP A;  3CAM A;  3BZK A;  1G51 A;  4A3C G;  1SR3 A;  5FLX c;  2UXB L;  2JE6 I;  1KRS A;  3K8A A;  1KL9 A;  2HHH Q;  4DAY B;  4GLV B;  1YJN A;  2IT1 A;  1YHA A;  2NZO A;  2OTJ A;  4DAM A;  5C3E G;  3M9B A;  1CKN B;  2A19 A;  2VS1 A;  1PH7 A;  2NVX H;  4NXN Q;  5IE8 A;  5M3F G;  1A0I A;  3GTQ H;  2PQA B;  1HR0 Q;  3VDY A;  1VQK A;  1XPO A;  2NVT H;  5FLM H;  3I2Z A;  4YHH Q;  1UEB A;  3M4Q A;  2KEN A;  3UE0 A;  2VUM H;  1FJG Q;  4LF8 Q;  1WCM G;  5K36 G;  3RLN A;  4GNX C;  3UDF A;  2UUB L;  4JI2 Q;  4R4Q A;  4A3G G;  4OXP A;  4AYB G;  2JEB I;  1C0A A;  4LF5 L;  1YVC A;  2Z6K C;  4EQ5 A;  2K14 A;  4R4I A;  3I55 A;  4P75 A;  2ZM6 L;  1OXT A;  3AFQ A;  1IBK L;  1VQ5 A;  1EIY B;  2JK8 A;  5BR8 Q;  3D0F A;  4BA2 I;  1VQ4 A;  2NN6 I;  2DGY A;  2PI2 E;  4BA1 I;  3WWV A;  3F2D A;  1Q12 A;  1HR0 W;  1NMG A;  4B3M L;  4HID A;  1NTG A;  4IFD J;  3HOU H;  2KHJ A;  3L0O A;  4DR3 L;  3GTL H;  4GN3 B;  4H02 A;  2UXC Q;  5M3M H;  4A3J G;  4PG3 A;  5IYB G;  1E24 A;  2C35 B;  4A3E H;  3RN2 A;  2IX1 A;  4DV5 L;  4DV0 Q;  1C7Y A;  4DR7 L;  1A62 A;  2OCE A;  1Q82 C;  2I0Q A;  1N34 Q;  2I5H A;  2H5X A;  3EN2 A;  4UY8 C;  2R7D A;  4HJ7 A;  1LUZ A;  3F2B A;  2B3G A;  4A3M H;  1PH9 A;  1NMF A;  4MTN A;  3H15 A;  3CCR A;  4LFC Q;  3M7N A;  1QUQ A;  2E8G A;  4DV2 L;  3F2C A;  3CCV A;  1TWH H;  1YEZ A;  4JI5 Q;  1WJJ A;  4JYA L;  4WJ3 M;  4LNQ A;  2OTL A;  4DV7 Q;  4LFA L;  4JI8 L;  4DR4 Q;  3HOX H;  5E7N A;  5GAE C;  2UUB Q;  2ES2 A;  3CC4 A;  3HOZ G;  1VQB A;  1X3F A;  4NB3 A;  4DV3 L;  2JQO A;  4B3R L;  1VQL A;  5IY0 A;  2CCZ A;  3CPW A;  3A5Z B;  4GOP A;  4L5S A;  1HZ9 A;  1VCI A;  5JJK A;  1U0L A;  4X65 Q;  1OXX K;  2FXQ A;  1S40 A;  4A3K G;  4TQU S;  3KJO A;  2BA0 A;  3LGJ A;  2R92 H;  2HHH L;  3U4V A;  4DK3 C;  4NPS A;  2Q2I A;  4AYB E;  4A3F G;  1I94 L;  1OXV A;  3TS2 A;  1SMX A;  2MNA A;  4OO1 I;  1HJP A;  3A5U A;  4IPG A;  1VQN A;  2OQ0 A;  1XMQ Q;  1BBW A;  3CPF A;  4C3J H;  1GD7 A;  5IP9 H;  1J5E Q;  4KHP L;  3HOV G;  2VQF L;  3CP0 A;  1SRU A;  2WB1 G;  4TVA B;  5FJ8 G;  4WJ4 A;  1YI2 A;  4LFB Q;  2R93 G;  3I7F A;  3CF5 A;  4BXX G;  1L1O B;  3K81 C;  5IYC G;  1PH5 A;  4DUZ L;  2JA8 H;  5H1S E;  4IOA A;  1H95 A;  1PYB A;  1X65 A;  1Y1V H;  2PNH A;  4KI0 A;  1FL0 A;  2RHS B;  5LMN Q;  4JI2 L;  1JMC A;  2ZJQ A;  1IL2 A;  2B29 A;  4IJL A;  3KF6 B;  1XNR L;  4DR5 L;  2UUC L;  1YNX A;  2D0O A;  2R7Z H;  1VQF A;  4AH6 A;  3TS0 A;  3CCE A;  3CCU A;  2JEA I;  3U58 A;  4QL5 A;  4DR1 Q;  2F4V L;  1VQJ A;  4IO9 A;  3RNU A;  4DPG A;  1K83 H;  4UPA A;  5IP7 G;  3PF5 A;  5GAG C;  4DR6 L;  2PMZ E;  3UDG A;  3S2H H;  1QVF A;  4YCU A;  3PUV A;  3JAM i;  1IBL L;  2R93 H;  1XPR A;  4OON A;  3SGI A;  4XIG S;  3KFU A;  1JJC B;  1FGU A;  5C0X I;  3PUZ A;  4HJ9 A;  4LWC A;  1JT8 A;  3L2P A;  3UDX A;  4LF4 L;  4X62 Q;  2MFI A;  2JA9 A;  4Y7N H;  3HOW H;  2OQK A;  1VQD A;  4JCV E;  2QEX A;  2AMC B;  3FP9 A;  5LMN W;  1TWF H;  4OX9 Q;  1E3P A;  2Q2T A;  4GN4 B;  2AKW B;  4GKJ L;  1LYL A;  1GVP A;  4X66 Q;  3Q8D A;  4DV6 Q;  4X64 Q;  1VQ6 A;  2E5L Q;  2YU9 H;  2HIV A;  1CSP A;  2UU9 L;  1BKB A;  1UE5 A;  1XMO Q;  1IBM Q;  5C0X G;  4A3I G;  1HNW L;  2YTY A;  4OWW B;  4JI0 Q;  1V9P A;  5AJ3 L;  1I3Q H;  1XTD A;  1T9H A;  2WAQ G;  4LUO A;  1K9M C;  1N32 Q;  4YY3 L;  3S24 A;  2UUA L;  2WB1 E;  4POG A;  4JBJ A;  1RL2 A;  1UE1 A;  4ME3 A;  4OWX B;  1M1K C;  1QZG A;  4JI4 L;  3OTO Q;  5JJL A;  1HNX Q;  1CSQ A;  1N36 Q;  1VQI A;  3T1Y L;  1Q1E A;  4POF A;  2R7F A;  4JI3 L;  1L2F A;  4DUY L;  3CMA A;  1PH8 A;  4NXM L;  2JA6 G;  1YHB A;  3HKS A;  3GTG H;  3HOY H;  4A93 G;  2HIX A;  1SE8 A;  4K0K L;  1J6Q A;  1EYG A;  1YHQ A;  3KLW A;  5IWA Q;  2N49 A;  2KCM A;  1VQP A;  3BU2 A;  2OWO A;  1Q86 C;  1L1O C;  1PFS A;  2XGT A;  4P74 A;  1PH6 A;  4A3C H;  1CKO A;  2HQL A;  3RLF A;  5GQO A;  3GTK H;  4B3T Q;  1OXU A;  3KJP A;  1AE3 A;  2K75 A;  2JA7 G;  4C3H H;  3GD7 A;  5C3E H;  2Q2H A;  1HNZ Q;  4DNI A;  2Q2U A;  1V43 A;  2ASB A;  5M3F H;  2MO0 A;  3G48 A;  3KF8 B;  4L5T A;  3UDI A;  3CXC A;  1N33 L;  3J7A 5;  3T1H Q;  4QY7 A;  4A3L G;  4JI1 L;  4LF9 L;  1Y1W G;  5DLQ E;  1XNQ Q;  3GDE A;  1TXY A;  1XJV A;  1B8A A;  1W3S A;  1BVS A;  1MIU A;  4LF6 L;  1WCM H;  2DUD A;  2RHQ B;  3A74 A;  1QZH A;  1EUJ A;  1SRO A;  2F3I A;  4P73 A;  3K7U C;  4HIO A;  1VQA A;  4BY7 G;  1Q46 A;  4A3G H;  4HJ5 A;  2Z0S A;  1KIX A;  4JI6 Q;  4IFD I;  1KD1 C;  1CKN A;  2MO1 A;  5C4J H;  1M90 C;  3S1R H;  4IJH A;  4GLX A;  4QQB X;  4GKK L;  1QVG A;  4DR2 L;  4BY1 G;  4L5R C;  3M3Y H;  1WI5 A;  2WAQ E;  1NBW A;  3BZC A;  4BBR G;  4BBS G;  1LM0 A;  2CWA A;  4JOI A;  4JI7 Q;  2VQE L;  3M4O H;  3I4M G;  4C3I H;  3M85 A;  4JC0 A;  2BH2 A;  1GO3 E;  1VQE A;  2VL6 A;  4LW1 A;  1YJW A;  2UXD Q;  3NBH B;  3PSI A;  3AEV A;  2IHF A;  1BBU A;  4IFD G;  4A3J H;  5IYB H;  1VS0 A;  4QJF A;  5ELO A;  5ELN A;  2EQS A;  4DK6 C;  1VQ7 A;  1X56 A;  5LMU Q;  4JI0 L;  4OWT B;  3J80 i;  3GTO H;  3E9I A;  3K80 C;  1N32 L;  3JC6 6;  4O2D A;  4JBW A;  4NXN L;  3MEF A;  3PUY A;  2UXB Q;  3CQZ H;  3J80 c;  3CME A;  3ZJY C;  1HR0 L;  1HZB A;  3HOZ H;  4EX5 A;  4GS3 A;  4JBM A;  1SLJ A;  3W1B A;  4YHH L;  3KDF B;  3J81 j;  1N9W A;  1FJG L;  4LF8 L;  3S14 H;  3H0G G;  4R4O A;  3I4N G;  2AWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...