2UU9Q

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uu9Q00
1KC8C 2RHSB 4YY3L 3HOYH 2LXKA 3I7FA 4NXNL 1K9MC 1U5KA 2JA8H 3D0FA 2WB1G 2NVXH 3CCEA 4DR3Q 3CC2A 1OXUA 2N78A 4R4CA 4POFA 3F2CA 4JI6Q 5JJIA 3B6YA 4B3MQ 3PGZA 4A3KH 4YCUA 2I0QA 4IJLA 3E9HA 2WP8J 5M3MH 1QUQA 1A62A 4BBRH 2ZJPA 1YNXA 1NTGA 4A3MH 2NVTH 2E5LQ 2JA9A 1G51A 1X3FA 3PUYA 1PYBA 3JC66 2ALYB 4MNOA 2GN5A 1KD1C 4A3FH 5EAYA 2UXBQ 4QJFA 1VQ6A 1KL9A 4DR1L 4DR6L 1OXVA 1AE2A 3KLWA 4UY8C 3CCMA 3CC7A 3AFPA 2N49A 3D31A 4PZ8A 4WJ4A 2K5VA 4QL5A 2E2IH 3FHWA 5GQOA 2A8VA 1X3EA 2A19A 5M5XH 2UUBL 4LF7L 4UP8A 1EOVA 1G291 2CFMA 3GO5A 1CKOA 1Q1BA 2N8NA 1Q86C 5BR8Q 2ID0A 4GLXA 4A3LH 1BBUA 3HOWH 1VQ8A 4JG2A 4A3GH 1UWVA 3STBC 4JI8Q 3UE0A 4DR4L 4HJ8A 1CSPA 1Q1EA 4DNIA 4DV0Q 1VS0A 3J81j 1YHQA 3J80i 4JI0L 3CD6A 2UXDL 3GTQH 1Q81C 1B8AA 2PI2E 1Q8KA 1WCMG 1OXSC 2VY3A 1CUKA 3F1ZA 2I5HA 1XTDA 3NEMA 2VQEQ 4HIKA 1K73C 2Q2TA 1AE3A 4IJHA 4A76A 1J6QA 1UEBA 2KENA 2CWAA 1S40A 4AH6A 1S72A 3J81i 5M5WH 2D0OA 4P71A 1XMQL 1I94L 4LNQA 3HOVH 5AJ3L 3ER0A 4DKAC 1OXXK 4LWCA 1CKNA 3G71A 1QVGA 2UUCQ 2R7ZG 2MO0A 4NXML 3BZCA 3E9IA 1TWAH 4DR7Q 3VDYA 2VNUD 3HKZE 1ASZA 4B3SL 5M3FG 4PG3A 4YY3Q 1HNXL 3I55A 4NXNQ 3NELA 4JI7L 2QGQA 1XNRL 3AEVA 4UP7A 1Y1VG 4TQUS 1LTLA 3WWVA 1MIUA 4AYBE 4YHHL 3RNUA 4DUYQ 4O2DA 1EIFA 1EUJA 1UE1A 5C0XG 3CC4A 2CCZA 2ATWA 2KHIA 1V43A 4P72A 5JJLA 3L7ZC 3H15A 4DV6L 2UUAL 2R7DA 4BY7G 4GKJL 4KHPL 3U50C 4B3TL 1VQIA 1X55A 3PUVA 3PF4A 4DV5L 5IT9c 3I4MH 2VQFQ 2R7FA 4GN4B 3CMEA 5IWAL 5C4XH 3K7AH 2I5LX 1QZHA 1RL2A 2K5NA 1L2FA 3UDXA 5IYCG 4DV1L 1E7ZA 2Y0SG 3RR5A 3CCJA 4GN3B 1UE6A 1IBKL 4POGA 1E24A 4A3JH 5K36G 2BH8A 4EX5A 3I4NG 2WFWA 2JA7H 3HOUH 1B70B 2LSSA 3A0JA 4RG1A 5IE8A 3TS0A 4LF8L 3I2ZA 4LF7Q 3G4SA 3PUXA 4R1JA 3H3VH 1VQNA 3HOZH 1V9PA 2F3IA 5M3MG 2PMZE 4OX9L 3TS2A 1KAWA 1VQDA 4BBRG 4BBSH 3PO2H 1N8RC 3CMAA 4R4IA 2K4KA 4Y7NH 3CCUA 4DK3C 1XNQL 3HKZG 5FJ8H 4DR4Q 4A3FG 1JJ2A 4JI2L 1OXTA 1N9WA 4NPSA 4JI0Q 5FLMH 1FJGL 4OONA 5HGQA 1E3PA 3RLFA 5C3EH 2HQLA 5GADC 2JA5H 1C0AA 4AYBG 4JC0A 3UDGA 5ELOA 2PNHA 1L0WA 3S1NH 2VUMG 3PCOB 4BY1H 1N33L 4A3IH 2A1AA 2BA0A 4HIDA 1XPOA 4A93H 2ZJRA 2GVAA 1YJWA 4EQ5A 2CKZB 4X6AH 3T1HL 1XMQQ 2UU9L 1DGSA 5AJ3Q 3K8AA 1QVFA 2XTIA 1G6PA 3ZJYC 2JJQA 4TVAB 3KYHC 4PMWA 1X65A 4DAYB 4MTNA 4NXMQ 4R4OA 3DM3A 4BXXH 2D0PA 1KQSA 1TWHH 2PQAA 2AHOB 1HNXQ 1XNRQ 1VQFA 4JI7Q 1QUQB 3CCVA 4BA2I 5IY0A 4A3EG 2Z6KA 1PFSA 4MZ9A 1VQBA 1K83H 2R92H 1Q7YC 1YI2A 1GKHA 3W1GA 5GAGC 2R93G 3TREA 1X9NA 3K7UC 1PH4A 4A3BG 3J80c 4GKJQ 3GTGH 4IOCA 2DGYA 1H95A 2EQSA 4GNXA 1LM0A 4DV5Q 1N36L 3PF5A 1SRUA 1BVSA 2IX1A 1O7IA 5IWAQ 1LYLA 4DR5L 3KJPA 2ZTDA 1SROA 3KF6A 5IP9G 2B63H 2BH2A 1IXRA 3U58A 4JI3Q 4OWTB 5C0XJ 1WYDA 2C35B 1Q82C 1IBKQ 4IPCA 5IP7G 1KRSA 4QQBX 1J5EQ 4A3CH 1JE5A 1HNWL 1X56A 2B29A 3FKIH 1EWIA 3K80C 4IPDA 1EYGA 4OX9Q 5LMUQ 3ICEA 4QGUA 3H3VI 4JYAL 1IZ6A 1VQ4A 2UXCL 2JK8A 4IPGA 1N34L 3G6EA 3JAMi 1VCIA 1OTCA 1TWCH 1PH7A 4JI2Q 4P75A 1FJGQ 2I5MX 1X6OA 1PH8A 4LF9Q 4GKKL 1AH9A 4XTCS 1VQAA 3HOXG 3CW2C 1BKBA 4DV3Q 3GDEA 1CKNB 4PZ7A 5GAHC 2NN6I 4C2MH 1GVPA 2MO1A 3HKSA 1GM5A 2Y0SE 4AQYQ 3T1HQ 3EIVA 2AWOA 4R4TA 2UU9Q 4A3DG 1CKMA 5C44G 1I3QH 5IYDH 1HR0L 4YWKA 3KFUA 4PZ6A 3K81C 3H0GH 4IO9A 2OWOA 4JBJA 1SLJA 3ULJA 1T9HA 4JI1L 4JI5L 3AQQA 1M1KC 4LUVA 2AKWB 5IYBH 4LFCQ 1XMOQ 1I50H 2N3SA 3RLOA 2NN6G 4GN5A 4IFDJ 1Y1WH 4DAMA 3T1YL 1YITA 1FVIA 4BY1G 3PIPA 2F52A 1N32L 2JEAI 4JV5L 5FLXc 1W3SA 1VQ7A 5E7NA 2Z0SA 1Z9FA 2YTYA 3OTOL 3CCSA 1A0IA 1YEZA 3K0XA 3CPFA 2E2HH 2NVQH 1NBWA 2NZOA 3NENA 1N36Q 1ASYA 3SGIA 5DLQE 4DR5Q 3GD7A 1R9TH 1PH6A 2K14A 3I4OA 1SE8A 4L5TA 4J15A 4GS3A 3EN2A 1B7YB 3MXNB 2D62A 2EIFA 2K52A 3HOYG 4GLAC 4DR1Q 4DR6Q 3F8TA 1HNWQ 4B3RL 2ZTCA 2ZM6L 2JA8G 1XJVA 4L5RC 5HY6A 4OO1I 1LUZA 1PH9A 4JYAQ 3RLNA 3A5UA 4WJ3M 1IBLL 1EQQA 4LFAL 2QA4A 4IOAA 1NY4A 3KOJA 4X66L 3PIOA 4A3KG 2UUBQ 3NBHB 1W2BA 3CXCA 2IHFA 5JJKA 4GKKQ 1L1OA 1VQOA 4A3MG 1VQ9A 3OW2A 1JB7A 4GOPA 1VQEA 3BZKA 4YWMA 4B3ML 4APVA 2UXDQ 4IPHA 2B3GA 2HIVA 4DV2L 4LFBL 1XPRA 3F2DA 2PQAB 3G48A 1I94Q 4JBMA 3UDIA 4OWWB 1PH2A 2R6GA 2KBNA 4HIMA 4HJAA 1Y14B 1K8GA 2HHHL 4JBWA 1NE3A 3CCRA 2YTVA 4GLVB 1IBML 4R4QA 4NB3A 4JI1Q 4LF5L 1WCMH 4L5SA 1RIPA 2CWPA 2BA1A 2WAQG 4A4IA 4HIOA 4A3LG 3M4PA 3HOWG 4A3GG 4A75A 1PH5A 2LXJA 2KCMA 4DV7L 4GNXB 2FXQA 3M4OH 1VQLA 4B3SQ 1N32Q 1SMXA 3JAMc 3KF6B 5C4JH 4C3IH 2OTLA 3ERSX 5BR8L 2V1CC 2Z6KC 3OTOQ 2R7ZH 4YHHQ 2YV5A 4P73A 3M9BA 1C7YA 4AIMA 1HR0W 4DV0L 4ME3A 2Q2HA 1WOCA 4XIGS 2JA6H 5M3FH 3FP9A 2PI2A 3CQZH 2E2JH 1VQCA 4DV6Q 2UUAQ 3S1MH 4X62L 1HZAA 3A74A 2VQEL 1Y1VH 4UPAA 4GNXC 4B3TQ 2F4VL 3HOVG 4KHPQ 2NVYH 4LW1A 2OCEA 5H1SE 1Y1WG 4X65L 2RCNA 4QY7A 1MJEA 1UE5A 3S17H 2YYZA 4JOIA 2H5XA 3DLLA 4DV1Q 1K8AC 3M85A 4B3RQ 2ZM6Q 2KHJA 4DV4L 2UUCL 3J81c 4P74A 5GAEC 1PA6A 4LFAQ 1IBLQ 1YZ6A 2CQOA 1GD7A 2ES2A 3KDFA 1WI5A 2RF4A 2RHQB 2QEXA 3KJOA 4LF8Q 4X66Q 1D8LA 5IYCH 1PH1A 1HJPA 1IL2A 4L5QA 1JJCB 1VQJA 3RZDH 2HIXA 3I4NH 1MJCA 1KHIA 4DUYL 1YBYA 1XNQQ 3UE1A 3GTOH 2MNAA 3I4MG 5LMNL 3OYYA 2K75A 5C4XG 2ZJQA 1V1QA 1P8LA 1GO3E 3PO3H 4DV2Q 4LFBQ 4HJ9A 3AFQA 4LUOA 1SN8A 4A3JG 3RZOH 3KF8B 2VQFL 2JA7G 3HOUG 2HHHQ 2OQ0A 1N33Q 1VQHA 1M90C 1KXLA 2NZHA 1TWGH 1HZCA 1UE7A 1C9OA 1IBMQ 2XGTA 3HOZG 4LF5Q 3M3YH 1P16A 2L15A 2JE6I 3PO2G 4BBSG 2VUMH 2MQHA 4QIWE 4KI0A 5FJ8G 4DV7Q 1JMCA 4DUZL 1E22A 5FLMG 2MFIA 2OQKA 3S1RH 1KIXA 1YJ9A 1K3RA 5C3EG 4DR2L 2Q2UA 2JA5G 4K0KL 1EQRA 1QVCA 4C3HH 1PVOA 3PUZA 1IYJB 3PSIA 4KHZA 3GTMH 1Q12A 1YVCA 3STBD 4A3IG 1VQPA 1YHAA 5M5YH 1HNZL 2DUDA 3A5ZB 4DPGA 1NJIC 3GTPH 4A93G 4OWXB 3LGJA 2ZTEA 3BU2A 4X62Q 1EIYB 2F4VQ 2AWNA 4A3EH 1D7QA 1EFWA 3GTKH 4LF4L 5C0XI 4BXXG 2R93H 4X65Q 4JI4L 1FGUA 1Z47A 1X54A 5JEAG 2Q2IA 3CAMA 3TQYA 2AMCB 4A3BH 4HJ5A 2WAQE 1L1OB 3EBEA 4DV4Q 3L2PA 1JT8A 2R92G 4GOPB 4KLKA 3GTLH 1SR3A 2JA6G 2OTJA 1NMFA 3I56A 5IP9H 1PH3A 1E1TA 4LUZA 1NMGA 2IT1A 3ULLA 3GTJH 1YIJA 3J7A5 3M7NA 4LF6L 4X64L 1A8VA 2UXCQ 5IP7H 2E8GA 1N34Q 2IY5B 1MKHA 1U0LA 4DK6C 2VS1A 5LMNQ 3CCQA 4JBKA 1L1OC 2B63G 1E1OA 3RN5A 1A63A 1KRTA 2YTXA 1XPUA 2YU9H 1VQGA 4BA1I 4GOPC 4DR3L 3HFZB 4YCVA 4JI6L 4ALPA 2K50A 1X3GA 1YHBA 2K5HA 2GVBA 4Y52H 4A3CG 4YCWA 1S3OA 3CF5A 3FKIG 3PUWA 4JI3L 4OO1G 1HZ9A 5J3BA 4OXPA 3HOXH 2E5LL 3S14H 1YJNA 3S16H 1HR0Q 1TWFH 2IHEA 2JQOA 3CPWA 2UXBL 1TXYA 5LMNW 1J5EL 3L0OA 1QZGA 4DUZQ 1PHJA 3S2DH 3S1QH 2VL6A 4JI5Q 4IFDI 5LMUL 2IX0A 4DR2Q 3PO3G 4A3DH 1I5FA 2WB1E 1WJJA 5C44H 4K0KQ 3RN2A 1VQMA 3F2BA 4RMFA 1I6HH 1FL0A 3W5OA 3T1YQ 1HNZQ 3AYHB 3S2HH 1PYSB 4LF9L 4JV5Q 3BJUA 2VW9A 1CSQA 5ELNA 4JCVE 3S15H 2VZAA 3J7ZC 1PV4A 5GROA 3Q8DA 5IYDG 4DV3L 1JJGA 4JI8L 2JEBI 2KCTA 3TRZA 3S24A 3U4VA 4HJ7A 3H0GG 4LF4Q 3ULPA 3W1BA 1WFQA 3KDFB 4O0AA 2EXDA 4H02A 1HH2P 3TEHB 4C3JH 4AQYL 4JI4Q 4IFDG 4UP9A 5IYBG 4FDBA 3U4ZA 3M4QA 1Q46A 2ASBA 4JOIC 1VQKA 3PV0A 3UDFA 3E0EA 1HZBA 3MEFA 4BY7H 1VQ5A 2HT1A 4YWLA 4LFCL 1SFOH 1XMOL 1BBWA 4LF6Q 1K0RA 4X64Q 3CCLA 3CP0A 4DR7L 3IRBA 5JEAJ
chains in the Genus database with same CATH superfamily
1KC8C 4MTKA 3M7GA 5ISRA 3GTPB 3T56B 4DK0A 3D0FA 1H9MA 3NWSA 3NPPA 2RBMA 2N78A 5JJIA 4JI6Q 4A3KH 2M00A 2I0QA 2J4XA 1A62A 1YNXA 1NTGA 1EZ6A 1G51A 2O5IC 4LJZC 3AMUA 2L1BA 2GN5A 1LTTD 4BS9A 5EAYA 1LT3D 5AFWA 3GTLB 2FHTA 1KL9A 4IUNA 2O5JC 1OXVA 2F0IA 1AE2A 3KLWA 4RCNA 3CCMA 3GTJB 1PZJD 2N49A 4FNFA 3FHWA 5M9OA 5GQOA 1X3EA 1EY4A 2UUBL 1G291 1ILQA 2K32A 3GO5A 3T4AC 5CV8A 3HOWH 1VQ8A 1JOKA 3NK9A 4DR4L 1DJRD 4HJ8A 4JI0L 3J80i 5G3LF 5C5LA 5CV9A 1XYIA 4EGVA 3OHXC 2PI2E 1D6EC 2Q2TA 1K73C 3LWEA 1J6QA 1UEBA 1VMPA 3TDQA 4AH6A 3J81i 5M5WH 3K5OA 3S2DB 2OXPA 3EVQA 1TIID 5AJ3L 3M4YA 2JP1A 1EYAA 4DKAC 3G71A 1QVGA 4A3DB 3E9IA 1TWAH 4DGZA 2K03A 1ASZA 1I6HB 1HTPA 4PG3A 1SE2A 5KNCA 3I55A 3S2HB 3NELA 3IFDA 1STYA 2QGQA 3G7LA 4YHHL 3RNUA 3S15B 3N52A 1EUJA 5C0XG 4V190 4ZYSA 2EY1A 4DV6L 4GKJL 3FPUB 3MHBA 4KHPL 2AUKA 3ONAB 2VQFQ 4QB4A 3CMEA 4IZ8A 4FF1A 1B44D 2RSNA 2K5DA 3WDNA 1RL2A 2EJGC 1L2FA 4DV1L 2Y0SG 4BY7B 2BH8A 4EX5A 2WFWA 1B70B 2LSSA 2F0HA 2ZXRA 4LF8L 3G4SA 1Y8OB 2FFKB 3TS2A 1V9PA 1HA6A 1PRTB 1N8RC 5COYA 3I4NB 2K4KA 4QUFA 1S5BD 4DR4Q 3PIP3 1JJ2A 2E2DC 4JI0Q 3K59A 5HGQA 1JOQA 5IGFA 5IGEA 1DZ1A 5GADC 2HDLA 1C0AA 4BBRB 2NVTB 2BA0A 1SAPA 2LMCB 3I8ZA 1PRTC 4ZLTF 1KABA 1TWGB 4EQ5A 5BN5A 3BVMA 3TN2A 1DGSA 2BE5D 5AJ3Q 2XTIA 3ZJYC 2IL8A 4PMWA 2L11A 1JWMD 4R4OA 2E2IB 4BXXH 4X3KA 3NTIA 2EZVA 5JEAH 1IL8A 2B2TA 3U9SA 1PFSA 4A3GB 3TBIB 1IKMA 5E4WC 1YI2A 5GAGC 5M5YB 5ELDA 3K7UC 3GTQB 4GKJQ 3GTGH 3A56A 2DGYA 1LM0A 1N36L 1SRUA 2PQEA 1SROA 1AZPA 5I6WA 1EEID 4OWTB 2PCFB 2K5QA 4K8IA 4JVZA 5HGTA 4ZCKA 1KDCA 4A3CH 1JE5A 4DXGA 1HNWL 2B29A 3A54A 4OO1H 1EYGA 1K8OA 4QGUA 1VQ4A 3NSWA 4IPGA 4KKSA 1N34L 2F4IA 1PH7A 1X6OA 4U673 2F0SA 1L0XB 1Q8IA 2NN6I 2MO1A 4QUCA 2ZXPA 1GM5A 2WINB 1EY5A 3KBXA 4R4TA 2B2WC 4DNTB 2X6GA 3J7YW 2OWOA 4XQJA 1SMYC 1NSNS 3MXGA 1M1KC 1I50H 2CW0C 3KF8A 2MUYA 4GN5A 4DAMA 1YITA 1FVIA 4F7XA 4H44C 2F52A 2LKVA 1O7ZA 2JN4A 2Z0SA 4GZYC 5C3EB 1FR3A 1SE4A 4DK1A 2K1BA 3LNNA 1N36Q 2HUGA 1XTCD 3SGIA 3H3VC 4XYQA 1F9SA 5EKKA 4A93B 1EYDA 1T5XD 2ZT9C 4J15A 3EN2A 2A6EC 3MXNB 2D62A 4RCOA 4ILWA 4RKBA 1HPCA 1TWHB 3F8TA 1SYGA 2DJGC 1HNWQ 2JA8G 1QNUA 3KK7A 5HY6A 1PH9A 3RLNA 3A5UA 4LFAL 3K5LA 2QA4A 4IOAA 1LV9A 4X66L 3PIOA 1AW7A 1ZYRC 2MHVA 1W2BA 5JJKA 3OMCA 1L1OA 4ZKBB 2OEOA 1B53A 1B50A 4GOPA 1VQEA 4DU9A 4X3SA 1WTQA 1XXGA 4IPHA 4F8MA 2HIVA 4DV2L 3KLSA 1I94Q 1HHVA 4OWWB 4QF4A 3MXPA 4HJAA 1FYCA 2YTVA 1CA5A 5IIFA 2B39A 1SYCA 2BA1A 3FKIB 4A4IA 4XQNA 4A3LG 1TU2B 4K6LA 2LXJA 2KCMA 4DV7L 2HD3A 3J7AV 3VR3A 1BQQT 3MWYW 3KF6B 3ERSX 5BR8L 2Z6KC 4L6TB 4P73A 1BOSA 3GV3A 1C7YA 4DV0L 4XIGS 1ZXTA 1G8ZD 2PI2A 4ZRZA 1ZEQX 2E2JH 1HZAA 3DHQA 2CH4W 5H1SE 5A35A 1K28A 1H9SB 2RCNA 1D5MC 1UE5A 4JOIA 2H5XA 3M85A 2KHJA 3HOVB 3Q6SA 3J81c 2UUCL 3A55A 1D5ZC 4LFAQ 1PTOB 2RHQB 3TZUA 3KJOA 1Y1WB 4X66Q 1PH1A 1HJPA 1M8AA 2F0DA 2R61A 3I4NH 1SDFA 1KHIA 5A2QE 2NVQB 1PMRA 2DNCA 5C3XA 1A3TA 1FNUA 4DV2Q 2PMZB 3S9WA 1STNA 2EOTA 2JA7G 2BCOA 5IOCA 1KXLA 1TWGH 1SE3A 1UE7A 1U4LA 2Q8RE 1TY0A 3HOZG 4ZK9B 2L15A 2JE6I 3PO2G 4BBSG 1SNCA 4QIWE 4DV7Q 1JMCA 4N9TA 1E22A 2EYJA 5FLMG 2MFIA 3S1RH 2JA5G 1EQRA 3PUZA 3MVVA 2KECA 5KEEA 3GTMH 1Q12A 1YVCA 4A3IG 2PW5A 1VQPA 5M5YH 3SK8A 2NZ1D 3LGJA 4YIJA 2ZTEA 5CC4A 3C1FA 3D8GA 4KD3A 2R93H 3SDZA 4JI4L 1FGUA 1QNKA 1U4MA 2N88A 4NMZA 3CAMA 4A3BH 3VA7A 2WAQE 3EBEA 4HJ5A 1PYWD 2R92G 1CI3M 1K3BC 2EYHA 5IP9H 1G2TA 2IT1A 3I3CA 5EBCA 1EZ8A 2HCIA 2JYOA 2UXCQ 3PQIA 1MHWC 3TP6A 2IY5B 3A7LA 1MKHA 1U0LA 3CCQA 2VB3X 1B9NA 5BN3A 1SNPA 2YTXA 1WTPA 4S3SA 4KN4C 4B9WA 4KY6A 2K50A 3P75A 3VA5A 1IYVA 2GVBA 3A7AB 4YCWA 1ET9A 2XSCA 1FNWA 4KD4A 5KRUA 3CF5A 3PUWA 1NR2A 4JI3L 1E0BA 1B3QA 3S14H 3S17B 4IN3A 4FXGC 1TXYA 5LMNW 1PHJA 1RDPD 5CGKA 4C1NI 1I5FA 5C44H 3RN2A 3F2BA 2PZWA 3T1YQ 2IWHA 4LF9L 3BJUA 4LAAA 5D3IB 3J7ZC 3DXJC 4DV3L 1X3PA 4JI8L 3OSOA 2KCTA 3TRZA 1H9KA 2EPBA 2K28A 3H91A 5ELFA 3TEHB 3BVZA 4JI4Q 2A69C 4UP9A 1PRTD 3KUPA 1BBXC 1EQVA 2NWGA 3MEFA 3DWQA 5CV5A 4N8FA 1DM0B 2KJXA 3NTKA 2RHSB 1GUGA 2RSOA 2E75C 2XVSA 4DAYA 3CCEA 3CC2A 4POFA 1KDBA 2F0UA 3VYSA 4B3MQ 2NTSA 4YCUA 2RQXA 5M3MH 3SR1A 2ZJPA 4A3MH 1SYFA 1QE6A 2HQEA 2JA9A 1PYBA 3JC66 1I4HA 3EROA 2ALYB 1KD1C 4A3FH 4DXFA 2F0PA 4DR1L 1MSGA 3C2PA 3CC7A 3AFPA 4DF7A 4QL5A 2L5TA 3DUZA 3E0JA 2KUMA 4XT3B 1SSOA 4UP8A 4LF7L 1CFMA 2CFMA 4L63B 3I4LA 2KEEA 5IT9E 1Q86C 2ID0A 2YU9B 4JG2A 4JI8Q 5A2QL 1STGA 3NQTA 1U9RA 4ZQ3A 1CHQD 1Q81C 1Q8KA 2VQEQ 1CUKA 3NEMA 1RJTA 1AN8A 4HIKA 3S16B 1AE3A 1TWFB 2KENA 3K57A 1SYEA 2D0OA 1XMQL 4LNQA 3HOVH 1A15A 1SMYD 3ER0A 4KMUC 3TP5A 3K5MA 5JAVA 4J1MA 4OGQC 1PTOH 2CW0D 1Z7TA 4B3SL 5M3FG 5IGDA 5L37A 1XNRL 1EYCA 3P1HA 4UP7A 1Y1VG 4AYBE 1MIUA 4Q5VA 1D1IA 2ATWA 3D6WA 5JJLA 2J0TD 2UUAL 3NQIA 3S1MB 3U50C 4B3TL 1X55A 3PUVA 4DV5L 3I4MH 2NVYB 2R7FA 1QZHA 2LFNA 1YNNC 2A6ED 1E7ZA 3CCJA 1HFNA 3GV6A 4A3JH 5K36G 3SK5A 1TY2A 2Z1CA 5CMDA 3HOUH 3A0JA 5CORA 4LF7Q 1VQNA 5E1FA 5M3MG 4OX9L 1ZYRD 3X3MA 4BWGB 1VQDA 2JA8B 2F0QA 1R4QB 3T51B 3CMAA 2NVXB 1QILA 3CCUA 1XNQL 3HKZG 5FJ8H 4A3FG 4NPSA 1N9WA 3E6ZX 4FXKC 1FJGL 1JCKB 1HUMA 3ND9A 4JC0A 3J7AF 2NN6H 1I4PA 3S1NH 2VUMG 4BY1H 2A1AA 4HIDA 2QF7A 3BG3A 2ZJRA 3KBGA 3HS0C 4X6AH 3T1HL 1XMQQ 2UU9L 1QVFA 4C3HG 5DNFA 1X65A 4K5VA 5M5XB 4K6DA 1QB5D 2AHOB 1XNRQ 1VQFA 1PRTF 1QUQB 5IY0A 4RFBA 1VQBA 1K83H 3EA6A 1NAPA 1WTRA 1JR0D 2XIWA 3FDTA 1X9NA 2CHBD 1UEAB 5EKIA 1PH4A 3R2TA 2WKDA 2EQSA 4GNXA 4A3EB 1XWEA 4DV5Q 1K0SA 1LT6D 3PF5A 1BVSA 2EYFA 2BH2A 3U58A 3MC0B 5C0XJ 1WYDA 1Q82C 2KHSA 1X3QA 5IP7G 1LLRD 4QQBX 1J5EQ 1EWIA 4IPDA 4OX9Q 2AQ1B 5LMUQ 3H3VI 1IZ6A 5EJWA 1QCBD 3G6EA 1OTCA 1TWCH 4P75A 1FJGQ 4GKKL 5J1ZA 4XTCS 1CZWA 1VQAA 5JPMC 3HOXG 3Q0AA 5GAHC 1CKNB 1PTOD 4MHEA 1GVPA 2JXMB 4OHJA 1EY7A 2F0JA 2EYPA 4QMGA 4N8X1 3T1HQ 1RTNA 3AU7A 2UU9Q 5IYDH 1QG7A 2Z4IA 1HR0L 4PZ6A 1MD2D 3H0GH 3N6RA 2JA7B 4JBJA 2BDOA 4JI1L 4IFDH 4Q0FA 3AQQA 4JI5L 1GXDC 2AKWB 5T1GA 4LFCQ 3HOZB 2N3SA 3RLOA 4BBSB 3PO2B 2NN6G 4IFDJ 4Y7NB 4BY1G 3PIPA 1N32L 4JV5L 4C3JG 5IT9L 2YTYA 4RHRA 1BXTA 1A0IA 2JA5B 2EY2A 1RODA 1DOMA 2E2HH 1NBWA 2NZOA 4C56C 1ASYA 4A3IB 4MN3A 4H7BA 3VR2A 3Q23A 1R9TH 2AUJD 3I4OA 4G7ZC 1SE8A 4L5TA 3CKIB 3A8JE 4GS3A 3NE5B 1B7YB 5D3DA 1M4VA 3JAME 4O42A 4OELB 2EIFA 4K14A 5E4XA 2K52A 4GLAC 4JK1C 2ZTCA 3BDCA 2H4OA 3MZ5A 4PNYA 1DCZA 4WJ3M 1NY4A 2R92B 3G6JB 2UUBQ 4A3KG 1FNVA 2IHFA 3HOYB 3OOCA 3SK6A 4GKKQ 2F0NA 2G9DA 2K05A 1WVLA 4XT1B 4HTHA 2F0EA 4RGOS 3FRPB 4LFBL 1XPRA 2PQAB 3UDIA 5DM73 2R6GA 1C8CA 1Y14B 1K8GA 4V0BA 3CCRA 1MGSA 2B2UC 1IW7C 1F77A 3CHBD 5ELEA 4JI1Q 1WCMH 2WAQG 4HIOA 3M4PA 3W2DA 3HOWG 4A75A 3M4OH 2CQAA 4WORA 2Q8IB 1F9RA 1VQLA 1N32Q 5HURA 5KNDA 2A6HC 3A8KE 2V1CC 4UDUC 2R7ZH 4YHHQ 4AIMA 2JA6H 3WOFA 1R4PB 4C2MB 5CV6A 4DV6Q 4Z9CB 4X62L 3S1MH 4U68A 4KHPQ 3D4DA 2A69D 2NVYH 1I3QB 2K33A 2B8FA 3UI2A 5F2DA 1WD0A 5J39A 1GUNA 2YYZA 3DLLA 4DV1Q 1K8AC 3C46A 4P74A 1WTHA 1PA6A 2EYOA 2G9HD 1YZ6A 1GD7A 3KDFA 1WI5A 2RF4A 4LF8Q 5I4DA 5IYCH 2ICEC 1KDAA 4L5QA 1JJCB 5EQ0A 1VQJA 3RZDH 1UAPA 1MJCA 2VXWA 4DUYL 1CA6A 4RGTA 3OYYA 1JB3A 1TQOA 2K75A 1P8LA 3PO3H 4LFBQ 3AFQA 4LUOA 3KLSX 3DWAA 1AP0A 1BF4A 5C4XB 1C9OA 2IPKD 4QCLA 5CBAE 1P16A 1PTOF 2WACA 2ENBA 4RAUC 5ELCA 4PQXA 1HA5A 1A3UA 1PVOA 1IYJB 3FMCA 3T53B 4CBVA 1LO5D 4DPGA 1NJIC 3GTPH 1HQMC 3TSSA 4X62Q 2VB2X 1EIYB 4A3EH 1ESFA 4LF4L 2I07B 3OWEB 5C0XI 4CHTB 5LL6X 4BXXG 5JEAG 2Q2IA 3TQYA 2AMCB 1U4RA 3L2PA 2FJ2A 1CM9A 3QOJA 3GTLH 2F0MA 2JA6G 3L3OC 3I56A 1E1TA 2XNAC 3GTJH 3P20A 3M7NA 2ZXOA 1YNJC 5C4JB 4C3IB 1H9RA 2EVBA 1N34Q 4TKOB 4EQPA 2L0CA 1E1OA 3HZXA 5M3FB 1A63A 1XPUA 1VQGA 4BA1I 2D9UA 4E6IA 4KN7C 3HFZB 1Y1VB 3EJIA 3T16A 1X3GA 1YHBA 2K5HA 3QJYA 4Y52H 4A3CG 2R3ZA 5ELBA 2B63B 2L55A 1TS2A 4OO1G 2RVLA 4OXPA 1YNND 5C5MA 1YJNA 3DM1A 1ONLA 4K5XA 1TR5A 5IGBA 1LTAD 1QJOA 2JQOA 3JAML 1GUWA 3S2DH 2DY8A 2VL6A 2A74C 4IFDI 2PO4A 3PO3G 4A3DH 4IQZA 1VQMA 4RMFA 5JVG3 2Z8LA 1I6HH 1DOLA 3GTOB 4KKTA 1EL0A 3S2HH 1PYSB 1CSQA 5ELNA 4JCVE 3S15H 2VZAA 1PV4A 3SHLA 3RZOB 3S24A 1O7LA 4HJ7A 3QG1A 3HKZB 4LF4Q 4XQQA 3GP7A 2NTTA 1ET6A 3TZDA 4WFN3 3GQBA 5LHY1 4AQYL 3EQLC 4FDBA 3M4QA 2F0VA 1VQKA 2B2YC 3PV0A 4BY7H 1VQ5A 3ERQA 1LTID 2HT1A 1XMOL 1K0RA 4CKCA 4RKLA 3CP0A 4C3HB 3D3RA 1PXUA 3QOLA 2WIIB 5KYIA 4YY3L 3HOYH 5IODA 2F3WA 2WB1G 2XWJB 1OXUA 3F2CA 3AB9A 3B6YA 4IJLA 2WP8J 4BBRH 2NVTH 2EJMA 3X3NA 2MGSA 4MNOA 3RUZA 4QJFA 1VQ6A 5DM63 4DR6L 5C4ZA 2Z4HA 4PZ8A 2OF1A 3SXHA 3C1EA 4IUQA 2E2IH 3R2IA 3H09A 4IUVA 2A19A 1RKNA 1CKOA 1EWHA 1Q1BA 4CJ1B 5BR8Q 1BBUA 4A3GH 4JPBW 1UWVA 3STBC 2MJ8A 2N55A 1WD1A 1CSPA 1Q1EA 2PNRC 4DNIA 1VS0A 3J81j 4DV0Q 3OW7A 1YHQA 2UXDL 3GTQH 2B8GA 1GOZA 1OXSC 2VY3A 3F1ZA 3HOXB 1FD7D 4IJHA 3L9AX 2B2WA 2G5DA 4ME5A 1A3VA 3IKJA 1GUOA 1RTOA 2UUCQ 4NXML 1PFNA 2M2LA 3VDYA 2VNUD 2P5ZX 1PDQA 5CYUA 4YY3Q 2A5HA 1HNXL 4JI7L 3AEVA 3R3OA 4TQUS 3WWVA 1BUVT 3HP3A 1EIFA 5EPKA 3MAQA 3L7ZC 5IGGA 3CQZB 3SK4A 3QIAA 2R7DA 5IGCA 4BY7G 4C3JB 1Y8NB 4RGNA 4CJ0B 2H1EA 5IT9c 4KKUA 1XX8A 2PZTA 4GN4B 5C4XH 2I5LX 2D2CC 3UDXA 1LTRD 1LTSD 3K0YA 1UE6A 1IBKL 2X6LA 3I4NG 2IX3A 4RG1A 5IE8A 3TS0A 3J80E 3I2ZA 1DD2A 3MTSA 2K01A 1CQFA 2K5WA 3H3VH 2Y0SB 2B2VA 4OL7A 1KAWA 4BBRG 3BYTB 5EKLA 3P7JA 3MXNA 1HFGA 4QIWB 3T13A 4JI2L 1OXTA 3VYUA 3J81E 3NWTA 4G7HC 1KAAA 5C3EH 2HQLA 3CRLC 3UDGA 2PNHA 1L0WA 4HSPA 1N33L 3EFXD 4IUPA 4A93H 1SEBD 1YJWA 1WTXA 4PV1C 1ENAA 1IW7D 1SJHD 2RDHA 1J9OA 3K8AA 1G6PA 4NXMQ 4MTNA 4JW0A 3TP7A 3DM3A 3VR4A 4I65A 2D0PA 1TWHH 2J7ZA 1HNXQ 2F0TA 4JI7Q 5KYLA 1TS3A 2BOSA 5E3FA 3TP8A 4BA2I 4TSSA 2Z6KA 3HOWB 2A6HD 3R8BA 1Q7YC 1GKHA 2R93G 2QDBA 3TREA 3O13A 4A3BG 2F03A 2O4XA 3GTKB 2IX1A 1LYLA 3KF6A 5IP9G 2B63H 1IXRA 5M5WB 3D4RA 4JI3Q 1EIHA 3MA2B 1IBKQ 1V1OA 3FEWX 5FLXE 4KJNA 1KRSA 1TWAB 2EJFC 3FKIH 3E5SA 3ICEA 4JYAL 1H9SA 2JK8A 1WTWA 1AFPA 1D2BA 1VCIA 4JI2Q 4UAIA 1QOHA 2I5MX 4X3TA 4LF9Q 3IFTA 1PH8A 5D14A 1VMCA 4K2KA 4DV3Q 4PZ7A 1H9JA 1QWYA 1EY9A 3EIVA 2AWOA 2NBFA 1CKMA 5C44G 1MI2A 5EPJA 4YWKA 3KFUA 3TMEA 3K81C 1I4RA 4LUVA 5IYBH 2F0KA 3BDOA 1SNOA 1Y1WH 4HR7B 2JEAI 1VQ7A 1W3SA 5E7NA 1Z9FA 3CCSA 1YEZA 3K0XA 1D1KA 3CPFA 2A68C 2SNMA 2NVQH 3NENA 4EQOA 1FGBD 2K14A 2RA4A 3MXUA 1X32A 2PW7A 2Z9HA 1KLGD 4DR1Q 2BDNA 4FP5D 1CZGA 1STAA 2EXZA 4B3RL 1XJVA 1HQRD 4L5RC 1RHPA 1LUZA 4JYAQ 1IBLL 1EQQA 2DJFC 1YNJD 1EU4A 3KOJA 4OIKA 1STHA 3CXCA 1KTKA 3CU7A 1SYDA 2ICIA 1KLUD 4HCSA 4A3MG 3OW2A 1VDZA 2K04A 4YWMA 3OPOA 2QKIC 3HRZC 2RDFA 4CKBA 4WRDA 3MFYA 1U4PA 2KCNA 3G48A 1CQVA 1NNXA 1BR9A 3OMGA 2KBNA 2HHHL 3NBHA 4RA8A 1NE3A 1SBBB 1V1PA 4NB3A 4L5SA 1RIPA 1EU3A 4XXEA 2FXQA 2MP1A 4B3SQ 3J80L 5DAUA 2B2TC 1SMXA 1T5EA 4I7ZC 3JAMc 2EYMA 3RMHA 3M9BA 1HR0W 3NTHA 1VF7A 1WOCA 3A8IE 3ITPA 3CQZH 4CGYB 1F9PA 3J81L 1VQCA 2UUAQ 3HOVG 3DWPA 4UPAA 4B3TQ 1LT5D 5C3WA 4LW1A 2OCEA 5C0XH 4CJ2C 1Y1WG 4QY7A 1MJEA 3S17H 4B3RQ 2KQ3A 1JQYD 1I50B 1IBLQ 2CQOA 2ES2A 4R8NA 2NUCA 1D8LA 2TMPA 4L8JA 1I4XA 1B1ZA 1EOTA 4ABNA 1XNQQ 3UE1A 1WTVA 2MNAA 3I4MG 5CV7A 1HTLD 1GO3E 4HJ9A 5FO9B 1LT4D 4CDFC 1SN8A 2WB1B 5JVH3 4A3JG 3KF8B 3V2TA 2VQFL 3HOUG 3OWFA 1RCVD 2DNEA 2OQ0A 2HHHQ 1VQHA 4PMBA 1M90C 3K7AB 1HZCA 1JE4A 2XGTA 1D5XC 3DEOA 2O2LD 2MQHA 3IL8A 4KI0A 5FLXL 5FJ8G 1GHKA 3K6OA 4DUZL 2OQKA 4DR2L 5FK9C 4KHVA 1HRJA 5EPLA 2EE1A 1IKLA 3STBD 1HNZL 1YHAA 1Q90A 3A5ZB 1L0YB 4OWXB 3BU2A 1WTOA 1BO0A 2AWNA 4KTAA 1EFWA 3BVGA 3GTKH 1HUNA 2FMMA 1L1OB 1K8MA 4GOPB 4KLKA 4KY7A 1SR3A 5CBEE 4NP5A 2OTJA 1NMFA 3R93A 1PH3A 3ULLA 3I70A 4LF6L 2F0WA 1A8VA 2K6AA 3NP8A 3V05A 2E8GA 3MEHA 4F88A 4KJOA 1II3A 1L1OC 3RN5A 1KRTA 2HDMA 3BZDB 3VR6A 3URYA 4GOPC 2YU9H 2E2JB 4DR3L 1I4QA 4LK1C 4ALPA 2EYLA 3HG9A 3K58A 1BCPB 1HZ9A 3S16H 1VF5C 2E5LL 3U9OA 1HR0Q 1RD9D 1TWFH 1G2SA 2IHEA 2UXBL 1C4QA 1QZGA 4DUZQ 5KIXA 4R9WA 4JI5Q 2IX0A 4DR2Q 2TSSA 5JOBA 1BCPC 4DA2A 1FL0A 1EQTA 4N9PA 1HNZQ 4JV5Q 1S5DD 4F87A 2QDLA 1EFID 5GROA 3Q8DA 5IYDG 3SVMA 5CV4A 2SEBD 3H0GG 1CT1D 3HEJA 3ULPA 3W1BA 1WFQA 1STBA 4O0AA 2EXDA 4H02A 4ODGA 4IFDG 4ID6A 3RD4A 3NHHA 2F0FA 1STEA 2ASBA 4JOIC 3DEPA 4EQNA 3S1RB 2KOLA 1BBWA 1ICFB 4LF6Q 4DR7L 5JEAJ 4LMQD 4POGA 2JSOA 3GTMB 5CR3A 2LXKA 3I7FA 2GA4B 3QWNA 4NXNL 1K9MC 1I6VC 1U5KA 2JA8H 2XN9C 2NVXH 1PLFA 4DR3Q 4R4CA 2FINB 2QEJC 3PGZA 5LL6S 3E9HA 2R93B 1QUQA 4HMJA 2E5LQ 4A3BB 1X3FA 3PUYA 2UXBQ 1V8QA 1F2MA 2LS01 5FO8B 4UY8C 4WJ4A 3D31A 2K5VA 3SE0A 2A8VA 4IUTA 1EY8A 5M5XH 4FYDA 2KVMA 1EOVA 2FMCA 2N8NA 4GLXA 4A3LH 4HEDA 3UE0A 2F0GA 3CD6A 4RH6A 5I2YA 3BS1A 1B8AA 3V96A 1WCMG 1I94L 2I5HA 1XTDA 3S14B 1LABA 4G57A 2D5DA 3VYRA 4A76A 1PZKD 1EY6A 2CWAA 1S40A 1S72A 2Q8TA 4P71A 3DMUA 1OXXK 4LWCA 1CKNA 2R7ZG 5C44B 2MO0A 3BZCA 4DR7Q 3HKZE 1W6JA 2NYZD 4NXNQ 1LTLA 2CVRA 4DUYQ 4O2DA 1UE1A 1S4ZA 4C1NK 3CC4A 2CCZA 2A68D 2KHIA 1V43A 4P72A 3H15A 1BNZA 4DFAA 3I72A 1NCVA 1VQIA 1EY0A 3PF4A 5IWAL 2KA7A 3K7AH 1O7YA 3FVQA 1G91A 2K5NA 5EGTA 5IYCG 4FF2A 3RR5A 4GN3B 1B9MA 1E24A 1NR4A 3PMFA 1E2WA 2JA7H 1LTGD 2F1MA 2B2VC 3PUXA 1ICWA 2EDGA 4R1JA 3VYTA 2F3IA 3HOZH 2PMZE 3VR5A 4BBSH 3PO2H 4R4IA 5FO7B 4ULLA 1Z6HA 4Y7NH 5K5PA 4DK3C 1F2ZA 1UNSA 5FLMH 4OONA 1AEXA 1E3PA 3RLFA 2IJ0A 5M3MB 4AYBG 2JA5H 3IAYA 4A3MB 1F9QA 5JJZA 5ELOA 2F3VA 1SNQA 3PCOB 4A3IH 4ZUIA 4A3FB 1KNEA 1XPOA 1GJXA 2GVAA 2B2UA 2CKZB 3M3YB 2A73B 2JJQA 4TVAB 3KYHC 4DAYB 2VUMB 1A2UA 3BDLA 1KQSA 1JC7A 4DAPA 2L4NA 2PQAA 4HAEA 1W6KA 1MSHA 3CCVA 2SOBA 1A2TA 5FOBB 3D4WA 4A3EG 4MZ9A 2F0LA 2R92H 1DYQA 2HCCA 3PIO3 3W1GA 2C5CA 3K5NA 4KY5A 3H6MA 3NBIA 3J80c 4IOCA 2K7VA 1H95A 1O7IA 3I73A 5IWAQ 4DR5L 3KJPA 2L9HA 2ZTDA 1O78A 2QCPX 1AZQA 2QW7A 2AQ3B 2C35B 1S5FD 4MIUA 2KCCA 4IPCA 1JORA 1LTBD 1X56A 3K80C 2UXCL 2E76C 1DXMA 2E74C 3JAMi 1KNAA 4P2CB 3BYYB 1AH9A 5EBDA 4O1NA 1PTOC 3CW2C 1BKBA 2LY7A 3GDEA 4C2MH 3I4MB 3HKSA 4RHSA 5T1IA 1ENFA 3SEBA 1TS4A 3W3AA 2Y0SE 4AQYQ 3OIQA 4K5WA 1EWCA 4A3DG 3CRKC 1I3QH 4X3UA 1S5ED 3H94A 4IURA 3E3XA 4A3JB 4IO9A 2M9VA 3HOUB 2QILA 1SLJA 3ULJA 1T9HA 3S1QB 1I4GA 1XMOQ 2X69A 4OIJA 4TRDA 4NW2A 3T1YL 4UHVA 5FLXc 1JICA 3OTOL 1RF2D 1F2YA 1B2TA 1Y8PB 1PFMA 3LX0A 3S1NB 4KK7A 5DLQE 4DR5Q 4H0LC 4BY1B 3GD7A 2NB0A 1CK1A 1PH6A 4M8AA 1SJED 4FVMA 1SNMA 2AQ2B 4NKLA 2EY5A 3HOYG 4DR6Q 4HCEA 2ZM6L 4G7OC 2XWBB 4OO1I 1SFOB 4H13C 2WKCA 4XYOA 3I90A 3FPPA 3C3LA 1K83B 1TKWB 4RGMA 3NBHB 3ND8A 4FF3A 1V1PB 1VQOA 1VQ9A 1JB7A 1ENCA 3BZKA 4B3ML 1JOOA 4APVA 2XRQD 2UXDQ 2B3GA 4A3KB 1HCZA 1DONA 4DNRB 3F2DA 4JBMA 1B4OA 3WOEA 4CDCC 1PH2A 4FXDA 2DN8A 4HIMA 4JBWA 1IBML 4GLVB 2RKSA 4CDDC 4R4QA 2BE5C 4PMCA 4LF5L 1F2LA 2CH4A 2CWPA 4IUUA 4FF4A 4A3GG 4KV6A 1PH5A 4IALA 4GNXB 2V4DA 1Y69U 1BCPD 1TWCB 1OO9B 1CHPD 5BN4A 5I9OA 5C4JH 4DAVA 4C3IH 5D65A 2OTLA 3OTOQ 2WAQB 2YV5A 4G4KA 4ME3A 2Q2HA 5NUCA 5M3FH 3FP9A 2F4VL 3A74A 2VQEL 1Y1VH 1ML0D 4GNXC 2OT2A 3F2UA 2IW3A 1E2ZA 1GUTA 1CTMA 4X65L 2EY6A 3H0GB 1SNDA 4ZKCB 2B2YA 2ZM6Q 1LACA 4DV4L 2RCFA 5GAEC 2QEXA 1IL2A 1S5CD 5K36H 2HIXA 1GHJA 2RDGA 1YBYA 3GTOH 2E2HB 5LMNL 5C4XG 3KLRA 2ZJQA 1V1QA 1R9TB 4CKEA 3RZOH 1MBYA 1N33Q 2SNSA 2NZHA 1IBMQ 5J22A 2F0OA 2MPMA 4LF5Q 3M3YH 4B9XA 4ZAIA 2VUMH 5G3LD 1TT2A 2XRSD 3MFGA 1JWSD 1KIXA 1YJ9A 1K3RA 5C3EG 2Q2UA 4K0KL 1QVCA 4C3HH 3PSIA 4KHZA 4RWSC 3QO2A 4HSVA 1A6XA 2DUDA 4K8JA 4A93G 4I7AA 4FO2A 2F4VQ 4HN7A 4XDXA 1D7QA 2SDFA 4NDXA 5I2XA 5DEHA 4B08A 4X65Q 1GUSA 1IHZA 1Z47A 1X54A 5I6YA 4ZUJA 1EIGA 4C3IG 1TVXA 1WCMB 4DV4Q 1JT8A 2Z6BA 3M4OB 4LUZA 1NMGA 1YIJA 3J7A5 4WJWA 4X64L 2WV6D 2R7ZB 5IP7H 4EVOA 4DK6C 2VS1A 4OEMB 5LMNQ 3NUCA 2JA6B 4JBKA 2B63G 1J8IA 5KGUA 3GTGB 4YCVA 3ZYYX 4JI6L 3LWUA 3D6CA 3QB3A 1SYBA 1S3OA 3Q22A 1C48A 3Q24A 3FKIG 5J3BA 3HOXH 2PZUA 5I9PA 4K2LA 1JWUD 1PFBA 4CDEC 3CPWA 2DY7A 1J5EL 5KNBA 3L0OA 3S1QH 5LMUL 5JPNC 1UUPA 4K0KQ 1HXYD 2WB1E 1WJJA 3RZDB 1IYUA 1B3AA 4J8QA 4HMIA 4DN4M 3W5OA 3I91A 3AYHB 3OIPA 1DOKA 1O80A 3QR8A 2VW9A 5FKAC 1EEFD 3PO3B 1ESRA 1JJGA 5C4HA 1ILPA 2JEBI 2C9OA 1G6ZA 5C6AA 4R8IA 1BDOA 2PYKA 2L12A 3U4VA 4M1UB 3KDFB 1BCPF 1TS5A 1HH2P 2PPBC 4C3JH 5IYBG 4AYBB 2I46A 4J6HA 1PZID 3HGBA 3U4ZA 1Q46A 5TSSA 1E2VA 1NUCA 1ZKOA 3UDFA 3E0EA 1HZBA 1SXTA 4YWLA 4LFCL 2KEDA 1SFOH 4X64Q 3CCLA 3NXWA 1Q3LA 3IRBA
chains in the Genus database with same CATH topology
1KC8C 2RHSB 4YY3L 3HOYH 2LXKA 3I7FA 4NXNL 1K9MC 1U5KA 2JA8H 3D0FA 2WB1G 2NVXH 3CCEA 4DR3Q 3CC2A 1OXUA 2N78A 4R4CA 4POFA 3F2CA 4JI6Q 5JJIA 3B6YA 4B3MQ 3PGZA 4A3KH 4YCUA 2I0QA 4IJLA 3E9HA 2WP8J 5M3MH 1QUQA 1A62A 4BBRH 2ZJPA 1YNXA 1NTGA 4A3MH 2NVTH 2E5LQ 2JA9A 1G51A 1X3FA 3PUYA 1PYBA 3JC66 2ALYB 4MNOA 2GN5A 1KD1C 4A3FH 5EAYA 2UXBQ 4QJFA 1VQ6A 1KL9A 4DR1L 4DR6L 1OXVA 1AE2A 3KLWA 4UY8C 3CCMA 3CC7A 3AFPA 2N49A 3D31A 4PZ8A 4WJ4A 2K5VA 4QL5A 2E2IH 3FHWA 5GQOA 2A8VA 1X3EA 2A19A 5M5XH 2UUBL 4LF7L 4UP8A 1EOVA 1G291 2CFMA 3GO5A 1CKOA 1Q1BA 2N8NA 1Q86C 5BR8Q 2ID0A 4GLXA 4A3LH 1BBUA 3HOWH 1VQ8A 4JG2A 4A3GH 1UWVA 3STBC 4JI8Q 3UE0A 4DR4L 4HJ8A 1CSPA 1Q1EA 4DNIA 4DV0Q 1VS0A 3J81j 1YHQA 3J80i 4JI0L 3CD6A 2UXDL 3GTQH 1Q81C 1B8AA 2PI2E 1Q8KA 1WCMG 1OXSC 2VY3A 1CUKA 3F1ZA 2I5HA 1XTDA 3NEMA 2VQEQ 4HIKA 1K73C 2Q2TA 1AE3A 4IJHA 4A76A 1J6QA 1UEBA 2KENA 2CWAA 1S40A 4AH6A 1S72A 3J81i 5M5WH 2D0OA 4P71A 1XMQL 1I94L 4LNQA 3HOVH 5AJ3L 3ER0A 4DKAC 1OXXK 4LWCA 1CKNA 3G71A 1QVGA 2UUCQ 2R7ZG 2MO0A 4NXML 3BZCA 3E9IA 1TWAH 4DR7Q 3VDYA 2VNUD 3HKZE 1ASZA 4B3SL 5M3FG 4PG3A 4YY3Q 1HNXL 3I55A 4NXNQ 3NELA 4JI7L 2QGQA 1XNRL 3AEVA 4UP7A 1Y1VG 4TQUS 1LTLA 3WWVA 1MIUA 4AYBE 4YHHL 3RNUA 4DUYQ 4O2DA 1EIFA 1EUJA 1UE1A 5C0XG 3CC4A 2CCZA 2ATWA 2KHIA 1V43A 4P72A 5JJLA 3L7ZC 3H15A 4DV6L 2UUAL 2R7DA 4BY7G 4GKJL 4KHPL 3U50C 4B3TL 1VQIA 1X55A 3PUVA 3PF4A 4DV5L 5IT9c 3I4MH 2VQFQ 2R7FA 4GN4B 3CMEA 5IWAL 5C4XH 3K7AH 2I5LX 1QZHA 1RL2A 2K5NA 1L2FA 3UDXA 5IYCG 4DV1L 1E7ZA 2Y0SG 3RR5A 3CCJA 4GN3B 1UE6A 1IBKL 4POGA 1E24A 4A3JH 5K36G 2BH8A 4EX5A 3I4NG 2WFWA 2JA7H 3HOUH 1B70B 2LSSA 3A0JA 4RG1A 5IE8A 3TS0A 4LF8L 3I2ZA 4LF7Q 3G4SA 3PUXA 4R1JA 3H3VH 1VQNA 3HOZH 1V9PA 2F3IA 5M3MG 2PMZE 4OX9L 3TS2A 1KAWA 1VQDA 4BBRG 4BBSH 3PO2H 1N8RC 3CMAA 4R4IA 2K4KA 4Y7NH 3CCUA 4DK3C 1XNQL 3HKZG 5FJ8H 4DR4Q 4A3FG 1JJ2A 4JI2L 1OXTA 1N9WA 4NPSA 4JI0Q 5FLMH 1FJGL 4OONA 5HGQA 1E3PA 3RLFA 5C3EH 2HQLA 5GADC 2JA5H 1C0AA 4AYBG 4JC0A 3UDGA 5ELOA 2PNHA 1L0WA 3S1NH 2VUMG 3PCOB 4BY1H 1N33L 4A3IH 2A1AA 2BA0A 4HIDA 1XPOA 4A93H 2ZJRA 2GVAA 1YJWA 4EQ5A 2CKZB 4X6AH 3T1HL 1XMQQ 2UU9L 1DGSA 5AJ3Q 3K8AA 1QVFA 2XTIA 1G6PA 3ZJYC 2JJQA 4TVAB 3KYHC 4PMWA 1X65A 4DAYB 4MTNA 4NXMQ 4R4OA 3DM3A 4BXXH 2D0PA 1KQSA 1TWHH 2PQAA 2AHOB 1HNXQ 1XNRQ 1VQFA 4JI7Q 1QUQB 3CCVA 4BA2I 5IY0A 4A3EG 2Z6KA 1PFSA 4MZ9A 1VQBA 1K83H 2R92H 1Q7YC 1YI2A 1GKHA 3W1GA 5GAGC 2R93G 3TREA 1X9NA 3K7UC 1PH4A 4A3BG 3J80c 4GKJQ 3GTGH 4IOCA 2DGYA 1H95A 2EQSA 4GNXA 1LM0A 4DV5Q 1N36L 3PF5A 1SRUA 1BVSA 2IX1A 1O7IA 5IWAQ 1LYLA 4DR5L 3KJPA 2ZTDA 1SROA 3KF6A 5IP9G 2B63H 2BH2A 1IXRA 3U58A 4JI3Q 4OWTB 5C0XJ 1WYDA 2C35B 1Q82C 1IBKQ 4IPCA 5IP7G 1KRSA 4QQBX 1J5EQ 4A3CH 1JE5A 1HNWL 1X56A 2B29A 3FKIH 1EWIA 3K80C 4IPDA 1EYGA 4OX9Q 5LMUQ 3ICEA 4QGUA 3H3VI 4JYAL 1IZ6A 1VQ4A 2UXCL 2JK8A 4IPGA 1N34L 3G6EA 3JAMi 1VCIA 1OTCA 1TWCH 1PH7A 4JI2Q 4P75A 1FJGQ 2I5MX 1X6OA 1PH8A 4LF9Q 4GKKL 1AH9A 4XTCS 1VQAA 3HOXG 3CW2C 1BKBA 4DV3Q 3GDEA 1CKNB 4PZ7A 5GAHC 2NN6I 4C2MH 1GVPA 2MO1A 3HKSA 1GM5A 2Y0SE 4AQYQ 3T1HQ 3EIVA 2AWOA 4R4TA 2UU9Q 4A3DG 1CKMA 5C44G 1I3QH 5IYDH 1HR0L 4YWKA 3KFUA 4PZ6A 3K81C 3H0GH 4IO9A 2OWOA 4JBJA 1SLJA 3ULJA 1T9HA 4JI1L 4JI5L 3AQQA 1M1KC 4LUVA 2AKWB 5IYBH 4LFCQ 1XMOQ 1I50H 2N3SA 3RLOA 2NN6G 4GN5A 4IFDJ 1Y1WH 4DAMA 3T1YL 1YITA 1FVIA 4BY1G 3PIPA 2F52A 1N32L 2JEAI 4JV5L 5FLXc 1W3SA 1VQ7A 5E7NA 2Z0SA 1Z9FA 2YTYA 3OTOL 3CCSA 1A0IA 1YEZA 3K0XA 3CPFA 2E2HH 2NVQH 1NBWA 2NZOA 3NENA 1N36Q 1ASYA 3SGIA 5DLQE 4DR5Q 3GD7A 1R9TH 1PH6A 2K14A 3I4OA 1SE8A 4L5TA 4J15A 4GS3A 3EN2A 1B7YB 3MXNB 2D62A 2EIFA 2K52A 3HOYG 4GLAC 4DR1Q 4DR6Q 3F8TA 1HNWQ 4B3RL 2ZTCA 2ZM6L 2JA8G 1XJVA 4L5RC 5HY6A 4OO1I 1LUZA 1PH9A 4JYAQ 3RLNA 3A5UA 4WJ3M 1IBLL 1EQQA 4LFAL 2QA4A 4IOAA 1NY4A 3KOJA 4X66L 3PIOA 4A3KG 2UUBQ 3NBHB 1W2BA 3CXCA 2IHFA 5JJKA 4GKKQ 1L1OA 1VQOA 4A3MG 1VQ9A 3OW2A 1JB7A 4GOPA 1VQEA 3BZKA 4YWMA 4B3ML 4APVA 2UXDQ 4IPHA 2B3GA 2HIVA 4DV2L 4LFBL 1XPRA 3F2DA 2PQAB 3G48A 1I94Q 4JBMA 3UDIA 4OWWB 1PH2A 2R6GA 2KBNA 4HIMA 4HJAA 1Y14B 1K8GA 2HHHL 4JBWA 1NE3A 3CCRA 2YTVA 4GLVB 1IBML 4R4QA 4NB3A 4JI1Q 4LF5L 1WCMH 4L5SA 1RIPA 2CWPA 2BA1A 2WAQG 4A4IA 4HIOA 4A3LG 3M4PA 3HOWG 4A3GG 4A75A 1PH5A 2LXJA 2KCMA 4DV7L 4GNXB 2FXQA 3M4OH 1VQLA 4B3SQ 1N32Q 1SMXA 3JAMc 3KF6B 5C4JH 4C3IH 2OTLA 3ERSX 5BR8L 2V1CC 2Z6KC 3OTOQ 2R7ZH 4YHHQ 2YV5A 4P73A 3M9BA 1C7YA 4AIMA 1HR0W 4DV0L 4ME3A 2Q2HA 1WOCA 4XIGS 2JA6H 5M3FH 3FP9A 2PI2A 3CQZH 2E2JH 1VQCA 4DV6Q 2UUAQ 3S1MH 4X62L 1HZAA 3A74A 2VQEL 1Y1VH 4UPAA 4GNXC 4B3TQ 2F4VL 3HOVG 4KHPQ 2NVYH 4LW1A 2OCEA 5H1SE 1Y1WG 4X65L 2RCNA 4QY7A 1MJEA 1UE5A 3S17H 2YYZA 4JOIA 2H5XA 3DLLA 4DV1Q 1K8AC 3M85A 4B3RQ 2ZM6Q 2KHJA 4DV4L 2UUCL 3J81c 4P74A 5GAEC 1PA6A 4LFAQ 1IBLQ 1YZ6A 2CQOA 1GD7A 2ES2A 3KDFA 1WI5A 2RF4A 2RHQB 2QEXA 3KJOA 4LF8Q 4X66Q 1D8LA 5IYCH 1PH1A 1HJPA 1IL2A 4L5QA 1JJCB 1VQJA 3RZDH 2HIXA 3I4NH 1MJCA 1KHIA 4DUYL 1YBYA 1XNQQ 3UE1A 3GTOH 2MNAA 3I4MG 5LMNL 3OYYA 2K75A 5C4XG 2ZJQA 1V1QA 1P8LA 1GO3E 3PO3H 4DV2Q 4LFBQ 4HJ9A 3AFQA 4LUOA 1SN8A 4A3JG 3RZOH 3KF8B 2VQFL 2JA7G 3HOUG 2HHHQ 2OQ0A 1N33Q 1VQHA 1M90C 1KXLA 2NZHA 1TWGH 1HZCA 1UE7A 1C9OA 1IBMQ 2XGTA 3HOZG 4LF5Q 3M3YH 1P16A 2L15A 2JE6I 3PO2G 4BBSG 2VUMH 2MQHA 4QIWE 4KI0A 5FJ8G 4DV7Q 1JMCA 4DUZL 1E22A 5FLMG 2MFIA 2OQKA 3S1RH 1KIXA 1YJ9A 1K3RA 5C3EG 4DR2L 2Q2UA 2JA5G 4K0KL 1EQRA 1QVCA 4C3HH 1PVOA 3PUZA 1IYJB 3PSIA 4KHZA 3GTMH 1Q12A 1YVCA 3STBD 4A3IG 1VQPA 1YHAA 5M5YH 1HNZL 2DUDA 3A5ZB 4DPGA 1NJIC 3GTPH 4A93G 4OWXB 3LGJA 2ZTEA 3BU2A 4X62Q 1EIYB 2F4VQ 2AWNA 4A3EH 1D7QA 1EFWA 3GTKH 4LF4L 5C0XI 4BXXG 2R93H 4X65Q 4JI4L 1FGUA 1Z47A 1X54A 5JEAG 2Q2IA 3CAMA 3TQYA 2AMCB 4A3BH 4HJ5A 2WAQE 1L1OB 3EBEA 4DV4Q 3L2PA 1JT8A 2R92G 4GOPB 4KLKA 3GTLH 1SR3A 2JA6G 2OTJA 1NMFA 3I56A 5IP9H 1PH3A 1E1TA 4LUZA 1NMGA 2IT1A 3ULLA 3GTJH 1YIJA 3J7A5 3M7NA 4LF6L 4X64L 1A8VA 2UXCQ 5IP7H 2E8GA 1N34Q 2IY5B 1MKHA 1U0LA 4DK6C 2VS1A 5LMNQ 3CCQA 4JBKA 1L1OC 2B63G 1E1OA 3RN5A 1A63A 1KRTA 2YTXA 1XPUA 2YU9H 1VQGA 4BA1I 4GOPC 4DR3L 3HFZB 4YCVA 4JI6L 4ALPA 2K50A 1X3GA 1YHBA 2K5HA 2GVBA 4Y52H 4A3CG 4YCWA 1S3OA 3CF5A 3FKIG 3PUWA 4JI3L 4OO1G 1HZ9A 5J3BA 4OXPA 3HOXH 2E5LL 3S14H 1YJNA 3S16H 1HR0Q 1TWFH 2IHEA 2JQOA 3CPWA 2UXBL 1TXYA 5LMNW 1J5EL 3L0OA 1QZGA 4DUZQ 1PHJA 3S2DH 3S1QH 2VL6A 4JI5Q 4IFDI 5LMUL 2IX0A 4DR2Q 3PO3G 4A3DH 1I5FA 2WB1E 1WJJA 5C44H 4K0KQ 3RN2A 1VQMA 3F2BA 4RMFA 1I6HH 1FL0A 3W5OA 3T1YQ 1HNZQ 3AYHB 3S2HH 1PYSB 4LF9L 4JV5Q 3BJUA 2VW9A 1CSQA 5ELNA 4JCVE 3S15H 2VZAA 3J7ZC 1PV4A 5GROA 3Q8DA 5IYDG 4DV3L 1JJGA 4JI8L 2JEBI 2KCTA 3TRZA 3S24A 3U4VA 4HJ7A 3H0GG 4LF4Q 3ULPA 3W1BA 1WFQA 3KDFB 4O0AA 2EXDA 4H02A 1HH2P 3TEHB 4C3JH 4AQYL 4JI4Q 4IFDG 4UP9A 5IYBG 4FDBA 3U4ZA 3M4QA 1Q46A 2ASBA 4JOIC 1VQKA 3PV0A 3UDFA 3E0EA 1HZBA 3MEFA 4BY7H 1VQ5A 2HT1A 4YWLA 4LFCL 1SFOH 1XMOL 1BBWA 4LF6Q 1K0RA 4X64Q 3CCLA 3CP0A 4DR7L 3IRBA 5JEAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 C;  2RHS B;  4YY3 L;  3HOY H;  2LXK A;  3I7F A;  4NXN L;  1K9M C;  1U5K A;  2JA8 H;  3D0F A;  2WB1 G;  2NVX H;  3CCE A;  4DR3 Q;  3CC2 A;  1OXU A;  2N78 A;  4R4C A;  4POF A;  3F2C A;  4JI6 Q;  5JJI A;  3B6Y A;  4B3M Q;  3PGZ A;  4A3K H;  4YCU A;  2I0Q A;  4IJL A;  3E9H A;  2WP8 J;  5M3M H;  1QUQ A;  1A62 A;  4BBR H;  2ZJP A;  1YNX A;  1NTG A;  4A3M H;  2NVT H;  2E5L Q;  2JA9 A;  1G51 A;  1X3F A;  3PUY A;  1PYB A;  3JC6 6;  2ALY B;  4MNO A;  2GN5 A;  1KD1 C;  4A3F H;  5EAY A;  2UXB Q;  4QJF A;  1VQ6 A;  1KL9 A;  4DR1 L;  4DR6 L;  1OXV A;  1AE2 A;  3KLW A;  4UY8 C;  3CCM A;  3CC7 A;  3AFP A;  2N49 A;  3D31 A;  4PZ8 A;  4WJ4 A;  2K5V A;  4QL5 A;  2E2I H;  3FHW A;  5GQO A;  2A8V A;  1X3E A;  2A19 A;  5M5X H;  2UUB L;  4LF7 L;  4UP8 A;  1EOV A;  1G29 1;  2CFM A;  3GO5 A;  1CKO A;  1Q1B A;  2N8N A;  1Q86 C;  5BR8 Q;  2ID0 A;  4GLX A;  4A3L H;  1BBU A;  3HOW H;  1VQ8 A;  4JG2 A;  4A3G H;  1UWV A;  3STB C;  4JI8 Q;  3UE0 A;  4DR4 L;  4HJ8 A;  1CSP A;  1Q1E A;  4DNI A;  4DV0 Q;  1VS0 A;  3J81 j;  1YHQ A;  3J80 i;  4JI0 L;  3CD6 A;  2UXD L;  3GTQ H;  1Q81 C;  1B8A A;  2PI2 E;  1Q8K A;  1WCM G;  1OXS C;  2VY3 A;  1CUK A;  3F1Z A;  2I5H A;  1XTD A;  3NEM A;  2VQE Q;  4HIK A;  1K73 C;  2Q2T A;  1AE3 A;  4IJH A;  4A76 A;  1J6Q A;  1UEB A;  2KEN A;  2CWA A;  1S40 A;  4AH6 A;  1S72 A;  3J81 i;  5M5W H;  2D0O A;  4P71 A;  1XMQ L;  1I94 L;  4LNQ A;  3HOV H;  5AJ3 L;  3ER0 A;  4DKA C;  1OXX K;  4LWC A;  1CKN A;  3G71 A;  1QVG A;  2UUC Q;  2R7Z G;  2MO0 A;  4NXM L;  3BZC A;  3E9I A;  1TWA H;  4DR7 Q;  3VDY A;  2VNU D;  3HKZ E;  1ASZ A;  4B3S L;  5M3F G;  4PG3 A;  4YY3 Q;  1HNX L;  3I55 A;  4NXN Q;  3NEL A;  4JI7 L;  2QGQ A;  1XNR L;  3AEV A;  4UP7 A;  1Y1V G;  4TQU S;  1LTL A;  3WWV A;  1MIU A;  4AYB E;  4YHH L;  3RNU A;  4DUY Q;  4O2D A;  1EIF A;  1EUJ A;  1UE1 A;  5C0X G;  3CC4 A;  2CCZ A;  2ATW A;  2KHI A;  1V43 A;  4P72 A;  5JJL A;  3L7Z C;  3H15 A;  4DV6 L;  2UUA L;  2R7D A;  4BY7 G;  4GKJ L;  4KHP L;  3U50 C;  4B3T L;  1VQI A;  1X55 A;  3PUV A;  3PF4 A;  4DV5 L;  5IT9 c;  3I4M H;  2VQF Q;  2R7F A;  4GN4 B;  3CME A;  5IWA L;  5C4X H;  3K7A H;  2I5L X;  1QZH A;  1RL2 A;  2K5N A;  1L2F A;  3UDX A;  5IYC G;  4DV1 L;  1E7Z A;  2Y0S G;  3RR5 A;  3CCJ A;  4GN3 B;  1UE6 A;  1IBK L;  4POG A;  1E24 A;  4A3J H;  5K36 G;  2BH8 A;  4EX5 A;  3I4N G;  2WFW A;  2JA7 H;  3HOU H;  1B70 B;  2LSS A;  3A0J A;  4RG1 A;  5IE8 A;  3TS0 A;  4LF8 L;  3I2Z A;  4LF7 Q;  3G4S A;  3PUX A;  4R1J A;  3H3V H;  1VQN A;  3HOZ H;  1V9P A;  2F3I A;  5M3M G;  2PMZ E;  4OX9 L;  3TS2 A;  1KAW A;  1VQD A;  4BBR G;  4BBS H;  3PO2 H;  1N8R C;  3CMA A;  4R4I A;  2K4K A;  4Y7N H;  3CCU A;  4DK3 C;  1XNQ L;  3HKZ G;  5FJ8 H;  4DR4 Q;  4A3F G;  1JJ2 A;  4JI2 L;  1OXT A;  1N9W A;  4NPS A;  4JI0 Q;  5FLM H;  1FJG L;  4OON A;  5HGQ A;  1E3P A;  3RLF A;  5C3E H;  2HQL A;  5GAD C;  2JA5 H;  1C0A A;  4AYB G;  4JC0 A;  3UDG A;  5ELO A;  2PNH A;  1L0W A;  3S1N H;  2VUM G;  3PCO B;  4BY1 H;  1N33 L;  4A3I H;  2A1A A;  2BA0 A;  4HID A;  1XPO A;  4A93 H;  2ZJR A;  2GVA A;  1YJW A;  4EQ5 A;  2CKZ B;  4X6A H;  3T1H L;  1XMQ Q;  2UU9 L;  1DGS A;  5AJ3 Q;  3K8A A;  1QVF A;  2XTI A;  1G6P A;  3ZJY C;  2JJQ A;  4TVA B;  3KYH C;  4PMW A;  1X65 A;  4DAY B;  4MTN A;  4NXM Q;  4R4O A;  3DM3 A;  4BXX H;  2D0P A;  1KQS A;  1TWH H;  2PQA A;  2AHO B;  1HNX Q;  1XNR Q;  1VQF A;  4JI7 Q;  1QUQ B;  3CCV A;  4BA2 I;  5IY0 A;  4A3E G;  2Z6K A;  1PFS A;  4MZ9 A;  1VQB A;  1K83 H;  2R92 H;  1Q7Y C;  1YI2 A;  1GKH A;  3W1G A;  5GAG C;  2R93 G;  3TRE A;  1X9N A;  3K7U C;  1PH4 A;  4A3B G;  3J80 c;  4GKJ Q;  3GTG H;  4IOC A;  2DGY A;  1H95 A;  2EQS A;  4GNX A;  1LM0 A;  4DV5 Q;  1N36 L;  3PF5 A;  1SRU A;  1BVS A;  2IX1 A;  1O7I A;  5IWA Q;  1LYL A;  4DR5 L;  3KJP A;  2ZTD A;  1SRO A;  3KF6 A;  5IP9 G;  2B63 H;  2BH2 A;  1IXR A;  3U58 A;  4JI3 Q;  4OWT B;  5C0X J;  1WYD A;  2C35 B;  1Q82 C;  1IBK Q;  4IPC A;  5IP7 G;  1KRS A;  4QQB X;  1J5E Q;  4A3C H;  1JE5 A;  1HNW L;  1X56 A;  2B29 A;  3FKI H;  1EWI A;  3K80 C;  4IPD A;  1EYG A;  4OX9 Q;  5LMU Q;  3ICE A;  4QGU A;  3H3V I;  4JYA L;  1IZ6 A;  1VQ4 A;  2UXC L;  2JK8 A;  4IPG A;  1N34 L;  3G6E A;  3JAM i;  1VCI A;  1OTC A;  1TWC H;  1PH7 A;  4JI2 Q;  4P75 A;  1FJG Q;  2I5M X;  1X6O A;  1PH8 A;  4LF9 Q;  4GKK L;  1AH9 A;  4XTC S;  1VQA A;  3HOX G;  3CW2 C;  1BKB A;  4DV3 Q;  3GDE A;  1CKN B;  4PZ7 A;  5GAH C;  2NN6 I;  4C2M H;  1GVP A;  2MO1 A;  3HKS A;  1GM5 A;  2Y0S E;  4AQY Q;  3T1H Q;  3EIV A;  2AWO A;  4R4T A;  2UU9 Q;  4A3D G;  1CKM A;  5C44 G;  1I3Q H;  5IYD H;  1HR0 L;  4YWK A;  3KFU A;  4PZ6 A;  3K81 C;  3H0G H;  4IO9 A;  2OWO A;  4JBJ A;  1SLJ A;  3ULJ A;  1T9H A;  4JI1 L;  4JI5 L;  3AQQ A;  1M1K C;  4LUV A;  2AKW B;  5IYB H;  4LFC Q;  1XMO Q;  1I50 H;  2N3S A;  3RLO A;  2NN6 G;  4GN5 A;  4IFD J;  1Y1W H;  4DAM A;  3T1Y L;  1YIT A;  1FVI A;  4BY1 G;  3PIP A;  2F52 A;  1N32 L;  2JEA I;  4JV5 L;  5FLX c;  1W3S A;  1VQ7 A;  5E7N A;  2Z0S A;  1Z9F A;  2YTY A;  3OTO L;  3CCS A;  1A0I A;  1YEZ A;  3K0X A;  3CPF A;  2E2H H;  2NVQ H;  1NBW A;  2NZO A;  3NEN A;  1N36 Q;  1ASY A;  3SGI A;  5DLQ E;  4DR5 Q;  3GD7 A;  1R9T H;  1PH6 A;  2K14 A;  3I4O A;  1SE8 A;  4L5T A;  4J15 A;  4GS3 A;  3EN2 A;  1B7Y B;  3MXN B;  2D62 A;  2EIF A;  2K52 A;  3HOY G;  4GLA C;  4DR1 Q;  4DR6 Q;  3F8T A;  1HNW Q;  4B3R L;  2ZTC A;  2ZM6 L;  2JA8 G;  1XJV A;  4L5R C;  5HY6 A;  4OO1 I;  1LUZ A;  1PH9 A;  4JYA Q;  3RLN A;  3A5U A;  4WJ3 M;  1IBL L;  1EQQ A;  4LFA L;  2QA4 A;  4IOA A;  1NY4 A;  3KOJ A;  4X66 L;  3PIO A;  4A3K G;  2UUB Q;  3NBH B;  1W2B A;  3CXC A;  2IHF A;  5JJK A;  4GKK Q;  1L1O A;  1VQO A;  4A3M G;  1VQ9 A;  3OW2 A;  1JB7 A;  4GOP A;  1VQE A;  3BZK A;  4YWM A;  4B3M L;  4APV A;  2UXD Q;  4IPH A;  2B3G A;  2HIV A;  4DV2 L;  4LFB L;  1XPR A;  3F2D A;  2PQA B;  3G48 A;  1I94 Q;  4JBM A;  3UDI A;  4OWW B;  1PH2 A;  2R6G A;  2KBN A;  4HIM A;  4HJA A;  1Y14 B;  1K8G A;  2HHH L;  4JBW A;  1NE3 A;  3CCR A;  2YTV A;  4GLV B;  1IBM L;  4R4Q A;  4NB3 A;  4JI1 Q;  4LF5 L;  1WCM H;  4L5S A;  1RIP A;  2CWP A;  2BA1 A;  2WAQ G;  4A4I A;  4HIO A;  4A3L G;  3M4P A;  3HOW G;  4A3G G;  4A75 A;  1PH5 A;  2LXJ A;  2KCM A;  4DV7 L;  4GNX B;  2FXQ A;  3M4O H;  1VQL A;  4B3S Q;  1N32 Q;  1SMX A;  3JAM c;  3KF6 B;  5C4J H;  4C3I H;  2OTL A;  3ERS X;  5BR8 L;  2V1C C;  2Z6K C;  3OTO Q;  2R7Z H;  4YHH Q;  2YV5 A;  4P73 A;  3M9B A;  1C7Y A;  4AIM A;  1HR0 W;  4DV0 L;  4ME3 A;  2Q2H A;  1WOC A;  4XIG S;  2JA6 H;  5M3F H;  3FP9 A;  2PI2 A;  3CQZ H;  2E2J H;  1VQC A;  4DV6 Q;  2UUA Q;  3S1M H;  4X62 L;  1HZA A;  3A74 A;  2VQE L;  1Y1V H;  4UPA A;  4GNX C;  4B3T Q;  2F4V L;  3HOV G;  4KHP Q;  2NVY H;  4LW1 A;  2OCE A;  5H1S E;  1Y1W G;  4X65 L;  2RCN A;  4QY7 A;  1MJE A;  1UE5 A;  3S17 H;  2YYZ A;  4JOI A;  2H5X A;  3DLL A;  4DV1 Q;  1K8A C;  3M85 A;  4B3R Q;  2ZM6 Q;  2KHJ A;  4DV4 L;  2UUC L;  3J81 c;  4P74 A;  5GAE C;  1PA6 A;  4LFA Q;  1IBL Q;  1YZ6 A;  2CQO A;  1GD7 A;  2ES2 A;  3KDF A;  1WI5 A;  2RF4 A;  2RHQ B;  2QEX A;  3KJO A;  4LF8 Q;  4X66 Q;  1D8L A;  5IYC H;  1PH1 A;  1HJP A;  1IL2 A;  4L5Q A;  1JJC B;  1VQJ A;  3RZD H;  2HIX A;  3I4N H;  1MJC A;  1KHI A;  4DUY L;  1YBY A;  1XNQ Q;  3UE1 A;  3GTO H;  2MNA A;  3I4M G;  5LMN L;  3OYY A;  2K75 A;  5C4X G;  2ZJQ A;  1V1Q A;  1P8L A;  1GO3 E;  3PO3 H;  4DV2 Q;  4LFB Q;  4HJ9 A;  3AFQ A;  4LUO A;  1SN8 A;  4A3J G;  3RZO H;  3KF8 B;  2VQF L;  2JA7 G;  3HOU G;  2HHH Q;  2OQ0 A;  1N33 Q;  1VQH A;  1M90 C;  1KXL A;  2NZH A;  1TWG H;  1HZC A;  1UE7 A;  1C9O A;  1IBM Q;  2XGT A;  3HOZ G;  4LF5 Q;  3M3Y H;  1P16 A;  2L15 A;  2JE6 I;  3PO2 G;  4BBS G;  2VUM H;  2MQH A;  4QIW E;  4KI0 A;  5FJ8 G;  4DV7 Q;  1JMC A;  4DUZ L;  1E22 A;  5FLM G;  2MFI A;  2OQK A;  3S1R H;  1KIX A;  1YJ9 A;  1K3R A;  5C3E G;  4DR2 L;  2Q2U A;  2JA5 G;  4K0K L;  1EQR A;  1QVC A;  4C3H H;  1PVO A;  3PUZ A;  1IYJ B;  3PSI A;  4KHZ A;  3GTM H;  1Q12 A;  1YVC A;  3STB D;  4A3I G;  1VQP A;  1YHA A;  5M5Y H;  1HNZ L;  2DUD A;  3A5Z B;  4DPG A;  1NJI C;  3GTP H;  4A93 G;  4OWX B;  3LGJ A;  2ZTE A;  3BU2 A;  4X62 Q;  1EIY B;  2F4V Q;  2AWN A;  4A3E H;  1D7Q A;  1EFW A;  3GTK H;  4LF4 L;  5C0X I;  4BXX G;  2R93 H;  4X65 Q;  4JI4 L;  1FGU A;  1Z47 A;  1X54 A;  5JEA G;  2Q2I A;  3CAM A;  3TQY A;  2AMC B;  4A3B H;  4HJ5 A;  2WAQ E;  1L1O B;  3EBE A;  4DV4 Q;  3L2P A;  1JT8 A;  2R92 G;  4GOP B;  4KLK A;  3GTL H;  1SR3 A;  2JA6 G;  2OTJ A;  1NMF A;  3I56 A;  5IP9 H;  1PH3 A;  1E1T A;  4LUZ A;  1NMG A;  2IT1 A;  3ULL A;  3GTJ H;  1YIJ A;  3J7A 5;  3M7N A;  4LF6 L;  4X64 L;  1A8V A;  2UXC Q;  5IP7 H;  2E8G A;  1N34 Q;  2IY5 B;  1MKH A;  1U0L A;  4DK6 C;  2VS1 A;  5LMN Q;  3CCQ A;  4JBK A;  1L1O C;  2B63 G;  1E1O A;  3RN5 A;  1A63 A;  1KRT A;  2YTX A;  1XPU A;  2YU9 H;  1VQG A;  4BA1 I;  4GOP C;  4DR3 L;  3HFZ B;  4YCV A;  4JI6 L;  4ALP A;  2K50 A;  1X3G A;  1YHB A;  2K5H A;  2GVB A;  4Y52 H;  4A3C G;  4YCW A;  1S3O A;  3CF5 A;  3FKI G;  3PUW A;  4JI3 L;  4OO1 G;  1HZ9 A;  5J3B A;  4OXP A;  3HOX H;  2E5L L;  3S14 H;  1YJN A;  3S16 H;  1HR0 Q;  1TWF H;  2IHE A;  2JQO A;  3CPW A;  2UXB L;  1TXY A;  5LMN W;  1J5E L;  3L0O A;  1QZG A;  4DUZ Q;  1PHJ A;  3S2D H;  3S1Q H;  2VL6 A;  4JI5 Q;  4IFD I;  5LMU L;  2IX0 A;  4DR2 Q;  3PO3 G;  4A3D H;  1I5F A;  2WB1 E;  1WJJ A;  5C44 H;  4K0K Q;  3RN2 A;  1VQM A;  3F2B A;  4RMF A;  1I6H H;  1FL0 A;  3W5O A;  3T1Y Q;  1HNZ Q;  3AYH B;  3S2H H;  1PYS B;  4LF9 L;  4JV5 Q;  3BJU A;  2VW9 A;  1CSQ A;  5ELN A;  4JCV E;  3S15 H;  2VZA A;  3J7Z C;  1PV4 A;  5GRO A;  3Q8D A;  5IYD G;  4DV3 L;  1JJG A;  4JI8 L;  2JEB I;  2KCT A;  3TRZ A;  3S24 A;  3U4V A;  4HJ7 A;  3H0G G;  4LF4 Q;  3ULP A;  3W1B A;  1WFQ A;  3KDF B;  4O0A A;  2EXD A;  4H02 A;  1HH2 P;  3TEH B;  4C3J H;  4AQY L;  4JI4 Q;  4IFD G;  4UP9 A;  5IYB G;  4FDB A;  3U4Z A;  3M4Q A;  1Q46 A;  2ASB A;  4JOI C;  1VQK A;  3PV0 A;  3UDF A;  3E0E A;  1HZB A;  3MEF A;  4BY7 H;  1VQ5 A;  2HT1 A;  4YWL A;  4LFC L;  1SFO H;  1XMO L;  1BBW A;  4LF6 Q;  1K0R A;  4X64 Q;  3CCL A;  3CP0 A;  4DR7 L;  3IRB A;  5JEA J; 
#chains in the Genus database with same CATH topology
 1KC8 C;  4MTK A;  3M7G A;  5ISR A;  3GTP B;  3T56 B;  4DK0 A;  3D0F A;  1H9M A;  3NWS A;  3NPP A;  2RBM A;  2N78 A;  5JJI A;  4JI6 Q;  4A3K H;  2M00 A;  2I0Q A;  2J4X A;  1A62 A;  1YNX A;  1NTG A;  1EZ6 A;  1G51 A;  2O5I C;  4LJZ C;  3AMU A;  2L1B A;  2GN5 A;  1LTT D;  4BS9 A;  5EAY A;  1LT3 D;  5AFW A;  3GTL B;  2FHT A;  1KL9 A;  4IUN A;  2O5J C;  1OXV A;  2F0I A;  1AE2 A;  3KLW A;  4RCN A;  3CCM A;  3GTJ B;  1PZJ D;  2N49 A;  4FNF A;  3FHW A;  5M9O A;  5GQO A;  1X3E A;  1EY4 A;  2UUB L;  1G29 1;  1ILQ A;  2K32 A;  3GO5 A;  3T4A C;  5CV8 A;  3HOW H;  1VQ8 A;  1JOK A;  3NK9 A;  4DR4 L;  1DJR D;  4HJ8 A;  4JI0 L;  3J80 i;  5G3L F;  5C5L A;  5CV9 A;  1XYI A;  4EGV A;  3OHX C;  2PI2 E;  1D6E C;  2Q2T A;  1K73 C;  3LWE A;  1J6Q A;  1UEB A;  1VMP A;  3TDQ A;  4AH6 A;  3J81 i;  5M5W H;  3K5O A;  3S2D B;  2OXP A;  3EVQ A;  1TII D;  5AJ3 L;  3M4Y A;  2JP1 A;  1EYA A;  4DKA C;  3G71 A;  1QVG A;  4A3D B;  3E9I A;  1TWA H;  4DGZ A;  2K03 A;  1ASZ A;  1I6H B;  1HTP A;  4PG3 A;  1SE2 A;  5KNC A;  3I55 A;  3S2H B;  3NEL A;  3IFD A;  1STY A;  2QGQ A;  3G7L A;  4YHH L;  3RNU A;  3S15 B;  3N52 A;  1EUJ A;  5C0X G;  4V19 0;  4ZYS A;  2EY1 A;  4DV6 L;  4GKJ L;  3FPU B;  3MHB A;  4KHP L;  2AUK A;  3ONA B;  2VQF Q;  4QB4 A;  3CME A;  4IZ8 A;  4FF1 A;  1B44 D;  2RSN A;  2K5D A;  3WDN A;  1RL2 A;  2EJG C;  1L2F A;  4DV1 L;  2Y0S G;  4BY7 B;  2BH8 A;  4EX5 A;  2WFW A;  1B70 B;  2LSS A;  2F0H A;  2ZXR A;  4LF8 L;  3G4S A;  1Y8O B;  2FFK B;  3TS2 A;  1V9P A;  1HA6 A;  1PRT B;  1N8R C;  5COY A;  3I4N B;  2K4K A;  4QUF A;  1S5B D;  4DR4 Q;  3PIP 3;  1JJ2 A;  2E2D C;  4JI0 Q;  3K59 A;  5HGQ A;  1JOQ A;  5IGF A;  5IGE A;  1DZ1 A;  5GAD C;  2HDL A;  1C0A A;  4BBR B;  2NVT B;  2BA0 A;  1SAP A;  2LMC B;  3I8Z A;  1PRT C;  4ZLT F;  1KAB A;  1TWG B;  4EQ5 A;  5BN5 A;  3BVM A;  3TN2 A;  1DGS A;  2BE5 D;  5AJ3 Q;  2XTI A;  3ZJY C;  2IL8 A;  4PMW A;  2L11 A;  1JWM D;  4R4O A;  2E2I B;  4BXX H;  4X3K A;  3NTI A;  2EZV A;  5JEA H;  1IL8 A;  2B2T A;  3U9S A;  1PFS A;  4A3G B;  3TBI B;  1IKM A;  5E4W C;  1YI2 A;  5GAG C;  5M5Y B;  5ELD A;  3K7U C;  3GTQ B;  4GKJ Q;  3GTG H;  3A56 A;  2DGY A;  1LM0 A;  1N36 L;  1SRU A;  2PQE A;  1SRO A;  1AZP A;  5I6W A;  1EEI D;  4OWT B;  2PCF B;  2K5Q A;  4K8I A;  4JVZ A;  5HGT A;  4ZCK A;  1KDC A;  4A3C H;  1JE5 A;  4DXG A;  1HNW L;  2B29 A;  3A54 A;  4OO1 H;  1EYG A;  1K8O A;  4QGU A;  1VQ4 A;  3NSW A;  4IPG A;  4KKS A;  1N34 L;  2F4I A;  1PH7 A;  1X6O A;  4U67 3;  2F0S A;  1L0X B;  1Q8I A;  2NN6 I;  2MO1 A;  4QUC A;  2ZXP A;  1GM5 A;  2WIN B;  1EY5 A;  3KBX A;  4R4T A;  2B2W C;  4DNT B;  2X6G A;  3J7Y W;  2OWO A;  4XQJ A;  1SMY C;  1NSN S;  3MXG A;  1M1K C;  1I50 H;  2CW0 C;  3KF8 A;  2MUY A;  4GN5 A;  4DAM A;  1YIT A;  1FVI A;  4F7X A;  4H44 C;  2F52 A;  2LKV A;  1O7Z A;  2JN4 A;  2Z0S A;  4GZY C;  5C3E B;  1FR3 A;  1SE4 A;  4DK1 A;  2K1B A;  3LNN A;  1N36 Q;  2HUG A;  1XTC D;  3SGI A;  3H3V C;  4XYQ A;  1F9S A;  5EKK A;  4A93 B;  1EYD A;  1T5X D;  2ZT9 C;  4J15 A;  3EN2 A;  2A6E C;  3MXN B;  2D62 A;  4RCO A;  4ILW A;  4RKB A;  1HPC A;  1TWH B;  3F8T A;  1SYG A;  2DJG C;  1HNW Q;  2JA8 G;  1QNU A;  3KK7 A;  5HY6 A;  1PH9 A;  3RLN A;  3A5U A;  4LFA L;  3K5L A;  2QA4 A;  4IOA A;  1LV9 A;  4X66 L;  3PIO A;  1AW7 A;  1ZYR C;  2MHV A;  1W2B A;  5JJK A;  3OMC A;  1L1O A;  4ZKB B;  2OEO A;  1B53 A;  1B50 A;  4GOP A;  1VQE A;  4DU9 A;  4X3S A;  1WTQ A;  1XXG A;  4IPH A;  4F8M A;  2HIV A;  4DV2 L;  3KLS A;  1I94 Q;  1HHV A;  4OWW B;  4QF4 A;  3MXP A;  4HJA A;  1FYC A;  2YTV A;  1CA5 A;  5IIF A;  2B39 A;  1SYC A;  2BA1 A;  3FKI B;  4A4I A;  4XQN A;  4A3L G;  1TU2 B;  4K6L A;  2LXJ A;  2KCM A;  4DV7 L;  2HD3 A;  3J7A V;  3VR3 A;  1BQQ T;  3MWY W;  3KF6 B;  3ERS X;  5BR8 L;  2Z6K C;  4L6T B;  4P73 A;  1BOS A;  3GV3 A;  1C7Y A;  4DV0 L;  4XIG S;  1ZXT A;  1G8Z D;  2PI2 A;  4ZRZ A;  1ZEQ X;  2E2J H;  1HZA A;  3DHQ A;  2CH4 W;  5H1S E;  5A35 A;  1K28 A;  1H9S B;  2RCN A;  1D5M C;  1UE5 A;  4JOI A;  2H5X A;  3M85 A;  2KHJ A;  3HOV B;  3Q6S A;  3J81 c;  2UUC L;  3A55 A;  1D5Z C;  4LFA Q;  1PTO B;  2RHQ B;  3TZU A;  3KJO A;  1Y1W B;  4X66 Q;  1PH1 A;  1HJP A;  1M8A A;  2F0D A;  2R61 A;  3I4N H;  1SDF A;  1KHI A;  5A2Q E;  2NVQ B;  1PMR A;  2DNC A;  5C3X A;  1A3T A;  1FNU A;  4DV2 Q;  2PMZ B;  3S9W A;  1STN A;  2EOT A;  2JA7 G;  2BCO A;  5IOC A;  1KXL A;  1TWG H;  1SE3 A;  1UE7 A;  1U4L A;  2Q8R E;  1TY0 A;  3HOZ G;  4ZK9 B;  2L15 A;  2JE6 I;  3PO2 G;  4BBS G;  1SNC A;  4QIW E;  4DV7 Q;  1JMC A;  4N9T A;  1E22 A;  2EYJ A;  5FLM G;  2MFI A;  3S1R H;  2JA5 G;  1EQR A;  3PUZ A;  3MVV A;  2KEC A;  5KEE A;  3GTM H;  1Q12 A;  1YVC A;  4A3I G;  2PW5 A;  1VQP A;  5M5Y H;  3SK8 A;  2NZ1 D;  3LGJ A;  4YIJ A;  2ZTE A;  5CC4 A;  3C1F A;  3D8G A;  4KD3 A;  2R93 H;  3SDZ A;  4JI4 L;  1FGU A;  1QNK A;  1U4M A;  2N88 A;  4NMZ A;  3CAM A;  4A3B H;  3VA7 A;  2WAQ E;  3EBE A;  4HJ5 A;  1PYW D;  2R92 G;  1CI3 M;  1K3B C;  2EYH A;  5IP9 H;  1G2T A;  2IT1 A;  3I3C A;  5EBC A;  1EZ8 A;  2HCI A;  2JYO A;  2UXC Q;  3PQI A;  1MHW C;  3TP6 A;  2IY5 B;  3A7L A;  1MKH A;  1U0L A;  3CCQ A;  2VB3 X;  1B9N A;  5BN3 A;  1SNP A;  2YTX A;  1WTP A;  4S3S A;  4KN4 C;  4B9W A;  4KY6 A;  2K50 A;  3P75 A;  3VA5 A;  1IYV A;  2GVB A;  3A7A B;  4YCW A;  1ET9 A;  2XSC A;  1FNW A;  4KD4 A;  5KRU A;  3CF5 A;  3PUW A;  1NR2 A;  4JI3 L;  1E0B A;  1B3Q A;  3S14 H;  3S17 B;  4IN3 A;  4FXG C;  1TXY A;  5LMN W;  1PHJ A;  1RDP D;  5CGK A;  4C1N I;  1I5F A;  5C44 H;  3RN2 A;  3F2B A;  2PZW A;  3T1Y Q;  2IWH A;  4LF9 L;  3BJU A;  4LAA A;  5D3I B;  3J7Z C;  3DXJ C;  4DV3 L;  1X3P A;  4JI8 L;  3OSO A;  2KCT A;  3TRZ A;  1H9K A;  2EPB A;  2K28 A;  3H91 A;  5ELF A;  3TEH B;  3BVZ A;  4JI4 Q;  2A69 C;  4UP9 A;  1PRT D;  3KUP A;  1BBX C;  1EQV A;  2NWG A;  3MEF A;  3DWQ A;  5CV5 A;  4N8F A;  1DM0 B;  2KJX A;  3NTK A;  2RHS B;  1GUG A;  2RSO A;  2E75 C;  2XVS A;  4DAY A;  3CCE A;  3CC2 A;  4POF A;  1KDB A;  2F0U A;  3VYS A;  4B3M Q;  2NTS A;  4YCU A;  2RQX A;  5M3M H;  3SR1 A;  2ZJP A;  4A3M H;  1SYF A;  1QE6 A;  2HQE A;  2JA9 A;  1PYB A;  3JC6 6;  1I4H A;  3ERO A;  2ALY B;  1KD1 C;  4A3F H;  4DXF A;  2F0P A;  4DR1 L;  1MSG A;  3C2P A;  3CC7 A;  3AFP A;  4DF7 A;  4QL5 A;  2L5T A;  3DUZ A;  3E0J A;  2KUM A;  4XT3 B;  1SSO A;  4UP8 A;  4LF7 L;  1CFM A;  2CFM A;  4L63 B;  3I4L A;  2KEE A;  5IT9 E;  1Q86 C;  2ID0 A;  2YU9 B;  4JG2 A;  4JI8 Q;  5A2Q L;  1STG A;  3NQT A;  1U9R A;  4ZQ3 A;  1CHQ D;  1Q81 C;  1Q8K A;  2VQE Q;  1CUK A;  3NEM A;  1RJT A;  1AN8 A;  4HIK A;  3S16 B;  1AE3 A;  1TWF B;  2KEN A;  3K57 A;  1SYE A;  2D0O A;  1XMQ L;  4LNQ A;  3HOV H;  1A15 A;  1SMY D;  3ER0 A;  4KMU C;  3TP5 A;  3K5M A;  5JAV A;  4J1M A;  4OGQ C;  1PTO H;  2CW0 D;  1Z7T A;  4B3S L;  5M3F G;  5IGD A;  5L37 A;  1XNR L;  1EYC A;  3P1H A;  4UP7 A;  1Y1V G;  4AYB E;  1MIU A;  4Q5V A;  1D1I A;  2ATW A;  3D6W A;  5JJL A;  2J0T D;  2UUA L;  3NQI A;  3S1M B;  3U50 C;  4B3T L;  1X55 A;  3PUV A;  4DV5 L;  3I4M H;  2NVY B;  2R7F A;  1QZH A;  2LFN A;  1YNN C;  2A6E D;  1E7Z A;  3CCJ A;  1HFN A;  3GV6 A;  4A3J H;  5K36 G;  3SK5 A;  1TY2 A;  2Z1C A;  5CMD A;  3HOU H;  3A0J A;  5COR A;  4LF7 Q;  1VQN A;  5E1F A;  5M3M G;  4OX9 L;  1ZYR D;  3X3M A;  4BWG B;  1VQD A;  2JA8 B;  2F0Q A;  1R4Q B;  3T51 B;  3CMA A;  2NVX B;  1QIL A;  3CCU A;  1XNQ L;  3HKZ G;  5FJ8 H;  4A3F G;  4NPS A;  1N9W A;  3E6Z X;  4FXK C;  1FJG L;  1JCK B;  1HUM A;  3ND9 A;  4JC0 A;  3J7A F;  2NN6 H;  1I4P A;  3S1N H;  2VUM G;  4BY1 H;  2A1A A;  4HID A;  2QF7 A;  3BG3 A;  2ZJR A;  3KBG A;  3HS0 C;  4X6A H;  3T1H L;  1XMQ Q;  2UU9 L;  1QVF A;  4C3H G;  5DNF A;  1X65 A;  4K5V A;  5M5X B;  4K6D A;  1QB5 D;  2AHO B;  1XNR Q;  1VQF A;  1PRT F;  1QUQ B;  5IY0 A;  4RFB A;  1VQB A;  1K83 H;  3EA6 A;  1NAP A;  1WTR A;  1JR0 D;  2XIW A;  3FDT A;  1X9N A;  2CHB D;  1UEA B;  5EKI A;  1PH4 A;  3R2T A;  2WKD A;  2EQS A;  4GNX A;  4A3E B;  1XWE A;  4DV5 Q;  1K0S A;  1LT6 D;  3PF5 A;  1BVS A;  2EYF A;  2BH2 A;  3U58 A;  3MC0 B;  5C0X J;  1WYD A;  1Q82 C;  2KHS A;  1X3Q A;  5IP7 G;  1LLR D;  4QQB X;  1J5E Q;  1EWI A;  4IPD A;  4OX9 Q;  2AQ1 B;  5LMU Q;  3H3V I;  1IZ6 A;  5EJW A;  1QCB D;  3G6E A;  1OTC A;  1TWC H;  4P75 A;  1FJG Q;  4GKK L;  5J1Z A;  4XTC S;  1CZW A;  1VQA A;  5JPM C;  3HOX G;  3Q0A A;  5GAH C;  1CKN B;  1PTO D;  4MHE A;  1GVP A;  2JXM B;  4OHJ A;  1EY7 A;  2F0J A;  2EYP A;  4QMG A;  4N8X 1;  3T1H Q;  1RTN A;  3AU7 A;  2UU9 Q;  5IYD H;  1QG7 A;  2Z4I A;  1HR0 L;  4PZ6 A;  1MD2 D;  3H0G H;  3N6R A;  2JA7 B;  4JBJ A;  2BDO A;  4JI1 L;  4IFD H;  4Q0F A;  3AQQ A;  4JI5 L;  1GXD C;  2AKW B;  5T1G A;  4LFC Q;  3HOZ B;  2N3S A;  3RLO A;  4BBS B;  3PO2 B;  2NN6 G;  4IFD J;  4Y7N B;  4BY1 G;  3PIP A;  1N32 L;  4JV5 L;  4C3J G;  5IT9 L;  2YTY A;  4RHR A;  1BXT A;  1A0I A;  2JA5 B;  2EY2 A;  1ROD A;  1DOM A;  2E2H H;  1NBW A;  2NZO A;  4C56 C;  1ASY A;  4A3I B;  4MN3 A;  4H7B A;  3VR2 A;  3Q23 A;  1R9T H;  2AUJ D;  3I4O A;  4G7Z C;  1SE8 A;  4L5T A;  3CKI B;  3A8J E;  4GS3 A;  3NE5 B;  1B7Y B;  5D3D A;  1M4V A;  3JAM E;  4O42 A;  4OEL B;  2EIF A;  4K14 A;  5E4X A;  2K52 A;  4GLA C;  4JK1 C;  2ZTC A;  3BDC A;  2H4O A;  3MZ5 A;  4PNY A;  1DCZ A;  4WJ3 M;  1NY4 A;  2R92 B;  3G6J B;  2UUB Q;  4A3K G;  1FNV A;  2IHF A;  3HOY B;  3OOC A;  3SK6 A;  4GKK Q;  2F0N A;  2G9D A;  2K05 A;  1WVL A;  4XT1 B;  4HTH A;  2F0E A;  4RGO S;  3FRP B;  4LFB L;  1XPR A;  2PQA B;  3UDI A;  5DM7 3;  2R6G A;  1C8C A;  1Y14 B;  1K8G A;  4V0B A;  3CCR A;  1MGS A;  2B2U C;  1IW7 C;  1F77 A;  3CHB D;  5ELE A;  4JI1 Q;  1WCM H;  2WAQ G;  4HIO A;  3M4P A;  3W2D A;  3HOW G;  4A75 A;  3M4O H;  2CQA A;  4WOR A;  2Q8I B;  1F9R A;  1VQL A;  1N32 Q;  5HUR A;  5KND A;  2A6H C;  3A8K E;  2V1C C;  4UDU C;  2R7Z H;  4YHH Q;  4AIM A;  2JA6 H;  3WOF A;  1R4P B;  4C2M B;  5CV6 A;  4DV6 Q;  4Z9C B;  4X62 L;  3S1M H;  4U68 A;  4KHP Q;  3D4D A;  2A69 D;  2NVY H;  1I3Q B;  2K33 A;  2B8F A;  3UI2 A;  5F2D A;  1WD0 A;  5J39 A;  1GUN A;  2YYZ A;  3DLL A;  4DV1 Q;  1K8A C;  3C46 A;  4P74 A;  1WTH A;  1PA6 A;  2EYO A;  2G9H D;  1YZ6 A;  1GD7 A;  3KDF A;  1WI5 A;  2RF4 A;  4LF8 Q;  5I4D A;  5IYC H;  2ICE C;  1KDA A;  4L5Q A;  1JJC B;  5EQ0 A;  1VQJ A;  3RZD H;  1UAP A;  1MJC A;  2VXW A;  4DUY L;  1CA6 A;  4RGT A;  3OYY A;  1JB3 A;  1TQO A;  2K75 A;  1P8L A;  3PO3 H;  4LFB Q;  3AFQ A;  4LUO A;  3KLS X;  3DWA A;  1AP0 A;  1BF4 A;  5C4X B;  1C9O A;  2IPK D;  4QCL A;  5CBA E;  1P16 A;  1PTO F;  2WAC A;  2ENB A;  4RAU C;  5ELC A;  4PQX A;  1HA5 A;  1A3U A;  1PVO A;  1IYJ B;  3FMC A;  3T53 B;  4CBV A;  1LO5 D;  4DPG A;  1NJI C;  3GTP H;  1HQM C;  3TSS A;  4X62 Q;  2VB2 X;  1EIY B;  4A3E H;  1ESF A;  4LF4 L;  2I07 B;  3OWE B;  5C0X I;  4CHT B;  5LL6 X;  4BXX G;  5JEA G;  2Q2I A;  3TQY A;  2AMC B;  1U4R A;  3L2P A;  2FJ2 A;  1CM9 A;  3QOJ A;  3GTL H;  2F0M A;  2JA6 G;  3L3O C;  3I56 A;  1E1T A;  2XNA C;  3GTJ H;  3P20 A;  3M7N A;  2ZXO A;  1YNJ C;  5C4J B;  4C3I B;  1H9R A;  2EVB A;  1N34 Q;  4TKO B;  4EQP A;  2L0C A;  1E1O A;  3HZX A;  5M3F B;  1A63 A;  1XPU A;  1VQG A;  4BA1 I;  2D9U A;  4E6I A;  4KN7 C;  3HFZ B;  1Y1V B;  3EJI A;  3T16 A;  1X3G A;  1YHB A;  2K5H A;  3QJY A;  4Y52 H;  4A3C G;  2R3Z A;  5ELB A;  2B63 B;  2L55 A;  1TS2 A;  4OO1 G;  2RVL A;  4OXP A;  1YNN D;  5C5M A;  1YJN A;  3DM1 A;  1ONL A;  4K5X A;  1TR5 A;  5IGB A;  1LTA D;  1QJO A;  2JQO A;  3JAM L;  1GUW A;  3S2D H;  2DY8 A;  2VL6 A;  2A74 C;  4IFD I;  2PO4 A;  3PO3 G;  4A3D H;  4IQZ A;  1VQM A;  4RMF A;  5JVG 3;  2Z8L A;  1I6H H;  1DOL A;  3GTO B;  4KKT A;  1EL0 A;  3S2H H;  1PYS B;  1CSQ A;  5ELN A;  4JCV E;  3S15 H;  2VZA A;  1PV4 A;  3SHL A;  3RZO B;  3S24 A;  1O7L A;  4HJ7 A;  3QG1 A;  3HKZ B;  4LF4 Q;  4XQQ A;  3GP7 A;  2NTT A;  1ET6 A;  3TZD A;  4WFN 3;  3GQB A;  5LHY 1;  4AQY L;  3EQL C;  4FDB A;  3M4Q A;  2F0V A;  1VQK A;  2B2Y C;  3PV0 A;  4BY7 H;  1VQ5 A;  3ERQ A;  1LTI D;  2HT1 A;  1XMO L;  1K0R A;  4CKC A;  4RKL A;  3CP0 A;  4C3H B;  3D3R A;  1PXU A;  3QOL A;  2WII B;  5KYI A;  4YY3 L;  3HOY H;  5IOD A;  2F3W A;  2WB1 G;  2XWJ B;  1OXU A;  3F2C A;  3AB9 A;  3B6Y A;  4IJL A;  2WP8 J;  4BBR H;  2NVT H;  2EJM A;  3X3N A;  2MGS A;  4MNO A;  3RUZ A;  4QJF A;  1VQ6 A;  5DM6 3;  4DR6 L;  5C4Z A;  2Z4H A;  4PZ8 A;  2OF1 A;  3SXH A;  3C1E A;  4IUQ A;  2E2I H;  3R2I A;  3H09 A;  4IUV A;  2A19 A;  1RKN A;  1CKO A;  1EWH A;  1Q1B A;  4CJ1 B;  5BR8 Q;  1BBU A;  4A3G H;  4JPB W;  1UWV A;  3STB C;  2MJ8 A;  2N55 A;  1WD1 A;  1CSP A;  1Q1E A;  2PNR C;  4DNI A;  1VS0 A;  3J81 j;  4DV0 Q;  3OW7 A;  1YHQ A;  2UXD L;  3GTQ H;  2B8G A;  1GOZ A;  1OXS C;  2VY3 A;  3F1Z A;  3HOX B;  1FD7 D;  4IJH A;  3L9A X;  2B2W A;  2G5D A;  4ME5 A;  1A3V A;  3IKJ A;  1GUO A;  1RTO A;  2UUC Q;  4NXM L;  1PFN A;  2M2L A;  3VDY A;  2VNU D;  2P5Z X;  1PDQ A;  5CYU A;  4YY3 Q;  2A5H A;  1HNX L;  4JI7 L;  3AEV A;  3R3O A;  4TQU S;  3WWV A;  1BUV T;  3HP3 A;  1EIF A;  5EPK A;  3MAQ A;  3L7Z C;  5IGG A;  3CQZ B;  3SK4 A;  3QIA A;  2R7D A;  5IGC A;  4BY7 G;  4C3J B;  1Y8N B;  4RGN A;  4CJ0 B;  2H1E A;  5IT9 c;  4KKU A;  1XX8 A;  2PZT A;  4GN4 B;  5C4X H;  2I5L X;  2D2C C;  3UDX A;  1LTR D;  1LTS D;  3K0Y A;  1UE6 A;  1IBK L;  2X6L A;  3I4N G;  2IX3 A;  4RG1 A;  5IE8 A;  3TS0 A;  3J80 E;  3I2Z A;  1DD2 A;  3MTS A;  2K01 A;  1CQF A;  2K5W A;  3H3V H;  2Y0S B;  2B2V A;  4OL7 A;  1KAW A;  4BBR G;  3BYT B;  5EKL A;  3P7J A;  3MXN A;  1HFG A;  4QIW B;  3T13 A;  4JI2 L;  1OXT A;  3VYU A;  3J81 E;  3NWT A;  4G7H C;  1KAA A;  5C3E H;  2HQL A;  3CRL C;  3UDG A;  2PNH A;  1L0W A;  4HSP A;  1N33 L;  3EFX D;  4IUP A;  4A93 H;  1SEB D;  1YJW A;  1WTX A;  4PV1 C;  1ENA A;  1IW7 D;  1SJH D;  2RDH A;  1J9O A;  3K8A A;  1G6P A;  4NXM Q;  4MTN A;  4JW0 A;  3TP7 A;  3DM3 A;  3VR4 A;  4I65 A;  2D0P A;  1TWH H;  2J7Z A;  1HNX Q;  2F0T A;  4JI7 Q;  5KYL A;  1TS3 A;  2BOS A;  5E3F A;  3TP8 A;  4BA2 I;  4TSS A;  2Z6K A;  3HOW B;  2A6H D;  3R8B A;  1Q7Y C;  1GKH A;  2R93 G;  2QDB A;  3TRE A;  3O13 A;  4A3B G;  2F03 A;  2O4X A;  3GTK B;  2IX1 A;  1LYL A;  3KF6 A;  5IP9 G;  2B63 H;  1IXR A;  5M5W B;  3D4R A;  4JI3 Q;  1EIH A;  3MA2 B;  1IBK Q;  1V1O A;  3FEW X;  5FLX E;  4KJN A;  1KRS A;  1TWA B;  2EJF C;  3FKI H;  3E5S A;  3ICE A;  4JYA L;  1H9S A;  2JK8 A;  1WTW A;  1AFP A;  1D2B A;  1VCI A;  4JI2 Q;  4UAI A;  1QOH A;  2I5M X;  4X3T A;  4LF9 Q;  3IFT A;  1PH8 A;  5D14 A;  1VMC A;  4K2K A;  4DV3 Q;  4PZ7 A;  1H9J A;  1QWY A;  1EY9 A;  3EIV A;  2AWO A;  2NBF A;  1CKM A;  5C44 G;  1MI2 A;  5EPJ A;  4YWK A;  3KFU A;  3TME A;  3K81 C;  1I4R A;  4LUV A;  5IYB H;  2F0K A;  3BDO A;  1SNO A;  1Y1W H;  4HR7 B;  2JEA I;  1VQ7 A;  1W3S A;  5E7N A;  1Z9F A;  3CCS A;  1YEZ A;  3K0X A;  1D1K A;  3CPF A;  2A68 C;  2SNM A;  2NVQ H;  3NEN A;  4EQO A;  1FGB D;  2K14 A;  2RA4 A;  3MXU A;  1X32 A;  2PW7 A;  2Z9H A;  1KLG D;  4DR1 Q;  2BDN A;  4FP5 D;  1CZG A;  1STA A;  2EXZ A;  4B3R L;  1XJV A;  1HQR D;  4L5R C;  1RHP A;  1LUZ A;  4JYA Q;  1IBL L;  1EQQ A;  2DJF C;  1YNJ D;  1EU4 A;  3KOJ A;  4OIK A;  1STH A;  3CXC A;  1KTK A;  3CU7 A;  1SYD A;  2ICI A;  1KLU D;  4HCS A;  4A3M G;  3OW2 A;  1VDZ A;  2K04 A;  4YWM A;  3OPO A;  2QKI C;  3HRZ C;  2RDF A;  4CKB A;  4WRD A;  3MFY A;  1U4P A;  2KCN A;  3G48 A;  1CQV A;  1NNX A;  1BR9 A;  3OMG A;  2KBN A;  2HHH L;  3NBH A;  4RA8 A;  1NE3 A;  1SBB B;  1V1P A;  4NB3 A;  4L5S A;  1RIP A;  1EU3 A;  4XXE A;  2FXQ A;  2MP1 A;  4B3S Q;  3J80 L;  5DAU A;  2B2T C;  1SMX A;  1T5E A;  4I7Z C;  3JAM c;  2EYM A;  3RMH A;  3M9B A;  1HR0 W;  3NTH A;  1VF7 A;  1WOC A;  3A8I E;  3ITP A;  3CQZ H;  4CGY B;  1F9P A;  3J81 L;  1VQC A;  2UUA Q;  3HOV G;  3DWP A;  4UPA A;  4B3T Q;  1LT5 D;  5C3W A;  4LW1 A;  2OCE A;  5C0X H;  4CJ2 C;  1Y1W G;  4QY7 A;  1MJE A;  3S17 H;  4B3R Q;  2KQ3 A;  1JQY D;  1I50 B;  1IBL Q;  2CQO A;  2ES2 A;  4R8N A;  2NUC A;  1D8L A;  2TMP A;  4L8J A;  1I4X A;  1B1Z A;  1EOT A;  4ABN A;  1XNQ Q;  3UE1 A;  1WTV A;  2MNA A;  3I4M G;  5CV7 A;  1HTL D;  1GO3 E;  4HJ9 A;  5FO9 B;  1LT4 D;  4CDF C;  1SN8 A;  2WB1 B;  5JVH 3;  4A3J G;  3KF8 B;  3V2T A;  2VQF L;  3HOU G;  3OWF A;  1RCV D;  2DNE A;  2OQ0 A;  2HHH Q;  1VQH A;  4PMB A;  1M90 C;  3K7A B;  1HZC A;  1JE4 A;  2XGT A;  1D5X C;  3DEO A;  2O2L D;  2MQH A;  3IL8 A;  4KI0 A;  5FLX L;  5FJ8 G;  1GHK A;  3K6O A;  4DUZ L;  2OQK A;  4DR2 L;  5FK9 C;  4KHV A;  1HRJ A;  5EPL A;  2EE1 A;  1IKL A;  3STB D;  1HNZ L;  1YHA A;  1Q90 A;  3A5Z B;  1L0Y B;  4OWX B;  3BU2 A;  1WTO A;  1BO0 A;  2AWN A;  4KTA A;  1EFW A;  3BVG A;  3GTK H;  1HUN A;  2FMM A;  1L1O B;  1K8M A;  4GOP B;  4KLK A;  4KY7 A;  1SR3 A;  5CBE E;  4NP5 A;  2OTJ A;  1NMF A;  3R93 A;  1PH3 A;  3ULL A;  3I70 A;  4LF6 L;  2F0W A;  1A8V A;  2K6A A;  3NP8 A;  3V05 A;  2E8G A;  3MEH A;  4F88 A;  4KJO A;  1II3 A;  1L1O C;  3RN5 A;  1KRT A;  2HDM A;  3BZD B;  3VR6 A;  3URY A;  4GOP C;  2YU9 H;  2E2J B;  4DR3 L;  1I4Q A;  4LK1 C;  4ALP A;  2EYL A;  3HG9 A;  3K58 A;  1BCP B;  1HZ9 A;  3S16 H;  1VF5 C;  2E5L L;  3U9O A;  1HR0 Q;  1RD9 D;  1TWF H;  1G2S A;  2IHE A;  2UXB L;  1C4Q A;  1QZG A;  4DUZ Q;  5KIX A;  4R9W A;  4JI5 Q;  2IX0 A;  4DR2 Q;  2TSS A;  5JOB A;  1BCP C;  4DA2 A;  1FL0 A;  1EQT A;  4N9P A;  1HNZ Q;  4JV5 Q;  1S5D D;  4F87 A;  2QDL A;  1EFI D;  5GRO A;  3Q8D A;  5IYD G;  3SVM A;  5CV4 A;  2SEB D;  3H0G G;  1CT1 D;  3HEJ A;  3ULP A;  3W1B A;  1WFQ A;  1STB A;  4O0A A;  2EXD A;  4H02 A;  4ODG A;  4IFD G;  4ID6 A;  3RD4 A;  3NHH A;  2F0F A;  1STE A;  2ASB A;  4JOI C;  3DEP A;  4EQN A;  3S1R B;  2KOL A;  1BBW A;  1ICF B;  4LF6 Q;  4DR7 L;  5JEA J;  4LMQ D;  4POG A;  2JSO A;  3GTM B;  5CR3 A;  2LXK A;  3I7F A;  2GA4 B;  3QWN A;  4NXN L;  1K9M C;  1I6V C;  1U5K A;  2JA8 H;  2XN9 C;  2NVX H;  1PLF A;  4DR3 Q;  4R4C A;  2FIN B;  2QEJ C;  3PGZ A;  5LL6 S;  3E9H A;  2R93 B;  1QUQ A;  4HMJ A;  2E5L Q;  4A3B B;  1X3F A;  3PUY A;  2UXB Q;  1V8Q A;  1F2M A;  2LS0 1;  5FO8 B;  4UY8 C;  4WJ4 A;  3D31 A;  2K5V A;  3SE0 A;  2A8V A;  4IUT A;  1EY8 A;  5M5X H;  4FYD A;  2KVM A;  1EOV A;  2FMC A;  2N8N A;  4GLX A;  4A3L H;  4HED A;  3UE0 A;  2F0G A;  3CD6 A;  4RH6 A;  5I2Y A;  3BS1 A;  1B8A A;  3V96 A;  1WCM G;  1I94 L;  2I5H A;  1XTD A;  3S14 B;  1LAB A;  4G57 A;  2D5D A;  3VYR A;  4A76 A;  1PZK D;  1EY6 A;  2CWA A;  1S40 A;  1S72 A;  2Q8T A;  4P71 A;  3DMU A;  1OXX K;  4LWC A;  1CKN A;  2R7Z G;  5C44 B;  2MO0 A;  3BZC A;  4DR7 Q;  3HKZ E;  1W6J A;  2NYZ D;  4NXN Q;  1LTL A;  2CVR A;  4DUY Q;  4O2D A;  1UE1 A;  1S4Z A;  4C1N K;  3CC4 A;  2CCZ A;  2A68 D;  2KHI A;  1V43 A;  4P72 A;  3H15 A;  1BNZ A;  4DFA A;  3I72 A;  1NCV A;  1VQI A;  1EY0 A;  3PF4 A;  5IWA L;  2KA7 A;  3K7A H;  1O7Y A;  3FVQ A;  1G91 A;  2K5N A;  5EGT A;  5IYC G;  4FF2 A;  3RR5 A;  4GN3 B;  1B9M A;  1E24 A;  1NR4 A;  3PMF A;  1E2W A;  2JA7 H;  1LTG D;  2F1M A;  2B2V C;  3PUX A;  1ICW A;  2EDG A;  4R1J A;  3VYT A;  2F3I A;  3HOZ H;  2PMZ E;  3VR5 A;  4BBS H;  3PO2 H;  4R4I A;  5FO7 B;  4ULL A;  1Z6H A;  4Y7N H;  5K5P A;  4DK3 C;  1F2Z A;  1UNS A;  5FLM H;  4OON A;  1AEX A;  1E3P A;  3RLF A;  2IJ0 A;  5M3M B;  4AYB G;  2JA5 H;  3IAY A;  4A3M B;  1F9Q A;  5JJZ A;  5ELO A;  2F3V A;  1SNQ A;  3PCO B;  4A3I H;  4ZUI A;  4A3F B;  1KNE A;  1XPO A;  1GJX A;  2GVA A;  2B2U A;  2CKZ B;  3M3Y B;  2A73 B;  2JJQ A;  4TVA B;  3KYH C;  4DAY B;  2VUM B;  1A2U A;  3BDL A;  1KQS A;  1JC7 A;  4DAP A;  2L4N A;  2PQA A;  4HAE A;  1W6K A;  1MSH A;  3CCV A;  2SOB A;  1A2T A;  5FOB B;  3D4W A;  4A3E G;  4MZ9 A;  2F0L A;  2R92 H;  1DYQ A;  2HCC A;  3PIO 3;  3W1G A;  2C5C A;  3K5N A;  4KY5 A;  3H6M A;  3NBI A;  3J80 c;  4IOC A;  2K7V A;  1H95 A;  1O7I A;  3I73 A;  5IWA Q;  4DR5 L;  3KJP A;  2L9H A;  2ZTD A;  1O78 A;  2QCP X;  1AZQ A;  2QW7 A;  2AQ3 B;  2C35 B;  1S5F D;  4MIU A;  2KCC A;  4IPC A;  1JOR A;  1LTB D;  1X56 A;  3K80 C;  2UXC L;  2E76 C;  1DXM A;  2E74 C;  3JAM i;  1KNA A;  4P2C B;  3BYY B;  1AH9 A;  5EBD A;  4O1N A;  1PTO C;  3CW2 C;  1BKB A;  2LY7 A;  3GDE A;  4C2M H;  3I4M B;  3HKS A;  4RHS A;  5T1I A;  1ENF A;  3SEB A;  1TS4 A;  3W3A A;  2Y0S E;  4AQY Q;  3OIQ A;  4K5W A;  1EWC A;  4A3D G;  3CRK C;  1I3Q H;  4X3U A;  1S5E D;  3H94 A;  4IUR A;  3E3X A;  4A3J B;  4IO9 A;  2M9V A;  3HOU B;  2QIL A;  1SLJ A;  3ULJ A;  1T9H A;  3S1Q B;  1I4G A;  1XMO Q;  2X69 A;  4OIJ A;  4TRD A;  4NW2 A;  3T1Y L;  4UHV A;  5FLX c;  1JIC A;  3OTO L;  1RF2 D;  1F2Y A;  1B2T A;  1Y8P B;  1PFM A;  3LX0 A;  3S1N B;  4KK7 A;  5DLQ E;  4DR5 Q;  4H0L C;  4BY1 B;  3GD7 A;  2NB0 A;  1CK1 A;  1PH6 A;  4M8A A;  1SJE D;  4FVM A;  1SNM A;  2AQ2 B;  4NKL A;  2EY5 A;  3HOY G;  4DR6 Q;  4HCE A;  2ZM6 L;  4G7O C;  2XWB B;  4OO1 I;  1SFO B;  4H13 C;  2WKC A;  4XYO A;  3I90 A;  3FPP A;  3C3L A;  1K83 B;  1TKW B;  4RGM A;  3NBH B;  3ND8 A;  4FF3 A;  1V1P B;  1VQO A;  1VQ9 A;  1JB7 A;  1ENC A;  3BZK A;  4B3M L;  1JOO A;  4APV A;  2XRQ D;  2UXD Q;  2B3G A;  4A3K B;  1HCZ A;  1DON A;  4DNR B;  3F2D A;  4JBM A;  1B4O A;  3WOE A;  4CDC C;  1PH2 A;  4FXD A;  2DN8 A;  4HIM A;  4JBW A;  1IBM L;  4GLV B;  2RKS A;  4CDD C;  4R4Q A;  2BE5 C;  4PMC A;  4LF5 L;  1F2L A;  2CH4 A;  2CWP A;  4IUU A;  4FF4 A;  4A3G G;  4KV6 A;  1PH5 A;  4IAL A;  4GNX B;  2V4D A;  1Y69 U;  1BCP D;  1TWC B;  1OO9 B;  1CHP D;  5BN4 A;  5I9O A;  5C4J H;  4DAV A;  4C3I H;  5D65 A;  2OTL A;  3OTO Q;  2WAQ B;  2YV5 A;  4G4K A;  4ME3 A;  2Q2H A;  5NUC A;  5M3F H;  3FP9 A;  2F4V L;  3A74 A;  2VQE L;  1Y1V H;  1ML0 D;  4GNX C;  2OT2 A;  3F2U A;  2IW3 A;  1E2Z A;  1GUT A;  1CTM A;  4X65 L;  2EY6 A;  3H0G B;  1SND A;  4ZKC B;  2B2Y A;  2ZM6 Q;  1LAC A;  4DV4 L;  2RCF A;  5GAE C;  2QEX A;  1IL2 A;  1S5C D;  5K36 H;  2HIX A;  1GHJ A;  2RDG A;  1YBY A;  3GTO H;  2E2H B;  5LMN L;  5C4X G;  3KLR A;  2ZJQ A;  1V1Q A;  1R9T B;  4CKE A;  3RZO H;  1MBY A;  1N33 Q;  2SNS A;  2NZH A;  1IBM Q;  5J22 A;  2F0O A;  2MPM A;  4LF5 Q;  3M3Y H;  4B9X A;  4ZAI A;  2VUM H;  5G3L D;  1TT2 A;  2XRS D;  3MFG A;  1JWS D;  1KIX A;  1YJ9 A;  1K3R A;  5C3E G;  2Q2U A;  4K0K L;  1QVC A;  4C3H H;  3PSI A;  4KHZ A;  4RWS C;  3QO2 A;  4HSV A;  1A6X A;  2DUD A;  4K8J A;  4A93 G;  4I7A A;  4FO2 A;  2F4V Q;  4HN7 A;  4XDX A;  1D7Q A;  2SDF A;  4NDX A;  5I2X A;  5DEH A;  4B08 A;  4X65 Q;  1GUS A;  1IHZ A;  1Z47 A;  1X54 A;  5I6Y A;  4ZUJ A;  1EIG A;  4C3I G;  1TVX A;  1WCM B;  4DV4 Q;  1JT8 A;  2Z6B A;  3M4O B;  4LUZ A;  1NMG A;  1YIJ A;  3J7A 5;  4WJW A;  4X64 L;  2WV6 D;  2R7Z B;  5IP7 H;  4EVO A;  4DK6 C;  2VS1 A;  4OEM B;  5LMN Q;  3NUC A;  2JA6 B;  4JBK A;  2B63 G;  1J8I A;  5KGU A;  3GTG B;  4YCV A;  3ZYY X;  4JI6 L;  3LWU A;  3D6C A;  3QB3 A;  1SYB A;  1S3O A;  3Q22 A;  1C48 A;  3Q24 A;  3FKI G;  5J3B A;  3HOX H;  2PZU A;  5I9P A;  4K2L A;  1JWU D;  1PFB A;  4CDE C;  3CPW A;  2DY7 A;  1J5E L;  5KNB A;  3L0O A;  3S1Q H;  5LMU L;  5JPN C;  1UUP A;  4K0K Q;  1HXY D;  2WB1 E;  1WJJ A;  3RZD B;  1IYU A;  1B3A A;  4J8Q A;  4HMI A;  4DN4 M;  3W5O A;  3I91 A;  3AYH B;  3OIP A;  1DOK A;  1O80 A;  3QR8 A;  2VW9 A;  5FKA C;  1EEF D;  3PO3 B;  1ESR A;  1JJG A;  5C4H A;  1ILP A;  2JEB I;  2C9O A;  1G6Z A;  5C6A A;  4R8I A;  1BDO A;  2PYK A;  2L12 A;  3U4V A;  4M1U B;  3KDF B;  1BCP F;  1TS5 A;  1HH2 P;  2PPB C;  4C3J H;  5IYB G;  4AYB B;  2I46 A;  4J6H A;  1PZI D;  3HGB A;  3U4Z A;  1Q46 A;  5TSS A;  1E2V A;  1NUC A;  1ZKO A;  3UDF A;  3E0E A;  1HZB A;  1SXT A;  4YWL A;  4LFC L;  2KED A;  1SFO H;  4X64 Q;  3CCL A;  3NXW A;  1Q3L A;  3IRB A; 
#chains in the Genus database with same CATH homology
 1KC8 C;  2RHS B;  4YY3 L;  3HOY H;  2LXK A;  3I7F A;  4NXN L;  1K9M C;  1U5K A;  2JA8 H;  3D0F A;  2WB1 G;  2NVX H;  3CCE A;  4DR3 Q;  3CC2 A;  1OXU A;  2N78 A;  4R4C A;  4POF A;  3F2C A;  4JI6 Q;  5JJI A;  3B6Y A;  4B3M Q;  3PGZ A;  4A3K H;  4YCU A;  2I0Q A;  4IJL A;  3E9H A;  2WP8 J;  5M3M H;  1QUQ A;  1A62 A;  4BBR H;  2ZJP A;  1YNX A;  1NTG A;  4A3M H;  2NVT H;  2E5L Q;  2JA9 A;  1G51 A;  1X3F A;  3PUY A;  1PYB A;  3JC6 6;  2ALY B;  4MNO A;  2GN5 A;  1KD1 C;  4A3F H;  5EAY A;  2UXB Q;  4QJF A;  1VQ6 A;  1KL9 A;  4DR1 L;  4DR6 L;  1OXV A;  1AE2 A;  3KLW A;  4UY8 C;  3CCM A;  3CC7 A;  3AFP A;  2N49 A;  3D31 A;  4PZ8 A;  4WJ4 A;  2K5V A;  4QL5 A;  2E2I H;  3FHW A;  5GQO A;  2A8V A;  1X3E A;  2A19 A;  5M5X H;  2UUB L;  4LF7 L;  4UP8 A;  1EOV A;  1G29 1;  2CFM A;  3GO5 A;  1CKO A;  1Q1B A;  2N8N A;  1Q86 C;  5BR8 Q;  2ID0 A;  4GLX A;  4A3L H;  1BBU A;  3HOW H;  1VQ8 A;  4JG2 A;  4A3G H;  1UWV A;  3STB C;  4JI8 Q;  3UE0 A;  4DR4 L;  4HJ8 A;  1CSP A;  1Q1E A;  4DNI A;  4DV0 Q;  1VS0 A;  3J81 j;  1YHQ A;  3J80 i;  4JI0 L;  3CD6 A;  2UXD L;  3GTQ H;  1Q81 C;  1B8A A;  2PI2 E;  1Q8K A;  1WCM G;  1OXS C;  2VY3 A;  1CUK A;  3F1Z A;  2I5H A;  1XTD A;  3NEM A;  2VQE Q;  4HIK A;  1K73 C;  2Q2T A;  1AE3 A;  4IJH A;  4A76 A;  1J6Q A;  1UEB A;  2KEN A;  2CWA A;  1S40 A;  4AH6 A;  1S72 A;  3J81 i;  5M5W H;  2D0O A;  4P71 A;  1XMQ L;  1I94 L;  4LNQ A;  3HOV H;  5AJ3 L;  3ER0 A;  4DKA C;  1OXX K;  4LWC A;  1CKN A;  3G71 A;  1QVG A;  2UUC Q;  2R7Z G;  2MO0 A;  4NXM L;  3BZC A;  3E9I A;  1TWA H;  4DR7 Q;  3VDY A;  2VNU D;  3HKZ E;  1ASZ A;  4B3S L;  5M3F G;  4PG3 A;  4YY3 Q;  1HNX L;  3I55 A;  4NXN Q;  3NEL A;  4JI7 L;  2QGQ A;  1XNR L;  3AEV A;  4UP7 A;  1Y1V G;  4TQU S;  1LTL A;  3WWV A;  1MIU A;  4AYB E;  4YHH L;  3RNU A;  4DUY Q;  4O2D A;  1EIF A;  1EUJ A;  1UE1 A;  5C0X G;  3CC4 A;  2CCZ A;  2ATW A;  2KHI A;  1V43 A;  4P72 A;  5JJL A;  3L7Z C;  3H15 A;  4DV6 L;  2UUA L;  2R7D A;  4BY7 G;  4GKJ L;  4KHP L;  3U50 C;  4B3T L;  1VQI A;  1X55 A;  3PUV A;  3PF4 A;  4DV5 L;  5IT9 c;  3I4M H;  2VQF Q;  2R7F A;  4GN4 B;  3CME A;  5IWA L;  5C4X H;  3K7A H;  2I5L X;  1QZH A;  1RL2 A;  2K5N A;  1L2F A;  3UDX A;  5IYC G;  4DV1 L;  1E7Z A;  2Y0S G;  3RR5 A;  3CCJ A;  4GN3 B;  1UE6 A;  1IBK L;  4POG A;  1E24 A;  4A3J H;  5K36 G;  2BH8 A;  4EX5 A;  3I4N G;  2WFW A;  2JA7 H;  3HOU H;  1B70 B;  2LSS A;  3A0J A;  4RG1 A;  5IE8 A;  3TS0 A;  4LF8 L;  3I2Z A;  4LF7 Q;  3G4S A;  3PUX A;  4R1J A;  3H3V H;  1VQN A;  3HOZ H;  1V9P A;  2F3I A;  5M3M G;  2PMZ E;  4OX9 L;  3TS2 A;  1KAW A;  1VQD A;  4BBR G;  4BBS H;  3PO2 H;  1N8R C;  3CMA A;  4R4I A;  2K4K A;  4Y7N H;  3CCU A;  4DK3 C;  1XNQ L;  3HKZ G;  5FJ8 H;  4DR4 Q;  4A3F G;  1JJ2 A;  4JI2 L;  1OXT A;  1N9W A;  4NPS A;  4JI0 Q;  5FLM H;  1FJG L;  4OON A;  5HGQ A;  1E3P A;  3RLF A;  5C3E H;  2HQL A;  5GAD C;  2JA5 H;  1C0A A;  4AYB G;  4JC0 A;  3UDG A;  5ELO A;  2PNH A;  1L0W A;  3S1N H;  2VUM G;  3PCO B;  4BY1 H;  1N33 L;  4A3I H;  2A1A A;  2BA0 A;  4HID A;  1XPO A;  4A93 H;  2ZJR A;  2GVA A;  1YJW A;  4EQ5 A;  2CKZ B;  4X6A H;  3T1H L;  1XMQ Q;  2UU9 L;  1DGS A;  5AJ3 Q;  3K8A A;  1QVF A;  2XTI A;  1G6P A;  3ZJY C;  2JJQ A;  4TVA B;  3KYH C;  4PMW A;  1X65 A;  4DAY B;  4MTN A;  4NXM Q;  4R4O A;  3DM3 A;  4BXX H;  2D0P A;  1KQS A;  1TWH H;  2PQA A;  2AHO B;  1HNX Q;  1XNR Q;  1VQF A;  4JI7 Q;  1QUQ B;  3CCV A;  4BA2 I;  5IY0 A;  4A3E G;  2Z6K A;  1PFS A;  4MZ9 A;  1VQB A;  1K83 H;  2R92 H;  1Q7Y C;  1YI2 A;  1GKH A;  3W1G A;  5GAG C;  2R93 G;  3TRE A;  1X9N A;  3K7U C;  1PH4 A;  4A3B G;  3J80 c;  4GKJ Q;  3GTG H;  4IOC A;  2DGY A;  1H95 A;  2EQS A;  4GNX A;  1LM0 A;  4DV5 Q;  1N36 L;  3PF5 A;  1SRU A;  1BVS A;  2IX1 A;  1O7I A;  5IWA Q;  1LYL A;  4DR5 L;  3KJP A;  2ZTD A;  1SRO A;  3KF6 A;  5IP9 G;  2B63 H;  2BH2 A;  1IXR A;  3U58 A;  4JI3 Q;  4OWT B;  5C0X J;  1WYD A;  2C35 B;  1Q82 C;  1IBK Q;  4IPC A;  5IP7 G;  1KRS A;  4QQB X;  1J5E Q;  4A3C H;  1JE5 A;  1HNW L;  1X56 A;  2B29 A;  3FKI H;  1EWI A;  3K80 C;  4IPD A;  1EYG A;  4OX9 Q;  5LMU Q;  3ICE A;  4QGU A;  3H3V I;  4JYA L;  1IZ6 A;  1VQ4 A;  2UXC L;  2JK8 A;  4IPG A;  1N34 L;  3G6E A;  3JAM i;  1VCI A;  1OTC A;  1TWC H;  1PH7 A;  4JI2 Q;  4P75 A;  1FJG Q;  2I5M X;  1X6O A;  1PH8 A;  4LF9 Q;  4GKK L;  1AH9 A;  4XTC S;  1VQA A;  3HOX G;  3CW2 C;  1BKB A;  4DV3 Q;  3GDE A;  1CKN B;  4PZ7 A;  5GAH C;  2NN6 I;  4C2M H;  1GVP A;  2MO1 A;  3HKS A;  1GM5 A;  2Y0S E;  4AQY Q;  3T1H Q;  3EIV A;  2AWO A;  4R4T A;  2UU9 Q;  4A3D G;  1CKM A;  5C44 G;  1I3Q H;  5IYD H;  1HR0 L;  4YWK A;  3KFU A;  4PZ6 A;  3K81 C;  3H0G H;  4IO9 A;  2OWO A;  4JBJ A;  1SLJ A;  3ULJ A;  1T9H A;  4JI1 L;  4JI5 L;  3AQQ A;  1M1K C;  4LUV A;  2AKW B;  5IYB H;  4LFC Q;  1XMO Q;  1I50 H;  2N3S A;  3RLO A;  2NN6 G;  4GN5 A;  4IFD J;  1Y1W H;  4DAM A;  3T1Y L;  1YIT A;  1FVI A;  4BY1 G;  3PIP A;  2F52 A;  1N32 L;  2JEA I;  4JV5 L;  5FLX c;  1W3S A;  1VQ7 A;  5E7N A;  2Z0S A;  1Z9F A;  2YTY A;  3OTO L;  3CCS A;  1A0I A;  1YEZ A;  3K0X A;  3CPF A;  2E2H H;  2NVQ H;  1NBW A;  2NZO A;  3NEN A;  1N36 Q;  1ASY A;  3SGI A;  5DLQ E;  4DR5 Q;  3GD7 A;  1R9T H;  1PH6 A;  2K14 A;  3I4O A;  1SE8 A;  4L5T A;  4J15 A;  4GS3 A;  3EN2 A;  1B7Y B;  3MXN B;  2D62 A;  2EIF A;  2K52 A;  3HOY G;  4GLA C;  4DR1 Q;  4DR6 Q;  3F8T A;  1HNW Q;  4B3R L;  2ZTC A;  2ZM6 L;  2JA8 G;  1XJV A;  4L5R C;  5HY6 A;  4OO1 I;  1LUZ A;  1PH9 A;  4JYA Q;  3RLN A;  3A5U A;  4WJ3 M;  1IBL L;  1EQQ A;  4LFA L;  2QA4 A;  4IOA A;  1NY4 A;  3KOJ A;  4X66 L;  3PIO A;  4A3K G;  2UUB Q;  3NBH B;  1W2B A;  3CXC A;  2IHF A;  5JJK A;  4GKK Q;  1L1O A;  1VQO A;  4A3M G;  1VQ9 A;  3OW2 A;  1JB7 A;  4GOP A;  1VQE A;  3BZK A;  4YWM A;  4B3M L;  4APV A;  2UXD Q;  4IPH A;  2B3G A;  2HIV A;  4DV2 L;  4LFB L;  1XPR A;  3F2D A;  2PQA B;  3G48 A;  1I94 Q;  4JBM A;  3UDI A;  4OWW B;  1PH2 A;  2R6G A;  2KBN A;  4HIM A;  4HJA A;  1Y14 B;  1K8G A;  2HHH L;  4JBW A;  1NE3 A;  3CCR A;  2YTV A;  4GLV B;  1IBM L;  4R4Q A;  4NB3 A;  4JI1 Q;  4LF5 L;  1WCM H;  4L5S A;  1RIP A;  2CWP A;  2BA1 A;  2WAQ G;  4A4I A;  4HIO A;  4A3L G;  3M4P A;  3HOW G;  4A3G G;  4A75 A;  1PH5 A;  2LXJ A;  2KCM A;  4DV7 L;  4GNX B;  2FXQ A;  3M4O H;  1VQL A;  4B3S Q;  1N32 Q;  1SMX A;  3JAM c;  3KF6 B;  5C4J H;  4C3I H;  2OTL A;  3ERS X;  5BR8 L;  2V1C C;  2Z6K C;  3OTO Q;  2R7Z H;  4YHH Q;  2YV5 A;  4P73 A;  3M9B A;  1C7Y A;  4AIM A;  1HR0 W;  4DV0 L;  4ME3 A;  2Q2H A;  1WOC A;  4XIG S;  2JA6 H;  5M3F H;  3FP9 A;  2PI2 A;  3CQZ H;  2E2J H;  1VQC A;  4DV6 Q;  2UUA Q;  3S1M H;  4X62 L;  1HZA A;  3A74 A;  2VQE L;  1Y1V H;  4UPA A;  4GNX C;  4B3T Q;  2F4V L;  3HOV G;  4KHP Q;  2NVY H;  4LW1 A;  2OCE A;  5H1S E;  1Y1W G;  4X65 L;  2RCN A;  4QY7 A;  1MJE A;  1UE5 A;  3S17 H;  2YYZ A;  4JOI A;  2H5X A;  3DLL A;  4DV1 Q;  1K8A C;  3M85 A;  4B3R Q;  2ZM6 Q;  2KHJ A;  4DV4 L;  2UUC L;  3J81 c;  4P74 A;  5GAE C;  1PA6 A;  4LFA Q;  1IBL Q;  1YZ6 A;  2CQO A;  1GD7 A;  2ES2 A;  3KDF A;  1WI5 A;  2RF4 A;  2RHQ B;  2QEX A;  3KJO A;  4LF8 Q;  4X66 Q;  1D8L A;  5IYC H;  1PH1 A;  1HJP A;  1IL2 A;  4L5Q A;  1JJC B;  1VQJ A;  3RZD H;  2HIX A;  3I4N H;  1MJC A;  1KHI A;  4DUY L;  1YBY A;  1XNQ Q;  3UE1 A;  3GTO H;  2MNA A;  3I4M G;  5LMN L;  3OYY A;  2K75 A;  5C4X G;  2ZJQ A;  1V1Q A;  1P8L A;  1GO3 E;  3PO3 H;  4DV2 Q;  4LFB Q;  4HJ9 A;  3AFQ A;  4LUO A;  1SN8 A;  4A3J G;  3RZO H;  3KF8 B;  2VQF L;  2JA7 G;  3HOU G;  2HHH Q;  2OQ0 A;  1N33 Q;  1VQH A;  1M90 C;  1KXL A;  2NZH A;  1TWG H;  1HZC A;  1UE7 A;  1C9O A;  1IBM Q;  2XGT A;  3HOZ G;  4LF5 Q;  3M3Y H;  1P16 A;  2L15 A;  2JE6 I;  3PO2 G;  4BBS G;  2VUM H;  2MQH A;  4QIW E;  4KI0 A;  5FJ8 G;  4DV7 Q;  1JMC A;  4DUZ L;  1E22 A;  5FLM G;  2MFI A;  2OQK A;  3S1R H;  1KIX A;  1YJ9 A;  1K3R A;  5C3E G;  4DR2 L;  2Q2U A;  2JA5 G;  4K0K L;  1EQR A;  1QVC A;  4C3H H;  1PVO A;  3PUZ A;  1IYJ B;  3PSI A;  4KHZ A;  3GTM H;  1Q12 A;  1YVC A;  3STB D;  4A3I G;  1VQP A;  1YHA A;  5M5Y H;  1HNZ L;  2DUD A;  3A5Z B;  4DPG A;  1NJI C;  3GTP H;  4A93 G;  4OWX B;  3LGJ A;  2ZTE A;  3BU2 A;  4X62 Q;  1EIY B;  2F4V Q;  2AWN A;  4A3E H;  1D7Q A;  1EFW A;  3GTK H;  4LF4 L;  5C0X I;  4BXX G;  2R93 H;  4X65 Q;  4JI4 L;  1FGU A;  1Z47 A;  1X54 A;  5JEA G;  2Q2I A;  3CAM A;  3TQY A;  2AMC B;  4A3B H;  4HJ5 A;  2WAQ E;  1L1O B;  3EBE A;  4DV4 Q;  3L2P A;  1JT8 A;  2R92 G;  4GOP B;  4KLK A;  3GTL H;  1SR3 A;  2JA6 G;  2OTJ A;  1NMF A;  3I56 A;  5IP9 H;  1PH3 A;  1E1T A;  4LUZ A;  1NMG A;  2IT1 A;  3ULL A;  3GTJ H;  1YIJ A;  3J7A 5;  3M7N A;  4LF6 L;  4X64 L;  1A8V A;  2UXC Q;  5IP7 H;  2E8G A;  1N34 Q;  2IY5 B;  1MKH A;  1U0L A;  4DK6 C;  2VS1 A;  5LMN Q;  3CCQ A;  4JBK A;  1L1O C;  2B63 G;  1E1O A;  3RN5 A;  1A63 A;  1KRT A;  2YTX A;  1XPU A;  2YU9 H;  1VQG A;  4BA1 I;  4GOP C;  4DR3 L;  3HFZ B;  4YCV A;  4JI6 L;  4ALP A;  2K50 A;  1X3G A;  1YHB A;  2K5H A;  2GVB A;  4Y52 H;  4A3C G;  4YCW A;  1S3O A;  3CF5 A;  3FKI G;  3PUW A;  4JI3 L;  4OO1 G;  1HZ9 A;  5J3B A;  4OXP A;  3HOX H;  2E5L L;  3S14 H;  1YJN A;  3S16 H;  1HR0 Q;  1TWF H;  2IHE A;  2JQO A;  3CPW A;  2UXB L;  1TXY A;  5LMN W;  1J5E L;  3L0O A;  1QZG A;  4DUZ Q;  1PHJ A;  3S2D H;  3S1Q H;  2VL6 A;  4JI5 Q;  4IFD I;  5LMU L;  2IX0 A;  4DR2 Q;  3PO3 G;  4A3D H;  1I5F A;  2WB1 E;  1WJJ A;  5C44 H;  4K0K Q;  3RN2 A;  1VQM A;  3F2B A;  4RMF A;  1I6H H;  1FL0 A;  3W5O A;  3T1Y Q;  1HNZ Q;  3AYH B;  3S2H H;  1PYS B;  4LF9 L;  4JV5 Q;  3BJU A;  2VW9 A;  1CSQ A;  5ELN A;  4JCV E;  3S15 H;  2VZA A;  3J7Z C;  1PV4 A;  5GRO A;  3Q8D A;  5IYD G;  4DV3 L;  1JJG A;  4JI8 L;  2JEB I;  2KCT A;  3TRZ A;  3S24 A;  3U4V A;  4HJ7 A;  3H0G G;  4LF4 Q;  3ULP A;  3W1B A;  1WFQ A;  3KDF B;  4O0A A;  2EXD A;  4H02 A;  1HH2 P;  3TEH B;  4C3J H;  4AQY L;  4JI4 Q;  4IFD G;  4UP9 A;  5IYB G;  4FDB A;  3U4Z A;  3M4Q A;  1Q46 A;  2ASB A;  4JOI C;  1VQK A;  3PV0 A;  3UDF A;  3E0E A;  1HZB A;  3MEF A;  4BY7 H;  1VQ5 A;  2HT1 A;  4YWL A;  4LFC L;  1SFO H;  1XMO L;  1BBW A;  4LF6 Q;  1K0R A;  4X64 Q;  3CCL A;  3CP0 A;  4DR7 L;  3IRB A;  5JEA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...