1LT3D

Heat-labile enterotoxin double mutant n40c/g166c
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
b'APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Crystal structure of heat-labile enterotoxin from Escherichia coli with increased thermostability introduced by an engineered disulfide bond in the A subunit.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 28
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt3D00
1PTOH 1ET9A 3BVZA 1RCVD 1EEFD 1V1PA 1L0YB 1SEBD 1KTKA 3DWPA 1HQRD 4TSSA 4UDUC 1SE4A 2XN9C 1PTOF 2XRSD 4L6TB 1ESFA 1FNUA 1LTRD 1PZID 1SXTA 1QILA 1CQVA 1LTID 2ICIA 1LT6D 2CHBD 2AQ3B 1D6EC 1CHPD 1FNWA 1FD7D 1S5BD 1XXGA 1JR0D 1JCKB 1S5CD 1SE2A 1LT3D 1L0XB 2AQ1B 2IJ0A 3BYTB 1SJHD 1AN8A 5ELBA 1PRTF 5ELFA 1LLRD 2RDHA 2Z8LA 1JWSD 5TSSA 1F77A 1LT4D 1TS2A 1HA5A 1TY2A 1V1PB 1I4QA 3EFXD 4RGTA 1TY0A 5ELEA 1CT1D 1BCPF 3OWEB 1TS3A 4RGMA 1AW7A 1LTGD 4RGOS 1CK1A 1I4RA 4ZYSA 4L63B 1HTLD 1RDPD 1UUPA 4RHSA 3EA6A 1LTSD 1PYWD 1ENFA 1LO5D 1XTCD 5FK9C 4DXFA 1D5MC 1PZKD 1SJED 1UNSA 1GOZA 1BXTA 3BVGA 1M4VA 1T5XD 1B1ZA 1BCPC 1ET6A 5FKAC 4DXGA 1KLGD 1V1OA 4RH6A 3BZDB 3KLSX 2RDGA 1BCPB 1PTOC 1EWCA 3TSSA 1G8ZD 4RFBA 1D5XC 3MFGA 3GP7A 1PTOD 1DJRD 4OHJA 1LTBD 1RD9D 1TS4A 1PTOB 1CHQD 1JQYD 1LTTD 1EU4A 2QILA 3R2TA 1EU3A 1HXYD 3URYA 1KLUD 3BVMA 1PRTC 1S5ED 4RCOA 3SEBA 2SEBD 1STEA 3W2DA 3R2IA 2XNAC 1JWMD 3V05A 1I4HA 1PZJD 3BYYB 1PRTD 1FNVA 3DWQA 1LT5D 1PRTB 4RHRA 1B44D 1I4PA 5I4DA 1MD2D 1BCPD 1DYQA 5ELCA 1SE3A 1TS5A 2G9HD 2WV6D 1S5DD 4O1NA 1D5ZC 2R61A 1S5FD 1I4GA 2AQ2B 2TSSA 1SBBB 2XRQD 5ELDA 2NTTA 5D3DA 4Z9CB 2IPKD 1FGBD 4BWGB 2J4XA 2NTSA 3O13A 1LTAD 1EEID 2QEJC 3R8BA 2O2LD 1JWUD 1RF2D 3DWAA 4C56C 1I4XA 5D3IB 1EFID 3MC0B 4K6LA 3CHBD 4RGNA
chains in the Genus database with same CATH superfamily
4X64Q 1PHJA 4O2DA 4TKOB 3J80E 3H3VI 2K52A 3BVZA 4GLAC 4KHZA 5C4JH 3M7NA 2QF7A 5KEEA 1SEBD 2QDLA 2EYHA 3T13A 3M3YH 4UDUC 1VQ8A 2Q8RE 4FXKC 1STYA 1LT6D 4LF4Q 1EY7A 2KCCA 1H9MA 5IIFA 3CCLA 2HHHQ 3H15A 3CCSA 2IWHA 5IGGA 1VQ6A 2VW9A 4A4IA 3F2BA 3CXCA 3HOVB 2LXJA 3J7AV 1O7ZA 2F0DA 1C9OA 4H02A 3T1YL 1KD1C 3S1QH 4RGOS 5A2QE 3NHHA 1I4RA 3MXPA 3SE0A 4ABNA 1VQ7A 1TWFB 3A54A 4ZLTF 2L55A 2F0FA 1X3QA 1XYIA 5C5MA 1DOMA 4NP5A 2F0EA 1BXTA 2BDOA 1QE6A 3CAMA 4ZK9B 4XQJA 5LMNQ 1HTPA 5FKAC 3PO2G 1W6KA 1PH4A 3GTKB 2Z0SA 2F0QA 2I5HA 4EQ5A 2MHVA 4JG2A 5C3EG 1EWCA 1TU2B 2B2TA 5IT9L 1EYAA 4RKLA 1WTOA 3I4MH 1A2TA 1PTOB 1NMGA 3NK9A 2A69C 4DAVA 1RTNA 2UXBQ 1VQNA 1QUQB 4EQNA 4GOPA 1PH1A 3VYRA 1NE3A 2ZM6Q 2EY5A 3D4WA 3PIP3 1G2SA 1CZGA 1XWEA 2KEDA 4IJLA 1N36Q 3S14B 1PDQA 1L2FA 1AZQA 3CC2A 1Y8PB 3S15H 3I91A 5IGEA 2WAQB 4IPGA 3OIQA 1IBKL 3VR6A 4A3GB 3ICEA 5D3DA 3C46A 4BWGB 4DR7Q 2A69D 2RBMA 2KOLA 2C9OA 3FVQA 1VQCA 4IO9A 4J1MA 1EQQA 3IRBA 1SMYD 4NXNL 5C44G 4JI3Q 3H91A 3MXNB 5FOBB 4BY1H 1Z6HA 5BN5A 4OX9L 3PV0A 2K03A 2LSSA 3GTQH 5C4XG 2RDFA 3VDYA 3A55A 5EAYA 3K5MA 3KJPA 4C3JH 1JE5A 3J80i 1HJPA 1XMQQ 2Z4HA 3E9IA 4C2MB 1HZCA 4A93B 5FO8B 1HRJA 5C5LA 4JBWA 2QKIC 2LMCB 1K3RA 4B3MQ 3NQTA 1XNQL 3M4OH 4V0BA 3CCJA 1F77A 3M4YA 5M3FH 4BA2I 5AFWA 2PCFB 5EPLA 4DV3L 1EWHA 3BS1A 3I4OA 2K5QA 2Q8TA 1HZAA 2JK8A 1TWGH 4P75A 4Q5VA 1ENFA 1Y8OB 2JA7H 3J80L 3RZDB 1BBUA 4F88A 4OL7A 3TS0A 4DR3L 1HR0L 3BVGA 1BVSA 2NVYH 2ENBA 1V8QA 4NDXA 3C2PA 3I72A 2IY5B 1U4MA 1JC7A 4KJNA 2F0TA 4G7OC 1IBLL 1VQ9A 4HJ9A 1STAA 1A3VA 1OXSC 3ERSX 3FPPA 3QO2A 4DR4Q 1B70B 1TS4A 2WIIB 3KK7A 2IT1A 4OIKA 3TP8A 2HDMA 3KLSA 4UP8A 3J7YW 5EPJA 3URYA 2RF4A 1KLUD 2EE1A 3GTJB 1B53A 5IYBG 4AQYL 3L9AX 2CWPA 2A6ED 3RZOH 1PRTB 2PZTA 4C1NI 1GVPA 5KNDA 1MSGA 3AU7A 3I4LA 1DYQA 4QGUA 2A68C 3T51B 2G9HD 3PO3G 2MJ8A 5LHY1 3MWYW 4YCUA 1KNEA 3KOJA 2PPBC 2JN4A 2B63G 3OSOA 4KY5A 2IPKD 2AMCB 3D3RA 2F3VA 1IHZA 1J5EQ 2J4XA 1E2WA 2O2LD 4DGZA 1K8AC 2UUBL 4IUNA 4CKEA 1FGUA 5IP7G 5GROA 1C4QA 1IKMA 1EZ6A 2ZXPA 4CBVA 3E5SA 3PO2B 3J81c 2JE6I 1WFQA 5GAGC 2IX1A 1MI2A 4YHHL 5C3EB 1OXXK 2EYJA 1I50B 4JI7L 4LF8L 1TWCH 4X65L 4H7BA 2JEAI 2F03A 4DV1L 5E4XA 1JICA 3ZYYX 1ZXTA 3HRZC 1M1KC 1N33Q 1RHPA 5C0XH 3ULLA 1L1OB 1LLRD 1CKMA 1X65A 1A2UA 3CF5A 1V1PB 4DR2L 3SDZA 4A3DG 2CCZA 3S2HH 4DNTB 1TXYA 2K32A 3WWVA 4YY3L 2EJMA 4XIGS 3HEJA 4YWLA 3T53B 4NXML 4JYAL 3BZKA 4CDEC 4TRDA 2UU9Q 5FK9C 3I8ZA 1SJED 2PQAB 3EVQA 3UE1A 3KFUA 1Z9FA 2K28A 3T1HQ 3STBD 3T56B 4BBRG 1ILQA 4FO2A 1UAPA 3NE5B 4HJ5A 1ET6A 4K5VA 2EJFC 1BKBA 2WINB 5K5PA 2K5WA 1BCPB 1II3A 1PTOC 4LFCL 4QQBX 2EXDA 2OXPA 2JYOA 3FKIB 2M9VA 2JA5G 2N88A 2X6LA 1VMPA 1DOLA 4JC0A 4LUOA 4IURA 4JOIC 3TDQA 2YTVA 2PMZB 3QWNA 2HQLA 3HOZH 2AUKA 4BY7G 5EGTA 4POGA 4RHRA 2KENA 4DFAA 2NB0A 4B3RQ 1HNWQ 3KDFB 3OTOQ 2WV6D 4A3CG 3LWUA 1K0SA 1JJ2A 3TS2A 3HOXH 2WB1G 3H0GH 3PUVA 3A56A 1WTXA 1GM5A 2CH4A 1SDFA 3W1GA 2QEXA 3R8BA 1JWUD 4ZRZA 5T1IA 4L5TA 1Y14B 1EFID 3NBIA 4P71A 5CORA 5J39A 4QB4A 1NMFA 1Q90A 1K83H 2E74C 4Y52H 4BXXG 2PQEA 3MA2B 2R7ZH 2K01A 2PZWA 1EIFA 5DEHA 4FF4A 3K7AB 2MUYA 1XMOQ 1YHBA 5A35A 3UDFA 2N78A 4ZUIA 3A8IE 3MVVA 2JA6G 3OIPA 5IGFA 4EQOA 3M4PA 3UDXA 2F0MA 1AFPA 2ALYB 4CGYB 4QL5A 4RGMA 4UP9A 2D62A 3HOWG 3PO3B 5M3MG 4DA2A 2RHQB 4DKAC 1KIXA 1DZ1A 3BU2A 2R3ZA 1MHWC 3K0YA 1LTSD 1XTCD 3H94A 3J81i 4DV7Q 1QUQA 2DGYA 3EN2A 5LL6X 2NWGA 1B1ZA 3HP3A 4GKKL 4JOIA 2NN6G 1V1OA 4UAIA 3HKZG 1K8MA 1Z47A 3I2ZA 2PNRC 1Y1VH 1TWAB 1UE6A 1TR5A 2O4XA 1LACA 3VYSA 5C0XI 1B8AA 2BA1A 5KNCA 2G5DA 1PRTC 4N9PA 4DV4Q 2DJGC 2OF1A 2EYOA 1I5FA 2NYZD 3UDIA 2SNMA 1YHQA 1I4PA 3MXNA 5JVH3 2ZTEA 3BDCA 4G4KA 1EQVA 4KK7A 1X55A 2NUCA 1X3FA 1PH5A 4JPBW 4B3TL 1UWVA 1C0AA 2KJXA 4G7HC 3SK8A 1VQOA 4PQXA 2HIXA 1S4ZA 1VQ5A 1XPUA 3I55A 4GNXB 2K1BA 5D3IB 4PMWA 4BBRB 2EYLA 4K6LA 3IFDA 3KYHC 3I4NG 5IP9G 5FJ8G 1G6PA 4PZ7A 3HOVG 3Q24A 4WFN3 1D8LA 5IY0A 4M1UB 1L0YB 5IWAL 5CV5A 1IBMQ 1STGA 4X66Q 4GLXA 4JI2Q 5DNFA 2HCIA 3VA7A 3MEHA 4OELB 4AIMA 2JA5B 1R9TH 1O7IA 1PV4A 2LS01 3PO2H 3R93A 4KD3A 4FVMA 3S2DB 1L1OC 5E4WC 1XMOL 1FVIA 1EYGA 2F0GA 1JR0D 1SE2A 2AQ1B 1LT3D 3W3AA 1IZ6A 4HCSA 1I50H 2ZXOA 1B4OA 1LT4D 2FMMA 1J9OA 1YNND 2GN5A 2RCFA 3SR1A 4KI0A 4K0KL 2RSNA 3Q23A 4IFDI 4CHTB 3GTLB 1DGSA 2VXWA 1RDPD 2WB1B 4KKUA 4A75A 1Y1WH 1BBXC 1YNJC 2AKWB 4IUVA 4KN4C 2IHEA 1PZKD 3PUYA 2UXDL 2E2DC 1JT8A 1T5XD 1BCPC 5F2DA 3T1YQ 2UUCL 1Q3LA 4RH6A 2LFNA 2RDGA 3JAME 2VB2X 2NVQH 1ICWA 3CD6A 3GP7A 2I5MX 3OYYA 2VQEL 3CRKC 4QF4A 2I0QA 4A3GG 4CJ1B 3E3XA 3ERQA 2DY7A 2QILA 5C44H 2FFKB 1VF5C 3P7JA 4FNFA 4IUUA 2XNAC 5JEAH 2Q2UA 2R7DA 5C4XH 1SYCA 5IYDG 4CKCA 5DLQE 3E9HA 4MZ9A 4DV4L 5CV9A 4DV2L 1YJ9A 4A3KG 1BCPD 2EJGC 2OT2A 5J1ZA 1OXUA 2F4VL 2NVTB 2QDBA 1KABA 1S5FD 3TP5A 3I90A 4HJ8A 3HOWB 4CJ2C 3HOYG 3A0JA 2GVBA 1GO3E 4A93G 3VYUA 4NKLA 1AEXA 4WJWA 3S1RB 5EQ0A 1I4XA 1AE2A 3CHBD 1I6HH 1K0RA 3GO5A 1L1OA 1SFOB 1MKHA 1F9SA 1V1PA 4DV0L 3F1ZA 3HKZB 4DF7A 1VQPA 4TSSA 1IBKQ 4NB3A 1B7YB 5I6WA 2L9HA 1PTOF 3VR3A 4JCVE 3DLLA 3NEMA 4FF1A 3GTGB 4IJHA 4FXGC 2Q2TA 3M9BA 1QNKA 4NXNQ 2IX0A 3K5NA 1JCKB 5ELFA 4RKBA 4HN7A 4OX9Q 2KEEA 2Z8LA 5DM73 4JI5L 1VQKA 2SOBA 4OXPA 1J8IA 1CT1D 4QCLA 4WJ4A 3D4RA 5G3LF 3NTKA 1U9RA 4F87A 4L63B 1EY4A 2HD3A 1B9NA 3U58A 4DV5L 3J7ZC 1XNQQ 4P74A 1M4VA 1HPCA 3GQBA 1PH9A 3PO3H 4DV3Q 4OGQC 2HT1A 3I4NB 1KHIA 2MNAA 4IPCA 3KLSX 2B63H 4DR6L 3NWTA 2I46A 1EY8A 3TSSA 1WTPA 1F9RA 3PUZA 4OONA 1AE3A 3KDFA 2JQOA 2V1CC 3N6RA 3Q0AA 4K6DA 4BBSG 5GAEC 1UE1A 4I7ZC 1Q82C 5FLXE 4DR3Q 1HR0Q 2AWNA 3NXWA 3MEFA 3BVMA 5ELOA 4BA1I 4EX5A 3SK4A 3R2IA 1A3TA 4O42A 1IBLQ 3A8KE 5DM63 3RMHA 3V96A 3CU7A 1STBA 1YITA 1B44D 1IW7D 3CCRA 2E5LL 1E1TA 4JK1C 1EYCA 1WTRA 1M8AA 5K36G 4KY7A 1S5DD 4A3EB 3DEPA 1NJIC 1JB7A 4Y7NB 5IODA 5LMNW 3S1NH 3DUZA 2XWBB 4L5SA 2BDNA 1F2ZA 1SMYC 4AQYQ 4A3IH 4X3KA 4A3DH 2B2YC 3JAML 1WTHA 3I56A 1YVCA 1STNA 3AFPA 2EIFA 1ASYA 2K05A 4XYQA 1GUOA 3PSIA 4LF9L 1N32L 1CUKA 4R8NA 1SMXA 4XT3B 5M5WH 1DD2A 1EOTA 3FHWA 2FXQA 2B2WC 2K5NA 3T16A 1HQMC 5CV7A 5HGQA 5C3XA 4APVA 1SR3A 1B50A 2ICIA 4K2KA 4MIUA 4XQQA 2UUBQ 3Q6SA 2EY2A 4ZAIA 1S5BD 1YZ6A 1N9WA 3I70A 3PIOA 3GTMB 2L5TA 1PRTF 1TT2A 3CQZH 5IYCG 1W3SA 3GTPB 2WACA 4YHHQ 3PF4A 2MGSA 2DUDA 2MQHA 4ME3A 4JI7Q 4A3KB 4ZCKA 4LF8Q 4F8MA 2IX3A 4X65Q 3S1MB 1EQTA 3HZXA 3FKIG 4DV1Q 4B3SL 1WI5A 2BH2A 3HOYB 4BY7H 1E7ZA 2HIVA 2R92B 1ZEQX 3U4ZA 3PUWA 5M5YB 4OWWB 4DR2Q 3DEOA 3GTLH 4A3CH 4HMJA 4YY3Q 4R4OA 1XPRA 4HSVA 2B2UA 2PW7A 4E6IA 2HQEA 4DK0A 4NXMQ 4JYAQ 3FDTA 3GTOH 2HDLA 3PUXA 3N52A 3CPFA 4XYOA 1QB5D 2IHFA 2MO1A 2RA4A 4A3BB 4K8JA 3J81j 1VMCA 3AQQA 1PA6A 5GQOA 2SEBD 2A6EC 2E2HH 4KLKA 3V05A 1I4HA 4BXXH 3BYYB 4GNXA 2A73B 4LFCQ 1A3UA 4KKTA 1WCMB 2ES2A 2PI2E 3RLFA 1PMRA 5CBAE 5JJIA 2B2YA 5I4DA 3VR4A 1K9MC 4B9WA 1K3BC 3NQIA 5CGKA 2I5LX 4J15A 3X3MA 3EIVA 1ZKOA 3KF8B 2JA6H 1QVFA 2TMPA 3OW2A 2F1MA 4ME5A 2B2WA 5JJZA 3S24A 2F0UA 1EEID 3I3CA 4KV6A 4DUYQ 3MHBA 1BO0A 5CV4A 4HIOA 4A76A 3L0OA 3WOFA 3S16H 3MC0B 4WJ3M 2X6GA 1RIPA 1STHA 4DN4M 1PH6A 2JA8G 3PGZA 1SNPA 2K4KA 3AMUA 3HOWH 5M3MH 4GS3A 2KCNA 2KHIA 2K7VA 3DHQA 5FLXL 3GD7A 2F0LA 1HNZL 1PFSA 1UE5A 4WRDA 4HAEA 4V190 2O5JC 2F52A 4BBSB 2B39A 1ILPA 1CTMA 4HJ7A 2NN6H 3IKJA 4DR5L 2YTYA 1CHPD 1P8LA 5KGUA 2B8FA 5J22A 5TSSA 4RGTA 1WOCA 4N8X1 1VQJA 3GTGH 3F2UA 4QY7A 3D8GA 1NY4A 2DNCA 5T1GA 3TP6A 2NBFA 4IQZA 1QVCA 1SROA 1UUPA 4I65A 4OO1H 4FF2A 3DMUA 2YYZA 1GKHA 2GVAA 2ZTCA 1D5MC 3STBC 2ATWA 3HOUB 2A1AA 4JBKA 1KAAA 2DN8A 2PO4A 2L15A 4IPHA 3BJUA 1LYLA 3KBGA 2KCMA 4LMQD 2NZOA 2HCCA 2A74C 4RFBA 3EQLC 3MFGA 2EDGA 2L11A 5COYA 2E2IB 3H6MA 2NVXB 1RD9D 1TWHB 2FMCA 1NTGA 2L4NA 1B2TA 2A6HD 1SNMA 2VS1A 4LF7L 4XQNA 1VQLA 1G2TA 5IP9H 1Q46A 3HOVH 4GKKQ 2OTJA 4UP7A 4OEMB 4KTAA 1Y69U 4LF6L 2L1BA 2NZHA 2FINB 3TMEA 1ONLA 4C3HG 4C3IB 3NELA 2D5DA 5EBDA 3P75A 1EY9A 4J8QA 4H44C 1TWFH 4QIWE 4DV6L 3Q8DA 1TIID 5BN4A 1KQSA 4LFAL 4R4QA 3GTKH 5CYUA 3QOJA 4DUZL 2YV5A 1EUJA 2A19A 4KJOA 1HUMA 4DNRB 4F7XA 4RGNA 4KY6A 4DUYL 1PTOH 3ER0A 1SYEA 1HFNA 1SNCA 3T4AC 4B3TQ 1K8GA 2QGQA 1LTRD 3G7LA 3VA5A 2P5ZX 4AH6A 1I3QB 4A3MB 2QCPX 4PNYA 5BN3A 3CKIB 3S14H 1FD7D 2N3SA 1GUTA 1KRTA 5DAUA 1G91A 5IWAQ 3TREA 4BS9A 3CW2C 3CCVA 4A3GH 3NBHA 4P72A 1SSOA 2UXCL 5M3FG 2R93B 1HUNA 1HTLD 4XDXA 4U68A 3KUPA 3PF5A 1LO5D 5IYDH 1PFNA 1VQGA 2ID0A 4JI4L 4A3KH 4KHPL 1LUZA 2E75C 3VR5A 3LNNA 3ND9A 1IL2A 1CFMA 4K0KQ 2JA8B 1SN8A 3RLNA 2E2JB 3CCUA 2H5XA 2FJ2A 2RVLA 3D4DA 1D5XC 4C2MH 4A93H 2Z4IA 2AHOB 2BE5C 5C4JB 1MJEA 5I9PA 3UE0A 2Q8IB 2UXDQ 2EYMA 4IN3A 1ICFB 1LTTD 4KN7C 3K59A 3M3YB 3D6CA 1AZPA 2XWJB 5H1SE 3HKSA 5KYLA 3TZDA 3W2DA 3P1HA 1PZJD 2UUCQ 2XSCA 3A7LA 1WJJA 4MHEA 3A5UA 3OMGA 3OHXC 2VQEQ 1O78A 5ELCA 4OO1I 1B3AA 3DM3A 4FP5D 1D1IA 1NR4A 1QNUA 4CDDC 1BUVT 4I7AA 3RZDH 2MO0A 5KIXA 1NR2A 4LAAA 2BE5D 4DU9A 2KHJA 1YEZA 3S1QB 2QEJC 2AUJD 1C48A 4DV2Q 4IUTA 1NSNS 1MGSA 1X3EA 2F4VQ 1CQFA 1X56A 1SRUA 3PIPA 4A3LG 1VDZA 1JE4A 1JOKA 1SAPA 3GTJH 1VF7A 2CVRA 3H3VC 2KUMA 3BDOA 2F0IA 4LW1A 3CCMA 1LM0A 1WD1A 1E2ZA 1GHJA 3AFQA 3OOCA 4R1JA 1FNWA 2CQAA 1CI3M 4QUCA 4IALA 5E3FA 1YNNC 4DV0Q 4IOCA 1RTOA 1BF4A 4DK6C 1ASZA 1K8OA 4R8IA 1I4QA 3EFXD 4C3HB 2LKVA 2Q2IA 4CDCC 5C0XG 1ENAA 1XNRL 3TZUA 3HFZB 2RQXA 1IXRA 4DK1A 1ESRA 2IL8A 5C6AA 4GLVB 4JW0A 3S15B 2OWOA 4DXFA 1BBWA 3BZCA 4LFBL 4JI5Q 2F0KA 1EIYB 2R7FA 4FYDA 5C3EH 1C7YA 4DXGA 2PI2A 3W1BA 1A0IA 2RCNA 4ZKCB 3JAMc 1GUGA 3BZDB 4L5RC 4ZKBB 4A3EG 2DY8A 2MFIA 3KF8A 3KLWA 4DK3C 2I07B 3MFYA 4YIJA 4DR1L 4DV5Q 3A74A 5JAVA 2SNSA 4LUVA 3GTQB 3F2DA 3R2TA 5C4HA 2MPMA 2UUAL 4C3JB 3MAQA 3OW7A 5JPMC 3CCQA 1U5KA 4DR6Q 3DWQA 1SNOA 4MN3A 1PFMA 3KF6B 1MD2D 3HOZG 2PZUA 2ASBA 2EPBA 2XTIA 4EVOA 5JJKA 1QG7A 2XIWA 3GDEA 1Q7YC 4AYBB 4PV1C 3M4OB 1PLFA 1WVLA 5M3FB 2VUMG 1I4GA 1H9JA 4AYBE 4ALPA 3RN2A 1IYVA 3EBEA 4R4CA 4HIMA 1CSQA 1FGBD 3O13A 1RKNA 3HOXG 1H9KA 4RWSC 3TQYA 1RF2D 4IFDG 4GKJL 1TWGB 2E5LQ 3TN2A 3U9OA 2JA7B 4IUQA 3FKIH 4JI0L 1D2BA 4LF5L 1ZYRD 2NVYB 3DWPA 2ZJQA 4FXDA 1F2MA 2XRSD 5CMDA 4MTNA 3TBIB 3SXHA 4XT1B 4ODGA 4YWMA 3I7FA 4CJ0B 3P20A 1GJXA 1B3QA 1D6EC 2R92G 4ILWA 1WYDA 1SE8A 2VZAA 1XXGA 1VQ4A 2D0OA 4LF9Q 1N32Q 2E76C 1N34Q 2X69A 1YBYA 1G51A 4WORA 1TS3A 1X3GA 5LMUL 1HNXL 3RZOB 5CBEE 2O5IC 4A3BG 1HHVA 1EIGA 3EA6A 3NWSA 1UNSA 1FYCA 1OXTA 4HSPA 1SYGA 3W5OA 2J0TD 2EZVA 5BR8L 1WCMG 1KLGD 2OCEA 3G6EA 1GD7A 3K7AH 5FLMG 2HUGA 3RD4A 1T5EA 1GXDC 4U673 2V4DA 4B3SQ 2VQFQ 1HFGA 2CW0D 4ID6A 1WTWA 2YTXA 1CHQD 1D1KA 5FLXc 1BOSA 1Y1VG 4GN5A 2LY7A 3D31A 4OIJA 1O80A 1EU4A 5IYBH 4JBMA 2JA8H 4B9XA 1PFBA 3MZ5A 1TWCB 1H9SB 1JOQA 3ONAB 1IW7C 1V43A 1QCBD 1FNVA 4FF3A 1H95A 4QMGA 2Z6KA 5M5XB 1QOHA 3RNUA 1KC8C 1DXMA 4HCEA 3NBHB 3VR2A 1CA6A 3OPOA 4X3TA 3M85A 1RJTA 1TS5A 1FR3A 3NSWA 1EWIA 1D5ZC 3KBXA 4JI6L 3NPPA 2F0WA 4KD4A 4LK1C 1QZHA 3S2HB 1AH9A 5ELDA 4RA8A 4JV5L 2PNHA 1XPOA 2K14A 2KHSA 2MP1A 5IP7H 2H1EA 3A8JE 3G6JB 3JAMi 5JVG3 1IYJB 1LTAD 4DNIA 4A3JG 1RL2A 1FJGQ 1Q1EA 5M9OA 3CPWA 2B2UC 1TWAH 1IL8A 4A3FG 1ET9A 1VQMA 1HR0W 1DOKA 1Q1BA 3LGJA 2KECA 4K14A 1BQQT 4S3SA 2EYPA 1ESFA 1LTLA 1GUSA 2K50A 2Z1CA 2F4IA 4HJAA 1LTID 2AQ3B 2VY3A 2LXKA 4GNXC 3HOUG 1BDOA 2CH4W 1SYDA 1A6XA 4K2LA 1F2LA 4HEDA 5EJWA 1HNZQ 4K5XA 1TY0A 2B29A 5ELEA 1N34L 3HOZB 3VYTA 4UPAA 1LTGD 1QVGA 1CK1A 2G9DA 4ZYSA 4IPDA 2VUMB 1X6OA 4RHSA 4C1NK 4DR5Q 1XJVA 4BBRH 1X54A 1A62A 1GUWA 4C3HH 1M90C 3HOXB 3G48A 1Y1WG 3H0GB 2L12A 1VQDA 4H13C 4C3IG 1I94Q 1H9RA 1E3PA 3FP9A 4X62L 4RG1A 3CCEA 2JA5H 3DM1A 3GV6A 1DJRD 3S2DH 3HS0C 2WAQE 1HA6A 1K83B 3K80C 2R7ZB 1CZWA 2VQFL 1QJOA 5IE8A 3A5ZB 1STEA 2B2VC 4IUPA 5EBCA 1KL9A 1EY6A 2K5HA 2RKSA 2VNUD 2H4OA 5L37A 1MJCA 1UEAB 4X3UA 1LT5D 2XGTA 1EFWA 1IYUA 4MTKA 4JI8L 4G57A 1PXUA 3M7GA 2F0JA 5JEAG 3CC7A 1VQHA 4X64L 1MSHA 4O1NA 2Y0SB 4UHVA 3X3NA 4LF7Q 2A8VA 1GUNA 1O7YA 2Y0SE 2TSSA 1NAPA 4A3MG 4LF6Q 3K5LA 1U4PA 2VL6A 3S9WA 3BDLA 2BA0A 4LF4L 5CR3A 1Q86C 1EOVA 5I6YA 5KYIA 5HY6A 2HHHL 1FJGL 3OMCA 1O7LA 1HZ9A 4YWKA 4LJZC 4KMUC 1WTVA 2OTLA 4DV6Q 1B9MA 3E6ZX 1F2YA 5EPKA 3L2PA 1SE4A 4L6TB 4R4TA 3BG3A 3ZJYC 2YU9B 2R93G 4DAMA 2A5HA 1JOOA 1QILA 4QJFA 4LFAQ 3K57A 1XTDA 4N8FA 2K5DA 2B8GA 4DUZQ 2CHBD 1Y1VB 2C5CA 2AWOA 1Q8IA 1S40A 2CFMA 1TVXA 2F3IA 5ELBA 1G6ZA 1SJHD 3NTHA 5KNBA 2NVTH 1TS2A 4CKBA 5LMNL 2EOTA 1SNDA 1BCPF 1JJCB 3G4SA 3FPUB 3S1RH 1Q12A 1T9HA 1UEBA 3V2TA 2Q2HA 1SFOH 2F0HA 4A3JB 2UXBL 2K5VA 2ZTDA 1TKWB 2M00A 5A2QL 1U4LA 1OO9B 1YIJA 1DONA 3AB9A 2ZM6L 4DAYA 4A3FB 2UXCQ 2EQSA 2B2VA 2RHSB 3KF6A 4HIKA 1G8ZD 1N36L 1I94L 1VQBA 4OWXB 2CWAA 1FL0A 2WKDA 5GADC 2A6HC 1X9NA 3KLRA 4RMFA 4JI4Q 5I9OA 1JQYD 1W2BA 1D7QA 2K33A 4KHPQ 3Q22A 1IKLA 4J6HA 4GN4B 1HXYD 3CC4A 4O0AA 1E0BA 4NW2A 4DR7L 1R9TB 4GN3B 5CV8A 3HG9A 2CQOA 1EZ8A 4A3LH 3I73A 3K58A 1KNAA 1R4QB 4JI3L 5CC4A 1J6QA 2BCOA 2KVMA 2A68D 2D2CC 3FRPB 1QWYA 5JJLA 1F9PA 4H0LC 3MXGA 5M5XH 3DXJC 1K73C 3KJOA 3I4MG 1A63A 3ITPA 3MXUA 3I4NH 5FJ8H 1XMQL 1HZBA 1E1OA 1Y1WB 3C1EA 4A3IG 1SNQA 2Z6BA 1CKNA 4KKSA 4B3ML 1RCVD 1AP0A 5FO9B 3J81E 5D14A 1SLJA 4QIWB 1KTKA 3QOLA 3PMFA 3U50C 5CV6A 3C3LA 3K0XA 4K5WA 1VQAA 3QB3A 1FNUA 2ZT9C 1SXTA 3G71A 2NVQB 2E8GA 3QIAA 4HTHA 4R9WA 1PH8A 5C4ZA 3BYTB 2IJ0A 1NCVA 3EROA 4A3EH 3K7UC 5C44B 5ELNA 2ZXRA 4XTCS 4Y7NH 3MTSA 3OWEB 1AW7A 2WFWA 2F3WA 5C4XB 2DJFC 3K5OA 1V1QA 1PH3A 2N8NA 2L0CA 1PVOA 4BY1G 1JB3A 1BNZA 1VCIA 5J3BA 4DR4L 1NNXA 3J7AF 4C3JG 5C0XJ 2OQ0A 2PMZE 3NP8A 2CKZB 4EGVA 1H9SA 2QW7A 4GZYC 5EKKA 4EQPA 1YJWA 1C8CA 1XNRQ 3R3OA 2GA4B 1Y8NB 3TEHB 2VUMH 2JJQA 3F2CA 1HCZA 1TQOA 1VQEA 1YHAA 4AYBG 1I6HB 1PTOD 4OHJA 1LTBD 1CA5A 5EKIA 3FEWX 5I2YA 4IFDH 4HIDA 3HGBA 3GTMH 4LFBQ 1A15A 5HURA 3GTPH 3RUZA 3WDNA 4QUFA 3U4VA 1PH7A 2BOSA 4OWTB 1J5EL 4P73A 2C35B 3RN5A 2KA7A 2JA7G 1WD0A 3S1MH 2JSOA 1MIUA 3WOEA 1UE7A 3H09A 3S17B 5EKLA 1SE3A 5G3LD 3HOYH 4NMZA 4DR1Q 1JMCA 2F0OA 2R92H 3NENA 2NN6I 1I6VC 2SDFA 3PIO3 5M5YH 1NBWA 1SBBB 2UUAQ 4YCWA 5AJ3Q 1SYBA 2DNEA 4GOPB 1EY5A 2NTSA 1E2VA 5IGBA 2ZJRA 1S72A 2RSOA 2WKCA 4ZQ3A 1E24A 1V9PA 4K8IA 1N33L 1EEFD 3SK5A 4YCVA 4A3BH 1EY0A 1JORA 1EQRA 3IFTA 3CRLC 5IGCA 2B63B 4JVZA 4IFDJ 3K8AA 1X3PA 4B08A 2VB3X 3QR8A 4GKJQ 1WCMH 1KAWA 1OTCA 4TQUS 2QA4A 3TP7A 1W6JA 5FLMH 1S5CD 2F0SA 2UU9L 1L0XB 1P16A 4JI0Q 2M2LA 4LF5Q 2RDHA 4RAUC 2EYFA 3T1HL 2YU9H 1HA5A 3E0EA 3ULPA 3IAYA 4PMBA 4JI1Q 1CM9A 2ZJPA 4L8JA 1ML0D 2JEBI 3FMCA 4JBJA 5D65A 1E22A 2IW3A 1PYWD 1L0WA 1SYFA 2FHTA 3NUCA 3I4MB 1N8RC 3J81L 4OO1G 1KDBA 1GHKA 3S1NB 2R6GA 4Q0FA 5LMUQ 1HNXQ 4A3IB 1EIHA 4A3DB 4BBSH 2KQ3A 2K04A 1OXVA 2WP8J 1CSPA 1XX8A 3D6WA 4LNQA 2XVSA 4A3JH 3H3VH 3GV3A 4B3RL 4DAPA 1HNWL 1DCZA 3OTOL 3CMAA 5FO7B 5NUCA 5M5WB 4X6AH 1F9QA 4ULLA 4A3FH 4X3SA 1S5ED 4RCOA 1VQIA 5BR8Q 1X32A 2N49A 3F8TA 4IZ8A 5HGTA 1Q81C 1LABA 1PRTD 2K6AA 2ICEC 1Q8KA 1ENCA 2JXMB 5K36H 2OEOA 5KRUA 1KDCA 2KCTA 3M4QA 2EXZA 1G291 4FDBA 3AEVA 3CQZB 4UY8C 3HOUH 5IGDA 3UDGA 2BH8A 3PQIA 4BY1B 1Z7TA 5IT9c 4Z9CB 5LL6S 3SGIA 4POFA 3B6YA 5GAHC 2JP1A 3RR5A 5AJ3L 2K75A 1PYBA 3DWAA 3PCOB 4R4IA 2F0NA 3LX0A 5ISRA 1YJNA 4BY7B 4KHVA 2E2IH 3K6OA 2NVXH 1U4RA 1TWHH 1ZYRC 4DAYB 1A8VA 3NTIA 1NUCA 2D9UA 3D0FA 4JI6Q 1MBYA 1HQRD 4ZUJA 5E7NA 2D0PA 1RODA 2XN9C 1PH2A 4JV5Q 1S3OA 1PZID 1YI2A 1CQVA 2EY6A 1KDAA 3L7ZC 2WB1E 3IL8A 1WTQA 4XXEA 3GTOB 1JJGA 5IT9E 3J7A5 2PW5A 1VQFA 4C3IH 3TRZA 5IYCH 2Z6KC 3SVMA 2OQKA 3CMEA 3H0GG 4DV7L 1AN8A 1EL0A 1JWSD 5E1FA 1TY2A 3ND8A 2E2HB 3LWEA 2WAQG 4M8AA 3ULJA 3JC66 4TVAB 4DPGA 1CKOA 4JI1L 2F0VA 2R7ZG 1VS0A 1QZGA 1YNJD 1GOZA 3UI2A 2PYKA 2JA6B 1KXLA 3U9SA 3CP0A 5JOBA 4PZ8A 1KRSA 1CKNB 4PMCA 4N9TA 3K81C 1U0LA 4G7ZC 1I3QH 3QJYA 4LUZA 3QG1A 3S16B 2EY1A 2CW0C 3A7AB 4A3MH 5IOCA 2Y0SG 4NPSA 4P2CB 5M3MB 3C1FA 3EJIA 1HH2P 4MNOA 4HR7B 1LV9A 1K28A 4RCNA 4HMIA 1EU3A 2Z9HA 1BR9A 2N55A 2KBNA 3SEBA 4L5QA 4IOAA 1JWMD 4PZ6A 1R4PB 4CDFC 3J80c 3SK6A 4LWCA 1DM0B 2B2TC 4X62Q 2EVBA 2R93H 2NZ1D 3HKZE 2F0PA 3SHLA 1PYSB 5I2XA 2R61A 5JPNC 1EYDA 4GOPC 2J7ZA 2B3GA 5C3WA 4PG3A 2AQ2B 1IBML 2XRQD 3RLOA 4X66L 2NTTA 4JI2L 2JA9A 3L3OC 2PQAA 5JEAJ 2E2JH 3AYHB 3S17H 4JI8Q 4C56C 3OWFA 3E0JA 1YNXA
chains in the Genus database with same CATH topology
4TKOB 3J80E 3BVZA 4KHZA 3M7NA 2QF7A 5KEEA 1SEBD 2EYHA 3T13A 4UDUC 2Q8RE 4FXKC 1STYA 1LT6D 1EY7A 2KCCA 1H9MA 5IIFA 2IWHA 5IGGA 3HOVB 3J7AV 1O7ZA 2F0DA 4RGOS 5A2QE 3NHHA 1I4RA 3MXPA 3SE0A 4ABNA 1TWFB 3A54A 4ZLTF 2L55A 2F0FA 1X3QA 1XYIA 5C5MA 1DOMA 4NP5A 2F0EA 1BXTA 2BDOA 1QE6A 4ZK9B 4XQJA 1HTPA 5FKAC 1W6KA 3GTKB 2F0QA 2MHVA 1EWCA 1TU2B 2B2TA 5IT9L 1EYAA 4RKLA 1WTOA 1A2TA 1PTOB 3NK9A 2A69C 4DAVA 1RTNA 4EQNA 3VYRA 2EY5A 3D4WA 3PIP3 1G2SA 1CZGA 1XWEA 2KEDA 3S14B 1PDQA 1AZQA 1Y8PB 3I91A 5IGEA 2WAQB 3OIQA 3VR6A 4A3GB 5D3DA 3C46A 4BWGB 2A69D 2RBMA 2KOLA 2C9OA 3FVQA 4J1MA 1SMYD 3H91A 5FOBB 1Z6HA 5BN5A 3PV0A 2K03A 2RDFA 3A55A 3K5MA 2Z4HA 4C2MB 4A93B 5FO8B 1HRJA 5C5LA 4JBWA 2QKIC 2LMCB 3NQTA 4V0BA 1F77A 3M4YA 4BA2I 5AFWA 2PCFB 5EPLA 1EWHA 3BS1A 2K5QA 2Q8TA 4Q5VA 1ENFA 1Y8OB 3J80L 3RZDB 4F88A 4OL7A 3BVGA 2ENBA 1V8QA 4NDXA 3C2PA 3I72A 1U4MA 1JC7A 4KJNA 2F0TA 4G7OC 1STAA 1A3VA 1OXSC 3FPPA 3QO2A 1TS4A 2WIIB 3KK7A 2IT1A 4OIKA 3TP8A 2HDMA 3KLSA 3J7YW 5EPJA 3URYA 1KLUD 2EE1A 3GTJB 1B53A 3L9AX 2A6ED 1PRTB 2PZTA 4C1NI 5KNDA 1MSGA 3AU7A 3I4LA 1DYQA 2A68C 3T51B 2G9HD 2MJ8A 5LHY1 3MWYW 1KNEA 2PPBC 3OSOA 4KY5A 2IPKD 2F3VA 3D3RA 1IHZA 2J4XA 1E2WA 2O2LD 4DGZA 4IUNA 4CKEA 1C4QA 1IKMA 1EZ6A 2ZXPA 4CBVA 3E5SA 3PO2B 2JE6I 2IX1A 1MI2A 5C3EB 1OXXK 2EYJA 1I50B 4H7BA 2JEAI 2F03A 5E4XA 1JICA 3ZYYX 1ZXTA 3HRZC 1RHPA 5C0XH 1LLRD 1A2UA 1V1PB 3SDZA 4DNTB 2K32A 2EJMA 4XIGS 3HEJA 3T53B 4TRDA 5FK9C 3I8ZA 1SJED 3EVQA 2K28A 3T56B 1ILQA 4FO2A 1UAPA 3NE5B 1ET6A 4K5VA 2EJFC 2WINB 5K5PA 2K5WA 1BCPB 1II3A 1PTOC 2OXPA 2JYOA 3FKIB 2M9VA 2N88A 2X6LA 1VMPA 1DOLA 4IURA 3TDQA 2PMZB 3QWNA 2AUKA 5EGTA 4RHRA 4DFAA 2NB0A 2WV6D 3LWUA 3PUVA 3A56A 1WTXA 1SDFA 3R8BA 1JWUD 4ZRZA 5T1IA 1EFID 3NBIA 5CORA 5J39A 4QB4A 1Q90A 2E74C 2PQEA 3MA2B 2K01A 2PZWA 5DEHA 4FF4A 3K7AB 2MUYA 5A35A 4ZUIA 3A8IE 3MVVA 3OIPA 5IGFA 4EQOA 2F0MA 1AFPA 4CGYB 4RGMA 2D62A 3PO3B 4DA2A 1DZ1A 2R3ZA 3K0YA 1LTSD 1XTCD 3H94A 5LL6X 2NWGA 1B1ZA 3HP3A 2NN6G 1V1OA 4UAIA 1K8MA 1Z47A 2PNRC 1TWAB 1TR5A 2O4XA 1LACA 3VYSA 5C0XI 2BA1A 5KNCA 4N9PA 1PRTC 2OF1A 2EYOA 2NYZD 2SNMA 1I4PA 3MXNA 5JVH3 3BDCA 4G4KA 1EQVA 4KK7A 2NUCA 2KJXA 4G7HC 3SK8A 4PQXA 1S4ZA 2K1BA 5D3IB 4PMWA 4BBRB 2EYLA 4K6LA 3IFDA 3Q24A 4WFN3 4M1UB 1L0YB 5CV5A 1STGA 5DNFA 2HCIA 3VA7A 3MEHA 2JA5B 2LS01 3R93A 4KD3A 4FVMA 3S2DB 5E4WC 2F0GA 1JR0D 1SE2A 2AQ1B 1LT3D 3W3AA 4HCSA 2ZXOA 1B4OA 1LT4D 2FMMA 1J9OA 1YNND 3SR1A 4KI0A 2RSNA 3Q23A 4IFDI 4CHTB 3GTLB 2VXWA 1RDPD 2WB1B 4KKUA 1BBXC 1YNJC 4IUVA 4KN4C 1PZKD 3PUYA 2E2DC 1T5XD 1BCPC 5F2DA 1Q3LA 4RH6A 2LFNA 2RDGA 3JAME 2VB2X 1ICWA 3GP7A 3CRKC 4QF4A 4CJ1B 3ERQA 2DY7A 2QILA 2FFKB 1VF5C 3P7JA 4FNFA 4IUUA 2XNAC 5JEAH 1SYCA 4CKCA 5CV9A 1BCPD 2EJGC 2OT2A 5J1ZA 1OXUA 2NVTB 2QDBA 1KABA 1S5FD 3TP5A 3I90A 3HOWB 4CJ2C 3VYUA 4NKLA 1AEXA 4WJWA 3S1RB 5EQ0A 1I4XA 3CHBD 3GO5A 1SFOB 1F9SA 1V1PA 3HKZB 4DF7A 4TSSA 5I6WA 2L9HA 1PTOF 3VR3A 4FF1A 3GTGB 4FXGC 1QNKA 2IX0A 3K5NA 1JCKB 5ELFA 4RKBA 4HN7A 2KEEA 2Z8LA 5DM73 2SOBA 1J8IA 1CT1D 4QCLA 3D4RA 5G3LF 3NTKA 1U9RA 4F87A 4L63B 1EY4A 1B9NA 1M4VA 1HPCA 3GQBA 4OGQC 3I4NB 3KLSX 3NWTA 2I46A 1EY8A 3TSSA 1WTPA 1F9RA 3PUZA 3N6RA 3Q0AA 4K6DA 4I7ZC 5FLXE 2AWNA 3NXWA 3BVMA 4BA1I 3SK4A 3R2IA 1A3TA 4O42A 3A8KE 5DM63 3RMHA 3V96A 3CU7A 1STBA 1B44D 1IW7D 4JK1C 1EYCA 1WTRA 1M8AA 5K36G 4KY7A 1S5DD 4A3EB 3DEPA 4Y7NB 5IODA 3DUZA 2XWBB 2BDNA 1F2ZA 1SMYC 4X3KA 2B2YC 3JAML 1STNA 2K05A 4XYQA 1GUOA 4R8NA 4XT3B 1DD2A 1EOTA 2B2WC 3T16A 1HQMC 5CV7A 5C3XA 1B50A 2ICIA 4K2KA 4MIUA 4XQQA 3Q6SA 2EY2A 4ZAIA 1S5BD 3I70A 3GTMB 2L5TA 1PRTF 1TT2A 3GTPB 2WACA 2MGSA 4A3KB 4F8MA 2IX3A 3S1MB 1EQTA 3HZXA 3HOYB 2R92B 1ZEQX 3PUWA 5M5YB 3DEOA 4HMJA 4HSVA 2B2UA 2PW7A 4E6IA 2HQEA 4DK0A 3FDTA 2HDLA 3PUXA 3N52A 4XYOA 1QB5D 2RA4A 4A3BB 4K8JA 1VMCA 2SEBD 2A6EC 3V05A 1I4HA 3BYYB 2A73B 1A3UA 4KKTA 1WCMB 3RLFA 1PMRA 5CBAE 2B2YA 5I4DA 3VR4A 4B9WA 3NQIA 5CGKA 3X3MA 1ZKOA 2TMPA 2F1MA 4ME5A 2B2WA 5JJZA 2F0UA 1EEID 3I3CA 4KV6A 3MHBA 1BO0A 5CV4A 3WOFA 3MC0B 2X6GA 1STHA 4DN4M 1SNPA 3AMUA 2KCNA 2K7VA 3DHQA 5FLXL 3GD7A 2F0LA 4WRDA 4HAEA 4V190 2O5JC 4BBSB 2B39A 1ILPA 1CTMA 2NN6H 3IKJA 1CHPD 5KGUA 2B8FA 5J22A 5TSSA 4RGTA 3F2UA 3D8GA 2DNCA 5T1GA 3TP6A 2NBFA 4IQZA 1UUPA 4I65A 4OO1H 4FF2A 3DMUA 2YYZA 1D5MC 3HOUB 1KAAA 2DN8A 2PO4A 3KBGA 4LMQD 2HCCA 2A74C 4RFBA 3EQLC 3MFGA 2EDGA 2L11A 5COYA 2E2IB 3H6MA 2NVXB 1RD9D 1TWHB 2FMCA 2L4NA 1B2TA 2A6HD 1SNMA 4XQNA 1G2TA 4KTAA 1Y69U 2L1BA 2FINB 3TMEA 1ONLA 4C3HG 4C3IB 2D5DA 5EBDA 3P75A 1EY9A 4J8QA 4H44C 1TIID 5BN4A 5CYUA 3QOJA 4KJOA 1HUMA 4F7XA 4DNRB 4RGNA 4KY6A 1PTOH 1SYEA 1HFNA 1SNCA 3T4AC 1LTRD 3G7LA 3VA5A 1I3QB 4A3MB 2QCPX 4PNYA 5BN3A 3CKIB 1FD7D 1GUTA 5DAUA 1G91A 4BS9A 3NBHA 1SSOA 2R93B 1HUNA 1HTLD 4XDXA 4U68A 3KUPA 1LO5D 1PFNA 2ID0A 2E75C 3VR5A 3LNNA 3ND9A 1CFMA 2JA8B 2E2JB 2FJ2A 2RVLA 3D4DA 1D5XC 2Z4IA 2BE5C 5C4JB 5I9PA 2Q8IB 2EYMA 4IN3A 4KN7C 1LTTD 3K59A 3M3YB 3D6CA 1AZPA 2XWJB 5KYLA 3TZDA 3W2DA 3P1HA 1PZJD 2XSCA 3A7LA 4MHEA 3OMGA 3OHXC 1O78A 5ELCA 4OO1I 1B3AA 4FP5D 1D1IA 1NR4A 1QNUA 1BUVT 5KIXA 1NR2A 4LAAA 2BE5D 4DU9A 3S1QB 2QEJC 2AUJD 1C48A 4IUTA 1NSNS 1MGSA 1CQFA 1VDZA 1JE4A 1JOKA 1SAPA 1VF7A 2CVRA 3H3VC 2KUMA 3BDOA 2F0IA 1WD1A 1E2ZA 1GHJA 3OOCA 1FNWA 2CQAA 1CI3M 4QUCA 4IALA 5E3FA 1YNNC 1BF4A 1RTOA 1K8OA 4R8IA 1I4QA 3EFXD 4C3HB 2LKVA 5C0XG 1ENAA 3TZUA 2RQXA 4DK1A 1ESRA 2IL8A 5C6AA 3S15B 4DXFA 2F0KA 4FYDA 4DXGA 4ZKCB 1GUGA 3BZDB 4ZKBB 2DY8A 3KF8A 2I07B 3MFYA 4YIJA 5JAVA 2SNSA 3GTQB 3R2TA 5C4HA 2MPMA 4C3JB 3MAQA 3OW7A 5JPMC 3DWQA 1SNOA 4MN3A 1PFMA 1MD2D 2PZUA 2EPBA 4EVOA 1QG7A 2XIWA 4AYBB 4PV1C 3M4OB 1PLFA 1WVLA 5M3FB 1I4GA 1H9JA 1IYVA 1FGBD 3O13A 1RKNA 1H9KA 4RWSC 1RF2D 4IFDG 1TWGB 3TN2A 3U9OA 2JA7B 4IUQA 1D2BA 1ZYRD 2NVYB 3DWPA 4FXDA 1F2MA 2XRSD 5CMDA 3TBIB 3SXHA 4XT1B 4ODGA 4CJ0B 3P20A 1GJXA 1D6EC 4ILWA 1XXGA 2E76C 2X69A 4WORA 1TS3A 3RZOB 5CBEE 2O5IC 1HHVA 1EIGA 3EA6A 3NWSA 1UNSA 1FYCA 1OXTA 4HSPA 1SYGA 2J0TD 2EZVA 1KLGD 2HUGA 3RD4A 1T5EA 1GXDC 4U673 2V4DA 1HFGA 2CW0D 4ID6A 1WTWA 1CHQD 1D1KA 1BOSA 2LY7A 3D31A 4OIJA 1O80A 1EU4A 4B9XA 1PFBA 3MZ5A 1TWCB 1H9SB 1JOQA 3ONAB 1IW7C 1V43A 1QCBD 1FNVA 4FF3A 4QMGA 5M5XB 1QOHA 1DXMA 4HCEA 3VR2A 1CA6A 3OPOA 4X3TA 3M85A 1RJTA 1TS5A 1FR3A 3NSWA 3KBXA 1D5ZC 3NPPA 2F0WA 4KD4A 4LK1C 3S2HB 5ELDA 4RA8A 2KHSA 2MP1A 2H1EA 3A8JE 3G6JB 5JVG3 1LTAD 1Q1EA 5M9OA 2B2UC 1IL8A 1ET9A 1DOKA 1Q1BA 4K14A 2KECA 1BQQT 4S3SA 2EYPA 1ESFA 1GUSA 2Z1CA 2F4IA 1LTID 2AQ3B 1BDOA 1SYDA 1A6XA 4K2LA 1F2LA 4HEDA 5EJWA 4K5XA 1TY0A 5ELEA 3HOZB 3VYTA 1LTGD 1CK1A 2G9DA 4ZYSA 2VUMB 4RHSA 4C1NK 1GUWA 3HOXB 3H0GB 2L12A 4H13C 4C3IG 1H9RA 3DM1A 3GV6A 1DJRD 3HS0C 1HA6A 1K83B 2R7ZB 1CZWA 1QJOA 1STEA 2B2VC 4IUPA 5EBCA 2VNUD 1EY6A 2RKSA 2H4OA 1UEAB 4X3UA 1LT5D 1IYUA 4G57A 1PXUA 3M7GA 2F0JA 5JEAG 1MSHA 4O1NA 2Y0SB 3X3NA 1GUNA 1O7YA 2TSSA 1NAPA 3K5LA 1U4PA 3S9WA 3BDLA 2BA0A 5CR3A 5I6YA 5KYIA 3OMCA 1O7LA 4LJZC 4KMUC 1WTVA 1B9MA 3E6ZX 1F2YA 5EPKA 1SE4A 4L6TB 3BG3A 2YU9B 2A5HA 1JOOA 1QILA 3K57A 2K5DA 2B8GA 2CHBD 1Y1VB 2C5CA 2AWOA 1Q8IA 1TVXA 5ELBA 1G6ZA 1SJHD 3NTHA 5KNBA 1TS2A 4CKBA 2EOTA 1SNDA 1BCPF 3FPUB 1Q12A 3V2TA 2F0HA 4A3JB 1TKWB 2M00A 5A2QL 1U4LA 1OO9B 1DONA 3AB9A 4DAYA 4A3FB 2B2VA 1G8ZD 2WKDA 2A6HC 3KLRA 5I9OA 1JQYD 2K33A 3Q22A 1IKLA 4J6HA 1HXYD 1E0BA 4NW2A 1R9TB 5CV8A 3HG9A 1EZ8A 3I73A 3K58A 1KNAA 1R4QB 5CC4A 2BCOA 2KVMA 2A68D 2D2CC 3FRPB 1QWYA 1F9PA 4H0LC 3MXGA 3DXJC 3ITPA 3MXUA 1Y1WB 3C1EA 1SNQA 4KKSA 1AP0A 1RCVD 5FO9B 3J81E 5D14A 4QIWB 1KTKA 3QOLA 3PMFA 5CV6A 3C3LA 4K5WA 3QB3A 1FNUA 2ZT9C 1SXTA 2NVQB 3QIAA 4HTHA 4R9WA 5C4ZA 3BYTB 2IJ0A 1NCVA 3EROA 5C44B 2ZXRA 4XTCS 3MTSA 3OWEB 1AW7A 2F3WA 5C4XB 3K5OA 2L0CA 1BNZA 1JB3A 1VCIA 3J7AF 4C3JG 5C0XJ 3NP8A 4EGVA 1H9SA 4GZYC 5EKKA 4EQPA 1C8CA 3R3OA 2GA4B 1Y8NB 1HCZA 1TQOA 1I6HB 1PTOD 4OHJA 1LTBD 1CA5A 5EKIA 3FEWX 5I2YA 4IFDH 3HGBA 1A15A 5HURA 3RUZA 3WDNA 4QUFA 2BOSA 2KA7A 1WD0A 2JSOA 3WOEA 3H09A 3S17B 5EKLA 1SE3A 5G3LD 4NMZA 2F0OA 2NN6I 1I6VC 2SDFA 3PIO3 1SBBB 1SYBA 2DNEA 1EY5A 2NTSA 1E2VA 5IGBA 2RSOA 2WKCA 4ZQ3A 4K8IA 1EEFD 3SK5A 1EY0A 1JORA 3IFTA 3CRLC 5IGCA 2B63B 4IFDJ 1X3PA 4B08A 2VB3X 4TQUS 3TP7A 1W6JA 1S5CD 2F0SA 1L0XB 2M2LA 2RDHA 4RAUC 2EYFA 1HA5A 3IAYA 4PMBA 1CM9A 4L8JA 1ML0D 2JEBI 3FMCA 5D65A 2IW3A 1PYWD 1SYFA 2FHTA 3NUCA 3I4MB 3J81L 4OO1G 1KDBA 1GHKA 3S1NB 2R6GA 4Q0FA 4A3IB 1EIHA 4A3DB 2KQ3A 2K04A 1OXVA 2WP8J 1XX8A 3D6WA 2XVSA 3GV3A 4DAPA 1DCZA 5FO7B 5NUCA 5M5WB 1F9QA 4ULLA 4X3SA 1S5ED 4RCOA 1X32A 4IZ8A 5HGTA 1LABA 1PRTD 2K6AA 2ICEC 5K36H 1ENCA 2JXMB 2OEOA 5KRUA 1KDCA 2EXZA 1G291 3CQZB 5IGDA 4BY1B 1Z7TA 4Z9CB 5LL6S 2JP1A 3DWAA 2F0NA 3LX0A 5ISRA 4BY7B 4KHVA 3K6OA 1U4RA 1ZYRC 3NTIA 1NUCA 2D9UA 1MBYA 1HQRD 4ZUJA 1RODA 2XN9C 1PZID 1CQVA 2EY6A 1KDAA 3L7ZC 3IL8A 1WTQA 4XXEA 3GTOB 5IT9E 2PW5A 3SVMA 1AN8A 1EL0A 1JWSD 5E1FA 1TY2A 3ND8A 2E2HB 3LWEA 4M8AA 2F0VA 1YNJD 1GOZA 3UI2A 2PYKA 2JA6B 3U9SA 5JOBA 4PMCA 4N9TA 4G7ZC 3QJYA 3QG1A 3S16B 2EY1A 2CW0C 3A7AB 5IOCA 4P2CB 5M3MB 3C1FA 3EJIA 4HR7B 1LV9A 4RCNA 4HMIA 1EU3A 1BR9A 2N55A 3SEBA 1JWMD 1R4PB 3SK6A 1DM0B 2B2TC 2EVBA 2NZ1D 2F0PA 3SHLA 5I2XA 2R61A 5JPNC 1EYDA 2J7ZA 5C3WA 2AQ2B 2XRQD 2NTTA 3L3OC 5JEAJ 4C56C 3OWFA 3E0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PTO H;  1ET9 A;  3BVZ A;  1RCV D;  1EEF D;  1V1P A;  1L0Y B;  1SEB D;  1KTK A;  3DWP A;  1HQR D;  4TSS A;  4UDU C;  1SE4 A;  2XN9 C;  1PTO F;  2XRS D;  4L6T B;  1ESF A;  1FNU A;  1LTR D;  1PZI D;  1SXT A;  1QIL A;  1CQV A;  1LTI D;  2ICI A;  1LT6 D;  2CHB D;  2AQ3 B;  1D6E C;  1CHP D;  1FNW A;  1FD7 D;  1S5B D;  1XXG A;  1JR0 D;  1JCK B;  1S5C D;  1SE2 A;  1LT3 D;  1L0X B;  2AQ1 B;  2IJ0 A;  3BYT B;  1SJH D;  1AN8 A;  5ELB A;  1PRT F;  5ELF A;  1LLR D;  2RDH A;  2Z8L A;  1JWS D;  5TSS A;  1F77 A;  1LT4 D;  1TS2 A;  1HA5 A;  1TY2 A;  1V1P B;  1I4Q A;  3EFX D;  4RGT A;  1TY0 A;  5ELE A;  1CT1 D;  1BCP F;  3OWE B;  1TS3 A;  4RGM A;  1AW7 A;  1LTG D;  4RGO S;  1CK1 A;  1I4R A;  4ZYS A;  4L63 B;  1HTL D;  1RDP D;  1UUP A;  4RHS A;  3EA6 A;  1LTS D;  1PYW D;  1ENF A;  1LO5 D;  1XTC D;  5FK9 C;  4DXF A;  1D5M C;  1PZK D;  1SJE D;  1UNS A;  1GOZ A;  1BXT A;  3BVG A;  1M4V A;  1T5X D;  1B1Z A;  1BCP C;  1ET6 A;  5FKA C;  4DXG A;  1KLG D;  1V1O A;  4RH6 A;  3BZD B;  3KLS X;  2RDG A;  1BCP B;  1PTO C;  1EWC A;  3TSS A;  1G8Z D;  4RFB A;  1D5X C;  3MFG A;  3GP7 A;  1PTO D;  1DJR D;  4OHJ A;  1LTB D;  1RD9 D;  1TS4 A;  1PTO B;  1CHQ D;  1JQY D;  1LTT D;  1EU4 A;  2QIL A;  3R2T A;  1EU3 A;  1HXY D;  3URY A;  1KLU D;  3BVM A;  1PRT C;  1S5E D;  4RCO A;  3SEB A;  2SEB D;  1STE A;  3W2D A;  3R2I A;  2XNA C;  1JWM D;  3V05 A;  1I4H A;  1PZJ D;  3BYY B;  1PRT D;  1FNV A;  3DWQ A;  1LT5 D;  1PRT B;  4RHR A;  1B44 D;  1I4P A;  5I4D A;  1MD2 D;  1BCP D;  1DYQ A;  5ELC A;  1SE3 A;  1TS5 A;  2G9H D;  2WV6 D;  1S5D D;  4O1N A;  1D5Z C;  2R61 A;  1S5F D;  1I4G A;  2AQ2 B;  2TSS A;  1SBB B;  2XRQ D;  5ELD A;  2NTT A;  5D3D A;  4Z9C B;  2IPK D;  1FGB D;  4BWG B;  2J4X A;  2NTS A;  3O13 A;  1LTA D;  1EEI D;  2QEJ C;  3R8B A;  2O2L D;  1JWU D;  1RF2 D;  3DWA A;  4C56 C;  1I4X A;  5D3I B;  1EFI D;  3MC0 B;  4K6L A;  3CHB D;  4RGN A; 
#chains in the Genus database with same CATH topology
 4X64 Q;  1PHJ A;  4O2D A;  4TKO B;  3J80 E;  3H3V I;  2K52 A;  3BVZ A;  4GLA C;  4KHZ A;  5C4J H;  3M7N A;  2QF7 A;  5KEE A;  1SEB D;  2QDL A;  2EYH A;  3T13 A;  3M3Y H;  4UDU C;  1VQ8 A;  2Q8R E;  4FXK C;  1STY A;  1LT6 D;  4LF4 Q;  1EY7 A;  2KCC A;  1H9M A;  5IIF A;  3CCL A;  2HHH Q;  3H15 A;  3CCS A;  2IWH A;  5IGG A;  1VQ6 A;  2VW9 A;  4A4I A;  3F2B A;  3CXC A;  3HOV B;  2LXJ A;  3J7A V;  1O7Z A;  2F0D A;  1C9O A;  4H02 A;  3T1Y L;  1KD1 C;  3S1Q H;  4RGO S;  5A2Q E;  3NHH A;  1I4R A;  3MXP A;  3SE0 A;  4ABN A;  1VQ7 A;  1TWF B;  3A54 A;  4ZLT F;  2L55 A;  2F0F A;  1X3Q A;  1XYI A;  5C5M A;  1DOM A;  4NP5 A;  2F0E A;  1BXT A;  2BDO A;  1QE6 A;  3CAM A;  4ZK9 B;  4XQJ A;  5LMN Q;  1HTP A;  5FKA C;  3PO2 G;  1W6K A;  1PH4 A;  3GTK B;  2Z0S A;  2F0Q A;  2I5H A;  4EQ5 A;  2MHV A;  4JG2 A;  5C3E G;  1EWC A;  1TU2 B;  2B2T A;  5IT9 L;  1EYA A;  4RKL A;  1WTO A;  3I4M H;  1A2T A;  1PTO B;  1NMG A;  3NK9 A;  2A69 C;  4DAV A;  1RTN A;  2UXB Q;  1VQN A;  1QUQ B;  4EQN A;  4GOP A;  1PH1 A;  3VYR A;  1NE3 A;  2ZM6 Q;  2EY5 A;  3D4W A;  3PIP 3;  1G2S A;  1CZG A;  1XWE A;  2KED A;  4IJL A;  1N36 Q;  3S14 B;  1PDQ A;  1L2F A;  1AZQ A;  3CC2 A;  1Y8P B;  3S15 H;  3I91 A;  5IGE A;  2WAQ B;  4IPG A;  3OIQ A;  1IBK L;  3VR6 A;  4A3G B;  3ICE A;  5D3D A;  3C46 A;  4BWG B;  4DR7 Q;  2A69 D;  2RBM A;  2KOL A;  2C9O A;  3FVQ A;  1VQC A;  4IO9 A;  4J1M A;  1EQQ A;  3IRB A;  1SMY D;  4NXN L;  5C44 G;  4JI3 Q;  3H91 A;  3MXN B;  5FOB B;  4BY1 H;  1Z6H A;  5BN5 A;  4OX9 L;  3PV0 A;  2K03 A;  2LSS A;  3GTQ H;  5C4X G;  2RDF A;  3VDY A;  3A55 A;  5EAY A;  3K5M A;  3KJP A;  4C3J H;  1JE5 A;  3J80 i;  1HJP A;  1XMQ Q;  2Z4H A;  3E9I A;  4C2M B;  1HZC A;  4A93 B;  5FO8 B;  1HRJ A;  5C5L A;  4JBW A;  2QKI C;  2LMC B;  1K3R A;  4B3M Q;  3NQT A;  1XNQ L;  3M4O H;  4V0B A;  3CCJ A;  1F77 A;  3M4Y A;  5M3F H;  4BA2 I;  5AFW A;  2PCF B;  5EPL A;  4DV3 L;  1EWH A;  3BS1 A;  3I4O A;  2K5Q A;  2Q8T A;  1HZA A;  2JK8 A;  1TWG H;  4P75 A;  4Q5V A;  1ENF A;  1Y8O B;  2JA7 H;  3J80 L;  3RZD B;  1BBU A;  4F88 A;  4OL7 A;  3TS0 A;  4DR3 L;  1HR0 L;  3BVG A;  1BVS A;  2NVY H;  2ENB A;  1V8Q A;  4NDX A;  3C2P A;  3I72 A;  2IY5 B;  1U4M A;  1JC7 A;  4KJN A;  2F0T A;  4G7O C;  1IBL L;  1VQ9 A;  4HJ9 A;  1STA A;  1A3V A;  1OXS C;  3ERS X;  3FPP A;  3QO2 A;  4DR4 Q;  1B70 B;  1TS4 A;  2WII B;  3KK7 A;  2IT1 A;  4OIK A;  3TP8 A;  2HDM A;  3KLS A;  4UP8 A;  3J7Y W;  5EPJ A;  3URY A;  2RF4 A;  1KLU D;  2EE1 A;  3GTJ B;  1B53 A;  5IYB G;  4AQY L;  3L9A X;  2CWP A;  2A6E D;  3RZO H;  1PRT B;  2PZT A;  4C1N I;  1GVP A;  5KND A;  1MSG A;  3AU7 A;  3I4L A;  1DYQ A;  4QGU A;  2A68 C;  3T51 B;  2G9H D;  3PO3 G;  2MJ8 A;  5LHY 1;  3MWY W;  4YCU A;  1KNE A;  3KOJ A;  2PPB C;  2JN4 A;  2B63 G;  3OSO A;  4KY5 A;  2IPK D;  2AMC B;  3D3R A;  2F3V A;  1IHZ A;  1J5E Q;  2J4X A;  1E2W A;  2O2L D;  4DGZ A;  1K8A C;  2UUB L;  4IUN A;  4CKE A;  1FGU A;  5IP7 G;  5GRO A;  1C4Q A;  1IKM A;  1EZ6 A;  2ZXP A;  4CBV A;  3E5S A;  3PO2 B;  3J81 c;  2JE6 I;  1WFQ A;  5GAG C;  2IX1 A;  1MI2 A;  4YHH L;  5C3E B;  1OXX K;  2EYJ A;  1I50 B;  4JI7 L;  4LF8 L;  1TWC H;  4X65 L;  4H7B A;  2JEA I;  2F03 A;  4DV1 L;  5E4X A;  1JIC A;  3ZYY X;  1ZXT A;  3HRZ C;  1M1K C;  1N33 Q;  1RHP A;  5C0X H;  3ULL A;  1L1O B;  1LLR D;  1CKM A;  1X65 A;  1A2U A;  3CF5 A;  1V1P B;  4DR2 L;  3SDZ A;  4A3D G;  2CCZ A;  3S2H H;  4DNT B;  1TXY A;  2K32 A;  3WWV A;  4YY3 L;  2EJM A;  4XIG S;  3HEJ A;  4YWL A;  3T53 B;  4NXM L;  4JYA L;  3BZK A;  4CDE C;  4TRD A;  2UU9 Q;  5FK9 C;  3I8Z A;  1SJE D;  2PQA B;  3EVQ A;  3UE1 A;  3KFU A;  1Z9F A;  2K28 A;  3T1H Q;  3STB D;  3T56 B;  4BBR G;  1ILQ A;  4FO2 A;  1UAP A;  3NE5 B;  4HJ5 A;  1ET6 A;  4K5V A;  2EJF C;  1BKB A;  2WIN B;  5K5P A;  2K5W A;  1BCP B;  1II3 A;  1PTO C;  4LFC L;  4QQB X;  2EXD A;  2OXP A;  2JYO A;  3FKI B;  2M9V A;  2JA5 G;  2N88 A;  2X6L A;  1VMP A;  1DOL A;  4JC0 A;  4LUO A;  4IUR A;  4JOI C;  3TDQ A;  2YTV A;  2PMZ B;  3QWN A;  2HQL A;  3HOZ H;  2AUK A;  4BY7 G;  5EGT A;  4POG A;  4RHR A;  2KEN A;  4DFA A;  2NB0 A;  4B3R Q;  1HNW Q;  3KDF B;  3OTO Q;  2WV6 D;  4A3C G;  3LWU A;  1K0S A;  1JJ2 A;  3TS2 A;  3HOX H;  2WB1 G;  3H0G H;  3PUV A;  3A56 A;  1WTX A;  1GM5 A;  2CH4 A;  1SDF A;  3W1G A;  2QEX A;  3R8B A;  1JWU D;  4ZRZ A;  5T1I A;  4L5T A;  1Y14 B;  1EFI D;  3NBI A;  4P71 A;  5COR A;  5J39 A;  4QB4 A;  1NMF A;  1Q90 A;  1K83 H;  2E74 C;  4Y52 H;  4BXX G;  2PQE A;  3MA2 B;  2R7Z H;  2K01 A;  2PZW A;  1EIF A;  5DEH A;  4FF4 A;  3K7A B;  2MUY A;  1XMO Q;  1YHB A;  5A35 A;  3UDF A;  2N78 A;  4ZUI A;  3A8I E;  3MVV A;  2JA6 G;  3OIP A;  5IGF A;  4EQO A;  3M4P A;  3UDX A;  2F0M A;  1AFP A;  2ALY B;  4CGY B;  4QL5 A;  4RGM A;  4UP9 A;  2D62 A;  3HOW G;  3PO3 B;  5M3M G;  4DA2 A;  2RHQ B;  4DKA C;  1KIX A;  1DZ1 A;  3BU2 A;  2R3Z A;  1MHW C;  3K0Y A;  1LTS D;  1XTC D;  3H94 A;  3J81 i;  4DV7 Q;  1QUQ A;  2DGY A;  3EN2 A;  5LL6 X;  2NWG A;  1B1Z A;  3HP3 A;  4GKK L;  4JOI A;  2NN6 G;  1V1O A;  4UAI A;  3HKZ G;  1K8M A;  1Z47 A;  3I2Z A;  2PNR C;  1Y1V H;  1TWA B;  1UE6 A;  1TR5 A;  2O4X A;  1LAC A;  3VYS A;  5C0X I;  1B8A A;  2BA1 A;  5KNC A;  2G5D A;  1PRT C;  4N9P A;  4DV4 Q;  2DJG C;  2OF1 A;  2EYO A;  1I5F A;  2NYZ D;  3UDI A;  2SNM A;  1YHQ A;  1I4P A;  3MXN A;  5JVH 3;  2ZTE A;  3BDC A;  4G4K A;  1EQV A;  4KK7 A;  1X55 A;  2NUC A;  1X3F A;  1PH5 A;  4JPB W;  4B3T L;  1UWV A;  1C0A A;  2KJX A;  4G7H C;  3SK8 A;  1VQO A;  4PQX A;  2HIX A;  1S4Z A;  1VQ5 A;  1XPU A;  3I55 A;  4GNX B;  2K1B A;  5D3I B;  4PMW A;  4BBR B;  2EYL A;  4K6L A;  3IFD A;  3KYH C;  3I4N G;  5IP9 G;  5FJ8 G;  1G6P A;  4PZ7 A;  3HOV G;  3Q24 A;  4WFN 3;  1D8L A;  5IY0 A;  4M1U B;  1L0Y B;  5IWA L;  5CV5 A;  1IBM Q;  1STG A;  4X66 Q;  4GLX A;  4JI2 Q;  5DNF A;  2HCI A;  3VA7 A;  3MEH A;  4OEL B;  4AIM A;  2JA5 B;  1R9T H;  1O7I A;  1PV4 A;  2LS0 1;  3PO2 H;  3R93 A;  4KD3 A;  4FVM A;  3S2D B;  1L1O C;  5E4W C;  1XMO L;  1FVI A;  1EYG A;  2F0G A;  1JR0 D;  1SE2 A;  2AQ1 B;  1LT3 D;  3W3A A;  1IZ6 A;  4HCS A;  1I50 H;  2ZXO A;  1B4O A;  1LT4 D;  2FMM A;  1J9O A;  1YNN D;  2GN5 A;  2RCF A;  3SR1 A;  4KI0 A;  4K0K L;  2RSN A;  3Q23 A;  4IFD I;  4CHT B;  3GTL B;  1DGS A;  2VXW A;  1RDP D;  2WB1 B;  4KKU A;  4A75 A;  1Y1W H;  1BBX C;  1YNJ C;  2AKW B;  4IUV A;  4KN4 C;  2IHE A;  1PZK D;  3PUY A;  2UXD L;  2E2D C;  1JT8 A;  1T5X D;  1BCP C;  5F2D A;  3T1Y Q;  2UUC L;  1Q3L A;  4RH6 A;  2LFN A;  2RDG A;  3JAM E;  2VB2 X;  2NVQ H;  1ICW A;  3CD6 A;  3GP7 A;  2I5M X;  3OYY A;  2VQE L;  3CRK C;  4QF4 A;  2I0Q A;  4A3G G;  4CJ1 B;  3E3X A;  3ERQ A;  2DY7 A;  2QIL A;  5C44 H;  2FFK B;  1VF5 C;  3P7J A;  4FNF A;  4IUU A;  2XNA C;  5JEA H;  2Q2U A;  2R7D A;  5C4X H;  1SYC A;  5IYD G;  4CKC A;  5DLQ E;  3E9H A;  4MZ9 A;  4DV4 L;  5CV9 A;  4DV2 L;  1YJ9 A;  4A3K G;  1BCP D;  2EJG C;  2OT2 A;  5J1Z A;  1OXU A;  2F4V L;  2NVT B;  2QDB A;  1KAB A;  1S5F D;  3TP5 A;  3I90 A;  4HJ8 A;  3HOW B;  4CJ2 C;  3HOY G;  3A0J A;  2GVB A;  1GO3 E;  4A93 G;  3VYU A;  4NKL A;  1AEX A;  4WJW A;  3S1R B;  5EQ0 A;  1I4X A;  1AE2 A;  3CHB D;  1I6H H;  1K0R A;  3GO5 A;  1L1O A;  1SFO B;  1MKH A;  1F9S A;  1V1P A;  4DV0 L;  3F1Z A;  3HKZ B;  4DF7 A;  1VQP A;  4TSS A;  1IBK Q;  4NB3 A;  1B7Y B;  5I6W A;  2L9H A;  1PTO F;  3VR3 A;  4JCV E;  3DLL A;  3NEM A;  4FF1 A;  3GTG B;  4IJH A;  4FXG C;  2Q2T A;  3M9B A;  1QNK A;  4NXN Q;  2IX0 A;  3K5N A;  1JCK B;  5ELF A;  4RKB A;  4HN7 A;  4OX9 Q;  2KEE A;  2Z8L A;  5DM7 3;  4JI5 L;  1VQK A;  2SOB A;  4OXP A;  1J8I A;  1CT1 D;  4QCL A;  4WJ4 A;  3D4R A;  5G3L F;  3NTK A;  1U9R A;  4F87 A;  4L63 B;  1EY4 A;  2HD3 A;  1B9N A;  3U58 A;  4DV5 L;  3J7Z C;  1XNQ Q;  4P74 A;  1M4V A;  1HPC A;  3GQB A;  1PH9 A;  3PO3 H;  4DV3 Q;  4OGQ C;  2HT1 A;  3I4N B;  1KHI A;  2MNA A;  4IPC A;  3KLS X;  2B63 H;  4DR6 L;  3NWT A;  2I46 A;  1EY8 A;  3TSS A;  1WTP A;  1F9R A;  3PUZ A;  4OON A;  1AE3 A;  3KDF A;  2JQO A;  2V1C C;  3N6R A;  3Q0A A;  4K6D A;  4BBS G;  5GAE C;  1UE1 A;  4I7Z C;  1Q82 C;  5FLX E;  4DR3 Q;  1HR0 Q;  2AWN A;  3NXW A;  3MEF A;  3BVM A;  5ELO A;  4BA1 I;  4EX5 A;  3SK4 A;  3R2I A;  1A3T A;  4O42 A;  1IBL Q;  3A8K E;  5DM6 3;  3RMH A;  3V96 A;  3CU7 A;  1STB A;  1YIT A;  1B44 D;  1IW7 D;  3CCR A;  2E5L L;  1E1T A;  4JK1 C;  1EYC A;  1WTR A;  1M8A A;  5K36 G;  4KY7 A;  1S5D D;  4A3E B;  3DEP A;  1NJI C;  1JB7 A;  4Y7N B;  5IOD A;  5LMN W;  3S1N H;  3DUZ A;  2XWB B;  4L5S A;  2BDN A;  1F2Z A;  1SMY C;  4AQY Q;  4A3I H;  4X3K A;  4A3D H;  2B2Y C;  3JAM L;  1WTH A;  3I56 A;  1YVC A;  1STN A;  3AFP A;  2EIF A;  1ASY A;  2K05 A;  4XYQ A;  1GUO A;  3PSI A;  4LF9 L;  1N32 L;  1CUK A;  4R8N A;  1SMX A;  4XT3 B;  5M5W H;  1DD2 A;  1EOT A;  3FHW A;  2FXQ A;  2B2W C;  2K5N A;  3T16 A;  1HQM C;  5CV7 A;  5HGQ A;  5C3X A;  4APV A;  1SR3 A;  1B50 A;  2ICI A;  4K2K A;  4MIU A;  4XQQ A;  2UUB Q;  3Q6S A;  2EY2 A;  4ZAI A;  1S5B D;  1YZ6 A;  1N9W A;  3I70 A;  3PIO A;  3GTM B;  2L5T A;  1PRT F;  1TT2 A;  3CQZ H;  5IYC G;  1W3S A;  3GTP B;  2WAC A;  4YHH Q;  3PF4 A;  2MGS A;  2DUD A;  2MQH A;  4ME3 A;  4JI7 Q;  4A3K B;  4ZCK A;  4LF8 Q;  4F8M A;  2IX3 A;  4X65 Q;  3S1M B;  1EQT A;  3HZX A;  3FKI G;  4DV1 Q;  4B3S L;  1WI5 A;  2BH2 A;  3HOY B;  4BY7 H;  1E7Z A;  2HIV A;  2R92 B;  1ZEQ X;  3U4Z A;  3PUW A;  5M5Y B;  4OWW B;  4DR2 Q;  3DEO A;  3GTL H;  4A3C H;  4HMJ A;  4YY3 Q;  4R4O A;  1XPR A;  4HSV A;  2B2U A;  2PW7 A;  4E6I A;  2HQE A;  4DK0 A;  4NXM Q;  4JYA Q;  3FDT A;  3GTO H;  2HDL A;  3PUX A;  3N52 A;  3CPF A;  4XYO A;  1QB5 D;  2IHF A;  2MO1 A;  2RA4 A;  4A3B B;  4K8J A;  3J81 j;  1VMC A;  3AQQ A;  1PA6 A;  5GQO A;  2SEB D;  2A6E C;  2E2H H;  4KLK A;  3V05 A;  1I4H A;  4BXX H;  3BYY B;  4GNX A;  2A73 B;  4LFC Q;  1A3U A;  4KKT A;  1WCM B;  2ES2 A;  2PI2 E;  3RLF A;  1PMR A;  5CBA E;  5JJI A;  2B2Y A;  5I4D A;  3VR4 A;  1K9M C;  4B9W A;  1K3B C;  3NQI A;  5CGK A;  2I5L X;  4J15 A;  3X3M A;  3EIV A;  1ZKO A;  3KF8 B;  2JA6 H;  1QVF A;  2TMP A;  3OW2 A;  2F1M A;  4ME5 A;  2B2W A;  5JJZ A;  3S24 A;  2F0U A;  1EEI D;  3I3C A;  4KV6 A;  4DUY Q;  3MHB A;  1BO0 A;  5CV4 A;  4HIO A;  4A76 A;  3L0O A;  3WOF A;  3S16 H;  3MC0 B;  4WJ3 M;  2X6G A;  1RIP A;  1STH A;  4DN4 M;  1PH6 A;  2JA8 G;  3PGZ A;  1SNP A;  2K4K A;  3AMU A;  3HOW H;  5M3M H;  4GS3 A;  2KCN A;  2KHI A;  2K7V A;  3DHQ A;  5FLX L;  3GD7 A;  2F0L A;  1HNZ L;  1PFS A;  1UE5 A;  4WRD A;  4HAE A;  4V19 0;  2O5J C;  2F52 A;  4BBS B;  2B39 A;  1ILP A;  1CTM A;  4HJ7 A;  2NN6 H;  3IKJ A;  4DR5 L;  2YTY A;  1CHP D;  1P8L A;  5KGU A;  2B8F A;  5J22 A;  5TSS A;  4RGT A;  1WOC A;  4N8X 1;  1VQJ A;  3GTG H;  3F2U A;  4QY7 A;  3D8G A;  1NY4 A;  2DNC A;  5T1G A;  3TP6 A;  2NBF A;  4IQZ A;  1QVC A;  1SRO A;  1UUP A;  4I65 A;  4OO1 H;  4FF2 A;  3DMU A;  2YYZ A;  1GKH A;  2GVA A;  2ZTC A;  1D5M C;  3STB C;  2ATW A;  3HOU B;  2A1A A;  4JBK A;  1KAA A;  2DN8 A;  2PO4 A;  2L15 A;  4IPH A;  3BJU A;  1LYL A;  3KBG A;  2KCM A;  4LMQ D;  2NZO A;  2HCC A;  2A74 C;  4RFB A;  3EQL C;  3MFG A;  2EDG A;  2L11 A;  5COY A;  2E2I B;  3H6M A;  2NVX B;  1RD9 D;  1TWH B;  2FMC A;  1NTG A;  2L4N A;  1B2T A;  2A6H D;  1SNM A;  2VS1 A;  4LF7 L;  4XQN A;  1VQL A;  1G2T A;  5IP9 H;  1Q46 A;  3HOV H;  4GKK Q;  2OTJ A;  4UP7 A;  4OEM B;  4KTA A;  1Y69 U;  4LF6 L;  2L1B A;  2NZH A;  2FIN B;  3TME A;  1ONL A;  4C3H G;  4C3I B;  3NEL A;  2D5D A;  5EBD A;  3P75 A;  1EY9 A;  4J8Q A;  4H44 C;  1TWF H;  4QIW E;  4DV6 L;  3Q8D A;  1TII D;  5BN4 A;  1KQS A;  4LFA L;  4R4Q A;  3GTK H;  5CYU A;  3QOJ A;  4DUZ L;  2YV5 A;  1EUJ A;  2A19 A;  4KJO A;  1HUM A;  4DNR B;  4F7X A;  4RGN A;  4KY6 A;  4DUY L;  1PTO H;  3ER0 A;  1SYE A;  1HFN A;  1SNC A;  3T4A C;  4B3T Q;  1K8G A;  2QGQ A;  1LTR D;  3G7L A;  3VA5 A;  2P5Z X;  4AH6 A;  1I3Q B;  4A3M B;  2QCP X;  4PNY A;  5BN3 A;  3CKI B;  3S14 H;  1FD7 D;  2N3S A;  1GUT A;  1KRT A;  5DAU A;  1G91 A;  5IWA Q;  3TRE A;  4BS9 A;  3CW2 C;  3CCV A;  4A3G H;  3NBH A;  4P72 A;  1SSO A;  2UXC L;  5M3F G;  2R93 B;  1HUN A;  1HTL D;  4XDX A;  4U68 A;  3KUP A;  3PF5 A;  1LO5 D;  5IYD H;  1PFN A;  1VQG A;  2ID0 A;  4JI4 L;  4A3K H;  4KHP L;  1LUZ A;  2E75 C;  3VR5 A;  3LNN A;  3ND9 A;  1IL2 A;  1CFM A;  4K0K Q;  2JA8 B;  1SN8 A;  3RLN A;  2E2J B;  3CCU A;  2H5X A;  2FJ2 A;  2RVL A;  3D4D A;  1D5X C;  4C2M H;  4A93 H;  2Z4I A;  2AHO B;  2BE5 C;  5C4J B;  1MJE A;  5I9P A;  3UE0 A;  2Q8I B;  2UXD Q;  2EYM A;  4IN3 A;  1ICF B;  1LTT D;  4KN7 C;  3K59 A;  3M3Y B;  3D6C A;  1AZP A;  2XWJ B;  5H1S E;  3HKS A;  5KYL A;  3TZD A;  3W2D A;  3P1H A;  1PZJ D;  2UUC Q;  2XSC A;  3A7L A;  1WJJ A;  4MHE A;  3A5U A;  3OMG A;  3OHX C;  2VQE Q;  1O78 A;  5ELC A;  4OO1 I;  1B3A A;  3DM3 A;  4FP5 D;  1D1I A;  1NR4 A;  1QNU A;  4CDD C;  1BUV T;  4I7A A;  3RZD H;  2MO0 A;  5KIX A;  1NR2 A;  4LAA A;  2BE5 D;  4DU9 A;  2KHJ A;  1YEZ A;  3S1Q B;  2QEJ C;  2AUJ D;  1C48 A;  4DV2 Q;  4IUT A;  1NSN S;  1MGS A;  1X3E A;  2F4V Q;  1CQF A;  1X56 A;  1SRU A;  3PIP A;  4A3L G;  1VDZ A;  1JE4 A;  1JOK A;  1SAP A;  3GTJ H;  1VF7 A;  2CVR A;  3H3V C;  2KUM A;  3BDO A;  2F0I A;  4LW1 A;  3CCM A;  1LM0 A;  1WD1 A;  1E2Z A;  1GHJ A;  3AFQ A;  3OOC A;  4R1J A;  1FNW A;  2CQA A;  1CI3 M;  4QUC A;  4IAL A;  5E3F A;  1YNN C;  4DV0 Q;  4IOC A;  1RTO A;  1BF4 A;  4DK6 C;  1ASZ A;  1K8O A;  4R8I A;  1I4Q A;  3EFX D;  4C3H B;  2LKV A;  2Q2I A;  4CDC C;  5C0X G;  1ENA A;  1XNR L;  3TZU A;  3HFZ B;  2RQX A;  1IXR A;  4DK1 A;  1ESR A;  2IL8 A;  5C6A A;  4GLV B;  4JW0 A;  3S15 B;  2OWO A;  4DXF A;  1BBW A;  3BZC A;  4LFB L;  4JI5 Q;  2F0K A;  1EIY B;  2R7F A;  4FYD A;  5C3E H;  1C7Y A;  4DXG A;  2PI2 A;  3W1B A;  1A0I A;  2RCN A;  4ZKC B;  3JAM c;  1GUG A;  3BZD B;  4L5R C;  4ZKB B;  4A3E G;  2DY8 A;  2MFI A;  3KF8 A;  3KLW A;  4DK3 C;  2I07 B;  3MFY A;  4YIJ A;  4DR1 L;  4DV5 Q;  3A74 A;  5JAV A;  2SNS A;  4LUV A;  3GTQ B;  3F2D A;  3R2T A;  5C4H A;  2MPM A;  2UUA L;  4C3J B;  3MAQ A;  3OW7 A;  5JPM C;  3CCQ A;  1U5K A;  4DR6 Q;  3DWQ A;  1SNO A;  4MN3 A;  1PFM A;  3KF6 B;  1MD2 D;  3HOZ G;  2PZU A;  2ASB A;  2EPB A;  2XTI A;  4EVO A;  5JJK A;  1QG7 A;  2XIW A;  3GDE A;  1Q7Y C;  4AYB B;  4PV1 C;  3M4O B;  1PLF A;  1WVL A;  5M3F B;  2VUM G;  1I4G A;  1H9J A;  4AYB E;  4ALP A;  3RN2 A;  1IYV A;  3EBE A;  4R4C A;  4HIM A;  1CSQ A;  1FGB D;  3O13 A;  1RKN A;  3HOX G;  1H9K A;  4RWS C;  3TQY A;  1RF2 D;  4IFD G;  4GKJ L;  1TWG B;  2E5L Q;  3TN2 A;  3U9O A;  2JA7 B;  4IUQ A;  3FKI H;  4JI0 L;  1D2B A;  4LF5 L;  1ZYR D;  2NVY B;  3DWP A;  2ZJQ A;  4FXD A;  1F2M A;  2XRS D;  5CMD A;  4MTN A;  3TBI B;  3SXH A;  4XT1 B;  4ODG A;  4YWM A;  3I7F A;  4CJ0 B;  3P20 A;  1GJX A;  1B3Q A;  1D6E C;  2R92 G;  4ILW A;  1WYD A;  1SE8 A;  2VZA A;  1XXG A;  1VQ4 A;  2D0O A;  4LF9 Q;  1N32 Q;  2E76 C;  1N34 Q;  2X69 A;  1YBY A;  1G51 A;  4WOR A;  1TS3 A;  1X3G A;  5LMU L;  1HNX L;  3RZO B;  5CBE E;  2O5I C;  4A3B G;  1HHV A;  1EIG A;  3EA6 A;  3NWS A;  1UNS A;  1FYC A;  1OXT A;  4HSP A;  1SYG A;  3W5O A;  2J0T D;  2EZV A;  5BR8 L;  1WCM G;  1KLG D;  2OCE A;  3G6E A;  1GD7 A;  3K7A H;  5FLM G;  2HUG A;  3RD4 A;  1T5E A;  1GXD C;  4U67 3;  2V4D A;  4B3S Q;  2VQF Q;  1HFG A;  2CW0 D;  4ID6 A;  1WTW A;  2YTX A;  1CHQ D;  1D1K A;  5FLX c;  1BOS A;  1Y1V G;  4GN5 A;  2LY7 A;  3D31 A;  4OIJ A;  1O80 A;  1EU4 A;  5IYB H;  4JBM A;  2JA8 H;  4B9X A;  1PFB A;  3MZ5 A;  1TWC B;  1H9S B;  1JOQ A;  3ONA B;  1IW7 C;  1V43 A;  1QCB D;  1FNV A;  4FF3 A;  1H95 A;  4QMG A;  2Z6K A;  5M5X B;  1QOH A;  3RNU A;  1KC8 C;  1DXM A;  4HCE A;  3NBH B;  3VR2 A;  1CA6 A;  3OPO A;  4X3T A;  3M85 A;  1RJT A;  1TS5 A;  1FR3 A;  3NSW A;  1EWI A;  1D5Z C;  3KBX A;  4JI6 L;  3NPP A;  2F0W A;  4KD4 A;  4LK1 C;  1QZH A;  3S2H B;  1AH9 A;  5ELD A;  4RA8 A;  4JV5 L;  2PNH A;  1XPO A;  2K14 A;  2KHS A;  2MP1 A;  5IP7 H;  2H1E A;  3A8J E;  3G6J B;  3JAM i;  5JVG 3;  1IYJ B;  1LTA D;  4DNI A;  4A3J G;  1RL2 A;  1FJG Q;  1Q1E A;  5M9O A;  3CPW A;  2B2U C;  1TWA H;  1IL8 A;  4A3F G;  1ET9 A;  1VQM A;  1HR0 W;  1DOK A;  1Q1B A;  3LGJ A;  2KEC A;  4K14 A;  1BQQ T;  4S3S A;  2EYP A;  1ESF A;  1LTL A;  1GUS A;  2K50 A;  2Z1C A;  2F4I A;  4HJA A;  1LTI D;  2AQ3 B;  2VY3 A;  2LXK A;  4GNX C;  3HOU G;  1BDO A;  2CH4 W;  1SYD A;  1A6X A;  4K2L A;  1F2L A;  4HED A;  5EJW A;  1HNZ Q;  4K5X A;  1TY0 A;  2B29 A;  5ELE A;  1N34 L;  3HOZ B;  3VYT A;  4UPA A;  1LTG D;  1QVG A;  1CK1 A;  2G9D A;  4ZYS A;  4IPD A;  2VUM B;  1X6O A;  4RHS A;  4C1N K;  4DR5 Q;  1XJV A;  4BBR H;  1X54 A;  1A62 A;  1GUW A;  4C3H H;  1M90 C;  3HOX B;  3G48 A;  1Y1W G;  3H0G B;  2L12 A;  1VQD A;  4H13 C;  4C3I G;  1I94 Q;  1H9R A;  1E3P A;  3FP9 A;  4X62 L;  4RG1 A;  3CCE A;  2JA5 H;  3DM1 A;  3GV6 A;  1DJR D;  3S2D H;  3HS0 C;  2WAQ E;  1HA6 A;  1K83 B;  3K80 C;  2R7Z B;  1CZW A;  2VQF L;  1QJO A;  5IE8 A;  3A5Z B;  1STE A;  2B2V C;  4IUP A;  5EBC A;  1KL9 A;  1EY6 A;  2K5H A;  2RKS A;  2VNU D;  2H4O A;  5L37 A;  1MJC A;  1UEA B;  4X3U A;  1LT5 D;  2XGT A;  1EFW A;  1IYU A;  4MTK A;  4JI8 L;  4G57 A;  1PXU A;  3M7G A;  2F0J A;  5JEA G;  3CC7 A;  1VQH A;  4X64 L;  1MSH A;  4O1N A;  2Y0S B;  4UHV A;  3X3N A;  4LF7 Q;  2A8V A;  1GUN A;  1O7Y A;  2Y0S E;  2TSS A;  1NAP A;  4A3M G;  4LF6 Q;  3K5L A;  1U4P A;  2VL6 A;  3S9W A;  3BDL A;  2BA0 A;  4LF4 L;  5CR3 A;  1Q86 C;  1EOV A;  5I6Y A;  5KYI A;  5HY6 A;  2HHH L;  1FJG L;  3OMC A;  1O7L A;  1HZ9 A;  4YWK A;  4LJZ C;  4KMU C;  1WTV A;  2OTL A;  4DV6 Q;  1B9M A;  3E6Z X;  1F2Y A;  5EPK A;  3L2P A;  1SE4 A;  4L6T B;  4R4T A;  3BG3 A;  3ZJY C;  2YU9 B;  2R93 G;  4DAM A;  2A5H A;  1JOO A;  1QIL A;  4QJF A;  4LFA Q;  3K57 A;  1XTD A;  4N8F A;  2K5D A;  2B8G A;  4DUZ Q;  2CHB D;  1Y1V B;  2C5C A;  2AWO A;  1Q8I A;  1S40 A;  2CFM A;  1TVX A;  2F3I A;  5ELB A;  1G6Z A;  1SJH D;  3NTH A;  5KNB A;  2NVT H;  1TS2 A;  4CKB A;  5LMN L;  2EOT A;  1SND A;  1BCP F;  1JJC B;  3G4S A;  3FPU B;  3S1R H;  1Q12 A;  1T9H A;  1UEB A;  3V2T A;  2Q2H A;  1SFO H;  2F0H A;  4A3J B;  2UXB L;  2K5V A;  2ZTD A;  1TKW B;  2M00 A;  5A2Q L;  1U4L A;  1OO9 B;  1YIJ A;  1DON A;  3AB9 A;  2ZM6 L;  4DAY A;  4A3F B;  2UXC Q;  2EQS A;  2B2V A;  2RHS B;  3KF6 A;  4HIK A;  1G8Z D;  1N36 L;  1I94 L;  1VQB A;  4OWX B;  2CWA A;  1FL0 A;  2WKD A;  5GAD C;  2A6H C;  1X9N A;  3KLR A;  4RMF A;  4JI4 Q;  5I9O A;  1JQY D;  1W2B A;  1D7Q A;  2K33 A;  4KHP Q;  3Q22 A;  1IKL A;  4J6H A;  4GN4 B;  1HXY D;  3CC4 A;  4O0A A;  1E0B A;  4NW2 A;  4DR7 L;  1R9T B;  4GN3 B;  5CV8 A;  3HG9 A;  2CQO A;  1EZ8 A;  4A3L H;  3I73 A;  3K58 A;  1KNA A;  1R4Q B;  4JI3 L;  5CC4 A;  1J6Q A;  2BCO A;  2KVM A;  2A68 D;  2D2C C;  3FRP B;  1QWY A;  5JJL A;  1F9P A;  4H0L C;  3MXG A;  5M5X H;  3DXJ C;  1K73 C;  3KJO A;  3I4M G;  1A63 A;  3ITP A;  3MXU A;  3I4N H;  5FJ8 H;  1XMQ L;  1HZB A;  1E1O A;  1Y1W B;  3C1E A;  4A3I G;  1SNQ A;  2Z6B A;  1CKN A;  4KKS A;  4B3M L;  1RCV D;  1AP0 A;  5FO9 B;  3J81 E;  5D14 A;  1SLJ A;  4QIW B;  1KTK A;  3QOL A;  3PMF A;  3U50 C;  5CV6 A;  3C3L A;  3K0X A;  4K5W A;  1VQA A;  3QB3 A;  1FNU A;  2ZT9 C;  1SXT A;  3G71 A;  2NVQ B;  2E8G A;  3QIA A;  4HTH A;  4R9W A;  1PH8 A;  5C4Z A;  3BYT B;  2IJ0 A;  1NCV A;  3ERO A;  4A3E H;  3K7U C;  5C44 B;  5ELN A;  2ZXR A;  4XTC S;  4Y7N H;  3MTS A;  3OWE B;  1AW7 A;  2WFW A;  2F3W A;  5C4X B;  2DJF C;  3K5O A;  1V1Q A;  1PH3 A;  2N8N A;  2L0C A;  1PVO A;  4BY1 G;  1JB3 A;  1BNZ A;  1VCI A;  5J3B A;  4DR4 L;  1NNX A;  3J7A F;  4C3J G;  5C0X J;  2OQ0 A;  2PMZ E;  3NP8 A;  2CKZ B;  4EGV A;  1H9S A;  2QW7 A;  4GZY C;  5EKK A;  4EQP A;  1YJW A;  1C8C A;  1XNR Q;  3R3O A;  2GA4 B;  1Y8N B;  3TEH B;  2VUM H;  2JJQ A;  3F2C A;  1HCZ A;  1TQO A;  1VQE A;  1YHA A;  4AYB G;  1I6H B;  1PTO D;  4OHJ A;  1LTB D;  1CA5 A;  5EKI A;  3FEW X;  5I2Y A;  4IFD H;  4HID A;  3HGB A;  3GTM H;  4LFB Q;  1A15 A;  5HUR A;  3GTP H;  3RUZ A;  3WDN A;  4QUF A;  3U4V A;  1PH7 A;  2BOS A;  4OWT B;  1J5E L;  4P73 A;  2C35 B;  3RN5 A;  2KA7 A;  2JA7 G;  1WD0 A;  3S1M H;  2JSO A;  1MIU A;  3WOE A;  1UE7 A;  3H09 A;  3S17 B;  5EKL A;  1SE3 A;  5G3L D;  3HOY H;  4NMZ A;  4DR1 Q;  1JMC A;  2F0O A;  2R92 H;  3NEN A;  2NN6 I;  1I6V C;  2SDF A;  3PIO 3;  5M5Y H;  1NBW A;  1SBB B;  2UUA Q;  4YCW A;  5AJ3 Q;  1SYB A;  2DNE A;  4GOP B;  1EY5 A;  2NTS A;  1E2V A;  5IGB A;  2ZJR A;  1S72 A;  2RSO A;  2WKC A;  4ZQ3 A;  1E24 A;  1V9P A;  4K8I A;  1N33 L;  1EEF D;  3SK5 A;  4YCV A;  4A3B H;  1EY0 A;  1JOR A;  1EQR A;  3IFT A;  3CRL C;  5IGC A;  2B63 B;  4JVZ A;  4IFD J;  3K8A A;  1X3P A;  4B08 A;  2VB3 X;  3QR8 A;  4GKJ Q;  1WCM H;  1KAW A;  1OTC A;  4TQU S;  2QA4 A;  3TP7 A;  1W6J A;  5FLM H;  1S5C D;  2F0S A;  2UU9 L;  1L0X B;  1P16 A;  4JI0 Q;  2M2L A;  4LF5 Q;  2RDH A;  4RAU C;  2EYF A;  3T1H L;  2YU9 H;  1HA5 A;  3E0E A;  3ULP A;  3IAY A;  4PMB A;  4JI1 Q;  1CM9 A;  2ZJP A;  4L8J A;  1ML0 D;  2JEB I;  3FMC A;  4JBJ A;  5D65 A;  1E22 A;  2IW3 A;  1PYW D;  1L0W A;  1SYF A;  2FHT A;  3NUC A;  3I4M B;  1N8R C;  3J81 L;  4OO1 G;  1KDB A;  1GHK A;  3S1N B;  2R6G A;  4Q0F A;  5LMU Q;  1HNX Q;  4A3I B;  1EIH A;  4A3D B;  4BBS H;  2KQ3 A;  2K04 A;  1OXV A;  2WP8 J;  1CSP A;  1XX8 A;  3D6W A;  4LNQ A;  2XVS A;  4A3J H;  3H3V H;  3GV3 A;  4B3R L;  4DAP A;  1HNW L;  1DCZ A;  3OTO L;  3CMA A;  5FO7 B;  5NUC A;  5M5W B;  4X6A H;  1F9Q A;  4ULL A;  4A3F H;  4X3S A;  1S5E D;  4RCO A;  1VQI A;  5BR8 Q;  1X32 A;  2N49 A;  3F8T A;  4IZ8 A;  5HGT A;  1Q81 C;  1LAB A;  1PRT D;  2K6A A;  2ICE C;  1Q8K A;  1ENC A;  2JXM B;  5K36 H;  2OEO A;  5KRU A;  1KDC A;  2KCT A;  3M4Q A;  2EXZ A;  1G29 1;  4FDB A;  3AEV A;  3CQZ B;  4UY8 C;  3HOU H;  5IGD A;  3UDG A;  2BH8 A;  3PQI A;  4BY1 B;  1Z7T A;  5IT9 c;  4Z9C B;  5LL6 S;  3SGI A;  4POF A;  3B6Y A;  5GAH C;  2JP1 A;  3RR5 A;  5AJ3 L;  2K75 A;  1PYB A;  3DWA A;  3PCO B;  4R4I A;  2F0N A;  3LX0 A;  5ISR A;  1YJN A;  4BY7 B;  4KHV A;  2E2I H;  3K6O A;  2NVX H;  1U4R A;  1TWH H;  1ZYR C;  4DAY B;  1A8V A;  3NTI A;  1NUC A;  2D9U A;  3D0F A;  4JI6 Q;  1MBY A;  1HQR D;  4ZUJ A;  5E7N A;  2D0P A;  1ROD A;  2XN9 C;  1PH2 A;  4JV5 Q;  1S3O A;  1PZI D;  1YI2 A;  1CQV A;  2EY6 A;  1KDA A;  3L7Z C;  2WB1 E;  3IL8 A;  1WTQ A;  4XXE A;  3GTO B;  1JJG A;  5IT9 E;  3J7A 5;  2PW5 A;  1VQF A;  4C3I H;  3TRZ A;  5IYC H;  2Z6K C;  3SVM A;  2OQK A;  3CME A;  3H0G G;  4DV7 L;  1AN8 A;  1EL0 A;  1JWS D;  5E1F A;  1TY2 A;  3ND8 A;  2E2H B;  3LWE A;  2WAQ G;  4M8A A;  3ULJ A;  3JC6 6;  4TVA B;  4DPG A;  1CKO A;  4JI1 L;  2F0V A;  2R7Z G;  1VS0 A;  1QZG A;  1YNJ D;  1GOZ A;  3UI2 A;  2PYK A;  2JA6 B;  1KXL A;  3U9S A;  3CP0 A;  5JOB A;  4PZ8 A;  1KRS A;  1CKN B;  4PMC A;  4N9T A;  3K81 C;  1U0L A;  4G7Z C;  1I3Q H;  3QJY A;  4LUZ A;  3QG1 A;  3S16 B;  2EY1 A;  2CW0 C;  3A7A B;  4A3M H;  5IOC A;  2Y0S G;  4NPS A;  4P2C B;  5M3M B;  3C1F A;  3EJI A;  1HH2 P;  4MNO A;  4HR7 B;  1LV9 A;  1K28 A;  4RCN A;  4HMI A;  1EU3 A;  2Z9H A;  1BR9 A;  2N55 A;  2KBN A;  3SEB A;  4L5Q A;  4IOA A;  1JWM D;  4PZ6 A;  1R4P B;  4CDF C;  3J80 c;  3SK6 A;  4LWC A;  1DM0 B;  2B2T C;  4X62 Q;  2EVB A;  2R93 H;  2NZ1 D;  3HKZ E;  2F0P A;  3SHL A;  1PYS B;  5I2X A;  2R61 A;  5JPN C;  1EYD A;  4GOP C;  2J7Z A;  2B3G A;  5C3W A;  4PG3 A;  2AQ2 B;  1IBM L;  2XRQ D;  3RLO A;  4X66 L;  2NTT A;  4JI2 L;  2JA9 A;  3L3O C;  2PQA A;  5JEA J;  2E2J H;  3AYH B;  3S17 H;  4JI8 Q;  4C56 C;  3OWF A;  3E0J A;  1YNX A; 
#chains in the Genus database with same CATH homology
 4TKO B;  3J80 E;  3BVZ A;  4KHZ A;  3M7N A;  2QF7 A;  5KEE A;  1SEB D;  2EYH A;  3T13 A;  4UDU C;  2Q8R E;  4FXK C;  1STY A;  1LT6 D;  1EY7 A;  2KCC A;  1H9M A;  5IIF A;  2IWH A;  5IGG A;  3HOV B;  3J7A V;  1O7Z A;  2F0D A;  4RGO S;  5A2Q E;  3NHH A;  1I4R A;  3MXP A;  3SE0 A;  4ABN A;  1TWF B;  3A54 A;  4ZLT F;  2L55 A;  2F0F A;  1X3Q A;  1XYI A;  5C5M A;  1DOM A;  4NP5 A;  2F0E A;  1BXT A;  2BDO A;  1QE6 A;  4ZK9 B;  4XQJ A;  1HTP A;  5FKA C;  1W6K A;  3GTK B;  2F0Q A;  2MHV A;  1EWC A;  1TU2 B;  2B2T A;  5IT9 L;  1EYA A;  4RKL A;  1WTO A;  1A2T A;  1PTO B;  3NK9 A;  2A69 C;  4DAV A;  1RTN A;  4EQN A;  3VYR A;  2EY5 A;  3D4W A;  3PIP 3;  1G2S A;  1CZG A;  1XWE A;  2KED A;  3S14 B;  1PDQ A;  1AZQ A;  1Y8P B;  3I91 A;  5IGE A;  2WAQ B;  3OIQ A;  3VR6 A;  4A3G B;  5D3D A;  3C46 A;  4BWG B;  2A69 D;  2RBM A;  2KOL A;  2C9O A;  3FVQ A;  4J1M A;  1SMY D;  3H91 A;  5FOB B;  1Z6H A;  5BN5 A;  3PV0 A;  2K03 A;  2RDF A;  3A55 A;  3K5M A;  2Z4H A;  4C2M B;  4A93 B;  5FO8 B;  1HRJ A;  5C5L A;  4JBW A;  2QKI C;  2LMC B;  3NQT A;  4V0B A;  1F77 A;  3M4Y A;  4BA2 I;  5AFW A;  2PCF B;  5EPL A;  1EWH A;  3BS1 A;  2K5Q A;  2Q8T A;  4Q5V A;  1ENF A;  1Y8O B;  3J80 L;  3RZD B;  4F88 A;  4OL7 A;  3BVG A;  2ENB A;  1V8Q A;  4NDX A;  3C2P A;  3I72 A;  1U4M A;  1JC7 A;  4KJN A;  2F0T A;  4G7O C;  1STA A;  1A3V A;  1OXS C;  3FPP A;  3QO2 A;  1TS4 A;  2WII B;  3KK7 A;  2IT1 A;  4OIK A;  3TP8 A;  2HDM A;  3KLS A;  3J7Y W;  5EPJ A;  3URY A;  1KLU D;  2EE1 A;  3GTJ B;  1B53 A;  3L9A X;  2A6E D;  1PRT B;  2PZT A;  4C1N I;  5KND A;  1MSG A;  3AU7 A;  3I4L A;  1DYQ A;  2A68 C;  3T51 B;  2G9H D;  2MJ8 A;  5LHY 1;  3MWY W;  1KNE A;  2PPB C;  3OSO A;  4KY5 A;  2IPK D;  2F3V A;  3D3R A;  1IHZ A;  2J4X A;  1E2W A;  2O2L D;  4DGZ A;  4IUN A;  4CKE A;  1C4Q A;  1IKM A;  1EZ6 A;  2ZXP A;  4CBV A;  3E5S A;  3PO2 B;  2JE6 I;  2IX1 A;  1MI2 A;  5C3E B;  1OXX K;  2EYJ A;  1I50 B;  4H7B A;  2JEA I;  2F03 A;  5E4X A;  1JIC A;  3ZYY X;  1ZXT A;  3HRZ C;  1RHP A;  5C0X H;  1LLR D;  1A2U A;  1V1P B;  3SDZ A;  4DNT B;  2K32 A;  2EJM A;  4XIG S;  3HEJ A;  3T53 B;  4TRD A;  5FK9 C;  3I8Z A;  1SJE D;  3EVQ A;  2K28 A;  3T56 B;  1ILQ A;  4FO2 A;  1UAP A;  3NE5 B;  1ET6 A;  4K5V A;  2EJF C;  2WIN B;  5K5P A;  2K5W A;  1BCP B;  1II3 A;  1PTO C;  2OXP A;  2JYO A;  3FKI B;  2M9V A;  2N88 A;  2X6L A;  1VMP A;  1DOL A;  4IUR A;  3TDQ A;  2PMZ B;  3QWN A;  2AUK A;  5EGT A;  4RHR A;  4DFA A;  2NB0 A;  2WV6 D;  3LWU A;  3PUV A;  3A56 A;  1WTX A;  1SDF A;  3R8B A;  1JWU D;  4ZRZ A;  5T1I A;  1EFI D;  3NBI A;  5COR A;  5J39 A;  4QB4 A;  1Q90 A;  2E74 C;  2PQE A;  3MA2 B;  2K01 A;  2PZW A;  5DEH A;  4FF4 A;  3K7A B;  2MUY A;  5A35 A;  4ZUI A;  3A8I E;  3MVV A;  3OIP A;  5IGF A;  4EQO A;  2F0M A;  1AFP A;  4CGY B;  4RGM A;  2D62 A;  3PO3 B;  4DA2 A;  1DZ1 A;  2R3Z A;  3K0Y A;  1LTS D;  1XTC D;  3H94 A;  5LL6 X;  2NWG A;  1B1Z A;  3HP3 A;  2NN6 G;  1V1O A;  4UAI A;  1K8M A;  1Z47 A;  2PNR C;  1TWA B;  1TR5 A;  2O4X A;  1LAC A;  3VYS A;  5C0X I;  2BA1 A;  5KNC A;  4N9P A;  1PRT C;  2OF1 A;  2EYO A;  2NYZ D;  2SNM A;  1I4P A;  3MXN A;  5JVH 3;  3BDC A;  4G4K A;  1EQV A;  4KK7 A;  2NUC A;  2KJX A;  4G7H C;  3SK8 A;  4PQX A;  1S4Z A;  2K1B A;  5D3I B;  4PMW A;  4BBR B;  2EYL A;  4K6L A;  3IFD A;  3Q24 A;  4WFN 3;  4M1U B;  1L0Y B;  5CV5 A;  1STG A;  5DNF A;  2HCI A;  3VA7 A;  3MEH A;  2JA5 B;  2LS0 1;  3R93 A;  4KD3 A;  4FVM A;  3S2D B;  5E4W C;  2F0G A;  1JR0 D;  1SE2 A;  2AQ1 B;  1LT3 D;  3W3A A;  4HCS A;  2ZXO A;  1B4O A;  1LT4 D;  2FMM A;  1J9O A;  1YNN D;  3SR1 A;  4KI0 A;  2RSN A;  3Q23 A;  4IFD I;  4CHT B;  3GTL B;  2VXW A;  1RDP D;  2WB1 B;  4KKU A;  1BBX C;  1YNJ C;  4IUV A;  4KN4 C;  1PZK D;  3PUY A;  2E2D C;  1T5X D;  1BCP C;  5F2D A;  1Q3L A;  4RH6 A;  2LFN A;  2RDG A;  3JAM E;  2VB2 X;  1ICW A;  3GP7 A;  3CRK C;  4QF4 A;  4CJ1 B;  3ERQ A;  2DY7 A;  2QIL A;  2FFK B;  1VF5 C;  3P7J A;  4FNF A;  4IUU A;  2XNA C;  5JEA H;  1SYC A;  4CKC A;  5CV9 A;  1BCP D;  2EJG C;  2OT2 A;  5J1Z A;  1OXU A;  2NVT B;  2QDB A;  1KAB A;  1S5F D;  3TP5 A;  3I90 A;  3HOW B;  4CJ2 C;  3VYU A;  4NKL A;  1AEX A;  4WJW A;  3S1R B;  5EQ0 A;  1I4X A;  3CHB D;  3GO5 A;  1SFO B;  1F9S A;  1V1P A;  3HKZ B;  4DF7 A;  4TSS A;  5I6W A;  2L9H A;  1PTO F;  3VR3 A;  4FF1 A;  3GTG B;  4FXG C;  1QNK A;  2IX0 A;  3K5N A;  1JCK B;  5ELF A;  4RKB A;  4HN7 A;  2KEE A;  2Z8L A;  5DM7 3;  2SOB A;  1J8I A;  1CT1 D;  4QCL A;  3D4R A;  5G3L F;  3NTK A;  1U9R A;  4F87 A;  4L63 B;  1EY4 A;  1B9N A;  1M4V A;  1HPC A;  3GQB A;  4OGQ C;  3I4N B;  3KLS X;  3NWT A;  2I46 A;  1EY8 A;  3TSS A;  1WTP A;  1F9R A;  3PUZ A;  3N6R A;  3Q0A A;  4K6D A;  4I7Z C;  5FLX E;  2AWN A;  3NXW A;  3BVM A;  4BA1 I;  3SK4 A;  3R2I A;  1A3T A;  4O42 A;  3A8K E;  5DM6 3;  3RMH A;  3V96 A;  3CU7 A;  1STB A;  1B44 D;  1IW7 D;  4JK1 C;  1EYC A;  1WTR A;  1M8A A;  5K36 G;  4KY7 A;  1S5D D;  4A3E B;  3DEP A;  4Y7N B;  5IOD A;  3DUZ A;  2XWB B;  2BDN A;  1F2Z A;  1SMY C;  4X3K A;  2B2Y C;  3JAM L;  1STN A;  2K05 A;  4XYQ A;  1GUO A;  4R8N A;  4XT3 B;  1DD2 A;  1EOT A;  2B2W C;  3T16 A;  1HQM C;  5CV7 A;  5C3X A;  1B50 A;  2ICI A;  4K2K A;  4MIU A;  4XQQ A;  3Q6S A;  2EY2 A;  4ZAI A;  1S5B D;  3I70 A;  3GTM B;  2L5T A;  1PRT F;  1TT2 A;  3GTP B;  2WAC A;  2MGS A;  4A3K B;  4F8M A;  2IX3 A;  3S1M B;  1EQT A;  3HZX A;  3HOY B;  2R92 B;  1ZEQ X;  3PUW A;  5M5Y B;  3DEO A;  4HMJ A;  4HSV A;  2B2U A;  2PW7 A;  4E6I A;  2HQE A;  4DK0 A;  3FDT A;  2HDL A;  3PUX A;  3N52 A;  4XYO A;  1QB5 D;  2RA4 A;  4A3B B;  4K8J A;  1VMC A;  2SEB D;  2A6E C;  3V05 A;  1I4H A;  3BYY B;  2A73 B;  1A3U A;  4KKT A;  1WCM B;  3RLF A;  1PMR A;  5CBA E;  2B2Y A;  5I4D A;  3VR4 A;  4B9W A;  3NQI A;  5CGK A;  3X3M A;  1ZKO A;  2TMP A;  2F1M A;  4ME5 A;  2B2W A;  5JJZ A;  2F0U A;  1EEI D;  3I3C A;  4KV6 A;  3MHB A;  1BO0 A;  5CV4 A;  3WOF A;  3MC0 B;  2X6G A;  1STH A;  4DN4 M;  1SNP A;  3AMU A;  2KCN A;  2K7V A;  3DHQ A;  5FLX L;  3GD7 A;  2F0L A;  4WRD A;  4HAE A;  4V19 0;  2O5J C;  4BBS B;  2B39 A;  1ILP A;  1CTM A;  2NN6 H;  3IKJ A;  1CHP D;  5KGU A;  2B8F A;  5J22 A;  5TSS A;  4RGT A;  3F2U A;  3D8G A;  2DNC A;  5T1G A;  3TP6 A;  2NBF A;  4IQZ A;  1UUP A;  4I65 A;  4OO1 H;  4FF2 A;  3DMU A;  2YYZ A;  1D5M C;  3HOU B;  1KAA A;  2DN8 A;  2PO4 A;  3KBG A;  4LMQ D;  2HCC A;  2A74 C;  4RFB A;  3EQL C;  3MFG A;  2EDG A;  2L11 A;  5COY A;  2E2I B;  3H6M A;  2NVX B;  1RD9 D;  1TWH B;  2FMC A;  2L4N A;  1B2T A;  2A6H D;  1SNM A;  4XQN A;  1G2T A;  4KTA A;  1Y69 U;  2L1B A;  2FIN B;  3TME A;  1ONL A;  4C3H G;  4C3I B;  2D5D A;  5EBD A;  3P75 A;  1EY9 A;  4J8Q A;  4H44 C;  1TII D;  5BN4 A;  5CYU A;  3QOJ A;  4KJO A;  1HUM A;  4F7X A;  4DNR B;  4RGN A;  4KY6 A;  1PTO H;  1SYE A;  1HFN A;  1SNC A;  3T4A C;  1LTR D;  3G7L A;  3VA5 A;  1I3Q B;  4A3M B;  2QCP X;  4PNY A;  5BN3 A;  3CKI B;  1FD7 D;  1GUT A;  5DAU A;  1G91 A;  4BS9 A;  3NBH A;  1SSO A;  2R93 B;  1HUN A;  1HTL D;  4XDX A;  4U68 A;  3KUP A;  1LO5 D;  1PFN A;  2ID0 A;  2E75 C;  3VR5 A;  3LNN A;  3ND9 A;  1CFM A;  2JA8 B;  2E2J B;  2FJ2 A;  2RVL A;  3D4D A;  1D5X C;  2Z4I A;  2BE5 C;  5C4J B;  5I9P A;  2Q8I B;  2EYM A;  4IN3 A;  4KN7 C;  1LTT D;  3K59 A;  3M3Y B;  3D6C A;  1AZP A;  2XWJ B;  5KYL A;  3TZD A;  3W2D A;  3P1H A;  1PZJ D;  2XSC A;  3A7L A;  4MHE A;  3OMG A;  3OHX C;  1O78 A;  5ELC A;  4OO1 I;  1B3A A;  4FP5 D;  1D1I A;  1NR4 A;  1QNU A;  1BUV T;  5KIX A;  1NR2 A;  4LAA A;  2BE5 D;  4DU9 A;  3S1Q B;  2QEJ C;  2AUJ D;  1C48 A;  4IUT A;  1NSN S;  1MGS A;  1CQF A;  1VDZ A;  1JE4 A;  1JOK A;  1SAP A;  1VF7 A;  2CVR A;  3H3V C;  2KUM A;  3BDO A;  2F0I A;  1WD1 A;  1E2Z A;  1GHJ A;  3OOC A;  1FNW A;  2CQA A;  1CI3 M;  4QUC A;  4IAL A;  5E3F A;  1YNN C;  1BF4 A;  1RTO A;  1K8O A;  4R8I A;  1I4Q A;  3EFX D;  4C3H B;  2LKV A;  5C0X G;  1ENA A;  3TZU A;  2RQX A;  4DK1 A;  1ESR A;  2IL8 A;  5C6A A;  3S15 B;  4DXF A;  2F0K A;  4FYD A;  4DXG A;  4ZKC B;  1GUG A;  3BZD B;  4ZKB B;  2DY8 A;  3KF8 A;  2I07 B;  3MFY A;  4YIJ A;  5JAV A;  2SNS A;  3GTQ B;  3R2T A;  5C4H A;  2MPM A;  4C3J B;  3MAQ A;  3OW7 A;  5JPM C;  3DWQ A;  1SNO A;  4MN3 A;  1PFM A;  1MD2 D;  2PZU A;  2EPB A;  4EVO A;  1QG7 A;  2XIW A;  4AYB B;  4PV1 C;  3M4O B;  1PLF A;  1WVL A;  5M3F B;  1I4G A;  1H9J A;  1IYV A;  1FGB D;  3O13 A;  1RKN A;  1H9K A;  4RWS C;  1RF2 D;  4IFD G;  1TWG B;  3TN2 A;  3U9O A;  2JA7 B;  4IUQ A;  1D2B A;  1ZYR D;  2NVY B;  3DWP A;  4FXD A;  1F2M A;  2XRS D;  5CMD A;  3TBI B;  3SXH A;  4XT1 B;  4ODG A;  4CJ0 B;  3P20 A;  1GJX A;  1D6E C;  4ILW A;  1XXG A;  2E76 C;  2X69 A;  4WOR A;  1TS3 A;  3RZO B;  5CBE E;  2O5I C;  1HHV A;  1EIG A;  3EA6 A;  3NWS A;  1UNS A;  1FYC A;  1OXT A;  4HSP A;  1SYG A;  2J0T D;  2EZV A;  1KLG D;  2HUG A;  3RD4 A;  1T5E A;  1GXD C;  4U67 3;  2V4D A;  1HFG A;  2CW0 D;  4ID6 A;  1WTW A;  1CHQ D;  1D1K A;  1BOS A;  2LY7 A;  3D31 A;  4OIJ A;  1O80 A;  1EU4 A;  4B9X A;  1PFB A;  3MZ5 A;  1TWC B;  1H9S B;  1JOQ A;  3ONA B;  1IW7 C;  1V43 A;  1QCB D;  1FNV A;  4FF3 A;  4QMG A;  5M5X B;  1QOH A;  1DXM A;  4HCE A;  3VR2 A;  1CA6 A;  3OPO A;  4X3T A;  3M85 A;  1RJT A;  1TS5 A;  1FR3 A;  3NSW A;  3KBX A;  1D5Z C;  3NPP A;  2F0W A;  4KD4 A;  4LK1 C;  3S2H B;  5ELD A;  4RA8 A;  2KHS A;  2MP1 A;  2H1E A;  3A8J E;  3G6J B;  5JVG 3;  1LTA D;  1Q1E A;  5M9O A;  2B2U C;  1IL8 A;  1ET9 A;  1DOK A;  1Q1B A;  4K14 A;  2KEC A;  1BQQ T;  4S3S A;  2EYP A;  1ESF A;  1GUS A;  2Z1C A;  2F4I A;  1LTI D;  2AQ3 B;  1BDO A;  1SYD A;  1A6X A;  4K2L A;  1F2L A;  4HED A;  5EJW A;  4K5X A;  1TY0 A;  5ELE A;  3HOZ B;  3VYT A;  1LTG D;  1CK1 A;  2G9D A;  4ZYS A;  2VUM B;  4RHS A;  4C1N K;  1GUW A;  3HOX B;  3H0G B;  2L12 A;  4H13 C;  4C3I G;  1H9R A;  3DM1 A;  3GV6 A;  1DJR D;  3HS0 C;  1HA6 A;  1K83 B;  2R7Z B;  1CZW A;  1QJO A;  1STE A;  2B2V C;  4IUP A;  5EBC A;  2VNU D;  1EY6 A;  2RKS A;  2H4O A;  1UEA B;  4X3U A;  1LT5 D;  1IYU A;  4G57 A;  1PXU A;  3M7G A;  2F0J A;  5JEA G;  1MSH A;  4O1N A;  2Y0S B;  3X3N A;  1GUN A;  1O7Y A;  2TSS A;  1NAP A;  3K5L A;  1U4P A;  3S9W A;  3BDL A;  2BA0 A;  5CR3 A;  5I6Y A;  5KYI A;  3OMC A;  1O7L A;  4LJZ C;  4KMU C;  1WTV A;  1B9M A;  3E6Z X;  1F2Y A;  5EPK A;  1SE4 A;  4L6T B;  3BG3 A;  2YU9 B;  2A5H A;  1JOO A;  1QIL A;  3K57 A;  2K5D A;  2B8G A;  2CHB D;  1Y1V B;  2C5C A;  2AWO A;  1Q8I A;  1TVX A;  5ELB A;  1G6Z A;  1SJH D;  3NTH A;  5KNB A;  1TS2 A;  4CKB A;  2EOT A;  1SND A;  1BCP F;  3FPU B;  1Q12 A;  3V2T A;  2F0H A;  4A3J B;  1TKW B;  2M00 A;  5A2Q L;  1U4L A;  1OO9 B;  1DON A;  3AB9 A;  4DAY A;  4A3F B;  2B2V A;  1G8Z D;  2WKD A;  2A6H C;  3KLR A;  5I9O A;  1JQY D;  2K33 A;  3Q22 A;  1IKL A;  4J6H A;  1HXY D;  1E0B A;  4NW2 A;  1R9T B;  5CV8 A;  3HG9 A;  1EZ8 A;  3I73 A;  3K58 A;  1KNA A;  1R4Q B;  5CC4 A;  2BCO A;  2KVM A;  2A68 D;  2D2C C;  3FRP B;  1QWY A;  1F9P A;  4H0L C;  3MXG A;  3DXJ C;  3ITP A;  3MXU A;  1Y1W B;  3C1E A;  1SNQ A;  4KKS A;  1AP0 A;  1RCV D;  5FO9 B;  3J81 E;  5D14 A;  4QIW B;  1KTK A;  3QOL A;  3PMF A;  5CV6 A;  3C3L A;  4K5W A;  3QB3 A;  1FNU A;  2ZT9 C;  1SXT A;  2NVQ B;  3QIA A;  4HTH A;  4R9W A;  5C4Z A;  3BYT B;  2IJ0 A;  1NCV A;  3ERO A;  5C44 B;  2ZXR A;  4XTC S;  3MTS A;  3OWE B;  1AW7 A;  2F3W A;  5C4X B;  3K5O A;  2L0C A;  1BNZ A;  1JB3 A;  1VCI A;  3J7A F;  4C3J G;  5C0X J;  3NP8 A;  4EGV A;  1H9S A;  4GZY C;  5EKK A;  4EQP A;  1C8C A;  3R3O A;  2GA4 B;  1Y8N B;  1HCZ A;  1TQO A;  1I6H B;  1PTO D;  4OHJ A;  1LTB D;  1CA5 A;  5EKI A;  3FEW X;  5I2Y A;  4IFD H;  3HGB A;  1A15 A;  5HUR A;  3RUZ A;  3WDN A;  4QUF A;  2BOS A;  2KA7 A;  1WD0 A;  2JSO A;  3WOE A;  3H09 A;  3S17 B;  5EKL A;  1SE3 A;  5G3L D;  4NMZ A;  2F0O A;  2NN6 I;  1I6V C;  2SDF A;  3PIO 3;  1SBB B;  1SYB A;  2DNE A;  1EY5 A;  2NTS A;  1E2V A;  5IGB A;  2RSO A;  2WKC A;  4ZQ3 A;  4K8I A;  1EEF D;  3SK5 A;  1EY0 A;  1JOR A;  3IFT A;  3CRL C;  5IGC A;  2B63 B;  4IFD J;  1X3P A;  4B08 A;  2VB3 X;  4TQU S;  3TP7 A;  1W6J A;  1S5C D;  2F0S A;  1L0X B;  2M2L A;  2RDH A;  4RAU C;  2EYF A;  1HA5 A;  3IAY A;  4PMB A;  1CM9 A;  4L8J A;  1ML0 D;  2JEB I;  3FMC A;  5D65 A;  2IW3 A;  1PYW D;  1SYF A;  2FHT A;  3NUC A;  3I4M B;  3J81 L;  4OO1 G;  1KDB A;  1GHK A;  3S1N B;  2R6G A;  4Q0F A;  4A3I B;  1EIH A;  4A3D B;  2KQ3 A;  2K04 A;  1OXV A;  2WP8 J;  1XX8 A;  3D6W A;  2XVS A;  3GV3 A;  4DAP A;  1DCZ A;  5FO7 B;  5NUC A;  5M5W B;  1F9Q A;  4ULL A;  4X3S A;  1S5E D;  4RCO A;  1X32 A;  4IZ8 A;  5HGT A;  1LAB A;  1PRT D;  2K6A A;  2ICE C;  5K36 H;  1ENC A;  2JXM B;  2OEO A;  5KRU A;  1KDC A;  2EXZ A;  1G29 1;  3CQZ B;  5IGD A;  4BY1 B;  1Z7T A;  4Z9C B;  5LL6 S;  2JP1 A;  3DWA A;  2F0N A;  3LX0 A;  5ISR A;  4BY7 B;  4KHV A;  3K6O A;  1U4R A;  1ZYR C;  3NTI A;  1NUC A;  2D9U A;  1MBY A;  1HQR D;  4ZUJ A;  1ROD A;  2XN9 C;  1PZI D;  1CQV A;  2EY6 A;  1KDA A;  3L7Z C;  3IL8 A;  1WTQ A;  4XXE A;  3GTO B;  5IT9 E;  2PW5 A;  3SVM A;  1AN8 A;  1EL0 A;  1JWS D;  5E1F A;  1TY2 A;  3ND8 A;  2E2H B;  3LWE A;  4M8A A;  2F0V A;  1YNJ D;  1GOZ A;  3UI2 A;  2PYK A;  2JA6 B;  3U9S A;  5JOB A;  4PMC A;  4N9T A;  4G7Z C;  3QJY A;  3QG1 A;  3S16 B;  2EY1 A;  2CW0 C;  3A7A B;  5IOC A;  4P2C B;  5M3M B;  3C1F A;  3EJI A;  4HR7 B;  1LV9 A;  4RCN A;  4HMI A;  1EU3 A;  1BR9 A;  2N55 A;  3SEB A;  1JWM D;  1R4P B;  3SK6 A;  1DM0 B;  2B2T C;  2EVB A;  2NZ1 D;  2F0P A;  3SHL A;  5I2X A;  2R61 A;  5JPN C;  1EYD A;  2J7Z A;  5C3W A;  2AQ2 B;  2XRQ D;  2NTT A;  3L3O C;  5JEA J;  4C56 C;  3OWF A;  3E0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...