1LT3D

Heat-labile enterotoxin double mutant n40c/g166c
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Crystal structure of heat-labile enterotoxin from Escherichia coli with increased thermostability introduced by an engineered disulfide bond in the A subunit.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 28
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt3D00
1S5ED 1JWSD 2AQ1B 3DWPA 1V1PB 2TSSA 2XRSD 3EA6A 4RHSA 2XRQD 3DWQA 1JR0D 1D5XC 1EEID 1QILA 4K6LA 1LTBD 1TS2A 1TY0A 3BVMA 1RD9D 3R2TA 1SJED 1B44D 1FNWA 1HTLD 1V1PA 1JWUD 1LLRD 1SE2A 1L0XB 1I4GA 1CK1A 1SE4A 1PTOB 2ICIA 3R8BA 3URYA 5ELFA 1UNSA 1EFID 1SBBB 1I4PA 1EU3A 1LTSD 1ET9A 1PZID 2IJ0A 3TSSA 1DJRD 1LTAD 1V1OA 3MFGA 4L63B 2WV6D 4RGMA 1CHPD 1ESFA 1JWMD 5I4DA 5D3DA 4RFBA 1PTOC 1AN8A 1LT5D 1PTOD 3CHBD 2XNAC 1RCVD 5FKAC 5ELDA 1XXGA 2XN9C 3BVGA 3BZDB 1HA5A 1FNVA 1CHQD 1LTGD 2G9HD 1PYWD 1AW7A 2CHBD 3R2IA 4BWGB 1FD7D 1DYQA 1FNUA 1KLUD 2RDHA 4L6TB 4RGNA 5D3IB 5ELBA 4C56C 2R61A 1XTCD 1D6EC 1F77A 5TSSA 1PRTC 2NTSA 1S5BD 1PRTD 4DXFA 1RF2D 1SJHD 1SXTA 1PTOF 3MC0B 4O1NA 5ELCA 1TS4A 1LTTD 1FGBD 4DXGA 2Z8LA 3BVZA 3DWAA 1SEBD 1PRTB 2O2LD 3BYYB 1S5FD 1EEFD 1I4XA 1RDPD 4Z9CB 1EU4A 1TS3A 1JQYD 5FK9C 1HXYD 1PTOH 1BCPB 1HQRD 4RHRA 1I4HA 4OHJA 1LTID 2NTTA 1KLGD 2IPKD 4ZYSA 2QILA 2SEBD 1LTRD 3O13A 1EWCA 3W2DA 1KTKA 1PZKD 3EFXD 1MD2D 4RGTA 1LT6D 1STEA 1D5MC 3SEBA 2QEJC 1BCPC 1BCPD 1G8ZD 1LT4D 1I4RA 4RH6A 1PZJD 1ENFA 1ET6A 2J4XA 1B1ZA 1TY2A 1S5CD 1L0YB 4RCOA 1GOZA 1JCKB 3V05A 1S5DD 1CQVA 1SE3A 5ELEA 1LO5D 2RDGA 3GP7A 1T5XD 3OWEB 1BXTA 1PRTF 4RGOS 4UDUC 2AQ3B 4TSSA 3BYTB 3KLSX 1M4VA 1D5ZC 2AQ2B 1BCPF 1TS5A 1CT1D 1UUPA 1I4QA 1LT3D
chains in the Genus database with same CATH superfamily
4X3UA 3WWVA 3M3YB 2R7DA 4LF7Q 1WCMH 3U9SA 3RZOH 1NMFA 2EJMA 1FYCA 4M1UB 1JWUD 3ONAB 1WTRA 3STBC 1EWHA 2IWHA 5ISRA 2F0UA 3A55A 1LTSD 4YWKA 5CV9A 4AQYQ 2R6GA 1X32A 1CA6A 4LF5L 4UY8C 3NHHA 5C6AA 1FL0A 3AB9A 1VQMA 3I91A 3MZ5A 3T51B 2H5XA 1XMOQ 4EQOA 1JOOA 1PYSB 5DNFA 3ICEA 3E5SA 4FF3A 4H0LC 4DPGA 3VR2A 3PO3B 2G9HD 4C3HB 1A63A 2D5DA 5ELBA 5K36G 2K6AA 4KKTA 4HCSA 1VQ6A 1XTCD 2RSOA 4JYAQ 2VQEL 1PRTC 1RHPA 1D1KA 4KY7A 3ULPA 3CCVA 4JI2L 5KNCA 1LTTD 4A3MG 4DR6Q 2R92B 5H1SE 4A3KG 3NEMA 1BDOA 3MXNB 4LUVA 5CORA 2QW7A 2EXDA 1EQTA 5KNBA 2DN8A 3VR3A 2A68D 4A3GG 3IRBA 1H9SA 4N8FA 5CV5A 4R9WA 2EYFA 2SEBD 4LF8Q 2UXDL 2BH8A 3K7AB 4K8IA 3U4ZA 3H0GH 1D5MC 2BH2A 1M1KC 1BCPC 2GA4B 1VQ8A 4X62L 1Y1WG 5BR8Q 4LFBQ 3D0FA 2F0SA 2PNRC 2V1CC 4QMGA 1V43A 2EY2A 4DV4L 3GTJH 1Q86C 1JCKB 1RTOA 4IJHA 3S16H 1SE3A 1IBMQ 3M7GA 2A6HD 1WCMG 1EYGA 1HZBA 4GN5A 3U58A 2Z6KC 3Q22A 3RLNA 1TWFH 2UUBL 1F9RA 4O1NA 5HGQA 4DF7A 2TSSA 3FDTA 4RHSA 1SMYD 1DZ1A 2ASBA 4A3LG 2F0PA 1SNOA 3BZKA 4IN3A 3PUWA 4EQ5A 5LHY1 3PCOB 2SNMA 3NUCA 4KTAA 4NXMQ 2X6LA 5EPJA 1PMRA 1SNPA 4BY7B 3P1HA 2NVTB 3S2HH 4HMIA 5AJ3L 2Z4IA 3T53B 4PQXA 3T1YQ 3HOZH 1VQ5A 2F0DA 1J8IA 2K75A 1PTOC 5C44B 3A0JA 4ABNA 3DXJC 3CHBD 5JEAJ 3PIPA 4DFAA 4C2MH 1NBWA 2ZM6L 1Z9FA 2PMZE 1TXYA 3TP6A 4A3EB 1OXXK 1HNXQ 1YNXA 1CKNB 1EYCA 2R7FA 5D3IB 4C56C 4JI0L 3J81E 2MQHA 1ML0D 4OO1H 1I5FA 2HIVA 2L4NA 2JA6H 1Z7TA 2IL8A 1FJGQ 1H9KA 1S4ZA 1PHJA 1AP0A 1GJXA 4HSPA 5C4HA 4R8IA 1EU4A 4EQPA 1JQYD 1CSPA 1BCPB 3H0GG 3TZUA 4AIMA 4QQBX 2L15A 3A8KE 1KLGD 2EPBA 3TP7A 1XNQL 2XSCA 3W2DA 1UE1A 4A3FG 2UXBQ 4IALA 2JA7B 2F0KA 3K6OA 3PMFA 1F9QA 5G3LF 2NBFA 4RH6A 3KLWA 4GLVB 5CMDA 4ZUJA 2ZXOA 1KIXA 4NKLA 1E22A 2R93B 5AFWA 3GTGB 1CA5A 2NVQH 1PH3A 2H1EA 4N9TA 2I07B 3AMUA 3M4OH 4DR2Q 3S2DH 3GDEA 2ATWA 3NPPA 1IYJB 1HCZA 2AQ1B 3T16A 5LL6X 1HUNA 3EA6A 3U50C 1TWAB 4RKBA 4DR6L 5CV4A 1WTOA 5IT9E 1LTBD 2KUMA 2KEDA 1SR3A 4POFA 1YJ9A 1FNWA 2K5NA 2E2JB 3IAYA 1XTDA 3HOZG 1PTOB 4CKEA 1XX8A 1GM5A 3G7LA 1EZ8A 5COYA 3KBGA 5J39A 1ET9A 3RLOA 1VQPA 2PZWA 2DY7A 2LY7A 2VXWA 3NTIA 3HOWH 2L55A 1ICWA 4DR7Q 5L37A 2F0JA 1SFOH 1KL9A 1IXRA 1ESFA 1QZGA 4NXNL 5D3DA 5FLXL 1W6KA 3NELA 4OO1G 1GUSA 4LFBL 1TKWB 4LFAQ 2JA6G 3Q24A 4KKSA 1JC7A 3KJOA 3FMCA 1LTGD 1KLUD 1VQBA 3VR6A 1IBML 2A8VA 1F77A 2OCEA 3ZYYX 3GV6A 3D8GA 2RQXA 4UP8A 1C9OA 4DUZL 4DKAC 3GTMH 3BVZA 3CMAA 3TQYA 1YNNC 1I6HB 2E2HH 2UUAQ 4DV7Q 4N9PA 1ZYRD 4RHRA 1W6JA 3PIP3 1F2LA 4TQUS 4OWWB 4K2KA 2BOSA 3F2UA 2K1BA 4NXML 1LV9A 2WINB 1MJEA 1Y14B 2WACA 3ERQA 3I4NB 2JYOA 1EFWA 1F9PA 2D2CC 1IHZA 3LX0A 4P75A 4DN4M 4P74A 2AMCB 5CBEE 4GOPA 3BDOA 3GD7A 3HOVH 4C1NI 1G8ZD 5M3MG 1HPCA 2A74C 4IUPA 5EKIA 1EWIA 4PMWA 4WFN3 5FJ8G 5KYIA 5FLMH 1ZYRC 4XXEA 3CQZB 3JAME 1KRTA 4NP5A 4X66Q 3MXNA 5BN4A 1R4QB 2KHJA 1JICA 3KLSX 2AQ2B 1CT1D 3OPOA 1Q7YC 1DOLA 3CCMA 2F1MA 5CYUA 3GTPH 1O7ZA 1BUVT 3S17B 4CJ1B 4LUZA 5KIXA 1FJGL 1QILA 3QIAA 3Q8DA 4WJ4A 1WTVA 2HDMA 1VS0A 1Y8OB 1SYFA 2WAQB 3MA2B 5JEAH 3HOXH 4ZKCB 1Q3LA 5HY6A 1NAPA 2VY3A 3E0JA 3J80E 3RR5A 1HR0Q 2YYZA 4OWTB 4FP5D 5IYDH 2E2IB 2PW7A 2E8GA 4IQZA 4RGMA 4XTCS 4K5XA 3ND9A 1HNZL 2XNAC 2RHQB 5FKAC 1MGSA 3L9AX 4A3BH 1I6VC 3BZDB 4DV2Q 1TWHH 3NXWA 1GXDC 2O5JC 3CD6A 3ULJA 2QF7A 1AW7A 2F3WA 4QB4A 3PO2G 1FNUA 3G4SA 1ENAA 4OONA 1EQRA 4OO1I 3ERSX 1PA6A 4OX9L 1WTWA 1SJHD 1SXTA 1N32L 1YHBA 2K5QA 5C3EH 4DR2L 1G91A 5EPKA 2NYZD 1Y1VG 1TT2A 2Z8LA 1SEBD 4DAVA 3HKZG 1PH4A 1H9SB 2XWBB 3S15H 4FXGC 1TS3A 1CZGA 1YHAA 2OEOA 3IFTA 4L5RC 3FVQA 2BE5D 2NTTA 4O0AA 3I4LA 1STYA 1X3FA 2EYHA 1PDQA 4NMZA 5FLMG 1EY0A 3EFXD 2NB0A 1X6OA 1ILQA 4Y7NH 1CKNA 1LT6D 2L5TA 3DM3A 2DY8A 1EL0A 1PZJD 1ENFA 5CR3A 5E1FA 5C4XH 2F03A 3ER0A 4JG2A 4LFAL 3SR1A 5I9OA 5IT9c 2YU9B 4UP7A 4JV5Q 3BZCA 4ME5A 1LO5D 5M5WB 4LF9Q 1KDCA 2NVXH 2AWOA 2CCZA 2JE6I 2KCNA 1QVCA 4JI7L 4KHPQ 1NY4A 1K0RA 1XMQL 3A7LA 4QJFA 4JK1C 1S5ED 3GTKH 4BBSB 3AFPA 2HQLA 1KXLA 1CZWA 1UEBA 1RD9D 2EJFC 2KOLA 4GNXC 3TBIB 1K83H 2UUAL 1CK1A 1SE4A 3R3OA 4DV7L 1JMCA 2MFIA 4KK7A 2PQEA 5D65A 3TP8A 3M85A 2DJFC 1A15A 1IW7D 2K01A 5GQOA 3CRKC 1PFBA 3PSIA 2EYJA 3QR8A 4JBKA 3LWUA 3SXHA 5A2QE 5ELDA 4IURA 2CFMA 4XT3B 1KDAA 4RG1A 1KDBA 4TVAB 2MO0A 1S3OA 2IW3A 4R4CA 2LXKA 2B2TC 4L6TB 2FJ2A 4X66L 4BBRB 3RN5A 4L5QA 3K5OA 4ID6A 2B3GA 2RSNA 3V2TA 5LMNL 4HJ5A 2NZOA 1LACA 3PUYA 2ICEC 2WFWA 5CBAE 3K57A 4IUUA 4JI3Q 3EROA 4R4TA 3MVVA 1Q46A 1STBA 4RCNA 1YNJC 2VB3X 1WI5A 2JXMB 3CCJA 1NCVA 5C0XJ 4GN3B 4XYQA 1UE5A 4C3HH 3H3VH 1Y69U 4X65Q 2YTXA 1E2WA 3RLFA 4HCEA 4YY3Q 2JSOA 1KAWA 1EY7A 3FPPA 4HMJA 3I4MB 1DD2A 1NR2A 4K5VA 1HR0L 2MP1A 2WB1B 1WJJA 2EJGC 1BF4A 2XWJB 2YTVA 2R7ZG 2K5VA 5J3BA 4DAYB 1S72A 5IYBH 3GQBA 3U4VA 3CCEA 3N52A 4DV2L 3OHXC 2YTYA 1HR0W 1K8OA 3NQIA 4LWCA 4GNXB 2B29A 4KJOA 5IP9H 2CVRA 3K7AH 1BR9A 4BY1H 2UXCQ 2K03A 2L1BA 1L1OC 5FOBB 5IGGA 3K5MA 1N33L 4X3KA 5JOBA 2I5MX 4OIJA 2HD3A 1A3VA 5LMUQ 2I0QA 3STBD 2WAQE 3HZXA 3D3RA 4UP9A 4EQNA 3KF8A 4A3IB 4WJWA 4C3JB 3BS1A 4BA2I 4DV0Q 3HP3A 1LTAD 1PH2A 4YWLA 3GTLH 4ULLA 1C4QA 4DGZA 3S1MB 2I46A 1UE6A 2F0IA 2B8FA 2XTIA 2WKDA 3I8ZA 3PIOA 2ZXPA 4AYBG 3VR5A 4BY7H 1HA5A 1IYVA 2NVTH 3MEFA 1K8AC 1T9HA 4RGNA 2RDHA 2DNCA 3Q0AA 2DGYA 2JA5B 4R8NA 1PRTD 4WJ3M 3VDYA 5M3FB 4C3HG 1TS4A 4LUOA 4X64Q 4CJ0B 4Q0FA 1YI2A 1EY8A 4B3SL 2HDLA 5KGUA 2O2LD 4HJAA 1U4RA 1EIHA 2KHIA 3DHQA 1I4HA 1VMCA 3SK5A 1F2YA 2UUCL 1YJWA 1RL2A 4GOPB 2PQAB 3KLRA 1XYIA 2F0WA 1KQSA 5M5XB 1D1IA 1BCPD 1ESRA 4B3RQ 2A6ED 3BDCA 2KCCA 4A4IA 4B9XA 2RA4A 5IP9G 2F0VA 4BY1G 4UHVA 2TMPA 2NZHA 4OL7A 2Q2TA 3H6MA 3A8IE 3CCRA 4ALPA 2AQ3B 1PH9A 2F0OA 3OW7A 4BS9A 4DUYQ 3S1RB 4JI8Q 3BYTB 3S1QB 3K5LA 4MIUA 1I94Q 5IP7H 2CH4A 1SYEA 1GVPA 2JA7H 1OXVA 4PMBA 1YVCA 1G51A 5EPLA 5IOCA 2A6EC 1D5XC 2VB2X 1EEID 1OXUA 4P72A 4JI3L 4K6LA 1U4PA 2BDOA 1ICFB 3DUZA 4JOIC 3OW2A 3SDZA 2R93H 3GTGH 1WYDA 4DNRB 1K8MA 3URYA 5ELFA 4IUVA 1EOVA 2N88A 4B3MQ 4X65L 4A3MB 1J5EL 4A3KB 4A3CH 4ZQ3A 4JC0A 3CCQA 1DJRD 4X3TA 3QJYA 2JK8A 1B4OA 5KRUA 5IODA 4DR1Q 5C5MA 1TWAH 2Z6BA 4CBVA 1WD0A 3CCSA 4A3GB 4HIOA 1PTOD 2CQAA 4KMUC 2E2JH 3K59A 4TRDA 4OGQC 3PUXA 3EQLC 4LK1C 4DU9A 1B9MA 2K28A 1E2VA 3VA7A 4FVMA 1LUZA 3RN2A 3E3XA 5C0XH 4JW0A 1EY5A 3J7A5 1PFMA 1SYGA 2A69D 1H9RA 3MXGA 4C3IH 3LGJA 2PZTA 5DM63 1TQOA 1N36Q 1NMGA 3NE5B 1AE2A 5JJKA 1ZEQX 1PRTB 1QWYA 1KC8C 1WVLA 3NTHA 3CAMA 1HXYD 4R4OA 1BBXC 2F0LA 2AHOB 1PH7A 2EXZA 3H3VI 2ZTCA 3PIO3 3QOJA 3JAMi 3HGBA 2A69C 1A3UA 3MXPA 2WB1E 4QGUA 3C1FA 2WP8J 1I6HH 4MN3A 3PQIA 4YCVA 2K5HA 4FYDA 2VW9A 4LF7L 2EVBA 4A75A 2BA1A 4ZAIA 1AFPA 3H94A 2F0EA 2EY1A 1STHA 5J1ZA 1N34Q 2IHEA 1H9MA 3GTOB 1IZ6A 4XQNA 2K33A 2ZTEA 2HIXA 2E5LQ 2ICIA 4AQYL 1WOCA 3J80i 2D0OA 4IFDJ 4X64L 1ZKOA 5FO8B 1B9NA 1V1PA 3CQZH 4EGVA 3KFUA 1ONLA 1XMOL 2MGSA 1SROA 5E4XA 1G6ZA 2NVYB 4L5TA 3T1HQ 1EU3A 4ODGA 1JB3A 3J81j 4DAYA 1SNCA 5EJWA 2F0MA 2E74C 4J6HA 3A5ZB 3EN2A 1YEZA 4GLAC 4V190 4JYAL 3SK6A 4LMQD 3H0GB 4DAPA 1Q82C 4GNXA 5C0XG 2Q8TA 1TR5A 4B3RL 1XXGA 1E1TA 2Y0SG 1VQ7A 2SDFA 4C3IG 1DM0B 3ZJYC 3NSWA 5JVH3 1GUTA 1FNVA 5KEEA 3GTJB 1U9RA 4A3FB 1VQDA 4K14A 3RZDB 2M9VA 3MXUA 2R61A 1B3QA 4DR5Q 3CC2A 3SE0A 4DUYL 2E2IH 4JI8L 5IGBA 4LF8L 1I94L 1A2UA 1TVXA 1YIJA 4LF6Q 4Y52H 2P5ZX 3NK9A 4WRDA 3J7AV 3KF6B 2ES2A 5T1GA 1YNND 2B2TA 5BR8L 4NW2A 3VYSA 1PFNA 4X6AH 1SYBA 3J7ZC 2Z4HA 3P7JA 1NE3A 4B3ML 3S2HB 1I50B 4BXXH 3NQTA 1EIYB 2EY5A 3VA5A 3W3AA 3TS0A 3S1NB 2FHTA 3J7AF 3HOZB 4DR1L 3E9HA 3W5OA 2ZJRA 5DM73 1B1ZA 5GADC 3QOLA 3OIQA 5EBDA 1GOZA 1UWVA 3QO2A 4XT1B 1STNA 4QUFA 5I6YA 5IT9L 4A3DB 2K52A 1II3A 1JOQA 4PG3A 2HCIA 1IYUA 4JI5Q 1BCPF 1TS5A 2AWNA 4XYOA 2K7VA 4IUNA 4LF4Q 5C3XA 3L7ZC 4HTHA 2N78A 2PQAA 3T1YL 2XRQD 4X3SA 1N36L 3KDFA 3KF8B 1TS2A 5CV6A 4C1NK 2EDGA 3MFYA 2OXPA 1TWGB 3HG9A 1QVGA 2VZAA 5M5WH 1SN8A 1BVSA 5EKKA 1UNSA 5M9OA 3HOYB 1RODA 2RKSA 1HZCA 3DEOA 5E7NA 1HNXL 2JA8H 1BKBA 1L1OA 1SYCA 2B63H 3W1BA 3TSSA 4DV1Q 1EIFA 5D14A 4DK0A 4BBSH 1RIPA 2A73B 1AH9A 2BDNA 2RF4A 1VDZA 2X6GA 4HIKA 1RCVD 3I90A 1HTPA 3HOWG 2R3ZA 4OWXB 4LFCQ 3BVGA 2K14A 2OTJA 1EIGA 4R4IA 4EX5A 4GKJQ 2HT1A 2NVQB 1N34L 1HQMC 1XWEA 1D8LA 1T5EA 1U5KA 5M3MB 5C0XI 4GZYC 1D2BA 3Q6SA 3H91A 2NTSA 4DXFA 4A3JH 1PTOF 4ZK9B 4IOAA 3J81c 1HNWQ 3A74A 1X65A 2F0FA 2UXBL 4PMCA 2PI2E 4LAAA 3CP0A 3NBIA 2FXQA 3HKSA 3D4WA 2NUCA 2F3VA 1PH5A 4I7AA 1Y8PB 1GHJA 4HR7B 2QCPX 3T56B 1VQEA 5JVG3 3F2BA 4F7XA 1O7IA 3AFQA 2K50A 1EWCA 2JQOA 4DNTB 2RCNA 3RNUA 3L0OA 2K4KA 1RJTA 2QEJC 4O42A 1G291 2NZ1D 3GV3A 4M8AA 1MSGA 5DLQE 3JC66 2NWGA 3M4YA 2VQFQ 1V1QA 4HAEA 1VQGA 1S5CD 4NPSA 4EVOA 5EKLA 3TN2A 1PH1A 4IFDH 1KAAA 2E2DC 2EY6A 5KYLA 4A93B 4YCWA 4GN4B 3HOVG 4YCUA 1CKMA 3I4MH 5C5LA 4CDDC 2HCCA 5IWAQ 4DR5L 2FINB 2F0GA 4DV5Q 2SNSA 1HJPA 1HFNA 1P16A 3WOEA 4DR7L 4K0KQ 2ZXRA 1JR0D 2LFNA 2JA8G 4LF6L 5T1IA 1I3QB 3EJIA 2B63G 3PO2B 4IZ8A 3HS0C 4RKLA 4P2CB 4BBSG 3S14B 5F2DA 4DV3Q 1F9SA 1JORA 5IGFA 3UDFA 5JAVA 4QF4A 4I65A 1Y1VB 2VUMH 4YIJA 3HRZC 3HKZB 1V1OA 3Q23A 2KBNA 3VYUA 3MTSA 1ILPA 5C4ZA 4JOIA 5CV7A 3M7NA 5LL6S 5JEAG 3HOXG 2O5IC 4A3JG 1MI2A 4KJNA 3TP5A 2L0CA 5I9PA 3FKIB 5IYDG 4A3IH 1CHQD 1PYWD 2CHBD 3U9OA 2Z6KA 4LF5Q 1GUGA 3CPFA 1L0WA 2Z0SA 3S1RH 3R93A 1RF2D 1X55A 4A3BG 1SDFA 1C7YA 3IL8A 5ELCA 1DCZA 3BDLA 2GN5A 3K5NA 4KI0A 2KEEA 3M3YH 4LF4L 1FGBD 1CUKA 1Q1BA 4IO9A 5DAUA 3BYYB 3I70A 3NWSA 1GUWA 1YNJD 1X3QA 2ZJQA 1TWCB 2LSSA 4K6DA 2RBMA 5C3EG 4B08A 4APVA 2MO1A 3K0YA 1LTLA 2IPKD 4GLXA 2KA7A 5M3FH 1VQOA 3D31A 2ID0A 4JI2Q 2C35B 4IFDG 1GD7A 1MD2D 5JPMC 1VQKA 4IPDA 1R9TB 1QNUA 1O80A 1ET6A 1H9JA 2I5LX 3OSOA 4IPCA 1ASYA 1S5DD 3PO3H 5EQ0A 3KF6A 4UDUC 3MHBA 2F52A 2UXDQ 1Q90A 4J8QA 2FMCA 1SNDA 1M4VA 3JAMc 5C4XG 1PFSA 1B7YB 3SGIA 2HQEA 1HHVA 1V1PB 2R92H 2XRSD 3SK8A 1SMXA 1Q81C 3DWQA 2VUMG 2CW0C 4POGA 2ZT9C 2KHSA 1HNWL 3K80C 3FHWA 1E24A 1EYAA 3I7FA 2F0HA 1SE2A 3IKJA 1I4GA 1A2TA 2I5HA 2N55A 3HFZB 2N3SA 4JBWA 5FO9B 1QZHA 2N49A 3H09A 1B70B 3S1QH 3AU7A 3WDNA 2PW5A 1SAPA 3MFGA 2B2WC 1X3GA 2WV6D 1UAPA 2LMCB 4Y7NB 2JN4A 3NENA 3J80c 4HEDA 1AN8A 1LT5D 2KQ3A 3P75A 3DEPA 1KHIA 1YBYA 4V0BA 1PV4A 2XN9C 2OT2A 1XPUA 5G3LD 2ZJPA 2FMMA 1X3PA 2RCFA 2B2VC 2VQFL 1JJCB 5AJ3Q 4HIDA 2Q2UA 1ASZA 1EY9A 3E9IA 4A3KH 1OXTA 2B2UC 2D0PA 1AZQA 4JI4Q 1D6EC 2M00A 5TSSA 4MHEA 2C5CA 2R7ZB 1GHKA 1SNMA 3I56A 1JJ2A 3PV0A 4A3GH 3L3OC 4KLKA 3GTKB 2EYMA 3ITPA 4DV5L 2JJQA 4E6IA 1OTCA 3GTQB 4K0KL 2QDLA 1LYLA 1KD1C 3C1EA 2ZM6Q 1M90C 4MNOA 4CHTB 3HOUB 4FO2A 4G7ZC 4CDEC 2D62A 5M5YB 1UEAB 4R1JA 3ND8A 1FR3A 2HHHQ 4JV5L 4OIKA 2VS1A 4LF9L 1PZKD 4KHPL 4TKOB 1W2BA 3PO3G 2YV5A 1TU2B 4FXDA 1STEA 1PYBA 1VQLA 4KN4C 4DK3C 5C44H 3X3NA 3I4OA 3OWFA 3CPWA 1I4RA 5IYCH 1KABA 3D4RA 5JJLA 1TY2A 2NN6H 4CJ2C 2OTLA 2PO4A 2EE1A 4A3EH 3V05A 4IFDI 4HJ7A 1BBUA 2R92G 2RDGA 1T5XD 4IPGA 3M4PA 1EY6A 1HZ9A 2QDBA 1XNQQ 1N8RC 4A3LH 3F2CA 2MUYA 1D5ZC 3MWYW 3EIVA 3KDFB 5IYBG 4QIWE 3UE0A 4AYBB 3G71A 1HUMA 5C4JB 1WFQA 4L8JA 4F8MA 1E3PA 4J15A 1HA6A 5JJZA 5DEHA 1L1OB 1DXMA 1KNEA 1MHWC 3R8BA 3GTOH 4DA2A 3ULLA 2K32A 1I4PA 3HKZE 2IJ0A 1IL8A 4RAUC 4FXKC 4KKUA 5CGKA 3OYYA 1A8VA 1JOKA 3DM1A 1C0AA 2B39A 3OTOQ 1GKHA 1V8QA 1KRSA 2IT1A 1YZ6A 5EGTA 3PF4A 4HJ8A 4CKBA 1AE3A 2NVYH 3HEJA 2FFKB 4OEMB 4B9WA 3TS2A 2L11A 3A5UA 1S5BD 4YY3L 1VMPA 4NXNQ 3TEHB 3MC0B 4JI6Q 4BY1B 4DV6Q 4BY7G 3CC7A 3DMUA 1XJVA 2ENBA 4NB3A 1Q1EA 2K5WA 3DWAA 5GROA 4DR4Q 2A5HA 3CCUA 4BA1I 4LW1A 1BQQT 1I4XA 3UDGA 3CCLA 4A3FH 1PTOH 2OF1A 2CH4W 1E1OA 2A68C 1WD1A 1QUQB 3RZDH 5C44G 1LTID 2EOTA 2VL6A 2EYOA 2CWAA 1NTGA 3CMEA 5IYCG 1GUOA 4ZKBB 1B2TA 3OMGA 1Y1WB 2NN6G 1IKLA 1KTKA 5CC4A 1Z6HA 3AEVA 4DUZQ 4A3EG 5GAEC 3GTLB 3GO5A 2K05A 3F8TA 2MPMA 2UXCL 1U4MA 1LT4D 3LNNA 2J0TD 3FRPB 3TREA 1WCMB 3M9BA 3RZOB 4ME3A 4RCOA 4IUQA 2XGTA 3I73A 1X9NA 1CQVA 1OXSC 5LMUL 2Q8IB 3MAQA 2A6HC 4N8X1 5K5PA 1I50H 4H44C 1GUNA 2EYPA 1BO0A 4JI4L 3S1NH 1UUPA 1MSHA 3I3CA 3RD4A 1L2FA 4DV0L 1JWSD 4P71A 1SMYC 4ZRZA 1QE6A 2DUDA 1EYDA 1J9OA 1VQ9A 3R2TA 1NR4A 3SK4A 1HTLD 5IP7G 1LLRD 1LABA 3KUPA 1STAA 2JA7G 2WKCA 3E0EA 1QJOA 4XQQA 4A3DH 1FGUA 1RTNA 3EBEA 1SLJA 3UE1A 4XIGS 5IIFA 5I2XA 1HFGA 3K81C 3I4NH 1PZID 3D6CA 1VQHA 2HHHL 2R93G 4L63B 1D7QA 1E2ZA 2Z9HA 3FEWX 3KBXA 1JWMD 2JA9A 5I4DA 4RFBA 4F88A 3W1GA 2JP1A 3G48A 4LJZC 4A3CG 1SE8A 4FF2A 1TWGH 4I7ZC 2KJXA 3TZDA 4AH6A 2RDFA 4IJLA 4CDCC 3HOYH 1EUJA 1XNRQ 1DYQA 3D6WA 2B2YC 4QCLA 5FLXE 3C46A 1PLFA 2Z1CA 2ALYB 1BNZA 4OXPA 1QVFA 1HNZQ 3S17H 3J81L 1A62A 4DXGA 3L2PA 2L9HA 4HSVA 3CW2C 1HRJA 4QUCA 1CI3M 1VQ4A 1BOSA 1G6PA 1NNXA 2F0TA 2Q2HA 4OELB 4B3TQ 5FK9C 4YHHQ 2OWOA 4JI1Q 1XPRA 4GKKQ 4OHJA 2A1AA 3NBHA 2N8NA 3S16B 4A76A 1U4LA 5M3MH 4OX9Q 1V9PA 1A3TA 1N32Q 3A7AB 5FJ8H 5GAHC 3X3MA 1P8LA 1VCIA 1TWFB 1MJCA 4KN7C 2MNAA 1SSOA 2XIWA 4DAMA 2SOBA 3OTOL 2RHSB 1IBKQ 4DNIA 3D4DA 1CSQA 4R4QA 1YJNA 3QG1A 2NN6I 4ZUIA 2KCMA 3OMCA 5ELEA 1C8CA 1BXTA 1PRTF 4RGOS 3S24A 2IHFA 1MIUA 3QWNA 3RUZA 4PZ8A 1EQVA 2Y0SB 5IY0A 1EY4A 2A19A 4C3IB 5A35A 1LT3D 4AYBE 4A3DG 2X69A 4XQJA 3P20A 3DWPA 4Q5VA 4JI6L 4DV6L 1Q12A 5C3WA 1B53A 3I4NG 5EAYA 1TY0A 1EQQA 1YHQA 4HJ9A 4DR4L 1B44D 1VQJA 1ENCA 1L0XB 3AQQA 4C2MB 4A93H 2CQOA 3M4QA 1XPOA 4JI7Q 2GVBA 1EFID 3UDIA 1SBBB 2EYLA 4ILWA 3KJPA 1XMQQ 1NJIC 2G9DA 1X3EA 3PGZA 1OO9B 1KNAA 2JA6B 3K0XA 3HOYG 3NWTA 1CHPD 1F2MA 1WTHA 1QOHA 2CWPA 2V4DA 1I3QH 3PO2H 5I2YA 2B8GA 1K28A 2IY5B 3C3LA 4IUTA 4G7OC 3S14H 5BN3A 3J7YW 3I55A 1E7ZA 5IGEA 2YU9H 4K2LA 5JPNC 2OQKA 2F4IA 1STGA 2PNHA 2PPBC 1QCBD 3R2IA 1B3AA 1Y1VH 4PV1C 1CM9A 2IX0A 2B2WA 1N9WA 1CQFA 2E76C 5HURA 4S3SA 1SYDA 2WAQG 2QA4A 1NSNS 1DGSA 2QGQA 1K3BC 4FF1A 2B2VA 1A6XA 1O78A 2Q8RE 4JBMA 4RWSC 1RDPD 1DOKA 1E0BA 3FKIH 1QG7A 1PVOA 3SHLA 2B2UA 3CU7A 1HQRD 4HIMA 4KD3A 5LMNQ 2QILA 5E3FA 2C9OA 3NP8A 1O7YA 2K5DA 3M4OB 3S2DB 1W3SA 4QY7A 3CXCA 2PYKA 2E5LL 3SEBA 2F4VQ 1RKNA 1IBLQ 1TWCH 4KHZA 3TRZA 4MZ9A 1AZPA 1M8AA 4O2DA 4BXXG 1L0YB 3E6ZX 1JB7A 4GS3A 1VQCA 3OWEB 2WIIB 4BBRH 1XNRL 4G4KA 1K73C 4FF4A 4DR3Q 3T1HL 1YITA 1QUQA 3JAML 1CFMA 3KLSA 1R9TH 3HOWB 4A93G 3MEHA 4KHVA 2HUGA 2UU9Q 1SFOB 1NUCA 5HGTA 3UI2A 4YWMA 3BVMA 1AEXA 5IGCA 1B50A 4B3TL 2PCFB 4YHHL 4JI1L 1WTQA 3CRLC 4GKKL 4DK6C 1LM0A 1Q8IA 4H7BA 2PI2A 4NDXA 1B8AA 1K0SA 1QB5D 4DK1A 4UPAA 4WORA 2DNEA 4JVZA 5EBCA 5ELOA 5FLXc 2PZUA 1N33Q 4QIWB 2IX1A 3J80L 2G5DA 4JCVE 3GTMB 2AUJD 4XDXA 1SRUA 1IBKL 2O4XA 2E2HB 2LXJA 3QB3A 1CKOA 3CKIB 5GAGC 4MTKA 1VQNA 4BWGB 1FD7D 3VYTA 3K58A 1SNQA 1CTMA 2M2LA 2MJ8A 3FKIG 4KD4A 2EZVA 1MBYA 5FO7B 2F3IA 4HN7A 3T13A 3SVMA 3K7UC 2D9UA 4KV6A 4ZCKA 1JJGA 1J6QA 1X56A 2ZTDA 1JT8A 4P73A 3HOVB 1IKMA 1EEFD 4Z9CB 4CKCA 2F0QA 4KY5A 3VR4A 3BU2A 2AUKA 2BCOA 2EQSA 2BE5C 4RA8A 2JEAI 4C3JH 3N6RA 2EIFA 2R7ZH 4ZYSA 5E4WC 1LTRD 1C48A 4U68A 3CF5A 2JA8B 2B63B 2J7ZA 4FDBA 3F2DA 1VF7A 4RGTA 4IOCA 3S1MH 4B3SQ 3UDXA 4JI5L 3GTQH 2QKIC 2KECA 4BBRG 3H15A 1BBWA 3GTPB 4JBJA 4PZ7A 3C2PA 2QEXA 1TIID 3HOUH 5CV8A 3KOJA 2UUCQ 5M5YH 1S40A 3A54A 2OQ0A 3LWEA 3GP7A 2VQEQ 5KNDA 4JPBW 4TSSA 2JA5H 3HOXB 4K5WA 2Y0SE 4G57A 4A3JB 1Q8KA 1I4QA 1ZXTA 3G6JB 1HZAA 3OOCA 4DV1L 4K8JA 1PXUA 2F0NA 2KENA 2MHVA 1WTPA 3OIPA 1K9MC 2CW0D 4CDFC 2Q2IA 2LS01 3I4MG 1MKHA 1SJED 4RMFA 1IL2A 5NUCA 2WB1G 5IGDA 1U0LA 3I72A 4A3BB 1EOTA 4L5SA 2L12A 4LFCL 1TWHB 1F2ZA 2E75C 3KK7A 3EVQA 3PF5A 3FP9A 1IW7C 4PZ6A 4GKJL 5M5XH 1H95A 1DONA 4UAIA 2K04A 4X62Q 3NTKA 5C4JH 3I2ZA 5C3EB 2F4VL 1G2TA 1O7LA 1VQAA 3A8JE 3A56A 3K8AA 4DV4Q 5BN5A 4IPHA 1IBLL 1JE5A 2LKVA 3V96A 1DOMA 3S15B 1A0IA 3FPUB 4ZLTF 5LMNW 5J22A 4U673 2PMZB 3TDQA 1J5EQ 5A2QL 3T4AC 1JE4A 3BG3A 5JJIA 1UE7A 3AYHB 3BJUA 1QNKA 2UUBQ 2AKWB 1EZ6A 1PH6A 4DR3L 2KCTA 3PUVA 3RMHA 4A3IG 5ELNA 3B6YA 2UU9L 4C3JG 5K36H 3PUZA 3KYHC 4H02A 3NBHB 1VF5C 3H3VC 1S5FD 4GOPC 4G7HC 1R4PB 3F1ZA 4KY6A 1WTXA 4FNFA 2B2YA 5C4XB 1FVIA 2VNUD 4A3MH 2CKZB 3IFDA 1VQFA 4PNYA 2XVSA 1VQIA 3CC4A 2VUMB 4MTNA 2NVXB 3HOUG 3O13A 3TMEA 1X54A 2RVLA 4QL5A 4H13C 5IWAL 4LNQA 1K8GA 2JA5G 3G6EA 2GVAA 2J4XA 5M3FG 1Z47A 2H4OA 2IX3A 2KVMA 1K83B 3VYRA 1GO3E 4DV3L 3DLLA 1PH8A 4JI0Q 3S9WA 4F87A 1Y1WH 4CGYB 3WOFA 2JEBI 1G2SA 1Y8NB 5IE8A 4J1MA 2BA0A 1HH2P 1K3RA 5I6WA 3J81i 2DJGC
chains in the Genus database with same CATH topology
4X3UA 3M3YB 3U9SA 2EJMA 1FYCA 4M1UB 1JWUD 3ONAB 1WTRA 1EWHA 2IWHA 5ISRA 2F0UA 3A55A 1LTSD 5CV9A 2R6GA 1X32A 1CA6A 3NHHA 5C6AA 3AB9A 3I91A 3MZ5A 3T51B 4EQOA 1JOOA 5DNFA 3E5SA 4FF3A 4H0LC 3VR2A 3PO3B 2G9HD 4C3HB 2D5DA 5ELBA 5K36G 2K6AA 4KKTA 4HCSA 1XTCD 2RSOA 1PRTC 1RHPA 1D1KA 4KY7A 5KNCA 1LTTD 2R92B 1BDOA 5CORA 1EQTA 5KNBA 2DN8A 3VR3A 2A68D 1H9SA 5CV5A 4R9WA 2EYFA 2SEBD 3K7AB 4K8IA 1D5MC 1BCPC 2GA4B 2F0SA 2PNRC 4QMGA 1V43A 2EY2A 1JCKB 1RTOA 1SE3A 3M7GA 2A6HD 3Q22A 1F9RA 4O1NA 4DF7A 2TSSA 3FDTA 4RHSA 1SMYD 1DZ1A 2F0PA 1SNOA 4IN3A 3PUWA 5LHY1 2SNMA 3NUCA 4KTAA 2X6LA 5EPJA 1PMRA 1SNPA 4BY7B 3P1HA 2NVTB 4HMIA 2Z4IA 3T53B 4PQXA 2F0DA 1J8IA 1PTOC 5C44B 4ABNA 3DXJC 3CHBD 5JEAJ 4DFAA 4A3EB 3TP6A 1OXXK 1EYCA 5D3IB 4C56C 3J81E 1ML0D 4OO1H 2L4NA 1Z7TA 2IL8A 1H9KA 1S4ZA 1AP0A 1GJXA 4HSPA 5C4HA 4R8IA 1EU4A 4EQPA 1JQYD 1BCPB 3TZUA 3A8KE 1KLGD 2EPBA 3TP7A 2XSCA 3W2DA 4IALA 2JA7B 2F0KA 3K6OA 3PMFA 1F9QA 5G3LF 2NBFA 4RH6A 5CMDA 4ZUJA 2ZXOA 4NKLA 2R93B 5AFWA 3GTGB 1CA5A 2H1EA 4N9TA 2I07B 3AMUA 3NPPA 1HCZA 2AQ1B 3T16A 5LL6X 1HUNA 3EA6A 1TWAB 4RKBA 5CV4A 1WTOA 5IT9E 1LTBD 2KUMA 2KEDA 1FNWA 2E2JB 3IAYA 1PTOB 4CKEA 1XX8A 3G7LA 1EZ8A 5COYA 3KBGA 5J39A 1ET9A 2PZWA 2DY7A 2LY7A 2VXWA 3NTIA 2L55A 1ICWA 2F0JA 1ESFA 5D3DA 5FLXL 1W6KA 4OO1G 1GUSA 1TKWB 3Q24A 4KKSA 1JC7A 3FMCA 1LTGD 1KLUD 3VR6A 1F77A 3ZYYX 3GV6A 3D8GA 2RQXA 3BVZA 1YNNC 1I6HB 4N9PA 1ZYRD 4RHRA 1W6JA 3PIP3 1F2LA 4TQUS 4K2KA 2BOSA 3F2UA 2K1BA 1LV9A 2WINB 2WACA 3ERQA 3I4NB 2JYOA 1F9PA 2D2CC 1IHZA 3LX0A 4DN4M 5CBEE 3BDOA 3GD7A 4C1NI 1G8ZD 1HPCA 2A74C 4IUPA 5EKIA 4PMWA 4WFN3 5KYIA 1ZYRC 4XXEA 3CQZB 3JAME 4NP5A 3MXNA 5BN4A 1R4QB 1JICA 3KLSX 2AQ2B 1CT1D 3OPOA 1DOLA 2F1MA 5CYUA 1O7ZA 1BUVT 3S17B 4CJ1B 5KIXA 1QILA 3QIAA 1WTVA 2HDMA 1Y8OB 1SYFA 2WAQB 3MA2B 5JEAH 4ZKCB 1Q3LA 1NAPA 3E0JA 3J80E 2YYZA 4FP5D 2E2IB 2PW7A 4IQZA 4RGMA 4XTCS 4K5XA 3ND9A 2XNAC 5FKAC 1MGSA 3L9AX 1I6VC 3BZDB 3NXWA 1GXDC 2O5JC 2QF7A 1AW7A 2F3WA 4QB4A 1FNUA 1ENAA 4OO1I 1WTWA 1SJHD 1SXTA 2K5QA 1G91A 5EPKA 2NYZD 1TT2A 2Z8LA 1SEBD 4DAVA 1H9SB 2XWBB 4FXGC 1TS3A 1CZGA 2OEOA 3IFTA 3FVQA 2BE5D 2NTTA 3I4LA 1STYA 2EYHA 1PDQA 4NMZA 1EY0A 3EFXD 2NB0A 1ILQA 1LT6D 2L5TA 2DY8A 1EL0A 1PZJD 1ENFA 5CR3A 5E1FA 2F03A 3SR1A 5I9OA 2YU9B 4ME5A 1LO5D 5M5WB 1KDCA 2AWOA 2JE6I 2KCNA 3A7LA 4JK1C 1S5ED 4BBSB 1CZWA 1RD9D 2EJFC 2KOLA 3TBIB 1CK1A 1SE4A 3R3OA 4KK7A 2PQEA 5D65A 3TP8A 3M85A 1A15A 1IW7D 2K01A 3CRKC 1PFBA 2EYJA 3LWUA 3SXHA 5A2QE 5ELDA 4IURA 4XT3B 1KDAA 1KDBA 2IW3A 2B2TC 4L6TB 2FJ2A 4BBRB 3K5OA 4ID6A 2RSNA 3V2TA 1LACA 3PUYA 2ICEC 5CBAE 3K57A 4IUUA 3EROA 3MVVA 1STBA 4RCNA 1YNJC 2VB3X 2JXMB 1NCVA 5C0XJ 4XYQA 1Y69U 3RLFA 1E2WA 4HCEA 2JSOA 1EY7A 3FPPA 4HMJA 3I4MB 1DD2A 1NR2A 4K5VA 2MP1A 2WB1B 2EJGC 1BF4A 2XWJB 3GQBA 3N52A 3OHXC 1K8OA 3NQIA 4KJOA 2CVRA 1BR9A 2K03A 2L1BA 5FOBB 5IGGA 3K5MA 4X3KA 5JOBA 4OIJA 1A3VA 3HZXA 3D3RA 4EQNA 3KF8A 4A3IB 4WJWA 4C3JB 3BS1A 4BA2I 3HP3A 1LTAD 4ULLA 1C4QA 4DGZA 3S1MB 2I46A 2F0IA 2B8FA 2WKDA 3I8ZA 2ZXPA 3VR5A 1HA5A 1IYVA 4RGNA 2RDHA 2DNCA 3Q0AA 2JA5B 4R8NA 1PRTD 5M3FB 4C3HG 1TS4A 4CJ0B 4Q0FA 1EY8A 2HDLA 5KGUA 2O2LD 1U4RA 1EIHA 3DHQA 1I4HA 1VMCA 3SK5A 1F2YA 3KLRA 1XYIA 2F0WA 5M5XB 1D1IA 1BCPD 1ESRA 2A6ED 3BDCA 2KCCA 4B9XA 2RA4A 2F0VA 2TMPA 4OL7A 3H6MA 3A8IE 2AQ3B 2F0OA 3OW7A 4BS9A 3BYTB 3S1QB 3K5LA 4MIUA 1SYEA 1OXVA 4PMBA 5EPLA 5IOCA 2A6EC 1D5XC 2VB2X 1EEID 1OXUA 4K6LA 1U4PA 2BDOA 3DUZA 3SDZA 4DNRB 1K8MA 3URYA 5ELFA 4IUVA 2N88A 4A3MB 4A3KB 4ZQ3A 1DJRD 4X3TA 3QJYA 1B4OA 5KRUA 5IODA 5C5MA 4CBVA 1WD0A 4A3GB 1PTOD 2CQAA 4KMUC 3K59A 4TRDA 4OGQC 3PUXA 3EQLC 4LK1C 4DU9A 1B9MA 2K28A 1E2VA 3VA7A 4FVMA 5C0XH 1EY5A 1PFMA 1SYGA 2A69D 1H9RA 3MXGA 2PZTA 5DM63 1TQOA 3NE5B 1ZEQX 1PRTB 1QWYA 1WVLA 3NTHA 1HXYD 1BBXC 2F0LA 2EXZA 3PIO3 3QOJA 3HGBA 2A69C 1A3UA 3MXPA 3C1FA 2WP8J 4MN3A 4FYDA 2EVBA 2BA1A 4ZAIA 1AFPA 3H94A 2F0EA 2EY1A 1STHA 5J1ZA 1H9MA 3GTOB 4XQNA 2K33A 2ICIA 4IFDJ 1ZKOA 5FO8B 1B9NA 1V1PA 4EGVA 1ONLA 2MGSA 5E4XA 1G6ZA 2NVYB 1EU3A 4ODGA 1JB3A 4DAYA 1SNCA 5EJWA 2F0MA 2E74C 4J6HA 4V190 3SK6A 4LMQD 3H0GB 4DAPA 5C0XG 2Q8TA 1TR5A 1XXGA 2SDFA 4C3IG 1DM0B 3NSWA 5JVH3 1GUTA 1FNVA 5KEEA 3GTJB 1U9RA 4A3FB 4K14A 3RZDB 2M9VA 3MXUA 2R61A 3SE0A 5IGBA 1A2UA 1TVXA 3NK9A 4WRDA 3J7AV 5T1GA 1YNND 2B2TA 4NW2A 3VYSA 1PFNA 1SYBA 2Z4HA 3P7JA 3S2HB 1I50B 3NQTA 2EY5A 3VA5A 3W3AA 3S1NB 2FHTA 3J7AF 3HOZB 5DM73 1B1ZA 3QOLA 3OIQA 5EBDA 1GOZA 3QO2A 4XT1B 1STNA 4QUFA 5I6YA 5IT9L 4A3DB 1II3A 1JOQA 2HCIA 1IYUA 1BCPF 1TS5A 2AWNA 4XYOA 2K7VA 4IUNA 5C3XA 3L7ZC 4HTHA 2XRQD 4X3SA 1TS2A 5CV6A 4C1NK 2EDGA 3MFYA 2OXPA 1TWGB 3HG9A 5EKKA 1UNSA 5M9OA 3HOYB 1RODA 2RKSA 3DEOA 1SYCA 3TSSA 5D14A 4DK0A 2A73B 2BDNA 1VDZA 2X6GA 1RCVD 3I90A 1HTPA 2R3ZA 3BVGA 1EIGA 2NVQB 1HQMC 1XWEA 1T5EA 4GZYC 5M3MB 5C0XI 1D2BA 3Q6SA 3H91A 2NTSA 4DXFA 1PTOF 4ZK9B 2F0FA 4PMCA 4LAAA 3NBIA 3D4WA 2NUCA 2F3VA 1Y8PB 1GHJA 4HR7B 2QCPX 3T56B 5JVG3 4F7XA 1EWCA 4DNTB 1RJTA 2QEJC 4O42A 1G291 2NZ1D 3GV3A 4M8AA 1MSGA 2NWGA 3M4YA 4HAEA 1S5CD 4EVOA 4IFDH 5EKLA 3TN2A 1KAAA 2E2DC 2EY6A 5KYLA 4A93B 5C5LA 2HCCA 2FINB 2F0GA 2SNSA 1HFNA 3WOEA 2ZXRA 1JR0D 2LFNA 3PO2B 5T1IA 1I3QB 3EJIA 4IZ8A 3HS0C 4RKLA 4P2CB 3S14B 5F2DA 1F9SA 1JORA 5IGFA 5JAVA 4QF4A 4I65A 1Y1VB 4YIJA 3HRZC 3HKZB 1V1OA 3Q23A 3VYUA 3MTSA 1ILPA 5C4ZA 5CV7A 3M7NA 5LL6S 5JEAG 2O5IC 1MI2A 4KJNA 3TP5A 2L0CA 5I9PA 3FKIB 1CHQD 1PYWD 2CHBD 3U9OA 1GUGA 3R93A 1RF2D 1SDFA 3IL8A 5ELCA 1DCZA 3BDLA 3K5NA 4KI0A 2KEEA 1FGBD 1Q1BA 5DAUA 3BYYB 3I70A 3NWSA 1GUWA 1YNJD 1X3QA 1TWCB 4K6DA 2RBMA 4B08A 3K0YA 2IPKD 2KA7A 3D31A 2ID0A 4IFDG 1MD2D 5JPMC 1R9TB 1QNUA 1O80A 1ET6A 1H9JA 3OSOA 1S5DD 5EQ0A 4UDUC 3MHBA 1Q90A 4J8QA 2FMCA 1SNDA 1M4VA 2HQEA 1HHVA 1V1PB 2XRSD 3SK8A 3DWQA 2CW0C 2ZT9C 2KHSA 1EYAA 2F0HA 1SE2A 3IKJA 1I4GA 1A2TA 2N55A 4JBWA 5FO9B 3H09A 3AU7A 3WDNA 2PW5A 1SAPA 3MFGA 2B2WC 2WV6D 1UAPA 2LMCB 4Y7NB 4HEDA 1AN8A 1LT5D 2KQ3A 3P75A 3DEPA 4V0BA 2XN9C 2OT2A 5G3LD 2FMMA 1X3PA 2B2VC 1EY9A 1OXTA 2B2UC 1AZQA 1D6EC 2M00A 5TSSA 4MHEA 2C5CA 2R7ZB 1GHKA 1SNMA 3PV0A 3L3OC 3GTKB 2EYMA 3ITPA 4E6IA 3GTQB 3C1EA 4CHTB 3HOUB 4FO2A 4G7ZC 2D62A 5M5YB 1UEAB 3ND8A 1FR3A 4OIKA 1PZKD 4TKOB 1TU2B 4FXDA 1STEA 4KN4C 3X3NA 3OWFA 1I4RA 1KABA 3D4RA 1TY2A 2NN6H 4CJ2C 2PO4A 2EE1A 3V05A 4IFDI 2RDGA 1T5XD 1EY6A 2QDBA 2MUYA 1D5ZC 3MWYW 4AYBB 1HUMA 5C4JB 4L8JA 4F8MA 1HA6A 5JJZA 5DEHA 1DXMA 1KNEA 3R8BA 4DA2A 2K32A 1I4PA 2IJ0A 1IL8A 4RAUC 4FXKC 4KKUA 5CGKA 1JOKA 3DM1A 2B39A 1V8QA 2IT1A 5EGTA 4CKBA 3HEJA 2FFKB 4B9WA 2L11A 1S5BD 1VMPA 3MC0B 4BY1B 3DMUA 2ENBA 1Q1EA 2K5WA 3DWAA 2A5HA 4BA1I 1BQQT 1I4XA 1PTOH 2OF1A 1WD1A 2A68C 1LTID 2EOTA 2EYOA 1GUOA 4ZKBB 1B2TA 3OMGA 1Y1WB 2NN6G 1IKLA 1KTKA 5CC4A 1Z6HA 3GTLB 3GO5A 2K05A 2MPMA 1U4MA 1LT4D 3LNNA 2J0TD 3FRPB 1WCMB 3RZOB 4RCOA 4IUQA 3I73A 1CQVA 1OXSC 2Q8IB 3MAQA 2A6HC 5K5PA 4H44C 1GUNA 2EYPA 1BO0A 1UUPA 1MSHA 3I3CA 3RD4A 1JWSD 1SMYC 4ZRZA 1QE6A 1EYDA 1J9OA 3R2TA 1NR4A 3SK4A 1HTLD 1LLRD 1LABA 3KUPA 1STAA 2WKCA 4XQQA 1QJOA 1RTNA 4XIGS 5IIFA 5I2XA 1HFGA 1PZID 3D6CA 4L63B 1E2ZA 3FEWX 3KBXA 1JWMD 5I4DA 4RFBA 4F88A 2JP1A 4LJZC 4FF2A 4I7ZC 2KJXA 3TZDA 2RDFA 1DYQA 3D6WA 2B2YC 4QCLA 5FLXE 3C46A 1PLFA 2Z1CA 1BNZA 3J81L 4DXGA 2L9HA 4HSVA 1HRJA 4QUCA 1CI3M 1BOSA 2F0TA 5FK9C 4OHJA 3NBHA 3S16B 1U4LA 1A3TA 3A7AB 3X3MA 1VCIA 1TWFB 4KN7C 1SSOA 2XIWA 2SOBA 3D4DA 3QG1A 2NN6I 4ZUIA 3OMCA 1C8CA 5ELEA 1BXTA 1PRTF 4RGOS 3QWNA 3RUZA 1EQVA 2Y0SB 1EY4A 4C3IB 5A35A 1LT3D 2X69A 4XQJA 3P20A 3DWPA 4Q5VA 1Q12A 5C3WA 1B53A 1TY0A 1B44D 1ENCA 1L0XB 4C2MB 1EFID 1SBBB 2EYLA 4ILWA 2G9DA 1OO9B 1KNAA 2JA6B 3NWTA 1CHPD 1F2MA 1QOHA 2V4DA 5I2YA 2B8GA 3C3LA 4IUTA 4G7OC 5BN3A 3J7YW 5IGEA 4K2LA 5JPNC 2F4IA 1STGA 2PPBC 1QCBD 3R2IA 1B3AA 4PV1C 1CM9A 2IX0A 2B2WA 1CQFA 2E76C 5HURA 4S3SA 1SYDA 1NSNS 4FF1A 2B2VA 1A6XA 1O78A 2Q8RE 4RWSC 1RDPD 1DOKA 1E0BA 1QG7A 3SHLA 2B2UA 3CU7A 1HQRD 4KD3A 2QILA 5E3FA 2C9OA 3NP8A 1O7YA 2K5DA 3M4OB 3S2DB 2PYKA 3SEBA 1RKNA 4KHZA 1AZPA 1M8AA 1L0YB 3E6ZX 3OWEB 2WIIB 4G4KA 4FF4A 3JAML 1CFMA 3KLSA 3HOWB 3MEHA 4KHVA 2HUGA 1SFOB 1NUCA 5HGTA 3UI2A 3BVMA 1AEXA 5IGCA 1B50A 2PCFB 1WTQA 3CRLC 1Q8IA 4H7BA 4NDXA 1QB5D 4DK1A 4WORA 2DNEA 5EBCA 2PZUA 4QIWB 2IX1A 3J80L 3GTMB 2AUJD 4XDXA 2E2HB 2O4XA 3QB3A 3CKIB 4BWGB 1FD7D 3VYTA 3K58A 1SNQA 1CTMA 2M2LA 2MJ8A 4KD4A 2EZVA 1MBYA 5FO7B 4HN7A 3T13A 3SVMA 2D9UA 4KV6A 3HOVB 1IKMA 1EEFD 4Z9CB 4CKCA 2F0QA 4KY5A 3VR4A 2AUKA 2BCOA 2BE5C 4RA8A 2JEAI 3N6RA 4ZYSA 5E4WC 1LTRD 1C48A 4U68A 2JA8B 2B63B 2J7ZA 1VF7A 4RGTA 2QKIC 2KECA 3GTPB 3C2PA 1TIID 5CV8A 3A54A 3LWEA 3GP7A 5KNDA 4TSSA 3HOXB 4K5WA 4G57A 4A3JB 1I4QA 1ZXTA 3G6JB 3OOCA 4K8JA 1PXUA 2F0NA 2MHVA 1WTPA 3OIPA 2CW0D 2LS01 1SJED 5NUCA 5IGDA 3I72A 4A3BB 1EOTA 2L12A 1TWHB 1F2ZA 2E75C 3KK7A 3EVQA 1IW7C 1DONA 4UAIA 2K04A 3NTKA 5C3EB 1G2TA 1O7LA 3A8JE 3A56A 5BN5A 2LKVA 3V96A 1DOMA 3S15B 3FPUB 4ZLTF 5J22A 4U673 2PMZB 3TDQA 5A2QL 3T4AC 1JE4A 3BG3A 1QNKA 1EZ6A 3PUVA 3RMHA 4C3JG 5K36H 3PUZA 1VF5C 3H3VC 1S5FD 4G7HC 1R4PB 4KY6A 1WTXA 4FNFA 2B2YA 5C4XB 2VNUD 3IFDA 4PNYA 2XVSA 2VUMB 2NVXB 3O13A 3TMEA 2RVLA 4H13C 2J4XA 1Z47A 2H4OA 2IX3A 2KVMA 1K83B 3VYRA 3S9WA 4F87A 4CGYB 3WOFA 2JEBI 1G2SA 1Y8NB 4J1MA 2BA0A 3S1RB 5I6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5E D;  1JWS D;  2AQ1 B;  3DWP A;  1V1P B;  2TSS A;  2XRS D;  3EA6 A;  4RHS A;  2XRQ D;  3DWQ A;  1JR0 D;  1D5X C;  1EEI D;  1QIL A;  4K6L A;  1LTB D;  1TS2 A;  1TY0 A;  3BVM A;  1RD9 D;  3R2T A;  1SJE D;  1B44 D;  1FNW A;  1HTL D;  1V1P A;  1JWU D;  1LLR D;  1SE2 A;  1L0X B;  1I4G A;  1CK1 A;  1SE4 A;  1PTO B;  2ICI A;  3R8B A;  3URY A;  5ELF A;  1UNS A;  1EFI D;  1SBB B;  1I4P A;  1EU3 A;  1LTS D;  1ET9 A;  1PZI D;  2IJ0 A;  3TSS A;  1DJR D;  1LTA D;  1V1O A;  3MFG A;  4L63 B;  2WV6 D;  4RGM A;  1CHP D;  1ESF A;  1JWM D;  5I4D A;  5D3D A;  4RFB A;  1PTO C;  1AN8 A;  1LT5 D;  1PTO D;  3CHB D;  2XNA C;  1RCV D;  5FKA C;  5ELD A;  1XXG A;  2XN9 C;  3BVG A;  3BZD B;  1HA5 A;  1FNV A;  1CHQ D;  1LTG D;  2G9H D;  1PYW D;  1AW7 A;  2CHB D;  3R2I A;  4BWG B;  1FD7 D;  1DYQ A;  1FNU A;  1KLU D;  2RDH A;  4L6T B;  4RGN A;  5D3I B;  5ELB A;  4C56 C;  2R61 A;  1XTC D;  1D6E C;  1F77 A;  5TSS A;  1PRT C;  2NTS A;  1S5B D;  1PRT D;  4DXF A;  1RF2 D;  1SJH D;  1SXT A;  1PTO F;  3MC0 B;  4O1N A;  5ELC A;  1TS4 A;  1LTT D;  1FGB D;  4DXG A;  2Z8L A;  3BVZ A;  3DWA A;  1SEB D;  1PRT B;  2O2L D;  3BYY B;  1S5F D;  1EEF D;  1I4X A;  1RDP D;  4Z9C B;  1EU4 A;  1TS3 A;  1JQY D;  5FK9 C;  1HXY D;  1PTO H;  1BCP B;  1HQR D;  4RHR A;  1I4H A;  4OHJ A;  1LTI D;  2NTT A;  1KLG D;  2IPK D;  4ZYS A;  2QIL A;  2SEB D;  1LTR D;  3O13 A;  1EWC A;  3W2D A;  1KTK A;  1PZK D;  3EFX D;  1MD2 D;  4RGT A;  1LT6 D;  1STE A;  1D5M C;  3SEB A;  2QEJ C;  1BCP C;  1BCP D;  1G8Z D;  1LT4 D;  1I4R A;  4RH6 A;  1PZJ D;  1ENF A;  1ET6 A;  2J4X A;  1B1Z A;  1TY2 A;  1S5C D;  1L0Y B;  4RCO A;  1GOZ A;  1JCK B;  3V05 A;  1S5D D;  1CQV A;  1SE3 A;  5ELE A;  1LO5 D;  2RDG A;  3GP7 A;  1T5X D;  3OWE B;  1BXT A;  1PRT F;  4RGO S;  4UDU C;  2AQ3 B;  4TSS A;  3BYT B;  3KLS X;  1M4V A;  1D5Z C;  2AQ2 B;  1BCP F;  1TS5 A;  1CT1 D;  1UUP A;  1I4Q A;  1LT3 D; 
#chains in the Genus database with same CATH topology
 4X3U A;  3WWV A;  3M3Y B;  2R7D A;  4LF7 Q;  1WCM H;  3U9S A;  3RZO H;  1NMF A;  2EJM A;  1FYC A;  4M1U B;  1JWU D;  3ONA B;  1WTR A;  3STB C;  1EWH A;  2IWH A;  5ISR A;  2F0U A;  3A55 A;  1LTS D;  4YWK A;  5CV9 A;  4AQY Q;  2R6G A;  1X32 A;  1CA6 A;  4LF5 L;  4UY8 C;  3NHH A;  5C6A A;  1FL0 A;  3AB9 A;  1VQM A;  3I91 A;  3MZ5 A;  3T51 B;  2H5X A;  1XMO Q;  4EQO A;  1JOO A;  1PYS B;  5DNF A;  3ICE A;  3E5S A;  4FF3 A;  4H0L C;  4DPG A;  3VR2 A;  3PO3 B;  2G9H D;  4C3H B;  1A63 A;  2D5D A;  5ELB A;  5K36 G;  2K6A A;  4KKT A;  4HCS A;  1VQ6 A;  1XTC D;  2RSO A;  4JYA Q;  2VQE L;  1PRT C;  1RHP A;  1D1K A;  4KY7 A;  3ULP A;  3CCV A;  4JI2 L;  5KNC A;  1LTT D;  4A3M G;  4DR6 Q;  2R92 B;  5H1S E;  4A3K G;  3NEM A;  1BDO A;  3MXN B;  4LUV A;  5COR A;  2QW7 A;  2EXD A;  1EQT A;  5KNB A;  2DN8 A;  3VR3 A;  2A68 D;  4A3G G;  3IRB A;  1H9S A;  4N8F A;  5CV5 A;  4R9W A;  2EYF A;  2SEB D;  4LF8 Q;  2UXD L;  2BH8 A;  3K7A B;  4K8I A;  3U4Z A;  3H0G H;  1D5M C;  2BH2 A;  1M1K C;  1BCP C;  2GA4 B;  1VQ8 A;  4X62 L;  1Y1W G;  5BR8 Q;  4LFB Q;  3D0F A;  2F0S A;  2PNR C;  2V1C C;  4QMG A;  1V43 A;  2EY2 A;  4DV4 L;  3GTJ H;  1Q86 C;  1JCK B;  1RTO A;  4IJH A;  3S16 H;  1SE3 A;  1IBM Q;  3M7G A;  2A6H D;  1WCM G;  1EYG A;  1HZB A;  4GN5 A;  3U58 A;  2Z6K C;  3Q22 A;  3RLN A;  1TWF H;  2UUB L;  1F9R A;  4O1N A;  5HGQ A;  4DF7 A;  2TSS A;  3FDT A;  4RHS A;  1SMY D;  1DZ1 A;  2ASB A;  4A3L G;  2F0P A;  1SNO A;  3BZK A;  4IN3 A;  3PUW A;  4EQ5 A;  5LHY 1;  3PCO B;  2SNM A;  3NUC A;  4KTA A;  4NXM Q;  2X6L A;  5EPJ A;  1PMR A;  1SNP A;  4BY7 B;  3P1H A;  2NVT B;  3S2H H;  4HMI A;  5AJ3 L;  2Z4I A;  3T53 B;  4PQX A;  3T1Y Q;  3HOZ H;  1VQ5 A;  2F0D A;  1J8I A;  2K75 A;  1PTO C;  5C44 B;  3A0J A;  4ABN A;  3DXJ C;  3CHB D;  5JEA J;  3PIP A;  4DFA A;  4C2M H;  1NBW A;  2ZM6 L;  1Z9F A;  2PMZ E;  1TXY A;  3TP6 A;  4A3E B;  1OXX K;  1HNX Q;  1YNX A;  1CKN B;  1EYC A;  2R7F A;  5D3I B;  4C56 C;  4JI0 L;  3J81 E;  2MQH A;  1ML0 D;  4OO1 H;  1I5F A;  2HIV A;  2L4N A;  2JA6 H;  1Z7T A;  2IL8 A;  1FJG Q;  1H9K A;  1S4Z A;  1PHJ A;  1AP0 A;  1GJX A;  4HSP A;  5C4H A;  4R8I A;  1EU4 A;  4EQP A;  1JQY D;  1CSP A;  1BCP B;  3H0G G;  3TZU A;  4AIM A;  4QQB X;  2L15 A;  3A8K E;  1KLG D;  2EPB A;  3TP7 A;  1XNQ L;  2XSC A;  3W2D A;  1UE1 A;  4A3F G;  2UXB Q;  4IAL A;  2JA7 B;  2F0K A;  3K6O A;  3PMF A;  1F9Q A;  5G3L F;  2NBF A;  4RH6 A;  3KLW A;  4GLV B;  5CMD A;  4ZUJ A;  2ZXO A;  1KIX A;  4NKL A;  1E22 A;  2R93 B;  5AFW A;  3GTG B;  1CA5 A;  2NVQ H;  1PH3 A;  2H1E A;  4N9T A;  2I07 B;  3AMU A;  3M4O H;  4DR2 Q;  3S2D H;  3GDE A;  2ATW A;  3NPP A;  1IYJ B;  1HCZ A;  2AQ1 B;  3T16 A;  5LL6 X;  1HUN A;  3EA6 A;  3U50 C;  1TWA B;  4RKB A;  4DR6 L;  5CV4 A;  1WTO A;  5IT9 E;  1LTB D;  2KUM A;  2KED A;  1SR3 A;  4POF A;  1YJ9 A;  1FNW A;  2K5N A;  2E2J B;  3IAY A;  1XTD A;  3HOZ G;  1PTO B;  4CKE A;  1XX8 A;  1GM5 A;  3G7L A;  1EZ8 A;  5COY A;  3KBG A;  5J39 A;  1ET9 A;  3RLO A;  1VQP A;  2PZW A;  2DY7 A;  2LY7 A;  2VXW A;  3NTI A;  3HOW H;  2L55 A;  1ICW A;  4DR7 Q;  5L37 A;  2F0J A;  1SFO H;  1KL9 A;  1IXR A;  1ESF A;  1QZG A;  4NXN L;  5D3D A;  5FLX L;  1W6K A;  3NEL A;  4OO1 G;  1GUS A;  4LFB L;  1TKW B;  4LFA Q;  2JA6 G;  3Q24 A;  4KKS A;  1JC7 A;  3KJO A;  3FMC A;  1LTG D;  1KLU D;  1VQB A;  3VR6 A;  1IBM L;  2A8V A;  1F77 A;  2OCE A;  3ZYY X;  3GV6 A;  3D8G A;  2RQX A;  4UP8 A;  1C9O A;  4DUZ L;  4DKA C;  3GTM H;  3BVZ A;  3CMA A;  3TQY A;  1YNN C;  1I6H B;  2E2H H;  2UUA Q;  4DV7 Q;  4N9P A;  1ZYR D;  4RHR A;  1W6J A;  3PIP 3;  1F2L A;  4TQU S;  4OWW B;  4K2K A;  2BOS A;  3F2U A;  2K1B A;  4NXM L;  1LV9 A;  2WIN B;  1MJE A;  1Y14 B;  2WAC A;  3ERQ A;  3I4N B;  2JYO A;  1EFW A;  1F9P A;  2D2C C;  1IHZ A;  3LX0 A;  4P75 A;  4DN4 M;  4P74 A;  2AMC B;  5CBE E;  4GOP A;  3BDO A;  3GD7 A;  3HOV H;  4C1N I;  1G8Z D;  5M3M G;  1HPC A;  2A74 C;  4IUP A;  5EKI A;  1EWI A;  4PMW A;  4WFN 3;  5FJ8 G;  5KYI A;  5FLM H;  1ZYR C;  4XXE A;  3CQZ B;  3JAM E;  1KRT A;  4NP5 A;  4X66 Q;  3MXN A;  5BN4 A;  1R4Q B;  2KHJ A;  1JIC A;  3KLS X;  2AQ2 B;  1CT1 D;  3OPO A;  1Q7Y C;  1DOL A;  3CCM A;  2F1M A;  5CYU A;  3GTP H;  1O7Z A;  1BUV T;  3S17 B;  4CJ1 B;  4LUZ A;  5KIX A;  1FJG L;  1QIL A;  3QIA A;  3Q8D A;  4WJ4 A;  1WTV A;  2HDM A;  1VS0 A;  1Y8O B;  1SYF A;  2WAQ B;  3MA2 B;  5JEA H;  3HOX H;  4ZKC B;  1Q3L A;  5HY6 A;  1NAP A;  2VY3 A;  3E0J A;  3J80 E;  3RR5 A;  1HR0 Q;  2YYZ A;  4OWT B;  4FP5 D;  5IYD H;  2E2I B;  2PW7 A;  2E8G A;  4IQZ A;  4RGM A;  4XTC S;  4K5X A;  3ND9 A;  1HNZ L;  2XNA C;  2RHQ B;  5FKA C;  1MGS A;  3L9A X;  4A3B H;  1I6V C;  3BZD B;  4DV2 Q;  1TWH H;  3NXW A;  1GXD C;  2O5J C;  3CD6 A;  3ULJ A;  2QF7 A;  1AW7 A;  2F3W A;  4QB4 A;  3PO2 G;  1FNU A;  3G4S A;  1ENA A;  4OON A;  1EQR A;  4OO1 I;  3ERS X;  1PA6 A;  4OX9 L;  1WTW A;  1SJH D;  1SXT A;  1N32 L;  1YHB A;  2K5Q A;  5C3E H;  4DR2 L;  1G91 A;  5EPK A;  2NYZ D;  1Y1V G;  1TT2 A;  2Z8L A;  1SEB D;  4DAV A;  3HKZ G;  1PH4 A;  1H9S B;  2XWB B;  3S15 H;  4FXG C;  1TS3 A;  1CZG A;  1YHA A;  2OEO A;  3IFT A;  4L5R C;  3FVQ A;  2BE5 D;  2NTT A;  4O0A A;  3I4L A;  1STY A;  1X3F A;  2EYH A;  1PDQ A;  4NMZ A;  5FLM G;  1EY0 A;  3EFX D;  2NB0 A;  1X6O A;  1ILQ A;  4Y7N H;  1CKN A;  1LT6 D;  2L5T A;  3DM3 A;  2DY8 A;  1EL0 A;  1PZJ D;  1ENF A;  5CR3 A;  5E1F A;  5C4X H;  2F03 A;  3ER0 A;  4JG2 A;  4LFA L;  3SR1 A;  5I9O A;  5IT9 c;  2YU9 B;  4UP7 A;  4JV5 Q;  3BZC A;  4ME5 A;  1LO5 D;  5M5W B;  4LF9 Q;  1KDC A;  2NVX H;  2AWO A;  2CCZ A;  2JE6 I;  2KCN A;  1QVC A;  4JI7 L;  4KHP Q;  1NY4 A;  1K0R A;  1XMQ L;  3A7L A;  4QJF A;  4JK1 C;  1S5E D;  3GTK H;  4BBS B;  3AFP A;  2HQL A;  1KXL A;  1CZW A;  1UEB A;  1RD9 D;  2EJF C;  2KOL A;  4GNX C;  3TBI B;  1K83 H;  2UUA L;  1CK1 A;  1SE4 A;  3R3O A;  4DV7 L;  1JMC A;  2MFI A;  4KK7 A;  2PQE A;  5D65 A;  3TP8 A;  3M85 A;  2DJF C;  1A15 A;  1IW7 D;  2K01 A;  5GQO A;  3CRK C;  1PFB A;  3PSI A;  2EYJ A;  3QR8 A;  4JBK A;  3LWU A;  3SXH A;  5A2Q E;  5ELD A;  4IUR A;  2CFM A;  4XT3 B;  1KDA A;  4RG1 A;  1KDB A;  4TVA B;  2MO0 A;  1S3O A;  2IW3 A;  4R4C A;  2LXK A;  2B2T C;  4L6T B;  2FJ2 A;  4X66 L;  4BBR B;  3RN5 A;  4L5Q A;  3K5O A;  4ID6 A;  2B3G A;  2RSN A;  3V2T A;  5LMN L;  4HJ5 A;  2NZO A;  1LAC A;  3PUY A;  2ICE C;  2WFW A;  5CBA E;  3K57 A;  4IUU A;  4JI3 Q;  3ERO A;  4R4T A;  3MVV A;  1Q46 A;  1STB A;  4RCN A;  1YNJ C;  2VB3 X;  1WI5 A;  2JXM B;  3CCJ A;  1NCV A;  5C0X J;  4GN3 B;  4XYQ A;  1UE5 A;  4C3H H;  3H3V H;  1Y69 U;  4X65 Q;  2YTX A;  1E2W A;  3RLF A;  4HCE A;  4YY3 Q;  2JSO A;  1KAW A;  1EY7 A;  3FPP A;  4HMJ A;  3I4M B;  1DD2 A;  1NR2 A;  4K5V A;  1HR0 L;  2MP1 A;  2WB1 B;  1WJJ A;  2EJG C;  1BF4 A;  2XWJ B;  2YTV A;  2R7Z G;  2K5V A;  5J3B A;  4DAY B;  1S72 A;  5IYB H;  3GQB A;  3U4V A;  3CCE A;  3N52 A;  4DV2 L;  3OHX C;  2YTY A;  1HR0 W;  1K8O A;  3NQI A;  4LWC A;  4GNX B;  2B29 A;  4KJO A;  5IP9 H;  2CVR A;  3K7A H;  1BR9 A;  4BY1 H;  2UXC Q;  2K03 A;  2L1B A;  1L1O C;  5FOB B;  5IGG A;  3K5M A;  1N33 L;  4X3K A;  5JOB A;  2I5M X;  4OIJ A;  2HD3 A;  1A3V A;  5LMU Q;  2I0Q A;  3STB D;  2WAQ E;  3HZX A;  3D3R A;  4UP9 A;  4EQN A;  3KF8 A;  4A3I B;  4WJW A;  4C3J B;  3BS1 A;  4BA2 I;  4DV0 Q;  3HP3 A;  1LTA D;  1PH2 A;  4YWL A;  3GTL H;  4ULL A;  1C4Q A;  4DGZ A;  3S1M B;  2I46 A;  1UE6 A;  2F0I A;  2B8F A;  2XTI A;  2WKD A;  3I8Z A;  3PIO A;  2ZXP A;  4AYB G;  3VR5 A;  4BY7 H;  1HA5 A;  1IYV A;  2NVT H;  3MEF A;  1K8A C;  1T9H A;  4RGN A;  2RDH A;  2DNC A;  3Q0A A;  2DGY A;  2JA5 B;  4R8N A;  1PRT D;  4WJ3 M;  3VDY A;  5M3F B;  4C3H G;  1TS4 A;  4LUO A;  4X64 Q;  4CJ0 B;  4Q0F A;  1YI2 A;  1EY8 A;  4B3S L;  2HDL A;  5KGU A;  2O2L D;  4HJA A;  1U4R A;  1EIH A;  2KHI A;  3DHQ A;  1I4H A;  1VMC A;  3SK5 A;  1F2Y A;  2UUC L;  1YJW A;  1RL2 A;  4GOP B;  2PQA B;  3KLR A;  1XYI A;  2F0W A;  1KQS A;  5M5X B;  1D1I A;  1BCP D;  1ESR A;  4B3R Q;  2A6E D;  3BDC A;  2KCC A;  4A4I A;  4B9X A;  2RA4 A;  5IP9 G;  2F0V A;  4BY1 G;  4UHV A;  2TMP A;  2NZH A;  4OL7 A;  2Q2T A;  3H6M A;  3A8I E;  3CCR A;  4ALP A;  2AQ3 B;  1PH9 A;  2F0O A;  3OW7 A;  4BS9 A;  4DUY Q;  3S1R B;  4JI8 Q;  3BYT B;  3S1Q B;  3K5L A;  4MIU A;  1I94 Q;  5IP7 H;  2CH4 A;  1SYE A;  1GVP A;  2JA7 H;  1OXV A;  4PMB A;  1YVC A;  1G51 A;  5EPL A;  5IOC A;  2A6E C;  1D5X C;  2VB2 X;  1EEI D;  1OXU A;  4P72 A;  4JI3 L;  4K6L A;  1U4P A;  2BDO A;  1ICF B;  3DUZ A;  4JOI C;  3OW2 A;  3SDZ A;  2R93 H;  3GTG H;  1WYD A;  4DNR B;  1K8M A;  3URY A;  5ELF A;  4IUV A;  1EOV A;  2N88 A;  4B3M Q;  4X65 L;  4A3M B;  1J5E L;  4A3K B;  4A3C H;  4ZQ3 A;  4JC0 A;  3CCQ A;  1DJR D;  4X3T A;  3QJY A;  2JK8 A;  1B4O A;  5KRU A;  5IOD A;  4DR1 Q;  5C5M A;  1TWA H;  2Z6B A;  4CBV A;  1WD0 A;  3CCS A;  4A3G B;  4HIO A;  1PTO D;  2CQA A;  4KMU C;  2E2J H;  3K59 A;  4TRD A;  4OGQ C;  3PUX A;  3EQL C;  4LK1 C;  4DU9 A;  1B9M A;  2K28 A;  1E2V A;  3VA7 A;  4FVM A;  1LUZ A;  3RN2 A;  3E3X A;  5C0X H;  4JW0 A;  1EY5 A;  3J7A 5;  1PFM A;  1SYG A;  2A69 D;  1H9R A;  3MXG A;  4C3I H;  3LGJ A;  2PZT A;  5DM6 3;  1TQO A;  1N36 Q;  1NMG A;  3NE5 B;  1AE2 A;  5JJK A;  1ZEQ X;  1PRT B;  1QWY A;  1KC8 C;  1WVL A;  3NTH A;  3CAM A;  1HXY D;  4R4O A;  1BBX C;  2F0L A;  2AHO B;  1PH7 A;  2EXZ A;  3H3V I;  2ZTC A;  3PIO 3;  3QOJ A;  3JAM i;  3HGB A;  2A69 C;  1A3U A;  3MXP A;  2WB1 E;  4QGU A;  3C1F A;  2WP8 J;  1I6H H;  4MN3 A;  3PQI A;  4YCV A;  2K5H A;  4FYD A;  2VW9 A;  4LF7 L;  2EVB A;  4A75 A;  2BA1 A;  4ZAI A;  1AFP A;  3H94 A;  2F0E A;  2EY1 A;  1STH A;  5J1Z A;  1N34 Q;  2IHE A;  1H9M A;  3GTO B;  1IZ6 A;  4XQN A;  2K33 A;  2ZTE A;  2HIX A;  2E5L Q;  2ICI A;  4AQY L;  1WOC A;  3J80 i;  2D0O A;  4IFD J;  4X64 L;  1ZKO A;  5FO8 B;  1B9N A;  1V1P A;  3CQZ H;  4EGV A;  3KFU A;  1ONL A;  1XMO L;  2MGS A;  1SRO A;  5E4X A;  1G6Z A;  2NVY B;  4L5T A;  3T1H Q;  1EU3 A;  4ODG A;  1JB3 A;  3J81 j;  4DAY A;  1SNC A;  5EJW A;  2F0M A;  2E74 C;  4J6H A;  3A5Z B;  3EN2 A;  1YEZ A;  4GLA C;  4V19 0;  4JYA L;  3SK6 A;  4LMQ D;  3H0G B;  4DAP A;  1Q82 C;  4GNX A;  5C0X G;  2Q8T A;  1TR5 A;  4B3R L;  1XXG A;  1E1T A;  2Y0S G;  1VQ7 A;  2SDF A;  4C3I G;  1DM0 B;  3ZJY C;  3NSW A;  5JVH 3;  1GUT A;  1FNV A;  5KEE A;  3GTJ B;  1U9R A;  4A3F B;  1VQD A;  4K14 A;  3RZD B;  2M9V A;  3MXU A;  2R61 A;  1B3Q A;  4DR5 Q;  3CC2 A;  3SE0 A;  4DUY L;  2E2I H;  4JI8 L;  5IGB A;  4LF8 L;  1I94 L;  1A2U A;  1TVX A;  1YIJ A;  4LF6 Q;  4Y52 H;  2P5Z X;  3NK9 A;  4WRD A;  3J7A V;  3KF6 B;  2ES2 A;  5T1G A;  1YNN D;  2B2T A;  5BR8 L;  4NW2 A;  3VYS A;  1PFN A;  4X6A H;  1SYB A;  3J7Z C;  2Z4H A;  3P7J A;  1NE3 A;  4B3M L;  3S2H B;  1I50 B;  4BXX H;  3NQT A;  1EIY B;  2EY5 A;  3VA5 A;  3W3A A;  3TS0 A;  3S1N B;  2FHT A;  3J7A F;  3HOZ B;  4DR1 L;  3E9H A;  3W5O A;  2ZJR A;  5DM7 3;  1B1Z A;  5GAD C;  3QOL A;  3OIQ A;  5EBD A;  1GOZ A;  1UWV A;  3QO2 A;  4XT1 B;  1STN A;  4QUF A;  5I6Y A;  5IT9 L;  4A3D B;  2K52 A;  1II3 A;  1JOQ A;  4PG3 A;  2HCI A;  1IYU A;  4JI5 Q;  1BCP F;  1TS5 A;  2AWN A;  4XYO A;  2K7V A;  4IUN A;  4LF4 Q;  5C3X A;  3L7Z C;  4HTH A;  2N78 A;  2PQA A;  3T1Y L;  2XRQ D;  4X3S A;  1N36 L;  3KDF A;  3KF8 B;  1TS2 A;  5CV6 A;  4C1N K;  2EDG A;  3MFY A;  2OXP A;  1TWG B;  3HG9 A;  1QVG A;  2VZA A;  5M5W H;  1SN8 A;  1BVS A;  5EKK A;  1UNS A;  5M9O A;  3HOY B;  1ROD A;  2RKS A;  1HZC A;  3DEO A;  5E7N A;  1HNX L;  2JA8 H;  1BKB A;  1L1O A;  1SYC A;  2B63 H;  3W1B A;  3TSS A;  4DV1 Q;  1EIF A;  5D14 A;  4DK0 A;  4BBS H;  1RIP A;  2A73 B;  1AH9 A;  2BDN A;  2RF4 A;  1VDZ A;  2X6G A;  4HIK A;  1RCV D;  3I90 A;  1HTP A;  3HOW G;  2R3Z A;  4OWX B;  4LFC Q;  3BVG A;  2K14 A;  2OTJ A;  1EIG A;  4R4I A;  4EX5 A;  4GKJ Q;  2HT1 A;  2NVQ B;  1N34 L;  1HQM C;  1XWE A;  1D8L A;  1T5E A;  1U5K A;  5M3M B;  5C0X I;  4GZY C;  1D2B A;  3Q6S A;  3H91 A;  2NTS A;  4DXF A;  4A3J H;  1PTO F;  4ZK9 B;  4IOA A;  3J81 c;  1HNW Q;  3A74 A;  1X65 A;  2F0F A;  2UXB L;  4PMC A;  2PI2 E;  4LAA A;  3CP0 A;  3NBI A;  2FXQ A;  3HKS A;  3D4W A;  2NUC A;  2F3V A;  1PH5 A;  4I7A A;  1Y8P B;  1GHJ A;  4HR7 B;  2QCP X;  3T56 B;  1VQE A;  5JVG 3;  3F2B A;  4F7X A;  1O7I A;  3AFQ A;  2K50 A;  1EWC A;  2JQO A;  4DNT B;  2RCN A;  3RNU A;  3L0O A;  2K4K A;  1RJT A;  2QEJ C;  4O42 A;  1G29 1;  2NZ1 D;  3GV3 A;  4M8A A;  1MSG A;  5DLQ E;  3JC6 6;  2NWG A;  3M4Y A;  2VQF Q;  1V1Q A;  4HAE A;  1VQG A;  1S5C D;  4NPS A;  4EVO A;  5EKL A;  3TN2 A;  1PH1 A;  4IFD H;  1KAA A;  2E2D C;  2EY6 A;  5KYL A;  4A93 B;  4YCW A;  4GN4 B;  3HOV G;  4YCU A;  1CKM A;  3I4M H;  5C5L A;  4CDD C;  2HCC A;  5IWA Q;  4DR5 L;  2FIN B;  2F0G A;  4DV5 Q;  2SNS A;  1HJP A;  1HFN A;  1P16 A;  3WOE A;  4DR7 L;  4K0K Q;  2ZXR A;  1JR0 D;  2LFN A;  2JA8 G;  4LF6 L;  5T1I A;  1I3Q B;  3EJI A;  2B63 G;  3PO2 B;  4IZ8 A;  3HS0 C;  4RKL A;  4P2C B;  4BBS G;  3S14 B;  5F2D A;  4DV3 Q;  1F9S A;  1JOR A;  5IGF A;  3UDF A;  5JAV A;  4QF4 A;  4I65 A;  1Y1V B;  2VUM H;  4YIJ A;  3HRZ C;  3HKZ B;  1V1O A;  3Q23 A;  2KBN A;  3VYU A;  3MTS A;  1ILP A;  5C4Z A;  4JOI A;  5CV7 A;  3M7N A;  5LL6 S;  5JEA G;  3HOX G;  2O5I C;  4A3J G;  1MI2 A;  4KJN A;  3TP5 A;  2L0C A;  5I9P A;  3FKI B;  5IYD G;  4A3I H;  1CHQ D;  1PYW D;  2CHB D;  3U9O A;  2Z6K A;  4LF5 Q;  1GUG A;  3CPF A;  1L0W A;  2Z0S A;  3S1R H;  3R93 A;  1RF2 D;  1X55 A;  4A3B G;  1SDF A;  1C7Y A;  3IL8 A;  5ELC A;  1DCZ A;  3BDL A;  2GN5 A;  3K5N A;  4KI0 A;  2KEE A;  3M3Y H;  4LF4 L;  1FGB D;  1CUK A;  1Q1B A;  4IO9 A;  5DAU A;  3BYY B;  3I70 A;  3NWS A;  1GUW A;  1YNJ D;  1X3Q A;  2ZJQ A;  1TWC B;  2LSS A;  4K6D A;  2RBM A;  5C3E G;  4B08 A;  4APV A;  2MO1 A;  3K0Y A;  1LTL A;  2IPK D;  4GLX A;  2KA7 A;  5M3F H;  1VQO A;  3D31 A;  2ID0 A;  4JI2 Q;  2C35 B;  4IFD G;  1GD7 A;  1MD2 D;  5JPM C;  1VQK A;  4IPD A;  1R9T B;  1QNU A;  1O80 A;  1ET6 A;  1H9J A;  2I5L X;  3OSO A;  4IPC A;  1ASY A;  1S5D D;  3PO3 H;  5EQ0 A;  3KF6 A;  4UDU C;  3MHB A;  2F52 A;  2UXD Q;  1Q90 A;  4J8Q A;  2FMC A;  1SND A;  1M4V A;  3JAM c;  5C4X G;  1PFS A;  1B7Y B;  3SGI A;  2HQE A;  1HHV A;  1V1P B;  2R92 H;  2XRS D;  3SK8 A;  1SMX A;  1Q81 C;  3DWQ A;  2VUM G;  2CW0 C;  4POG A;  2ZT9 C;  2KHS A;  1HNW L;  3K80 C;  3FHW A;  1E24 A;  1EYA A;  3I7F A;  2F0H A;  1SE2 A;  3IKJ A;  1I4G A;  1A2T A;  2I5H A;  2N55 A;  3HFZ B;  2N3S A;  4JBW A;  5FO9 B;  1QZH A;  2N49 A;  3H09 A;  1B70 B;  3S1Q H;  3AU7 A;  3WDN A;  2PW5 A;  1SAP A;  3MFG A;  2B2W C;  1X3G A;  2WV6 D;  1UAP A;  2LMC B;  4Y7N B;  2JN4 A;  3NEN A;  3J80 c;  4HED A;  1AN8 A;  1LT5 D;  2KQ3 A;  3P75 A;  3DEP A;  1KHI A;  1YBY A;  4V0B A;  1PV4 A;  2XN9 C;  2OT2 A;  1XPU A;  5G3L D;  2ZJP A;  2FMM A;  1X3P A;  2RCF A;  2B2V C;  2VQF L;  1JJC B;  5AJ3 Q;  4HID A;  2Q2U A;  1ASZ A;  1EY9 A;  3E9I A;  4A3K H;  1OXT A;  2B2U C;  2D0P A;  1AZQ A;  4JI4 Q;  1D6E C;  2M00 A;  5TSS A;  4MHE A;  2C5C A;  2R7Z B;  1GHK A;  1SNM A;  3I56 A;  1JJ2 A;  3PV0 A;  4A3G H;  3L3O C;  4KLK A;  3GTK B;  2EYM A;  3ITP A;  4DV5 L;  2JJQ A;  4E6I A;  1OTC A;  3GTQ B;  4K0K L;  2QDL A;  1LYL A;  1KD1 C;  3C1E A;  2ZM6 Q;  1M90 C;  4MNO A;  4CHT B;  3HOU B;  4FO2 A;  4G7Z C;  4CDE C;  2D62 A;  5M5Y B;  1UEA B;  4R1J A;  3ND8 A;  1FR3 A;  2HHH Q;  4JV5 L;  4OIK A;  2VS1 A;  4LF9 L;  1PZK D;  4KHP L;  4TKO B;  1W2B A;  3PO3 G;  2YV5 A;  1TU2 B;  4FXD A;  1STE A;  1PYB A;  1VQL A;  4KN4 C;  4DK3 C;  5C44 H;  3X3N A;  3I4O A;  3OWF A;  3CPW A;  1I4R A;  5IYC H;  1KAB A;  3D4R A;  5JJL A;  1TY2 A;  2NN6 H;  4CJ2 C;  2OTL A;  2PO4 A;  2EE1 A;  4A3E H;  3V05 A;  4IFD I;  4HJ7 A;  1BBU A;  2R92 G;  2RDG A;  1T5X D;  4IPG A;  3M4P A;  1EY6 A;  1HZ9 A;  2QDB A;  1XNQ Q;  1N8R C;  4A3L H;  3F2C A;  2MUY A;  1D5Z C;  3MWY W;  3EIV A;  3KDF B;  5IYB G;  4QIW E;  3UE0 A;  4AYB B;  3G71 A;  1HUM A;  5C4J B;  1WFQ A;  4L8J A;  4F8M A;  1E3P A;  4J15 A;  1HA6 A;  5JJZ A;  5DEH A;  1L1O B;  1DXM A;  1KNE A;  1MHW C;  3R8B A;  3GTO H;  4DA2 A;  3ULL A;  2K32 A;  1I4P A;  3HKZ E;  2IJ0 A;  1IL8 A;  4RAU C;  4FXK C;  4KKU A;  5CGK A;  3OYY A;  1A8V A;  1JOK A;  3DM1 A;  1C0A A;  2B39 A;  3OTO Q;  1GKH A;  1V8Q A;  1KRS A;  2IT1 A;  1YZ6 A;  5EGT A;  3PF4 A;  4HJ8 A;  4CKB A;  1AE3 A;  2NVY H;  3HEJ A;  2FFK B;  4OEM B;  4B9W A;  3TS2 A;  2L11 A;  3A5U A;  1S5B D;  4YY3 L;  1VMP A;  4NXN Q;  3TEH B;  3MC0 B;  4JI6 Q;  4BY1 B;  4DV6 Q;  4BY7 G;  3CC7 A;  3DMU A;  1XJV A;  2ENB A;  4NB3 A;  1Q1E A;  2K5W A;  3DWA A;  5GRO A;  4DR4 Q;  2A5H A;  3CCU A;  4BA1 I;  4LW1 A;  1BQQ T;  1I4X A;  3UDG A;  3CCL A;  4A3F H;  1PTO H;  2OF1 A;  2CH4 W;  1E1O A;  2A68 C;  1WD1 A;  1QUQ B;  3RZD H;  5C44 G;  1LTI D;  2EOT A;  2VL6 A;  2EYO A;  2CWA A;  1NTG A;  3CME A;  5IYC G;  1GUO A;  4ZKB B;  1B2T A;  3OMG A;  1Y1W B;  2NN6 G;  1IKL A;  1KTK A;  5CC4 A;  1Z6H A;  3AEV A;  4DUZ Q;  4A3E G;  5GAE C;  3GTL B;  3GO5 A;  2K05 A;  3F8T A;  2MPM A;  2UXC L;  1U4M A;  1LT4 D;  3LNN A;  2J0T D;  3FRP B;  3TRE A;  1WCM B;  3M9B A;  3RZO B;  4ME3 A;  4RCO A;  4IUQ A;  2XGT A;  3I73 A;  1X9N A;  1CQV A;  1OXS C;  5LMU L;  2Q8I B;  3MAQ A;  2A6H C;  4N8X 1;  5K5P A;  1I50 H;  4H44 C;  1GUN A;  2EYP A;  1BO0 A;  4JI4 L;  3S1N H;  1UUP A;  1MSH A;  3I3C A;  3RD4 A;  1L2F A;  4DV0 L;  1JWS D;  4P71 A;  1SMY C;  4ZRZ A;  1QE6 A;  2DUD A;  1EYD A;  1J9O A;  1VQ9 A;  3R2T A;  1NR4 A;  3SK4 A;  1HTL D;  5IP7 G;  1LLR D;  1LAB A;  3KUP A;  1STA A;  2JA7 G;  2WKC A;  3E0E A;  1QJO A;  4XQQ A;  4A3D H;  1FGU A;  1RTN A;  3EBE A;  1SLJ A;  3UE1 A;  4XIG S;  5IIF A;  5I2X A;  1HFG A;  3K81 C;  3I4N H;  1PZI D;  3D6C A;  1VQH A;  2HHH L;  2R93 G;  4L63 B;  1D7Q A;  1E2Z A;  2Z9H A;  3FEW X;  3KBX A;  1JWM D;  2JA9 A;  5I4D A;  4RFB A;  4F88 A;  3W1G A;  2JP1 A;  3G48 A;  4LJZ C;  4A3C G;  1SE8 A;  4FF2 A;  1TWG H;  4I7Z C;  2KJX A;  3TZD A;  4AH6 A;  2RDF A;  4IJL A;  4CDC C;  3HOY H;  1EUJ A;  1XNR Q;  1DYQ A;  3D6W A;  2B2Y C;  4QCL A;  5FLX E;  3C46 A;  1PLF A;  2Z1C A;  2ALY B;  1BNZ A;  4OXP A;  1QVF A;  1HNZ Q;  3S17 H;  3J81 L;  1A62 A;  4DXG A;  3L2P A;  2L9H A;  4HSV A;  3CW2 C;  1HRJ A;  4QUC A;  1CI3 M;  1VQ4 A;  1BOS A;  1G6P A;  1NNX A;  2F0T A;  2Q2H A;  4OEL B;  4B3T Q;  5FK9 C;  4YHH Q;  2OWO A;  4JI1 Q;  1XPR A;  4GKK Q;  4OHJ A;  2A1A A;  3NBH A;  2N8N A;  3S16 B;  4A76 A;  1U4L A;  5M3M H;  4OX9 Q;  1V9P A;  1A3T A;  1N32 Q;  3A7A B;  5FJ8 H;  5GAH C;  3X3M A;  1P8L A;  1VCI A;  1TWF B;  1MJC A;  4KN7 C;  2MNA A;  1SSO A;  2XIW A;  4DAM A;  2SOB A;  3OTO L;  2RHS B;  1IBK Q;  4DNI A;  3D4D A;  1CSQ A;  4R4Q A;  1YJN A;  3QG1 A;  2NN6 I;  4ZUI A;  2KCM A;  3OMC A;  5ELE A;  1C8C A;  1BXT A;  1PRT F;  4RGO S;  3S24 A;  2IHF A;  1MIU A;  3QWN A;  3RUZ A;  4PZ8 A;  1EQV A;  2Y0S B;  5IY0 A;  1EY4 A;  2A19 A;  4C3I B;  5A35 A;  1LT3 D;  4AYB E;  4A3D G;  2X69 A;  4XQJ A;  3P20 A;  3DWP A;  4Q5V A;  4JI6 L;  4DV6 L;  1Q12 A;  5C3W A;  1B53 A;  3I4N G;  5EAY A;  1TY0 A;  1EQQ A;  1YHQ A;  4HJ9 A;  4DR4 L;  1B44 D;  1VQJ A;  1ENC A;  1L0X B;  3AQQ A;  4C2M B;  4A93 H;  2CQO A;  3M4Q A;  1XPO A;  4JI7 Q;  2GVB A;  1EFI D;  3UDI A;  1SBB B;  2EYL A;  4ILW A;  3KJP A;  1XMQ Q;  1NJI C;  2G9D A;  1X3E A;  3PGZ A;  1OO9 B;  1KNA A;  2JA6 B;  3K0X A;  3HOY G;  3NWT A;  1CHP D;  1F2M A;  1WTH A;  1QOH A;  2CWP A;  2V4D A;  1I3Q H;  3PO2 H;  5I2Y A;  2B8G A;  1K28 A;  2IY5 B;  3C3L A;  4IUT A;  4G7O C;  3S14 H;  5BN3 A;  3J7Y W;  3I55 A;  1E7Z A;  5IGE A;  2YU9 H;  4K2L A;  5JPN C;  2OQK A;  2F4I A;  1STG A;  2PNH A;  2PPB C;  1QCB D;  3R2I A;  1B3A A;  1Y1V H;  4PV1 C;  1CM9 A;  2IX0 A;  2B2W A;  1N9W A;  1CQF A;  2E76 C;  5HUR A;  4S3S A;  1SYD A;  2WAQ G;  2QA4 A;  1NSN S;  1DGS A;  2QGQ A;  1K3B C;  4FF1 A;  2B2V A;  1A6X A;  1O78 A;  2Q8R E;  4JBM A;  4RWS C;  1RDP D;  1DOK A;  1E0B A;  3FKI H;  1QG7 A;  1PVO A;  3SHL A;  2B2U A;  3CU7 A;  1HQR D;  4HIM A;  4KD3 A;  5LMN Q;  2QIL A;  5E3F A;  2C9O A;  3NP8 A;  1O7Y A;  2K5D A;  3M4O B;  3S2D B;  1W3S A;  4QY7 A;  3CXC A;  2PYK A;  2E5L L;  3SEB A;  2F4V Q;  1RKN A;  1IBL Q;  1TWC H;  4KHZ A;  3TRZ A;  4MZ9 A;  1AZP A;  1M8A A;  4O2D A;  4BXX G;  1L0Y B;  3E6Z X;  1JB7 A;  4GS3 A;  1VQC A;  3OWE B;  2WII B;  4BBR H;  1XNR L;  4G4K A;  1K73 C;  4FF4 A;  4DR3 Q;  3T1H L;  1YIT A;  1QUQ A;  3JAM L;  1CFM A;  3KLS A;  1R9T H;  3HOW B;  4A93 G;  3MEH A;  4KHV A;  2HUG A;  2UU9 Q;  1SFO B;  1NUC A;  5HGT A;  3UI2 A;  4YWM A;  3BVM A;  1AEX A;  5IGC A;  1B50 A;  4B3T L;  2PCF B;  4YHH L;  4JI1 L;  1WTQ A;  3CRL C;  4GKK L;  4DK6 C;  1LM0 A;  1Q8I A;  4H7B A;  2PI2 A;  4NDX A;  1B8A A;  1K0S A;  1QB5 D;  4DK1 A;  4UPA A;  4WOR A;  2DNE A;  4JVZ A;  5EBC A;  5ELO A;  5FLX c;  2PZU A;  1N33 Q;  4QIW B;  2IX1 A;  3J80 L;  2G5D A;  4JCV E;  3GTM B;  2AUJ D;  4XDX A;  1SRU A;  1IBK L;  2O4X A;  2E2H B;  2LXJ A;  3QB3 A;  1CKO A;  3CKI B;  5GAG C;  4MTK A;  1VQN A;  4BWG B;  1FD7 D;  3VYT A;  3K58 A;  1SNQ A;  1CTM A;  2M2L A;  2MJ8 A;  3FKI G;  4KD4 A;  2EZV A;  1MBY A;  5FO7 B;  2F3I A;  4HN7 A;  3T13 A;  3SVM A;  3K7U C;  2D9U A;  4KV6 A;  4ZCK A;  1JJG A;  1J6Q A;  1X56 A;  2ZTD A;  1JT8 A;  4P73 A;  3HOV B;  1IKM A;  1EEF D;  4Z9C B;  4CKC A;  2F0Q A;  4KY5 A;  3VR4 A;  3BU2 A;  2AUK A;  2BCO A;  2EQS A;  2BE5 C;  4RA8 A;  2JEA I;  4C3J H;  3N6R A;  2EIF A;  2R7Z H;  4ZYS A;  5E4W C;  1LTR D;  1C48 A;  4U68 A;  3CF5 A;  2JA8 B;  2B63 B;  2J7Z A;  4FDB A;  3F2D A;  1VF7 A;  4RGT A;  4IOC A;  3S1M H;  4B3S Q;  3UDX A;  4JI5 L;  3GTQ H;  2QKI C;  2KEC A;  4BBR G;  3H15 A;  1BBW A;  3GTP B;  4JBJ A;  4PZ7 A;  3C2P A;  2QEX A;  1TII D;  3HOU H;  5CV8 A;  3KOJ A;  2UUC Q;  5M5Y H;  1S40 A;  3A54 A;  2OQ0 A;  3LWE A;  3GP7 A;  2VQE Q;  5KND A;  4JPB W;  4TSS A;  2JA5 H;  3HOX B;  4K5W A;  2Y0S E;  4G57 A;  4A3J B;  1Q8K A;  1I4Q A;  1ZXT A;  3G6J B;  1HZA A;  3OOC A;  4DV1 L;  4K8J A;  1PXU A;  2F0N A;  2KEN A;  2MHV A;  1WTP A;  3OIP A;  1K9M C;  2CW0 D;  4CDF C;  2Q2I A;  2LS0 1;  3I4M G;  1MKH A;  1SJE D;  4RMF A;  1IL2 A;  5NUC A;  2WB1 G;  5IGD A;  1U0L A;  3I72 A;  4A3B B;  1EOT A;  4L5S A;  2L12 A;  4LFC L;  1TWH B;  1F2Z A;  2E75 C;  3KK7 A;  3EVQ A;  3PF5 A;  3FP9 A;  1IW7 C;  4PZ6 A;  4GKJ L;  5M5X H;  1H95 A;  1DON A;  4UAI A;  2K04 A;  4X62 Q;  3NTK A;  5C4J H;  3I2Z A;  5C3E B;  2F4V L;  1G2T A;  1O7L A;  1VQA A;  3A8J E;  3A56 A;  3K8A A;  4DV4 Q;  5BN5 A;  4IPH A;  1IBL L;  1JE5 A;  2LKV A;  3V96 A;  1DOM A;  3S15 B;  1A0I A;  3FPU B;  4ZLT F;  5LMN W;  5J22 A;  4U67 3;  2PMZ B;  3TDQ A;  1J5E Q;  5A2Q L;  3T4A C;  1JE4 A;  3BG3 A;  5JJI A;  1UE7 A;  3AYH B;  3BJU A;  1QNK A;  2UUB Q;  2AKW B;  1EZ6 A;  1PH6 A;  4DR3 L;  2KCT A;  3PUV A;  3RMH A;  4A3I G;  5ELN A;  3B6Y A;  2UU9 L;  4C3J G;  5K36 H;  3PUZ A;  3KYH C;  4H02 A;  3NBH B;  1VF5 C;  3H3V C;  1S5F D;  4GOP C;  4G7H C;  1R4P B;  3F1Z A;  4KY6 A;  1WTX A;  4FNF A;  2B2Y A;  5C4X B;  1FVI A;  2VNU D;  4A3M H;  2CKZ B;  3IFD A;  1VQF A;  4PNY A;  2XVS A;  1VQI A;  3CC4 A;  2VUM B;  4MTN A;  2NVX B;  3HOU G;  3O13 A;  3TME A;  1X54 A;  2RVL A;  4QL5 A;  4H13 C;  5IWA L;  4LNQ A;  1K8G A;  2JA5 G;  3G6E A;  2GVA A;  2J4X A;  5M3F G;  1Z47 A;  2H4O A;  2IX3 A;  2KVM A;  1K83 B;  3VYR A;  1GO3 E;  4DV3 L;  3DLL A;  1PH8 A;  4JI0 Q;  3S9W A;  4F87 A;  1Y1W H;  4CGY B;  3WOF A;  2JEB I;  1G2S A;  1Y8N B;  5IE8 A;  4J1M A;  2BA0 A;  1HH2 P;  1K3R A;  5I6W A;  3J81 i;  2DJG C; 
#chains in the Genus database with same CATH homology
 4X3U A;  3M3Y B;  3U9S A;  2EJM A;  1FYC A;  4M1U B;  1JWU D;  3ONA B;  1WTR A;  1EWH A;  2IWH A;  5ISR A;  2F0U A;  3A55 A;  1LTS D;  5CV9 A;  2R6G A;  1X32 A;  1CA6 A;  3NHH A;  5C6A A;  3AB9 A;  3I91 A;  3MZ5 A;  3T51 B;  4EQO A;  1JOO A;  5DNF A;  3E5S A;  4FF3 A;  4H0L C;  3VR2 A;  3PO3 B;  2G9H D;  4C3H B;  2D5D A;  5ELB A;  5K36 G;  2K6A A;  4KKT A;  4HCS A;  1XTC D;  2RSO A;  1PRT C;  1RHP A;  1D1K A;  4KY7 A;  5KNC A;  1LTT D;  2R92 B;  1BDO A;  5COR A;  1EQT A;  5KNB A;  2DN8 A;  3VR3 A;  2A68 D;  1H9S A;  5CV5 A;  4R9W A;  2EYF A;  2SEB D;  3K7A B;  4K8I A;  1D5M C;  1BCP C;  2GA4 B;  2F0S A;  2PNR C;  4QMG A;  1V43 A;  2EY2 A;  1JCK B;  1RTO A;  1SE3 A;  3M7G A;  2A6H D;  3Q22 A;  1F9R A;  4O1N A;  4DF7 A;  2TSS A;  3FDT A;  4RHS A;  1SMY D;  1DZ1 A;  2F0P A;  1SNO A;  4IN3 A;  3PUW A;  5LHY 1;  2SNM A;  3NUC A;  4KTA A;  2X6L A;  5EPJ A;  1PMR A;  1SNP A;  4BY7 B;  3P1H A;  2NVT B;  4HMI A;  2Z4I A;  3T53 B;  4PQX A;  2F0D A;  1J8I A;  1PTO C;  5C44 B;  4ABN A;  3DXJ C;  3CHB D;  5JEA J;  4DFA A;  4A3E B;  3TP6 A;  1OXX K;  1EYC A;  5D3I B;  4C56 C;  3J81 E;  1ML0 D;  4OO1 H;  2L4N A;  1Z7T A;  2IL8 A;  1H9K A;  1S4Z A;  1AP0 A;  1GJX A;  4HSP A;  5C4H A;  4R8I A;  1EU4 A;  4EQP A;  1JQY D;  1BCP B;  3TZU A;  3A8K E;  1KLG D;  2EPB A;  3TP7 A;  2XSC A;  3W2D A;  4IAL A;  2JA7 B;  2F0K A;  3K6O A;  3PMF A;  1F9Q A;  5G3L F;  2NBF A;  4RH6 A;  5CMD A;  4ZUJ A;  2ZXO A;  4NKL A;  2R93 B;  5AFW A;  3GTG B;  1CA5 A;  2H1E A;  4N9T A;  2I07 B;  3AMU A;  3NPP A;  1HCZ A;  2AQ1 B;  3T16 A;  5LL6 X;  1HUN A;  3EA6 A;  1TWA B;  4RKB A;  5CV4 A;  1WTO A;  5IT9 E;  1LTB D;  2KUM A;  2KED A;  1FNW A;  2E2J B;  3IAY A;  1PTO B;  4CKE A;  1XX8 A;  3G7L A;  1EZ8 A;  5COY A;  3KBG A;  5J39 A;  1ET9 A;  2PZW A;  2DY7 A;  2LY7 A;  2VXW A;  3NTI A;  2L55 A;  1ICW A;  2F0J A;  1ESF A;  5D3D A;  5FLX L;  1W6K A;  4OO1 G;  1GUS A;  1TKW B;  3Q24 A;  4KKS A;  1JC7 A;  3FMC A;  1LTG D;  1KLU D;  3VR6 A;  1F77 A;  3ZYY X;  3GV6 A;  3D8G A;  2RQX A;  3BVZ A;  1YNN C;  1I6H B;  4N9P A;  1ZYR D;  4RHR A;  1W6J A;  3PIP 3;  1F2L A;  4TQU S;  4K2K A;  2BOS A;  3F2U A;  2K1B A;  1LV9 A;  2WIN B;  2WAC A;  3ERQ A;  3I4N B;  2JYO A;  1F9P A;  2D2C C;  1IHZ A;  3LX0 A;  4DN4 M;  5CBE E;  3BDO A;  3GD7 A;  4C1N I;  1G8Z D;  1HPC A;  2A74 C;  4IUP A;  5EKI A;  4PMW A;  4WFN 3;  5KYI A;  1ZYR C;  4XXE A;  3CQZ B;  3JAM E;  4NP5 A;  3MXN A;  5BN4 A;  1R4Q B;  1JIC A;  3KLS X;  2AQ2 B;  1CT1 D;  3OPO A;  1DOL A;  2F1M A;  5CYU A;  1O7Z A;  1BUV T;  3S17 B;  4CJ1 B;  5KIX A;  1QIL A;  3QIA A;  1WTV A;  2HDM A;  1Y8O B;  1SYF A;  2WAQ B;  3MA2 B;  5JEA H;  4ZKC B;  1Q3L A;  1NAP A;  3E0J A;  3J80 E;  2YYZ A;  4FP5 D;  2E2I B;  2PW7 A;  4IQZ A;  4RGM A;  4XTC S;  4K5X A;  3ND9 A;  2XNA C;  5FKA C;  1MGS A;  3L9A X;  1I6V C;  3BZD B;  3NXW A;  1GXD C;  2O5J C;  2QF7 A;  1AW7 A;  2F3W A;  4QB4 A;  1FNU A;  1ENA A;  4OO1 I;  1WTW A;  1SJH D;  1SXT A;  2K5Q A;  1G91 A;  5EPK A;  2NYZ D;  1TT2 A;  2Z8L A;  1SEB D;  4DAV A;  1H9S B;  2XWB B;  4FXG C;  1TS3 A;  1CZG A;  2OEO A;  3IFT A;  3FVQ A;  2BE5 D;  2NTT A;  3I4L A;  1STY A;  2EYH A;  1PDQ A;  4NMZ A;  1EY0 A;  3EFX D;  2NB0 A;  1ILQ A;  1LT6 D;  2L5T A;  2DY8 A;  1EL0 A;  1PZJ D;  1ENF A;  5CR3 A;  5E1F A;  2F03 A;  3SR1 A;  5I9O A;  2YU9 B;  4ME5 A;  1LO5 D;  5M5W B;  1KDC A;  2AWO A;  2JE6 I;  2KCN A;  3A7L A;  4JK1 C;  1S5E D;  4BBS B;  1CZW A;  1RD9 D;  2EJF C;  2KOL A;  3TBI B;  1CK1 A;  1SE4 A;  3R3O A;  4KK7 A;  2PQE A;  5D65 A;  3TP8 A;  3M85 A;  1A15 A;  1IW7 D;  2K01 A;  3CRK C;  1PFB A;  2EYJ A;  3LWU A;  3SXH A;  5A2Q E;  5ELD A;  4IUR A;  4XT3 B;  1KDA A;  1KDB A;  2IW3 A;  2B2T C;  4L6T B;  2FJ2 A;  4BBR B;  3K5O A;  4ID6 A;  2RSN A;  3V2T A;  1LAC A;  3PUY A;  2ICE C;  5CBA E;  3K57 A;  4IUU A;  3ERO A;  3MVV A;  1STB A;  4RCN A;  1YNJ C;  2VB3 X;  2JXM B;  1NCV A;  5C0X J;  4XYQ A;  1Y69 U;  3RLF A;  1E2W A;  4HCE A;  2JSO A;  1EY7 A;  3FPP A;  4HMJ A;  3I4M B;  1DD2 A;  1NR2 A;  4K5V A;  2MP1 A;  2WB1 B;  2EJG C;  1BF4 A;  2XWJ B;  3GQB A;  3N52 A;  3OHX C;  1K8O A;  3NQI A;  4KJO A;  2CVR A;  1BR9 A;  2K03 A;  2L1B A;  5FOB B;  5IGG A;  3K5M A;  4X3K A;  5JOB A;  4OIJ A;  1A3V A;  3HZX A;  3D3R A;  4EQN A;  3KF8 A;  4A3I B;  4WJW A;  4C3J B;  3BS1 A;  4BA2 I;  3HP3 A;  1LTA D;  4ULL A;  1C4Q A;  4DGZ A;  3S1M B;  2I46 A;  2F0I A;  2B8F A;  2WKD A;  3I8Z A;  2ZXP A;  3VR5 A;  1HA5 A;  1IYV A;  4RGN A;  2RDH A;  2DNC A;  3Q0A A;  2JA5 B;  4R8N A;  1PRT D;  5M3F B;  4C3H G;  1TS4 A;  4CJ0 B;  4Q0F A;  1EY8 A;  2HDL A;  5KGU A;  2O2L D;  1U4R A;  1EIH A;  3DHQ A;  1I4H A;  1VMC A;  3SK5 A;  1F2Y A;  3KLR A;  1XYI A;  2F0W A;  5M5X B;  1D1I A;  1BCP D;  1ESR A;  2A6E D;  3BDC A;  2KCC A;  4B9X A;  2RA4 A;  2F0V A;  2TMP A;  4OL7 A;  3H6M A;  3A8I E;  2AQ3 B;  2F0O A;  3OW7 A;  4BS9 A;  3BYT B;  3S1Q B;  3K5L A;  4MIU A;  1SYE A;  1OXV A;  4PMB A;  5EPL A;  5IOC A;  2A6E C;  1D5X C;  2VB2 X;  1EEI D;  1OXU A;  4K6L A;  1U4P A;  2BDO A;  3DUZ A;  3SDZ A;  4DNR B;  1K8M A;  3URY A;  5ELF A;  4IUV A;  2N88 A;  4A3M B;  4A3K B;  4ZQ3 A;  1DJR D;  4X3T A;  3QJY A;  1B4O A;  5KRU A;  5IOD A;  5C5M A;  4CBV A;  1WD0 A;  4A3G B;  1PTO D;  2CQA A;  4KMU C;  3K59 A;  4TRD A;  4OGQ C;  3PUX A;  3EQL C;  4LK1 C;  4DU9 A;  1B9M A;  2K28 A;  1E2V A;  3VA7 A;  4FVM A;  5C0X H;  1EY5 A;  1PFM A;  1SYG A;  2A69 D;  1H9R A;  3MXG A;  2PZT A;  5DM6 3;  1TQO A;  3NE5 B;  1ZEQ X;  1PRT B;  1QWY A;  1WVL A;  3NTH A;  1HXY D;  1BBX C;  2F0L A;  2EXZ A;  3PIO 3;  3QOJ A;  3HGB A;  2A69 C;  1A3U A;  3MXP A;  3C1F A;  2WP8 J;  4MN3 A;  4FYD A;  2EVB A;  2BA1 A;  4ZAI A;  1AFP A;  3H94 A;  2F0E A;  2EY1 A;  1STH A;  5J1Z A;  1H9M A;  3GTO B;  4XQN A;  2K33 A;  2ICI A;  4IFD J;  1ZKO A;  5FO8 B;  1B9N A;  1V1P A;  4EGV A;  1ONL A;  2MGS A;  5E4X A;  1G6Z A;  2NVY B;  1EU3 A;  4ODG A;  1JB3 A;  4DAY A;  1SNC A;  5EJW A;  2F0M A;  2E74 C;  4J6H A;  4V19 0;  3SK6 A;  4LMQ D;  3H0G B;  4DAP A;  5C0X G;  2Q8T A;  1TR5 A;  1XXG A;  2SDF A;  4C3I G;  1DM0 B;  3NSW A;  5JVH 3;  1GUT A;  1FNV A;  5KEE A;  3GTJ B;  1U9R A;  4A3F B;  4K14 A;  3RZD B;  2M9V A;  3MXU A;  2R61 A;  3SE0 A;  5IGB A;  1A2U A;  1TVX A;  3NK9 A;  4WRD A;  3J7A V;  5T1G A;  1YNN D;  2B2T A;  4NW2 A;  3VYS A;  1PFN A;  1SYB A;  2Z4H A;  3P7J A;  3S2H B;  1I50 B;  3NQT A;  2EY5 A;  3VA5 A;  3W3A A;  3S1N B;  2FHT A;  3J7A F;  3HOZ B;  5DM7 3;  1B1Z A;  3QOL A;  3OIQ A;  5EBD A;  1GOZ A;  3QO2 A;  4XT1 B;  1STN A;  4QUF A;  5I6Y A;  5IT9 L;  4A3D B;  1II3 A;  1JOQ A;  2HCI A;  1IYU A;  1BCP F;  1TS5 A;  2AWN A;  4XYO A;  2K7V A;  4IUN A;  5C3X A;  3L7Z C;  4HTH A;  2XRQ D;  4X3S A;  1TS2 A;  5CV6 A;  4C1N K;  2EDG A;  3MFY A;  2OXP A;  1TWG B;  3HG9 A;  5EKK A;  1UNS A;  5M9O A;  3HOY B;  1ROD A;  2RKS A;  3DEO A;  1SYC A;  3TSS A;  5D14 A;  4DK0 A;  2A73 B;  2BDN A;  1VDZ A;  2X6G A;  1RCV D;  3I90 A;  1HTP A;  2R3Z A;  3BVG A;  1EIG A;  2NVQ B;  1HQM C;  1XWE A;  1T5E A;  4GZY C;  5M3M B;  5C0X I;  1D2B A;  3Q6S A;  3H91 A;  2NTS A;  4DXF A;  1PTO F;  4ZK9 B;  2F0F A;  4PMC A;  4LAA A;  3NBI A;  3D4W A;  2NUC A;  2F3V A;  1Y8P B;  1GHJ A;  4HR7 B;  2QCP X;  3T56 B;  5JVG 3;  4F7X A;  1EWC A;  4DNT B;  1RJT A;  2QEJ C;  4O42 A;  1G29 1;  2NZ1 D;  3GV3 A;  4M8A A;  1MSG A;  2NWG A;  3M4Y A;  4HAE A;  1S5C D;  4EVO A;  4IFD H;  5EKL A;  3TN2 A;  1KAA A;  2E2D C;  2EY6 A;  5KYL A;  4A93 B;  5C5L A;  2HCC A;  2FIN B;  2F0G A;  2SNS A;  1HFN A;  3WOE A;  2ZXR A;  1JR0 D;  2LFN A;  3PO2 B;  5T1I A;  1I3Q B;  3EJI A;  4IZ8 A;  3HS0 C;  4RKL A;  4P2C B;  3S14 B;  5F2D A;  1F9S A;  1JOR A;  5IGF A;  5JAV A;  4QF4 A;  4I65 A;  1Y1V B;  4YIJ A;  3HRZ C;  3HKZ B;  1V1O A;  3Q23 A;  3VYU A;  3MTS A;  1ILP A;  5C4Z A;  5CV7 A;  3M7N A;  5LL6 S;  5JEA G;  2O5I C;  1MI2 A;  4KJN A;  3TP5 A;  2L0C A;  5I9P A;  3FKI B;  1CHQ D;  1PYW D;  2CHB D;  3U9O A;  1GUG A;  3R93 A;  1RF2 D;  1SDF A;  3IL8 A;  5ELC A;  1DCZ A;  3BDL A;  3K5N A;  4KI0 A;  2KEE A;  1FGB D;  1Q1B A;  5DAU A;  3BYY B;  3I70 A;  3NWS A;  1GUW A;  1YNJ D;  1X3Q A;  1TWC B;  4K6D A;  2RBM A;  4B08 A;  3K0Y A;  2IPK D;  2KA7 A;  3D31 A;  2ID0 A;  4IFD G;  1MD2 D;  5JPM C;  1R9T B;  1QNU A;  1O80 A;  1ET6 A;  1H9J A;  3OSO A;  1S5D D;  5EQ0 A;  4UDU C;  3MHB A;  1Q90 A;  4J8Q A;  2FMC A;  1SND A;  1M4V A;  2HQE A;  1HHV A;  1V1P B;  2XRS D;  3SK8 A;  3DWQ A;  2CW0 C;  2ZT9 C;  2KHS A;  1EYA A;  2F0H A;  1SE2 A;  3IKJ A;  1I4G A;  1A2T A;  2N55 A;  4JBW A;  5FO9 B;  3H09 A;  3AU7 A;  3WDN A;  2PW5 A;  1SAP A;  3MFG A;  2B2W C;  2WV6 D;  1UAP A;  2LMC B;  4Y7N B;  4HED A;  1AN8 A;  1LT5 D;  2KQ3 A;  3P75 A;  3DEP A;  4V0B A;  2XN9 C;  2OT2 A;  5G3L D;  2FMM A;  1X3P A;  2B2V C;  1EY9 A;  1OXT A;  2B2U C;  1AZQ A;  1D6E C;  2M00 A;  5TSS A;  4MHE A;  2C5C A;  2R7Z B;  1GHK A;  1SNM A;  3PV0 A;  3L3O C;  3GTK B;  2EYM A;  3ITP A;  4E6I A;  3GTQ B;  3C1E A;  4CHT B;  3HOU B;  4FO2 A;  4G7Z C;  2D62 A;  5M5Y B;  1UEA B;  3ND8 A;  1FR3 A;  4OIK A;  1PZK D;  4TKO B;  1TU2 B;  4FXD A;  1STE A;  4KN4 C;  3X3N A;  3OWF A;  1I4R A;  1KAB A;  3D4R A;  1TY2 A;  2NN6 H;  4CJ2 C;  2PO4 A;  2EE1 A;  3V05 A;  4IFD I;  2RDG A;  1T5X D;  1EY6 A;  2QDB A;  2MUY A;  1D5Z C;  3MWY W;  4AYB B;  1HUM A;  5C4J B;  4L8J A;  4F8M A;  1HA6 A;  5JJZ A;  5DEH A;  1DXM A;  1KNE A;  3R8B A;  4DA2 A;  2K32 A;  1I4P A;  2IJ0 A;  1IL8 A;  4RAU C;  4FXK C;  4KKU A;  5CGK A;  1JOK A;  3DM1 A;  2B39 A;  1V8Q A;  2IT1 A;  5EGT A;  4CKB A;  3HEJ A;  2FFK B;  4B9W A;  2L11 A;  1S5B D;  1VMP A;  3MC0 B;  4BY1 B;  3DMU A;  2ENB A;  1Q1E A;  2K5W A;  3DWA A;  2A5H A;  4BA1 I;  1BQQ T;  1I4X A;  1PTO H;  2OF1 A;  1WD1 A;  2A68 C;  1LTI D;  2EOT A;  2EYO A;  1GUO A;  4ZKB B;  1B2T A;  3OMG A;  1Y1W B;  2NN6 G;  1IKL A;  1KTK A;  5CC4 A;  1Z6H A;  3GTL B;  3GO5 A;  2K05 A;  2MPM A;  1U4M A;  1LT4 D;  3LNN A;  2J0T D;  3FRP B;  1WCM B;  3RZO B;  4RCO A;  4IUQ A;  3I73 A;  1CQV A;  1OXS C;  2Q8I B;  3MAQ A;  2A6H C;  5K5P A;  4H44 C;  1GUN A;  2EYP A;  1BO0 A;  1UUP A;  1MSH A;  3I3C A;  3RD4 A;  1JWS D;  1SMY C;  4ZRZ A;  1QE6 A;  1EYD A;  1J9O A;  3R2T A;  1NR4 A;  3SK4 A;  1HTL D;  1LLR D;  1LAB A;  3KUP A;  1STA A;  2WKC A;  4XQQ A;  1QJO A;  1RTN A;  4XIG S;  5IIF A;  5I2X A;  1HFG A;  1PZI D;  3D6C A;  4L63 B;  1E2Z A;  3FEW X;  3KBX A;  1JWM D;  5I4D A;  4RFB A;  4F88 A;  2JP1 A;  4LJZ C;  4FF2 A;  4I7Z C;  2KJX A;  3TZD A;  2RDF A;  1DYQ A;  3D6W A;  2B2Y C;  4QCL A;  5FLX E;  3C46 A;  1PLF A;  2Z1C A;  1BNZ A;  3J81 L;  4DXG A;  2L9H A;  4HSV A;  1HRJ A;  4QUC A;  1CI3 M;  1BOS A;  2F0T A;  5FK9 C;  4OHJ A;  3NBH A;  3S16 B;  1U4L A;  1A3T A;  3A7A B;  3X3M A;  1VCI A;  1TWF B;  4KN7 C;  1SSO A;  2XIW A;  2SOB A;  3D4D A;  3QG1 A;  2NN6 I;  4ZUI A;  3OMC A;  1C8C A;  5ELE A;  1BXT A;  1PRT F;  4RGO S;  3QWN A;  3RUZ A;  1EQV A;  2Y0S B;  1EY4 A;  4C3I B;  5A35 A;  1LT3 D;  2X69 A;  4XQJ A;  3P20 A;  3DWP A;  4Q5V A;  1Q12 A;  5C3W A;  1B53 A;  1TY0 A;  1B44 D;  1ENC A;  1L0X B;  4C2M B;  1EFI D;  1SBB B;  2EYL A;  4ILW A;  2G9D A;  1OO9 B;  1KNA A;  2JA6 B;  3NWT A;  1CHP D;  1F2M A;  1QOH A;  2V4D A;  5I2Y A;  2B8G A;  3C3L A;  4IUT A;  4G7O C;  5BN3 A;  3J7Y W;  5IGE A;  4K2L A;  5JPN C;  2F4I A;  1STG A;  2PPB C;  1QCB D;  3R2I A;  1B3A A;  4PV1 C;  1CM9 A;  2IX0 A;  2B2W A;  1CQF A;  2E76 C;  5HUR A;  4S3S A;  1SYD A;  1NSN S;  4FF1 A;  2B2V A;  1A6X A;  1O78 A;  2Q8R E;  4RWS C;  1RDP D;  1DOK A;  1E0B A;  1QG7 A;  3SHL A;  2B2U A;  3CU7 A;  1HQR D;  4KD3 A;  2QIL A;  5E3F A;  2C9O A;  3NP8 A;  1O7Y A;  2K5D A;  3M4O B;  3S2D B;  2PYK A;  3SEB A;  1RKN A;  4KHZ A;  1AZP A;  1M8A A;  1L0Y B;  3E6Z X;  3OWE B;  2WII B;  4G4K A;  4FF4 A;  3JAM L;  1CFM A;  3KLS A;  3HOW B;  3MEH A;  4KHV A;  2HUG A;  1SFO B;  1NUC A;  5HGT A;  3UI2 A;  3BVM A;  1AEX A;  5IGC A;  1B50 A;  2PCF B;  1WTQ A;  3CRL C;  1Q8I A;  4H7B A;  4NDX A;  1QB5 D;  4DK1 A;  4WOR A;  2DNE A;  5EBC A;  2PZU A;  4QIW B;  2IX1 A;  3J80 L;  3GTM B;  2AUJ D;  4XDX A;  2E2H B;  2O4X A;  3QB3 A;  3CKI B;  4BWG B;  1FD7 D;  3VYT A;  3K58 A;  1SNQ A;  1CTM A;  2M2L A;  2MJ8 A;  4KD4 A;  2EZV A;  1MBY A;  5FO7 B;  4HN7 A;  3T13 A;  3SVM A;  2D9U A;  4KV6 A;  3HOV B;  1IKM A;  1EEF D;  4Z9C B;  4CKC A;  2F0Q A;  4KY5 A;  3VR4 A;  2AUK A;  2BCO A;  2BE5 C;  4RA8 A;  2JEA I;  3N6R A;  4ZYS A;  5E4W C;  1LTR D;  1C48 A;  4U68 A;  2JA8 B;  2B63 B;  2J7Z A;  1VF7 A;  4RGT A;  2QKI C;  2KEC A;  3GTP B;  3C2P A;  1TII D;  5CV8 A;  3A54 A;  3LWE A;  3GP7 A;  5KND A;  4TSS A;  3HOX B;  4K5W A;  4G57 A;  4A3J B;  1I4Q A;  1ZXT A;  3G6J B;  3OOC A;  4K8J A;  1PXU A;  2F0N A;  2MHV A;  1WTP A;  3OIP A;  2CW0 D;  2LS0 1;  1SJE D;  5NUC A;  5IGD A;  3I72 A;  4A3B B;  1EOT A;  2L12 A;  1TWH B;  1F2Z A;  2E75 C;  3KK7 A;  3EVQ A;  1IW7 C;  1DON A;  4UAI A;  2K04 A;  3NTK A;  5C3E B;  1G2T A;  1O7L A;  3A8J E;  3A56 A;  5BN5 A;  2LKV A;  3V96 A;  1DOM A;  3S15 B;  3FPU B;  4ZLT F;  5J22 A;  4U67 3;  2PMZ B;  3TDQ A;  5A2Q L;  3T4A C;  1JE4 A;  3BG3 A;  1QNK A;  1EZ6 A;  3PUV A;  3RMH A;  4C3J G;  5K36 H;  3PUZ A;  1VF5 C;  3H3V C;  1S5F D;  4G7H C;  1R4P B;  4KY6 A;  1WTX A;  4FNF A;  2B2Y A;  5C4X B;  2VNU D;  3IFD A;  4PNY A;  2XVS A;  2VUM B;  2NVX B;  3O13 A;  3TME A;  2RVL A;  4H13 C;  2J4X A;  1Z47 A;  2H4O A;  2IX3 A;  2KVM A;  1K83 B;  3VYR A;  3S9W A;  4F87 A;  4CGY B;  3WOF A;  2JEB I;  1G2S A;  1Y8N B;  4J1M A;  2BA0 A;  3S1R B;  5I6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...