1LT3D

Heat-labile enterotoxin double mutant n40c/g166c
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Crystal structure of heat-labile enterotoxin from Escherichia coli with increased thermostability introduced by an engineered disulfide bond in the A subunit.
pubmed rcsb
source organism Escherichia coli
total genus 28
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt3D00
1HTLD 5D3DA 1BCPF 2ICIA 1EEID 1BCPC 1D5MC 1UNSA 3BYTB 1S5CD 3CHBD 5ELDA 1ET6A 1HQRD 2XRSD 1KLUD 2Z8LA 3MFGA 4RGOS 1I4XA 3KLSX 5I4DA 1I4RA 2G9HD 1JR0D 1LO5D 4RGTA 1AW7A 1ENFA 3DWPA 4RHRA 1SJHD 5FKAC 4TSSA 1DJRD 3SEBA 1G8ZD 1KTKA 1BCPB 4ZYSA 1S5FD 5ELCA 1SE2A 1JCKB 1SE3A 2WV6D 5ELBA 1M4VA 5D3IB 1JWMD 1LTTD 1TS3A 1LTBD 1LT3D 1LTRD 1PRTD 3MC0B 2TSSA 5ELEA 2SEBD 1XXGA 2RDGA 5FK9C 4L6TB 4Z9CB 3R2IA 2NTSA 5ELFA 1T5XD 1CHQD 4RGMA 1EU3A 1QILA 3BYYB 1TS2A 4RH6A 4DXGA 1CK1A 1I4GA 1V1OA 1FNWA 1BXTA 1EEFD 3DWQA 1LTID 2IPKD 1PTOD 1ET9A 1SE4A 1RD9D 1I4QA 1D6EC 1ESFA 3V05A 5TSSA 3R8BA 3BVZA 1UUPA 1CQVA 1JWSD 1MD2D 1PZJD 2RDHA 3EFXD 3URYA 1LTAD 2IJ0A 2O2LD 1PTOF 1L0YB 2CHBD 4RHSA 3O13A 1PTOC 1LTGD 2AQ1B 1BCPD 1TY0A 1PZID 4BWGB 2AQ2B 1SXTA 1FNVA 4K6LA 1TY2A 1PZKD 1I4PA 3BVGA 1LLRD 2J4XA 2XN9C 4OHJA 1JWUD 2QILA 1DYQA 1F77A 3OWEB 2XRQD 1XTCD 1FD7D 1PRTF 1S5ED 4RCOA 1PRTC 1S5DD 2QEJC 1FNUA 1D5XC 1D5ZC 1STEA 1RCVD 4RFBA 1SJED 1RDPD 1PTOB 1LT4D 1LT5D 4L63B 2R61A 1S5BD 4UDUC 1B44D 1RF2D 1I4HA 1L0XB 1CHPD 2NTTA 4O1NA 1EU4A 1FGBD 1LTSD 3R2TA 3DWAA 1HA5A 1V1PB 1V1PA 1LT6D 1PTOH 3BVMA 3EA6A 3GP7A 4RGNA 1KLGD 4DXFA 1AN8A 1CT1D 1SBBB 1B1ZA 2AQ3B 3BZDB 4C56C 1PRTB 1GOZA 3W2DA 2XNAC 1TS5A 1JQYD 1EFID 1EWCA 1PYWD 1SEBD 3TSSA 1TS4A 1HXYD
chains in the Genus database with same CATH superfamily
2F0QA 1F9PA 2R7FA 3WDNA 2QKIC 1Z6HA 3BYTB 4JBMA 2A5HA 4AIMA 3SR1A 1VQIA 1EQTA 4JVZA 4IALA 3PUXA 1C7YA 4JI4L 3PF4A 2JYOA 2RCFA 1XTDA 2D0PA 4I65A 2QEXA 5EKLA 1RJTA 4IUUA 4DR3L 2B2YC 4IPCA 4HCEA 5E4WC 4Q5VA 1R9TH 4LFBL 1CQFA 4X3KA 2AUJD 2NZHA 2G5DA 1BCPB 4ODGA 4ZUJA 5IYDG 1B9NA 2EE1A 2FJ2A 1KIXA 2E8GA 2NVQB 2KVMA 3CKIB 5FLMH 2XSCA 4OO1H 3HFZB 2HQEA 2M9VA 4JW0A 1F2MA 2HDLA 4KD4A 1I94Q 4BA2I 1CI3M 5FK9C 4QL5A 2A74C 3NP8A 4JI0Q 2GN5A 4LWCA 2J0TD 3BYYB 5JPMC 2NYZD 1AEXA 3H94A 5C6AA 3OYYA 3NXWA 3A5ZB 2NZOA 3K80C 1F9QA 4C3HB 1PHJA 3V96A 4DR4Q 1SE4A 2A73B 3CCRA 2JA6H 2K5NA 4QUCA 5C4HA 4DV0Q 1FGUA 1X54A 1ESFA 2JA5G 3S1MH 2A68D 5JJZA 1CA6A 1Q12A 2UXBQ 4GKJQ 3TQYA 2EXDA 1AP0A 3BG3A 2AQ1B 4CGYB 1Z7TA 1Y1VH 3HOZG 4LF6Q 5JEAH 4L5TA 4Y7NH 3NQTA 1XNQQ 1I4PA 4B3MQ 2NB0A 1O7YA 3PIOA 3A7AB 3U9OA 1HNWQ 3OIQA 5G3LD 1E3PA 3I4OA 3GTJB 3A5UA 1JOQA 3PV0A 5CV5A 2VY3A 1S5BD 4LF7Q 4ZKCB 1FVIA 4HSPA 1A62A 1DXMA 3GTGH 4A3KB 1PFSA 2DNCA 1XYIA 1GOZA 5HURA 2KQ3A 1VQKA 3KJPA 3DM1A 1A63A 3RN5A 4GNXA 3ITPA 4K0KL 3H3VH 1AH9A 4JI4Q 2O5IC 2JA7B 1SYFA 3TZUA 4A3FH 3MHBA 4DR3Q 4M1UB 1TWCH 4LFBQ 4FXDA 3S14H 3AFPA 4JOIC 1K3BC 2BA0A 5M5WH 1U4LA 1EQQA 1SE2A 4KV6A 2HCCA 5C4XB 3PUVA 2K32A 1EUJA 1YNJD 1MIUA 3NBIA 3TP7A 1XXGA 3TREA 4R8IA 4KHPL 5ELFA 4HIMA 1N32L 1IL8A 1LTLA 2EYLA 4L5RC 3K81C 5HY6A 1HFGA 2JA8H 3AMUA 4MN3A 1CM9A 5IT9E 4FXGC 4OL7A 3S2DB 2JEBI 4CDFC 2F0DA 1BNZA 3D4WA 4CJ2C 4JBWA 4ME3A 5KNCA 3SE0A 1HZBA 1TY0A 4YWMA 1HNZL 4DNTB 2NBFA 4EQ5A 4BY1B 4JI3L 1SMYC 1LLRD 2J4XA 2F0MA 4HAEA 4C3JB 1O78A 3HEJA 3QWNA 3M7NA 3A55A 1IZ6A 4R9WA 1LACA 4V190 1X65A 2HQLA 1QVFA 4IUQA 1MBYA 3CPFA 4XT3B 1YI2A 1VQ7A 3DLLA 3T16A 1HNXL 1I6HB 3AQQA 4DR5Q 2K7VA 3EQLC 1CKNA 1V1PA 4EQOA 1AN8A 1A3UA 2R7ZB 4JI7L 4K0KQ 1PMRA 1OTCA 1Q3LA 3CAMA 3GDEA 4GN4B 3T53B 5JVH3 4DUYL 2D0OA 1MJCA 3ERSX 4DK6C 4POGA 3G6EA 2E2JH 4X62L 3TEHB 1EIYB 5EBDA 5GQOA 1BBXC 3N6RA 4A3JH 5FJ8G 1H9SB 4TRDA 3G4SA 3I4MG 1VQ5A 4HIDA 2DJFC 1TXYA 1U9RA 4L8JA 1LO5D 1TWAB 3BDLA 4RHRA 3RZDB 2A6ED 4TSSA 4QY7A 3SEBA 3GTQH 2Z1CA 5M5XH 4C1NI 1MHWC 1G291 5C0XJ 2IX3A 4A3DB 1S5FD 3LWEA 4IJLA 1N32Q 2LY7A 3E5SA 5GAHC 3HKZG 3MC0B 2QDBA 4DR7L 1CUKA 5LMUL 1ONLA 2RF4A 2ZXPA 4HJ8A 5KGUA 1IBML 5CV7A 3P7JA 1EY7A 4LUZA 4G4KA 1V1OA 3GTPH 4GZYC 2KOLA 2E2IB 1BXTA 2NZ1D 2LKVA 4NP5A 1I50B 2VQFL 5I2YA 5KIXA 3HOWB 4RWSC 2O4XA 4FVMA 1H9KA 2CCZA 1VQCA 1YEZA 2WINB 3NELA 2BA1A 1HNZQ 1S4ZA 2VS1A 4DAMA 5DM73 2JK8A 5M3FG 3WOFA 4RHSA 1NR2A 5IWAQ 2GVBA 3SK8A 2BH2A 1GUTA 4J15A 3MFYA 3TP8A 1B3QA 3M3YH 2IL8A 1GKHA 4K6LA 1GUNA 3BVGA 3I4NG 3T1YL 1KDBA 5IGGA 4KKSA 1CZGA 1A2UA 3M4OB 4BXXG 4ILWA 1HNXQ 1V1QA 1UE5A 3K7AH 3HOZH 2R61A 3GTMB 4JI8L 1TIID 1XMQL 2ZXRA 4H13C 3G6JB 5EJWA 2VW9A 3HOXB 4JI7Q 1FR3A 3DMUA 4DUYQ 3VYSA 2B63G 1X55A 2JP1A 1PTOH 3FPPA 3GP7A 3E9HA 2PQAB 1R4PB 3C2PA 4N9TA 1UWVA 4LF9L 4X62Q 3OMCA 1JB7A 4X66Q 1VQ8A 1A8VA 1X3QA 2AMCB 5M5YB 1SEBD 1XX8A 3DM3A 3ER0A 4I7ZC 3AFQA 2EVBA 5D65A 1U4MA 3PO3G 4A3GG 2MJ8A 2NVXH 2QW7A 2MUYA 4DR6L 4K8IA 1NMGA 4K8JA 4UY8C 5BN4A 2K01A 1F2LA 4YCWA 2F0PA 4DN4M 5IT9c 4O42A 1BO0A 3ONAB 3TS0A 2UXDL 1KRTA 2IHFA 1PLFA 3GTOH 3OMGA 2KCNA 2PO4A 2RA4A 5BN3A 1SSOA 1WI5A 4DV3L 1TT2A 1Q86C 4RMFA 5ELNA 5HGTA 1ASZA 2E2HH 5CR3A 4B9WA 1SYGA 4DAPA 5LMUQ 2VUMB 4OX9L 3ICEA 1F2ZA 2HIVA 3NSWA 4HJAA 4IN3A 4KJOA 1T5XD 5FLMG 2VQFQ 4JC0A 1WTOA 4OO1G 4UP8A 3ERQA 2I5MX 3A54A 4XYOA 3TBIB 4BBSB 4PMBA 4A3EB 1CKMA 1BOSA 1OXSC 4KY7A 2F0NA 4UHVA 1RHPA 1QUQB 2JA6G 2A6EC 5LMNL 2LXKA 4B3TQ 3T1YQ 1PZID 2IY5B 3SVMA 3T4AC 4GN3B 4DV4L 4QB4A 3I4LA 2MPMA 2B8FA 2NVTB 1SNPA 2E76C 4OHJA 2IHEA 1F77A 3TS2A 3QO2A 1S5ED 1Y1VG 4JI8Q 1S5DD 4IUNA 5JEAG 2ZTEA 4X3UA 4YCVA 1VQ4A 1RCVD 2KUMA 4BBRB 1H9RA 1PFMA 4IO9A 2RQXA 3C46A 4A3LH 4O1NA 2CW0D 5LMNW 3MTSA 1B8AA 3S1RB 4ZKBB 1I3QB 3CC7A 2VL6A 3MA2B 4LMQD 1E2VA 3ZYYX 2Q2IA 1JQYD 1VMPA 3A74A 4DR6Q 1D8LA 3TP6A 2X6GA 5CORA 1UNSA 1VS0A 3T51B 1S5CD 4UP7A 1WTQA 5C44G 2UXDQ 1H9SA 3X3MA 2FMMA 3K5OA 4GN5A 4LF5L 3JAME 1I4RA 1G2TA 2E2DC 4DV3Q 5E4XA 1JC7A 3PO2G 1QVGA 1WYDA 4A3FG 3BDCA 2VQEL 1B3AA 1TWFH 5AFWA 4OX9Q 1RL2A 1U4PA 3D3RA 5FJ8H 3FRPB 1IYJB 2PW7A 2F0LA 4A3BG 2F3VA 3CW2C 4IFDJ 2JA5B 1SROA 4GLVB 2F3WA 3AU7A 4CDCC 2KCCA 1YNNC 1RIPA 2H4OA 5JJIA 3W1GA 4EQNA 4XIGS 4RKLA 4JOIA 2F0IA 1KD1C 1A6XA 1ML0D 3FHWA 3I70A 4IPDA 2Y0SB 1JE5A 1YNXA 1ET9A 4A76A 2KHSA 3KUPA 3EIVA 5LMNQ 4GKKQ 2Z4HA 1O7LA 1PZJD 1FJGL 5J39A 1ILPA 4A93B 1L0YB 4DV4Q 2ZT9C 3GTJH 2JA8G 3E3XA 3RN2A 1DOMA 2K04A 4XXEA 4NXNQ 2WAQB 1EYCA 4LFCL 3CQZB 1PYBA 1Q90A 1HQMC 3MEFA 1UEAB 1YITA 4RCOA 5HGQA 5C4JB 2QEJC 2RHQB 4JBKA 4ZK9B 3ULJA 3Q0AA 4N8FA 4UDUC 1NE3A 1BQQT 1B44D 1X3GA 2VB3X 2VXWA 4DV0L 1CHPD 3LWUA 2JJQA 2B2TC 1G6PA 2BDNA 1FGBD 1K3RA 1STAA 4A3MB 3H0GB 1B4OA 4E6IA 3BVMA 4HMIA 4DXFA 2PQAA 1CA5A 3BZDB 2A1AA 1YBYA 4GKJL 3V2TA 3K58A 3NQIA 4HJ9A 2F52A 4BY7B 1GXDC 2EPBA 3CCLA 1LV9A 2EYMA 4LF5Q 3K7UC 4YWKA 2KEEA 2HUGA 3CHBD 4CKBA 1SN8A 2MO1A 2WP8J 1L2FA 4J8QA 2HT1A 4DF7A 4RGOS 5DLQE 4R4IA 2K5HA 1JR0D 2F0TA 4RGTA 4A3JG 3IFTA 1DJRD 2WB1G 2WFWA 1Y8PB 4A3GH 2KA7A 3UE0A 1G8ZD 4FF3A 3FKIB 4DFAA 1EIFA 3KF6B 2YTYA 1BKBA 4WFN3 1K8OA 1B2TA 2A69C 2CW0C 3H15A 1YJWA 5M3MB 1PFNA 4CKEA 3RR5A 2TSSA 4R4QA 1A3VA 2K52A 2D62A 2L11A 2CH4A 4KD3A 5T1GA 3S2DH 1SFOH 1EU3A 5KYLA 1JICA 1STBA 4LUVA 1DONA 2ICEC 1DCZA 2I0QA 3U9SA 1RD9D 1FJGQ 4DK0A 1C8CA 2OTJA 2JSOA 1C48A 3NPPA 3CP0A 1C0AA 1SMYD 4OO1I 1QUQA 3EVQA 2Q2TA 3D6WA 2DGYA 2O2LD 1PTOF 2QCPX 4X3SA 1ILQA 3RZOH 1JJCB 4LFCQ 1B7YB 2L15A 1SR3A 1HPCA 1X6OA 2K05A 4KK7A 4B9XA 4QGUA 4ALPA 1AE3A 4U673 3I91A 1PRTF 2F3IA 3OHXC 3JAMc 3J7A5 4IZ8A 4GS3A 3T1HL 2QA4A 4RA8A 3H91A 5AJ3L 4F87A 5K5PA 3DEOA 1PH7A 1I4HA 2KBNA 1WD0A 5DAUA 1BBWA 3TMEA 2R92B 1FL0A 5IGDA 3Q23A 1OXVA 2EJFC 4KJNA 3NK9A 3HOVB 2PW5A 2GVAA 3MXPA 1DOLA 2Y0SE 1R4QB 2F0FA 3VR4A 4C1NK 1LYLA 4FF2A 2EY5A 1PH9A 4YWLA 5IYCG 2ES2A 3S1QB 3SXHA 5C0XG 1O7ZA 4DK1A 2UUBQ 2UU9L 4YHHL 2YYZA 2L9HA 4MTNA 3WWVA 3VYTA 1ET6A 3HOUH 2WAQE 5I4DA 1YZ6A 4C3IH 5BR8L 1Y1WG 3HKZB 1ICFB 2B2UC 2SNSA 2O5JC 3RD4A 1CSPA 3K5NA 2ID0A 3JAMi 1EFWA 4DR5L 4Q0FA 1G6ZA 1T9HA 4KI0A 3H3VI 5C44H 5EPLA 1VQLA 2E2IH 4H0LC 1H9MA 1NSNS 1PH1A 2YU9B 1LTTD 3UDXA 1GUWA 3FDTA 5GAGC 4CKCA 1LT3D 2KENA 3PO2H 3RLOA 1KQSA 5IE8A 2UUCL 5M3FB 2MP1A 3W5OA 4K5WA 3HGBA 1LTID 1K8MA 1SMXA 3HOYB 1EZ6A 2F0GA 4A3BH 4K6DA 5IGCA 1Y8NB 4YY3L 2EYHA 3S1NH 1D6EC 4C2MB 3NTKA 4OWXB 1U0LA 2BDOA 3M85A 1GM5A 1T5EA 4UP9A 1D1IA 4IJHA 2QGQA 4A3IB 1AE2A 1MD2D 1NCVA 4IPHA 1YJNA 1NAPA 2NVYB 4P73A 3ND8A 3GTLH 1JE4A 2OQ0A 3M4OH 3OPOA 3VYUA 4CJ0B 1H95A 4BWGB 1WTHA 3QOLA 3NHHA 4PMWA 2VZAA 2B63B 3T1HQ 3H3VC 4ME5A 5AJ3Q 3F2UA 3GTKB 1PYSB 3MZ5A 3FMCA 1E1OA 2N78A 1FNUA 1STEA 4DAYB 1GUGA 1VQOA 2DY8A 4G7HC 2MQHA 1L1OC 1DGSA 2QF7A 2PI2E 3ULPA 1VQNA 1VQGA 3DWAA 3I8ZA 2BCOA 3OOCA 1LT6D 1TR5A 3CCVA 3KLRA 3TDQA 3LGJA 2PZWA 2R93H 1N33L 5C3EG 1XWEA 4A3LG 5IWAL 3HP3A 5FOBB 2F4VL 3JAML 4RCNA 2UU9Q 3NEMA 1EWCA 4YHHQ 1BUVT 2K5WA 1UEBA 2RKSA 4IQZA 5C4ZA 1SAPA 5BR8Q 4DV1Q 2N3SA 1JB3A 2UXCL 4NKLA 4J1MA 1SYDA 5KYIA 1NUCA 3MFGA 5FO7B 3DXJC 3C1EA 3DWPA 1PH3A 3OW7A 1LUZA 4X65L 5IIFA 2RCNA 4AYBB 5FO8B 1A3TA 2Q8IB 1GHJA 2CWAA 2WV6D 3KF6A 5ELBA 3S2HH 3A56A 5D3IB 3S17H 4X66L 2C5CA 1UE6A 2UUCQ 4BBSH 4A3EH 1PRTD 1STYA 2EOTA 4H7BA 1VQMA 5LL6S 2PI2A 2AKWB 4F88A 2JA6B 5KNBA 4IUPA 2ASBA 2G9DA 4YY3Q 1D7QA 2E75C 1EEFD 1E2WA 1EL0A 2FHTA 1EYAA 1HZ9A 1VQPA 1VQ9A 3E9IA 1DOKA 5IYBH 2NVTH 2IX0A 5I2XA 5IY0A 1JWSD 3MVVA 3SK5A 1Q7YC 1K83H 3MXNB 3W3AA 2NN6G 3K57A 1QE6A 3HKZE 1U4RA 1FYCA 3NWTA 5J3BA 1K0SA 1TWHB 1ENAA 1FNVA 1W3SA 2K5VA 3FEWX 1EOVA 2XN9C 2D5DA 1DD2A 3S1RH 4CBVA 1ZXTA 1EYDA 2N49A 1STNA 1WTVA 3GTGB 1LT4D 3C3LA 1EIHA 1XPRA 2IX1A 4GLXA 2KJXA 1HFNA 1N33Q 1IL2A 1SNOA 2F4VQ 3RNUA 1CFMA 1PH4A 2AQ3B 3KYHC 3L2PA 2EY6A 4A75A 1IYUA 1SRUA 3W2DA 4IUVA 3U4VA 1P8LA 1TS5A 4B3TL 1PVOA 1RTOA 2OXPA 2UXCQ 1L1OB 4A3FB 2BH8A 1HR0W 5EGTA 1E24A 2F0SA 3T13A 4B3RQ 1D5MC 2B2TA 5KRUA 2CKZB 2C9OA 1WCMB 4IOCA 4OGQC 1HQRD 4X65Q 5M5WB 2EY2A 3U58A 2WKCA 1VQAA 1PV4A 1AW7A 1ENFA 5CV8A 5IYCH 3J81j 5L37A 5C0XH 3PIP3 1VQHA 4UAIA 1KAWA 1YNND 2RHSB 4PNYA 4A4IA 1XPOA 2PPBC 1KXLA 1QNUA 1Q8KA 3TN2A 1PH6A 1JCKB 2F0HA 5EAYA 1UE7A 4JPBW 4ZCKA 1Y1WH 1X3EA 4ID6A 4X64L 2B2WC 4XT1B 4CHTB 4P74A 5ELEA 2TMPA 2K4KA 2D9UA 1RTNA 2NTSA 5LL6X 1AFPA 4RH6A 4FP5D 1TVXA 2PYKA 3GO5A 1GO3E 4DXGA 2JA8B 3S15B 3K0YA 4A93H 1E7ZA 1SDFA 2JQOA 3DWQA 5GROA 1B9MA 3F1ZA 1O7IA 5CYUA 3J81L 1MI2A 2Z6BA 5EQ0A 2HDMA 4JYAQ 2EXZA 2XWJB 3I56A 5TSSA 4HR7B 2M2LA 1LM0A 3Q22A 2IJ0A 4A3CG 4YCUA 1PTOC 4C3JG 5CV6A 1IW7C 4PQXA 2JA9A 2B2YA 2AQ2B 5CMDA 5EBCA 2EYJA 3F8TA 4AYBE 1QJOA 5E1FA 2EYFA 1PRTC 1CSQA 1X3PA 1V8QA 3VR3A 2KHJA 4DAYA 1RDPD 4PZ7A 1LT5D 2CQAA 3S16H 1G2SA 2F0KA 2RSNA 4BY7H 1BBUA 2X6LA 2D2CC 2R7ZG 4GKKL 3CC4A 4B08A 3CC2A 1HA5A 1TWGH 4EVOA 2KECA 2E2JB 1KLGD 2OTLA 1CT1D 2LS01 1K8GA 1GUSA 4NXNL 4A3JB 4DV7L 1EEID 1KHIA 1AZPA 2Z6KC 5KNDA 3CCEA 1S72A 1BF4A 3GTQB 5C3EH 4P71A 5M5XB 2IT1A 2RSOA 2Z8LA 3VR5A 2A69D 3HZXA 1SE8A 1DM0B 3KLSX 3KLWA 3PUWA 3E0EA 4WJ4A 1OXTA 5A35A 4JI2L 4RKBA 4B3SL 1ZYRC 2EY1A 5K36G 2RBMA 2DY7A 3HOUG 4N9PA 2VB2X 1X9NA 3D31A 2KEDA 4C3IG 5M9OA 1KDCA 1YHBA 2Z4IA 4OELB 1YJ9A 4X64Q 5IP7G 1TQOA 2J7ZA 4KY5A 1Q1EA 3Q6SA 1LTBD 4AQYL 5ELOA 2SNMA 1EZ8A 3GTPB 4ULLA 2B2UA 3R2IA 1WTWA 2CQOA 1KAAA 5E3FA 2NVQH 4JV5L 2E5LL 3MAQA 3HOWG 2DNEA 3G48A 1UAPA 3GD7A 1SNQA 2K33A 1LABA 3PSIA 5DNFA 3MWYW 1E2ZA 3UDGA 3NBHB 3NWSA 2XWBB 3CCMA 3BVZA 1UUPA 1A15A 3J7AF 3UE1A 3NUCA 2Q8TA 3M3YB 2BOSA 4C3HH 4R1JA 2NUCA 3MXNA 4DAVA 4JCVE 2ZM6L 3BJUA 1J8IA 4CJ1B 1VQBA 1XNRL 1H9JA 4FYDA 3A8IE 1JWUD 2QILA 3K7AB 4KTAA 3HOZB 3OWEB 4FNFA 5JJKA 2XRQD 1MGSA 4BS9A 5GADC 1Y8OB 1EIGA 3PGZA 2NN6I 3KOJA 1K8AC 1D5XC 3KFUA 2NN6H 5IODA 1PTOB 3J80E 4KKTA 1IBLL 1QG7A 1WFQA 2NTTA 1NNXA 4RAUC 3SDZA 5G3LF 2EQSA 5CV9A 1HZAA 2ATWA 3I55A 3I3CA 2YV5A 3K6OA 4IURA 4ZAIA 1F9SA 4DV7Q 1PRTB 4G7ZC 2NVXB 2K6AA 5LHY1 4ZLTF 4FXKC 2L5TA 1EQVA 4A3KH 2OWOA 1L1OA 3L9AX 5D3DA 2ICIA 2R93G 1X56A 2H5XA 3SHLA 1JOKA 1J6QA 4XTCS 4JI2Q 4APVA 4B3SQ 3GTOB 2JN4A 2PQEA 1V43A 3D4DA 4IOAA 1KLUD 2YU9H 1EY0A 1OXUA 2I5LX 1HA6A 5CV4A 1U5KA 4XQNA 2BE5D 1K28A 2JA7H 1DZ1A 1IKLA 2M00A 2VUMG 4AQYQ 5ELCA 4DKAC 4IFDH 4QF4A 3PMFA 4WRDA 4KKUA 3QIAA 1N36L 5IP9H 4JV5Q 4JBJA 2E5LQ 4C2MH 4L6TB 2K28A 4ZRZA 2UUBL 1EY8A 4LNQA 5C4XH 1VCIA 3DHQA 4A3IH 3H09A 2MGSA 4BBSG 2NVYH 4A3EG 2B2VC 3SK4A 2B29A 1I4GA 4EGVA 4KHZA 4MHEA 4NXMQ 3Q24A 3CRKC 1QVCA 2ZM6Q 2F1MA 4LJZC 3KBXA 2R7DA 1HZCA 2PCFB 1NR4A 1YIJA 3GTKH 2R6GA 2CHBD 3MXGA 5KEEA 1XNRQ 1OO9B 5IYBG 4L5QA 3PUYA 3STBD 5C5LA 1PZKD 1IBKQ 4L5SA 2P5ZX 3EBEA 1O80A 2WACA 5JEAJ 1EWIA 1IHZA 4FO2A 3CF5A 1IBLQ 4A3CH 5I6YA 3WOEA 2DJGC 2K50A 1NBWA 4POFA 1I6VC 4BY1H 3HG9A 1HUNA 4HCSA 4C3JH 3IKJA 3D0FA 3FVQA 3OIPA 1WD1A 4OXPA 1L0XB 2RVLA 5FLXL 1EY6A 4S3SA 4KN7C 1WJJA 3CPWA 3RUZA 1X32A 2PZTA 3J81E 1S3OA 1W6JA 4HJ7A 1GUOA 1MSHA 2Z9HA 3F2CA 1I6HH 2F03A 2MHVA 1SYEA 3VDYA 3M9BA 2R7ZH 4RG1A 1NY4A 4DR1L 1C4QA 5JJLA 4G57A 2C35B 3KBGA 4H02A 5T1IA 1N34L 4LW1A 5F2DA 4HMJA 1JJ2A 1TWFB 2RDFA 1CKOA 1I4XA 2R3ZA 1Q82C 1SJHD 3I4MB 3J7AV 1X3FA 1W2BA 4KY6A 1PXUA 1Q81C 1N36Q 4ZYSA 1AZQA 4JI6L 1TWAH 1N8RC 1JMCA 1SE3A 1M4VA 2ALYB 2CFMA 3RZDH 1ASYA 1MSGA 1BR9A 1NJIC 1EY4A 4LFAL 3E0JA 4A3DH 4PMCA 5K36H 3VYRA 2KHIA 2SOBA 4Z9CB 3R3OA 1F9RA 2Y0SG 3OW2A 3M7GA 1SNMA 1VMCA 1VQEA 4DV1L 2B39A 4QCLA 5E7NA 3J80c 1KC8C 3L3OC 1FNWA 4MIUA 5IP7H 4BA1I 1TU2B 1WVLA 1TWHH 3NBHA 1M1KC 4K5VA 4A93G 2B2WA 2K75A 4WORA 3L0OA 5J1ZA 1RODA 2WAQG 4DV6L 1I50H 2BE5C 5CBEE 2I46A 4IUTA 3HOWH 4ABNA 4JI1L 3QG1A 2JE6I 3HS0C 1KNEA 2AWNA 1A0IA 2HD3A 3NENA 4P2CB 1HCZA 4DUZQ 4LAAA 1TY2A 2YTVA 1Q8IA 1NTGA 2NWGA 1ICWA 3I90A 3IAYA 1N9WA 1FD7D 1J5EL 3D4RA 2N8NA 3SGIA 1QZHA 3I4NB 2EIFA 4FF1A 2OCEA 1YVCA 1QOHA 4A3MG 1JOOA 3H0GG 5IOCA 1RF2D 5EPKA 3CMEA 3KF8B 5CBAE 4DV5L 3J80i 3A7LA 3K8AA 2XVSA 2A6HC 3EA6A 1WCMH 1SLJA 4DU9A 3GTMH 2XTIA 4BY7G 3EROA 4HN7A 2KCMA 3CCQA 3HOXH 1BDOA 1IKMA 3PIPA 4F7XA 1KNAA 2F0OA 4DR1Q 1XPUA 2F0EA 1BCPF 1N34Q 4M8AA 2WKDA 1STHA 3ZJYC 4TKOB 1B50A 3CRLC 1VQFA 3BDOA 3STBC 3I72A 1CZWA 3PO3B 5M5YH 4GOPC 1I5FA 3GV3A 4A3GB 2F0VA 2XRSD 1QNKA 4R8NA 3W1BA 4V0BA 2G9HD 3VA7A 3P75A 3FKIG 1E22A 4JI6Q 1HRJA 2F0JA 3CU7A 4P75A 3K5MA 2EZVA 2Z6KA 4HTHA 5M3MG 4LUOA 3S15H 4LFAQ 4KN4C 1JWMD 1SFOB 2A8VA 4MNOA 4YIJA 3U4ZA 3E6ZX 1D1KA 1LTRD 3OWFA 4NDXA 3M4PA 2OEOA 2LFNA 4OIJA 1R9TB 4B3RL 2MO0A 2HHHL 2VUMH 3KJOA 1TS2A 4K5XA 4QIWB 4F8MA 2OT2A 4ZUIA 4DNIA 5A2QE 2KCTA 1PTOD 3FP9A 4N8X1 1IW7D 2FINB 3QB3A 4DV6Q 3RZOB 1I4QA 5GAEC 2LSSA 4JI1Q 4DA2A 3J81c 1CQVA 1II3A 3RMHA 1EY5A 5EKIA 4OWWB 4DGZA 5IGFA 3RLFA 2L12A 4HIOA 3F2DA 1Z47A 2DN8A 5I9PA 3J80L 1J9OA 3CCUA 1J5EQ 1XMOL 4WJ3M 1SXTA 4UPAA 4C3HG 4X3TA 2A68C 3S1MB 3LNNA 3KK7A 4NW2A 5J22A 4KLKA 4R4CA 3H6MA 2V4DA 3X3NA 4QJFA 1Q46A 1IXRA 2K5QA 3KDFB 1Z9FA 5COYA 3R93A 4DV5Q 1P16A 1WTRA 2R92G 1Y1VB 1HHVA 4Y7NB 1Q1BA 1M90C 5I9OA 3HOVG 4JYAL 4QQBX 3I73A 1MKHA 4JI5L 4PZ6A 4BBRH 1C9OA 1HUMA 3PIO3 4C56C 1L0WA 3U50C 3QJYA 1PYWD 3J81i 1HR0L 4Y52H 1HXYD 1I3QH 4OONA 3HOUB 4KHPQ 1PFBA 1ZYRD 4C3IB 4JG2A 3CCJA 3D6CA 3BZKA 4A3KG 3AEVA 5IYDH 5C44B 4DPGA 4LF8L 5DEHA 3S9WA 1SYBA 1V9PA 1F2YA 5D14A 1PDQA 3OTOL 3PO2B 3UDFA 2LMCB 2N88A 4GOPB 5JAVA 2DUDA 5FLXE 2JA7G 1TWCB 2CWPA 1STGA 3G7LA 4GLAC 2HHHQ 4JI3Q 1QCBD 2SDFA 2SEBD 1TKWB 3S14B 4IFDG 1PH5A 4A3BB 2HIXA 1EYGA 2ZJQA 3S1NB 3HOYG 1QILA 3QOJA 4NMZA 1EY9A 5IP9G 5C0XI 2UUAL 2JA5H 1CK1A 2FMCA 2CH4W 3F2BA 2IPKD 1YNJC 5C4XG 3GTLB 4A3IG 1MJEA 3EN2A 5EPJA 4XDXA 2RDHA 1LTAD 1XMOQ 1IYVA 3FPUB 4X6AH 4QUFA 3TRZA 2B2VA 3O13A 1BCPD 3VA5A 5JVG3 1PA6A 3P20A 2LXJA 1PH2A 4NB3A 1GD7A 1SNCA 1PH8A 2B3GA 4DR2L 4LF4L 4WJWA 1M8AA 2PMZB 4DV2L 5CC4A 1D5ZC 4CDEC 4DK3C 1SJED 3CQZH 3I7FA 3PUZA 4JI5Q 4GNXC 1B53A 2R93B 4IPGA 4HSVA 3N52A 3KF8A 1EOTA 5C4JH 1EU4A 1LTSD 2L55A 1EQRA 3M4QA 3R2TA 4BY1G 5C3XA 2OF1A 2AUKA 4RGNA 1VQ6A 1HTPA 1HR0Q 4QIWE 1NMFA 3KLSA 1GVPA 3EJIA 4NPSA 3CXCA 1K9MC 3I2ZA 2A19A 4KMUC 4A3MH 3H0GH 3MXUA 4DR7Q 1HTLD 2ZXOA 5CGKA 3PQIA 5ISRA 2PNRC 1IBMQ 2CVRA 2X69A 4LF8Q 4TQUS 2V1CC 3UDIA 3J7YW 1G51A 1SYCA 1JT8A 1S40A 4QMGA 1E0BA 2F0WA 1ESRA 4AYBG 3RLNA 3OTOQ 5FKAC 3CD6A 3S2HB 2ZJPA 3ND9A 3S17B 1RKNA 4PG3A 3JC66 1KTKA 2EJMA 1KRSA 3A8KE 2WB1B 3D8GA 4JK1C 5FO9B 1VQDA 1TS3A 3VR6A 3BZCA 1EWHA 3FKIH 1A2TA 2H1EA 3CCSA 2UUAQ 3PF5A 4FDBA 2MFIA 4RGMA 1QB5D 1ZKOA 5M3MH 3AB9A 4I7AA 4A3DG 1K83B 3DUZA 3T56B 4KHVA 3M4YA 1XMQQ 5C5MA 1WTXA 4J6HA 3OSOA 2K14A 2EDGA 3R8BA 4U68A 3AYHB 3URYA 4LK1C 2F4IA 2Q2HA 4LF9Q 4HJ5A 2ZJRA 1KDAA 3K5LA 1E1TA 4DR2Q 3IFDA 2PZUA 4O0AA 4LF4Q 3ULLA 4DV2Q 2EYOA 2XGTA 3J7ZC 4R4OA 1DYQA 3PCOB 5JOBA 1XTCD 3DEPA 2ZTCA 3KDFA 5BN5A 4MZ9A 2E74C 3CMAA 1D2BA 4RFBA 2JEAI 3LX0A 1K0RA 4NXML 4FF4A 3P1HA 3NTIA 4HEDA 1QWYA 5FLXc 1SBBB 1B1ZA 3TP5A 1KL9A 2L4NA 2R92H 2HCIA 1EFID 4K14A 1GHKA 1TS4A 4GNXB 1XJVA 2FFKB 1WCMG 3I4MH 3HOVH 1IBKL 5JPNC 2GA4B 3B6YA 1BCPC 3HOXG 3HKSA 3C1FA 4OIKA 5ELDA 2Q8RE 3S1QH 5IT9L 2QDLA 1VF5C 1QZGA 4OEMB 1WOCA 2B8GA 1Y69U 1GJXA 5IGBA 4XQQA 3GV6A 1Y1WB 2N55A 3S24A 2PMZE 1YHQA 2EYPA 4O2DA 5A2QL 3BS1A 3BU2A 2AWOA 4GOPA 2F0UA 2Z0SA 5NUCA 1BVSA 4K2KA 1UE1A 3IL8A 2L1BA 2RDGA 1B70B 3NE5B 1HJPA 1CHQD 2YTXA 2WIIB 3MEHA 1I94L 2E2HB 2XIWA 5IGEA 1SNDA 4JI0L 1CTMA 4DNRB 3K59A 2I5HA 2PNHA 4G7OC 3L7ZC 5EKKA 4OWTB 5M3FH 4EQPA 2L0CA 4IFDI 1VQJA 3V05A 1VF7A 2K03A 4XYQA 4ZQ3A 1YHAA 3TZDA 3QR8A 5DM63 2IW3A 4DR4L 4HIKA 3EFXD 3HOYH 1K73C 1HH2P 2K1BA 1ZEQX 2FXQA 4K2LA 1Y14B 3I4NH 3VR2A 1LTGD 5I6WA 3Q8DA 4R4TA 1KABA 3A0JA 2UXBL 4BXXH 4P72A 4CDDC 5C3WA 2AHOB 4H44C 3UI2A 3S16B 4PZ8A 4AH6A 4LF6L 4MTKA 1OXXK 3HRZC 1XNQL 2A6HD 2WB1E 3GQBA 2EJGC 3A8JE 4B3ML 2ENBA 2Q2UA 1WTPA 1HNWL 1TWGB 2I07B 1ENCA 2ZTDA 2B63H 2IWHA 4L63B 2JXMB 1VDZA 3NTHA 4TVAB 4EX5A 4XQJA 3G71A 3IRBA 2MNAA 4PV1C 1W6KA 5H1SE 2VQEQ 1CKNB 1V1PB 3K0XA 2VNUD 1G91A 4LF7L 3PO3H 1JJGA 2K5DA 2OQKA 2XNAC 3SK6A 1JORA 4BBRG 3TSSA 4DUZL 5C3EB
chains in the Genus database with same CATH topology
2F0QA 1F9PA 3WDNA 2QKIC 1Z6HA 3BYTB 2A5HA 3SR1A 1EQTA 4IALA 3PUXA 2JYOA 4I65A 5EKLA 1RJTA 4IUUA 2B2YC 4HCEA 5E4WC 4Q5VA 1CQFA 4X3KA 2AUJD 1BCPB 4ODGA 4ZUJA 1B9NA 2EE1A 2FJ2A 2NVQB 2KVMA 3CKIB 2XSCA 4OO1H 2HQEA 2M9VA 1F2MA 2HDLA 4KD4A 4BA2I 1CI3M 5FK9C 2A74C 3NP8A 2J0TD 3BYYB 5JPMC 2NYZD 1AEXA 3H94A 5C6AA 3NXWA 1F9QA 4C3HB 3V96A 1SE4A 2A73B 4QUCA 5C4HA 1ESFA 2A68D 5JJZA 1CA6A 1Q12A 1AP0A 3BG3A 2AQ1B 4CGYB 1Z7TA 5JEAH 3NQTA 1I4PA 2NB0A 1O7YA 3A7AB 3U9OA 3OIQA 5G3LD 3GTJB 1JOQA 3PV0A 5CV5A 1S5BD 4ZKCB 4HSPA 1DXMA 4A3KB 2DNCA 1XYIA 1GOZA 5HURA 2KQ3A 3DM1A 3ITPA 2O5IC 2JA7B 1SYFA 3TZUA 3MHBA 4M1UB 4FXDA 2BA0A 1U4LA 1SE2A 4KV6A 2HCCA 5C4XB 3PUVA 2K32A 1YNJD 3NBIA 3TP7A 1XXGA 4R8IA 5ELFA 1IL8A 2EYLA 1HFGA 3AMUA 4MN3A 1CM9A 5IT9E 4FXGC 4OL7A 3S2DB 2JEBI 1BNZA 2F0DA 3D4WA 4CJ2C 4JBWA 5KNCA 3SE0A 1TY0A 4DNTB 2NBFA 4BY1B 1SMYC 1LLRD 2J4XA 2F0MA 4HAEA 4C3JB 1O78A 3HEJA 3QWNA 3M7NA 3A55A 4R9WA 1LACA 4V190 4IUQA 1MBYA 4XT3B 3T16A 1I6HB 2K7VA 3EQLC 1V1PA 4EQOA 1AN8A 1A3UA 2R7ZB 1PMRA 1Q3LA 3T53B 5JVH3 5EBDA 1BBXC 3N6RA 1H9SB 4TRDA 1U9RA 4L8JA 1LO5D 1TWAB 3BDLA 4RHRA 3RZDB 2A6ED 4TSSA 3SEBA 2Z1CA 4C1NI 1G291 5C0XJ 2IX3A 4A3DB 1S5FD 3LWEA 2LY7A 3E5SA 3MC0B 2QDBA 1ONLA 2ZXPA 5KGUA 5CV7A 3P7JA 1EY7A 4G4KA 1V1OA 4GZYC 2E2IB 2KOLA 1BXTA 2NZ1D 2LKVA 4NP5A 1I50B 5I2YA 5KIXA 3HOWB 4RWSC 2O4XA 4FVMA 1H9KA 2WINB 2BA1A 1S4ZA 5DM73 3WOFA 4RHSA 1NR2A 3SK8A 1GUTA 3MFYA 3TP8A 2IL8A 4K6LA 1GUNA 3BVGA 1KDBA 5IGGA 4KKSA 1CZGA 1A2UA 3M4OB 4ILWA 2R61A 3GTMB 1TIID 2ZXRA 4H13C 3G6JB 5EJWA 3HOXB 1FR3A 3DMUA 3VYSA 2JP1A 1PTOH 3FPPA 3GP7A 1R4PB 3C2PA 4N9TA 3OMCA 1X3QA 5M5YB 1SEBD 1XX8A 4I7ZC 2EVBA 5D65A 1U4MA 2MJ8A 2MUYA 4K8IA 4K8JA 5BN4A 2K01A 1F2LA 2F0PA 4DN4M 4O42A 1BO0A 3ONAB 1PLFA 3OMGA 2KCNA 2PO4A 2RA4A 5BN3A 1SSOA 1TT2A 5HGTA 5CR3A 4B9WA 1SYGA 4DAPA 2VUMB 1F2ZA 3NSWA 4IN3A 4KJOA 1T5XD 1WTOA 4OO1G 3ERQA 3A54A 4XYOA 3TBIB 4BBSB 4PMBA 4A3EB 1BOSA 1OXSC 4KY7A 2F0NA 1RHPA 2A6EC 1PZID 3SVMA 3T4AC 4QB4A 3I4LA 2MPMA 2B8FA 2NVTB 1SNPA 2E76C 4OHJA 1F77A 3QO2A 1S5ED 1S5DD 4IUNA 5JEAG 4X3UA 1RCVD 2KUMA 4BBRB 1H9RA 1PFMA 2RQXA 3C46A 4O1NA 2CW0D 3MTSA 3S1RB 4ZKBB 1I3QB 3MA2B 4LMQD 1E2VA 3ZYYX 1JQYD 1VMPA 3TP6A 2X6GA 5CORA 1UNSA 3T51B 1S5CD 1WTQA 1H9SA 3X3MA 2FMMA 3K5OA 3JAME 1I4RA 1G2TA 2E2DC 5E4XA 1JC7A 3BDCA 1B3AA 5AFWA 1U4PA 3D3RA 3FRPB 2PW7A 2F0LA 2F3VA 4IFDJ 2JA5B 2F3WA 3AU7A 2KCCA 1YNNC 2H4OA 4EQNA 4XIGS 4RKLA 2F0IA 1A6XA 1ML0D 3I70A 2Y0SB 1ET9A 2KHSA 3KUPA 2Z4HA 1O7LA 1PZJD 5J39A 1ILPA 4A93B 1L0YB 2ZT9C 1DOMA 2K04A 4XXEA 2WAQB 1EYCA 3CQZB 1Q90A 1HQMC 1UEAB 4RCOA 5C4JB 2QEJC 4ZK9B 3Q0AA 4UDUC 1BQQT 1B44D 2VB3X 2VXWA 1CHPD 3LWUA 2B2TC 2BDNA 1FGBD 1STAA 4A3MB 3H0GB 1B4OA 4E6IA 3BVMA 4HMIA 4DXFA 1CA5A 3BZDB 3V2TA 3K58A 3NQIA 4BY7B 1GXDC 2EPBA 1LV9A 2EYMA 2KEEA 2HUGA 3CHBD 4CKBA 2WP8J 4J8QA 4DF7A 4RGOS 1JR0D 2F0TA 4RGTA 3IFTA 1DJRD 1Y8PB 2KA7A 4FF3A 1G8ZD 3FKIB 4DFAA 4WFN3 1K8OA 1B2TA 2A69C 2CW0C 5M3MB 1PFNA 4CKEA 2TSSA 1A3VA 5T1GA 2D62A 2L11A 4KD3A 1EU3A 5KYLA 1JICA 1STBA 1DONA 2ICEC 1DCZA 3U9SA 1RD9D 4DK0A 1C8CA 2JSOA 1C48A 3NPPA 1SMYD 4OO1I 3EVQA 3D6WA 2O2LD 2QCPX 1PTOF 4X3SA 1ILQA 1HPCA 2K05A 4KK7A 4B9XA 4U673 3I91A 1PRTF 3OHXC 4IZ8A 4RA8A 3H91A 4F87A 5K5PA 3DEOA 1I4HA 1WD0A 5DAUA 3TMEA 2R92B 5IGDA 3Q23A 1OXVA 2EJFC 4KJNA 3NK9A 3HOVB 2PW5A 3MXPA 1DOLA 1R4QB 2F0FA 3VR4A 4C1NK 4FF2A 2EY5A 3S1QB 3SXHA 5C0XG 1O7ZA 4DK1A 2YYZA 2L9HA 3VYTA 1ET6A 5I4DA 3HKZB 2B2UC 2SNSA 2O5JC 3RD4A 3K5NA 2ID0A 4Q0FA 1G6ZA 4KI0A 5EPLA 4H0LC 1H9MA 1NSNS 2YU9B 1LTTD 1GUWA 3FDTA 4CKCA 1LT3D 5M3FB 2MP1A 4K5WA 3HGBA 1LTID 1K8MA 3HOYB 1EZ6A 2F0GA 4K6DA 5IGCA 1Y8NB 2EYHA 1D6EC 4C2MB 3NTKA 2BDOA 3M85A 1T5EA 1D1IA 4A3IB 1MD2D 1NCVA 1NAPA 2NVYB 3ND8A 1JE4A 3OPOA 3VYUA 4CJ0B 4BWGB 3QOLA 3NHHA 4PMWA 2B63B 3H3VC 4ME5A 3F2UA 3GTKB 3MZ5A 3FMCA 1FNUA 1STEA 1GUGA 2DY8A 4G7HC 2QF7A 3DWAA 3I8ZA 2BCOA 3OOCA 1LT6D 1TR5A 3KLRA 3TDQA 2PZWA 1XWEA 3HP3A 5FOBB 3JAML 4RCNA 1EWCA 1BUVT 2K5WA 2RKSA 4IQZA 5C4ZA 1SAPA 1JB3A 4NKLA 4J1MA 1SYDA 5KYIA 1NUCA 3MFGA 5FO7B 3DXJC 3C1EA 3DWPA 3OW7A 5IIFA 4AYBB 5FO8B 1A3TA 2Q8IB 1GHJA 2WV6D 5ELBA 3A56A 5D3IB 2C5CA 1PRTD 1STYA 2EOTA 4H7BA 5LL6S 4F88A 2JA6B 5KNBA 4IUPA 2G9DA 2E75C 1EEFD 1E2WA 1EL0A 2FHTA 1EYAA 1DOKA 2IX0A 5I2XA 1JWSD 3MVVA 3SK5A 3W3AA 2NN6G 3K57A 1QE6A 1U4RA 1FYCA 3NWTA 1TWHB 1ENAA 1FNVA 3FEWX 2XN9C 2D5DA 1DD2A 4CBVA 1ZXTA 1EYDA 1STNA 1WTVA 3GTGB 1LT4D 3C3LA 1EIHA 2IX1A 2KJXA 1HFNA 1SNOA 1CFMA 2AQ3B 2EY6A 1IYUA 3W2DA 4IUVA 1TS5A 1RTOA 2OXPA 4A3FB 5EGTA 2F0SA 3T13A 1D5MC 2B2TA 5KRUA 2C9OA 1WCMB 4OGQC 1HQRD 5M5WB 2EY2A 2WKCA 1AW7A 1ENFA 5CV8A 5C0XH 3PIP3 4UAIA 1YNND 4PNYA 2PPBC 1QNUA 3TN2A 1JCKB 2F0HA 4ID6A 2B2WC 4XT1B 4CHTB 5ELEA 2TMPA 2D9UA 1RTNA 2NTSA 5LL6X 1AFPA 4RH6A 4FP5D 1TVXA 2PYKA 3GO5A 4DXGA 2JA8B 3S15B 3K0YA 1SDFA 3DWQA 1B9MA 5CYUA 3J81L 1MI2A 5EQ0A 2HDMA 2EXZA 2XWJB 5TSSA 4HR7B 2M2LA 3Q22A 2IJ0A 1PTOC 4C3JG 5CV6A 1IW7C 4PQXA 2B2YA 2AQ2B 5CMDA 5EBCA 2EYJA 1QJOA 5E1FA 2EYFA 1PRTC 1X3PA 1V8QA 3VR3A 4DAYA 1RDPD 1LT5D 2CQAA 1G2SA 2F0KA 2RSNA 2X6LA 2D2CC 4B08A 1HA5A 4EVOA 2KECA 2E2JB 1KLGD 1CT1D 2LS01 1GUSA 4A3JB 1EEID 1AZPA 5KNDA 1BF4A 3GTQB 5M5XB 2IT1A 2RSOA 2Z8LA 3VR5A 2A69D 3HZXA 3KLSX 1DM0B 3PUWA 1OXTA 5A35A 4RKBA 1ZYRC 2EY1A 5K36G 2RBMA 2DY7A 4N9PA 2VB2X 3D31A 2KEDA 4C3IG 5M9OA 1KDCA 2Z4IA 1TQOA 2J7ZA 4KY5A 1Q1EA 3Q6SA 1LTBD 2SNMA 1EZ8A 3GTPB 4ULLA 2B2UA 3R2IA 1WTWA 1KAAA 5E3FA 3MAQA 2DNEA 1UAPA 3GD7A 1SNQA 2K33A 1LABA 5DNFA 3MWYW 1E2ZA 3NWSA 2XWBB 3BVZA 1UUPA 1A15A 3J7AF 3NUCA 2Q8TA 3M3YB 2BOSA 2NUCA 3MXNA 4DAVA 1J8IA 4CJ1B 1H9JA 4FYDA 3A8IE 1JWUD 2QILA 3K7AB 4KTAA 3HOZB 3OWEB 4FNFA 2XRQD 1MGSA 4BS9A 1Y8OB 1EIGA 2NN6I 1D5XC 2NN6H 5IODA 1PTOB 3J80E 4KKTA 1QG7A 2NTTA 4RAUC 3SDZA 5G3LF 5CV9A 3I3CA 3K6OA 4IURA 4ZAIA 1F9SA 1PRTB 4G7ZC 2NVXB 2K6AA 5LHY1 4ZLTF 4FXKC 2L5TA 1EQVA 3L9AX 5D3DA 2ICIA 3SHLA 1JOKA 4XTCS 3GTOB 2PQEA 1V43A 3D4DA 1KLUD 1EY0A 1OXUA 1HA6A 5CV4A 4XQNA 2BE5D 1DZ1A 1IKLA 2M00A 5ELCA 4IFDH 4QF4A 3PMFA 4WRDA 4KKUA 3QIAA 4L6TB 2K28A 4ZRZA 1EY8A 1VCIA 3DHQA 3H09A 2MGSA 2B2VC 3SK4A 1I4GA 4EGVA 4KHZA 4MHEA 3Q24A 3CRKC 2F1MA 4LJZC 3KBXA 2PCFB 1NR4A 2R6GA 2CHBD 3MXGA 5KEEA 1OO9B 3PUYA 5C5LA 1PZKD 1O80A 2WACA 5JEAJ 1IHZA 4FO2A 5I6YA 3WOEA 1I6VC 3HG9A 1HUNA 4HCSA 3IKJA 3FVQA 3OIPA 1WD1A 1L0XB 2RVLA 5FLXL 1EY6A 4S3SA 4KN7C 3RUZA 1X32A 2PZTA 3J81E 1W6JA 1GUOA 1MSHA 2F03A 2MHVA 1SYEA 1C4QA 4G57A 3KBGA 5T1IA 5F2DA 4HMJA 1TWFB 2RDFA 1I4XA 2R3ZA 1SJHD 3I4MB 3J7AV 4KY6A 1PXUA 4ZYSA 1AZQA 1SE3A 1M4VA 1MSGA 1BR9A 1EY4A 3E0JA 4PMCA 5K36H 3VYRA 2SOBA 4Z9CB 3R3OA 1F9RA 3M7GA 1SNMA 1VMCA 2B39A 4QCLA 3L3OC 1FNWA 4MIUA 4BA1I 1TU2B 1WVLA 3NBHA 4K5VA 2B2WA 4WORA 5J1ZA 1RODA 2BE5C 5CBEE 2I46A 4IUTA 4ABNA 3QG1A 2JE6I 3HS0C 1KNEA 2AWNA 4P2CB 1HCZA 4LAAA 1TY2A 1Q8IA 2NWGA 1ICWA 3I90A 3IAYA 1FD7D 3D4RA 3I4NB 4FF1A 1QOHA 1JOOA 5IOCA 1RF2D 5EPKA 5CBAE 3A7LA 2XVSA 2A6HC 3EA6A 4DU9A 3EROA 4HN7A 1BDOA 1IKMA 4F7XA 1KNAA 2F0OA 2F0EA 1BCPF 4M8AA 2WKDA 1STHA 4TKOB 1B50A 3CRLC 3BDOA 3I72A 1CZWA 3PO3B 3GV3A 4A3GB 2F0VA 2XRSD 1QNKA 4R8NA 4V0BA 2G9HD 3VA7A 3P75A 1HRJA 2F0JA 3CU7A 3K5MA 2EZVA 4HTHA 4KN4C 1JWMD 1SFOB 4YIJA 3E6ZX 1D1KA 1LTRD 3OWFA 4NDXA 2OEOA 2LFNA 4OIJA 1R9TB 1TS2A 4K5XA 4QIWB 4F8MA 2OT2A 4ZUIA 5A2QE 1PTOD 1IW7D 2FINB 3QB3A 3RZOB 1I4QA 4DA2A 1CQVA 1II3A 3RMHA 1EY5A 5EKIA 4DGZA 5IGFA 3RLFA 2L12A 1Z47A 2DN8A 5I9PA 3J80L 1J9OA 1SXTA 4C3HG 4X3TA 2A68C 3S1MB 3LNNA 3KK7A 4NW2A 5J22A 3H6MA 2V4DA 3X3NA 2K5QA 5COYA 3R93A 1WTRA 1Y1VB 1HHVA 4Y7NB 1Q1BA 5I9OA 3I73A 1HUMA 3PIO3 4C56C 3QJYA 1PYWD 1HXYD 3HOUB 1PFBA 1ZYRD 4C3IB 3D6CA 5C44B 5DEHA 3S9WA 1SYBA 1F2YA 5D14A 1PDQA 3PO2B 2LMCB 2N88A 5JAVA 5FLXE 1TWCB 1STGA 3G7LA 1QCBD 2SDFA 2SEBD 1TKWB 3S14B 4IFDG 4A3BB 3S1NB 1QILA 3QOJA 4NMZA 1EY9A 5C0XI 1CK1A 2FMCA 2IPKD 1YNJC 3GTLB 5EPJA 4XDXA 2RDHA 1LTAD 1IYVA 3FPUB 4QUFA 2B2VA 3O13A 1BCPD 3VA5A 5JVG3 3P20A 1SNCA 4WJWA 1M8AA 2PMZB 5CC4A 1D5ZC 1SJED 3PUZA 1B53A 2R93B 4HSVA 3N52A 3KF8A 1EOTA 1EU4A 1LTSD 2L55A 3R2TA 5C3XA 2OF1A 2AUKA 4RGNA 1HTPA 3KLSA 3EJIA 4KMUC 3MXUA 1HTLD 2ZXOA 5CGKA 5ISRA 2PNRC 2CVRA 2X69A 4TQUS 3J7YW 1SYCA 4QMGA 1E0BA 2F0WA 1ESRA 5FKAC 3S2HB 3ND9A 3S17B 1RKNA 1KTKA 2EJMA 3A8KE 2WB1B 3D8GA 4JK1C 5FO9B 1TS3A 3VR6A 1EWHA 1A2TA 2H1EA 4RGMA 1QB5D 1ZKOA 3AB9A 1K83B 3DUZA 3T56B 4KHVA 3M4YA 5C5MA 1WTXA 4J6HA 3OSOA 2EDGA 3R8BA 4U68A 3URYA 4LK1C 2F4IA 1KDAA 3K5LA 3IFDA 2PZUA 2EYOA 1DYQA 5JOBA 1XTCD 3DEPA 5BN5A 2E74C 1D2BA 4RFBA 2JEAI 3LX0A 4FF4A 3P1HA 3NTIA 4HEDA 1QWYA 1SBBB 1B1ZA 3TP5A 2L4NA 2HCIA 1EFID 4K14A 1GHKA 1TS4A 2FFKB 5JPNC 2GA4B 1BCPC 3C1FA 4OIKA 5ELDA 2Q8RE 5IT9L 1VF5C 2B8GA 1Y69U 1GJXA 5IGBA 4XQQA 3GV6A 1Y1WB 2N55A 2EYPA 5A2QL 3BS1A 2AWOA 2F0UA 5NUCA 4K2KA 3IL8A 2L1BA 2RDGA 3NE5B 1CHQD 2WIIB 3MEHA 2E2HB 2XIWA 5IGEA 1SNDA 1CTMA 4DNRB 3K59A 4G7OC 3L7ZC 5EKKA 4EQPA 2L0CA 4IFDI 3V05A 1VF7A 2K03A 4XYQA 4ZQ3A 3TZDA 5DM63 2IW3A 3EFXD 2K1BA 1ZEQX 4K2LA 3VR2A 1LTGD 5I6WA 1KABA 5C3WA 4H44C 3UI2A 3S16B 1OXXK 3HRZC 2A6HD 3GQBA 2EJGC 3A8JE 2ENBA 1WTPA 1TWGB 2I07B 1ENCA 2IWHA 4L63B 2JXMB 1VDZA 3NTHA 4XQJA 4PV1C 1W6KA 1V1PB 2VNUD 1G91A 2K5DA 2XNAC 3SK6A 1JORA 3TSSA 5C3EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTL D;  5D3D A;  1BCP F;  2ICI A;  1EEI D;  1BCP C;  1D5M C;  1UNS A;  3BYT B;  1S5C D;  3CHB D;  5ELD A;  1ET6 A;  1HQR D;  2XRS D;  1KLU D;  2Z8L A;  3MFG A;  4RGO S;  1I4X A;  3KLS X;  5I4D A;  1I4R A;  2G9H D;  1JR0 D;  1LO5 D;  4RGT A;  1AW7 A;  1ENF A;  3DWP A;  4RHR A;  1SJH D;  5FKA C;  4TSS A;  1DJR D;  3SEB A;  1G8Z D;  1KTK A;  1BCP B;  4ZYS A;  1S5F D;  5ELC A;  1SE2 A;  1JCK B;  1SE3 A;  2WV6 D;  5ELB A;  1M4V A;  5D3I B;  1JWM D;  1LTT D;  1TS3 A;  1LTB D;  1LT3 D;  1LTR D;  1PRT D;  3MC0 B;  2TSS A;  5ELE A;  2SEB D;  1XXG A;  2RDG A;  5FK9 C;  4L6T B;  4Z9C B;  3R2I A;  2NTS A;  5ELF A;  1T5X D;  1CHQ D;  4RGM A;  1EU3 A;  1QIL A;  3BYY B;  1TS2 A;  4RH6 A;  4DXG A;  1CK1 A;  1I4G A;  1V1O A;  1FNW A;  1BXT A;  1EEF D;  3DWQ A;  1LTI D;  2IPK D;  1PTO D;  1ET9 A;  1SE4 A;  1RD9 D;  1I4Q A;  1D6E C;  1ESF A;  3V05 A;  5TSS A;  3R8B A;  3BVZ A;  1UUP A;  1CQV A;  1JWS D;  1MD2 D;  1PZJ D;  2RDH A;  3EFX D;  3URY A;  1LTA D;  2IJ0 A;  2O2L D;  1PTO F;  1L0Y B;  2CHB D;  4RHS A;  3O13 A;  1PTO C;  1LTG D;  2AQ1 B;  1BCP D;  1TY0 A;  1PZI D;  4BWG B;  2AQ2 B;  1SXT A;  1FNV A;  4K6L A;  1TY2 A;  1PZK D;  1I4P A;  3BVG A;  1LLR D;  2J4X A;  2XN9 C;  4OHJ A;  1JWU D;  2QIL A;  1DYQ A;  1F77 A;  3OWE B;  2XRQ D;  1XTC D;  1FD7 D;  1PRT F;  1S5E D;  4RCO A;  1PRT C;  1S5D D;  2QEJ C;  1FNU A;  1D5X C;  1D5Z C;  1STE A;  1RCV D;  4RFB A;  1SJE D;  1RDP D;  1PTO B;  1LT4 D;  1LT5 D;  4L63 B;  2R61 A;  1S5B D;  4UDU C;  1B44 D;  1RF2 D;  1I4H A;  1L0X B;  1CHP D;  2NTT A;  4O1N A;  1EU4 A;  1FGB D;  1LTS D;  3R2T A;  3DWA A;  1HA5 A;  1V1P B;  1V1P A;  1LT6 D;  1PTO H;  3BVM A;  3EA6 A;  3GP7 A;  4RGN A;  1KLG D;  4DXF A;  1AN8 A;  1CT1 D;  1SBB B;  1B1Z A;  2AQ3 B;  3BZD B;  4C56 C;  1PRT B;  1GOZ A;  3W2D A;  2XNA C;  1TS5 A;  1JQY D;  1EFI D;  1EWC A;  1PYW D;  1SEB D;  3TSS A;  1TS4 A;  1HXY D; 
#chains in the Genus database with same CATH topology
 2F0Q A;  1F9P A;  2R7F A;  3WDN A;  2QKI C;  1Z6H A;  3BYT B;  4JBM A;  2A5H A;  4AIM A;  3SR1 A;  1VQI A;  1EQT A;  4JVZ A;  4IAL A;  3PUX A;  1C7Y A;  4JI4 L;  3PF4 A;  2JYO A;  2RCF A;  1XTD A;  2D0P A;  4I65 A;  2QEX A;  5EKL A;  1RJT A;  4IUU A;  4DR3 L;  2B2Y C;  4IPC A;  4HCE A;  5E4W C;  4Q5V A;  1R9T H;  4LFB L;  1CQF A;  4X3K A;  2AUJ D;  2NZH A;  2G5D A;  1BCP B;  4ODG A;  4ZUJ A;  5IYD G;  1B9N A;  2EE1 A;  2FJ2 A;  1KIX A;  2E8G A;  2NVQ B;  2KVM A;  3CKI B;  5FLM H;  2XSC A;  4OO1 H;  3HFZ B;  2HQE A;  2M9V A;  4JW0 A;  1F2M A;  2HDL A;  4KD4 A;  1I94 Q;  4BA2 I;  1CI3 M;  5FK9 C;  4QL5 A;  2A74 C;  3NP8 A;  4JI0 Q;  2GN5 A;  4LWC A;  2J0T D;  3BYY B;  5JPM C;  2NYZ D;  1AEX A;  3H94 A;  5C6A A;  3OYY A;  3NXW A;  3A5Z B;  2NZO A;  3K80 C;  1F9Q A;  4C3H B;  1PHJ A;  3V96 A;  4DR4 Q;  1SE4 A;  2A73 B;  3CCR A;  2JA6 H;  2K5N A;  4QUC A;  5C4H A;  4DV0 Q;  1FGU A;  1X54 A;  1ESF A;  2JA5 G;  3S1M H;  2A68 D;  5JJZ A;  1CA6 A;  1Q12 A;  2UXB Q;  4GKJ Q;  3TQY A;  2EXD A;  1AP0 A;  3BG3 A;  2AQ1 B;  4CGY B;  1Z7T A;  1Y1V H;  3HOZ G;  4LF6 Q;  5JEA H;  4L5T A;  4Y7N H;  3NQT A;  1XNQ Q;  1I4P A;  4B3M Q;  2NB0 A;  1O7Y A;  3PIO A;  3A7A B;  3U9O A;  1HNW Q;  3OIQ A;  5G3L D;  1E3P A;  3I4O A;  3GTJ B;  3A5U A;  1JOQ A;  3PV0 A;  5CV5 A;  2VY3 A;  1S5B D;  4LF7 Q;  4ZKC B;  1FVI A;  4HSP A;  1A62 A;  1DXM A;  3GTG H;  4A3K B;  1PFS A;  2DNC A;  1XYI A;  1GOZ A;  5HUR A;  2KQ3 A;  1VQK A;  3KJP A;  3DM1 A;  1A63 A;  3RN5 A;  4GNX A;  3ITP A;  4K0K L;  3H3V H;  1AH9 A;  4JI4 Q;  2O5I C;  2JA7 B;  1SYF A;  3TZU A;  4A3F H;  3MHB A;  4DR3 Q;  4M1U B;  1TWC H;  4LFB Q;  4FXD A;  3S14 H;  3AFP A;  4JOI C;  1K3B C;  2BA0 A;  5M5W H;  1U4L A;  1EQQ A;  1SE2 A;  4KV6 A;  2HCC A;  5C4X B;  3PUV A;  2K32 A;  1EUJ A;  1YNJ D;  1MIU A;  3NBI A;  3TP7 A;  1XXG A;  3TRE A;  4R8I A;  4KHP L;  5ELF A;  4HIM A;  1N32 L;  1IL8 A;  1LTL A;  2EYL A;  4L5R C;  3K81 C;  5HY6 A;  1HFG A;  2JA8 H;  3AMU A;  4MN3 A;  1CM9 A;  5IT9 E;  4FXG C;  4OL7 A;  3S2D B;  2JEB I;  4CDF C;  2F0D A;  1BNZ A;  3D4W A;  4CJ2 C;  4JBW A;  4ME3 A;  5KNC A;  3SE0 A;  1HZB A;  1TY0 A;  4YWM A;  1HNZ L;  4DNT B;  2NBF A;  4EQ5 A;  4BY1 B;  4JI3 L;  1SMY C;  1LLR D;  2J4X A;  2F0M A;  4HAE A;  4C3J B;  1O78 A;  3HEJ A;  3QWN A;  3M7N A;  3A55 A;  1IZ6 A;  4R9W A;  1LAC A;  4V19 0;  1X65 A;  2HQL A;  1QVF A;  4IUQ A;  1MBY A;  3CPF A;  4XT3 B;  1YI2 A;  1VQ7 A;  3DLL A;  3T16 A;  1HNX L;  1I6H B;  3AQQ A;  4DR5 Q;  2K7V A;  3EQL C;  1CKN A;  1V1P A;  4EQO A;  1AN8 A;  1A3U A;  2R7Z B;  4JI7 L;  4K0K Q;  1PMR A;  1OTC A;  1Q3L A;  3CAM A;  3GDE A;  4GN4 B;  3T53 B;  5JVH 3;  4DUY L;  2D0O A;  1MJC A;  3ERS X;  4DK6 C;  4POG A;  3G6E A;  2E2J H;  4X62 L;  3TEH B;  1EIY B;  5EBD A;  5GQO A;  1BBX C;  3N6R A;  4A3J H;  5FJ8 G;  1H9S B;  4TRD A;  3G4S A;  3I4M G;  1VQ5 A;  4HID A;  2DJF C;  1TXY A;  1U9R A;  4L8J A;  1LO5 D;  1TWA B;  3BDL A;  4RHR A;  3RZD B;  2A6E D;  4TSS A;  4QY7 A;  3SEB A;  3GTQ H;  2Z1C A;  5M5X H;  4C1N I;  1MHW C;  1G29 1;  5C0X J;  2IX3 A;  4A3D B;  1S5F D;  3LWE A;  4IJL A;  1N32 Q;  2LY7 A;  3E5S A;  5GAH C;  3HKZ G;  3MC0 B;  2QDB A;  4DR7 L;  1CUK A;  5LMU L;  1ONL A;  2RF4 A;  2ZXP A;  4HJ8 A;  5KGU A;  1IBM L;  5CV7 A;  3P7J A;  1EY7 A;  4LUZ A;  4G4K A;  1V1O A;  3GTP H;  4GZY C;  2KOL A;  2E2I B;  1BXT A;  2NZ1 D;  2LKV A;  4NP5 A;  1I50 B;  2VQF L;  5I2Y A;  5KIX A;  3HOW B;  4RWS C;  2O4X A;  4FVM A;  1H9K A;  2CCZ A;  1VQC A;  1YEZ A;  2WIN B;  3NEL A;  2BA1 A;  1HNZ Q;  1S4Z A;  2VS1 A;  4DAM A;  5DM7 3;  2JK8 A;  5M3F G;  3WOF A;  4RHS A;  1NR2 A;  5IWA Q;  2GVB A;  3SK8 A;  2BH2 A;  1GUT A;  4J15 A;  3MFY A;  3TP8 A;  1B3Q A;  3M3Y H;  2IL8 A;  1GKH A;  4K6L A;  1GUN A;  3BVG A;  3I4N G;  3T1Y L;  1KDB A;  5IGG A;  4KKS A;  1CZG A;  1A2U A;  3M4O B;  4BXX G;  4ILW A;  1HNX Q;  1V1Q A;  1UE5 A;  3K7A H;  3HOZ H;  2R61 A;  3GTM B;  4JI8 L;  1TII D;  1XMQ L;  2ZXR A;  4H13 C;  3G6J B;  5EJW A;  2VW9 A;  3HOX B;  4JI7 Q;  1FR3 A;  3DMU A;  4DUY Q;  3VYS A;  2B63 G;  1X55 A;  2JP1 A;  1PTO H;  3FPP A;  3GP7 A;  3E9H A;  2PQA B;  1R4P B;  3C2P A;  4N9T A;  1UWV A;  4LF9 L;  4X62 Q;  3OMC A;  1JB7 A;  4X66 Q;  1VQ8 A;  1A8V A;  1X3Q A;  2AMC B;  5M5Y B;  1SEB D;  1XX8 A;  3DM3 A;  3ER0 A;  4I7Z C;  3AFQ A;  2EVB A;  5D65 A;  1U4M A;  3PO3 G;  4A3G G;  2MJ8 A;  2NVX H;  2QW7 A;  2MUY A;  4DR6 L;  4K8I A;  1NMG A;  4K8J A;  4UY8 C;  5BN4 A;  2K01 A;  1F2L A;  4YCW A;  2F0P A;  4DN4 M;  5IT9 c;  4O42 A;  1BO0 A;  3ONA B;  3TS0 A;  2UXD L;  1KRT A;  2IHF A;  1PLF A;  3GTO H;  3OMG A;  2KCN A;  2PO4 A;  2RA4 A;  5BN3 A;  1SSO A;  1WI5 A;  4DV3 L;  1TT2 A;  1Q86 C;  4RMF A;  5ELN A;  5HGT A;  1ASZ A;  2E2H H;  5CR3 A;  4B9W A;  1SYG A;  4DAP A;  5LMU Q;  2VUM B;  4OX9 L;  3ICE A;  1F2Z A;  2HIV A;  3NSW A;  4HJA A;  4IN3 A;  4KJO A;  1T5X D;  5FLM G;  2VQF Q;  4JC0 A;  1WTO A;  4OO1 G;  4UP8 A;  3ERQ A;  2I5M X;  3A54 A;  4XYO A;  3TBI B;  4BBS B;  4PMB A;  4A3E B;  1CKM A;  1BOS A;  1OXS C;  4KY7 A;  2F0N A;  4UHV A;  1RHP A;  1QUQ B;  2JA6 G;  2A6E C;  5LMN L;  2LXK A;  4B3T Q;  3T1Y Q;  1PZI D;  2IY5 B;  3SVM A;  3T4A C;  4GN3 B;  4DV4 L;  4QB4 A;  3I4L A;  2MPM A;  2B8F A;  2NVT B;  1SNP A;  2E76 C;  4OHJ A;  2IHE A;  1F77 A;  3TS2 A;  3QO2 A;  1S5E D;  1Y1V G;  4JI8 Q;  1S5D D;  4IUN A;  5JEA G;  2ZTE A;  4X3U A;  4YCV A;  1VQ4 A;  1RCV D;  2KUM A;  4BBR B;  1H9R A;  1PFM A;  4IO9 A;  2RQX A;  3C46 A;  4A3L H;  4O1N A;  2CW0 D;  5LMN W;  3MTS A;  1B8A A;  3S1R B;  4ZKB B;  1I3Q B;  3CC7 A;  2VL6 A;  3MA2 B;  4LMQ D;  1E2V A;  3ZYY X;  2Q2I A;  1JQY D;  1VMP A;  3A74 A;  4DR6 Q;  1D8L A;  3TP6 A;  2X6G A;  5COR A;  1UNS A;  1VS0 A;  3T51 B;  1S5C D;  4UP7 A;  1WTQ A;  5C44 G;  2UXD Q;  1H9S A;  3X3M A;  2FMM A;  3K5O A;  4GN5 A;  4LF5 L;  3JAM E;  1I4R A;  1G2T A;  2E2D C;  4DV3 Q;  5E4X A;  1JC7 A;  3PO2 G;  1QVG A;  1WYD A;  4A3F G;  3BDC A;  2VQE L;  1B3A A;  1TWF H;  5AFW A;  4OX9 Q;  1RL2 A;  1U4P A;  3D3R A;  5FJ8 H;  3FRP B;  1IYJ B;  2PW7 A;  2F0L A;  4A3B G;  2F3V A;  3CW2 C;  4IFD J;  2JA5 B;  1SRO A;  4GLV B;  2F3W A;  3AU7 A;  4CDC C;  2KCC A;  1YNN C;  1RIP A;  2H4O A;  5JJI A;  3W1G A;  4EQN A;  4XIG S;  4RKL A;  4JOI A;  2F0I A;  1KD1 C;  1A6X A;  1ML0 D;  3FHW A;  3I70 A;  4IPD A;  2Y0S B;  1JE5 A;  1YNX A;  1ET9 A;  4A76 A;  2KHS A;  3KUP A;  3EIV A;  5LMN Q;  4GKK Q;  2Z4H A;  1O7L A;  1PZJ D;  1FJG L;  5J39 A;  1ILP A;  4A93 B;  1L0Y B;  4DV4 Q;  2ZT9 C;  3GTJ H;  2JA8 G;  3E3X A;  3RN2 A;  1DOM A;  2K04 A;  4XXE A;  4NXN Q;  2WAQ B;  1EYC A;  4LFC L;  3CQZ B;  1PYB A;  1Q90 A;  1HQM C;  3MEF A;  1UEA B;  1YIT A;  4RCO A;  5HGQ A;  5C4J B;  2QEJ C;  2RHQ B;  4JBK A;  4ZK9 B;  3ULJ A;  3Q0A A;  4N8F A;  4UDU C;  1NE3 A;  1BQQ T;  1B44 D;  1X3G A;  2VB3 X;  2VXW A;  4DV0 L;  1CHP D;  3LWU A;  2JJQ A;  2B2T C;  1G6P A;  2BDN A;  1FGB D;  1K3R A;  1STA A;  4A3M B;  3H0G B;  1B4O A;  4E6I A;  3BVM A;  4HMI A;  4DXF A;  2PQA A;  1CA5 A;  3BZD B;  2A1A A;  1YBY A;  4GKJ L;  3V2T A;  3K58 A;  3NQI A;  4HJ9 A;  2F52 A;  4BY7 B;  1GXD C;  2EPB A;  3CCL A;  1LV9 A;  2EYM A;  4LF5 Q;  3K7U C;  4YWK A;  2KEE A;  2HUG A;  3CHB D;  4CKB A;  1SN8 A;  2MO1 A;  2WP8 J;  1L2F A;  4J8Q A;  2HT1 A;  4DF7 A;  4RGO S;  5DLQ E;  4R4I A;  2K5H A;  1JR0 D;  2F0T A;  4RGT A;  4A3J G;  3IFT A;  1DJR D;  2WB1 G;  2WFW A;  1Y8P B;  4A3G H;  2KA7 A;  3UE0 A;  1G8Z D;  4FF3 A;  3FKI B;  4DFA A;  1EIF A;  3KF6 B;  2YTY A;  1BKB A;  4WFN 3;  1K8O A;  1B2T A;  2A69 C;  2CW0 C;  3H15 A;  1YJW A;  5M3M B;  1PFN A;  4CKE A;  3RR5 A;  2TSS A;  4R4Q A;  1A3V A;  2K52 A;  2D62 A;  2L11 A;  2CH4 A;  4KD3 A;  5T1G A;  3S2D H;  1SFO H;  1EU3 A;  5KYL A;  1JIC A;  1STB A;  4LUV A;  1DON A;  2ICE C;  1DCZ A;  2I0Q A;  3U9S A;  1RD9 D;  1FJG Q;  4DK0 A;  1C8C A;  2OTJ A;  2JSO A;  1C48 A;  3NPP A;  3CP0 A;  1C0A A;  1SMY D;  4OO1 I;  1QUQ A;  3EVQ A;  2Q2T A;  3D6W A;  2DGY A;  2O2L D;  1PTO F;  2QCP X;  4X3S A;  1ILQ A;  3RZO H;  1JJC B;  4LFC Q;  1B7Y B;  2L15 A;  1SR3 A;  1HPC A;  1X6O A;  2K05 A;  4KK7 A;  4B9X A;  4QGU A;  4ALP A;  1AE3 A;  4U67 3;  3I91 A;  1PRT F;  2F3I A;  3OHX C;  3JAM c;  3J7A 5;  4IZ8 A;  4GS3 A;  3T1H L;  2QA4 A;  4RA8 A;  3H91 A;  5AJ3 L;  4F87 A;  5K5P A;  3DEO A;  1PH7 A;  1I4H A;  2KBN A;  1WD0 A;  5DAU A;  1BBW A;  3TME A;  2R92 B;  1FL0 A;  5IGD A;  3Q23 A;  1OXV A;  2EJF C;  4KJN A;  3NK9 A;  3HOV B;  2PW5 A;  2GVA A;  3MXP A;  1DOL A;  2Y0S E;  1R4Q B;  2F0F A;  3VR4 A;  4C1N K;  1LYL A;  4FF2 A;  2EY5 A;  1PH9 A;  4YWL A;  5IYC G;  2ES2 A;  3S1Q B;  3SXH A;  5C0X G;  1O7Z A;  4DK1 A;  2UUB Q;  2UU9 L;  4YHH L;  2YYZ A;  2L9H A;  4MTN A;  3WWV A;  3VYT A;  1ET6 A;  3HOU H;  2WAQ E;  5I4D A;  1YZ6 A;  4C3I H;  5BR8 L;  1Y1W G;  3HKZ B;  1ICF B;  2B2U C;  2SNS A;  2O5J C;  3RD4 A;  1CSP A;  3K5N A;  2ID0 A;  3JAM i;  1EFW A;  4DR5 L;  4Q0F A;  1G6Z A;  1T9H A;  4KI0 A;  3H3V I;  5C44 H;  5EPL A;  1VQL A;  2E2I H;  4H0L C;  1H9M A;  1NSN S;  1PH1 A;  2YU9 B;  1LTT D;  3UDX A;  1GUW A;  3FDT A;  5GAG C;  4CKC A;  1LT3 D;  2KEN A;  3PO2 H;  3RLO A;  1KQS A;  5IE8 A;  2UUC L;  5M3F B;  2MP1 A;  3W5O A;  4K5W A;  3HGB A;  1LTI D;  1K8M A;  1SMX A;  3HOY B;  1EZ6 A;  2F0G A;  4A3B H;  4K6D A;  5IGC A;  1Y8N B;  4YY3 L;  2EYH A;  3S1N H;  1D6E C;  4C2M B;  3NTK A;  4OWX B;  1U0L A;  2BDO A;  3M85 A;  1GM5 A;  1T5E A;  4UP9 A;  1D1I A;  4IJH A;  2QGQ A;  4A3I B;  1AE2 A;  1MD2 D;  1NCV A;  4IPH A;  1YJN A;  1NAP A;  2NVY B;  4P73 A;  3ND8 A;  3GTL H;  1JE4 A;  2OQ0 A;  3M4O H;  3OPO A;  3VYU A;  4CJ0 B;  1H95 A;  4BWG B;  1WTH A;  3QOL A;  3NHH A;  4PMW A;  2VZA A;  2B63 B;  3T1H Q;  3H3V C;  4ME5 A;  5AJ3 Q;  3F2U A;  3GTK B;  1PYS B;  3MZ5 A;  3FMC A;  1E1O A;  2N78 A;  1FNU A;  1STE A;  4DAY B;  1GUG A;  1VQO A;  2DY8 A;  4G7H C;  2MQH A;  1L1O C;  1DGS A;  2QF7 A;  2PI2 E;  3ULP A;  1VQN A;  1VQG A;  3DWA A;  3I8Z A;  2BCO A;  3OOC A;  1LT6 D;  1TR5 A;  3CCV A;  3KLR A;  3TDQ A;  3LGJ A;  2PZW A;  2R93 H;  1N33 L;  5C3E G;  1XWE A;  4A3L G;  5IWA L;  3HP3 A;  5FOB B;  2F4V L;  3JAM L;  4RCN A;  2UU9 Q;  3NEM A;  1EWC A;  4YHH Q;  1BUV T;  2K5W A;  1UEB A;  2RKS A;  4IQZ A;  5C4Z A;  1SAP A;  5BR8 Q;  4DV1 Q;  2N3S A;  1JB3 A;  2UXC L;  4NKL A;  4J1M A;  1SYD A;  5KYI A;  1NUC A;  3MFG A;  5FO7 B;  3DXJ C;  3C1E A;  3DWP A;  1PH3 A;  3OW7 A;  1LUZ A;  4X65 L;  5IIF A;  2RCN A;  4AYB B;  5FO8 B;  1A3T A;  2Q8I B;  1GHJ A;  2CWA A;  2WV6 D;  3KF6 A;  5ELB A;  3S2H H;  3A56 A;  5D3I B;  3S17 H;  4X66 L;  2C5C A;  1UE6 A;  2UUC Q;  4BBS H;  4A3E H;  1PRT D;  1STY A;  2EOT A;  4H7B A;  1VQM A;  5LL6 S;  2PI2 A;  2AKW B;  4F88 A;  2JA6 B;  5KNB A;  4IUP A;  2ASB A;  2G9D A;  4YY3 Q;  1D7Q A;  2E75 C;  1EEF D;  1E2W A;  1EL0 A;  2FHT A;  1EYA A;  1HZ9 A;  1VQP A;  1VQ9 A;  3E9I A;  1DOK A;  5IYB H;  2NVT H;  2IX0 A;  5I2X A;  5IY0 A;  1JWS D;  3MVV A;  3SK5 A;  1Q7Y C;  1K83 H;  3MXN B;  3W3A A;  2NN6 G;  3K57 A;  1QE6 A;  3HKZ E;  1U4R A;  1FYC A;  3NWT A;  5J3B A;  1K0S A;  1TWH B;  1ENA A;  1FNV A;  1W3S A;  2K5V A;  3FEW X;  1EOV A;  2XN9 C;  2D5D A;  1DD2 A;  3S1R H;  4CBV A;  1ZXT A;  1EYD A;  2N49 A;  1STN A;  1WTV A;  3GTG B;  1LT4 D;  3C3L A;  1EIH A;  1XPR A;  2IX1 A;  4GLX A;  2KJX A;  1HFN A;  1N33 Q;  1IL2 A;  1SNO A;  2F4V Q;  3RNU A;  1CFM A;  1PH4 A;  2AQ3 B;  3KYH C;  3L2P A;  2EY6 A;  4A75 A;  1IYU A;  1SRU A;  3W2D A;  4IUV A;  3U4V A;  1P8L A;  1TS5 A;  4B3T L;  1PVO A;  1RTO A;  2OXP A;  2UXC Q;  1L1O B;  4A3F B;  2BH8 A;  1HR0 W;  5EGT A;  1E24 A;  2F0S A;  3T13 A;  4B3R Q;  1D5M C;  2B2T A;  5KRU A;  2CKZ B;  2C9O A;  1WCM B;  4IOC A;  4OGQ C;  1HQR D;  4X65 Q;  5M5W B;  2EY2 A;  3U58 A;  2WKC A;  1VQA A;  1PV4 A;  1AW7 A;  1ENF A;  5CV8 A;  5IYC H;  3J81 j;  5L37 A;  5C0X H;  3PIP 3;  1VQH A;  4UAI A;  1KAW A;  1YNN D;  2RHS B;  4PNY A;  4A4I A;  1XPO A;  2PPB C;  1KXL A;  1QNU A;  1Q8K A;  3TN2 A;  1PH6 A;  1JCK B;  2F0H A;  5EAY A;  1UE7 A;  4JPB W;  4ZCK A;  1Y1W H;  1X3E A;  4ID6 A;  4X64 L;  2B2W C;  4XT1 B;  4CHT B;  4P74 A;  5ELE A;  2TMP A;  2K4K A;  2D9U A;  1RTN A;  2NTS A;  5LL6 X;  1AFP A;  4RH6 A;  4FP5 D;  1TVX A;  2PYK A;  3GO5 A;  1GO3 E;  4DXG A;  2JA8 B;  3S15 B;  3K0Y A;  4A93 H;  1E7Z A;  1SDF A;  2JQO A;  3DWQ A;  5GRO A;  1B9M A;  3F1Z A;  1O7I A;  5CYU A;  3J81 L;  1MI2 A;  2Z6B A;  5EQ0 A;  2HDM A;  4JYA Q;  2EXZ A;  2XWJ B;  3I56 A;  5TSS A;  4HR7 B;  2M2L A;  1LM0 A;  3Q22 A;  2IJ0 A;  4A3C G;  4YCU A;  1PTO C;  4C3J G;  5CV6 A;  1IW7 C;  4PQX A;  2JA9 A;  2B2Y A;  2AQ2 B;  5CMD A;  5EBC A;  2EYJ A;  3F8T A;  4AYB E;  1QJO A;  5E1F A;  2EYF A;  1PRT C;  1CSQ A;  1X3P A;  1V8Q A;  3VR3 A;  2KHJ A;  4DAY A;  1RDP D;  4PZ7 A;  1LT5 D;  2CQA A;  3S16 H;  1G2S A;  2F0K A;  2RSN A;  4BY7 H;  1BBU A;  2X6L A;  2D2C C;  2R7Z G;  4GKK L;  3CC4 A;  4B08 A;  3CC2 A;  1HA5 A;  1TWG H;  4EVO A;  2KEC A;  2E2J B;  1KLG D;  2OTL A;  1CT1 D;  2LS0 1;  1K8G A;  1GUS A;  4NXN L;  4A3J B;  4DV7 L;  1EEI D;  1KHI A;  1AZP A;  2Z6K C;  5KND A;  3CCE A;  1S72 A;  1BF4 A;  3GTQ B;  5C3E H;  4P71 A;  5M5X B;  2IT1 A;  2RSO A;  2Z8L A;  3VR5 A;  2A69 D;  3HZX A;  1SE8 A;  1DM0 B;  3KLS X;  3KLW A;  3PUW A;  3E0E A;  4WJ4 A;  1OXT A;  5A35 A;  4JI2 L;  4RKB A;  4B3S L;  1ZYR C;  2EY1 A;  5K36 G;  2RBM A;  2DY7 A;  3HOU G;  4N9P A;  2VB2 X;  1X9N A;  3D31 A;  2KED A;  4C3I G;  5M9O A;  1KDC A;  1YHB A;  2Z4I A;  4OEL B;  1YJ9 A;  4X64 Q;  5IP7 G;  1TQO A;  2J7Z A;  4KY5 A;  1Q1E A;  3Q6S A;  1LTB D;  4AQY L;  5ELO A;  2SNM A;  1EZ8 A;  3GTP B;  4ULL A;  2B2U A;  3R2I A;  1WTW A;  2CQO A;  1KAA A;  5E3F A;  2NVQ H;  4JV5 L;  2E5L L;  3MAQ A;  3HOW G;  2DNE A;  3G48 A;  1UAP A;  3GD7 A;  1SNQ A;  2K33 A;  1LAB A;  3PSI A;  5DNF A;  3MWY W;  1E2Z A;  3UDG A;  3NBH B;  3NWS A;  2XWB B;  3CCM A;  3BVZ A;  1UUP A;  1A15 A;  3J7A F;  3UE1 A;  3NUC A;  2Q8T A;  3M3Y B;  2BOS A;  4C3H H;  4R1J A;  2NUC A;  3MXN A;  4DAV A;  4JCV E;  2ZM6 L;  3BJU A;  1J8I A;  4CJ1 B;  1VQB A;  1XNR L;  1H9J A;  4FYD A;  3A8I E;  1JWU D;  2QIL A;  3K7A B;  4KTA A;  3HOZ B;  3OWE B;  4FNF A;  5JJK A;  2XRQ D;  1MGS A;  4BS9 A;  5GAD C;  1Y8O B;  1EIG A;  3PGZ A;  2NN6 I;  3KOJ A;  1K8A C;  1D5X C;  3KFU A;  2NN6 H;  5IOD A;  1PTO B;  3J80 E;  4KKT A;  1IBL L;  1QG7 A;  1WFQ A;  2NTT A;  1NNX A;  4RAU C;  3SDZ A;  5G3L F;  2EQS A;  5CV9 A;  1HZA A;  2ATW A;  3I55 A;  3I3C A;  2YV5 A;  3K6O A;  4IUR A;  4ZAI A;  1F9S A;  4DV7 Q;  1PRT B;  4G7Z C;  2NVX B;  2K6A A;  5LHY 1;  4ZLT F;  4FXK C;  2L5T A;  1EQV A;  4A3K H;  2OWO A;  1L1O A;  3L9A X;  5D3D A;  2ICI A;  2R93 G;  1X56 A;  2H5X A;  3SHL A;  1JOK A;  1J6Q A;  4XTC S;  4JI2 Q;  4APV A;  4B3S Q;  3GTO B;  2JN4 A;  2PQE A;  1V43 A;  3D4D A;  4IOA A;  1KLU D;  2YU9 H;  1EY0 A;  1OXU A;  2I5L X;  1HA6 A;  5CV4 A;  1U5K A;  4XQN A;  2BE5 D;  1K28 A;  2JA7 H;  1DZ1 A;  1IKL A;  2M00 A;  2VUM G;  4AQY Q;  5ELC A;  4DKA C;  4IFD H;  4QF4 A;  3PMF A;  4WRD A;  4KKU A;  3QIA A;  1N36 L;  5IP9 H;  4JV5 Q;  4JBJ A;  2E5L Q;  4C2M H;  4L6T B;  2K28 A;  4ZRZ A;  2UUB L;  1EY8 A;  4LNQ A;  5C4X H;  1VCI A;  3DHQ A;  4A3I H;  3H09 A;  2MGS A;  4BBS G;  2NVY H;  4A3E G;  2B2V C;  3SK4 A;  2B29 A;  1I4G A;  4EGV A;  4KHZ A;  4MHE A;  4NXM Q;  3Q24 A;  3CRK C;  1QVC A;  2ZM6 Q;  2F1M A;  4LJZ C;  3KBX A;  2R7D A;  1HZC A;  2PCF B;  1NR4 A;  1YIJ A;  3GTK H;  2R6G A;  2CHB D;  3MXG A;  5KEE A;  1XNR Q;  1OO9 B;  5IYB G;  4L5Q A;  3PUY A;  3STB D;  5C5L A;  1PZK D;  1IBK Q;  4L5S A;  2P5Z X;  3EBE A;  1O80 A;  2WAC A;  5JEA J;  1EWI A;  1IHZ A;  4FO2 A;  3CF5 A;  1IBL Q;  4A3C H;  5I6Y A;  3WOE A;  2DJG C;  2K50 A;  1NBW A;  4POF A;  1I6V C;  4BY1 H;  3HG9 A;  1HUN A;  4HCS A;  4C3J H;  3IKJ A;  3D0F A;  3FVQ A;  3OIP A;  1WD1 A;  4OXP A;  1L0X B;  2RVL A;  5FLX L;  1EY6 A;  4S3S A;  4KN7 C;  1WJJ A;  3CPW A;  3RUZ A;  1X32 A;  2PZT A;  3J81 E;  1S3O A;  1W6J A;  4HJ7 A;  1GUO A;  1MSH A;  2Z9H A;  3F2C A;  1I6H H;  2F03 A;  2MHV A;  1SYE A;  3VDY A;  3M9B A;  2R7Z H;  4RG1 A;  1NY4 A;  4DR1 L;  1C4Q A;  5JJL A;  4G57 A;  2C35 B;  3KBG A;  4H02 A;  5T1I A;  1N34 L;  4LW1 A;  5F2D A;  4HMJ A;  1JJ2 A;  1TWF B;  2RDF A;  1CKO A;  1I4X A;  2R3Z A;  1Q82 C;  1SJH D;  3I4M B;  3J7A V;  1X3F A;  1W2B A;  4KY6 A;  1PXU A;  1Q81 C;  1N36 Q;  4ZYS A;  1AZQ A;  4JI6 L;  1TWA H;  1N8R C;  1JMC A;  1SE3 A;  1M4V A;  2ALY B;  2CFM A;  3RZD H;  1ASY A;  1MSG A;  1BR9 A;  1NJI C;  1EY4 A;  4LFA L;  3E0J A;  4A3D H;  4PMC A;  5K36 H;  3VYR A;  2KHI A;  2SOB A;  4Z9C B;  3R3O A;  1F9R A;  2Y0S G;  3OW2 A;  3M7G A;  1SNM A;  1VMC A;  1VQE A;  4DV1 L;  2B39 A;  4QCL A;  5E7N A;  3J80 c;  1KC8 C;  3L3O C;  1FNW A;  4MIU A;  5IP7 H;  4BA1 I;  1TU2 B;  1WVL A;  1TWH H;  3NBH A;  1M1K C;  4K5V A;  4A93 G;  2B2W A;  2K75 A;  4WOR A;  3L0O A;  5J1Z A;  1ROD A;  2WAQ G;  4DV6 L;  1I50 H;  2BE5 C;  5CBE E;  2I46 A;  4IUT A;  3HOW H;  4ABN A;  4JI1 L;  3QG1 A;  2JE6 I;  3HS0 C;  1KNE A;  2AWN A;  1A0I A;  2HD3 A;  3NEN A;  4P2C B;  1HCZ A;  4DUZ Q;  4LAA A;  1TY2 A;  2YTV A;  1Q8I A;  1NTG A;  2NWG A;  1ICW A;  3I90 A;  3IAY A;  1N9W A;  1FD7 D;  1J5E L;  3D4R A;  2N8N A;  3SGI A;  1QZH A;  3I4N B;  2EIF A;  4FF1 A;  2OCE A;  1YVC A;  1QOH A;  4A3M G;  1JOO A;  3H0G G;  5IOC A;  1RF2 D;  5EPK A;  3CME A;  3KF8 B;  5CBA E;  4DV5 L;  3J80 i;  3A7L A;  3K8A A;  2XVS A;  2A6H C;  3EA6 A;  1WCM H;  1SLJ A;  4DU9 A;  3GTM H;  2XTI A;  4BY7 G;  3ERO A;  4HN7 A;  2KCM A;  3CCQ A;  3HOX H;  1BDO A;  1IKM A;  3PIP A;  4F7X A;  1KNA A;  2F0O A;  4DR1 Q;  1XPU A;  2F0E A;  1BCP F;  1N34 Q;  4M8A A;  2WKD A;  1STH A;  3ZJY C;  4TKO B;  1B50 A;  3CRL C;  1VQF A;  3BDO A;  3STB C;  3I72 A;  1CZW A;  3PO3 B;  5M5Y H;  4GOP C;  1I5F A;  3GV3 A;  4A3G B;  2F0V A;  2XRS D;  1QNK A;  4R8N A;  3W1B A;  4V0B A;  2G9H D;  3VA7 A;  3P75 A;  3FKI G;  1E22 A;  4JI6 Q;  1HRJ A;  2F0J A;  3CU7 A;  4P75 A;  3K5M A;  2EZV A;  2Z6K A;  4HTH A;  5M3M G;  4LUO A;  3S15 H;  4LFA Q;  4KN4 C;  1JWM D;  1SFO B;  2A8V A;  4MNO A;  4YIJ A;  3U4Z A;  3E6Z X;  1D1K A;  1LTR D;  3OWF A;  4NDX A;  3M4P A;  2OEO A;  2LFN A;  4OIJ A;  1R9T B;  4B3R L;  2MO0 A;  2HHH L;  2VUM H;  3KJO A;  1TS2 A;  4K5X A;  4QIW B;  4F8M A;  2OT2 A;  4ZUI A;  4DNI A;  5A2Q E;  2KCT A;  1PTO D;  3FP9 A;  4N8X 1;  1IW7 D;  2FIN B;  3QB3 A;  4DV6 Q;  3RZO B;  1I4Q A;  5GAE C;  2LSS A;  4JI1 Q;  4DA2 A;  3J81 c;  1CQV A;  1II3 A;  3RMH A;  1EY5 A;  5EKI A;  4OWW B;  4DGZ A;  5IGF A;  3RLF A;  2L12 A;  4HIO A;  3F2D A;  1Z47 A;  2DN8 A;  5I9P A;  3J80 L;  1J9O A;  3CCU A;  1J5E Q;  1XMO L;  4WJ3 M;  1SXT A;  4UPA A;  4C3H G;  4X3T A;  2A68 C;  3S1M B;  3LNN A;  3KK7 A;  4NW2 A;  5J22 A;  4KLK A;  4R4C A;  3H6M A;  2V4D A;  3X3N A;  4QJF A;  1Q46 A;  1IXR A;  2K5Q A;  3KDF B;  1Z9F A;  5COY A;  3R93 A;  4DV5 Q;  1P16 A;  1WTR A;  2R92 G;  1Y1V B;  1HHV A;  4Y7N B;  1Q1B A;  1M90 C;  5I9O A;  3HOV G;  4JYA L;  4QQB X;  3I73 A;  1MKH A;  4JI5 L;  4PZ6 A;  4BBR H;  1C9O A;  1HUM A;  3PIO 3;  4C56 C;  1L0W A;  3U50 C;  3QJY A;  1PYW D;  3J81 i;  1HR0 L;  4Y52 H;  1HXY D;  1I3Q H;  4OON A;  3HOU B;  4KHP Q;  1PFB A;  1ZYR D;  4C3I B;  4JG2 A;  3CCJ A;  3D6C A;  3BZK A;  4A3K G;  3AEV A;  5IYD H;  5C44 B;  4DPG A;  4LF8 L;  5DEH A;  3S9W A;  1SYB A;  1V9P A;  1F2Y A;  5D14 A;  1PDQ A;  3OTO L;  3PO2 B;  3UDF A;  2LMC B;  2N88 A;  4GOP B;  5JAV A;  2DUD A;  5FLX E;  2JA7 G;  1TWC B;  2CWP A;  1STG A;  3G7L A;  4GLA C;  2HHH Q;  4JI3 Q;  1QCB D;  2SDF A;  2SEB D;  1TKW B;  3S14 B;  4IFD G;  1PH5 A;  4A3B B;  2HIX A;  1EYG A;  2ZJQ A;  3S1N B;  3HOY G;  1QIL A;  3QOJ A;  4NMZ A;  1EY9 A;  5IP9 G;  5C0X I;  2UUA L;  2JA5 H;  1CK1 A;  2FMC A;  2CH4 W;  3F2B A;  2IPK D;  1YNJ C;  5C4X G;  3GTL B;  4A3I G;  1MJE A;  3EN2 A;  5EPJ A;  4XDX A;  2RDH A;  1LTA D;  1XMO Q;  1IYV A;  3FPU B;  4X6A H;  4QUF A;  3TRZ A;  2B2V A;  3O13 A;  1BCP D;  3VA5 A;  5JVG 3;  1PA6 A;  3P20 A;  2LXJ A;  1PH2 A;  4NB3 A;  1GD7 A;  1SNC A;  1PH8 A;  2B3G A;  4DR2 L;  4LF4 L;  4WJW A;  1M8A A;  2PMZ B;  4DV2 L;  5CC4 A;  1D5Z C;  4CDE C;  4DK3 C;  1SJE D;  3CQZ H;  3I7F A;  3PUZ A;  4JI5 Q;  4GNX C;  1B53 A;  2R93 B;  4IPG A;  4HSV A;  3N52 A;  3KF8 A;  1EOT A;  5C4J H;  1EU4 A;  1LTS D;  2L55 A;  1EQR A;  3M4Q A;  3R2T A;  4BY1 G;  5C3X A;  2OF1 A;  2AUK A;  4RGN A;  1VQ6 A;  1HTP A;  1HR0 Q;  4QIW E;  1NMF A;  3KLS A;  1GVP A;  3EJI A;  4NPS A;  3CXC A;  1K9M C;  3I2Z A;  2A19 A;  4KMU C;  4A3M H;  3H0G H;  3MXU A;  4DR7 Q;  1HTL D;  2ZXO A;  5CGK A;  3PQI A;  5ISR A;  2PNR C;  1IBM Q;  2CVR A;  2X69 A;  4LF8 Q;  4TQU S;  2V1C C;  3UDI A;  3J7Y W;  1G51 A;  1SYC A;  1JT8 A;  1S40 A;  4QMG A;  1E0B A;  2F0W A;  1ESR A;  4AYB G;  3RLN A;  3OTO Q;  5FKA C;  3CD6 A;  3S2H B;  2ZJP A;  3ND9 A;  3S17 B;  1RKN A;  4PG3 A;  3JC6 6;  1KTK A;  2EJM A;  1KRS A;  3A8K E;  2WB1 B;  3D8G A;  4JK1 C;  5FO9 B;  1VQD A;  1TS3 A;  3VR6 A;  3BZC A;  1EWH A;  3FKI H;  1A2T A;  2H1E A;  3CCS A;  2UUA Q;  3PF5 A;  4FDB A;  2MFI A;  4RGM A;  1QB5 D;  1ZKO A;  5M3M H;  3AB9 A;  4I7A A;  4A3D G;  1K83 B;  3DUZ A;  3T56 B;  4KHV A;  3M4Y A;  1XMQ Q;  5C5M A;  1WTX A;  4J6H A;  3OSO A;  2K14 A;  2EDG A;  3R8B A;  4U68 A;  3AYH B;  3URY A;  4LK1 C;  2F4I A;  2Q2H A;  4LF9 Q;  4HJ5 A;  2ZJR A;  1KDA A;  3K5L A;  1E1T A;  4DR2 Q;  3IFD A;  2PZU A;  4O0A A;  4LF4 Q;  3ULL A;  4DV2 Q;  2EYO A;  2XGT A;  3J7Z C;  4R4O A;  1DYQ A;  3PCO B;  5JOB A;  1XTC D;  3DEP A;  2ZTC A;  3KDF A;  5BN5 A;  4MZ9 A;  2E74 C;  3CMA A;  1D2B A;  4RFB A;  2JEA I;  3LX0 A;  1K0R A;  4NXM L;  4FF4 A;  3P1H A;  3NTI A;  4HED A;  1QWY A;  5FLX c;  1SBB B;  1B1Z A;  3TP5 A;  1KL9 A;  2L4N A;  2R92 H;  2HCI A;  1EFI D;  4K14 A;  1GHK A;  1TS4 A;  4GNX B;  1XJV A;  2FFK B;  1WCM G;  3I4M H;  3HOV H;  1IBK L;  5JPN C;  2GA4 B;  3B6Y A;  1BCP C;  3HOX G;  3HKS A;  3C1F A;  4OIK A;  5ELD A;  2Q8R E;  3S1Q H;  5IT9 L;  2QDL A;  1VF5 C;  1QZG A;  4OEM B;  1WOC A;  2B8G A;  1Y69 U;  1GJX A;  5IGB A;  4XQQ A;  3GV6 A;  1Y1W B;  2N55 A;  3S24 A;  2PMZ E;  1YHQ A;  2EYP A;  4O2D A;  5A2Q L;  3BS1 A;  3BU2 A;  2AWO A;  4GOP A;  2F0U A;  2Z0S A;  5NUC A;  1BVS A;  4K2K A;  1UE1 A;  3IL8 A;  2L1B A;  2RDG A;  1B70 B;  3NE5 B;  1HJP A;  1CHQ D;  2YTX A;  2WII B;  3MEH A;  1I94 L;  2E2H B;  2XIW A;  5IGE A;  1SND A;  4JI0 L;  1CTM A;  4DNR B;  3K59 A;  2I5H A;  2PNH A;  4G7O C;  3L7Z C;  5EKK A;  4OWT B;  5M3F H;  4EQP A;  2L0C A;  4IFD I;  1VQJ A;  3V05 A;  1VF7 A;  2K03 A;  4XYQ A;  4ZQ3 A;  1YHA A;  3TZD A;  3QR8 A;  5DM6 3;  2IW3 A;  4DR4 L;  4HIK A;  3EFX D;  3HOY H;  1K73 C;  1HH2 P;  2K1B A;  1ZEQ X;  2FXQ A;  4K2L A;  1Y14 B;  3I4N H;  3VR2 A;  1LTG D;  5I6W A;  3Q8D A;  4R4T A;  1KAB A;  3A0J A;  2UXB L;  4BXX H;  4P72 A;  4CDD C;  5C3W A;  2AHO B;  4H44 C;  3UI2 A;  3S16 B;  4PZ8 A;  4AH6 A;  4LF6 L;  4MTK A;  1OXX K;  3HRZ C;  1XNQ L;  2A6H D;  2WB1 E;  3GQB A;  2EJG C;  3A8J E;  4B3M L;  2ENB A;  2Q2U A;  1WTP A;  1HNW L;  1TWG B;  2I07 B;  1ENC A;  2ZTD A;  2B63 H;  2IWH A;  4L63 B;  2JXM B;  1VDZ A;  3NTH A;  4TVA B;  4EX5 A;  4XQJ A;  3G71 A;  3IRB A;  2MNA A;  4PV1 C;  1W6K A;  5H1S E;  2VQE Q;  1CKN B;  1V1P B;  3K0X A;  2VNU D;  1G91 A;  4LF7 L;  3PO3 H;  1JJG A;  2K5D A;  2OQK A;  2XNA C;  3SK6 A;  1JOR A;  4BBR G;  3TSS A;  4DUZ L;  5C3E B; 
#chains in the Genus database with same CATH homology
 2F0Q A;  1F9P A;  3WDN A;  2QKI C;  1Z6H A;  3BYT B;  2A5H A;  3SR1 A;  1EQT A;  4IAL A;  3PUX A;  2JYO A;  4I65 A;  5EKL A;  1RJT A;  4IUU A;  2B2Y C;  4HCE A;  5E4W C;  4Q5V A;  1CQF A;  4X3K A;  2AUJ D;  1BCP B;  4ODG A;  4ZUJ A;  1B9N A;  2EE1 A;  2FJ2 A;  2NVQ B;  2KVM A;  3CKI B;  2XSC A;  4OO1 H;  2HQE A;  2M9V A;  1F2M A;  2HDL A;  4KD4 A;  4BA2 I;  1CI3 M;  5FK9 C;  2A74 C;  3NP8 A;  2J0T D;  3BYY B;  5JPM C;  2NYZ D;  1AEX A;  3H94 A;  5C6A A;  3NXW A;  1F9Q A;  4C3H B;  3V96 A;  1SE4 A;  2A73 B;  4QUC A;  5C4H A;  1ESF A;  2A68 D;  5JJZ A;  1CA6 A;  1Q12 A;  1AP0 A;  3BG3 A;  2AQ1 B;  4CGY B;  1Z7T A;  5JEA H;  3NQT A;  1I4P A;  2NB0 A;  1O7Y A;  3A7A B;  3U9O A;  3OIQ A;  5G3L D;  3GTJ B;  1JOQ A;  3PV0 A;  5CV5 A;  1S5B D;  4ZKC B;  4HSP A;  1DXM A;  4A3K B;  2DNC A;  1XYI A;  1GOZ A;  5HUR A;  2KQ3 A;  3DM1 A;  3ITP A;  2O5I C;  2JA7 B;  1SYF A;  3TZU A;  3MHB A;  4M1U B;  4FXD A;  2BA0 A;  1U4L A;  1SE2 A;  4KV6 A;  2HCC A;  5C4X B;  3PUV A;  2K32 A;  1YNJ D;  3NBI A;  3TP7 A;  1XXG A;  4R8I A;  5ELF A;  1IL8 A;  2EYL A;  1HFG A;  3AMU A;  4MN3 A;  1CM9 A;  5IT9 E;  4FXG C;  4OL7 A;  3S2D B;  2JEB I;  1BNZ A;  2F0D A;  3D4W A;  4CJ2 C;  4JBW A;  5KNC A;  3SE0 A;  1TY0 A;  4DNT B;  2NBF A;  4BY1 B;  1SMY C;  1LLR D;  2J4X A;  2F0M A;  4HAE A;  4C3J B;  1O78 A;  3HEJ A;  3QWN A;  3M7N A;  3A55 A;  4R9W A;  1LAC A;  4V19 0;  4IUQ A;  1MBY A;  4XT3 B;  3T16 A;  1I6H B;  2K7V A;  3EQL C;  1V1P A;  4EQO A;  1AN8 A;  1A3U A;  2R7Z B;  1PMR A;  1Q3L A;  3T53 B;  5JVH 3;  5EBD A;  1BBX C;  3N6R A;  1H9S B;  4TRD A;  1U9R A;  4L8J A;  1LO5 D;  1TWA B;  3BDL A;  4RHR A;  3RZD B;  2A6E D;  4TSS A;  3SEB A;  2Z1C A;  4C1N I;  1G29 1;  5C0X J;  2IX3 A;  4A3D B;  1S5F D;  3LWE A;  2LY7 A;  3E5S A;  3MC0 B;  2QDB A;  1ONL A;  2ZXP A;  5KGU A;  5CV7 A;  3P7J A;  1EY7 A;  4G4K A;  1V1O A;  4GZY C;  2E2I B;  2KOL A;  1BXT A;  2NZ1 D;  2LKV A;  4NP5 A;  1I50 B;  5I2Y A;  5KIX A;  3HOW B;  4RWS C;  2O4X A;  4FVM A;  1H9K A;  2WIN B;  2BA1 A;  1S4Z A;  5DM7 3;  3WOF A;  4RHS A;  1NR2 A;  3SK8 A;  1GUT A;  3MFY A;  3TP8 A;  2IL8 A;  4K6L A;  1GUN A;  3BVG A;  1KDB A;  5IGG A;  4KKS A;  1CZG A;  1A2U A;  3M4O B;  4ILW A;  2R61 A;  3GTM B;  1TII D;  2ZXR A;  4H13 C;  3G6J B;  5EJW A;  3HOX B;  1FR3 A;  3DMU A;  3VYS A;  2JP1 A;  1PTO H;  3FPP A;  3GP7 A;  1R4P B;  3C2P A;  4N9T A;  3OMC A;  1X3Q A;  5M5Y B;  1SEB D;  1XX8 A;  4I7Z C;  2EVB A;  5D65 A;  1U4M A;  2MJ8 A;  2MUY A;  4K8I A;  4K8J A;  5BN4 A;  2K01 A;  1F2L A;  2F0P A;  4DN4 M;  4O42 A;  1BO0 A;  3ONA B;  1PLF A;  3OMG A;  2KCN A;  2PO4 A;  2RA4 A;  5BN3 A;  1SSO A;  1TT2 A;  5HGT A;  5CR3 A;  4B9W A;  1SYG A;  4DAP A;  2VUM B;  1F2Z A;  3NSW A;  4IN3 A;  4KJO A;  1T5X D;  1WTO A;  4OO1 G;  3ERQ A;  3A54 A;  4XYO A;  3TBI B;  4BBS B;  4PMB A;  4A3E B;  1BOS A;  1OXS C;  4KY7 A;  2F0N A;  1RHP A;  2A6E C;  1PZI D;  3SVM A;  3T4A C;  4QB4 A;  3I4L A;  2MPM A;  2B8F A;  2NVT B;  1SNP A;  2E76 C;  4OHJ A;  1F77 A;  3QO2 A;  1S5E D;  1S5D D;  4IUN A;  5JEA G;  4X3U A;  1RCV D;  2KUM A;  4BBR B;  1H9R A;  1PFM A;  2RQX A;  3C46 A;  4O1N A;  2CW0 D;  3MTS A;  3S1R B;  4ZKB B;  1I3Q B;  3MA2 B;  4LMQ D;  1E2V A;  3ZYY X;  1JQY D;  1VMP A;  3TP6 A;  2X6G A;  5COR A;  1UNS A;  3T51 B;  1S5C D;  1WTQ A;  1H9S A;  3X3M A;  2FMM A;  3K5O A;  3JAM E;  1I4R A;  1G2T A;  2E2D C;  5E4X A;  1JC7 A;  3BDC A;  1B3A A;  5AFW A;  1U4P A;  3D3R A;  3FRP B;  2PW7 A;  2F0L A;  2F3V A;  4IFD J;  2JA5 B;  2F3W A;  3AU7 A;  2KCC A;  1YNN C;  2H4O A;  4EQN A;  4XIG S;  4RKL A;  2F0I A;  1A6X A;  1ML0 D;  3I70 A;  2Y0S B;  1ET9 A;  2KHS A;  3KUP A;  2Z4H A;  1O7L A;  1PZJ D;  5J39 A;  1ILP A;  4A93 B;  1L0Y B;  2ZT9 C;  1DOM A;  2K04 A;  4XXE A;  2WAQ B;  1EYC A;  3CQZ B;  1Q90 A;  1HQM C;  1UEA B;  4RCO A;  5C4J B;  2QEJ C;  4ZK9 B;  3Q0A A;  4UDU C;  1BQQ T;  1B44 D;  2VB3 X;  2VXW A;  1CHP D;  3LWU A;  2B2T C;  2BDN A;  1FGB D;  1STA A;  4A3M B;  3H0G B;  1B4O A;  4E6I A;  3BVM A;  4HMI A;  4DXF A;  1CA5 A;  3BZD B;  3V2T A;  3K58 A;  3NQI A;  4BY7 B;  1GXD C;  2EPB A;  1LV9 A;  2EYM A;  2KEE A;  2HUG A;  3CHB D;  4CKB A;  2WP8 J;  4J8Q A;  4DF7 A;  4RGO S;  1JR0 D;  2F0T A;  4RGT A;  3IFT A;  1DJR D;  1Y8P B;  2KA7 A;  4FF3 A;  1G8Z D;  3FKI B;  4DFA A;  4WFN 3;  1K8O A;  1B2T A;  2A69 C;  2CW0 C;  5M3M B;  1PFN A;  4CKE A;  2TSS A;  1A3V A;  5T1G A;  2D62 A;  2L11 A;  4KD3 A;  1EU3 A;  5KYL A;  1JIC A;  1STB A;  1DON A;  2ICE C;  1DCZ A;  3U9S A;  1RD9 D;  4DK0 A;  1C8C A;  2JSO A;  1C48 A;  3NPP A;  1SMY D;  4OO1 I;  3EVQ A;  3D6W A;  2O2L D;  2QCP X;  1PTO F;  4X3S A;  1ILQ A;  1HPC A;  2K05 A;  4KK7 A;  4B9X A;  4U67 3;  3I91 A;  1PRT F;  3OHX C;  4IZ8 A;  4RA8 A;  3H91 A;  4F87 A;  5K5P A;  3DEO A;  1I4H A;  1WD0 A;  5DAU A;  3TME A;  2R92 B;  5IGD A;  3Q23 A;  1OXV A;  2EJF C;  4KJN A;  3NK9 A;  3HOV B;  2PW5 A;  3MXP A;  1DOL A;  1R4Q B;  2F0F A;  3VR4 A;  4C1N K;  4FF2 A;  2EY5 A;  3S1Q B;  3SXH A;  5C0X G;  1O7Z A;  4DK1 A;  2YYZ A;  2L9H A;  3VYT A;  1ET6 A;  5I4D A;  3HKZ B;  2B2U C;  2SNS A;  2O5J C;  3RD4 A;  3K5N A;  2ID0 A;  4Q0F A;  1G6Z A;  4KI0 A;  5EPL A;  4H0L C;  1H9M A;  1NSN S;  2YU9 B;  1LTT D;  1GUW A;  3FDT A;  4CKC A;  1LT3 D;  5M3F B;  2MP1 A;  4K5W A;  3HGB A;  1LTI D;  1K8M A;  3HOY B;  1EZ6 A;  2F0G A;  4K6D A;  5IGC A;  1Y8N B;  2EYH A;  1D6E C;  4C2M B;  3NTK A;  2BDO A;  3M85 A;  1T5E A;  1D1I A;  4A3I B;  1MD2 D;  1NCV A;  1NAP A;  2NVY B;  3ND8 A;  1JE4 A;  3OPO A;  3VYU A;  4CJ0 B;  4BWG B;  3QOL A;  3NHH A;  4PMW A;  2B63 B;  3H3V C;  4ME5 A;  3F2U A;  3GTK B;  3MZ5 A;  3FMC A;  1FNU A;  1STE A;  1GUG A;  2DY8 A;  4G7H C;  2QF7 A;  3DWA A;  3I8Z A;  2BCO A;  3OOC A;  1LT6 D;  1TR5 A;  3KLR A;  3TDQ A;  2PZW A;  1XWE A;  3HP3 A;  5FOB B;  3JAM L;  4RCN A;  1EWC A;  1BUV T;  2K5W A;  2RKS A;  4IQZ A;  5C4Z A;  1SAP A;  1JB3 A;  4NKL A;  4J1M A;  1SYD A;  5KYI A;  1NUC A;  3MFG A;  5FO7 B;  3DXJ C;  3C1E A;  3DWP A;  3OW7 A;  5IIF A;  4AYB B;  5FO8 B;  1A3T A;  2Q8I B;  1GHJ A;  2WV6 D;  5ELB A;  3A56 A;  5D3I B;  2C5C A;  1PRT D;  1STY A;  2EOT A;  4H7B A;  5LL6 S;  4F88 A;  2JA6 B;  5KNB A;  4IUP A;  2G9D A;  2E75 C;  1EEF D;  1E2W A;  1EL0 A;  2FHT A;  1EYA A;  1DOK A;  2IX0 A;  5I2X A;  1JWS D;  3MVV A;  3SK5 A;  3W3A A;  2NN6 G;  3K57 A;  1QE6 A;  1U4R A;  1FYC A;  3NWT A;  1TWH B;  1ENA A;  1FNV A;  3FEW X;  2XN9 C;  2D5D A;  1DD2 A;  4CBV A;  1ZXT A;  1EYD A;  1STN A;  1WTV A;  3GTG B;  1LT4 D;  3C3L A;  1EIH A;  2IX1 A;  2KJX A;  1HFN A;  1SNO A;  1CFM A;  2AQ3 B;  2EY6 A;  1IYU A;  3W2D A;  4IUV A;  1TS5 A;  1RTO A;  2OXP A;  4A3F B;  5EGT A;  2F0S A;  3T13 A;  1D5M C;  2B2T A;  5KRU A;  2C9O A;  1WCM B;  4OGQ C;  1HQR D;  5M5W B;  2EY2 A;  2WKC A;  1AW7 A;  1ENF A;  5CV8 A;  5C0X H;  3PIP 3;  4UAI A;  1YNN D;  4PNY A;  2PPB C;  1QNU A;  3TN2 A;  1JCK B;  2F0H A;  4ID6 A;  2B2W C;  4XT1 B;  4CHT B;  5ELE A;  2TMP A;  2D9U A;  1RTN A;  2NTS A;  5LL6 X;  1AFP A;  4RH6 A;  4FP5 D;  1TVX A;  2PYK A;  3GO5 A;  4DXG A;  2JA8 B;  3S15 B;  3K0Y A;  1SDF A;  3DWQ A;  1B9M A;  5CYU A;  3J81 L;  1MI2 A;  5EQ0 A;  2HDM A;  2EXZ A;  2XWJ B;  5TSS A;  4HR7 B;  2M2L A;  3Q22 A;  2IJ0 A;  1PTO C;  4C3J G;  5CV6 A;  1IW7 C;  4PQX A;  2B2Y A;  2AQ2 B;  5CMD A;  5EBC A;  2EYJ A;  1QJO A;  5E1F A;  2EYF A;  1PRT C;  1X3P A;  1V8Q A;  3VR3 A;  4DAY A;  1RDP D;  1LT5 D;  2CQA A;  1G2S A;  2F0K A;  2RSN A;  2X6L A;  2D2C C;  4B08 A;  1HA5 A;  4EVO A;  2KEC A;  2E2J B;  1KLG D;  1CT1 D;  2LS0 1;  1GUS A;  4A3J B;  1EEI D;  1AZP A;  5KND A;  1BF4 A;  3GTQ B;  5M5X B;  2IT1 A;  2RSO A;  2Z8L A;  3VR5 A;  2A69 D;  3HZX A;  3KLS X;  1DM0 B;  3PUW A;  1OXT A;  5A35 A;  4RKB A;  1ZYR C;  2EY1 A;  5K36 G;  2RBM A;  2DY7 A;  4N9P A;  2VB2 X;  3D31 A;  2KED A;  4C3I G;  5M9O A;  1KDC A;  2Z4I A;  1TQO A;  2J7Z A;  4KY5 A;  1Q1E A;  3Q6S A;  1LTB D;  2SNM A;  1EZ8 A;  3GTP B;  4ULL A;  2B2U A;  3R2I A;  1WTW A;  1KAA A;  5E3F A;  3MAQ A;  2DNE A;  1UAP A;  3GD7 A;  1SNQ A;  2K33 A;  1LAB A;  5DNF A;  3MWY W;  1E2Z A;  3NWS A;  2XWB B;  3BVZ A;  1UUP A;  1A15 A;  3J7A F;  3NUC A;  2Q8T A;  3M3Y B;  2BOS A;  2NUC A;  3MXN A;  4DAV A;  1J8I A;  4CJ1 B;  1H9J A;  4FYD A;  3A8I E;  1JWU D;  2QIL A;  3K7A B;  4KTA A;  3HOZ B;  3OWE B;  4FNF A;  2XRQ D;  1MGS A;  4BS9 A;  1Y8O B;  1EIG A;  2NN6 I;  1D5X C;  2NN6 H;  5IOD A;  1PTO B;  3J80 E;  4KKT A;  1QG7 A;  2NTT A;  4RAU C;  3SDZ A;  5G3L F;  5CV9 A;  3I3C A;  3K6O A;  4IUR A;  4ZAI A;  1F9S A;  1PRT B;  4G7Z C;  2NVX B;  2K6A A;  5LHY 1;  4ZLT F;  4FXK C;  2L5T A;  1EQV A;  3L9A X;  5D3D A;  2ICI A;  3SHL A;  1JOK A;  4XTC S;  3GTO B;  2PQE A;  1V43 A;  3D4D A;  1KLU D;  1EY0 A;  1OXU A;  1HA6 A;  5CV4 A;  4XQN A;  2BE5 D;  1DZ1 A;  1IKL A;  2M00 A;  5ELC A;  4IFD H;  4QF4 A;  3PMF A;  4WRD A;  4KKU A;  3QIA A;  4L6T B;  2K28 A;  4ZRZ A;  1EY8 A;  1VCI A;  3DHQ A;  3H09 A;  2MGS A;  2B2V C;  3SK4 A;  1I4G A;  4EGV A;  4KHZ A;  4MHE A;  3Q24 A;  3CRK C;  2F1M A;  4LJZ C;  3KBX A;  2PCF B;  1NR4 A;  2R6G A;  2CHB D;  3MXG A;  5KEE A;  1OO9 B;  3PUY A;  5C5L A;  1PZK D;  1O80 A;  2WAC A;  5JEA J;  1IHZ A;  4FO2 A;  5I6Y A;  3WOE A;  1I6V C;  3HG9 A;  1HUN A;  4HCS A;  3IKJ A;  3FVQ A;  3OIP A;  1WD1 A;  1L0X B;  2RVL A;  5FLX L;  1EY6 A;  4S3S A;  4KN7 C;  3RUZ A;  1X32 A;  2PZT A;  3J81 E;  1W6J A;  1GUO A;  1MSH A;  2F03 A;  2MHV A;  1SYE A;  1C4Q A;  4G57 A;  3KBG A;  5T1I A;  5F2D A;  4HMJ A;  1TWF B;  2RDF A;  1I4X A;  2R3Z A;  1SJH D;  3I4M B;  3J7A V;  4KY6 A;  1PXU A;  4ZYS A;  1AZQ A;  1SE3 A;  1M4V A;  1MSG A;  1BR9 A;  1EY4 A;  3E0J A;  4PMC A;  5K36 H;  3VYR A;  2SOB A;  4Z9C B;  3R3O A;  1F9R A;  3M7G A;  1SNM A;  1VMC A;  2B39 A;  4QCL A;  3L3O C;  1FNW A;  4MIU A;  4BA1 I;  1TU2 B;  1WVL A;  3NBH A;  4K5V A;  2B2W A;  4WOR A;  5J1Z A;  1ROD A;  2BE5 C;  5CBE E;  2I46 A;  4IUT A;  4ABN A;  3QG1 A;  2JE6 I;  3HS0 C;  1KNE A;  2AWN A;  4P2C B;  1HCZ A;  4LAA A;  1TY2 A;  1Q8I A;  2NWG A;  1ICW A;  3I90 A;  3IAY A;  1FD7 D;  3D4R A;  3I4N B;  4FF1 A;  1QOH A;  1JOO A;  5IOC A;  1RF2 D;  5EPK A;  5CBA E;  3A7L A;  2XVS A;  2A6H C;  3EA6 A;  4DU9 A;  3ERO A;  4HN7 A;  1BDO A;  1IKM A;  4F7X A;  1KNA A;  2F0O A;  2F0E A;  1BCP F;  4M8A A;  2WKD A;  1STH A;  4TKO B;  1B50 A;  3CRL C;  3BDO A;  3I72 A;  1CZW A;  3PO3 B;  3GV3 A;  4A3G B;  2F0V A;  2XRS D;  1QNK A;  4R8N A;  4V0B A;  2G9H D;  3VA7 A;  3P75 A;  1HRJ A;  2F0J A;  3CU7 A;  3K5M A;  2EZV A;  4HTH A;  4KN4 C;  1JWM D;  1SFO B;  4YIJ A;  3E6Z X;  1D1K A;  1LTR D;  3OWF A;  4NDX A;  2OEO A;  2LFN A;  4OIJ A;  1R9T B;  1TS2 A;  4K5X A;  4QIW B;  4F8M A;  2OT2 A;  4ZUI A;  5A2Q E;  1PTO D;  1IW7 D;  2FIN B;  3QB3 A;  3RZO B;  1I4Q A;  4DA2 A;  1CQV A;  1II3 A;  3RMH A;  1EY5 A;  5EKI A;  4DGZ A;  5IGF A;  3RLF A;  2L12 A;  1Z47 A;  2DN8 A;  5I9P A;  3J80 L;  1J9O A;  1SXT A;  4C3H G;  4X3T A;  2A68 C;  3S1M B;  3LNN A;  3KK7 A;  4NW2 A;  5J22 A;  3H6M A;  2V4D A;  3X3N A;  2K5Q A;  5COY A;  3R93 A;  1WTR A;  1Y1V B;  1HHV A;  4Y7N B;  1Q1B A;  5I9O A;  3I73 A;  1HUM A;  3PIO 3;  4C56 C;  3QJY A;  1PYW D;  1HXY D;  3HOU B;  1PFB A;  1ZYR D;  4C3I B;  3D6C A;  5C44 B;  5DEH A;  3S9W A;  1SYB A;  1F2Y A;  5D14 A;  1PDQ A;  3PO2 B;  2LMC B;  2N88 A;  5JAV A;  5FLX E;  1TWC B;  1STG A;  3G7L A;  1QCB D;  2SDF A;  2SEB D;  1TKW B;  3S14 B;  4IFD G;  4A3B B;  3S1N B;  1QIL A;  3QOJ A;  4NMZ A;  1EY9 A;  5C0X I;  1CK1 A;  2FMC A;  2IPK D;  1YNJ C;  3GTL B;  5EPJ A;  4XDX A;  2RDH A;  1LTA D;  1IYV A;  3FPU B;  4QUF A;  2B2V A;  3O13 A;  1BCP D;  3VA5 A;  5JVG 3;  3P20 A;  1SNC A;  4WJW A;  1M8A A;  2PMZ B;  5CC4 A;  1D5Z C;  1SJE D;  3PUZ A;  1B53 A;  2R93 B;  4HSV A;  3N52 A;  3KF8 A;  1EOT A;  1EU4 A;  1LTS D;  2L55 A;  3R2T A;  5C3X A;  2OF1 A;  2AUK A;  4RGN A;  1HTP A;  3KLS A;  3EJI A;  4KMU C;  3MXU A;  1HTL D;  2ZXO A;  5CGK A;  5ISR A;  2PNR C;  2CVR A;  2X69 A;  4TQU S;  3J7Y W;  1SYC A;  4QMG A;  1E0B A;  2F0W A;  1ESR A;  5FKA C;  3S2H B;  3ND9 A;  3S17 B;  1RKN A;  1KTK A;  2EJM A;  3A8K E;  2WB1 B;  3D8G A;  4JK1 C;  5FO9 B;  1TS3 A;  3VR6 A;  1EWH A;  1A2T A;  2H1E A;  4RGM A;  1QB5 D;  1ZKO A;  3AB9 A;  1K83 B;  3DUZ A;  3T56 B;  4KHV A;  3M4Y A;  5C5M A;  1WTX A;  4J6H A;  3OSO A;  2EDG A;  3R8B A;  4U68 A;  3URY A;  4LK1 C;  2F4I A;  1KDA A;  3K5L A;  3IFD A;  2PZU A;  2EYO A;  1DYQ A;  5JOB A;  1XTC D;  3DEP A;  5BN5 A;  2E74 C;  1D2B A;  4RFB A;  2JEA I;  3LX0 A;  4FF4 A;  3P1H A;  3NTI A;  4HED A;  1QWY A;  1SBB B;  1B1Z A;  3TP5 A;  2L4N A;  2HCI A;  1EFI D;  4K14 A;  1GHK A;  1TS4 A;  2FFK B;  5JPN C;  2GA4 B;  1BCP C;  3C1F A;  4OIK A;  5ELD A;  2Q8R E;  5IT9 L;  1VF5 C;  2B8G A;  1Y69 U;  1GJX A;  5IGB A;  4XQQ A;  3GV6 A;  1Y1W B;  2N55 A;  2EYP A;  5A2Q L;  3BS1 A;  2AWO A;  2F0U A;  5NUC A;  4K2K A;  3IL8 A;  2L1B A;  2RDG A;  3NE5 B;  1CHQ D;  2WII B;  3MEH A;  2E2H B;  2XIW A;  5IGE A;  1SND A;  1CTM A;  4DNR B;  3K59 A;  4G7O C;  3L7Z C;  5EKK A;  4EQP A;  2L0C A;  4IFD I;  3V05 A;  1VF7 A;  2K03 A;  4XYQ A;  4ZQ3 A;  3TZD A;  5DM6 3;  2IW3 A;  3EFX D;  2K1B A;  1ZEQ X;  4K2L A;  3VR2 A;  1LTG D;  5I6W A;  1KAB A;  5C3W A;  4H44 C;  3UI2 A;  3S16 B;  1OXX K;  3HRZ C;  2A6H D;  3GQB A;  2EJG C;  3A8J E;  2ENB A;  1WTP A;  1TWG B;  2I07 B;  1ENC A;  2IWH A;  4L63 B;  2JXM B;  1VDZ A;  3NTH A;  4XQJ A;  4PV1 C;  1W6K A;  1V1P B;  2VNU D;  1G91 A;  2K5D A;  2XNA C;  3SK6 A;  1JOR A;  3TSS A;  5C3E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...