1LT3D

Heat-labile enterotoxin double mutant n40c/g166c
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Crystal structure of heat-labile enterotoxin from Escherichia coli with increased thermostability introduced by an engineered disulfide bond in the A subunit.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 28
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1997-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt3D00
1LT3D 2AQ3B 2TSSA 2NTSA 2XRQD 1M4VA 2AQ2B 1LTBD 2IPKD 4L6TB 1L0XB 3URYA 4UDUC 4RGNA 3EA6A 1CT1D 1D5XC 1FD7D 3BVMA 1XTCD 1D5MC 4RFBA 4RGMA 3BZDB 1LTGD 1EU4A 1HA5A 4RGTA 5ELDA 3BVZA 5ELCA 1I4HA 1KLUD 5I4DA 1S5CD 2RDGA 1TY2A 5D3DA 2SEBD 2O2LD 5FKAC 5ELBA 2AQ1B 1I4XA 1LT5D 1LT4D 1L0YB 3BVGA 3OWEB 1CHQD 1SE4A 1PTOD 1RCVD 1AW7A 1RD9D 1SJED 4RCOA 3MC0B 4TSSA 5TSSA 1S5BD 1HTLD 1LO5D 4ZYSA 1PRTD 1RF2D 5FK9C 4DXFA 1PTOF 2IJ0A 2XN9C 1LTTD 1EU3A 3CHBD 1PTOH 2J4XA 1EEFD 1PZJD 4OHJA 1MD2D 1UNSA 2QEJC 3TSSA 2RDHA 1F77A 1UUPA 1JWUD 1PRTF 4O1NA 1BCPD 4C56C 1DJRD 3R2TA 1XXGA 3DWAA 1B1ZA 1RDPD 1SBBB 1AN8A 1LTRD 1LT6D 3BYYB 5ELEA 1D6EC 2XRSD 3O13A 1ET6A 3SEBA 1BCPF 3MFGA 4RH6A 3R2IA 3DWQA 1LTSD 1BCPC 1KTKA 5D3IB 1LTAD 2QILA 1JR0D 1TY0A 5ELFA 1EEID 2ICIA 4RGOS 1KLGD 1TS4A 1V1PB 1JWMD 1SXTA 1LLRD 1PTOC 1PTOB 1B44D 3R8BA 1ET9A 3GP7A 1QILA 4DXGA 1JCKB 1ESFA 1GOZA 1BXTA 3V05A 1TS3A 1CQVA 1PRTC 1PRTB 1I4QA 1SE3A 1T5XD 2G9HD 1FNUA 4RHRA 1V1PA 1HXYD 1PZID 1SJHD 1FNVA 3DWPA 2NTTA 1S5ED 1V1OA 4BWGB 2XNAC 4L63B 3EFXD 1BCPB 1FGBD 3W2DA 1PYWD 1DYQA 2CHBD 1FNWA 1EWCA 1G8ZD 1I4RA 1CHPD 1I4PA 1SEBD 1SE2A 1JQYD 1I4GA 1JWSD 2R61A 4Z9CB 4K6LA 1CK1A 1D5ZC 2Z8LA 1TS5A 4RHSA 1S5DD 1ENFA 3BYTB 1LTID 1EFID 2WV6D 1PZKD 1TS2A 3KLSX 1STEA 1S5FD 1HQRD
chains in the Genus database with same CATH superfamily
2JA5B 2R92H 2ALYB 3RR5A 5M5XH 3PF4A 3NHHA 2QW7A 4UDUC 3M4OH 1GUSA 2ZXOA 4C3IB 2OWOA 3MVVA 5IYCG 2RSOA 4RFBA 5M3MH 1TWFB 4L8JA 3T16A 1IHZA 3L7ZC 1TVXA 2KQ3A 3SDZA 1SNPA 3I4MG 2MO1A 4GOPC 4AH6A 1JOQA 1L0WA 5JJLA 1IZ6A 2E2IH 4H7BA 3OWEB 2QDBA 1VQ7A 5ELOA 4QCLA 1NMGA 4A3MG 1C8CA 3MC0B 1Z47A 1PFMA 5E4WC 3CF5A 1EY6A 1SYBA 5JPMC 2ZXPA 1LO5D 4ZYSA 2WB1E 3WOEA 4J8QA 2BCOA 5JJIA 3J80E 1RDPD 2HDLA 2LSSA 3RNUA 1QUQB 2JA7G 1QZHA 4WJ4A 2UU9Q 1IL8A 5E1FA 3HOVG 4C1NK 4ODGA 4Y7NH 3W1BA 4P72A 5H1SE 2B39A 4K0KL 4A3EG 2VUMH 1QUQA 2DJGC 4LF9L 2VY3A 2CH4W 4L5TA 3GTPH 1CKOA 3KDFB 1BXTA 1Y8OB 4DR1L 2H5XA 5EKIA 2UUBQ 4I7ZC 2HCIA 3AYHB 2JA5H 1NUCA 1UEBA 4HSVA 1PH9A 4RMFA 2L55A 1PZID 1GUGA 4C3IH 5ISRA 4QUCA 4A3LH 5I9OA 3KDFA 1TWFH 3MA2B 3TMEA 1NY4A 2K5WA 5FLXL 1J9OA 1IKMA 4BY1G 4LWCA 1D5ZC 2JEBI 4RCNA 2SNSA 3AMUA 2DUDA 4K2KA 2NVXB 1SMYD 1BO0A 2EZVA 5LMNL 3E9IA 1A15A 3KLSA 1B50A 3Q8DA 3OIQA 4YCWA 1K28A 1K8OA 2EYFA 1RIPA 1QCBD 2AMCB 1VMCA 4V0BA 3K6OA 1CI3M 1EUJA 1VQ5A 1NMFA 2WFWA 2V4DA 4P73A 2IX1A 4C3HB 2B2TC 1TY2A 3PUZA 2NN6G 1YZ6A 2JJQA 4G7HC 2AUKA 3RN5A 1DM0B 4A93B 2I0QA 1LT5D 1ML0D 1G291 1JC7A 1TQOA 1IBKQ 4LAAA 1CZWA 4ZAIA 2JE6I 3CCMA 4MIUA 2K75A 4FXDA 5IYBG 1Q8IA 3SHLA 5C4XG 3VDYA 2PZWA 5C3EB 1MJCA 1BNZA 2XIWA 3WWVA 4JI6L 2O5JC 5EBCA 1VQGA 2IX0A 4GN4B 4LW1A 2EXDA 2D0OA 3KF8B 3MWYW 3KYHC 3I4NG 2IWHA 2A68D 1Q86C 3M7NA 1HCZA 2XVSA 3D4RA 1IBML 4GKKL 1JE4A 2CW0D 2ICIA 1HRJA 1CKNB 1PYBA 4AYBG 3C1EA 1UAPA 3KF8A 3R8BA 2NVXH 3GP7A 4JI5Q 4DXGA 5JEAG 1HNZL 3SK4A 4KHPL 2Z6KA 3T1HQ 5BR8Q 4LFBL 2A6ED 4HIDA 1DOMA 1HA6A 4QGUA 1T5XD 2JA6B 5FOBB 1W2BA 1CKNA 5CC4A 3KBGA 2A6HC 1NR2A 2JXMB 1MSHA 2RCFA 2R7ZG 5C6AA 5CBAE 1KXLA 4FP5D 2HCCA 5CV6A 4UY8C 1U4RA 4QF4A 2VL6A 3ONAB 4C3HH 3CCJA 3J81E 3I4LA 5C5MA 4TVAB 1TR5A 4N9PA 1S5DD 5G3LD 4RKBA 4K14A 3HOWB 4A93H 1STNA 4KY5A 2VQEQ 1N8RC 3H15A 1JOKA 1K8MA 1SSOA 5GROA 5K36G 3T1YQ 1ZKOA 4OO1G 4IURA 3PGZA 4GS3A 2F0JA 3M9BA 3I73A 4A3DB 2OTJA 1CQFA 1WD0A 2X6GA 1SYEA 5C3EH 3F2CA 3HOZG 1C48A 1SNMA 4O42A 3HKZE 2R7DA 4HR7B 3I90A 4LF7L 2D0PA 1YNJD 5EGTA 4ME5A 5FO8B 4DR6L 3A0JA 5EQ0A 4U673 2R6GA 4WJWA 1MI2A 1EL0A 1U4PA 4NXNL 5HY6A 4JBKA 3Q24A 3RZDB 1YJNA 1SFOH 2WAQG 1D1IA 1N33L 1CSPA 1QOHA 2E8GA 4P75A 4DV0L 1F77A 5A2QE 1PFSA 1BCPD 4IUNA 4NDXA 3GO5A 3DLLA 2JA6H 4UP9A 2B63G 1UEAB 1Y8PB 1ET6A 4DR3L 4IZ8A 3D0FA 1LACA 5IGEA 3CC7A 1NJIC 4LFCQ 4NMZA 1SYFA 2ES2A 4H0LC 2B2YA 3S1MB 1KHIA 1X32A 1EY0A 3RLFA 2DJFC 2QF7A 4R8NA 3RMHA 2MNAA 2E74C 4KKUA 2VW9A 3K5NA 3HOWH 1QILA 2NVYB 1EQTA 1GOZA 2JN4A 5IP7H 4DR7Q 1EOVA 1NCVA 5LMUL 3FKIG 3HEJA 4YWKA 4A3KB 1WCMG 2F3IA 1BVSA 1SAPA 4CDEC 1K83B 3VYUA 4A3DH 5EBDA 3T4AC 3Q6SA 3W2DA 1N34L 1VQ6A 1LTLA 2F0WA 3A74A 4MHEA 4DR4L 1I4RA 2JA9A 1L1OB 2O4XA 2KJXA 2F0OA 1STAA 4OWXB 1KAAA 4LUOA 5GQOA 4K6DA 2KENA 4EX5A 2ZT9C 1ZXTA 2XWBB 4KN4C 3WDNA 1ENCA 4HSPA 1L1OA 3RZDH 1QNKA 4A3BG 3BVMA 1XTCD 4X6AH 2WAQE 2LFNA 1VQJA 2MJ8A 3ER0A 4M1UB 4F8MA 4JI7Q 5E7NA 5FLXc 5ELDA 2KCTA 4A76A 4ZKBB 1QB5D 2F0KA 3L2PA 2K4KA 4IOCA 5CMDA 3UDIA 3PF5A 1HR0W 1MSGA 3F2UA 1JB7A 3CW2C 3JAML 3HS0C 1DCZA 2HHHQ 5AJ3L 3NK9A 1KRSA 1V1QA 1VQDA 4JVZA 5M9OA 5CV4A 4OELB 4OL7A 3S1MH 5JPNC 2UXDQ 2PI2E 1K8AC 2N55A 5IWAQ 1IBLL 2K05A 4BBSG 1XPUA 5FK9C 4DXFA 2XN9C 4O0AA 2EY2A 2X6LA 1Y69U 1XNRL 1II3A 4JI1Q 2RDHA 2NWGA 2B2VA 3EVQA 2MHVA 1YJ9A 4GZYC 2N8NA 4JI5L 1DJRD 5KNBA 3DWAA 4HMIA 4ME3A 3BDCA 2F4VQ 2PMZB 3UDFA 4A3KH 3CCQA 2LXKA 2BOSA 1O7IA 2RHSB 2F1MA 1K83H 3PUVA 5CV9A 1AZPA 4NXML 1UE7A 4JI4Q 1GO3E 1R4QB 4RGOS 4F88A 5C44G 4DR5Q 1V1PB 1JWMD 1TWAB 2F3WA 5COYA 1PTOC 1B44D 1ENAA 2D2CC 1HNWQ 5LL6S 1XNQQ 3I8ZA 3PO2G 1DGSA 4K5WA 4C2MB 1TS3A 1Q7YC 1B70B 3I55A 2G9DA 4ZKCB 3V96A 2B29A 1V1PA 4FO2A 2Z1CA 5CV7A 3NENA 2CFMA 4DAMA 3EFXD 1BCPB 4IFDH 1DYQA 2CHBD 1E1OA 2GVBA 1G8ZD 2Y0SG 3CCVA 4H44C 2H4OA 4Z9CB 5IODA 4EVOA 3G6EA 3ERQA 3CCEA 1WJJA 3A56A 1E2WA 1EY9A 3MZ5A 4JOIC 2MGSA 4IN3A 1O80A 3GTGB 4JI2Q 1N32L 3J81j 3FMCA 4DNTB 3EBEA 4A3FB 4DK1A 5DM63 4R4QA 2HT1A 4XDXA 4DV4L 3RD4A 3DMUA 5ELCA 2EIFA 3S17B 5IYDG 1SNDA 2QA4A 4GOPB 4DNRB 4DV1Q 2X69A 1WTWA 3D3RA 4LF5L 1PLFA 4IUPA 3IFTA 4PMCA 3P20A 1F9PA 2K14A 4P71A 2F0LA 1EYDA 2AUJD 2ZXRA 3BG3A 4A3JB 2F0QA 3M4YA 4GLVB 4TSSA 5KYIA 4GOPA 2R93H 2K01A 4ZLTF 4B3SQ 3JC66 1TWAH 3S15H 1T9HA 1M8AA 2Q8TA 3TREA 4GNXC 4HJ7A 4QJFA 1VQNA 2A6HD 2BH8A 1MD2D 1A63A 4OX9Q 4C2MH 2F0UA 4KLKA 3PV0A 1UUPA 1Y1VB 5EKLA 4B3TQ 2MO0A 3R2TA 1PXUA 3QO2A 5M3FB 1ZYRC 2N3SA 2Z4HA 3GTJB 5ELEA 1Y14B 1YNNC 2B8FA 4UAIA 1VQCA 2K5NA 2M9VA 4C1NI 1N36L 2CCZA 4DV3Q 2KECA 3CCUA 1G6ZA 4BXXG 1J8IA 3S14B 5FO7B 5FJ8G 5KNDA 4X62L 1A3VA 1CZGA 4NP5A 1K0RA 1S4ZA 1VQ4A 1TXYA 4KJNA 1CSQA 1VQMA 3V05A 2TMPA 2JA8G 4JC0A 4RAUC 4CHTB 1SNOA 5I2YA 3GTGH 4YY3Q 3PO3G 1JE5A 1VQBA 3H0GG 4A3FH 2YV5A 5IP9G 1S72A 2EJMA 1U5KA 3DEPA 5C0XH 2XTIA 4J1MA 4MNOA 3S17H 1CHPD 1SEBD 1JQYD 1I4GA 3PIOA 1I3QH 4Q0FA 2F0TA 3L3OC 2WB1G 2QGQA 4LNQA 2WV6D 4X66L 5C4JB 4JW0A 1EOTA 1H9JA 1STEA 3K8AA 2LKVA 3A54A 3UE1A 3HOYB 4A3JH 1GXDC 5T1IA 5G3LF 5M3MG 5E4XA 1AZQA 4LUZA 5IE8A 1EYCA 4RGNA 3C1FA 4HJAA 1FD7D 4IUVA 4RGMA 3T51B 4PG3A 1HA5A 4RGTA 1VS0A 4L5RC 1VCIA 1OXTA 5I4DA 1Y1VH 3MXNB 1K8GA 5M3FH 1AE3A 1XMQL 3GTJH 3Q0AA 1VQEA 1DOKA 5M5WB 1X55A 3CPFA 1U0LA 1JT8A 5GAGC 5DM73 3VR4A 3MXNA 1Z9FA 5CR3A 1CKMA 2D9UA 3S14H 1DONA 4G4KA 1Q12A 4A3MB 1M90C 4Q5VA 4JBJA 3KLRA 1RHPA 4LFAL 2J4XA 3IFDA 3G71A 4OHJA 4DR5L 1X56A 1GKHA 4BY7B 4QQBX 2E2JB 3OW2A 1YHAA 1BBXC 3K57A 4MN3A 2L0CA 2D62A 1QE6A 4YCVA 2EVBA 3F8TA 1PH3A 1BCPF 2EYLA 3KFUA 2JA7B 2VUMG 3H6MA 5D3IB 1KIXA 3HOVB 2SNMA 1EY5A 3H91A 1LLRD 1Q1BA 3L0OA 4JI8Q 3W5OA 3KUPA 3PUYA 2ZJPA 2JA5G 1JCKB 1KD1C 1BQQT 1MHWC 4POGA 5C4JH 4A3EB 1UWVA 3OTOL 3G6JB 1PRTC 4C3IG 3HOYH 1Q8KA 3DUZA 4HJ9A 4IFDJ 2G9HD 4WJ3M 4A3CH 3PSIA 3K0YA 1CA5A 3NEMA 1EYAA 4CJ0B 4B3RL 1D1KA 2ID0A 1PYWD 1RL2A 2B2UC 2DN8A 2RBMA 2R61A 2B2WC 3HP3A 4B3MQ 4RHSA 2HDMA 1EIGA 3BYTB 3QB3A 5L37A 2RDFA 5M5WH 4X64L 1EIYB 1TU2B 2RSNA 3NBHB 4P74A 4BY1B 4XIGS 4FF4A 2XRQD 2L12A 4X3KA 4ZQ3A 1Q82C 2KUMA 3EN2A 3TZUA 1X6OA 1FGUA 5IT9E 4A3MH 1VMPA 3K7UC 2UXBL 3K81C 1B4OA 3NBHA 3CMEA 4B3SL 2PZUA 2O5IC 2EYOA 4KKTA 1KLUD 1OXUA 2VQFQ 1O7ZA 4BY7H 4ZRZA 1STHA 2E2JH 2Q8IB 1KL9A 4GN5A 1ILPA 4IPCA 1I6VC 4LF6L 2IL8A 1PTOD 2JA7H 3J81L 4XT3B 1X3GA 2B3GA 3GD7A 4LF8L 2AKWB 3K5OA 2M2LA 4OWWB 2EYMA 1Y1WG 4IFDI 4CBVA 4EQOA 2JYOA 4DNIA 1PZJD 4ZUIA 4A3EH 2QCPX 4C56C 1PHJA 1M1KC 5C4XB 1VQHA 1HZCA 2F03A 2L9HA 1D6EC 3A7AB 3FRPB 5NUCA 1QVFA 1EIFA 2KOLA 3MFGA 1AP0A 3D8GA 5D65A 2QILA 1TWGB 1S3OA 2E5LL 3KBXA 1B8AA 2K5DA 3HOUG 1IW7C 5HGQA 1BF4A 2HQLA 1EYGA 3MHBA 2KCMA 2LS01 4NKLA 4AYBB 4BY1H 3HKZG 4GKJL 3Q22A 1AEXA 1WTXA 2GVAA 5C0XJ 2DY8A 2LXJA 2Z6BA 1FVIA 3LX0A 5DLQE 4LF4Q 2C5CA 1V1OA 4A4IA 1VQAA 5A2QL 5CYUA 4IJLA 4XQNA 1SE8A 4N8X1 3TP6A 4DV6Q 4NB3A 4PZ6A 1IYUA 4K2LA 4KJOA 1ENFA 2OF1A 3H09A 1EFID 2ATWA 4DV2L 2NN6H 3TEHB 1WTHA 1FJGQ 1K9MC 1CA6A 2UUCQ 5EKKA 3UE0A 1D5XC 1XJVA 1K73C 2UUAQ 1XPOA 4APVA 1STGA 1TWCB 4UP8A 4CGYB 5E3FA 1V43A 2ZM6Q 1YI2A 3OHXC 3CRKC 5I6WA 2CWPA 5C4XH 2O2LD 4RWSC 1X3QA 5CORA 3HOZB 2AQ1B 5FLXE 2AHOB 4GLXA 3BVGA 1LT4D 1SNCA 2WINB 5EPJA 1EY7A 3GTMB 4HCEA 4RCOA 2RQXA 1QZGA 1P8LA 1TWGH 2PQAB 3SXHA 3A5UA 1TIID 1HNXQ 2HIXA 1YITA 3I3CA 3X3MA 1LTTD 5C0XI 4L5SA 2MUYA 4A3IG 3KF6B 1YBYA 3TSSA 1CFMA 1I50B 1F9SA 2WAQB 2FMCA 2PQAA 2F0DA 3SR1A 4CDFC 5JEAH 1SBBB 3BYYB 1LT6D 4JI0Q 1W6JA 4XT1B 5JAVA 4HJ5A 1PV4A 3SEBA 1U4MA 5HGTA 1E3PA 1LM0A 2GN5A 3VYRA 3KF6A 4XQJA 2MPMA 2UU9L 2A69C 2MP1A 4MTNA 1G2SA 4HIMA 3HOWG 4BA2I 1XMOQ 1PTOB 3QR8A 1E1TA 1EY4A 3IL8A 2PW5A 3T53B 1J6QA 2KA7A 2KHSA 3EROA 3E0EA 2F0HA 2UUBL 2QDLA 3NBIA 4JI3Q 3A55A 3LWEA 4JYAQ 4JV5Q 5CBEE 4DUYQ 1TWCH 2PI2A 3FKIB 4BBRG 4X3UA 4C3JB 3PIP3 1H9SB 4OO1H 2F0PA 3NTKA 4YCUA 2FMMA 1I4PA 2Q2IA 1HJPA 4K6LA 1CK1A 4R4CA 4DV5Q 3HOZH 4ID6A 3NWSA 3S24A 3S9WA 3AU7A 2Q2HA 5BN4A 4OONA 3GTMH 1H9SA 3N6RA 1SMXA 2PZTA 3M4QA 2KCNA 3DM3A 2KEDA 4FVMA 3RZOB 3FHWA 2OQKA 4JPBW 2Q8RE 3HZXA 3OYYA 4A3BB 2F0IA 1A2TA 1I50H 1L2FA 2XWJB 2A1AA 2DY7A 1F2ZA 2DGYA 4I65A 5KRUA 4FNFA 2K7VA 1I6HB 2J7ZA 4X65Q 1RCVD 1DZ1A 3STBC 5J39A 2Z6KC 4IUUA 1SRUA 2RA4A 4ABNA 1IBKL 3C46A 1F9QA 4FF3A 1PRTD 2Z9HA 2EXZA 1PTOH 3H3VC 1U9RA 4GNXB 2Q2TA 2OXPA 1I94Q 2PNHA 3JAMi 1UNSA 1JJGA 4BBSB 1H95A 4DK6C 3PMFA 4KHZA 1G2TA 1HFGA 2YTVA 4H02A 1LTRD 2VZAA 4CKBA 4A3GG 3KLWA 4HN7A 4HCSA 4QIWB 5FLMH 3C2PA 3QOLA 1KDAA 3D6CA 4GNXA 1YHQA 5JJZA 2VB3X 3FKIH 3W1GA 4C3JH 1EQRA 3R2IA 2Z4IA 3J81c 1J5EQ 2N88A 5JVH3 3K7AB 3OW7A 1TS4A 1HQMC 3QG1A 1SXTA 2PNRC 4DR2Q 5T1GA 1PH4A 2NVYH 1SYGA 5C44B 1RKNA 2K6AA 1CM9A 4DN4M 1STYA 1DOLA 1X9NA 3GTKB 4DU9A 2UXCQ 5K5PA 3T1HL 5BR8L 2AWOA 4RHRA 2SOBA 5DEHA 3M85A 1JJ2A 1OO9B 1BKBA 3H94A 3ZJYC 4PV1C 1LYLA 1SDFA 4KMUC 3I91A 4N9TA 5KNCA 4B9WA 3RZOH 3F2BA 3RUZA 2UUCL 1O7YA 2HQEA 4DV7Q 1PFNA 2PW7A 2UUAL 1EWCA 2L1BA 1FL0A 3OMCA 1VQ9A 1CTMA 1D7QA 4KY7A 1U4LA 5JOBA 2Y0SB 1MJEA 4I7AA 1I6HH 1RTNA 2NBFA 3ITPA 4BS9A 1B3QA 1F2LA 2RHQB 3B6YA 3MXUA 2VQEL 4FXGC 3AEVA 1SMYC 3C3LA 3CC2A 2ZJRA 4U68A 3T1YL 3I70A 4AQYQ 1VQLA 3R93A 1KABA 4GN3B 1B7YB 4BBSH 4PNYA 1KDCA 1JICA 4NW2A 1NBWA 3QJYA 5C5LA 2R93G 4ZK9B 5M5YB 3OWFA 1SJED 1DD2A 2EYHA 4H13C 5ELNA 3MAQA 4IUQA 4CJ2C 5TSSA 3K7AH 4IPHA 3HOXG 4DKAC 4WFN3 1PTOF 3TP5A 1ICFB 4X3SA 1K0SA 5JEAJ 1A3TA 3UI2A 1B2TA 4OEMB 1WI5A 4PMBA 3QWNA 2N49A 5C44H 3CU7A 3NP8A 3GTKH 2K03A 4TKOB 4O1NA 3CC4A 1P16A 1B1ZA 3TS0A 3F1ZA 2BH2A 2XRSD 5C4ZA 1A8VA 1O78A 2Z0SA 2K28A 4K0KQ 4IQZA 1KTKA 3PQIA 1C7YA 4LFCL 1PYSB 4LF9Q 1E0BA 3NQTA 4M8AA 1WFQA 2FFKB 1L1OC 2KHIA 4DR1Q 3KK7A 2PO4A 5HURA 3TZDA 1CUKA 1CQVA 2ZJQA 1PRTB 1SE3A 4DR7L 3TP7A 2EDGA 3D31A 1NNXA 2Q2UA 1UE6A 2JA8B 1EWIA 5J22A 3V2TA 4BWGB 4DGZA 2PPBC 3PO3B 2VNUD 3GV3A 4KI0A 2PMZE 1WVLA 3K5LA 3A5ZB 5IOCA 2Z8LA 5LMNQ 2EY6A 2L15A 2CQOA 2EOTA 4K8JA 5CV5A 4KD4A 3A7LA 4KK7A 1ASZA 3FVQA 5M5YH 2WB1B 1S5FD 2EJGC 2B2VC 2NTSA 3J80i 4L6TB 3TQYA 3PUXA 3URYA 1F2MA 1L0XB 2B2WA 3M4OB 3J80L 1PH5A 2E2HB 4S3SA 2KHJA 4JI7L 2F4IA 1S5CD 2RDGA 2EJFC 4QUFA 2A69D 1QVGA 1F9RA 1TT2A 3DM1A 2R92G 2A5HA 3SGIA 3I56A 1QG7A 2PCFB 2K5QA 5LHY1 1MKHA 1WYDA 3MXPA 4K5VA 4R9WA 3ERSX 1Q81C 2HHHL 1HTPA 2RKSA 1YNJC 1D8LA 4CDDC 3BU2A 4E6IA 2YYZA 2UXDL 1GUTA 4OO1I 5IWAL 4BXXH 3TP8A 4JI6Q 4R4TA 5J1ZA 2KCCA 3AB9A 4JBWA 1ZEQX 5IT9L 3RLNA 3K59A 2ZTDA 4JI1L 3I4MB 2FHTA 4MTKA 3NUCA 4IPGA 4RKLA 2IHEA 3VYSA 2JA8H 3SK5A 1IBMQ 3IRBA 2F4VL 1LTSD 1BCPC 2ICEC 2B2TA 4JCVE 3SE0A 3PO3H 3MEFA 1JR0D 3U9OA 2CVRA 4JK1C 1YHBA 5IP9H 2NZOA 3EIVA 3PIO3 1KLGD 1HNZQ 4JI4L 4FF1A 3G7LA 4KHPQ 4LFBQ 1EZ6A 3VR2A 3SK6A 3HOYG 3S16B 1SLJA 2KBNA 4A3CG 1HNWL 1XNQL 5EPLA 4ALPA 3JAMc 1I4QA 4R8IA 3NSWA 5FO9B 1H9MA 1FNUA 4POFA 1OTCA 3PUWA 3TDQA 4B9XA 4X3TA 2NTTA 4K5XA 4KN7C 3ULJA 5IGBA 1FGBD 3IAYA 3S2DB 4NPSA 3E0JA 2E2HH 1YNXA 1GUOA 4AQYL 3HFZB 3STBD 4UHVA 1VQKA 1GD7A 3T13A 2C9OA 2RVLA 1TS2A 1NTGA 1A62A 1HQRD 1LT3D 1WTOA 4A3LG 2AQ3B 3BS1A 4JBMA 2TSSA 2IPKD 1LTBD 4V190 2KEEA 2NB0A 2BDNA 4BA1I 1VQFA 5F2DA 4JI2L 1PFBA 4BY7G 1TWHB 2BE5C 1X3PA 3EJIA 2QEXA 3I4OA 3CQZB 3CMAA 1I4HA 4LF7Q 5IYCH 1H9KA 4PMWA 1X65A 2EYJA 3CKIB 1AE2A 1WTRA 2K04A 4DR6Q 5IGCA 1JOOA 1WTPA 1PVOA 3LGJA 2A73B 3I4MH 4DV1L 4ILWA 4NXNQ 2K52A 4J15A 4OWTB 4FF2A 3OPOA 2NZ1D 3LWUA 1N33Q 1C0AA 2M00A 4IUTA 4JG2A 4DV0Q 2F0EA 2YTXA 5BN5A 3S16H 1XYIA 1NR4A 2VXWA 2QEJC 1W6KA 1Y1WB 1PRTF 3NQIA 2JSOA 4IPDA 5I2XA 4OX9L 4DR3Q 1KDBA 2ZTEA 1AN8A 1B3AA 1Q46A 3VR6A 4B3TL 3J81i 3O13A 3UDGA 1HH2P 2HUGA 1BDOA 2NZHA 3U4ZA 4XYQA 3S2DH 3HOVH 5J3BA 2CWAA 2HIVA 4XQQA 4OXPA 4DV3L 1G6PA 5EAYA 2K5HA 3HGBA 3GDEA 1IKLA 1YEZA 3S2HB 2PQEA 1UE1A 5LMUQ 3A8KE 4CKEA 1XPRA 3HOUB 1KC8C 1R4PB 3HKZB 5DNFA 1VF5C 1N34Q 3DWPA 2E75C 2L11A 2EYPA 4QY7A 4DR4Q 1AH9A 1KAWA 4YY3L 2EQSA 1TWHH 3CQZH 1SNQA 3I4NB 1VQPA 4YHHQ 3U9SA 1PH1A 1C9OA 3S1RB 1BBWA 2BDOA 1WTQA 3A8JE 4O2DA 3CXCA 2F3VA 4LJZC 5CGKA 3J7ZC 2OEOA 5IY0A 2RF4A 2OCEA 1LABA 4WORA 1KNEA 2JQOA 3HRZC 5JVG3 3GTQB 4C3HG 4EQPA 1WOCA 1LTGD 1EY8A 1Y8NB 2R7ZB 4A93G 1Y1WH 1XTDA 4J6HA 3ICEA 4KTAA 1HZBA 5AJ3Q 4RA8A 1CHQD 4GLAC 2CKZB 1QVCA 1IXRA 5IGGA 1IBLQ 3OOCA 5IGDA 2FINB 1UE5A 3RLOA 3S1QB 4QL5A 4EQNA 5C3EG 3FPPA 1XNRQ 1ZYRD 3J80c 2FXQA 5KIXA 1YNND 1SFOB 1EEFD 3SK8A 4OIJA 3S2HH 3KOJA 3BJUA 5IYBH 3OSOA 3HOUH 4KY6A 1ONLA 4A3IB 3TRZA 1HHVA 1X54A 5IGFA 2NVQB 2F0MA 3IKJA 3ULLA 4NXMQ 1Q3LA 3X3NA 4FDBA 1PH6A 1Q1EA 4RH6A 3QOJA 4L5QA 4LK1C 1XWEA 4FXKC 1GHJA 2I5LX 3I4NH 4F87A 3SVMA 1JJCB 3S1RH 1YIJA 1ET9A 2JA6G 1ESFA 2E76C 4JI8L 3J7A5 2BA0A 2F0VA 3A8IE 5IT9c 4UP7A 1WD1A 1G51A 1B53A 2CH4A 3M3YB 2PYKA 1GHKA 5C4HA 1O7LA 1SJHD 2LMCB 4UPAA 3GTQH 3I7FA 3P75A 4L63B 5GAEC 2P5ZX 2B63B 2MFIA 3PIPA 1PH8A 5KYLA 2R7ZH 1T5EA 5KEEA 3N52A 5IP7G 4BBRB 2NVTB 2I46A 2F52A 4QB4A 1PH7A 1TS5A 4HMJA 4P2CB 2L5TA 3DHQA 4F7XA 4B3ML 1PZKD 2F0NA 4HAEA 1N32Q 3CCSA 2WACA 3S1QH 2AQ2B 4A3DG 3CAMA 2V1CC 4ZCKA 4LUVA 5CV8A 5I6YA 4DV4Q 4AYBE 4HIOA 2IHFA 5K36H 3ND8A 3BZDB 3H3VH 1EU4A 2R3ZA 3P7JA 1WCMB 3BVZA 2I07B 4EGVA 3NELA 5D3DA 2SEBD 4A3IH 4XTCS 2OT2A 1B9NA 5EPKA 5FKAC 4LF5Q 2NVQH 2VQFL 2J0TD 3OIPA 1QNUA 1L0YB 1YVCA 3GV6A 1SE4A 1IYJB 4DUZQ 3VYTA 1GVPA 1BOSA 3BZCA 1HUMA 4Y52H 3ND9A 1E24A 2E2DC 3K80C 1HUNA 3D4WA 1B9MA 1SN8A 3VR3A 3LNNA 1HR0Q 2K32A 4PZ7A 2VB2X 1EFWA 4JOIA 1D2BA 3ZYYX 3U50C 5FLMG 3AFPA 1A2UA 4KHVA 3M3YH 4C3JG 1N36Q 1SR3A 3E9HA 4WRDA 3HKSA 3AFQA 1E2ZA 3CP0A 3EQLC 4CKCA 3DEOA 4KD3A 1ESRA 4XXEA 1W3SA 2B63H 4A3GB 2OTLA 2D5DA 1R9TB 4X62Q 1ASYA 2FJ2A 1PMRA 2F0GA 1A6XA 4HEDA 4BBRH 2NVTH 1A0IA 3NWTA 3OMGA 3GQBA 2B8GA 4DFAA 1LUZA 2XGTA 1OXXK 1F2YA 4G57A 1WTVA 1JMCA 1LV9A 3TS2A 4YHHL 1IYVA 5IIFA 2JP1A 4A3KG 3CPWA 3FDTA 1NE3A 1NAPA 4KKSA 2BE5D 1S40A 4XYOA 3NTHA 3RN2A 4DK0A 4RG1A 2C35B 2QKIC 2JK8A 4LF4L 2RCNA 3TN2A 1PH2A 1I5FA 1N9WA 4DAYB 2YU9B 1E22A 1WCMH 1Q90A 2ZTCA 3E6ZX 3NTIA 3CD6A 4IOAA 1SE2A 1JWSD 4DV6L 3FP9A 4X66Q 2L4NA 1TKWB 2A19A 1EQVA 4DAPA 2OQ0A 4G7OC 3AQQA 4DAYA 4DF7A 5KGUA 3PO2B 2F0SA 2MQHA 4YIJA 3FPUB 1GJXA 1EZ8A 4IFDG 3K58A 1GM5A 3D6WA 3EA6A 4CDCC 1KNAA 3CCRA 1FJGL 1D5MC 2R7FA 3ULPA 4A3BH 1VQ8A 2AWNA 1HZ9A 1NSNS 1K3BC 1XMQQ 2ZM6L 2A8VA 2IW3A 4DA2A 3F2DA 2GA4B 3E5SA 5LL6X 4YWMA 1I4XA 1PA6A 3I72A 5I9PA 3J7AV 3CCLA 2WP8J 5DAUA 3WOFA 1RD9D 4KV6A 4A3GH 2YTYA 1R9TH 3GTLB 3GTOB 2R93B 1S5BD 1STBA 4LFAQ 1E7ZA 1RF2D 5A35A 4MZ9A 4B08A 3MEHA 1HPCA 2IJ0A 1BBUA 3S15B 2SDFA 4FYDA 1HNXL 3R3OA 5AFWA 3HOXB 2B2YC 2EPBA 4HIKA 4PQXA 1XXGA 1MGSA 1C4QA 2BA1A 1RJTA 1IW7D 4R4IA 1H9RA 3S1NB 4JI0L 1DXMA 2VS1A 2YU9H 5C3XA 1BUVT 1LTAD 2K33A 5ELFA 1JORA 4OGQC 1RODA 4DAVA 1SROA 3M7GA 1KRTA 2H1EA 5C3WA 1E2VA 3OTOQ 4TRDA 1XMOL 1HFNA 1MBYA 3PO2H 4B3RQ 2A74C 4TQUS 2NYZD 3KJPA 1HXYD 2NN6I 2ENBA 1KQSA 3Q23A 4EQ5A 4JI3L 1S5ED 2XNAC 3HG9A 5D14A 5GAHC 3JAME 4JYAL 2I5MX 4JV5L 3NE5B 4DUYL 1GUNA 1VQIA 1FNWA 2IT1A 2XSCA 3P1HA 3G4SA 4HJ8A 2EE1A 4QIWE 3VA7A 3KJOA 2K50A 1K3RA 4R1JA 1I3QB 2IX3A 4X64Q 4OIKA 3L9AX 2A68C 2KVMA 3G48A 4DV5L 4IJHA 2CW0C 2N78A 2ASBA 4A3FG 3MFYA 1AFPA 1M4VA 1MIUA 5GADC 3GTLH 3GTOH 2WKDA 1VDZA 5C0XG 2UXBQ 4DUZL 1CT1D 4N8FA 2A6EC 3BDOA 4HTHA 4ZUJA 4ULLA 2DNEA 4QMGA 3T56B 3H0GB 1FYCA 3HOXH 2DNCA 3FEWX 1QWYA 1HR0L 5ELBA 4A3JG 1Z7TA 4LF6Q 5IYDH 3NPPA 3TBIB 1V9PA 1V8QA 3BZKA 1EIHA 3S1NH 2B2UA 1AW7A 4LF8Q 2R92B 3MXGA 5M5XB 1ICWA 4X65L 2Y0SE 3DXJC 1HTLD 5JJKA 1VQOA 3D4DA 3M4PA 1X3FA 1Y1VG 4DK3C 3U58A 1EU3A 3CHBD 5M3MB 4R4OA 5M3FG 1BR9A 3QIAA 2HD3A 1A3UA 3VA5A 4PZ8A 1JWUD 1IL2A 1YJWA 1I94L 3K0XA 2F0FA 3BDLA 5EJWA 3I2ZA 2E2IB 2IY5B 1OXSC 2JEAI 1PDQA 4DPGA 2E5LQ 1EQQA 3CRLC 3UDXA 1QJOA 3DWQA 1HZAA 1TY0A 1OXVA 1EEID 3W3AA 3VR5A 4LMQD 1J5EL 2EY5A 1RTOA 3MTSA 3H3VI 3NXWA 2WIIB 1GUWA 4GKJQ 1EWHA 1SYCA 1X3EA 5FJ8H 4DR2L 3U4VA 2WKCA 3J7AF 5LMNW 1Z6HA 2LY7A 3PCOB 3E3XA 4G7ZC 2UXCL 2G5DA 1FNVA 4GKKQ 1VF7A 4IO9A 2EY1A 3J7YW 1SYDA 4AIMA 2K5VA 1XX8A 4Y7NB 1ILQA 3H0GH 1JB3A 4K8IA 2I5HA 1FR3A 4A75A 2CQAA 2K1BA 4DV7L 2VUMB 4YWLA 2NUCA 4DV2Q 4IALA 1LTID 4CJ1B 3GTPB 1G91A 3K5MA 3KLSX 5BN3A
chains in the Genus database with same CATH topology
2JA5B 3NHHA 4UDUC 1GUSA 2ZXOA 4C3IB 3MVVA 2RSOA 4RFBA 1TWFB 4L8JA 3T16A 1IHZA 3L7ZC 1TVXA 2KQ3A 3SDZA 1SNPA 1JOQA 4H7BA 3OWEB 2QDBA 4QCLA 1C8CA 3MC0B 1Z47A 1PFMA 5E4WC 1EY6A 1SYBA 5JPMC 2ZXPA 1LO5D 4ZYSA 3WOEA 4J8QA 2BCOA 3J80E 1RDPD 2HDLA 1IL8A 5E1FA 4C1NK 4ODGA 2B39A 1BXTA 1Y8OB 5EKIA 4I7ZC 2HCIA 1NUCA 4HSVA 2L55A 1PZID 1GUGA 5ISRA 4QUCA 5I9OA 3MA2B 3TMEA 2K5WA 5FLXL 1J9OA 1IKMA 1D5ZC 2JEBI 4RCNA 2SNSA 3AMUA 4K2KA 2NVXB 1SMYD 1BO0A 2EZVA 1A15A 3KLSA 1B50A 3OIQA 1K8OA 2EYFA 1QCBD 1VMCA 4V0BA 3K6OA 1CI3M 2V4DA 2IX1A 4C3HB 2B2TC 1TY2A 3PUZA 2NN6G 4G7HC 2AUKA 1DM0B 4A93B 1LT5D 1ML0D 1G291 1JC7A 1TQOA 4LAAA 1CZWA 4ZAIA 2JE6I 4MIUA 4FXDA 1Q8IA 3SHLA 2PZWA 5C3EB 1BNZA 2XIWA 2O5JC 5EBCA 2IX0A 3MWYW 2IWHA 2A68D 3M7NA 1HCZA 2XVSA 3D4RA 1JE4A 2CW0D 2ICIA 1HRJA 3C1EA 1UAPA 3KF8A 3R8BA 3GP7A 4DXGA 5JEAG 3SK4A 2A6ED 1HA6A 1DOMA 1T5XD 2JA6B 5FOBB 5CC4A 3KBGA 2A6HC 1NR2A 2JXMB 1MSHA 5C6AA 5CBAE 4FP5D 2HCCA 5CV6A 1U4RA 4QF4A 3ONAB 3J81E 5C5MA 3I4LA 1TR5A 4N9PA 1S5DD 5G3LD 4RKBA 4K14A 3HOWB 1STNA 4KY5A 1JOKA 1K8MA 1SSOA 5K36G 1ZKOA 4OO1G 4IURA 2F0JA 3I73A 4A3DB 1CQFA 1WD0A 2X6GA 1SYEA 1C48A 1SNMA 4O42A 4HR7B 3I90A 1YNJD 5EGTA 4ME5A 5FO8B 5EQ0A 4U673 2R6GA 4WJWA 1MI2A 1EL0A 1U4PA 3Q24A 3RZDB 1D1IA 1QOHA 1F77A 5A2QE 1BCPD 4IUNA 4NDXA 3GO5A 1UEAB 1Y8PB 1ET6A 4IZ8A 1LACA 5IGEA 4NMZA 1SYFA 4H0LC 2B2YA 3S1MB 1X32A 1EY0A 3RLFA 2QF7A 4R8NA 3RMHA 2E74C 4KKUA 3K5NA 1QILA 2NVYB 1EQTA 1GOZA 1NCVA 3HEJA 4A3KB 1SAPA 1K83B 3VYUA 5EBDA 3T4AC 3Q6SA 3W2DA 2F0WA 4MHEA 1I4RA 2O4XA 2KJXA 2F0OA 1STAA 1KAAA 4K6DA 2ZT9C 1ZXTA 2XWBB 4KN4C 3WDNA 1ENCA 4HSPA 1QNKA 3BVMA 1XTCD 2LFNA 2MJ8A 4M1UB 4F8MA 5ELDA 4ZKBB 1QB5D 2F0KA 5CMDA 1MSGA 3F2UA 3JAML 3HS0C 1DCZA 3NK9A 5M9OA 5CV4A 4OL7A 5JPNC 2N55A 2K05A 5FK9C 4DXFA 2XN9C 2EY2A 2X6LA 1Y69U 1II3A 2RDHA 2NWGA 2B2VA 3EVQA 2MHVA 4GZYC 1DJRD 5KNBA 3DWAA 4HMIA 3BDCA 2PMZB 2BOSA 2F1MA 3PUVA 5CV9A 1AZPA 1R4QB 4RGOS 4F88A 1V1PB 1JWMD 1TWAB 2F3WA 5COYA 1PTOC 1B44D 1ENAA 2D2CC 5LL6S 3I8ZA 4K5WA 4C2MB 1TS3A 2G9DA 4ZKCB 3V96A 1V1PA 4FO2A 2Z1CA 5CV7A 3EFXD 1BCPB 4IFDH 1DYQA 2CHBD 1G8ZD 4H44C 2H4OA 4Z9CB 5IODA 4EVOA 3ERQA 3A56A 1E2WA 1EY9A 3MZ5A 2MGSA 4IN3A 1O80A 3GTGB 3FMCA 4DNTB 4A3FB 4DK1A 5DM63 4XDXA 3RD4A 3DMUA 5ELCA 3S17B 1SNDA 4DNRB 2X69A 1WTWA 3D3RA 1PLFA 4IUPA 3IFTA 4PMCA 3P20A 1F9PA 4A3JB 2F0LA 1EYDA 2AUJD 2ZXRA 3BG3A 2F0QA 3M4YA 4TSSA 5KYIA 2K01A 4ZLTF 1M8AA 2Q8TA 2A6HD 1MD2D 2F0UA 3PV0A 1UUPA 1Y1VB 5EKLA 3R2TA 1PXUA 3QO2A 5M3FB 1ZYRC 2Z4HA 3GTJB 5ELEA 1YNNC 2B8FA 4UAIA 2M9VA 4C1NI 2KECA 1G6ZA 1J8IA 3S14B 5FO7B 5KNDA 1A3VA 1CZGA 4NP5A 1S4ZA 4KJNA 3V05A 2TMPA 4RAUC 4CHTB 1SNOA 5I2YA 2EJMA 3DEPA 5C0XH 4J1MA 1CHPD 1SEBD 1JQYD 1I4GA 4Q0FA 2F0TA 3L3OC 2WV6D 5C4JB 1EOTA 1H9JA 1STEA 2LKVA 3A54A 3HOYB 1GXDC 5T1IA 5G3LF 1AZQA 5E4XA 1EYCA 4RGNA 3C1FA 1FD7D 4IUVA 4RGMA 3T51B 1HA5A 4RGTA 1VCIA 1OXTA 5I4DA 3Q0AA 1DOKA 5M5WB 5DM73 3VR4A 3MXNA 5CR3A 2D9UA 1DONA 4G4KA 1Q12A 4A3MB 4Q5VA 3KLRA 1RHPA 2J4XA 3IFDA 4OHJA 4BY7B 2E2JB 1BBXC 3K57A 4MN3A 2L0CA 2D62A 1QE6A 2EVBA 1BCPF 2EYLA 2JA7B 3H6MA 5D3IB 3HOVB 2SNMA 1EY5A 3H91A 1LLRD 1Q1BA 3KUPA 3PUYA 1JCKB 1BQQT 4A3EB 3G6JB 1PRTC 4C3IG 3DUZA 4IFDJ 2G9HD 3K0YA 1CA5A 1EYAA 4CJ0B 1D1KA 2ID0A 1PYWD 2B2UC 2DN8A 2RBMA 2R61A 2B2WC 3HP3A 4RHSA 2HDMA 1EIGA 3BYTB 3QB3A 2RDFA 1TU2B 2RSNA 4BY1B 4XIGS 4FF4A 2XRQD 2L12A 4X3KA 4ZQ3A 2KUMA 3TZUA 5IT9E 1VMPA 2O5IC 1B4OA 3NBHA 2PZUA 2EYOA 4KKTA 1KLUD 1OXUA 1O7ZA 4ZRZA 1STHA 2Q8IB 1ILPA 1I6VC 2IL8A 1PTOD 3J81L 4XT3B 3GD7A 3K5OA 2M2LA 2EYMA 4IFDI 4CBVA 4EQOA 2JYOA 1PZJD 4ZUIA 2QCPX 4C56C 5C4XB 2F03A 2L9HA 1D6EC 3A7AB 3FRPB 5NUCA 2KOLA 3MFGA 1AP0A 3D8GA 5D65A 2QILA 1TWGB 3KBXA 2K5DA 1IW7C 1BF4A 3MHBA 2LS01 4NKLA 4AYBB 3Q22A 1AEXA 1WTXA 5C0XJ 2DY8A 3LX0A 2C5CA 1V1OA 5A2QL 5CYUA 4XQNA 3TP6A 1IYUA 4K2LA 4KJOA 1ENFA 2OF1A 3H09A 1EFID 2NN6H 1CA6A 5EKKA 1D5XC 1STGA 1TWCB 4CGYB 5E3FA 1V43A 3OHXC 3CRKC 5I6WA 2O2LD 4RWSC 1X3QA 5CORA 3HOZB 2AQ1B 5FLXE 3BVGA 1LT4D 1SNCA 2WINB 5EPJA 1EY7A 3GTMB 4HCEA 4RCOA 2RQXA 3SXHA 1TIID 3I3CA 3X3MA 1LTTD 5C0XI 2MUYA 3TSSA 1CFMA 1I50B 1F9SA 2WAQB 2FMCA 2F0DA 3SR1A 5JEAH 1SBBB 3BYYB 1LT6D 1W6JA 4XT1B 5JAVA 3SEBA 1U4MA 5HGTA 3VYRA 4XQJA 2MPMA 2A69C 2MP1A 1G2SA 4BA2I 1PTOB 1EY4A 3IL8A 2PW5A 3T53B 2KA7A 2KHSA 3EROA 2F0HA 3NBIA 3A55A 3LWEA 5CBEE 3FKIB 4C3JB 4X3UA 3PIP3 1H9SB 4OO1H 2F0PA 3NTKA 2FMMA 1I4PA 4K6LA 1CK1A 4ID6A 3NWSA 3S9WA 3AU7A 5BN4A 1H9SA 3N6RA 2PZTA 2KCNA 2KEDA 4FVMA 3RZOB 2Q8RE 3HZXA 4A3BB 2F0IA 1A2TA 2XWJB 2DY7A 1F2ZA 4I65A 5KRUA 4FNFA 2K7VA 1I6HB 2J7ZA 1RCVD 1DZ1A 5J39A 4IUUA 2RA4A 4ABNA 3C46A 1F9QA 4FF3A 1PRTD 2EXZA 1PTOH 3H3VC 1U9RA 2OXPA 1UNSA 4BBSB 3PMFA 4KHZA 1G2TA 1HFGA 1LTRD 4CKBA 4HN7A 4HCSA 4QIWB 3C2PA 3QOLA 1KDAA 3D6CA 5JJZA 2VB3X 3R2IA 2Z4IA 2N88A 5JVH3 3K7AB 3OW7A 1TS4A 1HQMC 3QG1A 1SXTA 2PNRC 5T1GA 1SYGA 5C44B 1RKNA 2K6AA 1CM9A 4DN4M 1STYA 1DOLA 3GTKB 4DU9A 5K5PA 2AWOA 4RHRA 2SOBA 5DEHA 3M85A 1OO9B 3H94A 4PV1C 5KNCA 1SDFA 4KMUC 3I91A 4N9TA 4B9WA 3RUZA 1O7YA 2HQEA 1PFNA 2PW7A 1EWCA 2L1BA 3OMCA 1CTMA 4KY7A 1U4LA 5JOBA 2Y0SB 1RTNA 2NBFA 3ITPA 4BS9A 1F2LA 3MXUA 4FXGC 1SMYC 3C3LA 4U68A 3I70A 3R93A 1KABA 4PNYA 1KDCA 1JICA 4NW2A 3QJYA 5C5LA 4ZK9B 5M5YB 3OWFA 1SJED 1DD2A 2EYHA 4H13C 3MAQA 4IUQA 4CJ2C 5TSSA 4WFN3 1PTOF 3TP5A 4X3SA 5JEAJ 1A3TA 3UI2A 1B2TA 4PMBA 3QWNA 3CU7A 3NP8A 2K03A 4TKOB 4O1NA 1B1ZA 2XRSD 5C4ZA 1O78A 2K28A 4IQZA 1KTKA 1E0BA 3NQTA 4M8AA 2FFKB 3KK7A 2PO4A 5HURA 3TZDA 1CQVA 1PRTB 1SE3A 3TP7A 2EDGA 3D31A 2JA8B 5J22A 3V2TA 4BWGB 4DGZA 2PPBC 3PO3B 2VNUD 3GV3A 4KI0A 1WVLA 3K5LA 5IOCA 2Z8LA 2EY6A 2EOTA 4K8JA 5CV5A 4KD4A 3A7LA 4KK7A 3FVQA 2WB1B 1S5FD 2EJGC 2B2VC 2NTSA 4L6TB 3PUXA 3URYA 1F2MA 1L0XB 2B2WA 3M4OB 3J80L 2E2HB 4S3SA 2F4IA 1S5CD 2RDGA 2EJFC 4QUFA 2A69D 1F9RA 1TT2A 3DM1A 2A5HA 1QG7A 2PCFB 2K5QA 5LHY1 3MXPA 4K5VA 4R9WA 1HTPA 2RKSA 1YNJC 4E6IA 2YYZA 1GUTA 4OO1I 3TP8A 5J1ZA 2KCCA 3AB9A 4JBWA 1ZEQX 5IT9L 3K59A 3I4MB 2FHTA 3NUCA 4RKLA 3VYSA 3SK5A 1LTSD 1BCPC 2ICEC 2B2TA 3SE0A 1JR0D 3U9OA 2CVRA 4JK1C 3PIO3 1KLGD 4FF1A 3G7LA 1EZ6A 3VR2A 3SK6A 3S16B 5EPLA 1I4QA 4R8IA 3NSWA 5FO9B 1H9MA 1FNUA 3PUWA 3TDQA 4B9XA 4X3TA 2NTTA 4K5XA 4KN7C 5IGBA 1FGBD 3IAYA 3S2DB 3E0JA 1GUOA 3T13A 2C9OA 2RVLA 1TS2A 1HQRD 1LT3D 1WTOA 2AQ3B 3BS1A 2TSSA 2IPKD 1LTBD 4V190 2KEEA 2NB0A 2BDNA 4BA1I 5F2DA 1PFBA 1TWHB 2BE5C 1X3PA 3EJIA 3CQZB 1I4HA 1H9KA 4PMWA 3CKIB 2EYJA 1WTRA 2K04A 5IGCA 1JOOA 1WTPA 2A73B 4ILWA 4FF2A 3OPOA 2NZ1D 3LWUA 2M00A 4IUTA 2F0EA 5BN5A 1XYIA 1NR4A 2VXWA 2QEJC 1W6KA 1Y1WB 1PRTF 3NQIA 2JSOA 5I2XA 1KDBA 1AN8A 1B3AA 3VR6A 3O13A 2HUGA 1BDOA 4XYQA 4XQQA 3HGBA 1IKLA 3S2HB 2PQEA 3A8KE 4CKEA 3HOUB 1R4PB 3HKZB 5DNFA 1VF5C 3DWPA 2E75C 2L11A 2EYPA 1SNQA 3I4NB 3U9SA 3S1RB 2BDOA 1WTQA 3A8JE 2F3VA 4LJZC 5CGKA 2OEOA 4WORA 1LABA 1KNEA 3HRZC 5JVG3 3GTQB 4C3HG 4EQPA 1LTGD 1EY8A 1Y8NB 2R7ZB 4J6HA 4KTAA 4RA8A 1CHQD 5IGGA 3OOCA 5IGDA 2FINB 3S1QB 4EQNA 3FPPA 1ZYRD 5KIXA 1YNND 1SFOB 1EEFD 3SK8A 4OIJA 3OSOA 4KY6A 1ONLA 4A3IB 1HHVA 5IGFA 2NVQB 2F0MA 3IKJA 1Q3LA 3X3NA 1Q1EA 4RH6A 3QOJA 4LK1C 1XWEA 4FXKC 1GHJA 4F87A 3SVMA 1ET9A 1ESFA 2E76C 2BA0A 2F0VA 3A8IE 1WD1A 1B53A 3M3YB 2PYKA 1GHKA 5C4HA 1O7LA 1SJHD 2LMCB 3P75A 4L63B 2B63B 5KYLA 1T5EA 5KEEA 3N52A 2NVTB 4BBRB 2I46A 4QB4A 1TS5A 4HMJA 4P2CB 2L5TA 3DHQA 4F7XA 1PZKD 2F0NA 4HAEA 2WACA 2AQ2B 5CV8A 5I6YA 5K36H 3ND8A 3BZDB 1EU4A 2R3ZA 3P7JA 1WCMB 3BVZA 2I07B 4EGVA 5D3DA 2SEBD 4XTCS 2OT2A 1B9NA 5EPKA 5FKAC 2J0TD 3OIPA 1QNUA 1L0YB 3GV6A 1SE4A 3VYTA 1BOSA 1HUMA 3ND9A 2E2DC 1HUNA 3D4WA 1B9MA 3VR3A 3LNNA 2K32A 2VB2X 1D2BA 3ZYYX 1A2UA 4KHVA 4C3JG 4WRDA 1E2ZA 3EQLC 4CKCA 3DEOA 4KD3A 1ESRA 4XXEA 4A3GB 2D5DA 1R9TB 2FJ2A 1PMRA 2F0GA 1A6XA 4HEDA 3NWTA 3OMGA 3GQBA 2B8GA 4DFAA 4G57A 1OXXK 1F2YA 1WTVA 1LV9A 1IYVA 5IIFA 2JP1A 3FDTA 1NAPA 4KKSA 2BE5D 4XYOA 3NTHA 4DK0A 2QKIC 3TN2A 2YU9B 3NTIA 1Q90A 3E6ZX 1SE2A 1JWSD 2L4NA 1TKWB 1EQVA 4DAPA 4G7OC 4DAYA 4DF7A 5KGUA 3PO2B 2F0SA 4YIJA 1GJXA 3FPUB 1EZ8A 4IFDG 3K58A 3D6WA 3EA6A 1KNAA 1D5MC 2AWNA 1NSNS 2IW3A 4DA2A 2GA4B 3E5SA 5LL6X 1I4XA 3I72A 5I9PA 3J7AV 2WP8J 5DAUA 3WOFA 1RD9D 4KV6A 3GTLB 3GTOB 2R93B 1S5BD 1STBA 1RF2D 5A35A 4B08A 3MEHA 1HPCA 2IJ0A 3S15B 2SDFA 4FYDA 3R3OA 5AFWA 3HOXB 2B2YC 2EPBA 4PQXA 1XXGA 1MGSA 1C4QA 2BA1A 1RJTA 1IW7D 1H9RA 3S1NB 1DXMA 5C3XA 1BUVT 1LTAD 2K33A 5ELFA 1JORA 4OGQC 1RODA 4DAVA 3M7GA 2H1EA 5C3WA 1E2VA 4TRDA 1HFNA 1MBYA 2A74C 4TQUS 2NYZD 1HXYD 2NN6I 2ENBA 3Q23A 1S5ED 2XNAC 3HG9A 5D14A 3JAME 3NE5B 1GUNA 1FNWA 2IT1A 2XSCA 3P1HA 2EE1A 3VA7A 2IX3A 1I3QB 4OIKA 3L9AX 2A68C 2KVMA 2CW0C 3MFYA 1AFPA 1M4VA 2WKDA 1VDZA 5C0XG 1CT1D 2A6EC 3BDOA 4HTHA 4ZUJA 4ULLA 2DNEA 4QMGA 3T56B 3H0GB 1FYCA 2DNCA 3FEWX 1QWYA 5ELBA 1Z7TA 3NPPA 3TBIB 1V8QA 1EIHA 2B2UA 1AW7A 2R92B 3MXGA 5M5XB 1ICWA 3DXJC 1HTLD 3D4DA 1EU3A 3CHBD 5M3MB 1BR9A 3QIAA 3VA5A 1A3UA 1JWUD 2F0FA 3BDLA 5EJWA 2E2IB 1OXSC 2JEAI 1PDQA 3CRLC 1QJOA 3DWQA 1TY0A 1OXVA 1EEID 3W3AA 3VR5A 4LMQD 2EY5A 1RTOA 3MTSA 3NXWA 2WIIB 1GUWA 1EWHA 1SYCA 2WKCA 3J7AF 1Z6HA 2LY7A 4G7ZC 1FNVA 1VF7A 2EY1A 3J7YW 1SYDA 4Y7NB 1XX8A 1ILQA 1JB3A 4K8IA 1FR3A 2CQAA 2K1BA 2VUMB 2NUCA 4IALA 1LTID 4CJ1B 3GTPB 1G91A 3K5MA 3KLSX 5BN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT3 D;  2AQ3 B;  2TSS A;  2NTS A;  2XRQ D;  1M4V A;  2AQ2 B;  1LTB D;  2IPK D;  4L6T B;  1L0X B;  3URY A;  4UDU C;  4RGN A;  3EA6 A;  1CT1 D;  1D5X C;  1FD7 D;  3BVM A;  1XTC D;  1D5M C;  4RFB A;  4RGM A;  3BZD B;  1LTG D;  1EU4 A;  1HA5 A;  4RGT A;  5ELD A;  3BVZ A;  5ELC A;  1I4H A;  1KLU D;  5I4D A;  1S5C D;  2RDG A;  1TY2 A;  5D3D A;  2SEB D;  2O2L D;  5FKA C;  5ELB A;  2AQ1 B;  1I4X A;  1LT5 D;  1LT4 D;  1L0Y B;  3BVG A;  3OWE B;  1CHQ D;  1SE4 A;  1PTO D;  1RCV D;  1AW7 A;  1RD9 D;  1SJE D;  4RCO A;  3MC0 B;  4TSS A;  5TSS A;  1S5B D;  1HTL D;  1LO5 D;  4ZYS A;  1PRT D;  1RF2 D;  5FK9 C;  4DXF A;  1PTO F;  2IJ0 A;  2XN9 C;  1LTT D;  1EU3 A;  3CHB D;  1PTO H;  2J4X A;  1EEF D;  1PZJ D;  4OHJ A;  1MD2 D;  1UNS A;  2QEJ C;  3TSS A;  2RDH A;  1F77 A;  1UUP A;  1JWU D;  1PRT F;  4O1N A;  1BCP D;  4C56 C;  1DJR D;  3R2T A;  1XXG A;  3DWA A;  1B1Z A;  1RDP D;  1SBB B;  1AN8 A;  1LTR D;  1LT6 D;  3BYY B;  5ELE A;  1D6E C;  2XRS D;  3O13 A;  1ET6 A;  3SEB A;  1BCP F;  3MFG A;  4RH6 A;  3R2I A;  3DWQ A;  1LTS D;  1BCP C;  1KTK A;  5D3I B;  1LTA D;  2QIL A;  1JR0 D;  1TY0 A;  5ELF A;  1EEI D;  2ICI A;  4RGO S;  1KLG D;  1TS4 A;  1V1P B;  1JWM D;  1SXT A;  1LLR D;  1PTO C;  1PTO B;  1B44 D;  3R8B A;  1ET9 A;  3GP7 A;  1QIL A;  4DXG A;  1JCK B;  1ESF A;  1GOZ A;  1BXT A;  3V05 A;  1TS3 A;  1CQV A;  1PRT C;  1PRT B;  1I4Q A;  1SE3 A;  1T5X D;  2G9H D;  1FNU A;  4RHR A;  1V1P A;  1HXY D;  1PZI D;  1SJH D;  1FNV A;  3DWP A;  2NTT A;  1S5E D;  1V1O A;  4BWG B;  2XNA C;  4L63 B;  3EFX D;  1BCP B;  1FGB D;  3W2D A;  1PYW D;  1DYQ A;  2CHB D;  1FNW A;  1EWC A;  1G8Z D;  1I4R A;  1CHP D;  1I4P A;  1SEB D;  1SE2 A;  1JQY D;  1I4G A;  1JWS D;  2R61 A;  4Z9C B;  4K6L A;  1CK1 A;  1D5Z C;  2Z8L A;  1TS5 A;  4RHS A;  1S5D D;  1ENF A;  3BYT B;  1LTI D;  1EFI D;  2WV6 D;  1PZK D;  1TS2 A;  3KLS X;  1STE A;  1S5F D;  1HQR D; 
#chains in the Genus database with same CATH topology
 2JA5 B;  2R92 H;  2ALY B;  3RR5 A;  5M5X H;  3PF4 A;  3NHH A;  2QW7 A;  4UDU C;  3M4O H;  1GUS A;  2ZXO A;  4C3I B;  2OWO A;  3MVV A;  5IYC G;  2RSO A;  4RFB A;  5M3M H;  1TWF B;  4L8J A;  3T16 A;  1IHZ A;  3L7Z C;  1TVX A;  2KQ3 A;  3SDZ A;  1SNP A;  3I4M G;  2MO1 A;  4GOP C;  4AH6 A;  1JOQ A;  1L0W A;  5JJL A;  1IZ6 A;  2E2I H;  4H7B A;  3OWE B;  2QDB A;  1VQ7 A;  5ELO A;  4QCL A;  1NMG A;  4A3M G;  1C8C A;  3MC0 B;  1Z47 A;  1PFM A;  5E4W C;  3CF5 A;  1EY6 A;  1SYB A;  5JPM C;  2ZXP A;  1LO5 D;  4ZYS A;  2WB1 E;  3WOE A;  4J8Q A;  2BCO A;  5JJI A;  3J80 E;  1RDP D;  2HDL A;  2LSS A;  3RNU A;  1QUQ B;  2JA7 G;  1QZH A;  4WJ4 A;  2UU9 Q;  1IL8 A;  5E1F A;  3HOV G;  4C1N K;  4ODG A;  4Y7N H;  3W1B A;  4P72 A;  5H1S E;  2B39 A;  4K0K L;  4A3E G;  2VUM H;  1QUQ A;  2DJG C;  4LF9 L;  2VY3 A;  2CH4 W;  4L5T A;  3GTP H;  1CKO A;  3KDF B;  1BXT A;  1Y8O B;  4DR1 L;  2H5X A;  5EKI A;  2UUB Q;  4I7Z C;  2HCI A;  3AYH B;  2JA5 H;  1NUC A;  1UEB A;  4HSV A;  1PH9 A;  4RMF A;  2L55 A;  1PZI D;  1GUG A;  4C3I H;  5ISR A;  4QUC A;  4A3L H;  5I9O A;  3KDF A;  1TWF H;  3MA2 B;  3TME A;  1NY4 A;  2K5W A;  5FLX L;  1J9O A;  1IKM A;  4BY1 G;  4LWC A;  1D5Z C;  2JEB I;  4RCN A;  2SNS A;  3AMU A;  2DUD A;  4K2K A;  2NVX B;  1SMY D;  1BO0 A;  2EZV A;  5LMN L;  3E9I A;  1A15 A;  3KLS A;  1B50 A;  3Q8D A;  3OIQ A;  4YCW A;  1K28 A;  1K8O A;  2EYF A;  1RIP A;  1QCB D;  2AMC B;  1VMC A;  4V0B A;  3K6O A;  1CI3 M;  1EUJ A;  1VQ5 A;  1NMF A;  2WFW A;  2V4D A;  4P73 A;  2IX1 A;  4C3H B;  2B2T C;  1TY2 A;  3PUZ A;  2NN6 G;  1YZ6 A;  2JJQ A;  4G7H C;  2AUK A;  3RN5 A;  1DM0 B;  4A93 B;  2I0Q A;  1LT5 D;  1ML0 D;  1G29 1;  1JC7 A;  1TQO A;  1IBK Q;  4LAA A;  1CZW A;  4ZAI A;  2JE6 I;  3CCM A;  4MIU A;  2K75 A;  4FXD A;  5IYB G;  1Q8I A;  3SHL A;  5C4X G;  3VDY A;  2PZW A;  5C3E B;  1MJC A;  1BNZ A;  2XIW A;  3WWV A;  4JI6 L;  2O5J C;  5EBC A;  1VQG A;  2IX0 A;  4GN4 B;  4LW1 A;  2EXD A;  2D0O A;  3KF8 B;  3MWY W;  3KYH C;  3I4N G;  2IWH A;  2A68 D;  1Q86 C;  3M7N A;  1HCZ A;  2XVS A;  3D4R A;  1IBM L;  4GKK L;  1JE4 A;  2CW0 D;  2ICI A;  1HRJ A;  1CKN B;  1PYB A;  4AYB G;  3C1E A;  1UAP A;  3KF8 A;  3R8B A;  2NVX H;  3GP7 A;  4JI5 Q;  4DXG A;  5JEA G;  1HNZ L;  3SK4 A;  4KHP L;  2Z6K A;  3T1H Q;  5BR8 Q;  4LFB L;  2A6E D;  4HID A;  1DOM A;  1HA6 A;  4QGU A;  1T5X D;  2JA6 B;  5FOB B;  1W2B A;  1CKN A;  5CC4 A;  3KBG A;  2A6H C;  1NR2 A;  2JXM B;  1MSH A;  2RCF A;  2R7Z G;  5C6A A;  5CBA E;  1KXL A;  4FP5 D;  2HCC A;  5CV6 A;  4UY8 C;  1U4R A;  4QF4 A;  2VL6 A;  3ONA B;  4C3H H;  3CCJ A;  3J81 E;  3I4L A;  5C5M A;  4TVA B;  1TR5 A;  4N9P A;  1S5D D;  5G3L D;  4RKB A;  4K14 A;  3HOW B;  4A93 H;  1STN A;  4KY5 A;  2VQE Q;  1N8R C;  3H15 A;  1JOK A;  1K8M A;  1SSO A;  5GRO A;  5K36 G;  3T1Y Q;  1ZKO A;  4OO1 G;  4IUR A;  3PGZ A;  4GS3 A;  2F0J A;  3M9B A;  3I73 A;  4A3D B;  2OTJ A;  1CQF A;  1WD0 A;  2X6G A;  1SYE A;  5C3E H;  3F2C A;  3HOZ G;  1C48 A;  1SNM A;  4O42 A;  3HKZ E;  2R7D A;  4HR7 B;  3I90 A;  4LF7 L;  2D0P A;  1YNJ D;  5EGT A;  4ME5 A;  5FO8 B;  4DR6 L;  3A0J A;  5EQ0 A;  4U67 3;  2R6G A;  4WJW A;  1MI2 A;  1EL0 A;  1U4P A;  4NXN L;  5HY6 A;  4JBK A;  3Q24 A;  3RZD B;  1YJN A;  1SFO H;  2WAQ G;  1D1I A;  1N33 L;  1CSP A;  1QOH A;  2E8G A;  4P75 A;  4DV0 L;  1F77 A;  5A2Q E;  1PFS A;  1BCP D;  4IUN A;  4NDX A;  3GO5 A;  3DLL A;  2JA6 H;  4UP9 A;  2B63 G;  1UEA B;  1Y8P B;  1ET6 A;  4DR3 L;  4IZ8 A;  3D0F A;  1LAC A;  5IGE A;  3CC7 A;  1NJI C;  4LFC Q;  4NMZ A;  1SYF A;  2ES2 A;  4H0L C;  2B2Y A;  3S1M B;  1KHI A;  1X32 A;  1EY0 A;  3RLF A;  2DJF C;  2QF7 A;  4R8N A;  3RMH A;  2MNA A;  2E74 C;  4KKU A;  2VW9 A;  3K5N A;  3HOW H;  1QIL A;  2NVY B;  1EQT A;  1GOZ A;  2JN4 A;  5IP7 H;  4DR7 Q;  1EOV A;  1NCV A;  5LMU L;  3FKI G;  3HEJ A;  4YWK A;  4A3K B;  1WCM G;  2F3I A;  1BVS A;  1SAP A;  4CDE C;  1K83 B;  3VYU A;  4A3D H;  5EBD A;  3T4A C;  3Q6S A;  3W2D A;  1N34 L;  1VQ6 A;  1LTL A;  2F0W A;  3A74 A;  4MHE A;  4DR4 L;  1I4R A;  2JA9 A;  1L1O B;  2O4X A;  2KJX A;  2F0O A;  1STA A;  4OWX B;  1KAA A;  4LUO A;  5GQO A;  4K6D A;  2KEN A;  4EX5 A;  2ZT9 C;  1ZXT A;  2XWB B;  4KN4 C;  3WDN A;  1ENC A;  4HSP A;  1L1O A;  3RZD H;  1QNK A;  4A3B G;  3BVM A;  1XTC D;  4X6A H;  2WAQ E;  2LFN A;  1VQJ A;  2MJ8 A;  3ER0 A;  4M1U B;  4F8M A;  4JI7 Q;  5E7N A;  5FLX c;  5ELD A;  2KCT A;  4A76 A;  4ZKB B;  1QB5 D;  2F0K A;  3L2P A;  2K4K A;  4IOC A;  5CMD A;  3UDI A;  3PF5 A;  1HR0 W;  1MSG A;  3F2U A;  1JB7 A;  3CW2 C;  3JAM L;  3HS0 C;  1DCZ A;  2HHH Q;  5AJ3 L;  3NK9 A;  1KRS A;  1V1Q A;  1VQD A;  4JVZ A;  5M9O A;  5CV4 A;  4OEL B;  4OL7 A;  3S1M H;  5JPN C;  2UXD Q;  2PI2 E;  1K8A C;  2N55 A;  5IWA Q;  1IBL L;  2K05 A;  4BBS G;  1XPU A;  5FK9 C;  4DXF A;  2XN9 C;  4O0A A;  2EY2 A;  2X6L A;  1Y69 U;  1XNR L;  1II3 A;  4JI1 Q;  2RDH A;  2NWG A;  2B2V A;  3EVQ A;  2MHV A;  1YJ9 A;  4GZY C;  2N8N A;  4JI5 L;  1DJR D;  5KNB A;  3DWA A;  4HMI A;  4ME3 A;  3BDC A;  2F4V Q;  2PMZ B;  3UDF A;  4A3K H;  3CCQ A;  2LXK A;  2BOS A;  1O7I A;  2RHS B;  2F1M A;  1K83 H;  3PUV A;  5CV9 A;  1AZP A;  4NXM L;  1UE7 A;  4JI4 Q;  1GO3 E;  1R4Q B;  4RGO S;  4F88 A;  5C44 G;  4DR5 Q;  1V1P B;  1JWM D;  1TWA B;  2F3W A;  5COY A;  1PTO C;  1B44 D;  1ENA A;  2D2C C;  1HNW Q;  5LL6 S;  1XNQ Q;  3I8Z A;  3PO2 G;  1DGS A;  4K5W A;  4C2M B;  1TS3 A;  1Q7Y C;  1B70 B;  3I55 A;  2G9D A;  4ZKC B;  3V96 A;  2B29 A;  1V1P A;  4FO2 A;  2Z1C A;  5CV7 A;  3NEN A;  2CFM A;  4DAM A;  3EFX D;  1BCP B;  4IFD H;  1DYQ A;  2CHB D;  1E1O A;  2GVB A;  1G8Z D;  2Y0S G;  3CCV A;  4H44 C;  2H4O A;  4Z9C B;  5IOD A;  4EVO A;  3G6E A;  3ERQ A;  3CCE A;  1WJJ A;  3A56 A;  1E2W A;  1EY9 A;  3MZ5 A;  4JOI C;  2MGS A;  4IN3 A;  1O80 A;  3GTG B;  4JI2 Q;  1N32 L;  3J81 j;  3FMC A;  4DNT B;  3EBE A;  4A3F B;  4DK1 A;  5DM6 3;  4R4Q A;  2HT1 A;  4XDX A;  4DV4 L;  3RD4 A;  3DMU A;  5ELC A;  2EIF A;  3S17 B;  5IYD G;  1SND A;  2QA4 A;  4GOP B;  4DNR B;  4DV1 Q;  2X69 A;  1WTW A;  3D3R A;  4LF5 L;  1PLF A;  4IUP A;  3IFT A;  4PMC A;  3P20 A;  1F9P A;  2K14 A;  4P71 A;  2F0L A;  1EYD A;  2AUJ D;  2ZXR A;  3BG3 A;  4A3J B;  2F0Q A;  3M4Y A;  4GLV B;  4TSS A;  5KYI A;  4GOP A;  2R93 H;  2K01 A;  4ZLT F;  4B3S Q;  3JC6 6;  1TWA H;  3S15 H;  1T9H A;  1M8A A;  2Q8T A;  3TRE A;  4GNX C;  4HJ7 A;  4QJF A;  1VQN A;  2A6H D;  2BH8 A;  1MD2 D;  1A63 A;  4OX9 Q;  4C2M H;  2F0U A;  4KLK A;  3PV0 A;  1UUP A;  1Y1V B;  5EKL A;  4B3T Q;  2MO0 A;  3R2T A;  1PXU A;  3QO2 A;  5M3F B;  1ZYR C;  2N3S A;  2Z4H A;  3GTJ B;  5ELE A;  1Y14 B;  1YNN C;  2B8F A;  4UAI A;  1VQC A;  2K5N A;  2M9V A;  4C1N I;  1N36 L;  2CCZ A;  4DV3 Q;  2KEC A;  3CCU A;  1G6Z A;  4BXX G;  1J8I A;  3S14 B;  5FO7 B;  5FJ8 G;  5KND A;  4X62 L;  1A3V A;  1CZG A;  4NP5 A;  1K0R A;  1S4Z A;  1VQ4 A;  1TXY A;  4KJN A;  1CSQ A;  1VQM A;  3V05 A;  2TMP A;  2JA8 G;  4JC0 A;  4RAU C;  4CHT B;  1SNO A;  5I2Y A;  3GTG H;  4YY3 Q;  3PO3 G;  1JE5 A;  1VQB A;  3H0G G;  4A3F H;  2YV5 A;  5IP9 G;  1S72 A;  2EJM A;  1U5K A;  3DEP A;  5C0X H;  2XTI A;  4J1M A;  4MNO A;  3S17 H;  1CHP D;  1SEB D;  1JQY D;  1I4G A;  3PIO A;  1I3Q H;  4Q0F A;  2F0T A;  3L3O C;  2WB1 G;  2QGQ A;  4LNQ A;  2WV6 D;  4X66 L;  5C4J B;  4JW0 A;  1EOT A;  1H9J A;  1STE A;  3K8A A;  2LKV A;  3A54 A;  3UE1 A;  3HOY B;  4A3J H;  1GXD C;  5T1I A;  5G3L F;  5M3M G;  5E4X A;  1AZQ A;  4LUZ A;  5IE8 A;  1EYC A;  4RGN A;  3C1F A;  4HJA A;  1FD7 D;  4IUV A;  4RGM A;  3T51 B;  4PG3 A;  1HA5 A;  4RGT A;  1VS0 A;  4L5R C;  1VCI A;  1OXT A;  5I4D A;  1Y1V H;  3MXN B;  1K8G A;  5M3F H;  1AE3 A;  1XMQ L;  3GTJ H;  3Q0A A;  1VQE A;  1DOK A;  5M5W B;  1X55 A;  3CPF A;  1U0L A;  1JT8 A;  5GAG C;  5DM7 3;  3VR4 A;  3MXN A;  1Z9F A;  5CR3 A;  1CKM A;  2D9U A;  3S14 H;  1DON A;  4G4K A;  1Q12 A;  4A3M B;  1M90 C;  4Q5V A;  4JBJ A;  3KLR A;  1RHP A;  4LFA L;  2J4X A;  3IFD A;  3G71 A;  4OHJ A;  4DR5 L;  1X56 A;  1GKH A;  4BY7 B;  4QQB X;  2E2J B;  3OW2 A;  1YHA A;  1BBX C;  3K57 A;  4MN3 A;  2L0C A;  2D62 A;  1QE6 A;  4YCV A;  2EVB A;  3F8T A;  1PH3 A;  1BCP F;  2EYL A;  3KFU A;  2JA7 B;  2VUM G;  3H6M A;  5D3I B;  1KIX A;  3HOV B;  2SNM A;  1EY5 A;  3H91 A;  1LLR D;  1Q1B A;  3L0O A;  4JI8 Q;  3W5O A;  3KUP A;  3PUY A;  2ZJP A;  2JA5 G;  1JCK B;  1KD1 C;  1BQQ T;  1MHW C;  4POG A;  5C4J H;  4A3E B;  1UWV A;  3OTO L;  3G6J B;  1PRT C;  4C3I G;  3HOY H;  1Q8K A;  3DUZ A;  4HJ9 A;  4IFD J;  2G9H D;  4WJ3 M;  4A3C H;  3PSI A;  3K0Y A;  1CA5 A;  3NEM A;  1EYA A;  4CJ0 B;  4B3R L;  1D1K A;  2ID0 A;  1PYW D;  1RL2 A;  2B2U C;  2DN8 A;  2RBM A;  2R61 A;  2B2W C;  3HP3 A;  4B3M Q;  4RHS A;  2HDM A;  1EIG A;  3BYT B;  3QB3 A;  5L37 A;  2RDF A;  5M5W H;  4X64 L;  1EIY B;  1TU2 B;  2RSN A;  3NBH B;  4P74 A;  4BY1 B;  4XIG S;  4FF4 A;  2XRQ D;  2L12 A;  4X3K A;  4ZQ3 A;  1Q82 C;  2KUM A;  3EN2 A;  3TZU A;  1X6O A;  1FGU A;  5IT9 E;  4A3M H;  1VMP A;  3K7U C;  2UXB L;  3K81 C;  1B4O A;  3NBH A;  3CME A;  4B3S L;  2PZU A;  2O5I C;  2EYO A;  4KKT A;  1KLU D;  1OXU A;  2VQF Q;  1O7Z A;  4BY7 H;  4ZRZ A;  1STH A;  2E2J H;  2Q8I B;  1KL9 A;  4GN5 A;  1ILP A;  4IPC A;  1I6V C;  4LF6 L;  2IL8 A;  1PTO D;  2JA7 H;  3J81 L;  4XT3 B;  1X3G A;  2B3G A;  3GD7 A;  4LF8 L;  2AKW B;  3K5O A;  2M2L A;  4OWW B;  2EYM A;  1Y1W G;  4IFD I;  4CBV A;  4EQO A;  2JYO A;  4DNI A;  1PZJ D;  4ZUI A;  4A3E H;  2QCP X;  4C56 C;  1PHJ A;  1M1K C;  5C4X B;  1VQH A;  1HZC A;  2F03 A;  2L9H A;  1D6E C;  3A7A B;  3FRP B;  5NUC A;  1QVF A;  1EIF A;  2KOL A;  3MFG A;  1AP0 A;  3D8G A;  5D65 A;  2QIL A;  1TWG B;  1S3O A;  2E5L L;  3KBX A;  1B8A A;  2K5D A;  3HOU G;  1IW7 C;  5HGQ A;  1BF4 A;  2HQL A;  1EYG A;  3MHB A;  2KCM A;  2LS0 1;  4NKL A;  4AYB B;  4BY1 H;  3HKZ G;  4GKJ L;  3Q22 A;  1AEX A;  1WTX A;  2GVA A;  5C0X J;  2DY8 A;  2LXJ A;  2Z6B A;  1FVI A;  3LX0 A;  5DLQ E;  4LF4 Q;  2C5C A;  1V1O A;  4A4I A;  1VQA A;  5A2Q L;  5CYU A;  4IJL A;  4XQN A;  1SE8 A;  4N8X 1;  3TP6 A;  4DV6 Q;  4NB3 A;  4PZ6 A;  1IYU A;  4K2L A;  4KJO A;  1ENF A;  2OF1 A;  3H09 A;  1EFI D;  2ATW A;  4DV2 L;  2NN6 H;  3TEH B;  1WTH A;  1FJG Q;  1K9M C;  1CA6 A;  2UUC Q;  5EKK A;  3UE0 A;  1D5X C;  1XJV A;  1K73 C;  2UUA Q;  1XPO A;  4APV A;  1STG A;  1TWC B;  4UP8 A;  4CGY B;  5E3F A;  1V43 A;  2ZM6 Q;  1YI2 A;  3OHX C;  3CRK C;  5I6W A;  2CWP A;  5C4X H;  2O2L D;  4RWS C;  1X3Q A;  5COR A;  3HOZ B;  2AQ1 B;  5FLX E;  2AHO B;  4GLX A;  3BVG A;  1LT4 D;  1SNC A;  2WIN B;  5EPJ A;  1EY7 A;  3GTM B;  4HCE A;  4RCO A;  2RQX A;  1QZG A;  1P8L A;  1TWG H;  2PQA B;  3SXH A;  3A5U A;  1TII D;  1HNX Q;  2HIX A;  1YIT A;  3I3C A;  3X3M A;  1LTT D;  5C0X I;  4L5S A;  2MUY A;  4A3I G;  3KF6 B;  1YBY A;  3TSS A;  1CFM A;  1I50 B;  1F9S A;  2WAQ B;  2FMC A;  2PQA A;  2F0D A;  3SR1 A;  4CDF C;  5JEA H;  1SBB B;  3BYY B;  1LT6 D;  4JI0 Q;  1W6J A;  4XT1 B;  5JAV A;  4HJ5 A;  1PV4 A;  3SEB A;  1U4M A;  5HGT A;  1E3P A;  1LM0 A;  2GN5 A;  3VYR A;  3KF6 A;  4XQJ A;  2MPM A;  2UU9 L;  2A69 C;  2MP1 A;  4MTN A;  1G2S A;  4HIM A;  3HOW G;  4BA2 I;  1XMO Q;  1PTO B;  3QR8 A;  1E1T A;  1EY4 A;  3IL8 A;  2PW5 A;  3T53 B;  1J6Q A;  2KA7 A;  2KHS A;  3ERO A;  3E0E A;  2F0H A;  2UUB L;  2QDL A;  3NBI A;  4JI3 Q;  3A55 A;  3LWE A;  4JYA Q;  4JV5 Q;  5CBE E;  4DUY Q;  1TWC H;  2PI2 A;  3FKI B;  4BBR G;  4X3U A;  4C3J B;  3PIP 3;  1H9S B;  4OO1 H;  2F0P A;  3NTK A;  4YCU A;  2FMM A;  1I4P A;  2Q2I A;  1HJP A;  4K6L A;  1CK1 A;  4R4C A;  4DV5 Q;  3HOZ H;  4ID6 A;  3NWS A;  3S24 A;  3S9W A;  3AU7 A;  2Q2H A;  5BN4 A;  4OON A;  3GTM H;  1H9S A;  3N6R A;  1SMX A;  2PZT A;  3M4Q A;  2KCN A;  3DM3 A;  2KED A;  4FVM A;  3RZO B;  3FHW A;  2OQK A;  4JPB W;  2Q8R E;  3HZX A;  3OYY A;  4A3B B;  2F0I A;  1A2T A;  1I50 H;  1L2F A;  2XWJ B;  2A1A A;  2DY7 A;  1F2Z A;  2DGY A;  4I65 A;  5KRU A;  4FNF A;  2K7V A;  1I6H B;  2J7Z A;  4X65 Q;  1RCV D;  1DZ1 A;  3STB C;  5J39 A;  2Z6K C;  4IUU A;  1SRU A;  2RA4 A;  4ABN A;  1IBK L;  3C46 A;  1F9Q A;  4FF3 A;  1PRT D;  2Z9H A;  2EXZ A;  1PTO H;  3H3V C;  1U9R A;  4GNX B;  2Q2T A;  2OXP A;  1I94 Q;  2PNH A;  3JAM i;  1UNS A;  1JJG A;  4BBS B;  1H95 A;  4DK6 C;  3PMF A;  4KHZ A;  1G2T A;  1HFG A;  2YTV A;  4H02 A;  1LTR D;  2VZA A;  4CKB A;  4A3G G;  3KLW A;  4HN7 A;  4HCS A;  4QIW B;  5FLM H;  3C2P A;  3QOL A;  1KDA A;  3D6C A;  4GNX A;  1YHQ A;  5JJZ A;  2VB3 X;  3FKI H;  3W1G A;  4C3J H;  1EQR A;  3R2I A;  2Z4I A;  3J81 c;  1J5E Q;  2N88 A;  5JVH 3;  3K7A B;  3OW7 A;  1TS4 A;  1HQM C;  3QG1 A;  1SXT A;  2PNR C;  4DR2 Q;  5T1G A;  1PH4 A;  2NVY H;  1SYG A;  5C44 B;  1RKN A;  2K6A A;  1CM9 A;  4DN4 M;  1STY A;  1DOL A;  1X9N A;  3GTK B;  4DU9 A;  2UXC Q;  5K5P A;  3T1H L;  5BR8 L;  2AWO A;  4RHR A;  2SOB A;  5DEH A;  3M85 A;  1JJ2 A;  1OO9 B;  1BKB A;  3H94 A;  3ZJY C;  4PV1 C;  1LYL A;  1SDF A;  4KMU C;  3I91 A;  4N9T A;  5KNC A;  4B9W A;  3RZO H;  3F2B A;  3RUZ A;  2UUC L;  1O7Y A;  2HQE A;  4DV7 Q;  1PFN A;  2PW7 A;  2UUA L;  1EWC A;  2L1B A;  1FL0 A;  3OMC A;  1VQ9 A;  1CTM A;  1D7Q A;  4KY7 A;  1U4L A;  5JOB A;  2Y0S B;  1MJE A;  4I7A A;  1I6H H;  1RTN A;  2NBF A;  3ITP A;  4BS9 A;  1B3Q A;  1F2L A;  2RHQ B;  3B6Y A;  3MXU A;  2VQE L;  4FXG C;  3AEV A;  1SMY C;  3C3L A;  3CC2 A;  2ZJR A;  4U68 A;  3T1Y L;  3I70 A;  4AQY Q;  1VQL A;  3R93 A;  1KAB A;  4GN3 B;  1B7Y B;  4BBS H;  4PNY A;  1KDC A;  1JIC A;  4NW2 A;  1NBW A;  3QJY A;  5C5L A;  2R93 G;  4ZK9 B;  5M5Y B;  3OWF A;  1SJE D;  1DD2 A;  2EYH A;  4H13 C;  5ELN A;  3MAQ A;  4IUQ A;  4CJ2 C;  5TSS A;  3K7A H;  4IPH A;  3HOX G;  4DKA C;  4WFN 3;  1PTO F;  3TP5 A;  1ICF B;  4X3S A;  1K0S A;  5JEA J;  1A3T A;  3UI2 A;  1B2T A;  4OEM B;  1WI5 A;  4PMB A;  3QWN A;  2N49 A;  5C44 H;  3CU7 A;  3NP8 A;  3GTK H;  2K03 A;  4TKO B;  4O1N A;  3CC4 A;  1P16 A;  1B1Z A;  3TS0 A;  3F1Z A;  2BH2 A;  2XRS D;  5C4Z A;  1A8V A;  1O78 A;  2Z0S A;  2K28 A;  4K0K Q;  4IQZ A;  1KTK A;  3PQI A;  1C7Y A;  4LFC L;  1PYS B;  4LF9 Q;  1E0B A;  3NQT A;  4M8A A;  1WFQ A;  2FFK B;  1L1O C;  2KHI A;  4DR1 Q;  3KK7 A;  2PO4 A;  5HUR A;  3TZD A;  1CUK A;  1CQV A;  2ZJQ A;  1PRT B;  1SE3 A;  4DR7 L;  3TP7 A;  2EDG A;  3D31 A;  1NNX A;  2Q2U A;  1UE6 A;  2JA8 B;  1EWI A;  5J22 A;  3V2T A;  4BWG B;  4DGZ A;  2PPB C;  3PO3 B;  2VNU D;  3GV3 A;  4KI0 A;  2PMZ E;  1WVL A;  3K5L A;  3A5Z B;  5IOC A;  2Z8L A;  5LMN Q;  2EY6 A;  2L15 A;  2CQO A;  2EOT A;  4K8J A;  5CV5 A;  4KD4 A;  3A7L A;  4KK7 A;  1ASZ A;  3FVQ A;  5M5Y H;  2WB1 B;  1S5F D;  2EJG C;  2B2V C;  2NTS A;  3J80 i;  4L6T B;  3TQY A;  3PUX A;  3URY A;  1F2M A;  1L0X B;  2B2W A;  3M4O B;  3J80 L;  1PH5 A;  2E2H B;  4S3S A;  2KHJ A;  4JI7 L;  2F4I A;  1S5C D;  2RDG A;  2EJF C;  4QUF A;  2A69 D;  1QVG A;  1F9R A;  1TT2 A;  3DM1 A;  2R92 G;  2A5H A;  3SGI A;  3I56 A;  1QG7 A;  2PCF B;  2K5Q A;  5LHY 1;  1MKH A;  1WYD A;  3MXP A;  4K5V A;  4R9W A;  3ERS X;  1Q81 C;  2HHH L;  1HTP A;  2RKS A;  1YNJ C;  1D8L A;  4CDD C;  3BU2 A;  4E6I A;  2YYZ A;  2UXD L;  1GUT A;  4OO1 I;  5IWA L;  4BXX H;  3TP8 A;  4JI6 Q;  4R4T A;  5J1Z A;  2KCC A;  3AB9 A;  4JBW A;  1ZEQ X;  5IT9 L;  3RLN A;  3K59 A;  2ZTD A;  4JI1 L;  3I4M B;  2FHT A;  4MTK A;  3NUC A;  4IPG A;  4RKL A;  2IHE A;  3VYS A;  2JA8 H;  3SK5 A;  1IBM Q;  3IRB A;  2F4V L;  1LTS D;  1BCP C;  2ICE C;  2B2T A;  4JCV E;  3SE0 A;  3PO3 H;  3MEF A;  1JR0 D;  3U9O A;  2CVR A;  4JK1 C;  1YHB A;  5IP9 H;  2NZO A;  3EIV A;  3PIO 3;  1KLG D;  1HNZ Q;  4JI4 L;  4FF1 A;  3G7L A;  4KHP Q;  4LFB Q;  1EZ6 A;  3VR2 A;  3SK6 A;  3HOY G;  3S16 B;  1SLJ A;  2KBN A;  4A3C G;  1HNW L;  1XNQ L;  5EPL A;  4ALP A;  3JAM c;  1I4Q A;  4R8I A;  3NSW A;  5FO9 B;  1H9M A;  1FNU A;  4POF A;  1OTC A;  3PUW A;  3TDQ A;  4B9X A;  4X3T A;  2NTT A;  4K5X A;  4KN7 C;  3ULJ A;  5IGB A;  1FGB D;  3IAY A;  3S2D B;  4NPS A;  3E0J A;  2E2H H;  1YNX A;  1GUO A;  4AQY L;  3HFZ B;  3STB D;  4UHV A;  1VQK A;  1GD7 A;  3T13 A;  2C9O A;  2RVL A;  1TS2 A;  1NTG A;  1A62 A;  1HQR D;  1LT3 D;  1WTO A;  4A3L G;  2AQ3 B;  3BS1 A;  4JBM A;  2TSS A;  2IPK D;  1LTB D;  4V19 0;  2KEE A;  2NB0 A;  2BDN A;  4BA1 I;  1VQF A;  5F2D A;  4JI2 L;  1PFB A;  4BY7 G;  1TWH B;  2BE5 C;  1X3P A;  3EJI A;  2QEX A;  3I4O A;  3CQZ B;  3CMA A;  1I4H A;  4LF7 Q;  5IYC H;  1H9K A;  4PMW A;  1X65 A;  2EYJ A;  3CKI B;  1AE2 A;  1WTR A;  2K04 A;  4DR6 Q;  5IGC A;  1JOO A;  1WTP A;  1PVO A;  3LGJ A;  2A73 B;  3I4M H;  4DV1 L;  4ILW A;  4NXN Q;  2K52 A;  4J15 A;  4OWT B;  4FF2 A;  3OPO A;  2NZ1 D;  3LWU A;  1N33 Q;  1C0A A;  2M00 A;  4IUT A;  4JG2 A;  4DV0 Q;  2F0E A;  2YTX A;  5BN5 A;  3S16 H;  1XYI A;  1NR4 A;  2VXW A;  2QEJ C;  1W6K A;  1Y1W B;  1PRT F;  3NQI A;  2JSO A;  4IPD A;  5I2X A;  4OX9 L;  4DR3 Q;  1KDB A;  2ZTE A;  1AN8 A;  1B3A A;  1Q46 A;  3VR6 A;  4B3T L;  3J81 i;  3O13 A;  3UDG A;  1HH2 P;  2HUG A;  1BDO A;  2NZH A;  3U4Z A;  4XYQ A;  3S2D H;  3HOV H;  5J3B A;  2CWA A;  2HIV A;  4XQQ A;  4OXP A;  4DV3 L;  1G6P A;  5EAY A;  2K5H A;  3HGB A;  3GDE A;  1IKL A;  1YEZ A;  3S2H B;  2PQE A;  1UE1 A;  5LMU Q;  3A8K E;  4CKE A;  1XPR A;  3HOU B;  1KC8 C;  1R4P B;  3HKZ B;  5DNF A;  1VF5 C;  1N34 Q;  3DWP A;  2E75 C;  2L11 A;  2EYP A;  4QY7 A;  4DR4 Q;  1AH9 A;  1KAW A;  4YY3 L;  2EQS A;  1TWH H;  3CQZ H;  1SNQ A;  3I4N B;  1VQP A;  4YHH Q;  3U9S A;  1PH1 A;  1C9O A;  3S1R B;  1BBW A;  2BDO A;  1WTQ A;  3A8J E;  4O2D A;  3CXC A;  2F3V A;  4LJZ C;  5CGK A;  3J7Z C;  2OEO A;  5IY0 A;  2RF4 A;  2OCE A;  1LAB A;  4WOR A;  1KNE A;  2JQO A;  3HRZ C;  5JVG 3;  3GTQ B;  4C3H G;  4EQP A;  1WOC A;  1LTG D;  1EY8 A;  1Y8N B;  2R7Z B;  4A93 G;  1Y1W H;  1XTD A;  4J6H A;  3ICE A;  4KTA A;  1HZB A;  5AJ3 Q;  4RA8 A;  1CHQ D;  4GLA C;  2CKZ B;  1QVC A;  1IXR A;  5IGG A;  1IBL Q;  3OOC A;  5IGD A;  2FIN B;  1UE5 A;  3RLO A;  3S1Q B;  4QL5 A;  4EQN A;  5C3E G;  3FPP A;  1XNR Q;  1ZYR D;  3J80 c;  2FXQ A;  5KIX A;  1YNN D;  1SFO B;  1EEF D;  3SK8 A;  4OIJ A;  3S2H H;  3KOJ A;  3BJU A;  5IYB H;  3OSO A;  3HOU H;  4KY6 A;  1ONL A;  4A3I B;  3TRZ A;  1HHV A;  1X54 A;  5IGF A;  2NVQ B;  2F0M A;  3IKJ A;  3ULL A;  4NXM Q;  1Q3L A;  3X3N A;  4FDB A;  1PH6 A;  1Q1E A;  4RH6 A;  3QOJ A;  4L5Q A;  4LK1 C;  1XWE A;  4FXK C;  1GHJ A;  2I5L X;  3I4N H;  4F87 A;  3SVM A;  1JJC B;  3S1R H;  1YIJ A;  1ET9 A;  2JA6 G;  1ESF A;  2E76 C;  4JI8 L;  3J7A 5;  2BA0 A;  2F0V A;  3A8I E;  5IT9 c;  4UP7 A;  1WD1 A;  1G51 A;  1B53 A;  2CH4 A;  3M3Y B;  2PYK A;  1GHK A;  5C4H A;  1O7L A;  1SJH D;  2LMC B;  4UPA A;  3GTQ H;  3I7F A;  3P75 A;  4L63 B;  5GAE C;  2P5Z X;  2B63 B;  2MFI A;  3PIP A;  1PH8 A;  5KYL A;  2R7Z H;  1T5E A;  5KEE A;  3N52 A;  5IP7 G;  4BBR B;  2NVT B;  2I46 A;  2F52 A;  4QB4 A;  1PH7 A;  1TS5 A;  4HMJ A;  4P2C B;  2L5T A;  3DHQ A;  4F7X A;  4B3M L;  1PZK D;  2F0N A;  4HAE A;  1N32 Q;  3CCS A;  2WAC A;  3S1Q H;  2AQ2 B;  4A3D G;  3CAM A;  2V1C C;  4ZCK A;  4LUV A;  5CV8 A;  5I6Y A;  4DV4 Q;  4AYB E;  4HIO A;  2IHF A;  5K36 H;  3ND8 A;  3BZD B;  3H3V H;  1EU4 A;  2R3Z A;  3P7J A;  1WCM B;  3BVZ A;  2I07 B;  4EGV A;  3NEL A;  5D3D A;  2SEB D;  4A3I H;  4XTC S;  2OT2 A;  1B9N A;  5EPK A;  5FKA C;  4LF5 Q;  2NVQ H;  2VQF L;  2J0T D;  3OIP A;  1QNU A;  1L0Y B;  1YVC A;  3GV6 A;  1SE4 A;  1IYJ B;  4DUZ Q;  3VYT A;  1GVP A;  1BOS A;  3BZC A;  1HUM A;  4Y52 H;  3ND9 A;  1E24 A;  2E2D C;  3K80 C;  1HUN A;  3D4W A;  1B9M A;  1SN8 A;  3VR3 A;  3LNN A;  1HR0 Q;  2K32 A;  4PZ7 A;  2VB2 X;  1EFW A;  4JOI A;  1D2B A;  3ZYY X;  3U50 C;  5FLM G;  3AFP A;  1A2U A;  4KHV A;  3M3Y H;  4C3J G;  1N36 Q;  1SR3 A;  3E9H A;  4WRD A;  3HKS A;  3AFQ A;  1E2Z A;  3CP0 A;  3EQL C;  4CKC A;  3DEO A;  4KD3 A;  1ESR A;  4XXE A;  1W3S A;  2B63 H;  4A3G B;  2OTL A;  2D5D A;  1R9T B;  4X62 Q;  1ASY A;  2FJ2 A;  1PMR A;  2F0G A;  1A6X A;  4HED A;  4BBR H;  2NVT H;  1A0I A;  3NWT A;  3OMG A;  3GQB A;  2B8G A;  4DFA A;  1LUZ A;  2XGT A;  1OXX K;  1F2Y A;  4G57 A;  1WTV A;  1JMC A;  1LV9 A;  3TS2 A;  4YHH L;  1IYV A;  5IIF A;  2JP1 A;  4A3K G;  3CPW A;  3FDT A;  1NE3 A;  1NAP A;  4KKS A;  2BE5 D;  1S40 A;  4XYO A;  3NTH A;  3RN2 A;  4DK0 A;  4RG1 A;  2C35 B;  2QKI C;  2JK8 A;  4LF4 L;  2RCN A;  3TN2 A;  1PH2 A;  1I5F A;  1N9W A;  4DAY B;  2YU9 B;  1E22 A;  1WCM H;  1Q90 A;  2ZTC A;  3E6Z X;  3NTI A;  3CD6 A;  4IOA A;  1SE2 A;  1JWS D;  4DV6 L;  3FP9 A;  4X66 Q;  2L4N A;  1TKW B;  2A19 A;  1EQV A;  4DAP A;  2OQ0 A;  4G7O C;  3AQQ A;  4DAY A;  4DF7 A;  5KGU A;  3PO2 B;  2F0S A;  2MQH A;  4YIJ A;  3FPU B;  1GJX A;  1EZ8 A;  4IFD G;  3K58 A;  1GM5 A;  3D6W A;  3EA6 A;  4CDC C;  1KNA A;  3CCR A;  1FJG L;  1D5M C;  2R7F A;  3ULP A;  4A3B H;  1VQ8 A;  2AWN A;  1HZ9 A;  1NSN S;  1K3B C;  1XMQ Q;  2ZM6 L;  2A8V A;  2IW3 A;  4DA2 A;  3F2D A;  2GA4 B;  3E5S A;  5LL6 X;  4YWM A;  1I4X A;  1PA6 A;  3I72 A;  5I9P A;  3J7A V;  3CCL A;  2WP8 J;  5DAU A;  3WOF A;  1RD9 D;  4KV6 A;  4A3G H;  2YTY A;  1R9T H;  3GTL B;  3GTO B;  2R93 B;  1S5B D;  1STB A;  4LFA Q;  1E7Z A;  1RF2 D;  5A35 A;  4MZ9 A;  4B08 A;  3MEH A;  1HPC A;  2IJ0 A;  1BBU A;  3S15 B;  2SDF A;  4FYD A;  1HNX L;  3R3O A;  5AFW A;  3HOX B;  2B2Y C;  2EPB A;  4HIK A;  4PQX A;  1XXG A;  1MGS A;  1C4Q A;  2BA1 A;  1RJT A;  1IW7 D;  4R4I A;  1H9R A;  3S1N B;  4JI0 L;  1DXM A;  2VS1 A;  2YU9 H;  5C3X A;  1BUV T;  1LTA D;  2K33 A;  5ELF A;  1JOR A;  4OGQ C;  1ROD A;  4DAV A;  1SRO A;  3M7G A;  1KRT A;  2H1E A;  5C3W A;  1E2V A;  3OTO Q;  4TRD A;  1XMO L;  1HFN A;  1MBY A;  3PO2 H;  4B3R Q;  2A74 C;  4TQU S;  2NYZ D;  3KJP A;  1HXY D;  2NN6 I;  2ENB A;  1KQS A;  3Q23 A;  4EQ5 A;  4JI3 L;  1S5E D;  2XNA C;  3HG9 A;  5D14 A;  5GAH C;  3JAM E;  4JYA L;  2I5M X;  4JV5 L;  3NE5 B;  4DUY L;  1GUN A;  1VQI A;  1FNW A;  2IT1 A;  2XSC A;  3P1H A;  3G4S A;  4HJ8 A;  2EE1 A;  4QIW E;  3VA7 A;  3KJO A;  2K50 A;  1K3R A;  4R1J A;  1I3Q B;  2IX3 A;  4X64 Q;  4OIK A;  3L9A X;  2A68 C;  2KVM A;  3G48 A;  4DV5 L;  4IJH A;  2CW0 C;  2N78 A;  2ASB A;  4A3F G;  3MFY A;  1AFP A;  1M4V A;  1MIU A;  5GAD C;  3GTL H;  3GTO H;  2WKD A;  1VDZ A;  5C0X G;  2UXB Q;  4DUZ L;  1CT1 D;  4N8F A;  2A6E C;  3BDO A;  4HTH A;  4ZUJ A;  4ULL A;  2DNE A;  4QMG A;  3T56 B;  3H0G B;  1FYC A;  3HOX H;  2DNC A;  3FEW X;  1QWY A;  1HR0 L;  5ELB A;  4A3J G;  1Z7T A;  4LF6 Q;  5IYD H;  3NPP A;  3TBI B;  1V9P A;  1V8Q A;  3BZK A;  1EIH A;  3S1N H;  2B2U A;  1AW7 A;  4LF8 Q;  2R92 B;  3MXG A;  5M5X B;  1ICW A;  4X65 L;  2Y0S E;  3DXJ C;  1HTL D;  5JJK A;  1VQO A;  3D4D A;  3M4P A;  1X3F A;  1Y1V G;  4DK3 C;  3U58 A;  1EU3 A;  3CHB D;  5M3M B;  4R4O A;  5M3F G;  1BR9 A;  3QIA A;  2HD3 A;  1A3U A;  3VA5 A;  4PZ8 A;  1JWU D;  1IL2 A;  1YJW A;  1I94 L;  3K0X A;  2F0F A;  3BDL A;  5EJW A;  3I2Z A;  2E2I B;  2IY5 B;  1OXS C;  2JEA I;  1PDQ A;  4DPG A;  2E5L Q;  1EQQ A;  3CRL C;  3UDX A;  1QJO A;  3DWQ A;  1HZA A;  1TY0 A;  1OXV A;  1EEI D;  3W3A A;  3VR5 A;  4LMQ D;  1J5E L;  2EY5 A;  1RTO A;  3MTS A;  3H3V I;  3NXW A;  2WII B;  1GUW A;  4GKJ Q;  1EWH A;  1SYC A;  1X3E A;  5FJ8 H;  4DR2 L;  3U4V A;  2WKC A;  3J7A F;  5LMN W;  1Z6H A;  2LY7 A;  3PCO B;  3E3X A;  4G7Z C;  2UXC L;  2G5D A;  1FNV A;  4GKK Q;  1VF7 A;  4IO9 A;  2EY1 A;  3J7Y W;  1SYD A;  4AIM A;  2K5V A;  1XX8 A;  4Y7N B;  1ILQ A;  3H0G H;  1JB3 A;  4K8I A;  2I5H A;  1FR3 A;  4A75 A;  2CQA A;  2K1B A;  4DV7 L;  2VUM B;  4YWL A;  2NUC A;  4DV2 Q;  4IAL A;  1LTI D;  4CJ1 B;  3GTP B;  1G91 A;  3K5M A;  3KLS X;  5BN3 A; 
#chains in the Genus database with same CATH homology
 2JA5 B;  3NHH A;  4UDU C;  1GUS A;  2ZXO A;  4C3I B;  3MVV A;  2RSO A;  4RFB A;  1TWF B;  4L8J A;  3T16 A;  1IHZ A;  3L7Z C;  1TVX A;  2KQ3 A;  3SDZ A;  1SNP A;  1JOQ A;  4H7B A;  3OWE B;  2QDB A;  4QCL A;  1C8C A;  3MC0 B;  1Z47 A;  1PFM A;  5E4W C;  1EY6 A;  1SYB A;  5JPM C;  2ZXP A;  1LO5 D;  4ZYS A;  3WOE A;  4J8Q A;  2BCO A;  3J80 E;  1RDP D;  2HDL A;  1IL8 A;  5E1F A;  4C1N K;  4ODG A;  2B39 A;  1BXT A;  1Y8O B;  5EKI A;  4I7Z C;  2HCI A;  1NUC A;  4HSV A;  2L55 A;  1PZI D;  1GUG A;  5ISR A;  4QUC A;  5I9O A;  3MA2 B;  3TME A;  2K5W A;  5FLX L;  1J9O A;  1IKM A;  1D5Z C;  2JEB I;  4RCN A;  2SNS A;  3AMU A;  4K2K A;  2NVX B;  1SMY D;  1BO0 A;  2EZV A;  1A15 A;  3KLS A;  1B50 A;  3OIQ A;  1K8O A;  2EYF A;  1QCB D;  1VMC A;  4V0B A;  3K6O A;  1CI3 M;  2V4D A;  2IX1 A;  4C3H B;  2B2T C;  1TY2 A;  3PUZ A;  2NN6 G;  4G7H C;  2AUK A;  1DM0 B;  4A93 B;  1LT5 D;  1ML0 D;  1G29 1;  1JC7 A;  1TQO A;  4LAA A;  1CZW A;  4ZAI A;  2JE6 I;  4MIU A;  4FXD A;  1Q8I A;  3SHL A;  2PZW A;  5C3E B;  1BNZ A;  2XIW A;  2O5J C;  5EBC A;  2IX0 A;  3MWY W;  2IWH A;  2A68 D;  3M7N A;  1HCZ A;  2XVS A;  3D4R A;  1JE4 A;  2CW0 D;  2ICI A;  1HRJ A;  3C1E A;  1UAP A;  3KF8 A;  3R8B A;  3GP7 A;  4DXG A;  5JEA G;  3SK4 A;  2A6E D;  1HA6 A;  1DOM A;  1T5X D;  2JA6 B;  5FOB B;  5CC4 A;  3KBG A;  2A6H C;  1NR2 A;  2JXM B;  1MSH A;  5C6A A;  5CBA E;  4FP5 D;  2HCC A;  5CV6 A;  1U4R A;  4QF4 A;  3ONA B;  3J81 E;  5C5M A;  3I4L A;  1TR5 A;  4N9P A;  1S5D D;  5G3L D;  4RKB A;  4K14 A;  3HOW B;  1STN A;  4KY5 A;  1JOK A;  1K8M A;  1SSO A;  5K36 G;  1ZKO A;  4OO1 G;  4IUR A;  2F0J A;  3I73 A;  4A3D B;  1CQF A;  1WD0 A;  2X6G A;  1SYE A;  1C48 A;  1SNM A;  4O42 A;  4HR7 B;  3I90 A;  1YNJ D;  5EGT A;  4ME5 A;  5FO8 B;  5EQ0 A;  4U67 3;  2R6G A;  4WJW A;  1MI2 A;  1EL0 A;  1U4P A;  3Q24 A;  3RZD B;  1D1I A;  1QOH A;  1F77 A;  5A2Q E;  1BCP D;  4IUN A;  4NDX A;  3GO5 A;  1UEA B;  1Y8P B;  1ET6 A;  4IZ8 A;  1LAC A;  5IGE A;  4NMZ A;  1SYF A;  4H0L C;  2B2Y A;  3S1M B;  1X32 A;  1EY0 A;  3RLF A;  2QF7 A;  4R8N A;  3RMH A;  2E74 C;  4KKU A;  3K5N A;  1QIL A;  2NVY B;  1EQT A;  1GOZ A;  1NCV A;  3HEJ A;  4A3K B;  1SAP A;  1K83 B;  3VYU A;  5EBD A;  3T4A C;  3Q6S A;  3W2D A;  2F0W A;  4MHE A;  1I4R A;  2O4X A;  2KJX A;  2F0O A;  1STA A;  1KAA A;  4K6D A;  2ZT9 C;  1ZXT A;  2XWB B;  4KN4 C;  3WDN A;  1ENC A;  4HSP A;  1QNK A;  3BVM A;  1XTC D;  2LFN A;  2MJ8 A;  4M1U B;  4F8M A;  5ELD A;  4ZKB B;  1QB5 D;  2F0K A;  5CMD A;  1MSG A;  3F2U A;  3JAM L;  3HS0 C;  1DCZ A;  3NK9 A;  5M9O A;  5CV4 A;  4OL7 A;  5JPN C;  2N55 A;  2K05 A;  5FK9 C;  4DXF A;  2XN9 C;  2EY2 A;  2X6L A;  1Y69 U;  1II3 A;  2RDH A;  2NWG A;  2B2V A;  3EVQ A;  2MHV A;  4GZY C;  1DJR D;  5KNB A;  3DWA A;  4HMI A;  3BDC A;  2PMZ B;  2BOS A;  2F1M A;  3PUV A;  5CV9 A;  1AZP A;  1R4Q B;  4RGO S;  4F88 A;  1V1P B;  1JWM D;  1TWA B;  2F3W A;  5COY A;  1PTO C;  1B44 D;  1ENA A;  2D2C C;  5LL6 S;  3I8Z A;  4K5W A;  4C2M B;  1TS3 A;  2G9D A;  4ZKC B;  3V96 A;  1V1P A;  4FO2 A;  2Z1C A;  5CV7 A;  3EFX D;  1BCP B;  4IFD H;  1DYQ A;  2CHB D;  1G8Z D;  4H44 C;  2H4O A;  4Z9C B;  5IOD A;  4EVO A;  3ERQ A;  3A56 A;  1E2W A;  1EY9 A;  3MZ5 A;  2MGS A;  4IN3 A;  1O80 A;  3GTG B;  3FMC A;  4DNT B;  4A3F B;  4DK1 A;  5DM6 3;  4XDX A;  3RD4 A;  3DMU A;  5ELC A;  3S17 B;  1SND A;  4DNR B;  2X69 A;  1WTW A;  3D3R A;  1PLF A;  4IUP A;  3IFT A;  4PMC A;  3P20 A;  1F9P A;  4A3J B;  2F0L A;  1EYD A;  2AUJ D;  2ZXR A;  3BG3 A;  2F0Q A;  3M4Y A;  4TSS A;  5KYI A;  2K01 A;  4ZLT F;  1M8A A;  2Q8T A;  2A6H D;  1MD2 D;  2F0U A;  3PV0 A;  1UUP A;  1Y1V B;  5EKL A;  3R2T A;  1PXU A;  3QO2 A;  5M3F B;  1ZYR C;  2Z4H A;  3GTJ B;  5ELE A;  1YNN C;  2B8F A;  4UAI A;  2M9V A;  4C1N I;  2KEC A;  1G6Z A;  1J8I A;  3S14 B;  5FO7 B;  5KND A;  1A3V A;  1CZG A;  4NP5 A;  1S4Z A;  4KJN A;  3V05 A;  2TMP A;  4RAU C;  4CHT B;  1SNO A;  5I2Y A;  2EJM A;  3DEP A;  5C0X H;  4J1M A;  1CHP D;  1SEB D;  1JQY D;  1I4G A;  4Q0F A;  2F0T A;  3L3O C;  2WV6 D;  5C4J B;  1EOT A;  1H9J A;  1STE A;  2LKV A;  3A54 A;  3HOY B;  1GXD C;  5T1I A;  5G3L F;  1AZQ A;  5E4X A;  1EYC A;  4RGN A;  3C1F A;  1FD7 D;  4IUV A;  4RGM A;  3T51 B;  1HA5 A;  4RGT A;  1VCI A;  1OXT A;  5I4D A;  3Q0A A;  1DOK A;  5M5W B;  5DM7 3;  3VR4 A;  3MXN A;  5CR3 A;  2D9U A;  1DON A;  4G4K A;  1Q12 A;  4A3M B;  4Q5V A;  3KLR A;  1RHP A;  2J4X A;  3IFD A;  4OHJ A;  4BY7 B;  2E2J B;  1BBX C;  3K57 A;  4MN3 A;  2L0C A;  2D62 A;  1QE6 A;  2EVB A;  1BCP F;  2EYL A;  2JA7 B;  3H6M A;  5D3I B;  3HOV B;  2SNM A;  1EY5 A;  3H91 A;  1LLR D;  1Q1B A;  3KUP A;  3PUY A;  1JCK B;  1BQQ T;  4A3E B;  3G6J B;  1PRT C;  4C3I G;  3DUZ A;  4IFD J;  2G9H D;  3K0Y A;  1CA5 A;  1EYA A;  4CJ0 B;  1D1K A;  2ID0 A;  1PYW D;  2B2U C;  2DN8 A;  2RBM A;  2R61 A;  2B2W C;  3HP3 A;  4RHS A;  2HDM A;  1EIG A;  3BYT B;  3QB3 A;  2RDF A;  1TU2 B;  2RSN A;  4BY1 B;  4XIG S;  4FF4 A;  2XRQ D;  2L12 A;  4X3K A;  4ZQ3 A;  2KUM A;  3TZU A;  5IT9 E;  1VMP A;  2O5I C;  1B4O A;  3NBH A;  2PZU A;  2EYO A;  4KKT A;  1KLU D;  1OXU A;  1O7Z A;  4ZRZ A;  1STH A;  2Q8I B;  1ILP A;  1I6V C;  2IL8 A;  1PTO D;  3J81 L;  4XT3 B;  3GD7 A;  3K5O A;  2M2L A;  2EYM A;  4IFD I;  4CBV A;  4EQO A;  2JYO A;  1PZJ D;  4ZUI A;  2QCP X;  4C56 C;  5C4X B;  2F03 A;  2L9H A;  1D6E C;  3A7A B;  3FRP B;  5NUC A;  2KOL A;  3MFG A;  1AP0 A;  3D8G A;  5D65 A;  2QIL A;  1TWG B;  3KBX A;  2K5D A;  1IW7 C;  1BF4 A;  3MHB A;  2LS0 1;  4NKL A;  4AYB B;  3Q22 A;  1AEX A;  1WTX A;  5C0X J;  2DY8 A;  3LX0 A;  2C5C A;  1V1O A;  5A2Q L;  5CYU A;  4XQN A;  3TP6 A;  1IYU A;  4K2L A;  4KJO A;  1ENF A;  2OF1 A;  3H09 A;  1EFI D;  2NN6 H;  1CA6 A;  5EKK A;  1D5X C;  1STG A;  1TWC B;  4CGY B;  5E3F A;  1V43 A;  3OHX C;  3CRK C;  5I6W A;  2O2L D;  4RWS C;  1X3Q A;  5COR A;  3HOZ B;  2AQ1 B;  5FLX E;  3BVG A;  1LT4 D;  1SNC A;  2WIN B;  5EPJ A;  1EY7 A;  3GTM B;  4HCE A;  4RCO A;  2RQX A;  3SXH A;  1TII D;  3I3C A;  3X3M A;  1LTT D;  5C0X I;  2MUY A;  3TSS A;  1CFM A;  1I50 B;  1F9S A;  2WAQ B;  2FMC A;  2F0D A;  3SR1 A;  5JEA H;  1SBB B;  3BYY B;  1LT6 D;  1W6J A;  4XT1 B;  5JAV A;  3SEB A;  1U4M A;  5HGT A;  3VYR A;  4XQJ A;  2MPM A;  2A69 C;  2MP1 A;  1G2S A;  4BA2 I;  1PTO B;  1EY4 A;  3IL8 A;  2PW5 A;  3T53 B;  2KA7 A;  2KHS A;  3ERO A;  2F0H A;  3NBI A;  3A55 A;  3LWE A;  5CBE E;  3FKI B;  4C3J B;  4X3U A;  3PIP 3;  1H9S B;  4OO1 H;  2F0P A;  3NTK A;  2FMM A;  1I4P A;  4K6L A;  1CK1 A;  4ID6 A;  3NWS A;  3S9W A;  3AU7 A;  5BN4 A;  1H9S A;  3N6R A;  2PZT A;  2KCN A;  2KED A;  4FVM A;  3RZO B;  2Q8R E;  3HZX A;  4A3B B;  2F0I A;  1A2T A;  2XWJ B;  2DY7 A;  1F2Z A;  4I65 A;  5KRU A;  4FNF A;  2K7V A;  1I6H B;  2J7Z A;  1RCV D;  1DZ1 A;  5J39 A;  4IUU A;  2RA4 A;  4ABN A;  3C46 A;  1F9Q A;  4FF3 A;  1PRT D;  2EXZ A;  1PTO H;  3H3V C;  1U9R A;  2OXP A;  1UNS A;  4BBS B;  3PMF A;  4KHZ A;  1G2T A;  1HFG A;  1LTR D;  4CKB A;  4HN7 A;  4HCS A;  4QIW B;  3C2P A;  3QOL A;  1KDA A;  3D6C A;  5JJZ A;  2VB3 X;  3R2I A;  2Z4I A;  2N88 A;  5JVH 3;  3K7A B;  3OW7 A;  1TS4 A;  1HQM C;  3QG1 A;  1SXT A;  2PNR C;  5T1G A;  1SYG A;  5C44 B;  1RKN A;  2K6A A;  1CM9 A;  4DN4 M;  1STY A;  1DOL A;  3GTK B;  4DU9 A;  5K5P A;  2AWO A;  4RHR A;  2SOB A;  5DEH A;  3M85 A;  1OO9 B;  3H94 A;  4PV1 C;  5KNC A;  1SDF A;  4KMU C;  3I91 A;  4N9T A;  4B9W A;  3RUZ A;  1O7Y A;  2HQE A;  1PFN A;  2PW7 A;  1EWC A;  2L1B A;  3OMC A;  1CTM A;  4KY7 A;  1U4L A;  5JOB A;  2Y0S B;  1RTN A;  2NBF A;  3ITP A;  4BS9 A;  1F2L A;  3MXU A;  4FXG C;  1SMY C;  3C3L A;  4U68 A;  3I70 A;  3R93 A;  1KAB A;  4PNY A;  1KDC A;  1JIC A;  4NW2 A;  3QJY A;  5C5L A;  4ZK9 B;  5M5Y B;  3OWF A;  1SJE D;  1DD2 A;  2EYH A;  4H13 C;  3MAQ A;  4IUQ A;  4CJ2 C;  5TSS A;  4WFN 3;  1PTO F;  3TP5 A;  4X3S A;  5JEA J;  1A3T A;  3UI2 A;  1B2T A;  4PMB A;  3QWN A;  3CU7 A;  3NP8 A;  2K03 A;  4TKO B;  4O1N A;  1B1Z A;  2XRS D;  5C4Z A;  1O78 A;  2K28 A;  4IQZ A;  1KTK A;  1E0B A;  3NQT A;  4M8A A;  2FFK B;  3KK7 A;  2PO4 A;  5HUR A;  3TZD A;  1CQV A;  1PRT B;  1SE3 A;  3TP7 A;  2EDG A;  3D31 A;  2JA8 B;  5J22 A;  3V2T A;  4BWG B;  4DGZ A;  2PPB C;  3PO3 B;  2VNU D;  3GV3 A;  4KI0 A;  1WVL A;  3K5L A;  5IOC A;  2Z8L A;  2EY6 A;  2EOT A;  4K8J A;  5CV5 A;  4KD4 A;  3A7L A;  4KK7 A;  3FVQ A;  2WB1 B;  1S5F D;  2EJG C;  2B2V C;  2NTS A;  4L6T B;  3PUX A;  3URY A;  1F2M A;  1L0X B;  2B2W A;  3M4O B;  3J80 L;  2E2H B;  4S3S A;  2F4I A;  1S5C D;  2RDG A;  2EJF C;  4QUF A;  2A69 D;  1F9R A;  1TT2 A;  3DM1 A;  2A5H A;  1QG7 A;  2PCF B;  2K5Q A;  5LHY 1;  3MXP A;  4K5V A;  4R9W A;  1HTP A;  2RKS A;  1YNJ C;  4E6I A;  2YYZ A;  1GUT A;  4OO1 I;  3TP8 A;  5J1Z A;  2KCC A;  3AB9 A;  4JBW A;  1ZEQ X;  5IT9 L;  3K59 A;  3I4M B;  2FHT A;  3NUC A;  4RKL A;  3VYS A;  3SK5 A;  1LTS D;  1BCP C;  2ICE C;  2B2T A;  3SE0 A;  1JR0 D;  3U9O A;  2CVR A;  4JK1 C;  3PIO 3;  1KLG D;  4FF1 A;  3G7L A;  1EZ6 A;  3VR2 A;  3SK6 A;  3S16 B;  5EPL A;  1I4Q A;  4R8I A;  3NSW A;  5FO9 B;  1H9M A;  1FNU A;  3PUW A;  3TDQ A;  4B9X A;  4X3T A;  2NTT A;  4K5X A;  4KN7 C;  5IGB A;  1FGB D;  3IAY A;  3S2D B;  3E0J A;  1GUO A;  3T13 A;  2C9O A;  2RVL A;  1TS2 A;  1HQR D;  1LT3 D;  1WTO A;  2AQ3 B;  3BS1 A;  2TSS A;  2IPK D;  1LTB D;  4V19 0;  2KEE A;  2NB0 A;  2BDN A;  4BA1 I;  5F2D A;  1PFB A;  1TWH B;  2BE5 C;  1X3P A;  3EJI A;  3CQZ B;  1I4H A;  1H9K A;  4PMW A;  3CKI B;  2EYJ A;  1WTR A;  2K04 A;  5IGC A;  1JOO A;  1WTP A;  2A73 B;  4ILW A;  4FF2 A;  3OPO A;  2NZ1 D;  3LWU A;  2M00 A;  4IUT A;  2F0E A;  5BN5 A;  1XYI A;  1NR4 A;  2VXW A;  2QEJ C;  1W6K A;  1Y1W B;  1PRT F;  3NQI A;  2JSO A;  5I2X A;  1KDB A;  1AN8 A;  1B3A A;  3VR6 A;  3O13 A;  2HUG A;  1BDO A;  4XYQ A;  4XQQ A;  3HGB A;  1IKL A;  3S2H B;  2PQE A;  3A8K E;  4CKE A;  3HOU B;  1R4P B;  3HKZ B;  5DNF A;  1VF5 C;  3DWP A;  2E75 C;  2L11 A;  2EYP A;  1SNQ A;  3I4N B;  3U9S A;  3S1R B;  2BDO A;  1WTQ A;  3A8J E;  2F3V A;  4LJZ C;  5CGK A;  2OEO A;  4WOR A;  1LAB A;  1KNE A;  3HRZ C;  5JVG 3;  3GTQ B;  4C3H G;  4EQP A;  1LTG D;  1EY8 A;  1Y8N B;  2R7Z B;  4J6H A;  4KTA A;  4RA8 A;  1CHQ D;  5IGG A;  3OOC A;  5IGD A;  2FIN B;  3S1Q B;  4EQN A;  3FPP A;  1ZYR D;  5KIX A;  1YNN D;  1SFO B;  1EEF D;  3SK8 A;  4OIJ A;  3OSO A;  4KY6 A;  1ONL A;  4A3I B;  1HHV A;  5IGF A;  2NVQ B;  2F0M A;  3IKJ A;  1Q3L A;  3X3N A;  1Q1E A;  4RH6 A;  3QOJ A;  4LK1 C;  1XWE A;  4FXK C;  1GHJ A;  4F87 A;  3SVM A;  1ET9 A;  1ESF A;  2E76 C;  2BA0 A;  2F0V A;  3A8I E;  1WD1 A;  1B53 A;  3M3Y B;  2PYK A;  1GHK A;  5C4H A;  1O7L A;  1SJH D;  2LMC B;  3P75 A;  4L63 B;  2B63 B;  5KYL A;  1T5E A;  5KEE A;  3N52 A;  2NVT B;  4BBR B;  2I46 A;  4QB4 A;  1TS5 A;  4HMJ A;  4P2C B;  2L5T A;  3DHQ A;  4F7X A;  1PZK D;  2F0N A;  4HAE A;  2WAC A;  2AQ2 B;  5CV8 A;  5I6Y A;  5K36 H;  3ND8 A;  3BZD B;  1EU4 A;  2R3Z A;  3P7J A;  1WCM B;  3BVZ A;  2I07 B;  4EGV A;  5D3D A;  2SEB D;  4XTC S;  2OT2 A;  1B9N A;  5EPK A;  5FKA C;  2J0T D;  3OIP A;  1QNU A;  1L0Y B;  3GV6 A;  1SE4 A;  3VYT A;  1BOS A;  1HUM A;  3ND9 A;  2E2D C;  1HUN A;  3D4W A;  1B9M A;  3VR3 A;  3LNN A;  2K32 A;  2VB2 X;  1D2B A;  3ZYY X;  1A2U A;  4KHV A;  4C3J G;  4WRD A;  1E2Z A;  3EQL C;  4CKC A;  3DEO A;  4KD3 A;  1ESR A;  4XXE A;  4A3G B;  2D5D A;  1R9T B;  2FJ2 A;  1PMR A;  2F0G A;  1A6X A;  4HED A;  3NWT A;  3OMG A;  3GQB A;  2B8G A;  4DFA A;  4G57 A;  1OXX K;  1F2Y A;  1WTV A;  1LV9 A;  1IYV A;  5IIF A;  2JP1 A;  3FDT A;  1NAP A;  4KKS A;  2BE5 D;  4XYO A;  3NTH A;  4DK0 A;  2QKI C;  3TN2 A;  2YU9 B;  3NTI A;  1Q90 A;  3E6Z X;  1SE2 A;  1JWS D;  2L4N A;  1TKW B;  1EQV A;  4DAP A;  4G7O C;  4DAY A;  4DF7 A;  5KGU A;  3PO2 B;  2F0S A;  4YIJ A;  1GJX A;  3FPU B;  1EZ8 A;  4IFD G;  3K58 A;  3D6W A;  3EA6 A;  1KNA A;  1D5M C;  2AWN A;  1NSN S;  2IW3 A;  4DA2 A;  2GA4 B;  3E5S A;  5LL6 X;  1I4X A;  3I72 A;  5I9P A;  3J7A V;  2WP8 J;  5DAU A;  3WOF A;  1RD9 D;  4KV6 A;  3GTL B;  3GTO B;  2R93 B;  1S5B D;  1STB A;  1RF2 D;  5A35 A;  4B08 A;  3MEH A;  1HPC A;  2IJ0 A;  3S15 B;  2SDF A;  4FYD A;  3R3O A;  5AFW A;  3HOX B;  2B2Y C;  2EPB A;  4PQX A;  1XXG A;  1MGS A;  1C4Q A;  2BA1 A;  1RJT A;  1IW7 D;  1H9R A;  3S1N B;  1DXM A;  5C3X A;  1BUV T;  1LTA D;  2K33 A;  5ELF A;  1JOR A;  4OGQ C;  1ROD A;  4DAV A;  3M7G A;  2H1E A;  5C3W A;  1E2V A;  4TRD A;  1HFN A;  1MBY A;  2A74 C;  4TQU S;  2NYZ D;  1HXY D;  2NN6 I;  2ENB A;  3Q23 A;  1S5E D;  2XNA C;  3HG9 A;  5D14 A;  3JAM E;  3NE5 B;  1GUN A;  1FNW A;  2IT1 A;  2XSC A;  3P1H A;  2EE1 A;  3VA7 A;  2IX3 A;  1I3Q B;  4OIK A;  3L9A X;  2A68 C;  2KVM A;  2CW0 C;  3MFY A;  1AFP A;  1M4V A;  2WKD A;  1VDZ A;  5C0X G;  1CT1 D;  2A6E C;  3BDO A;  4HTH A;  4ZUJ A;  4ULL A;  2DNE A;  4QMG A;  3T56 B;  3H0G B;  1FYC A;  2DNC A;  3FEW X;  1QWY A;  5ELB A;  1Z7T A;  3NPP A;  3TBI B;  1V8Q A;  1EIH A;  2B2U A;  1AW7 A;  2R92 B;  3MXG A;  5M5X B;  1ICW A;  3DXJ C;  1HTL D;  3D4D A;  1EU3 A;  3CHB D;  5M3M B;  1BR9 A;  3QIA A;  3VA5 A;  1A3U A;  1JWU D;  2F0F A;  3BDL A;  5EJW A;  2E2I B;  1OXS C;  2JEA I;  1PDQ A;  3CRL C;  1QJO A;  3DWQ A;  1TY0 A;  1OXV A;  1EEI D;  3W3A A;  3VR5 A;  4LMQ D;  2EY5 A;  1RTO A;  3MTS A;  3NXW A;  2WII B;  1GUW A;  1EWH A;  1SYC A;  2WKC A;  3J7A F;  1Z6H A;  2LY7 A;  4G7Z C;  1FNV A;  1VF7 A;  2EY1 A;  3J7Y W;  1SYD A;  4Y7N B;  1XX8 A;  1ILQ A;  1JB3 A;  4K8I A;  1FR3 A;  2CQA A;  2K1B A;  2VUM B;  2NUC A;  4IAL A;  1LTI D;  4CJ1 B;  3GTP B;  1G91 A;  3K5M A;  3KLS X;  5BN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...