2CQAA

Solution structure of rsgi ruh-039, a fragment of c-terminal domain of ruvb-like 2 from human cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
95
Chain Sequence
GSSGSSGKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RuvB-like 2
publication title Solution structure of RSGI RUH-039, a fragment of C-terminal domain of RuvB-like 2 from human cDNA
rcsb
source organism Homo sapiens
total genus 10
structure length 95
sequence length 95
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.360 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2cqaA01
2CQAA 2C9OA
chains in the Genus database with same CATH superfamily
2OQKA 4JI1L 1JOQA 2HIVA 1XMOQ 1CKOA 1TXYA 4G7ZC 5A35A 2QDLA 4IFDG 2EXDA 3BYTB 3R2IA 2RDHA 1LT4D 1D8LA 3FPPA 3HFZB 3KJPA 1Q1BA 4QB4A 4B3SL 1BCPC 1KIXA 3HOZH 2KENA 2WAQE 4AH6A 1MBYA 1F77A 1MSGA 1NR4A 2EE1A 2YV5A 1CHQD 1SJED 2R92H 4LF4L 5IP9H 3S15H 2AUKA 1EU4A 3I73A 2VXWA 1IKMA 1DONA 3MXUA 4P74A 3HOWB 4GS3A 2KBNA 4DXGA 3GP7A 5BN5A 3HOUH 2F4IA 1NSNS 3FMCA 2DJFC 5C0XJ 1EY6A 1CSPA 3KF8A 3GO5A 4B9WA 1VQKA 1B4OA 1XWEA 1IKLA 5ELEA 2B2UC 3Q0AA 3QG1A 1WTXA 2EJFC 2LS01 1C0AA 1SYFA 1IBKQ 3HRZC 2RKSA 2WB1E 1PH7A 1E0BA 1HR0W 2QILA 2K6AA 4A3DG 3TEHB 5GAHC 3STBD 3OPOA 1TS3A 3M7NA 4OL7A 3V2TA 5IT9L 2JA7G 5BN3A 1X32A 2RCNA 1SXTA 2P5ZX 3SXHA 3RZOH 3HOXH 5JAVA 2OQ0A 4AYBE 3HOYH 5CC4A 1SFOH 1BCPF 2IW3A 1AE3A 2B2TC 3NK9A 4C3IG 3M3YH 1Z9FA 1GUSA 4K8JA 2E2DC 3H3VC 5IOCA 4A3FB 2G9HD 3MZ5A 3JAMc 4HIMA 1DOMA 2KCMA 3PUVA 5ELBA 1AN8A 1I6VC 1KLUD 4JOIC 1C4QA 2AQ1B 4DV1L 3CF5A 2SNSA 4NXNL 1SNDA 2B63G 2CVRA 3ND8A 3BZDB 3K81C 4LFCQ 4HJAA 1EIYB 1BO0A 4JI7Q 5D14A 1IBLQ 4JBKA 3NELA 2F0JA 2F0VA 2JN4A 2UUAL 2R93B 4JI6L 5IYBH 1BKBA 1K8GA 3HOVG 2KA7A 1Z7TA 2NVTB 1WVLA 1UUPA 4L63B 1PH8A 2Z1CA 5C5MA 3S14B 1WFQA 5J39A 4GN4B 2IWHA 4P71A 2UUBQ 2ZTDA 1ASZA 1B2TA 2NVQH 4Q0FA 2K5NA 2TMPA 5D3DA 3ERSX 2A5HA 4FVMA 1HPCA 4XQQA 3TP5A 3ERQA 4C56C 3PO3G 5D3IB 1EU3A 2A73B 1D5ZC 3K5OA 5GADC 1QJOA 1TS5A 4LWCA 2PCFB 1I4RA 4O0AA 1A6XA 2MNAA 4EQNA 1R4PB 1YJNA 4IUQA 5NUCA 1CA6A 1QUQB 3H09A 4XYOA 3AMUA 1O7LA 4NB3A 5KYLA 1JB7A 2KEEA 4KKTA 4X64L 2A74C 2WIIB 3K8AA 4K5XA 4Z9CB 1X3GA 3AFQA 2EQSA 1XNRQ 5FOBB 1H9JA 1EWHA 1HQMC 2NN6H 1AE2A 1YZ6A 3UE0A 1N34L 5M3MH 2CKZB 1S5CD 3T1YQ 3OTOQ 4G7HC 2OTLA 2F0WA 1H9SB 4JK1C 1E7ZA 2PYKA 3J80L 2KEDA 1K28A 1TQOA 4X62L 3A7AB 2PMZB 3BZCA 4RHRA 3X3NA 2PW5A 4J1MA 4EGVA 1A8VA 5HGQA 1DOLA 1GUTA 2VQEQ 1VQPA 2E2IH 1E2ZA 1HA5A 1ET6A 4OO1H 1JC7A 2E2HH 4RCOA 4X3UA 4PMCA 4TKOB 5C4XG 1BBUA 3H94A 4RA8A 4LFAQ 1SRUA 3CQZB 3VR3A 4A3CH 4G4KA 2ICEC 2LY7A 2R61A 1Y1VH 4ULLA 1PH1A 1YJ9A 5TSSA 4RGTA 5E1FA 1BUVT 4LF5Q 1EY0A 3GTGB 4FNFA 3DM1A 1BBXC 1PTOH 1Z47A 3J81j 5IGBA 4IJLA 4PG3A 1BOSA 1CHPD 2VL6A 3LWUA 4PZ6A 4UP7A 1XYIA 3A56A 1PVOA 1JWUD 1BNZA 1N33Q 1PYBA 2BA1A 1XPUA 3M9BA 4A75A 1D5MC 4ZCKA 4DV5L 1K8OA 5I4DA 4A3EB 2RA4A 1WTHA 3EJIA 3SHLA 5M5XB 1XTDA 2F4VQ 4IOAA 4GOPB 1TWGH 3MC0B 1VQOA 1PFBA 3S2DH 4I7ZC 1Y8PB 2H4OA 3KK7A 5GAEC 5C3EB 1VQJA 3A5UA 1YHQA 1M1KC 4B3MQ 4IN3A 4DUZL 4V0BA 1HZBA 1VS0A 4IPHA 2K03A 1GHKA 4KD3A 2MP1A 1PYWD 2DUDA 2F0DA 3DEOA 4C3JG 2I5MX 3F2UA 5DEHA 2K14A 1K0RA 2XGTA 1GHJA 1HQRD 1H9MA 1TR5A 2F0FA 1RTNA 1I4XA 2AKWB 2A6HC 2JA6G 1YNXA 3Q22A 4DR4L 3G48A 4FO2A 1VQ8A 2ES2A 4KHVA 3PCOB 4ME5A 2PW7A 2SOBA 3GTJB 1ENCA 2DY7A 4C3HB 3WWVA 4R8IA 3IL8A 4LF6L 4MIUA 4FXKC 4LF8Q 3HEJA 1V1OA 2XN9C 1QVCA 2AMCB 5C4JH 1EOTA 5C0XI 3I4NG 3TP6A 2JA9A 4A3BB 4YCVA 2PO4A 3HKSA 2CWAA 3MXPA 1KAWA 4DA2A 3MAQA 2E74C 5IYDG 1ZXTA 4HJ7A 1XMQQ 4JI8Q 3X3MA 2IPKD 1BF4A 3PIO3 5EPKA 2EY5A 1MSHA 2L1BA 1UE6A 3BVMA 3I4MH 4X3SA 4AIMA 1B44D 1LTGD 3AYHB 1HXYD 1EEFD 4BBSB 2WACA 2JA5G 4HSPA 4KLKA 3U58A 4RGNA 1N32Q 3D3RA 5IYCH 4X65Q 1SNOA 3NTKA 3MXNB 2C35B 4K6LA 2A6HD 1LTLA 4BY7H 2PQAB 2UXDQ 1SMXA 4KKSA 1EOVA 1G51A 2BOSA 5K5PA 3C46A 4FP5D 3HOZB 4YCWA 1DD2A 2RDGA 1HUNA 4GN3B 3S24A 3D4DA 3PO2G 5J1ZA 2R92B 3VDYA 2QEJC 3S15B 2E2JH 2G5DA 2RCFA 1UEAB 2HCCA 4DR6L 2E8GA 3DWAA 1Q7YC 2OCEA 3HOUB 3K7UC 3TBIB 1OXUA 2Z4HA 4YY3Q 4GNXB 4C3IH 3ZJYC 3L9AX 4EQ5A 1QZGA 5AJ3L 2KJXA 2Z9HA 5EJWA 1SNPA 4DAPA 3W1BA 1BDOA 1HFGA 1YNJC 2DJGC 2PZTA 1LV9A 4FXDA 3R3OA 3L0OA 2NTSA 3M4YA 1SROA 3MA2B 3IAYA 2AUJD 3SK8A 1M90C 2L55A 1NR2A 3QO2A 2VB3X 2L4NA 5JOBA 2K75A 3G71A 3BVGA 1HJPA 4DU9A 4BA1I 3D4RA 3I55A 3RZOB 5ELCA 1I4PA 2XWBB 4XT1B 1SMYC 3IKJA 4RGMA 3CPWA 1CT1D 2F0TA 3KOJA 3HOYB 2N3SA 1SFOB 2EY6A 2DGYA 3HOVH 1STEA 4NXML 4DXFA 1B3AA 3M3YB 3TSSA 4WFN3 3N52A 2KUMA 5C3XA 5CYUA 1Y1WG 3FP9A 4CHTB 2JA8G 1HNZL 4DAMA 4KD4A 3BS1A 3E0JA 5IP7H 1F9SA 1II3A 1AZPA 1JJGA 3SK4A 1EFID 3PO3H 2BE5C 4DR1L 4J6HA 2HUGA 3S1QH 1RKNA 1S4ZA 4IQZA 3VYUA 1IW7C 2WKDA 2IX0A 2F0NA 4OELB 1NE3A 1JR0D 4GKJQ 3A55A 1Q81C 3E6ZX 2CQAA 1XTCD 4KHZA 3W2DA 5C44G 3TS2A 3RR5A 4A93G 1EFWA 4LF7Q 5M5YH 4BY1G 4A3GG 4QUFA 1QNUA 3KBGA 1LM0A 2F1MA 4OIJA 3NBHB 4OWTB 1EYGA 1B53A 1O78A 2C5CA 3JAML 4QIWE 1GXDC 2K50A 1P16A 4GZYC 1IHZA 3N6RA 3T51B 2ZJPA 1KAAA 3W3AA 1KNEA 4BBRH 2M2LA 3GTLH 1G6PA 1UWVA 4LF9Q 5FJ8H 4ZKCB 3UDIA 1J8IA 1QVFA 2YTVA 2WB1G 5EPLA 5FLXE 5IWAL 4LFBL 5FLMH 5M3FG 1KDAA 2EVBA 1TS4A 4O42A 1EQRA 2Z6KC 2VY3A 2A8VA 4FXGC 2Q8TA 4DAYA 3EN2A 4H7BA 5EPJA 3SK6A 4XYQA 1A3VA 4B3SQ 1VQCA 2ZM6L 3CRLC 1ET9A 3CCRA 2SNMA 1ICFB 2NVXH 5L37A 1XNQQ 2K52A 1RD9D 5M3MB 4IPCA 3J7AV 4TRDA 1KNAA 1N9WA 2DY8A 2EYPA 2F0LA 4BA2I 1QUQA 2IHEA 2QKIC 3A8KE 3BYYB 5HURA 3DLLA 5GAGC 5EQ0A 4LF4Q 2R7ZG 3TZUA 1I94Q 3K5MA 3DMUA 1XPRA 1H95A 3QB3A 1VQ9A 3G7LA 4JYAL 2E2IB 5EBCA 2HT1A 2MQHA 4ID6A 4PNYA 1RDPD 2Q8IB 4OWXB 3CC4A 1FGUA 2E2HB 1MGSA 2AHOB 4P73A 3CMAA 4A3IB 3ND9A 2RBMA 4R4IA 2X69A 4EX5A 3AU7A 1QOHA 4IO9A 1KDCA 2BA0A 5JEAG 1WD1A 5E4XA 1Y1VB 4DF7A 4JBWA 3M85A 2QEXA 3LX0A 5JPMC 2JK8A 5CORA 4IFDJ 3AFPA 5HGTA 1EY5A 3VR6A 3TDQA 1WTVA 1E24A 2F0IA 4KHPL 1PTOB 2AWNA 3A8JE 4A3KG 3RNUA 2HCIA 3HKZE 4JI2L 2LSSA 1ENAA 3BDOA 2NZOA 1KABA 4G7OC 1RF2D 1DXMA 1DYQA 3BDLA 5KNDA 1CKMA 1NMGA 4PV1C 3P20A 4LW1A 3C1EA 5LMUL 1ASYA 3PMFA 1F9QA 4DR7L 2HHHL 1N36L 3GTMH 2K5WA 4EQOA 1BXTA 4Q5VA 3IFTA 5LL6X 1TWGB 3S2DB 1IBML 2F0KA 3S1NH 1TY0A 4B3RL 1EQQA 4DV1Q 5IGCA 1D6EC 2PZWA 5KRUA 4XQJA 2UXBQ 2JQOA 2R3ZA 2VQFQ 1A0IA 5JPNC 3DWPA 4DFAA 3QWNA 1T5EA 1WTPA 5IYDH 4N8X1 4HMIA 2VUMG 2OT2A 2UUAQ 2QA4A 4R4TA 4JI6Q 4DUYL 2GVAA 4HEDA 2Z4IA 4GOPA 4IJHA 2E76C 4POGA 3E9HA 1GUNA 1KL9A 2JA5H 1N8RC 1K83B 3MFGA 1X56A 2RHSB 4JPBW 4HIKA 1HA6A 1SJHD 4HAEA 1G6ZA 2EPBA 4JI4Q 1X54A 4CDCC 4CKEA 1IYUA 5C4JB 1XJVA 2QDBA 4CDFC 1YI2A 4IUPA 3K0YA 2XWJB 4B9XA 3GV3A 1A15A 3FEWX 4A3LH 3NWSA 1Y69U 1BCPD 4S3SA 2NYZD 5C0XG 2UU9L 1RODA 3PIPA 1HTPA 2Y0SE 4KTAA 4KY7A 2R93G 1FD7D 4QUCA 4WJWA 1A63A 4X64Q 4L5RC 4QQBX 5CGKA 3PO2H 1CZGA 2NZ1D 3FRPB 4ZQ3A 3CC2A 1LLRD 4RFBA 3T13A 1NAPA 1U4RA 3I4MB 1TWAH 2O2LD 1XMOL 2Q2HA 5G3LF 5T1IA 2GA4B 2EYOA 2XRQD 1N34Q 4Y52H 4QJFA 3J7AF 4GKKQ 1SDFA 1PXUA 1Q46A 2K32A 2Q8RE 1QG7A 3PF5A 4FYDA 5I2YA 1O80A 2KHIA 1OO9B 4L5TA 3WDNA 1U4LA 4OONA 4CJ0B 4X62Q 1IXRA 2EY2A 3NE5B 1U5KA 5FLXc 3S16H 3FKIH 4JV5L 1HRJA 2UUCL 4LUVA 4DV3L 4BY7B 1LTTD 3F8TA 3RLFA 2OWOA 2I07B 3J81i 1VQ5A 1VCIA 3I3CA 1SNMA 4K5VA 2CH4W 2NN6I 4ABNA 1PRTC 4A3DB 2AQ2B 3BJUA 1F9PA 1MKHA 1Q90A 4IUUA 3K7AH 4B3TQ 3OSOA 3HS0C 4RMFA 1AFPA 4DGZA 2E2JB 3MXNA 1VQHA 3J7YW 3DWQA 1JWMD 1HNXL 1HTLD 1IYJB 4JI0Q 4C3IB 3OMGA 1J9OA 1CUKA 4YHHQ 3W1GA 1SN8A 4ZLTF 2EJMA 4OO1I 5ELDA 3M4QA 5CV4A 1Y1WH 3HG9A 1SAPA 3CKIB 1STGA 4TVAB 1FL0A 1ZKOA 4GOPC 3A8IE 4KMUC 1HHVA 2D5DA 2BH8A 2VS1A 1UNSA 1QZHA 1OXVA 3KDFB 3S1MH 3RMHA 2HIXA 1E1OA 2G9DA 1YBYA 4GNXA 1JCKB 3RN2A 1BQQT 1CKNB 3U50C 1MD2D 4A4IA 2QW7A 1FYCA 3K80C 5H1SE 3NQTA 3HOVB 4MHEA 3CCMA 5C4HA 2D0OA 1PRTD 1YJWA 4HIDA 4BXXG 1Y8OB 2QCPX 5CBAE 1PRTF 4DUZQ 2O5JC 4R4OA 4KKUA 3VA5A 2L5TA 2R6GA 3EIVA 1Q1EA 1F2YA 3I72A 1IYVA 5GQOA 5DAUA 4H44C 4A3IH 5F2DA 2J7ZA 4CJ1B 1PZJD 3M7GA 3PO3B 2YTYA 4R8NA 3VYRA 3S1QB 3H0GH 1F2MA 4RH6A 1SYGA 2K04A 4LFCL 2O4XA 1STNA 4A3EG 2XVSA 2F3VA 4K8IA 5KIXA 3NTIA 4DR3Q 4PZ8A 4IPGA 2CQOA 1R9TB 1G291 3F2BA 1LTAD 1C7YA 2X6LA 4K5WA 1FGBD 4OX9L 5M5YB 2J4XA 1X6OA 3TREA 3ER0A 1K3BC 1A2UA 1SBBB 4CGYB 1R4QB 3M4PA 2UXCQ 4XTCS 2D62A 1YHBA 3MTSA 3IFDA 2VW9A 5BR8L 1TU2B 5FKAC 4LUZA 3TMEA 2H1EA 1LT5D 3KYHC 2BDOA 4F8MA 1AZQA 1LT6D 2IT1A 2BCOA 4IFDI 4ILWA 4BBRB 4IALA 3GTLB 4YWKA 1I50H 4G57A 5CBEE 4C3HG 5FK9C 2CWPA 3J81E 3T4AC 3NBHA 3GD7A 3KUPA 4A3JG 3HP3A 3GTOB 2JEAI 2ATWA 4DNIA 1JJ2A 4X3KA 4Y7NH 3KF6B 2I46A 5CV9A 4BWGB 1I4QA 4CBVA 3P1HA 3R2TA 4QL5A 4UP8A 5KEEA 5JEAH 3QIAA 4A3BG 5EKIA 1L0XB 3CRKC 2NVXB 1D1IA 2MPMA 3I56A 3OTOL 1TWFH 3T1YL 2N49A 4YWMA 4GNXC 3QOLA 3T1HQ 5E3FA 2KVMA 5LMNL 4JI5Q 4R4CA 2PMZE 1A62A 3NPPA 4DR2Q 2D0PA 1PDQA 1WCMG 2WFWA 1K83H 4IUTA 1Q12A 4H13C 4A3KH 4BBSG 3F2DA 4DV6L 4DR6Q 4DKAC 1W2BA 4IFDH 5FO8B 1XX8A 1VQ4A 4ZAIA 3S9WA 5KGUA 4LFAL 1X3PA 1HFNA 2KHSA 4X66L 3BDCA 2A69C 4KI0A 5E4WC 4DV2L 1ZEQX 2ZTCA 3SR1A 5AJ3Q 1PV4A 2Z8LA 1VQMA 3JC66 4OIKA 1VQFA 5AFWA 4TQUS 1X3EA 4GLAC 1HNWL 4A3MG 1Q8KA 1YIJA 1DJRD 4TSSA 4ALPA 1S5BD 2R92G 1YNNC 5LL6S 5IP9G 2BDNA 1GVPA 2HQEA 5IGGA 3FDTA 3K5LA 5CV7A 1L1OB 1LABA 5JVH3 3HOUG 1ZYRC 3ONAB 2L11A 2JJQA 5ELNA 2L12A 4CDEC 4JCVE 2F03A 3OW2A 1N33L 4AQYQ 2EYLA 1HZCA 1T9HA 3GTKH 3KLRA 4EQPA 2PPBC 1FNWA 1X3FA 2CW0C 3VYTA 1ONLA 2NBFA 1D5XC 2QF7A 5D65A 3GTMB 1A2TA 2R7DA 1HNZQ 4X3TA 1UE5A 1KTKA 5KYIA 4A3DH 1NBWA 1JORA 1TIID 4QY7A 3D8GA 3S1NB 2N78A 2JA7H 1FVIA 2A69D 3T16A 1Z6HA 3CCEA 5DM73 1NTGA 1JQYD 2LFNA 3I4NB 3HOXG 4KY6A 3HOYG 3ULLA 2TSSA 4DK0A 2KQ3A 2Q2TA 4RWSC 4NW2A 1VQNA 1YNND 4A76A 3PF4A 2B39A 3A0JA 4DNRB 5IGFA 1X9NA 2Z6KA 2JA5B 4K14A 4LF8L 1NJIC 2GN5A 2MJ8A 1ZYRD 3A5ZB 1SYDA 2F0QA 1TKWB 4LK1C 5J3BA 3E9IA 2CCZA 2XTIA 1VQEA 1RHPA 1RL2A 3U9SA 2I5HA 2B63H 4QGUA 1VQDA 4IPDA 1LT3D 3CCLA 1F9RA 5JJLA 3TQYA 2WKCA 1I3QH 3DXJC 2ASBA 4JI8L 1STHA 3GQBA 5IYBG 1K0SA 4RGOS 2O5IC 2ALYB 3K0XA 4HMJA 3PO2B 3OYYA 3SDZA 3T56B 1RJTA 1KD1C 1BBWA 1IZ6A 1V1QA 3CD6A 1TWAB 4R4QA 2JE6I 4RHSA 2ZTEA 1PFMA 1B70B 3HKZG 4J8QA 4NPSA 5JVG3 1D2BA 1LYLA 1LTBD 1EQVA 1EY9A 3HZXA 4GN5A 3R93A 1PH9A 3U4VA 1SYBA 4F87A 3H3VH 1KDBA 1KQSA 4UHVA 3J81c 4HIOA 2Q2UA 4PMBA 4JBMA 1YNJD 4DV7Q 2B2WA 3S16B 3FKIB 5I6WA 4DV0Q 2EYFA 1R9TH 4FF2A 1DGSA 3NUCA 4JI3Q 1V9PA 1FJGQ 4RAUC 2RDFA 4UPAA 5ELOA 3K7AB 1EWCA 1CSQA 1MJEA 4MTNA 1PTOC 5JJZA 1KXLA 2NN6G 1SE2A 4ZKBB 4EVOA 1AH9A 1I4GA 2KHJA 1SMYD 3RZDH 5M3MG 3NENA 2VZAA 3I2ZA 1ML0D 3G6EA 4ZYSA 4QCLA 1SYCA 1Q3LA 3SK5A 4BXXH 1WTQA 4F88A 5C5LA 1Q8IA 3VA7A 3MHBA 1G8ZD 1Y1WB 1PMRA 1T5XD 4JI1Q 1B9NA 4L5QA 4UP9A 1S40A 5FLXL 3GTOH 4OO1G 1SYEA 2A6EC 5C4XH 5I6YA 1MJCA 4DK3C 2FMMA 1UEBA 2BE5D 2GVBA 3GTPH 1D7QA 3S1MB 1HUMA 3EA6A 2K5VA 4OGQC 1IW7D 1GUOA 3MFYA 4QMGA 1EEID 2ZJRA 4A3CG 1N36Q 1Y8NB 3NEMA 2B3GA 1TWCH 1Y1VG 3OW7A 3UE1A 2PQEA 4RKLA 2ID0A 2Y0SG 4UDUC 2HD3A 3CCVA 3NWTA 2WAQB 4HSVA 3KJOA 5EKLA 2N8NA 4A3GB 2KECA 3BZKA 3SGIA 1G2TA 4OEMB 3KDFA 1L2FA 1TY2A 3PQIA 1PTOF 2F3IA 3DHQA 1JE4A 5JEAJ 1B1ZA 2RHQB 2MO0A 2ZXPA 2NZHA 1CKNA 1XXGA 1L0WA 1EZ8A 1H9KA 5CV8A 1PH4A 4I7AA 3NP8A 3H0GB 2WINB 1H9SA 1I6HH 2F0PA 1X3QA 3L3OC 1AP0A 1G91A 4DPGA 5IY0A 1JB3A 2XSCA 2ENBA 1EWIA 2YU9H 2A6ED 5DLQE 5CMDA 3PGZA 5M3FB 3L7ZC 2B2WC 2DN8A 3OIQA 3U4ZA 2FFKB 4WORA 4C3JH 3HOWG 3LNNA 3GDEA 2A19A 4E6IA 2UU9Q 1SE8A 1VMCA 4HJ9A 2K5HA 4KN7C 4OHJA 4AYBB 3PIOA 3J7A5 2K7VA 3CC7A 2JXMB 1ESRA 2EOTA 2I5LX 1GUWA 3Q23A 2JA6H 4HJ5A 1HR0L 2EY1A 5M5WH 1CK1A 4RCNA 1WCMH 4ZK9B 1PH6A 3I8ZA 3WOEA 3B6YA 1MI2A 1CQFA 1I50B 3K6OA 4DV4L 1VQ6A 3F1ZA 4XXEA 2CFMA 1QB5D 2PI2E 5EAYA 3M4OH 2A1AA 4NP5A 4DNTB 1WOCA 3STBC 1SSOA 5A2QL 4OXPA 4NKLA 3I4NH 3QJYA 5A2QE 4Y7NB 4NXNQ 4RKBA 1A3UA 4IOCA 4LJZC 3C3LA 3U9OA 5JJIA 2Z0SA 4DK1A 1XNQL 4JV5Q 4A3MH 1MHWC 5IGDA 4DV3Q 2UUCQ 4DR5L 2DNEA 1E1TA 3MWYW 2F3WA 5ELFA 1TWFB 1VQGA 1OXTA 1SLJA 4KK7A 3OWEB 2HDMA 4K0KL 1EIGA 1K8AC 4KJOA 1I94L 2K01A 4APVA 4A3FG 3I4MG 2EJGC 4A3KB 1W6KA 3KF6A 3CP0A 1W3SA 1FR3A 4GLVB 2E5LL 1U9RA 4K2KA 3D4WA 5IYCG 1KRSA 2XIWA 1HNXQ 3IRBA 2IL8A 1KHIA 1PA6A 1B7YB 1J5EL 1VQBA 2N88A 1NCVA 3D31A 3J80i 4PZ7A 5I9OA 2EYHA 2WP8J 1EL0A 2VB2X 4BY7G 5CV6A 4DAVA 4FF3A 4P2CB 3E3XA 3S17H 3DUZA 1VF5C 1WTRA 1GOZA 2F0UA 3MXGA 4C2MH 5GROA 5G3LD 5IT9E 2DNCA 3P75A 1MIUA 1SE4A 1Q86C 1WJJA 1WYDA 3D6WA 3RD4A 2C9OA 2VUMB 4DK6C 3CW2C 1PZID 2ZXOA 4JVZA 3S1RH 2A68C 3OHXC 5I9PA 3GTKB 5KNBA 1H9RA 1BVSA 2BH2A 3I91A 2J0TD 4YWLA 3UDGA 5EBDA 2NB0A 2SEBD 1IL8A 4WJ4A 1AEXA 1M4VA 4JC0A 3ITPA 1W6JA 1IL2A 3GV6A 1L1OA 1DCZA 3Q8DA 2ZXRA 2D2CC 3BG3A 4CKCA 2RSOA 4FDBA 3EFXD 1V1PB 2JA7B 1JE5A 2UXBL 1BCPB 2I0QA 5ISRA 4HR7B 2VQFL 1GO3E 1M8AA 2B29A 2JSOA 1TWHH 2XRSD 1SEBD 1JJCB 2PQAA 1HZAA 1NUCA 2XNAC 1GKHA 4QF4A 2FMCA 2SDFA 3OMCA 4OX9Q 1U4MA 1IBKL 5K36G 3KFUA 2JA8H 1RCVD 1KC8C 1EIFA 1SNQA 5C4ZA 1LTRD 2QGQA 1P8LA 1PH5A 2B8GA 1PFSA 4JI4L 1CZWA 2NVYH 4LUOA 5IP7G 2EYMA 2WV6D 3EROA 1O7ZA 2MUYA 5BR8Q 4DAYB 1WI5A 3EVQA 2A68D 2B63B 4ZUIA 4UAIA 4DV5Q 4FF1A 4ME3A 4I65A 1I3QB 4J15A 1EYDA 5C44H 2F0EA 4A93H 3O13A 4BY1H 1JOOA 3I70A 3SE0A 4A3GH 2JEBI 1CFMA 2B8FA 4WRDA 3H15A 1SNCA 1FNUA 1KRTA 2JYOA 1AW7A 1B3QA 1U0LA 3PUZA 4GKKL 4MN3A 3I7FA 4H0LC 2KCTA 3K57A 5LMNQ 4IZ8A 3J80E 4DR4Q 4BBRG 3CXCA 2PZUA 4JBJA 3TS0A 3OOCA 4JI7L 2MO1A 1IBLL 5FJ8G 5IE8A 4XT3B 2NUCA 4LF6Q 4DV6Q 2K4KA 3KLSA 1U4PA 5M3FH 3VR5A 1PZKD 2OTJA 4NMZA 5FLMG 5C3EG 3NTHA 2R7FA 3GTQH 3D0FA 3DEPA 3WOFA 4B3TL 4X66Q 5IGEA 4DV2Q 2LMCB 1F2LA 1OXXK 2UUBL 1Q82C 3KLSX 2LKVA 3CCJA 1L1OC 3S2HH 1Y14B 3LWEA 3RZDB 1HNWQ 1B50A 1EYAA 4JI0L 1PHJA 5BN4A 4ODGA 4YHHL 1JT8A 1PRTB 4MTKA 2R7ZH 1L0YB 5IODA 2MHVA 1EQTA 4ZUJA 4JW0A 3A74A 3RLNA 5JJKA 3W5OA 3J81L 1VQIA 2RVLA 1CQVA 1TVXA 3Q6SA 1YEZA 2JP1A 1GUGA 5C4XB 3A54A 4N9TA 4MNOA 3I90A 1XNRL 3GTPB 1X65A 1VDZA 1KLGD 3I4LA 4C1NI 2RQXA 5DNFA 3KF8B 3PV0A 4XDXA 1V43A 2B2VA 5EGTA 1O7YA 3T53B 1TWCB 4KV6A 4WJ3M 5COYA 3RN5A 1B9MA 5IT9c 3BU2A 3I4OA 2VNUD 1BR9A 2PI2A 2RSNA 3H6MA 3HOWH 2VQEL 3A7LA 1LTSD 1K73C 1TT2A 2L15A 1RIPA 2B2YA 1QWYA 1EIHA 3PUYA 2K5DA 4X6AH 3K5NA 1LTID 1EY8A 5E7NA 1EY7A 1YVCA 1S5ED 1S72A 1I6HB 3VR4A 2X6GA 1VQAA 3FVQA 3QOJA 4DR3L 1DZ1A 4KY5A 3HOZG 1OXSC 4POFA 2IX3A 2N55A 4LF5L 3KLWA 2ZT9C 4A3JB 2YU9B 2NWGA 1CI3M 4L6TB 1O7IA 1STBA 4R9WA 4IUNA 1E3PA 1QVGA 4C3JB 2UXCL 2ZJQA 4IURA 1S5DD 2LXKA 4HJ8A 2VUMH 3AQQA 1QCBD 4LNQA 1YHAA 1PLFA 4NXMQ 4F7XA 2CH4A 3V96A 2HQLA 1V8QA 1NMFA 3VYSA 5C3WA 2JA6B 1ILQA 5FO9B 5I2XA 3D6CA 4A3FH 4K6DA 1FNVA 4HCEA 5M5WB 1LO5D 1WCMB 4CKBA 3ICEA 2EYJA 3H91A 2F4VL 4MZ9A 5LMNW 1E2WA 3ULPA 2FINB 4B3ML 2KCCA 3JAMi 1VQ7A 1EY4A 3M4OB 4U68A 3MVVA 4DR1Q 3TP8A 2F52A 2Q2IA 3AB9A 2NTTA 1HZ9A 3UDFA 4A3LG 5C0XH 4OWWB 5CV5A 1K9MC 3CPFA 1LUZA 2R93H 2FJ2A 3LGJA 4A3MB 1VMPA 3T1HL 2NVTH 3UI2A 1JMCA 4R1JA 4JI5L 4IUVA 2D9UA 3K59A 4DR2L 3NBIA 3S14H 4M8AA 1SR3A 4UY8C 2B2VC 5J22A 3L2PA 1WD0A 4HN7A 2OEOA 4PQXA 3H3VI 1F2ZA 1PH3A 1RTOA 4U673 3J80c 3CMEA 1CA5A 4QIWB 2L0CA 1HCZA 3TN2A 1EUJA 1JOKA 1E22A 2B2YC 1GD7A 2CW0D 3K58A 2FHTA 2EXZA 4JG2A 3AEVA 1QE6A 3FKIG 1ENFA 1E2VA 2OXPA 4K2LA 1XMQL 2YTXA 3C1FA 3G6JB 3SVMA 3NHHA 1I4HA 2F0GA 3S17B 3PUWA 3PIP3 5IWAQ 4LFBQ 5HY6A 3CCQA 1C9OA 4RG1A 1HH2P 3P7JA 3KBXA 4C2MB 4N8FA 2EIFA 2HDLA 4V190 4P75A 3HOXB 1S3OA 2ZM6Q 1N32L 4ZRZA 1C8CA 4N9PA 4X65L 5DM63 1LACA 4FF4A 4AQYL 4YIJA 2EZVA 4KN4C 2L9HA 3F2CA 2K1BA 3EBEA 4LAAA 3S1RB 1ICWA 1I5FA 1UE1A 5K36H 2M00A 2UXDL 4XQNA 2ICIA 4M1UB 4JYAQ 2KCNA 1STYA 1JWSD 1YITA 2IX1A 1GJXA 3HGBA 4L8JA 5CR3A 1QNKA 4CDDC 3CQZH 5M9OA 1PH2A 3PSIA 5EKKA 2E75C 5LHY1 3CCSA 3OWFA 3J7ZC 1GM5A 1WTOA 2K05A 3RLOA 4YY3L 1TWHB 1SE3A 2MFIA 3CAMA 1NY4A 4NDXA 2YYZA 3GTGH 5C6AA 2WAQG 2RF4A 2IHFA 1A3TA 1XPOA 4KHPQ 1NNXA 2IY5B 2KOLA 3MEHA 2FXQA 2PNRC 3NSWA 4C1NK 1UAPA 4KJNA 3TZDA 2JA8B 4LMQD 2M9VA 1V1PA 1OTCA 2PNHA 2CHBD 2NVQB 2NVYB 3V05A 4JI2Q 3HKZB 3R8BA 4CJ2C 3JAME 3PUXA 4A3IG 2EDGA 5T1GA 2H5XA 1C48A 1TS2A 2K33A 2AWOA 4HCSA 3H0GG 5LMUQ 1HR0Q 2V1CC 3Q24A 2MGSA 5FO7B 3E0EA 4P72A 4A3EH 4DR7Q 2HHHQ 5M5XH 1CM9A 4XIGS 4DV4Q 3URYA 3CCUA 1ESFA 3DM3A 5C44B 5C3EH 4A93B 1IBMQ 1ILPA 4L5SA 4BY1B 3OIPA 4YCUA 1VQLA 3QR8A 4BS9A 4GLXA 4B3RQ 4HTHA 3ULJA 3E5SA 1J6QA 3EQLC 1PTOD 2B2UA 4H02A 2Z6BA 3TRZA 2F0HA 4AYBG 4DR5Q 3FHWA 1STAA 3UDXA 2F0MA 1DM0B 3BVZA 4DUYQ 2AQ3B 3FPUB 1S5FD 1X55A 1WTWA 1PFNA 4K0KQ 3G4SA 1K8MA 2K28A 3GTJH 4DV7L 4GKJL 3CU7A 4C3HH 1CTMA 3RUZA 1EZ6A 4DV0L 4DN4M 1PYSB 4JI3L 2WB1B 4A3JH 2E5LQ 3VR2A 5IIFA 1K3RA 4LF7L 1FJGL 3SEBA 2B2TA 3MEFA 1DOKA 3TP7A 3GTQB 1J5EQ 4PMWA 1B8AA 5KNCA 4A3BH 1EYCA 2F0SA 4O1NA 3S2HB 2V4DA 2IJ0A 1G2SA 1JICA 3CHBD 1VF7A 1UE7A 3C2PA 2LXJA 1D1KA 2Y0SB 2K5QA 1QILA 3NXWA 4O2DA 3ZYYX 2F0OA 3NQIA 4B08A 4LF9L 2R7ZB 2OF1A 4BBSH 4JOIA
chains in the Genus database with same CATH topology
1JOQA 4G7ZC 5A35A 4IFDG 3BYTB 3R2IA 2RDHA 1LT4D 3FPPA 1Q1BA 4QB4A 1BCPC 1MBYA 1F77A 1MSGA 1NR4A 2EE1A 1CHQD 1SJED 2AUKA 1EU4A 3I73A 2VXWA 1IKMA 1DONA 3MXUA 3HOWB 4DXGA 3GP7A 5BN5A 2F4IA 1NSNS 3FMCA 5C0XJ 1EY6A 3KF8A 3GO5A 4B9WA 1B4OA 1XWEA 1IKLA 5ELEA 2B2UC 3Q0AA 3QG1A 1WTXA 2EJFC 2LS01 1SYFA 3HRZC 2RKSA 1E0BA 2QILA 2K6AA 3OPOA 1TS3A 3M7NA 4OL7A 3V2TA 5IT9L 5BN3A 1X32A 1SXTA 3SXHA 5JAVA 5CC4A 1BCPF 2IW3A 2B2TC 3NK9A 4C3IG 1GUSA 4K8JA 2E2DC 3H3VC 5IOCA 4A3FB 2G9HD 3MZ5A 1DOMA 3PUVA 5ELBA 1AN8A 1I6VC 1KLUD 1C4QA 2AQ1B 2SNSA 1SNDA 2CVRA 3ND8A 3BZDB 1BO0A 5D14A 2F0JA 2F0VA 2R93B 2KA7A 1Z7TA 2NVTB 1WVLA 1UUPA 4L63B 2Z1CA 5C5MA 3S14B 5J39A 2IWHA 1B2TA 4Q0FA 5D3DA 2TMPA 2A5HA 4FVMA 1HPCA 4XQQA 3TP5A 3ERQA 4C56C 5D3IB 1EU3A 2A73B 1D5ZC 3K5OA 1QJOA 1TS5A 2PCFB 1I4RA 1A6XA 4EQNA 1R4PB 4IUQA 5NUCA 1CA6A 3H09A 4XYOA 3AMUA 1O7LA 5KYLA 2KEEA 4KKTA 2A74C 2WIIB 4K5XA 4Z9CB 5FOBB 1H9JA 1EWHA 1HQMC 2NN6H 1S5CD 4G7HC 2F0WA 1H9SB 4JK1C 2PYKA 3J80L 2KEDA 1TQOA 3A7AB 2PMZB 4RHRA 3X3NA 4EGVA 2PW5A 4J1MA 1DOLA 1GUTA 1E2ZA 1HA5A 1ET6A 4OO1H 1JC7A 4RCOA 4X3UA 4PMCA 4TKOB 3H94A 4RA8A 3CQZB 3VR3A 4G4KA 2ICEC 2LY7A 2R61A 4ULLA 5TSSA 4RGTA 5E1FA 1BUVT 1EY0A 3GTGB 4FNFA 3DM1A 1BBXC 1PTOH 1Z47A 5IGBA 1BOSA 1CHPD 3LWUA 1XYIA 3A56A 1JWUD 1BNZA 2BA1A 1D5MC 1K8OA 5I4DA 4A3EB 2RA4A 3EJIA 3SHLA 5M5XB 3MC0B 1PFBA 4I7ZC 1Y8PB 2H4OA 3KK7A 5C3EB 4IN3A 4V0BA 2K03A 1GHKA 4KD3A 2MP1A 1PYWD 2F0DA 3DEOA 4C3JG 3F2UA 5DEHA 1GHJA 1HQRD 1H9MA 1TR5A 2F0FA 1RTNA 1I4XA 2A6HC 3Q22A 4FO2A 4KHVA 4ME5A 2PW7A 2SOBA 3GTJB 1ENCA 2DY7A 4C3HB 4R8IA 3IL8A 4MIUA 4FXKC 3HEJA 1V1OA 2XN9C 1EOTA 5C0XI 3TP6A 4A3BB 2PO4A 3MXPA 4DA2A 3MAQA 2E74C 1ZXTA 3X3MA 2IPKD 1BF4A 3PIO3 5EPKA 2EY5A 1MSHA 2L1BA 3BVMA 4X3SA 1B44D 1LTGD 1HXYD 1EEFD 4BBSB 2WACA 4HSPA 4RGNA 3D3RA 1SNOA 3NTKA 4K6LA 2A6HD 4KKSA 5K5PA 3C46A 2BOSA 4FP5D 3HOZB 1DD2A 2RDGA 1HUNA 3D4DA 5J1ZA 2R92B 2QEJC 3S15B 1UEAB 2HCCA 3DWAA 3HOUB 3TBIB 1OXUA 2Z4HA 3L9AX 2KJXA 5EJWA 1SNPA 4DAPA 1BDOA 1HFGA 1YNJC 2PZTA 1LV9A 4FXDA 3R3OA 3M4YA 2NTSA 3MA2B 3IAYA 2AUJD 3SK8A 2L55A 1NR2A 3QO2A 2VB3X 2L4NA 5JOBA 3BVGA 4DU9A 4BA1I 3D4RA 3RZOB 5ELCA 1I4PA 2XWBB 4XT1B 1SMYC 3IKJA 4RGMA 3HOYB 1CT1D 2F0TA 1SFOB 2EY6A 1STEA 4DXFA 1B3AA 3M3YB 3TSSA 4WFN3 3N52A 5C3XA 2KUMA 5CYUA 4CHTB 4KD4A 3BS1A 3E0JA 1F9SA 1II3A 1AZPA 3SK4A 1EFID 2BE5C 4J6HA 2HUGA 1RKNA 1S4ZA 4IQZA 3VYUA 1IW7C 2WKDA 2IX0A 2F0NA 1JR0D 3A55A 3E6ZX 2CQAA 1XTCD 4KHZA 3W2DA 4QUFA 1QNUA 3KBGA 2F1MA 4OIJA 1B53A 1O78A 2C5CA 3JAML 1GXDC 4GZYC 1IHZA 3N6RA 3T51B 1KAAA 3W3AA 1KNEA 2M2LA 4ZKCB 1J8IA 5EPLA 5FLXE 1KDAA 2EVBA 1TS4A 4O42A 4FXGC 2Q8TA 4DAYA 4H7BA 5EPJA 3SK6A 4XYQA 1A3VA 3CRLC 1ET9A 2SNMA 1RD9D 5M3MB 3J7AV 4TRDA 1KNAA 2DY8A 2EYPA 2F0LA 4BA2I 3BYYB 2QKIC 5HURA 3A8KE 5EQ0A 3TZUA 3K5MA 3DMUA 3QB3A 3G7LA 2E2IB 5EBCA 4ID6A 4PNYA 1RDPD 2Q8IB 2E2HB 1MGSA 4A3IB 3ND9A 2RBMA 2X69A 3AU7A 1QOHA 1KDCA 2BA0A 5JEAG 1WD1A 5E4XA 1Y1VB 4DF7A 4JBWA 3M85A 3LX0A 5JPMC 5CORA 4IFDJ 5HGTA 1EY5A 3VR6A 3TDQA 1WTVA 2F0IA 1PTOB 2AWNA 3A8JE 2HCIA 1ENAA 3BDOA 1KABA 4G7OC 1RF2D 1DXMA 1DYQA 3BDLA 5KNDA 4PV1C 3P20A 3C1EA 3PMFA 1F9QA 2K5WA 4EQOA 1BXTA 4Q5VA 3IFTA 5LL6X 1TWGB 3S2DB 2F0KA 1TY0A 5IGCA 1D6EC 2PZWA 5KRUA 4XQJA 2R3ZA 5JPNC 3DWPA 4DFAA 3QWNA 1T5EA 1WTPA 4HMIA 2OT2A 4HEDA 2Z4IA 2E76C 1GUNA 1K83B 3MFGA 1HA6A 1SJHD 4HAEA 1G6ZA 2EPBA 4CKEA 1IYUA 5C4JB 2QDBA 4IUPA 3K0YA 2XWJB 4B9XA 3GV3A 1A15A 3FEWX 3NWSA 1Y69U 1BCPD 4S3SA 2NYZD 5C0XG 1RODA 1HTPA 4KTAA 4KY7A 1FD7D 4QUCA 4WJWA 5CGKA 1CZGA 2NZ1D 3FRPB 4ZQ3A 1LLRD 4RFBA 3T13A 1NAPA 1U4RA 3I4MB 2O2LD 5G3LF 5T1IA 2GA4B 2EYOA 2XRQD 3J7AF 1SDFA 1PXUA 2K32A 2Q8RE 1QG7A 4FYDA 5I2YA 1O80A 1OO9B 3WDNA 1U4LA 4CJ0B 3NE5B 2EY2A 1HRJA 4BY7B 1LTTD 3RLFA 2I07B 1VCIA 3I3CA 1SNMA 4K5VA 2NN6I 4ABNA 1PRTC 4A3DB 2AQ2B 1F9PA 1Q90A 4IUUA 3OSOA 3HS0C 1AFPA 4DGZA 2E2JB 3MXNA 3J7YW 3DWQA 1JWMD 1HTLD 4C3IB 3OMGA 1J9OA 4ZLTF 2EJMA 4OO1I 5ELDA 5CV4A 3HG9A 1SAPA 3CKIB 1STGA 1ZKOA 3A8IE 4KMUC 1HHVA 2D5DA 1UNSA 1OXVA 3RMHA 2G9DA 1JCKB 1BQQT 1MD2D 1FYCA 3NQTA 3HOVB 4MHEA 5C4HA 1PRTD 1Y8OB 2QCPX 5CBAE 1PRTF 2O5JC 4KKUA 3VA5A 2L5TA 2R6GA 1Q1EA 1F2YA 3I72A 1IYVA 5DAUA 4H44C 5F2DA 2J7ZA 4CJ1B 1PZJD 3M7GA 3PO3B 4R8NA 3VYRA 3S1QB 1F2MA 4RH6A 1SYGA 2K04A 2O4XA 1STNA 2XVSA 2F3VA 4K8IA 5KIXA 3NTIA 1R9TB 1G291 1LTAD 2X6LA 4K5WA 1FGBD 5M5YB 2J4XA 1A2UA 1SBBB 4CGYB 1R4QB 4XTCS 2D62A 3MTSA 3IFDA 1TU2B 5FKAC 3TMEA 2H1EA 1LT5D 4F8MA 2BDOA 1AZQA 1LT6D 2IT1A 2BCOA 4IFDI 4ILWA 4BBRB 4IALA 3GTLB 4G57A 5CBEE 4C3HG 5FK9C 3J81E 3T4AC 3NBHA 3GD7A 3KUPA 3HP3A 3GTOB 2JEAI 4X3KA 2I46A 5CV9A 4BWGB 1I4QA 4CBVA 3P1HA 3R2TA 5KEEA 5JEAH 3QIAA 5EKIA 1L0XB 3CRKC 2NVXB 1D1IA 2MPMA 3QOLA 5E3FA 2KVMA 3NPPA 1PDQA 4IUTA 1Q12A 4H13C 4IFDH 5FO8B 1XX8A 4ZAIA 3S9WA 5KGUA 1HFNA 1X3PA 2KHSA 3BDCA 2A69C 4KI0A 5E4WC 1ZEQX 3SR1A 2Z8LA 4OIKA 5AFWA 4TQUS 1DJRD 4TSSA 1S5BD 1YNNC 5LL6S 2BDNA 2HQEA 5IGGA 3FDTA 3K5LA 5CV7A 1LABA 5JVH3 1ZYRC 3ONAB 2L11A 2L12A 2F03A 2EYLA 3KLRA 4EQPA 2PPBC 1FNWA 2CW0C 3VYTA 1ONLA 2NBFA 1D5XC 2QF7A 5D65A 3GTMB 1A2TA 4X3TA 1KTKA 5KYIA 1JORA 1TIID 3D8GA 3S1NB 2A69D 3T16A 1Z6HA 5DM73 3I4NB 1JQYD 2LFNA 4KY6A 2TSSA 4DK0A 2KQ3A 4RWSC 4NW2A 1YNND 2B39A 4DNRB 5IGFA 2JA5B 4K14A 2MJ8A 1ZYRD 1SYDA 2F0QA 1TKWB 4LK1C 1RHPA 3U9SA 1LT3D 1F9RA 2WKCA 3DXJC 1STHA 3GQBA 4RGOS 2O5IC 4HMJA 3PO2B 3SDZA 3T56B 1RJTA 1TWAB 2JE6I 4RHSA 1PFMA 5JVG3 4J8QA 1D2BA 1LTBD 1EQVA 1EY9A 3HZXA 3R93A 1SYBA 4F87A 1KDBA 4PMBA 1YNJD 2B2WA 3S16B 3FKIB 5I6WA 2EYFA 4FF2A 3NUCA 4RAUC 2RDFA 3K7AB 1EWCA 1PTOC 5JJZA 2NN6G 1SE2A 4ZKBB 4EVOA 1I4GA 1SMYD 1ML0D 4ZYSA 4QCLA 1SYCA 1Q3LA 3SK5A 1WTQA 4F88A 5C5LA 1Q8IA 3VA7A 3MHBA 1G8ZD 1Y1WB 1PMRA 1T5XD 1B9NA 5FLXL 4OO1G 1SYEA 2A6EC 5I6YA 2FMMA 2BE5D 3S1MB 1HUMA 3EA6A 4OGQC 1IW7D 1GUOA 3MFYA 4QMGA 1EEID 1Y8NB 3OW7A 2PQEA 4RKLA 2ID0A 4UDUC 3NWTA 2WAQB 4HSVA 5EKLA 4A3GB 2KECA 1G2TA 1TY2A 1PTOF 3DHQA 1JE4A 5JEAJ 1B1ZA 2ZXPA 1XXGA 1EZ8A 1H9KA 5CV8A 3NP8A 3H0GB 2WINB 1H9SA 2F0PA 1X3QA 3L3OC 1AP0A 1G91A 1JB3A 2XSCA 2ENBA 2A6ED 5CMDA 5M3FB 3L7ZC 2B2WC 2DN8A 3OIQA 2FFKB 4WORA 3LNNA 4E6IA 1VMCA 4KN7C 4OHJA 4AYBB 2K7VA 2JXMB 1ESRA 2EOTA 1GUWA 3Q23A 2EY1A 1CK1A 4RCNA 4ZK9B 3I8ZA 3WOEA 1MI2A 1CQFA 1I50B 3K6OA 4XXEA 1QB5D 4NP5A 4DNTB 1SSOA 5A2QL 4NKLA 3QJYA 5A2QE 4Y7NB 4RKBA 1A3UA 4LJZC 3C3LA 3U9OA 4DK1A 5IGDA 2DNEA 3MWYW 2F3WA 5ELFA 1TWFB 1OXTA 4KK7A 3OWEB 2HDMA 1EIGA 4KJOA 2K01A 2EJGC 4A3KB 1W6KA 1FR3A 1U9RA 4K2KA 3D4WA 2XIWA 2IL8A 2N88A 1NCVA 3D31A 5I9OA 2EYHA 2WP8J 1EL0A 2VB2X 5CV6A 4DAVA 4FF3A 4P2CB 3DUZA 1VF5C 1WTRA 1GOZA 2F0UA 3MXGA 5G3LD 5IT9E 2DNCA 3P75A 1SE4A 3D6WA 3RD4A 2C9OA 2VUMB 1PZID 2ZXOA 2A68C 3OHXC 5I9PA 3GTKB 5KNBA 1H9RA 3I91A 2J0TD 5EBDA 2NB0A 2SEBD 1IL8A 1AEXA 1M4VA 3ITPA 1W6JA 3GV6A 1DCZA 2ZXRA 2D2CC 3BG3A 4CKCA 2RSOA 3EFXD 1V1PB 2JA7B 1BCPB 5ISRA 4HR7B 1M8AA 2JSOA 2XRSD 1SEBD 1NUCA 2XNAC 4QF4A 2FMCA 2SDFA 3OMCA 1U4MA 5K36G 1RCVD 1SNQA 5C4ZA 1LTRD 2B8GA 1CZWA 2EYMA 2WV6D 3EROA 1O7ZA 2MUYA 3EVQA 2A68D 2B63B 4ZUIA 4UAIA 4FF1A 4I65A 1I3QB 1EYDA 2F0EA 3O13A 1JOOA 3I70A 3SE0A 2JEBI 1CFMA 2B8FA 4WRDA 1SNCA 1FNUA 2JYOA 1AW7A 3PUZA 4MN3A 4H0LC 3K57A 4IZ8A 3J80E 2PZUA 3OOCA 4XT3B 2NUCA 3KLSA 1U4PA 3VR5A 1PZKD 4NMZA 3NTHA 3DEPA 3WOFA 5IGEA 2LMCB 1F2LA 1OXXK 3KLSX 2LKVA 3LWEA 3RZDB 1B50A 1EYAA 5BN4A 4ODGA 1PRTB 1L0YB 5IODA 2MHVA 1EQTA 4ZUJA 3J81L 2RVLA 1CQVA 1TVXA 3Q6SA 2JP1A 1GUGA 5C4XB 3A54A 4N9TA 3GTPB 3I90A 1VDZA 1KLGD 3I4LA 4C1NI 2RQXA 5DNFA 3PV0A 4XDXA 1V43A 2B2VA 5EGTA 1O7YA 3T53B 1TWCB 4KV6A 5COYA 1B9MA 2VNUD 1BR9A 3H6MA 2RSNA 3A7LA 1LTSD 1TT2A 2B2YA 1QWYA 1EIHA 3PUYA 2K5DA 3K5NA 1LTID 1EY8A 1EY7A 1S5ED 1I6HB 3VR4A 2X6GA 3FVQA 3QOJA 1DZ1A 4KY5A 1OXSC 2IX3A 2N55A 2ZT9C 4A3JB 2YU9B 2NWGA 1CI3M 4L6TB 1STBA 4R9WA 4IUNA 4C3JB 4IURA 1S5DD 1QCBD 1PLFA 4F7XA 3V96A 1V8QA 3VYSA 5C3WA 2JA6B 1ILQA 5FO9B 5I2XA 3D6CA 4K6DA 1FNVA 4HCEA 5M5WB 1LO5D 1WCMB 4CKBA 2EYJA 3H91A 1E2WA 2FINB 2KCCA 1EY4A 3M4OB 4U68A 3MVVA 3TP8A 3AB9A 2NTTA 5C0XH 5CV5A 2FJ2A 4A3MB 1VMPA 3UI2A 4IUVA 2D9UA 3K59A 3NBIA 4M8AA 2B2VC 5J22A 1WD0A 4HN7A 2OEOA 4PQXA 1F2ZA 1RTOA 4U673 1CA5A 4QIWB 2L0CA 1HCZA 3TN2A 1JOKA 2B2YC 2CW0D 3K58A 2FHTA 2EXZA 1QE6A 1ENFA 1E2VA 2OXPA 4K2LA 3C1FA 3G6JB 3SVMA 1I4HA 3NHHA 2F0GA 3S17B 3PUWA 3PIP3 3P7JA 3KBXA 4C2MB 2HDLA 4V190 3HOXB 4ZRZA 1C8CA 4N9PA 5DM63 1LACA 4FF4A 4YIJA 2EZVA 4KN4C 2L9HA 2K1BA 4LAAA 3S1RB 1ICWA 5K36H 2M00A 4XQNA 2ICIA 4M1UB 2KCNA 1STYA 1JWSD 2IX1A 1GJXA 3HGBA 4L8JA 5CR3A 1QNKA 5M9OA 5EKKA 2E75C 5LHY1 3OWFA 1WTOA 2K05A 1TWHB 1SE3A 4NDXA 2YYZA 5C6AA 1A3TA 2KOLA 2PNRC 3MEHA 4C1NK 3NSWA 1UAPA 4KJNA 3TZDA 2JA8B 4LMQD 2M9VA 1V1PA 2CHBD 2NVQB 2NVYB 3V05A 3HKZB 3R8BA 4CJ2C 3JAME 3PUXA 2EDGA 5T1GA 1C48A 1TS2A 2K33A 2AWOA 4HCSA 3Q24A 2MGSA 5FO7B 1CM9A 4XIGS 3URYA 1ESFA 5C44B 4A93B 1ILPA 4BY1B 3OIPA 4BS9A 4HTHA 3E5SA 3EQLC 1PTOD 2B2UA 2F0HA 1STAA 2F0MA 1DM0B 3BVZA 2AQ3B 3FPUB 1S5FD 1WTWA 1PFNA 1K8MA 2K28A 3CU7A 1CTMA 3RUZA 1EZ6A 4DN4M 2WB1B 3VR2A 5IIFA 3SEBA 2B2TA 1DOKA 3TP7A 3GTQB 4PMWA 5KNCA 1EYCA 2F0SA 4O1NA 3S2HB 2V4DA 2IJ0A 1G2SA 1JICA 1VF7A 3CHBD 3C2PA 2Y0SB 1D1KA 2K5QA 1QILA 3NXWA 3ZYYX 2F0OA 3NQIA 4B08A 2R7ZB 2OF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQA A;  2C9O A; 
#chains in the Genus database with same CATH topology
 2OQK A;  4JI1 L;  1JOQ A;  2HIV A;  1XMO Q;  1CKO A;  1TXY A;  4G7Z C;  5A35 A;  2QDL A;  4IFD G;  2EXD A;  3BYT B;  3R2I A;  2RDH A;  1LT4 D;  1D8L A;  3FPP A;  3HFZ B;  3KJP A;  1Q1B A;  4QB4 A;  4B3S L;  1BCP C;  1KIX A;  3HOZ H;  2KEN A;  2WAQ E;  4AH6 A;  1MBY A;  1F77 A;  1MSG A;  1NR4 A;  2EE1 A;  2YV5 A;  1CHQ D;  1SJE D;  2R92 H;  4LF4 L;  5IP9 H;  3S15 H;  2AUK A;  1EU4 A;  3I73 A;  2VXW A;  1IKM A;  1DON A;  3MXU A;  4P74 A;  3HOW B;  4GS3 A;  2KBN A;  4DXG A;  3GP7 A;  5BN5 A;  3HOU H;  2F4I A;  1NSN S;  3FMC A;  2DJF C;  5C0X J;  1EY6 A;  1CSP A;  3KF8 A;  3GO5 A;  4B9W A;  1VQK A;  1B4O A;  1XWE A;  1IKL A;  5ELE A;  2B2U C;  3Q0A A;  3QG1 A;  1WTX A;  2EJF C;  2LS0 1;  1C0A A;  1SYF A;  1IBK Q;  3HRZ C;  2RKS A;  2WB1 E;  1PH7 A;  1E0B A;  1HR0 W;  2QIL A;  2K6A A;  4A3D G;  3TEH B;  5GAH C;  3STB D;  3OPO A;  1TS3 A;  3M7N A;  4OL7 A;  3V2T A;  5IT9 L;  2JA7 G;  5BN3 A;  1X32 A;  2RCN A;  1SXT A;  2P5Z X;  3SXH A;  3RZO H;  3HOX H;  5JAV A;  2OQ0 A;  4AYB E;  3HOY H;  5CC4 A;  1SFO H;  1BCP F;  2IW3 A;  1AE3 A;  2B2T C;  3NK9 A;  4C3I G;  3M3Y H;  1Z9F A;  1GUS A;  4K8J A;  2E2D C;  3H3V C;  5IOC A;  4A3F B;  2G9H D;  3MZ5 A;  3JAM c;  4HIM A;  1DOM A;  2KCM A;  3PUV A;  5ELB A;  1AN8 A;  1I6V C;  1KLU D;  4JOI C;  1C4Q A;  2AQ1 B;  4DV1 L;  3CF5 A;  2SNS A;  4NXN L;  1SND A;  2B63 G;  2CVR A;  3ND8 A;  3BZD B;  3K81 C;  4LFC Q;  4HJA A;  1EIY B;  1BO0 A;  4JI7 Q;  5D14 A;  1IBL Q;  4JBK A;  3NEL A;  2F0J A;  2F0V A;  2JN4 A;  2UUA L;  2R93 B;  4JI6 L;  5IYB H;  1BKB A;  1K8G A;  3HOV G;  2KA7 A;  1Z7T A;  2NVT B;  1WVL A;  1UUP A;  4L63 B;  1PH8 A;  2Z1C A;  5C5M A;  3S14 B;  1WFQ A;  5J39 A;  4GN4 B;  2IWH A;  4P71 A;  2UUB Q;  2ZTD A;  1ASZ A;  1B2T A;  2NVQ H;  4Q0F A;  2K5N A;  2TMP A;  5D3D A;  3ERS X;  2A5H A;  4FVM A;  1HPC A;  4XQQ A;  3TP5 A;  3ERQ A;  4C56 C;  3PO3 G;  5D3I B;  1EU3 A;  2A73 B;  1D5Z C;  3K5O A;  5GAD C;  1QJO A;  1TS5 A;  4LWC A;  2PCF B;  1I4R A;  4O0A A;  1A6X A;  2MNA A;  4EQN A;  1R4P B;  1YJN A;  4IUQ A;  5NUC A;  1CA6 A;  1QUQ B;  3H09 A;  4XYO A;  3AMU A;  1O7L A;  4NB3 A;  5KYL A;  1JB7 A;  2KEE A;  4KKT A;  4X64 L;  2A74 C;  2WII B;  3K8A A;  4K5X A;  4Z9C B;  1X3G A;  3AFQ A;  2EQS A;  1XNR Q;  5FOB B;  1H9J A;  1EWH A;  1HQM C;  2NN6 H;  1AE2 A;  1YZ6 A;  3UE0 A;  1N34 L;  5M3M H;  2CKZ B;  1S5C D;  3T1Y Q;  3OTO Q;  4G7H C;  2OTL A;  2F0W A;  1H9S B;  4JK1 C;  1E7Z A;  2PYK A;  3J80 L;  2KED A;  1K28 A;  1TQO A;  4X62 L;  3A7A B;  2PMZ B;  3BZC A;  4RHR A;  3X3N A;  2PW5 A;  4J1M A;  4EGV A;  1A8V A;  5HGQ A;  1DOL A;  1GUT A;  2VQE Q;  1VQP A;  2E2I H;  1E2Z A;  1HA5 A;  1ET6 A;  4OO1 H;  1JC7 A;  2E2H H;  4RCO A;  4X3U A;  4PMC A;  4TKO B;  5C4X G;  1BBU A;  3H94 A;  4RA8 A;  4LFA Q;  1SRU A;  3CQZ B;  3VR3 A;  4A3C H;  4G4K A;  2ICE C;  2LY7 A;  2R61 A;  1Y1V H;  4ULL A;  1PH1 A;  1YJ9 A;  5TSS A;  4RGT A;  5E1F A;  1BUV T;  4LF5 Q;  1EY0 A;  3GTG B;  4FNF A;  3DM1 A;  1BBX C;  1PTO H;  1Z47 A;  3J81 j;  5IGB A;  4IJL A;  4PG3 A;  1BOS A;  1CHP D;  2VL6 A;  3LWU A;  4PZ6 A;  4UP7 A;  1XYI A;  3A56 A;  1PVO A;  1JWU D;  1BNZ A;  1N33 Q;  1PYB A;  2BA1 A;  1XPU A;  3M9B A;  4A75 A;  1D5M C;  4ZCK A;  4DV5 L;  1K8O A;  5I4D A;  4A3E B;  2RA4 A;  1WTH A;  3EJI A;  3SHL A;  5M5X B;  1XTD A;  2F4V Q;  4IOA A;  4GOP B;  1TWG H;  3MC0 B;  1VQO A;  1PFB A;  3S2D H;  4I7Z C;  1Y8P B;  2H4O A;  3KK7 A;  5GAE C;  5C3E B;  1VQJ A;  3A5U A;  1YHQ A;  1M1K C;  4B3M Q;  4IN3 A;  4DUZ L;  4V0B A;  1HZB A;  1VS0 A;  4IPH A;  2K03 A;  1GHK A;  4KD3 A;  2MP1 A;  1PYW D;  2DUD A;  2F0D A;  3DEO A;  4C3J G;  2I5M X;  3F2U A;  5DEH A;  2K14 A;  1K0R A;  2XGT A;  1GHJ A;  1HQR D;  1H9M A;  1TR5 A;  2F0F A;  1RTN A;  1I4X A;  2AKW B;  2A6H C;  2JA6 G;  1YNX A;  3Q22 A;  4DR4 L;  3G48 A;  4FO2 A;  1VQ8 A;  2ES2 A;  4KHV A;  3PCO B;  4ME5 A;  2PW7 A;  2SOB A;  3GTJ B;  1ENC A;  2DY7 A;  4C3H B;  3WWV A;  4R8I A;  3IL8 A;  4LF6 L;  4MIU A;  4FXK C;  4LF8 Q;  3HEJ A;  1V1O A;  2XN9 C;  1QVC A;  2AMC B;  5C4J H;  1EOT A;  5C0X I;  3I4N G;  3TP6 A;  2JA9 A;  4A3B B;  4YCV A;  2PO4 A;  3HKS A;  2CWA A;  3MXP A;  1KAW A;  4DA2 A;  3MAQ A;  2E74 C;  5IYD G;  1ZXT A;  4HJ7 A;  1XMQ Q;  4JI8 Q;  3X3M A;  2IPK D;  1BF4 A;  3PIO 3;  5EPK A;  2EY5 A;  1MSH A;  2L1B A;  1UE6 A;  3BVM A;  3I4M H;  4X3S A;  4AIM A;  1B44 D;  1LTG D;  3AYH B;  1HXY D;  1EEF D;  4BBS B;  2WAC A;  2JA5 G;  4HSP A;  4KLK A;  3U58 A;  4RGN A;  1N32 Q;  3D3R A;  5IYC H;  4X65 Q;  1SNO A;  3NTK A;  3MXN B;  2C35 B;  4K6L A;  2A6H D;  1LTL A;  4BY7 H;  2PQA B;  2UXD Q;  1SMX A;  4KKS A;  1EOV A;  1G51 A;  2BOS A;  5K5P A;  3C46 A;  4FP5 D;  3HOZ B;  4YCW A;  1DD2 A;  2RDG A;  1HUN A;  4GN3 B;  3S24 A;  3D4D A;  3PO2 G;  5J1Z A;  2R92 B;  3VDY A;  2QEJ C;  3S15 B;  2E2J H;  2G5D A;  2RCF A;  1UEA B;  2HCC A;  4DR6 L;  2E8G A;  3DWA A;  1Q7Y C;  2OCE A;  3HOU B;  3K7U C;  3TBI B;  1OXU A;  2Z4H A;  4YY3 Q;  4GNX B;  4C3I H;  3ZJY C;  3L9A X;  4EQ5 A;  1QZG A;  5AJ3 L;  2KJX A;  2Z9H A;  5EJW A;  1SNP A;  4DAP A;  3W1B A;  1BDO A;  1HFG A;  1YNJ C;  2DJG C;  2PZT A;  1LV9 A;  4FXD A;  3R3O A;  3L0O A;  2NTS A;  3M4Y A;  1SRO A;  3MA2 B;  3IAY A;  2AUJ D;  3SK8 A;  1M90 C;  2L55 A;  1NR2 A;  3QO2 A;  2VB3 X;  2L4N A;  5JOB A;  2K75 A;  3G71 A;  3BVG A;  1HJP A;  4DU9 A;  4BA1 I;  3D4R A;  3I55 A;  3RZO B;  5ELC A;  1I4P A;  2XWB B;  4XT1 B;  1SMY C;  3IKJ A;  4RGM A;  3CPW A;  1CT1 D;  2F0T A;  3KOJ A;  3HOY B;  2N3S A;  1SFO B;  2EY6 A;  2DGY A;  3HOV H;  1STE A;  4NXM L;  4DXF A;  1B3A A;  3M3Y B;  3TSS A;  4WFN 3;  3N52 A;  2KUM A;  5C3X A;  5CYU A;  1Y1W G;  3FP9 A;  4CHT B;  2JA8 G;  1HNZ L;  4DAM A;  4KD4 A;  3BS1 A;  3E0J A;  5IP7 H;  1F9S A;  1II3 A;  1AZP A;  1JJG A;  3SK4 A;  1EFI D;  3PO3 H;  2BE5 C;  4DR1 L;  4J6H A;  2HUG A;  3S1Q H;  1RKN A;  1S4Z A;  4IQZ A;  3VYU A;  1IW7 C;  2WKD A;  2IX0 A;  2F0N A;  4OEL B;  1NE3 A;  1JR0 D;  4GKJ Q;  3A55 A;  1Q81 C;  3E6Z X;  2CQA A;  1XTC D;  4KHZ A;  3W2D A;  5C44 G;  3TS2 A;  3RR5 A;  4A93 G;  1EFW A;  4LF7 Q;  5M5Y H;  4BY1 G;  4A3G G;  4QUF A;  1QNU A;  3KBG A;  1LM0 A;  2F1M A;  4OIJ A;  3NBH B;  4OWT B;  1EYG A;  1B53 A;  1O78 A;  2C5C A;  3JAM L;  4QIW E;  1GXD C;  2K50 A;  1P16 A;  4GZY C;  1IHZ A;  3N6R A;  3T51 B;  2ZJP A;  1KAA A;  3W3A A;  1KNE A;  4BBR H;  2M2L A;  3GTL H;  1G6P A;  1UWV A;  4LF9 Q;  5FJ8 H;  4ZKC B;  3UDI A;  1J8I A;  1QVF A;  2YTV A;  2WB1 G;  5EPL A;  5FLX E;  5IWA L;  4LFB L;  5FLM H;  5M3F G;  1KDA A;  2EVB A;  1TS4 A;  4O42 A;  1EQR A;  2Z6K C;  2VY3 A;  2A8V A;  4FXG C;  2Q8T A;  4DAY A;  3EN2 A;  4H7B A;  5EPJ A;  3SK6 A;  4XYQ A;  1A3V A;  4B3S Q;  1VQC A;  2ZM6 L;  3CRL C;  1ET9 A;  3CCR A;  2SNM A;  1ICF B;  2NVX H;  5L37 A;  1XNQ Q;  2K52 A;  1RD9 D;  5M3M B;  4IPC A;  3J7A V;  4TRD A;  1KNA A;  1N9W A;  2DY8 A;  2EYP A;  2F0L A;  4BA2 I;  1QUQ A;  2IHE A;  2QKI C;  3A8K E;  3BYY B;  5HUR A;  3DLL A;  5GAG C;  5EQ0 A;  4LF4 Q;  2R7Z G;  3TZU A;  1I94 Q;  3K5M A;  3DMU A;  1XPR A;  1H95 A;  3QB3 A;  1VQ9 A;  3G7L A;  4JYA L;  2E2I B;  5EBC A;  2HT1 A;  2MQH A;  4ID6 A;  4PNY A;  1RDP D;  2Q8I B;  4OWX B;  3CC4 A;  1FGU A;  2E2H B;  1MGS A;  2AHO B;  4P73 A;  3CMA A;  4A3I B;  3ND9 A;  2RBM A;  4R4I A;  2X69 A;  4EX5 A;  3AU7 A;  1QOH A;  4IO9 A;  1KDC A;  2BA0 A;  5JEA G;  1WD1 A;  5E4X A;  1Y1V B;  4DF7 A;  4JBW A;  3M85 A;  2QEX A;  3LX0 A;  5JPM C;  2JK8 A;  5COR A;  4IFD J;  3AFP A;  5HGT A;  1EY5 A;  3VR6 A;  3TDQ A;  1WTV A;  1E24 A;  2F0I A;  4KHP L;  1PTO B;  2AWN A;  3A8J E;  4A3K G;  3RNU A;  2HCI A;  3HKZ E;  4JI2 L;  2LSS A;  1ENA A;  3BDO A;  2NZO A;  1KAB A;  4G7O C;  1RF2 D;  1DXM A;  1DYQ A;  3BDL A;  5KND A;  1CKM A;  1NMG A;  4PV1 C;  3P20 A;  4LW1 A;  3C1E A;  5LMU L;  1ASY A;  3PMF A;  1F9Q A;  4DR7 L;  2HHH L;  1N36 L;  3GTM H;  2K5W A;  4EQO A;  1BXT A;  4Q5V A;  3IFT A;  5LL6 X;  1TWG B;  3S2D B;  1IBM L;  2F0K A;  3S1N H;  1TY0 A;  4B3R L;  1EQQ A;  4DV1 Q;  5IGC A;  1D6E C;  2PZW A;  5KRU A;  4XQJ A;  2UXB Q;  2JQO A;  2R3Z A;  2VQF Q;  1A0I A;  5JPN C;  3DWP A;  4DFA A;  3QWN A;  1T5E A;  1WTP A;  5IYD H;  4N8X 1;  4HMI A;  2VUM G;  2OT2 A;  2UUA Q;  2QA4 A;  4R4T A;  4JI6 Q;  4DUY L;  2GVA A;  4HED A;  2Z4I A;  4GOP A;  4IJH A;  2E76 C;  4POG A;  3E9H A;  1GUN A;  1KL9 A;  2JA5 H;  1N8R C;  1K83 B;  3MFG A;  1X56 A;  2RHS B;  4JPB W;  4HIK A;  1HA6 A;  1SJH D;  4HAE A;  1G6Z A;  2EPB A;  4JI4 Q;  1X54 A;  4CDC C;  4CKE A;  1IYU A;  5C4J B;  1XJV A;  2QDB A;  4CDF C;  1YI2 A;  4IUP A;  3K0Y A;  2XWJ B;  4B9X A;  3GV3 A;  1A15 A;  3FEW X;  4A3L H;  3NWS A;  1Y69 U;  1BCP D;  4S3S A;  2NYZ D;  5C0X G;  2UU9 L;  1ROD A;  3PIP A;  1HTP A;  2Y0S E;  4KTA A;  4KY7 A;  2R93 G;  1FD7 D;  4QUC A;  4WJW A;  1A63 A;  4X64 Q;  4L5R C;  4QQB X;  5CGK A;  3PO2 H;  1CZG A;  2NZ1 D;  3FRP B;  4ZQ3 A;  3CC2 A;  1LLR D;  4RFB A;  3T13 A;  1NAP A;  1U4R A;  3I4M B;  1TWA H;  2O2L D;  1XMO L;  2Q2H A;  5G3L F;  5T1I A;  2GA4 B;  2EYO A;  2XRQ D;  1N34 Q;  4Y52 H;  4QJF A;  3J7A F;  4GKK Q;  1SDF A;  1PXU A;  1Q46 A;  2K32 A;  2Q8R E;  1QG7 A;  3PF5 A;  4FYD A;  5I2Y A;  1O80 A;  2KHI A;  1OO9 B;  4L5T A;  3WDN A;  1U4L A;  4OON A;  4CJ0 B;  4X62 Q;  1IXR A;  2EY2 A;  3NE5 B;  1U5K A;  5FLX c;  3S16 H;  3FKI H;  4JV5 L;  1HRJ A;  2UUC L;  4LUV A;  4DV3 L;  4BY7 B;  1LTT D;  3F8T A;  3RLF A;  2OWO A;  2I07 B;  3J81 i;  1VQ5 A;  1VCI A;  3I3C A;  1SNM A;  4K5V A;  2CH4 W;  2NN6 I;  4ABN A;  1PRT C;  4A3D B;  2AQ2 B;  3BJU A;  1F9P A;  1MKH A;  1Q90 A;  4IUU A;  3K7A H;  4B3T Q;  3OSO A;  3HS0 C;  4RMF A;  1AFP A;  4DGZ A;  2E2J B;  3MXN A;  1VQH A;  3J7Y W;  3DWQ A;  1JWM D;  1HNX L;  1HTL D;  1IYJ B;  4JI0 Q;  4C3I B;  3OMG A;  1J9O A;  1CUK A;  4YHH Q;  3W1G A;  1SN8 A;  4ZLT F;  2EJM A;  4OO1 I;  5ELD A;  3M4Q A;  5CV4 A;  1Y1W H;  3HG9 A;  1SAP A;  3CKI B;  1STG A;  4TVA B;  1FL0 A;  1ZKO A;  4GOP C;  3A8I E;  4KMU C;  1HHV A;  2D5D A;  2BH8 A;  2VS1 A;  1UNS A;  1QZH A;  1OXV A;  3KDF B;  3S1M H;  3RMH A;  2HIX A;  1E1O A;  2G9D A;  1YBY A;  4GNX A;  1JCK B;  3RN2 A;  1BQQ T;  1CKN B;  3U50 C;  1MD2 D;  4A4I A;  2QW7 A;  1FYC A;  3K80 C;  5H1S E;  3NQT A;  3HOV B;  4MHE A;  3CCM A;  5C4H A;  2D0O A;  1PRT D;  1YJW A;  4HID A;  4BXX G;  1Y8O B;  2QCP X;  5CBA E;  1PRT F;  4DUZ Q;  2O5J C;  4R4O A;  4KKU A;  3VA5 A;  2L5T A;  2R6G A;  3EIV A;  1Q1E A;  1F2Y A;  3I72 A;  1IYV A;  5GQO A;  5DAU A;  4H44 C;  4A3I H;  5F2D A;  2J7Z A;  4CJ1 B;  1PZJ D;  3M7G A;  3PO3 B;  2YTY A;  4R8N A;  3VYR A;  3S1Q B;  3H0G H;  1F2M A;  4RH6 A;  1SYG A;  2K04 A;  4LFC L;  2O4X A;  1STN A;  4A3E G;  2XVS A;  2F3V A;  4K8I A;  5KIX A;  3NTI A;  4DR3 Q;  4PZ8 A;  4IPG A;  2CQO A;  1R9T B;  1G29 1;  3F2B A;  1LTA D;  1C7Y A;  2X6L A;  4K5W A;  1FGB D;  4OX9 L;  5M5Y B;  2J4X A;  1X6O A;  3TRE A;  3ER0 A;  1K3B C;  1A2U A;  1SBB B;  4CGY B;  1R4Q B;  3M4P A;  2UXC Q;  4XTC S;  2D62 A;  1YHB A;  3MTS A;  3IFD A;  2VW9 A;  5BR8 L;  1TU2 B;  5FKA C;  4LUZ A;  3TME A;  2H1E A;  1LT5 D;  3KYH C;  2BDO A;  4F8M A;  1AZQ A;  1LT6 D;  2IT1 A;  2BCO A;  4IFD I;  4ILW A;  4BBR B;  4IAL A;  3GTL B;  4YWK A;  1I50 H;  4G57 A;  5CBE E;  4C3H G;  5FK9 C;  2CWP A;  3J81 E;  3T4A C;  3NBH A;  3GD7 A;  3KUP A;  4A3J G;  3HP3 A;  3GTO B;  2JEA I;  2ATW A;  4DNI A;  1JJ2 A;  4X3K A;  4Y7N H;  3KF6 B;  2I46 A;  5CV9 A;  4BWG B;  1I4Q A;  4CBV A;  3P1H A;  3R2T A;  4QL5 A;  4UP8 A;  5KEE A;  5JEA H;  3QIA A;  4A3B G;  5EKI A;  1L0X B;  3CRK C;  2NVX B;  1D1I A;  2MPM A;  3I56 A;  3OTO L;  1TWF H;  3T1Y L;  2N49 A;  4YWM A;  4GNX C;  3QOL A;  3T1H Q;  5E3F A;  2KVM A;  5LMN L;  4JI5 Q;  4R4C A;  2PMZ E;  1A62 A;  3NPP A;  4DR2 Q;  2D0P A;  1PDQ A;  1WCM G;  2WFW A;  1K83 H;  4IUT A;  1Q12 A;  4H13 C;  4A3K H;  4BBS G;  3F2D A;  4DV6 L;  4DR6 Q;  4DKA C;  1W2B A;  4IFD H;  5FO8 B;  1XX8 A;  1VQ4 A;  4ZAI A;  3S9W A;  5KGU A;  4LFA L;  1X3P A;  1HFN A;  2KHS A;  4X66 L;  3BDC A;  2A69 C;  4KI0 A;  5E4W C;  4DV2 L;  1ZEQ X;  2ZTC A;  3SR1 A;  5AJ3 Q;  1PV4 A;  2Z8L A;  1VQM A;  3JC6 6;  4OIK A;  1VQF A;  5AFW A;  4TQU S;  1X3E A;  4GLA C;  1HNW L;  4A3M G;  1Q8K A;  1YIJ A;  1DJR D;  4TSS A;  4ALP A;  1S5B D;  2R92 G;  1YNN C;  5LL6 S;  5IP9 G;  2BDN A;  1GVP A;  2HQE A;  5IGG A;  3FDT A;  3K5L A;  5CV7 A;  1L1O B;  1LAB A;  5JVH 3;  3HOU G;  1ZYR C;  3ONA B;  2L11 A;  2JJQ A;  5ELN A;  2L12 A;  4CDE C;  4JCV E;  2F03 A;  3OW2 A;  1N33 L;  4AQY Q;  2EYL A;  1HZC A;  1T9H A;  3GTK H;  3KLR A;  4EQP A;  2PPB C;  1FNW A;  1X3F A;  2CW0 C;  3VYT A;  1ONL A;  2NBF A;  1D5X C;  2QF7 A;  5D65 A;  3GTM B;  1A2T A;  2R7D A;  1HNZ Q;  4X3T A;  1UE5 A;  1KTK A;  5KYI A;  4A3D H;  1NBW A;  1JOR A;  1TII D;  4QY7 A;  3D8G A;  3S1N B;  2N78 A;  2JA7 H;  1FVI A;  2A69 D;  3T16 A;  1Z6H A;  3CCE A;  5DM7 3;  1NTG A;  1JQY D;  2LFN A;  3I4N B;  3HOX G;  4KY6 A;  3HOY G;  3ULL A;  2TSS A;  4DK0 A;  2KQ3 A;  2Q2T A;  4RWS C;  4NW2 A;  1VQN A;  1YNN D;  4A76 A;  3PF4 A;  2B39 A;  3A0J A;  4DNR B;  5IGF A;  1X9N A;  2Z6K A;  2JA5 B;  4K14 A;  4LF8 L;  1NJI C;  2GN5 A;  2MJ8 A;  1ZYR D;  3A5Z B;  1SYD A;  2F0Q A;  1TKW B;  4LK1 C;  5J3B A;  3E9I A;  2CCZ A;  2XTI A;  1VQE A;  1RHP A;  1RL2 A;  3U9S A;  2I5H A;  2B63 H;  4QGU A;  1VQD A;  4IPD A;  1LT3 D;  3CCL A;  1F9R A;  5JJL A;  3TQY A;  2WKC A;  1I3Q H;  3DXJ C;  2ASB A;  4JI8 L;  1STH A;  3GQB A;  5IYB G;  1K0S A;  4RGO S;  2O5I C;  2ALY B;  3K0X A;  4HMJ A;  3PO2 B;  3OYY A;  3SDZ A;  3T56 B;  1RJT A;  1KD1 C;  1BBW A;  1IZ6 A;  1V1Q A;  3CD6 A;  1TWA B;  4R4Q A;  2JE6 I;  4RHS A;  2ZTE A;  1PFM A;  1B70 B;  3HKZ G;  4J8Q A;  4NPS A;  5JVG 3;  1D2B A;  1LYL A;  1LTB D;  1EQV A;  1EY9 A;  3HZX A;  4GN5 A;  3R93 A;  1PH9 A;  3U4V A;  1SYB A;  4F87 A;  3H3V H;  1KDB A;  1KQS A;  4UHV A;  3J81 c;  4HIO A;  2Q2U A;  4PMB A;  4JBM A;  1YNJ D;  4DV7 Q;  2B2W A;  3S16 B;  3FKI B;  5I6W A;  4DV0 Q;  2EYF A;  1R9T H;  4FF2 A;  1DGS A;  3NUC A;  4JI3 Q;  1V9P A;  1FJG Q;  4RAU C;  2RDF A;  4UPA A;  5ELO A;  3K7A B;  1EWC A;  1CSQ A;  1MJE A;  4MTN A;  1PTO C;  5JJZ A;  1KXL A;  2NN6 G;  1SE2 A;  4ZKB B;  4EVO A;  1AH9 A;  1I4G A;  2KHJ A;  1SMY D;  3RZD H;  5M3M G;  3NEN A;  2VZA A;  3I2Z A;  1ML0 D;  3G6E A;  4ZYS A;  4QCL A;  1SYC A;  1Q3L A;  3SK5 A;  4BXX H;  1WTQ A;  4F88 A;  5C5L A;  1Q8I A;  3VA7 A;  3MHB A;  1G8Z D;  1Y1W B;  1PMR A;  1T5X D;  4JI1 Q;  1B9N A;  4L5Q A;  4UP9 A;  1S40 A;  5FLX L;  3GTO H;  4OO1 G;  1SYE A;  2A6E C;  5C4X H;  5I6Y A;  1MJC A;  4DK3 C;  2FMM A;  1UEB A;  2BE5 D;  2GVB A;  3GTP H;  1D7Q A;  3S1M B;  1HUM A;  3EA6 A;  2K5V A;  4OGQ C;  1IW7 D;  1GUO A;  3MFY A;  4QMG A;  1EEI D;  2ZJR A;  4A3C G;  1N36 Q;  1Y8N B;  3NEM A;  2B3G A;  1TWC H;  1Y1V G;  3OW7 A;  3UE1 A;  2PQE A;  4RKL A;  2ID0 A;  2Y0S G;  4UDU C;  2HD3 A;  3CCV A;  3NWT A;  2WAQ B;  4HSV A;  3KJO A;  5EKL A;  2N8N A;  4A3G B;  2KEC A;  3BZK A;  3SGI A;  1G2T A;  4OEM B;  3KDF A;  1L2F A;  1TY2 A;  3PQI A;  1PTO F;  2F3I A;  3DHQ A;  1JE4 A;  5JEA J;  1B1Z A;  2RHQ B;  2MO0 A;  2ZXP A;  2NZH A;  1CKN A;  1XXG A;  1L0W A;  1EZ8 A;  1H9K A;  5CV8 A;  1PH4 A;  4I7A A;  3NP8 A;  3H0G B;  2WIN B;  1H9S A;  1I6H H;  2F0P A;  1X3Q A;  3L3O C;  1AP0 A;  1G91 A;  4DPG A;  5IY0 A;  1JB3 A;  2XSC A;  2ENB A;  1EWI A;  2YU9 H;  2A6E D;  5DLQ E;  5CMD A;  3PGZ A;  5M3F B;  3L7Z C;  2B2W C;  2DN8 A;  3OIQ A;  3U4Z A;  2FFK B;  4WOR A;  4C3J H;  3HOW G;  3LNN A;  3GDE A;  2A19 A;  4E6I A;  2UU9 Q;  1SE8 A;  1VMC A;  4HJ9 A;  2K5H A;  4KN7 C;  4OHJ A;  4AYB B;  3PIO A;  3J7A 5;  2K7V A;  3CC7 A;  2JXM B;  1ESR A;  2EOT A;  2I5L X;  1GUW A;  3Q23 A;  2JA6 H;  4HJ5 A;  1HR0 L;  2EY1 A;  5M5W H;  1CK1 A;  4RCN A;  1WCM H;  4ZK9 B;  1PH6 A;  3I8Z A;  3WOE A;  3B6Y A;  1MI2 A;  1CQF A;  1I50 B;  3K6O A;  4DV4 L;  1VQ6 A;  3F1Z A;  4XXE A;  2CFM A;  1QB5 D;  2PI2 E;  5EAY A;  3M4O H;  2A1A A;  4NP5 A;  4DNT B;  1WOC A;  3STB C;  1SSO A;  5A2Q L;  4OXP A;  4NKL A;  3I4N H;  3QJY A;  5A2Q E;  4Y7N B;  4NXN Q;  4RKB A;  1A3U A;  4IOC A;  4LJZ C;  3C3L A;  3U9O A;  5JJI A;  2Z0S A;  4DK1 A;  1XNQ L;  4JV5 Q;  4A3M H;  1MHW C;  5IGD A;  4DV3 Q;  2UUC Q;  4DR5 L;  2DNE A;  1E1T A;  3MWY W;  2F3W A;  5ELF A;  1TWF B;  1VQG A;  1OXT A;  1SLJ A;  4KK7 A;  3OWE B;  2HDM A;  4K0K L;  1EIG A;  1K8A C;  4KJO A;  1I94 L;  2K01 A;  4APV A;  4A3F G;  3I4M G;  2EJG C;  4A3K B;  1W6K A;  3KF6 A;  3CP0 A;  1W3S A;  1FR3 A;  4GLV B;  2E5L L;  1U9R A;  4K2K A;  3D4W A;  5IYC G;  1KRS A;  2XIW A;  1HNX Q;  3IRB A;  2IL8 A;  1KHI A;  1PA6 A;  1B7Y B;  1J5E L;  1VQB A;  2N88 A;  1NCV A;  3D31 A;  3J80 i;  4PZ7 A;  5I9O A;  2EYH A;  2WP8 J;  1EL0 A;  2VB2 X;  4BY7 G;  5CV6 A;  4DAV A;  4FF3 A;  4P2C B;  3E3X A;  3S17 H;  3DUZ A;  1VF5 C;  1WTR A;  1GOZ A;  2F0U A;  3MXG A;  4C2M H;  5GRO A;  5G3L D;  5IT9 E;  2DNC A;  3P75 A;  1MIU A;  1SE4 A;  1Q86 C;  1WJJ A;  1WYD A;  3D6W A;  3RD4 A;  2C9O A;  2VUM B;  4DK6 C;  3CW2 C;  1PZI D;  2ZXO A;  4JVZ A;  3S1R H;  2A68 C;  3OHX C;  5I9P A;  3GTK B;  5KNB A;  1H9R A;  1BVS A;  2BH2 A;  3I91 A;  2J0T D;  4YWL A;  3UDG A;  5EBD A;  2NB0 A;  2SEB D;  1IL8 A;  4WJ4 A;  1AEX A;  1M4V A;  4JC0 A;  3ITP A;  1W6J A;  1IL2 A;  3GV6 A;  1L1O A;  1DCZ A;  3Q8D A;  2ZXR A;  2D2C C;  3BG3 A;  4CKC A;  2RSO A;  4FDB A;  3EFX D;  1V1P B;  2JA7 B;  1JE5 A;  2UXB L;  1BCP B;  2I0Q A;  5ISR A;  4HR7 B;  2VQF L;  1GO3 E;  1M8A A;  2B29 A;  2JSO A;  1TWH H;  2XRS D;  1SEB D;  1JJC B;  2PQA A;  1HZA A;  1NUC A;  2XNA C;  1GKH A;  4QF4 A;  2FMC A;  2SDF A;  3OMC A;  4OX9 Q;  1U4M A;  1IBK L;  5K36 G;  3KFU A;  2JA8 H;  1RCV D;  1KC8 C;  1EIF A;  1SNQ A;  5C4Z A;  1LTR D;  2QGQ A;  1P8L A;  1PH5 A;  2B8G A;  1PFS A;  4JI4 L;  1CZW A;  2NVY H;  4LUO A;  5IP7 G;  2EYM A;  2WV6 D;  3ERO A;  1O7Z A;  2MUY A;  5BR8 Q;  4DAY B;  1WI5 A;  3EVQ A;  2A68 D;  2B63 B;  4ZUI A;  4UAI A;  4DV5 Q;  4FF1 A;  4ME3 A;  4I65 A;  1I3Q B;  4J15 A;  1EYD A;  5C44 H;  2F0E A;  4A93 H;  3O13 A;  4BY1 H;  1JOO A;  3I70 A;  3SE0 A;  4A3G H;  2JEB I;  1CFM A;  2B8F A;  4WRD A;  3H15 A;  1SNC A;  1FNU A;  1KRT A;  2JYO A;  1AW7 A;  1B3Q A;  1U0L A;  3PUZ A;  4GKK L;  4MN3 A;  3I7F A;  4H0L C;  2KCT A;  3K57 A;  5LMN Q;  4IZ8 A;  3J80 E;  4DR4 Q;  4BBR G;  3CXC A;  2PZU A;  4JBJ A;  3TS0 A;  3OOC A;  4JI7 L;  2MO1 A;  1IBL L;  5FJ8 G;  5IE8 A;  4XT3 B;  2NUC A;  4LF6 Q;  4DV6 Q;  2K4K A;  3KLS A;  1U4P A;  5M3F H;  3VR5 A;  1PZK D;  2OTJ A;  4NMZ A;  5FLM G;  5C3E G;  3NTH A;  2R7F A;  3GTQ H;  3D0F A;  3DEP A;  3WOF A;  4B3T L;  4X66 Q;  5IGE A;  4DV2 Q;  2LMC B;  1F2L A;  1OXX K;  2UUB L;  1Q82 C;  3KLS X;  2LKV A;  3CCJ A;  1L1O C;  3S2H H;  1Y14 B;  3LWE A;  3RZD B;  1HNW Q;  1B50 A;  1EYA A;  4JI0 L;  1PHJ A;  5BN4 A;  4ODG A;  4YHH L;  1JT8 A;  1PRT B;  4MTK A;  2R7Z H;  1L0Y B;  5IOD A;  2MHV A;  1EQT A;  4ZUJ A;  4JW0 A;  3A74 A;  3RLN A;  5JJK A;  3W5O A;  3J81 L;  1VQI A;  2RVL A;  1CQV A;  1TVX A;  3Q6S A;  1YEZ A;  2JP1 A;  1GUG A;  5C4X B;  3A54 A;  4N9T A;  4MNO A;  3I90 A;  1XNR L;  3GTP B;  1X65 A;  1VDZ A;  1KLG D;  3I4L A;  4C1N I;  2RQX A;  5DNF A;  3KF8 B;  3PV0 A;  4XDX A;  1V43 A;  2B2V A;  5EGT A;  1O7Y A;  3T53 B;  1TWC B;  4KV6 A;  4WJ3 M;  5COY A;  3RN5 A;  1B9M A;  5IT9 c;  3BU2 A;  3I4O A;  2VNU D;  1BR9 A;  2PI2 A;  2RSN A;  3H6M A;  3HOW H;  2VQE L;  3A7L A;  1LTS D;  1K73 C;  1TT2 A;  2L15 A;  1RIP A;  2B2Y A;  1QWY A;  1EIH A;  3PUY A;  2K5D A;  4X6A H;  3K5N A;  1LTI D;  1EY8 A;  5E7N A;  1EY7 A;  1YVC A;  1S5E D;  1S72 A;  1I6H B;  3VR4 A;  2X6G A;  1VQA A;  3FVQ A;  3QOJ A;  4DR3 L;  1DZ1 A;  4KY5 A;  3HOZ G;  1OXS C;  4POF A;  2IX3 A;  2N55 A;  4LF5 L;  3KLW A;  2ZT9 C;  4A3J B;  2YU9 B;  2NWG A;  1CI3 M;  4L6T B;  1O7I A;  1STB A;  4R9W A;  4IUN A;  1E3P A;  1QVG A;  4C3J B;  2UXC L;  2ZJQ A;  4IUR A;  1S5D D;  2LXK A;  4HJ8 A;  2VUM H;  3AQQ A;  1QCB D;  4LNQ A;  1YHA A;  1PLF A;  4NXM Q;  4F7X A;  2CH4 A;  3V96 A;  2HQL A;  1V8Q A;  1NMF A;  3VYS A;  5C3W A;  2JA6 B;  1ILQ A;  5FO9 B;  5I2X A;  3D6C A;  4A3F H;  4K6D A;  1FNV A;  4HCE A;  5M5W B;  1LO5 D;  1WCM B;  4CKB A;  3ICE A;  2EYJ A;  3H91 A;  2F4V L;  4MZ9 A;  5LMN W;  1E2W A;  3ULP A;  2FIN B;  4B3M L;  2KCC A;  3JAM i;  1VQ7 A;  1EY4 A;  3M4O B;  4U68 A;  3MVV A;  4DR1 Q;  3TP8 A;  2F52 A;  2Q2I A;  3AB9 A;  2NTT A;  1HZ9 A;  3UDF A;  4A3L G;  5C0X H;  4OWW B;  5CV5 A;  1K9M C;  3CPF A;  1LUZ A;  2R93 H;  2FJ2 A;  3LGJ A;  4A3M B;  1VMP A;  3T1H L;  2NVT H;  3UI2 A;  1JMC A;  4R1J A;  4JI5 L;  4IUV A;  2D9U A;  3K59 A;  4DR2 L;  3NBI A;  3S14 H;  4M8A A;  1SR3 A;  4UY8 C;  2B2V C;  5J22 A;  3L2P A;  1WD0 A;  4HN7 A;  2OEO A;  4PQX A;  3H3V I;  1F2Z A;  1PH3 A;  1RTO A;  4U67 3;  3J80 c;  3CME A;  1CA5 A;  4QIW B;  2L0C A;  1HCZ A;  3TN2 A;  1EUJ A;  1JOK A;  1E22 A;  2B2Y C;  1GD7 A;  2CW0 D;  3K58 A;  2FHT A;  2EXZ A;  4JG2 A;  3AEV A;  1QE6 A;  3FKI G;  1ENF A;  1E2V A;  2OXP A;  4K2L A;  1XMQ L;  2YTX A;  3C1F A;  3G6J B;  3SVM A;  3NHH A;  1I4H A;  2F0G A;  3S17 B;  3PUW A;  3PIP 3;  5IWA Q;  4LFB Q;  5HY6 A;  3CCQ A;  1C9O A;  4RG1 A;  1HH2 P;  3P7J A;  3KBX A;  4C2M B;  4N8F A;  2EIF A;  2HDL A;  4V19 0;  4P75 A;  3HOX B;  1S3O A;  2ZM6 Q;  1N32 L;  4ZRZ A;  1C8C A;  4N9P A;  4X65 L;  5DM6 3;  1LAC A;  4FF4 A;  4AQY L;  4YIJ A;  2EZV A;  4KN4 C;  2L9H A;  3F2C A;  2K1B A;  3EBE A;  4LAA A;  3S1R B;  1ICW A;  1I5F A;  1UE1 A;  5K36 H;  2M00 A;  2UXD L;  4XQN A;  2ICI A;  4M1U B;  4JYA Q;  2KCN A;  1STY A;  1JWS D;  1YIT A;  2IX1 A;  1GJX A;  3HGB A;  4L8J A;  5CR3 A;  1QNK A;  4CDD C;  3CQZ H;  5M9O A;  1PH2 A;  3PSI A;  5EKK A;  2E75 C;  5LHY 1;  3CCS A;  3OWF A;  3J7Z C;  1GM5 A;  1WTO A;  2K05 A;  3RLO A;  4YY3 L;  1TWH B;  1SE3 A;  2MFI A;  3CAM A;  1NY4 A;  4NDX A;  2YYZ A;  3GTG H;  5C6A A;  2WAQ G;  2RF4 A;  2IHF A;  1A3T A;  1XPO A;  4KHP Q;  1NNX A;  2IY5 B;  2KOL A;  3MEH A;  2FXQ A;  2PNR C;  3NSW A;  4C1N K;  1UAP A;  4KJN A;  3TZD A;  2JA8 B;  4LMQ D;  2M9V A;  1V1P A;  1OTC A;  2PNH A;  2CHB D;  2NVQ B;  2NVY B;  3V05 A;  4JI2 Q;  3HKZ B;  3R8B A;  4CJ2 C;  3JAM E;  3PUX A;  4A3I G;  2EDG A;  5T1G A;  2H5X A;  1C48 A;  1TS2 A;  2K33 A;  2AWO A;  4HCS A;  3H0G G;  5LMU Q;  1HR0 Q;  2V1C C;  3Q24 A;  2MGS A;  5FO7 B;  3E0E A;  4P72 A;  4A3E H;  4DR7 Q;  2HHH Q;  5M5X H;  1CM9 A;  4XIG S;  4DV4 Q;  3URY A;  3CCU A;  1ESF A;  3DM3 A;  5C44 B;  5C3E H;  4A93 B;  1IBM Q;  1ILP A;  4L5S A;  4BY1 B;  3OIP A;  4YCU A;  1VQL A;  3QR8 A;  4BS9 A;  4GLX A;  4B3R Q;  4HTH A;  3ULJ A;  3E5S A;  1J6Q A;  3EQL C;  1PTO D;  2B2U A;  4H02 A;  2Z6B A;  3TRZ A;  2F0H A;  4AYB G;  4DR5 Q;  3FHW A;  1STA A;  3UDX A;  2F0M A;  1DM0 B;  3BVZ A;  4DUY Q;  2AQ3 B;  3FPU B;  1S5F D;  1X55 A;  1WTW A;  1PFN A;  4K0K Q;  3G4S A;  1K8M A;  2K28 A;  3GTJ H;  4DV7 L;  4GKJ L;  3CU7 A;  4C3H H;  1CTM A;  3RUZ A;  1EZ6 A;  4DV0 L;  4DN4 M;  1PYS B;  4JI3 L;  2WB1 B;  4A3J H;  2E5L Q;  3VR2 A;  5IIF A;  1K3R A;  4LF7 L;  1FJG L;  3SEB A;  2B2T A;  3MEF A;  1DOK A;  3TP7 A;  3GTQ B;  1J5E Q;  4PMW A;  1B8A A;  5KNC A;  4A3B H;  1EYC A;  2F0S A;  4O1N A;  3S2H B;  2V4D A;  2IJ0 A;  1G2S A;  1JIC A;  3CHB D;  1VF7 A;  1UE7 A;  3C2P A;  2LXJ A;  1D1K A;  2Y0S B;  2K5Q A;  1QIL A;  3NXW A;  4O2D A;  3ZYY X;  2F0O A;  3NQI A;  4B08 A;  4LF9 L;  2R7Z B;  2OF1 A;  4BBS H;  4JOI A; 
#chains in the Genus database with same CATH homology
 1JOQ A;  4G7Z C;  5A35 A;  4IFD G;  3BYT B;  3R2I A;  2RDH A;  1LT4 D;  3FPP A;  1Q1B A;  4QB4 A;  1BCP C;  1MBY A;  1F77 A;  1MSG A;  1NR4 A;  2EE1 A;  1CHQ D;  1SJE D;  2AUK A;  1EU4 A;  3I73 A;  2VXW A;  1IKM A;  1DON A;  3MXU A;  3HOW B;  4DXG A;  3GP7 A;  5BN5 A;  2F4I A;  1NSN S;  3FMC A;  5C0X J;  1EY6 A;  3KF8 A;  3GO5 A;  4B9W A;  1B4O A;  1XWE A;  1IKL A;  5ELE A;  2B2U C;  3Q0A A;  3QG1 A;  1WTX A;  2EJF C;  2LS0 1;  1SYF A;  3HRZ C;  2RKS A;  1E0B A;  2QIL A;  2K6A A;  3OPO A;  1TS3 A;  3M7N A;  4OL7 A;  3V2T A;  5IT9 L;  5BN3 A;  1X32 A;  1SXT A;  3SXH A;  5JAV A;  5CC4 A;  1BCP F;  2IW3 A;  2B2T C;  3NK9 A;  4C3I G;  1GUS A;  4K8J A;  2E2D C;  3H3V C;  5IOC A;  4A3F B;  2G9H D;  3MZ5 A;  1DOM A;  3PUV A;  5ELB A;  1AN8 A;  1I6V C;  1KLU D;  1C4Q A;  2AQ1 B;  2SNS A;  1SND A;  2CVR A;  3ND8 A;  3BZD B;  1BO0 A;  5D14 A;  2F0J A;  2F0V A;  2R93 B;  2KA7 A;  1Z7T A;  2NVT B;  1WVL A;  1UUP A;  4L63 B;  2Z1C A;  5C5M A;  3S14 B;  5J39 A;  2IWH A;  1B2T A;  4Q0F A;  5D3D A;  2TMP A;  2A5H A;  4FVM A;  1HPC A;  4XQQ A;  3TP5 A;  3ERQ A;  4C56 C;  5D3I B;  1EU3 A;  2A73 B;  1D5Z C;  3K5O A;  1QJO A;  1TS5 A;  2PCF B;  1I4R A;  1A6X A;  4EQN A;  1R4P B;  4IUQ A;  5NUC A;  1CA6 A;  3H09 A;  4XYO A;  3AMU A;  1O7L A;  5KYL A;  2KEE A;  4KKT A;  2A74 C;  2WII B;  4K5X A;  4Z9C B;  5FOB B;  1H9J A;  1EWH A;  1HQM C;  2NN6 H;  1S5C D;  4G7H C;  2F0W A;  1H9S B;  4JK1 C;  2PYK A;  3J80 L;  2KED A;  1TQO A;  3A7A B;  2PMZ B;  4RHR A;  3X3N A;  4EGV A;  2PW5 A;  4J1M A;  1DOL A;  1GUT A;  1E2Z A;  1HA5 A;  1ET6 A;  4OO1 H;  1JC7 A;  4RCO A;  4X3U A;  4PMC A;  4TKO B;  3H94 A;  4RA8 A;  3CQZ B;  3VR3 A;  4G4K A;  2ICE C;  2LY7 A;  2R61 A;  4ULL A;  5TSS A;  4RGT A;  5E1F A;  1BUV T;  1EY0 A;  3GTG B;  4FNF A;  3DM1 A;  1BBX C;  1PTO H;  1Z47 A;  5IGB A;  1BOS A;  1CHP D;  3LWU A;  1XYI A;  3A56 A;  1JWU D;  1BNZ A;  2BA1 A;  1D5M C;  1K8O A;  5I4D A;  4A3E B;  2RA4 A;  3EJI A;  3SHL A;  5M5X B;  3MC0 B;  1PFB A;  4I7Z C;  1Y8P B;  2H4O A;  3KK7 A;  5C3E B;  4IN3 A;  4V0B A;  2K03 A;  1GHK A;  4KD3 A;  2MP1 A;  1PYW D;  2F0D A;  3DEO A;  4C3J G;  3F2U A;  5DEH A;  1GHJ A;  1HQR D;  1H9M A;  1TR5 A;  2F0F A;  1RTN A;  1I4X A;  2A6H C;  3Q22 A;  4FO2 A;  4KHV A;  4ME5 A;  2PW7 A;  2SOB A;  3GTJ B;  1ENC A;  2DY7 A;  4C3H B;  4R8I A;  3IL8 A;  4MIU A;  4FXK C;  3HEJ A;  1V1O A;  2XN9 C;  1EOT A;  5C0X I;  3TP6 A;  4A3B B;  2PO4 A;  3MXP A;  4DA2 A;  3MAQ A;  2E74 C;  1ZXT A;  3X3M A;  2IPK D;  1BF4 A;  3PIO 3;  5EPK A;  2EY5 A;  1MSH A;  2L1B A;  3BVM A;  4X3S A;  1B44 D;  1LTG D;  1HXY D;  1EEF D;  4BBS B;  2WAC A;  4HSP A;  4RGN A;  3D3R A;  1SNO A;  3NTK A;  4K6L A;  2A6H D;  4KKS A;  5K5P A;  3C46 A;  2BOS A;  4FP5 D;  3HOZ B;  1DD2 A;  2RDG A;  1HUN A;  3D4D A;  5J1Z A;  2R92 B;  2QEJ C;  3S15 B;  1UEA B;  2HCC A;  3DWA A;  3HOU B;  3TBI B;  1OXU A;  2Z4H A;  3L9A X;  2KJX A;  5EJW A;  1SNP A;  4DAP A;  1BDO A;  1HFG A;  1YNJ C;  2PZT A;  1LV9 A;  4FXD A;  3R3O A;  3M4Y A;  2NTS A;  3MA2 B;  3IAY A;  2AUJ D;  3SK8 A;  2L55 A;  1NR2 A;  3QO2 A;  2VB3 X;  2L4N A;  5JOB A;  3BVG A;  4DU9 A;  4BA1 I;  3D4R A;  3RZO B;  5ELC A;  1I4P A;  2XWB B;  4XT1 B;  1SMY C;  3IKJ A;  4RGM A;  3HOY B;  1CT1 D;  2F0T A;  1SFO B;  2EY6 A;  1STE A;  4DXF A;  1B3A A;  3M3Y B;  3TSS A;  4WFN 3;  3N52 A;  5C3X A;  2KUM A;  5CYU A;  4CHT B;  4KD4 A;  3BS1 A;  3E0J A;  1F9S A;  1II3 A;  1AZP A;  3SK4 A;  1EFI D;  2BE5 C;  4J6H A;  2HUG A;  1RKN A;  1S4Z A;  4IQZ A;  3VYU A;  1IW7 C;  2WKD A;  2IX0 A;  2F0N A;  1JR0 D;  3A55 A;  3E6Z X;  2CQA A;  1XTC D;  4KHZ A;  3W2D A;  4QUF A;  1QNU A;  3KBG A;  2F1M A;  4OIJ A;  1B53 A;  1O78 A;  2C5C A;  3JAM L;  1GXD C;  4GZY C;  1IHZ A;  3N6R A;  3T51 B;  1KAA A;  3W3A A;  1KNE A;  2M2L A;  4ZKC B;  1J8I A;  5EPL A;  5FLX E;  1KDA A;  2EVB A;  1TS4 A;  4O42 A;  4FXG C;  2Q8T A;  4DAY A;  4H7B A;  5EPJ A;  3SK6 A;  4XYQ A;  1A3V A;  3CRL C;  1ET9 A;  2SNM A;  1RD9 D;  5M3M B;  3J7A V;  4TRD A;  1KNA A;  2DY8 A;  2EYP A;  2F0L A;  4BA2 I;  3BYY B;  2QKI C;  5HUR A;  3A8K E;  5EQ0 A;  3TZU A;  3K5M A;  3DMU A;  3QB3 A;  3G7L A;  2E2I B;  5EBC A;  4ID6 A;  4PNY A;  1RDP D;  2Q8I B;  2E2H B;  1MGS A;  4A3I B;  3ND9 A;  2RBM A;  2X69 A;  3AU7 A;  1QOH A;  1KDC A;  2BA0 A;  5JEA G;  1WD1 A;  5E4X A;  1Y1V B;  4DF7 A;  4JBW A;  3M85 A;  3LX0 A;  5JPM C;  5COR A;  4IFD J;  5HGT A;  1EY5 A;  3VR6 A;  3TDQ A;  1WTV A;  2F0I A;  1PTO B;  2AWN A;  3A8J E;  2HCI A;  1ENA A;  3BDO A;  1KAB A;  4G7O C;  1RF2 D;  1DXM A;  1DYQ A;  3BDL A;  5KND A;  4PV1 C;  3P20 A;  3C1E A;  3PMF A;  1F9Q A;  2K5W A;  4EQO A;  1BXT A;  4Q5V A;  3IFT A;  5LL6 X;  1TWG B;  3S2D B;  2F0K A;  1TY0 A;  5IGC A;  1D6E C;  2PZW A;  5KRU A;  4XQJ A;  2R3Z A;  5JPN C;  3DWP A;  4DFA A;  3QWN A;  1T5E A;  1WTP A;  4HMI A;  2OT2 A;  4HED A;  2Z4I A;  2E76 C;  1GUN A;  1K83 B;  3MFG A;  1HA6 A;  1SJH D;  4HAE A;  1G6Z A;  2EPB A;  4CKE A;  1IYU A;  5C4J B;  2QDB A;  4IUP A;  3K0Y A;  2XWJ B;  4B9X A;  3GV3 A;  1A15 A;  3FEW X;  3NWS A;  1Y69 U;  1BCP D;  4S3S A;  2NYZ D;  5C0X G;  1ROD A;  1HTP A;  4KTA A;  4KY7 A;  1FD7 D;  4QUC A;  4WJW A;  5CGK A;  1CZG A;  2NZ1 D;  3FRP B;  4ZQ3 A;  1LLR D;  4RFB A;  3T13 A;  1NAP A;  1U4R A;  3I4M B;  2O2L D;  5G3L F;  5T1I A;  2GA4 B;  2EYO A;  2XRQ D;  3J7A F;  1SDF A;  1PXU A;  2K32 A;  2Q8R E;  1QG7 A;  4FYD A;  5I2Y A;  1O80 A;  1OO9 B;  3WDN A;  1U4L A;  4CJ0 B;  3NE5 B;  2EY2 A;  1HRJ A;  4BY7 B;  1LTT D;  3RLF A;  2I07 B;  1VCI A;  3I3C A;  1SNM A;  4K5V A;  2NN6 I;  4ABN A;  1PRT C;  4A3D B;  2AQ2 B;  1F9P A;  1Q90 A;  4IUU A;  3OSO A;  3HS0 C;  1AFP A;  4DGZ A;  2E2J B;  3MXN A;  3J7Y W;  3DWQ A;  1JWM D;  1HTL D;  4C3I B;  3OMG A;  1J9O A;  4ZLT F;  2EJM A;  4OO1 I;  5ELD A;  5CV4 A;  3HG9 A;  1SAP A;  3CKI B;  1STG A;  1ZKO A;  3A8I E;  4KMU C;  1HHV A;  2D5D A;  1UNS A;  1OXV A;  3RMH A;  2G9D A;  1JCK B;  1BQQ T;  1MD2 D;  1FYC A;  3NQT A;  3HOV B;  4MHE A;  5C4H A;  1PRT D;  1Y8O B;  2QCP X;  5CBA E;  1PRT F;  2O5J C;  4KKU A;  3VA5 A;  2L5T A;  2R6G A;  1Q1E A;  1F2Y A;  3I72 A;  1IYV A;  5DAU A;  4H44 C;  5F2D A;  2J7Z A;  4CJ1 B;  1PZJ D;  3M7G A;  3PO3 B;  4R8N A;  3VYR A;  3S1Q B;  1F2M A;  4RH6 A;  1SYG A;  2K04 A;  2O4X A;  1STN A;  2XVS A;  2F3V A;  4K8I A;  5KIX A;  3NTI A;  1R9T B;  1G29 1;  1LTA D;  2X6L A;  4K5W A;  1FGB D;  5M5Y B;  2J4X A;  1A2U A;  1SBB B;  4CGY B;  1R4Q B;  4XTC S;  2D62 A;  3MTS A;  3IFD A;  1TU2 B;  5FKA C;  3TME A;  2H1E A;  1LT5 D;  4F8M A;  2BDO A;  1AZQ A;  1LT6 D;  2IT1 A;  2BCO A;  4IFD I;  4ILW A;  4BBR B;  4IAL A;  3GTL B;  4G57 A;  5CBE E;  4C3H G;  5FK9 C;  3J81 E;  3T4A C;  3NBH A;  3GD7 A;  3KUP A;  3HP3 A;  3GTO B;  2JEA I;  4X3K A;  2I46 A;  5CV9 A;  4BWG B;  1I4Q A;  4CBV A;  3P1H A;  3R2T A;  5KEE A;  5JEA H;  3QIA A;  5EKI A;  1L0X B;  3CRK C;  2NVX B;  1D1I A;  2MPM A;  3QOL A;  5E3F A;  2KVM A;  3NPP A;  1PDQ A;  4IUT A;  1Q12 A;  4H13 C;  4IFD H;  5FO8 B;  1XX8 A;  4ZAI A;  3S9W A;  5KGU A;  1HFN A;  1X3P A;  2KHS A;  3BDC A;  2A69 C;  4KI0 A;  5E4W C;  1ZEQ X;  3SR1 A;  2Z8L A;  4OIK A;  5AFW A;  4TQU S;  1DJR D;  4TSS A;  1S5B D;  1YNN C;  5LL6 S;  2BDN A;  2HQE A;  5IGG A;  3FDT A;  3K5L A;  5CV7 A;  1LAB A;  5JVH 3;  1ZYR C;  3ONA B;  2L11 A;  2L12 A;  2F03 A;  2EYL A;  3KLR A;  4EQP A;  2PPB C;  1FNW A;  2CW0 C;  3VYT A;  1ONL A;  2NBF A;  1D5X C;  2QF7 A;  5D65 A;  3GTM B;  1A2T A;  4X3T A;  1KTK A;  5KYI A;  1JOR A;  1TII D;  3D8G A;  3S1N B;  2A69 D;  3T16 A;  1Z6H A;  5DM7 3;  3I4N B;  1JQY D;  2LFN A;  4KY6 A;  2TSS A;  4DK0 A;  2KQ3 A;  4RWS C;  4NW2 A;  1YNN D;  2B39 A;  4DNR B;  5IGF A;  2JA5 B;  4K14 A;  2MJ8 A;  1ZYR D;  1SYD A;  2F0Q A;  1TKW B;  4LK1 C;  1RHP A;  3U9S A;  1LT3 D;  1F9R A;  2WKC A;  3DXJ C;  1STH A;  3GQB A;  4RGO S;  2O5I C;  4HMJ A;  3PO2 B;  3SDZ A;  3T56 B;  1RJT A;  1TWA B;  2JE6 I;  4RHS A;  1PFM A;  5JVG 3;  4J8Q A;  1D2B A;  1LTB D;  1EQV A;  1EY9 A;  3HZX A;  3R93 A;  1SYB A;  4F87 A;  1KDB A;  4PMB A;  1YNJ D;  2B2W A;  3S16 B;  3FKI B;  5I6W A;  2EYF A;  4FF2 A;  3NUC A;  4RAU C;  2RDF A;  3K7A B;  1EWC A;  1PTO C;  5JJZ A;  2NN6 G;  1SE2 A;  4ZKB B;  4EVO A;  1I4G A;  1SMY D;  1ML0 D;  4ZYS A;  4QCL A;  1SYC A;  1Q3L A;  3SK5 A;  1WTQ A;  4F88 A;  5C5L A;  1Q8I A;  3VA7 A;  3MHB A;  1G8Z D;  1Y1W B;  1PMR A;  1T5X D;  1B9N A;  5FLX L;  4OO1 G;  1SYE A;  2A6E C;  5I6Y A;  2FMM A;  2BE5 D;  3S1M B;  1HUM A;  3EA6 A;  4OGQ C;  1IW7 D;  1GUO A;  3MFY A;  4QMG A;  1EEI D;  1Y8N B;  3OW7 A;  2PQE A;  4RKL A;  2ID0 A;  4UDU C;  3NWT A;  2WAQ B;  4HSV A;  5EKL A;  4A3G B;  2KEC A;  1G2T A;  1TY2 A;  1PTO F;  3DHQ A;  1JE4 A;  5JEA J;  1B1Z A;  2ZXP A;  1XXG A;  1EZ8 A;  1H9K A;  5CV8 A;  3NP8 A;  3H0G B;  2WIN B;  1H9S A;  2F0P A;  1X3Q A;  3L3O C;  1AP0 A;  1G91 A;  1JB3 A;  2XSC A;  2ENB A;  2A6E D;  5CMD A;  5M3F B;  3L7Z C;  2B2W C;  2DN8 A;  3OIQ A;  2FFK B;  4WOR A;  3LNN A;  4E6I A;  1VMC A;  4KN7 C;  4OHJ A;  4AYB B;  2K7V A;  2JXM B;  1ESR A;  2EOT A;  1GUW A;  3Q23 A;  2EY1 A;  1CK1 A;  4RCN A;  4ZK9 B;  3I8Z A;  3WOE A;  1MI2 A;  1CQF A;  1I50 B;  3K6O A;  4XXE A;  1QB5 D;  4NP5 A;  4DNT B;  1SSO A;  5A2Q L;  4NKL A;  3QJY A;  5A2Q E;  4Y7N B;  4RKB A;  1A3U A;  4LJZ C;  3C3L A;  3U9O A;  4DK1 A;  5IGD A;  2DNE A;  3MWY W;  2F3W A;  5ELF A;  1TWF B;  1OXT A;  4KK7 A;  3OWE B;  2HDM A;  1EIG A;  4KJO A;  2K01 A;  2EJG C;  4A3K B;  1W6K A;  1FR3 A;  1U9R A;  4K2K A;  3D4W A;  2XIW A;  2IL8 A;  2N88 A;  1NCV A;  3D31 A;  5I9O A;  2EYH A;  2WP8 J;  1EL0 A;  2VB2 X;  5CV6 A;  4DAV A;  4FF3 A;  4P2C B;  3DUZ A;  1VF5 C;  1WTR A;  1GOZ A;  2F0U A;  3MXG A;  5G3L D;  5IT9 E;  2DNC A;  3P75 A;  1SE4 A;  3D6W A;  3RD4 A;  2C9O A;  2VUM B;  1PZI D;  2ZXO A;  2A68 C;  3OHX C;  5I9P A;  3GTK B;  5KNB A;  1H9R A;  3I91 A;  2J0T D;  5EBD A;  2NB0 A;  2SEB D;  1IL8 A;  1AEX A;  1M4V A;  3ITP A;  1W6J A;  3GV6 A;  1DCZ A;  2ZXR A;  2D2C C;  3BG3 A;  4CKC A;  2RSO A;  3EFX D;  1V1P B;  2JA7 B;  1BCP B;  5ISR A;  4HR7 B;  1M8A A;  2JSO A;  2XRS D;  1SEB D;  1NUC A;  2XNA C;  4QF4 A;  2FMC A;  2SDF A;  3OMC A;  1U4M A;  5K36 G;  1RCV D;  1SNQ A;  5C4Z A;  1LTR D;  2B8G A;  1CZW A;  2EYM A;  2WV6 D;  3ERO A;  1O7Z A;  2MUY A;  3EVQ A;  2A68 D;  2B63 B;  4ZUI A;  4UAI A;  4FF1 A;  4I65 A;  1I3Q B;  1EYD A;  2F0E A;  3O13 A;  1JOO A;  3I70 A;  3SE0 A;  2JEB I;  1CFM A;  2B8F A;  4WRD A;  1SNC A;  1FNU A;  2JYO A;  1AW7 A;  3PUZ A;  4MN3 A;  4H0L C;  3K57 A;  4IZ8 A;  3J80 E;  2PZU A;  3OOC A;  4XT3 B;  2NUC A;  3KLS A;  1U4P A;  3VR5 A;  1PZK D;  4NMZ A;  3NTH A;  3DEP A;  3WOF A;  5IGE A;  2LMC B;  1F2L A;  1OXX K;  3KLS X;  2LKV A;  3LWE A;  3RZD B;  1B50 A;  1EYA A;  5BN4 A;  4ODG A;  1PRT B;  1L0Y B;  5IOD A;  2MHV A;  1EQT A;  4ZUJ A;  3J81 L;  2RVL A;  1CQV A;  1TVX A;  3Q6S A;  2JP1 A;  1GUG A;  5C4X B;  3A54 A;  4N9T A;  3GTP B;  3I90 A;  1VDZ A;  1KLG D;  3I4L A;  4C1N I;  2RQX A;  5DNF A;  3PV0 A;  4XDX A;  1V43 A;  2B2V A;  5EGT A;  1O7Y A;  3T53 B;  1TWC B;  4KV6 A;  5COY A;  1B9M A;  2VNU D;  1BR9 A;  3H6M A;  2RSN A;  3A7L A;  1LTS D;  1TT2 A;  2B2Y A;  1QWY A;  1EIH A;  3PUY A;  2K5D A;  3K5N A;  1LTI D;  1EY8 A;  1EY7 A;  1S5E D;  1I6H B;  3VR4 A;  2X6G A;  3FVQ A;  3QOJ A;  1DZ1 A;  4KY5 A;  1OXS C;  2IX3 A;  2N55 A;  2ZT9 C;  4A3J B;  2YU9 B;  2NWG A;  1CI3 M;  4L6T B;  1STB A;  4R9W A;  4IUN A;  4C3J B;  4IUR A;  1S5D D;  1QCB D;  1PLF A;  4F7X A;  3V96 A;  1V8Q A;  3VYS A;  5C3W A;  2JA6 B;  1ILQ A;  5FO9 B;  5I2X A;  3D6C A;  4K6D A;  1FNV A;  4HCE A;  5M5W B;  1LO5 D;  1WCM B;  4CKB A;  2EYJ A;  3H91 A;  1E2W A;  2FIN B;  2KCC A;  1EY4 A;  3M4O B;  4U68 A;  3MVV A;  3TP8 A;  3AB9 A;  2NTT A;  5C0X H;  5CV5 A;  2FJ2 A;  4A3M B;  1VMP A;  3UI2 A;  4IUV A;  2D9U A;  3K59 A;  3NBI A;  4M8A A;  2B2V C;  5J22 A;  1WD0 A;  4HN7 A;  2OEO A;  4PQX A;  1F2Z A;  1RTO A;  4U67 3;  1CA5 A;  4QIW B;  2L0C A;  1HCZ A;  3TN2 A;  1JOK A;  2B2Y C;  2CW0 D;  3K58 A;  2FHT A;  2EXZ A;  1QE6 A;  1ENF A;  1E2V A;  2OXP A;  4K2L A;  3C1F A;  3G6J B;  3SVM A;  1I4H A;  3NHH A;  2F0G A;  3S17 B;  3PUW A;  3PIP 3;  3P7J A;  3KBX A;  4C2M B;  2HDL A;  4V19 0;  3HOX B;  4ZRZ A;  1C8C A;  4N9P A;  5DM6 3;  1LAC A;  4FF4 A;  4YIJ A;  2EZV A;  4KN4 C;  2L9H A;  2K1B A;  4LAA A;  3S1R B;  1ICW A;  5K36 H;  2M00 A;  4XQN A;  2ICI A;  4M1U B;  2KCN A;  1STY A;  1JWS D;  2IX1 A;  1GJX A;  3HGB A;  4L8J A;  5CR3 A;  1QNK A;  5M9O A;  5EKK A;  2E75 C;  5LHY 1;  3OWF A;  1WTO A;  2K05 A;  1TWH B;  1SE3 A;  4NDX A;  2YYZ A;  5C6A A;  1A3T A;  2KOL A;  2PNR C;  3MEH A;  4C1N K;  3NSW A;  1UAP A;  4KJN A;  3TZD A;  2JA8 B;  4LMQ D;  2M9V A;  1V1P A;  2CHB D;  2NVQ B;  2NVY B;  3V05 A;  3HKZ B;  3R8B A;  4CJ2 C;  3JAM E;  3PUX A;  2EDG A;  5T1G A;  1C48 A;  1TS2 A;  2K33 A;  2AWO A;  4HCS A;  3Q24 A;  2MGS A;  5FO7 B;  1CM9 A;  4XIG S;  3URY A;  1ESF A;  5C44 B;  4A93 B;  1ILP A;  4BY1 B;  3OIP A;  4BS9 A;  4HTH A;  3E5S A;  3EQL C;  1PTO D;  2B2U A;  2F0H A;  1STA A;  2F0M A;  1DM0 B;  3BVZ A;  2AQ3 B;  3FPU B;  1S5F D;  1WTW A;  1PFN A;  1K8M A;  2K28 A;  3CU7 A;  1CTM A;  3RUZ A;  1EZ6 A;  4DN4 M;  2WB1 B;  3VR2 A;  5IIF A;  3SEB A;  2B2T A;  1DOK A;  3TP7 A;  3GTQ B;  4PMW A;  5KNC A;  1EYC A;  2F0S A;  4O1N A;  3S2H B;  2V4D A;  2IJ0 A;  1G2S A;  1JIC A;  1VF7 A;  3CHB D;  3C2P A;  2Y0S B;  1D1K A;  2K5Q A;  1QIL A;  3NXW A;  3ZYY X;  2F0O A;  3NQI A;  4B08 A;  2R7Z B;  2OF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...