2CQAA

Solution structure of rsgi ruh-039, a fragment of c-terminal domain of ruvb-like 2 from human cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
95
structure length
95
Chain Sequence
GSSGSSGKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-039, a fragment of C-terminal domain of RuvB-like 2 from human cDNA
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords RuvB-like 2
total genus 10
structure length 95
sequence length 95
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.360 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2cqaA01
2CQAA 2C9OA
chains in the Genus database with same CATH superfamily
3DXJC 1HNXL 1S4ZA 3FKIB 3D3RA 3L2PA 1SR3A 3CXCA 4HJAA 4HEDA 2NZOA 1K83B 2XGTA 3NEMA 3W2DA 1EQVA 2AMCB 3PIPA 4O1NA 4FF3A 3L7ZC 1SYEA 4XDXA 4NP5A 1N33Q 1QCBD 5D3IB 4IJLA 4KY5A 5I6YA 4R9WA 1B50A 3WOFA 1X65A 1RF2D 1CSPA 2OF1A 3DLLA 1YNJD 1IYUA 2NVYB 2BH8A 5J3BA 4QJFA 5E4WC 2WP8J 1D8LA 1I5FA 1RKNA 3K0YA 3TS2A 1NBWA 2KCMA 5IGGA 4CHTB 4MNOA 2ZJPA 3T13A 2G5DA 3TP6A 4G7ZC 1AE3A 2K28A 2RDGA 1KLGD 2ZT9C 5E7NA 1II3A 1EY0A 3KF6A 3GP7A 3WWVA 2UUAQ 1IL2A 3DWQA 3S1NB 3NBIA 3U58A 1CQVA 3TMEA 4HJ5A 1BQQT 2VS1A 3S2HH 3HOZH 2IHFA 4C3IH 4OIJA 3KFUA 2R93B 3EQLC 4OIKA 2WIIB 4IFDG 2ASBA 5J1ZA 1AEXA 1CA5A 1SNDA 2A69D 1BR9A 1W3SA 3PF4A 1Q81C 4BY1B 4TKOB 3L0OA 4LFBL 2VUMG 3PO3B 1BCPF 3VYTA 2J7ZA 1E1TA 4GLVB 2RSOA 2QEXA 5C4XB 5M3FH 3FHWA 1HA5A 1CFMA 4MTKA 4OGQC 3VR3A 4A3BB 3R8BA 4ALPA 1TS3A 3M85A 4IUVA 1TWAH 1PZJD 4LF4Q 1RHPA 3GTJH 1KIXA 4OEMB 1EUJA 5IYDG 1FL0A 1D5MC 3L9AX 1Q7YC 1EFWA 1PTOH 1HJPA 3D4DA 4EQ5A 2PMZE 4A3DH 1E3PA 3EFXD 4QCLA 2UXDQ 5FOBB 5LMNL 4RH6A 1STHA 1YJNA 1U4RA 3T4AC 2VQFL 1IBML 1B1ZA 5I4DA 2F0JA 5JEAH 5A2QL 2A6EC 1G6PA 2A68C 1K0RA 4B9WA 5FO8B 2F1MA 3CU7A 3I70A 4X3TA 1EWCA 3RN2A 1T5XD 4JI5Q 4RKLA 2HDMA 2E2HB 1RD9D 5JJKA 4DV6Q 1VQLA 5HGQA 1O7ZA 4ME3A 1BCPB 1STBA 4C3JB 4C3HG 3UI2A 4A93B 1VQ4A 5J39A 3Q24A 1QG7A 3AFQA 4GS3A 5IP7G 3VR5A 1K8MA 1QZHA 3F8TA 3CCQA 2F4VQ 4KD3A 1E1OA 4FF4A 1DZ1A 1RODA 2WFWA 4KD4A 4DR4L 1VQHA 3B6YA 1QVGA 5GAHC 2WAQE 3H3VH 4QB4A 3PUWA 5JEAG 1HA6A 2RKSA 1N34L 4ZYSA 2AQ3B 3QO2A 2JA7B 3KUPA 4IJHA 1O7IA 2K5DA 4HTHA 4C3IB 2EYOA 4EQOA 3PIP3 1I4HA 2B2UC 1H9MA 5IYBH 1IBKQ 4BY7B 1LTID 1F9PA 3NBHB 5JAVA 3HS0C 3A7LA 3A8JE 4X64Q 1PFMA 4DAYA 4CJ0B 1U4MA 1EQTA 3RZDH 4GKKL 4OL7A 5JJLA 4MZ9A 4HCEA 2L55A 4BA1I 3X3MA 1EYAA 1YNJC 5M3FB 1CI3M 5KYIA 3PIOA 1A62A 3RLFA 2KUMA 3R2IA 2CQAA 1G2SA 2E8GA 2WKCA 1JORA 1EYDA 1PTOD 1PH2A 1PRTF 3P20A 2A8VA 4R4IA 3I4LA 4RHRA 1ZEQX 4O2DA 3P75A 1EY6A 2SDFA 3K81C 2LFNA 2UXCL 4MIUA 3VYRA 1EU3A 1PH9A 2F4VL 1N32Q 1F9RA 1GM5A 1WFQA 3LX0A 4K2LA 4JI7Q 3OIQA 4ME5A 4LJZC 1M4VA 3HOXG 3S17B 4NPSA 4A3FB 2RBMA 3W1GA 1ASZA 1SMXA 1VQMA 3A7AB 1HQMC 2JXMB 4G4KA 2ICEC 3S15H 1TWHB 2CFMA 3HOUH 1YEZA 4LUZA 2VQEQ 5C0XH 2L4NA 3BDCA 1YBYA 4KJNA 3HRZC 3OW7A 2I0QA 2C35B 1FNVA 5NUCA 1PDQA 2F0WA 2LXJA 4PG3A 3HOVH 2NB0A 5EKLA 2K33A 1AE2A 3PUVA 3C46A 3I4OA 4A3KB 3HKSA 4JI4Q 4O42A 1CT1D 3JAML 3OWEB 4G7OC 2K5WA 3GTOB 2IX0A 2EXDA 5M3MB 2KECA 3CCMA 1XNQL 3RN5A 3VDYA 4MTNA 1PRTC 3LWUA 1G51A 2P5ZX 2JA6H 1YHQA 4M1UB 1Z47A 1TS5A 1Y1VB 1Q90A 4DFAA 3CF5A 1ZKOA 3NP8A 1D1IA 3PV0A 5AJ3Q 4HJ9A 4LFCQ 1JE5A 1ESRA 1EYCA 1EWIA 2NN6H 2R3ZA 4DV5L 5HURA 5BR8L 1H9RA 1X3PA 4JW0A 2OXPA 1E0BA 2SNMA 4HR7B 3W5OA 2WB1G 2BH2A 2HHHQ 3J7ZC 3S2DB 1LTGD 4PZ8A 5GROA 2CCZA 2NVQH 1NR4A 3BZKA 2E2IH 4DR2L 3NWTA 1IBLQ 1RIPA 4XYQA 3BZCA 1Q3LA 2CH4W 3HKZE 1PH1A 1B2TA 2F0HA 2NZ1D 2KCTA 5FLXL 4GOPB 4WJ4A 1SRUA 2BDOA 2PQAB 5ELBA 4GNXB 1A15A 2IT1A 3IRBA 1FVIA 3A56A 4A3CG 4A3IB 4JV5L 1J6QA 2PYKA 3KLWA 2F03A 1UE5A 3NHHA 1V8QA 3G71A 1XPOA 3MVVA 5C6AA 3HOYH 1E7ZA 3D0FA 4X3SA 4K0KQ 3H0GG 1FD7D 4OELB 2Q2HA 1FYCA 4B3TQ 2ZTCA 3Q0AA 3ERSX 5IOCA 2UUCQ 4CDCC 4LF4L 1EQRA 5C4HA 1OO9B 4C56C 2D5DA 5C44G 1SROA 1HNZL 2Z1CA 3HZXA 4A3FH 4DF7A 2Q8TA 3BG3A 3S1QH 2XVSA 1L2FA 1Q46A 2JA8B 1VQ5A 1IW7C 1QZGA 2DNEA 1Y8OB 1LABA 4LW1A 3NTHA 1B3QA 3D6WA 4B3SL 1IBMQ 1WTHA 4JI0Q 1EIYB 2YTYA 1JOKA 1PFNA 1SJED 4CJ2C 4DV4L 4A3IG 4LMQD 1U4PA 2IHEA 1TWCH 4DPGA 3UE0A 2PNRC 1XMOL 1U0LA 4DKAC 1I6VC 4FYDA 1BF4A 1I6HB 1ONLA 4OO1I 4UPAA 1X32A 5ELEA 3OIPA 4HN7A 5CV8A 3C3LA 1SAPA 2Y0SB 2KOLA 1F9QA 1ICWA 1CSQA 1GO3E 2JN4A 3SDZA 4CKBA 2NUCA 5G3LD 4YIJA 4L5TA 4J1MA 1PFSA 3DWAA 1CTMA 2FFKB 1CKNA 5BN3A 3OWFA 2CWPA 1DGSA 3ZYYX 4OO1H 3BDOA 4FF2A 1VQ9A 1K0SA 2GVBA 4DR1Q 4A3GH 1PLFA 4EGVA 1J5EL 2DY8A 2RDHA 1SMYC 1SNMA 2OEOA 5M3MG 4QIWB 4C3JH 3SK8A 2R92G 4NXNQ 3KBGA 4LAAA 3PO2G 4A3DB 1HTPA 1TS4A 4A3MG 2K50A 1MI2A 3F1ZA 1LTAD 4JC0A 4FDBA 3J81L 2QDBA 2HIVA 2VY3A 3KJPA 4B08A 2RHQB 1D5ZC 5DNFA 3U50C 4B3RL 2JK8A 5EKKA 1PFBA 2QCPX 3Q6SA 4N9PA 4DU9A 2QEJC 1SNCA 1EOVA 3V96A 1K9MC 3TS0A 5EJWA 4JVZA 2K32A 5E4XA 5I9PA 2F0NA 2Z9HA 3RLNA 2GN5A 5JPNC 4IUQA 1YHBA 5G3LF 1WOCA 4A3JH 5K36G 1FGBD 2NWGA 5LMUL 4QY7A 4A3FG 1HPCA 3E5SA 4DUZQ 4N9TA 2MO0A 3CCEA 1JE4A 5CBEE 5JVG3 4NXMQ 5IP7H 2M00A 1IKLA 3J80i 2PW7A 5CV4A 2YU9B 1JR0D 4XQQA 4BBSG 4KHZA 1BO0A 3G6JB 2FHTA 5GADC 2UXCQ 1KNAA 1NMFA 1HUNA 1GD7A 3O13A 3NK9A 3M9BA 1ILQA 5JJZA 4DUYQ 4GLXA 4JI7L 4ZUJA 2NVTH 1WD1A 1BCPD 4KN7C 1A3UA 1DCZA 2K5VA 2QKIC 1SFOB 1JC7A 1JMCA 4LF7Q 1M1KC 2ZJQA 1PH4A 3GTLB 1WJJA 3CQZB 3M4YA 1MHWC 3GTGB 4L8JA 1YI2A 3EROA 1IL8A 2NN6I 4A3JG 4A3KH 5K36H 1B3AA 3SVMA 4IPDA 2H1EA 4X6AH 2WAQB 2UXDL 4ZCKA 1EY7A 1I4XA 2BDNA 4AYBG 3JAMi 4BY7G 2B63G 1QUQA 2MHVA 1Y69U 5HY6A 4V0BA 4JI2L 2F0QA 2ZXPA 1GUGA 1QUQB 3D4RA 2JA7G 1S5CD 2WINB 3CD6A 2JYOA 2BE5C 2CQOA 4DK3C 1YVCA 4Y52H 4BWGB 4CDEC 2PI2A 1JB3A 2IL8A 1IYVA 4PMCA 4OWWB 3IKJA 5KRUA 3FP9A 1Q8IA 1JJ2A 2NVQB 3AEVA 2CH4A 2MQHA 4G7HC 1G2TA 2YTVA 3ND9A 3J81j 4C3JG 3DEOA 1SE8A 2EJFC 3FEWX 1VQPA 2EJGC 4BA2I 3I56A 2D0OA 3ULLA 1EZ8A 2MNAA 1JJCB 1RL2A 1Y1WB 5JVH3 1C9OA 3OMGA 5IODA 3SK6A 2F0EA 4ZAIA 4DAMA 4GNXA 3CRLC 1HH2P 3WDNA 1QB5D 4L5SA 4ZQ3A 1TIID 2VB3X 3CP0A 3RNUA 1N9WA 5ELCA 1PHJA 1LT3D 3QG1A 4KMUC 4DV3Q 2PPBC 3CCJA 2G9DA 1BNZA 4DA2A 4HAEA 2VB2X 1WTXA 4KKSA 4NMZA 5EQ0A 3KF6B 2RQXA 3CPFA 4HJ8A 2HHHL 4EX5A 1SMYD 4YCVA 2K52A 2Z0SA 4YHHL 2JJQA 2ZM6L 1VQ6A 4RCOA 3CCUA 3MXNB 1F2MA 5DEHA 2EPBA 4YWLA 4K8JA 4DV0L 4A3IH 2JA6B 4DR6L 4ZKCB 5KNDA 2A68D 1X3QA 3GTKB 4DR5L 2A69C 1O78A 4JOIC 1LT4D 1NJIC 1GHJA 2A73B 4JI1L 1EY9A 5CV6A 2OQ0A 1KDCA 1HNWQ 4PNYA 3OMCA 5D14A 3ITPA 4L63B 4GN5A 2LSSA 3PO3G 1MD2D 1QNKA 4F88A 2WAQG 4JI0L 2NTTA 1EY4A 1JOOA 1I4RA 2L15A 2Z4IA 3H3VI 3LNNA 1K73C 1B9MA 3RD4A 4KHPQ 3S2HB 1JWMD 3A0JA 3F2DA 3S1MH 5KYLA 2EYFA 1C48A 1DM0B 3D8GA 1O7LA 2FINB 5D65A 5EPKA 3S1RH 2BOSA 1Y1WG 2ENBA 2F0MA 2HT1A 5IT9L 3GD7A 1D5XC 3D4WA 1GUNA 2F0VA 4A3CH 1ET9A 1A8VA 5C0XJ 1EEFD 3CQZH 2EY2A 1NY4A 1IKMA 2E2DC 4BBSB 2N78A 1YZ6A 1XWEA 2L0CA 2QDLA 4KHVA 3G6EA 2EYLA 1FJGQ 1IBKL 3PIO3 2AQ2B 3MFGA 1Q8KA 3Q22A 3NQTA 5EKIA 3S15B 3H6MA 4X64L 2WKDA 2B2TA 4CGYB 5M5XH 1KNEA 4IALA 2N8NA 3SEBA 2XRQD 2EYPA 1TY2A 1STGA 4NDXA 3GO5A 2B63B 1V1OA 5KIXA 4H13C 1CK1A 1I3QB 1EIHA 1UE1A 1ENAA 4FXGC 1K8OA 5DM63 4POGA 2LKVA 4JBMA 4LF5Q 3OHXC 2DGYA 1KAAA 3E9IA 4A3JB 3H09A 1U9RA 1L1OA 2XWBB 3RZDB 3T1YQ 4RMFA 2SEBD 1TWCB 2NVYH 1Y1VH 2UXBQ 1L0XB 2ICIA 1JB7A 5I6WA 2Q2TA 3I4MH 3I91A 3CKIB 5C5LA 1G91A 3IFTA 4Q0FA 2R92B 4DK6C 4I7ZC 5LMUQ 2KEEA 2DNCA 1UEAB 1I4PA 4JI8Q 3PUYA 2BA0A 2OT2A 1Y1WH 3H91A 3GTPH 1I4QA 3RR5A 2QILA 3KK7A 3PGZA 2A6HC 3T51B 1HCZA 4A93H 3HKZG 1SYBA 2PCFB 1LM0A 3RZOB 1VQCA 4RFBA 2B8FA 2O4XA 1CA6A 1DONA 5C3EB 3K8AA 1K83H 3KLRA 4WJWA 1VQIA 3FRPB 1WCMG 4F8MA 4GLAC 2Y0SG 4DV7Q 3E3XA 2UUCL 1AW7A 1GOZA 3K0XA 5M5XB 3HOUB 4K14A 1RJTA 4LF7L 1N36Q 2JQOA 2UUBQ 1HZ9A 3VR2A 3MWYW 3F2UA 1PVOA 1R9TB 5GAEC 2H4OA 1A2TA 2JEAI 4FP5D 2PMZB 1H9KA 3K7AH 1IYJB 3QIAA 3NUCA 5KNCA 4A3MB 4UAIA 1YITA 2NVXH 1WTVA 2RF4A 3PO2B 2EYMA 2Q8IB 5M5YH 3VA7A 3GTGH 2RCFA 1KRTA 3H94A 3PUZA 2EVBA 4DXGA 1XMQL 2AHOB 1V1PB 2A6HD 1UAPA 2Z6BA 1QILA 5C4JH 3Q8DA 3I7FA 1VQ7A 4QGUA 2VUMH 3U4ZA 3PMFA 1DXMA 1Q1EA 1V1QA 5EBDA 2K6AA 3EA6A 3VA5A 1LO5D 2HQEA 1CKOA 5IGDA 3CPWA 4FVMA 2E2JB 1B44D 1D1KA 1RTNA 4IPCA 2EJMA 4OX9L 2OQKA 1CHPD 1V9PA 1Z9FA 4EQPA 3QOLA 4AQYQ 1HNXQ 3BYYB 1IXRA 2G9HD 1CUKA 2M2LA 5IWAL 3M3YH 1JJGA 2Q8RE 2D2CC 2SOBA 1GHKA 1F2LA 5CMDA 3J7AV 4RGMA 4B3TL 3MXNA 2QW7A 2QGQA 1N33L 1VDZA 3N6RA 2B2YC 3HOWH 3KLSA 3FDTA 1ZYRD 1S5BD 4DV3L 2OCEA 1P16A 5LMNW 1OXSC 3JAME 3GV6A 4UHVA 1EEID 2B2VC 5JPMC 4R1JA 3TP5A 2VQFQ 2HDLA 1X56A 3PUXA 1YJ9A 3TN2A 3J7YW 1DOLA 5T1IA 3OYYA 3MFYA 5FLXE 1Y1VG 1CZGA 2A5HA 3SE0A 3U9OA 5C3XA 3BS1A 4FO2A 4P73A 4DR6Q 3I8ZA 1ESFA 2VQEL 2R7FA 1TWFH 1UE6A 3H0GB 3K80C 3R3OA 4NKLA 3CRKC 4A3KG 3S9WA 1X3FA 5E3FA 5EPJA 4F87A 2E75C 3S16H 1OXXK 3WOEA 3EN2A 4K5VA 1P8LA 4JYAQ 2CWAA 1YIJA 3NSWA 3J80E 3SGIA 3T56B 4OX9Q 4TRDA 3A5UA 1WTPA 4QMGA 2JE6I 3ULJA 4DR4Q 1E22A 3VYUA 5L37A 3HOWG 1L1OB 1Q82C 4J8QA 1PRTB 1HNWL 2WB1B 3W3AA 1HR0L 3RLOA 1WCMB 1B7YB 3NTKA 4RKBA 3M4OB 5C4JB 1PYBA 4GN3B 4H44C 4I65A 2D62A 4C2MB 2I5LX 1NR2A 1WI5A 1D2BA 1A3VA 1BXTA 3P1HA 1BVSA 3HKZB 2O2LD 1JICA 5ELDA 1VF5C 2MFIA 3KJOA 3K5NA 2UU9Q 2FMCA 4ZLTF 1S5ED 5IGFA 2CW0D 1X3GA 2WV6D 1EIFA 1TWHH 2EQSA 5FJ8G 3S24A 1STYA 4A3MH 1SXTA 3PCOB 4JPBW 4JV5Q 1X3EA 2K7VA 4Q5VA 1PV4A 1TXYA 3TP8A 4B3ML 3EIVA 2MP1A 2I07B 3BJUA 4LK1C 2QF7A 3IAYA 1GUOA 1FJGL 5IYCG 1RDPD 1VQDA 1SNOA 3H15A 4BBRB 1I50H 1KDBA 3S1MB 2PZTA 4RA8A 3CC2A 3ONAB 5FKAC 2EZVA 4C3IG 3BVGA 2HCIA 4KV6A 5C3WA 3AYHB 2PQAA 4JBKA 1JCKB 3RUZA 5F2DA 2EOTA 2LMCB 4YCUA 3HOXB 5CGKA 4KK7A 2HUGA 4JI8L 3I3CA 1A6XA 4UDUC 3GTQH 3CMAA 2MO1A 4M8AA 2LS01 2E2HH 3AQQA 4XYOA 2DJFC 5CORA 4H02A 4U673 4C3HB 2JSOA 4LUVA 4BBSH 1STNA 3HOVB 1PA6A 4HIDA 1H9SB 5A35A 1XNRQ 1VQFA 4AIMA 1R9TH 2D0PA 3T1HQ 1AP0A 1STAA 4GKJQ 1KQSA 3R2TA 3A74A 2B2VA 2F0UA 4BY1H 5EPLA 2J4XA 2ZXOA 1A63A 4OWXB 2VL6A 3K57A 3CAMA 1WTQA 1IW7D 3I4MG 4G57A 1HXYD 4DR3L 4ULLA 4CKCA 1CM9A 2F0SA 2EYHA 3Q23A 3OSOA 4QIWE 2K4KA 3OW2A 3SK4A 4OONA 2JA9A 4UP7A 4WORA 2KBNA 2AQ1B 2IJ0A 1MBYA 5M9OA 4P75A 2F3VA 2XRSD 1DJRD 3M7NA 3DHQA 3S14H 2XTIA 2JA6G 2R93H 1EFID 1QWYA 5JOBA 4KY7A 2E2JH 1BKBA 4R4CA 3OPOA 4BS9A 1K3RA 4X62Q 4DAPA 4LWCA 5M3MH 2F0FA 1CKNB 3HP3A 1KTKA 2V1CC 4MN3A 4YWKA 1LTBD 3K58A 1YNNC 2K1BA 2KCNA 1QNUA 3ERQA 4NW2A 3M3YB 1RCVD 1V1PA 1E2VA 2K5NA 2F0IA 3RMHA 3TSSA 1EU4A 2YU9H 1HR0W 1VQBA 5C4XH 1SE3A 1KD1C 3T53B 3A8KE 1BBXC 2BCOA 4WJ3M 1B8AA 2RCNA 4YCWA 4DNRB 4IFDH 1T5EA 3UDIA 4DNIA 2L1BA 2UUAL 4K0KL 3MZ5A 1LT6D 1VMCA 1Q86C 3GTJB 1I50B 1TVXA 1DD2A 4X3UA 3KF8A 3SR1A 1D6EC 1SE4A 4EVOA 4DV6L 1WTOA 4OO1G 4TQUS 2PW5A 4DV2Q 4FNFA 5DAUA 2PZWA 2ZM6Q 3KLSX 2MUYA 2XNAC 4UP9A 1SJHD 1MJCA 4XTCS 4EQNA 2NBFA 2R61A 4IUUA 3J81c 2CW0C 1GVPA 4GN4B 5JEAJ 1BOSA 3PO3H 1SYDA 1LACA 4DR7Q 1W6KA 5ELNA 2DY7A 2UXBL 1QVFA 4JI6L 4Y7NB 1VQNA 1QJOA 1KHIA 3S14B 3LWEA 1E2ZA 1XMOQ 2IY5B 3V05A 2LXKA 2Z6KA 4PQXA 2F0OA 2F0TA 4A3BG 4BBRH 2IWHA 3GV3A 2IPKD 3NE5B 1EYGA 4A3EH 2F0GA 4AYBB 1WD0A 4ZK9B 3HGBA 1MSGA 3I55A 4BY1G 1ML0D 1IHZA 2KHIA 2K5QA 3J81E 1EWHA 2B2TC 3MAQA 2AWNA 4QUCA 3CCRA 4PV1C 1NUCA 4H7BA 4ZUIA 4PZ6A 3QR8A 4K8IA 5DM73 3S1RB 3J7A5 2KCCA 4CDFC 5IT9c 2PQEA 3ND8A 3TRZA 2AUKA 4IURA 1VQOA 4C2MH 2A1AA 4P72A 2ID0A 1SE2A 5FLMH 4H0LC 1SEBD 1PMRA 5I9OA 3KDFB 4IFDI 3C1FA 4IN3A 3K5MA 1ZYRC 1S5FD 4JBJA 4X3KA 4JYAL 1NSNS 4KI0A 3DEPA 2RDFA 4K5XA 3VR6A 4DV1Q 1EL0A 3J7AF 1UE7A 1UUPA 2Z6KC 2B2UA 5D3DA 5CV7A 1MJEA 4ILWA 3ICEA 4B3RQ 1NE3A 3IFDA 1B9NA 3KF8B 4IQZA 1OTCA 2VZAA 3PSIA 3U4VA 4HIMA 2KHJA 3DWPA 2B2WC 1RTOA 3STBC 3E6ZX 3SK5A 1BDOA 3AMUA 1NCVA 3J80c 4IUTA 4A3GB 5IYBG 4C1NK 2ZTDA 3F2BA 2PZUA 5K5PA 3DMUA 1TU2B 1H9JA 3OTOQ 5JJIA 4UP8A 4V190 1G6ZA 4XQNA 2HD3A 1VQ8A 4JCVE 1T9HA 1X6OA 4A3LG 3FKIG 3R93A 3NQIA 1MKHA 1KXLA 3PQIA 1Z7TA 2OWOA 4BXXG 5EAYA 3UDFA 2B29A 4A3DG 1L0WA 3EVQA 1C8CA 1WYDA 1XNQQ 4DUYL 1PYSB 4XXEA 2X6GA 5KGUA 2F0LA 4R4OA 4R8NA 2C5CA 1PYWD 2NYZD 1B70B 5FK9C 5FLMG 4DV7L 3K7UC 3HOYB 4B9XA 1SNPA 1LTTD 2DUDA 5BR8Q 3MEFA 2FMMA 3L3OC 1X9NA 5M5WH 4DGZA 4I7AA 1EQQA 2DJGC 5FO9B 3I4NH 3HOXH 3CC7A 4LNQA 2J0TD 1NAPA 5LMNQ 1HFGA 1F9SA 2AKWB 3DUZA 3S17H 3K6OA 3LGJA 1EIGA 4E6IA 3J81i 1JT8A 2F3WA 1V43A 3CCLA 3UDXA 2HCCA 5CYUA 2HIXA 4JOIA 2KJXA 4GOPA 1XJVA 4R4TA 1XMQQ 4X65Q 5IYCH 4JBWA 5CC4A 1VCIA 2JA8G 5GQOA 4MHEA 4GKJL 4K2KA 5FJ8H 2L5TA 4RWSC 1DOMA 4IUNA 1PH6A 4KY6A 1KABA 1M8AA 4J15A 5IP9G 4RGNA 5C44B 2N3SA 2EIFA 5AFWA 3G4SA 1I4GA 3CCVA 2R7DA 1K28A 2NZHA 4ODGA 1HR0Q 2IX3A 1NNXA 5C5MA 1NMGA 4K5WA 3HG9A 2LY7A 2PO4A 4DNTB 4X62L 3F2CA 3I2ZA 4Z9CB 4RHSA 3NENA 1B4OA 1QE6A 4DV4Q 4PMBA 2EY1A 4DAVA 1UNSA 3E9HA 4TSSA 4KTAA 1WCMH 4XQJA 1PZKD 3EJIA 4QL5A 4YHHQ 2FXQA 3PF5A 5J22A 3NTIA 1TR5A 1BBUA 4GZYC 3UE1A 4KN4C 5IP9H 4GKKQ 2JP1A 4FF1A 4L5RC 2R7ZH 5A2QE 4L5QA 2KENA 1IBLL 3S1QB 4B3MQ 3KBXA 1MSHA 2F0KA 4XT1B 4LFBQ 1SYFA 4OHJA 3M4PA 2NTSA 2EYJA 4BY7H 5I2YA 2F0PA 2EDGA 4WFN3 4POFA 1KRSA 3URYA 1PTOB 3GTLH 2N49A 1FNWA 2KHSA 4AH6A 5M5WB 4BXXH 2EY5A 4L6TB 2CHBD 2B63H 3D6CA 3GDEA 5C4ZA 5FLXc 4PZ7A 2ZTEA 1CHQD 4A3EB 2UUBL 3I4NB 1UWVA 1S5DD 2IW3A 5IGEA 2GA4B 2DN8A 3TBIB 4HSPA 3CCSA 2YTXA 1JQYD 3P7JA 2FJ2A 3MA2B 1TWFB 1XTDA 3H0GH 5IYDH 4CBVA 2TMPA 3CC4A 4NB3A 4RGOS 4ZRZA 4DR7L 3TZUA 3S2DH 1CQFA 4GOPC 2R7ZG 1LLRD 4JI6Q 1PH5A 3BDLA 3MEHA 1W6JA 4N8FA 1HHVA 1U4LA 4DXFA 5IIFA 1VS0A 2K03A 4B3SQ 1O80A 3BVZA 1HUMA 1S72A 1KL9A 4WRDA 4A76A 2OTLA 2AUJD 1MGSA 3HEJA 3GTQB 4DUZL 3H3VC 1Z6HA 3STBD 2KA7A 3KYHC 2HQLA 2PNHA 4DAYB 2B39A 2UU9L 1LTRD 1ILPA 5T1GA 5I2XA 5C3EH 1LT5D 1HZBA 2XIWA 2CKZB 1A0IA 1FGUA 1LYLA 3HOZG 3TDQA 1WVLA 4IUPA 4FXDA 1PH8A 3AB9A 4A3LH 1I3QH 2K01A 1IZ6A 3GTKH 1WTRA 1U5KA 4LF5L 3MXUA 4JI1Q 5IWAQ 1TKWB 4LF6L 3FMCA 2O5JC 1AH9A 4DV5Q 1ENCA 3I4MB 5LL6S 1J5EQ 3MTSA 3E0JA 1JOQA 1GJXA 3BZDB 4DV1L 4HJ7A 3BU2A 3V2TA 5M3FG 2V4DA 1QOHA 1YHAA 5IE8A 5ELFA 1Y8PB 3OTOL 4NXNL 4FXKC 4CDDC 1GXDC 1XYIA 3CHBD 1E24A 4YY3Q 3PO2H 3DM1A 1JWSD 4DR2Q 1K8AC 3HOVG 3BVMA 4XT3B 4LF8L 3BYTB 5EBCA 1DOKA 4TVAB 3ZJYC 5CBAE 4LF9Q 1I6HH 4HMJA 5KNBA 3UDGA 1ZXTA 1XPRA 1AZPA 4A75A 3HOZB 5LHY1 3ULPA 3S1NH 2JA5G 1BUVT 1HTLD 2JA5B 4P71A 1WTWA 2YYZA 1SBBB 1J8IA 3M4OH 3D31A 1LUZA 3KDFA 4HCSA 2B2YA 4NXML 4C3HH 1PRTD 2E5LQ 3NWSA 5COYA 4KKTA 4OWTB 4BBRG 1F2YA 1GUWA 1N32L 4A93G 3TP7A 4X66Q 2Z8LA 1TS2A 1KDAA 4LUOA 1VQEA 3FPUB 5BN4A 1PH3A 1H9SA 4UY8C 2B2WA 1VQKA 1FR3A 2ALYB 2XN9C 4C1NI 2O5IC 2WB1E 3CMEA 3G48A 4ZKBB 2KQ3A 3I73A 1HZCA 2QA4A 5GAGC 4CKEA 4KJOA 1FNUA 2F52A 1BBWA 4IPGA 3I4NG 3A54A 4P74A 4IOCA 1LTLA 3NBHA 5CR3A 3N52A 4OXPA 1MIUA 1G291 2B8GA 1C0AA 5ISRA 4R4QA 1NTGA 3U9SA 1DYQA 3GTMH 4LF9L 1SLJA 3GTPB 4DN4M 2CVRA 1XTCD 3EBEA 1PH7A 2EE1A 2ZJRA 1SNQA 3W1BA 3MXGA 3QB3A 5M5YB 4QF4A 1LV9A 4RCNA 4DR1L 4A4IA 2GVAA 3TEHB 1OXUA 3A55A 5AJ3L 4ABNA 5IGBA 1HFNA 2F4IA 5C4XG 3HOWB 2XWJB 4QQBX 2H5XA 1TWAB 4DV2L 3J80L 3AU7A 2VUMB 4R8IA 3DM3A 3TREA 1EY5A 4QUFA 3HFZB 3MXPA 1Q1BA 1SFOH 4JI3Q 4X66L 1TY0A 4DK0A 2KEDA 2Z4HA 1XPUA 2X6LA 2R7ZB 3A8IE 1PTOC 2K75A 2OTJA 3I90A 2RVLA 1K3BC 1YJWA 1SSOA 2R93G 4HMIA 2SNSA 2VW9A 4F7XA 1I94L 4K6LA 5DLQE 1G8ZD 2RA4A 3QWNA 2EY6A 5TSSA 1OXVA 1Y14B 3A5ZB 1N8RC 4A3EG 1OXTA 1YNXA 2F3IA 2E76C 4YWMA 1XX8A 1GUTA 4JI5L 4RGTA 4LFAQ 2JA8H 1ENFA 4J6HA 3OOCA 3S16B 1TWGH 4APVA 4A3BH 4Y7NH 1KC8C 3KOJA 1R4QB 1KLUD 1X55A 4IZ8A 1AZQA 2L12A 1QVCA 1XNRL 1GKHA 4N8X1 2M9VA 4PMWA 5E1FA 1HZAA 2PI2E 3G7LA 4IO9A 4JG2A 4S3SA 1S40A 3M7GA 5C0XI 5IT9E 1SYCA 2X69A 1TQOA 2MJ8A 1VQAA 2WACA 5LL6X 4JI4L 2K5HA 4KLKA 2BA1A 4DR3Q 3SHLA 5C44H 2B3GA 4O0AA 3C1EA 4DV0Q 4P2CB 2L11A 1C4QA 5CV9A 2R6GA 2Q2IA 3MHBA 3K5LA 4DR5Q 5HGTA 2MPMA 1Q12A 1EY8A 1F2ZA 3FVQA 1F77A 2JA5H 4ID6A 1N34Q 3ER0A 1SDFA 3T1YL 5IY0A 3K59A 1SYGA 5IGCA 4JI3L 4LFCL 3JAMc 2AWOA 1UEBA 1A3TA 3SXHA 1K8GA 2I46A 2RSNA 2L9HA 5H1SE 3GTMB 1AN8A 3AFPA 1AFPA 2N88A 1PXUA 1S3OA 3K5OA 1I94Q 4KHPL 4RAUC 1L0YB 1CKMA 3X3NA 1VF7A 4RG1A 4XIGS 4IOAA 1Y8NB 3VR4A 3QOJA 1SN8A 3RZOH 1TT2A 4JI2Q 4JK1C 1B53A 3NPPA 4LFAL 3FPPA 4KKUA 2YV5A 2ZXRA 4X65L 5EGTA 1TWGB 2Q2UA 4IFDJ 2K04A 1STEA 3FKIH 4CJ1B 2JA7H 2NN6G 2IX1A 2TSSA 1HQRD 1R4PB 2MGSA 1L1OC 1VMPA 2EXZA 2K05A 2VXWA 3GQBA 2I5HA 1N36L 3M4QA 2R92H 1ET6A 1ICFB 1EZ6A 3GTOH 2VNUD 3TZDA 3IL8A 1LTSD 1PTOF 2A6ED 2RHSB 1EOTA 5C0XG 1VQGA 3QJYA 3VYSA 1BCPC 1HNZQ 3HOUG 1C7YA 4U68A 3K7AB 1W2BA 4A3GG 1YNND 4IPHA 1JWUD 2C9OA 4YY3L 1GUSA 2F0DA 3I72A 2NVXB 2ES2A 5KEEA 2ATWA 2D9UA 3T16A 5CV5A 4LF6Q 5C3EG 3NELA 1ASYA 1PZID 5FO7B 4GNXC 5BN5A 3MC0B 4AYBE 2JEBI 1KAWA 3HOYG 2KVMA 3E0EA 1E2WA 5ELOA 2NVTB 1HRJA 3T1HL 4K6DA 2A74C 3TQYA 2A19A 2N55A 2I5MX 3JC66 1X54A 2K14A 4HSVA 4DK1A 2XSCA 4HIKA 1VQJA 2E2IB 1D7QA 4LF8Q 4HIOA 1A2UA 1O7YA 1M90C 3NXWA 2E74C 3CW2C 2BE5D 1H95A 2E5LL 1J9OA 1CZWA 3C2PA 4AQYL 1XXGA 2Y0SE
chains in the Genus database with same CATH topology
3DXJC 1S4ZA 3FKIB 3D3RA 4HEDA 1K83B 3W2DA 1EQVA 4O1NA 4FF3A 3L7ZC 1SYEA 4XDXA 4NP5A 1QCBD 5D3IB 4KY5A 5I6YA 4R9WA 1B50A 3WOFA 1RF2D 2OF1A 1YNJD 1IYUA 2NVYB 5E4WC 2WP8J 1RKNA 3K0YA 5IGGA 4CHTB 3T13A 3TP6A 4G7ZC 2K28A 2RDGA 1KLGD 2ZT9C 1II3A 1EY0A 3GP7A 3S1NB 3DWQA 3NBIA 1CQVA 3TMEA 1BQQT 4OIJA 2R93B 3EQLC 4OIKA 2WIIB 4IFDG 5J1ZA 1AEXA 1CA5A 1SNDA 2A69D 1BR9A 4BY1B 4TKOB 3PO3B 1BCPF 3VYTA 2J7ZA 2RSOA 5C4XB 1HA5A 1CFMA 4OGQC 3VR3A 4A3BB 3R8BA 1TS3A 3M85A 4IUVA 1PZJD 1RHPA 1D5MC 3L9AX 1PTOH 3D4DA 3EFXD 4QCLA 5FOBB 4RH6A 1STHA 1U4RA 3T4AC 5A2QL 1B1ZA 5I4DA 2F0JA 5JEAH 2A6EC 2A68C 4B9WA 5FO8B 2F1MA 3CU7A 3I70A 4X3TA 1EWCA 1T5XD 4RKLA 2HDMA 2E2HB 1RD9D 1O7ZA 1BCPB 1STBA 4C3JB 4C3HG 3UI2A 4A93B 5J39A 3Q24A 1QG7A 3VR5A 1K8MA 4KD3A 4FF4A 1DZ1A 1RODA 4KD4A 4QB4A 3PUWA 5JEAG 1HA6A 2RKSA 4ZYSA 2AQ3B 3QO2A 2JA7B 3KUPA 4C3IB 2K5DA 4HTHA 2EYOA 4EQOA 3PIP3 1I4HA 2B2UC 1H9MA 4BY7B 1LTID 1F9PA 5JAVA 3HS0C 3A7LA 3A8JE 1PFMA 4DAYA 4CJ0B 1U4MA 1EQTA 4OL7A 4HCEA 2L55A 4BA1I 3X3MA 1EYAA 1YNJC 5M3FB 1CI3M 5KYIA 3RLFA 2KUMA 3R2IA 2CQAA 1G2SA 2WKCA 1JORA 1EYDA 1PTOD 1PRTF 3P20A 3I4LA 4RHRA 1ZEQX 3P75A 1EY6A 2SDFA 2LFNA 4MIUA 3VYRA 1EU3A 1F9RA 3LX0A 4K2LA 3OIQA 4ME5A 4LJZC 1M4VA 3S17B 4A3FB 2RBMA 3A7AB 1HQMC 2JXMB 4G4KA 2ICEC 1TWHB 5C0XH 2L4NA 3BDCA 4KJNA 3HRZC 3OW7A 1FNVA 5NUCA 1PDQA 2F0WA 2NB0A 5EKLA 2K33A 3PUVA 3C46A 4A3KB 4O42A 1CT1D 3JAML 3OWEB 4G7OC 2K5WA 3GTOB 2IX0A 5M3MB 2KECA 1PRTC 3LWUA 4M1UB 1Z47A 1TS5A 1Y1VB 1Q90A 4DFAA 1ZKOA 3NP8A 1D1IA 3PV0A 1ESRA 1EYCA 2NN6H 2R3ZA 5HURA 1H9RA 1X3PA 2OXPA 1E0BA 2SNMA 4HR7B 3S2DB 1LTGD 1NR4A 3NWTA 4XYQA 1Q3LA 1B2TA 2F0HA 2NZ1D 5FLXL 2BDOA 5ELBA 1A15A 2IT1A 3A56A 4A3IB 2PYKA 2F03A 3NHHA 1V8QA 3MVVA 5C6AA 4X3SA 1FD7D 1FYCA 3Q0AA 5IOCA 5C4HA 1OO9B 4C56C 2D5DA 2Z1CA 3HZXA 4DF7A 2Q8TA 3BG3A 2XVSA 2JA8B 1IW7C 2DNEA 1Y8OB 1LABA 3NTHA 3D6WA 1JOKA 1PFNA 1SJED 4CJ2C 4LMQD 1U4PA 2PNRC 4FYDA 1I6VC 1BF4A 1I6HB 1ONLA 4OO1I 1X32A 5ELEA 3OIPA 4HN7A 5CV8A 3C3LA 1SAPA 2Y0SB 2KOLA 1F9QA 1ICWA 3SDZA 4CKBA 2NUCA 5G3LD 4YIJA 4J1MA 3DWAA 1CTMA 2FFKB 5BN3A 3OWFA 3ZYYX 4OO1H 3BDOA 4FF2A 1PLFA 4EGVA 2DY8A 2RDHA 1SMYC 1SNMA 2OEOA 4QIWB 3SK8A 3KBGA 4LAAA 4A3DB 1HTPA 1TS4A 1MI2A 1LTAD 3J81L 2QDBA 4B08A 5DNFA 1D5ZC 5EKKA 1PFBA 2QCPX 3Q6SA 4N9PA 4DU9A 2QEJC 1SNCA 3V96A 5EJWA 2K32A 5E4XA 5I9PA 2F0NA 5JPNC 4IUQA 5G3LF 5K36G 1FGBD 2NWGA 1HPCA 3E5SA 4N9TA 1JE4A 5CBEE 5JVG3 2M00A 1IKLA 2PW7A 5CV4A 2YU9B 1JR0D 4XQQA 4KHZA 1BO0A 3G6JB 2FHTA 1KNAA 1HUNA 3O13A 3NK9A 5JJZA 1ILQA 4ZUJA 1WD1A 1BCPD 4KN7C 1A3UA 1DCZA 2QKIC 1SFOB 1JC7A 3GTLB 3CQZB 3M4YA 3GTGB 4L8JA 3EROA 1IL8A 2NN6I 5K36H 1B3AA 3SVMA 2H1EA 2WAQB 1EY7A 1I4XA 2BDNA 2MHVA 1Y69U 4V0BA 2F0QA 2ZXPA 1GUGA 3D4RA 1S5CD 2WINB 2JYOA 2BE5C 4BWGB 1JB3A 2IL8A 1IYVA 4PMCA 3IKJA 5KRUA 1Q8IA 2NVQB 4G7HC 1G2TA 3ND9A 4C3JG 3DEOA 2EJFC 3FEWX 4BA2I 2EJGC 1EZ8A 1Y1WB 5JVH3 3OMGA 5IODA 3SK6A 2F0EA 4ZAIA 3CRLC 3WDNA 1QB5D 4ZQ3A 1TIID 2VB3X 5ELCA 1LT3D 3QG1A 4KMUC 2PPBC 2G9DA 1BNZA 4DA2A 4HAEA 2VB2X 1WTXA 4KKSA 4NMZA 5EQ0A 2RQXA 1SMYD 4RCOA 1F2MA 5DEHA 2EPBA 4K8JA 2JA6B 4ZKCB 5KNDA 2A68D 1X3QA 3GTKB 2A69C 1O78A 1LT4D 1GHJA 2A73B 1EY9A 5CV6A 1KDCA 4PNYA 3OMCA 5D14A 3ITPA 4L63B 1MD2D 1QNKA 4F88A 2NTTA 1EY4A 1JOOA 1I4RA 2Z4IA 3LNNA 1B9MA 3RD4A 3S2HB 1JWMD 5KYLA 2EYFA 1C48A 1DM0B 3D8GA 1O7LA 2FINB 5D65A 5EPKA 2BOSA 2ENBA 2F0MA 5IT9L 3GD7A 1D5XC 3D4WA 1GUNA 2F0VA 1ET9A 5C0XJ 1EEFD 2EY2A 1IKMA 2E2DC 4BBSB 1XWEA 2L0CA 4KHVA 2EYLA 3PIO3 2AQ2B 3MFGA 3Q22A 3NQTA 5EKIA 3S15B 3H6MA 2WKDA 2B2TA 4CGYB 1KNEA 4IALA 3SEBA 2XRQD 2EYPA 1TY2A 1STGA 4NDXA 3GO5A 2B63B 1V1OA 5KIXA 4H13C 1CK1A 1I3QB 1EIHA 1ENAA 4FXGC 1K8OA 5DM63 2LKVA 3OHXC 1KAAA 4A3JB 3H09A 1U9RA 2XWBB 3RZDB 2SEBD 1TWCB 1L0XB 2ICIA 5I6WA 3I91A 3CKIB 5C5LA 1G91A 3IFTA 4Q0FA 2R92B 4I7ZC 2KEEA 2DNCA 1UEAB 1I4PA 3PUYA 2BA0A 2OT2A 3H91A 1I4QA 2QILA 3KK7A 2A6HC 3T51B 1HCZA 1SYBA 2PCFB 3RZOB 4RFBA 2B8FA 2O4XA 1CA6A 1DONA 5C3EB 3KLRA 4WJWA 3FRPB 4F8MA 1AW7A 1GOZA 5M5XB 3HOUB 4K14A 1RJTA 3VR2A 3MWYW 3F2UA 1R9TB 2H4OA 1A2TA 2JEAI 4FP5D 2PMZB 1H9KA 3QIAA 3NUCA 5KNCA 4A3MB 4UAIA 1WTVA 3PO2B 2EYMA 2Q8IB 3VA7A 3H94A 3PUZA 2EVBA 4DXGA 1V1PB 2A6HD 1UAPA 1QILA 3PMFA 1DXMA 1Q1EA 5EBDA 2K6AA 3EA6A 3VA5A 1LO5D 2HQEA 5IGDA 4FVMA 2E2JB 1B44D 1D1KA 1RTNA 2EJMA 1CHPD 4EQPA 3QOLA 3BYYB 2G9HD 2M2LA 2Q8RE 2D2CC 2SOBA 1GHKA 1F2LA 5CMDA 3J7AV 4RGMA 3MXNA 1VDZA 3N6RA 2B2YC 3KLSA 3FDTA 1ZYRD 1S5BD 1OXSC 3JAME 3GV6A 1EEID 2B2VC 5JPMC 3TP5A 2HDLA 3PUXA 3TN2A 3J7YW 1DOLA 5T1IA 3MFYA 5FLXE 1CZGA 2A5HA 3SE0A 3U9OA 5C3XA 3BS1A 4FO2A 3I8ZA 1ESFA 3H0GB 3R3OA 4NKLA 3CRKC 3S9WA 5E3FA 5EPJA 4F87A 2E75C 1OXXK 3WOEA 4K5VA 3NSWA 3J80E 3T56B 4TRDA 1WTPA 4QMGA 2JE6I 3VYUA 4J8QA 1PRTB 2WB1B 3W3AA 1WCMB 3NTKA 4RKBA 3M4OB 5C4JB 4H44C 4I65A 2D62A 4C2MB 1NR2A 1D2BA 1A3VA 1BXTA 3P1HA 3HKZB 2O2LD 1JICA 5ELDA 1VF5C 3K5NA 2FMCA 4ZLTF 1S5ED 5IGFA 2CW0D 2WV6D 1STYA 1SXTA 2K7VA 4Q5VA 3TP8A 2MP1A 2I07B 4LK1C 2QF7A 3IAYA 1GUOA 1RDPD 1SNOA 4BBRB 1KDBA 3S1MB 2PZTA 4RA8A 3ONAB 5FKAC 2EZVA 4C3IG 3BVGA 2HCIA 4KV6A 5C3WA 1JCKB 3RUZA 5F2DA 2EOTA 2LMCB 3HOXB 5CGKA 4KK7A 2HUGA 3I3CA 1A6XA 4UDUC 4M8AA 2LS01 4XYOA 5CORA 4U673 4C3HB 2JSOA 1STNA 3HOVB 1H9SB 5A35A 1AP0A 1STAA 3R2TA 2B2VA 2F0UA 5EPLA 2J4XA 2ZXOA 3K57A 1WTQA 1IW7D 4G57A 1HXYD 4ULLA 4CKCA 1CM9A 2F0SA 2EYHA 3Q23A 3OSOA 3SK4A 4WORA 2AQ1B 2IJ0A 1MBYA 5M9OA 2F3VA 2XRSD 1DJRD 3M7NA 3DHQA 1EFID 1QWYA 5JOBA 4KY7A 3OPOA 4BS9A 4DAPA 2F0FA 3HP3A 3K58A 1KTKA 4MN3A 1LTBD 1YNNC 2K1BA 2KCNA 1QNUA 3ERQA 4NW2A 3M3YB 1RCVD 1V1PA 1E2VA 3RMHA 2F0IA 3TSSA 1EU4A 1SE3A 3T53B 3A8KE 1BBXC 2BCOA 4DNRB 4IFDH 1T5EA 2L1BA 3MZ5A 1LT6D 1VMCA 3GTJB 1I50B 1TVXA 1DD2A 4X3UA 3KF8A 3SR1A 1D6EC 1SE4A 4EVOA 1WTOA 4OO1G 4TQUS 2PW5A 4FNFA 5DAUA 2PZWA 3KLSX 2MUYA 2XNAC 1SJHD 4XTCS 4EQNA 2NBFA 2R61A 4IUUA 2CW0C 5JEAJ 1BOSA 1SYDA 1LACA 1W6KA 2DY7A 4Y7NB 1QJOA 3S14B 3LWEA 1E2ZA 3V05A 4PQXA 2F0OA 2F0TA 2IWHA 3GV3A 2IPKD 3NE5B 2F0GA 4AYBB 1WD0A 4ZK9B 3HGBA 1MSGA 1ML0D 1IHZA 3J81E 2K5QA 1EWHA 3MAQA 2B2TC 2AWNA 4QUCA 4PV1C 1NUCA 4H7BA 4ZUIA 4K8IA 5DM73 3S1RB 2KCCA 2PQEA 3ND8A 2AUKA 4IURA 2ID0A 1SE2A 4H0LC 1SEBD 1PMRA 5I9OA 4IFDI 3C1FA 4IN3A 3K5MA 1ZYRC 1S5FD 4X3KA 1NSNS 4KI0A 3DEPA 3VR6A 2RDFA 4K5XA 1EL0A 3J7AF 1UUPA 5D3DA 2B2UA 5CV7A 4ILWA 3IFDA 1B9NA 4IQZA 3DWPA 2B2WC 1RTOA 3E6ZX 3SK5A 1BDOA 3AMUA 1NCVA 4IUTA 4A3GB 4C1NK 2PZUA 5K5PA 3DMUA 1TU2B 1H9JA 4V190 1G6ZA 4XQNA 3R93A 3NQIA 1Z7TA 3EVQA 1C8CA 4XXEA 2X6GA 5KGUA 2F0LA 4R8NA 2C5CA 1PYWD 2NYZD 5FK9C 3HOYB 4B9XA 1SNPA 1LTTD 2FMMA 3L3OC 4DGZA 5FO9B 2J0TD 1NAPA 1HFGA 1F9SA 3DUZA 3K6OA 1EIGA 4E6IA 2F3WA 1V43A 2HCCA 5CYUA 2KJXA 4JBWA 5CC4A 1VCIA 4MHEA 4K2KA 2L5TA 4RWSC 1DOMA 4IUNA 4KY6A 1KABA 1M8AA 5C44B 4RGNA 5AFWA 1I4GA 4ODGA 2IX3A 5C5MA 4K5WA 3HG9A 2LY7A 2PO4A 4DNTB 4Z9CB 4RHSA 1B4OA 1QE6A 4PMBA 2EY1A 4DAVA 1UNSA 4TSSA 4KTAA 4XQJA 1PZKD 3EJIA 5J22A 3NTIA 1TR5A 4GZYC 4KN4C 2JP1A 4FF1A 5A2QE 3S1QB 3KBXA 1MSHA 2F0KA 4XT1B 1SYFA 4OHJA 2NTSA 2EYJA 5I2YA 2F0PA 2EDGA 4WFN3 3URYA 1PTOB 1FNWA 2KHSA 5M5WB 2EY5A 4L6TB 2CHBD 3D6CA 5C4ZA 1CHQD 4A3EB 3I4NB 1S5DD 2IW3A 5IGEA 2GA4B 2DN8A 3TBIB 4HSPA 1JQYD 3P7JA 2FJ2A 3MA2B 1TWFB 4CBVA 2TMPA 4RGOS 4ZRZA 3TZUA 1CQFA 1LLRD 3BDLA 3MEHA 1W6JA 1HHVA 1U4LA 4DXFA 5IIFA 2K03A 1O80A 3BVZA 1HUMA 4WRDA 2AUJD 1MGSA 3HEJA 3GTQB 3H3VC 1Z6HA 2KA7A 2B39A 1LTRD 1ILPA 5T1GA 5I2XA 1LT5D 2XIWA 3TDQA 1WVLA 4IUPA 4FXDA 3AB9A 2K01A 1WTRA 3MXUA 1TKWB 3FMCA 2O5JC 1ENCA 3I4MB 5LL6S 3MTSA 3E0JA 1JOQA 1GJXA 3BZDB 3V2TA 2V4DA 1QOHA 5ELFA 1Y8PB 4FXKC 1GXDC 1XYIA 3CHBD 3DM1A 1JWSD 3BVMA 4XT3B 3BYTB 5EBCA 1DOKA 5CBAE 4HMJA 5KNBA 1ZXTA 1AZPA 3HOZB 5LHY1 1BUVT 1HTLD 2JA5B 1WTWA 2YYZA 1SBBB 1J8IA 3D31A 4HCSA 2B2YA 1PRTD 3NWSA 5COYA 4KKTA 1F2YA 1GUWA 3TP7A 2Z8LA 1TS2A 1KDAA 3FPUB 5BN4A 1H9SA 2B2WA 1FR3A 2XN9C 4C1NI 2O5IC 4ZKBB 2KQ3A 3I73A 4CKEA 4KJOA 1FNUA 3A54A 3NBHA 5CR3A 3N52A 1G291 2B8GA 5ISRA 3U9SA 1DYQA 3GTPB 4DN4M 2CVRA 1XTCD 2EE1A 1SNQA 3MXGA 3QB3A 5M5YB 4QF4A 1LV9A 4RCNA 1OXUA 3A55A 4ABNA 5IGBA 1HFNA 2F4IA 3HOWB 2XWJB 1TWAB 3J80L 3AU7A 2VUMB 4R8IA 1EY5A 4QUFA 3MXPA 1Q1BA 1TY0A 4DK0A 2KEDA 2Z4HA 2X6LA 2R7ZB 3A8IE 1PTOC 3I90A 2RVLA 1SSOA 4HMIA 2SNSA 4F7XA 4K6LA 1G8ZD 2RA4A 3QWNA 2EY6A 5TSSA 1OXVA 1OXTA 2E76C 1XX8A 1GUTA 4RGTA 1ENFA 4J6HA 3OOCA 3S16B 1R4QB 1KLUD 4IZ8A 1AZQA 2L12A 2M9VA 4PMWA 5E1FA 3G7LA 4S3SA 3M7GA 5C0XI 5IT9E 1SYCA 2X69A 1TQOA 2MJ8A 2WACA 5LL6X 2BA1A 3SHLA 3C1EA 4P2CB 2L11A 1C4QA 5CV9A 2R6GA 3MHBA 3K5LA 5HGTA 2MPMA 1Q12A 1EY8A 1F2ZA 3FVQA 1F77A 4ID6A 1SDFA 3K59A 1SYGA 5IGCA 2AWOA 1A3TA 3SXHA 2I46A 2RSNA 2L9HA 3GTMB 1AN8A 1AFPA 2N88A 1PXUA 3K5OA 4RAUC 1L0YB 3X3NA 1VF7A 4XIGS 1Y8NB 3VR4A 3QOJA 1TT2A 4JK1C 1B53A 3NPPA 3FPPA 4KKUA 2ZXRA 5EGTA 1TWGB 4IFDJ 2K04A 1STEA 4CJ1B 2NN6G 2IX1A 2TSSA 1HQRD 1R4PB 2MGSA 1VMPA 2EXZA 2K05A 2VXWA 3GQBA 1ET6A 1EZ6A 2VNUD 3TZDA 3IL8A 1LTSD 1PTOF 2A6ED 1EOTA 5C0XG 3QJYA 3VYSA 1BCPC 4U68A 3K7AB 1YNND 1JWUD 2C9OA 1GUSA 2F0DA 3I72A 2NVXB 5KEEA 2D9UA 3T16A 5CV5A 1PZID 5FO7B 5BN5A 3MC0B 2JEBI 2KVMA 1E2WA 2NVTB 1HRJA 4K6DA 2A74C 2N55A 4HSVA 4DK1A 2XSCA 2E2IB 1A2UA 1O7YA 3NXWA 2E74C 2BE5D 1J9OA 1CZWA 3C2PA 1XXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQA A;  2C9O A; 
#chains in the Genus database with same CATH topology
 3DXJ C;  1HNX L;  1S4Z A;  3FKI B;  3D3R A;  3L2P A;  1SR3 A;  3CXC A;  4HJA A;  4HED A;  2NZO A;  1K83 B;  2XGT A;  3NEM A;  3W2D A;  1EQV A;  2AMC B;  3PIP A;  4O1N A;  4FF3 A;  3L7Z C;  1SYE A;  4XDX A;  4NP5 A;  1N33 Q;  1QCB D;  5D3I B;  4IJL A;  4KY5 A;  5I6Y A;  4R9W A;  1B50 A;  3WOF A;  1X65 A;  1RF2 D;  1CSP A;  2OF1 A;  3DLL A;  1YNJ D;  1IYU A;  2NVY B;  2BH8 A;  5J3B A;  4QJF A;  5E4W C;  2WP8 J;  1D8L A;  1I5F A;  1RKN A;  3K0Y A;  3TS2 A;  1NBW A;  2KCM A;  5IGG A;  4CHT B;  4MNO A;  2ZJP A;  3T13 A;  2G5D A;  3TP6 A;  4G7Z C;  1AE3 A;  2K28 A;  2RDG A;  1KLG D;  2ZT9 C;  5E7N A;  1II3 A;  1EY0 A;  3KF6 A;  3GP7 A;  3WWV A;  2UUA Q;  1IL2 A;  3DWQ A;  3S1N B;  3NBI A;  3U58 A;  1CQV A;  3TME A;  4HJ5 A;  1BQQ T;  2VS1 A;  3S2H H;  3HOZ H;  2IHF A;  4C3I H;  4OIJ A;  3KFU A;  2R93 B;  3EQL C;  4OIK A;  2WII B;  4IFD G;  2ASB A;  5J1Z A;  1AEX A;  1CA5 A;  1SND A;  2A69 D;  1BR9 A;  1W3S A;  3PF4 A;  1Q81 C;  4BY1 B;  4TKO B;  3L0O A;  4LFB L;  2VUM G;  3PO3 B;  1BCP F;  3VYT A;  2J7Z A;  1E1T A;  4GLV B;  2RSO A;  2QEX A;  5C4X B;  5M3F H;  3FHW A;  1HA5 A;  1CFM A;  4MTK A;  4OGQ C;  3VR3 A;  4A3B B;  3R8B A;  4ALP A;  1TS3 A;  3M85 A;  4IUV A;  1TWA H;  1PZJ D;  4LF4 Q;  1RHP A;  3GTJ H;  1KIX A;  4OEM B;  1EUJ A;  5IYD G;  1FL0 A;  1D5M C;  3L9A X;  1Q7Y C;  1EFW A;  1PTO H;  1HJP A;  3D4D A;  4EQ5 A;  2PMZ E;  4A3D H;  1E3P A;  3EFX D;  4QCL A;  2UXD Q;  5FOB B;  5LMN L;  4RH6 A;  1STH A;  1YJN A;  1U4R A;  3T4A C;  2VQF L;  1IBM L;  1B1Z A;  5I4D A;  2F0J A;  5JEA H;  5A2Q L;  2A6E C;  1G6P A;  2A68 C;  1K0R A;  4B9W A;  5FO8 B;  2F1M A;  3CU7 A;  3I70 A;  4X3T A;  1EWC A;  3RN2 A;  1T5X D;  4JI5 Q;  4RKL A;  2HDM A;  2E2H B;  1RD9 D;  5JJK A;  4DV6 Q;  1VQL A;  5HGQ A;  1O7Z A;  4ME3 A;  1BCP B;  1STB A;  4C3J B;  4C3H G;  3UI2 A;  4A93 B;  1VQ4 A;  5J39 A;  3Q24 A;  1QG7 A;  3AFQ A;  4GS3 A;  5IP7 G;  3VR5 A;  1K8M A;  1QZH A;  3F8T A;  3CCQ A;  2F4V Q;  4KD3 A;  1E1O A;  4FF4 A;  1DZ1 A;  1ROD A;  2WFW A;  4KD4 A;  4DR4 L;  1VQH A;  3B6Y A;  1QVG A;  5GAH C;  2WAQ E;  3H3V H;  4QB4 A;  3PUW A;  5JEA G;  1HA6 A;  2RKS A;  1N34 L;  4ZYS A;  2AQ3 B;  3QO2 A;  2JA7 B;  3KUP A;  4IJH A;  1O7I A;  2K5D A;  4HTH A;  4C3I B;  2EYO A;  4EQO A;  3PIP 3;  1I4H A;  2B2U C;  1H9M A;  5IYB H;  1IBK Q;  4BY7 B;  1LTI D;  1F9P A;  3NBH B;  5JAV A;  3HS0 C;  3A7L A;  3A8J E;  4X64 Q;  1PFM A;  4DAY A;  4CJ0 B;  1U4M A;  1EQT A;  3RZD H;  4GKK L;  4OL7 A;  5JJL A;  4MZ9 A;  4HCE A;  2L55 A;  4BA1 I;  3X3M A;  1EYA A;  1YNJ C;  5M3F B;  1CI3 M;  5KYI A;  3PIO A;  1A62 A;  3RLF A;  2KUM A;  3R2I A;  2CQA A;  1G2S A;  2E8G A;  2WKC A;  1JOR A;  1EYD A;  1PTO D;  1PH2 A;  1PRT F;  3P20 A;  2A8V A;  4R4I A;  3I4L A;  4RHR A;  1ZEQ X;  4O2D A;  3P75 A;  1EY6 A;  2SDF A;  3K81 C;  2LFN A;  2UXC L;  4MIU A;  3VYR A;  1EU3 A;  1PH9 A;  2F4V L;  1N32 Q;  1F9R A;  1GM5 A;  1WFQ A;  3LX0 A;  4K2L A;  4JI7 Q;  3OIQ A;  4ME5 A;  4LJZ C;  1M4V A;  3HOX G;  3S17 B;  4NPS A;  4A3F B;  2RBM A;  3W1G A;  1ASZ A;  1SMX A;  1VQM A;  3A7A B;  1HQM C;  2JXM B;  4G4K A;  2ICE C;  3S15 H;  1TWH B;  2CFM A;  3HOU H;  1YEZ A;  4LUZ A;  2VQE Q;  5C0X H;  2L4N A;  3BDC A;  1YBY A;  4KJN A;  3HRZ C;  3OW7 A;  2I0Q A;  2C35 B;  1FNV A;  5NUC A;  1PDQ A;  2F0W A;  2LXJ A;  4PG3 A;  3HOV H;  2NB0 A;  5EKL A;  2K33 A;  1AE2 A;  3PUV A;  3C46 A;  3I4O A;  4A3K B;  3HKS A;  4JI4 Q;  4O42 A;  1CT1 D;  3JAM L;  3OWE B;  4G7O C;  2K5W A;  3GTO B;  2IX0 A;  2EXD A;  5M3M B;  2KEC A;  3CCM A;  1XNQ L;  3RN5 A;  3VDY A;  4MTN A;  1PRT C;  3LWU A;  1G51 A;  2P5Z X;  2JA6 H;  1YHQ A;  4M1U B;  1Z47 A;  1TS5 A;  1Y1V B;  1Q90 A;  4DFA A;  3CF5 A;  1ZKO A;  3NP8 A;  1D1I A;  3PV0 A;  5AJ3 Q;  4HJ9 A;  4LFC Q;  1JE5 A;  1ESR A;  1EYC A;  1EWI A;  2NN6 H;  2R3Z A;  4DV5 L;  5HUR A;  5BR8 L;  1H9R A;  1X3P A;  4JW0 A;  2OXP A;  1E0B A;  2SNM A;  4HR7 B;  3W5O A;  2WB1 G;  2BH2 A;  2HHH Q;  3J7Z C;  3S2D B;  1LTG D;  4PZ8 A;  5GRO A;  2CCZ A;  2NVQ H;  1NR4 A;  3BZK A;  2E2I H;  4DR2 L;  3NWT A;  1IBL Q;  1RIP A;  4XYQ A;  3BZC A;  1Q3L A;  2CH4 W;  3HKZ E;  1PH1 A;  1B2T A;  2F0H A;  2NZ1 D;  2KCT A;  5FLX L;  4GOP B;  4WJ4 A;  1SRU A;  2BDO A;  2PQA B;  5ELB A;  4GNX B;  1A15 A;  2IT1 A;  3IRB A;  1FVI A;  3A56 A;  4A3C G;  4A3I B;  4JV5 L;  1J6Q A;  2PYK A;  3KLW A;  2F03 A;  1UE5 A;  3NHH A;  1V8Q A;  3G71 A;  1XPO A;  3MVV A;  5C6A A;  3HOY H;  1E7Z A;  3D0F A;  4X3S A;  4K0K Q;  3H0G G;  1FD7 D;  4OEL B;  2Q2H A;  1FYC A;  4B3T Q;  2ZTC A;  3Q0A A;  3ERS X;  5IOC A;  2UUC Q;  4CDC C;  4LF4 L;  1EQR A;  5C4H A;  1OO9 B;  4C56 C;  2D5D A;  5C44 G;  1SRO A;  1HNZ L;  2Z1C A;  3HZX A;  4A3F H;  4DF7 A;  2Q8T A;  3BG3 A;  3S1Q H;  2XVS A;  1L2F A;  1Q46 A;  2JA8 B;  1VQ5 A;  1IW7 C;  1QZG A;  2DNE A;  1Y8O B;  1LAB A;  4LW1 A;  3NTH A;  1B3Q A;  3D6W A;  4B3S L;  1IBM Q;  1WTH A;  4JI0 Q;  1EIY B;  2YTY A;  1JOK A;  1PFN A;  1SJE D;  4CJ2 C;  4DV4 L;  4A3I G;  4LMQ D;  1U4P A;  2IHE A;  1TWC H;  4DPG A;  3UE0 A;  2PNR C;  1XMO L;  1U0L A;  4DKA C;  1I6V C;  4FYD A;  1BF4 A;  1I6H B;  1ONL A;  4OO1 I;  4UPA A;  1X32 A;  5ELE A;  3OIP A;  4HN7 A;  5CV8 A;  3C3L A;  1SAP A;  2Y0S B;  2KOL A;  1F9Q A;  1ICW A;  1CSQ A;  1GO3 E;  2JN4 A;  3SDZ A;  4CKB A;  2NUC A;  5G3L D;  4YIJ A;  4L5T A;  4J1M A;  1PFS A;  3DWA A;  1CTM A;  2FFK B;  1CKN A;  5BN3 A;  3OWF A;  2CWP A;  1DGS A;  3ZYY X;  4OO1 H;  3BDO A;  4FF2 A;  1VQ9 A;  1K0S A;  2GVB A;  4DR1 Q;  4A3G H;  1PLF A;  4EGV A;  1J5E L;  2DY8 A;  2RDH A;  1SMY C;  1SNM A;  2OEO A;  5M3M G;  4QIW B;  4C3J H;  3SK8 A;  2R92 G;  4NXN Q;  3KBG A;  4LAA A;  3PO2 G;  4A3D B;  1HTP A;  1TS4 A;  4A3M G;  2K50 A;  1MI2 A;  3F1Z A;  1LTA D;  4JC0 A;  4FDB A;  3J81 L;  2QDB A;  2HIV A;  2VY3 A;  3KJP A;  4B08 A;  2RHQ B;  1D5Z C;  5DNF A;  3U50 C;  4B3R L;  2JK8 A;  5EKK A;  1PFB A;  2QCP X;  3Q6S A;  4N9P A;  4DU9 A;  2QEJ C;  1SNC A;  1EOV A;  3V96 A;  1K9M C;  3TS0 A;  5EJW A;  4JVZ A;  2K32 A;  5E4X A;  5I9P A;  2F0N A;  2Z9H A;  3RLN A;  2GN5 A;  5JPN C;  4IUQ A;  1YHB A;  5G3L F;  1WOC A;  4A3J H;  5K36 G;  1FGB D;  2NWG A;  5LMU L;  4QY7 A;  4A3F G;  1HPC A;  3E5S A;  4DUZ Q;  4N9T A;  2MO0 A;  3CCE A;  1JE4 A;  5CBE E;  5JVG 3;  4NXM Q;  5IP7 H;  2M00 A;  1IKL A;  3J80 i;  2PW7 A;  5CV4 A;  2YU9 B;  1JR0 D;  4XQQ A;  4BBS G;  4KHZ A;  1BO0 A;  3G6J B;  2FHT A;  5GAD C;  2UXC Q;  1KNA A;  1NMF A;  1HUN A;  1GD7 A;  3O13 A;  3NK9 A;  3M9B A;  1ILQ A;  5JJZ A;  4DUY Q;  4GLX A;  4JI7 L;  4ZUJ A;  2NVT H;  1WD1 A;  1BCP D;  4KN7 C;  1A3U A;  1DCZ A;  2K5V A;  2QKI C;  1SFO B;  1JC7 A;  1JMC A;  4LF7 Q;  1M1K C;  2ZJQ A;  1PH4 A;  3GTL B;  1WJJ A;  3CQZ B;  3M4Y A;  1MHW C;  3GTG B;  4L8J A;  1YI2 A;  3ERO A;  1IL8 A;  2NN6 I;  4A3J G;  4A3K H;  5K36 H;  1B3A A;  3SVM A;  4IPD A;  2H1E A;  4X6A H;  2WAQ B;  2UXD L;  4ZCK A;  1EY7 A;  1I4X A;  2BDN A;  4AYB G;  3JAM i;  4BY7 G;  2B63 G;  1QUQ A;  2MHV A;  1Y69 U;  5HY6 A;  4V0B A;  4JI2 L;  2F0Q A;  2ZXP A;  1GUG A;  1QUQ B;  3D4R A;  2JA7 G;  1S5C D;  2WIN B;  3CD6 A;  2JYO A;  2BE5 C;  2CQO A;  4DK3 C;  1YVC A;  4Y52 H;  4BWG B;  4CDE C;  2PI2 A;  1JB3 A;  2IL8 A;  1IYV A;  4PMC A;  4OWW B;  3IKJ A;  5KRU A;  3FP9 A;  1Q8I A;  1JJ2 A;  2NVQ B;  3AEV A;  2CH4 A;  2MQH A;  4G7H C;  1G2T A;  2YTV A;  3ND9 A;  3J81 j;  4C3J G;  3DEO A;  1SE8 A;  2EJF C;  3FEW X;  1VQP A;  2EJG C;  4BA2 I;  3I56 A;  2D0O A;  3ULL A;  1EZ8 A;  2MNA A;  1JJC B;  1RL2 A;  1Y1W B;  5JVH 3;  1C9O A;  3OMG A;  5IOD A;  3SK6 A;  2F0E A;  4ZAI A;  4DAM A;  4GNX A;  3CRL C;  1HH2 P;  3WDN A;  1QB5 D;  4L5S A;  4ZQ3 A;  1TII D;  2VB3 X;  3CP0 A;  3RNU A;  1N9W A;  5ELC A;  1PHJ A;  1LT3 D;  3QG1 A;  4KMU C;  4DV3 Q;  2PPB C;  3CCJ A;  2G9D A;  1BNZ A;  4DA2 A;  4HAE A;  2VB2 X;  1WTX A;  4KKS A;  4NMZ A;  5EQ0 A;  3KF6 B;  2RQX A;  3CPF A;  4HJ8 A;  2HHH L;  4EX5 A;  1SMY D;  4YCV A;  2K52 A;  2Z0S A;  4YHH L;  2JJQ A;  2ZM6 L;  1VQ6 A;  4RCO A;  3CCU A;  3MXN B;  1F2M A;  5DEH A;  2EPB A;  4YWL A;  4K8J A;  4DV0 L;  4A3I H;  2JA6 B;  4DR6 L;  4ZKC B;  5KND A;  2A68 D;  1X3Q A;  3GTK B;  4DR5 L;  2A69 C;  1O78 A;  4JOI C;  1LT4 D;  1NJI C;  1GHJ A;  2A73 B;  4JI1 L;  1EY9 A;  5CV6 A;  2OQ0 A;  1KDC A;  1HNW Q;  4PNY A;  3OMC A;  5D14 A;  3ITP A;  4L63 B;  4GN5 A;  2LSS A;  3PO3 G;  1MD2 D;  1QNK A;  4F88 A;  2WAQ G;  4JI0 L;  2NTT A;  1EY4 A;  1JOO A;  1I4R A;  2L15 A;  2Z4I A;  3H3V I;  3LNN A;  1K73 C;  1B9M A;  3RD4 A;  4KHP Q;  3S2H B;  1JWM D;  3A0J A;  3F2D A;  3S1M H;  5KYL A;  2EYF A;  1C48 A;  1DM0 B;  3D8G A;  1O7L A;  2FIN B;  5D65 A;  5EPK A;  3S1R H;  2BOS A;  1Y1W G;  2ENB A;  2F0M A;  2HT1 A;  5IT9 L;  3GD7 A;  1D5X C;  3D4W A;  1GUN A;  2F0V A;  4A3C H;  1ET9 A;  1A8V A;  5C0X J;  1EEF D;  3CQZ H;  2EY2 A;  1NY4 A;  1IKM A;  2E2D C;  4BBS B;  2N78 A;  1YZ6 A;  1XWE A;  2L0C A;  2QDL A;  4KHV A;  3G6E A;  2EYL A;  1FJG Q;  1IBK L;  3PIO 3;  2AQ2 B;  3MFG A;  1Q8K A;  3Q22 A;  3NQT A;  5EKI A;  3S15 B;  3H6M A;  4X64 L;  2WKD A;  2B2T A;  4CGY B;  5M5X H;  1KNE A;  4IAL A;  2N8N A;  3SEB A;  2XRQ D;  2EYP A;  1TY2 A;  1STG A;  4NDX A;  3GO5 A;  2B63 B;  1V1O A;  5KIX A;  4H13 C;  1CK1 A;  1I3Q B;  1EIH A;  1UE1 A;  1ENA A;  4FXG C;  1K8O A;  5DM6 3;  4POG A;  2LKV A;  4JBM A;  4LF5 Q;  3OHX C;  2DGY A;  1KAA A;  3E9I A;  4A3J B;  3H09 A;  1U9R A;  1L1O A;  2XWB B;  3RZD B;  3T1Y Q;  4RMF A;  2SEB D;  1TWC B;  2NVY H;  1Y1V H;  2UXB Q;  1L0X B;  2ICI A;  1JB7 A;  5I6W A;  2Q2T A;  3I4M H;  3I91 A;  3CKI B;  5C5L A;  1G91 A;  3IFT A;  4Q0F A;  2R92 B;  4DK6 C;  4I7Z C;  5LMU Q;  2KEE A;  2DNC A;  1UEA B;  1I4P A;  4JI8 Q;  3PUY A;  2BA0 A;  2OT2 A;  1Y1W H;  3H91 A;  3GTP H;  1I4Q A;  3RR5 A;  2QIL A;  3KK7 A;  3PGZ A;  2A6H C;  3T51 B;  1HCZ A;  4A93 H;  3HKZ G;  1SYB A;  2PCF B;  1LM0 A;  3RZO B;  1VQC A;  4RFB A;  2B8F A;  2O4X A;  1CA6 A;  1DON A;  5C3E B;  3K8A A;  1K83 H;  3KLR A;  4WJW A;  1VQI A;  3FRP B;  1WCM G;  4F8M A;  4GLA C;  2Y0S G;  4DV7 Q;  3E3X A;  2UUC L;  1AW7 A;  1GOZ A;  3K0X A;  5M5X B;  3HOU B;  4K14 A;  1RJT A;  4LF7 L;  1N36 Q;  2JQO A;  2UUB Q;  1HZ9 A;  3VR2 A;  3MWY W;  3F2U A;  1PVO A;  1R9T B;  5GAE C;  2H4O A;  1A2T A;  2JEA I;  4FP5 D;  2PMZ B;  1H9K A;  3K7A H;  1IYJ B;  3QIA A;  3NUC A;  5KNC A;  4A3M B;  4UAI A;  1YIT A;  2NVX H;  1WTV A;  2RF4 A;  3PO2 B;  2EYM A;  2Q8I B;  5M5Y H;  3VA7 A;  3GTG H;  2RCF A;  1KRT A;  3H94 A;  3PUZ A;  2EVB A;  4DXG A;  1XMQ L;  2AHO B;  1V1P B;  2A6H D;  1UAP A;  2Z6B A;  1QIL A;  5C4J H;  3Q8D A;  3I7F A;  1VQ7 A;  4QGU A;  2VUM H;  3U4Z A;  3PMF A;  1DXM A;  1Q1E A;  1V1Q A;  5EBD A;  2K6A A;  3EA6 A;  3VA5 A;  1LO5 D;  2HQE A;  1CKO A;  5IGD A;  3CPW A;  4FVM A;  2E2J B;  1B44 D;  1D1K A;  1RTN A;  4IPC A;  2EJM A;  4OX9 L;  2OQK A;  1CHP D;  1V9P A;  1Z9F A;  4EQP A;  3QOL A;  4AQY Q;  1HNX Q;  3BYY B;  1IXR A;  2G9H D;  1CUK A;  2M2L A;  5IWA L;  3M3Y H;  1JJG A;  2Q8R E;  2D2C C;  2SOB A;  1GHK A;  1F2L A;  5CMD A;  3J7A V;  4RGM A;  4B3T L;  3MXN A;  2QW7 A;  2QGQ A;  1N33 L;  1VDZ A;  3N6R A;  2B2Y C;  3HOW H;  3KLS A;  3FDT A;  1ZYR D;  1S5B D;  4DV3 L;  2OCE A;  1P16 A;  5LMN W;  1OXS C;  3JAM E;  3GV6 A;  4UHV A;  1EEI D;  2B2V C;  5JPM C;  4R1J A;  3TP5 A;  2VQF Q;  2HDL A;  1X56 A;  3PUX A;  1YJ9 A;  3TN2 A;  3J7Y W;  1DOL A;  5T1I A;  3OYY A;  3MFY A;  5FLX E;  1Y1V G;  1CZG A;  2A5H A;  3SE0 A;  3U9O A;  5C3X A;  3BS1 A;  4FO2 A;  4P73 A;  4DR6 Q;  3I8Z A;  1ESF A;  2VQE L;  2R7F A;  1TWF H;  1UE6 A;  3H0G B;  3K80 C;  3R3O A;  4NKL A;  3CRK C;  4A3K G;  3S9W A;  1X3F A;  5E3F A;  5EPJ A;  4F87 A;  2E75 C;  3S16 H;  1OXX K;  3WOE A;  3EN2 A;  4K5V A;  1P8L A;  4JYA Q;  2CWA A;  1YIJ A;  3NSW A;  3J80 E;  3SGI A;  3T56 B;  4OX9 Q;  4TRD A;  3A5U A;  1WTP A;  4QMG A;  2JE6 I;  3ULJ A;  4DR4 Q;  1E22 A;  3VYU A;  5L37 A;  3HOW G;  1L1O B;  1Q82 C;  4J8Q A;  1PRT B;  1HNW L;  2WB1 B;  3W3A A;  1HR0 L;  3RLO A;  1WCM B;  1B7Y B;  3NTK A;  4RKB A;  3M4O B;  5C4J B;  1PYB A;  4GN3 B;  4H44 C;  4I65 A;  2D62 A;  4C2M B;  2I5L X;  1NR2 A;  1WI5 A;  1D2B A;  1A3V A;  1BXT A;  3P1H A;  1BVS A;  3HKZ B;  2O2L D;  1JIC A;  5ELD A;  1VF5 C;  2MFI A;  3KJO A;  3K5N A;  2UU9 Q;  2FMC A;  4ZLT F;  1S5E D;  5IGF A;  2CW0 D;  1X3G A;  2WV6 D;  1EIF A;  1TWH H;  2EQS A;  5FJ8 G;  3S24 A;  1STY A;  4A3M H;  1SXT A;  3PCO B;  4JPB W;  4JV5 Q;  1X3E A;  2K7V A;  4Q5V A;  1PV4 A;  1TXY A;  3TP8 A;  4B3M L;  3EIV A;  2MP1 A;  2I07 B;  3BJU A;  4LK1 C;  2QF7 A;  3IAY A;  1GUO A;  1FJG L;  5IYC G;  1RDP D;  1VQD A;  1SNO A;  3H15 A;  4BBR B;  1I50 H;  1KDB A;  3S1M B;  2PZT A;  4RA8 A;  3CC2 A;  3ONA B;  5FKA C;  2EZV A;  4C3I G;  3BVG A;  2HCI A;  4KV6 A;  5C3W A;  3AYH B;  2PQA A;  4JBK A;  1JCK B;  3RUZ A;  5F2D A;  2EOT A;  2LMC B;  4YCU A;  3HOX B;  5CGK A;  4KK7 A;  2HUG A;  4JI8 L;  3I3C A;  1A6X A;  4UDU C;  3GTQ H;  3CMA A;  2MO1 A;  4M8A A;  2LS0 1;  2E2H H;  3AQQ A;  4XYO A;  2DJF C;  5COR A;  4H02 A;  4U67 3;  4C3H B;  2JSO A;  4LUV A;  4BBS H;  1STN A;  3HOV B;  1PA6 A;  4HID A;  1H9S B;  5A35 A;  1XNR Q;  1VQF A;  4AIM A;  1R9T H;  2D0P A;  3T1H Q;  1AP0 A;  1STA A;  4GKJ Q;  1KQS A;  3R2T A;  3A74 A;  2B2V A;  2F0U A;  4BY1 H;  5EPL A;  2J4X A;  2ZXO A;  1A63 A;  4OWX B;  2VL6 A;  3K57 A;  3CAM A;  1WTQ A;  1IW7 D;  3I4M G;  4G57 A;  1HXY D;  4DR3 L;  4ULL A;  4CKC A;  1CM9 A;  2F0S A;  2EYH A;  3Q23 A;  3OSO A;  4QIW E;  2K4K A;  3OW2 A;  3SK4 A;  4OON A;  2JA9 A;  4UP7 A;  4WOR A;  2KBN A;  2AQ1 B;  2IJ0 A;  1MBY A;  5M9O A;  4P75 A;  2F3V A;  2XRS D;  1DJR D;  3M7N A;  3DHQ A;  3S14 H;  2XTI A;  2JA6 G;  2R93 H;  1EFI D;  1QWY A;  5JOB A;  4KY7 A;  2E2J H;  1BKB A;  4R4C A;  3OPO A;  4BS9 A;  1K3R A;  4X62 Q;  4DAP A;  4LWC A;  5M3M H;  2F0F A;  1CKN B;  3HP3 A;  1KTK A;  2V1C C;  4MN3 A;  4YWK A;  1LTB D;  3K58 A;  1YNN C;  2K1B A;  2KCN A;  1QNU A;  3ERQ A;  4NW2 A;  3M3Y B;  1RCV D;  1V1P A;  1E2V A;  2K5N A;  2F0I A;  3RMH A;  3TSS A;  1EU4 A;  2YU9 H;  1HR0 W;  1VQB A;  5C4X H;  1SE3 A;  1KD1 C;  3T53 B;  3A8K E;  1BBX C;  2BCO A;  4WJ3 M;  1B8A A;  2RCN A;  4YCW A;  4DNR B;  4IFD H;  1T5E A;  3UDI A;  4DNI A;  2L1B A;  2UUA L;  4K0K L;  3MZ5 A;  1LT6 D;  1VMC A;  1Q86 C;  3GTJ B;  1I50 B;  1TVX A;  1DD2 A;  4X3U A;  3KF8 A;  3SR1 A;  1D6E C;  1SE4 A;  4EVO A;  4DV6 L;  1WTO A;  4OO1 G;  4TQU S;  2PW5 A;  4DV2 Q;  4FNF A;  5DAU A;  2PZW A;  2ZM6 Q;  3KLS X;  2MUY A;  2XNA C;  4UP9 A;  1SJH D;  1MJC A;  4XTC S;  4EQN A;  2NBF A;  2R61 A;  4IUU A;  3J81 c;  2CW0 C;  1GVP A;  4GN4 B;  5JEA J;  1BOS A;  3PO3 H;  1SYD A;  1LAC A;  4DR7 Q;  1W6K A;  5ELN A;  2DY7 A;  2UXB L;  1QVF A;  4JI6 L;  4Y7N B;  1VQN A;  1QJO A;  1KHI A;  3S14 B;  3LWE A;  1E2Z A;  1XMO Q;  2IY5 B;  3V05 A;  2LXK A;  2Z6K A;  4PQX A;  2F0O A;  2F0T A;  4A3B G;  4BBR H;  2IWH A;  3GV3 A;  2IPK D;  3NE5 B;  1EYG A;  4A3E H;  2F0G A;  4AYB B;  1WD0 A;  4ZK9 B;  3HGB A;  1MSG A;  3I55 A;  4BY1 G;  1ML0 D;  1IHZ A;  2KHI A;  2K5Q A;  3J81 E;  1EWH A;  2B2T C;  3MAQ A;  2AWN A;  4QUC A;  3CCR A;  4PV1 C;  1NUC A;  4H7B A;  4ZUI A;  4PZ6 A;  3QR8 A;  4K8I A;  5DM7 3;  3S1R B;  3J7A 5;  2KCC A;  4CDF C;  5IT9 c;  2PQE A;  3ND8 A;  3TRZ A;  2AUK A;  4IUR A;  1VQO A;  4C2M H;  2A1A A;  4P72 A;  2ID0 A;  1SE2 A;  5FLM H;  4H0L C;  1SEB D;  1PMR A;  5I9O A;  3KDF B;  4IFD I;  3C1F A;  4IN3 A;  3K5M A;  1ZYR C;  1S5F D;  4JBJ A;  4X3K A;  4JYA L;  1NSN S;  4KI0 A;  3DEP A;  2RDF A;  4K5X A;  3VR6 A;  4DV1 Q;  1EL0 A;  3J7A F;  1UE7 A;  1UUP A;  2Z6K C;  2B2U A;  5D3D A;  5CV7 A;  1MJE A;  4ILW A;  3ICE A;  4B3R Q;  1NE3 A;  3IFD A;  1B9N A;  3KF8 B;  4IQZ A;  1OTC A;  2VZA A;  3PSI A;  3U4V A;  4HIM A;  2KHJ A;  3DWP A;  2B2W C;  1RTO A;  3STB C;  3E6Z X;  3SK5 A;  1BDO A;  3AMU A;  1NCV A;  3J80 c;  4IUT A;  4A3G B;  5IYB G;  4C1N K;  2ZTD A;  3F2B A;  2PZU A;  5K5P A;  3DMU A;  1TU2 B;  1H9J A;  3OTO Q;  5JJI A;  4UP8 A;  4V19 0;  1G6Z A;  4XQN A;  2HD3 A;  1VQ8 A;  4JCV E;  1T9H A;  1X6O A;  4A3L G;  3FKI G;  3R93 A;  3NQI A;  1MKH A;  1KXL A;  3PQI A;  1Z7T A;  2OWO A;  4BXX G;  5EAY A;  3UDF A;  2B29 A;  4A3D G;  1L0W A;  3EVQ A;  1C8C A;  1WYD A;  1XNQ Q;  4DUY L;  1PYS B;  4XXE A;  2X6G A;  5KGU A;  2F0L A;  4R4O A;  4R8N A;  2C5C A;  1PYW D;  2NYZ D;  1B70 B;  5FK9 C;  5FLM G;  4DV7 L;  3K7U C;  3HOY B;  4B9X A;  1SNP A;  1LTT D;  2DUD A;  5BR8 Q;  3MEF A;  2FMM A;  3L3O C;  1X9N A;  5M5W H;  4DGZ A;  4I7A A;  1EQQ A;  2DJG C;  5FO9 B;  3I4N H;  3HOX H;  3CC7 A;  4LNQ A;  2J0T D;  1NAP A;  5LMN Q;  1HFG A;  1F9S A;  2AKW B;  3DUZ A;  3S17 H;  3K6O A;  3LGJ A;  1EIG A;  4E6I A;  3J81 i;  1JT8 A;  2F3W A;  1V43 A;  3CCL A;  3UDX A;  2HCC A;  5CYU A;  2HIX A;  4JOI A;  2KJX A;  4GOP A;  1XJV A;  4R4T A;  1XMQ Q;  4X65 Q;  5IYC H;  4JBW A;  5CC4 A;  1VCI A;  2JA8 G;  5GQO A;  4MHE A;  4GKJ L;  4K2K A;  5FJ8 H;  2L5T A;  4RWS C;  1DOM A;  4IUN A;  1PH6 A;  4KY6 A;  1KAB A;  1M8A A;  4J15 A;  5IP9 G;  4RGN A;  5C44 B;  2N3S A;  2EIF A;  5AFW A;  3G4S A;  1I4G A;  3CCV A;  2R7D A;  1K28 A;  2NZH A;  4ODG A;  1HR0 Q;  2IX3 A;  1NNX A;  5C5M A;  1NMG A;  4K5W A;  3HG9 A;  2LY7 A;  2PO4 A;  4DNT B;  4X62 L;  3F2C A;  3I2Z A;  4Z9C B;  4RHS A;  3NEN A;  1B4O A;  1QE6 A;  4DV4 Q;  4PMB A;  2EY1 A;  4DAV A;  1UNS A;  3E9H A;  4TSS A;  4KTA A;  1WCM H;  4XQJ A;  1PZK D;  3EJI A;  4QL5 A;  4YHH Q;  2FXQ A;  3PF5 A;  5J22 A;  3NTI A;  1TR5 A;  1BBU A;  4GZY C;  3UE1 A;  4KN4 C;  5IP9 H;  4GKK Q;  2JP1 A;  4FF1 A;  4L5R C;  2R7Z H;  5A2Q E;  4L5Q A;  2KEN A;  1IBL L;  3S1Q B;  4B3M Q;  3KBX A;  1MSH A;  2F0K A;  4XT1 B;  4LFB Q;  1SYF A;  4OHJ A;  3M4P A;  2NTS A;  2EYJ A;  4BY7 H;  5I2Y A;  2F0P A;  2EDG A;  4WFN 3;  4POF A;  1KRS A;  3URY A;  1PTO B;  3GTL H;  2N49 A;  1FNW A;  2KHS A;  4AH6 A;  5M5W B;  4BXX H;  2EY5 A;  4L6T B;  2CHB D;  2B63 H;  3D6C A;  3GDE A;  5C4Z A;  5FLX c;  4PZ7 A;  2ZTE A;  1CHQ D;  4A3E B;  2UUB L;  3I4N B;  1UWV A;  1S5D D;  2IW3 A;  5IGE A;  2GA4 B;  2DN8 A;  3TBI B;  4HSP A;  3CCS A;  2YTX A;  1JQY D;  3P7J A;  2FJ2 A;  3MA2 B;  1TWF B;  1XTD A;  3H0G H;  5IYD H;  4CBV A;  2TMP A;  3CC4 A;  4NB3 A;  4RGO S;  4ZRZ A;  4DR7 L;  3TZU A;  3S2D H;  1CQF A;  4GOP C;  2R7Z G;  1LLR D;  4JI6 Q;  1PH5 A;  3BDL A;  3MEH A;  1W6J A;  4N8F A;  1HHV A;  1U4L A;  4DXF A;  5IIF A;  1VS0 A;  2K03 A;  4B3S Q;  1O80 A;  3BVZ A;  1HUM A;  1S72 A;  1KL9 A;  4WRD A;  4A76 A;  2OTL A;  2AUJ D;  1MGS A;  3HEJ A;  3GTQ B;  4DUZ L;  3H3V C;  1Z6H A;  3STB D;  2KA7 A;  3KYH C;  2HQL A;  2PNH A;  4DAY B;  2B39 A;  2UU9 L;  1LTR D;  1ILP A;  5T1G A;  5I2X A;  5C3E H;  1LT5 D;  1HZB A;  2XIW A;  2CKZ B;  1A0I A;  1FGU A;  1LYL A;  3HOZ G;  3TDQ A;  1WVL A;  4IUP A;  4FXD A;  1PH8 A;  3AB9 A;  4A3L H;  1I3Q H;  2K01 A;  1IZ6 A;  3GTK H;  1WTR A;  1U5K A;  4LF5 L;  3MXU A;  4JI1 Q;  5IWA Q;  1TKW B;  4LF6 L;  3FMC A;  2O5J C;  1AH9 A;  4DV5 Q;  1ENC A;  3I4M B;  5LL6 S;  1J5E Q;  3MTS A;  3E0J A;  1JOQ A;  1GJX A;  3BZD B;  4DV1 L;  4HJ7 A;  3BU2 A;  3V2T A;  5M3F G;  2V4D A;  1QOH A;  1YHA A;  5IE8 A;  5ELF A;  1Y8P B;  3OTO L;  4NXN L;  4FXK C;  4CDD C;  1GXD C;  1XYI A;  3CHB D;  1E24 A;  4YY3 Q;  3PO2 H;  3DM1 A;  1JWS D;  4DR2 Q;  1K8A C;  3HOV G;  3BVM A;  4XT3 B;  4LF8 L;  3BYT B;  5EBC A;  1DOK A;  4TVA B;  3ZJY C;  5CBA E;  4LF9 Q;  1I6H H;  4HMJ A;  5KNB A;  3UDG A;  1ZXT A;  1XPR A;  1AZP A;  4A75 A;  3HOZ B;  5LHY 1;  3ULP A;  3S1N H;  2JA5 G;  1BUV T;  1HTL D;  2JA5 B;  4P71 A;  1WTW A;  2YYZ A;  1SBB B;  1J8I A;  3M4O H;  3D31 A;  1LUZ A;  3KDF A;  4HCS A;  2B2Y A;  4NXM L;  4C3H H;  1PRT D;  2E5L Q;  3NWS A;  5COY A;  4KKT A;  4OWT B;  4BBR G;  1F2Y A;  1GUW A;  1N32 L;  4A93 G;  3TP7 A;  4X66 Q;  2Z8L A;  1TS2 A;  1KDA A;  4LUO A;  1VQE A;  3FPU B;  5BN4 A;  1PH3 A;  1H9S A;  4UY8 C;  2B2W A;  1VQK A;  1FR3 A;  2ALY B;  2XN9 C;  4C1N I;  2O5I C;  2WB1 E;  3CME A;  3G48 A;  4ZKB B;  2KQ3 A;  3I73 A;  1HZC A;  2QA4 A;  5GAG C;  4CKE A;  4KJO A;  1FNU A;  2F52 A;  1BBW A;  4IPG A;  3I4N G;  3A54 A;  4P74 A;  4IOC A;  1LTL A;  3NBH A;  5CR3 A;  3N52 A;  4OXP A;  1MIU A;  1G29 1;  2B8G A;  1C0A A;  5ISR A;  4R4Q A;  1NTG A;  3U9S A;  1DYQ A;  3GTM H;  4LF9 L;  1SLJ A;  3GTP B;  4DN4 M;  2CVR A;  1XTC D;  3EBE A;  1PH7 A;  2EE1 A;  2ZJR A;  1SNQ A;  3W1B A;  3MXG A;  3QB3 A;  5M5Y B;  4QF4 A;  1LV9 A;  4RCN A;  4DR1 L;  4A4I A;  2GVA A;  3TEH B;  1OXU A;  3A55 A;  5AJ3 L;  4ABN A;  5IGB A;  1HFN A;  2F4I A;  5C4X G;  3HOW B;  2XWJ B;  4QQB X;  2H5X A;  1TWA B;  4DV2 L;  3J80 L;  3AU7 A;  2VUM B;  4R8I A;  3DM3 A;  3TRE A;  1EY5 A;  4QUF A;  3HFZ B;  3MXP A;  1Q1B A;  1SFO H;  4JI3 Q;  4X66 L;  1TY0 A;  4DK0 A;  2KED A;  2Z4H A;  1XPU A;  2X6L A;  2R7Z B;  3A8I E;  1PTO C;  2K75 A;  2OTJ A;  3I90 A;  2RVL A;  1K3B C;  1YJW A;  1SSO A;  2R93 G;  4HMI A;  2SNS A;  2VW9 A;  4F7X A;  1I94 L;  4K6L A;  5DLQ E;  1G8Z D;  2RA4 A;  3QWN A;  2EY6 A;  5TSS A;  1OXV A;  1Y14 B;  3A5Z B;  1N8R C;  4A3E G;  1OXT A;  1YNX A;  2F3I A;  2E76 C;  4YWM A;  1XX8 A;  1GUT A;  4JI5 L;  4RGT A;  4LFA Q;  2JA8 H;  1ENF A;  4J6H A;  3OOC A;  3S16 B;  1TWG H;  4APV A;  4A3B H;  4Y7N H;  1KC8 C;  3KOJ A;  1R4Q B;  1KLU D;  1X55 A;  4IZ8 A;  1AZQ A;  2L12 A;  1QVC A;  1XNR L;  1GKH A;  4N8X 1;  2M9V A;  4PMW A;  5E1F A;  1HZA A;  2PI2 E;  3G7L A;  4IO9 A;  4JG2 A;  4S3S A;  1S40 A;  3M7G A;  5C0X I;  5IT9 E;  1SYC A;  2X69 A;  1TQO A;  2MJ8 A;  1VQA A;  2WAC A;  5LL6 X;  4JI4 L;  2K5H A;  4KLK A;  2BA1 A;  4DR3 Q;  3SHL A;  5C44 H;  2B3G A;  4O0A A;  3C1E A;  4DV0 Q;  4P2C B;  2L11 A;  1C4Q A;  5CV9 A;  2R6G A;  2Q2I A;  3MHB A;  3K5L A;  4DR5 Q;  5HGT A;  2MPM A;  1Q12 A;  1EY8 A;  1F2Z A;  3FVQ A;  1F77 A;  2JA5 H;  4ID6 A;  1N34 Q;  3ER0 A;  1SDF A;  3T1Y L;  5IY0 A;  3K59 A;  1SYG A;  5IGC A;  4JI3 L;  4LFC L;  3JAM c;  2AWO A;  1UEB A;  1A3T A;  3SXH A;  1K8G A;  2I46 A;  2RSN A;  2L9H A;  5H1S E;  3GTM B;  1AN8 A;  3AFP A;  1AFP A;  2N88 A;  1PXU A;  1S3O A;  3K5O A;  1I94 Q;  4KHP L;  4RAU C;  1L0Y B;  1CKM A;  3X3N A;  1VF7 A;  4RG1 A;  4XIG S;  4IOA A;  1Y8N B;  3VR4 A;  3QOJ A;  1SN8 A;  3RZO H;  1TT2 A;  4JI2 Q;  4JK1 C;  1B53 A;  3NPP A;  4LFA L;  3FPP A;  4KKU A;  2YV5 A;  2ZXR A;  4X65 L;  5EGT A;  1TWG B;  2Q2U A;  4IFD J;  2K04 A;  1STE A;  3FKI H;  4CJ1 B;  2JA7 H;  2NN6 G;  2IX1 A;  2TSS A;  1HQR D;  1R4P B;  2MGS A;  1L1O C;  1VMP A;  2EXZ A;  2K05 A;  2VXW A;  3GQB A;  2I5H A;  1N36 L;  3M4Q A;  2R92 H;  1ET6 A;  1ICF B;  1EZ6 A;  3GTO H;  2VNU D;  3TZD A;  3IL8 A;  1LTS D;  1PTO F;  2A6E D;  2RHS B;  1EOT A;  5C0X G;  1VQG A;  3QJY A;  3VYS A;  1BCP C;  1HNZ Q;  3HOU G;  1C7Y A;  4U68 A;  3K7A B;  1W2B A;  4A3G G;  1YNN D;  4IPH A;  1JWU D;  2C9O A;  4YY3 L;  1GUS A;  2F0D A;  3I72 A;  2NVX B;  2ES2 A;  5KEE A;  2ATW A;  2D9U A;  3T16 A;  5CV5 A;  4LF6 Q;  5C3E G;  3NEL A;  1ASY A;  1PZI D;  5FO7 B;  4GNX C;  5BN5 A;  3MC0 B;  4AYB E;  2JEB I;  1KAW A;  3HOY G;  2KVM A;  3E0E A;  1E2W A;  5ELO A;  2NVT B;  1HRJ A;  3T1H L;  4K6D A;  2A74 C;  3TQY A;  2A19 A;  2N55 A;  2I5M X;  3JC6 6;  1X54 A;  2K14 A;  4HSV A;  4DK1 A;  2XSC A;  4HIK A;  1VQJ A;  2E2I B;  1D7Q A;  4LF8 Q;  4HIO A;  1A2U A;  1O7Y A;  1M90 C;  3NXW A;  2E74 C;  3CW2 C;  2BE5 D;  1H95 A;  2E5L L;  1J9O A;  1CZW A;  3C2P A;  4AQY L;  1XXG A;  2Y0S E; 
#chains in the Genus database with same CATH homology
 3DXJ C;  1S4Z A;  3FKI B;  3D3R A;  4HED A;  1K83 B;  3W2D A;  1EQV A;  4O1N A;  4FF3 A;  3L7Z C;  1SYE A;  4XDX A;  4NP5 A;  1QCB D;  5D3I B;  4KY5 A;  5I6Y A;  4R9W A;  1B50 A;  3WOF A;  1RF2 D;  2OF1 A;  1YNJ D;  1IYU A;  2NVY B;  5E4W C;  2WP8 J;  1RKN A;  3K0Y A;  5IGG A;  4CHT B;  3T13 A;  3TP6 A;  4G7Z C;  2K28 A;  2RDG A;  1KLG D;  2ZT9 C;  1II3 A;  1EY0 A;  3GP7 A;  3S1N B;  3DWQ A;  3NBI A;  1CQV A;  3TME A;  1BQQ T;  4OIJ A;  2R93 B;  3EQL C;  4OIK A;  2WII B;  4IFD G;  5J1Z A;  1AEX A;  1CA5 A;  1SND A;  2A69 D;  1BR9 A;  4BY1 B;  4TKO B;  3PO3 B;  1BCP F;  3VYT A;  2J7Z A;  2RSO A;  5C4X B;  1HA5 A;  1CFM A;  4OGQ C;  3VR3 A;  4A3B B;  3R8B A;  1TS3 A;  3M85 A;  4IUV A;  1PZJ D;  1RHP A;  1D5M C;  3L9A X;  1PTO H;  3D4D A;  3EFX D;  4QCL A;  5FOB B;  4RH6 A;  1STH A;  1U4R A;  3T4A C;  5A2Q L;  1B1Z A;  5I4D A;  2F0J A;  5JEA H;  2A6E C;  2A68 C;  4B9W A;  5FO8 B;  2F1M A;  3CU7 A;  3I70 A;  4X3T A;  1EWC A;  1T5X D;  4RKL A;  2HDM A;  2E2H B;  1RD9 D;  1O7Z A;  1BCP B;  1STB A;  4C3J B;  4C3H G;  3UI2 A;  4A93 B;  5J39 A;  3Q24 A;  1QG7 A;  3VR5 A;  1K8M A;  4KD3 A;  4FF4 A;  1DZ1 A;  1ROD A;  4KD4 A;  4QB4 A;  3PUW A;  5JEA G;  1HA6 A;  2RKS A;  4ZYS A;  2AQ3 B;  3QO2 A;  2JA7 B;  3KUP A;  4C3I B;  2K5D A;  4HTH A;  2EYO A;  4EQO A;  3PIP 3;  1I4H A;  2B2U C;  1H9M A;  4BY7 B;  1LTI D;  1F9P A;  5JAV A;  3HS0 C;  3A7L A;  3A8J E;  1PFM A;  4DAY A;  4CJ0 B;  1U4M A;  1EQT A;  4OL7 A;  4HCE A;  2L55 A;  4BA1 I;  3X3M A;  1EYA A;  1YNJ C;  5M3F B;  1CI3 M;  5KYI A;  3RLF A;  2KUM A;  3R2I A;  2CQA A;  1G2S A;  2WKC A;  1JOR A;  1EYD A;  1PTO D;  1PRT F;  3P20 A;  3I4L A;  4RHR A;  1ZEQ X;  3P75 A;  1EY6 A;  2SDF A;  2LFN A;  4MIU A;  3VYR A;  1EU3 A;  1F9R A;  3LX0 A;  4K2L A;  3OIQ A;  4ME5 A;  4LJZ C;  1M4V A;  3S17 B;  4A3F B;  2RBM A;  3A7A B;  1HQM C;  2JXM B;  4G4K A;  2ICE C;  1TWH B;  5C0X H;  2L4N A;  3BDC A;  4KJN A;  3HRZ C;  3OW7 A;  1FNV A;  5NUC A;  1PDQ A;  2F0W A;  2NB0 A;  5EKL A;  2K33 A;  3PUV A;  3C46 A;  4A3K B;  4O42 A;  1CT1 D;  3JAM L;  3OWE B;  4G7O C;  2K5W A;  3GTO B;  2IX0 A;  5M3M B;  2KEC A;  1PRT C;  3LWU A;  4M1U B;  1Z47 A;  1TS5 A;  1Y1V B;  1Q90 A;  4DFA A;  1ZKO A;  3NP8 A;  1D1I A;  3PV0 A;  1ESR A;  1EYC A;  2NN6 H;  2R3Z A;  5HUR A;  1H9R A;  1X3P A;  2OXP A;  1E0B A;  2SNM A;  4HR7 B;  3S2D B;  1LTG D;  1NR4 A;  3NWT A;  4XYQ A;  1Q3L A;  1B2T A;  2F0H A;  2NZ1 D;  5FLX L;  2BDO A;  5ELB A;  1A15 A;  2IT1 A;  3A56 A;  4A3I B;  2PYK A;  2F03 A;  3NHH A;  1V8Q A;  3MVV A;  5C6A A;  4X3S A;  1FD7 D;  1FYC A;  3Q0A A;  5IOC A;  5C4H A;  1OO9 B;  4C56 C;  2D5D A;  2Z1C A;  3HZX A;  4DF7 A;  2Q8T A;  3BG3 A;  2XVS A;  2JA8 B;  1IW7 C;  2DNE A;  1Y8O B;  1LAB A;  3NTH A;  3D6W A;  1JOK A;  1PFN A;  1SJE D;  4CJ2 C;  4LMQ D;  1U4P A;  2PNR C;  4FYD A;  1I6V C;  1BF4 A;  1I6H B;  1ONL A;  4OO1 I;  1X32 A;  5ELE A;  3OIP A;  4HN7 A;  5CV8 A;  3C3L A;  1SAP A;  2Y0S B;  2KOL A;  1F9Q A;  1ICW A;  3SDZ A;  4CKB A;  2NUC A;  5G3L D;  4YIJ A;  4J1M A;  3DWA A;  1CTM A;  2FFK B;  5BN3 A;  3OWF A;  3ZYY X;  4OO1 H;  3BDO A;  4FF2 A;  1PLF A;  4EGV A;  2DY8 A;  2RDH A;  1SMY C;  1SNM A;  2OEO A;  4QIW B;  3SK8 A;  3KBG A;  4LAA A;  4A3D B;  1HTP A;  1TS4 A;  1MI2 A;  1LTA D;  3J81 L;  2QDB A;  4B08 A;  5DNF A;  1D5Z C;  5EKK A;  1PFB A;  2QCP X;  3Q6S A;  4N9P A;  4DU9 A;  2QEJ C;  1SNC A;  3V96 A;  5EJW A;  2K32 A;  5E4X A;  5I9P A;  2F0N A;  5JPN C;  4IUQ A;  5G3L F;  5K36 G;  1FGB D;  2NWG A;  1HPC A;  3E5S A;  4N9T A;  1JE4 A;  5CBE E;  5JVG 3;  2M00 A;  1IKL A;  2PW7 A;  5CV4 A;  2YU9 B;  1JR0 D;  4XQQ A;  4KHZ A;  1BO0 A;  3G6J B;  2FHT A;  1KNA A;  1HUN A;  3O13 A;  3NK9 A;  5JJZ A;  1ILQ A;  4ZUJ A;  1WD1 A;  1BCP D;  4KN7 C;  1A3U A;  1DCZ A;  2QKI C;  1SFO B;  1JC7 A;  3GTL B;  3CQZ B;  3M4Y A;  3GTG B;  4L8J A;  3ERO A;  1IL8 A;  2NN6 I;  5K36 H;  1B3A A;  3SVM A;  2H1E A;  2WAQ B;  1EY7 A;  1I4X A;  2BDN A;  2MHV A;  1Y69 U;  4V0B A;  2F0Q A;  2ZXP A;  1GUG A;  3D4R A;  1S5C D;  2WIN B;  2JYO A;  2BE5 C;  4BWG B;  1JB3 A;  2IL8 A;  1IYV A;  4PMC A;  3IKJ A;  5KRU A;  1Q8I A;  2NVQ B;  4G7H C;  1G2T A;  3ND9 A;  4C3J G;  3DEO A;  2EJF C;  3FEW X;  4BA2 I;  2EJG C;  1EZ8 A;  1Y1W B;  5JVH 3;  3OMG A;  5IOD A;  3SK6 A;  2F0E A;  4ZAI A;  3CRL C;  3WDN A;  1QB5 D;  4ZQ3 A;  1TII D;  2VB3 X;  5ELC A;  1LT3 D;  3QG1 A;  4KMU C;  2PPB C;  2G9D A;  1BNZ A;  4DA2 A;  4HAE A;  2VB2 X;  1WTX A;  4KKS A;  4NMZ A;  5EQ0 A;  2RQX A;  1SMY D;  4RCO A;  1F2M A;  5DEH A;  2EPB A;  4K8J A;  2JA6 B;  4ZKC B;  5KND A;  2A68 D;  1X3Q A;  3GTK B;  2A69 C;  1O78 A;  1LT4 D;  1GHJ A;  2A73 B;  1EY9 A;  5CV6 A;  1KDC A;  4PNY A;  3OMC A;  5D14 A;  3ITP A;  4L63 B;  1MD2 D;  1QNK A;  4F88 A;  2NTT A;  1EY4 A;  1JOO A;  1I4R A;  2Z4I A;  3LNN A;  1B9M A;  3RD4 A;  3S2H B;  1JWM D;  5KYL A;  2EYF A;  1C48 A;  1DM0 B;  3D8G A;  1O7L A;  2FIN B;  5D65 A;  5EPK A;  2BOS A;  2ENB A;  2F0M A;  5IT9 L;  3GD7 A;  1D5X C;  3D4W A;  1GUN A;  2F0V A;  1ET9 A;  5C0X J;  1EEF D;  2EY2 A;  1IKM A;  2E2D C;  4BBS B;  1XWE A;  2L0C A;  4KHV A;  2EYL A;  3PIO 3;  2AQ2 B;  3MFG A;  3Q22 A;  3NQT A;  5EKI A;  3S15 B;  3H6M A;  2WKD A;  2B2T A;  4CGY B;  1KNE A;  4IAL A;  3SEB A;  2XRQ D;  2EYP A;  1TY2 A;  1STG A;  4NDX A;  3GO5 A;  2B63 B;  1V1O A;  5KIX A;  4H13 C;  1CK1 A;  1I3Q B;  1EIH A;  1ENA A;  4FXG C;  1K8O A;  5DM6 3;  2LKV A;  3OHX C;  1KAA A;  4A3J B;  3H09 A;  1U9R A;  2XWB B;  3RZD B;  2SEB D;  1TWC B;  1L0X B;  2ICI A;  5I6W A;  3I91 A;  3CKI B;  5C5L A;  1G91 A;  3IFT A;  4Q0F A;  2R92 B;  4I7Z C;  2KEE A;  2DNC A;  1UEA B;  1I4P A;  3PUY A;  2BA0 A;  2OT2 A;  3H91 A;  1I4Q A;  2QIL A;  3KK7 A;  2A6H C;  3T51 B;  1HCZ A;  1SYB A;  2PCF B;  3RZO B;  4RFB A;  2B8F A;  2O4X A;  1CA6 A;  1DON A;  5C3E B;  3KLR A;  4WJW A;  3FRP B;  4F8M A;  1AW7 A;  1GOZ A;  5M5X B;  3HOU B;  4K14 A;  1RJT A;  3VR2 A;  3MWY W;  3F2U A;  1R9T B;  2H4O A;  1A2T A;  2JEA I;  4FP5 D;  2PMZ B;  1H9K A;  3QIA A;  3NUC A;  5KNC A;  4A3M B;  4UAI A;  1WTV A;  3PO2 B;  2EYM A;  2Q8I B;  3VA7 A;  3H94 A;  3PUZ A;  2EVB A;  4DXG A;  1V1P B;  2A6H D;  1UAP A;  1QIL A;  3PMF A;  1DXM A;  1Q1E A;  5EBD A;  2K6A A;  3EA6 A;  3VA5 A;  1LO5 D;  2HQE A;  5IGD A;  4FVM A;  2E2J B;  1B44 D;  1D1K A;  1RTN A;  2EJM A;  1CHP D;  4EQP A;  3QOL A;  3BYY B;  2G9H D;  2M2L A;  2Q8R E;  2D2C C;  2SOB A;  1GHK A;  1F2L A;  5CMD A;  3J7A V;  4RGM A;  3MXN A;  1VDZ A;  3N6R A;  2B2Y C;  3KLS A;  3FDT A;  1ZYR D;  1S5B D;  1OXS C;  3JAM E;  3GV6 A;  1EEI D;  2B2V C;  5JPM C;  3TP5 A;  2HDL A;  3PUX A;  3TN2 A;  3J7Y W;  1DOL A;  5T1I A;  3MFY A;  5FLX E;  1CZG A;  2A5H A;  3SE0 A;  3U9O A;  5C3X A;  3BS1 A;  4FO2 A;  3I8Z A;  1ESF A;  3H0G B;  3R3O A;  4NKL A;  3CRK C;  3S9W A;  5E3F A;  5EPJ A;  4F87 A;  2E75 C;  1OXX K;  3WOE A;  4K5V A;  3NSW A;  3J80 E;  3T56 B;  4TRD A;  1WTP A;  4QMG A;  2JE6 I;  3VYU A;  4J8Q A;  1PRT B;  2WB1 B;  3W3A A;  1WCM B;  3NTK A;  4RKB A;  3M4O B;  5C4J B;  4H44 C;  4I65 A;  2D62 A;  4C2M B;  1NR2 A;  1D2B A;  1A3V A;  1BXT A;  3P1H A;  3HKZ B;  2O2L D;  1JIC A;  5ELD A;  1VF5 C;  3K5N A;  2FMC A;  4ZLT F;  1S5E D;  5IGF A;  2CW0 D;  2WV6 D;  1STY A;  1SXT A;  2K7V A;  4Q5V A;  3TP8 A;  2MP1 A;  2I07 B;  4LK1 C;  2QF7 A;  3IAY A;  1GUO A;  1RDP D;  1SNO A;  4BBR B;  1KDB A;  3S1M B;  2PZT A;  4RA8 A;  3ONA B;  5FKA C;  2EZV A;  4C3I G;  3BVG A;  2HCI A;  4KV6 A;  5C3W A;  1JCK B;  3RUZ A;  5F2D A;  2EOT A;  2LMC B;  3HOX B;  5CGK A;  4KK7 A;  2HUG A;  3I3C A;  1A6X A;  4UDU C;  4M8A A;  2LS0 1;  4XYO A;  5COR A;  4U67 3;  4C3H B;  2JSO A;  1STN A;  3HOV B;  1H9S B;  5A35 A;  1AP0 A;  1STA A;  3R2T A;  2B2V A;  2F0U A;  5EPL A;  2J4X A;  2ZXO A;  3K57 A;  1WTQ A;  1IW7 D;  4G57 A;  1HXY D;  4ULL A;  4CKC A;  1CM9 A;  2F0S A;  2EYH A;  3Q23 A;  3OSO A;  3SK4 A;  4WOR A;  2AQ1 B;  2IJ0 A;  1MBY A;  5M9O A;  2F3V A;  2XRS D;  1DJR D;  3M7N A;  3DHQ A;  1EFI D;  1QWY A;  5JOB A;  4KY7 A;  3OPO A;  4BS9 A;  4DAP A;  2F0F A;  3HP3 A;  3K58 A;  1KTK A;  4MN3 A;  1LTB D;  1YNN C;  2K1B A;  2KCN A;  1QNU A;  3ERQ A;  4NW2 A;  3M3Y B;  1RCV D;  1V1P A;  1E2V A;  3RMH A;  2F0I A;  3TSS A;  1EU4 A;  1SE3 A;  3T53 B;  3A8K E;  1BBX C;  2BCO A;  4DNR B;  4IFD H;  1T5E A;  2L1B A;  3MZ5 A;  1LT6 D;  1VMC A;  3GTJ B;  1I50 B;  1TVX A;  1DD2 A;  4X3U A;  3KF8 A;  3SR1 A;  1D6E C;  1SE4 A;  4EVO A;  1WTO A;  4OO1 G;  4TQU S;  2PW5 A;  4FNF A;  5DAU A;  2PZW A;  3KLS X;  2MUY A;  2XNA C;  1SJH D;  4XTC S;  4EQN A;  2NBF A;  2R61 A;  4IUU A;  2CW0 C;  5JEA J;  1BOS A;  1SYD A;  1LAC A;  1W6K A;  2DY7 A;  4Y7N B;  1QJO A;  3S14 B;  3LWE A;  1E2Z A;  3V05 A;  4PQX A;  2F0O A;  2F0T A;  2IWH A;  3GV3 A;  2IPK D;  3NE5 B;  2F0G A;  4AYB B;  1WD0 A;  4ZK9 B;  3HGB A;  1MSG A;  1ML0 D;  1IHZ A;  3J81 E;  2K5Q A;  1EWH A;  3MAQ A;  2B2T C;  2AWN A;  4QUC A;  4PV1 C;  1NUC A;  4H7B A;  4ZUI A;  4K8I A;  5DM7 3;  3S1R B;  2KCC A;  2PQE A;  3ND8 A;  2AUK A;  4IUR A;  2ID0 A;  1SE2 A;  4H0L C;  1SEB D;  1PMR A;  5I9O A;  4IFD I;  3C1F A;  4IN3 A;  3K5M A;  1ZYR C;  1S5F D;  4X3K A;  1NSN S;  4KI0 A;  3DEP A;  3VR6 A;  2RDF A;  4K5X A;  1EL0 A;  3J7A F;  1UUP A;  5D3D A;  2B2U A;  5CV7 A;  4ILW A;  3IFD A;  1B9N A;  4IQZ A;  3DWP A;  2B2W C;  1RTO A;  3E6Z X;  3SK5 A;  1BDO A;  3AMU A;  1NCV A;  4IUT A;  4A3G B;  4C1N K;  2PZU A;  5K5P A;  3DMU A;  1TU2 B;  1H9J A;  4V19 0;  1G6Z A;  4XQN A;  3R93 A;  3NQI A;  1Z7T A;  3EVQ A;  1C8C A;  4XXE A;  2X6G A;  5KGU A;  2F0L A;  4R8N A;  2C5C A;  1PYW D;  2NYZ D;  5FK9 C;  3HOY B;  4B9X A;  1SNP A;  1LTT D;  2FMM A;  3L3O C;  4DGZ A;  5FO9 B;  2J0T D;  1NAP A;  1HFG A;  1F9S A;  3DUZ A;  3K6O A;  1EIG A;  4E6I A;  2F3W A;  1V43 A;  2HCC A;  5CYU A;  2KJX A;  4JBW A;  5CC4 A;  1VCI A;  4MHE A;  4K2K A;  2L5T A;  4RWS C;  1DOM A;  4IUN A;  4KY6 A;  1KAB A;  1M8A A;  5C44 B;  4RGN A;  5AFW A;  1I4G A;  4ODG A;  2IX3 A;  5C5M A;  4K5W A;  3HG9 A;  2LY7 A;  2PO4 A;  4DNT B;  4Z9C B;  4RHS A;  1B4O A;  1QE6 A;  4PMB A;  2EY1 A;  4DAV A;  1UNS A;  4TSS A;  4KTA A;  4XQJ A;  1PZK D;  3EJI A;  5J22 A;  3NTI A;  1TR5 A;  4GZY C;  4KN4 C;  2JP1 A;  4FF1 A;  5A2Q E;  3S1Q B;  3KBX A;  1MSH A;  2F0K A;  4XT1 B;  1SYF A;  4OHJ A;  2NTS A;  2EYJ A;  5I2Y A;  2F0P A;  2EDG A;  4WFN 3;  3URY A;  1PTO B;  1FNW A;  2KHS A;  5M5W B;  2EY5 A;  4L6T B;  2CHB D;  3D6C A;  5C4Z A;  1CHQ D;  4A3E B;  3I4N B;  1S5D D;  2IW3 A;  5IGE A;  2GA4 B;  2DN8 A;  3TBI B;  4HSP A;  1JQY D;  3P7J A;  2FJ2 A;  3MA2 B;  1TWF B;  4CBV A;  2TMP A;  4RGO S;  4ZRZ A;  3TZU A;  1CQF A;  1LLR D;  3BDL A;  3MEH A;  1W6J A;  1HHV A;  1U4L A;  4DXF A;  5IIF A;  2K03 A;  1O80 A;  3BVZ A;  1HUM A;  4WRD A;  2AUJ D;  1MGS A;  3HEJ A;  3GTQ B;  3H3V C;  1Z6H A;  2KA7 A;  2B39 A;  1LTR D;  1ILP A;  5T1G A;  5I2X A;  1LT5 D;  2XIW A;  3TDQ A;  1WVL A;  4IUP A;  4FXD A;  3AB9 A;  2K01 A;  1WTR A;  3MXU A;  1TKW B;  3FMC A;  2O5J C;  1ENC A;  3I4M B;  5LL6 S;  3MTS A;  3E0J A;  1JOQ A;  1GJX A;  3BZD B;  3V2T A;  2V4D A;  1QOH A;  5ELF A;  1Y8P B;  4FXK C;  1GXD C;  1XYI A;  3CHB D;  3DM1 A;  1JWS D;  3BVM A;  4XT3 B;  3BYT B;  5EBC A;  1DOK A;  5CBA E;  4HMJ A;  5KNB A;  1ZXT A;  1AZP A;  3HOZ B;  5LHY 1;  1BUV T;  1HTL D;  2JA5 B;  1WTW A;  2YYZ A;  1SBB B;  1J8I A;  3D31 A;  4HCS A;  2B2Y A;  1PRT D;  3NWS A;  5COY A;  4KKT A;  1F2Y A;  1GUW A;  3TP7 A;  2Z8L A;  1TS2 A;  1KDA A;  3FPU B;  5BN4 A;  1H9S A;  2B2W A;  1FR3 A;  2XN9 C;  4C1N I;  2O5I C;  4ZKB B;  2KQ3 A;  3I73 A;  4CKE A;  4KJO A;  1FNU A;  3A54 A;  3NBH A;  5CR3 A;  3N52 A;  1G29 1;  2B8G A;  5ISR A;  3U9S A;  1DYQ A;  3GTP B;  4DN4 M;  2CVR A;  1XTC D;  2EE1 A;  1SNQ A;  3MXG A;  3QB3 A;  5M5Y B;  4QF4 A;  1LV9 A;  4RCN A;  1OXU A;  3A55 A;  4ABN A;  5IGB A;  1HFN A;  2F4I A;  3HOW B;  2XWJ B;  1TWA B;  3J80 L;  3AU7 A;  2VUM B;  4R8I A;  1EY5 A;  4QUF A;  3MXP A;  1Q1B A;  1TY0 A;  4DK0 A;  2KED A;  2Z4H A;  2X6L A;  2R7Z B;  3A8I E;  1PTO C;  3I90 A;  2RVL A;  1SSO A;  4HMI A;  2SNS A;  4F7X A;  4K6L A;  1G8Z D;  2RA4 A;  3QWN A;  2EY6 A;  5TSS A;  1OXV A;  1OXT A;  2E76 C;  1XX8 A;  1GUT A;  4RGT A;  1ENF A;  4J6H A;  3OOC A;  3S16 B;  1R4Q B;  1KLU D;  4IZ8 A;  1AZQ A;  2L12 A;  2M9V A;  4PMW A;  5E1F A;  3G7L A;  4S3S A;  3M7G A;  5C0X I;  5IT9 E;  1SYC A;  2X69 A;  1TQO A;  2MJ8 A;  2WAC A;  5LL6 X;  2BA1 A;  3SHL A;  3C1E A;  4P2C B;  2L11 A;  1C4Q A;  5CV9 A;  2R6G A;  3MHB A;  3K5L A;  5HGT A;  2MPM A;  1Q12 A;  1EY8 A;  1F2Z A;  3FVQ A;  1F77 A;  4ID6 A;  1SDF A;  3K59 A;  1SYG A;  5IGC A;  2AWO A;  1A3T A;  3SXH A;  2I46 A;  2RSN A;  2L9H A;  3GTM B;  1AN8 A;  1AFP A;  2N88 A;  1PXU A;  3K5O A;  4RAU C;  1L0Y B;  3X3N A;  1VF7 A;  4XIG S;  1Y8N B;  3VR4 A;  3QOJ A;  1TT2 A;  4JK1 C;  1B53 A;  3NPP A;  3FPP A;  4KKU A;  2ZXR A;  5EGT A;  1TWG B;  4IFD J;  2K04 A;  1STE A;  4CJ1 B;  2NN6 G;  2IX1 A;  2TSS A;  1HQR D;  1R4P B;  2MGS A;  1VMP A;  2EXZ A;  2K05 A;  2VXW A;  3GQB A;  1ET6 A;  1EZ6 A;  2VNU D;  3TZD A;  3IL8 A;  1LTS D;  1PTO F;  2A6E D;  1EOT A;  5C0X G;  3QJY A;  3VYS A;  1BCP C;  4U68 A;  3K7A B;  1YNN D;  1JWU D;  2C9O A;  1GUS A;  2F0D A;  3I72 A;  2NVX B;  5KEE A;  2D9U A;  3T16 A;  5CV5 A;  1PZI D;  5FO7 B;  5BN5 A;  3MC0 B;  2JEB I;  2KVM A;  1E2W A;  2NVT B;  1HRJ A;  4K6D A;  2A74 C;  2N55 A;  4HSV A;  4DK1 A;  2XSC A;  2E2I B;  1A2U A;  1O7Y A;  3NXW A;  2E74 C;  2BE5 D;  1J9O A;  1CZW A;  3C2P A;  1XXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...