1N32L

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n32L00
1N36L 2V1CC 1LTLA 2HIXA 4X6AH 1KXLA 5ELOA 3CCQA 3PUWA 4GOPC 4LFAQ 1YITA 2KCMA 4LF7L 4QGUA 4A3JG 3NENA 4MTNA 1W2BA 1XNRQ 3RN2A 1HNWL 4LW1A 3ICEA 4R4TA 2IHFA 4YHHQ 3I4MG 3ZJYC 3CP0A 5JJLA 1X3FA 1KC8C 3GDEA 1KL9A 1VQ9A 1A63A 1WJJA 4DAYB 2UUBL 2E2HH 3ULLA 2VW9A 1C0AA 1PYSB 2R7ZG 5LMNL 4WJ4A 5AJ3L 1GO3E 3GO5A 1VQKA 3S1MH 2OQ0A 1TWGH 1EQRA 1J5EL 3PCOB 3CCVA 5M3FG 4A3KG 1Q46A 5FJ8G 4A3CH 3F2CA 3CXCA 2Z6KC 1IYJB 1GKHA 5M3MG 4UY8C 2HIVA 3AFQA 1TWFH 1SRUA 2AWNA 4IPDA 3GTJH 1XNRL 1N32Q 1Y1WG 1MKHA 4YHHL 4B3RQ 2Q2TA 4JOIC 3HOVH 4HIKA 1E1OA 4BY7G 2MNAA 2QA4A 4A3EG 4YY3Q 1VQGA 4QIWE 3JAMi 1N33L 4AYBG 3UE1A 4GNXA 3FP9A 1PA6A 2F52A 3AFPA 4B3SL 4A3LG 3M4PA 5IWAQ 3M85A 1HNXQ 4PMWA 4A76A 1A0IA 1QVGA 4IPGA 2B63H 3M4QA 4A4IA 2A8VA 1X9NA 2F3IA 2CKZB 1P16A 5JEAJ 4UPAA 2ZJPA 1PYBA 3FHWA 2NN6G 1UWVA 4DR6Q 2XGTA 1VQ6A 3S1NH 1EIYB 1VQHA 5JJKA 1V43A 5HGQA 1X55A 3OTOQ 3J80c 1R9TH 1A8VA 1N32L 1HR0Q 4JI0Q 4B3RL 1N8RC 3DM3A 4DV7Q 2R7FA 4IJHA 3F8TA 4BY7H 5IYDH 1XMQQ 1NJIC 1X56A 3IRBA 4YY3L 4MZ9A 2JA8G 3E9HA 3J81c 3GTQH 3HOUH 2K5NA 1P8LA 4DK3C 2K4KA 1NTGA 4DV1Q 5IWAL 3S24A 3GTKH 3A0JA 3CPFA 1HNXL 4DV5Q 4DPGA 1NMGA 2EIFA 4BA1I 4GLXA 4XTCS 4A3CG 1UE1A 2KHIA 4P74A 2ASBA 1AH9A 3TREA 1X54A 2JA6H 4DR6L 3AYHB 3KDFB 4RMFA 4A3MH 5C4XH 3H0GG 1PH6A 4QQBX 4GS3A 1L1OC 1YJ9A 1SMXA 2CWAA 3OTOL 4JV5Q 1O7IA 3S2DH 3HOVG 3RR5A 4ME3A 4DV7L 2YTVA 1GD7A 1NBWA 3L7ZC 1XMQL 3CC2A 3S1QH 3KFUA 2D0PA 1KRSA 1MJCA 2YV5A 3KF6A 1VCIA 1YHBA 4GLAC 5C0XI 4L5RC 4QL5A 2BH2A 3RLFA 2NVQH 4UP7A 4DV1L 2D0OA 4DV3Q 1IBKQ 2CWPA 2GVAA 3PSIA 4H02A 4DV5L 1YBYA 1IBMQ 1VQ4A 3G6EA 4LF4Q 1Q1EA 2NVTH 1VQNA 1OXXK 1U0LA 3LGJA 2OCEA 4OWXB 3KJPA 4IPHA 2MFIA 2XTIA 4GN5A 4C3JH 1HZCA 1WYDA 5M3MH 5C3EH 2WP8J 4HJ7A 1YJNA 3MXNB 1KIXA 4KHPQ 1GVPA 4X65Q 1NY4A 2R6GA 3K0XA 1YEZA 3H3VH 1YZ6A 3GTMH 3HOUG 4LNQA 1X6OA 4HJ8A 3NEMA 1YVCA 3PIPA 1QUQA 5IP9H 2NZHA 3CCEA 3ULPA 1SFOH 1VQCA 1AE3A 1DGSA 4R4OA 4DV3L 1IBKL 5JJIA 1L1OB 2IX0A 2K5VA 2Q2UA 1A62A 1IBML 1PH4A 1TWCH 3M3YH 1SN8A 5M5YH 4NXNQ 2PNHA 4LF4L 2JA6G 1VS0A 4GNXB 2JA7H 3M7NA 4A3MG 5C4XG 3G48A 3GD7A 1S72A 1IBLQ 1KQSA 4JI7Q 4LF8Q 1I94Q 4X64Q 1EIFA 4TVAB 1I5FA 4KHPL 2EXDA 5M5WH 1VQ5A 1Y1VH 2VY3A 4X65L 4A3IH 4GN3B 3CC4A 1Y14B 2AKWB 1YI2A 1BKBA 2JJQA 4O2DA 1EYGA 3S17H 4AIMA 2K14A 3D31A 4K0KQ 1HH2P 2RHQB 2A19A 3BZCA 3E0EA 3ER0A 4HJAA 1GM5A 2JA8H 4BA2I 1E22A 1CKNA 1PFSA 1XJVA 4Y52H 3K8AA 4R1JA 3TEHB 3CCSA 3J81j 4DUYQ 4BXXH 1L0WA 2HHHQ 4NXNL 1XPOA 3GTOH 2OQKA 1Q7YC 4A3DG 5IYCH 2HT1A 4GN4B 1N33Q 3HOWG 3FKIG 5C3EG 2VL6A 1YIJA 1IBLL 4X64L 2E5LQ 4LF8L 3STBC 1PH9A 4LFAL 2YYZA 3K7AH 2QGQA 3H0GH 1EUJA 1VQJA 4IPCA 1XTDA 3RN5A 2NN6I 4NXMQ 3PUYA 1W3SA 4JI6Q 4C3HH 3I2ZA 1N34Q 4PZ6A 3U58A 1XMOQ 2JA9A 5IP7H 1PH8A 5IP9G 4K0KL 4OX9Q 1HZBA 4C3IH 3KOJA 2I5HA 1D8LA 5FLMH 2ALYB 4L5QA 4DUYL 1FL0A 1J6QA 2JA5G 3PO3H 4OO1G 4IFDG 2HHHL 2JA7G 3UDXA 5LMNW 1I3QH 4O0AA 2LXJA 2K50A 4JBJA 3W1BA 4DV0Q 4IOAA 1JE5A 2N78A 3EN2A 2MO0A 1IXRA 1PV4A 3A74A 3S1RH 2E5LL 4JI5Q 1Y1VG 1OTCA 3PF4A 4A3IG 2ES2A 3GTLH 5J3BA 1HZ9A 4A3BH 3L2PA 1OXTA 2KHJA 1EWIA 1SE8A 4JG2A 4YCWA 2ZJRA 2I0QA 4NXML 2ZTEA 2F4VQ 2ZTCA 1K0RA 4DR3Q 1N34L 3M4OH 4OWTB 1E3PA 3K7UC 2JQOA 1TXYA 3PUVA 1XMOL 1VQ8A 1QVCA 4OX9L 1FGUA 1E1TA 3F1ZA 1KRTA 5GQOA 4DV6Q 1K8AC 4GKJQ 5E7NA 4A93H 2DUDA 2VQEQ 3CQZH 4QY7A 4LUZA 2PQAA 1L2FA 2Q2HA 4EQ5A 2KBNA 3U4VA 2UUAQ 4HJ9A 1HZAA 4FDBA 3S2HH 3PIOA 1QUQB 4DV0L 5IYCG 2GVBA 2AMCB 2VS1A 2UUCQ 1UE5A 4LF5Q 4B3MQ 2B29A 3G71A 4JI5L 4JCVE 1VQLA 1QZGA 2GN5A 2ATWA 3RZOH 2HQLA 2VNUD 4EX5A 4TQUS 3HOWH 3DLLA 4JV5L 1HR0L 4BXXG 1MIUA 1B8AA 4P75A 2DGYA 4R4QA 3U50C 4HIOA 3T1YQ 1PH7A 4GNXC 5IP7G 1OXSC 5GAGC 4DR1Q 4DR3L 1Q82C 4DV2Q 2UXDL 5FLMG 4DV6L 4GKJL 2VQEL 4JYAQ 3JC66 2I5LX 1JMCA 2Y0SG 3PO3G 2UUAL 3SGIA 4DK6C 2N3SA 5BR8Q 5ELNA 3CMEA 1EQQA 4L5TA 1MJEA 2LXKA 2Z0SA 1QZHA 2CFMA 5IYBH 2UUCL 2NZOA 4LF5L 3AQQA 3OW2A 2MQHA 4B3ML 2R93H 2AHOB 1KHIA 3MEFA 1VQAA 3HOXG 3RNUA 1K3RA 4A3BG 4A3DH 4JI2Q 2AWOA 4IJLA 4HIMA 3FKIH 1YJWA 1PH5A 3BU2A 4GOPA 1K8GA 3JAMc 2ZJQA 4JI3Q 4A3FH 1Z9FA 1N9WA 3T1YL 2B3GA 1VQOA 3CCUA 4DR1L 3J7A5 1UE7A 2N8NA 3CCJA 3PUZA 4DV2L 4DV4Q 4A93G 1JT8A 1BBUA 2FXQA 2JE6I 2RCNA 1RL2A 1X65A 3K80C 1G6PA 1G291 1OXUA 3TQYA 1VQFA 1WOCA 1HJPA 2UXBQ 3RLNA 5BR8L 1WFQA 2R92G 1JJGA 3KJOA 1IL2A 1ASZA 2JA5H 3GTPH 1CSPA 4YWKA 4PG3A 4YWMA 1KAWA 1XPUA 2WFWA 3HKZG 3TS0A 1VQ7A 3EIVA 3J7ZC 4HJ5A 3NBHB 1K9MC 1PVOA 4QJFA 2LSSA 1PH1A 2Z6KA 4AQYQ 4BBRH 1X3EA 3T1HQ 4JI2L 2JEAI 3KF8B 5C0XG 3S14H 4DAMA 1LYLA 1VQIA 3M9BA 2CQOA 4JI3L 3CF5A 2NVXH 3A5ZB 3ERSX 3S15H 1UE6A 4KHZA 4JI4L 3J80i 1HNZQ 1U5KA 4JOIA 4DV4L 3H3VI 2RF4A 2EQSA 2YTXA 1YNXA 4JBKA 1NMFA 4KI0A 4KLKA 5C4JH 4IFDJ 2UXBL 1WCMH 2BH8A 3J81i 4DR2Q 3U4ZA 1LM0A 1M90C 4JI4Q 2OTJA 2BA1A 5IYBG 3D0FA 1C7YA 5GAHC 4JI1Q 2R93G 1E7ZA 5FLXc 1VQMA 3CMAA 3BZKA 4GKKQ 2PQAB 1K83H 4P72A 4APVA 1K73C 4OO1I 4NB3A 4JI7L 3TS2A 1LUZA 1I94L 4AQYL 1XNQQ 2UU9Q 3T1HL 2N49A 3PF5A 4IFDI 3HOZH 2RHSB 1PH2A 4NPSA 4A3FG 3EBEA 3F2DA 1QVFA 4JC0A 1SLJA 2R7DA 4OWWB 3BJUA 1BVSA 2PI2E 2NVYH 4A75A 3CCLA 3L0OA 4R4IA 4X62Q 1HNZL 3W1GA 4B3TQ 4DKAC 2YTYA 3HOYH 4YCUA 1SROA 4JI0L 1Q81C 4B3SQ 4LFBQ 4X66Q 5GAEC 2BA0A 4WJ3M 1EFWA 5HY6A 2VQFQ 3PV0A 3CCMA 4DR2L 1WI5A 2Y0SE 4PZ7A 1B70B 1C9OA 3K81C 4YWLA 3UE0A 3RZDH 3HFZB 1KD1C 3Q8DA 1OXVA 4LUVA 3ULJA 3NELA 3KF6B 4JI1L 4BBSH 3E9IA 4LUOA 2VZAA 4GKKL 2IY5B 1NE3A 4BBRG 1S40A 4IOCA 1CSQA 1XNQL 2ZM6Q 2UU9L 1AE2A 4LF6Q 3HOXH 2E2JH 3F2BA 5LMUQ 2I5MX 4C2MH 1L1OA 1FVIA 3PUXA 3CPWA 3CC7A 5C44H 4JI6L 2ID0A 5IE8A 4B3TL 1JJ2A 4X62L 5K36G 4LFBL 2Q2IA 3RLOA 3WWVA 4X66L 4GOPB 4LFCQ 4OXPA 3CCRA 4LF9Q 1WCMG 2VQFL 2JEBI 4P73A 3TRZA 2F4VL 1VQPA 4DNIA 4JI8Q 1S3OA 4DUZQ 2R92H 4RG1A 4BY1H 1V1QA 4HIDA 3KLWA 3B6YA 3HKZE 2KENA 3A5UA 2H5XA 3I56A 4AH6A 3HOZG 3I7FA 1TWHH 2ZM6L 4LF6L 1T9HA 4J15A 5LMUL 4POGA 2WB1E 3G4SA 1H95A 4POFA 2IHEA 2L15A 1ASYA 1V9PA 3HOYG 2WAQE 1CUKA 2VUMH 3STBD 2C35B 2JK8A 1VQDA 1YHAA 4A3GH 3I4NH 1B7YB 1PHJA 3CD6A 4DR7Q 4P71A 4LFCL 1I50H 2UXCQ 2ZTDA 4LF9L 5M5XH 1YHQA 5H1SE 1M1KC 3UDIA 4JBMA 4JI8L 4IO9A 4OONA 4BBSG 4MNOA 2E8GA 1EOVA 3HKSA 5IY0A 4DUZL 1PH3A 2PMZE 1FJGQ 3PO2H 3S16H 2K5HA 5JEAG 1CKNB 1IZ6A 5C0XJ 2D62A 4Y7NH 1Q86C 4A3JH 3KYHC 4R4CA 1SR3A 1D7QA 5C44G 4DR4Q 4DR5Q 3I4MH 2YU9H 1Q12A 3CW2C 3I55A 5DLQE 1I6HH 2A1AA 2KCTA 1JJCB 4DR7L 3UDFA 4JBWA 2UXCL 1HR0W 2B63G 2R7ZH 4UP9A 5GROA 1TWAH 3PGZA 2K75A 3OYYA 1G51A 5EAYA 1UEBA 4BY1G 4JYAL 5M3FH 4GLVB 4A3KH 1FJGL 5FJ8H 1N36Q 4L5SA 1Q8KA 5IT9c 2OWOA 4YCVA 4UP8A 4LF7Q 1E24A 2K52A 3UDGA 1HNWQ 2IX1A 1X3GA 2IT1A 1RIPA 1JB7A 2OTLA 1CKOA 1CKMA 1VQBA 2WB1G 5IYDG 1Y1WH 1XPRA 3GTGH 4DR4L 2WAQG 1Q1BA 4DR5L 2E2IH 3AEVA 1BBWA 2VUMG 2MO1A 4A3GG 5GADC 1VQEA 4A3EH 4LWCA 3VDYA 2UUBQ 4PZ8A 2CCZA 3H15A 3I4NG 5LMNQ 5AJ3Q 4AYBE 2QEXA 3W5OA 3I4OA 3KDFA 4A3LH 1Z47A 1J5EQ 4XIGS 2UXDQ 3PO2G 3CAMA 4ALPA 2PI2A
chains in the Genus database with same CATH superfamily
2VXWA 4X6AH 3A56A 1AW7A 2NN6H 1EY5A 3NENA 1XNRQ 1W2BA 3RN2A 2NBFA 2KECA 2IHFA 3I4MG 1TS5A 4K2LA 4EVOA 1PDQA 4RH6A 2DJGC 1A63A 1YNND 1C0AA 3I70A 1PRTF 5AJ3L 3S1MH 3KK7A 3Q0AA 3OIPA 3MXNA 2HQEA 3CCVA 1WTOA 2CW0D 1Q46A 5KYIA 5FJ8G 5M3FB 4F8MA 2Z6KC 4C3JG 1GKHA 4PV1C 3D6WA 4UY8C 1TWFH 3NWTA 5EKKA 1GXDC 3KLRA 3GTMB 1O7LA 2Q8RE 2Q2TA 2RBMA 4BY7G 3GQBA 1MI2A 1C48A 1SJHD 3JAMi 3FP9A 1T5EA 4ZYSA 1G2SA 1RD9D 4XXEA 4A4IA 3MZ5A 3VR5A 3BZDB 4OGQC 1PFNA 2ZJPA 1RODA 1JR0D 1STBA 4U673 1A8VA 1O7ZA 2DNCA 4Q5VA 1WTPA 1N8RC 2A68D 3DM3A 4DV7Q 1PZKD 1XMQQ 1X56A 2MP1A 4MZ9A 4YY3L 3GTQH 5C4ZA 2JA8B 2K5NA 4N9TA 5C5MA 5KYLA 1BCPF 4IZ8A 4DV1Q 5IWAL 3S24A 3CPFA 1F9SA 3OIQA 1NMGA 2EIFA 4XTCS 2KHIA 4RKLA 2ASBA 4FYDA 1B3QA 2G9DA 5G3LD 5C4XH 3K7AB 3H0GB 1YJ9A 1FGBD 1JORA 1BR9A 3HOVG 3AU7A 3T13A 1NBWA 3FPUB 1GUSA 1MJCA 3KF6A 5TSSA 4GLAC 3KBGA 1SMYC 1AN8A 1IL8A 3E3XA 5JPNC 4DV3Q 1IBKQ 1LLRD 2F0UA 2PZTA 4IUTA 1KDAA 1OXXK 3LGJA 2A6EC 2Z4IA 2XTIA 3LWEA 4HJ7A 5C3EH 1YJNA 3MXNB 4KK7A 1ONLA 2R6GA 4K5XA 2F0NA 3GTMH 3ITPA 3HOUB 2AQ2B 2MHVA 1Q90A 4HJ8A 4FXGC 3A8IE 5J1ZA 3SVMA 4ME5A 2IX0A 2K5VA 1PH4A 1TWCH 3M3YH 3U9SA 2JA6G 1VS0A 4J8QA 2JA7H 3D8GA 4EQPA 1HHVA 3G48A 3GD7A 1CZGA 1IBLQ 4JI7Q 4X64Q 4KHPL 1G8ZD 1VQ5A 1LT4D 2J0TD 1XWEA 5IGCA 2JJQA 3S17H 4K0KQ 3E0EA 2A19A 2JA8H 5FLXL 1EEFD 3J81j 5FLXE 1L0WA 2HHHQ 4J6HA 2NVTB 1XPOA 2OQKA 1SNQA 1NUCA 4A3DG 1PRTD 1I4GA 4GN4B 4CJ2C 3HOWB 3FKIB 3STBC 3P75A 1B3AA 3K7AH 1L0XB 3H0GH 1VQJA 5FO7B 1XTDA 3RN5A 4JI6Q 2MUYA 1MSGA 1NR2A 5IP7H 3BYYB 4OX9Q 1LTRD 4C3IH 4HAEA 2I5HA 1D8LA 2F3VA 2IX3A 2ALYB 3NE5B 3GV3A 4DK0A 1FL0A 1J6QA 2OT2A 2F0WA 3HEJA 3KF8A 5ELFA 3VA7A 1TR5A 2KEEA 1JE5A 1PTOH 1N33L 5DNFA 4A3IG 2LFNA 1HZ9A 5IGEA 3L2PA 1OXTA 4NXML 1K0RA 2N88A 2QDBA 4DR3Q 4S3SA 3M4OH 4OWTB 1PTOC 1RHPA 4BWGB 2JQOA 1XMOL 1VQ8A 2UXDQ 1QVCA 5GQOA 1VDZA 4DXGA 2DUDA 2VQEQ 3CQZH 3T4AC 2Q2HA 4EQ5A 4KKSA 1EY6A 4DV0L 5IYCG 1E2ZA 2AMCB 4ZKCB 4MIUA 1BDOA 1HXYD 1HUNA 3MWYW 1QZGA 2GN5A 2HQLA 4KTAA 4TQUS 4DN4M 4JV5L 4P75A 3SR1A 2PQEA 4DV6L 2Y0SG 3PO3G 1FR3A 1CQFA 2KEDA 3CMEA 1W6JA 1EYDA 3IAYA 1MJEA 1JICA 1SJED 2Z0SA 5IYBH 2UUCL 3OW2A 2MQHA 3OWEB 5D14A 3EA6A 3S1RB 4DAVA 4JI2Q 4A3BB 3QOLA 1YNNC 3FKIH 1A2UA 3BU2A 4GOPA 3NK9A 2ZJQA 2F1MA 2XWJB 4JI3Q 1G91A 3T1YL 1JOOA 2CW0C 1BBUA 2FXQA 4A93B 2JE6I 1Y8NB 2A6HC 1A15A 5EKIA 1TY0A 4DXFA 3TS0A 3V96A 1U4LA 4BBRH 1X3EA 2JEAI 3KF8B 3K5MA 2WB1B 3CF5A 1LT6D 4DK1A 3A5ZB 2WAQB 4CDEC 4HEDA 2X6LA 1HNZQ 1JC7A 5CV6A 3H3VI 5CBAE 2YTXA 4KI0A 3P1HA 5COYA 1ESRA 1I4QA 3KUPA 5CYUA 2K5WA 1KDCA 3A8KE 3V2TA 2PMZB 4H0LC 3QJYA 2R93B 2A68C 4C56C 1EWCA 4JI7L 4FO2A 4IFDI 1PZID 3T1HL 2RHSB 1PH2A 4FF4A 4NPSA 4A3FG 3F2DA 2AUKA 2FMCA 3QR8A 4B3TQ 4BXXH 3DMUA 4R4IA 2PW7A 4X62Q 3HOYH 4YCUA 4X66Q 1SAPA 2G9HD 5HY6A 1K8MA 5E1FA 4K6DA 3PV0A 5FK9C 3FDTA 3CCMA 4DR2L 2F4VQ 3KFUA 2J4XA 2F0TA 4RGTA 4A3KB 1CZWA 4ZQ3A 3NELA 1TT2A 2EJMA 4ODGA 2IY5B 5JEAH 4BS9A 2ZM6Q 4LF6Q 3WOFA 2I5MX 3FEWX 1L1OA 1FD7D 4JI6L 2ID0A 3D3RA 3L3OC 1JWMD 3RLOA 2NTSA 3TZUA 4GOPB 4FVMA 4KJOA 4OXPA 2VQFL 2JEBI 4P73A 4FF2A 1HTPA 1NR4A 1WVLA 1ICWA 1J8IA 2MJ8A 4RG1A 4Z9CB 1V1QA 4MHEA 4LMQD 5KEEA 4HIDA 4QMGA 5KRUA 2KENA 3I7FA 1TWHH 4ZUIA 5LMUL 2K1BA 1ASYA 1CUKA 4DAPA 2JK8A 1YHAA 4X3TA 3LX0A 1B7YB 1PHJA 3CD6A 1I50H 5DAUA 2UXCQ 2ZTDA 3K5OA 1YHQA 3UDIA 4HCSA 3EVQA 4OONA 1JOQA 4MNOA 3HKSA 1EOVA 4DUZL 1PH3A 4C1NK 1ZEQX 4O42A 3GTJB 1CKNB 1IZ6A 3TP5A 2K05A 2J7ZA 4I7AA 4JVZA 1B1ZA 5C44G 2B2VC 4HN7A 1C8CA 1QOHA 5DLQE 1I6HH 1V1PA 3GV6A 2KCTA 3MXGA 1G6ZA 4ZK9B 2R7ZH 3RUZA 2B63B 5IT9L 2F0GA 4O1NA 3OYYA 1G51A 5IT9E 3VYSA 5ELDA 4JYAL 4A3KH 1CHQD 3NQTA 4BY1B 1FJGL 1BUVT 5IT9c 4YCVA 1V8QA 2K52A 2IX1A 1RIPA 2OTLA 1EFID 1E2VA 1VQBA 2EXZA 4ZCKA 1Y1WH 2E2IH 4DR5L 1BBWA 2Z6BA 2VUMB 5GADC 1VQEA 3I4NB 3D4DA 4P2CB 5AJ3Q 2DNEA 2QEXA 4WRDA 1Z47A 2ZT9C 4ZKBB 4RA8A 3PO2B 3I3CA 4A3MB 3K58A 2HIXA 1Y8OB 5ELOA 4GOPC 2K04A 1YITA 5FO8B 2RA4A 4QGUA 4CDFC 4A3JB 4R4TA 3NHHA 1V1OA 1TU2B 3FVQA 3ZJYC 5JJLA 1I4PA 4IUQA 1KC8C 3GDEA 3NXWA 3SK8A 1S5ED 2E2HH 2NVQB 4XT1B 4WJ4A 4ABNA 3WDNA 2OQ0A 1J5EL 3PCOB 1I4RA 5M3FG 4EGVA 1RKNA 2HIVA 3AFQA 1SRUA 3CU7A 2AWNA 3QWNA 3GTJH 4MN3A 1BO0A 4YHHL 4FXKC 4HIKA 2MNAA 4A3EG 4YY3Q 1VQGA 4QIWE 2K01A 3UE1A 4DNRB 2F52A 4A3LG 3TN2A 3M4PA 5IWAQ 3PIO3 2M2LA 2B63H 1A0IA 1QVGA 4IPGA 5M5YB 4IUVA 3M4QA 1X9NA 3J80L 2CKZB 1P16A 1SYFA 1V1PB 4UPAA 2BOSA 3UI2A 3FHWA 3DEOA 2XGTA 2IWHA 1VQHA 5HGQA 4ZRZA 3X3MA 3MXPA 3J80c 3MVVA 1R9TH 1N32L 4HR7B 5E4WC 1A2TA 4GZYC 1LTID 3OWFA 3IRBA 2JA8G 3SDZA 2SNSA 1P8LA 2K4KA 3GTKH 3A0JA 2HCCA 1HNXL 2L4NA 4A3CG 4HCEA 1UE1A 1AH9A 4KN7C 1BBXC 3TREA 4DR6L 1TWFB 4CBVA 4RMFA 4A3MH 3H0GG 1L1OC 1KNAA 1T5XD 3OTOL 3P20A 2WKCA 4C3HB 3MXUA 1EU3A 5LHY1 1GD7A 1TY2A 2D0PA 1KRSA 1CA6A 3J7AF 3SEBA 2NVQH 2B2WA 3S16B 2GVAA 3E5SA 1I3QB 2NUCA 5IGBA 3G6EA 1VQ4A 1DXMA 1Q1EA 1RDPD 3VA5A 1VQNA 4H13C 1NSNS 2MFIA 2LMCB 2WP8J 4KHPQ 3N6RA 1CQVA 1KNEA 2WIIB 1WTVA 1WD1A 4KKTA 1NY4A 3H3VH 3HOUG 1LT3D 3GTQB 3I8ZA 1X6OA 2IJ0A 3NEMA 1GJXA 5IP9H 3CCEA 1CM9A 1CK1A 2DY8A 4B08A 1DGSA 5JJIA 3H3VC 5E3FA 3MC0B 1A62A 1ET6A 3U9OA 1JB3A 1SYEA 5M5YH 4LF4L 4IFDH 5M9OA 5D3IB 1VMCA 4QUFA 3LNNA 1U4MA 1IYUA 1S72A 1KQSA 5C4XB 1I94Q 5CMDA 1EIFA 2EXDA 1II3A 1Y1VH 4X65L 4WFN3 2EOTA 1Y14B 1SNOA 3TSSA 4O2DA 1F9QA 4AIMA 1ZXTA 2K14A 3D31A 1HH2P 3ER0A 3BZCA 4HJAA 5ELEA 1E22A 1XJVA 4R1JA 1A3VA 3TEHB 4NXNL 1SE4A 3SK5A 1CA5A 3HOWG 1N33Q 3FKIG 2EYJA 1YIJA 5C3EB 2F0DA 4FP5D 2YYZA 2QGQA 1EUJA 4NXMQ 1H9JA 1W3SA 2RQXA 5D65A 4C3HH 1TS2A 1XMOQ 2KA7A 4G7HC 5FLMH 3CKIB 1M8AA 5A35A 1ML0D 2L9HA 4DUYL 4OO1G 5LL6X 1TWCB 3M3YB 2JP1A 1I3QH 2JA7B 3VR6A 4DV0Q 1SBBB 2QDLA 3EN2A 5HURA 3A74A 5ELCA 2E5LL 3PF4A 5CORA 2O4XA 1Q8IA 1BXTA 3H94A 4JV5Q 2WV6D 4CJ1B 4YCWA 3S17B 1N34L 2VNUD 1HA5A 3F2UA 1KRTA 4DV6Q 2K28A 5E4XA 5E7NA 2E2DC 4DA2A 1BQQT 4PQXA 1RCVD 4QY7A 4LUZA 3MFGA 3C46A 2PQAA 1EY4A 3NWSA 1DOMA 2AQ3B 2UUCQ 3FMCA 1UE5A 3G71A 4JI5L 1VQLA 3NTKA 2PW5A 4IQZA 2D2CC 5IGFA 4L6TB 4QCLA 4CKBA 4BXXG 1B8AA 4HIOA 3T1YQ 1BNZA 4N8FA 3HS0C 4GKJL 4C3IB 1ZYRD 2G5DA 3Q22A 1SYCA 4I7ZC 3C2PA 2UUAL 3SGIA 4DK6C 5ELNA 1EQQA 2LXKA 2CFMA 2R3ZA 1NCVA 3AQQA 4B3ML 1PTOB 1BOSA 2AHOB 2RCFA 1H9RA 3MEFA 1I4XA 1VQAA 3E6ZX 1K3RA 4A3BG 3HOXB 2AWOA 4IJLA 1IKMA 2F0HA 4HIMA 1Z9FA 3M4OB 3M4YA 2B3GA 2ZXOA 3CCUA 1ENFA 1HPCA 4DR1L 2N8NA 3CCJA 3PUZA 4DV2L 4A93G 2HCIA 1H9SA 1RL2A 1X65A 2EY6A 2F0JA 3CQZB 1G291 1OXUA 1VQFA 3RLNA 5BR8L 4FF1A 3N52A 1IL2A 3PQIA 1B9NA 3QOJA 4YWMA 3VR2A 4UDUC 2CH4A 3J7ZC 2QILA 3T1HQ 1EWHA 4DAMA 4K8IA 4K14A 3EJIA 3S15H 2CHBD 4A3GB 4KHZA 3C3LA 3J80i 4JOIA 2B2WC 4OIJA 4DV4L 3OMCA 2XIWA 2Z4HA 2EQSA 4ZUJA 2P5ZX 2KCCA 1NMFA 2UXBL 1WCMH 4DR2Q 1LM0A 1LV9A 4RGNA 2PNRC 2R93G 1LTBD 5FLXc 4JK1C 4IUNA 2PQAB 5D3DA 4P72A 1K73C 2EDGA 1I94L 2N49A 5LL6S 3HOZH 3X3NA 1QVFA 2NVYH 4G57A 4B3SQ 1X32A 1PLFA 1FNWA 3H91A 1LTSD 2VQFQ 4DU9A 1KD1C 5CC4A 2RSNA 3K81C 3UE0A 4R8NA 3NQIA 3RZDH 1STGA 4JI1L 3KF6B 4LUOA 3K6OA 1NE3A 4IOCA 4BBRB 1XNQL 1STHA 3HOXH 2E2JH 4G7OC 5LMUQ 4C2MH 3EFXD 3CPWA 5K36G 3J7AV 5ELBA 4LFBL 3WWVA 2F0VA 2IW3A 4XT3B 1SNDA 5FKAC 4LK1C 2A5HA 1VQPA 1WTHA 2WINB 1S3OA 2B2UA 4DUZQ 1H9SB 3BVMA 1Z7TA 3HKZE 3J81L 1NNXA 3IKJA 1BCPD 2H5XA 3I56A 3QIAA 3J81E 4POFA 2IHEA 2OEOA 1V9PA 2O5IC 2SNMA 3HOYB 2RKSA 4A3GH 2CQAA 3M7GA 4LFCL 1TWGB 5I4DA 4LF9L 2XVSA 2EY1A 4YIJA 2XRSD 1M1KC 2F4IA 1DOLA 3SE0A 4PMCA 4BBSG 4JYAQ 1FJGQ 2ENBA 1D1IA 2K5HA 4L8JA 4Y7NH 1Q86C 4DGZA 2FINB 4CKCA 3PIP3 4DR5Q 4KD4A 3I4MH 3CW2C 4K5WA 2XSCA 4QIWB 2A1AA 4DR7L 4JBWA 2B63G 4IN3A 3PGZA 4G7ZC 1STYA 5EAYA 4BY1G 1K8OA 4GLVB 3S1NB 5FJ8H 1Q8KA 2OWOA 5CBEE 1TWHB 1X3GA 2EVBA 1U9RA 4RCNA 1IHZA 3GTGH 3OOCA 2HUGA 2I07B 2VUMG 4DR4L 2F0MA 2EPBA 4BY7H 3I4NG 4LWCA 2BE5D 4PZ8A 3MAQA 1I50B 3GP7A 1ESFA 4X3UA 1A3TA 3A54A 1J5EQ 3PO2G 1EQTA 3CAMA 4XQQA 3D0FA 2MGSA 3TMEA 2V1CC 1LTLA 4F87A 1KXLA 2C5CA 4LFAQ 1E0BA 4A3JG 1HNWL 1GUTA 5CV9A 4LW1A 3ICEA 1SNPA 1PRTB 4YHHQ 1SYGA 3CP0A 1X3FA 1MD2D 1VQ9A 1I6HB 1D1KA 5A2QL 3ULLA 5LMNL 2JN4A 2R7ZB 1GO3E 3K5NA 4CDCC 1VQKA 5A2QE 1TWGH 2QF7A 1EQRA 4RAUC 1AP0A 2JYOA 3HZXA 1I4HA 3CXCA 1IYJB 4HSPA 5M3MB 4IPDA 4RWSC 1ZKOA 4RFBA 1N32Q 1Y1WB 1XX8A 2E2IB 4JOIC 3T16A 3HOVH 4X3SA 3BS1A 1SSOA 2EY2A 4AYBG 4GNXA 4M1UB 3Q24A 5EPKA 4B3SL 5K5PA 1IW7D 3M85A 1DCZA 4PMBA 2KHSA 1HNXQ 4PMWA 2F0LA 3I4LA 2A8VA 1PYBA 1QNKA 2NN6G 2EYMA 1LTAD 4DR6Q 1VQ6A 3S1NH 1EIYB 1V43A 4A3IB 2F0FA 2TSSA 3OTOQ 2FHTA 1HR0Q 4B3RL 3Q23A 3TZDA 1U4PA 4M8AA 2R7FA 5IYDH 1NJIC 4B9WA 3E0JA 2E2HB 1JWSD 1QB5D 2B8FA 1TQOA 4CJ0B 1K3BC 4IUUA 4DPGA 1H9KA 4BA1I 4RKBA 3FRPB 3GTOB 5DEHA 5EJWA 1PFBA 2JA6H 1X54A 3I72A 1PH6A 2A69D 4QQBX 5BN4A 1WTXA 1O7IA 3S2DH 5C6AA 3VYUA 1W6KA 4UHVA 1TVXA 3L7ZC 3CC2A 3S1QH 1D2BA 5EBCA 2YV5A 2IPKD 1YHBA 2Z1CA 5C0XI 4OELB 4UP7A 2D0OA 2B39A 2CWPA 1PRTC 4DV5L 2DJFC 2MPMA 2PZWA 3JAML 4LF4Q 3NUCA 4TKOB 1U0LA 2OCEA 3JAME 3CRKC 3S9WA 1F2MA 4KMUC 4GN5A 5M3MH 1KIXA 1R9TB 2K33A 4X65Q 3OHXC 1YEZA 2SOBA 1DM0B 4LNQA 1YVCA 3HGBA 2QEJC 2NZHA 1SFOH 5FOBB 1VQCA 4KY7A 3GTKB 3BVGA 1L1OB 2K6AA 5I2YA 1IYVA 2Q2UA 1EZ8A 1IBML 1RJTA 3MFYA 4NXNQ 2PNHA 1YNJD 4GNXB 5C4XG 5C5LA 5M5WH 4A3IH 2AKWB 2RDFA 3VR4A 1GM5A 1D5XC 1E2WA 3CCSA 4RGMA 4DUYQ 1KAAA 1CHPD 2KCNA 2DY7A 1BCPC 1A3UA 1AFPA 3GTOH 3DWAA 4CGYB 1Q7YC 5BN5A 2E76C 1TKWB 3K59A 1SEBD 1EYAA 5IYCH 2HT1A 3OW7A 1STAA 2VL6A 5C3EG 4LF8L 2E5LQ 3DWPA 4LFAL 4IPCA 4N9PA 2A6ED 3I2ZA 1N34Q 4PZ6A 1WTRA 1PH8A 4L63B 1LTGD 5HGTA 2FMMA 3NBHA 1AZPA 4L5QA 2KUMA 1S5FD 3KBXA 1LTTD 3PO3H 2N55A 2VB3X 2JA5B 2JA7G 3UDXA 3OMGA 2LXJA 4JBJA 2L12A 2N78A 5I2XA 1IXRA 1PV4A 4JI5Q 1KDBA 1OTCA 1Y1VB 3GTLH 2NVXB 2KHJA 4KHVA 1K28A 2B8GA 3WOEA 1E3PA 1AZQA 2WKDA 3PUVA 1TXYA 3R93A 3AMUA 1K8AC 3F1ZA 4GKJQ 1FNVA 1EY8A 1HRJA 1JOKA 5C4JB 2EYFA 1L2FA 2R61A 2UUAQ 1B4OA 4HJ9A 1HCZA 3PIOA 4F7XA 1CTMA 2ZXPA 2VS1A 4B3MQ 1AEXA 4JCVE 4B9XA 4CKEA 2BE5C 2TMPA 1JCKB 3DLLA 1HR0L 2PCFB 4R4QA 1DOKA 3TBIB 4GNXC 5IP7G 5GAGC 4DR1Q 2L0CA 1Q82C 4DV2Q 4C3IG 3NP8A 5G3LF 3VR3A 1KLUD 4IALA 3JC66 2I5LX 2OXPA 1ICFB 2OF1A 1GHJA 5BR8Q 2WACA 1STEA 3QB3A 1QZHA 2NWGA 4LF5L 1H9MA 1WTWA 3HOXG 3RNUA 2XWBB 2V4DA 1K8GA 3T56B 1EIHA 4A3FH 1N9WA 1STNA 2B2YA 3J7A5 3EQLC 4DV4Q 1JT8A 3K80C 4K6LA 4R8IA 1GUOA 3TQYA 1WOCA 2UXBQ 1WFQA 4N8X1 1S5CD 3KJOA 2R92B 5EQ0A 3GTPH 2JA5H 4PG3A 1KAWA 1XPUA 2KOLA 2WFWA 1TIID 1VQ7A 3EIVA 3HKZB 4HJ5A 3NBHB 1PVOA 2LSSA 3O13A 3ERQA 4KD3A 1PH1A 3S14H 1Q3LA 1LYLA 1QJOA 4H44C 2CQOA 2NVXH 1IW7C 3P7JA 1GUWA 3ERSX 1U5KA 2RF4A 3NSWA 4HSVA 1OO9B 3TDQA 3HP3A 1YNXA 1QNUA 1O7YA 5C4JH 3U4ZA 2BA1A 5IYBG 1C7YA 5GAHC 4JI1Q 1E7ZA 1VQMA 4R9WA 4APVA 1K83H 4OO1I 2Q8IB 4NB3A 3TS2A 1LUZA 1XNQQ 4AQYL 4QF4A 2ICEC 2XNAC 3QG1A 2YU9B 3EBEA 2F0SA 4JC0A 1SLJA 1UUPA 1D5MC 1BVSA 4A75A 3CCLA 3L0OA 1QCBD 2HD3A 3W1GA 4LFBQ 1Q81C 5GAEC 1MGSA 1EFWA 3MHBA 3VYTA 2A69C 2Y0SE 4PZ7A 4YWLA 4JI4L 3T53B 4LUVA 1DZ1A 3ULJA 1CT1D 3E9IA 2A6HD 1R4QB 4GKKL 4BBRG 2PPBC 1CSQA 1D5ZC 3BYTB 2UU9L 1AE2A 3DHQA 2KVMA 4V190 3PUXA 5JAVA 3URYA 3S15B 3CC7A 4A3EB 5C44H 1JJ2A 1KLGD 2Q2IA 3H6MA 4LFCQ 1K0SA 4LF9Q 2PYKA 1ET9A 1WCMB 5KNBA 3TRZA 5T1GA 1BF4A 3KLSA 2K5QA 1C4QA 3MA2B 4EQNA 2R92H 3KLWA 2K32A 3B6YA 3A5UA 4DAYA 4EQOA 3HOZB 1T9HA 4J15A 1EY7A 2RSOA 1QG7A 1H95A 5C0XH 2L15A 1TS4A 1CFMA 3HOYG 2NVYB 4FNFA 1KTKA 5I9OA 2AQ1B 2A74C 1YNJC 4JPBW 4DR7Q 5IGDA 4WORA 5CV5A 1EEID 5JVH3 5JVG3 1Z6HA 5M5XH 5H1SE 4KN4C 4JBMA 1ENCA 3RZDB 4JI8L 3ONAB 2E8GA 5IY0A 3S16H 1G2TA 4MTKA 5JEAG 3MTSA 2D62A 1LO5D 2BCOA 2RDHA 2E2JB 1IKLA 4C2MB 1PZJD 1SR3A 3DUZA 4CHTB 1D7QA 4DR4Q 2YU9H 3OSOA 3DM1A 4FF3A 1B9MA 2HDLA 1JJCB 3SK6A 1QE6A 3I90A 1XTCD 5GROA 2LKVA 5I9PA 4NKLA 1DJRD 3ND9A 2K75A 3NTHA 2FFKB 1S5DD 2EYOA 2QW7A 1UEBA 1PMRA 5M3FH 2B2TA 4L5SA 3MEHA 4QUCA 3KLSX 1E24A 1HNWQ 5FO9B 2IT1A 1JB7A 1DD2A 1CKOA 1CKMA 2JXMB 2WB1G 5IYDG 1XPRA 1TS3A 2WAQG 1HFGA 1SYDA 4A3EH 3VDYA 1F77A 5C4HA 2CCZA 3H15A 5LMNQ 4I65A 4AYBE 3DWQA 1VMPA 3KDFA 1ENAA 1DYQA 4ZLTF 4A3LH 2E75C 4KV6A 2F0EA 1WD0A 4TSSA 2PI2A 4RHSA 1N36L 1B44D 3QO2A 3HG9A 3CCQA 3PUWA 5J39A 1O78A 4Y7NB 2KCMA 4LF7L 4MTNA 1S4ZA 3D6CA 4KKUA 2B2YC 1RTNA 4NW2A 3I4MB 1GOZA 3ZYYX 1KL9A 1WJJA 1HQMC 4DAYB 2UUBL 2EYPA 4RGOS 2VW9A 1PYSB 2R7ZG 5L37A 1F9PA 3GO5A 1UNSA 1X3QA 1X3PA 4A3KG 1FNUA 2GA4B 4A3CH 3F2CA 5M3MG 4C3JB 2F0OA 1HFNA 1XNRL 2D9UA 1HTLD 1Y1WG 1MKHA 1U4RA 3GTGB 4B3RQ 4UAIA 1EY9A 1E1OA 1EU4A 3I91A 2QA4A 4BY7B 2JSOA 4J1MA 2O5JC 1PA6A 4Q0FA 5EKLA 3AFPA 5JPMC 3BVZA 3K5LA 1RTOA 3TP7A 4A76A 5KNCA 2F3IA 2XRQD 2XN9C 2EY5A 5JEAJ 5CV7A 5JJZA 3L9AX 4HTHA 1UWVA 5KIXA 4KJNA 1EL0A 5JJKA 1X55A 1HQRD 2M9VA 4JI0Q 1D6EC 3Q6SA 3F8TA 4IJHA 2Q8TA 1EIGA 2ICIA 5I6WA 3HOUH 1RF2D 3E9HA 2B2VA 5CGKA 3J81c 2X6GA 4DK3C 1NTGA 1B2TA 1EZ6A 4DV5Q 4GLXA 1JQYD 4P74A 5IIFA 4U68A 3BDOA 5IGGA 3AYHB 1GUNA 3KDFB 3W2DA 4OIKA 3DXJC 4GS3A 1MHWC 1SMXA 2CWAA 2K03A 3RR5A 3HOVB 4ME3A 1M4VA 5IOCA 2NZ1D 2YTVA 4DV7L 1XMQL 1SYBA 4E6IA 1VCIA 4L5RC 4QL5A 2BH2A 3G7LA 3RLFA 4DV1L 1PFMA 1SXTA 3PSIA 4H02A 1YBYA 1IBMQ 4G4KA 2NVTH 3T51B 1GUGA 4K8JA 4OWXB 3J7YW 3KJPA 5EBDA 3G6JB 4IPHA 1XXGA 4C3JH 3HOWH 5EGTA 1HZCA 1WYDA 4RHRA 2NTTA 4XQNA 1GVPA 1UEAB 4NMZA 1EOTA 3K0XA 1YZ6A 2RDGA 5F2DA 2Z8LA 3PIPA 4LAAA 1QUQA 3ULPA 3RD4A 5ISRA 1AE3A 4DFAA 4R4OA 4DV3L 1IBKL 3S2HB 4QB4A 2SDFA 1SN8A 4OO1H 3M7NA 2JA6B 1VF5C 4A3MG 1CI3M 2AUJD 4LF8Q 3RZOB 3R3OA 4TVAB 1I5FA 2BDNA 3S2DB 3A55A 2VY3A 3CC4A 1J9OA 4GN3B 1UAPA 2L1BA 5T1IA 1YI2A 1BKBA 2F0PA 3V05A 3HRZC 1EYGA 3S1QB 4XQJA 3IFTA 2F0QA 2RHQB 4BA2I 4Y52H 1CKNA 1PFSA 3K8AA 3FPPA 2B2TC 2I46A 1F9RA 2QCPX 4K5VA 4A3DB 1IBLL 4X64L 1EY0A 2LS01 4H7BA 1PH9A 3I73A 4K2KA 3CHBD 1ZYRC 2NN6I 2NB0A 3PUYA 1JE4A 2IL8A 2K7VA 1LABA 3U58A 2JA9A 4K0KL 5IP9G 1HZBA 1SFOB 3NPPA 5EPJA 3KOJA 4X3KA 3TP8A 4OHJA 1Y69U 2L55A 3R2IA 4XYQA 2JA5G 1EQVA 2CVRA 4IFDG 2HHHL 5LMNW 4O0AA 2K50A 3W1BA 4IOAA 4F88A 2MO0A 1F2YA 3S1RH 2EJGC 1Y1VG 5M5WB 2ES2A 4A3BH 5J3BA 3C1FA 1EWIA 1SE8A 4JG2A 4C1NI 2ZJRA 2I0QA 2ZTEA 2ZTCA 1BCPB 2HDMA 2RVLA 3K7UC 2NYZD 2FJ2A 4OX9L 1FGUA 1E1TA 4A93H 5AFWA 2EYLA 2KBNA 3U4VA 4HMIA 3S2HH 1HZAA 4FDBA 1QUQB 4LF5Q 2GVBA 2L5TA 2B29A 4IURA 4OEMB 2ATWA 3RZOH 4EX5A 1VF7A 4C3HG 1MIUA 3VYRA 4TRDA 2DGYA 3U50C 3IL8A 1PH7A 4JI0L 1A6XA 4DR3L 1WTQA 1OXSC 2EZVA 2UXDL 2PZUA 5FLMG 2VQEL 1JMCA 2VB2X 5IODA 3SXHA 3DEPA 2Y0SB 3PO3B 2N3SA 4JW0A 2B2UC 3EROA 4L5TA 4BBSB 2NZOA 2R93H 1KHIA 4A3DH 2EYHA 3ND8A 4NDXA 3GTLB 1MSHA 3A7AB 1YJWA 1PH5A 3JAMc 1PTOF 1EYCA 2F0IA 1VQOA 5EPLA 1FYCA 1UE7A 3C1EA 3OPOA 2RCNA 1G6PA 3LWUA 2C9OA 3SHLA 3H09A 1HJPA 2R92G 1JJGA 4IUPA 1ASZA 4XDXA 1SNMA 1CSPA 3PMFA 4YWKA 4ILWA 3HKZG 3BDLA 1HA6A 1K9MC 4QJFA 2F3WA 2Z6KA 4AQYQ 4JI2L 5C0XG 4LJZC 3NBIA 3M9BA 1VQIA 4JI3L 3D4RA 1UE6A 2LY7A 5KGUA 5K36H 5JOBA 4JBKA 4KLKA 4IFDJ 2BH8A 3J81i 1M90C 4JI4Q 2OTJA 1B53A 2M00A 1SDFA 1SMYD 5J22A 3CMAA 3BZKA 4GKKQ 4ULLA 4PNYA 2DN8A 2UU9Q 3PF5A 1F2LA 4OL7A 4A3FB 4CDDC 4NP5A 4OWWB 2R7DA 5I6YA 2KQ3A 3BJUA 2PI2E 3R2TA 2Z9HA 4DF7A 1HNZL 4DKAC 2YTYA 4ID6A 1SROA 2E74C 2O2LD 2CH4W 1XYIA 1TWAB 2BA0A 4WJ3M 5CR3A 1WI5A 4V0BA 1B70B 1C9OA 3GTPB 3HFZB 3Q8DA 1OXVA 4BBSH 3IFDA 1PXUA 2VZAA 1LACA 1JWUD 1S40A 5CV8A 3S14B 1ILPA 2F0KA 3F2BA 1FVIA 3BG3A 2PO4A 5IE8A 4B3TL 2X69A 3W3AA 4X62L 3A8JE 4AYBB 1SE3A 4X66L 5BN3A 3CCRA 1R4PB 1WCMG 1SNCA 3K0YA 2F4VL 4DNIA 4JI8Q 2H1EA 1LT5D 5C3XA 4BY1H 3J80E 4HMJA 4DNTB 1K83B 2D5DA 2EJFC 1KABA 3HOZG 4AH6A 2KJXA 4WJWA 2ZM6L 4LF6L 3SK4A 4POGA 2WB1E 3G4SA 1NAPA 2L11A 1O80A 2WAQE 1SE2A 3STBD 3TP6A 2VUMH 2C35B 3A7LA 1VQDA 2EE1A 3I4NH 3S1MB 4P71A 5DM73 1HUMA 4IO9A 4KY5A 2F03A 3PO2H 2PMZE 4KY6A 5DM63 5C0XJ 4A3JH 3KYHC 2SEBD 4R4CA 4FXDA 1B50A 2H4OA 4ZAIA 5C44B 1Q12A 3I55A 1DONA 5C3WA 3UDFA 2ZXRA 2UXCL 1HR0W 1PYWD 4XYOA 4UP9A 3BDCA 1TWAH 1PTOD 1QWYA 5NUCA 1MBYA 3NTIA 1L0YB 4RCOA 2A73B 1N36Q 2BDOA 3RMHA 4UP8A 4LF7Q 3UDGA 5KNDA 1GHKA 3K57A 1Q1BA 3AEVA 1QILA 1Y8PB 5CV4A 1ILQA 2MO1A 1S5BD 2QKIC 4A3GG 2UUBQ 3AB9A 3CRLC 3W5OA 3I4OA 5M5XB 3D4WA 4XIGS 1F2ZA 2K5DA 1I6VC 4ALPA 3R8BA
chains in the Genus database with same CATH topology
1N36L 2V1CC 1LTLA 2HIXA 4X6AH 1KXLA 5ELOA 3CCQA 3PUWA 4GOPC 4LFAQ 1YITA 2KCMA 4LF7L 4QGUA 4A3JG 3NENA 4MTNA 1W2BA 1XNRQ 3RN2A 1HNWL 4LW1A 3ICEA 4R4TA 2IHFA 4YHHQ 3I4MG 3ZJYC 3CP0A 5JJLA 1X3FA 1KC8C 3GDEA 1KL9A 1VQ9A 1A63A 1WJJA 4DAYB 2UUBL 2E2HH 3ULLA 2VW9A 1C0AA 1PYSB 2R7ZG 5LMNL 4WJ4A 5AJ3L 1GO3E 3GO5A 1VQKA 3S1MH 2OQ0A 1TWGH 1EQRA 1J5EL 3PCOB 3CCVA 5M3FG 4A3KG 1Q46A 5FJ8G 4A3CH 3F2CA 3CXCA 2Z6KC 1IYJB 1GKHA 5M3MG 4UY8C 2HIVA 3AFQA 1TWFH 1SRUA 2AWNA 4IPDA 3GTJH 1XNRL 1N32Q 1Y1WG 1MKHA 4YHHL 4B3RQ 2Q2TA 4JOIC 3HOVH 4HIKA 1E1OA 4BY7G 2MNAA 2QA4A 4A3EG 4YY3Q 1VQGA 4QIWE 3JAMi 1N33L 4AYBG 3UE1A 4GNXA 3FP9A 1PA6A 2F52A 3AFPA 4B3SL 4A3LG 3M4PA 5IWAQ 3M85A 1HNXQ 4PMWA 4A76A 1A0IA 1QVGA 4IPGA 2B63H 3M4QA 4A4IA 2A8VA 1X9NA 2F3IA 2CKZB 1P16A 5JEAJ 4UPAA 2ZJPA 1PYBA 3FHWA 2NN6G 1UWVA 4DR6Q 2XGTA 1VQ6A 3S1NH 1EIYB 1VQHA 5JJKA 1V43A 5HGQA 1X55A 3OTOQ 3J80c 1R9TH 1A8VA 1N32L 1HR0Q 4JI0Q 4B3RL 1N8RC 3DM3A 4DV7Q 2R7FA 4IJHA 3F8TA 4BY7H 5IYDH 1XMQQ 1NJIC 1X56A 3IRBA 4YY3L 4MZ9A 2JA8G 3E9HA 3J81c 3GTQH 3HOUH 2K5NA 1P8LA 4DK3C 2K4KA 1NTGA 4DV1Q 5IWAL 3S24A 3GTKH 3A0JA 3CPFA 1HNXL 4DV5Q 4DPGA 1NMGA 2EIFA 4BA1I 4GLXA 4XTCS 4A3CG 1UE1A 2KHIA 4P74A 2ASBA 1AH9A 3TREA 1X54A 2JA6H 4DR6L 3AYHB 3KDFB 4RMFA 4A3MH 5C4XH 3H0GG 1PH6A 4QQBX 4GS3A 1L1OC 1YJ9A 1SMXA 2CWAA 3OTOL 4JV5Q 1O7IA 3S2DH 3HOVG 3RR5A 4ME3A 4DV7L 2YTVA 1GD7A 1NBWA 3L7ZC 1XMQL 3CC2A 3S1QH 3KFUA 2D0PA 1KRSA 1MJCA 2YV5A 3KF6A 1VCIA 1YHBA 4GLAC 5C0XI 4L5RC 4QL5A 2BH2A 3RLFA 2NVQH 4UP7A 4DV1L 2D0OA 4DV3Q 1IBKQ 2CWPA 2GVAA 3PSIA 4H02A 4DV5L 1YBYA 1IBMQ 1VQ4A 3G6EA 4LF4Q 1Q1EA 2NVTH 1VQNA 1OXXK 1U0LA 3LGJA 2OCEA 4OWXB 3KJPA 4IPHA 2MFIA 2XTIA 4GN5A 4C3JH 1HZCA 1WYDA 5M3MH 5C3EH 2WP8J 4HJ7A 1YJNA 3MXNB 1KIXA 4KHPQ 1GVPA 4X65Q 1NY4A 2R6GA 3K0XA 1YEZA 3H3VH 1YZ6A 3GTMH 3HOUG 4LNQA 1X6OA 4HJ8A 3NEMA 1YVCA 3PIPA 1QUQA 5IP9H 2NZHA 3CCEA 3ULPA 1SFOH 1VQCA 1AE3A 1DGSA 4R4OA 4DV3L 1IBKL 5JJIA 1L1OB 2IX0A 2K5VA 2Q2UA 1A62A 1IBML 1PH4A 1TWCH 3M3YH 1SN8A 5M5YH 4NXNQ 2PNHA 4LF4L 2JA6G 1VS0A 4GNXB 2JA7H 3M7NA 4A3MG 5C4XG 3G48A 3GD7A 1S72A 1IBLQ 1KQSA 4JI7Q 4LF8Q 1I94Q 4X64Q 1EIFA 4TVAB 1I5FA 4KHPL 2EXDA 5M5WH 1VQ5A 1Y1VH 2VY3A 4X65L 4A3IH 4GN3B 3CC4A 1Y14B 2AKWB 1YI2A 1BKBA 2JJQA 4O2DA 1EYGA 3S17H 4AIMA 2K14A 3D31A 4K0KQ 1HH2P 2RHQB 2A19A 3BZCA 3E0EA 3ER0A 4HJAA 1GM5A 2JA8H 4BA2I 1E22A 1CKNA 1PFSA 1XJVA 4Y52H 3K8AA 4R1JA 3TEHB 3CCSA 3J81j 4DUYQ 4BXXH 1L0WA 2HHHQ 4NXNL 1XPOA 3GTOH 2OQKA 1Q7YC 4A3DG 5IYCH 2HT1A 4GN4B 1N33Q 3HOWG 3FKIG 5C3EG 2VL6A 1YIJA 1IBLL 4X64L 2E5LQ 4LF8L 3STBC 1PH9A 4LFAL 2YYZA 3K7AH 2QGQA 3H0GH 1EUJA 1VQJA 4IPCA 1XTDA 3RN5A 2NN6I 4NXMQ 3PUYA 1W3SA 4JI6Q 4C3HH 3I2ZA 1N34Q 4PZ6A 3U58A 1XMOQ 2JA9A 5IP7H 1PH8A 5IP9G 4K0KL 4OX9Q 1HZBA 4C3IH 3KOJA 2I5HA 1D8LA 5FLMH 2ALYB 4L5QA 4DUYL 1FL0A 1J6QA 2JA5G 3PO3H 4OO1G 4IFDG 2HHHL 2JA7G 3UDXA 5LMNW 1I3QH 4O0AA 2LXJA 2K50A 4JBJA 3W1BA 4DV0Q 4IOAA 1JE5A 2N78A 3EN2A 2MO0A 1IXRA 1PV4A 3A74A 3S1RH 2E5LL 4JI5Q 1Y1VG 1OTCA 3PF4A 4A3IG 2ES2A 3GTLH 5J3BA 1HZ9A 4A3BH 3L2PA 1OXTA 2KHJA 1EWIA 1SE8A 4JG2A 4YCWA 2ZJRA 2I0QA 4NXML 2ZTEA 2F4VQ 2ZTCA 1K0RA 4DR3Q 1N34L 3M4OH 4OWTB 1E3PA 3K7UC 2JQOA 1TXYA 3PUVA 1XMOL 1VQ8A 1QVCA 4OX9L 1FGUA 1E1TA 3F1ZA 1KRTA 5GQOA 4DV6Q 1K8AC 4GKJQ 5E7NA 4A93H 2DUDA 2VQEQ 3CQZH 4QY7A 4LUZA 2PQAA 1L2FA 2Q2HA 4EQ5A 2KBNA 3U4VA 2UUAQ 4HJ9A 1HZAA 4FDBA 3S2HH 3PIOA 1QUQB 4DV0L 5IYCG 2GVBA 2AMCB 2VS1A 2UUCQ 1UE5A 4LF5Q 4B3MQ 2B29A 3G71A 4JI5L 4JCVE 1VQLA 1QZGA 2GN5A 2ATWA 3RZOH 2HQLA 2VNUD 4EX5A 4TQUS 3HOWH 3DLLA 4JV5L 1HR0L 4BXXG 1MIUA 1B8AA 4P75A 2DGYA 4R4QA 3U50C 4HIOA 3T1YQ 1PH7A 4GNXC 5IP7G 1OXSC 5GAGC 4DR1Q 4DR3L 1Q82C 4DV2Q 2UXDL 5FLMG 4DV6L 4GKJL 2VQEL 4JYAQ 3JC66 2I5LX 1JMCA 2Y0SG 3PO3G 2UUAL 3SGIA 4DK6C 2N3SA 5BR8Q 5ELNA 3CMEA 1EQQA 4L5TA 1MJEA 2LXKA 2Z0SA 1QZHA 2CFMA 5IYBH 2UUCL 2NZOA 4LF5L 3AQQA 3OW2A 2MQHA 4B3ML 2R93H 2AHOB 1KHIA 3MEFA 1VQAA 3HOXG 3RNUA 1K3RA 4A3BG 4A3DH 4JI2Q 2AWOA 4IJLA 4HIMA 3FKIH 1YJWA 1PH5A 3BU2A 4GOPA 1K8GA 3JAMc 2ZJQA 4JI3Q 4A3FH 1Z9FA 1N9WA 3T1YL 2B3GA 1VQOA 3CCUA 4DR1L 3J7A5 1UE7A 2N8NA 3CCJA 3PUZA 4DV2L 4DV4Q 4A93G 1JT8A 1BBUA 2FXQA 2JE6I 2RCNA 1RL2A 1X65A 3K80C 1G6PA 1G291 1OXUA 3TQYA 1VQFA 1WOCA 1HJPA 2UXBQ 3RLNA 5BR8L 1WFQA 2R92G 1JJGA 3KJOA 1IL2A 1ASZA 2JA5H 3GTPH 1CSPA 4YWKA 4PG3A 4YWMA 1KAWA 1XPUA 2WFWA 3HKZG 3TS0A 1VQ7A 3EIVA 3J7ZC 4HJ5A 3NBHB 1K9MC 1PVOA 4QJFA 2LSSA 1PH1A 2Z6KA 4AQYQ 4BBRH 1X3EA 3T1HQ 4JI2L 2JEAI 3KF8B 5C0XG 3S14H 4DAMA 1LYLA 1VQIA 3M9BA 2CQOA 4JI3L 3CF5A 2NVXH 3A5ZB 3ERSX 3S15H 1UE6A 4KHZA 4JI4L 3J80i 1HNZQ 1U5KA 4JOIA 4DV4L 3H3VI 2RF4A 2EQSA 2YTXA 1YNXA 4JBKA 1NMFA 4KI0A 4KLKA 5C4JH 4IFDJ 2UXBL 1WCMH 2BH8A 3J81i 4DR2Q 3U4ZA 1LM0A 1M90C 4JI4Q 2OTJA 2BA1A 5IYBG 3D0FA 1C7YA 5GAHC 4JI1Q 2R93G 1E7ZA 5FLXc 1VQMA 3CMAA 3BZKA 4GKKQ 2PQAB 1K83H 4P72A 4APVA 1K73C 4OO1I 4NB3A 4JI7L 3TS2A 1LUZA 1I94L 4AQYL 1XNQQ 2UU9Q 3T1HL 2N49A 3PF5A 4IFDI 3HOZH 2RHSB 1PH2A 4NPSA 4A3FG 3EBEA 3F2DA 1QVFA 4JC0A 1SLJA 2R7DA 4OWWB 3BJUA 1BVSA 2PI2E 2NVYH 4A75A 3CCLA 3L0OA 4R4IA 4X62Q 1HNZL 3W1GA 4B3TQ 4DKAC 2YTYA 3HOYH 4YCUA 1SROA 4JI0L 1Q81C 4B3SQ 4LFBQ 4X66Q 5GAEC 2BA0A 4WJ3M 1EFWA 5HY6A 2VQFQ 3PV0A 3CCMA 4DR2L 1WI5A 2Y0SE 4PZ7A 1B70B 1C9OA 3K81C 4YWLA 3UE0A 3RZDH 3HFZB 1KD1C 3Q8DA 1OXVA 4LUVA 3ULJA 3NELA 3KF6B 4JI1L 4BBSH 3E9IA 4LUOA 2VZAA 4GKKL 2IY5B 1NE3A 4BBRG 1S40A 4IOCA 1CSQA 1XNQL 2ZM6Q 2UU9L 1AE2A 4LF6Q 3HOXH 2E2JH 3F2BA 5LMUQ 2I5MX 4C2MH 1L1OA 1FVIA 3PUXA 3CPWA 3CC7A 5C44H 4JI6L 2ID0A 5IE8A 4B3TL 1JJ2A 4X62L 5K36G 4LFBL 2Q2IA 3RLOA 3WWVA 4X66L 4GOPB 4LFCQ 4OXPA 3CCRA 4LF9Q 1WCMG 2VQFL 2JEBI 4P73A 3TRZA 2F4VL 1VQPA 4DNIA 4JI8Q 1S3OA 4DUZQ 2R92H 4RG1A 4BY1H 1V1QA 4HIDA 3KLWA 3B6YA 3HKZE 2KENA 3A5UA 2H5XA 3I56A 4AH6A 3HOZG 3I7FA 1TWHH 2ZM6L 4LF6L 1T9HA 4J15A 5LMUL 4POGA 2WB1E 3G4SA 1H95A 4POFA 2IHEA 2L15A 1ASYA 1V9PA 3HOYG 2WAQE 1CUKA 2VUMH 3STBD 2C35B 2JK8A 1VQDA 1YHAA 4A3GH 3I4NH 1B7YB 1PHJA 3CD6A 4DR7Q 4P71A 4LFCL 1I50H 2UXCQ 2ZTDA 4LF9L 5M5XH 1YHQA 5H1SE 1M1KC 3UDIA 4JBMA 4JI8L 4IO9A 4OONA 4BBSG 4MNOA 2E8GA 1EOVA 3HKSA 5IY0A 4DUZL 1PH3A 2PMZE 1FJGQ 3PO2H 3S16H 2K5HA 5JEAG 1CKNB 1IZ6A 5C0XJ 2D62A 4Y7NH 1Q86C 4A3JH 3KYHC 4R4CA 1SR3A 1D7QA 5C44G 4DR4Q 4DR5Q 3I4MH 2YU9H 1Q12A 3CW2C 3I55A 5DLQE 1I6HH 2A1AA 2KCTA 1JJCB 4DR7L 3UDFA 4JBWA 2UXCL 1HR0W 2B63G 2R7ZH 4UP9A 5GROA 1TWAH 3PGZA 2K75A 3OYYA 1G51A 5EAYA 1UEBA 4BY1G 4JYAL 5M3FH 4GLVB 4A3KH 1FJGL 5FJ8H 1N36Q 4L5SA 1Q8KA 5IT9c 2OWOA 4YCVA 4UP8A 4LF7Q 1E24A 2K52A 3UDGA 1HNWQ 2IX1A 1X3GA 2IT1A 1RIPA 1JB7A 2OTLA 1CKOA 1CKMA 1VQBA 2WB1G 5IYDG 1Y1WH 1XPRA 3GTGH 4DR4L 2WAQG 1Q1BA 4DR5L 2E2IH 3AEVA 1BBWA 2VUMG 2MO1A 4A3GG 5GADC 1VQEA 4A3EH 4LWCA 3VDYA 2UUBQ 4PZ8A 2CCZA 3H15A 3I4NG 5LMNQ 5AJ3Q 4AYBE 2QEXA 3W5OA 3I4OA 3KDFA 4A3LH 1Z47A 1J5EQ 4XIGS 2UXDQ 3PO2G 3CAMA 4ALPA 2PI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 L;  2V1C C;  1LTL A;  2HIX A;  4X6A H;  1KXL A;  5ELO A;  3CCQ A;  3PUW A;  4GOP C;  4LFA Q;  1YIT A;  2KCM A;  4LF7 L;  4QGU A;  4A3J G;  3NEN A;  4MTN A;  1W2B A;  1XNR Q;  3RN2 A;  1HNW L;  4LW1 A;  3ICE A;  4R4T A;  2IHF A;  4YHH Q;  3I4M G;  3ZJY C;  3CP0 A;  5JJL A;  1X3F A;  1KC8 C;  3GDE A;  1KL9 A;  1VQ9 A;  1A63 A;  1WJJ A;  4DAY B;  2UUB L;  2E2H H;  3ULL A;  2VW9 A;  1C0A A;  1PYS B;  2R7Z G;  5LMN L;  4WJ4 A;  5AJ3 L;  1GO3 E;  3GO5 A;  1VQK A;  3S1M H;  2OQ0 A;  1TWG H;  1EQR A;  1J5E L;  3PCO B;  3CCV A;  5M3F G;  4A3K G;  1Q46 A;  5FJ8 G;  4A3C H;  3F2C A;  3CXC A;  2Z6K C;  1IYJ B;  1GKH A;  5M3M G;  4UY8 C;  2HIV A;  3AFQ A;  1TWF H;  1SRU A;  2AWN A;  4IPD A;  3GTJ H;  1XNR L;  1N32 Q;  1Y1W G;  1MKH A;  4YHH L;  4B3R Q;  2Q2T A;  4JOI C;  3HOV H;  4HIK A;  1E1O A;  4BY7 G;  2MNA A;  2QA4 A;  4A3E G;  4YY3 Q;  1VQG A;  4QIW E;  3JAM i;  1N33 L;  4AYB G;  3UE1 A;  4GNX A;  3FP9 A;  1PA6 A;  2F52 A;  3AFP A;  4B3S L;  4A3L G;  3M4P A;  5IWA Q;  3M85 A;  1HNX Q;  4PMW A;  4A76 A;  1A0I A;  1QVG A;  4IPG A;  2B63 H;  3M4Q A;  4A4I A;  2A8V A;  1X9N A;  2F3I A;  2CKZ B;  1P16 A;  5JEA J;  4UPA A;  2ZJP A;  1PYB A;  3FHW A;  2NN6 G;  1UWV A;  4DR6 Q;  2XGT A;  1VQ6 A;  3S1N H;  1EIY B;  1VQH A;  5JJK A;  1V43 A;  5HGQ A;  1X55 A;  3OTO Q;  3J80 c;  1R9T H;  1A8V A;  1N32 L;  1HR0 Q;  4JI0 Q;  4B3R L;  1N8R C;  3DM3 A;  4DV7 Q;  2R7F A;  4IJH A;  3F8T A;  4BY7 H;  5IYD H;  1XMQ Q;  1NJI C;  1X56 A;  3IRB A;  4YY3 L;  4MZ9 A;  2JA8 G;  3E9H A;  3J81 c;  3GTQ H;  3HOU H;  2K5N A;  1P8L A;  4DK3 C;  2K4K A;  1NTG A;  4DV1 Q;  5IWA L;  3S24 A;  3GTK H;  3A0J A;  3CPF A;  1HNX L;  4DV5 Q;  4DPG A;  1NMG A;  2EIF A;  4BA1 I;  4GLX A;  4XTC S;  4A3C G;  1UE1 A;  2KHI A;  4P74 A;  2ASB A;  1AH9 A;  3TRE A;  1X54 A;  2JA6 H;  4DR6 L;  3AYH B;  3KDF B;  4RMF A;  4A3M H;  5C4X H;  3H0G G;  1PH6 A;  4QQB X;  4GS3 A;  1L1O C;  1YJ9 A;  1SMX A;  2CWA A;  3OTO L;  4JV5 Q;  1O7I A;  3S2D H;  3HOV G;  3RR5 A;  4ME3 A;  4DV7 L;  2YTV A;  1GD7 A;  1NBW A;  3L7Z C;  1XMQ L;  3CC2 A;  3S1Q H;  3KFU A;  2D0P A;  1KRS A;  1MJC A;  2YV5 A;  3KF6 A;  1VCI A;  1YHB A;  4GLA C;  5C0X I;  4L5R C;  4QL5 A;  2BH2 A;  3RLF A;  2NVQ H;  4UP7 A;  4DV1 L;  2D0O A;  4DV3 Q;  1IBK Q;  2CWP A;  2GVA A;  3PSI A;  4H02 A;  4DV5 L;  1YBY A;  1IBM Q;  1VQ4 A;  3G6E A;  4LF4 Q;  1Q1E A;  2NVT H;  1VQN A;  1OXX K;  1U0L A;  3LGJ A;  2OCE A;  4OWX B;  3KJP A;  4IPH A;  2MFI A;  2XTI A;  4GN5 A;  4C3J H;  1HZC A;  1WYD A;  5M3M H;  5C3E H;  2WP8 J;  4HJ7 A;  1YJN A;  3MXN B;  1KIX A;  4KHP Q;  1GVP A;  4X65 Q;  1NY4 A;  2R6G A;  3K0X A;  1YEZ A;  3H3V H;  1YZ6 A;  3GTM H;  3HOU G;  4LNQ A;  1X6O A;  4HJ8 A;  3NEM A;  1YVC A;  3PIP A;  1QUQ A;  5IP9 H;  2NZH A;  3CCE A;  3ULP A;  1SFO H;  1VQC A;  1AE3 A;  1DGS A;  4R4O A;  4DV3 L;  1IBK L;  5JJI A;  1L1O B;  2IX0 A;  2K5V A;  2Q2U A;  1A62 A;  1IBM L;  1PH4 A;  1TWC H;  3M3Y H;  1SN8 A;  5M5Y H;  4NXN Q;  2PNH A;  4LF4 L;  2JA6 G;  1VS0 A;  4GNX B;  2JA7 H;  3M7N A;  4A3M G;  5C4X G;  3G48 A;  3GD7 A;  1S72 A;  1IBL Q;  1KQS A;  4JI7 Q;  4LF8 Q;  1I94 Q;  4X64 Q;  1EIF A;  4TVA B;  1I5F A;  4KHP L;  2EXD A;  5M5W H;  1VQ5 A;  1Y1V H;  2VY3 A;  4X65 L;  4A3I H;  4GN3 B;  3CC4 A;  1Y14 B;  2AKW B;  1YI2 A;  1BKB A;  2JJQ A;  4O2D A;  1EYG A;  3S17 H;  4AIM A;  2K14 A;  3D31 A;  4K0K Q;  1HH2 P;  2RHQ B;  2A19 A;  3BZC A;  3E0E A;  3ER0 A;  4HJA A;  1GM5 A;  2JA8 H;  4BA2 I;  1E22 A;  1CKN A;  1PFS A;  1XJV A;  4Y52 H;  3K8A A;  4R1J A;  3TEH B;  3CCS A;  3J81 j;  4DUY Q;  4BXX H;  1L0W A;  2HHH Q;  4NXN L;  1XPO A;  3GTO H;  2OQK A;  1Q7Y C;  4A3D G;  5IYC H;  2HT1 A;  4GN4 B;  1N33 Q;  3HOW G;  3FKI G;  5C3E G;  2VL6 A;  1YIJ A;  1IBL L;  4X64 L;  2E5L Q;  4LF8 L;  3STB C;  1PH9 A;  4LFA L;  2YYZ A;  3K7A H;  2QGQ A;  3H0G H;  1EUJ A;  1VQJ A;  4IPC A;  1XTD A;  3RN5 A;  2NN6 I;  4NXM Q;  3PUY A;  1W3S A;  4JI6 Q;  4C3H H;  3I2Z A;  1N34 Q;  4PZ6 A;  3U58 A;  1XMO Q;  2JA9 A;  5IP7 H;  1PH8 A;  5IP9 G;  4K0K L;  4OX9 Q;  1HZB A;  4C3I H;  3KOJ A;  2I5H A;  1D8L A;  5FLM H;  2ALY B;  4L5Q A;  4DUY L;  1FL0 A;  1J6Q A;  2JA5 G;  3PO3 H;  4OO1 G;  4IFD G;  2HHH L;  2JA7 G;  3UDX A;  5LMN W;  1I3Q H;  4O0A A;  2LXJ A;  2K50 A;  4JBJ A;  3W1B A;  4DV0 Q;  4IOA A;  1JE5 A;  2N78 A;  3EN2 A;  2MO0 A;  1IXR A;  1PV4 A;  3A74 A;  3S1R H;  2E5L L;  4JI5 Q;  1Y1V G;  1OTC A;  3PF4 A;  4A3I G;  2ES2 A;  3GTL H;  5J3B A;  1HZ9 A;  4A3B H;  3L2P A;  1OXT A;  2KHJ A;  1EWI A;  1SE8 A;  4JG2 A;  4YCW A;  2ZJR A;  2I0Q A;  4NXM L;  2ZTE A;  2F4V Q;  2ZTC A;  1K0R A;  4DR3 Q;  1N34 L;  3M4O H;  4OWT B;  1E3P A;  3K7U C;  2JQO A;  1TXY A;  3PUV A;  1XMO L;  1VQ8 A;  1QVC A;  4OX9 L;  1FGU A;  1E1T A;  3F1Z A;  1KRT A;  5GQO A;  4DV6 Q;  1K8A C;  4GKJ Q;  5E7N A;  4A93 H;  2DUD A;  2VQE Q;  3CQZ H;  4QY7 A;  4LUZ A;  2PQA A;  1L2F A;  2Q2H A;  4EQ5 A;  2KBN A;  3U4V A;  2UUA Q;  4HJ9 A;  1HZA A;  4FDB A;  3S2H H;  3PIO A;  1QUQ B;  4DV0 L;  5IYC G;  2GVB A;  2AMC B;  2VS1 A;  2UUC Q;  1UE5 A;  4LF5 Q;  4B3M Q;  2B29 A;  3G71 A;  4JI5 L;  4JCV E;  1VQL A;  1QZG A;  2GN5 A;  2ATW A;  3RZO H;  2HQL A;  2VNU D;  4EX5 A;  4TQU S;  3HOW H;  3DLL A;  4JV5 L;  1HR0 L;  4BXX G;  1MIU A;  1B8A A;  4P75 A;  2DGY A;  4R4Q A;  3U50 C;  4HIO A;  3T1Y Q;  1PH7 A;  4GNX C;  5IP7 G;  1OXS C;  5GAG C;  4DR1 Q;  4DR3 L;  1Q82 C;  4DV2 Q;  2UXD L;  5FLM G;  4DV6 L;  4GKJ L;  2VQE L;  4JYA Q;  3JC6 6;  2I5L X;  1JMC A;  2Y0S G;  3PO3 G;  2UUA L;  3SGI A;  4DK6 C;  2N3S A;  5BR8 Q;  5ELN A;  3CME A;  1EQQ A;  4L5T A;  1MJE A;  2LXK A;  2Z0S A;  1QZH A;  2CFM A;  5IYB H;  2UUC L;  2NZO A;  4LF5 L;  3AQQ A;  3OW2 A;  2MQH A;  4B3M L;  2R93 H;  2AHO B;  1KHI A;  3MEF A;  1VQA A;  3HOX G;  3RNU A;  1K3R A;  4A3B G;  4A3D H;  4JI2 Q;  2AWO A;  4IJL A;  4HIM A;  3FKI H;  1YJW A;  1PH5 A;  3BU2 A;  4GOP A;  1K8G A;  3JAM c;  2ZJQ A;  4JI3 Q;  4A3F H;  1Z9F A;  1N9W A;  3T1Y L;  2B3G A;  1VQO A;  3CCU A;  4DR1 L;  3J7A 5;  1UE7 A;  2N8N A;  3CCJ A;  3PUZ A;  4DV2 L;  4DV4 Q;  4A93 G;  1JT8 A;  1BBU A;  2FXQ A;  2JE6 I;  2RCN A;  1RL2 A;  1X65 A;  3K80 C;  1G6P A;  1G29 1;  1OXU A;  3TQY A;  1VQF A;  1WOC A;  1HJP A;  2UXB Q;  3RLN A;  5BR8 L;  1WFQ A;  2R92 G;  1JJG A;  3KJO A;  1IL2 A;  1ASZ A;  2JA5 H;  3GTP H;  1CSP A;  4YWK A;  4PG3 A;  4YWM A;  1KAW A;  1XPU A;  2WFW A;  3HKZ G;  3TS0 A;  1VQ7 A;  3EIV A;  3J7Z C;  4HJ5 A;  3NBH B;  1K9M C;  1PVO A;  4QJF A;  2LSS A;  1PH1 A;  2Z6K A;  4AQY Q;  4BBR H;  1X3E A;  3T1H Q;  4JI2 L;  2JEA I;  3KF8 B;  5C0X G;  3S14 H;  4DAM A;  1LYL A;  1VQI A;  3M9B A;  2CQO A;  4JI3 L;  3CF5 A;  2NVX H;  3A5Z B;  3ERS X;  3S15 H;  1UE6 A;  4KHZ A;  4JI4 L;  3J80 i;  1HNZ Q;  1U5K A;  4JOI A;  4DV4 L;  3H3V I;  2RF4 A;  2EQS A;  2YTX A;  1YNX A;  4JBK A;  1NMF A;  4KI0 A;  4KLK A;  5C4J H;  4IFD J;  2UXB L;  1WCM H;  2BH8 A;  3J81 i;  4DR2 Q;  3U4Z A;  1LM0 A;  1M90 C;  4JI4 Q;  2OTJ A;  2BA1 A;  5IYB G;  3D0F A;  1C7Y A;  5GAH C;  4JI1 Q;  2R93 G;  1E7Z A;  5FLX c;  1VQM A;  3CMA A;  3BZK A;  4GKK Q;  2PQA B;  1K83 H;  4P72 A;  4APV A;  1K73 C;  4OO1 I;  4NB3 A;  4JI7 L;  3TS2 A;  1LUZ A;  1I94 L;  4AQY L;  1XNQ Q;  2UU9 Q;  3T1H L;  2N49 A;  3PF5 A;  4IFD I;  3HOZ H;  2RHS B;  1PH2 A;  4NPS A;  4A3F G;  3EBE A;  3F2D A;  1QVF A;  4JC0 A;  1SLJ A;  2R7D A;  4OWW B;  3BJU A;  1BVS A;  2PI2 E;  2NVY H;  4A75 A;  3CCL A;  3L0O A;  4R4I A;  4X62 Q;  1HNZ L;  3W1G A;  4B3T Q;  4DKA C;  2YTY A;  3HOY H;  4YCU A;  1SRO A;  4JI0 L;  1Q81 C;  4B3S Q;  4LFB Q;  4X66 Q;  5GAE C;  2BA0 A;  4WJ3 M;  1EFW A;  5HY6 A;  2VQF Q;  3PV0 A;  3CCM A;  4DR2 L;  1WI5 A;  2Y0S E;  4PZ7 A;  1B70 B;  1C9O A;  3K81 C;  4YWL A;  3UE0 A;  3RZD H;  3HFZ B;  1KD1 C;  3Q8D A;  1OXV A;  4LUV A;  3ULJ A;  3NEL A;  3KF6 B;  4JI1 L;  4BBS H;  3E9I A;  4LUO A;  2VZA A;  4GKK L;  2IY5 B;  1NE3 A;  4BBR G;  1S40 A;  4IOC A;  1CSQ A;  1XNQ L;  2ZM6 Q;  2UU9 L;  1AE2 A;  4LF6 Q;  3HOX H;  2E2J H;  3F2B A;  5LMU Q;  2I5M X;  4C2M H;  1L1O A;  1FVI A;  3PUX A;  3CPW A;  3CC7 A;  5C44 H;  4JI6 L;  2ID0 A;  5IE8 A;  4B3T L;  1JJ2 A;  4X62 L;  5K36 G;  4LFB L;  2Q2I A;  3RLO A;  3WWV A;  4X66 L;  4GOP B;  4LFC Q;  4OXP A;  3CCR A;  4LF9 Q;  1WCM G;  2VQF L;  2JEB I;  4P73 A;  3TRZ A;  2F4V L;  1VQP A;  4DNI A;  4JI8 Q;  1S3O A;  4DUZ Q;  2R92 H;  4RG1 A;  4BY1 H;  1V1Q A;  4HID A;  3KLW A;  3B6Y A;  3HKZ E;  2KEN A;  3A5U A;  2H5X A;  3I56 A;  4AH6 A;  3HOZ G;  3I7F A;  1TWH H;  2ZM6 L;  4LF6 L;  1T9H A;  4J15 A;  5LMU L;  4POG A;  2WB1 E;  3G4S A;  1H95 A;  4POF A;  2IHE A;  2L15 A;  1ASY A;  1V9P A;  3HOY G;  2WAQ E;  1CUK A;  2VUM H;  3STB D;  2C35 B;  2JK8 A;  1VQD A;  1YHA A;  4A3G H;  3I4N H;  1B7Y B;  1PHJ A;  3CD6 A;  4DR7 Q;  4P71 A;  4LFC L;  1I50 H;  2UXC Q;  2ZTD A;  4LF9 L;  5M5X H;  1YHQ A;  5H1S E;  1M1K C;  3UDI A;  4JBM A;  4JI8 L;  4IO9 A;  4OON A;  4BBS G;  4MNO A;  2E8G A;  1EOV A;  3HKS A;  5IY0 A;  4DUZ L;  1PH3 A;  2PMZ E;  1FJG Q;  3PO2 H;  3S16 H;  2K5H A;  5JEA G;  1CKN B;  1IZ6 A;  5C0X J;  2D62 A;  4Y7N H;  1Q86 C;  4A3J H;  3KYH C;  4R4C A;  1SR3 A;  1D7Q A;  5C44 G;  4DR4 Q;  4DR5 Q;  3I4M H;  2YU9 H;  1Q12 A;  3CW2 C;  3I55 A;  5DLQ E;  1I6H H;  2A1A A;  2KCT A;  1JJC B;  4DR7 L;  3UDF A;  4JBW A;  2UXC L;  1HR0 W;  2B63 G;  2R7Z H;  4UP9 A;  5GRO A;  1TWA H;  3PGZ A;  2K75 A;  3OYY A;  1G51 A;  5EAY A;  1UEB A;  4BY1 G;  4JYA L;  5M3F H;  4GLV B;  4A3K H;  1FJG L;  5FJ8 H;  1N36 Q;  4L5S A;  1Q8K A;  5IT9 c;  2OWO A;  4YCV A;  4UP8 A;  4LF7 Q;  1E24 A;  2K52 A;  3UDG A;  1HNW Q;  2IX1 A;  1X3G A;  2IT1 A;  1RIP A;  1JB7 A;  2OTL A;  1CKO A;  1CKM A;  1VQB A;  2WB1 G;  5IYD G;  1Y1W H;  1XPR A;  3GTG H;  4DR4 L;  2WAQ G;  1Q1B A;  4DR5 L;  2E2I H;  3AEV A;  1BBW A;  2VUM G;  2MO1 A;  4A3G G;  5GAD C;  1VQE A;  4A3E H;  4LWC A;  3VDY A;  2UUB Q;  4PZ8 A;  2CCZ A;  3H15 A;  3I4N G;  5LMN Q;  5AJ3 Q;  4AYB E;  2QEX A;  3W5O A;  3I4O A;  3KDF A;  4A3L H;  1Z47 A;  1J5E Q;  4XIG S;  2UXD Q;  3PO2 G;  3CAM A;  4ALP A;  2PI2 A; 
#chains in the Genus database with same CATH topology
 2VXW A;  4X6A H;  3A56 A;  1AW7 A;  2NN6 H;  1EY5 A;  3NEN A;  1XNR Q;  1W2B A;  3RN2 A;  2NBF A;  2KEC A;  2IHF A;  3I4M G;  1TS5 A;  4K2L A;  4EVO A;  1PDQ A;  4RH6 A;  2DJG C;  1A63 A;  1YNN D;  1C0A A;  3I70 A;  1PRT F;  5AJ3 L;  3S1M H;  3KK7 A;  3Q0A A;  3OIP A;  3MXN A;  2HQE A;  3CCV A;  1WTO A;  2CW0 D;  1Q46 A;  5KYI A;  5FJ8 G;  5M3F B;  4F8M A;  2Z6K C;  4C3J G;  1GKH A;  4PV1 C;  3D6W A;  4UY8 C;  1TWF H;  3NWT A;  5EKK A;  1GXD C;  3KLR A;  3GTM B;  1O7L A;  2Q8R E;  2Q2T A;  2RBM A;  4BY7 G;  3GQB A;  1MI2 A;  1C48 A;  1SJH D;  3JAM i;  3FP9 A;  1T5E A;  4ZYS A;  1G2S A;  1RD9 D;  4XXE A;  4A4I A;  3MZ5 A;  3VR5 A;  3BZD B;  4OGQ C;  1PFN A;  2ZJP A;  1ROD A;  1JR0 D;  1STB A;  4U67 3;  1A8V A;  1O7Z A;  2DNC A;  4Q5V A;  1WTP A;  1N8R C;  2A68 D;  3DM3 A;  4DV7 Q;  1PZK D;  1XMQ Q;  1X56 A;  2MP1 A;  4MZ9 A;  4YY3 L;  3GTQ H;  5C4Z A;  2JA8 B;  2K5N A;  4N9T A;  5C5M A;  5KYL A;  1BCP F;  4IZ8 A;  4DV1 Q;  5IWA L;  3S24 A;  3CPF A;  1F9S A;  3OIQ A;  1NMG A;  2EIF A;  4XTC S;  2KHI A;  4RKL A;  2ASB A;  4FYD A;  1B3Q A;  2G9D A;  5G3L D;  5C4X H;  3K7A B;  3H0G B;  1YJ9 A;  1FGB D;  1JOR A;  1BR9 A;  3HOV G;  3AU7 A;  3T13 A;  1NBW A;  3FPU B;  1GUS A;  1MJC A;  3KF6 A;  5TSS A;  4GLA C;  3KBG A;  1SMY C;  1AN8 A;  1IL8 A;  3E3X A;  5JPN C;  4DV3 Q;  1IBK Q;  1LLR D;  2F0U A;  2PZT A;  4IUT A;  1KDA A;  1OXX K;  3LGJ A;  2A6E C;  2Z4I A;  2XTI A;  3LWE A;  4HJ7 A;  5C3E H;  1YJN A;  3MXN B;  4KK7 A;  1ONL A;  2R6G A;  4K5X A;  2F0N A;  3GTM H;  3ITP A;  3HOU B;  2AQ2 B;  2MHV A;  1Q90 A;  4HJ8 A;  4FXG C;  3A8I E;  5J1Z A;  3SVM A;  4ME5 A;  2IX0 A;  2K5V A;  1PH4 A;  1TWC H;  3M3Y H;  3U9S A;  2JA6 G;  1VS0 A;  4J8Q A;  2JA7 H;  3D8G A;  4EQP A;  1HHV A;  3G48 A;  3GD7 A;  1CZG A;  1IBL Q;  4JI7 Q;  4X64 Q;  4KHP L;  1G8Z D;  1VQ5 A;  1LT4 D;  2J0T D;  1XWE A;  5IGC A;  2JJQ A;  3S17 H;  4K0K Q;  3E0E A;  2A19 A;  2JA8 H;  5FLX L;  1EEF D;  3J81 j;  5FLX E;  1L0W A;  2HHH Q;  4J6H A;  2NVT B;  1XPO A;  2OQK A;  1SNQ A;  1NUC A;  4A3D G;  1PRT D;  1I4G A;  4GN4 B;  4CJ2 C;  3HOW B;  3FKI B;  3STB C;  3P75 A;  1B3A A;  3K7A H;  1L0X B;  3H0G H;  1VQJ A;  5FO7 B;  1XTD A;  3RN5 A;  4JI6 Q;  2MUY A;  1MSG A;  1NR2 A;  5IP7 H;  3BYY B;  4OX9 Q;  1LTR D;  4C3I H;  4HAE A;  2I5H A;  1D8L A;  2F3V A;  2IX3 A;  2ALY B;  3NE5 B;  3GV3 A;  4DK0 A;  1FL0 A;  1J6Q A;  2OT2 A;  2F0W A;  3HEJ A;  3KF8 A;  5ELF A;  3VA7 A;  1TR5 A;  2KEE A;  1JE5 A;  1PTO H;  1N33 L;  5DNF A;  4A3I G;  2LFN A;  1HZ9 A;  5IGE A;  3L2P A;  1OXT A;  4NXM L;  1K0R A;  2N88 A;  2QDB A;  4DR3 Q;  4S3S A;  3M4O H;  4OWT B;  1PTO C;  1RHP A;  4BWG B;  2JQO A;  1XMO L;  1VQ8 A;  2UXD Q;  1QVC A;  5GQO A;  1VDZ A;  4DXG A;  2DUD A;  2VQE Q;  3CQZ H;  3T4A C;  2Q2H A;  4EQ5 A;  4KKS A;  1EY6 A;  4DV0 L;  5IYC G;  1E2Z A;  2AMC B;  4ZKC B;  4MIU A;  1BDO A;  1HXY D;  1HUN A;  3MWY W;  1QZG A;  2GN5 A;  2HQL A;  4KTA A;  4TQU S;  4DN4 M;  4JV5 L;  4P75 A;  3SR1 A;  2PQE A;  4DV6 L;  2Y0S G;  3PO3 G;  1FR3 A;  1CQF A;  2KED A;  3CME A;  1W6J A;  1EYD A;  3IAY A;  1MJE A;  1JIC A;  1SJE D;  2Z0S A;  5IYB H;  2UUC L;  3OW2 A;  2MQH A;  3OWE B;  5D14 A;  3EA6 A;  3S1R B;  4DAV A;  4JI2 Q;  4A3B B;  3QOL A;  1YNN C;  3FKI H;  1A2U A;  3BU2 A;  4GOP A;  3NK9 A;  2ZJQ A;  2F1M A;  2XWJ B;  4JI3 Q;  1G91 A;  3T1Y L;  1JOO A;  2CW0 C;  1BBU A;  2FXQ A;  4A93 B;  2JE6 I;  1Y8N B;  2A6H C;  1A15 A;  5EKI A;  1TY0 A;  4DXF A;  3TS0 A;  3V96 A;  1U4L A;  4BBR H;  1X3E A;  2JEA I;  3KF8 B;  3K5M A;  2WB1 B;  3CF5 A;  1LT6 D;  4DK1 A;  3A5Z B;  2WAQ B;  4CDE C;  4HED A;  2X6L A;  1HNZ Q;  1JC7 A;  5CV6 A;  3H3V I;  5CBA E;  2YTX A;  4KI0 A;  3P1H A;  5COY A;  1ESR A;  1I4Q A;  3KUP A;  5CYU A;  2K5W A;  1KDC A;  3A8K E;  3V2T A;  2PMZ B;  4H0L C;  3QJY A;  2R93 B;  2A68 C;  4C56 C;  1EWC A;  4JI7 L;  4FO2 A;  4IFD I;  1PZI D;  3T1H L;  2RHS B;  1PH2 A;  4FF4 A;  4NPS A;  4A3F G;  3F2D A;  2AUK A;  2FMC A;  3QR8 A;  4B3T Q;  4BXX H;  3DMU A;  4R4I A;  2PW7 A;  4X62 Q;  3HOY H;  4YCU A;  4X66 Q;  1SAP A;  2G9H D;  5HY6 A;  1K8M A;  5E1F A;  4K6D A;  3PV0 A;  5FK9 C;  3FDT A;  3CCM A;  4DR2 L;  2F4V Q;  3KFU A;  2J4X A;  2F0T A;  4RGT A;  4A3K B;  1CZW A;  4ZQ3 A;  3NEL A;  1TT2 A;  2EJM A;  4ODG A;  2IY5 B;  5JEA H;  4BS9 A;  2ZM6 Q;  4LF6 Q;  3WOF A;  2I5M X;  3FEW X;  1L1O A;  1FD7 D;  4JI6 L;  2ID0 A;  3D3R A;  3L3O C;  1JWM D;  3RLO A;  2NTS A;  3TZU A;  4GOP B;  4FVM A;  4KJO A;  4OXP A;  2VQF L;  2JEB I;  4P73 A;  4FF2 A;  1HTP A;  1NR4 A;  1WVL A;  1ICW A;  1J8I A;  2MJ8 A;  4RG1 A;  4Z9C B;  1V1Q A;  4MHE A;  4LMQ D;  5KEE A;  4HID A;  4QMG A;  5KRU A;  2KEN A;  3I7F A;  1TWH H;  4ZUI A;  5LMU L;  2K1B A;  1ASY A;  1CUK A;  4DAP A;  2JK8 A;  1YHA A;  4X3T A;  3LX0 A;  1B7Y B;  1PHJ A;  3CD6 A;  1I50 H;  5DAU A;  2UXC Q;  2ZTD A;  3K5O A;  1YHQ A;  3UDI A;  4HCS A;  3EVQ A;  4OON A;  1JOQ A;  4MNO A;  3HKS A;  1EOV A;  4DUZ L;  1PH3 A;  4C1N K;  1ZEQ X;  4O42 A;  3GTJ B;  1CKN B;  1IZ6 A;  3TP5 A;  2K05 A;  2J7Z A;  4I7A A;  4JVZ A;  1B1Z A;  5C44 G;  2B2V C;  4HN7 A;  1C8C A;  1QOH A;  5DLQ E;  1I6H H;  1V1P A;  3GV6 A;  2KCT A;  3MXG A;  1G6Z A;  4ZK9 B;  2R7Z H;  3RUZ A;  2B63 B;  5IT9 L;  2F0G A;  4O1N A;  3OYY A;  1G51 A;  5IT9 E;  3VYS A;  5ELD A;  4JYA L;  4A3K H;  1CHQ D;  3NQT A;  4BY1 B;  1FJG L;  1BUV T;  5IT9 c;  4YCV A;  1V8Q A;  2K52 A;  2IX1 A;  1RIP A;  2OTL A;  1EFI D;  1E2V A;  1VQB A;  2EXZ A;  4ZCK A;  1Y1W H;  2E2I H;  4DR5 L;  1BBW A;  2Z6B A;  2VUM B;  5GAD C;  1VQE A;  3I4N B;  3D4D A;  4P2C B;  5AJ3 Q;  2DNE A;  2QEX A;  4WRD A;  1Z47 A;  2ZT9 C;  4ZKB B;  4RA8 A;  3PO2 B;  3I3C A;  4A3M B;  3K58 A;  2HIX A;  1Y8O B;  5ELO A;  4GOP C;  2K04 A;  1YIT A;  5FO8 B;  2RA4 A;  4QGU A;  4CDF C;  4A3J B;  4R4T A;  3NHH A;  1V1O A;  1TU2 B;  3FVQ A;  3ZJY C;  5JJL A;  1I4P A;  4IUQ A;  1KC8 C;  3GDE A;  3NXW A;  3SK8 A;  1S5E D;  2E2H H;  2NVQ B;  4XT1 B;  4WJ4 A;  4ABN A;  3WDN A;  2OQ0 A;  1J5E L;  3PCO B;  1I4R A;  5M3F G;  4EGV A;  1RKN A;  2HIV A;  3AFQ A;  1SRU A;  3CU7 A;  2AWN A;  3QWN A;  3GTJ H;  4MN3 A;  1BO0 A;  4YHH L;  4FXK C;  4HIK A;  2MNA A;  4A3E G;  4YY3 Q;  1VQG A;  4QIW E;  2K01 A;  3UE1 A;  4DNR B;  2F52 A;  4A3L G;  3TN2 A;  3M4P A;  5IWA Q;  3PIO 3;  2M2L A;  2B63 H;  1A0I A;  1QVG A;  4IPG A;  5M5Y B;  4IUV A;  3M4Q A;  1X9N A;  3J80 L;  2CKZ B;  1P16 A;  1SYF A;  1V1P B;  4UPA A;  2BOS A;  3UI2 A;  3FHW A;  3DEO A;  2XGT A;  2IWH A;  1VQH A;  5HGQ A;  4ZRZ A;  3X3M A;  3MXP A;  3J80 c;  3MVV A;  1R9T H;  1N32 L;  4HR7 B;  5E4W C;  1A2T A;  4GZY C;  1LTI D;  3OWF A;  3IRB A;  2JA8 G;  3SDZ A;  2SNS A;  1P8L A;  2K4K A;  3GTK H;  3A0J A;  2HCC A;  1HNX L;  2L4N A;  4A3C G;  4HCE A;  1UE1 A;  1AH9 A;  4KN7 C;  1BBX C;  3TRE A;  4DR6 L;  1TWF B;  4CBV A;  4RMF A;  4A3M H;  3H0G G;  1L1O C;  1KNA A;  1T5X D;  3OTO L;  3P20 A;  2WKC A;  4C3H B;  3MXU A;  1EU3 A;  5LHY 1;  1GD7 A;  1TY2 A;  2D0P A;  1KRS A;  1CA6 A;  3J7A F;  3SEB A;  2NVQ H;  2B2W A;  3S16 B;  2GVA A;  3E5S A;  1I3Q B;  2NUC A;  5IGB A;  3G6E A;  1VQ4 A;  1DXM A;  1Q1E A;  1RDP D;  3VA5 A;  1VQN A;  4H13 C;  1NSN S;  2MFI A;  2LMC B;  2WP8 J;  4KHP Q;  3N6R A;  1CQV A;  1KNE A;  2WII B;  1WTV A;  1WD1 A;  4KKT A;  1NY4 A;  3H3V H;  3HOU G;  1LT3 D;  3GTQ B;  3I8Z A;  1X6O A;  2IJ0 A;  3NEM A;  1GJX A;  5IP9 H;  3CCE A;  1CM9 A;  1CK1 A;  2DY8 A;  4B08 A;  1DGS A;  5JJI A;  3H3V C;  5E3F A;  3MC0 B;  1A62 A;  1ET6 A;  3U9O A;  1JB3 A;  1SYE A;  5M5Y H;  4LF4 L;  4IFD H;  5M9O A;  5D3I B;  1VMC A;  4QUF A;  3LNN A;  1U4M A;  1IYU A;  1S72 A;  1KQS A;  5C4X B;  1I94 Q;  5CMD A;  1EIF A;  2EXD A;  1II3 A;  1Y1V H;  4X65 L;  4WFN 3;  2EOT A;  1Y14 B;  1SNO A;  3TSS A;  4O2D A;  1F9Q A;  4AIM A;  1ZXT A;  2K14 A;  3D31 A;  1HH2 P;  3ER0 A;  3BZC A;  4HJA A;  5ELE A;  1E22 A;  1XJV A;  4R1J A;  1A3V A;  3TEH B;  4NXN L;  1SE4 A;  3SK5 A;  1CA5 A;  3HOW G;  1N33 Q;  3FKI G;  2EYJ A;  1YIJ A;  5C3E B;  2F0D A;  4FP5 D;  2YYZ A;  2QGQ A;  1EUJ A;  4NXM Q;  1H9J A;  1W3S A;  2RQX A;  5D65 A;  4C3H H;  1TS2 A;  1XMO Q;  2KA7 A;  4G7H C;  5FLM H;  3CKI B;  1M8A A;  5A35 A;  1ML0 D;  2L9H A;  4DUY L;  4OO1 G;  5LL6 X;  1TWC B;  3M3Y B;  2JP1 A;  1I3Q H;  2JA7 B;  3VR6 A;  4DV0 Q;  1SBB B;  2QDL A;  3EN2 A;  5HUR A;  3A74 A;  5ELC A;  2E5L L;  3PF4 A;  5COR A;  2O4X A;  1Q8I A;  1BXT A;  3H94 A;  4JV5 Q;  2WV6 D;  4CJ1 B;  4YCW A;  3S17 B;  1N34 L;  2VNU D;  1HA5 A;  3F2U A;  1KRT A;  4DV6 Q;  2K28 A;  5E4X A;  5E7N A;  2E2D C;  4DA2 A;  1BQQ T;  4PQX A;  1RCV D;  4QY7 A;  4LUZ A;  3MFG A;  3C46 A;  2PQA A;  1EY4 A;  3NWS A;  1DOM A;  2AQ3 B;  2UUC Q;  3FMC A;  1UE5 A;  3G71 A;  4JI5 L;  1VQL A;  3NTK A;  2PW5 A;  4IQZ A;  2D2C C;  5IGF A;  4L6T B;  4QCL A;  4CKB A;  4BXX G;  1B8A A;  4HIO A;  3T1Y Q;  1BNZ A;  4N8F A;  3HS0 C;  4GKJ L;  4C3I B;  1ZYR D;  2G5D A;  3Q22 A;  1SYC A;  4I7Z C;  3C2P A;  2UUA L;  3SGI A;  4DK6 C;  5ELN A;  1EQQ A;  2LXK A;  2CFM A;  2R3Z A;  1NCV A;  3AQQ A;  4B3M L;  1PTO B;  1BOS A;  2AHO B;  2RCF A;  1H9R A;  3MEF A;  1I4X A;  1VQA A;  3E6Z X;  1K3R A;  4A3B G;  3HOX B;  2AWO A;  4IJL A;  1IKM A;  2F0H A;  4HIM A;  1Z9F A;  3M4O B;  3M4Y A;  2B3G A;  2ZXO A;  3CCU A;  1ENF A;  1HPC A;  4DR1 L;  2N8N A;  3CCJ A;  3PUZ A;  4DV2 L;  4A93 G;  2HCI A;  1H9S A;  1RL2 A;  1X65 A;  2EY6 A;  2F0J A;  3CQZ B;  1G29 1;  1OXU A;  1VQF A;  3RLN A;  5BR8 L;  4FF1 A;  3N52 A;  1IL2 A;  3PQI A;  1B9N A;  3QOJ A;  4YWM A;  3VR2 A;  4UDU C;  2CH4 A;  3J7Z C;  2QIL A;  3T1H Q;  1EWH A;  4DAM A;  4K8I A;  4K14 A;  3EJI A;  3S15 H;  2CHB D;  4A3G B;  4KHZ A;  3C3L A;  3J80 i;  4JOI A;  2B2W C;  4OIJ A;  4DV4 L;  3OMC A;  2XIW A;  2Z4H A;  2EQS A;  4ZUJ A;  2P5Z X;  2KCC A;  1NMF A;  2UXB L;  1WCM H;  4DR2 Q;  1LM0 A;  1LV9 A;  4RGN A;  2PNR C;  2R93 G;  1LTB D;  5FLX c;  4JK1 C;  4IUN A;  2PQA B;  5D3D A;  4P72 A;  1K73 C;  2EDG A;  1I94 L;  2N49 A;  5LL6 S;  3HOZ H;  3X3N A;  1QVF A;  2NVY H;  4G57 A;  4B3S Q;  1X32 A;  1PLF A;  1FNW A;  3H91 A;  1LTS D;  2VQF Q;  4DU9 A;  1KD1 C;  5CC4 A;  2RSN A;  3K81 C;  3UE0 A;  4R8N A;  3NQI A;  3RZD H;  1STG A;  4JI1 L;  3KF6 B;  4LUO A;  3K6O A;  1NE3 A;  4IOC A;  4BBR B;  1XNQ L;  1STH A;  3HOX H;  2E2J H;  4G7O C;  5LMU Q;  4C2M H;  3EFX D;  3CPW A;  5K36 G;  3J7A V;  5ELB A;  4LFB L;  3WWV A;  2F0V A;  2IW3 A;  4XT3 B;  1SND A;  5FKA C;  4LK1 C;  2A5H A;  1VQP A;  1WTH A;  2WIN B;  1S3O A;  2B2U A;  4DUZ Q;  1H9S B;  3BVM A;  1Z7T A;  3HKZ E;  3J81 L;  1NNX A;  3IKJ A;  1BCP D;  2H5X A;  3I56 A;  3QIA A;  3J81 E;  4POF A;  2IHE A;  2OEO A;  1V9P A;  2O5I C;  2SNM A;  3HOY B;  2RKS A;  4A3G H;  2CQA A;  3M7G A;  4LFC L;  1TWG B;  5I4D A;  4LF9 L;  2XVS A;  2EY1 A;  4YIJ A;  2XRS D;  1M1K C;  2F4I A;  1DOL A;  3SE0 A;  4PMC A;  4BBS G;  4JYA Q;  1FJG Q;  2ENB A;  1D1I A;  2K5H A;  4L8J A;  4Y7N H;  1Q86 C;  4DGZ A;  2FIN B;  4CKC A;  3PIP 3;  4DR5 Q;  4KD4 A;  3I4M H;  3CW2 C;  4K5W A;  2XSC A;  4QIW B;  2A1A A;  4DR7 L;  4JBW A;  2B63 G;  4IN3 A;  3PGZ A;  4G7Z C;  1STY A;  5EAY A;  4BY1 G;  1K8O A;  4GLV B;  3S1N B;  5FJ8 H;  1Q8K A;  2OWO A;  5CBE E;  1TWH B;  1X3G A;  2EVB A;  1U9R A;  4RCN A;  1IHZ A;  3GTG H;  3OOC A;  2HUG A;  2I07 B;  2VUM G;  4DR4 L;  2F0M A;  2EPB A;  4BY7 H;  3I4N G;  4LWC A;  2BE5 D;  4PZ8 A;  3MAQ A;  1I50 B;  3GP7 A;  1ESF A;  4X3U A;  1A3T A;  3A54 A;  1J5E Q;  3PO2 G;  1EQT A;  3CAM A;  4XQQ A;  3D0F A;  2MGS A;  3TME A;  2V1C C;  1LTL A;  4F87 A;  1KXL A;  2C5C A;  4LFA Q;  1E0B A;  4A3J G;  1HNW L;  1GUT A;  5CV9 A;  4LW1 A;  3ICE A;  1SNP A;  1PRT B;  4YHH Q;  1SYG A;  3CP0 A;  1X3F A;  1MD2 D;  1VQ9 A;  1I6H B;  1D1K A;  5A2Q L;  3ULL A;  5LMN L;  2JN4 A;  2R7Z B;  1GO3 E;  3K5N A;  4CDC C;  1VQK A;  5A2Q E;  1TWG H;  2QF7 A;  1EQR A;  4RAU C;  1AP0 A;  2JYO A;  3HZX A;  1I4H A;  3CXC A;  1IYJ B;  4HSP A;  5M3M B;  4IPD A;  4RWS C;  1ZKO A;  4RFB A;  1N32 Q;  1Y1W B;  1XX8 A;  2E2I B;  4JOI C;  3T16 A;  3HOV H;  4X3S A;  3BS1 A;  1SSO A;  2EY2 A;  4AYB G;  4GNX A;  4M1U B;  3Q24 A;  5EPK A;  4B3S L;  5K5P A;  1IW7 D;  3M85 A;  1DCZ A;  4PMB A;  2KHS A;  1HNX Q;  4PMW A;  2F0L A;  3I4L A;  2A8V A;  1PYB A;  1QNK A;  2NN6 G;  2EYM A;  1LTA D;  4DR6 Q;  1VQ6 A;  3S1N H;  1EIY B;  1V43 A;  4A3I B;  2F0F A;  2TSS A;  3OTO Q;  2FHT A;  1HR0 Q;  4B3R L;  3Q23 A;  3TZD A;  1U4P A;  4M8A A;  2R7F A;  5IYD H;  1NJI C;  4B9W A;  3E0J A;  2E2H B;  1JWS D;  1QB5 D;  2B8F A;  1TQO A;  4CJ0 B;  1K3B C;  4IUU A;  4DPG A;  1H9K A;  4BA1 I;  4RKB A;  3FRP B;  3GTO B;  5DEH A;  5EJW A;  1PFB A;  2JA6 H;  1X54 A;  3I72 A;  1PH6 A;  2A69 D;  4QQB X;  5BN4 A;  1WTX A;  1O7I A;  3S2D H;  5C6A A;  3VYU A;  1W6K A;  4UHV A;  1TVX A;  3L7Z C;  3CC2 A;  3S1Q H;  1D2B A;  5EBC A;  2YV5 A;  2IPK D;  1YHB A;  2Z1C A;  5C0X I;  4OEL B;  4UP7 A;  2D0O A;  2B39 A;  2CWP A;  1PRT C;  4DV5 L;  2DJF C;  2MPM A;  2PZW A;  3JAM L;  4LF4 Q;  3NUC A;  4TKO B;  1U0L A;  2OCE A;  3JAM E;  3CRK C;  3S9W A;  1F2M A;  4KMU C;  4GN5 A;  5M3M H;  1KIX A;  1R9T B;  2K33 A;  4X65 Q;  3OHX C;  1YEZ A;  2SOB A;  1DM0 B;  4LNQ A;  1YVC A;  3HGB A;  2QEJ C;  2NZH A;  1SFO H;  5FOB B;  1VQC A;  4KY7 A;  3GTK B;  3BVG A;  1L1O B;  2K6A A;  5I2Y A;  1IYV A;  2Q2U A;  1EZ8 A;  1IBM L;  1RJT A;  3MFY A;  4NXN Q;  2PNH A;  1YNJ D;  4GNX B;  5C4X G;  5C5L A;  5M5W H;  4A3I H;  2AKW B;  2RDF A;  3VR4 A;  1GM5 A;  1D5X C;  1E2W A;  3CCS A;  4RGM A;  4DUY Q;  1KAA A;  1CHP D;  2KCN A;  2DY7 A;  1BCP C;  1A3U A;  1AFP A;  3GTO H;  3DWA A;  4CGY B;  1Q7Y C;  5BN5 A;  2E76 C;  1TKW B;  3K59 A;  1SEB D;  1EYA A;  5IYC H;  2HT1 A;  3OW7 A;  1STA A;  2VL6 A;  5C3E G;  4LF8 L;  2E5L Q;  3DWP A;  4LFA L;  4IPC A;  4N9P A;  2A6E D;  3I2Z A;  1N34 Q;  4PZ6 A;  1WTR A;  1PH8 A;  4L63 B;  1LTG D;  5HGT A;  2FMM A;  3NBH A;  1AZP A;  4L5Q A;  2KUM A;  1S5F D;  3KBX A;  1LTT D;  3PO3 H;  2N55 A;  2VB3 X;  2JA5 B;  2JA7 G;  3UDX A;  3OMG A;  2LXJ A;  4JBJ A;  2L12 A;  2N78 A;  5I2X A;  1IXR A;  1PV4 A;  4JI5 Q;  1KDB A;  1OTC A;  1Y1V B;  3GTL H;  2NVX B;  2KHJ A;  4KHV A;  1K28 A;  2B8G A;  3WOE A;  1E3P A;  1AZQ A;  2WKD A;  3PUV A;  1TXY A;  3R93 A;  3AMU A;  1K8A C;  3F1Z A;  4GKJ Q;  1FNV A;  1EY8 A;  1HRJ A;  1JOK A;  5C4J B;  2EYF A;  1L2F A;  2R61 A;  2UUA Q;  1B4O A;  4HJ9 A;  1HCZ A;  3PIO A;  4F7X A;  1CTM A;  2ZXP A;  2VS1 A;  4B3M Q;  1AEX A;  4JCV E;  4B9X A;  4CKE A;  2BE5 C;  2TMP A;  1JCK B;  3DLL A;  1HR0 L;  2PCF B;  4R4Q A;  1DOK A;  3TBI B;  4GNX C;  5IP7 G;  5GAG C;  4DR1 Q;  2L0C A;  1Q82 C;  4DV2 Q;  4C3I G;  3NP8 A;  5G3L F;  3VR3 A;  1KLU D;  4IAL A;  3JC6 6;  2I5L X;  2OXP A;  1ICF B;  2OF1 A;  1GHJ A;  5BR8 Q;  2WAC A;  1STE A;  3QB3 A;  1QZH A;  2NWG A;  4LF5 L;  1H9M A;  1WTW A;  3HOX G;  3RNU A;  2XWB B;  2V4D A;  1K8G A;  3T56 B;  1EIH A;  4A3F H;  1N9W A;  1STN A;  2B2Y A;  3J7A 5;  3EQL C;  4DV4 Q;  1JT8 A;  3K80 C;  4K6L A;  4R8I A;  1GUO A;  3TQY A;  1WOC A;  2UXB Q;  1WFQ A;  4N8X 1;  1S5C D;  3KJO A;  2R92 B;  5EQ0 A;  3GTP H;  2JA5 H;  4PG3 A;  1KAW A;  1XPU A;  2KOL A;  2WFW A;  1TII D;  1VQ7 A;  3EIV A;  3HKZ B;  4HJ5 A;  3NBH B;  1PVO A;  2LSS A;  3O13 A;  3ERQ A;  4KD3 A;  1PH1 A;  3S14 H;  1Q3L A;  1LYL A;  1QJO A;  4H44 C;  2CQO A;  2NVX H;  1IW7 C;  3P7J A;  1GUW A;  3ERS X;  1U5K A;  2RF4 A;  3NSW A;  4HSV A;  1OO9 B;  3TDQ A;  3HP3 A;  1YNX A;  1QNU A;  1O7Y A;  5C4J H;  3U4Z A;  2BA1 A;  5IYB G;  1C7Y A;  5GAH C;  4JI1 Q;  1E7Z A;  1VQM A;  4R9W A;  4APV A;  1K83 H;  4OO1 I;  2Q8I B;  4NB3 A;  3TS2 A;  1LUZ A;  1XNQ Q;  4AQY L;  4QF4 A;  2ICE C;  2XNA C;  3QG1 A;  2YU9 B;  3EBE A;  2F0S A;  4JC0 A;  1SLJ A;  1UUP A;  1D5M C;  1BVS A;  4A75 A;  3CCL A;  3L0O A;  1QCB D;  2HD3 A;  3W1G A;  4LFB Q;  1Q81 C;  5GAE C;  1MGS A;  1EFW A;  3MHB A;  3VYT A;  2A69 C;  2Y0S E;  4PZ7 A;  4YWL A;  4JI4 L;  3T53 B;  4LUV A;  1DZ1 A;  3ULJ A;  1CT1 D;  3E9I A;  2A6H D;  1R4Q B;  4GKK L;  4BBR G;  2PPB C;  1CSQ A;  1D5Z C;  3BYT B;  2UU9 L;  1AE2 A;  3DHQ A;  2KVM A;  4V19 0;  3PUX A;  5JAV A;  3URY A;  3S15 B;  3CC7 A;  4A3E B;  5C44 H;  1JJ2 A;  1KLG D;  2Q2I A;  3H6M A;  4LFC Q;  1K0S A;  4LF9 Q;  2PYK A;  1ET9 A;  1WCM B;  5KNB A;  3TRZ A;  5T1G A;  1BF4 A;  3KLS A;  2K5Q A;  1C4Q A;  3MA2 B;  4EQN A;  2R92 H;  3KLW A;  2K32 A;  3B6Y A;  3A5U A;  4DAY A;  4EQO A;  3HOZ B;  1T9H A;  4J15 A;  1EY7 A;  2RSO A;  1QG7 A;  1H95 A;  5C0X H;  2L15 A;  1TS4 A;  1CFM A;  3HOY G;  2NVY B;  4FNF A;  1KTK A;  5I9O A;  2AQ1 B;  2A74 C;  1YNJ C;  4JPB W;  4DR7 Q;  5IGD A;  4WOR A;  5CV5 A;  1EEI D;  5JVH 3;  5JVG 3;  1Z6H A;  5M5X H;  5H1S E;  4KN4 C;  4JBM A;  1ENC A;  3RZD B;  4JI8 L;  3ONA B;  2E8G A;  5IY0 A;  3S16 H;  1G2T A;  4MTK A;  5JEA G;  3MTS A;  2D62 A;  1LO5 D;  2BCO A;  2RDH A;  2E2J B;  1IKL A;  4C2M B;  1PZJ D;  1SR3 A;  3DUZ A;  4CHT B;  1D7Q A;  4DR4 Q;  2YU9 H;  3OSO A;  3DM1 A;  4FF3 A;  1B9M A;  2HDL A;  1JJC B;  3SK6 A;  1QE6 A;  3I90 A;  1XTC D;  5GRO A;  2LKV A;  5I9P A;  4NKL A;  1DJR D;  3ND9 A;  2K75 A;  3NTH A;  2FFK B;  1S5D D;  2EYO A;  2QW7 A;  1UEB A;  1PMR A;  5M3F H;  2B2T A;  4L5S A;  3MEH A;  4QUC A;  3KLS X;  1E24 A;  1HNW Q;  5FO9 B;  2IT1 A;  1JB7 A;  1DD2 A;  1CKO A;  1CKM A;  2JXM B;  2WB1 G;  5IYD G;  1XPR A;  1TS3 A;  2WAQ G;  1HFG A;  1SYD A;  4A3E H;  3VDY A;  1F77 A;  5C4H A;  2CCZ A;  3H15 A;  5LMN Q;  4I65 A;  4AYB E;  3DWQ A;  1VMP A;  3KDF A;  1ENA A;  1DYQ A;  4ZLT F;  4A3L H;  2E75 C;  4KV6 A;  2F0E A;  1WD0 A;  4TSS A;  2PI2 A;  4RHS A;  1N36 L;  1B44 D;  3QO2 A;  3HG9 A;  3CCQ A;  3PUW A;  5J39 A;  1O78 A;  4Y7N B;  2KCM A;  4LF7 L;  4MTN A;  1S4Z A;  3D6C A;  4KKU A;  2B2Y C;  1RTN A;  4NW2 A;  3I4M B;  1GOZ A;  3ZYY X;  1KL9 A;  1WJJ A;  1HQM C;  4DAY B;  2UUB L;  2EYP A;  4RGO S;  2VW9 A;  1PYS B;  2R7Z G;  5L37 A;  1F9P A;  3GO5 A;  1UNS A;  1X3Q A;  1X3P A;  4A3K G;  1FNU A;  2GA4 B;  4A3C H;  3F2C A;  5M3M G;  4C3J B;  2F0O A;  1HFN A;  1XNR L;  2D9U A;  1HTL D;  1Y1W G;  1MKH A;  1U4R A;  3GTG B;  4B3R Q;  4UAI A;  1EY9 A;  1E1O A;  1EU4 A;  3I91 A;  2QA4 A;  4BY7 B;  2JSO A;  4J1M A;  2O5J C;  1PA6 A;  4Q0F A;  5EKL A;  3AFP A;  5JPM C;  3BVZ A;  3K5L A;  1RTO A;  3TP7 A;  4A76 A;  5KNC A;  2F3I A;  2XRQ D;  2XN9 C;  2EY5 A;  5JEA J;  5CV7 A;  5JJZ A;  3L9A X;  4HTH A;  1UWV A;  5KIX A;  4KJN A;  1EL0 A;  5JJK A;  1X55 A;  1HQR D;  2M9V A;  4JI0 Q;  1D6E C;  3Q6S A;  3F8T A;  4IJH A;  2Q8T A;  1EIG A;  2ICI A;  5I6W A;  3HOU H;  1RF2 D;  3E9H A;  2B2V A;  5CGK A;  3J81 c;  2X6G A;  4DK3 C;  1NTG A;  1B2T A;  1EZ6 A;  4DV5 Q;  4GLX A;  1JQY D;  4P74 A;  5IIF A;  4U68 A;  3BDO A;  5IGG A;  3AYH B;  1GUN A;  3KDF B;  3W2D A;  4OIK A;  3DXJ C;  4GS3 A;  1MHW C;  1SMX A;  2CWA A;  2K03 A;  3RR5 A;  3HOV B;  4ME3 A;  1M4V A;  5IOC A;  2NZ1 D;  2YTV A;  4DV7 L;  1XMQ L;  1SYB A;  4E6I A;  1VCI A;  4L5R C;  4QL5 A;  2BH2 A;  3G7L A;  3RLF A;  4DV1 L;  1PFM A;  1SXT A;  3PSI A;  4H02 A;  1YBY A;  1IBM Q;  4G4K A;  2NVT H;  3T51 B;  1GUG A;  4K8J A;  4OWX B;  3J7Y W;  3KJP A;  5EBD A;  3G6J B;  4IPH A;  1XXG A;  4C3J H;  3HOW H;  5EGT A;  1HZC A;  1WYD A;  4RHR A;  2NTT A;  4XQN A;  1GVP A;  1UEA B;  4NMZ A;  1EOT A;  3K0X A;  1YZ6 A;  2RDG A;  5F2D A;  2Z8L A;  3PIP A;  4LAA A;  1QUQ A;  3ULP A;  3RD4 A;  5ISR A;  1AE3 A;  4DFA A;  4R4O A;  4DV3 L;  1IBK L;  3S2H B;  4QB4 A;  2SDF A;  1SN8 A;  4OO1 H;  3M7N A;  2JA6 B;  1VF5 C;  4A3M G;  1CI3 M;  2AUJ D;  4LF8 Q;  3RZO B;  3R3O A;  4TVA B;  1I5F A;  2BDN A;  3S2D B;  3A55 A;  2VY3 A;  3CC4 A;  1J9O A;  4GN3 B;  1UAP A;  2L1B A;  5T1I A;  1YI2 A;  1BKB A;  2F0P A;  3V05 A;  3HRZ C;  1EYG A;  3S1Q B;  4XQJ A;  3IFT A;  2F0Q A;  2RHQ B;  4BA2 I;  4Y52 H;  1CKN A;  1PFS A;  3K8A A;  3FPP A;  2B2T C;  2I46 A;  1F9R A;  2QCP X;  4K5V A;  4A3D B;  1IBL L;  4X64 L;  1EY0 A;  2LS0 1;  4H7B A;  1PH9 A;  3I73 A;  4K2K A;  3CHB D;  1ZYR C;  2NN6 I;  2NB0 A;  3PUY A;  1JE4 A;  2IL8 A;  2K7V A;  1LAB A;  3U58 A;  2JA9 A;  4K0K L;  5IP9 G;  1HZB A;  1SFO B;  3NPP A;  5EPJ A;  3KOJ A;  4X3K A;  3TP8 A;  4OHJ A;  1Y69 U;  2L55 A;  3R2I A;  4XYQ A;  2JA5 G;  1EQV A;  2CVR A;  4IFD G;  2HHH L;  5LMN W;  4O0A A;  2K50 A;  3W1B A;  4IOA A;  4F88 A;  2MO0 A;  1F2Y A;  3S1R H;  2EJG C;  1Y1V G;  5M5W B;  2ES2 A;  4A3B H;  5J3B A;  3C1F A;  1EWI A;  1SE8 A;  4JG2 A;  4C1N I;  2ZJR A;  2I0Q A;  2ZTE A;  2ZTC A;  1BCP B;  2HDM A;  2RVL A;  3K7U C;  2NYZ D;  2FJ2 A;  4OX9 L;  1FGU A;  1E1T A;  4A93 H;  5AFW A;  2EYL A;  2KBN A;  3U4V A;  4HMI A;  3S2H H;  1HZA A;  4FDB A;  1QUQ B;  4LF5 Q;  2GVB A;  2L5T A;  2B29 A;  4IUR A;  4OEM B;  2ATW A;  3RZO H;  4EX5 A;  1VF7 A;  4C3H G;  1MIU A;  3VYR A;  4TRD A;  2DGY A;  3U50 C;  3IL8 A;  1PH7 A;  4JI0 L;  1A6X A;  4DR3 L;  1WTQ A;  1OXS C;  2EZV A;  2UXD L;  2PZU A;  5FLM G;  2VQE L;  1JMC A;  2VB2 X;  5IOD A;  3SXH A;  3DEP A;  2Y0S B;  3PO3 B;  2N3S A;  4JW0 A;  2B2U C;  3ERO A;  4L5T A;  4BBS B;  2NZO A;  2R93 H;  1KHI A;  4A3D H;  2EYH A;  3ND8 A;  4NDX A;  3GTL B;  1MSH A;  3A7A B;  1YJW A;  1PH5 A;  3JAM c;  1PTO F;  1EYC A;  2F0I A;  1VQO A;  5EPL A;  1FYC A;  1UE7 A;  3C1E A;  3OPO A;  2RCN A;  1G6P A;  3LWU A;  2C9O A;  3SHL A;  3H09 A;  1HJP A;  2R92 G;  1JJG A;  4IUP A;  1ASZ A;  4XDX A;  1SNM A;  1CSP A;  3PMF A;  4YWK A;  4ILW A;  3HKZ G;  3BDL A;  1HA6 A;  1K9M C;  4QJF A;  2F3W A;  2Z6K A;  4AQY Q;  4JI2 L;  5C0X G;  4LJZ C;  3NBI A;  3M9B A;  1VQI A;  4JI3 L;  3D4R A;  1UE6 A;  2LY7 A;  5KGU A;  5K36 H;  5JOB A;  4JBK A;  4KLK A;  4IFD J;  2BH8 A;  3J81 i;  1M90 C;  4JI4 Q;  2OTJ A;  1B53 A;  2M00 A;  1SDF A;  1SMY D;  5J22 A;  3CMA A;  3BZK A;  4GKK Q;  4ULL A;  4PNY A;  2DN8 A;  2UU9 Q;  3PF5 A;  1F2L A;  4OL7 A;  4A3F B;  4CDD C;  4NP5 A;  4OWW B;  2R7D A;  5I6Y A;  2KQ3 A;  3BJU A;  2PI2 E;  3R2T A;  2Z9H A;  4DF7 A;  1HNZ L;  4DKA C;  2YTY A;  4ID6 A;  1SRO A;  2E74 C;  2O2L D;  2CH4 W;  1XYI A;  1TWA B;  2BA0 A;  4WJ3 M;  5CR3 A;  1WI5 A;  4V0B A;  1B70 B;  1C9O A;  3GTP B;  3HFZ B;  3Q8D A;  1OXV A;  4BBS H;  3IFD A;  1PXU A;  2VZA A;  1LAC A;  1JWU D;  1S40 A;  5CV8 A;  3S14 B;  1ILP A;  2F0K A;  3F2B A;  1FVI A;  3BG3 A;  2PO4 A;  5IE8 A;  4B3T L;  2X69 A;  3W3A A;  4X62 L;  3A8J E;  4AYB B;  1SE3 A;  4X66 L;  5BN3 A;  3CCR A;  1R4P B;  1WCM G;  1SNC A;  3K0Y A;  2F4V L;  4DNI A;  4JI8 Q;  2H1E A;  1LT5 D;  5C3X A;  4BY1 H;  3J80 E;  4HMJ A;  4DNT B;  1K83 B;  2D5D A;  2EJF C;  1KAB A;  3HOZ G;  4AH6 A;  2KJX A;  4WJW A;  2ZM6 L;  4LF6 L;  3SK4 A;  4POG A;  2WB1 E;  3G4S A;  1NAP A;  2L11 A;  1O80 A;  2WAQ E;  1SE2 A;  3STB D;  3TP6 A;  2VUM H;  2C35 B;  3A7L A;  1VQD A;  2EE1 A;  3I4N H;  3S1M B;  4P71 A;  5DM7 3;  1HUM A;  4IO9 A;  4KY5 A;  2F03 A;  3PO2 H;  2PMZ E;  4KY6 A;  5DM6 3;  5C0X J;  4A3J H;  3KYH C;  2SEB D;  4R4C A;  4FXD A;  1B50 A;  2H4O A;  4ZAI A;  5C44 B;  1Q12 A;  3I55 A;  1DON A;  5C3W A;  3UDF A;  2ZXR A;  2UXC L;  1HR0 W;  1PYW D;  4XYO A;  4UP9 A;  3BDC A;  1TWA H;  1PTO D;  1QWY A;  5NUC A;  1MBY A;  3NTI A;  1L0Y B;  4RCO A;  2A73 B;  1N36 Q;  2BDO A;  3RMH A;  4UP8 A;  4LF7 Q;  3UDG A;  5KND A;  1GHK A;  3K57 A;  1Q1B A;  3AEV A;  1QIL A;  1Y8P B;  5CV4 A;  1ILQ A;  2MO1 A;  1S5B D;  2QKI C;  4A3G G;  2UUB Q;  3AB9 A;  3CRL C;  3W5O A;  3I4O A;  5M5X B;  3D4W A;  4XIG S;  1F2Z A;  2K5D A;  1I6V C;  4ALP A;  3R8B A; 
#chains in the Genus database with same CATH homology
 1N36 L;  2V1C C;  1LTL A;  2HIX A;  4X6A H;  1KXL A;  5ELO A;  3CCQ A;  3PUW A;  4GOP C;  4LFA Q;  1YIT A;  2KCM A;  4LF7 L;  4QGU A;  4A3J G;  3NEN A;  4MTN A;  1W2B A;  1XNR Q;  3RN2 A;  1HNW L;  4LW1 A;  3ICE A;  4R4T A;  2IHF A;  4YHH Q;  3I4M G;  3ZJY C;  3CP0 A;  5JJL A;  1X3F A;  1KC8 C;  3GDE A;  1KL9 A;  1VQ9 A;  1A63 A;  1WJJ A;  4DAY B;  2UUB L;  2E2H H;  3ULL A;  2VW9 A;  1C0A A;  1PYS B;  2R7Z G;  5LMN L;  4WJ4 A;  5AJ3 L;  1GO3 E;  3GO5 A;  1VQK A;  3S1M H;  2OQ0 A;  1TWG H;  1EQR A;  1J5E L;  3PCO B;  3CCV A;  5M3F G;  4A3K G;  1Q46 A;  5FJ8 G;  4A3C H;  3F2C A;  3CXC A;  2Z6K C;  1IYJ B;  1GKH A;  5M3M G;  4UY8 C;  2HIV A;  3AFQ A;  1TWF H;  1SRU A;  2AWN A;  4IPD A;  3GTJ H;  1XNR L;  1N32 Q;  1Y1W G;  1MKH A;  4YHH L;  4B3R Q;  2Q2T A;  4JOI C;  3HOV H;  4HIK A;  1E1O A;  4BY7 G;  2MNA A;  2QA4 A;  4A3E G;  4YY3 Q;  1VQG A;  4QIW E;  3JAM i;  1N33 L;  4AYB G;  3UE1 A;  4GNX A;  3FP9 A;  1PA6 A;  2F52 A;  3AFP A;  4B3S L;  4A3L G;  3M4P A;  5IWA Q;  3M85 A;  1HNX Q;  4PMW A;  4A76 A;  1A0I A;  1QVG A;  4IPG A;  2B63 H;  3M4Q A;  4A4I A;  2A8V A;  1X9N A;  2F3I A;  2CKZ B;  1P16 A;  5JEA J;  4UPA A;  2ZJP A;  1PYB A;  3FHW A;  2NN6 G;  1UWV A;  4DR6 Q;  2XGT A;  1VQ6 A;  3S1N H;  1EIY B;  1VQH A;  5JJK A;  1V43 A;  5HGQ A;  1X55 A;  3OTO Q;  3J80 c;  1R9T H;  1A8V A;  1N32 L;  1HR0 Q;  4JI0 Q;  4B3R L;  1N8R C;  3DM3 A;  4DV7 Q;  2R7F A;  4IJH A;  3F8T A;  4BY7 H;  5IYD H;  1XMQ Q;  1NJI C;  1X56 A;  3IRB A;  4YY3 L;  4MZ9 A;  2JA8 G;  3E9H A;  3J81 c;  3GTQ H;  3HOU H;  2K5N A;  1P8L A;  4DK3 C;  2K4K A;  1NTG A;  4DV1 Q;  5IWA L;  3S24 A;  3GTK H;  3A0J A;  3CPF A;  1HNX L;  4DV5 Q;  4DPG A;  1NMG A;  2EIF A;  4BA1 I;  4GLX A;  4XTC S;  4A3C G;  1UE1 A;  2KHI A;  4P74 A;  2ASB A;  1AH9 A;  3TRE A;  1X54 A;  2JA6 H;  4DR6 L;  3AYH B;  3KDF B;  4RMF A;  4A3M H;  5C4X H;  3H0G G;  1PH6 A;  4QQB X;  4GS3 A;  1L1O C;  1YJ9 A;  1SMX A;  2CWA A;  3OTO L;  4JV5 Q;  1O7I A;  3S2D H;  3HOV G;  3RR5 A;  4ME3 A;  4DV7 L;  2YTV A;  1GD7 A;  1NBW A;  3L7Z C;  1XMQ L;  3CC2 A;  3S1Q H;  3KFU A;  2D0P A;  1KRS A;  1MJC A;  2YV5 A;  3KF6 A;  1VCI A;  1YHB A;  4GLA C;  5C0X I;  4L5R C;  4QL5 A;  2BH2 A;  3RLF A;  2NVQ H;  4UP7 A;  4DV1 L;  2D0O A;  4DV3 Q;  1IBK Q;  2CWP A;  2GVA A;  3PSI A;  4H02 A;  4DV5 L;  1YBY A;  1IBM Q;  1VQ4 A;  3G6E A;  4LF4 Q;  1Q1E A;  2NVT H;  1VQN A;  1OXX K;  1U0L A;  3LGJ A;  2OCE A;  4OWX B;  3KJP A;  4IPH A;  2MFI A;  2XTI A;  4GN5 A;  4C3J H;  1HZC A;  1WYD A;  5M3M H;  5C3E H;  2WP8 J;  4HJ7 A;  1YJN A;  3MXN B;  1KIX A;  4KHP Q;  1GVP A;  4X65 Q;  1NY4 A;  2R6G A;  3K0X A;  1YEZ A;  3H3V H;  1YZ6 A;  3GTM H;  3HOU G;  4LNQ A;  1X6O A;  4HJ8 A;  3NEM A;  1YVC A;  3PIP A;  1QUQ A;  5IP9 H;  2NZH A;  3CCE A;  3ULP A;  1SFO H;  1VQC A;  1AE3 A;  1DGS A;  4R4O A;  4DV3 L;  1IBK L;  5JJI A;  1L1O B;  2IX0 A;  2K5V A;  2Q2U A;  1A62 A;  1IBM L;  1PH4 A;  1TWC H;  3M3Y H;  1SN8 A;  5M5Y H;  4NXN Q;  2PNH A;  4LF4 L;  2JA6 G;  1VS0 A;  4GNX B;  2JA7 H;  3M7N A;  4A3M G;  5C4X G;  3G48 A;  3GD7 A;  1S72 A;  1IBL Q;  1KQS A;  4JI7 Q;  4LF8 Q;  1I94 Q;  4X64 Q;  1EIF A;  4TVA B;  1I5F A;  4KHP L;  2EXD A;  5M5W H;  1VQ5 A;  1Y1V H;  2VY3 A;  4X65 L;  4A3I H;  4GN3 B;  3CC4 A;  1Y14 B;  2AKW B;  1YI2 A;  1BKB A;  2JJQ A;  4O2D A;  1EYG A;  3S17 H;  4AIM A;  2K14 A;  3D31 A;  4K0K Q;  1HH2 P;  2RHQ B;  2A19 A;  3BZC A;  3E0E A;  3ER0 A;  4HJA A;  1GM5 A;  2JA8 H;  4BA2 I;  1E22 A;  1CKN A;  1PFS A;  1XJV A;  4Y52 H;  3K8A A;  4R1J A;  3TEH B;  3CCS A;  3J81 j;  4DUY Q;  4BXX H;  1L0W A;  2HHH Q;  4NXN L;  1XPO A;  3GTO H;  2OQK A;  1Q7Y C;  4A3D G;  5IYC H;  2HT1 A;  4GN4 B;  1N33 Q;  3HOW G;  3FKI G;  5C3E G;  2VL6 A;  1YIJ A;  1IBL L;  4X64 L;  2E5L Q;  4LF8 L;  3STB C;  1PH9 A;  4LFA L;  2YYZ A;  3K7A H;  2QGQ A;  3H0G H;  1EUJ A;  1VQJ A;  4IPC A;  1XTD A;  3RN5 A;  2NN6 I;  4NXM Q;  3PUY A;  1W3S A;  4JI6 Q;  4C3H H;  3I2Z A;  1N34 Q;  4PZ6 A;  3U58 A;  1XMO Q;  2JA9 A;  5IP7 H;  1PH8 A;  5IP9 G;  4K0K L;  4OX9 Q;  1HZB A;  4C3I H;  3KOJ A;  2I5H A;  1D8L A;  5FLM H;  2ALY B;  4L5Q A;  4DUY L;  1FL0 A;  1J6Q A;  2JA5 G;  3PO3 H;  4OO1 G;  4IFD G;  2HHH L;  2JA7 G;  3UDX A;  5LMN W;  1I3Q H;  4O0A A;  2LXJ A;  2K50 A;  4JBJ A;  3W1B A;  4DV0 Q;  4IOA A;  1JE5 A;  2N78 A;  3EN2 A;  2MO0 A;  1IXR A;  1PV4 A;  3A74 A;  3S1R H;  2E5L L;  4JI5 Q;  1Y1V G;  1OTC A;  3PF4 A;  4A3I G;  2ES2 A;  3GTL H;  5J3B A;  1HZ9 A;  4A3B H;  3L2P A;  1OXT A;  2KHJ A;  1EWI A;  1SE8 A;  4JG2 A;  4YCW A;  2ZJR A;  2I0Q A;  4NXM L;  2ZTE A;  2F4V Q;  2ZTC A;  1K0R A;  4DR3 Q;  1N34 L;  3M4O H;  4OWT B;  1E3P A;  3K7U C;  2JQO A;  1TXY A;  3PUV A;  1XMO L;  1VQ8 A;  1QVC A;  4OX9 L;  1FGU A;  1E1T A;  3F1Z A;  1KRT A;  5GQO A;  4DV6 Q;  1K8A C;  4GKJ Q;  5E7N A;  4A93 H;  2DUD A;  2VQE Q;  3CQZ H;  4QY7 A;  4LUZ A;  2PQA A;  1L2F A;  2Q2H A;  4EQ5 A;  2KBN A;  3U4V A;  2UUA Q;  4HJ9 A;  1HZA A;  4FDB A;  3S2H H;  3PIO A;  1QUQ B;  4DV0 L;  5IYC G;  2GVB A;  2AMC B;  2VS1 A;  2UUC Q;  1UE5 A;  4LF5 Q;  4B3M Q;  2B29 A;  3G71 A;  4JI5 L;  4JCV E;  1VQL A;  1QZG A;  2GN5 A;  2ATW A;  3RZO H;  2HQL A;  2VNU D;  4EX5 A;  4TQU S;  3HOW H;  3DLL A;  4JV5 L;  1HR0 L;  4BXX G;  1MIU A;  1B8A A;  4P75 A;  2DGY A;  4R4Q A;  3U50 C;  4HIO A;  3T1Y Q;  1PH7 A;  4GNX C;  5IP7 G;  1OXS C;  5GAG C;  4DR1 Q;  4DR3 L;  1Q82 C;  4DV2 Q;  2UXD L;  5FLM G;  4DV6 L;  4GKJ L;  2VQE L;  4JYA Q;  3JC6 6;  2I5L X;  1JMC A;  2Y0S G;  3PO3 G;  2UUA L;  3SGI A;  4DK6 C;  2N3S A;  5BR8 Q;  5ELN A;  3CME A;  1EQQ A;  4L5T A;  1MJE A;  2LXK A;  2Z0S A;  1QZH A;  2CFM A;  5IYB H;  2UUC L;  2NZO A;  4LF5 L;  3AQQ A;  3OW2 A;  2MQH A;  4B3M L;  2R93 H;  2AHO B;  1KHI A;  3MEF A;  1VQA A;  3HOX G;  3RNU A;  1K3R A;  4A3B G;  4A3D H;  4JI2 Q;  2AWO A;  4IJL A;  4HIM A;  3FKI H;  1YJW A;  1PH5 A;  3BU2 A;  4GOP A;  1K8G A;  3JAM c;  2ZJQ A;  4JI3 Q;  4A3F H;  1Z9F A;  1N9W A;  3T1Y L;  2B3G A;  1VQO A;  3CCU A;  4DR1 L;  3J7A 5;  1UE7 A;  2N8N A;  3CCJ A;  3PUZ A;  4DV2 L;  4DV4 Q;  4A93 G;  1JT8 A;  1BBU A;  2FXQ A;  2JE6 I;  2RCN A;  1RL2 A;  1X65 A;  3K80 C;  1G6P A;  1G29 1;  1OXU A;  3TQY A;  1VQF A;  1WOC A;  1HJP A;  2UXB Q;  3RLN A;  5BR8 L;  1WFQ A;  2R92 G;  1JJG A;  3KJO A;  1IL2 A;  1ASZ A;  2JA5 H;  3GTP H;  1CSP A;  4YWK A;  4PG3 A;  4YWM A;  1KAW A;  1XPU A;  2WFW A;  3HKZ G;  3TS0 A;  1VQ7 A;  3EIV A;  3J7Z C;  4HJ5 A;  3NBH B;  1K9M C;  1PVO A;  4QJF A;  2LSS A;  1PH1 A;  2Z6K A;  4AQY Q;  4BBR H;  1X3E A;  3T1H Q;  4JI2 L;  2JEA I;  3KF8 B;  5C0X G;  3S14 H;  4DAM A;  1LYL A;  1VQI A;  3M9B A;  2CQO A;  4JI3 L;  3CF5 A;  2NVX H;  3A5Z B;  3ERS X;  3S15 H;  1UE6 A;  4KHZ A;  4JI4 L;  3J80 i;  1HNZ Q;  1U5K A;  4JOI A;  4DV4 L;  3H3V I;  2RF4 A;  2EQS A;  2YTX A;  1YNX A;  4JBK A;  1NMF A;  4KI0 A;  4KLK A;  5C4J H;  4IFD J;  2UXB L;  1WCM H;  2BH8 A;  3J81 i;  4DR2 Q;  3U4Z A;  1LM0 A;  1M90 C;  4JI4 Q;  2OTJ A;  2BA1 A;  5IYB G;  3D0F A;  1C7Y A;  5GAH C;  4JI1 Q;  2R93 G;  1E7Z A;  5FLX c;  1VQM A;  3CMA A;  3BZK A;  4GKK Q;  2PQA B;  1K83 H;  4P72 A;  4APV A;  1K73 C;  4OO1 I;  4NB3 A;  4JI7 L;  3TS2 A;  1LUZ A;  1I94 L;  4AQY L;  1XNQ Q;  2UU9 Q;  3T1H L;  2N49 A;  3PF5 A;  4IFD I;  3HOZ H;  2RHS B;  1PH2 A;  4NPS A;  4A3F G;  3EBE A;  3F2D A;  1QVF A;  4JC0 A;  1SLJ A;  2R7D A;  4OWW B;  3BJU A;  1BVS A;  2PI2 E;  2NVY H;  4A75 A;  3CCL A;  3L0O A;  4R4I A;  4X62 Q;  1HNZ L;  3W1G A;  4B3T Q;  4DKA C;  2YTY A;  3HOY H;  4YCU A;  1SRO A;  4JI0 L;  1Q81 C;  4B3S Q;  4LFB Q;  4X66 Q;  5GAE C;  2BA0 A;  4WJ3 M;  1EFW A;  5HY6 A;  2VQF Q;  3PV0 A;  3CCM A;  4DR2 L;  1WI5 A;  2Y0S E;  4PZ7 A;  1B70 B;  1C9O A;  3K81 C;  4YWL A;  3UE0 A;  3RZD H;  3HFZ B;  1KD1 C;  3Q8D A;  1OXV A;  4LUV A;  3ULJ A;  3NEL A;  3KF6 B;  4JI1 L;  4BBS H;  3E9I A;  4LUO A;  2VZA A;  4GKK L;  2IY5 B;  1NE3 A;  4BBR G;  1S40 A;  4IOC A;  1CSQ A;  1XNQ L;  2ZM6 Q;  2UU9 L;  1AE2 A;  4LF6 Q;  3HOX H;  2E2J H;  3F2B A;  5LMU Q;  2I5M X;  4C2M H;  1L1O A;  1FVI A;  3PUX A;  3CPW A;  3CC7 A;  5C44 H;  4JI6 L;  2ID0 A;  5IE8 A;  4B3T L;  1JJ2 A;  4X62 L;  5K36 G;  4LFB L;  2Q2I A;  3RLO A;  3WWV A;  4X66 L;  4GOP B;  4LFC Q;  4OXP A;  3CCR A;  4LF9 Q;  1WCM G;  2VQF L;  2JEB I;  4P73 A;  3TRZ A;  2F4V L;  1VQP A;  4DNI A;  4JI8 Q;  1S3O A;  4DUZ Q;  2R92 H;  4RG1 A;  4BY1 H;  1V1Q A;  4HID A;  3KLW A;  3B6Y A;  3HKZ E;  2KEN A;  3A5U A;  2H5X A;  3I56 A;  4AH6 A;  3HOZ G;  3I7F A;  1TWH H;  2ZM6 L;  4LF6 L;  1T9H A;  4J15 A;  5LMU L;  4POG A;  2WB1 E;  3G4S A;  1H95 A;  4POF A;  2IHE A;  2L15 A;  1ASY A;  1V9P A;  3HOY G;  2WAQ E;  1CUK A;  2VUM H;  3STB D;  2C35 B;  2JK8 A;  1VQD A;  1YHA A;  4A3G H;  3I4N H;  1B7Y B;  1PHJ A;  3CD6 A;  4DR7 Q;  4P71 A;  4LFC L;  1I50 H;  2UXC Q;  2ZTD A;  4LF9 L;  5M5X H;  1YHQ A;  5H1S E;  1M1K C;  3UDI A;  4JBM A;  4JI8 L;  4IO9 A;  4OON A;  4BBS G;  4MNO A;  2E8G A;  1EOV A;  3HKS A;  5IY0 A;  4DUZ L;  1PH3 A;  2PMZ E;  1FJG Q;  3PO2 H;  3S16 H;  2K5H A;  5JEA G;  1CKN B;  1IZ6 A;  5C0X J;  2D62 A;  4Y7N H;  1Q86 C;  4A3J H;  3KYH C;  4R4C A;  1SR3 A;  1D7Q A;  5C44 G;  4DR4 Q;  4DR5 Q;  3I4M H;  2YU9 H;  1Q12 A;  3CW2 C;  3I55 A;  5DLQ E;  1I6H H;  2A1A A;  2KCT A;  1JJC B;  4DR7 L;  3UDF A;  4JBW A;  2UXC L;  1HR0 W;  2B63 G;  2R7Z H;  4UP9 A;  5GRO A;  1TWA H;  3PGZ A;  2K75 A;  3OYY A;  1G51 A;  5EAY A;  1UEB A;  4BY1 G;  4JYA L;  5M3F H;  4GLV B;  4A3K H;  1FJG L;  5FJ8 H;  1N36 Q;  4L5S A;  1Q8K A;  5IT9 c;  2OWO A;  4YCV A;  4UP8 A;  4LF7 Q;  1E24 A;  2K52 A;  3UDG A;  1HNW Q;  2IX1 A;  1X3G A;  2IT1 A;  1RIP A;  1JB7 A;  2OTL A;  1CKO A;  1CKM A;  1VQB A;  2WB1 G;  5IYD G;  1Y1W H;  1XPR A;  3GTG H;  4DR4 L;  2WAQ G;  1Q1B A;  4DR5 L;  2E2I H;  3AEV A;  1BBW A;  2VUM G;  2MO1 A;  4A3G G;  5GAD C;  1VQE A;  4A3E H;  4LWC A;  3VDY A;  2UUB Q;  4PZ8 A;  2CCZ A;  3H15 A;  3I4N G;  5LMN Q;  5AJ3 Q;  4AYB E;  2QEX A;  3W5O A;  3I4O A;  3KDF A;  4A3L H;  1Z47 A;  1J5E Q;  4XIG S;  2UXD Q;  3PO2 G;  3CAM A;  4ALP A;  2PI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...