1N32L

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1n32L00
1BBWA 3GD7A 5BR8L 1K9MC 2V1CC 4A3EH 1N36L 2ES2A 4BY1G 3I2ZA 4GN4B 1QZHA 3CQZH 4JG2A 4NXNL 1YJNA 2Q2UA 3HOVH 5C3EG 3KF8B 4B3SQ 3FKIH 2E2JH 2C35B 3OTOQ 3WWVA 1YHAA 2MFIA 3H0GG 3PUVA 1TXYA 4K0KL 5IWAQ 4EX5A 2KCMA 1VQDA 3H0GH 5ELOA 3RZDH 3LGJA 4A3DG 4HIOA 1SE8A 1IBKL 1IBLL 1KHIA 3A5ZB 2R7ZG 4QJFA 5GROA 4YCWA 4DAMA 1K73C 3HOWG 1YNXA 2ZJRA 2CWPA 1AE3A 3HOUH 3KJPA 1IBMQ 1VQ7A 4LF6Q 4LF7L 3J81c 1VQNA 1VQOA 4JI3L 2MNAA 4A3BG 4DV2L 1GD7A 3EN2A 4A3BH 5C44G 1I3QH 3U50C 4YHHL 4B3TL 4LF4L 3GTOH 1X3EA 4JYAL 4B3MQ 5C44H 2WAQE 2Y0SE 5AJ3Q 3HKSA 1FVIA 1K83H 1PH2A 2IX0A 2I5LX 1EFWA 3KOJA 1KC8C 2JK8A 1D7QA 3I4OA 4ME3A 2B63G 4BXXG 1G291 3T1YL 2OWOA 4MNOA 4TQUS 1PH9A 4DR4Q 1XPOA 4A75A 3MXNB 4JI6Q 2K52A 4GKKL 2XTIA 3PGZA 1YVCA 1LTLA 3M85A 1NJIC 2JA6H 3BZKA 1XMQL 1PVOA 1CKNA 4PZ7A 2E2HH 1K3RA 3K80C 2WP8J 4JCVE 5M3MH 2UUBQ 4A3LG 3S17H 2DUDA 4OWXB 4UP7A 4DUZL 4A3LH 2N78A 1C9OA 4DV6Q 4B3RL 4PMWA 1NMFA 1Z9FA 3AYHB 3PSIA 2AKWB 3EBEA 3I4NH 2A8VA 4DR7L 4OX9Q 3PCOB 4YY3Q 3KDFA 3I55A 4DV1L 2GN5A 1AH9A 1L0WA 4JI2Q 4C3JH 4AQYL 1Q46A 1E1OA 4C3IH 1X3GA 2XGTA 3FP9A 2HHHL 4NPSA 1VQ6A 1Y1WG 1K0RA 2F52A 2QGQA 5FLMG 2UXCL 1V43A 4DR5Q 1PH4A 1FGUA 4HJ9A 4DNIA 1SFOH 2ALYB 5FLMH 1E24A 4GOPB 3U4ZA 1V1QA 5GQOA 1YZ6A 3UE0A 4DR1L 1I6HH 2ZM6Q 1GM5A 2WB1E 4WJ3M 3PUYA 4HJAA 4BBSG 2BA0A 1IXRA 2HQLA 4A3MH 2JA7G 2UXDQ 4QQBX 1G6PA 1A63A 3RLOA 4BBSH 1VQCA 2OTJA 5FLXc 3PF5A 4LWCA 4KHPQ 4GNXB 1CKOA 4A4IA 2NN6I 1N34Q 2UUAL 1HJPA 1SMXA 2UUCQ 5H1SE 1KIXA 2EIFA 1PFSA 3CCLA 4LFBL 2Z6KA 1WCMG 5LMNL 3KJOA 3GTMH 1M1KC 1N32Q 2ATWA 2K4KA 1XTDA 4LUOA 2YTVA 2RHSB 2K5HA 2H5XA 3UDXA 4DUYL 3OW2A 1HNZQ 5C0XJ 1M90C 4GOPC 1XNQQ 1JT8A 2PNHA 5M3FG 4DR2L 2JA5G 1PV4A 1HZAA 3I56A 1LM0A 3AEVA 1HZ9A 4HIMA 5M3FH 2VUMG 1SROA 3RLFA 2JA5H 1VQMA 2Z0SA 3F1ZA 2NVYH 4OWTB 1VCIA 3J80c 4LF5Q 3I4MH 2ZTCA 4JI8L 3UE1A 3EIVA 4X65Q 4GNXC 2MO1A 3K7AH 4L5SA 4UPAA 3M4PA 4DV0L 2OTLA 2Q2TA 1U0LA 4JI4L 1E22A 2CKZB 3TS0A 1FJGQ 4A3JG 3CAMA 5LMUL 4BA1I 4X62L 4DV7Q 1K8AC 3CPWA 4DV3Q 2YTXA 5GAEC 2YYZA 1H95A 2D0OA 4O0AA 2VS1A 4A3CG 4AYBE 1PHJA 1E7ZA 2JEAI 2VQEL 1YHBA 3HKZE 1VQLA 3GTGH 4YWMA 2K75A 1P8LA 4NXMQ 1VS0A 2OQKA 1N9WA 4A3EG 4JI1Q 5GAGC 3HOZH 5IYDG 4KHZA 3HOVG 3CMAA 4UP9A 3FKIG 2JJQA 4JI0Q 5IYDH 3TREA 1GKHA 3CC4A 2LXJA 4GKJL 2JQOA 1UE7A 4X66L 3KYHC 3GTJH 3T1HL 4K0KQ 5JJIA 1K8GA 4YCUA 4L5RC 2RCNA 1X56A 4QIWE 4NB3A 3F2CA 4GN5A 4C2MH 1IBKQ 2WAQG 2Y0SG 3BJUA 3S1MH 4R4OA 5JEAJ 4OXPA 3HOUG 1MKHA 4DV4L 1NE3A 2EXDA 3GO5A 2PI2E 2ZTEA 3TEHB 1PYBA 5M5YH 3S16H 4LFAQ 1YHQA 4LF7Q 3GDEA 3U4VA 1XMOL 2R93G 1KXLA 2E2IH 4APVA 1W2BA 2R93H 4IFDJ 4H02A 3PIPA 1YI2A 3AFPA 1PH1A 5C0XI 4YHHQ 2JA8H 4A76A 1YIJA 3PUWA 3K7UC 3L0OA 4JBJA 2KENA 1UE1A 1GO3E 3D31A 3ULJA 3OTOL 4Y7NH 5K36G 3ERSX 5HY6A 4P72A 5IWAL 1OTCA 3J81j 3CD6A 1UEBA 3RZOH 3H3VI 1JJCB 1PH3A 4IPDA 4LNQA 1VQGA 3ER0A 4R4IA 1T9HA 1VQ9A 2PQAB 5M5WH 1QZGA 2UU9Q 4GKJQ 2GVBA 4OONA 3A0JA 5JJKA 4LF8Q 1I5FA 2JA6G 4RG1A 3S1NH 3GTLH 5JJLA 1IBML 2E5LQ 5M3MG 4BY7H 1Y14B 3ZJYC 2GVAA 4P71A 4LF6L 1WJJA 4LFCQ 4LUVA 3JC66 4B3RQ 1QUQB 2NVXH 1S40A 3W1GA 1OXVA 1VQHA 4IPGA 3I4NG 4EQ5A 2NVTH 3G71A 2WB1G 4B3ML 4HIKA 5AJ3L 3H15A 4DV1Q 1UWVA 1X55A 4IPCA 4AQYQ 2OQ0A 2QA4A 5IE8A 2KHIA 1HNWQ 1VQKA 1AE2A 4BA2I 1NMGA 1C0AA 1TWFH 1PH7A 1A62A 1BBUA 5HGQA 1I94L 1QVCA 4DR4L 3HOXG 1KRTA 4IOCA 1EWIA 3MEFA 4DR3Q 4KI0A 1KRSA 3HOXH 2JA9A 2F4VQ 4JBWA 1TWAH 1YITA 4OWWB 3PV0A 4A3MG 2UUBL 1WI5A 4JBMA 3G48A 2I5MX 3KFUA 4XIGS 1HR0L 3PUXA 3FHWA 4HJ7A 4IPHA 1VQJA 3F2DA 1EYGA 3KLWA 3J7ZC 1DGSA 1Q1EA 3RLNA 2LXKA 4OX9L 4IFDI 1JJGA 4OO1I 1Q7YC 3HOYG 1S3OA 1VQFA 4X64Q 4JV5L 3W5OA 1ASZA 3S2HH 1MJCA 3CF5A 1VQ4A 1XNRQ 3HOYH 2UXBL 1A0IA 1J6QA 3ULLA 3J7A5 3S15H 1EUJA 4QGUA 4YWKA 4DR5L 2ZJPA 1VQIA 1OXSC 4GN3B 2A1AA 3OYYA 1X54A 4RMFA 1X9NA 4DK6C 4GOPA 2ZM6L 4LF9Q 2YU9H 2Q2HA 5GAHC 2VY3A 4JI5Q 4Y52H 2VZAA 3GTKH 3D0FA 5IYCG 2DGYA 4AYBG 3I4MG 1BVSA 3ULPA 3HKZG 5IYCH 4KHPL 1JJ2A 1J5EQ 4GNXA 4A93G 2R6GA 1N34L 1L1OB 4DV0Q 2UUCL 2RHQB 1HNXQ 4A93H 1EOVA 5IP9H 2PI2A 1E1TA 2ZTDA 3CC2A 3KF6B 5FJ8H 3NELA 2IHFA 2BA1A 1N32L 3L7ZC 2NN6G 3ICEA 2ZJQA 4C3HH 3GTPH 3DLLA 4DV5Q 3J81i 1HNZL 1N33Q 2N8NA 5ELNA 3CPFA 3F2BA 1XNQL 4JI7L 2FXQA 1XJVA 4DR6Q 1YJWA 1Q86C 4BBRH 1UE5A 2YTYA 3BZCA 3W1BA 3HOZG 5BR8Q 2BH2A 3CCRA 2ID0A 2IX1A 1Q82C 1VQEA 1N36Q 4LF5L 1SLJA 1SRUA 3M4QA 2R92G 3CCEA 4NXNQ 1NBWA 4FDBA 4JC0A 4ALPA 1MJEA 2N3SA 2R92H 3G6EA 3PO2G 4X65L 3PO2H 1NY4A 2HIXA 1EQRA 1R9TH 1KAWA 4L5TA 1L1OC 4JOIC 2HIVA 4POFA 3JAMi 1S72A 2VQFL 1ASYA 1FJGL 3M7NA 1HR0W 2E8GA 2KHJA 5IYBG 1KL9A 4DV3L 1PYSB 4R4QA 1BKBA 4R4CA 5EAYA 5IYBH 1SN8A 5E7NA 2MQHA 4A3IH 1IBLQ 3UDIA 1P16A 3UDFA 3L2PA 1SR3A 4DPGA 1CUKA 2F3IA 1Q8KA 2HT1A 1FL0A 2CQOA 1RL2A 4UP8A 1IYJB 1E3PA 1V9PA 4NXML 4XTCS 4LW1A 1IL2A 4JI1L 4PZ6A 5C4JH 1B7YB 4JI3Q 3PF4A 1U5KA 5LMNW 4DV2Q 3RN2A 2JA8G 1UE6A 4P73A 5J3BA 1VQPA 4R1JA 1IZ6A 4KLKA 4BY1H 1HZCA 4B3TQ 4LF4Q 2B29A 1QVGA 1MIUA 4JI0L 2BH8A 3TRZA 5C3EH 4B3SL 4JYAQ 2IHEA 2Q2IA 2R7DA 3SGIA 2K5VA 4QL5A 3CCUA 4O2DA 4GLAC 3S2DH 4WJ4A 1RIPA 2A19A 3T1YQ 4A3DH 2D0PA 2YV5A 4GKKQ 3CCQA 2R7ZH 4J15A 4P75A 3HOWH 4BY7G 1CKNB 1W3SA 4IJLA 4LFAL 1XMQQ 1CSPA 4IJHA 1JMCA 3NENA 3AFQA 1PH6A 4DUZQ 4A3GH 3CMEA 2RF4A 2JEBI 1X3FA 3KDFB 4R4TA 3CXCA 3U58A 4DR7Q 2WFWA 1LYLA 1VQAA 2K14A 4PZ8A 1A8VA 1CSQA 3STBC 3A74A 5C0XG 3BU2A 4UY8C 1I94Q 2HHHQ 2B63H 4BXXH 3JAMc 2K50A 2R7FA 2NZOA 3S1QH 1JB7A 2AWNA 2UXCQ 2PQAA 2UU9L 3CP0A 2NZHA 4LF8L 4JI6L 1CKMA 3F8TA 1N8RC 2I5HA 3K0XA 2E5LL 1Z47A 4DR1Q 4JBKA 3H3VH 1XPRA 2VW9A 3CC7A 3J80i 2N49A 3K8AA 4LFCL 4AH6A 1HR0Q 3E0EA 1O7IA 2K5NA 3NEMA 5IT9c 1QUQA 4DV6L 4X6AH 3RR5A 2JE6I 1KQSA 3M3YH 1D8LA 4YWLA 2UUAQ 2AHOB 4YY3L 4JV5Q 3CCJA 3PO3G 3M4OH 1VQ5A 2IY5B 4JI2L 1HNWL 1Q1BA 2UXBQ 4A3FG 4LFBQ 3PO3H 1EIFA 4MZ9A 5LMNQ 3E9HA 4A3FH 1X65A 5C4XG 2VNUD 4HJ8A 1Y1WH 2OCEA 2AMCB 4DR3L 1I50H 1Q12A 5C4XH 4DUYQ 2CWAA 3G4SA 2F4VL 2EQSA 4IOAA 3STBD 1WOCA 1TWHH 4HIDA 1G51A 4POGA 1NTGA 4IO9A 4QY7A 4DR2Q 3RN5A 1YJ9A 2UXDL 4DAYB 2JA7H 2L15A 3M9BA 5IY0A 1L2FA 3I7FA 3A5UA 1EQQA 1OXTA 2CCZA 3HFZB 2AWOA 2KBNA 4MTNA 5JEAG 4JI8Q 1KD1C 2PMZE 3E9IA 1TWCH 5IP9G 3S14H 4X64L 3UDGA 5DLQE 1OXXK 3Q8DA 5FJ8G 2KCTA 4JI4Q 1XNRL 5LMUQ 4HJ5A 1PH5A 4X62Q 3PUZA 2Z6KC 1LUZA 2B3GA 1WYDA 1WCMH 4AIMA 1PA6A 1PH8A 4IFDG 1EIYB 4OO1G 1JE5A 3TQYA 1VQ8A 2VQEQ 1B8AA 1TWGH 5M5XH 4GLXA 1Q81C 4JI7Q 4LF9L 1XPUA 3CW2C 3DM3A 4BBRG 2NVQH 2CFMA 4JI5L 3K81C 4LUZA 3NBHB 3AQQA 1YEZA 2VUMH 4A3GG 2VL6A 1HZBA 1B70B 1J5EL 2I0QA 2MO0A 1C7YA 2IT1A 1Y1VG 1VQBA 1GVPA 2LSSA 4DK3C 3VDYA 5IP7G 1HNXL 1L1OA 4JOIA 4TVAB 1Y1VH 4YCVA 4X66Q 2VQFQ 3T1HQ 3TS2A 3CCVA 4L5QA 1YBYA 4A3KG 5IP7H 3S24A 3KF6A 1OXUA 4A3JH 3B6YA 4DV7L 3CCSA 1X6OA 4GLVB 2QEXA 4A3KH 2ASBA 4A3IG 3CCMA 4GS3A 1N33L 4DV5L 3GTQH 1WFQA 4DV4Q 3IRBA 4A3CH 2D62A 3PIOA 5GADC 1HH2P 1QVFA 4PG3A 4DR6L 3S1RH 4P74A 4DKAC 1XMOQ 3RNUA
chains in the Genus database with same CATH superfamily
2NB0A 1MSHA 1HFGA 3I2ZA 4GN4B 1QZHA 4NXNL 1IHZA 3DM1A 2Q2UA 5C3EG 2E2JH 2C35B 4FF1A 2MFIA 2D2CC 2WB1B 3PUVA 2KCMA 1Q90A 5CV4A 4JPBW 4RH6A 1EQVA 3LGJA 1LTSD 4JVZA 1UEAB 4YCWA 4NMZA 1K73C 3HOWG 2CWPA 1KNAA 3TP7A 2RCFA 4KKUA 3J81c 1I6HB 4X3UA 1VQOA 4A3BG 1C4QA 3EN2A 5K5PA 5IGFA 5AJ3Q 1K83H 1K3BC 2I5LX 3KOJA 1TIID 1GOZA 4TRDA 1YNND 3T1YL 4TQUS 4YIJA 3OMGA 4A75A 3GTMB 5LHY1 3MXNB 2CH4W 3PGZA 4DNTB 1K8MA 1PVOA 1II3A 4PZ7A 4JCVE 2WP8J 4ZUIA 2DUDA 4DNRB 1R4QB 4A3LH 1LT4D 4DV6Q 4ID6A 4PMWA 1Z9FA 3AYHB 3JAME 3I4NH 2A8VA 4AYBB 4OX9Q 4YY3Q 1E2ZA 3H6MA 4K2LA 4FXDA 2OF1A 3W2DA 4C3JH 4AQYL 2A69C 1DXMA 1WTRA 1E1OA 2ZXRA 4C3IH 1X3GA 2DY7A 1WTXA 2XN9C 1CI3M 3H91A 1J9OA 1W6KA 3FP9A 5E3FA 5FLMG 1V43A 4DR5Q 1E24A 4PMCA 3OWEB 2Q8IB 2WB1E 4WJ3M 1GHKA 4LK1C 1JC7A 3PUYA 3BG3A 2BA0A 2F0JA 4CDCC 3E6ZX 1U9RA 1VQCA 4L6TB 3P1HA 3HOZB 1EY9A 4A4IA 3X3MA 2UUCQ 4K8JA 1SNPA 3VR4A 1KIXA 3OIPA 2QF7A 3CCLA 1MD2D 2QEJC 5LMNL 3KJOA 3A54A 4FF4A 4LUOA 2YTVA 1DCZA 2RHSB 2K5HA 3HEJA 3OW2A 4BS9A 2WAQB 4RCNA 2PNHA 1AZPA 3AEVA 1HZ9A 5M3FH 1SEBD 3SK8A 2JA5H 1EY8A 4DAYA 1VCIA 3I4MH 2ZTCA 1CFMA 3EIVA 1RKNA 1CHQD 3M4PA 4DV0L 2Q2TA 1U0LA 2CKZB 3P75A 3TS0A 3CAMA 4X62L 2NWGA 3LX0A 2Z4HA 4DV3Q 2YTXA 1H95A 1QCBD 1BO0A 1XTCD 3BDOA 4A3CG 1A3VA 4AYBE 1PHJA 1L0XB 2VQEL 1MHWC 4YWMA 4H44C 4BY7B 4A3EG 5GAGC 3NWSA 5EGTA 1HQRD 3CMAA 3E5SA 5KEEA 1GKHA 4X66L 3A8JE 3T1HL 5JJIA 4N8FA 1K8GA 1WTQA 2RCNA 3Q0AA 1X56A 2EYJA 4NB3A 3F2CA 2WAQG 3C3LA 2EYLA 2H4OA 2EYMA 2C9OA 4OXPA 5JEAJ 1I4GA 1EIGA 1TS2A 1NE3A 3J80L 5EBCA 4TSSA 3T4AC 1HA5A 3HOXB 1PYBA 2E2IH 3PIPA 2FHTA 3X3NA 1YI2A 3NTKA 2QILA 1O7LA 4OIKA 3Q23A 4J1MA 2KENA 3OTOL 1U4LA 1PRTB 3MHBA 4Y7NH 4P72A 2BCOA 1UEBA 1ONLA 2RBMA 4ULLA 3A7LA 4LNQA 1VQGA 1D5MC 4R4IA 5M5WH 1QZGA 2UU9Q 1BXTA 4LF8Q 5C4XB 2JA6G 3K5LA 3S1NH 1UAPA 1Y14B 4LF6L 4P71A 1PLFA 3H3VC 5KRUA 4OELB 2PZTA 1OXVA 1VQHA 2B2VA 4EQ5A 1D5XC 5EPJA 1JORA 3G71A 2I46A 4B3ML 4HIKA 1UWVA 4N8X1 4AQYQ 2QA4A 5FOBB 1HNWQ 4G7ZC 1VQKA 1B3AA 1EY0A 2F0QA 4RKLA 3HOXG 5CGKA 2PO4A 3MEFA 1BOSA 2A74C 3MXNA 4JBWA 3GTPB 1TWGB 2UUBL 4XIGS 1HR0L 3PUXA 1A3TA 4BBRB 2B2UA 4UHVA 1VQJA 1SAPA 3F2DA 1PTOH 4ZYSA 4A3GB 4IFDI 1E0BA 3DXJC 1RCVD 1V1PB 1IL8A 5EKLA 1U4MA 3IFDA 4JV5L 3W5OA 3S2HH 2K28A 2HD3A 1VQ4A 3HOYH 3ONAB 3ULLA 2FMMA 1EUJA 1HHVA 4GN3B 1STEA 1X9NA 4KKTA 2AQ3B 5C3WA 2Q2HA 5GAHC 2VY3A 4Y52H 2VZAA 3GTKH 2EYPA 4KJOA 5IYCG 3RMHA 3C1EA 4CHTB 5C4JB 1JJ2A 1J5EQ 3A55A 4A93G 2B2TA 3M4YA 2R6GA 1L1OB 4DV0Q 1HNXQ 5E4XA 3TDQA 2ZTDA 3CC2A 3K6OA 5FJ8H 2O4XA 1RODA 2IHFA 1EY6A 1KABA 4K8IA 3S2DB 3ICEA 5G3LF 1I4XA 3DLLA 4DV5Q 4NW2A 2PNRC 4NP5A 2F0GA 1XNQL 2FXQA 1XJVA 1YJWA 3T56B 1SBBB 3BZCA 2BH2A 2R92G 1DOKA 3M4QA 1SLJA 3GTLH 3CCEA 4EQNA 4JC0A 1MJEA 3PO2G 4L5TA 4LMQD 5C6AA 1S72A 1K83B 4POFA 1ASYA 2KEDA 5CV6A 3P7JA 2VQFL 1ET6A 5IYBG 4X3SA 1RDPD 1B50A 3UDIA 3I72A 3UDFA 4DPGA 1FL0A 1V9PA 4NXML 4LW1A 3QWNA 4ZQ3A 5LMNW 4DV2Q 3BVZA 4R1JA 3K57A 3MZ5A 1QVGA 4JYAQ 5C3EH 3SGIA 2K5VA 4C3JB 1STYA 4WJ4A 4KY7A 2AUKA 1GXDC 2YV5A 1Y1WB 4GKKQ 2E2DC 2Z9HA 4P75A 3HOWH 1CKNB 2EYHA 4ZUJA 5C5LA 1XMQQ 1CSPA 3R3OA 4IJHA 3NENA 4IUUA 3CMEA 5HURA 2JA7B 1KTKA 1X3FA 3CXCA 3U58A 2PW5A 4L63B 4KY5A 2MJ8A 1VQAA 2X6LA 2K14A 5C0XG 3U9SA 3HZXA 4IUVA 2K50A 2UXCQ 2AWNA 3CP0A 4G4KA 2ZXPA 3F8TA 5I6WA 3CU7A 4F8MA 5I6YA 3BDLA 3J80i 1HR0Q 1O7IA 5IT9c 5M3FB 2JA5B 3RR5A 1KQSA 2VUMB 1D8LA 1HTPA 5JJZA 3NTIA 4JV5Q 3M4OH 1F9SA 3KBXA 3PO3H 4MZ9A 1X65A 1Q12A 4OIJA 2CWAA 3G4SA 3GTQB 3STBD 1WOCA 1PMRA 1NTGA 5KNCA 4Q0FA 1YJ9A 2Z6BA 5AFWA 1EU3A 4KY6A 1EQQA 3HFZB 3JAML 1D1KA 5KNBA 3HOVB 1TWCH 3FKIB 4DXFA 1V1PA 2KCTA 5DM63 2FMCA 3NUCA 2XWJB 3PUZA 2F0SA 3MFGA 4AIMA 2KJXA 1PH8A 2O5IC 4OO1G 2KCNA 4IFDH 3J7AF 2Y0SB 1JE5A 1I4HA 3HOUB 2SDFA 3K81C 2PYKA 1SYCA 3AQQA 2E2IB 1SYBA 1Q3LA 1ML0D 4O1NA 3MFYA 4OGQC 5IP7G 1L1OA 4JOIA 4TVAB 1Y1VH 2VQFQ 3CCVA 4K6DA 1SXTA 3ND8A 5EKKA 3MVVA 3B6YA 4A3KH 2XSCA 5M5WB 5EKIA 4K2KA 1EEFD 5EJWA 4A3CH 2D62A 1HH2P 1QVFA 3S1NB 4P74A 3VR6A 3C1FA 1KDBA 5BR8L 5M3MB 4A3EH 1O80A 5ISRA 4BY1G 4JG2A 1YNNC 1XWEA 1YJNA 3KF8B 3N6RA 4ODGA 1YHAA 1MSGA 3H0GH 3RZDH 5CBAE 4A3DG 1H9KA 3Q22A 4CDFC 4ZK9B 3A5ZB 3VYSA 2R7ZG 4DAMA 3L9AX 1YNXA 1ENAA 2EE1A 3BYYB 4CGYB 1WD1A 4KN7C 1SFOB 3FEWX 1IBMQ 4LF7L 3OWFA 4JI3L 2F0VA 3R2TA 5TSSA 4A3MB 5C44G 4B3TL 3ND9A 1PTOB 2Y0SE 5CORA 1JOKA 1PH2A 3QOLA 2IX0A 1EFWA 2RQXA 2B63G 1G291 3HOYB 2IWHA 2KOLA 3EJIA 2EXZA 1STBA 1U4PA 2XTIA 3OMCA 1S5FD 2JA6H 3BZKA 1CKNA 1Y8OB 2E2HH 1FNVA 3S17H 4UP7A 2N78A 2ICIA 1NMFA 5DEHA 1EOTA 3PCOB 3I55A 2GA4B 2IW3A 1EIHA 2KA7A 5KIXA 1VQ6A 1K0RA 2F52A 2QGQA 4DNIA 1EWHA 3I90A 1WTHA 3VR3A 2M00A 4F87A 1O7ZA 1V1QA 1YZ6A 3UE0A 4DR1L 5FK9C 2ZM6Q 1GUWA 3H09A 3GTGB 1G6PA 1A15A 4WFN3 1EQTA 4CBVA 4BBSH 3MXGA 3VA7A 4LWCA 1DOLA 1CKOA 2UUAL 2NN6I 1N34Q 3KLRA 3QR8A 2EIFA 4MN3A 4LFBL 1CM9A 2F4IA 2Z6KA 4CJ2C 4EQOA 1N32Q 5E1FA 3I4LA 2ATWA 1XTDA 2A68D 4C2MB 5KGUA 1HNZQ 2NTSA 3R2IA 1VF7A 4GOPC 1KNEA 1SE2A 2DNEA 3I56A 3LWEA 3S16B 2F0EA 4HIMA 3RLFA 4BWGB 4LAAA 3F1ZA 2NVYH 2N55A 4LF5Q 3J80c 1Y8NB 4U673 4JI8L 2JA8B 3UE1A 4GNXC 1UUPA 4UPAA 3NK9A 3RD4A 3D6WA 4JI4L 1E22A 1KLGD 2MPMA 5LMUL 1K8AC 3CPWA 3URYA 2F0PA 5FKAC 5GAEC 2HQEA 2YYZA 5C5MA 2VS1A 2KUMA 4CDDC 1X32A 4ZKBB 4JI1Q 3IKJA 4R9WA 1T5EA 4NDXA 2F0IA 5IYDH 4RHSA 3K59A 4R8IA 2G5DA 2K6AA 4YCUA 4L5RC 4QIWE 4GN5A 4XT1B 1TWFB 4IUQA 1JWSD 2XRSD 1MKHA 2F0LA 4N9PA 2OT2A 4DV4L 4KTAA 4XXEA 5M5YH 2BOSA 4LF7Q 2L0CA 1KXLA 4APVA 1KLUD 2R93H 4IFDJ 4H02A 3AFPA 1PH1A 5CYUA 1EWCA 2XVSA 4EGVA 1NR4A 1UE1A 1GO3E 3KF8A 5K36G 3ERSX 5IWAL 3RZOH 2B2WC 3H3VI 1EFID 1JJCB 3VR5A 3BDCA 3PMFA 4RGNA 4LJZC 2GVBA 3A0JA 1EEID 1QNUA 5JJLA 4ZLTF 1BDOA 2GVAA 3OHXC 4LFCQ 2YU9B 2J4XA 2SNMA 2OXPA 1S40A 3EA6A 3W1GA 4IPGA 2NVTH 2WB1G 2K7VA 3TSSA 1SYFA 1X55A 4H13C 1TWCB 4HSVA 5IE8A 3K58A 4BA2I 4HEDA 1HTLD 1I94L 1A62A 1BBUA 5HGQA 1JE4A 4DR4L 2LMCB 1KRTA 1K28A 2KHSA 4DR3Q 3VR2A 1TWAH 1YITA 4OL7A 1WI5A 1FGBD 2I5MX 3KFUA 2G9DA 3FHWA 1HXYD 3KLWA 2B8FA 3J7ZC 2OEOA 3RLNA 3MTSA 1WTWA 1STGA 3DMUA 1S3OA 1QILA 1Y1VB 1ASZA 1MJCA 3CF5A 1XNRQ 3MA2B 1A0IA 2WV6D 5CV8A 3S15H 3HS0C 4YWKA 4QGUA 4A3KB 4XYQA 1VDZA 2F03A 1BCPB 1OXSC 4RMFA 1BUVT 1X54A 3OYYA 5FLXE 5IGGA 5LL6X 4A3IB 1PRTD 4RGMA 1NUCA 1KDCA 5CV5A 3MXUA 2L9HA 4K14A 1BVSA 4AYBG 4KHPL 1PDQA 3NWTA 5BN4A 2P5ZX 2EJGC 4RGTA 5JPNC 1CTMA 3NELA 3H0GB 2BA1A 3L7ZC 2F0TA 4G57A 4KN4C 4C3HH 2NN6H 3WOFA 1N33Q 5ELNA 1TY0A 1SDFA 3OIQA 1EY4A 2WINB 1Q86C 2D9UA 2YTYA 4B9WA 3HOZG 1QJOA 2ID0A 4QUFA 2IX1A 4NXNQ 3VA5A 5LL6S 5FO7B 4X65L 1SNDA 1NY4A 1EQRA 3GP7A 1R9TH 2HIVA 1TR5A 1FJGL 2EDGA 3NPPA 2E8GA 3HP3A 1KL9A 4KJNA 5EAYA 1SN8A 2WKCA 3S1QB 1LTRD 3L2PA 1SR3A 2F3IA 1Q8KA 4UP8A 3S9WA 2E2HB 4PZ6A 3S17B 3PF4A 4DAVA 2RA4A 4BY1H 1HZCA 2B29A 5CV7A 4JI0L 1KDAA 2Q2IA 3M3YB 5EBDA 4FF3A 1LABA 1STNA 4O2DA 4GLAC 3EROA 4U68A 1RIPA 2A19A 3T1YQ 2BDNA 2EY1A 4A3DH 1IW7C 3CCQA 2R7ZH 4J15A 4BY7G 4LFAL 2LFNA 1JMCA 3T51B 3G7LA 2RDHA 1B3QA 1LT3D 1L0YB 2RF4A 3IFTA 4R4TA 3Q24A 1B9MA 2WFWA 2BDOA 2TMPA 2EPBA 4PZ8A 4B9XA 1A8VA 3STBC 3S14B 2ICEC 3BU2A 1XYIA 4M8AA 3QJYA 1I94Q 3SXHA 2B63H 3JAMc 2R7FA 1JB7A 4G7HC 1WCMB 1MBYA 1PZID 3V96A 2N88A 1CKMA 2SNSA 1N8RC 1H9JA 1JQYD 5BN3A 2E5LL 1Z47A 2Z8LA 3H3VH 5M5XB 5L37A 3K8AA 4AH6A 1A6XA 1PXUA 2L5TA 4X6AH 2JE6I 5JPMC 4OHJA 4YWLA 4DA2A 2IY5B 4JI2L 2QDBA 1PFNA 5BN5A 3J81L 1EIFA 5LMNQ 1B9NA 4A3FH 3L3OC 4A3JB 5C4XG 2E74C 4HJ8A 2OCEA 3CHBD 1I50H 2F4VL 2KCCA 2MGSA 1PZKD 1TWHH 1HA6A 4ZAIA 4IO9A 4DXGA 1EYDA 3I7FA 4S3SA 3A5UA 1HRJA 2AWOA 5JEAG 5IP9G 4B08A 2E2JB 4X64L 1OXXK 1PH5A 3PIO3 2KEEA 4X62Q 3QIAA 2L12A 4K6LA 4M1UB 1JOQA 2BE5C 1Z6HA 3FDTA 1LTID 3ERQA 1WVLA 3TQYA 2VQEQ 4GLXA 1VF5C 4LF9L 2Z4IA 1XPUA 4BBRG 4JI5L 1CK1A 4ZRZA 2R93B 1FR3A 4WJWA 4A3GG 2F0NA 2VL6A 5M9OA 1B70B 5J39A 1C7YA 4RA8A 2LSSA 4DK3C 1U4RA 3VDYA 4X66Q 3TS2A 3T1HQ 3S24A 2DNCA 2AQ1B 4CJ1B 1X6OA 2MUYA 1DYQA 4FF2A 3CCMA 3IRBA 2KQ3A 3D4WA 4CKCA 5GADC 2F0FA 4DR6L 1R4PB 1QNKA 4DKAC 3M7GA 2ES2A 1N36L 3CQZH 2PZWA 2NVTB 1I4PA 3I4NB 3OTOQ 3WWVA 4K0KL 1TXYA 1VQDA 5KYLA 5ELOA 3Q6SA 4C3IB 1YNJD 1GUTA 1OO9B 4HIOA 1I4QA 2O5JC 1ESRA 1SE8A 1IBKL 1I6VC 1IBLL 1JB3A 3W3AA 4QJFA 2QDLA 1I4RA 1AE3A 2HDLA 4CKEA 1TWAB 1VQ7A 4LF6Q 3D4DA 4PNYA 3CKIB 4A3BH 1EYCA 4YHHL 3DHQA 4LF4L 4IALA 3GTOH 2FFKB 4B3MQ 3HKSA 4ABNA 3T13A 5K36H 1KC8C 5D3DA 2B2YA 1D7QA 1JICA 3I4OA 4ME3A 2OWOA 4MNOA 1PH9A 1XPOA 2JN4A 2K52A 1YVCA 3M85A 1NJIC 3R93A 1SYEA 4A3LG 1K3RA 2UUBQ 3MXPA 4H0LC 4DUZL 1C8CA 1C9OA 2EJFC 2E75C 4XQQA 4RWSC 2B2VC 3PSIA 2WKDA 3EBEA 3I4MB 3VYTA 4DR7L 2A68C 4MIUA 4C3JG 4DV1L 4JI2Q 2F0WA 1Q46A 3N52A 3K0YA 2HHHL 2SEBD 1Y1WG 4FYDA 4MHEA 1RF2D 1FGUA 4HJ9A 4FO2A 2ALYB 4C3HB 4Z9CB 5FLMH 1I6HH 1GUNA 1DJRD 4R8NA 1IKMA 4HJAA 2HQLA 1IXRA 2EJMA 2JA7G 5T1GA 4QQBX 3VYUA 5DAUA 2D5DA 2B2UC 2OTJA 1IYUA 1HJPA 1SMXA 5H1SE 2VB2X 1WD0A 2F3VA 3GTMH 2JXMB 3DWAA 3TZDA 2EY6A 3UDXA 2H5XA 1PTOD 4DUYL 5FO9B 3A7AB 2NYZD 1M90C 5IGBA 1S5ED 1XNQQ 1FNUA 1JR0D 1PRTF 5M3FG 1SYDA 4DR2L 1JT8A 3LWUA 2JA5G 1HZAA 3TP6A 3A56A 1RD9D 2VUMG 2PPBC 1EL0A 2QKIC 1RTOA 4ZKCB 2B2TC 2MO1A 3K7AH 1TY2A 1EY5A 3GV6A 4IQZA 4Y7NB 2QW7A 1HQMC 3EFXD 4O0AA 4XDXA 4F7XA 1D5ZC 1A2TA 1E7ZA 5FLXL 2Z1CA 2JEAI 1YHBA 3HKZE 1VQLA 1SNMA 5F2DA 4NXMQ 1VS0A 2OQKA 4O42A 1AP0A 2L4NA 2RDGA 3KUPA 3HOZH 3HOVG 5DM73 4UP9A 3FKIG 1ZYRD 4KD3A 1EZ6A 3FMCA 4IURA 2LXJA 4GKJL 1TS3A 1UE7A 4K0KQ 1CZGA 3KYHC 1O78A 5HGTA 1F77A 1D6EC 1IBKQ 2Y0SG 3BJUA 4WRDA 2F0UA 4G7OC 3HOUG 1EYAA 3GO5A 3SK6A 2ZTEA 5D14A 3TEHB 1LT6D 1QE6A 5C3XA 3U4VA 1XMOL 4RCOA 1W2BA 3KBGA 5C0XI 4YHHQ 4A76A 1YIJA 3PUWA 3K7UC 2J0TD 4RHRA 3D31A 3ULJA 5FO8B 1W6JA 2EOTA 5HY6A 4C56C 3QO2A 3J81j 2M2LA 4IPDA 3J7YW 3S2HB 4ILWA 1T9HA 1V8QA 2RSOA 2PQAB 3J81E 1VQ9A 4A3FB 2ENBA 1KAAA 1SNCA 1D2BA 1CQFA 5JJKA 2G9HD 1LACA 1I5FA 2DY8A 4BY7H 3FPUB 5M3MG 1S5CD 3JC66 5CR3A 1QUQB 3GTKB 2NVXH 4V0BA 1NSNS 5AJ3L 3H15A 4DV1Q 1S4ZA 4Q5VA 2OQ0A 4MTKA 1PRTC 1NMGA 2LKVA 1PH7A 2RKSA 4OEMB 1DZ1A 1EWIA 4KI0A 1KRSA 3HOXH 2JA9A 3NHHA 3DUZA 1F2ZA 1F9RA 2A6ED 4A3MG 4JBMA 1TS4A 5NUCA 3EVQA 4QIWB 3DWQA 4HCSA 1QWYA 4XQNA 3GTLB 1DGSA 2K01A 1Q1EA 4OX9L 2LXKA 1CZWA 1QOHA 4OO1I 1Q7YC 3HOYG 3I73A 4P2CB 1JWUD 5C4HA 1DM0B 2UXBL 1J6QA 4K5VA 3J7A5 1SNQA 3MEHA 4DR5L 2RSNA 1ICFB 2A1AA 1LV9A 3V05A 3I70A 3D0FA 4X3KA 1SJED 2DGYA 5DNFA 3ULPA 4H7BA 5IYCH 2CW0D 4WORA 3TP8A 3LNNA 2MP1A 2UUCL 2RHQB 5C3EB 4A93H 1EOVA 5IP9H 1F9PA 1E1TA 1HFNA 3TP5A 1Y69U 2XRQD 5KYIA 1A2UA 2PCFB 1E2WA 2ZJQA 3GTPH 3I8ZA 3MC0B 3TBIB 3CPFA 4DN4M 4UAIA 3F2BA 4JI7L 3HOWB 2LS01 4BBRH 1UE5A 1TQOA 2JYOA 5BR8Q 1AZQA 1RJTA 1SRUA 2K03A 3CRLC 5I2YA 4I7ZC 4A3GH 4A3BB 3K5NA 2R92H 1GJXA 3G6EA 5T1IA 1B53A 3GTOB 4GZYC 3PO2H 1LLRD 5J1ZA 1L1OC 1LTTD 1LTAD 4JOIC 4K5WA 3JAMi 1LO5D 3QB3A 2K05A 3M7NA 2KHJA 4DV3L 1PYSB 2H1EA 1BKBA 4R4CA 5IYBH 4DF7A 1CUKA 2CQOA 4QUCA 1G6ZA 1F9QA 1IYJB 1E3PA 1SMYD 4XTCS 1IL2A 1BNZA 5C4JH 1B7YB 4JI3Q 1U5KA 2JA8G 4P73A 1BQQT 1IZ6A 4KLKA 4B3TQ 1BCPD 2BH8A 1JCKB 3TRZA 4B3SL 2R7DA 1G8ZD 2XIWA 4QL5A 3WDNA 3CCUA 3S2DH 3M4OB 1EZ8A 3PO3B 1ICWA 4IUPA 1ET9A 5CBEE 2PMZB 2I07B 2KVMA 1GHJA 1W3SA 2RVLA 2PW7A 1K0SA 3AFQA 1PH6A 2AQ2B 2JEBI 3KDFB 2IJ0A 2CHBD 1Z7TA 5ELCA 1IKLA 5EQ0A 2SOBA 3A74A 5C0XH 2A73B 3D3RA 3NQIA 5D3IB 2PQAA 2UU9L 2NZHA 4LF8L 4JI6L 2AUJD 4DU9A 2NBFA 2K5DA 4DR1Q 4JBKA 2FJ2A 4RKBA 3CC7A 1XPRA 2N49A 1JOOA 2K5NA 3V2TA 1QUQA 2DN8A 3SDZA 2UUAQ 1F2LA 3K7AB 3CCJA 3PO3G 1HNWL 1Q1BA 2UXBQ 4LFBQ 3E9HA 2Q8RE 2VNUD 1Y1WH 3DWPA 2AMCB 5EPKA 2EQSA 4JW0A 4IOAA 1F2YA 1DD2A 4POGA 5EPLA 3QOJA 2UXDL 2JA7H 2L15A 3R8BA 4A3EB 4JI8Q 2K04A 4IN3A 1KD1C 2PMZE 2F0DA 1TU2B 4JI4Q 1ILPA 5J22A 4HN7A 5CC4A 5LMUQ 3NQTA 2Z6KC 1LUZA 1VMCA 4IFDG 5JAVA 3RZDB 1ZKOA 4OO1H 2F0KA 1VQ8A 1PTOF 1B8AA 1V1OA 4JI7Q 2NVQH 3DM3A 3A8IE 2DJFC 4LUZA 3AB9A 1Q8IA 1HCZA 4ZCKA 1PFBA 2VUMH 1YNJC 1EY7A 1HZBA 1J5EL 3NXWA 3D4RA 1VMPA 2IT1A 1Y1VG 1VQBA 4DAPA 1GVPA 3SEBA 1E2VA 1HNXL 4YCVA 4A3KG 3OOCA 5IP7H 1OXUA 4DV7L 4GLVB 1SYGA 2QEXA 4KHVA 2ASBA 4A3IG 4GS3A 3H94A 3GTQH 4DV5L 1WFQA 4DV4Q 3PIOA 3O13A 3S1RH 5JOBA 3RNUA 2JA6B 3NBHA 1S5DD 5A2QE 1TKWB 1BBWA 3GD7A 1SE4A 1K9MC 2V1CC 4KK7A 5ELBA 2NVXB 3DEOA 1AEXA 3HOVH 5A35A 4B3SQ 3FKIH 1LTGD 2X69A 3H0GG 5IWAQ 5JVG3 4EX5A 1H9SB 2MHVA 1WTOA 4DGZA 3OW7A 4FXGC 1KHIA 1QG7A 5GROA 2A6HD 1ENCA 4KV6A 2ZJRA 3HOUH 1B1ZA 2M9VA 3IL8A 3KJPA 1WTVA 1NCVA 3MWYW 3E3XA 1VQNA 2MNAA 4DV2L 1HUNA 1GD7A 5ELDA 4HCEA 1I3QH 3U50C 4BBSB 1IYVA 1X3EA 4JYAL 5C44H 2WAQE 2PQEA 3SVMA 4DK1A 1FVIA 1RHPA 2EZVA 1BF4A 1CT1D 1MI2A 3J7AV 2JK8A 3QG1A 4BXXG 4EVOA 3VYRA 4DR4Q 4I65A 4XYOA 4JI6Q 4GKKL 2CH4A 4CKBA 1G2TA 5I9PA 1LTLA 2ZXOA 1X3PA 1XMQL 3K80C 5M3MH 2KECA 4OWXB 4CJ0B 4B3RL 2AKWB 4NKLA 2NVYB 4FNFA 3KDFA 1PTOC 4FXKC 2GN5A 4I7AA 1AH9A 1L0WA 4A93B 1STAA 2K32A 2XGTA 4QCLA 1AFPA 2QCPX 2LY7A 1GUOA 2A5HA 4NPSA 3NP8A 2UXCL 1PH4A 3SHLA 1SFOH 5IT9E 4PMBA 4GOPB 3U4ZA 4QMGA 5GQOA 2XNAC 4HSPA 1GM5A 4BBSG 4A3MH 5IGEA 2UXDQ 1A63A 4IUNA 3RLOA 3KLSA 3E0JA 4JK1C 5FLXc 3PF5A 1CQVA 4GNXB 4KHPQ 1H9MA 2R92B 3PO2B 1PFSA 1X3QA 1WCMG 2L55A 5ELFA 1M1KC 3SK4A 2K4KA 2V4DA 2FINB 3TZUA 1ZYRC 2A69D 5C0XJ 2O2LD 3FPPA 3PQIA 5M5YB 1PV4A 1LM0A 3I91A 1SROA 1VQMA 2Z0SA 4OWTB 3TMEA 4X65Q 4L5SA 1A3UA 3WOEA 2OTLA 1XX8A 1FJGQ 4A3JG 2HCCA 4C1NI 4UDUC 4BA1I 4DV7Q 2PZUA 3RZOB 2WACA 1GUSA 2D0OA 1PFMA 5IODA 3PIP3 3DEPA 3GTGH 2K75A 1P8LA 1XXGA 1CA5A 1N9WA 4HMIA 5IYDG 4KHZA 3P20A 1FD7D 1AN8A 1SJHD 2JJQA 1HUMA 4JI0Q 1CA6A 3TREA 3IAYA 3HRZC 3CC4A 2JQOA 5IGCA 4F88A 3GTJH 1G2SA 2NZ1D 4C2MH 3S1MH 4R4OA 4XT3B 4HMJA 3NBIA 2EXDA 1STHA 4CDEC 2PI2E 2R93G 3S16H 4LFAQ 1YHQA 3GDEA 2JP1A 4X3TA 3KK7A 1FNWA 1F2MA 2JA8H 2EVBA 2L1BA 3L0OA 4JBJA 4XQJA 1BCPF 2X6GA 4KKSA 1OTCA 3CD6A 3ITPA 1PH3A 3T53B 2A6EC 1H9SA 3ER0A 5CV9A 1WTPA 1QB5D 3S15B 1K8OA 2F3WA 2K5WA 3KLSX 4OONA 2JSOA 3BVGA 4RG1A 4DFAA 1IBML 2E5LQ 3AU7A 3ZJYC 1WJJA 5I4DA 1M8AA 1NR2A 4LUVA 4B3RQ 3I4NG 1TS5A 2TSSA 4HR7B 2R3ZA 4IPCA 3HKZB 4C3IG 4RGOS 2KHIA 1ILQA 1AE2A 1C0AA 3NSWA 1TWFH 1FYCA 3I3CA 1QVCA 5CMDA 4IOCA 2IX3A 4J8QA 2CW0C 2F4VQ 1M4VA 3C2PA 3U9OA 4OWWB 2NVQB 3PV0A 3G48A 1IW7D 4HJ7A 4IPHA 1LT5D 1EYGA 1ESFA 4ME5A 1JJGA 2HDMA 3FRPB 1VQFA 4X64Q 1R9TB 2J7ZA 5IIFA 2ZJPA 3HG9A 1VQIA 4QF4A 4DK6C 5KNDA 4FVMA 2K1BA 4GOPA 2ZM6L 2NUCA 2IL8A 4LF9Q 2XWBB 3K5MA 2YU9H 3S1RB 4JI5Q 4PQXA 3I4MG 5I2XA 3HKZG 3HGBA 4QB4A 5D65A 4GNXA 3A8KE 1T5XD 4BY1B 1N34L 2PI2A 3KF6B 1B2TA 1ZEQX 1SMYC 1N32L 5I9OA 3SE0A 4C3HG 3BS1A 2NN6G 1DOMA 4PV1C 4HTHA 2F0MA 1TVXA 3G6JB 4A3DB 3J81i 1HNZL 1BCPC 2N8NA 3BZDB 3J80E 3EQLC 2R7ZB 4DR6Q 3W1BA 4N9TA 1B44D 3CCRA 2CQAA 3D8GA 1Q82C 1VQEA 1N36Q 4LF5L 2ZT9C 1NBWA 1RTNA 4FDBA 1I3QB 5ELEA 2N3SA 4ALPA 3CRKC 3AMUA 2HIXA 5C44B 1KAWA 3UI2A 2F0HA 4IZ8A 1D1IA 1HR0W 3RUZA 3BVMA 4EQPA 4R4QA 2C5CA 2B39A 2B63B 5E7NA 1ENFA 1MGSA 2MQHA 1PYWD 4A3IH 2WIIB 1P16A 1IBLQ 3SK5A 2HT1A 1DONA 1RL2A 2EYFA 3D6CA 5COYA 2BE5D 4JI1L 3RN2A 2VXWA 4KMUC 1UE6A 2IPKD 5J3BA 1VQPA 2EY2A 4LF4Q 1MIUA 2IHEA 3K5OA 2K33A 1LTBD 2B2WA 2HCIA 1SNOA 1NNXA 3NTHA 5E4WC 2CVRA 2D0PA 3F2UA 2DJGC 3GQBA 3MAQA 1I50B 4IJLA 3C46A 1BBXC 1TWHB 1G91A 5A2QL 4DUZQ 1BR9A 2RDFA 3OPOA 4DR7Q 5IGDA 1LYLA 1CSQA 1PZJD 2K5QA 3GV3A 2B2YC 4UY8C 2HHHQ 4BXXH 1CHPD 3S1QH 1JWMD 2NZOA 1TT2A 3NE5B 2HUGA 2R61A 4RFBA 3ZYYX 2F1MA 2I5HA 3K0XA 2VW9A 4LFCL 4J6HA 3E0EA 5IOCA 3NEMA 1J8IA 4DV6L 1EU4A 3M3YH 4RAUC 4DK0A 2AHOB 4YY3L 1VQ5A 4A3FG 2VB3X 4IUTA 5C4ZA 4DR3L 5C4XH 4DUYQ 4HIDA 1G51A 3OSOA 4C1NK 4QY7A 4DR2Q 3RN5A 4L8JA 3T16A 1UNSA 4DAYB 3M9BA 5IY0A 1L2FA 1OXTA 2CCZA 5JVH3 2KBNA 1NAPA 4MTNA 3CQZB 3TN2A 3E9IA 2EYOA 3S14H 5JEAH 2L11A 3UDGA 5DLQE 4K5XA 3Q8DA 5FJ8G 3GTJB 1XNRL 4HJ5A 2E76C 2B3GA 1WYDA 1WCMH 1C48A 1O7YA 5G3LD 1PA6A 1EIYB 3S1MB 5IT9L 1HPCA 1S5BD 2NTTA 1TWGH 5M5XH 1Q81C 1SSOA 3CW2C 4HAEA 2CFMA 1B4OA 3NBHB 4FP5D 1YEZA 2Q8TA 4TKOB 1SE3A 2F0OA 3BYTB 1GUGA 2I0QA 2MO0A 2A6HC 1AW7A 4GKJQ 4V190 1Y8PB 1YBYA 4L5QA 3KF6A 1H9RA 4A3JH 3FVQA 3CCSA 2B8GA 1N33L 4E6IA 4KD4A 1ZXTA 3SR1A 4PG3A 1XMOQ 2EY5A
chains in the Genus database with same CATH topology
1BBWA 3GD7A 5BR8L 1K9MC 2V1CC 4A3EH 1N36L 2ES2A 4BY1G 3I2ZA 4GN4B 1QZHA 3CQZH 4JG2A 4NXNL 1YJNA 2Q2UA 3HOVH 5C3EG 3KF8B 4B3SQ 3FKIH 2E2JH 2C35B 3OTOQ 3WWVA 1YHAA 2MFIA 3H0GG 3PUVA 1TXYA 4K0KL 5IWAQ 4EX5A 2KCMA 1VQDA 3H0GH 5ELOA 3RZDH 3LGJA 4A3DG 4HIOA 1SE8A 1IBKL 1IBLL 1KHIA 3A5ZB 2R7ZG 4QJFA 5GROA 4YCWA 4DAMA 1K73C 3HOWG 1YNXA 2ZJRA 2CWPA 1AE3A 3HOUH 3KJPA 1IBMQ 1VQ7A 4LF6Q 4LF7L 3J81c 1VQNA 1VQOA 4JI3L 2MNAA 4A3BG 4DV2L 1GD7A 3EN2A 4A3BH 5C44G 1I3QH 3U50C 4YHHL 4B3TL 4LF4L 3GTOH 1X3EA 4JYAL 4B3MQ 5C44H 2WAQE 2Y0SE 5AJ3Q 3HKSA 1FVIA 1K83H 1PH2A 2IX0A 2I5LX 1EFWA 3KOJA 1KC8C 2JK8A 1D7QA 3I4OA 4ME3A 2B63G 4BXXG 1G291 3T1YL 2OWOA 4MNOA 4TQUS 1PH9A 4DR4Q 1XPOA 4A75A 3MXNB 4JI6Q 2K52A 4GKKL 2XTIA 3PGZA 1YVCA 1LTLA 3M85A 1NJIC 2JA6H 3BZKA 1XMQL 1PVOA 1CKNA 4PZ7A 2E2HH 1K3RA 3K80C 2WP8J 4JCVE 5M3MH 2UUBQ 4A3LG 3S17H 2DUDA 4OWXB 4UP7A 4DUZL 4A3LH 2N78A 1C9OA 4DV6Q 4B3RL 4PMWA 1NMFA 1Z9FA 3AYHB 3PSIA 2AKWB 3EBEA 3I4NH 2A8VA 4DR7L 4OX9Q 3PCOB 4YY3Q 3KDFA 3I55A 4DV1L 2GN5A 1AH9A 1L0WA 4JI2Q 4C3JH 4AQYL 1Q46A 1E1OA 4C3IH 1X3GA 2XGTA 3FP9A 2HHHL 4NPSA 1VQ6A 1Y1WG 1K0RA 2F52A 2QGQA 5FLMG 2UXCL 1V43A 4DR5Q 1PH4A 1FGUA 4HJ9A 4DNIA 1SFOH 2ALYB 5FLMH 1E24A 4GOPB 3U4ZA 1V1QA 5GQOA 1YZ6A 3UE0A 4DR1L 1I6HH 2ZM6Q 1GM5A 2WB1E 4WJ3M 3PUYA 4HJAA 4BBSG 2BA0A 1IXRA 2HQLA 4A3MH 2JA7G 2UXDQ 4QQBX 1G6PA 1A63A 3RLOA 4BBSH 1VQCA 2OTJA 5FLXc 3PF5A 4LWCA 4KHPQ 4GNXB 1CKOA 4A4IA 2NN6I 1N34Q 2UUAL 1HJPA 1SMXA 2UUCQ 5H1SE 1KIXA 2EIFA 1PFSA 3CCLA 4LFBL 2Z6KA 1WCMG 5LMNL 3KJOA 3GTMH 1M1KC 1N32Q 2ATWA 2K4KA 1XTDA 4LUOA 2YTVA 2RHSB 2K5HA 2H5XA 3UDXA 4DUYL 3OW2A 1HNZQ 5C0XJ 1M90C 4GOPC 1XNQQ 1JT8A 2PNHA 5M3FG 4DR2L 2JA5G 1PV4A 1HZAA 3I56A 1LM0A 3AEVA 1HZ9A 4HIMA 5M3FH 2VUMG 1SROA 3RLFA 2JA5H 1VQMA 2Z0SA 3F1ZA 2NVYH 4OWTB 1VCIA 3J80c 4LF5Q 3I4MH 2ZTCA 4JI8L 3UE1A 3EIVA 4X65Q 4GNXC 2MO1A 3K7AH 4L5SA 4UPAA 3M4PA 4DV0L 2OTLA 2Q2TA 1U0LA 4JI4L 1E22A 2CKZB 3TS0A 1FJGQ 4A3JG 3CAMA 5LMUL 4BA1I 4X62L 4DV7Q 1K8AC 3CPWA 4DV3Q 2YTXA 5GAEC 2YYZA 1H95A 2D0OA 4O0AA 2VS1A 4A3CG 4AYBE 1PHJA 1E7ZA 2JEAI 2VQEL 1YHBA 3HKZE 1VQLA 3GTGH 4YWMA 2K75A 1P8LA 4NXMQ 1VS0A 2OQKA 1N9WA 4A3EG 4JI1Q 5GAGC 3HOZH 5IYDG 4KHZA 3HOVG 3CMAA 4UP9A 3FKIG 2JJQA 4JI0Q 5IYDH 3TREA 1GKHA 3CC4A 2LXJA 4GKJL 2JQOA 1UE7A 4X66L 3KYHC 3GTJH 3T1HL 4K0KQ 5JJIA 1K8GA 4YCUA 4L5RC 2RCNA 1X56A 4QIWE 4NB3A 3F2CA 4GN5A 4C2MH 1IBKQ 2WAQG 2Y0SG 3BJUA 3S1MH 4R4OA 5JEAJ 4OXPA 3HOUG 1MKHA 4DV4L 1NE3A 2EXDA 3GO5A 2PI2E 2ZTEA 3TEHB 1PYBA 5M5YH 3S16H 4LFAQ 1YHQA 4LF7Q 3GDEA 3U4VA 1XMOL 2R93G 1KXLA 2E2IH 4APVA 1W2BA 2R93H 4IFDJ 4H02A 3PIPA 1YI2A 3AFPA 1PH1A 5C0XI 4YHHQ 2JA8H 4A76A 1YIJA 3PUWA 3K7UC 3L0OA 4JBJA 2KENA 1UE1A 1GO3E 3D31A 3ULJA 3OTOL 4Y7NH 5K36G 3ERSX 5HY6A 4P72A 5IWAL 1OTCA 3J81j 3CD6A 1UEBA 3RZOH 3H3VI 1JJCB 1PH3A 4IPDA 4LNQA 1VQGA 3ER0A 4R4IA 1T9HA 1VQ9A 2PQAB 5M5WH 1QZGA 2UU9Q 4GKJQ 2GVBA 4OONA 3A0JA 5JJKA 4LF8Q 1I5FA 2JA6G 4RG1A 3S1NH 3GTLH 5JJLA 1IBML 2E5LQ 5M3MG 4BY7H 1Y14B 3ZJYC 2GVAA 4P71A 4LF6L 1WJJA 4LFCQ 4LUVA 3JC66 4B3RQ 1QUQB 2NVXH 1S40A 3W1GA 1OXVA 1VQHA 4IPGA 3I4NG 4EQ5A 2NVTH 3G71A 2WB1G 4B3ML 4HIKA 5AJ3L 3H15A 4DV1Q 1UWVA 1X55A 4IPCA 4AQYQ 2OQ0A 2QA4A 5IE8A 2KHIA 1HNWQ 1VQKA 1AE2A 4BA2I 1NMGA 1C0AA 1TWFH 1PH7A 1A62A 1BBUA 5HGQA 1I94L 1QVCA 4DR4L 3HOXG 1KRTA 4IOCA 1EWIA 3MEFA 4DR3Q 4KI0A 1KRSA 3HOXH 2JA9A 2F4VQ 4JBWA 1TWAH 1YITA 4OWWB 3PV0A 4A3MG 2UUBL 1WI5A 4JBMA 3G48A 2I5MX 3KFUA 4XIGS 1HR0L 3PUXA 3FHWA 4HJ7A 4IPHA 1VQJA 3F2DA 1EYGA 3KLWA 3J7ZC 1DGSA 1Q1EA 3RLNA 2LXKA 4OX9L 4IFDI 1JJGA 4OO1I 1Q7YC 3HOYG 1S3OA 1VQFA 4X64Q 4JV5L 3W5OA 1ASZA 3S2HH 1MJCA 3CF5A 1VQ4A 1XNRQ 3HOYH 2UXBL 1A0IA 1J6QA 3ULLA 3J7A5 3S15H 1EUJA 4QGUA 4YWKA 4DR5L 2ZJPA 1VQIA 1OXSC 4GN3B 2A1AA 3OYYA 1X54A 4RMFA 1X9NA 4DK6C 4GOPA 2ZM6L 4LF9Q 2YU9H 2Q2HA 5GAHC 2VY3A 4JI5Q 4Y52H 2VZAA 3GTKH 3D0FA 5IYCG 2DGYA 4AYBG 3I4MG 1BVSA 3ULPA 3HKZG 5IYCH 4KHPL 1JJ2A 1J5EQ 4GNXA 4A93G 2R6GA 1N34L 1L1OB 4DV0Q 2UUCL 2RHQB 1HNXQ 4A93H 1EOVA 5IP9H 2PI2A 1E1TA 2ZTDA 3CC2A 3KF6B 5FJ8H 3NELA 2IHFA 2BA1A 1N32L 3L7ZC 2NN6G 3ICEA 2ZJQA 4C3HH 3GTPH 3DLLA 4DV5Q 3J81i 1HNZL 1N33Q 2N8NA 5ELNA 3CPFA 3F2BA 1XNQL 4JI7L 2FXQA 1XJVA 4DR6Q 1YJWA 1Q86C 4BBRH 1UE5A 2YTYA 3BZCA 3W1BA 3HOZG 5BR8Q 2BH2A 3CCRA 2ID0A 2IX1A 1Q82C 1VQEA 1N36Q 4LF5L 1SLJA 1SRUA 3M4QA 2R92G 3CCEA 4NXNQ 1NBWA 4FDBA 4JC0A 4ALPA 1MJEA 2N3SA 2R92H 3G6EA 3PO2G 4X65L 3PO2H 1NY4A 2HIXA 1EQRA 1R9TH 1KAWA 4L5TA 1L1OC 4JOIC 2HIVA 4POFA 3JAMi 1S72A 2VQFL 1ASYA 1FJGL 3M7NA 1HR0W 2E8GA 2KHJA 5IYBG 1KL9A 4DV3L 1PYSB 4R4QA 1BKBA 4R4CA 5EAYA 5IYBH 1SN8A 5E7NA 2MQHA 4A3IH 1IBLQ 3UDIA 1P16A 3UDFA 3L2PA 1SR3A 4DPGA 1CUKA 2F3IA 1Q8KA 2HT1A 1FL0A 2CQOA 1RL2A 4UP8A 1IYJB 1E3PA 1V9PA 4NXML 4XTCS 4LW1A 1IL2A 4JI1L 4PZ6A 5C4JH 1B7YB 4JI3Q 3PF4A 1U5KA 5LMNW 4DV2Q 3RN2A 2JA8G 1UE6A 4P73A 5J3BA 1VQPA 4R1JA 1IZ6A 4KLKA 4BY1H 1HZCA 4B3TQ 4LF4Q 2B29A 1QVGA 1MIUA 4JI0L 2BH8A 3TRZA 5C3EH 4B3SL 4JYAQ 2IHEA 2Q2IA 2R7DA 3SGIA 2K5VA 4QL5A 3CCUA 4O2DA 4GLAC 3S2DH 4WJ4A 1RIPA 2A19A 3T1YQ 4A3DH 2D0PA 2YV5A 4GKKQ 3CCQA 2R7ZH 4J15A 4P75A 3HOWH 4BY7G 1CKNB 1W3SA 4IJLA 4LFAL 1XMQQ 1CSPA 4IJHA 1JMCA 3NENA 3AFQA 1PH6A 4DUZQ 4A3GH 3CMEA 2RF4A 2JEBI 1X3FA 3KDFB 4R4TA 3CXCA 3U58A 4DR7Q 2WFWA 1LYLA 1VQAA 2K14A 4PZ8A 1A8VA 1CSQA 3STBC 3A74A 5C0XG 3BU2A 4UY8C 1I94Q 2HHHQ 2B63H 4BXXH 3JAMc 2K50A 2R7FA 2NZOA 3S1QH 1JB7A 2AWNA 2UXCQ 2PQAA 2UU9L 3CP0A 2NZHA 4LF8L 4JI6L 1CKMA 3F8TA 1N8RC 2I5HA 3K0XA 2E5LL 1Z47A 4DR1Q 4JBKA 3H3VH 1XPRA 2VW9A 3CC7A 3J80i 2N49A 3K8AA 4LFCL 4AH6A 1HR0Q 3E0EA 1O7IA 2K5NA 3NEMA 5IT9c 1QUQA 4DV6L 4X6AH 3RR5A 2JE6I 1KQSA 3M3YH 1D8LA 4YWLA 2UUAQ 2AHOB 4YY3L 4JV5Q 3CCJA 3PO3G 3M4OH 1VQ5A 2IY5B 4JI2L 1HNWL 1Q1BA 2UXBQ 4A3FG 4LFBQ 3PO3H 1EIFA 4MZ9A 5LMNQ 3E9HA 4A3FH 1X65A 5C4XG 2VNUD 4HJ8A 1Y1WH 2OCEA 2AMCB 4DR3L 1I50H 1Q12A 5C4XH 4DUYQ 2CWAA 3G4SA 2F4VL 2EQSA 4IOAA 3STBD 1WOCA 1TWHH 4HIDA 1G51A 4POGA 1NTGA 4IO9A 4QY7A 4DR2Q 3RN5A 1YJ9A 2UXDL 4DAYB 2JA7H 2L15A 3M9BA 5IY0A 1L2FA 3I7FA 3A5UA 1EQQA 1OXTA 2CCZA 3HFZB 2AWOA 2KBNA 4MTNA 5JEAG 4JI8Q 1KD1C 2PMZE 3E9IA 1TWCH 5IP9G 3S14H 4X64L 3UDGA 5DLQE 1OXXK 3Q8DA 5FJ8G 2KCTA 4JI4Q 1XNRL 5LMUQ 4HJ5A 1PH5A 4X62Q 3PUZA 2Z6KC 1LUZA 2B3GA 1WYDA 1WCMH 4AIMA 1PA6A 1PH8A 4IFDG 1EIYB 4OO1G 1JE5A 3TQYA 1VQ8A 2VQEQ 1B8AA 1TWGH 5M5XH 4GLXA 1Q81C 4JI7Q 4LF9L 1XPUA 3CW2C 3DM3A 4BBRG 2NVQH 2CFMA 4JI5L 3K81C 4LUZA 3NBHB 3AQQA 1YEZA 2VUMH 4A3GG 2VL6A 1HZBA 1B70B 1J5EL 2I0QA 2MO0A 1C7YA 2IT1A 1Y1VG 1VQBA 1GVPA 2LSSA 4DK3C 3VDYA 5IP7G 1HNXL 1L1OA 4JOIA 4TVAB 1Y1VH 4YCVA 4X66Q 2VQFQ 3T1HQ 3TS2A 3CCVA 4L5QA 1YBYA 4A3KG 5IP7H 3S24A 3KF6A 1OXUA 4A3JH 3B6YA 4DV7L 3CCSA 1X6OA 4GLVB 2QEXA 4A3KH 2ASBA 4A3IG 3CCMA 4GS3A 1N33L 4DV5L 3GTQH 1WFQA 4DV4Q 3IRBA 4A3CH 2D62A 3PIOA 5GADC 1HH2P 1QVFA 4PG3A 4DR6L 3S1RH 4P74A 4DKAC 1XMOQ 3RNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBW A;  3GD7 A;  5BR8 L;  1K9M C;  2V1C C;  4A3E H;  1N36 L;  2ES2 A;  4BY1 G;  3I2Z A;  4GN4 B;  1QZH A;  3CQZ H;  4JG2 A;  4NXN L;  1YJN A;  2Q2U A;  3HOV H;  5C3E G;  3KF8 B;  4B3S Q;  3FKI H;  2E2J H;  2C35 B;  3OTO Q;  3WWV A;  1YHA A;  2MFI A;  3H0G G;  3PUV A;  1TXY A;  4K0K L;  5IWA Q;  4EX5 A;  2KCM A;  1VQD A;  3H0G H;  5ELO A;  3RZD H;  3LGJ A;  4A3D G;  4HIO A;  1SE8 A;  1IBK L;  1IBL L;  1KHI A;  3A5Z B;  2R7Z G;  4QJF A;  5GRO A;  4YCW A;  4DAM A;  1K73 C;  3HOW G;  1YNX A;  2ZJR A;  2CWP A;  1AE3 A;  3HOU H;  3KJP A;  1IBM Q;  1VQ7 A;  4LF6 Q;  4LF7 L;  3J81 c;  1VQN A;  1VQO A;  4JI3 L;  2MNA A;  4A3B G;  4DV2 L;  1GD7 A;  3EN2 A;  4A3B H;  5C44 G;  1I3Q H;  3U50 C;  4YHH L;  4B3T L;  4LF4 L;  3GTO H;  1X3E A;  4JYA L;  4B3M Q;  5C44 H;  2WAQ E;  2Y0S E;  5AJ3 Q;  3HKS A;  1FVI A;  1K83 H;  1PH2 A;  2IX0 A;  2I5L X;  1EFW A;  3KOJ A;  1KC8 C;  2JK8 A;  1D7Q A;  3I4O A;  4ME3 A;  2B63 G;  4BXX G;  1G29 1;  3T1Y L;  2OWO A;  4MNO A;  4TQU S;  1PH9 A;  4DR4 Q;  1XPO A;  4A75 A;  3MXN B;  4JI6 Q;  2K52 A;  4GKK L;  2XTI A;  3PGZ A;  1YVC A;  1LTL A;  3M85 A;  1NJI C;  2JA6 H;  3BZK A;  1XMQ L;  1PVO A;  1CKN A;  4PZ7 A;  2E2H H;  1K3R A;  3K80 C;  2WP8 J;  4JCV E;  5M3M H;  2UUB Q;  4A3L G;  3S17 H;  2DUD A;  4OWX B;  4UP7 A;  4DUZ L;  4A3L H;  2N78 A;  1C9O A;  4DV6 Q;  4B3R L;  4PMW A;  1NMF A;  1Z9F A;  3AYH B;  3PSI A;  2AKW B;  3EBE A;  3I4N H;  2A8V A;  4DR7 L;  4OX9 Q;  3PCO B;  4YY3 Q;  3KDF A;  3I55 A;  4DV1 L;  2GN5 A;  1AH9 A;  1L0W A;  4JI2 Q;  4C3J H;  4AQY L;  1Q46 A;  1E1O A;  4C3I H;  1X3G A;  2XGT A;  3FP9 A;  2HHH L;  4NPS A;  1VQ6 A;  1Y1W G;  1K0R A;  2F52 A;  2QGQ A;  5FLM G;  2UXC L;  1V43 A;  4DR5 Q;  1PH4 A;  1FGU A;  4HJ9 A;  4DNI A;  1SFO H;  2ALY B;  5FLM H;  1E24 A;  4GOP B;  3U4Z A;  1V1Q A;  5GQO A;  1YZ6 A;  3UE0 A;  4DR1 L;  1I6H H;  2ZM6 Q;  1GM5 A;  2WB1 E;  4WJ3 M;  3PUY A;  4HJA A;  4BBS G;  2BA0 A;  1IXR A;  2HQL A;  4A3M H;  2JA7 G;  2UXD Q;  4QQB X;  1G6P A;  1A63 A;  3RLO A;  4BBS H;  1VQC A;  2OTJ A;  5FLX c;  3PF5 A;  4LWC A;  4KHP Q;  4GNX B;  1CKO A;  4A4I A;  2NN6 I;  1N34 Q;  2UUA L;  1HJP A;  1SMX A;  2UUC Q;  5H1S E;  1KIX A;  2EIF A;  1PFS A;  3CCL A;  4LFB L;  2Z6K A;  1WCM G;  5LMN L;  3KJO A;  3GTM H;  1M1K C;  1N32 Q;  2ATW A;  2K4K A;  1XTD A;  4LUO A;  2YTV A;  2RHS B;  2K5H A;  2H5X A;  3UDX A;  4DUY L;  3OW2 A;  1HNZ Q;  5C0X J;  1M90 C;  4GOP C;  1XNQ Q;  1JT8 A;  2PNH A;  5M3F G;  4DR2 L;  2JA5 G;  1PV4 A;  1HZA A;  3I56 A;  1LM0 A;  3AEV A;  1HZ9 A;  4HIM A;  5M3F H;  2VUM G;  1SRO A;  3RLF A;  2JA5 H;  1VQM A;  2Z0S A;  3F1Z A;  2NVY H;  4OWT B;  1VCI A;  3J80 c;  4LF5 Q;  3I4M H;  2ZTC A;  4JI8 L;  3UE1 A;  3EIV A;  4X65 Q;  4GNX C;  2MO1 A;  3K7A H;  4L5S A;  4UPA A;  3M4P A;  4DV0 L;  2OTL A;  2Q2T A;  1U0L A;  4JI4 L;  1E22 A;  2CKZ B;  3TS0 A;  1FJG Q;  4A3J G;  3CAM A;  5LMU L;  4BA1 I;  4X62 L;  4DV7 Q;  1K8A C;  3CPW A;  4DV3 Q;  2YTX A;  5GAE C;  2YYZ A;  1H95 A;  2D0O A;  4O0A A;  2VS1 A;  4A3C G;  4AYB E;  1PHJ A;  1E7Z A;  2JEA I;  2VQE L;  1YHB A;  3HKZ E;  1VQL A;  3GTG H;  4YWM A;  2K75 A;  1P8L A;  4NXM Q;  1VS0 A;  2OQK A;  1N9W A;  4A3E G;  4JI1 Q;  5GAG C;  3HOZ H;  5IYD G;  4KHZ A;  3HOV G;  3CMA A;  4UP9 A;  3FKI G;  2JJQ A;  4JI0 Q;  5IYD H;  3TRE A;  1GKH A;  3CC4 A;  2LXJ A;  4GKJ L;  2JQO A;  1UE7 A;  4X66 L;  3KYH C;  3GTJ H;  3T1H L;  4K0K Q;  5JJI A;  1K8G A;  4YCU A;  4L5R C;  2RCN A;  1X56 A;  4QIW E;  4NB3 A;  3F2C A;  4GN5 A;  4C2M H;  1IBK Q;  2WAQ G;  2Y0S G;  3BJU A;  3S1M H;  4R4O A;  5JEA J;  4OXP A;  3HOU G;  1MKH A;  4DV4 L;  1NE3 A;  2EXD A;  3GO5 A;  2PI2 E;  2ZTE A;  3TEH B;  1PYB A;  5M5Y H;  3S16 H;  4LFA Q;  1YHQ A;  4LF7 Q;  3GDE A;  3U4V A;  1XMO L;  2R93 G;  1KXL A;  2E2I H;  4APV A;  1W2B A;  2R93 H;  4IFD J;  4H02 A;  3PIP A;  1YI2 A;  3AFP A;  1PH1 A;  5C0X I;  4YHH Q;  2JA8 H;  4A76 A;  1YIJ A;  3PUW A;  3K7U C;  3L0O A;  4JBJ A;  2KEN A;  1UE1 A;  1GO3 E;  3D31 A;  3ULJ A;  3OTO L;  4Y7N H;  5K36 G;  3ERS X;  5HY6 A;  4P72 A;  5IWA L;  1OTC A;  3J81 j;  3CD6 A;  1UEB A;  3RZO H;  3H3V I;  1JJC B;  1PH3 A;  4IPD A;  4LNQ A;  1VQG A;  3ER0 A;  4R4I A;  1T9H A;  1VQ9 A;  2PQA B;  5M5W H;  1QZG A;  2UU9 Q;  4GKJ Q;  2GVB A;  4OON A;  3A0J A;  5JJK A;  4LF8 Q;  1I5F A;  2JA6 G;  4RG1 A;  3S1N H;  3GTL H;  5JJL A;  1IBM L;  2E5L Q;  5M3M G;  4BY7 H;  1Y14 B;  3ZJY C;  2GVA A;  4P71 A;  4LF6 L;  1WJJ A;  4LFC Q;  4LUV A;  3JC6 6;  4B3R Q;  1QUQ B;  2NVX H;  1S40 A;  3W1G A;  1OXV A;  1VQH A;  4IPG A;  3I4N G;  4EQ5 A;  2NVT H;  3G71 A;  2WB1 G;  4B3M L;  4HIK A;  5AJ3 L;  3H15 A;  4DV1 Q;  1UWV A;  1X55 A;  4IPC A;  4AQY Q;  2OQ0 A;  2QA4 A;  5IE8 A;  2KHI A;  1HNW Q;  1VQK A;  1AE2 A;  4BA2 I;  1NMG A;  1C0A A;  1TWF H;  1PH7 A;  1A62 A;  1BBU A;  5HGQ A;  1I94 L;  1QVC A;  4DR4 L;  3HOX G;  1KRT A;  4IOC A;  1EWI A;  3MEF A;  4DR3 Q;  4KI0 A;  1KRS A;  3HOX H;  2JA9 A;  2F4V Q;  4JBW A;  1TWA H;  1YIT A;  4OWW B;  3PV0 A;  4A3M G;  2UUB L;  1WI5 A;  4JBM A;  3G48 A;  2I5M X;  3KFU A;  4XIG S;  1HR0 L;  3PUX A;  3FHW A;  4HJ7 A;  4IPH A;  1VQJ A;  3F2D A;  1EYG A;  3KLW A;  3J7Z C;  1DGS A;  1Q1E A;  3RLN A;  2LXK A;  4OX9 L;  4IFD I;  1JJG A;  4OO1 I;  1Q7Y C;  3HOY G;  1S3O A;  1VQF A;  4X64 Q;  4JV5 L;  3W5O A;  1ASZ A;  3S2H H;  1MJC A;  3CF5 A;  1VQ4 A;  1XNR Q;  3HOY H;  2UXB L;  1A0I A;  1J6Q A;  3ULL A;  3J7A 5;  3S15 H;  1EUJ A;  4QGU A;  4YWK A;  4DR5 L;  2ZJP A;  1VQI A;  1OXS C;  4GN3 B;  2A1A A;  3OYY A;  1X54 A;  4RMF A;  1X9N A;  4DK6 C;  4GOP A;  2ZM6 L;  4LF9 Q;  2YU9 H;  2Q2H A;  5GAH C;  2VY3 A;  4JI5 Q;  4Y52 H;  2VZA A;  3GTK H;  3D0F A;  5IYC G;  2DGY A;  4AYB G;  3I4M G;  1BVS A;  3ULP A;  3HKZ G;  5IYC H;  4KHP L;  1JJ2 A;  1J5E Q;  4GNX A;  4A93 G;  2R6G A;  1N34 L;  1L1O B;  4DV0 Q;  2UUC L;  2RHQ B;  1HNX Q;  4A93 H;  1EOV A;  5IP9 H;  2PI2 A;  1E1T A;  2ZTD A;  3CC2 A;  3KF6 B;  5FJ8 H;  3NEL A;  2IHF A;  2BA1 A;  1N32 L;  3L7Z C;  2NN6 G;  3ICE A;  2ZJQ A;  4C3H H;  3GTP H;  3DLL A;  4DV5 Q;  3J81 i;  1HNZ L;  1N33 Q;  2N8N A;  5ELN A;  3CPF A;  3F2B A;  1XNQ L;  4JI7 L;  2FXQ A;  1XJV A;  4DR6 Q;  1YJW A;  1Q86 C;  4BBR H;  1UE5 A;  2YTY A;  3BZC A;  3W1B A;  3HOZ G;  5BR8 Q;  2BH2 A;  3CCR A;  2ID0 A;  2IX1 A;  1Q82 C;  1VQE A;  1N36 Q;  4LF5 L;  1SLJ A;  1SRU A;  3M4Q A;  2R92 G;  3CCE A;  4NXN Q;  1NBW A;  4FDB A;  4JC0 A;  4ALP A;  1MJE A;  2N3S A;  2R92 H;  3G6E A;  3PO2 G;  4X65 L;  3PO2 H;  1NY4 A;  2HIX A;  1EQR A;  1R9T H;  1KAW A;  4L5T A;  1L1O C;  4JOI C;  2HIV A;  4POF A;  3JAM i;  1S72 A;  2VQF L;  1ASY A;  1FJG L;  3M7N A;  1HR0 W;  2E8G A;  2KHJ A;  5IYB G;  1KL9 A;  4DV3 L;  1PYS B;  4R4Q A;  1BKB A;  4R4C A;  5EAY A;  5IYB H;  1SN8 A;  5E7N A;  2MQH A;  4A3I H;  1IBL Q;  3UDI A;  1P16 A;  3UDF A;  3L2P A;  1SR3 A;  4DPG A;  1CUK A;  2F3I A;  1Q8K A;  2HT1 A;  1FL0 A;  2CQO A;  1RL2 A;  4UP8 A;  1IYJ B;  1E3P A;  1V9P A;  4NXM L;  4XTC S;  4LW1 A;  1IL2 A;  4JI1 L;  4PZ6 A;  5C4J H;  1B7Y B;  4JI3 Q;  3PF4 A;  1U5K A;  5LMN W;  4DV2 Q;  3RN2 A;  2JA8 G;  1UE6 A;  4P73 A;  5J3B A;  1VQP A;  4R1J A;  1IZ6 A;  4KLK A;  4BY1 H;  1HZC A;  4B3T Q;  4LF4 Q;  2B29 A;  1QVG A;  1MIU A;  4JI0 L;  2BH8 A;  3TRZ A;  5C3E H;  4B3S L;  4JYA Q;  2IHE A;  2Q2I A;  2R7D A;  3SGI A;  2K5V A;  4QL5 A;  3CCU A;  4O2D A;  4GLA C;  3S2D H;  4WJ4 A;  1RIP A;  2A19 A;  3T1Y Q;  4A3D H;  2D0P A;  2YV5 A;  4GKK Q;  3CCQ A;  2R7Z H;  4J15 A;  4P75 A;  3HOW H;  4BY7 G;  1CKN B;  1W3S A;  4IJL A;  4LFA L;  1XMQ Q;  1CSP A;  4IJH A;  1JMC A;  3NEN A;  3AFQ A;  1PH6 A;  4DUZ Q;  4A3G H;  3CME A;  2RF4 A;  2JEB I;  1X3F A;  3KDF B;  4R4T A;  3CXC A;  3U58 A;  4DR7 Q;  2WFW A;  1LYL A;  1VQA A;  2K14 A;  4PZ8 A;  1A8V A;  1CSQ A;  3STB C;  3A74 A;  5C0X G;  3BU2 A;  4UY8 C;  1I94 Q;  2HHH Q;  2B63 H;  4BXX H;  3JAM c;  2K50 A;  2R7F A;  2NZO A;  3S1Q H;  1JB7 A;  2AWN A;  2UXC Q;  2PQA A;  2UU9 L;  3CP0 A;  2NZH A;  4LF8 L;  4JI6 L;  1CKM A;  3F8T A;  1N8R C;  2I5H A;  3K0X A;  2E5L L;  1Z47 A;  4DR1 Q;  4JBK A;  3H3V H;  1XPR A;  2VW9 A;  3CC7 A;  3J80 i;  2N49 A;  3K8A A;  4LFC L;  4AH6 A;  1HR0 Q;  3E0E A;  1O7I A;  2K5N A;  3NEM A;  5IT9 c;  1QUQ A;  4DV6 L;  4X6A H;  3RR5 A;  2JE6 I;  1KQS A;  3M3Y H;  1D8L A;  4YWL A;  2UUA Q;  2AHO B;  4YY3 L;  4JV5 Q;  3CCJ A;  3PO3 G;  3M4O H;  1VQ5 A;  2IY5 B;  4JI2 L;  1HNW L;  1Q1B A;  2UXB Q;  4A3F G;  4LFB Q;  3PO3 H;  1EIF A;  4MZ9 A;  5LMN Q;  3E9H A;  4A3F H;  1X65 A;  5C4X G;  2VNU D;  4HJ8 A;  1Y1W H;  2OCE A;  2AMC B;  4DR3 L;  1I50 H;  1Q12 A;  5C4X H;  4DUY Q;  2CWA A;  3G4S A;  2F4V L;  2EQS A;  4IOA A;  3STB D;  1WOC A;  1TWH H;  4HID A;  1G51 A;  4POG A;  1NTG A;  4IO9 A;  4QY7 A;  4DR2 Q;  3RN5 A;  1YJ9 A;  2UXD L;  4DAY B;  2JA7 H;  2L15 A;  3M9B A;  5IY0 A;  1L2F A;  3I7F A;  3A5U A;  1EQQ A;  1OXT A;  2CCZ A;  3HFZ B;  2AWO A;  2KBN A;  4MTN A;  5JEA G;  4JI8 Q;  1KD1 C;  2PMZ E;  3E9I A;  1TWC H;  5IP9 G;  3S14 H;  4X64 L;  3UDG A;  5DLQ E;  1OXX K;  3Q8D A;  5FJ8 G;  2KCT A;  4JI4 Q;  1XNR L;  5LMU Q;  4HJ5 A;  1PH5 A;  4X62 Q;  3PUZ A;  2Z6K C;  1LUZ A;  2B3G A;  1WYD A;  1WCM H;  4AIM A;  1PA6 A;  1PH8 A;  4IFD G;  1EIY B;  4OO1 G;  1JE5 A;  3TQY A;  1VQ8 A;  2VQE Q;  1B8A A;  1TWG H;  5M5X H;  4GLX A;  1Q81 C;  4JI7 Q;  4LF9 L;  1XPU A;  3CW2 C;  3DM3 A;  4BBR G;  2NVQ H;  2CFM A;  4JI5 L;  3K81 C;  4LUZ A;  3NBH B;  3AQQ A;  1YEZ A;  2VUM H;  4A3G G;  2VL6 A;  1HZB A;  1B70 B;  1J5E L;  2I0Q A;  2MO0 A;  1C7Y A;  2IT1 A;  1Y1V G;  1VQB A;  1GVP A;  2LSS A;  4DK3 C;  3VDY A;  5IP7 G;  1HNX L;  1L1O A;  4JOI A;  4TVA B;  1Y1V H;  4YCV A;  4X66 Q;  2VQF Q;  3T1H Q;  3TS2 A;  3CCV A;  4L5Q A;  1YBY A;  4A3K G;  5IP7 H;  3S24 A;  3KF6 A;  1OXU A;  4A3J H;  3B6Y A;  4DV7 L;  3CCS A;  1X6O A;  4GLV B;  2QEX A;  4A3K H;  2ASB A;  4A3I G;  3CCM A;  4GS3 A;  1N33 L;  4DV5 L;  3GTQ H;  1WFQ A;  4DV4 Q;  3IRB A;  4A3C H;  2D62 A;  3PIO A;  5GAD C;  1HH2 P;  1QVF A;  4PG3 A;  4DR6 L;  3S1R H;  4P74 A;  4DKA C;  1XMO Q;  3RNU A; 
#chains in the Genus database with same CATH topology
 2NB0 A;  1MSH A;  1HFG A;  3I2Z A;  4GN4 B;  1QZH A;  4NXN L;  1IHZ A;  3DM1 A;  2Q2U A;  5C3E G;  2E2J H;  2C35 B;  4FF1 A;  2MFI A;  2D2C C;  2WB1 B;  3PUV A;  2KCM A;  1Q90 A;  5CV4 A;  4JPB W;  4RH6 A;  1EQV A;  3LGJ A;  1LTS D;  4JVZ A;  1UEA B;  4YCW A;  4NMZ A;  1K73 C;  3HOW G;  2CWP A;  1KNA A;  3TP7 A;  2RCF A;  4KKU A;  3J81 c;  1I6H B;  4X3U A;  1VQO A;  4A3B G;  1C4Q A;  3EN2 A;  5K5P A;  5IGF A;  5AJ3 Q;  1K83 H;  1K3B C;  2I5L X;  3KOJ A;  1TII D;  1GOZ A;  4TRD A;  1YNN D;  3T1Y L;  4TQU S;  4YIJ A;  3OMG A;  4A75 A;  3GTM B;  5LHY 1;  3MXN B;  2CH4 W;  3PGZ A;  4DNT B;  1K8M A;  1PVO A;  1II3 A;  4PZ7 A;  4JCV E;  2WP8 J;  4ZUI A;  2DUD A;  4DNR B;  1R4Q B;  4A3L H;  1LT4 D;  4DV6 Q;  4ID6 A;  4PMW A;  1Z9F A;  3AYH B;  3JAM E;  3I4N H;  2A8V A;  4AYB B;  4OX9 Q;  4YY3 Q;  1E2Z A;  3H6M A;  4K2L A;  4FXD A;  2OF1 A;  3W2D A;  4C3J H;  4AQY L;  2A69 C;  1DXM A;  1WTR A;  1E1O A;  2ZXR A;  4C3I H;  1X3G A;  2DY7 A;  1WTX A;  2XN9 C;  1CI3 M;  3H91 A;  1J9O A;  1W6K A;  3FP9 A;  5E3F A;  5FLM G;  1V43 A;  4DR5 Q;  1E24 A;  4PMC A;  3OWE B;  2Q8I B;  2WB1 E;  4WJ3 M;  1GHK A;  4LK1 C;  1JC7 A;  3PUY A;  3BG3 A;  2BA0 A;  2F0J A;  4CDC C;  3E6Z X;  1U9R A;  1VQC A;  4L6T B;  3P1H A;  3HOZ B;  1EY9 A;  4A4I A;  3X3M A;  2UUC Q;  4K8J A;  1SNP A;  3VR4 A;  1KIX A;  3OIP A;  2QF7 A;  3CCL A;  1MD2 D;  2QEJ C;  5LMN L;  3KJO A;  3A54 A;  4FF4 A;  4LUO A;  2YTV A;  1DCZ A;  2RHS B;  2K5H A;  3HEJ A;  3OW2 A;  4BS9 A;  2WAQ B;  4RCN A;  2PNH A;  1AZP A;  3AEV A;  1HZ9 A;  5M3F H;  1SEB D;  3SK8 A;  2JA5 H;  1EY8 A;  4DAY A;  1VCI A;  3I4M H;  2ZTC A;  1CFM A;  3EIV A;  1RKN A;  1CHQ D;  3M4P A;  4DV0 L;  2Q2T A;  1U0L A;  2CKZ B;  3P75 A;  3TS0 A;  3CAM A;  4X62 L;  2NWG A;  3LX0 A;  2Z4H A;  4DV3 Q;  2YTX A;  1H95 A;  1QCB D;  1BO0 A;  1XTC D;  3BDO A;  4A3C G;  1A3V A;  4AYB E;  1PHJ A;  1L0X B;  2VQE L;  1MHW C;  4YWM A;  4H44 C;  4BY7 B;  4A3E G;  5GAG C;  3NWS A;  5EGT A;  1HQR D;  3CMA A;  3E5S A;  5KEE A;  1GKH A;  4X66 L;  3A8J E;  3T1H L;  5JJI A;  4N8F A;  1K8G A;  1WTQ A;  2RCN A;  3Q0A A;  1X56 A;  2EYJ A;  4NB3 A;  3F2C A;  2WAQ G;  3C3L A;  2EYL A;  2H4O A;  2EYM A;  2C9O A;  4OXP A;  5JEA J;  1I4G A;  1EIG A;  1TS2 A;  1NE3 A;  3J80 L;  5EBC A;  4TSS A;  3T4A C;  1HA5 A;  3HOX B;  1PYB A;  2E2I H;  3PIP A;  2FHT A;  3X3N A;  1YI2 A;  3NTK A;  2QIL A;  1O7L A;  4OIK A;  3Q23 A;  4J1M A;  2KEN A;  3OTO L;  1U4L A;  1PRT B;  3MHB A;  4Y7N H;  4P72 A;  2BCO A;  1UEB A;  1ONL A;  2RBM A;  4ULL A;  3A7L A;  4LNQ A;  1VQG A;  1D5M C;  4R4I A;  5M5W H;  1QZG A;  2UU9 Q;  1BXT A;  4LF8 Q;  5C4X B;  2JA6 G;  3K5L A;  3S1N H;  1UAP A;  1Y14 B;  4LF6 L;  4P71 A;  1PLF A;  3H3V C;  5KRU A;  4OEL B;  2PZT A;  1OXV A;  1VQH A;  2B2V A;  4EQ5 A;  1D5X C;  5EPJ A;  1JOR A;  3G71 A;  2I46 A;  4B3M L;  4HIK A;  1UWV A;  4N8X 1;  4AQY Q;  2QA4 A;  5FOB B;  1HNW Q;  4G7Z C;  1VQK A;  1B3A A;  1EY0 A;  2F0Q A;  4RKL A;  3HOX G;  5CGK A;  2PO4 A;  3MEF A;  1BOS A;  2A74 C;  3MXN A;  4JBW A;  3GTP B;  1TWG B;  2UUB L;  4XIG S;  1HR0 L;  3PUX A;  1A3T A;  4BBR B;  2B2U A;  4UHV A;  1VQJ A;  1SAP A;  3F2D A;  1PTO H;  4ZYS A;  4A3G B;  4IFD I;  1E0B A;  3DXJ C;  1RCV D;  1V1P B;  1IL8 A;  5EKL A;  1U4M A;  3IFD A;  4JV5 L;  3W5O A;  3S2H H;  2K28 A;  2HD3 A;  1VQ4 A;  3HOY H;  3ONA B;  3ULL A;  2FMM A;  1EUJ A;  1HHV A;  4GN3 B;  1STE A;  1X9N A;  4KKT A;  2AQ3 B;  5C3W A;  2Q2H A;  5GAH C;  2VY3 A;  4Y52 H;  2VZA A;  3GTK H;  2EYP A;  4KJO A;  5IYC G;  3RMH A;  3C1E A;  4CHT B;  5C4J B;  1JJ2 A;  1J5E Q;  3A55 A;  4A93 G;  2B2T A;  3M4Y A;  2R6G A;  1L1O B;  4DV0 Q;  1HNX Q;  5E4X A;  3TDQ A;  2ZTD A;  3CC2 A;  3K6O A;  5FJ8 H;  2O4X A;  1ROD A;  2IHF A;  1EY6 A;  1KAB A;  4K8I A;  3S2D B;  3ICE A;  5G3L F;  1I4X A;  3DLL A;  4DV5 Q;  4NW2 A;  2PNR C;  4NP5 A;  2F0G A;  1XNQ L;  2FXQ A;  1XJV A;  1YJW A;  3T56 B;  1SBB B;  3BZC A;  2BH2 A;  2R92 G;  1DOK A;  3M4Q A;  1SLJ A;  3GTL H;  3CCE A;  4EQN A;  4JC0 A;  1MJE A;  3PO2 G;  4L5T A;  4LMQ D;  5C6A A;  1S72 A;  1K83 B;  4POF A;  1ASY A;  2KED A;  5CV6 A;  3P7J A;  2VQF L;  1ET6 A;  5IYB G;  4X3S A;  1RDP D;  1B50 A;  3UDI A;  3I72 A;  3UDF A;  4DPG A;  1FL0 A;  1V9P A;  4NXM L;  4LW1 A;  3QWN A;  4ZQ3 A;  5LMN W;  4DV2 Q;  3BVZ A;  4R1J A;  3K57 A;  3MZ5 A;  1QVG A;  4JYA Q;  5C3E H;  3SGI A;  2K5V A;  4C3J B;  1STY A;  4WJ4 A;  4KY7 A;  2AUK A;  1GXD C;  2YV5 A;  1Y1W B;  4GKK Q;  2E2D C;  2Z9H A;  4P75 A;  3HOW H;  1CKN B;  2EYH A;  4ZUJ A;  5C5L A;  1XMQ Q;  1CSP A;  3R3O A;  4IJH A;  3NEN A;  4IUU A;  3CME A;  5HUR A;  2JA7 B;  1KTK A;  1X3F A;  3CXC A;  3U58 A;  2PW5 A;  4L63 B;  4KY5 A;  2MJ8 A;  1VQA A;  2X6L A;  2K14 A;  5C0X G;  3U9S A;  3HZX A;  4IUV A;  2K50 A;  2UXC Q;  2AWN A;  3CP0 A;  4G4K A;  2ZXP A;  3F8T A;  5I6W A;  3CU7 A;  4F8M A;  5I6Y A;  3BDL A;  3J80 i;  1HR0 Q;  1O7I A;  5IT9 c;  5M3F B;  2JA5 B;  3RR5 A;  1KQS A;  2VUM B;  1D8L A;  1HTP A;  5JJZ A;  3NTI A;  4JV5 Q;  3M4O H;  1F9S A;  3KBX A;  3PO3 H;  4MZ9 A;  1X65 A;  1Q12 A;  4OIJ A;  2CWA A;  3G4S A;  3GTQ B;  3STB D;  1WOC A;  1PMR A;  1NTG A;  5KNC A;  4Q0F A;  1YJ9 A;  2Z6B A;  5AFW A;  1EU3 A;  4KY6 A;  1EQQ A;  3HFZ B;  3JAM L;  1D1K A;  5KNB A;  3HOV B;  1TWC H;  3FKI B;  4DXF A;  1V1P A;  2KCT A;  5DM6 3;  2FMC A;  3NUC A;  2XWJ B;  3PUZ A;  2F0S A;  3MFG A;  4AIM A;  2KJX A;  1PH8 A;  2O5I C;  4OO1 G;  2KCN A;  4IFD H;  3J7A F;  2Y0S B;  1JE5 A;  1I4H A;  3HOU B;  2SDF A;  3K81 C;  2PYK A;  1SYC A;  3AQQ A;  2E2I B;  1SYB A;  1Q3L A;  1ML0 D;  4O1N A;  3MFY A;  4OGQ C;  5IP7 G;  1L1O A;  4JOI A;  4TVA B;  1Y1V H;  2VQF Q;  3CCV A;  4K6D A;  1SXT A;  3ND8 A;  5EKK A;  3MVV A;  3B6Y A;  4A3K H;  2XSC A;  5M5W B;  5EKI A;  4K2K A;  1EEF D;  5EJW A;  4A3C H;  2D62 A;  1HH2 P;  1QVF A;  3S1N B;  4P74 A;  3VR6 A;  3C1F A;  1KDB A;  5BR8 L;  5M3M B;  4A3E H;  1O80 A;  5ISR A;  4BY1 G;  4JG2 A;  1YNN C;  1XWE A;  1YJN A;  3KF8 B;  3N6R A;  4ODG A;  1YHA A;  1MSG A;  3H0G H;  3RZD H;  5CBA E;  4A3D G;  1H9K A;  3Q22 A;  4CDF C;  4ZK9 B;  3A5Z B;  3VYS A;  2R7Z G;  4DAM A;  3L9A X;  1YNX A;  1ENA A;  2EE1 A;  3BYY B;  4CGY B;  1WD1 A;  4KN7 C;  1SFO B;  3FEW X;  1IBM Q;  4LF7 L;  3OWF A;  4JI3 L;  2F0V A;  3R2T A;  5TSS A;  4A3M B;  5C44 G;  4B3T L;  3ND9 A;  1PTO B;  2Y0S E;  5COR A;  1JOK A;  1PH2 A;  3QOL A;  2IX0 A;  1EFW A;  2RQX A;  2B63 G;  1G29 1;  3HOY B;  2IWH A;  2KOL A;  3EJI A;  2EXZ A;  1STB A;  1U4P A;  2XTI A;  3OMC A;  1S5F D;  2JA6 H;  3BZK A;  1CKN A;  1Y8O B;  2E2H H;  1FNV A;  3S17 H;  4UP7 A;  2N78 A;  2ICI A;  1NMF A;  5DEH A;  1EOT A;  3PCO B;  3I55 A;  2GA4 B;  2IW3 A;  1EIH A;  2KA7 A;  5KIX A;  1VQ6 A;  1K0R A;  2F52 A;  2QGQ A;  4DNI A;  1EWH A;  3I90 A;  1WTH A;  3VR3 A;  2M00 A;  4F87 A;  1O7Z A;  1V1Q A;  1YZ6 A;  3UE0 A;  4DR1 L;  5FK9 C;  2ZM6 Q;  1GUW A;  3H09 A;  3GTG B;  1G6P A;  1A15 A;  4WFN 3;  1EQT A;  4CBV A;  4BBS H;  3MXG A;  3VA7 A;  4LWC A;  1DOL A;  1CKO A;  2UUA L;  2NN6 I;  1N34 Q;  3KLR A;  3QR8 A;  2EIF A;  4MN3 A;  4LFB L;  1CM9 A;  2F4I A;  2Z6K A;  4CJ2 C;  4EQO A;  1N32 Q;  5E1F A;  3I4L A;  2ATW A;  1XTD A;  2A68 D;  4C2M B;  5KGU A;  1HNZ Q;  2NTS A;  3R2I A;  1VF7 A;  4GOP C;  1KNE A;  1SE2 A;  2DNE A;  3I56 A;  3LWE A;  3S16 B;  2F0E A;  4HIM A;  3RLF A;  4BWG B;  4LAA A;  3F1Z A;  2NVY H;  2N55 A;  4LF5 Q;  3J80 c;  1Y8N B;  4U67 3;  4JI8 L;  2JA8 B;  3UE1 A;  4GNX C;  1UUP A;  4UPA A;  3NK9 A;  3RD4 A;  3D6W A;  4JI4 L;  1E22 A;  1KLG D;  2MPM A;  5LMU L;  1K8A C;  3CPW A;  3URY A;  2F0P A;  5FKA C;  5GAE C;  2HQE A;  2YYZ A;  5C5M A;  2VS1 A;  2KUM A;  4CDD C;  1X32 A;  4ZKB B;  4JI1 Q;  3IKJ A;  4R9W A;  1T5E A;  4NDX A;  2F0I A;  5IYD H;  4RHS A;  3K59 A;  4R8I A;  2G5D A;  2K6A A;  4YCU A;  4L5R C;  4QIW E;  4GN5 A;  4XT1 B;  1TWF B;  4IUQ A;  1JWS D;  2XRS D;  1MKH A;  2F0L A;  4N9P A;  2OT2 A;  4DV4 L;  4KTA A;  4XXE A;  5M5Y H;  2BOS A;  4LF7 Q;  2L0C A;  1KXL A;  4APV A;  1KLU D;  2R93 H;  4IFD J;  4H02 A;  3AFP A;  1PH1 A;  5CYU A;  1EWC A;  2XVS A;  4EGV A;  1NR4 A;  1UE1 A;  1GO3 E;  3KF8 A;  5K36 G;  3ERS X;  5IWA L;  3RZO H;  2B2W C;  3H3V I;  1EFI D;  1JJC B;  3VR5 A;  3BDC A;  3PMF A;  4RGN A;  4LJZ C;  2GVB A;  3A0J A;  1EEI D;  1QNU A;  5JJL A;  4ZLT F;  1BDO A;  2GVA A;  3OHX C;  4LFC Q;  2YU9 B;  2J4X A;  2SNM A;  2OXP A;  1S40 A;  3EA6 A;  3W1G A;  4IPG A;  2NVT H;  2WB1 G;  2K7V A;  3TSS A;  1SYF A;  1X55 A;  4H13 C;  1TWC B;  4HSV A;  5IE8 A;  3K58 A;  4BA2 I;  4HED A;  1HTL D;  1I94 L;  1A62 A;  1BBU A;  5HGQ A;  1JE4 A;  4DR4 L;  2LMC B;  1KRT A;  1K28 A;  2KHS A;  4DR3 Q;  3VR2 A;  1TWA H;  1YIT A;  4OL7 A;  1WI5 A;  1FGB D;  2I5M X;  3KFU A;  2G9D A;  3FHW A;  1HXY D;  3KLW A;  2B8F A;  3J7Z C;  2OEO A;  3RLN A;  3MTS A;  1WTW A;  1STG A;  3DMU A;  1S3O A;  1QIL A;  1Y1V B;  1ASZ A;  1MJC A;  3CF5 A;  1XNR Q;  3MA2 B;  1A0I A;  2WV6 D;  5CV8 A;  3S15 H;  3HS0 C;  4YWK A;  4QGU A;  4A3K B;  4XYQ A;  1VDZ A;  2F03 A;  1BCP B;  1OXS C;  4RMF A;  1BUV T;  1X54 A;  3OYY A;  5FLX E;  5IGG A;  5LL6 X;  4A3I B;  1PRT D;  4RGM A;  1NUC A;  1KDC A;  5CV5 A;  3MXU A;  2L9H A;  4K14 A;  1BVS A;  4AYB G;  4KHP L;  1PDQ A;  3NWT A;  5BN4 A;  2P5Z X;  2EJG C;  4RGT A;  5JPN C;  1CTM A;  3NEL A;  3H0G B;  2BA1 A;  3L7Z C;  2F0T A;  4G57 A;  4KN4 C;  4C3H H;  2NN6 H;  3WOF A;  1N33 Q;  5ELN A;  1TY0 A;  1SDF A;  3OIQ A;  1EY4 A;  2WIN B;  1Q86 C;  2D9U A;  2YTY A;  4B9W A;  3HOZ G;  1QJO A;  2ID0 A;  4QUF A;  2IX1 A;  4NXN Q;  3VA5 A;  5LL6 S;  5FO7 B;  4X65 L;  1SND A;  1NY4 A;  1EQR A;  3GP7 A;  1R9T H;  2HIV A;  1TR5 A;  1FJG L;  2EDG A;  3NPP A;  2E8G A;  3HP3 A;  1KL9 A;  4KJN A;  5EAY A;  1SN8 A;  2WKC A;  3S1Q B;  1LTR D;  3L2P A;  1SR3 A;  2F3I A;  1Q8K A;  4UP8 A;  3S9W A;  2E2H B;  4PZ6 A;  3S17 B;  3PF4 A;  4DAV A;  2RA4 A;  4BY1 H;  1HZC A;  2B29 A;  5CV7 A;  4JI0 L;  1KDA A;  2Q2I A;  3M3Y B;  5EBD A;  4FF3 A;  1LAB A;  1STN A;  4O2D A;  4GLA C;  3ERO A;  4U68 A;  1RIP A;  2A19 A;  3T1Y Q;  2BDN A;  2EY1 A;  4A3D H;  1IW7 C;  3CCQ A;  2R7Z H;  4J15 A;  4BY7 G;  4LFA L;  2LFN A;  1JMC A;  3T51 B;  3G7L A;  2RDH A;  1B3Q A;  1LT3 D;  1L0Y B;  2RF4 A;  3IFT A;  4R4T A;  3Q24 A;  1B9M A;  2WFW A;  2BDO A;  2TMP A;  2EPB A;  4PZ8 A;  4B9X A;  1A8V A;  3STB C;  3S14 B;  2ICE C;  3BU2 A;  1XYI A;  4M8A A;  3QJY A;  1I94 Q;  3SXH A;  2B63 H;  3JAM c;  2R7F A;  1JB7 A;  4G7H C;  1WCM B;  1MBY A;  1PZI D;  3V96 A;  2N88 A;  1CKM A;  2SNS A;  1N8R C;  1H9J A;  1JQY D;  5BN3 A;  2E5L L;  1Z47 A;  2Z8L A;  3H3V H;  5M5X B;  5L37 A;  3K8A A;  4AH6 A;  1A6X A;  1PXU A;  2L5T A;  4X6A H;  2JE6 I;  5JPM C;  4OHJ A;  4YWL A;  4DA2 A;  2IY5 B;  4JI2 L;  2QDB A;  1PFN A;  5BN5 A;  3J81 L;  1EIF A;  5LMN Q;  1B9N A;  4A3F H;  3L3O C;  4A3J B;  5C4X G;  2E74 C;  4HJ8 A;  2OCE A;  3CHB D;  1I50 H;  2F4V L;  2KCC A;  2MGS A;  1PZK D;  1TWH H;  1HA6 A;  4ZAI A;  4IO9 A;  4DXG A;  1EYD A;  3I7F A;  4S3S A;  3A5U A;  1HRJ A;  2AWO A;  5JEA G;  5IP9 G;  4B08 A;  2E2J B;  4X64 L;  1OXX K;  1PH5 A;  3PIO 3;  2KEE A;  4X62 Q;  3QIA A;  2L12 A;  4K6L A;  4M1U B;  1JOQ A;  2BE5 C;  1Z6H A;  3FDT A;  1LTI D;  3ERQ A;  1WVL A;  3TQY A;  2VQE Q;  4GLX A;  1VF5 C;  4LF9 L;  2Z4I A;  1XPU A;  4BBR G;  4JI5 L;  1CK1 A;  4ZRZ A;  2R93 B;  1FR3 A;  4WJW A;  4A3G G;  2F0N A;  2VL6 A;  5M9O A;  1B70 B;  5J39 A;  1C7Y A;  4RA8 A;  2LSS A;  4DK3 C;  1U4R A;  3VDY A;  4X66 Q;  3TS2 A;  3T1H Q;  3S24 A;  2DNC A;  2AQ1 B;  4CJ1 B;  1X6O A;  2MUY A;  1DYQ A;  4FF2 A;  3CCM A;  3IRB A;  2KQ3 A;  3D4W A;  4CKC A;  5GAD C;  2F0F A;  4DR6 L;  1R4P B;  1QNK A;  4DKA C;  3M7G A;  2ES2 A;  1N36 L;  3CQZ H;  2PZW A;  2NVT B;  1I4P A;  3I4N B;  3OTO Q;  3WWV A;  4K0K L;  1TXY A;  1VQD A;  5KYL A;  5ELO A;  3Q6S A;  4C3I B;  1YNJ D;  1GUT A;  1OO9 B;  4HIO A;  1I4Q A;  2O5J C;  1ESR A;  1SE8 A;  1IBK L;  1I6V C;  1IBL L;  1JB3 A;  3W3A A;  4QJF A;  2QDL A;  1I4R A;  1AE3 A;  2HDL A;  4CKE A;  1TWA B;  1VQ7 A;  4LF6 Q;  3D4D A;  4PNY A;  3CKI B;  4A3B H;  1EYC A;  4YHH L;  3DHQ A;  4LF4 L;  4IAL A;  3GTO H;  2FFK B;  4B3M Q;  3HKS A;  4ABN A;  3T13 A;  5K36 H;  1KC8 C;  5D3D A;  2B2Y A;  1D7Q A;  1JIC A;  3I4O A;  4ME3 A;  2OWO A;  4MNO A;  1PH9 A;  1XPO A;  2JN4 A;  2K52 A;  1YVC A;  3M85 A;  1NJI C;  3R93 A;  1SYE A;  4A3L G;  1K3R A;  2UUB Q;  3MXP A;  4H0L C;  4DUZ L;  1C8C A;  1C9O A;  2EJF C;  2E75 C;  4XQQ A;  4RWS C;  2B2V C;  3PSI A;  2WKD A;  3EBE A;  3I4M B;  3VYT A;  4DR7 L;  2A68 C;  4MIU A;  4C3J G;  4DV1 L;  4JI2 Q;  2F0W A;  1Q46 A;  3N52 A;  3K0Y A;  2HHH L;  2SEB D;  1Y1W G;  4FYD A;  4MHE A;  1RF2 D;  1FGU A;  4HJ9 A;  4FO2 A;  2ALY B;  4C3H B;  4Z9C B;  5FLM H;  1I6H H;  1GUN A;  1DJR D;  4R8N A;  1IKM A;  4HJA A;  2HQL A;  1IXR A;  2EJM A;  2JA7 G;  5T1G A;  4QQB X;  3VYU A;  5DAU A;  2D5D A;  2B2U C;  2OTJ A;  1IYU A;  1HJP A;  1SMX A;  5H1S E;  2VB2 X;  1WD0 A;  2F3V A;  3GTM H;  2JXM B;  3DWA A;  3TZD A;  2EY6 A;  3UDX A;  2H5X A;  1PTO D;  4DUY L;  5FO9 B;  3A7A B;  2NYZ D;  1M90 C;  5IGB A;  1S5E D;  1XNQ Q;  1FNU A;  1JR0 D;  1PRT F;  5M3F G;  1SYD A;  4DR2 L;  1JT8 A;  3LWU A;  2JA5 G;  1HZA A;  3TP6 A;  3A56 A;  1RD9 D;  2VUM G;  2PPB C;  1EL0 A;  2QKI C;  1RTO A;  4ZKC B;  2B2T C;  2MO1 A;  3K7A H;  1TY2 A;  1EY5 A;  3GV6 A;  4IQZ A;  4Y7N B;  2QW7 A;  1HQM C;  3EFX D;  4O0A A;  4XDX A;  4F7X A;  1D5Z C;  1A2T A;  1E7Z A;  5FLX L;  2Z1C A;  2JEA I;  1YHB A;  3HKZ E;  1VQL A;  1SNM A;  5F2D A;  4NXM Q;  1VS0 A;  2OQK A;  4O42 A;  1AP0 A;  2L4N A;  2RDG A;  3KUP A;  3HOZ H;  3HOV G;  5DM7 3;  4UP9 A;  3FKI G;  1ZYR D;  4KD3 A;  1EZ6 A;  3FMC A;  4IUR A;  2LXJ A;  4GKJ L;  1TS3 A;  1UE7 A;  4K0K Q;  1CZG A;  3KYH C;  1O78 A;  5HGT A;  1F77 A;  1D6E C;  1IBK Q;  2Y0S G;  3BJU A;  4WRD A;  2F0U A;  4G7O C;  3HOU G;  1EYA A;  3GO5 A;  3SK6 A;  2ZTE A;  5D14 A;  3TEH B;  1LT6 D;  1QE6 A;  5C3X A;  3U4V A;  1XMO L;  4RCO A;  1W2B A;  3KBG A;  5C0X I;  4YHH Q;  4A76 A;  1YIJ A;  3PUW A;  3K7U C;  2J0T D;  4RHR A;  3D31 A;  3ULJ A;  5FO8 B;  1W6J A;  2EOT A;  5HY6 A;  4C56 C;  3QO2 A;  3J81 j;  2M2L A;  4IPD A;  3J7Y W;  3S2H B;  4ILW A;  1T9H A;  1V8Q A;  2RSO A;  2PQA B;  3J81 E;  1VQ9 A;  4A3F B;  2ENB A;  1KAA A;  1SNC A;  1D2B A;  1CQF A;  5JJK A;  2G9H D;  1LAC A;  1I5F A;  2DY8 A;  4BY7 H;  3FPU B;  5M3M G;  1S5C D;  3JC6 6;  5CR3 A;  1QUQ B;  3GTK B;  2NVX H;  4V0B A;  1NSN S;  5AJ3 L;  3H15 A;  4DV1 Q;  1S4Z A;  4Q5V A;  2OQ0 A;  4MTK A;  1PRT C;  1NMG A;  2LKV A;  1PH7 A;  2RKS A;  4OEM B;  1DZ1 A;  1EWI A;  4KI0 A;  1KRS A;  3HOX H;  2JA9 A;  3NHH A;  3DUZ A;  1F2Z A;  1F9R A;  2A6E D;  4A3M G;  4JBM A;  1TS4 A;  5NUC A;  3EVQ A;  4QIW B;  3DWQ A;  4HCS A;  1QWY A;  4XQN A;  3GTL B;  1DGS A;  2K01 A;  1Q1E A;  4OX9 L;  2LXK A;  1CZW A;  1QOH A;  4OO1 I;  1Q7Y C;  3HOY G;  3I73 A;  4P2C B;  1JWU D;  5C4H A;  1DM0 B;  2UXB L;  1J6Q A;  4K5V A;  3J7A 5;  1SNQ A;  3MEH A;  4DR5 L;  2RSN A;  1ICF B;  2A1A A;  1LV9 A;  3V05 A;  3I70 A;  3D0F A;  4X3K A;  1SJE D;  2DGY A;  5DNF A;  3ULP A;  4H7B A;  5IYC H;  2CW0 D;  4WOR A;  3TP8 A;  3LNN A;  2MP1 A;  2UUC L;  2RHQ B;  5C3E B;  4A93 H;  1EOV A;  5IP9 H;  1F9P A;  1E1T A;  1HFN A;  3TP5 A;  1Y69 U;  2XRQ D;  5KYI A;  1A2U A;  2PCF B;  1E2W A;  2ZJQ A;  3GTP H;  3I8Z A;  3MC0 B;  3TBI B;  3CPF A;  4DN4 M;  4UAI A;  3F2B A;  4JI7 L;  3HOW B;  2LS0 1;  4BBR H;  1UE5 A;  1TQO A;  2JYO A;  5BR8 Q;  1AZQ A;  1RJT A;  1SRU A;  2K03 A;  3CRL C;  5I2Y A;  4I7Z C;  4A3G H;  4A3B B;  3K5N A;  2R92 H;  1GJX A;  3G6E A;  5T1I A;  1B53 A;  3GTO B;  4GZY C;  3PO2 H;  1LLR D;  5J1Z A;  1L1O C;  1LTT D;  1LTA D;  4JOI C;  4K5W A;  3JAM i;  1LO5 D;  3QB3 A;  2K05 A;  3M7N A;  2KHJ A;  4DV3 L;  1PYS B;  2H1E A;  1BKB A;  4R4C A;  5IYB H;  4DF7 A;  1CUK A;  2CQO A;  4QUC A;  1G6Z A;  1F9Q A;  1IYJ B;  1E3P A;  1SMY D;  4XTC S;  1IL2 A;  1BNZ A;  5C4J H;  1B7Y B;  4JI3 Q;  1U5K A;  2JA8 G;  4P73 A;  1BQQ T;  1IZ6 A;  4KLK A;  4B3T Q;  1BCP D;  2BH8 A;  1JCK B;  3TRZ A;  4B3S L;  2R7D A;  1G8Z D;  2XIW A;  4QL5 A;  3WDN A;  3CCU A;  3S2D H;  3M4O B;  1EZ8 A;  3PO3 B;  1ICW A;  4IUP A;  1ET9 A;  5CBE E;  2PMZ B;  2I07 B;  2KVM A;  1GHJ A;  1W3S A;  2RVL A;  2PW7 A;  1K0S A;  3AFQ A;  1PH6 A;  2AQ2 B;  2JEB I;  3KDF B;  2IJ0 A;  2CHB D;  1Z7T A;  5ELC A;  1IKL A;  5EQ0 A;  2SOB A;  3A74 A;  5C0X H;  2A73 B;  3D3R A;  3NQI A;  5D3I B;  2PQA A;  2UU9 L;  2NZH A;  4LF8 L;  4JI6 L;  2AUJ D;  4DU9 A;  2NBF A;  2K5D A;  4DR1 Q;  4JBK A;  2FJ2 A;  4RKB A;  3CC7 A;  1XPR A;  2N49 A;  1JOO A;  2K5N A;  3V2T A;  1QUQ A;  2DN8 A;  3SDZ A;  2UUA Q;  1F2L A;  3K7A B;  3CCJ A;  3PO3 G;  1HNW L;  1Q1B A;  2UXB Q;  4LFB Q;  3E9H A;  2Q8R E;  2VNU D;  1Y1W H;  3DWP A;  2AMC B;  5EPK A;  2EQS A;  4JW0 A;  4IOA A;  1F2Y A;  1DD2 A;  4POG A;  5EPL A;  3QOJ A;  2UXD L;  2JA7 H;  2L15 A;  3R8B A;  4A3E B;  4JI8 Q;  2K04 A;  4IN3 A;  1KD1 C;  2PMZ E;  2F0D A;  1TU2 B;  4JI4 Q;  1ILP A;  5J22 A;  4HN7 A;  5CC4 A;  5LMU Q;  3NQT A;  2Z6K C;  1LUZ A;  1VMC A;  4IFD G;  5JAV A;  3RZD B;  1ZKO A;  4OO1 H;  2F0K A;  1VQ8 A;  1PTO F;  1B8A A;  1V1O A;  4JI7 Q;  2NVQ H;  3DM3 A;  3A8I E;  2DJF C;  4LUZ A;  3AB9 A;  1Q8I A;  1HCZ A;  4ZCK A;  1PFB A;  2VUM H;  1YNJ C;  1EY7 A;  1HZB A;  1J5E L;  3NXW A;  3D4R A;  1VMP A;  2IT1 A;  1Y1V G;  1VQB A;  4DAP A;  1GVP A;  3SEB A;  1E2V A;  1HNX L;  4YCV A;  4A3K G;  3OOC A;  5IP7 H;  1OXU A;  4DV7 L;  4GLV B;  1SYG A;  2QEX A;  4KHV A;  2ASB A;  4A3I G;  4GS3 A;  3H94 A;  3GTQ H;  4DV5 L;  1WFQ A;  4DV4 Q;  3PIO A;  3O13 A;  3S1R H;  5JOB A;  3RNU A;  2JA6 B;  3NBH A;  1S5D D;  5A2Q E;  1TKW B;  1BBW A;  3GD7 A;  1SE4 A;  1K9M C;  2V1C C;  4KK7 A;  5ELB A;  2NVX B;  3DEO A;  1AEX A;  3HOV H;  5A35 A;  4B3S Q;  3FKI H;  1LTG D;  2X69 A;  3H0G G;  5IWA Q;  5JVG 3;  4EX5 A;  1H9S B;  2MHV A;  1WTO A;  4DGZ A;  3OW7 A;  4FXG C;  1KHI A;  1QG7 A;  5GRO A;  2A6H D;  1ENC A;  4KV6 A;  2ZJR A;  3HOU H;  1B1Z A;  2M9V A;  3IL8 A;  3KJP A;  1WTV A;  1NCV A;  3MWY W;  3E3X A;  1VQN A;  2MNA A;  4DV2 L;  1HUN A;  1GD7 A;  5ELD A;  4HCE A;  1I3Q H;  3U50 C;  4BBS B;  1IYV A;  1X3E A;  4JYA L;  5C44 H;  2WAQ E;  2PQE A;  3SVM A;  4DK1 A;  1FVI A;  1RHP A;  2EZV A;  1BF4 A;  1CT1 D;  1MI2 A;  3J7A V;  2JK8 A;  3QG1 A;  4BXX G;  4EVO A;  3VYR A;  4DR4 Q;  4I65 A;  4XYO A;  4JI6 Q;  4GKK L;  2CH4 A;  4CKB A;  1G2T A;  5I9P A;  1LTL A;  2ZXO A;  1X3P A;  1XMQ L;  3K80 C;  5M3M H;  2KEC A;  4OWX B;  4CJ0 B;  4B3R L;  2AKW B;  4NKL A;  2NVY B;  4FNF A;  3KDF A;  1PTO C;  4FXK C;  2GN5 A;  4I7A A;  1AH9 A;  1L0W A;  4A93 B;  1STA A;  2K32 A;  2XGT A;  4QCL A;  1AFP A;  2QCP X;  2LY7 A;  1GUO A;  2A5H A;  4NPS A;  3NP8 A;  2UXC L;  1PH4 A;  3SHL A;  1SFO H;  5IT9 E;  4PMB A;  4GOP B;  3U4Z A;  4QMG A;  5GQO A;  2XNA C;  4HSP A;  1GM5 A;  4BBS G;  4A3M H;  5IGE A;  2UXD Q;  1A63 A;  4IUN A;  3RLO A;  3KLS A;  3E0J A;  4JK1 C;  5FLX c;  3PF5 A;  1CQV A;  4GNX B;  4KHP Q;  1H9M A;  2R92 B;  3PO2 B;  1PFS A;  1X3Q A;  1WCM G;  2L55 A;  5ELF A;  1M1K C;  3SK4 A;  2K4K A;  2V4D A;  2FIN B;  3TZU A;  1ZYR C;  2A69 D;  5C0X J;  2O2L D;  3FPP A;  3PQI A;  5M5Y B;  1PV4 A;  1LM0 A;  3I91 A;  1SRO A;  1VQM A;  2Z0S A;  4OWT B;  3TME A;  4X65 Q;  4L5S A;  1A3U A;  3WOE A;  2OTL A;  1XX8 A;  1FJG Q;  4A3J G;  2HCC A;  4C1N I;  4UDU C;  4BA1 I;  4DV7 Q;  2PZU A;  3RZO B;  2WAC A;  1GUS A;  2D0O A;  1PFM A;  5IOD A;  3PIP 3;  3DEP A;  3GTG H;  2K75 A;  1P8L A;  1XXG A;  1CA5 A;  1N9W A;  4HMI A;  5IYD G;  4KHZ A;  3P20 A;  1FD7 D;  1AN8 A;  1SJH D;  2JJQ A;  1HUM A;  4JI0 Q;  1CA6 A;  3TRE A;  3IAY A;  3HRZ C;  3CC4 A;  2JQO A;  5IGC A;  4F88 A;  3GTJ H;  1G2S A;  2NZ1 D;  4C2M H;  3S1M H;  4R4O A;  4XT3 B;  4HMJ A;  3NBI A;  2EXD A;  1STH A;  4CDE C;  2PI2 E;  2R93 G;  3S16 H;  4LFA Q;  1YHQ A;  3GDE A;  2JP1 A;  4X3T A;  3KK7 A;  1FNW A;  1F2M A;  2JA8 H;  2EVB A;  2L1B A;  3L0O A;  4JBJ A;  4XQJ A;  1BCP F;  2X6G A;  4KKS A;  1OTC A;  3CD6 A;  3ITP A;  1PH3 A;  3T53 B;  2A6E C;  1H9S A;  3ER0 A;  5CV9 A;  1WTP A;  1QB5 D;  3S15 B;  1K8O A;  2F3W A;  2K5W A;  3KLS X;  4OON A;  2JSO A;  3BVG A;  4RG1 A;  4DFA A;  1IBM L;  2E5L Q;  3AU7 A;  3ZJY C;  1WJJ A;  5I4D A;  1M8A A;  1NR2 A;  4LUV A;  4B3R Q;  3I4N G;  1TS5 A;  2TSS A;  4HR7 B;  2R3Z A;  4IPC A;  3HKZ B;  4C3I G;  4RGO S;  2KHI A;  1ILQ A;  1AE2 A;  1C0A A;  3NSW A;  1TWF H;  1FYC A;  3I3C A;  1QVC A;  5CMD A;  4IOC A;  2IX3 A;  4J8Q A;  2CW0 C;  2F4V Q;  1M4V A;  3C2P A;  3U9O A;  4OWW B;  2NVQ B;  3PV0 A;  3G48 A;  1IW7 D;  4HJ7 A;  4IPH A;  1LT5 D;  1EYG A;  1ESF A;  4ME5 A;  1JJG A;  2HDM A;  3FRP B;  1VQF A;  4X64 Q;  1R9T B;  2J7Z A;  5IIF A;  2ZJP A;  3HG9 A;  1VQI A;  4QF4 A;  4DK6 C;  5KND A;  4FVM A;  2K1B A;  4GOP A;  2ZM6 L;  2NUC A;  2IL8 A;  4LF9 Q;  2XWB B;  3K5M A;  2YU9 H;  3S1R B;  4JI5 Q;  4PQX A;  3I4M G;  5I2X A;  3HKZ G;  3HGB A;  4QB4 A;  5D65 A;  4GNX A;  3A8K E;  1T5X D;  4BY1 B;  1N34 L;  2PI2 A;  3KF6 B;  1B2T A;  1ZEQ X;  1SMY C;  1N32 L;  5I9O A;  3SE0 A;  4C3H G;  3BS1 A;  2NN6 G;  1DOM A;  4PV1 C;  4HTH A;  2F0M A;  1TVX A;  3G6J B;  4A3D B;  3J81 i;  1HNZ L;  1BCP C;  2N8N A;  3BZD B;  3J80 E;  3EQL C;  2R7Z B;  4DR6 Q;  3W1B A;  4N9T A;  1B44 D;  3CCR A;  2CQA A;  3D8G A;  1Q82 C;  1VQE A;  1N36 Q;  4LF5 L;  2ZT9 C;  1NBW A;  1RTN A;  4FDB A;  1I3Q B;  5ELE A;  2N3S A;  4ALP A;  3CRK C;  3AMU A;  2HIX A;  5C44 B;  1KAW A;  3UI2 A;  2F0H A;  4IZ8 A;  1D1I A;  1HR0 W;  3RUZ A;  3BVM A;  4EQP A;  4R4Q A;  2C5C A;  2B39 A;  2B63 B;  5E7N A;  1ENF A;  1MGS A;  2MQH A;  1PYW D;  4A3I H;  2WII B;  1P16 A;  1IBL Q;  3SK5 A;  2HT1 A;  1DON A;  1RL2 A;  2EYF A;  3D6C A;  5COY A;  2BE5 D;  4JI1 L;  3RN2 A;  2VXW A;  4KMU C;  1UE6 A;  2IPK D;  5J3B A;  1VQP A;  2EY2 A;  4LF4 Q;  1MIU A;  2IHE A;  3K5O A;  2K33 A;  1LTB D;  2B2W A;  2HCI A;  1SNO A;  1NNX A;  3NTH A;  5E4W C;  2CVR A;  2D0P A;  3F2U A;  2DJG C;  3GQB A;  3MAQ A;  1I50 B;  4IJL A;  3C46 A;  1BBX C;  1TWH B;  1G91 A;  5A2Q L;  4DUZ Q;  1BR9 A;  2RDF A;  3OPO A;  4DR7 Q;  5IGD A;  1LYL A;  1CSQ A;  1PZJ D;  2K5Q A;  3GV3 A;  2B2Y C;  4UY8 C;  2HHH Q;  4BXX H;  1CHP D;  3S1Q H;  1JWM D;  2NZO A;  1TT2 A;  3NE5 B;  2HUG A;  2R61 A;  4RFB A;  3ZYY X;  2F1M A;  2I5H A;  3K0X A;  2VW9 A;  4LFC L;  4J6H A;  3E0E A;  5IOC A;  3NEM A;  1J8I A;  4DV6 L;  1EU4 A;  3M3Y H;  4RAU C;  4DK0 A;  2AHO B;  4YY3 L;  1VQ5 A;  4A3F G;  2VB3 X;  4IUT A;  5C4Z A;  4DR3 L;  5C4X H;  4DUY Q;  4HID A;  1G51 A;  3OSO A;  4C1N K;  4QY7 A;  4DR2 Q;  3RN5 A;  4L8J A;  3T16 A;  1UNS A;  4DAY B;  3M9B A;  5IY0 A;  1L2F A;  1OXT A;  2CCZ A;  5JVH 3;  2KBN A;  1NAP A;  4MTN A;  3CQZ B;  3TN2 A;  3E9I A;  2EYO A;  3S14 H;  5JEA H;  2L11 A;  3UDG A;  5DLQ E;  4K5X A;  3Q8D A;  5FJ8 G;  3GTJ B;  1XNR L;  4HJ5 A;  2E76 C;  2B3G A;  1WYD A;  1WCM H;  1C48 A;  1O7Y A;  5G3L D;  1PA6 A;  1EIY B;  3S1M B;  5IT9 L;  1HPC A;  1S5B D;  2NTT A;  1TWG H;  5M5X H;  1Q81 C;  1SSO A;  3CW2 C;  4HAE A;  2CFM A;  1B4O A;  3NBH B;  4FP5 D;  1YEZ A;  2Q8T A;  4TKO B;  1SE3 A;  2F0O A;  3BYT B;  1GUG A;  2I0Q A;  2MO0 A;  2A6H C;  1AW7 A;  4GKJ Q;  4V19 0;  1Y8P B;  1YBY A;  4L5Q A;  3KF6 A;  1H9R A;  4A3J H;  3FVQ A;  3CCS A;  2B8G A;  1N33 L;  4E6I A;  4KD4 A;  1ZXT A;  3SR1 A;  4PG3 A;  1XMO Q;  2EY5 A; 
#chains in the Genus database with same CATH homology
 1BBW A;  3GD7 A;  5BR8 L;  1K9M C;  2V1C C;  4A3E H;  1N36 L;  2ES2 A;  4BY1 G;  3I2Z A;  4GN4 B;  1QZH A;  3CQZ H;  4JG2 A;  4NXN L;  1YJN A;  2Q2U A;  3HOV H;  5C3E G;  3KF8 B;  4B3S Q;  3FKI H;  2E2J H;  2C35 B;  3OTO Q;  3WWV A;  1YHA A;  2MFI A;  3H0G G;  3PUV A;  1TXY A;  4K0K L;  5IWA Q;  4EX5 A;  2KCM A;  1VQD A;  3H0G H;  5ELO A;  3RZD H;  3LGJ A;  4A3D G;  4HIO A;  1SE8 A;  1IBK L;  1IBL L;  1KHI A;  3A5Z B;  2R7Z G;  4QJF A;  5GRO A;  4YCW A;  4DAM A;  1K73 C;  3HOW G;  1YNX A;  2ZJR A;  2CWP A;  1AE3 A;  3HOU H;  3KJP A;  1IBM Q;  1VQ7 A;  4LF6 Q;  4LF7 L;  3J81 c;  1VQN A;  1VQO A;  4JI3 L;  2MNA A;  4A3B G;  4DV2 L;  1GD7 A;  3EN2 A;  4A3B H;  5C44 G;  1I3Q H;  3U50 C;  4YHH L;  4B3T L;  4LF4 L;  3GTO H;  1X3E A;  4JYA L;  4B3M Q;  5C44 H;  2WAQ E;  2Y0S E;  5AJ3 Q;  3HKS A;  1FVI A;  1K83 H;  1PH2 A;  2IX0 A;  2I5L X;  1EFW A;  3KOJ A;  1KC8 C;  2JK8 A;  1D7Q A;  3I4O A;  4ME3 A;  2B63 G;  4BXX G;  1G29 1;  3T1Y L;  2OWO A;  4MNO A;  4TQU S;  1PH9 A;  4DR4 Q;  1XPO A;  4A75 A;  3MXN B;  4JI6 Q;  2K52 A;  4GKK L;  2XTI A;  3PGZ A;  1YVC A;  1LTL A;  3M85 A;  1NJI C;  2JA6 H;  3BZK A;  1XMQ L;  1PVO A;  1CKN A;  4PZ7 A;  2E2H H;  1K3R A;  3K80 C;  2WP8 J;  4JCV E;  5M3M H;  2UUB Q;  4A3L G;  3S17 H;  2DUD A;  4OWX B;  4UP7 A;  4DUZ L;  4A3L H;  2N78 A;  1C9O A;  4DV6 Q;  4B3R L;  4PMW A;  1NMF A;  1Z9F A;  3AYH B;  3PSI A;  2AKW B;  3EBE A;  3I4N H;  2A8V A;  4DR7 L;  4OX9 Q;  3PCO B;  4YY3 Q;  3KDF A;  3I55 A;  4DV1 L;  2GN5 A;  1AH9 A;  1L0W A;  4JI2 Q;  4C3J H;  4AQY L;  1Q46 A;  1E1O A;  4C3I H;  1X3G A;  2XGT A;  3FP9 A;  2HHH L;  4NPS A;  1VQ6 A;  1Y1W G;  1K0R A;  2F52 A;  2QGQ A;  5FLM G;  2UXC L;  1V43 A;  4DR5 Q;  1PH4 A;  1FGU A;  4HJ9 A;  4DNI A;  1SFO H;  2ALY B;  5FLM H;  1E24 A;  4GOP B;  3U4Z A;  1V1Q A;  5GQO A;  1YZ6 A;  3UE0 A;  4DR1 L;  1I6H H;  2ZM6 Q;  1GM5 A;  2WB1 E;  4WJ3 M;  3PUY A;  4HJA A;  4BBS G;  2BA0 A;  1IXR A;  2HQL A;  4A3M H;  2JA7 G;  2UXD Q;  4QQB X;  1G6P A;  1A63 A;  3RLO A;  4BBS H;  1VQC A;  2OTJ A;  5FLX c;  3PF5 A;  4LWC A;  4KHP Q;  4GNX B;  1CKO A;  4A4I A;  2NN6 I;  1N34 Q;  2UUA L;  1HJP A;  1SMX A;  2UUC Q;  5H1S E;  1KIX A;  2EIF A;  1PFS A;  3CCL A;  4LFB L;  2Z6K A;  1WCM G;  5LMN L;  3KJO A;  3GTM H;  1M1K C;  1N32 Q;  2ATW A;  2K4K A;  1XTD A;  4LUO A;  2YTV A;  2RHS B;  2K5H A;  2H5X A;  3UDX A;  4DUY L;  3OW2 A;  1HNZ Q;  5C0X J;  1M90 C;  4GOP C;  1XNQ Q;  1JT8 A;  2PNH A;  5M3F G;  4DR2 L;  2JA5 G;  1PV4 A;  1HZA A;  3I56 A;  1LM0 A;  3AEV A;  1HZ9 A;  4HIM A;  5M3F H;  2VUM G;  1SRO A;  3RLF A;  2JA5 H;  1VQM A;  2Z0S A;  3F1Z A;  2NVY H;  4OWT B;  1VCI A;  3J80 c;  4LF5 Q;  3I4M H;  2ZTC A;  4JI8 L;  3UE1 A;  3EIV A;  4X65 Q;  4GNX C;  2MO1 A;  3K7A H;  4L5S A;  4UPA A;  3M4P A;  4DV0 L;  2OTL A;  2Q2T A;  1U0L A;  4JI4 L;  1E22 A;  2CKZ B;  3TS0 A;  1FJG Q;  4A3J G;  3CAM A;  5LMU L;  4BA1 I;  4X62 L;  4DV7 Q;  1K8A C;  3CPW A;  4DV3 Q;  2YTX A;  5GAE C;  2YYZ A;  1H95 A;  2D0O A;  4O0A A;  2VS1 A;  4A3C G;  4AYB E;  1PHJ A;  1E7Z A;  2JEA I;  2VQE L;  1YHB A;  3HKZ E;  1VQL A;  3GTG H;  4YWM A;  2K75 A;  1P8L A;  4NXM Q;  1VS0 A;  2OQK A;  1N9W A;  4A3E G;  4JI1 Q;  5GAG C;  3HOZ H;  5IYD G;  4KHZ A;  3HOV G;  3CMA A;  4UP9 A;  3FKI G;  2JJQ A;  4JI0 Q;  5IYD H;  3TRE A;  1GKH A;  3CC4 A;  2LXJ A;  4GKJ L;  2JQO A;  1UE7 A;  4X66 L;  3KYH C;  3GTJ H;  3T1H L;  4K0K Q;  5JJI A;  1K8G A;  4YCU A;  4L5R C;  2RCN A;  1X56 A;  4QIW E;  4NB3 A;  3F2C A;  4GN5 A;  4C2M H;  1IBK Q;  2WAQ G;  2Y0S G;  3BJU A;  3S1M H;  4R4O A;  5JEA J;  4OXP A;  3HOU G;  1MKH A;  4DV4 L;  1NE3 A;  2EXD A;  3GO5 A;  2PI2 E;  2ZTE A;  3TEH B;  1PYB A;  5M5Y H;  3S16 H;  4LFA Q;  1YHQ A;  4LF7 Q;  3GDE A;  3U4V A;  1XMO L;  2R93 G;  1KXL A;  2E2I H;  4APV A;  1W2B A;  2R93 H;  4IFD J;  4H02 A;  3PIP A;  1YI2 A;  3AFP A;  1PH1 A;  5C0X I;  4YHH Q;  2JA8 H;  4A76 A;  1YIJ A;  3PUW A;  3K7U C;  3L0O A;  4JBJ A;  2KEN A;  1UE1 A;  1GO3 E;  3D31 A;  3ULJ A;  3OTO L;  4Y7N H;  5K36 G;  3ERS X;  5HY6 A;  4P72 A;  5IWA L;  1OTC A;  3J81 j;  3CD6 A;  1UEB A;  3RZO H;  3H3V I;  1JJC B;  1PH3 A;  4IPD A;  4LNQ A;  1VQG A;  3ER0 A;  4R4I A;  1T9H A;  1VQ9 A;  2PQA B;  5M5W H;  1QZG A;  2UU9 Q;  4GKJ Q;  2GVB A;  4OON A;  3A0J A;  5JJK A;  4LF8 Q;  1I5F A;  2JA6 G;  4RG1 A;  3S1N H;  3GTL H;  5JJL A;  1IBM L;  2E5L Q;  5M3M G;  4BY7 H;  1Y14 B;  3ZJY C;  2GVA A;  4P71 A;  4LF6 L;  1WJJ A;  4LFC Q;  4LUV A;  3JC6 6;  4B3R Q;  1QUQ B;  2NVX H;  1S40 A;  3W1G A;  1OXV A;  1VQH A;  4IPG A;  3I4N G;  4EQ5 A;  2NVT H;  3G71 A;  2WB1 G;  4B3M L;  4HIK A;  5AJ3 L;  3H15 A;  4DV1 Q;  1UWV A;  1X55 A;  4IPC A;  4AQY Q;  2OQ0 A;  2QA4 A;  5IE8 A;  2KHI A;  1HNW Q;  1VQK A;  1AE2 A;  4BA2 I;  1NMG A;  1C0A A;  1TWF H;  1PH7 A;  1A62 A;  1BBU A;  5HGQ A;  1I94 L;  1QVC A;  4DR4 L;  3HOX G;  1KRT A;  4IOC A;  1EWI A;  3MEF A;  4DR3 Q;  4KI0 A;  1KRS A;  3HOX H;  2JA9 A;  2F4V Q;  4JBW A;  1TWA H;  1YIT A;  4OWW B;  3PV0 A;  4A3M G;  2UUB L;  1WI5 A;  4JBM A;  3G48 A;  2I5M X;  3KFU A;  4XIG S;  1HR0 L;  3PUX A;  3FHW A;  4HJ7 A;  4IPH A;  1VQJ A;  3F2D A;  1EYG A;  3KLW A;  3J7Z C;  1DGS A;  1Q1E A;  3RLN A;  2LXK A;  4OX9 L;  4IFD I;  1JJG A;  4OO1 I;  1Q7Y C;  3HOY G;  1S3O A;  1VQF A;  4X64 Q;  4JV5 L;  3W5O A;  1ASZ A;  3S2H H;  1MJC A;  3CF5 A;  1VQ4 A;  1XNR Q;  3HOY H;  2UXB L;  1A0I A;  1J6Q A;  3ULL A;  3J7A 5;  3S15 H;  1EUJ A;  4QGU A;  4YWK A;  4DR5 L;  2ZJP A;  1VQI A;  1OXS C;  4GN3 B;  2A1A A;  3OYY A;  1X54 A;  4RMF A;  1X9N A;  4DK6 C;  4GOP A;  2ZM6 L;  4LF9 Q;  2YU9 H;  2Q2H A;  5GAH C;  2VY3 A;  4JI5 Q;  4Y52 H;  2VZA A;  3GTK H;  3D0F A;  5IYC G;  2DGY A;  4AYB G;  3I4M G;  1BVS A;  3ULP A;  3HKZ G;  5IYC H;  4KHP L;  1JJ2 A;  1J5E Q;  4GNX A;  4A93 G;  2R6G A;  1N34 L;  1L1O B;  4DV0 Q;  2UUC L;  2RHQ B;  1HNX Q;  4A93 H;  1EOV A;  5IP9 H;  2PI2 A;  1E1T A;  2ZTD A;  3CC2 A;  3KF6 B;  5FJ8 H;  3NEL A;  2IHF A;  2BA1 A;  1N32 L;  3L7Z C;  2NN6 G;  3ICE A;  2ZJQ A;  4C3H H;  3GTP H;  3DLL A;  4DV5 Q;  3J81 i;  1HNZ L;  1N33 Q;  2N8N A;  5ELN A;  3CPF A;  3F2B A;  1XNQ L;  4JI7 L;  2FXQ A;  1XJV A;  4DR6 Q;  1YJW A;  1Q86 C;  4BBR H;  1UE5 A;  2YTY A;  3BZC A;  3W1B A;  3HOZ G;  5BR8 Q;  2BH2 A;  3CCR A;  2ID0 A;  2IX1 A;  1Q82 C;  1VQE A;  1N36 Q;  4LF5 L;  1SLJ A;  1SRU A;  3M4Q A;  2R92 G;  3CCE A;  4NXN Q;  1NBW A;  4FDB A;  4JC0 A;  4ALP A;  1MJE A;  2N3S A;  2R92 H;  3G6E A;  3PO2 G;  4X65 L;  3PO2 H;  1NY4 A;  2HIX A;  1EQR A;  1R9T H;  1KAW A;  4L5T A;  1L1O C;  4JOI C;  2HIV A;  4POF A;  3JAM i;  1S72 A;  2VQF L;  1ASY A;  1FJG L;  3M7N A;  1HR0 W;  2E8G A;  2KHJ A;  5IYB G;  1KL9 A;  4DV3 L;  1PYS B;  4R4Q A;  1BKB A;  4R4C A;  5EAY A;  5IYB H;  1SN8 A;  5E7N A;  2MQH A;  4A3I H;  1IBL Q;  3UDI A;  1P16 A;  3UDF A;  3L2P A;  1SR3 A;  4DPG A;  1CUK A;  2F3I A;  1Q8K A;  2HT1 A;  1FL0 A;  2CQO A;  1RL2 A;  4UP8 A;  1IYJ B;  1E3P A;  1V9P A;  4NXM L;  4XTC S;  4LW1 A;  1IL2 A;  4JI1 L;  4PZ6 A;  5C4J H;  1B7Y B;  4JI3 Q;  3PF4 A;  1U5K A;  5LMN W;  4DV2 Q;  3RN2 A;  2JA8 G;  1UE6 A;  4P73 A;  5J3B A;  1VQP A;  4R1J A;  1IZ6 A;  4KLK A;  4BY1 H;  1HZC A;  4B3T Q;  4LF4 Q;  2B29 A;  1QVG A;  1MIU A;  4JI0 L;  2BH8 A;  3TRZ A;  5C3E H;  4B3S L;  4JYA Q;  2IHE A;  2Q2I A;  2R7D A;  3SGI A;  2K5V A;  4QL5 A;  3CCU A;  4O2D A;  4GLA C;  3S2D H;  4WJ4 A;  1RIP A;  2A19 A;  3T1Y Q;  4A3D H;  2D0P A;  2YV5 A;  4GKK Q;  3CCQ A;  2R7Z H;  4J15 A;  4P75 A;  3HOW H;  4BY7 G;  1CKN B;  1W3S A;  4IJL A;  4LFA L;  1XMQ Q;  1CSP A;  4IJH A;  1JMC A;  3NEN A;  3AFQ A;  1PH6 A;  4DUZ Q;  4A3G H;  3CME A;  2RF4 A;  2JEB I;  1X3F A;  3KDF B;  4R4T A;  3CXC A;  3U58 A;  4DR7 Q;  2WFW A;  1LYL A;  1VQA A;  2K14 A;  4PZ8 A;  1A8V A;  1CSQ A;  3STB C;  3A74 A;  5C0X G;  3BU2 A;  4UY8 C;  1I94 Q;  2HHH Q;  2B63 H;  4BXX H;  3JAM c;  2K50 A;  2R7F A;  2NZO A;  3S1Q H;  1JB7 A;  2AWN A;  2UXC Q;  2PQA A;  2UU9 L;  3CP0 A;  2NZH A;  4LF8 L;  4JI6 L;  1CKM A;  3F8T A;  1N8R C;  2I5H A;  3K0X A;  2E5L L;  1Z47 A;  4DR1 Q;  4JBK A;  3H3V H;  1XPR A;  2VW9 A;  3CC7 A;  3J80 i;  2N49 A;  3K8A A;  4LFC L;  4AH6 A;  1HR0 Q;  3E0E A;  1O7I A;  2K5N A;  3NEM A;  5IT9 c;  1QUQ A;  4DV6 L;  4X6A H;  3RR5 A;  2JE6 I;  1KQS A;  3M3Y H;  1D8L A;  4YWL A;  2UUA Q;  2AHO B;  4YY3 L;  4JV5 Q;  3CCJ A;  3PO3 G;  3M4O H;  1VQ5 A;  2IY5 B;  4JI2 L;  1HNW L;  1Q1B A;  2UXB Q;  4A3F G;  4LFB Q;  3PO3 H;  1EIF A;  4MZ9 A;  5LMN Q;  3E9H A;  4A3F H;  1X65 A;  5C4X G;  2VNU D;  4HJ8 A;  1Y1W H;  2OCE A;  2AMC B;  4DR3 L;  1I50 H;  1Q12 A;  5C4X H;  4DUY Q;  2CWA A;  3G4S A;  2F4V L;  2EQS A;  4IOA A;  3STB D;  1WOC A;  1TWH H;  4HID A;  1G51 A;  4POG A;  1NTG A;  4IO9 A;  4QY7 A;  4DR2 Q;  3RN5 A;  1YJ9 A;  2UXD L;  4DAY B;  2JA7 H;  2L15 A;  3M9B A;  5IY0 A;  1L2F A;  3I7F A;  3A5U A;  1EQQ A;  1OXT A;  2CCZ A;  3HFZ B;  2AWO A;  2KBN A;  4MTN A;  5JEA G;  4JI8 Q;  1KD1 C;  2PMZ E;  3E9I A;  1TWC H;  5IP9 G;  3S14 H;  4X64 L;  3UDG A;  5DLQ E;  1OXX K;  3Q8D A;  5FJ8 G;  2KCT A;  4JI4 Q;  1XNR L;  5LMU Q;  4HJ5 A;  1PH5 A;  4X62 Q;  3PUZ A;  2Z6K C;  1LUZ A;  2B3G A;  1WYD A;  1WCM H;  4AIM A;  1PA6 A;  1PH8 A;  4IFD G;  1EIY B;  4OO1 G;  1JE5 A;  3TQY A;  1VQ8 A;  2VQE Q;  1B8A A;  1TWG H;  5M5X H;  4GLX A;  1Q81 C;  4JI7 Q;  4LF9 L;  1XPU A;  3CW2 C;  3DM3 A;  4BBR G;  2NVQ H;  2CFM A;  4JI5 L;  3K81 C;  4LUZ A;  3NBH B;  3AQQ A;  1YEZ A;  2VUM H;  4A3G G;  2VL6 A;  1HZB A;  1B70 B;  1J5E L;  2I0Q A;  2MO0 A;  1C7Y A;  2IT1 A;  1Y1V G;  1VQB A;  1GVP A;  2LSS A;  4DK3 C;  3VDY A;  5IP7 G;  1HNX L;  1L1O A;  4JOI A;  4TVA B;  1Y1V H;  4YCV A;  4X66 Q;  2VQF Q;  3T1H Q;  3TS2 A;  3CCV A;  4L5Q A;  1YBY A;  4A3K G;  5IP7 H;  3S24 A;  3KF6 A;  1OXU A;  4A3J H;  3B6Y A;  4DV7 L;  3CCS A;  1X6O A;  4GLV B;  2QEX A;  4A3K H;  2ASB A;  4A3I G;  3CCM A;  4GS3 A;  1N33 L;  4DV5 L;  3GTQ H;  1WFQ A;  4DV4 Q;  3IRB A;  4A3C H;  2D62 A;  3PIO A;  5GAD C;  1HH2 P;  1QVF A;  4PG3 A;  4DR6 L;  3S1R H;  4P74 A;  4DKA C;  1XMO Q;  3RNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...