1BUVT

Crystal structure of the mt1-mmp-timp-2 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
184
structure length
184
Chain Sequence
CSCSPVHPQQAFCNADIVIRAKAVNKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEYLIAGKAEGNGNMHITLCDFIVPWDTLSATQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEIN (MEMBRANE-TYPE MATRIX METALLOPROTEINASE (CDMT1-MMP))
publication title Crystal structure of the complex formed by the membrane type 1-matrix metalloproteinase with the tissue inhibitor of metalloproteinases-2, the soluble progelatinase A receptor.
pubmed doi rcsb
total genus 31
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 1998-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1buvT02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 1buvT01
1UAPA 1GXDC 1BQQT 2XWBB 3FRPB 1JC7A 3I70A 1UEAB 4FXGC 3OHXC 2E2DC 3CU7A 3MA2B 4FXKC 3HRZC 2TMPA 3HS0C 1BR9A 2XWJB 1PXUA 1D2BA 5JPMC 5JPNC 5FO9B 4ILWA 2QKIC 3G6JB 3KLSA 1JB3A 2A74C 2J0TD 5FO7B 2B39A 2WINB 1OO9B 1BUVT 3T4AC 3L3OC 2WIIB 2A73B 5FOBB 1XWEA 2I07B 3V96A 2ICEC 3CKIB 5FO8B
chains in the Genus database with same CATH superfamily
4ULLA 2E2IH 2OWOA 1NR4A 3KF8A 4GLVB 1KTKA 4WFN3 1YEZA 2D5DA 4B9XA 2JK8A 2LSSA 1O7LA 3N52A 3QWNA 3WOFA 1QZGA 1GHKA 5C44H 1U4PA 1TKWB 3H6MA 5DEHA 3S2HH 1C9OA 3J81i 1F2LA 4AH6A 3EN2A 3I90A 4IUNA 2TSSA 1IYUA 2B2UA 4KY6A 4QIWE 1HZBA 1YNJD 5JAVA 3K7AH 4PZ8A 1KRTA 3TP5A 4AQYL 1KLGD 2ALYB 2NVQH 3I4LA 1BCPC 3K5OA 1LTBD 5NUCA 4K6DA 4JYAL 3TS0A 4BBRB 1X3GA 5C4XG 1LM0A 2CKZB 4APVA 4U68A 3K59A 4IN3A 4CDDC 1T5XD 3ND8A 1E2WA 3CPFA 3S15B 1C8CA 3TSSA 5IYCG 2ATWA 4JK1C 1W3SA 4HAEA 2NVYB 5IT9c 3TMEA 2JA6B 4K5WA 5C4JH 1WTHA 4S3SA 1SMYD 2A68C 1P16A 1JJGA 3T16A 4XT1B 1HNWQ 1SYEA 1WOCA 1GD7A 3PF4A 4CJ0B 1PXUA 2IY5B 1HNZL 1T5EA 2EOTA 2X6GA 2H4OA 3K7UC 3K0YA 1FYCA 3A8IE 4R4TA 1MIUA 1NR2A 2L5TA 1V8QA 1K83H 5FOBB 5GAEC 4KKTA 1LTTD 4A3LG 3K81C 2ENBA 2ICEC 3NBIA 3RUZA 4UPAA 4OWTB 2K50A 4QIWB 1IKMA 3EBEA 2NN6I 1PHJA 3CCLA 4C3IG 2E2HH 1O7IA 3KF6B 4HCSA 1LTID 2ZM6L 2ZXRA 3A55A 2EJGC 5IT9E 1L1OB 1E3PA 1K9MC 3AYHB 1HJPA 5IODA 3GTLH 3WWVA 1AE3A 4A3GH 1TS3A 2JSOA 2QILA 3I4MB 1TWCB 4HMJA 4QQBX 4X65L 2WP8J 3NPPA 2QCPX 2JA9A 4A3DH 2ID0A 1VMPA 3D6CA 3MWYW 1S72A 3HOXB 4YWLA 3DHQA 2IL8A 4N8FA 4ZCKA 1CZWA 3HOZB 4K2KA 1B3AA 2Z4IA 2KHSA 5L37A 4O42A 1CHQD 2NN6H 1LT6D 1NY4A 2FFKB 4A4IA 4CKBA 2ZTDA 4JCVE 3L7ZC 5J22A 1FJGL 1O80A 5FJ8H 2JA8H 4KKSA 2Z6BA 2F0IA 2RF4A 1RHPA 5F2DA 1EYCA 1QWYA 3A7LA 1HH2P 3ITPA 3FRPB 3FKIB 5ELEA 1A8VA 2DNEA 1LYLA 3X3MA 4B3RL 1G8ZD 3AQQA 1VQAA 3K5NA 3CHBD 2B63B 5IY0A 2K28A 1L0WA 1G6PA 3PO2B 3I4OA 4PMCA 1HFGA 2GN5A 4ZK9B 1AW7A 1IBLL 1XWEA 3P7JA 4JBMA 4GZYC 4JW0A 4J8QA 4PG3A 4DR2Q 2PI2A 4A3MH 2C9OA 1CM9A 4HJ9A 5JEAJ 3H91A 1EZ8A 1Y1VG 4HIOA 1ZYRC 4HIMA 2AKWB 3IAYA 4BY1B 1BKBA 1RCVD 2CW0C 4WORA 2EXDA 2QKIC 1WD0A 3J81c 5CV7A 4HJ5A 1Y8NB 3CMAA 1S3OA 3HOYB 1C48A 2KOLA 4LNQA 4E6IA 3HOVH 4A3KB 4F88A 1VQCA 4K0KQ 4DNIA 3I70A 3AMUA 5KGUA 1BVSA 1OTCA 2F0MA 4KN4C 2VUMG 4GNXB 2XGTA 4DAYA 1Z7TA 1NMGA 1C0AA 3QO2A 2UXDL 4PMBA 4BS9A 2RQXA 3JC66 1V1QA 4LJZC 5EBCA 1TWHB 3QG1A 1WTQA 5IIFA 4JC0A 1T9HA 3MC0B 3D8GA 2XWBB 3Q6SA 4JI6Q 1MJEA 5C4HA 1NBWA 1SE2A 1UE1A 2UUBL 1UWVA 4ZRZA 2MO1A 1IW7C 4BBRH 3IFTA 2JA5G 3OW7A 3S1NB 4JOIC 1QVCA 1X32A 3A0JA 3R2TA 4RMFA 1BUVT 1SNOA 2EQSA 3C1EA 4RWSC 3S15H 3O13A 4FNFA 1F9SA 2NVYH 3IFDA 2F0TA 1J5EQ 1SJED 1KD1C 2JA6H 3K58A 2AUKA 2MP1A 4R8NA 1PTOC 2ZTCA 2E76C 5HGQA 2F0QA 3HOWB 5M3MG 4A3BB 3A5ZB 4DK0A 2PNHA 2Z1CA 2LY7A 4RHRA 1B3QA 2R6GA 1JT8A 4IFDJ 1B9MA 2LFNA 2IJ0A 2K33A 3E0EA 1IBKQ 3V96A 2AWNA 3H0GG 3RLOA 4C2MB 2SDFA 3BDLA 4X62Q 4DV7L 4X3SA 3CCUA 1WTVA 2XRQD 4NW2A 3CXCA 3GDEA 3NTKA 1VQBA 1VQGA 5LMNW 2N55A 4O2DA 4LFBL 4LF9Q 1XNRQ 1TVXA 1SBBB 2HQEA 3CCSA 4P74A 4WJ3M 4G7HC 1S5DD 4DV3Q 4M1UB 4HJAA 4JI4Q 4RFBA 1E22A 2B2TC 3KJPA 1IHZA 3HOUB 2K32A 3D0FA 3FHWA 3I4MH 1TWCH 4DV5Q 1WD1A 1CQVA 3F2UA 3HOXH 1MSGA 3ULLA 2B2VA 4IZ8A 2R7FA 1GUWA 3TZUA 3HOZH 1D8LA 1BBXC 2M2LA 4GOPA 3C46A 4DAPA 1HZCA 4YCUA 2RDHA 4V0BA 3W5OA 4C3HB 4B3TL 1PFBA 2AQ3B 1WI5A 2WIIB 1EQQA 5E4WC 2F0NA 1PA6A 3CKIB 2EXZA 2JXMB 1D7QA 5IP7G 3IL8A 1HZAA 4DR1L 4A3EG 1O7YA 2R93B 4A93G 3FKIH 1RKNA 1SE3A 4LF4Q 1N36Q 4OEMB 4UDUC 1QOHA 4FF1A 4BY7G 3E9IA 4XQQA 3VYUA 3Q23A 4LF6Q 2B63H 3M4QA 3AFQA 1YNXA 3RZOB 1A0IA 3NTIA 3KUPA 3PO2H 3RD4A 2EJMA 4TRDA 2CH4A 4XTCS 5M3FG 1Q1BA 5CYUA 3DEPA 3T53B 4G7ZC 1PH8A 3SVMA 1EEID 4IFDG 2JYOA 1JWSD 3NBHB 1HUMA 2IX1A 1IKLA 1EY7A 1LACA 1FGUA 1VS0A 2K05A 1K8AC 2X6LA 3PGZA 2KCMA 5C3WA 5M5YB 1JWMD 4GLAC 3SE0A 1PRTB 3UDIA 3PIOA 1JE5A 1Q90A 3HOYH 1X9NA 1EL0A 1LTAD 1Z47A 4OGQC 2F3IA 2JQOA 1VQMA 5T1IA 4OX9Q 5DAUA 1W2BA 4A3KH 3D4RA 3TP7A 2DN8A 1VQEA 3I91A 1JICA 3HS0C 1G51A 2L1BA 1GUNA 1LTLA 1NTGA 4FP5D 5IYBG 2RKSA 2UU9L 1X65A 2MJ8A 3NP8A 4XYQA 1I4RA 2NZOA 2F0HA 5I9OA 3H94A 5ISRA 1HNXQ 2RDFA 4RG1A 1WTRA 5D3DA 1TWHH 4CDCC 1PH7A 3VYTA 4MHEA 4B3ML 3ERSX 4M8AA 4A75A 5ELFA 5A35A 4BA2I 1CUKA 4TKOB 3S1MB 2WAQB 3A5UA 1VCIA 5IGGA 2F0EA 3CCEA 3BS1A 1N34Q 1BR9A 2VZAA 3SK8A 4KV6A 1KIXA 1C4QA 3ZJYC 1PH1A 4ILWA 2EYMA 4F87A 1GJXA 1AE2A 3S1NH 4LW1A 3WDNA 1H95A 1PYSB 1G291 4KHVA 2R7DA 2KEEA 4GN3B 1N32L 1RTOA 1YVCA 1A62A 4IUVA 1U5KA 1XMOQ 4FXGC 1DM0B 2VW9A 5HURA 1SNDA 4A3JB 3KLSX 3HKSA 2O2LD 3T1HL 4DV6L 1PRTC 3Q8DA 1NCVA 3HOWH 4DR4L 4AIMA 3OMCA 5C0XI 4A3BH 4KK7A 3B6YA 2V4DA 1KNAA 1K0RA 1LUZA 2RHQB 4L5TA 1QCBD 1XMQL 1I4GA 1K0SA 1KAAA 4ZKBB 5J1ZA 4L5RC 1Q1EA 3BVZA 1N33Q 4DV1Q 1Y14B 2H1EA 4C2MH 1BQQT 5LMNQ 3NE5B 3PQIA 4POFA 1O78A 3IKJA 1RODA 1WTXA 3SDZA 1YNND 2R92G 1CZGA 2EPBA 5E7NA 3TZDA 2F0UA 2DY8A 1SYCA 2L4NA 4UP7A 4WRDA 3CC7A 2XSCA 2JEAI 4G4KA 4XQNA 5LL6X 1EYGA 1DD2A 4DK1A 2XIWA 3U4ZA 2C35B 2Z6KC 3HOUH 2UXBQ 1A2UA 3QB3A 4MN3A 1G91A 5IGEA 1GO3E 4RGTA 3EVQA 2A6EC 4KKUA 1DOLA 1STYA 3OPOA 1NAPA 4HR7B 1AZPA 1HQMC 2J7ZA 4KHPQ 1STBA 5JJZA 4DV4Q 5C3EB 2A6HC 2MO0A 1K8MA 2FXQA 2IWHA 4UP9A 4DKAC 2PQEA 3I4NB 1CKOA 2Z9HA 3J80i 1E2ZA 4K2LA 4C3HH 4P73A 3PSIA 4NXMQ 2KA7A 1KDBA 1SRUA 4X64Q 1JE4A 1MJCA 4JI7Q 3I72A 1HNWL 1AP0A 5EJWA 2A5HA 5K36H 4QB4A 4Q5VA 3HKZE 4RHSA 2E75C 1BDOA 5IGBA 2GVAA 4BBSB 2R93H 1Q8IA 1RD9D 3S16B 1PH2A 5FLMH 2KQ3A 2EYHA 3NELA 5CV9A 4MZ9A 4A3FG 2VL6A 1BCPB 2QEXA 3DXJC 4O1NA 1EIHA 2NUCA 1MBYA 1ENFA 5CMDA 4HCEA 1I6VC 5FO7B 1X54A 2EZVA 4OXPA 4F7XA 3NXWA 1HA6A 3RZOH 1IL8A 3A54A 2A69D 4J6HA 1KHIA 2L9HA 3GP7A 4NP5A 1RL2A 2K1BA 2O4XA 1VQ8A 2HDMA 1PZID 1QNKA 4POGA 3T1YQ 4EGVA 3L0OA 4C3JB 3PIO3 3NEMA 4QGUA 1YITA 4DFAA 5CBEE 3BG3A 4LF5Q 2F4VQ 5A2QE 1CKNB 3T4AC 2Y0SE 2Y0SG 3DMUA 3W1GA 5M5YH 4DV2Q 1HCZA 1DOMA 1AN8A 2JE6I 3VDYA 1B53A 4CJ1B 3Q24A 2E2JB 3KBGA 2KBNA 1LTRD 1AFPA 5E1FA 1JB7A 1BXTA 3W2DA 1YI2A 1EY8A 4LFAQ 1EIGA 3HKZB 1B4OA 3QR8A 1X3FA 4K5XA 2JA7B 1A15A 3GO5A 2SEBD 1EY9A 4H0LC 3KDFB 1B50A 2PQAB 2EVBA 1TU2B 1Y1WG 1U4RA 2BA0A 5G3LD 3C3LA 1LV9A 3U50C 4IALA 4KHZA 4DXGA 2NZ1D 3KJOA 3I8ZA 3PO3G 1HHVA 1G6ZA 1JORA 4JI2Q 3OIQA 3S1MH 5CV4A 3DWPA 3MXNA 4C1NI 3EFXD 5EGTA 1SJHD 5G3LF 2KCNA 2HCIA 4XXEA 5AJ3L 4DNTB 4DR2L 2L11A 4BXXH 3R3OA 3PIPA 4FO2A 1TQOA 2I46A 3V2TA 1ENAA 1EIYB 4Q0FA 3M85A 1ESRA 3STBD 1Y8PB 3HP3A 3ULJA 3N6RA 1B1ZA 4QY7A 5IWAQ 3ULPA 4A3JH 3VR6A 2EE1A 5KNDA 3J81j 1H9SB 4UP8A 3L9AX 2B2UC 3QOJA 3VR2A 3GTMB 2XVSA 4K5VA 4UAIA 2G9DA 1JJCB 3KBXA 2PI2E 4L63B 4K0KL 5H1SE 3FPUB 3M7GA 2B2YA 1KDAA 4DV0Q 1SSOA 3BZKA 1E2VA 2B29A 3H3VC 2YTXA 4CBVA 5IYDH 3I55A 4X6AH 5IGFA 1XPOA 2L0CA 3CAMA 5C4XB 2RHSB 3E5SA 4R4IA 3FPPA 2ASBA 1CT1D 4OHJA 3OWFA 5IP9H 2I5HA 4Z9CB 3J80c 4JI6L 4LK1C 5GQOA 2WFWA 5EPKA 2O5JC 1U0LA 2F0LA 2RA4A 2F4IA 1AEXA 5M5XB 3EIVA 4JV5Q 1VDZA 3M7NA 4OO1H 2K14A 5ELOA 2RSOA 5FLXL 1BBUA 5C3EH 2PMZE 4JI0Q 4LUVA 1X3PA 5I9PA 1LT3D 1EFID 1CKMA 4DR6Q 1M8AA 3I4NH 2L15A 3GTPB 1J8IA 5J39A 1WTWA 3GTKB 4JI3Q 1J5EL 1ICFB 3C1FA 2VQEQ 3TDQA 3ICEA 3Q0AA 4BY1G 1MHWC 1PVOA 2K03A 4ZQ3A 5C5MA 3KF6A 3PUYA 1HR0W 3OHXC 2D0PA 3PUZA 3SGIA 1TY2A 4C3IB 4BBSH 3J80E 4ALPA 3S16H 1L1OA 2D9UA 1IBKL 2WV6D 3A56A 2BA1A 4X62L 1H9KA 1VQLA 2F0OA 3CF5A 2VNUD 4H02A 3KYHC 5C0XJ 4LFCQ 3I7FA 3CD6A 4CDEC 2B8GA 4LF9L 3SK5A 1XNRL 3V05A 2X69A 4RKBA 1PYBA 3S1RB 4JI5Q 1HFNA 2VXWA 4DAYB 4JYAQ 1V1OA 1Z9FA 4A3CH 3H15A 2YU9B 4R4CA 3K5LA 1D6EC 4DUZQ 4PV1C 1WCMG 4JI4L 5KNCA 3G4SA 3UE1A 1P8LA 1PTOB 4C3JH 1PH5A 2JP1A 3G71A 1NNXA 4DV5L 3ONAB 1UUPA 1PZKD 5FK9C 1SFOB 2XRSD 3U9OA 3UDXA 2IT1A 1B7YB 2E2JH 3CPWA 2BE5C 1I94Q 3TEHB 5DM63 2TMPA 1K3RA 3UDGA 2PPBC 1QNUA 4YY3Q 3NQIA 3H3VH 2JA7H 1BCPD 4JBJA 4NPSA 3GD7A 2BCOA 2DUDA 2RVLA 1X3QA 5EKKA 5DM73 3F1ZA 3U58A 4JI8Q 4L8JA 1SXTA 1W6JA 1TWAB 1N36L 2MPMA 4X66Q 1QILA 1H9RA 1X56A 1DONA 2F3VA 1B8AA 1GUSA 4LF6L 2F03A 2Q8TA 1Y1VB 1BCPF 4DN4M 4FYDA 3VR5A 2PZWA 3UI2A 1F2YA 3D3RA 1EFWA 2CQOA 4OWXB 1FVIA 3NHHA 2A68D 1I4XA 1NJIC 3PIP3 1C7YA 3T51B 2MHVA 2NYZD 2AQ1B 4KI0A 3WOEA 4UHVA 3F2BA 1FNWA 2HCCA 2AUJD 4P2CB 2RCNA 3J7ZC 4GNXA 1GUGA 2F0JA 3GQBA 4QUCA 1G2TA 2EYFA 3G48A 3GTGB 2VUMB 3I56A 5C0XG 4KY7A 2C5CA 4JBKA 2CHBD 3K8AA 2HHHQ 5IE8A 1MD2D 1PYWD 1FL0A 1EYAA 2XTIA 5JEAG 1U4LA 1YHAA 1EY5A 3Q22A 3GTMH 4CJ2C 5KYIA 4OX9L 3S14B 3CQZB 1K28A 1A63A 4TQUS 2BDOA 2PW7A 1HA5A 1RDPD 1SE8A 3BDCA 4AYBG 3GTQB 4FXKC 1SYGA 3PCOB 4DGZA 5C5LA 3MZ5A 2JEBI 4GN5A 1LTSD 1ILQA 3MVVA 3NK9A 5C4XH 1S5BD 1F9PA 5KYLA 2RDGA 1HNXL 3PUXA 2JA5B 2N88A 2DNCA 5A2QL 1IBLQ 4IO9A 1I50B 1Q86C 5I6YA 4DA2A 5IYCH 1EQRA 2B2WA 4HSVA 1EIFA 4X3UA 1B2TA 1ESFA 4J15A 4B3SQ 1VQ7A 5M5XH 1N34L 1DGSA 1OXTA 1XX8A 1B44D 5CV5A 5EPLA 1R4PB 3I73A 3D4WA 5M3MB 3BZDB 4GKKQ 3GTPH 3LWUA 4DNRB 2KHIA 2OCEA 3GTKH 1XMOL 1HR0Q 2E5LQ 2HT1A 1WTOA 3OTOQ 3H0GB 4A3IG 4HN7A 3OYYA 4B9WA 2OTLA 2R7ZG 1SNMA 4KJOA 3D4DA 3C2PA 2I5LX 4C3IH 1MSHA 1PMRA 5FLXc 3M4OB 1SLJA 1N33L 1PH3A 2I07B 5LMNL 1ZYRD 1EY6A 1XPUA 2CW0D 2B2VC 1U9RA 4DK3C 5EQ0A 4JBWA 5C44G 5ELBA 4GOPC 3QIAA 3HEJA 1BO0A 1SYDA 3S1RH 3KLRA 3CW2C 1CFMA 4IUUA 2YU9H 1I4PA 1RJTA 1SNQA 1LLRD 2A19A 2J0TD 2VY3A 3BVGA 2UUAQ 4LMQD 2KHJA 1PTOH 3QJYA 3EA6A 2UXBL 2OTJA 4EQOA 1JMCA 3VR3A 1FD7D 1XXGA 4RGNA 1VQ6A 1SFOH 1VQFA 1LO5D 4KHPL 4DV4L 1J9OA 3JAML 2BH8A 5FLXE 3DEOA 1Q8KA 4A3EB 3W3AA 5I4DA 1KAWA 2FINB 4OIJA 4A93B 2E74C 1HXYD 4BXXG 2EY5A 4BY7B 1XJVA 4NXML 1PH9A 3S1QB 4GKJQ 4X64L 1QJOA 5D65A 3ZYYX 3GTJH 3A74A 1SMXA 1V9PA 4JI7L 3G7LA 5CV8A 1YZ6A 5BN5A 1IW7D 3OWEB 3OMGA 5M3FB 4K8IA 5I6WA 3BU2A 4HIKA 4X3TA 3NBHA 1D1KA 1TWAH 3MXPA 4OELB 5AFWA 2VQFQ 3MA2B 2F0WA 2EY1A 2IHEA 1V1PB 3KLWA 3S9WA 2JN4A 2JJQA 1HRJA 1Y1VH 1H9MA 3RR5A 2IX3A 3BDOA 2XNAC 3MHBA 4IOCA 2B8FA 2L55A 4I7AA 5FO8B 1PTOD 3AEVA 3MEFA 2NTSA 1PDQA 2N78A 3VA7A 3KK7A 1YNJC 5HY6A 3T1YL 5GAHC 3TS2A 1PLFA 4EVOA 3K57A 4A3GG 4LF5L 2F4VL 3D31A 3K80C 3JAMi 3GTGH 3J80L 4DV2L 2VUMH 3BVMA 4A3DG 1PTOF 3KFUA 3VR4A 4HMIA 4YCVA 2WB1G 2WB1E 2ZT9C 3W1BA 1U4MA 4JG2A 1M90C 4IQZA 2Q8IB 3S24A 4LFAL 2NN6G 3S14H 4YHHQ 3CQZH 1ET9A 4QMGA 1JOQA 1IZ6A 4JI1Q 1F77A 5I2XA 5JJKA 4RGOS 5C4ZA 4RGMA 1SYFA 2NVTB 3MXGA 2EY6A 2CFMA 3GTQH 5FJ8G 4QF4A 2JA8G 1SMYC 1CA6A 1Q46A 1TXYA 1PFSA 3EJIA 2IW3A 1GHJA 5D14A 5LHY1 5COYA 4HTHA 1LT5D 1STEA 4UY8C 1CTMA 1QUQB 3ND9A 2JA5H 3SK4A 3BJUA 5JOBA 2RBMA 1GXDC 2SOBA 1TS5A 3GV3A 1LABA 1I50H 4IPGA 4IUPA 4JI2L 3U9SA 3M3YB 1K3BC 2K75A 4DPGA 1L0XB 4IPCA 4R4OA 2EYJA 1XTDA 5JPMC 1GVPA 3KOJA 2BOSA 1VQKA 1VQNA 2B3GA 4A3MG 5M3MH 2AQ2B 4NKLA 3L3OC 1TIID 5KNBA 1B70B 3E3XA 3HGBA 4DR7Q 4Y7NB 3ERQA 5IWAL 3H0GH 3J7YW 5K5PA 1D5MC 3D6WA 5D3IB 2P5ZX 1HQRD 3OW2A 2Z4HA 3PUWA 2R92B 4XDXA 5BR8Q 1VQ5A 5JJIA 2ZJRA 3KLSA 3HOVG 1F2MA 1SAPA 2VB2X 3AFPA 4H13C 2RSNA 4FF3A 2OQKA 3CCJA 1YJWA 4CKEA 5T1GA 3M4OH 3M4YA 3RN5A 4YCWA 2PNRC 1Q7YC 3F8TA 4DV0L 2DGYA 2HDLA 1ASYA 4H44C 1O7ZA 4RA8A 1Y69U 2MNAA 3TP6A 3KF8B 4IPHA 1YHQA 1D5ZC 1IBMQ 4XYOA 5C6AA 5FKAC 1QG7A 4R4QA 1STAA 3RN2A 4B08A 2UXCQ 1L2FA 4P72A 1DOKA 1OXSC 4LF8Q 4DR5Q 2ZTEA 1RTNA 2EIFA 4IUQA 5LL6S 3S17B 1G2SA 4MTNA 1HTLD 4JV5L 3HZXA 4V190 1I4HA 3CCRA 1H9JA 4BBRG 2ZJPA 2KVMA 2HIXA 1STNA 5BN3A 4JI0L 4A3EH 4A93H 4DR6L 3T1HQ 5KRUA 4A3FB 3GTOB 2A74C 4JI3L 4KJNA 4BY7H 2JA6G 2VQEL 2AMCB 3S1QH 1SEBD 4EQ5A 4DR3Q 4DAVA 3MFYA 5JVH3 4PZ7A 2LMCB 2ICIA 4R8IA 1GUTA 5M3FH 2AHOB 2YTVA 1TS2A 4O0AA 4OL7A 3MXUA 4KD4A 4CGYB 2KENA 3TQYA 1EQVA 3LX0A 1J6QA 4IFDH 3NENA 1R4QB 3JAMc 1K8GA 4PNYA 1XNQQ 2M9VA 1CKNA 2R3ZA 3AU7A 4FF4A 4L5SA 4KTAA 4FVMA 3RZDB 5EKLA 4G57A 4LFCL 1E7ZA 1RIPA 2L12A 3NWTA 3R2IA 2Y0SB 1LTGD 2D0OA 1AH9A 1KNEA 1PRTD 4IJHA 4JI5L 2DY7A 3RNUA 3GV6A 5M5WB 4DUZL 1GOZA 4DK6C 4DUYQ 4IOAA 1PZJD 2I0QA 3R93A 1D2BA 1JOOA 1ENCA 3FDTA 3KDFA 1KDCA 4N9PA 1JOKA 2PQAA 3I4MG 4NMZA 1VQJA 2KCCA 4QL5A 1S5FD 1PRTF 3HOXG 3QOLA 1X55A 5IYBH 2Q2HA 3A8JE 2IHFA 4ZYSA 3FVQA 1Y1WB 2F3WA 1FGBD 4OO1I 3HOZG 1I94L 1CSQA 4NXNQ 3JAME 1Y8OB 3J7AV 2OT2A 3PO3B 2PW5A 1I3QB 2K52A 1Q3LA 2QDLA 4YY3L 1CI3M 2UUCQ 2NVTH 5CGKA 2E8GA 1M4VA 2CCZA 1IXRA 2PYKA 5BN4A 1Z6HA 4PQXA 1D5XC 4JI8L 2A6ED 2MUYA 4LF7Q 1TWFB 1YBYA 3LGJA 3FKIG 4EQNA 2A6HD 2J4XA 5I2YA 4X66L 5LMUQ 1SE4A 5EBDA 2NB0A 1A3UA 5KEEA 2B63G 2E2DC 4KN7C 3M3YH 1II3A 2BH2A 1A3TA 3PO2G 1UE5A 1H9SA 1ML0D 2A1AA 2WKCA 1WJJA 3E9HA 4ID6A 5E3FA 1TR5A 2A8VA 4EX5A 2PCFB 4DXFA 4JVZA 2B2YC 3DWAA 1UAPA 1S4ZA 1PH4A 2YYZA 1MI2A 2SNSA 4Y7NH 1SNCA 1ICWA 3SK6A 4Y52H 1QVGA 2HHHL 2QGQA 2K6AA 1R9TB 1SYBA 3HOYG 2R92H 1JB3A 1X6OA 2WINB 1DYQA 2A73B 4A3KG 4WJWA 2MGSA 1OXVA 1TY0A 2GVBA 3S2DB 4I65A 4AQYQ 3DM3A 2YTYA 3I2ZA 4IPDA 1ZEQX 4A76A 3H3VI 4XQJA 1ONLA 1CA5A 5JPNC 2Z8LA 4DV3L 2BDNA 4HJ8A 3ER0A 4YWKA 2K5VA 2PMZB 2IPKD 1ET6A 1I5FA 2KCTA 2K5NA 3OSOA 3X3NA 3S17H 1JWUD 5AJ3Q 5ELNA 4B3SL 1RF2D 3FEWX 1F9RA 1QE6A 2PO4A 4H7BA 1BF4A 1L1OC 2F0GA 5JJLA 4TSSA 2AWOA 1PFMA 4ME5A 2FHTA 5IOCA 1IYVA 5E4XA 1DZ1A 2F0VA 3UDFA 5GADC 2HQLA 3G6JB 4NDXA 3VA5A 4GKKL 3GTJB 1HNZQ 4A3FH 2CWAA 3GTOH 2CQAA 1HR0L 2ZXPA 2E5LL 4JOIA 3J7A5 3OTOL 1GKHA 1Q12A 3R8BA 1UE6A 4ZLTF 1VF5C 2N3SA 4P71A 4LF4L 3HOWG 4A3BG 1JCKB 1D1IA 2D62A 2PZTA 2LXJA 5JVG3 2NWGA 5HGTA 3A8KE 1VMCA 2ZM6Q 3I3CA 1E24A 5CC4A 5FO9B 1VQIA 2K4KA 1WCMB 1KABA 1DJRD 3RZDH 1EY0A 2IX0A 4IUTA 2ZJQA 1PV4A 2V1CC 4X65Q 3TP8A 3OOCA 3J81E 4HEDA 1KQSA 3T56B 4TVAB 1S40A 5M5WH 1E0BA 2KJXA 1AZQA 2UUAL 2XN9C 1I4QA 4RCOA 5CR3A 3U4VA 2G9HD 3HOUG 3G6EA 1LT4D 1KRSA 1FJGQ 1KLUD 3NQTA 1EWHA 1X3EA 2B2TA 4ABNA 5EKIA 2F0PA 1Y1WH 1IYJB 2N8NA 1UNSA 4L6TB 4AYBE 3FMCA 4GN4B 1BNZA 4BA1I 3PO3H 4ZKCB 3A7AB 1I3QH 2NTTA 2K01A 4C3HG 4FF2A 4B3RQ 1S5CD 2KEDA 4GKJL 3TRZA 4GOPB 1CSPA 4R9WA 3SEBA 1SN8A 5IGCA 1M1KC 1STHA 2YV5A 5K36G 4C56C 1NE3A 2NVXB 1WVLA 1Q81C 3P1HA 3TREA 2R93G 1TWFH 4GNXC 5FLMG 4QUFA 3CCMA 2VQFL 1JR0D 4X3KA 1UEAB 1ZXTA 4HJ7A 1W6KA 3UE0A 4XIGS 5CV6A 3K0XA 3NSWA 2LKVA 3NUCA 2WACA 1YNNC 2B39A 2DJFC 3CCVA 1NSNS 4K6LA 5DLQE 1A6XA 5M9OA 1EUJA 1OXUA 3IRBA 2HUGA 2ZXOA 2F0SA 3URYA 3PV0A 1ASZA 4ME3A 4A3LH 1DXMA 1KL9A 4CKCA 1CQFA 1WFQA 3NTHA 2K5HA 4IURA 4PZ6A 4AYBB 1TS4A 3RLNA 3FP9A 2N49A 3E0JA 2Q2IA 5CORA 2OF1A 1R9TH 3DWQA 4OWWB 2UXDQ 2B2WC 4DV1L 1QVFA 4YHHL 1STGA 4XT3B 2QEJC 3MEHA 4JI1L 1HZ9A 4LUZA 1JC7A 3L2PA 3S2DH 4ODGA 2Q2TA 4J1MA 1JQYD 1S5ED 4R1JA 2UUBQ 1PH6A 1GUOA 1TWGB 1N8RC 2K04A 4U673 5C3XA 1OXXK 1EZ6A 1SDFA 4MIUA 2BE5D 1VQHA 3J7AF 1EOTA 3K5MA 2RCFA 2O5IC 4KLKA 2WAQE 2WAQG 1F2ZA 1NUCA 1V43A 1HTPA 3EROA 4QJFA 2HIVA 4DU9A 3SHLA 4A3IB 3CU7A 2F0KA 4WJ4A 4HIDA 4BY1H 2R7ZB 2A69C 4ZAIA 2NZHA 1I6HB 3TN2A 4NB3A 1VQ9A 2QA4A 1E1OA 2CWPA 2E2IB 2LXKA 4GLXA 4N9TA 3RLFA 5EAYA 4DR7L 1NMFA 1EWIA 5IGDA 4LWCA 2EYLA 3P20A 4N8X1 4A3JG 4DV7Q 5GROA 3BYTB 1JJ2A 3LWEA 1VQPA 3CMEA 5J3BA 5BR8L 4QCLA 1ILPA 1VQDA 5C44B 3S2HB 4K8JA 4RAUC 4LFBQ 1A3VA 5IT9L 2Q8RE 1OO9B 4ZUJA 2G5DA 2EYOA 2OEOA 1E1TA 3K7AB 3CP0A 1XTCD 1UEBA 1WCMH 3OIPA 4K14A 3DLLA 2NVQB 1VQ4A 3DM1A 5TSSA 1SNPA 1IBML 5IYDG 2FMCA 3VYSA 1GM5A 2FMMA 2I5MX 3T13A 2LS01 2F0DA 3LNNA 3M4PA 5GAGC 2UXCL 4G7OC 1WTPA 1HUNA 5IP9G 3HG9A 4LF8L 4CDFC 4DR5L 1FR3A 1EOVA 1VQOA 4EQPA 3NWSA 3AB9A 3M9BA 4RCNA 4KY5A 1YIJA 3BZCA 1EU3A 2EYPA 4CHTB 4B3TQ 5CBAE 4LUOA 1QB5D 2KECA 3BYYB 5C4JB 1B9NA 2D2CC 4OO1G 2K5DA 4FDBA 1HPCA 2Q2UA 5C3EG 2Z6KA 1EEFD 1QZHA 4DR1Q 1V1PA 2DJGC 2Z0SA 4P75A 3HRZC 3PF5A 2XWJB 3I4NG 1K73C 2K5WA 2EDGA 3STBC 4RKLA 1K83B 1YJNA 4DR3L 2MFIA 2F1MA 4MNOA 2QW7A 3K6OA 5KIXA 5ELCA 2NVXH 2R61A 3RMHA 4BBSG 5EPJA 2VS1A 2E2HB 1A2TA 3VYRA 1F9QA 3DUZA 3SR1A 1MGSA 1XNQL 3TBIB 3GTLB 3MTSA 1CK1A 2CVRA 4A3GB 3F2CA 2SNMA 2K5QA 4KD3A 4MTKA 5DNFA 1YHBA 1KC8C 4HSPA 3CC4A 4IJLA 5C0XH 4I7ZC 4A3DB 2F0FA 2PZUA 2QDBA 1MKHA 2WB1B 5JEAH 2ES2A 4A3CG 4DUYL 2CH4W 2EJFC 4PMWA 4ZUIA 4C3JG 2QF7A 2WKDA 4RH6A 4BWGB 4KMUC 1EY4A 1VF7A 3HFZB 3P75A 2JA8B 3CRKC 1QUQA 4OONA 1UE7A 3SXHA 1ZKOA 4DF7A 2UU9Q 1IL2A 3CC2A 1KXLA 4NXNL 1EYDA 3E6ZX 1N9WA 3HKZG 4YIJA 1YJ9A 4GS3A 2KUMA 2FJ2A 4JPBW 2UUCL 4B3MQ 1BBWA 1EWCA 3MFGA 2JA7G 1XPRA 3J81L 2F52A 1L0YB 3PUVA 1FNUA 3PMFA 3MAQA 4LF7L 2NBFA 1K8OA 4LAAA 3EQLC 1TWGH 4F8MA 4C1NK 5LMUL 2EY2A 3H09A 4A3MB 2OXPA 2H5XA 1BOSA 4L5QA 1PFNA 1Q82C 1WYDA 1SROA 2GA4B 2M00A 1N32Q 1TT2A 4IFDI 1EQTA 4DAMA 2VB3X 3CRLC 1XYIA 1CHPD 1FNVA 5ELDA 3F2DA 4A3IH 5IP7H 2OQ0A 3MXNB 2R7ZH 3CCQA 1SR3A 4FXDA 4DV6Q 1I6HH 4DR4Q 4YWMA 1DCZA 2HD3A 3HOVB 2MQHA 4OIKA 1EU4A 2K7VA 1XMQQ
chains in the Genus database with same CATH topology
4ULLA 1NR4A 3KF8A 1KTKA 4WFN3 2D5DA 4B9XA 1O7LA 3N52A 3QWNA 3WOFA 1GHKA 1U4PA 1TKWB 3H6MA 5DEHA 1F2LA 3I90A 4IUNA 2TSSA 1IYUA 2B2UA 4KY6A 1YNJD 5JAVA 3TP5A 1KLGD 3I4LA 1BCPC 3K5OA 1LTBD 5NUCA 4K6DA 4BBRB 4U68A 3K59A 4IN3A 1T5XD 3ND8A 1E2WA 3S15B 1C8CA 3TSSA 4JK1C 4HAEA 2NVYB 3TMEA 2JA6B 4K5WA 4S3SA 1SMYD 2A68C 3T16A 4XT1B 1SYEA 4CJ0B 1PXUA 1T5EA 2EOTA 2X6GA 2H4OA 3K0YA 1FYCA 3A8IE 1NR2A 2L5TA 1V8QA 5FOBB 4KKTA 1LTTD 2ENBA 2ICEC 3NBIA 3RUZA 4QIWB 1IKMA 2NN6I 4C3IG 4HCSA 1LTID 2ZXRA 3A55A 2EJGC 5IT9E 5IODA 1TS3A 2JSOA 2QILA 3I4MB 1TWCB 4HMJA 2WP8J 3NPPA 2QCPX 2ID0A 1VMPA 3D6CA 3MWYW 3HOXB 3DHQA 2IL8A 1CZWA 3HOZB 4K2KA 1B3AA 2Z4IA 2KHSA 4O42A 1CHQD 2NN6H 1LT6D 2FFKB 4CKBA 3L7ZC 5J22A 1O80A 4KKSA 2F0IA 1RHPA 5F2DA 1EYCA 1QWYA 3A7LA 3ITPA 3FRPB 3FKIB 5ELEA 2DNEA 3X3MA 1G8ZD 3K5NA 3CHBD 2B63B 2K28A 3PO2B 4PMCA 1HFGA 4ZK9B 1AW7A 1XWEA 3P7JA 4GZYC 4J8QA 2C9OA 1CM9A 5JEAJ 3H91A 1EZ8A 4BY1B 1ZYRC 3IAYA 1RCVD 2CW0C 4WORA 2QKIC 1WD0A 5CV7A 1Y8NB 3HOYB 1C48A 2KOLA 4E6IA 4A3KB 4F88A 3I70A 3AMUA 5KGUA 2F0MA 4KN4C 4DAYA 1Z7TA 3QO2A 4PMBA 4BS9A 2RQXA 4LJZC 5EBCA 1TWHB 3QG1A 1WTQA 5IIFA 3MC0B 3D8GA 2XWBB 3Q6SA 5C4HA 1SE2A 4ZRZA 1IW7C 3IFTA 3OW7A 3S1NB 1X32A 3R2TA 1BUVT 1SNOA 3C1EA 4RWSC 3O13A 4FNFA 1F9SA 3IFDA 2F0TA 1SJED 3K58A 2AUKA 2MP1A 4R8NA 1PTOC 2E76C 2F0QA 3HOWB 4A3BB 4DK0A 2Z1CA 2LY7A 4RHRA 2R6GA 4IFDJ 1B9MA 2LFNA 2IJ0A 2K33A 3V96A 2AWNA 4C2MB 2SDFA 3BDLA 4X3SA 1WTVA 2XRQD 4NW2A 3NTKA 2N55A 1TVXA 1SBBB 2HQEA 4G7HC 1S5DD 4M1UB 4RFBA 2B2TC 1IHZA 3HOUB 2K32A 1WD1A 1CQVA 3F2UA 1MSGA 2B2VA 4IZ8A 1GUWA 3TZUA 1BBXC 2M2LA 3C46A 4DAPA 2RDHA 4V0BA 4C3HB 1PFBA 2AQ3B 2WIIB 5E4WC 2F0NA 3CKIB 2EXZA 2JXMB 3IL8A 1O7YA 2R93B 1RKNA 1SE3A 4UDUC 1QOHA 4FF1A 4XQQA 3VYUA 3Q23A 3RZOB 3NTIA 3KUPA 3RD4A 2EJMA 4TRDA 4XTCS 1Q1BA 5CYUA 3DEPA 3T53B 4G7ZC 3SVMA 1EEID 4IFDG 2JYOA 1JWSD 1HUMA 2IX1A 1IKLA 1EY7A 1LACA 2K05A 2X6LA 5C3WA 5M5YB 1JWMD 3SE0A 1PRTB 1Q90A 1EL0A 1LTAD 1Z47A 4OGQC 5T1IA 5DAUA 3D4RA 3TP7A 2DN8A 3I91A 1JICA 3HS0C 2L1BA 1GUNA 4FP5D 2RKSA 2MJ8A 3NP8A 4XYQA 1I4RA 2F0HA 5I9OA 3H94A 5ISRA 2RDFA 1WTRA 5D3DA 3VYTA 4MHEA 4M8AA 5ELFA 5A35A 4BA2I 4TKOB 3S1MB 2WAQB 1VCIA 5IGGA 2F0EA 3BS1A 1BR9A 3SK8A 4KV6A 1C4QA 4ILWA 2EYMA 4F87A 1GJXA 3WDNA 1G291 4KHVA 2KEEA 1RTOA 4IUVA 4FXGC 1DM0B 5HURA 1SNDA 4A3JB 3KLSX 2O2LD 1PRTC 1NCVA 3OMCA 5C0XI 4KK7A 2V4DA 1KNAA 1QCBD 1I4GA 1KAAA 4ZKBB 5J1ZA 1Q1EA 3BVZA 2H1EA 1BQQT 3NE5B 1O78A 3IKJA 1RODA 1WTXA 3SDZA 1YNND 1CZGA 2EPBA 3TZDA 2F0UA 2DY8A 1SYCA 2L4NA 4WRDA 2XSCA 2JEAI 4G4KA 4XQNA 5LL6X 1DD2A 4DK1A 2XIWA 1A2UA 3QB3A 4MN3A 1G91A 5IGEA 4RGTA 3EVQA 2A6EC 4KKUA 1DOLA 1STYA 3OPOA 1NAPA 4HR7B 1AZPA 1HQMC 2J7ZA 1STBA 5JJZA 5C3EB 2A6HC 1K8MA 2IWHA 2PQEA 3I4NB 1E2ZA 4K2LA 2KA7A 1KDBA 1JE4A 3I72A 1AP0A 5EJWA 2A5HA 5K36H 4QB4A 4Q5VA 4RHSA 2E75C 1BDOA 5IGBA 4BBSB 1Q8IA 1RD9D 3S16B 2KQ3A 2EYHA 5CV9A 1BCPB 3DXJC 4O1NA 1EIHA 2NUCA 1MBYA 1ENFA 5CMDA 4HCEA 1I6VC 5FO7B 2EZVA 4F7XA 3NXWA 1HA6A 1IL8A 3A54A 2A69D 4J6HA 2L9HA 3GP7A 4NP5A 2K1BA 2O4XA 2HDMA 1PZID 1QNKA 4EGVA 4C3JB 3PIO3 4DFAA 5CBEE 3BG3A 5A2QE 3T4AC 3DMUA 1HCZA 1DOMA 1AN8A 2JE6I 1B53A 4CJ1B 3Q24A 2E2JB 3KBGA 1LTRD 1AFPA 5E1FA 1BXTA 3W2DA 1EY8A 1EIGA 3HKZB 1B4OA 4K5XA 2JA7B 1A15A 3GO5A 2SEBD 1EY9A 4H0LC 1B50A 2EVBA 1TU2B 1U4RA 2BA0A 5G3LD 3C3LA 1LV9A 4IALA 4KHZA 4DXGA 2NZ1D 3I8ZA 1HHVA 1G6ZA 1JORA 3OIQA 5CV4A 3DWPA 3MXNA 4C1NI 3EFXD 5EGTA 1SJHD 5G3LF 2KCNA 2HCIA 4XXEA 4DNTB 2L11A 3R3OA 4FO2A 1TQOA 2I46A 3V2TA 1ENAA 4Q0FA 3M85A 1ESRA 1Y8PB 3HP3A 3N6RA 1B1ZA 3VR6A 2EE1A 5KNDA 1H9SB 3L9AX 2B2UC 3QOJA 3VR2A 3GTMB 2XVSA 4K5VA 4UAIA 2G9DA 3KBXA 4L63B 3FPUB 3M7GA 2B2YA 1KDAA 1SSOA 1E2VA 3H3VC 4CBVA 5IGFA 2L0CA 5C4XB 3E5SA 3FPPA 1CT1D 4OHJA 3OWFA 4Z9CB 4LK1C 5EPKA 2O5JC 2F0LA 2RA4A 2F4IA 1AEXA 5M5XB 1VDZA 3M7NA 4OO1H 2RSOA 5FLXL 1X3PA 5I9PA 1LT3D 1EFID 1M8AA 3GTPB 1J8IA 5J39A 1WTWA 3GTKB 3C1FA 3TDQA 3Q0AA 2K03A 4ZQ3A 5C5MA 3PUYA 3OHXC 3PUZA 1TY2A 4C3IB 3J80E 2D9UA 2WV6D 3A56A 2BA1A 1H9KA 2F0OA 2VNUD 5C0XJ 2B8GA 3SK5A 3V05A 2X69A 4RKBA 3S1RB 1HFNA 2VXWA 1V1OA 2YU9B 3K5LA 1D6EC 4PV1C 5KNCA 1PTOB 2JP1A 3ONAB 1UUPA 1PZKD 5FK9C 1SFOB 2XRSD 3U9OA 2IT1A 2BE5C 5DM63 2TMPA 2PPBC 1QNUA 3NQIA 1BCPD 3GD7A 2BCOA 2RVLA 1X3QA 5EKKA 5DM73 4L8JA 1SXTA 1W6JA 1TWAB 2MPMA 1QILA 1H9RA 1DONA 2F3VA 1GUSA 2F03A 2Q8TA 1Y1VB 1BCPF 4DN4M 4FYDA 3VR5A 2PZWA 3UI2A 1F2YA 3D3RA 3NHHA 2A68D 1I4XA 3PIP3 3T51B 2MHVA 2NYZD 2AQ1B 4KI0A 3WOEA 1FNWA 2HCCA 2AUJD 4P2CB 1GUGA 2F0JA 3GQBA 4QUCA 1G2TA 2EYFA 3GTGB 2VUMB 5C0XG 4KY7A 2C5CA 2CHBD 1MD2D 1PYWD 1EYAA 5JEAG 1U4LA 1EY5A 3Q22A 4CJ2C 5KYIA 3S14B 3CQZB 4TQUS 2BDOA 2PW7A 1HA5A 1RDPD 3BDCA 3GTQB 4FXKC 1SYGA 4DGZA 5C5LA 3MZ5A 2JEBI 1LTSD 1ILQA 3MVVA 3NK9A 1S5BD 1F9PA 5KYLA 2RDGA 3PUXA 2JA5B 2N88A 2DNCA 5A2QL 1I50B 5I6YA 4DA2A 2B2WA 4HSVA 4X3UA 1B2TA 1ESFA 1OXTA 1XX8A 1B44D 5CV5A 5EPLA 1R4PB 3I73A 3D4WA 5M3MB 3BZDB 3LWUA 4DNRB 1WTOA 3H0GB 4HN7A 4B9WA 1SNMA 4KJOA 3D4DA 3C2PA 1MSHA 1PMRA 3M4OB 2I07B 1ZYRD 1EY6A 2CW0D 2B2VC 1U9RA 5EQ0A 4JBWA 5ELBA 3QIAA 3HEJA 1BO0A 1SYDA 3KLRA 1CFMA 4IUUA 1I4PA 1RJTA 1SNQA 1LLRD 2J0TD 3BVGA 4LMQD 1PTOH 3QJYA 3EA6A 4EQOA 3VR3A 1FD7D 1XXGA 4RGNA 1LO5D 1J9OA 3JAML 5FLXE 3DEOA 4A3EB 3W3AA 5I4DA 4A93B 2FINB 4OIJA 2E74C 1HXYD 2EY5A 4BY7B 3S1QB 1QJOA 5D65A 3ZYYX 3G7LA 5CV8A 5BN5A 1IW7D 3OWEB 3OMGA 5M3FB 4K8IA 5I6WA 4X3TA 3NBHA 1D1KA 3MXPA 5AFWA 3MA2B 2F0WA 2EY1A 1V1PB 3S9WA 1HRJA 1H9MA 2IX3A 3BDOA 2XNAC 3MHBA 2B8FA 2L55A 5FO8B 1PTOD 2NTSA 1PDQA 3VA7A 3KK7A 1YNJC 1PLFA 4EVOA 3K57A 3D31A 3J80L 3BVMA 1PTOF 3VR4A 4HMIA 2ZT9C 1U4MA 4IQZA 2Q8IB 2NN6G 1ET9A 4QMGA 1JOQA 1F77A 5I2XA 4RGOS 5C4ZA 4RGMA 1SYFA 2NVTB 3MXGA 2EY6A 4QF4A 1SMYC 1CA6A 3EJIA 2IW3A 1GHJA 5D14A 5LHY1 5COYA 4HTHA 1LT5D 1STEA 1CTMA 3ND9A 3SK4A 5JOBA 2RBMA 1GXDC 2SOBA 1TS5A 3GV3A 1LABA 4IUPA 3U9SA 3M3YB 1L0XB 2EYJA 5JPMC 2BOSA 2AQ2B 4NKLA 3L3OC 1TIID 5KNBA 3HGBA 4Y7NB 3ERQA 3J7YW 5K5PA 1D5MC 3D6WA 5D3IB 1HQRD 2Z4HA 3PUWA 2R92B 4XDXA 3KLSA 1F2MA 1SAPA 2VB2X 4H13C 2RSNA 4FF3A 4CKEA 5T1GA 3M4YA 2PNRC 2HDLA 4H44C 1O7ZA 4RA8A 1Y69U 3TP6A 1D5ZC 4XYOA 5C6AA 5FKAC 1QG7A 1STAA 4B08A 1DOKA 1OXSC 1RTNA 4IUQA 5LL6S 3S17B 1G2SA 1HTLD 3HZXA 4V190 1I4HA 1H9JA 2KVMA 1STNA 5BN3A 5KRUA 4A3FB 3GTOB 2A74C 4KJNA 1SEBD 4DAVA 3MFYA 5JVH3 2LMCB 2ICIA 4R8IA 1GUTA 1TS2A 4OL7A 3MXUA 4KD4A 4CGYB 1EQVA 3LX0A 4IFDH 1R4QB 4PNYA 2M9VA 3AU7A 2R3ZA 4FF4A 4KTAA 4FVMA 3RZDB 5EKLA 4G57A 2L12A 3NWTA 3R2IA 2Y0SB 1LTGD 1KNEA 1PRTD 2DY7A 3GV6A 5M5WB 1GOZA 1PZJD 3R93A 1D2BA 1JOOA 1ENCA 3FDTA 1KDCA 4N9PA 1JOKA 4NMZA 2KCCA 1S5FD 1PRTF 3QOLA 3A8JE 4ZYSA 3FVQA 1Y1WB 2F3WA 1FGBD 4OO1I 3JAME 1Y8OB 3J7AV 2OT2A 3PO3B 2PW5A 1I3QB 1Q3LA 1CI3M 5CGKA 1M4VA 2PYKA 5BN4A 1Z6HA 4PQXA 1D5XC 2A6ED 2MUYA 1TWFB 4EQNA 2A6HD 2J4XA 5I2YA 1SE4A 5EBDA 2NB0A 1A3UA 5KEEA 2E2DC 4KN7C 1II3A 1A3TA 1H9SA 1ML0D 2WKCA 4ID6A 5E3FA 1TR5A 2PCFB 4DXFA 2B2YC 3DWAA 1UAPA 1S4ZA 2YYZA 1MI2A 2SNSA 1SNCA 1ICWA 3SK6A 2K6AA 1R9TB 1SYBA 1JB3A 2WINB 1DYQA 2A73B 4WJWA 2MGSA 1OXVA 1TY0A 3S2DB 4I65A 1ZEQX 4XQJA 1ONLA 1CA5A 5JPNC 2Z8LA 2BDNA 2PMZB 2IPKD 1ET6A 3OSOA 3X3NA 1JWUD 1RF2D 3FEWX 1F9RA 1QE6A 2PO4A 4H7BA 1BF4A 2F0GA 4TSSA 2AWOA 1PFMA 4ME5A 2FHTA 5IOCA 1IYVA 5E4XA 1DZ1A 2F0VA 3G6JB 4NDXA 3VA5A 3GTJB 2CQAA 2ZXPA 1Q12A 3R8BA 4ZLTF 1VF5C 1JCKB 1D1IA 2D62A 2PZTA 5JVG3 2NWGA 5HGTA 3A8KE 1VMCA 3I3CA 5CC4A 5FO9B 1WCMB 1KABA 1DJRD 1EY0A 2IX0A 4IUTA 3TP8A 3OOCA 3J81E 4HEDA 3T56B 1E0BA 2KJXA 1AZQA 2XN9C 1I4QA 4RCOA 5CR3A 2G9HD 1LT4D 1KLUD 3NQTA 1EWHA 4ABNA 2B2TA 5EKIA 2F0PA 1UNSA 4L6TB 3FMCA 1BNZA 4BA1I 4ZKCB 3A7AB 2NTTA 4C3HG 2K01A 4FF2A 1S5CD 2KEDA 3SEBA 4R9WA 5IGCA 1STHA 5K36G 4C56C 2NVXB 1WVLA 3P1HA 4QUFA 1JR0D 4X3KA 1UEAB 1ZXTA 1W6KA 4XIGS 5CV6A 3NSWA 2LKVA 3NUCA 2WACA 1YNNC 2B39A 1NSNS 4K6LA 1A6XA 5M9OA 1OXUA 2HUGA 2ZXOA 2F0SA 3URYA 3PV0A 1DXMA 4CKCA 1CQFA 3NTHA 4AYBB 4IURA 1TS4A 3E0JA 5CORA 2OF1A 3DWQA 2B2WC 1STGA 4XT3B 2QEJC 3MEHA 1JC7A 4ODGA 4J1MA 1JQYD 1S5ED 1GUOA 1TWGB 2K04A 4U673 5C3XA 1OXXK 1EZ6A 1SDFA 4MIUA 2BE5D 3J7AF 1EOTA 3K5MA 2O5IC 1F2ZA 1NUCA 1V43A 1HTPA 3EROA 4DU9A 3SHLA 4A3IB 3CU7A 2F0KA 2R7ZB 2A69C 4ZAIA 1I6HB 3TN2A 2E2IB 4N9TA 3RLFA 5IGDA 2EYLA 3P20A 3BYTB 3LWEA 4QCLA 1ILPA 5C44B 3S2HB 4K8JA 4RAUC 1A3VA 5IT9L 2Q8RE 1OO9B 4ZUJA 2EYOA 2OEOA 3K7AB 1XTCD 3OIPA 4K14A 2NVQB 3DM1A 5TSSA 1SNPA 2FMCA 3VYSA 2FMMA 3T13A 2LS01 2F0DA 3LNNA 4G7OC 1WTPA 1HUNA 3HG9A 1FR3A 4EQPA 3NWSA 3AB9A 4RCNA 4KY5A 1EU3A 2EYPA 4CHTB 5CBAE 1QB5D 2KECA 3BYYB 5C4JB 1B9NA 2D2CC 4OO1G 2K5DA 1HPCA 1EEFD 1V1PA 3HRZC 2XWJB 2K5WA 2EDGA 4RKLA 1K83B 2F1MA 3K6OA 5KIXA 5ELCA 2R61A 3RMHA 2E2HB 5EPJA 1A2TA 3VYRA 1F9QA 3DUZA 3SR1A 1MGSA 3TBIB 3GTLB 3MTSA 1CK1A 2CVRA 4A3GB 2SNMA 2K5QA 4KD3A 5DNFA 4HSPA 5C0XH 4I7ZC 4A3DB 2F0FA 2PZUA 2QDBA 2WB1B 5JEAH 2EJFC 4PMWA 4ZUIA 4C3JG 2QF7A 2WKDA 4RH6A 4BWGB 4KMUC 1EY4A 1VF7A 3P75A 2JA8B 3CRKC 3SXHA 1ZKOA 4DF7A 1EYDA 3E6ZX 4YIJA 2KUMA 2FJ2A 1EWCA 3MFGA 3J81L 1L0YB 3PUVA 1FNUA 3PMFA 3MAQA 2NBFA 1K8OA 4LAAA 3EQLC 4F8MA 4C1NK 2EY2A 3H09A 4A3MB 2OXPA 1BOSA 1PFNA 2M00A 2GA4B 1TT2A 4IFDI 1EQTA 2VB3X 3CRLC 1XYIA 1CHPD 1FNVA 5ELDA 4FXDA 1DCZA 3HOVB 4OIKA 1EU4A 2K7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UAP A;  1GXD C;  1BQQ T;  2XWB B;  3FRP B;  1JC7 A;  3I70 A;  1UEA B;  4FXG C;  3OHX C;  2E2D C;  3CU7 A;  3MA2 B;  4FXK C;  3HRZ C;  2TMP A;  3HS0 C;  1BR9 A;  2XWJ B;  1PXU A;  1D2B A;  5JPM C;  5JPN C;  5FO9 B;  4ILW A;  2QKI C;  3G6J B;  3KLS A;  1JB3 A;  2A74 C;  2J0T D;  5FO7 B;  2B39 A;  2WIN B;  1OO9 B;  1BUV T;  3T4A C;  3L3O C;  2WII B;  2A73 B;  5FOB B;  1XWE A;  2I07 B;  3V96 A;  2ICE C;  3CKI B;  5FO8 B; 
#chains in the Genus database with same CATH topology
 4ULL A;  2E2I H;  2OWO A;  1NR4 A;  3KF8 A;  4GLV B;  1KTK A;  4WFN 3;  1YEZ A;  2D5D A;  4B9X A;  2JK8 A;  2LSS A;  1O7L A;  3N52 A;  3QWN A;  3WOF A;  1QZG A;  1GHK A;  5C44 H;  1U4P A;  1TKW B;  3H6M A;  5DEH A;  3S2H H;  1C9O A;  3J81 i;  1F2L A;  4AH6 A;  3EN2 A;  3I90 A;  4IUN A;  2TSS A;  1IYU A;  2B2U A;  4KY6 A;  4QIW E;  1HZB A;  1YNJ D;  5JAV A;  3K7A H;  4PZ8 A;  1KRT A;  3TP5 A;  4AQY L;  1KLG D;  2ALY B;  2NVQ H;  3I4L A;  1BCP C;  3K5O A;  1LTB D;  5NUC A;  4K6D A;  4JYA L;  3TS0 A;  4BBR B;  1X3G A;  5C4X G;  1LM0 A;  2CKZ B;  4APV A;  4U68 A;  3K59 A;  4IN3 A;  4CDD C;  1T5X D;  3ND8 A;  1E2W A;  3CPF A;  3S15 B;  1C8C A;  3TSS A;  5IYC G;  2ATW A;  4JK1 C;  1W3S A;  4HAE A;  2NVY B;  5IT9 c;  3TME A;  2JA6 B;  4K5W A;  5C4J H;  1WTH A;  4S3S A;  1SMY D;  2A68 C;  1P16 A;  1JJG A;  3T16 A;  4XT1 B;  1HNW Q;  1SYE A;  1WOC A;  1GD7 A;  3PF4 A;  4CJ0 B;  1PXU A;  2IY5 B;  1HNZ L;  1T5E A;  2EOT A;  2X6G A;  2H4O A;  3K7U C;  3K0Y A;  1FYC A;  3A8I E;  4R4T A;  1MIU A;  1NR2 A;  2L5T A;  1V8Q A;  1K83 H;  5FOB B;  5GAE C;  4KKT A;  1LTT D;  4A3L G;  3K81 C;  2ENB A;  2ICE C;  3NBI A;  3RUZ A;  4UPA A;  4OWT B;  2K50 A;  4QIW B;  1IKM A;  3EBE A;  2NN6 I;  1PHJ A;  3CCL A;  4C3I G;  2E2H H;  1O7I A;  3KF6 B;  4HCS A;  1LTI D;  2ZM6 L;  2ZXR A;  3A55 A;  2EJG C;  5IT9 E;  1L1O B;  1E3P A;  1K9M C;  3AYH B;  1HJP A;  5IOD A;  3GTL H;  3WWV A;  1AE3 A;  4A3G H;  1TS3 A;  2JSO A;  2QIL A;  3I4M B;  1TWC B;  4HMJ A;  4QQB X;  4X65 L;  2WP8 J;  3NPP A;  2QCP X;  2JA9 A;  4A3D H;  2ID0 A;  1VMP A;  3D6C A;  3MWY W;  1S72 A;  3HOX B;  4YWL A;  3DHQ A;  2IL8 A;  4N8F A;  4ZCK A;  1CZW A;  3HOZ B;  4K2K A;  1B3A A;  2Z4I A;  2KHS A;  5L37 A;  4O42 A;  1CHQ D;  2NN6 H;  1LT6 D;  1NY4 A;  2FFK B;  4A4I A;  4CKB A;  2ZTD A;  4JCV E;  3L7Z C;  5J22 A;  1FJG L;  1O80 A;  5FJ8 H;  2JA8 H;  4KKS A;  2Z6B A;  2F0I A;  2RF4 A;  1RHP A;  5F2D A;  1EYC A;  1QWY A;  3A7L A;  1HH2 P;  3ITP A;  3FRP B;  3FKI B;  5ELE A;  1A8V A;  2DNE A;  1LYL A;  3X3M A;  4B3R L;  1G8Z D;  3AQQ A;  1VQA A;  3K5N A;  3CHB D;  2B63 B;  5IY0 A;  2K28 A;  1L0W A;  1G6P A;  3PO2 B;  3I4O A;  4PMC A;  1HFG A;  2GN5 A;  4ZK9 B;  1AW7 A;  1IBL L;  1XWE A;  3P7J A;  4JBM A;  4GZY C;  4JW0 A;  4J8Q A;  4PG3 A;  4DR2 Q;  2PI2 A;  4A3M H;  2C9O A;  1CM9 A;  4HJ9 A;  5JEA J;  3H91 A;  1EZ8 A;  1Y1V G;  4HIO A;  1ZYR C;  4HIM A;  2AKW B;  3IAY A;  4BY1 B;  1BKB A;  1RCV D;  2CW0 C;  4WOR A;  2EXD A;  2QKI C;  1WD0 A;  3J81 c;  5CV7 A;  4HJ5 A;  1Y8N B;  3CMA A;  1S3O A;  3HOY B;  1C48 A;  2KOL A;  4LNQ A;  4E6I A;  3HOV H;  4A3K B;  4F88 A;  1VQC A;  4K0K Q;  4DNI A;  3I70 A;  3AMU A;  5KGU A;  1BVS A;  1OTC A;  2F0M A;  4KN4 C;  2VUM G;  4GNX B;  2XGT A;  4DAY A;  1Z7T A;  1NMG A;  1C0A A;  3QO2 A;  2UXD L;  4PMB A;  4BS9 A;  2RQX A;  3JC6 6;  1V1Q A;  4LJZ C;  5EBC A;  1TWH B;  3QG1 A;  1WTQ A;  5IIF A;  4JC0 A;  1T9H A;  3MC0 B;  3D8G A;  2XWB B;  3Q6S A;  4JI6 Q;  1MJE A;  5C4H A;  1NBW A;  1SE2 A;  1UE1 A;  2UUB L;  1UWV A;  4ZRZ A;  2MO1 A;  1IW7 C;  4BBR H;  3IFT A;  2JA5 G;  3OW7 A;  3S1N B;  4JOI C;  1QVC A;  1X32 A;  3A0J A;  3R2T A;  4RMF A;  1BUV T;  1SNO A;  2EQS A;  3C1E A;  4RWS C;  3S15 H;  3O13 A;  4FNF A;  1F9S A;  2NVY H;  3IFD A;  2F0T A;  1J5E Q;  1SJE D;  1KD1 C;  2JA6 H;  3K58 A;  2AUK A;  2MP1 A;  4R8N A;  1PTO C;  2ZTC A;  2E76 C;  5HGQ A;  2F0Q A;  3HOW B;  5M3M G;  4A3B B;  3A5Z B;  4DK0 A;  2PNH A;  2Z1C A;  2LY7 A;  4RHR A;  1B3Q A;  2R6G A;  1JT8 A;  4IFD J;  1B9M A;  2LFN A;  2IJ0 A;  2K33 A;  3E0E A;  1IBK Q;  3V96 A;  2AWN A;  3H0G G;  3RLO A;  4C2M B;  2SDF A;  3BDL A;  4X62 Q;  4DV7 L;  4X3S A;  3CCU A;  1WTV A;  2XRQ D;  4NW2 A;  3CXC A;  3GDE A;  3NTK A;  1VQB A;  1VQG A;  5LMN W;  2N55 A;  4O2D A;  4LFB L;  4LF9 Q;  1XNR Q;  1TVX A;  1SBB B;  2HQE A;  3CCS A;  4P74 A;  4WJ3 M;  4G7H C;  1S5D D;  4DV3 Q;  4M1U B;  4HJA A;  4JI4 Q;  4RFB A;  1E22 A;  2B2T C;  3KJP A;  1IHZ A;  3HOU B;  2K32 A;  3D0F A;  3FHW A;  3I4M H;  1TWC H;  4DV5 Q;  1WD1 A;  1CQV A;  3F2U A;  3HOX H;  1MSG A;  3ULL A;  2B2V A;  4IZ8 A;  2R7F A;  1GUW A;  3TZU A;  3HOZ H;  1D8L A;  1BBX C;  2M2L A;  4GOP A;  3C46 A;  4DAP A;  1HZC A;  4YCU A;  2RDH A;  4V0B A;  3W5O A;  4C3H B;  4B3T L;  1PFB A;  2AQ3 B;  1WI5 A;  2WII B;  1EQQ A;  5E4W C;  2F0N A;  1PA6 A;  3CKI B;  2EXZ A;  2JXM B;  1D7Q A;  5IP7 G;  3IL8 A;  1HZA A;  4DR1 L;  4A3E G;  1O7Y A;  2R93 B;  4A93 G;  3FKI H;  1RKN A;  1SE3 A;  4LF4 Q;  1N36 Q;  4OEM B;  4UDU C;  1QOH A;  4FF1 A;  4BY7 G;  3E9I A;  4XQQ A;  3VYU A;  3Q23 A;  4LF6 Q;  2B63 H;  3M4Q A;  3AFQ A;  1YNX A;  3RZO B;  1A0I A;  3NTI A;  3KUP A;  3PO2 H;  3RD4 A;  2EJM A;  4TRD A;  2CH4 A;  4XTC S;  5M3F G;  1Q1B A;  5CYU A;  3DEP A;  3T53 B;  4G7Z C;  1PH8 A;  3SVM A;  1EEI D;  4IFD G;  2JYO A;  1JWS D;  3NBH B;  1HUM A;  2IX1 A;  1IKL A;  1EY7 A;  1LAC A;  1FGU A;  1VS0 A;  2K05 A;  1K8A C;  2X6L A;  3PGZ A;  2KCM A;  5C3W A;  5M5Y B;  1JWM D;  4GLA C;  3SE0 A;  1PRT B;  3UDI A;  3PIO A;  1JE5 A;  1Q90 A;  3HOY H;  1X9N A;  1EL0 A;  1LTA D;  1Z47 A;  4OGQ C;  2F3I A;  2JQO A;  1VQM A;  5T1I A;  4OX9 Q;  5DAU A;  1W2B A;  4A3K H;  3D4R A;  3TP7 A;  2DN8 A;  1VQE A;  3I91 A;  1JIC A;  3HS0 C;  1G51 A;  2L1B A;  1GUN A;  1LTL A;  1NTG A;  4FP5 D;  5IYB G;  2RKS A;  2UU9 L;  1X65 A;  2MJ8 A;  3NP8 A;  4XYQ A;  1I4R A;  2NZO A;  2F0H A;  5I9O A;  3H94 A;  5ISR A;  1HNX Q;  2RDF A;  4RG1 A;  1WTR A;  5D3D A;  1TWH H;  4CDC C;  1PH7 A;  3VYT A;  4MHE A;  4B3M L;  3ERS X;  4M8A A;  4A75 A;  5ELF A;  5A35 A;  4BA2 I;  1CUK A;  4TKO B;  3S1M B;  2WAQ B;  3A5U A;  1VCI A;  5IGG A;  2F0E A;  3CCE A;  3BS1 A;  1N34 Q;  1BR9 A;  2VZA A;  3SK8 A;  4KV6 A;  1KIX A;  1C4Q A;  3ZJY C;  1PH1 A;  4ILW A;  2EYM A;  4F87 A;  1GJX A;  1AE2 A;  3S1N H;  4LW1 A;  3WDN A;  1H95 A;  1PYS B;  1G29 1;  4KHV A;  2R7D A;  2KEE A;  4GN3 B;  1N32 L;  1RTO A;  1YVC A;  1A62 A;  4IUV A;  1U5K A;  1XMO Q;  4FXG C;  1DM0 B;  2VW9 A;  5HUR A;  1SND A;  4A3J B;  3KLS X;  3HKS A;  2O2L D;  3T1H L;  4DV6 L;  1PRT C;  3Q8D A;  1NCV A;  3HOW H;  4DR4 L;  4AIM A;  3OMC A;  5C0X I;  4A3B H;  4KK7 A;  3B6Y A;  2V4D A;  1KNA A;  1K0R A;  1LUZ A;  2RHQ B;  4L5T A;  1QCB D;  1XMQ L;  1I4G A;  1K0S A;  1KAA A;  4ZKB B;  5J1Z A;  4L5R C;  1Q1E A;  3BVZ A;  1N33 Q;  4DV1 Q;  1Y14 B;  2H1E A;  4C2M H;  1BQQ T;  5LMN Q;  3NE5 B;  3PQI A;  4POF A;  1O78 A;  3IKJ A;  1ROD A;  1WTX A;  3SDZ A;  1YNN D;  2R92 G;  1CZG A;  2EPB A;  5E7N A;  3TZD A;  2F0U A;  2DY8 A;  1SYC A;  2L4N A;  4UP7 A;  4WRD A;  3CC7 A;  2XSC A;  2JEA I;  4G4K A;  4XQN A;  5LL6 X;  1EYG A;  1DD2 A;  4DK1 A;  2XIW A;  3U4Z A;  2C35 B;  2Z6K C;  3HOU H;  2UXB Q;  1A2U A;  3QB3 A;  4MN3 A;  1G91 A;  5IGE A;  1GO3 E;  4RGT A;  3EVQ A;  2A6E C;  4KKU A;  1DOL A;  1STY A;  3OPO A;  1NAP A;  4HR7 B;  1AZP A;  1HQM C;  2J7Z A;  4KHP Q;  1STB A;  5JJZ A;  4DV4 Q;  5C3E B;  2A6H C;  2MO0 A;  1K8M A;  2FXQ A;  2IWH A;  4UP9 A;  4DKA C;  2PQE A;  3I4N B;  1CKO A;  2Z9H A;  3J80 i;  1E2Z A;  4K2L A;  4C3H H;  4P73 A;  3PSI A;  4NXM Q;  2KA7 A;  1KDB A;  1SRU A;  4X64 Q;  1JE4 A;  1MJC A;  4JI7 Q;  3I72 A;  1HNW L;  1AP0 A;  5EJW A;  2A5H A;  5K36 H;  4QB4 A;  4Q5V A;  3HKZ E;  4RHS A;  2E75 C;  1BDO A;  5IGB A;  2GVA A;  4BBS B;  2R93 H;  1Q8I A;  1RD9 D;  3S16 B;  1PH2 A;  5FLM H;  2KQ3 A;  2EYH A;  3NEL A;  5CV9 A;  4MZ9 A;  4A3F G;  2VL6 A;  1BCP B;  2QEX A;  3DXJ C;  4O1N A;  1EIH A;  2NUC A;  1MBY A;  1ENF A;  5CMD A;  4HCE A;  1I6V C;  5FO7 B;  1X54 A;  2EZV A;  4OXP A;  4F7X A;  3NXW A;  1HA6 A;  3RZO H;  1IL8 A;  3A54 A;  2A69 D;  4J6H A;  1KHI A;  2L9H A;  3GP7 A;  4NP5 A;  1RL2 A;  2K1B A;  2O4X A;  1VQ8 A;  2HDM A;  1PZI D;  1QNK A;  4POG A;  3T1Y Q;  4EGV A;  3L0O A;  4C3J B;  3PIO 3;  3NEM A;  4QGU A;  1YIT A;  4DFA A;  5CBE E;  3BG3 A;  4LF5 Q;  2F4V Q;  5A2Q E;  1CKN B;  3T4A C;  2Y0S E;  2Y0S G;  3DMU A;  3W1G A;  5M5Y H;  4DV2 Q;  1HCZ A;  1DOM A;  1AN8 A;  2JE6 I;  3VDY A;  1B53 A;  4CJ1 B;  3Q24 A;  2E2J B;  3KBG A;  2KBN A;  1LTR D;  1AFP A;  5E1F A;  1JB7 A;  1BXT A;  3W2D A;  1YI2 A;  1EY8 A;  4LFA Q;  1EIG A;  3HKZ B;  1B4O A;  3QR8 A;  1X3F A;  4K5X A;  2JA7 B;  1A15 A;  3GO5 A;  2SEB D;  1EY9 A;  4H0L C;  3KDF B;  1B50 A;  2PQA B;  2EVB A;  1TU2 B;  1Y1W G;  1U4R A;  2BA0 A;  5G3L D;  3C3L A;  1LV9 A;  3U50 C;  4IAL A;  4KHZ A;  4DXG A;  2NZ1 D;  3KJO A;  3I8Z A;  3PO3 G;  1HHV A;  1G6Z A;  1JOR A;  4JI2 Q;  3OIQ A;  3S1M H;  5CV4 A;  3DWP A;  3MXN A;  4C1N I;  3EFX D;  5EGT A;  1SJH D;  5G3L F;  2KCN A;  2HCI A;  4XXE A;  5AJ3 L;  4DNT B;  4DR2 L;  2L11 A;  4BXX H;  3R3O A;  3PIP A;  4FO2 A;  1TQO A;  2I46 A;  3V2T A;  1ENA A;  1EIY B;  4Q0F A;  3M85 A;  1ESR A;  3STB D;  1Y8P B;  3HP3 A;  3ULJ A;  3N6R A;  1B1Z A;  4QY7 A;  5IWA Q;  3ULP A;  4A3J H;  3VR6 A;  2EE1 A;  5KND A;  3J81 j;  1H9S B;  4UP8 A;  3L9A X;  2B2U C;  3QOJ A;  3VR2 A;  3GTM B;  2XVS A;  4K5V A;  4UAI A;  2G9D A;  1JJC B;  3KBX A;  2PI2 E;  4L63 B;  4K0K L;  5H1S E;  3FPU B;  3M7G A;  2B2Y A;  1KDA A;  4DV0 Q;  1SSO A;  3BZK A;  1E2V A;  2B29 A;  3H3V C;  2YTX A;  4CBV A;  5IYD H;  3I55 A;  4X6A H;  5IGF A;  1XPO A;  2L0C A;  3CAM A;  5C4X B;  2RHS B;  3E5S A;  4R4I A;  3FPP A;  2ASB A;  1CT1 D;  4OHJ A;  3OWF A;  5IP9 H;  2I5H A;  4Z9C B;  3J80 c;  4JI6 L;  4LK1 C;  5GQO A;  2WFW A;  5EPK A;  2O5J C;  1U0L A;  2F0L A;  2RA4 A;  2F4I A;  1AEX A;  5M5X B;  3EIV A;  4JV5 Q;  1VDZ A;  3M7N A;  4OO1 H;  2K14 A;  5ELO A;  2RSO A;  5FLX L;  1BBU A;  5C3E H;  2PMZ E;  4JI0 Q;  4LUV A;  1X3P A;  5I9P A;  1LT3 D;  1EFI D;  1CKM A;  4DR6 Q;  1M8A A;  3I4N H;  2L15 A;  3GTP B;  1J8I A;  5J39 A;  1WTW A;  3GTK B;  4JI3 Q;  1J5E L;  1ICF B;  3C1F A;  2VQE Q;  3TDQ A;  3ICE A;  3Q0A A;  4BY1 G;  1MHW C;  1PVO A;  2K03 A;  4ZQ3 A;  5C5M A;  3KF6 A;  3PUY A;  1HR0 W;  3OHX C;  2D0P A;  3PUZ A;  3SGI A;  1TY2 A;  4C3I B;  4BBS H;  3J80 E;  4ALP A;  3S16 H;  1L1O A;  2D9U A;  1IBK L;  2WV6 D;  3A56 A;  2BA1 A;  4X62 L;  1H9K A;  1VQL A;  2F0O A;  3CF5 A;  2VNU D;  4H02 A;  3KYH C;  5C0X J;  4LFC Q;  3I7F A;  3CD6 A;  4CDE C;  2B8G A;  4LF9 L;  3SK5 A;  1XNR L;  3V05 A;  2X69 A;  4RKB A;  1PYB A;  3S1R B;  4JI5 Q;  1HFN A;  2VXW A;  4DAY B;  4JYA Q;  1V1O A;  1Z9F A;  4A3C H;  3H15 A;  2YU9 B;  4R4C A;  3K5L A;  1D6E C;  4DUZ Q;  4PV1 C;  1WCM G;  4JI4 L;  5KNC A;  3G4S A;  3UE1 A;  1P8L A;  1PTO B;  4C3J H;  1PH5 A;  2JP1 A;  3G71 A;  1NNX A;  4DV5 L;  3ONA B;  1UUP A;  1PZK D;  5FK9 C;  1SFO B;  2XRS D;  3U9O A;  3UDX A;  2IT1 A;  1B7Y B;  2E2J H;  3CPW A;  2BE5 C;  1I94 Q;  3TEH B;  5DM6 3;  2TMP A;  1K3R A;  3UDG A;  2PPB C;  1QNU A;  4YY3 Q;  3NQI A;  3H3V H;  2JA7 H;  1BCP D;  4JBJ A;  4NPS A;  3GD7 A;  2BCO A;  2DUD A;  2RVL A;  1X3Q A;  5EKK A;  5DM7 3;  3F1Z A;  3U58 A;  4JI8 Q;  4L8J A;  1SXT A;  1W6J A;  1TWA B;  1N36 L;  2MPM A;  4X66 Q;  1QIL A;  1H9R A;  1X56 A;  1DON A;  2F3V A;  1B8A A;  1GUS A;  4LF6 L;  2F03 A;  2Q8T A;  1Y1V B;  1BCP F;  4DN4 M;  4FYD A;  3VR5 A;  2PZW A;  3UI2 A;  1F2Y A;  3D3R A;  1EFW A;  2CQO A;  4OWX B;  1FVI A;  3NHH A;  2A68 D;  1I4X A;  1NJI C;  3PIP 3;  1C7Y A;  3T51 B;  2MHV A;  2NYZ D;  2AQ1 B;  4KI0 A;  3WOE A;  4UHV A;  3F2B A;  1FNW A;  2HCC A;  2AUJ D;  4P2C B;  2RCN A;  3J7Z C;  4GNX A;  1GUG A;  2F0J A;  3GQB A;  4QUC A;  1G2T A;  2EYF A;  3G48 A;  3GTG B;  2VUM B;  3I56 A;  5C0X G;  4KY7 A;  2C5C A;  4JBK A;  2CHB D;  3K8A A;  2HHH Q;  5IE8 A;  1MD2 D;  1PYW D;  1FL0 A;  1EYA A;  2XTI A;  5JEA G;  1U4L A;  1YHA A;  1EY5 A;  3Q22 A;  3GTM H;  4CJ2 C;  5KYI A;  4OX9 L;  3S14 B;  3CQZ B;  1K28 A;  1A63 A;  4TQU S;  2BDO A;  2PW7 A;  1HA5 A;  1RDP D;  1SE8 A;  3BDC A;  4AYB G;  3GTQ B;  4FXK C;  1SYG A;  3PCO B;  4DGZ A;  5C5L A;  3MZ5 A;  2JEB I;  4GN5 A;  1LTS D;  1ILQ A;  3MVV A;  3NK9 A;  5C4X H;  1S5B D;  1F9P A;  5KYL A;  2RDG A;  1HNX L;  3PUX A;  2JA5 B;  2N88 A;  2DNC A;  5A2Q L;  1IBL Q;  4IO9 A;  1I50 B;  1Q86 C;  5I6Y A;  4DA2 A;  5IYC H;  1EQR A;  2B2W A;  4HSV A;  1EIF A;  4X3U A;  1B2T A;  1ESF A;  4J15 A;  4B3S Q;  1VQ7 A;  5M5X H;  1N34 L;  1DGS A;  1OXT A;  1XX8 A;  1B44 D;  5CV5 A;  5EPL A;  1R4P B;  3I73 A;  3D4W A;  5M3M B;  3BZD B;  4GKK Q;  3GTP H;  3LWU A;  4DNR B;  2KHI A;  2OCE A;  3GTK H;  1XMO L;  1HR0 Q;  2E5L Q;  2HT1 A;  1WTO A;  3OTO Q;  3H0G B;  4A3I G;  4HN7 A;  3OYY A;  4B9W A;  2OTL A;  2R7Z G;  1SNM A;  4KJO A;  3D4D A;  3C2P A;  2I5L X;  4C3I H;  1MSH A;  1PMR A;  5FLX c;  3M4O B;  1SLJ A;  1N33 L;  1PH3 A;  2I07 B;  5LMN L;  1ZYR D;  1EY6 A;  1XPU A;  2CW0 D;  2B2V C;  1U9R A;  4DK3 C;  5EQ0 A;  4JBW A;  5C44 G;  5ELB A;  4GOP C;  3QIA A;  3HEJ A;  1BO0 A;  1SYD A;  3S1R H;  3KLR A;  3CW2 C;  1CFM A;  4IUU A;  2YU9 H;  1I4P A;  1RJT A;  1SNQ A;  1LLR D;  2A19 A;  2J0T D;  2VY3 A;  3BVG A;  2UUA Q;  4LMQ D;  2KHJ A;  1PTO H;  3QJY A;  3EA6 A;  2UXB L;  2OTJ A;  4EQO A;  1JMC A;  3VR3 A;  1FD7 D;  1XXG A;  4RGN A;  1VQ6 A;  1SFO H;  1VQF A;  1LO5 D;  4KHP L;  4DV4 L;  1J9O A;  3JAM L;  2BH8 A;  5FLX E;  3DEO A;  1Q8K A;  4A3E B;  3W3A A;  5I4D A;  1KAW A;  2FIN B;  4OIJ A;  4A93 B;  2E74 C;  1HXY D;  4BXX G;  2EY5 A;  4BY7 B;  1XJV A;  4NXM L;  1PH9 A;  3S1Q B;  4GKJ Q;  4X64 L;  1QJO A;  5D65 A;  3ZYY X;  3GTJ H;  3A74 A;  1SMX A;  1V9P A;  4JI7 L;  3G7L A;  5CV8 A;  1YZ6 A;  5BN5 A;  1IW7 D;  3OWE B;  3OMG A;  5M3F B;  4K8I A;  5I6W A;  3BU2 A;  4HIK A;  4X3T A;  3NBH A;  1D1K A;  1TWA H;  3MXP A;  4OEL B;  5AFW A;  2VQF Q;  3MA2 B;  2F0W A;  2EY1 A;  2IHE A;  1V1P B;  3KLW A;  3S9W A;  2JN4 A;  2JJQ A;  1HRJ A;  1Y1V H;  1H9M A;  3RR5 A;  2IX3 A;  3BDO A;  2XNA C;  3MHB A;  4IOC A;  2B8F A;  2L55 A;  4I7A A;  5FO8 B;  1PTO D;  3AEV A;  3MEF A;  2NTS A;  1PDQ A;  2N78 A;  3VA7 A;  3KK7 A;  1YNJ C;  5HY6 A;  3T1Y L;  5GAH C;  3TS2 A;  1PLF A;  4EVO A;  3K57 A;  4A3G G;  4LF5 L;  2F4V L;  3D31 A;  3K80 C;  3JAM i;  3GTG H;  3J80 L;  4DV2 L;  2VUM H;  3BVM A;  4A3D G;  1PTO F;  3KFU A;  3VR4 A;  4HMI A;  4YCV A;  2WB1 G;  2WB1 E;  2ZT9 C;  3W1B A;  1U4M A;  4JG2 A;  1M90 C;  4IQZ A;  2Q8I B;  3S24 A;  4LFA L;  2NN6 G;  3S14 H;  4YHH Q;  3CQZ H;  1ET9 A;  4QMG A;  1JOQ A;  1IZ6 A;  4JI1 Q;  1F77 A;  5I2X A;  5JJK A;  4RGO S;  5C4Z A;  4RGM A;  1SYF A;  2NVT B;  3MXG A;  2EY6 A;  2CFM A;  3GTQ H;  5FJ8 G;  4QF4 A;  2JA8 G;  1SMY C;  1CA6 A;  1Q46 A;  1TXY A;  1PFS A;  3EJI A;  2IW3 A;  1GHJ A;  5D14 A;  5LHY 1;  5COY A;  4HTH A;  1LT5 D;  1STE A;  4UY8 C;  1CTM A;  1QUQ B;  3ND9 A;  2JA5 H;  3SK4 A;  3BJU A;  5JOB A;  2RBM A;  1GXD C;  2SOB A;  1TS5 A;  3GV3 A;  1LAB A;  1I50 H;  4IPG A;  4IUP A;  4JI2 L;  3U9S A;  3M3Y B;  1K3B C;  2K75 A;  4DPG A;  1L0X B;  4IPC A;  4R4O A;  2EYJ A;  1XTD A;  5JPM C;  1GVP A;  3KOJ A;  2BOS A;  1VQK A;  1VQN A;  2B3G A;  4A3M G;  5M3M H;  2AQ2 B;  4NKL A;  3L3O C;  1TII D;  5KNB A;  1B70 B;  3E3X A;  3HGB A;  4DR7 Q;  4Y7N B;  3ERQ A;  5IWA L;  3H0G H;  3J7Y W;  5K5P A;  1D5M C;  3D6W A;  5D3I B;  2P5Z X;  1HQR D;  3OW2 A;  2Z4H A;  3PUW A;  2R92 B;  4XDX A;  5BR8 Q;  1VQ5 A;  5JJI A;  2ZJR A;  3KLS A;  3HOV G;  1F2M A;  1SAP A;  2VB2 X;  3AFP A;  4H13 C;  2RSN A;  4FF3 A;  2OQK A;  3CCJ A;  1YJW A;  4CKE A;  5T1G A;  3M4O H;  3M4Y A;  3RN5 A;  4YCW A;  2PNR C;  1Q7Y C;  3F8T A;  4DV0 L;  2DGY A;  2HDL A;  1ASY A;  4H44 C;  1O7Z A;  4RA8 A;  1Y69 U;  2MNA A;  3TP6 A;  3KF8 B;  4IPH A;  1YHQ A;  1D5Z C;  1IBM Q;  4XYO A;  5C6A A;  5FKA C;  1QG7 A;  4R4Q A;  1STA A;  3RN2 A;  4B08 A;  2UXC Q;  1L2F A;  4P72 A;  1DOK A;  1OXS C;  4LF8 Q;  4DR5 Q;  2ZTE A;  1RTN A;  2EIF A;  4IUQ A;  5LL6 S;  3S17 B;  1G2S A;  4MTN A;  1HTL D;  4JV5 L;  3HZX A;  4V19 0;  1I4H A;  3CCR A;  1H9J A;  4BBR G;  2ZJP A;  2KVM A;  2HIX A;  1STN A;  5BN3 A;  4JI0 L;  4A3E H;  4A93 H;  4DR6 L;  3T1H Q;  5KRU A;  4A3F B;  3GTO B;  2A74 C;  4JI3 L;  4KJN A;  4BY7 H;  2JA6 G;  2VQE L;  2AMC B;  3S1Q H;  1SEB D;  4EQ5 A;  4DR3 Q;  4DAV A;  3MFY A;  5JVH 3;  4PZ7 A;  2LMC B;  2ICI A;  4R8I A;  1GUT A;  5M3F H;  2AHO B;  2YTV A;  1TS2 A;  4O0A A;  4OL7 A;  3MXU A;  4KD4 A;  4CGY B;  2KEN A;  3TQY A;  1EQV A;  3LX0 A;  1J6Q A;  4IFD H;  3NEN A;  1R4Q B;  3JAM c;  1K8G A;  4PNY A;  1XNQ Q;  2M9V A;  1CKN A;  2R3Z A;  3AU7 A;  4FF4 A;  4L5S A;  4KTA A;  4FVM A;  3RZD B;  5EKL A;  4G57 A;  4LFC L;  1E7Z A;  1RIP A;  2L12 A;  3NWT A;  3R2I A;  2Y0S B;  1LTG D;  2D0O A;  1AH9 A;  1KNE A;  1PRT D;  4IJH A;  4JI5 L;  2DY7 A;  3RNU A;  3GV6 A;  5M5W B;  4DUZ L;  1GOZ A;  4DK6 C;  4DUY Q;  4IOA A;  1PZJ D;  2I0Q A;  3R93 A;  1D2B A;  1JOO A;  1ENC A;  3FDT A;  3KDF A;  1KDC A;  4N9P A;  1JOK A;  2PQA A;  3I4M G;  4NMZ A;  1VQJ A;  2KCC A;  4QL5 A;  1S5F D;  1PRT F;  3HOX G;  3QOL A;  1X55 A;  5IYB H;  2Q2H A;  3A8J E;  2IHF A;  4ZYS A;  3FVQ A;  1Y1W B;  2F3W A;  1FGB D;  4OO1 I;  3HOZ G;  1I94 L;  1CSQ A;  4NXN Q;  3JAM E;  1Y8O B;  3J7A V;  2OT2 A;  3PO3 B;  2PW5 A;  1I3Q B;  2K52 A;  1Q3L A;  2QDL A;  4YY3 L;  1CI3 M;  2UUC Q;  2NVT H;  5CGK A;  2E8G A;  1M4V A;  2CCZ A;  1IXR A;  2PYK A;  5BN4 A;  1Z6H A;  4PQX A;  1D5X C;  4JI8 L;  2A6E D;  2MUY A;  4LF7 Q;  1TWF B;  1YBY A;  3LGJ A;  3FKI G;  4EQN A;  2A6H D;  2J4X A;  5I2Y A;  4X66 L;  5LMU Q;  1SE4 A;  5EBD A;  2NB0 A;  1A3U A;  5KEE A;  2B63 G;  2E2D C;  4KN7 C;  3M3Y H;  1II3 A;  2BH2 A;  1A3T A;  3PO2 G;  1UE5 A;  1H9S A;  1ML0 D;  2A1A A;  2WKC A;  1WJJ A;  3E9H A;  4ID6 A;  5E3F A;  1TR5 A;  2A8V A;  4EX5 A;  2PCF B;  4DXF A;  4JVZ A;  2B2Y C;  3DWA A;  1UAP A;  1S4Z A;  1PH4 A;  2YYZ A;  1MI2 A;  2SNS A;  4Y7N H;  1SNC A;  1ICW A;  3SK6 A;  4Y52 H;  1QVG A;  2HHH L;  2QGQ A;  2K6A A;  1R9T B;  1SYB A;  3HOY G;  2R92 H;  1JB3 A;  1X6O A;  2WIN B;  1DYQ A;  2A73 B;  4A3K G;  4WJW A;  2MGS A;  1OXV A;  1TY0 A;  2GVB A;  3S2D B;  4I65 A;  4AQY Q;  3DM3 A;  2YTY A;  3I2Z A;  4IPD A;  1ZEQ X;  4A76 A;  3H3V I;  4XQJ A;  1ONL A;  1CA5 A;  5JPN C;  2Z8L A;  4DV3 L;  2BDN A;  4HJ8 A;  3ER0 A;  4YWK A;  2K5V A;  2PMZ B;  2IPK D;  1ET6 A;  1I5F A;  2KCT A;  2K5N A;  3OSO A;  3X3N A;  3S17 H;  1JWU D;  5AJ3 Q;  5ELN A;  4B3S L;  1RF2 D;  3FEW X;  1F9R A;  1QE6 A;  2PO4 A;  4H7B A;  1BF4 A;  1L1O C;  2F0G A;  5JJL A;  4TSS A;  2AWO A;  1PFM A;  4ME5 A;  2FHT A;  5IOC A;  1IYV A;  5E4X A;  1DZ1 A;  2F0V A;  3UDF A;  5GAD C;  2HQL A;  3G6J B;  4NDX A;  3VA5 A;  4GKK L;  3GTJ B;  1HNZ Q;  4A3F H;  2CWA A;  3GTO H;  2CQA A;  1HR0 L;  2ZXP A;  2E5L L;  4JOI A;  3J7A 5;  3OTO L;  1GKH A;  1Q12 A;  3R8B A;  1UE6 A;  4ZLT F;  1VF5 C;  2N3S A;  4P71 A;  4LF4 L;  3HOW G;  4A3B G;  1JCK B;  1D1I A;  2D62 A;  2PZT A;  2LXJ A;  5JVG 3;  2NWG A;  5HGT A;  3A8K E;  1VMC A;  2ZM6 Q;  3I3C A;  1E24 A;  5CC4 A;  5FO9 B;  1VQI A;  2K4K A;  1WCM B;  1KAB A;  1DJR D;  3RZD H;  1EY0 A;  2IX0 A;  4IUT A;  2ZJQ A;  1PV4 A;  2V1C C;  4X65 Q;  3TP8 A;  3OOC A;  3J81 E;  4HED A;  1KQS A;  3T56 B;  4TVA B;  1S40 A;  5M5W H;  1E0B A;  2KJX A;  1AZQ A;  2UUA L;  2XN9 C;  1I4Q A;  4RCO A;  5CR3 A;  3U4V A;  2G9H D;  3HOU G;  3G6E A;  1LT4 D;  1KRS A;  1FJG Q;  1KLU D;  3NQT A;  1EWH A;  1X3E A;  2B2T A;  4ABN A;  5EKI A;  2F0P A;  1Y1W H;  1IYJ B;  2N8N A;  1UNS A;  4L6T B;  4AYB E;  3FMC A;  4GN4 B;  1BNZ A;  4BA1 I;  3PO3 H;  4ZKC B;  3A7A B;  1I3Q H;  2NTT A;  2K01 A;  4C3H G;  4FF2 A;  4B3R Q;  1S5C D;  2KED A;  4GKJ L;  3TRZ A;  4GOP B;  1CSP A;  4R9W A;  3SEB A;  1SN8 A;  5IGC A;  1M1K C;  1STH A;  2YV5 A;  5K36 G;  4C56 C;  1NE3 A;  2NVX B;  1WVL A;  1Q81 C;  3P1H A;  3TRE A;  2R93 G;  1TWF H;  4GNX C;  5FLM G;  4QUF A;  3CCM A;  2VQF L;  1JR0 D;  4X3K A;  1UEA B;  1ZXT A;  4HJ7 A;  1W6K A;  3UE0 A;  4XIG S;  5CV6 A;  3K0X A;  3NSW A;  2LKV A;  3NUC A;  2WAC A;  1YNN C;  2B39 A;  2DJF C;  3CCV A;  1NSN S;  4K6L A;  5DLQ E;  1A6X A;  5M9O A;  1EUJ A;  1OXU A;  3IRB A;  2HUG A;  2ZXO A;  2F0S A;  3URY A;  3PV0 A;  1ASZ A;  4ME3 A;  4A3L H;  1DXM A;  1KL9 A;  4CKC A;  1CQF A;  1WFQ A;  3NTH A;  2K5H A;  4IUR A;  4PZ6 A;  4AYB B;  1TS4 A;  3RLN A;  3FP9 A;  2N49 A;  3E0J A;  2Q2I A;  5COR A;  2OF1 A;  1R9T H;  3DWQ A;  4OWW B;  2UXD Q;  2B2W C;  4DV1 L;  1QVF A;  4YHH L;  1STG A;  4XT3 B;  2QEJ C;  3MEH A;  4JI1 L;  1HZ9 A;  4LUZ A;  1JC7 A;  3L2P A;  3S2D H;  4ODG A;  2Q2T A;  4J1M A;  1JQY D;  1S5E D;  4R1J A;  2UUB Q;  1PH6 A;  1GUO A;  1TWG B;  1N8R C;  2K04 A;  4U67 3;  5C3X A;  1OXX K;  1EZ6 A;  1SDF A;  4MIU A;  2BE5 D;  1VQH A;  3J7A F;  1EOT A;  3K5M A;  2RCF A;  2O5I C;  4KLK A;  2WAQ E;  2WAQ G;  1F2Z A;  1NUC A;  1V43 A;  1HTP A;  3ERO A;  4QJF A;  2HIV A;  4DU9 A;  3SHL A;  4A3I B;  3CU7 A;  2F0K A;  4WJ4 A;  4HID A;  4BY1 H;  2R7Z B;  2A69 C;  4ZAI A;  2NZH A;  1I6H B;  3TN2 A;  4NB3 A;  1VQ9 A;  2QA4 A;  1E1O A;  2CWP A;  2E2I B;  2LXK A;  4GLX A;  4N9T A;  3RLF A;  5EAY A;  4DR7 L;  1NMF A;  1EWI A;  5IGD A;  4LWC A;  2EYL A;  3P20 A;  4N8X 1;  4A3J G;  4DV7 Q;  5GRO A;  3BYT B;  1JJ2 A;  3LWE A;  1VQP A;  3CME A;  5J3B A;  5BR8 L;  4QCL A;  1ILP A;  1VQD A;  5C44 B;  3S2H B;  4K8J A;  4RAU C;  4LFB Q;  1A3V A;  5IT9 L;  2Q8R E;  1OO9 B;  4ZUJ A;  2G5D A;  2EYO A;  2OEO A;  1E1T A;  3K7A B;  3CP0 A;  1XTC D;  1UEB A;  1WCM H;  3OIP A;  4K14 A;  3DLL A;  2NVQ B;  1VQ4 A;  3DM1 A;  5TSS A;  1SNP A;  1IBM L;  5IYD G;  2FMC A;  3VYS A;  1GM5 A;  2FMM A;  2I5M X;  3T13 A;  2LS0 1;  2F0D A;  3LNN A;  3M4P A;  5GAG C;  2UXC L;  4G7O C;  1WTP A;  1HUN A;  5IP9 G;  3HG9 A;  4LF8 L;  4CDF C;  4DR5 L;  1FR3 A;  1EOV A;  1VQO A;  4EQP A;  3NWS A;  3AB9 A;  3M9B A;  4RCN A;  4KY5 A;  1YIJ A;  3BZC A;  1EU3 A;  2EYP A;  4CHT B;  4B3T Q;  5CBA E;  4LUO A;  1QB5 D;  2KEC A;  3BYY B;  5C4J B;  1B9N A;  2D2C C;  4OO1 G;  2K5D A;  4FDB A;  1HPC A;  2Q2U A;  5C3E G;  2Z6K A;  1EEF D;  1QZH A;  4DR1 Q;  1V1P A;  2DJG C;  2Z0S A;  4P75 A;  3HRZ C;  3PF5 A;  2XWJ B;  3I4N G;  1K73 C;  2K5W A;  2EDG A;  3STB C;  4RKL A;  1K83 B;  1YJN A;  4DR3 L;  2MFI A;  2F1M A;  4MNO A;  2QW7 A;  3K6O A;  5KIX A;  5ELC A;  2NVX H;  2R61 A;  3RMH A;  4BBS G;  5EPJ A;  2VS1 A;  2E2H B;  1A2T A;  3VYR A;  1F9Q A;  3DUZ A;  3SR1 A;  1MGS A;  1XNQ L;  3TBI B;  3GTL B;  3MTS A;  1CK1 A;  2CVR A;  4A3G B;  3F2C A;  2SNM A;  2K5Q A;  4KD3 A;  4MTK A;  5DNF A;  1YHB A;  1KC8 C;  4HSP A;  3CC4 A;  4IJL A;  5C0X H;  4I7Z C;  4A3D B;  2F0F A;  2PZU A;  2QDB A;  1MKH A;  2WB1 B;  5JEA H;  2ES2 A;  4A3C G;  4DUY L;  2CH4 W;  2EJF C;  4PMW A;  4ZUI A;  4C3J G;  2QF7 A;  2WKD A;  4RH6 A;  4BWG B;  4KMU C;  1EY4 A;  1VF7 A;  3HFZ B;  3P75 A;  2JA8 B;  3CRK C;  1QUQ A;  4OON A;  1UE7 A;  3SXH A;  1ZKO A;  4DF7 A;  2UU9 Q;  1IL2 A;  3CC2 A;  1KXL A;  4NXN L;  1EYD A;  3E6Z X;  1N9W A;  3HKZ G;  4YIJ A;  1YJ9 A;  4GS3 A;  2KUM A;  2FJ2 A;  4JPB W;  2UUC L;  4B3M Q;  1BBW A;  1EWC A;  3MFG A;  2JA7 G;  1XPR A;  3J81 L;  2F52 A;  1L0Y B;  3PUV A;  1FNU A;  3PMF A;  3MAQ A;  4LF7 L;  2NBF A;  1K8O A;  4LAA A;  3EQL C;  1TWG H;  4F8M A;  4C1N K;  5LMU L;  2EY2 A;  3H09 A;  4A3M B;  2OXP A;  2H5X A;  1BOS A;  4L5Q A;  1PFN A;  1Q82 C;  1WYD A;  1SRO A;  2GA4 B;  2M00 A;  1N32 Q;  1TT2 A;  4IFD I;  1EQT A;  4DAM A;  2VB3 X;  3CRL C;  1XYI A;  1CHP D;  1FNV A;  5ELD A;  3F2D A;  4A3I H;  5IP7 H;  2OQ0 A;  3MXN B;  2R7Z H;  3CCQ A;  1SR3 A;  4FXD A;  4DV6 Q;  1I6H H;  4DR4 Q;  4YWM A;  1DCZ A;  2HD3 A;  3HOV B;  2MQH A;  4OIK A;  1EU4 A;  2K7V A;  1XMQ Q; 
#chains in the Genus database with same CATH homology
 4ULL A;  1NR4 A;  3KF8 A;  1KTK A;  4WFN 3;  2D5D A;  4B9X A;  1O7L A;  3N52 A;  3QWN A;  3WOF A;  1GHK A;  1U4P A;  1TKW B;  3H6M A;  5DEH A;  1F2L A;  3I90 A;  4IUN A;  2TSS A;  1IYU A;  2B2U A;  4KY6 A;  1YNJ D;  5JAV A;  3TP5 A;  1KLG D;  3I4L A;  1BCP C;  3K5O A;  1LTB D;  5NUC A;  4K6D A;  4BBR B;  4U68 A;  3K59 A;  4IN3 A;  1T5X D;  3ND8 A;  1E2W A;  3S15 B;  1C8C A;  3TSS A;  4JK1 C;  4HAE A;  2NVY B;  3TME A;  2JA6 B;  4K5W A;  4S3S A;  1SMY D;  2A68 C;  3T16 A;  4XT1 B;  1SYE A;  4CJ0 B;  1PXU A;  1T5E A;  2EOT A;  2X6G A;  2H4O A;  3K0Y A;  1FYC A;  3A8I E;  1NR2 A;  2L5T A;  1V8Q A;  5FOB B;  4KKT A;  1LTT D;  2ENB A;  2ICE C;  3NBI A;  3RUZ A;  4QIW B;  1IKM A;  2NN6 I;  4C3I G;  4HCS A;  1LTI D;  2ZXR A;  3A55 A;  2EJG C;  5IT9 E;  5IOD A;  1TS3 A;  2JSO A;  2QIL A;  3I4M B;  1TWC B;  4HMJ A;  2WP8 J;  3NPP A;  2QCP X;  2ID0 A;  1VMP A;  3D6C A;  3MWY W;  3HOX B;  3DHQ A;  2IL8 A;  1CZW A;  3HOZ B;  4K2K A;  1B3A A;  2Z4I A;  2KHS A;  4O42 A;  1CHQ D;  2NN6 H;  1LT6 D;  2FFK B;  4CKB A;  3L7Z C;  5J22 A;  1O80 A;  4KKS A;  2F0I A;  1RHP A;  5F2D A;  1EYC A;  1QWY A;  3A7L A;  3ITP A;  3FRP B;  3FKI B;  5ELE A;  2DNE A;  3X3M A;  1G8Z D;  3K5N A;  3CHB D;  2B63 B;  2K28 A;  3PO2 B;  4PMC A;  1HFG A;  4ZK9 B;  1AW7 A;  1XWE A;  3P7J A;  4GZY C;  4J8Q A;  2C9O A;  1CM9 A;  5JEA J;  3H91 A;  1EZ8 A;  4BY1 B;  1ZYR C;  3IAY A;  1RCV D;  2CW0 C;  4WOR A;  2QKI C;  1WD0 A;  5CV7 A;  1Y8N B;  3HOY B;  1C48 A;  2KOL A;  4E6I A;  4A3K B;  4F88 A;  3I70 A;  3AMU A;  5KGU A;  2F0M A;  4KN4 C;  4DAY A;  1Z7T A;  3QO2 A;  4PMB A;  4BS9 A;  2RQX A;  4LJZ C;  5EBC A;  1TWH B;  3QG1 A;  1WTQ A;  5IIF A;  3MC0 B;  3D8G A;  2XWB B;  3Q6S A;  5C4H A;  1SE2 A;  4ZRZ A;  1IW7 C;  3IFT A;  3OW7 A;  3S1N B;  1X32 A;  3R2T A;  1BUV T;  1SNO A;  3C1E A;  4RWS C;  3O13 A;  4FNF A;  1F9S A;  3IFD A;  2F0T A;  1SJE D;  3K58 A;  2AUK A;  2MP1 A;  4R8N A;  1PTO C;  2E76 C;  2F0Q A;  3HOW B;  4A3B B;  4DK0 A;  2Z1C A;  2LY7 A;  4RHR A;  2R6G A;  4IFD J;  1B9M A;  2LFN A;  2IJ0 A;  2K33 A;  3V96 A;  2AWN A;  4C2M B;  2SDF A;  3BDL A;  4X3S A;  1WTV A;  2XRQ D;  4NW2 A;  3NTK A;  2N55 A;  1TVX A;  1SBB B;  2HQE A;  4G7H C;  1S5D D;  4M1U B;  4RFB A;  2B2T C;  1IHZ A;  3HOU B;  2K32 A;  1WD1 A;  1CQV A;  3F2U A;  1MSG A;  2B2V A;  4IZ8 A;  1GUW A;  3TZU A;  1BBX C;  2M2L A;  3C46 A;  4DAP A;  2RDH A;  4V0B A;  4C3H B;  1PFB A;  2AQ3 B;  2WII B;  5E4W C;  2F0N A;  3CKI B;  2EXZ A;  2JXM B;  3IL8 A;  1O7Y A;  2R93 B;  1RKN A;  1SE3 A;  4UDU C;  1QOH A;  4FF1 A;  4XQQ A;  3VYU A;  3Q23 A;  3RZO B;  3NTI A;  3KUP A;  3RD4 A;  2EJM A;  4TRD A;  4XTC S;  1Q1B A;  5CYU A;  3DEP A;  3T53 B;  4G7Z C;  3SVM A;  1EEI D;  4IFD G;  2JYO A;  1JWS D;  1HUM A;  2IX1 A;  1IKL A;  1EY7 A;  1LAC A;  2K05 A;  2X6L A;  5C3W A;  5M5Y B;  1JWM D;  3SE0 A;  1PRT B;  1Q90 A;  1EL0 A;  1LTA D;  1Z47 A;  4OGQ C;  5T1I A;  5DAU A;  3D4R A;  3TP7 A;  2DN8 A;  3I91 A;  1JIC A;  3HS0 C;  2L1B A;  1GUN A;  4FP5 D;  2RKS A;  2MJ8 A;  3NP8 A;  4XYQ A;  1I4R A;  2F0H A;  5I9O A;  3H94 A;  5ISR A;  2RDF A;  1WTR A;  5D3D A;  3VYT A;  4MHE A;  4M8A A;  5ELF A;  5A35 A;  4BA2 I;  4TKO B;  3S1M B;  2WAQ B;  1VCI A;  5IGG A;  2F0E A;  3BS1 A;  1BR9 A;  3SK8 A;  4KV6 A;  1C4Q A;  4ILW A;  2EYM A;  4F87 A;  1GJX A;  3WDN A;  1G29 1;  4KHV A;  2KEE A;  1RTO A;  4IUV A;  4FXG C;  1DM0 B;  5HUR A;  1SND A;  4A3J B;  3KLS X;  2O2L D;  1PRT C;  1NCV A;  3OMC A;  5C0X I;  4KK7 A;  2V4D A;  1KNA A;  1QCB D;  1I4G A;  1KAA A;  4ZKB B;  5J1Z A;  1Q1E A;  3BVZ A;  2H1E A;  1BQQ T;  3NE5 B;  1O78 A;  3IKJ A;  1ROD A;  1WTX A;  3SDZ A;  1YNN D;  1CZG A;  2EPB A;  3TZD A;  2F0U A;  2DY8 A;  1SYC A;  2L4N A;  4WRD A;  2XSC A;  2JEA I;  4G4K A;  4XQN A;  5LL6 X;  1DD2 A;  4DK1 A;  2XIW A;  1A2U A;  3QB3 A;  4MN3 A;  1G91 A;  5IGE A;  4RGT A;  3EVQ A;  2A6E C;  4KKU A;  1DOL A;  1STY A;  3OPO A;  1NAP A;  4HR7 B;  1AZP A;  1HQM C;  2J7Z A;  1STB A;  5JJZ A;  5C3E B;  2A6H C;  1K8M A;  2IWH A;  2PQE A;  3I4N B;  1E2Z A;  4K2L A;  2KA7 A;  1KDB A;  1JE4 A;  3I72 A;  1AP0 A;  5EJW A;  2A5H A;  5K36 H;  4QB4 A;  4Q5V A;  4RHS A;  2E75 C;  1BDO A;  5IGB A;  4BBS B;  1Q8I A;  1RD9 D;  3S16 B;  2KQ3 A;  2EYH A;  5CV9 A;  1BCP B;  3DXJ C;  4O1N A;  1EIH A;  2NUC A;  1MBY A;  1ENF A;  5CMD A;  4HCE A;  1I6V C;  5FO7 B;  2EZV A;  4F7X A;  3NXW A;  1HA6 A;  1IL8 A;  3A54 A;  2A69 D;  4J6H A;  2L9H A;  3GP7 A;  4NP5 A;  2K1B A;  2O4X A;  2HDM A;  1PZI D;  1QNK A;  4EGV A;  4C3J B;  3PIO 3;  4DFA A;  5CBE E;  3BG3 A;  5A2Q E;  3T4A C;  3DMU A;  1HCZ A;  1DOM A;  1AN8 A;  2JE6 I;  1B53 A;  4CJ1 B;  3Q24 A;  2E2J B;  3KBG A;  1LTR D;  1AFP A;  5E1F A;  1BXT A;  3W2D A;  1EY8 A;  1EIG A;  3HKZ B;  1B4O A;  4K5X A;  2JA7 B;  1A15 A;  3GO5 A;  2SEB D;  1EY9 A;  4H0L C;  1B50 A;  2EVB A;  1TU2 B;  1U4R A;  2BA0 A;  5G3L D;  3C3L A;  1LV9 A;  4IAL A;  4KHZ A;  4DXG A;  2NZ1 D;  3I8Z A;  1HHV A;  1G6Z A;  1JOR A;  3OIQ A;  5CV4 A;  3DWP A;  3MXN A;  4C1N I;  3EFX D;  5EGT A;  1SJH D;  5G3L F;  2KCN A;  2HCI A;  4XXE A;  4DNT B;  2L11 A;  3R3O A;  4FO2 A;  1TQO A;  2I46 A;  3V2T A;  1ENA A;  4Q0F A;  3M85 A;  1ESR A;  1Y8P B;  3HP3 A;  3N6R A;  1B1Z A;  3VR6 A;  2EE1 A;  5KND A;  1H9S B;  3L9A X;  2B2U C;  3QOJ A;  3VR2 A;  3GTM B;  2XVS A;  4K5V A;  4UAI A;  2G9D A;  3KBX A;  4L63 B;  3FPU B;  3M7G A;  2B2Y A;  1KDA A;  1SSO A;  1E2V A;  3H3V C;  4CBV A;  5IGF A;  2L0C A;  5C4X B;  3E5S A;  3FPP A;  1CT1 D;  4OHJ A;  3OWF A;  4Z9C B;  4LK1 C;  5EPK A;  2O5J C;  2F0L A;  2RA4 A;  2F4I A;  1AEX A;  5M5X B;  1VDZ A;  3M7N A;  4OO1 H;  2RSO A;  5FLX L;  1X3P A;  5I9P A;  1LT3 D;  1EFI D;  1M8A A;  3GTP B;  1J8I A;  5J39 A;  1WTW A;  3GTK B;  3C1F A;  3TDQ A;  3Q0A A;  2K03 A;  4ZQ3 A;  5C5M A;  3PUY A;  3OHX C;  3PUZ A;  1TY2 A;  4C3I B;  3J80 E;  2D9U A;  2WV6 D;  3A56 A;  2BA1 A;  1H9K A;  2F0O A;  2VNU D;  5C0X J;  2B8G A;  3SK5 A;  3V05 A;  2X69 A;  4RKB A;  3S1R B;  1HFN A;  2VXW A;  1V1O A;  2YU9 B;  3K5L A;  1D6E C;  4PV1 C;  5KNC A;  1PTO B;  2JP1 A;  3ONA B;  1UUP A;  1PZK D;  5FK9 C;  1SFO B;  2XRS D;  3U9O A;  2IT1 A;  2BE5 C;  5DM6 3;  2TMP A;  2PPB C;  1QNU A;  3NQI A;  1BCP D;  3GD7 A;  2BCO A;  2RVL A;  1X3Q A;  5EKK A;  5DM7 3;  4L8J A;  1SXT A;  1W6J A;  1TWA B;  2MPM A;  1QIL A;  1H9R A;  1DON A;  2F3V A;  1GUS A;  2F03 A;  2Q8T A;  1Y1V B;  1BCP F;  4DN4 M;  4FYD A;  3VR5 A;  2PZW A;  3UI2 A;  1F2Y A;  3D3R A;  3NHH A;  2A68 D;  1I4X A;  3PIP 3;  3T51 B;  2MHV A;  2NYZ D;  2AQ1 B;  4KI0 A;  3WOE A;  1FNW A;  2HCC A;  2AUJ D;  4P2C B;  1GUG A;  2F0J A;  3GQB A;  4QUC A;  1G2T A;  2EYF A;  3GTG B;  2VUM B;  5C0X G;  4KY7 A;  2C5C A;  2CHB D;  1MD2 D;  1PYW D;  1EYA A;  5JEA G;  1U4L A;  1EY5 A;  3Q22 A;  4CJ2 C;  5KYI A;  3S14 B;  3CQZ B;  4TQU S;  2BDO A;  2PW7 A;  1HA5 A;  1RDP D;  3BDC A;  3GTQ B;  4FXK C;  1SYG A;  4DGZ A;  5C5L A;  3MZ5 A;  2JEB I;  1LTS D;  1ILQ A;  3MVV A;  3NK9 A;  1S5B D;  1F9P A;  5KYL A;  2RDG A;  3PUX A;  2JA5 B;  2N88 A;  2DNC A;  5A2Q L;  1I50 B;  5I6Y A;  4DA2 A;  2B2W A;  4HSV A;  4X3U A;  1B2T A;  1ESF A;  1OXT A;  1XX8 A;  1B44 D;  5CV5 A;  5EPL A;  1R4P B;  3I73 A;  3D4W A;  5M3M B;  3BZD B;  3LWU A;  4DNR B;  1WTO A;  3H0G B;  4HN7 A;  4B9W A;  1SNM A;  4KJO A;  3D4D A;  3C2P A;  1MSH A;  1PMR A;  3M4O B;  2I07 B;  1ZYR D;  1EY6 A;  2CW0 D;  2B2V C;  1U9R A;  5EQ0 A;  4JBW A;  5ELB A;  3QIA A;  3HEJ A;  1BO0 A;  1SYD A;  3KLR A;  1CFM A;  4IUU A;  1I4P A;  1RJT A;  1SNQ A;  1LLR D;  2J0T D;  3BVG A;  4LMQ D;  1PTO H;  3QJY A;  3EA6 A;  4EQO A;  3VR3 A;  1FD7 D;  1XXG A;  4RGN A;  1LO5 D;  1J9O A;  3JAM L;  5FLX E;  3DEO A;  4A3E B;  3W3A A;  5I4D A;  4A93 B;  2FIN B;  4OIJ A;  2E74 C;  1HXY D;  2EY5 A;  4BY7 B;  3S1Q B;  1QJO A;  5D65 A;  3ZYY X;  3G7L A;  5CV8 A;  5BN5 A;  1IW7 D;  3OWE B;  3OMG A;  5M3F B;  4K8I A;  5I6W A;  4X3T A;  3NBH A;  1D1K A;  3MXP A;  5AFW A;  3MA2 B;  2F0W A;  2EY1 A;  1V1P B;  3S9W A;  1HRJ A;  1H9M A;  2IX3 A;  3BDO A;  2XNA C;  3MHB A;  2B8F A;  2L55 A;  5FO8 B;  1PTO D;  2NTS A;  1PDQ A;  3VA7 A;  3KK7 A;  1YNJ C;  1PLF A;  4EVO A;  3K57 A;  3D31 A;  3J80 L;  3BVM A;  1PTO F;  3VR4 A;  4HMI A;  2ZT9 C;  1U4M A;  4IQZ A;  2Q8I B;  2NN6 G;  1ET9 A;  4QMG A;  1JOQ A;  1F77 A;  5I2X A;  4RGO S;  5C4Z A;  4RGM A;  1SYF A;  2NVT B;  3MXG A;  2EY6 A;  4QF4 A;  1SMY C;  1CA6 A;  3EJI A;  2IW3 A;  1GHJ A;  5D14 A;  5LHY 1;  5COY A;  4HTH A;  1LT5 D;  1STE A;  1CTM A;  3ND9 A;  3SK4 A;  5JOB A;  2RBM A;  1GXD C;  2SOB A;  1TS5 A;  3GV3 A;  1LAB A;  4IUP A;  3U9S A;  3M3Y B;  1L0X B;  2EYJ A;  5JPM C;  2BOS A;  2AQ2 B;  4NKL A;  3L3O C;  1TII D;  5KNB A;  3HGB A;  4Y7N B;  3ERQ A;  3J7Y W;  5K5P A;  1D5M C;  3D6W A;  5D3I B;  1HQR D;  2Z4H A;  3PUW A;  2R92 B;  4XDX A;  3KLS A;  1F2M A;  1SAP A;  2VB2 X;  4H13 C;  2RSN A;  4FF3 A;  4CKE A;  5T1G A;  3M4Y A;  2PNR C;  2HDL A;  4H44 C;  1O7Z A;  4RA8 A;  1Y69 U;  3TP6 A;  1D5Z C;  4XYO A;  5C6A A;  5FKA C;  1QG7 A;  1STA A;  4B08 A;  1DOK A;  1OXS C;  1RTN A;  4IUQ A;  5LL6 S;  3S17 B;  1G2S A;  1HTL D;  3HZX A;  4V19 0;  1I4H A;  1H9J A;  2KVM A;  1STN A;  5BN3 A;  5KRU A;  4A3F B;  3GTO B;  2A74 C;  4KJN A;  1SEB D;  4DAV A;  3MFY A;  5JVH 3;  2LMC B;  2ICI A;  4R8I A;  1GUT A;  1TS2 A;  4OL7 A;  3MXU A;  4KD4 A;  4CGY B;  1EQV A;  3LX0 A;  4IFD H;  1R4Q B;  4PNY A;  2M9V A;  3AU7 A;  2R3Z A;  4FF4 A;  4KTA A;  4FVM A;  3RZD B;  5EKL A;  4G57 A;  2L12 A;  3NWT A;  3R2I A;  2Y0S B;  1LTG D;  1KNE A;  1PRT D;  2DY7 A;  3GV6 A;  5M5W B;  1GOZ A;  1PZJ D;  3R93 A;  1D2B A;  1JOO A;  1ENC A;  3FDT A;  1KDC A;  4N9P A;  1JOK A;  4NMZ A;  2KCC A;  1S5F D;  1PRT F;  3QOL A;  3A8J E;  4ZYS A;  3FVQ A;  1Y1W B;  2F3W A;  1FGB D;  4OO1 I;  3JAM E;  1Y8O B;  3J7A V;  2OT2 A;  3PO3 B;  2PW5 A;  1I3Q B;  1Q3L A;  1CI3 M;  5CGK A;  1M4V A;  2PYK A;  5BN4 A;  1Z6H A;  4PQX A;  1D5X C;  2A6E D;  2MUY A;  1TWF B;  4EQN A;  2A6H D;  2J4X A;  5I2Y A;  1SE4 A;  5EBD A;  2NB0 A;  1A3U A;  5KEE A;  2E2D C;  4KN7 C;  1II3 A;  1A3T A;  1H9S A;  1ML0 D;  2WKC A;  4ID6 A;  5E3F A;  1TR5 A;  2PCF B;  4DXF A;  2B2Y C;  3DWA A;  1UAP A;  1S4Z A;  2YYZ A;  1MI2 A;  2SNS A;  1SNC A;  1ICW A;  3SK6 A;  2K6A A;  1R9T B;  1SYB A;  1JB3 A;  2WIN B;  1DYQ A;  2A73 B;  4WJW A;  2MGS A;  1OXV A;  1TY0 A;  3S2D B;  4I65 A;  1ZEQ X;  4XQJ A;  1ONL A;  1CA5 A;  5JPN C;  2Z8L A;  2BDN A;  2PMZ B;  2IPK D;  1ET6 A;  3OSO A;  3X3N A;  1JWU D;  1RF2 D;  3FEW X;  1F9R A;  1QE6 A;  2PO4 A;  4H7B A;  1BF4 A;  2F0G A;  4TSS A;  2AWO A;  1PFM A;  4ME5 A;  2FHT A;  5IOC A;  1IYV A;  5E4X A;  1DZ1 A;  2F0V A;  3G6J B;  4NDX A;  3VA5 A;  3GTJ B;  2CQA A;  2ZXP A;  1Q12 A;  3R8B A;  4ZLT F;  1VF5 C;  1JCK B;  1D1I A;  2D62 A;  2PZT A;  5JVG 3;  2NWG A;  5HGT A;  3A8K E;  1VMC A;  3I3C A;  5CC4 A;  5FO9 B;  1WCM B;  1KAB A;  1DJR D;  1EY0 A;  2IX0 A;  4IUT A;  3TP8 A;  3OOC A;  3J81 E;  4HED A;  3T56 B;  1E0B A;  2KJX A;  1AZQ A;  2XN9 C;  1I4Q A;  4RCO A;  5CR3 A;  2G9H D;  1LT4 D;  1KLU D;  3NQT A;  1EWH A;  4ABN A;  2B2T A;  5EKI A;  2F0P A;  1UNS A;  4L6T B;  3FMC A;  1BNZ A;  4BA1 I;  4ZKC B;  3A7A B;  2NTT A;  4C3H G;  2K01 A;  4FF2 A;  1S5C D;  2KED A;  3SEB A;  4R9W A;  5IGC A;  1STH A;  5K36 G;  4C56 C;  2NVX B;  1WVL A;  3P1H A;  4QUF A;  1JR0 D;  4X3K A;  1UEA B;  1ZXT A;  1W6K A;  4XIG S;  5CV6 A;  3NSW A;  2LKV A;  3NUC A;  2WAC A;  1YNN C;  2B39 A;  1NSN S;  4K6L A;  1A6X A;  5M9O A;  1OXU A;  2HUG A;  2ZXO A;  2F0S A;  3URY A;  3PV0 A;  1DXM A;  4CKC A;  1CQF A;  3NTH A;  4AYB B;  4IUR A;  1TS4 A;  3E0J A;  5COR A;  2OF1 A;  3DWQ A;  2B2W C;  1STG A;  4XT3 B;  2QEJ C;  3MEH A;  1JC7 A;  4ODG A;  4J1M A;  1JQY D;  1S5E D;  1GUO A;  1TWG B;  2K04 A;  4U67 3;  5C3X A;  1OXX K;  1EZ6 A;  1SDF A;  4MIU A;  2BE5 D;  3J7A F;  1EOT A;  3K5M A;  2O5I C;  1F2Z A;  1NUC A;  1V43 A;  1HTP A;  3ERO A;  4DU9 A;  3SHL A;  4A3I B;  3CU7 A;  2F0K A;  2R7Z B;  2A69 C;  4ZAI A;  1I6H B;  3TN2 A;  2E2I B;  4N9T A;  3RLF A;  5IGD A;  2EYL A;  3P20 A;  3BYT B;  3LWE A;  4QCL A;  1ILP A;  5C44 B;  3S2H B;  4K8J A;  4RAU C;  1A3V A;  5IT9 L;  2Q8R E;  1OO9 B;  4ZUJ A;  2EYO A;  2OEO A;  3K7A B;  1XTC D;  3OIP A;  4K14 A;  2NVQ B;  3DM1 A;  5TSS A;  1SNP A;  2FMC A;  3VYS A;  2FMM A;  3T13 A;  2LS0 1;  2F0D A;  3LNN A;  4G7O C;  1WTP A;  1HUN A;  3HG9 A;  1FR3 A;  4EQP A;  3NWS A;  3AB9 A;  4RCN A;  4KY5 A;  1EU3 A;  2EYP A;  4CHT B;  5CBA E;  1QB5 D;  2KEC A;  3BYY B;  5C4J B;  1B9N A;  2D2C C;  4OO1 G;  2K5D A;  1HPC A;  1EEF D;  1V1P A;  3HRZ C;  2XWJ B;  2K5W A;  2EDG A;  4RKL A;  1K83 B;  2F1M A;  3K6O A;  5KIX A;  5ELC A;  2R61 A;  3RMH A;  2E2H B;  5EPJ A;  1A2T A;  3VYR A;  1F9Q A;  3DUZ A;  3SR1 A;  1MGS A;  3TBI B;  3GTL B;  3MTS A;  1CK1 A;  2CVR A;  4A3G B;  2SNM A;  2K5Q A;  4KD3 A;  5DNF A;  4HSP A;  5C0X H;  4I7Z C;  4A3D B;  2F0F A;  2PZU A;  2QDB A;  2WB1 B;  5JEA H;  2EJF C;  4PMW A;  4ZUI A;  4C3J G;  2QF7 A;  2WKD A;  4RH6 A;  4BWG B;  4KMU C;  1EY4 A;  1VF7 A;  3P75 A;  2JA8 B;  3CRK C;  3SXH A;  1ZKO A;  4DF7 A;  1EYD A;  3E6Z X;  4YIJ A;  2KUM A;  2FJ2 A;  1EWC A;  3MFG A;  3J81 L;  1L0Y B;  3PUV A;  1FNU A;  3PMF A;  3MAQ A;  2NBF A;  1K8O A;  4LAA A;  3EQL C;  4F8M A;  4C1N K;  2EY2 A;  3H09 A;  4A3M B;  2OXP A;  1BOS A;  1PFN A;  2M00 A;  2GA4 B;  1TT2 A;  4IFD I;  1EQT A;  2VB3 X;  3CRL C;  1XYI A;  1CHP D;  1FNV A;  5ELD A;  4FXD A;  1DCZ A;  3HOV B;  4OIK A;  1EU4 A;  2K7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...