1BUVT

Crystal structure of the mt1-mmp-timp-2 complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
184
structure length
184
Chain Sequence
b'CSCSPVHPQQAFCNADIVIRAKAVNKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGGKKEYLIAGKAEGNGNMHITLCDFIVPWDTLSATQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (MEMBRANE-TYPE MATRIX METALLOPROTEINASE (CDMT1-MMP))
publication title Crystal structure of the complex formed by the membrane type 1-matrix metalloproteinase with the tissue inhibitor of metalloproteinases-2, the soluble progelatinase A receptor.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 31
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 1998-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1buvT02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 1buvT01
1D2BA 1JC7A 3HS0C 1OO9B 3G6JB 3OHXC 1BUVT 3V96A 1XWEA 3L3OC 5JPNC 5FO7B 2B39A 4ILWA 2A74C 2WINB 1PXUA 1UAPA 2I07B 1BQQT 5JPMC 2XWBB 3CU7A 1GXDC 2TMPA 2J0TD 3I70A 3MA2B 2XWJB 5FOBB 3KLSA 3CKIB 5FO9B 1JB3A 2ICEC 4FXKC 5FO8B 2WIIB 3FRPB 2A73B 2QKIC 4FXGC 3T4AC 2E2DC 1UEAB 1BR9A 3HRZC
chains in the Genus database with same CATH superfamily
1K8MA 1J9OA 1IW7D 1Z47A 1I4QA 3UDIA 5GADC 2EJMA 2AUJD 1MKHA 1KL9A 3J7YW 4OWTB 1XMQL 1N33Q 4BBSH 4Z9CB 4K5WA 1NSNS 1HPCA 2PW7A 1Y69U 1PV4A 4F7XA 1XNQQ 3HOVB 3MEHA 3BZDB 2L15A 3MWYW 5K36H 1LT4D 1B8AA 4GLAC 4HSPA 1YNND 4XYOA 2B29A 2WKCA 5LL6X 3BVMA 3HS0C 1EY0A 1RJTA 4ZK9B 4B9WA 1EY7A 4J1MA 2O2LD 4AYBG 1TS3A 1YJNA 2IJ0A 2JN4A 3T56B 1SN8A 3GO5A 1CUKA 1G8ZD 3T1YQ 1QCBD 1CHPD 3ER0A 3EBEA 4L6TB 4ZUIA 5FK9C 4QQBX 4K0KQ 1SE4A 1ZXTA 4CHTB 5M9OA 1EL0A 2AWNA 2BCOA 1RL2A 3G6EA 1AEXA 1I4PA 1STHA 4A76A 1YNJC 4DV3Q 3QR8A 2FHTA 1VQFA 3KF8A 3F2BA 1CK1A 4R1JA 3S17H 4IZ8A 1AE2A 3ITPA 3I7FA 1LM0A 1IKLA 3L0OA 1YNXA 4U673 1DXMA 4NKLA 1EQTA 4QMGA 3JAMi 1K8GA 4HIDA 3RD4A 4JV5Q 3TBIB 1J6QA 1HA5A 5D3IB 3AYHB 1SE8A 3AFQA 1CTMA 1VQNA 4A93G 5EKIA 5LMUL 2NN6I 4A3DG 4YWLA 3S1QB 4AQYQ 2IX0A 5FKAC 4CDCC 4JCVE 5M5YB 4OO1H 3U4ZA 2I46A 2WFWA 3RLFA 1SYDA 1FVIA 4LF4Q 1WYDA 1PTOH 2SEBD 1EQVA 2XGTA 3VA5A 4JI8Q 3HG9A 5JVG3 4MIUA 3WWVA 4IUNA 2KHSA 4K8IA 4NXML 2RF4A 1SNQA 4N9TA 3KFUA 1ONLA 1PRTB 3T1HL 4A3IH 4PZ6A 1F9PA 1SEBD 2PO4A 3CD6A 4RG1A 4X3TA 4A3KG 4XQNA 2XIWA 3M4OH 1C0AA 1TWFH 2F0VA 4FVMA 4V190 4A3JB 1IBLQ 1PRTD 5GQOA 4JI7Q 4DV7Q 2UUCL 4FF3A 3K8AA 2IW3A 5IT9L 1EOVA 2OEOA 4L5RC 1SSOA 2TMPA 2N55A 4L5QA 3A7AB 1F77A 2WIIB 3A74A 3PO3G 1TS5A 2Z6KA 1YVCA 3P1HA 1JQYD 2B2WC 2PZUA 4KD4A 2ES2A 2NWGA 4LF7Q 4N8FA 1GHKA 1SLJA 4JI0L 1S4ZA 3HOXH 3GTPB 2EZVA 2R3ZA 3VYUA 4X65Q 1XMOQ 2B39A 4BA2I 1NUCA 5IP7H 4JW0A 5E7NA 2K5QA 5IT9E 1MSHA 2E2IH 3M3YH 2F0LA 4DV4L 1WTRA 1TWAH 3I4NH 1Y1VG 5JJLA 1Y8NB 4LF8Q 5C0XG 4C3IH 4YHHL 3STBD 4GZYC 4UP8A 4IUQA 2UUBQ 1F2MA 2NB0A 4C3JH 1AZQA 3S14B 2F0SA 1E1OA 5D3DA 4DR6L 4MNOA 5IYBG 1EUJA 1QVGA 1VF5C 5KIXA 3K5NA 2JA5B 1SE2A 2PQAA 5C4HA 4LMQD 3RNUA 3PV0A 1A8VA 3FPPA 1QE6A 2KBNA 1U4MA 1YI2A 2HIXA 1WTPA 1G6PA 4DR7Q 3BYTB 4DR1L 1L1OC 3UI2A 3OTOQ 2KCTA 2F03A 2K6AA 3CP0A 5JVH3 4P73A 1JT8A 4A3MB 1EYAA 4RMFA 3I72A 4YCWA 5IE8A 1Q8IA 2EYPA 1IBKL 3VYSA 3OMCA 1ILQA 3H3VI 1JE5A 4AYBE 5AJ3L 4R4TA 4DK1A 2X6LA 4ZKBB 3I70A 1PZID 2E2HB 4WJ4A 1EYDA 3QWNA 1FNUA 3GTGH 2RCNA 2EPBA 1CHQD 2JE6I 5M3FG 1XNRL 4DUYL 2IX1A 5ELDA 3S1NB 2RKSA 3G4SA 4DUZQ 4BBRH 1GUNA 3D8GA 4IFDG 4ID6A 1DCZA 2H1EA 1XPRA 1BCPC 2R7ZH 3IKJA 2MUYA 1KRTA 1STBA 3FKIB 2VS1A 1GUWA 3T13A 2ZXPA 5IIFA 2JA7H 2M9VA 1Y1WG 3SHLA 1H95A 3FEWX 1RF2D 4RA8A 1SE3A 1I4RA 3J81c 3W2DA 3NE5B 3OW7A 4ULLA 3CC4A 1K83H 2PZWA 1LTID 5C3EH 1N34Q 4GNXB 1SNCA 3MC0B 3E9IA 2BA0A 3DWQA 4DV2Q 3GTKH 4CKCA 5CYUA 1BVSA 5DM73 2EXZA 1PYSB 5CV8A 2UUAL 3KLWA 2UXCQ 3CCSA 4DR3Q 3GD7A 1UEAB 4X3KA 1D1IA 4HJ7A 1D2BA 1N32Q 2YTVA 3MFGA 3MFYA 3U9OA 4K14A 1I4HA 2Z9HA 4C2MB 3RZOB 2MNAA 2R61A 2DY8A 3HOWH 4LF5Q 1QZHA 1O78A 2HIVA 4HJ9A 4BBSB 3G7LA 3QOLA 4IPDA 1U9RA 3W3AA 5JOBA 3TS2A 3F2DA 2VB2X 4TSSA 2N3SA 1NNXA 1Z6HA 1F9SA 1VCIA 2GN5A 3GTJH 4POGA 4KKTA 1GUOA 4K2LA 3FPUB 2I5HA 2DN8A 1EIYB 2JP1A 1Q3LA 3HOVH 3OWEB 1ENAA 4KN7C 5M5WB 2RDHA 1HZCA 1GUTA 1HHVA 2LKVA 4K5VA 4UDUC 1WOCA 5T1IA 2NTTA 1PH5A 1E3PA 4IJLA 5FO8B 4DGZA 4BXXG 1XXGA 2G5DA 2CH4A 3K57A 1RCVD 2D5DA 1YJWA 4TRDA 1Q1EA 1WTQA 4XT1B 1KQSA 4DV0L 2B2UA 4A3FG 2KJXA 1HNXQ 2ZTEA 2A69C 3L7ZC 2K50A 4LNQA 2NVQH 2D0PA 2F3IA 2EYHA 1QVFA 5ELNA 2VQFQ 3S17B 3I4MG 4QIWB 1X3QA 5J3BA 1BBXC 3K5MA 1LV9A 4MZ9A 4FXGC 5CV7A 1CKMA 1Q12A 3KK7A 4RKLA 3S2DB 4U68A 5IGGA 1E7ZA 4A3EH 4M1UB 5IGDA 5JJZA 2VQEL 5ELBA 4OO1I 1EIFA 1GXDC 5C4XH 1V8QA 4IOCA 4FXKC 4DAVA 2NN6H 1DOMA 5ISRA 3J81j 3CC7A 3MVVA 1EWCA 1PH1A 3TP6A 1L2FA 5TSSA 1VQAA 1XWEA 1RDPD 4HSVA 1PTOD 4DV5Q 1IYJB 1I6VC 3J81L 1IZ6A 4A3IB 1QUQB 3NQIA 2F0JA 5IYCG 1A6XA 5J22A 3M4OB 1TWFB 2L55A 1NE3A 4LAAA 4JI2Q 4P75A 2K14A 2KCMA 2F4VL 4FNFA 3FRPB 4X66Q 3DMUA 3NXWA 1SYEA 2JA8H 2VY3A 1Q46A 1YZ6A 3K81C 3H0GH 2CW0C 5G3LF 3A7LA 3G6JB 3OHXC 3VR5A 2GVBA 3J81E 1O7ZA 2DY7A 3NHHA 1VQ6A 3HOXB 2D2CC 3JAMc 1JWUD 2HQEA 3PUYA 4R4OA 4G57A 4P72A 4B3TQ 5IY0A 4K6DA 1ZEQX 1FNVA 4GLVB 1GHJA 2D62A 3NENA 3MXNA 3M9BA 5LHY1 3K5LA 2KHIA 3PCOB 2N88A 3S16H 2E2IB 3GTPH 2QCPX 2ZM6Q 1CZWA 1QB5D 2EOTA 1VQJA 2RHSB 3S9WA 1T5XD 3CQZB 2QDLA 1TWAB 1I3QH 3I4NB 1A3VA 5IGEA 4C3IB 2BE5C 4FDBA 1I4XA 1F2YA 2MO1A 1LLRD 3VR3A 4KK7A 4PZ7A 5IYDG 4HJ8A 2KQ3A 4IPGA 2PNRC 3KBXA 5LL6S 1J5EL 2CWAA 4CDFC 1V43A 1CSQA 5C4JH 1YHBA 2RBMA 2ZTDA 5AFWA 1JB7A 1VQDA 3CCQA 1WFQA 3M4PA 3NELA 1ENFA 1EY4A 2R7FA 5BN4A 3BVGA 3KJOA 1MJEA 1BNZA 1YHAA 1BXTA 3DHQA 3CMAA 1GO3E 2WACA 4JI3Q 5FLMH 1B3AA 4RCNA 1DZ1A 5M5XB 3CPFA 2Z6KC 4QCLA 1YEZA 4PV1C 5BR8L 4A3CG 2K75A 1QNUA 4LF9L 1SBBB 4C1NI 2Y0SE 4R8IA 2HCCA 2EQSA 5CV6A 3EROA 4ZAIA 2OQ0A 4RAUC 3PF4A 3VYTA 4RGTA 4RFBA 2L0CA 2VXWA 4Q0FA 2QEJC 2MO0A 1TY0A 3ERSX 1HTLD 1NTGA 4IUVA 1ESFA 3ULLA 4A3BG 3DWPA 5E4WC 4RKBA 1B4OA 1PLFA 3Q22A 4LFAL 5I2YA 1IL2A 2E76C 3IFTA 3VDYA 1HH2P 2JA5G 1BR9A 3EA6A 4HEDA 1I50H 1TIID 3F2UA 2Z4IA 4UPAA 4JI1Q 2KENA 2HD3A 1D6EC 3EN2A 2KECA 4R4IA 4HJ5A 1KDBA 4HN7A 3FKIH 2SNSA 1IBMQ 1K83B 1AW7A 5C3EB 1SNDA 4A3MG 1PFSA 5KNCA 2ICEC 4KY5A 3GTKB 4GOPB 3EQLC 2R93G 1BCPF 1EIGA 4JYAL 2QGQA 5DLQE 2DGYA 2JJQA 1UEBA 4PMCA 2ICIA 5I2XA 2OXPA 3P75A 1CSPA 4X62Q 1PXUA 2H5XA 4B3MQ 1PFNA 3K58A 4EQOA 1ESRA 2QF7A 2NVTB 1KLUD 4DR5L 1EWIA 3JAML 3ICEA 5CV5A 4GKKL 4NMZA 1HR0W 2B2VA 1RODA 1IXRA 1EY5A 3HOWB 5D65A 3R2TA 1VS0A 2YYZA 4C2MH 5KEEA 1GKHA 1SXTA 2F4IA 1TQOA 3MTSA 4UY8C 3B6YA 4GN3B 3O13A 4KJOA 1WTXA 3HKZB 2N49A 1C8CA 2F0GA 1H9MA 4RGNA 4XYQA 1U4LA 2YU9H 3GTJB 2LY7A 4RHSA 3JAME 4X64L 2F0DA 1WTOA 3DM3A 1Q8KA 4JI5Q 3K5OA 1TXYA 3NTIA 1SAPA 4B3RL 3MXPA 2DNEA 1MD2D 2O5IC 3J7AF 1D5ZC 3I8ZA 1BBUA 1WD0A 3S15H 4DR4L 1K8AC 3KLRA 1SNMA 4RCOA 1OO9B 1HR0L 1XYIA 2PQEA 2ZJRA 4C3HB 1IW7C 1EY6A 2MP1A 3OMGA 3VR4A 3A8JE 4N8X1 5M5WH 1VQKA 3NBHB 4R8NA 2SOBA 1X3PA 1V1PB 3H09A 1OXUA 3KJPA 4G7ZC 1Q90A 2PMZB 3D3RA 3PUZA 4DV6Q 4B3SQ 2E75C 1PH8A 4OX9Q 2HT1A 1U0LA 1UWVA 4ME3A 1TWCH 1LTLA 3DXJC 3K0XA 3KOJA 4ODGA 4F88A 3M4QA 2NVQB 3T16A 3KF6A 2I5LX 5H1SE 5LMNW 3HOZH 3TQYA 3QIAA 2K05A 1F2ZA 1O7YA 2D9UA 3IAYA 4BBSG 4CJ2C 1LTSD 1II3A 2IWHA 3TP7A 3URYA 4WFN3 1VQHA 1SYGA 2K32A 3H91A 1X54A 5JAVA 4IQZA 1SMYC 1SJHD 2F0QA 5K36G 2YTXA 3DUZA 4JOIC 4IURA 1S5CD 2UXBQ 4A3EB 4MTNA 1K28A 2NZ1D 4JBMA 1R4QB 2UU9Q 2L1BA 2O4XA 1GUGA 5C4XB 1ENCA 4O1NA 2F0TA 3MXGA 5GAEC 1CM9A 1V1QA 1N8RC 3S2DH 2XRQD 2PZTA 4HAEA 1A2UA 1YHQA 5C44G 1Q81C 5I6WA 3CXCA 4KTAA 5FJ8H 5K5PA 4A3KH 4NXNL 2WAQG 5LMNL 2AHOB 4ZLTF 2IHEA 1QILA 3IL8A 3KDFA 4A4IA 5IWAL 3AQQA 3HOYB 1AP0A 2NTSA 2B2TA 2IPKD 4E6IA 4IUUA 2HHHQ 3CHBD 5EQ0A 2B2UC 1GVPA 1HZBA 3GTLH 1X9NA 4YWMA 4JBWA 4DAYA 1WD1A 2ID0A 2JA8B 1T9HA 4EQNA 4DV1L 3H0GB 2K28A 2A74C 1IKMA 2UXDQ 4HTHA 1MI2A 1LT6D 2OWOA 2RDGA 4KHVA 3TRZA 3OOCA 4MTKA 3C3LA 3PGZA 1K8OA 3E9HA 1A63A 1VQCA 2F1MA 4DXGA 2B2YA 1S40A 1IL8A 3MEFA 3PQIA 4OHJA 2M00A 4OO1G 3S16B 1VF7A 3HOUH 2J7ZA 3GTQH 2F0WA 3EJIA 1XMQQ 1I3QB 1KTKA 1M1KC 1B70B 4H13C 3GP7A 5EKLA 2PI2E 3RN5A 4R4QA 2HQLA 2I07B 3SXHA 1EYGA 1O80A 5E1FA 3J80i 5M3MH 1JWSD 3KBGA 3CQZH 3K0YA 1JB3A 5C3XA 3CCMA 2A73B 2QKIC 1C48A 1CKNB 4A3IG 1UE7A 5C4JB 1SFOH 1MSGA 4KLKA 4A3GG 4JI6L 2AQ2B 1L1OB 1AFPA 1U4RA 4J6HA 1UAPA 3J7ZC 5HGQA 3CCLA 2EJGC 1SDFA 2QEXA 2B63G 1K73C 4DK0A 2RVLA 1J8IA 3SR1A 5C5LA 5DEHA 4S3SA 2NZOA 3QJYA 3STBC 1STGA 1S72A 3NP8A 1IYUA 3EVQA 1IYVA 1B9MA 5IODA 5IP7G 1C9OA 5M5XH 3VYRA 2WINB 1VQIA 2PW5A 4F87A 1AE3A 3I4NG 1EOTA 1LTBD 3SDZA 4IOAA 4C3IG 3PMFA 1HA6A 1ET9A 4RGOS 2B3GA 4C3JG 1BCPB 5IP9H 5LMUQ 4JI4L 1R4PB 3Q24A 3S24A 3NBIA 3K7UC 4J15A 3VR2A 1HFGA 3CAMA 2EY5A 3CCUA 2A6HC 3RUZA 4HR7B 5C6AA 1L0XB 4EQ5A 1KNEA 4Y7NH 1I50B 4AH6A 1CA6A 2L12A 2EY6A 2VNUD 2KVMA 1VQOA 4M8AA 3CMEA 4NXMQ 4KV6A 3BS1A 1OXTA 3T1HQ 4XQQA 2Z4HA 1LO5D 3OW2A 1L0YB 3SEBA 5CV9A 1LTRD 1QZGA 2UUCQ 1DD2A 5CV4A 2Z8LA 2J0TD 5FOBB 2C9OA 5GAGC 2KCCA 2VUMG 3EIVA 2WAQE 2RCFA 2A68C 4QY7A 3SK6A 2O5JC 4K5XA 4JI0Q 3U58A 1STEA 4BBRG 4FF2A 3DEOA 1GD7A 1CKOA 3CF5A 2NBFA 2NVTH 4WJ3M 4GKJL 1RTOA 2F0PA 1ILPA 1FJGL 2GA4B 1A0IA 2ZTCA 2C5CA 2R7ZG 2G9DA 2K5WA 4POFA 1DONA 3E0EA 2MGSA 2KOLA 3E5SA 1JE4A 4O0AA 4DV4Q 4J8QA 2JA7G 4AYBB 2YU9B 2VW9A 4YHHQ 1ICFB 4CGYB 1D7QA 2V1CC 3NTKA 4APVA 3H15A 3C2PA 3ZJYC 2NVYB 1EYCA 3NUCA 4ZRZA 2B8FA 4DR6Q 3PUVA 1UE1A 2V4DA 2SDFA 4DNTB 4IO9A 3UE0A 1OXXK 3S15B 1TU2B 5BN5A 1X3FA 1TWHB 4L5SA 4FP5D 1JJ2A 3NPPA 2GVAA 2Y0SG 3OWFA 3PO2H 3ULPA 1EFWA 2KUMA 2XWJB 3D6CA 1R9TB 5IOCA 1U5KA 3OSOA 3I4MH 2FXQA 4DR1Q 1HCZA 1TY2A 4KY6A 4C3HH 1N36L 1S3OA 4DAPA 2WB1B 1TWCB 1WJJA 4YCUA 4HIOA 4A3LG 2EYJA 1LACA 1F2LA 1Y14B 3I91A 3HOWG 3HOZB 2ENBA 3OIQA 4A93B 1IBKQ 3LNNA 2B2VC 1E2WA 4BY7H 4BA1I 5AJ3Q 1WCMH 4DXFA 2AKWB 3D31A 4XT3B 4KHZA 3CCRA 1BBWA 4I65A 4QL5A 1Y8PB 5IGBA 2DNCA 4LFCL 4LFBL 3W1GA 5KNDA 2F0EA 1NMFA 2A6ED 1JC7A 2X69A 1XNRQ 4DUYQ 1EU4A 1KLGD 3HOVG 4NPSA 2EJFC 5CR3A 4DR2L 2RDFA 1F9RA 1P8LA 3BZCA 5NUCA 5JPMC 2R92H 5JEAH 2FFKB 3I73A 4A3KB 2ASBA 1CQVA 3CPWA 2EYMA 1X6OA 4XTCS 2VB3X 4DPGA 2E2JB 1HNWL 1S5DD 5COYA 1ICWA 2A19A 2CWPA 1DJRD 5T1GA 1VDZA 3TMEA 3PO3B 4ZQ3A 2F0MA 3GTLB 3CW2C 3HOYH 3KF8B 1W3SA 1D5XC 2K7VA 1HJPA 4YY3L 4DKAC 2UUAQ 1K0RA 2SNMA 2PCFB 3T53B 3W1BA 4NB3A 3I2ZA 4FF1A 3E3XA 1Y1VB 2NYZD 5C0XI 4KHPL 1VMCA 1WTHA 2E5LL 1SRUA 1PTOC 2PYKA 2E8GA 3RZDB 4BY1H 1H9RA 1Q82C 3HOUB 2F3WA 4LK1C 5C4XG 3R2IA 3GTQB 2XWBB 3PIOA 1UNSA 4CKEA 1NCVA 3AEVA 1G91A 2NN6G 2EXDA 4B08A 1FD7D 3P7JA 4LF6L 2VL6A 4HMJA 1VQGA 5EBDA 3BJUA 3L9AX 3BG3A 5M3MB 1KDAA 3MZ5A 1QG7A 2RSOA 3IRBA 1GM5A 1KHIA 5EPJA 3V05A 1HNZL 1AN8A 1SFOB 3KUPA 5EPLA 5DAUA 3TREA 4L5TA 2XTIA 3PIPA 1G291 4DF7A 2JA8G 1DOLA 1HZ9A 1SYCA 3A56A 3H0GG 2TSSA 4KKUA 2I5MX 3HRZC 4A3JG 2JSOA 2YTYA 4K2KA 4DV0Q 4FYDA 2Z0SA 1VQLA 4OL7A 3TZUA 4CJ0B 1FYCA 4GN4B 5C4ZA 2OQKA 2PI2A 4C1NK 4EGVA 2CCZA 5DNFA 1SR3A 2B2YC 4OEMB 4G7OC 1HQRD 1XNQL 2CQAA 2NZHA 3TSSA 1F9QA 3A8KE 3A54A 4IFDI 3Q6SA 1L0WA 3TZDA 5I9OA 1SNOA 4ZCKA 5J39A 1KDCA 1EEFD 2VZAA 3J81i 5IGFA 3J80c 4ILWA 1K3BC 1VQ8A 4QUFA 2OF1A 3K80C 2VQEQ 1STAA 5D14A 3W5OA 3CCVA 3T1YL 1FR3A 2PQAB 4Y7NB 2XRSD 4K0KL 5I6YA 4PNYA 1VQ5A 2E2DC 1Y8OB 1D8LA 2FINB 4IALA 2JA6H 3C1FA 3Q0AA 4DV3L 1FNWA 1TS2A 4QJFA 3E6ZX 3HKZE 5CC4A 4GNXA 5FLMG 2JA9A 4HCEA 2F0FA 4YCVA 1MGSA 4NDXA 3ULJA 4HJAA 2LFNA 1A3UA 4TQUS 3GQBA 1LTGD 3TDQA 3I3CA 1Q86C 2XVSA 2F4VQ 2ZJQA 4QB4A 4G4KA 4JV5L 4DK6C 1ZYRD 1E2ZA 4HMIA 2JEAI 2K03A 1S5BD 3FMCA 5HGTA 4I7AA 1SJED 2R7DA 2MHVA 4AQYL 3CC2A 1LT3D 3TP8A 5FO7B 3JC66 4YIJA 2PMZE 3WOEA 3OYYA 2CFMA 4LF4L 1O7IA 3MAQA 1CZGA 3RMHA 4F8MA 3Q23A 3HGBA 1G6ZA 4JI8L 3KLSA 4OWWB 2EVBA 2FMMA 2QDBA 3F2CA 3GTMH 4QF4A 2KCNA 1PH3A 1NAPA 4CBVA 3H94A 3M85A 2ALYB 3S1MH 2Q2UA 3GTOB 1TWGB 1I5FA 1A2TA 3S2HB 3FKIG 5E4XA 3QG1A 1IBLL 1J5EQ 2WKDA 4PMWA 4DV7L 1CT1D 1AH9A 4A3FB 3IFDA 2NVYH 4OIJA 1XJVA 1PMRA 3PSIA 1HRJA 1YJ9A 4LF7L 3PO2B 1H9KA 1OXVA 1B2TA 3NK9A 3I4MB 1STYA 1LT5D 1TWHH 1UE5A 4X65L 1KABA 1XMOL 4ME5A 1R9TH 2K4KA 1BQQT 1XPUA 2OT2A 2NUCA 1PH2A 3AMUA 5BR8Q 3HZXA 4LF8L 3MXUA 2AUKA 4LF9Q 4BY7B 3SGIA 1WCMB 1XPOA 1YNJD 3RLOA 1YNNC 4KMUC 2UUBL 5I4DA 1PZJD 3SK8A 3K6OA 1C7YA 2E74C 4A93H 4A3DH 5C44H 2L4NA 3KYHC 3QOJA 1PH9A 1B44D 1SMYD 2NVXH 1EWHA 1PHJA 5CBAE 1KAWA 3SK5A 3DEPA 1W2BA 4I7ZC 4YWKA 1RHPA 3J80L 1CA5A 1ASYA 2BOSA 4GS3A 4LFAQ 2Q8TA 2R92B 3CCJA 4DR7L 3ZYYX 2JYOA 2LSSA 3OTOL 5KYIA 4JBJA 2CQOA 1B50A 2H4OA 3I4OA 1NY4A 1QUQA 1ZKOA 5C3WA 5KGUA 2F0UA 4P71A 3J80E 2WB1G 1SYFA 1DM0B 1U4PA 5G3LD 2HUGA 2E2JH 2IY5B 2L5TA 1E1TA 3GDEA 3HOZG 1BKBA 1KRSA 4UP9A 4KD3A 4JYAQ 3DWAA 3PO3H 2EDGA 2QA4A 2IX3A 1M90C 1B1ZA 2K01A 2XNAC 2RQXA 4DUZL 2MQHA 3NEMA 2DJFC 3A5ZB 2F0NA 3BDLA 4XXEA 2K5VA 2K5HA 2ZT9C 2J4XA 5ELCA 1YBYA 1JCKB 4DR5Q 4JVZA 4GKKQ 1FGBD 4BY1B 1X3GA 2LXKA 3CRKC 1Y1VH 2EE1A 3U9SA 5BN3A 5C0XH 4ZKCB 4PZ8A 1W6JA 3ND9A 4LW1A 5FJ8G 3RZDH 4X3SA 5I9PA 1UUPA 1JR0D 5DM63 1QVCA 4A3GH 2EYFA 3LX0A 3A0JA 2EY1A 5IYBH 1N34L 2D0OA 1I4GA 3UDFA 3X3NA 4DV2L 1C4QA 4L8JA 4WJWA 4X64Q 1QNKA 1PRTC 1RD9D 4NP5A 4B3RQ 4X3UA 1A3TA 1PTOF 3AU7A 2B63H 3BVZA 2AQ1B 4ZUJA 2UXCL 1MHWC 4DR3L 4DR4Q 1RIPA 3P20A 3NWSA 2M2LA 5A2QL 1HTPA 1HR0Q 1N32L 4XQJA 5JEAJ 1PYWD 3SVMA 5C5MA 1JORA 1JMCA 3HEJA 1E0BA 5CGKA 4LF5L 1MIUA 2MPMA 4ABNA 5KYLA 2N8NA 3KLSX 3ND8A 1BDOA 3MXNB 1JICA 1CFMA 1JOKA 1X65A 3HOXG 3HOUG 5A2QE 2EY2A 1JWMD 1I6HH 4H0LC 3UDXA 1A62A 4A3BB 4K6LA 2QW7A 2LMCB 3G71A 3L3OC 5M3FH 1EZ6A 2BDNA 1Q7YC 4JG2A 4X6AH 3N6RA 1PH7A 1NR2A 5M3MG 1VMPA 2JXMB 3CRLC 3CU7A 4LUZA 4IFDH 1M4VA 3MA2B 5EKKA 3NQTA 4KN4C 5EGTA 2FMCA 1HXYD 3R8BA 1GJXA 4Q5VA 1WVLA 1MBYA 1KC8C 2L11A 5F2DA 3R93A 4BS9A 1JOOA 4LUOA 3TEHB 3WDNA 2A6HD 1Y1WH 1EFID 2BH2A 1B7YB 1NBWA 5EAYA 1HUMA 4KJNA 3BDCA 2ATWA 1GUSA 1HNXL 4NXNQ 5LMNQ 1Z7TA 2JA6B 2DUDA 2R93B 1BCPD 4RH6A 4DA2A 5IWAQ 1PDQA 3H6MA 2VQFL 1OXSC 5IGCA 2CHBD 1X56A 5A35A 4GOPA 4CKBA 3J7A5 3BU2A 3A55A 2VUMH 1ML0D 4JPBW 5HURA 3U4VA 4KY7A 3D0FA 4GLXA 4KKSA 2XN9C 2XSCA 3R3OA 1BUVT 5CMDA 1S5ED 3H3VC 1PH4A 1VQMA 4IPCA 4DV1Q 5EJWA 1ASZA 3OIPA 2JQOA 1S5FD 1KD1C 5JJKA 3S1RH 3A8IE 1X3EA 2ZXRA 2A68D 2OCEA 3K59A 1PZKD 1TVXA 1JJCB 2FJ2A 3HKSA 5IP9G 2WB1E 2Z6BA 2K04A 2A8VA 2Q8RE 1GOZA 4DNIA 1BOSA 1FL0A 3GTMB 3EFXD 4DV5L 3AB9A 1QWYA 1H9SB 2LXJA 4V0BA 3S1MB 4O42A 4WORA 3TP5A 4OXPA 1LABA 4OIKA 4P74A 4XDXA 3PF5A 4JI2L 3ERQA 4QIWE 2K5NA 2L9HA 2QILA 3NSWA 2Q8IB 1Z9FA 3F8TA 4OELB 5FLXc 4X66L 3M7GA 3K7AB 3GTOH 1TWGH 2IL8A 2Q2TA 4BXXH 3S2HH 4GNXC 1EQRA 3I55A 2WV6D 1UE6A 1WI5A 1H9JA 4IJHA 3CCEA 4JI6Q 2RSNA 3NBHA 5C3EG 1V9PA 4A3LH 1MJCA 1V1PA 1KXLA 4C56C 4A75A 4A3FH 4RHRA 4JK1C 2Z1CA 1T5EA 4B3TL 1Q1BA 1JOQA 2F0OA 3CKIB 2K33A 2CVRA 4JOIA 2ZM6L 3BYYB 4UP7A 1YITA 1EQQA 4OGQC 2OTLA 2F0KA 3C46A 1HQMC 2EIFA 4OONA 2A69D 1PFMA 4N9PA 3SE0A 1P16A 1TKWB 3NWTA 4G7HC 2KHJA 4A3DB 5C44B 3AFPA 2NVXB 4K8JA 2RHQB 1PH6A 5JJIA 1WTVA 2A1AA 3FP9A 2OTJA 1CQFA 2WAQB 4HCSA 1EY9A 4MN3A 3HKZG 4Y52H 4JI4Q 1G51A 5KNBA 1D1KA 3D6WA 3V96A 4AIMA 4O2DA 1I94L 4MHEA 1O7LA 1B53A 3E0JA 3PO2G 4JI3L 1SMXA 4IUTA 2ZJPA 4UHVA 5IYCH 1STNA 4C3HG 1XX8A 5FO9B 5EPKA 2R6GA 2I0QA 2EYLA 5E3FA 2LS01 3VR6A 1W6KA 4JBKA 3KF6B 3RR5A 1PVOA 2B2WA 3L2PA 1IHZA 2A6EC 5KRUA 2BDOA 3J7AV 4BY7G 3NTHA 1WCMG 3FVQA 4CJ1B 1LUZA 1KAAA 2F52A 2F3VA 3LWEA 1X32A 1NJIC 1PTOB 3MHBA 3PUXA 3S1QH 1EEID 1XTDA 2C35B 3DM1A 4H44C 3T4AC 3I90A 5M5YH 1LTTD 2CW0D 1FGUA 3F1ZA 1D5MC 4XIGS 5CORA 3PIO3 1OTCA 1PFBA 5GROA 4NW2A 4KI0A 4JI1L 2MJ8A 1E22A 4GKJQ 4IN3A 4A3EG 2R92G 5JEAG 1NMGA 3V2TA 1FJGQ 2BH8A 3FDTA 2RA4A 1NR4A 3D4DA 1IBML 2KA7A 5IYDH 3OPOA 1N9WA 4FO2A 4A3GB 3KDFB 5HY6A 2AQ3B 1CKNA 2N78A 3RN2A 1ET6A 2BE5D 1B3QA 3PIP3 4R4CA 1TT2A 4R9WA 4B9XA 1M8AA 5FLXL 2B63B 1L1OA 4A3JH 4OWXB 1K0SA 2K1BA 3QB3A 4DAYB 1E2VA 3HOYG 1BF4A 3M4YA 4PMBA 1DGSA 1HFNA 2JEBI 3D4WA 3Q8DA 4DFAA 4H02A 4FF4A 4X62L 1G2TA 2EYOA 1DOKA 3RLNA 4B3ML 3M7NA 2B2TC 1KNAA 4CDEC 3QO2A 5ELFA 5EBCA 3M3YB 1G2SA 2AMCB 2HDMA 1WTWA 3HFZB 2MFIA 4TVAB 1N36Q 2WP8J 3D4RA 4L63B 4A3CH 5GAHC 5FLXE 1PRTF 4IPHA 2PNHA 3UDGA 4WRDA 2DJGC 4ZYSA 4BY1G 4C3JB 2HCIA 1I6HB 1QJOA 1PYBA 4PQXA 1N33L 1SROA 1QOHA 3G48A 1K9MC 1A15A 5M3FB 1VQEA 1LYLA 2F0HA 3S14H 4JI5L 2CKZB 2K5DA 1RKNA 4A3BH 1KIXA 5ELOA 4LFCQ 4LFBQ 4DN4M 4EQPA 1TS4A 1EZ8A 1YIJA 2JA5H 4RWSC 1I94Q 1VQPA 4H7BA 4DNRB 3PUWA 3I56A 1Y1WB 2Q2HA 4DR2Q 4FXDA 3WOFA 4EVOA 2Q2IA 4B3SL 4DV6L 4HIMA 3T51B 2IT1A 3GV6A 4UAIA 1HUNA 4OX9L 3LWUA 3TS0A 5C0XJ 3A5UA 4HIKA 1JJGA 3X3MA 1AZPA 4A3MH 1HNWQ 1DYQA 3SK4A 3GTGB 3GV3A 2HDLA 2R93H 2VUMB 4TKOB 5JPNC 3H3VH 5J1ZA 3HP3A 4QUCA 4ALPA 2E2HH 2YV5A 2IHFA 4GN5A 1X55A 1RTNA 4BBRB 4YY3Q 4DAMA 1SNPA 4JC0A 4IUPA 2AWOA 2CH4W 1BO0A 5CBEE 3TN2A 4P2CB 2UXBL 5ELEA 1VQ7A 3DLLA 3S1RB 3S1NH 4LUVA 2ZXOA 2R7ZB 2BA1A 2UU9L 3UE1A 4BWGB 1XTCD 2JA7B 3C1EA 4RGMA 4KHPQ 4PG3A 4DK3C 1K3RA 1H9SA 1TR5A 1VQBA 3LGJA 2E5LQ 2JK8A 5L37A 4QGUA 3BZKA 3VA7A 3FHWA 3U50C 2PPBC 1HZAA 1EY8A 4LF6Q 2F0IA 4CDDC 3BDOA 2JA6G 2HHHL 4DU9A 2A5HA 1VQ4A 2Y0SB 1ZYRC 1E24A 2K52A 1V1OA 4LJZC 1PA6A 1EIHA 1HNZQ 2G9HD 1SYBA 2X6GA 5IT9c 1VQ9A 2P5ZX 4IFDJ 1LTAD 1CI3M 3N52A 1EU3A 2UXDL 4GOPC 4JI7L 3K7AH 4EX5A 2B8GA 2KEDA 3ONAB 2KEEA 1B9NA 3RZOH 4LWCA 3I4LA
chains in the Genus database with same CATH topology
1K8MA 1J9OA 1IW7D 1Z47A 1I4QA 2EJMA 2AUJD 3J7YW 4Z9CB 4K5WA 1NSNS 1HPCA 2PW7A 1Y69U 4F7XA 3HOVB 3MEHA 3BZDB 3MWYW 5K36H 1LT4D 4HSPA 1YNND 4XYOA 2WKCA 5LL6X 3BVMA 3HS0C 1EY0A 1RJTA 4ZK9B 4B9WA 1EY7A 4J1MA 2O2LD 1TS3A 2IJ0A 3T56B 3GO5A 1G8ZD 1QCBD 1CHPD 4L6TB 4ZUIA 5FK9C 1SE4A 1ZXTA 4CHTB 5M9OA 1EL0A 2AWNA 2BCOA 1AEXA 1I4PA 1STHA 1YNJC 2FHTA 3KF8A 1CK1A 4IZ8A 3ITPA 1IKLA 4U673 1DXMA 4NKLA 1EQTA 4QMGA 3RD4A 3TBIB 1HA5A 5D3IB 1CTMA 5EKIA 2NN6I 3S1QB 2IX0A 5FKAC 5M5YB 4OO1H 2I46A 3RLFA 1SYDA 1PTOH 2SEBD 1EQVA 3VA5A 3HG9A 5JVG3 4MIUA 4IUNA 2KHSA 4K8IA 1SNQA 4N9TA 1ONLA 1PRTB 1F9PA 1SEBD 2PO4A 4X3TA 4XQNA 2XIWA 2F0VA 4FVMA 4V190 4A3JB 1PRTD 4FF3A 5IT9L 2IW3A 2OEOA 1SSOA 2TMPA 2N55A 3A7AB 1F77A 2WIIB 1TS5A 1JQYD 4KD4A 2B2WC 2PZUA 3P1HA 1GHKA 2NWGA 1S4ZA 3GTPB 2EZVA 2R3ZA 3VYUA 2B39A 4BA2I 1NUCA 2K5QA 5IT9E 1MSHA 2F0LA 1WTRA 1Y8NB 5C0XG 4GZYC 4IUQA 3S14B 1F2MA 2NB0A 1AZQA 2F0SA 5D3DA 1VF5C 5KIXA 3K5NA 2JA5B 1SE2A 5C4HA 4LMQD 3PV0A 3FPPA 1QE6A 1U4MA 1WTPA 3BYTB 3UI2A 2F03A 2K6AA 5JVH3 4A3MB 1EYAA 3I72A 1Q8IA 2EYPA 3VYSA 3OMCA 1ILQA 4DK1A 2X6LA 4ZKBB 3I70A 1PZID 2E2HB 1EYDA 3QWNA 1FNUA 2EPBA 1CHQD 2JE6I 2IX1A 5ELDA 3S1NB 2RKSA 1GUNA 3D8GA 4IFDG 4ID6A 1DCZA 2H1EA 1BCPC 3IKJA 2MUYA 1STBA 3FKIB 1GUWA 3T13A 2ZXPA 5IIFA 2M9VA 3SHLA 3FEWX 1RF2D 4RA8A 1SE3A 1I4RA 3W2DA 3NE5B 3OW7A 4ULLA 2PZWA 1LTID 1SNCA 3MC0B 2BA0A 3DWQA 4CKCA 5CYUA 5DM73 2EXZA 5CV8A 3GD7A 1UEAB 4X3KA 1D1IA 1D2BA 3MFGA 3MFYA 3U9OA 4K14A 1I4HA 4C2MB 3RZOB 2R61A 2DY8A 1O78A 4BBSB 3G7LA 3QOLA 1U9RA 3W3AA 5JOBA 2VB2X 4TSSA 1Z6HA 1F9SA 1VCIA 4KKTA 1GUOA 4K2LA 3FPUB 2DN8A 2JP1A 1Q3LA 3OWEB 1ENAA 4KN7C 5M5WB 2RDHA 1GUTA 1HHVA 2LKVA 4K5VA 4UDUC 5T1IA 2NTTA 5FO8B 4DGZA 1XXGA 3K57A 1RCVD 2D5DA 4TRDA 1Q1EA 1WTQA 4XT1B 2B2UA 2KJXA 2A69C 3L7ZC 2EYHA 3S17B 4QIWB 1X3QA 1BBXC 3K5MA 1LV9A 4FXGC 5CV7A 1Q12A 3KK7A 4RKLA 3S2DB 4U68A 5IGGA 4M1UB 5IGDA 5JJZA 5ELBA 4OO1I 1GXDC 1V8QA 4FXKC 4DAVA 2NN6H 1DOMA 5ISRA 3MVVA 1EWCA 3TP6A 5TSSA 1XWEA 1RDPD 4HSVA 1PTOD 1I6VC 3J81L 4A3IB 3NQIA 2F0JA 1A6XA 5J22A 3M4OB 1TWFB 2L55A 4LAAA 4FNFA 3FRPB 3DMUA 3NXWA 1SYEA 2CW0C 5G3LF 3A7LA 3G6JB 3OHXC 3VR5A 3J81E 1O7ZA 2DY7A 3NHHA 3HOXB 2D2CC 1JWUD 2HQEA 3PUYA 4G57A 4K6DA 1ZEQX 1FNVA 1GHJA 2D62A 3MXNA 5LHY1 3K5LA 2N88A 2E2IB 2QCPX 1CZWA 1QB5D 2EOTA 3S9WA 1T5XD 3CQZB 1TWAB 3I4NB 1A3VA 5IGEA 4C3IB 2BE5C 1I4XA 1F2YA 1LLRD 3VR3A 4KK7A 2KQ3A 2PNRC 3KBXA 5LL6S 1V43A 2RBMA 5AFWA 1ENFA 1EY4A 5BN4A 3BVGA 1BNZA 1BXTA 3DHQA 2WACA 1B3AA 4RCNA 1DZ1A 5M5XB 4QCLA 4PV1C 1QNUA 1SBBB 4C1NI 4R8IA 2HCCA 5CV6A 3EROA 4ZAIA 4RAUC 3VYTA 4RGTA 4RFBA 2L0CA 2VXWA 4Q0FA 2QEJC 1TY0A 1HTLD 4IUVA 1ESFA 3DWPA 5E4WC 4RKBA 1B4OA 1PLFA 3Q22A 5I2YA 2E76C 3IFTA 1BR9A 3EA6A 4HEDA 1TIID 3F2UA 2Z4IA 1D6EC 2KECA 1KDBA 4HN7A 2SNSA 1K83B 1AW7A 5C3EB 1SNDA 5KNCA 2ICEC 4KY5A 3GTKB 3EQLC 1BCPF 1EIGA 4PMCA 2ICIA 5I2XA 2OXPA 3P75A 1PXUA 1PFNA 3K58A 4EQOA 1ESRA 2QF7A 2NVTB 1KLUD 3JAML 5CV5A 4NMZA 2B2VA 1RODA 1EY5A 3HOWB 5D65A 3R2TA 2YYZA 5KEEA 1SXTA 2F4IA 1TQOA 3MTSA 3O13A 4KJOA 1WTXA 3HKZB 1C8CA 2F0GA 1H9MA 4RGNA 4XYQA 1U4LA 3GTJB 2LY7A 4RHSA 3JAME 1WTOA 2F0DA 3K5OA 3NTIA 1SAPA 3MXPA 2DNEA 1MD2D 2O5IC 3J7AF 1D5ZC 3I8ZA 1WD0A 3KLRA 1SNMA 4RCOA 1OO9B 1XYIA 2PQEA 4C3HB 1IW7C 1EY6A 2MP1A 3OMGA 3VR4A 3A8JE 4R8NA 2SOBA 1X3PA 1V1PB 3H09A 1OXUA 4G7ZC 1Q90A 2PMZB 3D3RA 3PUZA 2E75C 3DXJC 4F88A 4ODGA 2NVQB 3T16A 3QIAA 2K05A 1F2ZA 1O7YA 2D9UA 3IAYA 4CJ2C 1LTSD 1II3A 2IWHA 3TP7A 3URYA 4WFN3 1SYGA 2K32A 3H91A 5JAVA 4IQZA 1SMYC 1SJHD 2F0QA 5K36G 3DUZA 4IURA 1S5CD 4A3EB 2NZ1D 1R4QB 2L1BA 2O4XA 1GUGA 5C4XB 1ENCA 4O1NA 2F0TA 3MXGA 1CM9A 2XRQD 2PZTA 4HAEA 1A2UA 5I6WA 4KTAA 5K5PA 4ZLTF 1QILA 3IL8A 3HOYB 1AP0A 2NTSA 2B2TA 2IPKD 4E6IA 4IUUA 3CHBD 5EQ0A 2B2UC 4JBWA 4DAYA 1WD1A 2ID0A 2JA8B 4EQNA 3H0GB 2K28A 2A74C 1IKMA 4HTHA 1MI2A 1LT6D 1K8OA 2RDGA 4KHVA 3OOCA 3C3LA 2F1MA 4DXGA 2B2YA 1IL8A 4OHJA 2M00A 4OO1G 3S16B 1VF7A 2J7ZA 2F0WA 3EJIA 1I3QB 1KTKA 4H13C 3GP7A 5EKLA 2I07B 3SXHA 1O80A 5E1FA 1JWSD 3KBGA 3K0YA 1JB3A 5C3XA 2A73B 2QKIC 1C48A 5C4JB 1MSGA 2AQ2B 1AFPA 1U4RA 4J6HA 1UAPA 2EJGC 1SDFA 4DK0A 2RVLA 1J8IA 3SR1A 5C5LA 5DEHA 4S3SA 3QJYA 1STGA 3NP8A 1IYUA 3EVQA 1IYVA 1B9MA 5IODA 3VYRA 2WINB 2PW5A 4F87A 1EOTA 1LTBD 3SDZA 4C3IG 3PMFA 1HA6A 1ET9A 4RGOS 4C3JG 1BCPB 1R4PB 3Q24A 3NBIA 3VR2A 1HFGA 2EY5A 2A6HC 3RUZA 4HR7B 5C6AA 1L0XB 1KNEA 1I50B 1CA6A 2L12A 2EY6A 2VNUD 2KVMA 4M8AA 4KV6A 3BS1A 1OXTA 4XQQA 2Z4HA 1LO5D 1L0YB 3SEBA 5CV9A 1LTRD 1DD2A 5CV4A 2Z8LA 2J0TD 5FOBB 2C9OA 2KCCA 2A68C 3SK6A 2O5JC 4K5XA 1STEA 4FF2A 3DEOA 2NBFA 1RTOA 2F0PA 1ILPA 2GA4B 2C5CA 2G9DA 2K5WA 1DONA 2MGSA 2KOLA 3E5SA 1JE4A 4J8QA 4AYBB 2YU9B 4CGYB 3NTKA 3C2PA 2NVYB 1EYCA 3NUCA 4ZRZA 2B8FA 3PUVA 2V4DA 2SDFA 4DNTB 1OXXK 3S15B 1TU2B 5BN5A 1TWHB 4FP5D 3NPPA 3OWFA 2KUMA 2XWJB 3D6CA 1R9TB 5IOCA 3OSOA 1HCZA 1TY2A 4KY6A 4DAPA 2WB1B 1TWCB 2EYJA 1LACA 1F2LA 3I91A 3HOZB 2ENBA 3OIQA 4A93B 3LNNA 2B2VC 1E2WA 4BA1I 4DXFA 3D31A 4XT3B 4KHZA 4I65A 1Y8PB 5IGBA 2DNCA 5KNDA 2F0EA 2A6ED 1JC7A 2X69A 1EU4A 1KLGD 2EJFC 5CR3A 2RDFA 1F9RA 5NUCA 5JPMC 5JEAH 2FFKB 3I73A 4A3KB 1CQVA 2EYMA 4XTCS 2VB3X 2E2JB 1S5DD 5COYA 1ICWA 1DJRD 5T1GA 1VDZA 3TMEA 3PO3B 4ZQ3A 2F0MA 3GTLB 1D5XC 2K7VA 2SNMA 2PCFB 3T53B 4FF1A 1Y1VB 2NYZD 5C0XI 1VMCA 1PTOC 2PYKA 3RZDB 1H9RA 3HOUB 2F3WA 4LK1C 3R2IA 3GTQB 2XWBB 1UNSA 4CKEA 1NCVA 1G91A 2NN6G 4B08A 1FD7D 3P7JA 4HMJA 5EBDA 3L9AX 3BG3A 5M3MB 1KDAA 3MZ5A 1QG7A 2RSOA 5EPJA 3V05A 1AN8A 1SFOB 3KUPA 5EPLA 5DAUA 1G291 4DF7A 1DOLA 1SYCA 3A56A 2TSSA 4KKUA 3HRZC 2JSOA 4K2KA 4FYDA 4OL7A 3TZUA 4CJ0B 1FYCA 5C4ZA 4C1NK 4EGVA 5DNFA 2B2YC 4G7OC 1HQRD 2CQAA 3TSSA 1F9QA 3A8KE 3A54A 4IFDI 3Q6SA 3TZDA 5I9OA 1SNOA 5J39A 1KDCA 1EEFD 5IGFA 4ILWA 4QUFA 2OF1A 1STAA 5D14A 1FR3A 4Y7NB 2XRSD 5I6YA 4PNYA 2E2DC 1Y8OB 2FINB 4IALA 3C1FA 3Q0AA 1FNWA 1TS2A 3E6ZX 5CC4A 4HCEA 2F0FA 1MGSA 4NDXA 2LFNA 1A3UA 4TQUS 3GQBA 1LTGD 3TDQA 3I3CA 2XVSA 4QB4A 4G4KA 1ZYRD 1E2ZA 4HMIA 2JEAI 2K03A 1S5BD 3FMCA 5HGTA 1SJED 2MHVA 1LT3D 3TP8A 5FO7B 4YIJA 3WOEA 3MAQA 1CZGA 3RMHA 4F8MA 3Q23A 3HGBA 1G6ZA 3KLSA 2EVBA 2FMMA 2QDBA 4QF4A 2KCNA 1NAPA 4CBVA 3H94A 3M85A 3GTOB 1TWGB 1A2TA 3S2HB 5E4XA 3QG1A 2WKDA 4PMWA 1CT1D 4A3FB 3IFDA 4OIJA 1PMRA 1HRJA 3PO2B 1H9KA 1OXVA 1B2TA 3NK9A 3I4MB 1STYA 1LT5D 1KABA 4ME5A 1BQQT 2OT2A 2NUCA 3AMUA 3HZXA 3MXUA 2AUKA 4BY7B 1WCMB 1YNJD 1YNNC 4KMUC 5I4DA 1PZJD 3SK8A 3K6OA 2E74C 2L4NA 3QOJA 1B44D 1SMYD 1EWHA 5CBAE 3SK5A 3DEPA 4I7ZC 1RHPA 3J80L 1CA5A 2BOSA 2Q8TA 2R92B 3ZYYX 2JYOA 5KYIA 1B50A 2H4OA 1ZKOA 5C3WA 5KGUA 2F0UA 3J80E 1SYFA 1DM0B 1U4PA 5G3LD 2HUGA 2L5TA 4KD3A 3DWAA 2EDGA 2IX3A 1B1ZA 2K01A 2XNAC 2RQXA 2F0NA 3BDLA 4XXEA 2ZT9C 2J4XA 5ELCA 1JCKB 1FGBD 4BY1B 3CRKC 2EE1A 3U9SA 5BN3A 5C0XH 4ZKCB 1W6JA 3ND9A 4X3SA 5I9PA 1UUPA 1JR0D 5DM63 2EYFA 3LX0A 2EY1A 1I4GA 3X3NA 1C4QA 4L8JA 4WJWA 1QNKA 1PRTC 1RD9D 4NP5A 4X3UA 1A3TA 1PTOF 3AU7A 3BVZA 2AQ1B 4ZUJA 3P20A 3NWSA 2M2LA 5A2QL 1HTPA 4XQJA 5JEAJ 1PYWD 3SVMA 5C5MA 1JORA 3HEJA 1E0BA 5CGKA 5KYLA 2MPMA 4ABNA 3KLSX 3ND8A 1BDOA 1JICA 1CFMA 1JOKA 5A2QE 2EY2A 1JWMD 4H0LC 4A3BB 4K6LA 2LMCB 3L3OC 1EZ6A 2BDNA 3N6RA 1NR2A 1VMPA 2JXMB 3CRLC 3CU7A 4IFDH 1M4VA 3MA2B 5EKKA 3NQTA 4KN4C 5EGTA 2FMCA 1HXYD 3R8BA 1GJXA 4Q5VA 1WVLA 1MBYA 2L11A 5F2DA 3R93A 4BS9A 1JOOA 3WDNA 2A6HD 1EFID 1HUMA 4KJNA 3BDCA 1GUSA 2JA6B 1Z7TA 2R93B 1BCPD 4RH6A 4DA2A 1PDQA 3H6MA 1OXSC 5IGCA 2CHBD 5A35A 4CKBA 3A55A 1ML0D 5HURA 4KY7A 4KKSA 2XN9C 2XSCA 3R3OA 1BUVT 5CMDA 1S5ED 3H3VC 5EJWA 3OIPA 1S5FD 3A8IE 2ZXRA 2A68D 3K59A 1PZKD 1TVXA 2FJ2A 2K04A 2Q8RE 1GOZA 1BOSA 3GTMB 3EFXD 3AB9A 1QWYA 1H9SB 4V0BA 3S1MB 4O42A 4WORA 3TP5A 1LABA 4OIKA 4XDXA 3ERQA 2QILA 2L9HA 3NSWA 2Q8IB 3M7GA 3K7AB 2IL8A 2WV6D 1H9JA 2RSNA 3NBHA 1V1PA 4C56C 4RHRA 4JK1C 2Z1CA 1T5EA 1Q1BA 1JOQA 2F0OA 3CKIB 2K33A 2CVRA 3BYYB 4OGQC 3C46A 2F0KA 1HQMC 2A69D 1PFMA 4N9PA 3SE0A 1TKWB 3NWTA 4G7HC 4A3DB 5C44B 2NVXB 4K8JA 1WTVA 1CQFA 2WAQB 4HCSA 1EY9A 4MN3A 5KNBA 1D1KA 3D6WA 3V96A 4MHEA 1O7LA 1B53A 3E0JA 4IUTA 1STNA 4C3HG 1XX8A 5FO9B 5EPKA 2R6GA 2EYLA 5E3FA 2LS01 3VR6A 1W6KA 2B2WA 1IHZA 2A6EC 5KRUA 2BDOA 3J7AV 3NTHA 3FVQA 4CJ1B 1KAAA 2F3VA 3LWEA 1X32A 1PTOB 3MHBA 3PUXA 1EEID 3DM1A 4H44C 3T4AC 3I90A 1LTTD 2CW0D 3PIO3 4XIGS 1D5MC 5CORA 1PFBA 4NW2A 4KI0A 2MJ8A 4IN3A 5JEAG 3V2TA 3FDTA 2RA4A 1NR4A 3D4DA 2KA7A 3OPOA 4FO2A 4A3GB 2AQ3B 1ET6A 2BE5D 3PIP3 1TT2A 4R9WA 4B9XA 1M8AA 5FLXL 2B63B 2K1BA 3QB3A 1E2VA 1BF4A 3M4YA 4PMBA 1HFNA 2JEBI 3D4WA 4DFAA 4FF4A 1G2TA 2EYOA 1DOKA 3M7NA 2B2TC 1KNAA 3QO2A 5ELFA 5EBCA 3M3YB 1G2SA 2HDMA 1WTWA 2WP8J 3D4RA 4L63B 5FLXE 1PRTF 4WRDA 4ZYSA 4C3JB 2HCIA 1I6HB 1QJOA 4PQXA 1QOHA 1A15A 5M3FB 2F0HA 2K5DA 1RKNA 4DN4M 4EQPA 1TS4A 1EZ8A 4RWSC 4H7BA 4DNRB 3PUWA 1Y1WB 4FXDA 3WOFA 4EVOA 3T51B 2IT1A 3GV6A 4UAIA 1HUNA 3LWUA 5C0XJ 3X3MA 1AZPA 1DYQA 3SK4A 3GTGB 3GV3A 2HDLA 2VUMB 4TKOB 5JPNC 5J1ZA 3HP3A 4QUCA 1RTNA 4BBRB 1SNPA 5CBEE 4IUPA 2AWOA 1BO0A 3TN2A 4P2CB 5ELEA 3S1RB 2R7ZB 2ZXOA 2BA1A 4BWGB 1XTCD 2JA7B 3C1EA 4RGMA 1TR5A 1H9SA 3VA7A 2PPBC 1EY8A 2F0IA 3BDOA 4DU9A 2A5HA 2Y0SB 1ZYRC 1V1OA 4LJZC 1EIHA 2G9HD 1SYBA 2X6GA 4IFDJ 1LTAD 1CI3M 3N52A 1EU3A 2B8GA 2KEDA 3ONAB 2KEEA 1B9NA 3I4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D2B A;  1JC7 A;  3HS0 C;  1OO9 B;  3G6J B;  3OHX C;  1BUV T;  3V96 A;  1XWE A;  3L3O C;  5JPN C;  5FO7 B;  2B39 A;  4ILW A;  2A74 C;  2WIN B;  1PXU A;  1UAP A;  2I07 B;  1BQQ T;  5JPM C;  2XWB B;  3CU7 A;  1GXD C;  2TMP A;  2J0T D;  3I70 A;  3MA2 B;  2XWJ B;  5FOB B;  3KLS A;  3CKI B;  5FO9 B;  1JB3 A;  2ICE C;  4FXK C;  5FO8 B;  2WII B;  3FRP B;  2A73 B;  2QKI C;  4FXG C;  3T4A C;  2E2D C;  1UEA B;  1BR9 A;  3HRZ C; 
#chains in the Genus database with same CATH topology
 1K8M A;  1J9O A;  1IW7 D;  1Z47 A;  1I4Q A;  3UDI A;  5GAD C;  2EJM A;  2AUJ D;  1MKH A;  1KL9 A;  3J7Y W;  4OWT B;  1XMQ L;  1N33 Q;  4BBS H;  4Z9C B;  4K5W A;  1NSN S;  1HPC A;  2PW7 A;  1Y69 U;  1PV4 A;  4F7X A;  1XNQ Q;  3HOV B;  3MEH A;  3BZD B;  2L15 A;  3MWY W;  5K36 H;  1LT4 D;  1B8A A;  4GLA C;  4HSP A;  1YNN D;  4XYO A;  2B29 A;  2WKC A;  5LL6 X;  3BVM A;  3HS0 C;  1EY0 A;  1RJT A;  4ZK9 B;  4B9W A;  1EY7 A;  4J1M A;  2O2L D;  4AYB G;  1TS3 A;  1YJN A;  2IJ0 A;  2JN4 A;  3T56 B;  1SN8 A;  3GO5 A;  1CUK A;  1G8Z D;  3T1Y Q;  1QCB D;  1CHP D;  3ER0 A;  3EBE A;  4L6T B;  4ZUI A;  5FK9 C;  4QQB X;  4K0K Q;  1SE4 A;  1ZXT A;  4CHT B;  5M9O A;  1EL0 A;  2AWN A;  2BCO A;  1RL2 A;  3G6E A;  1AEX A;  1I4P A;  1STH A;  4A76 A;  1YNJ C;  4DV3 Q;  3QR8 A;  2FHT A;  1VQF A;  3KF8 A;  3F2B A;  1CK1 A;  4R1J A;  3S17 H;  4IZ8 A;  1AE2 A;  3ITP A;  3I7F A;  1LM0 A;  1IKL A;  3L0O A;  1YNX A;  4U67 3;  1DXM A;  4NKL A;  1EQT A;  4QMG A;  3JAM i;  1K8G A;  4HID A;  3RD4 A;  4JV5 Q;  3TBI B;  1J6Q A;  1HA5 A;  5D3I B;  3AYH B;  1SE8 A;  3AFQ A;  1CTM A;  1VQN A;  4A93 G;  5EKI A;  5LMU L;  2NN6 I;  4A3D G;  4YWL A;  3S1Q B;  4AQY Q;  2IX0 A;  5FKA C;  4CDC C;  4JCV E;  5M5Y B;  4OO1 H;  3U4Z A;  2I46 A;  2WFW A;  3RLF A;  1SYD A;  1FVI A;  4LF4 Q;  1WYD A;  1PTO H;  2SEB D;  1EQV A;  2XGT A;  3VA5 A;  4JI8 Q;  3HG9 A;  5JVG 3;  4MIU A;  3WWV A;  4IUN A;  2KHS A;  4K8I A;  4NXM L;  2RF4 A;  1SNQ A;  4N9T A;  3KFU A;  1ONL A;  1PRT B;  3T1H L;  4A3I H;  4PZ6 A;  1F9P A;  1SEB D;  2PO4 A;  3CD6 A;  4RG1 A;  4X3T A;  4A3K G;  4XQN A;  2XIW A;  3M4O H;  1C0A A;  1TWF H;  2F0V A;  4FVM A;  4V19 0;  4A3J B;  1IBL Q;  1PRT D;  5GQO A;  4JI7 Q;  4DV7 Q;  2UUC L;  4FF3 A;  3K8A A;  2IW3 A;  5IT9 L;  1EOV A;  2OEO A;  4L5R C;  1SSO A;  2TMP A;  2N55 A;  4L5Q A;  3A7A B;  1F77 A;  2WII B;  3A74 A;  3PO3 G;  1TS5 A;  2Z6K A;  1YVC A;  3P1H A;  1JQY D;  2B2W C;  2PZU A;  4KD4 A;  2ES2 A;  2NWG A;  4LF7 Q;  4N8F A;  1GHK A;  1SLJ A;  4JI0 L;  1S4Z A;  3HOX H;  3GTP B;  2EZV A;  2R3Z A;  3VYU A;  4X65 Q;  1XMO Q;  2B39 A;  4BA2 I;  1NUC A;  5IP7 H;  4JW0 A;  5E7N A;  2K5Q A;  5IT9 E;  1MSH A;  2E2I H;  3M3Y H;  2F0L A;  4DV4 L;  1WTR A;  1TWA H;  3I4N H;  1Y1V G;  5JJL A;  1Y8N B;  4LF8 Q;  5C0X G;  4C3I H;  4YHH L;  3STB D;  4GZY C;  4UP8 A;  4IUQ A;  2UUB Q;  1F2M A;  2NB0 A;  4C3J H;  1AZQ A;  3S14 B;  2F0S A;  1E1O A;  5D3D A;  4DR6 L;  4MNO A;  5IYB G;  1EUJ A;  1QVG A;  1VF5 C;  5KIX A;  3K5N A;  2JA5 B;  1SE2 A;  2PQA A;  5C4H A;  4LMQ D;  3RNU A;  3PV0 A;  1A8V A;  3FPP A;  1QE6 A;  2KBN A;  1U4M A;  1YI2 A;  2HIX A;  1WTP A;  1G6P A;  4DR7 Q;  3BYT B;  4DR1 L;  1L1O C;  3UI2 A;  3OTO Q;  2KCT A;  2F03 A;  2K6A A;  3CP0 A;  5JVH 3;  4P73 A;  1JT8 A;  4A3M B;  1EYA A;  4RMF A;  3I72 A;  4YCW A;  5IE8 A;  1Q8I A;  2EYP A;  1IBK L;  3VYS A;  3OMC A;  1ILQ A;  3H3V I;  1JE5 A;  4AYB E;  5AJ3 L;  4R4T A;  4DK1 A;  2X6L A;  4ZKB B;  3I70 A;  1PZI D;  2E2H B;  4WJ4 A;  1EYD A;  3QWN A;  1FNU A;  3GTG H;  2RCN A;  2EPB A;  1CHQ D;  2JE6 I;  5M3F G;  1XNR L;  4DUY L;  2IX1 A;  5ELD A;  3S1N B;  2RKS A;  3G4S A;  4DUZ Q;  4BBR H;  1GUN A;  3D8G A;  4IFD G;  4ID6 A;  1DCZ A;  2H1E A;  1XPR A;  1BCP C;  2R7Z H;  3IKJ A;  2MUY A;  1KRT A;  1STB A;  3FKI B;  2VS1 A;  1GUW A;  3T13 A;  2ZXP A;  5IIF A;  2JA7 H;  2M9V A;  1Y1W G;  3SHL A;  1H95 A;  3FEW X;  1RF2 D;  4RA8 A;  1SE3 A;  1I4R A;  3J81 c;  3W2D A;  3NE5 B;  3OW7 A;  4ULL A;  3CC4 A;  1K83 H;  2PZW A;  1LTI D;  5C3E H;  1N34 Q;  4GNX B;  1SNC A;  3MC0 B;  3E9I A;  2BA0 A;  3DWQ A;  4DV2 Q;  3GTK H;  4CKC A;  5CYU A;  1BVS A;  5DM7 3;  2EXZ A;  1PYS B;  5CV8 A;  2UUA L;  3KLW A;  2UXC Q;  3CCS A;  4DR3 Q;  3GD7 A;  1UEA B;  4X3K A;  1D1I A;  4HJ7 A;  1D2B A;  1N32 Q;  2YTV A;  3MFG A;  3MFY A;  3U9O A;  4K14 A;  1I4H A;  2Z9H A;  4C2M B;  3RZO B;  2MNA A;  2R61 A;  2DY8 A;  3HOW H;  4LF5 Q;  1QZH A;  1O78 A;  2HIV A;  4HJ9 A;  4BBS B;  3G7L A;  3QOL A;  4IPD A;  1U9R A;  3W3A A;  5JOB A;  3TS2 A;  3F2D A;  2VB2 X;  4TSS A;  2N3S A;  1NNX A;  1Z6H A;  1F9S A;  1VCI A;  2GN5 A;  3GTJ H;  4POG A;  4KKT A;  1GUO A;  4K2L A;  3FPU B;  2I5H A;  2DN8 A;  1EIY B;  2JP1 A;  1Q3L A;  3HOV H;  3OWE B;  1ENA A;  4KN7 C;  5M5W B;  2RDH A;  1HZC A;  1GUT A;  1HHV A;  2LKV A;  4K5V A;  4UDU C;  1WOC A;  5T1I A;  2NTT A;  1PH5 A;  1E3P A;  4IJL A;  5FO8 B;  4DGZ A;  4BXX G;  1XXG A;  2G5D A;  2CH4 A;  3K57 A;  1RCV D;  2D5D A;  1YJW A;  4TRD A;  1Q1E A;  1WTQ A;  4XT1 B;  1KQS A;  4DV0 L;  2B2U A;  4A3F G;  2KJX A;  1HNX Q;  2ZTE A;  2A69 C;  3L7Z C;  2K50 A;  4LNQ A;  2NVQ H;  2D0P A;  2F3I A;  2EYH A;  1QVF A;  5ELN A;  2VQF Q;  3S17 B;  3I4M G;  4QIW B;  1X3Q A;  5J3B A;  1BBX C;  3K5M A;  1LV9 A;  4MZ9 A;  4FXG C;  5CV7 A;  1CKM A;  1Q12 A;  3KK7 A;  4RKL A;  3S2D B;  4U68 A;  5IGG A;  1E7Z A;  4A3E H;  4M1U B;  5IGD A;  5JJZ A;  2VQE L;  5ELB A;  4OO1 I;  1EIF A;  1GXD C;  5C4X H;  1V8Q A;  4IOC A;  4FXK C;  4DAV A;  2NN6 H;  1DOM A;  5ISR A;  3J81 j;  3CC7 A;  3MVV A;  1EWC A;  1PH1 A;  3TP6 A;  1L2F A;  5TSS A;  1VQA A;  1XWE A;  1RDP D;  4HSV A;  1PTO D;  4DV5 Q;  1IYJ B;  1I6V C;  3J81 L;  1IZ6 A;  4A3I B;  1QUQ B;  3NQI A;  2F0J A;  5IYC G;  1A6X A;  5J22 A;  3M4O B;  1TWF B;  2L55 A;  1NE3 A;  4LAA A;  4JI2 Q;  4P75 A;  2K14 A;  2KCM A;  2F4V L;  4FNF A;  3FRP B;  4X66 Q;  3DMU A;  3NXW A;  1SYE A;  2JA8 H;  2VY3 A;  1Q46 A;  1YZ6 A;  3K81 C;  3H0G H;  2CW0 C;  5G3L F;  3A7L A;  3G6J B;  3OHX C;  3VR5 A;  2GVB A;  3J81 E;  1O7Z A;  2DY7 A;  3NHH A;  1VQ6 A;  3HOX B;  2D2C C;  3JAM c;  1JWU D;  2HQE A;  3PUY A;  4R4O A;  4G57 A;  4P72 A;  4B3T Q;  5IY0 A;  4K6D A;  1ZEQ X;  1FNV A;  4GLV B;  1GHJ A;  2D62 A;  3NEN A;  3MXN A;  3M9B A;  5LHY 1;  3K5L A;  2KHI A;  3PCO B;  2N88 A;  3S16 H;  2E2I B;  3GTP H;  2QCP X;  2ZM6 Q;  1CZW A;  1QB5 D;  2EOT A;  1VQJ A;  2RHS B;  3S9W A;  1T5X D;  3CQZ B;  2QDL A;  1TWA B;  1I3Q H;  3I4N B;  1A3V A;  5IGE A;  4C3I B;  2BE5 C;  4FDB A;  1I4X A;  1F2Y A;  2MO1 A;  1LLR D;  3VR3 A;  4KK7 A;  4PZ7 A;  5IYD G;  4HJ8 A;  2KQ3 A;  4IPG A;  2PNR C;  3KBX A;  5LL6 S;  1J5E L;  2CWA A;  4CDF C;  1V43 A;  1CSQ A;  5C4J H;  1YHB A;  2RBM A;  2ZTD A;  5AFW A;  1JB7 A;  1VQD A;  3CCQ A;  1WFQ A;  3M4P A;  3NEL A;  1ENF A;  1EY4 A;  2R7F A;  5BN4 A;  3BVG A;  3KJO A;  1MJE A;  1BNZ A;  1YHA A;  1BXT A;  3DHQ A;  3CMA A;  1GO3 E;  2WAC A;  4JI3 Q;  5FLM H;  1B3A A;  4RCN A;  1DZ1 A;  5M5X B;  3CPF A;  2Z6K C;  4QCL A;  1YEZ A;  4PV1 C;  5BR8 L;  4A3C G;  2K75 A;  1QNU A;  4LF9 L;  1SBB B;  4C1N I;  2Y0S E;  4R8I A;  2HCC A;  2EQS A;  5CV6 A;  3ERO A;  4ZAI A;  2OQ0 A;  4RAU C;  3PF4 A;  3VYT A;  4RGT A;  4RFB A;  2L0C A;  2VXW A;  4Q0F A;  2QEJ C;  2MO0 A;  1TY0 A;  3ERS X;  1HTL D;  1NTG A;  4IUV A;  1ESF A;  3ULL A;  4A3B G;  3DWP A;  5E4W C;  4RKB A;  1B4O A;  1PLF A;  3Q22 A;  4LFA L;  5I2Y A;  1IL2 A;  2E76 C;  3IFT A;  3VDY A;  1HH2 P;  2JA5 G;  1BR9 A;  3EA6 A;  4HED A;  1I50 H;  1TII D;  3F2U A;  2Z4I A;  4UPA A;  4JI1 Q;  2KEN A;  2HD3 A;  1D6E C;  3EN2 A;  2KEC A;  4R4I A;  4HJ5 A;  1KDB A;  4HN7 A;  3FKI H;  2SNS A;  1IBM Q;  1K83 B;  1AW7 A;  5C3E B;  1SND A;  4A3M G;  1PFS A;  5KNC A;  2ICE C;  4KY5 A;  3GTK B;  4GOP B;  3EQL C;  2R93 G;  1BCP F;  1EIG A;  4JYA L;  2QGQ A;  5DLQ E;  2DGY A;  2JJQ A;  1UEB A;  4PMC A;  2ICI A;  5I2X A;  2OXP A;  3P75 A;  1CSP A;  4X62 Q;  1PXU A;  2H5X A;  4B3M Q;  1PFN A;  3K58 A;  4EQO A;  1ESR A;  2QF7 A;  2NVT B;  1KLU D;  4DR5 L;  1EWI A;  3JAM L;  3ICE A;  5CV5 A;  4GKK L;  4NMZ A;  1HR0 W;  2B2V A;  1ROD A;  1IXR A;  1EY5 A;  3HOW B;  5D65 A;  3R2T A;  1VS0 A;  2YYZ A;  4C2M H;  5KEE A;  1GKH A;  1SXT A;  2F4I A;  1TQO A;  3MTS A;  4UY8 C;  3B6Y A;  4GN3 B;  3O13 A;  4KJO A;  1WTX A;  3HKZ B;  2N49 A;  1C8C A;  2F0G A;  1H9M A;  4RGN A;  4XYQ A;  1U4L A;  2YU9 H;  3GTJ B;  2LY7 A;  4RHS A;  3JAM E;  4X64 L;  2F0D A;  1WTO A;  3DM3 A;  1Q8K A;  4JI5 Q;  3K5O A;  1TXY A;  3NTI A;  1SAP A;  4B3R L;  3MXP A;  2DNE A;  1MD2 D;  2O5I C;  3J7A F;  1D5Z C;  3I8Z A;  1BBU A;  1WD0 A;  3S15 H;  4DR4 L;  1K8A C;  3KLR A;  1SNM A;  4RCO A;  1OO9 B;  1HR0 L;  1XYI A;  2PQE A;  2ZJR A;  4C3H B;  1IW7 C;  1EY6 A;  2MP1 A;  3OMG A;  3VR4 A;  3A8J E;  4N8X 1;  5M5W H;  1VQK A;  3NBH B;  4R8N A;  2SOB A;  1X3P A;  1V1P B;  3H09 A;  1OXU A;  3KJP A;  4G7Z C;  1Q90 A;  2PMZ B;  3D3R A;  3PUZ A;  4DV6 Q;  4B3S Q;  2E75 C;  1PH8 A;  4OX9 Q;  2HT1 A;  1U0L A;  1UWV A;  4ME3 A;  1TWC H;  1LTL A;  3DXJ C;  3K0X A;  3KOJ A;  4ODG A;  4F88 A;  3M4Q A;  2NVQ B;  3T16 A;  3KF6 A;  2I5L X;  5H1S E;  5LMN W;  3HOZ H;  3TQY A;  3QIA A;  2K05 A;  1F2Z A;  1O7Y A;  2D9U A;  3IAY A;  4BBS G;  4CJ2 C;  1LTS D;  1II3 A;  2IWH A;  3TP7 A;  3URY A;  4WFN 3;  1VQH A;  1SYG A;  2K32 A;  3H91 A;  1X54 A;  5JAV A;  4IQZ A;  1SMY C;  1SJH D;  2F0Q A;  5K36 G;  2YTX A;  3DUZ A;  4JOI C;  4IUR A;  1S5C D;  2UXB Q;  4A3E B;  4MTN A;  1K28 A;  2NZ1 D;  4JBM A;  1R4Q B;  2UU9 Q;  2L1B A;  2O4X A;  1GUG A;  5C4X B;  1ENC A;  4O1N A;  2F0T A;  3MXG A;  5GAE C;  1CM9 A;  1V1Q A;  1N8R C;  3S2D H;  2XRQ D;  2PZT A;  4HAE A;  1A2U A;  1YHQ A;  5C44 G;  1Q81 C;  5I6W A;  3CXC A;  4KTA A;  5FJ8 H;  5K5P A;  4A3K H;  4NXN L;  2WAQ G;  5LMN L;  2AHO B;  4ZLT F;  2IHE A;  1QIL A;  3IL8 A;  3KDF A;  4A4I A;  5IWA L;  3AQQ A;  3HOY B;  1AP0 A;  2NTS A;  2B2T A;  2IPK D;  4E6I A;  4IUU A;  2HHH Q;  3CHB D;  5EQ0 A;  2B2U C;  1GVP A;  1HZB A;  3GTL H;  1X9N A;  4YWM A;  4JBW A;  4DAY A;  1WD1 A;  2ID0 A;  2JA8 B;  1T9H A;  4EQN A;  4DV1 L;  3H0G B;  2K28 A;  2A74 C;  1IKM A;  2UXD Q;  4HTH A;  1MI2 A;  1LT6 D;  2OWO A;  2RDG A;  4KHV A;  3TRZ A;  3OOC A;  4MTK A;  3C3L A;  3PGZ A;  1K8O A;  3E9H A;  1A63 A;  1VQC A;  2F1M A;  4DXG A;  2B2Y A;  1S40 A;  1IL8 A;  3MEF A;  3PQI A;  4OHJ A;  2M00 A;  4OO1 G;  3S16 B;  1VF7 A;  3HOU H;  2J7Z A;  3GTQ H;  2F0W A;  3EJI A;  1XMQ Q;  1I3Q B;  1KTK A;  1M1K C;  1B70 B;  4H13 C;  3GP7 A;  5EKL A;  2PI2 E;  3RN5 A;  4R4Q A;  2HQL A;  2I07 B;  3SXH A;  1EYG A;  1O80 A;  5E1F A;  3J80 i;  5M3M H;  1JWS D;  3KBG A;  3CQZ H;  3K0Y A;  1JB3 A;  5C3X A;  3CCM A;  2A73 B;  2QKI C;  1C48 A;  1CKN B;  4A3I G;  1UE7 A;  5C4J B;  1SFO H;  1MSG A;  4KLK A;  4A3G G;  4JI6 L;  2AQ2 B;  1L1O B;  1AFP A;  1U4R A;  4J6H A;  1UAP A;  3J7Z C;  5HGQ A;  3CCL A;  2EJG C;  1SDF A;  2QEX A;  2B63 G;  1K73 C;  4DK0 A;  2RVL A;  1J8I A;  3SR1 A;  5C5L A;  5DEH A;  4S3S A;  2NZO A;  3QJY A;  3STB C;  1STG A;  1S72 A;  3NP8 A;  1IYU A;  3EVQ A;  1IYV A;  1B9M A;  5IOD A;  5IP7 G;  1C9O A;  5M5X H;  3VYR A;  2WIN B;  1VQI A;  2PW5 A;  4F87 A;  1AE3 A;  3I4N G;  1EOT A;  1LTB D;  3SDZ A;  4IOA A;  4C3I G;  3PMF A;  1HA6 A;  1ET9 A;  4RGO S;  2B3G A;  4C3J G;  1BCP B;  5IP9 H;  5LMU Q;  4JI4 L;  1R4P B;  3Q24 A;  3S24 A;  3NBI A;  3K7U C;  4J15 A;  3VR2 A;  1HFG A;  3CAM A;  2EY5 A;  3CCU A;  2A6H C;  3RUZ A;  4HR7 B;  5C6A A;  1L0X B;  4EQ5 A;  1KNE A;  4Y7N H;  1I50 B;  4AH6 A;  1CA6 A;  2L12 A;  2EY6 A;  2VNU D;  2KVM A;  1VQO A;  4M8A A;  3CME A;  4NXM Q;  4KV6 A;  3BS1 A;  1OXT A;  3T1H Q;  4XQQ A;  2Z4H A;  1LO5 D;  3OW2 A;  1L0Y B;  3SEB A;  5CV9 A;  1LTR D;  1QZG A;  2UUC Q;  1DD2 A;  5CV4 A;  2Z8L A;  2J0T D;  5FOB B;  2C9O A;  5GAG C;  2KCC A;  2VUM G;  3EIV A;  2WAQ E;  2RCF A;  2A68 C;  4QY7 A;  3SK6 A;  2O5J C;  4K5X A;  4JI0 Q;  3U58 A;  1STE A;  4BBR G;  4FF2 A;  3DEO A;  1GD7 A;  1CKO A;  3CF5 A;  2NBF A;  2NVT H;  4WJ3 M;  4GKJ L;  1RTO A;  2F0P A;  1ILP A;  1FJG L;  2GA4 B;  1A0I A;  2ZTC A;  2C5C A;  2R7Z G;  2G9D A;  2K5W A;  4POF A;  1DON A;  3E0E A;  2MGS A;  2KOL A;  3E5S A;  1JE4 A;  4O0A A;  4DV4 Q;  4J8Q A;  2JA7 G;  4AYB B;  2YU9 B;  2VW9 A;  4YHH Q;  1ICF B;  4CGY B;  1D7Q A;  2V1C C;  3NTK A;  4APV A;  3H15 A;  3C2P A;  3ZJY C;  2NVY B;  1EYC A;  3NUC A;  4ZRZ A;  2B8F A;  4DR6 Q;  3PUV A;  1UE1 A;  2V4D A;  2SDF A;  4DNT B;  4IO9 A;  3UE0 A;  1OXX K;  3S15 B;  1TU2 B;  5BN5 A;  1X3F A;  1TWH B;  4L5S A;  4FP5 D;  1JJ2 A;  3NPP A;  2GVA A;  2Y0S G;  3OWF A;  3PO2 H;  3ULP A;  1EFW A;  2KUM A;  2XWJ B;  3D6C A;  1R9T B;  5IOC A;  1U5K A;  3OSO A;  3I4M H;  2FXQ A;  4DR1 Q;  1HCZ A;  1TY2 A;  4KY6 A;  4C3H H;  1N36 L;  1S3O A;  4DAP A;  2WB1 B;  1TWC B;  1WJJ A;  4YCU A;  4HIO A;  4A3L G;  2EYJ A;  1LAC A;  1F2L A;  1Y14 B;  3I91 A;  3HOW G;  3HOZ B;  2ENB A;  3OIQ A;  4A93 B;  1IBK Q;  3LNN A;  2B2V C;  1E2W A;  4BY7 H;  4BA1 I;  5AJ3 Q;  1WCM H;  4DXF A;  2AKW B;  3D31 A;  4XT3 B;  4KHZ A;  3CCR A;  1BBW A;  4I65 A;  4QL5 A;  1Y8P B;  5IGB A;  2DNC A;  4LFC L;  4LFB L;  3W1G A;  5KND A;  2F0E A;  1NMF A;  2A6E D;  1JC7 A;  2X69 A;  1XNR Q;  4DUY Q;  1EU4 A;  1KLG D;  3HOV G;  4NPS A;  2EJF C;  5CR3 A;  4DR2 L;  2RDF A;  1F9R A;  1P8L A;  3BZC A;  5NUC A;  5JPM C;  2R92 H;  5JEA H;  2FFK B;  3I73 A;  4A3K B;  2ASB A;  1CQV A;  3CPW A;  2EYM A;  1X6O A;  4XTC S;  2VB3 X;  4DPG A;  2E2J B;  1HNW L;  1S5D D;  5COY A;  1ICW A;  2A19 A;  2CWP A;  1DJR D;  5T1G A;  1VDZ A;  3TME A;  3PO3 B;  4ZQ3 A;  2F0M A;  3GTL B;  3CW2 C;  3HOY H;  3KF8 B;  1W3S A;  1D5X C;  2K7V A;  1HJP A;  4YY3 L;  4DKA C;  2UUA Q;  1K0R A;  2SNM A;  2PCF B;  3T53 B;  3W1B A;  4NB3 A;  3I2Z A;  4FF1 A;  3E3X A;  1Y1V B;  2NYZ D;  5C0X I;  4KHP L;  1VMC A;  1WTH A;  2E5L L;  1SRU A;  1PTO C;  2PYK A;  2E8G A;  3RZD B;  4BY1 H;  1H9R A;  1Q82 C;  3HOU B;  2F3W A;  4LK1 C;  5C4X G;  3R2I A;  3GTQ B;  2XWB B;  3PIO A;  1UNS A;  4CKE A;  1NCV A;  3AEV A;  1G91 A;  2NN6 G;  2EXD A;  4B08 A;  1FD7 D;  3P7J A;  4LF6 L;  2VL6 A;  4HMJ A;  1VQG A;  5EBD A;  3BJU A;  3L9A X;  3BG3 A;  5M3M B;  1KDA A;  3MZ5 A;  1QG7 A;  2RSO A;  3IRB A;  1GM5 A;  1KHI A;  5EPJ A;  3V05 A;  1HNZ L;  1AN8 A;  1SFO B;  3KUP A;  5EPL A;  5DAU A;  3TRE A;  4L5T A;  2XTI A;  3PIP A;  1G29 1;  4DF7 A;  2JA8 G;  1DOL A;  1HZ9 A;  1SYC A;  3A56 A;  3H0G G;  2TSS A;  4KKU A;  2I5M X;  3HRZ C;  4A3J G;  2JSO A;  2YTY A;  4K2K A;  4DV0 Q;  4FYD A;  2Z0S A;  1VQL A;  4OL7 A;  3TZU A;  4CJ0 B;  1FYC A;  4GN4 B;  5C4Z A;  2OQK A;  2PI2 A;  4C1N K;  4EGV A;  2CCZ A;  5DNF A;  1SR3 A;  2B2Y C;  4OEM B;  4G7O C;  1HQR D;  1XNQ L;  2CQA A;  2NZH A;  3TSS A;  1F9Q A;  3A8K E;  3A54 A;  4IFD I;  3Q6S A;  1L0W A;  3TZD A;  5I9O A;  1SNO A;  4ZCK A;  5J39 A;  1KDC A;  1EEF D;  2VZA A;  3J81 i;  5IGF A;  3J80 c;  4ILW A;  1K3B C;  1VQ8 A;  4QUF A;  2OF1 A;  3K80 C;  2VQE Q;  1STA A;  5D14 A;  3W5O A;  3CCV A;  3T1Y L;  1FR3 A;  2PQA B;  4Y7N B;  2XRS D;  4K0K L;  5I6Y A;  4PNY A;  1VQ5 A;  2E2D C;  1Y8O B;  1D8L A;  2FIN B;  4IAL A;  2JA6 H;  3C1F A;  3Q0A A;  4DV3 L;  1FNW A;  1TS2 A;  4QJF A;  3E6Z X;  3HKZ E;  5CC4 A;  4GNX A;  5FLM G;  2JA9 A;  4HCE A;  2F0F A;  4YCV A;  1MGS A;  4NDX A;  3ULJ A;  4HJA A;  2LFN A;  1A3U A;  4TQU S;  3GQB A;  1LTG D;  3TDQ A;  3I3C A;  1Q86 C;  2XVS A;  2F4V Q;  2ZJQ A;  4QB4 A;  4G4K A;  4JV5 L;  4DK6 C;  1ZYR D;  1E2Z A;  4HMI A;  2JEA I;  2K03 A;  1S5B D;  3FMC A;  5HGT A;  4I7A A;  1SJE D;  2R7D A;  2MHV A;  4AQY L;  3CC2 A;  1LT3 D;  3TP8 A;  5FO7 B;  3JC6 6;  4YIJ A;  2PMZ E;  3WOE A;  3OYY A;  2CFM A;  4LF4 L;  1O7I A;  3MAQ A;  1CZG A;  3RMH A;  4F8M A;  3Q23 A;  3HGB A;  1G6Z A;  4JI8 L;  3KLS A;  4OWW B;  2EVB A;  2FMM A;  2QDB A;  3F2C A;  3GTM H;  4QF4 A;  2KCN A;  1PH3 A;  1NAP A;  4CBV A;  3H94 A;  3M85 A;  2ALY B;  3S1M H;  2Q2U A;  3GTO B;  1TWG B;  1I5F A;  1A2T A;  3S2H B;  3FKI G;  5E4X A;  3QG1 A;  1IBL L;  1J5E Q;  2WKD A;  4PMW A;  4DV7 L;  1CT1 D;  1AH9 A;  4A3F B;  3IFD A;  2NVY H;  4OIJ A;  1XJV A;  1PMR A;  3PSI A;  1HRJ A;  1YJ9 A;  4LF7 L;  3PO2 B;  1H9K A;  1OXV A;  1B2T A;  3NK9 A;  3I4M B;  1STY A;  1LT5 D;  1TWH H;  1UE5 A;  4X65 L;  1KAB A;  1XMO L;  4ME5 A;  1R9T H;  2K4K A;  1BQQ T;  1XPU A;  2OT2 A;  2NUC A;  1PH2 A;  3AMU A;  5BR8 Q;  3HZX A;  4LF8 L;  3MXU A;  2AUK A;  4LF9 Q;  4BY7 B;  3SGI A;  1WCM B;  1XPO A;  1YNJ D;  3RLO A;  1YNN C;  4KMU C;  2UUB L;  5I4D A;  1PZJ D;  3SK8 A;  3K6O A;  1C7Y A;  2E74 C;  4A93 H;  4A3D H;  5C44 H;  2L4N A;  3KYH C;  3QOJ A;  1PH9 A;  1B44 D;  1SMY D;  2NVX H;  1EWH A;  1PHJ A;  5CBA E;  1KAW A;  3SK5 A;  3DEP A;  1W2B A;  4I7Z C;  4YWK A;  1RHP A;  3J80 L;  1CA5 A;  1ASY A;  2BOS A;  4GS3 A;  4LFA Q;  2Q8T A;  2R92 B;  3CCJ A;  4DR7 L;  3ZYY X;  2JYO A;  2LSS A;  3OTO L;  5KYI A;  4JBJ A;  2CQO A;  1B50 A;  2H4O A;  3I4O A;  1NY4 A;  1QUQ A;  1ZKO A;  5C3W A;  5KGU A;  2F0U A;  4P71 A;  3J80 E;  2WB1 G;  1SYF A;  1DM0 B;  1U4P A;  5G3L D;  2HUG A;  2E2J H;  2IY5 B;  2L5T A;  1E1T A;  3GDE A;  3HOZ G;  1BKB A;  1KRS A;  4UP9 A;  4KD3 A;  4JYA Q;  3DWA A;  3PO3 H;  2EDG A;  2QA4 A;  2IX3 A;  1M90 C;  1B1Z A;  2K01 A;  2XNA C;  2RQX A;  4DUZ L;  2MQH A;  3NEM A;  2DJF C;  3A5Z B;  2F0N A;  3BDL A;  4XXE A;  2K5V A;  2K5H A;  2ZT9 C;  2J4X A;  5ELC A;  1YBY A;  1JCK B;  4DR5 Q;  4JVZ A;  4GKK Q;  1FGB D;  4BY1 B;  1X3G A;  2LXK A;  3CRK C;  1Y1V H;  2EE1 A;  3U9S A;  5BN3 A;  5C0X H;  4ZKC B;  4PZ8 A;  1W6J A;  3ND9 A;  4LW1 A;  5FJ8 G;  3RZD H;  4X3S A;  5I9P A;  1UUP A;  1JR0 D;  5DM6 3;  1QVC A;  4A3G H;  2EYF A;  3LX0 A;  3A0J A;  2EY1 A;  5IYB H;  1N34 L;  2D0O A;  1I4G A;  3UDF A;  3X3N A;  4DV2 L;  1C4Q A;  4L8J A;  4WJW A;  4X64 Q;  1QNK A;  1PRT C;  1RD9 D;  4NP5 A;  4B3R Q;  4X3U A;  1A3T A;  1PTO F;  3AU7 A;  2B63 H;  3BVZ A;  2AQ1 B;  4ZUJ A;  2UXC L;  1MHW C;  4DR3 L;  4DR4 Q;  1RIP A;  3P20 A;  3NWS A;  2M2L A;  5A2Q L;  1HTP A;  1HR0 Q;  1N32 L;  4XQJ A;  5JEA J;  1PYW D;  3SVM A;  5C5M A;  1JOR A;  1JMC A;  3HEJ A;  1E0B A;  5CGK A;  4LF5 L;  1MIU A;  2MPM A;  4ABN A;  5KYL A;  2N8N A;  3KLS X;  3ND8 A;  1BDO A;  3MXN B;  1JIC A;  1CFM A;  1JOK A;  1X65 A;  3HOX G;  3HOU G;  5A2Q E;  2EY2 A;  1JWM D;  1I6H H;  4H0L C;  3UDX A;  1A62 A;  4A3B B;  4K6L A;  2QW7 A;  2LMC B;  3G71 A;  3L3O C;  5M3F H;  1EZ6 A;  2BDN A;  1Q7Y C;  4JG2 A;  4X6A H;  3N6R A;  1PH7 A;  1NR2 A;  5M3M G;  1VMP A;  2JXM B;  3CRL C;  3CU7 A;  4LUZ A;  4IFD H;  1M4V A;  3MA2 B;  5EKK A;  3NQT A;  4KN4 C;  5EGT A;  2FMC A;  1HXY D;  3R8B A;  1GJX A;  4Q5V A;  1WVL A;  1MBY A;  1KC8 C;  2L11 A;  5F2D A;  3R93 A;  4BS9 A;  1JOO A;  4LUO A;  3TEH B;  3WDN A;  2A6H D;  1Y1W H;  1EFI D;  2BH2 A;  1B7Y B;  1NBW A;  5EAY A;  1HUM A;  4KJN A;  3BDC A;  2ATW A;  1GUS A;  1HNX L;  4NXN Q;  5LMN Q;  1Z7T A;  2JA6 B;  2DUD A;  2R93 B;  1BCP D;  4RH6 A;  4DA2 A;  5IWA Q;  1PDQ A;  3H6M A;  2VQF L;  1OXS C;  5IGC A;  2CHB D;  1X56 A;  5A35 A;  4GOP A;  4CKB A;  3J7A 5;  3BU2 A;  3A55 A;  2VUM H;  1ML0 D;  4JPB W;  5HUR A;  3U4V A;  4KY7 A;  3D0F A;  4GLX A;  4KKS A;  2XN9 C;  2XSC A;  3R3O A;  1BUV T;  5CMD A;  1S5E D;  3H3V C;  1PH4 A;  1VQM A;  4IPC A;  4DV1 Q;  5EJW A;  1ASZ A;  3OIP A;  2JQO A;  1S5F D;  1KD1 C;  5JJK A;  3S1R H;  3A8I E;  1X3E A;  2ZXR A;  2A68 D;  2OCE A;  3K59 A;  1PZK D;  1TVX A;  1JJC B;  2FJ2 A;  3HKS A;  5IP9 G;  2WB1 E;  2Z6B A;  2K04 A;  2A8V A;  2Q8R E;  1GOZ A;  4DNI A;  1BOS A;  1FL0 A;  3GTM B;  3EFX D;  4DV5 L;  3AB9 A;  1QWY A;  1H9S B;  2LXJ A;  4V0B A;  3S1M B;  4O42 A;  4WOR A;  3TP5 A;  4OXP A;  1LAB A;  4OIK A;  4P74 A;  4XDX A;  3PF5 A;  4JI2 L;  3ERQ A;  4QIW E;  2K5N A;  2L9H A;  2QIL A;  3NSW A;  2Q8I B;  1Z9F A;  3F8T A;  4OEL B;  5FLX c;  4X66 L;  3M7G A;  3K7A B;  3GTO H;  1TWG H;  2IL8 A;  2Q2T A;  4BXX H;  3S2H H;  4GNX C;  1EQR A;  3I55 A;  2WV6 D;  1UE6 A;  1WI5 A;  1H9J A;  4IJH A;  3CCE A;  4JI6 Q;  2RSN A;  3NBH A;  5C3E G;  1V9P A;  4A3L H;  1MJC A;  1V1P A;  1KXL A;  4C56 C;  4A75 A;  4A3F H;  4RHR A;  4JK1 C;  2Z1C A;  1T5E A;  4B3T L;  1Q1B A;  1JOQ A;  2F0O A;  3CKI B;  2K33 A;  2CVR A;  4JOI A;  2ZM6 L;  3BYY B;  4UP7 A;  1YIT A;  1EQQ A;  4OGQ C;  2OTL A;  2F0K A;  3C46 A;  1HQM C;  2EIF A;  4OON A;  2A69 D;  1PFM A;  4N9P A;  3SE0 A;  1P16 A;  1TKW B;  3NWT A;  4G7H C;  2KHJ A;  4A3D B;  5C44 B;  3AFP A;  2NVX B;  4K8J A;  2RHQ B;  1PH6 A;  5JJI A;  1WTV A;  2A1A A;  3FP9 A;  2OTJ A;  1CQF A;  2WAQ B;  4HCS A;  1EY9 A;  4MN3 A;  3HKZ G;  4Y52 H;  4JI4 Q;  1G51 A;  5KNB A;  1D1K A;  3D6W A;  3V96 A;  4AIM A;  4O2D A;  1I94 L;  4MHE A;  1O7L A;  1B53 A;  3E0J A;  3PO2 G;  4JI3 L;  1SMX A;  4IUT A;  2ZJP A;  4UHV A;  5IYC H;  1STN A;  4C3H G;  1XX8 A;  5FO9 B;  5EPK A;  2R6G A;  2I0Q A;  2EYL A;  5E3F A;  2LS0 1;  3VR6 A;  1W6K A;  4JBK A;  3KF6 B;  3RR5 A;  1PVO A;  2B2W A;  3L2P A;  1IHZ A;  2A6E C;  5KRU A;  2BDO A;  3J7A V;  4BY7 G;  3NTH A;  1WCM G;  3FVQ A;  4CJ1 B;  1LUZ A;  1KAA A;  2F52 A;  2F3V A;  3LWE A;  1X32 A;  1NJI C;  1PTO B;  3MHB A;  3PUX A;  3S1Q H;  1EEI D;  1XTD A;  2C35 B;  3DM1 A;  4H44 C;  3T4A C;  3I90 A;  5M5Y H;  1LTT D;  2CW0 D;  1FGU A;  3F1Z A;  1D5M C;  4XIG S;  5COR A;  3PIO 3;  1OTC A;  1PFB A;  5GRO A;  4NW2 A;  4KI0 A;  4JI1 L;  2MJ8 A;  1E22 A;  4GKJ Q;  4IN3 A;  4A3E G;  2R92 G;  5JEA G;  1NMG A;  3V2T A;  1FJG Q;  2BH8 A;  3FDT A;  2RA4 A;  1NR4 A;  3D4D A;  1IBM L;  2KA7 A;  5IYD H;  3OPO A;  1N9W A;  4FO2 A;  4A3G B;  3KDF B;  5HY6 A;  2AQ3 B;  1CKN A;  2N78 A;  3RN2 A;  1ET6 A;  2BE5 D;  1B3Q A;  3PIP 3;  4R4C A;  1TT2 A;  4R9W A;  4B9X A;  1M8A A;  5FLX L;  2B63 B;  1L1O A;  4A3J H;  4OWX B;  1K0S A;  2K1B A;  3QB3 A;  4DAY B;  1E2V A;  3HOY G;  1BF4 A;  3M4Y A;  4PMB A;  1DGS A;  1HFN A;  2JEB I;  3D4W A;  3Q8D A;  4DFA A;  4H02 A;  4FF4 A;  4X62 L;  1G2T A;  2EYO A;  1DOK A;  3RLN A;  4B3M L;  3M7N A;  2B2T C;  1KNA A;  4CDE C;  3QO2 A;  5ELF A;  5EBC A;  3M3Y B;  1G2S A;  2AMC B;  2HDM A;  1WTW A;  3HFZ B;  2MFI A;  4TVA B;  1N36 Q;  2WP8 J;  3D4R A;  4L63 B;  4A3C H;  5GAH C;  5FLX E;  1PRT F;  4IPH A;  2PNH A;  3UDG A;  4WRD A;  2DJG C;  4ZYS A;  4BY1 G;  4C3J B;  2HCI A;  1I6H B;  1QJO A;  1PYB A;  4PQX A;  1N33 L;  1SRO A;  1QOH A;  3G48 A;  1K9M C;  1A15 A;  5M3F B;  1VQE A;  1LYL A;  2F0H A;  3S14 H;  4JI5 L;  2CKZ B;  2K5D A;  1RKN A;  4A3B H;  1KIX A;  5ELO A;  4LFC Q;  4LFB Q;  4DN4 M;  4EQP A;  1TS4 A;  1EZ8 A;  1YIJ A;  2JA5 H;  4RWS C;  1I94 Q;  1VQP A;  4H7B A;  4DNR B;  3PUW A;  3I56 A;  1Y1W B;  2Q2H A;  4DR2 Q;  4FXD A;  3WOF A;  4EVO A;  2Q2I A;  4B3S L;  4DV6 L;  4HIM A;  3T51 B;  2IT1 A;  3GV6 A;  4UAI A;  1HUN A;  4OX9 L;  3LWU A;  3TS0 A;  5C0X J;  3A5U A;  4HIK A;  1JJG A;  3X3M A;  1AZP A;  4A3M H;  1HNW Q;  1DYQ A;  3SK4 A;  3GTG B;  3GV3 A;  2HDL A;  2R93 H;  2VUM B;  4TKO B;  5JPN C;  3H3V H;  5J1Z A;  3HP3 A;  4QUC A;  4ALP A;  2E2H H;  2YV5 A;  2IHF A;  4GN5 A;  1X55 A;  1RTN A;  4BBR B;  4YY3 Q;  4DAM A;  1SNP A;  4JC0 A;  4IUP A;  2AWO A;  2CH4 W;  1BO0 A;  5CBE E;  3TN2 A;  4P2C B;  2UXB L;  5ELE A;  1VQ7 A;  3DLL A;  3S1R B;  3S1N H;  4LUV A;  2ZXO A;  2R7Z B;  2BA1 A;  2UU9 L;  3UE1 A;  4BWG B;  1XTC D;  2JA7 B;  3C1E A;  4RGM A;  4KHP Q;  4PG3 A;  4DK3 C;  1K3R A;  1H9S A;  1TR5 A;  1VQB A;  3LGJ A;  2E5L Q;  2JK8 A;  5L37 A;  4QGU A;  3BZK A;  3VA7 A;  3FHW A;  3U50 C;  2PPB C;  1HZA A;  1EY8 A;  4LF6 Q;  2F0I A;  4CDD C;  3BDO A;  2JA6 G;  2HHH L;  4DU9 A;  2A5H A;  1VQ4 A;  2Y0S B;  1ZYR C;  1E24 A;  2K52 A;  1V1O A;  4LJZ C;  1PA6 A;  1EIH A;  1HNZ Q;  2G9H D;  1SYB A;  2X6G A;  5IT9 c;  1VQ9 A;  2P5Z X;  4IFD J;  1LTA D;  1CI3 M;  3N52 A;  1EU3 A;  2UXD L;  4GOP C;  4JI7 L;  3K7A H;  4EX5 A;  2B8G A;  2KED A;  3ONA B;  2KEE A;  1B9N A;  3RZO H;  4LWC A;  3I4L A; 
#chains in the Genus database with same CATH homology
 1K8M A;  1J9O A;  1IW7 D;  1Z47 A;  1I4Q A;  2EJM A;  2AUJ D;  3J7Y W;  4Z9C B;  4K5W A;  1NSN S;  1HPC A;  2PW7 A;  1Y69 U;  4F7X A;  3HOV B;  3MEH A;  3BZD B;  3MWY W;  5K36 H;  1LT4 D;  4HSP A;  1YNN D;  4XYO A;  2WKC A;  5LL6 X;  3BVM A;  3HS0 C;  1EY0 A;  1RJT A;  4ZK9 B;  4B9W A;  1EY7 A;  4J1M A;  2O2L D;  1TS3 A;  2IJ0 A;  3T56 B;  3GO5 A;  1G8Z D;  1QCB D;  1CHP D;  4L6T B;  4ZUI A;  5FK9 C;  1SE4 A;  1ZXT A;  4CHT B;  5M9O A;  1EL0 A;  2AWN A;  2BCO A;  1AEX A;  1I4P A;  1STH A;  1YNJ C;  2FHT A;  3KF8 A;  1CK1 A;  4IZ8 A;  3ITP A;  1IKL A;  4U67 3;  1DXM A;  4NKL A;  1EQT A;  4QMG A;  3RD4 A;  3TBI B;  1HA5 A;  5D3I B;  1CTM A;  5EKI A;  2NN6 I;  3S1Q B;  2IX0 A;  5FKA C;  5M5Y B;  4OO1 H;  2I46 A;  3RLF A;  1SYD A;  1PTO H;  2SEB D;  1EQV A;  3VA5 A;  3HG9 A;  5JVG 3;  4MIU A;  4IUN A;  2KHS A;  4K8I A;  1SNQ A;  4N9T A;  1ONL A;  1PRT B;  1F9P A;  1SEB D;  2PO4 A;  4X3T A;  4XQN A;  2XIW A;  2F0V A;  4FVM A;  4V19 0;  4A3J B;  1PRT D;  4FF3 A;  5IT9 L;  2IW3 A;  2OEO A;  1SSO A;  2TMP A;  2N55 A;  3A7A B;  1F77 A;  2WII B;  1TS5 A;  1JQY D;  4KD4 A;  2B2W C;  2PZU A;  3P1H A;  1GHK A;  2NWG A;  1S4Z A;  3GTP B;  2EZV A;  2R3Z A;  3VYU A;  2B39 A;  4BA2 I;  1NUC A;  2K5Q A;  5IT9 E;  1MSH A;  2F0L A;  1WTR A;  1Y8N B;  5C0X G;  4GZY C;  4IUQ A;  3S14 B;  1F2M A;  2NB0 A;  1AZQ A;  2F0S A;  5D3D A;  1VF5 C;  5KIX A;  3K5N A;  2JA5 B;  1SE2 A;  5C4H A;  4LMQ D;  3PV0 A;  3FPP A;  1QE6 A;  1U4M A;  1WTP A;  3BYT B;  3UI2 A;  2F03 A;  2K6A A;  5JVH 3;  4A3M B;  1EYA A;  3I72 A;  1Q8I A;  2EYP A;  3VYS A;  3OMC A;  1ILQ A;  4DK1 A;  2X6L A;  4ZKB B;  3I70 A;  1PZI D;  2E2H B;  1EYD A;  3QWN A;  1FNU A;  2EPB A;  1CHQ D;  2JE6 I;  2IX1 A;  5ELD A;  3S1N B;  2RKS A;  1GUN A;  3D8G A;  4IFD G;  4ID6 A;  1DCZ A;  2H1E A;  1BCP C;  3IKJ A;  2MUY A;  1STB A;  3FKI B;  1GUW A;  3T13 A;  2ZXP A;  5IIF A;  2M9V A;  3SHL A;  3FEW X;  1RF2 D;  4RA8 A;  1SE3 A;  1I4R A;  3W2D A;  3NE5 B;  3OW7 A;  4ULL A;  2PZW A;  1LTI D;  1SNC A;  3MC0 B;  2BA0 A;  3DWQ A;  4CKC A;  5CYU A;  5DM7 3;  2EXZ A;  5CV8 A;  3GD7 A;  1UEA B;  4X3K A;  1D1I A;  1D2B A;  3MFG A;  3MFY A;  3U9O A;  4K14 A;  1I4H A;  4C2M B;  3RZO B;  2R61 A;  2DY8 A;  1O78 A;  4BBS B;  3G7L A;  3QOL A;  1U9R A;  3W3A A;  5JOB A;  2VB2 X;  4TSS A;  1Z6H A;  1F9S A;  1VCI A;  4KKT A;  1GUO A;  4K2L A;  3FPU B;  2DN8 A;  2JP1 A;  1Q3L A;  3OWE B;  1ENA A;  4KN7 C;  5M5W B;  2RDH A;  1GUT A;  1HHV A;  2LKV A;  4K5V A;  4UDU C;  5T1I A;  2NTT A;  5FO8 B;  4DGZ A;  1XXG A;  3K57 A;  1RCV D;  2D5D A;  4TRD A;  1Q1E A;  1WTQ A;  4XT1 B;  2B2U A;  2KJX A;  2A69 C;  3L7Z C;  2EYH A;  3S17 B;  4QIW B;  1X3Q A;  1BBX C;  3K5M A;  1LV9 A;  4FXG C;  5CV7 A;  1Q12 A;  3KK7 A;  4RKL A;  3S2D B;  4U68 A;  5IGG A;  4M1U B;  5IGD A;  5JJZ A;  5ELB A;  4OO1 I;  1GXD C;  1V8Q A;  4FXK C;  4DAV A;  2NN6 H;  1DOM A;  5ISR A;  3MVV A;  1EWC A;  3TP6 A;  5TSS A;  1XWE A;  1RDP D;  4HSV A;  1PTO D;  1I6V C;  3J81 L;  4A3I B;  3NQI A;  2F0J A;  1A6X A;  5J22 A;  3M4O B;  1TWF B;  2L55 A;  4LAA A;  4FNF A;  3FRP B;  3DMU A;  3NXW A;  1SYE A;  2CW0 C;  5G3L F;  3A7L A;  3G6J B;  3OHX C;  3VR5 A;  3J81 E;  1O7Z A;  2DY7 A;  3NHH A;  3HOX B;  2D2C C;  1JWU D;  2HQE A;  3PUY A;  4G57 A;  4K6D A;  1ZEQ X;  1FNV A;  1GHJ A;  2D62 A;  3MXN A;  5LHY 1;  3K5L A;  2N88 A;  2E2I B;  2QCP X;  1CZW A;  1QB5 D;  2EOT A;  3S9W A;  1T5X D;  3CQZ B;  1TWA B;  3I4N B;  1A3V A;  5IGE A;  4C3I B;  2BE5 C;  1I4X A;  1F2Y A;  1LLR D;  3VR3 A;  4KK7 A;  2KQ3 A;  2PNR C;  3KBX A;  5LL6 S;  1V43 A;  2RBM A;  5AFW A;  1ENF A;  1EY4 A;  5BN4 A;  3BVG A;  1BNZ A;  1BXT A;  3DHQ A;  2WAC A;  1B3A A;  4RCN A;  1DZ1 A;  5M5X B;  4QCL A;  4PV1 C;  1QNU A;  1SBB B;  4C1N I;  4R8I A;  2HCC A;  5CV6 A;  3ERO A;  4ZAI A;  4RAU C;  3VYT A;  4RGT A;  4RFB A;  2L0C A;  2VXW A;  4Q0F A;  2QEJ C;  1TY0 A;  1HTL D;  4IUV A;  1ESF A;  3DWP A;  5E4W C;  4RKB A;  1B4O A;  1PLF A;  3Q22 A;  5I2Y A;  2E76 C;  3IFT A;  1BR9 A;  3EA6 A;  4HED A;  1TII D;  3F2U A;  2Z4I A;  1D6E C;  2KEC A;  1KDB A;  4HN7 A;  2SNS A;  1K83 B;  1AW7 A;  5C3E B;  1SND A;  5KNC A;  2ICE C;  4KY5 A;  3GTK B;  3EQL C;  1BCP F;  1EIG A;  4PMC A;  2ICI A;  5I2X A;  2OXP A;  3P75 A;  1PXU A;  1PFN A;  3K58 A;  4EQO A;  1ESR A;  2QF7 A;  2NVT B;  1KLU D;  3JAM L;  5CV5 A;  4NMZ A;  2B2V A;  1ROD A;  1EY5 A;  3HOW B;  5D65 A;  3R2T A;  2YYZ A;  5KEE A;  1SXT A;  2F4I A;  1TQO A;  3MTS A;  3O13 A;  4KJO A;  1WTX A;  3HKZ B;  1C8C A;  2F0G A;  1H9M A;  4RGN A;  4XYQ A;  1U4L A;  3GTJ B;  2LY7 A;  4RHS A;  3JAM E;  1WTO A;  2F0D A;  3K5O A;  3NTI A;  1SAP A;  3MXP A;  2DNE A;  1MD2 D;  2O5I C;  3J7A F;  1D5Z C;  3I8Z A;  1WD0 A;  3KLR A;  1SNM A;  4RCO A;  1OO9 B;  1XYI A;  2PQE A;  4C3H B;  1IW7 C;  1EY6 A;  2MP1 A;  3OMG A;  3VR4 A;  3A8J E;  4R8N A;  2SOB A;  1X3P A;  1V1P B;  3H09 A;  1OXU A;  4G7Z C;  1Q90 A;  2PMZ B;  3D3R A;  3PUZ A;  2E75 C;  3DXJ C;  4F88 A;  4ODG A;  2NVQ B;  3T16 A;  3QIA A;  2K05 A;  1F2Z A;  1O7Y A;  2D9U A;  3IAY A;  4CJ2 C;  1LTS D;  1II3 A;  2IWH A;  3TP7 A;  3URY A;  4WFN 3;  1SYG A;  2K32 A;  3H91 A;  5JAV A;  4IQZ A;  1SMY C;  1SJH D;  2F0Q A;  5K36 G;  3DUZ A;  4IUR A;  1S5C D;  4A3E B;  2NZ1 D;  1R4Q B;  2L1B A;  2O4X A;  1GUG A;  5C4X B;  1ENC A;  4O1N A;  2F0T A;  3MXG A;  1CM9 A;  2XRQ D;  2PZT A;  4HAE A;  1A2U A;  5I6W A;  4KTA A;  5K5P A;  4ZLT F;  1QIL A;  3IL8 A;  3HOY B;  1AP0 A;  2NTS A;  2B2T A;  2IPK D;  4E6I A;  4IUU A;  3CHB D;  5EQ0 A;  2B2U C;  4JBW A;  4DAY A;  1WD1 A;  2ID0 A;  2JA8 B;  4EQN A;  3H0G B;  2K28 A;  2A74 C;  1IKM A;  4HTH A;  1MI2 A;  1LT6 D;  1K8O A;  2RDG A;  4KHV A;  3OOC A;  3C3L A;  2F1M A;  4DXG A;  2B2Y A;  1IL8 A;  4OHJ A;  2M00 A;  4OO1 G;  3S16 B;  1VF7 A;  2J7Z A;  2F0W A;  3EJI A;  1I3Q B;  1KTK A;  4H13 C;  3GP7 A;  5EKL A;  2I07 B;  3SXH A;  1O80 A;  5E1F A;  1JWS D;  3KBG A;  3K0Y A;  1JB3 A;  5C3X A;  2A73 B;  2QKI C;  1C48 A;  5C4J B;  1MSG A;  2AQ2 B;  1AFP A;  1U4R A;  4J6H A;  1UAP A;  2EJG C;  1SDF A;  4DK0 A;  2RVL A;  1J8I A;  3SR1 A;  5C5L A;  5DEH A;  4S3S A;  3QJY A;  1STG A;  3NP8 A;  1IYU A;  3EVQ A;  1IYV A;  1B9M A;  5IOD A;  3VYR A;  2WIN B;  2PW5 A;  4F87 A;  1EOT A;  1LTB D;  3SDZ A;  4C3I G;  3PMF A;  1HA6 A;  1ET9 A;  4RGO S;  4C3J G;  1BCP B;  1R4P B;  3Q24 A;  3NBI A;  3VR2 A;  1HFG A;  2EY5 A;  2A6H C;  3RUZ A;  4HR7 B;  5C6A A;  1L0X B;  1KNE A;  1I50 B;  1CA6 A;  2L12 A;  2EY6 A;  2VNU D;  2KVM A;  4M8A A;  4KV6 A;  3BS1 A;  1OXT A;  4XQQ A;  2Z4H A;  1LO5 D;  1L0Y B;  3SEB A;  5CV9 A;  1LTR D;  1DD2 A;  5CV4 A;  2Z8L A;  2J0T D;  5FOB B;  2C9O A;  2KCC A;  2A68 C;  3SK6 A;  2O5J C;  4K5X A;  1STE A;  4FF2 A;  3DEO A;  2NBF A;  1RTO A;  2F0P A;  1ILP A;  2GA4 B;  2C5C A;  2G9D A;  2K5W A;  1DON A;  2MGS A;  2KOL A;  3E5S A;  1JE4 A;  4J8Q A;  4AYB B;  2YU9 B;  4CGY B;  3NTK A;  3C2P A;  2NVY B;  1EYC A;  3NUC A;  4ZRZ A;  2B8F A;  3PUV A;  2V4D A;  2SDF A;  4DNT B;  1OXX K;  3S15 B;  1TU2 B;  5BN5 A;  1TWH B;  4FP5 D;  3NPP A;  3OWF A;  2KUM A;  2XWJ B;  3D6C A;  1R9T B;  5IOC A;  3OSO A;  1HCZ A;  1TY2 A;  4KY6 A;  4DAP A;  2WB1 B;  1TWC B;  2EYJ A;  1LAC A;  1F2L A;  3I91 A;  3HOZ B;  2ENB A;  3OIQ A;  4A93 B;  3LNN A;  2B2V C;  1E2W A;  4BA1 I;  4DXF A;  3D31 A;  4XT3 B;  4KHZ A;  4I65 A;  1Y8P B;  5IGB A;  2DNC A;  5KND A;  2F0E A;  2A6E D;  1JC7 A;  2X69 A;  1EU4 A;  1KLG D;  2EJF C;  5CR3 A;  2RDF A;  1F9R A;  5NUC A;  5JPM C;  5JEA H;  2FFK B;  3I73 A;  4A3K B;  1CQV A;  2EYM A;  4XTC S;  2VB3 X;  2E2J B;  1S5D D;  5COY A;  1ICW A;  1DJR D;  5T1G A;  1VDZ A;  3TME A;  3PO3 B;  4ZQ3 A;  2F0M A;  3GTL B;  1D5X C;  2K7V A;  2SNM A;  2PCF B;  3T53 B;  4FF1 A;  1Y1V B;  2NYZ D;  5C0X I;  1VMC A;  1PTO C;  2PYK A;  3RZD B;  1H9R A;  3HOU B;  2F3W A;  4LK1 C;  3R2I A;  3GTQ B;  2XWB B;  1UNS A;  4CKE A;  1NCV A;  1G91 A;  2NN6 G;  4B08 A;  1FD7 D;  3P7J A;  4HMJ A;  5EBD A;  3L9A X;  3BG3 A;  5M3M B;  1KDA A;  3MZ5 A;  1QG7 A;  2RSO A;  5EPJ A;  3V05 A;  1AN8 A;  1SFO B;  3KUP A;  5EPL A;  5DAU A;  1G29 1;  4DF7 A;  1DOL A;  1SYC A;  3A56 A;  2TSS A;  4KKU A;  3HRZ C;  2JSO A;  4K2K A;  4FYD A;  4OL7 A;  3TZU A;  4CJ0 B;  1FYC A;  5C4Z A;  4C1N K;  4EGV A;  5DNF A;  2B2Y C;  4G7O C;  1HQR D;  2CQA A;  3TSS A;  1F9Q A;  3A8K E;  3A54 A;  4IFD I;  3Q6S A;  3TZD A;  5I9O A;  1SNO A;  5J39 A;  1KDC A;  1EEF D;  5IGF A;  4ILW A;  4QUF A;  2OF1 A;  1STA A;  5D14 A;  1FR3 A;  4Y7N B;  2XRS D;  5I6Y A;  4PNY A;  2E2D C;  1Y8O B;  2FIN B;  4IAL A;  3C1F A;  3Q0A A;  1FNW A;  1TS2 A;  3E6Z X;  5CC4 A;  4HCE A;  2F0F A;  1MGS A;  4NDX A;  2LFN A;  1A3U A;  4TQU S;  3GQB A;  1LTG D;  3TDQ A;  3I3C A;  2XVS A;  4QB4 A;  4G4K A;  1ZYR D;  1E2Z A;  4HMI A;  2JEA I;  2K03 A;  1S5B D;  3FMC A;  5HGT A;  1SJE D;  2MHV A;  1LT3 D;  3TP8 A;  5FO7 B;  4YIJ A;  3WOE A;  3MAQ A;  1CZG A;  3RMH A;  4F8M A;  3Q23 A;  3HGB A;  1G6Z A;  3KLS A;  2EVB A;  2FMM A;  2QDB A;  4QF4 A;  2KCN A;  1NAP A;  4CBV A;  3H94 A;  3M85 A;  3GTO B;  1TWG B;  1A2T A;  3S2H B;  5E4X A;  3QG1 A;  2WKD A;  4PMW A;  1CT1 D;  4A3F B;  3IFD A;  4OIJ A;  1PMR A;  1HRJ A;  3PO2 B;  1H9K A;  1OXV A;  1B2T A;  3NK9 A;  3I4M B;  1STY A;  1LT5 D;  1KAB A;  4ME5 A;  1BQQ T;  2OT2 A;  2NUC A;  3AMU A;  3HZX A;  3MXU A;  2AUK A;  4BY7 B;  1WCM B;  1YNJ D;  1YNN C;  4KMU C;  5I4D A;  1PZJ D;  3SK8 A;  3K6O A;  2E74 C;  2L4N A;  3QOJ A;  1B44 D;  1SMY D;  1EWH A;  5CBA E;  3SK5 A;  3DEP A;  4I7Z C;  1RHP A;  3J80 L;  1CA5 A;  2BOS A;  2Q8T A;  2R92 B;  3ZYY X;  2JYO A;  5KYI A;  1B50 A;  2H4O A;  1ZKO A;  5C3W A;  5KGU A;  2F0U A;  3J80 E;  1SYF A;  1DM0 B;  1U4P A;  5G3L D;  2HUG A;  2L5T A;  4KD3 A;  3DWA A;  2EDG A;  2IX3 A;  1B1Z A;  2K01 A;  2XNA C;  2RQX A;  2F0N A;  3BDL A;  4XXE A;  2ZT9 C;  2J4X A;  5ELC A;  1JCK B;  1FGB D;  4BY1 B;  3CRK C;  2EE1 A;  3U9S A;  5BN3 A;  5C0X H;  4ZKC B;  1W6J A;  3ND9 A;  4X3S A;  5I9P A;  1UUP A;  1JR0 D;  5DM6 3;  2EYF A;  3LX0 A;  2EY1 A;  1I4G A;  3X3N A;  1C4Q A;  4L8J A;  4WJW A;  1QNK A;  1PRT C;  1RD9 D;  4NP5 A;  4X3U A;  1A3T A;  1PTO F;  3AU7 A;  3BVZ A;  2AQ1 B;  4ZUJ A;  3P20 A;  3NWS A;  2M2L A;  5A2Q L;  1HTP A;  4XQJ A;  5JEA J;  1PYW D;  3SVM A;  5C5M A;  1JOR A;  3HEJ A;  1E0B A;  5CGK A;  5KYL A;  2MPM A;  4ABN A;  3KLS X;  3ND8 A;  1BDO A;  1JIC A;  1CFM A;  1JOK A;  5A2Q E;  2EY2 A;  1JWM D;  4H0L C;  4A3B B;  4K6L A;  2LMC B;  3L3O C;  1EZ6 A;  2BDN A;  3N6R A;  1NR2 A;  1VMP A;  2JXM B;  3CRL C;  3CU7 A;  4IFD H;  1M4V A;  3MA2 B;  5EKK A;  3NQT A;  4KN4 C;  5EGT A;  2FMC A;  1HXY D;  3R8B A;  1GJX A;  4Q5V A;  1WVL A;  1MBY A;  2L11 A;  5F2D A;  3R93 A;  4BS9 A;  1JOO A;  3WDN A;  2A6H D;  1EFI D;  1HUM A;  4KJN A;  3BDC A;  1GUS A;  2JA6 B;  1Z7T A;  2R93 B;  1BCP D;  4RH6 A;  4DA2 A;  1PDQ A;  3H6M A;  1OXS C;  5IGC A;  2CHB D;  5A35 A;  4CKB A;  3A55 A;  1ML0 D;  5HUR A;  4KY7 A;  4KKS A;  2XN9 C;  2XSC A;  3R3O A;  1BUV T;  5CMD A;  1S5E D;  3H3V C;  5EJW A;  3OIP A;  1S5F D;  3A8I E;  2ZXR A;  2A68 D;  3K59 A;  1PZK D;  1TVX A;  2FJ2 A;  2K04 A;  2Q8R E;  1GOZ A;  1BOS A;  3GTM B;  3EFX D;  3AB9 A;  1QWY A;  1H9S B;  4V0B A;  3S1M B;  4O42 A;  4WOR A;  3TP5 A;  1LAB A;  4OIK A;  4XDX A;  3ERQ A;  2QIL A;  2L9H A;  3NSW A;  2Q8I B;  3M7G A;  3K7A B;  2IL8 A;  2WV6 D;  1H9J A;  2RSN A;  3NBH A;  1V1P A;  4C56 C;  4RHR A;  4JK1 C;  2Z1C A;  1T5E A;  1Q1B A;  1JOQ A;  2F0O A;  3CKI B;  2K33 A;  2CVR A;  3BYY B;  4OGQ C;  3C46 A;  2F0K A;  1HQM C;  2A69 D;  1PFM A;  4N9P A;  3SE0 A;  1TKW B;  3NWT A;  4G7H C;  4A3D B;  5C44 B;  2NVX B;  4K8J A;  1WTV A;  1CQF A;  2WAQ B;  4HCS A;  1EY9 A;  4MN3 A;  5KNB A;  1D1K A;  3D6W A;  3V96 A;  4MHE A;  1O7L A;  1B53 A;  3E0J A;  4IUT A;  1STN A;  4C3H G;  1XX8 A;  5FO9 B;  5EPK A;  2R6G A;  2EYL A;  5E3F A;  2LS0 1;  3VR6 A;  1W6K A;  2B2W A;  1IHZ A;  2A6E C;  5KRU A;  2BDO A;  3J7A V;  3NTH A;  3FVQ A;  4CJ1 B;  1KAA A;  2F3V A;  3LWE A;  1X32 A;  1PTO B;  3MHB A;  3PUX A;  1EEI D;  3DM1 A;  4H44 C;  3T4A C;  3I90 A;  1LTT D;  2CW0 D;  3PIO 3;  4XIG S;  1D5M C;  5COR A;  1PFB A;  4NW2 A;  4KI0 A;  2MJ8 A;  4IN3 A;  5JEA G;  3V2T A;  3FDT A;  2RA4 A;  1NR4 A;  3D4D A;  2KA7 A;  3OPO A;  4FO2 A;  4A3G B;  2AQ3 B;  1ET6 A;  2BE5 D;  3PIP 3;  1TT2 A;  4R9W A;  4B9X A;  1M8A A;  5FLX L;  2B63 B;  2K1B A;  3QB3 A;  1E2V A;  1BF4 A;  3M4Y A;  4PMB A;  1HFN A;  2JEB I;  3D4W A;  4DFA A;  4FF4 A;  1G2T A;  2EYO A;  1DOK A;  3M7N A;  2B2T C;  1KNA A;  3QO2 A;  5ELF A;  5EBC A;  3M3Y B;  1G2S A;  2HDM A;  1WTW A;  2WP8 J;  3D4R A;  4L63 B;  5FLX E;  1PRT F;  4WRD A;  4ZYS A;  4C3J B;  2HCI A;  1I6H B;  1QJO A;  4PQX A;  1QOH A;  1A15 A;  5M3F B;  2F0H A;  2K5D A;  1RKN A;  4DN4 M;  4EQP A;  1TS4 A;  1EZ8 A;  4RWS C;  4H7B A;  4DNR B;  3PUW A;  1Y1W B;  4FXD A;  3WOF A;  4EVO A;  3T51 B;  2IT1 A;  3GV6 A;  4UAI A;  1HUN A;  3LWU A;  5C0X J;  3X3M A;  1AZP A;  1DYQ A;  3SK4 A;  3GTG B;  3GV3 A;  2HDL A;  2VUM B;  4TKO B;  5JPN C;  5J1Z A;  3HP3 A;  4QUC A;  1RTN A;  4BBR B;  1SNP A;  5CBE E;  4IUP A;  2AWO A;  1BO0 A;  3TN2 A;  4P2C B;  5ELE A;  3S1R B;  2R7Z B;  2ZXO A;  2BA1 A;  4BWG B;  1XTC D;  2JA7 B;  3C1E A;  4RGM A;  1TR5 A;  1H9S A;  3VA7 A;  2PPB C;  1EY8 A;  2F0I A;  3BDO A;  4DU9 A;  2A5H A;  2Y0S B;  1ZYR C;  1V1O A;  4LJZ C;  1EIH A;  2G9H D;  1SYB A;  2X6G A;  4IFD J;  1LTA D;  1CI3 M;  3N52 A;  1EU3 A;  2B8G A;  2KED A;  3ONA B;  2KEE A;  1B9N A;  3I4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...