1LT6D

Heat-labile enterotoxin b-pentamer complexed with metanitrophenylgalactoside
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Structural foundation for the design of receptor antagonists targeting Escherichia coli heat-labile enterotoxin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P
ec nomenclature
pdb deposition date 1997-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt6D00
1L0YB 4RGOS 2XN9C 4O1NA 3TSSA 2NTSA 1S5BD 1ET9A 5TSSA 1S5DD 3URYA 4L6TB 1PTOD 5ELBA 1LTBD 1PRTD 1TY0A 4RH6A 1HTLD 2CHBD 1KTKA 2QILA 4Z9CB 1SJED 4RGNA 1PTOH 1XTCD 1CHPD 1LT4D 3O13A 1GOZA 1QILA 1LO5D 2TSSA 1S5FD 1LT6D 3W2DA 3BZDB 1M4VA 3DWAA 4BWGB 2WV6D 1EEID 1EU3A 1ENFA 1LTSD 1D6EC 1B1ZA 2NTTA 1JR0D 1SXTA 1LTID 1UUPA 1BXTA 3BYYB 3BYTB 1JWMD 2R61A 3GP7A 3R2IA 1RD9D 1STEA 1BCPD 1EFID 2AQ3B 4L63B 2SEBD 4RGMA 4TSSA 1PTOB 5FK9C 1PRTB 1I4HA 2G9HD 1D5MC 1TS2A 1XXGA 4OHJA 1SJHD 1I4GA 1LTGD 3R2TA 1LTRD 1G8ZD 1CQVA 1V1PA 3BVZA 1PZID 1FD7D 1V1PB 4RHRA 2Z8LA 1BCPF 3SEBA 1JQYD 4RFBA 1RDPD 1LLRD 5ELFA 5I4DA 3EFXD 2O2LD 3MC0B 2AQ1B 1PZJD 1CT1D 4UDUC 1V1OA 1TY2A 1HXYD 1JWUD 2RDGA 1EWCA 1HQRD 2XNAC 4RCOA 1RCVD 1PZKD 2J4XA 1MD2D 1AN8A 1T5XD 5ELCA 1PTOC 1EEFD 1ET6A 1PRTC 1JWSD 1I4RA 1SBBB 1LT5D 2XRSD 5FKAC 1SE3A 3BVGA 3R8BA 3OWEB 1KLUD 1S5ED 4RHSA 2IJ0A 1AW7A 1TS5A 3KLSX 1FNVA 3BVMA 1ESFA 5ELDA 4C56C 2ICIA 1EU4A 1S5CD 1TS3A 1CK1A 4K6LA 1SEBD 3EA6A 4DXFA 1D5ZC 3CHBD 1HA5A 4DXGA 4RGTA 1BCPB 1FNUA 1KLGD 2QEJC 5D3IB 3DWPA 1CHQD 1D5XC 1SE4A 5D3DA 1LTAD 1DYQA 1I4PA 1BCPC 1JCKB 1LTTD 4ZYSA 1F77A 1FGBD 1RF2D 2IPKD 2XRQD 1LT3D 5ELEA 1TS4A 3DWQA 1DJRD 3V05A 1I4XA 1PYWD 2RDHA 3MFGA 1I4QA 1PTOF 1B44D 1UNSA 1PRTF 1L0XB 1FNWA 1SE2A 2AQ2B
chains in the Genus database with same CATH superfamily
4X3UA 4POFA 3LNNA 4ZK9B 4JVZA 2DNEA 3H0GH 4UHVA 1VQNA 4KTAA 2QDBA 5FLXL 4XXEA 3F8TA 4B3RL 4BA2I 4YWMA 4C3IB 5EBCA 4DR7Q 1AP0A 1SJED 4WFN3 4LF4Q 2EJGC 1BNZA 5EQ0A 1VQ9A 5CV5A 1SYDA 4KV6A 4FP5D 4CDDC 1HUMA 4YY3L 5M3FB 4KKUA 1Q46A 5BR8Q 1V1QA 3CPFA 1OXXK 1L1OB 5C4JB 2QGQA 2L1BA 3BYTB 1K0SA 2R61A 1RD9D 2PQEA 1C0AA 2FFKB 2EYFA 3GO5A 3DUZA 2KHSA 5M3MH 2AMCB 4DR4Q 4DV4L 2KHJA 2JSOA 4U68A 4POGA 3JC66 4DR6L 4JI2L 2K28A 3R2TA 4TRDA 2N55A 1OTCA 4J1MA 4A3DB 1FD7D 5JEAJ 2WIIB 4ME5A 2K14A 2L15A 2Z8LA 4LMQD 4HMJA 3SE0A 3A74A 3SEBA 2PNRC 5JJZA 3BDCA 2NBFA 1TWGH 4DV6Q 5E1FA 4GS3A 4QCLA 2OXPA 1EFWA 1HNXL 4AQYQ 2RDGA 1H9KA 3VDYA 3CCQA 1DONA 1HNZL 2G5DA 4L5SA 2HUGA 1HHVA 1A3TA 1EEFD 4JI4Q 5CORA 2B2WA 2ZTEA 4HSPA 4DR3Q 5JAVA 2KBNA 1S72A 1CA6A 1B9NA 4C3HH 1TWAH 4CJ0B 2JK8A 1X6OA 3SVMA 1EQQA 1UE6A 2K5QA 5ELNA 1JMCA 1I50B 3ULLA 5D3IB 4QY7A 3GTJH 1EYAA 5T1GA 3J81L 3IKJA 3S15B 1I4PA 4KKTA 2UUBL 1GD7A 2JA8G 5FLMH 2DN8A 4A3EG 4JI0Q 4M8AA 3PO2B 4IFDH 3W1GA 5IT9c 4A93H 1EY6A 3S14H 4IOCA 1WTPA 2Z9HA 1NY4A 4DV0L 2VUMH 4P73A 4OO1I 4P74A 2QDLA 5M5YB 1LTBD 4PMWA 1G2SA 3L9AX 1O7ZA 4RGNA 3PO3B 1XTCD 2EE1A 2ID0A 3MVVA 4QF4A 1N34L 2I07B 3S24A 4K5VA 1VQJA 1EU3A 1YHQA 2K4KA 1X55A 2D0PA 1RTNA 2K33A 4HCSA 2EJFC 2B63H 3LX0A 3CCUA 2LMCB 4ABNA 4RG1A 4A3EH 2UU9Q 2E2DC 2F4IA 4A3LG 1DGSA 5JJLA 5CGKA 4DU9A 1KRTA 3GTOH 1QUQA 2EQSA 2F0IA 2HIVA 1E24A 1DM0B 2EYJA 1CUKA 4MN3A 3H09A 4RAUC 3BS1A 3G71A 2A69C 3D4WA 2M2LA 3ONAB 1EL0A 1PH7A 3RLNA 4ME3A 3PF5A 1IL2A 4MIUA 1CT1D 1ZEQX 5NUCA 3DXJC 1JWUD 3AFQA 4HAEA 2XNAC 2IT1A 3NWSA 4C2MH 5IYDG 1ENCA 2Y0SB 2OTJA 1JWSD 2D0OA 2EYMA 2WINB 1BOSA 2WP8J 1SE3A 5LMUQ 3J7ZC 2K5NA 2Z1CA 5K36H 2E8GA 4WJ3M 1M1KC 4L5RC 2PZWA 4DGZA 1FJGQ 4X66L 3J80E 1ESFA 3BZCA 4A3LH 1AFPA 4R4QA 4C56C 2ICIA 2UUAQ 1S5CD 3ND8A 3HOXB 2F03A 1AE2A 2E2HB 1BCPB 1BVSA 3CF5A 3DM3A 4A3IB 5IGGA 1PA6A 2MHVA 1FGBD 2NVQB 1XTDA 3PUXA 2OQKA 4CHTB 2ZXPA 1PH9A 3T16A 5IYCG 3GTQH 2EIFA 1IW7C 5I4DA 1SFOB 2ZJQA 1YNJC 4BXXH 5M5WB 1ET9A 1S5DD 3WOFA 4ZAIA 5ELBA 4RH6A 1X3PA 1U5KA 5IGBA 1VQIA 1Y8PB 1XPOA 1K9MC 1E2WA 3NTIA 3MEHA 4F88A 4AYBB 2DJGC 3TMEA 4HJ8A 4YWLA 2HCIA 2PMZB 4XDXA 1VQOA 4OX9Q 1ENFA 1N9WA 4IQZA 2JA5G 1WTWA 1L1OA 4A3MG 4DAMA 2F1MA 4CBVA 3CCMA 4FXKC 4KK7A 1Q90A 2K6AA 4WJ4A 4H0LC 4O0AA 4OIJA 2VNUD 2I5HA 4KHPL 4JI3Q 4TSSA 2PQAB 4RKLA 2E75C 1MSHA 4X62L 5IYCH 5C5MA 1XNQL 2DJFC 1LTRD 4X3TA 4EGVA 4LF8L 4A3FG 1J5EL 1SAPA 2WAQB 4RHRA 5FLXE 5DM63 5JJKA 1TWCH 4JI7Q 3PUVA 3H0GB 2DNCA 3TZUA 2FXQA 2F52A 4C3JG 2RCFA 2KUMA 4XQNA 2K50A 5I9OA 1KC8C 4R4IA 1Q1EA 5JEAG 4LF6Q 2GN5A 5CV7A 1MD2D 4A3MH 5ELCA 1DOMA 4KJOA 3DEOA 4JW0A 4K5WA 1LT5D 2ZTCA 1KXLA 1Q82C 3QIAA 2C35B 2CH4W 1KLUD 1SMYC 4LF5Q 1AH9A 3A0JA 1B8AA 4YIJA 2RKSA 4CDCC 3K5LA 4UP7A 1YVCA 3C2PA 4KN4C 3MHBA 1SYEA 3A8IE 4JPBW 1KQSA 2UXDQ 2DUDA 2A6HD 2X69A 4QIWE 4FF2A 1FL0A 3NP8A 4A3FH 4C3IH 4ILWA 4GNXC 1XPUA 3PV0A 1ZYRC 2KA7A 2HHHQ 3IL8A 2JQOA 4AYBE 4H02A 5HGTA 4DUYQ 3PF4A 2DY7A 1XPRA 3H3VI 2PMZE 1L0XB 2B3GA 2VY3A 1SE2A 4QQBX 1TKWB 1UE1A 2F0UA 3HEJA 1KIXA 1N33Q 4X64L 1TU2B 5C4JH 1WFQA 1E2ZA 4EQPA 3TEHB 2RHSB 2UUCL 1GKHA 3ERQA 1CKNB 4A3KG 3R3OA 4CKCA 5CV8A 1LUZA 4IOAA 4DR2L 3S2DH 3S1QB 2O5IC 1B50A 2E5LQ 1RTOA 1O7IA 4EQNA 2FHTA 3T13A 1F2YA 3J81E 5CV9A 3GP7A 5LMNL 4B9XA 3GTJB 4K6DA 1IBLL 3K0XA 4FXDA 1G6ZA 2G9HD 2MO0A 3HKZG 1N32Q 2MNAA 4NDXA 4NXMQ 4IUUA 4CGYB 2B2TC 2PW7A 4IJHA 3PQIA 4K0KL 4ALPA 1Y1VG 4G7OC 3NELA 4A3BG 3M4YA 3S14B 2VB2X 4B3RQ 4KY6A 2L5TA 5EBDA 3VA7A 4A3KH 2PO4A 3GTPH 1LLRD 2Q8RE 2OQ0A 1C9OA 1QVFA 4K2LA 2RSNA 3J7YW 1HXYD 1PFBA 3W5OA 3KFUA 1V8QA 4NXNQ 2KCNA 4V0BA 1D8LA 1I50H 1HZAA 1VQ5A 1YEZA 3S15H 1CA5A 5DNFA 1WTVA 1TT2A 3BVGA 1JB3A 3RZOB 3MXUA 1BO0A 3P7JA 2XWJB 3EN2A 4LFBL 2QW7A 2B63B 2K32A 1HRJA 2JA8B 4DV5Q 1JJCB 1CQFA 4A3EB 1UE7A 3VR4A 4S3SA 1A8VA 1Q8KA 1Z6HA 4A3BH 4F7XA 3K80C 5GADC 3GTOB 1PMRA 2XRQD 4JI1L 5C4ZA 1JICA 4B3SQ 1Y8OB 5ELOA 4TVAB 4LF9L 4PZ8A 3C3LA 2Q8TA 1I4QA 5I2YA 1EYDA 3J7AF 4FNFA 4EQOA 4DR5Q 5HY6A 1VQ8A 2R93G 3ULPA 3DLLA 5IE8A 1JOOA 3FPUB 4OO1G 3Q0AA 3FMCA 3NQIA 1X65A 1LM0A 2JEAI 1CZGA 3O13A 3SDZA 2TSSA 2MO1A 2EZVA 4PZ6A 2Q2TA 1D6EC 1Z47A 4TQUS 1K8MA 4GOPC 3BG3A 1SXTA 3W1BA 2FMCA 1FR3A 2AHOB 3D4DA 5C0XH 1JWMD 3FPPA 3FHWA 3L3OC 2UUBQ 2EJMA 1STEA 4CKEA 5JPMC 3CXCA 3T4AC 3KBGA 4OHJA 3A7AB 4DK3C 1LTGD 1EIGA 3MXPA 5IYBG 2R93H 1QOHA 1VQHA 4UAIA 3GTQB 4DV0Q 3RN2A 1CSQA 3KLSA 4JI5Q 2D5DA 4OO1H 1Y1WG 1F9QA 1EIHA 1U4RA 2LFNA 3TQYA 4CDFC 4DAYA 2KHIA 2R7FA 1JQYD 2LY7A 3CMAA 2OTLA 4GKJQ 1EOTA 1NAPA 4TKOB 1N34Q 3HS0C 2K03A 1SR3A 3CCJA 2E2HH 1PFMA 1AN8A 2OEOA 2LS01 2E2IH 3S17B 1C48A 1VMCA 2B2VA 4G4KA 3J7AV 2NVQH 3OSOA 5IT9L 5FO7B 3CP0A 1PYBA 2YU9B 2F0LA 2VXWA 3RN5A 1QWYA 4DNIA 4ZLTF 5BN4A 3M7GA 3K6OA 1O7LA 1SEBD 4IPCA 2NN6I 3CCEA 1WD0A 3DWPA 3CCVA 4YHHL 4QUCA 2PPBC 2ZT9C 2JA9A 3GD7A 1MJCA 2O5JC 1QZHA 4OL7A 1TS4A 2BDNA 1GUSA 1EOVA 3NXWA 1JORA 3BZKA 2YV5A 4DUZL 4P2CB 2AQ2B 4MTKA 3JAMc 3K57A 3U58A 1VQFA 3A5UA 1VS0A 1YHBA 2NYZD 2E76C 2EDGA 4C1NK 1MI2A 1TR5A 1CKNA 3RMHA 1KTKA 1LABA 2JA5B 2PI2E 4Z9CB 4A3MB 1YITA 1BUVT 4EQ5A 3RUZA 5E7NA 3I73A 4X66Q 4DV1Q 2A19A 3BDLA 4IUTA 3KOJA 4BY1G 1E1TA 1H9SB 1R4QB 1VQDA 4UP9A 2HQEA 2I46A 3ULJA 1HPCA 3K7UC 4A3FB 3NBIA 2I5LX 1GO3E 1ASZA 4ID6A 3VR2A 3AMUA 5IP9G 1EWHA 2R7DA 1I94L 2ES2A 3I70A 3IFDA 4DK6C 2JA7G 2C5CA 3KF6A 4IJLA 4NPSA 4C3JB 1BR9A 4F87A 3OMGA 1WCMG 4OWWB 2B2WC 1OXUA 2CWPA 3CC4A 3CKIB 1RDPD 3TREA 1G291 4UDUC 1NR2A 5DAUA 3OIPA 4DNTB 2NVXB 2XGTA 1IL8A 1PZKD 3S2DB 1VQLA 4BY1H 1GUTA 1GHKA 2Q2UA 1XX8A 5CBEE 1VQCA 1STYA 4V190 2Z6KA 4IPHA 4PMCA 1U0LA 4N8X1 2X6LA 1OO9B 2EYOA 3CW2C 3PUWA 4X62Q 3OW2A 2JA7H 5C5LA 2BA1A 1EQVA 1H9JA 4N9TA 3UDFA 4IUPA 4KN7C 3S1NB 5CYUA 3MXNA 1J6QA 2IY5B 5BN3A 2IPKD 2RVLA 3D6CA 1P16A 5EKLA 3HOVG 1PLFA 3S1QH 2F0EA 4OIKA 5D65A 5C3WA 5GAEC 2M9VA 5KYIA 2L4NA 4HIDA 1CHPD 4A3KB 3RLOA 1Q86C 1HJPA 3GTPB 1N36L 4IZ8A 3PUYA 5JPNC 1PTOD 4FF3A 1CZWA 4MZ9A 3GTKH 3KUPA 4DKAC 2MP1A 4LNQA 3NBHA 1L2FA 1LO5D 1Q81C 1T5EA 4LFCQ 2K52A 5CBAE 2D2CC 1KDCA 2D9UA 3A5ZB 2AWOA 5HURA 3HKZB 2BOSA 1HZBA 2VS1A 2PI2A 2IL8A 3FVQA 4FVMA 1BXTA 2BH8A 1U4PA 1K73C 1EIFA 4DFAA 3STBD 2SEBD 4P72A 1Y1VB 3HOVH 5FK9C 1HTPA 1NUCA 4A3BB 3KF8A 2L0CA 3NK9A 1X3GA 4NB3A 2F0QA 2QCPX 2A6HC 1BKBA 2AUKA 1S4ZA 5IY0A 3W3AA 4CKBA 2F3IA 3L0OA 1PFSA 4A3CG 1JOQA 3RZOH 1BCPF 1I5FA 3U9OA 2CWAA 1EYGA 2PW5A 3EFXD 4DV2L 3HZXA 1B4OA 3M4OH 2JA8H 5A35A 2CQOA 1HCZA 2ALYB 1EWCA 3Q6SA 2VQEQ 4JYAL 1QNUA 2V1CC 5IWAL 1Q7YC 2AUJD 4ZRZA 2RBMA 1SMXA 2A6ED 2ZTDA 3I4NG 2UXBL 3NHHA 2IJ0A 4R1JA 1TS5A 4B3TL 2N8NA 3SHLA 4R8NA 1IBLQ 4ZKCB 1NBWA 2R3ZA 1TS3A 1BBUA 4JBKA 4X3KA 1YIJA 4XT1B 3WOEA 2UXCL 2QEJC 3HGBA 4I7ZC 1TWHH 1NR4A 2B2UC 4WORA 4GNXB 4BY7G 5D3DA 5LL6S 1QVGA 4A3CH 2F0GA 3S1MB 3E0JA 3MA2B 1RF2D 5C3XA 2R93B 2WFWA 5ELEA 3CCLA 3D6WA 2F0KA 3S9WA 4GKKL 1CI3M 3E9IA 1LYLA 5IODA 1JJGA 2YTXA 2CCZA 4DN4M 3F2UA 1QCBD 3I91A 3KBXA 3TBIB 1KABA 1K3BC 4YCVA 3HKZE 1L0WA 1TY0A 3QR8A 3T1YL 5IT9E 3M7NA 2A73B 1BBWA 1EQTA 1OXTA 2E2IB 5I6YA 1IBML 5L37A 3DWAA 1J8IA 1E1OA 1IHZA 2NWGA 2H4OA 3G6JB 5IYDH 3V2TA 1X56A 2QF7A 3HOZG 1Q1BA 1BBXC 4JV5Q 1CFMA 3FDTA 4JI1Q 4OEMB 3Q23A 2XSCA 4LF9Q 2IX0A 1Y1WB 1SJHD 3U4ZA 2MJ8A 4IUNA 5C44G 3BVZA 1HZ9A 1GUNA 1F2MA 4M1UB 1PH5A 3CRLC 1I3QB 3S17H 1SROA 1X3FA 1CTMA 1XMQQ 5J22A 2YU9H 5BR8L 2JA6G 4Q5VA 3BU2A 4FDBA 3MC0B 2AQ1B 2B8FA 2PNHA 1V1OA 3J7A5 1A0IA 1ML0D 1WOCA 3FKIG 3ND9A 3KLRA 1SDFA 2Z4IA 1HNWL 1SBBB 1ET6A 2V4DA 4DR4L 1K83B 2XRSD 2Y0SE 2EY6A 3I8ZA 3OWEB 4JK1C 3TRZA 2VQFQ 3KLSX 2HD3A 1EQRA 3ER0A 3VYUA 3OTOQ 3OYYA 5F2DA 3CQZH 4K6LA 5C44H 5FO9B 3E6ZX 2Q2HA 3T53B 3SK5A 2ZM6Q 1ENAA 4DF7A 4DXGA 4L5QA 2NN6G 2EYPA 1CHQD 4DV6L 3TDQA 3VA5A 2B2YC 3SR1A 3OW7A 2JA5H 5C4XG 1B9MA 4AQYL 1VMPA 5E4XA 4NW2A 2XVSA 1HR0W 3BDOA 2JA6H 4JI4L 2YYZA 2N49A 4BWGB 4DR3L 1IBKL 2GA4B 1UWVA 1VF5C 5TSSA 1EIYB 1PRTD 3PIOA 2R92G 1EUJA 5JVG3 4MTNA 4BY1B 1B7YB 4AIMA 3C1FA 2KEEA 2R6GA 4OWXB 4GOPB 1MIUA 3KDFB 4B3ML 1EEID 1STBA 1HQMC 1PDQA 4B08A 4QUFA 3RLFA 4C3JH 1JR0D 2H5XA 4JI0L 2CQAA 2NN6H 3M85A 4IFDI 1VQEA 5I2XA 5JEAH 4HJ7A 2JA7B 3R2IA 1RODA 4JI6Q 5K5PA 1PTOB 5I6WA 4IUVA 1WTOA 1WCMB 4EVOA 1TVXA 4OWTB 2NVXH 1PXUA 1EY7A 1GHJA 4DAPA 3CU7A 4NMZA 5CMDA 1ONLA 1RJTA 4JI8L 1A2TA 3RR5A 2R92H 2K01A 2WAQE 2SOBA 2KCTA 1GVPA 4R4OA 2KJXA 2PZUA 3CAMA 5EJWA 2JXMB 3GTKB 2ZJPA 5CR3A 2A69D 5C6AA 4HCEA 2XIWA 3S1NH 2UU9L 1I4RA 2PYKA 2EY5A 3TS0A 2E74C 4DV7L 4Y7NH 1MJEA 4YCUA 1AEXA 4A3JG 1S5ED 1NNXA 2VW9A 3H15A 4GN3B 3JAML 3LGJA 1UE5A 1WI5A 1JJ2A 5IGEA 4KJNA 4A76A 2SNMA 1I94Q 1EU4A 4AH6A 1STHA 4BBSG 3HOVB 4GNXA 1D5ZC 5E4WC 1NCVA 1FNUA 4MNOA 4EX5A 5EKKA 3FP9A 1YI2A 4YY3Q 5EKIA 1LTAD 1KRSA 2EPBA 3CC2A 1LACA 5KEEA 1GUWA 1SNQA 3J80i 1I4XA 1GM5A 1TWFH 4A3GG 1NTGA 1IKMA 5CV4A 4KD3A 4DV4Q 2HQLA 3M4OB 4DR6Q 1FJGL 3WWVA 4JI2Q 1FYCA 1O80A 3UDIA 4OONA 1Y1VH 4IFDJ 1LT4D 4A3JH 1DD2A 3I55A 5IOCA 1LT6D 4FO2A 4OGQC 2WV6D 2TMPA 2IHFA 1HZCA 3I7FA 3M4PA 3K5MA 1HNXQ 4IUQA 3TP7A 3EVQA 1HNZQ 2B2TA 3MXGA 2WKCA 1TWHB 1VQAA 4PNYA 4LWCA 3F2CA 1BDOA 3HKSA 4A3GH 1I4GA 1Z7TA 1E7ZA 1EY9A 2RCNA 4LJZC 1EY5A 1V1PB 3SK4A 2YTVA 5IGFA 5DLQE 1XNRL 2BE5D 4R9WA 2OCEA 3U50C 2RSOA 2I5MX 3J81j 5IIFA 3QB3A 2QEXA 3TZDA 1RKNA 3F2BA 1YNXA 2O2LD 3PIO3 4K8IA 2PQAA 3NENA 3TN2A 3I4NB 3D4RA 1E2VA 3GTLH 2ATWA 1T5XD 2WB1G 2F3WA 1PTOC 4FYDA 1MSGA 3S1MH 2K5DA 4KD4A 1TQOA 2A1AA 3N52A 3K59A 1R9TH 3VYSA 2RQXA 3NSWA 2ZJRA 4BY7B 3A8KE 2F0JA 1QNKA 1OXVA 4JOIA 4RA8A 1WTQA 4DV3L 4JI7L 1VQ6A 2MQHA 3PMFA 4GLXA 3VYTA 4G7HC 1SE4A 4XT3B 3STBC 2L55A 1LTTD 3A56A 4K2KA 2B39A 2RF4A 3HG9A 3QOLA 1PYWD 4ODGA 4DV2Q 2IX1A 3D3RA 1V9PA 3G4SA 2CW0D 3RZDB 4JBWA 2WKDA 4FF4A 3I4MG 3UDXA 4RGOS 1EZ6A 1M8AA 4O1NA 1IYJB 2XTIA 5IWAQ 4LF5L 2PCFB 5IYBH 1JB7A 5DM73 1YJNA 3V96A 3M9BA 4JCVE 1ICFB 2VB3X 2UXDL 2UXBQ 3RD4A 1PH3A 2N78A 1UEBA 2A68D 1Y1WH 4B3TQ 4XYQA 4PMBA 1QUQB 3MWYW 3NTHA 4LK1C 4XQJA 3FRPB 3HOZB 2J0TD 3H3VC 5G3LF 2NTTA 1JOKA 1I3QH 4KKSA 5JOBA 3NWTA 2A6EC 5FO8B 2HHHL 4DK1A 1XMOL 1NE3A 3CQZB 3PCOB 4DUYL 5C44B 2I0QA 2FINB 2LXJA 2NVTB 1BCPD 2AQ3B 1AZQA 4RGMA 2K75A 3AFPA 3CPWA 1PRTB 1QE6A 1Y14B 4JBMA 1ZKOA 2ICEC 2K1BA 1TS2A 2JN4A 5EAYA 3EROA 2Z0SA 1IXRA 5C3EG 2HDLA 1PFNA 2LKVA 2JA6B 2EXDA 1K8OA 4CDEC 4HTHA 1K83H 1VCIA 3J81i 1AE3A 4IALA 1KD1C 3CC7A 2E5LL 1N8RC 2MUYA 3FKIB 3T1YQ 3F2DA 2NVYB 3RNUA 3T1HL 1UAPA 2EYHA 3QJYA 4DPGA 1IBMQ 1TY2A 1LV9A 2E2JB 1RCVD 1PHJA 5IP7G 2J4XA 2KENA 3EBEA 4K5XA 5KRUA 4LUOA 1KDAA 5M3MG 1A6XA 2F3VA 1DZ1A 4HMIA 2KOLA 4LF7L 2JP1A 4G7ZC 4DR1L 4ZQ3A 4A75A 4L5TA 3ZJYC 1BQQT 4ZCKA 3P20A 3DEPA 1G6PA 1JC7A 5C4XB 5C3EH 4DXFA 4J15A 4RKBA 1HA5A 1I6VC 1ILQA 5D14A 4LFAL 2F0PA 2CH4A 2R7ZG 1HFNA 4XYOA 2N3SA 4NXNL 2GVBA 1DJRD 1D1KA 3VR5A 1A15A 5CC4A 5E3FA 1VQ7A 5AJ3L 1ASYA 4QJFA 2R92B 1W6JA 4KHPQ 3K5NA 5IP7H 5IP9H 1YNND 1NSNS 2F0HA 4HIMA 1HNWQ 1B3AA 3S2HH 1XNQQ 4H13C 3OIQA 5C4HA 4C3HG 4LF8Q 4DV5L 1PTOH 2K5VA 3C1EA 1GOZA 1S3OA 1J5EQ 3JAME 1WCMH 1M90C 3AEVA 2HT1A 4Y7NB 3GTMH 1M4VA 5KNDA 1YJ9A 4UY8C 2F4VL 3A8JE 1LTSD 1B1ZA 5FLMG 2KCCA 4B3SL 1LTID 1UUPA 3K0YA 4Q0FA 4N8FA 4IFDG 2R7ZH 1QVCA 3BJUA 4KI0A 3A7LA 4PQXA 4A93G 1GXDC 4DR5L 1I4HA 3KLWA 1V43A 1FGUA 3NTKA 2F0OA 3F1ZA 3H94A 5GQOA 2VUMG 3PSIA 3AB9A 4IPDA 5M9OA 1K8AC 1MKHA 1G8ZD 1V1PA 1X9NA 4DA2A 2VL6A 1Y69U 2K5WA 4RCNA 3K8AA 4XIGS 1IBKQ 1TWFB 3OPOA 1X3QA 1X3EA 3OWFA 1PVOA 1VDZA 3X3MA 2C9OA 4HJ9A 3GTGH 2NB0A 2M00A 3TS2A 1HH2P 5C0XI 3D0FA 4B3MQ 2B63G 4A3JB 1GJXA 3J80c 2Z6BA 1HA6A 3U4VA 1PRTC 5J39A 1F9SA 3Q8DA 1VQBA 2OT2A 3X3NA 3H3VH 2QA4A 4BBRG 4BBSB 1II3A 1QZGA 4X65L 5CV6A 4X64Q 1NJIC 4H7BA 3HP3A 3EQLC 1C4QA 1AW7A 5I9PA 3MFYA 3SGIA 1W2BA 1FNVA 3HOUG 1A3UA 5ELDA 2UUCQ 3EJIA 3HOWG 4JI5L 2IW3A 1A3VA 1SYGA 1PH2A 1SSOA 4DR2Q 1Q8IA 5COYA 5EPKA 1SLJA 1PH1A 2F0WA 4A3GB 3R93A 4GKJL 1DYQA 2RDFA 1D1IA 1XJVA 4JI8Q 3HFZB 3L2PA 4Y52H 1TIID 4N9PA 4RWSC 1K28A 3E0EA 2OF1A 2RDHA 1B44D 1JE5A 1RL2A 1SNCA 5LMNQ 1U9RA 1WVLA 1SNPA 4U673 2SNSA 3UE1A 3TSSA 2NTSA 5K36G 1R4PB 3N6RA 4BBRH 2KVMA 3GTLB 4DV7Q 1I6HH 4X3SA 1F2LA 1WD1A 4K0KQ 4CJ1B 1O7YA 2RA4A 4E6IA 3HOYG 3W2DA 3HOUH 1TXYA 3BZDB 1MBYA 1R9TB 3HOWH 5DEHA 3GDEA 5M5XB 1PH8A 1B3QA 3VYRA 2FJ2A 3I72A 1L1OC 3B6YA 1O78A 1EFID 3KK7A 4O2DA 5FLXc 1H95A 2F0SA 3PIPA 1EWIA 4BXXG 1MHWC 4ULLA 1XXGA 4PG3A 3H91A 3NQTA 3I4NH 4IURA 5J1ZA 4LFBQ 1STGA 2KEDA 1A62A 4BS9A 5C0XJ 1PH4A 3S16B 4DAVA 1H9SA 4DV1L 1Q3LA 2WB1B 4BY7H 1PV4A 3DMUA 3HRZC 1HR0L 3HOYH 2L9HA 2K04A 4HJAA 1KL9A 2SDFA 5J3BA 1NMFA 2N88A 3K7AB 2K5HA 2GVAA 5GROA 3G48A 5EPLA 3MTSA 3CD6A 1KDBA 1SNDA 4F8MA 4GN4B 4KHVA 4DR7L 4LF4L 5ISRA 3R8BA 1RIPA 2CKZB 3TP5A 3A55A 3KJOA 2EOTA 4QIWB 2B2UA 3BVMA 5KIXA 1DOKA 4MHEA 3RZDH 1Z9FA 4JG2A 1NMGA 4RGTA 2RHQB 1KLGD 5IGDA 2EVBA 2A8VA 1LTLA 3QWNA 1XNRQ 1AZPA 1JCKB 1A63A 3I4MB 2ENBA 3HOZH 2BA0A 1PTOF 3OOCA 1K0RA 4L8JA 3CCRA 1G2TA 2HIXA 1FNWA 3M3YB 1IKLA 1X32A 3VR3A 1L0YB 3AQQA 3WDNA 2BE5C 1SYBA 3C46A 4L6TB 3JAMi 2NVTH 5FOBB 2BCOA 2QILA 1QJOA 3K5OA 4DNRB 1FVIA 3J81c 4UPAA 3S1RB 2ZXRA 1WJJA 1W3SA 5BN5A 3AU7A 3ITPA 4H44C 4C3IG 2MGSA 2JEBI 4YCWA 1YBYA 2L12A 5KNBA 4DV3Q 1DOLA 4QL5A 4ZKBB 3K81C 3BYYB 5A2QL 3M4QA 1C7YA 3FKIH 4DAYB 2KECA 5C3EB 5M3FG 2Q2IA 2NVYH 1OXSC 1D2BA 2WB1E 3D8GA 4J8QA 1D5MC 3PGZA 2A74C 1KAWA 2E2JH 2DY8A 5LL6X 4G57A 2JJQA 4K14A 4KLKA 1F9RA 2H1EA 1WYDA 2O4XA 3NUCA 4LFCL 1RHPA 2EYLA 3DHQA 2AKWB 1VQPA 3P1HA 3I90A 5KNCA 5HGQA 5ELFA 4A3DG 5M3MB 4YHHQ 1SYCA 3S2HB 5C4XH 5AFWA 2VZAA 4HN7A 1SYFA 2CW0C 3OHXC 1B53A 2ZXOA 3NE5B 4PZ7A 3I3CA 1KNEA 1PYSB 3GTMB 1DXMA 4DUZQ 1WTXA 4PV1C 5GAGC 1U4MA 1XMOQ 4RMFA 3QOJA 5M3FH 2JE6I 1ESRA 1CSPA 4YWKA 4I7AA 2A68C 4ZUIA 3A54A 1TWGB 2R7ZB 1ILPA 3QG1A 2B2YA 3I2ZA 3G6EA 3UDGA 4GN5A 1GUOA 2OWOA 2Z4HA 3PIP3 4K8JA 4HIOA 1D5XC 5EGTA 4OELB 4JBJA 1DCZA 2NZ1D 1HUNA 1BCPC 2G9DA 4R8IA 1LT3D 1SNMA 4J6HA 2VQEL 5KGUA 3DWQA 2MPMA 4GLAC 2WACA 3T1HQ 5FJ8G 4QGUA 4A3DH 3MFGA 1UNSA 4C3HB 1TWAB 2KQ3A 1EZ8A 3MAQA 1K3RA 2JYOA 2X6GA 1K8GA 1STAA 1XWEA 4OXPA 3GTGB 2XN9C 1ZXTA 5G3LD 3CRKC 3PO2G 1YZ6A 3URYA 3OMCA 1HTLD 3ERSX 2IHEA 2K05A 4JC0A 4UP8A 1QILA 4LF7Q 3T51B 4DR1Q 1EYCA 1HFGA 1STNA 3AYHB 2B8GA 4LUVA 4A93B 3KF6B 3GV3A 2IWHA 3EIVA 3PO3G 2L11A 2F0DA 3LWUA 4APVA 2EY1A 2VUMB 4WJWA 1X54A 4LFAQ 5H1SE 3I56A 4QB4A 5LMUL 1SRUA 2BH2A 4HR7B 1WTRA 1SE8A 3QO2A 1MGSA 2EY2A 4IPGA 4LUZA 3Q22A 2UUAL 4XTCS 5FJ8H 2HDMA 1W6KA 5AJ3Q 1H9RA 5JJIA 1IYVA 1F2ZA 1IW7D 4GZYC 3Q24A 1YNJD 3PO2H 4BBSH 4HEDA 3FEWX 1Y8NB 3IRBA 3TP8A 1PH6A 1VF7A 4RFBA 4GLVB 4P75A 1PZJD 3SK6A 1G51A 4BBRB 1I6HB 3MEFA 1IZ6A 1IYUA 4NKLA 3SK8A 5M5YH 1HQRD 1SN8A 2F4VQ 4KHZA 4RCOA 5C0XG 1YNNC 2YTYA 4JV5L 1U4LA 1VQMA 4JOIC 3PO3H 3HOUB 1G91A 3MXNB 2CFMA 3HOWB 2B29A 5LMNW 1YJWA 3G7LA 3CMEA 1N36Q 4HSVA 1F9PA 2Y0SG 3PUZA 4RHSA 2F0VA 2IX3A 3UI2A 3KJPA 4KY5A 1E3PA 1JT8A 1CKMA 1EY4A 2B2VC 4NP5A 4OX9L 4DK0A 3VR6A 1XMQL 3EA6A 2BDOA 4C2MB 2F0NA 2F0TA 3I4LA 2Q8IB 2CVRA 2NZHA 5JVH3 3NBHB 4JI3L 2F0MA 3HOXG 2F0FA 4A4IA 1CKOA 3E3XA 1KNAA 2NUCA 3V05A 1KAAA 3MZ5A 1SNOA 1EY8A 5GAHC 1PRTF 5M5XH 4A3IG 4QMGA 3LWEA 3T56B 1C8CA 3HOYB 1S5BD 1QB5D 2VQFL 2CHBD 1Q12A 3OTOL 3KF8B 4X65Q 2ZM6L 1YHAA 4C1NI 1S5FD 1SMYD 3K58A 1CM9A 1QG7A 4LF6L 3IAYA 3GV6A 2J7ZA 3S16H 4R4CA 4AYBG 1BF4A 3E9HA 1JE4A 1ICWA 2NZOA 2ASBA 2MFIA 4JYAQ 5KYLA 3IFTA 3HOXH 4L63B 4HJ5A 2XWBB 1VQ4A 1UEAB 1ZYRD 3DM1A 4B9WA 3J80L 3E5SA 4X6AH 4LW1A 3K7AH 4A3IH 1WTHA 4GOPA 1CQVA 4FF1A 3KDFA 1J9OA 1PZID 3NEMA 3I4OA 3GQBA 4P71A 2AWNA 3SXHA 2A5HA 3U9SA 4O42A 2LXKA 2UXCQ 5LHY1 5EPJA 1B2TA 3H6MA 2K7VA 1SFOH 1D7QA 3L7ZC 4KY7A 2WAQG 3KYHC 5M5WH 3TP6A 1XYIA 1KHIA 1S40A 3CCSA 4XQQA 1N33L 2EXZA 4IO9A 4GKKQ 3H0GG 4JI6L 4KMUC 2D62A 3P75A 2P5ZX 5FKAC 5A2QE 4LAAA 4R4TA 3I4MH 2HCCA 1TWCB 2FMMA 4I65A 4IN3A 1P8LA 1T9HA 1H9MA 5T1IA 3ICEA 1GUGA 1E0BA 1E22A 3ZYYX 3D31A 3NPPA 1VQGA 3M3YH 5IGCA 2Z6KC 1CK1A 4BA1I 4ZUJA 3CHBD 2LSSA 1VQKA 4HIKA 1B70B 4ZYSA 3UE0A 1F77A 1A2UA 4FXGC 3S1RH 2DGYA 4CJ2C 1N32L 2PZTA 4WRDA 1HR0Q 2KCMA 4NXML 1EY0A 2QKIC
chains in the Genus database with same CATH topology
4X3UA 4ZK9B 3LNNA 2DNEA 4KTAA 2QDBA 5FLXL 4XXEA 4BA2I 4C3IB 5EBCA 1AP0A 1SJED 4WFN3 2EJGC 1BNZA 5EQ0A 5CV5A 1SYDA 4KV6A 4FP5D 1HUMA 5M3FB 4KKUA 1OXXK 5C4JB 2L1BA 3BYTB 2R61A 1RD9D 2PQEA 2FFKB 2EYFA 3GO5A 3DUZA 2KHSA 2JSOA 4U68A 2K28A 3R2TA 4TRDA 2N55A 4J1MA 4A3DB 1FD7D 5JEAJ 2WIIB 4ME5A 2Z8LA 4LMQD 4HMJA 3SE0A 3SEBA 2PNRC 5JJZA 3BDCA 2NBFA 5E1FA 4QCLA 2OXPA 2RDGA 1H9KA 1DONA 2HUGA 1HHVA 1A3TA 1EEFD 5CORA 2B2WA 4HSPA 5JAVA 1CA6A 1B9NA 4CJ0B 3SVMA 2K5QA 1I50B 5D3IB 1EYAA 5T1GA 3J81L 3IKJA 3S15B 1I4PA 4KKTA 2DN8A 4M8AA 3PO2B 4IFDH 1EY6A 1WTPA 4OO1I 5M5YB 1LTBD 4PMWA 1G2SA 3L9AX 1O7ZA 4RGNA 3PO3B 1XTCD 2EE1A 2ID0A 3MVVA 4QF4A 2I07B 4K5VA 1EU3A 1RTNA 2K33A 4HCSA 2EJFC 3LX0A 2LMCB 4ABNA 2E2DC 2F4IA 5CGKA 4DU9A 2F0IA 1DM0B 2EYJA 4MN3A 3H09A 4RAUC 3BS1A 2A69C 3D4WA 2M2LA 3ONAB 1EL0A 4MIUA 1CT1D 1ZEQX 5NUCA 3DXJC 1JWUD 4HAEA 2XNAC 2IT1A 3NWSA 1ENCA 2Y0SB 1JWSD 2EYMA 2WINB 1BOSA 2WP8J 1SE3A 2Z1CA 5K36H 2PZWA 4DGZA 3J80E 1ESFA 1AFPA 4C56C 2ICIA 1S5CD 3ND8A 3HOXB 2F03A 2E2HB 1BCPB 4A3IB 5IGGA 2MHVA 1FGBD 2NVQB 3PUXA 4CHTB 2ZXPA 3T16A 1IW7C 5I4DA 1SFOB 1YNJC 5M5WB 1ET9A 1S5DD 3WOFA 4ZAIA 5ELBA 4RH6A 1X3PA 5IGBA 1Y8PB 1E2WA 3NTIA 3MEHA 4F88A 4AYBB 3TMEA 2HCIA 2PMZB 4XDXA 1ENFA 4IQZA 1WTWA 2F1MA 4CBVA 4FXKC 4KK7A 1Q90A 2K6AA 4H0LC 4OIJA 2VNUD 4TSSA 4RKLA 2E75C 1MSHA 5C5MA 1LTRD 4X3TA 4EGVA 1SAPA 2WAQB 4RHRA 5FLXE 5DM63 3PUVA 3H0GB 2DNCA 3TZUA 4C3JG 4XQNA 2KUMA 5I9OA 1Q1EA 5JEAG 5CV7A 1MD2D 5ELCA 1DOMA 4KJOA 3DEOA 4K5WA 1LT5D 3QIAA 1KLUD 1SMYC 4YIJA 2RKSA 3K5LA 3C2PA 4KN4C 3MHBA 1SYEA 3A8IE 2X69A 2A6HD 4FF2A 3NP8A 4ILWA 3PV0A 1ZYRC 2KA7A 3IL8A 5HGTA 2DY7A 1L0XB 1SE2A 1TKWB 2F0UA 3HEJA 1TU2B 1E2ZA 4EQPA 3ERQA 3R3OA 4CKCA 5CV8A 3S1QB 2O5IC 1B50A 1RTOA 4EQNA 2FHTA 3T13A 1F2YA 3J81E 5CV9A 3GP7A 4B9XA 3GTJB 4K6DA 4FXDA 1G6ZA 2G9HD 4NDXA 4IUUA 4CGYB 2B2TC 2PW7A 4G7OC 3M4YA 3S14B 2VB2X 4KY6A 2L5TA 5EBDA 3VA7A 2PO4A 1LLRD 2Q8RE 4K2LA 2RSNA 3J7YW 1HXYD 1PFBA 1V8QA 2KCNA 4V0BA 1CA5A 5DNFA 1WTVA 1TT2A 3BVGA 1JB3A 3RZOB 3MXUA 1BO0A 3P7JA 2XWJB 2B63B 2K32A 1HRJA 2JA8B 1CQFA 4A3EB 3VR4A 4S3SA 1Z6HA 4F7XA 3GTOB 1PMRA 2XRQD 5C4ZA 1JICA 1Y8OB 3C3LA 2Q8TA 1I4QA 5I2YA 1EYDA 3J7AF 4FNFA 4EQOA 1JOOA 3FPUB 4OO1G 3Q0AA 3FMCA 3NQIA 2JEAI 1CZGA 3O13A 3SDZA 2TSSA 2EZVA 1D6EC 1Z47A 4TQUS 1K8MA 3BG3A 1SXTA 2FMCA 1FR3A 3D4DA 5C0XH 1JWMD 3FPPA 3L3OC 2EJMA 1STEA 4CKEA 5JPMC 3T4AC 3KBGA 4OHJA 3A7AB 1LTGD 1EIGA 3MXPA 1QOHA 4UAIA 3GTQB 3KLSA 2D5DA 4OO1H 1F9QA 1EIHA 1U4RA 2LFNA 4DAYA 1JQYD 2LY7A 1EOTA 1NAPA 4TKOB 3HS0C 2K03A 1PFMA 1AN8A 2OEOA 2LS01 3S17B 1C48A 1VMCA 2B2VA 4G4KA 3J7AV 3OSOA 5IT9L 5FO7B 2YU9B 2F0LA 2VXWA 1QWYA 4ZLTF 5BN4A 3M7GA 3K6OA 1O7LA 1SEBD 2NN6I 1WD0A 3DWPA 4QUCA 2PPBC 2ZT9C 3GD7A 2O5JC 4OL7A 1TS4A 2BDNA 1GUSA 3NXWA 1JORA 4P2CB 2AQ2B 3K57A 2NYZD 2E76C 2EDGA 4C1NK 1MI2A 1TR5A 3RMHA 1KTKA 1LABA 2JA5B 4Z9CB 4A3MB 1BUVT 3RUZA 3I73A 3BDLA 4IUTA 1H9SB 1R4QB 2HQEA 2I46A 1HPCA 4A3FB 3NBIA 4ID6A 3VR2A 3AMUA 1EWHA 3I70A 3IFDA 2C5CA 4C3JB 1BR9A 4F87A 3OMGA 2B2WC 1OXUA 3CKIB 1RDPD 1G291 4UDUC 1NR2A 5DAUA 3OIPA 4DNTB 2NVXB 1IL8A 1PZKD 3S2DB 1GUTA 1GHKA 1XX8A 5CBEE 1STYA 4V190 4PMCA 2X6LA 1OO9B 2EYOA 3PUWA 5C5LA 2BA1A 1EQVA 1H9JA 4N9TA 4IUPA 4KN7C 3S1NB 5CYUA 3MXNA 5BN3A 2IPKD 2RVLA 3D6CA 5EKLA 1PLFA 2F0EA 5C3WA 4OIKA 5D65A 2M9VA 5KYIA 2L4NA 1CHPD 4A3KB 3GTPB 4IZ8A 3PUYA 5JPNC 1PTOD 4FF3A 1CZWA 3KUPA 2MP1A 3NBHA 1LO5D 1T5EA 5CBAE 2D2CC 1KDCA 2D9UA 2AWOA 5HURA 3HKZB 2BOSA 4FVMA 2IL8A 3FVQA 1BXTA 1U4PA 4DFAA 2SEBD 1Y1VB 5FK9C 1HTPA 1NUCA 4A3BB 3KF8A 2L0CA 3NK9A 2F0QA 2QCPX 2A6HC 2AUKA 1S4ZA 3W3AA 4CKBA 1JOQA 1BCPF 3U9OA 2PW5A 3EFXD 3HZXA 1B4OA 5A35A 1HCZA 3Q6SA 1EWCA 1QNUA 2AUJD 4ZRZA 2RBMA 2A6ED 3NHHA 2IJ0A 1TS5A 3SHLA 4R8NA 4ZKCB 2R3ZA 1TS3A 4X3KA 4XT1B 3WOEA 2QEJC 3HGBA 4I7ZC 4WORA 1NR4A 2B2UC 5D3DA 5LL6S 2F0GA 3S1MB 3E0JA 3MA2B 1RF2D 5C3XA 2R93B 5ELEA 3D6WA 2F0KA 3S9WA 1CI3M 5IODA 4DN4M 3F2UA 1QCBD 3I91A 3KBXA 3TBIB 1KABA 1TY0A 5IT9E 3M7NA 2A73B 1EQTA 1OXTA 2E2IB 5I6YA 3DWAA 1J8IA 1IHZA 2NWGA 2H4OA 3G6JB 3V2TA 2QF7A 1Q1BA 1BBXC 1CFMA 3FDTA 3Q23A 2XSCA 2IX0A 1Y1WB 1SJHD 2MJ8A 4IUNA 3BVZA 1GUNA 1F2MA 4M1UB 3CRLC 1I3QB 1CTMA 5J22A 4Q5VA 3MC0B 2AQ1B 2B8FA 1V1OA 1ML0D 3ND9A 3KLRA 1SDFA 2Z4IA 1SBBB 1ET6A 2V4DA 1K83B 2XRSD 2EY6A 3I8ZA 3OWEB 4JK1C 3KLSX 3VYUA 5F2DA 4K6LA 5FO9B 3E6ZX 3T53B 3SK5A 1ENAA 4DF7A 4DXGA 2NN6G 2EYPA 1CHQD 3TDQA 3VA5A 2B2YC 3SR1A 3OW7A 1B9MA 1VMPA 5E4XA 4NW2A 2XVSA 3BDOA 2YYZA 4BWGB 2GA4B 1VF5C 5TSSA 1PRTD 5JVG3 4BY1B 3C1FA 2KEEA 2R6GA 1EEID 1STBA 1HQMC 1PDQA 4B08A 4QUFA 3RLFA 1JR0D 2CQAA 2NN6H 3M85A 4IFDI 5I2XA 5JEAH 2JA7B 3R2IA 1RODA 5K5PA 1PTOB 5I6WA 4IUVA 1WTOA 1WCMB 4EVOA 1TVXA 1PXUA 1EY7A 1GHJA 4DAPA 3CU7A 4NMZA 5CMDA 1ONLA 1RJTA 1A2TA 2K01A 2SOBA 2KJXA 2PZUA 5EJWA 2JXMB 3GTKB 5CR3A 2A69D 5C6AA 4HCEA 2XIWA 1I4RA 2PYKA 2EY5A 2E74C 1AEXA 1S5ED 3JAML 5IGEA 4KJNA 2SNMA 1EU4A 1STHA 3HOVB 1D5ZC 5E4WC 1NCVA 1FNUA 5EKKA 5EKIA 1LTAD 2EPBA 1LACA 5KEEA 1GUWA 1SNQA 1I4XA 1IKMA 5CV4A 4KD3A 3M4OB 1FYCA 1O80A 4IFDJ 1LT4D 1DD2A 5IOCA 1LT6D 4FO2A 4OGQC 2WV6D 2TMPA 3K5MA 4IUQA 3TP7A 3EVQA 2B2TA 3MXGA 2WKCA 1TWHB 4PNYA 1BDOA 1I4GA 1Z7TA 1EY9A 4LJZC 1EY5A 1V1PB 3SK4A 5IGFA 2BE5D 4R9WA 2RSOA 5IIFA 3QB3A 3TZDA 1RKNA 2O2LD 3PIO3 4K8IA 3TN2A 3I4NB 3D4RA 1E2VA 1T5XD 2F3WA 1PTOC 4FYDA 1MSGA 2K5DA 4KD4A 1TQOA 3N52A 3K59A 3VYSA 2RQXA 3NSWA 4BY7B 3A8KE 2F0JA 1QNKA 1OXVA 4RA8A 1WTQA 3PMFA 3VYTA 4G7HC 1SE4A 4XT3B 2L55A 1LTTD 3A56A 4K2KA 2B39A 3HG9A 3QOLA 1PYWD 4ODGA 2IX1A 3D3RA 2CW0D 3RZDB 4JBWA 2WKDA 4FF4A 4RGOS 1EZ6A 1M8AA 4O1NA 2PCFB 5DM73 3V96A 2VB3X 3RD4A 2A68D 4XYQA 4PMBA 3MWYW 3NTHA 3HOZB 4LK1C 4XQJA 3FRPB 2J0TD 3H3VC 5G3LF 2NTTA 1JOKA 4KKSA 5JOBA 3NWTA 2A6EC 5FO8B 4DK1A 3CQZB 5C44B 2FINB 2NVTB 1BCPD 2AQ3B 1AZQA 4RGMA 1PRTB 1QE6A 1ZKOA 2ICEC 2K1BA 1TS2A 3EROA 2HDLA 1PFNA 2LKVA 2JA6B 1K8OA 4HTHA 1VCIA 4IALA 2MUYA 3FKIB 2NVYB 1UAPA 2EYHA 3QJYA 1TY2A 1LV9A 2E2JB 1RCVD 2J4XA 4K5XA 5KRUA 1KDAA 1A6XA 2F3VA 1DZ1A 4HMIA 2KOLA 2JP1A 4G7ZC 4ZQ3A 1BQQT 3P20A 3DEPA 1JC7A 5C4XB 4DXFA 4RKBA 1HA5A 1I6VC 1ILQA 5D14A 2F0PA 1HFNA 4XYOA 1DJRD 1D1KA 3VR5A 1A15A 5CC4A 5E3FA 2R92B 1W6JA 3K5NA 1YNND 1NSNS 2F0HA 1B3AA 4H13C 3OIQA 5C4HA 4C3HG 1PTOH 3C1EA 1GOZA 3JAME 4Y7NB 1M4VA 5KNDA 3A8JE 1LTSD 1B1ZA 2KCCA 1LTID 1UUPA 3K0YA 4Q0FA 4IFDG 4KI0A 3A7LA 4PQXA 1GXDC 1I4HA 1V43A 3NTKA 2F0OA 3H94A 3AB9A 5M9OA 1G8ZD 1V1PA 4DA2A 1Y69U 2K5WA 4RCNA 4XIGS 1TWFB 3OPOA 1X3QA 3OWFA 1VDZA 3X3MA 2C9OA 2NB0A 2M00A 5C0XI 4A3JB 1GJXA 1HA6A 1PRTC 5J39A 1F9SA 2OT2A 3X3NA 4BBSB 1II3A 5CV6A 4H7BA 3HP3A 3EQLC 1C4QA 1AW7A 5I9PA 3MFYA 1FNVA 1A3UA 5ELDA 3EJIA 2IW3A 1A3VA 1SYGA 1SSOA 1Q8IA 5COYA 5EPKA 4A3GB 2F0WA 3R93A 1DYQA 2RDFA 1D1IA 1TIID 4N9PA 4RWSC 2OF1A 2RDHA 1B44D 1SNCA 1U9RA 1WVLA 1SNPA 4U673 2SNSA 3TSSA 2NTSA 5K36G 1R4PB 3N6RA 2KVMA 3GTLB 4X3SA 1F2LA 1WD1A 4CJ1B 1O7YA 2RA4A 4E6IA 3W2DA 3BZDB 1MBYA 1R9TB 5DEHA 5M5XB 3VYRA 2FJ2A 3I72A 1O78A 1EFID 3KK7A 2F0SA 4ULLA 1XXGA 3H91A 3NQTA 4IURA 5J1ZA 1STGA 2KEDA 4BS9A 5C0XJ 3S16B 4DAVA 1H9SA 1Q3LA 2WB1B 3DMUA 3HRZC 2L9HA 2K04A 2SDFA 2N88A 3K7AB 5EPLA 3MTSA 1KDBA 1SNDA 4F8MA 4KHVA 5ISRA 3R8BA 3TP5A 3A55A 2EOTA 4QIWB 2B2UA 3BVMA 5KIXA 1DOKA 4MHEA 4RGTA 5IGDA 1KLGD 2EVBA 3QWNA 1AZPA 1JCKB 3I4MB 2ENBA 2BA0A 1PTOF 3OOCA 4L8JA 1G2TA 1FNWA 3M3YB 1IKLA 1X32A 3VR3A 1L0YB 3WDNA 2BE5C 1SYBA 3C46A 4L6TB 5FOBB 2BCOA 2QILA 1QJOA 3K5OA 4DNRB 3S1RB 2ZXRA 5BN5A 3AU7A 3ITPA 4H44C 4C3IG 2MGSA 2JEBI 2L12A 5KNBA 1DOLA 4ZKBB 3BYYB 5A2QL 2KECA 5C3EB 1OXSC 1D2BA 3D8GA 4J8QA 1D5MC 2A74C 2DY8A 5LL6X 4G57A 4K14A 1F9RA 2H1EA 2O4XA 3NUCA 1RHPA 2EYLA 3DHQA 3P1HA 3I90A 5KNCA 5ELFA 5M3MB 3S2HB 1SYCA 5AFWA 4HN7A 1SYFA 2CW0C 1B53A 3OHXC 2ZXOA 3NE5B 1KNEA 3I3CA 3GTMB 1DXMA 1WTXA 4PV1C 1U4MA 3QOJA 2JE6I 1ESRA 2A68C 4ZUIA 3A54A 1TWGB 2R7ZB 1ILPA 3QG1A 2B2YA 1GUOA 2Z4HA 3PIP3 4K8JA 1D5XC 5EGTA 1DCZA 2NZ1D 1HUNA 1BCPC 2G9DA 4R8IA 1LT3D 1SNMA 4J6HA 5KGUA 3DWQA 2MPMA 2WACA 3MFGA 1UNSA 4C3HB 1TWAB 2KQ3A 1EZ8A 3MAQA 2JYOA 2X6GA 1STAA 1XWEA 3GTGB 2XN9C 1ZXTA 5G3LD 3CRKC 3URYA 3OMCA 1HTLD 2K05A 1QILA 3T51B 1EYCA 1HFGA 1STNA 2B8GA 4A93B 3GV3A 2IWHA 2L11A 2F0DA 3LWUA 2EY1A 2VUMB 4WJWA 4QB4A 4HR7B 1WTRA 3QO2A 1MGSA 2EY2A 3Q22A 4XTCS 2HDMA 1W6KA 1H9RA 1IYVA 1F2ZA 1IW7D 4GZYC 3Q24A 1YNJD 4HEDA 3FEWX 1Y8NB 3TP8A 1VF7A 4RFBA 1PZJD 3SK6A 4BBRB 1I6HB 1IYUA 4NKLA 3SK8A 1HQRD 4KHZA 4RCOA 5C0XG 1YNNC 1U4LA 3HOUB 1G91A 3HOWB 3G7LA 4HSVA 1F9PA 3PUZA 4RHSA 2F0VA 2IX3A 3UI2A 4KY5A 1EY4A 2B2VC 4NP5A 4DK0A 3VR6A 3EA6A 4C2MB 2BDOA 2F0NA 2F0TA 3I4LA 2Q8IB 2CVRA 5JVH3 2F0MA 2F0FA 1KNAA 2NUCA 3V05A 1KAAA 3MZ5A 1SNOA 1EY8A 1PRTF 4QMGA 3LWEA 3T56B 1C8CA 3HOYB 1S5BD 1QB5D 2CHBD 1Q12A 4C1NI 1S5FD 1SMYD 3K58A 1CM9A 1QG7A 3IAYA 3GV6A 2J7ZA 1BF4A 1JE4A 1ICWA 5KYLA 3IFTA 4L63B 2XWBB 1UEAB 1ZYRD 3DM1A 4B9WA 3J80L 3E5SA 4FF1A 1CQVA 1J9OA 1PZID 3GQBA 2AWNA 3SXHA 2A5HA 3U9SA 4O42A 5LHY1 5EPJA 1B2TA 3H6MA 2K7VA 3L7ZC 4KY7A 3TP6A 1XYIA 4XQQA 2EXZA 4KMUC 2D62A 3P75A 5FKAC 5A2QE 4LAAA 2HCCA 1TWCB 2FMMA 4I65A 4IN3A 1H9MA 5T1IA 1GUGA 1E0BA 3ZYYX 3D31A 3NPPA 5IGCA 1CK1A 4BA1I 4ZUJA 3CHBD 4ZYSA 1F77A 1A2UA 4FXGC 4CJ2C 2PZTA 4WRDA 1EY0A 2QKIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0Y B;  4RGO S;  2XN9 C;  4O1N A;  3TSS A;  2NTS A;  1S5B D;  1ET9 A;  5TSS A;  1S5D D;  3URY A;  4L6T B;  1PTO D;  5ELB A;  1LTB D;  1PRT D;  1TY0 A;  4RH6 A;  1HTL D;  2CHB D;  1KTK A;  2QIL A;  4Z9C B;  1SJE D;  4RGN A;  1PTO H;  1XTC D;  1CHP D;  1LT4 D;  3O13 A;  1GOZ A;  1QIL A;  1LO5 D;  2TSS A;  1S5F D;  1LT6 D;  3W2D A;  3BZD B;  1M4V A;  3DWA A;  4BWG B;  2WV6 D;  1EEI D;  1EU3 A;  1ENF A;  1LTS D;  1D6E C;  1B1Z A;  2NTT A;  1JR0 D;  1SXT A;  1LTI D;  1UUP A;  1BXT A;  3BYY B;  3BYT B;  1JWM D;  2R61 A;  3GP7 A;  3R2I A;  1RD9 D;  1STE A;  1BCP D;  1EFI D;  2AQ3 B;  4L63 B;  2SEB D;  4RGM A;  4TSS A;  1PTO B;  5FK9 C;  1PRT B;  1I4H A;  2G9H D;  1D5M C;  1TS2 A;  1XXG A;  4OHJ A;  1SJH D;  1I4G A;  1LTG D;  3R2T A;  1LTR D;  1G8Z D;  1CQV A;  1V1P A;  3BVZ A;  1PZI D;  1FD7 D;  1V1P B;  4RHR A;  2Z8L A;  1BCP F;  3SEB A;  1JQY D;  4RFB A;  1RDP D;  1LLR D;  5ELF A;  5I4D A;  3EFX D;  2O2L D;  3MC0 B;  2AQ1 B;  1PZJ D;  1CT1 D;  4UDU C;  1V1O A;  1TY2 A;  1HXY D;  1JWU D;  2RDG A;  1EWC A;  1HQR D;  2XNA C;  4RCO A;  1RCV D;  1PZK D;  2J4X A;  1MD2 D;  1AN8 A;  1T5X D;  5ELC A;  1PTO C;  1EEF D;  1ET6 A;  1PRT C;  1JWS D;  1I4R A;  1SBB B;  1LT5 D;  2XRS D;  5FKA C;  1SE3 A;  3BVG A;  3R8B A;  3OWE B;  1KLU D;  1S5E D;  4RHS A;  2IJ0 A;  1AW7 A;  1TS5 A;  3KLS X;  1FNV A;  3BVM A;  1ESF A;  5ELD A;  4C56 C;  2ICI A;  1EU4 A;  1S5C D;  1TS3 A;  1CK1 A;  4K6L A;  1SEB D;  3EA6 A;  4DXF A;  1D5Z C;  3CHB D;  1HA5 A;  4DXG A;  4RGT A;  1BCP B;  1FNU A;  1KLG D;  2QEJ C;  5D3I B;  3DWP A;  1CHQ D;  1D5X C;  1SE4 A;  5D3D A;  1LTA D;  1DYQ A;  1I4P A;  1BCP C;  1JCK B;  1LTT D;  4ZYS A;  1F77 A;  1FGB D;  1RF2 D;  2IPK D;  2XRQ D;  1LT3 D;  5ELE A;  1TS4 A;  3DWQ A;  1DJR D;  3V05 A;  1I4X A;  1PYW D;  2RDH A;  3MFG A;  1I4Q A;  1PTO F;  1B44 D;  1UNS A;  1PRT F;  1L0X B;  1FNW A;  1SE2 A;  2AQ2 B; 
#chains in the Genus database with same CATH topology
 4X3U A;  4POF A;  3LNN A;  4ZK9 B;  4JVZ A;  2DNE A;  3H0G H;  4UHV A;  1VQN A;  4KTA A;  2QDB A;  5FLX L;  4XXE A;  3F8T A;  4B3R L;  4BA2 I;  4YWM A;  4C3I B;  5EBC A;  4DR7 Q;  1AP0 A;  1SJE D;  4WFN 3;  4LF4 Q;  2EJG C;  1BNZ A;  5EQ0 A;  1VQ9 A;  5CV5 A;  1SYD A;  4KV6 A;  4FP5 D;  4CDD C;  1HUM A;  4YY3 L;  5M3F B;  4KKU A;  1Q46 A;  5BR8 Q;  1V1Q A;  3CPF A;  1OXX K;  1L1O B;  5C4J B;  2QGQ A;  2L1B A;  3BYT B;  1K0S A;  2R61 A;  1RD9 D;  2PQE A;  1C0A A;  2FFK B;  2EYF A;  3GO5 A;  3DUZ A;  2KHS A;  5M3M H;  2AMC B;  4DR4 Q;  4DV4 L;  2KHJ A;  2JSO A;  4U68 A;  4POG A;  3JC6 6;  4DR6 L;  4JI2 L;  2K28 A;  3R2T A;  4TRD A;  2N55 A;  1OTC A;  4J1M A;  4A3D B;  1FD7 D;  5JEA J;  2WII B;  4ME5 A;  2K14 A;  2L15 A;  2Z8L A;  4LMQ D;  4HMJ A;  3SE0 A;  3A74 A;  3SEB A;  2PNR C;  5JJZ A;  3BDC A;  2NBF A;  1TWG H;  4DV6 Q;  5E1F A;  4GS3 A;  4QCL A;  2OXP A;  1EFW A;  1HNX L;  4AQY Q;  2RDG A;  1H9K A;  3VDY A;  3CCQ A;  1DON A;  1HNZ L;  2G5D A;  4L5S A;  2HUG A;  1HHV A;  1A3T A;  1EEF D;  4JI4 Q;  5COR A;  2B2W A;  2ZTE A;  4HSP A;  4DR3 Q;  5JAV A;  2KBN A;  1S72 A;  1CA6 A;  1B9N A;  4C3H H;  1TWA H;  4CJ0 B;  2JK8 A;  1X6O A;  3SVM A;  1EQQ A;  1UE6 A;  2K5Q A;  5ELN A;  1JMC A;  1I50 B;  3ULL A;  5D3I B;  4QY7 A;  3GTJ H;  1EYA A;  5T1G A;  3J81 L;  3IKJ A;  3S15 B;  1I4P A;  4KKT A;  2UUB L;  1GD7 A;  2JA8 G;  5FLM H;  2DN8 A;  4A3E G;  4JI0 Q;  4M8A A;  3PO2 B;  4IFD H;  3W1G A;  5IT9 c;  4A93 H;  1EY6 A;  3S14 H;  4IOC A;  1WTP A;  2Z9H A;  1NY4 A;  4DV0 L;  2VUM H;  4P73 A;  4OO1 I;  4P74 A;  2QDL A;  5M5Y B;  1LTB D;  4PMW A;  1G2S A;  3L9A X;  1O7Z A;  4RGN A;  3PO3 B;  1XTC D;  2EE1 A;  2ID0 A;  3MVV A;  4QF4 A;  1N34 L;  2I07 B;  3S24 A;  4K5V A;  1VQJ A;  1EU3 A;  1YHQ A;  2K4K A;  1X55 A;  2D0P A;  1RTN A;  2K33 A;  4HCS A;  2EJF C;  2B63 H;  3LX0 A;  3CCU A;  2LMC B;  4ABN A;  4RG1 A;  4A3E H;  2UU9 Q;  2E2D C;  2F4I A;  4A3L G;  1DGS A;  5JJL A;  5CGK A;  4DU9 A;  1KRT A;  3GTO H;  1QUQ A;  2EQS A;  2F0I A;  2HIV A;  1E24 A;  1DM0 B;  2EYJ A;  1CUK A;  4MN3 A;  3H09 A;  4RAU C;  3BS1 A;  3G71 A;  2A69 C;  3D4W A;  2M2L A;  3ONA B;  1EL0 A;  1PH7 A;  3RLN A;  4ME3 A;  3PF5 A;  1IL2 A;  4MIU A;  1CT1 D;  1ZEQ X;  5NUC A;  3DXJ C;  1JWU D;  3AFQ A;  4HAE A;  2XNA C;  2IT1 A;  3NWS A;  4C2M H;  5IYD G;  1ENC A;  2Y0S B;  2OTJ A;  1JWS D;  2D0O A;  2EYM A;  2WIN B;  1BOS A;  2WP8 J;  1SE3 A;  5LMU Q;  3J7Z C;  2K5N A;  2Z1C A;  5K36 H;  2E8G A;  4WJ3 M;  1M1K C;  4L5R C;  2PZW A;  4DGZ A;  1FJG Q;  4X66 L;  3J80 E;  1ESF A;  3BZC A;  4A3L H;  1AFP A;  4R4Q A;  4C56 C;  2ICI A;  2UUA Q;  1S5C D;  3ND8 A;  3HOX B;  2F03 A;  1AE2 A;  2E2H B;  1BCP B;  1BVS A;  3CF5 A;  3DM3 A;  4A3I B;  5IGG A;  1PA6 A;  2MHV A;  1FGB D;  2NVQ B;  1XTD A;  3PUX A;  2OQK A;  4CHT B;  2ZXP A;  1PH9 A;  3T16 A;  5IYC G;  3GTQ H;  2EIF A;  1IW7 C;  5I4D A;  1SFO B;  2ZJQ A;  1YNJ C;  4BXX H;  5M5W B;  1ET9 A;  1S5D D;  3WOF A;  4ZAI A;  5ELB A;  4RH6 A;  1X3P A;  1U5K A;  5IGB A;  1VQI A;  1Y8P B;  1XPO A;  1K9M C;  1E2W A;  3NTI A;  3MEH A;  4F88 A;  4AYB B;  2DJG C;  3TME A;  4HJ8 A;  4YWL A;  2HCI A;  2PMZ B;  4XDX A;  1VQO A;  4OX9 Q;  1ENF A;  1N9W A;  4IQZ A;  2JA5 G;  1WTW A;  1L1O A;  4A3M G;  4DAM A;  2F1M A;  4CBV A;  3CCM A;  4FXK C;  4KK7 A;  1Q90 A;  2K6A A;  4WJ4 A;  4H0L C;  4O0A A;  4OIJ A;  2VNU D;  2I5H A;  4KHP L;  4JI3 Q;  4TSS A;  2PQA B;  4RKL A;  2E75 C;  1MSH A;  4X62 L;  5IYC H;  5C5M A;  1XNQ L;  2DJF C;  1LTR D;  4X3T A;  4EGV A;  4LF8 L;  4A3F G;  1J5E L;  1SAP A;  2WAQ B;  4RHR A;  5FLX E;  5DM6 3;  5JJK A;  1TWC H;  4JI7 Q;  3PUV A;  3H0G B;  2DNC A;  3TZU A;  2FXQ A;  2F52 A;  4C3J G;  2RCF A;  2KUM A;  4XQN A;  2K50 A;  5I9O A;  1KC8 C;  4R4I A;  1Q1E A;  5JEA G;  4LF6 Q;  2GN5 A;  5CV7 A;  1MD2 D;  4A3M H;  5ELC A;  1DOM A;  4KJO A;  3DEO A;  4JW0 A;  4K5W A;  1LT5 D;  2ZTC A;  1KXL A;  1Q82 C;  3QIA A;  2C35 B;  2CH4 W;  1KLU D;  1SMY C;  4LF5 Q;  1AH9 A;  3A0J A;  1B8A A;  4YIJ A;  2RKS A;  4CDC C;  3K5L A;  4UP7 A;  1YVC A;  3C2P A;  4KN4 C;  3MHB A;  1SYE A;  3A8I E;  4JPB W;  1KQS A;  2UXD Q;  2DUD A;  2A6H D;  2X69 A;  4QIW E;  4FF2 A;  1FL0 A;  3NP8 A;  4A3F H;  4C3I H;  4ILW A;  4GNX C;  1XPU A;  3PV0 A;  1ZYR C;  2KA7 A;  2HHH Q;  3IL8 A;  2JQO A;  4AYB E;  4H02 A;  5HGT A;  4DUY Q;  3PF4 A;  2DY7 A;  1XPR A;  3H3V I;  2PMZ E;  1L0X B;  2B3G A;  2VY3 A;  1SE2 A;  4QQB X;  1TKW B;  1UE1 A;  2F0U A;  3HEJ A;  1KIX A;  1N33 Q;  4X64 L;  1TU2 B;  5C4J H;  1WFQ A;  1E2Z A;  4EQP A;  3TEH B;  2RHS B;  2UUC L;  1GKH A;  3ERQ A;  1CKN B;  4A3K G;  3R3O A;  4CKC A;  5CV8 A;  1LUZ A;  4IOA A;  4DR2 L;  3S2D H;  3S1Q B;  2O5I C;  1B50 A;  2E5L Q;  1RTO A;  1O7I A;  4EQN A;  2FHT A;  3T13 A;  1F2Y A;  3J81 E;  5CV9 A;  3GP7 A;  5LMN L;  4B9X A;  3GTJ B;  4K6D A;  1IBL L;  3K0X A;  4FXD A;  1G6Z A;  2G9H D;  2MO0 A;  3HKZ G;  1N32 Q;  2MNA A;  4NDX A;  4NXM Q;  4IUU A;  4CGY B;  2B2T C;  2PW7 A;  4IJH A;  3PQI A;  4K0K L;  4ALP A;  1Y1V G;  4G7O C;  3NEL A;  4A3B G;  3M4Y A;  3S14 B;  2VB2 X;  4B3R Q;  4KY6 A;  2L5T A;  5EBD A;  3VA7 A;  4A3K H;  2PO4 A;  3GTP H;  1LLR D;  2Q8R E;  2OQ0 A;  1C9O A;  1QVF A;  4K2L A;  2RSN A;  3J7Y W;  1HXY D;  1PFB A;  3W5O A;  3KFU A;  1V8Q A;  4NXN Q;  2KCN A;  4V0B A;  1D8L A;  1I50 H;  1HZA A;  1VQ5 A;  1YEZ A;  3S15 H;  1CA5 A;  5DNF A;  1WTV A;  1TT2 A;  3BVG A;  1JB3 A;  3RZO B;  3MXU A;  1BO0 A;  3P7J A;  2XWJ B;  3EN2 A;  4LFB L;  2QW7 A;  2B63 B;  2K32 A;  1HRJ A;  2JA8 B;  4DV5 Q;  1JJC B;  1CQF A;  4A3E B;  1UE7 A;  3VR4 A;  4S3S A;  1A8V A;  1Q8K A;  1Z6H A;  4A3B H;  4F7X A;  3K80 C;  5GAD C;  3GTO B;  1PMR A;  2XRQ D;  4JI1 L;  5C4Z A;  1JIC A;  4B3S Q;  1Y8O B;  5ELO A;  4TVA B;  4LF9 L;  4PZ8 A;  3C3L A;  2Q8T A;  1I4Q A;  5I2Y A;  1EYD A;  3J7A F;  4FNF A;  4EQO A;  4DR5 Q;  5HY6 A;  1VQ8 A;  2R93 G;  3ULP A;  3DLL A;  5IE8 A;  1JOO A;  3FPU B;  4OO1 G;  3Q0A A;  3FMC A;  3NQI A;  1X65 A;  1LM0 A;  2JEA I;  1CZG A;  3O13 A;  3SDZ A;  2TSS A;  2MO1 A;  2EZV A;  4PZ6 A;  2Q2T A;  1D6E C;  1Z47 A;  4TQU S;  1K8M A;  4GOP C;  3BG3 A;  1SXT A;  3W1B A;  2FMC A;  1FR3 A;  2AHO B;  3D4D A;  5C0X H;  1JWM D;  3FPP A;  3FHW A;  3L3O C;  2UUB Q;  2EJM A;  1STE A;  4CKE A;  5JPM C;  3CXC A;  3T4A C;  3KBG A;  4OHJ A;  3A7A B;  4DK3 C;  1LTG D;  1EIG A;  3MXP A;  5IYB G;  2R93 H;  1QOH A;  1VQH A;  4UAI A;  3GTQ B;  4DV0 Q;  3RN2 A;  1CSQ A;  3KLS A;  4JI5 Q;  2D5D A;  4OO1 H;  1Y1W G;  1F9Q A;  1EIH A;  1U4R A;  2LFN A;  3TQY A;  4CDF C;  4DAY A;  2KHI A;  2R7F A;  1JQY D;  2LY7 A;  3CMA A;  2OTL A;  4GKJ Q;  1EOT A;  1NAP A;  4TKO B;  1N34 Q;  3HS0 C;  2K03 A;  1SR3 A;  3CCJ A;  2E2H H;  1PFM A;  1AN8 A;  2OEO A;  2LS0 1;  2E2I H;  3S17 B;  1C48 A;  1VMC A;  2B2V A;  4G4K A;  3J7A V;  2NVQ H;  3OSO A;  5IT9 L;  5FO7 B;  3CP0 A;  1PYB A;  2YU9 B;  2F0L A;  2VXW A;  3RN5 A;  1QWY A;  4DNI A;  4ZLT F;  5BN4 A;  3M7G A;  3K6O A;  1O7L A;  1SEB D;  4IPC A;  2NN6 I;  3CCE A;  1WD0 A;  3DWP A;  3CCV A;  4YHH L;  4QUC A;  2PPB C;  2ZT9 C;  2JA9 A;  3GD7 A;  1MJC A;  2O5J C;  1QZH A;  4OL7 A;  1TS4 A;  2BDN A;  1GUS A;  1EOV A;  3NXW A;  1JOR A;  3BZK A;  2YV5 A;  4DUZ L;  4P2C B;  2AQ2 B;  4MTK A;  3JAM c;  3K57 A;  3U58 A;  1VQF A;  3A5U A;  1VS0 A;  1YHB A;  2NYZ D;  2E76 C;  2EDG A;  4C1N K;  1MI2 A;  1TR5 A;  1CKN A;  3RMH A;  1KTK A;  1LAB A;  2JA5 B;  2PI2 E;  4Z9C B;  4A3M B;  1YIT A;  1BUV T;  4EQ5 A;  3RUZ A;  5E7N A;  3I73 A;  4X66 Q;  4DV1 Q;  2A19 A;  3BDL A;  4IUT A;  3KOJ A;  4BY1 G;  1E1T A;  1H9S B;  1R4Q B;  1VQD A;  4UP9 A;  2HQE A;  2I46 A;  3ULJ A;  1HPC A;  3K7U C;  4A3F B;  3NBI A;  2I5L X;  1GO3 E;  1ASZ A;  4ID6 A;  3VR2 A;  3AMU A;  5IP9 G;  1EWH A;  2R7D A;  1I94 L;  2ES2 A;  3I70 A;  3IFD A;  4DK6 C;  2JA7 G;  2C5C A;  3KF6 A;  4IJL A;  4NPS A;  4C3J B;  1BR9 A;  4F87 A;  3OMG A;  1WCM G;  4OWW B;  2B2W C;  1OXU A;  2CWP A;  3CC4 A;  3CKI B;  1RDP D;  3TRE A;  1G29 1;  4UDU C;  1NR2 A;  5DAU A;  3OIP A;  4DNT B;  2NVX B;  2XGT A;  1IL8 A;  1PZK D;  3S2D B;  1VQL A;  4BY1 H;  1GUT A;  1GHK A;  2Q2U A;  1XX8 A;  5CBE E;  1VQC A;  1STY A;  4V19 0;  2Z6K A;  4IPH A;  4PMC A;  1U0L A;  4N8X 1;  2X6L A;  1OO9 B;  2EYO A;  3CW2 C;  3PUW A;  4X62 Q;  3OW2 A;  2JA7 H;  5C5L A;  2BA1 A;  1EQV A;  1H9J A;  4N9T A;  3UDF A;  4IUP A;  4KN7 C;  3S1N B;  5CYU A;  3MXN A;  1J6Q A;  2IY5 B;  5BN3 A;  2IPK D;  2RVL A;  3D6C A;  1P16 A;  5EKL A;  3HOV G;  1PLF A;  3S1Q H;  2F0E A;  4OIK A;  5D65 A;  5C3W A;  5GAE C;  2M9V A;  5KYI A;  2L4N A;  4HID A;  1CHP D;  4A3K B;  3RLO A;  1Q86 C;  1HJP A;  3GTP B;  1N36 L;  4IZ8 A;  3PUY A;  5JPN C;  1PTO D;  4FF3 A;  1CZW A;  4MZ9 A;  3GTK H;  3KUP A;  4DKA C;  2MP1 A;  4LNQ A;  3NBH A;  1L2F A;  1LO5 D;  1Q81 C;  1T5E A;  4LFC Q;  2K52 A;  5CBA E;  2D2C C;  1KDC A;  2D9U A;  3A5Z B;  2AWO A;  5HUR A;  3HKZ B;  2BOS A;  1HZB A;  2VS1 A;  2PI2 A;  2IL8 A;  3FVQ A;  4FVM A;  1BXT A;  2BH8 A;  1U4P A;  1K73 C;  1EIF A;  4DFA A;  3STB D;  2SEB D;  4P72 A;  1Y1V B;  3HOV H;  5FK9 C;  1HTP A;  1NUC A;  4A3B B;  3KF8 A;  2L0C A;  3NK9 A;  1X3G A;  4NB3 A;  2F0Q A;  2QCP X;  2A6H C;  1BKB A;  2AUK A;  1S4Z A;  5IY0 A;  3W3A A;  4CKB A;  2F3I A;  3L0O A;  1PFS A;  4A3C G;  1JOQ A;  3RZO H;  1BCP F;  1I5F A;  3U9O A;  2CWA A;  1EYG A;  2PW5 A;  3EFX D;  4DV2 L;  3HZX A;  1B4O A;  3M4O H;  2JA8 H;  5A35 A;  2CQO A;  1HCZ A;  2ALY B;  1EWC A;  3Q6S A;  2VQE Q;  4JYA L;  1QNU A;  2V1C C;  5IWA L;  1Q7Y C;  2AUJ D;  4ZRZ A;  2RBM A;  1SMX A;  2A6E D;  2ZTD A;  3I4N G;  2UXB L;  3NHH A;  2IJ0 A;  4R1J A;  1TS5 A;  4B3T L;  2N8N A;  3SHL A;  4R8N A;  1IBL Q;  4ZKC B;  1NBW A;  2R3Z A;  1TS3 A;  1BBU A;  4JBK A;  4X3K A;  1YIJ A;  4XT1 B;  3WOE A;  2UXC L;  2QEJ C;  3HGB A;  4I7Z C;  1TWH H;  1NR4 A;  2B2U C;  4WOR A;  4GNX B;  4BY7 G;  5D3D A;  5LL6 S;  1QVG A;  4A3C H;  2F0G A;  3S1M B;  3E0J A;  3MA2 B;  1RF2 D;  5C3X A;  2R93 B;  2WFW A;  5ELE A;  3CCL A;  3D6W A;  2F0K A;  3S9W A;  4GKK L;  1CI3 M;  3E9I A;  1LYL A;  5IOD A;  1JJG A;  2YTX A;  2CCZ A;  4DN4 M;  3F2U A;  1QCB D;  3I91 A;  3KBX A;  3TBI B;  1KAB A;  1K3B C;  4YCV A;  3HKZ E;  1L0W A;  1TY0 A;  3QR8 A;  3T1Y L;  5IT9 E;  3M7N A;  2A73 B;  1BBW A;  1EQT A;  1OXT A;  2E2I B;  5I6Y A;  1IBM L;  5L37 A;  3DWA A;  1J8I A;  1E1O A;  1IHZ A;  2NWG A;  2H4O A;  3G6J B;  5IYD H;  3V2T A;  1X56 A;  2QF7 A;  3HOZ G;  1Q1B A;  1BBX C;  4JV5 Q;  1CFM A;  3FDT A;  4JI1 Q;  4OEM B;  3Q23 A;  2XSC A;  4LF9 Q;  2IX0 A;  1Y1W B;  1SJH D;  3U4Z A;  2MJ8 A;  4IUN A;  5C44 G;  3BVZ A;  1HZ9 A;  1GUN A;  1F2M A;  4M1U B;  1PH5 A;  3CRL C;  1I3Q B;  3S17 H;  1SRO A;  1X3F A;  1CTM A;  1XMQ Q;  5J22 A;  2YU9 H;  5BR8 L;  2JA6 G;  4Q5V A;  3BU2 A;  4FDB A;  3MC0 B;  2AQ1 B;  2B8F A;  2PNH A;  1V1O A;  3J7A 5;  1A0I A;  1ML0 D;  1WOC A;  3FKI G;  3ND9 A;  3KLR A;  1SDF A;  2Z4I A;  1HNW L;  1SBB B;  1ET6 A;  2V4D A;  4DR4 L;  1K83 B;  2XRS D;  2Y0S E;  2EY6 A;  3I8Z A;  3OWE B;  4JK1 C;  3TRZ A;  2VQF Q;  3KLS X;  2HD3 A;  1EQR A;  3ER0 A;  3VYU A;  3OTO Q;  3OYY A;  5F2D A;  3CQZ H;  4K6L A;  5C44 H;  5FO9 B;  3E6Z X;  2Q2H A;  3T53 B;  3SK5 A;  2ZM6 Q;  1ENA A;  4DF7 A;  4DXG A;  4L5Q A;  2NN6 G;  2EYP A;  1CHQ D;  4DV6 L;  3TDQ A;  3VA5 A;  2B2Y C;  3SR1 A;  3OW7 A;  2JA5 H;  5C4X G;  1B9M A;  4AQY L;  1VMP A;  5E4X A;  4NW2 A;  2XVS A;  1HR0 W;  3BDO A;  2JA6 H;  4JI4 L;  2YYZ A;  2N49 A;  4BWG B;  4DR3 L;  1IBK L;  2GA4 B;  1UWV A;  1VF5 C;  5TSS A;  1EIY B;  1PRT D;  3PIO A;  2R92 G;  1EUJ A;  5JVG 3;  4MTN A;  4BY1 B;  1B7Y B;  4AIM A;  3C1F A;  2KEE A;  2R6G A;  4OWX B;  4GOP B;  1MIU A;  3KDF B;  4B3M L;  1EEI D;  1STB A;  1HQM C;  1PDQ A;  4B08 A;  4QUF A;  3RLF A;  4C3J H;  1JR0 D;  2H5X A;  4JI0 L;  2CQA A;  2NN6 H;  3M85 A;  4IFD I;  1VQE A;  5I2X A;  5JEA H;  4HJ7 A;  2JA7 B;  3R2I A;  1ROD A;  4JI6 Q;  5K5P A;  1PTO B;  5I6W A;  4IUV A;  1WTO A;  1WCM B;  4EVO A;  1TVX A;  4OWT B;  2NVX H;  1PXU A;  1EY7 A;  1GHJ A;  4DAP A;  3CU7 A;  4NMZ A;  5CMD A;  1ONL A;  1RJT A;  4JI8 L;  1A2T A;  3RR5 A;  2R92 H;  2K01 A;  2WAQ E;  2SOB A;  2KCT A;  1GVP A;  4R4O A;  2KJX A;  2PZU A;  3CAM A;  5EJW A;  2JXM B;  3GTK B;  2ZJP A;  5CR3 A;  2A69 D;  5C6A A;  4HCE A;  2XIW A;  3S1N H;  2UU9 L;  1I4R A;  2PYK A;  2EY5 A;  3TS0 A;  2E74 C;  4DV7 L;  4Y7N H;  1MJE A;  4YCU A;  1AEX A;  4A3J G;  1S5E D;  1NNX A;  2VW9 A;  3H15 A;  4GN3 B;  3JAM L;  3LGJ A;  1UE5 A;  1WI5 A;  1JJ2 A;  5IGE A;  4KJN A;  4A76 A;  2SNM A;  1I94 Q;  1EU4 A;  4AH6 A;  1STH A;  4BBS G;  3HOV B;  4GNX A;  1D5Z C;  5E4W C;  1NCV A;  1FNU A;  4MNO A;  4EX5 A;  5EKK A;  3FP9 A;  1YI2 A;  4YY3 Q;  5EKI A;  1LTA D;  1KRS A;  2EPB A;  3CC2 A;  1LAC A;  5KEE A;  1GUW A;  1SNQ A;  3J80 i;  1I4X A;  1GM5 A;  1TWF H;  4A3G G;  1NTG A;  1IKM A;  5CV4 A;  4KD3 A;  4DV4 Q;  2HQL A;  3M4O B;  4DR6 Q;  1FJG L;  3WWV A;  4JI2 Q;  1FYC A;  1O80 A;  3UDI A;  4OON A;  1Y1V H;  4IFD J;  1LT4 D;  4A3J H;  1DD2 A;  3I55 A;  5IOC A;  1LT6 D;  4FO2 A;  4OGQ C;  2WV6 D;  2TMP A;  2IHF A;  1HZC A;  3I7F A;  3M4P A;  3K5M A;  1HNX Q;  4IUQ A;  3TP7 A;  3EVQ A;  1HNZ Q;  2B2T A;  3MXG A;  2WKC A;  1TWH B;  1VQA A;  4PNY A;  4LWC A;  3F2C A;  1BDO A;  3HKS A;  4A3G H;  1I4G A;  1Z7T A;  1E7Z A;  1EY9 A;  2RCN A;  4LJZ C;  1EY5 A;  1V1P B;  3SK4 A;  2YTV A;  5IGF A;  5DLQ E;  1XNR L;  2BE5 D;  4R9W A;  2OCE A;  3U50 C;  2RSO A;  2I5M X;  3J81 j;  5IIF A;  3QB3 A;  2QEX A;  3TZD A;  1RKN A;  3F2B A;  1YNX A;  2O2L D;  3PIO 3;  4K8I A;  2PQA A;  3NEN A;  3TN2 A;  3I4N B;  3D4R A;  1E2V A;  3GTL H;  2ATW A;  1T5X D;  2WB1 G;  2F3W A;  1PTO C;  4FYD A;  1MSG A;  3S1M H;  2K5D A;  4KD4 A;  1TQO A;  2A1A A;  3N52 A;  3K59 A;  1R9T H;  3VYS A;  2RQX A;  3NSW A;  2ZJR A;  4BY7 B;  3A8K E;  2F0J A;  1QNK A;  1OXV A;  4JOI A;  4RA8 A;  1WTQ A;  4DV3 L;  4JI7 L;  1VQ6 A;  2MQH A;  3PMF A;  4GLX A;  3VYT A;  4G7H C;  1SE4 A;  4XT3 B;  3STB C;  2L55 A;  1LTT D;  3A56 A;  4K2K A;  2B39 A;  2RF4 A;  3HG9 A;  3QOL A;  1PYW D;  4ODG A;  4DV2 Q;  2IX1 A;  3D3R A;  1V9P A;  3G4S A;  2CW0 D;  3RZD B;  4JBW A;  2WKD A;  4FF4 A;  3I4M G;  3UDX A;  4RGO S;  1EZ6 A;  1M8A A;  4O1N A;  1IYJ B;  2XTI A;  5IWA Q;  4LF5 L;  2PCF B;  5IYB H;  1JB7 A;  5DM7 3;  1YJN A;  3V96 A;  3M9B A;  4JCV E;  1ICF B;  2VB3 X;  2UXD L;  2UXB Q;  3RD4 A;  1PH3 A;  2N78 A;  1UEB A;  2A68 D;  1Y1W H;  4B3T Q;  4XYQ A;  4PMB A;  1QUQ B;  3MWY W;  3NTH A;  4LK1 C;  4XQJ A;  3FRP B;  3HOZ B;  2J0T D;  3H3V C;  5G3L F;  2NTT A;  1JOK A;  1I3Q H;  4KKS A;  5JOB A;  3NWT A;  2A6E C;  5FO8 B;  2HHH L;  4DK1 A;  1XMO L;  1NE3 A;  3CQZ B;  3PCO B;  4DUY L;  5C44 B;  2I0Q A;  2FIN B;  2LXJ A;  2NVT B;  1BCP D;  2AQ3 B;  1AZQ A;  4RGM A;  2K75 A;  3AFP A;  3CPW A;  1PRT B;  1QE6 A;  1Y14 B;  4JBM A;  1ZKO A;  2ICE C;  2K1B A;  1TS2 A;  2JN4 A;  5EAY A;  3ERO A;  2Z0S A;  1IXR A;  5C3E G;  2HDL A;  1PFN A;  2LKV A;  2JA6 B;  2EXD A;  1K8O A;  4CDE C;  4HTH A;  1K83 H;  1VCI A;  3J81 i;  1AE3 A;  4IAL A;  1KD1 C;  3CC7 A;  2E5L L;  1N8R C;  2MUY A;  3FKI B;  3T1Y Q;  3F2D A;  2NVY B;  3RNU A;  3T1H L;  1UAP A;  2EYH A;  3QJY A;  4DPG A;  1IBM Q;  1TY2 A;  1LV9 A;  2E2J B;  1RCV D;  1PHJ A;  5IP7 G;  2J4X A;  2KEN A;  3EBE A;  4K5X A;  5KRU A;  4LUO A;  1KDA A;  5M3M G;  1A6X A;  2F3V A;  1DZ1 A;  4HMI A;  2KOL A;  4LF7 L;  2JP1 A;  4G7Z C;  4DR1 L;  4ZQ3 A;  4A75 A;  4L5T A;  3ZJY C;  1BQQ T;  4ZCK A;  3P20 A;  3DEP A;  1G6P A;  1JC7 A;  5C4X B;  5C3E H;  4DXF A;  4J15 A;  4RKB A;  1HA5 A;  1I6V C;  1ILQ A;  5D14 A;  4LFA L;  2F0P A;  2CH4 A;  2R7Z G;  1HFN A;  4XYO A;  2N3S A;  4NXN L;  2GVB A;  1DJR D;  1D1K A;  3VR5 A;  1A15 A;  5CC4 A;  5E3F A;  1VQ7 A;  5AJ3 L;  1ASY A;  4QJF A;  2R92 B;  1W6J A;  4KHP Q;  3K5N A;  5IP7 H;  5IP9 H;  1YNN D;  1NSN S;  2F0H A;  4HIM A;  1HNW Q;  1B3A A;  3S2H H;  1XNQ Q;  4H13 C;  3OIQ A;  5C4H A;  4C3H G;  4LF8 Q;  4DV5 L;  1PTO H;  2K5V A;  3C1E A;  1GOZ A;  1S3O A;  1J5E Q;  3JAM E;  1WCM H;  1M90 C;  3AEV A;  2HT1 A;  4Y7N B;  3GTM H;  1M4V A;  5KND A;  1YJ9 A;  4UY8 C;  2F4V L;  3A8J E;  1LTS D;  1B1Z A;  5FLM G;  2KCC A;  4B3S L;  1LTI D;  1UUP A;  3K0Y A;  4Q0F A;  4N8F A;  4IFD G;  2R7Z H;  1QVC A;  3BJU A;  4KI0 A;  3A7L A;  4PQX A;  4A93 G;  1GXD C;  4DR5 L;  1I4H A;  3KLW A;  1V43 A;  1FGU A;  3NTK A;  2F0O A;  3F1Z A;  3H94 A;  5GQO A;  2VUM G;  3PSI A;  3AB9 A;  4IPD A;  5M9O A;  1K8A C;  1MKH A;  1G8Z D;  1V1P A;  1X9N A;  4DA2 A;  2VL6 A;  1Y69 U;  2K5W A;  4RCN A;  3K8A A;  4XIG S;  1IBK Q;  1TWF B;  3OPO A;  1X3Q A;  1X3E A;  3OWF A;  1PVO A;  1VDZ A;  3X3M A;  2C9O A;  4HJ9 A;  3GTG H;  2NB0 A;  2M00 A;  3TS2 A;  1HH2 P;  5C0X I;  3D0F A;  4B3M Q;  2B63 G;  4A3J B;  1GJX A;  3J80 c;  2Z6B A;  1HA6 A;  3U4V A;  1PRT C;  5J39 A;  1F9S A;  3Q8D A;  1VQB A;  2OT2 A;  3X3N A;  3H3V H;  2QA4 A;  4BBR G;  4BBS B;  1II3 A;  1QZG A;  4X65 L;  5CV6 A;  4X64 Q;  1NJI C;  4H7B A;  3HP3 A;  3EQL C;  1C4Q A;  1AW7 A;  5I9P A;  3MFY A;  3SGI A;  1W2B A;  1FNV A;  3HOU G;  1A3U A;  5ELD A;  2UUC Q;  3EJI A;  3HOW G;  4JI5 L;  2IW3 A;  1A3V A;  1SYG A;  1PH2 A;  1SSO A;  4DR2 Q;  1Q8I A;  5COY A;  5EPK A;  1SLJ A;  1PH1 A;  2F0W A;  4A3G B;  3R93 A;  4GKJ L;  1DYQ A;  2RDF A;  1D1I A;  1XJV A;  4JI8 Q;  3HFZ B;  3L2P A;  4Y52 H;  1TII D;  4N9P A;  4RWS C;  1K28 A;  3E0E A;  2OF1 A;  2RDH A;  1B44 D;  1JE5 A;  1RL2 A;  1SNC A;  5LMN Q;  1U9R A;  1WVL A;  1SNP A;  4U67 3;  2SNS A;  3UE1 A;  3TSS A;  2NTS A;  5K36 G;  1R4P B;  3N6R A;  4BBR H;  2KVM A;  3GTL B;  4DV7 Q;  1I6H H;  4X3S A;  1F2L A;  1WD1 A;  4K0K Q;  4CJ1 B;  1O7Y A;  2RA4 A;  4E6I A;  3HOY G;  3W2D A;  3HOU H;  1TXY A;  3BZD B;  1MBY A;  1R9T B;  3HOW H;  5DEH A;  3GDE A;  5M5X B;  1PH8 A;  1B3Q A;  3VYR A;  2FJ2 A;  3I72 A;  1L1O C;  3B6Y A;  1O78 A;  1EFI D;  3KK7 A;  4O2D A;  5FLX c;  1H95 A;  2F0S A;  3PIP A;  1EWI A;  4BXX G;  1MHW C;  4ULL A;  1XXG A;  4PG3 A;  3H91 A;  3NQT A;  3I4N H;  4IUR A;  5J1Z A;  4LFB Q;  1STG A;  2KED A;  1A62 A;  4BS9 A;  5C0X J;  1PH4 A;  3S16 B;  4DAV A;  1H9S A;  4DV1 L;  1Q3L A;  2WB1 B;  4BY7 H;  1PV4 A;  3DMU A;  3HRZ C;  1HR0 L;  3HOY H;  2L9H A;  2K04 A;  4HJA A;  1KL9 A;  2SDF A;  5J3B A;  1NMF A;  2N88 A;  3K7A B;  2K5H A;  2GVA A;  5GRO A;  3G48 A;  5EPL A;  3MTS A;  3CD6 A;  1KDB A;  1SND A;  4F8M A;  4GN4 B;  4KHV A;  4DR7 L;  4LF4 L;  5ISR A;  3R8B A;  1RIP A;  2CKZ B;  3TP5 A;  3A55 A;  3KJO A;  2EOT A;  4QIW B;  2B2U A;  3BVM A;  5KIX A;  1DOK A;  4MHE A;  3RZD H;  1Z9F A;  4JG2 A;  1NMG A;  4RGT A;  2RHQ B;  1KLG D;  5IGD A;  2EVB A;  2A8V A;  1LTL A;  3QWN A;  1XNR Q;  1AZP A;  1JCK B;  1A63 A;  3I4M B;  2ENB A;  3HOZ H;  2BA0 A;  1PTO F;  3OOC A;  1K0R A;  4L8J A;  3CCR A;  1G2T A;  2HIX A;  1FNW A;  3M3Y B;  1IKL A;  1X32 A;  3VR3 A;  1L0Y B;  3AQQ A;  3WDN A;  2BE5 C;  1SYB A;  3C46 A;  4L6T B;  3JAM i;  2NVT H;  5FOB B;  2BCO A;  2QIL A;  1QJO A;  3K5O A;  4DNR B;  1FVI A;  3J81 c;  4UPA A;  3S1R B;  2ZXR A;  1WJJ A;  1W3S A;  5BN5 A;  3AU7 A;  3ITP A;  4H44 C;  4C3I G;  2MGS A;  2JEB I;  4YCW A;  1YBY A;  2L12 A;  5KNB A;  4DV3 Q;  1DOL A;  4QL5 A;  4ZKB B;  3K81 C;  3BYY B;  5A2Q L;  3M4Q A;  1C7Y A;  3FKI H;  4DAY B;  2KEC A;  5C3E B;  5M3F G;  2Q2I A;  2NVY H;  1OXS C;  1D2B A;  2WB1 E;  3D8G A;  4J8Q A;  1D5M C;  3PGZ A;  2A74 C;  1KAW A;  2E2J H;  2DY8 A;  5LL6 X;  4G57 A;  2JJQ A;  4K14 A;  4KLK A;  1F9R A;  2H1E A;  1WYD A;  2O4X A;  3NUC A;  4LFC L;  1RHP A;  2EYL A;  3DHQ A;  2AKW B;  1VQP A;  3P1H A;  3I90 A;  5KNC A;  5HGQ A;  5ELF A;  4A3D G;  5M3M B;  4YHH Q;  1SYC A;  3S2H B;  5C4X H;  5AFW A;  2VZA A;  4HN7 A;  1SYF A;  2CW0 C;  3OHX C;  1B53 A;  2ZXO A;  3NE5 B;  4PZ7 A;  3I3C A;  1KNE A;  1PYS B;  3GTM B;  1DXM A;  4DUZ Q;  1WTX A;  4PV1 C;  5GAG C;  1U4M A;  1XMO Q;  4RMF A;  3QOJ A;  5M3F H;  2JE6 I;  1ESR A;  1CSP A;  4YWK A;  4I7A A;  2A68 C;  4ZUI A;  3A54 A;  1TWG B;  2R7Z B;  1ILP A;  3QG1 A;  2B2Y A;  3I2Z A;  3G6E A;  3UDG A;  4GN5 A;  1GUO A;  2OWO A;  2Z4H A;  3PIP 3;  4K8J A;  4HIO A;  1D5X C;  5EGT A;  4OEL B;  4JBJ A;  1DCZ A;  2NZ1 D;  1HUN A;  1BCP C;  2G9D A;  4R8I A;  1LT3 D;  1SNM A;  4J6H A;  2VQE L;  5KGU A;  3DWQ A;  2MPM A;  4GLA C;  2WAC A;  3T1H Q;  5FJ8 G;  4QGU A;  4A3D H;  3MFG A;  1UNS A;  4C3H B;  1TWA B;  2KQ3 A;  1EZ8 A;  3MAQ A;  1K3R A;  2JYO A;  2X6G A;  1K8G A;  1STA A;  1XWE A;  4OXP A;  3GTG B;  2XN9 C;  1ZXT A;  5G3L D;  3CRK C;  3PO2 G;  1YZ6 A;  3URY A;  3OMC A;  1HTL D;  3ERS X;  2IHE A;  2K05 A;  4JC0 A;  4UP8 A;  1QIL A;  4LF7 Q;  3T51 B;  4DR1 Q;  1EYC A;  1HFG A;  1STN A;  3AYH B;  2B8G A;  4LUV A;  4A93 B;  3KF6 B;  3GV3 A;  2IWH A;  3EIV A;  3PO3 G;  2L11 A;  2F0D A;  3LWU A;  4APV A;  2EY1 A;  2VUM B;  4WJW A;  1X54 A;  4LFA Q;  5H1S E;  3I56 A;  4QB4 A;  5LMU L;  1SRU A;  2BH2 A;  4HR7 B;  1WTR A;  1SE8 A;  3QO2 A;  1MGS A;  2EY2 A;  4IPG A;  4LUZ A;  3Q22 A;  2UUA L;  4XTC S;  5FJ8 H;  2HDM A;  1W6K A;  5AJ3 Q;  1H9R A;  5JJI A;  1IYV A;  1F2Z A;  1IW7 D;  4GZY C;  3Q24 A;  1YNJ D;  3PO2 H;  4BBS H;  4HED A;  3FEW X;  1Y8N B;  3IRB A;  3TP8 A;  1PH6 A;  1VF7 A;  4RFB A;  4GLV B;  4P75 A;  1PZJ D;  3SK6 A;  1G51 A;  4BBR B;  1I6H B;  3MEF A;  1IZ6 A;  1IYU A;  4NKL A;  3SK8 A;  5M5Y H;  1HQR D;  1SN8 A;  2F4V Q;  4KHZ A;  4RCO A;  5C0X G;  1YNN C;  2YTY A;  4JV5 L;  1U4L A;  1VQM A;  4JOI C;  3PO3 H;  3HOU B;  1G91 A;  3MXN B;  2CFM A;  3HOW B;  2B29 A;  5LMN W;  1YJW A;  3G7L A;  3CME A;  1N36 Q;  4HSV A;  1F9P A;  2Y0S G;  3PUZ A;  4RHS A;  2F0V A;  2IX3 A;  3UI2 A;  3KJP A;  4KY5 A;  1E3P A;  1JT8 A;  1CKM A;  1EY4 A;  2B2V C;  4NP5 A;  4OX9 L;  4DK0 A;  3VR6 A;  1XMQ L;  3EA6 A;  2BDO A;  4C2M B;  2F0N A;  2F0T A;  3I4L A;  2Q8I B;  2CVR A;  2NZH A;  5JVH 3;  3NBH B;  4JI3 L;  2F0M A;  3HOX G;  2F0F A;  4A4I A;  1CKO A;  3E3X A;  1KNA A;  2NUC A;  3V05 A;  1KAA A;  3MZ5 A;  1SNO A;  1EY8 A;  5GAH C;  1PRT F;  5M5X H;  4A3I G;  4QMG A;  3LWE A;  3T56 B;  1C8C A;  3HOY B;  1S5B D;  1QB5 D;  2VQF L;  2CHB D;  1Q12 A;  3OTO L;  3KF8 B;  4X65 Q;  2ZM6 L;  1YHA A;  4C1N I;  1S5F D;  1SMY D;  3K58 A;  1CM9 A;  1QG7 A;  4LF6 L;  3IAY A;  3GV6 A;  2J7Z A;  3S16 H;  4R4C A;  4AYB G;  1BF4 A;  3E9H A;  1JE4 A;  1ICW A;  2NZO A;  2ASB A;  2MFI A;  4JYA Q;  5KYL A;  3IFT A;  3HOX H;  4L63 B;  4HJ5 A;  2XWB B;  1VQ4 A;  1UEA B;  1ZYR D;  3DM1 A;  4B9W A;  3J80 L;  3E5S A;  4X6A H;  4LW1 A;  3K7A H;  4A3I H;  1WTH A;  4GOP A;  1CQV A;  4FF1 A;  3KDF A;  1J9O A;  1PZI D;  3NEM A;  3I4O A;  3GQB A;  4P71 A;  2AWN A;  3SXH A;  2A5H A;  3U9S A;  4O42 A;  2LXK A;  2UXC Q;  5LHY 1;  5EPJ A;  1B2T A;  3H6M A;  2K7V A;  1SFO H;  1D7Q A;  3L7Z C;  4KY7 A;  2WAQ G;  3KYH C;  5M5W H;  3TP6 A;  1XYI A;  1KHI A;  1S40 A;  3CCS A;  4XQQ A;  1N33 L;  2EXZ A;  4IO9 A;  4GKK Q;  3H0G G;  4JI6 L;  4KMU C;  2D62 A;  3P75 A;  2P5Z X;  5FKA C;  5A2Q E;  4LAA A;  4R4T A;  3I4M H;  2HCC A;  1TWC B;  2FMM A;  4I65 A;  4IN3 A;  1P8L A;  1T9H A;  1H9M A;  5T1I A;  3ICE A;  1GUG A;  1E0B A;  1E22 A;  3ZYY X;  3D31 A;  3NPP A;  1VQG A;  3M3Y H;  5IGC A;  2Z6K C;  1CK1 A;  4BA1 I;  4ZUJ A;  3CHB D;  2LSS A;  1VQK A;  4HIK A;  1B70 B;  4ZYS A;  3UE0 A;  1F77 A;  1A2U A;  4FXG C;  3S1R H;  2DGY A;  4CJ2 C;  1N32 L;  2PZT A;  4WRD A;  1HR0 Q;  2KCM A;  4NXM L;  1EY0 A;  2QKI C; 
#chains in the Genus database with same CATH homology
 4X3U A;  4ZK9 B;  3LNN A;  2DNE A;  4KTA A;  2QDB A;  5FLX L;  4XXE A;  4BA2 I;  4C3I B;  5EBC A;  1AP0 A;  1SJE D;  4WFN 3;  2EJG C;  1BNZ A;  5EQ0 A;  5CV5 A;  1SYD A;  4KV6 A;  4FP5 D;  1HUM A;  5M3F B;  4KKU A;  1OXX K;  5C4J B;  2L1B A;  3BYT B;  2R61 A;  1RD9 D;  2PQE A;  2FFK B;  2EYF A;  3GO5 A;  3DUZ A;  2KHS A;  2JSO A;  4U68 A;  2K28 A;  3R2T A;  4TRD A;  2N55 A;  4J1M A;  4A3D B;  1FD7 D;  5JEA J;  2WII B;  4ME5 A;  2Z8L A;  4LMQ D;  4HMJ A;  3SE0 A;  3SEB A;  2PNR C;  5JJZ A;  3BDC A;  2NBF A;  5E1F A;  4QCL A;  2OXP A;  2RDG A;  1H9K A;  1DON A;  2HUG A;  1HHV A;  1A3T A;  1EEF D;  5COR A;  2B2W A;  4HSP A;  5JAV A;  1CA6 A;  1B9N A;  4CJ0 B;  3SVM A;  2K5Q A;  1I50 B;  5D3I B;  1EYA A;  5T1G A;  3J81 L;  3IKJ A;  3S15 B;  1I4P A;  4KKT A;  2DN8 A;  4M8A A;  3PO2 B;  4IFD H;  1EY6 A;  1WTP A;  4OO1 I;  5M5Y B;  1LTB D;  4PMW A;  1G2S A;  3L9A X;  1O7Z A;  4RGN A;  3PO3 B;  1XTC D;  2EE1 A;  2ID0 A;  3MVV A;  4QF4 A;  2I07 B;  4K5V A;  1EU3 A;  1RTN A;  2K33 A;  4HCS A;  2EJF C;  3LX0 A;  2LMC B;  4ABN A;  2E2D C;  2F4I A;  5CGK A;  4DU9 A;  2F0I A;  1DM0 B;  2EYJ A;  4MN3 A;  3H09 A;  4RAU C;  3BS1 A;  2A69 C;  3D4W A;  2M2L A;  3ONA B;  1EL0 A;  4MIU A;  1CT1 D;  1ZEQ X;  5NUC A;  3DXJ C;  1JWU D;  4HAE A;  2XNA C;  2IT1 A;  3NWS A;  1ENC A;  2Y0S B;  1JWS D;  2EYM A;  2WIN B;  1BOS A;  2WP8 J;  1SE3 A;  2Z1C A;  5K36 H;  2PZW A;  4DGZ A;  3J80 E;  1ESF A;  1AFP A;  4C56 C;  2ICI A;  1S5C D;  3ND8 A;  3HOX B;  2F03 A;  2E2H B;  1BCP B;  4A3I B;  5IGG A;  2MHV A;  1FGB D;  2NVQ B;  3PUX A;  4CHT B;  2ZXP A;  3T16 A;  1IW7 C;  5I4D A;  1SFO B;  1YNJ C;  5M5W B;  1ET9 A;  1S5D D;  3WOF A;  4ZAI A;  5ELB A;  4RH6 A;  1X3P A;  5IGB A;  1Y8P B;  1E2W A;  3NTI A;  3MEH A;  4F88 A;  4AYB B;  3TME A;  2HCI A;  2PMZ B;  4XDX A;  1ENF A;  4IQZ A;  1WTW A;  2F1M A;  4CBV A;  4FXK C;  4KK7 A;  1Q90 A;  2K6A A;  4H0L C;  4OIJ A;  2VNU D;  4TSS A;  4RKL A;  2E75 C;  1MSH A;  5C5M A;  1LTR D;  4X3T A;  4EGV A;  1SAP A;  2WAQ B;  4RHR A;  5FLX E;  5DM6 3;  3PUV A;  3H0G B;  2DNC A;  3TZU A;  4C3J G;  4XQN A;  2KUM A;  5I9O A;  1Q1E A;  5JEA G;  5CV7 A;  1MD2 D;  5ELC A;  1DOM A;  4KJO A;  3DEO A;  4K5W A;  1LT5 D;  3QIA A;  1KLU D;  1SMY C;  4YIJ A;  2RKS A;  3K5L A;  3C2P A;  4KN4 C;  3MHB A;  1SYE A;  3A8I E;  2X69 A;  2A6H D;  4FF2 A;  3NP8 A;  4ILW A;  3PV0 A;  1ZYR C;  2KA7 A;  3IL8 A;  5HGT A;  2DY7 A;  1L0X B;  1SE2 A;  1TKW B;  2F0U A;  3HEJ A;  1TU2 B;  1E2Z A;  4EQP A;  3ERQ A;  3R3O A;  4CKC A;  5CV8 A;  3S1Q B;  2O5I C;  1B50 A;  1RTO A;  4EQN A;  2FHT A;  3T13 A;  1F2Y A;  3J81 E;  5CV9 A;  3GP7 A;  4B9X A;  3GTJ B;  4K6D A;  4FXD A;  1G6Z A;  2G9H D;  4NDX A;  4IUU A;  4CGY B;  2B2T C;  2PW7 A;  4G7O C;  3M4Y A;  3S14 B;  2VB2 X;  4KY6 A;  2L5T A;  5EBD A;  3VA7 A;  2PO4 A;  1LLR D;  2Q8R E;  4K2L A;  2RSN A;  3J7Y W;  1HXY D;  1PFB A;  1V8Q A;  2KCN A;  4V0B A;  1CA5 A;  5DNF A;  1WTV A;  1TT2 A;  3BVG A;  1JB3 A;  3RZO B;  3MXU A;  1BO0 A;  3P7J A;  2XWJ B;  2B63 B;  2K32 A;  1HRJ A;  2JA8 B;  1CQF A;  4A3E B;  3VR4 A;  4S3S A;  1Z6H A;  4F7X A;  3GTO B;  1PMR A;  2XRQ D;  5C4Z A;  1JIC A;  1Y8O B;  3C3L A;  2Q8T A;  1I4Q A;  5I2Y A;  1EYD A;  3J7A F;  4FNF A;  4EQO A;  1JOO A;  3FPU B;  4OO1 G;  3Q0A A;  3FMC A;  3NQI A;  2JEA I;  1CZG A;  3O13 A;  3SDZ A;  2TSS A;  2EZV A;  1D6E C;  1Z47 A;  4TQU S;  1K8M A;  3BG3 A;  1SXT A;  2FMC A;  1FR3 A;  3D4D A;  5C0X H;  1JWM D;  3FPP A;  3L3O C;  2EJM A;  1STE A;  4CKE A;  5JPM C;  3T4A C;  3KBG A;  4OHJ A;  3A7A B;  1LTG D;  1EIG A;  3MXP A;  1QOH A;  4UAI A;  3GTQ B;  3KLS A;  2D5D A;  4OO1 H;  1F9Q A;  1EIH A;  1U4R A;  2LFN A;  4DAY A;  1JQY D;  2LY7 A;  1EOT A;  1NAP A;  4TKO B;  3HS0 C;  2K03 A;  1PFM A;  1AN8 A;  2OEO A;  2LS0 1;  3S17 B;  1C48 A;  1VMC A;  2B2V A;  4G4K A;  3J7A V;  3OSO A;  5IT9 L;  5FO7 B;  2YU9 B;  2F0L A;  2VXW A;  1QWY A;  4ZLT F;  5BN4 A;  3M7G A;  3K6O A;  1O7L A;  1SEB D;  2NN6 I;  1WD0 A;  3DWP A;  4QUC A;  2PPB C;  2ZT9 C;  3GD7 A;  2O5J C;  4OL7 A;  1TS4 A;  2BDN A;  1GUS A;  3NXW A;  1JOR A;  4P2C B;  2AQ2 B;  3K57 A;  2NYZ D;  2E76 C;  2EDG A;  4C1N K;  1MI2 A;  1TR5 A;  3RMH A;  1KTK A;  1LAB A;  2JA5 B;  4Z9C B;  4A3M B;  1BUV T;  3RUZ A;  3I73 A;  3BDL A;  4IUT A;  1H9S B;  1R4Q B;  2HQE A;  2I46 A;  1HPC A;  4A3F B;  3NBI A;  4ID6 A;  3VR2 A;  3AMU A;  1EWH A;  3I70 A;  3IFD A;  2C5C A;  4C3J B;  1BR9 A;  4F87 A;  3OMG A;  2B2W C;  1OXU A;  3CKI B;  1RDP D;  1G29 1;  4UDU C;  1NR2 A;  5DAU A;  3OIP A;  4DNT B;  2NVX B;  1IL8 A;  1PZK D;  3S2D B;  1GUT A;  1GHK A;  1XX8 A;  5CBE E;  1STY A;  4V19 0;  4PMC A;  2X6L A;  1OO9 B;  2EYO A;  3PUW A;  5C5L A;  2BA1 A;  1EQV A;  1H9J A;  4N9T A;  4IUP A;  4KN7 C;  3S1N B;  5CYU A;  3MXN A;  5BN3 A;  2IPK D;  2RVL A;  3D6C A;  5EKL A;  1PLF A;  2F0E A;  5C3W A;  4OIK A;  5D65 A;  2M9V A;  5KYI A;  2L4N A;  1CHP D;  4A3K B;  3GTP B;  4IZ8 A;  3PUY A;  5JPN C;  1PTO D;  4FF3 A;  1CZW A;  3KUP A;  2MP1 A;  3NBH A;  1LO5 D;  1T5E A;  5CBA E;  2D2C C;  1KDC A;  2D9U A;  2AWO A;  5HUR A;  3HKZ B;  2BOS A;  4FVM A;  2IL8 A;  3FVQ A;  1BXT A;  1U4P A;  4DFA A;  2SEB D;  1Y1V B;  5FK9 C;  1HTP A;  1NUC A;  4A3B B;  3KF8 A;  2L0C A;  3NK9 A;  2F0Q A;  2QCP X;  2A6H C;  2AUK A;  1S4Z A;  3W3A A;  4CKB A;  1JOQ A;  1BCP F;  3U9O A;  2PW5 A;  3EFX D;  3HZX A;  1B4O A;  5A35 A;  1HCZ A;  3Q6S A;  1EWC A;  1QNU A;  2AUJ D;  4ZRZ A;  2RBM A;  2A6E D;  3NHH A;  2IJ0 A;  1TS5 A;  3SHL A;  4R8N A;  4ZKC B;  2R3Z A;  1TS3 A;  4X3K A;  4XT1 B;  3WOE A;  2QEJ C;  3HGB A;  4I7Z C;  4WOR A;  1NR4 A;  2B2U C;  5D3D A;  5LL6 S;  2F0G A;  3S1M B;  3E0J A;  3MA2 B;  1RF2 D;  5C3X A;  2R93 B;  5ELE A;  3D6W A;  2F0K A;  3S9W A;  1CI3 M;  5IOD A;  4DN4 M;  3F2U A;  1QCB D;  3I91 A;  3KBX A;  3TBI B;  1KAB A;  1TY0 A;  5IT9 E;  3M7N A;  2A73 B;  1EQT A;  1OXT A;  2E2I B;  5I6Y A;  3DWA A;  1J8I A;  1IHZ A;  2NWG A;  2H4O A;  3G6J B;  3V2T A;  2QF7 A;  1Q1B A;  1BBX C;  1CFM A;  3FDT A;  3Q23 A;  2XSC A;  2IX0 A;  1Y1W B;  1SJH D;  2MJ8 A;  4IUN A;  3BVZ A;  1GUN A;  1F2M A;  4M1U B;  3CRL C;  1I3Q B;  1CTM A;  5J22 A;  4Q5V A;  3MC0 B;  2AQ1 B;  2B8F A;  1V1O A;  1ML0 D;  3ND9 A;  3KLR A;  1SDF A;  2Z4I A;  1SBB B;  1ET6 A;  2V4D A;  1K83 B;  2XRS D;  2EY6 A;  3I8Z A;  3OWE B;  4JK1 C;  3KLS X;  3VYU A;  5F2D A;  4K6L A;  5FO9 B;  3E6Z X;  3T53 B;  3SK5 A;  1ENA A;  4DF7 A;  4DXG A;  2NN6 G;  2EYP A;  1CHQ D;  3TDQ A;  3VA5 A;  2B2Y C;  3SR1 A;  3OW7 A;  1B9M A;  1VMP A;  5E4X A;  4NW2 A;  2XVS A;  3BDO A;  2YYZ A;  4BWG B;  2GA4 B;  1VF5 C;  5TSS A;  1PRT D;  5JVG 3;  4BY1 B;  3C1F A;  2KEE A;  2R6G A;  1EEI D;  1STB A;  1HQM C;  1PDQ A;  4B08 A;  4QUF A;  3RLF A;  1JR0 D;  2CQA A;  2NN6 H;  3M85 A;  4IFD I;  5I2X A;  5JEA H;  2JA7 B;  3R2I A;  1ROD A;  5K5P A;  1PTO B;  5I6W A;  4IUV A;  1WTO A;  1WCM B;  4EVO A;  1TVX A;  1PXU A;  1EY7 A;  1GHJ A;  4DAP A;  3CU7 A;  4NMZ A;  5CMD A;  1ONL A;  1RJT A;  1A2T A;  2K01 A;  2SOB A;  2KJX A;  2PZU A;  5EJW A;  2JXM B;  3GTK B;  5CR3 A;  2A69 D;  5C6A A;  4HCE A;  2XIW A;  1I4R A;  2PYK A;  2EY5 A;  2E74 C;  1AEX A;  1S5E D;  3JAM L;  5IGE A;  4KJN A;  2SNM A;  1EU4 A;  1STH A;  3HOV B;  1D5Z C;  5E4W C;  1NCV A;  1FNU A;  5EKK A;  5EKI A;  1LTA D;  2EPB A;  1LAC A;  5KEE A;  1GUW A;  1SNQ A;  1I4X A;  1IKM A;  5CV4 A;  4KD3 A;  3M4O B;  1FYC A;  1O80 A;  4IFD J;  1LT4 D;  1DD2 A;  5IOC A;  1LT6 D;  4FO2 A;  4OGQ C;  2WV6 D;  2TMP A;  3K5M A;  4IUQ A;  3TP7 A;  3EVQ A;  2B2T A;  3MXG A;  2WKC A;  1TWH B;  4PNY A;  1BDO A;  1I4G A;  1Z7T A;  1EY9 A;  4LJZ C;  1EY5 A;  1V1P B;  3SK4 A;  5IGF A;  2BE5 D;  4R9W A;  2RSO A;  5IIF A;  3QB3 A;  3TZD A;  1RKN A;  2O2L D;  3PIO 3;  4K8I A;  3TN2 A;  3I4N B;  3D4R A;  1E2V A;  1T5X D;  2F3W A;  1PTO C;  4FYD A;  1MSG A;  2K5D A;  4KD4 A;  1TQO A;  3N52 A;  3K59 A;  3VYS A;  2RQX A;  3NSW A;  4BY7 B;  3A8K E;  2F0J A;  1QNK A;  1OXV A;  4RA8 A;  1WTQ A;  3PMF A;  3VYT A;  4G7H C;  1SE4 A;  4XT3 B;  2L55 A;  1LTT D;  3A56 A;  4K2K A;  2B39 A;  3HG9 A;  3QOL A;  1PYW D;  4ODG A;  2IX1 A;  3D3R A;  2CW0 D;  3RZD B;  4JBW A;  2WKD A;  4FF4 A;  4RGO S;  1EZ6 A;  1M8A A;  4O1N A;  2PCF B;  5DM7 3;  3V96 A;  2VB3 X;  3RD4 A;  2A68 D;  4XYQ A;  4PMB A;  3MWY W;  3NTH A;  3HOZ B;  4LK1 C;  4XQJ A;  3FRP B;  2J0T D;  3H3V C;  5G3L F;  2NTT A;  1JOK A;  4KKS A;  5JOB A;  3NWT A;  2A6E C;  5FO8 B;  4DK1 A;  3CQZ B;  5C44 B;  2FIN B;  2NVT B;  1BCP D;  2AQ3 B;  1AZQ A;  4RGM A;  1PRT B;  1QE6 A;  1ZKO A;  2ICE C;  2K1B A;  1TS2 A;  3ERO A;  2HDL A;  1PFN A;  2LKV A;  2JA6 B;  1K8O A;  4HTH A;  1VCI A;  4IAL A;  2MUY A;  3FKI B;  2NVY B;  1UAP A;  2EYH A;  3QJY A;  1TY2 A;  1LV9 A;  2E2J B;  1RCV D;  2J4X A;  4K5X A;  5KRU A;  1KDA A;  1A6X A;  2F3V A;  1DZ1 A;  4HMI A;  2KOL A;  2JP1 A;  4G7Z C;  4ZQ3 A;  1BQQ T;  3P20 A;  3DEP A;  1JC7 A;  5C4X B;  4DXF A;  4RKB A;  1HA5 A;  1I6V C;  1ILQ A;  5D14 A;  2F0P A;  1HFN A;  4XYO A;  1DJR D;  1D1K A;  3VR5 A;  1A15 A;  5CC4 A;  5E3F A;  2R92 B;  1W6J A;  3K5N A;  1YNN D;  1NSN S;  2F0H A;  1B3A A;  4H13 C;  3OIQ A;  5C4H A;  4C3H G;  1PTO H;  3C1E A;  1GOZ A;  3JAM E;  4Y7N B;  1M4V A;  5KND A;  3A8J E;  1LTS D;  1B1Z A;  2KCC A;  1LTI D;  1UUP A;  3K0Y A;  4Q0F A;  4IFD G;  4KI0 A;  3A7L A;  4PQX A;  1GXD C;  1I4H A;  1V43 A;  3NTK A;  2F0O A;  3H94 A;  3AB9 A;  5M9O A;  1G8Z D;  1V1P A;  4DA2 A;  1Y69 U;  2K5W A;  4RCN A;  4XIG S;  1TWF B;  3OPO A;  1X3Q A;  3OWF A;  1VDZ A;  3X3M A;  2C9O A;  2NB0 A;  2M00 A;  5C0X I;  4A3J B;  1GJX A;  1HA6 A;  1PRT C;  5J39 A;  1F9S A;  2OT2 A;  3X3N A;  4BBS B;  1II3 A;  5CV6 A;  4H7B A;  3HP3 A;  3EQL C;  1C4Q A;  1AW7 A;  5I9P A;  3MFY A;  1FNV A;  1A3U A;  5ELD A;  3EJI A;  2IW3 A;  1A3V A;  1SYG A;  1SSO A;  1Q8I A;  5COY A;  5EPK A;  4A3G B;  2F0W A;  3R93 A;  1DYQ A;  2RDF A;  1D1I A;  1TII D;  4N9P A;  4RWS C;  2OF1 A;  2RDH A;  1B44 D;  1SNC A;  1U9R A;  1WVL A;  1SNP A;  4U67 3;  2SNS A;  3TSS A;  2NTS A;  5K36 G;  1R4P B;  3N6R A;  2KVM A;  3GTL B;  4X3S A;  1F2L A;  1WD1 A;  4CJ1 B;  1O7Y A;  2RA4 A;  4E6I A;  3W2D A;  3BZD B;  1MBY A;  1R9T B;  5DEH A;  5M5X B;  3VYR A;  2FJ2 A;  3I72 A;  1O78 A;  1EFI D;  3KK7 A;  2F0S A;  4ULL A;  1XXG A;  3H91 A;  3NQT A;  4IUR A;  5J1Z A;  1STG A;  2KED A;  4BS9 A;  5C0X J;  3S16 B;  4DAV A;  1H9S A;  1Q3L A;  2WB1 B;  3DMU A;  3HRZ C;  2L9H A;  2K04 A;  2SDF A;  2N88 A;  3K7A B;  5EPL A;  3MTS A;  1KDB A;  1SND A;  4F8M A;  4KHV A;  5ISR A;  3R8B A;  3TP5 A;  3A55 A;  2EOT A;  4QIW B;  2B2U A;  3BVM A;  5KIX A;  1DOK A;  4MHE A;  4RGT A;  5IGD A;  1KLG D;  2EVB A;  3QWN A;  1AZP A;  1JCK B;  3I4M B;  2ENB A;  2BA0 A;  1PTO F;  3OOC A;  4L8J A;  1G2T A;  1FNW A;  3M3Y B;  1IKL A;  1X32 A;  3VR3 A;  1L0Y B;  3WDN A;  2BE5 C;  1SYB A;  3C46 A;  4L6T B;  5FOB B;  2BCO A;  2QIL A;  1QJO A;  3K5O A;  4DNR B;  3S1R B;  2ZXR A;  5BN5 A;  3AU7 A;  3ITP A;  4H44 C;  4C3I G;  2MGS A;  2JEB I;  2L12 A;  5KNB A;  1DOL A;  4ZKB B;  3BYY B;  5A2Q L;  2KEC A;  5C3E B;  1OXS C;  1D2B A;  3D8G A;  4J8Q A;  1D5M C;  2A74 C;  2DY8 A;  5LL6 X;  4G57 A;  4K14 A;  1F9R A;  2H1E A;  2O4X A;  3NUC A;  1RHP A;  2EYL A;  3DHQ A;  3P1H A;  3I90 A;  5KNC A;  5ELF A;  5M3M B;  3S2H B;  1SYC A;  5AFW A;  4HN7 A;  1SYF A;  2CW0 C;  1B53 A;  3OHX C;  2ZXO A;  3NE5 B;  1KNE A;  3I3C A;  3GTM B;  1DXM A;  1WTX A;  4PV1 C;  1U4M A;  3QOJ A;  2JE6 I;  1ESR A;  2A68 C;  4ZUI A;  3A54 A;  1TWG B;  2R7Z B;  1ILP A;  3QG1 A;  2B2Y A;  1GUO A;  2Z4H A;  3PIP 3;  4K8J A;  1D5X C;  5EGT A;  1DCZ A;  2NZ1 D;  1HUN A;  1BCP C;  2G9D A;  4R8I A;  1LT3 D;  1SNM A;  4J6H A;  5KGU A;  3DWQ A;  2MPM A;  2WAC A;  3MFG A;  1UNS A;  4C3H B;  1TWA B;  2KQ3 A;  1EZ8 A;  3MAQ A;  2JYO A;  2X6G A;  1STA A;  1XWE A;  3GTG B;  2XN9 C;  1ZXT A;  5G3L D;  3CRK C;  3URY A;  3OMC A;  1HTL D;  2K05 A;  1QIL A;  3T51 B;  1EYC A;  1HFG A;  1STN A;  2B8G A;  4A93 B;  3GV3 A;  2IWH A;  2L11 A;  2F0D A;  3LWU A;  2EY1 A;  2VUM B;  4WJW A;  4QB4 A;  4HR7 B;  1WTR A;  3QO2 A;  1MGS A;  2EY2 A;  3Q22 A;  4XTC S;  2HDM A;  1W6K A;  1H9R A;  1IYV A;  1F2Z A;  1IW7 D;  4GZY C;  3Q24 A;  1YNJ D;  4HED A;  3FEW X;  1Y8N B;  3TP8 A;  1VF7 A;  4RFB A;  1PZJ D;  3SK6 A;  4BBR B;  1I6H B;  1IYU A;  4NKL A;  3SK8 A;  1HQR D;  4KHZ A;  4RCO A;  5C0X G;  1YNN C;  1U4L A;  3HOU B;  1G91 A;  3HOW B;  3G7L A;  4HSV A;  1F9P A;  3PUZ A;  4RHS A;  2F0V A;  2IX3 A;  3UI2 A;  4KY5 A;  1EY4 A;  2B2V C;  4NP5 A;  4DK0 A;  3VR6 A;  3EA6 A;  4C2M B;  2BDO A;  2F0N A;  2F0T A;  3I4L A;  2Q8I B;  2CVR A;  5JVH 3;  2F0M A;  2F0F A;  1KNA A;  2NUC A;  3V05 A;  1KAA A;  3MZ5 A;  1SNO A;  1EY8 A;  1PRT F;  4QMG A;  3LWE A;  3T56 B;  1C8C A;  3HOY B;  1S5B D;  1QB5 D;  2CHB D;  1Q12 A;  4C1N I;  1S5F D;  1SMY D;  3K58 A;  1CM9 A;  1QG7 A;  3IAY A;  3GV6 A;  2J7Z A;  1BF4 A;  1JE4 A;  1ICW A;  5KYL A;  3IFT A;  4L63 B;  2XWB B;  1UEA B;  1ZYR D;  3DM1 A;  4B9W A;  3J80 L;  3E5S A;  4FF1 A;  1CQV A;  1J9O A;  1PZI D;  3GQB A;  2AWN A;  3SXH A;  2A5H A;  3U9S A;  4O42 A;  5LHY 1;  5EPJ A;  1B2T A;  3H6M A;  2K7V A;  3L7Z C;  4KY7 A;  3TP6 A;  1XYI A;  4XQQ A;  2EXZ A;  4KMU C;  2D62 A;  3P75 A;  5FKA C;  5A2Q E;  4LAA A;  2HCC A;  1TWC B;  2FMM A;  4I65 A;  4IN3 A;  1H9M A;  5T1I A;  1GUG A;  1E0B A;  3ZYY X;  3D31 A;  3NPP A;  5IGC A;  1CK1 A;  4BA1 I;  4ZUJ A;  3CHB D;  4ZYS A;  1F77 A;  1A2U A;  4FXG C;  4CJ2 C;  2PZT A;  4WRD A;  1EY0 A;  2QKI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...