1LT6D

Heat-labile enterotoxin b-pentamer complexed with metanitrophenylgalactoside
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN
publication title Structural foundation for the design of receptor antagonists targeting Escherichia coli heat-labile enterotoxin.
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P
ec nomenclature
pdb deposition date 1997-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lt6D00
3BVGA 2CHBD 2G9HD 1BCPD 1CQVA 3BZDB 5I4DA 4L63B 1PTOD 2IPKD 2QILA 2WV6D 5ELEA 1UUPA 2NTSA 3TSSA 1BCPC 4ZYSA 1KLGD 4RHSA 1LTRD 1PZKD 1M4VA 2XRSD 1PTOC 1FNWA 1I4RA 1JCKB 1TS4A 1PTOH 2XNAC 1RD9D 1LTSD 1XTCD 2AQ2B 2QEJC 1SXTA 3BYTB 1JWMD 4RFBA 1PZJD 2SEBD 5TSSA 1S5ED 4UDUC 3R2IA 1I4HA 2J4XA 3MFGA 4RCOA 2Z8LA 1PYWD 4RHRA 1ESFA 1LLRD 1BCPF 3KLSX 1MD2D 5ELDA 1CHQD 1PTOB 2RDHA 1SE3A 1XXGA 1SEBD 1LTTD 1FNUA 1PTOF 3V05A 1TS5A 1I4GA 3OWEB 2AQ3B 1HTLD 4RGNA 4BWGB 4DXFA 1LT6D 1ET9A 2NTTA 1SJHD 1PZID 1V1PA 3BVZA 1S5BD 1KTKA 1UNSA 3EA6A 1HQRD 1L0XB 1BXTA 1TY2A 3O13A 3DWQA 1EFID 1PRTD 3BYYB 3CHBD 1T5XD 4L6TB 1RF2D 4RH6A 3R8BA 5D3IB 1DYQA 4O1NA 1RDPD 1TY0A 1I4XA 3DWPA 1HA5A 1CT1D 1L0YB 3SEBA 1CHPD 1GOZA 1V1OA 1BCPB 5FK9C 1EEFD 1LT4D 1AW7A 3W2DA 1SBBB 5ELBA 1D5MC 1FGBD 1STEA 3R2TA 2XN9C 1LO5D 1DJRD 1ENFA 1S5CD 1B1ZA 2XRQD 3BVMA 1QILA 1JR0D 1ET6A 1LTGD 3DWAA 3MC0B 1FNVA 2TSSA 4DXGA 1SE4A 5ELFA 1EWCA 1JQYD 1TS3A 2AQ1B 1LTBD 1AN8A 1PRTF 1LTID 1D6EC 4RGMA 3GP7A 1F77A 1B44D 1LT3D 1FD7D 1S5FD 2O2LD 3URYA 4OHJA 2IJ0A 1LT5D 1LTAD 4K6LA 4C56C 1V1PB 1PRTC 1RCVD 1EEID 1S5DD 1SE2A 1I4QA 1EU3A 1G8ZD 4RGTA 1KLUD 1TS2A 1I4PA 1JWSD 4Z9CB 1JWUD 5D3DA 2ICIA 5ELCA 3EFXD 1HXYD 4RGOS 5FKAC 1EU4A 2R61A 1SJED 1D5ZC 4TSSA 1PRTB 1CK1A 2RDGA 1D5XC
chains in the Genus database with same CATH superfamily
1FL0A 2CWAA 4PG3A 3GQBA 1VMPA 1VQNA 3CCRA 2D0PA 1HPCA 3AYHB 4O2DA 4PMBA 2EYPA 1TU2B 2KUMA 2LS01 2MFIA 2NZ1D 3PO2G 4JI8Q 1EZ8A 2L0CA 1VQIA 1XJVA 3HOZG 4ZYSA 5KEEA 2FMMA 5C4XG 1VQKA 1G2TA 5LHY1 4JV5L 4HJ8A 3E5SA 1JWMD 2WAQB 5LMNL 1LTLA 5IYBG 2F4VL 1I4HA 1R4PB 4DR5L 4RCOA 2O5JC 1WTXA 2Z4HA 2VQEL 2CH4W 3PO3G 2AMCB 1CSPA 1EQQA 1YEZA 1SEBD 1FNUA 2BOSA 2HDLA 3GTOH 1ICWA 5LMNQ 1P16A 2EVBA 2F4VQ 4CDCC 1XTDA 4DR5Q 1PH4A 3HGBA 2VQEQ 5IGCA 1L0XB 4GZYC 1YNJC 4O1NA 1TY0A 3GTOB 2F0KA 3DWPA 3ULJA 2ZM6L 4KY6A 2BDOA 3TS0A 1HFNA 3KDFA 3UDXA 3Q22A 1H95A 5IGGA 5C44G 4OO1H 2KQ3A 4K8IA 3BG3A 1ASZA 1KAWA 3PUYA 3R3OA 3QJYA 4I7ZC 4CKCA 2EE1A 1DJRD 1ONLA 2ZM6Q 3QOJA 5EBCA 4BS9A 1Q86C 1A3VA 1ET6A 3QWNA 3SGIA 1WI5A 2F0TA 5T1GA 3NHHA 3P7JA 4RGMA 1YITA 4QIWB 2B2TC 4TVAB 3W1BA 3CCQA 4OHJA 3K5LA 1TR5A 2SNMA 2GVAA 1G2SA 1MBYA 3UI2A 4J6HA 3U4ZA 2MGSA 1A62A 1SE2A 2NVYH 3NQIA 3AFPA 2F3WA 5CMDA 2IT1A 3HOWH 4LF9L 1JICA 4RGOS 4ZCKA 1IYUA 1E1OA 3BS1A 1PH1A 2JA7H 2NVYB 2BE5C 1M1KC 4HMIA 1BKBA 3JAME 2ZXPA 5JPMC 2H1EA 4XT3B 3RD4A 3HOWB 2UXCL 4LF9Q 2VS1A 1B9MA 4XQJA 2JA7B 3TSSA 3MHBA 4A93H 1YHAA 3T51B 2HHHL 1F9QA 1KC8C 4DV5L 2UXCQ 5EKLA 4DAVA 4ZKBB 1LTSD 1VQ7A 1QVFA 3VYTA 3CQZH 1ICFB 4PNYA 4A93B 3GDEA 1QWYA 2HHHQ 2B2UC 2ES2A 2EQSA 1QVGA 4DV5Q 3J80c 4R8IA 2DNCA 1AE3A 1XMOQ 4LJZC 2QA4A 3NTKA 1RHPA 4M8AA 1LTTD 5EGTA 3CQZB 1Y1VG 4KY7A 2HDMA 3RLFA 1PFMA 1XYIA 4X3SA 4BWGB 2UXBQ 1ET9A 5I9PA 4K5XA 1SJHD 4WORA 1PA6A 4DGZA 4LF6L 2JA5H 3R8BA 4A3LG 3S1QH 5IE8A 1VS0A 2N8NA 1B2TA 4X3KA 2RDFA 1TWFH 4CJ0B 1EEFD 1PV4A 3J7YW 1EYCA 4LF6Q 2F0NA 4XXEA 1ENAA 2JA5B 4NKLA 2MNAA 4A3IH 3U58A 2K6AA 1CSQA 4WJ3M 3MEFA 1LTGD 1TWFB 3SDZA 4DXGA 5ELFA 1C0AA 4I7AA 2K7VA 3WDNA 2A19A 4A3IB 2M9VA 3I55A 4LUOA 1EYAA 4HJ5A 2G9DA 2BA0A 4JI0L 4EVOA 1CKNB 2SNSA 1M90C 3DMUA 2C5CA 3E0JA 4FF2A 2BE5D 4K6DA 3KJOA 5FLXL 1AZPA 3HOXG 4KKSA 4JI0Q 1EY8A 2IHEA 2HQEA 5E4XA 1HZCA 4AYBB 2JE6I 2G9HD 1NY4A 2JSOA 2ZJPA 5K36G 3DLLA 4ME3A 1QZGA 2K5DA 3H6MA 1KHIA 1R9TH 3HOUH 2RVLA 3FP9A 3PIP3 2JP1A 4P73A 3I90A 1K8AC 1FJGL 1OO9B 4OEMB 5CV6A 5KIXA 4DR2L 1GUNA 2AUJD 4DN4M 4QL5A 1D2BA 1R9TB 3HOUB 4OELB 4IURA 4DF7A 1AH9A 2R92B 3F8TA 3TMEA 4C3JG 4RKBA 1ENCA 1RL2A 1FJGQ 2B2YA 4OL7A 1Z9FA 4RAUC 5J3BA 1MKHA 1PYWD 5IP7G 1ESFA 1UE6A 5CBEE 4LNQA 1HR0L 5GADC 1TS5A 1DD2A 4FXGC 1EL0A 3BDOA 2ZXOA 1TVXA 3PMFA 3S2HH 1KTKA 5IWAL 2J7ZA 1CKNA 1JE4A 2SDFA 1JOOA 4F87A 2RSNA 2E2JH 2WIIB 4C3IG 2I5MX 1VQGA 1B53A 5C5MA 4A3BG 4DV7L 2F3IA 4WJWA 5IWAQ 4DNTB 4ALPA 4FF3A 2JA6H 3S2HB 3J81E 1JB3A 1Y8NB 3W2DA 1LACA 4IFDG 4BY7H 2E2JB 4K14A 1B1ZA 2LXKA 2OQ0A 1HNXL 2HCIA 3UE0A 4F7XA 2JA6B 1I3QH 3E0EA 2E5LL 1JQYD 2RHSB 3KLSA 4BY7B 3CP0A 2AWNA 3GP7A 3CCLA 1LT3D 2MO0A 3KBXA 1HNXQ 4K6LA 2D62A 2E5LQ 1BR9A 1PRTC 3U4VA 3CU7A 4JI1Q 3KJPA 3UE1A 5LMUL 1K0SA 1Y14B 4DA2A 2H4OA 3IFDA 3I2ZA 1NNXA 3A54A 2FHTA 2VB3X 2EJFC 1I4PA 2VQFL 3MVVA 1IBKL 5EPJA 1Y1WG 3HKZG 4IN3A 1K3BC 2EYLA 3PIO3 1SR3A 5LMUQ 1XX8A 1ZYRD 2HCCA 1QG7A 5CV7A 4POGA 3C1FA 4FYDA 4GLAC 4TKOB 1Y8OB 2VQFQ 4X3TA 1IBKQ 2EYOA 3ICEA 2WV6D 3CRKC 5ELEA 3D4RA 5H1SE 3H3VI 3NENA 1GHJA 2A69C 3FEWX 3K59A 3I7FA 2JA9A 3OHXC 4X62L 2PI2A 4JI5L 1EZ6A 2AWOA 2KCNA 1JCKB 4B9WA 1JJ2A 3CCEA 4RG1A 4FDBA 2QEJC 1XNRL 1C9OA 1L1OC 2C35B 3IRBA 2EIFA 5A2QL 1E0BA 4X62Q 4JI5Q 1D1KA 3KLSX 1K83H 1F2YA 1XNRQ 3BJUA 4B9XA 3OWEB 2DJGC 2QDLA 5HURA 4WJ4A 1Q1EA 3IFTA 3EROA 5JVH3 2F3VA 1RF2D 1K83B 4IUVA 1A2TA 4JBKA 1JOKA 2PMZE 3SEBA 2WKDA 3STBC 3FKIH 3K57A 4LF5Q 3SXHA 1BCPB 4KHZA 1NTGA 4HEDA 4JBMA 3AB9A 5JEAJ 1IKMA 4JI7Q 3PUZA 4DU9A 4GNXC 4HR7B 4JI6L 3FKIB 1KABA 2NN6H 2F0SA 5IOCA 1UE1A 4IUTA 4LUVA 1BQQT 3EJIA 2RCNA 4DR7L 5C3EH 1O7LA 3S1RH 3TP7A 1S5FD 1ESRA 3OPOA 1EWIA 4DUYL 1MHWC 2KJXA 4JI6Q 2L11A 1Q46A 1V1PB 3GTMH 3HFZB 3TEHB 5C3EB 3CC7A 4KD4A 3FRPB 5IYCH 3S1RB 4LFCL 4KHPL 3SK5A 4GKKL 2K75A 3GTMB 2R93H 4LF7L 1PH9A 3EN2A 1CZGA 4IOCA 2JA8H 1K9MC 2PYKA 1D5XC 2KOLA 2A69D 4CJ1B 4LFCQ 1HNZQ 2NVXH 4DKAC 2PNRC 4C3HH 3GO5A 5T1IA 4DK6C 3OWFA 4GKKQ 2JEBI 2R93B 4LF7Q 3AMUA 1X54A 3D0FA 4ZRZA 2JA8B 3A8JE 1IZ6A 1MI2A 1UE5A 1SYFA 4B3ML 4QJFA 5IP9G 3ULPA 2NVXB 2DNEA 2NVQH 3ZJYC 4C3HB 2B39A 2LSSA 3RLNA 2AHOB 2M2LA 4GOPC 2K14A 4JYAL 4B3MQ 1MSGA 2NVQB 1EOVA 3MFGA 3PIPA 2OEOA 2N49A 2F0HA 1XWEA 4JI3L 4J1MA 3UDGA 2XWJB 2RQXA 4JYAQ 1EY0A 2DUDA 1K3RA 2X69A 4R4OA 4KKUA 3H09A 2NTTA 3STBD 4YWMA 4L5RC 4IOAA 1V1PA 4P75A 3S1MH 3O13A 5M5XH 1YHQA 2ZJRA 4JI3Q 4V0BA 4DV0L 4L6TB 5FOBB 4MTNA 3AFQA 2QKIC 2WAQG 4G7OC 5FJ8G 2R6GA 3D3RA 4XDXA 2F0WA 2R3ZA 1YJWA 2BH8A 1NMFA 5ISRA 2B2TA 2K4KA 2YV5A 4LWCA 3S1MB 3SVMA 1MJEA 5M5XB 4IJHA 4YWKA 4DV0Q 1SBBB 4ABNA 5DM63 3DM1A 2XN9C 1LYLA 2PZTA 3T1YQ 3CPWA 2XVSA 2LKVA 4MIUA 1NAPA 2I46A 1K0RA 1QILA 4KN4C 4IALA 5CBAE 5E3FA 2NZHA 3I91A 3QIAA 3OIPA 5BN4A 4U68A 3V2TA 1D7QA 1WVLA 1BF4A 4B08A 1WCMH 3HEJA 1ZKOA 2PPBC 3I72A 2HQLA 4Q5VA 4G7HC 1L2FA 1ILQA 2KCCA 5D65A 1E3PA 1U4RA 1Y69U 1BDOA 5FLXc 1WD0A 1QVCA 4KV6A 1WCMB 2D2CC 3AQQA 3W5OA 2OT2A 2X6LA 1IL2A 1U4LA 2G5DA 1JWUD 4PMCA 4LW1A 2B3GA 4KTAA 4OO1G 3PGZA 1SJED 3M7NA 1SMYD 4PQXA 1CK1A 2B2VC 1S5CD 3S17H 4IUQA 2IX1A 1IBML 2B2UA 3MXNB 3GD7A 3A0JA 1C48A 3NXWA 2WB1B 4FF4A 2ZTEA 1QUQB 4FXDA 3S17B 1KAAA 5IIFA 1TWCH 3PIOA 5FLXE 2RF4A 1IBMQ 1YZ6A 4ID6A 1GUTA 2IW3A 3EVQA 4NXNL 2RA4A 1BBUA 3NBHB 4RCNA 5JPNC 1KNEA 2O4XA 4MN3A 1TWCB 1JE5A 4KK7A 3S2DH 1LLRD 2F0EA 1CHQD 4NXNQ 1O7YA 5M5YH 3C3LA 2JA7G 3SK8A 1CTMA 4HSPA 5KRUA 4DV3Q 3K8AA 4GLXA 3S2DB 3NELA 2EOTA 1HQRD 2F0DA 3J7AV 1PLFA 2AKWB 5M5YB 4A93G 3OW7A 4IPGA 4YCWA 3K7UC 3NQTA 1PFSA 1NJIC 1QJOA 1BBXC 4DV2Q 2X6GA 4A3JH 3RR5A 4QGUA 1I94L 3CCSA 1AFPA 2XGTA 4P2CB 1PYSB 5C5LA 4A4IA 4A76A 3MXNA 3I4NG 3S14H 1DXMA 2BDNA 1S4ZA 4A3JB 4CDFC 3P20A 1I94Q 2F0MA 1QUQA 1YBYA 4GN4B 4K2LA 1B44D 1JJCB 4JVZA 1BUVT 2Z6BA 2HIXA 2IJ0A 2Q8IB 1I6HH 3S14B 4JPBW 2ALYB 4IJLA 1G6ZA 2MUYA 2JA5G 1Z7TA 2L55A 2F1MA 1F2MA 3PF4A 3NBHA 2D5DA 4HSVA 4MTKA 1SRUA 1PH7A 2L5TA 4UP8A 4K8JA 3PQIA 1E7ZA 4DK0A 4RGTA 3C1EA 4R1JA 1U9RA 5DNFA 1A15A 1SAPA 4POFA 1EU4A 4ZK9B 4A3IG 1DONA 1D5ZC 1PRTB 5BR8L 2R7ZH 3HKZE 1F9SA 3OIQA 3QOLA 3JAMc 2QDBA 3HOVH 2RSOA 2K5HA 3Q23A 3LWUA 1X56A 5BR8Q 3F2DA 2R7ZB 3J81j 4Y7NH 2P5ZX 1KLGD 1SYGA 2PW5A 1PDQA 1PTOC 1PMRA 1X55A 2E2IH 3HOVB 5KNCA 1FVIA 1TS4A 1WD1A 1VQ9A 1CUKA 3A7AB 4AYBG 2C9OA 2B63H 4Y7NB 3T16A 1XNQL 5HGTA 4LUZA 1WTWA 1F2ZA 3T1HL 2E2IB 2EXDA 1P8LA 3OSOA 5ELDA 3GV6A 1Q7YC 2YYZA 1EQVA 4DNRB 1L1OB 1HUMA 2E8GA 2L12A 1XNQQ 4KLKA 2D0OA 1PH3A 3T1HQ 2EYJA 3MFYA 2DY8A 3LWEA 1S3OA 3HOUG 4N9PA 4L5TA 3M3YH 2MQHA 1XMOL 4KI0A 2R92G 2UU9L 3EQLC 3PO2H 4JI2Q 3CCUA 1I4XA 2E2HH 1HFGA 1L0YB 4LFBL 5A2QE 2UXBL 4JCVE 5E4WC 2NWGA 5ELOA 3MWYW 1H9SB 3M3YB 3R2TA 3M7GA 2UU9Q 3PO2B 1KL9A 2E2HB 3VYSA 1LUZA 1S72A 4LFBQ 3KLWA 2V4DA 2Q8TA 5FO7B 1F9PA 1DOKA 1Q1BA 1X3QA 4X66Q 5C0XH 2A68C 1MGSA 4IPCA 2Z4IA 1AN8A 1NUCA 4OWWB 4BXXH 1QOHA 2K04A 2CWPA 4BY1H 4QCLA 2TMPA 2XWBB 4HCSA 1VQOA 5FLMG 4BA2I 2MPMA 5NUCA 2VUMH 2KENA 1C4QA 1B4OA 3EIVA 1SROA 3S1QB 5IT9L 3PSIA 2KHSA 4CJ2C 4BY1B 2I5LX 1X3GA 1ZXTA 2A73B 2JA6G 1IL8A 4DAPA 1IBLL 4EX5A 2VUMB 2FFKB 5GAEC 4X6AH 2ZXRA 3H3VC 5LL6S 5M3MH 2KCTA 1Q81C 5ELNA 1PTOD 4JBWA 1IBLQ 4XYQA 3H0GH 4JOIA 4DFAA 1JT8A 1IYVA 2Q8RE 3NK9A 2O5IC 5M3MB 4QY7A 1H9SA 1VQEA 4UP7A 5M3FG 4ZAIA 3WOEA 1XTCD 2AQ2B 3H0GB 2J0TD 1Q8KA 2BA1A 1JORA 1S5ED 4KHVA 5JEAH 3R2IA 4G7ZC 2A6ED 1PH8A 4YY3Q 4IFDI 1I4GA 1OXTA 4GOPB 4KJOA 1ZYRC 4RGNA 4DXFA 1Q82C 3TRZA 1TWGH 4N8FA 5M5WH 3VR5A 1BXTA 4BBSH 2XTIA 3CHBD 3J80i 3U9SA 5KNDA 4RH6A 4K5VA 1SFOH 2WAQE 1K8GA 1GKHA 1VQBA 1TWGB 5M5WB 3H91A 2LXJA 1KRSA 2V1CC 2B2WC 4RKLA 5FK9C 2UUCL 4C2MH 3J81c 2MP1A 2K28A 4BBSB 4UPAA 2A68D 2YTVA 1VQ4A 2CVRA 1SFOB 1H9MA 1CFMA 1ENFA 4GLVB 3NBIA 3HS0C 3DWAA 1FNVA 2TSSA 4C2MB 1NR4A 3WOFA 2OTLA 2UUCQ 1V9PA 4YIJA 1F9RA 3K5NA 4TRDA 5JJKA 1EOTA 1E22A 1SN8A 4AQYL 3PUVA 5GROA 4A3KH 5CV8A 2PQEA 1IXRA 1BBWA 4C56C 2HUGA 4A3DH 4A3LH 2F4IA 2MO1A 3W1GA 2F0PA 3K0XA 1KNAA 2DY7A 3NP8A 4AQYQ 4DUZQ 3FKIG 3M85A 4A3KB 2I07B 4KN7C 3I70A 4MZ9A 5IGEA 3OW2A 1HXYD 4QMGA 4A3DB 4LMQD 4DR3L 2BH2A 4JI1L 4GOPA 5CYUA 5C4HA 4IUNA 2R7FA 3FPUB 2JJQA 2NN6G 4QIWE 4NDXA 3DUZA 3BZDB 1MIUA 4TQUS 1EY5A 4S3SA 1I3QB 2Z9HA 3K58A 1PFBA 4O42A 4DR3Q 5C3EG 2JYOA 2DJFC 1UUPA 2FMCA 1YJNA 2K52A 1VQ8A 4RHSA 4K0KL 2A6HD 5C6AA 1PZKD 2D9UA 4OX9L 2XRSD 1QNKA 2K32A 3K0YA 1U4PA 3CPFA 1FYCA 1GUOA 3A5UA 1DCZA 4RFBA 5IYCG 3NTHA 2A8VA 4K0KQ 1HJPA 3R93A 1N8RC 4OX9Q 3D4DA 3I3CA 3HOXH 2R93G 5C0XJ 3G6EA 1X3FA 3I56A 1OTCA 2JA8G 2Z6KC 1OXVA 1RTOA 2Y0SG 1PTOF 2UUBL 1C7YA 4DR6L 1XPOA 3G4SA 4MHEA 4XQNA 1PH2A 2HIVA 1E1TA 4C3HG 1KIXA 1S5BD 3HOXB 1JC7A 1UAPA 1HQMC 2BCOA 5D3IB 1DYQA 2UUBQ 4FVMA 3VR4A 4DR6Q 1EFWA 2EYFA 4GKJQ 2QEXA 3RLOA 4I65A 3VR2A 4APVA 1D5MC 1STEA 1NSNS 1A8VA 4FO2A 4RMFA 4UHVA 4ME5A 4R4CA 4IZ8A 4X3UA 3HP3A 4LF5L 1A2UA 1A63A 4YHHL 1W6JA 1EWCA 1STAA 1STGA 1GUGA 1N33L 1II3A 1BNZA 1S40A 1HNWL 5C3XA 5IGFA 1D8LA 4JI7L 1FGUA 2KA7A 2IX0A 3VR6A 2ENBA 3G7LA 3QR8A 2K1BA 1STHA 3OOCA 3Q0AA 2K5QA 2KCMA 3NUCA 4YHHQ 4A3MH 1EEID 1N33Q 1HRJA 4CBVA 1HNWQ 4KMUC 2KHIA 1EU3A 1J8IA 5JOBA 4EQPA 3F2CA 3A8KE 3E9IA 4XQQA 1QCBD 4A3MB 1NMGA 1Q8IA 2RDGA 5KNBA 5IGBA 2CHBD 3K6OA 3WWVA 3ER0A 3J80L 1VQCA 1VMCA 2MJ8A 4OONA 3B6YA 2F03A 1KDAA 1YJ9A 3ONAB 5K5PA 1WCMG 3L0OA 1HNZL 5COYA 2UXDQ 4LK1C 1X3PA 3TREA 4R9WA 1PTOH 1EQRA 3BYTB 5TSSA 2ID0A 2L1BA 2NBFA 1QE6A 4UDUC 4AYBE 1QZHA 4K2KA 4NMZA 2Z8LA 1EIFA 2CFMA 1PTOB 3H94A 1Y1WH 5J22A 1SE3A 2WB1G 4DV4Q 3CCVA 1SMYC 1B3AA 1Z47A 4XTCS 1HTLD 2PZWA 4JI4L 1RJTA 1VQDA 1OXSC 3A55A 1TY2A 3GTPH 3AEVA 1Y1WB 1VDZA 3HKZB 1F2LA 2F0QA 3I73A 5DAUA 4WRDA 5G3LD 1CT1D 1X9NA 3Q8DA 4HN7A 3RMHA 4DK3C 1N36L 4JI4Q 2VZAA 2DN8A 2MHVA 1E2ZA 1GOZA 1GXDC 1J5EL 4X65L 4XIGS 4YCVA 5AJ3L 3KUPA 2PW7A 3GTPB 4NW2A 4H13C 2CW0C 5J39A 2B29A 3BVMA 1SLJA 1N36Q 2QF7A 2E2DC 4DAYB 1J5EQ 4OO1I 4X65Q 3RNUA 5AJ3Q 3I4MH 1W6KA 1HZBA 1K8OA 1TS3A 1VQ5A 3D31A 1CKOA 4QQBX 4HJAA 3T1YL 4H7BA 2K5VA 1KQSA 3DEPA 1H9KA 1WYDA 2PI2E 3I4MB 1Q12A 1VQMA 5EBDA 2PCFB 4HJ7A 2Q2UA 3MTSA 5C4JH 4QF4A 1KDBA 3GTKH 2KBNA 2GVBA 4Z9CB 3VYUA 4A3JG 5ELCA 2OQKA 5FKAC 1K8MA 1SMXA 1PVOA 4A3GH 2CQAA 2I5HA 3DXJC 3CC4A 3H3VH 1EY9A 3T56B 3GTKB 3AU7A 2H5XA 4IUUA 3QG1A 1HZ9A 1CZWA 3DEOA 1EY6A 1MJCA 2KEDA 4A3GB 1XMQQ 1B70B 2K5NA 5IT9E 3TP8A 4FF1A 1SNQA 5I9OA 5E7NA 1M4VA 3TDQA 3MA2B 4A3FH 1C8CA 3X3NA 4CKBA 1PZJD 2A5HA 1RODA 3VDYA 3DM3A 5A35A 1GUSA 1VQ6A 1JJGA 4DAYA 1Y8PB 4BBRH 4DK1A 2L9HA 3MAQA 1GO3E 4RHRA 1WTRA 3OMCA 3T4AC 4ZKCB 3K81C 4A3FB 3CMEA 2RDHA 5D14A 3CCMA 4EQOA 2R7ZG 3A56A 1B3QA 3HOVG 2R7DA 4BBRB 5GAGC 1UNSA 4U673 1AZQA 2NB0A 1DOMA 3VA5A 4DV1L 4JW0A 1YNNC 3ND8A 4OWXB 5C4ZA 2CW0D 4C1NK 1VCIA 3TQYA 3NWTA 4DV3L 4QB4A 2F0FA 1AEXA 3HOWG 1NBWA 4DV1Q 1H9JA 1RKNA 1FGBD 4IFDJ 2EYHA 2EJMA 4R4IA 4HTHA 2ZT9C 1Z6HA 1DZ1A 1V1QA 1KDCA 5IYDH 4FNFA 4DV2L 1GHKA 1PXUA 3Q6SA 1WTOA 3GTGH 3T13A 4RA8A 1D6EC 2O2LD 3URYA 3IAYA 5G3LF 2JN4A 1IYJB 2SOBA 2KHJA 3NE5B 3MXUA 3PUXA 3GTGB 4H0LC 1S5DD 4A3CH 2L4NA 5FJ8H 4ZLTF 4KKTA 1MSHA 2VW9A 3HZXA 1TKWB 1JWSD 3QO2A 1LM0A 3SE0A 4GN3B 1GUWA 3J7A5 2PNHA 5GAHC 2B8FA 5BN3A 3BVGA 4R4QA 1X3EA 3K5OA 5C0XG 4HIDA 4JV5Q 5E1FA 5JJZA 2N55A 4BXXG 4BY1G 1BCPC 2E76C 1EY4A 3NSWA 3HOYH 1O78A 2I0QA 1I6HB 3PCOB 2VUMG 2DGYA 3D6WA 4DNIA 5JVG3 1WTHA 4HAEA 4A3EH 2F52A 3PF5A 1STYA 4ULLA 3KK7A 3I4LA 3HOYB 1PYBA 1B8AA 2VY3A 2B2WA 1EYGA 1PFNA 1YNND 1BO0A 1TIID 2Y0SE 4A3EB 1G91A 2OTJA 1O7IA 1LT6D 4PZ7A 5M3MG 3SHLA 2ZTCA 2XSCA 3LGJA 4DR1L 3UDIA 3H0GG 2JQOA 1HA5A 3D8GA 4HCEA 1SNCA 1WJJA 1L0WA 4DR1Q 1AW7A 2QGQA 1GM5A 3P1HA 2K5WA 1VQAA 3BU2A 2IWHA 5JEAG 4JI2L 1NE3A 2E75C 4QUCA 1HA6A 5J1ZA 1DOLA 3BDCA 2B63B 5DM73 1JR0D 3LNNA 3RUZA 1I50H 2A6EC 4V190 5JJLA 2EZVA 1T5EA 1V43A 4KY5A 5C3WA 3HKSA 4ZUIA 4BA1I 2EXZA 1LTID 3F1ZA 1D1IA 3OMGA 3HOZH 2Q2TA 3I4OA 2VB2X 5F2DA 4HIMA 5C4XH 1I50B 4BBSG 2N88A 5CV9A 4X66L 3SK4A 4L5SA 4J15A 5IYBH 2CH4A 3VR3A 3P75A 3HOZB 1TS2A 3MXPA 2JEAI 5C4XB 3PO3H 1WTPA 3EFXD 2NVTH 1I5FA 4X64L 4CDDC 2OCEA 2WINB 4IPHA 2F0GA 5LMNW 4M1UB 3NTIA 4MNOA 2OXPA 3V96A 1BCPD 3GTQH 1GJXA 1E24A 3I4NH 4L8JA 3N6RA 4GNXB 3PO3B 2IPKD 1YNJD 2NVTB 4X64Q 3S24A 2EY1A 1U4MA 2Z6KA 1EYDA 1W3SA 3RN5A 1W2BA 2NTSA 2VXWA 3A7LA 4A3KG 3TS2A 1J9OA 3MZ5A 3GTQB 3I4NB 1EUJA 4IPDA 3S15H 3JAMi 1I4RA 5FO9B 3GTJH 1A6XA 4A3DG 5C44H 1CKMA 2LY7A 3NEMA 3C2PA 2GA4B 3S1NH 4BY7G 2SEBD 2PMZB 1L1OA 2F0VA 3MEHA 2L15A 1AE2A 4KD3A 3S15B 4GS3A 3J80E 2AUKA 4DPGA 1G51A 3GTJB 2IL8A 2CCZA 4WFN3 1V8QA 1Q3LA 5C44B 4NXML 3TZDA 4G57A 5I2YA 3S1NB 1UEBA 3M9BA 2WB1E 2EPBA 1SE8A 2YTYA 1HUNA 3K5MA 1EQTA 4ODGA 5I2XA 1EFID 1SNPA 1T5XD 4NXMQ 4YY3L 2F0UA 1IW7C 2WFWA 4CGYB 1GVPA 5DEHA 1PH6A 2ZJQA 1CHPD 2A6HC 1E2VA 2F0LA 1HCZA 2YTXA 1CA6A 2WACA 3E3XA 3CXCA 1CM9A 1IKLA 3KBGA 3BDLA 4K5WA 2XRQD 2OF1A 4FP5D 4UAIA 4NB3A 1HZAA 4UP9A 4GNXA 1VQFA 2IX3A 4UY8C 4P71A 2NN6I 5KYIA 1UE7A 5LL6X 1SNOA 5CV5A 2KVMA 2R92H 4ZQ3A 1ILPA 1ASYA 1RCVD 1WTVA 4FXKC 1QB5D 3Q24A 2K05A 4PV1C 4EQNA 2FINB 1UEAB 4DAMA 1Y1VH 1YIJA 2F0OA 3E9HA 2KEEA 4DR2Q 2EY5A 1O7ZA 4DUZL 4B3RL 3A74A 3FPPA 2QILA 3A8IE 3ERSX 3G48A 5I6WA 1Y1VB 2Q2IA 2QW7A 5I6YA 2CKZB 1LTRD 4QUFA 5FLMH 4B3RQ 2RHQB 4CHTB 1RD9D 4A3MG 3FHWA 1HR0Q 4DV6L 5IODA 1X65A 1K73C 2FJ2A 4NP5A 1R4QB 2J4XA 1H9RA 1SYCA 2Z1CA 1G6PA 3QB3A 1BCPF 2F0IA 3VA7A 2K01A 2K03A 2VNUD 4F8MA 1NCVA 4DV6Q 2EY2A 1IW7D 4XT1B 4JG2A 2K50A 4DV7Q 5EJWA 3DWQA 4LF8L 4OIKA 5IY0A 2PQAB 1KXLA 2KECA 3IKJA 2K33A 3ERQA 4OWTB 3M4OH 5CC4A 4JK1C 5M3FH 4LF8Q 3E6ZX 3S16H 5HY6A 1B50A 1X32A 1SNDA 1T9HA 3IL8A 1WTQA 1SYDA 3A5ZB 3MC0B 3M4OB 5K36H 1SE4A 4JBJA 4OGQC 2LFNA 5M3FB 4GKJL 3S16B 3TBIB 3J81i 5EQ0A 2RCFA 5M9OA 4LFAL 1F77A 1OXXK 1B9NA 3JAML 1LTAD 4O0AA 5GQOA 5JJIA 2QCPX 4B3TL 1ZEQX 4OIJA 5CV4A 1PHJA 4C3JH 4LFAQ 3UDFA 3HRZC 1I4QA 1U5KA 3M4PA 3J7ZC 3D4WA 5IP7H 5D3DA 1VQPA 4B3TQ 1SDFA 3NWSA 3F2BA 4TSSA 1I6VC 3CW2C 4C3JB 4HJ9A 3BZCA 2B2VA 1CQVA 1E2WA 4IUPA 3I4MG 1K28A 1ML0D 1STNA 2A74C 4JOIC 1SYEA 4L5QA 2EDGA 2PQAA 1HR0W 1KD1C 1A3TA 1JOQA 3X3MA 4PMWA 1YVCA 4R4TA 4C3IH 3FDTA 3CMAA 5EKIA 1KRTA 1RTNA 2HT1A 1EIYB 3J7AF 4A3BH 1CQFA 1VF7A 2XNAC 1Q90A 4PZ6A 2CQOA 4N9TA 1O80A 1SXTA 4IFDH 5KYLA 4C3IB 3RZDH 3ND9A 2E74C 5CGKA 4A3BB 3ITPA 2UXDL 1PH5A 3LX0A 2PO4A 4A3GG 2Z0SA 3S9WA 1XXGA 4NPSA 1AP0A 4IQZA 3V05A 1EWHA 2AQ3B 1LV9A 2IHFA 4HIKA 3RZDB 2F0JA 5CORA 3EA6A 5BN5A 3H15A 1PRTD 3BYYB 1HHVA 1YI2A 3CAMA 1JB7A 3L3OC 1RDPD 2FXQA 3DHQA 4DV4L 2UUAL 3KFUA 2Q2HA 3U50C 2B2YC 3VYRA 1CA5A 4EQ5A 4YCUA 1V1OA 1A3UA 4A3FG 2XIWA 4DR4L 1N32L 1WFQA 2ICEC 4DR7Q 3SR1A 4RWSC 1LO5D 2NYZD 3BZKA 3K80C 2UUAQ 4YWLA 3NPPA 4JC0A 4DUYQ 3K7AH 3CRLC 4BBRG 1IHZA 3KF8B 3KF6B 1QNUA 1N32Q 4DR4Q 2ASBA 1STBA 3PV0A 2AQ1B 5EAYA 3KYHC 4A75A 3K7AB 4KHPQ 2B8GA 4AH6A 3L7ZC 1N9WA 3U9OA 4XYOA 4P74A 1VF5C 4ZUJA 3FMCA 3KLRA 3CC2A 2Y0SB 4R8NA 3N52A 1EIHA 2PZUA 3OTOL 3RN2A 1VQLA 1M8AA 1G291 3F2UA 2ICIA 1VQHA 3CF5A 2R61A 1UWVA 2EYMA 3FVQA 3HG9A 1DM0B 2GN5A 1FR3A 3OTOQ 3W3AA 4HIOA 2ZTDA 3PUWA 5I4DA 4L63B 3OYYA 3TP6A 4F88A 5IYDG 1DGSA 1X6OA 4PZ8A 1JMCA 4Y52H 1OXUA 5IT9c 4J8QA 3SK6A 3TN2A 2HD3A 4ILWA 3EBEA 3L9AX 3RZOH 5HGQA 1FNWA 1WOCA 1LABA 3T53B 5EPKA 4KJNA 4A3CG 4CDEC 1XMQL 3CCJA 1HTPA 5C4JB 2EY6A 2YU9H 3ZYYX 3KF8A 3RZOB 3KF6A 4C1NI 1TWAH 4AIMA 3J81L 1MD2D 2RKSA 5EKKA 2IY5B 1BVSA 1TXYA 4B3SL 2OWOA 4LF4L 4GN5A 3TZUA 2YU9B 4Q0FA 3D6CA 1SSOA 1XPUA 4IO9A 4E6IA 4HMJA 1PZID 1EIGA 3BVZA 2JK8A 3TP5A 1TWAB 2NZOA 1CI3M 1YHBA 1SYBA 5KGUA 4H44C 3CD6A 4B3SQ 4LF4Q 4P72A 5DLQE 3JC66 2ATWA 1BOSA 3GTLH 3HOYG 5JAVA 2WKCA 5CR3A 1VQJA 2NUCA 1LT4D 3M4QA 5ELBA 4H02A 1SNMA 3MXGA 4G4KA 4A3EG 5FO8B 3M4YA 1YNXA 4CKEA 2EJGC 5EPLA 3GTLB 5L37A 1A0IA 3ULLA 3G6JB 3I8ZA 4EGVA 2A1AA 2N78A 2N3SA 1TWHH 1J6QA 2M00A 1LTBD 4LAAA 1PRTF 1U0LA 4N8X1 1N34L 1FD7D 1RIPA 5IP9H 1LT5D 5IGDA 2VL6A 5C0XI 1XPRA 3GV3A 1TT2A 5AFWA 1B7YB 1TWHB 1HH2P 2WP8J 3KOJA 2RBMA 3L2PA 3C46A 2B63G 1N34Q 1EY7A 2LMCB 1G8ZD 1KLUD 3G71A 3KDFB 1TQOA 2JXMB 4OXPA 1NR2A 4JI8L 1GD7A 3CKIB
chains in the Genus database with same CATH topology
3GQBA 1VMPA 1HPCA 4PMBA 2EYPA 1TU2B 2KUMA 2LS01 2NZ1D 1EZ8A 2L0CA 4ZYSA 5KEEA 2FMMA 1G2TA 5LHY1 3E5SA 1JWMD 2WAQB 1I4HA 1R4PB 4RCOA 2O5JC 1WTXA 2Z4HA 1SEBD 1FNUA 2BOSA 2HDLA 1ICWA 2EVBA 3HGBA 5IGCA 1L0XB 4GZYC 1YNJC 4O1NA 1TY0A 3GTOB 2F0KA 3DWPA 4KY6A 2BDOA 1HFNA 3Q22A 5IGGA 4OO1H 2KQ3A 4K8IA 3BG3A 3PUYA 3R3OA 3QJYA 4I7ZC 4CKCA 2EE1A 1DJRD 1ONLA 3QOJA 5EBCA 4BS9A 1A3VA 1ET6A 3QWNA 2F0TA 5T1GA 3NHHA 3P7JA 4RGMA 4QIWB 2B2TC 4OHJA 3K5LA 1TR5A 2SNMA 1G2SA 1MBYA 3UI2A 4J6HA 2MGSA 1SE2A 3NQIA 2F3WA 5CMDA 2IT1A 1JICA 4RGOS 1IYUA 3BS1A 2NVYB 2BE5C 4HMIA 3JAME 2ZXPA 5JPMC 2H1EA 4XT3B 3RD4A 3HOWB 1B9MA 4XQJA 2JA7B 3TSSA 3MHBA 3T51B 1F9QA 5EKLA 4DAVA 4ZKBB 1LTSD 3VYTA 4PNYA 4A93B 1QWYA 2B2UC 4R8IA 2DNCA 4LJZC 3NTKA 1RHPA 4M8AA 1LTTD 5EGTA 3CQZB 4KY7A 2HDMA 3RLFA 1PFMA 1XYIA 4X3SA 4BWGB 1ET9A 5I9PA 4K5XA 1SJHD 4WORA 4DGZA 3R8BA 1B2TA 4X3KA 2RDFA 4CJ0B 1EEFD 3J7YW 1EYCA 2F0NA 4XXEA 1ENAA 2JA5B 4NKLA 2K6AA 1LTGD 1TWFB 3SDZA 4DXGA 5ELFA 2K7VA 3WDNA 4A3IB 2M9VA 1EYAA 2G9DA 2BA0A 4EVOA 2SNSA 3DMUA 2C5CA 3E0JA 4FF2A 2BE5D 4K6DA 5FLXL 1AZPA 4KKSA 1EY8A 2HQEA 5E4XA 4AYBB 2JE6I 2G9HD 2JSOA 5K36G 2K5DA 3H6MA 2RVLA 3PIP3 2JP1A 3I90A 1OO9B 5CV6A 5KIXA 1GUNA 2AUJD 4DN4M 1D2BA 1R9TB 3HOUB 4IURA 4DF7A 2R92B 3TMEA 4C3JG 4RKBA 1ENCA 2B2YA 4OL7A 4RAUC 1PYWD 1ESFA 5CBEE 1TS5A 1DD2A 4FXGC 1EL0A 3BDOA 2ZXOA 1TVXA 3PMFA 1KTKA 2J7ZA 1JE4A 2SDFA 1JOOA 4F87A 2RSNA 2WIIB 4C3IG 1B53A 5C5MA 3S2HB 4WJWA 4DNTB 4FF3A 3J81E 1JB3A 1Y8NB 3W2DA 1LACA 4IFDG 2E2JB 4K14A 1B1ZA 2HCIA 4F7XA 2JA6B 1JQYD 3KLSA 4BY7B 2AWNA 3GP7A 1LT3D 3KBXA 4K6LA 2D62A 1BR9A 1PRTC 3CU7A 4DA2A 2H4OA 3IFDA 3A54A 2FHTA 2VB3X 2EJFC 1I4PA 3MVVA 5EPJA 4IN3A 2EYLA 3PIO3 1XX8A 1ZYRD 2HCCA 1QG7A 5CV7A 3C1FA 4FYDA 4TKOB 1Y8OB 4X3TA 2EYOA 2WV6D 3CRKC 5ELEA 3D4RA 1GHJA 2A69C 3FEWX 3K59A 3OHXC 1EZ6A 2AWOA 2KCNA 1JCKB 4B9WA 2QEJC 5A2QL 1E0BA 1D1KA 3KLSX 1F2YA 4B9XA 3OWEB 5HURA 1Q1EA 3IFTA 3EROA 5JVH3 2F3VA 1RF2D 1K83B 4IUVA 1A2TA 1JOKA 3SEBA 2WKDA 3K57A 3SXHA 1BCPB 4KHZA 4HEDA 3AB9A 5JEAJ 1IKMA 3PUZA 4DU9A 4HR7B 3FKIB 1KABA 2NN6H 2F0SA 5IOCA 4IUTA 1BQQT 3EJIA 1O7LA 3TP7A 1S5FD 1ESRA 3OPOA 2KJXA 2L11A 1V1PB 5C3EB 4KD4A 3FRPB 3S1RB 3SK5A 3GTMB 1CZGA 2PYKA 1D5XC 2KOLA 2A69D 4CJ1B 2PNRC 3GO5A 5T1IA 3OWFA 2JEBI 2R93B 3AMUA 4ZRZA 2JA8B 3A8JE 1MI2A 1SYFA 2NVXB 2DNEA 4C3HB 2B39A 2M2LA 1MSGA 2NVQB 3MFGA 2OEOA 2F0HA 1XWEA 4J1MA 2XWJB 2RQXA 1EY0A 2X69A 4KKUA 3H09A 2NTTA 1V1PA 3O13A 4V0BA 4L6TB 5FOBB 2QKIC 4G7OC 2R6GA 3D3RA 4XDXA 2F0WA 2R3ZA 5ISRA 2B2TA 3S1MB 3SVMA 5M5XB 1SBBB 4ABNA 5DM63 3DM1A 2XN9C 2PZTA 2XVSA 2LKVA 4MIUA 1NAPA 2I46A 1QILA 4KN4C 4IALA 5CBAE 5E3FA 3I91A 3QIAA 3OIPA 5BN4A 4U68A 3V2TA 1WVLA 1BF4A 4B08A 3HEJA 1ZKOA 2PPBC 3I72A 4Q5VA 4G7HC 1ILQA 2KCCA 5D65A 1U4RA 1Y69U 1BDOA 1WD0A 4KV6A 1WCMB 2D2CC 2OT2A 2X6LA 1U4LA 4PMCA 1JWUD 4OO1G 4KTAA 1SJED 3M7NA 1SMYD 4PQXA 1CK1A 2B2VC 1S5CD 4IUQA 2IX1A 2B2UA 3GD7A 1C48A 3NXWA 2WB1B 4FF4A 4FXDA 3S17B 1KAAA 5IIFA 5FLXE 4ID6A 1GUTA 2IW3A 3EVQA 2RA4A 4RCNA 5JPNC 1KNEA 2O4XA 4MN3A 1TWCB 4KK7A 1LLRD 2F0EA 1CHQD 1O7YA 3C3LA 3SK8A 1CTMA 4HSPA 5KRUA 3S2DB 2EOTA 1HQRD 2F0DA 3J7AV 1PLFA 5M5YB 3OW7A 3NQTA 1QJOA 1BBXC 2X6GA 1AFPA 4P2CB 5C5LA 3MXNA 1DXMA 2BDNA 1S4ZA 4A3JB 3P20A 2F0MA 4K2LA 1B44D 1BUVT 2IJ0A 2Q8IB 3S14B 1G6ZA 2MUYA 1Z7TA 2L55A 2F1MA 1F2MA 3NBHA 2D5DA 4HSVA 2L5TA 4K8JA 4DK0A 4RGTA 3C1EA 1U9RA 5DNFA 1A15A 1SAPA 1EU4A 4ZK9B 1DONA 1D5ZC 1PRTB 1F9SA 3OIQA 3QOLA 2QDBA 2RSOA 3Q23A 3LWUA 2R7ZB 1KLGD 1SYGA 2PW5A 1PDQA 1PTOC 1PMRA 3HOVB 5KNCA 1TS4A 1WD1A 3A7AB 2C9OA 4Y7NB 3T16A 5HGTA 1WTWA 1F2ZA 2E2IB 3OSOA 5ELDA 3GV6A 2YYZA 1EQVA 4DNRB 1HUMA 2L12A 2EYJA 3MFYA 2DY8A 3LWEA 4N9PA 4KI0A 3EQLC 1I4XA 1HFGA 1L0YB 5A2QE 5E4WC 2NWGA 3MWYW 1H9SB 3M3YB 3R2TA 3M7GA 3PO2B 2E2HB 3VYSA 2V4DA 2Q8TA 5FO7B 1F9PA 1DOKA 1Q1BA 1X3QA 5C0XH 2A68C 1MGSA 2Z4IA 1AN8A 1NUCA 1QOHA 2K04A 4QCLA 2TMPA 2XWBB 4HCSA 4BA2I 2MPMA 5NUCA 1C4QA 1B4OA 3S1QB 5IT9L 2KHSA 4CJ2C 4BY1B 1ZXTA 2A73B 1IL8A 4DAPA 2VUMB 2FFKB 2ZXRA 3H3VC 5LL6S 1PTOD 4JBWA 4XYQA 4DFAA 1IYVA 2Q8RE 3NK9A 2O5IC 5M3MB 1H9SA 4ZAIA 3WOEA 1XTCD 2AQ2B 3H0GB 2J0TD 1JORA 2BA1A 1S5ED 4KHVA 5JEAH 3R2IA 4G7ZC 2A6ED 4IFDI 1I4GA 1OXTA 4KJOA 1ZYRC 4RGNA 4DXFA 3VR5A 1BXTA 3CHBD 3U9SA 5KNDA 4RH6A 4K5VA 1TWGB 5M5WB 3H91A 2B2WC 4RKLA 5FK9C 2MP1A 2K28A 4BBSB 2A68D 2CVRA 1SFOB 1H9MA 1CFMA 1ENFA 3NBIA 3HS0C 3DWAA 1FNVA 2TSSA 4C2MB 1NR4A 3WOFA 4YIJA 1F9RA 3K5NA 4TRDA 1EOTA 3PUVA 5CV8A 2PQEA 4C56C 2HUGA 2F4IA 2F0PA 1KNAA 2DY7A 3NP8A 3M85A 4A3KB 2I07B 4KN7C 3I70A 5IGEA 1HXYD 4QMGA 4A3DB 4LMQD 5CYUA 5C4HA 4IUNA 3FPUB 2NN6G 4NDXA 3DUZA 3BZDB 4TQUS 1EY5A 4S3SA 1I3QB 3K58A 1PFBA 4O42A 2JYOA 2FMCA 1UUPA 4RHSA 2A6HD 5C6AA 1PZKD 2D9UA 2XRSD 1QNKA 2K32A 3K0YA 1U4PA 1FYCA 1GUOA 1DCZA 4RFBA 3NTHA 3R93A 3D4DA 3I3CA 5C0XJ 1OXVA 1RTOA 1PTOF 4MHEA 4XQNA 4C3HG 1S5BD 3HOXB 1JC7A 1UAPA 1HQMC 2BCOA 5D3IB 1DYQA 4FVMA 3VR4A 2EYFA 4I65A 3VR2A 1D5MC 1STEA 1NSNS 4FO2A 4ME5A 4IZ8A 4X3UA 3HP3A 1A2UA 1W6JA 1EWCA 1STAA 1STGA 1GUGA 1II3A 1BNZA 5C3XA 5IGFA 2KA7A 2IX0A 3VR6A 2ENBA 3G7LA 2K1BA 1STHA 3OOCA 3Q0AA 2K5QA 3NUCA 1EEID 1HRJA 4CBVA 4KMUC 1EU3A 1J8IA 5JOBA 4EQPA 3A8KE 4XQQA 1QCBD 4A3MB 1Q8IA 2RDGA 5KNBA 5IGBA 2CHBD 3K6OA 3J80L 1VMCA 2MJ8A 2F03A 1KDAA 3ONAB 5K5PA 5COYA 4LK1C 1X3PA 4R9WA 1PTOH 3BYTB 5TSSA 2ID0A 2L1BA 2NBFA 1QE6A 4UDUC 4K2KA 4NMZA 2Z8LA 1PTOB 3H94A 5J22A 1SE3A 1SMYC 1B3AA 1Z47A 4XTCS 1HTLD 2PZWA 1RJTA 1OXSC 3A55A 1TY2A 1Y1WB 1VDZA 3HKZB 1F2LA 2F0QA 3I73A 5DAUA 4WRDA 5G3LD 1CT1D 4HN7A 3RMHA 2DN8A 2MHVA 1E2ZA 1GOZA 1GXDC 4XIGS 3KUPA 2PW7A 3GTPB 4NW2A 4H13C 2CW0C 5J39A 3BVMA 2QF7A 2E2DC 4OO1I 1W6KA 1K8OA 1TS3A 3D31A 4H7BA 3DEPA 1H9KA 3I4MB 1Q12A 5EBDA 2PCFB 3MTSA 4QF4A 1KDBA 4Z9CB 3VYUA 5ELCA 5FKAC 1K8MA 2CQAA 3DXJC 1EY9A 3T56B 3GTKB 3AU7A 4IUUA 3QG1A 1CZWA 3DEOA 1EY6A 2KEDA 4A3GB 5IT9E 3TP8A 4FF1A 1SNQA 5I9OA 1M4VA 3TDQA 3MA2B 1C8CA 3X3NA 4CKBA 1PZJD 2A5HA 1RODA 5A35A 1GUSA 4DAYA 1Y8PB 4DK1A 2L9HA 3MAQA 4RHRA 1WTRA 3OMCA 3T4AC 4ZKCB 4A3FB 2RDHA 5D14A 4EQOA 3A56A 4BBRB 4U673 1UNSA 1AZQA 2NB0A 1DOMA 3VA5A 1YNNC 3ND8A 5C4ZA 2CW0D 4C1NK 1VCIA 3NWTA 4QB4A 2F0FA 1AEXA 1H9JA 1RKNA 1FGBD 4IFDJ 2EYHA 2EJMA 4HTHA 2ZT9C 1Z6HA 1DZ1A 1KDCA 4FNFA 1GHKA 1PXUA 3Q6SA 1WTOA 3T13A 4RA8A 1D6EC 2O2LD 3URYA 3IAYA 5G3LF 2SOBA 3NE5B 3MXUA 3PUXA 3GTGB 4H0LC 1S5DD 2L4NA 4ZLTF 4KKTA 1MSHA 3HZXA 1TKWB 1JWSD 3QO2A 3SE0A 1GUWA 2B8FA 5BN3A 3BVGA 3K5OA 5C0XG 5E1FA 5JJZA 2N55A 1BCPC 2E76C 1EY4A 3NSWA 1O78A 1I6HB 3D6WA 5JVG3 4HAEA 1STYA 4ULLA 3KK7A 3I4LA 3HOYB 2B2WA 1PFNA 1YNND 1BO0A 1TIID 4A3EB 1G91A 1LT6D 3SHLA 2XSCA 1HA5A 3D8GA 4HCEA 1SNCA 1AW7A 3P1HA 2K5WA 2IWHA 5JEAG 2E75C 4QUCA 1HA6A 5J1ZA 1DOLA 3BDCA 2B63B 5DM73 1JR0D 3LNNA 3RUZA 2A6EC 4V190 2EZVA 1T5EA 1V43A 4KY5A 5C3WA 4ZUIA 4BA1I 2EXZA 1LTID 1D1IA 3OMGA 2VB2X 5F2DA 1I50B 2N88A 5CV9A 3SK4A 3HOZB 3VR3A 3P75A 1TS2A 3MXPA 2JEAI 5C4XB 1WTPA 3EFXD 2WINB 2F0GA 4M1UB 3NTIA 2OXPA 3V96A 1BCPD 1GJXA 4L8JA 3N6RA 3PO3B 2IPKD 1YNJD 2NVTB 2EY1A 1U4MA 1EYDA 2NTSA 2VXWA 3A7LA 1J9OA 3MZ5A 3GTQB 3I4NB 1I4RA 5FO9B 1A6XA 2LY7A 3C2PA 2GA4B 2SEBD 2PMZB 2F0VA 3MEHA 4KD3A 3S15B 3J80E 2AUKA 3GTJB 2IL8A 4WFN3 1V8QA 1Q3LA 5C44B 3TZDA 4G57A 5I2YA 3S1NB 2EPBA 1HUNA 3K5MA 1EQTA 4ODGA 5I2XA 1EFID 1SNPA 1T5XD 2F0UA 1IW7C 4CGYB 5DEHA 1CHPD 2A6HC 1E2VA 2F0LA 1HCZA 1CA6A 2WACA 1CM9A 1IKLA 3KBGA 3BDLA 4K5WA 2XRQD 2OF1A 4FP5D 4UAIA 2IX3A 2NN6I 5KYIA 5LL6X 1SNOA 5CV5A 2KVMA 4ZQ3A 1ILPA 1RCVD 1WTVA 4FXKC 1QB5D 3Q24A 2K05A 4PV1C 4EQNA 2FINB 1UEAB 2F0OA 2KEEA 2EY5A 1O7ZA 3FPPA 2QILA 3A8IE 5I6WA 1Y1VB 5I6YA 1LTRD 4QUFA 4CHTB 1RD9D 5IODA 2FJ2A 4NP5A 1R4QB 2J4XA 1H9RA 1SYCA 2Z1CA 3QB3A 1BCPF 2F0IA 3VA7A 2K01A 2K03A 2VNUD 4F8MA 1NCVA 2EY2A 1IW7D 4XT1B 5EJWA 3DWQA 4OIKA 2KECA 3IKJA 2K33A 3ERQA 5CC4A 4JK1C 3E6ZX 1B50A 1X32A 1SNDA 3IL8A 1WTQA 1SYDA 3MC0B 3M4OB 5K36H 1SE4A 4OGQC 5M3FB 2LFNA 3S16B 3TBIB 5EQ0A 5M9OA 1F77A 1OXXK 1B9NA 3JAML 1LTAD 2QCPX 1ZEQX 4OIJA 5CV4A 3HRZC 1I4QA 3D4WA 5D3DA 1SDFA 3NWSA 4TSSA 1I6VC 4C3JB 2B2VA 1CQVA 1E2WA 4IUPA 1ML0D 1STNA 2A74C 1SYEA 2EDGA 1A3TA 1JOQA 3X3MA 4PMWA 3FDTA 5EKIA 1RTNA 3J7AF 1CQFA 1VF7A 2XNAC 1Q90A 4N9TA 1O80A 1SXTA 4IFDH 5KYLA 4C3IB 3ND9A 2E74C 5CGKA 4A3BB 3ITPA 3LX0A 2PO4A 3S9WA 1XXGA 1AP0A 4IQZA 3V05A 1EWHA 2AQ3B 1LV9A 3RZDB 2F0JA 5CORA 3EA6A 5BN5A 1PRTD 3BYYB 1HHVA 3L3OC 1RDPD 3DHQA 3VYRA 2B2YC 1CA5A 1V1OA 1A3UA 2XIWA 2ICEC 3SR1A 4RWSC 1LO5D 2NYZD 3NPPA 3CRLC 1IHZA 1QNUA 1STBA 3PV0A 2AQ1B 3K7AB 2B8GA 3L7ZC 3U9OA 4XYOA 1VF5C 4ZUJA 3FMCA 3KLRA 2Y0SB 4R8NA 3N52A 1EIHA 2PZUA 1M8AA 1G291 3F2UA 2ICIA 2R61A 2EYMA 3FVQA 3HG9A 1DM0B 1FR3A 3W3AA 3PUWA 5I4DA 4L63B 3TP6A 4F88A 1OXUA 4J8QA 3SK6A 3TN2A 4ILWA 3L9AX 1FNWA 1LABA 3T53B 5EPKA 4KJNA 1HTPA 5C4JB 2EY6A 3ZYYX 3KF8A 3RZOB 4C1NI 3J81L 1MD2D 2RKSA 5EKKA 3TZUA 2YU9B 4Q0FA 3D6CA 1SSOA 4E6IA 4HMJA 1PZID 1EIGA 3BVZA 3TP5A 1TWAB 1CI3M 1SYBA 5KGUA 4H44C 1BOSA 5JAVA 2WKCA 5CR3A 2NUCA 1LT4D 5ELBA 1SNMA 3MXGA 4G4KA 5FO8B 3M4YA 4CKEA 2EJGC 5EPLA 3GTLB 3G6JB 3I8ZA 4EGVA 2M00A 1LTBD 4LAAA 1PRTF 1FD7D 1LT5D 5IGDA 5C0XI 3GV3A 1TT2A 5AFWA 1TWHB 2WP8J 2RBMA 3C46A 1EY7A 2LMCB 1G8ZD 1KLUD 1TQOA 2JXMB 1NR2A 3CKIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BVG A;  2CHB D;  2G9H D;  1BCP D;  1CQV A;  3BZD B;  5I4D A;  4L63 B;  1PTO D;  2IPK D;  2QIL A;  2WV6 D;  5ELE A;  1UUP A;  2NTS A;  3TSS A;  1BCP C;  4ZYS A;  1KLG D;  4RHS A;  1LTR D;  1PZK D;  1M4V A;  2XRS D;  1PTO C;  1FNW A;  1I4R A;  1JCK B;  1TS4 A;  1PTO H;  2XNA C;  1RD9 D;  1LTS D;  1XTC D;  2AQ2 B;  2QEJ C;  1SXT A;  3BYT B;  1JWM D;  4RFB A;  1PZJ D;  2SEB D;  5TSS A;  1S5E D;  4UDU C;  3R2I A;  1I4H A;  2J4X A;  3MFG A;  4RCO A;  2Z8L A;  1PYW D;  4RHR A;  1ESF A;  1LLR D;  1BCP F;  3KLS X;  1MD2 D;  5ELD A;  1CHQ D;  1PTO B;  2RDH A;  1SE3 A;  1XXG A;  1SEB D;  1LTT D;  1FNU A;  1PTO F;  3V05 A;  1TS5 A;  1I4G A;  3OWE B;  2AQ3 B;  1HTL D;  4RGN A;  4BWG B;  4DXF A;  1LT6 D;  1ET9 A;  2NTT A;  1SJH D;  1PZI D;  1V1P A;  3BVZ A;  1S5B D;  1KTK A;  1UNS A;  3EA6 A;  1HQR D;  1L0X B;  1BXT A;  1TY2 A;  3O13 A;  3DWQ A;  1EFI D;  1PRT D;  3BYY B;  3CHB D;  1T5X D;  4L6T B;  1RF2 D;  4RH6 A;  3R8B A;  5D3I B;  1DYQ A;  4O1N A;  1RDP D;  1TY0 A;  1I4X A;  3DWP A;  1HA5 A;  1CT1 D;  1L0Y B;  3SEB A;  1CHP D;  1GOZ A;  1V1O A;  1BCP B;  5FK9 C;  1EEF D;  1LT4 D;  1AW7 A;  3W2D A;  1SBB B;  5ELB A;  1D5M C;  1FGB D;  1STE A;  3R2T A;  2XN9 C;  1LO5 D;  1DJR D;  1ENF A;  1S5C D;  1B1Z A;  2XRQ D;  3BVM A;  1QIL A;  1JR0 D;  1ET6 A;  1LTG D;  3DWA A;  3MC0 B;  1FNV A;  2TSS A;  4DXG A;  1SE4 A;  5ELF A;  1EWC A;  1JQY D;  1TS3 A;  2AQ1 B;  1LTB D;  1AN8 A;  1PRT F;  1LTI D;  1D6E C;  4RGM A;  3GP7 A;  1F77 A;  1B44 D;  1LT3 D;  1FD7 D;  1S5F D;  2O2L D;  3URY A;  4OHJ A;  2IJ0 A;  1LT5 D;  1LTA D;  4K6L A;  4C56 C;  1V1P B;  1PRT C;  1RCV D;  1EEI D;  1S5D D;  1SE2 A;  1I4Q A;  1EU3 A;  1G8Z D;  4RGT A;  1KLU D;  1TS2 A;  1I4P A;  1JWS D;  4Z9C B;  1JWU D;  5D3D A;  2ICI A;  5ELC A;  3EFX D;  1HXY D;  4RGO S;  5FKA C;  1EU4 A;  2R61 A;  1SJE D;  1D5Z C;  4TSS A;  1PRT B;  1CK1 A;  2RDG A;  1D5X C; 
#chains in the Genus database with same CATH topology
 1FL0 A;  2CWA A;  4PG3 A;  3GQB A;  1VMP A;  1VQN A;  3CCR A;  2D0P A;  1HPC A;  3AYH B;  4O2D A;  4PMB A;  2EYP A;  1TU2 B;  2KUM A;  2LS0 1;  2MFI A;  2NZ1 D;  3PO2 G;  4JI8 Q;  1EZ8 A;  2L0C A;  1VQI A;  1XJV A;  3HOZ G;  4ZYS A;  5KEE A;  2FMM A;  5C4X G;  1VQK A;  1G2T A;  5LHY 1;  4JV5 L;  4HJ8 A;  3E5S A;  1JWM D;  2WAQ B;  5LMN L;  1LTL A;  5IYB G;  2F4V L;  1I4H A;  1R4P B;  4DR5 L;  4RCO A;  2O5J C;  1WTX A;  2Z4H A;  2VQE L;  2CH4 W;  3PO3 G;  2AMC B;  1CSP A;  1EQQ A;  1YEZ A;  1SEB D;  1FNU A;  2BOS A;  2HDL A;  3GTO H;  1ICW A;  5LMN Q;  1P16 A;  2EVB A;  2F4V Q;  4CDC C;  1XTD A;  4DR5 Q;  1PH4 A;  3HGB A;  2VQE Q;  5IGC A;  1L0X B;  4GZY C;  1YNJ C;  4O1N A;  1TY0 A;  3GTO B;  2F0K A;  3DWP A;  3ULJ A;  2ZM6 L;  4KY6 A;  2BDO A;  3TS0 A;  1HFN A;  3KDF A;  3UDX A;  3Q22 A;  1H95 A;  5IGG A;  5C44 G;  4OO1 H;  2KQ3 A;  4K8I A;  3BG3 A;  1ASZ A;  1KAW A;  3PUY A;  3R3O A;  3QJY A;  4I7Z C;  4CKC A;  2EE1 A;  1DJR D;  1ONL A;  2ZM6 Q;  3QOJ A;  5EBC A;  4BS9 A;  1Q86 C;  1A3V A;  1ET6 A;  3QWN A;  3SGI A;  1WI5 A;  2F0T A;  5T1G A;  3NHH A;  3P7J A;  4RGM A;  1YIT A;  4QIW B;  2B2T C;  4TVA B;  3W1B A;  3CCQ A;  4OHJ A;  3K5L A;  1TR5 A;  2SNM A;  2GVA A;  1G2S A;  1MBY A;  3UI2 A;  4J6H A;  3U4Z A;  2MGS A;  1A62 A;  1SE2 A;  2NVY H;  3NQI A;  3AFP A;  2F3W A;  5CMD A;  2IT1 A;  3HOW H;  4LF9 L;  1JIC A;  4RGO S;  4ZCK A;  1IYU A;  1E1O A;  3BS1 A;  1PH1 A;  2JA7 H;  2NVY B;  2BE5 C;  1M1K C;  4HMI A;  1BKB A;  3JAM E;  2ZXP A;  5JPM C;  2H1E A;  4XT3 B;  3RD4 A;  3HOW B;  2UXC L;  4LF9 Q;  2VS1 A;  1B9M A;  4XQJ A;  2JA7 B;  3TSS A;  3MHB A;  4A93 H;  1YHA A;  3T51 B;  2HHH L;  1F9Q A;  1KC8 C;  4DV5 L;  2UXC Q;  5EKL A;  4DAV A;  4ZKB B;  1LTS D;  1VQ7 A;  1QVF A;  3VYT A;  3CQZ H;  1ICF B;  4PNY A;  4A93 B;  3GDE A;  1QWY A;  2HHH Q;  2B2U C;  2ES2 A;  2EQS A;  1QVG A;  4DV5 Q;  3J80 c;  4R8I A;  2DNC A;  1AE3 A;  1XMO Q;  4LJZ C;  2QA4 A;  3NTK A;  1RHP A;  4M8A A;  1LTT D;  5EGT A;  3CQZ B;  1Y1V G;  4KY7 A;  2HDM A;  3RLF A;  1PFM A;  1XYI A;  4X3S A;  4BWG B;  2UXB Q;  1ET9 A;  5I9P A;  4K5X A;  1SJH D;  4WOR A;  1PA6 A;  4DGZ A;  4LF6 L;  2JA5 H;  3R8B A;  4A3L G;  3S1Q H;  5IE8 A;  1VS0 A;  2N8N A;  1B2T A;  4X3K A;  2RDF A;  1TWF H;  4CJ0 B;  1EEF D;  1PV4 A;  3J7Y W;  1EYC A;  4LF6 Q;  2F0N A;  4XXE A;  1ENA A;  2JA5 B;  4NKL A;  2MNA A;  4A3I H;  3U58 A;  2K6A A;  1CSQ A;  4WJ3 M;  3MEF A;  1LTG D;  1TWF B;  3SDZ A;  4DXG A;  5ELF A;  1C0A A;  4I7A A;  2K7V A;  3WDN A;  2A19 A;  4A3I B;  2M9V A;  3I55 A;  4LUO A;  1EYA A;  4HJ5 A;  2G9D A;  2BA0 A;  4JI0 L;  4EVO A;  1CKN B;  2SNS A;  1M90 C;  3DMU A;  2C5C A;  3E0J A;  4FF2 A;  2BE5 D;  4K6D A;  3KJO A;  5FLX L;  1AZP A;  3HOX G;  4KKS A;  4JI0 Q;  1EY8 A;  2IHE A;  2HQE A;  5E4X A;  1HZC A;  4AYB B;  2JE6 I;  2G9H D;  1NY4 A;  2JSO A;  2ZJP A;  5K36 G;  3DLL A;  4ME3 A;  1QZG A;  2K5D A;  3H6M A;  1KHI A;  1R9T H;  3HOU H;  2RVL A;  3FP9 A;  3PIP 3;  2JP1 A;  4P73 A;  3I90 A;  1K8A C;  1FJG L;  1OO9 B;  4OEM B;  5CV6 A;  5KIX A;  4DR2 L;  1GUN A;  2AUJ D;  4DN4 M;  4QL5 A;  1D2B A;  1R9T B;  3HOU B;  4OEL B;  4IUR A;  4DF7 A;  1AH9 A;  2R92 B;  3F8T A;  3TME A;  4C3J G;  4RKB A;  1ENC A;  1RL2 A;  1FJG Q;  2B2Y A;  4OL7 A;  1Z9F A;  4RAU C;  5J3B A;  1MKH A;  1PYW D;  5IP7 G;  1ESF A;  1UE6 A;  5CBE E;  4LNQ A;  1HR0 L;  5GAD C;  1TS5 A;  1DD2 A;  4FXG C;  1EL0 A;  3BDO A;  2ZXO A;  1TVX A;  3PMF A;  3S2H H;  1KTK A;  5IWA L;  2J7Z A;  1CKN A;  1JE4 A;  2SDF A;  1JOO A;  4F87 A;  2RSN A;  2E2J H;  2WII B;  4C3I G;  2I5M X;  1VQG A;  1B53 A;  5C5M A;  4A3B G;  4DV7 L;  2F3I A;  4WJW A;  5IWA Q;  4DNT B;  4ALP A;  4FF3 A;  2JA6 H;  3S2H B;  3J81 E;  1JB3 A;  1Y8N B;  3W2D A;  1LAC A;  4IFD G;  4BY7 H;  2E2J B;  4K14 A;  1B1Z A;  2LXK A;  2OQ0 A;  1HNX L;  2HCI A;  3UE0 A;  4F7X A;  2JA6 B;  1I3Q H;  3E0E A;  2E5L L;  1JQY D;  2RHS B;  3KLS A;  4BY7 B;  3CP0 A;  2AWN A;  3GP7 A;  3CCL A;  1LT3 D;  2MO0 A;  3KBX A;  1HNX Q;  4K6L A;  2D62 A;  2E5L Q;  1BR9 A;  1PRT C;  3U4V A;  3CU7 A;  4JI1 Q;  3KJP A;  3UE1 A;  5LMU L;  1K0S A;  1Y14 B;  4DA2 A;  2H4O A;  3IFD A;  3I2Z A;  1NNX A;  3A54 A;  2FHT A;  2VB3 X;  2EJF C;  1I4P A;  2VQF L;  3MVV A;  1IBK L;  5EPJ A;  1Y1W G;  3HKZ G;  4IN3 A;  1K3B C;  2EYL A;  3PIO 3;  1SR3 A;  5LMU Q;  1XX8 A;  1ZYR D;  2HCC A;  1QG7 A;  5CV7 A;  4POG A;  3C1F A;  4FYD A;  4GLA C;  4TKO B;  1Y8O B;  2VQF Q;  4X3T A;  1IBK Q;  2EYO A;  3ICE A;  2WV6 D;  3CRK C;  5ELE A;  3D4R A;  5H1S E;  3H3V I;  3NEN A;  1GHJ A;  2A69 C;  3FEW X;  3K59 A;  3I7F A;  2JA9 A;  3OHX C;  4X62 L;  2PI2 A;  4JI5 L;  1EZ6 A;  2AWO A;  2KCN A;  1JCK B;  4B9W A;  1JJ2 A;  3CCE A;  4RG1 A;  4FDB A;  2QEJ C;  1XNR L;  1C9O A;  1L1O C;  2C35 B;  3IRB A;  2EIF A;  5A2Q L;  1E0B A;  4X62 Q;  4JI5 Q;  1D1K A;  3KLS X;  1K83 H;  1F2Y A;  1XNR Q;  3BJU A;  4B9X A;  3OWE B;  2DJG C;  2QDL A;  5HUR A;  4WJ4 A;  1Q1E A;  3IFT A;  3ERO A;  5JVH 3;  2F3V A;  1RF2 D;  1K83 B;  4IUV A;  1A2T A;  4JBK A;  1JOK A;  2PMZ E;  3SEB A;  2WKD A;  3STB C;  3FKI H;  3K57 A;  4LF5 Q;  3SXH A;  1BCP B;  4KHZ A;  1NTG A;  4HED A;  4JBM A;  3AB9 A;  5JEA J;  1IKM A;  4JI7 Q;  3PUZ A;  4DU9 A;  4GNX C;  4HR7 B;  4JI6 L;  3FKI B;  1KAB A;  2NN6 H;  2F0S A;  5IOC A;  1UE1 A;  4IUT A;  4LUV A;  1BQQ T;  3EJI A;  2RCN A;  4DR7 L;  5C3E H;  1O7L A;  3S1R H;  3TP7 A;  1S5F D;  1ESR A;  3OPO A;  1EWI A;  4DUY L;  1MHW C;  2KJX A;  4JI6 Q;  2L11 A;  1Q46 A;  1V1P B;  3GTM H;  3HFZ B;  3TEH B;  5C3E B;  3CC7 A;  4KD4 A;  3FRP B;  5IYC H;  3S1R B;  4LFC L;  4KHP L;  3SK5 A;  4GKK L;  2K75 A;  3GTM B;  2R93 H;  4LF7 L;  1PH9 A;  3EN2 A;  1CZG A;  4IOC A;  2JA8 H;  1K9M C;  2PYK A;  1D5X C;  2KOL A;  2A69 D;  4CJ1 B;  4LFC Q;  1HNZ Q;  2NVX H;  4DKA C;  2PNR C;  4C3H H;  3GO5 A;  5T1I A;  4DK6 C;  3OWF A;  4GKK Q;  2JEB I;  2R93 B;  4LF7 Q;  3AMU A;  1X54 A;  3D0F A;  4ZRZ A;  2JA8 B;  3A8J E;  1IZ6 A;  1MI2 A;  1UE5 A;  1SYF A;  4B3M L;  4QJF A;  5IP9 G;  3ULP A;  2NVX B;  2DNE A;  2NVQ H;  3ZJY C;  4C3H B;  2B39 A;  2LSS A;  3RLN A;  2AHO B;  2M2L A;  4GOP C;  2K14 A;  4JYA L;  4B3M Q;  1MSG A;  2NVQ B;  1EOV A;  3MFG A;  3PIP A;  2OEO A;  2N49 A;  2F0H A;  1XWE A;  4JI3 L;  4J1M A;  3UDG A;  2XWJ B;  2RQX A;  4JYA Q;  1EY0 A;  2DUD A;  1K3R A;  2X69 A;  4R4O A;  4KKU A;  3H09 A;  2NTT A;  3STB D;  4YWM A;  4L5R C;  4IOA A;  1V1P A;  4P75 A;  3S1M H;  3O13 A;  5M5X H;  1YHQ A;  2ZJR A;  4JI3 Q;  4V0B A;  4DV0 L;  4L6T B;  5FOB B;  4MTN A;  3AFQ A;  2QKI C;  2WAQ G;  4G7O C;  5FJ8 G;  2R6G A;  3D3R A;  4XDX A;  2F0W A;  2R3Z A;  1YJW A;  2BH8 A;  1NMF A;  5ISR A;  2B2T A;  2K4K A;  2YV5 A;  4LWC A;  3S1M B;  3SVM A;  1MJE A;  5M5X B;  4IJH A;  4YWK A;  4DV0 Q;  1SBB B;  4ABN A;  5DM6 3;  3DM1 A;  2XN9 C;  1LYL A;  2PZT A;  3T1Y Q;  3CPW A;  2XVS A;  2LKV A;  4MIU A;  1NAP A;  2I46 A;  1K0R A;  1QIL A;  4KN4 C;  4IAL A;  5CBA E;  5E3F A;  2NZH A;  3I91 A;  3QIA A;  3OIP A;  5BN4 A;  4U68 A;  3V2T A;  1D7Q A;  1WVL A;  1BF4 A;  4B08 A;  1WCM H;  3HEJ A;  1ZKO A;  2PPB C;  3I72 A;  2HQL A;  4Q5V A;  4G7H C;  1L2F A;  1ILQ A;  2KCC A;  5D65 A;  1E3P A;  1U4R A;  1Y69 U;  1BDO A;  5FLX c;  1WD0 A;  1QVC A;  4KV6 A;  1WCM B;  2D2C C;  3AQQ A;  3W5O A;  2OT2 A;  2X6L A;  1IL2 A;  1U4L A;  2G5D A;  1JWU D;  4PMC A;  4LW1 A;  2B3G A;  4KTA A;  4OO1 G;  3PGZ A;  1SJE D;  3M7N A;  1SMY D;  4PQX A;  1CK1 A;  2B2V C;  1S5C D;  3S17 H;  4IUQ A;  2IX1 A;  1IBM L;  2B2U A;  3MXN B;  3GD7 A;  3A0J A;  1C48 A;  3NXW A;  2WB1 B;  4FF4 A;  2ZTE A;  1QUQ B;  4FXD A;  3S17 B;  1KAA A;  5IIF A;  1TWC H;  3PIO A;  5FLX E;  2RF4 A;  1IBM Q;  1YZ6 A;  4ID6 A;  1GUT A;  2IW3 A;  3EVQ A;  4NXN L;  2RA4 A;  1BBU A;  3NBH B;  4RCN A;  5JPN C;  1KNE A;  2O4X A;  4MN3 A;  1TWC B;  1JE5 A;  4KK7 A;  3S2D H;  1LLR D;  2F0E A;  1CHQ D;  4NXN Q;  1O7Y A;  5M5Y H;  3C3L A;  2JA7 G;  3SK8 A;  1CTM A;  4HSP A;  5KRU A;  4DV3 Q;  3K8A A;  4GLX A;  3S2D B;  3NEL A;  2EOT A;  1HQR D;  2F0D A;  3J7A V;  1PLF A;  2AKW B;  5M5Y B;  4A93 G;  3OW7 A;  4IPG A;  4YCW A;  3K7U C;  3NQT A;  1PFS A;  1NJI C;  1QJO A;  1BBX C;  4DV2 Q;  2X6G A;  4A3J H;  3RR5 A;  4QGU A;  1I94 L;  3CCS A;  1AFP A;  2XGT A;  4P2C B;  1PYS B;  5C5L A;  4A4I A;  4A76 A;  3MXN A;  3I4N G;  3S14 H;  1DXM A;  2BDN A;  1S4Z A;  4A3J B;  4CDF C;  3P20 A;  1I94 Q;  2F0M A;  1QUQ A;  1YBY A;  4GN4 B;  4K2L A;  1B44 D;  1JJC B;  4JVZ A;  1BUV T;  2Z6B A;  2HIX A;  2IJ0 A;  2Q8I B;  1I6H H;  3S14 B;  4JPB W;  2ALY B;  4IJL A;  1G6Z A;  2MUY A;  2JA5 G;  1Z7T A;  2L55 A;  2F1M A;  1F2M A;  3PF4 A;  3NBH A;  2D5D A;  4HSV A;  4MTK A;  1SRU A;  1PH7 A;  2L5T A;  4UP8 A;  4K8J A;  3PQI A;  1E7Z A;  4DK0 A;  4RGT A;  3C1E A;  4R1J A;  1U9R A;  5DNF A;  1A15 A;  1SAP A;  4POF A;  1EU4 A;  4ZK9 B;  4A3I G;  1DON A;  1D5Z C;  1PRT B;  5BR8 L;  2R7Z H;  3HKZ E;  1F9S A;  3OIQ A;  3QOL A;  3JAM c;  2QDB A;  3HOV H;  2RSO A;  2K5H A;  3Q23 A;  3LWU A;  1X56 A;  5BR8 Q;  3F2D A;  2R7Z B;  3J81 j;  4Y7N H;  2P5Z X;  1KLG D;  1SYG A;  2PW5 A;  1PDQ A;  1PTO C;  1PMR A;  1X55 A;  2E2I H;  3HOV B;  5KNC A;  1FVI A;  1TS4 A;  1WD1 A;  1VQ9 A;  1CUK A;  3A7A B;  4AYB G;  2C9O A;  2B63 H;  4Y7N B;  3T16 A;  1XNQ L;  5HGT A;  4LUZ A;  1WTW A;  1F2Z A;  3T1H L;  2E2I B;  2EXD A;  1P8L A;  3OSO A;  5ELD A;  3GV6 A;  1Q7Y C;  2YYZ A;  1EQV A;  4DNR B;  1L1O B;  1HUM A;  2E8G A;  2L12 A;  1XNQ Q;  4KLK A;  2D0O A;  1PH3 A;  3T1H Q;  2EYJ A;  3MFY A;  2DY8 A;  3LWE A;  1S3O A;  3HOU G;  4N9P A;  4L5T A;  3M3Y H;  2MQH A;  1XMO L;  4KI0 A;  2R92 G;  2UU9 L;  3EQL C;  3PO2 H;  4JI2 Q;  3CCU A;  1I4X A;  2E2H H;  1HFG A;  1L0Y B;  4LFB L;  5A2Q E;  2UXB L;  4JCV E;  5E4W C;  2NWG A;  5ELO A;  3MWY W;  1H9S B;  3M3Y B;  3R2T A;  3M7G A;  2UU9 Q;  3PO2 B;  1KL9 A;  2E2H B;  3VYS A;  1LUZ A;  1S72 A;  4LFB Q;  3KLW A;  2V4D A;  2Q8T A;  5FO7 B;  1F9P A;  1DOK A;  1Q1B A;  1X3Q A;  4X66 Q;  5C0X H;  2A68 C;  1MGS A;  4IPC A;  2Z4I A;  1AN8 A;  1NUC A;  4OWW B;  4BXX H;  1QOH A;  2K04 A;  2CWP A;  4BY1 H;  4QCL A;  2TMP A;  2XWB B;  4HCS A;  1VQO A;  5FLM G;  4BA2 I;  2MPM A;  5NUC A;  2VUM H;  2KEN A;  1C4Q A;  1B4O A;  3EIV A;  1SRO A;  3S1Q B;  5IT9 L;  3PSI A;  2KHS A;  4CJ2 C;  4BY1 B;  2I5L X;  1X3G A;  1ZXT A;  2A73 B;  2JA6 G;  1IL8 A;  4DAP A;  1IBL L;  4EX5 A;  2VUM B;  2FFK B;  5GAE C;  4X6A H;  2ZXR A;  3H3V C;  5LL6 S;  5M3M H;  2KCT A;  1Q81 C;  5ELN A;  1PTO D;  4JBW A;  1IBL Q;  4XYQ A;  3H0G H;  4JOI A;  4DFA A;  1JT8 A;  1IYV A;  2Q8R E;  3NK9 A;  2O5I C;  5M3M B;  4QY7 A;  1H9S A;  1VQE A;  4UP7 A;  5M3F G;  4ZAI A;  3WOE A;  1XTC D;  2AQ2 B;  3H0G B;  2J0T D;  1Q8K A;  2BA1 A;  1JOR A;  1S5E D;  4KHV A;  5JEA H;  3R2I A;  4G7Z C;  2A6E D;  1PH8 A;  4YY3 Q;  4IFD I;  1I4G A;  1OXT A;  4GOP B;  4KJO A;  1ZYR C;  4RGN A;  4DXF A;  1Q82 C;  3TRZ A;  1TWG H;  4N8F A;  5M5W H;  3VR5 A;  1BXT A;  4BBS H;  2XTI A;  3CHB D;  3J80 i;  3U9S A;  5KND A;  4RH6 A;  4K5V A;  1SFO H;  2WAQ E;  1K8G A;  1GKH A;  1VQB A;  1TWG B;  5M5W B;  3H91 A;  2LXJ A;  1KRS A;  2V1C C;  2B2W C;  4RKL A;  5FK9 C;  2UUC L;  4C2M H;  3J81 c;  2MP1 A;  2K28 A;  4BBS B;  4UPA A;  2A68 D;  2YTV A;  1VQ4 A;  2CVR A;  1SFO B;  1H9M A;  1CFM A;  1ENF A;  4GLV B;  3NBI A;  3HS0 C;  3DWA A;  1FNV A;  2TSS A;  4C2M B;  1NR4 A;  3WOF A;  2OTL A;  2UUC Q;  1V9P A;  4YIJ A;  1F9R A;  3K5N A;  4TRD A;  5JJK A;  1EOT A;  1E22 A;  1SN8 A;  4AQY L;  3PUV A;  5GRO A;  4A3K H;  5CV8 A;  2PQE A;  1IXR A;  1BBW A;  4C56 C;  2HUG A;  4A3D H;  4A3L H;  2F4I A;  2MO1 A;  3W1G A;  2F0P A;  3K0X A;  1KNA A;  2DY7 A;  3NP8 A;  4AQY Q;  4DUZ Q;  3FKI G;  3M85 A;  4A3K B;  2I07 B;  4KN7 C;  3I70 A;  4MZ9 A;  5IGE A;  3OW2 A;  1HXY D;  4QMG A;  4A3D B;  4LMQ D;  4DR3 L;  2BH2 A;  4JI1 L;  4GOP A;  5CYU A;  5C4H A;  4IUN A;  2R7F A;  3FPU B;  2JJQ A;  2NN6 G;  4QIW E;  4NDX A;  3DUZ A;  3BZD B;  1MIU A;  4TQU S;  1EY5 A;  4S3S A;  1I3Q B;  2Z9H A;  3K58 A;  1PFB A;  4O42 A;  4DR3 Q;  5C3E G;  2JYO A;  2DJF C;  1UUP A;  2FMC A;  1YJN A;  2K52 A;  1VQ8 A;  4RHS A;  4K0K L;  2A6H D;  5C6A A;  1PZK D;  2D9U A;  4OX9 L;  2XRS D;  1QNK A;  2K32 A;  3K0Y A;  1U4P A;  3CPF A;  1FYC A;  1GUO A;  3A5U A;  1DCZ A;  4RFB A;  5IYC G;  3NTH A;  2A8V A;  4K0K Q;  1HJP A;  3R93 A;  1N8R C;  4OX9 Q;  3D4D A;  3I3C A;  3HOX H;  2R93 G;  5C0X J;  3G6E A;  1X3F A;  3I56 A;  1OTC A;  2JA8 G;  2Z6K C;  1OXV A;  1RTO A;  2Y0S G;  1PTO F;  2UUB L;  1C7Y A;  4DR6 L;  1XPO A;  3G4S A;  4MHE A;  4XQN A;  1PH2 A;  2HIV A;  1E1T A;  4C3H G;  1KIX A;  1S5B D;  3HOX B;  1JC7 A;  1UAP A;  1HQM C;  2BCO A;  5D3I B;  1DYQ A;  2UUB Q;  4FVM A;  3VR4 A;  4DR6 Q;  1EFW A;  2EYF A;  4GKJ Q;  2QEX A;  3RLO A;  4I65 A;  3VR2 A;  4APV A;  1D5M C;  1STE A;  1NSN S;  1A8V A;  4FO2 A;  4RMF A;  4UHV A;  4ME5 A;  4R4C A;  4IZ8 A;  4X3U A;  3HP3 A;  4LF5 L;  1A2U A;  1A63 A;  4YHH L;  1W6J A;  1EWC A;  1STA A;  1STG A;  1GUG A;  1N33 L;  1II3 A;  1BNZ A;  1S40 A;  1HNW L;  5C3X A;  5IGF A;  1D8L A;  4JI7 L;  1FGU A;  2KA7 A;  2IX0 A;  3VR6 A;  2ENB A;  3G7L A;  3QR8 A;  2K1B A;  1STH A;  3OOC A;  3Q0A A;  2K5Q A;  2KCM A;  3NUC A;  4YHH Q;  4A3M H;  1EEI D;  1N33 Q;  1HRJ A;  4CBV A;  1HNW Q;  4KMU C;  2KHI A;  1EU3 A;  1J8I A;  5JOB A;  4EQP A;  3F2C A;  3A8K E;  3E9I A;  4XQQ A;  1QCB D;  4A3M B;  1NMG A;  1Q8I A;  2RDG A;  5KNB A;  5IGB A;  2CHB D;  3K6O A;  3WWV A;  3ER0 A;  3J80 L;  1VQC A;  1VMC A;  2MJ8 A;  4OON A;  3B6Y A;  2F03 A;  1KDA A;  1YJ9 A;  3ONA B;  5K5P A;  1WCM G;  3L0O A;  1HNZ L;  5COY A;  2UXD Q;  4LK1 C;  1X3P A;  3TRE A;  4R9W A;  1PTO H;  1EQR A;  3BYT B;  5TSS A;  2ID0 A;  2L1B A;  2NBF A;  1QE6 A;  4UDU C;  4AYB E;  1QZH A;  4K2K A;  4NMZ A;  2Z8L A;  1EIF A;  2CFM A;  1PTO B;  3H94 A;  1Y1W H;  5J22 A;  1SE3 A;  2WB1 G;  4DV4 Q;  3CCV A;  1SMY C;  1B3A A;  1Z47 A;  4XTC S;  1HTL D;  2PZW A;  4JI4 L;  1RJT A;  1VQD A;  1OXS C;  3A55 A;  1TY2 A;  3GTP H;  3AEV A;  1Y1W B;  1VDZ A;  3HKZ B;  1F2L A;  2F0Q A;  3I73 A;  5DAU A;  4WRD A;  5G3L D;  1CT1 D;  1X9N A;  3Q8D A;  4HN7 A;  3RMH A;  4DK3 C;  1N36 L;  4JI4 Q;  2VZA A;  2DN8 A;  2MHV A;  1E2Z A;  1GOZ A;  1GXD C;  1J5E L;  4X65 L;  4XIG S;  4YCV A;  5AJ3 L;  3KUP A;  2PW7 A;  3GTP B;  4NW2 A;  4H13 C;  2CW0 C;  5J39 A;  2B29 A;  3BVM A;  1SLJ A;  1N36 Q;  2QF7 A;  2E2D C;  4DAY B;  1J5E Q;  4OO1 I;  4X65 Q;  3RNU A;  5AJ3 Q;  3I4M H;  1W6K A;  1HZB A;  1K8O A;  1TS3 A;  1VQ5 A;  3D31 A;  1CKO A;  4QQB X;  4HJA A;  3T1Y L;  4H7B A;  2K5V A;  1KQS A;  3DEP A;  1H9K A;  1WYD A;  2PI2 E;  3I4M B;  1Q12 A;  1VQM A;  5EBD A;  2PCF B;  4HJ7 A;  2Q2U A;  3MTS A;  5C4J H;  4QF4 A;  1KDB A;  3GTK H;  2KBN A;  2GVB A;  4Z9C B;  3VYU A;  4A3J G;  5ELC A;  2OQK A;  5FKA C;  1K8M A;  1SMX A;  1PVO A;  4A3G H;  2CQA A;  2I5H A;  3DXJ C;  3CC4 A;  3H3V H;  1EY9 A;  3T56 B;  3GTK B;  3AU7 A;  2H5X A;  4IUU A;  3QG1 A;  1HZ9 A;  1CZW A;  3DEO A;  1EY6 A;  1MJC A;  2KED A;  4A3G B;  1XMQ Q;  1B70 B;  2K5N A;  5IT9 E;  3TP8 A;  4FF1 A;  1SNQ A;  5I9O A;  5E7N A;  1M4V A;  3TDQ A;  3MA2 B;  4A3F H;  1C8C A;  3X3N A;  4CKB A;  1PZJ D;  2A5H A;  1ROD A;  3VDY A;  3DM3 A;  5A35 A;  1GUS A;  1VQ6 A;  1JJG A;  4DAY A;  1Y8P B;  4BBR H;  4DK1 A;  2L9H A;  3MAQ A;  1GO3 E;  4RHR A;  1WTR A;  3OMC A;  3T4A C;  4ZKC B;  3K81 C;  4A3F B;  3CME A;  2RDH A;  5D14 A;  3CCM A;  4EQO A;  2R7Z G;  3A56 A;  1B3Q A;  3HOV G;  2R7D A;  4BBR B;  5GAG C;  1UNS A;  4U67 3;  1AZQ A;  2NB0 A;  1DOM A;  3VA5 A;  4DV1 L;  4JW0 A;  1YNN C;  3ND8 A;  4OWX B;  5C4Z A;  2CW0 D;  4C1N K;  1VCI A;  3TQY A;  3NWT A;  4DV3 L;  4QB4 A;  2F0F A;  1AEX A;  3HOW G;  1NBW A;  4DV1 Q;  1H9J A;  1RKN A;  1FGB D;  4IFD J;  2EYH A;  2EJM A;  4R4I A;  4HTH A;  2ZT9 C;  1Z6H A;  1DZ1 A;  1V1Q A;  1KDC A;  5IYD H;  4FNF A;  4DV2 L;  1GHK A;  1PXU A;  3Q6S A;  1WTO A;  3GTG H;  3T13 A;  4RA8 A;  1D6E C;  2O2L D;  3URY A;  3IAY A;  5G3L F;  2JN4 A;  1IYJ B;  2SOB A;  2KHJ A;  3NE5 B;  3MXU A;  3PUX A;  3GTG B;  4H0L C;  1S5D D;  4A3C H;  2L4N A;  5FJ8 H;  4ZLT F;  4KKT A;  1MSH A;  2VW9 A;  3HZX A;  1TKW B;  1JWS D;  3QO2 A;  1LM0 A;  3SE0 A;  4GN3 B;  1GUW A;  3J7A 5;  2PNH A;  5GAH C;  2B8F A;  5BN3 A;  3BVG A;  4R4Q A;  1X3E A;  3K5O A;  5C0X G;  4HID A;  4JV5 Q;  5E1F A;  5JJZ A;  2N55 A;  4BXX G;  4BY1 G;  1BCP C;  2E76 C;  1EY4 A;  3NSW A;  3HOY H;  1O78 A;  2I0Q A;  1I6H B;  3PCO B;  2VUM G;  2DGY A;  3D6W A;  4DNI A;  5JVG 3;  1WTH A;  4HAE A;  4A3E H;  2F52 A;  3PF5 A;  1STY A;  4ULL A;  3KK7 A;  3I4L A;  3HOY B;  1PYB A;  1B8A A;  2VY3 A;  2B2W A;  1EYG A;  1PFN A;  1YNN D;  1BO0 A;  1TII D;  2Y0S E;  4A3E B;  1G91 A;  2OTJ A;  1O7I A;  1LT6 D;  4PZ7 A;  5M3M G;  3SHL A;  2ZTC A;  2XSC A;  3LGJ A;  4DR1 L;  3UDI A;  3H0G G;  2JQO A;  1HA5 A;  3D8G A;  4HCE A;  1SNC A;  1WJJ A;  1L0W A;  4DR1 Q;  1AW7 A;  2QGQ A;  1GM5 A;  3P1H A;  2K5W A;  1VQA A;  3BU2 A;  2IWH A;  5JEA G;  4JI2 L;  1NE3 A;  2E75 C;  4QUC A;  1HA6 A;  5J1Z A;  1DOL A;  3BDC A;  2B63 B;  5DM7 3;  1JR0 D;  3LNN A;  3RUZ A;  1I50 H;  2A6E C;  4V19 0;  5JJL A;  2EZV A;  1T5E A;  1V43 A;  4KY5 A;  5C3W A;  3HKS A;  4ZUI A;  4BA1 I;  2EXZ A;  1LTI D;  3F1Z A;  1D1I A;  3OMG A;  3HOZ H;  2Q2T A;  3I4O A;  2VB2 X;  5F2D A;  4HIM A;  5C4X H;  1I50 B;  4BBS G;  2N88 A;  5CV9 A;  4X66 L;  3SK4 A;  4L5S A;  4J15 A;  5IYB H;  2CH4 A;  3VR3 A;  3P75 A;  3HOZ B;  1TS2 A;  3MXP A;  2JEA I;  5C4X B;  3PO3 H;  1WTP A;  3EFX D;  2NVT H;  1I5F A;  4X64 L;  4CDD C;  2OCE A;  2WIN B;  4IPH A;  2F0G A;  5LMN W;  4M1U B;  3NTI A;  4MNO A;  2OXP A;  3V96 A;  1BCP D;  3GTQ H;  1GJX A;  1E24 A;  3I4N H;  4L8J A;  3N6R A;  4GNX B;  3PO3 B;  2IPK D;  1YNJ D;  2NVT B;  4X64 Q;  3S24 A;  2EY1 A;  1U4M A;  2Z6K A;  1EYD A;  1W3S A;  3RN5 A;  1W2B A;  2NTS A;  2VXW A;  3A7L A;  4A3K G;  3TS2 A;  1J9O A;  3MZ5 A;  3GTQ B;  3I4N B;  1EUJ A;  4IPD A;  3S15 H;  3JAM i;  1I4R A;  5FO9 B;  3GTJ H;  1A6X A;  4A3D G;  5C44 H;  1CKM A;  2LY7 A;  3NEM A;  3C2P A;  2GA4 B;  3S1N H;  4BY7 G;  2SEB D;  2PMZ B;  1L1O A;  2F0V A;  3MEH A;  2L15 A;  1AE2 A;  4KD3 A;  3S15 B;  4GS3 A;  3J80 E;  2AUK A;  4DPG A;  1G51 A;  3GTJ B;  2IL8 A;  2CCZ A;  4WFN 3;  1V8Q A;  1Q3L A;  5C44 B;  4NXM L;  3TZD A;  4G57 A;  5I2Y A;  3S1N B;  1UEB A;  3M9B A;  2WB1 E;  2EPB A;  1SE8 A;  2YTY A;  1HUN A;  3K5M A;  1EQT A;  4ODG A;  5I2X A;  1EFI D;  1SNP A;  1T5X D;  4NXM Q;  4YY3 L;  2F0U A;  1IW7 C;  2WFW A;  4CGY B;  1GVP A;  5DEH A;  1PH6 A;  2ZJQ A;  1CHP D;  2A6H C;  1E2V A;  2F0L A;  1HCZ A;  2YTX A;  1CA6 A;  2WAC A;  3E3X A;  3CXC A;  1CM9 A;  1IKL A;  3KBG A;  3BDL A;  4K5W A;  2XRQ D;  2OF1 A;  4FP5 D;  4UAI A;  4NB3 A;  1HZA A;  4UP9 A;  4GNX A;  1VQF A;  2IX3 A;  4UY8 C;  4P71 A;  2NN6 I;  5KYI A;  1UE7 A;  5LL6 X;  1SNO A;  5CV5 A;  2KVM A;  2R92 H;  4ZQ3 A;  1ILP A;  1ASY A;  1RCV D;  1WTV A;  4FXK C;  1QB5 D;  3Q24 A;  2K05 A;  4PV1 C;  4EQN A;  2FIN B;  1UEA B;  4DAM A;  1Y1V H;  1YIJ A;  2F0O A;  3E9H A;  2KEE A;  4DR2 Q;  2EY5 A;  1O7Z A;  4DUZ L;  4B3R L;  3A74 A;  3FPP A;  2QIL A;  3A8I E;  3ERS X;  3G48 A;  5I6W A;  1Y1V B;  2Q2I A;  2QW7 A;  5I6Y A;  2CKZ B;  1LTR D;  4QUF A;  5FLM H;  4B3R Q;  2RHQ B;  4CHT B;  1RD9 D;  4A3M G;  3FHW A;  1HR0 Q;  4DV6 L;  5IOD A;  1X65 A;  1K73 C;  2FJ2 A;  4NP5 A;  1R4Q B;  2J4X A;  1H9R A;  1SYC A;  2Z1C A;  1G6P A;  3QB3 A;  1BCP F;  2F0I A;  3VA7 A;  2K01 A;  2K03 A;  2VNU D;  4F8M A;  1NCV A;  4DV6 Q;  2EY2 A;  1IW7 D;  4XT1 B;  4JG2 A;  2K50 A;  4DV7 Q;  5EJW A;  3DWQ A;  4LF8 L;  4OIK A;  5IY0 A;  2PQA B;  1KXL A;  2KEC A;  3IKJ A;  2K33 A;  3ERQ A;  4OWT B;  3M4O H;  5CC4 A;  4JK1 C;  5M3F H;  4LF8 Q;  3E6Z X;  3S16 H;  5HY6 A;  1B50 A;  1X32 A;  1SND A;  1T9H A;  3IL8 A;  1WTQ A;  1SYD A;  3A5Z B;  3MC0 B;  3M4O B;  5K36 H;  1SE4 A;  4JBJ A;  4OGQ C;  2LFN A;  5M3F B;  4GKJ L;  3S16 B;  3TBI B;  3J81 i;  5EQ0 A;  2RCF A;  5M9O A;  4LFA L;  1F77 A;  1OXX K;  1B9N A;  3JAM L;  1LTA D;  4O0A A;  5GQO A;  5JJI A;  2QCP X;  4B3T L;  1ZEQ X;  4OIJ A;  5CV4 A;  1PHJ A;  4C3J H;  4LFA Q;  3UDF A;  3HRZ C;  1I4Q A;  1U5K A;  3M4P A;  3J7Z C;  3D4W A;  5IP7 H;  5D3D A;  1VQP A;  4B3T Q;  1SDF A;  3NWS A;  3F2B A;  4TSS A;  1I6V C;  3CW2 C;  4C3J B;  4HJ9 A;  3BZC A;  2B2V A;  1CQV A;  1E2W A;  4IUP A;  3I4M G;  1K28 A;  1ML0 D;  1STN A;  2A74 C;  4JOI C;  1SYE A;  4L5Q A;  2EDG A;  2PQA A;  1HR0 W;  1KD1 C;  1A3T A;  1JOQ A;  3X3M A;  4PMW A;  1YVC A;  4R4T A;  4C3I H;  3FDT A;  3CMA A;  5EKI A;  1KRT A;  1RTN A;  2HT1 A;  1EIY B;  3J7A F;  4A3B H;  1CQF A;  1VF7 A;  2XNA C;  1Q90 A;  4PZ6 A;  2CQO A;  4N9T A;  1O80 A;  1SXT A;  4IFD H;  5KYL A;  4C3I B;  3RZD H;  3ND9 A;  2E74 C;  5CGK A;  4A3B B;  3ITP A;  2UXD L;  1PH5 A;  3LX0 A;  2PO4 A;  4A3G G;  2Z0S A;  3S9W A;  1XXG A;  4NPS A;  1AP0 A;  4IQZ A;  3V05 A;  1EWH A;  2AQ3 B;  1LV9 A;  2IHF A;  4HIK A;  3RZD B;  2F0J A;  5COR A;  3EA6 A;  5BN5 A;  3H15 A;  1PRT D;  3BYY B;  1HHV A;  1YI2 A;  3CAM A;  1JB7 A;  3L3O C;  1RDP D;  2FXQ A;  3DHQ A;  4DV4 L;  2UUA L;  3KFU A;  2Q2H A;  3U50 C;  2B2Y C;  3VYR A;  1CA5 A;  4EQ5 A;  4YCU A;  1V1O A;  1A3U A;  4A3F G;  2XIW A;  4DR4 L;  1N32 L;  1WFQ A;  2ICE C;  4DR7 Q;  3SR1 A;  4RWS C;  1LO5 D;  2NYZ D;  3BZK A;  3K80 C;  2UUA Q;  4YWL A;  3NPP A;  4JC0 A;  4DUY Q;  3K7A H;  3CRL C;  4BBR G;  1IHZ A;  3KF8 B;  3KF6 B;  1QNU A;  1N32 Q;  4DR4 Q;  2ASB A;  1STB A;  3PV0 A;  2AQ1 B;  5EAY A;  3KYH C;  4A75 A;  3K7A B;  4KHP Q;  2B8G A;  4AH6 A;  3L7Z C;  1N9W A;  3U9O A;  4XYO A;  4P74 A;  1VF5 C;  4ZUJ A;  3FMC A;  3KLR A;  3CC2 A;  2Y0S B;  4R8N A;  3N52 A;  1EIH A;  2PZU A;  3OTO L;  3RN2 A;  1VQL A;  1M8A A;  1G29 1;  3F2U A;  2ICI A;  1VQH A;  3CF5 A;  2R61 A;  1UWV A;  2EYM A;  3FVQ A;  3HG9 A;  1DM0 B;  2GN5 A;  1FR3 A;  3OTO Q;  3W3A A;  4HIO A;  2ZTD A;  3PUW A;  5I4D A;  4L63 B;  3OYY A;  3TP6 A;  4F88 A;  5IYD G;  1DGS A;  1X6O A;  4PZ8 A;  1JMC A;  4Y52 H;  1OXU A;  5IT9 c;  4J8Q A;  3SK6 A;  3TN2 A;  2HD3 A;  4ILW A;  3EBE A;  3L9A X;  3RZO H;  5HGQ A;  1FNW A;  1WOC A;  1LAB A;  3T53 B;  5EPK A;  4KJN A;  4A3C G;  4CDE C;  1XMQ L;  3CCJ A;  1HTP A;  5C4J B;  2EY6 A;  2YU9 H;  3ZYY X;  3KF8 A;  3RZO B;  3KF6 A;  4C1N I;  1TWA H;  4AIM A;  3J81 L;  1MD2 D;  2RKS A;  5EKK A;  2IY5 B;  1BVS A;  1TXY A;  4B3S L;  2OWO A;  4LF4 L;  4GN5 A;  3TZU A;  2YU9 B;  4Q0F A;  3D6C A;  1SSO A;  1XPU A;  4IO9 A;  4E6I A;  4HMJ A;  1PZI D;  1EIG A;  3BVZ A;  2JK8 A;  3TP5 A;  1TWA B;  2NZO A;  1CI3 M;  1YHB A;  1SYB A;  5KGU A;  4H44 C;  3CD6 A;  4B3S Q;  4LF4 Q;  4P72 A;  5DLQ E;  3JC6 6;  2ATW A;  1BOS A;  3GTL H;  3HOY G;  5JAV A;  2WKC A;  5CR3 A;  1VQJ A;  2NUC A;  1LT4 D;  3M4Q A;  5ELB A;  4H02 A;  1SNM A;  3MXG A;  4G4K A;  4A3E G;  5FO8 B;  3M4Y A;  1YNX A;  4CKE A;  2EJG C;  5EPL A;  3GTL B;  5L37 A;  1A0I A;  3ULL A;  3G6J B;  3I8Z A;  4EGV A;  2A1A A;  2N78 A;  2N3S A;  1TWH H;  1J6Q A;  2M00 A;  1LTB D;  4LAA A;  1PRT F;  1U0L A;  4N8X 1;  1N34 L;  1FD7 D;  1RIP A;  5IP9 H;  1LT5 D;  5IGD A;  2VL6 A;  5C0X I;  1XPR A;  3GV3 A;  1TT2 A;  5AFW A;  1B7Y B;  1TWH B;  1HH2 P;  2WP8 J;  3KOJ A;  2RBM A;  3L2P A;  3C46 A;  2B63 G;  1N34 Q;  1EY7 A;  2LMC B;  1G8Z D;  1KLU D;  3G71 A;  3KDF B;  1TQO A;  2JXM B;  4OXP A;  1NR2 A;  4JI8 L;  1GD7 A;  3CKI B; 
#chains in the Genus database with same CATH homology
 3GQB A;  1VMP A;  1HPC A;  4PMB A;  2EYP A;  1TU2 B;  2KUM A;  2LS0 1;  2NZ1 D;  1EZ8 A;  2L0C A;  4ZYS A;  5KEE A;  2FMM A;  1G2T A;  5LHY 1;  3E5S A;  1JWM D;  2WAQ B;  1I4H A;  1R4P B;  4RCO A;  2O5J C;  1WTX A;  2Z4H A;  1SEB D;  1FNU A;  2BOS A;  2HDL A;  1ICW A;  2EVB A;  3HGB A;  5IGC A;  1L0X B;  4GZY C;  1YNJ C;  4O1N A;  1TY0 A;  3GTO B;  2F0K A;  3DWP A;  4KY6 A;  2BDO A;  1HFN A;  3Q22 A;  5IGG A;  4OO1 H;  2KQ3 A;  4K8I A;  3BG3 A;  3PUY A;  3R3O A;  3QJY A;  4I7Z C;  4CKC A;  2EE1 A;  1DJR D;  1ONL A;  3QOJ A;  5EBC A;  4BS9 A;  1A3V A;  1ET6 A;  3QWN A;  2F0T A;  5T1G A;  3NHH A;  3P7J A;  4RGM A;  4QIW B;  2B2T C;  4OHJ A;  3K5L A;  1TR5 A;  2SNM A;  1G2S A;  1MBY A;  3UI2 A;  4J6H A;  2MGS A;  1SE2 A;  3NQI A;  2F3W A;  5CMD A;  2IT1 A;  1JIC A;  4RGO S;  1IYU A;  3BS1 A;  2NVY B;  2BE5 C;  4HMI A;  3JAM E;  2ZXP A;  5JPM C;  2H1E A;  4XT3 B;  3RD4 A;  3HOW B;  1B9M A;  4XQJ A;  2JA7 B;  3TSS A;  3MHB A;  3T51 B;  1F9Q A;  5EKL A;  4DAV A;  4ZKB B;  1LTS D;  3VYT A;  4PNY A;  4A93 B;  1QWY A;  2B2U C;  4R8I A;  2DNC A;  4LJZ C;  3NTK A;  1RHP A;  4M8A A;  1LTT D;  5EGT A;  3CQZ B;  4KY7 A;  2HDM A;  3RLF A;  1PFM A;  1XYI A;  4X3S A;  4BWG B;  1ET9 A;  5I9P A;  4K5X A;  1SJH D;  4WOR A;  4DGZ A;  3R8B A;  1B2T A;  4X3K A;  2RDF A;  4CJ0 B;  1EEF D;  3J7Y W;  1EYC A;  2F0N A;  4XXE A;  1ENA A;  2JA5 B;  4NKL A;  2K6A A;  1LTG D;  1TWF B;  3SDZ A;  4DXG A;  5ELF A;  2K7V A;  3WDN A;  4A3I B;  2M9V A;  1EYA A;  2G9D A;  2BA0 A;  4EVO A;  2SNS A;  3DMU A;  2C5C A;  3E0J A;  4FF2 A;  2BE5 D;  4K6D A;  5FLX L;  1AZP A;  4KKS A;  1EY8 A;  2HQE A;  5E4X A;  4AYB B;  2JE6 I;  2G9H D;  2JSO A;  5K36 G;  2K5D A;  3H6M A;  2RVL A;  3PIP 3;  2JP1 A;  3I90 A;  1OO9 B;  5CV6 A;  5KIX A;  1GUN A;  2AUJ D;  4DN4 M;  1D2B A;  1R9T B;  3HOU B;  4IUR A;  4DF7 A;  2R92 B;  3TME A;  4C3J G;  4RKB A;  1ENC A;  2B2Y A;  4OL7 A;  4RAU C;  1PYW D;  1ESF A;  5CBE E;  1TS5 A;  1DD2 A;  4FXG C;  1EL0 A;  3BDO A;  2ZXO A;  1TVX A;  3PMF A;  1KTK A;  2J7Z A;  1JE4 A;  2SDF A;  1JOO A;  4F87 A;  2RSN A;  2WII B;  4C3I G;  1B53 A;  5C5M A;  3S2H B;  4WJW A;  4DNT B;  4FF3 A;  3J81 E;  1JB3 A;  1Y8N B;  3W2D A;  1LAC A;  4IFD G;  2E2J B;  4K14 A;  1B1Z A;  2HCI A;  4F7X A;  2JA6 B;  1JQY D;  3KLS A;  4BY7 B;  2AWN A;  3GP7 A;  1LT3 D;  3KBX A;  4K6L A;  2D62 A;  1BR9 A;  1PRT C;  3CU7 A;  4DA2 A;  2H4O A;  3IFD A;  3A54 A;  2FHT A;  2VB3 X;  2EJF C;  1I4P A;  3MVV A;  5EPJ A;  4IN3 A;  2EYL A;  3PIO 3;  1XX8 A;  1ZYR D;  2HCC A;  1QG7 A;  5CV7 A;  3C1F A;  4FYD A;  4TKO B;  1Y8O B;  4X3T A;  2EYO A;  2WV6 D;  3CRK C;  5ELE A;  3D4R A;  1GHJ A;  2A69 C;  3FEW X;  3K59 A;  3OHX C;  1EZ6 A;  2AWO A;  2KCN A;  1JCK B;  4B9W A;  2QEJ C;  5A2Q L;  1E0B A;  1D1K A;  3KLS X;  1F2Y A;  4B9X A;  3OWE B;  5HUR A;  1Q1E A;  3IFT A;  3ERO A;  5JVH 3;  2F3V A;  1RF2 D;  1K83 B;  4IUV A;  1A2T A;  1JOK A;  3SEB A;  2WKD A;  3K57 A;  3SXH A;  1BCP B;  4KHZ A;  4HED A;  3AB9 A;  5JEA J;  1IKM A;  3PUZ A;  4DU9 A;  4HR7 B;  3FKI B;  1KAB A;  2NN6 H;  2F0S A;  5IOC A;  4IUT A;  1BQQ T;  3EJI A;  1O7L A;  3TP7 A;  1S5F D;  1ESR A;  3OPO A;  2KJX A;  2L11 A;  1V1P B;  5C3E B;  4KD4 A;  3FRP B;  3S1R B;  3SK5 A;  3GTM B;  1CZG A;  2PYK A;  1D5X C;  2KOL A;  2A69 D;  4CJ1 B;  2PNR C;  3GO5 A;  5T1I A;  3OWF A;  2JEB I;  2R93 B;  3AMU A;  4ZRZ A;  2JA8 B;  3A8J E;  1MI2 A;  1SYF A;  2NVX B;  2DNE A;  4C3H B;  2B39 A;  2M2L A;  1MSG A;  2NVQ B;  3MFG A;  2OEO A;  2F0H A;  1XWE A;  4J1M A;  2XWJ B;  2RQX A;  1EY0 A;  2X69 A;  4KKU A;  3H09 A;  2NTT A;  1V1P A;  3O13 A;  4V0B A;  4L6T B;  5FOB B;  2QKI C;  4G7O C;  2R6G A;  3D3R A;  4XDX A;  2F0W A;  2R3Z A;  5ISR A;  2B2T A;  3S1M B;  3SVM A;  5M5X B;  1SBB B;  4ABN A;  5DM6 3;  3DM1 A;  2XN9 C;  2PZT A;  2XVS A;  2LKV A;  4MIU A;  1NAP A;  2I46 A;  1QIL A;  4KN4 C;  4IAL A;  5CBA E;  5E3F A;  3I91 A;  3QIA A;  3OIP A;  5BN4 A;  4U68 A;  3V2T A;  1WVL A;  1BF4 A;  4B08 A;  3HEJ A;  1ZKO A;  2PPB C;  3I72 A;  4Q5V A;  4G7H C;  1ILQ A;  2KCC A;  5D65 A;  1U4R A;  1Y69 U;  1BDO A;  1WD0 A;  4KV6 A;  1WCM B;  2D2C C;  2OT2 A;  2X6L A;  1U4L A;  4PMC A;  1JWU D;  4OO1 G;  4KTA A;  1SJE D;  3M7N A;  1SMY D;  4PQX A;  1CK1 A;  2B2V C;  1S5C D;  4IUQ A;  2IX1 A;  2B2U A;  3GD7 A;  1C48 A;  3NXW A;  2WB1 B;  4FF4 A;  4FXD A;  3S17 B;  1KAA A;  5IIF A;  5FLX E;  4ID6 A;  1GUT A;  2IW3 A;  3EVQ A;  2RA4 A;  4RCN A;  5JPN C;  1KNE A;  2O4X A;  4MN3 A;  1TWC B;  4KK7 A;  1LLR D;  2F0E A;  1CHQ D;  1O7Y A;  3C3L A;  3SK8 A;  1CTM A;  4HSP A;  5KRU A;  3S2D B;  2EOT A;  1HQR D;  2F0D A;  3J7A V;  1PLF A;  5M5Y B;  3OW7 A;  3NQT A;  1QJO A;  1BBX C;  2X6G A;  1AFP A;  4P2C B;  5C5L A;  3MXN A;  1DXM A;  2BDN A;  1S4Z A;  4A3J B;  3P20 A;  2F0M A;  4K2L A;  1B44 D;  1BUV T;  2IJ0 A;  2Q8I B;  3S14 B;  1G6Z A;  2MUY A;  1Z7T A;  2L55 A;  2F1M A;  1F2M A;  3NBH A;  2D5D A;  4HSV A;  2L5T A;  4K8J A;  4DK0 A;  4RGT A;  3C1E A;  1U9R A;  5DNF A;  1A15 A;  1SAP A;  1EU4 A;  4ZK9 B;  1DON A;  1D5Z C;  1PRT B;  1F9S A;  3OIQ A;  3QOL A;  2QDB A;  2RSO A;  3Q23 A;  3LWU A;  2R7Z B;  1KLG D;  1SYG A;  2PW5 A;  1PDQ A;  1PTO C;  1PMR A;  3HOV B;  5KNC A;  1TS4 A;  1WD1 A;  3A7A B;  2C9O A;  4Y7N B;  3T16 A;  5HGT A;  1WTW A;  1F2Z A;  2E2I B;  3OSO A;  5ELD A;  3GV6 A;  2YYZ A;  1EQV A;  4DNR B;  1HUM A;  2L12 A;  2EYJ A;  3MFY A;  2DY8 A;  3LWE A;  4N9P A;  4KI0 A;  3EQL C;  1I4X A;  1HFG A;  1L0Y B;  5A2Q E;  5E4W C;  2NWG A;  3MWY W;  1H9S B;  3M3Y B;  3R2T A;  3M7G A;  3PO2 B;  2E2H B;  3VYS A;  2V4D A;  2Q8T A;  5FO7 B;  1F9P A;  1DOK A;  1Q1B A;  1X3Q A;  5C0X H;  2A68 C;  1MGS A;  2Z4I A;  1AN8 A;  1NUC A;  1QOH A;  2K04 A;  4QCL A;  2TMP A;  2XWB B;  4HCS A;  4BA2 I;  2MPM A;  5NUC A;  1C4Q A;  1B4O A;  3S1Q B;  5IT9 L;  2KHS A;  4CJ2 C;  4BY1 B;  1ZXT A;  2A73 B;  1IL8 A;  4DAP A;  2VUM B;  2FFK B;  2ZXR A;  3H3V C;  5LL6 S;  1PTO D;  4JBW A;  4XYQ A;  4DFA A;  1IYV A;  2Q8R E;  3NK9 A;  2O5I C;  5M3M B;  1H9S A;  4ZAI A;  3WOE A;  1XTC D;  2AQ2 B;  3H0G B;  2J0T D;  1JOR A;  2BA1 A;  1S5E D;  4KHV A;  5JEA H;  3R2I A;  4G7Z C;  2A6E D;  4IFD I;  1I4G A;  1OXT A;  4KJO A;  1ZYR C;  4RGN A;  4DXF A;  3VR5 A;  1BXT A;  3CHB D;  3U9S A;  5KND A;  4RH6 A;  4K5V A;  1TWG B;  5M5W B;  3H91 A;  2B2W C;  4RKL A;  5FK9 C;  2MP1 A;  2K28 A;  4BBS B;  2A68 D;  2CVR A;  1SFO B;  1H9M A;  1CFM A;  1ENF A;  3NBI A;  3HS0 C;  3DWA A;  1FNV A;  2TSS A;  4C2M B;  1NR4 A;  3WOF A;  4YIJ A;  1F9R A;  3K5N A;  4TRD A;  1EOT A;  3PUV A;  5CV8 A;  2PQE A;  4C56 C;  2HUG A;  2F4I A;  2F0P A;  1KNA A;  2DY7 A;  3NP8 A;  3M85 A;  4A3K B;  2I07 B;  4KN7 C;  3I70 A;  5IGE A;  1HXY D;  4QMG A;  4A3D B;  4LMQ D;  5CYU A;  5C4H A;  4IUN A;  3FPU B;  2NN6 G;  4NDX A;  3DUZ A;  3BZD B;  4TQU S;  1EY5 A;  4S3S A;  1I3Q B;  3K58 A;  1PFB A;  4O42 A;  2JYO A;  2FMC A;  1UUP A;  4RHS A;  2A6H D;  5C6A A;  1PZK D;  2D9U A;  2XRS D;  1QNK A;  2K32 A;  3K0Y A;  1U4P A;  1FYC A;  1GUO A;  1DCZ A;  4RFB A;  3NTH A;  3R93 A;  3D4D A;  3I3C A;  5C0X J;  1OXV A;  1RTO A;  1PTO F;  4MHE A;  4XQN A;  4C3H G;  1S5B D;  3HOX B;  1JC7 A;  1UAP A;  1HQM C;  2BCO A;  5D3I B;  1DYQ A;  4FVM A;  3VR4 A;  2EYF A;  4I65 A;  3VR2 A;  1D5M C;  1STE A;  1NSN S;  4FO2 A;  4ME5 A;  4IZ8 A;  4X3U A;  3HP3 A;  1A2U A;  1W6J A;  1EWC A;  1STA A;  1STG A;  1GUG A;  1II3 A;  1BNZ A;  5C3X A;  5IGF A;  2KA7 A;  2IX0 A;  3VR6 A;  2ENB A;  3G7L A;  2K1B A;  1STH A;  3OOC A;  3Q0A A;  2K5Q A;  3NUC A;  1EEI D;  1HRJ A;  4CBV A;  4KMU C;  1EU3 A;  1J8I A;  5JOB A;  4EQP A;  3A8K E;  4XQQ A;  1QCB D;  4A3M B;  1Q8I A;  2RDG A;  5KNB A;  5IGB A;  2CHB D;  3K6O A;  3J80 L;  1VMC A;  2MJ8 A;  2F03 A;  1KDA A;  3ONA B;  5K5P A;  5COY A;  4LK1 C;  1X3P A;  4R9W A;  1PTO H;  3BYT B;  5TSS A;  2ID0 A;  2L1B A;  2NBF A;  1QE6 A;  4UDU C;  4K2K A;  4NMZ A;  2Z8L A;  1PTO B;  3H94 A;  5J22 A;  1SE3 A;  1SMY C;  1B3A A;  1Z47 A;  4XTC S;  1HTL D;  2PZW A;  1RJT A;  1OXS C;  3A55 A;  1TY2 A;  1Y1W B;  1VDZ A;  3HKZ B;  1F2L A;  2F0Q A;  3I73 A;  5DAU A;  4WRD A;  5G3L D;  1CT1 D;  4HN7 A;  3RMH A;  2DN8 A;  2MHV A;  1E2Z A;  1GOZ A;  1GXD C;  4XIG S;  3KUP A;  2PW7 A;  3GTP B;  4NW2 A;  4H13 C;  2CW0 C;  5J39 A;  3BVM A;  2QF7 A;  2E2D C;  4OO1 I;  1W6K A;  1K8O A;  1TS3 A;  3D31 A;  4H7B A;  3DEP A;  1H9K A;  3I4M B;  1Q12 A;  5EBD A;  2PCF B;  3MTS A;  4QF4 A;  1KDB A;  4Z9C B;  3VYU A;  5ELC A;  5FKA C;  1K8M A;  2CQA A;  3DXJ C;  1EY9 A;  3T56 B;  3GTK B;  3AU7 A;  4IUU A;  3QG1 A;  1CZW A;  3DEO A;  1EY6 A;  2KED A;  4A3G B;  5IT9 E;  3TP8 A;  4FF1 A;  1SNQ A;  5I9O A;  1M4V A;  3TDQ A;  3MA2 B;  1C8C A;  3X3N A;  4CKB A;  1PZJ D;  2A5H A;  1ROD A;  5A35 A;  1GUS A;  4DAY A;  1Y8P B;  4DK1 A;  2L9H A;  3MAQ A;  4RHR A;  1WTR A;  3OMC A;  3T4A C;  4ZKC B;  4A3F B;  2RDH A;  5D14 A;  4EQO A;  3A56 A;  4BBR B;  4U67 3;  1UNS A;  1AZQ A;  2NB0 A;  1DOM A;  3VA5 A;  1YNN C;  3ND8 A;  5C4Z A;  2CW0 D;  4C1N K;  1VCI A;  3NWT A;  4QB4 A;  2F0F A;  1AEX A;  1H9J A;  1RKN A;  1FGB D;  4IFD J;  2EYH A;  2EJM A;  4HTH A;  2ZT9 C;  1Z6H A;  1DZ1 A;  1KDC A;  4FNF A;  1GHK A;  1PXU A;  3Q6S A;  1WTO A;  3T13 A;  4RA8 A;  1D6E C;  2O2L D;  3URY A;  3IAY A;  5G3L F;  2SOB A;  3NE5 B;  3MXU A;  3PUX A;  3GTG B;  4H0L C;  1S5D D;  2L4N A;  4ZLT F;  4KKT A;  1MSH A;  3HZX A;  1TKW B;  1JWS D;  3QO2 A;  3SE0 A;  1GUW A;  2B8F A;  5BN3 A;  3BVG A;  3K5O A;  5C0X G;  5E1F A;  5JJZ A;  2N55 A;  1BCP C;  2E76 C;  1EY4 A;  3NSW A;  1O78 A;  1I6H B;  3D6W A;  5JVG 3;  4HAE A;  1STY A;  4ULL A;  3KK7 A;  3I4L A;  3HOY B;  2B2W A;  1PFN A;  1YNN D;  1BO0 A;  1TII D;  4A3E B;  1G91 A;  1LT6 D;  3SHL A;  2XSC A;  1HA5 A;  3D8G A;  4HCE A;  1SNC A;  1AW7 A;  3P1H A;  2K5W A;  2IWH A;  5JEA G;  2E75 C;  4QUC A;  1HA6 A;  5J1Z A;  1DOL A;  3BDC A;  2B63 B;  5DM7 3;  1JR0 D;  3LNN A;  3RUZ A;  2A6E C;  4V19 0;  2EZV A;  1T5E A;  1V43 A;  4KY5 A;  5C3W A;  4ZUI A;  4BA1 I;  2EXZ A;  1LTI D;  1D1I A;  3OMG A;  2VB2 X;  5F2D A;  1I50 B;  2N88 A;  5CV9 A;  3SK4 A;  3HOZ B;  3VR3 A;  3P75 A;  1TS2 A;  3MXP A;  2JEA I;  5C4X B;  1WTP A;  3EFX D;  2WIN B;  2F0G A;  4M1U B;  3NTI A;  2OXP A;  3V96 A;  1BCP D;  1GJX A;  4L8J A;  3N6R A;  3PO3 B;  2IPK D;  1YNJ D;  2NVT B;  2EY1 A;  1U4M A;  1EYD A;  2NTS A;  2VXW A;  3A7L A;  1J9O A;  3MZ5 A;  3GTQ B;  3I4N B;  1I4R A;  5FO9 B;  1A6X A;  2LY7 A;  3C2P A;  2GA4 B;  2SEB D;  2PMZ B;  2F0V A;  3MEH A;  4KD3 A;  3S15 B;  3J80 E;  2AUK A;  3GTJ B;  2IL8 A;  4WFN 3;  1V8Q A;  1Q3L A;  5C44 B;  3TZD A;  4G57 A;  5I2Y A;  3S1N B;  2EPB A;  1HUN A;  3K5M A;  1EQT A;  4ODG A;  5I2X A;  1EFI D;  1SNP A;  1T5X D;  2F0U A;  1IW7 C;  4CGY B;  5DEH A;  1CHP D;  2A6H C;  1E2V A;  2F0L A;  1HCZ A;  1CA6 A;  2WAC A;  1CM9 A;  1IKL A;  3KBG A;  3BDL A;  4K5W A;  2XRQ D;  2OF1 A;  4FP5 D;  4UAI A;  2IX3 A;  2NN6 I;  5KYI A;  5LL6 X;  1SNO A;  5CV5 A;  2KVM A;  4ZQ3 A;  1ILP A;  1RCV D;  1WTV A;  4FXK C;  1QB5 D;  3Q24 A;  2K05 A;  4PV1 C;  4EQN A;  2FIN B;  1UEA B;  2F0O A;  2KEE A;  2EY5 A;  1O7Z A;  3FPP A;  2QIL A;  3A8I E;  5I6W A;  1Y1V B;  5I6Y A;  1LTR D;  4QUF A;  4CHT B;  1RD9 D;  5IOD A;  2FJ2 A;  4NP5 A;  1R4Q B;  2J4X A;  1H9R A;  1SYC A;  2Z1C A;  3QB3 A;  1BCP F;  2F0I A;  3VA7 A;  2K01 A;  2K03 A;  2VNU D;  4F8M A;  1NCV A;  2EY2 A;  1IW7 D;  4XT1 B;  5EJW A;  3DWQ A;  4OIK A;  2KEC A;  3IKJ A;  2K33 A;  3ERQ A;  5CC4 A;  4JK1 C;  3E6Z X;  1B50 A;  1X32 A;  1SND A;  3IL8 A;  1WTQ A;  1SYD A;  3MC0 B;  3M4O B;  5K36 H;  1SE4 A;  4OGQ C;  5M3F B;  2LFN A;  3S16 B;  3TBI B;  5EQ0 A;  5M9O A;  1F77 A;  1OXX K;  1B9N A;  3JAM L;  1LTA D;  2QCP X;  1ZEQ X;  4OIJ A;  5CV4 A;  3HRZ C;  1I4Q A;  3D4W A;  5D3D A;  1SDF A;  3NWS A;  4TSS A;  1I6V C;  4C3J B;  2B2V A;  1CQV A;  1E2W A;  4IUP A;  1ML0 D;  1STN A;  2A74 C;  1SYE A;  2EDG A;  1A3T A;  1JOQ A;  3X3M A;  4PMW A;  3FDT A;  5EKI A;  1RTN A;  3J7A F;  1CQF A;  1VF7 A;  2XNA C;  1Q90 A;  4N9T A;  1O80 A;  1SXT A;  4IFD H;  5KYL A;  4C3I B;  3ND9 A;  2E74 C;  5CGK A;  4A3B B;  3ITP A;  3LX0 A;  2PO4 A;  3S9W A;  1XXG A;  1AP0 A;  4IQZ A;  3V05 A;  1EWH A;  2AQ3 B;  1LV9 A;  3RZD B;  2F0J A;  5COR A;  3EA6 A;  5BN5 A;  1PRT D;  3BYY B;  1HHV A;  3L3O C;  1RDP D;  3DHQ A;  3VYR A;  2B2Y C;  1CA5 A;  1V1O A;  1A3U A;  2XIW A;  2ICE C;  3SR1 A;  4RWS C;  1LO5 D;  2NYZ D;  3NPP A;  3CRL C;  1IHZ A;  1QNU A;  1STB A;  3PV0 A;  2AQ1 B;  3K7A B;  2B8G A;  3L7Z C;  3U9O A;  4XYO A;  1VF5 C;  4ZUJ A;  3FMC A;  3KLR A;  2Y0S B;  4R8N A;  3N52 A;  1EIH A;  2PZU A;  1M8A A;  1G29 1;  3F2U A;  2ICI A;  2R61 A;  2EYM A;  3FVQ A;  3HG9 A;  1DM0 B;  1FR3 A;  3W3A A;  3PUW A;  5I4D A;  4L63 B;  3TP6 A;  4F88 A;  1OXU A;  4J8Q A;  3SK6 A;  3TN2 A;  4ILW A;  3L9A X;  1FNW A;  1LAB A;  3T53 B;  5EPK A;  4KJN A;  1HTP A;  5C4J B;  2EY6 A;  3ZYY X;  3KF8 A;  3RZO B;  4C1N I;  3J81 L;  1MD2 D;  2RKS A;  5EKK A;  3TZU A;  2YU9 B;  4Q0F A;  3D6C A;  1SSO A;  4E6I A;  4HMJ A;  1PZI D;  1EIG A;  3BVZ A;  3TP5 A;  1TWA B;  1CI3 M;  1SYB A;  5KGU A;  4H44 C;  1BOS A;  5JAV A;  2WKC A;  5CR3 A;  2NUC A;  1LT4 D;  5ELB A;  1SNM A;  3MXG A;  4G4K A;  5FO8 B;  3M4Y A;  4CKE A;  2EJG C;  5EPL A;  3GTL B;  3G6J B;  3I8Z A;  4EGV A;  2M00 A;  1LTB D;  4LAA A;  1PRT F;  1FD7 D;  1LT5 D;  5IGD A;  5C0X I;  3GV3 A;  1TT2 A;  5AFW A;  1TWH B;  2WP8 J;  2RBM A;  3C46 A;  1EY7 A;  2LMC B;  1G8Z D;  1KLU D;  1TQO A;  2JXM B;  1NR2 A;  3CKI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...