1KDAA

Stabilization of a strained protein loop conformation through protein engineering
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYDPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stabilization of a strained protein loop conformation through protein engineering.
pubmed rcsb
source organism Staphylococcus aureus
total genus 39
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kdaA00
1TR5A 3MZ5A 4KD4A 3C1FA 1EZ8A 1RKNA 1SNCA 2F0IA 3P1HA 5KEEA 2OEOA 2F0SA 4NP5A 5IGGA 1IHZA 4NKLA 4DGZA 4KJNA 3EVQA 2EYHA 3NUCA 2F0QA 1F2MA 1SYFA 4N9PA 4RKBA 1TT2A 2F0TA 2PZWA 5EKLA 3HZXA 3OWFA 3QOLA 4NMZA 2PYKA 3D4WA 3SHLA 4ZUJA 1ENCA 1EY5A 4DU9A 5IGEA 3MHBA 2LKVA 2PZTA 4ME5A 3TP6A 1STNA 4K14A 3LX0A 5IGBA 2RBMA 2F0HA 5E1FA 1KABA 2F0LA 1KDCA 3D4DA 5JOBA 5C3XA 3VA5A 3P75A 3EROA 3OMGA 5KGUA 2F0VA 5DEHA 4YIJA 4K5VA 2F0DA 3NP8A 5ISRA 5IGFA 4ODGA 4K2KA 3ERQA 4K2LA 4QF4A 4KD3A 1SYEA 2SNSA 5EKKA 2PW5A 3RUZA 4E6IA 2F0EA 4EQOA 1EY4A 4HTHA 1SNOA 1II3A 2EYOA 3OMCA 5C5LA 2EY1A 3MEHA 4WRDA 4F7XA 5KIXA 4PMCA 1NUCA 1EYCA 1EZ6A 1JORA 2EXZA 3NXWA 5CC4A 1ENAA 1STHA 2F0KA 3QOJA 4N9TA 4ZQ3A 5HURA 5DAUA 4KV6A 3DHQA 3H6MA 4MIUA 4HMJA 3SK8A 2RDFA 1EY6A 4OL7A 4EVOA 5IODA 4ZUIA 5CV9A 2O4XA 5CV6A 4RKLA 5CV7A 3SK6A 3TP8A 5KYLA 1EY8A 1A2UA 3U9OA 3D8GA 2SNMA 2EY2A 3QB3A 4IALA 5F2DA 3T13A 2F0JA 3OSOA 5J39A 3BDCA 4KY5A 5IGDA 4K6DA 5IGCA 3MXPA 1STYA 5KRUA 2PZUA 1SYGA 1STGA 1STBA 2F0GA 2F0UA 1EY0A 3EJIA 4K5XA 5CR3A 3E5SA 1A3VA 3MVVA 1JOKA 1SYBA 1SYCA 2PQEA 4I65A 5CV5A 4QB4A 5C3WA 5K5PA 4J1MA 3T16A 2EYLA 1EY9A 2F3VA 5J22A 1KAAA 2NUCA 5IOCA 3SK5A 3D6CA 5JAVA 4WORA 3BDLA 4EQNA 1EY7A 4KY6A 1A2TA 2WACA 2F0OA 1SNDA 3TMEA 5CGKA 1JOQA 2EYPA 1NSNS 1EYAA 4LAAA 4PNYA 5IIFA 5CV8A 4DFAA 2SOBA 1SYDA 4IZ8A 4HMIA 2F0WA 3C1EA 4NDXA 4R8NA 1SNPA 3TP7A 3SR1A 2KQ3A 2F0FA 1AEXA 4PMBA 4S3SA 4B9WA 1KDBA 4KTAA 4B9XA 1SNQA 2QDBA 4J6HA 4K5WA 3S9WA 4TRDA 3HEJA 4F8MA 5I6YA 1EQVA 3NHHA 3NQTA 5I6WA 2M00A 3SXHA 1SNMA 1EYDA 5C4ZA 3NK9A 3SK4A 2F0NA 1TQOA 4K8IA 1F2ZA 4K8JA 5C5MA 4EQPA 2F3WA 2F0MA 2PW7A 5HGTA 4IUNA 1A3UA 3R3OA 2OXPA 4ID6A 4KY7A 5KYIA 5NUCA 4QMGA 2HQEA 3PMFA 4KJOA 1F2YA 4G57A 4KHVA 2EYJA 1A3TA 5CV4A 5I9OA 1STAA 2EYFA 2EY6A 2F0PA 5E3FA 1U9RA 2EYMA 5EGTA 4DF7A 2EY5A 2OF1A 5M9OA 5C6AA 2RKSA 2ENBA 1KDAA 4H7BA 3V2TA 5I9PA 5C4HA 3DMUA 5J1ZA 2KHSA 1JOOA 3ITPA 3TP5A
chains in the Genus database with same CATH superfamily
3BS1A 1L1OB 2JA9A 2KVMA 1WTWA 1AN8A 3FHWA 5A35A 3OYYA 3N52A 2JA8H 1IL2A 3D4WA 1HQRD 1JB3A 3H94A 2JA8B 4ZAIA 1HCZA 4JBKA 2WB1E 4A75A 2EJMA 4XT1B 4FF4A 2F0VA 1PZKD 3MFGA 3PIO3 2PCFB 2F0DA 2RF4A 3A54A 5M3FG 1PDQA 3GQBA 3Q8DA 5K36G 1SR3A 5EKKA 4LF4L 4RA8A 3C3LA 4XIGS 4F7XA 2EY1A 1B4OA 1EYCA 4UP7A 4MNOA 3TDQA 1Q90A 3CCEA 1SLJA 1TWHH 4JI3L 1VQDA 1GUNA 4R4IA 4ZUIA 3ULJA 1TWHB 3X3NA 2MGSA 2KBNA 3U9OA 3I3CA 2SNMA 1PH6A 5J39A 3RLNA 1MKHA 3T56B 5C4XH 1G291 1KQSA 4OO1H 1HTLD 3TREA 3TP5A 3HOXH 4APVA 1UWVA 1ESFA 1QVCA 5CV5A 1YNXA 3HOXB 2FHTA 1RCVD 2TMPA 1GUWA 2LXJA 3I4MH 1HR0Q 2KCCA 4GOPA 3MXUA 1CK1A 4R4TA 2AQ1B 1W3SA 2NVYH 3DEPA 4GNXC 1NR4A 4LAAA 1N32L 4DAYA 1SYDA 2NVYB 4IZ8A 4QY7A 5C0XJ 4B9XA 2EJGC 4J6HA 4JPBW 4TRDA 1XTDA 2I5MX 1EOTA 1VQKA 1PH1A 3K6OA 2OXPA 2VUMH 1X56A 4QMGA 4YWKA 2HQEA 1DOLA 3W1BA 2D9UA 2VUMB 1EFID 3PO3H 3NEMA 4CKEA 2NZOA 2IL8A 1TWGH 3EQLC 3PO3B 5JJZA 4IQZA 1TWGB 1XNRQ 3ZYYX 2FMMA 2K75A 3MAQA 1CI3M 2VQEQ 1Z6HA 2VZAA 5KNCA 4NKLA 2MO1A 2EYHA 2VNUD 2BA1A 1NE3A 4JI8Q 3HZXA 4NMZA 3V05A 4AYBE 4LWCA 1B3AA 3F2DA 3CCUA 3A5ZB 4DR1Q 1VCIA 2A74C 2B2TC 1I4RA 5FLXE 3OMGA 1J5EL 1SJED 4RHRA 4KHPL 2G9DA 1H9RA 5IGFA 1PH5A 2VQFL 3HOYG 3A7AB 3PF4A 4A3KG 1OO9B 4BBRB 1V43A 3HOUH 4QIWE 4YWLA 3MEHA 1HQMC 4CDDC 2TSSA 1LLRD 3HOUB 5JPNC 3NWTA 4DUZL 1IBMQ 5CC4A 2NYZD 1STHA 4N9TA 3E3XA 1CKNB 1D2BA 3BVMA 5IYCG 3G48A 3AYHB 4EVOA 1Y1VG 1M1KC 5IYBH 3U50C 1PV4A 1BF4A 3M4PA 4K6DA 2L9HA 4FNFA 5EPLA 3Q24A 2HCIA 1STBA 4C3IG 4DNIA 3MVVA 2HDMA 4LFBL 1ZYRD 1Q12A 1EEID 1EY9A 5M5XH 5C0XG 5J22A 5ELEA 5M5XB 3RN2A 5FLXL 2AKWB 1SEBD 4RHSA 2A6EC 4HJ5A 1EFWA 4YCUA 4GOPB 3S2HH 3KF6B 1GOZA 3G7LA 3VR5A 1M8AA 4R8NA 3S2HB 2C35B 2YTVA 2ZM6L 4JI6L 1HR0W 2HD3A 2J0TD 5COYA 4CJ2C 2F0NA 5C5MA 2F3WA 2Q2IA 4NXML 2MQHA 3L0OA 3PMFA 3PIP3 5D3IB 1DXMA 2Z1CA 4C3HH 2O5IC 5C3EH 1H9SA 4DR5L 2R7DA 3I72A 4C3HB 5ELCA 4OX9L 5C3EB 3KLWA 3K58A 2JN4A 4H7BA 2NB0A 2UUAQ 5FO7B 1U5KA 2CFMA 5CORA 1TWCH 3MZ5A 3IKJA 4RCNA 3T1HQ 1I4PA 1Q7YC 3K0YA 1FVIA 1S5FD 2F0SA 2MO0A 1TWCB 2OTLA 4KJNA 4N9PA 2A1AA 4P2CB 4RKBA 3LNNA 4X3UA 3H3VI 4ME5A 4RAUC 1YEZA 1SROA 2AUKA 4A3DG 3CF5A 5M3FH 3ND8A 5T1GA 5BR8Q 5K36H 1EIGA 5M3FB 1STEA 1SYEA 2E5LL 2BOSA 2B2WC 3K57A 3NENA 4GKJQ 4IUTA 4CGYB 1ENAA 1IBLQ 2KHIA 3OTOQ 3LWUA 5JPMC 2YYZA 1E1OA 3NPPA 4QL5A 5I2XA 5IE8A 1IBKL 4P73A 4WJ3M 4A3EG 1DONA 2KOLA 1C48A 4IALA 4DK0A 1B50A 1X6OA 4FYDA 3CMAA 4XYOA 4L63B 1CZWA 1JOKA 4DV7Q 1G6ZA 4X64Q 4YHHL 2F3VA 3L9AX 3R2IA 5JAVA 2C9OA 1EY7A 1A15A 1I6HH 4A3CG 1PFMA 2QKIC 3NTHA 4P71A 3GTPH 3FEWX 4PZ7A 1PH4A 1U4LA 3A0JA 3GTPB 3PUXA 1LYLA 1HRJA 2KEEA 1WTXA 4DR2L 3S17H 1I5FA 1W6JA 2JSOA 4DV5Q 1GHJA 3S17B 2ZXPA 1NNXA 2ZXRA 1XNQQ 2WAQE 3CCLA 3I91A 3AB9A 4IUNA 3CD6A 2IX3A 1D8LA 2EQSA 2PPBC 5IP9G 2J7ZA 4A3BG 2UXDQ 4NB3A 1UEBA 3SVMA 1H9SB 3MTSA 2ZT9C 2EJFC 5EPJA 2HCCA 4JI2Q 3M3YH 1N34Q 3GTKH 3NTIA 2F52A 2EVBA 3WDNA 3M3YB 3J7A5 2VXWA 2IX0A 1FD7D 1PH2A 4YCWA 4ZLTF 3UI2A 3FVQA 1VQ8A 1EQTA 1KHIA 1W2BA 3QOLA 2JA7G 2PYKA 2N55A 1KC8C 3DXJC 1AH9A 1HR0L 1TS3A 3RMHA 2F0LA 3D4DA 5ELDA 2J4XA 4DNTB 3CQZH 2E8GA 4L6TB 4IOAA 1CUKA 3HOYH 3DWPA 2NN6H 2L0CA 3CQZB 1L1OC 4G7HC 3HOYB 3DWQA 4A3KB 4KD3A 4R8IA 1N9WA 1GXDC 1SXTA 1YBYA 4LF6L 2JA5H 2CKZB 4CDEC 1YNJC 1QG7A 4GLAC 2B2UC 4HJ9A 2JA5B 3MC0B 1I4QA 3F2BA 3CW2C 1LTBD 4O0AA 4ZQ3A 5HURA 5DAUA 1Y1VH 5C44G 5ELNA 1EUJA 4MHEA 1Y1VB 3W5OA 2AQ3B 3HOVG 3UE0A 1PH7A 3JC66 4GZYC 1EY8A 4C3IH 2QCPX 4KY5A 1VQIA 2E76C 1STGA 4DU9A 4C3IB 3CXCA 2WB1G 1WD0A 1HJPA 2B2VC 4JC0A 4PZ8A 1DYQA 4B3TL 3EFXD 1SE3A 2PI2E 1GHKA 1D1IA 1BO0A 1PFNA 4JI8L 3KDFA 2OQKA 4HMIA 3TP8A 3U4VA 3RZOH 1JJCB 5TSSA 4B9WA 2F0FA 1PH8A 4KTAA 5GADC 1JT8A 3L3OC 1DM0B 4K5WA 3RZOB 2KENA 3GDEA 1Z7TA 2K32A 4U68A 2PQAB 4G4KA 1PYBA 5AFWA 1G2TA 4L5TA 1PMRA 2XWBB 4UP9A 4XXEA 3I4OA 2AWNA 1FYCA 1PVOA 2M9VA 2DGYA 1L0YB 3EIVA 1IBML 3UDXA 3OW7A 2OTJA 3MXGA 5JEAJ 1U4PA 5E3FA 1U9RA 3FRPB 3I4NG 5GAHC 4DAPA 1V9PA 4IJHA 1OXUA 5I9PA 2IT1A 5GAEC 1K8AC 1FNVA 1BNZA 5J1ZA 2UXBL 3A56A 2PMZB 3BYYB 5KEEA 1NCVA 2OEOA 5JVH3 1DGSA 3CRKC 4GN3B 4GLXA 1GJXA 2NVQH 3OWFA 1IYVA 5IGEA 1S3OA 2PZTA 1FR3A 3K5MA 2Z9HA 3I2ZA 1LTSD 1E3PA 4IUUA 2XSCA 3IL8A 3VYRA 4ME3A 1I4GA 3SEBA 4OEMB 4QGUA 2VB2X 4K2LA 1F9QA 1LACA 1VQPA 1FGBD 4LUZA 3S15H 5KIXA 1B44D 1YVCA 1KRTA 5ELBA 2M2LA 1EZ6A 1JORA 1Q1EA 2XVSA 2F0KA 4H44C 2RDHA 3CPWA 4IPCA 3TS0A 4A3EH 4OWXB 1WTHA 3SK8A 1L2FA 5IP7G 3I4LA 2O4XA 4A3MG 3IFDA 4A3EB 4AYBG 4UAIA 3GTOH 3MXPA 3NBHA 4XYQA 3TZDA 5EQ0A 3GTOB 4N8X1 2Z8LA 5K5PA 1VQAA 4J1MA 2UUAL 1TWAH 2GVBA 4M8AA 4NW2A 4HIMA 4K6LA 5IOCA 4A3CH 1TWAB 1XPUA 3BDLA 1WOCA 1LT3D 1ONLA 4PNYA 1V1PA 3J7ZC 2R93G 4DK1A 4NDXA 1KTKA 4R9WA 5HY6A 2WP8J 1TVXA 1Z47A 4R4CA 4A76A 3DLLA 2KA7A 2M00A 1D5ZC 2Z0SA 5JEAG 4EQPA 4BA2I 5HGTA 1AE3A 3CU7A 4KY7A 1UEAB 4X66Q 4C3JG 4GOPC 1F2YA 3RR5A 1CA6A 1WTQA 4KHVA 1BDOA 3BVGA 1JR0D 4LF9Q 4V190 1Q1BA 1RTNA 4JOIA 4A3BB 5M9OA 5C6AA 4X3SA 2RKSA 2CH4A 4V0BA 4WFN3 2Z4HA 1O7LA 1B8AA 1HNXQ 1JOOA 2B2YA 3RLOA 1ICWA 1BCPB 4IFDI 4NXNQ 5KNDA 5GQOA 3UDFA 1IW7C 1KL9A 4K14A 4F87A 2UXCQ 2RBMA 1VF7A 1TS5A 4DV0L 4DK3C 1QNKA 2A69C 1S5ED 4YIJA 1HZ9A 3I56A 1MJCA 3D0FA 3HFZB 4E6IA 1LTID 1QB5D 4JI1Q 4DV4Q 1NAPA 3GTLB 4DV5L 2BDOA 5FK9C 2Y0SE 1XNQL 1F2LA 5C44H 3S16B 5C44B 4FF1A 4FXGC 3BZCA 4HJ7A 4DR7L 4PZ6A 5CV6A 2BCOA 2QA4A 1YJNA 4CHTB 1IKMA 4O1NA 4OXPA 4KKSA 5IGCA 4X65L 1TS2A 2UXDL 1SYGA 1GO3E 4ZKBB 4LW1A 1A3VA 4I7ZC 2WB1B 3NBHB 2ZJQA 2OCEA 1KAAA 4Q0FA 1VQEA 4RMFA 4L8JA 5I2YA 5IYDG 4QCLA 2XIWA 3TN2A 1A2TA 1VQCA 1SNDA 3TMEA 5D3DA 1HFGA 4DFAA 1C7YA 2K5VA 4KI0A 3F2UA 4JVZA 1IW7D 1PFBA 2IX1A 4K0KQ 1GUGA 1ASYA 1KRSA 2X6LA 3BDOA 1P16A 1EIYB 1FJGQ 2A69D 4A3IH 3L2PA 1CM9A 2ICEC 4IUPA 5NUCA 4A3IB 1SE2A 2VW9A 1VQ7A 3S1RB 1D5XC 3H15A 1JMCA 1BUVT 3RNUA 2OT2A 3UDIA 4XQJA 1MBYA 2D0OA 1I4HA 1FGUA 3I4NH 1VQBA 2QEXA 3M4YA 2GA4B 3I4NB 3R8BA 2IPKD 4OO1I 1VDZA 3NSWA 3NTKA 3NELA 4JG2A 2XGTA 2I5LX 1VQ9A 2H1EA 2KJXA 1GD7A 1B1ZA 5G3LD 4DR6L 2F0TA 1G91A 3SHLA 2ZJRA 2WKDA 2N88A 4QUCA 3K5LA 2Z6KC 2WAQG 3AMUA 4JI7L 5DM73 3GP7A 3KOJA 1LT6D 1BKBA 1M90C 1E2WA 4U673 3NBIA 4EX5A 4CJ1B 1ZYRC 1JC7A 5ISRA 2L5TA 1F77A 1VQMA 3HOZG 3AU7A 4ALPA 3H0GG 3K8AA 1TKWB 3OMCA 4RGOS 1VMCA 2MNAA 3T1YQ 1WJJA 2R92G 5IP7H 3SDZA 1JWMD 4MIUA 2NVTB 2RDFA 2GN5A 5CV9A 5CV7A 3R93A 3BZKA 3HS0C 3CRLC 1U4RA 4AYBB 2ASBA 3BDCA 1I6VC 4BBRH 4FXDA 3H91A 4DR3Q 4Z9CB 4A3LG 1IKLA 2R7FA 2AQ2B 1PYSB 1CA5A 1JE4A 2UU9Q 2OWOA 3H09A 4CJ0B 1E7ZA 4ULLA 2R93H 1Y8OB 3GTMH 3A5UA 2R93B 4QIWB 1L0WA 3GTMB 1V1QA 4ABNA 3DUZA 2L15A 3KYHC 3FMCA 3VDYA 2B63G 1XMOQ 3T53B 3RD4A 3J81i 4LF5Q 4XDXA 1DOKA 2F0MA 1ESRA 4C1NI 3HOWH 4QUFA 4C3JH 3MXNA 1S5DD 3FDTA 1CTMA 4MZ9A 5AJ3Q 1XMQQ 3M7NA 3HOWB 2K33A 1TY0A 4C3JB 3K7AH 4XT3B 2KECA 3P20A 1SDFA 4JK1C 2YTXA 3K7AB 3U58A 3BJUA 1KAWA 1G6PA 3BYTB 2PNHA 4DAYB 1MD2D 4HN7A 4PMWA 1UNSA 3OPOA 2HHHQ 4R4OA 5IGGA 1EEFD 1IHZA 3QJYA 2SDFA 5EKLA 4GNXA 2JP1A 3M85A 2LKVA 3TP6A 1STNA 4XTCS 1R9TB 2RVLA 5EBDA 1MGSA 5L37A 4LFAQ 4LF8Q 1QJOA 3OOCA 4HJ8A 1NMFA 1P8LA 1EIFA 2B39A 3VR3A 3UDGA 4JYAL 3IFTA 1MI2A 1PTOH 2K5WA 2HDLA 1ML0D 2FINB 4DXFA 4IPDA 1PTOB 1TU2B 4BY1G 2CCZA 2EIFA 3S24A 1SSOA 2CWPA 5EKIA 2A73B 4CKBA 2BDNA 1KIXA 1GKHA 3GO5A 4A3GG 2WV6D 1BBUA 3D3RA 3I70A 2Q8IB 4LF9L 1OXVA 2KCMA 1MJEA 3FKIG 1F9PA 1JWSD 4R1JA 3SE0A 5KRUA 4IFDJ 2PZUA 2F0GA 4DNRB 2PQEA 1MHWC 3T16A 1E1TA 5IYDH 4GN4B 1GUTA 2NUCA 4DV2Q 5LMUL 4WORA 4KY6A 1JB7A 4DK6C 4DV3Q 4KN7C 1LV9A 4NXNL 4EQ5A 5IIFA 1AP0A 1BVSA 4B3MQ 1X3GA 5FJ8G 5M5YH 4J15A 1PZJD 3GTJH 5M5YB 4TKOB 1SFOH 3GTJB 2Z4IA 4HR7B 1F2ZA 1HXYD 2K5NA 1SFOB 2I5HA 1YIJA 4R4QA 5ELOA 4DV4L 4HJAA 3A8KE 3BZDB 3MXNB 2K1BA 2F03A 1G2SA 1ASZA 3G6EA 3PSIA 1O7YA 2F0PA 1ILQA 2ALYB 1JE5A 2EYMA 2PI2A 5EGTA 2ENBA 2WFWA 4CKCA 5C4HA 1EU3A 4B3RQ 4DAMA 2IHFA 1ZXTA 4OIJA 4DGZA 1KLGD 2LFNA 3P7JA 5D14A 5CBEE 3M7GA 2O5JC 4EGVA 2WAQB 1Y8NB 2P5ZX 1FNUA 3P75A 1ET9A 2F4IA 3C2PA 4RG1A 3W1GA 3J81c 3K5NA 2IW3A 3I73A 4K0KL 3HOZB 3ND9A 1BCPC 3H0GB 4CBVA 2HT1A 1NTGA 1RODA 4PMCA 1S72A 1FJGL 2K6AA 1CKMA 2QW7A 3KUPA 1C9OA 2R92B 2RDGA 1BR9A 1UUPA 2MUYA 1HUNA 3M4OH 3D8GA 3QB3A 1OTCA 1PHJA 3M4OB 5BN4A 4A3KH 5CYUA 3I8ZA 5FLMG 1AZQA 1IYJB 3J80i 4MN3A 4A3LH 1GUSA 3E0JA 2DNEA 3I90A 1WD1A 4FF2A 2EYLA 1D5MC 1Y8PB 4X62Q 4JI3Q 3SK5A 1V8QA 4H13C 1T5XD 4FF3A 2F0OA 2K5HA 5IYCH 2B8FA 2WINB 2NBFA 2CVRA 2K4KA 2NZHA 2SOBA 3PCOB 4TSSA 4DPGA 1T9HA 2Y0SG 3CC4A 2NN6I 2QGQA 2B63H 2ICIA 4JV5Q 1T5EA 2B63B 3S1QB 2XRSD 2ZTCA 3SK4A 2IWHA 4JI4Q 1VQFA 1RHPA 5C0XH 2PW7A 1XNRL 4DV6Q 1N8RC 5KYIA 2KHJA 1XXGA 2VQEL 4RCOA 1BCPD 2JA8G 2CHBD 1VQHA 4L5SA 5GROA 2E2HH 2RHQB 1CZGA 2EY6A 1VF5C 2RSOA 2E2HB 2L55A 3CHBD 3ERSX 2RQXA 2Q2TA 4DR1L 1S4ZA 1SE8A 2G9HD 2YU9H 2KHSA 1SRUA 2YU9B 1RKNA 1LTRD 3QR8A 4RGMA 3S1NH 2G5DA 3WOEA 1SYFA 2RHSB 3S1NB 3JAMi 3W3AA 2ZJPA 4ZUJA 1K0RA 1F9SA 1BQQT 2UU9L 2H5XA 1C8CA 2LS01 3BU2A 1KDCA 5JOBA 2E2IH 1K8OA 3PQIA 4KLKA 4HCSA 4JOIC 3TQYA 4F88A 3TZUA 2E2IB 1JWUD 3BVZA 5C4XG 3DEOA 4IO9A 4HSVA 2B8GA 1EY4A 4BY1H 4M1UB 1V1OA 1HA6A 1QZGA 4WRDA 3URYA 2NZ1D 1NUCA 4BY1B 3I4MG 5JVG3 4FVMA 4A3GH 3DHQA 1J5EQ 5AJ3L 2MP1A 4HMJA 4KHPQ 4AQYQ 4A3DH 4A3GB 2VQFQ 3FKIH 1MSGA 1K83H 2K14A 4A3DB 4Y7NH 5F2DA 3J7YW 3M4QA 1QNUA 3FKIB 4P72A 1LT4D 1K83B 3HKZE 4Y7NB 4BS9A 4X6AH 2F0UA 4DUZQ 4KHZA 5C3WA 3CCRA 1ILPA 4JBJA 5LL6S 4XQQA 2WIIB 2HHHL 3E6ZX 5IY0A 2MPMA 4EQNA 1NBWA 1EYAA 5FJ8H 1EWHA 5CBAE 3VR6A 2MFIA 4LUVA 3A8IE 3HP3A 4OIKA 3PO3G 3ULPA 4S3SA 1RJTA 1XPRA 4LFBQ 1L1OA 3GV6A 1X3FA 3IAYA 4GLVB 1EQVA 3NHHA 4AIMA 4C2MH 2N49A 5EAYA 4LFAL 3OIQA 4IURA 5E7NA 4C2MB 4LF8L 2D62A 3GTQH 1SBBB 2FFKB 2BE5C 2B2UA 1SE4A 3GTQB 1EWCA 3T1HL 5D65A 2DN8A 2JK8A 3HG9A 2N8NA 3CCMA 1FNWA 1YNND 5E4XA 2XRQD 2JQOA 3KDFB 3J80c 3X3MA 4IJLA 1KD1C 1G51A 2R6GA 1VQ4A 2V1CC 4NXMQ 1EOVA 1IYUA 3QG1A 1SNCA 5BR8L 4OELB 1K28A 1ZEQX 2E74C 3EVQA 3NUCA 1ICFB 2NVXH 1G8ZD 2UUBQ 1EQRA 1TS4A 3CAMA 3PV0A 2NVXB 1ENCA 1J9OA 1H9JA 2N3SA 4QQBX 4XQNA 1WTPA 4DV2L 2B29A 1QZHA 1YHAA 5IP9H 4GKJL 1QE6A 5E1FA 1EL0A 1WTRA 2A8VA 1IBLL 5G3LF 2RCFA 3S1MH 4A3BH 3VA5A 1HZBA 1SN8A 3EROA 5IYBG 3OTOL 5DEHA 2K5QA 2L12A 1B9MA 3S1MB 4A93G 1VS0A 3RUZA 4OWWB 1UE7A 1XYIA 4ZYSA 2JA7H 4O2DA 2ID0A 1YITA 2EXZA 4DV7L 4LMQD 1VQOA 2UUCQ 4X64L 2JA7B 2PNRC 1PRTB 2BE5D 4KV6A 5IODA 2JYOA 4RKLA 1HNZQ 2K04A 4DA2A 1HTPA 4I7AA 5FLMH 2K05A 3J7AF 3KF8A 5CR3A 3HKSA 1PTOC 4I65A 3TS2A 3GTLH 1XPOA 1Y1WG 2R7ZG 1NY4A 4HCEA 3JAMc 2Q2UA 4Q5VA 1EYGA 4LNQA 1LTGD 2A68C 3AFQA 3S16H 4B08A 4WJ4A 4L5RC 3UE1A 1YJ9A 2JEBI 5CGKA 4JW0A 3H3VC 2JEAI 3HOVH 1E2VA 1MIUA 3PGZA 5C3EG 3FPUB 2ZTEA 3HOVB 1KDBA 2Y0SB 1X32A 3S9WA 5DNFA 1Y69U 2DUDA 3SGIA 2I07B 4KKUA 5I6WA 4PV1C 1HH2P 3SXHA 3NK9A 4MTKA 2O2LD 4DAVA 4JI2L 1NR2A 1N34L 2WKCA 1Q82C 4IPGA 1Q81C 1CHPD 4L5QA 4HIDA 1KXLA 4JCVE 4DR2Q 5I9OA 2IJ0A 4ZK9B 4JI0Q 1WTOA 2A6HC 1CHQD 4NPSA 4LFCQ 1V1PB 3V2TA 3CCSA 2EDGA 3EN2A 3MWYW 3DMUA 2XWJB 3T4AC 1PLFA 1S5BD 1SMXA 3C1FA 3TRZA 4WJWA 1HNWQ 1CKNA 1I4XA 3S1RH 1MSHA 1WFQA 1TT2A 1TIID 1PTOD 4KKTA 3D6WA 4X62L 4YWMA 1D6EC 1O7IA 2A68D 2F0HA 4JI5Q 5KNBA 3LWEA 1IL8A 4LF7Q 3AEVA 1X65A 4QJFA 3VR4A 3A7LA 3LGJA 3J81j 3ERQA 5C4XB 3K7UC 3QWNA 5EBCA 2LMCB 2FJ2A 1FL0A 4DUYQ 4JV5L 2IY5B 1A62A 5C5LA 1PH3A 3GD7A 3M9BA 3KF6A 4JI4L 3CMEA 3I4MB 4DV6L 2Q2HA 4DR4Q 1XJVA 2JE6I 4N8FA 2VB3X 1RDPD 2A19A 3H6MA 3L7ZC 1CQFA 1BOSA 1PYWD 1XX8A 3J81E 3SK6A 5E4WC 1IXRA 3VYUA 1YHQA 1C0AA 5KYLA 3Q22A 4A3FG 4A3JG 3PUWA 4LF6Q 3D4RA 3CCQA 5EPKA 1I50H 1OXTA 2BH2A 2AWOA 2A6HD 1BBXC 4YCVA 1I50B 4LK1C 4B3SQ 3I7FA 3E0EA 5JJIA 3KF8B 1N36Q 2KCTA 2X6GA 3K81C 1QCBD 1TWFH 1KNAA 3D6CA 1GM5A 4BWGB 2Q8TA 1IZ6A 1TWFB 2NVTH 4CDFC 2D5DA 3U4ZA 5CV8A 2ATWA 4A3MH 1SNPA 2D2CC 4A3MB 1I94Q 3F1ZA 1B9NA 2QDBA 4P75A 2PO4A 1SMYC 2EXDA 1YI2A 1B70B 1EU4A 1Q46A 1SNMA 4B3TQ 1TQOA 3S2DH 3KLSX 1OXSC 1RL2A 3D31A 4ZRZA 2F4VQ 4ID6A 3S2DB 4H02A 3I55A 3J81L 4FP5D 1PFSA 1X55A 1O78A 2KEDA 4BXXG 3A74A 3MA2B 1KLUD 2OQ0A 2NTSA 5DM63 4AQYL 3HGBA 1J6QA 3N6RA 1WTVA 2NN6G 1U4MA 1TR5A 5JEAH 1K0SA 2LXKA 2AUJD 4ZCKA 1DJRD 2FXQA 2JA5G 2F0QA 1Y14B 1K73C 2XN9C 4X3KA 2AHOB 1O7ZA 2UXBQ 1CKOA 1YZ6A 3ULLA 1RF2D 5IWAQ 3QIAA 4IN3A 4A93H 4YY3Q 5JJKA 4ODGA 2NWGA 2V4DA 4A93B 2CQOA 4BBSG 1JJGA 2E75C 3A55A 3VYTA 1SMYD 5I4DA 3AQQA 2K7VA 1GUOA 1YHBA 2B3GA 3CKIB 3CC7A 3HRZC 5IT9c 1R9TH 3T51B 1EQQA 1EY6A 4OL7A 2JJQA 5M5WH 2BH8A 2EE1A 3KBXA 5M5WB 3T13A 1X3EA 3Q23A 4GKKQ 1HUMA 3R2TA 1PA6A 5CV4A 1Y1WH 2R7ZH 5T1IA 1A0IA 4BA1I 4UY8C 1Y1WB 2R7ZB 2VY3A 1N33Q 5LMNQ 1X3PA 2JA6G 4HSPA 2Z6KA 1NSNS 3H3VH 4X66L 2UUBL 1Q86C 1AW7A 2KQ3A 1UAPA 2CW0C 1WYDA 4TVAB 2FMCA 4RH6A 1HZAA 1RTOA 3HEJA 2D0PA 2CQAA 3BG3A 2XNAC 3NE5B 4DV1Q 1Q8KA 1JCKB 3AFPA 4C1NK 1A3UA 1HNXL 1RD9D 1E24A 3HKZG 1QUQA 2KCNA 2EYJA 4TQUS 1A3TA 3MEFA 3KJOA 2MHVA 1DD2A 1NMGA 3KLSA 4UDUC 2UUCL 2B2TA 4C56C 3CC2A 3TSSA 1WCMG 1PZID 2A6ED 1BCPF 2GVAA 2EZVA 2UXCL 3PIOA 5CMDA 2JXMB 1C4QA 1HNZL 1PRTF 1M4VA 1E0BA 2F0IA 3P1HA 2IHEA 4NP5A 1HPCA 1K8MA 2EOTA 2E2JH 1B3QA 1F2MA 3KFUA 2PZWA 1CFMA 4JI1L 3K5OA 2E2JB 3G71A 1VQ6A 3VA7A 3ONAB 3J80E 5FOBB 1KABA 3QO2A 4G7OC 3RLFA 4GS3A 3VYSA 1JICA 1UE6A 4K5VA 3S14H 4IUQA 3GV3A 4QF4A 3S14B 1R4PB 2CW0D 2PW5A 4RGTA 4HTHA 1H95A 1II3A 3FP9A 4FXKC 3PO2G 1TXYA 2X69A 1QVFA 4POGA 3STBC 3NXWA 3QOJA 2DY7A 4DV0Q 1LM0A 1I6HB 1CSPA 1LO5D 4GNXB 2HUGA 4A3FH 2DNCA 4A3JH 2PQAA 4OWTB 4A3FB 1X9NA 4A3JB 4JI0L 1VQGA 3K59A 5M3MG 3HOZH 1VQLA 3EJIA 3H0GH 2HIVA 4LFCL 1E22A 4UHVA 1SYBA 4J8QA 4QB4A 2CWAA 2YV5A 2Q8RE 3J80L 1PRTC 2R92H 4DR7Q 1HNWL 1EWIA 1VMPA 4HEDA 2ZTDA 2EYPA 1X54A 4IFDG 5JJLA 5GAGC 1BBWA 1SJHD 1X3QA 2ZXOA 3F2CA 2F0WA 4X65Q 4H0LC 3SR1A 3C46A 4PMBA 4LF4Q 4JI5L 4POFA 5LMNW 2K28A 4F8MA 5I6YA 1B7YB 3JAME 4O42A 4LF7L 1WI5A 1EYDA 2AMCB 5C4ZA 3CCVA 3GTKB 4GN5A 5LHY1 4K8IA 4LUOA 1A6XA 1TY2A 3PF5A 4RFBA 3R3OA 2RCNA 1Z9FA 4DUYL 1JJ2A 4KJOA 3Q6SA 4BXXH 4FO2A 3CCJA 1QUQB 3STBD 4DR4L 1QWYA 1ZKOA 1L0XB 1A63A 4KK7A 4JBMA 2QEJC 2HQLA 3U9SA 4DXGA 3EA6A 1B53A 4BY7G 3S1QH 1UE5A 3OIPA 5FLXc 4HIKA 4KD4A 3GTGH 4G7ZC 1EZ8A 1CQVA 3OHXC 2B2WA 2YTYA 1DZ1A 3NQIA 3GTGB 2NTTA 1A8VA 1UE1A 1K3BC 4B3SL 5A2QE 1CT1D 2QF7A 3ZJYC 1N32Q 1K3RA 1OXXK 2L1BA 1N36L 3MHBA 1BXTA 4FDBA 5IGBA 1PRTD 3G4SA 3JAML 3T1YL 2BA0A 5KGUA 4OONA 1AE2A 2VL6A 5LL6X 3NP8A 3K80C 3V96A 4BBSH 1NJIC 4K2KA 1SAPA 1I94L 4DR6Q 2SNSA 5C0XI 4BBSB 2F0EA 3OWEB 1LTLA 1SNOA 2N78A 2K52A 3PUVA 4JI7Q 4DR3L 1HFNA 2F4VL 1H9KA 1XWEA 1Q3LA 4P74A 2SEBD 4PQXA 2F0JA 5DLQE 1STYA 5BN5A 4K5XA 5A2QL 1LTTD 4OO1G 1SYCA 2B2YC 2I46A 3HOXG 3J7AV 2I0QA 4A3IG 1XMOL 1F9RA 2JA6H 4LF5L 2JA6B 3O13A 3PIPA 1YNNC 1YNJD 1D7QA 4HIOA 2PMZE 1S40A 1XMQL 2EPBA 1J8IA 3C1EA 3TP7A 1AEXA 3RZDH 2RA4A 5FO8B 1SNQA 3CPFA 1HA5A 3RZDB 3NQTA 1QILA 4MTNA 4JBWA 5IWAL 2H4OA 4UP8A 1U0LA 4K8JA 3ER0A 5EJWA 4YY3L 3DWAA 1CSQA 3ICEA 3KK7A 2L11A 2E2DC 2VUMG 1LT5D 2NVQB 3HKZB 4G57A 1AZPA 3MFYA 4RWSC 4Y52H 2L4NA 2LSSA 1GVPA 1WCMH 2MJ8A 2EYFA 3CP0A 4RGNA 5HGQA 1WCMB 1DOMA 1JQYD 2EY5A 2OF1A 4IPHA 1E2ZA 1KNEA 4KN4C 3ITPA 5FKAC 2R3ZA 4A4IA 2RSNA 1EIHA 4GKKL 1QVGA 3DM1A 3S15B 1S5CD 4IUVA 1N33L 1EY5A 5LMNL 4LJZC 3LX0A 2KUMA 2XTIA 2C5CA 1PH9A 5C3XA 2ZM6Q 4JI6Q 3Q0AA 1PTOF 5J3BA 1HHVA 4DN4M 1O80A 4AH6A 3PUZA 4OHJA 4X3TA 3WWVA 1RIPA 4BBRG 3PO2H 1DCZA 2B2VA 4EQOA 2K5DA 2EYOA 3PO2B 3IRBA 5BN3A 1I3QH 3B6YA 3HOUG 2A5HA 2ES2A 1VQJA 1QOHA 2QDLA 4DV1L 3W2DA 1PXUA 1I3QB 4DR5Q 1YJWA 4OX9Q 2K01A 3E9HA 1ENFA 4OGQC 3A8JE 4KMUC 1H9MA 4PG3A 4DV3L 5FO9B 4JYAQ 1WVLA 1A2UA 5C4JH 1K9MC 1LTAD 2EY2A 5M3MH 3OSOA 5IGDA 1HZCA 3EBEA 4B3ML 5C4JB 5M3MB 1EY0A 3E5SA 3NWSA 1XTCD 3WOFA 1D1KA 1R4QB 1AFPA 3FPPA 3TBIB 5IT9E 3HOWG 2VS1A 2F1MA 2R61A 4IFDH 4ILWA 1W6KA 3G6JB 2WACA 1JOQA 4UPAA 1Q8IA 2K50A 2LY7A 4ZKCB 5H1SE 2CH4W 1B2TA 4HAEA 3OW2A 3RN5A 5ELFA 2E5LQ 2Z6BA 1VQ5A 3TEHB 2QILA 2K03A 4DKAC 1VQNA 3E9IA 1LABA 5LMUQ 3F8TA 3K0XA 2DJFC 4B3RL 3VR2A 4IOCA 2HIXA 1IBKQ 4CDCC 1STAA 1LUZA 1ET6A 4C3HG 3DM3A 4DF7A 3KJPA 1K8GA 4BY7H 3PUYA 2DJGC 2DY8A 1KDAA 2F3IA 3KLRA 4BY7B 3KBGA 5IT9L 4YHHQ
chains in the Genus database with same CATH topology
3BS1A 2KVMA 1WTWA 1AN8A 5A35A 3N52A 3D4WA 1HQRD 1JB3A 3H94A 2JA8B 4ZAIA 1HCZA 2EJMA 4XT1B 4FF4A 2F0VA 1PZKD 3MFGA 3PIO3 2PCFB 2F0DA 3A54A 1PDQA 3GQBA 5K36G 5EKKA 4RA8A 3C3LA 4XIGS 4F7XA 2EY1A 1B4OA 1EYCA 3TDQA 1Q90A 1GUNA 4ZUIA 1TWHB 3X3NA 2MGSA 3U9OA 3I3CA 2SNMA 5J39A 3T56B 1G291 4OO1H 1HTLD 3TP5A 1ESFA 5CV5A 3HOXB 2FHTA 1RCVD 2TMPA 1GUWA 2KCCA 3MXUA 1CK1A 2AQ1B 3DEPA 1NR4A 4LAAA 4DAYA 1SYDA 2NVYB 4IZ8A 5C0XJ 4B9XA 2EJGC 4J6HA 4TRDA 1EOTA 3K6OA 2OXPA 4QMGA 2HQEA 1DOLA 2D9UA 2VUMB 1EFID 4CKEA 2IL8A 3EQLC 3PO3B 5JJZA 4IQZA 1TWGB 3ZYYX 2FMMA 3MAQA 1CI3M 1Z6HA 5KNCA 4NKLA 2EYHA 2VNUD 2BA1A 3HZXA 4NMZA 3V05A 1B3AA 1VCIA 2A74C 2B2TC 1I4RA 5FLXE 3OMGA 1SJED 4RHRA 2G9DA 1H9RA 5IGFA 3A7AB 1OO9B 4BBRB 1V43A 3MEHA 1HQMC 2TSSA 1LLRD 3HOUB 5JPNC 3NWTA 5CC4A 2NYZD 1STHA 4N9TA 1D2BA 3BVMA 4EVOA 1BF4A 4K6DA 2L9HA 4FNFA 5EPLA 3Q24A 2HCIA 1STBA 4C3IG 3MVVA 2HDMA 1ZYRD 1Q12A 1EEID 1EY9A 5C0XG 5J22A 5ELEA 5M5XB 5FLXL 1SEBD 4RHSA 2A6EC 1GOZA 3G7LA 3VR5A 1M8AA 4R8NA 3S2HB 2J0TD 5COYA 4CJ2C 2F0NA 5C5MA 2F3WA 3PMFA 3PIP3 5D3IB 1DXMA 2Z1CA 2O5IC 1H9SA 3I72A 4C3HB 5ELCA 5C3EB 3K58A 4H7BA 2NB0A 5FO7B 5CORA 3MZ5A 3IKJA 4RCNA 1I4PA 3K0YA 1S5FD 2F0SA 1TWCB 4KJNA 4N9PA 4P2CB 4RKBA 3LNNA 4X3UA 4ME5A 4RAUC 2AUKA 3ND8A 5T1GA 5K36H 1EIGA 5M3FB 1STEA 1SYEA 2BOSA 2B2WC 3K57A 4IUTA 4CGYB 1ENAA 3LWUA 5JPMC 2YYZA 3NPPA 5I2XA 1DONA 2KOLA 1C48A 4IALA 4DK0A 1B50A 4FYDA 4XYOA 4L63B 1CZWA 1JOKA 1G6ZA 2F3VA 3L9AX 3R2IA 5JAVA 2C9OA 1EY7A 1A15A 1PFMA 2QKIC 3NTHA 3FEWX 1U4LA 3GTPB 3PUXA 1HRJA 2KEEA 1WTXA 1W6JA 2JSOA 1GHJA 3S17B 2ZXPA 2ZXRA 3I91A 3AB9A 4IUNA 2IX3A 2PPBC 2J7ZA 3SVMA 1H9SB 3MTSA 2ZT9C 2EJFC 5EPJA 2HCCA 3NTIA 3WDNA 2EVBA 3M3YB 2VXWA 2IX0A 1FD7D 4ZLTF 3UI2A 3FVQA 1EQTA 3QOLA 2PYKA 2N55A 3DXJC 1TS3A 3RMHA 2F0LA 3D4DA 5ELDA 2J4XA 4DNTB 4L6TB 3DWPA 2NN6H 2L0CA 3CQZB 4G7HC 3HOYB 3DWQA 4A3KB 4KD3A 4R8IA 1GXDC 1SXTA 1YNJC 1QG7A 2JA5B 2B2UC 3MC0B 1I4QA 1LTBD 4ZQ3A 5HURA 5DAUA 4MHEA 1Y1VB 2AQ3B 4GZYC 1EY8A 2QCPX 4KY5A 2E76C 1STGA 4DU9A 4C3IB 1WD0A 2B2VC 1DYQA 3EFXD 1SE3A 1GHKA 1D1IA 1BO0A 1PFNA 4HMIA 3TP8A 5TSSA 4B9WA 2F0FA 4KTAA 3L3OC 1DM0B 4K5WA 3RZOB 1Z7TA 2K32A 4U68A 4G4KA 5AFWA 1G2TA 1PMRA 2XWBB 4XXEA 2AWNA 1FYCA 2M9VA 1L0YB 3OW7A 3MXGA 5JEAJ 1U4PA 5E3FA 1U9RA 3FRPB 4DAPA 1OXUA 5I9PA 2IT1A 1FNVA 1BNZA 5J1ZA 3A56A 2PMZB 3BYYB 5KEEA 1NCVA 2OEOA 5JVH3 3CRKC 1GJXA 3OWFA 1IYVA 5IGEA 2PZTA 1FR3A 3K5MA 1LTSD 4IUUA 2XSCA 3IL8A 3VYRA 1I4GA 3SEBA 2VB2X 4K2LA 1F9QA 1LACA 1FGBD 5KIXA 1B44D 5ELBA 2M2LA 1EZ6A 1JORA 1Q1EA 2XVSA 2F0KA 4H44C 2RDHA 3SK8A 3I4LA 2O4XA 3IFDA 4A3EB 4UAIA 3MXPA 3NBHA 4XYQA 3TZDA 5EQ0A 3GTOB 2Z8LA 5K5PA 4J1MA 4M8AA 4NW2A 4K6LA 5IOCA 1TWAB 3BDLA 1LT3D 1ONLA 4PNYA 1V1PA 4DK1A 4NDXA 1KTKA 4R9WA 2WP8J 1TVXA 1Z47A 2KA7A 2M00A 1D5ZC 5JEAG 4EQPA 4BA2I 5HGTA 3CU7A 4KY7A 1UEAB 4C3JG 1F2YA 1CA6A 1WTQA 4KHVA 1BDOA 3BVGA 1JR0D 4V190 1Q1BA 1RTNA 4A3BB 5M9OA 5C6AA 4X3SA 2RKSA 4V0BA 4WFN3 2Z4HA 1O7LA 1JOOA 2B2YA 1ICWA 1BCPB 4IFDI 5KNDA 1IW7C 4K14A 4F87A 2RBMA 1VF7A 1TS5A 1QNKA 2A69C 1S5ED 4YIJA 4E6IA 1LTID 1QB5D 1NAPA 3GTLB 2BDOA 5FK9C 1F2LA 3S16B 5C44B 4FF1A 4FXGC 5CV6A 2BCOA 4CHTB 1IKMA 4O1NA 4KKSA 5IGCA 1TS2A 1SYGA 4ZKBB 1A3VA 4I7ZC 2WB1B 1KAAA 4Q0FA 4L8JA 5I2YA 4QCLA 2XIWA 3TN2A 1A2TA 1SNDA 3TMEA 5D3DA 1HFGA 4DFAA 4KI0A 3F2UA 1IW7D 1PFBA 2IX1A 1GUGA 2X6LA 3BDOA 2A69D 1CM9A 2ICEC 4IUPA 5NUCA 4A3IB 1SE2A 3S1RB 1D5XC 1BUVT 2OT2A 4XQJA 1MBYA 1I4HA 3M4YA 2GA4B 3I4NB 3R8BA 2IPKD 4OO1I 1VDZA 3NSWA 3NTKA 2H1EA 2KJXA 5G3LD 1B1ZA 2F0TA 1G91A 3SHLA 2WKDA 2N88A 4QUCA 3K5LA 3AMUA 5DM73 3GP7A 1LT6D 1E2WA 4U673 3NBIA 4CJ1B 1ZYRC 1JC7A 5ISRA 2L5TA 1F77A 3AU7A 1TKWB 3OMCA 4RGOS 1VMCA 3SDZA 1JWMD 4MIUA 2NVTB 2RDFA 5CV9A 5CV7A 3R93A 3HS0C 3CRLC 1U4RA 4AYBB 3BDCA 1I6VC 4FXDA 3H91A 4Z9CB 1IKLA 2AQ2B 1CA5A 1JE4A 3H09A 4CJ0B 4ULLA 1Y8OB 2R93B 4QIWB 3GTMB 4ABNA 3DUZA 3FMCA 3T53B 3RD4A 4XDXA 1DOKA 2F0MA 1ESRA 4C1NI 4QUFA 3MXNA 1S5DD 3FDTA 1CTMA 3M7NA 3HOWB 2K33A 1TY0A 4C3JB 4XT3B 2KECA 3P20A 1SDFA 4JK1C 3K7AB 3BYTB 1MD2D 4HN7A 4PMWA 1UNSA 3OPOA 5IGGA 1EEFD 1IHZA 3QJYA 2SDFA 5EKLA 2JP1A 3M85A 2LKVA 3TP6A 1STNA 4XTCS 1R9TB 2RVLA 5EBDA 1MGSA 1QJOA 3OOCA 2B39A 3VR3A 3IFTA 1MI2A 1PTOH 2K5WA 2HDLA 1ML0D 2FINB 4DXFA 1PTOB 1TU2B 1SSOA 5EKIA 2A73B 4CKBA 2BDNA 3GO5A 2WV6D 3D3RA 3I70A 2Q8IB 1OXVA 1F9PA 1JWSD 3SE0A 5KRUA 4IFDJ 2PZUA 2F0GA 4DNRB 2PQEA 3T16A 1GUTA 2NUCA 4WORA 4KY6A 4KN7C 1LV9A 5IIFA 1AP0A 1PZJD 5M5YB 4TKOB 3GTJB 2Z4IA 4HR7B 1F2ZA 1HXYD 1SFOB 3A8KE 3BZDB 2F03A 2K1BA 1G2SA 1O7YA 2F0PA 1ILQA 2EYMA 5EGTA 2ENBA 4CKCA 5C4HA 1EU3A 1ZXTA 4OIJA 4DGZA 1KLGD 2LFNA 3P7JA 5D14A 5CBEE 3M7GA 2O5JC 4EGVA 2WAQB 1Y8NB 1FNUA 3P75A 1ET9A 2F4IA 3C2PA 3K5NA 2IW3A 3I73A 3HOZB 3ND9A 1BCPC 3H0GB 4CBVA 1RODA 4PMCA 2K6AA 3KUPA 2R92B 2RDGA 1BR9A 1UUPA 2MUYA 1HUNA 3D8GA 3QB3A 3M4OB 5BN4A 5CYUA 3I8ZA 1AZQA 4MN3A 1GUSA 3E0JA 2DNEA 3I90A 1WD1A 4FF2A 2EYLA 1D5MC 1Y8PB 3SK5A 1V8QA 4H13C 1T5XD 4FF3A 2F0OA 2B8FA 2WINB 2NBFA 2CVRA 2SOBA 4TSSA 2NN6I 2ICIA 1T5EA 2B63B 3S1QB 2XRSD 3SK4A 2IWHA 1RHPA 5C0XH 2PW7A 5KYIA 1XXGA 4RCOA 1BCPD 2CHBD 1CZGA 2EY6A 1VF5C 2RSOA 2E2HB 2L55A 3CHBD 2RQXA 1S4ZA 2G9HD 2KHSA 2YU9B 1RKNA 1LTRD 4RGMA 3WOEA 1SYFA 3S1NB 3W3AA 4ZUJA 1F9SA 1BQQT 1C8CA 2LS01 1KDCA 5JOBA 1K8OA 4HCSA 4F88A 3TZUA 2E2IB 1JWUD 3BVZA 3DEOA 4HSVA 2B8GA 1EY4A 4M1UB 1V1OA 1HA6A 4WRDA 3URYA 2NZ1D 1NUCA 4BY1B 5JVG3 4FVMA 3DHQA 2MP1A 4HMJA 4A3GB 1MSGA 4A3DB 5F2DA 3J7YW 1QNUA 3FKIB 1LT4D 1K83B 4Y7NB 4BS9A 2F0UA 4KHZA 5C3WA 1ILPA 5LL6S 4XQQA 2WIIB 3E6ZX 2MPMA 4EQNA 1EYAA 1EWHA 5CBAE 3VR6A 3A8IE 3HP3A 4OIKA 4S3SA 1RJTA 3GV6A 3IAYA 1EQVA 3NHHA 3OIQA 4IURA 4C2MB 2D62A 1SBBB 2FFKB 2BE5C 2B2UA 1SE4A 3GTQB 1EWCA 5D65A 2DN8A 3HG9A 1FNWA 1YNND 5E4XA 2XRQD 3X3MA 2R6GA 1IYUA 3QG1A 1SNCA 1ZEQX 2E74C 3EVQA 3NUCA 1G8ZD 3PV0A 1TS4A 2NVXB 1ENCA 1J9OA 1H9JA 4XQNA 1WTPA 1EL0A 1QE6A 5E1FA 1WTRA 5G3LF 3VA5A 3EROA 5DEHA 2K5QA 2L12A 1B9MA 3S1MB 3RUZA 1XYIA 4ZYSA 2ID0A 2EXZA 4LMQD 2JA7B 2PNRC 1PRTB 2BE5D 4KV6A 5IODA 2JYOA 4RKLA 2K04A 4DA2A 1HTPA 3J7AF 2K05A 3KF8A 5CR3A 1PTOC 4I65A 4HCEA 4Q5VA 1LTGD 2A68C 4B08A 2JEBI 5CGKA 3H3VC 2JEAI 1E2VA 3FPUB 3HOVB 1KDBA 2Y0SB 1X32A 3S9WA 5DNFA 1Y69U 2I07B 4KKUA 5I6WA 4PV1C 3SXHA 3NK9A 2O2LD 4DAVA 1NR2A 2WKCA 1CHPD 5I9OA 2IJ0A 4ZK9B 1WTOA 2A6HC 1CHQD 1V1PB 3V2TA 2EDGA 3MWYW 3DMUA 2XWJB 3T4AC 1PLFA 1S5BD 3C1FA 4WJWA 1I4XA 1MSHA 1TT2A 1TIID 1PTOD 4KKTA 3D6WA 1D6EC 2A68D 2F0HA 5KNBA 3LWEA 1IL8A 3VR4A 3A7LA 3ERQA 5C4XB 5EBCA 3QWNA 2LMCB 2FJ2A 5C5LA 3GD7A 3I4MB 2JE6I 2VB3X 1RDPD 3H6MA 3L7ZC 1CQFA 1BOSA 1PYWD 1XX8A 3J81E 3SK6A 5E4WC 3VYUA 5KYLA 3Q22A 3PUWA 3D4RA 5EPKA 1OXTA 2AWOA 2A6HD 1BBXC 1I50B 4LK1C 2X6GA 1QCBD 1KNAA 3D6CA 4BWGB 2Q8TA 1TWFB 2D5DA 5CV8A 1SNPA 2D2CC 4A3MB 1B9NA 2QDBA 2PO4A 1SMYC 1EU4A 1SNMA 1TQOA 3KLSX 1OXSC 3D31A 4ZRZA 4ID6A 3S2DB 3J81L 4FP5D 1O78A 2KEDA 3MA2B 1KLUD 2NTSA 5DM63 3HGBA 3N6RA 1WTVA 2NN6G 1U4MA 1TR5A 5JEAH 2AUJD 1DJRD 2F0QA 2XN9C 4X3KA 1O7ZA 1RF2D 3QIAA 4IN3A 4ODGA 2NWGA 2V4DA 4A93B 2E75C 3A55A 3VYTA 1SMYD 5I4DA 2K7VA 1GUOA 3CKIB 3HRZC 3T51B 1EY6A 4OL7A 2EE1A 3KBXA 5M5WB 3T13A 3Q23A 1HUMA 3R2TA 5CV4A 5T1IA 4BA1I 1Y1WB 2R7ZB 1X3PA 4HSPA 1NSNS 1AW7A 2KQ3A 1UAPA 2CW0C 2FMCA 4RH6A 1RTOA 3HEJA 2CQAA 3BG3A 2XNAC 3NE5B 1JCKB 4C1NK 1A3UA 1RD9D 2KCNA 2EYJA 4TQUS 1A3TA 2MHVA 1DD2A 3KLSA 4UDUC 2B2TA 4C56C 3TSSA 1PZID 2A6ED 1BCPF 2EZVA 5CMDA 2JXMB 1C4QA 1PRTF 1M4VA 1E0BA 2F0IA 3P1HA 4NP5A 1HPCA 1K8MA 2EOTA 1F2MA 2PZWA 1CFMA 3K5OA 2E2JB 3VA7A 3ONAB 3J80E 5FOBB 1KABA 3QO2A 4G7OC 3RLFA 3VYSA 1JICA 4K5VA 4IUQA 3GV3A 4QF4A 3S14B 1R4PB 2CW0D 2PW5A 4RGTA 4HTHA 1II3A 4FXKC 2X69A 3NXWA 3QOJA 2DY7A 1I6HB 1LO5D 2HUGA 2DNCA 4A3FB 4A3JB 3K59A 3EJIA 1SYBA 4J8QA 4QB4A 2Q8RE 3J80L 1PRTC 1VMPA 4HEDA 4IFDG 2EYPA 1SJHD 1X3QA 2ZXOA 2F0WA 4H0LC 3SR1A 3C46A 4PMBA 2K28A 4F8MA 5I6YA 3JAME 4O42A 1EYDA 5C4ZA 3GTKB 5LHY1 4K8IA 1A6XA 1TY2A 4RFBA 3R3OA 4KJOA 3Q6SA 4FO2A 1QWYA 1ZKOA 1L0XB 4KK7A 2QEJC 3U9SA 4DXGA 3EA6A 1B53A 3OIPA 4KD4A 4G7ZC 1EZ8A 1CQVA 3OHXC 2B2WA 1DZ1A 3NQIA 3GTGB 2NTTA 5A2QE 1CT1D 2QF7A 1OXXK 2L1BA 3MHBA 1BXTA 5IGBA 1PRTD 3JAML 2BA0A 5KGUA 5LL6X 3NP8A 3V96A 4K2KA 1SAPA 2SNSA 5C0XI 4BBSB 2F0EA 3OWEB 1SNOA 3PUVA 1HFNA 1H9KA 1XWEA 1Q3LA 2SEBD 4PQXA 2F0JA 1STYA 5BN5A 4K5XA 5A2QL 1LTTD 4OO1G 1SYCA 2B2YC 2I46A 3J7AV 1F9RA 2JA6B 3O13A 1YNNC 1YNJD 2EPBA 1J8IA 3C1EA 3TP7A 1AEXA 2RA4A 5FO8B 1SNQA 1HA5A 3RZDB 3NQTA 1QILA 4JBWA 2H4OA 5EJWA 4K8JA 3DWAA 3KK7A 2L11A 2E2DC 1LT5D 2NVQB 3HKZB 4G57A 1AZPA 3MFYA 4RWSC 2L4NA 2MJ8A 2EYFA 4RGNA 1WCMB 1DOMA 1JQYD 2EY5A 2OF1A 1E2ZA 1KNEA 4KN4C 3ITPA 5FKAC 2R3ZA 1EIHA 2RSNA 3DM1A 3S15B 1S5CD 4IUVA 1EY5A 4LJZC 3LX0A 2KUMA 2C5CA 5C3XA 3Q0AA 1PTOF 1HHVA 4DN4M 1O80A 3PUZA 4OHJA 4X3TA 1DCZA 2B2VA 4EQOA 2K5DA 2EYOA 3PO2B 5BN3A 2A5HA 1QOHA 3W2DA 1PXUA 1I3QB 2K01A 1ENFA 4OGQC 3A8JE 4KMUC 1H9MA 5FO9B 1WVLA 1A2UA 1LTAD 2EY2A 3OSOA 5IGDA 5C4JB 5M3MB 1EY0A 3E5SA 3NWSA 1XTCD 3WOFA 1D1KA 1R4QB 1AFPA 3FPPA 3TBIB 5IT9E 2F1MA 2R61A 4IFDH 4ILWA 1W6KA 3G6JB 2WACA 1JOQA 1Q8IA 2LY7A 4ZKCB 1B2TA 4HAEA 5ELFA 2QILA 2K03A 1LABA 3VR2A 1STAA 1ET6A 4C3HG 4DF7A 3PUYA 2DY8A 1KDAA 3KLRA 4BY7B 3KBGA 5IT9L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TR5 A;  3MZ5 A;  4KD4 A;  3C1F A;  1EZ8 A;  1RKN A;  1SNC A;  2F0I A;  3P1H A;  5KEE A;  2OEO A;  2F0S A;  4NP5 A;  5IGG A;  1IHZ A;  4NKL A;  4DGZ A;  4KJN A;  3EVQ A;  2EYH A;  3NUC A;  2F0Q A;  1F2M A;  1SYF A;  4N9P A;  4RKB A;  1TT2 A;  2F0T A;  2PZW A;  5EKL A;  3HZX A;  3OWF A;  3QOL A;  4NMZ A;  2PYK A;  3D4W A;  3SHL A;  4ZUJ A;  1ENC A;  1EY5 A;  4DU9 A;  5IGE A;  3MHB A;  2LKV A;  2PZT A;  4ME5 A;  3TP6 A;  1STN A;  4K14 A;  3LX0 A;  5IGB A;  2RBM A;  2F0H A;  5E1F A;  1KAB A;  2F0L A;  1KDC A;  3D4D A;  5JOB A;  5C3X A;  3VA5 A;  3P75 A;  3ERO A;  3OMG A;  5KGU A;  2F0V A;  5DEH A;  4YIJ A;  4K5V A;  2F0D A;  3NP8 A;  5ISR A;  5IGF A;  4ODG A;  4K2K A;  3ERQ A;  4K2L A;  4QF4 A;  4KD3 A;  1SYE A;  2SNS A;  5EKK A;  2PW5 A;  3RUZ A;  4E6I A;  2F0E A;  4EQO A;  1EY4 A;  4HTH A;  1SNO A;  1II3 A;  2EYO A;  3OMC A;  5C5L A;  2EY1 A;  3MEH A;  4WRD A;  4F7X A;  5KIX A;  4PMC A;  1NUC A;  1EYC A;  1EZ6 A;  1JOR A;  2EXZ A;  3NXW A;  5CC4 A;  1ENA A;  1STH A;  2F0K A;  3QOJ A;  4N9T A;  4ZQ3 A;  5HUR A;  5DAU A;  4KV6 A;  3DHQ A;  3H6M A;  4MIU A;  4HMJ A;  3SK8 A;  2RDF A;  1EY6 A;  4OL7 A;  4EVO A;  5IOD A;  4ZUI A;  5CV9 A;  2O4X A;  5CV6 A;  4RKL A;  5CV7 A;  3SK6 A;  3TP8 A;  5KYL A;  1EY8 A;  1A2U A;  3U9O A;  3D8G A;  2SNM A;  2EY2 A;  3QB3 A;  4IAL A;  5F2D A;  3T13 A;  2F0J A;  3OSO A;  5J39 A;  3BDC A;  4KY5 A;  5IGD A;  4K6D A;  5IGC A;  3MXP A;  1STY A;  5KRU A;  2PZU A;  1SYG A;  1STG A;  1STB A;  2F0G A;  2F0U A;  1EY0 A;  3EJI A;  4K5X A;  5CR3 A;  3E5S A;  1A3V A;  3MVV A;  1JOK A;  1SYB A;  1SYC A;  2PQE A;  4I65 A;  5CV5 A;  4QB4 A;  5C3W A;  5K5P A;  4J1M A;  3T16 A;  2EYL A;  1EY9 A;  2F3V A;  5J22 A;  1KAA A;  2NUC A;  5IOC A;  3SK5 A;  3D6C A;  5JAV A;  4WOR A;  3BDL A;  4EQN A;  1EY7 A;  4KY6 A;  1A2T A;  2WAC A;  2F0O A;  1SND A;  3TME A;  5CGK A;  1JOQ A;  2EYP A;  1NSN S;  1EYA A;  4LAA A;  4PNY A;  5IIF A;  5CV8 A;  4DFA A;  2SOB A;  1SYD A;  4IZ8 A;  4HMI A;  2F0W A;  3C1E A;  4NDX A;  4R8N A;  1SNP A;  3TP7 A;  3SR1 A;  2KQ3 A;  2F0F A;  1AEX A;  4PMB A;  4S3S A;  4B9W A;  1KDB A;  4KTA A;  4B9X A;  1SNQ A;  2QDB A;  4J6H A;  4K5W A;  3S9W A;  4TRD A;  3HEJ A;  4F8M A;  5I6Y A;  1EQV A;  3NHH A;  3NQT A;  5I6W A;  2M00 A;  3SXH A;  1SNM A;  1EYD A;  5C4Z A;  3NK9 A;  3SK4 A;  2F0N A;  1TQO A;  4K8I A;  1F2Z A;  4K8J A;  5C5M A;  4EQP A;  2F3W A;  2F0M A;  2PW7 A;  5HGT A;  4IUN A;  1A3U A;  3R3O A;  2OXP A;  4ID6 A;  4KY7 A;  5KYI A;  5NUC A;  4QMG A;  2HQE A;  3PMF A;  4KJO A;  1F2Y A;  4G57 A;  4KHV A;  2EYJ A;  1A3T A;  5CV4 A;  5I9O A;  1STA A;  2EYF A;  2EY6 A;  2F0P A;  5E3F A;  1U9R A;  2EYM A;  5EGT A;  4DF7 A;  2EY5 A;  2OF1 A;  5M9O A;  5C6A A;  2RKS A;  2ENB A;  1KDA A;  4H7B A;  3V2T A;  5I9P A;  5C4H A;  3DMU A;  5J1Z A;  2KHS A;  1JOO A;  3ITP A;  3TP5 A; 
#chains in the Genus database with same CATH topology
 3BS1 A;  1L1O B;  2JA9 A;  2KVM A;  1WTW A;  1AN8 A;  3FHW A;  5A35 A;  3OYY A;  3N52 A;  2JA8 H;  1IL2 A;  3D4W A;  1HQR D;  1JB3 A;  3H94 A;  2JA8 B;  4ZAI A;  1HCZ A;  4JBK A;  2WB1 E;  4A75 A;  2EJM A;  4XT1 B;  4FF4 A;  2F0V A;  1PZK D;  3MFG A;  3PIO 3;  2PCF B;  2F0D A;  2RF4 A;  3A54 A;  5M3F G;  1PDQ A;  3GQB A;  3Q8D A;  5K36 G;  1SR3 A;  5EKK A;  4LF4 L;  4RA8 A;  3C3L A;  4XIG S;  4F7X A;  2EY1 A;  1B4O A;  1EYC A;  4UP7 A;  4MNO A;  3TDQ A;  1Q90 A;  3CCE A;  1SLJ A;  1TWH H;  4JI3 L;  1VQD A;  1GUN A;  4R4I A;  4ZUI A;  3ULJ A;  1TWH B;  3X3N A;  2MGS A;  2KBN A;  3U9O A;  3I3C A;  2SNM A;  1PH6 A;  5J39 A;  3RLN A;  1MKH A;  3T56 B;  5C4X H;  1G29 1;  1KQS A;  4OO1 H;  1HTL D;  3TRE A;  3TP5 A;  3HOX H;  4APV A;  1UWV A;  1ESF A;  1QVC A;  5CV5 A;  1YNX A;  3HOX B;  2FHT A;  1RCV D;  2TMP A;  1GUW A;  2LXJ A;  3I4M H;  1HR0 Q;  2KCC A;  4GOP A;  3MXU A;  1CK1 A;  4R4T A;  2AQ1 B;  1W3S A;  2NVY H;  3DEP A;  4GNX C;  1NR4 A;  4LAA A;  1N32 L;  4DAY A;  1SYD A;  2NVY B;  4IZ8 A;  4QY7 A;  5C0X J;  4B9X A;  2EJG C;  4J6H A;  4JPB W;  4TRD A;  1XTD A;  2I5M X;  1EOT A;  1VQK A;  1PH1 A;  3K6O A;  2OXP A;  2VUM H;  1X56 A;  4QMG A;  4YWK A;  2HQE A;  1DOL A;  3W1B A;  2D9U A;  2VUM B;  1EFI D;  3PO3 H;  3NEM A;  4CKE A;  2NZO A;  2IL8 A;  1TWG H;  3EQL C;  3PO3 B;  5JJZ A;  4IQZ A;  1TWG B;  1XNR Q;  3ZYY X;  2FMM A;  2K75 A;  3MAQ A;  1CI3 M;  2VQE Q;  1Z6H A;  2VZA A;  5KNC A;  4NKL A;  2MO1 A;  2EYH A;  2VNU D;  2BA1 A;  1NE3 A;  4JI8 Q;  3HZX A;  4NMZ A;  3V05 A;  4AYB E;  4LWC A;  1B3A A;  3F2D A;  3CCU A;  3A5Z B;  4DR1 Q;  1VCI A;  2A74 C;  2B2T C;  1I4R A;  5FLX E;  3OMG A;  1J5E L;  1SJE D;  4RHR A;  4KHP L;  2G9D A;  1H9R A;  5IGF A;  1PH5 A;  2VQF L;  3HOY G;  3A7A B;  3PF4 A;  4A3K G;  1OO9 B;  4BBR B;  1V43 A;  3HOU H;  4QIW E;  4YWL A;  3MEH A;  1HQM C;  4CDD C;  2TSS A;  1LLR D;  3HOU B;  5JPN C;  3NWT A;  4DUZ L;  1IBM Q;  5CC4 A;  2NYZ D;  1STH A;  4N9T A;  3E3X A;  1CKN B;  1D2B A;  3BVM A;  5IYC G;  3G48 A;  3AYH B;  4EVO A;  1Y1V G;  1M1K C;  5IYB H;  3U50 C;  1PV4 A;  1BF4 A;  3M4P A;  4K6D A;  2L9H A;  4FNF A;  5EPL A;  3Q24 A;  2HCI A;  1STB A;  4C3I G;  4DNI A;  3MVV A;  2HDM A;  4LFB L;  1ZYR D;  1Q12 A;  1EEI D;  1EY9 A;  5M5X H;  5C0X G;  5J22 A;  5ELE A;  5M5X B;  3RN2 A;  5FLX L;  2AKW B;  1SEB D;  4RHS A;  2A6E C;  4HJ5 A;  1EFW A;  4YCU A;  4GOP B;  3S2H H;  3KF6 B;  1GOZ A;  3G7L A;  3VR5 A;  1M8A A;  4R8N A;  3S2H B;  2C35 B;  2YTV A;  2ZM6 L;  4JI6 L;  1HR0 W;  2HD3 A;  2J0T D;  5COY A;  4CJ2 C;  2F0N A;  5C5M A;  2F3W A;  2Q2I A;  4NXM L;  2MQH A;  3L0O A;  3PMF A;  3PIP 3;  5D3I B;  1DXM A;  2Z1C A;  4C3H H;  2O5I C;  5C3E H;  1H9S A;  4DR5 L;  2R7D A;  3I72 A;  4C3H B;  5ELC A;  4OX9 L;  5C3E B;  3KLW A;  3K58 A;  2JN4 A;  4H7B A;  2NB0 A;  2UUA Q;  5FO7 B;  1U5K A;  2CFM A;  5COR A;  1TWC H;  3MZ5 A;  3IKJ A;  4RCN A;  3T1H Q;  1I4P A;  1Q7Y C;  3K0Y A;  1FVI A;  1S5F D;  2F0S A;  2MO0 A;  1TWC B;  2OTL A;  4KJN A;  4N9P A;  2A1A A;  4P2C B;  4RKB A;  3LNN A;  4X3U A;  3H3V I;  4ME5 A;  4RAU C;  1YEZ A;  1SRO A;  2AUK A;  4A3D G;  3CF5 A;  5M3F H;  3ND8 A;  5T1G A;  5BR8 Q;  5K36 H;  1EIG A;  5M3F B;  1STE A;  1SYE A;  2E5L L;  2BOS A;  2B2W C;  3K57 A;  3NEN A;  4GKJ Q;  4IUT A;  4CGY B;  1ENA A;  1IBL Q;  2KHI A;  3OTO Q;  3LWU A;  5JPM C;  2YYZ A;  1E1O A;  3NPP A;  4QL5 A;  5I2X A;  5IE8 A;  1IBK L;  4P73 A;  4WJ3 M;  4A3E G;  1DON A;  2KOL A;  1C48 A;  4IAL A;  4DK0 A;  1B50 A;  1X6O A;  4FYD A;  3CMA A;  4XYO A;  4L63 B;  1CZW A;  1JOK A;  4DV7 Q;  1G6Z A;  4X64 Q;  4YHH L;  2F3V A;  3L9A X;  3R2I A;  5JAV A;  2C9O A;  1EY7 A;  1A15 A;  1I6H H;  4A3C G;  1PFM A;  2QKI C;  3NTH A;  4P71 A;  3GTP H;  3FEW X;  4PZ7 A;  1PH4 A;  1U4L A;  3A0J A;  3GTP B;  3PUX A;  1LYL A;  1HRJ A;  2KEE A;  1WTX A;  4DR2 L;  3S17 H;  1I5F A;  1W6J A;  2JSO A;  4DV5 Q;  1GHJ A;  3S17 B;  2ZXP A;  1NNX A;  2ZXR A;  1XNQ Q;  2WAQ E;  3CCL A;  3I91 A;  3AB9 A;  4IUN A;  3CD6 A;  2IX3 A;  1D8L A;  2EQS A;  2PPB C;  5IP9 G;  2J7Z A;  4A3B G;  2UXD Q;  4NB3 A;  1UEB A;  3SVM A;  1H9S B;  3MTS A;  2ZT9 C;  2EJF C;  5EPJ A;  2HCC A;  4JI2 Q;  3M3Y H;  1N34 Q;  3GTK H;  3NTI A;  2F52 A;  2EVB A;  3WDN A;  3M3Y B;  3J7A 5;  2VXW A;  2IX0 A;  1FD7 D;  1PH2 A;  4YCW A;  4ZLT F;  3UI2 A;  3FVQ A;  1VQ8 A;  1EQT A;  1KHI A;  1W2B A;  3QOL A;  2JA7 G;  2PYK A;  2N55 A;  1KC8 C;  3DXJ C;  1AH9 A;  1HR0 L;  1TS3 A;  3RMH A;  2F0L A;  3D4D A;  5ELD A;  2J4X A;  4DNT B;  3CQZ H;  2E8G A;  4L6T B;  4IOA A;  1CUK A;  3HOY H;  3DWP A;  2NN6 H;  2L0C A;  3CQZ B;  1L1O C;  4G7H C;  3HOY B;  3DWQ A;  4A3K B;  4KD3 A;  4R8I A;  1N9W A;  1GXD C;  1SXT A;  1YBY A;  4LF6 L;  2JA5 H;  2CKZ B;  4CDE C;  1YNJ C;  1QG7 A;  4GLA C;  2B2U C;  4HJ9 A;  2JA5 B;  3MC0 B;  1I4Q A;  3F2B A;  3CW2 C;  1LTB D;  4O0A A;  4ZQ3 A;  5HUR A;  5DAU A;  1Y1V H;  5C44 G;  5ELN A;  1EUJ A;  4MHE A;  1Y1V B;  3W5O A;  2AQ3 B;  3HOV G;  3UE0 A;  1PH7 A;  3JC6 6;  4GZY C;  1EY8 A;  4C3I H;  2QCP X;  4KY5 A;  1VQI A;  2E76 C;  1STG A;  4DU9 A;  4C3I B;  3CXC A;  2WB1 G;  1WD0 A;  1HJP A;  2B2V C;  4JC0 A;  4PZ8 A;  1DYQ A;  4B3T L;  3EFX D;  1SE3 A;  2PI2 E;  1GHK A;  1D1I A;  1BO0 A;  1PFN A;  4JI8 L;  3KDF A;  2OQK A;  4HMI A;  3TP8 A;  3U4V A;  3RZO H;  1JJC B;  5TSS A;  4B9W A;  2F0F A;  1PH8 A;  4KTA A;  5GAD C;  1JT8 A;  3L3O C;  1DM0 B;  4K5W A;  3RZO B;  2KEN A;  3GDE A;  1Z7T A;  2K32 A;  4U68 A;  2PQA B;  4G4K A;  1PYB A;  5AFW A;  1G2T A;  4L5T A;  1PMR A;  2XWB B;  4UP9 A;  4XXE A;  3I4O A;  2AWN A;  1FYC A;  1PVO A;  2M9V A;  2DGY A;  1L0Y B;  3EIV A;  1IBM L;  3UDX A;  3OW7 A;  2OTJ A;  3MXG A;  5JEA J;  1U4P A;  5E3F A;  1U9R A;  3FRP B;  3I4N G;  5GAH C;  4DAP A;  1V9P A;  4IJH A;  1OXU A;  5I9P A;  2IT1 A;  5GAE C;  1K8A C;  1FNV A;  1BNZ A;  5J1Z A;  2UXB L;  3A56 A;  2PMZ B;  3BYY B;  5KEE A;  1NCV A;  2OEO A;  5JVH 3;  1DGS A;  3CRK C;  4GN3 B;  4GLX A;  1GJX A;  2NVQ H;  3OWF A;  1IYV A;  5IGE A;  1S3O A;  2PZT A;  1FR3 A;  3K5M A;  2Z9H A;  3I2Z A;  1LTS D;  1E3P A;  4IUU A;  2XSC A;  3IL8 A;  3VYR A;  4ME3 A;  1I4G A;  3SEB A;  4OEM B;  4QGU A;  2VB2 X;  4K2L A;  1F9Q A;  1LAC A;  1VQP A;  1FGB D;  4LUZ A;  3S15 H;  5KIX A;  1B44 D;  1YVC A;  1KRT A;  5ELB A;  2M2L A;  1EZ6 A;  1JOR A;  1Q1E A;  2XVS A;  2F0K A;  4H44 C;  2RDH A;  3CPW A;  4IPC A;  3TS0 A;  4A3E H;  4OWX B;  1WTH A;  3SK8 A;  1L2F A;  5IP7 G;  3I4L A;  2O4X A;  4A3M G;  3IFD A;  4A3E B;  4AYB G;  4UAI A;  3GTO H;  3MXP A;  3NBH A;  4XYQ A;  3TZD A;  5EQ0 A;  3GTO B;  4N8X 1;  2Z8L A;  5K5P A;  1VQA A;  4J1M A;  2UUA L;  1TWA H;  2GVB A;  4M8A A;  4NW2 A;  4HIM A;  4K6L A;  5IOC A;  4A3C H;  1TWA B;  1XPU A;  3BDL A;  1WOC A;  1LT3 D;  1ONL A;  4PNY A;  1V1P A;  3J7Z C;  2R93 G;  4DK1 A;  4NDX A;  1KTK A;  4R9W A;  5HY6 A;  2WP8 J;  1TVX A;  1Z47 A;  4R4C A;  4A76 A;  3DLL A;  2KA7 A;  2M00 A;  1D5Z C;  2Z0S A;  5JEA G;  4EQP A;  4BA2 I;  5HGT A;  1AE3 A;  3CU7 A;  4KY7 A;  1UEA B;  4X66 Q;  4C3J G;  4GOP C;  1F2Y A;  3RR5 A;  1CA6 A;  1WTQ A;  4KHV A;  1BDO A;  3BVG A;  1JR0 D;  4LF9 Q;  4V19 0;  1Q1B A;  1RTN A;  4JOI A;  4A3B B;  5M9O A;  5C6A A;  4X3S A;  2RKS A;  2CH4 A;  4V0B A;  4WFN 3;  2Z4H A;  1O7L A;  1B8A A;  1HNX Q;  1JOO A;  2B2Y A;  3RLO A;  1ICW A;  1BCP B;  4IFD I;  4NXN Q;  5KND A;  5GQO A;  3UDF A;  1IW7 C;  1KL9 A;  4K14 A;  4F87 A;  2UXC Q;  2RBM A;  1VF7 A;  1TS5 A;  4DV0 L;  4DK3 C;  1QNK A;  2A69 C;  1S5E D;  4YIJ A;  1HZ9 A;  3I56 A;  1MJC A;  3D0F A;  3HFZ B;  4E6I A;  1LTI D;  1QB5 D;  4JI1 Q;  4DV4 Q;  1NAP A;  3GTL B;  4DV5 L;  2BDO A;  5FK9 C;  2Y0S E;  1XNQ L;  1F2L A;  5C44 H;  3S16 B;  5C44 B;  4FF1 A;  4FXG C;  3BZC A;  4HJ7 A;  4DR7 L;  4PZ6 A;  5CV6 A;  2BCO A;  2QA4 A;  1YJN A;  4CHT B;  1IKM A;  4O1N A;  4OXP A;  4KKS A;  5IGC A;  4X65 L;  1TS2 A;  2UXD L;  1SYG A;  1GO3 E;  4ZKB B;  4LW1 A;  1A3V A;  4I7Z C;  2WB1 B;  3NBH B;  2ZJQ A;  2OCE A;  1KAA A;  4Q0F A;  1VQE A;  4RMF A;  4L8J A;  5I2Y A;  5IYD G;  4QCL A;  2XIW A;  3TN2 A;  1A2T A;  1VQC A;  1SND A;  3TME A;  5D3D A;  1HFG A;  4DFA A;  1C7Y A;  2K5V A;  4KI0 A;  3F2U A;  4JVZ A;  1IW7 D;  1PFB A;  2IX1 A;  4K0K Q;  1GUG A;  1ASY A;  1KRS A;  2X6L A;  3BDO A;  1P16 A;  1EIY B;  1FJG Q;  2A69 D;  4A3I H;  3L2P A;  1CM9 A;  2ICE C;  4IUP A;  5NUC A;  4A3I B;  1SE2 A;  2VW9 A;  1VQ7 A;  3S1R B;  1D5X C;  3H15 A;  1JMC A;  1BUV T;  3RNU A;  2OT2 A;  3UDI A;  4XQJ A;  1MBY A;  2D0O A;  1I4H A;  1FGU A;  3I4N H;  1VQB A;  2QEX A;  3M4Y A;  2GA4 B;  3I4N B;  3R8B A;  2IPK D;  4OO1 I;  1VDZ A;  3NSW A;  3NTK A;  3NEL A;  4JG2 A;  2XGT A;  2I5L X;  1VQ9 A;  2H1E A;  2KJX A;  1GD7 A;  1B1Z A;  5G3L D;  4DR6 L;  2F0T A;  1G91 A;  3SHL A;  2ZJR A;  2WKD A;  2N88 A;  4QUC A;  3K5L A;  2Z6K C;  2WAQ G;  3AMU A;  4JI7 L;  5DM7 3;  3GP7 A;  3KOJ A;  1LT6 D;  1BKB A;  1M90 C;  1E2W A;  4U67 3;  3NBI A;  4EX5 A;  4CJ1 B;  1ZYR C;  1JC7 A;  5ISR A;  2L5T A;  1F77 A;  1VQM A;  3HOZ G;  3AU7 A;  4ALP A;  3H0G G;  3K8A A;  1TKW B;  3OMC A;  4RGO S;  1VMC A;  2MNA A;  3T1Y Q;  1WJJ A;  2R92 G;  5IP7 H;  3SDZ A;  1JWM D;  4MIU A;  2NVT B;  2RDF A;  2GN5 A;  5CV9 A;  5CV7 A;  3R93 A;  3BZK A;  3HS0 C;  3CRL C;  1U4R A;  4AYB B;  2ASB A;  3BDC A;  1I6V C;  4BBR H;  4FXD A;  3H91 A;  4DR3 Q;  4Z9C B;  4A3L G;  1IKL A;  2R7F A;  2AQ2 B;  1PYS B;  1CA5 A;  1JE4 A;  2UU9 Q;  2OWO A;  3H09 A;  4CJ0 B;  1E7Z A;  4ULL A;  2R93 H;  1Y8O B;  3GTM H;  3A5U A;  2R93 B;  4QIW B;  1L0W A;  3GTM B;  1V1Q A;  4ABN A;  3DUZ A;  2L15 A;  3KYH C;  3FMC A;  3VDY A;  2B63 G;  1XMO Q;  3T53 B;  3RD4 A;  3J81 i;  4LF5 Q;  4XDX A;  1DOK A;  2F0M A;  1ESR A;  4C1N I;  3HOW H;  4QUF A;  4C3J H;  3MXN A;  1S5D D;  3FDT A;  1CTM A;  4MZ9 A;  5AJ3 Q;  1XMQ Q;  3M7N A;  3HOW B;  2K33 A;  1TY0 A;  4C3J B;  3K7A H;  4XT3 B;  2KEC A;  3P20 A;  1SDF A;  4JK1 C;  2YTX A;  3K7A B;  3U58 A;  3BJU A;  1KAW A;  1G6P A;  3BYT B;  2PNH A;  4DAY B;  1MD2 D;  4HN7 A;  4PMW A;  1UNS A;  3OPO A;  2HHH Q;  4R4O A;  5IGG A;  1EEF D;  1IHZ A;  3QJY A;  2SDF A;  5EKL A;  4GNX A;  2JP1 A;  3M85 A;  2LKV A;  3TP6 A;  1STN A;  4XTC S;  1R9T B;  2RVL A;  5EBD A;  1MGS A;  5L37 A;  4LFA Q;  4LF8 Q;  1QJO A;  3OOC A;  4HJ8 A;  1NMF A;  1P8L A;  1EIF A;  2B39 A;  3VR3 A;  3UDG A;  4JYA L;  3IFT A;  1MI2 A;  1PTO H;  2K5W A;  2HDL A;  1ML0 D;  2FIN B;  4DXF A;  4IPD A;  1PTO B;  1TU2 B;  4BY1 G;  2CCZ A;  2EIF A;  3S24 A;  1SSO A;  2CWP A;  5EKI A;  2A73 B;  4CKB A;  2BDN A;  1KIX A;  1GKH A;  3GO5 A;  4A3G G;  2WV6 D;  1BBU A;  3D3R A;  3I70 A;  2Q8I B;  4LF9 L;  1OXV A;  2KCM A;  1MJE A;  3FKI G;  1F9P A;  1JWS D;  4R1J A;  3SE0 A;  5KRU A;  4IFD J;  2PZU A;  2F0G A;  4DNR B;  2PQE A;  1MHW C;  3T16 A;  1E1T A;  5IYD H;  4GN4 B;  1GUT A;  2NUC A;  4DV2 Q;  5LMU L;  4WOR A;  4KY6 A;  1JB7 A;  4DK6 C;  4DV3 Q;  4KN7 C;  1LV9 A;  4NXN L;  4EQ5 A;  5IIF A;  1AP0 A;  1BVS A;  4B3M Q;  1X3G A;  5FJ8 G;  5M5Y H;  4J15 A;  1PZJ D;  3GTJ H;  5M5Y B;  4TKO B;  1SFO H;  3GTJ B;  2Z4I A;  4HR7 B;  1F2Z A;  1HXY D;  2K5N A;  1SFO B;  2I5H A;  1YIJ A;  4R4Q A;  5ELO A;  4DV4 L;  4HJA A;  3A8K E;  3BZD B;  3MXN B;  2K1B A;  2F03 A;  1G2S A;  1ASZ A;  3G6E A;  3PSI A;  1O7Y A;  2F0P A;  1ILQ A;  2ALY B;  1JE5 A;  2EYM A;  2PI2 A;  5EGT A;  2ENB A;  2WFW A;  4CKC A;  5C4H A;  1EU3 A;  4B3R Q;  4DAM A;  2IHF A;  1ZXT A;  4OIJ A;  4DGZ A;  1KLG D;  2LFN A;  3P7J A;  5D14 A;  5CBE E;  3M7G A;  2O5J C;  4EGV A;  2WAQ B;  1Y8N B;  2P5Z X;  1FNU A;  3P75 A;  1ET9 A;  2F4I A;  3C2P A;  4RG1 A;  3W1G A;  3J81 c;  3K5N A;  2IW3 A;  3I73 A;  4K0K L;  3HOZ B;  3ND9 A;  1BCP C;  3H0G B;  4CBV A;  2HT1 A;  1NTG A;  1ROD A;  4PMC A;  1S72 A;  1FJG L;  2K6A A;  1CKM A;  2QW7 A;  3KUP A;  1C9O A;  2R92 B;  2RDG A;  1BR9 A;  1UUP A;  2MUY A;  1HUN A;  3M4O H;  3D8G A;  3QB3 A;  1OTC A;  1PHJ A;  3M4O B;  5BN4 A;  4A3K H;  5CYU A;  3I8Z A;  5FLM G;  1AZQ A;  1IYJ B;  3J80 i;  4MN3 A;  4A3L H;  1GUS A;  3E0J A;  2DNE A;  3I90 A;  1WD1 A;  4FF2 A;  2EYL A;  1D5M C;  1Y8P B;  4X62 Q;  4JI3 Q;  3SK5 A;  1V8Q A;  4H13 C;  1T5X D;  4FF3 A;  2F0O A;  2K5H A;  5IYC H;  2B8F A;  2WIN B;  2NBF A;  2CVR A;  2K4K A;  2NZH A;  2SOB A;  3PCO B;  4TSS A;  4DPG A;  1T9H A;  2Y0S G;  3CC4 A;  2NN6 I;  2QGQ A;  2B63 H;  2ICI A;  4JV5 Q;  1T5E A;  2B63 B;  3S1Q B;  2XRS D;  2ZTC A;  3SK4 A;  2IWH A;  4JI4 Q;  1VQF A;  1RHP A;  5C0X H;  2PW7 A;  1XNR L;  4DV6 Q;  1N8R C;  5KYI A;  2KHJ A;  1XXG A;  2VQE L;  4RCO A;  1BCP D;  2JA8 G;  2CHB D;  1VQH A;  4L5S A;  5GRO A;  2E2H H;  2RHQ B;  1CZG A;  2EY6 A;  1VF5 C;  2RSO A;  2E2H B;  2L55 A;  3CHB D;  3ERS X;  2RQX A;  2Q2T A;  4DR1 L;  1S4Z A;  1SE8 A;  2G9H D;  2YU9 H;  2KHS A;  1SRU A;  2YU9 B;  1RKN A;  1LTR D;  3QR8 A;  4RGM A;  3S1N H;  2G5D A;  3WOE A;  1SYF A;  2RHS B;  3S1N B;  3JAM i;  3W3A A;  2ZJP A;  4ZUJ A;  1K0R A;  1F9S A;  1BQQ T;  2UU9 L;  2H5X A;  1C8C A;  2LS0 1;  3BU2 A;  1KDC A;  5JOB A;  2E2I H;  1K8O A;  3PQI A;  4KLK A;  4HCS A;  4JOI C;  3TQY A;  4F88 A;  3TZU A;  2E2I B;  1JWU D;  3BVZ A;  5C4X G;  3DEO A;  4IO9 A;  4HSV A;  2B8G A;  1EY4 A;  4BY1 H;  4M1U B;  1V1O A;  1HA6 A;  1QZG A;  4WRD A;  3URY A;  2NZ1 D;  1NUC A;  4BY1 B;  3I4M G;  5JVG 3;  4FVM A;  4A3G H;  3DHQ A;  1J5E Q;  5AJ3 L;  2MP1 A;  4HMJ A;  4KHP Q;  4AQY Q;  4A3D H;  4A3G B;  2VQF Q;  3FKI H;  1MSG A;  1K83 H;  2K14 A;  4A3D B;  4Y7N H;  5F2D A;  3J7Y W;  3M4Q A;  1QNU A;  3FKI B;  4P72 A;  1LT4 D;  1K83 B;  3HKZ E;  4Y7N B;  4BS9 A;  4X6A H;  2F0U A;  4DUZ Q;  4KHZ A;  5C3W A;  3CCR A;  1ILP A;  4JBJ A;  5LL6 S;  4XQQ A;  2WII B;  2HHH L;  3E6Z X;  5IY0 A;  2MPM A;  4EQN A;  1NBW A;  1EYA A;  5FJ8 H;  1EWH A;  5CBA E;  3VR6 A;  2MFI A;  4LUV A;  3A8I E;  3HP3 A;  4OIK A;  3PO3 G;  3ULP A;  4S3S A;  1RJT A;  1XPR A;  4LFB Q;  1L1O A;  3GV6 A;  1X3F A;  3IAY A;  4GLV B;  1EQV A;  3NHH A;  4AIM A;  4C2M H;  2N49 A;  5EAY A;  4LFA L;  3OIQ A;  4IUR A;  5E7N A;  4C2M B;  4LF8 L;  2D62 A;  3GTQ H;  1SBB B;  2FFK B;  2BE5 C;  2B2U A;  1SE4 A;  3GTQ B;  1EWC A;  3T1H L;  5D65 A;  2DN8 A;  2JK8 A;  3HG9 A;  2N8N A;  3CCM A;  1FNW A;  1YNN D;  5E4X A;  2XRQ D;  2JQO A;  3KDF B;  3J80 c;  3X3M A;  4IJL A;  1KD1 C;  1G51 A;  2R6G A;  1VQ4 A;  2V1C C;  4NXM Q;  1EOV A;  1IYU A;  3QG1 A;  1SNC A;  5BR8 L;  4OEL B;  1K28 A;  1ZEQ X;  2E74 C;  3EVQ A;  3NUC A;  1ICF B;  2NVX H;  1G8Z D;  2UUB Q;  1EQR A;  1TS4 A;  3CAM A;  3PV0 A;  2NVX B;  1ENC A;  1J9O A;  1H9J A;  2N3S A;  4QQB X;  4XQN A;  1WTP A;  4DV2 L;  2B29 A;  1QZH A;  1YHA A;  5IP9 H;  4GKJ L;  1QE6 A;  5E1F A;  1EL0 A;  1WTR A;  2A8V A;  1IBL L;  5G3L F;  2RCF A;  3S1M H;  4A3B H;  3VA5 A;  1HZB A;  1SN8 A;  3ERO A;  5IYB G;  3OTO L;  5DEH A;  2K5Q A;  2L12 A;  1B9M A;  3S1M B;  4A93 G;  1VS0 A;  3RUZ A;  4OWW B;  1UE7 A;  1XYI A;  4ZYS A;  2JA7 H;  4O2D A;  2ID0 A;  1YIT A;  2EXZ A;  4DV7 L;  4LMQ D;  1VQO A;  2UUC Q;  4X64 L;  2JA7 B;  2PNR C;  1PRT B;  2BE5 D;  4KV6 A;  5IOD A;  2JYO A;  4RKL A;  1HNZ Q;  2K04 A;  4DA2 A;  1HTP A;  4I7A A;  5FLM H;  2K05 A;  3J7A F;  3KF8 A;  5CR3 A;  3HKS A;  1PTO C;  4I65 A;  3TS2 A;  3GTL H;  1XPO A;  1Y1W G;  2R7Z G;  1NY4 A;  4HCE A;  3JAM c;  2Q2U A;  4Q5V A;  1EYG A;  4LNQ A;  1LTG D;  2A68 C;  3AFQ A;  3S16 H;  4B08 A;  4WJ4 A;  4L5R C;  3UE1 A;  1YJ9 A;  2JEB I;  5CGK A;  4JW0 A;  3H3V C;  2JEA I;  3HOV H;  1E2V A;  1MIU A;  3PGZ A;  5C3E G;  3FPU B;  2ZTE A;  3HOV B;  1KDB A;  2Y0S B;  1X32 A;  3S9W A;  5DNF A;  1Y69 U;  2DUD A;  3SGI A;  2I07 B;  4KKU A;  5I6W A;  4PV1 C;  1HH2 P;  3SXH A;  3NK9 A;  4MTK A;  2O2L D;  4DAV A;  4JI2 L;  1NR2 A;  1N34 L;  2WKC A;  1Q82 C;  4IPG A;  1Q81 C;  1CHP D;  4L5Q A;  4HID A;  1KXL A;  4JCV E;  4DR2 Q;  5I9O A;  2IJ0 A;  4ZK9 B;  4JI0 Q;  1WTO A;  2A6H C;  1CHQ D;  4NPS A;  4LFC Q;  1V1P B;  3V2T A;  3CCS A;  2EDG A;  3EN2 A;  3MWY W;  3DMU A;  2XWJ B;  3T4A C;  1PLF A;  1S5B D;  1SMX A;  3C1F A;  3TRZ A;  4WJW A;  1HNW Q;  1CKN A;  1I4X A;  3S1R H;  1MSH A;  1WFQ A;  1TT2 A;  1TII D;  1PTO D;  4KKT A;  3D6W A;  4X62 L;  4YWM A;  1D6E C;  1O7I A;  2A68 D;  2F0H A;  4JI5 Q;  5KNB A;  3LWE A;  1IL8 A;  4LF7 Q;  3AEV A;  1X65 A;  4QJF A;  3VR4 A;  3A7L A;  3LGJ A;  3J81 j;  3ERQ A;  5C4X B;  3K7U C;  3QWN A;  5EBC A;  2LMC B;  2FJ2 A;  1FL0 A;  4DUY Q;  4JV5 L;  2IY5 B;  1A62 A;  5C5L A;  1PH3 A;  3GD7 A;  3M9B A;  3KF6 A;  4JI4 L;  3CME A;  3I4M B;  4DV6 L;  2Q2H A;  4DR4 Q;  1XJV A;  2JE6 I;  4N8F A;  2VB3 X;  1RDP D;  2A19 A;  3H6M A;  3L7Z C;  1CQF A;  1BOS A;  1PYW D;  1XX8 A;  3J81 E;  3SK6 A;  5E4W C;  1IXR A;  3VYU A;  1YHQ A;  1C0A A;  5KYL A;  3Q22 A;  4A3F G;  4A3J G;  3PUW A;  4LF6 Q;  3D4R A;  3CCQ A;  5EPK A;  1I50 H;  1OXT A;  2BH2 A;  2AWO A;  2A6H D;  1BBX C;  4YCV A;  1I50 B;  4LK1 C;  4B3S Q;  3I7F A;  3E0E A;  5JJI A;  3KF8 B;  1N36 Q;  2KCT A;  2X6G A;  3K81 C;  1QCB D;  1TWF H;  1KNA A;  3D6C A;  1GM5 A;  4BWG B;  2Q8T A;  1IZ6 A;  1TWF B;  2NVT H;  4CDF C;  2D5D A;  3U4Z A;  5CV8 A;  2ATW A;  4A3M H;  1SNP A;  2D2C C;  4A3M B;  1I94 Q;  3F1Z A;  1B9N A;  2QDB A;  4P75 A;  2PO4 A;  1SMY C;  2EXD A;  1YI2 A;  1B70 B;  1EU4 A;  1Q46 A;  1SNM A;  4B3T Q;  1TQO A;  3S2D H;  3KLS X;  1OXS C;  1RL2 A;  3D31 A;  4ZRZ A;  2F4V Q;  4ID6 A;  3S2D B;  4H02 A;  3I55 A;  3J81 L;  4FP5 D;  1PFS A;  1X55 A;  1O78 A;  2KED A;  4BXX G;  3A74 A;  3MA2 B;  1KLU D;  2OQ0 A;  2NTS A;  5DM6 3;  4AQY L;  3HGB A;  1J6Q A;  3N6R A;  1WTV A;  2NN6 G;  1U4M A;  1TR5 A;  5JEA H;  1K0S A;  2LXK A;  2AUJ D;  4ZCK A;  1DJR D;  2FXQ A;  2JA5 G;  2F0Q A;  1Y14 B;  1K73 C;  2XN9 C;  4X3K A;  2AHO B;  1O7Z A;  2UXB Q;  1CKO A;  1YZ6 A;  3ULL A;  1RF2 D;  5IWA Q;  3QIA A;  4IN3 A;  4A93 H;  4YY3 Q;  5JJK A;  4ODG A;  2NWG A;  2V4D A;  4A93 B;  2CQO A;  4BBS G;  1JJG A;  2E75 C;  3A55 A;  3VYT A;  1SMY D;  5I4D A;  3AQQ A;  2K7V A;  1GUO A;  1YHB A;  2B3G A;  3CKI B;  3CC7 A;  3HRZ C;  5IT9 c;  1R9T H;  3T51 B;  1EQQ A;  1EY6 A;  4OL7 A;  2JJQ A;  5M5W H;  2BH8 A;  2EE1 A;  3KBX A;  5M5W B;  3T13 A;  1X3E A;  3Q23 A;  4GKK Q;  1HUM A;  3R2T A;  1PA6 A;  5CV4 A;  1Y1W H;  2R7Z H;  5T1I A;  1A0I A;  4BA1 I;  4UY8 C;  1Y1W B;  2R7Z B;  2VY3 A;  1N33 Q;  5LMN Q;  1X3P A;  2JA6 G;  4HSP A;  2Z6K A;  1NSN S;  3H3V H;  4X66 L;  2UUB L;  1Q86 C;  1AW7 A;  2KQ3 A;  1UAP A;  2CW0 C;  1WYD A;  4TVA B;  2FMC A;  4RH6 A;  1HZA A;  1RTO A;  3HEJ A;  2D0P A;  2CQA A;  3BG3 A;  2XNA C;  3NE5 B;  4DV1 Q;  1Q8K A;  1JCK B;  3AFP A;  4C1N K;  1A3U A;  1HNX L;  1RD9 D;  1E24 A;  3HKZ G;  1QUQ A;  2KCN A;  2EYJ A;  4TQU S;  1A3T A;  3MEF A;  3KJO A;  2MHV A;  1DD2 A;  1NMG A;  3KLS A;  4UDU C;  2UUC L;  2B2T A;  4C56 C;  3CC2 A;  3TSS A;  1WCM G;  1PZI D;  2A6E D;  1BCP F;  2GVA A;  2EZV A;  2UXC L;  3PIO A;  5CMD A;  2JXM B;  1C4Q A;  1HNZ L;  1PRT F;  1M4V A;  1E0B A;  2F0I A;  3P1H A;  2IHE A;  4NP5 A;  1HPC A;  1K8M A;  2EOT A;  2E2J H;  1B3Q A;  1F2M A;  3KFU A;  2PZW A;  1CFM A;  4JI1 L;  3K5O A;  2E2J B;  3G71 A;  1VQ6 A;  3VA7 A;  3ONA B;  3J80 E;  5FOB B;  1KAB A;  3QO2 A;  4G7O C;  3RLF A;  4GS3 A;  3VYS A;  1JIC A;  1UE6 A;  4K5V A;  3S14 H;  4IUQ A;  3GV3 A;  4QF4 A;  3S14 B;  1R4P B;  2CW0 D;  2PW5 A;  4RGT A;  4HTH A;  1H95 A;  1II3 A;  3FP9 A;  4FXK C;  3PO2 G;  1TXY A;  2X69 A;  1QVF A;  4POG A;  3STB C;  3NXW A;  3QOJ A;  2DY7 A;  4DV0 Q;  1LM0 A;  1I6H B;  1CSP A;  1LO5 D;  4GNX B;  2HUG A;  4A3F H;  2DNC A;  4A3J H;  2PQA A;  4OWT B;  4A3F B;  1X9N A;  4A3J B;  4JI0 L;  1VQG A;  3K59 A;  5M3M G;  3HOZ H;  1VQL A;  3EJI A;  3H0G H;  2HIV A;  4LFC L;  1E22 A;  4UHV A;  1SYB A;  4J8Q A;  4QB4 A;  2CWA A;  2YV5 A;  2Q8R E;  3J80 L;  1PRT C;  2R92 H;  4DR7 Q;  1HNW L;  1EWI A;  1VMP A;  4HED A;  2ZTD A;  2EYP A;  1X54 A;  4IFD G;  5JJL A;  5GAG C;  1BBW A;  1SJH D;  1X3Q A;  2ZXO A;  3F2C A;  2F0W A;  4X65 Q;  4H0L C;  3SR1 A;  3C46 A;  4PMB A;  4LF4 Q;  4JI5 L;  4POF A;  5LMN W;  2K28 A;  4F8M A;  5I6Y A;  1B7Y B;  3JAM E;  4O42 A;  4LF7 L;  1WI5 A;  1EYD A;  2AMC B;  5C4Z A;  3CCV A;  3GTK B;  4GN5 A;  5LHY 1;  4K8I A;  4LUO A;  1A6X A;  1TY2 A;  3PF5 A;  4RFB A;  3R3O A;  2RCN A;  1Z9F A;  4DUY L;  1JJ2 A;  4KJO A;  3Q6S A;  4BXX H;  4FO2 A;  3CCJ A;  1QUQ B;  3STB D;  4DR4 L;  1QWY A;  1ZKO A;  1L0X B;  1A63 A;  4KK7 A;  4JBM A;  2QEJ C;  2HQL A;  3U9S A;  4DXG A;  3EA6 A;  1B53 A;  4BY7 G;  3S1Q H;  1UE5 A;  3OIP A;  5FLX c;  4HIK A;  4KD4 A;  3GTG H;  4G7Z C;  1EZ8 A;  1CQV A;  3OHX C;  2B2W A;  2YTY A;  1DZ1 A;  3NQI A;  3GTG B;  2NTT A;  1A8V A;  1UE1 A;  1K3B C;  4B3S L;  5A2Q E;  1CT1 D;  2QF7 A;  3ZJY C;  1N32 Q;  1K3R A;  1OXX K;  2L1B A;  1N36 L;  3MHB A;  1BXT A;  4FDB A;  5IGB A;  1PRT D;  3G4S A;  3JAM L;  3T1Y L;  2BA0 A;  5KGU A;  4OON A;  1AE2 A;  2VL6 A;  5LL6 X;  3NP8 A;  3K80 C;  3V96 A;  4BBS H;  1NJI C;  4K2K A;  1SAP A;  1I94 L;  4DR6 Q;  2SNS A;  5C0X I;  4BBS B;  2F0E A;  3OWE B;  1LTL A;  1SNO A;  2N78 A;  2K52 A;  3PUV A;  4JI7 Q;  4DR3 L;  1HFN A;  2F4V L;  1H9K A;  1XWE A;  1Q3L A;  4P74 A;  2SEB D;  4PQX A;  2F0J A;  5DLQ E;  1STY A;  5BN5 A;  4K5X A;  5A2Q L;  1LTT D;  4OO1 G;  1SYC A;  2B2Y C;  2I46 A;  3HOX G;  3J7A V;  2I0Q A;  4A3I G;  1XMO L;  1F9R A;  2JA6 H;  4LF5 L;  2JA6 B;  3O13 A;  3PIP A;  1YNN C;  1YNJ D;  1D7Q A;  4HIO A;  2PMZ E;  1S40 A;  1XMQ L;  2EPB A;  1J8I A;  3C1E A;  3TP7 A;  1AEX A;  3RZD H;  2RA4 A;  5FO8 B;  1SNQ A;  3CPF A;  1HA5 A;  3RZD B;  3NQT A;  1QIL A;  4MTN A;  4JBW A;  5IWA L;  2H4O A;  4UP8 A;  1U0L A;  4K8J A;  3ER0 A;  5EJW A;  4YY3 L;  3DWA A;  1CSQ A;  3ICE A;  3KK7 A;  2L11 A;  2E2D C;  2VUM G;  1LT5 D;  2NVQ B;  3HKZ B;  4G57 A;  1AZP A;  3MFY A;  4RWS C;  4Y52 H;  2L4N A;  2LSS A;  1GVP A;  1WCM H;  2MJ8 A;  2EYF A;  3CP0 A;  4RGN A;  5HGQ A;  1WCM B;  1DOM A;  1JQY D;  2EY5 A;  2OF1 A;  4IPH A;  1E2Z A;  1KNE A;  4KN4 C;  3ITP A;  5FKA C;  2R3Z A;  4A4I A;  2RSN A;  1EIH A;  4GKK L;  1QVG A;  3DM1 A;  3S15 B;  1S5C D;  4IUV A;  1N33 L;  1EY5 A;  5LMN L;  4LJZ C;  3LX0 A;  2KUM A;  2XTI A;  2C5C A;  1PH9 A;  5C3X A;  2ZM6 Q;  4JI6 Q;  3Q0A A;  1PTO F;  5J3B A;  1HHV A;  4DN4 M;  1O80 A;  4AH6 A;  3PUZ A;  4OHJ A;  4X3T A;  3WWV A;  1RIP A;  4BBR G;  3PO2 H;  1DCZ A;  2B2V A;  4EQO A;  2K5D A;  2EYO A;  3PO2 B;  3IRB A;  5BN3 A;  1I3Q H;  3B6Y A;  3HOU G;  2A5H A;  2ES2 A;  1VQJ A;  1QOH A;  2QDL A;  4DV1 L;  3W2D A;  1PXU A;  1I3Q B;  4DR5 Q;  1YJW A;  4OX9 Q;  2K01 A;  3E9H A;  1ENF A;  4OGQ C;  3A8J E;  4KMU C;  1H9M A;  4PG3 A;  4DV3 L;  5FO9 B;  4JYA Q;  1WVL A;  1A2U A;  5C4J H;  1K9M C;  1LTA D;  2EY2 A;  5M3M H;  3OSO A;  5IGD A;  1HZC A;  3EBE A;  4B3M L;  5C4J B;  5M3M B;  1EY0 A;  3E5S A;  3NWS A;  1XTC D;  3WOF A;  1D1K A;  1R4Q B;  1AFP A;  3FPP A;  3TBI B;  5IT9 E;  3HOW G;  2VS1 A;  2F1M A;  2R61 A;  4IFD H;  4ILW A;  1W6K A;  3G6J B;  2WAC A;  1JOQ A;  4UPA A;  1Q8I A;  2K50 A;  2LY7 A;  4ZKC B;  5H1S E;  2CH4 W;  1B2T A;  4HAE A;  3OW2 A;  3RN5 A;  5ELF A;  2E5L Q;  2Z6B A;  1VQ5 A;  3TEH B;  2QIL A;  2K03 A;  4DKA C;  1VQN A;  3E9I A;  1LAB A;  5LMU Q;  3F8T A;  3K0X A;  2DJF C;  4B3R L;  3VR2 A;  4IOC A;  2HIX A;  1IBK Q;  4CDC C;  1STA A;  1LUZ A;  1ET6 A;  4C3H G;  3DM3 A;  4DF7 A;  3KJP A;  1K8G A;  4BY7 H;  3PUY A;  2DJG C;  2DY8 A;  1KDA A;  2F3I A;  3KLR A;  4BY7 B;  3KBG A;  5IT9 L;  4YHH Q; 
#chains in the Genus database with same CATH homology
 3BS1 A;  2KVM A;  1WTW A;  1AN8 A;  5A35 A;  3N52 A;  3D4W A;  1HQR D;  1JB3 A;  3H94 A;  2JA8 B;  4ZAI A;  1HCZ A;  2EJM A;  4XT1 B;  4FF4 A;  2F0V A;  1PZK D;  3MFG A;  3PIO 3;  2PCF B;  2F0D A;  3A54 A;  1PDQ A;  3GQB A;  5K36 G;  5EKK A;  4RA8 A;  3C3L A;  4XIG S;  4F7X A;  2EY1 A;  1B4O A;  1EYC A;  3TDQ A;  1Q90 A;  1GUN A;  4ZUI A;  1TWH B;  3X3N A;  2MGS A;  3U9O A;  3I3C A;  2SNM A;  5J39 A;  3T56 B;  1G29 1;  4OO1 H;  1HTL D;  3TP5 A;  1ESF A;  5CV5 A;  3HOX B;  2FHT A;  1RCV D;  2TMP A;  1GUW A;  2KCC A;  3MXU A;  1CK1 A;  2AQ1 B;  3DEP A;  1NR4 A;  4LAA A;  4DAY A;  1SYD A;  2NVY B;  4IZ8 A;  5C0X J;  4B9X A;  2EJG C;  4J6H A;  4TRD A;  1EOT A;  3K6O A;  2OXP A;  4QMG A;  2HQE A;  1DOL A;  2D9U A;  2VUM B;  1EFI D;  4CKE A;  2IL8 A;  3EQL C;  3PO3 B;  5JJZ A;  4IQZ A;  1TWG B;  3ZYY X;  2FMM A;  3MAQ A;  1CI3 M;  1Z6H A;  5KNC A;  4NKL A;  2EYH A;  2VNU D;  2BA1 A;  3HZX A;  4NMZ A;  3V05 A;  1B3A A;  1VCI A;  2A74 C;  2B2T C;  1I4R A;  5FLX E;  3OMG A;  1SJE D;  4RHR A;  2G9D A;  1H9R A;  5IGF A;  3A7A B;  1OO9 B;  4BBR B;  1V43 A;  3MEH A;  1HQM C;  2TSS A;  1LLR D;  3HOU B;  5JPN C;  3NWT A;  5CC4 A;  2NYZ D;  1STH A;  4N9T A;  1D2B A;  3BVM A;  4EVO A;  1BF4 A;  4K6D A;  2L9H A;  4FNF A;  5EPL A;  3Q24 A;  2HCI A;  1STB A;  4C3I G;  3MVV A;  2HDM A;  1ZYR D;  1Q12 A;  1EEI D;  1EY9 A;  5C0X G;  5J22 A;  5ELE A;  5M5X B;  5FLX L;  1SEB D;  4RHS A;  2A6E C;  1GOZ A;  3G7L A;  3VR5 A;  1M8A A;  4R8N A;  3S2H B;  2J0T D;  5COY A;  4CJ2 C;  2F0N A;  5C5M A;  2F3W A;  3PMF A;  3PIP 3;  5D3I B;  1DXM A;  2Z1C A;  2O5I C;  1H9S A;  3I72 A;  4C3H B;  5ELC A;  5C3E B;  3K58 A;  4H7B A;  2NB0 A;  5FO7 B;  5COR A;  3MZ5 A;  3IKJ A;  4RCN A;  1I4P A;  3K0Y A;  1S5F D;  2F0S A;  1TWC B;  4KJN A;  4N9P A;  4P2C B;  4RKB A;  3LNN A;  4X3U A;  4ME5 A;  4RAU C;  2AUK A;  3ND8 A;  5T1G A;  5K36 H;  1EIG A;  5M3F B;  1STE A;  1SYE A;  2BOS A;  2B2W C;  3K57 A;  4IUT A;  4CGY B;  1ENA A;  3LWU A;  5JPM C;  2YYZ A;  3NPP A;  5I2X A;  1DON A;  2KOL A;  1C48 A;  4IAL A;  4DK0 A;  1B50 A;  4FYD A;  4XYO A;  4L63 B;  1CZW A;  1JOK A;  1G6Z A;  2F3V A;  3L9A X;  3R2I A;  5JAV A;  2C9O A;  1EY7 A;  1A15 A;  1PFM A;  2QKI C;  3NTH A;  3FEW X;  1U4L A;  3GTP B;  3PUX A;  1HRJ A;  2KEE A;  1WTX A;  1W6J A;  2JSO A;  1GHJ A;  3S17 B;  2ZXP A;  2ZXR A;  3I91 A;  3AB9 A;  4IUN A;  2IX3 A;  2PPB C;  2J7Z A;  3SVM A;  1H9S B;  3MTS A;  2ZT9 C;  2EJF C;  5EPJ A;  2HCC A;  3NTI A;  3WDN A;  2EVB A;  3M3Y B;  2VXW A;  2IX0 A;  1FD7 D;  4ZLT F;  3UI2 A;  3FVQ A;  1EQT A;  3QOL A;  2PYK A;  2N55 A;  3DXJ C;  1TS3 A;  3RMH A;  2F0L A;  3D4D A;  5ELD A;  2J4X A;  4DNT B;  4L6T B;  3DWP A;  2NN6 H;  2L0C A;  3CQZ B;  4G7H C;  3HOY B;  3DWQ A;  4A3K B;  4KD3 A;  4R8I A;  1GXD C;  1SXT A;  1YNJ C;  1QG7 A;  2JA5 B;  2B2U C;  3MC0 B;  1I4Q A;  1LTB D;  4ZQ3 A;  5HUR A;  5DAU A;  4MHE A;  1Y1V B;  2AQ3 B;  4GZY C;  1EY8 A;  2QCP X;  4KY5 A;  2E76 C;  1STG A;  4DU9 A;  4C3I B;  1WD0 A;  2B2V C;  1DYQ A;  3EFX D;  1SE3 A;  1GHK A;  1D1I A;  1BO0 A;  1PFN A;  4HMI A;  3TP8 A;  5TSS A;  4B9W A;  2F0F A;  4KTA A;  3L3O C;  1DM0 B;  4K5W A;  3RZO B;  1Z7T A;  2K32 A;  4U68 A;  4G4K A;  5AFW A;  1G2T A;  1PMR A;  2XWB B;  4XXE A;  2AWN A;  1FYC A;  2M9V A;  1L0Y B;  3OW7 A;  3MXG A;  5JEA J;  1U4P A;  5E3F A;  1U9R A;  3FRP B;  4DAP A;  1OXU A;  5I9P A;  2IT1 A;  1FNV A;  1BNZ A;  5J1Z A;  3A56 A;  2PMZ B;  3BYY B;  5KEE A;  1NCV A;  2OEO A;  5JVH 3;  3CRK C;  1GJX A;  3OWF A;  1IYV A;  5IGE A;  2PZT A;  1FR3 A;  3K5M A;  1LTS D;  4IUU A;  2XSC A;  3IL8 A;  3VYR A;  1I4G A;  3SEB A;  2VB2 X;  4K2L A;  1F9Q A;  1LAC A;  1FGB D;  5KIX A;  1B44 D;  5ELB A;  2M2L A;  1EZ6 A;  1JOR A;  1Q1E A;  2XVS A;  2F0K A;  4H44 C;  2RDH A;  3SK8 A;  3I4L A;  2O4X A;  3IFD A;  4A3E B;  4UAI A;  3MXP A;  3NBH A;  4XYQ A;  3TZD A;  5EQ0 A;  3GTO B;  2Z8L A;  5K5P A;  4J1M A;  4M8A A;  4NW2 A;  4K6L A;  5IOC A;  1TWA B;  3BDL A;  1LT3 D;  1ONL A;  4PNY A;  1V1P A;  4DK1 A;  4NDX A;  1KTK A;  4R9W A;  2WP8 J;  1TVX A;  1Z47 A;  2KA7 A;  2M00 A;  1D5Z C;  5JEA G;  4EQP A;  4BA2 I;  5HGT A;  3CU7 A;  4KY7 A;  1UEA B;  4C3J G;  1F2Y A;  1CA6 A;  1WTQ A;  4KHV A;  1BDO A;  3BVG A;  1JR0 D;  4V19 0;  1Q1B A;  1RTN A;  4A3B B;  5M9O A;  5C6A A;  4X3S A;  2RKS A;  4V0B A;  4WFN 3;  2Z4H A;  1O7L A;  1JOO A;  2B2Y A;  1ICW A;  1BCP B;  4IFD I;  5KND A;  1IW7 C;  4K14 A;  4F87 A;  2RBM A;  1VF7 A;  1TS5 A;  1QNK A;  2A69 C;  1S5E D;  4YIJ A;  4E6I A;  1LTI D;  1QB5 D;  1NAP A;  3GTL B;  2BDO A;  5FK9 C;  1F2L A;  3S16 B;  5C44 B;  4FF1 A;  4FXG C;  5CV6 A;  2BCO A;  4CHT B;  1IKM A;  4O1N A;  4KKS A;  5IGC A;  1TS2 A;  1SYG A;  4ZKB B;  1A3V A;  4I7Z C;  2WB1 B;  1KAA A;  4Q0F A;  4L8J A;  5I2Y A;  4QCL A;  2XIW A;  3TN2 A;  1A2T A;  1SND A;  3TME A;  5D3D A;  1HFG A;  4DFA A;  4KI0 A;  3F2U A;  1IW7 D;  1PFB A;  2IX1 A;  1GUG A;  2X6L A;  3BDO A;  2A69 D;  1CM9 A;  2ICE C;  4IUP A;  5NUC A;  4A3I B;  1SE2 A;  3S1R B;  1D5X C;  1BUV T;  2OT2 A;  4XQJ A;  1MBY A;  1I4H A;  3M4Y A;  2GA4 B;  3I4N B;  3R8B A;  2IPK D;  4OO1 I;  1VDZ A;  3NSW A;  3NTK A;  2H1E A;  2KJX A;  5G3L D;  1B1Z A;  2F0T A;  1G91 A;  3SHL A;  2WKD A;  2N88 A;  4QUC A;  3K5L A;  3AMU A;  5DM7 3;  3GP7 A;  1LT6 D;  1E2W A;  4U67 3;  3NBI A;  4CJ1 B;  1ZYR C;  1JC7 A;  5ISR A;  2L5T A;  1F77 A;  3AU7 A;  1TKW B;  3OMC A;  4RGO S;  1VMC A;  3SDZ A;  1JWM D;  4MIU A;  2NVT B;  2RDF A;  5CV9 A;  5CV7 A;  3R93 A;  3HS0 C;  3CRL C;  1U4R A;  4AYB B;  3BDC A;  1I6V C;  4FXD A;  3H91 A;  4Z9C B;  1IKL A;  2AQ2 B;  1CA5 A;  1JE4 A;  3H09 A;  4CJ0 B;  4ULL A;  1Y8O B;  2R93 B;  4QIW B;  3GTM B;  4ABN A;  3DUZ A;  3FMC A;  3T53 B;  3RD4 A;  4XDX A;  1DOK A;  2F0M A;  1ESR A;  4C1N I;  4QUF A;  3MXN A;  1S5D D;  3FDT A;  1CTM A;  3M7N A;  3HOW B;  2K33 A;  1TY0 A;  4C3J B;  4XT3 B;  2KEC A;  3P20 A;  1SDF A;  4JK1 C;  3K7A B;  3BYT B;  1MD2 D;  4HN7 A;  4PMW A;  1UNS A;  3OPO A;  5IGG A;  1EEF D;  1IHZ A;  3QJY A;  2SDF A;  5EKL A;  2JP1 A;  3M85 A;  2LKV A;  3TP6 A;  1STN A;  4XTC S;  1R9T B;  2RVL A;  5EBD A;  1MGS A;  1QJO A;  3OOC A;  2B39 A;  3VR3 A;  3IFT A;  1MI2 A;  1PTO H;  2K5W A;  2HDL A;  1ML0 D;  2FIN B;  4DXF A;  1PTO B;  1TU2 B;  1SSO A;  5EKI A;  2A73 B;  4CKB A;  2BDN A;  3GO5 A;  2WV6 D;  3D3R A;  3I70 A;  2Q8I B;  1OXV A;  1F9P A;  1JWS D;  3SE0 A;  5KRU A;  4IFD J;  2PZU A;  2F0G A;  4DNR B;  2PQE A;  3T16 A;  1GUT A;  2NUC A;  4WOR A;  4KY6 A;  4KN7 C;  1LV9 A;  5IIF A;  1AP0 A;  1PZJ D;  5M5Y B;  4TKO B;  3GTJ B;  2Z4I A;  4HR7 B;  1F2Z A;  1HXY D;  1SFO B;  3A8K E;  3BZD B;  2F03 A;  2K1B A;  1G2S A;  1O7Y A;  2F0P A;  1ILQ A;  2EYM A;  5EGT A;  2ENB A;  4CKC A;  5C4H A;  1EU3 A;  1ZXT A;  4OIJ A;  4DGZ A;  1KLG D;  2LFN A;  3P7J A;  5D14 A;  5CBE E;  3M7G A;  2O5J C;  4EGV A;  2WAQ B;  1Y8N B;  1FNU A;  3P75 A;  1ET9 A;  2F4I A;  3C2P A;  3K5N A;  2IW3 A;  3I73 A;  3HOZ B;  3ND9 A;  1BCP C;  3H0G B;  4CBV A;  1ROD A;  4PMC A;  2K6A A;  3KUP A;  2R92 B;  2RDG A;  1BR9 A;  1UUP A;  2MUY A;  1HUN A;  3D8G A;  3QB3 A;  3M4O B;  5BN4 A;  5CYU A;  3I8Z A;  1AZQ A;  4MN3 A;  1GUS A;  3E0J A;  2DNE A;  3I90 A;  1WD1 A;  4FF2 A;  2EYL A;  1D5M C;  1Y8P B;  3SK5 A;  1V8Q A;  4H13 C;  1T5X D;  4FF3 A;  2F0O A;  2B8F A;  2WIN B;  2NBF A;  2CVR A;  2SOB A;  4TSS A;  2NN6 I;  2ICI A;  1T5E A;  2B63 B;  3S1Q B;  2XRS D;  3SK4 A;  2IWH A;  1RHP A;  5C0X H;  2PW7 A;  5KYI A;  1XXG A;  4RCO A;  1BCP D;  2CHB D;  1CZG A;  2EY6 A;  1VF5 C;  2RSO A;  2E2H B;  2L55 A;  3CHB D;  2RQX A;  1S4Z A;  2G9H D;  2KHS A;  2YU9 B;  1RKN A;  1LTR D;  4RGM A;  3WOE A;  1SYF A;  3S1N B;  3W3A A;  4ZUJ A;  1F9S A;  1BQQ T;  1C8C A;  2LS0 1;  1KDC A;  5JOB A;  1K8O A;  4HCS A;  4F88 A;  3TZU A;  2E2I B;  1JWU D;  3BVZ A;  3DEO A;  4HSV A;  2B8G A;  1EY4 A;  4M1U B;  1V1O A;  1HA6 A;  4WRD A;  3URY A;  2NZ1 D;  1NUC A;  4BY1 B;  5JVG 3;  4FVM A;  3DHQ A;  2MP1 A;  4HMJ A;  4A3G B;  1MSG A;  4A3D B;  5F2D A;  3J7Y W;  1QNU A;  3FKI B;  1LT4 D;  1K83 B;  4Y7N B;  4BS9 A;  2F0U A;  4KHZ A;  5C3W A;  1ILP A;  5LL6 S;  4XQQ A;  2WII B;  3E6Z X;  2MPM A;  4EQN A;  1EYA A;  1EWH A;  5CBA E;  3VR6 A;  3A8I E;  3HP3 A;  4OIK A;  4S3S A;  1RJT A;  3GV6 A;  3IAY A;  1EQV A;  3NHH A;  3OIQ A;  4IUR A;  4C2M B;  2D62 A;  1SBB B;  2FFK B;  2BE5 C;  2B2U A;  1SE4 A;  3GTQ B;  1EWC A;  5D65 A;  2DN8 A;  3HG9 A;  1FNW A;  1YNN D;  5E4X A;  2XRQ D;  3X3M A;  2R6G A;  1IYU A;  3QG1 A;  1SNC A;  1ZEQ X;  2E74 C;  3EVQ A;  3NUC A;  1G8Z D;  3PV0 A;  1TS4 A;  2NVX B;  1ENC A;  1J9O A;  1H9J A;  4XQN A;  1WTP A;  1EL0 A;  1QE6 A;  5E1F A;  1WTR A;  5G3L F;  3VA5 A;  3ERO A;  5DEH A;  2K5Q A;  2L12 A;  1B9M A;  3S1M B;  3RUZ A;  1XYI A;  4ZYS A;  2ID0 A;  2EXZ A;  4LMQ D;  2JA7 B;  2PNR C;  1PRT B;  2BE5 D;  4KV6 A;  5IOD A;  2JYO A;  4RKL A;  2K04 A;  4DA2 A;  1HTP A;  3J7A F;  2K05 A;  3KF8 A;  5CR3 A;  1PTO C;  4I65 A;  4HCE A;  4Q5V A;  1LTG D;  2A68 C;  4B08 A;  2JEB I;  5CGK A;  3H3V C;  2JEA I;  1E2V A;  3FPU B;  3HOV B;  1KDB A;  2Y0S B;  1X32 A;  3S9W A;  5DNF A;  1Y69 U;  2I07 B;  4KKU A;  5I6W A;  4PV1 C;  3SXH A;  3NK9 A;  2O2L D;  4DAV A;  1NR2 A;  2WKC A;  1CHP D;  5I9O A;  2IJ0 A;  4ZK9 B;  1WTO A;  2A6H C;  1CHQ D;  1V1P B;  3V2T A;  2EDG A;  3MWY W;  3DMU A;  2XWJ B;  3T4A C;  1PLF A;  1S5B D;  3C1F A;  4WJW A;  1I4X A;  1MSH A;  1TT2 A;  1TII D;  1PTO D;  4KKT A;  3D6W A;  1D6E C;  2A68 D;  2F0H A;  5KNB A;  3LWE A;  1IL8 A;  3VR4 A;  3A7L A;  3ERQ A;  5C4X B;  5EBC A;  3QWN A;  2LMC B;  2FJ2 A;  5C5L A;  3GD7 A;  3I4M B;  2JE6 I;  2VB3 X;  1RDP D;  3H6M A;  3L7Z C;  1CQF A;  1BOS A;  1PYW D;  1XX8 A;  3J81 E;  3SK6 A;  5E4W C;  3VYU A;  5KYL A;  3Q22 A;  3PUW A;  3D4R A;  5EPK A;  1OXT A;  2AWO A;  2A6H D;  1BBX C;  1I50 B;  4LK1 C;  2X6G A;  1QCB D;  1KNA A;  3D6C A;  4BWG B;  2Q8T A;  1TWF B;  2D5D A;  5CV8 A;  1SNP A;  2D2C C;  4A3M B;  1B9N A;  2QDB A;  2PO4 A;  1SMY C;  1EU4 A;  1SNM A;  1TQO A;  3KLS X;  1OXS C;  3D31 A;  4ZRZ A;  4ID6 A;  3S2D B;  3J81 L;  4FP5 D;  1O78 A;  2KED A;  3MA2 B;  1KLU D;  2NTS A;  5DM6 3;  3HGB A;  3N6R A;  1WTV A;  2NN6 G;  1U4M A;  1TR5 A;  5JEA H;  2AUJ D;  1DJR D;  2F0Q A;  2XN9 C;  4X3K A;  1O7Z A;  1RF2 D;  3QIA A;  4IN3 A;  4ODG A;  2NWG A;  2V4D A;  4A93 B;  2E75 C;  3A55 A;  3VYT A;  1SMY D;  5I4D A;  2K7V A;  1GUO A;  3CKI B;  3HRZ C;  3T51 B;  1EY6 A;  4OL7 A;  2EE1 A;  3KBX A;  5M5W B;  3T13 A;  3Q23 A;  1HUM A;  3R2T A;  5CV4 A;  5T1I A;  4BA1 I;  1Y1W B;  2R7Z B;  1X3P A;  4HSP A;  1NSN S;  1AW7 A;  2KQ3 A;  1UAP A;  2CW0 C;  2FMC A;  4RH6 A;  1RTO A;  3HEJ A;  2CQA A;  3BG3 A;  2XNA C;  3NE5 B;  1JCK B;  4C1N K;  1A3U A;  1RD9 D;  2KCN A;  2EYJ A;  4TQU S;  1A3T A;  2MHV A;  1DD2 A;  3KLS A;  4UDU C;  2B2T A;  4C56 C;  3TSS A;  1PZI D;  2A6E D;  1BCP F;  2EZV A;  5CMD A;  2JXM B;  1C4Q A;  1PRT F;  1M4V A;  1E0B A;  2F0I A;  3P1H A;  4NP5 A;  1HPC A;  1K8M A;  2EOT A;  1F2M A;  2PZW A;  1CFM A;  3K5O A;  2E2J B;  3VA7 A;  3ONA B;  3J80 E;  5FOB B;  1KAB A;  3QO2 A;  4G7O C;  3RLF A;  3VYS A;  1JIC A;  4K5V A;  4IUQ A;  3GV3 A;  4QF4 A;  3S14 B;  1R4P B;  2CW0 D;  2PW5 A;  4RGT A;  4HTH A;  1II3 A;  4FXK C;  2X69 A;  3NXW A;  3QOJ A;  2DY7 A;  1I6H B;  1LO5 D;  2HUG A;  2DNC A;  4A3F B;  4A3J B;  3K59 A;  3EJI A;  1SYB A;  4J8Q A;  4QB4 A;  2Q8R E;  3J80 L;  1PRT C;  1VMP A;  4HED A;  4IFD G;  2EYP A;  1SJH D;  1X3Q A;  2ZXO A;  2F0W A;  4H0L C;  3SR1 A;  3C46 A;  4PMB A;  2K28 A;  4F8M A;  5I6Y A;  3JAM E;  4O42 A;  1EYD A;  5C4Z A;  3GTK B;  5LHY 1;  4K8I A;  1A6X A;  1TY2 A;  4RFB A;  3R3O A;  4KJO A;  3Q6S A;  4FO2 A;  1QWY A;  1ZKO A;  1L0X B;  4KK7 A;  2QEJ C;  3U9S A;  4DXG A;  3EA6 A;  1B53 A;  3OIP A;  4KD4 A;  4G7Z C;  1EZ8 A;  1CQV A;  3OHX C;  2B2W A;  1DZ1 A;  3NQI A;  3GTG B;  2NTT A;  5A2Q E;  1CT1 D;  2QF7 A;  1OXX K;  2L1B A;  3MHB A;  1BXT A;  5IGB A;  1PRT D;  3JAM L;  2BA0 A;  5KGU A;  5LL6 X;  3NP8 A;  3V96 A;  4K2K A;  1SAP A;  2SNS A;  5C0X I;  4BBS B;  2F0E A;  3OWE B;  1SNO A;  3PUV A;  1HFN A;  1H9K A;  1XWE A;  1Q3L A;  2SEB D;  4PQX A;  2F0J A;  1STY A;  5BN5 A;  4K5X A;  5A2Q L;  1LTT D;  4OO1 G;  1SYC A;  2B2Y C;  2I46 A;  3J7A V;  1F9R A;  2JA6 B;  3O13 A;  1YNN C;  1YNJ D;  2EPB A;  1J8I A;  3C1E A;  3TP7 A;  1AEX A;  2RA4 A;  5FO8 B;  1SNQ A;  1HA5 A;  3RZD B;  3NQT A;  1QIL A;  4JBW A;  2H4O A;  5EJW A;  4K8J A;  3DWA A;  3KK7 A;  2L11 A;  2E2D C;  1LT5 D;  2NVQ B;  3HKZ B;  4G57 A;  1AZP A;  3MFY A;  4RWS C;  2L4N A;  2MJ8 A;  2EYF A;  4RGN A;  1WCM B;  1DOM A;  1JQY D;  2EY5 A;  2OF1 A;  1E2Z A;  1KNE A;  4KN4 C;  3ITP A;  5FKA C;  2R3Z A;  1EIH A;  2RSN A;  3DM1 A;  3S15 B;  1S5C D;  4IUV A;  1EY5 A;  4LJZ C;  3LX0 A;  2KUM A;  2C5C A;  5C3X A;  3Q0A A;  1PTO F;  1HHV A;  4DN4 M;  1O80 A;  3PUZ A;  4OHJ A;  4X3T A;  1DCZ A;  2B2V A;  4EQO A;  2K5D A;  2EYO A;  3PO2 B;  5BN3 A;  2A5H A;  1QOH A;  3W2D A;  1PXU A;  1I3Q B;  2K01 A;  1ENF A;  4OGQ C;  3A8J E;  4KMU C;  1H9M A;  5FO9 B;  1WVL A;  1A2U A;  1LTA D;  2EY2 A;  3OSO A;  5IGD A;  5C4J B;  5M3M B;  1EY0 A;  3E5S A;  3NWS A;  1XTC D;  3WOF A;  1D1K A;  1R4Q B;  1AFP A;  3FPP A;  3TBI B;  5IT9 E;  2F1M A;  2R61 A;  4IFD H;  4ILW A;  1W6K A;  3G6J B;  2WAC A;  1JOQ A;  1Q8I A;  2LY7 A;  4ZKC B;  1B2T A;  4HAE A;  5ELF A;  2QIL A;  2K03 A;  1LAB A;  3VR2 A;  1STA A;  1ET6 A;  4C3H G;  4DF7 A;  3PUY A;  2DY8 A;  1KDA A;  3KLR A;  4BY7 B;  3KBG A;  5IT9 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...