1KDAA

Stabilization of a strained protein loop conformation through protein engineering
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYDPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stabilization of a strained protein loop conformation through protein engineering.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 39
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kdaA00
5CV7A 1RKNA 3QOLA 3TP7A 2EXZA 4PMBA 1SNDA 1A2UA 1IHZA 2ENBA 3NXWA 4KJNA 5NUCA 5KGUA 5M9OA 5HGTA 5C5MA 1U9RA 5KIXA 4IALA 5J22A 2O4XA 5F2DA 4ZQ3A 3SR1A 4K5VA 2F0UA 1ENAA 4IZ8A 2F3VA 2F0SA 5IIFA 4NMZA 2F0JA 2EY1A 4ID6A 5EKKA 5C3XA 2F0IA 3RUZA 3TP5A 4QF4A 5EGTA 5I6YA 2WACA 4K2KA 2F0WA 5IGGA 5IODA 3P75A 1EZ6A 3BDCA 3MZ5A 3MXPA 4TRDA 2PYKA 3MVVA 3OMCA 4EQNA 1F2MA 3EVQA 5ISRA 2F0QA 1A2TA 1SNOA 5E1FA 4J1MA 4J6HA 4DF7A 4QB4A 4KV6A 2EY6A 2F0DA 2F0PA 2SNMA 4PMCA 5IGCA 2EYJA 3EJIA 5KYLA 5I6WA 1NSNS 2EYPA 3E5SA 3OSOA 3SHLA 4NKLA 4KY6A 1F2ZA 2RKSA 2EYHA 1EY7A 2M00A 3BDLA 3DMUA 3QB3A 4B9XA 3U9OA 4B9WA 4KHVA 4EQPA 3T16A 3TP6A 5J39A 4K8JA 5DEHA 2F0NA 2OEOA 3LX0A 3HEJA 1II3A 4IUNA 4MIUA 3H6MA 4R8NA 5EKLA 1SYGA 1SYFA 1STHA 4KD3A 3QOJA 4K5WA 2F0HA 1JOQA 2EY2A 2RBMA 4YIJA 1A3TA 4K2LA 1STBA 4KD4A 4KY7A 3ITPA 4DGZA 4EVOA 5IOCA 4HMJA 4DU9A 5JOBA 5CV8A 4RKLA 5KEEA 5CGKA 2HQEA 1EYCA 1EY0A 1EY6A 2SNSA 3D4WA 4N9TA 1TT2A 2F0TA 3SK5A 5KYIA 5IGEA 5K5PA 5I9PA 3D6CA 2LKVA 1KDCA 3OMGA 4KJOA 3TMEA 1A3VA 2F0EA 2F0FA 2F0OA 5IGBA 1EQVA 2EYLA 4QMGA 4DFAA 4S3SA 1EZ8A 5C3WA 4KY5A 2SOBA 2RDFA 1TR5A 2KHSA 3D4DA 4NP5A 3SK6A 4H7BA 3MHBA 3ERQA 1SNPA 2F0MA 4K14A 2PZUA 3P1HA 1KDBA 5CV6A 3T13A 5I9OA 4WORA 3NQTA 5IGFA 3TP8A 3NUCA 1STAA 3OWFA 1EY8A 1JOOA 2F0KA 2EYOA 3EROA 4N9PA 3NHHA 4ODGA 2F3WA 1KAAA 2OF1A 4K5XA 4ME5A 3SK4A 2EYFA 4OL7A 2F0VA 2QDBA 1SYDA 3C1FA 1KDAA 2OXPA 3MEHA 5IGDA 1SNQA 1EYAA 5DAUA 1EY5A 1EY9A 4WRDA 3HZXA 3DHQA 2KQ3A 3C1EA 1SYEA 4PNYA 5KRUA 4K6DA 3PMFA 5C5LA 3V2TA 5CV4A 5CV9A 5J1ZA 1EY4A 3D8GA 4K8IA 2PQEA 1SYCA 4I65A 2PW5A 5JAVA 3S9WA 5C6AA 1TQOA 1ENCA 3VA5A 5CR3A 3NK9A 2EYMA 2PZTA 2PW7A 1SYBA 3R3OA 2NUCA 2F0GA 5E3FA 3SXHA 4E6IA 5C4HA 4F8MA 1SNMA 1EYDA 1STNA 2PZWA 5C4ZA 1SNCA 1STGA 5HURA 4KTAA 4ZUIA 5CC4A 4LAAA 1STYA 4G57A 2F0LA 4F7XA 1F2YA 3NP8A 4NDXA 1KABA 4HMIA 4RKBA 5CV5A 4EQOA 1JORA 1NUCA 4HTHA 4ZUJA 1AEXA 1JOKA 2EY5A 3SK8A 1A3UA
chains in the Genus database with same CATH superfamily
2VS1A 4PMBA 5EAYA 4B3SL 1A2UA 1L0XB 4ZYSA 4BY7B 5HGTA 1JQYD 1BF4A 4CJ2C 3ZYYX 1XNRQ 1NJIC 2E74C 2ZM6Q 4DXFA 4LF5L 5COYA 5IE8A 5K36G 1U5KA 3A54A 4P72A 5IODA 3I4OA 1NR2A 3MVVA 1SR3A 1XNQQ 5ISRA 1KIXA 1ZXTA 4FO2A 2VZAA 3CU7A 4BY7G 3DM3A 5A35A 5IGCA 2EYJA 2A6HC 3NTKA 4DR2L 3RMHA 2VNUD 2F0NA 3LX0A 1FGBD 1SYFA 2XTIA 3M3YB 5JJIA 4KD3A 3MFYA 2WAQE 3E0EA 5ELDA 1W2BA 4KD4A 3GO5A 4JI0Q 4HMJA 4V0BA 4GN5A 5FKAC 2JA5H 1IL8A 1EY0A 1EYCA 5C4XH 1UAPA 2B39A 4PV1C 1O7YA 5C4JH 1EOVA 1VQMA 5M3FH 1ZEQX 2G9DA 2CWPA 2B2YA 2RA4A 3KYHC 3CPWA 3QJYA 5IT9c 1K8AC 4IJHA 1F9QA 1KDBA 4HCSA 1D1IA 4RA8A 1TKWB 1S40A 3M9BA 4KN4C 1IL2A 3NHHA 2PNHA 4JCVE 1KNEA 2OF1A 1OXTA 2DNCA 3KF8B 4A3CG 3HFZB 2F0VA 2KJXA 1IYVA 2MUYA 5HY6A 3C1FA 3OHXC 4DUYL 4A3MB 2WINB 1EY9A 5FLXL 4RHSA 2PQAB 5ELFA 1VQNA 1V1PB 1HUNA 5IP7H 4CJ1B 3LWEA 2HHHQ 2D0OA 4DV1Q 1RDPD 2NWGA 3I4MB 1NAPA 2IY5B 1SAPA 1Q46A 4A3MG 2R6GA 2FMMA 3H94A 1KABA 5CV5A 2I0QA 3MXUA 5DM63 2K03A 2JA6H 2MFIA 1AEXA 2J4XA 4H02A 5GAHC 2L1BA 4LMQD 1D7QA 1HTLD 3S2HB 2ZXOA 2A69D 1YHAA 3J81c 2IHFA 3I4MG 1PTOD 1TS5A 1WTQA 3PCOB 4XTCS 3NTIA 1SEBD 1DOMA 5EGTA 1JC7A 3PO2B 3A7AB 3UDXA 3RLFA 2J7ZA 2PYKA 1Y69U 1HNXQ 1N33L 1PFNA 4APVA 5C3EH 2F0DA 2IT1A 4C3HB 2QGQA 1MJCA 5IGEA 3SHLA 2ICEC 1VQ6A 3MA2B 4B3MQ 4BY1B 1E24A 1J9OA 2KUMA 3L7ZC 3K5MA 3L2PA 1FJGL 2B2VC 1I6HB 1HNWQ 3PO2G 3BVZA 2XRSD 3QOJA 4LUZA 2EY2A 3KF8A 1GOZA 3OWEB 2QKIC 4NXNQ 4UAIA 1SBBB 1JJCB 3S1RH 5FO8B 1N34Q 4DR5L 4C3HG 1I5FA 2QEXA 2Z9HA 2FINB 3EIVA 3IKJA 1JR0D 5IYBH 3SE0A 2PQAA 3OMGA 4BY1G 1DZ1A 2O2LD 4OIKA 2F0OA 4L8JA 4QMGA 1O7ZA 1N32Q 3AMUA 4TVAB 3RZOB 4IQZA 3QWNA 4CGYB 4JOIC 5BN4A 1DYQA 5IGFA 5LHY1 3CCVA 3U4VA 3M4OH 2ZJRA 4R4TA 1C48A 2EJFC 1D5XC 3T51B 1G2SA 2Q8RE 1TVXA 1OXSC 1VDZA 3VYUA 1XMQQ 5E4WC 3CD6A 1GKHA 1TWHB 2A69C 5FLXc 4A3JH 5H1SE 4QIWE 1GUTA 3PUYA 4H0LC 1PTOC 3N6RA 4HR7B 4RCOA 2VW9A 1QUQB 1YI2A 3EA6A 4K8IA 1CTMA 3AFQA 4K0KL 3CCUA 2MNAA 3S9WA 1GXDC 1IBKL 4DR6Q 4JI4L 5CR3A 4F7XA 5IY0A 4HN7A 5ELEA 2AWNA 3HOYH 3UDFA 3ONAB 1Z9FA 1XX8A 4CKBA 5JJZA 1JB3A 2JEBI 4B3RL 1SE8A 4LAAA 2K28A 5I2YA 2F0LA 1L1OB 4JG2A 4DV2L 2FMCA 2OQ0A 5BN5A 4HTHA 1N36L 4KLKA 5D3IB 3K5LA 1X55A 5KGUA 3FP9A 4A93B 4IOCA 1D8LA 1VQPA 4IALA 3KLSX 3K6OA 4DR4Q 3PF4A 3I2ZA 1LT3D 2JSOA 1SFOH 3ZJYC 5FO7B 2F0JA 1BXTA 4ID6A 2B63H 3TQYA 3UE0A 2NVYH 1K3BC 4U673 1VQBA 1XMOQ 2DJGC 4NXMQ 1HZAA 4HIDA 4MTKA 2CCZA 3GDEA 4QL5A 1BNZA 4A93G 4HEDA 4ZK9B 5TSSA 2YTXA 2NVQB 3H3VI 5IGBA 1K83B 2D9UA 4DN4M 4IUNA 1FD7D 3HOXB 5K36H 2VQFL 2HDMA 4K5WA 2RDHA 1PZJD 4IPGA 4TQUS 2YV5A 2XN9C 4RKLA 2WAQB 4BY7H 4N9TA 1LM0A 3P7JA 1IBML 1QUQA 1STEA 2JEAI 2PI2A 3EN2A 2RCNA 1K8MA 2CFMA 4LF8L 2F0FA 4PQXA 1EQVA 1HFGA 2EYLA 4YWKA 3J7YW 3HOXG 4L5RC 1TY0A 2SOBA 1TR5A 2RDGA 4LF4Q 4JI2L 4LF9Q 4UY8C 1YIJA 4L5QA 3CQZB 1VQKA 3I70A 3IL8A 2WAQG 3GTQB 4P74A 1KQSA 4JBKA 1HNZL 1L1OA 3K80C 2XWBB 3KLSA 5IYCG 3PO3B 3GTGH 1RTOA 4I7AA 4FF3A 5LMNW 1I4GA 5GADC 1UNSA 3A8JE 3DLLA 2B29A 4DV7Q 3VYTA 4X65Q 1FNUA 1I4QA 3PMFA 4POFA 1LACA 3BYYB 1U4RA 3PO3G 1CUKA 1G91A 4X6AH 4BWGB 3A7LA 4RHRA 1HZ9A 3I91A 4A3CH 1PZKD 1STGA 1YNNC 4HCEA 3K58A 1JOKA 1T5EA 1YNJD 1IZ6A 3K8AA 4QCLA 2UXDL 4G7OC 1BCPD 2NN6I 3H15A 4YCUA 5C5MA 3URYA 5DLQE 3F2BA 1KNAA 4LJZC 3GTKB 1TY2A 1EUJA 1HA5A 4K5VA 3M85A 1V1QA 3BZDB 1EWHA 3QIAA 2E5LL 2O5IC 4KK7A 4A3MH 4K2KA 2QDLA 4ME3A 3MZ5A 1LTID 2K33A 4MHEA 1S5CD 4GNXB 4X66Q 4X3UA 1X3QA 1PYWD 1WCMH 5KYLA 5EPLA 3I4MH 4KI0A 4A75A 2RKSA 4IJLA 1E2VA 3PQIA 2PPBC 3M7GA 5EKLA 1II3A 4UPAA 4ZKCB 3T1HL 1JJGA 1XNRL 4RGMA 2CW0D 1B70B 3GQBA 1PTOB 1C7YA 1CZGA 4EVOA 2NN6G 2K1BA 3KF6B 4LUVA 3S15H 3S2HH 2AMCB 5CGKA 2A68D 4DK6C 4DR1Q 4JYAL 3CAMA 5JEAJ 3V05A 4B3TL 1A3VA 1Q86C 1QNUA 1WTOA 2UUCQ 4BS9A 3PO2H 1JMCA 3I7FA 2ZTCA 4LFAQ 3T13A 3P1HA 2LXJA 1BDOA 4C3HH 1S5ED 3IRBA 1RHPA 1GUNA 1BCPC 4BY1H 2MPMA 1M90C 1I6HH 3DHQA 2KQ3A 4DV5Q 2ES2A 3K7UC 1BO0A 2O5JC 3AU7A 3HKZE 1I4PA 4R4IA 2PQEA 4DR3L 1ILPA 1TWFB 2R92B 1ICFB 3K57A 4DV3L 2BA0A 4A3FH 4L5SA 3VA5A 3N52A 3Q8DA 2JJQA 2B8FA 2K5DA 3DM1A 4LF6L 1VQGA 4GNXA 1VQIA 4JOIA 3UI2A 4GN4B 1JB7A 4RH6A 1VF5C 2A1AA 4OWXB 3RZOH 5FOBB 4R1JA 2M9VA 3ND8A 2F52A 2I5MX 4LFCL 2R92G 2FFKB 2VQEQ 5KIXA 3J81j 2BA1A 4OO1H 2N55A 3W2DA 2KHIA 4IURA 4NMZA 3RR5A 1TWHH 1I4HA 1QVCA 2KCNA 3RUZA 2UXCL 3BZCA 3CC7A 1KL9A 3CKIB 2Z8LA 1A2TA 2EDGA 1B4OA 4J1MA 3W1GA 3L9AX 3AYHB 2LFNA 1HJPA 4RFBA 5L37A 1NSNS 1FR3A 4KHZA 4CKCA 5AJ3L 1CSPA 4KHVA 3GTMB 3TP6A 1O7IA 2F4VL 1L0YB 4A3DB 4HJ8A 5JVH3 2WIIB 4DU9A 1TU2B 1SMXA 5CV8A 3A74A 4DAYB 2YTYA 3OW2A 2EZVA 3KJPA 4QJFA 3J7ZC 1GUWA 4KJOA 1WTXA 1Q90A 5C3WA 1K0SA 3CC2A 2ASBA 4A3DG 4C1NK 2Z4IA 2E2JB 3CXCA 2E2IB 4K14A 1R9TB 1LABA 4WORA 2JA7B 1HNWL 3TZUA 4JI3L 2R7ZB 1JOOA 4NXNL 2NVQH 1KAAA 1K83H 2K04A 4CDEC 2RSOA 3J80E 2KCCA 1TS4A 3HOXH 4FXGC 2EPBA 1PFSA 3TZDA 4JBJA 4LF7Q 1EWIA 4OGQC 4OWTB 2Z0SA 1PH3A 2JA7G 2IHEA 2R7ZG 3FKIB 4DAMA 4LFBL 2A6HD 4AIMA 3ULJA 1KRSA 3I8ZA 3H3VH 3CCEA 2EJGC 1EQTA 1Q12A 1QVFA 3HOVB 1CHQD 1I3QH 1PH5A 3NP8A 2YYZA 2CQAA 4QQBX 1XMQL 2B63B 1RKNA 3QOLA 1HH2P 3TP7A 3FKIG 4KJNA 1SXTA 1MJEA 3BS1A 1ZKOA 2AUKA 4AQYQ 1QZHA 2O4XA 4JI6Q 2A73B 2JE6I 2TMPA 5F2DA 4DV6Q 3HOVG 3KLRA 3G4SA 1W6JA 3AQQA 4DR6L 4BBSB 5C3XA 4DAYA 1KRTA 1AW7A 2HUGA 2F0IA 3F2UA 2UU9L 4GOPC 2K5QA 4DUZQ 1CA5A 1EL0A 2B63G 1PYSB 1FL0A 1SE3A 5FJ8G 4OHJA 5E1FA 5M3MB 5C0XJ 1IBLQ 2F1MA 1LT5D 3X3MA 2BDNA 3J7AF 4UP7A 2V4DA 4FDBA 3OSOA 4IPHA 3UE1A 2IJ0A 3F8TA 4BBSG 1BCPB 2GVAA 1NNXA 1IW7D 1SYGA 4GLVB 1JWMD 2RBMA 1OTCA 1H9RA 1JE4A 2UUBL 5M3MG 3S16B 1EOTA 3GTPH 1PRTB 1G6ZA 1X54A 3GTKH 3S1NB 4AYBE 3OTOQ 1BBWA 1R4QB 2DY7A 3GTGB 4WJ4A 3MXNA 3NBHB 2L9HA 4H7BA 4BXXH 1IYJB 1JWSD 3J80L 1B50A 1IXRA 2L0CA 2NN6H 3S24A 3OWFA 1CK1A 2F0KA 2JYOA 3GV3A 2WB1E 1PDQA 2AQ2B 4OL7A 4GKKL 2A5HA 3JAME 2QDBA 2L15A 1EYGA 2WKCA 1S72A 4KHPL 3NELA 3KDFA 1U4PA 2UXBQ 1PTOH 5C5LA 5CV9A 3DWPA 1E3PA 1GUSA 4A3BB 1YHBA 1NE3A 4NB3A 4LNQA 3NK9A 3J80i 4YHHQ 1SYBA 4JI1L 2HDLA 1WFQA 4O42A 1YITA 2YTVA 1Y14B 3WWVA 2JP1A 3DEOA 1V8QA 1UE6A 1CKOA 1XJVA 3KBXA 2A74C 2HCIA 1XXGA 3U50C 1G291 1H9MA 2EE1A 5IWAL 4FNFA 2X6LA 3I56A 1IW7C 4A3BG 1WJJA 2I07B 2R93H 1DOLA 4JI7L 3U9SA 2VB2X 2E2DC 3NENA 1B53A 1HUMA 2QF7A 1WCMB 3A8KE 3G71A 3K0YA 5DM73 2AQ3B 4P71A 3MXGA 4X64L 1RCVD 5JEAH 3RLNA 3UDGA 3RN2A 1M1KC 4YCVA 1SNOA 1HQRD 1TWFH 2R92H 1J5EQ 1PLFA 1MSHA 1LYLA 3NBHA 1NMFA 1RJTA 2EYPA 4C2MB 1UE5A 3S15B 2K14A 3DMUA 2OCEA 1IKMA 1K8OA 1WCMG 3T16A 1ICWA 2PMZE 4R8NA 3BVGA 2QILA 2F0HA 4DV0Q 2ZTEA 4DV4Q 2K7VA 1GUOA 1TWAB 1CHPD 1KTKA 4OELB 4HIKA 3PUZA 1EWCA 5IP9G 3D6WA 5HGQA 3J7A5 4X66L 2A6ED 2HIXA 4OX9L 4YY3L 1V43A 1CKMA 4S3SA 2Q2TA 2KEEA 4NP5A 1SRUA 3JAML 4UDUC 3J80c 5G3LD 4TSSA 1C0AA 2PZUA 1VQ9A 1PFBA 3TP8A 2Y0SE 1E2WA 3K5NA 2QEJC 2IL8A 2B2UA 2XRQD 3DUZA 3PUWA 4L63B 1B8AA 5EQ0A 3HS0C 4A3FB 2M2LA 3GTMH 2DN8A 4OO1I 2JN4A 4HJ9A 1VQEA 2R7DA 3Q6SA 2B2WC 4A3DH 4GOPB 3I3CA 3V2TA 1VQDA 3KJOA 2UUCL 2RCFA 3CW2C 3JAMi 4N8FA 3D4RA 2N3SA 4LW1A 2F0GA 1HA6A 4EQ5A 3RNUA 3KFUA 1WYDA 4A3FG 3KBGA 4KTAA 4RKBA 2E2JH 4RMFA 1GHKA 2E2IH 3FPPA 1F77A 1R9TH 2JA7H 2R7ZH 4DV5L 1PH6A 5LMUQ 5CORA 2C9OA 1XYIA 5GAGC 4GKJQ 4G7HC 2NVXB 1E1TA 1HQMC 2F0UA 4DAVA 5IIFA 2K01A 2JA9A 2OTLA 3R93A 4OO1G 5LMNL 2KHJA 4QF4A 3TP5A 2NTTA 2WACA 2F0WA 5ELOA 1EZ6A 1F2MA 2A6EC 1PH8A 2DJFC 4IUUA 3ICEA 5D65A 1ILQA 3FKIH 4L6TB 1RL2A 5I2XA 3DWAA 2RHQB 3M7NA 5FK9C 4P75A 1Q7YC 3RD4A 3HOVH 4ZCKA 1UWVA 2AKWB 3HEJA 1A15A 1MBYA 1BCPF 1Z7TA 4YIJA 3FEWX 3I72A 5FJ8H 1LO5D 2D62A 4ZKBB 3D31A 2UUAQ 1PRTF 4DNTB 4GOPA 3M4PA 4P2CB 4B3SQ 1YNND 3CCLA 3CP0A 4BBSH 4H44C 2XGTA 3JAMc 1X3EA 4AYBB 1XPRA 3ULLA 3G7LA 4LF5Q 1U4MA 2AUJD 3C2PA 3C3LA 1WTVA 5M3MH 2VUMB 4CDFC 1H9SB 1VQJA 1EIYB 1Y1WB 1DCZA 2WB1B 5IGDA 4AYBG 4M8AA 3VR3A 3CHBD 4KMUC 1MGSA 1NBWA 4DR2Q 4FF2A 2WV6D 3SDZA 1I3QB 3A55A 5J3BA 3S16H 1C8CA 3BZKA 3TS2A 2VUMG 1RTNA 1OXUA 3TEHB 3S2DB 3SEBA 2NB0A 1Y1WG 1T5XD 2R7FA 4KKTA 3GTOB 1YJ9A 3S14B 3S1NH 2WP8J 2HQLA 2WB1G 1SNMA 1HXYD 1B3AA 2N88A 4JI8L 3NQIA 4QGUA 4ZUJA 3X3NA 5CV7A 1Z6HA 1WD1A 5M5YB 2SEBD 2NVTB 4FXDA 2B3GA 3NXWA 1BOSA 1BKBA 1BVSA 4A3KB 3SR1A 1PH1A 1B9NA 1HR0L 2F3VA 1KD1C 3G6EA 1ASYA 1B3QA 2N78A 4JC0A 3UDIA 4DUYQ 1QZGA 4QB4A 4UP8A 1U0LA 2MO1A 4A3BH 5E7NA 3CCRA 4A3KG 2Q2UA 1GO3E 4JV5L 2H5XA 4NKLA 1ENFA 4RGOS 3GTPB 4K8JA 1H9SA 4MNOA 1AP0A 2K5NA 4CBVA 2C5CA 5T1GA 3NWTA 2F4IA 2LXKA 4DR7L 1VQ5A 2L4NA 1AZQA 2SNSA 2DGYA 4R8IA 3A8IE 3D3RA 2IX1A 4N8X1 4XDXA 5ELBA 3BDOA 2X6GA 2E75C 3PUXA 2K32A 2KHSA 2MO0A 3T1YQ 1J8IA 3MHBA 4BBRB 1O7LA 3Q22A 4CHTB 1N8RC 1JJ2A 1HHVA 4JPBW 1SNPA 2PNRC 2XVSA 4BXXG 2ZM6L 1K0RA 2Y0SB 4C2MH 1N33Q 2B2TC 5IP9H 3QO2A 1F9PA 1XNQL 1KDAA 2VL6A 3CMEA 1EY5A 1TWGB 4BBRG 3I4LA 3CMAA 2FJ2A 1KXLA 5J1ZA 1FJGQ 1TWAH 4RG1A 2KCMA 1S5DD 3K7AB 3S17B 5EJWA 3RLOA 1ET6A 2ID0A 3GV6A 2Y0SG 4JVZA 1X9NA 2PO4A 4DR5Q 3C46A 2R93B 2B2VA 4JI0L 1PVOA 4G57A 3TN2A 4YWMA 3FDTA 2RQXA 2F3IA 2Z6BA 3NPPA 2EY5A 2CH4A 1L0WA 1IHZA 5DNFA 2UXBL 1GUGA 1EIHA 1O80A 4QIWB 1VQ8A 2FXQA 4ZQ3A 2B2WA 1I94Q 4BA2I 4IUPA 2R93G 4POGA 1H9JA 1VQFA 2ZJPA 4J15A 1Y8OB 3MXPA 4WJ3M 1AE2A 2HIVA 4J6HA 1EEID 1X56A 4DF7A 5JEAG 4IFDJ 1SDFA 1D5ZC 2LS01 1PA6A 3H0GB 1K9MC 2IW3A 1WI5A 2RSNA 1S5BD 4K0KQ 3QB3A 1EY7A 4EQPA 4H13C 4B9WA 4B9XA 4CJ0B 3PF5A 1IBKQ 1ESFA 4JI4Q 1O78A 4UHVA 1I4RA 2HHHL 2H1EA 4DV1L 1V9PA 1A3TA 1YJWA 1STBA 3M4QA 4WJWA 1AFPA 5JOBA 1YZ6A 3LWUA 4DV2Q 3KUPA 4TKOB 4ZAIA 2EXDA 3E9HA 3H0GG 1N36Q 1J6QA 1I6VC 1B44D 3MWYW 5M5WH 5IT9E 4AH6A 4HJAA 2NVXH 5C44H 1FYCA 4C56C 1J5EL 3TMEA 1PYBA 2QW7A 4KY5A 3D4DA 4IN3A 3I90A 2EIFA 4QUFA 3W1BA 1B1ZA 4KKSA 3NQTA 1JWUD 1PZID 2G9HD 4C3JH 2K5HA 4DV0L 4HJ5A 3PIO3 3OYYA 1AN8A 2NZHA 3L3OC 1BQQT 4IFDG 1LLRD 2OXPA 4RGNA 1HNXL 3DEPA 3R2IA 1Q1EA 1PV4A 2BH2A 2Q2IA 2ZT9C 2N8NA 1CM9A 3FVQA 3G48A 1QWYA 2VQFQ 1VQAA 5CBEE 2GVBA 4B3ML 5D3DA 1LT6D 2D2CC 3RN5A 1I50B 2KENA 2PW7A 5E3FA 1G2TA 1KLUD 1VQLA 1EYDA 3NEMA 1JORA 2Z6KC 4JK1C 4BA1I 1N34L 3J81E 4A4IA 4LF8Q 5LL6S 1EQRA 4C1NI 5NUCA 4JI2Q 1WTPA 2VUMH 1U4LA 3Q23A 1PH4A 2ZJQA 2LMCB 5J22A 1Y1WH 1N32L 1DOKA 1LV9A 3MXNB 2Q8IB 3L0OA 2ALYB 3B6YA 5IGGA 2Z4HA 3OMCA 3OIPA 4IOAA 2WKDA 4HSPA 4A3IB 3AEVA 3S2DH 1OO9B 1X3PA 4DA2A 3S1MB 3GTOH 2JQOA 3S14H 1DD2A 2EQSA 3BDLA 1KAWA 1EIFA 1AE3A 4RGTA 5IT9L 4GKJL 5EPKA 3KDFB 5A2QE 4X3KA 2MQHA 1A8VA 1B7YB 5M5YH 5JJLA 4A3IG 2NVTH 1YBYA 1Q3LA 5BN3A 2HQEA 3BVMA 3SK5A 3VR6A 1SMYC 2UXDQ 1DXMA 5I9PA 4A3KH 2A19A 2PI2E 4A3EB 1WTRA 2I5LX 1BBUA 2F0EA 4FP5D 1DONA 1ZYRD 1EZ8A 3EQLC 1SJED 3EFXD 4DAPA 3SK6A 2E8GA 2DY8A 3BU2A 3ERQA 5C0XI 1WD0A 4Y7NB 2F0MA 2EJMA 4DR4L 3I55A 3H91A 1PFMA 3BJUA 3HOUB 2XIWA 2CVRA 4A76A 1QVGA 2F3WA 2RHSB 1PTOF 2JXMB 1EFWA 4A3EG 5AFWA 1XMOL 3F2CA 1MSGA 3HRZC 1VCIA 4NXML 1SNQA 1E1OA 2IWHA 4X62Q 1ML0D 2IX3A 1JT8A 1ET9A 1GHJA 4DK1A 4JI5Q 3E0JA 1P16A 4G4KA 3BYTB 3AFPA 4GS3A 3J81L 3T1HQ 3HOUG 1R4PB 3U58A 4O2DA 2EYMA 3D0FA 4Q0FA 5G3LF 2ZXPA 4MTNA 2CKZB 2NYZD 4A3LH 5CC4A 3M4YA 1F2YA 3KK7A 5C0XG 4JYAQ 1E7ZA 4HMIA 3IAYA 4BBRH 4B3TQ 3PIP3 3SK8A 2X69A 2E2HB 3TDQA 2B2TA 2EXZA 4Q5VA 2AHOB 1N9WA 1LT4D 2I46A 5M9OA 3BG3A 3PSIA 4DKAC 2JK8A 3TREA 1L1OC 1VQ7A 3HOZB 4FYDA 1XTCD 4LF4L 2GN5A 5KNCA 4LF9L 3W3AA 3HKZB 3J81i 1NTGA 3PIOA 3CPFA 4OIJA 1QNKA 1RF2D 4ILWA 3MAQA 4KKUA 2KCTA 1BR9A 1TWGH 5I6YA 1QB5D 3IFDA 4EQNA 1WTHA 2MGSA 1KC8C 5A2QL 1ZYRC 1X32A 1F9RA 2V1CC 3K7AH 4RWSC 3HOZG 3NSWA 3S17H 1TIID 4IUTA 3E5SA 4DR3Q 3HKZG 4RAUC 1SE4A 4DV7L 4X65L 3U9OA 4XQQA 4DV3Q 5J39A 3NTHA 1LTBD 3T56B 3STBC 1LTRD 1Q8IA 4EX5A 4LF6Q 1JOQA 1QE6A 2D5DA 4FF4A 1TXYA 4K2LA 3ITPA 2K5VA 1SSOA 1D6EC 1Q1BA 3V96A 1SLJA 3I4NH 2F0TA 3PUVA 2K6AA 3MC0B 5K5PA 4LFCQ 2NZ1D 2P5ZX 3VA7A 4L5TA 3F1ZA 1EQQA 2E76C 3FPUB 5CBAE 1D2BA 3H3VC 2JA8B 1NMGA 1XWEA 1NY4A 2UXCQ 3LGJA 1LTLA 5I4DA 4OWWB 1Y1VB 1STAA 1EY8A 1RD9D 3EROA 2R61A 1UEBA 2Z1CA 3H0GH 1BUVT 4ME5A 1YVCA 3SK4A 5GAEC 2EYFA 4HIOA 1SYDA 3NWSA 3HZXA 2OTJA 5AJ3Q 2JA8G 4K6DA 5CV4A 2NBFA 1AH9A 4XQJA 1Y1VG 2H4OA 2G5DA 3T1YL 1SYCA 2F4VQ 4FXKC 2PW5A 1A0IA 4HJ7A 1PH2A 4GLAC 1GJXA 4Y52H 1TQOA 2RF4A 1G6PA 1S5FD 5M5XB 1JE5A 3DXJC 3HG9A 1OXXK 3PGZA 2OT2A 4IFDH 3ERSX 5HURA 1STYA 1YHQA 2UUAL 3IFTA 1AZPA 1EY4A 2QCPX 3KOJA 4PZ8A 4CKEA 4GZYC 4DR1L 4IO9A 3GP7A 1SNDA 1QILA 4CDDC 3ND9A 1FNVA 2MHVA 1D5MC 1X3FA 2HCCA 4XQNA 4JI3Q 3NE5B 5EKKA 4LFAL 3A56A 3RZDB 1EEFD 1E22A 4OXPA 5GQOA 1VMPA 3T4AC 1V1PA 4KN7C 1EU4A 4PMCA 1PMRA 2KBNA 1CT1D 1MHWC 1I50H 2Z6KA 1CSQA 4F88A 2BOSA 3LNNA 3F2DA 4LFBQ 3R8BA 2EVBA 5DEHA 3CCJA 4GNXC 1C4QA 3R2TA 3H6MA 5M5WB 5C44B 1I94L 4B08A 1IYUA 4X3TA 3GTJH 4KY7A 1V1OA 3PIPA 2QA4A 1EY6A 5KYIA 1TT2A 5BR8Q 1K8GA 2BDOA 5FLMG 4C3JB 5JJKA 1YEZA 4DFAA 5C44G 2RDFA 1PH9A 3OPOA 2VQEL 2DNEA 2UU9Q 4R4QA 4WFN3 4A3IH 4RCNA 3WOFA 4PZ7A 1Q82C 2NZOA 1DGSA 3S1MH 3S1QB 4DNIA 4DK0A 3CCQA 1LTSD 2K5WA 4M1UB 4C3JG 1K73C 4JBWA 5IYDG 4WRDA 4ZLTF 1UEAB 4PG3A 4GLXA 2HD3A 4NPSA 4I65A 1GVPA 2UUBQ 2PZTA 3VYRA 1XPOA 1SN8A 1X65A 3WDNA 5C4HA 4A3EH 3K0XA 3O13A 4P73A 3H09A 4QUCA 1STNA 4LWCA 1UUPA 1I4XA 4NDXA 1CZWA 3FRPB 4Y7NH 3ULPA 1TWCB 2IX0A 2ICIA 2B8GA 3A5UA 1EFID 4DPGA 3HOUH 2WFWA 3QR8A 2LY7A 3TS0A 5JVG3 1RIPA 1G51A 5JPMC 1PHJA 2N49A 1CKNB 1ENAA 3E9IA 4IZ8A 3GTLB 4HIMA 2EY1A 2RVLA 1WOCA 3NBIA 5C0XH 4GKKQ 1NCVA 1E0BA 5EPJA 1LUZA 1B2TA 4C3IB 3MFGA 4KHPQ 1QOHA 1JCKB 1X6OA 1VQHA 2M00A 3J7AV 4LF7L 3WOEA 2C35B 4A3GB 4YCWA 2BH8A 2OEOA 3QG1A 4XT1B 4ABNA 4R4OA 3OOCA 4JI1Q 3FHWA 1KLGD 1IKLA 4XYQA 2E2HH 1T9HA 2CH4W 1K3RA 3MEFA 4FVMA 2K75A 1Q8KA 4C3IG 1VF7A 5KEEA 3MTSA 2YU9B 3HOZH 2CQOA 4PMWA 1HZCA 1BBXC 1CA6A 2A8VA 1KDCA 1LTTD 3M3YH 5IWAQ 4A3GG 3HOWB 2VY3A 1QG7A 4JI7Q 5KNBA 1RODA 4AQYL 1OXVA 4JI6L 2NTSA 2XNAC 1UE7A 3NUCA 2VB3X 4DV6L 1MI2A 2PMZB 4X64Q 3CRLC 1MIUA 1Y8PB 1ESRA 1QJOA 1EU3A 2KA7A 1DM0B 4DUZL 3HOWG 3CCSA 1EYAA 1F9SA 5DAUA 3SGIA 1IBLL 2VXWA 1CKNA 3D8GA 3TSSA 1TS2A 3CCMA 4UP9A 2FHTA 1L2FA 1PRTD 5JAVA 3FMCA 4MN3A 1X3GA 1KHIA 4JW0A 4XIGS 5EKIA 2PZWA 5C4ZA 1FVIA 5LL6X 4EGVA 5JPNC 5EBCA 5FO9B 2Q2HA 4IPCA 4A3LG 4OX9Q 2I5HA 3P20A 3Q0AA 1PH7A 4YY3Q 1A3UA 2JA8H 4O0AA 4IPDA 1LTAD 2Q8TA 4X62L 4OEMB 1Y1VH 1S3OA 1Y8NB 2ENBA 4IUVA 3OTOL 2JA5B 1U9RA 4O1NA 4JI5L 4ALPA 5C4XB 2K50A 5C4JB 3VR2A 4PZ6A 3AB9A 2F0SA 5M3FB 1HRJA 1WVLA 1CQFA 2MJ8A 3BDCA 2HT1A 4TRDA 3EVQA 4DXGA 2F0QA 2B2YC 3ER0A 5CMDA 2K4KA 5ELCA 2JA5G 4KV6A 3VYSA 3CC4A 5C4XG 2F0PA 1W6KA 3EJIA 5I6WA 5M5XH 1WTWA 4E6IA 4KY6A 2ZXRA 3HP3A 2EYHA 5M3FG 3E6ZX 4JBMA 3I4NB 2OQKA 3A5ZB 1E2ZA 1TS3A 2CWAA 1W3SA 4FF1A 1MKHA 1HZBA 1M8AA 3K81C 1HR0W 4YHHL 4XXEA 1YNJC 4OONA 5EBDA 1QCBD 1Q81C 4CDCC 1JICA 3D6CA 2LKVA 3E3XA 2K05A 4GN3B 3I4NG 4K6LA 3RZDH 4R4CA 1PRTC 2D0PA 2JA6B 3A0JA 4IFDI 5CV6A 5IP7G 5LMNQ 4V190 3U4ZA 4DNRB 4B3RQ 1M4VA 5FLMH 1CI3M 4U68A 1ASZA 3MEHA 3TBIB 4G7ZC 4Z9CB 2JA6G 2L55A 2J0TD 4F87A 1CFMA 2L12A 3C1EA 1SYEA 4PNYA 4NW2A 5KRUA 2CW0C 1D1KA 1P8LA 5C3EB 2BE5D 2ATWA 3KF6A 1ENCA 3HGBA 2A68C 3R3OA 3HKSA 3T53B 2NUCA 1EIGA 2GA4B 2DUDA 2KECA 3OW7A 4DV4L 1GM5A 4ZUIA 5IYDH 4EQOA 1A62A 4ZRZA 1VMCA 4QY7A 4YWLA 5T1IA 3I73A 2ZTDA 5C3EG 3S1RB 1SMYD 3OIQA 3GD7A 1GD7A 1SE2A 3S1QH 2TSSA 2B2UC 3KLWA 1VQOA 1HCZA 2L5TA 5KNDA 4LUOA 3VR5A 3EBEA 3K59A 5E4XA 4XT3B 4A93H 3P75A 3G6JB 1C9OA 4R9WA 1XPUA 1VQCA 2K52A 3SVMA 1IBMQ 1HTPA 2CHBD 4XYOA 3M4OB 4IUQA 2EY6A 2KOLA 3GTJB 2SNMA 5IYBG 1G8ZD 1F2ZA 1SJHD 1HPCA 1MD2D 3W5OA 1S4ZA 4A3JB 2F03A 2XSCA 4MIUA 1NR4A 1H9KA 1YJNA 1STHA 1VS0A 1H95A 1HNZQ 2KEDA 1TWCH 3JC66 5IOCA 4DGZA 4JI8Q 4J8QA 4HSVA 3D4WA 2R3ZA 1XTDA 1FGUA 5CYUA 3HOYB 5GROA 1B9MA 4X3SA 3VR4A 3Q24A 3VDYA 1LTGD 1HFNA 1FNWA 3GTLH 4A3JG 2IPKD 5D14A 1VQ4A 2BE5C 2AQ1B 5LMUL 1HR0Q 1A6XA 2BCOA 3CF5A 1PXUA 5IYCH 4DK3C 4MZ9A 3DWQA 4N9PA 4ODGA 2EYOA 4C3IH 2XWJB 3HOYG 3CRKC 4K5XA 1SFOB 4A3GH 4HAEA 5BR8L 3CQZH 4I7ZC 4JV5Q 2NVYB 1Z47A 2L11A 2LSSA 3K5OA 2OWOA 3GTQH 1UE1A 1ONLA 2PCFB 1F2LA 3PO3H 2E5LQ 3PV0A 5C6AA 2EOTA 1SROA 2YU9H 4DR7Q 1K28A 3SXHA 2MP1A 1DJRD 4F8MA 5FLXE 2AWOA 3HOWH 5I9OA 2KVMA 1SNCA 3STBD 3TRZA 4ULLA 1A63A 2SDFA 1YNXA 1NUCA 5ELNA 4LK1C 1CQVA
chains in the Genus database with same CATH topology
4PMBA 1A2UA 1L0XB 4ZYSA 4BY7B 5HGTA 1JQYD 1BF4A 4CJ2C 3ZYYX 2E74C 4DXFA 5COYA 5K36G 3A54A 5IODA 1NR2A 3MVVA 5ISRA 1ZXTA 4FO2A 3CU7A 5A35A 5IGCA 2EYJA 2A6HC 3NTKA 3RMHA 2VNUD 2F0NA 3LX0A 1FGBD 1SYFA 3M3YB 4KD3A 3MFYA 5ELDA 4KD4A 3GO5A 4HMJA 4V0BA 5FKAC 1IL8A 1EY0A 1EYCA 1UAPA 2B39A 4PV1C 1O7YA 1ZEQX 2G9DA 2B2YA 2RA4A 3QJYA 1F9QA 1KDBA 4HCSA 1D1IA 4RA8A 1TKWB 4KN4C 3NHHA 1KNEA 2OF1A 1OXTA 2DNCA 2F0VA 2KJXA 1IYVA 2MUYA 3C1FA 3OHXC 4A3MB 2WINB 1EY9A 5FLXL 4RHSA 5ELFA 1V1PB 1HUNA 4CJ1B 3LWEA 1RDPD 2NWGA 3I4MB 1NAPA 1SAPA 2R6GA 2FMMA 3H94A 1KABA 5CV5A 3MXUA 5DM63 2K03A 1AEXA 2J4XA 2L1BA 4LMQD 1HTLD 3S2HB 2ZXOA 2A69D 1PTOD 1TS5A 1WTQA 4XTCS 3NTIA 1SEBD 1DOMA 5EGTA 1JC7A 3PO2B 3A7AB 3RLFA 2J7ZA 2PYKA 1Y69U 1PFNA 2F0DA 2IT1A 4C3HB 5IGEA 3SHLA 2ICEC 3MA2B 4BY1B 1J9OA 2KUMA 3L7ZC 3K5MA 2B2VC 1I6HB 3BVZA 2XRSD 3QOJA 2EY2A 3KF8A 1GOZA 3OWEB 2QKIC 4UAIA 1SBBB 5FO8B 4C3HG 2FINB 3IKJA 1JR0D 3SE0A 3OMGA 1DZ1A 2O2LD 4OIKA 2F0OA 4L8JA 4QMGA 1O7ZA 3AMUA 3RZOB 4IQZA 3QWNA 4CGYB 5BN4A 1DYQA 5IGFA 5LHY1 1C48A 2EJFC 1D5XC 3T51B 1G2SA 2Q8RE 1TVXA 1OXSC 1VDZA 3VYUA 5E4WC 1TWHB 2A69C 1GUTA 3PUYA 4H0LC 1PTOC 3N6RA 4HR7B 4RCOA 3EA6A 4K8IA 1CTMA 3S9WA 1GXDC 5CR3A 4F7XA 4HN7A 5ELEA 2AWNA 3ONAB 1XX8A 4CKBA 5JJZA 1JB3A 2JEBI 4LAAA 2K28A 5I2YA 2F0LA 2FMCA 5BN5A 4HTHA 5D3IB 3K5LA 5KGUA 4A93B 4IALA 3KLSX 3K6OA 1LT3D 2JSOA 5FO7B 2F0JA 1BXTA 4ID6A 4U673 1BNZA 4HEDA 4ZK9B 5TSSA 2NVQB 5IGBA 1K83B 2D9UA 4DN4M 4IUNA 1FD7D 3HOXB 5K36H 2HDMA 4K5WA 2RDHA 1PZJD 4TQUS 2XN9C 4RKLA 2WAQB 4N9TA 3P7JA 1STEA 2JEAI 1K8MA 2F0FA 4PQXA 1EQVA 1HFGA 2EYLA 3J7YW 1TY0A 2SOBA 1TR5A 2RDGA 3CQZB 3I70A 3IL8A 3GTQB 2XWBB 3KLSA 3PO3B 1RTOA 4FF3A 1I4GA 1UNSA 3A8JE 3VYTA 1FNUA 1I4QA 3PMFA 1LACA 3BYYB 1U4RA 1G91A 4BWGB 3A7LA 4RHRA 3I91A 1PZKD 1STGA 1YNNC 4HCEA 3K58A 1JOKA 1T5EA 1YNJD 4QCLA 4G7OC 1BCPD 2NN6I 5C5MA 3URYA 1KNAA 4LJZC 3GTKB 1TY2A 1HA5A 4K5VA 3M85A 3BZDB 3QIAA 1EWHA 2O5IC 4KK7A 4K2KA 3MZ5A 1LTID 2K33A 4MHEA 1S5CD 4X3UA 1X3QA 1PYWD 5KYLA 5EPLA 4KI0A 2RKSA 1E2VA 2PPBC 3M7GA 5EKLA 4ZKCB 1II3A 4RGMA 2CW0D 3GQBA 1PTOB 1CZGA 4EVOA 2NN6G 2K1BA 5CGKA 2A68D 5JEAJ 3V05A 1A3VA 1QNUA 1WTOA 4BS9A 3T13A 3P1HA 1BDOA 1S5ED 1RHPA 1GUNA 1BCPC 2MPMA 3DHQA 2KQ3A 1BO0A 2O5JC 3AU7A 1I4PA 2PQEA 1ILPA 1TWFB 2R92B 3K57A 2BA0A 3VA5A 3N52A 2B8FA 2K5DA 3DM1A 3UI2A 4RH6A 1VF5C 5FOBB 2M9VA 3ND8A 2FFKB 5KIXA 2BA1A 4OO1H 2N55A 3W2DA 4IURA 4NMZA 1I4HA 2KCNA 3RUZA 3CKIB 2Z8LA 1A2TA 2EDGA 1B4OA 4J1MA 3L9AX 2LFNA 4RFBA 1NSNS 1FR3A 4KHZA 4CKCA 4KHVA 3GTMB 3TP6A 1L0YB 4A3DB 5JVH3 2WIIB 4DU9A 1TU2B 5CV8A 2EZVA 1GUWA 4KJOA 1WTXA 1Q90A 5C3WA 4C1NK 2Z4IA 2E2JB 2E2IB 4K14A 1R9TB 1LABA 4WORA 2JA7B 3TZUA 2R7ZB 1JOOA 1KAAA 2K04A 2RSOA 3J80E 2KCCA 1TS4A 4FXGC 2EPBA 3TZDA 4OGQC 3FKIB 2A6HD 3I8ZA 2EJGC 1EQTA 1Q12A 3HOVB 1CHQD 3NP8A 2YYZA 2CQAA 2B63B 1RKNA 3QOLA 3TP7A 4KJNA 1SXTA 3BS1A 1ZKOA 2AUKA 2O4XA 2A73B 2JE6I 2TMPA 5F2DA 3KLRA 1W6JA 4BBSB 5C3XA 4DAYA 1AW7A 2HUGA 2F0IA 3F2UA 2K5QA 1CA5A 1EL0A 1SE3A 4OHJA 5E1FA 5M3MB 5C0XJ 2F1MA 1LT5D 3X3MA 2BDNA 3J7AF 2V4DA 3OSOA 2IJ0A 1BCPB 1IW7D 1SYGA 1JWMD 2RBMA 1H9RA 1JE4A 3S16B 1EOTA 1PRTB 1G6ZA 3S1NB 2DY7A 1R4QB 3GTGB 3MXNA 2L9HA 4H7BA 1JWSD 3J80L 1B50A 2L0CA 2NN6H 3OWFA 1CK1A 2F0KA 2JYOA 3GV3A 1PDQA 2AQ2B 4OL7A 2A5HA 3JAME 2QDBA 2WKCA 1U4PA 1PTOH 5C5LA 5CV9A 3DWPA 1GUSA 4A3BB 3NK9A 1SYBA 2HDLA 4O42A 2JP1A 3DEOA 1V8QA 3KBXA 2A74C 2HCIA 1XXGA 1G291 1H9MA 2EE1A 4FNFA 2X6LA 1IW7C 2I07B 1DOLA 3U9SA 2VB2X 2E2DC 1B53A 1HUMA 2QF7A 1WCMB 3A8KE 3K0YA 5DM73 2AQ3B 3MXGA 1RCVD 5JEAH 1SNOA 1HQRD 1PLFA 1MSHA 3NBHA 1RJTA 2EYPA 4C2MB 3S15B 3DMUA 1IKMA 1K8OA 3T16A 1ICWA 4R8NA 3BVGA 2QILA 2F0HA 2K7VA 1GUOA 1TWAB 1CHPD 1KTKA 3PUZA 1EWCA 3D6WA 2A6ED 1V43A 4S3SA 2KEEA 4NP5A 3JAML 4UDUC 5G3LD 4TSSA 2PZUA 1PFBA 3TP8A 1E2WA 3K5NA 2QEJC 2IL8A 2B2UA 2XRQD 3DUZA 3PUWA 4L63B 5EQ0A 3HS0C 4A3FB 2M2LA 2DN8A 4OO1I 3Q6SA 2B2WC 3I3CA 3V2TA 3D4RA 1HA6A 2F0GA 3KBGA 4KTAA 4RKBA 1GHKA 3FPPA 1F77A 5CORA 2C9OA 1XYIA 4G7HC 2NVXB 1HQMC 2F0UA 4DAVA 5IIFA 2K01A 4OO1G 3R93A 3TP5A 4QF4A 2NTTA 2WACA 2F0WA 1EZ6A 1F2MA 2A6EC 4IUUA 5D65A 1ILQA 4L6TB 5I2XA 3DWAA 3M7NA 5FK9C 3RD4A 3HEJA 1A15A 1MBYA 1BCPF 1Z7TA 4YIJA 3FEWX 3I72A 1LO5D 2D62A 4ZKBB 3D31A 1PRTF 4DNTB 4P2CB 1YNND 4H44C 4AYBB 3G7LA 1U4MA 2AUJD 3C2PA 3C3LA 1WTVA 2VUMB 1H9SB 1Y1WB 1DCZA 2WB1B 5IGDA 4M8AA 3VR3A 3CHBD 4KMUC 1MGSA 4FF2A 2WV6D 3SDZA 1I3QB 3A55A 1C8CA 1RTNA 1OXUA 3S2DB 3SEBA 2NB0A 1T5XD 4KKTA 3GTOB 3S14B 2WP8J 1SNMA 1HXYD 1B3AA 2N88A 3NQIA 4ZUJA 3X3NA 5CV7A 1Z6HA 1WD1A 5M5YB 2SEBD 2NVTB 4FXDA 3NXWA 1BOSA 4A3KB 3SR1A 1B9NA 2F3VA 4QB4A 4NKLA 1ENFA 4RGOS 3GTPB 4K8JA 1H9SA 1AP0A 4CBVA 2C5CA 5T1GA 3NWTA 2F4IA 2L4NA 1AZQA 2SNSA 4R8IA 3A8IE 3D3RA 2IX1A 4XDXA 5ELBA 3BDOA 2X6GA 2E75C 3PUXA 2K32A 2KHSA 1J8IA 3MHBA 4BBRB 1O7LA 3Q22A 4CHTB 1HHVA 1SNPA 2PNRC 2XVSA 2Y0SB 2B2TC 3QO2A 1F9PA 1KDAA 1EY5A 1TWGB 3I4LA 2FJ2A 5J1ZA 1S5DD 3K7AB 3S17B 5EJWA 1ET6A 2ID0A 3GV6A 2PO4A 3C46A 2R93B 2B2VA 4G57A 3TN2A 3FDTA 2RQXA 3NPPA 2EY5A 1IHZA 5DNFA 1EIHA 1GUGA 1O80A 4QIWB 4ZQ3A 2B2WA 4BA2I 4IUPA 1H9JA 1Y8OB 3MXPA 4J6HA 1EEID 4DF7A 5JEAG 4IFDJ 1SDFA 1D5ZC 2LS01 3H0GB 2IW3A 2RSNA 1S5BD 3QB3A 1EY7A 4EQPA 4H13C 4B9WA 4B9XA 4CJ0B 1ESFA 1O78A 1I4RA 2H1EA 1A3TA 1STBA 4WJWA 1AFPA 5JOBA 3LWUA 3KUPA 4TKOB 4ZAIA 1I6VC 1B44D 3MWYW 5IT9E 1FYCA 4C56C 3TMEA 4KY5A 3D4DA 4IN3A 3I90A 4QUFA 1B1ZA 4KKSA 3NQTA 1JWUD 1PZID 2G9HD 3PIO3 1AN8A 3L3OC 1BQQT 4IFDG 1LLRD 2OXPA 4RGNA 3DEPA 3R2IA 1Q1EA 2ZT9C 1CM9A 3FVQA 1QWYA 5CBEE 5D3DA 1LT6D 2D2CC 1I50B 5E3FA 2PW7A 1G2TA 1KLUD 1EYDA 1JORA 4JK1C 4BA1I 3J81E 5LL6S 4C1NI 5NUCA 1WTPA 1U4LA 3Q23A 2LMCB 5J22A 1DOKA 1LV9A 2Q8IB 5IGGA 2Z4HA 3OMCA 3OIPA 2WKDA 4HSPA 4A3IB 1OO9B 1X3PA 4DA2A 3S1MB 1DD2A 3BDLA 4RGTA 5IT9L 5EPKA 5A2QE 4X3KA 1Q3LA 5BN3A 2HQEA 3BVMA 3SK5A 3VR6A 1SMYC 1DXMA 5I9PA 4A3EB 1WTRA 2F0EA 4FP5D 1DONA 1ZYRD 1EZ8A 3EFXD 1SJED 3EQLC 4DAPA 3SK6A 2DY8A 5C0XI 3ERQA 1WD0A 4Y7NB 2F0MA 2EJMA 3H91A 1PFMA 3HOUB 2XIWA 2CVRA 2F3WA 1PTOF 2JXMB 5AFWA 1MSGA 3HRZC 1VCIA 1SNQA 2IWHA 1ML0D 2IX3A 1ET9A 1GHJA 4DK1A 3E0JA 4G4KA 3BYTB 3J81L 1R4PB 2EYMA 4Q0FA 5G3LF 2ZXPA 2NYZD 5CC4A 3M4YA 1F2YA 3KK7A 5C0XG 4HMIA 3IAYA 3PIP3 3SK8A 2X69A 2E2HB 3TDQA 2B2TA 2EXZA 4Q5VA 2I46A 1LT4D 5M9OA 3BG3A 4FYDA 3HOZB 1XTCD 5KNCA 3W3AA 3HKZB 4OIJA 1QNKA 1RF2D 4ILWA 3MAQA 4KKUA 1BR9A 5I6YA 1QB5D 3IFDA 4EQNA 2MGSA 5A2QL 1ZYRC 1X32A 1F9RA 4RWSC 3NSWA 1TIID 4IUTA 3E5SA 4RAUC 1SE4A 3U9OA 4XQQA 5J39A 3NTHA 1LTBD 3T56B 1LTRD 1Q8IA 1JOQA 1QE6A 2D5DA 4FF4A 4K2LA 3ITPA 1SSOA 1D6EC 1Q1BA 3V96A 2F0TA 3PUVA 2K6AA 3MC0B 5K5PA 2NZ1D 3VA7A 2E76C 3FPUB 5CBAE 1D2BA 3H3VC 2JA8B 1XWEA 5I4DA 1Y1VB 1STAA 1EY8A 1RD9D 3EROA 2R61A 2Z1CA 1BUVT 4ME5A 3SK4A 2EYFA 1SYDA 3NWSA 3HZXA 4K6DA 5CV4A 2NBFA 4XQJA 2H4OA 1SYCA 4FXKC 2PW5A 1GJXA 1TQOA 1S5FD 5M5XB 3HG9A 3DXJC 1OXXK 2OT2A 4IFDH 5HURA 1STYA 3IFTA 1AZPA 1EY4A 2QCPX 4CKEA 4GZYC 3GP7A 1SNDA 1QILA 3ND9A 1FNVA 2MHVA 1D5MC 2HCCA 4XQNA 3NE5B 5EKKA 3A56A 3RZDB 1EEFD 1VMPA 3T4AC 1V1PA 4KN7C 1EU4A 4PMCA 1PMRA 1CT1D 4F88A 2BOSA 3LNNA 3R8BA 2EVBA 5DEHA 1C4QA 3R2TA 3H6MA 5M5WB 5C44B 4B08A 1IYUA 4X3TA 4KY7A 1V1OA 1EY6A 5KYIA 1TT2A 2BDOA 4C3JB 4DFAA 2RDFA 3OPOA 2DNEA 4WFN3 4RCNA 3WOFA 3S1QB 4DK0A 1LTSD 2K5WA 4M1UB 4C3JG 4JBWA 4WRDA 4ZLTF 1UEAB 4I65A 2PZTA 3VYRA 5C4HA 3WDNA 3O13A 3H09A 4QUCA 1STNA 1UUPA 1I4XA 4NDXA 1CZWA 3FRPB 1TWCB 2IX0A 2ICIA 2B8GA 1EFID 2LY7A 5JVG3 5JPMC 1ENAA 4IZ8A 3GTLB 2EY1A 2RVLA 3NBIA 5C0XH 1NCVA 1E0BA 5EPJA 1B2TA 4C3IB 3MFGA 1QOHA 1JCKB 2M00A 3J7AV 3WOEA 4A3GB 2OEOA 3QG1A 4XT1B 4ABNA 3OOCA 1KLGD 1IKLA 4XYQA 4FVMA 4C3IG 1VF7A 5KEEA 3MTSA 2YU9B 4PMWA 1BBXC 1CA6A 1KDCA 1LTTD 3HOWB 1QG7A 5KNBA 1RODA 1OXVA 2NTSA 2XNAC 3NUCA 2VB3X 1MI2A 2PMZB 3CRLC 1Y8PB 1ESRA 1QJOA 1EU3A 2KA7A 1DM0B 1EYAA 1F9SA 5DAUA 2VXWA 3D8GA 3TSSA 1TS2A 2FHTA 1PRTD 5JAVA 3FMCA 4MN3A 4XIGS 5EKIA 2PZWA 5C4ZA 5LL6X 4EGVA 5JPNC 5EBCA 5FO9B 3P20A 3Q0AA 1A3UA 1LTAD 2Q8TA 1Y8NB 2ENBA 4IUVA 2JA5B 1U9RA 4O1NA 5C4XB 5C4JB 3VR2A 3AB9A 2F0SA 5M3FB 1HRJA 1WVLA 1CQFA 2MJ8A 3BDCA 4TRDA 3EVQA 4DXGA 2F0QA 2B2YC 5CMDA 5ELCA 4KV6A 3VYSA 2F0PA 1W6KA 3EJIA 5I6WA 1WTWA 4E6IA 4KY6A 2ZXRA 3HP3A 2EYHA 3E6ZX 3I4NB 1E2ZA 1TS3A 4FF1A 1M8AA 4XXEA 1YNJC 5EBDA 1QCBD 1JICA 3D6CA 2LKVA 2K05A 4K6LA 1PRTC 2JA6B 4IFDI 5CV6A 4V190 4DNRB 1M4VA 1CI3M 4U68A 3MEHA 3TBIB 4G7ZC 4Z9CB 2L55A 2J0TD 4F87A 1CFMA 2L12A 3C1EA 1SYEA 4PNYA 4NW2A 5KRUA 2CW0C 1D1KA 5C3EB 2BE5D 1ENCA 3HGBA 2A68C 3R3OA 3T53B 2NUCA 1EIGA 2GA4B 2KECA 3OW7A 4ZUIA 4EQOA 4ZRZA 1VMCA 5T1IA 3I73A 3S1RB 1SMYD 3OIQA 3GD7A 1SE2A 2TSSA 2B2UC 1HCZA 2L5TA 5KNDA 3VR5A 3K59A 5E4XA 4XT3B 3P75A 3G6JB 4R9WA 3SVMA 1HTPA 2CHBD 4XYOA 3M4OB 4IUQA 2EY6A 2KOLA 3GTJB 2SNMA 1G8ZD 1F2ZA 1SJHD 1HPCA 1MD2D 1S4ZA 4A3JB 2F03A 4MIUA 2XSCA 1NR4A 1H9KA 1STHA 2KEDA 5IOCA 4DGZA 4J8QA 4HSVA 3D4WA 2R3ZA 5CYUA 3HOYB 3Q24A 1B9MA 4X3SA 3VR4A 1LTGD 1HFNA 1FNWA 2IPKD 5D14A 2BE5C 2AQ1B 1A6XA 2BCOA 1PXUA 3DWQA 4N9PA 4ODGA 2EYOA 2XWJB 3CRKC 4K5XA 1SFOB 4HAEA 4I7ZC 2NVYB 1Z47A 2L11A 3K5OA 1ONLA 2PCFB 1F2LA 3PV0A 5C6AA 2EOTA 3SXHA 2MP1A 1DJRD 4F8MA 5FLXE 2AWOA 5I9OA 2KVMA 1SNCA 4ULLA 2SDFA 1NUCA 4LK1C 1CQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV7 A;  1RKN A;  3QOL A;  3TP7 A;  2EXZ A;  4PMB A;  1SND A;  1A2U A;  1IHZ A;  2ENB A;  3NXW A;  4KJN A;  5NUC A;  5KGU A;  5M9O A;  5HGT A;  5C5M A;  1U9R A;  5KIX A;  4IAL A;  5J22 A;  2O4X A;  5F2D A;  4ZQ3 A;  3SR1 A;  4K5V A;  2F0U A;  1ENA A;  4IZ8 A;  2F3V A;  2F0S A;  5IIF A;  4NMZ A;  2F0J A;  2EY1 A;  4ID6 A;  5EKK A;  5C3X A;  2F0I A;  3RUZ A;  3TP5 A;  4QF4 A;  5EGT A;  5I6Y A;  2WAC A;  4K2K A;  2F0W A;  5IGG A;  5IOD A;  3P75 A;  1EZ6 A;  3BDC A;  3MZ5 A;  3MXP A;  4TRD A;  2PYK A;  3MVV A;  3OMC A;  4EQN A;  1F2M A;  3EVQ A;  5ISR A;  2F0Q A;  1A2T A;  1SNO A;  5E1F A;  4J1M A;  4J6H A;  4DF7 A;  4QB4 A;  4KV6 A;  2EY6 A;  2F0D A;  2F0P A;  2SNM A;  4PMC A;  5IGC A;  2EYJ A;  3EJI A;  5KYL A;  5I6W A;  1NSN S;  2EYP A;  3E5S A;  3OSO A;  3SHL A;  4NKL A;  4KY6 A;  1F2Z A;  2RKS A;  2EYH A;  1EY7 A;  2M00 A;  3BDL A;  3DMU A;  3QB3 A;  4B9X A;  3U9O A;  4B9W A;  4KHV A;  4EQP A;  3T16 A;  3TP6 A;  5J39 A;  4K8J A;  5DEH A;  2F0N A;  2OEO A;  3LX0 A;  3HEJ A;  1II3 A;  4IUN A;  4MIU A;  3H6M A;  4R8N A;  5EKL A;  1SYG A;  1SYF A;  1STH A;  4KD3 A;  3QOJ A;  4K5W A;  2F0H A;  1JOQ A;  2EY2 A;  2RBM A;  4YIJ A;  1A3T A;  4K2L A;  1STB A;  4KD4 A;  4KY7 A;  3ITP A;  4DGZ A;  4EVO A;  5IOC A;  4HMJ A;  4DU9 A;  5JOB A;  5CV8 A;  4RKL A;  5KEE A;  5CGK A;  2HQE A;  1EYC A;  1EY0 A;  1EY6 A;  2SNS A;  3D4W A;  4N9T A;  1TT2 A;  2F0T A;  3SK5 A;  5KYI A;  5IGE A;  5K5P A;  5I9P A;  3D6C A;  2LKV A;  1KDC A;  3OMG A;  4KJO A;  3TME A;  1A3V A;  2F0E A;  2F0F A;  2F0O A;  5IGB A;  1EQV A;  2EYL A;  4QMG A;  4DFA A;  4S3S A;  1EZ8 A;  5C3W A;  4KY5 A;  2SOB A;  2RDF A;  1TR5 A;  2KHS A;  3D4D A;  4NP5 A;  3SK6 A;  4H7B A;  3MHB A;  3ERQ A;  1SNP A;  2F0M A;  4K14 A;  2PZU A;  3P1H A;  1KDB A;  5CV6 A;  3T13 A;  5I9O A;  4WOR A;  3NQT A;  5IGF A;  3TP8 A;  3NUC A;  1STA A;  3OWF A;  1EY8 A;  1JOO A;  2F0K A;  2EYO A;  3ERO A;  4N9P A;  3NHH A;  4ODG A;  2F3W A;  1KAA A;  2OF1 A;  4K5X A;  4ME5 A;  3SK4 A;  2EYF A;  4OL7 A;  2F0V A;  2QDB A;  1SYD A;  3C1F A;  1KDA A;  2OXP A;  3MEH A;  5IGD A;  1SNQ A;  1EYA A;  5DAU A;  1EY5 A;  1EY9 A;  4WRD A;  3HZX A;  3DHQ A;  2KQ3 A;  3C1E A;  1SYE A;  4PNY A;  5KRU A;  4K6D A;  3PMF A;  5C5L A;  3V2T A;  5CV4 A;  5CV9 A;  5J1Z A;  1EY4 A;  3D8G A;  4K8I A;  2PQE A;  1SYC A;  4I65 A;  2PW5 A;  5JAV A;  3S9W A;  5C6A A;  1TQO A;  1ENC A;  3VA5 A;  5CR3 A;  3NK9 A;  2EYM A;  2PZT A;  2PW7 A;  1SYB A;  3R3O A;  2NUC A;  2F0G A;  5E3F A;  3SXH A;  4E6I A;  5C4H A;  4F8M A;  1SNM A;  1EYD A;  1STN A;  2PZW A;  5C4Z A;  1SNC A;  1STG A;  5HUR A;  4KTA A;  4ZUI A;  5CC4 A;  4LAA A;  1STY A;  4G57 A;  2F0L A;  4F7X A;  1F2Y A;  3NP8 A;  4NDX A;  1KAB A;  4HMI A;  4RKB A;  5CV5 A;  4EQO A;  1JOR A;  1NUC A;  4HTH A;  4ZUJ A;  1AEX A;  1JOK A;  2EY5 A;  3SK8 A;  1A3U A; 
#chains in the Genus database with same CATH topology
 2VS1 A;  4PMB A;  5EAY A;  4B3S L;  1A2U A;  1L0X B;  4ZYS A;  4BY7 B;  5HGT A;  1JQY D;  1BF4 A;  4CJ2 C;  3ZYY X;  1XNR Q;  1NJI C;  2E74 C;  2ZM6 Q;  4DXF A;  4LF5 L;  5COY A;  5IE8 A;  5K36 G;  1U5K A;  3A54 A;  4P72 A;  5IOD A;  3I4O A;  1NR2 A;  3MVV A;  1SR3 A;  1XNQ Q;  5ISR A;  1KIX A;  1ZXT A;  4FO2 A;  2VZA A;  3CU7 A;  4BY7 G;  3DM3 A;  5A35 A;  5IGC A;  2EYJ A;  2A6H C;  3NTK A;  4DR2 L;  3RMH A;  2VNU D;  2F0N A;  3LX0 A;  1FGB D;  1SYF A;  2XTI A;  3M3Y B;  5JJI A;  4KD3 A;  3MFY A;  2WAQ E;  3E0E A;  5ELD A;  1W2B A;  4KD4 A;  3GO5 A;  4JI0 Q;  4HMJ A;  4V0B A;  4GN5 A;  5FKA C;  2JA5 H;  1IL8 A;  1EY0 A;  1EYC A;  5C4X H;  1UAP A;  2B39 A;  4PV1 C;  1O7Y A;  5C4J H;  1EOV A;  1VQM A;  5M3F H;  1ZEQ X;  2G9D A;  2CWP A;  2B2Y A;  2RA4 A;  3KYH C;  3CPW A;  3QJY A;  5IT9 c;  1K8A C;  4IJH A;  1F9Q A;  1KDB A;  4HCS A;  1D1I A;  4RA8 A;  1TKW B;  1S40 A;  3M9B A;  4KN4 C;  1IL2 A;  3NHH A;  2PNH A;  4JCV E;  1KNE A;  2OF1 A;  1OXT A;  2DNC A;  3KF8 B;  4A3C G;  3HFZ B;  2F0V A;  2KJX A;  1IYV A;  2MUY A;  5HY6 A;  3C1F A;  3OHX C;  4DUY L;  4A3M B;  2WIN B;  1EY9 A;  5FLX L;  4RHS A;  2PQA B;  5ELF A;  1VQN A;  1V1P B;  1HUN A;  5IP7 H;  4CJ1 B;  3LWE A;  2HHH Q;  2D0O A;  4DV1 Q;  1RDP D;  2NWG A;  3I4M B;  1NAP A;  2IY5 B;  1SAP A;  1Q46 A;  4A3M G;  2R6G A;  2FMM A;  3H94 A;  1KAB A;  5CV5 A;  2I0Q A;  3MXU A;  5DM6 3;  2K03 A;  2JA6 H;  2MFI A;  1AEX A;  2J4X A;  4H02 A;  5GAH C;  2L1B A;  4LMQ D;  1D7Q A;  1HTL D;  3S2H B;  2ZXO A;  2A69 D;  1YHA A;  3J81 c;  2IHF A;  3I4M G;  1PTO D;  1TS5 A;  1WTQ A;  3PCO B;  4XTC S;  3NTI A;  1SEB D;  1DOM A;  5EGT A;  1JC7 A;  3PO2 B;  3A7A B;  3UDX A;  3RLF A;  2J7Z A;  2PYK A;  1Y69 U;  1HNX Q;  1N33 L;  1PFN A;  4APV A;  5C3E H;  2F0D A;  2IT1 A;  4C3H B;  2QGQ A;  1MJC A;  5IGE A;  3SHL A;  2ICE C;  1VQ6 A;  3MA2 B;  4B3M Q;  4BY1 B;  1E24 A;  1J9O A;  2KUM A;  3L7Z C;  3K5M A;  3L2P A;  1FJG L;  2B2V C;  1I6H B;  1HNW Q;  3PO2 G;  3BVZ A;  2XRS D;  3QOJ A;  4LUZ A;  2EY2 A;  3KF8 A;  1GOZ A;  3OWE B;  2QKI C;  4NXN Q;  4UAI A;  1SBB B;  1JJC B;  3S1R H;  5FO8 B;  1N34 Q;  4DR5 L;  4C3H G;  1I5F A;  2QEX A;  2Z9H A;  2FIN B;  3EIV A;  3IKJ A;  1JR0 D;  5IYB H;  3SE0 A;  2PQA A;  3OMG A;  4BY1 G;  1DZ1 A;  2O2L D;  4OIK A;  2F0O A;  4L8J A;  4QMG A;  1O7Z A;  1N32 Q;  3AMU A;  4TVA B;  3RZO B;  4IQZ A;  3QWN A;  4CGY B;  4JOI C;  5BN4 A;  1DYQ A;  5IGF A;  5LHY 1;  3CCV A;  3U4V A;  3M4O H;  2ZJR A;  4R4T A;  1C48 A;  2EJF C;  1D5X C;  3T51 B;  1G2S A;  2Q8R E;  1TVX A;  1OXS C;  1VDZ A;  3VYU A;  1XMQ Q;  5E4W C;  3CD6 A;  1GKH A;  1TWH B;  2A69 C;  5FLX c;  4A3J H;  5H1S E;  4QIW E;  1GUT A;  3PUY A;  4H0L C;  1PTO C;  3N6R A;  4HR7 B;  4RCO A;  2VW9 A;  1QUQ B;  1YI2 A;  3EA6 A;  4K8I A;  1CTM A;  3AFQ A;  4K0K L;  3CCU A;  2MNA A;  3S9W A;  1GXD C;  1IBK L;  4DR6 Q;  4JI4 L;  5CR3 A;  4F7X A;  5IY0 A;  4HN7 A;  5ELE A;  2AWN A;  3HOY H;  3UDF A;  3ONA B;  1Z9F A;  1XX8 A;  4CKB A;  5JJZ A;  1JB3 A;  2JEB I;  4B3R L;  1SE8 A;  4LAA A;  2K28 A;  5I2Y A;  2F0L A;  1L1O B;  4JG2 A;  4DV2 L;  2FMC A;  2OQ0 A;  5BN5 A;  4HTH A;  1N36 L;  4KLK A;  5D3I B;  3K5L A;  1X55 A;  5KGU A;  3FP9 A;  4A93 B;  4IOC A;  1D8L A;  1VQP A;  4IAL A;  3KLS X;  3K6O A;  4DR4 Q;  3PF4 A;  3I2Z A;  1LT3 D;  2JSO A;  1SFO H;  3ZJY C;  5FO7 B;  2F0J A;  1BXT A;  4ID6 A;  2B63 H;  3TQY A;  3UE0 A;  2NVY H;  1K3B C;  4U67 3;  1VQB A;  1XMO Q;  2DJG C;  4NXM Q;  1HZA A;  4HID A;  4MTK A;  2CCZ A;  3GDE A;  4QL5 A;  1BNZ A;  4A93 G;  4HED A;  4ZK9 B;  5TSS A;  2YTX A;  2NVQ B;  3H3V I;  5IGB A;  1K83 B;  2D9U A;  4DN4 M;  4IUN A;  1FD7 D;  3HOX B;  5K36 H;  2VQF L;  2HDM A;  4K5W A;  2RDH A;  1PZJ D;  4IPG A;  4TQU S;  2YV5 A;  2XN9 C;  4RKL A;  2WAQ B;  4BY7 H;  4N9T A;  1LM0 A;  3P7J A;  1IBM L;  1QUQ A;  1STE A;  2JEA I;  2PI2 A;  3EN2 A;  2RCN A;  1K8M A;  2CFM A;  4LF8 L;  2F0F A;  4PQX A;  1EQV A;  1HFG A;  2EYL A;  4YWK A;  3J7Y W;  3HOX G;  4L5R C;  1TY0 A;  2SOB A;  1TR5 A;  2RDG A;  4LF4 Q;  4JI2 L;  4LF9 Q;  4UY8 C;  1YIJ A;  4L5Q A;  3CQZ B;  1VQK A;  3I70 A;  3IL8 A;  2WAQ G;  3GTQ B;  4P74 A;  1KQS A;  4JBK A;  1HNZ L;  1L1O A;  3K80 C;  2XWB B;  3KLS A;  5IYC G;  3PO3 B;  3GTG H;  1RTO A;  4I7A A;  4FF3 A;  5LMN W;  1I4G A;  5GAD C;  1UNS A;  3A8J E;  3DLL A;  2B29 A;  4DV7 Q;  3VYT A;  4X65 Q;  1FNU A;  1I4Q A;  3PMF A;  4POF A;  1LAC A;  3BYY B;  1U4R A;  3PO3 G;  1CUK A;  1G91 A;  4X6A H;  4BWG B;  3A7L A;  4RHR A;  1HZ9 A;  3I91 A;  4A3C H;  1PZK D;  1STG A;  1YNN C;  4HCE A;  3K58 A;  1JOK A;  1T5E A;  1YNJ D;  1IZ6 A;  3K8A A;  4QCL A;  2UXD L;  4G7O C;  1BCP D;  2NN6 I;  3H15 A;  4YCU A;  5C5M A;  3URY A;  5DLQ E;  3F2B A;  1KNA A;  4LJZ C;  3GTK B;  1TY2 A;  1EUJ A;  1HA5 A;  4K5V A;  3M85 A;  1V1Q A;  3BZD B;  1EWH A;  3QIA A;  2E5L L;  2O5I C;  4KK7 A;  4A3M H;  4K2K A;  2QDL A;  4ME3 A;  3MZ5 A;  1LTI D;  2K33 A;  4MHE A;  1S5C D;  4GNX B;  4X66 Q;  4X3U A;  1X3Q A;  1PYW D;  1WCM H;  5KYL A;  5EPL A;  3I4M H;  4KI0 A;  4A75 A;  2RKS A;  4IJL A;  1E2V A;  3PQI A;  2PPB C;  3M7G A;  5EKL A;  1II3 A;  4UPA A;  4ZKC B;  3T1H L;  1JJG A;  1XNR L;  4RGM A;  2CW0 D;  1B70 B;  3GQB A;  1PTO B;  1C7Y A;  1CZG A;  4EVO A;  2NN6 G;  2K1B A;  3KF6 B;  4LUV A;  3S15 H;  3S2H H;  2AMC B;  5CGK A;  2A68 D;  4DK6 C;  4DR1 Q;  4JYA L;  3CAM A;  5JEA J;  3V05 A;  4B3T L;  1A3V A;  1Q86 C;  1QNU A;  1WTO A;  2UUC Q;  4BS9 A;  3PO2 H;  1JMC A;  3I7F A;  2ZTC A;  4LFA Q;  3T13 A;  3P1H A;  2LXJ A;  1BDO A;  4C3H H;  1S5E D;  3IRB A;  1RHP A;  1GUN A;  1BCP C;  4BY1 H;  2MPM A;  1M90 C;  1I6H H;  3DHQ A;  2KQ3 A;  4DV5 Q;  2ES2 A;  3K7U C;  1BO0 A;  2O5J C;  3AU7 A;  3HKZ E;  1I4P A;  4R4I A;  2PQE A;  4DR3 L;  1ILP A;  1TWF B;  2R92 B;  1ICF B;  3K57 A;  4DV3 L;  2BA0 A;  4A3F H;  4L5S A;  3VA5 A;  3N52 A;  3Q8D A;  2JJQ A;  2B8F A;  2K5D A;  3DM1 A;  4LF6 L;  1VQG A;  4GNX A;  1VQI A;  4JOI A;  3UI2 A;  4GN4 B;  1JB7 A;  4RH6 A;  1VF5 C;  2A1A A;  4OWX B;  3RZO H;  5FOB B;  4R1J A;  2M9V A;  3ND8 A;  2F52 A;  2I5M X;  4LFC L;  2R92 G;  2FFK B;  2VQE Q;  5KIX A;  3J81 j;  2BA1 A;  4OO1 H;  2N55 A;  3W2D A;  2KHI A;  4IUR A;  4NMZ A;  3RR5 A;  1TWH H;  1I4H A;  1QVC A;  2KCN A;  3RUZ A;  2UXC L;  3BZC A;  3CC7 A;  1KL9 A;  3CKI B;  2Z8L A;  1A2T A;  2EDG A;  1B4O A;  4J1M A;  3W1G A;  3L9A X;  3AYH B;  2LFN A;  1HJP A;  4RFB A;  5L37 A;  1NSN S;  1FR3 A;  4KHZ A;  4CKC A;  5AJ3 L;  1CSP A;  4KHV A;  3GTM B;  3TP6 A;  1O7I A;  2F4V L;  1L0Y B;  4A3D B;  4HJ8 A;  5JVH 3;  2WII B;  4DU9 A;  1TU2 B;  1SMX A;  5CV8 A;  3A74 A;  4DAY B;  2YTY A;  3OW2 A;  2EZV A;  3KJP A;  4QJF A;  3J7Z C;  1GUW A;  4KJO A;  1WTX A;  1Q90 A;  5C3W A;  1K0S A;  3CC2 A;  2ASB A;  4A3D G;  4C1N K;  2Z4I A;  2E2J B;  3CXC A;  2E2I B;  4K14 A;  1R9T B;  1LAB A;  4WOR A;  2JA7 B;  1HNW L;  3TZU A;  4JI3 L;  2R7Z B;  1JOO A;  4NXN L;  2NVQ H;  1KAA A;  1K83 H;  2K04 A;  4CDE C;  2RSO A;  3J80 E;  2KCC A;  1TS4 A;  3HOX H;  4FXG C;  2EPB A;  1PFS A;  3TZD A;  4JBJ A;  4LF7 Q;  1EWI A;  4OGQ C;  4OWT B;  2Z0S A;  1PH3 A;  2JA7 G;  2IHE A;  2R7Z G;  3FKI B;  4DAM A;  4LFB L;  2A6H D;  4AIM A;  3ULJ A;  1KRS A;  3I8Z A;  3H3V H;  3CCE A;  2EJG C;  1EQT A;  1Q12 A;  1QVF A;  3HOV B;  1CHQ D;  1I3Q H;  1PH5 A;  3NP8 A;  2YYZ A;  2CQA A;  4QQB X;  1XMQ L;  2B63 B;  1RKN A;  3QOL A;  1HH2 P;  3TP7 A;  3FKI G;  4KJN A;  1SXT A;  1MJE A;  3BS1 A;  1ZKO A;  2AUK A;  4AQY Q;  1QZH A;  2O4X A;  4JI6 Q;  2A73 B;  2JE6 I;  2TMP A;  5F2D A;  4DV6 Q;  3HOV G;  3KLR A;  3G4S A;  1W6J A;  3AQQ A;  4DR6 L;  4BBS B;  5C3X A;  4DAY A;  1KRT A;  1AW7 A;  2HUG A;  2F0I A;  3F2U A;  2UU9 L;  4GOP C;  2K5Q A;  4DUZ Q;  1CA5 A;  1EL0 A;  2B63 G;  1PYS B;  1FL0 A;  1SE3 A;  5FJ8 G;  4OHJ A;  5E1F A;  5M3M B;  5C0X J;  1IBL Q;  2F1M A;  1LT5 D;  3X3M A;  2BDN A;  3J7A F;  4UP7 A;  2V4D A;  4FDB A;  3OSO A;  4IPH A;  3UE1 A;  2IJ0 A;  3F8T A;  4BBS G;  1BCP B;  2GVA A;  1NNX A;  1IW7 D;  1SYG A;  4GLV B;  1JWM D;  2RBM A;  1OTC A;  1H9R A;  1JE4 A;  2UUB L;  5M3M G;  3S16 B;  1EOT A;  3GTP H;  1PRT B;  1G6Z A;  1X54 A;  3GTK H;  3S1N B;  4AYB E;  3OTO Q;  1BBW A;  1R4Q B;  2DY7 A;  3GTG B;  4WJ4 A;  3MXN A;  3NBH B;  2L9H A;  4H7B A;  4BXX H;  1IYJ B;  1JWS D;  3J80 L;  1B50 A;  1IXR A;  2L0C A;  2NN6 H;  3S24 A;  3OWF A;  1CK1 A;  2F0K A;  2JYO A;  3GV3 A;  2WB1 E;  1PDQ A;  2AQ2 B;  4OL7 A;  4GKK L;  2A5H A;  3JAM E;  2QDB A;  2L15 A;  1EYG A;  2WKC A;  1S72 A;  4KHP L;  3NEL A;  3KDF A;  1U4P A;  2UXB Q;  1PTO H;  5C5L A;  5CV9 A;  3DWP A;  1E3P A;  1GUS A;  4A3B B;  1YHB A;  1NE3 A;  4NB3 A;  4LNQ A;  3NK9 A;  3J80 i;  4YHH Q;  1SYB A;  4JI1 L;  2HDL A;  1WFQ A;  4O42 A;  1YIT A;  2YTV A;  1Y14 B;  3WWV A;  2JP1 A;  3DEO A;  1V8Q A;  1UE6 A;  1CKO A;  1XJV A;  3KBX A;  2A74 C;  2HCI A;  1XXG A;  3U50 C;  1G29 1;  1H9M A;  2EE1 A;  5IWA L;  4FNF A;  2X6L A;  3I56 A;  1IW7 C;  4A3B G;  1WJJ A;  2I07 B;  2R93 H;  1DOL A;  4JI7 L;  3U9S A;  2VB2 X;  2E2D C;  3NEN A;  1B53 A;  1HUM A;  2QF7 A;  1WCM B;  3A8K E;  3G71 A;  3K0Y A;  5DM7 3;  2AQ3 B;  4P71 A;  3MXG A;  4X64 L;  1RCV D;  5JEA H;  3RLN A;  3UDG A;  3RN2 A;  1M1K C;  4YCV A;  1SNO A;  1HQR D;  1TWF H;  2R92 H;  1J5E Q;  1PLF A;  1MSH A;  1LYL A;  3NBH A;  1NMF A;  1RJT A;  2EYP A;  4C2M B;  1UE5 A;  3S15 B;  2K14 A;  3DMU A;  2OCE A;  1IKM A;  1K8O A;  1WCM G;  3T16 A;  1ICW A;  2PMZ E;  4R8N A;  3BVG A;  2QIL A;  2F0H A;  4DV0 Q;  2ZTE A;  4DV4 Q;  2K7V A;  1GUO A;  1TWA B;  1CHP D;  1KTK A;  4OEL B;  4HIK A;  3PUZ A;  1EWC A;  5IP9 G;  3D6W A;  5HGQ A;  3J7A 5;  4X66 L;  2A6E D;  2HIX A;  4OX9 L;  4YY3 L;  1V43 A;  1CKM A;  4S3S A;  2Q2T A;  2KEE A;  4NP5 A;  1SRU A;  3JAM L;  4UDU C;  3J80 c;  5G3L D;  4TSS A;  1C0A A;  2PZU A;  1VQ9 A;  1PFB A;  3TP8 A;  2Y0S E;  1E2W A;  3K5N A;  2QEJ C;  2IL8 A;  2B2U A;  2XRQ D;  3DUZ A;  3PUW A;  4L63 B;  1B8A A;  5EQ0 A;  3HS0 C;  4A3F B;  2M2L A;  3GTM H;  2DN8 A;  4OO1 I;  2JN4 A;  4HJ9 A;  1VQE A;  2R7D A;  3Q6S A;  2B2W C;  4A3D H;  4GOP B;  3I3C A;  3V2T A;  1VQD A;  3KJO A;  2UUC L;  2RCF A;  3CW2 C;  3JAM i;  4N8F A;  3D4R A;  2N3S A;  4LW1 A;  2F0G A;  1HA6 A;  4EQ5 A;  3RNU A;  3KFU A;  1WYD A;  4A3F G;  3KBG A;  4KTA A;  4RKB A;  2E2J H;  4RMF A;  1GHK A;  2E2I H;  3FPP A;  1F77 A;  1R9T H;  2JA7 H;  2R7Z H;  4DV5 L;  1PH6 A;  5LMU Q;  5COR A;  2C9O A;  1XYI A;  5GAG C;  4GKJ Q;  4G7H C;  2NVX B;  1E1T A;  1HQM C;  2F0U A;  4DAV A;  5IIF A;  2K01 A;  2JA9 A;  2OTL A;  3R93 A;  4OO1 G;  5LMN L;  2KHJ A;  4QF4 A;  3TP5 A;  2NTT A;  2WAC A;  2F0W A;  5ELO A;  1EZ6 A;  1F2M A;  2A6E C;  1PH8 A;  2DJF C;  4IUU A;  3ICE A;  5D65 A;  1ILQ A;  3FKI H;  4L6T B;  1RL2 A;  5I2X A;  3DWA A;  2RHQ B;  3M7N A;  5FK9 C;  4P75 A;  1Q7Y C;  3RD4 A;  3HOV H;  4ZCK A;  1UWV A;  2AKW B;  3HEJ A;  1A15 A;  1MBY A;  1BCP F;  1Z7T A;  4YIJ A;  3FEW X;  3I72 A;  5FJ8 H;  1LO5 D;  2D62 A;  4ZKB B;  3D31 A;  2UUA Q;  1PRT F;  4DNT B;  4GOP A;  3M4P A;  4P2C B;  4B3S Q;  1YNN D;  3CCL A;  3CP0 A;  4BBS H;  4H44 C;  2XGT A;  3JAM c;  1X3E A;  4AYB B;  1XPR A;  3ULL A;  3G7L A;  4LF5 Q;  1U4M A;  2AUJ D;  3C2P A;  3C3L A;  1WTV A;  5M3M H;  2VUM B;  4CDF C;  1H9S B;  1VQJ A;  1EIY B;  1Y1W B;  1DCZ A;  2WB1 B;  5IGD A;  4AYB G;  4M8A A;  3VR3 A;  3CHB D;  4KMU C;  1MGS A;  1NBW A;  4DR2 Q;  4FF2 A;  2WV6 D;  3SDZ A;  1I3Q B;  3A55 A;  5J3B A;  3S16 H;  1C8C A;  3BZK A;  3TS2 A;  2VUM G;  1RTN A;  1OXU A;  3TEH B;  3S2D B;  3SEB A;  2NB0 A;  1Y1W G;  1T5X D;  2R7F A;  4KKT A;  3GTO B;  1YJ9 A;  3S14 B;  3S1N H;  2WP8 J;  2HQL A;  2WB1 G;  1SNM A;  1HXY D;  1B3A A;  2N88 A;  4JI8 L;  3NQI A;  4QGU A;  4ZUJ A;  3X3N A;  5CV7 A;  1Z6H A;  1WD1 A;  5M5Y B;  2SEB D;  2NVT B;  4FXD A;  2B3G A;  3NXW A;  1BOS A;  1BKB A;  1BVS A;  4A3K B;  3SR1 A;  1PH1 A;  1B9N A;  1HR0 L;  2F3V A;  1KD1 C;  3G6E A;  1ASY A;  1B3Q A;  2N78 A;  4JC0 A;  3UDI A;  4DUY Q;  1QZG A;  4QB4 A;  4UP8 A;  1U0L A;  2MO1 A;  4A3B H;  5E7N A;  3CCR A;  4A3K G;  2Q2U A;  1GO3 E;  4JV5 L;  2H5X A;  4NKL A;  1ENF A;  4RGO S;  3GTP B;  4K8J A;  1H9S A;  4MNO A;  1AP0 A;  2K5N A;  4CBV A;  2C5C A;  5T1G A;  3NWT A;  2F4I A;  2LXK A;  4DR7 L;  1VQ5 A;  2L4N A;  1AZQ A;  2SNS A;  2DGY A;  4R8I A;  3A8I E;  3D3R A;  2IX1 A;  4N8X 1;  4XDX A;  5ELB A;  3BDO A;  2X6G A;  2E75 C;  3PUX A;  2K32 A;  2KHS A;  2MO0 A;  3T1Y Q;  1J8I A;  3MHB A;  4BBR B;  1O7L A;  3Q22 A;  4CHT B;  1N8R C;  1JJ2 A;  1HHV A;  4JPB W;  1SNP A;  2PNR C;  2XVS A;  4BXX G;  2ZM6 L;  1K0R A;  2Y0S B;  4C2M H;  1N33 Q;  2B2T C;  5IP9 H;  3QO2 A;  1F9P A;  1XNQ L;  1KDA A;  2VL6 A;  3CME A;  1EY5 A;  1TWG B;  4BBR G;  3I4L A;  3CMA A;  2FJ2 A;  1KXL A;  5J1Z A;  1FJG Q;  1TWA H;  4RG1 A;  2KCM A;  1S5D D;  3K7A B;  3S17 B;  5EJW A;  3RLO A;  1ET6 A;  2ID0 A;  3GV6 A;  2Y0S G;  4JVZ A;  1X9N A;  2PO4 A;  4DR5 Q;  3C46 A;  2R93 B;  2B2V A;  4JI0 L;  1PVO A;  4G57 A;  3TN2 A;  4YWM A;  3FDT A;  2RQX A;  2F3I A;  2Z6B A;  3NPP A;  2EY5 A;  2CH4 A;  1L0W A;  1IHZ A;  5DNF A;  2UXB L;  1GUG A;  1EIH A;  1O80 A;  4QIW B;  1VQ8 A;  2FXQ A;  4ZQ3 A;  2B2W A;  1I94 Q;  4BA2 I;  4IUP A;  2R93 G;  4POG A;  1H9J A;  1VQF A;  2ZJP A;  4J15 A;  1Y8O B;  3MXP A;  4WJ3 M;  1AE2 A;  2HIV A;  4J6H A;  1EEI D;  1X56 A;  4DF7 A;  5JEA G;  4IFD J;  1SDF A;  1D5Z C;  2LS0 1;  1PA6 A;  3H0G B;  1K9M C;  2IW3 A;  1WI5 A;  2RSN A;  1S5B D;  4K0K Q;  3QB3 A;  1EY7 A;  4EQP A;  4H13 C;  4B9W A;  4B9X A;  4CJ0 B;  3PF5 A;  1IBK Q;  1ESF A;  4JI4 Q;  1O78 A;  4UHV A;  1I4R A;  2HHH L;  2H1E A;  4DV1 L;  1V9P A;  1A3T A;  1YJW A;  1STB A;  3M4Q A;  4WJW A;  1AFP A;  5JOB A;  1YZ6 A;  3LWU A;  4DV2 Q;  3KUP A;  4TKO B;  4ZAI A;  2EXD A;  3E9H A;  3H0G G;  1N36 Q;  1J6Q A;  1I6V C;  1B44 D;  3MWY W;  5M5W H;  5IT9 E;  4AH6 A;  4HJA A;  2NVX H;  5C44 H;  1FYC A;  4C56 C;  1J5E L;  3TME A;  1PYB A;  2QW7 A;  4KY5 A;  3D4D A;  4IN3 A;  3I90 A;  2EIF A;  4QUF A;  3W1B A;  1B1Z A;  4KKS A;  3NQT A;  1JWU D;  1PZI D;  2G9H D;  4C3J H;  2K5H A;  4DV0 L;  4HJ5 A;  3PIO 3;  3OYY A;  1AN8 A;  2NZH A;  3L3O C;  1BQQ T;  4IFD G;  1LLR D;  2OXP A;  4RGN A;  1HNX L;  3DEP A;  3R2I A;  1Q1E A;  1PV4 A;  2BH2 A;  2Q2I A;  2ZT9 C;  2N8N A;  1CM9 A;  3FVQ A;  3G48 A;  1QWY A;  2VQF Q;  1VQA A;  5CBE E;  2GVB A;  4B3M L;  5D3D A;  1LT6 D;  2D2C C;  3RN5 A;  1I50 B;  2KEN A;  2PW7 A;  5E3F A;  1G2T A;  1KLU D;  1VQL A;  1EYD A;  3NEM A;  1JOR A;  2Z6K C;  4JK1 C;  4BA1 I;  1N34 L;  3J81 E;  4A4I A;  4LF8 Q;  5LL6 S;  1EQR A;  4C1N I;  5NUC A;  4JI2 Q;  1WTP A;  2VUM H;  1U4L A;  3Q23 A;  1PH4 A;  2ZJQ A;  2LMC B;  5J22 A;  1Y1W H;  1N32 L;  1DOK A;  1LV9 A;  3MXN B;  2Q8I B;  3L0O A;  2ALY B;  3B6Y A;  5IGG A;  2Z4H A;  3OMC A;  3OIP A;  4IOA A;  2WKD A;  4HSP A;  4A3I B;  3AEV A;  3S2D H;  1OO9 B;  1X3P A;  4DA2 A;  3S1M B;  3GTO H;  2JQO A;  3S14 H;  1DD2 A;  2EQS A;  3BDL A;  1KAW A;  1EIF A;  1AE3 A;  4RGT A;  5IT9 L;  4GKJ L;  5EPK A;  3KDF B;  5A2Q E;  4X3K A;  2MQH A;  1A8V A;  1B7Y B;  5M5Y H;  5JJL A;  4A3I G;  2NVT H;  1YBY A;  1Q3L A;  5BN3 A;  2HQE A;  3BVM A;  3SK5 A;  3VR6 A;  1SMY C;  2UXD Q;  1DXM A;  5I9P A;  4A3K H;  2A19 A;  2PI2 E;  4A3E B;  1WTR A;  2I5L X;  1BBU A;  2F0E A;  4FP5 D;  1DON A;  1ZYR D;  1EZ8 A;  3EQL C;  1SJE D;  3EFX D;  4DAP A;  3SK6 A;  2E8G A;  2DY8 A;  3BU2 A;  3ERQ A;  5C0X I;  1WD0 A;  4Y7N B;  2F0M A;  2EJM A;  4DR4 L;  3I55 A;  3H91 A;  1PFM A;  3BJU A;  3HOU B;  2XIW A;  2CVR A;  4A76 A;  1QVG A;  2F3W A;  2RHS B;  1PTO F;  2JXM B;  1EFW A;  4A3E G;  5AFW A;  1XMO L;  3F2C A;  1MSG A;  3HRZ C;  1VCI A;  4NXM L;  1SNQ A;  1E1O A;  2IWH A;  4X62 Q;  1ML0 D;  2IX3 A;  1JT8 A;  1ET9 A;  1GHJ A;  4DK1 A;  4JI5 Q;  3E0J A;  1P16 A;  4G4K A;  3BYT B;  3AFP A;  4GS3 A;  3J81 L;  3T1H Q;  3HOU G;  1R4P B;  3U58 A;  4O2D A;  2EYM A;  3D0F A;  4Q0F A;  5G3L F;  2ZXP A;  4MTN A;  2CKZ B;  2NYZ D;  4A3L H;  5CC4 A;  3M4Y A;  1F2Y A;  3KK7 A;  5C0X G;  4JYA Q;  1E7Z A;  4HMI A;  3IAY A;  4BBR H;  4B3T Q;  3PIP 3;  3SK8 A;  2X69 A;  2E2H B;  3TDQ A;  2B2T A;  2EXZ A;  4Q5V A;  2AHO B;  1N9W A;  1LT4 D;  2I46 A;  5M9O A;  3BG3 A;  3PSI A;  4DKA C;  2JK8 A;  3TRE A;  1L1O C;  1VQ7 A;  3HOZ B;  4FYD A;  1XTC D;  4LF4 L;  2GN5 A;  5KNC A;  4LF9 L;  3W3A A;  3HKZ B;  3J81 i;  1NTG A;  3PIO A;  3CPF A;  4OIJ A;  1QNK A;  1RF2 D;  4ILW A;  3MAQ A;  4KKU A;  2KCT A;  1BR9 A;  1TWG H;  5I6Y A;  1QB5 D;  3IFD A;  4EQN A;  1WTH A;  2MGS A;  1KC8 C;  5A2Q L;  1ZYR C;  1X32 A;  1F9R A;  2V1C C;  3K7A H;  4RWS C;  3HOZ G;  3NSW A;  3S17 H;  1TII D;  4IUT A;  3E5S A;  4DR3 Q;  3HKZ G;  4RAU C;  1SE4 A;  4DV7 L;  4X65 L;  3U9O A;  4XQQ A;  4DV3 Q;  5J39 A;  3NTH A;  1LTB D;  3T56 B;  3STB C;  1LTR D;  1Q8I A;  4EX5 A;  4LF6 Q;  1JOQ A;  1QE6 A;  2D5D A;  4FF4 A;  1TXY A;  4K2L A;  3ITP A;  2K5V A;  1SSO A;  1D6E C;  1Q1B A;  3V96 A;  1SLJ A;  3I4N H;  2F0T A;  3PUV A;  2K6A A;  3MC0 B;  5K5P A;  4LFC Q;  2NZ1 D;  2P5Z X;  3VA7 A;  4L5T A;  3F1Z A;  1EQQ A;  2E76 C;  3FPU B;  5CBA E;  1D2B A;  3H3V C;  2JA8 B;  1NMG A;  1XWE A;  1NY4 A;  2UXC Q;  3LGJ A;  1LTL A;  5I4D A;  4OWW B;  1Y1V B;  1STA A;  1EY8 A;  1RD9 D;  3ERO A;  2R61 A;  1UEB A;  2Z1C A;  3H0G H;  1BUV T;  4ME5 A;  1YVC A;  3SK4 A;  5GAE C;  2EYF A;  4HIO A;  1SYD A;  3NWS A;  3HZX A;  2OTJ A;  5AJ3 Q;  2JA8 G;  4K6D A;  5CV4 A;  2NBF A;  1AH9 A;  4XQJ A;  1Y1V G;  2H4O A;  2G5D A;  3T1Y L;  1SYC A;  2F4V Q;  4FXK C;  2PW5 A;  1A0I A;  4HJ7 A;  1PH2 A;  4GLA C;  1GJX A;  4Y52 H;  1TQO A;  2RF4 A;  1G6P A;  1S5F D;  5M5X B;  1JE5 A;  3DXJ C;  3HG9 A;  1OXX K;  3PGZ A;  2OT2 A;  4IFD H;  3ERS X;  5HUR A;  1STY A;  1YHQ A;  2UUA L;  3IFT A;  1AZP A;  1EY4 A;  2QCP X;  3KOJ A;  4PZ8 A;  4CKE A;  4GZY C;  4DR1 L;  4IO9 A;  3GP7 A;  1SND A;  1QIL A;  4CDD C;  3ND9 A;  1FNV A;  2MHV A;  1D5M C;  1X3F A;  2HCC A;  4XQN A;  4JI3 Q;  3NE5 B;  5EKK A;  4LFA L;  3A56 A;  3RZD B;  1EEF D;  1E22 A;  4OXP A;  5GQO A;  1VMP A;  3T4A C;  1V1P A;  4KN7 C;  1EU4 A;  4PMC A;  1PMR A;  2KBN A;  1CT1 D;  1MHW C;  1I50 H;  2Z6K A;  1CSQ A;  4F88 A;  2BOS A;  3LNN A;  3F2D A;  4LFB Q;  3R8B A;  2EVB A;  5DEH A;  3CCJ A;  4GNX C;  1C4Q A;  3R2T A;  3H6M A;  5M5W B;  5C44 B;  1I94 L;  4B08 A;  1IYU A;  4X3T A;  3GTJ H;  4KY7 A;  1V1O A;  3PIP A;  2QA4 A;  1EY6 A;  5KYI A;  1TT2 A;  5BR8 Q;  1K8G A;  2BDO A;  5FLM G;  4C3J B;  5JJK A;  1YEZ A;  4DFA A;  5C44 G;  2RDF A;  1PH9 A;  3OPO A;  2VQE L;  2DNE A;  2UU9 Q;  4R4Q A;  4WFN 3;  4A3I H;  4RCN A;  3WOF A;  4PZ7 A;  1Q82 C;  2NZO A;  1DGS A;  3S1M H;  3S1Q B;  4DNI A;  4DK0 A;  3CCQ A;  1LTS D;  2K5W A;  4M1U B;  4C3J G;  1K73 C;  4JBW A;  5IYD G;  4WRD A;  4ZLT F;  1UEA B;  4PG3 A;  4GLX A;  2HD3 A;  4NPS A;  4I65 A;  1GVP A;  2UUB Q;  2PZT A;  3VYR A;  1XPO A;  1SN8 A;  1X65 A;  3WDN A;  5C4H A;  4A3E H;  3K0X A;  3O13 A;  4P73 A;  3H09 A;  4QUC A;  1STN A;  4LWC A;  1UUP A;  1I4X A;  4NDX A;  1CZW A;  3FRP B;  4Y7N H;  3ULP A;  1TWC B;  2IX0 A;  2ICI A;  2B8G A;  3A5U A;  1EFI D;  4DPG A;  3HOU H;  2WFW A;  3QR8 A;  2LY7 A;  3TS0 A;  5JVG 3;  1RIP A;  1G51 A;  5JPM C;  1PHJ A;  2N49 A;  1CKN B;  1ENA A;  3E9I A;  4IZ8 A;  3GTL B;  4HIM A;  2EY1 A;  2RVL A;  1WOC A;  3NBI A;  5C0X H;  4GKK Q;  1NCV A;  1E0B A;  5EPJ A;  1LUZ A;  1B2T A;  4C3I B;  3MFG A;  4KHP Q;  1QOH A;  1JCK B;  1X6O A;  1VQH A;  2M00 A;  3J7A V;  4LF7 L;  3WOE A;  2C35 B;  4A3G B;  4YCW A;  2BH8 A;  2OEO A;  3QG1 A;  4XT1 B;  4ABN A;  4R4O A;  3OOC A;  4JI1 Q;  3FHW A;  1KLG D;  1IKL A;  4XYQ A;  2E2H H;  1T9H A;  2CH4 W;  1K3R A;  3MEF A;  4FVM A;  2K75 A;  1Q8K A;  4C3I G;  1VF7 A;  5KEE A;  3MTS A;  2YU9 B;  3HOZ H;  2CQO A;  4PMW A;  1HZC A;  1BBX C;  1CA6 A;  2A8V A;  1KDC A;  1LTT D;  3M3Y H;  5IWA Q;  4A3G G;  3HOW B;  2VY3 A;  1QG7 A;  4JI7 Q;  5KNB A;  1ROD A;  4AQY L;  1OXV A;  4JI6 L;  2NTS A;  2XNA C;  1UE7 A;  3NUC A;  2VB3 X;  4DV6 L;  1MI2 A;  2PMZ B;  4X64 Q;  3CRL C;  1MIU A;  1Y8P B;  1ESR A;  1QJO A;  1EU3 A;  2KA7 A;  1DM0 B;  4DUZ L;  3HOW G;  3CCS A;  1EYA A;  1F9S A;  5DAU A;  3SGI A;  1IBL L;  2VXW A;  1CKN A;  3D8G A;  3TSS A;  1TS2 A;  3CCM A;  4UP9 A;  2FHT A;  1L2F A;  1PRT D;  5JAV A;  3FMC A;  4MN3 A;  1X3G A;  1KHI A;  4JW0 A;  4XIG S;  5EKI A;  2PZW A;  5C4Z A;  1FVI A;  5LL6 X;  4EGV A;  5JPN C;  5EBC A;  5FO9 B;  2Q2H A;  4IPC A;  4A3L G;  4OX9 Q;  2I5H A;  3P20 A;  3Q0A A;  1PH7 A;  4YY3 Q;  1A3U A;  2JA8 H;  4O0A A;  4IPD A;  1LTA D;  2Q8T A;  4X62 L;  4OEM B;  1Y1V H;  1S3O A;  1Y8N B;  2ENB A;  4IUV A;  3OTO L;  2JA5 B;  1U9R A;  4O1N A;  4JI5 L;  4ALP A;  5C4X B;  2K50 A;  5C4J B;  3VR2 A;  4PZ6 A;  3AB9 A;  2F0S A;  5M3F B;  1HRJ A;  1WVL A;  1CQF A;  2MJ8 A;  3BDC A;  2HT1 A;  4TRD A;  3EVQ A;  4DXG A;  2F0Q A;  2B2Y C;  3ER0 A;  5CMD A;  2K4K A;  5ELC A;  2JA5 G;  4KV6 A;  3VYS A;  3CC4 A;  5C4X G;  2F0P A;  1W6K A;  3EJI A;  5I6W A;  5M5X H;  1WTW A;  4E6I A;  4KY6 A;  2ZXR A;  3HP3 A;  2EYH A;  5M3F G;  3E6Z X;  4JBM A;  3I4N B;  2OQK A;  3A5Z B;  1E2Z A;  1TS3 A;  2CWA A;  1W3S A;  4FF1 A;  1MKH A;  1HZB A;  1M8A A;  3K81 C;  1HR0 W;  4YHH L;  4XXE A;  1YNJ C;  4OON A;  5EBD A;  1QCB D;  1Q81 C;  4CDC C;  1JIC A;  3D6C A;  2LKV A;  3E3X A;  2K05 A;  4GN3 B;  3I4N G;  4K6L A;  3RZD H;  4R4C A;  1PRT C;  2D0P A;  2JA6 B;  3A0J A;  4IFD I;  5CV6 A;  5IP7 G;  5LMN Q;  4V19 0;  3U4Z A;  4DNR B;  4B3R Q;  1M4V A;  5FLM H;  1CI3 M;  4U68 A;  1ASZ A;  3MEH A;  3TBI B;  4G7Z C;  4Z9C B;  2JA6 G;  2L55 A;  2J0T D;  4F87 A;  1CFM A;  2L12 A;  3C1E A;  1SYE A;  4PNY A;  4NW2 A;  5KRU A;  2CW0 C;  1D1K A;  1P8L A;  5C3E B;  2BE5 D;  2ATW A;  3KF6 A;  1ENC A;  3HGB A;  2A68 C;  3R3O A;  3HKS A;  3T53 B;  2NUC A;  1EIG A;  2GA4 B;  2DUD A;  2KEC A;  3OW7 A;  4DV4 L;  1GM5 A;  4ZUI A;  5IYD H;  4EQO A;  1A62 A;  4ZRZ A;  1VMC A;  4QY7 A;  4YWL A;  5T1I A;  3I73 A;  2ZTD A;  5C3E G;  3S1R B;  1SMY D;  3OIQ A;  3GD7 A;  1GD7 A;  1SE2 A;  3S1Q H;  2TSS A;  2B2U C;  3KLW A;  1VQO A;  1HCZ A;  2L5T A;  5KND A;  4LUO A;  3VR5 A;  3EBE A;  3K59 A;  5E4X A;  4XT3 B;  4A93 H;  3P75 A;  3G6J B;  1C9O A;  4R9W A;  1XPU A;  1VQC A;  2K52 A;  3SVM A;  1IBM Q;  1HTP A;  2CHB D;  4XYO A;  3M4O B;  4IUQ A;  2EY6 A;  2KOL A;  3GTJ B;  2SNM A;  5IYB G;  1G8Z D;  1F2Z A;  1SJH D;  1HPC A;  1MD2 D;  3W5O A;  1S4Z A;  4A3J B;  2F03 A;  2XSC A;  4MIU A;  1NR4 A;  1H9K A;  1YJN A;  1STH A;  1VS0 A;  1H95 A;  1HNZ Q;  2KED A;  1TWC H;  3JC6 6;  5IOC A;  4DGZ A;  4JI8 Q;  4J8Q A;  4HSV A;  3D4W A;  2R3Z A;  1XTD A;  1FGU A;  5CYU A;  3HOY B;  5GRO A;  1B9M A;  4X3S A;  3VR4 A;  3Q24 A;  3VDY A;  1LTG D;  1HFN A;  1FNW A;  3GTL H;  4A3J G;  2IPK D;  5D14 A;  1VQ4 A;  2BE5 C;  2AQ1 B;  5LMU L;  1HR0 Q;  1A6X A;  2BCO A;  3CF5 A;  1PXU A;  5IYC H;  4DK3 C;  4MZ9 A;  3DWQ A;  4N9P A;  4ODG A;  2EYO A;  4C3I H;  2XWJ B;  3HOY G;  3CRK C;  4K5X A;  1SFO B;  4A3G H;  4HAE A;  5BR8 L;  3CQZ H;  4I7Z C;  4JV5 Q;  2NVY B;  1Z47 A;  2L11 A;  2LSS A;  3K5O A;  2OWO A;  3GTQ H;  1UE1 A;  1ONL A;  2PCF B;  1F2L A;  3PO3 H;  2E5L Q;  3PV0 A;  5C6A A;  2EOT A;  1SRO A;  2YU9 H;  4DR7 Q;  1K28 A;  3SXH A;  2MP1 A;  1DJR D;  4F8M A;  5FLX E;  2AWO A;  3HOW H;  5I9O A;  2KVM A;  1SNC A;  3STB D;  3TRZ A;  4ULL A;  1A63 A;  2SDF A;  1YNX A;  1NUC A;  5ELN A;  4LK1 C;  1CQV A; 
#chains in the Genus database with same CATH homology
 4PMB A;  1A2U A;  1L0X B;  4ZYS A;  4BY7 B;  5HGT A;  1JQY D;  1BF4 A;  4CJ2 C;  3ZYY X;  2E74 C;  4DXF A;  5COY A;  5K36 G;  3A54 A;  5IOD A;  1NR2 A;  3MVV A;  5ISR A;  1ZXT A;  4FO2 A;  3CU7 A;  5A35 A;  5IGC A;  2EYJ A;  2A6H C;  3NTK A;  3RMH A;  2VNU D;  2F0N A;  3LX0 A;  1FGB D;  1SYF A;  3M3Y B;  4KD3 A;  3MFY A;  5ELD A;  4KD4 A;  3GO5 A;  4HMJ A;  4V0B A;  5FKA C;  1IL8 A;  1EY0 A;  1EYC A;  1UAP A;  2B39 A;  4PV1 C;  1O7Y A;  1ZEQ X;  2G9D A;  2B2Y A;  2RA4 A;  3QJY A;  1F9Q A;  1KDB A;  4HCS A;  1D1I A;  4RA8 A;  1TKW B;  4KN4 C;  3NHH A;  1KNE A;  2OF1 A;  1OXT A;  2DNC A;  2F0V A;  2KJX A;  1IYV A;  2MUY A;  3C1F A;  3OHX C;  4A3M B;  2WIN B;  1EY9 A;  5FLX L;  4RHS A;  5ELF A;  1V1P B;  1HUN A;  4CJ1 B;  3LWE A;  1RDP D;  2NWG A;  3I4M B;  1NAP A;  1SAP A;  2R6G A;  2FMM A;  3H94 A;  1KAB A;  5CV5 A;  3MXU A;  5DM6 3;  2K03 A;  1AEX A;  2J4X A;  2L1B A;  4LMQ D;  1HTL D;  3S2H B;  2ZXO A;  2A69 D;  1PTO D;  1TS5 A;  1WTQ A;  4XTC S;  3NTI A;  1SEB D;  1DOM A;  5EGT A;  1JC7 A;  3PO2 B;  3A7A B;  3RLF A;  2J7Z A;  2PYK A;  1Y69 U;  1PFN A;  2F0D A;  2IT1 A;  4C3H B;  5IGE A;  3SHL A;  2ICE C;  3MA2 B;  4BY1 B;  1J9O A;  2KUM A;  3L7Z C;  3K5M A;  2B2V C;  1I6H B;  3BVZ A;  2XRS D;  3QOJ A;  2EY2 A;  3KF8 A;  1GOZ A;  3OWE B;  2QKI C;  4UAI A;  1SBB B;  5FO8 B;  4C3H G;  2FIN B;  3IKJ A;  1JR0 D;  3SE0 A;  3OMG A;  1DZ1 A;  2O2L D;  4OIK A;  2F0O A;  4L8J A;  4QMG A;  1O7Z A;  3AMU A;  3RZO B;  4IQZ A;  3QWN A;  4CGY B;  5BN4 A;  1DYQ A;  5IGF A;  5LHY 1;  1C48 A;  2EJF C;  1D5X C;  3T51 B;  1G2S A;  2Q8R E;  1TVX A;  1OXS C;  1VDZ A;  3VYU A;  5E4W C;  1TWH B;  2A69 C;  1GUT A;  3PUY A;  4H0L C;  1PTO C;  3N6R A;  4HR7 B;  4RCO A;  3EA6 A;  4K8I A;  1CTM A;  3S9W A;  1GXD C;  5CR3 A;  4F7X A;  4HN7 A;  5ELE A;  2AWN A;  3ONA B;  1XX8 A;  4CKB A;  5JJZ A;  1JB3 A;  2JEB I;  4LAA A;  2K28 A;  5I2Y A;  2F0L A;  2FMC A;  5BN5 A;  4HTH A;  5D3I B;  3K5L A;  5KGU A;  4A93 B;  4IAL A;  3KLS X;  3K6O A;  1LT3 D;  2JSO A;  5FO7 B;  2F0J A;  1BXT A;  4ID6 A;  4U67 3;  1BNZ A;  4HED A;  4ZK9 B;  5TSS A;  2NVQ B;  5IGB A;  1K83 B;  2D9U A;  4DN4 M;  4IUN A;  1FD7 D;  3HOX B;  5K36 H;  2HDM A;  4K5W A;  2RDH A;  1PZJ D;  4TQU S;  2XN9 C;  4RKL A;  2WAQ B;  4N9T A;  3P7J A;  1STE A;  2JEA I;  1K8M A;  2F0F A;  4PQX A;  1EQV A;  1HFG A;  2EYL A;  3J7Y W;  1TY0 A;  2SOB A;  1TR5 A;  2RDG A;  3CQZ B;  3I70 A;  3IL8 A;  3GTQ B;  2XWB B;  3KLS A;  3PO3 B;  1RTO A;  4FF3 A;  1I4G A;  1UNS A;  3A8J E;  3VYT A;  1FNU A;  1I4Q A;  3PMF A;  1LAC A;  3BYY B;  1U4R A;  1G91 A;  4BWG B;  3A7L A;  4RHR A;  3I91 A;  1PZK D;  1STG A;  1YNN C;  4HCE A;  3K58 A;  1JOK A;  1T5E A;  1YNJ D;  4QCL A;  4G7O C;  1BCP D;  2NN6 I;  5C5M A;  3URY A;  1KNA A;  4LJZ C;  3GTK B;  1TY2 A;  1HA5 A;  4K5V A;  3M85 A;  3BZD B;  3QIA A;  1EWH A;  2O5I C;  4KK7 A;  4K2K A;  3MZ5 A;  1LTI D;  2K33 A;  4MHE A;  1S5C D;  4X3U A;  1X3Q A;  1PYW D;  5KYL A;  5EPL A;  4KI0 A;  2RKS A;  1E2V A;  2PPB C;  3M7G A;  5EKL A;  4ZKC B;  1II3 A;  4RGM A;  2CW0 D;  3GQB A;  1PTO B;  1CZG A;  4EVO A;  2NN6 G;  2K1B A;  5CGK A;  2A68 D;  5JEA J;  3V05 A;  1A3V A;  1QNU A;  1WTO A;  4BS9 A;  3T13 A;  3P1H A;  1BDO A;  1S5E D;  1RHP A;  1GUN A;  1BCP C;  2MPM A;  3DHQ A;  2KQ3 A;  1BO0 A;  2O5J C;  3AU7 A;  1I4P A;  2PQE A;  1ILP A;  1TWF B;  2R92 B;  3K57 A;  2BA0 A;  3VA5 A;  3N52 A;  2B8F A;  2K5D A;  3DM1 A;  3UI2 A;  4RH6 A;  1VF5 C;  5FOB B;  2M9V A;  3ND8 A;  2FFK B;  5KIX A;  2BA1 A;  4OO1 H;  2N55 A;  3W2D A;  4IUR A;  4NMZ A;  1I4H A;  2KCN A;  3RUZ A;  3CKI B;  2Z8L A;  1A2T A;  2EDG A;  1B4O A;  4J1M A;  3L9A X;  2LFN A;  4RFB A;  1NSN S;  1FR3 A;  4KHZ A;  4CKC A;  4KHV A;  3GTM B;  3TP6 A;  1L0Y B;  4A3D B;  5JVH 3;  2WII B;  4DU9 A;  1TU2 B;  5CV8 A;  2EZV A;  1GUW A;  4KJO A;  1WTX A;  1Q90 A;  5C3W A;  4C1N K;  2Z4I A;  2E2J B;  2E2I B;  4K14 A;  1R9T B;  1LAB A;  4WOR A;  2JA7 B;  3TZU A;  2R7Z B;  1JOO A;  1KAA A;  2K04 A;  2RSO A;  3J80 E;  2KCC A;  1TS4 A;  4FXG C;  2EPB A;  3TZD A;  4OGQ C;  3FKI B;  2A6H D;  3I8Z A;  2EJG C;  1EQT A;  1Q12 A;  3HOV B;  1CHQ D;  3NP8 A;  2YYZ A;  2CQA A;  2B63 B;  1RKN A;  3QOL A;  3TP7 A;  4KJN A;  1SXT A;  3BS1 A;  1ZKO A;  2AUK A;  2O4X A;  2A73 B;  2JE6 I;  2TMP A;  5F2D A;  3KLR A;  1W6J A;  4BBS B;  5C3X A;  4DAY A;  1AW7 A;  2HUG A;  2F0I A;  3F2U A;  2K5Q A;  1CA5 A;  1EL0 A;  1SE3 A;  4OHJ A;  5E1F A;  5M3M B;  5C0X J;  2F1M A;  1LT5 D;  3X3M A;  2BDN A;  3J7A F;  2V4D A;  3OSO A;  2IJ0 A;  1BCP B;  1IW7 D;  1SYG A;  1JWM D;  2RBM A;  1H9R A;  1JE4 A;  3S16 B;  1EOT A;  1PRT B;  1G6Z A;  3S1N B;  2DY7 A;  1R4Q B;  3GTG B;  3MXN A;  2L9H A;  4H7B A;  1JWS D;  3J80 L;  1B50 A;  2L0C A;  2NN6 H;  3OWF A;  1CK1 A;  2F0K A;  2JYO A;  3GV3 A;  1PDQ A;  2AQ2 B;  4OL7 A;  2A5H A;  3JAM E;  2QDB A;  2WKC A;  1U4P A;  1PTO H;  5C5L A;  5CV9 A;  3DWP A;  1GUS A;  4A3B B;  3NK9 A;  1SYB A;  2HDL A;  4O42 A;  2JP1 A;  3DEO A;  1V8Q A;  3KBX A;  2A74 C;  2HCI A;  1XXG A;  1G29 1;  1H9M A;  2EE1 A;  4FNF A;  2X6L A;  1IW7 C;  2I07 B;  1DOL A;  3U9S A;  2VB2 X;  2E2D C;  1B53 A;  1HUM A;  2QF7 A;  1WCM B;  3A8K E;  3K0Y A;  5DM7 3;  2AQ3 B;  3MXG A;  1RCV D;  5JEA H;  1SNO A;  1HQR D;  1PLF A;  1MSH A;  3NBH A;  1RJT A;  2EYP A;  4C2M B;  3S15 B;  3DMU A;  1IKM A;  1K8O A;  3T16 A;  1ICW A;  4R8N A;  3BVG A;  2QIL A;  2F0H A;  2K7V A;  1GUO A;  1TWA B;  1CHP D;  1KTK A;  3PUZ A;  1EWC A;  3D6W A;  2A6E D;  1V43 A;  4S3S A;  2KEE A;  4NP5 A;  3JAM L;  4UDU C;  5G3L D;  4TSS A;  2PZU A;  1PFB A;  3TP8 A;  1E2W A;  3K5N A;  2QEJ C;  2IL8 A;  2B2U A;  2XRQ D;  3DUZ A;  3PUW A;  4L63 B;  5EQ0 A;  3HS0 C;  4A3F B;  2M2L A;  2DN8 A;  4OO1 I;  3Q6S A;  2B2W C;  3I3C A;  3V2T A;  3D4R A;  1HA6 A;  2F0G A;  3KBG A;  4KTA A;  4RKB A;  1GHK A;  3FPP A;  1F77 A;  5COR A;  2C9O A;  1XYI A;  4G7H C;  2NVX B;  1HQM C;  2F0U A;  4DAV A;  5IIF A;  2K01 A;  4OO1 G;  3R93 A;  3TP5 A;  4QF4 A;  2NTT A;  2WAC A;  2F0W A;  1EZ6 A;  1F2M A;  2A6E C;  4IUU A;  5D65 A;  1ILQ A;  4L6T B;  5I2X A;  3DWA A;  3M7N A;  5FK9 C;  3RD4 A;  3HEJ A;  1A15 A;  1MBY A;  1BCP F;  1Z7T A;  4YIJ A;  3FEW X;  3I72 A;  1LO5 D;  2D62 A;  4ZKB B;  3D31 A;  1PRT F;  4DNT B;  4P2C B;  1YNN D;  4H44 C;  4AYB B;  3G7L A;  1U4M A;  2AUJ D;  3C2P A;  3C3L A;  1WTV A;  2VUM B;  1H9S B;  1Y1W B;  1DCZ A;  2WB1 B;  5IGD A;  4M8A A;  3VR3 A;  3CHB D;  4KMU C;  1MGS A;  4FF2 A;  2WV6 D;  3SDZ A;  1I3Q B;  3A55 A;  1C8C A;  1RTN A;  1OXU A;  3S2D B;  3SEB A;  2NB0 A;  1T5X D;  4KKT A;  3GTO B;  3S14 B;  2WP8 J;  1SNM A;  1HXY D;  1B3A A;  2N88 A;  3NQI A;  4ZUJ A;  3X3N A;  5CV7 A;  1Z6H A;  1WD1 A;  5M5Y B;  2SEB D;  2NVT B;  4FXD A;  3NXW A;  1BOS A;  4A3K B;  3SR1 A;  1B9N A;  2F3V A;  4QB4 A;  4NKL A;  1ENF A;  4RGO S;  3GTP B;  4K8J A;  1H9S A;  1AP0 A;  4CBV A;  2C5C A;  5T1G A;  3NWT A;  2F4I A;  2L4N A;  1AZQ A;  2SNS A;  4R8I A;  3A8I E;  3D3R A;  2IX1 A;  4XDX A;  5ELB A;  3BDO A;  2X6G A;  2E75 C;  3PUX A;  2K32 A;  2KHS A;  1J8I A;  3MHB A;  4BBR B;  1O7L A;  3Q22 A;  4CHT B;  1HHV A;  1SNP A;  2PNR C;  2XVS A;  2Y0S B;  2B2T C;  3QO2 A;  1F9P A;  1KDA A;  1EY5 A;  1TWG B;  3I4L A;  2FJ2 A;  5J1Z A;  1S5D D;  3K7A B;  3S17 B;  5EJW A;  1ET6 A;  2ID0 A;  3GV6 A;  2PO4 A;  3C46 A;  2R93 B;  2B2V A;  4G57 A;  3TN2 A;  3FDT A;  2RQX A;  3NPP A;  2EY5 A;  1IHZ A;  5DNF A;  1EIH A;  1GUG A;  1O80 A;  4QIW B;  4ZQ3 A;  2B2W A;  4BA2 I;  4IUP A;  1H9J A;  1Y8O B;  3MXP A;  4J6H A;  1EEI D;  4DF7 A;  5JEA G;  4IFD J;  1SDF A;  1D5Z C;  2LS0 1;  3H0G B;  2IW3 A;  2RSN A;  1S5B D;  3QB3 A;  1EY7 A;  4EQP A;  4H13 C;  4B9W A;  4B9X A;  4CJ0 B;  1ESF A;  1O78 A;  1I4R A;  2H1E A;  1A3T A;  1STB A;  4WJW A;  1AFP A;  5JOB A;  3LWU A;  3KUP A;  4TKO B;  4ZAI A;  1I6V C;  1B44 D;  3MWY W;  5IT9 E;  1FYC A;  4C56 C;  3TME A;  4KY5 A;  3D4D A;  4IN3 A;  3I90 A;  4QUF A;  1B1Z A;  4KKS A;  3NQT A;  1JWU D;  1PZI D;  2G9H D;  3PIO 3;  1AN8 A;  3L3O C;  1BQQ T;  4IFD G;  1LLR D;  2OXP A;  4RGN A;  3DEP A;  3R2I A;  1Q1E A;  2ZT9 C;  1CM9 A;  3FVQ A;  1QWY A;  5CBE E;  5D3D A;  1LT6 D;  2D2C C;  1I50 B;  5E3F A;  2PW7 A;  1G2T A;  1KLU D;  1EYD A;  1JOR A;  4JK1 C;  4BA1 I;  3J81 E;  5LL6 S;  4C1N I;  5NUC A;  1WTP A;  1U4L A;  3Q23 A;  2LMC B;  5J22 A;  1DOK A;  1LV9 A;  2Q8I B;  5IGG A;  2Z4H A;  3OMC A;  3OIP A;  2WKD A;  4HSP A;  4A3I B;  1OO9 B;  1X3P A;  4DA2 A;  3S1M B;  1DD2 A;  3BDL A;  4RGT A;  5IT9 L;  5EPK A;  5A2Q E;  4X3K A;  1Q3L A;  5BN3 A;  2HQE A;  3BVM A;  3SK5 A;  3VR6 A;  1SMY C;  1DXM A;  5I9P A;  4A3E B;  1WTR A;  2F0E A;  4FP5 D;  1DON A;  1ZYR D;  1EZ8 A;  3EFX D;  1SJE D;  3EQL C;  4DAP A;  3SK6 A;  2DY8 A;  5C0X I;  3ERQ A;  1WD0 A;  4Y7N B;  2F0M A;  2EJM A;  3H91 A;  1PFM A;  3HOU B;  2XIW A;  2CVR A;  2F3W A;  1PTO F;  2JXM B;  5AFW A;  1MSG A;  3HRZ C;  1VCI A;  1SNQ A;  2IWH A;  1ML0 D;  2IX3 A;  1ET9 A;  1GHJ A;  4DK1 A;  3E0J A;  4G4K A;  3BYT B;  3J81 L;  1R4P B;  2EYM A;  4Q0F A;  5G3L F;  2ZXP A;  2NYZ D;  5CC4 A;  3M4Y A;  1F2Y A;  3KK7 A;  5C0X G;  4HMI A;  3IAY A;  3PIP 3;  3SK8 A;  2X69 A;  2E2H B;  3TDQ A;  2B2T A;  2EXZ A;  4Q5V A;  2I46 A;  1LT4 D;  5M9O A;  3BG3 A;  4FYD A;  3HOZ B;  1XTC D;  5KNC A;  3W3A A;  3HKZ B;  4OIJ A;  1QNK A;  1RF2 D;  4ILW A;  3MAQ A;  4KKU A;  1BR9 A;  5I6Y A;  1QB5 D;  3IFD A;  4EQN A;  2MGS A;  5A2Q L;  1ZYR C;  1X32 A;  1F9R A;  4RWS C;  3NSW A;  1TII D;  4IUT A;  3E5S A;  4RAU C;  1SE4 A;  3U9O A;  4XQQ A;  5J39 A;  3NTH A;  1LTB D;  3T56 B;  1LTR D;  1Q8I A;  1JOQ A;  1QE6 A;  2D5D A;  4FF4 A;  4K2L A;  3ITP A;  1SSO A;  1D6E C;  1Q1B A;  3V96 A;  2F0T A;  3PUV A;  2K6A A;  3MC0 B;  5K5P A;  2NZ1 D;  3VA7 A;  2E76 C;  3FPU B;  5CBA E;  1D2B A;  3H3V C;  2JA8 B;  1XWE A;  5I4D A;  1Y1V B;  1STA A;  1EY8 A;  1RD9 D;  3ERO A;  2R61 A;  2Z1C A;  1BUV T;  4ME5 A;  3SK4 A;  2EYF A;  1SYD A;  3NWS A;  3HZX A;  4K6D A;  5CV4 A;  2NBF A;  4XQJ A;  2H4O A;  1SYC A;  4FXK C;  2PW5 A;  1GJX A;  1TQO A;  1S5F D;  5M5X B;  3HG9 A;  3DXJ C;  1OXX K;  2OT2 A;  4IFD H;  5HUR A;  1STY A;  3IFT A;  1AZP A;  1EY4 A;  2QCP X;  4CKE A;  4GZY C;  3GP7 A;  1SND A;  1QIL A;  3ND9 A;  1FNV A;  2MHV A;  1D5M C;  2HCC A;  4XQN A;  3NE5 B;  5EKK A;  3A56 A;  3RZD B;  1EEF D;  1VMP A;  3T4A C;  1V1P A;  4KN7 C;  1EU4 A;  4PMC A;  1PMR A;  1CT1 D;  4F88 A;  2BOS A;  3LNN A;  3R8B A;  2EVB A;  5DEH A;  1C4Q A;  3R2T A;  3H6M A;  5M5W B;  5C44 B;  4B08 A;  1IYU A;  4X3T A;  4KY7 A;  1V1O A;  1EY6 A;  5KYI A;  1TT2 A;  2BDO A;  4C3J B;  4DFA A;  2RDF A;  3OPO A;  2DNE A;  4WFN 3;  4RCN A;  3WOF A;  3S1Q B;  4DK0 A;  1LTS D;  2K5W A;  4M1U B;  4C3J G;  4JBW A;  4WRD A;  4ZLT F;  1UEA B;  4I65 A;  2PZT A;  3VYR A;  5C4H A;  3WDN A;  3O13 A;  3H09 A;  4QUC A;  1STN A;  1UUP A;  1I4X A;  4NDX A;  1CZW A;  3FRP B;  1TWC B;  2IX0 A;  2ICI A;  2B8G A;  1EFI D;  2LY7 A;  5JVG 3;  5JPM C;  1ENA A;  4IZ8 A;  3GTL B;  2EY1 A;  2RVL A;  3NBI A;  5C0X H;  1NCV A;  1E0B A;  5EPJ A;  1B2T A;  4C3I B;  3MFG A;  1QOH A;  1JCK B;  2M00 A;  3J7A V;  3WOE A;  4A3G B;  2OEO A;  3QG1 A;  4XT1 B;  4ABN A;  3OOC A;  1KLG D;  1IKL A;  4XYQ A;  4FVM A;  4C3I G;  1VF7 A;  5KEE A;  3MTS A;  2YU9 B;  4PMW A;  1BBX C;  1CA6 A;  1KDC A;  1LTT D;  3HOW B;  1QG7 A;  5KNB A;  1ROD A;  1OXV A;  2NTS A;  2XNA C;  3NUC A;  2VB3 X;  1MI2 A;  2PMZ B;  3CRL C;  1Y8P B;  1ESR A;  1QJO A;  1EU3 A;  2KA7 A;  1DM0 B;  1EYA A;  1F9S A;  5DAU A;  2VXW A;  3D8G A;  3TSS A;  1TS2 A;  2FHT A;  1PRT D;  5JAV A;  3FMC A;  4MN3 A;  4XIG S;  5EKI A;  2PZW A;  5C4Z A;  5LL6 X;  4EGV A;  5JPN C;  5EBC A;  5FO9 B;  3P20 A;  3Q0A A;  1A3U A;  1LTA D;  2Q8T A;  1Y8N B;  2ENB A;  4IUV A;  2JA5 B;  1U9R A;  4O1N A;  5C4X B;  5C4J B;  3VR2 A;  3AB9 A;  2F0S A;  5M3F B;  1HRJ A;  1WVL A;  1CQF A;  2MJ8 A;  3BDC A;  4TRD A;  3EVQ A;  4DXG A;  2F0Q A;  2B2Y C;  5CMD A;  5ELC A;  4KV6 A;  3VYS A;  2F0P A;  1W6K A;  3EJI A;  5I6W A;  1WTW A;  4E6I A;  4KY6 A;  2ZXR A;  3HP3 A;  2EYH A;  3E6Z X;  3I4N B;  1E2Z A;  1TS3 A;  4FF1 A;  1M8A A;  4XXE A;  1YNJ C;  5EBD A;  1QCB D;  1JIC A;  3D6C A;  2LKV A;  2K05 A;  4K6L A;  1PRT C;  2JA6 B;  4IFD I;  5CV6 A;  4V19 0;  4DNR B;  1M4V A;  1CI3 M;  4U68 A;  3MEH A;  3TBI B;  4G7Z C;  4Z9C B;  2L55 A;  2J0T D;  4F87 A;  1CFM A;  2L12 A;  3C1E A;  1SYE A;  4PNY A;  4NW2 A;  5KRU A;  2CW0 C;  1D1K A;  5C3E B;  2BE5 D;  1ENC A;  3HGB A;  2A68 C;  3R3O A;  3T53 B;  2NUC A;  1EIG A;  2GA4 B;  2KEC A;  3OW7 A;  4ZUI A;  4EQO A;  4ZRZ A;  1VMC A;  5T1I A;  3I73 A;  3S1R B;  1SMY D;  3OIQ A;  3GD7 A;  1SE2 A;  2TSS A;  2B2U C;  1HCZ A;  2L5T A;  5KND A;  3VR5 A;  3K59 A;  5E4X A;  4XT3 B;  3P75 A;  3G6J B;  4R9W A;  3SVM A;  1HTP A;  2CHB D;  4XYO A;  3M4O B;  4IUQ A;  2EY6 A;  2KOL A;  3GTJ B;  2SNM A;  1G8Z D;  1F2Z A;  1SJH D;  1HPC A;  1MD2 D;  1S4Z A;  4A3J B;  2F03 A;  4MIU A;  2XSC A;  1NR4 A;  1H9K A;  1STH A;  2KED A;  5IOC A;  4DGZ A;  4J8Q A;  4HSV A;  3D4W A;  2R3Z A;  5CYU A;  3HOY B;  3Q24 A;  1B9M A;  4X3S A;  3VR4 A;  1LTG D;  1HFN A;  1FNW A;  2IPK D;  5D14 A;  2BE5 C;  2AQ1 B;  1A6X A;  2BCO A;  1PXU A;  3DWQ A;  4N9P A;  4ODG A;  2EYO A;  2XWJ B;  3CRK C;  4K5X A;  1SFO B;  4HAE A;  4I7Z C;  2NVY B;  1Z47 A;  2L11 A;  3K5O A;  1ONL A;  2PCF B;  1F2L A;  3PV0 A;  5C6A A;  2EOT A;  3SXH A;  2MP1 A;  1DJR D;  4F8M A;  5FLX E;  2AWO A;  5I9O A;  2KVM A;  1SNC A;  4ULL A;  2SDF A;  1NUC A;  4LK1 C;  1CQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...