2K03A

Structure of sdf1 in complex with the cxcr4 n-terminus containing a sulfotyrosine at postition 21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
b'KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCACQIVARLKNNNRQVCIDPKLKWIQEYLEKCLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1
publication title Structural basis of CXCR4 sulfotyrosine recognition by the chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 10
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k03A00
3N52A 2NYZD 2KUMA 1EQTA 1MI2A 2KOLA 3D6WA 1WTWA 3G7LA 1LV9A 2NZ1D 1G2SA 2B2UC 4NW2A 4XDXA 1X3PA 2EOTA 1B53A 4OIKA 5DNFA 1O7YA 2L12A 1VMPA 2J7ZA 1F9PA 2MGSA 4HAEA 1U4RA 2N55A 2FINB 5E4XA 4ZK9B 1KNEA 2X69A 2RSOA 2B2UA 1DOKA 1J8IA 4HSVA 1SAPA 1NR4A 3MWYW 2N88A 1RTNA 2EE1A 2H1EA 1WD0A 2B2TC 4IURA 4MHEA 2KECA 2L1BA 4O42A 1ILPA 2VXWA 3IL8A 4OIJA 3DEPA 3QO2A 1ILQA 4IUUA 1SSOA 1CA5A 2RA4A 1ESRA 4R9WA 3FDTA 2KVMA 2RSNA 3I3CA 5EJWA 2KEDA 1F9SA 1RJTA 1B3AA 1NCVA 1RHPA 2HDMA 5EPLA 4DN4M 1ICWA 1X32A 2IL8A 5E4WC 1EIHA 1JE4A 2B2YC 1GUWA 2D9UA 1QG7A 2R3ZA 4RA8A 4MN3A 2L9HA 3I90A 2HUGA 2B2WC 3R93A 1G91A 1HA6A 1QE6A 1TVXA 1PFMA 2HCIA 2JYOA 2X6GA 1IKLA 1WTXA 2EPBA 3FPUB 5CMDA 1F2LA 2K01A 2X6LA 5D65A 1O7ZA 1NAPA 3HP3A 4ZAIA 3KUPA 2CVRA 2HDLA 4CJ1B 2FJ2A 4RWSC 1HHVA 1A15A 2RVLA 3GV6A 5CBAE 2B2VC 5D14A 1QNKA 2K1BA 4X3TA 5T1GA 1EL0A 1WTQA 4LMQD 1MSHA 4R8IA 4X3KA 4HCSA 1ZXTA 3MTSA 1VMCA 1F9QA 2DY8A 1BO0A 1ML0D 1IL8A 1C8CA 2B2TA 3Q6SA 5EKIA 1U4MA 1Q3LA 3I8ZA 5EPKA 4XT1B 4CJ0B 1XX8A 1HFNA 3KBXA 1WTVA 1PFBA 5EPJA 3UI2A 1EIGA 1U4PA 2K28A 5AFWA 4QUCA 1MSGA 2MP1A 3DEOA 4IUQA 4HEDA 2B2YA 3IFDA 1PFNA 1S4ZA 2FFKB 2HCCA 5CORA 4IUVA 4RAUC 1JICA 5T1IA 4UAIA 3ONAB 2K05A 3F2UA 1B4OA 5EQ0A 2B2WA 2K04A 2MJ8A 1DOLA 1SDFA 1WD1A 1G2TA 1IKMA 1J9OA 4IUTA 4U68A 1WTRA 1DZ1A 2FMMA 2KEEA 4ZKCB 1X3QA 1U4LA 1CA6A 3I91A 3TN2A 4CJ2C 1AP0A 2FHTA 4IUPA 2M2LA 2BDNA 1HUMA 4X3UA 2B2VA 1KNAA 1DOMA 3H91A 5JJZA 2XIWA 1B50A 1RODA 1M8AA 1B2TA 3DM1A 5CBEE 1BNZA 2K03A 1XYIA 3LWEA 2Q8TA 1PDQA 1AZPA 2JP1A 1WTPA 1BBXC 3TZDA 3GV3A 4ZKBB 1EOTA 1O80A 1PLFA 2L11A 2L4NA 1WVLA 1HUNA 2NWGA 5COYA 1F9RA 1CM9A 4QUFA 1RTOA 2Q8RE 4X3SA 4ZLTF 3P7JA 1AZQA 1DONA 3SVMA 4XT3B 1MGSA 1BF4A 2DY7A 1E0BA 2MPMA 1G6ZA 2SDFA 1NR2A 1WTOA 1HRJA 1HFGA
chains in the Genus database with same CATH superfamily
4LFBQ 4JPBW 4NXML 4NW2A 2NZ1D 4LUVA 2WP8J 5M5XH 4ZCKA 3CCUA 3BS1A 1XPRA 2E5LL 2JEAI 4A3DG 3D3RA 4TVAB 3LWUA 3MVVA 4RKLA 1EOVA 5C5MA 1HCZA 4C3IB 2R92B 3PUZA 2B2UA 4OL7A 3QOJA 3SE0A 4BS9A 3S15H 4I65A 3IKJA 3FVQA 1YJNA 2F0EA 2N49A 3AEVA 1UE6A 2Z9HA 3NP8A 1CA5A 4OX9Q 3GTQB 1PH9A 1SNOA 3PMFA 4C3IH 1V9PA 2R92H 5KYLA 1FJGL 1VQOA 3BZDB 1GUWA 5KNDA 5LMNL 4FXDA 4IALA 5I9OA 4CHTB 3BU2A 2OTLA 4C3JB 1F2LA 4IOCA 4KN7C 1O78A 1EY0A 2CQAA 2NN6G 2FJ2A 4GN4B 3GTQH 1Z6HA 2ZM6L 5HGTA 2OXPA 1X9NA 1SROA 3HS0C 3PV0A 1T9HA 3OHXC 4XXEA 4JYAQ 2EYFA 4CDEC 2ICIA 3K59A 1B8AA 4RGMA 3CRKC 5M5WB 1Q3LA 4C3JH 1VQLA 3RZOB 4DR5L 1XX8A 3VR3A 3VYTA 5BR8Q 5LL6X 1CZWA 1EY8A 2B2YA 4A3IG 2UUCQ 1TWFB 3CMAA 1CKNB 2BH2A 1LTSD 1MJCA 4K0KL 5M5WH 2JA6B 3GTPH 4YCWA 3FP9A 4IUPA 2O4XA 3J80L 1GVPA 2XN9C 3CCLA 3NQIA 1SEBD 1PMRA 2WACA 1RODA 3HFZB 4DV4Q 1TWFH 2E2IB 2OTJA 2I5MX 2Q8TA 4YWMA 4LK1C 2JA6H 5I9PA 4J8QA 3EFXD 1BBXC 3M85A 1KAAA 1LT5D 3FKIG 1NSNS 4CDDC 3M4PA 1N9WA 3SVMA 5EBCA 1G6ZA 2K14A 4DAPA 3J80c 2KENA 1SN8A 1ML0D 2E2DC 1N36L 4QIWB 4YIJA 4X64L 3UDIA 2B2UC 2QW7A 4OIKA 1EZ8A 2YTVA 4BBRB 3CCRA 1F9PA 1SJED 1U4RA 4A3BB 1LLRD 2EE1A 2R93B 1VCIA 2HHHQ 2XRSD 3UDFA 1SYBA 2H4OA 3DEPA 4DAYB 4GZYC 3I7FA 4C2MB 4BBRH 5ISRA 4FF3A 5EJWA 3DHQA 5C3XA 5I6YA 1F9SA 3BZCA 4JI4L 4DUZL 4KY5A 4DN4M 1R4QB 3SGIA 4A3BH 4LFBL 5M9OA 3S2HH 1ZYRD 2PCFB 3HOWG 2HT1A 1PTOC 2R93H 4ME5A 2B2WC 4DAMA 2CHBD 3CCSA 1XWEA 4KD4A 1S72A 3RR5A 2PI2A 2K7VA 1Q81C 4C2MH 1PZKD 3K7AB 3GTLB 2V1CC 1OXSC 3D31A 2F0TA 1OXVA 4DR4L 2FMCA 1A0IA 5LHY1 1SFOB 3T4AC 3K81C 4DGZA 3J80E 2B2TA 2AQ1B 3OW2A 2Y0SB 5KNCA 3QG1A 3HOZB 3D4WA 4CJ0B 5JAVA 3GTLH 3K7AH 1WTVA 4PNYA 2K5NA 5M3FB 1Y14B 2A6ED 1STYA 1SFOH 1AFPA 3S9WA 3G6EA 5EQ0A 4ZQ3A 3EVQA 1PH7A 3P1HA 4JK1C 3KYHC 4IO9A 1PRTD 2Z6KC 2O5JC 4DFAA 5M3FH 3QB3A 4OGQC 4JYAL 5I6WA 1QNUA 3J80i 1PYWD 2AWNA 3DWQA 5IODA 1VQMA 5CBEE 3D8GA 2K03A 1S5DD 4GKKQ 1D6EC 3GV3A 1AW7A 4ALPA 1GKHA 1KIXA 4Q0FA 2WAQG 1DONA 2RHSB 4Y52H 5E3FA 1HFGA 1Y1WG 1N32Q 3FHWA 1EQTA 5FJ8H 2RQXA 5C3WA 5C4JB 3DWPA 1PRTF 2CWPA 1Q12A 3IFTA 1X3PA 1GO3E 4CGYB 1YIJA 1TS2A 3D4DA 4DV4L 3MFYA 5E4XA 3W1GA 4DV0Q 2RSOA 3I70A 4L5TA 4DK1A 3TDQA 1K3BC 2PMZE 2N8NA 1A3VA 5IGCA 2LS01 4JI0L 3ULJA 2NN6I 5C4JH 5GAEC 5LMUQ 1STEA 4JI7L 1A2TA 2RA4A 3EROA 1ICFB 1H9JA 4BBSH 5IT9c 2Q8IB 1XJVA 5EPLA 4FO2A 4NXNQ 4F88A 1JCKB 1PH5A 3VYUA 3V96A 1TQOA 1E1TA 4IPDA 4K5VA 3FPUB 4C3HB 1K8AC 2QEJC 1JB7A 1NBWA 4LJZC 2CVRA 2CH4W 3CPWA 1SNPA 4J15A 5E1FA 1X55A 2HHHL 1HQMC 4LF9Q 1KLGD 1HR0Q 1TY2A 1CHPD 2Q2IA 3J7AV 3R3OA 3I8ZA 1HXYD 4JI6Q 4C3HH 4MIUA 5CV7A 1EZ6A 4OWWB 1QOHA 2VW9A 4CBVA 3DEOA 2IHEA 2HIXA 4B3SL 5CORA 2TSSA 1VQIA 5C4XB 3SXHA 4U68A 3D0FA 1DCZA 1FNWA 2A6HC 2KEEA 2R61A 5TSSA 4ZKCB 5IP7G 2VNUD 2EJMA 4KK7A 4DR7Q 5E7NA 1R9TB 3M9BA 1PZJD 1VQFA 4QL5A 2QGQA 4UP7A 5C4XH 5A2QL 2QF7A 3H0GB 3WOFA 1WTHA 3AFPA 3T1YQ 4FVMA 1R9TH 2MPMA 4A3GB 3OIPA 3TRZA 3OW7A 1FVIA 1U0LA 1TY0A 3H0GH 3D6WA 1PTOD 4F87A 5CYUA 4DAVA 5GQOA 4XDXA 4YWLA 1O7YA 5KRUA 3TP8A 1EY6A 1GUSA 1NR4A 4GKKL 4A3GH 4L63B 4FP5D 2N88A 2BDOA 1E22A 4LF7L 3I4NG 4TKOB 3MAQA 3GTGB 1QVFA 4K5WA 1BCPD 4WJ3M 1E2WA 3DUZA 1QZHA 1GJXA 1NCVA 4C1NI 1N32L 4N9PA 4NP5A 3T1HQ 1EIHA 3TSSA 4UY8C 4RA8A 3EJIA 4MN3A 4A3LG 1PTOF 5J39A 2F52A 4KHZA 3GTGH 2ZTCA 4DV1L 1YHAA 2B8FA 2KHSA 5HGQA 3U4VA 4XQNA 1A62A 1TR5A 4P72A 4UPAA 2DJFC 1BBUA 4DV5Q 5D14A 3M7GA 4JI2L 1L1OA 4HCSA 5EAYA 1SNCA 5LMUL 2B63B 4N8X1 3WWVA 3ITPA 1BCPF 2L55A 3D6CA 1HJPA 4DF7A 3A8IE 3BG3A 4RGOS 5A2QE 5NUCA 1L0YB 3PGZA 1VQPA 1XNQL 4QUCA 1EY4A 2DNEA 2MP1A 2SOBA 1L1OB 2PZUA 2B63H 4UAIA 3ICEA 1S5ED 4HSPA 2LMCB 2D62A 4K2KA 4L5QA 4EX5A 2FXQA 1V1OA 4DV7Q 5K36H 3TEHB 2KBNA 2EY2A 4EQOA 5LL6S 1IYVA 4R1JA 4LF9L 2NVYB 5IGEA 4A93B 4AYBG 3PF5A 1RL2A 3KDFA 4R4IA 4EQ5A 2UUBQ 4QB4A 1HPCA 3A74A 2JP1A 4LWCA 3CQZB 4HJAA 3TZDA 4JI1Q 3RUZA 1XTDA 2NVYH 3Q8DA 2OQKA 3CMEA 1TXYA 4A93H 1WYDA 1Y1VB 2XRQD 3CCEA 2EYMA 1WTOA 4DR2L 1CSQA 3SEBA 2KOLA 4JOIA 1S3OA 3CQZH 1G2SA 2EOTA 4JVZA 4DR7L 3MZ5A 3EQLC 2E5LQ 1SJHD 2B3GA 3NBHB 2EJFC 4ZUIA 2BH8A 1IBLL 4B08A 1Y1VH 1VQ9A 5BN5A 4GNXA 3HOVB 1RTNA 1BDOA 4U673 1F2ZA 4GLAC 1D5XC 2KECA 1YITA 3R8BA 1M1KC 3T1YL 3E0JA 1XPOA 4QJFA 5L37A 1QUQA 2J0TD 3FDTA 1SR3A 5BN4A 3W3AA 1RJTA 1FJGQ 3NSWA 1V1QA 1ESFA 3T13A 4UDUC 2F1MA 3H3VH 2HUGA 3X3NA 4G7OC 1EYGA 2HIVA 2A73B 1QUQB 3ZYYX 4BY1B 5IGGA 3ER0A 1KRSA 2E74C 1HTPA 4DR3Q 3A54A 4KD3A 4LMQD 2JK8A 1GHKA 4WRDA 3PUVA 1Q82C 1PH4A 3Q0AA 3NPPA 2K32A 5EPKA 1PRTB 3DM3A 1X56A 2B29A 2JA5B 3WOEA 3T1HL 3NEMA 4BY1H 5FO7B 1VQ7A 4GOPA 2K28A 1H9RA 4HIOA 3VR5A 1Y69U 4LW1A 3CD6A 2WB1B 4K0KQ 5M3MB 4A3KG 2A19A 1KHIA 1WTRA 5IP9H 1X3QA 2JA5H 1U4LA 1SBBB 1ET6A 1EIYB 3NXWA 4DK3C 4GOPB 5JOBA 1DOMA 2R7ZG 3JC66 2C9OA 3BZKA 1GD7A 1PH3A 3K58A 5M3MH 3CCVA 1GUNA 4RHRA 1ZYRC 1B9MA 1VQ4A 4FNFA 3KFUA 1HQRD 2AMCB 1EUJA 4Q5VA 4ULLA 1K9MC 1KD1C 1N8RC 1N34Q 4OWTB 3C2PA 4YCVA 2PQAB 3I4MG 2E8GA 4DV7L 3J7ZC 3HG9A 3H94A 3LX0A 5IYBH 2KQ3A 3KOJA 3K5MA 2OCEA 2ZTEA 2EVBA 4YWKA 1B53A 4ABNA 1EWIA 4F7XA 1TWHB 3QOLA 2UUBL 5EKLA 5FLMH 2F0HA 2A6EC 1Q1BA 4G57A 4IURA 3MC0B 2DGYA 3L3OC 2NVQB 3IL8A 1UEBA 2AKWB 4JG2A 4WJ4A 1XMOQ 1UE1A 1TWHH 1UEAB 4R9WA 1VQNA 4DUZQ 3NQTA 4DV3Q 1TU2B 1X32A 1PRTC 2VQEL 4G4KA 2EY5A 2R3ZA 1QG7A 1IBML 4MTKA 1PFSA 3I90A 3R93A 4IQZA 1CKOA 1JOQA 1FNUA 1IKLA 4RFBA 5D65A 1A63A 3KUPA 4DUYQ 1G8ZD 5JEAH 2XSCA 5FO9B 1F77A 3AFQA 4DR4Q 4X3TA 5T1GA 3M3YB 1EEID 2JA8B 1RF2D 3BYTB 5DAUA 1EEFD 1I6VC 1C8CA 3VR2A 1I4XA 4GOPC 3K0XA 2LXKA 2KCCA 4LF4L 1D2BA 5FKAC 1STAA 3TP7A 2F4IA 2HQLA 3M3YH 2F0VA 4IUQA 2JA8H 2F0WA 3M4QA 2HCCA 4X62Q 1JICA 2I07B 1NUCA 2B2WA 1VQCA 1IKMA 1J9OA 1VF5C 4DR3L 2F0FA 2LKVA 4CJ2C 2M2LA 2OWOA 1CKNA 1HUMA 1RIPA 1EWHA 1XNRL 4N9TA 1PTOB 4AYBE 2AHOB 4PZ8A 1LTLA 1XYIA 3ND8A 1XXGA 4OHJA 1NTGA 3PSIA 4G7ZC 1EYCA 1SE3A 1HNWQ 1PHJA 3SK5A 1ASZA 4AQYQ 4P71A 1D8LA 5CV9A 2PZWA 3SK6A 5CC4A 3RZOH 2SDFA 2F3VA 2ASBA 2IWHA 1BKBA 2IX3A 1PTOH 1NE3A 1BCPB 4JV5L 3ND9A 2NYZD 1IHZA 2M00A 4RGTA 2Z6KA 5F2DA 4KLKA 2X69A 3TS0A 1J8IA 3M4YA 2NBFA 4JI0Q 4MHEA 4CDFC 3PIPA 4B3RL 1SMXA 4JI7Q 1N34L 1P8LA 1SYDA 2E2IH 4KV6A 1EFWA 4LFCL 2VQFQ 1Z47A 5E4WC 2DNCA 4P75A 5HY6A 4DAYA 4DNTB 4IFDH 1FL0A 2RCNA 3HOUG 1P16A 4I7ZC 2F0DA 5G3LD 3OMGA 3BVGA 4EQPA 3BVMA 2PW5A 2KA7A 3GV6A 1I4PA 3E0EA 3VR6A 3TZUA 1MSHA 1X6OA 4LFAL 1VMCA 2ZJPA 3CPFA 4TSSA 5JEAG 1K0RA 1XMOL 1A3UA 4DV3L 1EY9A 1FGBD 2F3WA 3T16A 4OEMB 4IPHA 3NELA 4C3IG 2R92G 3PF4A 4B3SQ 4OXPA 1S4ZA 4KI0A 1B4OA 1S5CD 2K04A 1YNND 5G3LF 4DUYL 3CXCA 2Z0SA 4A3MB 4ODGA 3A8KE 2EY1A 1SE8A 1WI5A 3TMEA 5EBDA 1K3RA 3TQYA 1K28A 1BCPC 3CKIB 2C5CA 2A5HA 2QA4A 2IPKD 3LWEA 1G291 2E2HB 1AZPA 4DK6C 4A3MH 4FF4A 4C3JG 1ONLA 4B9WA 3NBIA 2L11A 3TP5A 1C9OA 4UHVA 4X62L 4NB3A 4ZLTF 2UU9L 3HKZB 4X66L 3HOZH 1DOLA 4K8IA 1MI2A 5ELEA 1WTWA 4H44C 3DMUA 4IZ8A 1SMYC 5FLXc 3OWEB 2BCOA 4J1MA 1SNMA 2XTIA 4LF7Q 1LTAD 3AYHB 4KKTA 3S24A 1Q1EA 1SYEA 1HNWL 3H3VI 2JA6G 4AQYL 5DM63 1KABA 2CH4A 5ELCA 1DD2A 2AUJD 4XYQA 2UXBQ 1VQDA 4BA1I 2WKDA 1RKNA 1RHPA 4CKEA 3RMHA 4Y7NB 1LTGD 5CR3A 2D0PA 2IT1A 4DV1Q 2PYKA 3W1BA 2JA7B 1Y8NB 2RVLA 1MJEA 4RHSA 1W6JA 1S40A 4JI2Q 3OPOA 3WDNA 4F8MA 1IYUA 2K5DA 1GM5A 3K80C 1ENAA 1VS0A 3I4LA 1Q46A 2VQFL 4B3TL 3EN2A 3UDXA 2VY3A 4BBRG 1QZGA 1XNQQ 3S1RB 3JAMc 2JA7H 5EPJA 2DUDA 2O2LD 4A3BG 5CGKA 3J7YW 1NMGA 3I73A 1QVGA 1UE7A 4HIKA 4QY7A 4IUVA 5EGTA 4O0AA 4BWGB 5ELOA 4A3FB 2R93G 2A69C 2N78A 1WD1A 4K2LA 1EYAA 2G9HD 3S1MB 2R7DA 2EIFA 2NZHA 1D5MC 4UP8A 3TN2A 3QWNA 2CWAA 3S1RH 3BYYB 2PQEA 3NK9A 3G4SA 2XGTA 3G48A 4OONA 5KGUA 1B2TA 2MO1A 3V2TA 5IWAL 4A3FH 4A3CH 4BY7B 1CI3M 4X6AH 3LGJA 4A76A 3RZDB 2WB1E 4HMJA 4QUFA 2DY7A 4K14A 5ELDA 1JE5A 4DR2Q 3Q24A 4C56C 3A5ZB 3CC4A 4BY7H 1PYBA 1VDZA 1SNQA 2Y0SG 4NPSA 4GLXA 3K57A 4EGVA 3DXJC 3CF5A 3RZDH 5M3FG 3S17B 2MNAA 1IBLQ 1K83B 1VQHA 4B3MQ 4QF4A 3BJUA 1JWMD 2Q2UA 4AIMA 1EQRA 4O42A 4GLVB 3HOXB 4JI5L 2YTYA 2VZAA 3NWSA 4A3JB 3I3CA 4NKLA 1AH9A 2WIIB 3BDOA 3S17H 5IT9L 1K83H 1JQYD 3NWTA 2F0JA 1FD7D 1K8OA 1QE6A 3JAML 5JJIA 1CKMA 5FJ8G 4BA2I 1KL9A 1O7ZA 3M4OB 1H9SA 4ZAIA 4A3JH 1X3FA 2ZXPA 3MXGA 3VA5A 1KDAA 3PO3B 3S1NB 2DY8A 2DJGC 1ZKOA 2D5DA 5CV8A 3CRLC 3OYYA 2CW0D 2UXBL 4POFA 1CFMA 4RKBA 1H9SB 2NB0A 5J1ZA 4BBSG 2HQEA 1AE2A 1E2ZA 2IX0A 1LT3D 1E1OA 2L15A 1LTRD 1MSGA 1STHA 1R4PB 1YHBA 4KY7A 5I2YA 4HEDA 4BXXH 3PO3H 3S1NH 1HZCA 1LM0A 3QR8A 1DYQA 3C1FA 4IUTA 3DLLA 4PMCA 3SR1A 3ULPA 2F0QA 4HMIA 2EYHA 1TWCB 3W2DA 1YJWA 1GUOA 4LUOA 1B3QA 5LMNW 1LO5D 4R4QA 1W2BA 1SMYD 4H02A 5JJLA 1WCMB 4GN3B 2ZT9C 1QILA 4XQJA 4C3HG 5CV4A 5KIXA 1TWCH 3A5UA 4A3EB 5C3EB 4KKUA 1T5EA 1YVCA 2AQ2B 3PIP3 1M90C 1JC7A 1MGSA 3UDGA 1NR2A 1X3GA 3ERQA 4OO1H 1WCMH 4J6HA 5IT9E 1HH2P 1W6KA 3KLSX 1CT1D 1SXTA 1SLJA 3G7LA 1CHQD 5C44B 3JAME 3CHBD 4DR6Q 1VMPA 3VYSA 4A3EH 5C3EH 3PUYA 2BA1A 1PZID 3VA7A 3J81c 2IW3A 5I4DA 1KQSA 1UAPA 1O7LA 1MD2D 1SYGA 1PXUA 2VUMB 3P75A 3C46A 5C4XG 3MFGA 3NBHA 4IFDI 2F0LA 3QO2A 4O1NA 5GAGC 3A0JA 3FEWX 5C44H 1HNZL 1QB5D 4APVA 3C1EA 1C4QA 4LF6L 2VQEQ 1IBMQ 4IJHA 3HOYB 2IHFA 4KJOA 2PO4A 3AB9A 1PFMA 2HCIA 1EYDA 2JYOA 3H0GG 2BA0A 2WV6D 3JAMi 2A69D 2EJGC 1TWAB 5GAHC 3Q23A 4B3ML 2F0SA 3PO2B 1QNKA 1TKWB 1EL0A 1VQ8A 1EWCA 1HZBA 2F0KA 2IJ0A 1F9QA 3HOYH 3K5NA 1W3SA 4A3GG 1VQGA 2EXDA 1IL8A 2F4VQ 3MEHA 5J22A 5JEAJ 2K5HA 2NVXB 4P74A 1TWAH 4LF4Q 4QIWE 1A6XA 5IYCH 3HOVH 4A3DB 1PFBA 1D7QA 3UI2A 1EIGA 2KHIA 4E6IA 3PO2H 2JEBI 1TT2A 5JPMC 3IFDA 3RN2A 2Z4IA 4PMWA 1CTMA 4PZ6A 1JR0D 1SDFA 1TIID 3KLWA 1QVCA 3K6OA 2F0NA 3I4OA 3F1ZA 3K0YA 2NVXH 1I4GA 3E9HA 3J7A5 5IIFA 4HIMA 4A3DH 3GQBA 2XWBB 2ZJQA 3H91A 4JI3L 1AEXA 1XNRQ 1I50B 1LTBD 1FR3A 2F0OA 4KN4C 1OO9B 2I5LX 4ZRZA 3J81L 2QEXA 3STBD 1YZ6A 4JW0A 2GA4B 1PLFA 3U9OA 1LYLA 2SEBD 2NWGA 1F9RA 4PQXA 1STNA 5HURA 1I94Q 4C1NK 3RN5A 1X65A 2ENBA 2EDGA 3HGBA 3KJOA 1E24A 1N33Q 1I50H 2B63G 4JV5Q 1UNSA 2E76C 1NNXA 1M4VA 5K36G 3SDZA 2NN6H 2PQAA 3BDCA 4X65L 2Y0SE 2MGSA 4H0LC 3CC7A 1PH6A 1EY7A 4ZYSA 3MXNA 4GS3A 1JB3A 4A3IB 4GKJL 5EKKA 1C0AA 5D3DA 3J7AF 1LT4D 4B3RQ 1KXLA 1K0SA 3S14B 4LF5L 1S5BD 4OIJA 4UP9A 4P2CB 1YNNC 3CW2C 1SSOA 2EYOA 3E9IA 3HKZE 5KNBA 3R2IA 5C0XH 2Z4HA 2OQ0A 4LFCQ 3MXNB 1U5KA 3URYA 4A93G 4A3IH 2HD3A 3M7NA 2L9HA 3GTMB 3S14H 4DR6L 2MO0A 2ES2A 2F0UA 2A68D 3RLNA 3KJPA 3FKIB 3K7UC 1HHVA 1G51A 1JJ2A 4IFDJ 2B2VC 3N6RA 4R8IA 1Y1VG 4LFAQ 4JI8L 1ZXTA 3KF6B 1L0WA 3U50C 4DV6Q 3SHLA 4O2DA 3GTMH 5EKIA 2I0QA 4N8FA 3I56A 1Y8OB 1FNVA 2YYZA 1SYFA 2Z1CA 2EYPA 1BXTA 3FKIH 2LY7A 3HEJA 1RDPD 3VYRA 5IY0A 2NVQH 1KLUD 2IX1A 1UUPA 5T1IA 3NTKA 1GOZA 3GDEA 4IJLA 3CAMA 2RHQB 2A74C 2Q2HA 1H95A 2ZTDA 3I91A 3MEFA 1CQVA 4XTCS 1PV4A 5A35A 2JE6I 5FK9C 5C4HA 3OSOA 2F4VL 2K50A 3HOWB 2AUKA 2MHVA 1DM0B 1KDCA 2LXJA 3F8TA 5AJ3L 3V05A 1WTPA 1JJCB 3O13A 3BVZA 3J81i 4KMUC 4BY1G 3TS2A 5COYA 1IYJB 3U4ZA 2UU9Q 1HZ9A 4Z9CB 1JOOA 1E0BA 2CKZB 4X66Q 3VR4A 3HOWH 1YEZA 1DGSA 4L5RC 2PW7A 1B70B 5KYIA 5FO8B 3R2TA 3KBGA 1LV9A 3CCJA 5IP9G 2JA5G 3RD4A 2RF4A 4K6DA 4B9XA 3GTJB 5GROA 3J81j 3I55A 2JXMB 1I3QB 3CC2A 5CV5A 4HSVA 4MTNA 3TP6A 1TWGB 2WB1G 3U9SA 3GO5A 2CFMA 2L1BA 5M3MG 1KDBA 1MHWC 2LFNA 1II3A 5C5LA 5JVH3 1I94L 2GVAA 1WOCA 2KVMA 2RSNA 1N33L 3GTJH 2UUAQ 3GTPB 4RCNA 2XWJB 3S2DB 5IOCA 1I3QH 2IL8A 2G5DA 4PZ7A 4KTAA 2LSSA 1TWGH 4YHHL 2PNHA 4R4TA 5C0XG 1ASYA 4IPGA 2RKSA 4H7BA 2QDBA 5IYBG 4DV2Q 1GUTA 3E5SA 1NAPA 3HP3A 4HJ7A 2HDLA 1KRTA 2UXCQ 5CBAE 3GTKB 2WAQB 4QCLA 3S2DH 2K1BA 1WTQA 2BOSA 2KCMA 4WORA 1CUKA 1JT8A 3MTSA 3FMCA 5FLMG 1IL2A 1YNXA 5FOBB 1Y1WB 2GVBA 1BVSA 3Q6SA 1U4MA 1A8VA 4A75A 5DEHA 4B3TQ 3QIAA 3A8JE 3T56B 2KCTA 1Z7TA 3GTKH 1U4PA 4MZ9A 4EQNA 2RDHA 1YBYA 1ENCA 2L0CA 3I2ZA 2VL6A 3ONAB 1Y1WH 1OTCA 3CP0A 1NJIC 1HTLD 2UXDL 3MXPA 2K4KA 3NUCA 5ELFA 4CDCC 3OIQA 3AQQA 4DV6L 3AMUA 4LAAA 1JWUD 5JJZA 1B50A 2I46A 3NE5B 1M8AA 5IWAQ 4YY3L 1XPUA 4OO1I 3S2HB 2SNSA 1STGA 5IYDH 2KJXA 2VB2X 1QWYA 5D3IB 2ZXOA 1UWVA 2A8VA 3MA2B 1RTOA 2Q8RE 1OXXK 2F03A 2JA8G 5ELNA 1DXMA 1EQVA 1VQJA 4TQUS 4L5SA 3OMCA 4FDBA 4HR7B 1D5ZC 1KAWA 2CW0C 2K5WA 2YTXA 2L12A 4M8AA 2M9VA 1DOKA 1EU3A 1SAPA 5CV6A 4ILWA 3DWAA 5IGDA 3U58A 4FF1A 3T51B 3G6JB 1X54A 4JI5Q 1UE5A 2VXWA 4CKCA 3BDLA 2J4XA 1XTCD 1HR0W 1A3TA 1I5FA 1SE2A 2N3SA 5BN3A 2EYLA 4OX9L 4CKBA 2E2HH 2B2YC 1PH1A 3ERSX 4PV1C 1GXDC 1H9KA 3L7ZC 1G91A 1L2FA 2EXZA 3IRBA 4PG3A 1G6PA 5IP7H 1WJJA 2Z6BA 4P73A 3F2BA 1TS5A 3NHHA 4PMBA 5JJKA 3GD7A 1IBKQ 2JJQA 1AE3A 1BO0A 1BOSA 1J5EQ 2R7FA 1T5XD 1HNXQ 4OELB 2UUAL 2CCZA 3PIOA 3A56A 5K5PA 5IGBA 4JC0A 4RGNA 4XIGS 5BR8L 5AFWA 2F0PA 2QILA 4RG1A 4FXKC 4QGUA 2ZJRA 4DV2L 4RAUC 2UUCL 3I4NB 4IFDG 2K05A 1YNJC 1RD9D 2GN5A 4KY6A 4R4CA 1PA6A 4G7HC 2UXCL 4IUNA 4KKSA 1U9RA 1IW7C 2OT2A 1CA6A 1DJRD 2E2JB 1BQQT 4Y7NH 4ZUJA 4JBJA 3X3MA 3I72A 1KNAA 2NTSA 5C4ZA 1K73C 3RLFA 1EIFA 4BBSB 4WFN3 3I4NH 4LNQA 1LT6D 1CZGA 4H13C 1I4RA 4L8JA 1RCVD 2CQOA 1I6HB 4XQQA 2E2JH 3CU7A 1CM9A 1J6QA 1JORA 1AN8A 2ID0A 1FYCA 5IYDG 3KLRA 4KHPQ 1CSPA 1HRJA 4K8JA 4A3LH 2MQHA 2JA9A 4XYOA 3NENA 3EA6A 4DKAC 3N52A 3QJYA 1JJGA 1VQ5A 1I6HH 4YCUA 2R6GA 3A7AB 2VB3X 3MHBA 4M1UB 2WFWA 4K5XA 1PH8A 2K5QA 5C0XI 5FLXL 3S1MH 1B7YB 3TBIB 2V4DA 1ZEQX 2B2TC 2Q2TA 2P5ZX 1ILPA 4A3MG 1OXUA 1ILQA 5JPNC 1HNZQ 1VQ6A 1ESRA 2KEDA 1B3AA 4LF6Q 3S16B 4KHVA 1SRUA 4ID6A 5DM73 4AYBB 3F2CA 1XMQQ 1JE4A 2WINB 4LF8Q 1H9MA 1VQBA 2K6AA 4DU9A 2JN4A 3RNUA 3HOZG 3ZJYC 4JBWA 1LABA 3K5OA 4IPCA 2K75A 1WTXA 1B44D 3H15A 4RWSC 3Q22A 3STBC 3S16H 2QKIC 3HZXA 1BUVT 3PCOB 3HKZG 4X3KA 2NUCA 1V8QA 2L5TA 3NTIA 5JVG3 4HJ9A 4NDXA 3W5OA 5H1SE 4NMZA 1S5FD 2BE5C 3HOXH 1PFNA 2FFKB 1Q8KA 1G2TA 1EQQA 2C35B 3E3XA 2EYJA 1K8MA 3PQIA 2K33A 1IBKL 4DNRB 3MXUA 2OF1A 4DNIA 4JI3Q 1C7YA 3RLOA 2XIWA 1J5EL 2XNAC 4IN3A 1HNXL 2K5VA 3ULLA 3M4OH 1BNZA 1PVOA 1QCBD 1SNDA 3K8AA 1X3EA 4MNOA 2KCNA 1PDQA 5FLXE 1EU4A 3C3LA 2JA7G 2A68C 2NTTA 2SNMA 1NY4A 2D2CC 1GHJA 2DN8A 2K52A 4FYDA 1QJOA 2KHJA 2EY6A 1BBWA 1ET9A 3H6MA 4X65Q 2NZOA 5DNFA 1LUZA 2WKCA 3T53B 3OTOQ 4HAEA 2RCFA 2FINB 4ZK9B 1KNEA 4DV0L 4GKJQ 3EIVA 2H1EA 4S3SA 3G71A 3L0OA 2MFIA 4A3FG 1VQEA 4A3KB 4LF5Q 4RMFA 4A3CG 3HKSA 1V43A 1MKHA 1PH2A 3TREA 1CQFA 1SE4A 4KHPL 4HN7A 1O7IA 4EVOA 1IZ6A 4HJ5A 2HDMA 2R7ZB 1VF7A 3CCMA 3L9AX 4DXFA 1NMFA 4NXNL 1IXRA 3HRZC 2TMPA 2O5IC 4A3KH 1HA6A 2EZVA 1TVXA 4HIDA 3NTHA 5C0XJ 4BY7G 2EPBA 5CMDA 2K01A 1YNJD 2X6LA 3E6ZX 4WJWA 4CJ1B 4POGA 1IW7D 2R7ZH 4R4OA 4JI8Q 1A2UA 3I4MB 1ENFA 1KTKA 4GN5A 1Y8PB 1SYCA 1Z9FA 1HR0L 1TS3A 1Q7YC 3H09A 4RH6A 4DPGA 4JI6L 2ICEC 1XMQL 1HFNA 4LF8L 4KJNA 2YU9B 2ALYB 2VUMH 4DR1Q 3I4MH 2PPBC 3D4RA 1GUGA 1Q90A 4R8NA 3GTOB 2QDLA 2VS1A 1YI2A 3KDFB 4OWXB 3HOXG 2WAQE 1MIUA 1HA5A 1AP0A 1HZAA 1LTTD 4A3JG 4NXMQ 2BDNA 4HJ8A 2RDGA 2YU9H 4DXGA 2B2VA 1E3PA 1WFQA 1VQAA 3FRPB 1YHQA 3DM1A 2JSOA 5AJ3Q 3EBEA 3CCQA 3OOCA 3GTOH 2PMZB 1EFID 4ZKBB 1EOTA 1WVLA 2L4NA 3K5LA 3S1QB 1AZQA 3P7JA 1F2MA 3A7LA 4BXXG 3B6YA 3PO3G 1I4QA 4IOAA 4ME3A 2KUMA 5LMNQ 1E7ZA 4GNXB 1C48A 2A1AA 4FF2A 3OWFA 5GADC 4QQBX 5IGFA 4V0BA 2J7ZA 1TS4A 2N55A 3S1QH 2B39A 2YV5A 1L1OC 1K8GA 4HTHA 4FXGC 3MWYW 2E75C 1PYSB 2A6HD 2ZM6Q 1WD0A 4I7AA 3UE0A 1FGUA 5IE8A 4IUUA 2JQOA 4K6LA 1D1IA 4LUZA 2ATWA 1JMCA 2ZXRA 4DR5Q 1ICWA 4DK0A 2F0IA 3LNNA 2D9UA 4YHHQ 4OO1G 1CK1A 2PZTA 2G9DA 4A4IA 3PIO3 1B9NA 2IY5B 3KK7A 1JWSD 1WCMG 2BE5D 1LTID 4AH6A 3OTOL 2X6GA 2XVSA 2H5XA 5ELBA 3UE1A 2OEOA 2AWOA 2EQSA 1D1KA 4L6TB 1I4HA 3GP7A 3PUXA 4HCEA 1A15A 4A3EG 5C3EG 4DV5L 1LACA 1V1PA 2AQ3B 1Q86C 3AU7A 2QCPX 4JCVE 4RCOA 3FPPA 5I2XA 4JBMA 1MBYA 4XT1B 1B1ZA 1YJ9A 2PI2E 3A55A 3KBXA 3KF6A 5C44G 1BR9A 1OXTA 2B8GA 2RBMA 2MUYA 4V190 1V1PB 1KC8C 3H3VC 2RDFA 3F2UA 2NVTB 2F0MA 2MJ8A 2VUMG 2I5HA 4JOIC 1DZ1A 2FMMA 1EY5A 2UXDQ 3L2PA 1N36Q 3F2DA 3SK8A 2D0OA 2FHTA 3KF8A 1VQKA 4X64Q 3SK4A 4X3UA 4DA2A 1JOKA 5M5YB 2Z8LA 4GNXC 4YY3Q 3HOYG 3HOUB 2NVTH 5C6AA 3KLSA 4TRDA 1F2YA 2PNRC 2F0GA 3PUWA 3J81E 5M5XB 4DR1L 1L0XB 1O80A 5IYCG 3KF8B 3HOVG 4JI1L 1HUNA 5KEEA 3IAYA 1STBA 4X3SA 5M5YH 3PO2G 4XT3B 3VDYA 1BF4A 3S15B 1Q8IA 4QMGA 4JBKA 3P20A 5J3BA 4JI4Q 2F3IA 3HOUH 5DLQE 1E2VA
chains in the Genus database with same CATH topology
4NW2A 2NZ1D 2WP8J 3BS1A 2JEAI 3D3RA 3LWUA 3MVVA 4RKLA 5C5MA 4C3IB 1HCZA 2R92B 3PUZA 2B2UA 4OL7A 3QOJA 3SE0A 4BS9A 4I65A 3IKJA 3FVQA 2F0EA 3NP8A 1CA5A 3GTQB 1SNOA 3PMFA 5KYLA 3BZDB 1GUWA 5KNDA 4FXDA 4IALA 5I9OA 4CHTB 4C3JB 1F2LA 4KN7C 1O78A 1EY0A 2CQAA 2NN6G 2FJ2A 1Z6HA 5HGTA 2OXPA 3HS0C 3PV0A 3OHXC 4XXEA 2EYFA 3K59A 2ICIA 4RGMA 3CRKC 5M5WB 1Q3LA 3RZOB 1XX8A 3VR3A 3VYTA 5LL6X 1CZWA 1EY8A 2B2YA 1TWFB 1LTSD 2JA6B 4IUPA 2O4XA 3J80L 2XN9C 3NQIA 1SEBD 1PMRA 2WACA 1RODA 2E2IB 2Q8TA 4LK1C 5I9PA 4J8QA 3EFXD 1BBXC 3M85A 1KAAA 1LT5D 1NSNS 3SVMA 5EBCA 1G6ZA 4DAPA 1ML0D 2E2DC 4QIWB 4YIJA 2B2UC 4OIKA 1EZ8A 4BBRB 1F9PA 1SJED 1U4RA 4A3BB 1LLRD 2EE1A 2R93B 1VCIA 2XRSD 1SYBA 2H4OA 3DEPA 4GZYC 4C2MB 5ISRA 4FF3A 5EJWA 3DHQA 5C3XA 5I6YA 1F9SA 4KY5A 4DN4M 1R4QB 5M9OA 1ZYRD 2PCFB 1PTOC 4ME5A 2B2WC 2CHBD 1XWEA 4KD4A 2K7VA 3GTLB 1PZKD 3K7AB 1OXSC 3D31A 2F0TA 1OXVA 2FMCA 5LHY1 1SFOB 3T4AC 4DGZA 3J80E 2B2TA 2AQ1B 2Y0SB 5KNCA 3QG1A 3HOZB 3D4WA 4CJ0B 5JAVA 1WTVA 4PNYA 5M3FB 2A6ED 1STYA 1AFPA 3S9WA 5EQ0A 4ZQ3A 3EVQA 3P1HA 4JK1C 1PRTD 2O5JC 4DFAA 3QB3A 4OGQC 5I6WA 1QNUA 1PYWD 2AWNA 3DWQA 5IODA 5CBEE 3D8GA 2K03A 1S5DD 1D6EC 3GV3A 1AW7A 4Q0FA 1DONA 5E3FA 1HFGA 1EQTA 2RQXA 5C3WA 5C4JB 3DWPA 1PRTF 1Q12A 3IFTA 1X3PA 4CGYB 1TS2A 3D4DA 3MFYA 5E4XA 2RSOA 3I70A 4DK1A 3TDQA 1A3VA 5IGCA 2LS01 2NN6I 1STEA 1A2TA 2RA4A 3EROA 1H9JA 2Q8IB 5EPLA 4FO2A 4F88A 1JCKB 3VYUA 3V96A 1TQOA 4K5VA 3FPUB 4C3HB 2QEJC 4LJZC 2CVRA 1SNPA 5E1FA 1HQMC 1KLGD 1TY2A 1CHPD 3J7AV 3R3OA 3I8ZA 1HXYD 4MIUA 5CV7A 1EZ6A 1QOHA 4CBVA 3DEOA 5CORA 2TSSA 5C4XB 3SXHA 4U68A 1DCZA 1FNWA 5TSSA 2A6HC 2KEEA 2R61A 4ZKCB 2VNUD 2EJMA 4KK7A 1R9TB 1PZJD 5A2QL 2QF7A 3H0GB 3WOFA 4FVMA 2MPMA 4A3GB 3OIPA 3OW7A 1TY0A 3D6WA 1PTOD 4F87A 5CYUA 4DAVA 4XDXA 1O7YA 5KRUA 3TP8A 1EY6A 1GUSA 1NR4A 4L63B 4FP5D 2N88A 2BDOA 4TKOB 3MAQA 3GTGB 4K5WA 1BCPD 1E2WA 3DUZA 1GJXA 1NCVA 4C1NI 4N9PA 4NP5A 1EIHA 3TSSA 4RA8A 3EJIA 4MN3A 1PTOF 5J39A 4KHZA 2B8FA 2KHSA 4XQNA 1TR5A 5D14A 3M7GA 4HCSA 1SNCA 2B63B 3ITPA 1BCPF 2L55A 3D6CA 4DF7A 3A8IE 3BG3A 4RGOS 5A2QE 5NUCA 1L0YB 4QUCA 1EY4A 2DNEA 2MP1A 2SOBA 2PZUA 4UAIA 1S5ED 4HSPA 2LMCB 2D62A 4K2KA 1V1OA 5K36H 2EY2A 4EQOA 5LL6S 1IYVA 2NVYB 5IGEA 4A93B 4QB4A 1HPCA 2JP1A 3CQZB 3TZDA 3RUZA 1Y1VB 2XRQD 2EYMA 1WTOA 3SEBA 2KOLA 1G2SA 2EOTA 3MZ5A 3EQLC 1SJHD 2EJFC 4ZUIA 4B08A 5BN5A 3HOVB 1RTNA 1BDOA 4U673 1F2ZA 1D5XC 2KECA 3R8BA 3E0JA 2J0TD 3FDTA 5BN4A 3W3AA 1RJTA 3NSWA 1ESFA 3T13A 4UDUC 2F1MA 2HUGA 3X3NA 4G7OC 2A73B 3ZYYX 4BY1B 5IGGA 2E74C 1HTPA 3A54A 4KD3A 4LMQD 1GHKA 4WRDA 3PUVA 3Q0AA 3NPPA 2K32A 5EPKA 1PRTB 2JA5B 3WOEA 5FO7B 2K28A 1H9RA 3VR5A 1Y69U 2WB1B 5M3MB 1WTRA 1X3QA 1U4LA 1SBBB 1ET6A 3NXWA 5JOBA 1DOMA 2C9OA 3K58A 1GUNA 4RHRA 1ZYRC 1B9MA 4FNFA 1HQRD 4Q5VA 4ULLA 3C2PA 3HG9A 3H94A 3LX0A 2KQ3A 3K5MA 2EVBA 1B53A 4ABNA 4F7XA 1TWHB 3QOLA 5EKLA 2F0HA 2A6EC 1Q1BA 4G57A 4IURA 3MC0B 3L3OC 2NVQB 3IL8A 1UEAB 4R9WA 3NQTA 1TU2B 1X32A 1PRTC 4G4KA 2EY5A 2R3ZA 1QG7A 3I90A 3R93A 4IQZA 1JOQA 1FNUA 1IKLA 4RFBA 5D65A 3KUPA 1G8ZD 5JEAH 2XSCA 5FO9B 1F77A 4X3TA 5T1GA 3M3YB 1EEID 2JA8B 1RF2D 3BYTB 5DAUA 1EEFD 1I6VC 1C8CA 3VR2A 1I4XA 2KCCA 1D2BA 5FKAC 1STAA 3TP7A 2F4IA 2F0VA 4IUQA 2F0WA 2HCCA 1JICA 2I07B 1NUCA 2B2WA 1IKMA 1J9OA 1VF5C 2F0FA 2LKVA 4CJ2C 2M2LA 1HUMA 1EWHA 4N9TA 1PTOB 1XYIA 3ND8A 1XXGA 4OHJA 4G7ZC 1EYCA 1SE3A 3SK5A 5CV9A 2PZWA 3SK6A 5CC4A 2SDFA 2F3VA 2IWHA 2IX3A 1PTOH 1BCPB 3ND9A 2NYZD 1IHZA 2M00A 4RGTA 5F2DA 2X69A 1J8IA 3M4YA 2NBFA 4MHEA 1SYDA 4KV6A 1Z47A 5E4WC 2DNCA 4DAYA 4DNTB 4IFDH 4I7ZC 2F0DA 5G3LD 3OMGA 3BVGA 4EQPA 3BVMA 2PW5A 2KA7A 3GV6A 1I4PA 3VR6A 3TZUA 1MSHA 1VMCA 4TSSA 5JEAG 1A3UA 1EY9A 1FGBD 2F3WA 3T16A 4C3IG 1S4ZA 4KI0A 1B4OA 1S5CD 2K04A 1YNND 5G3LF 4A3MB 4ODGA 3A8KE 2EY1A 3TMEA 5EBDA 1BCPC 3CKIB 2C5CA 2A5HA 2IPKD 3LWEA 1G291 2E2HB 1AZPA 4FF4A 4C3JG 1ONLA 4B9WA 3NBIA 2L11A 3TP5A 4ZLTF 3HKZB 1DOLA 4K8IA 1MI2A 5ELEA 1WTWA 4H44C 3DMUA 4IZ8A 1SMYC 3OWEB 2BCOA 4J1MA 1SNMA 1LTAD 4KKTA 1Q1EA 1SYEA 5DM63 1KABA 1DD2A 5ELCA 2AUJD 4XYQA 4BA1I 2WKDA 1RKNA 1RHPA 4CKEA 3RMHA 4Y7NB 1LTGD 5CR3A 2IT1A 2PYKA 2JA7B 1Y8NB 2RVLA 4RHSA 1W6JA 3OPOA 3WDNA 4F8MA 1IYUA 2K5DA 1ENAA 3I4LA 3S1RB 5EPJA 2O2LD 5CGKA 3J7YW 3I73A 4IUVA 5EGTA 4BWGB 4A3FB 2A69C 1WD1A 4K2LA 1EYAA 2G9HD 3S1MB 1D5MC 3TN2A 3QWNA 3BYYB 2PQEA 3NK9A 5KGUA 1B2TA 3V2TA 4BY7B 1CI3M 3RZDB 4HMJA 4QUFA 2DY7A 4K14A 5ELDA 3Q24A 4C56C 1VDZA 1SNQA 3K57A 4EGVA 3DXJC 3S17B 1K83B 4QF4A 1JWMD 4O42A 3HOXB 3NWSA 4A3JB 3I3CA 4NKLA 2WIIB 3BDOA 5IT9L 1JQYD 3NWTA 2F0JA 1FD7D 1K8OA 1QE6A 3JAML 4BA2I 1O7ZA 3M4OB 1H9SA 4ZAIA 2ZXPA 3MXGA 3VA5A 1KDAA 3PO3B 3S1NB 2DY8A 1ZKOA 2D5DA 5CV8A 3CRLC 2CW0D 1CFMA 4RKBA 1H9SB 2NB0A 5J1ZA 2HQEA 1E2ZA 2IX0A 1LT3D 1LTRD 1MSGA 1STHA 1R4PB 4KY7A 5I2YA 4HEDA 1DYQA 3C1FA 4IUTA 4PMCA 3SR1A 2F0QA 4HMIA 2EYHA 1TWCB 3W2DA 1GUOA 1LO5D 1SMYD 1WCMB 2ZT9C 1QILA 4XQJA 4C3HG 5CV4A 5KIXA 4A3EB 5C3EB 4KKUA 1T5EA 2AQ2B 3PIP3 1JC7A 1MGSA 1NR2A 4OO1H 3ERQA 4J6HA 5IT9E 1W6KA 3KLSX 1CT1D 1SXTA 3G7LA 1CHQD 5C44B 3JAME 3CHBD 1VMPA 3VYSA 3PUYA 2BA1A 1PZID 3VA7A 2IW3A 5I4DA 1UAPA 1O7LA 1MD2D 1SYGA 1PXUA 2VUMB 3P75A 3C46A 3MFGA 3NBHA 4IFDI 2F0LA 3QO2A 4O1NA 3FEWX 1QB5D 3C1EA 1C4QA 3HOYB 4KJOA 2PO4A 3AB9A 1PFMA 2HCIA 1EYDA 2JYOA 2BA0A 2WV6D 2A69D 2EJGC 1TWAB 3Q23A 2F0SA 3PO2B 1QNKA 1TKWB 1EL0A 1EWCA 2F0KA 2IJ0A 1F9QA 3K5NA 1IL8A 3MEHA 5J22A 5JEAJ 2NVXB 1A6XA 4A3DB 1PFBA 3UI2A 1EIGA 4E6IA 2JEBI 1TT2A 5JPMC 3IFDA 2Z4IA 4PMWA 1CTMA 1JR0D 1SDFA 1TIID 3K6OA 2F0NA 3K0YA 1I4GA 5IIFA 3GQBA 2XWBB 3H91A 1AEXA 1I50B 1LTBD 1FR3A 2F0OA 4KN4C 1OO9B 4ZRZA 3J81L 2GA4B 1PLFA 3U9OA 2SEBD 2NWGA 1F9RA 4PQXA 1STNA 5HURA 4C1NK 3HGBA 2ENBA 2EDGA 1UNSA 2E76C 1M4VA 5K36G 3SDZA 2NN6H 3BDCA 2MGSA 4H0LC 1EY7A 4ZYSA 3MXNA 1JB3A 4A3IB 5EKKA 5D3DA 3J7AF 1LT4D 3S14B 1S5BD 4OIJA 4P2CB 1YNNC 1SSOA 2EYOA 5KNBA 3R2IA 5C0XH 2Z4HA 3URYA 3M7NA 2L9HA 3GTMB 2F0UA 2A68D 3FKIB 1HHVA 4IFDJ 2B2VC 3N6RA 4R8IA 1ZXTA 3SHLA 5EKIA 1Y8OB 1FNVA 2YYZA 1SYFA 2Z1CA 2EYPA 1BXTA 2LY7A 3HEJA 1RDPD 3VYRA 1KLUD 2IX1A 1UUPA 5T1IA 3NTKA 1GOZA 2A74C 3I91A 1CQVA 4XTCS 5A35A 2JE6I 5FK9C 5C4HA 3OSOA 3HOWB 2AUKA 2MHVA 1DM0B 1KDCA 3V05A 1WTPA 3O13A 3BVZA 4KMUC 5COYA 4Z9CB 1JOOA 1E0BA 3VR4A 2PW7A 5KYIA 5FO8B 3R2TA 3KBGA 1LV9A 3RD4A 4K6DA 4B9XA 3GTJB 2JXMB 1I3QB 5CV5A 4HSVA 3TP6A 1TWGB 3U9SA 3GO5A 2L1BA 1KDBA 2LFNA 1II3A 5C5LA 5JVH3 2KVMA 2RSNA 3S2DB 3GTPB 4RCNA 2XWJB 5IOCA 2IL8A 4KTAA 5C0XG 2RKSA 4H7BA 2QDBA 1GUTA 3E5SA 1NAPA 3HP3A 2HDLA 5CBAE 3GTKB 2WAQB 4QCLA 2K1BA 1WTQA 2BOSA 4WORA 3MTSA 3FMCA 5FOBB 1Y1WB 3Q6SA 1U4MA 5DEHA 3QIAA 3A8JE 3T56B 1Z7TA 1U4PA 4EQNA 2RDHA 1ENCA 2L0CA 3ONAB 1HTLD 3MXPA 3NUCA 5ELFA 3OIQA 3AMUA 4LAAA 1JWUD 5JJZA 1B50A 2I46A 3NE5B 1M8AA 4OO1I 3S2HB 2SNSA 1STGA 2KJXA 2VB2X 1QWYA 5D3IB 2ZXOA 3MA2B 1RTOA 2Q8RE 1OXXK 2F03A 1DXMA 1EQVA 4TQUS 3OMCA 4HR7B 1D5ZC 2K5WA 2CW0C 2L12A 4M8AA 2M9VA 1DOKA 1EU3A 1SAPA 5CV6A 4ILWA 3DWAA 5IGDA 4FF1A 3T51B 3G6JB 2VXWA 4CKCA 3BDLA 2J4XA 1XTCD 1A3TA 1SE2A 5BN3A 2EYLA 4CKBA 2B2YC 4PV1C 1GXDC 1H9KA 3L7ZC 1G91A 2EXZA 1TS5A 3NHHA 4PMBA 3GD7A 1BO0A 1BOSA 1T5XD 3A56A 5K5PA 5IGBA 4RGNA 4XIGS 5AFWA 2F0PA 2QILA 4FXKC 4RAUC 3I4NB 4IFDG 2K05A 1YNJC 1RD9D 4KY6A 4G7HC 4IUNA 4KKSA 1U9RA 1IW7C 2OT2A 1CA6A 1DJRD 2E2JB 1BQQT 4ZUJA 3X3MA 3I72A 1KNAA 2NTSA 5C4ZA 3RLFA 4BBSB 4WFN3 1LT6D 1CZGA 4H13C 1I4RA 4L8JA 1RCVD 1I6HB 4XQQA 3CU7A 1CM9A 1JORA 1AN8A 2ID0A 1FYCA 3KLRA 1HRJA 4K8JA 4XYOA 3EA6A 3N52A 3QJYA 2R6GA 3A7AB 2VB3X 3MHBA 4M1UB 4K5XA 2K5QA 5C0XI 5FLXL 3TBIB 2V4DA 1ZEQX 2B2TC 1ILPA 1OXUA 1ILQA 5JPNC 1ESRA 2KEDA 1B3AA 3S16B 4KHVA 5DM73 4ID6A 4AYBB 1JE4A 2WINB 1H9MA 2K6AA 4DU9A 4JBWA 1LABA 3K5OA 1WTXA 1B44D 4RWSC 3Q22A 2QKIC 3HZXA 1BUVT 4X3KA 2NUCA 1V8QA 2L5TA 3NTIA 5JVG3 4NDXA 4NMZA 1S5FD 2BE5C 1PFNA 2FFKB 1G2TA 2EYJA 1K8MA 2K33A 4DNRB 3MXUA 2OF1A 2XIWA 2XNAC 4IN3A 1BNZA 1QCBD 1SNDA 2KCNA 1PDQA 5FLXE 1EU4A 3C3LA 2A68C 2NTTA 2SNMA 2D2CC 1GHJA 2DN8A 4FYDA 1QJOA 2EY6A 1ET9A 3H6MA 5DNFA 2WKCA 3T53B 4HAEA 4ZK9B 2FINB 1KNEA 2H1EA 4S3SA 4A3KB 1V43A 1CQFA 1SE4A 4HN7A 4EVOA 2HDMA 2R7ZB 1VF7A 3L9AX 4DXFA 3HRZC 2TMPA 2O5IC 1HA6A 2EZVA 1TVXA 3NTHA 5C0XJ 5CMDA 2EPBA 2K01A 1YNJD 2X6LA 3E6ZX 4WJWA 4CJ1B 1IW7D 1A2UA 3I4MB 1ENFA 1KTKA 1Y8PB 1SYCA 1TS3A 3H09A 4RH6A 2ICEC 1HFNA 4KJNA 2YU9B 2PPBC 3D4RA 1GUGA 1Q90A 4R8NA 3GTOB 1HA5A 1AP0A 1LTTD 2BDNA 2RDGA 4DXGA 2B2VA 3FRPB 3DM1A 2JSOA 3OOCA 2PMZB 1EFID 4ZKBB 1EOTA 1WVLA 2L4NA 3K5LA 3S1QB 1AZQA 3P7JA 1F2MA 3A7LA 1I4QA 2KUMA 1C48A 4FF2A 3OWFA 5IGFA 4V0BA 2J7ZA 1TS4A 2N55A 2B39A 4HTHA 4FXGC 2E75C 3MWYW 2A6HD 1WD0A 4IUUA 4K6LA 1D1IA 2ZXRA 1ICWA 4DK0A 2F0IA 3LNNA 2D9UA 4OO1G 1CK1A 2PZTA 2G9DA 3PIO3 1B9NA 3KK7A 1JWSD 2BE5D 1LTID 2X6GA 2XVSA 5ELBA 2OEOA 2AWOA 1D1KA 4L6TB 1I4HA 3GP7A 3PUXA 4HCEA 1A15A 1LACA 1V1PA 2AQ3B 3AU7A 2QCPX 4RCOA 3FPPA 5I2XA 1MBYA 4XT1B 1B1ZA 3A55A 3KBXA 1BR9A 1OXTA 2B8GA 2RBMA 2MUYA 4V190 1V1PB 3H3VC 2RDFA 3F2UA 2NVTB 2F0MA 2MJ8A 1DZ1A 2FMMA 1EY5A 3SK8A 2FHTA 3KF8A 3SK4A 4X3UA 4DA2A 1JOKA 5M5YB 2Z8LA 3HOUB 5C6AA 3KLSA 4TRDA 1F2YA 2PNRC 2F0GA 3PUWA 3J81E 5M5XB 1L0XB 1O80A 1HUNA 5KEEA 3IAYA 1STBA 4X3SA 4XT3B 1BF4A 3S15B 1Q8IA 4QMGA 3P20A 1E2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N52 A;  2NYZ D;  2KUM A;  1EQT A;  1MI2 A;  2KOL A;  3D6W A;  1WTW A;  3G7L A;  1LV9 A;  2NZ1 D;  1G2S A;  2B2U C;  4NW2 A;  4XDX A;  1X3P A;  2EOT A;  1B53 A;  4OIK A;  5DNF A;  1O7Y A;  2L12 A;  1VMP A;  2J7Z A;  1F9P A;  2MGS A;  4HAE A;  1U4R A;  2N55 A;  2FIN B;  5E4X A;  4ZK9 B;  1KNE A;  2X69 A;  2RSO A;  2B2U A;  1DOK A;  1J8I A;  4HSV A;  1SAP A;  1NR4 A;  3MWY W;  2N88 A;  1RTN A;  2EE1 A;  2H1E A;  1WD0 A;  2B2T C;  4IUR A;  4MHE A;  2KEC A;  2L1B A;  4O42 A;  1ILP A;  2VXW A;  3IL8 A;  4OIJ A;  3DEP A;  3QO2 A;  1ILQ A;  4IUU A;  1SSO A;  1CA5 A;  2RA4 A;  1ESR A;  4R9W A;  3FDT A;  2KVM A;  2RSN A;  3I3C A;  5EJW A;  2KED A;  1F9S A;  1RJT A;  1B3A A;  1NCV A;  1RHP A;  2HDM A;  5EPL A;  4DN4 M;  1ICW A;  1X32 A;  2IL8 A;  5E4W C;  1EIH A;  1JE4 A;  2B2Y C;  1GUW A;  2D9U A;  1QG7 A;  2R3Z A;  4RA8 A;  4MN3 A;  2L9H A;  3I90 A;  2HUG A;  2B2W C;  3R93 A;  1G91 A;  1HA6 A;  1QE6 A;  1TVX A;  1PFM A;  2HCI A;  2JYO A;  2X6G A;  1IKL A;  1WTX A;  2EPB A;  3FPU B;  5CMD A;  1F2L A;  2K01 A;  2X6L A;  5D65 A;  1O7Z A;  1NAP A;  3HP3 A;  4ZAI A;  3KUP A;  2CVR A;  2HDL A;  4CJ1 B;  2FJ2 A;  4RWS C;  1HHV A;  1A15 A;  2RVL A;  3GV6 A;  5CBA E;  2B2V C;  5D14 A;  1QNK A;  2K1B A;  4X3T A;  5T1G A;  1EL0 A;  1WTQ A;  4LMQ D;  1MSH A;  4R8I A;  4X3K A;  4HCS A;  1ZXT A;  3MTS A;  1VMC A;  1F9Q A;  2DY8 A;  1BO0 A;  1ML0 D;  1IL8 A;  1C8C A;  2B2T A;  3Q6S A;  5EKI A;  1U4M A;  1Q3L A;  3I8Z A;  5EPK A;  4XT1 B;  4CJ0 B;  1XX8 A;  1HFN A;  3KBX A;  1WTV A;  1PFB A;  5EPJ A;  3UI2 A;  1EIG A;  1U4P A;  2K28 A;  5AFW A;  4QUC A;  1MSG A;  2MP1 A;  3DEO A;  4IUQ A;  4HED A;  2B2Y A;  3IFD A;  1PFN A;  1S4Z A;  2FFK B;  2HCC A;  5COR A;  4IUV A;  4RAU C;  1JIC A;  5T1I A;  4UAI A;  3ONA B;  2K05 A;  3F2U A;  1B4O A;  5EQ0 A;  2B2W A;  2K04 A;  2MJ8 A;  1DOL A;  1SDF A;  1WD1 A;  1G2T A;  1IKM A;  1J9O A;  4IUT A;  4U68 A;  1WTR A;  1DZ1 A;  2FMM A;  2KEE A;  4ZKC B;  1X3Q A;  1U4L A;  1CA6 A;  3I91 A;  3TN2 A;  4CJ2 C;  1AP0 A;  2FHT A;  4IUP A;  2M2L A;  2BDN A;  1HUM A;  4X3U A;  2B2V A;  1KNA A;  1DOM A;  3H91 A;  5JJZ A;  2XIW A;  1B50 A;  1ROD A;  1M8A A;  1B2T A;  3DM1 A;  5CBE E;  1BNZ A;  2K03 A;  1XYI A;  3LWE A;  2Q8T A;  1PDQ A;  1AZP A;  2JP1 A;  1WTP A;  1BBX C;  3TZD A;  3GV3 A;  4ZKB B;  1EOT A;  1O80 A;  1PLF A;  2L11 A;  2L4N A;  1WVL A;  1HUN A;  2NWG A;  5COY A;  1F9R A;  1CM9 A;  4QUF A;  1RTO A;  2Q8R E;  4X3S A;  4ZLT F;  3P7J A;  1AZQ A;  1DON A;  3SVM A;  4XT3 B;  1MGS A;  1BF4 A;  2DY7 A;  1E0B A;  2MPM A;  1G6Z A;  2SDF A;  1NR2 A;  1WTO A;  1HRJ A;  1HFG A; 
#chains in the Genus database with same CATH topology
 4LFB Q;  4JPB W;  4NXM L;  4NW2 A;  2NZ1 D;  4LUV A;  2WP8 J;  5M5X H;  4ZCK A;  3CCU A;  3BS1 A;  1XPR A;  2E5L L;  2JEA I;  4A3D G;  3D3R A;  4TVA B;  3LWU A;  3MVV A;  4RKL A;  1EOV A;  5C5M A;  1HCZ A;  4C3I B;  2R92 B;  3PUZ A;  2B2U A;  4OL7 A;  3QOJ A;  3SE0 A;  4BS9 A;  3S15 H;  4I65 A;  3IKJ A;  3FVQ A;  1YJN A;  2F0E A;  2N49 A;  3AEV A;  1UE6 A;  2Z9H A;  3NP8 A;  1CA5 A;  4OX9 Q;  3GTQ B;  1PH9 A;  1SNO A;  3PMF A;  4C3I H;  1V9P A;  2R92 H;  5KYL A;  1FJG L;  1VQO A;  3BZD B;  1GUW A;  5KND A;  5LMN L;  4FXD A;  4IAL A;  5I9O A;  4CHT B;  3BU2 A;  2OTL A;  4C3J B;  1F2L A;  4IOC A;  4KN7 C;  1O78 A;  1EY0 A;  2CQA A;  2NN6 G;  2FJ2 A;  4GN4 B;  3GTQ H;  1Z6H A;  2ZM6 L;  5HGT A;  2OXP A;  1X9N A;  1SRO A;  3HS0 C;  3PV0 A;  1T9H A;  3OHX C;  4XXE A;  4JYA Q;  2EYF A;  4CDE C;  2ICI A;  3K59 A;  1B8A A;  4RGM A;  3CRK C;  5M5W B;  1Q3L A;  4C3J H;  1VQL A;  3RZO B;  4DR5 L;  1XX8 A;  3VR3 A;  3VYT A;  5BR8 Q;  5LL6 X;  1CZW A;  1EY8 A;  2B2Y A;  4A3I G;  2UUC Q;  1TWF B;  3CMA A;  1CKN B;  2BH2 A;  1LTS D;  1MJC A;  4K0K L;  5M5W H;  2JA6 B;  3GTP H;  4YCW A;  3FP9 A;  4IUP A;  2O4X A;  3J80 L;  1GVP A;  2XN9 C;  3CCL A;  3NQI A;  1SEB D;  1PMR A;  2WAC A;  1ROD A;  3HFZ B;  4DV4 Q;  1TWF H;  2E2I B;  2OTJ A;  2I5M X;  2Q8T A;  4YWM A;  4LK1 C;  2JA6 H;  5I9P A;  4J8Q A;  3EFX D;  1BBX C;  3M85 A;  1KAA A;  1LT5 D;  3FKI G;  1NSN S;  4CDD C;  3M4P A;  1N9W A;  3SVM A;  5EBC A;  1G6Z A;  2K14 A;  4DAP A;  3J80 c;  2KEN A;  1SN8 A;  1ML0 D;  2E2D C;  1N36 L;  4QIW B;  4YIJ A;  4X64 L;  3UDI A;  2B2U C;  2QW7 A;  4OIK A;  1EZ8 A;  2YTV A;  4BBR B;  3CCR A;  1F9P A;  1SJE D;  1U4R A;  4A3B B;  1LLR D;  2EE1 A;  2R93 B;  1VCI A;  2HHH Q;  2XRS D;  3UDF A;  1SYB A;  2H4O A;  3DEP A;  4DAY B;  4GZY C;  3I7F A;  4C2M B;  4BBR H;  5ISR A;  4FF3 A;  5EJW A;  3DHQ A;  5C3X A;  5I6Y A;  1F9S A;  3BZC A;  4JI4 L;  4DUZ L;  4KY5 A;  4DN4 M;  1R4Q B;  3SGI A;  4A3B H;  4LFB L;  5M9O A;  3S2H H;  1ZYR D;  2PCF B;  3HOW G;  2HT1 A;  1PTO C;  2R93 H;  4ME5 A;  2B2W C;  4DAM A;  2CHB D;  3CCS A;  1XWE A;  4KD4 A;  1S72 A;  3RR5 A;  2PI2 A;  2K7V A;  1Q81 C;  4C2M H;  1PZK D;  3K7A B;  3GTL B;  2V1C C;  1OXS C;  3D31 A;  2F0T A;  1OXV A;  4DR4 L;  2FMC A;  1A0I A;  5LHY 1;  1SFO B;  3T4A C;  3K81 C;  4DGZ A;  3J80 E;  2B2T A;  2AQ1 B;  3OW2 A;  2Y0S B;  5KNC A;  3QG1 A;  3HOZ B;  3D4W A;  4CJ0 B;  5JAV A;  3GTL H;  3K7A H;  1WTV A;  4PNY A;  2K5N A;  5M3F B;  1Y14 B;  2A6E D;  1STY A;  1SFO H;  1AFP A;  3S9W A;  3G6E A;  5EQ0 A;  4ZQ3 A;  3EVQ A;  1PH7 A;  3P1H A;  4JK1 C;  3KYH C;  4IO9 A;  1PRT D;  2Z6K C;  2O5J C;  4DFA A;  5M3F H;  3QB3 A;  4OGQ C;  4JYA L;  5I6W A;  1QNU A;  3J80 i;  1PYW D;  2AWN A;  3DWQ A;  5IOD A;  1VQM A;  5CBE E;  3D8G A;  2K03 A;  1S5D D;  4GKK Q;  1D6E C;  3GV3 A;  1AW7 A;  4ALP A;  1GKH A;  1KIX A;  4Q0F A;  2WAQ G;  1DON A;  2RHS B;  4Y52 H;  5E3F A;  1HFG A;  1Y1W G;  1N32 Q;  3FHW A;  1EQT A;  5FJ8 H;  2RQX A;  5C3W A;  5C4J B;  3DWP A;  1PRT F;  2CWP A;  1Q12 A;  3IFT A;  1X3P A;  1GO3 E;  4CGY B;  1YIJ A;  1TS2 A;  3D4D A;  4DV4 L;  3MFY A;  5E4X A;  3W1G A;  4DV0 Q;  2RSO A;  3I70 A;  4L5T A;  4DK1 A;  3TDQ A;  1K3B C;  2PMZ E;  2N8N A;  1A3V A;  5IGC A;  2LS0 1;  4JI0 L;  3ULJ A;  2NN6 I;  5C4J H;  5GAE C;  5LMU Q;  1STE A;  4JI7 L;  1A2T A;  2RA4 A;  3ERO A;  1ICF B;  1H9J A;  4BBS H;  5IT9 c;  2Q8I B;  1XJV A;  5EPL A;  4FO2 A;  4NXN Q;  4F88 A;  1JCK B;  1PH5 A;  3VYU A;  3V96 A;  1TQO A;  1E1T A;  4IPD A;  4K5V A;  3FPU B;  4C3H B;  1K8A C;  2QEJ C;  1JB7 A;  1NBW A;  4LJZ C;  2CVR A;  2CH4 W;  3CPW A;  1SNP A;  4J15 A;  5E1F A;  1X55 A;  2HHH L;  1HQM C;  4LF9 Q;  1KLG D;  1HR0 Q;  1TY2 A;  1CHP D;  2Q2I A;  3J7A V;  3R3O A;  3I8Z A;  1HXY D;  4JI6 Q;  4C3H H;  4MIU A;  5CV7 A;  1EZ6 A;  4OWW B;  1QOH A;  2VW9 A;  4CBV A;  3DEO A;  2IHE A;  2HIX A;  4B3S L;  5COR A;  2TSS A;  1VQI A;  5C4X B;  3SXH A;  4U68 A;  3D0F A;  1DCZ A;  1FNW A;  2A6H C;  2KEE A;  2R61 A;  5TSS A;  4ZKC B;  5IP7 G;  2VNU D;  2EJM A;  4KK7 A;  4DR7 Q;  5E7N A;  1R9T B;  3M9B A;  1PZJ D;  1VQF A;  4QL5 A;  2QGQ A;  4UP7 A;  5C4X H;  5A2Q L;  2QF7 A;  3H0G B;  3WOF A;  1WTH A;  3AFP A;  3T1Y Q;  4FVM A;  1R9T H;  2MPM A;  4A3G B;  3OIP A;  3TRZ A;  3OW7 A;  1FVI A;  1U0L A;  1TY0 A;  3H0G H;  3D6W A;  1PTO D;  4F87 A;  5CYU A;  4DAV A;  5GQO A;  4XDX A;  4YWL A;  1O7Y A;  5KRU A;  3TP8 A;  1EY6 A;  1GUS A;  1NR4 A;  4GKK L;  4A3G H;  4L63 B;  4FP5 D;  2N88 A;  2BDO A;  1E22 A;  4LF7 L;  3I4N G;  4TKO B;  3MAQ A;  3GTG B;  1QVF A;  4K5W A;  1BCP D;  4WJ3 M;  1E2W A;  3DUZ A;  1QZH A;  1GJX A;  1NCV A;  4C1N I;  1N32 L;  4N9P A;  4NP5 A;  3T1H Q;  1EIH A;  3TSS A;  4UY8 C;  4RA8 A;  3EJI A;  4MN3 A;  4A3L G;  1PTO F;  5J39 A;  2F52 A;  4KHZ A;  3GTG H;  2ZTC A;  4DV1 L;  1YHA A;  2B8F A;  2KHS A;  5HGQ A;  3U4V A;  4XQN A;  1A62 A;  1TR5 A;  4P72 A;  4UPA A;  2DJF C;  1BBU A;  4DV5 Q;  5D14 A;  3M7G A;  4JI2 L;  1L1O A;  4HCS A;  5EAY A;  1SNC A;  5LMU L;  2B63 B;  4N8X 1;  3WWV A;  3ITP A;  1BCP F;  2L55 A;  3D6C A;  1HJP A;  4DF7 A;  3A8I E;  3BG3 A;  4RGO S;  5A2Q E;  5NUC A;  1L0Y B;  3PGZ A;  1VQP A;  1XNQ L;  4QUC A;  1EY4 A;  2DNE A;  2MP1 A;  2SOB A;  1L1O B;  2PZU A;  2B63 H;  4UAI A;  3ICE A;  1S5E D;  4HSP A;  2LMC B;  2D62 A;  4K2K A;  4L5Q A;  4EX5 A;  2FXQ A;  1V1O A;  4DV7 Q;  5K36 H;  3TEH B;  2KBN A;  2EY2 A;  4EQO A;  5LL6 S;  1IYV A;  4R1J A;  4LF9 L;  2NVY B;  5IGE A;  4A93 B;  4AYB G;  3PF5 A;  1RL2 A;  3KDF A;  4R4I A;  4EQ5 A;  2UUB Q;  4QB4 A;  1HPC A;  3A74 A;  2JP1 A;  4LWC A;  3CQZ B;  4HJA A;  3TZD A;  4JI1 Q;  3RUZ A;  1XTD A;  2NVY H;  3Q8D A;  2OQK A;  3CME A;  1TXY A;  4A93 H;  1WYD A;  1Y1V B;  2XRQ D;  3CCE A;  2EYM A;  1WTO A;  4DR2 L;  1CSQ A;  3SEB A;  2KOL A;  4JOI A;  1S3O A;  3CQZ H;  1G2S A;  2EOT A;  4JVZ A;  4DR7 L;  3MZ5 A;  3EQL C;  2E5L Q;  1SJH D;  2B3G A;  3NBH B;  2EJF C;  4ZUI A;  2BH8 A;  1IBL L;  4B08 A;  1Y1V H;  1VQ9 A;  5BN5 A;  4GNX A;  3HOV B;  1RTN A;  1BDO A;  4U67 3;  1F2Z A;  4GLA C;  1D5X C;  2KEC A;  1YIT A;  3R8B A;  1M1K C;  3T1Y L;  3E0J A;  1XPO A;  4QJF A;  5L37 A;  1QUQ A;  2J0T D;  3FDT A;  1SR3 A;  5BN4 A;  3W3A A;  1RJT A;  1FJG Q;  3NSW A;  1V1Q A;  1ESF A;  3T13 A;  4UDU C;  2F1M A;  3H3V H;  2HUG A;  3X3N A;  4G7O C;  1EYG A;  2HIV A;  2A73 B;  1QUQ B;  3ZYY X;  4BY1 B;  5IGG A;  3ER0 A;  1KRS A;  2E74 C;  1HTP A;  4DR3 Q;  3A54 A;  4KD3 A;  4LMQ D;  2JK8 A;  1GHK A;  4WRD A;  3PUV A;  1Q82 C;  1PH4 A;  3Q0A A;  3NPP A;  2K32 A;  5EPK A;  1PRT B;  3DM3 A;  1X56 A;  2B29 A;  2JA5 B;  3WOE A;  3T1H L;  3NEM A;  4BY1 H;  5FO7 B;  1VQ7 A;  4GOP A;  2K28 A;  1H9R A;  4HIO A;  3VR5 A;  1Y69 U;  4LW1 A;  3CD6 A;  2WB1 B;  4K0K Q;  5M3M B;  4A3K G;  2A19 A;  1KHI A;  1WTR A;  5IP9 H;  1X3Q A;  2JA5 H;  1U4L A;  1SBB B;  1ET6 A;  1EIY B;  3NXW A;  4DK3 C;  4GOP B;  5JOB A;  1DOM A;  2R7Z G;  3JC6 6;  2C9O A;  3BZK A;  1GD7 A;  1PH3 A;  3K58 A;  5M3M H;  3CCV A;  1GUN A;  4RHR A;  1ZYR C;  1B9M A;  1VQ4 A;  4FNF A;  3KFU A;  1HQR D;  2AMC B;  1EUJ A;  4Q5V A;  4ULL A;  1K9M C;  1KD1 C;  1N8R C;  1N34 Q;  4OWT B;  3C2P A;  4YCV A;  2PQA B;  3I4M G;  2E8G A;  4DV7 L;  3J7Z C;  3HG9 A;  3H94 A;  3LX0 A;  5IYB H;  2KQ3 A;  3KOJ A;  3K5M A;  2OCE A;  2ZTE A;  2EVB A;  4YWK A;  1B53 A;  4ABN A;  1EWI A;  4F7X A;  1TWH B;  3QOL A;  2UUB L;  5EKL A;  5FLM H;  2F0H A;  2A6E C;  1Q1B A;  4G57 A;  4IUR A;  3MC0 B;  2DGY A;  3L3O C;  2NVQ B;  3IL8 A;  1UEB A;  2AKW B;  4JG2 A;  4WJ4 A;  1XMO Q;  1UE1 A;  1TWH H;  1UEA B;  4R9W A;  1VQN A;  4DUZ Q;  3NQT A;  4DV3 Q;  1TU2 B;  1X32 A;  1PRT C;  2VQE L;  4G4K A;  2EY5 A;  2R3Z A;  1QG7 A;  1IBM L;  4MTK A;  1PFS A;  3I90 A;  3R93 A;  4IQZ A;  1CKO A;  1JOQ A;  1FNU A;  1IKL A;  4RFB A;  5D65 A;  1A63 A;  3KUP A;  4DUY Q;  1G8Z D;  5JEA H;  2XSC A;  5FO9 B;  1F77 A;  3AFQ A;  4DR4 Q;  4X3T A;  5T1G A;  3M3Y B;  1EEI D;  2JA8 B;  1RF2 D;  3BYT B;  5DAU A;  1EEF D;  1I6V C;  1C8C A;  3VR2 A;  1I4X A;  4GOP C;  3K0X A;  2LXK A;  2KCC A;  4LF4 L;  1D2B A;  5FKA C;  1STA A;  3TP7 A;  2F4I A;  2HQL A;  3M3Y H;  2F0V A;  4IUQ A;  2JA8 H;  2F0W A;  3M4Q A;  2HCC A;  4X62 Q;  1JIC A;  2I07 B;  1NUC A;  2B2W A;  1VQC A;  1IKM A;  1J9O A;  1VF5 C;  4DR3 L;  2F0F A;  2LKV A;  4CJ2 C;  2M2L A;  2OWO A;  1CKN A;  1HUM A;  1RIP A;  1EWH A;  1XNR L;  4N9T A;  1PTO B;  4AYB E;  2AHO B;  4PZ8 A;  1LTL A;  1XYI A;  3ND8 A;  1XXG A;  4OHJ A;  1NTG A;  3PSI A;  4G7Z C;  1EYC A;  1SE3 A;  1HNW Q;  1PHJ A;  3SK5 A;  1ASZ A;  4AQY Q;  4P71 A;  1D8L A;  5CV9 A;  2PZW A;  3SK6 A;  5CC4 A;  3RZO H;  2SDF A;  2F3V A;  2ASB A;  2IWH A;  1BKB A;  2IX3 A;  1PTO H;  1NE3 A;  1BCP B;  4JV5 L;  3ND9 A;  2NYZ D;  1IHZ A;  2M00 A;  4RGT A;  2Z6K A;  5F2D A;  4KLK A;  2X69 A;  3TS0 A;  1J8I A;  3M4Y A;  2NBF A;  4JI0 Q;  4MHE A;  4CDF C;  3PIP A;  4B3R L;  1SMX A;  4JI7 Q;  1N34 L;  1P8L A;  1SYD A;  2E2I H;  4KV6 A;  1EFW A;  4LFC L;  2VQF Q;  1Z47 A;  5E4W C;  2DNC A;  4P75 A;  5HY6 A;  4DAY A;  4DNT B;  4IFD H;  1FL0 A;  2RCN A;  3HOU G;  1P16 A;  4I7Z C;  2F0D A;  5G3L D;  3OMG A;  3BVG A;  4EQP A;  3BVM A;  2PW5 A;  2KA7 A;  3GV6 A;  1I4P A;  3E0E A;  3VR6 A;  3TZU A;  1MSH A;  1X6O A;  4LFA L;  1VMC A;  2ZJP A;  3CPF A;  4TSS A;  5JEA G;  1K0R A;  1XMO L;  1A3U A;  4DV3 L;  1EY9 A;  1FGB D;  2F3W A;  3T16 A;  4OEM B;  4IPH A;  3NEL A;  4C3I G;  2R92 G;  3PF4 A;  4B3S Q;  4OXP A;  1S4Z A;  4KI0 A;  1B4O A;  1S5C D;  2K04 A;  1YNN D;  5G3L F;  4DUY L;  3CXC A;  2Z0S A;  4A3M B;  4ODG A;  3A8K E;  2EY1 A;  1SE8 A;  1WI5 A;  3TME A;  5EBD A;  1K3R A;  3TQY A;  1K28 A;  1BCP C;  3CKI B;  2C5C A;  2A5H A;  2QA4 A;  2IPK D;  3LWE A;  1G29 1;  2E2H B;  1AZP A;  4DK6 C;  4A3M H;  4FF4 A;  4C3J G;  1ONL A;  4B9W A;  3NBI A;  2L11 A;  3TP5 A;  1C9O A;  4UHV A;  4X62 L;  4NB3 A;  4ZLT F;  2UU9 L;  3HKZ B;  4X66 L;  3HOZ H;  1DOL A;  4K8I A;  1MI2 A;  5ELE A;  1WTW A;  4H44 C;  3DMU A;  4IZ8 A;  1SMY C;  5FLX c;  3OWE B;  2BCO A;  4J1M A;  1SNM A;  2XTI A;  4LF7 Q;  1LTA D;  3AYH B;  4KKT A;  3S24 A;  1Q1E A;  1SYE A;  1HNW L;  3H3V I;  2JA6 G;  4AQY L;  5DM6 3;  1KAB A;  2CH4 A;  5ELC A;  1DD2 A;  2AUJ D;  4XYQ A;  2UXB Q;  1VQD A;  4BA1 I;  2WKD A;  1RKN A;  1RHP A;  4CKE A;  3RMH A;  4Y7N B;  1LTG D;  5CR3 A;  2D0P A;  2IT1 A;  4DV1 Q;  2PYK A;  3W1B A;  2JA7 B;  1Y8N B;  2RVL A;  1MJE A;  4RHS A;  1W6J A;  1S40 A;  4JI2 Q;  3OPO A;  3WDN A;  4F8M A;  1IYU A;  2K5D A;  1GM5 A;  3K80 C;  1ENA A;  1VS0 A;  3I4L A;  1Q46 A;  2VQF L;  4B3T L;  3EN2 A;  3UDX A;  2VY3 A;  4BBR G;  1QZG A;  1XNQ Q;  3S1R B;  3JAM c;  2JA7 H;  5EPJ A;  2DUD A;  2O2L D;  4A3B G;  5CGK A;  3J7Y W;  1NMG A;  3I73 A;  1QVG A;  1UE7 A;  4HIK A;  4QY7 A;  4IUV A;  5EGT A;  4O0A A;  4BWG B;  5ELO A;  4A3F B;  2R93 G;  2A69 C;  2N78 A;  1WD1 A;  4K2L A;  1EYA A;  2G9H D;  3S1M B;  2R7D A;  2EIF A;  2NZH A;  1D5M C;  4UP8 A;  3TN2 A;  3QWN A;  2CWA A;  3S1R H;  3BYY B;  2PQE A;  3NK9 A;  3G4S A;  2XGT A;  3G48 A;  4OON A;  5KGU A;  1B2T A;  2MO1 A;  3V2T A;  5IWA L;  4A3F H;  4A3C H;  4BY7 B;  1CI3 M;  4X6A H;  3LGJ A;  4A76 A;  3RZD B;  2WB1 E;  4HMJ A;  4QUF A;  2DY7 A;  4K14 A;  5ELD A;  1JE5 A;  4DR2 Q;  3Q24 A;  4C56 C;  3A5Z B;  3CC4 A;  4BY7 H;  1PYB A;  1VDZ A;  1SNQ A;  2Y0S G;  4NPS A;  4GLX A;  3K57 A;  4EGV A;  3DXJ C;  3CF5 A;  3RZD H;  5M3F G;  3S17 B;  2MNA A;  1IBL Q;  1K83 B;  1VQH A;  4B3M Q;  4QF4 A;  3BJU A;  1JWM D;  2Q2U A;  4AIM A;  1EQR A;  4O42 A;  4GLV B;  3HOX B;  4JI5 L;  2YTY A;  2VZA A;  3NWS A;  4A3J B;  3I3C A;  4NKL A;  1AH9 A;  2WII B;  3BDO A;  3S17 H;  5IT9 L;  1K83 H;  1JQY D;  3NWT A;  2F0J A;  1FD7 D;  1K8O A;  1QE6 A;  3JAM L;  5JJI A;  1CKM A;  5FJ8 G;  4BA2 I;  1KL9 A;  1O7Z A;  3M4O B;  1H9S A;  4ZAI A;  4A3J H;  1X3F A;  2ZXP A;  3MXG A;  3VA5 A;  1KDA A;  3PO3 B;  3S1N B;  2DY8 A;  2DJG C;  1ZKO A;  2D5D A;  5CV8 A;  3CRL C;  3OYY A;  2CW0 D;  2UXB L;  4POF A;  1CFM A;  4RKB A;  1H9S B;  2NB0 A;  5J1Z A;  4BBS G;  2HQE A;  1AE2 A;  1E2Z A;  2IX0 A;  1LT3 D;  1E1O A;  2L15 A;  1LTR D;  1MSG A;  1STH A;  1R4P B;  1YHB A;  4KY7 A;  5I2Y A;  4HED A;  4BXX H;  3PO3 H;  3S1N H;  1HZC A;  1LM0 A;  3QR8 A;  1DYQ A;  3C1F A;  4IUT A;  3DLL A;  4PMC A;  3SR1 A;  3ULP A;  2F0Q A;  4HMI A;  2EYH A;  1TWC B;  3W2D A;  1YJW A;  1GUO A;  4LUO A;  1B3Q A;  5LMN W;  1LO5 D;  4R4Q A;  1W2B A;  1SMY D;  4H02 A;  5JJL A;  1WCM B;  4GN3 B;  2ZT9 C;  1QIL A;  4XQJ A;  4C3H G;  5CV4 A;  5KIX A;  1TWC H;  3A5U A;  4A3E B;  5C3E B;  4KKU A;  1T5E A;  1YVC A;  2AQ2 B;  3PIP 3;  1M90 C;  1JC7 A;  1MGS A;  3UDG A;  1NR2 A;  1X3G A;  3ERQ A;  4OO1 H;  1WCM H;  4J6H A;  5IT9 E;  1HH2 P;  1W6K A;  3KLS X;  1CT1 D;  1SXT A;  1SLJ A;  3G7L A;  1CHQ D;  5C44 B;  3JAM E;  3CHB D;  4DR6 Q;  1VMP A;  3VYS A;  4A3E H;  5C3E H;  3PUY A;  2BA1 A;  1PZI D;  3VA7 A;  3J81 c;  2IW3 A;  5I4D A;  1KQS A;  1UAP A;  1O7L A;  1MD2 D;  1SYG A;  1PXU A;  2VUM B;  3P75 A;  3C46 A;  5C4X G;  3MFG A;  3NBH A;  4IFD I;  2F0L A;  3QO2 A;  4O1N A;  5GAG C;  3A0J A;  3FEW X;  5C44 H;  1HNZ L;  1QB5 D;  4APV A;  3C1E A;  1C4Q A;  4LF6 L;  2VQE Q;  1IBM Q;  4IJH A;  3HOY B;  2IHF A;  4KJO A;  2PO4 A;  3AB9 A;  1PFM A;  2HCI A;  1EYD A;  2JYO A;  3H0G G;  2BA0 A;  2WV6 D;  3JAM i;  2A69 D;  2EJG C;  1TWA B;  5GAH C;  3Q23 A;  4B3M L;  2F0S A;  3PO2 B;  1QNK A;  1TKW B;  1EL0 A;  1VQ8 A;  1EWC A;  1HZB A;  2F0K A;  2IJ0 A;  1F9Q A;  3HOY H;  3K5N A;  1W3S A;  4A3G G;  1VQG A;  2EXD A;  1IL8 A;  2F4V Q;  3MEH A;  5J22 A;  5JEA J;  2K5H A;  2NVX B;  4P74 A;  1TWA H;  4LF4 Q;  4QIW E;  1A6X A;  5IYC H;  3HOV H;  4A3D B;  1PFB A;  1D7Q A;  3UI2 A;  1EIG A;  2KHI A;  4E6I A;  3PO2 H;  2JEB I;  1TT2 A;  5JPM C;  3IFD A;  3RN2 A;  2Z4I A;  4PMW A;  1CTM A;  4PZ6 A;  1JR0 D;  1SDF A;  1TII D;  3KLW A;  1QVC A;  3K6O A;  2F0N A;  3I4O A;  3F1Z A;  3K0Y A;  2NVX H;  1I4G A;  3E9H A;  3J7A 5;  5IIF A;  4HIM A;  4A3D H;  3GQB A;  2XWB B;  2ZJQ A;  3H91 A;  4JI3 L;  1AEX A;  1XNR Q;  1I50 B;  1LTB D;  1FR3 A;  2F0O A;  4KN4 C;  1OO9 B;  2I5L X;  4ZRZ A;  3J81 L;  2QEX A;  3STB D;  1YZ6 A;  4JW0 A;  2GA4 B;  1PLF A;  3U9O A;  1LYL A;  2SEB D;  2NWG A;  1F9R A;  4PQX A;  1STN A;  5HUR A;  1I94 Q;  4C1N K;  3RN5 A;  1X65 A;  2ENB A;  2EDG A;  3HGB A;  3KJO A;  1E24 A;  1N33 Q;  1I50 H;  2B63 G;  4JV5 Q;  1UNS A;  2E76 C;  1NNX A;  1M4V A;  5K36 G;  3SDZ A;  2NN6 H;  2PQA A;  3BDC A;  4X65 L;  2Y0S E;  2MGS A;  4H0L C;  3CC7 A;  1PH6 A;  1EY7 A;  4ZYS A;  3MXN A;  4GS3 A;  1JB3 A;  4A3I B;  4GKJ L;  5EKK A;  1C0A A;  5D3D A;  3J7A F;  1LT4 D;  4B3R Q;  1KXL A;  1K0S A;  3S14 B;  4LF5 L;  1S5B D;  4OIJ A;  4UP9 A;  4P2C B;  1YNN C;  3CW2 C;  1SSO A;  2EYO A;  3E9I A;  3HKZ E;  5KNB A;  3R2I A;  5C0X H;  2Z4H A;  2OQ0 A;  4LFC Q;  3MXN B;  1U5K A;  3URY A;  4A93 G;  4A3I H;  2HD3 A;  3M7N A;  2L9H A;  3GTM B;  3S14 H;  4DR6 L;  2MO0 A;  2ES2 A;  2F0U A;  2A68 D;  3RLN A;  3KJP A;  3FKI B;  3K7U C;  1HHV A;  1G51 A;  1JJ2 A;  4IFD J;  2B2V C;  3N6R A;  4R8I A;  1Y1V G;  4LFA Q;  4JI8 L;  1ZXT A;  3KF6 B;  1L0W A;  3U50 C;  4DV6 Q;  3SHL A;  4O2D A;  3GTM H;  5EKI A;  2I0Q A;  4N8F A;  3I56 A;  1Y8O B;  1FNV A;  2YYZ A;  1SYF A;  2Z1C A;  2EYP A;  1BXT A;  3FKI H;  2LY7 A;  3HEJ A;  1RDP D;  3VYR A;  5IY0 A;  2NVQ H;  1KLU D;  2IX1 A;  1UUP A;  5T1I A;  3NTK A;  1GOZ A;  3GDE A;  4IJL A;  3CAM A;  2RHQ B;  2A74 C;  2Q2H A;  1H95 A;  2ZTD A;  3I91 A;  3MEF A;  1CQV A;  4XTC S;  1PV4 A;  5A35 A;  2JE6 I;  5FK9 C;  5C4H A;  3OSO A;  2F4V L;  2K50 A;  3HOW B;  2AUK A;  2MHV A;  1DM0 B;  1KDC A;  2LXJ A;  3F8T A;  5AJ3 L;  3V05 A;  1WTP A;  1JJC B;  3O13 A;  3BVZ A;  3J81 i;  4KMU C;  4BY1 G;  3TS2 A;  5COY A;  1IYJ B;  3U4Z A;  2UU9 Q;  1HZ9 A;  4Z9C B;  1JOO A;  1E0B A;  2CKZ B;  4X66 Q;  3VR4 A;  3HOW H;  1YEZ A;  1DGS A;  4L5R C;  2PW7 A;  1B70 B;  5KYI A;  5FO8 B;  3R2T A;  3KBG A;  1LV9 A;  3CCJ A;  5IP9 G;  2JA5 G;  3RD4 A;  2RF4 A;  4K6D A;  4B9X A;  3GTJ B;  5GRO A;  3J81 j;  3I55 A;  2JXM B;  1I3Q B;  3CC2 A;  5CV5 A;  4HSV A;  4MTN A;  3TP6 A;  1TWG B;  2WB1 G;  3U9S A;  3GO5 A;  2CFM A;  2L1B A;  5M3M G;  1KDB A;  1MHW C;  2LFN A;  1II3 A;  5C5L A;  5JVH 3;  1I94 L;  2GVA A;  1WOC A;  2KVM A;  2RSN A;  1N33 L;  3GTJ H;  2UUA Q;  3GTP B;  4RCN A;  2XWJ B;  3S2D B;  5IOC A;  1I3Q H;  2IL8 A;  2G5D A;  4PZ7 A;  4KTA A;  2LSS A;  1TWG H;  4YHH L;  2PNH A;  4R4T A;  5C0X G;  1ASY A;  4IPG A;  2RKS A;  4H7B A;  2QDB A;  5IYB G;  4DV2 Q;  1GUT A;  3E5S A;  1NAP A;  3HP3 A;  4HJ7 A;  2HDL A;  1KRT A;  2UXC Q;  5CBA E;  3GTK B;  2WAQ B;  4QCL A;  3S2D H;  2K1B A;  1WTQ A;  2BOS A;  2KCM A;  4WOR A;  1CUK A;  1JT8 A;  3MTS A;  3FMC A;  5FLM G;  1IL2 A;  1YNX A;  5FOB B;  1Y1W B;  2GVB A;  1BVS A;  3Q6S A;  1U4M A;  1A8V A;  4A75 A;  5DEH A;  4B3T Q;  3QIA A;  3A8J E;  3T56 B;  2KCT A;  1Z7T A;  3GTK H;  1U4P A;  4MZ9 A;  4EQN A;  2RDH A;  1YBY A;  1ENC A;  2L0C A;  3I2Z A;  2VL6 A;  3ONA B;  1Y1W H;  1OTC A;  3CP0 A;  1NJI C;  1HTL D;  2UXD L;  3MXP A;  2K4K A;  3NUC A;  5ELF A;  4CDC C;  3OIQ A;  3AQQ A;  4DV6 L;  3AMU A;  4LAA A;  1JWU D;  5JJZ A;  1B50 A;  2I46 A;  3NE5 B;  1M8A A;  5IWA Q;  4YY3 L;  1XPU A;  4OO1 I;  3S2H B;  2SNS A;  1STG A;  5IYD H;  2KJX A;  2VB2 X;  1QWY A;  5D3I B;  2ZXO A;  1UWV A;  2A8V A;  3MA2 B;  1RTO A;  2Q8R E;  1OXX K;  2F03 A;  2JA8 G;  5ELN A;  1DXM A;  1EQV A;  1VQJ A;  4TQU S;  4L5S A;  3OMC A;  4FDB A;  4HR7 B;  1D5Z C;  1KAW A;  2CW0 C;  2K5W A;  2YTX A;  2L12 A;  4M8A A;  2M9V A;  1DOK A;  1EU3 A;  1SAP A;  5CV6 A;  4ILW A;  3DWA A;  5IGD A;  3U58 A;  4FF1 A;  3T51 B;  3G6J B;  1X54 A;  4JI5 Q;  1UE5 A;  2VXW A;  4CKC A;  3BDL A;  2J4X A;  1XTC D;  1HR0 W;  1A3T A;  1I5F A;  1SE2 A;  2N3S A;  5BN3 A;  2EYL A;  4OX9 L;  4CKB A;  2E2H H;  2B2Y C;  1PH1 A;  3ERS X;  4PV1 C;  1GXD C;  1H9K A;  3L7Z C;  1G91 A;  1L2F A;  2EXZ A;  3IRB A;  4PG3 A;  1G6P A;  5IP7 H;  1WJJ A;  2Z6B A;  4P73 A;  3F2B A;  1TS5 A;  3NHH A;  4PMB A;  5JJK A;  3GD7 A;  1IBK Q;  2JJQ A;  1AE3 A;  1BO0 A;  1BOS A;  1J5E Q;  2R7F A;  1T5X D;  1HNX Q;  4OEL B;  2UUA L;  2CCZ A;  3PIO A;  3A56 A;  5K5P A;  5IGB A;  4JC0 A;  4RGN A;  4XIG S;  5BR8 L;  5AFW A;  2F0P A;  2QIL A;  4RG1 A;  4FXK C;  4QGU A;  2ZJR A;  4DV2 L;  4RAU C;  2UUC L;  3I4N B;  4IFD G;  2K05 A;  1YNJ C;  1RD9 D;  2GN5 A;  4KY6 A;  4R4C A;  1PA6 A;  4G7H C;  2UXC L;  4IUN A;  4KKS A;  1U9R A;  1IW7 C;  2OT2 A;  1CA6 A;  1DJR D;  2E2J B;  1BQQ T;  4Y7N H;  4ZUJ A;  4JBJ A;  3X3M A;  3I72 A;  1KNA A;  2NTS A;  5C4Z A;  1K73 C;  3RLF A;  1EIF A;  4BBS B;  4WFN 3;  3I4N H;  4LNQ A;  1LT6 D;  1CZG A;  4H13 C;  1I4R A;  4L8J A;  1RCV D;  2CQO A;  1I6H B;  4XQQ A;  2E2J H;  3CU7 A;  1CM9 A;  1J6Q A;  1JOR A;  1AN8 A;  2ID0 A;  1FYC A;  5IYD G;  3KLR A;  4KHP Q;  1CSP A;  1HRJ A;  4K8J A;  4A3L H;  2MQH A;  2JA9 A;  4XYO A;  3NEN A;  3EA6 A;  4DKA C;  3N52 A;  3QJY A;  1JJG A;  1VQ5 A;  1I6H H;  4YCU A;  2R6G A;  3A7A B;  2VB3 X;  3MHB A;  4M1U B;  2WFW A;  4K5X A;  1PH8 A;  2K5Q A;  5C0X I;  5FLX L;  3S1M H;  1B7Y B;  3TBI B;  2V4D A;  1ZEQ X;  2B2T C;  2Q2T A;  2P5Z X;  1ILP A;  4A3M G;  1OXU A;  1ILQ A;  5JPN C;  1HNZ Q;  1VQ6 A;  1ESR A;  2KED A;  1B3A A;  4LF6 Q;  3S16 B;  4KHV A;  1SRU A;  4ID6 A;  5DM7 3;  4AYB B;  3F2C A;  1XMQ Q;  1JE4 A;  2WIN B;  4LF8 Q;  1H9M A;  1VQB A;  2K6A A;  4DU9 A;  2JN4 A;  3RNU A;  3HOZ G;  3ZJY C;  4JBW A;  1LAB A;  3K5O A;  4IPC A;  2K75 A;  1WTX A;  1B44 D;  3H15 A;  4RWS C;  3Q22 A;  3STB C;  3S16 H;  2QKI C;  3HZX A;  1BUV T;  3PCO B;  3HKZ G;  4X3K A;  2NUC A;  1V8Q A;  2L5T A;  3NTI A;  5JVG 3;  4HJ9 A;  4NDX A;  3W5O A;  5H1S E;  4NMZ A;  1S5F D;  2BE5 C;  3HOX H;  1PFN A;  2FFK B;  1Q8K A;  1G2T A;  1EQQ A;  2C35 B;  3E3X A;  2EYJ A;  1K8M A;  3PQI A;  2K33 A;  1IBK L;  4DNR B;  3MXU A;  2OF1 A;  4DNI A;  4JI3 Q;  1C7Y A;  3RLO A;  2XIW A;  1J5E L;  2XNA C;  4IN3 A;  1HNX L;  2K5V A;  3ULL A;  3M4O H;  1BNZ A;  1PVO A;  1QCB D;  1SND A;  3K8A A;  1X3E A;  4MNO A;  2KCN A;  1PDQ A;  5FLX E;  1EU4 A;  3C3L A;  2JA7 G;  2A68 C;  2NTT A;  2SNM A;  1NY4 A;  2D2C C;  1GHJ A;  2DN8 A;  2K52 A;  4FYD A;  1QJO A;  2KHJ A;  2EY6 A;  1BBW A;  1ET9 A;  3H6M A;  4X65 Q;  2NZO A;  5DNF A;  1LUZ A;  2WKC A;  3T53 B;  3OTO Q;  4HAE A;  2RCF A;  2FIN B;  4ZK9 B;  1KNE A;  4DV0 L;  4GKJ Q;  3EIV A;  2H1E A;  4S3S A;  3G71 A;  3L0O A;  2MFI A;  4A3F G;  1VQE A;  4A3K B;  4LF5 Q;  4RMF A;  4A3C G;  3HKS A;  1V43 A;  1MKH A;  1PH2 A;  3TRE A;  1CQF A;  1SE4 A;  4KHP L;  4HN7 A;  1O7I A;  4EVO A;  1IZ6 A;  4HJ5 A;  2HDM A;  2R7Z B;  1VF7 A;  3CCM A;  3L9A X;  4DXF A;  1NMF A;  4NXN L;  1IXR A;  3HRZ C;  2TMP A;  2O5I C;  4A3K H;  1HA6 A;  2EZV A;  1TVX A;  4HID A;  3NTH A;  5C0X J;  4BY7 G;  2EPB A;  5CMD A;  2K01 A;  1YNJ D;  2X6L A;  3E6Z X;  4WJW A;  4CJ1 B;  4POG A;  1IW7 D;  2R7Z H;  4R4O A;  4JI8 Q;  1A2U A;  3I4M B;  1ENF A;  1KTK A;  4GN5 A;  1Y8P B;  1SYC A;  1Z9F A;  1HR0 L;  1TS3 A;  1Q7Y C;  3H09 A;  4RH6 A;  4DPG A;  4JI6 L;  2ICE C;  1XMQ L;  1HFN A;  4LF8 L;  4KJN A;  2YU9 B;  2ALY B;  2VUM H;  4DR1 Q;  3I4M H;  2PPB C;  3D4R A;  1GUG A;  1Q90 A;  4R8N A;  3GTO B;  2QDL A;  2VS1 A;  1YI2 A;  3KDF B;  4OWX B;  3HOX G;  2WAQ E;  1MIU A;  1HA5 A;  1AP0 A;  1HZA A;  1LTT D;  4A3J G;  4NXM Q;  2BDN A;  4HJ8 A;  2RDG A;  2YU9 H;  4DXG A;  2B2V A;  1E3P A;  1WFQ A;  1VQA A;  3FRP B;  1YHQ A;  3DM1 A;  2JSO A;  5AJ3 Q;  3EBE A;  3CCQ A;  3OOC A;  3GTO H;  2PMZ B;  1EFI D;  4ZKB B;  1EOT A;  1WVL A;  2L4N A;  3K5L A;  3S1Q B;  1AZQ A;  3P7J A;  1F2M A;  3A7L A;  4BXX G;  3B6Y A;  3PO3 G;  1I4Q A;  4IOA A;  4ME3 A;  2KUM A;  5LMN Q;  1E7Z A;  4GNX B;  1C48 A;  2A1A A;  4FF2 A;  3OWF A;  5GAD C;  4QQB X;  5IGF A;  4V0B A;  2J7Z A;  1TS4 A;  2N55 A;  3S1Q H;  2B39 A;  2YV5 A;  1L1O C;  1K8G A;  4HTH A;  4FXG C;  3MWY W;  2E75 C;  1PYS B;  2A6H D;  2ZM6 Q;  1WD0 A;  4I7A A;  3UE0 A;  1FGU A;  5IE8 A;  4IUU A;  2JQO A;  4K6L A;  1D1I A;  4LUZ A;  2ATW A;  1JMC A;  2ZXR A;  4DR5 Q;  1ICW A;  4DK0 A;  2F0I A;  3LNN A;  2D9U A;  4YHH Q;  4OO1 G;  1CK1 A;  2PZT A;  2G9D A;  4A4I A;  3PIO 3;  1B9N A;  2IY5 B;  3KK7 A;  1JWS D;  1WCM G;  2BE5 D;  1LTI D;  4AH6 A;  3OTO L;  2X6G A;  2XVS A;  2H5X A;  5ELB A;  3UE1 A;  2OEO A;  2AWO A;  2EQS A;  1D1K A;  4L6T B;  1I4H A;  3GP7 A;  3PUX A;  4HCE A;  1A15 A;  4A3E G;  5C3E G;  4DV5 L;  1LAC A;  1V1P A;  2AQ3 B;  1Q86 C;  3AU7 A;  2QCP X;  4JCV E;  4RCO A;  3FPP A;  5I2X A;  4JBM A;  1MBY A;  4XT1 B;  1B1Z A;  1YJ9 A;  2PI2 E;  3A55 A;  3KBX A;  3KF6 A;  5C44 G;  1BR9 A;  1OXT A;  2B8G A;  2RBM A;  2MUY A;  4V19 0;  1V1P B;  1KC8 C;  3H3V C;  2RDF A;  3F2U A;  2NVT B;  2F0M A;  2MJ8 A;  2VUM G;  2I5H A;  4JOI C;  1DZ1 A;  2FMM A;  1EY5 A;  2UXD Q;  3L2P A;  1N36 Q;  3F2D A;  3SK8 A;  2D0O A;  2FHT A;  3KF8 A;  1VQK A;  4X64 Q;  3SK4 A;  4X3U A;  4DA2 A;  1JOK A;  5M5Y B;  2Z8L A;  4GNX C;  4YY3 Q;  3HOY G;  3HOU B;  2NVT H;  5C6A A;  3KLS A;  4TRD A;  1F2Y A;  2PNR C;  2F0G A;  3PUW A;  3J81 E;  5M5X B;  4DR1 L;  1L0X B;  1O80 A;  5IYC G;  3KF8 B;  3HOV G;  4JI1 L;  1HUN A;  5KEE A;  3IAY A;  1STB A;  4X3S A;  5M5Y H;  3PO2 G;  4XT3 B;  3VDY A;  1BF4 A;  3S15 B;  1Q8I A;  4QMG A;  4JBK A;  3P20 A;  5J3B A;  4JI4 Q;  2F3I A;  3HOU H;  5DLQ E;  1E2V A; 
#chains in the Genus database with same CATH homology
 4NW2 A;  2NZ1 D;  2WP8 J;  3BS1 A;  2JEA I;  3D3R A;  3LWU A;  3MVV A;  4RKL A;  5C5M A;  4C3I B;  1HCZ A;  2R92 B;  3PUZ A;  2B2U A;  4OL7 A;  3QOJ A;  3SE0 A;  4BS9 A;  4I65 A;  3IKJ A;  3FVQ A;  2F0E A;  3NP8 A;  1CA5 A;  3GTQ B;  1SNO A;  3PMF A;  5KYL A;  3BZD B;  1GUW A;  5KND A;  4FXD A;  4IAL A;  5I9O A;  4CHT B;  4C3J B;  1F2L A;  4KN7 C;  1O78 A;  1EY0 A;  2CQA A;  2NN6 G;  2FJ2 A;  1Z6H A;  5HGT A;  2OXP A;  3HS0 C;  3PV0 A;  3OHX C;  4XXE A;  2EYF A;  3K59 A;  2ICI A;  4RGM A;  3CRK C;  5M5W B;  1Q3L A;  3RZO B;  1XX8 A;  3VR3 A;  3VYT A;  5LL6 X;  1CZW A;  1EY8 A;  2B2Y A;  1TWF B;  1LTS D;  2JA6 B;  4IUP A;  2O4X A;  3J80 L;  2XN9 C;  3NQI A;  1SEB D;  1PMR A;  2WAC A;  1ROD A;  2E2I B;  2Q8T A;  4LK1 C;  5I9P A;  4J8Q A;  3EFX D;  1BBX C;  3M85 A;  1KAA A;  1LT5 D;  1NSN S;  3SVM A;  5EBC A;  1G6Z A;  4DAP A;  1ML0 D;  2E2D C;  4QIW B;  4YIJ A;  2B2U C;  4OIK A;  1EZ8 A;  4BBR B;  1F9P A;  1SJE D;  1U4R A;  4A3B B;  1LLR D;  2EE1 A;  2R93 B;  1VCI A;  2XRS D;  1SYB A;  2H4O A;  3DEP A;  4GZY C;  4C2M B;  5ISR A;  4FF3 A;  5EJW A;  3DHQ A;  5C3X A;  5I6Y A;  1F9S A;  4KY5 A;  4DN4 M;  1R4Q B;  5M9O A;  1ZYR D;  2PCF B;  1PTO C;  4ME5 A;  2B2W C;  2CHB D;  1XWE A;  4KD4 A;  2K7V A;  3GTL B;  1PZK D;  3K7A B;  1OXS C;  3D31 A;  2F0T A;  1OXV A;  2FMC A;  5LHY 1;  1SFO B;  3T4A C;  4DGZ A;  3J80 E;  2B2T A;  2AQ1 B;  2Y0S B;  5KNC A;  3QG1 A;  3HOZ B;  3D4W A;  4CJ0 B;  5JAV A;  1WTV A;  4PNY A;  5M3F B;  2A6E D;  1STY A;  1AFP A;  3S9W A;  5EQ0 A;  4ZQ3 A;  3EVQ A;  3P1H A;  4JK1 C;  1PRT D;  2O5J C;  4DFA A;  3QB3 A;  4OGQ C;  5I6W A;  1QNU A;  1PYW D;  2AWN A;  3DWQ A;  5IOD A;  5CBE E;  3D8G A;  2K03 A;  1S5D D;  1D6E C;  3GV3 A;  1AW7 A;  4Q0F A;  1DON A;  5E3F A;  1HFG A;  1EQT A;  2RQX A;  5C3W A;  5C4J B;  3DWP A;  1PRT F;  1Q12 A;  3IFT A;  1X3P A;  4CGY B;  1TS2 A;  3D4D A;  3MFY A;  5E4X A;  2RSO A;  3I70 A;  4DK1 A;  3TDQ A;  1A3V A;  5IGC A;  2LS0 1;  2NN6 I;  1STE A;  1A2T A;  2RA4 A;  3ERO A;  1H9J A;  2Q8I B;  5EPL A;  4FO2 A;  4F88 A;  1JCK B;  3VYU A;  3V96 A;  1TQO A;  4K5V A;  3FPU B;  4C3H B;  2QEJ C;  4LJZ C;  2CVR A;  1SNP A;  5E1F A;  1HQM C;  1KLG D;  1TY2 A;  1CHP D;  3J7A V;  3R3O A;  3I8Z A;  1HXY D;  4MIU A;  5CV7 A;  1EZ6 A;  1QOH A;  4CBV A;  3DEO A;  5COR A;  2TSS A;  5C4X B;  3SXH A;  4U68 A;  1DCZ A;  1FNW A;  5TSS A;  2A6H C;  2KEE A;  2R61 A;  4ZKC B;  2VNU D;  2EJM A;  4KK7 A;  1R9T B;  1PZJ D;  5A2Q L;  2QF7 A;  3H0G B;  3WOF A;  4FVM A;  2MPM A;  4A3G B;  3OIP A;  3OW7 A;  1TY0 A;  3D6W A;  1PTO D;  4F87 A;  5CYU A;  4DAV A;  4XDX A;  1O7Y A;  5KRU A;  3TP8 A;  1EY6 A;  1GUS A;  1NR4 A;  4L63 B;  4FP5 D;  2N88 A;  2BDO A;  4TKO B;  3MAQ A;  3GTG B;  4K5W A;  1BCP D;  1E2W A;  3DUZ A;  1GJX A;  1NCV A;  4C1N I;  4N9P A;  4NP5 A;  1EIH A;  3TSS A;  4RA8 A;  3EJI A;  4MN3 A;  1PTO F;  5J39 A;  4KHZ A;  2B8F A;  2KHS A;  4XQN A;  1TR5 A;  5D14 A;  3M7G A;  4HCS A;  1SNC A;  2B63 B;  3ITP A;  1BCP F;  2L55 A;  3D6C A;  4DF7 A;  3A8I E;  3BG3 A;  4RGO S;  5A2Q E;  5NUC A;  1L0Y B;  4QUC A;  1EY4 A;  2DNE A;  2MP1 A;  2SOB A;  2PZU A;  4UAI A;  1S5E D;  4HSP A;  2LMC B;  2D62 A;  4K2K A;  1V1O A;  5K36 H;  2EY2 A;  4EQO A;  5LL6 S;  1IYV A;  2NVY B;  5IGE A;  4A93 B;  4QB4 A;  1HPC A;  2JP1 A;  3CQZ B;  3TZD A;  3RUZ A;  1Y1V B;  2XRQ D;  2EYM A;  1WTO A;  3SEB A;  2KOL A;  1G2S A;  2EOT A;  3MZ5 A;  3EQL C;  1SJH D;  2EJF C;  4ZUI A;  4B08 A;  5BN5 A;  3HOV B;  1RTN A;  1BDO A;  4U67 3;  1F2Z A;  1D5X C;  2KEC A;  3R8B A;  3E0J A;  2J0T D;  3FDT A;  5BN4 A;  3W3A A;  1RJT A;  3NSW A;  1ESF A;  3T13 A;  4UDU C;  2F1M A;  2HUG A;  3X3N A;  4G7O C;  2A73 B;  3ZYY X;  4BY1 B;  5IGG A;  2E74 C;  1HTP A;  3A54 A;  4KD3 A;  4LMQ D;  1GHK A;  4WRD A;  3PUV A;  3Q0A A;  3NPP A;  2K32 A;  5EPK A;  1PRT B;  2JA5 B;  3WOE A;  5FO7 B;  2K28 A;  1H9R A;  3VR5 A;  1Y69 U;  2WB1 B;  5M3M B;  1WTR A;  1X3Q A;  1U4L A;  1SBB B;  1ET6 A;  3NXW A;  5JOB A;  1DOM A;  2C9O A;  3K58 A;  1GUN A;  4RHR A;  1ZYR C;  1B9M A;  4FNF A;  1HQR D;  4Q5V A;  4ULL A;  3C2P A;  3HG9 A;  3H94 A;  3LX0 A;  2KQ3 A;  3K5M A;  2EVB A;  1B53 A;  4ABN A;  4F7X A;  1TWH B;  3QOL A;  5EKL A;  2F0H A;  2A6E C;  1Q1B A;  4G57 A;  4IUR A;  3MC0 B;  3L3O C;  2NVQ B;  3IL8 A;  1UEA B;  4R9W A;  3NQT A;  1TU2 B;  1X32 A;  1PRT C;  4G4K A;  2EY5 A;  2R3Z A;  1QG7 A;  3I90 A;  3R93 A;  4IQZ A;  1JOQ A;  1FNU A;  1IKL A;  4RFB A;  5D65 A;  3KUP A;  1G8Z D;  5JEA H;  2XSC A;  5FO9 B;  1F77 A;  4X3T A;  5T1G A;  3M3Y B;  1EEI D;  2JA8 B;  1RF2 D;  3BYT B;  5DAU A;  1EEF D;  1I6V C;  1C8C A;  3VR2 A;  1I4X A;  2KCC A;  1D2B A;  5FKA C;  1STA A;  3TP7 A;  2F4I A;  2F0V A;  4IUQ A;  2F0W A;  2HCC A;  1JIC A;  2I07 B;  1NUC A;  2B2W A;  1IKM A;  1J9O A;  1VF5 C;  2F0F A;  2LKV A;  4CJ2 C;  2M2L A;  1HUM A;  1EWH A;  4N9T A;  1PTO B;  1XYI A;  3ND8 A;  1XXG A;  4OHJ A;  4G7Z C;  1EYC A;  1SE3 A;  3SK5 A;  5CV9 A;  2PZW A;  3SK6 A;  5CC4 A;  2SDF A;  2F3V A;  2IWH A;  2IX3 A;  1PTO H;  1BCP B;  3ND9 A;  2NYZ D;  1IHZ A;  2M00 A;  4RGT A;  5F2D A;  2X69 A;  1J8I A;  3M4Y A;  2NBF A;  4MHE A;  1SYD A;  4KV6 A;  1Z47 A;  5E4W C;  2DNC A;  4DAY A;  4DNT B;  4IFD H;  4I7Z C;  2F0D A;  5G3L D;  3OMG A;  3BVG A;  4EQP A;  3BVM A;  2PW5 A;  2KA7 A;  3GV6 A;  1I4P A;  3VR6 A;  3TZU A;  1MSH A;  1VMC A;  4TSS A;  5JEA G;  1A3U A;  1EY9 A;  1FGB D;  2F3W A;  3T16 A;  4C3I G;  1S4Z A;  4KI0 A;  1B4O A;  1S5C D;  2K04 A;  1YNN D;  5G3L F;  4A3M B;  4ODG A;  3A8K E;  2EY1 A;  3TME A;  5EBD A;  1BCP C;  3CKI B;  2C5C A;  2A5H A;  2IPK D;  3LWE A;  1G29 1;  2E2H B;  1AZP A;  4FF4 A;  4C3J G;  1ONL A;  4B9W A;  3NBI A;  2L11 A;  3TP5 A;  4ZLT F;  3HKZ B;  1DOL A;  4K8I A;  1MI2 A;  5ELE A;  1WTW A;  4H44 C;  3DMU A;  4IZ8 A;  1SMY C;  3OWE B;  2BCO A;  4J1M A;  1SNM A;  1LTA D;  4KKT A;  1Q1E A;  1SYE A;  5DM6 3;  1KAB A;  1DD2 A;  5ELC A;  2AUJ D;  4XYQ A;  4BA1 I;  2WKD A;  1RKN A;  1RHP A;  4CKE A;  3RMH A;  4Y7N B;  1LTG D;  5CR3 A;  2IT1 A;  2PYK A;  2JA7 B;  1Y8N B;  2RVL A;  4RHS A;  1W6J A;  3OPO A;  3WDN A;  4F8M A;  1IYU A;  2K5D A;  1ENA A;  3I4L A;  3S1R B;  5EPJ A;  2O2L D;  5CGK A;  3J7Y W;  3I73 A;  4IUV A;  5EGT A;  4BWG B;  4A3F B;  2A69 C;  1WD1 A;  4K2L A;  1EYA A;  2G9H D;  3S1M B;  1D5M C;  3TN2 A;  3QWN A;  3BYY B;  2PQE A;  3NK9 A;  5KGU A;  1B2T A;  3V2T A;  4BY7 B;  1CI3 M;  3RZD B;  4HMJ A;  4QUF A;  2DY7 A;  4K14 A;  5ELD A;  3Q24 A;  4C56 C;  1VDZ A;  1SNQ A;  3K57 A;  4EGV A;  3DXJ C;  3S17 B;  1K83 B;  4QF4 A;  1JWM D;  4O42 A;  3HOX B;  3NWS A;  4A3J B;  3I3C A;  4NKL A;  2WII B;  3BDO A;  5IT9 L;  1JQY D;  3NWT A;  2F0J A;  1FD7 D;  1K8O A;  1QE6 A;  3JAM L;  4BA2 I;  1O7Z A;  3M4O B;  1H9S A;  4ZAI A;  2ZXP A;  3MXG A;  3VA5 A;  1KDA A;  3PO3 B;  3S1N B;  2DY8 A;  1ZKO A;  2D5D A;  5CV8 A;  3CRL C;  2CW0 D;  1CFM A;  4RKB A;  1H9S B;  2NB0 A;  5J1Z A;  2HQE A;  1E2Z A;  2IX0 A;  1LT3 D;  1LTR D;  1MSG A;  1STH A;  1R4P B;  4KY7 A;  5I2Y A;  4HED A;  1DYQ A;  3C1F A;  4IUT A;  4PMC A;  3SR1 A;  2F0Q A;  4HMI A;  2EYH A;  1TWC B;  3W2D A;  1GUO A;  1LO5 D;  1SMY D;  1WCM B;  2ZT9 C;  1QIL A;  4XQJ A;  4C3H G;  5CV4 A;  5KIX A;  4A3E B;  5C3E B;  4KKU A;  1T5E A;  2AQ2 B;  3PIP 3;  1JC7 A;  1MGS A;  1NR2 A;  4OO1 H;  3ERQ A;  4J6H A;  5IT9 E;  1W6K A;  3KLS X;  1CT1 D;  1SXT A;  3G7L A;  1CHQ D;  5C44 B;  3JAM E;  3CHB D;  1VMP A;  3VYS A;  3PUY A;  2BA1 A;  1PZI D;  3VA7 A;  2IW3 A;  5I4D A;  1UAP A;  1O7L A;  1MD2 D;  1SYG A;  1PXU A;  2VUM B;  3P75 A;  3C46 A;  3MFG A;  3NBH A;  4IFD I;  2F0L A;  3QO2 A;  4O1N A;  3FEW X;  1QB5 D;  3C1E A;  1C4Q A;  3HOY B;  4KJO A;  2PO4 A;  3AB9 A;  1PFM A;  2HCI A;  1EYD A;  2JYO A;  2BA0 A;  2WV6 D;  2A69 D;  2EJG C;  1TWA B;  3Q23 A;  2F0S A;  3PO2 B;  1QNK A;  1TKW B;  1EL0 A;  1EWC A;  2F0K A;  2IJ0 A;  1F9Q A;  3K5N A;  1IL8 A;  3MEH A;  5J22 A;  5JEA J;  2NVX B;  1A6X A;  4A3D B;  1PFB A;  3UI2 A;  1EIG A;  4E6I A;  2JEB I;  1TT2 A;  5JPM C;  3IFD A;  2Z4I A;  4PMW A;  1CTM A;  1JR0 D;  1SDF A;  1TII D;  3K6O A;  2F0N A;  3K0Y A;  1I4G A;  5IIF A;  3GQB A;  2XWB B;  3H91 A;  1AEX A;  1I50 B;  1LTB D;  1FR3 A;  2F0O A;  4KN4 C;  1OO9 B;  4ZRZ A;  3J81 L;  2GA4 B;  1PLF A;  3U9O A;  2SEB D;  2NWG A;  1F9R A;  4PQX A;  1STN A;  5HUR A;  4C1N K;  3HGB A;  2ENB A;  2EDG A;  1UNS A;  2E76 C;  1M4V A;  5K36 G;  3SDZ A;  2NN6 H;  3BDC A;  2MGS A;  4H0L C;  1EY7 A;  4ZYS A;  3MXN A;  1JB3 A;  4A3I B;  5EKK A;  5D3D A;  3J7A F;  1LT4 D;  3S14 B;  1S5B D;  4OIJ A;  4P2C B;  1YNN C;  1SSO A;  2EYO A;  5KNB A;  3R2I A;  5C0X H;  2Z4H A;  3URY A;  3M7N A;  2L9H A;  3GTM B;  2F0U A;  2A68 D;  3FKI B;  1HHV A;  4IFD J;  2B2V C;  3N6R A;  4R8I A;  1ZXT A;  3SHL A;  5EKI A;  1Y8O B;  1FNV A;  2YYZ A;  1SYF A;  2Z1C A;  2EYP A;  1BXT A;  2LY7 A;  3HEJ A;  1RDP D;  3VYR A;  1KLU D;  2IX1 A;  1UUP A;  5T1I A;  3NTK A;  1GOZ A;  2A74 C;  3I91 A;  1CQV A;  4XTC S;  5A35 A;  2JE6 I;  5FK9 C;  5C4H A;  3OSO A;  3HOW B;  2AUK A;  2MHV A;  1DM0 B;  1KDC A;  3V05 A;  1WTP A;  3O13 A;  3BVZ A;  4KMU C;  5COY A;  4Z9C B;  1JOO A;  1E0B A;  3VR4 A;  2PW7 A;  5KYI A;  5FO8 B;  3R2T A;  3KBG A;  1LV9 A;  3RD4 A;  4K6D A;  4B9X A;  3GTJ B;  2JXM B;  1I3Q B;  5CV5 A;  4HSV A;  3TP6 A;  1TWG B;  3U9S A;  3GO5 A;  2L1B A;  1KDB A;  2LFN A;  1II3 A;  5C5L A;  5JVH 3;  2KVM A;  2RSN A;  3S2D B;  3GTP B;  4RCN A;  2XWJ B;  5IOC A;  2IL8 A;  4KTA A;  5C0X G;  2RKS A;  4H7B A;  2QDB A;  1GUT A;  3E5S A;  1NAP A;  3HP3 A;  2HDL A;  5CBA E;  3GTK B;  2WAQ B;  4QCL A;  2K1B A;  1WTQ A;  2BOS A;  4WOR A;  3MTS A;  3FMC A;  5FOB B;  1Y1W B;  3Q6S A;  1U4M A;  5DEH A;  3QIA A;  3A8J E;  3T56 B;  1Z7T A;  1U4P A;  4EQN A;  2RDH A;  1ENC A;  2L0C A;  3ONA B;  1HTL D;  3MXP A;  3NUC A;  5ELF A;  3OIQ A;  3AMU A;  4LAA A;  1JWU D;  5JJZ A;  1B50 A;  2I46 A;  3NE5 B;  1M8A A;  4OO1 I;  3S2H B;  2SNS A;  1STG A;  2KJX A;  2VB2 X;  1QWY A;  5D3I B;  2ZXO A;  3MA2 B;  1RTO A;  2Q8R E;  1OXX K;  2F03 A;  1DXM A;  1EQV A;  4TQU S;  3OMC A;  4HR7 B;  1D5Z C;  2K5W A;  2CW0 C;  2L12 A;  4M8A A;  2M9V A;  1DOK A;  1EU3 A;  1SAP A;  5CV6 A;  4ILW A;  3DWA A;  5IGD A;  4FF1 A;  3T51 B;  3G6J B;  2VXW A;  4CKC A;  3BDL A;  2J4X A;  1XTC D;  1A3T A;  1SE2 A;  5BN3 A;  2EYL A;  4CKB A;  2B2Y C;  4PV1 C;  1GXD C;  1H9K A;  3L7Z C;  1G91 A;  2EXZ A;  1TS5 A;  3NHH A;  4PMB A;  3GD7 A;  1BO0 A;  1BOS A;  1T5X D;  3A56 A;  5K5P A;  5IGB A;  4RGN A;  4XIG S;  5AFW A;  2F0P A;  2QIL A;  4FXK C;  4RAU C;  3I4N B;  4IFD G;  2K05 A;  1YNJ C;  1RD9 D;  4KY6 A;  4G7H C;  4IUN A;  4KKS A;  1U9R A;  1IW7 C;  2OT2 A;  1CA6 A;  1DJR D;  2E2J B;  1BQQ T;  4ZUJ A;  3X3M A;  3I72 A;  1KNA A;  2NTS A;  5C4Z A;  3RLF A;  4BBS B;  4WFN 3;  1LT6 D;  1CZG A;  4H13 C;  1I4R A;  4L8J A;  1RCV D;  1I6H B;  4XQQ A;  3CU7 A;  1CM9 A;  1JOR A;  1AN8 A;  2ID0 A;  1FYC A;  3KLR A;  1HRJ A;  4K8J A;  4XYO A;  3EA6 A;  3N52 A;  3QJY A;  2R6G A;  3A7A B;  2VB3 X;  3MHB A;  4M1U B;  4K5X A;  2K5Q A;  5C0X I;  5FLX L;  3TBI B;  2V4D A;  1ZEQ X;  2B2T C;  1ILP A;  1OXU A;  1ILQ A;  5JPN C;  1ESR A;  2KED A;  1B3A A;  3S16 B;  4KHV A;  5DM7 3;  4ID6 A;  4AYB B;  1JE4 A;  2WIN B;  1H9M A;  2K6A A;  4DU9 A;  4JBW A;  1LAB A;  3K5O A;  1WTX A;  1B44 D;  4RWS C;  3Q22 A;  2QKI C;  3HZX A;  1BUV T;  4X3K A;  2NUC A;  1V8Q A;  2L5T A;  3NTI A;  5JVG 3;  4NDX A;  4NMZ A;  1S5F D;  2BE5 C;  1PFN A;  2FFK B;  1G2T A;  2EYJ A;  1K8M A;  2K33 A;  4DNR B;  3MXU A;  2OF1 A;  2XIW A;  2XNA C;  4IN3 A;  1BNZ A;  1QCB D;  1SND A;  2KCN A;  1PDQ A;  5FLX E;  1EU4 A;  3C3L A;  2A68 C;  2NTT A;  2SNM A;  2D2C C;  1GHJ A;  2DN8 A;  4FYD A;  1QJO A;  2EY6 A;  1ET9 A;  3H6M A;  5DNF A;  2WKC A;  3T53 B;  4HAE A;  4ZK9 B;  2FIN B;  1KNE A;  2H1E A;  4S3S A;  4A3K B;  1V43 A;  1CQF A;  1SE4 A;  4HN7 A;  4EVO A;  2HDM A;  2R7Z B;  1VF7 A;  3L9A X;  4DXF A;  3HRZ C;  2TMP A;  2O5I C;  1HA6 A;  2EZV A;  1TVX A;  3NTH A;  5C0X J;  5CMD A;  2EPB A;  2K01 A;  1YNJ D;  2X6L A;  3E6Z X;  4WJW A;  4CJ1 B;  1IW7 D;  1A2U A;  3I4M B;  1ENF A;  1KTK A;  1Y8P B;  1SYC A;  1TS3 A;  3H09 A;  4RH6 A;  2ICE C;  1HFN A;  4KJN A;  2YU9 B;  2PPB C;  3D4R A;  1GUG A;  1Q90 A;  4R8N A;  3GTO B;  1HA5 A;  1AP0 A;  1LTT D;  2BDN A;  2RDG A;  4DXG A;  2B2V A;  3FRP B;  3DM1 A;  2JSO A;  3OOC A;  2PMZ B;  1EFI D;  4ZKB B;  1EOT A;  1WVL A;  2L4N A;  3K5L A;  3S1Q B;  1AZQ A;  3P7J A;  1F2M A;  3A7L A;  1I4Q A;  2KUM A;  1C48 A;  4FF2 A;  3OWF A;  5IGF A;  4V0B A;  2J7Z A;  1TS4 A;  2N55 A;  2B39 A;  4HTH A;  4FXG C;  2E75 C;  3MWY W;  2A6H D;  1WD0 A;  4IUU A;  4K6L A;  1D1I A;  2ZXR A;  1ICW A;  4DK0 A;  2F0I A;  3LNN A;  2D9U A;  4OO1 G;  1CK1 A;  2PZT A;  2G9D A;  3PIO 3;  1B9N A;  3KK7 A;  1JWS D;  2BE5 D;  1LTI D;  2X6G A;  2XVS A;  5ELB A;  2OEO A;  2AWO A;  1D1K A;  4L6T B;  1I4H A;  3GP7 A;  3PUX A;  4HCE A;  1A15 A;  1LAC A;  1V1P A;  2AQ3 B;  3AU7 A;  2QCP X;  4RCO A;  3FPP A;  5I2X A;  1MBY A;  4XT1 B;  1B1Z A;  3A55 A;  3KBX A;  1BR9 A;  1OXT A;  2B8G A;  2RBM A;  2MUY A;  4V19 0;  1V1P B;  3H3V C;  2RDF A;  3F2U A;  2NVT B;  2F0M A;  2MJ8 A;  1DZ1 A;  2FMM A;  1EY5 A;  3SK8 A;  2FHT A;  3KF8 A;  3SK4 A;  4X3U A;  4DA2 A;  1JOK A;  5M5Y B;  2Z8L A;  3HOU B;  5C6A A;  3KLS A;  4TRD A;  1F2Y A;  2PNR C;  2F0G A;  3PUW A;  3J81 E;  5M5X B;  1L0X B;  1O80 A;  1HUN A;  5KEE A;  3IAY A;  1STB A;  4X3S A;  4XT3 B;  1BF4 A;  3S15 B;  1Q8I A;  4QMG A;  3P20 A;  1E2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...