2K03A

Structure of sdf1 in complex with the cxcr4 n-terminus containing a sulfotyrosine at postition 21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCACQIVARLKNNNRQVCIDPKLKWIQEYLEKCLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of CXCR4 sulfotyrosine recognition by the chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Stromal cell-derived factor 1
total genus 10
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k03A00
1DOMA 5EKIA 4X3SA 2RSOA 1AZPA 2L9HA 1F9PA 5CBEE 1U4RA 4O42A 5CORA 5DNFA 2MP1A 5CBAE 3KUPA 2FJ2A 4HSVA 2KEDA 4QUCA 1U4PA 5COYA 1XYIA 1X3PA 1HA6A 1JICA 5CMDA 3R93A 1PFBA 2KUMA 2K03A 3GV3A 1CA5A 3SVMA 2H1EA 1G91A 1F9SA 1HRJA 1NAPA 1TVXA 1E0BA 1HUMA 3FPUB 1VMPA 3I8ZA 4DN4M 1ICWA 2B2VA 2X6GA 1F9RA 1B4OA 1MI2A 2FFKB 2L4NA 1G2TA 4IUQA 2NZ1D 1KNEA 2K01A 1AP0A 1F9QA 2X69A 1WD1A 3Q6SA 2B2UC 4HEDA 1AZQA 2FMMA 1IKLA 1MSGA 2HDLA 5AFWA 2JYOA 1EL0A 1ILPA 1WTQA 1A15A 4OIKA 1PFNA 1F2LA 2D9UA 1X3QA 4X3TA 3HP3A 2N55A 3TZDA 3I3CA 1ESRA 4ZKBB 1BO0A 1X32A 2K04A 5JJZA 1JE4A 2L1BA 4QUFA 4ZK9B 1WTVA 4IUTA 2KEEA 4XT1B 4X3UA 2HUGA 4UAIA 1EIHA 2IL8A 3H91A 1RHPA 1WTWA 3IL8A 2EE1A 2HCIA 1SDFA 1B53A 1RJTA 1S4ZA 2KOLA 2XIWA 2B2YA 4HAEA 1G2SA 4ZLTF 1HHVA 1IKMA 1DZ1A 1G6ZA 1DOKA 5EJWA 2SDFA 4CJ0B 2B2YC 3DEPA 1MSHA 4RAUC 3DEOA 1QNKA 1GUWA 1RODA 2HDMA 4ZAIA 1WVLA 1XX8A 1O80A 3D6WA 1WTRA 1MGSA 1KNAA 2B2TC 2RA4A 3LWEA 2NYZD 1PDQA 1HFGA 1RTNA 3I91A 4IUVA 4IUPA 2FINB 1RTOA 1U4MA 1IL8A 3F2UA 1B3AA 1ZXTA 2HCCA 1EOTA 3DM1A 3GV6A 4HCSA 2VXWA 5EQ0A 5T1IA 2B2UA 3N52A 2Q8TA 1SAPA 1O7YA 2K05A 1PFMA 2M2LA 1SSOA 1CA6A 1HFNA 2J7ZA 2B2TA 1PLFA 3IFDA 4OIJA 2EPBA 2N88A 3G7LA 2BDNA 2B2VC 2NWGA 2Q8RE 3MWYW 3TN2A 4CJ2C 1DOLA 2MPMA 2DY8A 2B2WC 4CJ1B 4XT3B 5D14A 1EQTA 1HUNA 1WD0A 1ILQA 3P7JA 2CVRA 4X3KA 5EPLA 4RWSC 5E4WC 1BF4A 1QG7A 2KECA 3ONAB 2RVLA 1DONA 4RA8A 2KVMA 1U4LA 1ML0D 1QE6A 4LMQD 4R8IA 3KBXA 1Q3LA 2K1BA 3I90A 5D65A 5T1GA 1J8IA 5E4XA 2B2WA 4MN3A 1M8AA 2K28A 2L12A 1WTPA 3MTSA 1B2TA 4R9WA 1LV9A 2RSNA 3FDTA 1WTOA 1BNZA 4NW2A 1CM9A 4IURA 4IUUA 4MHEA 3UI2A 1C8CA 1J9OA 1O7ZA 2R3ZA 1VMCA 2L11A 2FHTA 2X6LA 5EPKA 1NR2A 2DY7A 2EOTA 3QO2A 1WTXA 1BBXC 1B50A 4XDXA 2MJ8A 1NR4A 4ZKCB 4U68A 1EIGA 2JP1A 5EPJA 2MGSA 1NCVA
chains in the Genus database with same CATH superfamily
2CWPA 2RSOA 1B44D 2WKDA 1IBMQ 3HKZE 3AU7A 5C0XJ 4WFN3 3T56B 5KNBA 5LL6X 3UE0A 1SNCA 3H94A 4O1NA 4A3EH 4A3KB 1I4HA 1F9SA 1HR0W 3ULPA 1Y8OB 1I50B 2WB1E 3CCQA 2JXMB 3X3MA 1Y8PB 4ME3A 1K3BC 4K6DA 1I4GA 2WKCA 4NXML 3DUZA 3HOXG 5ELEA 3KDFA 1EY8A 1Y1WG 5CV4A 2E2IB 3PO2B 2XRQD 4BY7B 1LTID 1CKMA 4A3GG 2C5CA 1CQFA 4B08A 3H3VI 2IJ0A 1CI3M 5EBDA 1OO9B 3GTQB 3L0OA 4GOPA 2F0PA 4QL5A 3DWPA 4IPCA 1ZKOA 4A3IG 1V1PB 3KF8B 3NE5B 3KJOA 1WVLA 3S9WA 1VQ9A 4YY3L 2JA7G 2K5WA 4ZUIA 3GTLH 1S5CD 5CR3A 4A3DB 3A8IE 5JJLA 1DD2A 1O7IA 2F03A 4L63B 4S3SA 4DR4Q 5JEAH 1I4PA 2AQ1B 1PH5A 2LY7A 1B9MA 4JVZA 1L1OC 4JI5Q 3MWYW 4F87A 3K5MA 1F2YA 3Q22A 2DY8A 2NVTB 3J7A5 4DV1L 3SEBA 1WD0A 1NY4A 2B63G 2BOSA 4O2DA 3UE1A 3S1QB 5M5XB 2OF1A 1SEBD 1FVIA 2K75A 1E1TA 2O2LD 1CSQA 2B2WA 2A6EC 2NVTH 4PNYA 4A3MB 1S40A 1LTGD 4YCVA 4DV4L 1NMGA 5C44G 2X6LA 4GN4B 2FHTA 5EPKA 2DY7A 2VB2X 2JA7H 1EIFA 4C3HH 1CFMA 1PMRA 1T5EA 4RCNA 1TY2A 3HOVB 2L9HA 2F0HA 3UDIA 1TWHB 1E3PA 2OEOA 4JI8L 5CORA 1PV4A 3MC0B 2N3SA 4UDUC 3KLWA 1X3PA 3RR5A 3S1RH 5CMDA 1PFBA 4JI5L 1G91A 5DLQE 4RCOA 1QZGA 3K5NA 4ID6A 1M4VA 1FYCA 2BE5C 1B4OA 4BXXH 1ESFA 4GKJL 3HOXH 5C0XH 5IY0A 4K5WA 4JI4Q 1LABA 1UE7A 4KD3A 2OT2A 3A5ZB 1TQOA 3RLOA 1JQYD 3B6YA 2UUAQ 2A73B 4JPBW 5K36G 1BDOA 3ULJA 4PMWA 2KEEA 4LWCA 3EA6A 1DYQA 4X62Q 2KOLA 4L8JA 4ZLTF 5IT9E 2B2YC 4V0BA 4RAUC 2UXDL 4X62L 2HDMA 1YJNA 3U9OA 4LFCQ 5A2QE 2NYZD 1PDQA 2NN6H 4LF7L 5FJ8H 3FRPB 3TS0A 1R4PB 3GD7A 3SK5A 1ONLA 4UHVA 4OX9L 3F2BA 4GNXB 1UE6A 1LO5D 1C48A 2B2WC 5JJIA 4WJWA 5I9OA 4TRDA 3D4RA 4MTNA 5CYUA 2KECA 4J6HA 1DONA 2NZOA 3HRZC 2CH4W 4A3JH 4DFAA 2PPBC 5J39A 1EZ8A 4QCLA 2ATWA 1ZEQX 2SNSA 4AQYQ 1IYJB 2WB1B 3K58A 3OIPA 4QGUA 2K28A 3BS1A 1B2TA 1A63A 4DV6L 3GTMH 2DN8A 4KMUC 1G8ZD 1RL2A 2I07B 1TS2A 1O78A 1EWIA 1GUTA 1PH8A 1IBLL 2M00A 3BVMA 3PMFA 3QOLA 2QEJC 2Y0SG 4ZUJA 2R6GA 1AE2A 5KIXA 5KNDA 1SMYD 1D1IA 5BN3A 4YHHL 4LF9L 2I5LX 1AZPA 5FLXc 4L6TB 3NWSA 2JA6H 4O42A 3J7YW 3T1HL 1F2MA 2KEDA 1YIJA 1SYGA 1E1OA 3AB9A 4HJAA 3I4MB 4IPGA 2B63B 5CV8A 4DPGA 2PZWA 2QEXA 4DN4M 3I8ZA 4XTCS 2K7VA 1OXXK 3PCOB 4A3IH 1KAWA 1BR9A 4PZ6A 1HNXL 2B3GA 1QVFA 3MXNB 1SE4A 4NMZA 5H1SE 1XPUA 1AP0A 4PG3A 3HOWH 2NVQH 1FNWA 2F0SA 2HDLA 2EIFA 2WINB 3FMCA 4F8MA 1R9TB 1JJ2A 1F2LA 2BA1A 2JQOA 3KF6B 4JBKA 4ZKBB 2ZXRA 4MNOA 2JN4A 1PA6A 1EU4A 5IT9c 2A19A 3PQIA 5I6YA 4IOCA 4POFA 3TMEA 1Q1EA 4OONA 1DM0B 1KXLA 1C4QA 1GKHA 4HJ7A 2Z0SA 1IBLQ 2ZM6Q 4C3JG 4CDFC 5C4JB 1EY0A 3VR6A 2YU9H 2Y0SB 4UPAA 2C9OA 2D62A 2B29A 1H9SB 4ZAIA 3CW2C 2PW7A 4N9PA 3PO2G 1BBWA 1RTOA 4LAAA 3OYYA 1QZHA 3LWUA 5K36H 2I5HA 2NZHA 2HCCA 2IPKD 3HOXB 1YHAA 1PH2A 3PUYA 4K8IA 2JEAI 1HFNA 2B2TA 4DUZQ 3VR5A 5LL6S 1N33Q 3RN2A 1O7LA 1EU3A 3W5OA 1EOVA 2Q8RE 5D3DA 1K3RA 2NTSA 1VQ4A 1IW7C 3NPPA 5I9PA 1PRTF 5JOBA 2R93H 1JT8A 2K5QA 1I50H 1ML0D 5GADC 2QA4A 1MIUA 2LMCB 4A93B 2ENBA 4OGQC 1FL0A 4YWLA 4H02A 3I7FA 1P16A 4DV0L 2YU9B 3E6ZX 4Y7NH 2VY3A 4A3BH 1B9NA 1PTOH 4EQOA 1BKBA 4IURA 5C4XB 2A69D 3NTHA 5KGUA 4BY1B 4DAMA 4A3MH 5DAUA 2L11A 3CCMA 3QO2A 1BBXC 4JYAL 3S16B 1TS4A 5C3XA 1FD7D 5EPJA 3NK9A 1PH7A 4GN5A 1LTTD 3EROA 4DK6C 2ZM6L 3A7AB 1D8LA 3GTKH 1VQAA 2KA7A 2K5HA 2EYHA 3CRKC 2G5DA 3K6OA 4QJFA 3NBHB 3QJYA 1VQPA 1VCIA 1JOOA 4JBJA 4B3ML 1HZBA 2MO0A 1Y8NB 1S5BD 4C2MH 1G2TA 2OQ0A 2F4IA 4X66Q 4B9WA 1W6KA 2NVXH 3CCVA 1OXSC 2Z1CA 4RMFA 2RHQB 3W1GA 1ESRA 1SR3A 2ZXOA 3GTJB 5IE8A 2ZTCA 1X3FA 1DCZA 4BBSH 3GTQH 1JOKA 2LFNA 2RCFA 3H91A 2ZJQA 1B53A 3VYUA 2F4VQ 3E0EA 3TP8A 5FLXL 2CQOA 4L5QA 4A3LG 3D6WA 2EVBA 2B2TC 1WFQA 2CFMA 5ELDA 4LFAL 3MFYA 5FKAC 1RTNA 3RZOH 1IL8A 3F2UA 1LM0A 1VQLA 3DLLA 5KYLA 3HOYH 3M4OH 3BYTB 5IODA 3BDLA 2QILA 4FO2A 3H0GG 2MPMA 3DWAA 3EBEA 3VA5A 1L0YB 1ILQA 1I3QB 1Y14B 1STBA 2EYOA 1TWCH 2CVRA 4I65A 1QG7A 3A74A 3ONAB 5C5MA 3FKIH 3J80i 4DR5Q 1OXTA 3QR8A 2K6AA 1TY0A 4DAVA 1KLGD 2A6ED 3TS2A 2AWNA 1GUOA 3U4ZA 2ZTDA 5CV9A 2Q2TA 4CDEC 1PRTB 1L1OB 1S3OA 1G51A 4BBRB 1N9WA 3FP9A 3H3VH 2NUCA 3U58A 1VMCA 2A69C 3MEFA 1VQ5A 5FO8B 2MGSA 3I56A 3H09A 1N34Q 4JI7L 1JC7A 5EBCA 1D5ZC 5F2DA 1HZAA 4KKTA 2TSSA 1PTOF 3IFTA 2FJ2A 2HHHQ 4PZ7A 4A3GH 4DK0A 4LJZC 2PQEA 3E9HA 2K03A 2N78A 1LLRD 2B2VA 3V05A 2R7ZH 2L5TA 2L4NA 4HMIA 3PO3G 1CKOA 4HJ9A 3TRZA 1I94L 1F9QA 3MXNA 3NEMA 2CQAA 2ZJPA 5HGTA 1A62A 3RMHA 1KABA 2JYOA 5NUCA 1YITA 4BBSG 4FDBA 3TZDA 2NVXB 3BDOA 2K04A 4I7ZC 3S16H 2F52A 1WTVA 1PXUA 4LF8L 4JI6Q 5CGKA 3R2TA 2AQ3B 3M7NA 1NNXA 1RHPA 4JOIC 2AUKA 1SN8A 1EFWA 1G2SA 2CW0D 4H13C 1E22A 2FXQA 5IOCA 4CJ0B 1EY9A 3DEPA 4GN3B 3HGBA 1JWUD 2KBNA 1VQNA 1TR5A 2PQAB 4ILWA 4CGYB 1EIYB 2JA5H 2R92H 2YTVA 4OWWB 2ZT9C 2WACA 5IGDA 1XNRQ 5IYDG 3I4OA 4HIOA 5EQ0A 2B2UA 4KJNA 1B3QA 1CA6A 3PO3H 1FJGL 3QOJA 3R2IA 4C3IG 2EYMA 4TVAB 2BDNA 4BS9A 1PYBA 1GUGA 4RG1A 4LF4L 3NP8A 3CF5A 4HIKA 3KDFB 1EYGA 3K81C 4B3MQ 1BF4A 3MVVA 4DV5Q 4RA8A 2JA8G 1P8LA 3DM3A 2KCNA 4EQ5A 4X66L 1I94Q 1YBYA 3L9AX 3J80E 3FEWX 2L12A 1WTPA 1XXGA 2JE6I 2K5NA 3J7AF 2E74C 1WTOA 2RCNA 3HOUH 1NTGA 2UXBQ 3ERQA 3JC66 1SMYC 2AQ2B 1VQKA 4JI2L 4IPDA 4IALA 3QG1A 1XNQL 1SE2A 1V1PA 4KY7A 2EYFA 3S15B 4H7BA 3W1BA 4X3SA 1V43A 1U5KA 4EQNA 2Q2IA 2F0KA 1U4PA 1I3QH 1IBKL 1CT1D 1EUJA 4HCEA 4RKLA 4I7AA 2OTJA 2H1EA 3F1ZA 5IWAQ 3TSSA 1HZ9A 3BYYB 3DWQA 3I70A 4JI1Q 4DR6L 1X55A 1HNZL 5G3LD 5KEEA 4IUQA 4OO1I 5C4HA 2MFIA 3E3XA 4DV3L 3H0GH 3G71A 1S5FD 1IKLA 2R7ZG 2E2DC 1HNZQ 2XN9C 3T4AC 2OQKA 3HP3A 4RGNA 4DR7L 1Q8IA 4WJ4A 5C5LA 4ZRZA 3ERSX 4NKLA 4ZK9B 4DR2Q 4IUTA 2IX1A 1VQ6A 4C3HG 5M3MB 4A76A 5IYBH 1JMCA 4DGZA 1OTCA 4HEDA 1SDFA 4WJ3M 1MJCA 3AFQA 2RQXA 1DOKA 2PNHA 2VW9A 2UUAL 3QIAA 4HJ8A 5M9OA 4FYDA 4IFDI 3K5OA 1XMOL 1Y1WH 3HKZG 4IUPA 5EKKA 3GTOH 3L3OC 4R1JA 5ELFA 3UDFA 2BH2A 2VUMH 4KHPQ 1XMOQ 1PH4A 1SAPA 2QCPX 3KJPA 3I4NB 5HGQA 1SNDA 4PV1C 1ASZA 1K8OA 2K4KA 2RKSA 3K8AA 3GTMB 2F0UA 4P71A 1HTPA 1TWFB 1PTOD 2D0PA 2ICIA 3C2PA 4B3TL 3D8GA 2ZXPA 3C1EA 4BA1I 4LMQD 5HY6A 1Z9FA 5M5XH 5GQOA 5GAGC 3Q23A 3MZ5A 3S1MB 3GTPH 1BNZA 2HQEA 4C1NI 5TSSA 1YNND 3VDYA 3S2DH 1J9OA 2ZTEA 3CCJA 1X3EA 2A74C 2NVYH 3I4MH 4OWXB 2EJFC 2MJ8A 4JI6L 2RDGA 3M7GA 3D3RA 4ZKCB 1SXTA 4A3DH 2JA6B 1IXRA 3K7AB 3H6MA 3M4QA 5EAYA 3RUZA 1ENFA 1EEID 1L0XB 1JICA 1K73C 3SVMA 3KK7A 5M5YB 1TVXA 1ICWA 1HJPA 1KTKA 5IP7H 3HFZB 2Z9HA 4IPHA 1SNMA 4DR4L 3NHHA 2XWBB 2K01A 1BXTA 2LXKA 2B2UC 4OX9Q 2B63H 2F0LA 4JBMA 5LMNQ 1Z47A 3U4VA 4NXMQ 1NSNS 1D5XC 4WRDA 2QKIC 4XQNA 4C3HB 5M3MG 4KY6A 3SXHA 1E2VA 2JJQA 1DJRD 4GOPB 4X6AH 2EE1A 3NTIA 2XIWA 1QCBD 4HAEA 2LKVA 1J6QA 1DZ1A 1U9RA 1RODA 1Z6HA 3F2DA 1GHKA 4BWGB 1XJVA 2PQAA 3VR2A 1HH2P 1CHQD 3RLFA 2Z4HA 1WCMG 2YV5A 3WWVA 3N52A 4K5XA 3ZYYX 1PFMA 2M2LA 4M1UB 4GLVB 2UUCQ 2EPBA 5IGCA 1JJGA 1MHWC 2NWGA 5D14A 3S14H 3PIO3 2RHSB 4KY5A 2MUYA 3VR3A 2RVLA 1STNA 5C0XI 2DJFC 5C3EB 1BVSA 2B8FA 1QE6A 4C56C 1R4QB 4P2CB 4DV5L 4K6LA 2IW3A 4DAYB 2IY5B 1FGUA 1KDCA 3PIOA 1TWAH 2RSNA 3A55A 1CUKA 1YNJD 3NQIA 4A3FG 4DXGA 4EQPA 5E1FA 3OMCA 4HSPA 1B50A 1A2UA 2L15A 1AEXA 2N88A 4G7HC 1K83H 1KQSA 3I4NH 4PMCA 3HG9A 1PTOB 5C4XH 1C7YA 2LSSA 1S5ED 5ELOA 2P5ZX 2NB0A 1EFID 2JK8A 4HSVA 3KUPA 4LUVA 1DXMA 1CQVA 3K0YA 3TP6A 5BN4A 2I46A 2BE5D 5IYBG 1E0BA 4LF6L 3FVQA 5FO7B 3K5LA 1FNUA 3DXJC 2X69A 3N6RA 2J0TD 3I72A 4UP8A 1AW7A 3OTOQ 2Q2HA 5FJ8G 2QDBA 4K5VA 1SFOB 3EFXD 4H44C 1PTOC 4M8AA 4IJLA 5M5WB 4ABNA 1RD9D 1Q1BA 5L37A 1BCPD 3I4LA 5C6AA 2EQSA 4IFDH 4DV2L 2EYLA 5EJWA 5C4JH 5I2XA 5ISRA 1GOZA 1Y69U 1BCPF 2F0JA 1KNAA 2R7DA 4TKOB 1MKHA 1Q12A 4R4TA 1L2FA 2F1MA 4F7XA 1H95A 4RGOS 1XNRL 4NDXA 4IQZA 2F4VL 3NBHA 4AYBE 4MIUA 2L0CA 1ASYA 1LT3D 4DF7A 1SJHD 2F0WA 4IZ8A 3FKIB 1UNSA 1HUNA 3S1RB 1A3VA 4X3KA 3HZXA 1TT2A 5C3EG 2UXDQ 4DK3C 3SR1A 1JWMD 4BBSB 3I90A 5FLMH 1E2ZA 1SYFA 2NN6G 4RFBA 3CC4A 1VQEA 3MTSA 4K2KA 2HQLA 1EYDA 4O0AA 1YJ9A 4NW2A 4C3IH 4GNXC 1QVGA 4YWKA 2F0OA 3RZOB 2JA5G 1QNUA 2F0VA 3NXWA 4XDXA 3HOWB 3I4NG 1EIGA 4CJ1B 5KNCA 3AQQA 3MEHA 1PHJA 2GVBA 3K7AH 4X64Q 3CU7A 3PF4A 4DV0Q 5DNFA 4G4KA 3H0GB 1VQJA 2IWHA 3PO2H 1N36L 3S14B 3SK4A 3TREA 1CTMA 1IW7D 1NAPA 2JA5B 1EWCA 2EY6A 1D6EC 2NBFA 3ZJYC 1K8GA 4Z9CB 4JYAQ 4K14A 1LTSD 2HHHL 3T1HQ 4XXEA 1TIID 2WAQB 1KIXA 1KNEA 4A75A 1JB3A 4CKEA 2VQFQ 1N34L 3PUVA 2QW7A 1XPOA 3HEJA 1ILPA 1HNXQ 1PFNA 3P75A 4Y7NB 1NUCA 4DNIA 2KJXA 3BVGA 4OXPA 4N8X1 2E2JH 1F77A 2PW5A 2TMPA 3CC2A 1YHBA 1N33L 2XGTA 1T5XD 4HR7B 1WTWA 3IL8A 2HCIA 2RBMA 1RJTA 5C4ZA 1HZCA 2PI2E 5IGEA 2NN6I 3AFPA 1JOQA 1H9JA 2WP8J 5E7NA 1X9NA 4PQXA 1EY7A 4JI3L 3J7ZC 1STYA 3X3NA 3ER0A 4IFDJ 2G9DA 1ZXTA 1W6JA 2VXWA 2HD3A 3SGIA 1RCVD 1IYUA 1STGA 5J1ZA 3GP7A 2A68C 1LACA 4JK1C 1KL9A 2Z8LA 4B9XA 3Q0AA 2UUCL 1DOLA 3NWTA 1SYDA 5GROA 1EY6A 1IL2A 3OHXC 3K57A 3MHBA 2BCOA 4LFAQ 2F0NA 1MBYA 2MQHA 2D5DA 2IHEA 1I6HH 2EXDA 2WIIB 1VQDA 2QF7A 3PUWA 4L5TA 4UP9A 3I2ZA 2SEBD 2UXCQ 1Q86C 3S2HB 4DAYA 5DEHA 2NVYB 3TP5A 4R4OA 3UI2A 5JVG3 3GTGH 4JG2A 2F3WA 3FPPA 4KK7A 1E2WA 1NR2A 5FK9C 1EWHA 5C3WA 2GA4B 1G6PA 3CAMA 5GAHC 3H15A 3KLSX 3FHWA 4QB4A 4A3BG 3M9BA 1PH1A 4GKJQ 4HMJA 2SNMA 5CBAE 1HNWQ 1XNQQ 1VQOA 4CDCC 4A3CH 3S1NH 1K0RA 1PZJD 4QMGA 5FLXE 3E5SA 2LXJA 2AKWB 4G7OC 4TQUS 3AEVA 3S24A 2FFKB 4ME5A 3PGZA 4R4IA 4K2LA 3OTOL 3HOZG 2VUMB 3BZDB 2YTXA 1QUQA 4X65Q 5G3LF 1QB5D 2FMCA 2KCTA 1K0SA 3GQBA 1JB7A 4FF3A 1SMXA 3SHLA 1CZGA 2EJGC 4QIWB 1MD2D 2E5LQ 3VYTA 3HOYB 4DV7L 1AE3A 3O13A 1VQMA 3QWNA 1PFSA 2IT1A 4OELB 4IFDG 1UUPA 3CRLC 4OWTB 3PO3B 3RN5A 3M4YA 3OWEB 1ENAA 3DHQA 3D0FA 3DEOA 2BDOA 3HS0C 4H0LC 4A3FB 1WTRA 3CP0A 5C0XG 2EJMA 1MGSA 4AYBG 4GKKQ 1VQ8A 3KLRA 2KCCA 3MXGA 3CHBD 5FLMG 1KC8C 1KHIA 2JA8H 3S2HH 3W3AA 4DK1A 3GTJH 3RNUA 2Q8TA 3GTKB 5ELBA 1QILA 1SSOA 3W2DA 4POGA 1B70B 4C1NK 3G7LA 1SE3A 5BN5A 3GTLB 1N36Q 2VQEL 2ALYB 3NUCA 2O5JC 3CD6A 2F0EA 4KD4A 3MAQA 2A6HC 1A3TA 5EPLA 5E4WC 4A93H 1RF2D 3JAME 3GTOB 4HJ5A 2XSCA 3URYA 2CCZA 5M3FG 4QQBX 2AHOB 4MN3A 2Z6BA 1LV9A 2PI2A 4JW0A 1L1OA 4FXDA 4EGVA 1II3A 3E0JA 2PCFB 1Q81C 4LW1A 1FJGQ 1I6HB 3LX0A 3GDEA 1I5FA 2PMZE 2KHSA 4GKKL 2O4XA 2V1CC 4Y52H 1STAA 3I55A 4DR3L 2XVSA 1WOCA 5K5PA 1J5EQ 1PRTD 5COYA 4A3KH 3R93A 4DV4Q 4C2MB 2ASBA 1HRJA 3ND8A 3M4OB 1MI2A 4KHPL 1I4XA 2N49A 3S1MH 2LS01 1YZ6A 4KLKA 1YNNC 4NP5A 3TBIB 5JPNC 2VQFL 1ICFB 1PH6A 4DR1L 1X3QA 4TSSA 2XWJB 4XQQA 3V2TA 4B3RQ 4NXNL 1HPCA 4X3UA 2HUGA 4UAIA 1BQQT 2JA6G 4K0KL 4GOPC 1WCMB 4Q5VA 3ITPA 2NVQB 1OXUA 4B3RL 1HHVA 1K28A 2F0FA 1IZ6A 2N8NA 3J81j 2F0MA 4JI3Q 1XX8A 3G6JB 3LWEA 5LHY1 4JC0A 4IUVA 2ZJRA 4NB3A 5M3FB 5T1IA 2E76C 4DAPA 3T1YL 5I6WA 2J7ZA 2CW0C 2VL6A 5ELCA 3JAMc 4OIJA 4DR2L 3CQZB 4OO1H 3UDXA 3D6CA 3TP7A 3TN2A 1X3GA 1YNJC 3KBGA 4DXFA 3PUXA 3CMEA 1YHQA 4Q0FA 3OSOA 4KKSA 1BCPC 4K8JA 1TU2B 1KRSA 1ET6A 2EDGA 2G9HD 2H4OA 3HOZH 2OCEA 2K1BA 3ND9A 1PVOA 4LF9Q 5E4XA 4QF4A 4BXXG 3STBD 3D31A 4KV6A 4LFCL 3FDTA 5DM63 5IWAL 1VQGA 4UY8C 2VS1A 4G7ZC 2DNEA 1HQMC 5FOBB 1WTXA 4ODGA 1A6XA 3OW7A 4U68A 2VB3X 5JJKA 1V1OA 1DOMA 4CDDC 1X54A 1XTDA 4XQJA 3KOJA 3OMGA 1R9TH 3CPWA 2GVAA 1UWVA 2MP1A 3CC7A 3P20A 4DU9A 2F0TA 2E8GA 3S1NB 1V9PA 3CCEA 2R7ZB 3GV3A 1B1ZA 2UUBL 2F0IA 1E24A 5C44B 3PF5A 4C3JB 4MTKA 1F2ZA 2O5IC 2JSOA 2IX3A 2WFWA 1GVPA 1CKNB 1LT5D 4P74A 1QUQB 5AFWA 4U673 5CC4A 4DR6Q 1EY4A 4CHTB 3I3CA 1FR3A 4DV3Q 5I4DA 5JJZA 1VQHA 1C0AA 4QUFA 1X6OA 3A54A 1IBKQ 4C3JH 1M1KC 5BR8L 2IL8A 3Q24A 2F3VA 2ICEC 2SDFA 4JBWA 4DUZL 4RGTA 1QNKA 1GUNA 3ICEA 1CZWA 5AJ3L 2EY2A 3I4MG 1IBML 2KQ3A 2RDHA 2BH8A 1T9HA 4FF2A 3T53B 1Q90A 1EOTA 4HCSA 1H9RA 2UXBL 4DR5L 5J3BA 1EEFD 3A7LA 1TWHH 1CHPD 1O7YA 1SROA 1LTAD 1UE1A 2J4XA 4BY1G 3V96A 3J81i 2PZTA 2HIXA 2WV6D 5D3IB 4A3KG 4JI0Q 4FF1A 1JR0D 3OWFA 4KN7C 4GNXA 1KAAA 2DGYA 4LF5L 5I2YA 4V190 4BY7G 2AWOA 3EVQA 2VUMG 4J1MA 3PIP3 2E2HB 1K8MA 2B39A 4AYBB 4JI7Q 3SK8A 3KBXA 3D4DA 4RH6A 4F88A 3C46A 5IT9L 1A8VA 1W2BA 4JI1L 1HCZA 2Q8IB 2I5MX 4JV5L 4OL7A 4IUUA 1EY5A 1PZID 3CCUA 5LMNW 5IGGA 2ES2A 3J80c 3G4SA 4BY1H 4R4QA 2PNRC 1V1QA 3LNNA 4P75A 1FGBD 4N8FA 4YIJA 3HOYG 3HOVH 2K5DA 4A3JG 4GS3A 3J7AV 2OWOA 4HIMA 4CKCA 2JP1A 1WI5A 4DR3Q 1RDPD 3ULLA 1XPRA 4DUYL 4GLXA 4R8NA 1LTRD 3K59A 3D4WA 4N9TA 5LMNL 4L5RC 3JAMi 5IGFA 4RKBA 4LNQA 1HXYD 1TXYA 1SJED 1Y1VB 4JCVE 1HR0Q 3S17B 1KD1C 2DJGC 4LK1C 1EYAA 4OHJA 1E7ZA 3BDCA 3C1FA 2MO1A 5C3EH 4YWMA 2AMCB 4DV1Q 1STHA 2PYKA 1SLJA 2K33A 1WD1A 3CMAA 4DNRB 5CV7A 1AZQA 3STBC 2A5HA 3NTKA 1EL0A 3S17H 4JOIA 2Y0SE 4DNTB 4QY7A 4LF5Q 4C3IB 3KF6A 4B3SQ 1KDAA 1ET9A 5A35A 1WTHA 4IO9A 4OO1G 2L1BA 4A4IA 4RHSA 2K50A 5JEAJ 2EY1A 2DNCA 2YYZA 3IRBA 3G48A 1IKMA 1QVCA 1G6ZA 4IN3A 5IP7G 1UAPA 4DUYQ 1GUWA 1I4RA 1VF5C 1GHJA 1SYCA 3L2PA 1H9SA 1NBWA 3S2DB 3KYHC 5M5YH 2EY5A 4A3EB 4R4CA 2Z6KC 1B3AA 3S1QH 2XTIA 3CCRA 2PZUA 1UEAB 3J81L 3T16A 4DKAC 1PLFA 4KTAA 5EGTA 3OOCA 4CJ2C 1LYLA 1LT6D 3HOUB 2WB1G 3T1YQ 4A3MG 1CSPA 2R61A 4KHVA 4ZYSA 1PH3A 4FNFA 2KVMA 4FP5D 4X65L 2WAQG 1GXDC 1SNPA 4HIDA 3GTPB 3T51B 2MHVA 4IOAA 1ZYRC 4AH6A 3M3YB 2RDFA 3SDZA 1CM9A 2HIVA 3A56A 1NJIC 5IYDH 2R7FA 5C44H 1SFOH 3CQZH 3PSIA 1EQQA 2D2CC 4B3SL 2KHIA 3MXUA 2E2HH 1BUVT 5KRUA 3IAYA 5LMUL 4YY3Q 1D1KA 1TWFH 3WOFA 5ELNA 5IP9G 1NCVA 5EKIA 3BG3A 4LF7Q 3Q8DA 1LUZA 1EQVA 1U4RA 1ZYRD 1GM5A 4BBRG 2A6HD 3HKSA 1XYIA 2Q2UA 2JA7B 3F2CA 1YNXA 1WYDA 1X56A 5A2QL 3NENA 4A3IB 3FPUB 4KKUA 1VMPA 3J81E 2X6GA 2JEBI 1KLUD 4RHRA 5JEAG 4J15A 2CHBD 1OXVA 5IIFA 3Q6SA 3F8TA 3CCSA 2FMMA 5IYCH 4A93G 1LTLA 3BVZA 3H3VC 1K8AC 4QIWE 3EJIA 1A15A 3U50C 3HKZB 3OIQA 3HOWG 1BO0A 1VQBA 1X32A 4A3LH 4KI0A 1AH9A 1TWGH 4P73A 3WOEA 3EIVA 4YHHQ 1SRUA 3AMUA 5FO9B 1S4ZA 1VS0A 2B2YA 1YEZA 1MSHA 4OEMB 1TS5A 4ZCKA 1O80A 1M90C 4XYQA 4JI8Q 1H9KA 4NXNQ 3I91A 1IYVA 2FINB 4P72A 3TZUA 5M3MH 3A5UA 3DM1A 2F3IA 4APVA 2Z4IA 3FKIG 4JI0L 5AJ3Q 1SYBA 3HOZB 3TEHB 1VDZA 1S72A 4GLAC 3M4PA 3IFDA 1D2BA 4BBRH 1LT4D 2EYJA 3MXPA 1Q7YC 2XNAC 4BY7H 1TWCB 1GJXA 3S15H 2E2JB 5GAEC 3T13A 2E2IH 2JA8B 2KCMA 1WJJA 2YTYA 1JE5A 3MFGA 2NTTA 3A8JE 3BZKA 1XTCD 1U4LA 3RLNA 4MZ9A 1LTBD 2OTLA 1N32Q 1J8IA 1IHZA 5T1GA 1UEBA 1M8AA 5M3FH 1U0LA 3UDGA 2F0GA 4E6IA 4L5SA 3PV0A 5KYIA 3BZCA 4DV7Q 1PH9A 3RZDH 4BA2I 4A3CG 4NPSA 3KFUA 1O7ZA 2E5LL 1SNOA 5M5WH 5LMUQ 1XMQL 3BU2A 4HTHA 1EQRA 2UXCL 3VR4A 3LGJA 1Q8KA 1FNVA 1F9PA 2PMZB 5CBEE 3C3LA 1YVCA 3J81c 5JAVA 1CK1A 1PYWD 1UE5A 2ID0A 4QUCA 1RIPA 3L7ZC 2K5VA 1CA5A 4KJOA 2R92B 1S5DD 2I0QA 1D7QA 1K9MC 2BA0A 4CKBA 4EX5A 4FXKC 1A2TA 1F9RA 3PUZA 1QOHA 1Q82C 1QJOA 2NZ1D 4J8QA 1NMFA 2RF4A 5CV5A 3NBIA 1Z7TA 1MSGA 1BOSA 1EZ6A 3R8BA 1WTQA 1YJWA 1SNQA 4X3TA 4GZYC 5HURA 2K14A 4LF6Q 3K0XA 4AIMA 5E3FA 1KRTA 2PO4A 3AYHB 1VQIA 4XT1B 3CCLA 1EIHA 1VF7A 1XMQQ 1SYEA 1RKNA 1AN8A 4YCWA 2JA9A 1D5MC 4LF4Q 2EYPA 4LFBL 3CXCA 1N8RC 3KF8A 2SOBA 4IUNA 2AUJD 2K32A 2IHFA 4FVMA 4FF4A 3IKJA 1U4MA 4KN4C 1JJCB 4ZQ3A 4RGMA 2R93G 2QDLA 4DV2Q 3M3YH 3DMUA 1Q46A 4JI4L 4LUZA 4K0KQ 3NQTA 4LF8Q 1STEA 2A8VA 1ENCA 4DA2A 4XYOA 4PZ8A 2UUBQ 2CWAA 1GUSA 2B2VC 1YI2A 4A3BB 4DV6Q 1EQTA 1H9MA 2GN5A 3P7JA 3G6EA 1GO3E 4X64L 4XIGS 1HR0L 4AQYL 2VNUD 3PIPA 1A3UA 1Q3LA 1HNWL 5D65A 2K52A 1PZKD 1W3SA 3CPFA 3NELA 4R9WA 3CKIB 2E75C 2V4DA 4MHEA 2VZAA 4A3FH 1JCKB 2R3ZA 3I73A 2M9VA 1X65A 2F0DA 3VA7A 1XWEA 1NR4A 1VQFA 1I6VC 1C9OA 4EVOA 3TQYA 5JPMC 3A0JA 5IP9H 2XRSD 4JV5Q 4DR7Q 1NE3A 2Z6KA 3U9SA 4CBVA 4LFBQ 2D0OA 3HOUG 1Y1VH 2UU9L 2A1AA 1K83B 1BBUA 3SE0A 4KHZA 3RZDB 4IJHA 1L0WA 2EXZA 1SE8A 1HA6A 4B3TQ 4WORA 2KUMA 3K7UC 3GO5A 1HUMA 1SBBB 3BJUA 3OW2A 5J22A 1VQ7A 1KDBA 4JI2Q 3JAML 3SK6A 1HQRD 1TWAB 2OXPA 1HTLD 2EZVA 5IYCG 1JWSD 4YCUA 4OIKA 2D9UA 1B8AA 1I4QA 3K80C 2N55A 3RD4A 4ALPA 2DUDA 1JE4A 5EKLA 3VYSA 3WDNA 3VYRA 3J80L 1G291 2KHJA 5CV6A 1DGSA 2KENA 3NSWA 2VQEQ 2HT1A 1EYCA 5JVH3 3MA2B 2QGQA 2R92G 5BR8Q 1PRTC 3GTGB 2RA4A 2UU9Q 1B7YB 4A3EG 1GD7A 4FXGC 1JORA 1HFGA 4PMBA 3E9IA 1HA5A 2H5XA 4LUOA 3GV6A 4UP7A 3TDQA 2K05A 1TKWB 1VQCA 2B8GA 2CKZB 1PYSB 3M85A 4ULLA 3EQLC 2A68D 3OPOA 4HN7A 4XT3B 1V8QA 2CH4A 4A3GB 3KLSA 3R3OA 1MJEA 1J5EL 1CKNA 4RWSC 3QB3A 2C35B 2IX0A 5IGBA 2F0QA 1N32L 1Y1WB 3P1HA 4G57A 4R8IA 1WCMH 3A8KE 2WAQE 4A3JB 1A0IA 4A3DG 1QWYA 3EN2A 1TS3A 1C8CA 5DM73 2MNAA 2R93B 2EOTA 4DR1Q 1Y1VG 1TWGB 2L55A 3HOVG 5C4XG 1BCPB 1AFPA
chains in the Genus database with same CATH topology
2RSOA 1B44D 2WKDA 3AU7A 5C0XJ 4WFN3 3T56B 5KNBA 5LL6X 1SNCA 3H94A 4O1NA 4A3KB 1I4HA 1F9SA 1Y8OB 1I50B 2JXMB 3X3MA 1Y8PB 4K6DA 1I4GA 2WKCA 3DUZA 5ELEA 1EY8A 5CV4A 2E2IB 3PO2B 2XRQD 4BY7B 1LTID 2C5CA 1CQFA 4B08A 2IJ0A 1CI3M 5EBDA 1OO9B 3GTQB 2F0PA 3DWPA 1ZKOA 1V1PB 3NE5B 1WVLA 3S9WA 2K5WA 4ZUIA 1S5CD 5CR3A 4A3DB 3A8IE 1DD2A 2F03A 4L63B 4S3SA 5JEAH 1I4PA 2AQ1B 2LY7A 1B9MA 3MWYW 4F87A 3K5MA 1F2YA 3Q22A 2DY8A 2NVTB 3SEBA 1WD0A 2BOSA 3S1QB 5M5XB 2OF1A 1SEBD 2O2LD 2B2WA 2A6EC 4PNYA 4A3MB 1LTGD 2X6LA 2FHTA 5EPKA 2DY7A 2VB2X 1CFMA 1PMRA 1T5EA 4RCNA 1TY2A 3HOVB 2L9HA 2F0HA 1TWHB 2OEOA 5CORA 3MC0B 4UDUC 1X3PA 5CMDA 1PFBA 1G91A 4RCOA 3K5NA 4ID6A 1M4VA 1FYCA 2BE5C 1B4OA 1ESFA 5C0XH 4K5WA 1LABA 4KD3A 2OT2A 1TQOA 1JQYD 2A73B 5K36G 1BDOA 4PMWA 2KEEA 3EA6A 1DYQA 2KOLA 4L8JA 4ZLTF 5IT9E 2B2YC 4V0BA 4RAUC 2HDMA 3U9OA 5A2QE 2NYZD 1PDQA 2NN6H 3FRPB 1R4PB 3GD7A 3SK5A 1ONLA 1LO5D 1C48A 2B2WC 4WJWA 5I9OA 4TRDA 3D4RA 5CYUA 2KECA 4J6HA 1DONA 3HRZC 4DFAA 2PPBC 5J39A 1EZ8A 4QCLA 1ZEQX 2SNSA 2WB1B 3K58A 3OIPA 2K28A 3BS1A 1B2TA 2DN8A 4KMUC 1G8ZD 2I07B 1TS2A 1O78A 1GUTA 2M00A 3BVMA 3PMFA 3QOLA 2QEJC 4ZUJA 2R6GA 5KIXA 5KNDA 1SMYD 1D1IA 5BN3A 1AZPA 4L6TB 3NWSA 4O42A 3J7YW 1F2MA 2KEDA 1SYGA 3AB9A 3I4MB 2B63B 5CV8A 2PZWA 4DN4M 3I8ZA 4XTCS 2K7VA 1OXXK 1BR9A 1SE4A 4NMZA 1AP0A 1FNWA 2F0SA 2HDLA 2WINB 3FMCA 4F8MA 1R9TB 1F2LA 2BA1A 4ZKBB 2ZXRA 1EU4A 5I6YA 3TMEA 1Q1EA 1DM0B 1C4QA 4C3JG 5C4JB 1EY0A 3VR6A 2Y0SB 2C9OA 2D62A 1H9SB 4ZAIA 2PW7A 4N9PA 1RTOA 4LAAA 3LWUA 5K36H 2HCCA 2IPKD 3HOXB 3PUYA 4K8IA 2JEAI 1HFNA 2B2TA 3VR5A 5LL6S 1O7LA 1EU3A 2Q8RE 5D3DA 2NTSA 1IW7C 3NPPA 5I9PA 1PRTF 5JOBA 2K5QA 1ML0D 2LMCB 4A93B 2ENBA 4OGQC 2YU9B 3E6ZX 1B9NA 1PTOH 4EQOA 5C4XB 4IURA 2A69D 3NTHA 5KGUA 4BY1B 5DAUA 2L11A 3QO2A 1BBXC 3S16B 1TS4A 5C3XA 1FD7D 5EPJA 3NK9A 1LTTD 3EROA 3A7AB 2KA7A 2EYHA 3CRKC 3K6OA 3QJYA 1VCIA 1JOOA 1Y8NB 1S5BD 1G2TA 2F4IA 4B9WA 1W6KA 1OXSC 2Z1CA 1ESRA 2ZXOA 3GTJB 1DCZA 1JOKA 2LFNA 3H91A 1B53A 3VYUA 3TP8A 5FLXL 3D6WA 2EVBA 2B2TC 5ELDA 3MFYA 5FKAC 1RTNA 1IL8A 3F2UA 5KYLA 3BYTB 5IODA 3BDLA 2QILA 4FO2A 2MPMA 3DWAA 3VA5A 1L0YB 1ILQA 1I3QB 1STBA 2EYOA 2CVRA 4I65A 1QG7A 3ONAB 5C5MA 1OXTA 2K6AA 1TY0A 4DAVA 1KLGD 2A6ED 2AWNA 1GUOA 5CV9A 1PRTB 4BBRB 2NUCA 1VMCA 2A69C 5FO8B 2MGSA 3H09A 1JC7A 5EBCA 1D5ZC 5F2DA 4KKTA 2TSSA 1PTOF 3IFTA 2FJ2A 4DK0A 4LJZC 2PQEA 2K03A 1LLRD 2B2VA 3V05A 2L5TA 2L4NA 4HMIA 1F9QA 3MXNA 2CQAA 5HGTA 3RMHA 1KABA 2JYOA 5NUCA 3TZDA 2NVXB 3BDOA 2K04A 4I7ZC 1WTVA 1PXUA 5CGKA 3R2TA 2AQ3B 3M7NA 1RHPA 2AUKA 1G2SA 2CW0D 4H13C 5IOCA 4CJ0B 1EY9A 3DEPA 3HGBA 1JWUD 1TR5A 4ILWA 4CGYB 2ZT9C 2WACA 5IGDA 5EQ0A 2B2UA 4KJNA 1CA6A 3QOJA 3R2IA 4C3IG 2EYMA 4BS9A 2BDNA 1GUGA 3NP8A 1BF4A 3MVVA 4RA8A 2KCNA 3L9AX 3J80E 3FEWX 2L12A 1WTPA 1XXGA 2JE6I 3J7AF 2E74C 1WTOA 3ERQA 1SMYC 2AQ2B 4IALA 3QG1A 1SE2A 1V1PA 4KY7A 2EYFA 3S15B 4H7BA 4X3SA 1V43A 4EQNA 2F0KA 1U4PA 1CT1D 4HCEA 4RKLA 2H1EA 3TSSA 3BYYB 3DWQA 3I70A 5G3LD 5KEEA 4IUQA 4OO1I 5C4HA 1S5FD 1IKLA 2E2DC 2XN9C 3T4AC 3HP3A 4RGNA 1Q8IA 5C5LA 4ZRZA 4NKLA 4ZK9B 4IUTA 2IX1A 4C3HG 5M3MB 4DGZA 4HEDA 1SDFA 2RQXA 1DOKA 3QIAA 5M9OA 4FYDA 4IFDI 3K5OA 4IUPA 5EKKA 3L3OC 5ELFA 1SAPA 2QCPX 3I4NB 1SNDA 4PV1C 1K8OA 2RKSA 3GTMB 2F0UA 1HTPA 1TWFB 1PTOD 2ICIA 3C2PA 3D8GA 2ZXPA 3C1EA 4BA1I 4LMQD 3Q23A 3MZ5A 3S1MB 1BNZA 2HQEA 4C1NI 5TSSA 1YNND 1J9OA 2A74C 2EJFC 2MJ8A 2RDGA 3M7GA 3D3RA 4ZKCB 1SXTA 2JA6B 3K7AB 3H6MA 3RUZA 1ENFA 1EEID 1L0XB 1JICA 3SVMA 3KK7A 5M5YB 1TVXA 1ICWA 1KTKA 1SNMA 3NHHA 2XWBB 2K01A 1BXTA 2B2UC 2F0LA 1Z47A 1NSNS 1D5XC 4WRDA 2QKIC 4XQNA 4C3HB 4KY6A 3SXHA 1E2VA 1DJRD 2EE1A 3NTIA 2XIWA 1QCBD 4HAEA 2LKVA 1DZ1A 1U9RA 1RODA 1Z6HA 1GHKA 4BWGB 3VR2A 1CHQD 3RLFA 2Z4HA 3N52A 4K5XA 3ZYYX 1PFMA 2M2LA 4M1UB 2EPBA 5IGCA 2NWGA 5D14A 3PIO3 4KY5A 2MUYA 3VR3A 2RVLA 1STNA 5C0XI 5C3EB 2B8FA 1QE6A 4C56C 1R4QB 4P2CB 4K6LA 2IW3A 1KDCA 2RSNA 3A55A 1YNJD 3NQIA 4DXGA 4EQPA 5E1FA 3OMCA 4HSPA 1B50A 1A2UA 1AEXA 2N88A 4G7HC 4PMCA 3HG9A 1PTOB 1S5ED 2NB0A 1EFID 3KUPA 4HSVA 1DXMA 1CQVA 3K0YA 3TP6A 5BN4A 2I46A 2BE5D 1E0BA 3FVQA 5FO7B 3K5LA 1FNUA 3DXJC 2X69A 3N6RA 2J0TD 3I72A 1AW7A 2QDBA 4K5VA 1SFOB 3EFXD 4H44C 1PTOC 4M8AA 5M5WB 4ABNA 1RD9D 1Q1BA 1BCPD 3I4LA 5C6AA 4IFDH 2EYLA 5EJWA 5I2XA 5ISRA 1GOZA 1Y69U 1BCPF 2F0JA 1KNAA 4TKOB 1Q12A 4F7XA 2F1MA 4RGOS 4NDXA 4IQZA 3NBHA 4MIUA 2L0CA 1LT3D 4DF7A 1SJHD 2F0WA 4IZ8A 3FKIB 1UNSA 1HUNA 3S1RB 1A3VA 4X3KA 3HZXA 1TT2A 3SR1A 1JWMD 4BBSB 3I90A 1E2ZA 1SYFA 2NN6G 4RFBA 3MTSA 4K2KA 1EYDA 4NW2A 2F0OA 3RZOB 1QNUA 2F0VA 3NXWA 4XDXA 3HOWB 1EIGA 4CJ1B 5KNCA 3MEHA 3CU7A 5DNFA 4G4KA 3H0GB 2IWHA 3S14B 3SK4A 1CTMA 1IW7D 1NAPA 2JA5B 1EWCA 2EY6A 1D6EC 2NBFA 4Z9CB 4K14A 1LTSD 4XXEA 1TIID 2WAQB 1KNEA 1JB3A 4CKEA 3PUVA 3HEJA 1ILPA 1PFNA 3P75A 4Y7NB 1NUCA 2KJXA 3BVGA 1F77A 2PW5A 2TMPA 1T5XD 4HR7B 1WTWA 3IL8A 2HCIA 2RBMA 1RJTA 5C4ZA 5IGEA 2NN6I 1JOQA 1H9JA 2WP8J 4PQXA 1EY7A 1STYA 3X3NA 4IFDJ 2G9DA 1ZXTA 1W6JA 2VXWA 1RCVD 1IYUA 1STGA 5J1ZA 3GP7A 2A68C 1LACA 4JK1C 2Z8LA 3Q0AA 4B9XA 1DOLA 3NWTA 1SYDA 1EY6A 3OHXC 3K57A 3MHBA 2BCOA 2F0NA 1MBYA 2D5DA 2WIIB 2QF7A 3PUWA 2SEBD 3S2HB 4DAYA 5DEHA 2NVYB 3TP5A 3UI2A 5JVG3 2F3WA 3FPPA 4KK7A 1E2WA 1NR2A 5FK9C 1EWHA 5C3WA 2GA4B 3KLSX 4QB4A 4HMJA 2SNMA 5CBAE 1PZJD 4QMGA 5FLXE 3E5SA 4G7OC 4TQUS 2FFKB 4ME5A 4K2LA 2VUMB 3BZDB 5G3LF 1QB5D 2FMCA 3GQBA 4FF3A 3SHLA 1CZGA 2EJGC 4QIWB 1MD2D 3VYTA 3HOYB 3O13A 3QWNA 2IT1A 4IFDG 1UUPA 3CRLC 3PO3B 3M4YA 3OWEB 1ENAA 3DHQA 3DEOA 2BDOA 3HS0C 4H0LC 1WTRA 4A3FB 5C0XG 2EJMA 1MGSA 3KLRA 2KCCA 3MXGA 3CHBD 3W3AA 4DK1A 2Q8TA 3GTKB 5ELBA 1QILA 1SSOA 3W2DA 4C1NK 3G7LA 1SE3A 5BN5A 3GTLB 3NUCA 2O5JC 2F0EA 4KD4A 3MAQA 2A6HC 1A3TA 5EPLA 5E4WC 1RF2D 3JAME 3GTOB 2XSCA 3URYA 4MN3A 1LV9A 4FXDA 4EGVA 1II3A 3E0JA 2PCFB 1I6HB 3LX0A 2KHSA 2O4XA 1STAA 2XVSA 5K5PA 1PRTD 5COYA 3R93A 4C2MB 1HRJA 3ND8A 3M4OB 1MI2A 1I4XA 2LS01 1YNNC 4NP5A 3TBIB 5JPNC 1X3QA 4TSSA 2XWJB 4XQQA 3V2TA 1HPCA 4X3UA 2HUGA 4UAIA 1BQQT 1WCMB 4Q5VA 3ITPA 2NVQB 1OXUA 1HHVA 2F0FA 2F0MA 1XX8A 3G6JB 3LWEA 5LHY1 4IUVA 5M3FB 5T1IA 2E76C 4DAPA 5I6WA 2J7ZA 2CW0C 5ELCA 4OIJA 3CQZB 4OO1H 3D6CA 3TP7A 3TN2A 1YNJC 3KBGA 4DXFA 3PUXA 4Q0FA 3OSOA 4KKSA 1BCPC 4K8JA 1TU2B 1ET6A 2EDGA 2G9HD 2H4OA 2K1BA 3ND9A 5E4XA 4QF4A 3D31A 4KV6A 3FDTA 5DM63 4G7ZC 2DNEA 1HQMC 5FOBB 1WTXA 4ODGA 1A6XA 3OW7A 4U68A 2VB3X 1V1OA 1DOMA 4XQJA 3OMGA 2MP1A 3P20A 4DU9A 2F0TA 3S1NB 2R7ZB 3GV3A 1B1ZA 2F0IA 5C44B 4C3JB 1F2ZA 2O5IC 2JSOA 2IX3A 1LT5D 5AFWA 4U673 5CC4A 1EY4A 4CHTB 3I3CA 1FR3A 5I4DA 5JJZA 4QUFA 3A54A 2IL8A 3Q24A 2F3VA 2ICEC 2SDFA 4JBWA 4RGTA 1QNKA 1GUNA 1CZWA 2EY2A 2KQ3A 2RDHA 4FF2A 3T53B 1Q90A 1EOTA 4HCSA 1H9RA 1EEFD 3A7LA 1CHPD 1O7YA 2J4XA 1LTAD 3V96A 2PZTA 2WV6D 5D3IB 4FF1A 1JR0D 3OWFA 4KN7C 1KAAA 5I2YA 4V190 2AWOA 3EVQA 4J1MA 3PIP3 2E2HB 1K8MA 2B39A 4AYBB 3SK8A 3KBXA 3D4DA 4RH6A 4F88A 3C46A 5IT9L 1HCZA 2Q8IB 4OL7A 4IUUA 1EY5A 1PZID 5IGGA 2PNRC 3LNNA 1FGBD 4YIJA 2K5DA 3J7AV 4CKCA 2JP1A 1RDPD 4R8NA 1LTRD 3K59A 3D4WA 4N9TA 5IGFA 4RKBA 1HXYD 1Y1VB 1SJED 3S17B 4LK1C 1EYAA 4OHJA 3BDCA 3C1FA 1STHA 2PYKA 2K33A 1WD1A 4DNRB 5CV7A 1AZQA 2A5HA 3NTKA 1EL0A 4DNTB 4C3IB 1KDAA 1ET9A 5A35A 4OO1G 2L1BA 4RHSA 5JEAJ 2EY1A 2DNCA 2YYZA 1IKMA 1G6ZA 4IN3A 1UAPA 1GUWA 1I4RA 1VF5C 1GHJA 1SYCA 1H9SA 3S2DB 2EY5A 4A3EB 1B3AA 2PZUA 1UEAB 3J81L 3T16A 1PLFA 4KTAA 5EGTA 3OOCA 4CJ2C 1LT6D 3HOUB 2R61A 4KHVA 4ZYSA 4FNFA 2KVMA 4FP5D 1GXDC 1SNPA 3GTPB 3T51B 2MHVA 1ZYRC 3M3YB 2RDFA 3SDZA 1CM9A 3A56A 2D2CC 3MXUA 1BUVT 5KRUA 3IAYA 1D1KA 3WOFA 1NCVA 5EKIA 3BG3A 1EQVA 1U4RA 1ZYRD 2A6HD 1XYIA 2JA7B 4A3IB 5A2QL 3FPUB 4KKUA 1VMPA 3J81E 2X6GA 2JEBI 1KLUD 4RHRA 5JEAG 2CHBD 1OXVA 5IIFA 3Q6SA 2FMMA 3BVZA 3H3VC 3EJIA 1A15A 3HKZB 3OIQA 1BO0A 1X32A 4KI0A 3WOEA 3AMUA 5FO9B 1S4ZA 2B2YA 1MSHA 1TS5A 1O80A 4XYQA 1H9KA 3I91A 1IYVA 2FINB 3TZUA 3DM1A 2Z4IA 1SYBA 3HOZB 1VDZA 3IFDA 1D2BA 1LT4D 2EYJA 3MXPA 2XNAC 1TWCB 1GJXA 2E2JB 3T13A 2JA8B 3MFGA 2NTTA 3A8JE 1XTCD 1U4LA 1LTBD 1J8IA 1IHZA 5T1GA 1M8AA 2F0GA 4E6IA 3PV0A 5KYIA 4BA2I 1O7ZA 1SNOA 4HTHA 3VR4A 1FNVA 1F9PA 2PMZB 5CBEE 3C3LA 5JAVA 1CK1A 1PYWD 2ID0A 4QUCA 3L7ZC 1CA5A 4KJOA 2R92B 1S5DD 2BA0A 4CKBA 4FXKC 1A2TA 1F9RA 3PUZA 1QOHA 1QJOA 2NZ1D 4J8QA 5CV5A 3NBIA 1Z7TA 1MSGA 1BOSA 1EZ6A 3R8BA 1WTQA 1SNQA 4X3TA 4GZYC 5HURA 5E3FA 2PO4A 4XT1B 1EIHA 1VF7A 1SYEA 1RKNA 1AN8A 1D5MC 2EYPA 3KF8A 2SOBA 4IUNA 2AUJD 2K32A 4FVMA 4FF4A 3IKJA 1U4MA 4KN4C 4ZQ3A 4RGMA 3DMUA 3NQTA 1STEA 1ENCA 4DA2A 4XYOA 1GUSA 2B2VC 4A3BB 1EQTA 1H9MA 3P7JA 4XIGS 2VNUD 1A3UA 1Q3LA 5D65A 1PZKD 4R9WA 3CKIB 2E75C 2V4DA 4MHEA 1JCKB 2R3ZA 3I73A 2M9VA 2F0DA 3VA7A 1XWEA 1NR4A 1I6VC 4EVOA 5JPMC 2XRSD 3U9SA 4CBVA 3RZDB 1K83B 3SE0A 4KHZA 2EXZA 1HA6A 4WORA 2KUMA 3GO5A 1HUMA 1SBBB 5J22A 1KDBA 3JAML 3SK6A 1HQRD 1TWAB 2OXPA 1HTLD 2EZVA 1JWSD 4OIKA 2D9UA 1I4QA 2N55A 3RD4A 1JE4A 5EKLA 3VYSA 3WDNA 3VYRA 3J80L 1G291 5CV6A 3NSWA 1EYCA 5JVH3 3MA2B 1PRTC 3GTGB 2RA4A 1JORA 4FXGC 1HFGA 4PMBA 1HA5A 3GV6A 3TDQA 1TKWB 2K05A 2B8GA 3M85A 4ULLA 3EQLC 2A68D 3OPOA 4HN7A 4XT3B 1V8QA 4A3GB 3KLSA 3R3OA 4RWSC 3QB3A 2IX0A 5IGBA 2F0QA 1Y1WB 3P1HA 4G57A 4R8IA 3A8KE 4A3JB 1QWYA 1TS3A 1C8CA 5DM73 2R93B 2EOTA 1TWGB 2L55A 1AFPA 1BCPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOM A;  5EKI A;  4X3S A;  2RSO A;  1AZP A;  2L9H A;  1F9P A;  5CBE E;  1U4R A;  4O42 A;  5COR A;  5DNF A;  2MP1 A;  5CBA E;  3KUP A;  2FJ2 A;  4HSV A;  2KED A;  4QUC A;  1U4P A;  5COY A;  1XYI A;  1X3P A;  1HA6 A;  1JIC A;  5CMD A;  3R93 A;  1PFB A;  2KUM A;  2K03 A;  3GV3 A;  1CA5 A;  3SVM A;  2H1E A;  1G91 A;  1F9S A;  1HRJ A;  1NAP A;  1TVX A;  1E0B A;  1HUM A;  3FPU B;  1VMP A;  3I8Z A;  4DN4 M;  1ICW A;  2B2V A;  2X6G A;  1F9R A;  1B4O A;  1MI2 A;  2FFK B;  2L4N A;  1G2T A;  4IUQ A;  2NZ1 D;  1KNE A;  2K01 A;  1AP0 A;  1F9Q A;  2X69 A;  1WD1 A;  3Q6S A;  2B2U C;  4HED A;  1AZQ A;  2FMM A;  1IKL A;  1MSG A;  2HDL A;  5AFW A;  2JYO A;  1EL0 A;  1ILP A;  1WTQ A;  1A15 A;  4OIK A;  1PFN A;  1F2L A;  2D9U A;  1X3Q A;  4X3T A;  3HP3 A;  2N55 A;  3TZD A;  3I3C A;  1ESR A;  4ZKB B;  1BO0 A;  1X32 A;  2K04 A;  5JJZ A;  1JE4 A;  2L1B A;  4QUF A;  4ZK9 B;  1WTV A;  4IUT A;  2KEE A;  4XT1 B;  4X3U A;  2HUG A;  4UAI A;  1EIH A;  2IL8 A;  3H91 A;  1RHP A;  1WTW A;  3IL8 A;  2EE1 A;  2HCI A;  1SDF A;  1B53 A;  1RJT A;  1S4Z A;  2KOL A;  2XIW A;  2B2Y A;  4HAE A;  1G2S A;  4ZLT F;  1HHV A;  1IKM A;  1DZ1 A;  1G6Z A;  1DOK A;  5EJW A;  2SDF A;  4CJ0 B;  2B2Y C;  3DEP A;  1MSH A;  4RAU C;  3DEO A;  1QNK A;  1GUW A;  1ROD A;  2HDM A;  4ZAI A;  1WVL A;  1XX8 A;  1O80 A;  3D6W A;  1WTR A;  1MGS A;  1KNA A;  2B2T C;  2RA4 A;  3LWE A;  2NYZ D;  1PDQ A;  1HFG A;  1RTN A;  3I91 A;  4IUV A;  4IUP A;  2FIN B;  1RTO A;  1U4M A;  1IL8 A;  3F2U A;  1B3A A;  1ZXT A;  2HCC A;  1EOT A;  3DM1 A;  3GV6 A;  4HCS A;  2VXW A;  5EQ0 A;  5T1I A;  2B2U A;  3N52 A;  2Q8T A;  1SAP A;  1O7Y A;  2K05 A;  1PFM A;  2M2L A;  1SSO A;  1CA6 A;  1HFN A;  2J7Z A;  2B2T A;  1PLF A;  3IFD A;  4OIJ A;  2EPB A;  2N88 A;  3G7L A;  2BDN A;  2B2V C;  2NWG A;  2Q8R E;  3MWY W;  3TN2 A;  4CJ2 C;  1DOL A;  2MPM A;  2DY8 A;  2B2W C;  4CJ1 B;  4XT3 B;  5D14 A;  1EQT A;  1HUN A;  1WD0 A;  1ILQ A;  3P7J A;  2CVR A;  4X3K A;  5EPL A;  4RWS C;  5E4W C;  1BF4 A;  1QG7 A;  2KEC A;  3ONA B;  2RVL A;  1DON A;  4RA8 A;  2KVM A;  1U4L A;  1ML0 D;  1QE6 A;  4LMQ D;  4R8I A;  3KBX A;  1Q3L A;  2K1B A;  3I90 A;  5D65 A;  5T1G A;  1J8I A;  5E4X A;  2B2W A;  4MN3 A;  1M8A A;  2K28 A;  2L12 A;  1WTP A;  3MTS A;  1B2T A;  4R9W A;  1LV9 A;  2RSN A;  3FDT A;  1WTO A;  1BNZ A;  4NW2 A;  1CM9 A;  4IUR A;  4IUU A;  4MHE A;  3UI2 A;  1C8C A;  1J9O A;  1O7Z A;  2R3Z A;  1VMC A;  2L11 A;  2FHT A;  2X6L A;  5EPK A;  1NR2 A;  2DY7 A;  2EOT A;  3QO2 A;  1WTX A;  1BBX C;  1B50 A;  4XDX A;  2MJ8 A;  1NR4 A;  4ZKC B;  4U68 A;  1EIG A;  2JP1 A;  5EPJ A;  2MGS A;  1NCV A; 
#chains in the Genus database with same CATH topology
 2CWP A;  2RSO A;  1B44 D;  2WKD A;  1IBM Q;  3HKZ E;  3AU7 A;  5C0X J;  4WFN 3;  3T56 B;  5KNB A;  5LL6 X;  3UE0 A;  1SNC A;  3H94 A;  4O1N A;  4A3E H;  4A3K B;  1I4H A;  1F9S A;  1HR0 W;  3ULP A;  1Y8O B;  1I50 B;  2WB1 E;  3CCQ A;  2JXM B;  3X3M A;  1Y8P B;  4ME3 A;  1K3B C;  4K6D A;  1I4G A;  2WKC A;  4NXM L;  3DUZ A;  3HOX G;  5ELE A;  3KDF A;  1EY8 A;  1Y1W G;  5CV4 A;  2E2I B;  3PO2 B;  2XRQ D;  4BY7 B;  1LTI D;  1CKM A;  4A3G G;  2C5C A;  1CQF A;  4B08 A;  3H3V I;  2IJ0 A;  1CI3 M;  5EBD A;  1OO9 B;  3GTQ B;  3L0O A;  4GOP A;  2F0P A;  4QL5 A;  3DWP A;  4IPC A;  1ZKO A;  4A3I G;  1V1P B;  3KF8 B;  3NE5 B;  3KJO A;  1WVL A;  3S9W A;  1VQ9 A;  4YY3 L;  2JA7 G;  2K5W A;  4ZUI A;  3GTL H;  1S5C D;  5CR3 A;  4A3D B;  3A8I E;  5JJL A;  1DD2 A;  1O7I A;  2F03 A;  4L63 B;  4S3S A;  4DR4 Q;  5JEA H;  1I4P A;  2AQ1 B;  1PH5 A;  2LY7 A;  1B9M A;  4JVZ A;  1L1O C;  4JI5 Q;  3MWY W;  4F87 A;  3K5M A;  1F2Y A;  3Q22 A;  2DY8 A;  2NVT B;  3J7A 5;  4DV1 L;  3SEB A;  1WD0 A;  1NY4 A;  2B63 G;  2BOS A;  4O2D A;  3UE1 A;  3S1Q B;  5M5X B;  2OF1 A;  1SEB D;  1FVI A;  2K75 A;  1E1T A;  2O2L D;  1CSQ A;  2B2W A;  2A6E C;  2NVT H;  4PNY A;  4A3M B;  1S40 A;  1LTG D;  4YCV A;  4DV4 L;  1NMG A;  5C44 G;  2X6L A;  4GN4 B;  2FHT A;  5EPK A;  2DY7 A;  2VB2 X;  2JA7 H;  1EIF A;  4C3H H;  1CFM A;  1PMR A;  1T5E A;  4RCN A;  1TY2 A;  3HOV B;  2L9H A;  2F0H A;  3UDI A;  1TWH B;  1E3P A;  2OEO A;  4JI8 L;  5COR A;  1PV4 A;  3MC0 B;  2N3S A;  4UDU C;  3KLW A;  1X3P A;  3RR5 A;  3S1R H;  5CMD A;  1PFB A;  4JI5 L;  1G91 A;  5DLQ E;  4RCO A;  1QZG A;  3K5N A;  4ID6 A;  1M4V A;  1FYC A;  2BE5 C;  1B4O A;  4BXX H;  1ESF A;  4GKJ L;  3HOX H;  5C0X H;  5IY0 A;  4K5W A;  4JI4 Q;  1LAB A;  1UE7 A;  4KD3 A;  2OT2 A;  3A5Z B;  1TQO A;  3RLO A;  1JQY D;  3B6Y A;  2UUA Q;  2A73 B;  4JPB W;  5K36 G;  1BDO A;  3ULJ A;  4PMW A;  2KEE A;  4LWC A;  3EA6 A;  1DYQ A;  4X62 Q;  2KOL A;  4L8J A;  4ZLT F;  5IT9 E;  2B2Y C;  4V0B A;  4RAU C;  2UXD L;  4X62 L;  2HDM A;  1YJN A;  3U9O A;  4LFC Q;  5A2Q E;  2NYZ D;  1PDQ A;  2NN6 H;  4LF7 L;  5FJ8 H;  3FRP B;  3TS0 A;  1R4P B;  3GD7 A;  3SK5 A;  1ONL A;  4UHV A;  4OX9 L;  3F2B A;  4GNX B;  1UE6 A;  1LO5 D;  1C48 A;  2B2W C;  5JJI A;  4WJW A;  5I9O A;  4TRD A;  3D4R A;  4MTN A;  5CYU A;  2KEC A;  4J6H A;  1DON A;  2NZO A;  3HRZ C;  2CH4 W;  4A3J H;  4DFA A;  2PPB C;  5J39 A;  1EZ8 A;  4QCL A;  2ATW A;  1ZEQ X;  2SNS A;  4AQY Q;  1IYJ B;  2WB1 B;  3K58 A;  3OIP A;  4QGU A;  2K28 A;  3BS1 A;  1B2T A;  1A63 A;  4DV6 L;  3GTM H;  2DN8 A;  4KMU C;  1G8Z D;  1RL2 A;  2I07 B;  1TS2 A;  1O78 A;  1EWI A;  1GUT A;  1PH8 A;  1IBL L;  2M00 A;  3BVM A;  3PMF A;  3QOL A;  2QEJ C;  2Y0S G;  4ZUJ A;  2R6G A;  1AE2 A;  5KIX A;  5KND A;  1SMY D;  1D1I A;  5BN3 A;  4YHH L;  4LF9 L;  2I5L X;  1AZP A;  5FLX c;  4L6T B;  3NWS A;  2JA6 H;  4O42 A;  3J7Y W;  3T1H L;  1F2M A;  2KED A;  1YIJ A;  1SYG A;  1E1O A;  3AB9 A;  4HJA A;  3I4M B;  4IPG A;  2B63 B;  5CV8 A;  4DPG A;  2PZW A;  2QEX A;  4DN4 M;  3I8Z A;  4XTC S;  2K7V A;  1OXX K;  3PCO B;  4A3I H;  1KAW A;  1BR9 A;  4PZ6 A;  1HNX L;  2B3G A;  1QVF A;  3MXN B;  1SE4 A;  4NMZ A;  5H1S E;  1XPU A;  1AP0 A;  4PG3 A;  3HOW H;  2NVQ H;  1FNW A;  2F0S A;  2HDL A;  2EIF A;  2WIN B;  3FMC A;  4F8M A;  1R9T B;  1JJ2 A;  1F2L A;  2BA1 A;  2JQO A;  3KF6 B;  4JBK A;  4ZKB B;  2ZXR A;  4MNO A;  2JN4 A;  1PA6 A;  1EU4 A;  5IT9 c;  2A19 A;  3PQI A;  5I6Y A;  4IOC A;  4POF A;  3TME A;  1Q1E A;  4OON A;  1DM0 B;  1KXL A;  1C4Q A;  1GKH A;  4HJ7 A;  2Z0S A;  1IBL Q;  2ZM6 Q;  4C3J G;  4CDF C;  5C4J B;  1EY0 A;  3VR6 A;  2YU9 H;  2Y0S B;  4UPA A;  2C9O A;  2D62 A;  2B29 A;  1H9S B;  4ZAI A;  3CW2 C;  2PW7 A;  4N9P A;  3PO2 G;  1BBW A;  1RTO A;  4LAA A;  3OYY A;  1QZH A;  3LWU A;  5K36 H;  2I5H A;  2NZH A;  2HCC A;  2IPK D;  3HOX B;  1YHA A;  1PH2 A;  3PUY A;  4K8I A;  2JEA I;  1HFN A;  2B2T A;  4DUZ Q;  3VR5 A;  5LL6 S;  1N33 Q;  3RN2 A;  1O7L A;  1EU3 A;  3W5O A;  1EOV A;  2Q8R E;  5D3D A;  1K3R A;  2NTS A;  1VQ4 A;  1IW7 C;  3NPP A;  5I9P A;  1PRT F;  5JOB A;  2R93 H;  1JT8 A;  2K5Q A;  1I50 H;  1ML0 D;  5GAD C;  2QA4 A;  1MIU A;  2LMC B;  4A93 B;  2ENB A;  4OGQ C;  1FL0 A;  4YWL A;  4H02 A;  3I7F A;  1P16 A;  4DV0 L;  2YU9 B;  3E6Z X;  4Y7N H;  2VY3 A;  4A3B H;  1B9N A;  1PTO H;  4EQO A;  1BKB A;  4IUR A;  5C4X B;  2A69 D;  3NTH A;  5KGU A;  4BY1 B;  4DAM A;  4A3M H;  5DAU A;  2L11 A;  3CCM A;  3QO2 A;  1BBX C;  4JYA L;  3S16 B;  1TS4 A;  5C3X A;  1FD7 D;  5EPJ A;  3NK9 A;  1PH7 A;  4GN5 A;  1LTT D;  3ERO A;  4DK6 C;  2ZM6 L;  3A7A B;  1D8L A;  3GTK H;  1VQA A;  2KA7 A;  2K5H A;  2EYH A;  3CRK C;  2G5D A;  3K6O A;  4QJF A;  3NBH B;  3QJY A;  1VQP A;  1VCI A;  1JOO A;  4JBJ A;  4B3M L;  1HZB A;  2MO0 A;  1Y8N B;  1S5B D;  4C2M H;  1G2T A;  2OQ0 A;  2F4I A;  4X66 Q;  4B9W A;  1W6K A;  2NVX H;  3CCV A;  1OXS C;  2Z1C A;  4RMF A;  2RHQ B;  3W1G A;  1ESR A;  1SR3 A;  2ZXO A;  3GTJ B;  5IE8 A;  2ZTC A;  1X3F A;  1DCZ A;  4BBS H;  3GTQ H;  1JOK A;  2LFN A;  2RCF A;  3H91 A;  2ZJQ A;  1B53 A;  3VYU A;  2F4V Q;  3E0E A;  3TP8 A;  5FLX L;  2CQO A;  4L5Q A;  4A3L G;  3D6W A;  2EVB A;  2B2T C;  1WFQ A;  2CFM A;  5ELD A;  4LFA L;  3MFY A;  5FKA C;  1RTN A;  3RZO H;  1IL8 A;  3F2U A;  1LM0 A;  1VQL A;  3DLL A;  5KYL A;  3HOY H;  3M4O H;  3BYT B;  5IOD A;  3BDL A;  2QIL A;  4FO2 A;  3H0G G;  2MPM A;  3DWA A;  3EBE A;  3VA5 A;  1L0Y B;  1ILQ A;  1I3Q B;  1Y14 B;  1STB A;  2EYO A;  1TWC H;  2CVR A;  4I65 A;  1QG7 A;  3A74 A;  3ONA B;  5C5M A;  3FKI H;  3J80 i;  4DR5 Q;  1OXT A;  3QR8 A;  2K6A A;  1TY0 A;  4DAV A;  1KLG D;  2A6E D;  3TS2 A;  2AWN A;  1GUO A;  3U4Z A;  2ZTD A;  5CV9 A;  2Q2T A;  4CDE C;  1PRT B;  1L1O B;  1S3O A;  1G51 A;  4BBR B;  1N9W A;  3FP9 A;  3H3V H;  2NUC A;  3U58 A;  1VMC A;  2A69 C;  3MEF A;  1VQ5 A;  5FO8 B;  2MGS A;  3I56 A;  3H09 A;  1N34 Q;  4JI7 L;  1JC7 A;  5EBC A;  1D5Z C;  5F2D A;  1HZA A;  4KKT A;  2TSS A;  1PTO F;  3IFT A;  2FJ2 A;  2HHH Q;  4PZ7 A;  4A3G H;  4DK0 A;  4LJZ C;  2PQE A;  3E9H A;  2K03 A;  2N78 A;  1LLR D;  2B2V A;  3V05 A;  2R7Z H;  2L5T A;  2L4N A;  4HMI A;  3PO3 G;  1CKO A;  4HJ9 A;  3TRZ A;  1I94 L;  1F9Q A;  3MXN A;  3NEM A;  2CQA A;  2ZJP A;  5HGT A;  1A62 A;  3RMH A;  1KAB A;  2JYO A;  5NUC A;  1YIT A;  4BBS G;  4FDB A;  3TZD A;  2NVX B;  3BDO A;  2K04 A;  4I7Z C;  3S16 H;  2F52 A;  1WTV A;  1PXU A;  4LF8 L;  4JI6 Q;  5CGK A;  3R2T A;  2AQ3 B;  3M7N A;  1NNX A;  1RHP A;  4JOI C;  2AUK A;  1SN8 A;  1EFW A;  1G2S A;  2CW0 D;  4H13 C;  1E22 A;  2FXQ A;  5IOC A;  4CJ0 B;  1EY9 A;  3DEP A;  4GN3 B;  3HGB A;  1JWU D;  2KBN A;  1VQN A;  1TR5 A;  2PQA B;  4ILW A;  4CGY B;  1EIY B;  2JA5 H;  2R92 H;  2YTV A;  4OWW B;  2ZT9 C;  2WAC A;  5IGD A;  1XNR Q;  5IYD G;  3I4O A;  4HIO A;  5EQ0 A;  2B2U A;  4KJN A;  1B3Q A;  1CA6 A;  3PO3 H;  1FJG L;  3QOJ A;  3R2I A;  4C3I G;  2EYM A;  4TVA B;  2BDN A;  4BS9 A;  1PYB A;  1GUG A;  4RG1 A;  4LF4 L;  3NP8 A;  3CF5 A;  4HIK A;  3KDF B;  1EYG A;  3K81 C;  4B3M Q;  1BF4 A;  3MVV A;  4DV5 Q;  4RA8 A;  2JA8 G;  1P8L A;  3DM3 A;  2KCN A;  4EQ5 A;  4X66 L;  1I94 Q;  1YBY A;  3L9A X;  3J80 E;  3FEW X;  2L12 A;  1WTP A;  1XXG A;  2JE6 I;  2K5N A;  3J7A F;  2E74 C;  1WTO A;  2RCN A;  3HOU H;  1NTG A;  2UXB Q;  3ERQ A;  3JC6 6;  1SMY C;  2AQ2 B;  1VQK A;  4JI2 L;  4IPD A;  4IAL A;  3QG1 A;  1XNQ L;  1SE2 A;  1V1P A;  4KY7 A;  2EYF A;  3S15 B;  4H7B A;  3W1B A;  4X3S A;  1V43 A;  1U5K A;  4EQN A;  2Q2I A;  2F0K A;  1U4P A;  1I3Q H;  1IBK L;  1CT1 D;  1EUJ A;  4HCE A;  4RKL A;  4I7A A;  2OTJ A;  2H1E A;  3F1Z A;  5IWA Q;  3TSS A;  1HZ9 A;  3BYY B;  3DWQ A;  3I70 A;  4JI1 Q;  4DR6 L;  1X55 A;  1HNZ L;  5G3L D;  5KEE A;  4IUQ A;  4OO1 I;  5C4H A;  2MFI A;  3E3X A;  4DV3 L;  3H0G H;  3G71 A;  1S5F D;  1IKL A;  2R7Z G;  2E2D C;  1HNZ Q;  2XN9 C;  3T4A C;  2OQK A;  3HP3 A;  4RGN A;  4DR7 L;  1Q8I A;  4WJ4 A;  5C5L A;  4ZRZ A;  3ERS X;  4NKL A;  4ZK9 B;  4DR2 Q;  4IUT A;  2IX1 A;  1VQ6 A;  4C3H G;  5M3M B;  4A76 A;  5IYB H;  1JMC A;  4DGZ A;  1OTC A;  4HED A;  1SDF A;  4WJ3 M;  1MJC A;  3AFQ A;  2RQX A;  1DOK A;  2PNH A;  2VW9 A;  2UUA L;  3QIA A;  4HJ8 A;  5M9O A;  4FYD A;  4IFD I;  3K5O A;  1XMO L;  1Y1W H;  3HKZ G;  4IUP A;  5EKK A;  3GTO H;  3L3O C;  4R1J A;  5ELF A;  3UDF A;  2BH2 A;  2VUM H;  4KHP Q;  1XMO Q;  1PH4 A;  1SAP A;  2QCP X;  3KJP A;  3I4N B;  5HGQ A;  1SND A;  4PV1 C;  1ASZ A;  1K8O A;  2K4K A;  2RKS A;  3K8A A;  3GTM B;  2F0U A;  4P71 A;  1HTP A;  1TWF B;  1PTO D;  2D0P A;  2ICI A;  3C2P A;  4B3T L;  3D8G A;  2ZXP A;  3C1E A;  4BA1 I;  4LMQ D;  5HY6 A;  1Z9F A;  5M5X H;  5GQO A;  5GAG C;  3Q23 A;  3MZ5 A;  3S1M B;  3GTP H;  1BNZ A;  2HQE A;  4C1N I;  5TSS A;  1YNN D;  3VDY A;  3S2D H;  1J9O A;  2ZTE A;  3CCJ A;  1X3E A;  2A74 C;  2NVY H;  3I4M H;  4OWX B;  2EJF C;  2MJ8 A;  4JI6 L;  2RDG A;  3M7G A;  3D3R A;  4ZKC B;  1SXT A;  4A3D H;  2JA6 B;  1IXR A;  3K7A B;  3H6M A;  3M4Q A;  5EAY A;  3RUZ A;  1ENF A;  1EEI D;  1L0X B;  1JIC A;  1K73 C;  3SVM A;  3KK7 A;  5M5Y B;  1TVX A;  1ICW A;  1HJP A;  1KTK A;  5IP7 H;  3HFZ B;  2Z9H A;  4IPH A;  1SNM A;  4DR4 L;  3NHH A;  2XWB B;  2K01 A;  1BXT A;  2LXK A;  2B2U C;  4OX9 Q;  2B63 H;  2F0L A;  4JBM A;  5LMN Q;  1Z47 A;  3U4V A;  4NXM Q;  1NSN S;  1D5X C;  4WRD A;  2QKI C;  4XQN A;  4C3H B;  5M3M G;  4KY6 A;  3SXH A;  1E2V A;  2JJQ A;  1DJR D;  4GOP B;  4X6A H;  2EE1 A;  3NTI A;  2XIW A;  1QCB D;  4HAE A;  2LKV A;  1J6Q A;  1DZ1 A;  1U9R A;  1ROD A;  1Z6H A;  3F2D A;  1GHK A;  4BWG B;  1XJV A;  2PQA A;  3VR2 A;  1HH2 P;  1CHQ D;  3RLF A;  2Z4H A;  1WCM G;  2YV5 A;  3WWV A;  3N52 A;  4K5X A;  3ZYY X;  1PFM A;  2M2L A;  4M1U B;  4GLV B;  2UUC Q;  2EPB A;  5IGC A;  1JJG A;  1MHW C;  2NWG A;  5D14 A;  3S14 H;  3PIO 3;  2RHS B;  4KY5 A;  2MUY A;  3VR3 A;  2RVL A;  1STN A;  5C0X I;  2DJF C;  5C3E B;  1BVS A;  2B8F A;  1QE6 A;  4C56 C;  1R4Q B;  4P2C B;  4DV5 L;  4K6L A;  2IW3 A;  4DAY B;  2IY5 B;  1FGU A;  1KDC A;  3PIO A;  1TWA H;  2RSN A;  3A55 A;  1CUK A;  1YNJ D;  3NQI A;  4A3F G;  4DXG A;  4EQP A;  5E1F A;  3OMC A;  4HSP A;  1B50 A;  1A2U A;  2L15 A;  1AEX A;  2N88 A;  4G7H C;  1K83 H;  1KQS A;  3I4N H;  4PMC A;  3HG9 A;  1PTO B;  5C4X H;  1C7Y A;  2LSS A;  1S5E D;  5ELO A;  2P5Z X;  2NB0 A;  1EFI D;  2JK8 A;  4HSV A;  3KUP A;  4LUV A;  1DXM A;  1CQV A;  3K0Y A;  3TP6 A;  5BN4 A;  2I46 A;  2BE5 D;  5IYB G;  1E0B A;  4LF6 L;  3FVQ A;  5FO7 B;  3K5L A;  1FNU A;  3DXJ C;  2X69 A;  3N6R A;  2J0T D;  3I72 A;  4UP8 A;  1AW7 A;  3OTO Q;  2Q2H A;  5FJ8 G;  2QDB A;  4K5V A;  1SFO B;  3EFX D;  4H44 C;  1PTO C;  4M8A A;  4IJL A;  5M5W B;  4ABN A;  1RD9 D;  1Q1B A;  5L37 A;  1BCP D;  3I4L A;  5C6A A;  2EQS A;  4IFD H;  4DV2 L;  2EYL A;  5EJW A;  5C4J H;  5I2X A;  5ISR A;  1GOZ A;  1Y69 U;  1BCP F;  2F0J A;  1KNA A;  2R7D A;  4TKO B;  1MKH A;  1Q12 A;  4R4T A;  1L2F A;  2F1M A;  4F7X A;  1H95 A;  4RGO S;  1XNR L;  4NDX A;  4IQZ A;  2F4V L;  3NBH A;  4AYB E;  4MIU A;  2L0C A;  1ASY A;  1LT3 D;  4DF7 A;  1SJH D;  2F0W A;  4IZ8 A;  3FKI B;  1UNS A;  1HUN A;  3S1R B;  1A3V A;  4X3K A;  3HZX A;  1TT2 A;  5C3E G;  2UXD Q;  4DK3 C;  3SR1 A;  1JWM D;  4BBS B;  3I90 A;  5FLM H;  1E2Z A;  1SYF A;  2NN6 G;  4RFB A;  3CC4 A;  1VQE A;  3MTS A;  4K2K A;  2HQL A;  1EYD A;  4O0A A;  1YJ9 A;  4NW2 A;  4C3I H;  4GNX C;  1QVG A;  4YWK A;  2F0O A;  3RZO B;  2JA5 G;  1QNU A;  2F0V A;  3NXW A;  4XDX A;  3HOW B;  3I4N G;  1EIG A;  4CJ1 B;  5KNC A;  3AQQ A;  3MEH A;  1PHJ A;  2GVB A;  3K7A H;  4X64 Q;  3CU7 A;  3PF4 A;  4DV0 Q;  5DNF A;  4G4K A;  3H0G B;  1VQJ A;  2IWH A;  3PO2 H;  1N36 L;  3S14 B;  3SK4 A;  3TRE A;  1CTM A;  1IW7 D;  1NAP A;  2JA5 B;  1EWC A;  2EY6 A;  1D6E C;  2NBF A;  3ZJY C;  1K8G A;  4Z9C B;  4JYA Q;  4K14 A;  1LTS D;  2HHH L;  3T1H Q;  4XXE A;  1TII D;  2WAQ B;  1KIX A;  1KNE A;  4A75 A;  1JB3 A;  4CKE A;  2VQF Q;  1N34 L;  3PUV A;  2QW7 A;  1XPO A;  3HEJ A;  1ILP A;  1HNX Q;  1PFN A;  3P75 A;  4Y7N B;  1NUC A;  4DNI A;  2KJX A;  3BVG A;  4OXP A;  4N8X 1;  2E2J H;  1F77 A;  2PW5 A;  2TMP A;  3CC2 A;  1YHB A;  1N33 L;  2XGT A;  1T5X D;  4HR7 B;  1WTW A;  3IL8 A;  2HCI A;  2RBM A;  1RJT A;  5C4Z A;  1HZC A;  2PI2 E;  5IGE A;  2NN6 I;  3AFP A;  1JOQ A;  1H9J A;  2WP8 J;  5E7N A;  1X9N A;  4PQX A;  1EY7 A;  4JI3 L;  3J7Z C;  1STY A;  3X3N A;  3ER0 A;  4IFD J;  2G9D A;  1ZXT A;  1W6J A;  2VXW A;  2HD3 A;  3SGI A;  1RCV D;  1IYU A;  1STG A;  5J1Z A;  3GP7 A;  2A68 C;  1LAC A;  4JK1 C;  1KL9 A;  2Z8L A;  4B9X A;  3Q0A A;  2UUC L;  1DOL A;  3NWT A;  1SYD A;  5GRO A;  1EY6 A;  1IL2 A;  3OHX C;  3K57 A;  3MHB A;  2BCO A;  4LFA Q;  2F0N A;  1MBY A;  2MQH A;  2D5D A;  2IHE A;  1I6H H;  2EXD A;  2WII B;  1VQD A;  2QF7 A;  3PUW A;  4L5T A;  4UP9 A;  3I2Z A;  2SEB D;  2UXC Q;  1Q86 C;  3S2H B;  4DAY A;  5DEH A;  2NVY B;  3TP5 A;  4R4O A;  3UI2 A;  5JVG 3;  3GTG H;  4JG2 A;  2F3W A;  3FPP A;  4KK7 A;  1E2W A;  1NR2 A;  5FK9 C;  1EWH A;  5C3W A;  2GA4 B;  1G6P A;  3CAM A;  5GAH C;  3H15 A;  3KLS X;  3FHW A;  4QB4 A;  4A3B G;  3M9B A;  1PH1 A;  4GKJ Q;  4HMJ A;  2SNM A;  5CBA E;  1HNW Q;  1XNQ Q;  1VQO A;  4CDC C;  4A3C H;  3S1N H;  1K0R A;  1PZJ D;  4QMG A;  5FLX E;  3E5S A;  2LXJ A;  2AKW B;  4G7O C;  4TQU S;  3AEV A;  3S24 A;  2FFK B;  4ME5 A;  3PGZ A;  4R4I A;  4K2L A;  3OTO L;  3HOZ G;  2VUM B;  3BZD B;  2YTX A;  1QUQ A;  4X65 Q;  5G3L F;  1QB5 D;  2FMC A;  2KCT A;  1K0S A;  3GQB A;  1JB7 A;  4FF3 A;  1SMX A;  3SHL A;  1CZG A;  2EJG C;  4QIW B;  1MD2 D;  2E5L Q;  3VYT A;  3HOY B;  4DV7 L;  1AE3 A;  3O13 A;  1VQM A;  3QWN A;  1PFS A;  2IT1 A;  4OEL B;  4IFD G;  1UUP A;  3CRL C;  4OWT B;  3PO3 B;  3RN5 A;  3M4Y A;  3OWE B;  1ENA A;  3DHQ A;  3D0F A;  3DEO A;  2BDO A;  3HS0 C;  4H0L C;  4A3F B;  1WTR A;  3CP0 A;  5C0X G;  2EJM A;  1MGS A;  4AYB G;  4GKK Q;  1VQ8 A;  3KLR A;  2KCC A;  3MXG A;  3CHB D;  5FLM G;  1KC8 C;  1KHI A;  2JA8 H;  3S2H H;  3W3A A;  4DK1 A;  3GTJ H;  3RNU A;  2Q8T A;  3GTK B;  5ELB A;  1QIL A;  1SSO A;  3W2D A;  4POG A;  1B70 B;  4C1N K;  3G7L A;  1SE3 A;  5BN5 A;  3GTL B;  1N36 Q;  2VQE L;  2ALY B;  3NUC A;  2O5J C;  3CD6 A;  2F0E A;  4KD4 A;  3MAQ A;  2A6H C;  1A3T A;  5EPL A;  5E4W C;  4A93 H;  1RF2 D;  3JAM E;  3GTO B;  4HJ5 A;  2XSC A;  3URY A;  2CCZ A;  5M3F G;  4QQB X;  2AHO B;  4MN3 A;  2Z6B A;  1LV9 A;  2PI2 A;  4JW0 A;  1L1O A;  4FXD A;  4EGV A;  1II3 A;  3E0J A;  2PCF B;  1Q81 C;  4LW1 A;  1FJG Q;  1I6H B;  3LX0 A;  3GDE A;  1I5F A;  2PMZ E;  2KHS A;  4GKK L;  2O4X A;  2V1C C;  4Y52 H;  1STA A;  3I55 A;  4DR3 L;  2XVS A;  1WOC A;  5K5P A;  1J5E Q;  1PRT D;  5COY A;  4A3K H;  3R93 A;  4DV4 Q;  4C2M B;  2ASB A;  1HRJ A;  3ND8 A;  3M4O B;  1MI2 A;  4KHP L;  1I4X A;  2N49 A;  3S1M H;  2LS0 1;  1YZ6 A;  4KLK A;  1YNN C;  4NP5 A;  3TBI B;  5JPN C;  2VQF L;  1ICF B;  1PH6 A;  4DR1 L;  1X3Q A;  4TSS A;  2XWJ B;  4XQQ A;  3V2T A;  4B3R Q;  4NXN L;  1HPC A;  4X3U A;  2HUG A;  4UAI A;  1BQQ T;  2JA6 G;  4K0K L;  4GOP C;  1WCM B;  4Q5V A;  3ITP A;  2NVQ B;  1OXU A;  4B3R L;  1HHV A;  1K28 A;  2F0F A;  1IZ6 A;  2N8N A;  3J81 j;  2F0M A;  4JI3 Q;  1XX8 A;  3G6J B;  3LWE A;  5LHY 1;  4JC0 A;  4IUV A;  2ZJR A;  4NB3 A;  5M3F B;  5T1I A;  2E76 C;  4DAP A;  3T1Y L;  5I6W A;  2J7Z A;  2CW0 C;  2VL6 A;  5ELC A;  3JAM c;  4OIJ A;  4DR2 L;  3CQZ B;  4OO1 H;  3UDX A;  3D6C A;  3TP7 A;  3TN2 A;  1X3G A;  1YNJ C;  3KBG A;  4DXF A;  3PUX A;  3CME A;  1YHQ A;  4Q0F A;  3OSO A;  4KKS A;  1BCP C;  4K8J A;  1TU2 B;  1KRS A;  1ET6 A;  2EDG A;  2G9H D;  2H4O A;  3HOZ H;  2OCE A;  2K1B A;  3ND9 A;  1PVO A;  4LF9 Q;  5E4X A;  4QF4 A;  4BXX G;  3STB D;  3D31 A;  4KV6 A;  4LFC L;  3FDT A;  5DM6 3;  5IWA L;  1VQG A;  4UY8 C;  2VS1 A;  4G7Z C;  2DNE A;  1HQM C;  5FOB B;  1WTX A;  4ODG A;  1A6X A;  3OW7 A;  4U68 A;  2VB3 X;  5JJK A;  1V1O A;  1DOM A;  4CDD C;  1X54 A;  1XTD A;  4XQJ A;  3KOJ A;  3OMG A;  1R9T H;  3CPW A;  2GVA A;  1UWV A;  2MP1 A;  3CC7 A;  3P20 A;  4DU9 A;  2F0T A;  2E8G A;  3S1N B;  1V9P A;  3CCE A;  2R7Z B;  3GV3 A;  1B1Z A;  2UUB L;  2F0I A;  1E24 A;  5C44 B;  3PF5 A;  4C3J B;  4MTK A;  1F2Z A;  2O5I C;  2JSO A;  2IX3 A;  2WFW A;  1GVP A;  1CKN B;  1LT5 D;  4P74 A;  1QUQ B;  5AFW A;  4U67 3;  5CC4 A;  4DR6 Q;  1EY4 A;  4CHT B;  3I3C A;  1FR3 A;  4DV3 Q;  5I4D A;  5JJZ A;  1VQH A;  1C0A A;  4QUF A;  1X6O A;  3A54 A;  1IBK Q;  4C3J H;  1M1K C;  5BR8 L;  2IL8 A;  3Q24 A;  2F3V A;  2ICE C;  2SDF A;  4JBW A;  4DUZ L;  4RGT A;  1QNK A;  1GUN A;  3ICE A;  1CZW A;  5AJ3 L;  2EY2 A;  3I4M G;  1IBM L;  2KQ3 A;  2RDH A;  2BH8 A;  1T9H A;  4FF2 A;  3T53 B;  1Q90 A;  1EOT A;  4HCS A;  1H9R A;  2UXB L;  4DR5 L;  5J3B A;  1EEF D;  3A7L A;  1TWH H;  1CHP D;  1O7Y A;  1SRO A;  1LTA D;  1UE1 A;  2J4X A;  4BY1 G;  3V96 A;  3J81 i;  2PZT A;  2HIX A;  2WV6 D;  5D3I B;  4A3K G;  4JI0 Q;  4FF1 A;  1JR0 D;  3OWF A;  4KN7 C;  4GNX A;  1KAA A;  2DGY A;  4LF5 L;  5I2Y A;  4V19 0;  4BY7 G;  2AWO A;  3EVQ A;  2VUM G;  4J1M A;  3PIP 3;  2E2H B;  1K8M A;  2B39 A;  4AYB B;  4JI7 Q;  3SK8 A;  3KBX A;  3D4D A;  4RH6 A;  4F88 A;  3C46 A;  5IT9 L;  1A8V A;  1W2B A;  4JI1 L;  1HCZ A;  2Q8I B;  2I5M X;  4JV5 L;  4OL7 A;  4IUU A;  1EY5 A;  1PZI D;  3CCU A;  5LMN W;  5IGG A;  2ES2 A;  3J80 c;  3G4S A;  4BY1 H;  4R4Q A;  2PNR C;  1V1Q A;  3LNN A;  4P75 A;  1FGB D;  4N8F A;  4YIJ A;  3HOY G;  3HOV H;  2K5D A;  4A3J G;  4GS3 A;  3J7A V;  2OWO A;  4HIM A;  4CKC A;  2JP1 A;  1WI5 A;  4DR3 Q;  1RDP D;  3ULL A;  1XPR A;  4DUY L;  4GLX A;  4R8N A;  1LTR D;  3K59 A;  3D4W A;  4N9T A;  5LMN L;  4L5R C;  3JAM i;  5IGF A;  4RKB A;  4LNQ A;  1HXY D;  1TXY A;  1SJE D;  1Y1V B;  4JCV E;  1HR0 Q;  3S17 B;  1KD1 C;  2DJG C;  4LK1 C;  1EYA A;  4OHJ A;  1E7Z A;  3BDC A;  3C1F A;  2MO1 A;  5C3E H;  4YWM A;  2AMC B;  4DV1 Q;  1STH A;  2PYK A;  1SLJ A;  2K33 A;  1WD1 A;  3CMA A;  4DNR B;  5CV7 A;  1AZQ A;  3STB C;  2A5H A;  3NTK A;  1EL0 A;  3S17 H;  4JOI A;  2Y0S E;  4DNT B;  4QY7 A;  4LF5 Q;  4C3I B;  3KF6 A;  4B3S Q;  1KDA A;  1ET9 A;  5A35 A;  1WTH A;  4IO9 A;  4OO1 G;  2L1B A;  4A4I A;  4RHS A;  2K50 A;  5JEA J;  2EY1 A;  2DNC A;  2YYZ A;  3IRB A;  3G48 A;  1IKM A;  1QVC A;  1G6Z A;  4IN3 A;  5IP7 G;  1UAP A;  4DUY Q;  1GUW A;  1I4R A;  1VF5 C;  1GHJ A;  1SYC A;  3L2P A;  1H9S A;  1NBW A;  3S2D B;  3KYH C;  5M5Y H;  2EY5 A;  4A3E B;  4R4C A;  2Z6K C;  1B3A A;  3S1Q H;  2XTI A;  3CCR A;  2PZU A;  1UEA B;  3J81 L;  3T16 A;  4DKA C;  1PLF A;  4KTA A;  5EGT A;  3OOC A;  4CJ2 C;  1LYL A;  1LT6 D;  3HOU B;  2WB1 G;  3T1Y Q;  4A3M G;  1CSP A;  2R61 A;  4KHV A;  4ZYS A;  1PH3 A;  4FNF A;  2KVM A;  4FP5 D;  4X65 L;  2WAQ G;  1GXD C;  1SNP A;  4HID A;  3GTP B;  3T51 B;  2MHV A;  4IOA A;  1ZYR C;  4AH6 A;  3M3Y B;  2RDF A;  3SDZ A;  1CM9 A;  2HIV A;  3A56 A;  1NJI C;  5IYD H;  2R7F A;  5C44 H;  1SFO H;  3CQZ H;  3PSI A;  1EQQ A;  2D2C C;  4B3S L;  2KHI A;  3MXU A;  2E2H H;  1BUV T;  5KRU A;  3IAY A;  5LMU L;  4YY3 Q;  1D1K A;  1TWF H;  3WOF A;  5ELN A;  5IP9 G;  1NCV A;  5EKI A;  3BG3 A;  4LF7 Q;  3Q8D A;  1LUZ A;  1EQV A;  1U4R A;  1ZYR D;  1GM5 A;  4BBR G;  2A6H D;  3HKS A;  1XYI A;  2Q2U A;  2JA7 B;  3F2C A;  1YNX A;  1WYD A;  1X56 A;  5A2Q L;  3NEN A;  4A3I B;  3FPU B;  4KKU A;  1VMP A;  3J81 E;  2X6G A;  2JEB I;  1KLU D;  4RHR A;  5JEA G;  4J15 A;  2CHB D;  1OXV A;  5IIF A;  3Q6S A;  3F8T A;  3CCS A;  2FMM A;  5IYC H;  4A93 G;  1LTL A;  3BVZ A;  3H3V C;  1K8A C;  4QIW E;  3EJI A;  1A15 A;  3U50 C;  3HKZ B;  3OIQ A;  3HOW G;  1BO0 A;  1VQB A;  1X32 A;  4A3L H;  4KI0 A;  1AH9 A;  1TWG H;  4P73 A;  3WOE A;  3EIV A;  4YHH Q;  1SRU A;  3AMU A;  5FO9 B;  1S4Z A;  1VS0 A;  2B2Y A;  1YEZ A;  1MSH A;  4OEM B;  1TS5 A;  4ZCK A;  1O80 A;  1M90 C;  4XYQ A;  4JI8 Q;  1H9K A;  4NXN Q;  3I91 A;  1IYV A;  2FIN B;  4P72 A;  3TZU A;  5M3M H;  3A5U A;  3DM1 A;  2F3I A;  4APV A;  2Z4I A;  3FKI G;  4JI0 L;  5AJ3 Q;  1SYB A;  3HOZ B;  3TEH B;  1VDZ A;  1S72 A;  4GLA C;  3M4P A;  3IFD A;  1D2B A;  4BBR H;  1LT4 D;  2EYJ A;  3MXP A;  1Q7Y C;  2XNA C;  4BY7 H;  1TWC B;  1GJX A;  3S15 H;  2E2J B;  5GAE C;  3T13 A;  2E2I H;  2JA8 B;  2KCM A;  1WJJ A;  2YTY A;  1JE5 A;  3MFG A;  2NTT A;  3A8J E;  3BZK A;  1XTC D;  1U4L A;  3RLN A;  4MZ9 A;  1LTB D;  2OTL A;  1N32 Q;  1J8I A;  1IHZ A;  5T1G A;  1UEB A;  1M8A A;  5M3F H;  1U0L A;  3UDG A;  2F0G A;  4E6I A;  4L5S A;  3PV0 A;  5KYI A;  3BZC A;  4DV7 Q;  1PH9 A;  3RZD H;  4BA2 I;  4A3C G;  4NPS A;  3KFU A;  1O7Z A;  2E5L L;  1SNO A;  5M5W H;  5LMU Q;  1XMQ L;  3BU2 A;  4HTH A;  1EQR A;  2UXC L;  3VR4 A;  3LGJ A;  1Q8K A;  1FNV A;  1F9P A;  2PMZ B;  5CBE E;  3C3L A;  1YVC A;  3J81 c;  5JAV A;  1CK1 A;  1PYW D;  1UE5 A;  2ID0 A;  4QUC A;  1RIP A;  3L7Z C;  2K5V A;  1CA5 A;  4KJO A;  2R92 B;  1S5D D;  2I0Q A;  1D7Q A;  1K9M C;  2BA0 A;  4CKB A;  4EX5 A;  4FXK C;  1A2T A;  1F9R A;  3PUZ A;  1QOH A;  1Q82 C;  1QJO A;  2NZ1 D;  4J8Q A;  1NMF A;  2RF4 A;  5CV5 A;  3NBI A;  1Z7T A;  1MSG A;  1BOS A;  1EZ6 A;  3R8B A;  1WTQ A;  1YJW A;  1SNQ A;  4X3T A;  4GZY C;  5HUR A;  2K14 A;  4LF6 Q;  3K0X A;  4AIM A;  5E3F A;  1KRT A;  2PO4 A;  3AYH B;  1VQI A;  4XT1 B;  3CCL A;  1EIH A;  1VF7 A;  1XMQ Q;  1SYE A;  1RKN A;  1AN8 A;  4YCW A;  2JA9 A;  1D5M C;  4LF4 Q;  2EYP A;  4LFB L;  3CXC A;  1N8R C;  3KF8 A;  2SOB A;  4IUN A;  2AUJ D;  2K32 A;  2IHF A;  4FVM A;  4FF4 A;  3IKJ A;  1U4M A;  4KN4 C;  1JJC B;  4ZQ3 A;  4RGM A;  2R93 G;  2QDL A;  4DV2 Q;  3M3Y H;  3DMU A;  1Q46 A;  4JI4 L;  4LUZ A;  4K0K Q;  3NQT A;  4LF8 Q;  1STE A;  2A8V A;  1ENC A;  4DA2 A;  4XYO A;  4PZ8 A;  2UUB Q;  2CWA A;  1GUS A;  2B2V C;  1YI2 A;  4A3B B;  4DV6 Q;  1EQT A;  1H9M A;  2GN5 A;  3P7J A;  3G6E A;  1GO3 E;  4X64 L;  4XIG S;  1HR0 L;  4AQY L;  2VNU D;  3PIP A;  1A3U A;  1Q3L A;  1HNW L;  5D65 A;  2K52 A;  1PZK D;  1W3S A;  3CPF A;  3NEL A;  4R9W A;  3CKI B;  2E75 C;  2V4D A;  4MHE A;  2VZA A;  4A3F H;  1JCK B;  2R3Z A;  3I73 A;  2M9V A;  1X65 A;  2F0D A;  3VA7 A;  1XWE A;  1NR4 A;  1VQF A;  1I6V C;  1C9O A;  4EVO A;  3TQY A;  5JPM C;  3A0J A;  5IP9 H;  2XRS D;  4JV5 Q;  4DR7 Q;  1NE3 A;  2Z6K A;  3U9S A;  4CBV A;  4LFB Q;  2D0O A;  3HOU G;  1Y1V H;  2UU9 L;  2A1A A;  1K83 B;  1BBU A;  3SE0 A;  4KHZ A;  3RZD B;  4IJH A;  1L0W A;  2EXZ A;  1SE8 A;  1HA6 A;  4B3T Q;  4WOR A;  2KUM A;  3K7U C;  3GO5 A;  1HUM A;  1SBB B;  3BJU A;  3OW2 A;  5J22 A;  1VQ7 A;  1KDB A;  4JI2 Q;  3JAM L;  3SK6 A;  1HQR D;  1TWA B;  2OXP A;  1HTL D;  2EZV A;  5IYC G;  1JWS D;  4YCU A;  4OIK A;  2D9U A;  1B8A A;  1I4Q A;  3K80 C;  2N55 A;  3RD4 A;  4ALP A;  2DUD A;  1JE4 A;  5EKL A;  3VYS A;  3WDN A;  3VYR A;  3J80 L;  1G29 1;  2KHJ A;  5CV6 A;  1DGS A;  2KEN A;  3NSW A;  2VQE Q;  2HT1 A;  1EYC A;  5JVH 3;  3MA2 B;  2QGQ A;  2R92 G;  5BR8 Q;  1PRT C;  3GTG B;  2RA4 A;  2UU9 Q;  1B7Y B;  4A3E G;  1GD7 A;  4FXG C;  1JOR A;  1HFG A;  4PMB A;  3E9I A;  1HA5 A;  2H5X A;  4LUO A;  3GV6 A;  4UP7 A;  3TDQ A;  2K05 A;  1TKW B;  1VQC A;  2B8G A;  2CKZ B;  1PYS B;  3M85 A;  4ULL A;  3EQL C;  2A68 D;  3OPO A;  4HN7 A;  4XT3 B;  1V8Q A;  2CH4 A;  4A3G B;  3KLS A;  3R3O A;  1MJE A;  1J5E L;  1CKN A;  4RWS C;  3QB3 A;  2C35 B;  2IX0 A;  5IGB A;  2F0Q A;  1N32 L;  1Y1W B;  3P1H A;  4G57 A;  4R8I A;  1WCM H;  3A8K E;  2WAQ E;  4A3J B;  1A0I A;  4A3D G;  1QWY A;  3EN2 A;  1TS3 A;  1C8C A;  5DM7 3;  2MNA A;  2R93 B;  2EOT A;  4DR1 Q;  1Y1V G;  1TWG B;  2L55 A;  3HOV G;  5C4X G;  1BCP B;  1AFP A; 
#chains in the Genus database with same CATH homology
 2RSO A;  1B44 D;  2WKD A;  3AU7 A;  5C0X J;  4WFN 3;  3T56 B;  5KNB A;  5LL6 X;  1SNC A;  3H94 A;  4O1N A;  4A3K B;  1I4H A;  1F9S A;  1Y8O B;  1I50 B;  2JXM B;  3X3M A;  1Y8P B;  4K6D A;  1I4G A;  2WKC A;  3DUZ A;  5ELE A;  1EY8 A;  5CV4 A;  2E2I B;  3PO2 B;  2XRQ D;  4BY7 B;  1LTI D;  2C5C A;  1CQF A;  4B08 A;  2IJ0 A;  1CI3 M;  5EBD A;  1OO9 B;  3GTQ B;  2F0P A;  3DWP A;  1ZKO A;  1V1P B;  3NE5 B;  1WVL A;  3S9W A;  2K5W A;  4ZUI A;  1S5C D;  5CR3 A;  4A3D B;  3A8I E;  1DD2 A;  2F03 A;  4L63 B;  4S3S A;  5JEA H;  1I4P A;  2AQ1 B;  2LY7 A;  1B9M A;  3MWY W;  4F87 A;  3K5M A;  1F2Y A;  3Q22 A;  2DY8 A;  2NVT B;  3SEB A;  1WD0 A;  2BOS A;  3S1Q B;  5M5X B;  2OF1 A;  1SEB D;  2O2L D;  2B2W A;  2A6E C;  4PNY A;  4A3M B;  1LTG D;  2X6L A;  2FHT A;  5EPK A;  2DY7 A;  2VB2 X;  1CFM A;  1PMR A;  1T5E A;  4RCN A;  1TY2 A;  3HOV B;  2L9H A;  2F0H A;  1TWH B;  2OEO A;  5COR A;  3MC0 B;  4UDU C;  1X3P A;  5CMD A;  1PFB A;  1G91 A;  4RCO A;  3K5N A;  4ID6 A;  1M4V A;  1FYC A;  2BE5 C;  1B4O A;  1ESF A;  5C0X H;  4K5W A;  1LAB A;  4KD3 A;  2OT2 A;  1TQO A;  1JQY D;  2A73 B;  5K36 G;  1BDO A;  4PMW A;  2KEE A;  3EA6 A;  1DYQ A;  2KOL A;  4L8J A;  4ZLT F;  5IT9 E;  2B2Y C;  4V0B A;  4RAU C;  2HDM A;  3U9O A;  5A2Q E;  2NYZ D;  1PDQ A;  2NN6 H;  3FRP B;  1R4P B;  3GD7 A;  3SK5 A;  1ONL A;  1LO5 D;  1C48 A;  2B2W C;  4WJW A;  5I9O A;  4TRD A;  3D4R A;  5CYU A;  2KEC A;  4J6H A;  1DON A;  3HRZ C;  4DFA A;  2PPB C;  5J39 A;  1EZ8 A;  4QCL A;  1ZEQ X;  2SNS A;  2WB1 B;  3K58 A;  3OIP A;  2K28 A;  3BS1 A;  1B2T A;  2DN8 A;  4KMU C;  1G8Z D;  2I07 B;  1TS2 A;  1O78 A;  1GUT A;  2M00 A;  3BVM A;  3PMF A;  3QOL A;  2QEJ C;  4ZUJ A;  2R6G A;  5KIX A;  5KND A;  1SMY D;  1D1I A;  5BN3 A;  1AZP A;  4L6T B;  3NWS A;  4O42 A;  3J7Y W;  1F2M A;  2KED A;  1SYG A;  3AB9 A;  3I4M B;  2B63 B;  5CV8 A;  2PZW A;  4DN4 M;  3I8Z A;  4XTC S;  2K7V A;  1OXX K;  1BR9 A;  1SE4 A;  4NMZ A;  1AP0 A;  1FNW A;  2F0S A;  2HDL A;  2WIN B;  3FMC A;  4F8M A;  1R9T B;  1F2L A;  2BA1 A;  4ZKB B;  2ZXR A;  1EU4 A;  5I6Y A;  3TME A;  1Q1E A;  1DM0 B;  1C4Q A;  4C3J G;  5C4J B;  1EY0 A;  3VR6 A;  2Y0S B;  2C9O A;  2D62 A;  1H9S B;  4ZAI A;  2PW7 A;  4N9P A;  1RTO A;  4LAA A;  3LWU A;  5K36 H;  2HCC A;  2IPK D;  3HOX B;  3PUY A;  4K8I A;  2JEA I;  1HFN A;  2B2T A;  3VR5 A;  5LL6 S;  1O7L A;  1EU3 A;  2Q8R E;  5D3D A;  2NTS A;  1IW7 C;  3NPP A;  5I9P A;  1PRT F;  5JOB A;  2K5Q A;  1ML0 D;  2LMC B;  4A93 B;  2ENB A;  4OGQ C;  2YU9 B;  3E6Z X;  1B9N A;  1PTO H;  4EQO A;  5C4X B;  4IUR A;  2A69 D;  3NTH A;  5KGU A;  4BY1 B;  5DAU A;  2L11 A;  3QO2 A;  1BBX C;  3S16 B;  1TS4 A;  5C3X A;  1FD7 D;  5EPJ A;  3NK9 A;  1LTT D;  3ERO A;  3A7A B;  2KA7 A;  2EYH A;  3CRK C;  3K6O A;  3QJY A;  1VCI A;  1JOO A;  1Y8N B;  1S5B D;  1G2T A;  2F4I A;  4B9W A;  1W6K A;  1OXS C;  2Z1C A;  1ESR A;  2ZXO A;  3GTJ B;  1DCZ A;  1JOK A;  2LFN A;  3H91 A;  1B53 A;  3VYU A;  3TP8 A;  5FLX L;  3D6W A;  2EVB A;  2B2T C;  5ELD A;  3MFY A;  5FKA C;  1RTN A;  1IL8 A;  3F2U A;  5KYL A;  3BYT B;  5IOD A;  3BDL A;  2QIL A;  4FO2 A;  2MPM A;  3DWA A;  3VA5 A;  1L0Y B;  1ILQ A;  1I3Q B;  1STB A;  2EYO A;  2CVR A;  4I65 A;  1QG7 A;  3ONA B;  5C5M A;  1OXT A;  2K6A A;  1TY0 A;  4DAV A;  1KLG D;  2A6E D;  2AWN A;  1GUO A;  5CV9 A;  1PRT B;  4BBR B;  2NUC A;  1VMC A;  2A69 C;  5FO8 B;  2MGS A;  3H09 A;  1JC7 A;  5EBC A;  1D5Z C;  5F2D A;  4KKT A;  2TSS A;  1PTO F;  3IFT A;  2FJ2 A;  4DK0 A;  4LJZ C;  2PQE A;  2K03 A;  1LLR D;  2B2V A;  3V05 A;  2L5T A;  2L4N A;  4HMI A;  1F9Q A;  3MXN A;  2CQA A;  5HGT A;  3RMH A;  1KAB A;  2JYO A;  5NUC A;  3TZD A;  2NVX B;  3BDO A;  2K04 A;  4I7Z C;  1WTV A;  1PXU A;  5CGK A;  3R2T A;  2AQ3 B;  3M7N A;  1RHP A;  2AUK A;  1G2S A;  2CW0 D;  4H13 C;  5IOC A;  4CJ0 B;  1EY9 A;  3DEP A;  3HGB A;  1JWU D;  1TR5 A;  4ILW A;  4CGY B;  2ZT9 C;  2WAC A;  5IGD A;  5EQ0 A;  2B2U A;  4KJN A;  1CA6 A;  3QOJ A;  3R2I A;  4C3I G;  2EYM A;  4BS9 A;  2BDN A;  1GUG A;  3NP8 A;  1BF4 A;  3MVV A;  4RA8 A;  2KCN A;  3L9A X;  3J80 E;  3FEW X;  2L12 A;  1WTP A;  1XXG A;  2JE6 I;  3J7A F;  2E74 C;  1WTO A;  3ERQ A;  1SMY C;  2AQ2 B;  4IAL A;  3QG1 A;  1SE2 A;  1V1P A;  4KY7 A;  2EYF A;  3S15 B;  4H7B A;  4X3S A;  1V43 A;  4EQN A;  2F0K A;  1U4P A;  1CT1 D;  4HCE A;  4RKL A;  2H1E A;  3TSS A;  3BYY B;  3DWQ A;  3I70 A;  5G3L D;  5KEE A;  4IUQ A;  4OO1 I;  5C4H A;  1S5F D;  1IKL A;  2E2D C;  2XN9 C;  3T4A C;  3HP3 A;  4RGN A;  1Q8I A;  5C5L A;  4ZRZ A;  4NKL A;  4ZK9 B;  4IUT A;  2IX1 A;  4C3H G;  5M3M B;  4DGZ A;  4HED A;  1SDF A;  2RQX A;  1DOK A;  3QIA A;  5M9O A;  4FYD A;  4IFD I;  3K5O A;  4IUP A;  5EKK A;  3L3O C;  5ELF A;  1SAP A;  2QCP X;  3I4N B;  1SND A;  4PV1 C;  1K8O A;  2RKS A;  3GTM B;  2F0U A;  1HTP A;  1TWF B;  1PTO D;  2ICI A;  3C2P A;  3D8G A;  2ZXP A;  3C1E A;  4BA1 I;  4LMQ D;  3Q23 A;  3MZ5 A;  3S1M B;  1BNZ A;  2HQE A;  4C1N I;  5TSS A;  1YNN D;  1J9O A;  2A74 C;  2EJF C;  2MJ8 A;  2RDG A;  3M7G A;  3D3R A;  4ZKC B;  1SXT A;  2JA6 B;  3K7A B;  3H6M A;  3RUZ A;  1ENF A;  1EEI D;  1L0X B;  1JIC A;  3SVM A;  3KK7 A;  5M5Y B;  1TVX A;  1ICW A;  1KTK A;  1SNM A;  3NHH A;  2XWB B;  2K01 A;  1BXT A;  2B2U C;  2F0L A;  1Z47 A;  1NSN S;  1D5X C;  4WRD A;  2QKI C;  4XQN A;  4C3H B;  4KY6 A;  3SXH A;  1E2V A;  1DJR D;  2EE1 A;  3NTI A;  2XIW A;  1QCB D;  4HAE A;  2LKV A;  1DZ1 A;  1U9R A;  1ROD A;  1Z6H A;  1GHK A;  4BWG B;  3VR2 A;  1CHQ D;  3RLF A;  2Z4H A;  3N52 A;  4K5X A;  3ZYY X;  1PFM A;  2M2L A;  4M1U B;  2EPB A;  5IGC A;  2NWG A;  5D14 A;  3PIO 3;  4KY5 A;  2MUY A;  3VR3 A;  2RVL A;  1STN A;  5C0X I;  5C3E B;  2B8F A;  1QE6 A;  4C56 C;  1R4Q B;  4P2C B;  4K6L A;  2IW3 A;  1KDC A;  2RSN A;  3A55 A;  1YNJ D;  3NQI A;  4DXG A;  4EQP A;  5E1F A;  3OMC A;  4HSP A;  1B50 A;  1A2U A;  1AEX A;  2N88 A;  4G7H C;  4PMC A;  3HG9 A;  1PTO B;  1S5E D;  2NB0 A;  1EFI D;  3KUP A;  4HSV A;  1DXM A;  1CQV A;  3K0Y A;  3TP6 A;  5BN4 A;  2I46 A;  2BE5 D;  1E0B A;  3FVQ A;  5FO7 B;  3K5L A;  1FNU A;  3DXJ C;  2X69 A;  3N6R A;  2J0T D;  3I72 A;  1AW7 A;  2QDB A;  4K5V A;  1SFO B;  3EFX D;  4H44 C;  1PTO C;  4M8A A;  5M5W B;  4ABN A;  1RD9 D;  1Q1B A;  1BCP D;  3I4L A;  5C6A A;  4IFD H;  2EYL A;  5EJW A;  5I2X A;  5ISR A;  1GOZ A;  1Y69 U;  1BCP F;  2F0J A;  1KNA A;  4TKO B;  1Q12 A;  4F7X A;  2F1M A;  4RGO S;  4NDX A;  4IQZ A;  3NBH A;  4MIU A;  2L0C A;  1LT3 D;  4DF7 A;  1SJH D;  2F0W A;  4IZ8 A;  3FKI B;  1UNS A;  1HUN A;  3S1R B;  1A3V A;  4X3K A;  3HZX A;  1TT2 A;  3SR1 A;  1JWM D;  4BBS B;  3I90 A;  1E2Z A;  1SYF A;  2NN6 G;  4RFB A;  3MTS A;  4K2K A;  1EYD A;  4NW2 A;  2F0O A;  3RZO B;  1QNU A;  2F0V A;  3NXW A;  4XDX A;  3HOW B;  1EIG A;  4CJ1 B;  5KNC A;  3MEH A;  3CU7 A;  5DNF A;  4G4K A;  3H0G B;  2IWH A;  3S14 B;  3SK4 A;  1CTM A;  1IW7 D;  1NAP A;  2JA5 B;  1EWC A;  2EY6 A;  1D6E C;  2NBF A;  4Z9C B;  4K14 A;  1LTS D;  4XXE A;  1TII D;  2WAQ B;  1KNE A;  1JB3 A;  4CKE A;  3PUV A;  3HEJ A;  1ILP A;  1PFN A;  3P75 A;  4Y7N B;  1NUC A;  2KJX A;  3BVG A;  1F77 A;  2PW5 A;  2TMP A;  1T5X D;  4HR7 B;  1WTW A;  3IL8 A;  2HCI A;  2RBM A;  1RJT A;  5C4Z A;  5IGE A;  2NN6 I;  1JOQ A;  1H9J A;  2WP8 J;  4PQX A;  1EY7 A;  1STY A;  3X3N A;  4IFD J;  2G9D A;  1ZXT A;  1W6J A;  2VXW A;  1RCV D;  1IYU A;  1STG A;  5J1Z A;  3GP7 A;  2A68 C;  1LAC A;  4JK1 C;  2Z8L A;  3Q0A A;  4B9X A;  1DOL A;  3NWT A;  1SYD A;  1EY6 A;  3OHX C;  3K57 A;  3MHB A;  2BCO A;  2F0N A;  1MBY A;  2D5D A;  2WII B;  2QF7 A;  3PUW A;  2SEB D;  3S2H B;  4DAY A;  5DEH A;  2NVY B;  3TP5 A;  3UI2 A;  5JVG 3;  2F3W A;  3FPP A;  4KK7 A;  1E2W A;  1NR2 A;  5FK9 C;  1EWH A;  5C3W A;  2GA4 B;  3KLS X;  4QB4 A;  4HMJ A;  2SNM A;  5CBA E;  1PZJ D;  4QMG A;  5FLX E;  3E5S A;  4G7O C;  4TQU S;  2FFK B;  4ME5 A;  4K2L A;  2VUM B;  3BZD B;  5G3L F;  1QB5 D;  2FMC A;  3GQB A;  4FF3 A;  3SHL A;  1CZG A;  2EJG C;  4QIW B;  1MD2 D;  3VYT A;  3HOY B;  3O13 A;  3QWN A;  2IT1 A;  4IFD G;  1UUP A;  3CRL C;  3PO3 B;  3M4Y A;  3OWE B;  1ENA A;  3DHQ A;  3DEO A;  2BDO A;  3HS0 C;  4H0L C;  1WTR A;  4A3F B;  5C0X G;  2EJM A;  1MGS A;  3KLR A;  2KCC A;  3MXG A;  3CHB D;  3W3A A;  4DK1 A;  2Q8T A;  3GTK B;  5ELB A;  1QIL A;  1SSO A;  3W2D A;  4C1N K;  3G7L A;  1SE3 A;  5BN5 A;  3GTL B;  3NUC A;  2O5J C;  2F0E A;  4KD4 A;  3MAQ A;  2A6H C;  1A3T A;  5EPL A;  5E4W C;  1RF2 D;  3JAM E;  3GTO B;  2XSC A;  3URY A;  4MN3 A;  1LV9 A;  4FXD A;  4EGV A;  1II3 A;  3E0J A;  2PCF B;  1I6H B;  3LX0 A;  2KHS A;  2O4X A;  1STA A;  2XVS A;  5K5P A;  1PRT D;  5COY A;  3R93 A;  4C2M B;  1HRJ A;  3ND8 A;  3M4O B;  1MI2 A;  1I4X A;  2LS0 1;  1YNN C;  4NP5 A;  3TBI B;  5JPN C;  1X3Q A;  4TSS A;  2XWJ B;  4XQQ A;  3V2T A;  1HPC A;  4X3U A;  2HUG A;  4UAI A;  1BQQ T;  1WCM B;  4Q5V A;  3ITP A;  2NVQ B;  1OXU A;  1HHV A;  2F0F A;  2F0M A;  1XX8 A;  3G6J B;  3LWE A;  5LHY 1;  4IUV A;  5M3F B;  5T1I A;  2E76 C;  4DAP A;  5I6W A;  2J7Z A;  2CW0 C;  5ELC A;  4OIJ A;  3CQZ B;  4OO1 H;  3D6C A;  3TP7 A;  3TN2 A;  1YNJ C;  3KBG A;  4DXF A;  3PUX A;  4Q0F A;  3OSO A;  4KKS A;  1BCP C;  4K8J A;  1TU2 B;  1ET6 A;  2EDG A;  2G9H D;  2H4O A;  2K1B A;  3ND9 A;  5E4X A;  4QF4 A;  3D31 A;  4KV6 A;  3FDT A;  5DM6 3;  4G7Z C;  2DNE A;  1HQM C;  5FOB B;  1WTX A;  4ODG A;  1A6X A;  3OW7 A;  4U68 A;  2VB3 X;  1V1O A;  1DOM A;  4XQJ A;  3OMG A;  2MP1 A;  3P20 A;  4DU9 A;  2F0T A;  3S1N B;  2R7Z B;  3GV3 A;  1B1Z A;  2F0I A;  5C44 B;  4C3J B;  1F2Z A;  2O5I C;  2JSO A;  2IX3 A;  1LT5 D;  5AFW A;  4U67 3;  5CC4 A;  1EY4 A;  4CHT B;  3I3C A;  1FR3 A;  5I4D A;  5JJZ A;  4QUF A;  3A54 A;  2IL8 A;  3Q24 A;  2F3V A;  2ICE C;  2SDF A;  4JBW A;  4RGT A;  1QNK A;  1GUN A;  1CZW A;  2EY2 A;  2KQ3 A;  2RDH A;  4FF2 A;  3T53 B;  1Q90 A;  1EOT A;  4HCS A;  1H9R A;  1EEF D;  3A7L A;  1CHP D;  1O7Y A;  2J4X A;  1LTA D;  3V96 A;  2PZT A;  2WV6 D;  5D3I B;  4FF1 A;  1JR0 D;  3OWF A;  4KN7 C;  1KAA A;  5I2Y A;  4V19 0;  2AWO A;  3EVQ A;  4J1M A;  3PIP 3;  2E2H B;  1K8M A;  2B39 A;  4AYB B;  3SK8 A;  3KBX A;  3D4D A;  4RH6 A;  4F88 A;  3C46 A;  5IT9 L;  1HCZ A;  2Q8I B;  4OL7 A;  4IUU A;  1EY5 A;  1PZI D;  5IGG A;  2PNR C;  3LNN A;  1FGB D;  4YIJ A;  2K5D A;  3J7A V;  4CKC A;  2JP1 A;  1RDP D;  4R8N A;  1LTR D;  3K59 A;  3D4W A;  4N9T A;  5IGF A;  4RKB A;  1HXY D;  1Y1V B;  1SJE D;  3S17 B;  4LK1 C;  1EYA A;  4OHJ A;  3BDC A;  3C1F A;  1STH A;  2PYK A;  2K33 A;  1WD1 A;  4DNR B;  5CV7 A;  1AZQ A;  2A5H A;  3NTK A;  1EL0 A;  4DNT B;  4C3I B;  1KDA A;  1ET9 A;  5A35 A;  4OO1 G;  2L1B A;  4RHS A;  5JEA J;  2EY1 A;  2DNC A;  2YYZ A;  1IKM A;  1G6Z A;  4IN3 A;  1UAP A;  1GUW A;  1I4R A;  1VF5 C;  1GHJ A;  1SYC A;  1H9S A;  3S2D B;  2EY5 A;  4A3E B;  1B3A A;  2PZU A;  1UEA B;  3J81 L;  3T16 A;  1PLF A;  4KTA A;  5EGT A;  3OOC A;  4CJ2 C;  1LT6 D;  3HOU B;  2R61 A;  4KHV A;  4ZYS A;  4FNF A;  2KVM A;  4FP5 D;  1GXD C;  1SNP A;  3GTP B;  3T51 B;  2MHV A;  1ZYR C;  3M3Y B;  2RDF A;  3SDZ A;  1CM9 A;  3A56 A;  2D2C C;  3MXU A;  1BUV T;  5KRU A;  3IAY A;  1D1K A;  3WOF A;  1NCV A;  5EKI A;  3BG3 A;  1EQV A;  1U4R A;  1ZYR D;  2A6H D;  1XYI A;  2JA7 B;  4A3I B;  5A2Q L;  3FPU B;  4KKU A;  1VMP A;  3J81 E;  2X6G A;  2JEB I;  1KLU D;  4RHR A;  5JEA G;  2CHB D;  1OXV A;  5IIF A;  3Q6S A;  2FMM A;  3BVZ A;  3H3V C;  3EJI A;  1A15 A;  3HKZ B;  3OIQ A;  1BO0 A;  1X32 A;  4KI0 A;  3WOE A;  3AMU A;  5FO9 B;  1S4Z A;  2B2Y A;  1MSH A;  1TS5 A;  1O80 A;  4XYQ A;  1H9K A;  3I91 A;  1IYV A;  2FIN B;  3TZU A;  3DM1 A;  2Z4I A;  1SYB A;  3HOZ B;  1VDZ A;  3IFD A;  1D2B A;  1LT4 D;  2EYJ A;  3MXP A;  2XNA C;  1TWC B;  1GJX A;  2E2J B;  3T13 A;  2JA8 B;  3MFG A;  2NTT A;  3A8J E;  1XTC D;  1U4L A;  1LTB D;  1J8I A;  1IHZ A;  5T1G A;  1M8A A;  2F0G A;  4E6I A;  3PV0 A;  5KYI A;  4BA2 I;  1O7Z A;  1SNO A;  4HTH A;  3VR4 A;  1FNV A;  1F9P A;  2PMZ B;  5CBE E;  3C3L A;  5JAV A;  1CK1 A;  1PYW D;  2ID0 A;  4QUC A;  3L7Z C;  1CA5 A;  4KJO A;  2R92 B;  1S5D D;  2BA0 A;  4CKB A;  4FXK C;  1A2T A;  1F9R A;  3PUZ A;  1QOH A;  1QJO A;  2NZ1 D;  4J8Q A;  5CV5 A;  3NBI A;  1Z7T A;  1MSG A;  1BOS A;  1EZ6 A;  3R8B A;  1WTQ A;  1SNQ A;  4X3T A;  4GZY C;  5HUR A;  5E3F A;  2PO4 A;  4XT1 B;  1EIH A;  1VF7 A;  1SYE A;  1RKN A;  1AN8 A;  1D5M C;  2EYP A;  3KF8 A;  2SOB A;  4IUN A;  2AUJ D;  2K32 A;  4FVM A;  4FF4 A;  3IKJ A;  1U4M A;  4KN4 C;  4ZQ3 A;  4RGM A;  3DMU A;  3NQT A;  1STE A;  1ENC A;  4DA2 A;  4XYO A;  1GUS A;  2B2V C;  4A3B B;  1EQT A;  1H9M A;  3P7J A;  4XIG S;  2VNU D;  1A3U A;  1Q3L A;  5D65 A;  1PZK D;  4R9W A;  3CKI B;  2E75 C;  2V4D A;  4MHE A;  1JCK B;  2R3Z A;  3I73 A;  2M9V A;  2F0D A;  3VA7 A;  1XWE A;  1NR4 A;  1I6V C;  4EVO A;  5JPM C;  2XRS D;  3U9S A;  4CBV A;  3RZD B;  1K83 B;  3SE0 A;  4KHZ A;  2EXZ A;  1HA6 A;  4WOR A;  2KUM A;  3GO5 A;  1HUM A;  1SBB B;  5J22 A;  1KDB A;  3JAM L;  3SK6 A;  1HQR D;  1TWA B;  2OXP A;  1HTL D;  2EZV A;  1JWS D;  4OIK A;  2D9U A;  1I4Q A;  2N55 A;  3RD4 A;  1JE4 A;  5EKL A;  3VYS A;  3WDN A;  3VYR A;  3J80 L;  1G29 1;  5CV6 A;  3NSW A;  1EYC A;  5JVH 3;  3MA2 B;  1PRT C;  3GTG B;  2RA4 A;  1JOR A;  4FXG C;  1HFG A;  4PMB A;  1HA5 A;  3GV6 A;  3TDQ A;  1TKW B;  2K05 A;  2B8G A;  3M85 A;  4ULL A;  3EQL C;  2A68 D;  3OPO A;  4HN7 A;  4XT3 B;  1V8Q A;  4A3G B;  3KLS A;  3R3O A;  4RWS C;  3QB3 A;  2IX0 A;  5IGB A;  2F0Q A;  1Y1W B;  3P1H A;  4G57 A;  4R8I A;  3A8K E;  4A3J B;  1QWY A;  1TS3 A;  1C8C A;  5DM7 3;  2R93 B;  2EOT A;  1TWG B;  2L55 A;  1AFP A;  1BCP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...