2K03A

Structure of sdf1 in complex with the cxcr4 n-terminus containing a sulfotyrosine at postition 21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCACQIVARLKNNNRQVCIDPKLKWIQEYLEKCLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of CXCR4 sulfotyrosine recognition by the chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Stromal cell-derived factor 1
total genus 10
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k03A00
1NR2A 1LV9A 1WTQA 2B2UA 1AZQA 1BF4A 1U4LA 2B2WC 2L1BA 2K03A 3FDTA 2SDFA 4IUVA 4LMQD 2RVLA 1MGSA 2B2WA 1WTXA 2HUGA 4OIKA 2EPBA 1AP0A 2R3ZA 1O7YA 2L11A 3MTSA 1O80A 2L9HA 4IUUA 1RHPA 1ILPA 3QO2A 1EOTA 1WTRA 1PFBA 4RA8A 2MP1A 1X3QA 3G7LA 1WD0A 1NCVA 3DEOA 1DONA 2FJ2A 4O42A 4QUFA 2N55A 1EIHA 2X6GA 2XIWA 1B53A 2K28A 1J8IA 5AFWA 5COYA 4IUPA 3N52A 1PDQA 2K05A 2KVMA 2B2VA 4HAEA 1DOKA 1NAPA 1HHVA 2KUMA 1WTOA 1HA6A 2KECA 2IL8A 4CJ1B 1SDFA 2EOTA 3HP3A 4XT1B 5D65A 2K01A 5T1IA 1B4OA 1QG7A 2FINB 2VXWA 1TVXA 4CJ2C 1C8CA 2BDNA 2HCCA 2HDMA 2K1BA 5EPLA 1B50A 1E0BA 1QE6A 1PLFA 1WTPA 1B3AA 1MSHA 5EQ0A 1M8AA 1U4RA 2B2VC 2RSNA 5CORA 3H91A 5D14A 3DEPA 1ESRA 1JE4A 3Q6SA 1PFNA 2B2YC 1G2TA 1WTVA 2FMMA 3GV3A 3P7JA 5EPKA 2K04A 2HCIA 4X3SA 5T1GA 2MJ8A 2DY8A 1XX8A 3D6WA 1Q3LA 4IUQA 2NWGA 4QUCA 5E4WC 1A15A 1F9PA 4NW2A 1BNZA 3I91A 3UI2A 5CMDA 1HFGA 1S4ZA 4DN4M 1ILQA 4OIJA 3R93A 1EQTA 3F2UA 1ZXTA 1NR4A 2B2YA 1DOLA 4RAUC 4ZK9B 1XYIA 4R8IA 3SVMA 3KBXA 1EIGA 4HCSA 1HUMA 1WD1A 1G2SA 1ML0D 4ZAIA 1F9SA 2B2TC 2EE1A 2KEEA 3MWYW 1J9OA 3IFDA 2MPMA 1AZPA 1HFNA 4MHEA 2J7ZA 2JP1A 4HSVA 2M2LA 2MGSA 1VMCA 1RJTA 4IURA 1HRJA 1BBXC 5DNFA 3TN2A 4ZKCB 1IKLA 2D9UA 1X32A 2L12A 1GUWA 1RTNA 4RWSC 1JICA 5EPJA 1CM9A 1MSGA 3FPUB 3GV6A 1G91A 1O7ZA 2CVRA 4X3KA 5JJZA 5CBAE 1B2TA 1EL0A 1U4MA 4ZLTF 1KNAA 1F9QA 1RODA 4ZKBB 4U68A 1KNEA 1VMPA 4IUTA 1RTOA 2X69A 2KOLA 3ONAB 4UAIA 1CA5A 1DOMA 4CJ0B 1SAPA 1F9RA 5CBEE 2KEDA 2Q8RE 4X3UA 1CA6A 4MN3A 1WTWA 2DY7A 2JYOA 2NYZD 3I3CA 1G6ZA 2Q8TA 1U4PA 5EJWA 1F2LA 2B2UC 3TZDA 4XT3B 3IL8A 5EKIA 2L4NA 2N88A 3DM1A 1IL8A 1SSOA 4XDXA 5E4XA 4X3TA 1IKMA 1ICWA 2HDLA 4HEDA 2NZ1D 1QNKA 1DZ1A 3KUPA 2FHTA 3I90A 1WVLA 1X3PA 1MI2A 1HUNA 2H1EA 2X6LA 4R9WA 2FFKB 2RSOA 3LWEA 1BO0A 2RA4A 2B2TA 1PFMA 3I8ZA
chains in the Genus database with same CATH superfamily
1STEA 1PMRA 2K03A 4IUVA 4YCWA 1PV4A 4LMQD 2RHSB 3DMUA 3AYHB 2JA7H 4G4KA 2EXZA 2HUGA 1YVCA 4P73A 4E6IA 4RGOS 2F0GA 5KEEA 1WTRA 4GKJL 2R7ZH 1HTLD 4Y7NB 2VZAA 4B3SL 2ASBA 2D5DA 2WAQB 1XNRQ 2UXBQ 3T53B 3C1EA 3JC66 4KY7A 4HJ9A 1L0YB 4GNXB 1SYFA 4CJ2C 1XPOA 3CC2A 4DV4Q 4DV6Q 4KHVA 4YWKA 4DR5Q 1AFPA 3NEMA 3PV0A 2VQFL 1ICFB 4NXNL 1V1PA 4JI1L 1K9MC 1QCBD 2K04A 3LNNA 4X3SA 3OSOA 5C0XG 1I50H 4NKLA 3D31A 1BNZA 4A4IA 2F4IA 2PYKA 3BZKA 4B3RQ 3R93A 5FJ8G 4A93G 4A3MB 3SVMA 1X65A 1T5XD 3MXNB 4DA2A 1K8MA 2AWOA 1CQVA 2CFMA 4KI0A 4PMBA 5JVG3 4UPAA 3HZXA 3PF4A 2M9VA 5BN5A 5LMUQ 3I4MB 4HSVA 2Z1CA 3UE1A 2F0WA 3K5OA 1E1OA 4ZKCB 3HKZB 3PO3B 5DAUA 1EQVA 4JBMA 4DV3Q 1V9PA 2D62A 3KBGA 3VA5A 3T1HL 1PH8A 4NPSA 4XYQA 4N9TA 3FMCA 4WRDA 2PZUA 4IUTA 1Y1VG 5FLXE 1CSPA 1ZKOA 5M3MG 3Q24A 3PO3G 3EIVA 1EU3A 1GUGA 4JOIC 4DR3Q 1X55A 2Q2IA 1BUVT 1QB5D 4DV4L 4XDXA 4H0LC 5E4XA 1GXDC 1LACA 1IKMA 1OXVA 1W3SA 1FYCA 2EYOA 1QNKA 4DF7A 3I56A 1YNXA 4N8FA 1GOZA 3S16B 2V1CC 4UP7A 3H09A 5EAYA 4WJ3M 1TIID 2A6HD 5EBCA 4KK7A 3R8BA 2R92H 2OQ0A 2O2LD 2B2TA 3VR6A 3PF5A 4JI0L 4A3IG 2KCMA 5D3IB 4R4TA 3FDTA 1ENAA 4X65Q 2A69C 3C46A 4DU9A 1Z9FA 1Y1WG 1TY0A 2XSCA 4S3SA 4OWTB 2YU9B 4DR2Q 1SYGA 4RA8A 3G7LA 5LMUL 4Z9CB 1DONA 5JEAJ 3RN5A 3HOXH 1CTMA 5G3LF 2KBNA 2ZXOA 1P8LA 3K0YA 4KHPL 1CI3M 1VQDA 3NBHB 1FGUA 4XXEA 3I4NH 5FLMH 4AYBB 2PI2A 5ISRA 3HOZH 4A3GG 3KOJA 1SE4A 2HDMA 1QE6A 4CKCA 3AQQA 1XTDA 4H7BA 4X64L 1EOVA 3G48A 3N6RA 2C35B 2HHHQ 3OWFA 4ME3A 4C3JH 4A3GH 2H5XA 5K36G 2DY8A 4KD3A 1EY0A 1N36L 3I4NG 3SK5A 1IHZA 4PG3A 2MO0A 4OHJA 2B2YA 4ZRZA 4EQOA 5IP9G 4V190 2A1AA 3E9HA 4L5TA 4L6TB 4C3IH 2JA7B 1H9SA 3MWYW 2ZM6L 1HFNA 2NBFA 4HJ7A 3URYA 4A93B 2IW3A 3P20A 2EZVA 1I3QB 1RJTA 3HKSA 4HIMA 3Q8DA 3R2IA 4DFAA 3FKIH 3CCSA 3QWNA 2XRSD 3OMGA 5L37A 4A76A 3KF8A 1RODA 1CKNA 3NHHA 1T5EA 5NUCA 1SNMA 3HOZB 5IYBG 1B9NA 4C3HH 2MNAA 4UP9A 2K33A 4B9XA 4XT3B 4KV6A 2SNMA 4FDBA 3JAMc 1VQJA 1SJED 2O5JC 1KD1C 1SMXA 2K5WA 1IBKL 1HNXL 5E7NA 1X3PA 1H9JA 1EU4A 1NBWA 2PNHA 5HGQA 2HIXA 2PW7A 4IOCA 2Z8LA 3U9OA 1LTLA 3I8ZA 1SNOA 2D2CC 2H4OA 2I5LX 1JWUD 1F2ZA 3H3VH 2VUMB 2N49A 2HD3A 3CRKC 2VB2X 5G3LD 3CCVA 3DWQA 4LF8Q 1HQRD 4O42A 5JVH3 4JI4L 1HZ9A 2K05A 3GTMB 2B2VA 2B63B 4CHTB 1EY5A 2IL8A 4MNOA 4OELB 4FO2A 2A6EC 2B8FA 1JE5A 4OX9L 1QG7A 3HOYG 2YTXA 2NN6H 1JJ2A 1ONLA 2F0TA 1ZYRC 2Q2TA 3H94A 1UAPA 1UEBA 5M5XH 3J80c 1JOQA 1JJCB 4AH6A 3KF6B 2RQXA 3P7JA 1QUQA 1IBLQ 4YWLA 2MJ8A 3EJIA 1D1IA 4LF4L 3PUXA 2Q2HA 1J5EL 4KTAA 2F0FA 2F0IA 5KYLA 5EKKA 1IZ6A 1SNQA 3C2PA 2WP8J 1HXYD 2NTSA 4NXMQ 3KBXA 1LM0A 4BA2I 4BS9A 1F9SA 3OYYA 5ELNA 2UU9Q 1EEFD 3A8KE 3BG3A 4MHEA 4F88A 2XWBB 4B9WA 2MGSA 4YY3Q 1HH2P 4PNYA 4DXGA 1RTNA 1M4VA 3MXPA 4DGZA 2F0NA 2VS1A 3AU7A 4J8QA 3FPUB 5EPJA 4JI6L 5I2YA 4GLAC 1XWEA 4IPDA 1I4XA 3A7AB 4DR3L 4DKAC 1U4MA 4KMUC 5E3FA 1BOSA 5BR8Q 4ZKBB 2XNAC 2HQLA 3K7AH 1IYVA 2RDFA 5EBDA 3SGIA 5HGTA 1SAPA 5J3BA 3HEJA 1BBWA 3OTOQ 2AUJD 4L8JA 4QMGA 4C3HB 1BR9A 2ZXPA 1WCMB 3CCRA 1LYLA 5IYBH 3FP9A 5AJ3Q 1SSOA 4MTKA 1KDAA 1FJGL 1FVIA 2HDLA 1TY2A 5CV9A 1VQ7A 4B3TL 2K14A 1NJIC 1TT2A 4ZUIA 4JG2A 2CW0C 3RR5A 3MZ5A 3UDXA 4PV1C 3RMHA 1E24A 4LWCA 2CH4A 2JA5B 4IJHA 1EY7A 1EQRA 2YTYA 3S2DH 2Z6KC 4HN7A 2F0SA 1YJ9A 4IQZA 1KHIA 4JBKA 5JPNC 1GUNA 2EY6A 3GTMH 2NVQH 1HA6A 4MTNA 1UWVA 3TBIB 3RLFA 1X56A 4RGMA 3GO5A 2EYJA 1UE6A 2VXWA 4JI3L 4IN3A 3ERQA 3TEHB 2KHSA 1CHQD 4L5QA 1STHA 3PIPA 2GVBA 3CXCA 1NY4A 3GDEA 2K7VA 2G9DA 2CWPA 3BDCA 1EY9A 3FRPB 2HIVA 1IL2A 1F9PA 4BY1G 1S5BD 3S14H 3M4OB 4R4IA 4ZQ3A 2EY2A 1SN8A 4ZK9B 2BCOA 3GTQH 5K36H 1RD9D 4R8IA 3J80E 4DUZL 3MFYA 4DUYQ 2R7FA 5IGCA 3IFDA 2R93B 5M3FH 2J7ZA 1TWHB 1SBBB 4KHZA 3W1BA 1DD2A 1B7YB 2IHEA 4IURA 1H9RA 5C3WA 2NZOA 1MJEA 4G7HC 1X3FA 2ZXRA 4Y52H 3E3XA 4L5SA 3TP8A 1JORA 3S2HB 1VMPA 5FKAC 2Q8IB 5M3FG 1LLRD 1CQFA 4R4QA 4A3JG 1ENFA 2LSSA 2K5NA 1TWFH 2ZJPA 4LF7L 2QGQA 2QDBA 4X62L 3RZOB 1F2LA 4JBJA 3CCEA 1YHQA 1HZBA 5M9OA 1BXTA 1LTAD 1OXTA 2Z4IA 3FEWX 2LXJA 4CDEC 3F2DA 5GAEC 4TVAB 3BDOA 3U9SA 3HOVH 3H6MA 5J22A 1VQ4A 5A2QL 4C1NK 1JOKA 1XMOL 3L9AX 2B2UA 2UXDQ 1EIHA 1U4LA 4AQYQ 3PSIA 2RHQB 1IBML 5M5YB 2EPBA 1YNND 2R3ZA 1X3EA 1O7YA 3TQYA 1O80A 3HOYB 3L7ZC 4A75A 1SFOH 2OTJA 3F2BA 3J81j 4IJLA 5JEAG 2PQAB 2PZWA 2KUMA 1PH4A 4JI0Q 2R7ZB 3CC4A 1K83B 3QOLA 3TDQA 2BDNA 2EIFA 4P75A 3T16A 1QNUA 1F77A 2I46A 3H91A 4FXDA 1VQGA 3CMAA 4TKOB 1K3RA 2IY5B 3TRZA 4QY7A 1MD2D 5FO8B 2HCIA 1QZGA 5JPMC 2NN6I 3HOWB 3AFPA 3NWSA 2B29A 1ILQA 1B44D 1ZXTA 3M4PA 4NDXA 3ULJA 2AMCB 1I50B 3RNUA 1FD7D 5LL6X 5BN3A 5IYDG 2NVTH 4HMIA 1BCPF 4IOAA 4PMCA 3K5LA 4O1NA 5JJIA 1VQ6A 2OEOA 4LF9L 4DK6C 2K4KA 2Z9HA 1XXGA 1V1PB 4B3RL 4IO9A 1K8AC 4C2MH 1VF7A 2EQSA 1KNEA 3D6CA 1XMOQ 3NP8A 3NXWA 4YHHQ 4L63B 1KTKA 4EQ5A 4DR4Q 1NSNS 3V96A 2Z6KA 2Q8RE 3VA7A 4RCOA 2JYOA 4LUZA 3BVGA 1U4PA 4AYBG 5EJWA 3IL8A 3AB9A 5EKIA 1PYBA 3OW7A 2C9OA 4JI1Q 1TS3A 2JA5G 1XPUA 4BY7H 5GQOA 3NK9A 1GUOA 1S5DD 1EFWA 2WB1G 3D3RA 1WCMH 3J7AF 2UUBL 1N32Q 1EIYB 1W2BA 1X32A 4ME5A 3CF5A 4DPGA 1DXMA 2B2WC 4A3CG 1MGSA 2RCFA 1WTXA 1E2WA 2CQOA 1ET6A 4A3KB 1TWGB 1CKOA 1HZCA 2ICEC 1EZ8A 2WB1E 3AEVA 2IT1A 1A2TA 4IUPA 3VR4A 2M00A 3T1HQ 1GM5A 2EOTA 2K75A 1UE1A 4Y7NH 3CAMA 4DV7L 1TVXA 4BY1B 3SXHA 5EPLA 3TP7A 2JJQA 4A3IB 2D0PA 2I5HA 1G6PA 2PQAA 3DWPA 2NVXH 3OHXC 2JXMB 2DNCA 4HR7B 1PFNA 4PQXA 1FNVA 1V8QA 1R4QB 5EPKA 1KXLA 3L2PA 1R4PB 1EEID 2EYHA 5FJ8H 2F0EA 5ELCA 4LF7Q 4GN5A 1EQTA 1EYAA 3EN2A 2L5TA 2RDGA 3HFZB 1HNWL 1WFQA 5M5YH 2KEEA 5ELOA 4LF5L 4H44C 3A5UA 2E2HH 1BDOA 3ZYYX 4DUYL 2F0OA 3H0GG 1HTPA 4DR6Q 1CZWA 3NQIA 5HY6A 2PZTA 4HTHA 2L12A 1CM9A 2G5DA 2UXBL 1XTCD 2B3GA 1EY8A 1XNQL 3KJOA 1B2TA 4X6AH 3OPOA 2UU9L 1J6QA 4KD4A 1EFID 1IBLL 2JQOA 3FKIB 3ND9A 1Q1EA 3R2TA 3BJUA 1IW7D 2F0LA 4DAYB 3VYRA 3F2CA 2B39A 2EYLA 2Y0SE 2JA7G 4LF6Q 3G71A 1KIXA 4BXXG 3S1NB 4CDFC 3I90A 2PW5A 3FKIG 3ND8A 1YIJA 3HOWG 4ZUJA 3SE0A 4KKTA 2VQEL 1YITA 4OO1H 4LFCQ 1K0SA 3IKJA 2L1BA 5E1FA 2SDFA 1B70B 3S16H 2F3VA 2Y0SG 2P5ZX 1LTID 2UUAQ 4C1NI 2L9HA 1CZGA 5F2DA 1EOTA 1GHJA 1KL9A 1PFBA 1U5KA 1LUZA 1LABA 3QOJA 4A3BG 2F0UA 2K28A 3K5MA 3EA6A 2FMCA 1HNXQ 1SMYD 3DM3A 4X66L 1VF5C 1SE3A 3TS0A 2FINB 4HJ8A 4HMJA 4GLXA 1VQEA 2Q2UA 4QB4A 1WTPA 2XN9C 3MEHA 5D14A 1TS2A 4OL7A 1NNXA 3I70A 3K5NA 2L0CA 5IGBA 1FL0A 1QJOA 1Q3LA 3EQLC 5C5LA 3MVVA 1D8LA 4A3FG 1A15A 1BVSA 2JA6H 1NTGA 3BYTB 2DGYA 4AYBE 1NR4A 1EY4A 3PUWA 5CV7A 2PPBC 2K5HA 2MPMA 2DJFC 5KYIA 4JI2L 1VQFA 3S15H 4DK0A 4IFDJ 4DNIA 1YHBA 3OIPA 2SEBD 4A3KG 3VR5A 3SDZA 1M1KC 3TMEA 1KRSA 1BKBA 1PHJA 3GV6A 2B63G 1KRTA 3U58A 1O7ZA 1UUPA 4NB3A 4ABNA 4U68A 4JYAQ 4DR7L 3D4RA 3LGJA 1A3UA 3MC0B 1IYJB 1G6ZA 3HKZE 3KK7A 4YIJA 1HJPA 1DCZA 5IWAL 2PMZB 5IYDH 4X3TA 4O2DA 1ICWA 3K0XA 1DZ1A 3PCOB 3WOFA 3A55A 3SR1A 3D8GA 3OOCA 5M5XB 1HCZA 1BO0A 3RN2A 1D5ZC 1WTQA 4LNQA 3G6EA 1VQIA 1S5CD 4BY7B 3M4OH 3S14B 1LT4D 2JEBI 4R1JA 2J0TD 2IJ0A 1AP0A 5J39A 2UXCQ 1E22A 1SRUA 3PUYA 4NXNQ 3E6ZX 2PNRC 3H15A 1EYGA 2A19A 3PO2G 1PZKD 3T4AC 4HAEA 5CR3A 4JW0A 2ZJRA 5DEHA 3S1QH 1SDFA 3J81i 1MJCA 5TSSA 1B4OA 1CKMA 2LS01 4DAMA 1EIFA 4MZ9A 4TSSA 4IFDH 3CPFA 1CSQA 1LT5D 3SK6A 4FF3A 1JJGA 2E5LQ 2FXQA 4JI8Q 1V43A 2A68C 1A6XA 4DXFA 3J7YW 1JT8A 1NE3A 1E7ZA 4DK1A 4P2CB 3KF6A 3TP6A 2J4XA 2EY5A 1OTCA 2O5IC 2A5HA 2Z6BA 1TQOA 1HPCA 1YHAA 2B2TC 4A3LH 3QB3A 3R3OA 5CV4A 1J9OA 1XNQQ 3U4ZA 3I72A 4DV2L 1HNWQ 4KJOA 3P75A 5DNFA 1EQQA 1QVGA 2QDLA 5C3EB 2QEXA 3U50C 4B08A 3EROA 5ELFA 2CVRA 4X3KA 1QZHA 2A74C 3S1QB 4FF1A 2NB0A 3ONAB 1EWIA 1L0WA 1CA5A 4BBSG 1RKNA 2PI2E 5JAVA 3EBEA 3RUZA 1CK1A 1CA6A 4OONA 5ELDA 4DAVA 4X65L 5C4JH 1WTHA 3DM1A 4PZ7A 4R8NA 4KN7C 2YU9H 1N33L 1A2UA 3VR3A 4HEDA 3NE5B 3CU7A 3CQZB 1K0RA 3ZJYC 2OTLA 1R9TB 3A7LA 3W3AA 4A3FB 4NXML 1HR0W 4LF9Q 3PQIA 2KHIA 2VW9A 1MKHA 5IGGA 1PFSA 2ZTEA 1S5ED 1W6KA 4FXKC 1II3A 1Y69U 2UUCL 4B3SQ 2ES2A 2R6GA 1OXUA 4IUUA 1SNDA 1VQNA 4IFDI 4C3JB 4X64Q 1WD0A 3JAMi 4V0BA 3GTGB 1Y1VH 2PMZE 1Q82C 3H0GH 3W5OA 2ID0A 3VYSA 5COYA 1KDBA 1I5FA 3J81c 4DV6L 1YNJD 3D0FA 3HOZG 3HP3A 3J81L 1JC7A 2CQAA 4M1UB 2F0MA 2HCCA 5C0XJ 4Q0FA 2ZM6Q 1M8AA 3MEFA 4EQNA 3GTKH 2EYMA 3UDFA 2QW7A 4GN3B 1GVPA 2EVBA 1VQ8A 3PGZA 5C4HA 5IE8A 2EYPA 3C1FA 5T1GA 4A3BH 2VQFQ 2OCEA 4RGTA 3HOXB 1SYDA 2EJFC 1D6EC 2NVXB 3HKZG 2WB1B 3HRZC 4BBRB 1G2SA 3TSSA 2ALYB 2G9HD 1SE2A 1WYDA 3KDFB 5C0XI 3HOVB 5FLXL 4K0KL 1MBYA 2JP1A 5I9PA 4B3TQ 3MFGA 4G57A 3S17B 1PTOB 1IW7C 1Q46A 2I07B 3UE0A 2N3SA 1MSGA 1EWHA 2LMCB 5C44H 1VQMA 4PMWA 5IT9c 1A3VA 2DNEA 3OIQA 1K28A 1E2VA 3ER0A 3CD6A 4J6HA 3OWEB 1B1ZA 4N9PA 4OWWB 3RLOA 4N8X1 3QJYA 1ESFA 4JI7Q 4JYAL 2NYZD 1S40A 4DK3C 1SE8A 1G51A 4YCUA 1HR0Q 3I4MH 1K8GA 1UE5A 1STAA 1STNA 3CC7A 4OEMB 1IXRA 4QJFA 5DM73 1E2ZA 3PO3H 1NUCA 3KUPA 3F8TA 1BCPC 1WVLA 4GKKL 1RF2D 4ID6A 1SNPA 3I2ZA 3KLRA 4RKBA 3UDGA 4A3FH 2JA6G 2SNSA 3NBIA 1ASYA 1PFMA 2K01A 4BBRH 2KJXA 3S1NH 4OIKA 4DR1L 1LTGD 2WIIB 3GTQB 2E8GA 4JI8L 4A3GB 3HOUB 2ZTCA 3A0JA 4GOPA 1LTBD 3CCQA 1GKHA 1STYA 3A8JE 1V1QA 2F0KA 1FR3A 3TZUA 4GOPB 1PVOA 1XMQQ 1KABA 1WTOA 2CH4W 5IOCA 4HIKA 3IRBA 4CDCC 4RHSA 3IFTA 1U0LA 2IHFA 1E0BA 2HQEA 4HCEA 2B2VC 1VS0A 5CORA 5KIXA 2VUMH 3HOXG 1JE4A 1HNZL 2XVSA 1G2TA 5M5WB 3GV3A 1F2YA 1S72A 3T1YQ 3K80C 3M85A 3ITPA 4X66Q 4IUQA 5C3XA 5LL6S 4AIMA 1KLGD 1I6HB 1RCVD 3M3YH 4OO1G 2D0OA 1A8VA 3I91A 4GZYC 4UDUC 3K6OA 2ENBA 4OO1I 3VDYA 1XYIA 2VY3A 3F1ZA 4POFA 1WD1A 4KKSA 4XQQA 1ML0D 4K5VA 1PXUA 1XNRL 1AZPA 3NENA 3K57A 4IALA 5GAHC 1VCIA 4APVA 1VQLA 2NVYH 2JA9A 4RKLA 3TN2A 1FJGQ 5KNBA 4R4OA 4XQNA 3PUVA 5IWAQ 1Q8KA 1YJWA 1F9QA 5IGFA 3A74A 2VL6A 4DV5L 1WI5A 4JBWA 4UAIA 5KGUA 3Q23A 1PRTB 3EVQA 1T9HA 2A8VA 3QIAA 1Z7TA 5IYCG 4LUVA 1AEXA 3A5ZB 3GTJH 2F4VL 2LFNA 1F2MA 1H95A 1SROA 4DR7Q 1WCMG 2XGTA 4JPBW 3PIO3 2FHTA 2TMPA 3S1RH 3V05A 1MI2A 1AW7A 5EGTA 3AFQA 3PIP3 3NTKA 2BDOA 1GHKA 1I4RA 1WTWA 4QQBX 1PTOC 5GAGC 3KFUA 2WFWA 2B2WA 5KRUA 4LFBQ 2JA6B 4LF5Q 1QOHA 5M3MH 2QF7A 4DV1Q 3HOVG 1RHPA 4LFCL 5IODA 3B6YA 2IX0A 1TS5A 5A35A 1X3QA 5C6AA 3GP7A 1OXSC 1TU2B 1Y1WB 2I5MX 2QILA 2XIWA 3HOWH 1TWCB 1A3TA 3T51B 3J7A5 2NVTB 3QR8A 3L0OA 1GD7A 2BH2A 2AWNA 2OWOA 1BBUA 1SXTA 5I9OA 4GOPC 3NUCA 4IPCA 3NSWA 4HJAA 1K8OA 3SHLA 3RZDB 2B2YC 3A56A 5I2XA 3L3OC 1YNJC 4HJ5A 1EZ6A 2R7ZG 4KHPQ 1AH9A 3BU2A 3M3YB 3G6JB 2KCNA 1HFGA 1KAWA 1S4ZA 3KDFA 4DN4M 3CMEA 3F2UA 2EY1A 4GLVB 1U9RA 2F52A 1LTRD 4FYDA 5IGEA 4ZAIA 4DR2L 1TWFB 2EE1A 5BR8L 2Z0SA 5K5PA 1XJVA 3CCJA 1ASZA 3KF8B 3WWVA 1CUKA 4JI5L 4ZYSA 1HA5A 1N36Q 4K8IA 5CV5A 1D5MC 4LUOA 2VB3X 2JEAI 2X69A 2ATWA 2KOLA 1NMGA 2F03A 1FGBD 5FOBB 2K52A 2IWHA 4X3UA 4C3IB 4MN3A 1PZJD 4A3MG 1IYUA 1GJXA 5IIFA 1DGSA 2JA5H 4DR1Q 3BVMA 2A69D 5IGDA 1C9OA 5M3FB 1MIUA 4DV3L 2WV6D 1AE3A 1PRTC 3GQBA 1VQ5A 3MXGA 5C5MA 4DR6L 1Y8NB 3VYTA 4C3IG 4FNFA 1VQOA 1TKWB 4GN4B 1Q1BA 2KQ3A 2A73B 2DJGC 1X6OA 1N9WA 1Y14B 2WAQE 5CV6A 1VDZA 1A0IA 5C4XG 5DLQE 4A3DG 3A54A 1H9MA 3RLNA 1A63A 1H9KA 1FNUA 4IFDG 2L11A 3MTSA 5FLXc 1W6JA 3KLSA 3BZCA 3DEOA 1Y1WH 2GVAA 1J8IA 2K5DA 5AFWA 1PYWD 3N52A 4BBSH 3TREA 1I94L 5IT9L 4PZ6A 3KJPA 2EJMA 4GNXC 2TSSA 3K8AA 2R92G 5T1IA 1L1OA 4IZ8A 1LT6D 4QF4A 2VQEQ 1PZID 1JQYD 1AE2A 4H13C 3M7GA 4LF8L 4LW1A 1WTVA 1SJHD 4J1MA 4HIDA 3E0JA 1SFOB 4DV5Q 4I65A 3S1RB 5I4DA 1YNNC 2NWGA 5BN4A 1WOCA 4NW2A 3BYYB 4BA1I 5CMDA 5LMNL 1JCKB 2F3WA 1HQMC 4OIJA 3S24A 1STBA 1OXXK 4QL5A 3QG1A 1QUQB 4K5WA 4UHVA 4EVOA 1N34Q 1UNSA 1R9TH 1SNCA 4GNXA 3UDIA 2EYFA 2PCFB 4JV5Q 1IKLA 4I7ZC 4FP5D 1DM0B 3GTLH 1GUWA 1JICA 4A3EB 4A3JH 3I4LA 3OW2A 4Q5VA 3WDNA 5JJZA 1EL0A 2E2JH 4DNTB 4A3CH 2R93G 2A68D 3NTHA 1CFMA 4FF2A 4DV1L 1FNWA 1DYQA 5D3DA 1V1OA 1BCPB 3SEBA 3STBD 1TWHH 3J7AV 1ET9A 4G7ZC 4JVZA 1JOOA 1XPRA 1PA6A 2JA8G 5CC4A 3S1MB 4B3ML 3IAYA 3S1MH 3I55A 4JI7L 4A3DB 2H1EA 2FFKB 1UE7A 3M4YA 3EFXD 5KNCA 2ZTDA 1G291 1L2FA 1LV9A 1AZQA 1BF4A 4BY1H 1OO9B 4BBRG 5AJ3L 3E9IA 3J80i 1PRTD 4A3LG 5IP7G 5CV8A 4AQYL 1SYEA 1I6VC 1ZYRD 4F7XA 5JJLA 3QO2A 3PO2H 2LKVA 2MP1A 1NCVA 1EWCA 4IPHA 1E3PA 1B53A 2F0JA 1PDQA 2KVMA 4NP5A 4DV0Q 1DOKA 4UY8C 4BBSB 3I73A 1Q81C 4ALPA 4XT1B 2DN8A 2WACA 3S17H 2XTIA 1PH3A 2F0PA 3GTGH 4K2LA 4RH6A 1KAAA 1PH7A 5C44B 2PO4A 1EYCA 4FF4A 1QWYA 1PLFA 5EQ0A 4B3MQ 4A3KH 2R92B 1D2BA 3Q6SA 4WJWA 3E0EA 3S2DB 3NTIA 4CKBA 2F0DA 1M90C 2UXCL 3D6WA 2BE5C 5DM63 4POGA 4C3JG 4QUCA 1VQHA 5E4WC 4KLKA 1LO5D 1PH2A 5JOBA 1C7YA 3FHWA 1BQQT 1JB3A 4TRDA 5EKLA 5M5WH 4DR4L 1TS4A 4RG1A 1D7QA 1HZAA 4NMZA 3CQZH 2RBMA 1SR3A 4BXXH 5IP9H 1GUSA 3J80L 2MO1A 4A3EG 2NN6G 1CKNB 1BCPD 2ZT9C 2WINB 4K6DA 1BBXC 2L55A 3Q0AA 4OGQC 4A3EH 3ULPA 2CCZA 2JSOA 3M7NA 1A62A 1LTSD 5CBAE 3KYHC 1KNAA 4JI4Q 1PRTF 5GROA 4DUZQ 3HOUH 3BVZA 4CJ0B 2NTTA 1PH9A 1F9RA 1N8RC 3O13A 4EX5A 4DAPA 2DY7A 4K6LA 4YWMA 1JMCA 2KENA 4ULLA 4IUNA 4X62Q 2RDHA 3CKIB 1IL8A 3DUZA 2F0HA 3E5SA 5IYCH 3MXUA 1RL2A 5I6WA 1H9SB 1C4QA 1X9NA 1QILA 2F0QA 4WFN3 4YY3L 4K0KQ 2MQHA 4DV0L 2E74C 2AUKA 1Y8PB 1MHWC 1O78A 1PH6A 4DR5L 2IX3A 1DJRD 2K5QA 2V4DA 2YYZA 3LWEA 2RA4A 5HURA 2YV5A 1TWAH 1HR0L 4QGUA 3K81C 2RVLA 3VYUA 1IBMQ 2A6ED 3S9WA 5FK9C 1STGA 4JCVE 1JWSD 3OTOL 3W1GA 1G8ZD 3FVQA 1CT1D 5FO9B 3I4NB 4RGNA 4QUFA 2X6GA 1B8AA 4F8MA 3HS0C 1HHVA 5M3MB 4FVMA 5D65A 3CHBD 4RHRA 4DV2Q 2K1BA 1B50A 1X3GA 4KN4C 2NZHA 1I4PA 2JA8H 1TWCH 4HSPA 1U4RA 1VQBA 4K14A 2RSNA 4O0AA 3A8IE 4XQJA 4P71A 1K73C 1EY6A 5C0XH 2WKDA 2N8NA 3H3VI 2UUCQ 3TS2A 4K8JA 2IPKD 1XX8A 5C3EH 1TXYA 1JB7A 5IP7H 3UI2A 4I7AA 3KLSX 1YEZA 4JI3Q 3PMFA 4JI5Q 3D4WA 1DOLA 2HT1A 1GO3E 4JV5L 4BY7G 4OXPA 3GTOH 1HUMA 2AQ3B 3T56B 4EQPA 4WJ4A 1VQ9A 3BDLA 4A3IH 4DNRB 3VR2A 1L0XB 3P1HA 1Q7YC 3CCMA 2M2LA 1SLJA 2VUMG 2L15A 4QIWB 4LFAQ 2D9UA 5KNDA 4RWSC 3JAME 1PH1A 4H02A 4OWXB 1NMFA 1VQPA 3LX0A 1P16A 3CP0A 3NPPA 2AQ2B 2XWJB 4MIUA 2K50A 2AQ1B 4ILWA 2C5CA 5CBEE 2KEDA 4IPGA 3GTLB 2EJGC 3I3CA 4CKEA 3AMUA 3C3LA 3JAML 4KJNA 4LAAA 1PTOF 1B9MA 2DUDA 3K7UC 4JK1C 4C56C 2Y0SB 4XYOA 3Q22A 2QKIC 2E2IH 3RD4A 3T13A 2EDGA 3NWTA 4U673 2BA1A 4A93H 1HUNA 4K2KA 2R93H 3CCLA 3NQTA 1SMYC 2LXKA 2X6LA 3RZDH 1YJNA 4R9WA 3D4DA 2RSOA 2AHOB 1I3QH 2JN4A 4LFAL 4A3BB 2UUAL 4CDDC 1I4HA 1TWAB 2I0QA 2AKWB 2F4VQ 1I94Q 1Z47A 1KC8C 4A3DH 3PIOA 3ULLA 5C44G 2A6HC 3V2TA 1Y8OB 2KCTA 3NBHA 1WJJA 2FJ2A 4YHHL 2MUYA 2PQEA 3I4OA 2E75C 4G7OC 4PZ8A 1VQKA 4UP8A 4LF4Q 2KECA 2N78A 2MHVA 4RMFA 1PTOH 5JEAH 3DLLA 4HIOA 5J1ZA 1C8CA 5ELEA 3PO2B 5LMNQ 3GD7A 3KLWA 1J5EQ 1B3AA 1MSHA 2OT2A 1TWGH 1JR0D 2RCNA 1JWMD 3DEPA 3M9BA 4C3HG 2E5LL 2YTVA 2OQKA 2NUCA 4TQUS 3MHBA 1D5XC 3ERSX 2LY7A 1QVFA 4GS3A 1YZ6A 1VQAA 4BWGB 2IX1A 3GTPH 1KDCA 5CYUA 3GTJB 5FO7B 4RAUC 4DAYA 2KA7A 3HOYH 1K83H 2JK8A 4HCSA 2R61A 2F0VA 1YBYA 2B8GA 3H3VC 3STBC 2GN5A 4JC0A 1CHPD 1YI2A 2B63H 5CGKA 2QA4A 2BE5D 5C4JB 3NELA 1VMCA 2SOBA 3K7AB 2CHBD 2MFIA 2EXDA 1N33Q 2BA0A 2CW0D 1SEBD 3BS1A 5IT9E 1G91A 2QEJC 4ZLTF 2NVYB 1C48A 1I4GA 1RTOA 5C3EG 3I4MG 1S3OA 1O7IA 5C4XB 4XTCS 2O4XA 4P72A 5C4XH 2ZJQA 4EGVA 4R4CA 2BH8A 4WORA 2Q8TA 1Q90A 3TZDA 2E2HB 1I4QA 3HOUG 3S15B 2L4NA 2N88A 3T1YL 2NZ1D 3HGBA 1LTTD 5C4ZA 1Y1VB 1XMQL 2RF4A 3BZDB 3SK4A 1N34L 5LMNW 4QCLA 1PYSB 3WOEA 3GTOB 5H1SE 3DWAA 4OX9Q 1NR2A 3PUZA 4A3MH 3G4SA 1RDPD 1UEAB 5FLMG 3DHQA 3S2HH 4ODGA 4C2MB 3GTKB 4P74A 2WAQG 2CWAA 1AN8A 2NVQB 4CGYB 1ILPA 1KLUD 2QCPX 1HNZQ 5A2QE 2K6AA 4K5XA 2N55A 2XRQD 3X3NA 3I7FA 2KHJA 3CRLC 1SYBA 1Z6HA 1VQCA 2E76C 2F1MA 1I6HH 1NAPA 4CJ1B 3MAQA 3TP5A 3FPPA 4YCVA 4LF6L 1N32L 4KKUA 4M8AA 4A3JB 2BOSA 1L1OB 3J7ZC 1ESRA 1O7LA 2E2JB 4ZCKA 2FMMA 4RFBA 3LWUA 1K3BC 3MXNA 3U4VA 2E2IB 1EUJA 1KQSA 5IY0A 3CW2C 4FXGC 3X3MA 3K59A 5JJKA 1SYCA 2WKCA 1Q86C 2JA8B 1GUTA 4DV7Q 2UXDL 1B3QA 2CKZB 1PH5A 1EIGA 2HHHL 3K58A 2ICIA 1X54A 2JE6I 2KCCA 3DXJC 5LHY1 4LK1C 2K32A 1E1TA 2E2DC 1HRJA 1TR5A 1Q12A 4XIGS 5I6YA 3HG9A 4L5RC 4JOIA 4KY5A 1LT3D 4LFBL 2UUBQ 1QVCA 3W2DA 3RZOH 2GA4B 3ICEA 2F3IA 4F87A 4GKKQ 4KY6A 3CCUA 2RKSA 4J15A 2OF1A 4CBVA 1DOMA 4GKJQ 1ZEQX 1Q8IA 3J81E 4QIWE 1L1OC 4JI6Q 2B2UC 1IBKQ 1PTOD 1RIPA 5ELBA 4RCNA 1S5FD 1ENCA 2VNUD 3SK8A 3M4QA 3H0GB 1C0AA 4LJZC 4JI2Q 3MA2B 1EYDA 2OXPA 3GTPB 2R7DA 2Z4HA 5GADC 2K5VA 3OMCA 3CPWA 1D1KA
chains in the Genus database with same CATH topology
1STEA 1PMRA 2K03A 4IUVA 4LMQD 3DMUA 4G4KA 2EXZA 2HUGA 4E6IA 4RGOS 2F0GA 5KEEA 1WTRA 1HTLD 4Y7NB 2D5DA 2WAQB 3T53B 3C1EA 4KY7A 1L0YB 1SYFA 4CJ2C 4KHVA 1AFPA 3PV0A 1V1PA 1QCBD 2K04A 3LNNA 4X3SA 3OSOA 5C0XG 4NKLA 3D31A 1BNZA 2F4IA 2PYKA 3R93A 4A3MB 3SVMA 1T5XD 4DA2A 1K8MA 2AWOA 1CQVA 4KI0A 4PMBA 5JVG3 3HZXA 3I4MB 2M9VA 5BN5A 4HSVA 2Z1CA 2F0WA 3K5OA 4ZKCB 3HKZB 3PO3B 5DAUA 1EQVA 2D62A 3KBGA 3VA5A 4XYQA 4N9TA 3FMCA 4WRDA 2PZUA 4IUTA 5FLXE 1ZKOA 3Q24A 1EU3A 1GUGA 1BUVT 1QB5D 4XDXA 4H0LC 5E4XA 1GXDC 1LACA 1IKMA 1OXVA 1FYCA 2EYOA 1QNKA 4DF7A 1GOZA 3S16B 3H09A 1TIID 2A6HD 5EBCA 4KK7A 3R8BA 2O2LD 2B2TA 3VR6A 5D3IB 3FDTA 1ENAA 2A69C 3C46A 4DU9A 1TY0A 2XSCA 4S3SA 2YU9B 1SYGA 4RA8A 3G7LA 4Z9CB 1DONA 5JEAJ 1CTMA 5G3LF 2ZXOA 3K0YA 1CI3M 4XXEA 4AYBB 5ISRA 1SE4A 2HDMA 1QE6A 4CKCA 4H7BA 3N6RA 3OWFA 5K36G 2DY8A 4KD3A 1EY0A 3SK5A 1IHZA 4OHJA 2B2YA 4ZRZA 4EQOA 4V190 4L6TB 2JA7B 1H9SA 3MWYW 1HFNA 2NBFA 3URYA 4A93B 2IW3A 3P20A 2EZVA 1I3QB 1RJTA 3R2IA 4DFAA 3QWNA 2XRSD 3OMGA 3KF8A 1RODA 3NHHA 1T5EA 5NUCA 1SNMA 3HOZB 1B9NA 2K33A 4B9XA 4XT3B 4KV6A 2SNMA 1SJED 2O5JC 2K5WA 1X3PA 1H9JA 1EU4A 2PW7A 2Z8LA 3U9OA 3I8ZA 1SNOA 2D2CC 2H4OA 1JWUD 1F2ZA 2VUMB 3CRKC 2VB2X 5G3LD 3DWQA 1HQRD 4O42A 5JVH3 2K05A 3GTMB 2B2VA 2B63B 4CHTB 1EY5A 2IL8A 4FO2A 2A6EC 2B8FA 1QG7A 2NN6H 1ONLA 2F0TA 1ZYRC 3H94A 1UAPA 1JOQA 2RQXA 3P7JA 2MJ8A 3EJIA 1D1IA 3PUXA 4KTAA 2F0FA 2F0IA 5KYLA 5EKKA 1SNQA 3C2PA 2WP8J 1HXYD 2NTSA 3KBXA 4BA2I 4BS9A 1F9SA 1EEFD 3A8KE 3BG3A 4MHEA 4F88A 2XWBB 4B9WA 2MGSA 4PNYA 4DXGA 1RTNA 1M4VA 3MXPA 4DGZA 2F0NA 3AU7A 4J8QA 5EPJA 3FPUB 5I2YA 1XWEA 1I4XA 3A7AB 1U4MA 4KMUC 5E3FA 1BOSA 4ZKBB 2XNAC 1IYVA 2RDFA 5EBDA 5HGTA 1SAPA 3HEJA 2AUJD 4L8JA 4QMGA 4C3HB 1BR9A 2ZXPA 1WCMB 1SSOA 1KDAA 2HDLA 1TY2A 5CV9A 1TT2A 4ZUIA 2CW0C 3MZ5A 4PV1C 3RMHA 2JA5B 1EY7A 4HN7A 2F0SA 4IQZA 5JPNC 1GUNA 2EY6A 1HA6A 3TBIB 3RLFA 4RGMA 3GO5A 2EYJA 2VXWA 4IN3A 3ERQA 2KHSA 1CHQD 1STHA 2K7VA 2G9DA 3BDCA 1EY9A 3FRPB 1F9PA 1S5BD 3M4OB 4ZQ3A 2EY2A 4ZK9B 2BCOA 5K36H 1RD9D 4R8IA 3J80E 3MFYA 5IGCA 3IFDA 2R93B 2J7ZA 1TWHB 1SBBB 4KHZA 1DD2A 4IURA 1H9RA 5C3WA 4G7HC 2ZXRA 3TP8A 1JORA 3S2HB 1VMPA 5FKAC 2Q8IB 1LLRD 1CQFA 1ENFA 2QDBA 3RZOB 1F2LA 5M9OA 1BXTA 1LTAD 1OXTA 2Z4IA 3FEWX 3BDOA 3U9SA 3H6MA 5J22A 5A2QL 4C1NK 1JOKA 3L9AX 2B2UA 1EIHA 1U4LA 5M5YB 2EPBA 1YNND 2R3ZA 1O7YA 1O80A 3HOYB 3L7ZC 5JEAG 2PZWA 2KUMA 2R7ZB 1K83B 3QOLA 3TDQA 2BDNA 3T16A 1QNUA 1F77A 2I46A 3H91A 4FXDA 4TKOB 1MD2D 5FO8B 2HCIA 5JPMC 2NN6I 3HOWB 3NWSA 1ILQA 1B44D 1ZXTA 4NDXA 1I50B 1FD7D 5LL6X 5BN3A 4HMIA 1BCPF 4PMCA 3K5LA 4O1NA 2OEOA 1XXGA 1V1PB 1VF7A 1KNEA 3D6CA 3NP8A 3NXWA 4L63B 1KTKA 1NSNS 3V96A 2Q8RE 3VA7A 4RCOA 2JYOA 3BVGA 1U4PA 5EJWA 3IL8A 3AB9A 5EKIA 3OW7A 2C9OA 1TS3A 3NK9A 1GUOA 1S5DD 3D3RA 3J7AF 1X32A 4ME5A 1DXMA 2B2WC 1MGSA 1WTXA 1E2WA 1ET6A 4A3KB 1TWGB 2ICEC 1EZ8A 2IT1A 1A2TA 4IUPA 3VR4A 2M00A 2EOTA 1TVXA 4BY1B 3SXHA 5EPLA 3TP7A 4A3IB 3DWPA 3OHXC 2JXMB 2DNCA 4HR7B 1PFNA 4PQXA 1FNVA 1V8QA 1R4QB 5EPKA 1R4PB 1EEID 2EYHA 2F0EA 5ELCA 1EQTA 1EYAA 2L5TA 2RDGA 2KEEA 4H44C 1BDOA 3ZYYX 2F0OA 1HTPA 1CZWA 3NQIA 2PZTA 4HTHA 2L12A 1CM9A 1XTCD 1EY8A 1B2TA 3OPOA 4KD4A 1EFID 3FKIB 3ND9A 1Q1EA 3R2TA 1IW7D 2F0LA 3VYRA 2B39A 2EYLA 3S1NB 2PW5A 3I90A 3ND8A 4ZUJA 3SE0A 4KKTA 4OO1H 3IKJA 2L1BA 5E1FA 2SDFA 2F3VA 1LTID 4C1NI 2L9HA 1CZGA 5F2DA 1EOTA 1GHJA 1PFBA 3QOJA 1LABA 2F0UA 2K28A 3K5MA 3EA6A 2FMCA 1SMYD 1VF5C 1SE3A 2FINB 4HMJA 4QB4A 1WTPA 2XN9C 3MEHA 5D14A 1TS2A 4OL7A 3I70A 3K5NA 2L0CA 5IGBA 1QJOA 1Q3LA 3EQLC 5C5LA 3MVVA 1A15A 3BYTB 1NR4A 1EY4A 3PUWA 5CV7A 2PPBC 2MPMA 5KYIA 4DK0A 4IFDJ 3OIPA 2SEBD 3VR5A 3SDZA 3TMEA 3GV6A 1O7ZA 1UUPA 4ABNA 4U68A 3D4RA 1A3UA 3MC0B 1G6ZA 3KK7A 4YIJA 1DCZA 2PMZB 4X3TA 1ICWA 1DZ1A 3WOFA 3A55A 3SR1A 3D8GA 3OOCA 5M5XB 1HCZA 1BO0A 1D5ZC 1WTQA 1S5CD 4BY7B 3S14B 1LT4D 2JEBI 2J0TD 2IJ0A 1AP0A 5J39A 3PUYA 3E6ZX 2PNRC 1PZKD 3T4AC 4HAEA 5CR3A 5DEHA 1SDFA 5TSSA 1B4OA 2LS01 4TSSA 4IFDH 1LT5D 3SK6A 4FF3A 1V43A 2A68C 1A6XA 4DXFA 3J7YW 4DK1A 4P2CB 3TP6A 2J4XA 2EY5A 2O5IC 2A5HA 1TQOA 1HPCA 2B2TC 3QB3A 3R3OA 5CV4A 1J9OA 3I72A 4KJOA 3P75A 5DNFA 5C3EB 4B08A 3EROA 5ELFA 2CVRA 4X3KA 2A74C 3S1QB 4FF1A 2NB0A 3ONAB 1CA5A 1RKNA 5JAVA 3RUZA 1CK1A 1CA6A 5ELDA 4DAVA 4R8NA 3DM1A 4KN7C 1A2UA 3VR3A 4HEDA 3NE5B 3CU7A 3CQZB 1R9TB 3A7LA 3W3AA 4A3FB 5IGGA 1S5ED 1W6KA 4FXKC 1II3A 1Y69U 2R6GA 1OXUA 4IUUA 1SNDA 4IFDI 4C3JB 1WD0A 4V0BA 3GTGB 2ID0A 3VYSA 5COYA 1KDBA 1YNJD 3HP3A 3J81L 1JC7A 2CQAA 4M1UB 2F0MA 2HCCA 5C0XJ 4Q0FA 1M8AA 4EQNA 2EYMA 2EVBA 5C4HA 2EYPA 3C1FA 5T1GA 4RGTA 3HOXB 1SYDA 2EJFC 1D6EC 2NVXB 2WB1B 3HRZC 4BBRB 1G2SA 3TSSA 2G9HD 1SE2A 3HOVB 5C0XI 5FLXL 1MBYA 2JP1A 5I9PA 3MFGA 4G57A 3S17B 1PTOB 1IW7C 2I07B 1MSGA 1EWHA 2LMCB 4PMWA 1A3VA 2DNEA 3OIQA 1E2VA 4J6HA 3OWEB 1B1ZA 4N9PA 3QJYA 1ESFA 2NYZD 1STAA 1STNA 5DM73 1E2ZA 1NUCA 3KUPA 1BCPC 1WVLA 1RF2D 4ID6A 1SNPA 4RKBA 3KLRA 2SNSA 3NBIA 1PFMA 2K01A 2KJXA 4OIKA 1LTGD 2WIIB 3GTQB 4A3GB 3HOUB 1LTBD 1STYA 3A8JE 2F0KA 1FR3A 3TZUA 1KABA 1WTOA 5IOCA 4RHSA 3IFTA 1E0BA 2HQEA 4HCEA 2B2VC 5CORA 5KIXA 1JE4A 2XVSA 1G2TA 5M5WB 3GV3A 1F2YA 3M85A 3ITPA 4IUQA 5C3XA 5LL6S 1KLGD 1I6HB 1RCVD 4OO1G 3I91A 4GZYC 4UDUC 3K6OA 2ENBA 4OO1I 1XYIA 1WD1A 4KKSA 4XQQA 1ML0D 4K5VA 1PXUA 1AZPA 3K57A 4IALA 1VCIA 4RKLA 3TN2A 5KNBA 4XQNA 3PUVA 1F9QA 5IGFA 4JBWA 4UAIA 5KGUA 3Q23A 1PRTB 3EVQA 3QIAA 1Z7TA 1AEXA 2LFNA 1F2MA 3PIO3 2FHTA 2TMPA 3V05A 1MI2A 1AW7A 5EGTA 3PIP3 3NTKA 2BDOA 1GHKA 1I4RA 1WTWA 1PTOC 2B2WA 5KRUA 2JA6B 1QOHA 2QF7A 1RHPA 5IODA 2IX0A 1TS5A 5A35A 1X3QA 5C6AA 3GP7A 1OXSC 1TU2B 1Y1WB 2QILA 2XIWA 1TWCB 1A3TA 3T51B 2NVTB 2AWNA 1SXTA 5I9OA 3NUCA 3NSWA 1K8OA 3SHLA 3RZDB 2B2YC 3A56A 5I2XA 3L3OC 1YNJC 1EZ6A 3M3YB 3G6JB 2KCNA 1HFGA 1S4ZA 4DN4M 3F2UA 2EY1A 1U9RA 1LTRD 4FYDA 5IGEA 4ZAIA 1TWFB 2EE1A 5K5PA 4ZYSA 1HA5A 4K8IA 5CV5A 1D5MC 2VB3X 2JEAI 2X69A 2KOLA 2F03A 1FGBD 5FOBB 2IWHA 4X3UA 4C3IB 4MN3A 1PZJD 1IYUA 1GJXA 5IIFA 3BVMA 2A69D 5IGDA 5M3FB 2WV6D 1PRTC 3GQBA 3MXGA 5C5MA 1Y8NB 3VYTA 4C3IG 4FNFA 1TKWB 1Q1BA 2KQ3A 2A73B 5CV6A 1VDZA 3A54A 1H9MA 1H9KA 1FNUA 4IFDG 2L11A 3MTSA 1W6JA 3KLSA 3DEOA 1J8IA 2K5DA 5AFWA 1PYWD 3N52A 5IT9L 2EJMA 2TSSA 5T1IA 4IZ8A 1LT6D 4QF4A 1PZID 1JQYD 4H13C 3M7GA 1WTVA 1SJHD 4J1MA 3E0JA 1SFOB 4I65A 3S1RB 5I4DA 1YNNC 2NWGA 5BN4A 4NW2A 3BYYB 4BA1I 5CMDA 1JCKB 2F3WA 1HQMC 4OIJA 1STBA 1OXXK 3QG1A 4K5WA 4EVOA 1UNSA 1SNCA 2EYFA 2PCFB 1IKLA 4I7ZC 4FP5D 1DM0B 1GUWA 1JICA 4A3EB 3I4LA 4Q5VA 3WDNA 5JJZA 1EL0A 4DNTB 2A68D 3NTHA 1CFMA 4FF2A 1FNWA 1DYQA 5D3DA 1V1OA 1BCPB 3SEBA 3J7AV 1ET9A 4G7ZC 1JOOA 5CC4A 3S1MB 3IAYA 4A3DB 2H1EA 2FFKB 3M4YA 5KNCA 3EFXD 1G291 1LV9A 1AZQA 1BF4A 1OO9B 1PRTD 5CV8A 1SYEA 1I6VC 1ZYRD 4F7XA 3QO2A 2LKVA 2MP1A 1NCVA 1EWCA 1B53A 2F0JA 1PDQA 2KVMA 4NP5A 1DOKA 4BBSB 3I73A 4XT1B 2DN8A 2WACA 2F0PA 4K2LA 4RH6A 1KAAA 5C44B 2PO4A 1EYCA 4FF4A 1QWYA 1PLFA 5EQ0A 2R92B 1D2BA 3Q6SA 4WJWA 3S2DB 3NTIA 4CKBA 2F0DA 3D6WA 2BE5C 5DM63 4C3JG 4QUCA 5E4WC 1LO5D 5JOBA 1BQQT 1JB3A 4TRDA 5EKLA 1TS4A 4NMZA 2RBMA 1GUSA 3J80L 2NN6G 1BCPD 2ZT9C 2WINB 4K6DA 1BBXC 2L55A 3Q0AA 4OGQC 3M7NA 2JSOA 1LTSD 5CBAE 1KNAA 1PRTF 3BVZA 4CJ0B 2NTTA 1F9RA 3O13A 4DAPA 2DY7A 4K6LA 4ULLA 4IUNA 2RDHA 3CKIB 1IL8A 3DUZA 2F0HA 3E5SA 3MXUA 5I6WA 1H9SB 1C4QA 1QILA 2F0QA 4WFN3 2E74C 2AUKA 1Y8PB 1O78A 2IX3A 1DJRD 2K5QA 2V4DA 2YYZA 3LWEA 2RA4A 5HURA 2RVLA 3VYUA 2A6ED 3S9WA 5FK9C 1STGA 1JWSD 1G8ZD 3FVQA 1CT1D 5FO9B 3I4NB 4RGNA 4QUFA 2X6GA 4F8MA 3HS0C 1HHVA 5M3MB 4FVMA 5D65A 3CHBD 4RHRA 2K1BA 1B50A 4KN4C 1I4PA 4HSPA 1U4RA 4K14A 2RSNA 3A8IE 4XQJA 1EY6A 5C0XH 2WKDA 4K8JA 2IPKD 1XX8A 3UI2A 3KLSX 3PMFA 3D4WA 1DOLA 1HUMA 2AQ3B 3T56B 4EQPA 3BDLA 4DNRB 3VR2A 1L0XB 3P1HA 2M2LA 4QIWB 2D9UA 5KNDA 4RWSC 3JAME 3LX0A 3NPPA 2AQ2B 2XWJB 4MIUA 2AQ1B 4ILWA 2C5CA 5CBEE 2KEDA 3GTLB 2EJGC 3I3CA 4CKEA 3AMUA 3C3LA 3JAML 4KJNA 4LAAA 1PTOF 1B9MA 4JK1C 4C56C 2Y0SB 4XYOA 3Q22A 2QKIC 3T13A 3RD4A 2EDGA 4U673 3NWTA 2BA1A 1HUNA 4K2KA 3NQTA 1SMYC 2X6LA 4R9WA 3D4DA 2RSOA 4A3BB 1I4HA 1TWAB 1Z47A 2A6HC 3V2TA 1Y8OB 3NBHA 2FJ2A 2MUYA 2PQEA 2E75C 4G7OC 2KECA 2MHVA 1PTOH 5JEAH 5J1ZA 1C8CA 5ELEA 3PO2B 3GD7A 1B3AA 1MSHA 2OT2A 1JR0D 1JWMD 3DEPA 4C3HG 2NUCA 4TQUS 3MHBA 1D5XC 2LY7A 4BWGB 2IX1A 1KDCA 5CYUA 3GTJB 5FO7B 4RAUC 4DAYA 2KA7A 4HCSA 2R61A 2F0VA 2B8GA 3H3VC 1CHPD 5CGKA 2BE5D 5C4JB 1VMCA 2SOBA 3K7AB 2CHBD 2BA0A 2CW0D 1SEBD 3BS1A 5IT9E 1G91A 2QEJC 4ZLTF 2NVYB 1C48A 1I4GA 1RTOA 5C4XB 4XTCS 2O4XA 4EGVA 4WORA 2Q8TA 1Q90A 3TZDA 2E2HB 1I4QA 3S15B 2L4NA 2N88A 2NZ1D 3HGBA 1LTTD 5C4ZA 1Y1VB 3BZDB 3SK4A 4QCLA 3WOEA 3GTOB 3DWAA 1NR2A 3PUZA 1RDPD 1UEAB 3DHQA 4ODGA 4C2MB 3GTKB 1AN8A 2NVQB 4CGYB 1ILPA 1KLUD 2QCPX 5A2QE 2K6AA 4K5XA 2N55A 2XRQD 3X3NA 3CRLC 1SYBA 1Z6HA 2E76C 2F1MA 1NAPA 4CJ1B 3MAQA 3TP5A 3FPPA 4KKUA 4M8AA 4A3JB 2BOSA 1ESRA 1O7LA 2E2JB 2FMMA 4RFBA 3LWUA 3MXNA 2E2IB 4FXGC 3X3MA 3K59A 1SYCA 2WKCA 2JA8B 1GUTA 1EIGA 3K58A 2ICIA 2JE6I 2KCCA 3DXJC 5LHY1 4LK1C 2K32A 2E2DC 1HRJA 1TR5A 1Q12A 4XIGS 5I6YA 3HG9A 4KY5A 1LT3D 3W2DA 2GA4B 4F87A 4KY6A 2RKSA 2OF1A 4CBVA 1DOMA 1ZEQX 1Q8IA 3J81E 2B2UC 1PTOD 5ELBA 4RCNA 1S5FD 1ENCA 2VNUD 3SK8A 3H0GB 4LJZC 3MA2B 1EYDA 2OXPA 3GTPB 2Z4HA 3OMCA 1D1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR2 A;  1LV9 A;  1WTQ A;  2B2U A;  1AZQ A;  1BF4 A;  1U4L A;  2B2W C;  2L1B A;  2K03 A;  3FDT A;  2SDF A;  4IUV A;  4LMQ D;  2RVL A;  1MGS A;  2B2W A;  1WTX A;  2HUG A;  4OIK A;  2EPB A;  1AP0 A;  2R3Z A;  1O7Y A;  2L11 A;  3MTS A;  1O80 A;  2L9H A;  4IUU A;  1RHP A;  1ILP A;  3QO2 A;  1EOT A;  1WTR A;  1PFB A;  4RA8 A;  2MP1 A;  1X3Q A;  3G7L A;  1WD0 A;  1NCV A;  3DEO A;  1DON A;  2FJ2 A;  4O42 A;  4QUF A;  2N55 A;  1EIH A;  2X6G A;  2XIW A;  1B53 A;  2K28 A;  1J8I A;  5AFW A;  5COY A;  4IUP A;  3N52 A;  1PDQ A;  2K05 A;  2KVM A;  2B2V A;  4HAE A;  1DOK A;  1NAP A;  1HHV A;  2KUM A;  1WTO A;  1HA6 A;  2KEC A;  2IL8 A;  4CJ1 B;  1SDF A;  2EOT A;  3HP3 A;  4XT1 B;  5D65 A;  2K01 A;  5T1I A;  1B4O A;  1QG7 A;  2FIN B;  2VXW A;  1TVX A;  4CJ2 C;  1C8C A;  2BDN A;  2HCC A;  2HDM A;  2K1B A;  5EPL A;  1B50 A;  1E0B A;  1QE6 A;  1PLF A;  1WTP A;  1B3A A;  1MSH A;  5EQ0 A;  1M8A A;  1U4R A;  2B2V C;  2RSN A;  5COR A;  3H91 A;  5D14 A;  3DEP A;  1ESR A;  1JE4 A;  3Q6S A;  1PFN A;  2B2Y C;  1G2T A;  1WTV A;  2FMM A;  3GV3 A;  3P7J A;  5EPK A;  2K04 A;  2HCI A;  4X3S A;  5T1G A;  2MJ8 A;  2DY8 A;  1XX8 A;  3D6W A;  1Q3L A;  4IUQ A;  2NWG A;  4QUC A;  5E4W C;  1A15 A;  1F9P A;  4NW2 A;  1BNZ A;  3I91 A;  3UI2 A;  5CMD A;  1HFG A;  1S4Z A;  4DN4 M;  1ILQ A;  4OIJ A;  3R93 A;  1EQT A;  3F2U A;  1ZXT A;  1NR4 A;  2B2Y A;  1DOL A;  4RAU C;  4ZK9 B;  1XYI A;  4R8I A;  3SVM A;  3KBX A;  1EIG A;  4HCS A;  1HUM A;  1WD1 A;  1G2S A;  1ML0 D;  4ZAI A;  1F9S A;  2B2T C;  2EE1 A;  2KEE A;  3MWY W;  1J9O A;  3IFD A;  2MPM A;  1AZP A;  1HFN A;  4MHE A;  2J7Z A;  2JP1 A;  4HSV A;  2M2L A;  2MGS A;  1VMC A;  1RJT A;  4IUR A;  1HRJ A;  1BBX C;  5DNF A;  3TN2 A;  4ZKC B;  1IKL A;  2D9U A;  1X32 A;  2L12 A;  1GUW A;  1RTN A;  4RWS C;  1JIC A;  5EPJ A;  1CM9 A;  1MSG A;  3FPU B;  3GV6 A;  1G91 A;  1O7Z A;  2CVR A;  4X3K A;  5JJZ A;  5CBA E;  1B2T A;  1EL0 A;  1U4M A;  4ZLT F;  1KNA A;  1F9Q A;  1ROD A;  4ZKB B;  4U68 A;  1KNE A;  1VMP A;  4IUT A;  1RTO A;  2X69 A;  2KOL A;  3ONA B;  4UAI A;  1CA5 A;  1DOM A;  4CJ0 B;  1SAP A;  1F9R A;  5CBE E;  2KED A;  2Q8R E;  4X3U A;  1CA6 A;  4MN3 A;  1WTW A;  2DY7 A;  2JYO A;  2NYZ D;  3I3C A;  1G6Z A;  2Q8T A;  1U4P A;  5EJW A;  1F2L A;  2B2U C;  3TZD A;  4XT3 B;  3IL8 A;  5EKI A;  2L4N A;  2N88 A;  3DM1 A;  1IL8 A;  1SSO A;  4XDX A;  5E4X A;  4X3T A;  1IKM A;  1ICW A;  2HDL A;  4HED A;  2NZ1 D;  1QNK A;  1DZ1 A;  3KUP A;  2FHT A;  3I90 A;  1WVL A;  1X3P A;  1MI2 A;  1HUN A;  2H1E A;  2X6L A;  4R9W A;  2FFK B;  2RSO A;  3LWE A;  1BO0 A;  2RA4 A;  2B2T A;  1PFM A;  3I8Z A; 
#chains in the Genus database with same CATH topology
 1STE A;  1PMR A;  2K03 A;  4IUV A;  4YCW A;  1PV4 A;  4LMQ D;  2RHS B;  3DMU A;  3AYH B;  2JA7 H;  4G4K A;  2EXZ A;  2HUG A;  1YVC A;  4P73 A;  4E6I A;  4RGO S;  2F0G A;  5KEE A;  1WTR A;  4GKJ L;  2R7Z H;  1HTL D;  4Y7N B;  2VZA A;  4B3S L;  2ASB A;  2D5D A;  2WAQ B;  1XNR Q;  2UXB Q;  3T53 B;  3C1E A;  3JC6 6;  4KY7 A;  4HJ9 A;  1L0Y B;  4GNX B;  1SYF A;  4CJ2 C;  1XPO A;  3CC2 A;  4DV4 Q;  4DV6 Q;  4KHV A;  4YWK A;  4DR5 Q;  1AFP A;  3NEM A;  3PV0 A;  2VQF L;  1ICF B;  4NXN L;  1V1P A;  4JI1 L;  1K9M C;  1QCB D;  2K04 A;  3LNN A;  4X3S A;  3OSO A;  5C0X G;  1I50 H;  4NKL A;  3D31 A;  1BNZ A;  4A4I A;  2F4I A;  2PYK A;  3BZK A;  4B3R Q;  3R93 A;  5FJ8 G;  4A93 G;  4A3M B;  3SVM A;  1X65 A;  1T5X D;  3MXN B;  4DA2 A;  1K8M A;  2AWO A;  1CQV A;  2CFM A;  4KI0 A;  4PMB A;  5JVG 3;  4UPA A;  3HZX A;  3PF4 A;  2M9V A;  5BN5 A;  5LMU Q;  3I4M B;  4HSV A;  2Z1C A;  3UE1 A;  2F0W A;  3K5O A;  1E1O A;  4ZKC B;  3HKZ B;  3PO3 B;  5DAU A;  1EQV A;  4JBM A;  4DV3 Q;  1V9P A;  2D62 A;  3KBG A;  3VA5 A;  3T1H L;  1PH8 A;  4NPS A;  4XYQ A;  4N9T A;  3FMC A;  4WRD A;  2PZU A;  4IUT A;  1Y1V G;  5FLX E;  1CSP A;  1ZKO A;  5M3M G;  3Q24 A;  3PO3 G;  3EIV A;  1EU3 A;  1GUG A;  4JOI C;  4DR3 Q;  1X55 A;  2Q2I A;  1BUV T;  1QB5 D;  4DV4 L;  4XDX A;  4H0L C;  5E4X A;  1GXD C;  1LAC A;  1IKM A;  1OXV A;  1W3S A;  1FYC A;  2EYO A;  1QNK A;  4DF7 A;  3I56 A;  1YNX A;  4N8F A;  1GOZ A;  3S16 B;  2V1C C;  4UP7 A;  3H09 A;  5EAY A;  4WJ3 M;  1TII D;  2A6H D;  5EBC A;  4KK7 A;  3R8B A;  2R92 H;  2OQ0 A;  2O2L D;  2B2T A;  3VR6 A;  3PF5 A;  4JI0 L;  4A3I G;  2KCM A;  5D3I B;  4R4T A;  3FDT A;  1ENA A;  4X65 Q;  2A69 C;  3C46 A;  4DU9 A;  1Z9F A;  1Y1W G;  1TY0 A;  2XSC A;  4S3S A;  4OWT B;  2YU9 B;  4DR2 Q;  1SYG A;  4RA8 A;  3G7L A;  5LMU L;  4Z9C B;  1DON A;  5JEA J;  3RN5 A;  3HOX H;  1CTM A;  5G3L F;  2KBN A;  2ZXO A;  1P8L A;  3K0Y A;  4KHP L;  1CI3 M;  1VQD A;  3NBH B;  1FGU A;  4XXE A;  3I4N H;  5FLM H;  4AYB B;  2PI2 A;  5ISR A;  3HOZ H;  4A3G G;  3KOJ A;  1SE4 A;  2HDM A;  1QE6 A;  4CKC A;  3AQQ A;  1XTD A;  4H7B A;  4X64 L;  1EOV A;  3G48 A;  3N6R A;  2C35 B;  2HHH Q;  3OWF A;  4ME3 A;  4C3J H;  4A3G H;  2H5X A;  5K36 G;  2DY8 A;  4KD3 A;  1EY0 A;  1N36 L;  3I4N G;  3SK5 A;  1IHZ A;  4PG3 A;  2MO0 A;  4OHJ A;  2B2Y A;  4ZRZ A;  4EQO A;  5IP9 G;  4V19 0;  2A1A A;  3E9H A;  4L5T A;  4L6T B;  4C3I H;  2JA7 B;  1H9S A;  3MWY W;  2ZM6 L;  1HFN A;  2NBF A;  4HJ7 A;  3URY A;  4A93 B;  2IW3 A;  3P20 A;  2EZV A;  1I3Q B;  1RJT A;  3HKS A;  4HIM A;  3Q8D A;  3R2I A;  4DFA A;  3FKI H;  3CCS A;  3QWN A;  2XRS D;  3OMG A;  5L37 A;  4A76 A;  3KF8 A;  1ROD A;  1CKN A;  3NHH A;  1T5E A;  5NUC A;  1SNM A;  3HOZ B;  5IYB G;  1B9N A;  4C3H H;  2MNA A;  4UP9 A;  2K33 A;  4B9X A;  4XT3 B;  4KV6 A;  2SNM A;  4FDB A;  3JAM c;  1VQJ A;  1SJE D;  2O5J C;  1KD1 C;  1SMX A;  2K5W A;  1IBK L;  1HNX L;  5E7N A;  1X3P A;  1H9J A;  1EU4 A;  1NBW A;  2PNH A;  5HGQ A;  2HIX A;  2PW7 A;  4IOC A;  2Z8L A;  3U9O A;  1LTL A;  3I8Z A;  1SNO A;  2D2C C;  2H4O A;  2I5L X;  1JWU D;  1F2Z A;  3H3V H;  2VUM B;  2N49 A;  2HD3 A;  3CRK C;  2VB2 X;  5G3L D;  3CCV A;  3DWQ A;  4LF8 Q;  1HQR D;  4O42 A;  5JVH 3;  4JI4 L;  1HZ9 A;  2K05 A;  3GTM B;  2B2V A;  2B63 B;  4CHT B;  1EY5 A;  2IL8 A;  4MNO A;  4OEL B;  4FO2 A;  2A6E C;  2B8F A;  1JE5 A;  4OX9 L;  1QG7 A;  3HOY G;  2YTX A;  2NN6 H;  1JJ2 A;  1ONL A;  2F0T A;  1ZYR C;  2Q2T A;  3H94 A;  1UAP A;  1UEB A;  5M5X H;  3J80 c;  1JOQ A;  1JJC B;  4AH6 A;  3KF6 B;  2RQX A;  3P7J A;  1QUQ A;  1IBL Q;  4YWL A;  2MJ8 A;  3EJI A;  1D1I A;  4LF4 L;  3PUX A;  2Q2H A;  1J5E L;  4KTA A;  2F0F A;  2F0I A;  5KYL A;  5EKK A;  1IZ6 A;  1SNQ A;  3C2P A;  2WP8 J;  1HXY D;  2NTS A;  4NXM Q;  3KBX A;  1LM0 A;  4BA2 I;  4BS9 A;  1F9S A;  3OYY A;  5ELN A;  2UU9 Q;  1EEF D;  3A8K E;  3BG3 A;  4MHE A;  4F88 A;  2XWB B;  4B9W A;  2MGS A;  4YY3 Q;  1HH2 P;  4PNY A;  4DXG A;  1RTN A;  1M4V A;  3MXP A;  4DGZ A;  2F0N A;  2VS1 A;  3AU7 A;  4J8Q A;  3FPU B;  5EPJ A;  4JI6 L;  5I2Y A;  4GLA C;  1XWE A;  4IPD A;  1I4X A;  3A7A B;  4DR3 L;  4DKA C;  1U4M A;  4KMU C;  5E3F A;  1BOS A;  5BR8 Q;  4ZKB B;  2XNA C;  2HQL A;  3K7A H;  1IYV A;  2RDF A;  5EBD A;  3SGI A;  5HGT A;  1SAP A;  5J3B A;  3HEJ A;  1BBW A;  3OTO Q;  2AUJ D;  4L8J A;  4QMG A;  4C3H B;  1BR9 A;  2ZXP A;  1WCM B;  3CCR A;  1LYL A;  5IYB H;  3FP9 A;  5AJ3 Q;  1SSO A;  4MTK A;  1KDA A;  1FJG L;  1FVI A;  2HDL A;  1TY2 A;  5CV9 A;  1VQ7 A;  4B3T L;  2K14 A;  1NJI C;  1TT2 A;  4ZUI A;  4JG2 A;  2CW0 C;  3RR5 A;  3MZ5 A;  3UDX A;  4PV1 C;  3RMH A;  1E24 A;  4LWC A;  2CH4 A;  2JA5 B;  4IJH A;  1EY7 A;  1EQR A;  2YTY A;  3S2D H;  2Z6K C;  4HN7 A;  2F0S A;  1YJ9 A;  4IQZ A;  1KHI A;  4JBK A;  5JPN C;  1GUN A;  2EY6 A;  3GTM H;  2NVQ H;  1HA6 A;  4MTN A;  1UWV A;  3TBI B;  3RLF A;  1X56 A;  4RGM A;  3GO5 A;  2EYJ A;  1UE6 A;  2VXW A;  4JI3 L;  4IN3 A;  3ERQ A;  3TEH B;  2KHS A;  1CHQ D;  4L5Q A;  1STH A;  3PIP A;  2GVB A;  3CXC A;  1NY4 A;  3GDE A;  2K7V A;  2G9D A;  2CWP A;  3BDC A;  1EY9 A;  3FRP B;  2HIV A;  1IL2 A;  1F9P A;  4BY1 G;  1S5B D;  3S14 H;  3M4O B;  4R4I A;  4ZQ3 A;  2EY2 A;  1SN8 A;  4ZK9 B;  2BCO A;  3GTQ H;  5K36 H;  1RD9 D;  4R8I A;  3J80 E;  4DUZ L;  3MFY A;  4DUY Q;  2R7F A;  5IGC A;  3IFD A;  2R93 B;  5M3F H;  2J7Z A;  1TWH B;  1SBB B;  4KHZ A;  3W1B A;  1DD2 A;  1B7Y B;  2IHE A;  4IUR A;  1H9R A;  5C3W A;  2NZO A;  1MJE A;  4G7H C;  1X3F A;  2ZXR A;  4Y52 H;  3E3X A;  4L5S A;  3TP8 A;  1JOR A;  3S2H B;  1VMP A;  5FKA C;  2Q8I B;  5M3F G;  1LLR D;  1CQF A;  4R4Q A;  4A3J G;  1ENF A;  2LSS A;  2K5N A;  1TWF H;  2ZJP A;  4LF7 L;  2QGQ A;  2QDB A;  4X62 L;  3RZO B;  1F2L A;  4JBJ A;  3CCE A;  1YHQ A;  1HZB A;  5M9O A;  1BXT A;  1LTA D;  1OXT A;  2Z4I A;  3FEW X;  2LXJ A;  4CDE C;  3F2D A;  5GAE C;  4TVA B;  3BDO A;  3U9S A;  3HOV H;  3H6M A;  5J22 A;  1VQ4 A;  5A2Q L;  4C1N K;  1JOK A;  1XMO L;  3L9A X;  2B2U A;  2UXD Q;  1EIH A;  1U4L A;  4AQY Q;  3PSI A;  2RHQ B;  1IBM L;  5M5Y B;  2EPB A;  1YNN D;  2R3Z A;  1X3E A;  1O7Y A;  3TQY A;  1O80 A;  3HOY B;  3L7Z C;  4A75 A;  1SFO H;  2OTJ A;  3F2B A;  3J81 j;  4IJL A;  5JEA G;  2PQA B;  2PZW A;  2KUM A;  1PH4 A;  4JI0 Q;  2R7Z B;  3CC4 A;  1K83 B;  3QOL A;  3TDQ A;  2BDN A;  2EIF A;  4P75 A;  3T16 A;  1QNU A;  1F77 A;  2I46 A;  3H91 A;  4FXD A;  1VQG A;  3CMA A;  4TKO B;  1K3R A;  2IY5 B;  3TRZ A;  4QY7 A;  1MD2 D;  5FO8 B;  2HCI A;  1QZG A;  5JPM C;  2NN6 I;  3HOW B;  3AFP A;  3NWS A;  2B29 A;  1ILQ A;  1B44 D;  1ZXT A;  3M4P A;  4NDX A;  3ULJ A;  2AMC B;  1I50 B;  3RNU A;  1FD7 D;  5LL6 X;  5BN3 A;  5IYD G;  2NVT H;  4HMI A;  1BCP F;  4IOA A;  4PMC A;  3K5L A;  4O1N A;  5JJI A;  1VQ6 A;  2OEO A;  4LF9 L;  4DK6 C;  2K4K A;  2Z9H A;  1XXG A;  1V1P B;  4B3R L;  4IO9 A;  1K8A C;  4C2M H;  1VF7 A;  2EQS A;  1KNE A;  3D6C A;  1XMO Q;  3NP8 A;  3NXW A;  4YHH Q;  4L63 B;  1KTK A;  4EQ5 A;  4DR4 Q;  1NSN S;  3V96 A;  2Z6K A;  2Q8R E;  3VA7 A;  4RCO A;  2JYO A;  4LUZ A;  3BVG A;  1U4P A;  4AYB G;  5EJW A;  3IL8 A;  3AB9 A;  5EKI A;  1PYB A;  3OW7 A;  2C9O A;  4JI1 Q;  1TS3 A;  2JA5 G;  1XPU A;  4BY7 H;  5GQO A;  3NK9 A;  1GUO A;  1S5D D;  1EFW A;  2WB1 G;  3D3R A;  1WCM H;  3J7A F;  2UUB L;  1N32 Q;  1EIY B;  1W2B A;  1X32 A;  4ME5 A;  3CF5 A;  4DPG A;  1DXM A;  2B2W C;  4A3C G;  1MGS A;  2RCF A;  1WTX A;  1E2W A;  2CQO A;  1ET6 A;  4A3K B;  1TWG B;  1CKO A;  1HZC A;  2ICE C;  1EZ8 A;  2WB1 E;  3AEV A;  2IT1 A;  1A2T A;  4IUP A;  3VR4 A;  2M00 A;  3T1H Q;  1GM5 A;  2EOT A;  2K75 A;  1UE1 A;  4Y7N H;  3CAM A;  4DV7 L;  1TVX A;  4BY1 B;  3SXH A;  5EPL A;  3TP7 A;  2JJQ A;  4A3I B;  2D0P A;  2I5H A;  1G6P A;  2PQA A;  3DWP A;  2NVX H;  3OHX C;  2JXM B;  2DNC A;  4HR7 B;  1PFN A;  4PQX A;  1FNV A;  1V8Q A;  1R4Q B;  5EPK A;  1KXL A;  3L2P A;  1R4P B;  1EEI D;  2EYH A;  5FJ8 H;  2F0E A;  5ELC A;  4LF7 Q;  4GN5 A;  1EQT A;  1EYA A;  3EN2 A;  2L5T A;  2RDG A;  3HFZ B;  1HNW L;  1WFQ A;  5M5Y H;  2KEE A;  5ELO A;  4LF5 L;  4H44 C;  3A5U A;  2E2H H;  1BDO A;  3ZYY X;  4DUY L;  2F0O A;  3H0G G;  1HTP A;  4DR6 Q;  1CZW A;  3NQI A;  5HY6 A;  2PZT A;  4HTH A;  2L12 A;  1CM9 A;  2G5D A;  2UXB L;  1XTC D;  2B3G A;  1EY8 A;  1XNQ L;  3KJO A;  1B2T A;  4X6A H;  3OPO A;  2UU9 L;  1J6Q A;  4KD4 A;  1EFI D;  1IBL L;  2JQO A;  3FKI B;  3ND9 A;  1Q1E A;  3R2T A;  3BJU A;  1IW7 D;  2F0L A;  4DAY B;  3VYR A;  3F2C A;  2B39 A;  2EYL A;  2Y0S E;  2JA7 G;  4LF6 Q;  3G71 A;  1KIX A;  4BXX G;  3S1N B;  4CDF C;  3I90 A;  2PW5 A;  3FKI G;  3ND8 A;  1YIJ A;  3HOW G;  4ZUJ A;  3SE0 A;  4KKT A;  2VQE L;  1YIT A;  4OO1 H;  4LFC Q;  1K0S A;  3IKJ A;  2L1B A;  5E1F A;  2SDF A;  1B70 B;  3S16 H;  2F3V A;  2Y0S G;  2P5Z X;  1LTI D;  2UUA Q;  4C1N I;  2L9H A;  1CZG A;  5F2D A;  1EOT A;  1GHJ A;  1KL9 A;  1PFB A;  1U5K A;  1LUZ A;  1LAB A;  3QOJ A;  4A3B G;  2F0U A;  2K28 A;  3K5M A;  3EA6 A;  2FMC A;  1HNX Q;  1SMY D;  3DM3 A;  4X66 L;  1VF5 C;  1SE3 A;  3TS0 A;  2FIN B;  4HJ8 A;  4HMJ A;  4GLX A;  1VQE A;  2Q2U A;  4QB4 A;  1WTP A;  2XN9 C;  3MEH A;  5D14 A;  1TS2 A;  4OL7 A;  1NNX A;  3I70 A;  3K5N A;  2L0C A;  5IGB A;  1FL0 A;  1QJO A;  1Q3L A;  3EQL C;  5C5L A;  3MVV A;  1D8L A;  4A3F G;  1A15 A;  1BVS A;  2JA6 H;  1NTG A;  3BYT B;  2DGY A;  4AYB E;  1NR4 A;  1EY4 A;  3PUW A;  5CV7 A;  2PPB C;  2K5H A;  2MPM A;  2DJF C;  5KYI A;  4JI2 L;  1VQF A;  3S15 H;  4DK0 A;  4IFD J;  4DNI A;  1YHB A;  3OIP A;  2SEB D;  4A3K G;  3VR5 A;  3SDZ A;  1M1K C;  3TME A;  1KRS A;  1BKB A;  1PHJ A;  3GV6 A;  2B63 G;  1KRT A;  3U58 A;  1O7Z A;  1UUP A;  4NB3 A;  4ABN A;  4U68 A;  4JYA Q;  4DR7 L;  3D4R A;  3LGJ A;  1A3U A;  3MC0 B;  1IYJ B;  1G6Z A;  3HKZ E;  3KK7 A;  4YIJ A;  1HJP A;  1DCZ A;  5IWA L;  2PMZ B;  5IYD H;  4X3T A;  4O2D A;  1ICW A;  3K0X A;  1DZ1 A;  3PCO B;  3WOF A;  3A55 A;  3SR1 A;  3D8G A;  3OOC A;  5M5X B;  1HCZ A;  1BO0 A;  3RN2 A;  1D5Z C;  1WTQ A;  4LNQ A;  3G6E A;  1VQI A;  1S5C D;  4BY7 B;  3M4O H;  3S14 B;  1LT4 D;  2JEB I;  4R1J A;  2J0T D;  2IJ0 A;  1AP0 A;  5J39 A;  2UXC Q;  1E22 A;  1SRU A;  3PUY A;  4NXN Q;  3E6Z X;  2PNR C;  3H15 A;  1EYG A;  2A19 A;  3PO2 G;  1PZK D;  3T4A C;  4HAE A;  5CR3 A;  4JW0 A;  2ZJR A;  5DEH A;  3S1Q H;  1SDF A;  3J81 i;  1MJC A;  5TSS A;  1B4O A;  1CKM A;  2LS0 1;  4DAM A;  1EIF A;  4MZ9 A;  4TSS A;  4IFD H;  3CPF A;  1CSQ A;  1LT5 D;  3SK6 A;  4FF3 A;  1JJG A;  2E5L Q;  2FXQ A;  4JI8 Q;  1V43 A;  2A68 C;  1A6X A;  4DXF A;  3J7Y W;  1JT8 A;  1NE3 A;  1E7Z A;  4DK1 A;  4P2C B;  3KF6 A;  3TP6 A;  2J4X A;  2EY5 A;  1OTC A;  2O5I C;  2A5H A;  2Z6B A;  1TQO A;  1HPC A;  1YHA A;  2B2T C;  4A3L H;  3QB3 A;  3R3O A;  5CV4 A;  1J9O A;  1XNQ Q;  3U4Z A;  3I72 A;  4DV2 L;  1HNW Q;  4KJO A;  3P75 A;  5DNF A;  1EQQ A;  1QVG A;  2QDL A;  5C3E B;  2QEX A;  3U50 C;  4B08 A;  3ERO A;  5ELF A;  2CVR A;  4X3K A;  1QZH A;  2A74 C;  3S1Q B;  4FF1 A;  2NB0 A;  3ONA B;  1EWI A;  1L0W A;  1CA5 A;  4BBS G;  1RKN A;  2PI2 E;  5JAV A;  3EBE A;  3RUZ A;  1CK1 A;  1CA6 A;  4OON A;  5ELD A;  4DAV A;  4X65 L;  5C4J H;  1WTH A;  3DM1 A;  4PZ7 A;  4R8N A;  4KN7 C;  2YU9 H;  1N33 L;  1A2U A;  3VR3 A;  4HED A;  3NE5 B;  3CU7 A;  3CQZ B;  1K0R A;  3ZJY C;  2OTL A;  1R9T B;  3A7L A;  3W3A A;  4A3F B;  4NXM L;  1HR0 W;  4LF9 Q;  3PQI A;  2KHI A;  2VW9 A;  1MKH A;  5IGG A;  1PFS A;  2ZTE A;  1S5E D;  1W6K A;  4FXK C;  1II3 A;  1Y69 U;  2UUC L;  4B3S Q;  2ES2 A;  2R6G A;  1OXU A;  4IUU A;  1SND A;  1VQN A;  4IFD I;  4C3J B;  4X64 Q;  1WD0 A;  3JAM i;  4V0B A;  3GTG B;  1Y1V H;  2PMZ E;  1Q82 C;  3H0G H;  3W5O A;  2ID0 A;  3VYS A;  5COY A;  1KDB A;  1I5F A;  3J81 c;  4DV6 L;  1YNJ D;  3D0F A;  3HOZ G;  3HP3 A;  3J81 L;  1JC7 A;  2CQA A;  4M1U B;  2F0M A;  2HCC A;  5C0X J;  4Q0F A;  2ZM6 Q;  1M8A A;  3MEF A;  4EQN A;  3GTK H;  2EYM A;  3UDF A;  2QW7 A;  4GN3 B;  1GVP A;  2EVB A;  1VQ8 A;  3PGZ A;  5C4H A;  5IE8 A;  2EYP A;  3C1F A;  5T1G A;  4A3B H;  2VQF Q;  2OCE A;  4RGT A;  3HOX B;  1SYD A;  2EJF C;  1D6E C;  2NVX B;  3HKZ G;  2WB1 B;  3HRZ C;  4BBR B;  1G2S A;  3TSS A;  2ALY B;  2G9H D;  1SE2 A;  1WYD A;  3KDF B;  5C0X I;  3HOV B;  5FLX L;  4K0K L;  1MBY A;  2JP1 A;  5I9P A;  4B3T Q;  3MFG A;  4G57 A;  3S17 B;  1PTO B;  1IW7 C;  1Q46 A;  2I07 B;  3UE0 A;  2N3S A;  1MSG A;  1EWH A;  2LMC B;  5C44 H;  1VQM A;  4PMW A;  5IT9 c;  1A3V A;  2DNE A;  3OIQ A;  1K28 A;  1E2V A;  3ER0 A;  3CD6 A;  4J6H A;  3OWE B;  1B1Z A;  4N9P A;  4OWW B;  3RLO A;  4N8X 1;  3QJY A;  1ESF A;  4JI7 Q;  4JYA L;  2NYZ D;  1S40 A;  4DK3 C;  1SE8 A;  1G51 A;  4YCU A;  1HR0 Q;  3I4M H;  1K8G A;  1UE5 A;  1STA A;  1STN A;  3CC7 A;  4OEM B;  1IXR A;  4QJF A;  5DM7 3;  1E2Z A;  3PO3 H;  1NUC A;  3KUP A;  3F8T A;  1BCP C;  1WVL A;  4GKK L;  1RF2 D;  4ID6 A;  1SNP A;  3I2Z A;  3KLR A;  4RKB A;  3UDG A;  4A3F H;  2JA6 G;  2SNS A;  3NBI A;  1ASY A;  1PFM A;  2K01 A;  4BBR H;  2KJX A;  3S1N H;  4OIK A;  4DR1 L;  1LTG D;  2WII B;  3GTQ B;  2E8G A;  4JI8 L;  4A3G B;  3HOU B;  2ZTC A;  3A0J A;  4GOP A;  1LTB D;  3CCQ A;  1GKH A;  1STY A;  3A8J E;  1V1Q A;  2F0K A;  1FR3 A;  3TZU A;  4GOP B;  1PVO A;  1XMQ Q;  1KAB A;  1WTO A;  2CH4 W;  5IOC A;  4HIK A;  3IRB A;  4CDC C;  4RHS A;  3IFT A;  1U0L A;  2IHF A;  1E0B A;  2HQE A;  4HCE A;  2B2V C;  1VS0 A;  5COR A;  5KIX A;  2VUM H;  3HOX G;  1JE4 A;  1HNZ L;  2XVS A;  1G2T A;  5M5W B;  3GV3 A;  1F2Y A;  1S72 A;  3T1Y Q;  3K80 C;  3M85 A;  3ITP A;  4X66 Q;  4IUQ A;  5C3X A;  5LL6 S;  4AIM A;  1KLG D;  1I6H B;  1RCV D;  3M3Y H;  4OO1 G;  2D0O A;  1A8V A;  3I91 A;  4GZY C;  4UDU C;  3K6O A;  2ENB A;  4OO1 I;  3VDY A;  1XYI A;  2VY3 A;  3F1Z A;  4POF A;  1WD1 A;  4KKS A;  4XQQ A;  1ML0 D;  4K5V A;  1PXU A;  1XNR L;  1AZP A;  3NEN A;  3K57 A;  4IAL A;  5GAH C;  1VCI A;  4APV A;  1VQL A;  2NVY H;  2JA9 A;  4RKL A;  3TN2 A;  1FJG Q;  5KNB A;  4R4O A;  4XQN A;  3PUV A;  5IWA Q;  1Q8K A;  1YJW A;  1F9Q A;  5IGF A;  3A74 A;  2VL6 A;  4DV5 L;  1WI5 A;  4JBW A;  4UAI A;  5KGU A;  3Q23 A;  1PRT B;  3EVQ A;  1T9H A;  2A8V A;  3QIA A;  1Z7T A;  5IYC G;  4LUV A;  1AEX A;  3A5Z B;  3GTJ H;  2F4V L;  2LFN A;  1F2M A;  1H95 A;  1SRO A;  4DR7 Q;  1WCM G;  2XGT A;  4JPB W;  3PIO 3;  2FHT A;  2TMP A;  3S1R H;  3V05 A;  1MI2 A;  1AW7 A;  5EGT A;  3AFQ A;  3PIP 3;  3NTK A;  2BDO A;  1GHK A;  1I4R A;  1WTW A;  4QQB X;  1PTO C;  5GAG C;  3KFU A;  2WFW A;  2B2W A;  5KRU A;  4LFB Q;  2JA6 B;  4LF5 Q;  1QOH A;  5M3M H;  2QF7 A;  4DV1 Q;  3HOV G;  1RHP A;  4LFC L;  5IOD A;  3B6Y A;  2IX0 A;  1TS5 A;  5A35 A;  1X3Q A;  5C6A A;  3GP7 A;  1OXS C;  1TU2 B;  1Y1W B;  2I5M X;  2QIL A;  2XIW A;  3HOW H;  1TWC B;  1A3T A;  3T51 B;  3J7A 5;  2NVT B;  3QR8 A;  3L0O A;  1GD7 A;  2BH2 A;  2AWN A;  2OWO A;  1BBU A;  1SXT A;  5I9O A;  4GOP C;  3NUC A;  4IPC A;  3NSW A;  4HJA A;  1K8O A;  3SHL A;  3RZD B;  2B2Y C;  3A56 A;  5I2X A;  3L3O C;  1YNJ C;  4HJ5 A;  1EZ6 A;  2R7Z G;  4KHP Q;  1AH9 A;  3BU2 A;  3M3Y B;  3G6J B;  2KCN A;  1HFG A;  1KAW A;  1S4Z A;  3KDF A;  4DN4 M;  3CME A;  3F2U A;  2EY1 A;  4GLV B;  1U9R A;  2F52 A;  1LTR D;  4FYD A;  5IGE A;  4ZAI A;  4DR2 L;  1TWF B;  2EE1 A;  5BR8 L;  2Z0S A;  5K5P A;  1XJV A;  3CCJ A;  1ASZ A;  3KF8 B;  3WWV A;  1CUK A;  4JI5 L;  4ZYS A;  1HA5 A;  1N36 Q;  4K8I A;  5CV5 A;  1D5M C;  4LUO A;  2VB3 X;  2JEA I;  2X69 A;  2ATW A;  2KOL A;  1NMG A;  2F03 A;  1FGB D;  5FOB B;  2K52 A;  2IWH A;  4X3U A;  4C3I B;  4MN3 A;  1PZJ D;  4A3M G;  1IYU A;  1GJX A;  5IIF A;  1DGS A;  2JA5 H;  4DR1 Q;  3BVM A;  2A69 D;  5IGD A;  1C9O A;  5M3F B;  1MIU A;  4DV3 L;  2WV6 D;  1AE3 A;  1PRT C;  3GQB A;  1VQ5 A;  3MXG A;  5C5M A;  4DR6 L;  1Y8N B;  3VYT A;  4C3I G;  4FNF A;  1VQO A;  1TKW B;  4GN4 B;  1Q1B A;  2KQ3 A;  2A73 B;  2DJG C;  1X6O A;  1N9W A;  1Y14 B;  2WAQ E;  5CV6 A;  1VDZ A;  1A0I A;  5C4X G;  5DLQ E;  4A3D G;  3A54 A;  1H9M A;  3RLN A;  1A63 A;  1H9K A;  1FNU A;  4IFD G;  2L11 A;  3MTS A;  5FLX c;  1W6J A;  3KLS A;  3BZC A;  3DEO A;  1Y1W H;  2GVA A;  1J8I A;  2K5D A;  5AFW A;  1PYW D;  3N52 A;  4BBS H;  3TRE A;  1I94 L;  5IT9 L;  4PZ6 A;  3KJP A;  2EJM A;  4GNX C;  2TSS A;  3K8A A;  2R92 G;  5T1I A;  1L1O A;  4IZ8 A;  1LT6 D;  4QF4 A;  2VQE Q;  1PZI D;  1JQY D;  1AE2 A;  4H13 C;  3M7G A;  4LF8 L;  4LW1 A;  1WTV A;  1SJH D;  4J1M A;  4HID A;  3E0J A;  1SFO B;  4DV5 Q;  4I65 A;  3S1R B;  5I4D A;  1YNN C;  2NWG A;  5BN4 A;  1WOC A;  4NW2 A;  3BYY B;  4BA1 I;  5CMD A;  5LMN L;  1JCK B;  2F3W A;  1HQM C;  4OIJ A;  3S24 A;  1STB A;  1OXX K;  4QL5 A;  3QG1 A;  1QUQ B;  4K5W A;  4UHV A;  4EVO A;  1N34 Q;  1UNS A;  1R9T H;  1SNC A;  4GNX A;  3UDI A;  2EYF A;  2PCF B;  4JV5 Q;  1IKL A;  4I7Z C;  4FP5 D;  1DM0 B;  3GTL H;  1GUW A;  1JIC A;  4A3E B;  4A3J H;  3I4L A;  3OW2 A;  4Q5V A;  3WDN A;  5JJZ A;  1EL0 A;  2E2J H;  4DNT B;  4A3C H;  2R93 G;  2A68 D;  3NTH A;  1CFM A;  4FF2 A;  4DV1 L;  1FNW A;  1DYQ A;  5D3D A;  1V1O A;  1BCP B;  3SEB A;  3STB D;  1TWH H;  3J7A V;  1ET9 A;  4G7Z C;  4JVZ A;  1JOO A;  1XPR A;  1PA6 A;  2JA8 G;  5CC4 A;  3S1M B;  4B3M L;  3IAY A;  3S1M H;  3I55 A;  4JI7 L;  4A3D B;  2H1E A;  2FFK B;  1UE7 A;  3M4Y A;  3EFX D;  5KNC A;  2ZTD A;  1G29 1;  1L2F A;  1LV9 A;  1AZQ A;  1BF4 A;  4BY1 H;  1OO9 B;  4BBR G;  5AJ3 L;  3E9I A;  3J80 i;  1PRT D;  4A3L G;  5IP7 G;  5CV8 A;  4AQY L;  1SYE A;  1I6V C;  1ZYR D;  4F7X A;  5JJL A;  3QO2 A;  3PO2 H;  2LKV A;  2MP1 A;  1NCV A;  1EWC A;  4IPH A;  1E3P A;  1B53 A;  2F0J A;  1PDQ A;  2KVM A;  4NP5 A;  4DV0 Q;  1DOK A;  4UY8 C;  4BBS B;  3I73 A;  1Q81 C;  4ALP A;  4XT1 B;  2DN8 A;  2WAC A;  3S17 H;  2XTI A;  1PH3 A;  2F0P A;  3GTG H;  4K2L A;  4RH6 A;  1KAA A;  1PH7 A;  5C44 B;  2PO4 A;  1EYC A;  4FF4 A;  1QWY A;  1PLF A;  5EQ0 A;  4B3M Q;  4A3K H;  2R92 B;  1D2B A;  3Q6S A;  4WJW A;  3E0E A;  3S2D B;  3NTI A;  4CKB A;  2F0D A;  1M90 C;  2UXC L;  3D6W A;  2BE5 C;  5DM6 3;  4POG A;  4C3J G;  4QUC A;  1VQH A;  5E4W C;  4KLK A;  1LO5 D;  1PH2 A;  5JOB A;  1C7Y A;  3FHW A;  1BQQ T;  1JB3 A;  4TRD A;  5EKL A;  5M5W H;  4DR4 L;  1TS4 A;  4RG1 A;  1D7Q A;  1HZA A;  4NMZ A;  3CQZ H;  2RBM A;  1SR3 A;  4BXX H;  5IP9 H;  1GUS A;  3J80 L;  2MO1 A;  4A3E G;  2NN6 G;  1CKN B;  1BCP D;  2ZT9 C;  2WIN B;  4K6D A;  1BBX C;  2L55 A;  3Q0A A;  4OGQ C;  4A3E H;  3ULP A;  2CCZ A;  2JSO A;  3M7N A;  1A62 A;  1LTS D;  5CBA E;  3KYH C;  1KNA A;  4JI4 Q;  1PRT F;  5GRO A;  4DUZ Q;  3HOU H;  3BVZ A;  4CJ0 B;  2NTT A;  1PH9 A;  1F9R A;  1N8R C;  3O13 A;  4EX5 A;  4DAP A;  2DY7 A;  4K6L A;  4YWM A;  1JMC A;  2KEN A;  4ULL A;  4IUN A;  4X62 Q;  2RDH A;  3CKI B;  1IL8 A;  3DUZ A;  2F0H A;  3E5S A;  5IYC H;  3MXU A;  1RL2 A;  5I6W A;  1H9S B;  1C4Q A;  1X9N A;  1QIL A;  2F0Q A;  4WFN 3;  4YY3 L;  4K0K Q;  2MQH A;  4DV0 L;  2E74 C;  2AUK A;  1Y8P B;  1MHW C;  1O78 A;  1PH6 A;  4DR5 L;  2IX3 A;  1DJR D;  2K5Q A;  2V4D A;  2YYZ A;  3LWE A;  2RA4 A;  5HUR A;  2YV5 A;  1TWA H;  1HR0 L;  4QGU A;  3K81 C;  2RVL A;  3VYU A;  1IBM Q;  2A6E D;  3S9W A;  5FK9 C;  1STG A;  4JCV E;  1JWS D;  3OTO L;  3W1G A;  1G8Z D;  3FVQ A;  1CT1 D;  5FO9 B;  3I4N B;  4RGN A;  4QUF A;  2X6G A;  1B8A A;  4F8M A;  3HS0 C;  1HHV A;  5M3M B;  4FVM A;  5D65 A;  3CHB D;  4RHR A;  4DV2 Q;  2K1B A;  1B50 A;  1X3G A;  4KN4 C;  2NZH A;  1I4P A;  2JA8 H;  1TWC H;  4HSP A;  1U4R A;  1VQB A;  4K14 A;  2RSN A;  4O0A A;  3A8I E;  4XQJ A;  4P71 A;  1K73 C;  1EY6 A;  5C0X H;  2WKD A;  2N8N A;  3H3V I;  2UUC Q;  3TS2 A;  4K8J A;  2IPK D;  1XX8 A;  5C3E H;  1TXY A;  1JB7 A;  5IP7 H;  3UI2 A;  4I7A A;  3KLS X;  1YEZ A;  4JI3 Q;  3PMF A;  4JI5 Q;  3D4W A;  1DOL A;  2HT1 A;  1GO3 E;  4JV5 L;  4BY7 G;  4OXP A;  3GTO H;  1HUM A;  2AQ3 B;  3T56 B;  4EQP A;  4WJ4 A;  1VQ9 A;  3BDL A;  4A3I H;  4DNR B;  3VR2 A;  1L0X B;  3P1H A;  1Q7Y C;  3CCM A;  2M2L A;  1SLJ A;  2VUM G;  2L15 A;  4QIW B;  4LFA Q;  2D9U A;  5KND A;  4RWS C;  3JAM E;  1PH1 A;  4H02 A;  4OWX B;  1NMF A;  1VQP A;  3LX0 A;  1P16 A;  3CP0 A;  3NPP A;  2AQ2 B;  2XWJ B;  4MIU A;  2K50 A;  2AQ1 B;  4ILW A;  2C5C A;  5CBE E;  2KED A;  4IPG A;  3GTL B;  2EJG C;  3I3C A;  4CKE A;  3AMU A;  3C3L A;  3JAM L;  4KJN A;  4LAA A;  1PTO F;  1B9M A;  2DUD A;  3K7U C;  4JK1 C;  4C56 C;  2Y0S B;  4XYO A;  3Q22 A;  2QKI C;  2E2I H;  3RD4 A;  3T13 A;  2EDG A;  3NWT A;  4U67 3;  2BA1 A;  4A93 H;  1HUN A;  4K2K A;  2R93 H;  3CCL A;  3NQT A;  1SMY C;  2LXK A;  2X6L A;  3RZD H;  1YJN A;  4R9W A;  3D4D A;  2RSO A;  2AHO B;  1I3Q H;  2JN4 A;  4LFA L;  4A3B B;  2UUA L;  4CDD C;  1I4H A;  1TWA B;  2I0Q A;  2AKW B;  2F4V Q;  1I94 Q;  1Z47 A;  1KC8 C;  4A3D H;  3PIO A;  3ULL A;  5C44 G;  2A6H C;  3V2T A;  1Y8O B;  2KCT A;  3NBH A;  1WJJ A;  2FJ2 A;  4YHH L;  2MUY A;  2PQE A;  3I4O A;  2E75 C;  4G7O C;  4PZ8 A;  1VQK A;  4UP8 A;  4LF4 Q;  2KEC A;  2N78 A;  2MHV A;  4RMF A;  1PTO H;  5JEA H;  3DLL A;  4HIO A;  5J1Z A;  1C8C A;  5ELE A;  3PO2 B;  5LMN Q;  3GD7 A;  3KLW A;  1J5E Q;  1B3A A;  1MSH A;  2OT2 A;  1TWG H;  1JR0 D;  2RCN A;  1JWM D;  3DEP A;  3M9B A;  4C3H G;  2E5L L;  2YTV A;  2OQK A;  2NUC A;  4TQU S;  3MHB A;  1D5X C;  3ERS X;  2LY7 A;  1QVF A;  4GS3 A;  1YZ6 A;  1VQA A;  4BWG B;  2IX1 A;  3GTP H;  1KDC A;  5CYU A;  3GTJ B;  5FO7 B;  4RAU C;  4DAY A;  2KA7 A;  3HOY H;  1K83 H;  2JK8 A;  4HCS A;  2R61 A;  2F0V A;  1YBY A;  2B8G A;  3H3V C;  3STB C;  2GN5 A;  4JC0 A;  1CHP D;  1YI2 A;  2B63 H;  5CGK A;  2QA4 A;  2BE5 D;  5C4J B;  3NEL A;  1VMC A;  2SOB A;  3K7A B;  2CHB D;  2MFI A;  2EXD A;  1N33 Q;  2BA0 A;  2CW0 D;  1SEB D;  3BS1 A;  5IT9 E;  1G91 A;  2QEJ C;  4ZLT F;  2NVY B;  1C48 A;  1I4G A;  1RTO A;  5C3E G;  3I4M G;  1S3O A;  1O7I A;  5C4X B;  4XTC S;  2O4X A;  4P72 A;  5C4X H;  2ZJQ A;  4EGV A;  4R4C A;  2BH8 A;  4WOR A;  2Q8T A;  1Q90 A;  3TZD A;  2E2H B;  1I4Q A;  3HOU G;  3S15 B;  2L4N A;  2N88 A;  3T1Y L;  2NZ1 D;  3HGB A;  1LTT D;  5C4Z A;  1Y1V B;  1XMQ L;  2RF4 A;  3BZD B;  3SK4 A;  1N34 L;  5LMN W;  4QCL A;  1PYS B;  3WOE A;  3GTO B;  5H1S E;  3DWA A;  4OX9 Q;  1NR2 A;  3PUZ A;  4A3M H;  3G4S A;  1RDP D;  1UEA B;  5FLM G;  3DHQ A;  3S2H H;  4ODG A;  4C2M B;  3GTK B;  4P74 A;  2WAQ G;  2CWA A;  1AN8 A;  2NVQ B;  4CGY B;  1ILP A;  1KLU D;  2QCP X;  1HNZ Q;  5A2Q E;  2K6A A;  4K5X A;  2N55 A;  2XRQ D;  3X3N A;  3I7F A;  2KHJ A;  3CRL C;  1SYB A;  1Z6H A;  1VQC A;  2E76 C;  2F1M A;  1I6H H;  1NAP A;  4CJ1 B;  3MAQ A;  3TP5 A;  3FPP A;  4YCV A;  4LF6 L;  1N32 L;  4KKU A;  4M8A A;  4A3J B;  2BOS A;  1L1O B;  3J7Z C;  1ESR A;  1O7L A;  2E2J B;  4ZCK A;  2FMM A;  4RFB A;  3LWU A;  1K3B C;  3MXN A;  3U4V A;  2E2I B;  1EUJ A;  1KQS A;  5IY0 A;  3CW2 C;  4FXG C;  3X3M A;  3K59 A;  5JJK A;  1SYC A;  2WKC A;  1Q86 C;  2JA8 B;  1GUT A;  4DV7 Q;  2UXD L;  1B3Q A;  2CKZ B;  1PH5 A;  1EIG A;  2HHH L;  3K58 A;  2ICI A;  1X54 A;  2JE6 I;  2KCC A;  3DXJ C;  5LHY 1;  4LK1 C;  2K32 A;  1E1T A;  2E2D C;  1HRJ A;  1TR5 A;  1Q12 A;  4XIG S;  5I6Y A;  3HG9 A;  4L5R C;  4JOI A;  4KY5 A;  1LT3 D;  4LFB L;  2UUB Q;  1QVC A;  3W2D A;  3RZO H;  2GA4 B;  3ICE A;  2F3I A;  4F87 A;  4GKK Q;  4KY6 A;  3CCU A;  2RKS A;  4J15 A;  2OF1 A;  4CBV A;  1DOM A;  4GKJ Q;  1ZEQ X;  1Q8I A;  3J81 E;  4QIW E;  1L1O C;  4JI6 Q;  2B2U C;  1IBK Q;  1PTO D;  1RIP A;  5ELB A;  4RCN A;  1S5F D;  1ENC A;  2VNU D;  3SK8 A;  3M4Q A;  3H0G B;  1C0A A;  4LJZ C;  4JI2 Q;  3MA2 B;  1EYD A;  2OXP A;  3GTP B;  2R7D A;  2Z4H A;  5GAD C;  2K5V A;  3OMC A;  3CPW A;  1D1K A; 
#chains in the Genus database with same CATH homology
 1STE A;  1PMR A;  2K03 A;  4IUV A;  4LMQ D;  3DMU A;  4G4K A;  2EXZ A;  2HUG A;  4E6I A;  4RGO S;  2F0G A;  5KEE A;  1WTR A;  1HTL D;  4Y7N B;  2D5D A;  2WAQ B;  3T53 B;  3C1E A;  4KY7 A;  1L0Y B;  1SYF A;  4CJ2 C;  4KHV A;  1AFP A;  3PV0 A;  1V1P A;  1QCB D;  2K04 A;  3LNN A;  4X3S A;  3OSO A;  5C0X G;  4NKL A;  3D31 A;  1BNZ A;  2F4I A;  2PYK A;  3R93 A;  4A3M B;  3SVM A;  1T5X D;  4DA2 A;  1K8M A;  2AWO A;  1CQV A;  4KI0 A;  4PMB A;  5JVG 3;  3HZX A;  3I4M B;  2M9V A;  5BN5 A;  4HSV A;  2Z1C A;  2F0W A;  3K5O A;  4ZKC B;  3HKZ B;  3PO3 B;  5DAU A;  1EQV A;  2D62 A;  3KBG A;  3VA5 A;  4XYQ A;  4N9T A;  3FMC A;  4WRD A;  2PZU A;  4IUT A;  5FLX E;  1ZKO A;  3Q24 A;  1EU3 A;  1GUG A;  1BUV T;  1QB5 D;  4XDX A;  4H0L C;  5E4X A;  1GXD C;  1LAC A;  1IKM A;  1OXV A;  1FYC A;  2EYO A;  1QNK A;  4DF7 A;  1GOZ A;  3S16 B;  3H09 A;  1TII D;  2A6H D;  5EBC A;  4KK7 A;  3R8B A;  2O2L D;  2B2T A;  3VR6 A;  5D3I B;  3FDT A;  1ENA A;  2A69 C;  3C46 A;  4DU9 A;  1TY0 A;  2XSC A;  4S3S A;  2YU9 B;  1SYG A;  4RA8 A;  3G7L A;  4Z9C B;  1DON A;  5JEA J;  1CTM A;  5G3L F;  2ZXO A;  3K0Y A;  1CI3 M;  4XXE A;  4AYB B;  5ISR A;  1SE4 A;  2HDM A;  1QE6 A;  4CKC A;  4H7B A;  3N6R A;  3OWF A;  5K36 G;  2DY8 A;  4KD3 A;  1EY0 A;  3SK5 A;  1IHZ A;  4OHJ A;  2B2Y A;  4ZRZ A;  4EQO A;  4V19 0;  4L6T B;  2JA7 B;  1H9S A;  3MWY W;  1HFN A;  2NBF A;  3URY A;  4A93 B;  2IW3 A;  3P20 A;  2EZV A;  1I3Q B;  1RJT A;  3R2I A;  4DFA A;  3QWN A;  2XRS D;  3OMG A;  3KF8 A;  1ROD A;  3NHH A;  1T5E A;  5NUC A;  1SNM A;  3HOZ B;  1B9N A;  2K33 A;  4B9X A;  4XT3 B;  4KV6 A;  2SNM A;  1SJE D;  2O5J C;  2K5W A;  1X3P A;  1H9J A;  1EU4 A;  2PW7 A;  2Z8L A;  3U9O A;  3I8Z A;  1SNO A;  2D2C C;  2H4O A;  1JWU D;  1F2Z A;  2VUM B;  3CRK C;  2VB2 X;  5G3L D;  3DWQ A;  1HQR D;  4O42 A;  5JVH 3;  2K05 A;  3GTM B;  2B2V A;  2B63 B;  4CHT B;  1EY5 A;  2IL8 A;  4FO2 A;  2A6E C;  2B8F A;  1QG7 A;  2NN6 H;  1ONL A;  2F0T A;  1ZYR C;  3H94 A;  1UAP A;  1JOQ A;  2RQX A;  3P7J A;  2MJ8 A;  3EJI A;  1D1I A;  3PUX A;  4KTA A;  2F0F A;  2F0I A;  5KYL A;  5EKK A;  1SNQ A;  3C2P A;  2WP8 J;  1HXY D;  2NTS A;  3KBX A;  4BA2 I;  4BS9 A;  1F9S A;  1EEF D;  3A8K E;  3BG3 A;  4MHE A;  4F88 A;  2XWB B;  4B9W A;  2MGS A;  4PNY A;  4DXG A;  1RTN A;  1M4V A;  3MXP A;  4DGZ A;  2F0N A;  3AU7 A;  4J8Q A;  5EPJ A;  3FPU B;  5I2Y A;  1XWE A;  1I4X A;  3A7A B;  1U4M A;  4KMU C;  5E3F A;  1BOS A;  4ZKB B;  2XNA C;  1IYV A;  2RDF A;  5EBD A;  5HGT A;  1SAP A;  3HEJ A;  2AUJ D;  4L8J A;  4QMG A;  4C3H B;  1BR9 A;  2ZXP A;  1WCM B;  1SSO A;  1KDA A;  2HDL A;  1TY2 A;  5CV9 A;  1TT2 A;  4ZUI A;  2CW0 C;  3MZ5 A;  4PV1 C;  3RMH A;  2JA5 B;  1EY7 A;  4HN7 A;  2F0S A;  4IQZ A;  5JPN C;  1GUN A;  2EY6 A;  1HA6 A;  3TBI B;  3RLF A;  4RGM A;  3GO5 A;  2EYJ A;  2VXW A;  4IN3 A;  3ERQ A;  2KHS A;  1CHQ D;  1STH A;  2K7V A;  2G9D A;  3BDC A;  1EY9 A;  3FRP B;  1F9P A;  1S5B D;  3M4O B;  4ZQ3 A;  2EY2 A;  4ZK9 B;  2BCO A;  5K36 H;  1RD9 D;  4R8I A;  3J80 E;  3MFY A;  5IGC A;  3IFD A;  2R93 B;  2J7Z A;  1TWH B;  1SBB B;  4KHZ A;  1DD2 A;  4IUR A;  1H9R A;  5C3W A;  4G7H C;  2ZXR A;  3TP8 A;  1JOR A;  3S2H B;  1VMP A;  5FKA C;  2Q8I B;  1LLR D;  1CQF A;  1ENF A;  2QDB A;  3RZO B;  1F2L A;  5M9O A;  1BXT A;  1LTA D;  1OXT A;  2Z4I A;  3FEW X;  3BDO A;  3U9S A;  3H6M A;  5J22 A;  5A2Q L;  4C1N K;  1JOK A;  3L9A X;  2B2U A;  1EIH A;  1U4L A;  5M5Y B;  2EPB A;  1YNN D;  2R3Z A;  1O7Y A;  1O80 A;  3HOY B;  3L7Z C;  5JEA G;  2PZW A;  2KUM A;  2R7Z B;  1K83 B;  3QOL A;  3TDQ A;  2BDN A;  3T16 A;  1QNU A;  1F77 A;  2I46 A;  3H91 A;  4FXD A;  4TKO B;  1MD2 D;  5FO8 B;  2HCI A;  5JPM C;  2NN6 I;  3HOW B;  3NWS A;  1ILQ A;  1B44 D;  1ZXT A;  4NDX A;  1I50 B;  1FD7 D;  5LL6 X;  5BN3 A;  4HMI A;  1BCP F;  4PMC A;  3K5L A;  4O1N A;  2OEO A;  1XXG A;  1V1P B;  1VF7 A;  1KNE A;  3D6C A;  3NP8 A;  3NXW A;  4L63 B;  1KTK A;  1NSN S;  3V96 A;  2Q8R E;  3VA7 A;  4RCO A;  2JYO A;  3BVG A;  1U4P A;  5EJW A;  3IL8 A;  3AB9 A;  5EKI A;  3OW7 A;  2C9O A;  1TS3 A;  3NK9 A;  1GUO A;  1S5D D;  3D3R A;  3J7A F;  1X32 A;  4ME5 A;  1DXM A;  2B2W C;  1MGS A;  1WTX A;  1E2W A;  1ET6 A;  4A3K B;  1TWG B;  2ICE C;  1EZ8 A;  2IT1 A;  1A2T A;  4IUP A;  3VR4 A;  2M00 A;  2EOT A;  1TVX A;  4BY1 B;  3SXH A;  5EPL A;  3TP7 A;  4A3I B;  3DWP A;  3OHX C;  2JXM B;  2DNC A;  4HR7 B;  1PFN A;  4PQX A;  1FNV A;  1V8Q A;  1R4Q B;  5EPK A;  1R4P B;  1EEI D;  2EYH A;  2F0E A;  5ELC A;  1EQT A;  1EYA A;  2L5T A;  2RDG A;  2KEE A;  4H44 C;  1BDO A;  3ZYY X;  2F0O A;  1HTP A;  1CZW A;  3NQI A;  2PZT A;  4HTH A;  2L12 A;  1CM9 A;  1XTC D;  1EY8 A;  1B2T A;  3OPO A;  4KD4 A;  1EFI D;  3FKI B;  3ND9 A;  1Q1E A;  3R2T A;  1IW7 D;  2F0L A;  3VYR A;  2B39 A;  2EYL A;  3S1N B;  2PW5 A;  3I90 A;  3ND8 A;  4ZUJ A;  3SE0 A;  4KKT A;  4OO1 H;  3IKJ A;  2L1B A;  5E1F A;  2SDF A;  2F3V A;  1LTI D;  4C1N I;  2L9H A;  1CZG A;  5F2D A;  1EOT A;  1GHJ A;  1PFB A;  3QOJ A;  1LAB A;  2F0U A;  2K28 A;  3K5M A;  3EA6 A;  2FMC A;  1SMY D;  1VF5 C;  1SE3 A;  2FIN B;  4HMJ A;  4QB4 A;  1WTP A;  2XN9 C;  3MEH A;  5D14 A;  1TS2 A;  4OL7 A;  3I70 A;  3K5N A;  2L0C A;  5IGB A;  1QJO A;  1Q3L A;  3EQL C;  5C5L A;  3MVV A;  1A15 A;  3BYT B;  1NR4 A;  1EY4 A;  3PUW A;  5CV7 A;  2PPB C;  2MPM A;  5KYI A;  4DK0 A;  4IFD J;  3OIP A;  2SEB D;  3VR5 A;  3SDZ A;  3TME A;  3GV6 A;  1O7Z A;  1UUP A;  4ABN A;  4U68 A;  3D4R A;  1A3U A;  3MC0 B;  1G6Z A;  3KK7 A;  4YIJ A;  1DCZ A;  2PMZ B;  4X3T A;  1ICW A;  1DZ1 A;  3WOF A;  3A55 A;  3SR1 A;  3D8G A;  3OOC A;  5M5X B;  1HCZ A;  1BO0 A;  1D5Z C;  1WTQ A;  1S5C D;  4BY7 B;  3S14 B;  1LT4 D;  2JEB I;  2J0T D;  2IJ0 A;  1AP0 A;  5J39 A;  3PUY A;  3E6Z X;  2PNR C;  1PZK D;  3T4A C;  4HAE A;  5CR3 A;  5DEH A;  1SDF A;  5TSS A;  1B4O A;  2LS0 1;  4TSS A;  4IFD H;  1LT5 D;  3SK6 A;  4FF3 A;  1V43 A;  2A68 C;  1A6X A;  4DXF A;  3J7Y W;  4DK1 A;  4P2C B;  3TP6 A;  2J4X A;  2EY5 A;  2O5I C;  2A5H A;  1TQO A;  1HPC A;  2B2T C;  3QB3 A;  3R3O A;  5CV4 A;  1J9O A;  3I72 A;  4KJO A;  3P75 A;  5DNF A;  5C3E B;  4B08 A;  3ERO A;  5ELF A;  2CVR A;  4X3K A;  2A74 C;  3S1Q B;  4FF1 A;  2NB0 A;  3ONA B;  1CA5 A;  1RKN A;  5JAV A;  3RUZ A;  1CK1 A;  1CA6 A;  5ELD A;  4DAV A;  4R8N A;  3DM1 A;  4KN7 C;  1A2U A;  3VR3 A;  4HED A;  3NE5 B;  3CU7 A;  3CQZ B;  1R9T B;  3A7L A;  3W3A A;  4A3F B;  5IGG A;  1S5E D;  1W6K A;  4FXK C;  1II3 A;  1Y69 U;  2R6G A;  1OXU A;  4IUU A;  1SND A;  4IFD I;  4C3J B;  1WD0 A;  4V0B A;  3GTG B;  2ID0 A;  3VYS A;  5COY A;  1KDB A;  1YNJ D;  3HP3 A;  3J81 L;  1JC7 A;  2CQA A;  4M1U B;  2F0M A;  2HCC A;  5C0X J;  4Q0F A;  1M8A A;  4EQN A;  2EYM A;  2EVB A;  5C4H A;  2EYP A;  3C1F A;  5T1G A;  4RGT A;  3HOX B;  1SYD A;  2EJF C;  1D6E C;  2NVX B;  2WB1 B;  3HRZ C;  4BBR B;  1G2S A;  3TSS A;  2G9H D;  1SE2 A;  3HOV B;  5C0X I;  5FLX L;  1MBY A;  2JP1 A;  5I9P A;  3MFG A;  4G57 A;  3S17 B;  1PTO B;  1IW7 C;  2I07 B;  1MSG A;  1EWH A;  2LMC B;  4PMW A;  1A3V A;  2DNE A;  3OIQ A;  1E2V A;  4J6H A;  3OWE B;  1B1Z A;  4N9P A;  3QJY A;  1ESF A;  2NYZ D;  1STA A;  1STN A;  5DM7 3;  1E2Z A;  1NUC A;  3KUP A;  1BCP C;  1WVL A;  1RF2 D;  4ID6 A;  1SNP A;  4RKB A;  3KLR A;  2SNS A;  3NBI A;  1PFM A;  2K01 A;  2KJX A;  4OIK A;  1LTG D;  2WII B;  3GTQ B;  4A3G B;  3HOU B;  1LTB D;  1STY A;  3A8J E;  2F0K A;  1FR3 A;  3TZU A;  1KAB A;  1WTO A;  5IOC A;  4RHS A;  3IFT A;  1E0B A;  2HQE A;  4HCE A;  2B2V C;  5COR A;  5KIX A;  1JE4 A;  2XVS A;  1G2T A;  5M5W B;  3GV3 A;  1F2Y A;  3M85 A;  3ITP A;  4IUQ A;  5C3X A;  5LL6 S;  1KLG D;  1I6H B;  1RCV D;  4OO1 G;  3I91 A;  4GZY C;  4UDU C;  3K6O A;  2ENB A;  4OO1 I;  1XYI A;  1WD1 A;  4KKS A;  4XQQ A;  1ML0 D;  4K5V A;  1PXU A;  1AZP A;  3K57 A;  4IAL A;  1VCI A;  4RKL A;  3TN2 A;  5KNB A;  4XQN A;  3PUV A;  1F9Q A;  5IGF A;  4JBW A;  4UAI A;  5KGU A;  3Q23 A;  1PRT B;  3EVQ A;  3QIA A;  1Z7T A;  1AEX A;  2LFN A;  1F2M A;  3PIO 3;  2FHT A;  2TMP A;  3V05 A;  1MI2 A;  1AW7 A;  5EGT A;  3PIP 3;  3NTK A;  2BDO A;  1GHK A;  1I4R A;  1WTW A;  1PTO C;  2B2W A;  5KRU A;  2JA6 B;  1QOH A;  2QF7 A;  1RHP A;  5IOD A;  2IX0 A;  1TS5 A;  5A35 A;  1X3Q A;  5C6A A;  3GP7 A;  1OXS C;  1TU2 B;  1Y1W B;  2QIL A;  2XIW A;  1TWC B;  1A3T A;  3T51 B;  2NVT B;  2AWN A;  1SXT A;  5I9O A;  3NUC A;  3NSW A;  1K8O A;  3SHL A;  3RZD B;  2B2Y C;  3A56 A;  5I2X A;  3L3O C;  1YNJ C;  1EZ6 A;  3M3Y B;  3G6J B;  2KCN A;  1HFG A;  1S4Z A;  4DN4 M;  3F2U A;  2EY1 A;  1U9R A;  1LTR D;  4FYD A;  5IGE A;  4ZAI A;  1TWF B;  2EE1 A;  5K5P A;  4ZYS A;  1HA5 A;  4K8I A;  5CV5 A;  1D5M C;  2VB3 X;  2JEA I;  2X69 A;  2KOL A;  2F03 A;  1FGB D;  5FOB B;  2IWH A;  4X3U A;  4C3I B;  4MN3 A;  1PZJ D;  1IYU A;  1GJX A;  5IIF A;  3BVM A;  2A69 D;  5IGD A;  5M3F B;  2WV6 D;  1PRT C;  3GQB A;  3MXG A;  5C5M A;  1Y8N B;  3VYT A;  4C3I G;  4FNF A;  1TKW B;  1Q1B A;  2KQ3 A;  2A73 B;  5CV6 A;  1VDZ A;  3A54 A;  1H9M A;  1H9K A;  1FNU A;  4IFD G;  2L11 A;  3MTS A;  1W6J A;  3KLS A;  3DEO A;  1J8I A;  2K5D A;  5AFW A;  1PYW D;  3N52 A;  5IT9 L;  2EJM A;  2TSS A;  5T1I A;  4IZ8 A;  1LT6 D;  4QF4 A;  1PZI D;  1JQY D;  4H13 C;  3M7G A;  1WTV A;  1SJH D;  4J1M A;  3E0J A;  1SFO B;  4I65 A;  3S1R B;  5I4D A;  1YNN C;  2NWG A;  5BN4 A;  4NW2 A;  3BYY B;  4BA1 I;  5CMD A;  1JCK B;  2F3W A;  1HQM C;  4OIJ A;  1STB A;  1OXX K;  3QG1 A;  4K5W A;  4EVO A;  1UNS A;  1SNC A;  2EYF A;  2PCF B;  1IKL A;  4I7Z C;  4FP5 D;  1DM0 B;  1GUW A;  1JIC A;  4A3E B;  3I4L A;  4Q5V A;  3WDN A;  5JJZ A;  1EL0 A;  4DNT B;  2A68 D;  3NTH A;  1CFM A;  4FF2 A;  1FNW A;  1DYQ A;  5D3D A;  1V1O A;  1BCP B;  3SEB A;  3J7A V;  1ET9 A;  4G7Z C;  1JOO A;  5CC4 A;  3S1M B;  3IAY A;  4A3D B;  2H1E A;  2FFK B;  3M4Y A;  5KNC A;  3EFX D;  1G29 1;  1LV9 A;  1AZQ A;  1BF4 A;  1OO9 B;  1PRT D;  5CV8 A;  1SYE A;  1I6V C;  1ZYR D;  4F7X A;  3QO2 A;  2LKV A;  2MP1 A;  1NCV A;  1EWC A;  1B53 A;  2F0J A;  1PDQ A;  2KVM A;  4NP5 A;  1DOK A;  4BBS B;  3I73 A;  4XT1 B;  2DN8 A;  2WAC A;  2F0P A;  4K2L A;  4RH6 A;  1KAA A;  5C44 B;  2PO4 A;  1EYC A;  4FF4 A;  1QWY A;  1PLF A;  5EQ0 A;  2R92 B;  1D2B A;  3Q6S A;  4WJW A;  3S2D B;  3NTI A;  4CKB A;  2F0D A;  3D6W A;  2BE5 C;  5DM6 3;  4C3J G;  4QUC A;  5E4W C;  1LO5 D;  5JOB A;  1BQQ T;  1JB3 A;  4TRD A;  5EKL A;  1TS4 A;  4NMZ A;  2RBM A;  1GUS A;  3J80 L;  2NN6 G;  1BCP D;  2ZT9 C;  2WIN B;  4K6D A;  1BBX C;  2L55 A;  3Q0A A;  4OGQ C;  3M7N A;  2JSO A;  1LTS D;  5CBA E;  1KNA A;  1PRT F;  3BVZ A;  4CJ0 B;  2NTT A;  1F9R A;  3O13 A;  4DAP A;  2DY7 A;  4K6L A;  4ULL A;  4IUN A;  2RDH A;  3CKI B;  1IL8 A;  3DUZ A;  2F0H A;  3E5S A;  3MXU A;  5I6W A;  1H9S B;  1C4Q A;  1QIL A;  2F0Q A;  4WFN 3;  2E74 C;  2AUK A;  1Y8P B;  1O78 A;  2IX3 A;  1DJR D;  2K5Q A;  2V4D A;  2YYZ A;  3LWE A;  2RA4 A;  5HUR A;  2RVL A;  3VYU A;  2A6E D;  3S9W A;  5FK9 C;  1STG A;  1JWS D;  1G8Z D;  3FVQ A;  1CT1 D;  5FO9 B;  3I4N B;  4RGN A;  4QUF A;  2X6G A;  4F8M A;  3HS0 C;  1HHV A;  5M3M B;  4FVM A;  5D65 A;  3CHB D;  4RHR A;  2K1B A;  1B50 A;  4KN4 C;  1I4P A;  4HSP A;  1U4R A;  4K14 A;  2RSN A;  3A8I E;  4XQJ A;  1EY6 A;  5C0X H;  2WKD A;  4K8J A;  2IPK D;  1XX8 A;  3UI2 A;  3KLS X;  3PMF A;  3D4W A;  1DOL A;  1HUM A;  2AQ3 B;  3T56 B;  4EQP A;  3BDL A;  4DNR B;  3VR2 A;  1L0X B;  3P1H A;  2M2L A;  4QIW B;  2D9U A;  5KND A;  4RWS C;  3JAM E;  3LX0 A;  3NPP A;  2AQ2 B;  2XWJ B;  4MIU A;  2AQ1 B;  4ILW A;  2C5C A;  5CBE E;  2KED A;  3GTL B;  2EJG C;  3I3C A;  4CKE A;  3AMU A;  3C3L A;  3JAM L;  4KJN A;  4LAA A;  1PTO F;  1B9M A;  4JK1 C;  4C56 C;  2Y0S B;  4XYO A;  3Q22 A;  2QKI C;  3T13 A;  3RD4 A;  2EDG A;  4U67 3;  3NWT A;  2BA1 A;  1HUN A;  4K2K A;  3NQT A;  1SMY C;  2X6L A;  4R9W A;  3D4D A;  2RSO A;  4A3B B;  1I4H A;  1TWA B;  1Z47 A;  2A6H C;  3V2T A;  1Y8O B;  3NBH A;  2FJ2 A;  2MUY A;  2PQE A;  2E75 C;  4G7O C;  2KEC A;  2MHV A;  1PTO H;  5JEA H;  5J1Z A;  1C8C A;  5ELE A;  3PO2 B;  3GD7 A;  1B3A A;  1MSH A;  2OT2 A;  1JR0 D;  1JWM D;  3DEP A;  4C3H G;  2NUC A;  4TQU S;  3MHB A;  1D5X C;  2LY7 A;  4BWG B;  2IX1 A;  1KDC A;  5CYU A;  3GTJ B;  5FO7 B;  4RAU C;  4DAY A;  2KA7 A;  4HCS A;  2R61 A;  2F0V A;  2B8G A;  3H3V C;  1CHP D;  5CGK A;  2BE5 D;  5C4J B;  1VMC A;  2SOB A;  3K7A B;  2CHB D;  2BA0 A;  2CW0 D;  1SEB D;  3BS1 A;  5IT9 E;  1G91 A;  2QEJ C;  4ZLT F;  2NVY B;  1C48 A;  1I4G A;  1RTO A;  5C4X B;  4XTC S;  2O4X A;  4EGV A;  4WOR A;  2Q8T A;  1Q90 A;  3TZD A;  2E2H B;  1I4Q A;  3S15 B;  2L4N A;  2N88 A;  2NZ1 D;  3HGB A;  1LTT D;  5C4Z A;  1Y1V B;  3BZD B;  3SK4 A;  4QCL A;  3WOE A;  3GTO B;  3DWA A;  1NR2 A;  3PUZ A;  1RDP D;  1UEA B;  3DHQ A;  4ODG A;  4C2M B;  3GTK B;  1AN8 A;  2NVQ B;  4CGY B;  1ILP A;  1KLU D;  2QCP X;  5A2Q E;  2K6A A;  4K5X A;  2N55 A;  2XRQ D;  3X3N A;  3CRL C;  1SYB A;  1Z6H A;  2E76 C;  2F1M A;  1NAP A;  4CJ1 B;  3MAQ A;  3TP5 A;  3FPP A;  4KKU A;  4M8A A;  4A3J B;  2BOS A;  1ESR A;  1O7L A;  2E2J B;  2FMM A;  4RFB A;  3LWU A;  3MXN A;  2E2I B;  4FXG C;  3X3M A;  3K59 A;  1SYC A;  2WKC A;  2JA8 B;  1GUT A;  1EIG A;  3K58 A;  2ICI A;  2JE6 I;  2KCC A;  3DXJ C;  5LHY 1;  4LK1 C;  2K32 A;  2E2D C;  1HRJ A;  1TR5 A;  1Q12 A;  4XIG S;  5I6Y A;  3HG9 A;  4KY5 A;  1LT3 D;  3W2D A;  2GA4 B;  4F87 A;  4KY6 A;  2RKS A;  2OF1 A;  4CBV A;  1DOM A;  1ZEQ X;  1Q8I A;  3J81 E;  2B2U C;  1PTO D;  5ELB A;  4RCN A;  1S5F D;  1ENC A;  2VNU D;  3SK8 A;  3H0G B;  4LJZ C;  3MA2 B;  1EYD A;  2OXP A;  3GTP B;  2Z4H A;  3OMC A;  1D1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...