2K03A

Structure of sdf1 in complex with the cxcr4 n-terminus containing a sulfotyrosine at postition 21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCACQIVARLKNNNRQVCIDPKLKWIQEYLEKCLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1
publication title Structural basis of CXCR4 sulfotyrosine recognition by the chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 10
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k03A00
4OIKA 1WTWA 5EJWA 1U4RA 1EOTA 2L9HA 1GUWA 1RJTA 5EQ0A 2NYZD 3R93A 2N88A 3GV3A 1IKMA 2B2VA 2J7ZA 5EPKA 1QE6A 1SSOA 1DZ1A 2HDLA 2JYOA 2KOLA 4LMQD 2FMMA 1HUNA 2EOTA 1HFNA 1NCVA 1MGSA 2HUGA 2MP1A 1JE4A 1EIGA 3KUPA 4RAUC 1EIHA 2B2TA 1F9SA 4ZKBB 1TVXA 2X6LA 1G6ZA 1WD0A 2K1BA 3QO2A 4O42A 4NW2A 5CBEE 5E4WC 2X6GA 4R8IA 3I91A 5D65A 1WVLA 1DOKA 3LWEA 3D6WA 1WTVA 1NR2A 1BO0A 4X3KA 1RTNA 1F2LA 2B2WA 1MSHA 2M2LA 4IUVA 4HSVA 4QUCA 3ONAB 1QNKA 2SDFA 3H91A 4ZK9B 1JICA 5T1IA 1B50A 2VXWA 1EQTA 2K01A 3N52A 1KNAA 1AZPA 3KBXA 3SVMA 2KUMA 1B53A 4XT1B 1DOLA 1HA6A 3I3CA 1MSGA 1G2SA 3MTSA 1XYIA 1XX8A 4OIJA 1F9PA 2MJ8A 5E4XA 2H1EA 1LV9A 3IL8A 2NZ1D 5T1GA 1ILPA 2MPMA 4IUPA 4HEDA 1PFBA 1IL8A 1O80A 4IUTA 3I90A 2NWGA 3GV6A 1X3PA 2L11A 3DEOA 1PFMA 1U4MA 2L12A 1NR4A 1C8CA 3DEPA 2FJ2A 1B4OA 1G91A 2FHTA 3MWYW 1WTOA 5AFWA 1SDFA 5EKIA 1ZXTA 2FINB 1WTPA 1ILQA 2HCCA 4UAIA 1BNZA 1DOMA 1HHVA 1O7YA 2RSOA 1HFGA 1S4ZA 2B2UA 2B2WC 2K04A 3FDTA 1KNEA 2HCIA 4RA8A 1RODA 2D9UA 1F9QA 1HUMA 4IUUA 5DNFA 1DONA 1U4LA 4X3TA 1BF4A 1B3AA 2B2VC 1WTRA 1AZQA 2XIWA 1U4PA 4X3UA 5COYA 1CA6A 3I8ZA 1PLFA 1ESRA 2B2YA 5EPJA 1CA5A 4XDXA 5D14A 2R3ZA 1EL0A 1ICWA 1X3QA 3F2UA 2B2TC 2CVRA 1M8AA 5CMDA 4XT3B 3UI2A 4QUFA 1BBXC 1CM9A 3HP3A 1J8IA 1RTOA 1A15A 1E0BA 4MN3A 1RHPA 3G7LA 1B2TA 4CJ1B 4X3SA 2L4NA 4CJ0B 4R9WA 2KEDA 4DN4M 4CJ2C 4HCSA 2RA4A 1J9OA 1O7ZA 1PFNA 2EPBA 4IURA 3TN2A 3TZDA 1WTQA 4RWSC 1Q3LA 2Q8TA 2K03A 3P7JA 4HAEA 3FPUB 2B2UC 1X32A 2DY7A 1AP0A 1IKLA 2DY8A 2FFKB 2KVMA 2RSNA 2RVLA 2EE1A 2X69A 5EPLA 1ML0D 1WTXA 3Q6SA 5CORA 1WD1A 2K05A 1G2TA 1HRJA 2Q8RE 2HDMA 4U68A 3IFDA 1PDQA 1QG7A 2MGSA 4ZKCB 2IL8A 2BDNA 1VMPA 4ZLTF 2KECA 4IUQA 1VMCA 2JP1A 5JJZA 2N55A 2B2YC 1SAPA 1NAPA 5CBAE 4MHEA 2KEEA 4ZAIA 3DM1A 1F9RA 2K28A 2L1BA 1MI2A
chains in the Genus database with same CATH superfamily
2XWBB 2K52A 4IPDA 4L5SA 2E8GA 3H6MA 3KJOA 2A5HA 3X3NA 4M8AA 4X65Q 4DUYL 3URYA 4JI4Q 5J39A 4QJFA 3KOJA 2I5MX 2RCFA 2LFNA 2VY3A 4KJNA 2PMZE 1G6ZA 4AQYQ 2PZWA 2WKCA 1J5EL 1CKNB 3FMCA 1SMYD 4KN7C 1SYGA 1Q90A 2E2JH 4ZRZA 4JI5Q 2D0OA 2VXWA 1SEBD 1YEZA 3KBXA 4C56C 1GO3E 3TMEA 1KIXA 1MSGA 1G2SA 3MTSA 5H1SE 4DR2L 2GVBA 2M00A 1A8VA 2Z8LA 5C6AA 5DM73 5IP9H 1SBBB 5I2YA 3UDXA 5GROA 5FO8B 2CQAA 2SOBA 2V1CC 3EN2A 3NWTA 1GUTA 2DNEA 5EKLA 1GUOA 2BOSA 1D5ZC 4JI8Q 1HNZL 2E76C 1Q82C 1HFGA 1S4ZA 2K04A 1VF5C 2SNSA 2Z4HA 1SYBA 1G8ZD 1NJIC 4IO9A 3OOCA 1PH6A 1F9QA 3CCQA 3PQIA 5DNFA 4KHZA 3G6EA 3U4ZA 2UUAL 1SE8A 2ICEC 2PQEA 3A7LA 1HH2P 5C0XJ 4GKJQ 2B2YA 4M1UB 2JA5B 4L8JA 4DPGA 2CVRA 3I4MH 3CP0A 3TS2A 2K50A 1SNMA 4DKAC 1KRSA 1NBWA 2PZTA 1RHPA 2KQ3A 2Y0SB 2Z4IA 1LT4D 3L9AX 4F7XA 3QR8A 1S5FD 1PFNA 1JB3A 1SR3A 5KNBA 5IE8A 5C3EB 2K03A 3GTJB 4A76A 4IQZA 2EQSA 2FFKB 4LF6Q 1WOCA 4OWTB 2E2HH 4C3IB 3BZCA 1G2TA 2B8GA 3ND8A 4BWGB 1YIJA 5DM63 1CT1D 2JA5G 1B9MA 4HR7B 2KECA 3A8KE 3JAME 3KK7A 4R4QA 2OT2A 4MHEA 2Y0SG 2PPBC 3GTOB 1FNVA 4OIKA 5EQ0A 4K6DA 4Y7NB 4A3CG 2YYZA 3OTOQ 3CCJA 2OTLA 1SSOA 3QB3A 5IIFA 2HDLA 2KOLA 2WB1E 3W2DA 5CV5A 2QGQA 2TSSA 5FO7B 1S72A 2O2LD 1HUNA 4LF5L 3BZKA 3GTKB 1RD9D 1JE4A 1EIGA 3KUPA 3MXUA 2NVQB 1LUZA 3OHXC 3A54A 5KRUA 4FF3A 5M3FB 3KDFB 3QO2A 1IXRA 2MNAA 2NBFA 1FNWA 2DJFC 4MNOA 3JAMc 2BE5D 1WTVA 1NR2A 3S15H 3DXJC 1K0RA 3HOVB 1BBWA 5I4DA 3UE1A 1L1OB 4LF4L 3ULLA 2EY5A 1AN8A 4QMGA 5LHY1 1LTSD 1B53A 3S2HH 3NTHA 5GQOA 2N8NA 4DR5L 3P20A 4WRDA 1GOZA 2LXJA 2MPMA 4KK7A 1PFBA 3S16B 2NVYB 2MHVA 5C4JB 1K73C 1PFMA 5FLXc 1X54A 2FHTA 2R61A 4DV2L 1YNJC 3U50C 5IT9E 4A3LG 1KC8C 1BNZA 1KHIA 2H5XA 2F3WA 4EQOA 4DV4L 1IBML 1QOHA 3NTIA 3KLRA 4NPSA 4BY1B 5DEHA 1AZQA 4R1JA 1L1OC 4X3UA 1CA6A 2AWOA 1STBA 4P2CB 3F2UA 1UUPA 1TWGB 3T1YL 3HFZB 4QIWB 4MIUA 4A75A 1YJNA 3K81C 1XNQL 1E22A 3W5OA 3QWNA 2RF4A 4UY8C 1SE2A 5IT9c 4DUZL 5C5LA 2CH4W 2ENBA 3J81j 4B3MQ 4BY1G 1EIYB 1CZWA 3KYHC 3U4VA 1CQFA 1TS5A 2K6AA 3IKJA 1A2UA 1K8GA 1VQMA 2PW5A 3L3OC 3R3OA 4DAPA 1MJEA 1R9TH 1JWSD 2JA5H 3CCMA 3A56A 2JEBI 3CCEA 3D0FA 3I4NH 4LF8Q 4WJ4A 3A55A 4B3TQ 1QE6A 5I6YA 5IGBA 1JJCB 3FEWX 1PHJA 5C3EH 1K3BC 2J0TD 4RAUC 3GTJH 2ZJQA 2F0TA 3MVVA 4IPGA 2H4OA 1F9SA 4K2LA 4C3IH 2Q2TA 3J7AF 3G48A 4O42A 3I2ZA 1DXMA 5E4WC 1AEXA 4PZ8A 2X6GA 5C5MA 3RLOA 3VYSA 1B1ZA 1D2BA 1QB5D 4X3KA 2IT1A 3ULPA 3AB9A 4X66Q 3STBD 1E1OA 1PH8A 3GTOH 1VQGA 3I4LA 2K5NA 4Q0FA 2RDHA 4RFBA 5HY6A 2KUMA 1A3UA 4G7OC 3TQYA 2ZJPA 1TR5A 3J81L 1IW7D 3I72A 1VQBA 5M3MH 3GTKH 5E7NA 5KGUA 3ITPA 2NVQH 4JCVE 2CQOA 4QL5A 1B3QA 2VNUD 2KCMA 2VB3X 5M3FH 4OO1G 5IOCA 2WP8J 4HCEA 4HIMA 1IBKQ 3FDTA 3D4DA 4NXNQ 3HOVH 4A3LH 2NTTA 3D4WA 3M4QA 4IPCA 4JI5L 4DK3C 3OYYA 4X3TA 3G4SA 1BF4A 5EBCA 2UXCQ 4DV7L 1ESRA 3TBIB 4DV0L 1Q81C 4LUOA 3S16H 5C4JH 1KD1C 2KCCA 2F0LA 4CJ1B 1D1KA 3A8JE 5CV8A 4DN4M 4DXGA 1WYDA 1W6JA 1SYEA 1JJ2A 3GQBA 2PYKA 3S17B 3HOUH 2AUJD 1X32A 3NBHB 1UNSA 1Z9FA 5EPLA 3X3MA 4P71A 3FP9A 1K8AC 2PQAA 2YU9B 3GTLH 4KKUA 3S1NB 1E3PA 5A2QL 4BY1H 3QIAA 2JXMB 3T1HL 1ET6A 3VYTA 4GKJL 1Q86C 1I5FA 5C4XB 1WCMH 1I4QA 1EY9A 1TWGH 2AUKA 1HTLD 2F0IA 1STHA 4GNXC 5EPKA 4TSSA 4FF2A 1STYA 4N9TA 1EYAA 4JV5L 2PI2E 5LMNW 2IHFA 3OIPA 4ME3A 2OTJA 3BDLA 4ZCKA 1J5EQ 4PG3A 1PV4A 3I56A 4ULLA 1ESFA 1HZAA 2CH4A 2AHOB 2QILA 1BDOA 1VQPA 3PUVA 4DNRB 4JPBW 5IYCG 4DGZA 1HQMC 1KLGD 3GDEA 5K36G 2EY6A 4F88A 1EZ8A 1N33L 4DR2Q 1TWCB 1UE5A 1QVFA 1XYIA 1XX8A 3FPPA 2E2DC 1CKMA 1LV9A 3KF6B 4IJHA 1A3VA 2I0QA 4LF9Q 4JW0A 1NSNS 3A5ZB 4IFDH 1SYCA 4A3MH 1CHPD 5IODA 3R2TA 1PRTF 4NB3A 1X3GA 4OX9Q 2JA6H 5EKKA 2ZXOA 3CCRA 3RZOB 4DFAA 2VQFL 2VZAA 4KY7A 2UUAQ 3H09A 2WAQB 3J80c 3TP7A 2D9UA 5LMUL 4A3DH 4LUVA 1HA5A 1B3AA 2F0QA 1HJPA 1GHKA 4GOPB 1CSQA 2R6GA 2B63B 2KHSA 2B2TC 1I4GA 5IYBG 1W2BA 1JR0D 4HMJA 2NZOA 1NE3A 4N8X1 1CUKA 3CCUA 1GUGA 1PMRA 1WTHA 2WAQG 1LTLA 1OXVA 3F2DA 1OXXK 1K3RA 3WDNA 3P7JA 4C3JH 5IWAQ 2ZM6Q 1EZ6A 5G3LD 1IKLA 1TWFB 2HD3A 3PMFA 4HJAA 5M5WH 1HRJA 5IGCA 1YNJD 3HKZE 4C3HB 5JEAH 3I7FA 2B63G 1VQCA 4CHTB 1CFMA 3BVGA 2BDNA 2YV5A 3T4AC 3NSWA 4I7AA 4UHVA 5HGQA 2I5LX 1IBLQ 1B8AA 3HOXG 4GOPC 2A73B 1RJTA 4DNTB 3PO2G 2R7DA 4A3EB 4DR3L 4LF5Q 4A3KH 1EY6A 4JK1C 2F4VL 4WJ3M 4C3HG 3B6YA 3MXNA 3S17H 1MGSA 2CW0C 4FVMA 4XYOA 2AWNA 3CW2C 4ZKBB 2EYPA 4JI7L 3S1NH 1YJWA 2A19A 3H0GB 4LF4Q 1HR0W 3RNUA 4DAYA 5JJIA 4KD4A 2CWPA 3G71A 1VQ6A 2SDFA 4DV3L 1XMQL 5C4XH 2BCOA 2RDFA 4DR5Q 1YVCA 5IYCH 1SMXA 3SVMA 4K8IA 3SK4A 3Q24A 2E5LL 1JCKB 4JI0L 4RCNA 1AW7A 2MJ8A 1UE1A 2XNAC 4PMBA 4B3TL 1EY8A 1X3FA 1ZEQX 3I90A 5IGFA 3J7YW 1SJHD 3RLNA 2QEXA 1PA6A 4DV2Q 1ENAA 2L12A 2N49A 3H0GG 4KKTA 4K2KA 4J8QA 2XGTA 2PW7A 4YY3Q 4IOCA 2HIXA 1D5XC 1PTOB 2EJGC 4DV4Q 2VUMB 4BY7B 1EOVA 1SXTA 1X6OA 4DXFA 2B2WC 3Q22A 4RKLA 2QDLA 3UE0A 1JQYD 3J81E 2B2VC 1CQVA 4OO1I 3DUZA 3VA7A 5COYA 4A3FB 4KN4C 4Q5VA 4HIKA 3QG1A 4KKSA 4FF1A 4A3BG 4ILWA 2R7ZH 3GD7A 1X3QA 1HQRD 1XNQQ 1GD7A 1Q12A 3AFPA 5C44B 1B2TA 1IZ6A 2CFMA 3G7LA 2OF1A 4DUZQ 2VUMG 4EGVA 4BY7G 1A3TA 1KRTA 1Q3LA 4QGUA 3RZOH 2KHIA 1WTXA 1YNNC 2RVLA 1EUJA 1IBKL 2K05A 3MA2B 2NZHA 4GKKL 3EROA 3J81c 5F2DA 4DV1L 2ID0A 3PO3G 3ZYYX 5C44G 5M5XB 3H3VI 4J15A 2JA8B 4JI1L 1UE7A 1I4RA 2EY1A 3NUCA 4K14A 4IFDJ 2Q8IB 2L9HA 2VB2X 2K5WA 3TP5A 2RQXA 3R93A 4P74A 3M4OH 2A6HD 1STGA 3W1BA 3NQTA 4L5RC 3M3YH 1QUQA 3Q8DA 4LK1C 4HIDA 4CDDC 4Y52H 1I50B 4G7HC 1TWFH 5A2QE 5E3FA 4TQUS 3VR3A 4DK0A 4NW2A 1PH2A 2JA8G 4NKLA 1D5MC 1L0XB 3OMCA 3SGIA 5FJ8H 1RDPD 3EVQA 3I4OA 2EDGA 1X3EA 1KTKA 1JICA 2K75A 5T1IA 4EQNA 3OPOA 1DOLA 3NXWA 3Q0AA 4A3EH 1E7ZA 2HHHL 1X55A 2QEJC 1LTID 1PRTC 1IL8A 3U9OA 2K4KA 4IUTA 5GAGC 4HJ5A 3MAQA 1C8CA 3A74A 1WTOA 5JEAJ 2OEOA 4FP5D 4BXXH 2NVXH 1A6XA 3AU7A 3S14B 1ILQA 2K5VA 4IZ8A 4FF4A 1ICFB 3PUWA 3LWUA 4DV7Q 2MFIA 1HUMA 2AKWB 4B3SL 3DLLA 1EFID 2YTXA 4RG1A 3EA6A 4DV0Q 1SFOB 1S5CD 4S3SA 2A1AA 3K5OA 4A3GG 4BS9A 1JC7A 4LFCQ 1BXTA 4LF9L 1M8AA 1GUNA 1VQEA 4QUFA 1OXTA 5EGTA 2B39A 1Y8OB 2K7VA 5KIXA 4ID6A 2KA7A 5IGEA 1TS4A 2Q2HA 2ICIA 1STAA 5ELDA 1YHBA 3G6JB 4BBRH 4OX9L 2UXBL 4H0LC 2B2UC 3ZJYC 3LNNA 1LLRD 3UDFA 1EY4A 3T1HQ 3Q6SA 2SNMA 2HDMA 2L5TA 1PH5A 3IFDA 3S1MH 1Y1WH 4A3FH 4KHPQ 2PNHA 2K28A 1MI2A 5CGKA 1JT8A 2ASBA 5EJWA 1RF2D 1U4RA 2NB0A 4PZ7A 2IX3A 1ASZA 2F0WA 1EWCA 3KF8A 1E2WA 4JV5Q 4FXGC 2JYOA 1CKOA 3HOZH 1KDAA 3J7A5 2EOTA 1Z47A 2MP1A 3SDZA 5IWAL 2ZM6L 3WWVA 3M7GA 3P75A 2R92H 5ISRA 2F0MA 2OQKA 2Z9HA 1SNCA 3IRBA 3D6WA 1LABA 3K6OA 4JI6L 3WOFA 1H9JA 1N33Q 1HZCA 2JA8H 2L55A 3CD6A 1IBLL 2AQ3B 3N52A 3F2BA 1TY2A 4RGOS 1BCPF 3I3CA 3S1RB 3OIQA 1CZGA 4HTHA 1AFPA 1K8MA 3CC4A 2CWAA 1VF7A 1XPRA 1PH1A 3GTMB 1TWHB 4YCUA 1Y14B 4EVOA 3GTQB 2HT1A 1BVSA 1I50H 2QKIC 1BQQT 1B4OA 2VQFQ 4HIOA 4K5WA 1XWEA 2CW0D 1O7LA 5LMUQ 2PI2A 3R2IA 1PXUA 4UP7A 5GADC 1QNUA 4IUUA 1VQDA 4OWXB 4CKEA 2RHSB 1GHJA 3T16A 2NN6G 3RR5A 4LAAA 4O1NA 1KABA 3CXCA 4CGYB 3MC0B 1AE2A 3QOLA 3A0JA 3HGBA 3N6RA 3PF5A 1DJRD 3HOYB 4R9WA 1B44D 4YY3L 4HAEA 4DR7Q 1WI5A 3L2PA 3AQQA 1JJGA 1T5XD 1LT5D 2Z0SA 4GS3A 4K0KL 1V9PA 2MUYA 1QCBD 4I7ZC 2O4XA 1YJ9A 5CYUA 1V1OA 1U0LA 2JA7G 1VMCA 2B2YC 1PVOA 1STEA 2LS01 3DWAA 2O5IC 3L0OA 4KY6A 3V96A 3HOYG 5M5YB 4DR3Q 3A8IE 1XPOA 1I6HB 4IPHA 2NYZD 3K5MA 1B70B 2F4VQ 1IKMA 2K33A 1LTRD 4DAMA 2DGYA 5J3BA 1W6KA 3E6ZX 1O7IA 5KEEA 4LNQA 3Q23A 1H9MA 2C9OA 2WFWA 1PH7A 1GUSA 4JI7Q 3BZDB 2LKVA 3H15A 4F87A 1VQAA 4DV3Q 1XMQQ 2KHJA 4G57A 1SNPA 1PH4A 2E5LQ 4JI0Q 4A4IA 1LTAD 2A68C 4R4IA 4C2MB 2F1MA 3SXHA 4A3CH 5ELFA 4CDCC 2Y0SE 3CMAA 5J1ZA 4CBVA 1O80A 2XVSA 2NWGA 3GV6A 1X3PA 1U4MA 4NXML 1NR4A 4L63B 5EKIA 4A3IB 5EBDA 1VQKA 1HNWL 4RMFA 4GNXA 4CDEC 2O5JC 1XMOQ 1O7YA 4K5VA 3RMHA 3RUZA 5BN4A 3E9HA 1DGSA 4Y7NH 1DONA 4CKBA 1TY0A 4AYBG 1Z6HA 2ALYB 4DR4Q 1U4PA 4FXDA 3I8ZA 3S24A 3CU7A 1HZ9A 1ICWA 2HQLA 3GTMH 3S9WA 1FNUA 5CMDA 3GTQH 5ELEA 1E0BA 4R8NA 4A3IG 1A2TA 3NEMA 5FO9B 2IY5B 3TN2A 3U58A 4RWSC 1EQVA 3T13A 1JOKA 2XRSD 4GKKQ 3F1ZA 1E2VA 1KL9A 2X69A 4LJZC 1V1PA 1QILA 3HS0C 5CORA 1LYLA 1PZID 4DV1Q 1FGBD 3PCOB 1D6EC 4ZLTF 1I3QB 1BCPB 4JI1Q 2JSOA 2NVYH 4CDFC 4LFCL 4JVZA 3CQZB 4LUZA 1YI2A 4PNYA 1ENCA 4WORA 2N88A 2LXKA 3OMGA 4DV6L 1JWMD 4LMQD 2FMMA 3K0YA 3V2TA 1EIHA 4JBJA 5ELNA 1EU3A 2B2TA 1VQ4A 1TIID 2K5HA 1PTOF 4H7BA 3I91A 1DOKA 5IYDG 3H3VC 3LWEA 2R93G 1V1QA 4JBMA 4KHPL 2I46A 2HHHQ 2QA4A 2F0GA 4YIJA 1I6HH 2A6EC 4NMZA 2F52A 4IUNA 1QWYA 1X65A 4QIWE 3IL8A 3O13A 4LWCA 3CPFA 4N8FA 4DF7A 4RGTA 3MEHA 4X6AH 2VS1A 2FJ2A 3HOWB 3DM3A 3HRZC 1ZYRC 2XRQD 3U9SA 4YWLA 5CR3A 4B3SQ 1KAWA 2HCIA 1SMYC 1G51A 3S1QB 1WTRA 5I9OA 2XIWA 1G291 2YTYA 3CKIB 2A8VA 5D14A 3HOWG 4JOIC 3VYRA 4DV5Q 1FD7D 4XT3B 5DAUA 5C0XG 4TRDA 5BR8L 3JAMi 4MN3A 4V0BA 2Z6KC 3I70A 2NN6I 1ET9A 4IN3A 2I07B 1EEFD 1VQFA 4JI3Q 2UXBQ 4HCSA 1J9OA 3NBIA 4R4OA 5KNCA 2PQAB 2UUBQ 3I55A 4OO1H 1Y1VB 4YCWA 1P16A 3CCLA 1F2MA 1TU2B 2DUDA 1H9SA 1SROA 1SYFA 2KENA 1I94Q 4A3JB 3E5SA 1MIUA 1VMPA 3PIPA 4G7ZC 2G5DA 3VDYA 2F0DA 3QOJA 3DMUA 1UEBA 4ZAIA 1SNQA 1YZ6A 4JC0A 5C4HA 1KDBA 3PUXA 1X9NA 4XTCS 1N8RC 1BUVT 1WTWA 4JBWA 5CC4A 3HOXB 3K5LA 4POFA 2XSCA 3GV3A 2B2VA 4G4KA 3PO2B 1Y1VG 1MJCA 4ODGA 4JG2A 5JVG3 2WACA 5E1FA 1BKBA 1LACA 2VL6A 4A3JG 4POGA 4KTAA 4DR7L 4L6TB 3GTPB 3H3VH 4HJ8A 4OGQC 3A5UA 4JI6Q 5CBEE 1KAAA 2SEBD 1F2YA 4R8IA 3OSOA 1WVLA 3I73A 1I3QH 1MD2D 4R4TA 3L7ZC 5KYIA 1F2LA 2F0HA 1B9NA 1EQTA 2EXZA 2R7FA 3CQZH 4HJ9A 4L5QA 1PH9A 5ELBA 2K5QA 2ZXPA 4QB4A 4O0AA 4B08A 1PZJD 4HEDA 2PZUA 3DEOA 3D6CA 2F4IA 3PIP3 1H95A 5BN3A 2YU9H 2RCNA 1G91A 4OL7A 1SDFA 4JI2Q 3FVQA 2VW9A 1ZXTA 3PF4A 1VQLA 4I65A 5CV9A 1VS0A 3MZ5A 1ENFA 3J7ZC 5LMNL 2XTIA 5KNDA 2BE5C 1M1KC 5K36H 3PIOA 4AIMA 2FMCA 4X62Q 3TEHB 2WV6D 5FLXL 2EZVA 1OTCA 3HKSA 1KXLA 2UXDL 2J4XA 2E2JB 2PO4A 3UI2A 4A3BB 2AMCB 3BU2A 3C1EA 2NVTB 1TS3A 3HOWH 2DNCA 4J1MA 5JJKA 3MXGA 3CC2A 1T9HA 3TZDA 5C0XH 1WTQA 4FYDA 1HXYD 1HPCA 3EQLC 3E0EA 3ERQA 1QZHA 4K0KQ 4FO2A 1XMOL 3CRKC 1ZKOA 4U673 1TWCH 1SNDA 4IALA 3IFTA 4EQ5A 2MGSA 3NK9A 4K8JA 1TT2A 4KI0A 3C2PA 1SYDA 5CBAE 4DR4L 3PO3B 2IX0A 1UEAB 4P73A 1C9OA 5IT9L 1EEID 3PUYA 3CRLC 1NMGA 1VCIA 3R8BA 2WIIB 1EQQA 3E3XA 5IYBH 3D31A 3MXNB 2MO0A 2JA9A 3PIO3 3NWSA 2UUCL 1PTOC 4KY5A 1PZKD 4DA2A 1Q1BA 1TVXA 3K7UC 3OWEB 4DAYB 4TVAB 2WAQE 4RH6A 4A3JH 2E2IB 2RDGA 4RGMA 3UDIA 2B63H 4ME5A 3SHLA 5G3LF 1O78A 1CKNA 4JBKA 1MHWC 3HOXH 4HN7A 3PO2H 2NZ1D 3I4MG 2F0SA 4KV6A 4NXMQ 3VA5A 1D7QA 4NP5A 2LSSA 3HG9A 3AEVA 4C3HH 2WB1B 1HNWQ 1CI3M 3MWYW 2V4DA 3KLSA 1RCVD 3TP6A 4MZ9A 2F0EA 5FK9C 5IP7G 4KLKA 2EIFA 1A62A 4B3RL 3TP8A 2BDOA 1PH3A 1YBYA 2OQ0A 1BOSA 4B9WA 5HURA 3STBC 3KFUA 3PSIA 2ZTDA 4Z9CB 4C1NI 4XDXA 2WB1G 1HR0L 3S15B 1Y69U 4YWMA 1DCZA 5LL6S 1YHQA 4A3GB 1NTGA 2A6ED 4L5TA 1BBXC 2VQEQ 4E6IA 1IW7C 1VQNA 4UP9A 1KQSA 3MFGA 3NQIA 3S2HB 1K28A 3H0GH 4GN5A 1NMFA 2Q8TA 2F0KA 5GAEC 1N36L 3FPUB 5C3WA 1CSPA 2B8FA 5C0XI 2KVMA 4XIGS 3KLSX 1VQ7A 1ZYRD 1EY7A 4ZKCB 4HJ7A 2C35B 1KLUD 5I9PA 1NAPA 3MXPA 1K83B 2CKZB 3A7AB 4LW1A 5I2XA 5KYLA 3MHBA 3K8AA 4A3BH 1GUWA 4DV5L 1QUQB 2NVTH 1I6VC 3WOEA 5JAVA 4DV6Q 3J80i 1RL2A 3S2DB 3BYYB 1DZ1A 1PTOH 4JI3L 2VUMH 3GTGB 1VQ8A 2Z1CA 4BY7H 2K14A 2N3SA 1TKWB 2UUBL 2OCEA 1A0IA 3TSSA 1DM0B 1I4XA 4QY7A 4XQNA 1XNRL 3HZXA 3E0JA 2K1BA 1XTCD 2E75C 5D65A 1I94L 5HGTA 1BR9A 3KDFA 3PO3H 1S5BD 5L37A 2JEAI 5C44H 1DYQA 2GA4B 2XWJB 3JC66 1B50A 1D8LA 2K01A 1KNAA 4H13C 5FOBB 1GVPA 1AZPA 4OWWB 3KBGA 3K59A 2LMCB 1L1OA 2H1EA 4IOAA 1R9TB 1B7YB 3DWQA 3NHHA 2F0PA 1FJGL 3C46A 3I4NB 3AYHB 5AFWA 5IGDA 3KJPA 2E2IH 5M5XH 2FINB 1WTPA 2HCCA 4DK1A 1H9RA 1JB7A 2RSOA 5AJ3L 3BDCA 4QQBX 2ZTEA 3TRZA 4DAVA 1JORA 1HTPA 2EYMA 1XTDA 4QF4A 3FKIB 5IP7H 1LT6D 1L0YB 4CKCA 2A69C 1E24A 5NUCA 5BR8Q 1N34Q 2ATWA 4F8MA 2D5DA 2M9VA 3I4NG 3BG3A 4KHVA 4UPAA 3VR6A 2OXPA 4N9PA 1EY5A 4X3SA 1N32Q 1OXSC 3J80L 1IYUA 4CJ0B 5C3EG 3RN5A 2EPBA 1E1TA 2HQEA 4JI2L 2OWOA 3TS0A 1Q8KA 1HCZA 4C3IG 4DR6L 1MBYA 3FKIG 2DY7A 4NDXA 5M3MB 2DY8A 1AP0A 2I5HA 1WD1A 1H9KA 1N9WA 2JE6I 5FLXE 5CV4A 1LTGD 2CHBD 5M9OA 2UU9L 1IHZA 3J7AV 4X62L 3K7AB 5K5PA 1IYJB 3VYUA 3KF8B 1F9RA 2PNRC 2JA7B 1FVIA 4XQQA 3BVZA 2ZT9C 4A3GH 3H94A 5I6WA 4JYAL 1J6QA 5M3MG 1V8QA 4GLVB 3S14H 3NE5B 4PMCA 4K6LA 5FLMG 4DR1L 2ZJRA 5M3FG 1EQRA 1STNA 4HSPA 2E74C 1L2FA 4GLAC 4RCOA 2A74C 1SFOH 1YITA 2L0CA 1HZBA 3HOVG 3T53B 2M2LA 4X64L 3HOUB 1K83H 3ONAB 3SK6A 4LFBL 4GN4B 1Y8PB 2F0FA 4ZK9B 4XYQA 4ZYSA 2MQHA 1U9RA 4OONA 3GTLB 4OIJA 1F9PA 3M4YA 3S2DH 5T1GA 2K32A 3J81i 3GTGH 3TZUA 3AFQA 4RGNA 2RBMA 4YCVA 5GAHC 4YHHL 1WCMB 2BA1A 3UDGA 2EYOA 4EX5A 2KBNA 1RKNA 1EYGA 3HOUG 1YNND 5LMNQ 1PTOD 2B29A 1HHVA 4UAIA 1W3SA 1DOMA 4ABNA 5JPMC 1TWAB 4GZYC 3M4PA 2UXDQ 1NUCA 4DNIA 2EXDA 4WJWA 2NTSA 4LFAL 4RKBA 4AYBB 1Q8IA 1WCMG 1FGUA 3DWPA 1CA5A 2NUCA 1EY0A 1S5ED 1QJOA 1HNXL 3NPPA 2ES2A 1F77A 1J8IA 1A15A 5D3IB 1GKHA 2F0UA 1Q1EA 2KEDA 4EQPA 1JE5A 4HMIA 3VR5A 3C1FA 2EJFC 3D4RA 4A3MB 1JOOA 1JMCA 4BA2I 2EVBA 4DU9A 3FKIH 5DLQE 3S1RH 3NBHA 5JJLA 1QZGA 3D3RA 2EYHA 2JA6B 2JP1A 5JJZA 1FYCA 1SAPA 2EYFA 2D62A 2KEEA 2NN6H 1TWHH 1C7YA 1S5DD 4RHRA 3M7NA 4BBSB 5FKAC 4XXEA 2JQOA 4FNFA 3W1GA 4GN3B 1AH9A 4A3DB 2VQEL 4LF7L 1PRTD 1C4QA 3DHQA 1A63A 4KMUC 4IFDG 3SE0A 2UUCQ 1MKHA 1AE3A 5LL6X 4A3MG 5C3XA 1EU4A 3ER0A 1R4QB 2ZXRA 1NCVA 2HUGA 4RHSA 1F2ZA 4JOIA 4X65L 2LY7A 1K0SA 1VQHA 4JI4L 2JA6G 1PFSA 2D2CC 2F0JA 2JN4A 5FLMH 1LTBD 2Z6KA 3OW7A 1WD0A 4BBSG 1BBUA 3ERSX 4H44C 2QW7A 1C0AA 5IY0A 2KCTA 4AQYL 3HKZB 3CPWA 3K7AH 1BO0A 1RTNA 3RLFA 4C3JB 2R93B 1MSHA 3PUZA 1TQOA 2JA7H 4A3DG 1P8LA 2F0NA 2YTVA 4PQXA 5CV7A 2GVAA 5M5WB 1ASYA 3ICEA 2JK8A 3HOYH 2EJMA 2JJQA 1VQOA 1EYCA 1SLJA 3IAYA 3CCSA 1GJXA 4A93B 5ELCA 1V43A 2B3GA 2A6HC 2L11A 1Z7TA 3KF6A 4FXKC 3DEPA 3FRPB 4GNXB 3RD4A 3OWFA 2G9DA 4C1NK 3HKZG 1PYSB 4C3JG 5J22A 1G6PA 4A3KB 3SK8A 4B3RQ 5JEAG 2DJGC 1BCPC 3EJIA 3SK5A 3CCVA 1TXYA 5M5YH 4R4CA 4JI8L 1RODA 1EWIA 4A93G 1M4VA 3GP7A 1HR0Q 4PMWA 1T5EA 1CHQD 2DN8A 3D8GA 3K5NA 1RIPA 1SNOA 4MTNA 2R3ZA 1S40A 1C48A 3BS1A 4GOPA 3TDQA 1CM9A 4OEMB 2Q2IA 3W3AA 4A3KG 2XN9C 2AQ2B 4YWKA 2GN5A 5D3DA 4DUYQ 4V190 1JOQA 1N36Q 4CJ2C 3K80C 1V1PB 2IPKD 2F3IA 4TKOB 1I4HA 3PGZA 1XXGA 1S3OA 1SRUA 4P72A 2RSNA 3RZDB 3RN2A 1KDCA 2EE1A 2BH2A 1ML0D 4P75A 1TWAH 3NELA 2F0OA 4LF6L 2IL8A 4OXPA 4C2MH 3QJYA 2D0PA 4J6HA 1XPUA 4KD3A 1Y8NB 5C4XG 2L1BA 1ILPA 3MFYA 5TSSA 1N34L 1K8OA 3J80E 1EOTA 4AYBE 2A69D 1CK1A 2MO1A 3PV0A 2J7ZA 4A3IH 1N32L 2FXQA 3OTOL 1XNRQ 2RHQB 1HFNA 2R7ZB 2KJXA 2X6LA 2IW3A 3SEBA 3EBEA 1HNZQ 3GO5A 1PYWD 3EFXD 2B2WA 4HSVA 4BBSH 4ZUJA 3H91A 3EIVA 1R4PB 4OHJA 3NENA 5ELOA 1VQ9A 4H02A 5JPNC 2R7ZG 1JWUD 2F0VA 1FJGQ 4IUPA 1DD2A 3K0XA 3VR2A 3BVMA 1L0WA 2Q2UA 3M9BA 1SE4A 3M4OB 5AJ3Q 4IJLA 3CMEA 3M3YB 4BA1I 2KCNA 1WJJA 1E2ZA 1X56A 4PZ6A 5IYDH 2R93H 4KJOA 1KNEA 4FDBA 1WFQA 1ONLA 4B9XA 1LO5D 1EIFA 1QVGA 3OW2A 1VQ5A 2P5ZX 5EPJA 1EL0A 4A93H 1K9MC 3JAML 2PCFB 2C5CA 1LM0A 1IYVA 1RTOA 2BH8A 2AQ1B 1OO9B 4IURA 4DR6Q 3VR4A 1EYDA 3LX0A 1H9SB 2PMZB 1QVCA 2UU9Q 2IHEA 4B3ML 3M85A 3F2CA 2EYJA 2IWHA 1QG7A 3LGJA 5FJ8G 2QF7A 3SR1A 2NVXB 1XJVA 1UWVA 3DM1A 2A68D 3BYTB 2L15A 1PYBA 5C4ZA 5EAYA 2BA0A 2F03A 4UDUC 4JYAQ 1YHAA 4A3EG 2TMPA 3NTKA 1Q7YC 1GM5A 2F3VA 4UP8A 4DR1Q 4ZQ3A 3CC7A 4PV1C 5A35A 1VDZA 4LF8L 4OELB 3ND9A 3K57A 2HIVA 3RZDH 3E9IA 2G9HD 3S1QH 4BXXG 4IFDI 2QCPX 5BN5A 2Z6BA 3T51B 4X64Q 4LFBQ 1SN8A 2EYLA 1FR3A 4BBRB 1IBMQ 4K5XA 3ULJA 4IUVA 4QUCA 3NP8A 1QNKA 3AMUA 4X66L 4XT1B 1EFWA 3MEFA 1HA6A 4QCLA 1LT3D 1M90C 1IL2A 5IP9G 3S1MB 4ALPA 5E4XA 3F8TA 1Y1WB 4YHHQ 2K5DA 4APVA 3T1YQ 5JVH3 1VQIA 1Y1VH 3I4MB 4AH6A 2IJ0A 3HEJA 2ZTCA 4DK6C 1NNXA 2IX1A 1I4PA 4WFN3 4BBRG 3CAMA 3K58A 5CV6A 1NY4A 4MTKA 3HOZB 3BJUA 3V05A 2B2UA 1D1IA 2E2HB 3CF5A 4RA8A 1II3A 1Q46A 4LFAQ 2R92B 1U4LA 1GXDC 4ZUIA 4A3FG 2WKDA 3P1HA 1Y1WG 4NXNL 2RKSA 1CTMA 1PLFA 1HNXQ 1UAPA 2UXCL 3BDOA 2EY2A 1SE3A 3GTPH 3HP3A 3CHBD 1U5KA 1UE6A 2N78A 3HOZG 2L4NA 1VQJA 2QDBA 1PRTB 2RA4A 1O7ZA 1YNXA 1SJED 2R92G 2CCZA 2WINB 1FL0A 5IGGA 1LTTD 3TREA 3FHWA 2Q8RE 4U68A 5JOBA 1PDQA 1OXUA 3KLWA 4GLXA 1TS2A 4IUQA 1BCPD 3T56B 4XQJA 4O2DA 2N55A 1EWHA 3C3LA 4LF7Q
chains in the Genus database with same CATH topology
2XWBB 3H6MA 2A5HA 3X3NA 4M8AA 3URYA 5J39A 2LFNA 4KJNA 1G6ZA 2PZWA 2WKCA 3FMCA 1SMYD 4KN7C 1SYGA 1Q90A 4ZRZA 2VXWA 1SEBD 3KBXA 4C56C 3TMEA 1MSGA 1G2SA 3MTSA 2M00A 2Z8LA 5C6AA 5DM73 1SBBB 5I2YA 5FO8B 2CQAA 2SOBA 3NWTA 1GUTA 2DNEA 5EKLA 1GUOA 2BOSA 1D5ZC 2E76C 1HFGA 1S4ZA 2K04A 1VF5C 2SNSA 2Z4HA 1SYBA 1G8ZD 3OOCA 1F9QA 5DNFA 4KHZA 2ICEC 2PQEA 3A7LA 5C0XJ 2B2YA 4M1UB 2JA5B 4L8JA 2CVRA 1SNMA 2Y0SB 2PZTA 1RHPA 2KQ3A 2Z4IA 3L9AX 1LT4D 4F7XA 1S5FD 1PFNA 1JB3A 5KNBA 5C3EB 2K03A 3GTJB 4IQZA 2FFKB 4C3IB 1G2TA 2B8GA 3ND8A 4BWGB 5DM63 1CT1D 1B9MA 4HR7B 2KECA 3A8KE 3JAME 3KK7A 2OT2A 4MHEA 2PPBC 3GTOB 1FNVA 4OIKA 5EQ0A 4K6DA 4Y7NB 2YYZA 1SSOA 3QB3A 5IIFA 2HDLA 2KOLA 3W2DA 5CV5A 2TSSA 5FO7B 2O2LD 1HUNA 3GTKB 1RD9D 1JE4A 1EIGA 3KUPA 3MXUA 2NVQB 3OHXC 3A54A 5KRUA 4FF3A 5M3FB 3QO2A 2NBFA 1FNWA 2BE5D 1WTVA 1NR2A 3DXJC 3HOVB 5I4DA 2EY5A 1AN8A 4QMGA 5LHY1 1LTSD 1B53A 3NTHA 3P20A 4WRDA 1GOZA 2MPMA 4KK7A 1PFBA 3S16B 2NVYB 2MHVA 5C4JB 1PFMA 2FHTA 2R61A 1YNJC 5IT9E 1BNZA 2F3WA 4EQOA 1QOHA 3NTIA 3KLRA 4BY1B 5DEHA 1AZQA 4X3UA 1CA6A 2AWOA 1STBA 4P2CB 3F2UA 1UUPA 1TWGB 4QIWB 4MIUA 3QWNA 1SE2A 5C5LA 2ENBA 1CZWA 1CQFA 1TS5A 2K6AA 3IKJA 1A2UA 2PW5A 3L3OC 3R3OA 4DAPA 1JWSD 3A56A 2JEBI 3A55A 1QE6A 5I6YA 5IGBA 3FEWX 2J0TD 4RAUC 2F0TA 3MVVA 2H4OA 1F9SA 4K2LA 3J7AF 4O42A 1DXMA 5E4WC 1AEXA 5C5MA 2X6GA 3VYSA 1B1ZA 1D2BA 1QB5D 4X3KA 2IT1A 3AB9A 3I4LA 4Q0FA 2RDHA 4RFBA 2KUMA 1A3UA 4G7OC 1TR5A 3J81L 1IW7D 3I72A 5KGUA 3ITPA 2VNUD 2VB3X 4OO1G 5IOCA 2WP8J 4HCEA 3FDTA 3D4DA 2NTTA 3D4WA 4X3TA 1BF4A 5EBCA 1ESRA 3TBIB 2KCCA 2F0LA 4CJ1B 1D1KA 3A8JE 5CV8A 4DN4M 4DXGA 1W6JA 1SYEA 3GQBA 2PYKA 3S17B 2AUJD 1X32A 1UNSA 5EPLA 3X3MA 2YU9B 4KKUA 3S1NB 5A2QL 3QIAA 2JXMB 1ET6A 3VYTA 5C4XB 1I4QA 1EY9A 2AUKA 1HTLD 2F0IA 1STHA 5EPKA 4TSSA 4FF2A 1STYA 4N9TA 1EYAA 3OIPA 3BDLA 4ULLA 1ESFA 2QILA 1BDOA 3PUVA 4DNRB 4DGZA 1HQMC 1KLGD 5K36G 2EY6A 4F88A 1EZ8A 1TWCB 1XYIA 1XX8A 3FPPA 2E2DC 1LV9A 1A3VA 1NSNS 4IFDH 1SYCA 1CHPD 5IODA 3R2TA 1PRTF 5EKKA 2ZXOA 3RZOB 4DFAA 4KY7A 3H09A 2WAQB 3TP7A 2D9UA 1HA5A 1B3AA 2F0QA 1GHKA 2R6GA 2B63B 2KHSA 2B2TC 1I4GA 1JR0D 4HMJA 1GUGA 1PMRA 1OXVA 1OXXK 3WDNA 3P7JA 1EZ6A 5G3LD 1IKLA 1TWFB 3PMFA 1HRJA 5IGCA 1YNJD 4C3HB 5JEAH 4CHTB 1CFMA 3BVGA 2BDNA 3T4AC 3NSWA 2A73B 1RJTA 4DNTB 4A3EB 1EY6A 4JK1C 4C3HG 3MXNA 1MGSA 2CW0C 4FVMA 4XYOA 2AWNA 4ZKBB 2EYPA 3H0GB 4DAYA 4KD4A 2SDFA 2BCOA 2RDFA 3SVMA 4K8IA 3SK4A 3Q24A 1JCKB 4RCNA 1AW7A 2MJ8A 4PMBA 2XNAC 1EY8A 1ZEQX 3I90A 5IGFA 3J7YW 1SJHD 1ENAA 2L12A 4KKTA 4K2KA 4J8QA 2PW7A 1D5XC 1PTOB 2EJGC 2VUMB 4BY7B 1SXTA 4DXFA 2B2WC 3Q22A 4RKLA 1JQYD 3J81E 2B2VC 1CQVA 4OO1I 3DUZA 3VA7A 5COYA 4A3FB 4KN4C 4Q5VA 3QG1A 4KKSA 4FF1A 4ILWA 3GD7A 1X3QA 1HQRD 1Q12A 5C44B 1B2TA 3G7LA 2OF1A 4EGVA 1A3TA 1Q3LA 1WTXA 1YNNC 2RVLA 2K05A 3MA2B 3EROA 5F2DA 2ID0A 3ZYYX 5M5XB 2JA8B 1I4RA 2EY1A 3NUCA 4K14A 4IFDJ 2Q8IB 2L9HA 2VB2X 2K5WA 3TP5A 2RQXA 3R93A 2A6HD 1STGA 3NQTA 4LK1C 1I50B 4G7HC 5A2QE 5E3FA 4TQUS 3VR3A 4DK0A 4NW2A 4NKLA 1D5MC 1L0XB 3OMCA 1RDPD 3EVQA 2EDGA 1KTKA 1JICA 5T1IA 4EQNA 3OPOA 1DOLA 3NXWA 3Q0AA 2QEJC 1LTID 1PRTC 1IL8A 3U9OA 4IUTA 3MAQA 1C8CA 1WTOA 5JEAJ 2OEOA 4FP5D 1A6XA 3AU7A 3S14B 1ILQA 4IZ8A 4FF4A 3PUWA 3LWUA 1HUMA 1EFID 3EA6A 1SFOB 1S5CD 4S3SA 3K5OA 4BS9A 1JC7A 1BXTA 1M8AA 1GUNA 4QUFA 1OXTA 5EGTA 2B39A 1Y8OB 2K7VA 5KIXA 4ID6A 2KA7A 5IGEA 1TS4A 2ICIA 1STAA 5ELDA 3G6JB 4H0LC 2B2UC 3LNNA 1LLRD 1EY4A 3Q6SA 2SNMA 2HDMA 2L5TA 3IFDA 2K28A 1MI2A 5CGKA 5EJWA 1RF2D 1U4RA 2NB0A 2IX3A 2F0WA 1EWCA 3KF8A 1E2WA 4FXGC 2JYOA 1KDAA 2EOTA 1Z47A 2MP1A 3SDZA 3M7GA 3P75A 5ISRA 2F0MA 1SNCA 3D6WA 1LABA 3K6OA 3WOFA 1H9JA 2L55A 2AQ3B 3N52A 1TY2A 4RGOS 1BCPF 3I3CA 3S1RB 3OIQA 1CZGA 4HTHA 1AFPA 1K8MA 3GTMB 1VF7A 1TWHB 4EVOA 3GTQB 2QKIC 1BQQT 1B4OA 4K5WA 1XWEA 2CW0D 1O7LA 3R2IA 1PXUA 1QNUA 4IUUA 4CKEA 1GHJA 3T16A 2NN6G 4LAAA 4O1NA 1KABA 4CGYB 3MC0B 3QOLA 3HGBA 3N6RA 1DJRD 3HOYB 4R9WA 1B44D 4HAEA 1T5XD 1LT5D 2MUYA 1QCBD 4I7ZC 2O4XA 5CYUA 1V1OA 1VMCA 2B2YC 1STEA 2LS01 3DWAA 2O5IC 4KY6A 3V96A 5M5YB 3A8IE 1I6HB 2NYZD 3K5MA 1IKMA 2K33A 1LTRD 1W6KA 3E6ZX 5KEEA 3Q23A 1H9MA 2C9OA 1GUSA 3BZDB 2LKVA 4F87A 4G57A 1SNPA 1LTAD 2A68C 4C2MB 2F1MA 3SXHA 5ELFA 5J1ZA 4CBVA 1O80A 2XVSA 2NWGA 3GV6A 1X3PA 1U4MA 1NR4A 4L63B 5EKIA 4A3IB 5EBDA 2O5JC 1O7YA 4K5VA 3RMHA 3RUZA 5BN4A 1DONA 4CKBA 1TY0A 1Z6HA 1U4PA 4FXDA 3I8ZA 3CU7A 1ICWA 3S9WA 1FNUA 5CMDA 5ELEA 1E0BA 4R8NA 1A2TA 5FO9B 3TN2A 4RWSC 1EQVA 3T13A 1JOKA 2XRSD 1E2VA 2X69A 4LJZC 1V1PA 1QILA 3HS0C 5CORA 1PZID 1FGBD 1D6EC 4ZLTF 1I3QB 1BCPB 2JSOA 3CQZB 4PNYA 1ENCA 4WORA 2N88A 3OMGA 1JWMD 4LMQD 2FMMA 3K0YA 3V2TA 1EIHA 1EU3A 2B2TA 1TIID 1PTOF 4H7BA 3I91A 1DOKA 3H3VC 3LWEA 2I46A 2F0GA 4YIJA 2A6EC 4NMZA 4IUNA 1QWYA 3IL8A 3O13A 4DF7A 4RGTA 3MEHA 2FJ2A 3HOWB 3HRZC 1ZYRC 2XRQD 3U9SA 5CR3A 2HCIA 1SMYC 3S1QB 1WTRA 5I9OA 2XIWA 1G291 3CKIB 5D14A 3VYRA 1FD7D 4XT3B 5DAUA 5C0XG 4TRDA 4MN3A 4V0BA 3I70A 2NN6I 1ET9A 4IN3A 2I07B 1EEFD 4HCSA 1J9OA 3NBIA 5KNCA 4OO1H 1Y1VB 1F2MA 1TU2B 1H9SA 1SYFA 4A3JB 3E5SA 1VMPA 4G7ZC 2F0DA 3QOJA 3DMUA 4ZAIA 1SNQA 5C4HA 1KDBA 3PUXA 4XTCS 1BUVT 1WTWA 4JBWA 5CC4A 3HOXB 3K5LA 2XSCA 3GV3A 2B2VA 4G4KA 3PO2B 4ODGA 5JVG3 2WACA 5E1FA 1LACA 4KTAA 4L6TB 3GTPB 4OGQC 5CBEE 1KAAA 2SEBD 1F2YA 4R8IA 3OSOA 1WVLA 3I73A 1MD2D 3L7ZC 5KYIA 1F2LA 2F0HA 1B9NA 1EQTA 2EXZA 5ELBA 2K5QA 2ZXPA 4QB4A 4B08A 1PZJD 4HEDA 2PZUA 3DEOA 3D6CA 2F4IA 3PIP3 5BN3A 1G91A 4OL7A 1SDFA 3FVQA 1ZXTA 4I65A 5CV9A 3MZ5A 1ENFA 5KNDA 2BE5C 5K36H 2FMCA 2WV6D 5FLXL 2EZVA 2J4XA 2E2JB 2PO4A 3UI2A 4A3BB 3C1EA 2NVTB 1TS3A 2DNCA 4J1MA 3MXGA 3TZDA 5C0XH 1WTQA 4FYDA 1HXYD 1HPCA 3EQLC 3ERQA 4FO2A 3CRKC 1ZKOA 4U673 1SNDA 4IALA 3IFTA 2MGSA 3NK9A 4K8JA 1TT2A 4KI0A 3C2PA 1SYDA 5CBAE 3PO3B 2IX0A 1UEAB 5IT9L 1EEID 3PUYA 3CRLC 1VCIA 3R8BA 2WIIB 3D31A 3PIO3 3NWSA 1PTOC 4KY5A 1PZKD 4DA2A 1Q1BA 1TVXA 3OWEB 4RH6A 2E2IB 2RDGA 4RGMA 4ME5A 3SHLA 5G3LF 1O78A 4HN7A 2NZ1D 2F0SA 4KV6A 3VA5A 4NP5A 3HG9A 2WB1B 1CI3M 3MWYW 2V4DA 3KLSA 1RCVD 3TP6A 5FK9C 2F0EA 3TP8A 2BDOA 1BOSA 4B9WA 5HURA 4Z9CB 4C1NI 4XDXA 3S15B 1Y69U 1DCZA 5LL6S 4A3GB 2A6ED 1BBXC 4E6IA 1IW7C 3MFGA 3NQIA 3S2HB 2Q8TA 2F0KA 3FPUB 5C3WA 2B8FA 5C0XI 2KVMA 4XIGS 3KLSX 1ZYRD 1EY7A 4ZKCB 1KLUD 5I9PA 1NAPA 3MXPA 1K83B 3A7AB 5I2XA 5KYLA 3MHBA 1GUWA 1I6VC 3WOEA 5JAVA 3S2DB 3BYYB 1DZ1A 1PTOH 3GTGB 2Z1CA 1TKWB 3TSSA 1DM0B 1I4XA 4XQNA 3HZXA 3E0JA 2K1BA 1XTCD 2E75C 5D65A 5HGTA 1BR9A 1S5BD 2JEAI 1DYQA 2GA4B 2XWJB 1B50A 2K01A 4H13C 1KNAA 1AZPA 5FOBB 3KBGA 3K59A 2LMCB 2H1EA 1R9TB 3DWQA 3NHHA 2F0PA 3C46A 3I4NB 5AFWA 5IGDA 2FINB 1WTPA 2HCCA 4DK1A 1H9RA 2RSOA 3BDCA 4DAVA 1JORA 1HTPA 2EYMA 4QF4A 3FKIB 1LT6D 1L0YB 4CKCA 2A69C 5NUCA 4F8MA 2D5DA 2M9VA 3BG3A 4KHVA 3VR6A 2OXPA 4N9PA 1EY5A 4X3SA 1OXSC 3J80L 1IYUA 4CJ0B 2EPBA 2HQEA 1HCZA 4C3IG 1MBYA 2DY7A 4NDXA 5M3MB 2DY8A 1AP0A 1WD1A 1H9KA 2JE6I 5FLXE 5CV4A 1LTGD 2CHBD 5M9OA 1IHZA 3J7AV 3K7AB 5K5PA 3VYUA 1F9RA 2PNRC 2JA7B 4XQQA 3BVZA 2ZT9C 3H94A 5I6WA 1V8QA 3NE5B 4PMCA 4K6LA 1STNA 4HSPA 2E74C 4RCOA 2A74C 2L0CA 3T53B 2M2LA 3HOUB 3ONAB 3SK6A 1Y8PB 2F0FA 4ZK9B 4XYQA 4ZYSA 1U9RA 3GTLB 4OIJA 1F9PA 3M4YA 5T1GA 2K32A 3TZUA 4RGNA 2RBMA 1WCMB 2BA1A 2EYOA 1RKNA 1YNND 1PTOD 1HHVA 4UAIA 1DOMA 4ABNA 5JPMC 1TWAB 4GZYC 1NUCA 4WJWA 2NTSA 4RKBA 4AYBB 1Q8IA 3DWPA 1CA5A 2NUCA 1EY0A 1S5ED 1QJOA 3NPPA 1F77A 1J8IA 1A15A 5D3IB 2F0UA 1Q1EA 2KEDA 4EQPA 4HMIA 3VR5A 3C1FA 2EJFC 3D4RA 4A3MB 1JOOA 4BA2I 2EVBA 4DU9A 3NBHA 3D3RA 2EYHA 2JA6B 2JP1A 5JJZA 1FYCA 1SAPA 2EYFA 2D62A 2KEEA 2NN6H 1S5DD 4RHRA 3M7NA 4BBSB 5FKAC 4XXEA 4FNFA 4A3DB 1PRTD 1C4QA 3DHQA 4KMUC 4IFDG 3SE0A 5LL6X 5C3XA 1EU4A 1R4QB 2ZXRA 1NCVA 2HUGA 4RHSA 1F2ZA 2LY7A 2D2CC 2F0JA 1LTBD 3OW7A 1WD0A 4H44C 3HKZB 1BO0A 1RTNA 3RLFA 4C3JB 2R93B 1MSHA 3PUZA 1TQOA 2F0NA 4PQXA 5CV7A 5M5WB 2EJMA 1EYCA 3IAYA 1GJXA 4A93B 5ELCA 1V43A 2A6HC 2L11A 1Z7TA 4FXKC 3DEPA 3FRPB 3RD4A 3OWFA 2G9DA 4C1NK 4C3JG 5J22A 4A3KB 3SK8A 5JEAG 1BCPC 3EJIA 3SK5A 1RODA 1M4VA 3GP7A 4PMWA 1T5EA 1CHQD 2DN8A 3D8GA 3K5NA 1SNOA 2R3ZA 1C48A 3BS1A 3TDQA 1CM9A 3W3AA 2XN9C 2AQ2B 5D3DA 4V190 1JOQA 4CJ2C 1V1PB 2IPKD 4TKOB 1I4HA 1XXGA 2RSNA 3RZDB 1KDCA 2EE1A 1ML0D 2F0OA 2IL8A 3QJYA 4J6HA 4KD3A 1Y8NB 2L1BA 1ILPA 3MFYA 5TSSA 1K8OA 3J80E 1EOTA 2A69D 1CK1A 3PV0A 2J7ZA 1HFNA 2R7ZB 2KJXA 2X6LA 2IW3A 3SEBA 3GO5A 1PYWD 3EFXD 2B2WA 4HSVA 4ZUJA 3H91A 1R4PB 4OHJA 5JPNC 1JWUD 2F0VA 4IUPA 1DD2A 3VR2A 3BVMA 1SE4A 3M4OB 3M3YB 4BA1I 2KCNA 1E2ZA 4KJOA 1KNEA 1ONLA 4B9XA 1LO5D 5EPJA 1EL0A 3JAML 2PCFB 2C5CA 1IYVA 1RTOA 2AQ1B 1OO9B 4IURA 3VR4A 1EYDA 3LX0A 1H9SB 2PMZB 3M85A 2EYJA 2IWHA 1QG7A 2QF7A 3SR1A 2NVXB 3DM1A 2A68D 3BYTB 5C4ZA 2BA0A 2F03A 4UDUC 2TMPA 3NTKA 2F3VA 4ZQ3A 4PV1C 5A35A 1VDZA 3ND9A 3K57A 2G9HD 4IFDI 2QCPX 5BN5A 3T51B 2EYLA 1FR3A 4BBRB 4K5XA 4IUVA 4QUCA 3NP8A 1QNKA 3AMUA 4XT1B 1HA6A 4QCLA 1LT3D 3S1MB 5E4XA 1Y1WB 2K5DA 5JVH3 3I4MB 2IJ0A 3HEJA 2IX1A 1I4PA 4WFN3 3K58A 5CV6A 3HOZB 3V05A 2B2UA 1D1IA 2E2HB 4RA8A 1II3A 2R92B 1U4LA 1GXDC 4ZUIA 2WKDA 3P1HA 2RKSA 1CTMA 1PLFA 1UAPA 3BDOA 2EY2A 1SE3A 3HP3A 3CHBD 2L4NA 2QDBA 1PRTB 2RA4A 1O7ZA 1SJED 2WINB 5IGGA 1LTTD 2Q8RE 4U68A 5JOBA 1PDQA 1OXUA 1TS2A 4IUQA 1BCPD 3T56B 4XQJA 2N55A 1EWHA 3C3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIK A;  1WTW A;  5EJW A;  1U4R A;  1EOT A;  2L9H A;  1GUW A;  1RJT A;  5EQ0 A;  2NYZ D;  3R93 A;  2N88 A;  3GV3 A;  1IKM A;  2B2V A;  2J7Z A;  5EPK A;  1QE6 A;  1SSO A;  1DZ1 A;  2HDL A;  2JYO A;  2KOL A;  4LMQ D;  2FMM A;  1HUN A;  2EOT A;  1HFN A;  1NCV A;  1MGS A;  2HUG A;  2MP1 A;  1JE4 A;  1EIG A;  3KUP A;  4RAU C;  1EIH A;  2B2T A;  1F9S A;  4ZKB B;  1TVX A;  2X6L A;  1G6Z A;  1WD0 A;  2K1B A;  3QO2 A;  4O42 A;  4NW2 A;  5CBE E;  5E4W C;  2X6G A;  4R8I A;  3I91 A;  5D65 A;  1WVL A;  1DOK A;  3LWE A;  3D6W A;  1WTV A;  1NR2 A;  1BO0 A;  4X3K A;  1RTN A;  1F2L A;  2B2W A;  1MSH A;  2M2L A;  4IUV A;  4HSV A;  4QUC A;  3ONA B;  1QNK A;  2SDF A;  3H91 A;  4ZK9 B;  1JIC A;  5T1I A;  1B50 A;  2VXW A;  1EQT A;  2K01 A;  3N52 A;  1KNA A;  1AZP A;  3KBX A;  3SVM A;  2KUM A;  1B53 A;  4XT1 B;  1DOL A;  1HA6 A;  3I3C A;  1MSG A;  1G2S A;  3MTS A;  1XYI A;  1XX8 A;  4OIJ A;  1F9P A;  2MJ8 A;  5E4X A;  2H1E A;  1LV9 A;  3IL8 A;  2NZ1 D;  5T1G A;  1ILP A;  2MPM A;  4IUP A;  4HED A;  1PFB A;  1IL8 A;  1O80 A;  4IUT A;  3I90 A;  2NWG A;  3GV6 A;  1X3P A;  2L11 A;  3DEO A;  1PFM A;  1U4M A;  2L12 A;  1NR4 A;  1C8C A;  3DEP A;  2FJ2 A;  1B4O A;  1G91 A;  2FHT A;  3MWY W;  1WTO A;  5AFW A;  1SDF A;  5EKI A;  1ZXT A;  2FIN B;  1WTP A;  1ILQ A;  2HCC A;  4UAI A;  1BNZ A;  1DOM A;  1HHV A;  1O7Y A;  2RSO A;  1HFG A;  1S4Z A;  2B2U A;  2B2W C;  2K04 A;  3FDT A;  1KNE A;  2HCI A;  4RA8 A;  1ROD A;  2D9U A;  1F9Q A;  1HUM A;  4IUU A;  5DNF A;  1DON A;  1U4L A;  4X3T A;  1BF4 A;  1B3A A;  2B2V C;  1WTR A;  1AZQ A;  2XIW A;  1U4P A;  4X3U A;  5COY A;  1CA6 A;  3I8Z A;  1PLF A;  1ESR A;  2B2Y A;  5EPJ A;  1CA5 A;  4XDX A;  5D14 A;  2R3Z A;  1EL0 A;  1ICW A;  1X3Q A;  3F2U A;  2B2T C;  2CVR A;  1M8A A;  5CMD A;  4XT3 B;  3UI2 A;  4QUF A;  1BBX C;  1CM9 A;  3HP3 A;  1J8I A;  1RTO A;  1A15 A;  1E0B A;  4MN3 A;  1RHP A;  3G7L A;  1B2T A;  4CJ1 B;  4X3S A;  2L4N A;  4CJ0 B;  4R9W A;  2KED A;  4DN4 M;  4CJ2 C;  4HCS A;  2RA4 A;  1J9O A;  1O7Z A;  1PFN A;  2EPB A;  4IUR A;  3TN2 A;  3TZD A;  1WTQ A;  4RWS C;  1Q3L A;  2Q8T A;  2K03 A;  3P7J A;  4HAE A;  3FPU B;  2B2U C;  1X32 A;  2DY7 A;  1AP0 A;  1IKL A;  2DY8 A;  2FFK B;  2KVM A;  2RSN A;  2RVL A;  2EE1 A;  2X69 A;  5EPL A;  1ML0 D;  1WTX A;  3Q6S A;  5COR A;  1WD1 A;  2K05 A;  1G2T A;  1HRJ A;  2Q8R E;  2HDM A;  4U68 A;  3IFD A;  1PDQ A;  1QG7 A;  2MGS A;  4ZKC B;  2IL8 A;  2BDN A;  1VMP A;  4ZLT F;  2KEC A;  4IUQ A;  1VMC A;  2JP1 A;  5JJZ A;  2N55 A;  2B2Y C;  1SAP A;  1NAP A;  5CBA E;  4MHE A;  2KEE A;  4ZAI A;  3DM1 A;  1F9R A;  2K28 A;  2L1B A;  1MI2 A; 
#chains in the Genus database with same CATH topology
 2XWB B;  2K52 A;  4IPD A;  4L5S A;  2E8G A;  3H6M A;  3KJO A;  2A5H A;  3X3N A;  4M8A A;  4X65 Q;  4DUY L;  3URY A;  4JI4 Q;  5J39 A;  4QJF A;  3KOJ A;  2I5M X;  2RCF A;  2LFN A;  2VY3 A;  4KJN A;  2PMZ E;  1G6Z A;  4AQY Q;  2PZW A;  2WKC A;  1J5E L;  1CKN B;  3FMC A;  1SMY D;  4KN7 C;  1SYG A;  1Q90 A;  2E2J H;  4ZRZ A;  4JI5 Q;  2D0O A;  2VXW A;  1SEB D;  1YEZ A;  3KBX A;  4C56 C;  1GO3 E;  3TME A;  1KIX A;  1MSG A;  1G2S A;  3MTS A;  5H1S E;  4DR2 L;  2GVB A;  2M00 A;  1A8V A;  2Z8L A;  5C6A A;  5DM7 3;  5IP9 H;  1SBB B;  5I2Y A;  3UDX A;  5GRO A;  5FO8 B;  2CQA A;  2SOB A;  2V1C C;  3EN2 A;  3NWT A;  1GUT A;  2DNE A;  5EKL A;  1GUO A;  2BOS A;  1D5Z C;  4JI8 Q;  1HNZ L;  2E76 C;  1Q82 C;  1HFG A;  1S4Z A;  2K04 A;  1VF5 C;  2SNS A;  2Z4H A;  1SYB A;  1G8Z D;  1NJI C;  4IO9 A;  3OOC A;  1PH6 A;  1F9Q A;  3CCQ A;  3PQI A;  5DNF A;  4KHZ A;  3G6E A;  3U4Z A;  2UUA L;  1SE8 A;  2ICE C;  2PQE A;  3A7L A;  1HH2 P;  5C0X J;  4GKJ Q;  2B2Y A;  4M1U B;  2JA5 B;  4L8J A;  4DPG A;  2CVR A;  3I4M H;  3CP0 A;  3TS2 A;  2K50 A;  1SNM A;  4DKA C;  1KRS A;  1NBW A;  2PZT A;  1RHP A;  2KQ3 A;  2Y0S B;  2Z4I A;  1LT4 D;  3L9A X;  4F7X A;  3QR8 A;  1S5F D;  1PFN A;  1JB3 A;  1SR3 A;  5KNB A;  5IE8 A;  5C3E B;  2K03 A;  3GTJ B;  4A76 A;  4IQZ A;  2EQS A;  2FFK B;  4LF6 Q;  1WOC A;  4OWT B;  2E2H H;  4C3I B;  3BZC A;  1G2T A;  2B8G A;  3ND8 A;  4BWG B;  1YIJ A;  5DM6 3;  1CT1 D;  2JA5 G;  1B9M A;  4HR7 B;  2KEC A;  3A8K E;  3JAM E;  3KK7 A;  4R4Q A;  2OT2 A;  4MHE A;  2Y0S G;  2PPB C;  3GTO B;  1FNV A;  4OIK A;  5EQ0 A;  4K6D A;  4Y7N B;  4A3C G;  2YYZ A;  3OTO Q;  3CCJ A;  2OTL A;  1SSO A;  3QB3 A;  5IIF A;  2HDL A;  2KOL A;  2WB1 E;  3W2D A;  5CV5 A;  2QGQ A;  2TSS A;  5FO7 B;  1S72 A;  2O2L D;  1HUN A;  4LF5 L;  3BZK A;  3GTK B;  1RD9 D;  1JE4 A;  1EIG A;  3KUP A;  3MXU A;  2NVQ B;  1LUZ A;  3OHX C;  3A54 A;  5KRU A;  4FF3 A;  5M3F B;  3KDF B;  3QO2 A;  1IXR A;  2MNA A;  2NBF A;  1FNW A;  2DJF C;  4MNO A;  3JAM c;  2BE5 D;  1WTV A;  1NR2 A;  3S15 H;  3DXJ C;  1K0R A;  3HOV B;  1BBW A;  5I4D A;  3UE1 A;  1L1O B;  4LF4 L;  3ULL A;  2EY5 A;  1AN8 A;  4QMG A;  5LHY 1;  1LTS D;  1B53 A;  3S2H H;  3NTH A;  5GQO A;  2N8N A;  4DR5 L;  3P20 A;  4WRD A;  1GOZ A;  2LXJ A;  2MPM A;  4KK7 A;  1PFB A;  3S16 B;  2NVY B;  2MHV A;  5C4J B;  1K73 C;  1PFM A;  5FLX c;  1X54 A;  2FHT A;  2R61 A;  4DV2 L;  1YNJ C;  3U50 C;  5IT9 E;  4A3L G;  1KC8 C;  1BNZ A;  1KHI A;  2H5X A;  2F3W A;  4EQO A;  4DV4 L;  1IBM L;  1QOH A;  3NTI A;  3KLR A;  4NPS A;  4BY1 B;  5DEH A;  1AZQ A;  4R1J A;  1L1O C;  4X3U A;  1CA6 A;  2AWO A;  1STB A;  4P2C B;  3F2U A;  1UUP A;  1TWG B;  3T1Y L;  3HFZ B;  4QIW B;  4MIU A;  4A75 A;  1YJN A;  3K81 C;  1XNQ L;  1E22 A;  3W5O A;  3QWN A;  2RF4 A;  4UY8 C;  1SE2 A;  5IT9 c;  4DUZ L;  5C5L A;  2CH4 W;  2ENB A;  3J81 j;  4B3M Q;  4BY1 G;  1EIY B;  1CZW A;  3KYH C;  3U4V A;  1CQF A;  1TS5 A;  2K6A A;  3IKJ A;  1A2U A;  1K8G A;  1VQM A;  2PW5 A;  3L3O C;  3R3O A;  4DAP A;  1MJE A;  1R9T H;  1JWS D;  2JA5 H;  3CCM A;  3A56 A;  2JEB I;  3CCE A;  3D0F A;  3I4N H;  4LF8 Q;  4WJ4 A;  3A55 A;  4B3T Q;  1QE6 A;  5I6Y A;  5IGB A;  1JJC B;  3FEW X;  1PHJ A;  5C3E H;  1K3B C;  2J0T D;  4RAU C;  3GTJ H;  2ZJQ A;  2F0T A;  3MVV A;  4IPG A;  2H4O A;  1F9S A;  4K2L A;  4C3I H;  2Q2T A;  3J7A F;  3G48 A;  4O42 A;  3I2Z A;  1DXM A;  5E4W C;  1AEX A;  4PZ8 A;  2X6G A;  5C5M A;  3RLO A;  3VYS A;  1B1Z A;  1D2B A;  1QB5 D;  4X3K A;  2IT1 A;  3ULP A;  3AB9 A;  4X66 Q;  3STB D;  1E1O A;  1PH8 A;  3GTO H;  1VQG A;  3I4L A;  2K5N A;  4Q0F A;  2RDH A;  4RFB A;  5HY6 A;  2KUM A;  1A3U A;  4G7O C;  3TQY A;  2ZJP A;  1TR5 A;  3J81 L;  1IW7 D;  3I72 A;  1VQB A;  5M3M H;  3GTK H;  5E7N A;  5KGU A;  3ITP A;  2NVQ H;  4JCV E;  2CQO A;  4QL5 A;  1B3Q A;  2VNU D;  2KCM A;  2VB3 X;  5M3F H;  4OO1 G;  5IOC A;  2WP8 J;  4HCE A;  4HIM A;  1IBK Q;  3FDT A;  3D4D A;  4NXN Q;  3HOV H;  4A3L H;  2NTT A;  3D4W A;  3M4Q A;  4IPC A;  4JI5 L;  4DK3 C;  3OYY A;  4X3T A;  3G4S A;  1BF4 A;  5EBC A;  2UXC Q;  4DV7 L;  1ESR A;  3TBI B;  4DV0 L;  1Q81 C;  4LUO A;  3S16 H;  5C4J H;  1KD1 C;  2KCC A;  2F0L A;  4CJ1 B;  1D1K A;  3A8J E;  5CV8 A;  4DN4 M;  4DXG A;  1WYD A;  1W6J A;  1SYE A;  1JJ2 A;  3GQB A;  2PYK A;  3S17 B;  3HOU H;  2AUJ D;  1X32 A;  3NBH B;  1UNS A;  1Z9F A;  5EPL A;  3X3M A;  4P71 A;  3FP9 A;  1K8A C;  2PQA A;  2YU9 B;  3GTL H;  4KKU A;  3S1N B;  1E3P A;  5A2Q L;  4BY1 H;  3QIA A;  2JXM B;  3T1H L;  1ET6 A;  3VYT A;  4GKJ L;  1Q86 C;  1I5F A;  5C4X B;  1WCM H;  1I4Q A;  1EY9 A;  1TWG H;  2AUK A;  1HTL D;  2F0I A;  1STH A;  4GNX C;  5EPK A;  4TSS A;  4FF2 A;  1STY A;  4N9T A;  1EYA A;  4JV5 L;  2PI2 E;  5LMN W;  2IHF A;  3OIP A;  4ME3 A;  2OTJ A;  3BDL A;  4ZCK A;  1J5E Q;  4PG3 A;  1PV4 A;  3I56 A;  4ULL A;  1ESF A;  1HZA A;  2CH4 A;  2AHO B;  2QIL A;  1BDO A;  1VQP A;  3PUV A;  4DNR B;  4JPB W;  5IYC G;  4DGZ A;  1HQM C;  1KLG D;  3GDE A;  5K36 G;  2EY6 A;  4F88 A;  1EZ8 A;  1N33 L;  4DR2 Q;  1TWC B;  1UE5 A;  1QVF A;  1XYI A;  1XX8 A;  3FPP A;  2E2D C;  1CKM A;  1LV9 A;  3KF6 B;  4IJH A;  1A3V A;  2I0Q A;  4LF9 Q;  4JW0 A;  1NSN S;  3A5Z B;  4IFD H;  1SYC A;  4A3M H;  1CHP D;  5IOD A;  3R2T A;  1PRT F;  4NB3 A;  1X3G A;  4OX9 Q;  2JA6 H;  5EKK A;  2ZXO A;  3CCR A;  3RZO B;  4DFA A;  2VQF L;  2VZA A;  4KY7 A;  2UUA Q;  3H09 A;  2WAQ B;  3J80 c;  3TP7 A;  2D9U A;  5LMU L;  4A3D H;  4LUV A;  1HA5 A;  1B3A A;  2F0Q A;  1HJP A;  1GHK A;  4GOP B;  1CSQ A;  2R6G A;  2B63 B;  2KHS A;  2B2T C;  1I4G A;  5IYB G;  1W2B A;  1JR0 D;  4HMJ A;  2NZO A;  1NE3 A;  4N8X 1;  1CUK A;  3CCU A;  1GUG A;  1PMR A;  1WTH A;  2WAQ G;  1LTL A;  1OXV A;  3F2D A;  1OXX K;  1K3R A;  3WDN A;  3P7J A;  4C3J H;  5IWA Q;  2ZM6 Q;  1EZ6 A;  5G3L D;  1IKL A;  1TWF B;  2HD3 A;  3PMF A;  4HJA A;  5M5W H;  1HRJ A;  5IGC A;  1YNJ D;  3HKZ E;  4C3H B;  5JEA H;  3I7F A;  2B63 G;  1VQC A;  4CHT B;  1CFM A;  3BVG A;  2BDN A;  2YV5 A;  3T4A C;  3NSW A;  4I7A A;  4UHV A;  5HGQ A;  2I5L X;  1IBL Q;  1B8A A;  3HOX G;  4GOP C;  2A73 B;  1RJT A;  4DNT B;  3PO2 G;  2R7D A;  4A3E B;  4DR3 L;  4LF5 Q;  4A3K H;  1EY6 A;  4JK1 C;  2F4V L;  4WJ3 M;  4C3H G;  3B6Y A;  3MXN A;  3S17 H;  1MGS A;  2CW0 C;  4FVM A;  4XYO A;  2AWN A;  3CW2 C;  4ZKB B;  2EYP A;  4JI7 L;  3S1N H;  1YJW A;  2A19 A;  3H0G B;  4LF4 Q;  1HR0 W;  3RNU A;  4DAY A;  5JJI A;  4KD4 A;  2CWP A;  3G71 A;  1VQ6 A;  2SDF A;  4DV3 L;  1XMQ L;  5C4X H;  2BCO A;  2RDF A;  4DR5 Q;  1YVC A;  5IYC H;  1SMX A;  3SVM A;  4K8I A;  3SK4 A;  3Q24 A;  2E5L L;  1JCK B;  4JI0 L;  4RCN A;  1AW7 A;  2MJ8 A;  1UE1 A;  2XNA C;  4PMB A;  4B3T L;  1EY8 A;  1X3F A;  1ZEQ X;  3I90 A;  5IGF A;  3J7Y W;  1SJH D;  3RLN A;  2QEX A;  1PA6 A;  4DV2 Q;  1ENA A;  2L12 A;  2N49 A;  3H0G G;  4KKT A;  4K2K A;  4J8Q A;  2XGT A;  2PW7 A;  4YY3 Q;  4IOC A;  2HIX A;  1D5X C;  1PTO B;  2EJG C;  4DV4 Q;  2VUM B;  4BY7 B;  1EOV A;  1SXT A;  1X6O A;  4DXF A;  2B2W C;  3Q22 A;  4RKL A;  2QDL A;  3UE0 A;  1JQY D;  3J81 E;  2B2V C;  1CQV A;  4OO1 I;  3DUZ A;  3VA7 A;  5COY A;  4A3F B;  4KN4 C;  4Q5V A;  4HIK A;  3QG1 A;  4KKS A;  4FF1 A;  4A3B G;  4ILW A;  2R7Z H;  3GD7 A;  1X3Q A;  1HQR D;  1XNQ Q;  1GD7 A;  1Q12 A;  3AFP A;  5C44 B;  1B2T A;  1IZ6 A;  2CFM A;  3G7L A;  2OF1 A;  4DUZ Q;  2VUM G;  4EGV A;  4BY7 G;  1A3T A;  1KRT A;  1Q3L A;  4QGU A;  3RZO H;  2KHI A;  1WTX A;  1YNN C;  2RVL A;  1EUJ A;  1IBK L;  2K05 A;  3MA2 B;  2NZH A;  4GKK L;  3ERO A;  3J81 c;  5F2D A;  4DV1 L;  2ID0 A;  3PO3 G;  3ZYY X;  5C44 G;  5M5X B;  3H3V I;  4J15 A;  2JA8 B;  4JI1 L;  1UE7 A;  1I4R A;  2EY1 A;  3NUC A;  4K14 A;  4IFD J;  2Q8I B;  2L9H A;  2VB2 X;  2K5W A;  3TP5 A;  2RQX A;  3R93 A;  4P74 A;  3M4O H;  2A6H D;  1STG A;  3W1B A;  3NQT A;  4L5R C;  3M3Y H;  1QUQ A;  3Q8D A;  4LK1 C;  4HID A;  4CDD C;  4Y52 H;  1I50 B;  4G7H C;  1TWF H;  5A2Q E;  5E3F A;  4TQU S;  3VR3 A;  4DK0 A;  4NW2 A;  1PH2 A;  2JA8 G;  4NKL A;  1D5M C;  1L0X B;  3OMC A;  3SGI A;  5FJ8 H;  1RDP D;  3EVQ A;  3I4O A;  2EDG A;  1X3E A;  1KTK A;  1JIC A;  2K75 A;  5T1I A;  4EQN A;  3OPO A;  1DOL A;  3NXW A;  3Q0A A;  4A3E H;  1E7Z A;  2HHH L;  1X55 A;  2QEJ C;  1LTI D;  1PRT C;  1IL8 A;  3U9O A;  2K4K A;  4IUT A;  5GAG C;  4HJ5 A;  3MAQ A;  1C8C A;  3A74 A;  1WTO A;  5JEA J;  2OEO A;  4FP5 D;  4BXX H;  2NVX H;  1A6X A;  3AU7 A;  3S14 B;  1ILQ A;  2K5V A;  4IZ8 A;  4FF4 A;  1ICF B;  3PUW A;  3LWU A;  4DV7 Q;  2MFI A;  1HUM A;  2AKW B;  4B3S L;  3DLL A;  1EFI D;  2YTX A;  4RG1 A;  3EA6 A;  4DV0 Q;  1SFO B;  1S5C D;  4S3S A;  2A1A A;  3K5O A;  4A3G G;  4BS9 A;  1JC7 A;  4LFC Q;  1BXT A;  4LF9 L;  1M8A A;  1GUN A;  1VQE A;  4QUF A;  1OXT A;  5EGT A;  2B39 A;  1Y8O B;  2K7V A;  5KIX A;  4ID6 A;  2KA7 A;  5IGE A;  1TS4 A;  2Q2H A;  2ICI A;  1STA A;  5ELD A;  1YHB A;  3G6J B;  4BBR H;  4OX9 L;  2UXB L;  4H0L C;  2B2U C;  3ZJY C;  3LNN A;  1LLR D;  3UDF A;  1EY4 A;  3T1H Q;  3Q6S A;  2SNM A;  2HDM A;  2L5T A;  1PH5 A;  3IFD A;  3S1M H;  1Y1W H;  4A3F H;  4KHP Q;  2PNH A;  2K28 A;  1MI2 A;  5CGK A;  1JT8 A;  2ASB A;  5EJW A;  1RF2 D;  1U4R A;  2NB0 A;  4PZ7 A;  2IX3 A;  1ASZ A;  2F0W A;  1EWC A;  3KF8 A;  1E2W A;  4JV5 Q;  4FXG C;  2JYO A;  1CKO A;  3HOZ H;  1KDA A;  3J7A 5;  2EOT A;  1Z47 A;  2MP1 A;  3SDZ A;  5IWA L;  2ZM6 L;  3WWV A;  3M7G A;  3P75 A;  2R92 H;  5ISR A;  2F0M A;  2OQK A;  2Z9H A;  1SNC A;  3IRB A;  3D6W A;  1LAB A;  3K6O A;  4JI6 L;  3WOF A;  1H9J A;  1N33 Q;  1HZC A;  2JA8 H;  2L55 A;  3CD6 A;  1IBL L;  2AQ3 B;  3N52 A;  3F2B A;  1TY2 A;  4RGO S;  1BCP F;  3I3C A;  3S1R B;  3OIQ A;  1CZG A;  4HTH A;  1AFP A;  1K8M A;  3CC4 A;  2CWA A;  1VF7 A;  1XPR A;  1PH1 A;  3GTM B;  1TWH B;  4YCU A;  1Y14 B;  4EVO A;  3GTQ B;  2HT1 A;  1BVS A;  1I50 H;  2QKI C;  1BQQ T;  1B4O A;  2VQF Q;  4HIO A;  4K5W A;  1XWE A;  2CW0 D;  1O7L A;  5LMU Q;  2PI2 A;  3R2I A;  1PXU A;  4UP7 A;  5GAD C;  1QNU A;  4IUU A;  1VQD A;  4OWX B;  4CKE A;  2RHS B;  1GHJ A;  3T16 A;  2NN6 G;  3RR5 A;  4LAA A;  4O1N A;  1KAB A;  3CXC A;  4CGY B;  3MC0 B;  1AE2 A;  3QOL A;  3A0J A;  3HGB A;  3N6R A;  3PF5 A;  1DJR D;  3HOY B;  4R9W A;  1B44 D;  4YY3 L;  4HAE A;  4DR7 Q;  1WI5 A;  3L2P A;  3AQQ A;  1JJG A;  1T5X D;  1LT5 D;  2Z0S A;  4GS3 A;  4K0K L;  1V9P A;  2MUY A;  1QCB D;  4I7Z C;  2O4X A;  1YJ9 A;  5CYU A;  1V1O A;  1U0L A;  2JA7 G;  1VMC A;  2B2Y C;  1PVO A;  1STE A;  2LS0 1;  3DWA A;  2O5I C;  3L0O A;  4KY6 A;  3V96 A;  3HOY G;  5M5Y B;  4DR3 Q;  3A8I E;  1XPO A;  1I6H B;  4IPH A;  2NYZ D;  3K5M A;  1B70 B;  2F4V Q;  1IKM A;  2K33 A;  1LTR D;  4DAM A;  2DGY A;  5J3B A;  1W6K A;  3E6Z X;  1O7I A;  5KEE A;  4LNQ A;  3Q23 A;  1H9M A;  2C9O A;  2WFW A;  1PH7 A;  1GUS A;  4JI7 Q;  3BZD B;  2LKV A;  3H15 A;  4F87 A;  1VQA A;  4DV3 Q;  1XMQ Q;  2KHJ A;  4G57 A;  1SNP A;  1PH4 A;  2E5L Q;  4JI0 Q;  4A4I A;  1LTA D;  2A68 C;  4R4I A;  4C2M B;  2F1M A;  3SXH A;  4A3C H;  5ELF A;  4CDC C;  2Y0S E;  3CMA A;  5J1Z A;  4CBV A;  1O80 A;  2XVS A;  2NWG A;  3GV6 A;  1X3P A;  1U4M A;  4NXM L;  1NR4 A;  4L63 B;  5EKI A;  4A3I B;  5EBD A;  1VQK A;  1HNW L;  4RMF A;  4GNX A;  4CDE C;  2O5J C;  1XMO Q;  1O7Y A;  4K5V A;  3RMH A;  3RUZ A;  5BN4 A;  3E9H A;  1DGS A;  4Y7N H;  1DON A;  4CKB A;  1TY0 A;  4AYB G;  1Z6H A;  2ALY B;  4DR4 Q;  1U4P A;  4FXD A;  3I8Z A;  3S24 A;  3CU7 A;  1HZ9 A;  1ICW A;  2HQL A;  3GTM H;  3S9W A;  1FNU A;  5CMD A;  3GTQ H;  5ELE A;  1E0B A;  4R8N A;  4A3I G;  1A2T A;  3NEM A;  5FO9 B;  2IY5 B;  3TN2 A;  3U58 A;  4RWS C;  1EQV A;  3T13 A;  1JOK A;  2XRS D;  4GKK Q;  3F1Z A;  1E2V A;  1KL9 A;  2X69 A;  4LJZ C;  1V1P A;  1QIL A;  3HS0 C;  5COR A;  1LYL A;  1PZI D;  4DV1 Q;  1FGB D;  3PCO B;  1D6E C;  4ZLT F;  1I3Q B;  1BCP B;  4JI1 Q;  2JSO A;  2NVY H;  4CDF C;  4LFC L;  4JVZ A;  3CQZ B;  4LUZ A;  1YI2 A;  4PNY A;  1ENC A;  4WOR A;  2N88 A;  2LXK A;  3OMG A;  4DV6 L;  1JWM D;  4LMQ D;  2FMM A;  3K0Y A;  3V2T A;  1EIH A;  4JBJ A;  5ELN A;  1EU3 A;  2B2T A;  1VQ4 A;  1TII D;  2K5H A;  1PTO F;  4H7B A;  3I91 A;  1DOK A;  5IYD G;  3H3V C;  3LWE A;  2R93 G;  1V1Q A;  4JBM A;  4KHP L;  2I46 A;  2HHH Q;  2QA4 A;  2F0G A;  4YIJ A;  1I6H H;  2A6E C;  4NMZ A;  2F52 A;  4IUN A;  1QWY A;  1X65 A;  4QIW E;  3IL8 A;  3O13 A;  4LWC A;  3CPF A;  4N8F A;  4DF7 A;  4RGT A;  3MEH A;  4X6A H;  2VS1 A;  2FJ2 A;  3HOW B;  3DM3 A;  3HRZ C;  1ZYR C;  2XRQ D;  3U9S A;  4YWL A;  5CR3 A;  4B3S Q;  1KAW A;  2HCI A;  1SMY C;  1G51 A;  3S1Q B;  1WTR A;  5I9O A;  2XIW A;  1G29 1;  2YTY A;  3CKI B;  2A8V A;  5D14 A;  3HOW G;  4JOI C;  3VYR A;  4DV5 Q;  1FD7 D;  4XT3 B;  5DAU A;  5C0X G;  4TRD A;  5BR8 L;  3JAM i;  4MN3 A;  4V0B A;  2Z6K C;  3I70 A;  2NN6 I;  1ET9 A;  4IN3 A;  2I07 B;  1EEF D;  1VQF A;  4JI3 Q;  2UXB Q;  4HCS A;  1J9O A;  3NBI A;  4R4O A;  5KNC A;  2PQA B;  2UUB Q;  3I55 A;  4OO1 H;  1Y1V B;  4YCW A;  1P16 A;  3CCL A;  1F2M A;  1TU2 B;  2DUD A;  1H9S A;  1SRO A;  1SYF A;  2KEN A;  1I94 Q;  4A3J B;  3E5S A;  1MIU A;  1VMP A;  3PIP A;  4G7Z C;  2G5D A;  3VDY A;  2F0D A;  3QOJ A;  3DMU A;  1UEB A;  4ZAI A;  1SNQ A;  1YZ6 A;  4JC0 A;  5C4H A;  1KDB A;  3PUX A;  1X9N A;  4XTC S;  1N8R C;  1BUV T;  1WTW A;  4JBW A;  5CC4 A;  3HOX B;  3K5L A;  4POF A;  2XSC A;  3GV3 A;  2B2V A;  4G4K A;  3PO2 B;  1Y1V G;  1MJC A;  4ODG A;  4JG2 A;  5JVG 3;  2WAC A;  5E1F A;  1BKB A;  1LAC A;  2VL6 A;  4A3J G;  4POG A;  4KTA A;  4DR7 L;  4L6T B;  3GTP B;  3H3V H;  4HJ8 A;  4OGQ C;  3A5U A;  4JI6 Q;  5CBE E;  1KAA A;  2SEB D;  1F2Y A;  4R8I A;  3OSO A;  1WVL A;  3I73 A;  1I3Q H;  1MD2 D;  4R4T A;  3L7Z C;  5KYI A;  1F2L A;  2F0H A;  1B9N A;  1EQT A;  2EXZ A;  2R7F A;  3CQZ H;  4HJ9 A;  4L5Q A;  1PH9 A;  5ELB A;  2K5Q A;  2ZXP A;  4QB4 A;  4O0A A;  4B08 A;  1PZJ D;  4HED A;  2PZU A;  3DEO A;  3D6C A;  2F4I A;  3PIP 3;  1H95 A;  5BN3 A;  2YU9 H;  2RCN A;  1G91 A;  4OL7 A;  1SDF A;  4JI2 Q;  3FVQ A;  2VW9 A;  1ZXT A;  3PF4 A;  1VQL A;  4I65 A;  5CV9 A;  1VS0 A;  3MZ5 A;  1ENF A;  3J7Z C;  5LMN L;  2XTI A;  5KND A;  2BE5 C;  1M1K C;  5K36 H;  3PIO A;  4AIM A;  2FMC A;  4X62 Q;  3TEH B;  2WV6 D;  5FLX L;  2EZV A;  1OTC A;  3HKS A;  1KXL A;  2UXD L;  2J4X A;  2E2J B;  2PO4 A;  3UI2 A;  4A3B B;  2AMC B;  3BU2 A;  3C1E A;  2NVT B;  1TS3 A;  3HOW H;  2DNC A;  4J1M A;  5JJK A;  3MXG A;  3CC2 A;  1T9H A;  3TZD A;  5C0X H;  1WTQ A;  4FYD A;  1HXY D;  1HPC A;  3EQL C;  3E0E A;  3ERQ A;  1QZH A;  4K0K Q;  4FO2 A;  1XMO L;  3CRK C;  1ZKO A;  4U67 3;  1TWC H;  1SND A;  4IAL A;  3IFT A;  4EQ5 A;  2MGS A;  3NK9 A;  4K8J A;  1TT2 A;  4KI0 A;  3C2P A;  1SYD A;  5CBA E;  4DR4 L;  3PO3 B;  2IX0 A;  1UEA B;  4P73 A;  1C9O A;  5IT9 L;  1EEI D;  3PUY A;  3CRL C;  1NMG A;  1VCI A;  3R8B A;  2WII B;  1EQQ A;  3E3X A;  5IYB H;  3D31 A;  3MXN B;  2MO0 A;  2JA9 A;  3PIO 3;  3NWS A;  2UUC L;  1PTO C;  4KY5 A;  1PZK D;  4DA2 A;  1Q1B A;  1TVX A;  3K7U C;  3OWE B;  4DAY B;  4TVA B;  2WAQ E;  4RH6 A;  4A3J H;  2E2I B;  2RDG A;  4RGM A;  3UDI A;  2B63 H;  4ME5 A;  3SHL A;  5G3L F;  1O78 A;  1CKN A;  4JBK A;  1MHW C;  3HOX H;  4HN7 A;  3PO2 H;  2NZ1 D;  3I4M G;  2F0S A;  4KV6 A;  4NXM Q;  3VA5 A;  1D7Q A;  4NP5 A;  2LSS A;  3HG9 A;  3AEV A;  4C3H H;  2WB1 B;  1HNW Q;  1CI3 M;  3MWY W;  2V4D A;  3KLS A;  1RCV D;  3TP6 A;  4MZ9 A;  2F0E A;  5FK9 C;  5IP7 G;  4KLK A;  2EIF A;  1A62 A;  4B3R L;  3TP8 A;  2BDO A;  1PH3 A;  1YBY A;  2OQ0 A;  1BOS A;  4B9W A;  5HUR A;  3STB C;  3KFU A;  3PSI A;  2ZTD A;  4Z9C B;  4C1N I;  4XDX A;  2WB1 G;  1HR0 L;  3S15 B;  1Y69 U;  4YWM A;  1DCZ A;  5LL6 S;  1YHQ A;  4A3G B;  1NTG A;  2A6E D;  4L5T A;  1BBX C;  2VQE Q;  4E6I A;  1IW7 C;  1VQN A;  4UP9 A;  1KQS A;  3MFG A;  3NQI A;  3S2H B;  1K28 A;  3H0G H;  4GN5 A;  1NMF A;  2Q8T A;  2F0K A;  5GAE C;  1N36 L;  3FPU B;  5C3W A;  1CSP A;  2B8F A;  5C0X I;  2KVM A;  4XIG S;  3KLS X;  1VQ7 A;  1ZYR D;  1EY7 A;  4ZKC B;  4HJ7 A;  2C35 B;  1KLU D;  5I9P A;  1NAP A;  3MXP A;  1K83 B;  2CKZ B;  3A7A B;  4LW1 A;  5I2X A;  5KYL A;  3MHB A;  3K8A A;  4A3B H;  1GUW A;  4DV5 L;  1QUQ B;  2NVT H;  1I6V C;  3WOE A;  5JAV A;  4DV6 Q;  3J80 i;  1RL2 A;  3S2D B;  3BYY B;  1DZ1 A;  1PTO H;  4JI3 L;  2VUM H;  3GTG B;  1VQ8 A;  2Z1C A;  4BY7 H;  2K14 A;  2N3S A;  1TKW B;  2UUB L;  2OCE A;  1A0I A;  3TSS A;  1DM0 B;  1I4X A;  4QY7 A;  4XQN A;  1XNR L;  3HZX A;  3E0J A;  2K1B A;  1XTC D;  2E75 C;  5D65 A;  1I94 L;  5HGT A;  1BR9 A;  3KDF A;  3PO3 H;  1S5B D;  5L37 A;  2JEA I;  5C44 H;  1DYQ A;  2GA4 B;  2XWJ B;  3JC6 6;  1B50 A;  1D8L A;  2K01 A;  1KNA A;  4H13 C;  5FOB B;  1GVP A;  1AZP A;  4OWW B;  3KBG A;  3K59 A;  2LMC B;  1L1O A;  2H1E A;  4IOA A;  1R9T B;  1B7Y B;  3DWQ A;  3NHH A;  2F0P A;  1FJG L;  3C46 A;  3I4N B;  3AYH B;  5AFW A;  5IGD A;  3KJP A;  2E2I H;  5M5X H;  2FIN B;  1WTP A;  2HCC A;  4DK1 A;  1H9R A;  1JB7 A;  2RSO A;  5AJ3 L;  3BDC A;  4QQB X;  2ZTE A;  3TRZ A;  4DAV A;  1JOR A;  1HTP A;  2EYM A;  1XTD A;  4QF4 A;  3FKI B;  5IP7 H;  1LT6 D;  1L0Y B;  4CKC A;  2A69 C;  1E24 A;  5NUC A;  5BR8 Q;  1N34 Q;  2ATW A;  4F8M A;  2D5D A;  2M9V A;  3I4N G;  3BG3 A;  4KHV A;  4UPA A;  3VR6 A;  2OXP A;  4N9P A;  1EY5 A;  4X3S A;  1N32 Q;  1OXS C;  3J80 L;  1IYU A;  4CJ0 B;  5C3E G;  3RN5 A;  2EPB A;  1E1T A;  2HQE A;  4JI2 L;  2OWO A;  3TS0 A;  1Q8K A;  1HCZ A;  4C3I G;  4DR6 L;  1MBY A;  3FKI G;  2DY7 A;  4NDX A;  5M3M B;  2DY8 A;  1AP0 A;  2I5H A;  1WD1 A;  1H9K A;  1N9W A;  2JE6 I;  5FLX E;  5CV4 A;  1LTG D;  2CHB D;  5M9O A;  2UU9 L;  1IHZ A;  3J7A V;  4X62 L;  3K7A B;  5K5P A;  1IYJ B;  3VYU A;  3KF8 B;  1F9R A;  2PNR C;  2JA7 B;  1FVI A;  4XQQ A;  3BVZ A;  2ZT9 C;  4A3G H;  3H94 A;  5I6W A;  4JYA L;  1J6Q A;  5M3M G;  1V8Q A;  4GLV B;  3S14 H;  3NE5 B;  4PMC A;  4K6L A;  5FLM G;  4DR1 L;  2ZJR A;  5M3F G;  1EQR A;  1STN A;  4HSP A;  2E74 C;  1L2F A;  4GLA C;  4RCO A;  2A74 C;  1SFO H;  1YIT A;  2L0C A;  1HZB A;  3HOV G;  3T53 B;  2M2L A;  4X64 L;  3HOU B;  1K83 H;  3ONA B;  3SK6 A;  4LFB L;  4GN4 B;  1Y8P B;  2F0F A;  4ZK9 B;  4XYQ A;  4ZYS A;  2MQH A;  1U9R A;  4OON A;  3GTL B;  4OIJ A;  1F9P A;  3M4Y A;  3S2D H;  5T1G A;  2K32 A;  3J81 i;  3GTG H;  3TZU A;  3AFQ A;  4RGN A;  2RBM A;  4YCV A;  5GAH C;  4YHH L;  1WCM B;  2BA1 A;  3UDG A;  2EYO A;  4EX5 A;  2KBN A;  1RKN A;  1EYG A;  3HOU G;  1YNN D;  5LMN Q;  1PTO D;  2B29 A;  1HHV A;  4UAI A;  1W3S A;  1DOM A;  4ABN A;  5JPM C;  1TWA B;  4GZY C;  3M4P A;  2UXD Q;  1NUC A;  4DNI A;  2EXD A;  4WJW A;  2NTS A;  4LFA L;  4RKB A;  4AYB B;  1Q8I A;  1WCM G;  1FGU A;  3DWP A;  1CA5 A;  2NUC A;  1EY0 A;  1S5E D;  1QJO A;  1HNX L;  3NPP A;  2ES2 A;  1F77 A;  1J8I A;  1A15 A;  5D3I B;  1GKH A;  2F0U A;  1Q1E A;  2KED A;  4EQP A;  1JE5 A;  4HMI A;  3VR5 A;  3C1F A;  2EJF C;  3D4R A;  4A3M B;  1JOO A;  1JMC A;  4BA2 I;  2EVB A;  4DU9 A;  3FKI H;  5DLQ E;  3S1R H;  3NBH A;  5JJL A;  1QZG A;  3D3R A;  2EYH A;  2JA6 B;  2JP1 A;  5JJZ A;  1FYC A;  1SAP A;  2EYF A;  2D62 A;  2KEE A;  2NN6 H;  1TWH H;  1C7Y A;  1S5D D;  4RHR A;  3M7N A;  4BBS B;  5FKA C;  4XXE A;  2JQO A;  4FNF A;  3W1G A;  4GN3 B;  1AH9 A;  4A3D B;  2VQE L;  4LF7 L;  1PRT D;  1C4Q A;  3DHQ A;  1A63 A;  4KMU C;  4IFD G;  3SE0 A;  2UUC Q;  1MKH A;  1AE3 A;  5LL6 X;  4A3M G;  5C3X A;  1EU4 A;  3ER0 A;  1R4Q B;  2ZXR A;  1NCV A;  2HUG A;  4RHS A;  1F2Z A;  4JOI A;  4X65 L;  2LY7 A;  1K0S A;  1VQH A;  4JI4 L;  2JA6 G;  1PFS A;  2D2C C;  2F0J A;  2JN4 A;  5FLM H;  1LTB D;  2Z6K A;  3OW7 A;  1WD0 A;  4BBS G;  1BBU A;  3ERS X;  4H44 C;  2QW7 A;  1C0A A;  5IY0 A;  2KCT A;  4AQY L;  3HKZ B;  3CPW A;  3K7A H;  1BO0 A;  1RTN A;  3RLF A;  4C3J B;  2R93 B;  1MSH A;  3PUZ A;  1TQO A;  2JA7 H;  4A3D G;  1P8L A;  2F0N A;  2YTV A;  4PQX A;  5CV7 A;  2GVA A;  5M5W B;  1ASY A;  3ICE A;  2JK8 A;  3HOY H;  2EJM A;  2JJQ A;  1VQO A;  1EYC A;  1SLJ A;  3IAY A;  3CCS A;  1GJX A;  4A93 B;  5ELC A;  1V43 A;  2B3G A;  2A6H C;  2L11 A;  1Z7T A;  3KF6 A;  4FXK C;  3DEP A;  3FRP B;  4GNX B;  3RD4 A;  3OWF A;  2G9D A;  4C1N K;  3HKZ G;  1PYS B;  4C3J G;  5J22 A;  1G6P A;  4A3K B;  3SK8 A;  4B3R Q;  5JEA G;  2DJG C;  1BCP C;  3EJI A;  3SK5 A;  3CCV A;  1TXY A;  5M5Y H;  4R4C A;  4JI8 L;  1ROD A;  1EWI A;  4A93 G;  1M4V A;  3GP7 A;  1HR0 Q;  4PMW A;  1T5E A;  1CHQ D;  2DN8 A;  3D8G A;  3K5N A;  1RIP A;  1SNO A;  4MTN A;  2R3Z A;  1S40 A;  1C48 A;  3BS1 A;  4GOP A;  3TDQ A;  1CM9 A;  4OEM B;  2Q2I A;  3W3A A;  4A3K G;  2XN9 C;  2AQ2 B;  4YWK A;  2GN5 A;  5D3D A;  4DUY Q;  4V19 0;  1JOQ A;  1N36 Q;  4CJ2 C;  3K80 C;  1V1P B;  2IPK D;  2F3I A;  4TKO B;  1I4H A;  3PGZ A;  1XXG A;  1S3O A;  1SRU A;  4P72 A;  2RSN A;  3RZD B;  3RN2 A;  1KDC A;  2EE1 A;  2BH2 A;  1ML0 D;  4P75 A;  1TWA H;  3NEL A;  2F0O A;  4LF6 L;  2IL8 A;  4OXP A;  4C2M H;  3QJY A;  2D0P A;  4J6H A;  1XPU A;  4KD3 A;  1Y8N B;  5C4X G;  2L1B A;  1ILP A;  3MFY A;  5TSS A;  1N34 L;  1K8O A;  3J80 E;  1EOT A;  4AYB E;  2A69 D;  1CK1 A;  2MO1 A;  3PV0 A;  2J7Z A;  4A3I H;  1N32 L;  2FXQ A;  3OTO L;  1XNR Q;  2RHQ B;  1HFN A;  2R7Z B;  2KJX A;  2X6L A;  2IW3 A;  3SEB A;  3EBE A;  1HNZ Q;  3GO5 A;  1PYW D;  3EFX D;  2B2W A;  4HSV A;  4BBS H;  4ZUJ A;  3H91 A;  3EIV A;  1R4P B;  4OHJ A;  3NEN A;  5ELO A;  1VQ9 A;  4H02 A;  5JPN C;  2R7Z G;  1JWU D;  2F0V A;  1FJG Q;  4IUP A;  1DD2 A;  3K0X A;  3VR2 A;  3BVM A;  1L0W A;  2Q2U A;  3M9B A;  1SE4 A;  3M4O B;  5AJ3 Q;  4IJL A;  3CME A;  3M3Y B;  4BA1 I;  2KCN A;  1WJJ A;  1E2Z A;  1X56 A;  4PZ6 A;  5IYD H;  2R93 H;  4KJO A;  1KNE A;  4FDB A;  1WFQ A;  1ONL A;  4B9X A;  1LO5 D;  1EIF A;  1QVG A;  3OW2 A;  1VQ5 A;  2P5Z X;  5EPJ A;  1EL0 A;  4A93 H;  1K9M C;  3JAM L;  2PCF B;  2C5C A;  1LM0 A;  1IYV A;  1RTO A;  2BH8 A;  2AQ1 B;  1OO9 B;  4IUR A;  4DR6 Q;  3VR4 A;  1EYD A;  3LX0 A;  1H9S B;  2PMZ B;  1QVC A;  2UU9 Q;  2IHE A;  4B3M L;  3M85 A;  3F2C A;  2EYJ A;  2IWH A;  1QG7 A;  3LGJ A;  5FJ8 G;  2QF7 A;  3SR1 A;  2NVX B;  1XJV A;  1UWV A;  3DM1 A;  2A68 D;  3BYT B;  2L15 A;  1PYB A;  5C4Z A;  5EAY A;  2BA0 A;  2F03 A;  4UDU C;  4JYA Q;  1YHA A;  4A3E G;  2TMP A;  3NTK A;  1Q7Y C;  1GM5 A;  2F3V A;  4UP8 A;  4DR1 Q;  4ZQ3 A;  3CC7 A;  4PV1 C;  5A35 A;  1VDZ A;  4LF8 L;  4OEL B;  3ND9 A;  3K57 A;  2HIV A;  3RZD H;  3E9I A;  2G9H D;  3S1Q H;  4BXX G;  4IFD I;  2QCP X;  5BN5 A;  2Z6B A;  3T51 B;  4X64 Q;  4LFB Q;  1SN8 A;  2EYL A;  1FR3 A;  4BBR B;  1IBM Q;  4K5X A;  3ULJ A;  4IUV A;  4QUC A;  3NP8 A;  1QNK A;  3AMU A;  4X66 L;  4XT1 B;  1EFW A;  3MEF A;  1HA6 A;  4QCL A;  1LT3 D;  1M90 C;  1IL2 A;  5IP9 G;  3S1M B;  4ALP A;  5E4X A;  3F8T A;  1Y1W B;  4YHH Q;  2K5D A;  4APV A;  3T1Y Q;  5JVH 3;  1VQI A;  1Y1V H;  3I4M B;  4AH6 A;  2IJ0 A;  3HEJ A;  2ZTC A;  4DK6 C;  1NNX A;  2IX1 A;  1I4P A;  4WFN 3;  4BBR G;  3CAM A;  3K58 A;  5CV6 A;  1NY4 A;  4MTK A;  3HOZ B;  3BJU A;  3V05 A;  2B2U A;  1D1I A;  2E2H B;  3CF5 A;  4RA8 A;  1II3 A;  1Q46 A;  4LFA Q;  2R92 B;  1U4L A;  1GXD C;  4ZUI A;  4A3F G;  2WKD A;  3P1H A;  1Y1W G;  4NXN L;  2RKS A;  1CTM A;  1PLF A;  1HNX Q;  1UAP A;  2UXC L;  3BDO A;  2EY2 A;  1SE3 A;  3GTP H;  3HP3 A;  3CHB D;  1U5K A;  1UE6 A;  2N78 A;  3HOZ G;  2L4N A;  1VQJ A;  2QDB A;  1PRT B;  2RA4 A;  1O7Z A;  1YNX A;  1SJE D;  2R92 G;  2CCZ A;  2WIN B;  1FL0 A;  5IGG A;  1LTT D;  3TRE A;  3FHW A;  2Q8R E;  4U68 A;  5JOB A;  1PDQ A;  1OXU A;  3KLW A;  4GLX A;  1TS2 A;  4IUQ A;  1BCP D;  3T56 B;  4XQJ A;  4O2D A;  2N55 A;  1EWH A;  3C3L A;  4LF7 Q; 
#chains in the Genus database with same CATH homology
 2XWB B;  3H6M A;  2A5H A;  3X3N A;  4M8A A;  3URY A;  5J39 A;  2LFN A;  4KJN A;  1G6Z A;  2PZW A;  2WKC A;  3FMC A;  1SMY D;  4KN7 C;  1SYG A;  1Q90 A;  4ZRZ A;  2VXW A;  1SEB D;  3KBX A;  4C56 C;  3TME A;  1MSG A;  1G2S A;  3MTS A;  2M00 A;  2Z8L A;  5C6A A;  5DM7 3;  1SBB B;  5I2Y A;  5FO8 B;  2CQA A;  2SOB A;  3NWT A;  1GUT A;  2DNE A;  5EKL A;  1GUO A;  2BOS A;  1D5Z C;  2E76 C;  1HFG A;  1S4Z A;  2K04 A;  1VF5 C;  2SNS A;  2Z4H A;  1SYB A;  1G8Z D;  3OOC A;  1F9Q A;  5DNF A;  4KHZ A;  2ICE C;  2PQE A;  3A7L A;  5C0X J;  2B2Y A;  4M1U B;  2JA5 B;  4L8J A;  2CVR A;  1SNM A;  2Y0S B;  2PZT A;  1RHP A;  2KQ3 A;  2Z4I A;  3L9A X;  1LT4 D;  4F7X A;  1S5F D;  1PFN A;  1JB3 A;  5KNB A;  5C3E B;  2K03 A;  3GTJ B;  4IQZ A;  2FFK B;  4C3I B;  1G2T A;  2B8G A;  3ND8 A;  4BWG B;  5DM6 3;  1CT1 D;  1B9M A;  4HR7 B;  2KEC A;  3A8K E;  3JAM E;  3KK7 A;  2OT2 A;  4MHE A;  2PPB C;  3GTO B;  1FNV A;  4OIK A;  5EQ0 A;  4K6D A;  4Y7N B;  2YYZ A;  1SSO A;  3QB3 A;  5IIF A;  2HDL A;  2KOL A;  3W2D A;  5CV5 A;  2TSS A;  5FO7 B;  2O2L D;  1HUN A;  3GTK B;  1RD9 D;  1JE4 A;  1EIG A;  3KUP A;  3MXU A;  2NVQ B;  3OHX C;  3A54 A;  5KRU A;  4FF3 A;  5M3F B;  3QO2 A;  2NBF A;  1FNW A;  2BE5 D;  1WTV A;  1NR2 A;  3DXJ C;  3HOV B;  5I4D A;  2EY5 A;  1AN8 A;  4QMG A;  5LHY 1;  1LTS D;  1B53 A;  3NTH A;  3P20 A;  4WRD A;  1GOZ A;  2MPM A;  4KK7 A;  1PFB A;  3S16 B;  2NVY B;  2MHV A;  5C4J B;  1PFM A;  2FHT A;  2R61 A;  1YNJ C;  5IT9 E;  1BNZ A;  2F3W A;  4EQO A;  1QOH A;  3NTI A;  3KLR A;  4BY1 B;  5DEH A;  1AZQ A;  4X3U A;  1CA6 A;  2AWO A;  1STB A;  4P2C B;  3F2U A;  1UUP A;  1TWG B;  4QIW B;  4MIU A;  3QWN A;  1SE2 A;  5C5L A;  2ENB A;  1CZW A;  1CQF A;  1TS5 A;  2K6A A;  3IKJ A;  1A2U A;  2PW5 A;  3L3O C;  3R3O A;  4DAP A;  1JWS D;  3A56 A;  2JEB I;  3A55 A;  1QE6 A;  5I6Y A;  5IGB A;  3FEW X;  2J0T D;  4RAU C;  2F0T A;  3MVV A;  2H4O A;  1F9S A;  4K2L A;  3J7A F;  4O42 A;  1DXM A;  5E4W C;  1AEX A;  5C5M A;  2X6G A;  3VYS A;  1B1Z A;  1D2B A;  1QB5 D;  4X3K A;  2IT1 A;  3AB9 A;  3I4L A;  4Q0F A;  2RDH A;  4RFB A;  2KUM A;  1A3U A;  4G7O C;  1TR5 A;  3J81 L;  1IW7 D;  3I72 A;  5KGU A;  3ITP A;  2VNU D;  2VB3 X;  4OO1 G;  5IOC A;  2WP8 J;  4HCE A;  3FDT A;  3D4D A;  2NTT A;  3D4W A;  4X3T A;  1BF4 A;  5EBC A;  1ESR A;  3TBI B;  2KCC A;  2F0L A;  4CJ1 B;  1D1K A;  3A8J E;  5CV8 A;  4DN4 M;  4DXG A;  1W6J A;  1SYE A;  3GQB A;  2PYK A;  3S17 B;  2AUJ D;  1X32 A;  1UNS A;  5EPL A;  3X3M A;  2YU9 B;  4KKU A;  3S1N B;  5A2Q L;  3QIA A;  2JXM B;  1ET6 A;  3VYT A;  5C4X B;  1I4Q A;  1EY9 A;  2AUK A;  1HTL D;  2F0I A;  1STH A;  5EPK A;  4TSS A;  4FF2 A;  1STY A;  4N9T A;  1EYA A;  3OIP A;  3BDL A;  4ULL A;  1ESF A;  2QIL A;  1BDO A;  3PUV A;  4DNR B;  4DGZ A;  1HQM C;  1KLG D;  5K36 G;  2EY6 A;  4F88 A;  1EZ8 A;  1TWC B;  1XYI A;  1XX8 A;  3FPP A;  2E2D C;  1LV9 A;  1A3V A;  1NSN S;  4IFD H;  1SYC A;  1CHP D;  5IOD A;  3R2T A;  1PRT F;  5EKK A;  2ZXO A;  3RZO B;  4DFA A;  4KY7 A;  3H09 A;  2WAQ B;  3TP7 A;  2D9U A;  1HA5 A;  1B3A A;  2F0Q A;  1GHK A;  2R6G A;  2B63 B;  2KHS A;  2B2T C;  1I4G A;  1JR0 D;  4HMJ A;  1GUG A;  1PMR A;  1OXV A;  1OXX K;  3WDN A;  3P7J A;  1EZ6 A;  5G3L D;  1IKL A;  1TWF B;  3PMF A;  1HRJ A;  5IGC A;  1YNJ D;  4C3H B;  5JEA H;  4CHT B;  1CFM A;  3BVG A;  2BDN A;  3T4A C;  3NSW A;  2A73 B;  1RJT A;  4DNT B;  4A3E B;  1EY6 A;  4JK1 C;  4C3H G;  3MXN A;  1MGS A;  2CW0 C;  4FVM A;  4XYO A;  2AWN A;  4ZKB B;  2EYP A;  3H0G B;  4DAY A;  4KD4 A;  2SDF A;  2BCO A;  2RDF A;  3SVM A;  4K8I A;  3SK4 A;  3Q24 A;  1JCK B;  4RCN A;  1AW7 A;  2MJ8 A;  4PMB A;  2XNA C;  1EY8 A;  1ZEQ X;  3I90 A;  5IGF A;  3J7Y W;  1SJH D;  1ENA A;  2L12 A;  4KKT A;  4K2K A;  4J8Q A;  2PW7 A;  1D5X C;  1PTO B;  2EJG C;  2VUM B;  4BY7 B;  1SXT A;  4DXF A;  2B2W C;  3Q22 A;  4RKL A;  1JQY D;  3J81 E;  2B2V C;  1CQV A;  4OO1 I;  3DUZ A;  3VA7 A;  5COY A;  4A3F B;  4KN4 C;  4Q5V A;  3QG1 A;  4KKS A;  4FF1 A;  4ILW A;  3GD7 A;  1X3Q A;  1HQR D;  1Q12 A;  5C44 B;  1B2T A;  3G7L A;  2OF1 A;  4EGV A;  1A3T A;  1Q3L A;  1WTX A;  1YNN C;  2RVL A;  2K05 A;  3MA2 B;  3ERO A;  5F2D A;  2ID0 A;  3ZYY X;  5M5X B;  2JA8 B;  1I4R A;  2EY1 A;  3NUC A;  4K14 A;  4IFD J;  2Q8I B;  2L9H A;  2VB2 X;  2K5W A;  3TP5 A;  2RQX A;  3R93 A;  2A6H D;  1STG A;  3NQT A;  4LK1 C;  1I50 B;  4G7H C;  5A2Q E;  5E3F A;  4TQU S;  3VR3 A;  4DK0 A;  4NW2 A;  4NKL A;  1D5M C;  1L0X B;  3OMC A;  1RDP D;  3EVQ A;  2EDG A;  1KTK A;  1JIC A;  5T1I A;  4EQN A;  3OPO A;  1DOL A;  3NXW A;  3Q0A A;  2QEJ C;  1LTI D;  1PRT C;  1IL8 A;  3U9O A;  4IUT A;  3MAQ A;  1C8C A;  1WTO A;  5JEA J;  2OEO A;  4FP5 D;  1A6X A;  3AU7 A;  3S14 B;  1ILQ A;  4IZ8 A;  4FF4 A;  3PUW A;  3LWU A;  1HUM A;  1EFI D;  3EA6 A;  1SFO B;  1S5C D;  4S3S A;  3K5O A;  4BS9 A;  1JC7 A;  1BXT A;  1M8A A;  1GUN A;  4QUF A;  1OXT A;  5EGT A;  2B39 A;  1Y8O B;  2K7V A;  5KIX A;  4ID6 A;  2KA7 A;  5IGE A;  1TS4 A;  2ICI A;  1STA A;  5ELD A;  3G6J B;  4H0L C;  2B2U C;  3LNN A;  1LLR D;  1EY4 A;  3Q6S A;  2SNM A;  2HDM A;  2L5T A;  3IFD A;  2K28 A;  1MI2 A;  5CGK A;  5EJW A;  1RF2 D;  1U4R A;  2NB0 A;  2IX3 A;  2F0W A;  1EWC A;  3KF8 A;  1E2W A;  4FXG C;  2JYO A;  1KDA A;  2EOT A;  1Z47 A;  2MP1 A;  3SDZ A;  3M7G A;  3P75 A;  5ISR A;  2F0M A;  1SNC A;  3D6W A;  1LAB A;  3K6O A;  3WOF A;  1H9J A;  2L55 A;  2AQ3 B;  3N52 A;  1TY2 A;  4RGO S;  1BCP F;  3I3C A;  3S1R B;  3OIQ A;  1CZG A;  4HTH A;  1AFP A;  1K8M A;  3GTM B;  1VF7 A;  1TWH B;  4EVO A;  3GTQ B;  2QKI C;  1BQQ T;  1B4O A;  4K5W A;  1XWE A;  2CW0 D;  1O7L A;  3R2I A;  1PXU A;  1QNU A;  4IUU A;  4CKE A;  1GHJ A;  3T16 A;  2NN6 G;  4LAA A;  4O1N A;  1KAB A;  4CGY B;  3MC0 B;  3QOL A;  3HGB A;  3N6R A;  1DJR D;  3HOY B;  4R9W A;  1B44 D;  4HAE A;  1T5X D;  1LT5 D;  2MUY A;  1QCB D;  4I7Z C;  2O4X A;  5CYU A;  1V1O A;  1VMC A;  2B2Y C;  1STE A;  2LS0 1;  3DWA A;  2O5I C;  4KY6 A;  3V96 A;  5M5Y B;  3A8I E;  1I6H B;  2NYZ D;  3K5M A;  1IKM A;  2K33 A;  1LTR D;  1W6K A;  3E6Z X;  5KEE A;  3Q23 A;  1H9M A;  2C9O A;  1GUS A;  3BZD B;  2LKV A;  4F87 A;  4G57 A;  1SNP A;  1LTA D;  2A68 C;  4C2M B;  2F1M A;  3SXH A;  5ELF A;  5J1Z A;  4CBV A;  1O80 A;  2XVS A;  2NWG A;  3GV6 A;  1X3P A;  1U4M A;  1NR4 A;  4L63 B;  5EKI A;  4A3I B;  5EBD A;  2O5J C;  1O7Y A;  4K5V A;  3RMH A;  3RUZ A;  5BN4 A;  1DON A;  4CKB A;  1TY0 A;  1Z6H A;  1U4P A;  4FXD A;  3I8Z A;  3CU7 A;  1ICW A;  3S9W A;  1FNU A;  5CMD A;  5ELE A;  1E0B A;  4R8N A;  1A2T A;  5FO9 B;  3TN2 A;  4RWS C;  1EQV A;  3T13 A;  1JOK A;  2XRS D;  1E2V A;  2X69 A;  4LJZ C;  1V1P A;  1QIL A;  3HS0 C;  5COR A;  1PZI D;  1FGB D;  1D6E C;  4ZLT F;  1I3Q B;  1BCP B;  2JSO A;  3CQZ B;  4PNY A;  1ENC A;  4WOR A;  2N88 A;  3OMG A;  1JWM D;  4LMQ D;  2FMM A;  3K0Y A;  3V2T A;  1EIH A;  1EU3 A;  2B2T A;  1TII D;  1PTO F;  4H7B A;  3I91 A;  1DOK A;  3H3V C;  3LWE A;  2I46 A;  2F0G A;  4YIJ A;  2A6E C;  4NMZ A;  4IUN A;  1QWY A;  3IL8 A;  3O13 A;  4DF7 A;  4RGT A;  3MEH A;  2FJ2 A;  3HOW B;  3HRZ C;  1ZYR C;  2XRQ D;  3U9S A;  5CR3 A;  2HCI A;  1SMY C;  3S1Q B;  1WTR A;  5I9O A;  2XIW A;  1G29 1;  3CKI B;  5D14 A;  3VYR A;  1FD7 D;  4XT3 B;  5DAU A;  5C0X G;  4TRD A;  4MN3 A;  4V0B A;  3I70 A;  2NN6 I;  1ET9 A;  4IN3 A;  2I07 B;  1EEF D;  4HCS A;  1J9O A;  3NBI A;  5KNC A;  4OO1 H;  1Y1V B;  1F2M A;  1TU2 B;  1H9S A;  1SYF A;  4A3J B;  3E5S A;  1VMP A;  4G7Z C;  2F0D A;  3QOJ A;  3DMU A;  4ZAI A;  1SNQ A;  5C4H A;  1KDB A;  3PUX A;  4XTC S;  1BUV T;  1WTW A;  4JBW A;  5CC4 A;  3HOX B;  3K5L A;  2XSC A;  3GV3 A;  2B2V A;  4G4K A;  3PO2 B;  4ODG A;  5JVG 3;  2WAC A;  5E1F A;  1LAC A;  4KTA A;  4L6T B;  3GTP B;  4OGQ C;  5CBE E;  1KAA A;  2SEB D;  1F2Y A;  4R8I A;  3OSO A;  1WVL A;  3I73 A;  1MD2 D;  3L7Z C;  5KYI A;  1F2L A;  2F0H A;  1B9N A;  1EQT A;  2EXZ A;  5ELB A;  2K5Q A;  2ZXP A;  4QB4 A;  4B08 A;  1PZJ D;  4HED A;  2PZU A;  3DEO A;  3D6C A;  2F4I A;  3PIP 3;  5BN3 A;  1G91 A;  4OL7 A;  1SDF A;  3FVQ A;  1ZXT A;  4I65 A;  5CV9 A;  3MZ5 A;  1ENF A;  5KND A;  2BE5 C;  5K36 H;  2FMC A;  2WV6 D;  5FLX L;  2EZV A;  2J4X A;  2E2J B;  2PO4 A;  3UI2 A;  4A3B B;  3C1E A;  2NVT B;  1TS3 A;  2DNC A;  4J1M A;  3MXG A;  3TZD A;  5C0X H;  1WTQ A;  4FYD A;  1HXY D;  1HPC A;  3EQL C;  3ERQ A;  4FO2 A;  3CRK C;  1ZKO A;  4U67 3;  1SND A;  4IAL A;  3IFT A;  2MGS A;  3NK9 A;  4K8J A;  1TT2 A;  4KI0 A;  3C2P A;  1SYD A;  5CBA E;  3PO3 B;  2IX0 A;  1UEA B;  5IT9 L;  1EEI D;  3PUY A;  3CRL C;  1VCI A;  3R8B A;  2WII B;  3D31 A;  3PIO 3;  3NWS A;  1PTO C;  4KY5 A;  1PZK D;  4DA2 A;  1Q1B A;  1TVX A;  3OWE B;  4RH6 A;  2E2I B;  2RDG A;  4RGM A;  4ME5 A;  3SHL A;  5G3L F;  1O78 A;  4HN7 A;  2NZ1 D;  2F0S A;  4KV6 A;  3VA5 A;  4NP5 A;  3HG9 A;  2WB1 B;  1CI3 M;  3MWY W;  2V4D A;  3KLS A;  1RCV D;  3TP6 A;  5FK9 C;  2F0E A;  3TP8 A;  2BDO A;  1BOS A;  4B9W A;  5HUR A;  4Z9C B;  4C1N I;  4XDX A;  3S15 B;  1Y69 U;  1DCZ A;  5LL6 S;  4A3G B;  2A6E D;  1BBX C;  4E6I A;  1IW7 C;  3MFG A;  3NQI A;  3S2H B;  2Q8T A;  2F0K A;  3FPU B;  5C3W A;  2B8F A;  5C0X I;  2KVM A;  4XIG S;  3KLS X;  1ZYR D;  1EY7 A;  4ZKC B;  1KLU D;  5I9P A;  1NAP A;  3MXP A;  1K83 B;  3A7A B;  5I2X A;  5KYL A;  3MHB A;  1GUW A;  1I6V C;  3WOE A;  5JAV A;  3S2D B;  3BYY B;  1DZ1 A;  1PTO H;  3GTG B;  2Z1C A;  1TKW B;  3TSS A;  1DM0 B;  1I4X A;  4XQN A;  3HZX A;  3E0J A;  2K1B A;  1XTC D;  2E75 C;  5D65 A;  5HGT A;  1BR9 A;  1S5B D;  2JEA I;  1DYQ A;  2GA4 B;  2XWJ B;  1B50 A;  2K01 A;  4H13 C;  1KNA A;  1AZP A;  5FOB B;  3KBG A;  3K59 A;  2LMC B;  2H1E A;  1R9T B;  3DWQ A;  3NHH A;  2F0P A;  3C46 A;  3I4N B;  5AFW A;  5IGD A;  2FIN B;  1WTP A;  2HCC A;  4DK1 A;  1H9R A;  2RSO A;  3BDC A;  4DAV A;  1JOR A;  1HTP A;  2EYM A;  4QF4 A;  3FKI B;  1LT6 D;  1L0Y B;  4CKC A;  2A69 C;  5NUC A;  4F8M A;  2D5D A;  2M9V A;  3BG3 A;  4KHV A;  3VR6 A;  2OXP A;  4N9P A;  1EY5 A;  4X3S A;  1OXS C;  3J80 L;  1IYU A;  4CJ0 B;  2EPB A;  2HQE A;  1HCZ A;  4C3I G;  1MBY A;  2DY7 A;  4NDX A;  5M3M B;  2DY8 A;  1AP0 A;  1WD1 A;  1H9K A;  2JE6 I;  5FLX E;  5CV4 A;  1LTG D;  2CHB D;  5M9O A;  1IHZ A;  3J7A V;  3K7A B;  5K5P A;  3VYU A;  1F9R A;  2PNR C;  2JA7 B;  4XQQ A;  3BVZ A;  2ZT9 C;  3H94 A;  5I6W A;  1V8Q A;  3NE5 B;  4PMC A;  4K6L A;  1STN A;  4HSP A;  2E74 C;  4RCO A;  2A74 C;  2L0C A;  3T53 B;  2M2L A;  3HOU B;  3ONA B;  3SK6 A;  1Y8P B;  2F0F A;  4ZK9 B;  4XYQ A;  4ZYS A;  1U9R A;  3GTL B;  4OIJ A;  1F9P A;  3M4Y A;  5T1G A;  2K32 A;  3TZU A;  4RGN A;  2RBM A;  1WCM B;  2BA1 A;  2EYO A;  1RKN A;  1YNN D;  1PTO D;  1HHV A;  4UAI A;  1DOM A;  4ABN A;  5JPM C;  1TWA B;  4GZY C;  1NUC A;  4WJW A;  2NTS A;  4RKB A;  4AYB B;  1Q8I A;  3DWP A;  1CA5 A;  2NUC A;  1EY0 A;  1S5E D;  1QJO A;  3NPP A;  1F77 A;  1J8I A;  1A15 A;  5D3I B;  2F0U A;  1Q1E A;  2KED A;  4EQP A;  4HMI A;  3VR5 A;  3C1F A;  2EJF C;  3D4R A;  4A3M B;  1JOO A;  4BA2 I;  2EVB A;  4DU9 A;  3NBH A;  3D3R A;  2EYH A;  2JA6 B;  2JP1 A;  5JJZ A;  1FYC A;  1SAP A;  2EYF A;  2D62 A;  2KEE A;  2NN6 H;  1S5D D;  4RHR A;  3M7N A;  4BBS B;  5FKA C;  4XXE A;  4FNF A;  4A3D B;  1PRT D;  1C4Q A;  3DHQ A;  4KMU C;  4IFD G;  3SE0 A;  5LL6 X;  5C3X A;  1EU4 A;  1R4Q B;  2ZXR A;  1NCV A;  2HUG A;  4RHS A;  1F2Z A;  2LY7 A;  2D2C C;  2F0J A;  1LTB D;  3OW7 A;  1WD0 A;  4H44 C;  3HKZ B;  1BO0 A;  1RTN A;  3RLF A;  4C3J B;  2R93 B;  1MSH A;  3PUZ A;  1TQO A;  2F0N A;  4PQX A;  5CV7 A;  5M5W B;  2EJM A;  1EYC A;  3IAY A;  1GJX A;  4A93 B;  5ELC A;  1V43 A;  2A6H C;  2L11 A;  1Z7T A;  4FXK C;  3DEP A;  3FRP B;  3RD4 A;  3OWF A;  2G9D A;  4C1N K;  4C3J G;  5J22 A;  4A3K B;  3SK8 A;  5JEA G;  1BCP C;  3EJI A;  3SK5 A;  1ROD A;  1M4V A;  3GP7 A;  4PMW A;  1T5E A;  1CHQ D;  2DN8 A;  3D8G A;  3K5N A;  1SNO A;  2R3Z A;  1C48 A;  3BS1 A;  3TDQ A;  1CM9 A;  3W3A A;  2XN9 C;  2AQ2 B;  5D3D A;  4V19 0;  1JOQ A;  4CJ2 C;  1V1P B;  2IPK D;  4TKO B;  1I4H A;  1XXG A;  2RSN A;  3RZD B;  1KDC A;  2EE1 A;  1ML0 D;  2F0O A;  2IL8 A;  3QJY A;  4J6H A;  4KD3 A;  1Y8N B;  2L1B A;  1ILP A;  3MFY A;  5TSS A;  1K8O A;  3J80 E;  1EOT A;  2A69 D;  1CK1 A;  3PV0 A;  2J7Z A;  1HFN A;  2R7Z B;  2KJX A;  2X6L A;  2IW3 A;  3SEB A;  3GO5 A;  1PYW D;  3EFX D;  2B2W A;  4HSV A;  4ZUJ A;  3H91 A;  1R4P B;  4OHJ A;  5JPN C;  1JWU D;  2F0V A;  4IUP A;  1DD2 A;  3VR2 A;  3BVM A;  1SE4 A;  3M4O B;  3M3Y B;  4BA1 I;  2KCN A;  1E2Z A;  4KJO A;  1KNE A;  1ONL A;  4B9X A;  1LO5 D;  5EPJ A;  1EL0 A;  3JAM L;  2PCF B;  2C5C A;  1IYV A;  1RTO A;  2AQ1 B;  1OO9 B;  4IUR A;  3VR4 A;  1EYD A;  3LX0 A;  1H9S B;  2PMZ B;  3M85 A;  2EYJ A;  2IWH A;  1QG7 A;  2QF7 A;  3SR1 A;  2NVX B;  3DM1 A;  2A68 D;  3BYT B;  5C4Z A;  2BA0 A;  2F03 A;  4UDU C;  2TMP A;  3NTK A;  2F3V A;  4ZQ3 A;  4PV1 C;  5A35 A;  1VDZ A;  3ND9 A;  3K57 A;  2G9H D;  4IFD I;  2QCP X;  5BN5 A;  3T51 B;  2EYL A;  1FR3 A;  4BBR B;  4K5X A;  4IUV A;  4QUC A;  3NP8 A;  1QNK A;  3AMU A;  4XT1 B;  1HA6 A;  4QCL A;  1LT3 D;  3S1M B;  5E4X A;  1Y1W B;  2K5D A;  5JVH 3;  3I4M B;  2IJ0 A;  3HEJ A;  2IX1 A;  1I4P A;  4WFN 3;  3K58 A;  5CV6 A;  3HOZ B;  3V05 A;  2B2U A;  1D1I A;  2E2H B;  4RA8 A;  1II3 A;  2R92 B;  1U4L A;  1GXD C;  4ZUI A;  2WKD A;  3P1H A;  2RKS A;  1CTM A;  1PLF A;  1UAP A;  3BDO A;  2EY2 A;  1SE3 A;  3HP3 A;  3CHB D;  2L4N A;  2QDB A;  1PRT B;  2RA4 A;  1O7Z A;  1SJE D;  2WIN B;  5IGG A;  1LTT D;  2Q8R E;  4U68 A;  5JOB A;  1PDQ A;  1OXU A;  1TS2 A;  4IUQ A;  1BCP D;  3T56 B;  4XQJ A;  2N55 A;  1EWH A;  3C3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...