2K03A

Structure of sdf1 in complex with the cxcr4 n-terminus containing a sulfotyrosine at postition 21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCACQIVARLKNNNRQVCIDPKLKWIQEYLEKCLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Stromal cell-derived factor 1
publication title Structural basis of CXCR4 sulfotyrosine recognition by the chemokine SDF-1/CXCL12
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k03A00
1CM9A 2RVLA 3KBXA 2B2TC 3I91A 1HFNA 2M2LA 1G6ZA 1HA6A 4HEDA 4ZLTF 1ZXTA 1U4RA 2K05A 4CJ1B 2MJ8A 5EPLA 4IUVA 2HUGA 1O80A 2FMMA 2HCIA 1LV9A 4OIJA 4CJ2C 2MGSA 1O7YA 2B2YA 2SDFA 3UI2A 1NR2A 4NW2A 5EJWA 1CA5A 2B2VA 1RODA 2EPBA 1PLFA 1DOMA 2L12A 1B50A 1SSOA 1XYIA 1F2LA 2K04A 2Q8TA 1QG7A 3LWEA 2FJ2A 3D6WA 1IL8A 2K1BA 1GUWA 2B2WA 4CJ0B 1B3AA 3MWYW 4IUPA 3F2UA 1U4PA 4QUFA 5D65A 2BDNA 4RA8A 1WTQA 5EQ0A 1J9OA 4ZKCB 2HCCA 2N55A 3DEOA 4IURA 2DY7A 1BF4A 1BNZA 2KEDA 5CBAE 2JYOA 1WTOA 2N88A 1HHVA 2HDMA 1QNKA 2IL8A 1RHPA 4IUUA 2B2TA 1JICA 1ILPA 1DONA 1B53A 1RTOA 4X3SA 1AZPA 2H1EA 2NYZD 4RWSC 2D9UA 2KOLA 2VXWA 3FPUB 2NZ1D 1M8AA 1AZQA 3TN2A 1S4ZA 2R3ZA 4XT3B 1JE4A 4ZAIA 5CBEE 5JJZA 1EQTA 1WTXA 2MPMA 1EIHA 2B2UA 4XT1B 2NWGA 1WTPA 2L11A 2EOTA 1MI2A 1G2TA 3Q6SA 2L4NA 1KNAA 1F9RA 1PFMA 1WTRA 3HP3A 1F9QA 5T1IA 1B2TA 1RJTA 1HUMA 3IL8A 3KUPA 2EE1A 3QO2A 4DN4M 1X32A 1NCVA 4ZK9B 1IKLA 3MTSA 4X3KA 4R9WA 1XX8A 5T1GA 1NR4A 2L1BA 1MGSA 1Q3LA 1WD1A 2FHTA 1ICWA 1WTWA 1WTVA 2CVRA 4UAIA 3ONAB 2FFKB 4R8IA 3P7JA 3DEPA 1A15A 2K03A 4RAUC 1F9SA 4X3UA 3TZDA 4OIKA 1NAPA 1SDFA 1MSGA 2X6LA 1PDQA 3SVMA 1EOTA 4QUCA 4X3TA 1BO0A 4HCSA 4ZKBB 3GV6A 1CA6A 5CORA 2B2WC 2KEEA 1DOKA 3GV3A 3N52A 1VMCA 2DY8A 3I90A 1DOLA 4IUQA 4LMQD 1KNEA 1ILQA 3FDTA 3H91A 1G91A 2K01A 2HDLA 5DNFA 1HUNA 2KECA 3IFDA 1VMPA 1AP0A 1WD0A 1PFNA 1HRJA 1HFGA 1SAPA 2K28A 2KUMA 1X3QA 4HAEA 5E4WC 5CMDA 1J8IA 2JP1A 2L9HA 2MP1A 5D14A 2J7ZA 5EKIA 1PFBA 2B2YC 1F9PA 5EPKA 2FINB 1MSHA 2B2VC 1ML0D 3G7LA 2RA4A 1O7ZA 2B2UC 3R93A 1RTNA 1X3PA 4IUTA 4HSVA 1EL0A 5EPJA 1E0BA 5E4XA 2X6GA 1G2SA 4MHEA 1IKMA 2X69A 2XIWA 1BBXC 2KVMA 2Q8RE 2RSNA 4U68A 5AFWA 1QE6A 4O42A 1C8CA 1WVLA 1U4MA 5COYA 4MN3A 1B4OA 4XDXA 1DZ1A 3I8ZA 2RSOA 1ESRA 1EIGA 3DM1A 1U4LA 1TVXA 3I3CA
chains in the Genus database with same CATH superfamily
2JN4A 2LFNA 2PO4A 1CK1A 4X62L 5IODA 3U4ZA 2HHHL 2IW3A 3U4VA 4B08A 1UAPA 2B39A 1BVSA 4BWGB 3S2HH 3T51B 5KIXA 3HOVH 5A2QL 4YWKA 4N9TA 1VQGA 5JJKA 2MO0A 4KMUC 3U9OA 4XQQA 5FK9C 2B8FA 4G4KA 1BDOA 3HOUG 1XNRQ 2BCOA 2UXCL 1TWHB 2F0QA 5IP9H 4ME3A 2F3IA 1KL9A 2DY7A 4LUZA 1PMRA 2QDBA 4M1UB 4IFDI 2XVSA 1ESFA 4OL7A 1ILPA 2V1CC 2VXWA 4B3SL 4DR4L 3PO2G 3AQQA 1NBWA 5KEEA 5CBEE 1L1OC 3S14B 1HTLD 1FR3A 2PQAB 2EYFA 1WTPA 1MI2A 3NE5B 4IPCA 5T1IA 4DR3Q 1X32A 4GOPB 3B6YA 4B3TQ 3K81C 1L1OB 3SE0A 3CF5A 2E2IB 1HA5A 3E5SA 4YWLA 3BZDB 4A3MG 2R7ZG 1X3FA 5M5YB 4G7HC 2ZXRA 2K7VA 4RG1A 1PRTB 3RR5A 1JJ2A 3TZDA 4KJNA 2ENBA 4JI3Q 1X9NA 4PG3A 2EY2A 2NVYB 3I2ZA 1VQIA 1KAAA 3A8JE 3I90A 1A3VA 2CHBD 2KCMA 3F2BA 3LNNA 4PZ6A 4K6LA 4GLXA 1EU3A 5IY0A 2KUMA 4IN3A 2JP1A 1YI2A 1PA6A 3WOFA 3FVQA 4J8QA 4A3CH 4A3JG 2BH8A 1D8LA 1UE1A 1I4GA 1O7ZA 2B2UC 4QQBX 3M4OH 1YNJD 4A4IA 4YIJA 5E4XA 4MHEA 2A6EC 1BBXC 2KHSA 4YY3L 1JJCB 4O42A 4N8X1 1LTBD 1ZYRC 1PRTF 1LACA 3I8ZA 4M8AA 1ESRA 1EIGA 4MIUA 4LF8L 3I4NH 4XYQA 3P20A 2ZJRA 2Z6KC 3AFPA 3IFTA 1JE5A 1V1PB 3QR8A 1X3EA 4RGOS 1JOOA 1U9RA 2OCEA 1STEA 1ENCA 5CV8A 3MFGA 2AQ3B 2NUCA 1Y1VH 1RODA 2RCNA 1XPRA 1D1IA 1F2LA 4JI6L 3LWEA 2QEXA 1PHJA 4KY6A 4JPBW 3HOYG 1SR3A 2KA7A 2CWPA 3QG1A 5C0XH 4BY1H 1BNZA 3KF8B 2JYOA 4K14A 1I6HB 1RHPA 2B63G 3S16H 3BJUA 4O0AA 1PH8A 1DONA 1PTOB 2OT2A 3BZKA 4IOCA 1W2BA 2NYZD 3I4OA 1IYVA 2JA7G 2GVBA 1JE4A 2LY7A 1Z6HA 4BBSG 3QIAA 2ID0A 1WTRA 1UE6A 5HY6A 4I65A 1S5DD 3VR5A 1E3PA 1CHQD 2PZTA 3H0GG 3GTMH 1FVIA 2DJGC 1KIXA 1WD1A 1Q3LA 3S1RH 1DGSA 2K5NA 3EQLC 1YZ6A 4NB3A 2LXJA 2XNAC 3T1HQ 1YVCA 1PYBA 1HXYD 3HFZB 2PW7A 1XMOQ 1XTCD 4QL5A 3M3YH 1MSGA 1TWCB 2NN6I 4LFBQ 2HD3A 4L5TA 1S3OA 1LM0A 2F0WA 3ERQA 4IOAA 2VQFQ 2RDHA 3D4DA 2JA6B 4XTCS 1KNEA 1PTOF 3M9BA 1YJ9A 3HOZH 3SDZA 2JA5H 1GUOA 2R93B 4LUOA 1FNWA 2F0EA 1CQVA 5BN4A 1ET9A 2HQLA 2WB1G 3IFDA 2O5IC 4A3FH 1HNZQ 5KNCA 4RGNA 1TS3A 5I6YA 1MJCA 5JOBA 1N33Q 3ZYYX 4IUTA 4FXGC 3RZDH 1E0BA 1RD9D 4B3RL 1KLGD 1RCVD 1BCPF 4L5QA 2A6ED 5EBCA 3HOVG 1RL2A 3FMCA 1IBLQ 1DZ1A 2WIIB 3S1NH 1ZYRD 5J22A 2LKVA 5IYCH 3D3RA 1PXUA 2IHEA 3W1BA 2F0VA 1Q46A 4EVOA 2XRSD 4OGQC 4EGVA 5IP9G 2E76C 2Q2TA 1VQPA 4OEMB 5J1ZA 5C3EH 5M5XH 4JI2Q 2XWBB 1QUQB 2SDFA 1GHJA 1ASZA 3TP6A 4A3IH 3VR4A 1SE2A 1FD7D 3NPPA 2PYKA 1IL8A 4A3BB 4FF3A 1WI5A 3NP8A 3AYHB 3KK7A 4IUPA 1CKMA 3EIVA 3H3VH 3S15H 2D5DA 5IP7H 1PTOD 3VYUA 2AHOB 3I55A 1HHVA 4LAAA 1RIPA 2BE5C 4F7XA 4K2LA 1XXGA 4YCUA 2SEBD 4KHPL 3MEFA 4XT3B 4X6AH 3MZ5A 1GJXA 3HKZE 1QVGA 3UE0A 5L37A 3HP3A 3D4RA 4JYAL 2IX0A 2A6HC 3QO2A 2EE1A 1QILA 4KI0A 1YJWA 3MTSA 4X3KA 5TSSA 4H7BA 1EWCA 4RFBA 1CSQA 3PUWA 1QCBD 2CVRA 2JA8B 2O5JC 3H15A 1SNCA 2F4VQ 1VQOA 4B9WA 1LT4D 2X6LA 4A3CG 1IBMQ 3SVMA 4NXML 2A74C 4G57A 1Q8IA 1I3QB 1VMCA 3OW2A 2F0KA 4HJ8A 4RHSA 1SNOA 5A2QE 2EYPA 1TIID 1RKNA 1LUZA 1C48A 5M5WH 2XN9C 1N34L 3I4MB 1SAPA 3H09A 3I4NG 3PIO3 4C56C 2E5LQ 1X3PA 3E0EA 1E24A 3M85A 5EPJA 2PQAA 3OTOL 2O2LD 3GTPB 2MFIA 3BYTB 3KDFB 1DM0B 1QE6A 1A2TA 3EN2A 4QY7A 5I2YA 2ZT9C 3CQZB 1Y1VG 5G3LF 1EQQA 1T9HA 4GOPA 4BBRH 1L1OA 3K7AH 3CC2A 1CQFA 3CCRA 4N9PA 2E2JB 3W5OA 1GO3E 4KHVA 4EQNA 5C0XG 2F0OA 4LF4Q 4BY1G 2F0GA 3J7A5 1Q81C 4DV0L 4OIJA 3ULLA 4GN3B 5ELBA 1SXTA 5HGQA 1PH3A 1KQSA 3ND8A 4LJZC 4XXEA 4OO1H 4QUFA 1SLJA 1AEXA 1YHQA 2KJXA 3K57A 1J9OA 2B29A 1GOZA 4CGYB 1W3SA 3KF6B 3C1FA 3S24A 2QA4A 1L0YB 1KTKA 2BE5D 3FPUB 3RLOA 1M8AA 4LFCL 1FJGQ 4ALPA 1S4ZA 2K5VA 4RGTA 2B2UA 1TWAH 2NWGA 5FLXE 4HMIA 1XNRL 1STYA 1LTAD 2E2DC 3GO5A 4IPGA 4TRDA 1G6PA 2I5LX 1NCVA 3KYHC 3NENA 2A6HD 3BDOA 3HOZG 2P5ZX 2JA5G 2R61A 1ICWA 4POFA 5FO9B 3RNUA 1TS5A 2UXDQ 4A3FG 3P7JA 1TXYA 1NMGA 2K03A 3T1YQ 4A3EB 1F9SA 1WCMH 1QZHA 1Q86C 3T16A 4H0LC 1NAPA 1XTDA 4L6TB 4X3TA 4EQ5A 1Y1WB 1TWGH 4DR6Q 1CA6A 3GTQB 2A73B 2PMZE 1DOLA 3A55A 1MHWC 4A76A 2BOSA 1I50B 1EFWA 1AH9A 3D31A 4R4TA 4LWCA 1KLUD 1V9PA 3RMHA 4OWTB 5IYCG 4K5WA 1S5FD 4JI3L 4EX5A 1STHA 1HNWQ 1G291 2Z9HA 3NQIA 2XTIA 4IJLA 2F0TA 1UUPA 4HSVA 5C4XB 1UNSA 5C3EG 3FRPB 3PSIA 4RCOA 4U68A 5FLXc 4A3IG 1VQDA 5COYA 4A3DH 4S3SA 5C3XA 1K8AC 3QWNA 1VQBA 4QMGA 4A3KB 1SNQA 1YJNA 5LMUQ 1J5EQ 5IP7G 1VQMA 2RQXA 3A56A 1ZXTA 2L55A 4MNOA 2KBNA 3OPOA 4RKLA 1KRSA 1EY4A 5LHY1 2FMCA 3PV0A 4ABNA 1K73C 1PLFA 2A1AA 2IX3A 1K9MC 4IPDA 3HKSA 1LLRD 1L2FA 2FJ2A 4RKBA 5CV9A 1TY2A 2K1BA 2WB1E 3RN2A 3MWYW 1KHIA 4LF7Q 3MFYA 1NMFA 4F8MA 5M3FH 4ZKCB 1B8AA 2F0SA 1QNUA 1EYAA 1WTOA 2HDMA 3C2PA 3PIPA 1B53A 1TR5A 1VCIA 2D9UA 2PI2A 4DAMA 2DNCA 2NZ1D 1UE5A 2RCFA 1JOKA 2ZTDA 3BG3A 4HIMA 2AQ1B 2LMCB 3OMGA 4XT1B 5IYDH 1Z47A 3DWPA 5AJ3Q 3MA2B 5EGTA 1CKNA 1N9WA 1U5KA 1PVOA 4JI8Q 4OWXB 4YWMA 2XRQD 1I94Q 1A2UA 2K5WA 1B9MA 4G7ZC 4X3UA 1QUQA 1JR0D 1ET6A 1NUCA 4TQUS 5IIFA 3IRBA 3J80c 1XNQL 1BBWA 3W1GA 3GV6A 4UY8C 4R4OA 1DOKA 1KAWA 3FPPA 1SJHD 2DY8A 4O1NA 4IUQA 4OONA 1EY8A 1CHPD 1JORA 3PO2B 1PH1A 5JPNC 4BBRG 3EVQA 2AWNA 3J7ZC 1HPCA 3GTOB 3I73A 2GVAA 3F1ZA 4CDEC 4ZYSA 3HRZC 4HAEA 2KENA 2F0JA 5CMDA 1EWIA 4LFBL 3KJOA 1X6OA 3MXGA 3MXNA 1KDBA 1TWFH 1TWHH 3S9WA 4A3LH 5JPMC 2VUMH 2JK8A 2NVXH 2GN5A 2VQFL 4Y7NB 2XIWA 4DV7Q 3CRLC 1EUJA 1OXUA 3G48A 4PZ7A 1B4OA 4IQZA 2RSOA 3HS0C 4OXPA 5EAYA 3S14H 1UE7A 1ENFA 3I91A 4OO1G 1N33L 1MJEA 2K32A 2MQHA 4GN5A 3X3MA 1U4RA 5IE8A 3ER0A 1IW7C 4IUVA 1HH2P 3E3XA 3CCJA 2F0MA 2WP8J 2B2YA 2ZM6Q 3UI2A 1JOQA 4NW2A 1EYGA 1IBLL 2OF1A 1Q82C 4J6HA 1X54A 2K04A 3GTGB 1QG7A 4A3JB 1I5FA 3TP8A 2E2HB 4JBWA 1FGBD 3LWUA 3NQTA 4F87A 1IHZA 1GUNA 2JEBI 3J81j 5C44B 1II3A 3CHBD 2Q2UA 4JI2L 4ZRZA 3H6MA 2N78A 3VYRA 3PUXA 2AMCB 4DU9A 4FF4A 1ASYA 1WCMG 3KDFA 1N36Q 4QGUA 5JJIA 5JJLA 4JV5L 5IWAQ 2ZJPA 4FYDA 4QB4A 3TREA 4DN4M 1VQHA 2YV5A 4Z9CB 1MGSA 1XPOA 2NVQB 3GTJH 4UAIA 2CCZA 3FKIB 3ONAB 2I5MX 2C35B 2DUDA 3HOYB 1FNVA 5KYIA 2F0NA 2KCTA 1V43A 1EOTA 4X66Q 3A5UA 4GOPC 4K2KA 1D7QA 5HGTA 2MUYA 4HMJA 4YCVA 5KRUA 4A3DG 1HQRD 1PRTC 4QIWB 2F1MA 3E6ZX 2JA9A 3KF6A 3Q0AA 4DF7A 4H44C 1HRJA 4BBSB 1HNXQ 1IBML 5EKIA 1PFBA 4JI4Q 1KD1C 1MSHA 3D0FA 4I7ZC 3Q23A 3E9HA 4X65L 5BR8Q 1PZJD 1CUKA 3BYYB 2Q8RE 3S17B 1PTOH 4DV4Q 2K14A 1WVLA 4C3HB 4OX9L 2NB0A 5F2DA 1WJJA 3URYA 1E1TA 1B3QA 3SR1A 1KC8C 1X65A 1CKOA 4P72A 3EA6A 4HEDA 1SJED 3L2PA 5M3FG 1PH6A 2OXPA 4NKLA 2FMMA 2Y0SE 1IW7D 4K0KL 2B3GA 5FLXL 2AQ2B 3NTHA 1K8MA 1G8ZD 1NJIC 3OYYA 1TWCH 2A5HA 4H02A 1EIYB 2CW0D 4V190 5IYDG 3RZOH 1VQAA 4LF4L 5H1SE 5KNDA 3S2HB 4YHHQ 4IURA 2EY1A 2KQ3A 3D8GA 2PNRC 2F52A 5CR3A 2H1EA 1KABA 1R9TH 3TN2A 1NSNS 3VYTA 3RLNA 3R3OA 2VQEQ 3WDNA 2EOTA 4FVMA 3BU2A 5JVG3 1D5MC 1HUMA 1PTOC 2VNUD 4R9WA 2RKSA 2IWHA 5C0XJ 1DJRD 1ONLA 2ICIA 2F0HA 1FJGL 4DUZL 2WAQB 2WFWA 4LFAQ 3SEBA 3T53B 1IBKQ 4A3LG 1BO0A 2Z8LA 3LGJA 1VQ9A 4ZKBB 2VUMG 2WINB 1HZBA 3TS0A 5LMNW 2CQOA 3PGZA 1BCPC 4DUYQ 4JI5Q 3G6JB 3CCSA 1HUNA 2HDLA 1VQ6A 2PW5A 2UXDL 5FOBB 5I4DA 1PRTD 4P73A 3HEJA 3NBHA 2RDGA 3D6CA 5E4WC 1BCPB 5D14A 4N8FA 3CCVA 3J80L 4DR6L 1RF2D 3MVVA 2EJGC 2HIVA 4ZUJA 4DAVA 3QJYA 5ELEA 5FLMH 3A7AB 2IJ0A 2BA1A 4KKUA 1C8CA 4XDXA 1AN8A 1D2BA 2I46A 3W2DA 1HR0W 3NHHA 4AYBE 3R2IA 1VQ8A 3M4OB 1FGUA 2E74C 4FF2A 4BA2I 1LT5D 1GUTA 2AUJD 3AFQA 2PPBC 1LV9A 3F2CA 3VYSA 3NSWA 1MBYA 1WTHA 1B7YB 2JA8H 4B3MQ 2EYLA 3TDQA 1SYBA 1B3AA 3CD6A 2LXKA 5I2XA 1I3QH 1LABA 3VDYA 4DFAA 1O7IA 4CKEA 5GAHC 1WTQA 3NXWA 5CV6A 5EQ0A 3PF5A 3WOEA 1BKBA 1Y1VB 4BY7B 2UUAQ 5IGBA 1QNKA 4YCWA 2G9DA 4IFDH 5D3DA 2G5DA 4KKSA 4IFDJ 3I4MH 1I4QA 1C0AA 4X64Q 2R3ZA 1EQTA 2Z6BA 4JI1Q 5C3WA 2UU9Q 1G2TA 2SOBA 1QOHA 3GTPH 3IL8A 3K5OA 4WJ3M 1IKLA 2PQEA 1FNUA 2VB3X 4FXKC 4WFN3 1I4RA 3N6RA 2ASBA 3K80C 5K36H 5C4HA 1H9SB 2AKWB 3V96A 2YYZA 3J81E 4DV6L 4DK1A 4X62Q 1K8GA 3GQBA 4JVZA 2NVTB 3T13A 4IPHA 1XMQQ 3DMUA 4HJ7A 4HJ9A 4CKCA 3K5NA 3MXPA 3PO3H 1I94L 5KYLA 1BCPD 4GN4B 2R92B 1EYDA 2JSOA 3M3YB 3GTKH 1VMPA 1STGA 4ILWA 1MIUA 3K5LA 4P74A 2B2YC 5M3MB 2IPKD 3NWTA 5J39A 2EIFA 2JA5B 4JI0Q 1IKMA 2X69A 5FKAC 1Y8PB 5GAGC 1JMCA 4A3FB 1UWVA 2DN8A 1SYCA 3F8TA 2D0PA 4DXFA 1G51A 3TZUA 3VR3A 1W6JA 2UUCL 2OWOA 1S5CD 2AWOA 1SE8A 1K83H 2EZVA 4KN7C 1EZ6A 3J81c 1D5ZC 4HR7B 1OXTA 4GNXB 1T5XD 4CJ2C 1VQKA 1NR2A 1SMYC 4DR1L 5FO8B 2WACA 2L12A 1E7ZA 1GHKA 3DM3A 1BQQT 1QVCA 2EY6A 4LW1A 1GUWA 3GTQH 2FXQA 4P75A 1PH9A 4DV3Q 1QWYA 4NXNQ 3KLRA 2I5HA 1XPUA 2HCCA 3DEOA 1TKWB 2IL8A 3AB9A 1A6XA 3S1QH 3SK6A 4X3SA 5E7NA 3KBGA 4LF9L 1M90C 2WV6D 3S2DB 3DXJC 1VQ7A 4DK3C 1Q1EA 2A8VA 3S15B 5ISRA 2F0LA 4L5RC 1EEID 2EQSA 2L4NA 1PFMA 1RDPD 3VR6A 5C4XH 1EY5A 1RJTA 2A69D 1VQ5A 3AMUA 1SYDA 2L5TA 4EQPA 1I4HA 4LF8Q 4A75A 1NTGA 3JAMc 5IOCA 3C46A 4MTNA 5E3FA 2K50A 1SYGA 4C3IB 5IWAL 3K8AA 2NN6H 2HIXA 3W3AA 1Q90A 5FLMG 1A3UA 4ZCKA 4DAYB 1I4XA 4LMQD 3K0YA 2Z4HA 3FDTA 3STBC 1X56A 5G3LD 1TU2B 5IGFA 2EXDA 5CC4A 3C3LA 4DK6C 1V1PA 4KLKA 4KK7A 5C4ZA 2VL6A 4K8IA 4X66L 2MNAA 2L0CA 1PZKD 2FINB 4Q5VA 4FP5D 3KJPA 4C3JH 2ZXOA 3GDEA 4JK1C 5ELDA 4KY5A 3OSOA 5J3BA 2X6GA 1M1KC 2J0TD 2Y0SG 5M5WB 4LUVA 3PF4A 2JA8G 1XWEA 4FNFA 5GQOA 4CDCC 3SXHA 4DR3L 2RHQB 1O78A 4B3TL 1EYCA 1SNMA 1TVXA 4WRDA 3G71A 2EJMA 3V05A 1F2YA 4JI4L 3KF8A 1HFNA 4UP8A 3NWSA 2EVBA 1LTID 5CGKA 2VB2X 5A35A 5BR8L 4RHRA 3CPWA 5C6AA 5FO7B 2EXZA 1A0IA 1D1KA 4C2MH 1STAA 2V4DA 4HIOA 4DV4L 3K7AB 4IFDG 1EEFD 4DKAC 1EY0A 2B2VA 2CKZB 3I4MG 5JAVA 1SMYD 2L15A 4R4CA 2OTLA 4A93H 2QF7A 1SNPA 3CW2C 4JBKA 1GM5A 1E2ZA 1SROA 2I07B 1U4PA 4DV2Q 2EYJA 1LTLA 2YU9B 2BDNA 3CMAA 2N88A 4IUUA 4QIWE 5LMNQ 2B2TA 4R4QA 3MXUA 2WKCA 1RTOA 5K36G 4RGMA 3GTOH 3CC7A 2EJFC 1SRUA 3J80E 4B9XA 4DR7Q 1H9RA 1OTCA 2F0IA 2OQ0A 4H13C 4CKBA 4B3RQ 4NPSA 3KLSX 4YHHL 2OTJA 4ZK9B 2LSSA 3PO3G 2F3VA 2TSSA 1NR4A 3KOJA 1WTWA 1WTVA 1QZGA 4A3GH 3S1MH 3K58A 1VDZA 4UDUC 2HQEA 3HKZB 1HR0Q 2VQEL 1SNDA 2GA4B 4QUCA 4BXXH 1S5ED 3NEMA 4KN4C 2I0QA 3HOWH 3OHXC 2EY5A 4ME5A 2KEEA 3VA7A 3Q22A 4ZQ3A 1A8VA 3HOXH 2MO1A 4GS3A 4ULLA 1VQNA 3NELA 3J81i 3TQYA 1G91A 1WCMB 2K01A 5DNFA 5BN3A 4CHTB 5I9PA 4LNQA 2QKIC 3STBD 1N8RC 3GTGH 5M9OA 1LO5D 3J7YW 1TWGB 4AYBG 2MP1A 5DLQE 2E2HH 2JE6I 1F9PA 2WKDA 2ZTCA 1HQMC 2Z0SA 3SHLA 1RTNA 5C44H 3HOUB 4DUYL 1G2SA 4KHPQ 5C4JB 4C1NK 3CCUA 4RH6A 1W6KA 3VA5A 4DR2Q 5JEAH 5IYBH 1JB7A 3I3CA 3T1HL 4AIMA 1H9SA 1XMOL 3EBEA 3M7NA 1GVPA 5EPLA 3M7GA 2RBMA 1BBUA 1DXMA 4L8JA 1QVFA 2R7DA 4A3DB 1BR9A 4WORA 3MAQA 2NVQH 3FKIH 1BUVT 4A3MB 2WAQE 2R7ZB 2EPBA 1SBBB 1XYIA 3M4YA 3GTLB 4DAPA 3H94A 1S40A 2QCPX 3M4QA 5DAUA 1SN8A 1HNZL 4KV6A 2ZTEA 4LF5Q 5D65A 2ZJQA 3OMCA 5C4XG 3I70A 4XYOA 3J81L 2N49A 4PV1C 4PMCA 1STBA 3K59A 2BH2A 3NBIA 4I7AA 1N34Q 1JICA 4B3ML 3NUCA 4L63B 1YNXA 2E2IH 2KOLA 1R4PB 4UHVA 5M5YH 1Z7TA 1WTXA 1KXLA 5ELFA 1TQOA 1EY7A 1MD2D 4IALA 2NN6G 4XIGS 3OTOQ 2CW0C 2NZHA 1KNAA 1C4QA 5CV7A 4DV1Q 2NVYH 2UUAL 3S17H 1BOSA 1XX8A 1LYLA 3NK9A 1A63A 4C3HH 5CV5A 5LL6S 2FFKB 1VQLA 2QGQA 4X64L 4RAUC 3KLWA 2VW9A 5ELNA 3OIQA 2Z4IA 5IT9E 1IL2A 1E2VA 4DNRB 5CORA 4C3JG 2UXBQ 5C5MA 5IGEA 3AEVA 1CFMA 2PI2E 2H5XA 2ZXPA 2PZWA 4R4IA 3CCEA 2YTXA 1B44D 1KDCA 1ZKOA 2DNEA 1AP0A 1PFNA 1UEAB 1GD7A 1X3QA 3JAML 2L9HA 4DGZA 1JCKB 1XMQL 1PYSB 4KKTA 2RA4A 1JWMD 2PMZB 2JQOA 3TMEA 1SMXA 3PIOA 2KCNA 2KVMA 1QJOA 3T4AC 4LFCQ 4OWWB 3TSSA 2B63B 4MN3A 4F88A 1VQJA 3D4WA 4A93G 3IKJA 5NUCA 1R4QB 1TWFB 4LF6Q 5FJ8H 2JA7B 1Q8KA 1CM9A 5DM73 2VUMB 1CSPA 1Q1BA 2NVXB 4JOIC 2F4VL 3A8KE 5DEHA 3FP9A 4WJ4A 4CJ1B 3HG9A 2MJ8A 4JI0L 4GKJQ 4JBMA 3I4LA 2UUBQ 2NTTA 2JXMB 3EROA 3H0GB 1SFOB 3OW7A 1ICFB 5IT9c 1H9JA 1CA5A 2SNSA 4DAYA 1I6HH 3E0JA 2N3SA 4Y52H 2OQKA 3H3VI 2YTYA 1IXRA 1YNNC 4JCVE 1I4PA 4P71A 1QB5D 1M4VA 3TP5A 1E2WA 3V2TA 4O2DA 1EZ8A 4E6IA 1UEBA 2E5LL 4XQJA 4A3GG 1EIFA 5KGUA 1AZPA 5DM63 3NTIA 2WB1B 1TS4A 3P75A 4WJWA 1N32Q 3DWQA 3NTKA 4BXXG 2QW7A 4ID6A 1SE4A 3CXCA 3HOWG 1HTPA 4DV3L 4GLVB 4NXNL 1F9RA 4DR5Q 4PQXA 1AFPA 3KUPA 3BVMA 5IGDA 3HOXG 1PH2A 4DA2A 1OXXK 3J80i 1WOCA 4DXGA 3HOVB 2JA6H 3KFUA 2Q8IB 4V0BA 2R93H 3RN5A 2M9VA 4U673 1SDFA 1H9MA 2QILA 2B2WC 1C9OA 4MZ9A 5C44G 2R6GA 1JWSD 2CQAA 3GTJB 1A3TA 2K75A 4AQYQ 3H91A 4BS9A 1S5BD 2KECA 1D6EC 5JEAG 4J1MA 5IYBG 1HFGA 2K28A 3DLLA 4HJAA 3BVZA 4IUNA 4RMFA 2QEJC 3UDGA 3ITPA 4HN7A 4DV5Q 4BA1I 2B2VC 1ML0D 3R93A 5HURA 2C9OA 3M4PA 4BY7H 1KDAA 2RSNA 3FKIG 1BXTA 1U4MA 2EYOA 4TVAB 4CDFC 3BZCA 4HIDA 1FL0A 4K8JA 4RWSC 1T5EA 2B2TC 1B9NA 1IYUA 1F2ZA 3T1YL 3RUZA 1G6ZA 1HA6A 4JI7Q 1EY6A 4UP9A 4A3BH 4QCLA 1NE3A 1Y8OB 4JC0A 1DYQA 2F03A 3DHQA 5IGGA 3Q8DA 1SSOA 1XNQQ 4POGA 4GKKQ 1X55A 4OO1I 2NVTH 3CMEA 4LK1C 4QJFA 2Q2IA 4K5XA 1IYJB 2PCFB 1YNND 3PIP3 3G6EA 1HNWL 1ENAA 1EOVA 4DPGA 4JG2A 5EKLA 2O4XA 4C3HG 2E8GA 3I72A 2R92H 2Q2HA 3MEHA 1GXDC 3RZOB 1OXVA 4C1NI 4PNYA 4DNIA 4ZAIA 1EQVA 5M3MH 3I4NB 1DD2A 1B70B 2A19A 4EQOA 4DV2L 3T56B 5LMUL 1J5EL 2CH4W 4PMBA 4KD4A 3SGIA 5LMNL 3C1EA 4IO9A 1Y14B 1R9TB 5GROA 1L0XB 3U9SA 4DR7L 1PDQA 2D2CC 3Q24A 4HCEA 4UP7A 1K8OA 1HZ9A 1STNA 4J15A 3N52A 3P1HA 3OWFA 4QF4A 4MTKA 4LF7L 4BY1B 3WWVA 4FF1A 2A69C 2F0FA 3PMFA 3S16B 4K5VA 1CKNB 3I56A 2VZAA 1WD0A 1VQFA 3CQZH 1HR0L 2DJFC 5FJ8G 1SEBD 4Q0FA 1CTMA 4ZUIA 1DCZA 4KHZA 5EPKA 2E2JH 2IHFA 3G7LA 1JJGA 2HHHQ 3CCLA 5AJ3L 2DGYA 3GTMB 3U58A 1HCZA 2K5QA 3S1RB 4JV5Q 3S2DH 2E75C 2A68C 2WAQG 3VR2A 4JI8L 1EWHA 1D5XC 2PNHA 2TMPA 1WYDA 3KBXA 2RF4A 3R8BA 2KHIA 1V1OA 2UXCQ 1A62A 1NY4A 2HUGA 4JBJA 1KRTA 1F2MA 2MGSA 3MXNB 3HGBA 3PUYA 1PH4A 1JB3A 4DR2L 2K5DA 4OELB 5EJWA 3HOZB 3QOJA 1DOMA 4B3SQ 4DR4Q 2Q8TA 2F0PA 3CKIB 1PH5A 4APVA 4C3IH 3ND9A 3BS1A 2Y0SB 3CP0A 4GNXC 3CPFA 1YHAA 1B1ZA 2N55A 3RZDB 2KEDA 5CBAE 1PZID 1SE3A 3ULJA 2NBFA 5IT9L 2JA6G 3JAME 3TRZA 4DV7L 3J7AF 3L0OA 5C5LA 2EDGA 1AZQA 2R93G 4FDBA 3S1NB 2JEAI 4HTHA 4IZ8A 4X65Q 4A3EH 3A54A 2L11A 3MHBA 3CU7A 1AE3A 4LF5L 2R7FA 4NMZA 1U0LA 1VQEA 1Y1WH 3SK5A 4OX9Q 5T1GA 5C3EB 5M5XB 2FHTA 1IZ6A 3MC0B 2B8GA 3H3VC 4A3IB 3A5ZB 2ZM6L 1I50H 4NDXA 4JOIA 3DWAA 3DUZA 2CWAA 4K0KQ 2LS01 4BY7G 3OIPA 4DV1L 3L9AX 5KNBA 3SK8A 4ODGA 2H4OA 2XWJB 3ERSX 5LL6X 3CCMA 2KCCA 3UDXA 4YY3Q 3CCQA 1LTGD 1AW7A 1WFQA 2KHJA 1Y8NB 5I6WA 1EY9A 2XGTA 2J7ZA 1X3GA 1N36L 2MHVA 4A3KH 2YU9H 4A3BG 2UXBL 3PO3B 3A0JA 2ICEC 1CT1D 1PYWD 3GTKB 3K7UC 3HZXA 4NP5A 1LT3D 2F4IA 2D0OA 1CZWA 3CAMA 3EJIA 2A68D 4AH6A 4JI6Q 1VF5C 1H9KA 2RVLA 1VQCA 2F0UA 2G9HD 2CFMA 3PQIA 2K05A 2NTSA 1YHBA 3FHWA 2ATWA 2HCIA 1VF7A 4R1JA 1EU4A 1JC7A 4DUZQ 2R92G 3BVGA 4AYBB 4G7OC 3ZJYC 3ULPA 2IX1A 1B50A 5IGCA 2C5CA 1K83B 4LF6L 5M3MG 3PUVA 4TKOB 1V1QA 2B2WA 4CJ0B 2OEOA 3F2UA 1J6QA 2QDLA 3K5MA 1HNXL 1Q12A 3FEWX 4RA8A 5ELOA 3TBIB 4L5SA 1PV4A 4GKJL 1O7LA 2UUBL 2F0DA 3PUZA 1E22A 2Z6KA 2IY5B 1PH7A 1E1OA 1AE2A 2PZUA 3K6OA 3UDIA 2K4KA 4BBRB 1OO9B 4FXDA 1LTRD 1EIHA 5JJZA 4HSPA 2MPMA 4HJ5A 3Q6SA 4FO2A 1XJVA 5E1FA 3HOUH 1B2TA 1YBYA 3EFXD 1PFSA 2CH4A 3S1QB 5C4JH 5EKKA 2M00A 5JVH3 2L1BA 1K0SA 5ELCA 4TSSA 3DEPA 4KD3A 3PO2H 4OIKA 3K0XA 3A7LA 1YITA 1HZCA 2EYHA 1N32L 3A8IE 4DR5L 5GAEC 2ES2A 3GV3A 4UPAA 1V8QA 2VY3A 3R2TA 3TS2A 4GLAC 1HJPA 1P8LA 3AU7A 2ALYB 5D3IB 4OHJA 4A3MH 2R7ZH 1L0WA 4Y7NH 3CC4A 3E9IA 2EYMA 2K33A 3UE1A 3GTLH 4IJHA 2RDFA 1VS0A 1Z9FA 1I6VC 3UDFA 2IT1A 1TWAB 1OXSC 3JC66 4PZ8A 1EL0A 1K3RA 1GKHA 4AQYL 5CV4A 1MKHA 3I7FA 1EFID 1GUSA 3L3OC 4C3IG 1FYCA 3GD7A 4C3JB 4XQNA 4DV5L 3QB3A 1TS2A 2M2LA 2SNMA 4A3JH 2N8NA 5K5PA 3NBHB 4ZLTF 1TT2A 4JW0A 1Y69U 4LFAL 1IBKL 3QOLA 1O80A 4GZYC 4DV6Q 1GUGA 1O7YA 4DNTB 2K6AA 2HT1A 4JI5L 1P16A 3KLSA 3D6WA 4A3EG 5BN5A 1EQRA 1K3BC 1ZEQX 4JI7L 1S72A 5JEAJ 4KJOA 4C2MB 2BDOA 2YTVA 4K6DA 2BA0A 4JYAQ 1Y1WG 5CYUA 3L7ZC 1BF4A 1NNXA 1CZGA 1K28A 2D62A 2NZOA 1SYEA 4A93B 2K52A 2RHSB 2K5HA 1JT8A 4GKKL 3TP7A 3HOYH 2AUKA 4NXMQ 1JWUD 1F9QA 5C0XI 3JAMi 3F2DA 4CBVA 1K0RA 1YIJA 2B63H 4R8NA 1LT6D 2UUCQ 4R8IA 3LX0A 1A15A 1F77A 3IAYA 2JA7H 1VQ4A 1HZAA 3TEHB 2Z1CA 4A3KG 4BBSH 1JQYD 4HCSA 3SK4A 2VS1A 3OWEB 3GP7A 3ICEA 3CRKC 3RLFA 3X3NA 3G4SA 5M3FB 4DR1Q 2JJQA 4A3GB 2J4XA 2F3WA 3S1MB 3H0GH 1SFOH 3BDCA 3O13A 3J7AV 3PCOB 1ILQA 1LTSD 1YEZA 1LTTD 1SYFA 3HOWB 3RD4A 1J8IA 5GADC 3BDLA 5I9OA 4P2CB 4PMWA 4GNXA 4KY7A 4CDDC 1YNJC 3HOXB 4HIKA 1TY0A 1H95A 4DK0A 4KTAA 3U50C 1CI3M 4JI1L 4LF9Q 2UU9L 1C7YA 5EBDA 4DV0Q 5AFWA 3OOCA 1Q7YC 3HKZG 2XSCA 3DM1A 1U4LA 3A74A 4RCNA
chains in the Genus database with same CATH topology
2LFNA 2PO4A 1CK1A 5IODA 2IW3A 4B08A 1UAPA 2B39A 4BWGB 3T51B 5KIXA 5A2QL 4N9TA 4KMUC 3U9OA 4XQQA 5FK9C 2B8FA 4G4KA 1BDOA 2BCOA 1TWHB 2F0QA 2DY7A 4M1UB 1PMRA 2QDBA 4IFDI 2XVSA 1ESFA 4OL7A 1ILPA 2VXWA 5KEEA 5CBEE 3S14B 1HTLD 1FR3A 2EYFA 1WTPA 1MI2A 3NE5B 5T1IA 1X32A 2E2IB 3SE0A 1HA5A 3E5SA 3BZDB 5M5YB 4G7HC 2ZXRA 2K7VA 1PRTB 3TZDA 4KJNA 2ENBA 2EY2A 2NVYB 1KAAA 3A8JE 3I90A 1A3VA 2CHBD 3LNNA 4K6LA 1EU3A 2KUMA 4IN3A 2JP1A 3WOFA 3FVQA 4J8QA 1I4GA 1O7ZA 2B2UC 1YNJD 4YIJA 5E4XA 4MHEA 2A6EC 1BBXC 2KHSA 4O42A 1LTBD 1ZYRC 1PRTF 1LACA 3I8ZA 4M8AA 1ESRA 1EIGA 4MIUA 4XYQA 3P20A 3IFTA 1V1PB 4RGOS 1JOOA 1U9RA 1STEA 1ENCA 5CV8A 3MFGA 2AQ3B 2NUCA 1RODA 1D1IA 1F2LA 3LWEA 4KY6A 2KA7A 3QG1A 5C0XH 1BNZA 2JYOA 4K14A 1I6HB 1RHPA 1DONA 1PTOB 2OT2A 2NYZD 1IYVA 1JE4A 2LY7A 1Z6HA 3QIAA 2ID0A 1WTRA 4I65A 1S5DD 3VR5A 1CHQD 2PZTA 1WD1A 1Q3LA 3EQLC 2XNAC 1HXYD 2PW7A 1XTCD 1MSGA 1TWCB 2NN6I 2F0WA 3ERQA 2RDHA 3D4DA 2JA6B 4XTCS 1PTOF 1KNEA 3SDZA 1GUOA 2R93B 1FNWA 2F0EA 1CQVA 5BN4A 1ET9A 3IFDA 2O5IC 5KNCA 4RGNA 1TS3A 5I6YA 5JOBA 3ZYYX 4IUTA 4FXGC 1E0BA 1RD9D 1KLGD 1RCVD 1BCPF 2A6ED 5EBCA 3FMCA 1DZ1A 2WIIB 1ZYRD 5J22A 2LKVA 3D3RA 1PXUA 2F0VA 4EVOA 2XRSD 4OGQC 4EGVA 2E76C 5J1ZA 2XWBB 2SDFA 1GHJA 3TP6A 3VR4A 1SE2A 1FD7D 3NPPA 2PYKA 1IL8A 4A3BB 4FF3A 3NP8A 3KK7A 4IUPA 2D5DA 1PTOD 3VYUA 1HHVA 4LAAA 2BE5C 4F7XA 4K2LA 1XXGA 2SEBD 4XT3B 3MZ5A 1GJXA 3HP3A 3D4RA 2IX0A 2A6HC 3QO2A 2EE1A 1QILA 4KI0A 3MTSA 4X3KA 5TSSA 4H7BA 1EWCA 4RFBA 3PUWA 1QCBD 2CVRA 2JA8B 2O5JC 1SNCA 4B9WA 1LT4D 2X6LA 3SVMA 2A74C 4G57A 1Q8IA 1I3QB 1VMCA 2F0KA 4RHSA 1SNOA 5A2QE 2EYPA 1TIID 1RKNA 1C48A 2XN9C 3I4MB 1SAPA 3H09A 3PIO3 4C56C 1X3PA 3M85A 5EPJA 3GTPB 2O2LD 3BYTB 1DM0B 1QE6A 1A2TA 5I2YA 2ZT9C 3CQZB 5G3LF 1CQFA 2E2JB 4N9PA 4KHVA 4EQNA 5C0XG 2F0OA 2F0GA 4OIJA 5ELBA 1SXTA 3ND8A 4LJZC 4XXEA 4OO1H 4QUFA 1AEXA 2KJXA 3K57A 1J9OA 1GOZA 4CGYB 3C1FA 1L0YB 1KTKA 2BE5D 3FPUB 1M8AA 1S4ZA 4RGTA 2B2UA 2NWGA 5FLXE 4HMIA 1STYA 1LTAD 2E2DC 3GO5A 4TRDA 1NCVA 2A6HD 3BDOA 2R61A 1ICWA 5FO9B 1TS5A 3P7JA 2K03A 4A3EB 1F9SA 3T16A 4H0LC 1NAPA 4L6TB 4X3TA 1Y1WB 1CA6A 3GTQB 2A73B 1DOLA 3A55A 2BOSA 1I50B 3D31A 1KLUD 3RMHA 4K5WA 1S5FD 1STHA 1G291 3NQIA 2F0TA 1UUPA 4HSVA 5C4XB 1UNSA 3FRPB 4RCOA 4U68A 5COYA 4S3SA 5C3XA 3QWNA 4QMGA 4A3KB 1SNQA 2RQXA 3A56A 1ZXTA 2L55A 3OPOA 4RKLA 1EY4A 5LHY1 2FMCA 3PV0A 4ABNA 1PLFA 2IX3A 1LLRD 4RKBA 2FJ2A 5CV9A 1TY2A 2K1BA 3MWYW 3MFYA 4F8MA 4ZKCB 2F0SA 1QNUA 1EYAA 1WTOA 2HDMA 3C2PA 1B53A 1TR5A 1VCIA 2D9UA 2DNCA 2NZ1D 1JOKA 3BG3A 2AQ1B 2LMCB 3OMGA 4XT1B 1Z47A 3DWPA 3MA2B 5EGTA 2XRQD 1A2UA 2K5WA 1B9MA 4G7ZC 4X3UA 1JR0D 1ET6A 1NUCA 4TQUS 5IIFA 3GV6A 1DOKA 3FPPA 1SJHD 2DY8A 4O1NA 4IUQA 1EY8A 1CHPD 1JORA 3PO2B 5JPNC 3EVQA 2AWNA 1HPCA 3GTOB 3I73A 4ZYSA 3HRZC 4HAEA 5CMDA 2F0JA 3MXGA 3S9WA 1KDBA 3MXNA 5JPMC 4Y7NB 2XIWA 3CRLC 1OXUA 1B4OA 4IQZA 2RSOA 3HS0C 1ENFA 3I91A 4OO1G 2K32A 3X3MA 1U4RA 1IW7C 4IUVA 2F0MA 2WP8J 2B2YA 3UI2A 1JOQA 4NW2A 2OF1A 4J6HA 2K04A 3GTGB 1QG7A 4A3JB 3TP8A 2E2HB 4JBWA 1FGBD 3LWUA 3NQTA 4F87A 1IHZA 1GUNA 2JEBI 5C44B 1II3A 3CHBD 4ZRZA 3H6MA 3VYRA 3PUXA 4DU9A 4FF4A 4FYDA 4QB4A 4DN4M 4Z9CB 1MGSA 2NVQB 4UAIA 3FKIB 3ONAB 3HOYB 1FNVA 5KYIA 2F0NA 1V43A 1EOTA 4K2KA 5HGTA 2MUYA 4HMJA 5KRUA 1HQRD 1PRTC 4QIWB 2F1MA 3E6ZX 3Q0AA 4DF7A 4H44C 1HRJA 4BBSB 5EKIA 1PFBA 1MSHA 4I7ZC 3Q23A 1PZJD 3BYYB 2Q8RE 3S17B 1PTOH 1WVLA 4C3HB 2NB0A 5F2DA 3URYA 3SR1A 3EA6A 4HEDA 1SJED 2OXPA 4NKLA 2FMMA 1IW7D 5FLXL 2AQ2B 3NTHA 1K8MA 1G8ZD 2A5HA 2CW0D 4V190 5KNDA 3S2HB 4IURA 2EY1A 2KQ3A 3D8GA 2PNRC 5CR3A 2H1EA 1KABA 3TN2A 1NSNS 3VYTA 3R3OA 3WDNA 2EOTA 4FVMA 5JVG3 1D5MC 1HUMA 1PTOC 2VNUD 4R9WA 2RKSA 2IWHA 5C0XJ 1DJRD 1ONLA 2ICIA 2F0HA 2WAQB 3SEBA 3T53B 1BO0A 2Z8LA 4ZKBB 2WINB 1BCPC 3G6JB 1HUNA 2HDLA 2PW5A 5FOBB 5I4DA 1PRTD 3HEJA 3NBHA 2RDGA 3D6CA 5E4WC 1BCPB 5D14A 3J80L 1RF2D 3MVVA 2EJGC 4ZUJA 4DAVA 3QJYA 5ELEA 3A7AB 2IJ0A 2BA1A 4KKUA 1C8CA 4XDXA 1AN8A 1D2BA 2I46A 3W2DA 3NHHA 3R2IA 3M4OB 2E74C 4FF2A 4BA2I 1LT5D 1GUTA 2AUJD 2PPBC 1LV9A 3VYSA 3NSWA 1MBYA 2EYLA 3TDQA 1SYBA 1B3AA 5I2XA 1LABA 4DFAA 4CKEA 1WTQA 3NXWA 5CV6A 5EQ0A 3WOEA 1Y1VB 4BY7B 5IGBA 1QNKA 2G9DA 4IFDH 5D3DA 4KKSA 4IFDJ 1I4QA 2R3ZA 1EQTA 5C3WA 1G2TA 2SOBA 1QOHA 3IL8A 3K5OA 1IKLA 2PQEA 1FNUA 2VB3X 4FXKC 4WFN3 1I4RA 3N6RA 5K36H 5C4HA 1H9SB 3V96A 2YYZA 3J81E 4DK1A 3GQBA 2NVTB 3T13A 3DMUA 4CKCA 3K5NA 3MXPA 5KYLA 1BCPD 2R92B 1EYDA 2JSOA 3M3YB 1VMPA 1STGA 4ILWA 3K5LA 2B2YC 5M3MB 2IPKD 3NWTA 5J39A 2JA5B 1IKMA 2X69A 5FKAC 1Y8PB 4A3FB 2DN8A 1SYCA 4DXFA 3TZUA 3VR3A 1W6JA 1S5CD 2AWOA 2EZVA 4KN7C 1EZ6A 1D5ZC 4HR7B 1OXTA 1T5XD 4CJ2C 1NR2A 1SMYC 5FO8B 2WACA 2L12A 1GHKA 1BQQT 2EY6A 1GUWA 1QWYA 3KLRA 2HCCA 3DEOA 1TKWB 2IL8A 3AB9A 1A6XA 3SK6A 4X3SA 3KBGA 2WV6D 3S2DB 3DXJC 1Q1EA 3S15B 5ISRA 2F0LA 1EEID 2L4NA 1PFMA 1RDPD 3VR6A 1EY5A 1RJTA 2A69D 3AMUA 1SYDA 2L5TA 4EQPA 1I4HA 5IOCA 3C46A 5E3FA 1SYGA 4C3IB 2NN6H 3W3AA 1Q90A 1A3UA 1I4XA 4LMQD 3K0YA 2Z4HA 3FDTA 5G3LD 1TU2B 5IGFA 5CC4A 3C3LA 1V1PA 4KK7A 5C4ZA 4K8IA 2L0CA 1PZKD 2FINB 4Q5VA 4FP5D 2ZXOA 4JK1C 5ELDA 4KY5A 3OSOA 2X6GA 2J0TD 5M5WB 1XWEA 4FNFA 3SXHA 1O78A 1EYCA 1SNMA 1TVXA 4WRDA 2EJMA 3V05A 1F2YA 3KF8A 1HFNA 3NWSA 2EVBA 1LTID 5CGKA 2VB2X 5A35A 4RHRA 5C6AA 5FO7B 2EXZA 1D1KA 1STAA 2V4DA 3K7AB 4IFDG 1EEFD 1EY0A 2B2VA 5JAVA 1SMYD 2QF7A 1SNPA 1E2ZA 2I07B 1U4PA 2EYJA 2YU9B 2BDNA 2N88A 4IUUA 2B2TA 3MXUA 2WKCA 1RTOA 5K36G 4RGMA 2EJFC 3J80E 4B9XA 1H9RA 2F0IA 4CKBA 4H13C 3KLSX 4ZK9B 2F3VA 2TSSA 1NR4A 1WTWA 1WTVA 3K58A 1VDZA 4UDUC 2HQEA 3HKZB 1SNDA 2GA4B 4QUCA 1S5ED 4KN4C 3OHXC 2EY5A 4ME5A 2KEEA 3VA7A 3Q22A 4ZQ3A 4ULLA 1G91A 1WCMB 2K01A 5DNFA 5BN3A 5I9PA 4CHTB 2QKIC 5M9OA 1LO5D 3J7YW 1TWGB 2MP1A 2JE6I 1F9PA 2WKDA 1HQMC 3SHLA 1RTNA 3HOUB 1G2SA 5C4JB 4C1NK 4RH6A 1W6KA 3VA5A 5JEAH 3I3CA 1H9SA 3M7NA 5EPLA 3M7GA 2RBMA 4L8JA 1DXMA 4A3DB 1BR9A 4WORA 3MAQA 1BUVT 4A3MB 2R7ZB 2EPBA 1SBBB 1XYIA 3M4YA 3GTLB 4DAPA 3H94A 2QCPX 5DAUA 4KV6A 5D65A 3OMCA 3I70A 4XYOA 3J81L 4PV1C 4PMCA 1STBA 3K59A 3NBIA 1JICA 3NUCA 4L63B 2KOLA 1R4PB 1Z7TA 1WTXA 5ELFA 1TQOA 1EY7A 1MD2D 4IALA 2NN6G 4XIGS 2CW0C 1KNAA 1C4QA 5CV7A 1BOSA 1XX8A 3NK9A 5CV5A 5LL6S 2FFKB 4RAUC 3OIQA 2Z4IA 5IT9E 1E2VA 4DNRB 5CORA 4C3JG 5C5MA 5IGEA 1CFMA 2ZXPA 2PZWA 1B44D 1KDCA 1ZKOA 2DNEA 1AP0A 1PFNA 1UEAB 1X3QA 3JAML 2L9HA 4DGZA 1JCKB 4KKTA 2RA4A 1JWMD 2PMZB 3TMEA 2KCNA 2KVMA 1QJOA 3T4AC 3TSSA 2B63B 4MN3A 4F88A 3D4WA 3IKJA 5NUCA 1R4QB 1TWFB 2JA7B 1CM9A 5DM73 2VUMB 1Q1BA 2NVXB 3A8KE 5DEHA 4CJ1B 3HG9A 2MJ8A 3I4LA 2NTTA 2JXMB 3EROA 3H0GB 1SFOB 3OW7A 1H9JA 1CA5A 2SNSA 4DAYA 3E0JA 1YNNC 1I4PA 1QB5D 1M4VA 3TP5A 1E2WA 3V2TA 1EZ8A 4E6IA 4XQJA 5KGUA 1AZPA 5DM63 3NTIA 2WB1B 1TS4A 3P75A 4WJWA 3DWQA 3NTKA 4ID6A 1SE4A 1HTPA 1F9RA 4PQXA 1AFPA 3KUPA 3BVMA 5IGDA 4DA2A 1OXXK 4DXGA 3HOVB 2Q8IB 4V0BA 2M9VA 4U673 1SDFA 1H9MA 2QILA 2B2WC 2R6GA 1JWSD 2CQAA 3GTJB 1A3TA 3H91A 4BS9A 1S5BD 2KECA 1D6EC 5JEAG 4J1MA 1HFGA 2K28A 3BVZA 4IUNA 2QEJC 3ITPA 4HN7A 4BA1I 2B2VC 1ML0D 3R93A 5HURA 2C9OA 1KDAA 2RSNA 1BXTA 1U4MA 2EYOA 4K8JA 4RWSC 1T5EA 2B2TC 1B9NA 1IYUA 1F2ZA 3RUZA 1G6ZA 1HA6A 1EY6A 4QCLA 1Y8OB 1DYQA 2F03A 3DHQA 5IGGA 1SSOA 4OO1I 4LK1C 4K5XA 2PCFB 1YNND 3PIP3 1ENAA 5EKLA 2O4XA 4C3HG 3I72A 3MEHA 1GXDC 3RZOB 1OXVA 4C1NI 4PNYA 4ZAIA 1EQVA 3I4NB 1DD2A 4EQOA 3T56B 4PMBA 4KD4A 3C1EA 1R9TB 1L0XB 3U9SA 1PDQA 2D2CC 3Q24A 4HCEA 1K8OA 1STNA 3N52A 3P1HA 3OWFA 4QF4A 4BY1B 4FF1A 2A69C 2F0FA 3PMFA 3S16B 4K5VA 1WD0A 1SEBD 4Q0FA 1CTMA 4ZUIA 1DCZA 4KHZA 5EPKA 3G7LA 3GTMB 1HCZA 2K5QA 3S1RB 2E75C 2A68C 3VR2A 1EWHA 1D5XC 2TMPA 3KBXA 3R8BA 1V1OA 2HUGA 1F2MA 2MGSA 3PUYA 3HGBA 1JB3A 2K5DA 5EJWA 3HOZB 3QOJA 1DOMA 2Q8TA 2F0PA 3CKIB 3ND9A 3BS1A 2Y0SB 2N55A 1B1ZA 3RZDB 2KEDA 5CBAE 1PZID 1SE3A 2NBFA 5IT9L 3JAME 3J7AF 5C5LA 2EDGA 1AZQA 3S1NB 2JEAI 4HTHA 4IZ8A 3A54A 2L11A 3MHBA 3CU7A 4NMZA 3SK5A 5T1GA 5C3EB 5M5XB 2FHTA 3MC0B 2B8GA 3H3VC 4A3IB 4NDXA 3DWAA 3DUZA 2LS01 3OIPA 3L9AX 5KNBA 3SK8A 4ODGA 2H4OA 2XWJB 5LL6X 2KCCA 1LTGD 1AW7A 1Y8NB 5I6WA 1EY9A 2J7ZA 2MHVA 3PO3B 2ICEC 1CT1D 1PYWD 3GTKB 3HZXA 4NP5A 1LT3D 2F4IA 1CZWA 3EJIA 2A68D 1VF5C 1H9KA 2RVLA 2F0UA 2G9HD 2K05A 2NTSA 2HCIA 1VF7A 1EU4A 1JC7A 3BVGA 4AYBB 4G7OC 2IX1A 1B50A 5IGCA 2C5CA 1K83B 3PUVA 4TKOB 2B2WA 4CJ0B 2OEOA 3F2UA 3K5MA 1Q12A 3FEWX 4RA8A 3TBIB 1O7LA 2F0DA 3PUZA 2PZUA 3K6OA 4BBRB 1OO9B 4FXDA 1LTRD 1EIHA 5JJZA 4HSPA 2MPMA 3Q6SA 4FO2A 5E1FA 1B2TA 3EFXD 3S1QB 5EKKA 2M00A 5JVH3 2L1BA 5ELCA 4TSSA 3DEPA 4KD3A 4OIKA 3A7LA 2EYHA 3A8IE 3GV3A 1V8QA 3R2TA 3AU7A 5D3IB 4OHJA 2EYMA 2K33A 2RDFA 1I6VC 2IT1A 1TWAB 1OXSC 1EL0A 5CV4A 1EFID 1GUSA 3L3OC 4C3IG 1FYCA 3GD7A 4C3JB 4XQNA 3QB3A 1TS2A 2M2LA 2SNMA 5K5PA 4ZLTF 1TT2A 1Y69U 3QOLA 1O80A 4GZYC 1GUGA 1O7YA 4DNTB 2K6AA 3KLSA 3D6WA 5BN5A 1ZEQX 5JEAJ 4KJOA 4C2MB 2BDOA 4K6DA 2BA0A 5CYUA 3L7ZC 1BF4A 1CZGA 2D62A 1SYEA 4A93B 3TP7A 2AUKA 1JWUD 1F9QA 5C0XI 4CBVA 4R8NA 1LT6D 4R8IA 3LX0A 1A15A 1F77A 3IAYA 2Z1CA 1JQYD 4HCSA 3SK4A 3OWEB 3GP7A 3CRKC 3RLFA 3X3NA 5M3FB 4A3GB 2J4XA 2F3WA 3S1MB 3BDCA 3O13A 3J7AV 1ILQA 1LTSD 1LTTD 1SYFA 3HOWB 3RD4A 1J8IA 3BDLA 5I9OA 4P2CB 4PMWA 4KY7A 1YNJC 3HOXB 1TY0A 4DK0A 4KTAA 1CI3M 5EBDA 5AFWA 3OOCA 2XSCA 3DM1A 1U4LA 4RCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CM9 A;  2RVL A;  3KBX A;  2B2T C;  3I91 A;  1HFN A;  2M2L A;  1G6Z A;  1HA6 A;  4HED A;  4ZLT F;  1ZXT A;  1U4R A;  2K05 A;  4CJ1 B;  2MJ8 A;  5EPL A;  4IUV A;  2HUG A;  1O80 A;  2FMM A;  2HCI A;  1LV9 A;  4OIJ A;  4CJ2 C;  2MGS A;  1O7Y A;  2B2Y A;  2SDF A;  3UI2 A;  1NR2 A;  4NW2 A;  5EJW A;  1CA5 A;  2B2V A;  1ROD A;  2EPB A;  1PLF A;  1DOM A;  2L12 A;  1B50 A;  1SSO A;  1XYI A;  1F2L A;  2K04 A;  2Q8T A;  1QG7 A;  3LWE A;  2FJ2 A;  3D6W A;  1IL8 A;  2K1B A;  1GUW A;  2B2W A;  4CJ0 B;  1B3A A;  3MWY W;  4IUP A;  3F2U A;  1U4P A;  4QUF A;  5D65 A;  2BDN A;  4RA8 A;  1WTQ A;  5EQ0 A;  1J9O A;  4ZKC B;  2HCC A;  2N55 A;  3DEO A;  4IUR A;  2DY7 A;  1BF4 A;  1BNZ A;  2KED A;  5CBA E;  2JYO A;  1WTO A;  2N88 A;  1HHV A;  2HDM A;  1QNK A;  2IL8 A;  1RHP A;  4IUU A;  2B2T A;  1JIC A;  1ILP A;  1DON A;  1B53 A;  1RTO A;  4X3S A;  1AZP A;  2H1E A;  2NYZ D;  4RWS C;  2D9U A;  2KOL A;  2VXW A;  3FPU B;  2NZ1 D;  1M8A A;  1AZQ A;  3TN2 A;  1S4Z A;  2R3Z A;  4XT3 B;  1JE4 A;  4ZAI A;  5CBE E;  5JJZ A;  1EQT A;  1WTX A;  2MPM A;  1EIH A;  2B2U A;  4XT1 B;  2NWG A;  1WTP A;  2L11 A;  2EOT A;  1MI2 A;  1G2T A;  3Q6S A;  2L4N A;  1KNA A;  1F9R A;  1PFM A;  1WTR A;  3HP3 A;  1F9Q A;  5T1I A;  1B2T A;  1RJT A;  1HUM A;  3IL8 A;  3KUP A;  2EE1 A;  3QO2 A;  4DN4 M;  1X32 A;  1NCV A;  4ZK9 B;  1IKL A;  3MTS A;  4X3K A;  4R9W A;  1XX8 A;  5T1G A;  1NR4 A;  2L1B A;  1MGS A;  1Q3L A;  1WD1 A;  2FHT A;  1ICW A;  1WTW A;  1WTV A;  2CVR A;  4UAI A;  3ONA B;  2FFK B;  4R8I A;  3P7J A;  3DEP A;  1A15 A;  2K03 A;  4RAU C;  1F9S A;  4X3U A;  3TZD A;  4OIK A;  1NAP A;  1SDF A;  1MSG A;  2X6L A;  1PDQ A;  3SVM A;  1EOT A;  4QUC A;  4X3T A;  1BO0 A;  4HCS A;  4ZKB B;  3GV6 A;  1CA6 A;  5COR A;  2B2W C;  2KEE A;  1DOK A;  3GV3 A;  3N52 A;  1VMC A;  2DY8 A;  3I90 A;  1DOL A;  4IUQ A;  4LMQ D;  1KNE A;  1ILQ A;  3FDT A;  3H91 A;  1G91 A;  2K01 A;  2HDL A;  5DNF A;  1HUN A;  2KEC A;  3IFD A;  1VMP A;  1AP0 A;  1WD0 A;  1PFN A;  1HRJ A;  1HFG A;  1SAP A;  2K28 A;  2KUM A;  1X3Q A;  4HAE A;  5E4W C;  5CMD A;  1J8I A;  2JP1 A;  2L9H A;  2MP1 A;  5D14 A;  2J7Z A;  5EKI A;  1PFB A;  2B2Y C;  1F9P A;  5EPK A;  2FIN B;  1MSH A;  2B2V C;  1ML0 D;  3G7L A;  2RA4 A;  1O7Z A;  2B2U C;  3R93 A;  1RTN A;  1X3P A;  4IUT A;  4HSV A;  1EL0 A;  5EPJ A;  1E0B A;  5E4X A;  2X6G A;  1G2S A;  4MHE A;  1IKM A;  2X69 A;  2XIW A;  1BBX C;  2KVM A;  2Q8R E;  2RSN A;  4U68 A;  5AFW A;  1QE6 A;  4O42 A;  1C8C A;  1WVL A;  1U4M A;  5COY A;  4MN3 A;  1B4O A;  4XDX A;  1DZ1 A;  3I8Z A;  2RSO A;  1ESR A;  1EIG A;  3DM1 A;  1U4L A;  1TVX A;  3I3C A; 
#chains in the Genus database with same CATH topology
 2JN4 A;  2LFN A;  2PO4 A;  1CK1 A;  4X62 L;  5IOD A;  3U4Z A;  2HHH L;  2IW3 A;  3U4V A;  4B08 A;  1UAP A;  2B39 A;  1BVS A;  4BWG B;  3S2H H;  3T51 B;  5KIX A;  3HOV H;  5A2Q L;  4YWK A;  4N9T A;  1VQG A;  5JJK A;  2MO0 A;  4KMU C;  3U9O A;  4XQQ A;  5FK9 C;  2B8F A;  4G4K A;  1BDO A;  3HOU G;  1XNR Q;  2BCO A;  2UXC L;  1TWH B;  2F0Q A;  5IP9 H;  4ME3 A;  2F3I A;  1KL9 A;  2DY7 A;  4LUZ A;  1PMR A;  2QDB A;  4M1U B;  4IFD I;  2XVS A;  1ESF A;  4OL7 A;  1ILP A;  2V1C C;  2VXW A;  4B3S L;  4DR4 L;  3PO2 G;  3AQQ A;  1NBW A;  5KEE A;  5CBE E;  1L1O C;  3S14 B;  1HTL D;  1FR3 A;  2PQA B;  2EYF A;  1WTP A;  1MI2 A;  3NE5 B;  4IPC A;  5T1I A;  4DR3 Q;  1X32 A;  4GOP B;  3B6Y A;  4B3T Q;  3K81 C;  1L1O B;  3SE0 A;  3CF5 A;  2E2I B;  1HA5 A;  3E5S A;  4YWL A;  3BZD B;  4A3M G;  2R7Z G;  1X3F A;  5M5Y B;  4G7H C;  2ZXR A;  2K7V A;  4RG1 A;  1PRT B;  3RR5 A;  1JJ2 A;  3TZD A;  4KJN A;  2ENB A;  4JI3 Q;  1X9N A;  4PG3 A;  2EY2 A;  2NVY B;  3I2Z A;  1VQI A;  1KAA A;  3A8J E;  3I90 A;  1A3V A;  2CHB D;  2KCM A;  3F2B A;  3LNN A;  4PZ6 A;  4K6L A;  4GLX A;  1EU3 A;  5IY0 A;  2KUM A;  4IN3 A;  2JP1 A;  1YI2 A;  1PA6 A;  3WOF A;  3FVQ A;  4J8Q A;  4A3C H;  4A3J G;  2BH8 A;  1D8L A;  1UE1 A;  1I4G A;  1O7Z A;  2B2U C;  4QQB X;  3M4O H;  1YNJ D;  4A4I A;  4YIJ A;  5E4X A;  4MHE A;  2A6E C;  1BBX C;  2KHS A;  4YY3 L;  1JJC B;  4O42 A;  4N8X 1;  1LTB D;  1ZYR C;  1PRT F;  1LAC A;  3I8Z A;  4M8A A;  1ESR A;  1EIG A;  4MIU A;  4LF8 L;  3I4N H;  4XYQ A;  3P20 A;  2ZJR A;  2Z6K C;  3AFP A;  3IFT A;  1JE5 A;  1V1P B;  3QR8 A;  1X3E A;  4RGO S;  1JOO A;  1U9R A;  2OCE A;  1STE A;  1ENC A;  5CV8 A;  3MFG A;  2AQ3 B;  2NUC A;  1Y1V H;  1ROD A;  2RCN A;  1XPR A;  1D1I A;  1F2L A;  4JI6 L;  3LWE A;  2QEX A;  1PHJ A;  4KY6 A;  4JPB W;  3HOY G;  1SR3 A;  2KA7 A;  2CWP A;  3QG1 A;  5C0X H;  4BY1 H;  1BNZ A;  3KF8 B;  2JYO A;  4K14 A;  1I6H B;  1RHP A;  2B63 G;  3S16 H;  3BJU A;  4O0A A;  1PH8 A;  1DON A;  1PTO B;  2OT2 A;  3BZK A;  4IOC A;  1W2B A;  2NYZ D;  3I4O A;  1IYV A;  2JA7 G;  2GVB A;  1JE4 A;  2LY7 A;  1Z6H A;  4BBS G;  3QIA A;  2ID0 A;  1WTR A;  1UE6 A;  5HY6 A;  4I65 A;  1S5D D;  3VR5 A;  1E3P A;  1CHQ D;  2PZT A;  3H0G G;  3GTM H;  1FVI A;  2DJG C;  1KIX A;  1WD1 A;  1Q3L A;  3S1R H;  1DGS A;  2K5N A;  3EQL C;  1YZ6 A;  4NB3 A;  2LXJ A;  2XNA C;  3T1H Q;  1YVC A;  1PYB A;  1HXY D;  3HFZ B;  2PW7 A;  1XMO Q;  1XTC D;  4QL5 A;  3M3Y H;  1MSG A;  1TWC B;  2NN6 I;  4LFB Q;  2HD3 A;  4L5T A;  1S3O A;  1LM0 A;  2F0W A;  3ERQ A;  4IOA A;  2VQF Q;  2RDH A;  3D4D A;  2JA6 B;  4XTC S;  1KNE A;  1PTO F;  3M9B A;  1YJ9 A;  3HOZ H;  3SDZ A;  2JA5 H;  1GUO A;  2R93 B;  4LUO A;  1FNW A;  2F0E A;  1CQV A;  5BN4 A;  1ET9 A;  2HQL A;  2WB1 G;  3IFD A;  2O5I C;  4A3F H;  1HNZ Q;  5KNC A;  4RGN A;  1TS3 A;  5I6Y A;  1MJC A;  5JOB A;  1N33 Q;  3ZYY X;  4IUT A;  4FXG C;  3RZD H;  1E0B A;  1RD9 D;  4B3R L;  1KLG D;  1RCV D;  1BCP F;  4L5Q A;  2A6E D;  5EBC A;  3HOV G;  1RL2 A;  3FMC A;  1IBL Q;  1DZ1 A;  2WII B;  3S1N H;  1ZYR D;  5J22 A;  2LKV A;  5IYC H;  3D3R A;  1PXU A;  2IHE A;  3W1B A;  2F0V A;  1Q46 A;  4EVO A;  2XRS D;  4OGQ C;  4EGV A;  5IP9 G;  2E76 C;  2Q2T A;  1VQP A;  4OEM B;  5J1Z A;  5C3E H;  5M5X H;  4JI2 Q;  2XWB B;  1QUQ B;  2SDF A;  1GHJ A;  1ASZ A;  3TP6 A;  4A3I H;  3VR4 A;  1SE2 A;  1FD7 D;  3NPP A;  2PYK A;  1IL8 A;  4A3B B;  4FF3 A;  1WI5 A;  3NP8 A;  3AYH B;  3KK7 A;  4IUP A;  1CKM A;  3EIV A;  3H3V H;  3S15 H;  2D5D A;  5IP7 H;  1PTO D;  3VYU A;  2AHO B;  3I55 A;  1HHV A;  4LAA A;  1RIP A;  2BE5 C;  4F7X A;  4K2L A;  1XXG A;  4YCU A;  2SEB D;  4KHP L;  3MEF A;  4XT3 B;  4X6A H;  3MZ5 A;  1GJX A;  3HKZ E;  1QVG A;  3UE0 A;  5L37 A;  3HP3 A;  3D4R A;  4JYA L;  2IX0 A;  2A6H C;  3QO2 A;  2EE1 A;  1QIL A;  4KI0 A;  1YJW A;  3MTS A;  4X3K A;  5TSS A;  4H7B A;  1EWC A;  4RFB A;  1CSQ A;  3PUW A;  1QCB D;  2CVR A;  2JA8 B;  2O5J C;  3H15 A;  1SNC A;  2F4V Q;  1VQO A;  4B9W A;  1LT4 D;  2X6L A;  4A3C G;  1IBM Q;  3SVM A;  4NXM L;  2A74 C;  4G57 A;  1Q8I A;  1I3Q B;  1VMC A;  3OW2 A;  2F0K A;  4HJ8 A;  4RHS A;  1SNO A;  5A2Q E;  2EYP A;  1TII D;  1RKN A;  1LUZ A;  1C48 A;  5M5W H;  2XN9 C;  1N34 L;  3I4M B;  1SAP A;  3H09 A;  3I4N G;  3PIO 3;  4C56 C;  2E5L Q;  1X3P A;  3E0E A;  1E24 A;  3M85 A;  5EPJ A;  2PQA A;  3OTO L;  2O2L D;  3GTP B;  2MFI A;  3BYT B;  3KDF B;  1DM0 B;  1QE6 A;  1A2T A;  3EN2 A;  4QY7 A;  5I2Y A;  2ZT9 C;  3CQZ B;  1Y1V G;  5G3L F;  1EQQ A;  1T9H A;  4GOP A;  4BBR H;  1L1O A;  3K7A H;  3CC2 A;  1CQF A;  3CCR A;  4N9P A;  2E2J B;  3W5O A;  1GO3 E;  4KHV A;  4EQN A;  5C0X G;  2F0O A;  4LF4 Q;  4BY1 G;  2F0G A;  3J7A 5;  1Q81 C;  4DV0 L;  4OIJ A;  3ULL A;  4GN3 B;  5ELB A;  1SXT A;  5HGQ A;  1PH3 A;  1KQS A;  3ND8 A;  4LJZ C;  4XXE A;  4OO1 H;  4QUF A;  1SLJ A;  1AEX A;  1YHQ A;  2KJX A;  3K57 A;  1J9O A;  2B29 A;  1GOZ A;  4CGY B;  1W3S A;  3KF6 B;  3C1F A;  3S24 A;  2QA4 A;  1L0Y B;  1KTK A;  2BE5 D;  3FPU B;  3RLO A;  1M8A A;  4LFC L;  1FJG Q;  4ALP A;  1S4Z A;  2K5V A;  4RGT A;  2B2U A;  1TWA H;  2NWG A;  5FLX E;  4HMI A;  1XNR L;  1STY A;  1LTA D;  2E2D C;  3GO5 A;  4IPG A;  4TRD A;  1G6P A;  2I5L X;  1NCV A;  3KYH C;  3NEN A;  2A6H D;  3BDO A;  3HOZ G;  2P5Z X;  2JA5 G;  2R61 A;  1ICW A;  4POF A;  5FO9 B;  3RNU A;  1TS5 A;  2UXD Q;  4A3F G;  3P7J A;  1TXY A;  1NMG A;  2K03 A;  3T1Y Q;  4A3E B;  1F9S A;  1WCM H;  1QZH A;  1Q86 C;  3T16 A;  4H0L C;  1NAP A;  1XTD A;  4L6T B;  4X3T A;  4EQ5 A;  1Y1W B;  1TWG H;  4DR6 Q;  1CA6 A;  3GTQ B;  2A73 B;  2PMZ E;  1DOL A;  3A55 A;  1MHW C;  4A76 A;  2BOS A;  1I50 B;  1EFW A;  1AH9 A;  3D31 A;  4R4T A;  4LWC A;  1KLU D;  1V9P A;  3RMH A;  4OWT B;  5IYC G;  4K5W A;  1S5F D;  4JI3 L;  4EX5 A;  1STH A;  1HNW Q;  1G29 1;  2Z9H A;  3NQI A;  2XTI A;  4IJL A;  2F0T A;  1UUP A;  4HSV A;  5C4X B;  1UNS A;  5C3E G;  3FRP B;  3PSI A;  4RCO A;  4U68 A;  5FLX c;  4A3I G;  1VQD A;  5COY A;  4A3D H;  4S3S A;  5C3X A;  1K8A C;  3QWN A;  1VQB A;  4QMG A;  4A3K B;  1SNQ A;  1YJN A;  5LMU Q;  1J5E Q;  5IP7 G;  1VQM A;  2RQX A;  3A56 A;  1ZXT A;  2L55 A;  4MNO A;  2KBN A;  3OPO A;  4RKL A;  1KRS A;  1EY4 A;  5LHY 1;  2FMC A;  3PV0 A;  4ABN A;  1K73 C;  1PLF A;  2A1A A;  2IX3 A;  1K9M C;  4IPD A;  3HKS A;  1LLR D;  1L2F A;  2FJ2 A;  4RKB A;  5CV9 A;  1TY2 A;  2K1B A;  2WB1 E;  3RN2 A;  3MWY W;  1KHI A;  4LF7 Q;  3MFY A;  1NMF A;  4F8M A;  5M3F H;  4ZKC B;  1B8A A;  2F0S A;  1QNU A;  1EYA A;  1WTO A;  2HDM A;  3C2P A;  3PIP A;  1B53 A;  1TR5 A;  1VCI A;  2D9U A;  2PI2 A;  4DAM A;  2DNC A;  2NZ1 D;  1UE5 A;  2RCF A;  1JOK A;  2ZTD A;  3BG3 A;  4HIM A;  2AQ1 B;  2LMC B;  3OMG A;  4XT1 B;  5IYD H;  1Z47 A;  3DWP A;  5AJ3 Q;  3MA2 B;  5EGT A;  1CKN A;  1N9W A;  1U5K A;  1PVO A;  4JI8 Q;  4OWX B;  4YWM A;  2XRQ D;  1I94 Q;  1A2U A;  2K5W A;  1B9M A;  4G7Z C;  4X3U A;  1QUQ A;  1JR0 D;  1ET6 A;  1NUC A;  4TQU S;  5IIF A;  3IRB A;  3J80 c;  1XNQ L;  1BBW A;  3W1G A;  3GV6 A;  4UY8 C;  4R4O A;  1DOK A;  1KAW A;  3FPP A;  1SJH D;  2DY8 A;  4O1N A;  4IUQ A;  4OON A;  1EY8 A;  1CHP D;  1JOR A;  3PO2 B;  1PH1 A;  5JPN C;  4BBR G;  3EVQ A;  2AWN A;  3J7Z C;  1HPC A;  3GTO B;  3I73 A;  2GVA A;  3F1Z A;  4CDE C;  4ZYS A;  3HRZ C;  4HAE A;  2KEN A;  2F0J A;  5CMD A;  1EWI A;  4LFB L;  3KJO A;  1X6O A;  3MXG A;  3MXN A;  1KDB A;  1TWF H;  1TWH H;  3S9W A;  4A3L H;  5JPM C;  2VUM H;  2JK8 A;  2NVX H;  2GN5 A;  2VQF L;  4Y7N B;  2XIW A;  4DV7 Q;  3CRL C;  1EUJ A;  1OXU A;  3G48 A;  4PZ7 A;  1B4O A;  4IQZ A;  2RSO A;  3HS0 C;  4OXP A;  5EAY A;  3S14 H;  1UE7 A;  1ENF A;  3I91 A;  4OO1 G;  1N33 L;  1MJE A;  2K32 A;  2MQH A;  4GN5 A;  3X3M A;  1U4R A;  5IE8 A;  3ER0 A;  1IW7 C;  4IUV A;  1HH2 P;  3E3X A;  3CCJ A;  2F0M A;  2WP8 J;  2B2Y A;  2ZM6 Q;  3UI2 A;  1JOQ A;  4NW2 A;  1EYG A;  1IBL L;  2OF1 A;  1Q82 C;  4J6H A;  1X54 A;  2K04 A;  3GTG B;  1QG7 A;  4A3J B;  1I5F A;  3TP8 A;  2E2H B;  4JBW A;  1FGB D;  3LWU A;  3NQT A;  4F87 A;  1IHZ A;  1GUN A;  2JEB I;  3J81 j;  5C44 B;  1II3 A;  3CHB D;  2Q2U A;  4JI2 L;  4ZRZ A;  3H6M A;  2N78 A;  3VYR A;  3PUX A;  2AMC B;  4DU9 A;  4FF4 A;  1ASY A;  1WCM G;  3KDF A;  1N36 Q;  4QGU A;  5JJI A;  5JJL A;  4JV5 L;  5IWA Q;  2ZJP A;  4FYD A;  4QB4 A;  3TRE A;  4DN4 M;  1VQH A;  2YV5 A;  4Z9C B;  1MGS A;  1XPO A;  2NVQ B;  3GTJ H;  4UAI A;  2CCZ A;  3FKI B;  3ONA B;  2I5M X;  2C35 B;  2DUD A;  3HOY B;  1FNV A;  5KYI A;  2F0N A;  2KCT A;  1V43 A;  1EOT A;  4X66 Q;  3A5U A;  4GOP C;  4K2K A;  1D7Q A;  5HGT A;  2MUY A;  4HMJ A;  4YCV A;  5KRU A;  4A3D G;  1HQR D;  1PRT C;  4QIW B;  2F1M A;  3E6Z X;  2JA9 A;  3KF6 A;  3Q0A A;  4DF7 A;  4H44 C;  1HRJ A;  4BBS B;  1HNX Q;  1IBM L;  5EKI A;  1PFB A;  4JI4 Q;  1KD1 C;  1MSH A;  3D0F A;  4I7Z C;  3Q23 A;  3E9H A;  4X65 L;  5BR8 Q;  1PZJ D;  1CUK A;  3BYY B;  2Q8R E;  3S17 B;  1PTO H;  4DV4 Q;  2K14 A;  1WVL A;  4C3H B;  4OX9 L;  2NB0 A;  5F2D A;  1WJJ A;  3URY A;  1E1T A;  1B3Q A;  3SR1 A;  1KC8 C;  1X65 A;  1CKO A;  4P72 A;  3EA6 A;  4HED A;  1SJE D;  3L2P A;  5M3F G;  1PH6 A;  2OXP A;  4NKL A;  2FMM A;  2Y0S E;  1IW7 D;  4K0K L;  2B3G A;  5FLX L;  2AQ2 B;  3NTH A;  1K8M A;  1G8Z D;  1NJI C;  3OYY A;  1TWC H;  2A5H A;  4H02 A;  1EIY B;  2CW0 D;  4V19 0;  5IYD G;  3RZO H;  1VQA A;  4LF4 L;  5H1S E;  5KND A;  3S2H B;  4YHH Q;  4IUR A;  2EY1 A;  2KQ3 A;  3D8G A;  2PNR C;  2F52 A;  5CR3 A;  2H1E A;  1KAB A;  1R9T H;  3TN2 A;  1NSN S;  3VYT A;  3RLN A;  3R3O A;  2VQE Q;  3WDN A;  2EOT A;  4FVM A;  3BU2 A;  5JVG 3;  1D5M C;  1HUM A;  1PTO C;  2VNU D;  4R9W A;  2RKS A;  2IWH A;  5C0X J;  1DJR D;  1ONL A;  2ICI A;  2F0H A;  1FJG L;  4DUZ L;  2WAQ B;  2WFW A;  4LFA Q;  3SEB A;  3T53 B;  1IBK Q;  4A3L G;  1BO0 A;  2Z8L A;  3LGJ A;  1VQ9 A;  4ZKB B;  2VUM G;  2WIN B;  1HZB A;  3TS0 A;  5LMN W;  2CQO A;  3PGZ A;  1BCP C;  4DUY Q;  4JI5 Q;  3G6J B;  3CCS A;  1HUN A;  2HDL A;  1VQ6 A;  2PW5 A;  2UXD L;  5FOB B;  5I4D A;  1PRT D;  4P73 A;  3HEJ A;  3NBH A;  2RDG A;  3D6C A;  5E4W C;  1BCP B;  5D14 A;  4N8F A;  3CCV A;  3J80 L;  4DR6 L;  1RF2 D;  3MVV A;  2EJG C;  2HIV A;  4ZUJ A;  4DAV A;  3QJY A;  5ELE A;  5FLM H;  3A7A B;  2IJ0 A;  2BA1 A;  4KKU A;  1C8C A;  4XDX A;  1AN8 A;  1D2B A;  2I46 A;  3W2D A;  1HR0 W;  3NHH A;  4AYB E;  3R2I A;  1VQ8 A;  3M4O B;  1FGU A;  2E74 C;  4FF2 A;  4BA2 I;  1LT5 D;  1GUT A;  2AUJ D;  3AFQ A;  2PPB C;  1LV9 A;  3F2C A;  3VYS A;  3NSW A;  1MBY A;  1WTH A;  1B7Y B;  2JA8 H;  4B3M Q;  2EYL A;  3TDQ A;  1SYB A;  1B3A A;  3CD6 A;  2LXK A;  5I2X A;  1I3Q H;  1LAB A;  3VDY A;  4DFA A;  1O7I A;  4CKE A;  5GAH C;  1WTQ A;  3NXW A;  5CV6 A;  5EQ0 A;  3PF5 A;  3WOE A;  1BKB A;  1Y1V B;  4BY7 B;  2UUA Q;  5IGB A;  1QNK A;  4YCW A;  2G9D A;  4IFD H;  5D3D A;  2G5D A;  4KKS A;  4IFD J;  3I4M H;  1I4Q A;  1C0A A;  4X64 Q;  2R3Z A;  1EQT A;  2Z6B A;  4JI1 Q;  5C3W A;  2UU9 Q;  1G2T A;  2SOB A;  1QOH A;  3GTP H;  3IL8 A;  3K5O A;  4WJ3 M;  1IKL A;  2PQE A;  1FNU A;  2VB3 X;  4FXK C;  4WFN 3;  1I4R A;  3N6R A;  2ASB A;  3K80 C;  5K36 H;  5C4H A;  1H9S B;  2AKW B;  3V96 A;  2YYZ A;  3J81 E;  4DV6 L;  4DK1 A;  4X62 Q;  1K8G A;  3GQB A;  4JVZ A;  2NVT B;  3T13 A;  4IPH A;  1XMQ Q;  3DMU A;  4HJ7 A;  4HJ9 A;  4CKC A;  3K5N A;  3MXP A;  3PO3 H;  1I94 L;  5KYL A;  1BCP D;  4GN4 B;  2R92 B;  1EYD A;  2JSO A;  3M3Y B;  3GTK H;  1VMP A;  1STG A;  4ILW A;  1MIU A;  3K5L A;  4P74 A;  2B2Y C;  5M3M B;  2IPK D;  3NWT A;  5J39 A;  2EIF A;  2JA5 B;  4JI0 Q;  1IKM A;  2X69 A;  5FKA C;  1Y8P B;  5GAG C;  1JMC A;  4A3F B;  1UWV A;  2DN8 A;  1SYC A;  3F8T A;  2D0P A;  4DXF A;  1G51 A;  3TZU A;  3VR3 A;  1W6J A;  2UUC L;  2OWO A;  1S5C D;  2AWO A;  1SE8 A;  1K83 H;  2EZV A;  4KN7 C;  1EZ6 A;  3J81 c;  1D5Z C;  4HR7 B;  1OXT A;  4GNX B;  1T5X D;  4CJ2 C;  1VQK A;  1NR2 A;  1SMY C;  4DR1 L;  5FO8 B;  2WAC A;  2L12 A;  1E7Z A;  1GHK A;  3DM3 A;  1BQQ T;  1QVC A;  2EY6 A;  4LW1 A;  1GUW A;  3GTQ H;  2FXQ A;  4P75 A;  1PH9 A;  4DV3 Q;  1QWY A;  4NXN Q;  3KLR A;  2I5H A;  1XPU A;  2HCC A;  3DEO A;  1TKW B;  2IL8 A;  3AB9 A;  1A6X A;  3S1Q H;  3SK6 A;  4X3S A;  5E7N A;  3KBG A;  4LF9 L;  1M90 C;  2WV6 D;  3S2D B;  3DXJ C;  1VQ7 A;  4DK3 C;  1Q1E A;  2A8V A;  3S15 B;  5ISR A;  2F0L A;  4L5R C;  1EEI D;  2EQS A;  2L4N A;  1PFM A;  1RDP D;  3VR6 A;  5C4X H;  1EY5 A;  1RJT A;  2A69 D;  1VQ5 A;  3AMU A;  1SYD A;  2L5T A;  4EQP A;  1I4H A;  4LF8 Q;  4A75 A;  1NTG A;  3JAM c;  5IOC A;  3C46 A;  4MTN A;  5E3F A;  2K50 A;  1SYG A;  4C3I B;  5IWA L;  3K8A A;  2NN6 H;  2HIX A;  3W3A A;  1Q90 A;  5FLM G;  1A3U A;  4ZCK A;  4DAY B;  1I4X A;  4LMQ D;  3K0Y A;  2Z4H A;  3FDT A;  3STB C;  1X56 A;  5G3L D;  1TU2 B;  5IGF A;  2EXD A;  5CC4 A;  3C3L A;  4DK6 C;  1V1P A;  4KLK A;  4KK7 A;  5C4Z A;  2VL6 A;  4K8I A;  4X66 L;  2MNA A;  2L0C A;  1PZK D;  2FIN B;  4Q5V A;  4FP5 D;  3KJP A;  4C3J H;  2ZXO A;  3GDE A;  4JK1 C;  5ELD A;  4KY5 A;  3OSO A;  5J3B A;  2X6G A;  1M1K C;  2J0T D;  2Y0S G;  5M5W B;  4LUV A;  3PF4 A;  2JA8 G;  1XWE A;  4FNF A;  5GQO A;  4CDC C;  3SXH A;  4DR3 L;  2RHQ B;  1O78 A;  4B3T L;  1EYC A;  1SNM A;  1TVX A;  4WRD A;  3G71 A;  2EJM A;  3V05 A;  1F2Y A;  4JI4 L;  3KF8 A;  1HFN A;  4UP8 A;  3NWS A;  2EVB A;  1LTI D;  5CGK A;  2VB2 X;  5A35 A;  5BR8 L;  4RHR A;  3CPW A;  5C6A A;  5FO7 B;  2EXZ A;  1A0I A;  1D1K A;  4C2M H;  1STA A;  2V4D A;  4HIO A;  4DV4 L;  3K7A B;  4IFD G;  1EEF D;  4DKA C;  1EY0 A;  2B2V A;  2CKZ B;  3I4M G;  5JAV A;  1SMY D;  2L15 A;  4R4C A;  2OTL A;  4A93 H;  2QF7 A;  1SNP A;  3CW2 C;  4JBK A;  1GM5 A;  1E2Z A;  1SRO A;  2I07 B;  1U4P A;  4DV2 Q;  2EYJ A;  1LTL A;  2YU9 B;  2BDN A;  3CMA A;  2N88 A;  4IUU A;  4QIW E;  5LMN Q;  2B2T A;  4R4Q A;  3MXU A;  2WKC A;  1RTO A;  5K36 G;  4RGM A;  3GTO H;  3CC7 A;  2EJF C;  1SRU A;  3J80 E;  4B9X A;  4DR7 Q;  1H9R A;  1OTC A;  2F0I A;  2OQ0 A;  4H13 C;  4CKB A;  4B3R Q;  4NPS A;  3KLS X;  4YHH L;  2OTJ A;  4ZK9 B;  2LSS A;  3PO3 G;  2F3V A;  2TSS A;  1NR4 A;  3KOJ A;  1WTW A;  1WTV A;  1QZG A;  4A3G H;  3S1M H;  3K58 A;  1VDZ A;  4UDU C;  2HQE A;  3HKZ B;  1HR0 Q;  2VQE L;  1SND A;  2GA4 B;  4QUC A;  4BXX H;  1S5E D;  3NEM A;  4KN4 C;  2I0Q A;  3HOW H;  3OHX C;  2EY5 A;  4ME5 A;  2KEE A;  3VA7 A;  3Q22 A;  4ZQ3 A;  1A8V A;  3HOX H;  2MO1 A;  4GS3 A;  4ULL A;  1VQN A;  3NEL A;  3J81 i;  3TQY A;  1G91 A;  1WCM B;  2K01 A;  5DNF A;  5BN3 A;  4CHT B;  5I9P A;  4LNQ A;  2QKI C;  3STB D;  1N8R C;  3GTG H;  5M9O A;  1LO5 D;  3J7Y W;  1TWG B;  4AYB G;  2MP1 A;  5DLQ E;  2E2H H;  2JE6 I;  1F9P A;  2WKD A;  2ZTC A;  1HQM C;  2Z0S A;  3SHL A;  1RTN A;  5C44 H;  3HOU B;  4DUY L;  1G2S A;  4KHP Q;  5C4J B;  4C1N K;  3CCU A;  4RH6 A;  1W6K A;  3VA5 A;  4DR2 Q;  5JEA H;  5IYB H;  1JB7 A;  3I3C A;  3T1H L;  4AIM A;  1H9S A;  1XMO L;  3EBE A;  3M7N A;  1GVP A;  5EPL A;  3M7G A;  2RBM A;  1BBU A;  1DXM A;  4L8J A;  1QVF A;  2R7D A;  4A3D B;  1BR9 A;  4WOR A;  3MAQ A;  2NVQ H;  3FKI H;  1BUV T;  4A3M B;  2WAQ E;  2R7Z B;  2EPB A;  1SBB B;  1XYI A;  3M4Y A;  3GTL B;  4DAP A;  3H94 A;  1S40 A;  2QCP X;  3M4Q A;  5DAU A;  1SN8 A;  1HNZ L;  4KV6 A;  2ZTE A;  4LF5 Q;  5D65 A;  2ZJQ A;  3OMC A;  5C4X G;  3I70 A;  4XYO A;  3J81 L;  2N49 A;  4PV1 C;  4PMC A;  1STB A;  3K59 A;  2BH2 A;  3NBI A;  4I7A A;  1N34 Q;  1JIC A;  4B3M L;  3NUC A;  4L63 B;  1YNX A;  2E2I H;  2KOL A;  1R4P B;  4UHV A;  5M5Y H;  1Z7T A;  1WTX A;  1KXL A;  5ELF A;  1TQO A;  1EY7 A;  1MD2 D;  4IAL A;  2NN6 G;  4XIG S;  3OTO Q;  2CW0 C;  2NZH A;  1KNA A;  1C4Q A;  5CV7 A;  4DV1 Q;  2NVY H;  2UUA L;  3S17 H;  1BOS A;  1XX8 A;  1LYL A;  3NK9 A;  1A63 A;  4C3H H;  5CV5 A;  5LL6 S;  2FFK B;  1VQL A;  2QGQ A;  4X64 L;  4RAU C;  3KLW A;  2VW9 A;  5ELN A;  3OIQ A;  2Z4I A;  5IT9 E;  1IL2 A;  1E2V A;  4DNR B;  5COR A;  4C3J G;  2UXB Q;  5C5M A;  5IGE A;  3AEV A;  1CFM A;  2PI2 E;  2H5X A;  2ZXP A;  2PZW A;  4R4I A;  3CCE A;  2YTX A;  1B44 D;  1KDC A;  1ZKO A;  2DNE A;  1AP0 A;  1PFN A;  1UEA B;  1GD7 A;  1X3Q A;  3JAM L;  2L9H A;  4DGZ A;  1JCK B;  1XMQ L;  1PYS B;  4KKT A;  2RA4 A;  1JWM D;  2PMZ B;  2JQO A;  3TME A;  1SMX A;  3PIO A;  2KCN A;  2KVM A;  1QJO A;  3T4A C;  4LFC Q;  4OWW B;  3TSS A;  2B63 B;  4MN3 A;  4F88 A;  1VQJ A;  3D4W A;  4A93 G;  3IKJ A;  5NUC A;  1R4Q B;  1TWF B;  4LF6 Q;  5FJ8 H;  2JA7 B;  1Q8K A;  1CM9 A;  5DM7 3;  2VUM B;  1CSP A;  1Q1B A;  2NVX B;  4JOI C;  2F4V L;  3A8K E;  5DEH A;  3FP9 A;  4WJ4 A;  4CJ1 B;  3HG9 A;  2MJ8 A;  4JI0 L;  4GKJ Q;  4JBM A;  3I4L A;  2UUB Q;  2NTT A;  2JXM B;  3ERO A;  3H0G B;  1SFO B;  3OW7 A;  1ICF B;  5IT9 c;  1H9J A;  1CA5 A;  2SNS A;  4DAY A;  1I6H H;  3E0J A;  2N3S A;  4Y52 H;  2OQK A;  3H3V I;  2YTY A;  1IXR A;  1YNN C;  4JCV E;  1I4P A;  4P71 A;  1QB5 D;  1M4V A;  3TP5 A;  1E2W A;  3V2T A;  4O2D A;  1EZ8 A;  4E6I A;  1UEB A;  2E5L L;  4XQJ A;  4A3G G;  1EIF A;  5KGU A;  1AZP A;  5DM6 3;  3NTI A;  2WB1 B;  1TS4 A;  3P75 A;  4WJW A;  1N32 Q;  3DWQ A;  3NTK A;  4BXX G;  2QW7 A;  4ID6 A;  1SE4 A;  3CXC A;  3HOW G;  1HTP A;  4DV3 L;  4GLV B;  4NXN L;  1F9R A;  4DR5 Q;  4PQX A;  1AFP A;  3KUP A;  3BVM A;  5IGD A;  3HOX G;  1PH2 A;  4DA2 A;  1OXX K;  3J80 i;  1WOC A;  4DXG A;  3HOV B;  2JA6 H;  3KFU A;  2Q8I B;  4V0B A;  2R93 H;  3RN5 A;  2M9V A;  4U67 3;  1SDF A;  1H9M A;  2QIL A;  2B2W C;  1C9O A;  4MZ9 A;  5C44 G;  2R6G A;  1JWS D;  2CQA A;  3GTJ B;  1A3T A;  2K75 A;  4AQY Q;  3H91 A;  4BS9 A;  1S5B D;  2KEC A;  1D6E C;  5JEA G;  4J1M A;  5IYB G;  1HFG A;  2K28 A;  3DLL A;  4HJA A;  3BVZ A;  4IUN A;  4RMF A;  2QEJ C;  3UDG A;  3ITP A;  4HN7 A;  4DV5 Q;  4BA1 I;  2B2V C;  1ML0 D;  3R93 A;  5HUR A;  2C9O A;  3M4P A;  4BY7 H;  1KDA A;  2RSN A;  3FKI G;  1BXT A;  1U4M A;  2EYO A;  4TVA B;  4CDF C;  3BZC A;  4HID A;  1FL0 A;  4K8J A;  4RWS C;  1T5E A;  2B2T C;  1B9N A;  1IYU A;  1F2Z A;  3T1Y L;  3RUZ A;  1G6Z A;  1HA6 A;  4JI7 Q;  1EY6 A;  4UP9 A;  4A3B H;  4QCL A;  1NE3 A;  1Y8O B;  4JC0 A;  1DYQ A;  2F03 A;  3DHQ A;  5IGG A;  3Q8D A;  1SSO A;  1XNQ Q;  4POG A;  4GKK Q;  1X55 A;  4OO1 I;  2NVT H;  3CME A;  4LK1 C;  4QJF A;  2Q2I A;  4K5X A;  1IYJ B;  2PCF B;  1YNN D;  3PIP 3;  3G6E A;  1HNW L;  1ENA A;  1EOV A;  4DPG A;  4JG2 A;  5EKL A;  2O4X A;  4C3H G;  2E8G A;  3I72 A;  2R92 H;  2Q2H A;  3MEH A;  1GXD C;  3RZO B;  1OXV A;  4C1N I;  4PNY A;  4DNI A;  4ZAI A;  1EQV A;  5M3M H;  3I4N B;  1DD2 A;  1B70 B;  2A19 A;  4EQO A;  4DV2 L;  3T56 B;  5LMU L;  1J5E L;  2CH4 W;  4PMB A;  4KD4 A;  3SGI A;  5LMN L;  3C1E A;  4IO9 A;  1Y14 B;  1R9T B;  5GRO A;  1L0X B;  3U9S A;  4DR7 L;  1PDQ A;  2D2C C;  3Q24 A;  4HCE A;  4UP7 A;  1K8O A;  1HZ9 A;  1STN A;  4J15 A;  3N52 A;  3P1H A;  3OWF A;  4QF4 A;  4MTK A;  4LF7 L;  4BY1 B;  3WWV A;  4FF1 A;  2A69 C;  2F0F A;  3PMF A;  3S16 B;  4K5V A;  1CKN B;  3I56 A;  2VZA A;  1WD0 A;  1VQF A;  3CQZ H;  1HR0 L;  2DJF C;  5FJ8 G;  1SEB D;  4Q0F A;  1CTM A;  4ZUI A;  1DCZ A;  4KHZ A;  5EPK A;  2E2J H;  2IHF A;  3G7L A;  1JJG A;  2HHH Q;  3CCL A;  5AJ3 L;  2DGY A;  3GTM B;  3U58 A;  1HCZ A;  2K5Q A;  3S1R B;  4JV5 Q;  3S2D H;  2E75 C;  2A68 C;  2WAQ G;  3VR2 A;  4JI8 L;  1EWH A;  1D5X C;  2PNH A;  2TMP A;  1WYD A;  3KBX A;  2RF4 A;  3R8B A;  2KHI A;  1V1O A;  2UXC Q;  1A62 A;  1NY4 A;  2HUG A;  4JBJ A;  1KRT A;  1F2M A;  2MGS A;  3MXN B;  3HGB A;  3PUY A;  1PH4 A;  1JB3 A;  4DR2 L;  2K5D A;  4OEL B;  5EJW A;  3HOZ B;  3QOJ A;  1DOM A;  4B3S Q;  4DR4 Q;  2Q8T A;  2F0P A;  3CKI B;  1PH5 A;  4APV A;  4C3I H;  3ND9 A;  3BS1 A;  2Y0S B;  3CP0 A;  4GNX C;  3CPF A;  1YHA A;  1B1Z A;  2N55 A;  3RZD B;  2KED A;  5CBA E;  1PZI D;  1SE3 A;  3ULJ A;  2NBF A;  5IT9 L;  2JA6 G;  3JAM E;  3TRZ A;  4DV7 L;  3J7A F;  3L0O A;  5C5L A;  2EDG A;  1AZQ A;  2R93 G;  4FDB A;  3S1N B;  2JEA I;  4HTH A;  4IZ8 A;  4X65 Q;  4A3E H;  3A54 A;  2L11 A;  3MHB A;  3CU7 A;  1AE3 A;  4LF5 L;  2R7F A;  4NMZ A;  1U0L A;  1VQE A;  1Y1W H;  3SK5 A;  4OX9 Q;  5T1G A;  5C3E B;  5M5X B;  2FHT A;  1IZ6 A;  3MC0 B;  2B8G A;  3H3V C;  4A3I B;  3A5Z B;  2ZM6 L;  1I50 H;  4NDX A;  4JOI A;  3DWA A;  3DUZ A;  2CWA A;  4K0K Q;  2LS0 1;  4BY7 G;  3OIP A;  4DV1 L;  3L9A X;  5KNB A;  3SK8 A;  4ODG A;  2H4O A;  2XWJ B;  3ERS X;  5LL6 X;  3CCM A;  2KCC A;  3UDX A;  4YY3 Q;  3CCQ A;  1LTG D;  1AW7 A;  1WFQ A;  2KHJ A;  1Y8N B;  5I6W A;  1EY9 A;  2XGT A;  2J7Z A;  1X3G A;  1N36 L;  2MHV A;  4A3K H;  2YU9 H;  4A3B G;  2UXB L;  3PO3 B;  3A0J A;  2ICE C;  1CT1 D;  1PYW D;  3GTK B;  3K7U C;  3HZX A;  4NP5 A;  1LT3 D;  2F4I A;  2D0O A;  1CZW A;  3CAM A;  3EJI A;  2A68 D;  4AH6 A;  4JI6 Q;  1VF5 C;  1H9K A;  2RVL A;  1VQC A;  2F0U A;  2G9H D;  2CFM A;  3PQI A;  2K05 A;  2NTS A;  1YHB A;  3FHW A;  2ATW A;  2HCI A;  1VF7 A;  4R1J A;  1EU4 A;  1JC7 A;  4DUZ Q;  2R92 G;  3BVG A;  4AYB B;  4G7O C;  3ZJY C;  3ULP A;  2IX1 A;  1B50 A;  5IGC A;  2C5C A;  1K83 B;  4LF6 L;  5M3M G;  3PUV A;  4TKO B;  1V1Q A;  2B2W A;  4CJ0 B;  2OEO A;  3F2U A;  1J6Q A;  2QDL A;  3K5M A;  1HNX L;  1Q12 A;  3FEW X;  4RA8 A;  5ELO A;  3TBI B;  4L5S A;  1PV4 A;  4GKJ L;  1O7L A;  2UUB L;  2F0D A;  3PUZ A;  1E22 A;  2Z6K A;  2IY5 B;  1PH7 A;  1E1O A;  1AE2 A;  2PZU A;  3K6O A;  3UDI A;  2K4K A;  4BBR B;  1OO9 B;  4FXD A;  1LTR D;  1EIH A;  5JJZ A;  4HSP A;  2MPM A;  4HJ5 A;  3Q6S A;  4FO2 A;  1XJV A;  5E1F A;  3HOU H;  1B2T A;  1YBY A;  3EFX D;  1PFS A;  2CH4 A;  3S1Q B;  5C4J H;  5EKK A;  2M00 A;  5JVH 3;  2L1B A;  1K0S A;  5ELC A;  4TSS A;  3DEP A;  4KD3 A;  3PO2 H;  4OIK A;  3K0X A;  3A7L A;  1YIT A;  1HZC A;  2EYH A;  1N32 L;  3A8I E;  4DR5 L;  5GAE C;  2ES2 A;  3GV3 A;  4UPA A;  1V8Q A;  2VY3 A;  3R2T A;  3TS2 A;  4GLA C;  1HJP A;  1P8L A;  3AU7 A;  2ALY B;  5D3I B;  4OHJ A;  4A3M H;  2R7Z H;  1L0W A;  4Y7N H;  3CC4 A;  3E9I A;  2EYM A;  2K33 A;  3UE1 A;  3GTL H;  4IJH A;  2RDF A;  1VS0 A;  1Z9F A;  1I6V C;  3UDF A;  2IT1 A;  1TWA B;  1OXS C;  3JC6 6;  4PZ8 A;  1EL0 A;  1K3R A;  1GKH A;  4AQY L;  5CV4 A;  1MKH A;  3I7F A;  1EFI D;  1GUS A;  3L3O C;  4C3I G;  1FYC A;  3GD7 A;  4C3J B;  4XQN A;  4DV5 L;  3QB3 A;  1TS2 A;  2M2L A;  2SNM A;  4A3J H;  2N8N A;  5K5P A;  3NBH B;  4ZLT F;  1TT2 A;  4JW0 A;  1Y69 U;  4LFA L;  1IBK L;  3QOL A;  1O80 A;  4GZY C;  4DV6 Q;  1GUG A;  1O7Y A;  4DNT B;  2K6A A;  2HT1 A;  4JI5 L;  1P16 A;  3KLS A;  3D6W A;  4A3E G;  5BN5 A;  1EQR A;  1K3B C;  1ZEQ X;  4JI7 L;  1S72 A;  5JEA J;  4KJO A;  4C2M B;  2BDO A;  2YTV A;  4K6D A;  2BA0 A;  4JYA Q;  1Y1W G;  5CYU A;  3L7Z C;  1BF4 A;  1NNX A;  1CZG A;  1K28 A;  2D62 A;  2NZO A;  1SYE A;  4A93 B;  2K52 A;  2RHS B;  2K5H A;  1JT8 A;  4GKK L;  3TP7 A;  3HOY H;  2AUK A;  4NXM Q;  1JWU D;  1F9Q A;  5C0X I;  3JAM i;  3F2D A;  4CBV A;  1K0R A;  1YIJ A;  2B63 H;  4R8N A;  1LT6 D;  2UUC Q;  4R8I A;  3LX0 A;  1A15 A;  1F77 A;  3IAY A;  2JA7 H;  1VQ4 A;  1HZA A;  3TEH B;  2Z1C A;  4A3K G;  4BBS H;  1JQY D;  4HCS A;  3SK4 A;  2VS1 A;  3OWE B;  3GP7 A;  3ICE A;  3CRK C;  3RLF A;  3X3N A;  3G4S A;  5M3F B;  4DR1 Q;  2JJQ A;  4A3G B;  2J4X A;  2F3W A;  3S1M B;  3H0G H;  1SFO H;  3BDC A;  3O13 A;  3J7A V;  3PCO B;  1ILQ A;  1LTS D;  1YEZ A;  1LTT D;  1SYF A;  3HOW B;  3RD4 A;  1J8I A;  5GAD C;  3BDL A;  5I9O A;  4P2C B;  4PMW A;  4GNX A;  4KY7 A;  4CDD C;  1YNJ C;  3HOX B;  4HIK A;  1TY0 A;  1H95 A;  4DK0 A;  4KTA A;  3U50 C;  1CI3 M;  4JI1 L;  4LF9 Q;  2UU9 L;  1C7Y A;  5EBD A;  4DV0 Q;  5AFW A;  3OOC A;  1Q7Y C;  3HKZ G;  2XSC A;  3DM1 A;  1U4L A;  3A74 A;  4RCN A; 
#chains in the Genus database with same CATH homology
 2LFN A;  2PO4 A;  1CK1 A;  5IOD A;  2IW3 A;  4B08 A;  1UAP A;  2B39 A;  4BWG B;  3T51 B;  5KIX A;  5A2Q L;  4N9T A;  4KMU C;  3U9O A;  4XQQ A;  5FK9 C;  2B8F A;  4G4K A;  1BDO A;  2BCO A;  1TWH B;  2F0Q A;  2DY7 A;  4M1U B;  1PMR A;  2QDB A;  4IFD I;  2XVS A;  1ESF A;  4OL7 A;  1ILP A;  2VXW A;  5KEE A;  5CBE E;  3S14 B;  1HTL D;  1FR3 A;  2EYF A;  1WTP A;  1MI2 A;  3NE5 B;  5T1I A;  1X32 A;  2E2I B;  3SE0 A;  1HA5 A;  3E5S A;  3BZD B;  5M5Y B;  4G7H C;  2ZXR A;  2K7V A;  1PRT B;  3TZD A;  4KJN A;  2ENB A;  2EY2 A;  2NVY B;  1KAA A;  3A8J E;  3I90 A;  1A3V A;  2CHB D;  3LNN A;  4K6L A;  1EU3 A;  2KUM A;  4IN3 A;  2JP1 A;  3WOF A;  3FVQ A;  4J8Q A;  1I4G A;  1O7Z A;  2B2U C;  1YNJ D;  4YIJ A;  5E4X A;  4MHE A;  2A6E C;  1BBX C;  2KHS A;  4O42 A;  1LTB D;  1ZYR C;  1PRT F;  1LAC A;  3I8Z A;  4M8A A;  1ESR A;  1EIG A;  4MIU A;  4XYQ A;  3P20 A;  3IFT A;  1V1P B;  4RGO S;  1JOO A;  1U9R A;  1STE A;  1ENC A;  5CV8 A;  3MFG A;  2AQ3 B;  2NUC A;  1ROD A;  1D1I A;  1F2L A;  3LWE A;  4KY6 A;  2KA7 A;  3QG1 A;  5C0X H;  1BNZ A;  2JYO A;  4K14 A;  1I6H B;  1RHP A;  1DON A;  1PTO B;  2OT2 A;  2NYZ D;  1IYV A;  1JE4 A;  2LY7 A;  1Z6H A;  3QIA A;  2ID0 A;  1WTR A;  4I65 A;  1S5D D;  3VR5 A;  1CHQ D;  2PZT A;  1WD1 A;  1Q3L A;  3EQL C;  2XNA C;  1HXY D;  2PW7 A;  1XTC D;  1MSG A;  1TWC B;  2NN6 I;  2F0W A;  3ERQ A;  2RDH A;  3D4D A;  2JA6 B;  4XTC S;  1PTO F;  1KNE A;  3SDZ A;  1GUO A;  2R93 B;  1FNW A;  2F0E A;  1CQV A;  5BN4 A;  1ET9 A;  3IFD A;  2O5I C;  5KNC A;  4RGN A;  1TS3 A;  5I6Y A;  5JOB A;  3ZYY X;  4IUT A;  4FXG C;  1E0B A;  1RD9 D;  1KLG D;  1RCV D;  1BCP F;  2A6E D;  5EBC A;  3FMC A;  1DZ1 A;  2WII B;  1ZYR D;  5J22 A;  2LKV A;  3D3R A;  1PXU A;  2F0V A;  4EVO A;  2XRS D;  4OGQ C;  4EGV A;  2E76 C;  5J1Z A;  2XWB B;  2SDF A;  1GHJ A;  3TP6 A;  3VR4 A;  1SE2 A;  1FD7 D;  3NPP A;  2PYK A;  1IL8 A;  4A3B B;  4FF3 A;  3NP8 A;  3KK7 A;  4IUP A;  2D5D A;  1PTO D;  3VYU A;  1HHV A;  4LAA A;  2BE5 C;  4F7X A;  4K2L A;  1XXG A;  2SEB D;  4XT3 B;  3MZ5 A;  1GJX A;  3HP3 A;  3D4R A;  2IX0 A;  2A6H C;  3QO2 A;  2EE1 A;  1QIL A;  4KI0 A;  3MTS A;  4X3K A;  5TSS A;  4H7B A;  1EWC A;  4RFB A;  3PUW A;  1QCB D;  2CVR A;  2JA8 B;  2O5J C;  1SNC A;  4B9W A;  1LT4 D;  2X6L A;  3SVM A;  2A74 C;  4G57 A;  1Q8I A;  1I3Q B;  1VMC A;  2F0K A;  4RHS A;  1SNO A;  5A2Q E;  2EYP A;  1TII D;  1RKN A;  1C48 A;  2XN9 C;  3I4M B;  1SAP A;  3H09 A;  3PIO 3;  4C56 C;  1X3P A;  3M85 A;  5EPJ A;  3GTP B;  2O2L D;  3BYT B;  1DM0 B;  1QE6 A;  1A2T A;  5I2Y A;  2ZT9 C;  3CQZ B;  5G3L F;  1CQF A;  2E2J B;  4N9P A;  4KHV A;  4EQN A;  5C0X G;  2F0O A;  2F0G A;  4OIJ A;  5ELB A;  1SXT A;  3ND8 A;  4LJZ C;  4XXE A;  4OO1 H;  4QUF A;  1AEX A;  2KJX A;  3K57 A;  1J9O A;  1GOZ A;  4CGY B;  3C1F A;  1L0Y B;  1KTK A;  2BE5 D;  3FPU B;  1M8A A;  1S4Z A;  4RGT A;  2B2U A;  2NWG A;  5FLX E;  4HMI A;  1STY A;  1LTA D;  2E2D C;  3GO5 A;  4TRD A;  1NCV A;  2A6H D;  3BDO A;  2R61 A;  1ICW A;  5FO9 B;  1TS5 A;  3P7J A;  2K03 A;  4A3E B;  1F9S A;  3T16 A;  4H0L C;  1NAP A;  4L6T B;  4X3T A;  1Y1W B;  1CA6 A;  3GTQ B;  2A73 B;  1DOL A;  3A55 A;  2BOS A;  1I50 B;  3D31 A;  1KLU D;  3RMH A;  4K5W A;  1S5F D;  1STH A;  1G29 1;  3NQI A;  2F0T A;  1UUP A;  4HSV A;  5C4X B;  1UNS A;  3FRP B;  4RCO A;  4U68 A;  5COY A;  4S3S A;  5C3X A;  3QWN A;  4QMG A;  4A3K B;  1SNQ A;  2RQX A;  3A56 A;  1ZXT A;  2L55 A;  3OPO A;  4RKL A;  1EY4 A;  5LHY 1;  2FMC A;  3PV0 A;  4ABN A;  1PLF A;  2IX3 A;  1LLR D;  4RKB A;  2FJ2 A;  5CV9 A;  1TY2 A;  2K1B A;  3MWY W;  3MFY A;  4F8M A;  4ZKC B;  2F0S A;  1QNU A;  1EYA A;  1WTO A;  2HDM A;  3C2P A;  1B53 A;  1TR5 A;  1VCI A;  2D9U A;  2DNC A;  2NZ1 D;  1JOK A;  3BG3 A;  2AQ1 B;  2LMC B;  3OMG A;  4XT1 B;  1Z47 A;  3DWP A;  3MA2 B;  5EGT A;  2XRQ D;  1A2U A;  2K5W A;  1B9M A;  4G7Z C;  4X3U A;  1JR0 D;  1ET6 A;  1NUC A;  4TQU S;  5IIF A;  3GV6 A;  1DOK A;  3FPP A;  1SJH D;  2DY8 A;  4O1N A;  4IUQ A;  1EY8 A;  1CHP D;  1JOR A;  3PO2 B;  5JPN C;  3EVQ A;  2AWN A;  1HPC A;  3GTO B;  3I73 A;  4ZYS A;  3HRZ C;  4HAE A;  5CMD A;  2F0J A;  3MXG A;  3S9W A;  1KDB A;  3MXN A;  5JPM C;  4Y7N B;  2XIW A;  3CRL C;  1OXU A;  1B4O A;  4IQZ A;  2RSO A;  3HS0 C;  1ENF A;  3I91 A;  4OO1 G;  2K32 A;  3X3M A;  1U4R A;  1IW7 C;  4IUV A;  2F0M A;  2WP8 J;  2B2Y A;  3UI2 A;  1JOQ A;  4NW2 A;  2OF1 A;  4J6H A;  2K04 A;  3GTG B;  1QG7 A;  4A3J B;  3TP8 A;  2E2H B;  4JBW A;  1FGB D;  3LWU A;  3NQT A;  4F87 A;  1IHZ A;  1GUN A;  2JEB I;  5C44 B;  1II3 A;  3CHB D;  4ZRZ A;  3H6M A;  3VYR A;  3PUX A;  4DU9 A;  4FF4 A;  4FYD A;  4QB4 A;  4DN4 M;  4Z9C B;  1MGS A;  2NVQ B;  4UAI A;  3FKI B;  3ONA B;  3HOY B;  1FNV A;  5KYI A;  2F0N A;  1V43 A;  1EOT A;  4K2K A;  5HGT A;  2MUY A;  4HMJ A;  5KRU A;  1HQR D;  1PRT C;  4QIW B;  2F1M A;  3E6Z X;  3Q0A A;  4DF7 A;  4H44 C;  1HRJ A;  4BBS B;  5EKI A;  1PFB A;  1MSH A;  4I7Z C;  3Q23 A;  1PZJ D;  3BYY B;  2Q8R E;  3S17 B;  1PTO H;  1WVL A;  4C3H B;  2NB0 A;  5F2D A;  3URY A;  3SR1 A;  3EA6 A;  4HED A;  1SJE D;  2OXP A;  4NKL A;  2FMM A;  1IW7 D;  5FLX L;  2AQ2 B;  3NTH A;  1K8M A;  1G8Z D;  2A5H A;  2CW0 D;  4V19 0;  5KND A;  3S2H B;  4IUR A;  2EY1 A;  2KQ3 A;  3D8G A;  2PNR C;  5CR3 A;  2H1E A;  1KAB A;  3TN2 A;  1NSN S;  3VYT A;  3R3O A;  3WDN A;  2EOT A;  4FVM A;  5JVG 3;  1D5M C;  1HUM A;  1PTO C;  2VNU D;  4R9W A;  2RKS A;  2IWH A;  5C0X J;  1DJR D;  1ONL A;  2ICI A;  2F0H A;  2WAQ B;  3SEB A;  3T53 B;  1BO0 A;  2Z8L A;  4ZKB B;  2WIN B;  1BCP C;  3G6J B;  1HUN A;  2HDL A;  2PW5 A;  5FOB B;  5I4D A;  1PRT D;  3HEJ A;  3NBH A;  2RDG A;  3D6C A;  5E4W C;  1BCP B;  5D14 A;  3J80 L;  1RF2 D;  3MVV A;  2EJG C;  4ZUJ A;  4DAV A;  3QJY A;  5ELE A;  3A7A B;  2IJ0 A;  2BA1 A;  4KKU A;  1C8C A;  4XDX A;  1AN8 A;  1D2B A;  2I46 A;  3W2D A;  3NHH A;  3R2I A;  3M4O B;  2E74 C;  4FF2 A;  4BA2 I;  1LT5 D;  1GUT A;  2AUJ D;  2PPB C;  1LV9 A;  3VYS A;  3NSW A;  1MBY A;  2EYL A;  3TDQ A;  1SYB A;  1B3A A;  5I2X A;  1LAB A;  4DFA A;  4CKE A;  1WTQ A;  3NXW A;  5CV6 A;  5EQ0 A;  3WOE A;  1Y1V B;  4BY7 B;  5IGB A;  1QNK A;  2G9D A;  4IFD H;  5D3D A;  4KKS A;  4IFD J;  1I4Q A;  2R3Z A;  1EQT A;  5C3W A;  1G2T A;  2SOB A;  1QOH A;  3IL8 A;  3K5O A;  1IKL A;  2PQE A;  1FNU A;  2VB3 X;  4FXK C;  4WFN 3;  1I4R A;  3N6R A;  5K36 H;  5C4H A;  1H9S B;  3V96 A;  2YYZ A;  3J81 E;  4DK1 A;  3GQB A;  2NVT B;  3T13 A;  3DMU A;  4CKC A;  3K5N A;  3MXP A;  5KYL A;  1BCP D;  2R92 B;  1EYD A;  2JSO A;  3M3Y B;  1VMP A;  1STG A;  4ILW A;  3K5L A;  2B2Y C;  5M3M B;  2IPK D;  3NWT A;  5J39 A;  2JA5 B;  1IKM A;  2X69 A;  5FKA C;  1Y8P B;  4A3F B;  2DN8 A;  1SYC A;  4DXF A;  3TZU A;  3VR3 A;  1W6J A;  1S5C D;  2AWO A;  2EZV A;  4KN7 C;  1EZ6 A;  1D5Z C;  4HR7 B;  1OXT A;  1T5X D;  4CJ2 C;  1NR2 A;  1SMY C;  5FO8 B;  2WAC A;  2L12 A;  1GHK A;  1BQQ T;  2EY6 A;  1GUW A;  1QWY A;  3KLR A;  2HCC A;  3DEO A;  1TKW B;  2IL8 A;  3AB9 A;  1A6X A;  3SK6 A;  4X3S A;  3KBG A;  2WV6 D;  3S2D B;  3DXJ C;  1Q1E A;  3S15 B;  5ISR A;  2F0L A;  1EEI D;  2L4N A;  1PFM A;  1RDP D;  3VR6 A;  1EY5 A;  1RJT A;  2A69 D;  3AMU A;  1SYD A;  2L5T A;  4EQP A;  1I4H A;  5IOC A;  3C46 A;  5E3F A;  1SYG A;  4C3I B;  2NN6 H;  3W3A A;  1Q90 A;  1A3U A;  1I4X A;  4LMQ D;  3K0Y A;  2Z4H A;  3FDT A;  5G3L D;  1TU2 B;  5IGF A;  5CC4 A;  3C3L A;  1V1P A;  4KK7 A;  5C4Z A;  4K8I A;  2L0C A;  1PZK D;  2FIN B;  4Q5V A;  4FP5 D;  2ZXO A;  4JK1 C;  5ELD A;  4KY5 A;  3OSO A;  2X6G A;  2J0T D;  5M5W B;  1XWE A;  4FNF A;  3SXH A;  1O78 A;  1EYC A;  1SNM A;  1TVX A;  4WRD A;  2EJM A;  3V05 A;  1F2Y A;  3KF8 A;  1HFN A;  3NWS A;  2EVB A;  1LTI D;  5CGK A;  2VB2 X;  5A35 A;  4RHR A;  5C6A A;  5FO7 B;  2EXZ A;  1D1K A;  1STA A;  2V4D A;  3K7A B;  4IFD G;  1EEF D;  1EY0 A;  2B2V A;  5JAV A;  1SMY D;  2QF7 A;  1SNP A;  1E2Z A;  2I07 B;  1U4P A;  2EYJ A;  2YU9 B;  2BDN A;  2N88 A;  4IUU A;  2B2T A;  3MXU A;  2WKC A;  1RTO A;  5K36 G;  4RGM A;  2EJF C;  3J80 E;  4B9X A;  1H9R A;  2F0I A;  4CKB A;  4H13 C;  3KLS X;  4ZK9 B;  2F3V A;  2TSS A;  1NR4 A;  1WTW A;  1WTV A;  3K58 A;  1VDZ A;  4UDU C;  2HQE A;  3HKZ B;  1SND A;  2GA4 B;  4QUC A;  1S5E D;  4KN4 C;  3OHX C;  2EY5 A;  4ME5 A;  2KEE A;  3VA7 A;  3Q22 A;  4ZQ3 A;  4ULL A;  1G91 A;  1WCM B;  2K01 A;  5DNF A;  5BN3 A;  5I9P A;  4CHT B;  2QKI C;  5M9O A;  1LO5 D;  3J7Y W;  1TWG B;  2MP1 A;  2JE6 I;  1F9P A;  2WKD A;  1HQM C;  3SHL A;  1RTN A;  3HOU B;  1G2S A;  5C4J B;  4C1N K;  4RH6 A;  1W6K A;  3VA5 A;  5JEA H;  3I3C A;  1H9S A;  3M7N A;  5EPL A;  3M7G A;  2RBM A;  4L8J A;  1DXM A;  4A3D B;  1BR9 A;  4WOR A;  3MAQ A;  1BUV T;  4A3M B;  2R7Z B;  2EPB A;  1SBB B;  1XYI A;  3M4Y A;  3GTL B;  4DAP A;  3H94 A;  2QCP X;  5DAU A;  4KV6 A;  5D65 A;  3OMC A;  3I70 A;  4XYO A;  3J81 L;  4PV1 C;  4PMC A;  1STB A;  3K59 A;  3NBI A;  1JIC A;  3NUC A;  4L63 B;  2KOL A;  1R4P B;  1Z7T A;  1WTX A;  5ELF A;  1TQO A;  1EY7 A;  1MD2 D;  4IAL A;  2NN6 G;  4XIG S;  2CW0 C;  1KNA A;  1C4Q A;  5CV7 A;  1BOS A;  1XX8 A;  3NK9 A;  5CV5 A;  5LL6 S;  2FFK B;  4RAU C;  3OIQ A;  2Z4I A;  5IT9 E;  1E2V A;  4DNR B;  5COR A;  4C3J G;  5C5M A;  5IGE A;  1CFM A;  2ZXP A;  2PZW A;  1B44 D;  1KDC A;  1ZKO A;  2DNE A;  1AP0 A;  1PFN A;  1UEA B;  1X3Q A;  3JAM L;  2L9H A;  4DGZ A;  1JCK B;  4KKT A;  2RA4 A;  1JWM D;  2PMZ B;  3TME A;  2KCN A;  2KVM A;  1QJO A;  3T4A C;  3TSS A;  2B63 B;  4MN3 A;  4F88 A;  3D4W A;  3IKJ A;  5NUC A;  1R4Q B;  1TWF B;  2JA7 B;  1CM9 A;  5DM7 3;  2VUM B;  1Q1B A;  2NVX B;  3A8K E;  5DEH A;  4CJ1 B;  3HG9 A;  2MJ8 A;  3I4L A;  2NTT A;  2JXM B;  3ERO A;  3H0G B;  1SFO B;  3OW7 A;  1H9J A;  1CA5 A;  2SNS A;  4DAY A;  3E0J A;  1YNN C;  1I4P A;  1QB5 D;  1M4V A;  3TP5 A;  1E2W A;  3V2T A;  1EZ8 A;  4E6I A;  4XQJ A;  5KGU A;  1AZP A;  5DM6 3;  3NTI A;  2WB1 B;  1TS4 A;  3P75 A;  4WJW A;  3DWQ A;  3NTK A;  4ID6 A;  1SE4 A;  1HTP A;  1F9R A;  4PQX A;  1AFP A;  3KUP A;  3BVM A;  5IGD A;  4DA2 A;  1OXX K;  4DXG A;  3HOV B;  2Q8I B;  4V0B A;  2M9V A;  4U67 3;  1SDF A;  1H9M A;  2QIL A;  2B2W C;  2R6G A;  1JWS D;  2CQA A;  3GTJ B;  1A3T A;  3H91 A;  4BS9 A;  1S5B D;  2KEC A;  1D6E C;  5JEA G;  4J1M A;  1HFG A;  2K28 A;  3BVZ A;  4IUN A;  2QEJ C;  3ITP A;  4HN7 A;  4BA1 I;  2B2V C;  1ML0 D;  3R93 A;  5HUR A;  2C9O A;  1KDA A;  2RSN A;  1BXT A;  1U4M A;  2EYO A;  4K8J A;  4RWS C;  1T5E A;  2B2T C;  1B9N A;  1IYU A;  1F2Z A;  3RUZ A;  1G6Z A;  1HA6 A;  1EY6 A;  4QCL A;  1Y8O B;  1DYQ A;  2F03 A;  3DHQ A;  5IGG A;  1SSO A;  4OO1 I;  4LK1 C;  4K5X A;  2PCF B;  1YNN D;  3PIP 3;  1ENA A;  5EKL A;  2O4X A;  4C3H G;  3I72 A;  3MEH A;  1GXD C;  3RZO B;  1OXV A;  4C1N I;  4PNY A;  4ZAI A;  1EQV A;  3I4N B;  1DD2 A;  4EQO A;  3T56 B;  4PMB A;  4KD4 A;  3C1E A;  1R9T B;  1L0X B;  3U9S A;  1PDQ A;  2D2C C;  3Q24 A;  4HCE A;  1K8O A;  1STN A;  3N52 A;  3P1H A;  3OWF A;  4QF4 A;  4BY1 B;  4FF1 A;  2A69 C;  2F0F A;  3PMF A;  3S16 B;  4K5V A;  1WD0 A;  1SEB D;  4Q0F A;  1CTM A;  4ZUI A;  1DCZ A;  4KHZ A;  5EPK A;  3G7L A;  3GTM B;  1HCZ A;  2K5Q A;  3S1R B;  2E75 C;  2A68 C;  3VR2 A;  1EWH A;  1D5X C;  2TMP A;  3KBX A;  3R8B A;  1V1O A;  2HUG A;  1F2M A;  2MGS A;  3PUY A;  3HGB A;  1JB3 A;  2K5D A;  5EJW A;  3HOZ B;  3QOJ A;  1DOM A;  2Q8T A;  2F0P A;  3CKI B;  3ND9 A;  3BS1 A;  2Y0S B;  2N55 A;  1B1Z A;  3RZD B;  2KED A;  5CBA E;  1PZI D;  1SE3 A;  2NBF A;  5IT9 L;  3JAM E;  3J7A F;  5C5L A;  2EDG A;  1AZQ A;  3S1N B;  2JEA I;  4HTH A;  4IZ8 A;  3A54 A;  2L11 A;  3MHB A;  3CU7 A;  4NMZ A;  3SK5 A;  5T1G A;  5C3E B;  5M5X B;  2FHT A;  3MC0 B;  2B8G A;  3H3V C;  4A3I B;  4NDX A;  3DWA A;  3DUZ A;  2LS0 1;  3OIP A;  3L9A X;  5KNB A;  3SK8 A;  4ODG A;  2H4O A;  2XWJ B;  5LL6 X;  2KCC A;  1LTG D;  1AW7 A;  1Y8N B;  5I6W A;  1EY9 A;  2J7Z A;  2MHV A;  3PO3 B;  2ICE C;  1CT1 D;  1PYW D;  3GTK B;  3HZX A;  4NP5 A;  1LT3 D;  2F4I A;  1CZW A;  3EJI A;  2A68 D;  1VF5 C;  1H9K A;  2RVL A;  2F0U A;  2G9H D;  2K05 A;  2NTS A;  2HCI A;  1VF7 A;  1EU4 A;  1JC7 A;  3BVG A;  4AYB B;  4G7O C;  2IX1 A;  1B50 A;  5IGC A;  2C5C A;  1K83 B;  3PUV A;  4TKO B;  2B2W A;  4CJ0 B;  2OEO A;  3F2U A;  3K5M A;  1Q12 A;  3FEW X;  4RA8 A;  3TBI B;  1O7L A;  2F0D A;  3PUZ A;  2PZU A;  3K6O A;  4BBR B;  1OO9 B;  4FXD A;  1LTR D;  1EIH A;  5JJZ A;  4HSP A;  2MPM A;  3Q6S A;  4FO2 A;  5E1F A;  1B2T A;  3EFX D;  3S1Q B;  5EKK A;  2M00 A;  5JVH 3;  2L1B A;  5ELC A;  4TSS A;  3DEP A;  4KD3 A;  4OIK A;  3A7L A;  2EYH A;  3A8I E;  3GV3 A;  1V8Q A;  3R2T A;  3AU7 A;  5D3I B;  4OHJ A;  2EYM A;  2K33 A;  2RDF A;  1I6V C;  2IT1 A;  1TWA B;  1OXS C;  1EL0 A;  5CV4 A;  1EFI D;  1GUS A;  3L3O C;  4C3I G;  1FYC A;  3GD7 A;  4C3J B;  4XQN A;  3QB3 A;  1TS2 A;  2M2L A;  2SNM A;  5K5P A;  4ZLT F;  1TT2 A;  1Y69 U;  3QOL A;  1O80 A;  4GZY C;  1GUG A;  1O7Y A;  4DNT B;  2K6A A;  3KLS A;  3D6W A;  5BN5 A;  1ZEQ X;  5JEA J;  4KJO A;  4C2M B;  2BDO A;  4K6D A;  2BA0 A;  5CYU A;  3L7Z C;  1BF4 A;  1CZG A;  2D62 A;  1SYE A;  4A93 B;  3TP7 A;  2AUK A;  1JWU D;  1F9Q A;  5C0X I;  4CBV A;  4R8N A;  1LT6 D;  4R8I A;  3LX0 A;  1A15 A;  1F77 A;  3IAY A;  2Z1C A;  1JQY D;  4HCS A;  3SK4 A;  3OWE B;  3GP7 A;  3CRK C;  3RLF A;  3X3N A;  5M3F B;  4A3G B;  2J4X A;  2F3W A;  3S1M B;  3BDC A;  3O13 A;  3J7A V;  1ILQ A;  1LTS D;  1LTT D;  1SYF A;  3HOW B;  3RD4 A;  1J8I A;  3BDL A;  5I9O A;  4P2C B;  4PMW A;  4KY7 A;  1YNJ C;  3HOX B;  1TY0 A;  4DK0 A;  4KTA A;  1CI3 M;  5EBD A;  5AFW A;  3OOC A;  2XSC A;  3DM1 A;  1U4L A;  4RCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...