2MQHA

Solution structure of the chlamydomonas reinhardtii nab1 cold shock domain, csd1
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
72
structure length
72
Chain Sequence
GSGEQLRQQGTVKWFNATKGFGFITPGGGGEDLFVHQTNINSEGFRSLREGEVVEFEVEAGPDGRSKAVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA-binding cold-shock domain of the Chlamydomonas reinhardtii NAB1 protein and insights into RNA recognition.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Dna binding protein
molecule keywords Nucleic acid binding protein
total genus 1
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2mqhA00
4LWCA 1HZCA 2N49A 1WCMG 4X66L 3H3VI 1B70B 1K8AC 1Z9FA 5GAHC 2VS1A 1SMXA 2CQOA 4HJ8A 1K8GA 1IXRA 1V1QA 5K36G 2A1AA 4PG3A 1VCIA 3H15A 1YJWA 2VZAA 5M3MG 3KFUA 1E24A 4DR7Q 3KJPA 2B29A 2VQEQ 3K7UC 4R4QA 4JI7L 5IYDG 3FKIG 4LFBL 2D62A 1WYDA 3RNUA 4DNIA 3J7A5 4GNXB 4LFBQ 4IPCA 4JG2A 5ELNA 2KCMA 3ERSX 1EWIA 1IBKQ 3T1HL 1HR0L 1GKHA 1WFQA 1XMOL 1VQLA 4OWXB 3GTLH 3J7ZC 3OTOL 3W1GA 3UDGA 4A3IH 2E5LQ 4LFAL 4GNXA 4DV3L 3EBEA 4X66Q 4LF9L 1XNQQ 4GKKQ 4UP9A 3PUWA 2OQKA 4BBSH 2C35B 1JE5A 3D0FA 4JI5L 4X64Q 2K4KA 1EYGA 1A63A 4HIMA 4YCWA 2DGYA 3I4NG 4K0KL 5M5WH 2CWPA 2N8NA 1NMGA 5IYCG 1QVFA 3CXCA 4JBJA 4DR6L 4DV2Q 2F4VQ 5IWAL 3HOYH 4HIDA 2JA8G 4A3CG 1OXUA 2UXBQ 4IJHA 4QIWE 3CQZH 2WB1E 2MO0A 5LMUL 4NXNQ 3E9HA 1Z47A 2ASBA 1HNWL 3TS2A 4AYBE 1CKOA 4DV0L 2PMZE 2R93H 3F1ZA 4AQYQ 4YWLA 1VQOA 4JI8L 2YV5A 4YWKA 4MNOA 4LF5L 1L1OA 4H02A 1LYLA 3GD7A 1Y1WG 3RZOH 1H95A 1EUJA 1SE8A 1Q82C 2I5HA 1KD1C 2IHEA 1HNXL 2EXDA 3J81j 3WWVA 2I0QA 3KJOA 3FP9A 4NXNL 2E2HH 4NXML 2EQSA 5DLQE 4C3JH 1A0IA 1VQCA 4HJ9A 4QY7A 4IFDJ 1I6HH 4A3JG 4BY1G 3CCUA 1JB7A 3S2HH 2GVAA 4NB3A 2N78A 1N32L 1HNWQ 4JYAQ 1D8LA 4APVA 2UXBL 1HJPA 4LUOA 4DR2L 2PQAB 5IWAQ 3ULPA 5IYBH 2JJQA 3PIOA 1VS0A 4JI5Q 4HJ5A 1Q1BA 3ZJYC 1S3OA 4K0KQ 1PH3A 4BBRG 3CMEA 1E1TA 4LF6L 2UUBQ 3CCSA 1C9OA 2AMCB 3NEMA 2OCEA 5IY0A 1IBLL 4A3KH 3FHWA 1Y1VH 4DV3Q 5AJ3L 1IL2A 3F2BA 3HKZE 5C4JH 1PVOA 2UXDQ 1NMFA 1X6OA 5JJKA 4A3MG 3F2CA 5FJ8H 1K9MC 3J81c 1SR3A 4JYAL 4POFA 3T1HQ 1K83H 1HR0W 2NVXH 4R4OA 4A3FH 4DUYL 2R92G 2VNUD 2AWOA 1QVGA 4JI3Q 3PIPA 1TWCH 1NY4A 3JAMc 2BA0A 5M3FH 3UDFA 2WAQG 3GTOH 1EQRA 5C3EH 4P74A 1QUQB 2JK8A 5C44H 2K5HA 3CCRA 3NENA 4XIGS 2ZTCA 4ME3A 5JJLA 2UUBL 3HKSA 2JA7H 4IOCA 2B3GA 1WCMH 1YITA 1EFWA 1N33Q 4R4IA 3A0JA 4GOPC 4Y52H 2DUDA 1SN8A 3TS0A 2HHHQ 2Y0SE 3DLLA 1JMCA 3PUXA 1N36Q 1Q81C 2N3SA 3F8TA 5E7NA 4A3EG 3I4MH 2JA6G 4A3DH 4GS3A 1L1OC 4HIKA 2CWAA 1HH2P 3UDXA 4YY3L 2VQFQ 2K52A 2QGQA 3G6EA 3W1BA 4HJAA 2ZM6L 1YNXA 2VY3A 2ALYB 2ZJQA 3L0OA 2ZTDA 4YHHL 1CUKA 3HOZG 4X65L 1UE1A 1T9HA 4NXMQ 3CC2A 5C4XH 1E3PA 3BZCA 2JA6H 4IOAA 4AH6A 4DV7L 5IP7H 3RR5A 3S17H 1J5EQ 1HZBA 1Q12A 1AH9A 3L2PA 3E9IA 2YTXA 2B63G 2K75A 3PO3G 4NPSA 1VQIA 2KCTA 3ULJA 3K81C 4JI1Q 1YHQA 4JI8Q 1VQJA 1FJGQ 1OXSC 1QVCA 4JI2Q 4LF8L 4DV6L 5GADC 4C3HH 4MTNA 4X65Q 4DR3Q 4BY1H 1VQ7A 1B7YB 4JI6Q 1P8LA 1LUZA 4FDBA 3KF8B 1MJCA 3RLNA 2XGTA 4JI6L 5LMUQ 1JJCB 3RLFA 1PH9A 1W3SA 4LNQA 3KF6B 1XNRQ 2IY5B 1N9WA 4LF8Q 1UWVA 1IYJB 3M9BA 4GLXA 1XPOA 4B3SQ 2IX0A 4DV2L 1EIYB 4L5QA 1PH5A 3H3VH 4JOIC 2UUCQ 2Q2UA 1CKNA 4BBRH 4UP7A 2YYZA 1HZAA 1X54A 1NE3A 1VQDA 1YZ6A 2K14A 3E0EA 3KF6A 3M85A 3SGIA 1KAWA 1VQ9A 4JBMA 4YWMA 1E7ZA 2JA9A 4OXPA 3HOWG 4O2DA 2JA5H 1YJ9A 1GM5A 3T1YL 2R93G 3DM3A 5FLMH 2AWNA 4ALPA 1GO3E 1YHBA 1ASYA 3CC4A 3ICEA 4LUZA 2QEXA 2LSSA 4L5TA 1IBKL 4BBSG 2YTYA 4WJ3M 1VQBA 3HOXH 4DUYQ 4MZ9A 4A3GG 4BXXH 1KRTA 4HJ7A 4AIMA 4JV5L 1KXLA 5JEAJ 2NN6I 3JAMi 4A93G 3S1QH 2KBNA 1WOCA 4PMWA 2PQAA 1NTGA 1DGSA 4HIOA 4IFDI 3CD6A 3S1NH 4RG1A 4DR1L 4A3JH 3U50C 2JQOA 1N34L 4R4CA 2IX1A 2OWOA 1OXTA 1KRSA 1N34Q 4IJLA 4IPHA 3GTPH 2H5XA 1G291 1VQFA 1C7YA 4DV5L 1E1OA 2UXCL 1BVSA 2R7DA 3HOVG 4DV4L 3PO2H 3FKIH 4O0AA 4BY7H 3GO5A 2UU9L 2VUMG 2ATWA 3A74A 3BU2A 1PH4A 1CKNB 4GKJL 4B3RL 1VQ8A 4LFCQ 3NELA 1SLJA 5IE8A 1OXXK 2RF4A 1PFSA 1YJNA 1TXYA 3AEVA 2ZTEA 1X65A 3RN2A 1HNXQ 1UE6A 3HOYG 3KDFB 4P71A 4DK6C 3STBC 4XTCS 3UE0A 4QGUA 1MJEA 1PV4A 3IRBA 1K3RA 3CAMA 3CCJA 4OWTB 3PF5A 2OTLA 4B3SL 1OTCA 1N8RC 1PH8A 2MNAA 2V1CC 3CCMA 2WB1G 2E2JH 1O7IA 3EIVA 5EAYA 2F52A 3K8AA 2WP8J 3K80C 4OX9Q 4P72A 5BR8L 1MIUA 3M4OH 1XPUA 1VQHA 5JJIA 3BZKA 4LUVA 4YCVA 3LGJA 1VQ6A 4GN5A 4JI2L 1CKMA 1RL2A 4B3TQ 2Y0SG 4A76A 4LF7L 2JE6I 1X9NA 4A3MH 3A5ZB 2D0PA 4POGA 1V43A 2LXJA 5H1SE 2I5LX 4JBWA 3GTMH 1UEBA 3J80i 3I4MG 1W2BA 3I2ZA 4C2MH 1I3QH 2MQHA 5IP9H 3S1MH 2NVTH 1HNZL 2R7FA 1IBMQ 3EN2A 1U0LA 1JJ2A 3PV0A 1YI2A 4KHPQ 4GKKL 4LFAQ 4GLVB 4YHHQ 1XMQQ 1XNQL 1EIFA 4DV1Q 3HOZH 4B3RQ 3W5OA 3CP0A 2ZM6Q 1XMOQ 2ES2A 3M4QA 4J15A 1X56A 1HR0Q 2LXKA 3KDFA 4PZ6A 4QQBX 1QZGA 3AQQA 1D7QA 2F4VL 4JBKA 4L5RC 1JJGA 2A19A 1PH1A 2MO1A 4JOIA 1L1OB 1S72A 2HQLA 2RCNA 2UUAQ 2PI2E 4LF4Q 1U5KA 3MXNB 4P75A 4X64L 3ER0A 5M5XH 4DR7L 1YHAA 2UXCQ 4EQ5A 5IYDH 5LMNL 4L5SA 2PNHA 3ULLA 4EX5A 2JEBI 4JC0A 1P16A 4LF9Q 4DR1Q 3G48A 3CCVA 2KHIA 2HT1A 5GAGC 3I55A 1WI5A 3CMAA 2E8GA 4YCUA 4B3MQ 2GVBA 5C0XJ 4LF4L 5HGQA 4IO9A 4JI3L 2Q2IA 1Q7YC 4IPDA 3GTKH 5IYCH 4GN3B 2L15A 1KHIA 3J81i 4A3IG 2Q2TA 4BY7G 4A4IA 3HOUH 3RN5A 1TWGH 2HIVA 1I94L 4QJFA 4JV5Q 4JI7Q 4A3CH 1M1KC 2KHJA 4GN4B 1K73C 2UXDL 1Y14B 3J80c 4DPGA 4DR5Q 1PH6A 3RLOA 4A93H 4R4TA 1AE3A 2Q2HA 2NVQH 3T1YQ 1HNZQ 2D0OA 1IBML 3G4SA 4KHPL 4GLAC 1PA6A 2AKWB 2NVYH 5J3BA 1PHJA 1A62A 2F3IA 2R7ZH 3S1RH 4TQUS 4AYBG 4BA1I 1LM0A 4LF7Q 3U4VA 2UUCL 1XTDA 2Z0SA 1TWFH 1Q1EA 2WFWA 3CC7A 4KI0A 2R92H 4OX9L 1BBUA 1SROA 4RMFA 3KYHC 5JEAG 1FL0A 3NBHB 4DR3L 4IFDG 5M5YH 1X55A 5BR8Q 4Y7NH 5C3EG 1AE2A 5M3MH 2K5VA 5ELOA 1FJGL 3PUVA 3PO2G 2Z6KA 1EOVA 1VQAA 3HOXG 3F2DA 4DUZL 1VQ5A 4A3GH 3GTJH 2ZJPA 3S24A 2CFMA 3PUZA 3TEHB 2JA8H 1OXVA 3D31A 5GQOA 1UE7A 3VDYA 4PZ7A 3UE1A 1R9TH 2JEAI 2JA7G 4OO1I 1VQPA 4JI4L 3PF4A 4GKJQ 1YIJA 1PYBA 2VQFL 4GOPB 3U58A 4JI0L 4YY3Q 5FJ8G 1B8AA 3H0GG 1L2FA 3PSIA 1VQNA 4A3DG 4OWWB 1IZ6A 4X6AH 1I94Q 3S16H 1X3EA 1G51A 2HHHL 1FGUA 1VQEA 1VQKA 1K0RA 2EIFA 4DV4Q 1N36L 3GTQH 3S14H 5IP7G 3JC66 3HKZG 1YVCA 3GDEA 2QA4A 1CSPA 1VQMA 4B3ML 3G71A 3K7AH 4UY8C 2BH2A 3B6YA 2RHSB 4A3FG 4DR4L 3H0GH 1MKHA 3OTOQ 2E5LL 3I56A 4P73A 1SRUA 2FXQA 4R1JA 4WJ4A 4DR4Q 5LMNW 2GN5A 3Q8DA 5C0XI 3CCQA 3CCLA 5GAEC 5LMNQ 2MFIA 3PGZA 3U4ZA 1NJIC 2OQ0A 1Q8KA 2UUAL 1XPRA 3M3YH 4KHZA 1BKBA 2I5MX 3M4PA 1XJVA 1M90C 3S2DH 1QUQA 2VQEL 2AHOB 3M7NA 1S40A 2CKZB 3CW2C 3PUYA 1YEZA 5AJ3Q 4A75A 4JI0Q 2CCZA 3OYYA 1FVIA 2NZOA 4DV1L 4JI4Q 1Q46A 2NN6G 5IT9c 3STBD 1XMQL 1KQSA 5C0XG 3PCOB 1E22A 1IBLQ 1SFOH 1VQGA 3UDIA 4LF6Q 1NBWA 1YBYA 2JA5G 1N33L 2R7ZG 3TRZA 4PZ8A 2WAQE 1GVPA 4DUZQ 2B63H 1PYSB 4LW1A 3TQYA 3CCEA 1VQ4A 1ASZA 1TWHH 1TWAH 2HIXA 3L7ZC 5GROA 5IYBG 2R6GA 4DK3C 3I4NH 4DR2Q 1EQQA 3KLWA 1I5FA 1I50H 1LTLA 2PI2A 1GD7A 2YTVA 4UP8A 5C44G 1XNRL 1A8VA 2YU9H 4C3IH 4GNXC 4B3TL 2VW9A 3S15H 4BXXG 5HY6A 2Z6KC 4A3LG 4OO1G 3I7FA 3PO3H 1CSQA 4A3KG 1N32Q 3KOJA 3MEFA 1Y1VG 4X62L 2ID0A 4IPGA 3CF5A 1C0AA 4JI1L 2OTJA 1KIXA 4DV6Q 1UE5A 4QL5A 1HZ9A 2RHQB 4DKAC 1QZHA 1J5EL 2IHFA 4A3EH 1JT8A 4LF5Q 4TVAB 3RZDH 1Y1WH 2KENA 3HFZB 2K50A 4A3LH 3K0XA 4DAYB 1G6PA 1PH7A 3AYHB 4A3BG 1V9PA 3HOWH 1X3FA 4DV7Q 3TREA 2K5NA 1WJJA 2E2IH 2A8VA 5M3FG 4GOPA 1X3GA 4AQYL 4X62Q 4OONA 2VUMH 3CPWA 2IT1A 4BA2I 2BH8A 2VL6A 4DV0Q 4DR5L 4JCVE 4LFCL 1KL9A 3OW2A 3A5UA 3HOVH 1RIPA 3I4OA 5C4XG 2BA1A 4UPAA 3GTGH 4DR6Q 1J6QA 5IP9G 1Q86C 3AFPA 3AFQA 4A3BH 1L0WA 2UU9Q 2ZJRA 5FLMG 1PH2A 3BJUA 4KLKA 2XTIA 4DAMA 3CPFA 3HOUG 2NZHA 1KC8C 4DV5Q 5FLXc 1BBWA
chains in the Genus database with same CATH superfamily
1HZCA 2QW7A 3H3VI 1K8AC 1SAPA 1Z9FA 5GAHC 2CQOA 1TY2A 5JOBA 4HJ8A 1Y69U 5K36G 3T53B 1Z7TA 4ID6A 3FKIG 3J7A5 2RCFA 1MSGA 3M4OB 1GUNA 2K03A 4LFBQ 4XDXA 4IPCA 4JG2A 5ELNA 1EWIA 3M4YA 1SEBD 4OWXB 3J7ZC 5I2YA 2E5LQ 4GNXA 4DV3L 3EBEA 4LF9L 3PUWA 4BBSH 2C35B 1JE5A 4K2KA 1SNPA 3D0FA 5CORA 2K4KA 5CGKA 4HIMA 1F2LA 2CWPA 3W3AA 3FVQA 1HCZA 2F0GA 1GUWA 1OO9B 1LV9A 2F0TA 4QIWE 4RGTA 4DA2A 2MO0A 5LMUL 1HNWL 5FO8B 3TS2A 4AYBE 2KJXA 4DV0L 4DAVA 1EY5A 1M8AA 4YWLA 1I6VC 5HGTA 4JI8L 4H13C 1H9KA 4EQNA 1U4RA 2QEJC 2EXDA 2K01A 3WWVA 1VF5C 3MZ5A 5CMDA 2F0SA 2NTTA 3FP9A 4NXNL 4IFDJ 4HJ9A 1I6HH 3TZDA 3CCUA 3ND8A 2SEBD 2N78A 1N32L 1TT2A 2D2CC 3GV6A 3KLRA 4APVA 5G3LF 2UXBL 1HJPA 4LUOA 4DR2L 2SNMA 3PIP3 1AN8A 4JI5Q 1VS0A 1Y1VB 1V1PB 3F2UA 2AMCB 3NEMA 4A3KH 1IL2A 5AJ3L 3S1RB 4K5XA 5E3FA 3H94A 1X6OA 2SDFA 5I6WA 3F2CA 5FJ8H 1K9MC 3J81c 3NWSA 4BY7B 1PFBA 5EKIA 2L9HA 4A3FB 1D6EC 4RGNA 5M3FH 3GTOH 3UDFA 2WAQG 5LL6X 1EQRA 2G5DA 4K6DA 1STNA 5C3EH 4ME3A 2JA7H 2X69A 4IOCA 1EY7A 1WCMH 1N33Q 4Y52H 2HHHQ 3DLLA 3PUXA 2N3SA 3I4MH 4PMCA 2L1BA 1L1OC 2LS01 4YY3L 4DAYA 1S4ZA 4EQPA 5IODA 4HJAA 4IFDH 2BOSA 3L0OA 2RKSA 2ZTDA 4KY7A 4YHHL 3R93A 2L11A 3CC2A 5C4XH 3QJYA 4AH6A 4H0LC 5IP7H 1K8MA 1TVXA 2YTXA 3L2PA 2K75A 3RZDB 3M7GA 5GADC 5IGCA 4X65Q 2F0PA 1VQ7A 1P8LA 1LUZA 3RLNA 1MJCA 2I46A 1PTOD 2LKVA 1PMRA 2XGTA 5EPLA 3RLFA 5LMUQ 3KF6B 4ZYSA 1W6JA 4LF8Q 1UWVA 2MUYA 1XPOA 4B3SQ 2IX0A 2R7ZB 1EIYB 1T5EA 1BXTA 5IT9L 1BO0A 2CW0C 2Q2UA 3ZYYX 2C9OA 2YYZA 1C48A 4DF7A 5EKLA 2K14A 1B4OA 3SGIA 4JBMA 3HOWG 4YWMA 2JA9A 4OXPA 1YJ9A 1PRTB 2R93G 2AWNA 1TS2A 1GO3E 1ASYA 2QEXA 2WAQB 1LO5D 3D4RA 4DUYQ 4MZ9A 3HEJA 4BXXH 4IALA 3HZXA 2OXPA 1BNZA 5JEAJ 3I72A 2KBNA 2PZTA 3HOUB 2PQAA 1ENAA 4IUNA 4IFDI 4RG1A 4DR1L 1N34L 3J7AV 4R4CA 1OXTA 1YNJD 1KRSA 1N34Q 2B2WA 4IJLA 3FKIB 1EY6A 2PPBC 1G291 4WORA 5BN4A 4C1NI 3FKIH 2UU9L 1BCPB 1D5MC 3EQLC 3KUPA 4E6IA 2ATWA 3A74A 2B2TA 4ME5A 3MEHA 3SK4A 4LFCQ 1GHKA 1SNCA 3GQBA 4FP5D 1PFSA 5M5XB 1X65A 1HNXQ 4ZKCB 3HOYG 2B8FA 2QCPX 4PQXA 5IGBA 1DD2A 4OWTB 1L0YB 4B3SL 1EIGA 5EPKA 1PH8A 1I4RA 4F87A 1TS5A 2E2JH 5J22A 4CKBA 4OX9Q 2SOBA 5BR8L 3M4OH 1XPUA 3BZKA 2J4XA 3LGJA 4YCVA 1YNNC 2E75C 4GN5A 5EGTA 4B3TQ 4A76A 2JE6I 1EY9A 1EY0A 1EZ6A 5H1SE 4JBWA 4QUFA 1UEBA 3J80i 4CGYB 3E6ZX 3I2ZA 4C2MH 1GOZA 2MQHA 2V4DA 5IP9H 1H9SA 4BY1B 3EN2A 2MGSA 2XWBB 1A15A 5KGUA 1YI2A 1ENCA 4KHPQ 4GLVB 4ILWA 4A3IB 1XMOQ 2K5DA 3AMUA 5CV4A 1X56A 1HR0Q 2LXKA 3AQQA 4A3EB 3Q22A 3A8KE 2MO1A 4IQZA 1L1OB 1S72A 4FVMA 2PI2E 2WKDA 3MXNB 3ER0A 1EY4A 1YHAA 2TSSA 2UXCQ 5IYDH 3N52A 2NZ1D 1F9PA 4LF9Q 4DR1Q 3L3OC 4UAIA 4DU9A 2HT1A 5GAGC 1A3VA 3I55A 3QR8A 5C4ZA 4JI3L 4C3JB 5C5LA 2L15A 5IYCH 4A3IG 3A7AB 4J6HA 3RN5A 2HIVA 1Y8NB 3SE0A 4N8FA 2IPKD 4UDUC 4DR5Q 5I2XA 3TDQA 4TRDA 3EJIA 2Q2HA 1CM9A 4J1MA 5LL6S 3BS1A 1BCPD 4RKBA 2AKWB 2NVYH 1U4PA 3MVVA 2F3IA 3A56A 3MC0B 1RF2D 2R7ZH 1JE4A 5CV5A 1A2TA 1K8OA 1XTDA 1JC7A 2BE5C 2WFWA 3BDOA 3S2DB 3CC7A 4C56C 4OX9L 3K7AB 1SROA 5I9PA 5JEAG 1FL0A 4DR3L 1PFNA 4IFDG 5K36H 3OIPA 3NSWA 3WDNA 1AE2A 1ET9A 1UNSA 3PUVA 3PO2G 4OELB 1EOVA 4DUZL 4N9PA 3GTJH 3CHBD 3PUZA 2JA8H 3VDYA 4PZ7A 2PNRC 3AU7A 2JA7G 2EE1A 1PRTF 1WTPA 4RKLA 3FEWX 3IFDA 3L9AX 4GOPB 4JI0L 1II3A 4YY3Q 3OSOA 1JOKA 1PTOC 1LTTD 4OWWB 3KLSX 1FGUA 2BDOA 2MP1A 1WTWA 5EKKA 4B3ML 2BH2A 5BN3A 4C3IB 1AFPA 2SNSA 1CFMA 1IHZA 1LACA 5FK9C 1V1OA 3Q8DA 3CCLA 2MFIA 2PCFB 1I4QA 2OQ0A 4BBSB 4FYDA 1Q8KA 5CYUA 1DOMA 4KHZA 4KJNA 3M4PA 3S2DH 1S40A 1ZKOA 3K5NA 5AJ3Q 2A69D 1D2BA 3OYYA 1Q46A 2NN6G 1K83B 1EWCA 1HUMA 5IGEA 4QUCA 3TRZA 1EY8A 2B63H 3I91A 3TQYA 1ILPA 3K5LA 3I4NH 1I5FA 1I50H 2PI2A 1GD7A 4C3HG 1WTHA 1A8VA 1NR4A 4GNXC 5HY6A 1AW7A 3PO3H 4A3KG 2E76C 3MEFA 4RFBA 3CF5A 1C0AA 3TZUA 1KIXA 4DV6Q 1HZ9A 3MXUA 1YNJC 3GTPB 1PH7A 4A3BG 2E2IH 4IZ8A 5M3FG 2A8VA 1TU2B 1X3GA 4GOPA 4X62Q 4HTHA 1SYCA 3J81L 2VUMH 2IT1A 4U68A 4BA2I 2FJ2A 3I3CA 4JCVE 3A5UA 1RIPA 2F1MA 1DJRD 4A3BH 3QWNA 3HG9A 5FLMG 2ZJRA 1RODA 2A6HC 5C44B 3G48A 3A7LA 5ELDA 3UDIA 1N33L 1HA6A 3PF4A 2EY6A 3Q0AA 1XWEA 1IXRA 1V1QA 3NTIA 2A1AA 2OEOA 4XYQA 1X3PA 3MTSA 1YJWA 5M3MG 3S15B 1E24A 5J39A 4RHRA 3KJPA 2VQEQ 4JI7L 1LTRD 4LFBL 1WYDA 2FHTA 4DNIA 4GNXB 2PYKA 2AUKA 4RCNA 1SNOA 2EYLA 2KCMA 3ERSX 4IURA 3T1HL 4RGOS 5D65A 5KEEA 2XRSD 4DN4M 1GKHA 4YIJA 1VQLA 5ELCA 3GTLH 3OTOL 3W1GA 3UDGA 4GKKQ 4X66Q 4LK1C 2L4NA 4X64Q 3JAME 1W6KA 1A63A 5IYCG 1QVFA 5K5PA 4CKEA 1SSOA 3CXCA 2G9DA 4OIKA 1DYQA 2F4VQ 5IWAL 5FO7B 2KHSA 1PYWD 3G7LA 2F0JA 4NXNQ 2DY8A 2M00A 3BDLA 1PLFA 2R93H 3F1ZA 4Z9CB 3D3RA 3VR4A 4YWKA 4LF5L 1LYLA 1Y1WG 1H95A 2HCCA 1MHWC 2XVSA 2F0MA 2F0WA 3K5OA 2IHEA 4KMUC 3J81j 3FPPA 2I0QA 1FNVA 1R9TB 2EQSA 5DLQE 1SNQA 3A8IE 1F9QA 4C3JH 5COYA 2GVAA 4JYAQ 1D5ZC 3ONAB 3I4NB 3BVZA 2PQAB 3I70A 5IWAQ 1PRTC 3HOZB 3ULPA 5IYBH 3T13A 2JJQA 1S3OA 1CK1A 4K0KQ 1DCZA 4CDCC 2UUBQ 4LF6L 4XQJA 1IYVA 3FHWA 5C3WA 1H9JA 3HKZE 3D6WA 4NDXA 4KHVA 4FXKC 1BR9A 2EYFA 1K83H 3T1HQ 2QDLA 3HP3A 1QVGA 4DXGA 1NY4A 3JAMc 3BYTB 1KDCA 5DM63 4ODGA 4XIGS 2ZTCA 1STHA 5JJLA 1EFWA 1JQYD 4B9WA 1SMYC 1JMCA 2I07B 2HD3A 3CRLC 2B2VA 4KD4A 4X3TA 1Q81C 2RQXA 1LTAD 3F8TA 4A3EG 1N36Q 3OWFA 2JA6G 4A3DH 4GS3A 3MA2B 4L6TB 2VQFQ 2ZJQA 2VY3A 5JAVA 2Q8RE 1HFNA 1UE1A 2EDGA 1R4PB 2KVMA 1SYGA 3U9SA 4HAEA 3BZCA 1JR0D 5T1GA 2JA6H 3T51B 4IOAA 1SDFA 1AEXA 3RR5A 3S17H 1J5EQ 1Q12A 4A3JB 3E9IA 4K8JA 2B63G 5CR3A 3RD4A 2KCTA 5M3FB 3GTOB 1Z6HA 1VQJA 3HOVB 3VR6A 4DV6L 4C3HH 1WTQA 4JI6Q 1PTOF 3K59A 4JI6L 1JJCB 3CU7A 1N9WA 2NTSA 1CZWA 1TS4A 1PH5A 3H3VH 3UI2A 2NB0A 2Y0SB 2UUCQ 2HQEA 4UP7A 1YZ6A 4PNYA 1STGA 1KAWA 1E7ZA 4O2DA 1GM5A 2ZXRA 3DM3A 1BF4A 1HFGA 1YHBA 3CC4A 5M9OA 1KTKA 1O7ZA 2F0KA 2F0OA 2A6ED 4A3GG 1KRTA 1KXLA 3JAMi 1WOCA 1U9RA 1NTGA 4RAUC 1CQVA 1NUCA 3C3LA 2JQOA 2KCNA 2JA6B 2ENBA 4CDDC 3K58A 3MXGA 3H91A 1QB5D 1E1OA 2F0DA 1BVSA 1HQMC 2R7DA 1CTMA 3PO2H 1UUPA 2EJFC 4BY7H 2VUMG 1LT5D 3HOWB 4QIWB 5ELFA 2JXMB 4GKJL 3RMHA 4B3RL 3PO2B 5CBEE 3NELA 1PXUA 4HEDA 2XIWA 4R9WA 2DJFC 1TXYA 3AEVA 3D6CA 1UE6A 4DK6C 2RSNA 3UE0A 1ILQA 1E0BA 1SJHD 1PV4A 3PF5A 2AQ2B 1N8RC 4HN7A 2MNAA 2V1CC 1GUGA 1O7IA 1VMPA 1I4PA 1PZID 3E0JA 4P72A 4CKCA 2A6EC 1S5CD 5JJIA 4LUVA 4JK1C 5EQ0A 2B39A 4JI2L 1CKMA 1B2TA 4A3MH 2JA5B 1V43A 2LXJA 2I5LX 3MAQA 5KNBA 1JWMD 3WOEA 2NVQB 4Y7NB 3PV0A 4GKKL 1EIFA 3OW7A 2ES2A 2ZM6Q 1PDQA 2O5IC 3CKIB 1DOKA 3BDCA 4UHVA 4G7HC 4QQBX 1CHQD 1QZGA 1ESRA 2HDLA 3VYSA 1PH1A 1IW7D 2LMCB 2X6GA 5M5XH 4EQ5A 2KCCA 5LMNL 1V8QA 2JEBI 1P16A 1HUNA 4L63B 5EBDA 2KHIA 4HMIA 3K57A 4B3MQ 1AZQA 4N8X1 5C0XJ 3SK6A 5HGQA 4IO9A 1Q7YC 4IPDA 4DK0A 4GN3B 4H7BA 2E2HB 2ZXOA 3HOUH 2K05A 4JI7Q 4A3CH 2KHJA 4GN4B 5BN5A 1Y8PB 1Y14B 1I50B 2XRQD 1PH6A 2DY7A 4R4TA 1AE3A 4KN4C 4A3MB 4IUVA 3VR5A 3G4SA 4KHPL 1BCPC 3EROA 5J3BA 1PHJA 1BCPF 1BOSA 2L55A 4TQUS 4AYBG 4BA1I 3U4VA 4BBRB 3VYTA 2ZXPA 2R92H 3AB9A 3R3OA 4RMFA 3NBHB 3H6MA 2R93B 1X55A 5BR8Q 4R8IA 1K3BC 5E4WC 5M3MH 4FNFA 5ELOA 2Z6KA 1VQAA 3HOXG 2CFMA 2BCOA 4B9XA 1OXVA 5GQOA 3UE1A 4MN3A 4TKOB 2KEEA 2CW0D 5TSSA 4CJ2C 1B9NA 1PRTD 1PZJD 5D3DA 4IUPA 1L2FA 4A3DG 2Z4IA 1IZ6A 2VB3X 2Q8TA 3X3MA 1G51A 1VQKA 1K0RA 2EIFA 3S14B 3J81E 3S14H 5I9OA 1E2VA 3HKZG 1YVCA 2QA4A 3G71A 3B6YA 2RHSB 4U673 1SRUA 4WJ4A 1PTOB 1STYA 3DXJC 5E4XA 2GN5A 1EEID 3C1FA 1F9SA 1NJIC 1XPRA 4B08A 2QF7A 1BKBA 4M1UB 1M90C 1QUQA 2H1EA 4HMJA 2VQEL 1JICA 1YEZA 2F3WA 1FVIA 1RJTA 5IT9c 3STBD 2FINB 4N9TA 4X3UA 3TP8A 5C4HA 4CBVA 1IBLQ 1BDOA 1ONLA 1I4XA 3LX0A 5KYLA 1YBYA 2B2VC 1HRJA 4GZYC 2R7ZG 4DUZQ 2A5HA 3N6RA 3CCEA 4DXFA 4XT1B 1TWHH 5IYBG 5EJWA 1TKWB 2KEDA 1G6ZA 4JYAL 2YU9H 4C3IH 2EPBA 2VW9A 1QCBD 2CVRA 4A3LG 3MHBA 1F77A 1B50A 3I7FA 4X62L 4HSPA 3OWEB 4HCEA 4C2MB 3IFTA 1QNKA 1S5ED 4C3HB 4DKAC 2M2LA 3NHHA 1FNWA 4TVAB 4A3LH 1SE3A 2K50A 4DAYB 2TMPA 3AYHB 1X3FA 4DV7Q 1WJJA 5M5YB 4FF2A 1DXMA 3BYYB 2VL6A 4DV0Q 4PMBA 4KKUA 5C4XG 3GTGH 1G91A 3AFPA 2X6LA 2UU9Q 4DAMA 1AP0A 2Q8IB 2NZHA 1KC8C 1BBWA 2PZWA 1J8IA 2N49A 4X66L 1B70B 1HPCA 4CDFC 2VS1A 2B8GA 3QO2A 1SMXA 2PZUA 3I73A 4PG3A 1VCIA 3QIAA 3QB3A 3R8BA 2VZAA 3KFUA 4FF4A 4DR7Q 2B29A 4R4QA 3J80E 2IX3A 3RNUA 2Z6BA 4KY5A 1GUOA 2H4OA 2B2UA 1IBKQ 1VMCA 1HR0L 1WFQA 1XMOL 3LNNA 1GUTA 2NN6H 1Q90A 4UP9A 2OQKA 2E74C 2F0FA 2DGYA 4YCWA 3I4NG 1SNDA 4LJZC 3KK7A 3K6OA 3PQIA 1GHJA 4JBJA 4DR6L 1RDPD 2O4XA 4DV2Q 3D8GA 3HOYH 1HTPA 5A2QL 4A3CG 1OXUA 2ICIA 4ABNA 2UXBQ 1EIHA 2EY2A 4IJHA 1B1ZA 2DJGC 4EVOA 1Z47A 2K32A 4EQOA 4RH6A 1CQFA 1ICFB 3RZOH 3GD7A 4XT3B 3LWUA 1LT4D 1EUJA 2O5JC 1Q82C 2I5HA 1KD1C 1HNXL 1JCKB 4KY6A 4G57A 1ET6A 2AUJD 4QF4A 1VQCA 1U4LA 4QY7A 2C5CA 4I7AA 2EOTA 4BY1G 3IAYA 3S2HH 3HRZC 1HNWQ 2EYPA 1V1PA 3URYA 1IYUA 2B2TC 2G9HD 1XX8A 3PIOA 1NNXA 2E2DC 3ZJYC 3P1HA 4BBRG 4JVZA 2EJGC 2Z8LA 3TP7A 4I65A 3CCSA 1C9OA 1IBLL 3ERQA 4DNRB 2NVXB 1Y1VH 4DV3Q 5CBAE 2QKIC 4F7XA 2EYOA 3TMEA 2UXDQ 3O13A 1NMFA 2F0NA 1MI2A 1TWFB 1EYAA 2NVXH 2HCIA 3OMGA 1HA5A 4ZQ3A 4DUYL 4A3FH 2R92G 4RCOA 5I6YA 3TBIB 2KECA 4JI3Q 3PIPA 1JOQA 3QOLA 2BA0A 1G2TA 5C44H 2K5HA 3PMFA 5A2QE 1YITA 3RZOB 2MPMA 3A0JA 3OMCA 4R4IA 3S1QB 1EU3A 1SN8A 2DUDA 3SVMA 1XTCD 2Y0SE 1O78A 5JPNC 3R2TA 5E7NA 2B2YC 2NYZD 2CWAA 3DMUA 1HH2P 3KBGA 4KK7A 2QGQA 2ALYB 1SJED 4FXGC 3I4MB 4XYOA 4X65L 1ZYRD 1T9HA 3H3VC 3D4WA 2XSCA 1E3PA 2FMCA 4DV7L 3QG1A 4ZRZA 3P20A 4KD3A 1G2SA 1LABA 3W2DA 3OPOA 4NPSA 3K81C 4JI1Q 4JI8Q 1RKNA 1QVCA 4LF8L 5NUCA 2NBFA 4DR3Q 1B7YB 4FDBA 4OHJA 1J9OA 2IY5B 1W3SA 4WRDA 3CQZB 1ICWA 4QCLA 2RBMA 1IYJB 4DV2L 3H09A 2QDBA 2LFNA 4JOIC 4ZKBB 1CKNA 1HZAA 3I90A 1SXTA 3BVGA 1VQDA 2K1BA 2WKCA 4RGMA 3E0EA 3M85A 1Q3LA 3C1EA 1WTRA 4ALPA 5ELEA 3ICEA 2F3VA 4L5TA 2LSSA 1AZPA 1IBKL 4BBSG 5DEHA 2JSOA 5JVH3 4TSSA 4HCSA 3GTKB 3NQTA 4HJ7A 4JV5L 2NN6I 4A93G 3NP8A 3S1QH 1I6HB 3IKJA 4PMWA 1DGSA 1Y8OB 3VA7A 4HSVA 3S1NH 4A3JH 3NPPA 1PZKD 3E3XA 3T56B 3WOFA 2H5XA 2K5QA 4DNTB 3NTHA 1C7YA 4DV5L 2F0LA 2KOLA 2D5DA 5J1ZA 1SE2A 3I4LA 4KN7C 4O0AA 3GO5A 1RD9D 1LTSD 3NUCA 1KNEA 1CKNB 3DHQA 1NR2A 1SYBA 2IL8A 1VQ8A 1TWCB 2KQ3A 1SLJA 2ICEC 4LAAA 3A8JE 5IE8A 2F0EA 2FFKB 1OXXK 2RF4A 2YU9B 5KNCA 2RDFA 4IUTA 3VA5A 1FR3A 1TWHB 1MJEA 5C3EB 1STBA 3CAMA 1X3QA 3HS0C 2WB1G 2EVBA 2MHVA 3NBIA 4LMQD 2F52A 3K8AA 2WP8J 2F03A 2EXZA 1SFOB 2RDGA 1VQ6A 1EEFD 1A3UA 3DUZA 4LF7L 4O1NA 3A5ZB 3P7JA 5FKAC 2NVYB 4OGQC 1W2BA 1C4QA 4ZCKA 1I3QH 3BZDB 3S1MH 1HNZL 2R7FA 1QOHA 1U0LA 4Q5VA 1E2WA 4OIJA 1DOLA 1EQVA 4YHHQ 1QNUA 3HOZH 3NXWA 3MFGA 3M4QA 1FYCA 4J15A 4K8IA 2A19A 4JOIA 2HQLA 2EYMA 2UUAQ 3VR2A 4DR7L 3C2PA 3NBHA 4L5SA 4EX5A 1IW7C 3R2IA 1RHPA 3CMAA 4YCUA 5IOCA 5D14A 5T1IA 5M3MB 1KHIA 5CC4A 1WTXA 4BY7G 4A4IA 1TWGH 5EPJA 1WD0A 4QJFA 2CH4A 2IWHA 3NQIA 4CJ0B 3DEPA 2UXDL 4I7ZC 3J80c 4DPGA 1A2UA 1IKMA 3RLOA 2JP1A 2NVQH 3T1YQ 1HNZQ 2D0OA 3NTKA 5ISRA 5FOBB 3MFYA 1RCVD 1PA6A 5C0XH 1WVLA 1A62A 1HTLD 4BS9A 4ULLA 2F0HA 4LF7Q 2WINB 2FMMA 2UUCL 1TWFH 1Q1EA 4R8NA 4KI0A 1ZXTA 1SYEA 5M5YH 3JAML 3T16A 1CT1D 1O7LA 1FJGL 4K14A 1VQ5A 4KTAA 3S24A 3TEHB 5LHY1 1WTOA 1NSNS 1UE7A 1L0XB 4JI4L 4MIUA 1YIJA 1PYBA 3U58A 2IJ0A 1B8AA 1BBXC 3H0GG 1BQQT 1LTID 4X6AH 1I94Q 2HHHL 4DV4Q 2VUMB 3TN2A 1N36L 3GTQH 4KV6A 3JC66 1VQMA 2KUMA 3H0GH 2E5LL 1E2ZA 3I56A 4P73A 4R1JA 4DR4Q 1EL0A 5C0XI 3CCQA 5LMNQ 1TY0A 1SMYD 3PGZA 1ESFA 3U4ZA 4HR7B 1LT6D 5HURA 3J7AF 4KJOA 2K6AA 4DFAA 2DNCA 2AHOB 3CW2C 3NK9A 3PUYA 2K7VA 4NMZA 1B3AA 2NZOA 4DV1L 3J80L 1XMQL 1KQSA 1D1IA 1CI3M 3PCOB 2PW5A 1E22A 4DK1A 1SFOH 1VQGA 4LF6Q 1NBWA 3OOCA 2JA5G 2XN9C 2VB2X 4MHEA 4PZ8A 1GVPA 4RHSA 1DM0B 4LW1A 1PYSB 3NWTA 3GTJB 1TWAH 2HIXA 3L7ZC 2R6GA 4DK3C 4DR2Q 1EQQA 3KLWA 5L37A 1LTLA 4UP8A 3OIQA 1GJXA 3S2HB 4OO1G 4KKSA 1CSQA 3KOJA 5IGDA 1Y1VG 4IPGA 1SE4A 4JI1L 2OTJA 3TP6A 1QZHA 4EGVA 4A3EH 1JT8A 1B44D 1NAPA 2KENA 3FMCA 3HFZB 3RZDH 3K0XA 5C4XB 1V9PA 3TREA 1RTNA 2A6HD 1SBBB 4AQYL 2JYOA 4OONA 3CPWA 4NW2A 4G7OC 2BH8A 1CZGA 1KL9A 3I4OA 4X3SA 3P75A 2BA1A 4DR6Q 1J6QA 5IP9G 3AFQA 2B2WC 2WACA 1EZ8A 4KLKA 2XTIA 1I4HA 4F88A 3Q6SA 4LWCA 2L5TA 1WCMG 2A68C 3OHXC 1K8GA 2A73B 4G7ZC 3DWQA 1XXGA 2WV6D 3H15A 3BVMA 1CA6A 2QILA 3K7UC 5IYDG 1GUSA 2D62A 5E1FA 2A68D 3U9OA 1HXYD 4XQQA 4K2LA 4A3IH 4LFAL 1XNQQ 5JEAH 1KABA 2LY7A 1UAPA 4XQNA 3EVQA 1Q8IA 4JI5L 1EYGA 4K0KL 5M5WH 2N8NA 1NMGA 5JPMC 3HKZB 4OEMB 2RVLA 4S3SA 2M9VA 3FDTA 4HIDA 2JA8G 2VXWA 1TIID 3SDZA 1LTGD 3CQZH 2WB1E 2EY1A 2ASBA 3E9HA 3HGBA 4PV1C 3V05A 2HUGA 1CKOA 2PMZE 1C8CA 2E2JB 4AQYQ 1VQOA 2K28A 2YV5A 4A3DB 4MNOA 1MBYA 1L1OA 4H02A 4CJ1B 5G3LD 3C46A 1QWYA 2EYJA 1SE8A 3SHLA 2KA7A 5C5MA 1UEAB 3KJOA 2D9UA 4NXML 2E2HH 1A0IA 1EWHA 4A3JG 1A3TA 5ELBA 1I3QB 1EFID 1JB7A 4NB3A 1F2ZA 1D8LA 4DGZA 1FD7D 5KNDA 1H9MA 4HJ5A 1Q1BA 1PH3A 4IUUA 3CMEA 1D1KA 1E1TA 5IY0A 2OCEA 1JOOA 4BWGB 3K0YA 3F2BA 3SK8A 1QG7A 5C4JH 1PVOA 5JJKA 4A3MG 1VDZA 3SEBA 1SR3A 1ML0D 4POFA 1HR0W 4R4OA 5F2DA 4QMGA 4J8QA 2VNUD 2AWOA 1EOTA 2EJMA 1TWCH 2RDHA 2R61A 4P74A 1QUQB 2JK8A 3CCRA 3NENA 2EZVA 1R4QB 3M3YB 4M8AA 2UUBL 3HKSA 4JPBW 2B3GA 2R3ZA 2A74C 4GOPC 3TS0A 1FGBD 4O42A 1H9RA 3Q24A 4HIKA 2L0CA 3GTMB 2DN8A 3UDXA 4V0BA 2K52A 3G6EA 4A3KB 3W1BA 2ZM6L 1YNXA 3Q23A 2AQ3B 1CUKA 3HOZG 3V96A 1KDBA 4NXMQ 1Y1WB 2CQAA 1DZ1A 4Q0FA 1HZBA 1AH9A 4A3BB 3PO3G 1VQIA 1YHQA 3ULJA 3GTLB 1JORA 5EBCA 1I4GA 3ITPA 1FJGQ 1OXSC 2Z4HA 4JI2Q 4P2CB 4MTNA 3VYUA 4BY1H 3KF8B 4LNQA 1XNRQ 1PH9A 1S5DD 4GLXA 3M9BA 3ND9A 4L5QA 4NP5A 5KYIA 2A69C 5C4JB 3T4AC 2PMZB 4BBRH 3K5MA 1X54A 1NE3A 3EFXD 3KF6A 1VQ9A 2BE5D 3I8ZA 1DONA 2JA5H 2N55A 3T1YL 1SNMA 5FLMH 5FLXE 4LUZA 1MGSA 1BUVT 1TWGB 1YNND 5D3IB 1X32A 2JN4A 5CV8A 2YTYA 4WJ3M 1VQBA 2MJ8A 1B9MA 2F0IA 3HOXH 4L8JA 4AIMA 1CHPD 3A55A 3LWEA 2HDMA 4HIOA 2PW7A 3CD6A 5JVG3 2E2IB 1NCVA 3U50C 2IX1A 1EYDA 3TP5A 2OWOA 3TSSA 4IPHA 3GTPH 4RA8A 1EU4A 2K5WA 3SR1A 3VR3A 1VQFA 2RA4A 2UXCL 3HOVG 4DV4L 4JW0A 3KLSA 1F2YA 3BU2A 1WD1A 1PH4A 3BG3A 2EYHA 1PTOH 1S5FD 4A3GB 3SK5A 1TWAB 1QE6A 3A54A 4ZAIA 1B3QA 3DWPA 5DNFA 4MTKA 5AFWA 4C3IG 3VYRA 2WB1B 1YJNA 1VF7A 2ZTEA 3KF8A 1LT3D 3CRKC 3RN2A 2JA7B 3KDFB 4P71A 1MSHA 3PO3B 3STBC 4XTCS 3RUZA 4QGUA 2JA8B 3IRBA 1K3RA 3CCJA 2OTLA 1A6XA 1EQTA 1OTCA 1HHVA 3CCMA 5IT9E 4AYBB 3EIVA 5EAYA 3K80C 1ZEQX 4F8MA 1MIUA 4IUQA 1TQOA 1VQHA 5I4DA 4ZUIA 1SYDA 1RL2A 2Y0SG 1X9NA 1KDAA 3FRPB 2D0PA 4POGA 3GTMH 4G4KA 4K6LA 3I4MG 4C3JG 3H0GB 2NVTH 1IBMQ 2NUCA 1CA5A 1JJ2A 4V190 1XYIA 3GTQB 5C3XA 4LFAQ 1XNQL 1XMQQ 4DV1Q 4B3RQ 3W5OA 3CP0A 5CV6A 1JWUD 3KDFA 4PZ6A 1S5BD 3S17B 3HOYB 1D7QA 2B2YA 2F4VL 4JBKA 4L5RC 1O80A 5C6AA 1JJGA 1FNUA 5A35A 2J7ZA 2RCNA 4NKLA 4LF4Q 1U5KA 2DNEA 4P75A 4C1NK 4X64L 3GV3A 2PNHA 3ULLA 1K0SA 4JC0A 2J0TD 1SYFA 2K04A 5JJZA 2ZT9C 4K5WA 4OO1H 3NE5B 3CCVA 2P5ZX 1WI5A 2E8GA 2GVBA 4LF4L 1GXDC 3J7YW 1U4MA 2Q2IA 3GTKH 1KNAA 1QJOA 3J81i 2Q2TA 3X3NA 1I94L 4JV5Q 5FO9B 3S1NB 1M1KC 5CV7A 1K73C 1WCMB 4WJWA 2XNAC 4CDEC 5M5WB 4QB4A 4A93H 4ZLTF 1IBML 3HOXB 1O7YA 4GLAC 1IL8A 3EA6A 2F4IA 4A93B 2NVTB 3S1RH 1LM0A 5KIXA 2EY5A 2CH4W 2Z0SA 3FPUB 5DM73 1STAA 1LLRD 1BBUA 3E5SA 1B53A 1K28A 3KYHC 3IL8A 1KLGD 4Y7NH 1MD2D 5C3EG 5IGFA 3D4DA 1TS3A 2K5VA 5FLXL 1KLUD 2PQEA 4OL7A 3F2DA 4A3GH 3SXHA 1HQRD 2ZJPA 3D31A 1STEA 2JEAI 1R9TH 4X3KA 3GP7A 4OO1I 1VQPA 3KBXA 2CHBD 4GKJQ 1ENFA 2VQFL 5FJ8G 2OF1A 1JWSD 3PSIA 4IN3A 1F9RA 1VQNA 5KRUA 4XXEA 3S16H 4WFN3 1X3EA 2F0UA 2WIIB 2B63B 1D5XC 1IKLA 1TR5A 1VQEA 3DM1A 1WTVA 5IP7G 3GDEA 1CSPA 1RTOA 1EYCA 4UY8C 3K7AH 3DEOA 3V2TA 4RWSC 4A3FG 3S16B 1MKHA 3S1MB 4DR4L 3OTOQ 2Z1CA 1KAAA 2FXQA 5LMNW 5GAEC 2OT2A 1F2MA 3PIO3 2BDNA 2UUAL 3DWAA 1LTBD 4ZK9B 3M3YH 1XJVA 2I5MX 4K5VA 2R92B 5IGGA 3M7NA 2CKZB 2F0QA 4DAPA 4A75A 3MWYW 4JI0Q 2L12A 2CCZA 3MXNA 4JI4Q 2PO4A 5C0XG 2XWJB 2N88A 4KKTA 2F0VA 2GA4B 4FXDA 2WAQE 5DAUA 2Z9HA 1VQ4A 1ASZA 2O2LD 4FF3A 5GROA 4FF1A 2YTVA 1XNRL 5C44G 3S15H 4B3TL 4ZUJA 4BXXG 5IIFA 5CV9A 2Z6KC 4FO2A 2AQ1B 1H9SB 1N32Q 3S9WA 2ID0A 2NWGA 1QILA 1G8ZD 1UE5A 4QL5A 2RHQB 2RSOA 1J5EL 2IHFA 1JB3A 4LF5Q 3MXPA 1Y1WH 1M4VA 1G6PA 3QOJA 3HOWH 2K5NA 4CHTB 1T5XD 4DR5L 4LFCL 2IW3A 3OW2A 3HOVH 1PFMA 2B2UC 4UPAA 3GTGB 1Q86C 4H44C 1L0WA 1PH2A 1ZYRC 2K33A 3BJUA 3G6JB 3CPFA 3HOUG 4DV5Q 5FLXc
chains in the Genus database with same CATH topology
4LWCA 1HZCA 2N49A 1WCMG 4X66L 3H3VI 1B70B 1K8AC 1Z9FA 5GAHC 2VS1A 1SMXA 2CQOA 4HJ8A 1K8GA 1IXRA 1V1QA 5K36G 2A1AA 4PG3A 1VCIA 3H15A 1YJWA 2VZAA 5M3MG 3KFUA 1E24A 4DR7Q 3KJPA 2B29A 2VQEQ 3K7UC 4R4QA 4JI7L 5IYDG 3FKIG 4LFBL 2D62A 1WYDA 3RNUA 4DNIA 3J7A5 4GNXB 4LFBQ 4IPCA 4JG2A 5ELNA 2KCMA 3ERSX 1EWIA 1IBKQ 3T1HL 1HR0L 1GKHA 1WFQA 1XMOL 1VQLA 4OWXB 3GTLH 3J7ZC 3OTOL 3W1GA 3UDGA 4A3IH 2E5LQ 4LFAL 4GNXA 4DV3L 3EBEA 4X66Q 4LF9L 1XNQQ 4GKKQ 4UP9A 3PUWA 2OQKA 4BBSH 2C35B 1JE5A 3D0FA 4JI5L 4X64Q 2K4KA 1EYGA 1A63A 4HIMA 4YCWA 2DGYA 3I4NG 4K0KL 5M5WH 2CWPA 2N8NA 1NMGA 5IYCG 1QVFA 3CXCA 4JBJA 4DR6L 4DV2Q 2F4VQ 5IWAL 3HOYH 4HIDA 2JA8G 4A3CG 1OXUA 2UXBQ 4IJHA 4QIWE 3CQZH 2WB1E 2MO0A 5LMUL 4NXNQ 3E9HA 1Z47A 2ASBA 1HNWL 3TS2A 4AYBE 1CKOA 4DV0L 2PMZE 2R93H 3F1ZA 4AQYQ 4YWLA 1VQOA 4JI8L 2YV5A 4YWKA 4MNOA 4LF5L 1L1OA 4H02A 1LYLA 3GD7A 1Y1WG 3RZOH 1H95A 1EUJA 1SE8A 1Q82C 2I5HA 1KD1C 2IHEA 1HNXL 2EXDA 3J81j 3WWVA 2I0QA 3KJOA 3FP9A 4NXNL 2E2HH 4NXML 2EQSA 5DLQE 4C3JH 1A0IA 1VQCA 4HJ9A 4QY7A 4IFDJ 1I6HH 4A3JG 4BY1G 3CCUA 1JB7A 3S2HH 2GVAA 4NB3A 2N78A 1N32L 1HNWQ 4JYAQ 1D8LA 4APVA 2UXBL 1HJPA 4LUOA 4DR2L 2PQAB 5IWAQ 3ULPA 5IYBH 2JJQA 3PIOA 1VS0A 4JI5Q 4HJ5A 1Q1BA 3ZJYC 1S3OA 4K0KQ 1PH3A 4BBRG 3CMEA 1E1TA 4LF6L 2UUBQ 3CCSA 1C9OA 2AMCB 3NEMA 2OCEA 5IY0A 1IBLL 4A3KH 3FHWA 1Y1VH 4DV3Q 5AJ3L 1IL2A 3F2BA 3HKZE 5C4JH 1PVOA 2UXDQ 1NMFA 1X6OA 5JJKA 4A3MG 3F2CA 5FJ8H 1K9MC 3J81c 1SR3A 4JYAL 4POFA 3T1HQ 1K83H 1HR0W 2NVXH 4R4OA 4A3FH 4DUYL 2R92G 2VNUD 2AWOA 1QVGA 4JI3Q 3PIPA 1TWCH 1NY4A 3JAMc 2BA0A 5M3FH 3UDFA 2WAQG 3GTOH 1EQRA 5C3EH 4P74A 1QUQB 2JK8A 5C44H 2K5HA 3CCRA 3NENA 4XIGS 2ZTCA 4ME3A 5JJLA 2UUBL 3HKSA 2JA7H 4IOCA 2B3GA 1WCMH 1YITA 1EFWA 1N33Q 4R4IA 3A0JA 4GOPC 4Y52H 2DUDA 1SN8A 3TS0A 2HHHQ 2Y0SE 3DLLA 1JMCA 3PUXA 1N36Q 1Q81C 2N3SA 3F8TA 5E7NA 4A3EG 3I4MH 2JA6G 4A3DH 4GS3A 1L1OC 4HIKA 2CWAA 1HH2P 3UDXA 4YY3L 2VQFQ 2K52A 2QGQA 3G6EA 3W1BA 4HJAA 2ZM6L 1YNXA 2VY3A 2ALYB 2ZJQA 3L0OA 2ZTDA 4YHHL 1CUKA 3HOZG 4X65L 1UE1A 1T9HA 4NXMQ 3CC2A 5C4XH 1E3PA 3BZCA 2JA6H 4IOAA 4AH6A 4DV7L 5IP7H 3RR5A 3S17H 1J5EQ 1HZBA 1Q12A 1AH9A 3L2PA 3E9IA 2YTXA 2B63G 2K75A 3PO3G 4NPSA 1VQIA 2KCTA 3ULJA 3K81C 4JI1Q 1YHQA 4JI8Q 1VQJA 1FJGQ 1OXSC 1QVCA 4JI2Q 4LF8L 4DV6L 5GADC 4C3HH 4MTNA 4X65Q 4DR3Q 4BY1H 1VQ7A 1B7YB 4JI6Q 1P8LA 1LUZA 4FDBA 3KF8B 1MJCA 3RLNA 2XGTA 4JI6L 5LMUQ 1JJCB 3RLFA 1PH9A 1W3SA 4LNQA 3KF6B 1XNRQ 2IY5B 1N9WA 4LF8Q 1UWVA 1IYJB 3M9BA 4GLXA 1XPOA 4B3SQ 2IX0A 4DV2L 1EIYB 4L5QA 1PH5A 3H3VH 4JOIC 2UUCQ 2Q2UA 1CKNA 4BBRH 4UP7A 2YYZA 1HZAA 1X54A 1NE3A 1VQDA 1YZ6A 2K14A 3E0EA 3KF6A 3M85A 3SGIA 1KAWA 1VQ9A 4JBMA 4YWMA 1E7ZA 2JA9A 4OXPA 3HOWG 4O2DA 2JA5H 1YJ9A 1GM5A 3T1YL 2R93G 3DM3A 5FLMH 2AWNA 4ALPA 1GO3E 1YHBA 1ASYA 3CC4A 3ICEA 4LUZA 2QEXA 2LSSA 4L5TA 1IBKL 4BBSG 2YTYA 4WJ3M 1VQBA 3HOXH 4DUYQ 4MZ9A 4A3GG 4BXXH 1KRTA 4HJ7A 4AIMA 4JV5L 1KXLA 5JEAJ 2NN6I 3JAMi 4A93G 3S1QH 2KBNA 1WOCA 4PMWA 2PQAA 1NTGA 1DGSA 4HIOA 4IFDI 3CD6A 3S1NH 4RG1A 4DR1L 4A3JH 3U50C 2JQOA 1N34L 4R4CA 2IX1A 2OWOA 1OXTA 1KRSA 1N34Q 4IJLA 4IPHA 3GTPH 2H5XA 1G291 1VQFA 1C7YA 4DV5L 1E1OA 2UXCL 1BVSA 2R7DA 3HOVG 4DV4L 3PO2H 3FKIH 4O0AA 4BY7H 3GO5A 2UU9L 2VUMG 2ATWA 3A74A 3BU2A 1PH4A 1CKNB 4GKJL 4B3RL 1VQ8A 4LFCQ 3NELA 1SLJA 5IE8A 1OXXK 2RF4A 1PFSA 1YJNA 1TXYA 3AEVA 2ZTEA 1X65A 3RN2A 1HNXQ 1UE6A 3HOYG 3KDFB 4P71A 4DK6C 3STBC 4XTCS 3UE0A 4QGUA 1MJEA 1PV4A 3IRBA 1K3RA 3CAMA 3CCJA 4OWTB 3PF5A 2OTLA 4B3SL 1OTCA 1N8RC 1PH8A 2MNAA 2V1CC 3CCMA 2WB1G 2E2JH 1O7IA 3EIVA 5EAYA 2F52A 3K8AA 2WP8J 3K80C 4OX9Q 4P72A 5BR8L 1MIUA 3M4OH 1XPUA 1VQHA 5JJIA 3BZKA 4LUVA 4YCVA 3LGJA 1VQ6A 4GN5A 4JI2L 1CKMA 1RL2A 4B3TQ 2Y0SG 4A76A 4LF7L 2JE6I 1X9NA 4A3MH 3A5ZB 2D0PA 4POGA 1V43A 2LXJA 5H1SE 2I5LX 4JBWA 3GTMH 1UEBA 3J80i 3I4MG 1W2BA 3I2ZA 4C2MH 1I3QH 2MQHA 5IP9H 3S1MH 2NVTH 1HNZL 2R7FA 1IBMQ 3EN2A 1U0LA 1JJ2A 3PV0A 1YI2A 4KHPQ 4GKKL 4LFAQ 4GLVB 4YHHQ 1XMQQ 1XNQL 1EIFA 4DV1Q 3HOZH 4B3RQ 3W5OA 3CP0A 2ZM6Q 1XMOQ 2ES2A 3M4QA 4J15A 1X56A 1HR0Q 2LXKA 3KDFA 4PZ6A 4QQBX 1QZGA 3AQQA 1D7QA 2F4VL 4JBKA 4L5RC 1JJGA 2A19A 1PH1A 2MO1A 4JOIA 1L1OB 1S72A 2HQLA 2RCNA 2UUAQ 2PI2E 4LF4Q 1U5KA 3MXNB 4P75A 4X64L 3ER0A 5M5XH 4DR7L 1YHAA 2UXCQ 4EQ5A 5IYDH 5LMNL 4L5SA 2PNHA 3ULLA 4EX5A 2JEBI 4JC0A 1P16A 4LF9Q 4DR1Q 3G48A 3CCVA 2KHIA 2HT1A 5GAGC 3I55A 1WI5A 3CMAA 2E8GA 4YCUA 4B3MQ 2GVBA 5C0XJ 4LF4L 5HGQA 4IO9A 4JI3L 2Q2IA 1Q7YC 4IPDA 3GTKH 5IYCH 4GN3B 2L15A 1KHIA 3J81i 4A3IG 2Q2TA 4BY7G 4A4IA 3HOUH 3RN5A 1TWGH 2HIVA 1I94L 4QJFA 4JV5Q 4JI7Q 4A3CH 1M1KC 2KHJA 4GN4B 1K73C 2UXDL 1Y14B 3J80c 4DPGA 4DR5Q 1PH6A 3RLOA 4A93H 4R4TA 1AE3A 2Q2HA 2NVQH 3T1YQ 1HNZQ 2D0OA 1IBML 3G4SA 4KHPL 4GLAC 1PA6A 2AKWB 2NVYH 5J3BA 1PHJA 1A62A 2F3IA 2R7ZH 3S1RH 4TQUS 4AYBG 4BA1I 1LM0A 4LF7Q 3U4VA 2UUCL 1XTDA 2Z0SA 1TWFH 1Q1EA 2WFWA 3CC7A 4KI0A 2R92H 4OX9L 1BBUA 1SROA 4RMFA 3KYHC 5JEAG 1FL0A 3NBHB 4DR3L 4IFDG 5M5YH 1X55A 5BR8Q 4Y7NH 5C3EG 1AE2A 5M3MH 2K5VA 5ELOA 1FJGL 3PUVA 3PO2G 2Z6KA 1EOVA 1VQAA 3HOXG 3F2DA 4DUZL 1VQ5A 4A3GH 3GTJH 2ZJPA 3S24A 2CFMA 3PUZA 3TEHB 2JA8H 1OXVA 3D31A 5GQOA 1UE7A 3VDYA 4PZ7A 3UE1A 1R9TH 2JEAI 2JA7G 4OO1I 1VQPA 4JI4L 3PF4A 4GKJQ 1YIJA 1PYBA 2VQFL 4GOPB 3U58A 4JI0L 4YY3Q 5FJ8G 1B8AA 3H0GG 1L2FA 3PSIA 1VQNA 4A3DG 4OWWB 1IZ6A 4X6AH 1I94Q 3S16H 1X3EA 1G51A 2HHHL 1FGUA 1VQEA 1VQKA 1K0RA 2EIFA 4DV4Q 1N36L 3GTQH 3S14H 5IP7G 3JC66 3HKZG 1YVCA 3GDEA 2QA4A 1CSPA 1VQMA 4B3ML 3G71A 3K7AH 4UY8C 2BH2A 3B6YA 2RHSB 4A3FG 4DR4L 3H0GH 1MKHA 3OTOQ 2E5LL 3I56A 4P73A 1SRUA 2FXQA 4R1JA 4WJ4A 4DR4Q 5LMNW 2GN5A 3Q8DA 5C0XI 3CCQA 3CCLA 5GAEC 5LMNQ 2MFIA 3PGZA 3U4ZA 1NJIC 2OQ0A 1Q8KA 2UUAL 1XPRA 3M3YH 4KHZA 1BKBA 2I5MX 3M4PA 1XJVA 1M90C 3S2DH 1QUQA 2VQEL 2AHOB 3M7NA 1S40A 2CKZB 3CW2C 3PUYA 1YEZA 5AJ3Q 4A75A 4JI0Q 2CCZA 3OYYA 1FVIA 2NZOA 4DV1L 4JI4Q 1Q46A 2NN6G 5IT9c 3STBD 1XMQL 1KQSA 5C0XG 3PCOB 1E22A 1IBLQ 1SFOH 1VQGA 3UDIA 4LF6Q 1NBWA 1YBYA 2JA5G 1N33L 2R7ZG 3TRZA 4PZ8A 2WAQE 1GVPA 4DUZQ 2B63H 1PYSB 4LW1A 3TQYA 3CCEA 1VQ4A 1ASZA 1TWHH 1TWAH 2HIXA 3L7ZC 5GROA 5IYBG 2R6GA 4DK3C 3I4NH 4DR2Q 1EQQA 3KLWA 1I5FA 1I50H 1LTLA 2PI2A 1GD7A 2YTVA 4UP8A 5C44G 1XNRL 1A8VA 2YU9H 4C3IH 4GNXC 4B3TL 2VW9A 3S15H 4BXXG 5HY6A 2Z6KC 4A3LG 4OO1G 3I7FA 3PO3H 1CSQA 4A3KG 1N32Q 3KOJA 3MEFA 1Y1VG 4X62L 2ID0A 4IPGA 3CF5A 1C0AA 4JI1L 2OTJA 1KIXA 4DV6Q 1UE5A 4QL5A 1HZ9A 2RHQB 4DKAC 1QZHA 1J5EL 2IHFA 4A3EH 1JT8A 4LF5Q 4TVAB 3RZDH 1Y1WH 2KENA 3HFZB 2K50A 4A3LH 3K0XA 4DAYB 1G6PA 1PH7A 3AYHB 4A3BG 1V9PA 3HOWH 1X3FA 4DV7Q 3TREA 2K5NA 1WJJA 2E2IH 2A8VA 5M3FG 4GOPA 1X3GA 4AQYL 4X62Q 4OONA 2VUMH 3CPWA 2IT1A 4BA2I 2BH8A 2VL6A 4DV0Q 4DR5L 4JCVE 4LFCL 1KL9A 3OW2A 3A5UA 3HOVH 1RIPA 3I4OA 5C4XG 2BA1A 4UPAA 3GTGH 4DR6Q 1J6QA 5IP9G 1Q86C 3AFPA 3AFQA 4A3BH 1L0WA 2UU9Q 2ZJRA 5FLMG 1PH2A 3BJUA 4KLKA 2XTIA 4DAMA 3CPFA 3HOUG 2NZHA 1KC8C 4DV5Q 5FLXc 1BBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LWC A;  1HZC A;  2N49 A;  1WCM G;  4X66 L;  3H3V I;  1B70 B;  1K8A C;  1Z9F A;  5GAH C;  2VS1 A;  1SMX A;  2CQO A;  4HJ8 A;  1K8G A;  1IXR A;  1V1Q A;  5K36 G;  2A1A A;  4PG3 A;  1VCI A;  3H15 A;  1YJW A;  2VZA A;  5M3M G;  3KFU A;  1E24 A;  4DR7 Q;  3KJP A;  2B29 A;  2VQE Q;  3K7U C;  4R4Q A;  4JI7 L;  5IYD G;  3FKI G;  4LFB L;  2D62 A;  1WYD A;  3RNU A;  4DNI A;  3J7A 5;  4GNX B;  4LFB Q;  4IPC A;  4JG2 A;  5ELN A;  2KCM A;  3ERS X;  1EWI A;  1IBK Q;  3T1H L;  1HR0 L;  1GKH A;  1WFQ A;  1XMO L;  1VQL A;  4OWX B;  3GTL H;  3J7Z C;  3OTO L;  3W1G A;  3UDG A;  4A3I H;  2E5L Q;  4LFA L;  4GNX A;  4DV3 L;  3EBE A;  4X66 Q;  4LF9 L;  1XNQ Q;  4GKK Q;  4UP9 A;  3PUW A;  2OQK A;  4BBS H;  2C35 B;  1JE5 A;  3D0F A;  4JI5 L;  4X64 Q;  2K4K A;  1EYG A;  1A63 A;  4HIM A;  4YCW A;  2DGY A;  3I4N G;  4K0K L;  5M5W H;  2CWP A;  2N8N A;  1NMG A;  5IYC G;  1QVF A;  3CXC A;  4JBJ A;  4DR6 L;  4DV2 Q;  2F4V Q;  5IWA L;  3HOY H;  4HID A;  2JA8 G;  4A3C G;  1OXU A;  2UXB Q;  4IJH A;  4QIW E;  3CQZ H;  2WB1 E;  2MO0 A;  5LMU L;  4NXN Q;  3E9H A;  1Z47 A;  2ASB A;  1HNW L;  3TS2 A;  4AYB E;  1CKO A;  4DV0 L;  2PMZ E;  2R93 H;  3F1Z A;  4AQY Q;  4YWL A;  1VQO A;  4JI8 L;  2YV5 A;  4YWK A;  4MNO A;  4LF5 L;  1L1O A;  4H02 A;  1LYL A;  3GD7 A;  1Y1W G;  3RZO H;  1H95 A;  1EUJ A;  1SE8 A;  1Q82 C;  2I5H A;  1KD1 C;  2IHE A;  1HNX L;  2EXD A;  3J81 j;  3WWV A;  2I0Q A;  3KJO A;  3FP9 A;  4NXN L;  2E2H H;  4NXM L;  2EQS A;  5DLQ E;  4C3J H;  1A0I A;  1VQC A;  4HJ9 A;  4QY7 A;  4IFD J;  1I6H H;  4A3J G;  4BY1 G;  3CCU A;  1JB7 A;  3S2H H;  2GVA A;  4NB3 A;  2N78 A;  1N32 L;  1HNW Q;  4JYA Q;  1D8L A;  4APV A;  2UXB L;  1HJP A;  4LUO A;  4DR2 L;  2PQA B;  5IWA Q;  3ULP A;  5IYB H;  2JJQ A;  3PIO A;  1VS0 A;  4JI5 Q;  4HJ5 A;  1Q1B A;  3ZJY C;  1S3O A;  4K0K Q;  1PH3 A;  4BBR G;  3CME A;  1E1T A;  4LF6 L;  2UUB Q;  3CCS A;  1C9O A;  2AMC B;  3NEM A;  2OCE A;  5IY0 A;  1IBL L;  4A3K H;  3FHW A;  1Y1V H;  4DV3 Q;  5AJ3 L;  1IL2 A;  3F2B A;  3HKZ E;  5C4J H;  1PVO A;  2UXD Q;  1NMF A;  1X6O A;  5JJK A;  4A3M G;  3F2C A;  5FJ8 H;  1K9M C;  3J81 c;  1SR3 A;  4JYA L;  4POF A;  3T1H Q;  1K83 H;  1HR0 W;  2NVX H;  4R4O A;  4A3F H;  4DUY L;  2R92 G;  2VNU D;  2AWO A;  1QVG A;  4JI3 Q;  3PIP A;  1TWC H;  1NY4 A;  3JAM c;  2BA0 A;  5M3F H;  3UDF A;  2WAQ G;  3GTO H;  1EQR A;  5C3E H;  4P74 A;  1QUQ B;  2JK8 A;  5C44 H;  2K5H A;  3CCR A;  3NEN A;  4XIG S;  2ZTC A;  4ME3 A;  5JJL A;  2UUB L;  3HKS A;  2JA7 H;  4IOC A;  2B3G A;  1WCM H;  1YIT A;  1EFW A;  1N33 Q;  4R4I A;  3A0J A;  4GOP C;  4Y52 H;  2DUD A;  1SN8 A;  3TS0 A;  2HHH Q;  2Y0S E;  3DLL A;  1JMC A;  3PUX A;  1N36 Q;  1Q81 C;  2N3S A;  3F8T A;  5E7N A;  4A3E G;  3I4M H;  2JA6 G;  4A3D H;  4GS3 A;  1L1O C;  4HIK A;  2CWA A;  1HH2 P;  3UDX A;  4YY3 L;  2VQF Q;  2K52 A;  2QGQ A;  3G6E A;  3W1B A;  4HJA A;  2ZM6 L;  1YNX A;  2VY3 A;  2ALY B;  2ZJQ A;  3L0O A;  2ZTD A;  4YHH L;  1CUK A;  3HOZ G;  4X65 L;  1UE1 A;  1T9H A;  4NXM Q;  3CC2 A;  5C4X H;  1E3P A;  3BZC A;  2JA6 H;  4IOA A;  4AH6 A;  4DV7 L;  5IP7 H;  3RR5 A;  3S17 H;  1J5E Q;  1HZB A;  1Q12 A;  1AH9 A;  3L2P A;  3E9I A;  2YTX A;  2B63 G;  2K75 A;  3PO3 G;  4NPS A;  1VQI A;  2KCT A;  3ULJ A;  3K81 C;  4JI1 Q;  1YHQ A;  4JI8 Q;  1VQJ A;  1FJG Q;  1OXS C;  1QVC A;  4JI2 Q;  4LF8 L;  4DV6 L;  5GAD C;  4C3H H;  4MTN A;  4X65 Q;  4DR3 Q;  4BY1 H;  1VQ7 A;  1B7Y B;  4JI6 Q;  1P8L A;  1LUZ A;  4FDB A;  3KF8 B;  1MJC A;  3RLN A;  2XGT A;  4JI6 L;  5LMU Q;  1JJC B;  3RLF A;  1PH9 A;  1W3S A;  4LNQ A;  3KF6 B;  1XNR Q;  2IY5 B;  1N9W A;  4LF8 Q;  1UWV A;  1IYJ B;  3M9B A;  4GLX A;  1XPO A;  4B3S Q;  2IX0 A;  4DV2 L;  1EIY B;  4L5Q A;  1PH5 A;  3H3V H;  4JOI C;  2UUC Q;  2Q2U A;  1CKN A;  4BBR H;  4UP7 A;  2YYZ A;  1HZA A;  1X54 A;  1NE3 A;  1VQD A;  1YZ6 A;  2K14 A;  3E0E A;  3KF6 A;  3M85 A;  3SGI A;  1KAW A;  1VQ9 A;  4JBM A;  4YWM A;  1E7Z A;  2JA9 A;  4OXP A;  3HOW G;  4O2D A;  2JA5 H;  1YJ9 A;  1GM5 A;  3T1Y L;  2R93 G;  3DM3 A;  5FLM H;  2AWN A;  4ALP A;  1GO3 E;  1YHB A;  1ASY A;  3CC4 A;  3ICE A;  4LUZ A;  2QEX A;  2LSS A;  4L5T A;  1IBK L;  4BBS G;  2YTY A;  4WJ3 M;  1VQB A;  3HOX H;  4DUY Q;  4MZ9 A;  4A3G G;  4BXX H;  1KRT A;  4HJ7 A;  4AIM A;  4JV5 L;  1KXL A;  5JEA J;  2NN6 I;  3JAM i;  4A93 G;  3S1Q H;  2KBN A;  1WOC A;  4PMW A;  2PQA A;  1NTG A;  1DGS A;  4HIO A;  4IFD I;  3CD6 A;  3S1N H;  4RG1 A;  4DR1 L;  4A3J H;  3U50 C;  2JQO A;  1N34 L;  4R4C A;  2IX1 A;  2OWO A;  1OXT A;  1KRS A;  1N34 Q;  4IJL A;  4IPH A;  3GTP H;  2H5X A;  1G29 1;  1VQF A;  1C7Y A;  4DV5 L;  1E1O A;  2UXC L;  1BVS A;  2R7D A;  3HOV G;  4DV4 L;  3PO2 H;  3FKI H;  4O0A A;  4BY7 H;  3GO5 A;  2UU9 L;  2VUM G;  2ATW A;  3A74 A;  3BU2 A;  1PH4 A;  1CKN B;  4GKJ L;  4B3R L;  1VQ8 A;  4LFC Q;  3NEL A;  1SLJ A;  5IE8 A;  1OXX K;  2RF4 A;  1PFS A;  1YJN A;  1TXY A;  3AEV A;  2ZTE A;  1X65 A;  3RN2 A;  1HNX Q;  1UE6 A;  3HOY G;  3KDF B;  4P71 A;  4DK6 C;  3STB C;  4XTC S;  3UE0 A;  4QGU A;  1MJE A;  1PV4 A;  3IRB A;  1K3R A;  3CAM A;  3CCJ A;  4OWT B;  3PF5 A;  2OTL A;  4B3S L;  1OTC A;  1N8R C;  1PH8 A;  2MNA A;  2V1C C;  3CCM A;  2WB1 G;  2E2J H;  1O7I A;  3EIV A;  5EAY A;  2F52 A;  3K8A A;  2WP8 J;  3K80 C;  4OX9 Q;  4P72 A;  5BR8 L;  1MIU A;  3M4O H;  1XPU A;  1VQH A;  5JJI A;  3BZK A;  4LUV A;  4YCV A;  3LGJ A;  1VQ6 A;  4GN5 A;  4JI2 L;  1CKM A;  1RL2 A;  4B3T Q;  2Y0S G;  4A76 A;  4LF7 L;  2JE6 I;  1X9N A;  4A3M H;  3A5Z B;  2D0P A;  4POG A;  1V43 A;  2LXJ A;  5H1S E;  2I5L X;  4JBW A;  3GTM H;  1UEB A;  3J80 i;  3I4M G;  1W2B A;  3I2Z A;  4C2M H;  1I3Q H;  2MQH A;  5IP9 H;  3S1M H;  2NVT H;  1HNZ L;  2R7F A;  1IBM Q;  3EN2 A;  1U0L A;  1JJ2 A;  3PV0 A;  1YI2 A;  4KHP Q;  4GKK L;  4LFA Q;  4GLV B;  4YHH Q;  1XMQ Q;  1XNQ L;  1EIF A;  4DV1 Q;  3HOZ H;  4B3R Q;  3W5O A;  3CP0 A;  2ZM6 Q;  1XMO Q;  2ES2 A;  3M4Q A;  4J15 A;  1X56 A;  1HR0 Q;  2LXK A;  3KDF A;  4PZ6 A;  4QQB X;  1QZG A;  3AQQ A;  1D7Q A;  2F4V L;  4JBK A;  4L5R C;  1JJG A;  2A19 A;  1PH1 A;  2MO1 A;  4JOI A;  1L1O B;  1S72 A;  2HQL A;  2RCN A;  2UUA Q;  2PI2 E;  4LF4 Q;  1U5K A;  3MXN B;  4P75 A;  4X64 L;  3ER0 A;  5M5X H;  4DR7 L;  1YHA A;  2UXC Q;  4EQ5 A;  5IYD H;  5LMN L;  4L5S A;  2PNH A;  3ULL A;  4EX5 A;  2JEB I;  4JC0 A;  1P16 A;  4LF9 Q;  4DR1 Q;  3G48 A;  3CCV A;  2KHI A;  2HT1 A;  5GAG C;  3I55 A;  1WI5 A;  3CMA A;  2E8G A;  4YCU A;  4B3M Q;  2GVB A;  5C0X J;  4LF4 L;  5HGQ A;  4IO9 A;  4JI3 L;  2Q2I A;  1Q7Y C;  4IPD A;  3GTK H;  5IYC H;  4GN3 B;  2L15 A;  1KHI A;  3J81 i;  4A3I G;  2Q2T A;  4BY7 G;  4A4I A;  3HOU H;  3RN5 A;  1TWG H;  2HIV A;  1I94 L;  4QJF A;  4JV5 Q;  4JI7 Q;  4A3C H;  1M1K C;  2KHJ A;  4GN4 B;  1K73 C;  2UXD L;  1Y14 B;  3J80 c;  4DPG A;  4DR5 Q;  1PH6 A;  3RLO A;  4A93 H;  4R4T A;  1AE3 A;  2Q2H A;  2NVQ H;  3T1Y Q;  1HNZ Q;  2D0O A;  1IBM L;  3G4S A;  4KHP L;  4GLA C;  1PA6 A;  2AKW B;  2NVY H;  5J3B A;  1PHJ A;  1A62 A;  2F3I A;  2R7Z H;  3S1R H;  4TQU S;  4AYB G;  4BA1 I;  1LM0 A;  4LF7 Q;  3U4V A;  2UUC L;  1XTD A;  2Z0S A;  1TWF H;  1Q1E A;  2WFW A;  3CC7 A;  4KI0 A;  2R92 H;  4OX9 L;  1BBU A;  1SRO A;  4RMF A;  3KYH C;  5JEA G;  1FL0 A;  3NBH B;  4DR3 L;  4IFD G;  5M5Y H;  1X55 A;  5BR8 Q;  4Y7N H;  5C3E G;  1AE2 A;  5M3M H;  2K5V A;  5ELO A;  1FJG L;  3PUV A;  3PO2 G;  2Z6K A;  1EOV A;  1VQA A;  3HOX G;  3F2D A;  4DUZ L;  1VQ5 A;  4A3G H;  3GTJ H;  2ZJP A;  3S24 A;  2CFM A;  3PUZ A;  3TEH B;  2JA8 H;  1OXV A;  3D31 A;  5GQO A;  1UE7 A;  3VDY A;  4PZ7 A;  3UE1 A;  1R9T H;  2JEA I;  2JA7 G;  4OO1 I;  1VQP A;  4JI4 L;  3PF4 A;  4GKJ Q;  1YIJ A;  1PYB A;  2VQF L;  4GOP B;  3U58 A;  4JI0 L;  4YY3 Q;  5FJ8 G;  1B8A A;  3H0G G;  1L2F A;  3PSI A;  1VQN A;  4A3D G;  4OWW B;  1IZ6 A;  4X6A H;  1I94 Q;  3S16 H;  1X3E A;  1G51 A;  2HHH L;  1FGU A;  1VQE A;  1VQK A;  1K0R A;  2EIF A;  4DV4 Q;  1N36 L;  3GTQ H;  3S14 H;  5IP7 G;  3JC6 6;  3HKZ G;  1YVC A;  3GDE A;  2QA4 A;  1CSP A;  1VQM A;  4B3M L;  3G71 A;  3K7A H;  4UY8 C;  2BH2 A;  3B6Y A;  2RHS B;  4A3F G;  4DR4 L;  3H0G H;  1MKH A;  3OTO Q;  2E5L L;  3I56 A;  4P73 A;  1SRU A;  2FXQ A;  4R1J A;  4WJ4 A;  4DR4 Q;  5LMN W;  2GN5 A;  3Q8D A;  5C0X I;  3CCQ A;  3CCL A;  5GAE C;  5LMN Q;  2MFI A;  3PGZ A;  3U4Z A;  1NJI C;  2OQ0 A;  1Q8K A;  2UUA L;  1XPR A;  3M3Y H;  4KHZ A;  1BKB A;  2I5M X;  3M4P A;  1XJV A;  1M90 C;  3S2D H;  1QUQ A;  2VQE L;  2AHO B;  3M7N A;  1S40 A;  2CKZ B;  3CW2 C;  3PUY A;  1YEZ A;  5AJ3 Q;  4A75 A;  4JI0 Q;  2CCZ A;  3OYY A;  1FVI A;  2NZO A;  4DV1 L;  4JI4 Q;  1Q46 A;  2NN6 G;  5IT9 c;  3STB D;  1XMQ L;  1KQS A;  5C0X G;  3PCO B;  1E22 A;  1IBL Q;  1SFO H;  1VQG A;  3UDI A;  4LF6 Q;  1NBW A;  1YBY A;  2JA5 G;  1N33 L;  2R7Z G;  3TRZ A;  4PZ8 A;  2WAQ E;  1GVP A;  4DUZ Q;  2B63 H;  1PYS B;  4LW1 A;  3TQY A;  3CCE A;  1VQ4 A;  1ASZ A;  1TWH H;  1TWA H;  2HIX A;  3L7Z C;  5GRO A;  5IYB G;  2R6G A;  4DK3 C;  3I4N H;  4DR2 Q;  1EQQ A;  3KLW A;  1I5F A;  1I50 H;  1LTL A;  2PI2 A;  1GD7 A;  2YTV A;  4UP8 A;  5C44 G;  1XNR L;  1A8V A;  2YU9 H;  4C3I H;  4GNX C;  4B3T L;  2VW9 A;  3S15 H;  4BXX G;  5HY6 A;  2Z6K C;  4A3L G;  4OO1 G;  3I7F A;  3PO3 H;  1CSQ A;  4A3K G;  1N32 Q;  3KOJ A;  3MEF A;  1Y1V G;  4X62 L;  2ID0 A;  4IPG A;  3CF5 A;  1C0A A;  4JI1 L;  2OTJ A;  1KIX A;  4DV6 Q;  1UE5 A;  4QL5 A;  1HZ9 A;  2RHQ B;  4DKA C;  1QZH A;  1J5E L;  2IHF A;  4A3E H;  1JT8 A;  4LF5 Q;  4TVA B;  3RZD H;  1Y1W H;  2KEN A;  3HFZ B;  2K50 A;  4A3L H;  3K0X A;  4DAY B;  1G6P A;  1PH7 A;  3AYH B;  4A3B G;  1V9P A;  3HOW H;  1X3F A;  4DV7 Q;  3TRE A;  2K5N A;  1WJJ A;  2E2I H;  2A8V A;  5M3F G;  4GOP A;  1X3G A;  4AQY L;  4X62 Q;  4OON A;  2VUM H;  3CPW A;  2IT1 A;  4BA2 I;  2BH8 A;  2VL6 A;  4DV0 Q;  4DR5 L;  4JCV E;  4LFC L;  1KL9 A;  3OW2 A;  3A5U A;  3HOV H;  1RIP A;  3I4O A;  5C4X G;  2BA1 A;  4UPA A;  3GTG H;  4DR6 Q;  1J6Q A;  5IP9 G;  1Q86 C;  3AFP A;  3AFQ A;  4A3B H;  1L0W A;  2UU9 Q;  2ZJR A;  5FLM G;  1PH2 A;  3BJU A;  4KLK A;  2XTI A;  4DAM A;  3CPF A;  3HOU G;  2NZH A;  1KC8 C;  4DV5 Q;  5FLX c;  1BBW A; 
#chains in the Genus database with same CATH topology
 1HZC A;  2QW7 A;  3H3V I;  1K8A C;  1SAP A;  1Z9F A;  5GAH C;  2CQO A;  1TY2 A;  5JOB A;  4HJ8 A;  1Y69 U;  5K36 G;  3T53 B;  1Z7T A;  4ID6 A;  3FKI G;  3J7A 5;  2RCF A;  1MSG A;  3M4O B;  1GUN A;  2K03 A;  4LFB Q;  4XDX A;  4IPC A;  4JG2 A;  5ELN A;  1EWI A;  3M4Y A;  1SEB D;  4OWX B;  3J7Z C;  5I2Y A;  2E5L Q;  4GNX A;  4DV3 L;  3EBE A;  4LF9 L;  3PUW A;  4BBS H;  2C35 B;  1JE5 A;  4K2K A;  1SNP A;  3D0F A;  5COR A;  2K4K A;  5CGK A;  4HIM A;  1F2L A;  2CWP A;  3W3A A;  3FVQ A;  1HCZ A;  2F0G A;  1GUW A;  1OO9 B;  1LV9 A;  2F0T A;  4QIW E;  4RGT A;  4DA2 A;  2MO0 A;  5LMU L;  1HNW L;  5FO8 B;  3TS2 A;  4AYB E;  2KJX A;  4DV0 L;  4DAV A;  1EY5 A;  1M8A A;  4YWL A;  1I6V C;  5HGT A;  4JI8 L;  4H13 C;  1H9K A;  4EQN A;  1U4R A;  2QEJ C;  2EXD A;  2K01 A;  3WWV A;  1VF5 C;  3MZ5 A;  5CMD A;  2F0S A;  2NTT A;  3FP9 A;  4NXN L;  4IFD J;  4HJ9 A;  1I6H H;  3TZD A;  3CCU A;  3ND8 A;  2SEB D;  2N78 A;  1N32 L;  1TT2 A;  2D2C C;  3GV6 A;  3KLR A;  4APV A;  5G3L F;  2UXB L;  1HJP A;  4LUO A;  4DR2 L;  2SNM A;  3PIP 3;  1AN8 A;  4JI5 Q;  1VS0 A;  1Y1V B;  1V1P B;  3F2U A;  2AMC B;  3NEM A;  4A3K H;  1IL2 A;  5AJ3 L;  3S1R B;  4K5X A;  5E3F A;  3H94 A;  1X6O A;  2SDF A;  5I6W A;  3F2C A;  5FJ8 H;  1K9M C;  3J81 c;  3NWS A;  4BY7 B;  1PFB A;  5EKI A;  2L9H A;  4A3F B;  1D6E C;  4RGN A;  5M3F H;  3GTO H;  3UDF A;  2WAQ G;  5LL6 X;  1EQR A;  2G5D A;  4K6D A;  1STN A;  5C3E H;  4ME3 A;  2JA7 H;  2X69 A;  4IOC A;  1EY7 A;  1WCM H;  1N33 Q;  4Y52 H;  2HHH Q;  3DLL A;  3PUX A;  2N3S A;  3I4M H;  4PMC A;  2L1B A;  1L1O C;  2LS0 1;  4YY3 L;  4DAY A;  1S4Z A;  4EQP A;  5IOD A;  4HJA A;  4IFD H;  2BOS A;  3L0O A;  2RKS A;  2ZTD A;  4KY7 A;  4YHH L;  3R93 A;  2L11 A;  3CC2 A;  5C4X H;  3QJY A;  4AH6 A;  4H0L C;  5IP7 H;  1K8M A;  1TVX A;  2YTX A;  3L2P A;  2K75 A;  3RZD B;  3M7G A;  5GAD C;  5IGC A;  4X65 Q;  2F0P A;  1VQ7 A;  1P8L A;  1LUZ A;  3RLN A;  1MJC A;  2I46 A;  1PTO D;  2LKV A;  1PMR A;  2XGT A;  5EPL A;  3RLF A;  5LMU Q;  3KF6 B;  4ZYS A;  1W6J A;  4LF8 Q;  1UWV A;  2MUY A;  1XPO A;  4B3S Q;  2IX0 A;  2R7Z B;  1EIY B;  1T5E A;  1BXT A;  5IT9 L;  1BO0 A;  2CW0 C;  2Q2U A;  3ZYY X;  2C9O A;  2YYZ A;  1C48 A;  4DF7 A;  5EKL A;  2K14 A;  1B4O A;  3SGI A;  4JBM A;  3HOW G;  4YWM A;  2JA9 A;  4OXP A;  1YJ9 A;  1PRT B;  2R93 G;  2AWN A;  1TS2 A;  1GO3 E;  1ASY A;  2QEX A;  2WAQ B;  1LO5 D;  3D4R A;  4DUY Q;  4MZ9 A;  3HEJ A;  4BXX H;  4IAL A;  3HZX A;  2OXP A;  1BNZ A;  5JEA J;  3I72 A;  2KBN A;  2PZT A;  3HOU B;  2PQA A;  1ENA A;  4IUN A;  4IFD I;  4RG1 A;  4DR1 L;  1N34 L;  3J7A V;  4R4C A;  1OXT A;  1YNJ D;  1KRS A;  1N34 Q;  2B2W A;  4IJL A;  3FKI B;  1EY6 A;  2PPB C;  1G29 1;  4WOR A;  5BN4 A;  4C1N I;  3FKI H;  2UU9 L;  1BCP B;  1D5M C;  3EQL C;  3KUP A;  4E6I A;  2ATW A;  3A74 A;  2B2T A;  4ME5 A;  3MEH A;  3SK4 A;  4LFC Q;  1GHK A;  1SNC A;  3GQB A;  4FP5 D;  1PFS A;  5M5X B;  1X65 A;  1HNX Q;  4ZKC B;  3HOY G;  2B8F A;  2QCP X;  4PQX A;  5IGB A;  1DD2 A;  4OWT B;  1L0Y B;  4B3S L;  1EIG A;  5EPK A;  1PH8 A;  1I4R A;  4F87 A;  1TS5 A;  2E2J H;  5J22 A;  4CKB A;  4OX9 Q;  2SOB A;  5BR8 L;  3M4O H;  1XPU A;  3BZK A;  2J4X A;  3LGJ A;  4YCV A;  1YNN C;  2E75 C;  4GN5 A;  5EGT A;  4B3T Q;  4A76 A;  2JE6 I;  1EY9 A;  1EY0 A;  1EZ6 A;  5H1S E;  4JBW A;  4QUF A;  1UEB A;  3J80 i;  4CGY B;  3E6Z X;  3I2Z A;  4C2M H;  1GOZ A;  2MQH A;  2V4D A;  5IP9 H;  1H9S A;  4BY1 B;  3EN2 A;  2MGS A;  2XWB B;  1A15 A;  5KGU A;  1YI2 A;  1ENC A;  4KHP Q;  4GLV B;  4ILW A;  4A3I B;  1XMO Q;  2K5D A;  3AMU A;  5CV4 A;  1X56 A;  1HR0 Q;  2LXK A;  3AQQ A;  4A3E B;  3Q22 A;  3A8K E;  2MO1 A;  4IQZ A;  1L1O B;  1S72 A;  4FVM A;  2PI2 E;  2WKD A;  3MXN B;  3ER0 A;  1EY4 A;  1YHA A;  2TSS A;  2UXC Q;  5IYD H;  3N52 A;  2NZ1 D;  1F9P A;  4LF9 Q;  4DR1 Q;  3L3O C;  4UAI A;  4DU9 A;  2HT1 A;  5GAG C;  1A3V A;  3I55 A;  3QR8 A;  5C4Z A;  4JI3 L;  4C3J B;  5C5L A;  2L15 A;  5IYC H;  4A3I G;  3A7A B;  4J6H A;  3RN5 A;  2HIV A;  1Y8N B;  3SE0 A;  4N8F A;  2IPK D;  4UDU C;  4DR5 Q;  5I2X A;  3TDQ A;  4TRD A;  3EJI A;  2Q2H A;  1CM9 A;  4J1M A;  5LL6 S;  3BS1 A;  1BCP D;  4RKB A;  2AKW B;  2NVY H;  1U4P A;  3MVV A;  2F3I A;  3A56 A;  3MC0 B;  1RF2 D;  2R7Z H;  1JE4 A;  5CV5 A;  1A2T A;  1K8O A;  1XTD A;  1JC7 A;  2BE5 C;  2WFW A;  3BDO A;  3S2D B;  3CC7 A;  4C56 C;  4OX9 L;  3K7A B;  1SRO A;  5I9P A;  5JEA G;  1FL0 A;  4DR3 L;  1PFN A;  4IFD G;  5K36 H;  3OIP A;  3NSW A;  3WDN A;  1AE2 A;  1ET9 A;  1UNS A;  3PUV A;  3PO2 G;  4OEL B;  1EOV A;  4DUZ L;  4N9P A;  3GTJ H;  3CHB D;  3PUZ A;  2JA8 H;  3VDY A;  4PZ7 A;  2PNR C;  3AU7 A;  2JA7 G;  2EE1 A;  1PRT F;  1WTP A;  4RKL A;  3FEW X;  3IFD A;  3L9A X;  4GOP B;  4JI0 L;  1II3 A;  4YY3 Q;  3OSO A;  1JOK A;  1PTO C;  1LTT D;  4OWW B;  3KLS X;  1FGU A;  2BDO A;  2MP1 A;  1WTW A;  5EKK A;  4B3M L;  2BH2 A;  5BN3 A;  4C3I B;  1AFP A;  2SNS A;  1CFM A;  1IHZ A;  1LAC A;  5FK9 C;  1V1O A;  3Q8D A;  3CCL A;  2MFI A;  2PCF B;  1I4Q A;  2OQ0 A;  4BBS B;  4FYD A;  1Q8K A;  5CYU A;  1DOM A;  4KHZ A;  4KJN A;  3M4P A;  3S2D H;  1S40 A;  1ZKO A;  3K5N A;  5AJ3 Q;  2A69 D;  1D2B A;  3OYY A;  1Q46 A;  2NN6 G;  1K83 B;  1EWC A;  1HUM A;  5IGE A;  4QUC A;  3TRZ A;  1EY8 A;  2B63 H;  3I91 A;  3TQY A;  1ILP A;  3K5L A;  3I4N H;  1I5F A;  1I50 H;  2PI2 A;  1GD7 A;  4C3H G;  1WTH A;  1A8V A;  1NR4 A;  4GNX C;  5HY6 A;  1AW7 A;  3PO3 H;  4A3K G;  2E76 C;  3MEF A;  4RFB A;  3CF5 A;  1C0A A;  3TZU A;  1KIX A;  4DV6 Q;  1HZ9 A;  3MXU A;  1YNJ C;  3GTP B;  1PH7 A;  4A3B G;  2E2I H;  4IZ8 A;  5M3F G;  2A8V A;  1TU2 B;  1X3G A;  4GOP A;  4X62 Q;  4HTH A;  1SYC A;  3J81 L;  2VUM H;  2IT1 A;  4U68 A;  4BA2 I;  2FJ2 A;  3I3C A;  4JCV E;  3A5U A;  1RIP A;  2F1M A;  1DJR D;  4A3B H;  3QWN A;  3HG9 A;  5FLM G;  2ZJR A;  1ROD A;  2A6H C;  5C44 B;  3G48 A;  3A7L A;  5ELD A;  3UDI A;  1N33 L;  1HA6 A;  3PF4 A;  2EY6 A;  3Q0A A;  1XWE A;  1IXR A;  1V1Q A;  3NTI A;  2A1A A;  2OEO A;  4XYQ A;  1X3P A;  3MTS A;  1YJW A;  5M3M G;  3S15 B;  1E24 A;  5J39 A;  4RHR A;  3KJP A;  2VQE Q;  4JI7 L;  1LTR D;  4LFB L;  1WYD A;  2FHT A;  4DNI A;  4GNX B;  2PYK A;  2AUK A;  4RCN A;  1SNO A;  2EYL A;  2KCM A;  3ERS X;  4IUR A;  3T1H L;  4RGO S;  5D65 A;  5KEE A;  2XRS D;  4DN4 M;  1GKH A;  4YIJ A;  1VQL A;  5ELC A;  3GTL H;  3OTO L;  3W1G A;  3UDG A;  4GKK Q;  4X66 Q;  4LK1 C;  2L4N A;  4X64 Q;  3JAM E;  1W6K A;  1A63 A;  5IYC G;  1QVF A;  5K5P A;  4CKE A;  1SSO A;  3CXC A;  2G9D A;  4OIK A;  1DYQ A;  2F4V Q;  5IWA L;  5FO7 B;  2KHS A;  1PYW D;  3G7L A;  2F0J A;  4NXN Q;  2DY8 A;  2M00 A;  3BDL A;  1PLF A;  2R93 H;  3F1Z A;  4Z9C B;  3D3R A;  3VR4 A;  4YWK A;  4LF5 L;  1LYL A;  1Y1W G;  1H95 A;  2HCC A;  1MHW C;  2XVS A;  2F0M A;  2F0W A;  3K5O A;  2IHE A;  4KMU C;  3J81 j;  3FPP A;  2I0Q A;  1FNV A;  1R9T B;  2EQS A;  5DLQ E;  1SNQ A;  3A8I E;  1F9Q A;  4C3J H;  5COY A;  2GVA A;  4JYA Q;  1D5Z C;  3ONA B;  3I4N B;  3BVZ A;  2PQA B;  3I70 A;  5IWA Q;  1PRT C;  3HOZ B;  3ULP A;  5IYB H;  3T13 A;  2JJQ A;  1S3O A;  1CK1 A;  4K0K Q;  1DCZ A;  4CDC C;  2UUB Q;  4LF6 L;  4XQJ A;  1IYV A;  3FHW A;  5C3W A;  1H9J A;  3HKZ E;  3D6W A;  4NDX A;  4KHV A;  4FXK C;  1BR9 A;  2EYF A;  1K83 H;  3T1H Q;  2QDL A;  3HP3 A;  1QVG A;  4DXG A;  1NY4 A;  3JAM c;  3BYT B;  1KDC A;  5DM6 3;  4ODG A;  4XIG S;  2ZTC A;  1STH A;  5JJL A;  1EFW A;  1JQY D;  4B9W A;  1SMY C;  1JMC A;  2I07 B;  2HD3 A;  3CRL C;  2B2V A;  4KD4 A;  4X3T A;  1Q81 C;  2RQX A;  1LTA D;  3F8T A;  4A3E G;  1N36 Q;  3OWF A;  2JA6 G;  4A3D H;  4GS3 A;  3MA2 B;  4L6T B;  2VQF Q;  2ZJQ A;  2VY3 A;  5JAV A;  2Q8R E;  1HFN A;  1UE1 A;  2EDG A;  1R4P B;  2KVM A;  1SYG A;  3U9S A;  4HAE A;  3BZC A;  1JR0 D;  5T1G A;  2JA6 H;  3T51 B;  4IOA A;  1SDF A;  1AEX A;  3RR5 A;  3S17 H;  1J5E Q;  1Q12 A;  4A3J B;  3E9I A;  4K8J A;  2B63 G;  5CR3 A;  3RD4 A;  2KCT A;  5M3F B;  3GTO B;  1Z6H A;  1VQJ A;  3HOV B;  3VR6 A;  4DV6 L;  4C3H H;  1WTQ A;  4JI6 Q;  1PTO F;  3K59 A;  4JI6 L;  1JJC B;  3CU7 A;  1N9W A;  2NTS A;  1CZW A;  1TS4 A;  1PH5 A;  3H3V H;  3UI2 A;  2NB0 A;  2Y0S B;  2UUC Q;  2HQE A;  4UP7 A;  1YZ6 A;  4PNY A;  1STG A;  1KAW A;  1E7Z A;  4O2D A;  1GM5 A;  2ZXR A;  3DM3 A;  1BF4 A;  1HFG A;  1YHB A;  3CC4 A;  5M9O A;  1KTK A;  1O7Z A;  2F0K A;  2F0O A;  2A6E D;  4A3G G;  1KRT A;  1KXL A;  3JAM i;  1WOC A;  1U9R A;  1NTG A;  4RAU C;  1CQV A;  1NUC A;  3C3L A;  2JQO A;  2KCN A;  2JA6 B;  2ENB A;  4CDD C;  3K58 A;  3MXG A;  3H91 A;  1QB5 D;  1E1O A;  2F0D A;  1BVS A;  1HQM C;  2R7D A;  1CTM A;  3PO2 H;  1UUP A;  2EJF C;  4BY7 H;  2VUM G;  1LT5 D;  3HOW B;  4QIW B;  5ELF A;  2JXM B;  4GKJ L;  3RMH A;  4B3R L;  3PO2 B;  5CBE E;  3NEL A;  1PXU A;  4HED A;  2XIW A;  4R9W A;  2DJF C;  1TXY A;  3AEV A;  3D6C A;  1UE6 A;  4DK6 C;  2RSN A;  3UE0 A;  1ILQ A;  1E0B A;  1SJH D;  1PV4 A;  3PF5 A;  2AQ2 B;  1N8R C;  4HN7 A;  2MNA A;  2V1C C;  1GUG A;  1O7I A;  1VMP A;  1I4P A;  1PZI D;  3E0J A;  4P72 A;  4CKC A;  2A6E C;  1S5C D;  5JJI A;  4LUV A;  4JK1 C;  5EQ0 A;  2B39 A;  4JI2 L;  1CKM A;  1B2T A;  4A3M H;  2JA5 B;  1V43 A;  2LXJ A;  2I5L X;  3MAQ A;  5KNB A;  1JWM D;  3WOE A;  2NVQ B;  4Y7N B;  3PV0 A;  4GKK L;  1EIF A;  3OW7 A;  2ES2 A;  2ZM6 Q;  1PDQ A;  2O5I C;  3CKI B;  1DOK A;  3BDC A;  4UHV A;  4G7H C;  4QQB X;  1CHQ D;  1QZG A;  1ESR A;  2HDL A;  3VYS A;  1PH1 A;  1IW7 D;  2LMC B;  2X6G A;  5M5X H;  4EQ5 A;  2KCC A;  5LMN L;  1V8Q A;  2JEB I;  1P16 A;  1HUN A;  4L63 B;  5EBD A;  2KHI A;  4HMI A;  3K57 A;  4B3M Q;  1AZQ A;  4N8X 1;  5C0X J;  3SK6 A;  5HGQ A;  4IO9 A;  1Q7Y C;  4IPD A;  4DK0 A;  4GN3 B;  4H7B A;  2E2H B;  2ZXO A;  3HOU H;  2K05 A;  4JI7 Q;  4A3C H;  2KHJ A;  4GN4 B;  5BN5 A;  1Y8P B;  1Y14 B;  1I50 B;  2XRQ D;  1PH6 A;  2DY7 A;  4R4T A;  1AE3 A;  4KN4 C;  4A3M B;  4IUV A;  3VR5 A;  3G4S A;  4KHP L;  1BCP C;  3ERO A;  5J3B A;  1PHJ A;  1BCP F;  1BOS A;  2L55 A;  4TQU S;  4AYB G;  4BA1 I;  3U4V A;  4BBR B;  3VYT A;  2ZXP A;  2R92 H;  3AB9 A;  3R3O A;  4RMF A;  3NBH B;  3H6M A;  2R93 B;  1X55 A;  5BR8 Q;  4R8I A;  1K3B C;  5E4W C;  5M3M H;  4FNF A;  5ELO A;  2Z6K A;  1VQA A;  3HOX G;  2CFM A;  2BCO A;  4B9X A;  1OXV A;  5GQO A;  3UE1 A;  4MN3 A;  4TKO B;  2KEE A;  2CW0 D;  5TSS A;  4CJ2 C;  1B9N A;  1PRT D;  1PZJ D;  5D3D A;  4IUP A;  1L2F A;  4A3D G;  2Z4I A;  1IZ6 A;  2VB3 X;  2Q8T A;  3X3M A;  1G51 A;  1VQK A;  1K0R A;  2EIF A;  3S14 B;  3J81 E;  3S14 H;  5I9O A;  1E2V A;  3HKZ G;  1YVC A;  2QA4 A;  3G71 A;  3B6Y A;  2RHS B;  4U67 3;  1SRU A;  4WJ4 A;  1PTO B;  1STY A;  3DXJ C;  5E4X A;  2GN5 A;  1EEI D;  3C1F A;  1F9S A;  1NJI C;  1XPR A;  4B08 A;  2QF7 A;  1BKB A;  4M1U B;  1M90 C;  1QUQ A;  2H1E A;  4HMJ A;  2VQE L;  1JIC A;  1YEZ A;  2F3W A;  1FVI A;  1RJT A;  5IT9 c;  3STB D;  2FIN B;  4N9T A;  4X3U A;  3TP8 A;  5C4H A;  4CBV A;  1IBL Q;  1BDO A;  1ONL A;  1I4X A;  3LX0 A;  5KYL A;  1YBY A;  2B2V C;  1HRJ A;  4GZY C;  2R7Z G;  4DUZ Q;  2A5H A;  3N6R A;  3CCE A;  4DXF A;  4XT1 B;  1TWH H;  5IYB G;  5EJW A;  1TKW B;  2KED A;  1G6Z A;  4JYA L;  2YU9 H;  4C3I H;  2EPB A;  2VW9 A;  1QCB D;  2CVR A;  4A3L G;  3MHB A;  1F77 A;  1B50 A;  3I7F A;  4X62 L;  4HSP A;  3OWE B;  4HCE A;  4C2M B;  3IFT A;  1QNK A;  1S5E D;  4C3H B;  4DKA C;  2M2L A;  3NHH A;  1FNW A;  4TVA B;  4A3L H;  1SE3 A;  2K50 A;  4DAY B;  2TMP A;  3AYH B;  1X3F A;  4DV7 Q;  1WJJ A;  5M5Y B;  4FF2 A;  1DXM A;  3BYY B;  2VL6 A;  4DV0 Q;  4PMB A;  4KKU A;  5C4X G;  3GTG H;  1G91 A;  3AFP A;  2X6L A;  2UU9 Q;  4DAM A;  1AP0 A;  2Q8I B;  2NZH A;  1KC8 C;  1BBW A;  2PZW A;  1J8I A;  2N49 A;  4X66 L;  1B70 B;  1HPC A;  4CDF C;  2VS1 A;  2B8G A;  3QO2 A;  1SMX A;  2PZU A;  3I73 A;  4PG3 A;  1VCI A;  3QIA A;  3QB3 A;  3R8B A;  2VZA A;  3KFU A;  4FF4 A;  4DR7 Q;  2B29 A;  4R4Q A;  3J80 E;  2IX3 A;  3RNU A;  2Z6B A;  4KY5 A;  1GUO A;  2H4O A;  2B2U A;  1IBK Q;  1VMC A;  1HR0 L;  1WFQ A;  1XMO L;  3LNN A;  1GUT A;  2NN6 H;  1Q90 A;  4UP9 A;  2OQK A;  2E74 C;  2F0F A;  2DGY A;  4YCW A;  3I4N G;  1SND A;  4LJZ C;  3KK7 A;  3K6O A;  3PQI A;  1GHJ A;  4JBJ A;  4DR6 L;  1RDP D;  2O4X A;  4DV2 Q;  3D8G A;  3HOY H;  1HTP A;  5A2Q L;  4A3C G;  1OXU A;  2ICI A;  4ABN A;  2UXB Q;  1EIH A;  2EY2 A;  4IJH A;  1B1Z A;  2DJG C;  4EVO A;  1Z47 A;  2K32 A;  4EQO A;  4RH6 A;  1CQF A;  1ICF B;  3RZO H;  3GD7 A;  4XT3 B;  3LWU A;  1LT4 D;  1EUJ A;  2O5J C;  1Q82 C;  2I5H A;  1KD1 C;  1HNX L;  1JCK B;  4KY6 A;  4G57 A;  1ET6 A;  2AUJ D;  4QF4 A;  1VQC A;  1U4L A;  4QY7 A;  2C5C A;  4I7A A;  2EOT A;  4BY1 G;  3IAY A;  3S2H H;  3HRZ C;  1HNW Q;  2EYP A;  1V1P A;  3URY A;  1IYU A;  2B2T C;  2G9H D;  1XX8 A;  3PIO A;  1NNX A;  2E2D C;  3ZJY C;  3P1H A;  4BBR G;  4JVZ A;  2EJG C;  2Z8L A;  3TP7 A;  4I65 A;  3CCS A;  1C9O A;  1IBL L;  3ERQ A;  4DNR B;  2NVX B;  1Y1V H;  4DV3 Q;  5CBA E;  2QKI C;  4F7X A;  2EYO A;  3TME A;  2UXD Q;  3O13 A;  1NMF A;  2F0N A;  1MI2 A;  1TWF B;  1EYA A;  2NVX H;  2HCI A;  3OMG A;  1HA5 A;  4ZQ3 A;  4DUY L;  4A3F H;  2R92 G;  4RCO A;  5I6Y A;  3TBI B;  2KEC A;  4JI3 Q;  3PIP A;  1JOQ A;  3QOL A;  2BA0 A;  1G2T A;  5C44 H;  2K5H A;  3PMF A;  5A2Q E;  1YIT A;  3RZO B;  2MPM A;  3A0J A;  3OMC A;  4R4I A;  3S1Q B;  1EU3 A;  1SN8 A;  2DUD A;  3SVM A;  1XTC D;  2Y0S E;  1O78 A;  5JPN C;  3R2T A;  5E7N A;  2B2Y C;  2NYZ D;  2CWA A;  3DMU A;  1HH2 P;  3KBG A;  4KK7 A;  2QGQ A;  2ALY B;  1SJE D;  4FXG C;  3I4M B;  4XYO A;  4X65 L;  1ZYR D;  1T9H A;  3H3V C;  3D4W A;  2XSC A;  1E3P A;  2FMC A;  4DV7 L;  3QG1 A;  4ZRZ A;  3P20 A;  4KD3 A;  1G2S A;  1LAB A;  3W2D A;  3OPO A;  4NPS A;  3K81 C;  4JI1 Q;  4JI8 Q;  1RKN A;  1QVC A;  4LF8 L;  5NUC A;  2NBF A;  4DR3 Q;  1B7Y B;  4FDB A;  4OHJ A;  1J9O A;  2IY5 B;  1W3S A;  4WRD A;  3CQZ B;  1ICW A;  4QCL A;  2RBM A;  1IYJ B;  4DV2 L;  3H09 A;  2QDB A;  2LFN A;  4JOI C;  4ZKB B;  1CKN A;  1HZA A;  3I90 A;  1SXT A;  3BVG A;  1VQD A;  2K1B A;  2WKC A;  4RGM A;  3E0E A;  3M85 A;  1Q3L A;  3C1E A;  1WTR A;  4ALP A;  5ELE A;  3ICE A;  2F3V A;  4L5T A;  2LSS A;  1AZP A;  1IBK L;  4BBS G;  5DEH A;  2JSO A;  5JVH 3;  4TSS A;  4HCS A;  3GTK B;  3NQT A;  4HJ7 A;  4JV5 L;  2NN6 I;  4A93 G;  3NP8 A;  3S1Q H;  1I6H B;  3IKJ A;  4PMW A;  1DGS A;  1Y8O B;  3VA7 A;  4HSV A;  3S1N H;  4A3J H;  3NPP A;  1PZK D;  3E3X A;  3T56 B;  3WOF A;  2H5X A;  2K5Q A;  4DNT B;  3NTH A;  1C7Y A;  4DV5 L;  2F0L A;  2KOL A;  2D5D A;  5J1Z A;  1SE2 A;  3I4L A;  4KN7 C;  4O0A A;  3GO5 A;  1RD9 D;  1LTS D;  3NUC A;  1KNE A;  1CKN B;  3DHQ A;  1NR2 A;  1SYB A;  2IL8 A;  1VQ8 A;  1TWC B;  2KQ3 A;  1SLJ A;  2ICE C;  4LAA A;  3A8J E;  5IE8 A;  2F0E A;  2FFK B;  1OXX K;  2RF4 A;  2YU9 B;  5KNC A;  2RDF A;  4IUT A;  3VA5 A;  1FR3 A;  1TWH B;  1MJE A;  5C3E B;  1STB A;  3CAM A;  1X3Q A;  3HS0 C;  2WB1 G;  2EVB A;  2MHV A;  3NBI A;  4LMQ D;  2F52 A;  3K8A A;  2WP8 J;  2F03 A;  2EXZ A;  1SFO B;  2RDG A;  1VQ6 A;  1EEF D;  1A3U A;  3DUZ A;  4LF7 L;  4O1N A;  3A5Z B;  3P7J A;  5FKA C;  2NVY B;  4OGQ C;  1W2B A;  1C4Q A;  4ZCK A;  1I3Q H;  3BZD B;  3S1M H;  1HNZ L;  2R7F A;  1QOH A;  1U0L A;  4Q5V A;  1E2W A;  4OIJ A;  1DOL A;  1EQV A;  4YHH Q;  1QNU A;  3HOZ H;  3NXW A;  3MFG A;  3M4Q A;  1FYC A;  4J15 A;  4K8I A;  2A19 A;  4JOI A;  2HQL A;  2EYM A;  2UUA Q;  3VR2 A;  4DR7 L;  3C2P A;  3NBH A;  4L5S A;  4EX5 A;  1IW7 C;  3R2I A;  1RHP A;  3CMA A;  4YCU A;  5IOC A;  5D14 A;  5T1I A;  5M3M B;  1KHI A;  5CC4 A;  1WTX A;  4BY7 G;  4A4I A;  1TWG H;  5EPJ A;  1WD0 A;  4QJF A;  2CH4 A;  2IWH A;  3NQI A;  4CJ0 B;  3DEP A;  2UXD L;  4I7Z C;  3J80 c;  4DPG A;  1A2U A;  1IKM A;  3RLO A;  2JP1 A;  2NVQ H;  3T1Y Q;  1HNZ Q;  2D0O A;  3NTK A;  5ISR A;  5FOB B;  3MFY A;  1RCV D;  1PA6 A;  5C0X H;  1WVL A;  1A62 A;  1HTL D;  4BS9 A;  4ULL A;  2F0H A;  4LF7 Q;  2WIN B;  2FMM A;  2UUC L;  1TWF H;  1Q1E A;  4R8N A;  4KI0 A;  1ZXT A;  1SYE A;  5M5Y H;  3JAM L;  3T16 A;  1CT1 D;  1O7L A;  1FJG L;  4K14 A;  1VQ5 A;  4KTA A;  3S24 A;  3TEH B;  5LHY 1;  1WTO A;  1NSN S;  1UE7 A;  1L0X B;  4JI4 L;  4MIU A;  1YIJ A;  1PYB A;  3U58 A;  2IJ0 A;  1B8A A;  1BBX C;  3H0G G;  1BQQ T;  1LTI D;  4X6A H;  1I94 Q;  2HHH L;  4DV4 Q;  2VUM B;  3TN2 A;  1N36 L;  3GTQ H;  4KV6 A;  3JC6 6;  1VQM A;  2KUM A;  3H0G H;  2E5L L;  1E2Z A;  3I56 A;  4P73 A;  4R1J A;  4DR4 Q;  1EL0 A;  5C0X I;  3CCQ A;  5LMN Q;  1TY0 A;  1SMY D;  3PGZ A;  1ESF A;  3U4Z A;  4HR7 B;  1LT6 D;  5HUR A;  3J7A F;  4KJO A;  2K6A A;  4DFA A;  2DNC A;  2AHO B;  3CW2 C;  3NK9 A;  3PUY A;  2K7V A;  4NMZ A;  1B3A A;  2NZO A;  4DV1 L;  3J80 L;  1XMQ L;  1KQS A;  1D1I A;  1CI3 M;  3PCO B;  2PW5 A;  1E22 A;  4DK1 A;  1SFO H;  1VQG A;  4LF6 Q;  1NBW A;  3OOC A;  2JA5 G;  2XN9 C;  2VB2 X;  4MHE A;  4PZ8 A;  1GVP A;  4RHS A;  1DM0 B;  4LW1 A;  1PYS B;  3NWT A;  3GTJ B;  1TWA H;  2HIX A;  3L7Z C;  2R6G A;  4DK3 C;  4DR2 Q;  1EQQ A;  3KLW A;  5L37 A;  1LTL A;  4UP8 A;  3OIQ A;  1GJX A;  3S2H B;  4OO1 G;  4KKS A;  1CSQ A;  3KOJ A;  5IGD A;  1Y1V G;  4IPG A;  1SE4 A;  4JI1 L;  2OTJ A;  3TP6 A;  1QZH A;  4EGV A;  4A3E H;  1JT8 A;  1B44 D;  1NAP A;  2KEN A;  3FMC A;  3HFZ B;  3RZD H;  3K0X A;  5C4X B;  1V9P A;  3TRE A;  1RTN A;  2A6H D;  1SBB B;  4AQY L;  2JYO A;  4OON A;  3CPW A;  4NW2 A;  4G7O C;  2BH8 A;  1CZG A;  1KL9 A;  3I4O A;  4X3S A;  3P75 A;  2BA1 A;  4DR6 Q;  1J6Q A;  5IP9 G;  3AFQ A;  2B2W C;  2WAC A;  1EZ8 A;  4KLK A;  2XTI A;  1I4H A;  4F88 A;  3Q6S A;  4LWC A;  2L5T A;  1WCM G;  2A68 C;  3OHX C;  1K8G A;  2A73 B;  4G7Z C;  3DWQ A;  1XXG A;  2WV6 D;  3H15 A;  3BVM A;  1CA6 A;  2QIL A;  3K7U C;  5IYD G;  1GUS A;  2D62 A;  5E1F A;  2A68 D;  3U9O A;  1HXY D;  4XQQ A;  4K2L A;  4A3I H;  4LFA L;  1XNQ Q;  5JEA H;  1KAB A;  2LY7 A;  1UAP A;  4XQN A;  3EVQ A;  1Q8I A;  4JI5 L;  1EYG A;  4K0K L;  5M5W H;  2N8N A;  1NMG A;  5JPM C;  3HKZ B;  4OEM B;  2RVL A;  4S3S A;  2M9V A;  3FDT A;  4HID A;  2JA8 G;  2VXW A;  1TII D;  3SDZ A;  1LTG D;  3CQZ H;  2WB1 E;  2EY1 A;  2ASB A;  3E9H A;  3HGB A;  4PV1 C;  3V05 A;  2HUG A;  1CKO A;  2PMZ E;  1C8C A;  2E2J B;  4AQY Q;  1VQO A;  2K28 A;  2YV5 A;  4A3D B;  4MNO A;  1MBY A;  1L1O A;  4H02 A;  4CJ1 B;  5G3L D;  3C46 A;  1QWY A;  2EYJ A;  1SE8 A;  3SHL A;  2KA7 A;  5C5M A;  1UEA B;  3KJO A;  2D9U A;  4NXM L;  2E2H H;  1A0I A;  1EWH A;  4A3J G;  1A3T A;  5ELB A;  1I3Q B;  1EFI D;  1JB7 A;  4NB3 A;  1F2Z A;  1D8L A;  4DGZ A;  1FD7 D;  5KND A;  1H9M A;  4HJ5 A;  1Q1B A;  1PH3 A;  4IUU A;  3CME A;  1D1K A;  1E1T A;  5IY0 A;  2OCE A;  1JOO A;  4BWG B;  3K0Y A;  3F2B A;  3SK8 A;  1QG7 A;  5C4J H;  1PVO A;  5JJK A;  4A3M G;  1VDZ A;  3SEB A;  1SR3 A;  1ML0 D;  4POF A;  1HR0 W;  4R4O A;  5F2D A;  4QMG A;  4J8Q A;  2VNU D;  2AWO A;  1EOT A;  2EJM A;  1TWC H;  2RDH A;  2R61 A;  4P74 A;  1QUQ B;  2JK8 A;  3CCR A;  3NEN A;  2EZV A;  1R4Q B;  3M3Y B;  4M8A A;  2UUB L;  3HKS A;  4JPB W;  2B3G A;  2R3Z A;  2A74 C;  4GOP C;  3TS0 A;  1FGB D;  4O42 A;  1H9R A;  3Q24 A;  4HIK A;  2L0C A;  3GTM B;  2DN8 A;  3UDX A;  4V0B A;  2K52 A;  3G6E A;  4A3K B;  3W1B A;  2ZM6 L;  1YNX A;  3Q23 A;  2AQ3 B;  1CUK A;  3HOZ G;  3V96 A;  1KDB A;  4NXM Q;  1Y1W B;  2CQA A;  1DZ1 A;  4Q0F A;  1HZB A;  1AH9 A;  4A3B B;  3PO3 G;  1VQI A;  1YHQ A;  3ULJ A;  3GTL B;  1JOR A;  5EBC A;  1I4G A;  3ITP A;  1FJG Q;  1OXS C;  2Z4H A;  4JI2 Q;  4P2C B;  4MTN A;  3VYU A;  4BY1 H;  3KF8 B;  4LNQ A;  1XNR Q;  1PH9 A;  1S5D D;  4GLX A;  3M9B A;  3ND9 A;  4L5Q A;  4NP5 A;  5KYI A;  2A69 C;  5C4J B;  3T4A C;  2PMZ B;  4BBR H;  3K5M A;  1X54 A;  1NE3 A;  3EFX D;  3KF6 A;  1VQ9 A;  2BE5 D;  3I8Z A;  1DON A;  2JA5 H;  2N55 A;  3T1Y L;  1SNM A;  5FLM H;  5FLX E;  4LUZ A;  1MGS A;  1BUV T;  1TWG B;  1YNN D;  5D3I B;  1X32 A;  2JN4 A;  5CV8 A;  2YTY A;  4WJ3 M;  1VQB A;  2MJ8 A;  1B9M A;  2F0I A;  3HOX H;  4L8J A;  4AIM A;  1CHP D;  3A55 A;  3LWE A;  2HDM A;  4HIO A;  2PW7 A;  3CD6 A;  5JVG 3;  2E2I B;  1NCV A;  3U50 C;  2IX1 A;  1EYD A;  3TP5 A;  2OWO A;  3TSS A;  4IPH A;  3GTP H;  4RA8 A;  1EU4 A;  2K5W A;  3SR1 A;  3VR3 A;  1VQF A;  2RA4 A;  2UXC L;  3HOV G;  4DV4 L;  4JW0 A;  3KLS A;  1F2Y A;  3BU2 A;  1WD1 A;  1PH4 A;  3BG3 A;  2EYH A;  1PTO H;  1S5F D;  4A3G B;  3SK5 A;  1TWA B;  1QE6 A;  3A54 A;  4ZAI A;  1B3Q A;  3DWP A;  5DNF A;  4MTK A;  5AFW A;  4C3I G;  3VYR A;  2WB1 B;  1YJN A;  1VF7 A;  2ZTE A;  3KF8 A;  1LT3 D;  3CRK C;  3RN2 A;  2JA7 B;  3KDF B;  4P71 A;  1MSH A;  3PO3 B;  3STB C;  4XTC S;  3RUZ A;  4QGU A;  2JA8 B;  3IRB A;  1K3R A;  3CCJ A;  2OTL A;  1A6X A;  1EQT A;  1OTC A;  1HHV A;  3CCM A;  5IT9 E;  4AYB B;  3EIV A;  5EAY A;  3K80 C;  1ZEQ X;  4F8M A;  1MIU A;  4IUQ A;  1TQO A;  1VQH A;  5I4D A;  4ZUI A;  1SYD A;  1RL2 A;  2Y0S G;  1X9N A;  1KDA A;  3FRP B;  2D0P A;  4POG A;  3GTM H;  4G4K A;  4K6L A;  3I4M G;  4C3J G;  3H0G B;  2NVT H;  1IBM Q;  2NUC A;  1CA5 A;  1JJ2 A;  4V19 0;  1XYI A;  3GTQ B;  5C3X A;  4LFA Q;  1XNQ L;  1XMQ Q;  4DV1 Q;  4B3R Q;  3W5O A;  3CP0 A;  5CV6 A;  1JWU D;  3KDF A;  4PZ6 A;  1S5B D;  3S17 B;  3HOY B;  1D7Q A;  2B2Y A;  2F4V L;  4JBK A;  4L5R C;  1O80 A;  5C6A A;  1JJG A;  1FNU A;  5A35 A;  2J7Z A;  2RCN A;  4NKL A;  4LF4 Q;  1U5K A;  2DNE A;  4P75 A;  4C1N K;  4X64 L;  3GV3 A;  2PNH A;  3ULL A;  1K0S A;  4JC0 A;  2J0T D;  1SYF A;  2K04 A;  5JJZ A;  2ZT9 C;  4K5W A;  4OO1 H;  3NE5 B;  3CCV A;  2P5Z X;  1WI5 A;  2E8G A;  2GVB A;  4LF4 L;  1GXD C;  3J7Y W;  1U4M A;  2Q2I A;  3GTK H;  1KNA A;  1QJO A;  3J81 i;  2Q2T A;  3X3N A;  1I94 L;  4JV5 Q;  5FO9 B;  3S1N B;  1M1K C;  5CV7 A;  1K73 C;  1WCM B;  4WJW A;  2XNA C;  4CDE C;  5M5W B;  4QB4 A;  4A93 H;  4ZLT F;  1IBM L;  3HOX B;  1O7Y A;  4GLA C;  1IL8 A;  3EA6 A;  2F4I A;  4A93 B;  2NVT B;  3S1R H;  1LM0 A;  5KIX A;  2EY5 A;  2CH4 W;  2Z0S A;  3FPU B;  5DM7 3;  1STA A;  1LLR D;  1BBU A;  3E5S A;  1B53 A;  1K28 A;  3KYH C;  3IL8 A;  1KLG D;  4Y7N H;  1MD2 D;  5C3E G;  5IGF A;  3D4D A;  1TS3 A;  2K5V A;  5FLX L;  1KLU D;  2PQE A;  4OL7 A;  3F2D A;  4A3G H;  3SXH A;  1HQR D;  2ZJP A;  3D31 A;  1STE A;  2JEA I;  1R9T H;  4X3K A;  3GP7 A;  4OO1 I;  1VQP A;  3KBX A;  2CHB D;  4GKJ Q;  1ENF A;  2VQF L;  5FJ8 G;  2OF1 A;  1JWS D;  3PSI A;  4IN3 A;  1F9R A;  1VQN A;  5KRU A;  4XXE A;  3S16 H;  4WFN 3;  1X3E A;  2F0U A;  2WII B;  2B63 B;  1D5X C;  1IKL A;  1TR5 A;  1VQE A;  3DM1 A;  1WTV A;  5IP7 G;  3GDE A;  1CSP A;  1RTO A;  1EYC A;  4UY8 C;  3K7A H;  3DEO A;  3V2T A;  4RWS C;  4A3F G;  3S16 B;  1MKH A;  3S1M B;  4DR4 L;  3OTO Q;  2Z1C A;  1KAA A;  2FXQ A;  5LMN W;  5GAE C;  2OT2 A;  1F2M A;  3PIO 3;  2BDN A;  2UUA L;  3DWA A;  1LTB D;  4ZK9 B;  3M3Y H;  1XJV A;  2I5M X;  4K5V A;  2R92 B;  5IGG A;  3M7N A;  2CKZ B;  2F0Q A;  4DAP A;  4A75 A;  3MWY W;  4JI0 Q;  2L12 A;  2CCZ A;  3MXN A;  4JI4 Q;  2PO4 A;  5C0X G;  2XWJ B;  2N88 A;  4KKT A;  2F0V A;  2GA4 B;  4FXD A;  2WAQ E;  5DAU A;  2Z9H A;  1VQ4 A;  1ASZ A;  2O2L D;  4FF3 A;  5GRO A;  4FF1 A;  2YTV A;  1XNR L;  5C44 G;  3S15 H;  4B3T L;  4ZUJ A;  4BXX G;  5IIF A;  5CV9 A;  2Z6K C;  4FO2 A;  2AQ1 B;  1H9S B;  1N32 Q;  3S9W A;  2ID0 A;  2NWG A;  1QIL A;  1G8Z D;  1UE5 A;  4QL5 A;  2RHQ B;  2RSO A;  1J5E L;  2IHF A;  1JB3 A;  4LF5 Q;  3MXP A;  1Y1W H;  1M4V A;  1G6P A;  3QOJ A;  3HOW H;  2K5N A;  4CHT B;  1T5X D;  4DR5 L;  4LFC L;  2IW3 A;  3OW2 A;  3HOV H;  1PFM A;  2B2U C;  4UPA A;  3GTG B;  1Q86 C;  4H44 C;  1L0W A;  1PH2 A;  1ZYR C;  2K33 A;  3BJU A;  3G6J B;  3CPF A;  3HOU G;  4DV5 Q;  5FLX c; 
#chains in the Genus database with same CATH homology
 4LWC A;  1HZC A;  2N49 A;  1WCM G;  4X66 L;  3H3V I;  1B70 B;  1K8A C;  1Z9F A;  5GAH C;  2VS1 A;  1SMX A;  2CQO A;  4HJ8 A;  1K8G A;  1IXR A;  1V1Q A;  5K36 G;  2A1A A;  4PG3 A;  1VCI A;  3H15 A;  1YJW A;  2VZA A;  5M3M G;  3KFU A;  1E24 A;  4DR7 Q;  3KJP A;  2B29 A;  2VQE Q;  3K7U C;  4R4Q A;  4JI7 L;  5IYD G;  3FKI G;  4LFB L;  2D62 A;  1WYD A;  3RNU A;  4DNI A;  3J7A 5;  4GNX B;  4LFB Q;  4IPC A;  4JG2 A;  5ELN A;  2KCM A;  3ERS X;  1EWI A;  1IBK Q;  3T1H L;  1HR0 L;  1GKH A;  1WFQ A;  1XMO L;  1VQL A;  4OWX B;  3GTL H;  3J7Z C;  3OTO L;  3W1G A;  3UDG A;  4A3I H;  2E5L Q;  4LFA L;  4GNX A;  4DV3 L;  3EBE A;  4X66 Q;  4LF9 L;  1XNQ Q;  4GKK Q;  4UP9 A;  3PUW A;  2OQK A;  4BBS H;  2C35 B;  1JE5 A;  3D0F A;  4JI5 L;  4X64 Q;  2K4K A;  1EYG A;  1A63 A;  4HIM A;  4YCW A;  2DGY A;  3I4N G;  4K0K L;  5M5W H;  2CWP A;  2N8N A;  1NMG A;  5IYC G;  1QVF A;  3CXC A;  4JBJ A;  4DR6 L;  4DV2 Q;  2F4V Q;  5IWA L;  3HOY H;  4HID A;  2JA8 G;  4A3C G;  1OXU A;  2UXB Q;  4IJH A;  4QIW E;  3CQZ H;  2WB1 E;  2MO0 A;  5LMU L;  4NXN Q;  3E9H A;  1Z47 A;  2ASB A;  1HNW L;  3TS2 A;  4AYB E;  1CKO A;  4DV0 L;  2PMZ E;  2R93 H;  3F1Z A;  4AQY Q;  4YWL A;  1VQO A;  4JI8 L;  2YV5 A;  4YWK A;  4MNO A;  4LF5 L;  1L1O A;  4H02 A;  1LYL A;  3GD7 A;  1Y1W G;  3RZO H;  1H95 A;  1EUJ A;  1SE8 A;  1Q82 C;  2I5H A;  1KD1 C;  2IHE A;  1HNX L;  2EXD A;  3J81 j;  3WWV A;  2I0Q A;  3KJO A;  3FP9 A;  4NXN L;  2E2H H;  4NXM L;  2EQS A;  5DLQ E;  4C3J H;  1A0I A;  1VQC A;  4HJ9 A;  4QY7 A;  4IFD J;  1I6H H;  4A3J G;  4BY1 G;  3CCU A;  1JB7 A;  3S2H H;  2GVA A;  4NB3 A;  2N78 A;  1N32 L;  1HNW Q;  4JYA Q;  1D8L A;  4APV A;  2UXB L;  1HJP A;  4LUO A;  4DR2 L;  2PQA B;  5IWA Q;  3ULP A;  5IYB H;  2JJQ A;  3PIO A;  1VS0 A;  4JI5 Q;  4HJ5 A;  1Q1B A;  3ZJY C;  1S3O A;  4K0K Q;  1PH3 A;  4BBR G;  3CME A;  1E1T A;  4LF6 L;  2UUB Q;  3CCS A;  1C9O A;  2AMC B;  3NEM A;  2OCE A;  5IY0 A;  1IBL L;  4A3K H;  3FHW A;  1Y1V H;  4DV3 Q;  5AJ3 L;  1IL2 A;  3F2B A;  3HKZ E;  5C4J H;  1PVO A;  2UXD Q;  1NMF A;  1X6O A;  5JJK A;  4A3M G;  3F2C A;  5FJ8 H;  1K9M C;  3J81 c;  1SR3 A;  4JYA L;  4POF A;  3T1H Q;  1K83 H;  1HR0 W;  2NVX H;  4R4O A;  4A3F H;  4DUY L;  2R92 G;  2VNU D;  2AWO A;  1QVG A;  4JI3 Q;  3PIP A;  1TWC H;  1NY4 A;  3JAM c;  2BA0 A;  5M3F H;  3UDF A;  2WAQ G;  3GTO H;  1EQR A;  5C3E H;  4P74 A;  1QUQ B;  2JK8 A;  5C44 H;  2K5H A;  3CCR A;  3NEN A;  4XIG S;  2ZTC A;  4ME3 A;  5JJL A;  2UUB L;  3HKS A;  2JA7 H;  4IOC A;  2B3G A;  1WCM H;  1YIT A;  1EFW A;  1N33 Q;  4R4I A;  3A0J A;  4GOP C;  4Y52 H;  2DUD A;  1SN8 A;  3TS0 A;  2HHH Q;  2Y0S E;  3DLL A;  1JMC A;  3PUX A;  1N36 Q;  1Q81 C;  2N3S A;  3F8T A;  5E7N A;  4A3E G;  3I4M H;  2JA6 G;  4A3D H;  4GS3 A;  1L1O C;  4HIK A;  2CWA A;  1HH2 P;  3UDX A;  4YY3 L;  2VQF Q;  2K52 A;  2QGQ A;  3G6E A;  3W1B A;  4HJA A;  2ZM6 L;  1YNX A;  2VY3 A;  2ALY B;  2ZJQ A;  3L0O A;  2ZTD A;  4YHH L;  1CUK A;  3HOZ G;  4X65 L;  1UE1 A;  1T9H A;  4NXM Q;  3CC2 A;  5C4X H;  1E3P A;  3BZC A;  2JA6 H;  4IOA A;  4AH6 A;  4DV7 L;  5IP7 H;  3RR5 A;  3S17 H;  1J5E Q;  1HZB A;  1Q12 A;  1AH9 A;  3L2P A;  3E9I A;  2YTX A;  2B63 G;  2K75 A;  3PO3 G;  4NPS A;  1VQI A;  2KCT A;  3ULJ A;  3K81 C;  4JI1 Q;  1YHQ A;  4JI8 Q;  1VQJ A;  1FJG Q;  1OXS C;  1QVC A;  4JI2 Q;  4LF8 L;  4DV6 L;  5GAD C;  4C3H H;  4MTN A;  4X65 Q;  4DR3 Q;  4BY1 H;  1VQ7 A;  1B7Y B;  4JI6 Q;  1P8L A;  1LUZ A;  4FDB A;  3KF8 B;  1MJC A;  3RLN A;  2XGT A;  4JI6 L;  5LMU Q;  1JJC B;  3RLF A;  1PH9 A;  1W3S A;  4LNQ A;  3KF6 B;  1XNR Q;  2IY5 B;  1N9W A;  4LF8 Q;  1UWV A;  1IYJ B;  3M9B A;  4GLX A;  1XPO A;  4B3S Q;  2IX0 A;  4DV2 L;  1EIY B;  4L5Q A;  1PH5 A;  3H3V H;  4JOI C;  2UUC Q;  2Q2U A;  1CKN A;  4BBR H;  4UP7 A;  2YYZ A;  1HZA A;  1X54 A;  1NE3 A;  1VQD A;  1YZ6 A;  2K14 A;  3E0E A;  3KF6 A;  3M85 A;  3SGI A;  1KAW A;  1VQ9 A;  4JBM A;  4YWM A;  1E7Z A;  2JA9 A;  4OXP A;  3HOW G;  4O2D A;  2JA5 H;  1YJ9 A;  1GM5 A;  3T1Y L;  2R93 G;  3DM3 A;  5FLM H;  2AWN A;  4ALP A;  1GO3 E;  1YHB A;  1ASY A;  3CC4 A;  3ICE A;  4LUZ A;  2QEX A;  2LSS A;  4L5T A;  1IBK L;  4BBS G;  2YTY A;  4WJ3 M;  1VQB A;  3HOX H;  4DUY Q;  4MZ9 A;  4A3G G;  4BXX H;  1KRT A;  4HJ7 A;  4AIM A;  4JV5 L;  1KXL A;  5JEA J;  2NN6 I;  3JAM i;  4A93 G;  3S1Q H;  2KBN A;  1WOC A;  4PMW A;  2PQA A;  1NTG A;  1DGS A;  4HIO A;  4IFD I;  3CD6 A;  3S1N H;  4RG1 A;  4DR1 L;  4A3J H;  3U50 C;  2JQO A;  1N34 L;  4R4C A;  2IX1 A;  2OWO A;  1OXT A;  1KRS A;  1N34 Q;  4IJL A;  4IPH A;  3GTP H;  2H5X A;  1G29 1;  1VQF A;  1C7Y A;  4DV5 L;  1E1O A;  2UXC L;  1BVS A;  2R7D A;  3HOV G;  4DV4 L;  3PO2 H;  3FKI H;  4O0A A;  4BY7 H;  3GO5 A;  2UU9 L;  2VUM G;  2ATW A;  3A74 A;  3BU2 A;  1PH4 A;  1CKN B;  4GKJ L;  4B3R L;  1VQ8 A;  4LFC Q;  3NEL A;  1SLJ A;  5IE8 A;  1OXX K;  2RF4 A;  1PFS A;  1YJN A;  1TXY A;  3AEV A;  2ZTE A;  1X65 A;  3RN2 A;  1HNX Q;  1UE6 A;  3HOY G;  3KDF B;  4P71 A;  4DK6 C;  3STB C;  4XTC S;  3UE0 A;  4QGU A;  1MJE A;  1PV4 A;  3IRB A;  1K3R A;  3CAM A;  3CCJ A;  4OWT B;  3PF5 A;  2OTL A;  4B3S L;  1OTC A;  1N8R C;  1PH8 A;  2MNA A;  2V1C C;  3CCM A;  2WB1 G;  2E2J H;  1O7I A;  3EIV A;  5EAY A;  2F52 A;  3K8A A;  2WP8 J;  3K80 C;  4OX9 Q;  4P72 A;  5BR8 L;  1MIU A;  3M4O H;  1XPU A;  1VQH A;  5JJI A;  3BZK A;  4LUV A;  4YCV A;  3LGJ A;  1VQ6 A;  4GN5 A;  4JI2 L;  1CKM A;  1RL2 A;  4B3T Q;  2Y0S G;  4A76 A;  4LF7 L;  2JE6 I;  1X9N A;  4A3M H;  3A5Z B;  2D0P A;  4POG A;  1V43 A;  2LXJ A;  5H1S E;  2I5L X;  4JBW A;  3GTM H;  1UEB A;  3J80 i;  3I4M G;  1W2B A;  3I2Z A;  4C2M H;  1I3Q H;  2MQH A;  5IP9 H;  3S1M H;  2NVT H;  1HNZ L;  2R7F A;  1IBM Q;  3EN2 A;  1U0L A;  1JJ2 A;  3PV0 A;  1YI2 A;  4KHP Q;  4GKK L;  4LFA Q;  4GLV B;  4YHH Q;  1XMQ Q;  1XNQ L;  1EIF A;  4DV1 Q;  3HOZ H;  4B3R Q;  3W5O A;  3CP0 A;  2ZM6 Q;  1XMO Q;  2ES2 A;  3M4Q A;  4J15 A;  1X56 A;  1HR0 Q;  2LXK A;  3KDF A;  4PZ6 A;  4QQB X;  1QZG A;  3AQQ A;  1D7Q A;  2F4V L;  4JBK A;  4L5R C;  1JJG A;  2A19 A;  1PH1 A;  2MO1 A;  4JOI A;  1L1O B;  1S72 A;  2HQL A;  2RCN A;  2UUA Q;  2PI2 E;  4LF4 Q;  1U5K A;  3MXN B;  4P75 A;  4X64 L;  3ER0 A;  5M5X H;  4DR7 L;  1YHA A;  2UXC Q;  4EQ5 A;  5IYD H;  5LMN L;  4L5S A;  2PNH A;  3ULL A;  4EX5 A;  2JEB I;  4JC0 A;  1P16 A;  4LF9 Q;  4DR1 Q;  3G48 A;  3CCV A;  2KHI A;  2HT1 A;  5GAG C;  3I55 A;  1WI5 A;  3CMA A;  2E8G A;  4YCU A;  4B3M Q;  2GVB A;  5C0X J;  4LF4 L;  5HGQ A;  4IO9 A;  4JI3 L;  2Q2I A;  1Q7Y C;  4IPD A;  3GTK H;  5IYC H;  4GN3 B;  2L15 A;  1KHI A;  3J81 i;  4A3I G;  2Q2T A;  4BY7 G;  4A4I A;  3HOU H;  3RN5 A;  1TWG H;  2HIV A;  1I94 L;  4QJF A;  4JV5 Q;  4JI7 Q;  4A3C H;  1M1K C;  2KHJ A;  4GN4 B;  1K73 C;  2UXD L;  1Y14 B;  3J80 c;  4DPG A;  4DR5 Q;  1PH6 A;  3RLO A;  4A93 H;  4R4T A;  1AE3 A;  2Q2H A;  2NVQ H;  3T1Y Q;  1HNZ Q;  2D0O A;  1IBM L;  3G4S A;  4KHP L;  4GLA C;  1PA6 A;  2AKW B;  2NVY H;  5J3B A;  1PHJ A;  1A62 A;  2F3I A;  2R7Z H;  3S1R H;  4TQU S;  4AYB G;  4BA1 I;  1LM0 A;  4LF7 Q;  3U4V A;  2UUC L;  1XTD A;  2Z0S A;  1TWF H;  1Q1E A;  2WFW A;  3CC7 A;  4KI0 A;  2R92 H;  4OX9 L;  1BBU A;  1SRO A;  4RMF A;  3KYH C;  5JEA G;  1FL0 A;  3NBH B;  4DR3 L;  4IFD G;  5M5Y H;  1X55 A;  5BR8 Q;  4Y7N H;  5C3E G;  1AE2 A;  5M3M H;  2K5V A;  5ELO A;  1FJG L;  3PUV A;  3PO2 G;  2Z6K A;  1EOV A;  1VQA A;  3HOX G;  3F2D A;  4DUZ L;  1VQ5 A;  4A3G H;  3GTJ H;  2ZJP A;  3S24 A;  2CFM A;  3PUZ A;  3TEH B;  2JA8 H;  1OXV A;  3D31 A;  5GQO A;  1UE7 A;  3VDY A;  4PZ7 A;  3UE1 A;  1R9T H;  2JEA I;  2JA7 G;  4OO1 I;  1VQP A;  4JI4 L;  3PF4 A;  4GKJ Q;  1YIJ A;  1PYB A;  2VQF L;  4GOP B;  3U58 A;  4JI0 L;  4YY3 Q;  5FJ8 G;  1B8A A;  3H0G G;  1L2F A;  3PSI A;  1VQN A;  4A3D G;  4OWW B;  1IZ6 A;  4X6A H;  1I94 Q;  3S16 H;  1X3E A;  1G51 A;  2HHH L;  1FGU A;  1VQE A;  1VQK A;  1K0R A;  2EIF A;  4DV4 Q;  1N36 L;  3GTQ H;  3S14 H;  5IP7 G;  3JC6 6;  3HKZ G;  1YVC A;  3GDE A;  2QA4 A;  1CSP A;  1VQM A;  4B3M L;  3G71 A;  3K7A H;  4UY8 C;  2BH2 A;  3B6Y A;  2RHS B;  4A3F G;  4DR4 L;  3H0G H;  1MKH A;  3OTO Q;  2E5L L;  3I56 A;  4P73 A;  1SRU A;  2FXQ A;  4R1J A;  4WJ4 A;  4DR4 Q;  5LMN W;  2GN5 A;  3Q8D A;  5C0X I;  3CCQ A;  3CCL A;  5GAE C;  5LMN Q;  2MFI A;  3PGZ A;  3U4Z A;  1NJI C;  2OQ0 A;  1Q8K A;  2UUA L;  1XPR A;  3M3Y H;  4KHZ A;  1BKB A;  2I5M X;  3M4P A;  1XJV A;  1M90 C;  3S2D H;  1QUQ A;  2VQE L;  2AHO B;  3M7N A;  1S40 A;  2CKZ B;  3CW2 C;  3PUY A;  1YEZ A;  5AJ3 Q;  4A75 A;  4JI0 Q;  2CCZ A;  3OYY A;  1FVI A;  2NZO A;  4DV1 L;  4JI4 Q;  1Q46 A;  2NN6 G;  5IT9 c;  3STB D;  1XMQ L;  1KQS A;  5C0X G;  3PCO B;  1E22 A;  1IBL Q;  1SFO H;  1VQG A;  3UDI A;  4LF6 Q;  1NBW A;  1YBY A;  2JA5 G;  1N33 L;  2R7Z G;  3TRZ A;  4PZ8 A;  2WAQ E;  1GVP A;  4DUZ Q;  2B63 H;  1PYS B;  4LW1 A;  3TQY A;  3CCE A;  1VQ4 A;  1ASZ A;  1TWH H;  1TWA H;  2HIX A;  3L7Z C;  5GRO A;  5IYB G;  2R6G A;  4DK3 C;  3I4N H;  4DR2 Q;  1EQQ A;  3KLW A;  1I5F A;  1I50 H;  1LTL A;  2PI2 A;  1GD7 A;  2YTV A;  4UP8 A;  5C44 G;  1XNR L;  1A8V A;  2YU9 H;  4C3I H;  4GNX C;  4B3T L;  2VW9 A;  3S15 H;  4BXX G;  5HY6 A;  2Z6K C;  4A3L G;  4OO1 G;  3I7F A;  3PO3 H;  1CSQ A;  4A3K G;  1N32 Q;  3KOJ A;  3MEF A;  1Y1V G;  4X62 L;  2ID0 A;  4IPG A;  3CF5 A;  1C0A A;  4JI1 L;  2OTJ A;  1KIX A;  4DV6 Q;  1UE5 A;  4QL5 A;  1HZ9 A;  2RHQ B;  4DKA C;  1QZH A;  1J5E L;  2IHF A;  4A3E H;  1JT8 A;  4LF5 Q;  4TVA B;  3RZD H;  1Y1W H;  2KEN A;  3HFZ B;  2K50 A;  4A3L H;  3K0X A;  4DAY B;  1G6P A;  1PH7 A;  3AYH B;  4A3B G;  1V9P A;  3HOW H;  1X3F A;  4DV7 Q;  3TRE A;  2K5N A;  1WJJ A;  2E2I H;  2A8V A;  5M3F G;  4GOP A;  1X3G A;  4AQY L;  4X62 Q;  4OON A;  2VUM H;  3CPW A;  2IT1 A;  4BA2 I;  2BH8 A;  2VL6 A;  4DV0 Q;  4DR5 L;  4JCV E;  4LFC L;  1KL9 A;  3OW2 A;  3A5U A;  3HOV H;  1RIP A;  3I4O A;  5C4X G;  2BA1 A;  4UPA A;  3GTG H;  4DR6 Q;  1J6Q A;  5IP9 G;  1Q86 C;  3AFP A;  3AFQ A;  4A3B H;  1L0W A;  2UU9 Q;  2ZJR A;  5FLM G;  1PH2 A;  3BJU A;  4KLK A;  2XTI A;  4DAM A;  3CPF A;  3HOU G;  2NZH A;  1KC8 C;  4DV5 Q;  5FLX c;  1BBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...