2MQHA

Solution structure of the chlamydomonas reinhardtii nab1 cold shock domain, csd1
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
72
structure length
72
Chain Sequence
GSGEQLRQQGTVKWFNATKGFGFITPGGGGEDLFVHQTNINSEGFRSLREGEVVEFEVEAGPDGRSKAVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleic acid binding protein
publication title Solution structure of the RNA-binding cold-shock domain of the Chlamydomonas reinhardtii NAB1 protein and insights into RNA recognition.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Dna binding protein
total genus 1
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2mqhA00
4NXNQ 3RN2A 4BBSH 2BA0A 2Q2TA 1XNQQ 4YCVA 3KOJA 3CCMA 3J7A5 2CQOA 1Q12A 5K36G 1FL0A 4JI2Q 4YY3Q 1SROA 1N9WA 4RG1A 1VQCA 1YIJA 3TREA 1BBUA 3A74A 3STBD 1X54A 4HJ8A 1LUZA 3UE0A 3ULJA 4JI0L 5M3FG 5IYBG 1E3PA 4X64Q 3I4NG 2N3SA 1P8LA 1SMXA 3A5UA 3PO3H 1N32Q 1VQKA 1WOCA 3HOUG 1DGSA 1YJWA 1NJIC 1PYBA 1E22A 5JEAG 4OX9L 3D0FA 3KF6A 4LF7L 4X6AH 2K14A 2R6GA 3F1ZA 4EX5A 1SE8A 4A3EH 3KLWA 4B3TQ 4LF4L 1OXSC 1VQ4A 4GS3A 1SN8A 4APVA 2B63G 2JA7H 4NXML 2R92H 2UXBQ 4DR2L 4DV6L 1K8AC 2ATWA 2K4KA 2UXCL 3RLFA 1I3QH 1NMGA 3S24A 1HR0Q 4UP7A 2BH8A 1SFOH 4L5SA 1RL2A 1Q86C 1QUQB 1VS0A 1MKHA 3CF5A 1XPOA 3I56A 2JEAI 1N34L 3PGZA 2Q2HA 1XPUA 1IXRA 4X65Q 1VQEA 4ALPA 3I4NH 2WB1G 5IYBH 5H1SE 5M3FH 3KJOA 1HR0W 1YJNA 1N32L 5JJKA 5C4JH 4AH6A 3CCEA 3CCSA 4DR3L 3PUXA 4DV5Q 1VQLA 2EIFA 5M5XH 3K7AH 1VCIA 1Q1BA 1UWVA 4JBWA 4XTCS 4GNXC 3HOYG 1X65A 5JJIA 3DM3A 4JYAL 2KENA 1Y1WG 3TEHB 2A1AA 2AKWB 3KYHC 2B29A 2HIVA 5GQOA 3E9HA 4XIGS 3ULPA 4LNQA 2JA8G 2JK8A 2NN6I 2UU9L 4DV4Q 4JC0A 3HOUH 4JI5L 1YJ9A 3M9BA 2ZJPA 1N8RC 4C3JH 2JA6G 2K5NA 1Q81C 1J6QA 1EQRA 3M85A 3I2ZA 3BU2A 2CCZA 1PYSB 4DR6Q 3PV0A 4IPDA 3KDFB 3A5ZB 2ASBA 4C2MH 1V9PA 2WAQE 3FKIG 4DAMA 1Y1VG 1K9MC 3GTKH 4IFDI 4P73A 1VQIA 3HOYH 1OXUA 4A3DG 4DAYB 4DV2L 1HNZQ 1Q7YC 2UUCL 1Y1WH 4GNXA 2VQFQ 3F2DA 2E2IH 4DNIA 2CKZB 3U4ZA 1PH8A 4KHZA 1KD1C 1J5EQ 4LF9L 3UE1A 4WJ4A 1YNXA 2JA8H 4IJHA 2E2HH 2R7ZH 1CSPA 1M90C 1KL9A 3S1QH 4R4OA 2Z0SA 1XNRL 3BZKA 4NPSA 3FP9A 2VW9A 1KRTA 1LM0A 3GO5A 5GAEC 3CCRA 1K3RA 2N49A 4A93G 1X55A 5IYCG 1ASYA 2AMCB 1W2BA 5FJ8G 4JI6Q 3L7ZC 2IT1A 3GTGH 2UXDL 1K0RA 4LF6L 2WFWA 4DR6L 1D7QA 2LXJA 1K73C 3GTQH 3FKIH 1Y1VH 4YWLA 4H02A 3I4MH 1N36Q 3JAMi 4BY7G 1MIUA 2MQHA 2F3IA 1HNWQ 1FJGL 2ZTDA 1IL2A 4BXXG 4AQYL 1N33L 5IT9c 1CUKA 1PVOA 1I94Q 1VQ9A 1YITA 5GADC 4DR5L 2Z6KA 3K8AA 1OXVA 1XMOQ 3G48A 1IYJB 2I5HA 3G4SA 4IO9A 4GLVB 2XTIA 3RZDH 2N8NA 3ERSX 1IZ6A 2C35B 3JAMc 5IYCH 4YHHL 4A93H 2WB1E 2R7DA 1XJVA 1UE6A 5LMNL 3AQQA 4O2DA 4P75A 1JJ2A 1QVFA 2F4VQ 2JA9A 1VQ8A 1HNXQ 1WCMH 2UUBQ 4OXPA 4A3FH 1EIFA 1YHBA 3MEFA 2ZM6L 1Q46A 2AWOA 1B8AA 4QJFA 4MZ9A 4DV3L 4A3MG 1VQFA 2IHEA 4BY7H 4LFBQ 2N78A 5LMUL 1HNWL 4LFCQ 2ALYB 5IP9G 1V1QA 3PUVA 4FDBA 3KF8B 4LW1A 2D62A 4LF5L 3J7ZC 5GAHC 3K80C 1KHIA 4DR7L 1IBML 1UEBA 3S15H 4IOCA 2JA5G 1EQQA 1Q82C 1OTCA 3PF4A 1GO3E 3UDFA 1NMFA 4DR4L 1XMQL 1EIYB 1OXTA 4AYBE 1GVPA 4DV1Q 5AJ3L 4QIWE 4DKAC 1E1OA 1I5FA 2NVTH 1BKBA 3W1BA 4JI4Q 1IBLQ 3F8TA 4GNXB 3OW2A 1HZCA 1YEZA 3S14H 3FHWA 1CKNA 4JI3L 2F4VL 2HQLA 3T1YL 2PI2A 4UPAA 2JJQA 4Y7NH 4JV5Q 1H95A 1L1OA 1U0LA 3RLNA 1VQ6A 2IX0A 4R4QA 4A3MH 4A3GG 3NELA 3E0EA 3PUWA 3TS2A 1JT8A 2LSSA 5IP9H 4B3MQ 5HGQA 2R7FA 4A3LG 1CKMA 2ZJRA 3K0XA 4NXNL 2AWNA 2L15A 4JCVE 3W5OA 1XNQL 4RMFA 3CPFA 2JA5H 4JI2L 4YY3L 4LWCA 1FVIA 4IPHA 4GKKQ 4GN4B 3S1NH 4X64L 2YV5A 2NVQH 3OTOQ 5BR8Q 4QQBX 4DK6C 2RHSB 2GVBA 1VQ5A 2NVXH 3B6YA 4K0KQ 3AFQA 4BBRG 1L2FA 3I7FA 4IPCA 1UE5A 1C7YA 1K83H 1TWFH 2NZOA 4POFA 3J81i 2QEXA 3CCUA 4B3TL 4DV0Q 5JJLA 2KCMA 3CMAA 2B63H 1AE2A 3GTLH 4IFDJ 2D0PA 2NZHA 3TQYA 4AIMA 1PH2A 2ZJQA 2UXBL 5IY0A 1MJEA 3CCJA 1BBWA 2K5HA 2NVYH 5C44G 1HR0L 3CW2C 1EFWA 3WWVA 3OYYA 3PUYA 1HZBA 1GKHA 1NTGA 1QVGA 4JOIC 4X65L 4JI8Q 3J81c 4A3JG 2Y0SG 5IYDG 4GKKL 1WFQA 2ES2A 1X3GA 2PNHA 1EWIA 1QVCA 1VQMA 1IBKQ 4GKJQ 3CD6A 1HJPA 4DV5L 3CC2A 3BJUA 1A62A 1VQNA 2ZTCA 4DR1Q 4IOAA 3CCVA 3NBHB 1K8GA 3CCQA 4GOPC 2Z6KC 5ELNA 2B3GA 2PI2E 2VUMG 1VQJA 2E8GA 5C44H 4DV4L 4A3BG 1B7YB 2MO1A 4QL5A 1PH6A 1PH1A 1D8LA 4LFAQ 2JA6H 1G6PA 5J3BA 1CKNB 2OCEA 2VS1A 4O0AA 4YWKA 3CPWA 4JOIA 2VL6A 4A3JH 1VQBA 5IYDH 3BZCA 1BVSA 4L5TA 1L1OB 4MNOA 2HHHQ 4DUZQ 5JEAJ 1PH3A 4OWXB 3GD7A 4IJLA 1JE5A 3NENA 5M3MG 5FLXc 5C0XI 3PIOA 2K50A 4BA1I 4A3DH 2Q2IA 4PMWA 2VQEQ 2YTVA 1A0IA 5GAGC 1HNZL 3I4OA 1EYGA 3VDYA 2VQFL 1S40A 2I0QA 4OWWB 1S3OA 3J80i 1J5EL 4GOPA 2YTYA 3IRBA 1CKOA 1HZ9A 1A8VA 3U4VA 4P72A 3CC4A 3PUZA 3T1HQ 2BH2A 3UDIA 2QGQA 5FJ8H 2OTLA 2I5LX 3M4PA 1OXXK 1Y14B 4JI6L 1LYLA 2F52A 4JG2A 4QY7A 1PA6A 4KHPQ 4R1JA 4DUZL 1R9TH 1VQHA 1G291 1L1OC 3AFPA 5M3MH 1T9HA 1JJCB 2KHJA 1C0AA 3L0OA 5C0XG 1N36L 4A3CG 4R4IA 5IWAQ 5ELOA 4BXXH 1X3FA 2VQEL 2VZAA 3ICEA 2IY5B 2H5XA 1KAWA 3H0GG 5C4XG 3S2DH 1I94L 5EAYA 4JI0Q 1Q8KA 3HOWG 2CWPA 1PFSA 5E7NA 3PO3G 4WJ3M 2HT1A 4PZ8A 4OX9Q 2KBNA 3NEMA 1XMOL 4JBKA 4J15A 3F2CA 5DLQE 2CFMA 2ZTEA 3T1HL 5HY6A 1EUJA 4HJAA 4HIMA 4X62Q 4HIOA 4X66Q 4LF4Q 1HH2P 5C3EG 2Y0SE 4LUOA 4A3KG 3RNUA 2K5VA 4YWMA 4C3HH 3HOVG 1L0WA 4BA2I 4NXMQ 4GLAC 1WI5A 4DR2Q 5IE8A 3CXCA 2E5LQ 4JI1Q 2GVAA 2OTJA 1UE7A 4PZ6A 3GTJH 1HNXL 3RZOH 1Q1EA 4DPGA 5IP7G 2UUBL 4A3CH 4UY8C 1SLJA 4OO1I 1A63A 5IWAL 1N34Q 2JQOA 4LFBL 3S1RH 4B3RQ 4LFCL 3H0GH 2MFIA 5C4XH 3RN5A 3PCOB 3HOWH 3M7NA 3GTPH 1JJGA 4GLXA 4QGUA 4A76A 4L5QA 1PH4A 1XTDA 2E2JH 3AYHB 4DV7Q 1SR3A 4DR3Q 2LXKA 3RR5A 1NY4A 2K52A 4YCWA 2D0OA 1O7IA 3EN2A 4DV1L 2PMZE 3SGIA 2UUAQ 4P71A 2PQAA 1YVCA 4A4IA 5C3EH 4X62L 4A3KH 4X66L 4JYAQ 3UDGA 3JC66 1I50H 4JI4L 1IBLL 3HOVH 4C3IH 2A8VA 1QZGA 1Z47A 2K75A 4JBMA 3A0JA 2E5LL 3HOXG 4JI1L 4GOPB 2UU9Q 5IP7H 4JV5L 2A19A 4JI5Q 1PH7A 4A3GH 4IPGA 5M5WH 4OO1G 1AE3A 4MTNA 3MXNB 2YU9H 2JE6I 4ME3A 4A3LH 4B3ML 5FLMG 4LF8Q 1YHQA 4B3RL 2EXDA 2QA4A 2XGTA 3K81C 3ER0A 3CMEA 3CP0A 4DV7L 3GTMH 1VQAA 3H15A 1UE1A 4HJ5A 3PIPA 1KRSA 1W3SA 3HOZG 2VY3A 2WP8J 4EQ5A 2R93G 2DUDA 4TVAB 1YHAA 3CCLA 3OTOL 5BR8L 3CQZH 3HKZG 4DV2Q 2UUAL 4GN5A 3M3YH 2UUCQ 4BBRH 1P16A 4K0KL 4LF9Q 4OONA 2VNUD 3GTOH 3HOXH 1X3EA 2YTXA 4JBJA 2R7ZG 1I6HH 4DV0L 3PF5A 4HJ9A 1PHJA 5C0XJ 2RHQB 2OQKA 1MJCA 1XNRQ 1TWCH 3U50C 4AYBG 3G71A 5FLMH 3H3VI 1NBWA 3S1MH 4LF8L 1U5KA 3KJPA 4KLKA 2UXDQ 2AHOB 4R4CA 2YYZA 3TRZA 4NB3A 1GM5A 4LF6Q 4Y52H 4BY1G 1KXLA 2JEBI 3HOZH 1B70B 4JI8L 1X9NA 2R93H 1FGUA 2KHIA 3I4MG 4DUYQ 1WYDA 3PO2G 4HJ7A 2ID0A 1IBKL 1FJGQ 2RF4A 2DGYA 1NE3A 4AQYQ 4GKJL 1X6OA 1N33Q 4A3IG 2V1CC 1V43A 2KCTA 4PG3A 1PH5A 2OQ0A 1S72A 2IX1A 3EIVA 4DR5Q 3TS0A 1JB7A 3S17H 4DR1L 3CC7A 3ZJYC 4B3SQ 3LGJA 1RIPA 1YI2A 2NN6G 3S2HH 1ASZA 1KC8C 4UP9A 4JI7Q 3S16H 2MO0A 3KF6B 3I55A 3EBEA 2VUMH 1QZHA 4LUVA 4YHHQ 1VQDA 4A3BH 2FXQA 3J81j 4UP8A 1Z9FA 1QUQA 2RCNA 4GN3B 3L2PA 2PQAB 5LMNQ 1KIXA 3K7UC 3U58A 3E9IA 4POGA 1HZAA 1YZ6A 2GN5A 4BY1H 1E1TA 3F2BA 1M1KC 4LFAL 3CAMA 1WCMG 2ZM6Q 1JMCA 4A3FG 3Q8DA 1TWAH 4OWTB 5LMNW 3W1GA 1VQPA 4P74A 4DV3Q 3PO2H 4IFDG 1GD7A 4R4TA 3J80c 3DLLA 4DUYL 5LMUQ 1VQOA 2HHHL 1PV4A 4A3IH 4LF5Q 4PZ7A 3D31A 1TWHH 3AEVA 3GDEA 2Q2UA 4LUZA 1IBMQ 3G6EA 4BBSG 4DR7Q 3PSIA 4DR4Q 1WJJA 4B3SL 5GROA 1PH9A 4L5RC 3RLOA 1XMQQ 1LTLA 2CWAA 3HFZB 3M4QA 5AJ3Q 1KQSA 1G51A 4JI7L 4HIKA 4YCUA 3H3VH 4A75A 1E7ZA 2I5MX 1CSQA 3UDXA 3STBC 1VQ7A 4LF7Q 1AH9A 4TQUS 1YBYA 3KFUA 5M5YH 2WAQG 4JI3Q 1E24A 1TWGH 1TXYA 3M4OH 3T1YQ 4A3EG 2HIXA 2EQSA 1X56A 4KI0A 1SRUA 2OWOA 3KDFA 3HKZE 2JA7G 4KHPL 2BA1A 4DV6Q 2R92G 2UXCQ 3HKSA 4DK3C 1C9OA 1XPRA 3ULLA 2IHFA 1VQGA 4HIDA 2MNAA 1EOVA
chains in the Genus database with same CATH superfamily
2K03A 1XNQQ 2Q2TA 3J7A5 3KOJA 4YY3Q 1N9WA 1VQCA 2EYLA 3ULJA 4X64Q 3K0YA 3A5UA 1YJWA 1E22A 5JEAG 1SAPA 3KF6A 4LF7L 1WTVA 3I73A 3MEHA 2F0VA 4A3EH 4B3TQ 4LF4L 5C5LA 2VUMB 1OXSC 1JICA 2B63G 4A3BB 4NXML 2UXBQ 2E76C 2HUGA 3OWFA 1MBYA 4B9WA 3S24A 1SFOH 2EY5A 1N34L 1K28A 2PW5A 2Q2HA 1VQEA 2M00A 5H1SE 1YJNA 5JJKA 1H9JA 1JWUD 5JEAH 1R4QB 3PUXA 1VQLA 1AEXA 2F0MA 4UDUC 5M5XH 1RTOA 5C4HA 5JJIA 2MP1A 4BWGB 5CV4A 4LNQA 5GQOA 2HIVA 3D6WA 3E9HA 1S5ED 1F77A 1XWEA 1A3TA 2JK8A 2UU9L 4RKBA 4JC0A 1YJ9A 5JPNC 3KF8A 1O7YA 4TSSA 2EE1A 5FO7B 3S1NB 1OO9B 1V9PA 3FKIG 1Y1VG 4IFDI 5CV9A 4A3DG 3NQIA 2F0GA 2UUCL 5IGCA 2IWHA 2VQFQ 3F2DA 1JOKA 4LF9L 3UE1A 2E2HH 1U9RA 1CSPA 1LTSD 1WTWA 2QW7A 1XNRL 4OIJA 3FP9A 4RCOA 3GO5A 5IODA 1JR0D 1ASYA 3SE0A 2B2TA 5JJZA 3GTGH 4V0BA 3FEWX 1D1IA 1K0RA 1RKNA 4HAEA 1K73C 2LFNA 3FKIH 1Y1VH 5ELFA 2XN9C 4HSVA 1NAPA 3BDCA 3P20A 3FPPA 4BY7G 1IYUA 1IL8A 4BXXG 1TY0A 1LO5D 5GADC 4DR5L 3VYRA 1XMOQ 1HHVA 4PQXA 4L63B 4IO9A 3JAMc 2B2YA 1XJVA 4HEDA 3A55A 3AQQA 4O2DA 1GUGA 4CKEA 2F4VQ 3HEJA 3NK9A 4UHVA 1GUWA 3CRKC 4Q0FA 1WCMH 5ELDA 2B2UA 4A3FH 1EIFA 4IFDH 2ZM6L 3MEFA 1F2ZA 2HDMA 4L8JA 3IKJA 4BY7H 4DV3L 1VQFA 2I46A 1CK1A 2WB1B 5LMUL 1HNWL 4LFCQ 3TP7A 3K80C 3S15H 3D6CA 1Q82C 4DR4L 3UDFA 4XXEA 4JVZA 1EIYB 3J80L 4AYBE 1LTBD 2D5DA 2RKSA 1Y1WB 2GA4B 2F3WA 4JI4Q 1E2WA 1HCZA 3F8TA 1HZCA 4GNXB 3FHWA 1CKNA 1YNJC 2PZTA 3DWPA 2PI2A 2JJQA 3RLNA 1I4GA 1EY4A 4K5WA 3PUWA 3QO2A 1B9NA 2R7FA 1LTTD 1PZID 1GJXA 4K6DA 4DNTB 2NYZD 1TWAB 2WACA 3NWTA 1BNZA 5EQ0A 1JWMD 4KD3A 1JCKB 3GV3A 2P5ZX 5BR8Q 4QQBX 4EQOA 1YNJD 2RHSB 5EBDA 3FRPB 2RVLA 3V96A 4BBRG 1L2FA 4R9WA 1K83H 1TWFH 3CCUA 3VR4A 1AE2A 2A5HA 2D0PA 2NZHA 5I2XA 1BBWA 1AZQA 5C44G 1FGBD 4G7ZC 4I65A 3PUYA 2B2WC 4X65L 3J81c 1STAA 4GKKL 2D9UA 4K6LA 1QNKA 4K2LA 4X3SA 4HR7B 5CR3A 1CI3M 4GKJQ 3CD6A 1HJPA 2X6LA 3RUZA 1Z7TA 1K8MA 1A62A 3NXWA 1ZYRC 3DXJC 4DR1Q 3N6RA 2SNSA 1VF5C 4XQQA 3CCVA 3NBHB 1CHQD 4GOPC 1JOQA 2Z6KC 3TMEA 2B3GA 4JPBW 2AQ2B 1VQJA 2E8GA 5C44H 4DV4L 3FPUB 4ABNA 4QUFA 4NW2A 4KN7C 3QR8A 3R93A 1G6PA 4YWKA 3CPWA 4JOIA 1XTCD 3DEOA 5T1GA 1XX8A 1ZYRD 5JEAJ 2O5IC 1DM0B 1LTAD 4IJLA 3R3OA 5FLXc 1SXTA 2K50A 5EKLA 3C1EA 5KYLA 3E5SA 1S3OA 3NTHA 1J5EL 1SNPA 1EU3A 5EKIA 5M5XB 3IRBA 4ID6A 1A8VA 5LL6S 3CC4A 2B63B 1D1KA 5FJ8H 3M4PA 1OXXK 4RFBA 1LYLA 1UUPA 2F52A 1L0YB 4U68A 4R1JA 2NVYB 4DUZL 1CTMA 1G291 3NBIA 1T9HA 2ZT9C 4IUTA 3L0OA 2K5QA 1N36L 4A3CG 5IWAQ 5ELOA 1SYFA 2VZAA 2H5XA 2F0FA 5C4XG 1I94L 4JI0Q 1Q8KA 1PXUA 3P7JA 4WJ3M 1QB5D 1HFNA 1V1PA 4JBKA 3F2CA 5DLQE 1LACA 2CFMA 2ZTEA 3A54A 5HY6A 1A6XA 1Q90A 4X62Q 4HIOA 5CC4A 2E2HB 3HOVG 4BA2I 5IIFA 1WI5A 3CXCA 1TS4A 4XYQA 1HQMC 2GVAA 2OTJA 1HNXL 3KUPA 4DPGA 5IP7G 4A3CH 3VYUA 1SLJA 5KYIA 1EYCA 3CKIB 2XRSD 1PRTB 3MXGA 3VR3A 3S1RH 3GTGB 5NUCA 4N8FA 4B3RQ 3RN5A 5C4XH 3ZYYX 3GTPH 3MHBA 4GLXA 4OGQC 4L5QA 3FKIB 2Q8IB 1Y1VB 3AYHB 4KKTA 2E2JH 4DR3Q 4A3DB 1FYCA 2B8FA 2D0OA 5E4XA 1O7IA 4KMUC 1SEBD 3ND8A 4X66L 4JYAQ 3TZDA 1MSHA 4CDDC 3K5MA 3HOVH 1SNCA 1GOZA 2F4IA 2OXPA 4S3SA 3A0JA 3HOXG 4JI1L 5IP7H 3MTSA 4JV5L 1Q3LA 2YU9H 2JE6I 1SYGA 2F0PA 3M4YA 3H09A 4RGOS 2WV6D 2QA4A 3BVGA 4NDXA 4CKCA 4PMBA 3K81C 4HCEA 2MUYA 1H9SA 2HDLA 3TDQA 1PTOF 1VQAA 3H15A 4BY7B 3P75A 3HOZG 1D2BA 4EQ5A 2DUDA 4TVAB 1YHAA 1UNSA 2G9DA 4DV2Q 3K58A 1BF4A 2BCOA 4ZCKA 2EOTA 3S15B 1Y8OB 3HOXH 1STBA 1HA5A 2RHQB 1IKLA 3RD4A 5LHY1 3NHHA 3K59A 2IX3A 4YIJA 3I91A 4C3HB 1F9QA 1U5KA 4KKUA 4RHSA 2UXDQ 1TKWB 2YYZA 2IL8A 1GM5A 3HOZH 4JI8L 3MAQA 1FGUA 3BDOA 3I4MG 4DUYQ 3HOWB 3IL8A 2DN8A 2DGYA 1NE3A 4DAPA 5CV7A 4AQYQ 1JB3A 1KLUD 1PFNA 4PG3A 2KCTA 2IX1A 1II3A 3OPOA 5CGKA 2K1BA 3TS0A 1LT3D 2L12A 3CC7A 3H3VC 2A69C 4C1NK 1G2TA 2SOBA 4NP5A 2VUMH 1O7LA 1I50B 1VQDA 2RA4A 4YHHQ 1EY9A 4A3BH 2RCNA 1TWFB 4GZYC 1X3QA 2HD3A 3MXPA 3Q8DA 2A69D 2QDLA 2ZXRA 2PPBC 3D31A 3GDEA 2Q2UA 4LUZA 1IBMQ 4DR7Q 3DEPA 4B3SL 1F2MA 5GROA 2Q8RE 3RLOA 1XMQQ 2CWAA 3HFZB 1G51A 4HIKA 4I7ZC 4BBRB 1CSQA 3HP3A 2FMCA 1I6HB 4JI3Q 3SEBA 4IUNA 2KOLA 4KI0A 1SRUA 5C44B 3N52A 2IHFA 4HIDA 3J7AV 3S1NH 3RN2A 4ODGA 2BA0A 5K36G 2EDGA 1FL0A 4JI2Q 1EZ8A 4RG1A 1BBUA 2F0QA 2Z6BA 3HKZB 1X54A 1IYVA 1LUZA 3UE0A 5J1ZA 1E3PA 3TZUA 1P8LA 2CVRA 3LX0A 3S17B 3AU7A 1HPCA 2F0TA 3KLWA 1VQ4A 2TSSA 2EPBA 3A7AB 4DR2L 1K8AC 2WKCA 2K4KA 1EFID 2PMZB 2BH8A 4UP7A 1HR0Q 4L5SA 1RL2A 1T5XD 1QUQB 1VS0A 1Q86C 5K36H 3I56A 2LS01 1PTOC 2NWGA 1QG7A 3PGZA 2LKVA 1IXRA 4C3JG 3J7YW 2WB1G 2Z9HA 1HR0W 3SK8A 4A3IB 2XIWA 1X3PA 4DV5Q 1VDZA 3R2TA 2F0IA 1VCIA 1WVLA 4K2KA 1Y1WG 1LLRD 2A1AA 5T1IA 3TEHB 1EIHA 2R3ZA 1PTOD 2NN6I 1SE3A 4JI5L 2FJ2A 3M4OB 2ZJPA 3M7GA 1KDBA 1N8RC 3Q24A 4C3JH 4F7XA 5C3WA 2EYJA 1PFMA 3M85A 3E0JA 3I2ZA 4K8JA 2G5DA 2CCZA 5E4WC 2ASBA 4BBSB 5BN4A 2PYKA 2WAQE 3S1RB 3GV6A 3GTKH 5C4XB 3MXUA 3GTPB 2PW7A 1HNZQ 4J1MA 4NKLA 3G6JB 1HXYD 4GNXA 1Y1WH 3U4ZA 1PH8A 2A68C 4WJ4A 4IJHA 1KTKA 4H13C 5D3IB 3SK6A 3BZKA 3EVQA 1LM0A 3HOVB 2QEJC 2N49A 3KK7A 1I4RA 2B39A 1W2BA 4B08A 2OF1A 2I07B 4XDXA 3W2DA 3EA6A 4H02A 2A68D 1MIUA 2MQHA 2F3IA 1FJGL 3DMUA 1PMRA 2Z8LA 1N33L 5IT9c 4F8MA 2JN4A 4X3TA 1YITA 3QOLA 1SNMA 2Z6KA 4CDEC 2NN6H 5CMDA 2DJGC 3K7AB 3NQTA 1RD9D 1GHKA 2I5HA 3G4SA 4GLVB 5BN5A 3J7AF 3ERSX 1IZ6A 2MPMA 1DONA 2F0JA 5LMNL 3HOXB 1JJ2A 3KLSA 1QVFA 2K28A 1M4VA 1VQ8A 5C3XA 2UUBQ 1I4HA 1O78A 4H7BA 2KUMA 3T13A 2AWOA 1SBBB 2N78A 3EFXD 4FF2A 2ALYB 5IP9G 3PUVA 4LW1A 2D62A 3BDLA 1C8CA 3J7ZC 1SYEA 3HOZB 4C2MB 1UEBA 4IOCA 3X3MA 1GVPA 4CKBA 4DV1Q 5AJ3L 2L0CA 1ILQA 1E1OA 1CZWA 1I5FA 2L1BA 3OW2A 1FNVA 2K5WA 2F4VL 1STEA 2HQLA 3T1YL 4UPAA 1ONLA 4QIWB 3SK5A 3SDZA 5IP9H 5HGQA 4EGVA 2ZJRA 1BDOA 1H9KA 4NXNL 2EYMA 4JCVE 1J9OA 4RA8A 4X3UA 1F9RA 3I4MB 4TRDA 1RDPD 1JC7A 2WINB 1ICWA 2A74C 4ZRZA 3I8ZA 4GN4B 4HSPA 2TMPA 3SXHA 4DK6C 3TSSA 4K0KQ 1DOKA 5ISRA 3I7FA 2G9HD 1C7YA 4POFA 2EYHA 4DV0Q 1KLGD 3NE5B 1S4ZA 2B63H 2JP1A 1J8IA 3TQYA 3D3RA 4G57A 5IY0A 3CCJA 2NVYH 3WWVA 3QOJA 2EY6A 3MZ5A 3VR5A 2ES2A 2PNHA 1VQMA 1IBKQ 4ULLA 2B2VA 1W6JA 2EJMA 4IALA 3BJUA 2EYPA 4DXGA 5FK9C 4WFN3 4RGTA 3ITPA 3TP8A 2C5CA 3CCQA 4R8IA 2PI2E 4JK1C 3S14B 1BBXC 4E6IA 5EJWA 1A2UA 2V4DA 3QWNA 2BE5C 1PH6A 1D8LA 4LFAQ 4A3MB 4O0AA 3PF5A 2NB0A 4CJ2C 3BZCA 1BVSA 1Z6HA 1L1OB 4MNOA 2HHHQ 4H44C 1JWSD 1PH3A 1ET9A 1JE5A 2JA5B 4A3DH 2Q2IA 1BCPF 2VQEQ 1A2TA 3I4OA 2JYOA 4MTKA 3VDYA 1EYGA 2NVQB 4ZYSA 2I0QA 2BDNA 3J80i 4DGZA 1GHJA 2OT2A 2YTYA 3S9WA 2F03A 2BE5D 1HZ9A 5DM73 2R61A 2BH2A 3GTLB 1F2LA 2I5LX 3QB3A 4ILWA 4JI6L 5COYA 1DOMA 4JG2A 4QY7A 4C3HG 3WDNA 1PA6A 4KHPQ 1S5BD 1L1OC 3AFPA 2E74C 1JJCB 2F0HA 4C3JB 4R4IA 3NTKA 4Q5VA 4BXXH 3ICEA 1KAWA 2IW3A 1HUNA 5D65A 5EAYA 3HOWG 1EY6A 1PFSA 3PO3G 3GTKB 3A8IE 1CFMA 2CHBD 4FO2A 4J6HA 4UAIA 3LWUA 1B53A 1IHZA 1EUJA 4HJAA 4HIMA 4KJOA 4LF4Q 1HH2P 2EYOA 5C3EG 4K5XA 3RNUA 2K5VA 4C3HH 1L0WA 4NXMQ 4GLAC 5IE8A 2E5LQ 4R8NA 1C4QA 3F2UA 5IWAL 4A3JB 1N34Q 1TU2B 4LFBL 1B44D 1SSOA 3PCOB 3HOWH 1F9SA 4PMCA 3P1HA 4KN4C 1NR4A 2LXKA 1NY4A 2PMZE 2UUAQ 4P71A 1YNNC 5C3EH 3LNNA 4X62L 3JC66 1I50H 2X6GA 1IBLL 5EPJA 2XNAC 3BS1A 4JBMA 2UU9Q 4GOPB 4FXKC 1O7ZA 4IPGA 4CDCC 5M5WH 3MXNB 4ME3A 3Q22A 5G3LD 4B3ML 1I4QA 3J80E 4B3RL 4I7AA 2XGTA 5AFWA 4RHRA 1Y69U 1EIGA 1FNUA 5TSSA 3T56B 2NUCA 3LWEA 1YNND 3QJYA 2CW0D 2SDFA 5JPMC 1QCBD 4P2CB 3OTOL 3HKZG 2UUCQ 4BBRH 1P16A 4LF9Q 5KNBA 5CBAE 3OMCA 4PNYA 3NWSA 4M1UB 3VR2A 2R7ZG 1I6HH 1PHJA 5C0XJ 1XNRQ 2N88A 4KD4A 3U50C 4AYBG 3G71A 4ZUJA 5KNDA 4OHJA 1BQQT 1PFBA 5IGGA 1AP0A 4R4CA 3TRZA 3RZOB 1PTOH 5LL6X 1T5EA 2O2LD 1TIID 2KHIA 1K0SA 1BCPC 3QIAA 4RKLA 3PO2G 1WYDA 5D14A 4F87A 3EQLC 1G6ZA 1X6OA 4A3IG 1PH5A 1XYIA 2OQ0A 3S17H 4DR5Q 4RH6A 2ICIA 3LGJA 3S2HH 1E2ZA 2KCCA 1ASZA 1KC8C 5I4DA 4HCSA 2DNCA 1EWHA 3KF6B 2VXWA 3EBEA 3A8KE 3C1FA 4IUQA 1QZHA 2PQEA 4UP8A 1Z9FA 1QUQA 4GN3B 1KIXA 2PQAB 1BCPD 3F2BA 1H9MA 1M1KC 2F0EA 2EJGC 2D2CC 3CAMA 2ZM6Q 4OWTB 3PO2H 1VQPA 4DV3Q 1GD7A 4R4TA 4DUYL 5LMUQ 4A3IH 4PZ7A 1IKMA 3GTMB 1TWHH 3AEVA 5IGDA 4BBSG 2L9HA 3G6EA 3A56A 1ML0D 4DR4Q 3CQZB 3VA5A 3M3YB 2RSOA 1KNAA 3M4QA 2EXZA 1EU4A 1BO0A 5KRUA 5J22A 3STBC 1VQ7A 1STNA 1I4XA 1YBYA 3KFUA 1D6EC 3M4OH 2PZUA 1TS3A 3OOCA 1B9MA 1EOTA 1X56A 1PZJD 2Z4HA 3S1MB 4DV6Q 2UXCQ 3HKSA 4DK3C 1HA6A 1C9OA 2F0KA 5E1FA 1NNXA 4RGMA 2MNAA 1EOVA 3JAML 4BBSH 1MGSA 2AUJD 4YCVA 3V2TA 3CCMA 5I9OA 2HCIA 5ELCA 2R93B 3TREA 3A74A 3STBD 4HJ8A 3IFTA 1LT6D 1N32Q 1SMXA 1WOCA 4RWSC 5I2YA 4OX9L 3D0FA 4X6AH 3TP5A 3HS0C 2R6GA 3S16B 1LV9A 3VA7A 4GS3A 1SN8A 4APVA 1CQVA 1VMPA 4KKSA 5FO8B 4XT1B 2ATWA 3RLFA 2J4XA 1I3QH 1NMGA 4G4KA 4BY1B 3HOUG 3CF5A 3HGBA 4LMQD 1SYDA 3V05A 4ALPA 4X65Q 1QILA 3KJOA 1CM9A 5C4JH 3CCEA 4N9PA 1ILPA 2ICEC 3K7AH 2H4OA 3HOYG 1Q1BA 4JBWA 4XTCS 5FOBB 1X65A 3DM3A 1HRJA 1Y8NB 2AKWB 3UI2A 2EY1A 5A2QL 1R4PB 4DV4Q 3HOUH 1TWGB 4ZK9B 1SNOA 1PYWD 1EWCA 2B2TC 2JA6G 2QDBA 4DA2A 1J6QA 1EQRA 3PMFA 4KY5A 1EEID 4DR6Q 3PV0A 4IPDA 3C2PA 3I90A 4C2MH 4FYDA 3X3NA 3HOYH 5I6YA 4DAYB 1Q7YC 3PIO3 3PO3B 2CKZB 1S5DD 4KHZA 3L9AX 1J5EQ 4HMIA 1EEFD 3J81L 1QJOA 3E6ZX 1KL9A 1KABA 4R4OA 4IUVA 5C3EB 4NPSA 2VW9A 1KRTA 3CCRA 1K3RA 1BR9A 3MVVA 2AMCB 2HQEA 2IT1A 3OIPA 5HURA 1STHA 2WFWA 4LF6L 1S5CD 1D7QA 2LXJA 5M5WB 2B2UC 4YWLA 3I4MH 1N36Q 3U9OA 3K57A 4G7OC 3I4NB 2RDHA 1PVOA 1I94Q 4ZKBB 1NSNS 3K8AA 2F1MA 3G48A 1B3QA 1XXGA 3Q23A 2F0NA 4HMJA 1D5ZC 2C35B 5FLXL 2WB1E 4P75A 1DYQA 3K5OA 1HNXQ 1TS2A 4OXPA 1YHBA 1Q46A 1B8AA 4MZ9A 4A3MG 2IHEA 3H91A 2KHSA 4FDBA 2Z1CA 2RCFA 1PTOB 4LF5L 2EY2A 1GXDC 1KHIA 2JA5G 1EQQA 1OTCA 3PF4A 1GO3E 1NMFA 1OXTA 3R8BA 4FVMA 2J7ZA 4DKAC 2E2IB 3MC0B 2DY7A 1BOSA 1AFPA 2VB2X 3OHXC 2R7ZB 3S14H 3S2HB 4C3IG 1O80A 5KIXA 1D5MC 4KTAA 4AYBB 1STGA 4JV5Q 1L1OA 3NSWA 4FXGC 4A3MH 1CT1D 2EZVA 4A3GG 2EYFA 3E0EA 3NELA 1JT8A 2K04A 4A3LG 1CKMA 3K0XA 2L15A 4HN7A 3RMHA 1XNQL 3GTQB 3CPFA 2JA5H 3PO2B 4YY3L 4IPHA 2HCCA 3T53B 4X64L 2YV5A 2NVQH 2NTTA 2PZWA 1VMCA 2GVBA 1TWHB 4BS9A 4KHVA 5I6WA 1VQ5A 4N8X1 3FDTA 3B6YA 5C5MA 3AFQA 1B3AA 1SYCA 2MJ8A 1UE5A 4IPCA 2NZOA 4ME5A 2QEXA 4B3TL 5JJLA 2KCMA 3CMAA 3RZDB 3GTLH 5IGFA 4AIMA 3OW7A 2KEDA 2UXBL 1LABA 1MJEA 2BDOA 4XYOA 3OSOA 1CHPD 5FO9B 2ZXOA 3CW2C 2RDGA 3HG9A 1HZBA 1GKHA 1NTGA 4JOIC 1K3BC 4JI8Q 4A3JG 2RBMA 5CV5A 1A3VA 2Y0SG 2DNEA 1WFQA 1TS5A 1X3GA 2ENBA 1EWIA 1QVCA 3OIQA 4WORA 3CC2A 2C9OA 4RCNA 3EJIA 2ZTCA 5BN3A 1HFGA 4OELB 2NVTB 3T4AC 5ELNA 2K05A 1EY7A 3TBIB 4CBVA 4G7HC 5KNCA 5CBEE 2CH4A 1G91A 2MO1A 4Y7NB 4DU9A 3MFGA 2B2WA 1ESRA 2VS1A 4A3JH 1VQBA 3D4DA 3CU7A 4QMGA 1UAPA 1I3QB 1KDAA 1RJTA 4L5TA 2F0OA 1STYA 4OWXB 1S5FD 1KNEA 5K5PA 1MD2D 3NENA 5M3MG 1DJRD 5C0XI 3K5LA 4BA1I 1CZGA 1RODA 4DK0A 2YTVA 1A0IA 3U9SA 1ZKOA 3EROA 5C4JB 2VQFL 4OWWB 1B4OA 1SNDA 4GOPA 2QCPX 1WTQA 3U4VA 4XT3B 1EL0A 4ZUIA 3T1HQ 2PNRC 3NPPA 2VB3X 4KY6A 5JOBA 1E2VA 3HOUB 3C46A 5M3MH 1FNWA 2KHJA 5L37A 5C0XG 5J39A 2VQEL 4V190 4U673 3QG1A 3H0GG 3SK4A 3NBHA 2HT1A 4PZ8A 3HOYB 3NEMA 1XMOL 2XWJB 1G8ZD 4LUOA 4YWMA 4DR2Q 3BZDB 1UE7A 3GTJH 3RZOH 3KLRA 5C0XH 4KK7A 2MGSA 4UY8C 2JA6B 2JQOA 4LFCL 3H0GH 2MFIA 2PCFB 3M7NA 1C48A 2L4NA 1XTDA 1PH4A 2NBFA 4DV7Q 1SR3A 2K7VA 3RR5A 3TP6A 2K52A 4YCWA 3EN2A 2F0SA 4KV6A 2OEOA 5G3LF 2PQAA 1SE2A 3A8JE 4A4IA 3UDGA 2A6ED 4JI4L 1QZGA 1EY0A 5DEHA 2E5LL 5CYUA 2A19A 4JI5Q 4K8IA 1AE3A 4MTNA 2FHTA 3ERQA 3AMUA 4LF8Q 1YHQA 2EXDA 3NTIA 1R9TB 3OMGA 3CMEA 3D8GA 3GTMH 1KRSA 3ND9A 1Q8IA 3KLSX 2VY3A 2WP8J 1LTID 2R93G 5BR8L 2B8GA 3CQZH 3M3YH 2UUAL 3S2DB 4GN5A 4CJ0B 4CGYB 4X3KA 4CJ1B 2ZXPA 4RAUC 5KGUA 2VNUD 3GTOH 1X3EA 2YTXA 3HZXA 1SMYC 4JBJA 4LK1C 1GUTA 1CA6A 1F2YA 2OQKA 1MJCA 2PO4A 1RCVD 1DOLA 3H3VI 3S1MH 4FP5D 3KJPA 4KLKA 4NB3A 4TKOB 4BY1G 4DFAA 4K5VA 4C56C 1B70B 1X9NA 2R93H 1LT4D 4HJ7A 1FJGQ 4GKJL 1SMYD 4DXFA 1N33Q 4IUPA 2V1CC 1V43A 3EIVA 1JB7A 4DR1L 3VR6A 3ZJYC 1QOHA 1RIPA 1YI2A 3MA2B 4UP9A 4JI7Q 4A3KB 3S16H 2DY8A 4LUVA 4MIUA 4C3IB 4QB4A 2FXQA 2ZJQA 3L2PA 5LMNQ 1Y8PB 3DWAA 1EQTA 3BYYB 3K7UC 3SHLA 1HZAA 1YZ6A 2DJFC 2GN5A 4BY1H 5FKAC 4A3GB 2N55A 3KBXA 1WCMG 1JMCA 4A3FG 5D3DA 5LMNW 3W1GA 4IFDG 2L11A 3ONAB 4M8AA 3DLLA 1PV4A 2Q8TA 4F88A 4OIKA 1B1ZA 2EVBA 3D4WA 2JXMB 3PSIA 1WJJA 1PH9A 4L5RC 4DK1A 5AJ3Q 4YCUA 3H3VH 3PQIA 4IURA 2I5MX 3UDXA 1AH9A 4LF7Q 1BUVT 3GQBA 4KY7A 5M5YH 1TVXA 1A15A 4O42A 1E24A 1TWGH 5IT9L 3T1YQ 1TWCB 2HIXA 1FD7D 1V1OA 2IPKD 3HKZE 4H0LC 4FF4A 2JA7G 2R92G 2XRQD 1GUOA 4C1NI 2F0WA 3KBGA 4NXNQ 4DAYA 3NUCA 2CQOA 1Q12A 2Y0SB 4WRDA 1SROA 4DF7A 1YIJA 1SE4A 2Z4IA 4IN3A 4WJWA 5JVH3 4JI0L 3I4NG 5M3FG 5IYBG 3O13A 2N3SA 3PO3H 4ZKCB 5EBCA 1VQKA 1DGSA 1NJIC 1PYBA 2SNMA 4N9TA 1ENCA 2K14A 3F1ZA 4EX5A 1KDCA 1EYAA 1SE8A 2L55A 3WOFA 2CW0C 3BVMA 2JA7H 1A3UA 2R92H 4DV6L 2UXCL 1MKHA 1XPOA 4XQJA 2JEAI 5EPKA 1XPUA 1UEAB 5JAVA 1WTRA 3I4NH 5M3FH 5IYBH 1IW7C 4NMZA 5IT9E 1N32L 2RDFA 5M3MB 3CCSA 4AH6A 4DR3L 1BCPB 5F2DA 2AQ3B 2EIFA 5C4ZA 5IOCA 1UWVA 4GNXC 4JYAL 2KENA 3KYHC 2B29A 3ULPA 4XIGS 2XVSA 2JA8G 3M9BA 1IW7D 3C3LA 2LY7A 2K5NA 1EY8A 4EVOA 1Q81C 1EY5A 1PRTF 3I70A 3BU2A 3GTJB 1PYSB 3DHQA 1G2SA 3KDFB 3A5ZB 3SR1A 2KQ3A 4DAMA 1K9MC 3DM1A 4QUCA 4P73A 3H0GB 1VQIA 1OXUA 4DV2L 1B2TA 5EGTA 2E2IH 4DNIA 2J0TD 1KD1C 1L0XB 1YNXA 1K8OA 2JA8H 2R7ZH 2WAQB 4IUUA 4MHEA 1M90C 3S1QH 2Z0SA 1ESFA 1PLFA 4A3EB 5GAEC 4A93G 1X55A 5IYCG 5FJ8G 4JI6Q 3L7ZC 2UXDL 3R2IA 3DUZA 3VYTA 4DR6L 1ZEQX 4ZAIA 1SFOB 3GTQH 1SDFA 3VYSA 3JAMi 3Q0AA 1ENFA 1HNWQ 2ZTDA 1IL2A 1HTLD 4AQYL 1CQFA 4DN4M 1CUKA 1VQ9A 4CDFC 2KCNA 4L6TB 2KECA 2FFKB 1OXVA 1HTPA 1IYJB 4DAVA 2XTIA 5ELBA 3RZDH 2N8NA 4A93H 4YHHL 5IYCH 4QCLA 2FMMA 2R7DA 3GTOB 1UE6A 1KAAA 1CA5A 3T16A 2F3VA 3URYA 2JA9A 2K33A 4OEMB 1MHWC 1WD0A 4QJFA 3FMCA 4LFBQ 1V1QA 2F0LA 3KF8B 3GP7A 5GAHC 2O4XA 1GUSA 3CRLC 4DR7L 1IBML 1NR2A 1M8AA 1XMQL 4QIWE 1EQVA 2AQ1B 2NVTH 2FINB 1BKBA 5I9PA 3W1BA 1D5XC 3I3CA 4IQZA 3K6OA 1IBLQ 1YEZA 1WTXA 1LT5D 4JI3L 2E75C 1WTHA 4RGNA 3SVMA 4Y7NH 2F0DA 1JOOA 1U0LA 1VQ6A 1H95A 2IX0A 4R4QA 1QE6A 3TS2A 1SNQA 2LSSA 4B3MQ 1E0BA 2AWNA 3W5OA 4RMFA 2X69A 1EZ6A 2EJFC 4JI2L 4LWCA 1FVIA 5HGTA 2NZ1D 4FNFA 5CV8A 4GKKQ 3CHBD 4O1NA 3OTOQ 5JVG3 1U4MA 2B2VC 2K5DA 3K5NA 2NVXH 1AW7A 3J81i 5E3FA 1RHPA 1QWYA 3G7LA 1TT2A 3JAME 4IFDJ 3T51B 2QILA 3BVZA 3WOEA 1PH2A 1DXMA 2KEEA 4B9XA 5M5YB 4FF1A 1PRTC 2K5HA 1HR0L 2BOSA 1I6VC 1EFWA 1WCMB 3OYYA 4A3FB 1QVGA 1HQRD 5IYDG 5EPLA 1NUCA 2XSCA 1MSGA 2K01A 4DV5L 2CQAA 1VQNA 4IOAA 1LTRD 1H9RA 1PRTD 1K8GA 5CORA 3DWQA 2VUMG 2WIIB 3E3XA 4A3BG 3W3AA 1B7YB 4QL5A 1PH1A 1SJHD 1VF7A 2JA6H 2B2YC 2JA7B 5J3BA 1CKNB 2OCEA 5M9OA 2R92B 2VL6A 4PV1C 5IYDH 1PZKD 4DUZQ 5A35A 3GD7A 3PIOA 5A2QE 1ENAA 2IJ0A 4PMWA 4ZQ3A 5M3FB 5GAGC 1HNZL 1S40A 2H1EA 4DNRB 5C6AA 1CKOA 2AUKA 4P72A 3AB9A 1K83B 5DM63 3PUZA 2KJXA 3UDIA 2QGQA 3H94A 4JW0A 2OTLA 1Y14B 5IGBA 1GUNA 4IZ8A 2F0UA 1SJED 3Q6SA 1R9TH 1VQHA 2KA7A 1EYDA 1C0AA 1I4PA 3J81E 1X3FA 2IY5B 1RF2D 2KVMA 1ICFB 3S2DH 2CWPA 5DNFA 5E7NA 1U4LA 3I4LA 5EKKA 4OX9Q 2KBNA 4J15A 3NP8A 1HUMA 3T1HL 2L5TA 1JE4A 5IGEA 4OL7A 4X66Q 4A3KG 2Y0SE 2JA8B 5ELEA 1JQYD 5KEEA 5CV6A 3S1QB 4JI1Q 2MHVA 4PZ6A 1Q1EA 2UUBL 1QNUA 4OO1I 1A63A 3L3OC 3I72A 2NTSA 3HRZC 1WD1A 1JJGA 4QGUA 4A76A 5FLXE 2M2LA 1TY2A 1BXTA 4DV1L 3SGIA 3PIP3 2A6HC 1TR5A 1YVCA 4A3KH 3A7LA 1AN8A 1NCVA 2K32A 4C3IH 2A8VA 1Z47A 2K75A 4FXDA 4A93B 1PH7A 4A3GH 4OO1G 1W6KA 4A3LH 3TN2A 5FLMG 1DD2A 1DZ1A 1JORA 4K14A 2E2DC 3ER0A 3CP0A 4DV7L 2A6HD 1UE1A 4HJ5A 3PIPA 1WTPA 1W3SA 1SYBA 3CCLA 3IAYA 2SEBD 3BYTB 2XWBB 4K0KL 4OONA 4MN3A 1RTNA 4KJNA 4DV0L 1PDQA 4HJ9A 4OO1H 1TWCH 1U4PA 1V1PB 4FF3A 3FVQA 5FLMH 1NBWA 4LF8L 2K6AA 2AHOB 4LF6Q 4Y52H 1KXLA 2JEBI 3D4RA 2A73B 2ID0A 1IBKL 2RF4A 3H6MA 2E2JB 1S72A 2CH4W 4B3SQ 1TQOA 2NN6G 2RQXA 4EQPA 2MO0A 3I55A 2NVXB 1MI2A 3J81j 3MXNA 4QF4A 3U58A 1WTOA 2WKDA 3E9IA 4POGA 1E1TA 2JSOA 4LFAL 1DCZA 2YU9B 1TWAH 1U4RA 4P74A 3J80c 3OWEB 1VQOA 2HHHL 1FR3A 2RSNA 1V8QA 4LF5Q 1F9PA 4EQNA 3IFDA 4Z9CB 5DAUA 1B50A 4J8QA 4XQNA 4LAAA 1H9SB 1AZPA 2LMCB 3MFYA 1LTLA 1KQSA 4JI7L 2O5JC 1ET6A 4A75A 2QKIC 3MWYW 1E7ZA 2QF7A 4CHTB 4ZLTF 1X32A 4TQUS 4HTHA 1LTGD 2WAQG 3BG3A 1TXYA 2M9VA 1ZXTA 4A3EG 2EQSA 4LJZC 2OWOA 3KDFA 4KHPL 2BA1A 1XPRA 2A6EC 3ULLA 1VQGA
chains in the Genus database with same CATH topology
4NXNQ 3RN2A 4BBSH 2BA0A 2Q2TA 1XNQQ 4YCVA 3KOJA 3CCMA 3J7A5 2CQOA 1Q12A 5K36G 1FL0A 4JI2Q 4YY3Q 1SROA 1N9WA 4RG1A 1VQCA 1YIJA 3TREA 1BBUA 3A74A 3STBD 1X54A 4HJ8A 1LUZA 3UE0A 3ULJA 4JI0L 5M3FG 5IYBG 1E3PA 4X64Q 3I4NG 2N3SA 1P8LA 1SMXA 3A5UA 3PO3H 1N32Q 1VQKA 1WOCA 3HOUG 1DGSA 1YJWA 1NJIC 1PYBA 1E22A 5JEAG 4OX9L 3D0FA 3KF6A 4LF7L 4X6AH 2K14A 2R6GA 3F1ZA 4EX5A 1SE8A 4A3EH 3KLWA 4B3TQ 4LF4L 1OXSC 1VQ4A 4GS3A 1SN8A 4APVA 2B63G 2JA7H 4NXML 2R92H 2UXBQ 4DR2L 4DV6L 1K8AC 2ATWA 2K4KA 2UXCL 3RLFA 1I3QH 1NMGA 3S24A 1HR0Q 4UP7A 2BH8A 1SFOH 4L5SA 1RL2A 1Q86C 1QUQB 1VS0A 1MKHA 3CF5A 1XPOA 3I56A 2JEAI 1N34L 3PGZA 2Q2HA 1XPUA 1IXRA 4X65Q 1VQEA 4ALPA 3I4NH 2WB1G 5IYBH 5H1SE 5M3FH 3KJOA 1HR0W 1YJNA 1N32L 5JJKA 5C4JH 4AH6A 3CCEA 3CCSA 4DR3L 3PUXA 4DV5Q 1VQLA 2EIFA 5M5XH 3K7AH 1VCIA 1Q1BA 1UWVA 4JBWA 4XTCS 4GNXC 3HOYG 1X65A 5JJIA 3DM3A 4JYAL 2KENA 1Y1WG 3TEHB 2A1AA 2AKWB 3KYHC 2B29A 2HIVA 5GQOA 3E9HA 4XIGS 3ULPA 4LNQA 2JA8G 2JK8A 2NN6I 2UU9L 4DV4Q 4JC0A 3HOUH 4JI5L 1YJ9A 3M9BA 2ZJPA 1N8RC 4C3JH 2JA6G 2K5NA 1Q81C 1J6QA 1EQRA 3M85A 3I2ZA 3BU2A 2CCZA 1PYSB 4DR6Q 3PV0A 4IPDA 3KDFB 3A5ZB 2ASBA 4C2MH 1V9PA 2WAQE 3FKIG 4DAMA 1Y1VG 1K9MC 3GTKH 4IFDI 4P73A 1VQIA 3HOYH 1OXUA 4A3DG 4DAYB 4DV2L 1HNZQ 1Q7YC 2UUCL 1Y1WH 4GNXA 2VQFQ 3F2DA 2E2IH 4DNIA 2CKZB 3U4ZA 1PH8A 4KHZA 1KD1C 1J5EQ 4LF9L 3UE1A 4WJ4A 1YNXA 2JA8H 4IJHA 2E2HH 2R7ZH 1CSPA 1M90C 1KL9A 3S1QH 4R4OA 2Z0SA 1XNRL 3BZKA 4NPSA 3FP9A 2VW9A 1KRTA 1LM0A 3GO5A 5GAEC 3CCRA 1K3RA 2N49A 4A93G 1X55A 5IYCG 1ASYA 2AMCB 1W2BA 5FJ8G 4JI6Q 3L7ZC 2IT1A 3GTGH 2UXDL 1K0RA 4LF6L 2WFWA 4DR6L 1D7QA 2LXJA 1K73C 3GTQH 3FKIH 1Y1VH 4YWLA 4H02A 3I4MH 1N36Q 3JAMi 4BY7G 1MIUA 2MQHA 2F3IA 1HNWQ 1FJGL 2ZTDA 1IL2A 4BXXG 4AQYL 1N33L 5IT9c 1CUKA 1PVOA 1I94Q 1VQ9A 1YITA 5GADC 4DR5L 2Z6KA 3K8AA 1OXVA 1XMOQ 3G48A 1IYJB 2I5HA 3G4SA 4IO9A 4GLVB 2XTIA 3RZDH 2N8NA 3ERSX 1IZ6A 2C35B 3JAMc 5IYCH 4YHHL 4A93H 2WB1E 2R7DA 1XJVA 1UE6A 5LMNL 3AQQA 4O2DA 4P75A 1JJ2A 1QVFA 2F4VQ 2JA9A 1VQ8A 1HNXQ 1WCMH 2UUBQ 4OXPA 4A3FH 1EIFA 1YHBA 3MEFA 2ZM6L 1Q46A 2AWOA 1B8AA 4QJFA 4MZ9A 4DV3L 4A3MG 1VQFA 2IHEA 4BY7H 4LFBQ 2N78A 5LMUL 1HNWL 4LFCQ 2ALYB 5IP9G 1V1QA 3PUVA 4FDBA 3KF8B 4LW1A 2D62A 4LF5L 3J7ZC 5GAHC 3K80C 1KHIA 4DR7L 1IBML 1UEBA 3S15H 4IOCA 2JA5G 1EQQA 1Q82C 1OTCA 3PF4A 1GO3E 3UDFA 1NMFA 4DR4L 1XMQL 1EIYB 1OXTA 4AYBE 1GVPA 4DV1Q 5AJ3L 4QIWE 4DKAC 1E1OA 1I5FA 2NVTH 1BKBA 3W1BA 4JI4Q 1IBLQ 3F8TA 4GNXB 3OW2A 1HZCA 1YEZA 3S14H 3FHWA 1CKNA 4JI3L 2F4VL 2HQLA 3T1YL 2PI2A 4UPAA 2JJQA 4Y7NH 4JV5Q 1H95A 1L1OA 1U0LA 3RLNA 1VQ6A 2IX0A 4R4QA 4A3MH 4A3GG 3NELA 3E0EA 3PUWA 3TS2A 1JT8A 2LSSA 5IP9H 4B3MQ 5HGQA 2R7FA 4A3LG 1CKMA 2ZJRA 3K0XA 4NXNL 2AWNA 2L15A 4JCVE 3W5OA 1XNQL 4RMFA 3CPFA 2JA5H 4JI2L 4YY3L 4LWCA 1FVIA 4IPHA 4GKKQ 4GN4B 3S1NH 4X64L 2YV5A 2NVQH 3OTOQ 5BR8Q 4QQBX 4DK6C 2RHSB 2GVBA 1VQ5A 2NVXH 3B6YA 4K0KQ 3AFQA 4BBRG 1L2FA 3I7FA 4IPCA 1UE5A 1C7YA 1K83H 1TWFH 2NZOA 4POFA 3J81i 2QEXA 3CCUA 4B3TL 4DV0Q 5JJLA 2KCMA 3CMAA 2B63H 1AE2A 3GTLH 4IFDJ 2D0PA 2NZHA 3TQYA 4AIMA 1PH2A 2ZJQA 2UXBL 5IY0A 1MJEA 3CCJA 1BBWA 2K5HA 2NVYH 5C44G 1HR0L 3CW2C 1EFWA 3WWVA 3OYYA 3PUYA 1HZBA 1GKHA 1NTGA 1QVGA 4JOIC 4X65L 4JI8Q 3J81c 4A3JG 2Y0SG 5IYDG 4GKKL 1WFQA 2ES2A 1X3GA 2PNHA 1EWIA 1QVCA 1VQMA 1IBKQ 4GKJQ 3CD6A 1HJPA 4DV5L 3CC2A 3BJUA 1A62A 1VQNA 2ZTCA 4DR1Q 4IOAA 3CCVA 3NBHB 1K8GA 3CCQA 4GOPC 2Z6KC 5ELNA 2B3GA 2PI2E 2VUMG 1VQJA 2E8GA 5C44H 4DV4L 4A3BG 1B7YB 2MO1A 4QL5A 1PH6A 1PH1A 1D8LA 4LFAQ 2JA6H 1G6PA 5J3BA 1CKNB 2OCEA 2VS1A 4O0AA 4YWKA 3CPWA 4JOIA 2VL6A 4A3JH 1VQBA 5IYDH 3BZCA 1BVSA 4L5TA 1L1OB 4MNOA 2HHHQ 4DUZQ 5JEAJ 1PH3A 4OWXB 3GD7A 4IJLA 1JE5A 3NENA 5M3MG 5FLXc 5C0XI 3PIOA 2K50A 4BA1I 4A3DH 2Q2IA 4PMWA 2VQEQ 2YTVA 1A0IA 5GAGC 1HNZL 3I4OA 1EYGA 3VDYA 2VQFL 1S40A 2I0QA 4OWWB 1S3OA 3J80i 1J5EL 4GOPA 2YTYA 3IRBA 1CKOA 1HZ9A 1A8VA 3U4VA 4P72A 3CC4A 3PUZA 3T1HQ 2BH2A 3UDIA 2QGQA 5FJ8H 2OTLA 2I5LX 3M4PA 1OXXK 1Y14B 4JI6L 1LYLA 2F52A 4JG2A 4QY7A 1PA6A 4KHPQ 4R1JA 4DUZL 1R9TH 1VQHA 1G291 1L1OC 3AFPA 5M3MH 1T9HA 1JJCB 2KHJA 1C0AA 3L0OA 5C0XG 1N36L 4A3CG 4R4IA 5IWAQ 5ELOA 4BXXH 1X3FA 2VQEL 2VZAA 3ICEA 2IY5B 2H5XA 1KAWA 3H0GG 5C4XG 3S2DH 1I94L 5EAYA 4JI0Q 1Q8KA 3HOWG 2CWPA 1PFSA 5E7NA 3PO3G 4WJ3M 2HT1A 4PZ8A 4OX9Q 2KBNA 3NEMA 1XMOL 4JBKA 4J15A 3F2CA 5DLQE 2CFMA 2ZTEA 3T1HL 5HY6A 1EUJA 4HJAA 4HIMA 4X62Q 4HIOA 4X66Q 4LF4Q 1HH2P 5C3EG 2Y0SE 4LUOA 4A3KG 3RNUA 2K5VA 4YWMA 4C3HH 3HOVG 1L0WA 4BA2I 4NXMQ 4GLAC 1WI5A 4DR2Q 5IE8A 3CXCA 2E5LQ 4JI1Q 2GVAA 2OTJA 1UE7A 4PZ6A 3GTJH 1HNXL 3RZOH 1Q1EA 4DPGA 5IP7G 2UUBL 4A3CH 4UY8C 1SLJA 4OO1I 1A63A 5IWAL 1N34Q 2JQOA 4LFBL 3S1RH 4B3RQ 4LFCL 3H0GH 2MFIA 5C4XH 3RN5A 3PCOB 3HOWH 3M7NA 3GTPH 1JJGA 4GLXA 4QGUA 4A76A 4L5QA 1PH4A 1XTDA 2E2JH 3AYHB 4DV7Q 1SR3A 4DR3Q 2LXKA 3RR5A 1NY4A 2K52A 4YCWA 2D0OA 1O7IA 3EN2A 4DV1L 2PMZE 3SGIA 2UUAQ 4P71A 2PQAA 1YVCA 4A4IA 5C3EH 4X62L 4A3KH 4X66L 4JYAQ 3UDGA 3JC66 1I50H 4JI4L 1IBLL 3HOVH 4C3IH 2A8VA 1QZGA 1Z47A 2K75A 4JBMA 3A0JA 2E5LL 3HOXG 4JI1L 4GOPB 2UU9Q 5IP7H 4JV5L 2A19A 4JI5Q 1PH7A 4A3GH 4IPGA 5M5WH 4OO1G 1AE3A 4MTNA 3MXNB 2YU9H 2JE6I 4ME3A 4A3LH 4B3ML 5FLMG 4LF8Q 1YHQA 4B3RL 2EXDA 2QA4A 2XGTA 3K81C 3ER0A 3CMEA 3CP0A 4DV7L 3GTMH 1VQAA 3H15A 1UE1A 4HJ5A 3PIPA 1KRSA 1W3SA 3HOZG 2VY3A 2WP8J 4EQ5A 2R93G 2DUDA 4TVAB 1YHAA 3CCLA 3OTOL 5BR8L 3CQZH 3HKZG 4DV2Q 2UUAL 4GN5A 3M3YH 2UUCQ 4BBRH 1P16A 4K0KL 4LF9Q 4OONA 2VNUD 3GTOH 3HOXH 1X3EA 2YTXA 4JBJA 2R7ZG 1I6HH 4DV0L 3PF5A 4HJ9A 1PHJA 5C0XJ 2RHQB 2OQKA 1MJCA 1XNRQ 1TWCH 3U50C 4AYBG 3G71A 5FLMH 3H3VI 1NBWA 3S1MH 4LF8L 1U5KA 3KJPA 4KLKA 2UXDQ 2AHOB 4R4CA 2YYZA 3TRZA 4NB3A 1GM5A 4LF6Q 4Y52H 4BY1G 1KXLA 2JEBI 3HOZH 1B70B 4JI8L 1X9NA 2R93H 1FGUA 2KHIA 3I4MG 4DUYQ 1WYDA 3PO2G 4HJ7A 2ID0A 1IBKL 1FJGQ 2RF4A 2DGYA 1NE3A 4AQYQ 4GKJL 1X6OA 1N33Q 4A3IG 2V1CC 1V43A 2KCTA 4PG3A 1PH5A 2OQ0A 1S72A 2IX1A 3EIVA 4DR5Q 3TS0A 1JB7A 3S17H 4DR1L 3CC7A 3ZJYC 4B3SQ 3LGJA 1RIPA 1YI2A 2NN6G 3S2HH 1ASZA 1KC8C 4UP9A 4JI7Q 3S16H 2MO0A 3KF6B 3I55A 3EBEA 2VUMH 1QZHA 4LUVA 4YHHQ 1VQDA 4A3BH 2FXQA 3J81j 4UP8A 1Z9FA 1QUQA 2RCNA 4GN3B 3L2PA 2PQAB 5LMNQ 1KIXA 3K7UC 3U58A 3E9IA 4POGA 1HZAA 1YZ6A 2GN5A 4BY1H 1E1TA 3F2BA 1M1KC 4LFAL 3CAMA 1WCMG 2ZM6Q 1JMCA 4A3FG 3Q8DA 1TWAH 4OWTB 5LMNW 3W1GA 1VQPA 4P74A 4DV3Q 3PO2H 4IFDG 1GD7A 4R4TA 3J80c 3DLLA 4DUYL 5LMUQ 1VQOA 2HHHL 1PV4A 4A3IH 4LF5Q 4PZ7A 3D31A 1TWHH 3AEVA 3GDEA 2Q2UA 4LUZA 1IBMQ 3G6EA 4BBSG 4DR7Q 3PSIA 4DR4Q 1WJJA 4B3SL 5GROA 1PH9A 4L5RC 3RLOA 1XMQQ 1LTLA 2CWAA 3HFZB 3M4QA 5AJ3Q 1KQSA 1G51A 4JI7L 4HIKA 4YCUA 3H3VH 4A75A 1E7ZA 2I5MX 1CSQA 3UDXA 3STBC 1VQ7A 4LF7Q 1AH9A 4TQUS 1YBYA 3KFUA 5M5YH 2WAQG 4JI3Q 1E24A 1TWGH 1TXYA 3M4OH 3T1YQ 4A3EG 2HIXA 2EQSA 1X56A 4KI0A 1SRUA 2OWOA 3KDFA 3HKZE 2JA7G 4KHPL 2BA1A 4DV6Q 2R92G 2UXCQ 3HKSA 4DK3C 1C9OA 1XPRA 3ULLA 2IHFA 1VQGA 4HIDA 2MNAA 1EOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN Q;  3RN2 A;  4BBS H;  2BA0 A;  2Q2T A;  1XNQ Q;  4YCV A;  3KOJ A;  3CCM A;  3J7A 5;  2CQO A;  1Q12 A;  5K36 G;  1FL0 A;  4JI2 Q;  4YY3 Q;  1SRO A;  1N9W A;  4RG1 A;  1VQC A;  1YIJ A;  3TRE A;  1BBU A;  3A74 A;  3STB D;  1X54 A;  4HJ8 A;  1LUZ A;  3UE0 A;  3ULJ A;  4JI0 L;  5M3F G;  5IYB G;  1E3P A;  4X64 Q;  3I4N G;  2N3S A;  1P8L A;  1SMX A;  3A5U A;  3PO3 H;  1N32 Q;  1VQK A;  1WOC A;  3HOU G;  1DGS A;  1YJW A;  1NJI C;  1PYB A;  1E22 A;  5JEA G;  4OX9 L;  3D0F A;  3KF6 A;  4LF7 L;  4X6A H;  2K14 A;  2R6G A;  3F1Z A;  4EX5 A;  1SE8 A;  4A3E H;  3KLW A;  4B3T Q;  4LF4 L;  1OXS C;  1VQ4 A;  4GS3 A;  1SN8 A;  4APV A;  2B63 G;  2JA7 H;  4NXM L;  2R92 H;  2UXB Q;  4DR2 L;  4DV6 L;  1K8A C;  2ATW A;  2K4K A;  2UXC L;  3RLF A;  1I3Q H;  1NMG A;  3S24 A;  1HR0 Q;  4UP7 A;  2BH8 A;  1SFO H;  4L5S A;  1RL2 A;  1Q86 C;  1QUQ B;  1VS0 A;  1MKH A;  3CF5 A;  1XPO A;  3I56 A;  2JEA I;  1N34 L;  3PGZ A;  2Q2H A;  1XPU A;  1IXR A;  4X65 Q;  1VQE A;  4ALP A;  3I4N H;  2WB1 G;  5IYB H;  5H1S E;  5M3F H;  3KJO A;  1HR0 W;  1YJN A;  1N32 L;  5JJK A;  5C4J H;  4AH6 A;  3CCE A;  3CCS A;  4DR3 L;  3PUX A;  4DV5 Q;  1VQL A;  2EIF A;  5M5X H;  3K7A H;  1VCI A;  1Q1B A;  1UWV A;  4JBW A;  4XTC S;  4GNX C;  3HOY G;  1X65 A;  5JJI A;  3DM3 A;  4JYA L;  2KEN A;  1Y1W G;  3TEH B;  2A1A A;  2AKW B;  3KYH C;  2B29 A;  2HIV A;  5GQO A;  3E9H A;  4XIG S;  3ULP A;  4LNQ A;  2JA8 G;  2JK8 A;  2NN6 I;  2UU9 L;  4DV4 Q;  4JC0 A;  3HOU H;  4JI5 L;  1YJ9 A;  3M9B A;  2ZJP A;  1N8R C;  4C3J H;  2JA6 G;  2K5N A;  1Q81 C;  1J6Q A;  1EQR A;  3M85 A;  3I2Z A;  3BU2 A;  2CCZ A;  1PYS B;  4DR6 Q;  3PV0 A;  4IPD A;  3KDF B;  3A5Z B;  2ASB A;  4C2M H;  1V9P A;  2WAQ E;  3FKI G;  4DAM A;  1Y1V G;  1K9M C;  3GTK H;  4IFD I;  4P73 A;  1VQI A;  3HOY H;  1OXU A;  4A3D G;  4DAY B;  4DV2 L;  1HNZ Q;  1Q7Y C;  2UUC L;  1Y1W H;  4GNX A;  2VQF Q;  3F2D A;  2E2I H;  4DNI A;  2CKZ B;  3U4Z A;  1PH8 A;  4KHZ A;  1KD1 C;  1J5E Q;  4LF9 L;  3UE1 A;  4WJ4 A;  1YNX A;  2JA8 H;  4IJH A;  2E2H H;  2R7Z H;  1CSP A;  1M90 C;  1KL9 A;  3S1Q H;  4R4O A;  2Z0S A;  1XNR L;  3BZK A;  4NPS A;  3FP9 A;  2VW9 A;  1KRT A;  1LM0 A;  3GO5 A;  5GAE C;  3CCR A;  1K3R A;  2N49 A;  4A93 G;  1X55 A;  5IYC G;  1ASY A;  2AMC B;  1W2B A;  5FJ8 G;  4JI6 Q;  3L7Z C;  2IT1 A;  3GTG H;  2UXD L;  1K0R A;  4LF6 L;  2WFW A;  4DR6 L;  1D7Q A;  2LXJ A;  1K73 C;  3GTQ H;  3FKI H;  1Y1V H;  4YWL A;  4H02 A;  3I4M H;  1N36 Q;  3JAM i;  4BY7 G;  1MIU A;  2MQH A;  2F3I A;  1HNW Q;  1FJG L;  2ZTD A;  1IL2 A;  4BXX G;  4AQY L;  1N33 L;  5IT9 c;  1CUK A;  1PVO A;  1I94 Q;  1VQ9 A;  1YIT A;  5GAD C;  4DR5 L;  2Z6K A;  3K8A A;  1OXV A;  1XMO Q;  3G48 A;  1IYJ B;  2I5H A;  3G4S A;  4IO9 A;  4GLV B;  2XTI A;  3RZD H;  2N8N A;  3ERS X;  1IZ6 A;  2C35 B;  3JAM c;  5IYC H;  4YHH L;  4A93 H;  2WB1 E;  2R7D A;  1XJV A;  1UE6 A;  5LMN L;  3AQQ A;  4O2D A;  4P75 A;  1JJ2 A;  1QVF A;  2F4V Q;  2JA9 A;  1VQ8 A;  1HNX Q;  1WCM H;  2UUB Q;  4OXP A;  4A3F H;  1EIF A;  1YHB A;  3MEF A;  2ZM6 L;  1Q46 A;  2AWO A;  1B8A A;  4QJF A;  4MZ9 A;  4DV3 L;  4A3M G;  1VQF A;  2IHE A;  4BY7 H;  4LFB Q;  2N78 A;  5LMU L;  1HNW L;  4LFC Q;  2ALY B;  5IP9 G;  1V1Q A;  3PUV A;  4FDB A;  3KF8 B;  4LW1 A;  2D62 A;  4LF5 L;  3J7Z C;  5GAH C;  3K80 C;  1KHI A;  4DR7 L;  1IBM L;  1UEB A;  3S15 H;  4IOC A;  2JA5 G;  1EQQ A;  1Q82 C;  1OTC A;  3PF4 A;  1GO3 E;  3UDF A;  1NMF A;  4DR4 L;  1XMQ L;  1EIY B;  1OXT A;  4AYB E;  1GVP A;  4DV1 Q;  5AJ3 L;  4QIW E;  4DKA C;  1E1O A;  1I5F A;  2NVT H;  1BKB A;  3W1B A;  4JI4 Q;  1IBL Q;  3F8T A;  4GNX B;  3OW2 A;  1HZC A;  1YEZ A;  3S14 H;  3FHW A;  1CKN A;  4JI3 L;  2F4V L;  2HQL A;  3T1Y L;  2PI2 A;  4UPA A;  2JJQ A;  4Y7N H;  4JV5 Q;  1H95 A;  1L1O A;  1U0L A;  3RLN A;  1VQ6 A;  2IX0 A;  4R4Q A;  4A3M H;  4A3G G;  3NEL A;  3E0E A;  3PUW A;  3TS2 A;  1JT8 A;  2LSS A;  5IP9 H;  4B3M Q;  5HGQ A;  2R7F A;  4A3L G;  1CKM A;  2ZJR A;  3K0X A;  4NXN L;  2AWN A;  2L15 A;  4JCV E;  3W5O A;  1XNQ L;  4RMF A;  3CPF A;  2JA5 H;  4JI2 L;  4YY3 L;  4LWC A;  1FVI A;  4IPH A;  4GKK Q;  4GN4 B;  3S1N H;  4X64 L;  2YV5 A;  2NVQ H;  3OTO Q;  5BR8 Q;  4QQB X;  4DK6 C;  2RHS B;  2GVB A;  1VQ5 A;  2NVX H;  3B6Y A;  4K0K Q;  3AFQ A;  4BBR G;  1L2F A;  3I7F A;  4IPC A;  1UE5 A;  1C7Y A;  1K83 H;  1TWF H;  2NZO A;  4POF A;  3J81 i;  2QEX A;  3CCU A;  4B3T L;  4DV0 Q;  5JJL A;  2KCM A;  3CMA A;  2B63 H;  1AE2 A;  3GTL H;  4IFD J;  2D0P A;  2NZH A;  3TQY A;  4AIM A;  1PH2 A;  2ZJQ A;  2UXB L;  5IY0 A;  1MJE A;  3CCJ A;  1BBW A;  2K5H A;  2NVY H;  5C44 G;  1HR0 L;  3CW2 C;  1EFW A;  3WWV A;  3OYY A;  3PUY A;  1HZB A;  1GKH A;  1NTG A;  1QVG A;  4JOI C;  4X65 L;  4JI8 Q;  3J81 c;  4A3J G;  2Y0S G;  5IYD G;  4GKK L;  1WFQ A;  2ES2 A;  1X3G A;  2PNH A;  1EWI A;  1QVC A;  1VQM A;  1IBK Q;  4GKJ Q;  3CD6 A;  1HJP A;  4DV5 L;  3CC2 A;  3BJU A;  1A62 A;  1VQN A;  2ZTC A;  4DR1 Q;  4IOA A;  3CCV A;  3NBH B;  1K8G A;  3CCQ A;  4GOP C;  2Z6K C;  5ELN A;  2B3G A;  2PI2 E;  2VUM G;  1VQJ A;  2E8G A;  5C44 H;  4DV4 L;  4A3B G;  1B7Y B;  2MO1 A;  4QL5 A;  1PH6 A;  1PH1 A;  1D8L A;  4LFA Q;  2JA6 H;  1G6P A;  5J3B A;  1CKN B;  2OCE A;  2VS1 A;  4O0A A;  4YWK A;  3CPW A;  4JOI A;  2VL6 A;  4A3J H;  1VQB A;  5IYD H;  3BZC A;  1BVS A;  4L5T A;  1L1O B;  4MNO A;  2HHH Q;  4DUZ Q;  5JEA J;  1PH3 A;  4OWX B;  3GD7 A;  4IJL A;  1JE5 A;  3NEN A;  5M3M G;  5FLX c;  5C0X I;  3PIO A;  2K50 A;  4BA1 I;  4A3D H;  2Q2I A;  4PMW A;  2VQE Q;  2YTV A;  1A0I A;  5GAG C;  1HNZ L;  3I4O A;  1EYG A;  3VDY A;  2VQF L;  1S40 A;  2I0Q A;  4OWW B;  1S3O A;  3J80 i;  1J5E L;  4GOP A;  2YTY A;  3IRB A;  1CKO A;  1HZ9 A;  1A8V A;  3U4V A;  4P72 A;  3CC4 A;  3PUZ A;  3T1H Q;  2BH2 A;  3UDI A;  2QGQ A;  5FJ8 H;  2OTL A;  2I5L X;  3M4P A;  1OXX K;  1Y14 B;  4JI6 L;  1LYL A;  2F52 A;  4JG2 A;  4QY7 A;  1PA6 A;  4KHP Q;  4R1J A;  4DUZ L;  1R9T H;  1VQH A;  1G29 1;  1L1O C;  3AFP A;  5M3M H;  1T9H A;  1JJC B;  2KHJ A;  1C0A A;  3L0O A;  5C0X G;  1N36 L;  4A3C G;  4R4I A;  5IWA Q;  5ELO A;  4BXX H;  1X3F A;  2VQE L;  2VZA A;  3ICE A;  2IY5 B;  2H5X A;  1KAW A;  3H0G G;  5C4X G;  3S2D H;  1I94 L;  5EAY A;  4JI0 Q;  1Q8K A;  3HOW G;  2CWP A;  1PFS A;  5E7N A;  3PO3 G;  4WJ3 M;  2HT1 A;  4PZ8 A;  4OX9 Q;  2KBN A;  3NEM A;  1XMO L;  4JBK A;  4J15 A;  3F2C A;  5DLQ E;  2CFM A;  2ZTE A;  3T1H L;  5HY6 A;  1EUJ A;  4HJA A;  4HIM A;  4X62 Q;  4HIO A;  4X66 Q;  4LF4 Q;  1HH2 P;  5C3E G;  2Y0S E;  4LUO A;  4A3K G;  3RNU A;  2K5V A;  4YWM A;  4C3H H;  3HOV G;  1L0W A;  4BA2 I;  4NXM Q;  4GLA C;  1WI5 A;  4DR2 Q;  5IE8 A;  3CXC A;  2E5L Q;  4JI1 Q;  2GVA A;  2OTJ A;  1UE7 A;  4PZ6 A;  3GTJ H;  1HNX L;  3RZO H;  1Q1E A;  4DPG A;  5IP7 G;  2UUB L;  4A3C H;  4UY8 C;  1SLJ A;  4OO1 I;  1A63 A;  5IWA L;  1N34 Q;  2JQO A;  4LFB L;  3S1R H;  4B3R Q;  4LFC L;  3H0G H;  2MFI A;  5C4X H;  3RN5 A;  3PCO B;  3HOW H;  3M7N A;  3GTP H;  1JJG A;  4GLX A;  4QGU A;  4A76 A;  4L5Q A;  1PH4 A;  1XTD A;  2E2J H;  3AYH B;  4DV7 Q;  1SR3 A;  4DR3 Q;  2LXK A;  3RR5 A;  1NY4 A;  2K52 A;  4YCW A;  2D0O A;  1O7I A;  3EN2 A;  4DV1 L;  2PMZ E;  3SGI A;  2UUA Q;  4P71 A;  2PQA A;  1YVC A;  4A4I A;  5C3E H;  4X62 L;  4A3K H;  4X66 L;  4JYA Q;  3UDG A;  3JC6 6;  1I50 H;  4JI4 L;  1IBL L;  3HOV H;  4C3I H;  2A8V A;  1QZG A;  1Z47 A;  2K75 A;  4JBM A;  3A0J A;  2E5L L;  3HOX G;  4JI1 L;  4GOP B;  2UU9 Q;  5IP7 H;  4JV5 L;  2A19 A;  4JI5 Q;  1PH7 A;  4A3G H;  4IPG A;  5M5W H;  4OO1 G;  1AE3 A;  4MTN A;  3MXN B;  2YU9 H;  2JE6 I;  4ME3 A;  4A3L H;  4B3M L;  5FLM G;  4LF8 Q;  1YHQ A;  4B3R L;  2EXD A;  2QA4 A;  2XGT A;  3K81 C;  3ER0 A;  3CME A;  3CP0 A;  4DV7 L;  3GTM H;  1VQA A;  3H15 A;  1UE1 A;  4HJ5 A;  3PIP A;  1KRS A;  1W3S A;  3HOZ G;  2VY3 A;  2WP8 J;  4EQ5 A;  2R93 G;  2DUD A;  4TVA B;  1YHA A;  3CCL A;  3OTO L;  5BR8 L;  3CQZ H;  3HKZ G;  4DV2 Q;  2UUA L;  4GN5 A;  3M3Y H;  2UUC Q;  4BBR H;  1P16 A;  4K0K L;  4LF9 Q;  4OON A;  2VNU D;  3GTO H;  3HOX H;  1X3E A;  2YTX A;  4JBJ A;  2R7Z G;  1I6H H;  4DV0 L;  3PF5 A;  4HJ9 A;  1PHJ A;  5C0X J;  2RHQ B;  2OQK A;  1MJC A;  1XNR Q;  1TWC H;  3U50 C;  4AYB G;  3G71 A;  5FLM H;  3H3V I;  1NBW A;  3S1M H;  4LF8 L;  1U5K A;  3KJP A;  4KLK A;  2UXD Q;  2AHO B;  4R4C A;  2YYZ A;  3TRZ A;  4NB3 A;  1GM5 A;  4LF6 Q;  4Y52 H;  4BY1 G;  1KXL A;  2JEB I;  3HOZ H;  1B70 B;  4JI8 L;  1X9N A;  2R93 H;  1FGU A;  2KHI A;  3I4M G;  4DUY Q;  1WYD A;  3PO2 G;  4HJ7 A;  2ID0 A;  1IBK L;  1FJG Q;  2RF4 A;  2DGY A;  1NE3 A;  4AQY Q;  4GKJ L;  1X6O A;  1N33 Q;  4A3I G;  2V1C C;  1V43 A;  2KCT A;  4PG3 A;  1PH5 A;  2OQ0 A;  1S72 A;  2IX1 A;  3EIV A;  4DR5 Q;  3TS0 A;  1JB7 A;  3S17 H;  4DR1 L;  3CC7 A;  3ZJY C;  4B3S Q;  3LGJ A;  1RIP A;  1YI2 A;  2NN6 G;  3S2H H;  1ASZ A;  1KC8 C;  4UP9 A;  4JI7 Q;  3S16 H;  2MO0 A;  3KF6 B;  3I55 A;  3EBE A;  2VUM H;  1QZH A;  4LUV A;  4YHH Q;  1VQD A;  4A3B H;  2FXQ A;  3J81 j;  4UP8 A;  1Z9F A;  1QUQ A;  2RCN A;  4GN3 B;  3L2P A;  2PQA B;  5LMN Q;  1KIX A;  3K7U C;  3U58 A;  3E9I A;  4POG A;  1HZA A;  1YZ6 A;  2GN5 A;  4BY1 H;  1E1T A;  3F2B A;  1M1K C;  4LFA L;  3CAM A;  1WCM G;  2ZM6 Q;  1JMC A;  4A3F G;  3Q8D A;  1TWA H;  4OWT B;  5LMN W;  3W1G A;  1VQP A;  4P74 A;  4DV3 Q;  3PO2 H;  4IFD G;  1GD7 A;  4R4T A;  3J80 c;  3DLL A;  4DUY L;  5LMU Q;  1VQO A;  2HHH L;  1PV4 A;  4A3I H;  4LF5 Q;  4PZ7 A;  3D31 A;  1TWH H;  3AEV A;  3GDE A;  2Q2U A;  4LUZ A;  1IBM Q;  3G6E A;  4BBS G;  4DR7 Q;  3PSI A;  4DR4 Q;  1WJJ A;  4B3S L;  5GRO A;  1PH9 A;  4L5R C;  3RLO A;  1XMQ Q;  1LTL A;  2CWA A;  3HFZ B;  3M4Q A;  5AJ3 Q;  1KQS A;  1G51 A;  4JI7 L;  4HIK A;  4YCU A;  3H3V H;  4A75 A;  1E7Z A;  2I5M X;  1CSQ A;  3UDX A;  3STB C;  1VQ7 A;  4LF7 Q;  1AH9 A;  4TQU S;  1YBY A;  3KFU A;  5M5Y H;  2WAQ G;  4JI3 Q;  1E24 A;  1TWG H;  1TXY A;  3M4O H;  3T1Y Q;  4A3E G;  2HIX A;  2EQS A;  1X56 A;  4KI0 A;  1SRU A;  2OWO A;  3KDF A;  3HKZ E;  2JA7 G;  4KHP L;  2BA1 A;  4DV6 Q;  2R92 G;  2UXC Q;  3HKS A;  4DK3 C;  1C9O A;  1XPR A;  3ULL A;  2IHF A;  1VQG A;  4HID A;  2MNA A;  1EOV A; 
#chains in the Genus database with same CATH topology
 2K03 A;  1XNQ Q;  2Q2T A;  3J7A 5;  3KOJ A;  4YY3 Q;  1N9W A;  1VQC A;  2EYL A;  3ULJ A;  4X64 Q;  3K0Y A;  3A5U A;  1YJW A;  1E22 A;  5JEA G;  1SAP A;  3KF6 A;  4LF7 L;  1WTV A;  3I73 A;  3MEH A;  2F0V A;  4A3E H;  4B3T Q;  4LF4 L;  5C5L A;  2VUM B;  1OXS C;  1JIC A;  2B63 G;  4A3B B;  4NXM L;  2UXB Q;  2E76 C;  2HUG A;  3OWF A;  1MBY A;  4B9W A;  3S24 A;  1SFO H;  2EY5 A;  1N34 L;  1K28 A;  2PW5 A;  2Q2H A;  1VQE A;  2M00 A;  5H1S E;  1YJN A;  5JJK A;  1H9J A;  1JWU D;  5JEA H;  1R4Q B;  3PUX A;  1VQL A;  1AEX A;  2F0M A;  4UDU C;  5M5X H;  1RTO A;  5C4H A;  5JJI A;  2MP1 A;  4BWG B;  5CV4 A;  4LNQ A;  5GQO A;  2HIV A;  3D6W A;  3E9H A;  1S5E D;  1F77 A;  1XWE A;  1A3T A;  2JK8 A;  2UU9 L;  4RKB A;  4JC0 A;  1YJ9 A;  5JPN C;  3KF8 A;  1O7Y A;  4TSS A;  2EE1 A;  5FO7 B;  3S1N B;  1OO9 B;  1V9P A;  3FKI G;  1Y1V G;  4IFD I;  5CV9 A;  4A3D G;  3NQI A;  2F0G A;  2UUC L;  5IGC A;  2IWH A;  2VQF Q;  3F2D A;  1JOK A;  4LF9 L;  3UE1 A;  2E2H H;  1U9R A;  1CSP A;  1LTS D;  1WTW A;  2QW7 A;  1XNR L;  4OIJ A;  3FP9 A;  4RCO A;  3GO5 A;  5IOD A;  1JR0 D;  1ASY A;  3SE0 A;  2B2T A;  5JJZ A;  3GTG H;  4V0B A;  3FEW X;  1D1I A;  1K0R A;  1RKN A;  4HAE A;  1K73 C;  2LFN A;  3FKI H;  1Y1V H;  5ELF A;  2XN9 C;  4HSV A;  1NAP A;  3BDC A;  3P20 A;  3FPP A;  4BY7 G;  1IYU A;  1IL8 A;  4BXX G;  1TY0 A;  1LO5 D;  5GAD C;  4DR5 L;  3VYR A;  1XMO Q;  1HHV A;  4PQX A;  4L63 B;  4IO9 A;  3JAM c;  2B2Y A;  1XJV A;  4HED A;  3A55 A;  3AQQ A;  4O2D A;  1GUG A;  4CKE A;  2F4V Q;  3HEJ A;  3NK9 A;  4UHV A;  1GUW A;  3CRK C;  4Q0F A;  1WCM H;  5ELD A;  2B2U A;  4A3F H;  1EIF A;  4IFD H;  2ZM6 L;  3MEF A;  1F2Z A;  2HDM A;  4L8J A;  3IKJ A;  4BY7 H;  4DV3 L;  1VQF A;  2I46 A;  1CK1 A;  2WB1 B;  5LMU L;  1HNW L;  4LFC Q;  3TP7 A;  3K80 C;  3S15 H;  3D6C A;  1Q82 C;  4DR4 L;  3UDF A;  4XXE A;  4JVZ A;  1EIY B;  3J80 L;  4AYB E;  1LTB D;  2D5D A;  2RKS A;  1Y1W B;  2GA4 B;  2F3W A;  4JI4 Q;  1E2W A;  1HCZ A;  3F8T A;  1HZC A;  4GNX B;  3FHW A;  1CKN A;  1YNJ C;  2PZT A;  3DWP A;  2PI2 A;  2JJQ A;  3RLN A;  1I4G A;  1EY4 A;  4K5W A;  3PUW A;  3QO2 A;  1B9N A;  2R7F A;  1LTT D;  1PZI D;  1GJX A;  4K6D A;  4DNT B;  2NYZ D;  1TWA B;  2WAC A;  3NWT A;  1BNZ A;  5EQ0 A;  1JWM D;  4KD3 A;  1JCK B;  3GV3 A;  2P5Z X;  5BR8 Q;  4QQB X;  4EQO A;  1YNJ D;  2RHS B;  5EBD A;  3FRP B;  2RVL A;  3V96 A;  4BBR G;  1L2F A;  4R9W A;  1K83 H;  1TWF H;  3CCU A;  3VR4 A;  1AE2 A;  2A5H A;  2D0P A;  2NZH A;  5I2X A;  1BBW A;  1AZQ A;  5C44 G;  1FGB D;  4G7Z C;  4I65 A;  3PUY A;  2B2W C;  4X65 L;  3J81 c;  1STA A;  4GKK L;  2D9U A;  4K6L A;  1QNK A;  4K2L A;  4X3S A;  4HR7 B;  5CR3 A;  1CI3 M;  4GKJ Q;  3CD6 A;  1HJP A;  2X6L A;  3RUZ A;  1Z7T A;  1K8M A;  1A62 A;  3NXW A;  1ZYR C;  3DXJ C;  4DR1 Q;  3N6R A;  2SNS A;  1VF5 C;  4XQQ A;  3CCV A;  3NBH B;  1CHQ D;  4GOP C;  1JOQ A;  2Z6K C;  3TME A;  2B3G A;  4JPB W;  2AQ2 B;  1VQJ A;  2E8G A;  5C44 H;  4DV4 L;  3FPU B;  4ABN A;  4QUF A;  4NW2 A;  4KN7 C;  3QR8 A;  3R93 A;  1G6P A;  4YWK A;  3CPW A;  4JOI A;  1XTC D;  3DEO A;  5T1G A;  1XX8 A;  1ZYR D;  5JEA J;  2O5I C;  1DM0 B;  1LTA D;  4IJL A;  3R3O A;  5FLX c;  1SXT A;  2K50 A;  5EKL A;  3C1E A;  5KYL A;  3E5S A;  1S3O A;  3NTH A;  1J5E L;  1SNP A;  1EU3 A;  5EKI A;  5M5X B;  3IRB A;  4ID6 A;  1A8V A;  5LL6 S;  3CC4 A;  2B63 B;  1D1K A;  5FJ8 H;  3M4P A;  1OXX K;  4RFB A;  1LYL A;  1UUP A;  2F52 A;  1L0Y B;  4U68 A;  4R1J A;  2NVY B;  4DUZ L;  1CTM A;  1G29 1;  3NBI A;  1T9H A;  2ZT9 C;  4IUT A;  3L0O A;  2K5Q A;  1N36 L;  4A3C G;  5IWA Q;  5ELO A;  1SYF A;  2VZA A;  2H5X A;  2F0F A;  5C4X G;  1I94 L;  4JI0 Q;  1Q8K A;  1PXU A;  3P7J A;  4WJ3 M;  1QB5 D;  1HFN A;  1V1P A;  4JBK A;  3F2C A;  5DLQ E;  1LAC A;  2CFM A;  2ZTE A;  3A54 A;  5HY6 A;  1A6X A;  1Q90 A;  4X62 Q;  4HIO A;  5CC4 A;  2E2H B;  3HOV G;  4BA2 I;  5IIF A;  1WI5 A;  3CXC A;  1TS4 A;  4XYQ A;  1HQM C;  2GVA A;  2OTJ A;  1HNX L;  3KUP A;  4DPG A;  5IP7 G;  4A3C H;  3VYU A;  1SLJ A;  5KYI A;  1EYC A;  3CKI B;  2XRS D;  1PRT B;  3MXG A;  3VR3 A;  3S1R H;  3GTG B;  5NUC A;  4N8F A;  4B3R Q;  3RN5 A;  5C4X H;  3ZYY X;  3GTP H;  3MHB A;  4GLX A;  4OGQ C;  4L5Q A;  3FKI B;  2Q8I B;  1Y1V B;  3AYH B;  4KKT A;  2E2J H;  4DR3 Q;  4A3D B;  1FYC A;  2B8F A;  2D0O A;  5E4X A;  1O7I A;  4KMU C;  1SEB D;  3ND8 A;  4X66 L;  4JYA Q;  3TZD A;  1MSH A;  4CDD C;  3K5M A;  3HOV H;  1SNC A;  1GOZ A;  2F4I A;  2OXP A;  4S3S A;  3A0J A;  3HOX G;  4JI1 L;  5IP7 H;  3MTS A;  4JV5 L;  1Q3L A;  2YU9 H;  2JE6 I;  1SYG A;  2F0P A;  3M4Y A;  3H09 A;  4RGO S;  2WV6 D;  2QA4 A;  3BVG A;  4NDX A;  4CKC A;  4PMB A;  3K81 C;  4HCE A;  2MUY A;  1H9S A;  2HDL A;  3TDQ A;  1PTO F;  1VQA A;  3H15 A;  4BY7 B;  3P75 A;  3HOZ G;  1D2B A;  4EQ5 A;  2DUD A;  4TVA B;  1YHA A;  1UNS A;  2G9D A;  4DV2 Q;  3K58 A;  1BF4 A;  2BCO A;  4ZCK A;  2EOT A;  3S15 B;  1Y8O B;  3HOX H;  1STB A;  1HA5 A;  2RHQ B;  1IKL A;  3RD4 A;  5LHY 1;  3NHH A;  3K59 A;  2IX3 A;  4YIJ A;  3I91 A;  4C3H B;  1F9Q A;  1U5K A;  4KKU A;  4RHS A;  2UXD Q;  1TKW B;  2YYZ A;  2IL8 A;  1GM5 A;  3HOZ H;  4JI8 L;  3MAQ A;  1FGU A;  3BDO A;  3I4M G;  4DUY Q;  3HOW B;  3IL8 A;  2DN8 A;  2DGY A;  1NE3 A;  4DAP A;  5CV7 A;  4AQY Q;  1JB3 A;  1KLU D;  1PFN A;  4PG3 A;  2KCT A;  2IX1 A;  1II3 A;  3OPO A;  5CGK A;  2K1B A;  3TS0 A;  1LT3 D;  2L12 A;  3CC7 A;  3H3V C;  2A69 C;  4C1N K;  1G2T A;  2SOB A;  4NP5 A;  2VUM H;  1O7L A;  1I50 B;  1VQD A;  2RA4 A;  4YHH Q;  1EY9 A;  4A3B H;  2RCN A;  1TWF B;  4GZY C;  1X3Q A;  2HD3 A;  3MXP A;  3Q8D A;  2A69 D;  2QDL A;  2ZXR A;  2PPB C;  3D31 A;  3GDE A;  2Q2U A;  4LUZ A;  1IBM Q;  4DR7 Q;  3DEP A;  4B3S L;  1F2M A;  5GRO A;  2Q8R E;  3RLO A;  1XMQ Q;  2CWA A;  3HFZ B;  1G51 A;  4HIK A;  4I7Z C;  4BBR B;  1CSQ A;  3HP3 A;  2FMC A;  1I6H B;  4JI3 Q;  3SEB A;  4IUN A;  2KOL A;  4KI0 A;  1SRU A;  5C44 B;  3N52 A;  2IHF A;  4HID A;  3J7A V;  3S1N H;  3RN2 A;  4ODG A;  2BA0 A;  5K36 G;  2EDG A;  1FL0 A;  4JI2 Q;  1EZ8 A;  4RG1 A;  1BBU A;  2F0Q A;  2Z6B A;  3HKZ B;  1X54 A;  1IYV A;  1LUZ A;  3UE0 A;  5J1Z A;  1E3P A;  3TZU A;  1P8L A;  2CVR A;  3LX0 A;  3S17 B;  3AU7 A;  1HPC A;  2F0T A;  3KLW A;  1VQ4 A;  2TSS A;  2EPB A;  3A7A B;  4DR2 L;  1K8A C;  2WKC A;  2K4K A;  1EFI D;  2PMZ B;  2BH8 A;  4UP7 A;  1HR0 Q;  4L5S A;  1RL2 A;  1T5X D;  1QUQ B;  1VS0 A;  1Q86 C;  5K36 H;  3I56 A;  2LS0 1;  1PTO C;  2NWG A;  1QG7 A;  3PGZ A;  2LKV A;  1IXR A;  4C3J G;  3J7Y W;  2WB1 G;  2Z9H A;  1HR0 W;  3SK8 A;  4A3I B;  2XIW A;  1X3P A;  4DV5 Q;  1VDZ A;  3R2T A;  2F0I A;  1VCI A;  1WVL A;  4K2K A;  1Y1W G;  1LLR D;  2A1A A;  5T1I A;  3TEH B;  1EIH A;  2R3Z A;  1PTO D;  2NN6 I;  1SE3 A;  4JI5 L;  2FJ2 A;  3M4O B;  2ZJP A;  3M7G A;  1KDB A;  1N8R C;  3Q24 A;  4C3J H;  4F7X A;  5C3W A;  2EYJ A;  1PFM A;  3M85 A;  3E0J A;  3I2Z A;  4K8J A;  2G5D A;  2CCZ A;  5E4W C;  2ASB A;  4BBS B;  5BN4 A;  2PYK A;  2WAQ E;  3S1R B;  3GV6 A;  3GTK H;  5C4X B;  3MXU A;  3GTP B;  2PW7 A;  1HNZ Q;  4J1M A;  4NKL A;  3G6J B;  1HXY D;  4GNX A;  1Y1W H;  3U4Z A;  1PH8 A;  2A68 C;  4WJ4 A;  4IJH A;  1KTK A;  4H13 C;  5D3I B;  3SK6 A;  3BZK A;  3EVQ A;  1LM0 A;  3HOV B;  2QEJ C;  2N49 A;  3KK7 A;  1I4R A;  2B39 A;  1W2B A;  4B08 A;  2OF1 A;  2I07 B;  4XDX A;  3W2D A;  3EA6 A;  4H02 A;  2A68 D;  1MIU A;  2MQH A;  2F3I A;  1FJG L;  3DMU A;  1PMR A;  2Z8L A;  1N33 L;  5IT9 c;  4F8M A;  2JN4 A;  4X3T A;  1YIT A;  3QOL A;  1SNM A;  2Z6K A;  4CDE C;  2NN6 H;  5CMD A;  2DJG C;  3K7A B;  3NQT A;  1RD9 D;  1GHK A;  2I5H A;  3G4S A;  4GLV B;  5BN5 A;  3J7A F;  3ERS X;  1IZ6 A;  2MPM A;  1DON A;  2F0J A;  5LMN L;  3HOX B;  1JJ2 A;  3KLS A;  1QVF A;  2K28 A;  1M4V A;  1VQ8 A;  5C3X A;  2UUB Q;  1I4H A;  1O78 A;  4H7B A;  2KUM A;  3T13 A;  2AWO A;  1SBB B;  2N78 A;  3EFX D;  4FF2 A;  2ALY B;  5IP9 G;  3PUV A;  4LW1 A;  2D62 A;  3BDL A;  1C8C A;  3J7Z C;  1SYE A;  3HOZ B;  4C2M B;  1UEB A;  4IOC A;  3X3M A;  1GVP A;  4CKB A;  4DV1 Q;  5AJ3 L;  2L0C A;  1ILQ A;  1E1O A;  1CZW A;  1I5F A;  2L1B A;  3OW2 A;  1FNV A;  2K5W A;  2F4V L;  1STE A;  2HQL A;  3T1Y L;  4UPA A;  1ONL A;  4QIW B;  3SK5 A;  3SDZ A;  5IP9 H;  5HGQ A;  4EGV A;  2ZJR A;  1BDO A;  1H9K A;  4NXN L;  2EYM A;  4JCV E;  1J9O A;  4RA8 A;  4X3U A;  1F9R A;  3I4M B;  4TRD A;  1RDP D;  1JC7 A;  2WIN B;  1ICW A;  2A74 C;  4ZRZ A;  3I8Z A;  4GN4 B;  4HSP A;  2TMP A;  3SXH A;  4DK6 C;  3TSS A;  4K0K Q;  1DOK A;  5ISR A;  3I7F A;  2G9H D;  1C7Y A;  4POF A;  2EYH A;  4DV0 Q;  1KLG D;  3NE5 B;  1S4Z A;  2B63 H;  2JP1 A;  1J8I A;  3TQY A;  3D3R A;  4G57 A;  5IY0 A;  3CCJ A;  2NVY H;  3WWV A;  3QOJ A;  2EY6 A;  3MZ5 A;  3VR5 A;  2ES2 A;  2PNH A;  1VQM A;  1IBK Q;  4ULL A;  2B2V A;  1W6J A;  2EJM A;  4IAL A;  3BJU A;  2EYP A;  4DXG A;  5FK9 C;  4WFN 3;  4RGT A;  3ITP A;  3TP8 A;  2C5C A;  3CCQ A;  4R8I A;  2PI2 E;  4JK1 C;  3S14 B;  1BBX C;  4E6I A;  5EJW A;  1A2U A;  2V4D A;  3QWN A;  2BE5 C;  1PH6 A;  1D8L A;  4LFA Q;  4A3M B;  4O0A A;  3PF5 A;  2NB0 A;  4CJ2 C;  3BZC A;  1BVS A;  1Z6H A;  1L1O B;  4MNO A;  2HHH Q;  4H44 C;  1JWS D;  1PH3 A;  1ET9 A;  1JE5 A;  2JA5 B;  4A3D H;  2Q2I A;  1BCP F;  2VQE Q;  1A2T A;  3I4O A;  2JYO A;  4MTK A;  3VDY A;  1EYG A;  2NVQ B;  4ZYS A;  2I0Q A;  2BDN A;  3J80 i;  4DGZ A;  1GHJ A;  2OT2 A;  2YTY A;  3S9W A;  2F03 A;  2BE5 D;  1HZ9 A;  5DM7 3;  2R61 A;  2BH2 A;  3GTL B;  1F2L A;  2I5L X;  3QB3 A;  4ILW A;  4JI6 L;  5COY A;  1DOM A;  4JG2 A;  4QY7 A;  4C3H G;  3WDN A;  1PA6 A;  4KHP Q;  1S5B D;  1L1O C;  3AFP A;  2E74 C;  1JJC B;  2F0H A;  4C3J B;  4R4I A;  3NTK A;  4Q5V A;  4BXX H;  3ICE A;  1KAW A;  2IW3 A;  1HUN A;  5D65 A;  5EAY A;  3HOW G;  1EY6 A;  1PFS A;  3PO3 G;  3GTK B;  3A8I E;  1CFM A;  2CHB D;  4FO2 A;  4J6H A;  4UAI A;  3LWU A;  1B53 A;  1IHZ A;  1EUJ A;  4HJA A;  4HIM A;  4KJO A;  4LF4 Q;  1HH2 P;  2EYO A;  5C3E G;  4K5X A;  3RNU A;  2K5V A;  4C3H H;  1L0W A;  4NXM Q;  4GLA C;  5IE8 A;  2E5L Q;  4R8N A;  1C4Q A;  3F2U A;  5IWA L;  4A3J B;  1N34 Q;  1TU2 B;  4LFB L;  1B44 D;  1SSO A;  3PCO B;  3HOW H;  1F9S A;  4PMC A;  3P1H A;  4KN4 C;  1NR4 A;  2LXK A;  1NY4 A;  2PMZ E;  2UUA Q;  4P71 A;  1YNN C;  5C3E H;  3LNN A;  4X62 L;  3JC6 6;  1I50 H;  2X6G A;  1IBL L;  5EPJ A;  2XNA C;  3BS1 A;  4JBM A;  2UU9 Q;  4GOP B;  4FXK C;  1O7Z A;  4IPG A;  4CDC C;  5M5W H;  3MXN B;  4ME3 A;  3Q22 A;  5G3L D;  4B3M L;  1I4Q A;  3J80 E;  4B3R L;  4I7A A;  2XGT A;  5AFW A;  4RHR A;  1Y69 U;  1EIG A;  1FNU A;  5TSS A;  3T56 B;  2NUC A;  3LWE A;  1YNN D;  3QJY A;  2CW0 D;  2SDF A;  5JPM C;  1QCB D;  4P2C B;  3OTO L;  3HKZ G;  2UUC Q;  4BBR H;  1P16 A;  4LF9 Q;  5KNB A;  5CBA E;  3OMC A;  4PNY A;  3NWS A;  4M1U B;  3VR2 A;  2R7Z G;  1I6H H;  1PHJ A;  5C0X J;  1XNR Q;  2N88 A;  4KD4 A;  3U50 C;  4AYB G;  3G71 A;  4ZUJ A;  5KND A;  4OHJ A;  1BQQ T;  1PFB A;  5IGG A;  1AP0 A;  4R4C A;  3TRZ A;  3RZO B;  1PTO H;  5LL6 X;  1T5E A;  2O2L D;  1TII D;  2KHI A;  1K0S A;  1BCP C;  3QIA A;  4RKL A;  3PO2 G;  1WYD A;  5D14 A;  4F87 A;  3EQL C;  1G6Z A;  1X6O A;  4A3I G;  1PH5 A;  1XYI A;  2OQ0 A;  3S17 H;  4DR5 Q;  4RH6 A;  2ICI A;  3LGJ A;  3S2H H;  1E2Z A;  2KCC A;  1ASZ A;  1KC8 C;  5I4D A;  4HCS A;  2DNC A;  1EWH A;  3KF6 B;  2VXW A;  3EBE A;  3A8K E;  3C1F A;  4IUQ A;  1QZH A;  2PQE A;  4UP8 A;  1Z9F A;  1QUQ A;  4GN3 B;  1KIX A;  2PQA B;  1BCP D;  3F2B A;  1H9M A;  1M1K C;  2F0E A;  2EJG C;  2D2C C;  3CAM A;  2ZM6 Q;  4OWT B;  3PO2 H;  1VQP A;  4DV3 Q;  1GD7 A;  4R4T A;  4DUY L;  5LMU Q;  4A3I H;  4PZ7 A;  1IKM A;  3GTM B;  1TWH H;  3AEV A;  5IGD A;  4BBS G;  2L9H A;  3G6E A;  3A56 A;  1ML0 D;  4DR4 Q;  3CQZ B;  3VA5 A;  3M3Y B;  2RSO A;  1KNA A;  3M4Q A;  2EXZ A;  1EU4 A;  1BO0 A;  5KRU A;  5J22 A;  3STB C;  1VQ7 A;  1STN A;  1I4X A;  1YBY A;  3KFU A;  1D6E C;  3M4O H;  2PZU A;  1TS3 A;  3OOC A;  1B9M A;  1EOT A;  1X56 A;  1PZJ D;  2Z4H A;  3S1M B;  4DV6 Q;  2UXC Q;  3HKS A;  4DK3 C;  1HA6 A;  1C9O A;  2F0K A;  5E1F A;  1NNX A;  4RGM A;  2MNA A;  1EOV A;  3JAM L;  4BBS H;  1MGS A;  2AUJ D;  4YCV A;  3V2T A;  3CCM A;  5I9O A;  2HCI A;  5ELC A;  2R93 B;  3TRE A;  3A74 A;  3STB D;  4HJ8 A;  3IFT A;  1LT6 D;  1N32 Q;  1SMX A;  1WOC A;  4RWS C;  5I2Y A;  4OX9 L;  3D0F A;  4X6A H;  3TP5 A;  3HS0 C;  2R6G A;  3S16 B;  1LV9 A;  3VA7 A;  4GS3 A;  1SN8 A;  4APV A;  1CQV A;  1VMP A;  4KKS A;  5FO8 B;  4XT1 B;  2ATW A;  3RLF A;  2J4X A;  1I3Q H;  1NMG A;  4G4K A;  4BY1 B;  3HOU G;  3CF5 A;  3HGB A;  4LMQ D;  1SYD A;  3V05 A;  4ALP A;  4X65 Q;  1QIL A;  3KJO A;  1CM9 A;  5C4J H;  3CCE A;  4N9P A;  1ILP A;  2ICE C;  3K7A H;  2H4O A;  3HOY G;  1Q1B A;  4JBW A;  4XTC S;  5FOB B;  1X65 A;  3DM3 A;  1HRJ A;  1Y8N B;  2AKW B;  3UI2 A;  2EY1 A;  5A2Q L;  1R4P B;  4DV4 Q;  3HOU H;  1TWG B;  4ZK9 B;  1SNO A;  1PYW D;  1EWC A;  2B2T C;  2JA6 G;  2QDB A;  4DA2 A;  1J6Q A;  1EQR A;  3PMF A;  4KY5 A;  1EEI D;  4DR6 Q;  3PV0 A;  4IPD A;  3C2P A;  3I90 A;  4C2M H;  4FYD A;  3X3N A;  3HOY H;  5I6Y A;  4DAY B;  1Q7Y C;  3PIO 3;  3PO3 B;  2CKZ B;  1S5D D;  4KHZ A;  3L9A X;  1J5E Q;  4HMI A;  1EEF D;  3J81 L;  1QJO A;  3E6Z X;  1KL9 A;  1KAB A;  4R4O A;  4IUV A;  5C3E B;  4NPS A;  2VW9 A;  1KRT A;  3CCR A;  1K3R A;  1BR9 A;  3MVV A;  2AMC B;  2HQE A;  2IT1 A;  3OIP A;  5HUR A;  1STH A;  2WFW A;  4LF6 L;  1S5C D;  1D7Q A;  2LXJ A;  5M5W B;  2B2U C;  4YWL A;  3I4M H;  1N36 Q;  3U9O A;  3K57 A;  4G7O C;  3I4N B;  2RDH A;  1PVO A;  1I94 Q;  4ZKB B;  1NSN S;  3K8A A;  2F1M A;  3G48 A;  1B3Q A;  1XXG A;  3Q23 A;  2F0N A;  4HMJ A;  1D5Z C;  2C35 B;  5FLX L;  2WB1 E;  4P75 A;  1DYQ A;  3K5O A;  1HNX Q;  1TS2 A;  4OXP A;  1YHB A;  1Q46 A;  1B8A A;  4MZ9 A;  4A3M G;  2IHE A;  3H91 A;  2KHS A;  4FDB A;  2Z1C A;  2RCF A;  1PTO B;  4LF5 L;  2EY2 A;  1GXD C;  1KHI A;  2JA5 G;  1EQQ A;  1OTC A;  3PF4 A;  1GO3 E;  1NMF A;  1OXT A;  3R8B A;  4FVM A;  2J7Z A;  4DKA C;  2E2I B;  3MC0 B;  2DY7 A;  1BOS A;  1AFP A;  2VB2 X;  3OHX C;  2R7Z B;  3S14 H;  3S2H B;  4C3I G;  1O80 A;  5KIX A;  1D5M C;  4KTA A;  4AYB B;  1STG A;  4JV5 Q;  1L1O A;  3NSW A;  4FXG C;  4A3M H;  1CT1 D;  2EZV A;  4A3G G;  2EYF A;  3E0E A;  3NEL A;  1JT8 A;  2K04 A;  4A3L G;  1CKM A;  3K0X A;  2L15 A;  4HN7 A;  3RMH A;  1XNQ L;  3GTQ B;  3CPF A;  2JA5 H;  3PO2 B;  4YY3 L;  4IPH A;  2HCC A;  3T53 B;  4X64 L;  2YV5 A;  2NVQ H;  2NTT A;  2PZW A;  1VMC A;  2GVB A;  1TWH B;  4BS9 A;  4KHV A;  5I6W A;  1VQ5 A;  4N8X 1;  3FDT A;  3B6Y A;  5C5M A;  3AFQ A;  1B3A A;  1SYC A;  2MJ8 A;  1UE5 A;  4IPC A;  2NZO A;  4ME5 A;  2QEX A;  4B3T L;  5JJL A;  2KCM A;  3CMA A;  3RZD B;  3GTL H;  5IGF A;  4AIM A;  3OW7 A;  2KED A;  2UXB L;  1LAB A;  1MJE A;  2BDO A;  4XYO A;  3OSO A;  1CHP D;  5FO9 B;  2ZXO A;  3CW2 C;  2RDG A;  3HG9 A;  1HZB A;  1GKH A;  1NTG A;  4JOI C;  1K3B C;  4JI8 Q;  4A3J G;  2RBM A;  5CV5 A;  1A3V A;  2Y0S G;  2DNE A;  1WFQ A;  1TS5 A;  1X3G A;  2ENB A;  1EWI A;  1QVC A;  3OIQ A;  4WOR A;  3CC2 A;  2C9O A;  4RCN A;  3EJI A;  2ZTC A;  5BN3 A;  1HFG A;  4OEL B;  2NVT B;  3T4A C;  5ELN A;  2K05 A;  1EY7 A;  3TBI B;  4CBV A;  4G7H C;  5KNC A;  5CBE E;  2CH4 A;  1G91 A;  2MO1 A;  4Y7N B;  4DU9 A;  3MFG A;  2B2W A;  1ESR A;  2VS1 A;  4A3J H;  1VQB A;  3D4D A;  3CU7 A;  4QMG A;  1UAP A;  1I3Q B;  1KDA A;  1RJT A;  4L5T A;  2F0O A;  1STY A;  4OWX B;  1S5F D;  1KNE A;  5K5P A;  1MD2 D;  3NEN A;  5M3M G;  1DJR D;  5C0X I;  3K5L A;  4BA1 I;  1CZG A;  1ROD A;  4DK0 A;  2YTV A;  1A0I A;  3U9S A;  1ZKO A;  3ERO A;  5C4J B;  2VQF L;  4OWW B;  1B4O A;  1SND A;  4GOP A;  2QCP X;  1WTQ A;  3U4V A;  4XT3 B;  1EL0 A;  4ZUI A;  3T1H Q;  2PNR C;  3NPP A;  2VB3 X;  4KY6 A;  5JOB A;  1E2V A;  3HOU B;  3C46 A;  5M3M H;  1FNW A;  2KHJ A;  5L37 A;  5C0X G;  5J39 A;  2VQE L;  4V19 0;  4U67 3;  3QG1 A;  3H0G G;  3SK4 A;  3NBH A;  2HT1 A;  4PZ8 A;  3HOY B;  3NEM A;  1XMO L;  2XWJ B;  1G8Z D;  4LUO A;  4YWM A;  4DR2 Q;  3BZD B;  1UE7 A;  3GTJ H;  3RZO H;  3KLR A;  5C0X H;  4KK7 A;  2MGS A;  4UY8 C;  2JA6 B;  2JQO A;  4LFC L;  3H0G H;  2MFI A;  2PCF B;  3M7N A;  1C48 A;  2L4N A;  1XTD A;  1PH4 A;  2NBF A;  4DV7 Q;  1SR3 A;  2K7V A;  3RR5 A;  3TP6 A;  2K52 A;  4YCW A;  3EN2 A;  2F0S A;  4KV6 A;  2OEO A;  5G3L F;  2PQA A;  1SE2 A;  3A8J E;  4A4I A;  3UDG A;  2A6E D;  4JI4 L;  1QZG A;  1EY0 A;  5DEH A;  2E5L L;  5CYU A;  2A19 A;  4JI5 Q;  4K8I A;  1AE3 A;  4MTN A;  2FHT A;  3ERQ A;  3AMU A;  4LF8 Q;  1YHQ A;  2EXD A;  3NTI A;  1R9T B;  3OMG A;  3CME A;  3D8G A;  3GTM H;  1KRS A;  3ND9 A;  1Q8I A;  3KLS X;  2VY3 A;  2WP8 J;  1LTI D;  2R93 G;  5BR8 L;  2B8G A;  3CQZ H;  3M3Y H;  2UUA L;  3S2D B;  4GN5 A;  4CJ0 B;  4CGY B;  4X3K A;  4CJ1 B;  2ZXP A;  4RAU C;  5KGU A;  2VNU D;  3GTO H;  1X3E A;  2YTX A;  3HZX A;  1SMY C;  4JBJ A;  4LK1 C;  1GUT A;  1CA6 A;  1F2Y A;  2OQK A;  1MJC A;  2PO4 A;  1RCV D;  1DOL A;  3H3V I;  3S1M H;  4FP5 D;  3KJP A;  4KLK A;  4NB3 A;  4TKO B;  4BY1 G;  4DFA A;  4K5V A;  4C56 C;  1B70 B;  1X9N A;  2R93 H;  1LT4 D;  4HJ7 A;  1FJG Q;  4GKJ L;  1SMY D;  4DXF A;  1N33 Q;  4IUP A;  2V1C C;  1V43 A;  3EIV A;  1JB7 A;  4DR1 L;  3VR6 A;  3ZJY C;  1QOH A;  1RIP A;  1YI2 A;  3MA2 B;  4UP9 A;  4JI7 Q;  4A3K B;  3S16 H;  2DY8 A;  4LUV A;  4MIU A;  4C3I B;  4QB4 A;  2FXQ A;  2ZJQ A;  3L2P A;  5LMN Q;  1Y8P B;  3DWA A;  1EQT A;  3BYY B;  3K7U C;  3SHL A;  1HZA A;  1YZ6 A;  2DJF C;  2GN5 A;  4BY1 H;  5FKA C;  4A3G B;  2N55 A;  3KBX A;  1WCM G;  1JMC A;  4A3F G;  5D3D A;  5LMN W;  3W1G A;  4IFD G;  2L11 A;  3ONA B;  4M8A A;  3DLL A;  1PV4 A;  2Q8T A;  4F88 A;  4OIK A;  1B1Z A;  2EVB A;  3D4W A;  2JXM B;  3PSI A;  1WJJ A;  1PH9 A;  4L5R C;  4DK1 A;  5AJ3 Q;  4YCU A;  3H3V H;  3PQI A;  4IUR A;  2I5M X;  3UDX A;  1AH9 A;  4LF7 Q;  1BUV T;  3GQB A;  4KY7 A;  5M5Y H;  1TVX A;  1A15 A;  4O42 A;  1E24 A;  1TWG H;  5IT9 L;  3T1Y Q;  1TWC B;  2HIX A;  1FD7 D;  1V1O A;  2IPK D;  3HKZ E;  4H0L C;  4FF4 A;  2JA7 G;  2R92 G;  2XRQ D;  1GUO A;  4C1N I;  2F0W A;  3KBG A;  4NXN Q;  4DAY A;  3NUC A;  2CQO A;  1Q12 A;  2Y0S B;  4WRD A;  1SRO A;  4DF7 A;  1YIJ A;  1SE4 A;  2Z4I A;  4IN3 A;  4WJW A;  5JVH 3;  4JI0 L;  3I4N G;  5M3F G;  5IYB G;  3O13 A;  2N3S A;  3PO3 H;  4ZKC B;  5EBC A;  1VQK A;  1DGS A;  1NJI C;  1PYB A;  2SNM A;  4N9T A;  1ENC A;  2K14 A;  3F1Z A;  4EX5 A;  1KDC A;  1EYA A;  1SE8 A;  2L55 A;  3WOF A;  2CW0 C;  3BVM A;  2JA7 H;  1A3U A;  2R92 H;  4DV6 L;  2UXC L;  1MKH A;  1XPO A;  4XQJ A;  2JEA I;  5EPK A;  1XPU A;  1UEA B;  5JAV A;  1WTR A;  3I4N H;  5M3F H;  5IYB H;  1IW7 C;  4NMZ A;  5IT9 E;  1N32 L;  2RDF A;  5M3M B;  3CCS A;  4AH6 A;  4DR3 L;  1BCP B;  5F2D A;  2AQ3 B;  2EIF A;  5C4Z A;  5IOC A;  1UWV A;  4GNX C;  4JYA L;  2KEN A;  3KYH C;  2B29 A;  3ULP A;  4XIG S;  2XVS A;  2JA8 G;  3M9B A;  1IW7 D;  3C3L A;  2LY7 A;  2K5N A;  1EY8 A;  4EVO A;  1Q81 C;  1EY5 A;  1PRT F;  3I70 A;  3BU2 A;  3GTJ B;  1PYS B;  3DHQ A;  1G2S A;  3KDF B;  3A5Z B;  3SR1 A;  2KQ3 A;  4DAM A;  1K9M C;  3DM1 A;  4QUC A;  4P73 A;  3H0G B;  1VQI A;  1OXU A;  4DV2 L;  1B2T A;  5EGT A;  2E2I H;  4DNI A;  2J0T D;  1KD1 C;  1L0X B;  1YNX A;  1K8O A;  2JA8 H;  2R7Z H;  2WAQ B;  4IUU A;  4MHE A;  1M90 C;  3S1Q H;  2Z0S A;  1ESF A;  1PLF A;  4A3E B;  5GAE C;  4A93 G;  1X55 A;  5IYC G;  5FJ8 G;  4JI6 Q;  3L7Z C;  2UXD L;  3R2I A;  3DUZ A;  3VYT A;  4DR6 L;  1ZEQ X;  4ZAI A;  1SFO B;  3GTQ H;  1SDF A;  3VYS A;  3JAM i;  3Q0A A;  1ENF A;  1HNW Q;  2ZTD A;  1IL2 A;  1HTL D;  4AQY L;  1CQF A;  4DN4 M;  1CUK A;  1VQ9 A;  4CDF C;  2KCN A;  4L6T B;  2KEC A;  2FFK B;  1OXV A;  1HTP A;  1IYJ B;  4DAV A;  2XTI A;  5ELB A;  3RZD H;  2N8N A;  4A93 H;  4YHH L;  5IYC H;  4QCL A;  2FMM A;  2R7D A;  3GTO B;  1UE6 A;  1KAA A;  1CA5 A;  3T16 A;  2F3V A;  3URY A;  2JA9 A;  2K33 A;  4OEM B;  1MHW C;  1WD0 A;  4QJF A;  3FMC A;  4LFB Q;  1V1Q A;  2F0L A;  3KF8 B;  3GP7 A;  5GAH C;  2O4X A;  1GUS A;  3CRL C;  4DR7 L;  1IBM L;  1NR2 A;  1M8A A;  1XMQ L;  4QIW E;  1EQV A;  2AQ1 B;  2NVT H;  2FIN B;  1BKB A;  5I9P A;  3W1B A;  1D5X C;  3I3C A;  4IQZ A;  3K6O A;  1IBL Q;  1YEZ A;  1WTX A;  1LT5 D;  4JI3 L;  2E75 C;  1WTH A;  4RGN A;  3SVM A;  4Y7N H;  2F0D A;  1JOO A;  1U0L A;  1VQ6 A;  1H95 A;  2IX0 A;  4R4Q A;  1QE6 A;  3TS2 A;  1SNQ A;  2LSS A;  4B3M Q;  1E0B A;  2AWN A;  3W5O A;  4RMF A;  2X69 A;  1EZ6 A;  2EJF C;  4JI2 L;  4LWC A;  1FVI A;  5HGT A;  2NZ1 D;  4FNF A;  5CV8 A;  4GKK Q;  3CHB D;  4O1N A;  3OTO Q;  5JVG 3;  1U4M A;  2B2V C;  2K5D A;  3K5N A;  2NVX H;  1AW7 A;  3J81 i;  5E3F A;  1RHP A;  1QWY A;  3G7L A;  1TT2 A;  3JAM E;  4IFD J;  3T51 B;  2QIL A;  3BVZ A;  3WOE A;  1PH2 A;  1DXM A;  2KEE A;  4B9X A;  5M5Y B;  4FF1 A;  1PRT C;  2K5H A;  1HR0 L;  2BOS A;  1I6V C;  1EFW A;  1WCM B;  3OYY A;  4A3F B;  1QVG A;  1HQR D;  5IYD G;  5EPL A;  1NUC A;  2XSC A;  1MSG A;  2K01 A;  4DV5 L;  2CQA A;  1VQN A;  4IOA A;  1LTR D;  1H9R A;  1PRT D;  1K8G A;  5COR A;  3DWQ A;  2VUM G;  2WII B;  3E3X A;  4A3B G;  3W3A A;  1B7Y B;  4QL5 A;  1PH1 A;  1SJH D;  1VF7 A;  2JA6 H;  2B2Y C;  2JA7 B;  5J3B A;  1CKN B;  2OCE A;  5M9O A;  2R92 B;  2VL6 A;  4PV1 C;  5IYD H;  1PZK D;  4DUZ Q;  5A35 A;  3GD7 A;  3PIO A;  5A2Q E;  1ENA A;  2IJ0 A;  4PMW A;  4ZQ3 A;  5M3F B;  5GAG C;  1HNZ L;  1S40 A;  2H1E A;  4DNR B;  5C6A A;  1CKO A;  2AUK A;  4P72 A;  3AB9 A;  1K83 B;  5DM6 3;  3PUZ A;  2KJX A;  3UDI A;  2QGQ A;  3H94 A;  4JW0 A;  2OTL A;  1Y14 B;  5IGB A;  1GUN A;  4IZ8 A;  2F0U A;  1SJE D;  3Q6S A;  1R9T H;  1VQH A;  2KA7 A;  1EYD A;  1C0A A;  1I4P A;  3J81 E;  1X3F A;  2IY5 B;  1RF2 D;  2KVM A;  1ICF B;  3S2D H;  2CWP A;  5DNF A;  5E7N A;  1U4L A;  3I4L A;  5EKK A;  4OX9 Q;  2KBN A;  4J15 A;  3NP8 A;  1HUM A;  3T1H L;  2L5T A;  1JE4 A;  5IGE A;  4OL7 A;  4X66 Q;  4A3K G;  2Y0S E;  2JA8 B;  5ELE A;  1JQY D;  5KEE A;  5CV6 A;  3S1Q B;  4JI1 Q;  2MHV A;  4PZ6 A;  1Q1E A;  2UUB L;  1QNU A;  4OO1 I;  1A63 A;  3L3O C;  3I72 A;  2NTS A;  3HRZ C;  1WD1 A;  1JJG A;  4QGU A;  4A76 A;  5FLX E;  2M2L A;  1TY2 A;  1BXT A;  4DV1 L;  3SGI A;  3PIP 3;  2A6H C;  1TR5 A;  1YVC A;  4A3K H;  3A7L A;  1AN8 A;  1NCV A;  2K32 A;  4C3I H;  2A8V A;  1Z47 A;  2K75 A;  4FXD A;  4A93 B;  1PH7 A;  4A3G H;  4OO1 G;  1W6K A;  4A3L H;  3TN2 A;  5FLM G;  1DD2 A;  1DZ1 A;  1JOR A;  4K14 A;  2E2D C;  3ER0 A;  3CP0 A;  4DV7 L;  2A6H D;  1UE1 A;  4HJ5 A;  3PIP A;  1WTP A;  1W3S A;  1SYB A;  3CCL A;  3IAY A;  2SEB D;  3BYT B;  2XWB B;  4K0K L;  4OON A;  4MN3 A;  1RTN A;  4KJN A;  4DV0 L;  1PDQ A;  4HJ9 A;  4OO1 H;  1TWC H;  1U4P A;  1V1P B;  4FF3 A;  3FVQ A;  5FLM H;  1NBW A;  4LF8 L;  2K6A A;  2AHO B;  4LF6 Q;  4Y52 H;  1KXL A;  2JEB I;  3D4R A;  2A73 B;  2ID0 A;  1IBK L;  2RF4 A;  3H6M A;  2E2J B;  1S72 A;  2CH4 W;  4B3S Q;  1TQO A;  2NN6 G;  2RQX A;  4EQP A;  2MO0 A;  3I55 A;  2NVX B;  1MI2 A;  3J81 j;  3MXN A;  4QF4 A;  3U58 A;  1WTO A;  2WKD A;  3E9I A;  4POG A;  1E1T A;  2JSO A;  4LFA L;  1DCZ A;  2YU9 B;  1TWA H;  1U4R A;  4P74 A;  3J80 c;  3OWE B;  1VQO A;  2HHH L;  1FR3 A;  2RSN A;  1V8Q A;  4LF5 Q;  1F9P A;  4EQN A;  3IFD A;  4Z9C B;  5DAU A;  1B50 A;  4J8Q A;  4XQN A;  4LAA A;  1H9S B;  1AZP A;  2LMC B;  3MFY A;  1LTL A;  1KQS A;  4JI7 L;  2O5J C;  1ET6 A;  4A75 A;  2QKI C;  3MWY W;  1E7Z A;  2QF7 A;  4CHT B;  4ZLT F;  1X32 A;  4TQU S;  4HTH A;  1LTG D;  2WAQ G;  3BG3 A;  1TXY A;  2M9V A;  1ZXT A;  4A3E G;  2EQS A;  4LJZ C;  2OWO A;  3KDF A;  4KHP L;  2BA1 A;  1XPR A;  2A6E C;  3ULL A;  1VQG A; 
#chains in the Genus database with same CATH homology
 4NXN Q;  3RN2 A;  4BBS H;  2BA0 A;  2Q2T A;  1XNQ Q;  4YCV A;  3KOJ A;  3CCM A;  3J7A 5;  2CQO A;  1Q12 A;  5K36 G;  1FL0 A;  4JI2 Q;  4YY3 Q;  1SRO A;  1N9W A;  4RG1 A;  1VQC A;  1YIJ A;  3TRE A;  1BBU A;  3A74 A;  3STB D;  1X54 A;  4HJ8 A;  1LUZ A;  3UE0 A;  3ULJ A;  4JI0 L;  5M3F G;  5IYB G;  1E3P A;  4X64 Q;  3I4N G;  2N3S A;  1P8L A;  1SMX A;  3A5U A;  3PO3 H;  1N32 Q;  1VQK A;  1WOC A;  3HOU G;  1DGS A;  1YJW A;  1NJI C;  1PYB A;  1E22 A;  5JEA G;  4OX9 L;  3D0F A;  3KF6 A;  4LF7 L;  4X6A H;  2K14 A;  2R6G A;  3F1Z A;  4EX5 A;  1SE8 A;  4A3E H;  3KLW A;  4B3T Q;  4LF4 L;  1OXS C;  1VQ4 A;  4GS3 A;  1SN8 A;  4APV A;  2B63 G;  2JA7 H;  4NXM L;  2R92 H;  2UXB Q;  4DR2 L;  4DV6 L;  1K8A C;  2ATW A;  2K4K A;  2UXC L;  3RLF A;  1I3Q H;  1NMG A;  3S24 A;  1HR0 Q;  4UP7 A;  2BH8 A;  1SFO H;  4L5S A;  1RL2 A;  1Q86 C;  1QUQ B;  1VS0 A;  1MKH A;  3CF5 A;  1XPO A;  3I56 A;  2JEA I;  1N34 L;  3PGZ A;  2Q2H A;  1XPU A;  1IXR A;  4X65 Q;  1VQE A;  4ALP A;  3I4N H;  2WB1 G;  5IYB H;  5H1S E;  5M3F H;  3KJO A;  1HR0 W;  1YJN A;  1N32 L;  5JJK A;  5C4J H;  4AH6 A;  3CCE A;  3CCS A;  4DR3 L;  3PUX A;  4DV5 Q;  1VQL A;  2EIF A;  5M5X H;  3K7A H;  1VCI A;  1Q1B A;  1UWV A;  4JBW A;  4XTC S;  4GNX C;  3HOY G;  1X65 A;  5JJI A;  3DM3 A;  4JYA L;  2KEN A;  1Y1W G;  3TEH B;  2A1A A;  2AKW B;  3KYH C;  2B29 A;  2HIV A;  5GQO A;  3E9H A;  4XIG S;  3ULP A;  4LNQ A;  2JA8 G;  2JK8 A;  2NN6 I;  2UU9 L;  4DV4 Q;  4JC0 A;  3HOU H;  4JI5 L;  1YJ9 A;  3M9B A;  2ZJP A;  1N8R C;  4C3J H;  2JA6 G;  2K5N A;  1Q81 C;  1J6Q A;  1EQR A;  3M85 A;  3I2Z A;  3BU2 A;  2CCZ A;  1PYS B;  4DR6 Q;  3PV0 A;  4IPD A;  3KDF B;  3A5Z B;  2ASB A;  4C2M H;  1V9P A;  2WAQ E;  3FKI G;  4DAM A;  1Y1V G;  1K9M C;  3GTK H;  4IFD I;  4P73 A;  1VQI A;  3HOY H;  1OXU A;  4A3D G;  4DAY B;  4DV2 L;  1HNZ Q;  1Q7Y C;  2UUC L;  1Y1W H;  4GNX A;  2VQF Q;  3F2D A;  2E2I H;  4DNI A;  2CKZ B;  3U4Z A;  1PH8 A;  4KHZ A;  1KD1 C;  1J5E Q;  4LF9 L;  3UE1 A;  4WJ4 A;  1YNX A;  2JA8 H;  4IJH A;  2E2H H;  2R7Z H;  1CSP A;  1M90 C;  1KL9 A;  3S1Q H;  4R4O A;  2Z0S A;  1XNR L;  3BZK A;  4NPS A;  3FP9 A;  2VW9 A;  1KRT A;  1LM0 A;  3GO5 A;  5GAE C;  3CCR A;  1K3R A;  2N49 A;  4A93 G;  1X55 A;  5IYC G;  1ASY A;  2AMC B;  1W2B A;  5FJ8 G;  4JI6 Q;  3L7Z C;  2IT1 A;  3GTG H;  2UXD L;  1K0R A;  4LF6 L;  2WFW A;  4DR6 L;  1D7Q A;  2LXJ A;  1K73 C;  3GTQ H;  3FKI H;  1Y1V H;  4YWL A;  4H02 A;  3I4M H;  1N36 Q;  3JAM i;  4BY7 G;  1MIU A;  2MQH A;  2F3I A;  1HNW Q;  1FJG L;  2ZTD A;  1IL2 A;  4BXX G;  4AQY L;  1N33 L;  5IT9 c;  1CUK A;  1PVO A;  1I94 Q;  1VQ9 A;  1YIT A;  5GAD C;  4DR5 L;  2Z6K A;  3K8A A;  1OXV A;  1XMO Q;  3G48 A;  1IYJ B;  2I5H A;  3G4S A;  4IO9 A;  4GLV B;  2XTI A;  3RZD H;  2N8N A;  3ERS X;  1IZ6 A;  2C35 B;  3JAM c;  5IYC H;  4YHH L;  4A93 H;  2WB1 E;  2R7D A;  1XJV A;  1UE6 A;  5LMN L;  3AQQ A;  4O2D A;  4P75 A;  1JJ2 A;  1QVF A;  2F4V Q;  2JA9 A;  1VQ8 A;  1HNX Q;  1WCM H;  2UUB Q;  4OXP A;  4A3F H;  1EIF A;  1YHB A;  3MEF A;  2ZM6 L;  1Q46 A;  2AWO A;  1B8A A;  4QJF A;  4MZ9 A;  4DV3 L;  4A3M G;  1VQF A;  2IHE A;  4BY7 H;  4LFB Q;  2N78 A;  5LMU L;  1HNW L;  4LFC Q;  2ALY B;  5IP9 G;  1V1Q A;  3PUV A;  4FDB A;  3KF8 B;  4LW1 A;  2D62 A;  4LF5 L;  3J7Z C;  5GAH C;  3K80 C;  1KHI A;  4DR7 L;  1IBM L;  1UEB A;  3S15 H;  4IOC A;  2JA5 G;  1EQQ A;  1Q82 C;  1OTC A;  3PF4 A;  1GO3 E;  3UDF A;  1NMF A;  4DR4 L;  1XMQ L;  1EIY B;  1OXT A;  4AYB E;  1GVP A;  4DV1 Q;  5AJ3 L;  4QIW E;  4DKA C;  1E1O A;  1I5F A;  2NVT H;  1BKB A;  3W1B A;  4JI4 Q;  1IBL Q;  3F8T A;  4GNX B;  3OW2 A;  1HZC A;  1YEZ A;  3S14 H;  3FHW A;  1CKN A;  4JI3 L;  2F4V L;  2HQL A;  3T1Y L;  2PI2 A;  4UPA A;  2JJQ A;  4Y7N H;  4JV5 Q;  1H95 A;  1L1O A;  1U0L A;  3RLN A;  1VQ6 A;  2IX0 A;  4R4Q A;  4A3M H;  4A3G G;  3NEL A;  3E0E A;  3PUW A;  3TS2 A;  1JT8 A;  2LSS A;  5IP9 H;  4B3M Q;  5HGQ A;  2R7F A;  4A3L G;  1CKM A;  2ZJR A;  3K0X A;  4NXN L;  2AWN A;  2L15 A;  4JCV E;  3W5O A;  1XNQ L;  4RMF A;  3CPF A;  2JA5 H;  4JI2 L;  4YY3 L;  4LWC A;  1FVI A;  4IPH A;  4GKK Q;  4GN4 B;  3S1N H;  4X64 L;  2YV5 A;  2NVQ H;  3OTO Q;  5BR8 Q;  4QQB X;  4DK6 C;  2RHS B;  2GVB A;  1VQ5 A;  2NVX H;  3B6Y A;  4K0K Q;  3AFQ A;  4BBR G;  1L2F A;  3I7F A;  4IPC A;  1UE5 A;  1C7Y A;  1K83 H;  1TWF H;  2NZO A;  4POF A;  3J81 i;  2QEX A;  3CCU A;  4B3T L;  4DV0 Q;  5JJL A;  2KCM A;  3CMA A;  2B63 H;  1AE2 A;  3GTL H;  4IFD J;  2D0P A;  2NZH A;  3TQY A;  4AIM A;  1PH2 A;  2ZJQ A;  2UXB L;  5IY0 A;  1MJE A;  3CCJ A;  1BBW A;  2K5H A;  2NVY H;  5C44 G;  1HR0 L;  3CW2 C;  1EFW A;  3WWV A;  3OYY A;  3PUY A;  1HZB A;  1GKH A;  1NTG A;  1QVG A;  4JOI C;  4X65 L;  4JI8 Q;  3J81 c;  4A3J G;  2Y0S G;  5IYD G;  4GKK L;  1WFQ A;  2ES2 A;  1X3G A;  2PNH A;  1EWI A;  1QVC A;  1VQM A;  1IBK Q;  4GKJ Q;  3CD6 A;  1HJP A;  4DV5 L;  3CC2 A;  3BJU A;  1A62 A;  1VQN A;  2ZTC A;  4DR1 Q;  4IOA A;  3CCV A;  3NBH B;  1K8G A;  3CCQ A;  4GOP C;  2Z6K C;  5ELN A;  2B3G A;  2PI2 E;  2VUM G;  1VQJ A;  2E8G A;  5C44 H;  4DV4 L;  4A3B G;  1B7Y B;  2MO1 A;  4QL5 A;  1PH6 A;  1PH1 A;  1D8L A;  4LFA Q;  2JA6 H;  1G6P A;  5J3B A;  1CKN B;  2OCE A;  2VS1 A;  4O0A A;  4YWK A;  3CPW A;  4JOI A;  2VL6 A;  4A3J H;  1VQB A;  5IYD H;  3BZC A;  1BVS A;  4L5T A;  1L1O B;  4MNO A;  2HHH Q;  4DUZ Q;  5JEA J;  1PH3 A;  4OWX B;  3GD7 A;  4IJL A;  1JE5 A;  3NEN A;  5M3M G;  5FLX c;  5C0X I;  3PIO A;  2K50 A;  4BA1 I;  4A3D H;  2Q2I A;  4PMW A;  2VQE Q;  2YTV A;  1A0I A;  5GAG C;  1HNZ L;  3I4O A;  1EYG A;  3VDY A;  2VQF L;  1S40 A;  2I0Q A;  4OWW B;  1S3O A;  3J80 i;  1J5E L;  4GOP A;  2YTY A;  3IRB A;  1CKO A;  1HZ9 A;  1A8V A;  3U4V A;  4P72 A;  3CC4 A;  3PUZ A;  3T1H Q;  2BH2 A;  3UDI A;  2QGQ A;  5FJ8 H;  2OTL A;  2I5L X;  3M4P A;  1OXX K;  1Y14 B;  4JI6 L;  1LYL A;  2F52 A;  4JG2 A;  4QY7 A;  1PA6 A;  4KHP Q;  4R1J A;  4DUZ L;  1R9T H;  1VQH A;  1G29 1;  1L1O C;  3AFP A;  5M3M H;  1T9H A;  1JJC B;  2KHJ A;  1C0A A;  3L0O A;  5C0X G;  1N36 L;  4A3C G;  4R4I A;  5IWA Q;  5ELO A;  4BXX H;  1X3F A;  2VQE L;  2VZA A;  3ICE A;  2IY5 B;  2H5X A;  1KAW A;  3H0G G;  5C4X G;  3S2D H;  1I94 L;  5EAY A;  4JI0 Q;  1Q8K A;  3HOW G;  2CWP A;  1PFS A;  5E7N A;  3PO3 G;  4WJ3 M;  2HT1 A;  4PZ8 A;  4OX9 Q;  2KBN A;  3NEM A;  1XMO L;  4JBK A;  4J15 A;  3F2C A;  5DLQ E;  2CFM A;  2ZTE A;  3T1H L;  5HY6 A;  1EUJ A;  4HJA A;  4HIM A;  4X62 Q;  4HIO A;  4X66 Q;  4LF4 Q;  1HH2 P;  5C3E G;  2Y0S E;  4LUO A;  4A3K G;  3RNU A;  2K5V A;  4YWM A;  4C3H H;  3HOV G;  1L0W A;  4BA2 I;  4NXM Q;  4GLA C;  1WI5 A;  4DR2 Q;  5IE8 A;  3CXC A;  2E5L Q;  4JI1 Q;  2GVA A;  2OTJ A;  1UE7 A;  4PZ6 A;  3GTJ H;  1HNX L;  3RZO H;  1Q1E A;  4DPG A;  5IP7 G;  2UUB L;  4A3C H;  4UY8 C;  1SLJ A;  4OO1 I;  1A63 A;  5IWA L;  1N34 Q;  2JQO A;  4LFB L;  3S1R H;  4B3R Q;  4LFC L;  3H0G H;  2MFI A;  5C4X H;  3RN5 A;  3PCO B;  3HOW H;  3M7N A;  3GTP H;  1JJG A;  4GLX A;  4QGU A;  4A76 A;  4L5Q A;  1PH4 A;  1XTD A;  2E2J H;  3AYH B;  4DV7 Q;  1SR3 A;  4DR3 Q;  2LXK A;  3RR5 A;  1NY4 A;  2K52 A;  4YCW A;  2D0O A;  1O7I A;  3EN2 A;  4DV1 L;  2PMZ E;  3SGI A;  2UUA Q;  4P71 A;  2PQA A;  1YVC A;  4A4I A;  5C3E H;  4X62 L;  4A3K H;  4X66 L;  4JYA Q;  3UDG A;  3JC6 6;  1I50 H;  4JI4 L;  1IBL L;  3HOV H;  4C3I H;  2A8V A;  1QZG A;  1Z47 A;  2K75 A;  4JBM A;  3A0J A;  2E5L L;  3HOX G;  4JI1 L;  4GOP B;  2UU9 Q;  5IP7 H;  4JV5 L;  2A19 A;  4JI5 Q;  1PH7 A;  4A3G H;  4IPG A;  5M5W H;  4OO1 G;  1AE3 A;  4MTN A;  3MXN B;  2YU9 H;  2JE6 I;  4ME3 A;  4A3L H;  4B3M L;  5FLM G;  4LF8 Q;  1YHQ A;  4B3R L;  2EXD A;  2QA4 A;  2XGT A;  3K81 C;  3ER0 A;  3CME A;  3CP0 A;  4DV7 L;  3GTM H;  1VQA A;  3H15 A;  1UE1 A;  4HJ5 A;  3PIP A;  1KRS A;  1W3S A;  3HOZ G;  2VY3 A;  2WP8 J;  4EQ5 A;  2R93 G;  2DUD A;  4TVA B;  1YHA A;  3CCL A;  3OTO L;  5BR8 L;  3CQZ H;  3HKZ G;  4DV2 Q;  2UUA L;  4GN5 A;  3M3Y H;  2UUC Q;  4BBR H;  1P16 A;  4K0K L;  4LF9 Q;  4OON A;  2VNU D;  3GTO H;  3HOX H;  1X3E A;  2YTX A;  4JBJ A;  2R7Z G;  1I6H H;  4DV0 L;  3PF5 A;  4HJ9 A;  1PHJ A;  5C0X J;  2RHQ B;  2OQK A;  1MJC A;  1XNR Q;  1TWC H;  3U50 C;  4AYB G;  3G71 A;  5FLM H;  3H3V I;  1NBW A;  3S1M H;  4LF8 L;  1U5K A;  3KJP A;  4KLK A;  2UXD Q;  2AHO B;  4R4C A;  2YYZ A;  3TRZ A;  4NB3 A;  1GM5 A;  4LF6 Q;  4Y52 H;  4BY1 G;  1KXL A;  2JEB I;  3HOZ H;  1B70 B;  4JI8 L;  1X9N A;  2R93 H;  1FGU A;  2KHI A;  3I4M G;  4DUY Q;  1WYD A;  3PO2 G;  4HJ7 A;  2ID0 A;  1IBK L;  1FJG Q;  2RF4 A;  2DGY A;  1NE3 A;  4AQY Q;  4GKJ L;  1X6O A;  1N33 Q;  4A3I G;  2V1C C;  1V43 A;  2KCT A;  4PG3 A;  1PH5 A;  2OQ0 A;  1S72 A;  2IX1 A;  3EIV A;  4DR5 Q;  3TS0 A;  1JB7 A;  3S17 H;  4DR1 L;  3CC7 A;  3ZJY C;  4B3S Q;  3LGJ A;  1RIP A;  1YI2 A;  2NN6 G;  3S2H H;  1ASZ A;  1KC8 C;  4UP9 A;  4JI7 Q;  3S16 H;  2MO0 A;  3KF6 B;  3I55 A;  3EBE A;  2VUM H;  1QZH A;  4LUV A;  4YHH Q;  1VQD A;  4A3B H;  2FXQ A;  3J81 j;  4UP8 A;  1Z9F A;  1QUQ A;  2RCN A;  4GN3 B;  3L2P A;  2PQA B;  5LMN Q;  1KIX A;  3K7U C;  3U58 A;  3E9I A;  4POG A;  1HZA A;  1YZ6 A;  2GN5 A;  4BY1 H;  1E1T A;  3F2B A;  1M1K C;  4LFA L;  3CAM A;  1WCM G;  2ZM6 Q;  1JMC A;  4A3F G;  3Q8D A;  1TWA H;  4OWT B;  5LMN W;  3W1G A;  1VQP A;  4P74 A;  4DV3 Q;  3PO2 H;  4IFD G;  1GD7 A;  4R4T A;  3J80 c;  3DLL A;  4DUY L;  5LMU Q;  1VQO A;  2HHH L;  1PV4 A;  4A3I H;  4LF5 Q;  4PZ7 A;  3D31 A;  1TWH H;  3AEV A;  3GDE A;  2Q2U A;  4LUZ A;  1IBM Q;  3G6E A;  4BBS G;  4DR7 Q;  3PSI A;  4DR4 Q;  1WJJ A;  4B3S L;  5GRO A;  1PH9 A;  4L5R C;  3RLO A;  1XMQ Q;  1LTL A;  2CWA A;  3HFZ B;  3M4Q A;  5AJ3 Q;  1KQS A;  1G51 A;  4JI7 L;  4HIK A;  4YCU A;  3H3V H;  4A75 A;  1E7Z A;  2I5M X;  1CSQ A;  3UDX A;  3STB C;  1VQ7 A;  4LF7 Q;  1AH9 A;  4TQU S;  1YBY A;  3KFU A;  5M5Y H;  2WAQ G;  4JI3 Q;  1E24 A;  1TWG H;  1TXY A;  3M4O H;  3T1Y Q;  4A3E G;  2HIX A;  2EQS A;  1X56 A;  4KI0 A;  1SRU A;  2OWO A;  3KDF A;  3HKZ E;  2JA7 G;  4KHP L;  2BA1 A;  4DV6 Q;  2R92 G;  2UXC Q;  3HKS A;  4DK3 C;  1C9O A;  1XPR A;  3ULL A;  2IHF A;  1VQG A;  4HID A;  2MNA A;  1EOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...