2MQHA

Solution structure of the chlamydomonas reinhardtii nab1 cold shock domain, csd1
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
72
structure length
72
Chain Sequence
GSGEQLRQQGTVKWFNATKGFGFITPGGGGEDLFVHQTNINSEGFRSLREGEVVEFEVEAGPDGRSKAVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA-binding cold-shock domain of the Chlamydomonas reinhardtii NAB1 protein and insights into RNA recognition.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Dna binding protein
molecule keywords Nucleic acid binding protein
total genus 1
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2mqhA00
4IOCA 3PIOA 1PH6A 1Z47A 2A19A 3I7FA 4IJHA 4HJ7A 5JEAJ 1NTGA 3U58A 4AQYL 1M1KC 3UDGA 1ASYA 4JI4L 1IL2A 4BBSH 1S40A 2YYZA 1KRSA 2BH2A 1GVPA 3RN2A 4DV0Q 4JBJA 2WP8J 4K0KL 3KJPA 3KYHC 4MNOA 1HZBA 5JJKA 4R4IA 2YTXA 2MFIA 3STBC 4C3IH 1PH4A 3ZJYC 4XTCS 1VQKA 3G4SA 3J7ZC 3GTKH 1ASZA 3F2CA 2E8GA 1V1QA 2AWOA 4DR3Q 3CXCA 2NVYH 1IYJB 4DV3Q 1IBLL 1QUQB 2R7ZH 1K3RA 1IBKL 3M4OH 2UXCL 4A3IG 3I4NG 2R93G 1IZ6A 1QVFA 1XNRL 2VUMH 5IP7H 1X3GA 3T1HL 1KL9A 1W2BA 1N32Q 2RHQB 4LF6L 1HZAA 1VQBA 1YZ6A 3L2PA 4P74A 1FJGQ 3HOVH 3JAMc 2IY5B 4PG3A 4KHPQ 3BZKA 1WJJA 2XGTA 5LMUQ 1L1OB 4HIOA 4LFAQ 2E2HH 3ULJA 3AQQA 4JI2Q 2YTYA 3SGIA 4OO1I 1NJIC 3UE0A 5DLQE 4RG1A 1P8LA 4ME3A 5FJ8G 2JA7G 4BY7H 3CCEA 1HNZL 4BXXH 1JJ2A 3TS0A 1XNQL 1J6QA 1NY4A 2CFMA 4X64Q 1EFWA 3FP9A 1CKOA 3CP0A 4DR1Q 4ALPA 3PIPA 2R7FA 3KDFB 3PGZA 4IOAA 2Z6KA 4OWTB 2JEAI 1Y1WH 1KXLA 1MJEA 3H3VI 4JI7L 3F8TA 4A75A 4DV6Q 4B3RL 2B3GA 3EIVA 3GTGH 4K0KQ 1NMGA 1JE5A 1NE3A 1IXRA 4AYBG 2ZTDA 3GTQH 4JYAQ 1FVIA 3S15H 1AE3A 2AWNA 3E9IA 3CCQA 4C3JH 3S14H 1H95A 3M7NA 3F2DA 4LF9Q 4DR3L 2R6GA 2CWAA 4O2DA 1IBLQ 3J81i 4LF5L 1S3OA 1YI2A 1L1OC 4A3MH 1Q86C 2WB1G 1X65A 4JV5L 3GO5A 2N78A 1UE7A 4UP7A 3HOZH 2NZOA 4LF7L 4PZ6A 5IP9G 5IWAQ 2VZAA 4QIWE 5M3MG 1Q7YC 2NVTH 5GAGC 1Q12A 4DUYQ 2VY3A 1I94Q 1JT8A 3GDEA 3BZCA 1EQQA 4JI2L 2HT1A 4WJ3M 2A1AA 2R92H 2PQAA 1YEZA 1OXXK 2I0QA 2D62A 3H3VH 1MIUA 4NXML 1TWGH 3RNUA 1UEBA 2N3SA 3HOUG 2E2JH 1XNQQ 3A5UA 4LF8Q 1TWAH 2JA7H 3I4OA 4BXXG 3W1GA 1J5EQ 3CW2C 4LFBQ 4GN3B 2ATWA 2K14A 3HFZB 2KHJA 1W3SA 3BJUA 5ELNA 2AHOB 5E7NA 2I5MX 1L0WA 1CKMA 3RLNA 3U4VA 1OXUA 4P75A 3RR5A 1XMQQ 4JI8Q 4HJ5A 2QEXA 1UWVA 1K83H 3HOXG 4IPGA 2BA0A 5C44G 1K8GA 4B3TQ 2JA8H 1VQAA 4DPGA 2F4VQ 1VQJA 2VQFL 2HHHQ 2I5HA 2MNAA 2PMZE 5ELOA 3CD6A 4GN4B 1XPRA 5C3EG 2K4KA 2ASBA 1I3QH 5C4XH 1CSQA 1SFOH 1RIPA 2B29A 1CKNA 2Q2IA 3CMAA 4FDBA 1CUKA 4KLKA 3B6YA 1WFQA 4YHHQ 1WCMG 3UE1A 5GAEC 5IP9H 5LMNL 4DUYL 1I94L 2UU9L 4R4TA 4YCVA 2RHSB 4DV7L 3S1QH 1PV4A 4DK3C 4A3EG 1KQSA 2IX1A 1V43A 4C2MH 2ZTEA 2D0PA 3K7UC 3NENA 1DGSA 4MTNA 2N49A 1UE5A 4DKAC 3JAMi 1PVOA 5IYDH 4DV5L 1PH5A 4C3HH 1AH9A 4JI4Q 1WI5A 3PUZA 4LFCL 1WYDA 4DR6Q 1EWIA 4OONA 4LF4L 1PH8A 1VQ5A 4JI3L 1OXTA 4PZ8A 5M5WH 3OTOL 4DR7L 3UDXA 3FKIG 4DV4Q 1A62A 3K7AH 1B70B 2OCEA 5M5XH 3KF6B 4LUOA 2C35B 1EOVA 2CWPA 1Z9FA 2MO0A 4B3SQ 1C0AA 2VQFQ 2LSSA 3TRZA 2UXCQ 4XIGS 2JA9A 4AH6A 5IT9c 1T9HA 1GKHA 2K5HA 1SROA 2MQHA 3J81c 3S17H 3D31A 4A3LH 1N32L 4YY3L 4LF6Q 5JEAG 2HQLA 2JA5G 1EIYB 4YWLA 3K81C 1VS0A 3L7ZC 5M3FG 1R9TH 1XMOQ 1D7QA 3S1MH 4A3DG 1HR0Q 4GS3A 1Y1VG 1LYLA 4DR4Q 4X62Q 4IPCA 2ZM6L 3NBHB 1QZGA 1A63A 2UUBQ 1A8VA 4DR1L 4A3EH 3H0GH 2OWOA 2R7ZG 4GKKQ 3J81j 4BA2I 4GKJL 1A0IA 1FJGL 4B3MQ 5K36G 3HOUH 5JJIA 4DR2Q 2Q2UA 1G51A 1TXYA 2VW9A 3BU2A 4QL5A 3KOJA 4BY1H 2PI2E 1OTCA 1Q1BA 3PV0A 5GADC 4P71A 4GOPC 4DV4L 1IBMQ 3M4QA 3GTOH 3T1YL 3UDFA 1VQ9A 2ES2A 1BBUA 4TVAB 3FKIH 2WB1E 1X6OA 4LF5Q 1MKHA 5EAYA 1PH9A 4J15A 1PHJA 3A5ZB 1KIXA 1KC8C 3RZOH 4R4CA 4OWWB 4JI7Q 3GD7A 4L5QA 1K73C 3EN2A 1HJPA 4LUVA 5C3EH 3S2DH 4JOIA 2JA6H 4OO1G 5IY0A 2NZHA 2VQEL 4JYAL 2RF4A 3HOVG 5BR8Q 1U5KA 2CQOA 1JB7A 1B8AA 2B63H 1VQ7A 2ALYB 2UUCQ 4DR5L 1Y14B 5GROA 3CPWA 1JJGA 1VQNA 1VQ8A 1VQFA 1PYBA 4GNXA 1HR0L 3DM3A 4R1JA 5M3FH 4UPAA 3KFUA 4A93G 4JOIC 3CCVA 4EX5A 4DV1L 2VS1A 2EXDA 4NB3A 4DR4L 1Q46A 5C4JH 2GVAA 1VQEA 4POFA 3ULPA 2UXBQ 1KRTA 2YU9H 1LTLA 2IHFA 4X65Q 1YJ9A 3GTLH 1VQGA 3HKSA 1N33Q 1I50H 3S1NH 1I6HH 1TWHH 4DV2L 4DR2L 1N34Q 3RLFA 5C0XG 1U0LA 4NXNL 3J80c 3A74A 4A4IA 1YIJA 3CC2A 2JJQA 2OTJA 4HJ8A 3AFPA 3PUVA 3M85A 3CCRA 2IHEA 2PNHA 2UXDQ 4UY8C 4KI0A 4LWCA 3I55A 5LMNW 1E1OA 4X66L 2BH8A 5C44H 1G6PA 1E22A 1NMFA 2RCNA 4AQYQ 3FHWA 1EUJA 2JQOA 3STBD 4JG2A 3OW2A 1PA6A 1XPUA 1HR0W 1PYSB 2K5NA 4OX9L 3S24A 2F52A 2LXJA 3T1HQ 1UE1A 3ICEA 2YTVA 4JI8L 4DUZQ 4LUZA 2WFWA 3ERSX 3M3YH 3KLWA 1YJNA 2VQEQ 2Z0SA 1I5FA 4R4QA 2F4VL 3S16H 4UP9A 5LMUL 3E9HA 2IX0A 4JI0Q 1WCMH 3CCLA 2OQ0A 1Q1EA 4PZ7A 4AYBE 5C0XI 3GTMH 4A3GH 1UE6A 2PQAB 5IYBG 2R92G 1VQMA 4HJAA 2UUAL 1C9OA 2YV5A 3RZDH 5FLXc 3RLOA 1N33L 3PF4A 4YHHL 4HJ9A 5LMNQ 4HIMA 3K8AA 2HIXA 1E1TA 1MJCA 3RN5A 4Y52H 1HNWQ 5IYCH 1HNXQ 1VCIA 2CCZA 2JA8G 4A3CH 3CPFA 1X54A 1K0RA 1Q82C 3CCSA 4A3BG 2BA1A 4BBRG 4L5TA 1Q81C 1OXVA 1L1OA 1Q8KA 5FLMG 1X56A 1O7IA 1TWFH 3UDIA 3IRBA 4NPSA 3HOYH 4QGUA 1FL0A 1PH2A 4JV5Q 1GD7A 4A3KH 1LM0A 2CKZB 4YWMA 1V9PA 3TREA 3JC66 3PSIA 3CC7A 5GAHC 1M90C 4A3LG 1X9NA 1CSPA 3G48A 3G71A 1QUQA 4B3SL 2ZJPA 1K9MC 1L2FA 1PH3A 3I4MH 1SR3A 2B63G 4JCVE 4X6AH 3W1BA 1CKNB 1LUZA 2L15A 3M9BA 1KD1C 1YBYA 5IWAL 4A93H 1QVGA 1SRUA 1X3FA 3PCOB 3E0EA 4DAMA 3I2ZA 4GNXC 4BA1I 3PO3G 1K8AC 2Y0SE 3WWVA 2H5XA 4LFBL 1XPOA 2NVXH 3J7A5 1HZCA 4GNXB 1N36Q 2WAQG 1BBWA 4GLVB 1N8RC 2Z6KC 4LW1A 3H15A 4GOPA 4NXMQ 3CCUA 4IFDG 2K50A 4X62L 2Q2HA 4GLAC 4BY1G 2ZM6Q 3T1YQ 1HNXL 4JC0A 4P73A 3CQZH 4B3TL 1SE8A 3CCMA 2I5LX 3TQYA 4DV3L 1VQCA 1Y1WG 4B3ML 4UP8A 4QQBX 4HIKA 4Y7NH 3OYYA 1G291 2Y0SG 3U4ZA 2GVBA 5FLMH 4YCWA 1VQPA 4AIMA 2ZJRA 4JI6L 4LF8L 1GM5A 3HOYG 3KDFA 3AEVA 3A0JA 4A3KG 1AE2A 2UUCL 4DR5Q 2JK8A 1KAWA 2JA5H 4A3IH 3I4NH 5GQOA 2R93H 4WJ4A 1E7ZA 4DAYB 3CCJA 4A3MG 3MEFA 1YHQA 1B7YB 4DV7Q 2ID0A 2WAQE 1Y1VH 3PF5A 1TWCH 1VQHA 2AKWB 3PUYA 1PH1A 1BKBA 2QA4A 3K0XA 4X64L 3I4MG 1S72A 1HZ9A 1YHBA 1P16A 1VQDA 2K75A 2PI2A 5IYBH 4A3JG 3HOWG 3PO2H 2KCMA 3F2BA 5BR8L 1PFSA 4OWXB 2F3IA 2NVQH 4P72A 4QY7A 4DV6L 1N36L 4MZ9A 2UXDL 1D8LA 2JE6I 2MO1A 1PH7A 4DV1Q 3LGJA 1EIFA 1EQRA 1HNZQ 1VQLA 4LNQA 3PUXA 1YNXA 5IE8A 4DV5Q 4QJFA 1VQ4A 4TQUS 4LF9L 2LXKA 3U50C 2E5LL 1XJVA 4LFCQ 1X55A 4X65L 2IT1A 2N8NA 4IPHA 3CAMA 4DR6L 5AJ3L 4A3BH 4JBWA 5HY6A 2VL6A 1JMCA 4LF4Q 4A3FG 3W5OA 1X3EA 2D0OA 4JI1L 5M5YH 4JI3Q 4DR7Q 3HKZE 4JBKA 1VQ6A 4B3RQ 3HOXH 1BVSA 1QVCA 4YY3Q 4DUZL 4IO9A 3CC4A 1FGUA 4L5RC 1YJWA 2OTLA 2JA6G 4JI6Q 5C0XJ 1RL2A 2KBNA 4R4OA 4X66Q 4L5SA 2VUMG 4JI0L 5IP7G 4APVA 4DNIA 4DK6C 4IFDJ 5C4XG 3VDYA 5H1SE 3ER0A 4GOPB 3ULLA 3M4PA 4A3GG 4OX9Q 4KHZA 2NN6G 4H02A 3D0FA 2UUAQ 4LF7Q 2UUBL 2ZTCA 4PMWA 3CF5A 3S1RH 1XMOL 4JBMA 4O0AA 3KF8B 3L0OA 2K5VA 4JI5L 4A3JH 3NEMA 3PO2G 1JJCB 2FXQA 2R7DA 1YITA 2NN6I 1XMQL 1C7YA 1QZHA 2KHIA 5J3BA 2V1CC 5HGQA 4GKKL 2GN5A 4BBSG 5IYCG 4GKJQ 2XTIA 2VNUD 3AFQA 3G6EA 1IBML 2DUDA 3KJOA 2HHHL 1SMXA 3GTJH 3EBEA 4A3CG 3KF6A 2AMCB 2E5LQ 1J5EL 3J80i 2ZJQA 4BBRH 5AJ3Q 4DV0L 4EQ5A 2K52A 2KCTA 1N9WA 4JI1Q 1E24A 1E3PA 3S2HH 1HNWL 1NBWA 3Q8DA 4A3FH 3HKZG 3PUWA 2DGYA 1KHIA 1XTDA 2QGQA 2JEBI 4YCUA 4RMFA 3AYHB 1IBKQ 4POGA 1HH2P 1XNRQ 3HOZG 2EIFA 1VQIA 4IJLA 2KENA 2OQKA 1SN8A 3K80C 4IPDA 2E2IH 5M3MH 5JJLA 1OXSC 3MXNB 1VQOA 1GO3E 4KHPL 4GN5A 1WOCA 4GLXA 4OXPA 3I56A 2EQSA 3CMEA 4HIDA 4A3DH 4A76A 4LFAL 3HOWH 5FJ8H 3GTPH 1YVCA 2A8VA 3PO3H 4BY7G 4DV2Q 4JI5Q 4IFDI 1N34L 4YWKA 1EYGA 2UU9Q 1SLJA 3F1ZA 1YHAA 3DLLA 3OTOQ 3TEHB 4NXNQ 3NELA 3TS2A 2UXBL 3H0GG 2Q2TA 5IYDG 2HIVA
chains in the Genus database with same CATH superfamily
3SR1A 4P2CB 1ASZA 1EY7A 4CDEC 4HJ7A 2F0KA 5IGDA 1EOTA 5EBDA 1GVPA 3PIP3 4K0KL 2WP8J 3KYHC 4MNOA 5JJKA 4R4IA 2MFIA 3STBC 3QR8A 1PH4A 5CBAE 3ZJYC 1LTTD 2AWOA 4UHVA 1AZPA 3CXCA 1IBLL 4DV3Q 3M4OH 1IBKL 2UXCL 1QVFA 5IP7H 2JA5B 1H9JA 1HPCA 4KK7A 2RHQB 4LF6L 1VQBA 3KK7A 2AQ1B 1L1OB 1KTKA 4K5VA 3ULJA 3SGIA 2JA7G 2D5DA 5FJ8G 4DFAA 3DM1A 3HS0C 4OIKA 4X64Q 3SEBA 3FP9A 2F3VA 3CP0A 4DR1Q 4NDXA 1NNXA 2R7FA 3KDFB 1NAPA 1RJTA 4XT3B 1MJEA 3H3VI 1KABA 4ZUJA 1DZ1A 1J8IA 1K28A 4K0KQ 3H91A 1GXDC 1NE3A 3NUCA 1IXRA 3GTQH 3S15H 3ND9A 3M7NA 3F2DA 4LF9Q 2A5HA 1SMYD 4DR3L 4O2DA 1IBLQ 1TS5A 2M2LA 2PCFB 4A3MH 2R3ZA 1Q86C 2IW3A 2K04A 1SYEA 4UP7A 5IWAQ 1IL8A 5D3DA 4CKEA 1Q12A 1DXMA 4ZYSA 1I94Q 3M7GA 1HXYD 1JORA 1B1ZA 4JI2L 3EVQA 1SYDA 2F0SA 5CMDA 1YEZA 1OXXK 3NWSA 1D1IA 1UEBA 1AP0A 3SE0A 1QCBD 1B3QA 4BXXG 2K14A 4HMIA 2DNEA 1OXUA 1WTXA 2QEXA 2BA0A 2QKIC 2PNRC 5ELFA 1KAAA 1E2VA 5ELOA 4GN4B 1XPRA 5M3FB 2I07B 2KA7A 1CSQA 4H44C 4DK0A 1SFOH 2DJFC 1SYBA 4CDDC 1GHJA 4KKSA 3S1NB 1I94L 2UU9L 2EY2A 2RHSB 4DV7L 3S1QH 4DK3C 1EU3A 2IX1A 1V43A 4A3JB 1O7YA 5DEHA 2D0PA 2QDLA 1EY8A 1QG7A 1E2ZA 4MTNA 4DKAC 5IYDH 4DV5L 4IUVA 2Z6BA 3FVQA 1WI5A 4ZRZA 5CV8A 5I6YA 1BO0A 1K3BC 4BBRB 1PRTD 1PH8A 4JI3L 5M5WH 4DR7L 3UDXA 4DV4Q 1A62A 1T5EA 4X3KA 1SE4A 4JVZA 5M5WB 2C35B 1C0AA 1Z9FA 4RCOA 1CT1D 2LSSA 1BOSA 2JA9A 1T9HA 1LLRD 3J81c 5BN5A 2XNAC 1XXGA 2HQLA 1F77A 5L37A 1VS0A 1R9TH 1RKNA 2R93B 2KOLA 4GS3A 1I6VC 1Y1VG 5KIXA 3JAME 5J39A 4DK1A 4QMGA 2ZM6L 2F0EA 4A3EH 3T16A 2OWOA 4GKKQ 4BA2I 2PW5A 1A0IA 3BZDB 1BNZA 5K36G 4I7AA 4U673 4HSPA 1G51A 1B9MA 2H1EA 2E74C 4BY1H 1OTCA 3PV0A 4GOPC 3BDLA 1D5ZC 4DV4L 3T1YL 1BBUA 1UAPA 2WB1E 3NSWA 5EAYA 3AMUA 1KIXA 1S5BD 1KC8C 3RZOH 1K73C 1JWSD 1LV9A 4HR7B 3A8KE 5C3EH 1O7ZA 2F0UA 5JVH3 2ALYB 2RKSA 4GNXA 1PYBA 2IL8A 5M3FH 1HQRD 1H9MA 1YNNC 2XRQD 5CV6A 4EX5A 3CCVA 1TQOA 4PMCA 5IOCA 5C4JH 4TRDA 4J8QA 1LTLA 2RDFA 1QWYA 2DJGC 1TWHH 4DV2L 3RLFA 4ZKBB 2OTJA 3D4DA 5C4ZA 3MVVA 1BXTA 2IHEA 2PNHA 1DOKA 3BYYB 3X3MA 1A2UA 1ET6A 1A3VA 5ISRA 4ZLTF 3E5SA 5KYLA 1UE1A 4DUZQ 3ERSX 3M3YH 2VQEQ 1ET9A 2F0TA 5LMUL 3E9HA 3QG1A 3CCLA 3SK6A 4A3GH 1EZ6A 1UE6A 4XYOA 2J0TD 2R92G 1EY0A 4HJAA 4ZCKA 3NQIA 2F0WA 4R8IA 5FLXc 2E2JB 3PF4A 3GP7A 4HIMA 5K36H 3SHLA 4LAAA 5KGUA 1F9PA 4Y52H 2A74C 2JA8G 2JXMB 2ICEC 1Q82C 3CCSA 2BA1A 1HRJA 1L1OA 2NWGA 5FLMG 2EYLA 3UDIA 3FEWX 3HOYH 4QGUA 4A3KH 4YWMA 2HUGA 4F7XA 3PSIA 3GTKB 1V1OA 2B39A 1CSPA 2PMZB 2PZWA 3BYTB 5FKAC 1QUQA 2ZJPA 3AU7A 1L2FA 1NR4A 1UEAB 3MXGA 5T1GA 4DAVA 1PZKD 3M9BA 2DN8A 2B2VC 1SRUA 3GQBA 4GNXC 1K8AC 2H5XA 1R4QB 2JSOA 2K7VA 1HZCA 1N36Q 3E6ZX 3HRZC 4GLVB 3A8IE 1LACA 3TP8A 3DXJC 4HTHA 5AFWA 2F3WA 1Q8IA 4JC0A 5EKLA 1SE8A 3TP7A 5I9PA 1GUNA 4L8JA 4Z9CB 1VQCA 3MZ5A 3I70A 4I65A 4CBVA 1NSNS 1F9QA 1G291 3NP8A 5M3MB 2OXPA 4CKCA 5IGGA 1IKLA 4A3KG 1AE2A 4DR5Q 4NKLA 2OEOA 4A3IH 3I4NH 1E7ZA 4DAYB 2AUJD 1G2TA 2ID0A 1PH1A 2AKWB 5J1ZA 4UDUC 1HZ9A 2MUYA 3PO2H 2EYOA 2EY6A 5IYBH 3WOFA 3F2BA 4BY7B 2SNMA 3OWEB 4OWXB 3NWTA 4DV6L 3TP6A 1N36L 1SNDA 2BDOA 1D8LA 2JE6I 2A6HC 4NMZA 5E1FA 3PUXA 2CHBD 3S15B 1MI2A 2ZXRA 1CZGA 4F8MA 3VA7A 1XJVA 2IT1A 2N8NA 2E5LL 3CAMA 5AJ3L 4O1NA 3SXHA 1C4QA 1RHPA 5JVG3 1CQVA 3W5OA 4L5RC 2SDFA 4R4OA 2Z4HA 2L55A 4RA8A 3A55A 4APVA 3MXPA 1XWEA 1I4XA 4X3TA 5KEEA 4E6IA 2B2TC 2A69D 2MHVA 2UUAQ 4H02A 4OX9Q 4PMWA 1PTOC 2X69A 4JBMA 1EIGA 3KF8B 3L0OA 4KV6A 3RUZA 2K5VA 1JJCB 4M8AA 2R7DA 3FMCA 1YITA 3HGBA 1G8ZD 3NPPA 1XMQL 3D8GA 1C7YA 3TZUA 4GKKL 2GN5A 4BBSG 1HFGA 3AFQA 3G6EA 3KJOA 4A3CG 2AMCB 4HMJA 1WTRA 2KCTA 3VYTA 4JI1Q 1E24A 3DWPA 3ZYYX 1E3PA 1NBWA 4A3FH 4OELB 2EPBA 1KHIA 3M3YB 1FR3A 3TZDA 1FYCA 3AYHB 5DM73 1HH2P 1SMYC 2N88A 4IJLA 1EIHA 3K80C 3I4MB 2EQSA 3CMEA 2A6HD 4PMBA 4IFDI 3TBIB 1YVCA 1SNQA 2G5DA 1SEBD 1N34L 4DF7A 2UU9Q 1YHAA 2BE5C 3OTOQ 1F9SA 3P1HA 4A3DB 1CA5A 4H7BA 5D14A 2UXBL 2Q2TA 5IYDG 4CKBA 3PIOA 1Z47A 3OPOA 4IJHA 3U58A 4JI4L 2EJGC 3UDGA 4RWSC 2YYZA 1KRSA 2BH2A 4KD3A 3RN2A 1EYAA 3OHXC 1HZBA 2YTXA 1LT5D 3GTKH 5LL6X 4CJ2C 1V1QA 2NVYH 1GUOA 1S5CD 1JB3A 1K3RA 4KY6A 2JP1A 2R93G 1CI3M 2WINB 1O7LA 1PFMA 2A68C 4B9WA 1N32Q 1HZAA 1YZ6A 3L2PA 3HOVH 1FJGQ 2NTSA 1IW7D 4M1UB 5NUCA 5LMUQ 4HIOA 3HOVB 3AQQA 3PO2B 4OO1I 4FXKC 3UE0A 5DLQE 4BY7H 3CCEA 1TS4A 3TS0A 1XNQL 2NBFA 1EFWA 1PRTC 2F0LA 1A3UA 4ALPA 3DEOA 3PGZA 4L6TB 2Z6KA 4OWTB 4X3UA 1Y1WH 1MD2D 2X6LA 4A75A 2K5DA 4TSSA 2EDGA 4IZ8A 4AYBG 2ZTDA 3R93A 1FVIA 4JYAQ 1SAPA 4C3JH 3S14H 2R6GA 3P20A 3J81i 3MFYA 1S3OA 1AN8A 5CORA 4JV5L 3GO5A 2L12A 1UE7A 4PZ6A 2DNCA 3W2DA 2VZAA 4QIWE 5M3MG 4A3GB 4DUYQ 4G7ZC 3DWAA 1JT8A 2EYJA 1FGBD 4BWGB 3NBHA 2D62A 1MIUA 4NXML 3RNUA 2E2JH 1STAA 1LTID 4QUFA 4GN3B 2KHJA 2F0FA 3RZOB 2AHOB 4C3HB 5E7NA 3RLNA 1CKMA 2KJXA 3U4VA 2QILA 3RR5A 4IPGA 5C44G 1VQAA 1A2TA 1VQJA 2KHSA 2VQFL 2HHHQ 3ONAB 3P7JA 1TKWB 4A3KB 2PMZE 2TMPA 5CV7A 5EPJA 1GHKA 1RIPA 3RMHA 2B29A 1KDCA 4FDBA 1CUKA 2B2TA 4YHHQ 4ABNA 4DUYL 4R4TA 1M8AA 3TDQA 2ZTEA 1DGSA 2N49A 1UE5A 1PVOA 3JAMi 3T13A 4MTKA 1WYDA 4K8JA 3T56B 2RA4A 4OONA 1NCVA 1DD2A 1ML0D 1VQ5A 3HOYB 4PZ8A 3Q22A 4HN7A 1EEFD 5C4HA 4LUOA 4BY1B 1EOVA 2MO0A 3BG3A 3TRZA 1ONLA 1PZJD 1RDPD 2MQHA 1ESFA 3S17H 2CW0D 5EQ0A 2KEEA 5KRUA 1IHZA 1HHVA 4YWLA 4RHRA 1D7QA 1Y1VB 4HEDA 1IW7C 1HFNA 1CFMA 5JOBA 1JOQA 2NTTA 1LYLA 1R9TB 4IPCA 1D2BA 3NBHB 1A63A 1S5FD 2IWHA 4DR2Q 4A3EB 1HA5A 2Q2UA 3K7AB 4K6DA 1TXYA 2VW9A 4QL5A 4JK1C 4P71A 1IBMQ 2ES2A 1AEXA 3KBXA 3FKIH 1EQTA 3A5ZB 3JAML 1WD0A 2R61A 4R4CA 4JI7Q 3GD7A 5IT9L 3EN2A 1YNJC 2CH4W 3HOVG 5BR8Q 1LT6D 4K6LA 2UUCQ 5JAVA 1Y14B 4L63B 4DR5L 1J9OA 5EPLA 2A6EC 4K5XA 3DM3A 3BS1A 4G57A 1EWCA 1DYQA 4RKLA 4POFA 2UXBQ 1UNSA 1CHPD 5BN4A 1S4ZA 1YJ9A 1JCKB 3S9WA 3HKSA 1I50H 2MPMA 4DR2L 1N34Q 3A54A 3FDTA 3J80c 1VMCA 1LTRD 3AFPA 1TWGB 2UXDQ 1CK1A 3HEJA 1BCPF 1KDBA 4X66L 3OSOA 1G6PA 1NMFA 3LX0A 3FHWA 4V0BA 2KCCA 2JQOA 1LTAD 1JWMD 1PA6A 2K5NA 1G6ZA 2F52A 3T1HQ 1BQQT 1IKMA 1JQYD 2DY7A 3ITPA 2F4VL 2NUCA 1WD1A 1AW7A 4PZ7A 4AYBE 3RZDB 2NZ1D 4XT1B 2PQAB 2Z8LA 3VR5A 1ESRA 2UUAL 2KQ3A 2YV5A 5KNDA 3RZDH 4R8NA 2ZXPA 4C3HG 5LMNQ 4IUUA 1PRTF 3RN5A 5DAUA 3K6OA 4XYQA 1HNWQ 1ENCA 3I4LA 5EJWA 1X54A 1K0RA 1WTOA 4L5TA 1TY0A 3J81E 1Q81C 4XQNA 3J7AF 1IYUA 4ZQ3A 5CGKA 4DA2A 3CKIB 4JV5Q 2TSSA 2CKZB 3MFGA 4EQNA 4C3IG 4C3IB 1H9KA 3DMUA 1M90C 5FK9C 4A3LG 1X9NA 1HCZA 4K2KA 2C9OA 3MHBA 4LK1C 4ZK9B 1K9MC 1PH3A 1SR3A 2B63G 2VUMB 1Z6HA 1KD1C 1QVGA 2HCIA 1X3FA 3PCOB 2PQEA 5D65A 4DAMA 3I2ZA 3PO3G 2Y0SE 5C6AA 3WWVA 3J7A5 2R7ZB 2AUKA 4OEMB 1N8RC 2Z6KC 4LW1A 3H15A 3H09A 4NXMQ 3CCUA 2K50A 2ZM6Q 4BY1G 4GLAC 4A3FB 5FO8B 3SK5A 2EZVA 3CQZH 5EBCA 1STEA 4DV3L 1Y1WG 5IODA 1JWUD 4UP8A 4QQBX 1RF2D 3OYYA 2K33A 2GVBA 1LTSD 4AIMA 1SSOA 5C3EB 2VB3X 3OIQA 1GM5A 3KDFA 2F1MA 1KAWA 4FF2A 2R93H 3CCJA 4WFN3 1YHQA 1EYDA 1Y1VH 3PUYA 5HGTA 1WTPA 2EYFA 3K0XA 1PYWD 3Q24A 3I4MG 1S72A 1P16A 2LS01 4NP5A 2O5IC 1R4PB 1QJOA 4DAYA 4DNRB 2NVQH 4QY7A 1Y1WB 3S1RB 1EY4A 4MZ9A 4DV1Q 1TVXA 4LNQA 5IE8A 4QUCA 4K2LA 1FD7D 3T51B 4DR6L 1X55A 4X65L 3VYSA 4A3BH 4JBWA 5HY6A 1JMCA 4A3FG 4A3MB 3CU7A 3HOXH 1MBYA 4F88A 1QVCA 4YY3Q 4C3JG 3CC4A 3V2TA 2JA6G 1E0BA 2VUMG 4LJZC 2OF1A 1CTMA 5IP7G 1TR5A 3VDYA 3ULLA 3C1FA 4KHZA 4EQOA 1XTCD 2ZTCA 3C3LA 1JICA 1PZID 1U4RA 3NQTA 4JI5L 3PO2G 3NEMA 1WCMB 2FXQA 1AFPA 4KKTA 3DHQA 3R8BA 2NN6I 3L9AX 3KLSA 2V1CC 4DNTB 4RKBA 3KF8A 3K5MA 1IBML 3VA5A 1SMXA 3J81L 3KF6A 2E5LQ 5EGTA 5AJ3Q 2ZXOA 4DV0L 4EQ5A 4KD4A 2F0NA 3PQIA 4DXFA 1HUNA 5CBEE 4DU9A 3Q8DA 1SFOB 3WOEA 3PUWA 2DGYA 1XTDA 2QGQA 4YCUA 2EJFC 5IGBA 3L3OC 1SDFA 1XNRQ 5JPMC 2FMMA 3HOZG 1L0YB 2J4XA 1VQIA 2R92B 3VR3A 2A73B 2WKCA 4K5WA 2EY5A 1GO3E 4F87A 2JA7B 2KCNA 4OXPA 1BF4A 4LFAL 3HOWH 3PO3H 1SLJA 4K8IA 3F1ZA 3H0GB 1GUTA 4NXNQ 3PO3B 3NELA 1W6JA 4IALA 4QF4A 2R7ZH 1DJRD 5E3FA 1G2SA 1PH6A 3PMFA 5I2YA 5I4DA 5JEAJ 1JOKA 1NTGA 3PIO3 4AQYL 1ASYA 4BBSH 1KXLA 1S40A 4DV0Q 1PRTB 3IFTA 1PTOH 2F0IA 3LWUA 2F0VA 4C3IH 1VQKA 3G4SA 2E8GA 4C1NK 2Q8IB 3K5LA 2LMCB 2O2LD 4A3BB 4A3IG 3I4NG 5LL6S 1XNRL 3IL8A 1PXUA 3T1HL 2E2HB 3JAMc 3BZKA 4CJ0B 1HUMA 3Q23A 4N9PA 4LFAQ 2E2HH 4FNFA 3C46A 4FP5D 5FO7B 1J6QA 1NY4A 3VR6A 1F2MA 1STGA 1TIID 1YNJD 2JEAI 1ZEQX 4ZAIA 1H9SB 3F8TA 2RQXA 4B3RL 2B3GA 2L5TA 3S17B 2JN4A 3UI2A 5M5YB 2A6ED 1JE5A 1NMGA 1Y69U 1DONA 1AE3A 3CCQA 3GV3A 1H95A 3C2PA 4S3SA 3TMEA 2B2YC 1QILA 3QWNA 2WB1G 3C1EA 1X65A 5HURA 5TSSA 2B2VA 4I7ZC 4OO1H 4LF7L 3NTHA 2F0JA 5C4JB 2B2YA 3O13A 5GAGC 2VY3A 4WRDA 3GDEA 3MA2B 1EQQA 3VYUA 1A6XA 5I6WA 2R92H 2I0QA 2D9UA 2NVQB 1WTHA 1EY5A 5JJZA 2N3SA 2N55A 1XNQQ 3HOUG 4LF8Q 1TWAH 2JA7H 1X3PA 2LFNA 3I4OA 3Q0AA 1J5EQ 4GZYC 4FO2A 4G7HC 4IUNA 1TWAB 1BUVT 3BJUA 5ELNA 1QZHA 2O4XA 4JI8Q 4HJ5A 4KTAA 1K83H 2FINB 4O42A 1JC7A 2WIIB 4DPGA 2G9HD 1XYIA 3R3OA 2H4OA 2MNAA 2CW0C 2K4KA 2ASBA 1I3QH 5C4XH 3EA6A 2Q2IA 1I3QB 5JPNC 1I50B 5IP9H 3QO2A 1KQSA 4IURA 3SVMA 1SE2A 3HOWB 4Q0FA 1C8CA 3NENA 4B08A 1AZQA 1AH9A 1MHWC 1JR0D 3PUZA 4DR6Q 1EWIA 1Y8PB 1F2LA 3OTOL 3FKIG 1B70B 3KF6B 1U4MA 2KUMA 2AQ3B 1EYCA 4B3SQ 2VQFQ 4RGMA 1GKHA 2K5HA 1SROA 4YY3L 2A69C 2K1BA 1E2WA 4LF6Q 3HP3A 5JEAG 2F4IA 4ZUIA 1SYFA 2JA5G 1EIYB 5M3FG 3L7ZC 1IYVA 5CYUA 1HR0Q 4OGQC 1ICFB 2FHTA 2OT2A 2SEBD 4DR4Q 4X62Q 1QZGA 4GKJL 3H0GH 5C0XH 1QOHA 4B3MQ 3HOUH 3OMGA 5K5PA 3BU2A 4IFDH 3GTOB 3Q6SA 1G91A 2QF7A 3MXNA 3NXWA 3M4QA 3E3XA 3GTOH 3UDFA 2B2UA 5ELDA 4TVAB 1X6OA 5A35A 1A15A 1MKHA 4LF5Q 1B9NA 3TSSA 5CC4A 3FKIB 1SBBB 1HJPA 1Q3LA 2B2UC 4OO1G 2NZHA 4JYAL 2CQOA 1JB7A 1TWCB 2B63H 2K01A 4TKOB 5JEAH 3CPWA 1VQNA 1VQ8A 1VQFA 1OO9B 5E4XA 4R1JA 3KFUA 2Z9HA 1GUSA 1H9RA 2VS1A 5DNFA 1Q46A 3ULPA 1LTBD 1KRTA 4G7OC 2NVTB 3LNNA 3GTLH 4MHEA 5IT9E 3QIAA 1LO5D 1N33Q 1I6HH 2EYPA 5C0XG 4NXNL 4CJ1B 4A4IA 1YIJA 3CC2A 1SXTA 2JJQA 1X3QA 2D2CC 3PUVA 3CCRA 4G4KA 1S5ED 4UY8C 2B8FA 3I55A 2BH8A 4C3JB 5C44H 1E22A 1WTQA 4AQYQ 1H9SA 1V1PA 1KLGD 3OW2A 1XPUA 4IUPA 4KHVA 1PDQA 3ICEA 3S16B 3I90A 2YTVA 1K0SA 4LUZA 3KLSX 1SE3A 3KLWA 1YJNA 1I5FA 5C4XB 4R4QA 3S16H 1QNUA 1EQVA 1WCMH 5C0XI 2EJMA 1K8MA 4FF4A 2NN6H 2BE5D 2E2IB 1VQMA 3ND8A 4IUQA 2CH4A 4WJWA 1VMPA 1PTOF 4CHTB 4HJ9A 2VB2X 3OW7A 3DUZA 2E75C 1E1TA 5I9OA 4DGZA 3HOXB 1HNXQ 2RVLA 4A3CH 4PQXA 3URYA 3CPFA 3I73A 3N6RA 1U4LA 2B8GA 1O7IA 4CDFC 1PH2A 3JC66 3CC7A 4XQJA 5GAHC 2MP1A 4FXGC 2RDGA 1WTVA 1LT4D 3G71A 3H94A 1SYCA 2PPBC 3BVMA 4JCVE 1LUZA 2L15A 1TT2A 3W3AA 1RTOA 3SDZA 5KYIA 1BCPD 3GTPB 4A93H 3E0EA 4BA1I 1XPOA 3MXUA 4GNXB 3DEPA 1STNA 1SJED 2WAQG 3I72A 1KNEA 4GOPA 4IFDG 1D5XC 1BDOA 1HNXL 4LF8L 3T1YQ 4P73A 3CCMA 4KMUC 3VYRA 2I5LX 4HIKA 1V1PB 5COYA 4Y7NH 3U4ZA 5FLMH 4YCWA 1VQPA 2EXZA 2BCOA 1YNND 4JI6L 3WDNA 1B53A 3AEVA 2F0MA 3F2UA 2JA5H 1II3A 1NUCA 5GQOA 5G3LF 1B7YB 4EQPA 2DY8A 2WAQE 4ULLA 1WTWA 3PF5A 1TWCH 1D6EC 2QA4A 2RDHA 4X64L 4XXEA 1ENAA 1YHBA 4A3JG 1VQDA 2K75A 3HOWG 1RD9D 1ZXTA 5CV9A 2XRSD 4RCNA 4CDCC 3QJYA 1SJHD 2C5CA 4OIJA 1WVLA 2MO1A 3P75A 1EIFA 1VQLA 1CM9A 1YNXA 3D6WA 4KN7C 1SNMA 4QJFA 1VQ4A 4LF9L 2LXKA 2WAQB 4LFCQ 4FXDA 1B50A 2CQAA 4R9WA 1NR2A 3NK9A 2D0OA 2MGSA 1VQ6A 4B3RQ 3IKJA 1BVSA 4DUZL 1FGUA 3R2IA 2OTLA 3S14B 1FNUA 5C0XJ 2Z1CA 1RL2A 1TS2A 2F0GA 4JI0L 2K32A 4DNIA 4DK6C 4IFDJ 5C4XG 5H1SE 3ER0A 3M4PA 4ZKCB 4A3GG 4RGTA 2NN6G 2G9DA 2K6AA 3OMCA 4O0AA 3KUPA 3EFXD 4LMQD 4C2MB 2BDNA 4MN3A 5FO9B 3CRLC 5ELCA 2KHIA 4GKJQ 1K83B 2XTIA 2HHHL 3CHBD 4QIWB 2EYHA 1SNCA 3J80i 4BBRH 2JA8B 2L9HA 5C3XA 4CGYB 2K52A 2EVBA 3K57A 4HAEA 3D6CA 1HNWL 2J7ZA 3I91A 3HKZG 4RFBA 1STYA 2JEBI 3KLRA 5KNCA 2KEDA 2MJ8A 1D1KA 1IBKQ 3FPUB 1L0XB 3GV6A 2KENA 2OQKA 1SN8A 2FFKB 1OXSC 3MXNB 4KHPL 4GN5A 5CV5A 2M00A 3I56A 5T1IA 2PO4A 4A76A 3QB3A 3GTPH 2A8VA 4JI5Q 1LABA 1I4QA 3MTSA 4IN3A 2RSNA 1EFID 3TEHB 3GTJB 3HOUB 3H0GG 4IPDA 1U9RA 2F0PA 1EZ8A 4IOCA 2BOSA 3CQZB 4XQQA 2GA4B 1RTNA 2A19A 3I7FA 1M1KC 1IL2A 2L1BA 2PYKA 1CZWA 4JBJA 4QB4A 3KJPA 1I4PA 4BBSB 5IGFA 1EL0A 4XTCS 3J7ZC 2FJ2A 2KECA 3F2CA 4DR3Q 1IYJB 3NTIA 1QUQB 4X3SA 1M4VA 2EY1A 1K8OA 1EY9A 1IZ6A 4H13C 2VUMH 1PFBA 3J80L 1X3GA 1KL9A 3S1MB 3VR2A 1W2BA 1Y8OB 1PLFA 2K28A 3G7LA 5F2DA 4P74A 2IY5B 4PG3A 1QB5D 4EGVA 4KHPQ 3LWEA 1TU2B 3QOLA 1WJJA 2XGTA 4C1NI 2QW7A 4JI2Q 2YTYA 5KNBA 1NJIC 4RG1A 1P8LA 4ME3A 4BXXH 1HNZL 3GTLB 1JJ2A 2WACA 2K5QA 2CFMA 4J6HA 1CKOA 2WKDA 5C5LA 1BCPC 5D3IB 3PIPA 1TWHB 4RGNA 4NW2A 4IOAA 2Q8RE 3A8JE 4JI7L 4DV6Q 4JW0A 5LHY1 5E4WC 3EIVA 3HKZB 3GTGH 1B2TA 1GUWA 2PW7A 2AWNA 3E9IA 4ME5A 4MIUA 5I2XA 1BR9A 3ERQA 4YIJA 2E2DC 2CWAA 4LF5L 1YI2A 1L1OC 1DOLA 1SNOA 2N78A 4J1MA 2NZOA 2LKVA 3HOZH 5IP9G 1TS3A 1S5DD 1RODA 1Q7YC 2NVTH 2XWJB 3BZCA 4WJ3M 3QOJA 2HT1A 2A1AA 2PQAA 3H3VH 5EKKA 1TWGH 4RH6A 3A5UA 3BVZA 3W1GA 5BN3A 2ICIA 3CW2C 4LFBQ 2RCFA 2ATWA 3HFZB 1W3SA 1U4PA 1VF5C 1L0WA 2I5MX 3BVGA 4P75A 1XMQQ 2PZUA 1K8GA 1UWVA 3HOXG 2CVRA 4B3TQ 3A7AB 2JA8H 4N8X1 3I8ZA 2F4VQ 3NHHA 2I5HA 3CD6A 4XDXA 5C3EG 1DCZA 1HTPA 4KY7A 1GUGA 3NBIA 5IIFA 4KN4C 1CKNA 3CMAA 4KLKA 1B4OA 1CHQD 3B6YA 1KNAA 1QE6A 1WFQA 2QEJC 1WCMG 3UE1A 3R2TA 5GAEC 5LMNL 1I6HB 1ILPA 4DN4M 3NTKA 2L0CA 2XVSA 4YCVA 5M9OA 1PV4A 4A3EG 4FVMA 4C2MH 1LT3D 3K7UC 1PH5A 4C3HH 3TP5A 5IGEA 4JI4Q 1LTGD 2XSCA 4U68A 4LFCL 5G3LD 4LF4L 1FNWA 1TY2A 2Q8TA 4AYBB 1DM0B 2F0QA 1OXTA 4ODGA 1I4GA 3K7AH 2OCEA 5M5XH 2FMCA 3FPPA 2CWPA 2NVYB 2UXCQ 4XIGS 4AH6A 3U9OA 4HCEA 5IT9c 3D31A 4A3LH 1N32L 1CA6A 4KJNA 5DM63 3VR4A 3K81C 1XMOQ 4A3IB 3I4NB 3S1MH 4A3DG 3MC0B 4IQZA 2XIWA 3D4RA 3IFDA 2UUBQ 1A8VA 4DR1L 2R7ZG 3J81j 1FJGL 2XWBB 3MEHA 4RAUC 1ZKOA 5JJIA 5FLXE 1HA6A 5C3WA 2I46A 5FLXL 3KOJA 4Y7NB 2PI2E 1Q1BA 5J22A 4K14A 5GADC 1Y8NB 3EQLC 1VQ9A 1KDAA 1PH9A 4J15A 1PHJA 1UUPA 1QNKA 4OWWB 4FF3A 4L5QA 2XN9C 4LUVA 3BDOA 3S2DH 2HD3A 4JOIA 2JA6H 5IY0A 2VQEL 2RF4A 3DWQA 1Q90A 1U5KA 1F2ZA 1B8AA 1VQ7A 3HOZB 1EU4A 5GROA 2JA6B 1JJGA 1HR0L 1EY6A 4UPAA 4A93G 4JOIC 3N52A 4NB3A 2EXDA 4DV1L 4DR4L 2AQ2B 4OL7A 2GVAA 1VQEA 3KBGA 2YU9H 2IHFA 4X65Q 1VQGA 3S1NH 1ENFA 3A7LA 3K5OA 1U0LA 2HDLA 3D3RA 1STBA 3A74A 3K59A 4HJ8A 1ICWA 3M85A 2HCCA 4KI0A 4LWCA 5LMNW 1E1OA 3GTGB 2RCNA 3GTQB 4JPBW 1EUJA 3STBD 5C44B 2E76C 2K5WA 4JG2A 1HR0W 1EWHA 1PYSB 4OX9L 3S24A 2LXJA 3D4WA 3EROA 4ILWA 4JI8L 3I3CA 2WFWA 2Y0SB 2M9VA 2ZT9C 1D5MC 4FYDA 2Z0SA 4HSVA 3GTMB 4UP9A 1B3AA 2IX0A 4JI0Q 3EJIA 3X3NA 2OQ0A 1Q1EA 2O5JC 3GTMH 2PZTA 1V8QA 5IYBG 4ID6A 4KJOA 1ZYRD 3SK8A 4N8FA 1C9OA 3K0YA 1HTLD 3RLOA 1N33L 4YHHL 4V190 1GJXA 2F0OA 3K8AA 2EYMA 2HIXA 1MJCA 3HG9A 5IYCH 1I4RA 1PMRA 1VCIA 2CCZA 2HQEA 3V05A 4A3BG 1JE4A 1BBXC 4BBRG 2RSOA 1SNPA 1OXVA 1Q8KA 1X56A 5CR3A 1STHA 1HQMC 1TWFH 3IRBA 4NPSA 1FL0A 4B9XA 1GD7A 1LM0A 1V9PA 3G6JB 3TREA 3M4OB 3H3VC 3G48A 3SK4A 2SNSA 3M4YA 4BS9A 4B3SL 4QCLA 1BCPB 2A68D 3I4MH 1Z7TA 1FNVA 4X6AH 2F0HA 2HDMA 3W1BA 3IAYA 1CKNB 1YBYA 5IWAL 3S1QB 2KVMA 2NVXB 2L4NA 2EE1A 3H6MA 4LFBL 2NVXH 4HCSA 3J7YW 2WV6D 2K03A 1BBWA 1ZYRC 4DAPA 2F03A 5C5MA 2Q2HA 4X62L 1GOZA 4B3TL 5A2QL 3CRKC 5M5XB 2YU9B 2B2WA 1MSGA 3TQYA 4B3ML 3K5NA 1VDZA 2RBMA 2Y0SG 1PTOB 3FRPB 4H0LC 2ZJRA 3NE5B 5ELEA 3HOYG 3A0JA 2VXWA 2UUCL 4N9TA 2JK8A 3OOCA 4RHSA 1PTOD 4RGOS 4OHJA 4WJ4A 4A3MG 2QCPX 1EEID 3MEFA 4DXGA 4Q5VA 3K58A 4DV7Q 4KY5A 1VQHA 3TN2A 1BKBA 2PI2A 1DOMA 2KCMA 5BR8L 1B44D 1PFSA 2F3IA 4WORA 4P72A 4UAIA 1T5XD 2UXDL 1PH7A 3E0JA 3LGJA 1HNZQ 1EQRA 2JYOA 4DV5Q 4TQUS 2SOBA 1F9RA 3U50C 2EOTA 4IPHA 3HZXA 4LF4Q 2VL6A 2L11A 1X3EA 4JI1L 5M5YH 4JI3Q 1VF7A 3HKZE 4DR7Q 4JBKA 3T53B 4IO9A 3S2DB 2WB1B 1YJWA 4C56C 4JI6Q 4FF1A 4X66Q 2KBNA 4L5SA 2B63B 5A2QE 3J80E 1KLUD 3T4AC 1TWFB 3OIPA 3OWFA 1I4HA 4GOPB 3BDCA 1F2YA 2ENBA 3D0FA 4LF7Q 1A3TA 5CV4A 3S1RH 3CF5A 2UUBL 1XMOL 1PFNA 2NYZD 2QDBA 4A3JH 3RD4A 1O80A 2V4DA 1ILQA 1SYGA 1O78A 4PNYA 4EVOA 3MWYW 5J3BA 5HGQA 2NB0A 4IUTA 5IYCG 1XX8A 2VNUD 4KKUA 2DUDA 4PV1C 3GTJH 3EBEA 1J5EL 2F0DA 2P5ZX 2ZJQA 2LY7A 2IPKD 1N9WA 2B2WC 3S2HH 4RMFA 5ELBA 5EKIA 5FOBB 1RCVD 3S2HB 5IGCA 4POGA 1MGSA 2IJ0A 1W6KA 2IX3A 1CQFA 2Z4IA 1C48A 2EIFA 1JOOA 3A56A 1MSHA 3J7AV 2E2IH 3V96A 5M3MH 5JJLA 1VQOA 4A93B 5EPKA 1WOCA 4GLXA 4HIDA 4A3DH 1X32A 4BY7G 5FJ8H 2X6GA 2K05A 4DV2Q 4YWKA 1EYGA 3MAQA 3AB9A 3DLLA 3TS2A 2HIVA 3U9SA
chains in the Genus database with same CATH topology
4IOCA 3PIOA 1PH6A 1Z47A 2A19A 3I7FA 4IJHA 4HJ7A 5JEAJ 1NTGA 3U58A 4AQYL 1M1KC 3UDGA 1ASYA 4JI4L 1IL2A 4BBSH 1S40A 2YYZA 1KRSA 2BH2A 1GVPA 3RN2A 4DV0Q 4JBJA 2WP8J 4K0KL 3KJPA 3KYHC 4MNOA 1HZBA 5JJKA 4R4IA 2YTXA 2MFIA 3STBC 4C3IH 1PH4A 3ZJYC 4XTCS 1VQKA 3G4SA 3J7ZC 3GTKH 1ASZA 3F2CA 2E8GA 1V1QA 2AWOA 4DR3Q 3CXCA 2NVYH 1IYJB 4DV3Q 1IBLL 1QUQB 2R7ZH 1K3RA 1IBKL 3M4OH 2UXCL 4A3IG 3I4NG 2R93G 1IZ6A 1QVFA 1XNRL 2VUMH 5IP7H 1X3GA 3T1HL 1KL9A 1W2BA 1N32Q 2RHQB 4LF6L 1HZAA 1VQBA 1YZ6A 3L2PA 4P74A 1FJGQ 3HOVH 3JAMc 2IY5B 4PG3A 4KHPQ 3BZKA 1WJJA 2XGTA 5LMUQ 1L1OB 4HIOA 4LFAQ 2E2HH 3ULJA 3AQQA 4JI2Q 2YTYA 3SGIA 4OO1I 1NJIC 3UE0A 5DLQE 4RG1A 1P8LA 4ME3A 5FJ8G 2JA7G 4BY7H 3CCEA 1HNZL 4BXXH 1JJ2A 3TS0A 1XNQL 1J6QA 1NY4A 2CFMA 4X64Q 1EFWA 3FP9A 1CKOA 3CP0A 4DR1Q 4ALPA 3PIPA 2R7FA 3KDFB 3PGZA 4IOAA 2Z6KA 4OWTB 2JEAI 1Y1WH 1KXLA 1MJEA 3H3VI 4JI7L 3F8TA 4A75A 4DV6Q 4B3RL 2B3GA 3EIVA 3GTGH 4K0KQ 1NMGA 1JE5A 1NE3A 1IXRA 4AYBG 2ZTDA 3GTQH 4JYAQ 1FVIA 3S15H 1AE3A 2AWNA 3E9IA 3CCQA 4C3JH 3S14H 1H95A 3M7NA 3F2DA 4LF9Q 4DR3L 2R6GA 2CWAA 4O2DA 1IBLQ 3J81i 4LF5L 1S3OA 1YI2A 1L1OC 4A3MH 1Q86C 2WB1G 1X65A 4JV5L 3GO5A 2N78A 1UE7A 4UP7A 3HOZH 2NZOA 4LF7L 4PZ6A 5IP9G 5IWAQ 2VZAA 4QIWE 5M3MG 1Q7YC 2NVTH 5GAGC 1Q12A 4DUYQ 2VY3A 1I94Q 1JT8A 3GDEA 3BZCA 1EQQA 4JI2L 2HT1A 4WJ3M 2A1AA 2R92H 2PQAA 1YEZA 1OXXK 2I0QA 2D62A 3H3VH 1MIUA 4NXML 1TWGH 3RNUA 1UEBA 2N3SA 3HOUG 2E2JH 1XNQQ 3A5UA 4LF8Q 1TWAH 2JA7H 3I4OA 4BXXG 3W1GA 1J5EQ 3CW2C 4LFBQ 4GN3B 2ATWA 2K14A 3HFZB 2KHJA 1W3SA 3BJUA 5ELNA 2AHOB 5E7NA 2I5MX 1L0WA 1CKMA 3RLNA 3U4VA 1OXUA 4P75A 3RR5A 1XMQQ 4JI8Q 4HJ5A 2QEXA 1UWVA 1K83H 3HOXG 4IPGA 2BA0A 5C44G 1K8GA 4B3TQ 2JA8H 1VQAA 4DPGA 2F4VQ 1VQJA 2VQFL 2HHHQ 2I5HA 2MNAA 2PMZE 5ELOA 3CD6A 4GN4B 1XPRA 5C3EG 2K4KA 2ASBA 1I3QH 5C4XH 1CSQA 1SFOH 1RIPA 2B29A 1CKNA 2Q2IA 3CMAA 4FDBA 1CUKA 4KLKA 3B6YA 1WFQA 4YHHQ 1WCMG 3UE1A 5GAEC 5IP9H 5LMNL 4DUYL 1I94L 2UU9L 4R4TA 4YCVA 2RHSB 4DV7L 3S1QH 1PV4A 4DK3C 4A3EG 1KQSA 2IX1A 1V43A 4C2MH 2ZTEA 2D0PA 3K7UC 3NENA 1DGSA 4MTNA 2N49A 1UE5A 4DKAC 3JAMi 1PVOA 5IYDH 4DV5L 1PH5A 4C3HH 1AH9A 4JI4Q 1WI5A 3PUZA 4LFCL 1WYDA 4DR6Q 1EWIA 4OONA 4LF4L 1PH8A 1VQ5A 4JI3L 1OXTA 4PZ8A 5M5WH 3OTOL 4DR7L 3UDXA 3FKIG 4DV4Q 1A62A 3K7AH 1B70B 2OCEA 5M5XH 3KF6B 4LUOA 2C35B 1EOVA 2CWPA 1Z9FA 2MO0A 4B3SQ 1C0AA 2VQFQ 2LSSA 3TRZA 2UXCQ 4XIGS 2JA9A 4AH6A 5IT9c 1T9HA 1GKHA 2K5HA 1SROA 2MQHA 3J81c 3S17H 3D31A 4A3LH 1N32L 4YY3L 4LF6Q 5JEAG 2HQLA 2JA5G 1EIYB 4YWLA 3K81C 1VS0A 3L7ZC 5M3FG 1R9TH 1XMOQ 1D7QA 3S1MH 4A3DG 1HR0Q 4GS3A 1Y1VG 1LYLA 4DR4Q 4X62Q 4IPCA 2ZM6L 3NBHB 1QZGA 1A63A 2UUBQ 1A8VA 4DR1L 4A3EH 3H0GH 2OWOA 2R7ZG 4GKKQ 3J81j 4BA2I 4GKJL 1A0IA 1FJGL 4B3MQ 5K36G 3HOUH 5JJIA 4DR2Q 2Q2UA 1G51A 1TXYA 2VW9A 3BU2A 4QL5A 3KOJA 4BY1H 2PI2E 1OTCA 1Q1BA 3PV0A 5GADC 4P71A 4GOPC 4DV4L 1IBMQ 3M4QA 3GTOH 3T1YL 3UDFA 1VQ9A 2ES2A 1BBUA 4TVAB 3FKIH 2WB1E 1X6OA 4LF5Q 1MKHA 5EAYA 1PH9A 4J15A 1PHJA 3A5ZB 1KIXA 1KC8C 3RZOH 4R4CA 4OWWB 4JI7Q 3GD7A 4L5QA 1K73C 3EN2A 1HJPA 4LUVA 5C3EH 3S2DH 4JOIA 2JA6H 4OO1G 5IY0A 2NZHA 2VQEL 4JYAL 2RF4A 3HOVG 5BR8Q 1U5KA 2CQOA 1JB7A 1B8AA 2B63H 1VQ7A 2ALYB 2UUCQ 4DR5L 1Y14B 5GROA 3CPWA 1JJGA 1VQNA 1VQ8A 1VQFA 1PYBA 4GNXA 1HR0L 3DM3A 4R1JA 5M3FH 4UPAA 3KFUA 4A93G 4JOIC 3CCVA 4EX5A 4DV1L 2VS1A 2EXDA 4NB3A 4DR4L 1Q46A 5C4JH 2GVAA 1VQEA 4POFA 3ULPA 2UXBQ 1KRTA 2YU9H 1LTLA 2IHFA 4X65Q 1YJ9A 3GTLH 1VQGA 3HKSA 1N33Q 1I50H 3S1NH 1I6HH 1TWHH 4DV2L 4DR2L 1N34Q 3RLFA 5C0XG 1U0LA 4NXNL 3J80c 3A74A 4A4IA 1YIJA 3CC2A 2JJQA 2OTJA 4HJ8A 3AFPA 3PUVA 3M85A 3CCRA 2IHEA 2PNHA 2UXDQ 4UY8C 4KI0A 4LWCA 3I55A 5LMNW 1E1OA 4X66L 2BH8A 5C44H 1G6PA 1E22A 1NMFA 2RCNA 4AQYQ 3FHWA 1EUJA 2JQOA 3STBD 4JG2A 3OW2A 1PA6A 1XPUA 1HR0W 1PYSB 2K5NA 4OX9L 3S24A 2F52A 2LXJA 3T1HQ 1UE1A 3ICEA 2YTVA 4JI8L 4DUZQ 4LUZA 2WFWA 3ERSX 3M3YH 3KLWA 1YJNA 2VQEQ 2Z0SA 1I5FA 4R4QA 2F4VL 3S16H 4UP9A 5LMUL 3E9HA 2IX0A 4JI0Q 1WCMH 3CCLA 2OQ0A 1Q1EA 4PZ7A 4AYBE 5C0XI 3GTMH 4A3GH 1UE6A 2PQAB 5IYBG 2R92G 1VQMA 4HJAA 2UUAL 1C9OA 2YV5A 3RZDH 5FLXc 3RLOA 1N33L 3PF4A 4YHHL 4HJ9A 5LMNQ 4HIMA 3K8AA 2HIXA 1E1TA 1MJCA 3RN5A 4Y52H 1HNWQ 5IYCH 1HNXQ 1VCIA 2CCZA 2JA8G 4A3CH 3CPFA 1X54A 1K0RA 1Q82C 3CCSA 4A3BG 2BA1A 4BBRG 4L5TA 1Q81C 1OXVA 1L1OA 1Q8KA 5FLMG 1X56A 1O7IA 1TWFH 3UDIA 3IRBA 4NPSA 3HOYH 4QGUA 1FL0A 1PH2A 4JV5Q 1GD7A 4A3KH 1LM0A 2CKZB 4YWMA 1V9PA 3TREA 3JC66 3PSIA 3CC7A 5GAHC 1M90C 4A3LG 1X9NA 1CSPA 3G48A 3G71A 1QUQA 4B3SL 2ZJPA 1K9MC 1L2FA 1PH3A 3I4MH 1SR3A 2B63G 4JCVE 4X6AH 3W1BA 1CKNB 1LUZA 2L15A 3M9BA 1KD1C 1YBYA 5IWAL 4A93H 1QVGA 1SRUA 1X3FA 3PCOB 3E0EA 4DAMA 3I2ZA 4GNXC 4BA1I 3PO3G 1K8AC 2Y0SE 3WWVA 2H5XA 4LFBL 1XPOA 2NVXH 3J7A5 1HZCA 4GNXB 1N36Q 2WAQG 1BBWA 4GLVB 1N8RC 2Z6KC 4LW1A 3H15A 4GOPA 4NXMQ 3CCUA 4IFDG 2K50A 4X62L 2Q2HA 4GLAC 4BY1G 2ZM6Q 3T1YQ 1HNXL 4JC0A 4P73A 3CQZH 4B3TL 1SE8A 3CCMA 2I5LX 3TQYA 4DV3L 1VQCA 1Y1WG 4B3ML 4UP8A 4QQBX 4HIKA 4Y7NH 3OYYA 1G291 2Y0SG 3U4ZA 2GVBA 5FLMH 4YCWA 1VQPA 4AIMA 2ZJRA 4JI6L 4LF8L 1GM5A 3HOYG 3KDFA 3AEVA 3A0JA 4A3KG 1AE2A 2UUCL 4DR5Q 2JK8A 1KAWA 2JA5H 4A3IH 3I4NH 5GQOA 2R93H 4WJ4A 1E7ZA 4DAYB 3CCJA 4A3MG 3MEFA 1YHQA 1B7YB 4DV7Q 2ID0A 2WAQE 1Y1VH 3PF5A 1TWCH 1VQHA 2AKWB 3PUYA 1PH1A 1BKBA 2QA4A 3K0XA 4X64L 3I4MG 1S72A 1HZ9A 1YHBA 1P16A 1VQDA 2K75A 2PI2A 5IYBH 4A3JG 3HOWG 3PO2H 2KCMA 3F2BA 5BR8L 1PFSA 4OWXB 2F3IA 2NVQH 4P72A 4QY7A 4DV6L 1N36L 4MZ9A 2UXDL 1D8LA 2JE6I 2MO1A 1PH7A 4DV1Q 3LGJA 1EIFA 1EQRA 1HNZQ 1VQLA 4LNQA 3PUXA 1YNXA 5IE8A 4DV5Q 4QJFA 1VQ4A 4TQUS 4LF9L 2LXKA 3U50C 2E5LL 1XJVA 4LFCQ 1X55A 4X65L 2IT1A 2N8NA 4IPHA 3CAMA 4DR6L 5AJ3L 4A3BH 4JBWA 5HY6A 2VL6A 1JMCA 4LF4Q 4A3FG 3W5OA 1X3EA 2D0OA 4JI1L 5M5YH 4JI3Q 4DR7Q 3HKZE 4JBKA 1VQ6A 4B3RQ 3HOXH 1BVSA 1QVCA 4YY3Q 4DUZL 4IO9A 3CC4A 1FGUA 4L5RC 1YJWA 2OTLA 2JA6G 4JI6Q 5C0XJ 1RL2A 2KBNA 4R4OA 4X66Q 4L5SA 2VUMG 4JI0L 5IP7G 4APVA 4DNIA 4DK6C 4IFDJ 5C4XG 3VDYA 5H1SE 3ER0A 4GOPB 3ULLA 3M4PA 4A3GG 4OX9Q 4KHZA 2NN6G 4H02A 3D0FA 2UUAQ 4LF7Q 2UUBL 2ZTCA 4PMWA 3CF5A 3S1RH 1XMOL 4JBMA 4O0AA 3KF8B 3L0OA 2K5VA 4JI5L 4A3JH 3NEMA 3PO2G 1JJCB 2FXQA 2R7DA 1YITA 2NN6I 1XMQL 1C7YA 1QZHA 2KHIA 5J3BA 2V1CC 5HGQA 4GKKL 2GN5A 4BBSG 5IYCG 4GKJQ 2XTIA 2VNUD 3AFQA 3G6EA 1IBML 2DUDA 3KJOA 2HHHL 1SMXA 3GTJH 3EBEA 4A3CG 3KF6A 2AMCB 2E5LQ 1J5EL 3J80i 2ZJQA 4BBRH 5AJ3Q 4DV0L 4EQ5A 2K52A 2KCTA 1N9WA 4JI1Q 1E24A 1E3PA 3S2HH 1HNWL 1NBWA 3Q8DA 4A3FH 3HKZG 3PUWA 2DGYA 1KHIA 1XTDA 2QGQA 2JEBI 4YCUA 4RMFA 3AYHB 1IBKQ 4POGA 1HH2P 1XNRQ 3HOZG 2EIFA 1VQIA 4IJLA 2KENA 2OQKA 1SN8A 3K80C 4IPDA 2E2IH 5M3MH 5JJLA 1OXSC 3MXNB 1VQOA 1GO3E 4KHPL 4GN5A 1WOCA 4GLXA 4OXPA 3I56A 2EQSA 3CMEA 4HIDA 4A3DH 4A76A 4LFAL 3HOWH 5FJ8H 3GTPH 1YVCA 2A8VA 3PO3H 4BY7G 4DV2Q 4JI5Q 4IFDI 1N34L 4YWKA 1EYGA 2UU9Q 1SLJA 3F1ZA 1YHAA 3DLLA 3OTOQ 3TEHB 4NXNQ 3NELA 3TS2A 2UXBL 3H0GG 2Q2TA 5IYDG 2HIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOC A;  3PIO A;  1PH6 A;  1Z47 A;  2A19 A;  3I7F A;  4IJH A;  4HJ7 A;  5JEA J;  1NTG A;  3U58 A;  4AQY L;  1M1K C;  3UDG A;  1ASY A;  4JI4 L;  1IL2 A;  4BBS H;  1S40 A;  2YYZ A;  1KRS A;  2BH2 A;  1GVP A;  3RN2 A;  4DV0 Q;  4JBJ A;  2WP8 J;  4K0K L;  3KJP A;  3KYH C;  4MNO A;  1HZB A;  5JJK A;  4R4I A;  2YTX A;  2MFI A;  3STB C;  4C3I H;  1PH4 A;  3ZJY C;  4XTC S;  1VQK A;  3G4S A;  3J7Z C;  3GTK H;  1ASZ A;  3F2C A;  2E8G A;  1V1Q A;  2AWO A;  4DR3 Q;  3CXC A;  2NVY H;  1IYJ B;  4DV3 Q;  1IBL L;  1QUQ B;  2R7Z H;  1K3R A;  1IBK L;  3M4O H;  2UXC L;  4A3I G;  3I4N G;  2R93 G;  1IZ6 A;  1QVF A;  1XNR L;  2VUM H;  5IP7 H;  1X3G A;  3T1H L;  1KL9 A;  1W2B A;  1N32 Q;  2RHQ B;  4LF6 L;  1HZA A;  1VQB A;  1YZ6 A;  3L2P A;  4P74 A;  1FJG Q;  3HOV H;  3JAM c;  2IY5 B;  4PG3 A;  4KHP Q;  3BZK A;  1WJJ A;  2XGT A;  5LMU Q;  1L1O B;  4HIO A;  4LFA Q;  2E2H H;  3ULJ A;  3AQQ A;  4JI2 Q;  2YTY A;  3SGI A;  4OO1 I;  1NJI C;  3UE0 A;  5DLQ E;  4RG1 A;  1P8L A;  4ME3 A;  5FJ8 G;  2JA7 G;  4BY7 H;  3CCE A;  1HNZ L;  4BXX H;  1JJ2 A;  3TS0 A;  1XNQ L;  1J6Q A;  1NY4 A;  2CFM A;  4X64 Q;  1EFW A;  3FP9 A;  1CKO A;  3CP0 A;  4DR1 Q;  4ALP A;  3PIP A;  2R7F A;  3KDF B;  3PGZ A;  4IOA A;  2Z6K A;  4OWT B;  2JEA I;  1Y1W H;  1KXL A;  1MJE A;  3H3V I;  4JI7 L;  3F8T A;  4A75 A;  4DV6 Q;  4B3R L;  2B3G A;  3EIV A;  3GTG H;  4K0K Q;  1NMG A;  1JE5 A;  1NE3 A;  1IXR A;  4AYB G;  2ZTD A;  3GTQ H;  4JYA Q;  1FVI A;  3S15 H;  1AE3 A;  2AWN A;  3E9I A;  3CCQ A;  4C3J H;  3S14 H;  1H95 A;  3M7N A;  3F2D A;  4LF9 Q;  4DR3 L;  2R6G A;  2CWA A;  4O2D A;  1IBL Q;  3J81 i;  4LF5 L;  1S3O A;  1YI2 A;  1L1O C;  4A3M H;  1Q86 C;  2WB1 G;  1X65 A;  4JV5 L;  3GO5 A;  2N78 A;  1UE7 A;  4UP7 A;  3HOZ H;  2NZO A;  4LF7 L;  4PZ6 A;  5IP9 G;  5IWA Q;  2VZA A;  4QIW E;  5M3M G;  1Q7Y C;  2NVT H;  5GAG C;  1Q12 A;  4DUY Q;  2VY3 A;  1I94 Q;  1JT8 A;  3GDE A;  3BZC A;  1EQQ A;  4JI2 L;  2HT1 A;  4WJ3 M;  2A1A A;  2R92 H;  2PQA A;  1YEZ A;  1OXX K;  2I0Q A;  2D62 A;  3H3V H;  1MIU A;  4NXM L;  1TWG H;  3RNU A;  1UEB A;  2N3S A;  3HOU G;  2E2J H;  1XNQ Q;  3A5U A;  4LF8 Q;  1TWA H;  2JA7 H;  3I4O A;  4BXX G;  3W1G A;  1J5E Q;  3CW2 C;  4LFB Q;  4GN3 B;  2ATW A;  2K14 A;  3HFZ B;  2KHJ A;  1W3S A;  3BJU A;  5ELN A;  2AHO B;  5E7N A;  2I5M X;  1L0W A;  1CKM A;  3RLN A;  3U4V A;  1OXU A;  4P75 A;  3RR5 A;  1XMQ Q;  4JI8 Q;  4HJ5 A;  2QEX A;  1UWV A;  1K83 H;  3HOX G;  4IPG A;  2BA0 A;  5C44 G;  1K8G A;  4B3T Q;  2JA8 H;  1VQA A;  4DPG A;  2F4V Q;  1VQJ A;  2VQF L;  2HHH Q;  2I5H A;  2MNA A;  2PMZ E;  5ELO A;  3CD6 A;  4GN4 B;  1XPR A;  5C3E G;  2K4K A;  2ASB A;  1I3Q H;  5C4X H;  1CSQ A;  1SFO H;  1RIP A;  2B29 A;  1CKN A;  2Q2I A;  3CMA A;  4FDB A;  1CUK A;  4KLK A;  3B6Y A;  1WFQ A;  4YHH Q;  1WCM G;  3UE1 A;  5GAE C;  5IP9 H;  5LMN L;  4DUY L;  1I94 L;  2UU9 L;  4R4T A;  4YCV A;  2RHS B;  4DV7 L;  3S1Q H;  1PV4 A;  4DK3 C;  4A3E G;  1KQS A;  2IX1 A;  1V43 A;  4C2M H;  2ZTE A;  2D0P A;  3K7U C;  3NEN A;  1DGS A;  4MTN A;  2N49 A;  1UE5 A;  4DKA C;  3JAM i;  1PVO A;  5IYD H;  4DV5 L;  1PH5 A;  4C3H H;  1AH9 A;  4JI4 Q;  1WI5 A;  3PUZ A;  4LFC L;  1WYD A;  4DR6 Q;  1EWI A;  4OON A;  4LF4 L;  1PH8 A;  1VQ5 A;  4JI3 L;  1OXT A;  4PZ8 A;  5M5W H;  3OTO L;  4DR7 L;  3UDX A;  3FKI G;  4DV4 Q;  1A62 A;  3K7A H;  1B70 B;  2OCE A;  5M5X H;  3KF6 B;  4LUO A;  2C35 B;  1EOV A;  2CWP A;  1Z9F A;  2MO0 A;  4B3S Q;  1C0A A;  2VQF Q;  2LSS A;  3TRZ A;  2UXC Q;  4XIG S;  2JA9 A;  4AH6 A;  5IT9 c;  1T9H A;  1GKH A;  2K5H A;  1SRO A;  2MQH A;  3J81 c;  3S17 H;  3D31 A;  4A3L H;  1N32 L;  4YY3 L;  4LF6 Q;  5JEA G;  2HQL A;  2JA5 G;  1EIY B;  4YWL A;  3K81 C;  1VS0 A;  3L7Z C;  5M3F G;  1R9T H;  1XMO Q;  1D7Q A;  3S1M H;  4A3D G;  1HR0 Q;  4GS3 A;  1Y1V G;  1LYL A;  4DR4 Q;  4X62 Q;  4IPC A;  2ZM6 L;  3NBH B;  1QZG A;  1A63 A;  2UUB Q;  1A8V A;  4DR1 L;  4A3E H;  3H0G H;  2OWO A;  2R7Z G;  4GKK Q;  3J81 j;  4BA2 I;  4GKJ L;  1A0I A;  1FJG L;  4B3M Q;  5K36 G;  3HOU H;  5JJI A;  4DR2 Q;  2Q2U A;  1G51 A;  1TXY A;  2VW9 A;  3BU2 A;  4QL5 A;  3KOJ A;  4BY1 H;  2PI2 E;  1OTC A;  1Q1B A;  3PV0 A;  5GAD C;  4P71 A;  4GOP C;  4DV4 L;  1IBM Q;  3M4Q A;  3GTO H;  3T1Y L;  3UDF A;  1VQ9 A;  2ES2 A;  1BBU A;  4TVA B;  3FKI H;  2WB1 E;  1X6O A;  4LF5 Q;  1MKH A;  5EAY A;  1PH9 A;  4J15 A;  1PHJ A;  3A5Z B;  1KIX A;  1KC8 C;  3RZO H;  4R4C A;  4OWW B;  4JI7 Q;  3GD7 A;  4L5Q A;  1K73 C;  3EN2 A;  1HJP A;  4LUV A;  5C3E H;  3S2D H;  4JOI A;  2JA6 H;  4OO1 G;  5IY0 A;  2NZH A;  2VQE L;  4JYA L;  2RF4 A;  3HOV G;  5BR8 Q;  1U5K A;  2CQO A;  1JB7 A;  1B8A A;  2B63 H;  1VQ7 A;  2ALY B;  2UUC Q;  4DR5 L;  1Y14 B;  5GRO A;  3CPW A;  1JJG A;  1VQN A;  1VQ8 A;  1VQF A;  1PYB A;  4GNX A;  1HR0 L;  3DM3 A;  4R1J A;  5M3F H;  4UPA A;  3KFU A;  4A93 G;  4JOI C;  3CCV A;  4EX5 A;  4DV1 L;  2VS1 A;  2EXD A;  4NB3 A;  4DR4 L;  1Q46 A;  5C4J H;  2GVA A;  1VQE A;  4POF A;  3ULP A;  2UXB Q;  1KRT A;  2YU9 H;  1LTL A;  2IHF A;  4X65 Q;  1YJ9 A;  3GTL H;  1VQG A;  3HKS A;  1N33 Q;  1I50 H;  3S1N H;  1I6H H;  1TWH H;  4DV2 L;  4DR2 L;  1N34 Q;  3RLF A;  5C0X G;  1U0L A;  4NXN L;  3J80 c;  3A74 A;  4A4I A;  1YIJ A;  3CC2 A;  2JJQ A;  2OTJ A;  4HJ8 A;  3AFP A;  3PUV A;  3M85 A;  3CCR A;  2IHE A;  2PNH A;  2UXD Q;  4UY8 C;  4KI0 A;  4LWC A;  3I55 A;  5LMN W;  1E1O A;  4X66 L;  2BH8 A;  5C44 H;  1G6P A;  1E22 A;  1NMF A;  2RCN A;  4AQY Q;  3FHW A;  1EUJ A;  2JQO A;  3STB D;  4JG2 A;  3OW2 A;  1PA6 A;  1XPU A;  1HR0 W;  1PYS B;  2K5N A;  4OX9 L;  3S24 A;  2F52 A;  2LXJ A;  3T1H Q;  1UE1 A;  3ICE A;  2YTV A;  4JI8 L;  4DUZ Q;  4LUZ A;  2WFW A;  3ERS X;  3M3Y H;  3KLW A;  1YJN A;  2VQE Q;  2Z0S A;  1I5F A;  4R4Q A;  2F4V L;  3S16 H;  4UP9 A;  5LMU L;  3E9H A;  2IX0 A;  4JI0 Q;  1WCM H;  3CCL A;  2OQ0 A;  1Q1E A;  4PZ7 A;  4AYB E;  5C0X I;  3GTM H;  4A3G H;  1UE6 A;  2PQA B;  5IYB G;  2R92 G;  1VQM A;  4HJA A;  2UUA L;  1C9O A;  2YV5 A;  3RZD H;  5FLX c;  3RLO A;  1N33 L;  3PF4 A;  4YHH L;  4HJ9 A;  5LMN Q;  4HIM A;  3K8A A;  2HIX A;  1E1T A;  1MJC A;  3RN5 A;  4Y52 H;  1HNW Q;  5IYC H;  1HNX Q;  1VCI A;  2CCZ A;  2JA8 G;  4A3C H;  3CPF A;  1X54 A;  1K0R A;  1Q82 C;  3CCS A;  4A3B G;  2BA1 A;  4BBR G;  4L5T A;  1Q81 C;  1OXV A;  1L1O A;  1Q8K A;  5FLM G;  1X56 A;  1O7I A;  1TWF H;  3UDI A;  3IRB A;  4NPS A;  3HOY H;  4QGU A;  1FL0 A;  1PH2 A;  4JV5 Q;  1GD7 A;  4A3K H;  1LM0 A;  2CKZ B;  4YWM A;  1V9P A;  3TRE A;  3JC6 6;  3PSI A;  3CC7 A;  5GAH C;  1M90 C;  4A3L G;  1X9N A;  1CSP A;  3G48 A;  3G71 A;  1QUQ A;  4B3S L;  2ZJP A;  1K9M C;  1L2F A;  1PH3 A;  3I4M H;  1SR3 A;  2B63 G;  4JCV E;  4X6A H;  3W1B A;  1CKN B;  1LUZ A;  2L15 A;  3M9B A;  1KD1 C;  1YBY A;  5IWA L;  4A93 H;  1QVG A;  1SRU A;  1X3F A;  3PCO B;  3E0E A;  4DAM A;  3I2Z A;  4GNX C;  4BA1 I;  3PO3 G;  1K8A C;  2Y0S E;  3WWV A;  2H5X A;  4LFB L;  1XPO A;  2NVX H;  3J7A 5;  1HZC A;  4GNX B;  1N36 Q;  2WAQ G;  1BBW A;  4GLV B;  1N8R C;  2Z6K C;  4LW1 A;  3H15 A;  4GOP A;  4NXM Q;  3CCU A;  4IFD G;  2K50 A;  4X62 L;  2Q2H A;  4GLA C;  4BY1 G;  2ZM6 Q;  3T1Y Q;  1HNX L;  4JC0 A;  4P73 A;  3CQZ H;  4B3T L;  1SE8 A;  3CCM A;  2I5L X;  3TQY A;  4DV3 L;  1VQC A;  1Y1W G;  4B3M L;  4UP8 A;  4QQB X;  4HIK A;  4Y7N H;  3OYY A;  1G29 1;  2Y0S G;  3U4Z A;  2GVB A;  5FLM H;  4YCW A;  1VQP A;  4AIM A;  2ZJR A;  4JI6 L;  4LF8 L;  1GM5 A;  3HOY G;  3KDF A;  3AEV A;  3A0J A;  4A3K G;  1AE2 A;  2UUC L;  4DR5 Q;  2JK8 A;  1KAW A;  2JA5 H;  4A3I H;  3I4N H;  5GQO A;  2R93 H;  4WJ4 A;  1E7Z A;  4DAY B;  3CCJ A;  4A3M G;  3MEF A;  1YHQ A;  1B7Y B;  4DV7 Q;  2ID0 A;  2WAQ E;  1Y1V H;  3PF5 A;  1TWC H;  1VQH A;  2AKW B;  3PUY A;  1PH1 A;  1BKB A;  2QA4 A;  3K0X A;  4X64 L;  3I4M G;  1S72 A;  1HZ9 A;  1YHB A;  1P16 A;  1VQD A;  2K75 A;  2PI2 A;  5IYB H;  4A3J G;  3HOW G;  3PO2 H;  2KCM A;  3F2B A;  5BR8 L;  1PFS A;  4OWX B;  2F3I A;  2NVQ H;  4P72 A;  4QY7 A;  4DV6 L;  1N36 L;  4MZ9 A;  2UXD L;  1D8L A;  2JE6 I;  2MO1 A;  1PH7 A;  4DV1 Q;  3LGJ A;  1EIF A;  1EQR A;  1HNZ Q;  1VQL A;  4LNQ A;  3PUX A;  1YNX A;  5IE8 A;  4DV5 Q;  4QJF A;  1VQ4 A;  4TQU S;  4LF9 L;  2LXK A;  3U50 C;  2E5L L;  1XJV A;  4LFC Q;  1X55 A;  4X65 L;  2IT1 A;  2N8N A;  4IPH A;  3CAM A;  4DR6 L;  5AJ3 L;  4A3B H;  4JBW A;  5HY6 A;  2VL6 A;  1JMC A;  4LF4 Q;  4A3F G;  3W5O A;  1X3E A;  2D0O A;  4JI1 L;  5M5Y H;  4JI3 Q;  4DR7 Q;  3HKZ E;  4JBK A;  1VQ6 A;  4B3R Q;  3HOX H;  1BVS A;  1QVC A;  4YY3 Q;  4DUZ L;  4IO9 A;  3CC4 A;  1FGU A;  4L5R C;  1YJW A;  2OTL A;  2JA6 G;  4JI6 Q;  5C0X J;  1RL2 A;  2KBN A;  4R4O A;  4X66 Q;  4L5S A;  2VUM G;  4JI0 L;  5IP7 G;  4APV A;  4DNI A;  4DK6 C;  4IFD J;  5C4X G;  3VDY A;  5H1S E;  3ER0 A;  4GOP B;  3ULL A;  3M4P A;  4A3G G;  4OX9 Q;  4KHZ A;  2NN6 G;  4H02 A;  3D0F A;  2UUA Q;  4LF7 Q;  2UUB L;  2ZTC A;  4PMW A;  3CF5 A;  3S1R H;  1XMO L;  4JBM A;  4O0A A;  3KF8 B;  3L0O A;  2K5V A;  4JI5 L;  4A3J H;  3NEM A;  3PO2 G;  1JJC B;  2FXQ A;  2R7D A;  1YIT A;  2NN6 I;  1XMQ L;  1C7Y A;  1QZH A;  2KHI A;  5J3B A;  2V1C C;  5HGQ A;  4GKK L;  2GN5 A;  4BBS G;  5IYC G;  4GKJ Q;  2XTI A;  2VNU D;  3AFQ A;  3G6E A;  1IBM L;  2DUD A;  3KJO A;  2HHH L;  1SMX A;  3GTJ H;  3EBE A;  4A3C G;  3KF6 A;  2AMC B;  2E5L Q;  1J5E L;  3J80 i;  2ZJQ A;  4BBR H;  5AJ3 Q;  4DV0 L;  4EQ5 A;  2K52 A;  2KCT A;  1N9W A;  4JI1 Q;  1E24 A;  1E3P A;  3S2H H;  1HNW L;  1NBW A;  3Q8D A;  4A3F H;  3HKZ G;  3PUW A;  2DGY A;  1KHI A;  1XTD A;  2QGQ A;  2JEB I;  4YCU A;  4RMF A;  3AYH B;  1IBK Q;  4POG A;  1HH2 P;  1XNR Q;  3HOZ G;  2EIF A;  1VQI A;  4IJL A;  2KEN A;  2OQK A;  1SN8 A;  3K80 C;  4IPD A;  2E2I H;  5M3M H;  5JJL A;  1OXS C;  3MXN B;  1VQO A;  1GO3 E;  4KHP L;  4GN5 A;  1WOC A;  4GLX A;  4OXP A;  3I56 A;  2EQS A;  3CME A;  4HID A;  4A3D H;  4A76 A;  4LFA L;  3HOW H;  5FJ8 H;  3GTP H;  1YVC A;  2A8V A;  3PO3 H;  4BY7 G;  4DV2 Q;  4JI5 Q;  4IFD I;  1N34 L;  4YWK A;  1EYG A;  2UU9 Q;  1SLJ A;  3F1Z A;  1YHA A;  3DLL A;  3OTO Q;  3TEH B;  4NXN Q;  3NEL A;  3TS2 A;  2UXB L;  3H0G G;  2Q2T A;  5IYD G;  2HIV A; 
#chains in the Genus database with same CATH topology
 3SR1 A;  4P2C B;  1ASZ A;  1EY7 A;  4CDE C;  4HJ7 A;  2F0K A;  5IGD A;  1EOT A;  5EBD A;  1GVP A;  3PIP 3;  4K0K L;  2WP8 J;  3KYH C;  4MNO A;  5JJK A;  4R4I A;  2MFI A;  3STB C;  3QR8 A;  1PH4 A;  5CBA E;  3ZJY C;  1LTT D;  2AWO A;  4UHV A;  1AZP A;  3CXC A;  1IBL L;  4DV3 Q;  3M4O H;  1IBK L;  2UXC L;  1QVF A;  5IP7 H;  2JA5 B;  1H9J A;  1HPC A;  4KK7 A;  2RHQ B;  4LF6 L;  1VQB A;  3KK7 A;  2AQ1 B;  1L1O B;  1KTK A;  4K5V A;  3ULJ A;  3SGI A;  2JA7 G;  2D5D A;  5FJ8 G;  4DFA A;  3DM1 A;  3HS0 C;  4OIK A;  4X64 Q;  3SEB A;  3FP9 A;  2F3V A;  3CP0 A;  4DR1 Q;  4NDX A;  1NNX A;  2R7F A;  3KDF B;  1NAP A;  1RJT A;  4XT3 B;  1MJE A;  3H3V I;  1KAB A;  4ZUJ A;  1DZ1 A;  1J8I A;  1K28 A;  4K0K Q;  3H91 A;  1GXD C;  1NE3 A;  3NUC A;  1IXR A;  3GTQ H;  3S15 H;  3ND9 A;  3M7N A;  3F2D A;  4LF9 Q;  2A5H A;  1SMY D;  4DR3 L;  4O2D A;  1IBL Q;  1TS5 A;  2M2L A;  2PCF B;  4A3M H;  2R3Z A;  1Q86 C;  2IW3 A;  2K04 A;  1SYE A;  4UP7 A;  5IWA Q;  1IL8 A;  5D3D A;  4CKE A;  1Q12 A;  1DXM A;  4ZYS A;  1I94 Q;  3M7G A;  1HXY D;  1JOR A;  1B1Z A;  4JI2 L;  3EVQ A;  1SYD A;  2F0S A;  5CMD A;  1YEZ A;  1OXX K;  3NWS A;  1D1I A;  1UEB A;  1AP0 A;  3SE0 A;  1QCB D;  1B3Q A;  4BXX G;  2K14 A;  4HMI A;  2DNE A;  1OXU A;  1WTX A;  2QEX A;  2BA0 A;  2QKI C;  2PNR C;  5ELF A;  1KAA A;  1E2V A;  5ELO A;  4GN4 B;  1XPR A;  5M3F B;  2I07 B;  2KA7 A;  1CSQ A;  4H44 C;  4DK0 A;  1SFO H;  2DJF C;  1SYB A;  4CDD C;  1GHJ A;  4KKS A;  3S1N B;  1I94 L;  2UU9 L;  2EY2 A;  2RHS B;  4DV7 L;  3S1Q H;  4DK3 C;  1EU3 A;  2IX1 A;  1V43 A;  4A3J B;  1O7Y A;  5DEH A;  2D0P A;  2QDL A;  1EY8 A;  1QG7 A;  1E2Z A;  4MTN A;  4DKA C;  5IYD H;  4DV5 L;  4IUV A;  2Z6B A;  3FVQ A;  1WI5 A;  4ZRZ A;  5CV8 A;  5I6Y A;  1BO0 A;  1K3B C;  4BBR B;  1PRT D;  1PH8 A;  4JI3 L;  5M5W H;  4DR7 L;  3UDX A;  4DV4 Q;  1A62 A;  1T5E A;  4X3K A;  1SE4 A;  4JVZ A;  5M5W B;  2C35 B;  1C0A A;  1Z9F A;  4RCO A;  1CT1 D;  2LSS A;  1BOS A;  2JA9 A;  1T9H A;  1LLR D;  3J81 c;  5BN5 A;  2XNA C;  1XXG A;  2HQL A;  1F77 A;  5L37 A;  1VS0 A;  1R9T H;  1RKN A;  2R93 B;  2KOL A;  4GS3 A;  1I6V C;  1Y1V G;  5KIX A;  3JAM E;  5J39 A;  4DK1 A;  4QMG A;  2ZM6 L;  2F0E A;  4A3E H;  3T16 A;  2OWO A;  4GKK Q;  4BA2 I;  2PW5 A;  1A0I A;  3BZD B;  1BNZ A;  5K36 G;  4I7A A;  4U67 3;  4HSP A;  1G51 A;  1B9M A;  2H1E A;  2E74 C;  4BY1 H;  1OTC A;  3PV0 A;  4GOP C;  3BDL A;  1D5Z C;  4DV4 L;  3T1Y L;  1BBU A;  1UAP A;  2WB1 E;  3NSW A;  5EAY A;  3AMU A;  1KIX A;  1S5B D;  1KC8 C;  3RZO H;  1K73 C;  1JWS D;  1LV9 A;  4HR7 B;  3A8K E;  5C3E H;  1O7Z A;  2F0U A;  5JVH 3;  2ALY B;  2RKS A;  4GNX A;  1PYB A;  2IL8 A;  5M3F H;  1HQR D;  1H9M A;  1YNN C;  2XRQ D;  5CV6 A;  4EX5 A;  3CCV A;  1TQO A;  4PMC A;  5IOC A;  5C4J H;  4TRD A;  4J8Q A;  1LTL A;  2RDF A;  1QWY A;  2DJG C;  1TWH H;  4DV2 L;  3RLF A;  4ZKB B;  2OTJ A;  3D4D A;  5C4Z A;  3MVV A;  1BXT A;  2IHE A;  2PNH A;  1DOK A;  3BYY B;  3X3M A;  1A2U A;  1ET6 A;  1A3V A;  5ISR A;  4ZLT F;  3E5S A;  5KYL A;  1UE1 A;  4DUZ Q;  3ERS X;  3M3Y H;  2VQE Q;  1ET9 A;  2F0T A;  5LMU L;  3E9H A;  3QG1 A;  3CCL A;  3SK6 A;  4A3G H;  1EZ6 A;  1UE6 A;  4XYO A;  2J0T D;  2R92 G;  1EY0 A;  4HJA A;  4ZCK A;  3NQI A;  2F0W A;  4R8I A;  5FLX c;  2E2J B;  3PF4 A;  3GP7 A;  4HIM A;  5K36 H;  3SHL A;  4LAA A;  5KGU A;  1F9P A;  4Y52 H;  2A74 C;  2JA8 G;  2JXM B;  2ICE C;  1Q82 C;  3CCS A;  2BA1 A;  1HRJ A;  1L1O A;  2NWG A;  5FLM G;  2EYL A;  3UDI A;  3FEW X;  3HOY H;  4QGU A;  4A3K H;  4YWM A;  2HUG A;  4F7X A;  3PSI A;  3GTK B;  1V1O A;  2B39 A;  1CSP A;  2PMZ B;  2PZW A;  3BYT B;  5FKA C;  1QUQ A;  2ZJP A;  3AU7 A;  1L2F A;  1NR4 A;  1UEA B;  3MXG A;  5T1G A;  4DAV A;  1PZK D;  3M9B A;  2DN8 A;  2B2V C;  1SRU A;  3GQB A;  4GNX C;  1K8A C;  2H5X A;  1R4Q B;  2JSO A;  2K7V A;  1HZC A;  1N36 Q;  3E6Z X;  3HRZ C;  4GLV B;  3A8I E;  1LAC A;  3TP8 A;  3DXJ C;  4HTH A;  5AFW A;  2F3W A;  1Q8I A;  4JC0 A;  5EKL A;  1SE8 A;  3TP7 A;  5I9P A;  1GUN A;  4L8J A;  4Z9C B;  1VQC A;  3MZ5 A;  3I70 A;  4I65 A;  4CBV A;  1NSN S;  1F9Q A;  1G29 1;  3NP8 A;  5M3M B;  2OXP A;  4CKC A;  5IGG A;  1IKL A;  4A3K G;  1AE2 A;  4DR5 Q;  4NKL A;  2OEO A;  4A3I H;  3I4N H;  1E7Z A;  4DAY B;  2AUJ D;  1G2T A;  2ID0 A;  1PH1 A;  2AKW B;  5J1Z A;  4UDU C;  1HZ9 A;  2MUY A;  3PO2 H;  2EYO A;  2EY6 A;  5IYB H;  3WOF A;  3F2B A;  4BY7 B;  2SNM A;  3OWE B;  4OWX B;  3NWT A;  4DV6 L;  3TP6 A;  1N36 L;  1SND A;  2BDO A;  1D8L A;  2JE6 I;  2A6H C;  4NMZ A;  5E1F A;  3PUX A;  2CHB D;  3S15 B;  1MI2 A;  2ZXR A;  1CZG A;  4F8M A;  3VA7 A;  1XJV A;  2IT1 A;  2N8N A;  2E5L L;  3CAM A;  5AJ3 L;  4O1N A;  3SXH A;  1C4Q A;  1RHP A;  5JVG 3;  1CQV A;  3W5O A;  4L5R C;  2SDF A;  4R4O A;  2Z4H A;  2L55 A;  4RA8 A;  3A55 A;  4APV A;  3MXP A;  1XWE A;  1I4X A;  4X3T A;  5KEE A;  4E6I A;  2B2T C;  2A69 D;  2MHV A;  2UUA Q;  4H02 A;  4OX9 Q;  4PMW A;  1PTO C;  2X69 A;  4JBM A;  1EIG A;  3KF8 B;  3L0O A;  4KV6 A;  3RUZ A;  2K5V A;  1JJC B;  4M8A A;  2R7D A;  3FMC A;  1YIT A;  3HGB A;  1G8Z D;  3NPP A;  1XMQ L;  3D8G A;  1C7Y A;  3TZU A;  4GKK L;  2GN5 A;  4BBS G;  1HFG A;  3AFQ A;  3G6E A;  3KJO A;  4A3C G;  2AMC B;  4HMJ A;  1WTR A;  2KCT A;  3VYT A;  4JI1 Q;  1E24 A;  3DWP A;  3ZYY X;  1E3P A;  1NBW A;  4A3F H;  4OEL B;  2EPB A;  1KHI A;  3M3Y B;  1FR3 A;  3TZD A;  1FYC A;  3AYH B;  5DM7 3;  1HH2 P;  1SMY C;  2N88 A;  4IJL A;  1EIH A;  3K80 C;  3I4M B;  2EQS A;  3CME A;  2A6H D;  4PMB A;  4IFD I;  3TBI B;  1YVC A;  1SNQ A;  2G5D A;  1SEB D;  1N34 L;  4DF7 A;  2UU9 Q;  1YHA A;  2BE5 C;  3OTO Q;  1F9S A;  3P1H A;  4A3D B;  1CA5 A;  4H7B A;  5D14 A;  2UXB L;  2Q2T A;  5IYD G;  4CKB A;  3PIO A;  1Z47 A;  3OPO A;  4IJH A;  3U58 A;  4JI4 L;  2EJG C;  3UDG A;  4RWS C;  2YYZ A;  1KRS A;  2BH2 A;  4KD3 A;  3RN2 A;  1EYA A;  3OHX C;  1HZB A;  2YTX A;  1LT5 D;  3GTK H;  5LL6 X;  4CJ2 C;  1V1Q A;  2NVY H;  1GUO A;  1S5C D;  1JB3 A;  1K3R A;  4KY6 A;  2JP1 A;  2R93 G;  1CI3 M;  2WIN B;  1O7L A;  1PFM A;  2A68 C;  4B9W A;  1N32 Q;  1HZA A;  1YZ6 A;  3L2P A;  3HOV H;  1FJG Q;  2NTS A;  1IW7 D;  4M1U B;  5NUC A;  5LMU Q;  4HIO A;  3HOV B;  3AQQ A;  3PO2 B;  4OO1 I;  4FXK C;  3UE0 A;  5DLQ E;  4BY7 H;  3CCE A;  1TS4 A;  3TS0 A;  1XNQ L;  2NBF A;  1EFW A;  1PRT C;  2F0L A;  1A3U A;  4ALP A;  3DEO A;  3PGZ A;  4L6T B;  2Z6K A;  4OWT B;  4X3U A;  1Y1W H;  1MD2 D;  2X6L A;  4A75 A;  2K5D A;  4TSS A;  2EDG A;  4IZ8 A;  4AYB G;  2ZTD A;  3R93 A;  1FVI A;  4JYA Q;  1SAP A;  4C3J H;  3S14 H;  2R6G A;  3P20 A;  3J81 i;  3MFY A;  1S3O A;  1AN8 A;  5COR A;  4JV5 L;  3GO5 A;  2L12 A;  1UE7 A;  4PZ6 A;  2DNC A;  3W2D A;  2VZA A;  4QIW E;  5M3M G;  4A3G B;  4DUY Q;  4G7Z C;  3DWA A;  1JT8 A;  2EYJ A;  1FGB D;  4BWG B;  3NBH A;  2D62 A;  1MIU A;  4NXM L;  3RNU A;  2E2J H;  1STA A;  1LTI D;  4QUF A;  4GN3 B;  2KHJ A;  2F0F A;  3RZO B;  2AHO B;  4C3H B;  5E7N A;  3RLN A;  1CKM A;  2KJX A;  3U4V A;  2QIL A;  3RR5 A;  4IPG A;  5C44 G;  1VQA A;  1A2T A;  1VQJ A;  2KHS A;  2VQF L;  2HHH Q;  3ONA B;  3P7J A;  1TKW B;  4A3K B;  2PMZ E;  2TMP A;  5CV7 A;  5EPJ A;  1GHK A;  1RIP A;  3RMH A;  2B29 A;  1KDC A;  4FDB A;  1CUK A;  2B2T A;  4YHH Q;  4ABN A;  4DUY L;  4R4T A;  1M8A A;  3TDQ A;  2ZTE A;  1DGS A;  2N49 A;  1UE5 A;  1PVO A;  3JAM i;  3T13 A;  4MTK A;  1WYD A;  4K8J A;  3T56 B;  2RA4 A;  4OON A;  1NCV A;  1DD2 A;  1ML0 D;  1VQ5 A;  3HOY B;  4PZ8 A;  3Q22 A;  4HN7 A;  1EEF D;  5C4H A;  4LUO A;  4BY1 B;  1EOV A;  2MO0 A;  3BG3 A;  3TRZ A;  1ONL A;  1PZJ D;  1RDP D;  2MQH A;  1ESF A;  3S17 H;  2CW0 D;  5EQ0 A;  2KEE A;  5KRU A;  1IHZ A;  1HHV A;  4YWL A;  4RHR A;  1D7Q A;  1Y1V B;  4HED A;  1IW7 C;  1HFN A;  1CFM A;  5JOB A;  1JOQ A;  2NTT A;  1LYL A;  1R9T B;  4IPC A;  1D2B A;  3NBH B;  1A63 A;  1S5F D;  2IWH A;  4DR2 Q;  4A3E B;  1HA5 A;  2Q2U A;  3K7A B;  4K6D A;  1TXY A;  2VW9 A;  4QL5 A;  4JK1 C;  4P71 A;  1IBM Q;  2ES2 A;  1AEX A;  3KBX A;  3FKI H;  1EQT A;  3A5Z B;  3JAM L;  1WD0 A;  2R61 A;  4R4C A;  4JI7 Q;  3GD7 A;  5IT9 L;  3EN2 A;  1YNJ C;  2CH4 W;  3HOV G;  5BR8 Q;  1LT6 D;  4K6L A;  2UUC Q;  5JAV A;  1Y14 B;  4L63 B;  4DR5 L;  1J9O A;  5EPL A;  2A6E C;  4K5X A;  3DM3 A;  3BS1 A;  4G57 A;  1EWC A;  1DYQ A;  4RKL A;  4POF A;  2UXB Q;  1UNS A;  1CHP D;  5BN4 A;  1S4Z A;  1YJ9 A;  1JCK B;  3S9W A;  3HKS A;  1I50 H;  2MPM A;  4DR2 L;  1N34 Q;  3A54 A;  3FDT A;  3J80 c;  1VMC A;  1LTR D;  3AFP A;  1TWG B;  2UXD Q;  1CK1 A;  3HEJ A;  1BCP F;  1KDB A;  4X66 L;  3OSO A;  1G6P A;  1NMF A;  3LX0 A;  3FHW A;  4V0B A;  2KCC A;  2JQO A;  1LTA D;  1JWM D;  1PA6 A;  2K5N A;  1G6Z A;  2F52 A;  3T1H Q;  1BQQ T;  1IKM A;  1JQY D;  2DY7 A;  3ITP A;  2F4V L;  2NUC A;  1WD1 A;  1AW7 A;  4PZ7 A;  4AYB E;  3RZD B;  2NZ1 D;  4XT1 B;  2PQA B;  2Z8L A;  3VR5 A;  1ESR A;  2UUA L;  2KQ3 A;  2YV5 A;  5KND A;  3RZD H;  4R8N A;  2ZXP A;  4C3H G;  5LMN Q;  4IUU A;  1PRT F;  3RN5 A;  5DAU A;  3K6O A;  4XYQ A;  1HNW Q;  1ENC A;  3I4L A;  5EJW A;  1X54 A;  1K0R A;  1WTO A;  4L5T A;  1TY0 A;  3J81 E;  1Q81 C;  4XQN A;  3J7A F;  1IYU A;  4ZQ3 A;  5CGK A;  4DA2 A;  3CKI B;  4JV5 Q;  2TSS A;  2CKZ B;  3MFG A;  4EQN A;  4C3I G;  4C3I B;  1H9K A;  3DMU A;  1M90 C;  5FK9 C;  4A3L G;  1X9N A;  1HCZ A;  4K2K A;  2C9O A;  3MHB A;  4LK1 C;  4ZK9 B;  1K9M C;  1PH3 A;  1SR3 A;  2B63 G;  2VUM B;  1Z6H A;  1KD1 C;  1QVG A;  2HCI A;  1X3F A;  3PCO B;  2PQE A;  5D65 A;  4DAM A;  3I2Z A;  3PO3 G;  2Y0S E;  5C6A A;  3WWV A;  3J7A 5;  2R7Z B;  2AUK A;  4OEM B;  1N8R C;  2Z6K C;  4LW1 A;  3H15 A;  3H09 A;  4NXM Q;  3CCU A;  2K50 A;  2ZM6 Q;  4BY1 G;  4GLA C;  4A3F B;  5FO8 B;  3SK5 A;  2EZV A;  3CQZ H;  5EBC A;  1STE A;  4DV3 L;  1Y1W G;  5IOD A;  1JWU D;  4UP8 A;  4QQB X;  1RF2 D;  3OYY A;  2K33 A;  2GVB A;  1LTS D;  4AIM A;  1SSO A;  5C3E B;  2VB3 X;  3OIQ A;  1GM5 A;  3KDF A;  2F1M A;  1KAW A;  4FF2 A;  2R93 H;  3CCJ A;  4WFN 3;  1YHQ A;  1EYD A;  1Y1V H;  3PUY A;  5HGT A;  1WTP A;  2EYF A;  3K0X A;  1PYW D;  3Q24 A;  3I4M G;  1S72 A;  1P16 A;  2LS0 1;  4NP5 A;  2O5I C;  1R4P B;  1QJO A;  4DAY A;  4DNR B;  2NVQ H;  4QY7 A;  1Y1W B;  3S1R B;  1EY4 A;  4MZ9 A;  4DV1 Q;  1TVX A;  4LNQ A;  5IE8 A;  4QUC A;  4K2L A;  1FD7 D;  3T51 B;  4DR6 L;  1X55 A;  4X65 L;  3VYS A;  4A3B H;  4JBW A;  5HY6 A;  1JMC A;  4A3F G;  4A3M B;  3CU7 A;  3HOX H;  1MBY A;  4F88 A;  1QVC A;  4YY3 Q;  4C3J G;  3CC4 A;  3V2T A;  2JA6 G;  1E0B A;  2VUM G;  4LJZ C;  2OF1 A;  1CTM A;  5IP7 G;  1TR5 A;  3VDY A;  3ULL A;  3C1F A;  4KHZ A;  4EQO A;  1XTC D;  2ZTC A;  3C3L A;  1JIC A;  1PZI D;  1U4R A;  3NQT A;  4JI5 L;  3PO2 G;  3NEM A;  1WCM B;  2FXQ A;  1AFP A;  4KKT A;  3DHQ A;  3R8B A;  2NN6 I;  3L9A X;  3KLS A;  2V1C C;  4DNT B;  4RKB A;  3KF8 A;  3K5M A;  1IBM L;  3VA5 A;  1SMX A;  3J81 L;  3KF6 A;  2E5L Q;  5EGT A;  5AJ3 Q;  2ZXO A;  4DV0 L;  4EQ5 A;  4KD4 A;  2F0N A;  3PQI A;  4DXF A;  1HUN A;  5CBE E;  4DU9 A;  3Q8D A;  1SFO B;  3WOE A;  3PUW A;  2DGY A;  1XTD A;  2QGQ A;  4YCU A;  2EJF C;  5IGB A;  3L3O C;  1SDF A;  1XNR Q;  5JPM C;  2FMM A;  3HOZ G;  1L0Y B;  2J4X A;  1VQI A;  2R92 B;  3VR3 A;  2A73 B;  2WKC A;  4K5W A;  2EY5 A;  1GO3 E;  4F87 A;  2JA7 B;  2KCN A;  4OXP A;  1BF4 A;  4LFA L;  3HOW H;  3PO3 H;  1SLJ A;  4K8I A;  3F1Z A;  3H0G B;  1GUT A;  4NXN Q;  3PO3 B;  3NEL A;  1W6J A;  4IAL A;  4QF4 A;  2R7Z H;  1DJR D;  5E3F A;  1G2S A;  1PH6 A;  3PMF A;  5I2Y A;  5I4D A;  5JEA J;  1JOK A;  1NTG A;  3PIO 3;  4AQY L;  1ASY A;  4BBS H;  1KXL A;  1S40 A;  4DV0 Q;  1PRT B;  3IFT A;  1PTO H;  2F0I A;  3LWU A;  2F0V A;  4C3I H;  1VQK A;  3G4S A;  2E8G A;  4C1N K;  2Q8I B;  3K5L A;  2LMC B;  2O2L D;  4A3B B;  4A3I G;  3I4N G;  5LL6 S;  1XNR L;  3IL8 A;  1PXU A;  3T1H L;  2E2H B;  3JAM c;  3BZK A;  4CJ0 B;  1HUM A;  3Q23 A;  4N9P A;  4LFA Q;  2E2H H;  4FNF A;  3C46 A;  4FP5 D;  5FO7 B;  1J6Q A;  1NY4 A;  3VR6 A;  1F2M A;  1STG A;  1TII D;  1YNJ D;  2JEA I;  1ZEQ X;  4ZAI A;  1H9S B;  3F8T A;  2RQX A;  4B3R L;  2B3G A;  2L5T A;  3S17 B;  2JN4 A;  3UI2 A;  5M5Y B;  2A6E D;  1JE5 A;  1NMG A;  1Y69 U;  1DON A;  1AE3 A;  3CCQ A;  3GV3 A;  1H95 A;  3C2P A;  4S3S A;  3TME A;  2B2Y C;  1QIL A;  3QWN A;  2WB1 G;  3C1E A;  1X65 A;  5HUR A;  5TSS A;  2B2V A;  4I7Z C;  4OO1 H;  4LF7 L;  3NTH A;  2F0J A;  5C4J B;  2B2Y A;  3O13 A;  5GAG C;  2VY3 A;  4WRD A;  3GDE A;  3MA2 B;  1EQQ A;  3VYU A;  1A6X A;  5I6W A;  2R92 H;  2I0Q A;  2D9U A;  2NVQ B;  1WTH A;  1EY5 A;  5JJZ A;  2N3S A;  2N55 A;  1XNQ Q;  3HOU G;  4LF8 Q;  1TWA H;  2JA7 H;  1X3P A;  2LFN A;  3I4O A;  3Q0A A;  1J5E Q;  4GZY C;  4FO2 A;  4G7H C;  4IUN A;  1TWA B;  1BUV T;  3BJU A;  5ELN A;  1QZH A;  2O4X A;  4JI8 Q;  4HJ5 A;  4KTA A;  1K83 H;  2FIN B;  4O42 A;  1JC7 A;  2WII B;  4DPG A;  2G9H D;  1XYI A;  3R3O A;  2H4O A;  2MNA A;  2CW0 C;  2K4K A;  2ASB A;  1I3Q H;  5C4X H;  3EA6 A;  2Q2I A;  1I3Q B;  5JPN C;  1I50 B;  5IP9 H;  3QO2 A;  1KQS A;  4IUR A;  3SVM A;  1SE2 A;  3HOW B;  4Q0F A;  1C8C A;  3NEN A;  4B08 A;  1AZQ A;  1AH9 A;  1MHW C;  1JR0 D;  3PUZ A;  4DR6 Q;  1EWI A;  1Y8P B;  1F2L A;  3OTO L;  3FKI G;  1B70 B;  3KF6 B;  1U4M A;  2KUM A;  2AQ3 B;  1EYC A;  4B3S Q;  2VQF Q;  4RGM A;  1GKH A;  2K5H A;  1SRO A;  4YY3 L;  2A69 C;  2K1B A;  1E2W A;  4LF6 Q;  3HP3 A;  5JEA G;  2F4I A;  4ZUI A;  1SYF A;  2JA5 G;  1EIY B;  5M3F G;  3L7Z C;  1IYV A;  5CYU A;  1HR0 Q;  4OGQ C;  1ICF B;  2FHT A;  2OT2 A;  2SEB D;  4DR4 Q;  4X62 Q;  1QZG A;  4GKJ L;  3H0G H;  5C0X H;  1QOH A;  4B3M Q;  3HOU H;  3OMG A;  5K5P A;  3BU2 A;  4IFD H;  3GTO B;  3Q6S A;  1G91 A;  2QF7 A;  3MXN A;  3NXW A;  3M4Q A;  3E3X A;  3GTO H;  3UDF A;  2B2U A;  5ELD A;  4TVA B;  1X6O A;  5A35 A;  1A15 A;  1MKH A;  4LF5 Q;  1B9N A;  3TSS A;  5CC4 A;  3FKI B;  1SBB B;  1HJP A;  1Q3L A;  2B2U C;  4OO1 G;  2NZH A;  4JYA L;  2CQO A;  1JB7 A;  1TWC B;  2B63 H;  2K01 A;  4TKO B;  5JEA H;  3CPW A;  1VQN A;  1VQ8 A;  1VQF A;  1OO9 B;  5E4X A;  4R1J A;  3KFU A;  2Z9H A;  1GUS A;  1H9R A;  2VS1 A;  5DNF A;  1Q46 A;  3ULP A;  1LTB D;  1KRT A;  4G7O C;  2NVT B;  3LNN A;  3GTL H;  4MHE A;  5IT9 E;  3QIA A;  1LO5 D;  1N33 Q;  1I6H H;  2EYP A;  5C0X G;  4NXN L;  4CJ1 B;  4A4I A;  1YIJ A;  3CC2 A;  1SXT A;  2JJQ A;  1X3Q A;  2D2C C;  3PUV A;  3CCR A;  4G4K A;  1S5E D;  4UY8 C;  2B8F A;  3I55 A;  2BH8 A;  4C3J B;  5C44 H;  1E22 A;  1WTQ A;  4AQY Q;  1H9S A;  1V1P A;  1KLG D;  3OW2 A;  1XPU A;  4IUP A;  4KHV A;  1PDQ A;  3ICE A;  3S16 B;  3I90 A;  2YTV A;  1K0S A;  4LUZ A;  3KLS X;  1SE3 A;  3KLW A;  1YJN A;  1I5F A;  5C4X B;  4R4Q A;  3S16 H;  1QNU A;  1EQV A;  1WCM H;  5C0X I;  2EJM A;  1K8M A;  4FF4 A;  2NN6 H;  2BE5 D;  2E2I B;  1VQM A;  3ND8 A;  4IUQ A;  2CH4 A;  4WJW A;  1VMP A;  1PTO F;  4CHT B;  4HJ9 A;  2VB2 X;  3OW7 A;  3DUZ A;  2E75 C;  1E1T A;  5I9O A;  4DGZ A;  3HOX B;  1HNX Q;  2RVL A;  4A3C H;  4PQX A;  3URY A;  3CPF A;  3I73 A;  3N6R A;  1U4L A;  2B8G A;  1O7I A;  4CDF C;  1PH2 A;  3JC6 6;  3CC7 A;  4XQJ A;  5GAH C;  2MP1 A;  4FXG C;  2RDG A;  1WTV A;  1LT4 D;  3G71 A;  3H94 A;  1SYC A;  2PPB C;  3BVM A;  4JCV E;  1LUZ A;  2L15 A;  1TT2 A;  3W3A A;  1RTO A;  3SDZ A;  5KYI A;  1BCP D;  3GTP B;  4A93 H;  3E0E A;  4BA1 I;  1XPO A;  3MXU A;  4GNX B;  3DEP A;  1STN A;  1SJE D;  2WAQ G;  3I72 A;  1KNE A;  4GOP A;  4IFD G;  1D5X C;  1BDO A;  1HNX L;  4LF8 L;  3T1Y Q;  4P73 A;  3CCM A;  4KMU C;  3VYR A;  2I5L X;  4HIK A;  1V1P B;  5COY A;  4Y7N H;  3U4Z A;  5FLM H;  4YCW A;  1VQP A;  2EXZ A;  2BCO A;  1YNN D;  4JI6 L;  3WDN A;  1B53 A;  3AEV A;  2F0M A;  3F2U A;  2JA5 H;  1II3 A;  1NUC A;  5GQO A;  5G3L F;  1B7Y B;  4EQP A;  2DY8 A;  2WAQ E;  4ULL A;  1WTW A;  3PF5 A;  1TWC H;  1D6E C;  2QA4 A;  2RDH A;  4X64 L;  4XXE A;  1ENA A;  1YHB A;  4A3J G;  1VQD A;  2K75 A;  3HOW G;  1RD9 D;  1ZXT A;  5CV9 A;  2XRS D;  4RCN A;  4CDC C;  3QJY A;  1SJH D;  2C5C A;  4OIJ A;  1WVL A;  2MO1 A;  3P75 A;  1EIF A;  1VQL A;  1CM9 A;  1YNX A;  3D6W A;  4KN7 C;  1SNM A;  4QJF A;  1VQ4 A;  4LF9 L;  2LXK A;  2WAQ B;  4LFC Q;  4FXD A;  1B50 A;  2CQA A;  4R9W A;  1NR2 A;  3NK9 A;  2D0O A;  2MGS A;  1VQ6 A;  4B3R Q;  3IKJ A;  1BVS A;  4DUZ L;  1FGU A;  3R2I A;  2OTL A;  3S14 B;  1FNU A;  5C0X J;  2Z1C A;  1RL2 A;  1TS2 A;  2F0G A;  4JI0 L;  2K32 A;  4DNI A;  4DK6 C;  4IFD J;  5C4X G;  5H1S E;  3ER0 A;  3M4P A;  4ZKC B;  4A3G G;  4RGT A;  2NN6 G;  2G9D A;  2K6A A;  3OMC A;  4O0A A;  3KUP A;  3EFX D;  4LMQ D;  4C2M B;  2BDN A;  4MN3 A;  5FO9 B;  3CRL C;  5ELC A;  2KHI A;  4GKJ Q;  1K83 B;  2XTI A;  2HHH L;  3CHB D;  4QIW B;  2EYH A;  1SNC A;  3J80 i;  4BBR H;  2JA8 B;  2L9H A;  5C3X A;  4CGY B;  2K52 A;  2EVB A;  3K57 A;  4HAE A;  3D6C A;  1HNW L;  2J7Z A;  3I91 A;  3HKZ G;  4RFB A;  1STY A;  2JEB I;  3KLR A;  5KNC A;  2KED A;  2MJ8 A;  1D1K A;  1IBK Q;  3FPU B;  1L0X B;  3GV6 A;  2KEN A;  2OQK A;  1SN8 A;  2FFK B;  1OXS C;  3MXN B;  4KHP L;  4GN5 A;  5CV5 A;  2M00 A;  3I56 A;  5T1I A;  2PO4 A;  4A76 A;  3QB3 A;  3GTP H;  2A8V A;  4JI5 Q;  1LAB A;  1I4Q A;  3MTS A;  4IN3 A;  2RSN A;  1EFI D;  3TEH B;  3GTJ B;  3HOU B;  3H0G G;  4IPD A;  1U9R A;  2F0P A;  1EZ8 A;  4IOC A;  2BOS A;  3CQZ B;  4XQQ A;  2GA4 B;  1RTN A;  2A19 A;  3I7F A;  1M1K C;  1IL2 A;  2L1B A;  2PYK A;  1CZW A;  4JBJ A;  4QB4 A;  3KJP A;  1I4P A;  4BBS B;  5IGF A;  1EL0 A;  4XTC S;  3J7Z C;  2FJ2 A;  2KEC A;  3F2C A;  4DR3 Q;  1IYJ B;  3NTI A;  1QUQ B;  4X3S A;  1M4V A;  2EY1 A;  1K8O A;  1EY9 A;  1IZ6 A;  4H13 C;  2VUM H;  1PFB A;  3J80 L;  1X3G A;  1KL9 A;  3S1M B;  3VR2 A;  1W2B A;  1Y8O B;  1PLF A;  2K28 A;  3G7L A;  5F2D A;  4P74 A;  2IY5 B;  4PG3 A;  1QB5 D;  4EGV A;  4KHP Q;  3LWE A;  1TU2 B;  3QOL A;  1WJJ A;  2XGT A;  4C1N I;  2QW7 A;  4JI2 Q;  2YTY A;  5KNB A;  1NJI C;  4RG1 A;  1P8L A;  4ME3 A;  4BXX H;  1HNZ L;  3GTL B;  1JJ2 A;  2WAC A;  2K5Q A;  2CFM A;  4J6H A;  1CKO A;  2WKD A;  5C5L A;  1BCP C;  5D3I B;  3PIP A;  1TWH B;  4RGN A;  4NW2 A;  4IOA A;  2Q8R E;  3A8J E;  4JI7 L;  4DV6 Q;  4JW0 A;  5LHY 1;  5E4W C;  3EIV A;  3HKZ B;  3GTG H;  1B2T A;  1GUW A;  2PW7 A;  2AWN A;  3E9I A;  4ME5 A;  4MIU A;  5I2X A;  1BR9 A;  3ERQ A;  4YIJ A;  2E2D C;  2CWA A;  4LF5 L;  1YI2 A;  1L1O C;  1DOL A;  1SNO A;  2N78 A;  4J1M A;  2NZO A;  2LKV A;  3HOZ H;  5IP9 G;  1TS3 A;  1S5D D;  1ROD A;  1Q7Y C;  2NVT H;  2XWJ B;  3BZC A;  4WJ3 M;  3QOJ A;  2HT1 A;  2A1A A;  2PQA A;  3H3V H;  5EKK A;  1TWG H;  4RH6 A;  3A5U A;  3BVZ A;  3W1G A;  5BN3 A;  2ICI A;  3CW2 C;  4LFB Q;  2RCF A;  2ATW A;  3HFZ B;  1W3S A;  1U4P A;  1VF5 C;  1L0W A;  2I5M X;  3BVG A;  4P75 A;  1XMQ Q;  2PZU A;  1K8G A;  1UWV A;  3HOX G;  2CVR A;  4B3T Q;  3A7A B;  2JA8 H;  4N8X 1;  3I8Z A;  2F4V Q;  3NHH A;  2I5H A;  3CD6 A;  4XDX A;  5C3E G;  1DCZ A;  1HTP A;  4KY7 A;  1GUG A;  3NBI A;  5IIF A;  4KN4 C;  1CKN A;  3CMA A;  4KLK A;  1B4O A;  1CHQ D;  3B6Y A;  1KNA A;  1QE6 A;  1WFQ A;  2QEJ C;  1WCM G;  3UE1 A;  3R2T A;  5GAE C;  5LMN L;  1I6H B;  1ILP A;  4DN4 M;  3NTK A;  2L0C A;  2XVS A;  4YCV A;  5M9O A;  1PV4 A;  4A3E G;  4FVM A;  4C2M H;  1LT3 D;  3K7U C;  1PH5 A;  4C3H H;  3TP5 A;  5IGE A;  4JI4 Q;  1LTG D;  2XSC A;  4U68 A;  4LFC L;  5G3L D;  4LF4 L;  1FNW A;  1TY2 A;  2Q8T A;  4AYB B;  1DM0 B;  2F0Q A;  1OXT A;  4ODG A;  1I4G A;  3K7A H;  2OCE A;  5M5X H;  2FMC A;  3FPP A;  2CWP A;  2NVY B;  2UXC Q;  4XIG S;  4AH6 A;  3U9O A;  4HCE A;  5IT9 c;  3D31 A;  4A3L H;  1N32 L;  1CA6 A;  4KJN A;  5DM6 3;  3VR4 A;  3K81 C;  1XMO Q;  4A3I B;  3I4N B;  3S1M H;  4A3D G;  3MC0 B;  4IQZ A;  2XIW A;  3D4R A;  3IFD A;  2UUB Q;  1A8V A;  4DR1 L;  2R7Z G;  3J81 j;  1FJG L;  2XWB B;  3MEH A;  4RAU C;  1ZKO A;  5JJI A;  5FLX E;  1HA6 A;  5C3W A;  2I46 A;  5FLX L;  3KOJ A;  4Y7N B;  2PI2 E;  1Q1B A;  5J22 A;  4K14 A;  5GAD C;  1Y8N B;  3EQL C;  1VQ9 A;  1KDA A;  1PH9 A;  4J15 A;  1PHJ A;  1UUP A;  1QNK A;  4OWW B;  4FF3 A;  4L5Q A;  2XN9 C;  4LUV A;  3BDO A;  3S2D H;  2HD3 A;  4JOI A;  2JA6 H;  5IY0 A;  2VQE L;  2RF4 A;  3DWQ A;  1Q90 A;  1U5K A;  1F2Z A;  1B8A A;  1VQ7 A;  3HOZ B;  1EU4 A;  5GRO A;  2JA6 B;  1JJG A;  1HR0 L;  1EY6 A;  4UPA A;  4A93 G;  4JOI C;  3N52 A;  4NB3 A;  2EXD A;  4DV1 L;  4DR4 L;  2AQ2 B;  4OL7 A;  2GVA A;  1VQE A;  3KBG A;  2YU9 H;  2IHF A;  4X65 Q;  1VQG A;  3S1N H;  1ENF A;  3A7L A;  3K5O A;  1U0L A;  2HDL A;  3D3R A;  1STB A;  3A74 A;  3K59 A;  4HJ8 A;  1ICW A;  3M85 A;  2HCC A;  4KI0 A;  4LWC A;  5LMN W;  1E1O A;  3GTG B;  2RCN A;  3GTQ B;  4JPB W;  1EUJ A;  3STB D;  5C44 B;  2E76 C;  2K5W A;  4JG2 A;  1HR0 W;  1EWH A;  1PYS B;  4OX9 L;  3S24 A;  2LXJ A;  3D4W A;  3ERO A;  4ILW A;  4JI8 L;  3I3C A;  2WFW A;  2Y0S B;  2M9V A;  2ZT9 C;  1D5M C;  4FYD A;  2Z0S A;  4HSV A;  3GTM B;  4UP9 A;  1B3A A;  2IX0 A;  4JI0 Q;  3EJI A;  3X3N A;  2OQ0 A;  1Q1E A;  2O5J C;  3GTM H;  2PZT A;  1V8Q A;  5IYB G;  4ID6 A;  4KJO A;  1ZYR D;  3SK8 A;  4N8F A;  1C9O A;  3K0Y A;  1HTL D;  3RLO A;  1N33 L;  4YHH L;  4V19 0;  1GJX A;  2F0O A;  3K8A A;  2EYM A;  2HIX A;  1MJC A;  3HG9 A;  5IYC H;  1I4R A;  1PMR A;  1VCI A;  2CCZ A;  2HQE A;  3V05 A;  4A3B G;  1JE4 A;  1BBX C;  4BBR G;  2RSO A;  1SNP A;  1OXV A;  1Q8K A;  1X56 A;  5CR3 A;  1STH A;  1HQM C;  1TWF H;  3IRB A;  4NPS A;  1FL0 A;  4B9X A;  1GD7 A;  1LM0 A;  1V9P A;  3G6J B;  3TRE A;  3M4O B;  3H3V C;  3G48 A;  3SK4 A;  2SNS A;  3M4Y A;  4BS9 A;  4B3S L;  4QCL A;  1BCP B;  2A68 D;  3I4M H;  1Z7T A;  1FNV A;  4X6A H;  2F0H A;  2HDM A;  3W1B A;  3IAY A;  1CKN B;  1YBY A;  5IWA L;  3S1Q B;  2KVM A;  2NVX B;  2L4N A;  2EE1 A;  3H6M A;  4LFB L;  2NVX H;  4HCS A;  3J7Y W;  2WV6 D;  2K03 A;  1BBW A;  1ZYR C;  4DAP A;  2F03 A;  5C5M A;  2Q2H A;  4X62 L;  1GOZ A;  4B3T L;  5A2Q L;  3CRK C;  5M5X B;  2YU9 B;  2B2W A;  1MSG A;  3TQY A;  4B3M L;  3K5N A;  1VDZ A;  2RBM A;  2Y0S G;  1PTO B;  3FRP B;  4H0L C;  2ZJR A;  3NE5 B;  5ELE A;  3HOY G;  3A0J A;  2VXW A;  2UUC L;  4N9T A;  2JK8 A;  3OOC A;  4RHS A;  1PTO D;  4RGO S;  4OHJ A;  4WJ4 A;  4A3M G;  2QCP X;  1EEI D;  3MEF A;  4DXG A;  4Q5V A;  3K58 A;  4DV7 Q;  4KY5 A;  1VQH A;  3TN2 A;  1BKB A;  2PI2 A;  1DOM A;  2KCM A;  5BR8 L;  1B44 D;  1PFS A;  2F3I A;  4WOR A;  4P72 A;  4UAI A;  1T5X D;  2UXD L;  1PH7 A;  3E0J A;  3LGJ A;  1HNZ Q;  1EQR A;  2JYO A;  4DV5 Q;  4TQU S;  2SOB A;  1F9R A;  3U50 C;  2EOT A;  4IPH A;  3HZX A;  4LF4 Q;  2VL6 A;  2L11 A;  1X3E A;  4JI1 L;  5M5Y H;  4JI3 Q;  1VF7 A;  3HKZ E;  4DR7 Q;  4JBK A;  3T53 B;  4IO9 A;  3S2D B;  2WB1 B;  1YJW A;  4C56 C;  4JI6 Q;  4FF1 A;  4X66 Q;  2KBN A;  4L5S A;  2B63 B;  5A2Q E;  3J80 E;  1KLU D;  3T4A C;  1TWF B;  3OIP A;  3OWF A;  1I4H A;  4GOP B;  3BDC A;  1F2Y A;  2ENB A;  3D0F A;  4LF7 Q;  1A3T A;  5CV4 A;  3S1R H;  3CF5 A;  2UUB L;  1XMO L;  1PFN A;  2NYZ D;  2QDB A;  4A3J H;  3RD4 A;  1O80 A;  2V4D A;  1ILQ A;  1SYG A;  1O78 A;  4PNY A;  4EVO A;  3MWY W;  5J3B A;  5HGQ A;  2NB0 A;  4IUT A;  5IYC G;  1XX8 A;  2VNU D;  4KKU A;  2DUD A;  4PV1 C;  3GTJ H;  3EBE A;  1J5E L;  2F0D A;  2P5Z X;  2ZJQ A;  2LY7 A;  2IPK D;  1N9W A;  2B2W C;  3S2H H;  4RMF A;  5ELB A;  5EKI A;  5FOB B;  1RCV D;  3S2H B;  5IGC A;  4POG A;  1MGS A;  2IJ0 A;  1W6K A;  2IX3 A;  1CQF A;  2Z4I A;  1C48 A;  2EIF A;  1JOO A;  3A56 A;  1MSH A;  3J7A V;  2E2I H;  3V96 A;  5M3M H;  5JJL A;  1VQO A;  4A93 B;  5EPK A;  1WOC A;  4GLX A;  4HID A;  4A3D H;  1X32 A;  4BY7 G;  5FJ8 H;  2X6G A;  2K05 A;  4DV2 Q;  4YWK A;  1EYG A;  3MAQ A;  3AB9 A;  3DLL A;  3TS2 A;  2HIV A;  3U9S A; 
#chains in the Genus database with same CATH homology
 4IOC A;  3PIO A;  1PH6 A;  1Z47 A;  2A19 A;  3I7F A;  4IJH A;  4HJ7 A;  5JEA J;  1NTG A;  3U58 A;  4AQY L;  1M1K C;  3UDG A;  1ASY A;  4JI4 L;  1IL2 A;  4BBS H;  1S40 A;  2YYZ A;  1KRS A;  2BH2 A;  1GVP A;  3RN2 A;  4DV0 Q;  4JBJ A;  2WP8 J;  4K0K L;  3KJP A;  3KYH C;  4MNO A;  1HZB A;  5JJK A;  4R4I A;  2YTX A;  2MFI A;  3STB C;  4C3I H;  1PH4 A;  3ZJY C;  4XTC S;  1VQK A;  3G4S A;  3J7Z C;  3GTK H;  1ASZ A;  3F2C A;  2E8G A;  1V1Q A;  2AWO A;  4DR3 Q;  3CXC A;  2NVY H;  1IYJ B;  4DV3 Q;  1IBL L;  1QUQ B;  2R7Z H;  1K3R A;  1IBK L;  3M4O H;  2UXC L;  4A3I G;  3I4N G;  2R93 G;  1IZ6 A;  1QVF A;  1XNR L;  2VUM H;  5IP7 H;  1X3G A;  3T1H L;  1KL9 A;  1W2B A;  1N32 Q;  2RHQ B;  4LF6 L;  1HZA A;  1VQB A;  1YZ6 A;  3L2P A;  4P74 A;  1FJG Q;  3HOV H;  3JAM c;  2IY5 B;  4PG3 A;  4KHP Q;  3BZK A;  1WJJ A;  2XGT A;  5LMU Q;  1L1O B;  4HIO A;  4LFA Q;  2E2H H;  3ULJ A;  3AQQ A;  4JI2 Q;  2YTY A;  3SGI A;  4OO1 I;  1NJI C;  3UE0 A;  5DLQ E;  4RG1 A;  1P8L A;  4ME3 A;  5FJ8 G;  2JA7 G;  4BY7 H;  3CCE A;  1HNZ L;  4BXX H;  1JJ2 A;  3TS0 A;  1XNQ L;  1J6Q A;  1NY4 A;  2CFM A;  4X64 Q;  1EFW A;  3FP9 A;  1CKO A;  3CP0 A;  4DR1 Q;  4ALP A;  3PIP A;  2R7F A;  3KDF B;  3PGZ A;  4IOA A;  2Z6K A;  4OWT B;  2JEA I;  1Y1W H;  1KXL A;  1MJE A;  3H3V I;  4JI7 L;  3F8T A;  4A75 A;  4DV6 Q;  4B3R L;  2B3G A;  3EIV A;  3GTG H;  4K0K Q;  1NMG A;  1JE5 A;  1NE3 A;  1IXR A;  4AYB G;  2ZTD A;  3GTQ H;  4JYA Q;  1FVI A;  3S15 H;  1AE3 A;  2AWN A;  3E9I A;  3CCQ A;  4C3J H;  3S14 H;  1H95 A;  3M7N A;  3F2D A;  4LF9 Q;  4DR3 L;  2R6G A;  2CWA A;  4O2D A;  1IBL Q;  3J81 i;  4LF5 L;  1S3O A;  1YI2 A;  1L1O C;  4A3M H;  1Q86 C;  2WB1 G;  1X65 A;  4JV5 L;  3GO5 A;  2N78 A;  1UE7 A;  4UP7 A;  3HOZ H;  2NZO A;  4LF7 L;  4PZ6 A;  5IP9 G;  5IWA Q;  2VZA A;  4QIW E;  5M3M G;  1Q7Y C;  2NVT H;  5GAG C;  1Q12 A;  4DUY Q;  2VY3 A;  1I94 Q;  1JT8 A;  3GDE A;  3BZC A;  1EQQ A;  4JI2 L;  2HT1 A;  4WJ3 M;  2A1A A;  2R92 H;  2PQA A;  1YEZ A;  1OXX K;  2I0Q A;  2D62 A;  3H3V H;  1MIU A;  4NXM L;  1TWG H;  3RNU A;  1UEB A;  2N3S A;  3HOU G;  2E2J H;  1XNQ Q;  3A5U A;  4LF8 Q;  1TWA H;  2JA7 H;  3I4O A;  4BXX G;  3W1G A;  1J5E Q;  3CW2 C;  4LFB Q;  4GN3 B;  2ATW A;  2K14 A;  3HFZ B;  2KHJ A;  1W3S A;  3BJU A;  5ELN A;  2AHO B;  5E7N A;  2I5M X;  1L0W A;  1CKM A;  3RLN A;  3U4V A;  1OXU A;  4P75 A;  3RR5 A;  1XMQ Q;  4JI8 Q;  4HJ5 A;  2QEX A;  1UWV A;  1K83 H;  3HOX G;  4IPG A;  2BA0 A;  5C44 G;  1K8G A;  4B3T Q;  2JA8 H;  1VQA A;  4DPG A;  2F4V Q;  1VQJ A;  2VQF L;  2HHH Q;  2I5H A;  2MNA A;  2PMZ E;  5ELO A;  3CD6 A;  4GN4 B;  1XPR A;  5C3E G;  2K4K A;  2ASB A;  1I3Q H;  5C4X H;  1CSQ A;  1SFO H;  1RIP A;  2B29 A;  1CKN A;  2Q2I A;  3CMA A;  4FDB A;  1CUK A;  4KLK A;  3B6Y A;  1WFQ A;  4YHH Q;  1WCM G;  3UE1 A;  5GAE C;  5IP9 H;  5LMN L;  4DUY L;  1I94 L;  2UU9 L;  4R4T A;  4YCV A;  2RHS B;  4DV7 L;  3S1Q H;  1PV4 A;  4DK3 C;  4A3E G;  1KQS A;  2IX1 A;  1V43 A;  4C2M H;  2ZTE A;  2D0P A;  3K7U C;  3NEN A;  1DGS A;  4MTN A;  2N49 A;  1UE5 A;  4DKA C;  3JAM i;  1PVO A;  5IYD H;  4DV5 L;  1PH5 A;  4C3H H;  1AH9 A;  4JI4 Q;  1WI5 A;  3PUZ A;  4LFC L;  1WYD A;  4DR6 Q;  1EWI A;  4OON A;  4LF4 L;  1PH8 A;  1VQ5 A;  4JI3 L;  1OXT A;  4PZ8 A;  5M5W H;  3OTO L;  4DR7 L;  3UDX A;  3FKI G;  4DV4 Q;  1A62 A;  3K7A H;  1B70 B;  2OCE A;  5M5X H;  3KF6 B;  4LUO A;  2C35 B;  1EOV A;  2CWP A;  1Z9F A;  2MO0 A;  4B3S Q;  1C0A A;  2VQF Q;  2LSS A;  3TRZ A;  2UXC Q;  4XIG S;  2JA9 A;  4AH6 A;  5IT9 c;  1T9H A;  1GKH A;  2K5H A;  1SRO A;  2MQH A;  3J81 c;  3S17 H;  3D31 A;  4A3L H;  1N32 L;  4YY3 L;  4LF6 Q;  5JEA G;  2HQL A;  2JA5 G;  1EIY B;  4YWL A;  3K81 C;  1VS0 A;  3L7Z C;  5M3F G;  1R9T H;  1XMO Q;  1D7Q A;  3S1M H;  4A3D G;  1HR0 Q;  4GS3 A;  1Y1V G;  1LYL A;  4DR4 Q;  4X62 Q;  4IPC A;  2ZM6 L;  3NBH B;  1QZG A;  1A63 A;  2UUB Q;  1A8V A;  4DR1 L;  4A3E H;  3H0G H;  2OWO A;  2R7Z G;  4GKK Q;  3J81 j;  4BA2 I;  4GKJ L;  1A0I A;  1FJG L;  4B3M Q;  5K36 G;  3HOU H;  5JJI A;  4DR2 Q;  2Q2U A;  1G51 A;  1TXY A;  2VW9 A;  3BU2 A;  4QL5 A;  3KOJ A;  4BY1 H;  2PI2 E;  1OTC A;  1Q1B A;  3PV0 A;  5GAD C;  4P71 A;  4GOP C;  4DV4 L;  1IBM Q;  3M4Q A;  3GTO H;  3T1Y L;  3UDF A;  1VQ9 A;  2ES2 A;  1BBU A;  4TVA B;  3FKI H;  2WB1 E;  1X6O A;  4LF5 Q;  1MKH A;  5EAY A;  1PH9 A;  4J15 A;  1PHJ A;  3A5Z B;  1KIX A;  1KC8 C;  3RZO H;  4R4C A;  4OWW B;  4JI7 Q;  3GD7 A;  4L5Q A;  1K73 C;  3EN2 A;  1HJP A;  4LUV A;  5C3E H;  3S2D H;  4JOI A;  2JA6 H;  4OO1 G;  5IY0 A;  2NZH A;  2VQE L;  4JYA L;  2RF4 A;  3HOV G;  5BR8 Q;  1U5K A;  2CQO A;  1JB7 A;  1B8A A;  2B63 H;  1VQ7 A;  2ALY B;  2UUC Q;  4DR5 L;  1Y14 B;  5GRO A;  3CPW A;  1JJG A;  1VQN A;  1VQ8 A;  1VQF A;  1PYB A;  4GNX A;  1HR0 L;  3DM3 A;  4R1J A;  5M3F H;  4UPA A;  3KFU A;  4A93 G;  4JOI C;  3CCV A;  4EX5 A;  4DV1 L;  2VS1 A;  2EXD A;  4NB3 A;  4DR4 L;  1Q46 A;  5C4J H;  2GVA A;  1VQE A;  4POF A;  3ULP A;  2UXB Q;  1KRT A;  2YU9 H;  1LTL A;  2IHF A;  4X65 Q;  1YJ9 A;  3GTL H;  1VQG A;  3HKS A;  1N33 Q;  1I50 H;  3S1N H;  1I6H H;  1TWH H;  4DV2 L;  4DR2 L;  1N34 Q;  3RLF A;  5C0X G;  1U0L A;  4NXN L;  3J80 c;  3A74 A;  4A4I A;  1YIJ A;  3CC2 A;  2JJQ A;  2OTJ A;  4HJ8 A;  3AFP A;  3PUV A;  3M85 A;  3CCR A;  2IHE A;  2PNH A;  2UXD Q;  4UY8 C;  4KI0 A;  4LWC A;  3I55 A;  5LMN W;  1E1O A;  4X66 L;  2BH8 A;  5C44 H;  1G6P A;  1E22 A;  1NMF A;  2RCN A;  4AQY Q;  3FHW A;  1EUJ A;  2JQO A;  3STB D;  4JG2 A;  3OW2 A;  1PA6 A;  1XPU A;  1HR0 W;  1PYS B;  2K5N A;  4OX9 L;  3S24 A;  2F52 A;  2LXJ A;  3T1H Q;  1UE1 A;  3ICE A;  2YTV A;  4JI8 L;  4DUZ Q;  4LUZ A;  2WFW A;  3ERS X;  3M3Y H;  3KLW A;  1YJN A;  2VQE Q;  2Z0S A;  1I5F A;  4R4Q A;  2F4V L;  3S16 H;  4UP9 A;  5LMU L;  3E9H A;  2IX0 A;  4JI0 Q;  1WCM H;  3CCL A;  2OQ0 A;  1Q1E A;  4PZ7 A;  4AYB E;  5C0X I;  3GTM H;  4A3G H;  1UE6 A;  2PQA B;  5IYB G;  2R92 G;  1VQM A;  4HJA A;  2UUA L;  1C9O A;  2YV5 A;  3RZD H;  5FLX c;  3RLO A;  1N33 L;  3PF4 A;  4YHH L;  4HJ9 A;  5LMN Q;  4HIM A;  3K8A A;  2HIX A;  1E1T A;  1MJC A;  3RN5 A;  4Y52 H;  1HNW Q;  5IYC H;  1HNX Q;  1VCI A;  2CCZ A;  2JA8 G;  4A3C H;  3CPF A;  1X54 A;  1K0R A;  1Q82 C;  3CCS A;  4A3B G;  2BA1 A;  4BBR G;  4L5T A;  1Q81 C;  1OXV A;  1L1O A;  1Q8K A;  5FLM G;  1X56 A;  1O7I A;  1TWF H;  3UDI A;  3IRB A;  4NPS A;  3HOY H;  4QGU A;  1FL0 A;  1PH2 A;  4JV5 Q;  1GD7 A;  4A3K H;  1LM0 A;  2CKZ B;  4YWM A;  1V9P A;  3TRE A;  3JC6 6;  3PSI A;  3CC7 A;  5GAH C;  1M90 C;  4A3L G;  1X9N A;  1CSP A;  3G48 A;  3G71 A;  1QUQ A;  4B3S L;  2ZJP A;  1K9M C;  1L2F A;  1PH3 A;  3I4M H;  1SR3 A;  2B63 G;  4JCV E;  4X6A H;  3W1B A;  1CKN B;  1LUZ A;  2L15 A;  3M9B A;  1KD1 C;  1YBY A;  5IWA L;  4A93 H;  1QVG A;  1SRU A;  1X3F A;  3PCO B;  3E0E A;  4DAM A;  3I2Z A;  4GNX C;  4BA1 I;  3PO3 G;  1K8A C;  2Y0S E;  3WWV A;  2H5X A;  4LFB L;  1XPO A;  2NVX H;  3J7A 5;  1HZC A;  4GNX B;  1N36 Q;  2WAQ G;  1BBW A;  4GLV B;  1N8R C;  2Z6K C;  4LW1 A;  3H15 A;  4GOP A;  4NXM Q;  3CCU A;  4IFD G;  2K50 A;  4X62 L;  2Q2H A;  4GLA C;  4BY1 G;  2ZM6 Q;  3T1Y Q;  1HNX L;  4JC0 A;  4P73 A;  3CQZ H;  4B3T L;  1SE8 A;  3CCM A;  2I5L X;  3TQY A;  4DV3 L;  1VQC A;  1Y1W G;  4B3M L;  4UP8 A;  4QQB X;  4HIK A;  4Y7N H;  3OYY A;  1G29 1;  2Y0S G;  3U4Z A;  2GVB A;  5FLM H;  4YCW A;  1VQP A;  4AIM A;  2ZJR A;  4JI6 L;  4LF8 L;  1GM5 A;  3HOY G;  3KDF A;  3AEV A;  3A0J A;  4A3K G;  1AE2 A;  2UUC L;  4DR5 Q;  2JK8 A;  1KAW A;  2JA5 H;  4A3I H;  3I4N H;  5GQO A;  2R93 H;  4WJ4 A;  1E7Z A;  4DAY B;  3CCJ A;  4A3M G;  3MEF A;  1YHQ A;  1B7Y B;  4DV7 Q;  2ID0 A;  2WAQ E;  1Y1V H;  3PF5 A;  1TWC H;  1VQH A;  2AKW B;  3PUY A;  1PH1 A;  1BKB A;  2QA4 A;  3K0X A;  4X64 L;  3I4M G;  1S72 A;  1HZ9 A;  1YHB A;  1P16 A;  1VQD A;  2K75 A;  2PI2 A;  5IYB H;  4A3J G;  3HOW G;  3PO2 H;  2KCM A;  3F2B A;  5BR8 L;  1PFS A;  4OWX B;  2F3I A;  2NVQ H;  4P72 A;  4QY7 A;  4DV6 L;  1N36 L;  4MZ9 A;  2UXD L;  1D8L A;  2JE6 I;  2MO1 A;  1PH7 A;  4DV1 Q;  3LGJ A;  1EIF A;  1EQR A;  1HNZ Q;  1VQL A;  4LNQ A;  3PUX A;  1YNX A;  5IE8 A;  4DV5 Q;  4QJF A;  1VQ4 A;  4TQU S;  4LF9 L;  2LXK A;  3U50 C;  2E5L L;  1XJV A;  4LFC Q;  1X55 A;  4X65 L;  2IT1 A;  2N8N A;  4IPH A;  3CAM A;  4DR6 L;  5AJ3 L;  4A3B H;  4JBW A;  5HY6 A;  2VL6 A;  1JMC A;  4LF4 Q;  4A3F G;  3W5O A;  1X3E A;  2D0O A;  4JI1 L;  5M5Y H;  4JI3 Q;  4DR7 Q;  3HKZ E;  4JBK A;  1VQ6 A;  4B3R Q;  3HOX H;  1BVS A;  1QVC A;  4YY3 Q;  4DUZ L;  4IO9 A;  3CC4 A;  1FGU A;  4L5R C;  1YJW A;  2OTL A;  2JA6 G;  4JI6 Q;  5C0X J;  1RL2 A;  2KBN A;  4R4O A;  4X66 Q;  4L5S A;  2VUM G;  4JI0 L;  5IP7 G;  4APV A;  4DNI A;  4DK6 C;  4IFD J;  5C4X G;  3VDY A;  5H1S E;  3ER0 A;  4GOP B;  3ULL A;  3M4P A;  4A3G G;  4OX9 Q;  4KHZ A;  2NN6 G;  4H02 A;  3D0F A;  2UUA Q;  4LF7 Q;  2UUB L;  2ZTC A;  4PMW A;  3CF5 A;  3S1R H;  1XMO L;  4JBM A;  4O0A A;  3KF8 B;  3L0O A;  2K5V A;  4JI5 L;  4A3J H;  3NEM A;  3PO2 G;  1JJC B;  2FXQ A;  2R7D A;  1YIT A;  2NN6 I;  1XMQ L;  1C7Y A;  1QZH A;  2KHI A;  5J3B A;  2V1C C;  5HGQ A;  4GKK L;  2GN5 A;  4BBS G;  5IYC G;  4GKJ Q;  2XTI A;  2VNU D;  3AFQ A;  3G6E A;  1IBM L;  2DUD A;  3KJO A;  2HHH L;  1SMX A;  3GTJ H;  3EBE A;  4A3C G;  3KF6 A;  2AMC B;  2E5L Q;  1J5E L;  3J80 i;  2ZJQ A;  4BBR H;  5AJ3 Q;  4DV0 L;  4EQ5 A;  2K52 A;  2KCT A;  1N9W A;  4JI1 Q;  1E24 A;  1E3P A;  3S2H H;  1HNW L;  1NBW A;  3Q8D A;  4A3F H;  3HKZ G;  3PUW A;  2DGY A;  1KHI A;  1XTD A;  2QGQ A;  2JEB I;  4YCU A;  4RMF A;  3AYH B;  1IBK Q;  4POG A;  1HH2 P;  1XNR Q;  3HOZ G;  2EIF A;  1VQI A;  4IJL A;  2KEN A;  2OQK A;  1SN8 A;  3K80 C;  4IPD A;  2E2I H;  5M3M H;  5JJL A;  1OXS C;  3MXN B;  1VQO A;  1GO3 E;  4KHP L;  4GN5 A;  1WOC A;  4GLX A;  4OXP A;  3I56 A;  2EQS A;  3CME A;  4HID A;  4A3D H;  4A76 A;  4LFA L;  3HOW H;  5FJ8 H;  3GTP H;  1YVC A;  2A8V A;  3PO3 H;  4BY7 G;  4DV2 Q;  4JI5 Q;  4IFD I;  1N34 L;  4YWK A;  1EYG A;  2UU9 Q;  1SLJ A;  3F1Z A;  1YHA A;  3DLL A;  3OTO Q;  3TEH B;  4NXN Q;  3NEL A;  3TS2 A;  2UXB L;  3H0G G;  2Q2T A;  5IYD G;  2HIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...