2MQHA

Solution structure of the chlamydomonas reinhardtii nab1 cold shock domain, csd1
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
72
structure length
72
Chain Sequence
GSGEQLRQQGTVKWFNATKGFGFITPGGGGEDLFVHQTNINSEGFRSLREGEVVEFEVEAGPDGRSKAVNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Nucleic acid binding protein
publication title Solution structure of the RNA-binding cold-shock domain of the Chlamydomonas reinhardtii NAB1 protein and insights into RNA recognition.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 1
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2mqhA00
3CPFA 4A93H 2VNUD 3S2HH 3KDFA 1EWIA 3KJPA 2HHHL 3CP0A 4BY7H 1VQNA 1MJCA 1OTCA 1HNXQ 1VQHA 2E5LQ 4BY1H 4JI3L 3CQZH 1YNXA 1WOCA 2ID0A 2K5HA 1Q1BA 2OQKA 2JEAI 2K5NA 4UP9A 3K7UC 4YWKA 5IP9G 2I5MX 4NXMQ 4QIWE 1OXSC 3BU2A 4DV2Q 4JOIA 1V43A 1L0WA 3PO3H 3J81j 2ZJRA 4AQYL 4GOPA 3FHWA 2KBNA 3H0GH 3TEHB 1L1OB 1RIPA 1PH6A 4LF9Q 2N3SA 5IWAL 4OONA 2R93G 4GKJQ 3HKSA 3PIPA 4X66L 4DUZQ 2MNAA 1OXVA 4R4IA 2HT1A 1TWHH 1N33L 4B3RL 5M5WH 4UP8A 2NVQH 3G48A 3CCQA 2JA5G 3HOUH 4LFBQ 2N49A 1PA6A 3JAMi 4LF6Q 5JJKA 3CC4A 3SGIA 4L5QA 2PQAA 3GO5A 3FKIH 3PGZA 2K50A 3RLNA 1SE8A 2WP8J 4DR1Q 3KF6A 5C3EG 2EQSA 4GS3A 1XMQL 4L5TA 1LYLA 2IX1A 2HIVA 5GADC 1PYBA 2RF4A 3JC66 4DR3Q 4B3TQ 2JA7G 4FDBA 3G4SA 4BXXH 1SROA 1CKNB 3H3VI 3T1HQ 4NXNQ 4GN3B 5IP7H 1H95A 1GVPA 1S3OA 2OQ0A 1X55A 3TS0A 3DM3A 1QUQA 2IT1A 3KDFB 2ATWA 3PO2G 4KI0A 4X65Q 4IJHA 4XIGS 2CFMA 4B3SQ 4MZ9A 4YWMA 2UUCL 3OTOL 4DR6L 1BKBA 1NMGA 1VQ5A 2BH2A 3CC7A 5IYCH 1A63A 5C0XJ 1VQCA 4LFAL 2NVYH 2VY3A 4DV4Q 4DPGA 1N32Q 3PUWA 1N36L 3UDIA 4A3EG 4LF5Q 5LMNW 1XMOL 4L5RC 3S15H 2I0QA 2BA1A 4GOPB 2JA6G 2UUAL 2ES2A 1FJGL 1OXUA 3RLOA 4GNXA 1KIXA 5FJ8H 1YEZA 4GN4B 1HZCA 3D31A 2A8VA 4BBSH 1MJEA 3I56A 3HOXH 4DR4Q 1CSPA 4A93G 1E3PA 4PZ7A 1PH9A 4A3FH 2NZOA 4BY7G 1JJGA 2VW9A 1VS0A 4AIMA 4JI5Q 5LMUQ 2R92H 4YCWA 4JI6L 2QGQA 3DLLA 4A3BH 4ME3A 1K0RA 2AKWB 3K8AA 4JI0Q 3J81c 2NN6G 2PQAB 1GD7A 2Q2IA 4QJFA 3L2PA 1L2FA 2ALYB 3PO3G 3KF6B 5C44G 1PH3A 2UXDQ 3F1ZA 1Y1VH 1XPRA 3GTQH 2K75A 2UUBQ 2UXCQ 3S1NH 1Q82C 2DUDA 3S16H 2EIFA 2UXBQ 4DAMA 1L1OA 3J81i 4UY8C 1VQ6A 1QUQB 5M3FH 2ZM6Q 1E1OA 1NE3A 1GM5A 4JI4L 4IFDJ 3U4VA 2VUMG 3CD6A 5J3BA 1VQEA 1HR0W 1N8RC 2B63H 1SMXA 2UU9Q 1NMFA 1KAWA 3GTPH 4IO9A 3J80i 1L1OC 3UDFA 4A3IH 3HKZE 2KENA 1T9HA 1AH9A 4QY7A 3S1MH 3CCJA 3FKIG 4X64L 4OWWB 1UE1A 3A74A 3RZDH 1PHJA 1M90C 4DKAC 2D0PA 4DR2Q 1J5EQ 3GD7A 1KRTA 4OX9Q 1I94L 4BXXG 1EQRA 1JMCA 4A4IA 3A5ZB 2HQLA 5GAGC 4HJAA 3UDGA 4GNXB 1C9OA 3K0XA 4LWCA 5IP7G 3CCSA 4DV1L 1YIJA 1YHAA 5C0XG 2MFIA 3E9HA 1X3GA 1X54A 4IPGA 1IBLL 3S17H 4PG3A 3BJUA 3L0OA 4JI1L 5IT9c 4WJ3M 1WFQA 2GVAA 4LW1A 1Z47A 1X3FA 1X65A 1J6QA 2WFWA 1KXLA 4EX5A 1HNWL 5BR8L 5ELOA 3AQQA 4A3KG 2YTVA 1Q86C 3W5OA 2CCZA 5C4XG 1V1QA 3CCUA 1S72A 4TQUS 1IBML 3KF8B 2LSSA 1NY4A 4DK3C 1SFOH 4C3JH 2LXKA 4RMFA 5C0XI 3I4MG 4MTNA 2IHEA 4R4QA 5FJ8G 4LF4Q 1LUZA 1X3EA 3HOWH 1HNXL 2E5LL 1SRUA 3I4OA 4DAYB 3HOXG 4DV6Q 1XNRQ 1QZGA 1ASZA 4P74A 3MEFA 3JAMc 1WYDA 3K80C 4A3FG 1A62A 1JJCB 1C0AA 3UE0A 3PUYA 4JOIC 4NXML 1YHBA 4DV2L 4LF7Q 1K3RA 1UEBA 2VL6A 1NJIC 1IBKQ 1IL2A 4NPSA 1VQGA 2Y0SE 4OWTB 1K8GA 3GTJH 4A3BG 4GOPC 3H15A 1R9TH 3GTOH 3M4PA 3M4QA 2PI2E 4LUOA 4O0AA 1D8LA 1G51A 3UE1A 1VQKA 4WJ4A 5LMNQ 1NTGA 3NENA 2I5LX 5IE8A 4LF9L 4PMWA 1EQQA 2E2HH 4GKJL 1U0LA 4YWLA 1IBKL 1BVSA 1Y1VG 3TREA 5IY0A 2XTIA 4DUZL 4HJ7A 4TVAB 4IFDG 1OXTA 1K9MC 1AE2A 1UE6A 2F4VQ 1QVFA 5IYDH 1UE5A 1VQMA 4YHHQ 3KLWA 2E2JH 5IYBH 2AHOB 1B8AA 4LFBL 1K83H 1FL0A 2CKZB 1VQ7A 1YVCA 4AYBE 1IZ6A 4LF6L 1E1TA 4A75A 3T1YQ 1K8AC 1A8VA 1Q1EA 2IHFA 4A3JG 4JI8Q 4A3GG 2AWNA 4P75A 4LNQA 1PV4A 1SN8A 4A3DH 4JBWA 3FP9A 4DR1L 3OYYA 5M5YH 2JA9A 4A3IG 4A3LH 3RN5A 1CSQA 3CMAA 4IFDI 2RCNA 1HH2P 2OCEA 4DR3L 4B3TL 2PNHA 4IPHA 4Y7NH 3T1HL 4JG2A 4NXNL 4IOAA 2RHSB 1PH2A 4C3IH 3PF5A 3EBEA 3KOJA 3NEMA 4K0KQ 1TWFH 5FLMH 1G291 4YCUA 1VQ9A 4DR5Q 2R7FA 4JYAQ 4JI2Q 4X65L 4DV3Q 3HOZG 4B3SL 3CCLA 1Y14B 2WAQE 5FLXc 3I4NG 5M3MG 1HZBA 4HIOA 4QL5A 4P72A 3HOVH 1N32L 4DV4L 1EOVA 4MNOA 3CCVA 3BZKA 4A3MH 2WB1E 4LF5L 2CWAA 4OXPA 4KHPQ 1CKOA 5ELNA 4DV0Q 3AYHB 1CKMA 2K5VA 2Y0SG 1X56A 3I55A 5M5XH 4GNXC 4BY1G 5JJLA 2JEBI 2CQOA 1VQIA 1PVOA 2GVBA 4DR4L 4DV7Q 4HIKA 5HY6A 3NELA 1SLJA 1XPOA 1N9WA 4H02A 4JI5L 5IP9H 5C4JH 1Q81C 5LMUL 2OTLA 4L5SA 4DUYQ 4IPCA 2OTJA 4JV5Q 2YTXA 3H0GG 4C3HH 3OW2A 1HZ9A 1W3SA 3J80c 1KL9A 4HJ8A 2BA0A 2B3GA 2ZTCA 3UDXA 4JI7Q 4JI0L 4AYBG 1VQFA 1TXYA 3LGJA 1JB7A 4GKKQ 2UXDL 4HJ5A 5JJIA 3EIVA 3HOUG 1E24A 4DV5Q 4IOCA 3H3VH 2Z0SA 1E7ZA 3CXCA 1K73C 1B7YB 5K36G 2NN6I 2UUBL 2UXCL 4AH6A 2JA5H 2IY5B 2YTYA 2VQFQ 2K14A 1KD1C 1LM0A 2UXBL 4BBRH 1TWCH 4C2MH 4R4CA 5IYDG 3J7A5 3EN2A 2ZM6L 3CAMA 3ICEA 4OO1G 1VQ8A 1Q46A 1MKHA 1XNQQ 4R4TA 2UU9L 4LFCQ 2JE6I 2WAQG 2Q2UA 1YZ6A 4X62Q 1BBUA 4ALPA 4P71A 1QVGA 3GTMH 3S14H 4B3MQ 3PUVA 4A3DG 2L15A 4GLAC 3A0JA 4YY3Q 4HJ9A 1J5EL 2DGYA 4DR2L 4OX9L 2JK8A 3ZJYC 1YHQA 3GTLH 1XJVA 5E7NA 4DNIA 3PO2H 1AE3A 3CC2A 1UE7A 3PV0A 2GN5A 4BA2I 4DR7Q 4HIMA 2H5XA 1HNZQ 2E2IH 5JEAJ 2PI2A 2VQEQ 5IYCG 2NZHA 3M9BA 4P73A 1KHIA 5FLMG 1V9PA 2A19A 3BZCA 5AJ3Q 4GLXA 1Q8KA 4JBJA 1Y1WH 4POGA 4GLVB 3CW2C 2K52A 5GAEC 2ZTDA 4A3CH 2HHHQ 4HIDA 2AWOA 2OWOA 2JA6H 2MO1A 3PUZA 4JI3Q 3HOVG 4BBSG 4QQBX 2ASBA 3ULPA 1LTLA 1OXXK 2KHIA 1FGUA 4A76A 3ER0A 2QA4A 5GAHC 1PH5A 1XPUA 2R92G 1VQPA 4IJLA 4LF4L 4KHZA 4AQYQ 1EUJA 4DV6L 1QZHA 1XNRL 2FXQA 4RG1A 1VQOA 3PF4A 3S1RH 5IWAQ 1SR3A 2MO0A 5H1SE 3HKZG 3AFPA 1YJWA 4LF8L 2YYZA 1YITA 2R7DA 4LF7L 3B6YA 2JQOA 4X66Q 3NBHB 3VDYA 3GDEA 2JA8H 3S1QH 1KC8C 3AEVA 1N33Q 5C44H 4B3RQ 3M3YH 1WCMH 3D0FA 1P16A 1B70B 5LMNL 2RHQB 3S24A 5M3FG 1WI5A 4LUVA 4UP7A 3GTGH 2N78A 1O7IA 2B63G 3E9IA 1JE5A 2F4VL 2AMCB 3CPWA 1XMQQ 1Z9FA 4DK6C 4GN5A 3RLFA 4YHHL 2VUMH 1VQDA 3G71A 2QEXA 2D62A 1N34Q 4BBRG 4UPAA 3PUXA 2F3IA 3F8TA 1P8LA 1IXRA 3T1YL 1Q7YC 4JI8L 2NVTH 3PSIA 4OWXB 2ZTEA 1C7YA 2ZJQA 2E8GA 4JBKA 3RR5A 2VZAA 2LXJA 1PH4A 1N34L 3GTKH 5JEAG 2K4KA 2UUCQ 3OTOQ 5HGQA 2R7ZH 4DR6Q 2PMZE 3CCMA 1HR0Q 2MQHA 3TS2A 3RNUA 4NB3A 3L7ZC 4KLKA 4LFAQ 4K0KL 1M1KC 1MIUA 1D7QA 3M4OH 3G6EA 1N36Q 4DR5L 3HOYH 1XMOQ 4JI2L 1S40A 4DV3L 1GKHA 1NBWA 1YJ9A 3F2DA 5GQOA 4XTCS 4J15A 4YCVA 2UUAQ 1FJGQ 1HR0L 4A3KH 1W2BA 1Q12A 3ERSX 1VQ4A 4JC0A 2JJQA 2KCTA 4R4OA 5C4XH 1Y1WG 2V1CC 2YU9H 1KRSA 4O2DA 5GROA 4PZ6A 4A3CG 4KHPL 2R6GA 5DLQE 2VS1A 3KYHC 4DV0L 1EIFA 3STBD 3HOWG 1JT8A 3I4MH 4JI6Q 4X6AH 2Q2TA 1EIYB 3STBC 1X9NA 2I5HA 2Q2HA 3CMEA 3M7NA 3K81C 2EXDA 3TQYA 4DV7L 3WWVA 2R93H 1GO3E 1E22A 3ULLA 3M85A 1IYJB 1PH7A 4DUYL 1U5KA 1CUKA 4JV5L 3TRZA 1EFWA 4QGUA 1I6HH 3PCOB 1HZAA 1JJ2A 1KQSA 1YI2A 4JYAL 1DGSA 4JI7L 1ASYA 3AFQA 4JCVE 2KHJA 1BBWA 3F2CA 2A1AA 3E0EA 2JA8G 4LUZA 3CCEA 2NVXH 4GKKL 3CCRA 1XTDA 4JBMA 4JI4Q 1WCMG 3A5UA 3K7AH 1TWGH 1YBYA 5IYBG 4DV5L 3RN2A 1PH8A 3KFUA 1A0IA 4BA1I 2KCMA 5C3EH 1FVIA 4POFA 2YV5A 1QVCA 2VQFL 3S2DH 2XGTA 4R1JA 1VQJA 2C35B 4X64Q 2JA7H 1PYSB 3U58A 4A3JH 4A3GH 1I94Q 4A3LG 1XNQL 2WB1G 3MXNB 4Y52H 3ULJA 1X6OA 4LFCL 1PH1A 1VQAA 1PFSA 5EAYA 2D0OA 3F2BA 1EYGA 4LF8Q 3KJOA 2HIXA 3W1BA 4X62L 4DV1Q 1RL2A 1HJPA 1VCIA 3U50C 1IBLQ 4B3ML 4OO1I 4JI1Q 3J7ZC 3PIOA 3U4ZA 2BH8A 2F52A 4YY3L 1UWVA 2ZJPA 1VQBA 4EQ5A 1G6PA 1I3QH 1WJJA 2Z6KA 4PZ8A 1VQLA 2B29A 1HNWQ 3Q8DA 2IX0A 5BR8Q 4A3EH 1YJNA 2CWPA 2R7ZG 1HNZL 3HOZH 4DR7L 3I2ZA 2VQEL 1I5FA 2N8NA 1I50H 3W1GA 4IPDA 3I4NH 5M3MH 3HFZB 3CF5A 2Z6KC 1CKNA 3I7FA 3IRBA 5AJ3L 4A3MG 1IBMQ 3HOYG 1TWAH 4APVA 3RZOH
chains in the Genus database with same CATH superfamily
1W6JA 4YIJA 1TWCB 2MPMA 3DMUA 1OTCA 4DXFA 1QJOA 4XXEA 3VR4A 2ID0A 2K5HA 1Q1BA 1PTOD 3K7AB 2JEAI 2K5NA 3RD4A 3K7UC 2I5MX 1LTRD 2NN6H 2AUJD 4XDXA 5KEEA 2ZJRA 4GOPA 4BS9A 3H0GH 1WD1A 1L1OB 2R93G 3SHLA 3OWFA 2LS01 3HKSA 5DAUA 3SE0A 3PO2B 2MNAA 1OXVA 5CBEE 4R4IA 4KKTA 5FLXL 3EFXD 1N33L 3NTIA 2ICEC 4UP8A 3ND8A 4RAUC 4WORA 3CCQA 2JA5G 4KMUC 5KNBA 4JW0A 1PA6A 4LF6Q 2F0KA 3CC4A 1Z7TA 3SGIA 4A3EB 1WD0A 2MHVA 4EQPA 3GO5A 2WP8J 5T1IA 2HQEA 3KF6A 5C3EG 2EQSA 2XIWA 5LL6S 1HPCA 2HIVA 2Z8LA 1PYBA 5GADC 3T16A 1TWAB 2JA7G 4FDBA 3G4SA 3URYA 3D8GA 1STYA 1CKNB 3NWSA 3T1HQ 4PNYA 5IP7H 1H95A 1GVPA 2PZWA 3BVMA 4EGVA 2ATWA 1PTOB 3J80L 4KI0A 4XIGS 2CFMA 1ONLA 4F87A 3OTOL 4DR6L 2FMMA 5L37A 3CC7A 5C0XJ 1VQCA 2N55A 2OT2A 3PUWA 2I0QA 5D3DA 1B9NA 2ES2A 2UUAL 1FJGL 3RLOA 1DOMA 4BBSH 1BCPD 3PQIA 1CSPA 1PH9A 4RKLA 1JJGA 1GUSA 4BY7G 2VW9A 4JI5Q 2QGQA 2RKSA 1CK1A 4KKUA 1ENAA 2RQXA 4ILWA 4N9TA 3L2PA 3KF8A 1L2FA 5EJWA 5C44G 5ELDA 1XPRA 1CI3M 1W6KA 3GQBA 3LWEA 3EVQA 2K75A 3W2DA 3S1NH 2DUDA 1DONA 3HS0C 5DM73 1L1OA 2G5DA 1QUQB 1PRTD 5JVG3 1LV9A 3U4VA 2VUMG 4KKSA 2HD3A 2UU9Q 1PFBA 1L1OC 1LTTD 2DN8A 1KABA 2CVRA 4A3IH 2KENA 1AH9A 3S1MH 3FKIG 4KN4C 3NUCA 3RZDH 1M90C 4DKAC 1U4PA 2E2DC 1EQVA 4PQXA 4TRDA 1AN8A 4WJWA 4BXXG 1BCPB 5IOCA 3A5ZB 4BBSB 1U4LA 3HRZC 1C9OA 3K0XA 1Q90A 5C0XG 4IPGA 3S17H 4R9WA 1Z47A 2IPKD 1X3FA 4G4KA 1X65A 1QOHA 1EYAA 2F0DA 1SYBA 4EX5A 4KHVA 5ELOA 4A3KG 2CCZA 1T5EA 1S72A 1IBML 1I4GA 4DK3C 4C3JH 1LTSD 4RMFA 1NAPA 3S1NB 4MTNA 1LTID 1A3TA 2Z9HA 2WKDA 3HOWH 3I4OA 3MEFA 4A3JB 1VDZA 3K80C 1A62A 1JJCB 4NXML 1CHPD 1YHBA 1UEBA 1IBKQ 3DWAA 5C5MA 4A3IB 1EOTA 1R9TH 3M4PA 1SYEA 2CQAA 3RZDB 4HEDA 1G51A 1TQOA 4KD4A 4CDFC 3NENA 2F0SA 4DNRB 3CKIB 1EQQA 2E2HH 4GKJL 1SJHD 1R4PB 2TMPA 4DXGA 1OXTA 3NK9A 2F4VQ 1QVFA 1VF7A 1VQMA 1LTAD 3S17B 3KLWA 4J1MA 3MWYW 4X3TA 1FL0A 1CA6A 1SYDA 1FR3A 1SNDA 3P75A 4A3GG 4LNQA 5JPMC 2Y0SB 4BY1B 4KN7C 5BN3A 5M5YH 4A3LH 2RCFA 4IFDI 3VYSA 4DR3L 4C3JB 3M7GA 1YNND 4NXNL 1V8QA 5KIXA 1PH2A 1UAPA 3HOWB 1D5MC 1G291 4YCUA 1VQ9A 4MN3A 4X65L 1IKMA 5G3LF 2H4OA 4DAPA 1VMPA 3HOVH 1R9TB 3CCVA 3V2TA 2WB1E 4LF5L 3VR3A 5ELNA 1MSHA 2PW7A 2K5VA 1SE4A 3I55A 2E2HB 4KY6A 2CQOA 1VQIA 2GVBA 4ZUIA 4L8JA 1DZ1A 1HTLD 1N9WA 4IUQA 5IP9H 2OTLA 3VYTA 2TSSA 2BE5C 2WAQB 3OW2A 4C3HH 1HZ9A 1I4QA 4HJ8A 1MHWC 3UDXA 1X32A 4JI0L 4JI7Q 5M5YB 3LGJA 3WDNA 5CBAE 5EBCA 1BO0A 2Z0SA 1E7ZA 1K73C 1B7YB 1JOKA 2OEOA 4K14A 2IY5B 1VMCA 1KD1C 2K14A 4BBRH 5IYDG 3EN2A 4OO1G 1NNXA 1CTMA 1Q46A 1XNQQ 1HHVA 3HOVB 4ZK9B 2JE6I 2RVLA 1YZ6A 1BBUA 3Q23A 4CJ2C 4B3MQ 2B2TA 3MXGA 2KECA 4IUUA 4GLAC 3A0JA 5D65A 4YY3Q 4OX9L 2DGYA 4DR2L 2JK8A 3EQLC 3ZJYC 3GTLH 5JOBA 5C4HA 3I90A 3PV0A 2E2IH 2H5XA 4ZLTF 5JEAJ 2PI2A 5IYCG 2NZHA 4P73A 1KHIA 1C8CA 1J9OA 3BZCA 1A2UA 5AJ3Q 1Y1WH 2WKCA 3CW2C 2ZTDA 5K5PA 1JR0D 5CV7A 3C3LA 1S4ZA 2MO1A 3EA6A 2B2YC 2QILA 1SNPA 1XYIA 2DJFC 1WTXA 4IJLA 1H9KA 3VR6A 1T5XD 1O7LA 4BBRB 1EUJA 2AQ2B 1A3UA 2FXQA 5CYUA 3VA7A 3PF4A 4IUPA 3MVVA 1S5ED 5H1SE 3AFPA 1YJWA 2YYZA 1M4VA 2JQOA 1EY7A 3AEVA 5CV9A 1N33Q 1UUPA 5I4DA 3M3YH 3VYUA 2RHQB 3A8IE 2K6AA 3GTLB 4NW2A 4LUVA 1LTBD 2E2IB 2EYLA 3SK8A 3E9IA 3ZYYX 1LTGD 4GN5A 1VQDA 2BDNA 1Y1WB 1NSNS 2F3IA 4JI8L 1YNNC 5EKLA 2ZJQA 4DAVA 5EKKA 3RR5A 3KLRA 1JCKB 2LXJA 2PPBC 3GTKH 3T51B 5JEAG 1L0YB 3OTOQ 5HGQA 2R7ZH 4DR6Q 2DNCA 2PMZE 2R61A 3CCMA 1EY8A 3TS2A 1HXYD 3GTJB 1PRTF 4K0KL 3M4OH 3VR5A 3HOYH 4JI2L 1S40A 4DV3L 5GQOA 4GZYC 2HDLA 2KEDA 2UUAQ 1FJGQ 2QDLA 1GUOA 3U9SA 1W2BA 4RCOA 1FNWA 5C4XH 2A74C 2KUMA 4FXDA 3M3YB 4A3CG 2K5DA 5DLQE 3KYHC 4DV0L 1AW7A 1EIFA 3I4LA 1JT8A 3I4MH 3NXWA 3STBC 3DEOA 2Q2HA 1G6ZA 3H09A 3WOFA 3M7NA 5F2DA 1S5FD 4DV7L 4FVMA 4O1NA 1GO3E 3TP8A 4RH6A 4DUYL 2KA7A 3TZUA 1HUMA 4ID6A 3OSOA 4RGTA 3TRZA 1I6HH 1JJ2A 1KQSA 2PQEA 3GTKB 1SNOA 3F2CA 4IUVA 3CCEA 1QILA 3SDZA 4JBMA 1WCMG 2R7ZB 2QF7A 2E75C 3NPPA 5IYBG 1WTRA 4BA1I 1QVCA 3M4OB 3G6JB 2A68C 3HOYB 5CV4A 1TIID 1STEA 3U58A 2WB1G 4NKLA 2RDHA 1S5CD 1PH1A 1VQAA 1CZWA 3F2BA 2HIXA 3W1BA 1PZID 2A6HD 1VCIA 4M8AA 1JOOA 1ENCA 2IL8A 3U50C 2B8GA 4OO1I 3I4MB 1VQBA 1WJJA 2Z6KA 1A15A 5CC4A 3FDTA 2HCCA 3HOZH 1F77A 2V4DA 1I50H 5M3MH 4ZKCB 2Z6KC 1IBMQ 1BNZA 3RZOH 1I6HB 3CPFA 5I2YA 3WOEA 4A93H 4OIJA 2VNUD 3S2HH 3KJPA 3CP0A 1RJTA 4ZYSA 1VQNA 2RDGA 1E2VA 3SK6A 4BWGB 4X3KA 2FINB 4NXMQ 4C56C 2ICIA 2PCFB 4QIWE 1OXSC 3TDQA 4JOIA 3FPUB 3NSWA 3PO3H 1K0SA 2G9HD 3FHWA 2WV6D 4GKJQ 4X66L 4V0BA 2F0FA 5J1ZA 2HT1A 1TWHH 2F0OA 4B3RL 2JN4A 3LX0A 2O5IC 1SEBD 3HOUH 2H1EA 2CW0C 1HA5A 3PGZA 1F9PA 1I50B 1XMQL 2JA6B 5M3MB 4L5TA 1TKWB 1LYLA 2IX1A 1LACA 4DR3Q 3RZOB 4A93B 2B2UA 1G2SA 3H3VI 4NXNQ 4GN3B 4RHSA 1X55A 3PO2G 4X65Q 1U4RA 4MZ9A 2UUCL 2BH2A 4DFAA 4DPGA 3PO3B 4A3EG 4LF5Q 1XMOL 3S15H 1CHQD 2BA1A 4Q5VA 4GOPB 2EZVA 1A6XA 4KY5A 4KD3A 4GNXA 1KIXA 5FJ8H 2F0TA 1HZCA 1PZKD 1TWHB 3C2PA 1MJEA 2NTSA 2NZOA 3HOUB 1VS0A 1A2TA 2R92H 1PZJD 2F0JA 2PW5A 5E3FA 3V05A 4A3BH 4JI0Q 3KBXA 5CR3A 3J81c 2NN6G 1QE6A 3KF6B 1SJED 3E3XA 1Y1VH 4G7HC 2LY7A 3GTQH 1MGSA 4DA2A 3D3RA 3X3NA 1WTVA 1D1KA 4HMIA 4DAYA 3BVGA 4DN4M 2EIFA 2QKIC 1ET6A 3I72A 1U9RA 5EPKA 2Z1CA 1VQ6A 5M3FH 1GM5A 4IFDJ 2KEEA 4C1NI 2B63H 3BZDB 1N8RC 4RGOS 1KAWA 4IO9A 3I73A 1RTNA 3MTSA 5ELCA 5KRUA 2MP1A 4OWWB 1CT1D 4OX9Q 4DR2Q 1I94L 1IKLA 4HJAA 3UDGA 4LWCA 2NWGA 5IP7G 2EYHA 2MFIA 2B2WC 4E6IA 1WTOA 4PG3A 3BJUA 4Z9CB 1WFQA 4A3BB 4FYDA 1BBXC 1HNWL 2K5QA 4J6HA 2RSNA 1TR5A 4MIUA 3HKZB 5C6AA 1V1QA 1Y1VB 3KF8B 1GUNA 2KHSA 3GTQB 3TP7A 1I4PA 1JB3A 5I6YA 1QCBD 1X3EA 3Q6SA 2E5LL 4LAAA 3BYYB 2B63B 1K3RA 2VL6A 4NPSA 5FOBB 1K8GA 5DEHA 4GOPC 5NUCA 4O0AA 4LUOA 1D8LA 1C48A 1NTGA 1II3A 4PMWA 2IW3A 5K36H 2L0CA 1SXTA 3TREA 2KCNA 1CQFA 2DNEA 5IY0A 4DUZL 4IFDG 2K33A 5CMDA 2E2JH 1PLFA 3I4NB 3H94A 5IGCA 1EFID 2CKZB 3OW7A 3EROA 3LWUA 4CDEC 1K8AC 2D5DA 4A3JG 4JI8Q 4P75A 1L0XB 1PV4A 1SN8A 3FP9A 3OYYA 4A3IG 1IYVA 2RCNA 4B3TL 3ONAB 2PNHA 4IPHA 3K59A 2RHSB 4C3IH 3PF5A 3KOJA 4IALA 3NEMA 4K0KQ 1VF5C 4JI2Q 3H0GB 4DV3Q 3HGBA 1F2MA 3CCLA 1Y14B 2L9HA 4AYBB 3ITPA 1DD2A 3BZKA 4K2LA 4A3MH 2CWAA 1CKOA 4DV0Q 2Y0SG 1X56A 2J4XA 5JJLA 2F0VA 4BY1G 2JEBI 2L1BA 1PVOA 1Z6HA 4C3JG 4DR4L 4DV7Q 4HIKA 1O7YA 5HY6A 2E2JB 3NELA 1TY2A 3IFTA 5C4JH 2BE5D 3KK7A 5EQ0A 1K8MA 3CRKC 4DUYQ 2YTXA 1KL9A 4FF1A 2B3GA 2B2VA 2ZTCA 2CH4W 2Z6BA 1TXYA 3E6ZX 1JB7A 4LMQD 2RBMA 1GHKA 5C5LA 2UXDL 5FK9C 3EIVA 4IOCA 4C3IB 2NN6I 1GUTA 2UXCL 4AH6A 2JA5H 2UXBL 3BDOA 1ZKOA 4R4TA 1FD7D 2F0GA 1C4QA 2WAQG 5KYLA 4F88A 3DHQA 4JK1C 1PMRA 3K5MA 4L63B 2L15A 5ELBA 2SDFA 4OGQC 1XJVA 2GN5A 3FMCA 3PIO3 5C4JB 3QR8A 4POGA 1NR4A 5GAEC 2F0UA 3VR2A 1ICFB 1B50A 3IFDA 3HOVG 3PUZA 1TS4A 2I07B 5IGDA 2EYOA 2ASBA 2F0LA 1LTLA 5DM63 4UHVA 5HURA 2XWJB 3ER0A 3DM1A 2QA4A 1PH5A 2JA5B 1STHA 2EYMA 3S1MB 4DV6L 1QZHA 1XNRL 1SR3A 2M00A 3B6YA 4X66Q 3VDYA 2JA8H 3S1QH 5C44H 4B3RQ 4HSVA 1B70B 1LT4D 1Q8IA 1AZQA 3PIP3 2L12A 1WI5A 1SYGA 1JE5A 1DOLA 1XMQQ 4YHHL 3RLFA 1SNMA 2VUMH 2D62A 4BBRG 1ZYRC 2L4NA 1M8AA 3T1YL 1KNAA 2NVTH 3PSIA 4OWXB 2ZTEA 4FXKC 2E8GA 2VZAA 1PH4A 5KGUA 1EY4A 1N34L 1QNKA 3A7AB 1WTHA 2XSCA 1NUCA 3J81L 2UUCQ 2MQHA 5EGTA 5C0XH 3O13A 4NB3A 3L7ZC 4KLKA 1M1KC 4DR5L 1XMOQ 4JYAL 1JICA 1HR0L 4A3KH 1Y1WG 2YU9H 4JC0A 2JA8B 3S1QB 1D5XC 1D2BA 5C44B 1KRSA 4XQNA 1ESFA 4PZ6A 2R6GA 1BOSA 1TT2A 3GV3A 3CU7A 1FYCA 3STBD 4CHTB 2EJMA 4CJ1B 1D5ZC 3K81C 2EXDA 3TQYA 3WWVA 2VUMB 1UNSA 3M85A 1IYJB 1PH7A 2EE1A 3BVZA 4JV5L 4RWSC 5LL6X 1EFWA 3PCOB 2NVTB 5IIFA 1YI2A 1PTOF 1FNVA 1GUGA 4K2KA 1U4MA 3CCRA 1RF2D 1XTDA 3OWEB 1V1PA 1TWGH 4H7BA 3RN2A 4DV5L 1TVXA 1A0IA 1RDPD 2A68D 1DM0B 2PZTA 2VQFL 3S2DH 4R1JA 3OMCA 3KLSX 3J81E 1EU3A 4ZUJA 4A3GH 1I94Q 4A3KB 4Y52H 3CRLC 4G57A 2F3WA 4LFCL 2J0TD 1PFSA 2B2TC 4XQJA 1RL2A 1HJPA 5D14A 5JJZA 4H44C 2L5TA 3PIOA 3J7AV 4FO2A 4EQ5A 3KUPA 4C3HB 4PZ8A 1VQLA 2B29A 1HNWQ 2R7ZG 1YJNA 4DR7L 3NQIA 1I4RA 2K1BA 1I5FA 1EZ8A 1F2LA 1H9RA 1QB5D 1XX8A 2X69A 1ILQA 3HOYG 1IW7D 4APVA 4LK1C 3L9AX 3KDFA 4CKCA 1TS2A 1DCZA 1K28A 2E5LQ 1YNXA 3DXJC 1TWGB 4HTHA 4FP5D 1X3PA 4ULLA 4CKBA 1SE2A 1V43A 4RCNA 3S2DB 3NTKA 5JPNC 2G9DA 3VA5A 5J39A 1CQVA 2N3SA 5IWAL 4OONA 1WTPA 1J8IA 1TS3A 1EEID 1BCPF 2HDMA 3NTHA 5BN5A 3PIPA 3OMGA 4DUZQ 1JWSD 3DWQA 4S3SA 2NVQH 5ISRA 4XT3B 2N49A 3SEBA 4H13C 5A35A 1RD9D 2CW0D 4L5QA 5EBDA 2PQAA 3RLNA 2EVBA 1SE8A 1JOQA 1SYFA 4GS3A 1JQYD 2RF4A 4B3TQ 2B8FA 3MEHA 4KV6A 3A7LA 1S3OA 1Y8OB 4ABNA 3TS0A 3DM3A 2IT1A 1AFPA 2A73B 3DEPA 1HTPA 1EY0A 2EYPA 1PXUA 4IJHA 5DNFA 3AU7A 4KK7A 1NMGA 1KTKA 5IYCH 2VY3A 1KLGD 1N36L 3UDIA 1DOKA 2JA6G 1OXUA 3R2TA 3D31A 2A8VA 4DR4Q 4N8FA 1EYDA 4A93G 3HOXH 2NVQB 4A3FH 2WIIB 4AIMA 4UDUC 2F0WA 4JI6L 3K58A 2XN9C 4I7AA 2CH4A 4ME3A 1K0RA 3K8AA 2J7ZA 3FVQA 1GD7A 1ENFA 1NR2A 3PO3G 2UXDQ 1PH3A 2MUYA 2K32A 4X3UA 5JAVA 3M4YA 4ODGA 2UXCQ 3R93A 1EL0A 3S16H 2UXBQ 3QOJA 4DAMA 3J81i 3Q0AA 2KJXA 1NE3A 1LLRD 4JI4L 1FNUA 4DGZA 1HR0W 1VQEA 3I70A 2N88A 4MTKA 5C4XB 5C3WA 1G91A 2NTTA 4PMCA 4X64L 3A74A 1TU2B 2D0PA 3GD7A 1CFMA 1JMCA 4A4IA 1D6EC 2HQLA 5GAGC 3HOXB 4GNXB 3MXPA 4HCSA 4A3FB 2QEJC 3E9HA 3VYRA 1X54A 1IBLL 1E0BA 2EYJA 3L0OA 4JI1L 2EJGC 4WJ3M 2GVAA 2WACA 1KDAA 2A69C 5FKAC 1J6QA 1TS5A 2WFWA 3IL8A 4TKOB 1KXLA 1IW7C 4XT1B 2JSOA 3AQQA 1Q86C 2EPBA 1LABA 2LSSA 1NY4A 1SFOH 2IHEA 5FJ8G 1HNXL 5A2QE 4DAYB 4R8NA 4DV6Q 1KAAA 1XNRQ 1C0AA 1DXMA 4G7OC 4IUNA 3PUYA 4JOIC 4DV2L 1IL2A 1NJIC 2EOTA 1VQGA 2Y0SE 4A3BG 1HQMC 3GTOH 3ERQA 3D4DA 2PI2E 1DYQA 4WJ4A 4EVOA 3TN2A 2I5LX 4LF9L 4U68A 1U0LA 4YWLA 4QB4A 1IBKL 1Y1VG 2XTIA 4HJ7A 3PMFA 1K9MC 1AE2A 3HOZB 1G2TA 5I6WA 4YHHQ 3D4RA 1Y8PB 5IYBH 2AHOB 1B8AA 4LFBL 2D2CC 3E5SA 2XRQD 1VQ7A 1YVCA 1IZ6A 1DJRD 1E1TA 4A75A 3T1YQ 4IN3A 1Q1EA 3S2HB 5I9OA 2AWNA 4K5VA 4EQNA 3Q22A 4A3DH 4DR1L 3MFGA 2QDBA 3DUZA 1CSQA 2B2UC 2OCEA 1MD2D 1KNEA 2F0HA 4IOAA 1O78A 4HCEA 4RKBA 3EBEA 1KDCA 5FLMH 4DR5Q 2R7FA 4JYAQ 1EY9A 4B3SL 4JVZA 4CDCC 2WAQE 3K0YA 3I4NG 1HZBA 1KDBA 4P72A 3GTOB 4DV4L 1N32L 2B39A 1F9RA 1JWMD 4ZKBB 4K5XA 3AYHB 1BF4A 3W3AA 3HEJA 4OL7A 4GNXC 1IL8A 3N52A 2M2LA 5EKIA 1PYWD 1XPOA 1XWEA 1Q81C 5LMUL 1RTOA 4IPCA 4JV5Q 3H0GG 1W3SA 2BA0A 4JPBW 4A3DB 4AYBG 4PMBA 3NQTA 1RCVD 2WB1B 3GP7A 4XQQA 4WFN3 3K57A 1EIGA 1S5BD 5JJIA 1WTQA 3MXUA 1EY6A 4DV5Q 4HN7A 4IUTA 4KJOA 1E2WA 5K36G 2UUBL 3A8JE 2IX3A 2MGSA 2YTYA 2VQFQ 1LM0A 1TWCH 3K5NA 3S15B 4FXGC 2ZM6L 3ICEA 2AQ1B 2SNSA 1VQ8A 4IZ8A 1STNA 2AUKA 4LFCQ 3MAQA 5G3LD 1ZXTA 1R4QB 3S14H 2KCCA 4IQZA 3GTMH 1HCZA 3PUVA 1SYCA 1YNJC 1J5EL 2R92B 5E7NA 4KJNA 3PO2H 4BA2I 1UE7A 2RA4A 1CA5A 4DR7Q 3GV6A 4HIMA 2Q8TA 3S9WA 1D1IA 1AZPA 1RODA 2A6EC 4QMGA 4GLXA 2RSOA 4JBJA 5E1FA 3G7LA 4N9PA 1H9SA 2OWOA 2D9UA 4ZRZA 4BBSG 1B53A 1EEFD 5M3FB 1SBBB 1BDOA 2KHIA 4A76A 5GAHC 1EY5A 2HUGA 4LF4L 2O2LD 2SOBA 1PTOH 2JP1A 2Q8RE 4RG1A 2Q8IB 2F0MA 3S1RH 5IWAQ 3TBIB 2K28A 3NWTA 2MO0A 2O4XA 3QG1A 5IT9E 1BR9A 3MHBA 4G7ZC 2R7DA 3HG9A 4LF7L 2Z4HA 3NBHB 1KC8C 3S14B 3GTMB 3Q24A 1LO5D 3D0FA 1P16A 4FNFA 5LMNL 5AFWA 2QCPX 1O7IA 4B08A 3CPWA 3KBGA 1ZYRD 3G71A 2QEXA 1NCVA 3PUXA 3D6CA 1B44D 3JAME 1Q7YC 5FO7B 1C7YA 4NMZA 4JBKA 2EDGA 2VB3X 2VXWA 3SR1A 4RGMA 2KVMA 2ENBA 4LJZC 1JWUD 1D7QA 1MIUA 3G6EA 1N36Q 3BDLA 5IODA 1GKHA 1NBWA 3S1RB 2C5CA 4XTCS 3C1EA 3MXNA 1BXTA 2WINB 4P2CB 1SAPA 1Q12A 3ERSX 4J8QA 4R4OA 4QUFA 2BOSA 4OHJA 4I7ZC 4CBVA 4KHPL 3KLSA 3HOWG 3EJIA 4JI6Q 4X6AH 2XNAC 3P7JA 2Q2TA 1X9NA 1STAA 5IGGA 5IGEA 2PMZB 2ZT9C 3CMEA 1B2TA 1F2YA 1UEAB 2R93H 1HFNA 4ME5A 1E22A 1U5KA 1CUKA 2F0NA 2EY5A 2B2VC 3H6MA 5FLXE 4QGUA 1OO9B 1DGSA 2K01A 1ASYA 1FGBD 2FFKB 4JCVE 2KHJA 1BBWA 2JA8G 4LUZA 4GKKL 2NVXH 1TY0A 4IFDH 4JI4Q 1YBYA 2X6LA 1PH8A 3KFUA 5CGKA 4H0LC 3NBHA 4HSPA 4O42A 4F8MA 5C3EH 1FVIA 4DK1A 4POFA 2LMCB 1B1ZA 2YV5A 4A3MB 1LT6D 2XGTA 1LT5D 3SXHA 2NUCA 2XRSD 2JA7H 4X64Q 1PYSB 1GOZA 4A3JH 4N8X1 4A3LG 1XXGA 5HGTA 3P20A 1I4XA 3MC0B 1X6OA 3J80E 2D0OA 4FF4A 1GHJA 4X62L 1PFNA 1ET9A 3J7YW 1IBLQ 4JI1Q 2F52A 1UWVA 3QIAA 5EPLA 2ZJPA 5I2XA 2LFNA 1G6PA 1I3QH 3Q8DA 2IX0A 2VB2X 2CWPA 1HNZL 2FMCA 3I2ZA 1HRJA 2VQEL 2R93B 2N8NA 1ILPA 1MI2A 1IYUA 4C1NK 3HFZB 3CF5A 1CKNA 1PDQA 4CDDC 1EWIA 2HHHL 4BY7H 4CJ0B 1MJCA 2JXMB 1HNXQ 1VQHA 4BY1H 4JI3L 3CQZH 4CGYB 5KYIA 2NVXB 1WOCA 3UI2A 2OQKA 4UP9A 2PYKA 4F7XA 4YWKA 5IP9G 1PTOC 3BU2A 1V1PB 4HAEA 3BS1A 3P1HA 5C3EB 4DV2Q 4NP5A 1L0WA 4C3HG 1O80A 2JA7B 1PRTB 3J81j 3BDCA 4AQYL 1E2ZA 2KBNA 3TEHB 3RMHA 2SNMA 1RIPA 3AB9A 1PH6A 4LF9Q 2EJFC 4QCLA 4K6LA 3A54A 1SNQA 2BCOA 2F4IA 2OF1A 5CORA 5CV5A 2L55A 3MA2B 3R2IA 5M5WH 3D4WA 3G48A 3FRPB 4LFBQ 2F3VA 1I3QB 1A3VA 3JAMi 1JC7A 5JJKA 4QIWB 1CM9A 3RUZA 2EY2A 3FKIH 2K50A 4DR1Q 1ESRA 3OIPA 3SK5A 3JC66 4BXXH 1SROA 2R3ZA 2XWBB 4BY7B 1S5DD 2OQ0A 5I9PA 3KDFB 1QUQA 5EPJA 1QG7A 3HZXA 3CQZB 2O5JC 4B3SQ 4YWMA 3AMUA 2EYFA 3MZ5A 1BKBA 1B9MA 1VQ5A 4QF4A 1A63A 2CHBD 4LFAL 2NVYH 4DV4Q 4OIKA 2NZ1D 1N32Q 3NBIA 4DK0A 5LMNW 2PNRC 4L5RC 3IKJA 1PFMA 1YEZA 3I3CA 3R3OA 4GN4B 4PV1C 3C1FA 3I56A 5M5WB 1E3PA 4PZ7A 1BCPC 5LMUQ 2L11A 4YCWA 2K04A 3DLLA 3OIQA 3MFYA 3NHHA 3FKIB 2AKWB 2PQAB 3K5LA 2Q2IA 4QJFA 2ALYB 2E76C 3A55A 3F1ZA 2F0PA 1HQRD 2UUBQ 1Q82C 1QWYA 4UY8C 5D3IB 2ZM6Q 1E1OA 1HUNA 3CD6A 5J3BA 1PRTC 1GJXA 1SMXA 1NMFA 1K8OA 2YU9B 3N6RA 3GTPH 2NVYB 1O7ZA 3J80i 3UDFA 3HKZE 1T9HA 4QY7A 2A5HA 3CCJA 3J7AF 1UE1A 4K8JA 1PHJA 1J5EQ 1KRTA 4XYQA 4TSSA 5LHY1 1EQRA 4HR7B 5KNCA 3C46A 1EYCA 4CKEA 3CCSA 1YIJA 4DV1L 4LF8L 1YHAA 1X3GA 5IT9c 2A69D 4LW1A 3V96A 4KY7A 1SE3A 1WTWA 2ZXRA 5BR8L 2YTVA 3W5OA 2NYZD 1GXDC 1QNUA 5C4XG 3TZDA 3CCUA 4TQUS 2B2YA 4NDXA 1JORA 2K03A 2LXKA 5C0XI 3I4MG 4R4QA 4LF4Q 5IGBA 1LUZA 4OEMB 3K6OA 1SRUA 3HOXG 5C4ZA 1QZGA 1XTCD 4P74A 1ASZA 3JAMc 1WYDA 4A3FG 4A3GB 3UE0A 2E74C 3U9OA 4LF7Q 3GTPB 4OWTB 3GTJH 3CHBD 2RDFA 3H15A 3M4QA 1Y8NB 3UE1A 1VQKA 5LMNQ 5IE8A 2NB0A 5E4XA 3NP8A 1BVSA 4EQOA 1RKNA 4DU9A 4TVAB 1SMYD 1UE6A 5IYDH 1UE5A 4OO1H 1AEXA 4K5WA 1K83H 4AYBE 4LF6L 4RGNA 1A8VA 2IHFA 5CV8A 4JBWA 3A8KE 2JA9A 3RN5A 3CMAA 3H91A 1HH2P 4UAIA 4B9WA 4Y7NH 3T1HL 4JG2A 3T4AC 1BUVT 1ICWA 1TWFH 1I6VC 1KLUD 3HOZG 1K3BC 5FLXc 4Q0FA 5E4WC 5M3MG 4HIOA 1EZ6A 4QL5A 3NE5B 1EOVA 3QOLA 4MNOA 5CV6A 2FHTA 4OXPA 4KHPQ 1Q3LA 1CKMA 4K8IA 1STBA 5M5XH 2F0QA 3OOCA 4FF3A 2DY7A 4DF7A 4M1UB 2XVSA 3L3OC 1SLJA 4RFBA 4RA8A 4JI5L 4H02A 3T56B 1K83B 4L5SA 5A2QL 2EY6A 3FEWX 2OTJA 3J80c 1MSGA 1I4HA 3I8ZA 1VQFA 4ZQ3A 1SNCA 5C3XA 4GKKQ 5FO9B 4HJ5A 2X6GA 4Y7NB 3HOUG 1E24A 3H3VH 3CXCA 1BQQT 1LT3D 1TWFB 1CZGA 4C2MH 2K5WA 2SEBD 4R4CA 3J7A5 3I91A 3CAMA 3LNNA 1MKHA 2UU9L 2F03A 1EWHA 2Q2UA 4X62Q 5JEAH 2M9VA 2C9OA 1YNJD 4P71A 4WRDA 4ALPA 1WVLA 4L6TB 1QVGA 4A3DG 3SVMA 4HJ9A 5M5XB 1MBYA 1YHQA 1RHPA 1SDFA 4DNIA 1AE3A 5FO8B 2K05A 3CC2A 2EY1A 1HNZQ 4V190 4DNTB 2AQ3B 2A6ED 2VQEQ 3M9BA 1ML0D 5FLMG 1F9QA 1V9PA 5BN4A 2A19A 3TP6A 1Q8KA 2DJGC 3A56A 4GLVB 1F2ZA 2K52A 4B9XA 4A3CH 2HHHQ 4HIDA 2AWOA 3TMEA 3S16B 2KOLA 2F1MA 4R8IA 2JA6H 4QQBX 4JI3Q 1B3QA 3ULPA 1OXXK 5COYA 5J22A 1FGUA 1H9JA 2EXZA 4XYOA 3T53B 5TSSA 1G8ZD 5JVH3 1XPUA 1VQPA 2R92G 1IHZA 2OXPA 4C2MB 4KHZA 4AQYQ 1B4OA 1VQOA 2F0EA 3BYTB 3HKZG 1YITA 2BDOA 4MHEA 3HP3A 3GDEA 1SMYC 1WCMH 3T13A 3S24A 5M3FG 5IGFA 4I65A 4UP7A 3GTGH 2N78A 2B63G 2F4VL 3D6WA 2AMCB 1Z9FA 4DK6C 2ZXPA 3TP5A 1N34Q 1EWCA 4UPAA 3F8TA 1P8LA 1IXRA 4U673 1SFOB 1H9SB 2K4KA 2I46A 2ZXOA 2K7VA 4RHRA 1HR0Q 4OELB 3RNUA 4LFAQ 5T1GA 1AP0A 1YJ9A 2F0IA 3F2DA 2JYOA 4J15A 4YCVA 3SK4A 3ND9A 1EQTA 1HA6A 1VQ4A 2JJQA 2KCTA 1STGA 3K5OA 2V1CC 3R8BA 4O2DA 2LKVA 5GROA 1WCMB 1GUWA 4K6DA 3DWPA 1Y69U 2VS1A 3QO2A 3OPOA 4FF2A 3QWNA 1EIYB 4HMJA 3GTGB 4IURA 2I5HA 1H9MA 2PO4A 3QB3A 3OHXC 3FPPA 4ZAIA 2HCIA 3ULLA 1SSOA 3X3MA 5IT9L 1HZAA 2MJ8A 4QUCA 4JI7L 2NBFA 3AFQA 3H3VC 2A1AA 2QW7A 3E0EA 2PZUA 1HFGA 3QJYA 3IAYA 3A5UA 3K7AH 2KQ3A 1EIHA 1EU4A 2KCMA 2DY8A 1VQJA 2C35B 5ELEA 5KNDA 4ZCKA 4X3SA 3E0JA 1XNQL 3MXNB 5ELFA 3F2UA 4KTAA 1F9SA 2GA4B 3ULJA 3JAML 1EYGA 5EAYA 4LF8Q 3KJOA 5M9OA 4DV1Q 4C3IG 1V1OA 4B3ML 1ZEQX 3J7ZC 3U4ZA 2BH8A 2B2WA 2A6HC 2Z4IA 3BG3A 4YY3L 2P5ZX 2IJ0A 5BR8Q 4A3EH 1B3AA 3TSSA 3W1GA 2IWHA 4IPDA 3I4NH 1X3QA 3I7FA 5AJ3L 3IRBA 4A3MG 1TWAH 2FJ2A 1JE4A
chains in the Genus database with same CATH topology
3CPFA 4A93H 2VNUD 3S2HH 3KDFA 1EWIA 3KJPA 2HHHL 3CP0A 4BY7H 1VQNA 1MJCA 1OTCA 1HNXQ 1VQHA 2E5LQ 4BY1H 4JI3L 3CQZH 1YNXA 1WOCA 2ID0A 2K5HA 1Q1BA 2OQKA 2JEAI 2K5NA 4UP9A 3K7UC 4YWKA 5IP9G 2I5MX 4NXMQ 4QIWE 1OXSC 3BU2A 4DV2Q 4JOIA 1V43A 1L0WA 3PO3H 3J81j 2ZJRA 4AQYL 4GOPA 3FHWA 2KBNA 3H0GH 3TEHB 1L1OB 1RIPA 1PH6A 4LF9Q 2N3SA 5IWAL 4OONA 2R93G 4GKJQ 3HKSA 3PIPA 4X66L 4DUZQ 2MNAA 1OXVA 4R4IA 2HT1A 1TWHH 1N33L 4B3RL 5M5WH 4UP8A 2NVQH 3G48A 3CCQA 2JA5G 3HOUH 4LFBQ 2N49A 1PA6A 3JAMi 4LF6Q 5JJKA 3CC4A 3SGIA 4L5QA 2PQAA 3GO5A 3FKIH 3PGZA 2K50A 3RLNA 1SE8A 2WP8J 4DR1Q 3KF6A 5C3EG 2EQSA 4GS3A 1XMQL 4L5TA 1LYLA 2IX1A 2HIVA 5GADC 1PYBA 2RF4A 3JC66 4DR3Q 4B3TQ 2JA7G 4FDBA 3G4SA 4BXXH 1SROA 1CKNB 3H3VI 3T1HQ 4NXNQ 4GN3B 5IP7H 1H95A 1GVPA 1S3OA 2OQ0A 1X55A 3TS0A 3DM3A 1QUQA 2IT1A 3KDFB 2ATWA 3PO2G 4KI0A 4X65Q 4IJHA 4XIGS 2CFMA 4B3SQ 4MZ9A 4YWMA 2UUCL 3OTOL 4DR6L 1BKBA 1NMGA 1VQ5A 2BH2A 3CC7A 5IYCH 1A63A 5C0XJ 1VQCA 4LFAL 2NVYH 2VY3A 4DV4Q 4DPGA 1N32Q 3PUWA 1N36L 3UDIA 4A3EG 4LF5Q 5LMNW 1XMOL 4L5RC 3S15H 2I0QA 2BA1A 4GOPB 2JA6G 2UUAL 2ES2A 1FJGL 1OXUA 3RLOA 4GNXA 1KIXA 5FJ8H 1YEZA 4GN4B 1HZCA 3D31A 2A8VA 4BBSH 1MJEA 3I56A 3HOXH 4DR4Q 1CSPA 4A93G 1E3PA 4PZ7A 1PH9A 4A3FH 2NZOA 4BY7G 1JJGA 2VW9A 1VS0A 4AIMA 4JI5Q 5LMUQ 2R92H 4YCWA 4JI6L 2QGQA 3DLLA 4A3BH 4ME3A 1K0RA 2AKWB 3K8AA 4JI0Q 3J81c 2NN6G 2PQAB 1GD7A 2Q2IA 4QJFA 3L2PA 1L2FA 2ALYB 3PO3G 3KF6B 5C44G 1PH3A 2UXDQ 3F1ZA 1Y1VH 1XPRA 3GTQH 2K75A 2UUBQ 2UXCQ 3S1NH 1Q82C 2DUDA 3S16H 2EIFA 2UXBQ 4DAMA 1L1OA 3J81i 4UY8C 1VQ6A 1QUQB 5M3FH 2ZM6Q 1E1OA 1NE3A 1GM5A 4JI4L 4IFDJ 3U4VA 2VUMG 3CD6A 5J3BA 1VQEA 1HR0W 1N8RC 2B63H 1SMXA 2UU9Q 1NMFA 1KAWA 3GTPH 4IO9A 3J80i 1L1OC 3UDFA 4A3IH 3HKZE 2KENA 1T9HA 1AH9A 4QY7A 3S1MH 3CCJA 3FKIG 4X64L 4OWWB 1UE1A 3A74A 3RZDH 1PHJA 1M90C 4DKAC 2D0PA 4DR2Q 1J5EQ 3GD7A 1KRTA 4OX9Q 1I94L 4BXXG 1EQRA 1JMCA 4A4IA 3A5ZB 2HQLA 5GAGC 4HJAA 3UDGA 4GNXB 1C9OA 3K0XA 4LWCA 5IP7G 3CCSA 4DV1L 1YIJA 1YHAA 5C0XG 2MFIA 3E9HA 1X3GA 1X54A 4IPGA 1IBLL 3S17H 4PG3A 3BJUA 3L0OA 4JI1L 5IT9c 4WJ3M 1WFQA 2GVAA 4LW1A 1Z47A 1X3FA 1X65A 1J6QA 2WFWA 1KXLA 4EX5A 1HNWL 5BR8L 5ELOA 3AQQA 4A3KG 2YTVA 1Q86C 3W5OA 2CCZA 5C4XG 1V1QA 3CCUA 1S72A 4TQUS 1IBML 3KF8B 2LSSA 1NY4A 4DK3C 1SFOH 4C3JH 2LXKA 4RMFA 5C0XI 3I4MG 4MTNA 2IHEA 4R4QA 5FJ8G 4LF4Q 1LUZA 1X3EA 3HOWH 1HNXL 2E5LL 1SRUA 3I4OA 4DAYB 3HOXG 4DV6Q 1XNRQ 1QZGA 1ASZA 4P74A 3MEFA 3JAMc 1WYDA 3K80C 4A3FG 1A62A 1JJCB 1C0AA 3UE0A 3PUYA 4JOIC 4NXML 1YHBA 4DV2L 4LF7Q 1K3RA 1UEBA 2VL6A 1NJIC 1IBKQ 1IL2A 4NPSA 1VQGA 2Y0SE 4OWTB 1K8GA 3GTJH 4A3BG 4GOPC 3H15A 1R9TH 3GTOH 3M4PA 3M4QA 2PI2E 4LUOA 4O0AA 1D8LA 1G51A 3UE1A 1VQKA 4WJ4A 5LMNQ 1NTGA 3NENA 2I5LX 5IE8A 4LF9L 4PMWA 1EQQA 2E2HH 4GKJL 1U0LA 4YWLA 1IBKL 1BVSA 1Y1VG 3TREA 5IY0A 2XTIA 4DUZL 4HJ7A 4TVAB 4IFDG 1OXTA 1K9MC 1AE2A 1UE6A 2F4VQ 1QVFA 5IYDH 1UE5A 1VQMA 4YHHQ 3KLWA 2E2JH 5IYBH 2AHOB 1B8AA 4LFBL 1K83H 1FL0A 2CKZB 1VQ7A 1YVCA 4AYBE 1IZ6A 4LF6L 1E1TA 4A75A 3T1YQ 1K8AC 1A8VA 1Q1EA 2IHFA 4A3JG 4JI8Q 4A3GG 2AWNA 4P75A 4LNQA 1PV4A 1SN8A 4A3DH 4JBWA 3FP9A 4DR1L 3OYYA 5M5YH 2JA9A 4A3IG 4A3LH 3RN5A 1CSQA 3CMAA 4IFDI 2RCNA 1HH2P 2OCEA 4DR3L 4B3TL 2PNHA 4IPHA 4Y7NH 3T1HL 4JG2A 4NXNL 4IOAA 2RHSB 1PH2A 4C3IH 3PF5A 3EBEA 3KOJA 3NEMA 4K0KQ 1TWFH 5FLMH 1G291 4YCUA 1VQ9A 4DR5Q 2R7FA 4JYAQ 4JI2Q 4X65L 4DV3Q 3HOZG 4B3SL 3CCLA 1Y14B 2WAQE 5FLXc 3I4NG 5M3MG 1HZBA 4HIOA 4QL5A 4P72A 3HOVH 1N32L 4DV4L 1EOVA 4MNOA 3CCVA 3BZKA 4A3MH 2WB1E 4LF5L 2CWAA 4OXPA 4KHPQ 1CKOA 5ELNA 4DV0Q 3AYHB 1CKMA 2K5VA 2Y0SG 1X56A 3I55A 5M5XH 4GNXC 4BY1G 5JJLA 2JEBI 2CQOA 1VQIA 1PVOA 2GVBA 4DR4L 4DV7Q 4HIKA 5HY6A 3NELA 1SLJA 1XPOA 1N9WA 4H02A 4JI5L 5IP9H 5C4JH 1Q81C 5LMUL 2OTLA 4L5SA 4DUYQ 4IPCA 2OTJA 4JV5Q 2YTXA 3H0GG 4C3HH 3OW2A 1HZ9A 1W3SA 3J80c 1KL9A 4HJ8A 2BA0A 2B3GA 2ZTCA 3UDXA 4JI7Q 4JI0L 4AYBG 1VQFA 1TXYA 3LGJA 1JB7A 4GKKQ 2UXDL 4HJ5A 5JJIA 3EIVA 3HOUG 1E24A 4DV5Q 4IOCA 3H3VH 2Z0SA 1E7ZA 3CXCA 1K73C 1B7YB 5K36G 2NN6I 2UUBL 2UXCL 4AH6A 2JA5H 2IY5B 2YTYA 2VQFQ 2K14A 1KD1C 1LM0A 2UXBL 4BBRH 1TWCH 4C2MH 4R4CA 5IYDG 3J7A5 3EN2A 2ZM6L 3CAMA 3ICEA 4OO1G 1VQ8A 1Q46A 1MKHA 1XNQQ 4R4TA 2UU9L 4LFCQ 2JE6I 2WAQG 2Q2UA 1YZ6A 4X62Q 1BBUA 4ALPA 4P71A 1QVGA 3GTMH 3S14H 4B3MQ 3PUVA 4A3DG 2L15A 4GLAC 3A0JA 4YY3Q 4HJ9A 1J5EL 2DGYA 4DR2L 4OX9L 2JK8A 3ZJYC 1YHQA 3GTLH 1XJVA 5E7NA 4DNIA 3PO2H 1AE3A 3CC2A 1UE7A 3PV0A 2GN5A 4BA2I 4DR7Q 4HIMA 2H5XA 1HNZQ 2E2IH 5JEAJ 2PI2A 2VQEQ 5IYCG 2NZHA 3M9BA 4P73A 1KHIA 5FLMG 1V9PA 2A19A 3BZCA 5AJ3Q 4GLXA 1Q8KA 4JBJA 1Y1WH 4POGA 4GLVB 3CW2C 2K52A 5GAEC 2ZTDA 4A3CH 2HHHQ 4HIDA 2AWOA 2OWOA 2JA6H 2MO1A 3PUZA 4JI3Q 3HOVG 4BBSG 4QQBX 2ASBA 3ULPA 1LTLA 1OXXK 2KHIA 1FGUA 4A76A 3ER0A 2QA4A 5GAHC 1PH5A 1XPUA 2R92G 1VQPA 4IJLA 4LF4L 4KHZA 4AQYQ 1EUJA 4DV6L 1QZHA 1XNRL 2FXQA 4RG1A 1VQOA 3PF4A 3S1RH 5IWAQ 1SR3A 2MO0A 5H1SE 3HKZG 3AFPA 1YJWA 4LF8L 2YYZA 1YITA 2R7DA 4LF7L 3B6YA 2JQOA 4X66Q 3NBHB 3VDYA 3GDEA 2JA8H 3S1QH 1KC8C 3AEVA 1N33Q 5C44H 4B3RQ 3M3YH 1WCMH 3D0FA 1P16A 1B70B 5LMNL 2RHQB 3S24A 5M3FG 1WI5A 4LUVA 4UP7A 3GTGH 2N78A 1O7IA 2B63G 3E9IA 1JE5A 2F4VL 2AMCB 3CPWA 1XMQQ 1Z9FA 4DK6C 4GN5A 3RLFA 4YHHL 2VUMH 1VQDA 3G71A 2QEXA 2D62A 1N34Q 4BBRG 4UPAA 3PUXA 2F3IA 3F8TA 1P8LA 1IXRA 3T1YL 1Q7YC 4JI8L 2NVTH 3PSIA 4OWXB 2ZTEA 1C7YA 2ZJQA 2E8GA 4JBKA 3RR5A 2VZAA 2LXJA 1PH4A 1N34L 3GTKH 5JEAG 2K4KA 2UUCQ 3OTOQ 5HGQA 2R7ZH 4DR6Q 2PMZE 3CCMA 1HR0Q 2MQHA 3TS2A 3RNUA 4NB3A 3L7ZC 4KLKA 4LFAQ 4K0KL 1M1KC 1MIUA 1D7QA 3M4OH 3G6EA 1N36Q 4DR5L 3HOYH 1XMOQ 4JI2L 1S40A 4DV3L 1GKHA 1NBWA 1YJ9A 3F2DA 5GQOA 4XTCS 4J15A 4YCVA 2UUAQ 1FJGQ 1HR0L 4A3KH 1W2BA 1Q12A 3ERSX 1VQ4A 4JC0A 2JJQA 2KCTA 4R4OA 5C4XH 1Y1WG 2V1CC 2YU9H 1KRSA 4O2DA 5GROA 4PZ6A 4A3CG 4KHPL 2R6GA 5DLQE 2VS1A 3KYHC 4DV0L 1EIFA 3STBD 3HOWG 1JT8A 3I4MH 4JI6Q 4X6AH 2Q2TA 1EIYB 3STBC 1X9NA 2I5HA 2Q2HA 3CMEA 3M7NA 3K81C 2EXDA 3TQYA 4DV7L 3WWVA 2R93H 1GO3E 1E22A 3ULLA 3M85A 1IYJB 1PH7A 4DUYL 1U5KA 1CUKA 4JV5L 3TRZA 1EFWA 4QGUA 1I6HH 3PCOB 1HZAA 1JJ2A 1KQSA 1YI2A 4JYAL 1DGSA 4JI7L 1ASYA 3AFQA 4JCVE 2KHJA 1BBWA 3F2CA 2A1AA 3E0EA 2JA8G 4LUZA 3CCEA 2NVXH 4GKKL 3CCRA 1XTDA 4JBMA 4JI4Q 1WCMG 3A5UA 3K7AH 1TWGH 1YBYA 5IYBG 4DV5L 3RN2A 1PH8A 3KFUA 1A0IA 4BA1I 2KCMA 5C3EH 1FVIA 4POFA 2YV5A 1QVCA 2VQFL 3S2DH 2XGTA 4R1JA 1VQJA 2C35B 4X64Q 2JA7H 1PYSB 3U58A 4A3JH 4A3GH 1I94Q 4A3LG 1XNQL 2WB1G 3MXNB 4Y52H 3ULJA 1X6OA 4LFCL 1PH1A 1VQAA 1PFSA 5EAYA 2D0OA 3F2BA 1EYGA 4LF8Q 3KJOA 2HIXA 3W1BA 4X62L 4DV1Q 1RL2A 1HJPA 1VCIA 3U50C 1IBLQ 4B3ML 4OO1I 4JI1Q 3J7ZC 3PIOA 3U4ZA 2BH8A 2F52A 4YY3L 1UWVA 2ZJPA 1VQBA 4EQ5A 1G6PA 1I3QH 1WJJA 2Z6KA 4PZ8A 1VQLA 2B29A 1HNWQ 3Q8DA 2IX0A 5BR8Q 4A3EH 1YJNA 2CWPA 2R7ZG 1HNZL 3HOZH 4DR7L 3I2ZA 2VQEL 1I5FA 2N8NA 1I50H 3W1GA 4IPDA 3I4NH 5M3MH 3HFZB 3CF5A 2Z6KC 1CKNA 3I7FA 3IRBA 5AJ3L 4A3MG 1IBMQ 3HOYG 1TWAH 4APVA 3RZOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPF A;  4A93 H;  2VNU D;  3S2H H;  3KDF A;  1EWI A;  3KJP A;  2HHH L;  3CP0 A;  4BY7 H;  1VQN A;  1MJC A;  1OTC A;  1HNX Q;  1VQH A;  2E5L Q;  4BY1 H;  4JI3 L;  3CQZ H;  1YNX A;  1WOC A;  2ID0 A;  2K5H A;  1Q1B A;  2OQK A;  2JEA I;  2K5N A;  4UP9 A;  3K7U C;  4YWK A;  5IP9 G;  2I5M X;  4NXM Q;  4QIW E;  1OXS C;  3BU2 A;  4DV2 Q;  4JOI A;  1V43 A;  1L0W A;  3PO3 H;  3J81 j;  2ZJR A;  4AQY L;  4GOP A;  3FHW A;  2KBN A;  3H0G H;  3TEH B;  1L1O B;  1RIP A;  1PH6 A;  4LF9 Q;  2N3S A;  5IWA L;  4OON A;  2R93 G;  4GKJ Q;  3HKS A;  3PIP A;  4X66 L;  4DUZ Q;  2MNA A;  1OXV A;  4R4I A;  2HT1 A;  1TWH H;  1N33 L;  4B3R L;  5M5W H;  4UP8 A;  2NVQ H;  3G48 A;  3CCQ A;  2JA5 G;  3HOU H;  4LFB Q;  2N49 A;  1PA6 A;  3JAM i;  4LF6 Q;  5JJK A;  3CC4 A;  3SGI A;  4L5Q A;  2PQA A;  3GO5 A;  3FKI H;  3PGZ A;  2K50 A;  3RLN A;  1SE8 A;  2WP8 J;  4DR1 Q;  3KF6 A;  5C3E G;  2EQS A;  4GS3 A;  1XMQ L;  4L5T A;  1LYL A;  2IX1 A;  2HIV A;  5GAD C;  1PYB A;  2RF4 A;  3JC6 6;  4DR3 Q;  4B3T Q;  2JA7 G;  4FDB A;  3G4S A;  4BXX H;  1SRO A;  1CKN B;  3H3V I;  3T1H Q;  4NXN Q;  4GN3 B;  5IP7 H;  1H95 A;  1GVP A;  1S3O A;  2OQ0 A;  1X55 A;  3TS0 A;  3DM3 A;  1QUQ A;  2IT1 A;  3KDF B;  2ATW A;  3PO2 G;  4KI0 A;  4X65 Q;  4IJH A;  4XIG S;  2CFM A;  4B3S Q;  4MZ9 A;  4YWM A;  2UUC L;  3OTO L;  4DR6 L;  1BKB A;  1NMG A;  1VQ5 A;  2BH2 A;  3CC7 A;  5IYC H;  1A63 A;  5C0X J;  1VQC A;  4LFA L;  2NVY H;  2VY3 A;  4DV4 Q;  4DPG A;  1N32 Q;  3PUW A;  1N36 L;  3UDI A;  4A3E G;  4LF5 Q;  5LMN W;  1XMO L;  4L5R C;  3S15 H;  2I0Q A;  2BA1 A;  4GOP B;  2JA6 G;  2UUA L;  2ES2 A;  1FJG L;  1OXU A;  3RLO A;  4GNX A;  1KIX A;  5FJ8 H;  1YEZ A;  4GN4 B;  1HZC A;  3D31 A;  2A8V A;  4BBS H;  1MJE A;  3I56 A;  3HOX H;  4DR4 Q;  1CSP A;  4A93 G;  1E3P A;  4PZ7 A;  1PH9 A;  4A3F H;  2NZO A;  4BY7 G;  1JJG A;  2VW9 A;  1VS0 A;  4AIM A;  4JI5 Q;  5LMU Q;  2R92 H;  4YCW A;  4JI6 L;  2QGQ A;  3DLL A;  4A3B H;  4ME3 A;  1K0R A;  2AKW B;  3K8A A;  4JI0 Q;  3J81 c;  2NN6 G;  2PQA B;  1GD7 A;  2Q2I A;  4QJF A;  3L2P A;  1L2F A;  2ALY B;  3PO3 G;  3KF6 B;  5C44 G;  1PH3 A;  2UXD Q;  3F1Z A;  1Y1V H;  1XPR A;  3GTQ H;  2K75 A;  2UUB Q;  2UXC Q;  3S1N H;  1Q82 C;  2DUD A;  3S16 H;  2EIF A;  2UXB Q;  4DAM A;  1L1O A;  3J81 i;  4UY8 C;  1VQ6 A;  1QUQ B;  5M3F H;  2ZM6 Q;  1E1O A;  1NE3 A;  1GM5 A;  4JI4 L;  4IFD J;  3U4V A;  2VUM G;  3CD6 A;  5J3B A;  1VQE A;  1HR0 W;  1N8R C;  2B63 H;  1SMX A;  2UU9 Q;  1NMF A;  1KAW A;  3GTP H;  4IO9 A;  3J80 i;  1L1O C;  3UDF A;  4A3I H;  3HKZ E;  2KEN A;  1T9H A;  1AH9 A;  4QY7 A;  3S1M H;  3CCJ A;  3FKI G;  4X64 L;  4OWW B;  1UE1 A;  3A74 A;  3RZD H;  1PHJ A;  1M90 C;  4DKA C;  2D0P A;  4DR2 Q;  1J5E Q;  3GD7 A;  1KRT A;  4OX9 Q;  1I94 L;  4BXX G;  1EQR A;  1JMC A;  4A4I A;  3A5Z B;  2HQL A;  5GAG C;  4HJA A;  3UDG A;  4GNX B;  1C9O A;  3K0X A;  4LWC A;  5IP7 G;  3CCS A;  4DV1 L;  1YIJ A;  1YHA A;  5C0X G;  2MFI A;  3E9H A;  1X3G A;  1X54 A;  4IPG A;  1IBL L;  3S17 H;  4PG3 A;  3BJU A;  3L0O A;  4JI1 L;  5IT9 c;  4WJ3 M;  1WFQ A;  2GVA A;  4LW1 A;  1Z47 A;  1X3F A;  1X65 A;  1J6Q A;  2WFW A;  1KXL A;  4EX5 A;  1HNW L;  5BR8 L;  5ELO A;  3AQQ A;  4A3K G;  2YTV A;  1Q86 C;  3W5O A;  2CCZ A;  5C4X G;  1V1Q A;  3CCU A;  1S72 A;  4TQU S;  1IBM L;  3KF8 B;  2LSS A;  1NY4 A;  4DK3 C;  1SFO H;  4C3J H;  2LXK A;  4RMF A;  5C0X I;  3I4M G;  4MTN A;  2IHE A;  4R4Q A;  5FJ8 G;  4LF4 Q;  1LUZ A;  1X3E A;  3HOW H;  1HNX L;  2E5L L;  1SRU A;  3I4O A;  4DAY B;  3HOX G;  4DV6 Q;  1XNR Q;  1QZG A;  1ASZ A;  4P74 A;  3MEF A;  3JAM c;  1WYD A;  3K80 C;  4A3F G;  1A62 A;  1JJC B;  1C0A A;  3UE0 A;  3PUY A;  4JOI C;  4NXM L;  1YHB A;  4DV2 L;  4LF7 Q;  1K3R A;  1UEB A;  2VL6 A;  1NJI C;  1IBK Q;  1IL2 A;  4NPS A;  1VQG A;  2Y0S E;  4OWT B;  1K8G A;  3GTJ H;  4A3B G;  4GOP C;  3H15 A;  1R9T H;  3GTO H;  3M4P A;  3M4Q A;  2PI2 E;  4LUO A;  4O0A A;  1D8L A;  1G51 A;  3UE1 A;  1VQK A;  4WJ4 A;  5LMN Q;  1NTG A;  3NEN A;  2I5L X;  5IE8 A;  4LF9 L;  4PMW A;  1EQQ A;  2E2H H;  4GKJ L;  1U0L A;  4YWL A;  1IBK L;  1BVS A;  1Y1V G;  3TRE A;  5IY0 A;  2XTI A;  4DUZ L;  4HJ7 A;  4TVA B;  4IFD G;  1OXT A;  1K9M C;  1AE2 A;  1UE6 A;  2F4V Q;  1QVF A;  5IYD H;  1UE5 A;  1VQM A;  4YHH Q;  3KLW A;  2E2J H;  5IYB H;  2AHO B;  1B8A A;  4LFB L;  1K83 H;  1FL0 A;  2CKZ B;  1VQ7 A;  1YVC A;  4AYB E;  1IZ6 A;  4LF6 L;  1E1T A;  4A75 A;  3T1Y Q;  1K8A C;  1A8V A;  1Q1E A;  2IHF A;  4A3J G;  4JI8 Q;  4A3G G;  2AWN A;  4P75 A;  4LNQ A;  1PV4 A;  1SN8 A;  4A3D H;  4JBW A;  3FP9 A;  4DR1 L;  3OYY A;  5M5Y H;  2JA9 A;  4A3I G;  4A3L H;  3RN5 A;  1CSQ A;  3CMA A;  4IFD I;  2RCN A;  1HH2 P;  2OCE A;  4DR3 L;  4B3T L;  2PNH A;  4IPH A;  4Y7N H;  3T1H L;  4JG2 A;  4NXN L;  4IOA A;  2RHS B;  1PH2 A;  4C3I H;  3PF5 A;  3EBE A;  3KOJ A;  3NEM A;  4K0K Q;  1TWF H;  5FLM H;  1G29 1;  4YCU A;  1VQ9 A;  4DR5 Q;  2R7F A;  4JYA Q;  4JI2 Q;  4X65 L;  4DV3 Q;  3HOZ G;  4B3S L;  3CCL A;  1Y14 B;  2WAQ E;  5FLX c;  3I4N G;  5M3M G;  1HZB A;  4HIO A;  4QL5 A;  4P72 A;  3HOV H;  1N32 L;  4DV4 L;  1EOV A;  4MNO A;  3CCV A;  3BZK A;  4A3M H;  2WB1 E;  4LF5 L;  2CWA A;  4OXP A;  4KHP Q;  1CKO A;  5ELN A;  4DV0 Q;  3AYH B;  1CKM A;  2K5V A;  2Y0S G;  1X56 A;  3I55 A;  5M5X H;  4GNX C;  4BY1 G;  5JJL A;  2JEB I;  2CQO A;  1VQI A;  1PVO A;  2GVB A;  4DR4 L;  4DV7 Q;  4HIK A;  5HY6 A;  3NEL A;  1SLJ A;  1XPO A;  1N9W A;  4H02 A;  4JI5 L;  5IP9 H;  5C4J H;  1Q81 C;  5LMU L;  2OTL A;  4L5S A;  4DUY Q;  4IPC A;  2OTJ A;  4JV5 Q;  2YTX A;  3H0G G;  4C3H H;  3OW2 A;  1HZ9 A;  1W3S A;  3J80 c;  1KL9 A;  4HJ8 A;  2BA0 A;  2B3G A;  2ZTC A;  3UDX A;  4JI7 Q;  4JI0 L;  4AYB G;  1VQF A;  1TXY A;  3LGJ A;  1JB7 A;  4GKK Q;  2UXD L;  4HJ5 A;  5JJI A;  3EIV A;  3HOU G;  1E24 A;  4DV5 Q;  4IOC A;  3H3V H;  2Z0S A;  1E7Z A;  3CXC A;  1K73 C;  1B7Y B;  5K36 G;  2NN6 I;  2UUB L;  2UXC L;  4AH6 A;  2JA5 H;  2IY5 B;  2YTY A;  2VQF Q;  2K14 A;  1KD1 C;  1LM0 A;  2UXB L;  4BBR H;  1TWC H;  4C2M H;  4R4C A;  5IYD G;  3J7A 5;  3EN2 A;  2ZM6 L;  3CAM A;  3ICE A;  4OO1 G;  1VQ8 A;  1Q46 A;  1MKH A;  1XNQ Q;  4R4T A;  2UU9 L;  4LFC Q;  2JE6 I;  2WAQ G;  2Q2U A;  1YZ6 A;  4X62 Q;  1BBU A;  4ALP A;  4P71 A;  1QVG A;  3GTM H;  3S14 H;  4B3M Q;  3PUV A;  4A3D G;  2L15 A;  4GLA C;  3A0J A;  4YY3 Q;  4HJ9 A;  1J5E L;  2DGY A;  4DR2 L;  4OX9 L;  2JK8 A;  3ZJY C;  1YHQ A;  3GTL H;  1XJV A;  5E7N A;  4DNI A;  3PO2 H;  1AE3 A;  3CC2 A;  1UE7 A;  3PV0 A;  2GN5 A;  4BA2 I;  4DR7 Q;  4HIM A;  2H5X A;  1HNZ Q;  2E2I H;  5JEA J;  2PI2 A;  2VQE Q;  5IYC G;  2NZH A;  3M9B A;  4P73 A;  1KHI A;  5FLM G;  1V9P A;  2A19 A;  3BZC A;  5AJ3 Q;  4GLX A;  1Q8K A;  4JBJ A;  1Y1W H;  4POG A;  4GLV B;  3CW2 C;  2K52 A;  5GAE C;  2ZTD A;  4A3C H;  2HHH Q;  4HID A;  2AWO A;  2OWO A;  2JA6 H;  2MO1 A;  3PUZ A;  4JI3 Q;  3HOV G;  4BBS G;  4QQB X;  2ASB A;  3ULP A;  1LTL A;  1OXX K;  2KHI A;  1FGU A;  4A76 A;  3ER0 A;  2QA4 A;  5GAH C;  1PH5 A;  1XPU A;  2R92 G;  1VQP A;  4IJL A;  4LF4 L;  4KHZ A;  4AQY Q;  1EUJ A;  4DV6 L;  1QZH A;  1XNR L;  2FXQ A;  4RG1 A;  1VQO A;  3PF4 A;  3S1R H;  5IWA Q;  1SR3 A;  2MO0 A;  5H1S E;  3HKZ G;  3AFP A;  1YJW A;  4LF8 L;  2YYZ A;  1YIT A;  2R7D A;  4LF7 L;  3B6Y A;  2JQO A;  4X66 Q;  3NBH B;  3VDY A;  3GDE A;  2JA8 H;  3S1Q H;  1KC8 C;  3AEV A;  1N33 Q;  5C44 H;  4B3R Q;  3M3Y H;  1WCM H;  3D0F A;  1P16 A;  1B70 B;  5LMN L;  2RHQ B;  3S24 A;  5M3F G;  1WI5 A;  4LUV A;  4UP7 A;  3GTG H;  2N78 A;  1O7I A;  2B63 G;  3E9I A;  1JE5 A;  2F4V L;  2AMC B;  3CPW A;  1XMQ Q;  1Z9F A;  4DK6 C;  4GN5 A;  3RLF A;  4YHH L;  2VUM H;  1VQD A;  3G71 A;  2QEX A;  2D62 A;  1N34 Q;  4BBR G;  4UPA A;  3PUX A;  2F3I A;  3F8T A;  1P8L A;  1IXR A;  3T1Y L;  1Q7Y C;  4JI8 L;  2NVT H;  3PSI A;  4OWX B;  2ZTE A;  1C7Y A;  2ZJQ A;  2E8G A;  4JBK A;  3RR5 A;  2VZA A;  2LXJ A;  1PH4 A;  1N34 L;  3GTK H;  5JEA G;  2K4K A;  2UUC Q;  3OTO Q;  5HGQ A;  2R7Z H;  4DR6 Q;  2PMZ E;  3CCM A;  1HR0 Q;  2MQH A;  3TS2 A;  3RNU A;  4NB3 A;  3L7Z C;  4KLK A;  4LFA Q;  4K0K L;  1M1K C;  1MIU A;  1D7Q A;  3M4O H;  3G6E A;  1N36 Q;  4DR5 L;  3HOY H;  1XMO Q;  4JI2 L;  1S40 A;  4DV3 L;  1GKH A;  1NBW A;  1YJ9 A;  3F2D A;  5GQO A;  4XTC S;  4J15 A;  4YCV A;  2UUA Q;  1FJG Q;  1HR0 L;  4A3K H;  1W2B A;  1Q12 A;  3ERS X;  1VQ4 A;  4JC0 A;  2JJQ A;  2KCT A;  4R4O A;  5C4X H;  1Y1W G;  2V1C C;  2YU9 H;  1KRS A;  4O2D A;  5GRO A;  4PZ6 A;  4A3C G;  4KHP L;  2R6G A;  5DLQ E;  2VS1 A;  3KYH C;  4DV0 L;  1EIF A;  3STB D;  3HOW G;  1JT8 A;  3I4M H;  4JI6 Q;  4X6A H;  2Q2T A;  1EIY B;  3STB C;  1X9N A;  2I5H A;  2Q2H A;  3CME A;  3M7N A;  3K81 C;  2EXD A;  3TQY A;  4DV7 L;  3WWV A;  2R93 H;  1GO3 E;  1E22 A;  3ULL A;  3M85 A;  1IYJ B;  1PH7 A;  4DUY L;  1U5K A;  1CUK A;  4JV5 L;  3TRZ A;  1EFW A;  4QGU A;  1I6H H;  3PCO B;  1HZA A;  1JJ2 A;  1KQS A;  1YI2 A;  4JYA L;  1DGS A;  4JI7 L;  1ASY A;  3AFQ A;  4JCV E;  2KHJ A;  1BBW A;  3F2C A;  2A1A A;  3E0E A;  2JA8 G;  4LUZ A;  3CCE A;  2NVX H;  4GKK L;  3CCR A;  1XTD A;  4JBM A;  4JI4 Q;  1WCM G;  3A5U A;  3K7A H;  1TWG H;  1YBY A;  5IYB G;  4DV5 L;  3RN2 A;  1PH8 A;  3KFU A;  1A0I A;  4BA1 I;  2KCM A;  5C3E H;  1FVI A;  4POF A;  2YV5 A;  1QVC A;  2VQF L;  3S2D H;  2XGT A;  4R1J A;  1VQJ A;  2C35 B;  4X64 Q;  2JA7 H;  1PYS B;  3U58 A;  4A3J H;  4A3G H;  1I94 Q;  4A3L G;  1XNQ L;  2WB1 G;  3MXN B;  4Y52 H;  3ULJ A;  1X6O A;  4LFC L;  1PH1 A;  1VQA A;  1PFS A;  5EAY A;  2D0O A;  3F2B A;  1EYG A;  4LF8 Q;  3KJO A;  2HIX A;  3W1B A;  4X62 L;  4DV1 Q;  1RL2 A;  1HJP A;  1VCI A;  3U50 C;  1IBL Q;  4B3M L;  4OO1 I;  4JI1 Q;  3J7Z C;  3PIO A;  3U4Z A;  2BH8 A;  2F52 A;  4YY3 L;  1UWV A;  2ZJP A;  1VQB A;  4EQ5 A;  1G6P A;  1I3Q H;  1WJJ A;  2Z6K A;  4PZ8 A;  1VQL A;  2B29 A;  1HNW Q;  3Q8D A;  2IX0 A;  5BR8 Q;  4A3E H;  1YJN A;  2CWP A;  2R7Z G;  1HNZ L;  3HOZ H;  4DR7 L;  3I2Z A;  2VQE L;  1I5F A;  2N8N A;  1I50 H;  3W1G A;  4IPD A;  3I4N H;  5M3M H;  3HFZ B;  3CF5 A;  2Z6K C;  1CKN A;  3I7F A;  3IRB A;  5AJ3 L;  4A3M G;  1IBM Q;  3HOY G;  1TWA H;  4APV A;  3RZO H; 
#chains in the Genus database with same CATH topology
 1W6J A;  4YIJ A;  1TWC B;  2MPM A;  3DMU A;  1OTC A;  4DXF A;  1QJO A;  4XXE A;  3VR4 A;  2ID0 A;  2K5H A;  1Q1B A;  1PTO D;  3K7A B;  2JEA I;  2K5N A;  3RD4 A;  3K7U C;  2I5M X;  1LTR D;  2NN6 H;  2AUJ D;  4XDX A;  5KEE A;  2ZJR A;  4GOP A;  4BS9 A;  3H0G H;  1WD1 A;  1L1O B;  2R93 G;  3SHL A;  3OWF A;  2LS0 1;  3HKS A;  5DAU A;  3SE0 A;  3PO2 B;  2MNA A;  1OXV A;  5CBE E;  4R4I A;  4KKT A;  5FLX L;  3EFX D;  1N33 L;  3NTI A;  2ICE C;  4UP8 A;  3ND8 A;  4RAU C;  4WOR A;  3CCQ A;  2JA5 G;  4KMU C;  5KNB A;  4JW0 A;  1PA6 A;  4LF6 Q;  2F0K A;  3CC4 A;  1Z7T A;  3SGI A;  4A3E B;  1WD0 A;  2MHV A;  4EQP A;  3GO5 A;  2WP8 J;  5T1I A;  2HQE A;  3KF6 A;  5C3E G;  2EQS A;  2XIW A;  5LL6 S;  1HPC A;  2HIV A;  2Z8L A;  1PYB A;  5GAD C;  3T16 A;  1TWA B;  2JA7 G;  4FDB A;  3G4S A;  3URY A;  3D8G A;  1STY A;  1CKN B;  3NWS A;  3T1H Q;  4PNY A;  5IP7 H;  1H95 A;  1GVP A;  2PZW A;  3BVM A;  4EGV A;  2ATW A;  1PTO B;  3J80 L;  4KI0 A;  4XIG S;  2CFM A;  1ONL A;  4F87 A;  3OTO L;  4DR6 L;  2FMM A;  5L37 A;  3CC7 A;  5C0X J;  1VQC A;  2N55 A;  2OT2 A;  3PUW A;  2I0Q A;  5D3D A;  1B9N A;  2ES2 A;  2UUA L;  1FJG L;  3RLO A;  1DOM A;  4BBS H;  1BCP D;  3PQI A;  1CSP A;  1PH9 A;  4RKL A;  1JJG A;  1GUS A;  4BY7 G;  2VW9 A;  4JI5 Q;  2QGQ A;  2RKS A;  1CK1 A;  4KKU A;  1ENA A;  2RQX A;  4ILW A;  4N9T A;  3L2P A;  3KF8 A;  1L2F A;  5EJW A;  5C44 G;  5ELD A;  1XPR A;  1CI3 M;  1W6K A;  3GQB A;  3LWE A;  3EVQ A;  2K75 A;  3W2D A;  3S1N H;  2DUD A;  1DON A;  3HS0 C;  5DM7 3;  1L1O A;  2G5D A;  1QUQ B;  1PRT D;  5JVG 3;  1LV9 A;  3U4V A;  2VUM G;  4KKS A;  2HD3 A;  2UU9 Q;  1PFB A;  1L1O C;  1LTT D;  2DN8 A;  1KAB A;  2CVR A;  4A3I H;  2KEN A;  1AH9 A;  3S1M H;  3FKI G;  4KN4 C;  3NUC A;  3RZD H;  1M90 C;  4DKA C;  1U4P A;  2E2D C;  1EQV A;  4PQX A;  4TRD A;  1AN8 A;  4WJW A;  4BXX G;  1BCP B;  5IOC A;  3A5Z B;  4BBS B;  1U4L A;  3HRZ C;  1C9O A;  3K0X A;  1Q90 A;  5C0X G;  4IPG A;  3S17 H;  4R9W A;  1Z47 A;  2IPK D;  1X3F A;  4G4K A;  1X65 A;  1QOH A;  1EYA A;  2F0D A;  1SYB A;  4EX5 A;  4KHV A;  5ELO A;  4A3K G;  2CCZ A;  1T5E A;  1S72 A;  1IBM L;  1I4G A;  4DK3 C;  4C3J H;  1LTS D;  4RMF A;  1NAP A;  3S1N B;  4MTN A;  1LTI D;  1A3T A;  2Z9H A;  2WKD A;  3HOW H;  3I4O A;  3MEF A;  4A3J B;  1VDZ A;  3K80 C;  1A62 A;  1JJC B;  4NXM L;  1CHP D;  1YHB A;  1UEB A;  1IBK Q;  3DWA A;  5C5M A;  4A3I B;  1EOT A;  1R9T H;  3M4P A;  1SYE A;  2CQA A;  3RZD B;  4HED A;  1G51 A;  1TQO A;  4KD4 A;  4CDF C;  3NEN A;  2F0S A;  4DNR B;  3CKI B;  1EQQ A;  2E2H H;  4GKJ L;  1SJH D;  1R4P B;  2TMP A;  4DXG A;  1OXT A;  3NK9 A;  2F4V Q;  1QVF A;  1VF7 A;  1VQM A;  1LTA D;  3S17 B;  3KLW A;  4J1M A;  3MWY W;  4X3T A;  1FL0 A;  1CA6 A;  1SYD A;  1FR3 A;  1SND A;  3P75 A;  4A3G G;  4LNQ A;  5JPM C;  2Y0S B;  4BY1 B;  4KN7 C;  5BN3 A;  5M5Y H;  4A3L H;  2RCF A;  4IFD I;  3VYS A;  4DR3 L;  4C3J B;  3M7G A;  1YNN D;  4NXN L;  1V8Q A;  5KIX A;  1PH2 A;  1UAP A;  3HOW B;  1D5M C;  1G29 1;  4YCU A;  1VQ9 A;  4MN3 A;  4X65 L;  1IKM A;  5G3L F;  2H4O A;  4DAP A;  1VMP A;  3HOV H;  1R9T B;  3CCV A;  3V2T A;  2WB1 E;  4LF5 L;  3VR3 A;  5ELN A;  1MSH A;  2PW7 A;  2K5V A;  1SE4 A;  3I55 A;  2E2H B;  4KY6 A;  2CQO A;  1VQI A;  2GVB A;  4ZUI A;  4L8J A;  1DZ1 A;  1HTL D;  1N9W A;  4IUQ A;  5IP9 H;  2OTL A;  3VYT A;  2TSS A;  2BE5 C;  2WAQ B;  3OW2 A;  4C3H H;  1HZ9 A;  1I4Q A;  4HJ8 A;  1MHW C;  3UDX A;  1X32 A;  4JI0 L;  4JI7 Q;  5M5Y B;  3LGJ A;  3WDN A;  5CBA E;  5EBC A;  1BO0 A;  2Z0S A;  1E7Z A;  1K73 C;  1B7Y B;  1JOK A;  2OEO A;  4K14 A;  2IY5 B;  1VMC A;  1KD1 C;  2K14 A;  4BBR H;  5IYD G;  3EN2 A;  4OO1 G;  1NNX A;  1CTM A;  1Q46 A;  1XNQ Q;  1HHV A;  3HOV B;  4ZK9 B;  2JE6 I;  2RVL A;  1YZ6 A;  1BBU A;  3Q23 A;  4CJ2 C;  4B3M Q;  2B2T A;  3MXG A;  2KEC A;  4IUU A;  4GLA C;  3A0J A;  5D65 A;  4YY3 Q;  4OX9 L;  2DGY A;  4DR2 L;  2JK8 A;  3EQL C;  3ZJY C;  3GTL H;  5JOB A;  5C4H A;  3I90 A;  3PV0 A;  2E2I H;  2H5X A;  4ZLT F;  5JEA J;  2PI2 A;  5IYC G;  2NZH A;  4P73 A;  1KHI A;  1C8C A;  1J9O A;  3BZC A;  1A2U A;  5AJ3 Q;  1Y1W H;  2WKC A;  3CW2 C;  2ZTD A;  5K5P A;  1JR0 D;  5CV7 A;  3C3L A;  1S4Z A;  2MO1 A;  3EA6 A;  2B2Y C;  2QIL A;  1SNP A;  1XYI A;  2DJF C;  1WTX A;  4IJL A;  1H9K A;  3VR6 A;  1T5X D;  1O7L A;  4BBR B;  1EUJ A;  2AQ2 B;  1A3U A;  2FXQ A;  5CYU A;  3VA7 A;  3PF4 A;  4IUP A;  3MVV A;  1S5E D;  5H1S E;  3AFP A;  1YJW A;  2YYZ A;  1M4V A;  2JQO A;  1EY7 A;  3AEV A;  5CV9 A;  1N33 Q;  1UUP A;  5I4D A;  3M3Y H;  3VYU A;  2RHQ B;  3A8I E;  2K6A A;  3GTL B;  4NW2 A;  4LUV A;  1LTB D;  2E2I B;  2EYL A;  3SK8 A;  3E9I A;  3ZYY X;  1LTG D;  4GN5 A;  1VQD A;  2BDN A;  1Y1W B;  1NSN S;  2F3I A;  4JI8 L;  1YNN C;  5EKL A;  2ZJQ A;  4DAV A;  5EKK A;  3RR5 A;  3KLR A;  1JCK B;  2LXJ A;  2PPB C;  3GTK H;  3T51 B;  5JEA G;  1L0Y B;  3OTO Q;  5HGQ A;  2R7Z H;  4DR6 Q;  2DNC A;  2PMZ E;  2R61 A;  3CCM A;  1EY8 A;  3TS2 A;  1HXY D;  3GTJ B;  1PRT F;  4K0K L;  3M4O H;  3VR5 A;  3HOY H;  4JI2 L;  1S40 A;  4DV3 L;  5GQO A;  4GZY C;  2HDL A;  2KED A;  2UUA Q;  1FJG Q;  2QDL A;  1GUO A;  3U9S A;  1W2B A;  4RCO A;  1FNW A;  5C4X H;  2A74 C;  2KUM A;  4FXD A;  3M3Y B;  4A3C G;  2K5D A;  5DLQ E;  3KYH C;  4DV0 L;  1AW7 A;  1EIF A;  3I4L A;  1JT8 A;  3I4M H;  3NXW A;  3STB C;  3DEO A;  2Q2H A;  1G6Z A;  3H09 A;  3WOF A;  3M7N A;  5F2D A;  1S5F D;  4DV7 L;  4FVM A;  4O1N A;  1GO3 E;  3TP8 A;  4RH6 A;  4DUY L;  2KA7 A;  3TZU A;  1HUM A;  4ID6 A;  3OSO A;  4RGT A;  3TRZ A;  1I6H H;  1JJ2 A;  1KQS A;  2PQE A;  3GTK B;  1SNO A;  3F2C A;  4IUV A;  3CCE A;  1QIL A;  3SDZ A;  4JBM A;  1WCM G;  2R7Z B;  2QF7 A;  2E75 C;  3NPP A;  5IYB G;  1WTR A;  4BA1 I;  1QVC A;  3M4O B;  3G6J B;  2A68 C;  3HOY B;  5CV4 A;  1TII D;  1STE A;  3U58 A;  2WB1 G;  4NKL A;  2RDH A;  1S5C D;  1PH1 A;  1VQA A;  1CZW A;  3F2B A;  2HIX A;  3W1B A;  1PZI D;  2A6H D;  1VCI A;  4M8A A;  1JOO A;  1ENC A;  2IL8 A;  3U50 C;  2B8G A;  4OO1 I;  3I4M B;  1VQB A;  1WJJ A;  2Z6K A;  1A15 A;  5CC4 A;  3FDT A;  2HCC A;  3HOZ H;  1F77 A;  2V4D A;  1I50 H;  5M3M H;  4ZKC B;  2Z6K C;  1IBM Q;  1BNZ A;  3RZO H;  1I6H B;  3CPF A;  5I2Y A;  3WOE A;  4A93 H;  4OIJ A;  2VNU D;  3S2H H;  3KJP A;  3CP0 A;  1RJT A;  4ZYS A;  1VQN A;  2RDG A;  1E2V A;  3SK6 A;  4BWG B;  4X3K A;  2FIN B;  4NXM Q;  4C56 C;  2ICI A;  2PCF B;  4QIW E;  1OXS C;  3TDQ A;  4JOI A;  3FPU B;  3NSW A;  3PO3 H;  1K0S A;  2G9H D;  3FHW A;  2WV6 D;  4GKJ Q;  4X66 L;  4V0B A;  2F0F A;  5J1Z A;  2HT1 A;  1TWH H;  2F0O A;  4B3R L;  2JN4 A;  3LX0 A;  2O5I C;  1SEB D;  3HOU H;  2H1E A;  2CW0 C;  1HA5 A;  3PGZ A;  1F9P A;  1I50 B;  1XMQ L;  2JA6 B;  5M3M B;  4L5T A;  1TKW B;  1LYL A;  2IX1 A;  1LAC A;  4DR3 Q;  3RZO B;  4A93 B;  2B2U A;  1G2S A;  3H3V I;  4NXN Q;  4GN3 B;  4RHS A;  1X55 A;  3PO2 G;  4X65 Q;  1U4R A;  4MZ9 A;  2UUC L;  2BH2 A;  4DFA A;  4DPG A;  3PO3 B;  4A3E G;  4LF5 Q;  1XMO L;  3S15 H;  1CHQ D;  2BA1 A;  4Q5V A;  4GOP B;  2EZV A;  1A6X A;  4KY5 A;  4KD3 A;  4GNX A;  1KIX A;  5FJ8 H;  2F0T A;  1HZC A;  1PZK D;  1TWH B;  3C2P A;  1MJE A;  2NTS A;  2NZO A;  3HOU B;  1VS0 A;  1A2T A;  2R92 H;  1PZJ D;  2F0J A;  2PW5 A;  5E3F A;  3V05 A;  4A3B H;  4JI0 Q;  3KBX A;  5CR3 A;  3J81 c;  2NN6 G;  1QE6 A;  3KF6 B;  1SJE D;  3E3X A;  1Y1V H;  4G7H C;  2LY7 A;  3GTQ H;  1MGS A;  4DA2 A;  3D3R A;  3X3N A;  1WTV A;  1D1K A;  4HMI A;  4DAY A;  3BVG A;  4DN4 M;  2EIF A;  2QKI C;  1ET6 A;  3I72 A;  1U9R A;  5EPK A;  2Z1C A;  1VQ6 A;  5M3F H;  1GM5 A;  4IFD J;  2KEE A;  4C1N I;  2B63 H;  3BZD B;  1N8R C;  4RGO S;  1KAW A;  4IO9 A;  3I73 A;  1RTN A;  3MTS A;  5ELC A;  5KRU A;  2MP1 A;  4OWW B;  1CT1 D;  4OX9 Q;  4DR2 Q;  1I94 L;  1IKL A;  4HJA A;  3UDG A;  4LWC A;  2NWG A;  5IP7 G;  2EYH A;  2MFI A;  2B2W C;  4E6I A;  1WTO A;  4PG3 A;  3BJU A;  4Z9C B;  1WFQ A;  4A3B B;  4FYD A;  1BBX C;  1HNW L;  2K5Q A;  4J6H A;  2RSN A;  1TR5 A;  4MIU A;  3HKZ B;  5C6A A;  1V1Q A;  1Y1V B;  3KF8 B;  1GUN A;  2KHS A;  3GTQ B;  3TP7 A;  1I4P A;  1JB3 A;  5I6Y A;  1QCB D;  1X3E A;  3Q6S A;  2E5L L;  4LAA A;  3BYY B;  2B63 B;  1K3R A;  2VL6 A;  4NPS A;  5FOB B;  1K8G A;  5DEH A;  4GOP C;  5NUC A;  4O0A A;  4LUO A;  1D8L A;  1C48 A;  1NTG A;  1II3 A;  4PMW A;  2IW3 A;  5K36 H;  2L0C A;  1SXT A;  3TRE A;  2KCN A;  1CQF A;  2DNE A;  5IY0 A;  4DUZ L;  4IFD G;  2K33 A;  5CMD A;  2E2J H;  1PLF A;  3I4N B;  3H94 A;  5IGC A;  1EFI D;  2CKZ B;  3OW7 A;  3ERO A;  3LWU A;  4CDE C;  1K8A C;  2D5D A;  4A3J G;  4JI8 Q;  4P75 A;  1L0X B;  1PV4 A;  1SN8 A;  3FP9 A;  3OYY A;  4A3I G;  1IYV A;  2RCN A;  4B3T L;  3ONA B;  2PNH A;  4IPH A;  3K59 A;  2RHS B;  4C3I H;  3PF5 A;  3KOJ A;  4IAL A;  3NEM A;  4K0K Q;  1VF5 C;  4JI2 Q;  3H0G B;  4DV3 Q;  3HGB A;  1F2M A;  3CCL A;  1Y14 B;  2L9H A;  4AYB B;  3ITP A;  1DD2 A;  3BZK A;  4K2L A;  4A3M H;  2CWA A;  1CKO A;  4DV0 Q;  2Y0S G;  1X56 A;  2J4X A;  5JJL A;  2F0V A;  4BY1 G;  2JEB I;  2L1B A;  1PVO A;  1Z6H A;  4C3J G;  4DR4 L;  4DV7 Q;  4HIK A;  1O7Y A;  5HY6 A;  2E2J B;  3NEL A;  1TY2 A;  3IFT A;  5C4J H;  2BE5 D;  3KK7 A;  5EQ0 A;  1K8M A;  3CRK C;  4DUY Q;  2YTX A;  1KL9 A;  4FF1 A;  2B3G A;  2B2V A;  2ZTC A;  2CH4 W;  2Z6B A;  1TXY A;  3E6Z X;  1JB7 A;  4LMQ D;  2RBM A;  1GHK A;  5C5L A;  2UXD L;  5FK9 C;  3EIV A;  4IOC A;  4C3I B;  2NN6 I;  1GUT A;  2UXC L;  4AH6 A;  2JA5 H;  2UXB L;  3BDO A;  1ZKO A;  4R4T A;  1FD7 D;  2F0G A;  1C4Q A;  2WAQ G;  5KYL A;  4F88 A;  3DHQ A;  4JK1 C;  1PMR A;  3K5M A;  4L63 B;  2L15 A;  5ELB A;  2SDF A;  4OGQ C;  1XJV A;  2GN5 A;  3FMC A;  3PIO 3;  5C4J B;  3QR8 A;  4POG A;  1NR4 A;  5GAE C;  2F0U A;  3VR2 A;  1ICF B;  1B50 A;  3IFD A;  3HOV G;  3PUZ A;  1TS4 A;  2I07 B;  5IGD A;  2EYO A;  2ASB A;  2F0L A;  1LTL A;  5DM6 3;  4UHV A;  5HUR A;  2XWJ B;  3ER0 A;  3DM1 A;  2QA4 A;  1PH5 A;  2JA5 B;  1STH A;  2EYM A;  3S1M B;  4DV6 L;  1QZH A;  1XNR L;  1SR3 A;  2M00 A;  3B6Y A;  4X66 Q;  3VDY A;  2JA8 H;  3S1Q H;  5C44 H;  4B3R Q;  4HSV A;  1B70 B;  1LT4 D;  1Q8I A;  1AZQ A;  3PIP 3;  2L12 A;  1WI5 A;  1SYG A;  1JE5 A;  1DOL A;  1XMQ Q;  4YHH L;  3RLF A;  1SNM A;  2VUM H;  2D62 A;  4BBR G;  1ZYR C;  2L4N A;  1M8A A;  3T1Y L;  1KNA A;  2NVT H;  3PSI A;  4OWX B;  2ZTE A;  4FXK C;  2E8G A;  2VZA A;  1PH4 A;  5KGU A;  1EY4 A;  1N34 L;  1QNK A;  3A7A B;  1WTH A;  2XSC A;  1NUC A;  3J81 L;  2UUC Q;  2MQH A;  5EGT A;  5C0X H;  3O13 A;  4NB3 A;  3L7Z C;  4KLK A;  1M1K C;  4DR5 L;  1XMO Q;  4JYA L;  1JIC A;  1HR0 L;  4A3K H;  1Y1W G;  2YU9 H;  4JC0 A;  2JA8 B;  3S1Q B;  1D5X C;  1D2B A;  5C44 B;  1KRS A;  4XQN A;  1ESF A;  4PZ6 A;  2R6G A;  1BOS A;  1TT2 A;  3GV3 A;  3CU7 A;  1FYC A;  3STB D;  4CHT B;  2EJM A;  4CJ1 B;  1D5Z C;  3K81 C;  2EXD A;  3TQY A;  3WWV A;  2VUM B;  1UNS A;  3M85 A;  1IYJ B;  1PH7 A;  2EE1 A;  3BVZ A;  4JV5 L;  4RWS C;  5LL6 X;  1EFW A;  3PCO B;  2NVT B;  5IIF A;  1YI2 A;  1PTO F;  1FNV A;  1GUG A;  4K2K A;  1U4M A;  3CCR A;  1RF2 D;  1XTD A;  3OWE B;  1V1P A;  1TWG H;  4H7B A;  3RN2 A;  4DV5 L;  1TVX A;  1A0I A;  1RDP D;  2A68 D;  1DM0 B;  2PZT A;  2VQF L;  3S2D H;  4R1J A;  3OMC A;  3KLS X;  3J81 E;  1EU3 A;  4ZUJ A;  4A3G H;  1I94 Q;  4A3K B;  4Y52 H;  3CRL C;  4G57 A;  2F3W A;  4LFC L;  2J0T D;  1PFS A;  2B2T C;  4XQJ A;  1RL2 A;  1HJP A;  5D14 A;  5JJZ A;  4H44 C;  2L5T A;  3PIO A;  3J7A V;  4FO2 A;  4EQ5 A;  3KUP A;  4C3H B;  4PZ8 A;  1VQL A;  2B29 A;  1HNW Q;  2R7Z G;  1YJN A;  4DR7 L;  3NQI A;  1I4R A;  2K1B A;  1I5F A;  1EZ8 A;  1F2L A;  1H9R A;  1QB5 D;  1XX8 A;  2X69 A;  1ILQ A;  3HOY G;  1IW7 D;  4APV A;  4LK1 C;  3L9A X;  3KDF A;  4CKC A;  1TS2 A;  1DCZ A;  1K28 A;  2E5L Q;  1YNX A;  3DXJ C;  1TWG B;  4HTH A;  4FP5 D;  1X3P A;  4ULL A;  4CKB A;  1SE2 A;  1V43 A;  4RCN A;  3S2D B;  3NTK A;  5JPN C;  2G9D A;  3VA5 A;  5J39 A;  1CQV A;  2N3S A;  5IWA L;  4OON A;  1WTP A;  1J8I A;  1TS3 A;  1EEI D;  1BCP F;  2HDM A;  3NTH A;  5BN5 A;  3PIP A;  3OMG A;  4DUZ Q;  1JWS D;  3DWQ A;  4S3S A;  2NVQ H;  5ISR A;  4XT3 B;  2N49 A;  3SEB A;  4H13 C;  5A35 A;  1RD9 D;  2CW0 D;  4L5Q A;  5EBD A;  2PQA A;  3RLN A;  2EVB A;  1SE8 A;  1JOQ A;  1SYF A;  4GS3 A;  1JQY D;  2RF4 A;  4B3T Q;  2B8F A;  3MEH A;  4KV6 A;  3A7L A;  1S3O A;  1Y8O B;  4ABN A;  3TS0 A;  3DM3 A;  2IT1 A;  1AFP A;  2A73 B;  3DEP A;  1HTP A;  1EY0 A;  2EYP A;  1PXU A;  4IJH A;  5DNF A;  3AU7 A;  4KK7 A;  1NMG A;  1KTK A;  5IYC H;  2VY3 A;  1KLG D;  1N36 L;  3UDI A;  1DOK A;  2JA6 G;  1OXU A;  3R2T A;  3D31 A;  2A8V A;  4DR4 Q;  4N8F A;  1EYD A;  4A93 G;  3HOX H;  2NVQ B;  4A3F H;  2WII B;  4AIM A;  4UDU C;  2F0W A;  4JI6 L;  3K58 A;  2XN9 C;  4I7A A;  2CH4 A;  4ME3 A;  1K0R A;  3K8A A;  2J7Z A;  3FVQ A;  1GD7 A;  1ENF A;  1NR2 A;  3PO3 G;  2UXD Q;  1PH3 A;  2MUY A;  2K32 A;  4X3U A;  5JAV A;  3M4Y A;  4ODG A;  2UXC Q;  3R93 A;  1EL0 A;  3S16 H;  2UXB Q;  3QOJ A;  4DAM A;  3J81 i;  3Q0A A;  2KJX A;  1NE3 A;  1LLR D;  4JI4 L;  1FNU A;  4DGZ A;  1HR0 W;  1VQE A;  3I70 A;  2N88 A;  4MTK A;  5C4X B;  5C3W A;  1G91 A;  2NTT A;  4PMC A;  4X64 L;  3A74 A;  1TU2 B;  2D0P A;  3GD7 A;  1CFM A;  1JMC A;  4A4I A;  1D6E C;  2HQL A;  5GAG C;  3HOX B;  4GNX B;  3MXP A;  4HCS A;  4A3F B;  2QEJ C;  3E9H A;  3VYR A;  1X54 A;  1IBL L;  1E0B A;  2EYJ A;  3L0O A;  4JI1 L;  2EJG C;  4WJ3 M;  2GVA A;  2WAC A;  1KDA A;  2A69 C;  5FKA C;  1J6Q A;  1TS5 A;  2WFW A;  3IL8 A;  4TKO B;  1KXL A;  1IW7 C;  4XT1 B;  2JSO A;  3AQQ A;  1Q86 C;  2EPB A;  1LAB A;  2LSS A;  1NY4 A;  1SFO H;  2IHE A;  5FJ8 G;  1HNX L;  5A2Q E;  4DAY B;  4R8N A;  4DV6 Q;  1KAA A;  1XNR Q;  1C0A A;  1DXM A;  4G7O C;  4IUN A;  3PUY A;  4JOI C;  4DV2 L;  1IL2 A;  1NJI C;  2EOT A;  1VQG A;  2Y0S E;  4A3B G;  1HQM C;  3GTO H;  3ERQ A;  3D4D A;  2PI2 E;  1DYQ A;  4WJ4 A;  4EVO A;  3TN2 A;  2I5L X;  4LF9 L;  4U68 A;  1U0L A;  4YWL A;  4QB4 A;  1IBK L;  1Y1V G;  2XTI A;  4HJ7 A;  3PMF A;  1K9M C;  1AE2 A;  3HOZ B;  1G2T A;  5I6W A;  4YHH Q;  3D4R A;  1Y8P B;  5IYB H;  2AHO B;  1B8A A;  4LFB L;  2D2C C;  3E5S A;  2XRQ D;  1VQ7 A;  1YVC A;  1IZ6 A;  1DJR D;  1E1T A;  4A75 A;  3T1Y Q;  4IN3 A;  1Q1E A;  3S2H B;  5I9O A;  2AWN A;  4K5V A;  4EQN A;  3Q22 A;  4A3D H;  4DR1 L;  3MFG A;  2QDB A;  3DUZ A;  1CSQ A;  2B2U C;  2OCE A;  1MD2 D;  1KNE A;  2F0H A;  4IOA A;  1O78 A;  4HCE A;  4RKB A;  3EBE A;  1KDC A;  5FLM H;  4DR5 Q;  2R7F A;  4JYA Q;  1EY9 A;  4B3S L;  4JVZ A;  4CDC C;  2WAQ E;  3K0Y A;  3I4N G;  1HZB A;  1KDB A;  4P72 A;  3GTO B;  4DV4 L;  1N32 L;  2B39 A;  1F9R A;  1JWM D;  4ZKB B;  4K5X A;  3AYH B;  1BF4 A;  3W3A A;  3HEJ A;  4OL7 A;  4GNX C;  1IL8 A;  3N52 A;  2M2L A;  5EKI A;  1PYW D;  1XPO A;  1XWE A;  1Q81 C;  5LMU L;  1RTO A;  4IPC A;  4JV5 Q;  3H0G G;  1W3S A;  2BA0 A;  4JPB W;  4A3D B;  4AYB G;  4PMB A;  3NQT A;  1RCV D;  2WB1 B;  3GP7 A;  4XQQ A;  4WFN 3;  3K57 A;  1EIG A;  1S5B D;  5JJI A;  1WTQ A;  3MXU A;  1EY6 A;  4DV5 Q;  4HN7 A;  4IUT A;  4KJO A;  1E2W A;  5K36 G;  2UUB L;  3A8J E;  2IX3 A;  2MGS A;  2YTY A;  2VQF Q;  1LM0 A;  1TWC H;  3K5N A;  3S15 B;  4FXG C;  2ZM6 L;  3ICE A;  2AQ1 B;  2SNS A;  1VQ8 A;  4IZ8 A;  1STN A;  2AUK A;  4LFC Q;  3MAQ A;  5G3L D;  1ZXT A;  1R4Q B;  3S14 H;  2KCC A;  4IQZ A;  3GTM H;  1HCZ A;  3PUV A;  1SYC A;  1YNJ C;  1J5E L;  2R92 B;  5E7N A;  4KJN A;  3PO2 H;  4BA2 I;  1UE7 A;  2RA4 A;  1CA5 A;  4DR7 Q;  3GV6 A;  4HIM A;  2Q8T A;  3S9W A;  1D1I A;  1AZP A;  1ROD A;  2A6E C;  4QMG A;  4GLX A;  2RSO A;  4JBJ A;  5E1F A;  3G7L A;  4N9P A;  1H9S A;  2OWO A;  2D9U A;  4ZRZ A;  4BBS G;  1B53 A;  1EEF D;  5M3F B;  1SBB B;  1BDO A;  2KHI A;  4A76 A;  5GAH C;  1EY5 A;  2HUG A;  4LF4 L;  2O2L D;  2SOB A;  1PTO H;  2JP1 A;  2Q8R E;  4RG1 A;  2Q8I B;  2F0M A;  3S1R H;  5IWA Q;  3TBI B;  2K28 A;  3NWT A;  2MO0 A;  2O4X A;  3QG1 A;  5IT9 E;  1BR9 A;  3MHB A;  4G7Z C;  2R7D A;  3HG9 A;  4LF7 L;  2Z4H A;  3NBH B;  1KC8 C;  3S14 B;  3GTM B;  3Q24 A;  1LO5 D;  3D0F A;  1P16 A;  4FNF A;  5LMN L;  5AFW A;  2QCP X;  1O7I A;  4B08 A;  3CPW A;  3KBG A;  1ZYR D;  3G71 A;  2QEX A;  1NCV A;  3PUX A;  3D6C A;  1B44 D;  3JAM E;  1Q7Y C;  5FO7 B;  1C7Y A;  4NMZ A;  4JBK A;  2EDG A;  2VB3 X;  2VXW A;  3SR1 A;  4RGM A;  2KVM A;  2ENB A;  4LJZ C;  1JWU D;  1D7Q A;  1MIU A;  3G6E A;  1N36 Q;  3BDL A;  5IOD A;  1GKH A;  1NBW A;  3S1R B;  2C5C A;  4XTC S;  3C1E A;  3MXN A;  1BXT A;  2WIN B;  4P2C B;  1SAP A;  1Q12 A;  3ERS X;  4J8Q A;  4R4O A;  4QUF A;  2BOS A;  4OHJ A;  4I7Z C;  4CBV A;  4KHP L;  3KLS A;  3HOW G;  3EJI A;  4JI6 Q;  4X6A H;  2XNA C;  3P7J A;  2Q2T A;  1X9N A;  1STA A;  5IGG A;  5IGE A;  2PMZ B;  2ZT9 C;  3CME A;  1B2T A;  1F2Y A;  1UEA B;  2R93 H;  1HFN A;  4ME5 A;  1E22 A;  1U5K A;  1CUK A;  2F0N A;  2EY5 A;  2B2V C;  3H6M A;  5FLX E;  4QGU A;  1OO9 B;  1DGS A;  2K01 A;  1ASY A;  1FGB D;  2FFK B;  4JCV E;  2KHJ A;  1BBW A;  2JA8 G;  4LUZ A;  4GKK L;  2NVX H;  1TY0 A;  4IFD H;  4JI4 Q;  1YBY A;  2X6L A;  1PH8 A;  3KFU A;  5CGK A;  4H0L C;  3NBH A;  4HSP A;  4O42 A;  4F8M A;  5C3E H;  1FVI A;  4DK1 A;  4POF A;  2LMC B;  1B1Z A;  2YV5 A;  4A3M B;  1LT6 D;  2XGT A;  1LT5 D;  3SXH A;  2NUC A;  2XRS D;  2JA7 H;  4X64 Q;  1PYS B;  1GOZ A;  4A3J H;  4N8X 1;  4A3L G;  1XXG A;  5HGT A;  3P20 A;  1I4X A;  3MC0 B;  1X6O A;  3J80 E;  2D0O A;  4FF4 A;  1GHJ A;  4X62 L;  1PFN A;  1ET9 A;  3J7Y W;  1IBL Q;  4JI1 Q;  2F52 A;  1UWV A;  3QIA A;  5EPL A;  2ZJP A;  5I2X A;  2LFN A;  1G6P A;  1I3Q H;  3Q8D A;  2IX0 A;  2VB2 X;  2CWP A;  1HNZ L;  2FMC A;  3I2Z A;  1HRJ A;  2VQE L;  2R93 B;  2N8N A;  1ILP A;  1MI2 A;  1IYU A;  4C1N K;  3HFZ B;  3CF5 A;  1CKN A;  1PDQ A;  4CDD C;  1EWI A;  2HHH L;  4BY7 H;  4CJ0 B;  1MJC A;  2JXM B;  1HNX Q;  1VQH A;  4BY1 H;  4JI3 L;  3CQZ H;  4CGY B;  5KYI A;  2NVX B;  1WOC A;  3UI2 A;  2OQK A;  4UP9 A;  2PYK A;  4F7X A;  4YWK A;  5IP9 G;  1PTO C;  3BU2 A;  1V1P B;  4HAE A;  3BS1 A;  3P1H A;  5C3E B;  4DV2 Q;  4NP5 A;  1L0W A;  4C3H G;  1O80 A;  2JA7 B;  1PRT B;  3J81 j;  3BDC A;  4AQY L;  1E2Z A;  2KBN A;  3TEH B;  3RMH A;  2SNM A;  1RIP A;  3AB9 A;  1PH6 A;  4LF9 Q;  2EJF C;  4QCL A;  4K6L A;  3A54 A;  1SNQ A;  2BCO A;  2F4I A;  2OF1 A;  5COR A;  5CV5 A;  2L55 A;  3MA2 B;  3R2I A;  5M5W H;  3D4W A;  3G48 A;  3FRP B;  4LFB Q;  2F3V A;  1I3Q B;  1A3V A;  3JAM i;  1JC7 A;  5JJK A;  4QIW B;  1CM9 A;  3RUZ A;  2EY2 A;  3FKI H;  2K50 A;  4DR1 Q;  1ESR A;  3OIP A;  3SK5 A;  3JC6 6;  4BXX H;  1SRO A;  2R3Z A;  2XWB B;  4BY7 B;  1S5D D;  2OQ0 A;  5I9P A;  3KDF B;  1QUQ A;  5EPJ A;  1QG7 A;  3HZX A;  3CQZ B;  2O5J C;  4B3S Q;  4YWM A;  3AMU A;  2EYF A;  3MZ5 A;  1BKB A;  1B9M A;  1VQ5 A;  4QF4 A;  1A63 A;  2CHB D;  4LFA L;  2NVY H;  4DV4 Q;  4OIK A;  2NZ1 D;  1N32 Q;  3NBI A;  4DK0 A;  5LMN W;  2PNR C;  4L5R C;  3IKJ A;  1PFM A;  1YEZ A;  3I3C A;  3R3O A;  4GN4 B;  4PV1 C;  3C1F A;  3I56 A;  5M5W B;  1E3P A;  4PZ7 A;  1BCP C;  5LMU Q;  2L11 A;  4YCW A;  2K04 A;  3DLL A;  3OIQ A;  3MFY A;  3NHH A;  3FKI B;  2AKW B;  2PQA B;  3K5L A;  2Q2I A;  4QJF A;  2ALY B;  2E76 C;  3A55 A;  3F1Z A;  2F0P A;  1HQR D;  2UUB Q;  1Q82 C;  1QWY A;  4UY8 C;  5D3I B;  2ZM6 Q;  1E1O A;  1HUN A;  3CD6 A;  5J3B A;  1PRT C;  1GJX A;  1SMX A;  1NMF A;  1K8O A;  2YU9 B;  3N6R A;  3GTP H;  2NVY B;  1O7Z A;  3J80 i;  3UDF A;  3HKZ E;  1T9H A;  4QY7 A;  2A5H A;  3CCJ A;  3J7A F;  1UE1 A;  4K8J A;  1PHJ A;  1J5E Q;  1KRT A;  4XYQ A;  4TSS A;  5LHY 1;  1EQR A;  4HR7 B;  5KNC A;  3C46 A;  1EYC A;  4CKE A;  3CCS A;  1YIJ A;  4DV1 L;  4LF8 L;  1YHA A;  1X3G A;  5IT9 c;  2A69 D;  4LW1 A;  3V96 A;  4KY7 A;  1SE3 A;  1WTW A;  2ZXR A;  5BR8 L;  2YTV A;  3W5O A;  2NYZ D;  1GXD C;  1QNU A;  5C4X G;  3TZD A;  3CCU A;  4TQU S;  2B2Y A;  4NDX A;  1JOR A;  2K03 A;  2LXK A;  5C0X I;  3I4M G;  4R4Q A;  4LF4 Q;  5IGB A;  1LUZ A;  4OEM B;  3K6O A;  1SRU A;  3HOX G;  5C4Z A;  1QZG A;  1XTC D;  4P74 A;  1ASZ A;  3JAM c;  1WYD A;  4A3F G;  4A3G B;  3UE0 A;  2E74 C;  3U9O A;  4LF7 Q;  3GTP B;  4OWT B;  3GTJ H;  3CHB D;  2RDF A;  3H15 A;  3M4Q A;  1Y8N B;  3UE1 A;  1VQK A;  5LMN Q;  5IE8 A;  2NB0 A;  5E4X A;  3NP8 A;  1BVS A;  4EQO A;  1RKN A;  4DU9 A;  4TVA B;  1SMY D;  1UE6 A;  5IYD H;  1UE5 A;  4OO1 H;  1AEX A;  4K5W A;  1K83 H;  4AYB E;  4LF6 L;  4RGN A;  1A8V A;  2IHF A;  5CV8 A;  4JBW A;  3A8K E;  2JA9 A;  3RN5 A;  3CMA A;  3H91 A;  1HH2 P;  4UAI A;  4B9W A;  4Y7N H;  3T1H L;  4JG2 A;  3T4A C;  1BUV T;  1ICW A;  1TWF H;  1I6V C;  1KLU D;  3HOZ G;  1K3B C;  5FLX c;  4Q0F A;  5E4W C;  5M3M G;  4HIO A;  1EZ6 A;  4QL5 A;  3NE5 B;  1EOV A;  3QOL A;  4MNO A;  5CV6 A;  2FHT A;  4OXP A;  4KHP Q;  1Q3L A;  1CKM A;  4K8I A;  1STB A;  5M5X H;  2F0Q A;  3OOC A;  4FF3 A;  2DY7 A;  4DF7 A;  4M1U B;  2XVS A;  3L3O C;  1SLJ A;  4RFB A;  4RA8 A;  4JI5 L;  4H02 A;  3T56 B;  1K83 B;  4L5S A;  5A2Q L;  2EY6 A;  3FEW X;  2OTJ A;  3J80 c;  1MSG A;  1I4H A;  3I8Z A;  1VQF A;  4ZQ3 A;  1SNC A;  5C3X A;  4GKK Q;  5FO9 B;  4HJ5 A;  2X6G A;  4Y7N B;  3HOU G;  1E24 A;  3H3V H;  3CXC A;  1BQQ T;  1LT3 D;  1TWF B;  1CZG A;  4C2M H;  2K5W A;  2SEB D;  4R4C A;  3J7A 5;  3I91 A;  3CAM A;  3LNN A;  1MKH A;  2UU9 L;  2F03 A;  1EWH A;  2Q2U A;  4X62 Q;  5JEA H;  2M9V A;  2C9O A;  1YNJ D;  4P71 A;  4WRD A;  4ALP A;  1WVL A;  4L6T B;  1QVG A;  4A3D G;  3SVM A;  4HJ9 A;  5M5X B;  1MBY A;  1YHQ A;  1RHP A;  1SDF A;  4DNI A;  1AE3 A;  5FO8 B;  2K05 A;  3CC2 A;  2EY1 A;  1HNZ Q;  4V19 0;  4DNT B;  2AQ3 B;  2A6E D;  2VQE Q;  3M9B A;  1ML0 D;  5FLM G;  1F9Q A;  1V9P A;  5BN4 A;  2A19 A;  3TP6 A;  1Q8K A;  2DJG C;  3A56 A;  4GLV B;  1F2Z A;  2K52 A;  4B9X A;  4A3C H;  2HHH Q;  4HID A;  2AWO A;  3TME A;  3S16 B;  2KOL A;  2F1M A;  4R8I A;  2JA6 H;  4QQB X;  4JI3 Q;  1B3Q A;  3ULP A;  1OXX K;  5COY A;  5J22 A;  1FGU A;  1H9J A;  2EXZ A;  4XYO A;  3T53 B;  5TSS A;  1G8Z D;  5JVH 3;  1XPU A;  1VQP A;  2R92 G;  1IHZ A;  2OXP A;  4C2M B;  4KHZ A;  4AQY Q;  1B4O A;  1VQO A;  2F0E A;  3BYT B;  3HKZ G;  1YIT A;  2BDO A;  4MHE A;  3HP3 A;  3GDE A;  1SMY C;  1WCM H;  3T13 A;  3S24 A;  5M3F G;  5IGF A;  4I65 A;  4UP7 A;  3GTG H;  2N78 A;  2B63 G;  2F4V L;  3D6W A;  2AMC B;  1Z9F A;  4DK6 C;  2ZXP A;  3TP5 A;  1N34 Q;  1EWC A;  4UPA A;  3F8T A;  1P8L A;  1IXR A;  4U67 3;  1SFO B;  1H9S B;  2K4K A;  2I46 A;  2ZXO A;  2K7V A;  4RHR A;  1HR0 Q;  4OEL B;  3RNU A;  4LFA Q;  5T1G A;  1AP0 A;  1YJ9 A;  2F0I A;  3F2D A;  2JYO A;  4J15 A;  4YCV A;  3SK4 A;  3ND9 A;  1EQT A;  1HA6 A;  1VQ4 A;  2JJQ A;  2KCT A;  1STG A;  3K5O A;  2V1C C;  3R8B A;  4O2D A;  2LKV A;  5GRO A;  1WCM B;  1GUW A;  4K6D A;  3DWP A;  1Y69 U;  2VS1 A;  3QO2 A;  3OPO A;  4FF2 A;  3QWN A;  1EIY B;  4HMJ A;  3GTG B;  4IUR A;  2I5H A;  1H9M A;  2PO4 A;  3QB3 A;  3OHX C;  3FPP A;  4ZAI A;  2HCI A;  3ULL A;  1SSO A;  3X3M A;  5IT9 L;  1HZA A;  2MJ8 A;  4QUC A;  4JI7 L;  2NBF A;  3AFQ A;  3H3V C;  2A1A A;  2QW7 A;  3E0E A;  2PZU A;  1HFG A;  3QJY A;  3IAY A;  3A5U A;  3K7A H;  2KQ3 A;  1EIH A;  1EU4 A;  2KCM A;  2DY8 A;  1VQJ A;  2C35 B;  5ELE A;  5KND A;  4ZCK A;  4X3S A;  3E0J A;  1XNQ L;  3MXN B;  5ELF A;  3F2U A;  4KTA A;  1F9S A;  2GA4 B;  3ULJ A;  3JAM L;  1EYG A;  5EAY A;  4LF8 Q;  3KJO A;  5M9O A;  4DV1 Q;  4C3I G;  1V1O A;  4B3M L;  1ZEQ X;  3J7Z C;  3U4Z A;  2BH8 A;  2B2W A;  2A6H C;  2Z4I A;  3BG3 A;  4YY3 L;  2P5Z X;  2IJ0 A;  5BR8 Q;  4A3E H;  1B3A A;  3TSS A;  3W1G A;  2IWH A;  4IPD A;  3I4N H;  1X3Q A;  3I7F A;  5AJ3 L;  3IRB A;  4A3M G;  1TWA H;  2FJ2 A;  1JE4 A; 
#chains in the Genus database with same CATH homology
 3CPF A;  4A93 H;  2VNU D;  3S2H H;  3KDF A;  1EWI A;  3KJP A;  2HHH L;  3CP0 A;  4BY7 H;  1VQN A;  1MJC A;  1OTC A;  1HNX Q;  1VQH A;  2E5L Q;  4BY1 H;  4JI3 L;  3CQZ H;  1YNX A;  1WOC A;  2ID0 A;  2K5H A;  1Q1B A;  2OQK A;  2JEA I;  2K5N A;  4UP9 A;  3K7U C;  4YWK A;  5IP9 G;  2I5M X;  4NXM Q;  4QIW E;  1OXS C;  3BU2 A;  4DV2 Q;  4JOI A;  1V43 A;  1L0W A;  3PO3 H;  3J81 j;  2ZJR A;  4AQY L;  4GOP A;  3FHW A;  2KBN A;  3H0G H;  3TEH B;  1L1O B;  1RIP A;  1PH6 A;  4LF9 Q;  2N3S A;  5IWA L;  4OON A;  2R93 G;  4GKJ Q;  3HKS A;  3PIP A;  4X66 L;  4DUZ Q;  2MNA A;  1OXV A;  4R4I A;  2HT1 A;  1TWH H;  1N33 L;  4B3R L;  5M5W H;  4UP8 A;  2NVQ H;  3G48 A;  3CCQ A;  2JA5 G;  3HOU H;  4LFB Q;  2N49 A;  1PA6 A;  3JAM i;  4LF6 Q;  5JJK A;  3CC4 A;  3SGI A;  4L5Q A;  2PQA A;  3GO5 A;  3FKI H;  3PGZ A;  2K50 A;  3RLN A;  1SE8 A;  2WP8 J;  4DR1 Q;  3KF6 A;  5C3E G;  2EQS A;  4GS3 A;  1XMQ L;  4L5T A;  1LYL A;  2IX1 A;  2HIV A;  5GAD C;  1PYB A;  2RF4 A;  3JC6 6;  4DR3 Q;  4B3T Q;  2JA7 G;  4FDB A;  3G4S A;  4BXX H;  1SRO A;  1CKN B;  3H3V I;  3T1H Q;  4NXN Q;  4GN3 B;  5IP7 H;  1H95 A;  1GVP A;  1S3O A;  2OQ0 A;  1X55 A;  3TS0 A;  3DM3 A;  1QUQ A;  2IT1 A;  3KDF B;  2ATW A;  3PO2 G;  4KI0 A;  4X65 Q;  4IJH A;  4XIG S;  2CFM A;  4B3S Q;  4MZ9 A;  4YWM A;  2UUC L;  3OTO L;  4DR6 L;  1BKB A;  1NMG A;  1VQ5 A;  2BH2 A;  3CC7 A;  5IYC H;  1A63 A;  5C0X J;  1VQC A;  4LFA L;  2NVY H;  2VY3 A;  4DV4 Q;  4DPG A;  1N32 Q;  3PUW A;  1N36 L;  3UDI A;  4A3E G;  4LF5 Q;  5LMN W;  1XMO L;  4L5R C;  3S15 H;  2I0Q A;  2BA1 A;  4GOP B;  2JA6 G;  2UUA L;  2ES2 A;  1FJG L;  1OXU A;  3RLO A;  4GNX A;  1KIX A;  5FJ8 H;  1YEZ A;  4GN4 B;  1HZC A;  3D31 A;  2A8V A;  4BBS H;  1MJE A;  3I56 A;  3HOX H;  4DR4 Q;  1CSP A;  4A93 G;  1E3P A;  4PZ7 A;  1PH9 A;  4A3F H;  2NZO A;  4BY7 G;  1JJG A;  2VW9 A;  1VS0 A;  4AIM A;  4JI5 Q;  5LMU Q;  2R92 H;  4YCW A;  4JI6 L;  2QGQ A;  3DLL A;  4A3B H;  4ME3 A;  1K0R A;  2AKW B;  3K8A A;  4JI0 Q;  3J81 c;  2NN6 G;  2PQA B;  1GD7 A;  2Q2I A;  4QJF A;  3L2P A;  1L2F A;  2ALY B;  3PO3 G;  3KF6 B;  5C44 G;  1PH3 A;  2UXD Q;  3F1Z A;  1Y1V H;  1XPR A;  3GTQ H;  2K75 A;  2UUB Q;  2UXC Q;  3S1N H;  1Q82 C;  2DUD A;  3S16 H;  2EIF A;  2UXB Q;  4DAM A;  1L1O A;  3J81 i;  4UY8 C;  1VQ6 A;  1QUQ B;  5M3F H;  2ZM6 Q;  1E1O A;  1NE3 A;  1GM5 A;  4JI4 L;  4IFD J;  3U4V A;  2VUM G;  3CD6 A;  5J3B A;  1VQE A;  1HR0 W;  1N8R C;  2B63 H;  1SMX A;  2UU9 Q;  1NMF A;  1KAW A;  3GTP H;  4IO9 A;  3J80 i;  1L1O C;  3UDF A;  4A3I H;  3HKZ E;  2KEN A;  1T9H A;  1AH9 A;  4QY7 A;  3S1M H;  3CCJ A;  3FKI G;  4X64 L;  4OWW B;  1UE1 A;  3A74 A;  3RZD H;  1PHJ A;  1M90 C;  4DKA C;  2D0P A;  4DR2 Q;  1J5E Q;  3GD7 A;  1KRT A;  4OX9 Q;  1I94 L;  4BXX G;  1EQR A;  1JMC A;  4A4I A;  3A5Z B;  2HQL A;  5GAG C;  4HJA A;  3UDG A;  4GNX B;  1C9O A;  3K0X A;  4LWC A;  5IP7 G;  3CCS A;  4DV1 L;  1YIJ A;  1YHA A;  5C0X G;  2MFI A;  3E9H A;  1X3G A;  1X54 A;  4IPG A;  1IBL L;  3S17 H;  4PG3 A;  3BJU A;  3L0O A;  4JI1 L;  5IT9 c;  4WJ3 M;  1WFQ A;  2GVA A;  4LW1 A;  1Z47 A;  1X3F A;  1X65 A;  1J6Q A;  2WFW A;  1KXL A;  4EX5 A;  1HNW L;  5BR8 L;  5ELO A;  3AQQ A;  4A3K G;  2YTV A;  1Q86 C;  3W5O A;  2CCZ A;  5C4X G;  1V1Q A;  3CCU A;  1S72 A;  4TQU S;  1IBM L;  3KF8 B;  2LSS A;  1NY4 A;  4DK3 C;  1SFO H;  4C3J H;  2LXK A;  4RMF A;  5C0X I;  3I4M G;  4MTN A;  2IHE A;  4R4Q A;  5FJ8 G;  4LF4 Q;  1LUZ A;  1X3E A;  3HOW H;  1HNX L;  2E5L L;  1SRU A;  3I4O A;  4DAY B;  3HOX G;  4DV6 Q;  1XNR Q;  1QZG A;  1ASZ A;  4P74 A;  3MEF A;  3JAM c;  1WYD A;  3K80 C;  4A3F G;  1A62 A;  1JJC B;  1C0A A;  3UE0 A;  3PUY A;  4JOI C;  4NXM L;  1YHB A;  4DV2 L;  4LF7 Q;  1K3R A;  1UEB A;  2VL6 A;  1NJI C;  1IBK Q;  1IL2 A;  4NPS A;  1VQG A;  2Y0S E;  4OWT B;  1K8G A;  3GTJ H;  4A3B G;  4GOP C;  3H15 A;  1R9T H;  3GTO H;  3M4P A;  3M4Q A;  2PI2 E;  4LUO A;  4O0A A;  1D8L A;  1G51 A;  3UE1 A;  1VQK A;  4WJ4 A;  5LMN Q;  1NTG A;  3NEN A;  2I5L X;  5IE8 A;  4LF9 L;  4PMW A;  1EQQ A;  2E2H H;  4GKJ L;  1U0L A;  4YWL A;  1IBK L;  1BVS A;  1Y1V G;  3TRE A;  5IY0 A;  2XTI A;  4DUZ L;  4HJ7 A;  4TVA B;  4IFD G;  1OXT A;  1K9M C;  1AE2 A;  1UE6 A;  2F4V Q;  1QVF A;  5IYD H;  1UE5 A;  1VQM A;  4YHH Q;  3KLW A;  2E2J H;  5IYB H;  2AHO B;  1B8A A;  4LFB L;  1K83 H;  1FL0 A;  2CKZ B;  1VQ7 A;  1YVC A;  4AYB E;  1IZ6 A;  4LF6 L;  1E1T A;  4A75 A;  3T1Y Q;  1K8A C;  1A8V A;  1Q1E A;  2IHF A;  4A3J G;  4JI8 Q;  4A3G G;  2AWN A;  4P75 A;  4LNQ A;  1PV4 A;  1SN8 A;  4A3D H;  4JBW A;  3FP9 A;  4DR1 L;  3OYY A;  5M5Y H;  2JA9 A;  4A3I G;  4A3L H;  3RN5 A;  1CSQ A;  3CMA A;  4IFD I;  2RCN A;  1HH2 P;  2OCE A;  4DR3 L;  4B3T L;  2PNH A;  4IPH A;  4Y7N H;  3T1H L;  4JG2 A;  4NXN L;  4IOA A;  2RHS B;  1PH2 A;  4C3I H;  3PF5 A;  3EBE A;  3KOJ A;  3NEM A;  4K0K Q;  1TWF H;  5FLM H;  1G29 1;  4YCU A;  1VQ9 A;  4DR5 Q;  2R7F A;  4JYA Q;  4JI2 Q;  4X65 L;  4DV3 Q;  3HOZ G;  4B3S L;  3CCL A;  1Y14 B;  2WAQ E;  5FLX c;  3I4N G;  5M3M G;  1HZB A;  4HIO A;  4QL5 A;  4P72 A;  3HOV H;  1N32 L;  4DV4 L;  1EOV A;  4MNO A;  3CCV A;  3BZK A;  4A3M H;  2WB1 E;  4LF5 L;  2CWA A;  4OXP A;  4KHP Q;  1CKO A;  5ELN A;  4DV0 Q;  3AYH B;  1CKM A;  2K5V A;  2Y0S G;  1X56 A;  3I55 A;  5M5X H;  4GNX C;  4BY1 G;  5JJL A;  2JEB I;  2CQO A;  1VQI A;  1PVO A;  2GVB A;  4DR4 L;  4DV7 Q;  4HIK A;  5HY6 A;  3NEL A;  1SLJ A;  1XPO A;  1N9W A;  4H02 A;  4JI5 L;  5IP9 H;  5C4J H;  1Q81 C;  5LMU L;  2OTL A;  4L5S A;  4DUY Q;  4IPC A;  2OTJ A;  4JV5 Q;  2YTX A;  3H0G G;  4C3H H;  3OW2 A;  1HZ9 A;  1W3S A;  3J80 c;  1KL9 A;  4HJ8 A;  2BA0 A;  2B3G A;  2ZTC A;  3UDX A;  4JI7 Q;  4JI0 L;  4AYB G;  1VQF A;  1TXY A;  3LGJ A;  1JB7 A;  4GKK Q;  2UXD L;  4HJ5 A;  5JJI A;  3EIV A;  3HOU G;  1E24 A;  4DV5 Q;  4IOC A;  3H3V H;  2Z0S A;  1E7Z A;  3CXC A;  1K73 C;  1B7Y B;  5K36 G;  2NN6 I;  2UUB L;  2UXC L;  4AH6 A;  2JA5 H;  2IY5 B;  2YTY A;  2VQF Q;  2K14 A;  1KD1 C;  1LM0 A;  2UXB L;  4BBR H;  1TWC H;  4C2M H;  4R4C A;  5IYD G;  3J7A 5;  3EN2 A;  2ZM6 L;  3CAM A;  3ICE A;  4OO1 G;  1VQ8 A;  1Q46 A;  1MKH A;  1XNQ Q;  4R4T A;  2UU9 L;  4LFC Q;  2JE6 I;  2WAQ G;  2Q2U A;  1YZ6 A;  4X62 Q;  1BBU A;  4ALP A;  4P71 A;  1QVG A;  3GTM H;  3S14 H;  4B3M Q;  3PUV A;  4A3D G;  2L15 A;  4GLA C;  3A0J A;  4YY3 Q;  4HJ9 A;  1J5E L;  2DGY A;  4DR2 L;  4OX9 L;  2JK8 A;  3ZJY C;  1YHQ A;  3GTL H;  1XJV A;  5E7N A;  4DNI A;  3PO2 H;  1AE3 A;  3CC2 A;  1UE7 A;  3PV0 A;  2GN5 A;  4BA2 I;  4DR7 Q;  4HIM A;  2H5X A;  1HNZ Q;  2E2I H;  5JEA J;  2PI2 A;  2VQE Q;  5IYC G;  2NZH A;  3M9B A;  4P73 A;  1KHI A;  5FLM G;  1V9P A;  2A19 A;  3BZC A;  5AJ3 Q;  4GLX A;  1Q8K A;  4JBJ A;  1Y1W H;  4POG A;  4GLV B;  3CW2 C;  2K52 A;  5GAE C;  2ZTD A;  4A3C H;  2HHH Q;  4HID A;  2AWO A;  2OWO A;  2JA6 H;  2MO1 A;  3PUZ A;  4JI3 Q;  3HOV G;  4BBS G;  4QQB X;  2ASB A;  3ULP A;  1LTL A;  1OXX K;  2KHI A;  1FGU A;  4A76 A;  3ER0 A;  2QA4 A;  5GAH C;  1PH5 A;  1XPU A;  2R92 G;  1VQP A;  4IJL A;  4LF4 L;  4KHZ A;  4AQY Q;  1EUJ A;  4DV6 L;  1QZH A;  1XNR L;  2FXQ A;  4RG1 A;  1VQO A;  3PF4 A;  3S1R H;  5IWA Q;  1SR3 A;  2MO0 A;  5H1S E;  3HKZ G;  3AFP A;  1YJW A;  4LF8 L;  2YYZ A;  1YIT A;  2R7D A;  4LF7 L;  3B6Y A;  2JQO A;  4X66 Q;  3NBH B;  3VDY A;  3GDE A;  2JA8 H;  3S1Q H;  1KC8 C;  3AEV A;  1N33 Q;  5C44 H;  4B3R Q;  3M3Y H;  1WCM H;  3D0F A;  1P16 A;  1B70 B;  5LMN L;  2RHQ B;  3S24 A;  5M3F G;  1WI5 A;  4LUV A;  4UP7 A;  3GTG H;  2N78 A;  1O7I A;  2B63 G;  3E9I A;  1JE5 A;  2F4V L;  2AMC B;  3CPW A;  1XMQ Q;  1Z9F A;  4DK6 C;  4GN5 A;  3RLF A;  4YHH L;  2VUM H;  1VQD A;  3G71 A;  2QEX A;  2D62 A;  1N34 Q;  4BBR G;  4UPA A;  3PUX A;  2F3I A;  3F8T A;  1P8L A;  1IXR A;  3T1Y L;  1Q7Y C;  4JI8 L;  2NVT H;  3PSI A;  4OWX B;  2ZTE A;  1C7Y A;  2ZJQ A;  2E8G A;  4JBK A;  3RR5 A;  2VZA A;  2LXJ A;  1PH4 A;  1N34 L;  3GTK H;  5JEA G;  2K4K A;  2UUC Q;  3OTO Q;  5HGQ A;  2R7Z H;  4DR6 Q;  2PMZ E;  3CCM A;  1HR0 Q;  2MQH A;  3TS2 A;  3RNU A;  4NB3 A;  3L7Z C;  4KLK A;  4LFA Q;  4K0K L;  1M1K C;  1MIU A;  1D7Q A;  3M4O H;  3G6E A;  1N36 Q;  4DR5 L;  3HOY H;  1XMO Q;  4JI2 L;  1S40 A;  4DV3 L;  1GKH A;  1NBW A;  1YJ9 A;  3F2D A;  5GQO A;  4XTC S;  4J15 A;  4YCV A;  2UUA Q;  1FJG Q;  1HR0 L;  4A3K H;  1W2B A;  1Q12 A;  3ERS X;  1VQ4 A;  4JC0 A;  2JJQ A;  2KCT A;  4R4O A;  5C4X H;  1Y1W G;  2V1C C;  2YU9 H;  1KRS A;  4O2D A;  5GRO A;  4PZ6 A;  4A3C G;  4KHP L;  2R6G A;  5DLQ E;  2VS1 A;  3KYH C;  4DV0 L;  1EIF A;  3STB D;  3HOW G;  1JT8 A;  3I4M H;  4JI6 Q;  4X6A H;  2Q2T A;  1EIY B;  3STB C;  1X9N A;  2I5H A;  2Q2H A;  3CME A;  3M7N A;  3K81 C;  2EXD A;  3TQY A;  4DV7 L;  3WWV A;  2R93 H;  1GO3 E;  1E22 A;  3ULL A;  3M85 A;  1IYJ B;  1PH7 A;  4DUY L;  1U5K A;  1CUK A;  4JV5 L;  3TRZ A;  1EFW A;  4QGU A;  1I6H H;  3PCO B;  1HZA A;  1JJ2 A;  1KQS A;  1YI2 A;  4JYA L;  1DGS A;  4JI7 L;  1ASY A;  3AFQ A;  4JCV E;  2KHJ A;  1BBW A;  3F2C A;  2A1A A;  3E0E A;  2JA8 G;  4LUZ A;  3CCE A;  2NVX H;  4GKK L;  3CCR A;  1XTD A;  4JBM A;  4JI4 Q;  1WCM G;  3A5U A;  3K7A H;  1TWG H;  1YBY A;  5IYB G;  4DV5 L;  3RN2 A;  1PH8 A;  3KFU A;  1A0I A;  4BA1 I;  2KCM A;  5C3E H;  1FVI A;  4POF A;  2YV5 A;  1QVC A;  2VQF L;  3S2D H;  2XGT A;  4R1J A;  1VQJ A;  2C35 B;  4X64 Q;  2JA7 H;  1PYS B;  3U58 A;  4A3J H;  4A3G H;  1I94 Q;  4A3L G;  1XNQ L;  2WB1 G;  3MXN B;  4Y52 H;  3ULJ A;  1X6O A;  4LFC L;  1PH1 A;  1VQA A;  1PFS A;  5EAY A;  2D0O A;  3F2B A;  1EYG A;  4LF8 Q;  3KJO A;  2HIX A;  3W1B A;  4X62 L;  4DV1 Q;  1RL2 A;  1HJP A;  1VCI A;  3U50 C;  1IBL Q;  4B3M L;  4OO1 I;  4JI1 Q;  3J7Z C;  3PIO A;  3U4Z A;  2BH8 A;  2F52 A;  4YY3 L;  1UWV A;  2ZJP A;  1VQB A;  4EQ5 A;  1G6P A;  1I3Q H;  1WJJ A;  2Z6K A;  4PZ8 A;  1VQL A;  2B29 A;  1HNW Q;  3Q8D A;  2IX0 A;  5BR8 Q;  4A3E H;  1YJN A;  2CWP A;  2R7Z G;  1HNZ L;  3HOZ H;  4DR7 L;  3I2Z A;  2VQE L;  1I5F A;  2N8N A;  1I50 H;  3W1G A;  4IPD A;  3I4N H;  5M3M H;  3HFZ B;  3CF5 A;  2Z6K C;  1CKN A;  3I7F A;  3IRB A;  5AJ3 L;  4A3M G;  1IBM Q;  3HOY G;  1TWA H;  4APV A;  3RZO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...