1A6XA

Structure of the apo-biotin carboxyl carrier protein (apo-bccp87) of escherichia coli acetyl-coa carboxylase, nmr, 49 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
MEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the carboxy-terminal fragment of the apo-biotin carboxyl carrier subunit of Escherichia coli acetyl-CoA carboxylase.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Carrier protein
molecule keywords APO-BIOTIN CARBOXYL CARRIER PROTEIN OF ACETYL-COA CARBOXYLAS
total genus 7
structure length 87
sequence length 87
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1998-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a6xA00
1OXSC 4KN4C 3CRLC 1BDOA 1I6VC 1LACA 1OXXK 1HTPA 1LABA 4DNRB 4IFDG 1E2ZA 2NN6G 4IFDH 3QJYA 1K8MA 2K7VA 3SDZA 1Y8OB 1Z6HA 4L8JA 1Z7TA 2E74C 3VR3A 1Q12A 3VR5A 2EJMA 4H13C 3LNNA 1ONLA 1GHJA 1A6XA 4OO1G 2YYZA 3NE5B 4OO1H 1HCZA 3KLRA 4HR7B 3M7NA 3IFTA 1Y8NB 4BA1I 5A35A 2JEAI 1H9JA 3WDNA 1OXUA 4IQZA 1YNNC 1Q1BA 3I4LA 4DNTB 2JEBI 2PNRC 1EWHA 3M4YA 4KMUC 4DK1A 1GJXA 1O78A 3VA7A 1G291 1FR3A 3CRKC 2AWOA 1GUOA 3DXJC 3OPOA 4OGQC 4GZYC 4I7ZC 3MFYA 2L5TA 3M85A 4LK1C 2A6EC 1GUSA 1B9NA 1V43A 1PMRA 2AUKA 2EJFC 1H9MA 4KKTA 4JK1C 3VR4A 2BA1A 2LMCB 3PUWA 1IW7D 2D2CC 3GD7A 1OXVA 4KKSA 3HGBA 3A7LA 1E2WA 3PUXA 3T51B 5JEAH 2O5JC 3W3AA 2ZT9C 2BE5D 2NN6H 3QIAA 1VF7A 1DCZA 5C0XH 5BN5A 1E2VA 3P20A 1H9RA 4LJZC 2KA7A 2K33A 3BG3A 3L7ZC 3T53B 1VCIA 1CFMA 2EVBA 3A8IE 2JXMB 2A69C 1T5EA 2KCCA 3FMCA 3LWUA 4H0LC 3MXUA 4DK0A 3VR2A 3IKJA 3ND9A 1SMYC 2QF7A 3A8JE 1Q90A 2BDOA 1DXMA 1CTMA 2AUJD 3D31A 3SE0A 1H9SA 5KNDA 2F1MA 2R6GA 3PV0A 3RLFA 1GUTA 2K32A 2DN8A 2D62A 5BN4A 1Q1EA 3A8KE 3EQLC 3PUYA 3PUZA 1V8QA 5KNCA 4PV1C 3OOCA 1ZKOA 1IYUA 2V4DA 1ZYRC 5KNBA 2B8GA 4TKOB 1TKWB 3TZUA 2E75C 1H9SB 4KN7C 1VF5C 2D5DA 1HPCA 1O7LA 4RCNA 1Y69U 1IW7C 3FPPA 3PUVA 1GHKA 2B8FA 3GQBA 5BN3A 3VR6A 4XIGS 2A6HC 5K36H 2JE6I 1GUGA 2Q8IB 5JEAG 2CW0C 1YNJC 1B9MA 2A68D 2E76C 2EJGC 4H44C 1K8OA 4KKUA 1IYVA 1GUNA 1Y8PB 2BE5C 2DNCA 2IT1A 3U9SA 3AB9A 2PCFB 3OW7A 1QJOA 3A7AB 3T56B 2O5IC 5K36G 1H9KA 3H94A 4BA2I 4G7OC 1OXTA 1TU2B 2A6HD 3N6RA 3I72A 4TQUS 2A68C 2BA0A 1CI3M 3ND8A 4KI0A 4JBWA 3D4RA 1VDZA 2A69D 2NN6I 3BDOA 4G7HC 1DD2A 4KHZA 3QG1A 3I73A 1HQMC 4XTCS 2EDGA 4G7ZC 1FYCA 2A6ED 2PPBC 5C0XG 2DNEA
chains in the Genus database with same CATH superfamily
4ZQ3A 3HKZB 4KN4C 3BVMA 1PTOH 1EZ8A 4LF4L 3CRLC 3KLSA 4H7BA 4IPGA 5IOCA 1LABA 2HHHQ 1PYBA 1ICWA 3DWQA 5CBEE 2K04A 2L9HA 4MTKA 1NBWA 3DEOA 1SNCA 4WRDA 4XT1B 4K5XA 2PMZE 2OF1A 4A3KB 2HQLA 3NK9A 3J81c 4A3FG 2RSOA 4IZ8A 1ILQA 2YYZA 5IYCH 4LF8Q 5IYDG 1BBWA 4PG3A 1U4LA 4GLXA 3IFTA 5IT9L 2UUBQ 1SYDA 5M5YH 1SYFA 1PFBA 2RBMA 3OYYA 4HCSA 1EOTA 4GN3B 3MFYA 3X3MA 4ZUJA 4UY8C 3PQIA 1L1OC 1PMRA 2CH4W 1NY4A 3QWNA 4X66Q 3FP9A 3NP8A 3T1YL 5M3MB 4J15A 4E6IA 2HT1A 1CK1A 4DR6L 5JJIA 1JC7A 1I6HH 2PQAA 5BN5A 1K3BC 4WFN3 2JA5G 3V2TA 1V1PB 4HIDA 1LT6D 4OL7A 5AJ3Q 1QNUA 3BG3A 4A3EH 2HQEA 5C5LA 5C5MA 1LTRD 5CMDA 1MHWC 1SROA 1EY4A 4QUCA 3PV0A 4DR4Q 4QY7A 1KAWA 1MSGA 4CDEC 1QCBD 1SMYD 2JA7B 2DJFC 2B8GA 4HSVA 1TKWB 2RSNA 3ZYYX 1FL0A 2EYJA 4OWTB 4A3JH 4IALA 5IGDA 1NE3A 4LFBL 1BO0A 2EY1A 1YNJC 4ZYSA 1MBYA 1CZWA 1TWFB 1V9PA 1L0WA 2IPKD 3M9BA 5IE8A 3GTOH 5CORA 1V1QA 1H9KA 3ULLA 3RMHA 1BCPF 3J80E 2E2HH 1K0SA 4C2MH 2A68C 1VDZA 4PMCA 2A69D 4IJHA 4P72A 4ZKBB 3GTPH 1EIFA 1X55A 3P7JA 4HJAA 1FYCA 5FLXL 3L2PA 5CV4A 3CC7A 5C4XG 1F2MA 3TQYA 4DR5Q 4K2LA 4DV7Q 3S2HB 2VS1A 3C1EA 4DV4L 1WOCA 2B2TA 1W3SA 2B2UC 5G3LD 3I4MG 3VR5A 4OX9L 2EIFA 1ONLA 3CCUA 3MA2B 1DOMA 1BKBA 1EYAA 4B3RQ 5CV8A 1IL8A 5ELBA 5FK9C 1HA6A 1A0IA 1STAA 4KY7A 1UE1A 2PZUA 1DYQA 3OPOA 3TN2A 2Y0SE 3J80c 4KK7A 4IUUA 2A6EC 1VQGA 1ZEQX 3FHWA 1ENAA 2E5LQ 4A3JG 4R8IA 4A3DH 2D2CC 4RKBA 3U9OA 2QEJC 3GTMH 3GTQH 2QILA 3ULPA 3H3VH 4JI2Q 4DUZQ 3KDFB 3L9AX 2WINB 4BBRB 1PHJA 3GTGH 4BXXH 3A8IE 3S1MH 1VQBA 4QQBX 2Q2IA 4H0LC 2J7ZA 1L0XB 4YCWA 2DJGC 3CCJA 1FGBD 2N8NA 1YJWA 1HR0Q 1XWEA 3I4NG 2EXDA 1N9WA 1FNUA 1X3PA 4A93B 2EZVA 2KOLA 2VW9A 4ULLA 4C3JH 1D7QA 4L6TB 1I50H 4YWKA 3STBC 1C0AA 2G9DA 1B9MA 2C9OA 1Y1WB 2QDBA 1VQDA 1SDFA 4KJOA 4XYOA 3A7AB 4NXML 1CSQA 5FO9B 4BA2I 4K0KQ 1QVFA 3W1GA 5M3MH 5CR3A 3A56A 2DY8A 4GKJL 4R4IA 4XTCS 4G7ZC 2F0OA 1KABA 2A6ED 1STYA 3BZDB 1SAPA 2DNEA 3K5MA 1KRSA 4A3DG 5CV9A 4QB4A 5DAUA 1PTOD 2F0DA 4RHSA 4GOPB 2VNUD 1VQKA 3UDGA 4DAYA 4B3ML 1IXRA 2BOSA 1HCZA 2CWAA 5DEHA 4B3TQ 3WOEA 4LW1A 3WDNA 3M4OB 3G6JB 4BY7G 5M5XH 1I4PA 2F0UA 3J81i 1D5MC 2R7DA 3CAMA 3GDEA 5M5WH 3M85A 2UUCQ 5HY6A 1LYLA 4KHVA 1J5EL 3BVZA 4DR7L 1V43A 3I70A 2JJQA 4AYBG 4DR4L 3NEMA 5DLQE 4A3KH 5GQOA 2VB3X 2EYLA 1G6ZA 2VUMG 1PRTD 4DAPA 2PNHA 1LT3D 4X3KA 1BXTA 2KBNA 3BS1A 1SSOA 3TREA 3A5UA 1ENFA 1ZYRD 4PNYA 3IKJA 3J81j 1JE5A 1EU4A 5C3XA 1J5EQ 1IBML 2R7ZH 1S72A 1I94Q 3SE0A 2I07B 3GV6A 4UHVA 2ZM6Q 3JAMi 2K4KA 3I4NB 1RDPD 2OEOA 3S1NH 1X9NA 1EEID 3S24A 1W2BA 1HUNA 1CUKA 3FPPA 1PH6A 3FVQA 4LWCA 3AYHB 2LFNA 2NVYB 4DR2Q 1IBKL 5K36H 1N36L 1K83B 4APVA 1UAPA 4P71A 1GUWA 2B29A 4HIKA 2JA6G 4NXNQ 3AB9A 1E0BA 4BY7H 1PLFA 4FXGC 3CC2A 4GNXB 2CQOA 1FNVA 3CCRA 2K75A 5JPNC 5EBDA 3CXCA 2WV6D 1T9HA 2JA5H 1NR2A 1DD2A 4C3IH 2H5XA 4GN5A 3K5LA 2KQ3A 2RDHA 2WIIB 5EPLA 4JC0A 4JI3Q 5ELCA 1N33L 1X65A 3NELA 4A3BH 1UEBA 3HOYB 3UE0A 2X6GA 4YWMA 2A8VA 3OWFA 4OIJA 2YTVA 4EQNA 1D2BA 4J6HA 2B63B 4HIMA 3BVGA 1GVPA 1IL2A 4IOCA 2WB1G 3ERSX 5LMNW 2Z4HA 1OXUA 2F0WA 5M9OA 2MNAA 2UUAL 3DM1A 4KMUC 3GTKB 3Q24A 1TWAH 3MEFA 5KEEA 4X64L 2KEEA 2KEDA 1VS0A 3CF5A 1CZGA 2K05A 1VQ9A 3D6CA 4JK1C 5FO8B 5FO7B 1HUMA 2EXZA 1X3EA 1B8AA 2PI2A 4UAIA 3DEPA 4ME3A 2KHJA 3TZDA 2Y0SB 1XNQL 5EJWA 1E2WA 1SNPA 1VQMA 1PTOC 3E6ZX 3U4VA 1Y1VH 2KA7A 4DGZA 2ATWA 3H0GH 3L7ZC 1N32Q 1F9QA 5IT9E 4RMFA 2UU9L 4L63B 4X64Q 1PTOF 1EY9A 2K1BA 2C5CA 1AE3A 1SMYC 2D9UA 3OW2A 4OWXB 1R9TH 2Z6KC 1VQ5A 3KLSX 2I46A 1IKLA 2F0SA 2FHTA 4K0KL 3K0XA 2JA7G 1V8QA 1A3UA 2PW7A 5EKKA 4XQNA 3TZUA 3HOWB 5M3FB 1UE6A 1O7LA 5T1GA 1KAAA 4CDCC 3H09A 5JVH3 4LF5L 1TY2A 3IFDA 4FF2A 1WD0A 5BN3A 3S1QB 4F8MA 2JSOA 5ISRA 4LAAA 3JAML 4H44C 1SFOH 2IT1A 2VB2X 3M4OH 4RH6A 3A5ZB 3E0EA 5M5XB 4CDFC 2VUMB 2D0OA 1XX8A 4LFCL 2Y0SG 3M3YH 3TDQA 2AQ3B 1PH8A 4IPDA 2BH2A 1BCPC 2EDGA 1TXYA 3DMUA 1G6PA 4LF5Q 3NTHA 3C46A 3PO2H 1EY8A 2L4NA 4FVMA 1PH3A 1BOSA 1Z7TA 2B63G 2I5HA 3F2DA 2UXDQ 3VR3A 2G5DA 3P1HA 3RZDB 1STGA 4LFCQ 5IYCG 3TRZA 4LUVA 1JT8A 1XXGA 4DNIA 3QO2A 2WAQG 1YNNC 3B6YA 4WJWA 1KIXA 1O78A 1BBXC 5FLMG 4RG1A 4JI8L 3R8BA 4OIKA 4NDXA 4ZAIA 3Q6SA 4DR1Q 2AUKA 1I94L 4A3MH 1H9MA 1S3OA 4ZUIA 4A3MG 2QCPX 1QG7A 4QGUA 3PUWA 5T1IA 4LF6Q 2JA8H 5DM73 2SNSA 2O5JC 1X3GA 2NWGA 4LF9L 1VF7A 5LL6S 2UUBL 1E24A 4R4OA 2NZHA 1TT2A 2XGTA 3R2IA 5G3LF 2K03A 2OQKA 3PMFA 4HMIA 4BWGB 3S1MB 3CCQA 4DV6L 1WJJA 1CQVA 4Z9CB 1YEZA 3I55A 4RGMA 1PRTF 4GNXC 2BDOA 2JK8A 4NXNL 2PMZB 2A1AA 1HNWL 4CJ0B 1H9SA 1SNDA 3MXPA 1QNKA 2NVQB 4ODGA 4MIUA 2ZXPA 1Q1EA 2JA8B 1JWUD 1YHBA 4JBMA 4N9PA 4HJ8A 3VYUA 3HOXB 3WWVA 2DUDA 4DK6C 5CV5A 1GO3E 1IW7C 5CGKA 1GHKA 1VQFA 4R1JA 4JI3L 4A3FH 3H3VI 1CM9A 1ML0D 4DV6Q 3H3VC 2MPMA 3CMAA 3J81E 5LMUL 3E5SA 3FPUB 5DM63 4G57A 3AU7A 4J8QA 1I6HB 1ASZA 4FF1A 3CCVA 1A2UA 1EOVA 4XXEA 4CKCA 3H6MA 5C4JB 1NJIC 2XRQD 3KBXA 4DK3C 1YNJD 1NSNS 1W6JA 2GN5A 4C3HG 2UUAQ 4KTAA 4ZK9B 5F2DA 2PO4A 2R3ZA 4GOPC 1HZ9A 3CMEA 1HTPA 1PZJD 1SNMA 2F0NA 1X3QA 3PO2B 2J0TD 3K81C 4EQ5A 2F0PA 2PZTA 2XVSA 1Q12A 4N8FA 1O80A 2EYPA 1XNQQ 4OO1H 3TEHB 2R7FA 1WTVA 4A3GG 2WAQE 1K73C 1ET9A 1EZ6A 3E3XA 2K28A 4LNQA 3NPPA 3HRZC 5JVG3 1K0RA 2HIXA 5EBCA 1STHA 1JB7A 1EQRA 5C44H 3MEHA 4O2DA 1CQFA 1KNAA 3PO3H 3P75A 1IW7D 2R93G 1Q46A 2IW3A 4A3LG 3RD4A 4JI0Q 1DCZA 4JI6L 1MSHA 4P74A 3I3CA 3TP5A 3Q22A 1KQSA 1UE5A 1DOKA 1JOOA 4PZ7A 3UE1A 4BBSB 4BXXG 2RCFA 2OQ0A 4UPAA 3PO2G 3FKIG 3LX0A 1JMCA 4FXDA 3NBHB 2DY7A 1XPRA 1CSPA 1HFGA 5BN4A 2K5DA 3G7LA 3K80C 3L3OC 3HFZB 1S5ED 1EUJA 1NMFA 1VQCA 1HQRD 3T1HL 2JQOA 4OXPA 4TKOB 4DUZL 4RCNA 2NVYH 3MVVA 3EIVA 5ELEA 2MQHA 1R4PB 1XTDA 4WJ3M 5ELFA 4XDXA 2HHHL 1QUQB 3GTJH 3LWEA 1GUNA 2XNAC 1RD9D 4K14A 3T56B 1XPOA 3CPFA 3CQZH 1JICA 3KOJA 1TWHH 2L12A 3NWSA 5E4WC 1U5KA 5L37A 1KLUD 4L5TA 2AQ2B 3ND8A 4Y52H 4LFAL 1L2FA 3D4RA 4JI5Q 5FJ8G 1NTGA 5J1ZA 2LY7A 4HTHA 2F0TA 1HHVA 4IOAA 1AH9A 4JBKA 1WTHA 1TS5A 4X62Q 4RHRA 4JI8Q 3BDLA 3HOUG 1EIHA 2CHBD 2YV5A 4B3SQ 3D8GA 1EEFD 4DXFA 3ZJYC 2B2VC 3K58A 2XRSD 4GLVB 2IL8A 2OTJA 1BCPD 5IY0A 2F0GA 2AKWB 3KF8A 3Q8DA 2UXBL 4JI5L 3HOYH 3MC0B 1H9JA 1RHPA 1STEA 4JI1Q 5JJKA 1B3AA 1EU3A 3I4LA 2PNRC 1TVXA 2WP8J 1GJXA 1FJGL 3VA7A 1G8ZD 4YIJA 2PQEA 1BBUA 5C3EB 2B2YA 2M9VA 3AEVA 3MTSA 3MXGA 3GTJB 3SGIA 5C4ZA 2RDFA 3SK5A 3D3RA 1B9NA 4ME5A 1NAPA 4KY5A 1TWHB 5KYIA 3VYTA 1WTPA 4C3JG 2CCZA 4A3KG 4BY1H 3NSWA 4BY1G 4B3MQ 3KK7A 4FF3A 2UXBQ 3WOFA 2R61A 2XWBB 1K8GA 2BE5D 3HOVG 2WACA 5M5YB 1TS2A 1E2VA 2VL6A 1SLJA 1NNXA 5KYLA 1FJGQ 1VCIA 4BBSG 1TWCB 3SR1A 4LFBQ 1L1OB 3ND9A 4NB3A 1VQ6A 1KXLA 3H0GG 1EY6A 1STBA 1CKNB 2F0LA 2NZ1D 4PMBA 5KNDA 2ICEC 2E2JB 1PV4A 4PV1C 4KV6A 1ZYRC 4TVAB 1F2LA 2Z8LA 1S4ZA 3JAMc 4HIOA 1VF5C 1HPCA 1DOLA 2HUGA 3T13A 2F0MA 4CJ1B 5IYBH 1QE6A 2A6HC 2Q8IB 2Q8RE 5JEAG 3HOZB 1V1OA 2CKZB 2FMCA 4DV4Q 1IYVA 2NB0A 1Z47A 3OW7A 5FJ8H 1U9RA 1YNND 1JE4A 3EJIA 3I4MB 3PGZA 4B9XA 2TSSA 3ULJA 3NTKA 1O7ZA 2I0QA 2F3IA 3CU7A 3KF8B 1HQMC 4A3EG 3W5OA 1BUVT 4MHEA 3MFGA 1X6OA 4DV1Q 2IY5B 1SJHD 1MGSA 4AIMA 1N36Q 4DV2Q 1G2TA 4C1NI 2E74C 4YWLA 1SMXA 3CKIB 4HJ5A 3I56A 4JOIA 1MJEA 3EA6A 4QMGA 4WJ4A 3S1RH 5A35A 1C9OA 4IQZA 4PMWA 2JN4A 4JI6Q 3F8TA 1MJCA 1Q1BA 2JEBI 3W1BA 5IP9H 1TS4A 1EWHA 3VYSA 4A3IH 4DV1L 1N33Q 1OO9B 4C1NK 3CRKC 4XYQA 1KD1C 3PO3B 2QKIC 5AFWA 3OTOQ 3HEJA 4LK1C 2SNMA 4DV2L 5IIFA 4A3MB 3R2TA 1EIGA 3I90A 3ITPA 2EJFC 4A76A 1JJGA 4C3JB 3U50C 3GD7A 2I5MX 1IZ6A 3HGBA 4X3SA 2K50A 5ELOA 1PH9A 4J1MA 3PF5A 1MKHA 3T1HQ 1EYDA 1EWCA 1MD2D 5KRUA 2Z6KA 5EGTA 2IX1A 1B2TA 3I7FA 2EOTA 1KNEA 3J7A5 5E3FA 2NVXB 1HRJA 3A8JE 3J7ZC 4FF4A 2JYOA 2D0PA 1WI5A 3D31A 2NVQH 3TMEA 1JOQA 4KHPL 4LFAQ 4GKJQ 1TY0A 3CP0A 2NVXH 1PH5A 2B2WC 4POFA 4Y7NB 2K5VA 4OHJA 4TSSA 1EQTA 3PCOB 5C3EG 1UEAB 1F77A 1HZAA 4B3SL 2LXJA 4IUQA 4HSPA 1GD7A 1JWMD 2BE5C 3GTOB 2J4XA 1HNZL 1WYDA 2R93H 2UXCL 4C3IG 3GTLH 1DJRD 1Y14B 4A3FB 4JI4Q 2F0EA 3E0JA 1FNWA 4B3TL 2EY2A 5C6AA 3HOXH 2QW7A 5IP7H 4A93G 1LV9A 3QR8A 5IP7G 1YNXA 5D3DA 5IWAL 3S2HH 3F2BA 1Y1WH 4K2KA 3CD6A 2UUCL 3SK8A 1E3PA 2NN6G 3SDZA 1Y8OB 1Z6HA 1QOHA 1SE3A 5I4DA 2E2IH 1C4QA 4NW2A 2M00A 4N9TA 3GTLB 1T5XD 5IP9G 3PIP3 1AW7A 2RDGA 3NBIA 4HR7B 1IHZA 1LTSD 1ICFB 1Y1VB 2PZWA 2OTLA 1HZBA 2MUYA 2A73B 1YI2A 2N88A 1WTQA 3T16A 1QWYA 4OO1I 4FNFA 3RLOA 1TWFH 1SFOB 5J39A 3TBIB 4PQXA 1IBMQ 1BF4A 3GTGB 1MIUA 4EVOA 1VQNA 1XMOL 4RWSC 1OXVA 2AQ1B 3T51B 1IYJB 1ENCA 4JI7Q 3F2UA 1KDCA 2K33A 4DR2L 1IBKQ 3UDFA 1YITA 1LTBD 1RF2D 1T5EA 1D1KA 3FKIB 1JORA 3RZOB 2I5LX 1HR0W 2B2WA 4K5VA 3RUZA 4QCLA 3J80L 2AUJD 4F7XA 1TWCH 3PIOA 2MJ8A 3M4QA 1GUTA 1SBBB 2Z4IA 1VQJA 2PQAB 4KD3A 3HZXA 1XMOQ 4DF7A 5KNCA 4QUFA 4A3BB 5HGTA 5C3WA 2LXKA 4LF9Q 3GV3A 1HH2P 1XYIA 1C48A 1CA6A 1WTOA 2KENA 5FLXE 2E2DC 4JBJA 2ENBA 4TRDA 3PO3G 3C1FA 3EROA 2KJXA 1WTWA 1ZXTA 3UDXA 5KGUA 4H02A 3G71A 4R4CA 5COYA 4NKLA 2B2VA 4I7AA 3CQZB 2ASBA 2YU9H 4IUNA 1G91A 2ALYB 3GTKH 1TU2B 3D4WA 4X3UA 3I72A 1I4QA 5GAEC 1HFNA 1S5DD 4IJLA 2NN6I 1HXYD 1J8IA 1PFSA 4EQPA 5I2YA 3PIO3 4HJ9A 3S15B 3S17B 3NUCA 3QG1A 3G48A 1XJVA 1SJED 1PYSB 2PYKA 1JJ2A 2O4XA 1PTOB 2WKDA 1BDOA 1LACA 2K5QA 1OXXK 1N34L 3JAME 2GA4B 3CW2C 3OTOL 1II3A 3D6WA 2ES2A 1PFNA 1AEXA 1DONA 4L8JA 3SXHA 1I4GA 1EWIA 4RAUC 3KJOA 1O7IA 4O1NA 4JOIC 3I4MH 3DLLA 4OO1G 2B2UA 1M90C 3AMUA 2JA7H 2B2TC 2JA5B 3K57A 4YCUA 3A54A 4WORA 2K52A 2CQAA 5A2QL 2F3WA 5C4XB 4FO2A 4K8JA 1FR3A 4OGQC 1EYCA 1BR9A 2UU9Q 3M4PA 4GZYC 1SYEA 4I7ZC 4P75A 3KDFA 2K01A 4FP5D 1GM5A 1XPUA 2ZTCA 4IPCA 2A74C 3PSIA 4C3IB 4N8X1 1PH4A 1EYGA 3S16H 1VQPA 2TMPA 2AWNA 1LTAD 4RA8A 4KHPQ 3A7LA 3OHXC 3J80i 4OELB 2WB1B 1EY0A 2L11A 3P20A 4GLAC 2K5HA 1S40A 1C7YA 2JA9A 2KUMA 1SE2A 3TP7A 3LWUA 2MO1A 2RKSA 2RQXA 2F0KA 5BR8L 4RFBA 1SN8A 5EPJA 5HURA 1YJNA 1HNZQ 2F1MA 1CHPD 3OMCA 1B44D 2R92G 2UXCQ 1AP0A 1KL9A 3G4SA 1YJ9A 3I4NH 1SRUA 1YVCA 2V4DA 3QOLA 1JR0D 2R7ZB 3KYHC 4BBRG 4GN4B 3PUVA 3VYRA 1G2SA 4X3TA 5C44B 1Q8KA 1PRTC 2V1CC 2XWJB 2RVLA 4ILWA 1F9SA 5BR8Q 2XIWA 3U9SA 2GVAA 5K36G 3I4OA 2CWPA 3H94A 4G7OC 2KCNA 3NHHA 5I9OA 4KI0A 1Q8IA 2Z0SA 3KUPA 1NUCA 3J7AV 4ZLTF 3EFXD 5I2XA 4GS3A 4ALPA 5M3FG 5C0XG 1Q81C 4BY7B 1X32A 2YTYA 1YZ6A 1QZGA 1C8CA 1I6VC 2RHSB 1LT4D 4QIWB 4IFDG 1K83H 2VQFL 1EQQA 2K7VA 4RGNA 4O0AA 4DR1L 2NTSA 1A62A 3PIPA 1HZCA 1QILA 4LF6L 4H13C 2RHQB 2CFMA 3QOJA 5IGGA 3S1NB 1PZID 3F2CA 2CH4A 2JP1A 4BA1I 1AZQA 1VQLA 2N55A 2EPBA 5E4XA 3NXWA 1UE7A 1G291 5D3IB 1STNA 5C44G 3DXJC 5CV7A 1CT1D 2NYZD 4NP5A 1A2TA 2AMCB 3A0JA 1HNWQ 5GAHC 4B9WA 3MZ5A 2BA1A 3NQIA 3ONAB 4R9WA 2IWHA 2F0IA 3NWTA 5M5WB 1CKNA 5J3BA 4LF8L 1SNOA 3K59A 3W3AA 3HOVH 1XTCD 2OT2A 2EE1A 3UI2A 3RZOH 4Q0FA 1IKMA 3K0YA 2DGYA 4KD4A 4NMZA 1Y1WG 4LF7Q 4BBSH 2WKCA 2JXMB 2KCCA 3RZDH 1YHQA 1PH7A 1QUQA 3MXUA 2Q2UA 1A8VA 2SEBD 1Q90A 2NTTA 3X3NA 1VQOA 3F1ZA 4IURA 5CYUA 2K32A 2DN8A 1HNXQ 5ELNA 3A8KE 4KLKA 4QIWE 3J81L 3T1YQ 1ZKOA 2K5NA 3CCSA 5HGQA 1KC8C 3S15H 3S17H 5D65A 1VMCA 2XSCA 2VY3A 2FFKB 3GTPB 1L1OA 4A3DB 2NZOA 5AJ3L 3GQBA 3M3YB 4LF7L 1JWSD 2JE6I 2RA4A 1B4OA 3D4DA 1JOKA 4JV5Q 3J7AF 3MXNB 1E22A 1XMQL 1P16A 1OXTA 1HNXL 1AN8A 3A74A 4K8IA 4JBWA 2M2LA 2E2IB 1VQ4A 4KHZA 4X65Q 4CKEA 1ET6A 4X6AH 1AZPA 1F9PA 1Q3LA 3SK6A 3QJYA 2R92B 3KFUA 4EQOA 1D5XC 1DZ1A 1Q7YC 1KRTA 1XMQQ 4AYBE 1PZKD 3CHBD 5C4JH 5EQ0A 1BCPB 4OONA 5CBAE 1DGSA 1TIID 5NUCA 4JI0L 2H4OA 1I4HA 1LLRD 3CCEA 3RLNA 3IRBA 1D5ZC 2E2HB 5LL6X 4DFAA 5JJLA 4S3SA 1B3QA 3S1RB 5FLXc 4JG2A 3M7GA 3HG9A 2CVRA 1I3QB 3BZCA 3CCMA 4RCOA 1TWGH 2LMCB 4RGOS 4DKAC 5JJZA 3Q23A 3RNUA 1X56A 4R4QA 5JEAH 3HKZE 2L55A 3NENA 5IGCA 1K3RA 3QIAA 4IPHA 1PDQA 2XN9C 1PRTB 2X69A 3VA5A 1B53A 2WAQB 1UUPA 2ZJQA 3HOZH 3GP7A 4DK0A 4UP9A 4P2CB 4A3JB 1I4RA 1ESFA 3AQQA 1K28A 1GKHA 2R6GA 5FKAC 3BJUA 2CW0D 3EQLC 1E1OA 3SVMA 4DV0L 4XT3B 1WTRA 2E2JH 4I65A 2LS01 3OOCA 5KNBA 4JI2L 4LMQD 4GNXA 2KECA 2SDFA 5TSSA 1R4QB 1BQQT 1LTGD 4X62L 3ERQA 1SYGA 3K7AH 2HCIA 5JPMC 2VQEL 1GUGA 5GADC 2EJGC 3OWEB 3UDIA 3HOUB 4ZKCB 4DXGA 2PCFB 1GOZA 3IL8A 2A6HD 5JAVA 3N6RA 4YHHL 1W6KA 5E1FA 1HR0L 4ID6A 1E1TA 3STBD 4G7HC 1TS3A 3HOWG 1N8RC 2Z1CA 4Y7NH 4JI1L 1J9OA 3I73A 5DNFA 1ILPA 4DV5Q 2NVTH 2KCMA 4A3CH 2HDMA 5C4XH 1K8MA 5CC4A 1S5BD 1VQHA 4NXMQ 4DPGA 2B63H 4X66L 3A55A 2N49A 1GHJA 1A6XA 4JI4L 1LT5D 3NE5B 1B70B 5IYDH 3M7NA 4DR6Q 2EYFA 3HOVB 4DNTB 1KHIA 3SEBA 3M4YA 4ZCKA 1VQIA 1BVSA 2HCCA 4A3GH 1SYBA 1V1PA 3I91A 1U4PA 2IJ0A 1CKOA 4DR3Q 3LGJA 2FMMA 2Z9HA 4IFDJ 3EN2A 3H0GB 2FINB 2JA6H 2Q2HA 4BS9A 1YIJA 4KKSA 1VQ7A 5ELDA 2SOBA 2L15A 4OEMB 2NVTB 5C0XH 3OMGA 3N52A 1PH1A 1U4MA 3H15A 4QL5A 3BU2A 4EX5A 4DAMA 1CFMA 1FVIA 1D6EC 3H91A 3FMCA 3R3OA 5IGFA 1D8LA 4JPBW 5GROA 4CHTB 4DR3L 4DR7Q 1QVGA 2MHVA 1TWAB 1TR5A 2WFWA 4IUTA 3I2ZA 3BZKA 1RKNA 2BCOA 2L0CA 2QA4A 1RODA 4JI7L 4A3CG 5LHY1 1A3TA 2D5DA 1G51A 2IX0A 1K9MC 4YY3L 1PXUA 2B3GA 3K8AA 4DR5L 3KBGA 4POGA 4CDDC 3VR6A 4XIGS 4A3IG 4A3LH 3ICEA 4F87A 5C4HA 4DA2A 4KKUA 1RTNA 2DNCA 4MNOA 3S16B 3BYYB 3EVQA 1U0LA 1F2ZA 1HTLD 4OX9Q 5EKLA 4TQUS 4MN3A 5EAYA 2BA0A 1PH2A 4FYDA 1EY5A 1I50B 3K7AB 1M8AA 5LMNL 4C3HH 1Q86C 2L1BA 3R93A 3MAQA 1KDBA 2F0FA 2F4VL 1YBYA 1PYWD 2B39A 3HOZG 4DNRB 2E8GA 3TS2A 1F2YA 5JEAJ 3S2DH 4QJFA 1BNZA 4V0BA 1SE8A 2F52A 4C56C 2ZTEA 5IT9c 4DV0Q 3S14H 4JYAQ 3SK4A 1FD7D 2EJMA 3PF4A 3LNNA 1QVCA 4HAEA 1LM0A 3HKSA 4MZ9A 5LMNQ 2YTXA 1HJPA 3FRPB 1OTCA 3NQTA 1YHAA 4FXKC 1EIYB 1O7YA 3TSSA 5IGBA 3HOYG 1MI2A 4ZRZA 3ER0A 3CPWA 1UNSA 1N34Q 4IUPA 2VZAA 3RR5A 2L5TA 2OXPA 1WCMH 1WCMG 3NTIA 3KLWA 4NPSA 5GAGC 4KKTA 1SEBD 2Q8TA 2YU9B 4ABNA 2FJ2A 3AFPA 4DAYB 4JVZA 2WB1E 4UP7A 1E7ZA 4DUYL 1EQVA 3V96A 3G6EA 2F4IA 1ASYA 1A15A 4LJZC 4EGVA 1Q82C 4GKKL 4IUVA 3AFQA 2EVBA 3CC4A 3DM3A 1CA5A 2KVMA 5H1SE 2VQEQ 4CGYB 3E9HA 2ZXRA 3FKIH 3K5OA 1NMGA 4K6LA 4DN4M 2R92H 3V05A 2R93B 4YHHQ 3PUZA 1SXTA 1SR3A 3DWAA 4L5RC 1IYUA 1HA5A 3KJPA 4Q5VA 4YCVA 1H9SB 1Y69U 3MWYW 1VMPA 3DHQA 1I5FA 2LSSA 2ZXOA 1ESRA 1TWGB 5IWAQ 1N32L 3D0FA 3GO5A 4DV5L 2CW0C 1KTKA 2A68D 4M8AA 2ZTDA 3SHLA 1DM0B 5JOBA 4CKBA 3MHBA 5E7NA 1QJOA 2O5IC 1PVOA 1M1KC 2AHOB 2QEXA 2QGQA 1RCVD 1JQYD 2Z6BA 1EFWA 3OIQA 5J22A 5A2QE 1CI3M 2G9HD 3L0OA 3GTMB 4CJ2C 2Q2TA 3U58A 2GVBA 3OIPA 1KLGD 1F9RA 5KIXA 1B7YB 4FDBA 2QDLA 5CV6A 5M3FH 3Q0AA 1WTXA 1UWVA 1VQAA 2PPBC 1S5FD 5I6YA 2VXWA 3JC66 4HCEA 3W2DA 3KF6A 3HOUH 4P73A 1E2ZA 4IFDH 2K6AA 1M4VA 4JCVE 1LO5D 3U4ZA 2IHEA 5IYBG 3T4AC 4B08A 2F3VA 4LUZA 2ZJRA 4K6DA 3TP6A 1Y8NB 3J7YW 3KF6B 2EY5A 1JB3A 4DK1A 4A3IB 4O42A 4R4TA 2OCEA 4AH6A 2MO0A 1KDAA 3TP8A 1XNRL 1GUSA 2F03A 2IHFA 5D14A 4BBRH 2UXDL 3VR4A 2O2LD 3FDTA 2ZM6L 3QB3A 1AE2A 2NBFA 2OWOA 3PUXA 2VUMH 3DUZA 2ZT9C 1U4RA 2HD3A 3HOXG 3GTQB 2F0VA 3S9WA 5C0XJ 4YY3Q 2F0HA 1I3QH 1RTOA 3RN5A 4GOPA 2XTIA 1A3VA 1WFQA 3VR2A 4U68A 5I9PA 1DXMA 1XNRQ 2H1EA 2ID0A 1VQ8A 1CTMA 1NCVA 4HJ7A 1X54A 4PZ8A 1RL2A 2BDNA 2HDLA 2IX3A 1PA6A 3MXNA 4K5WA 4QF4A 2E75C 4DV3L 2K14A 2C35B 2N3SA 4A3EB 2F4VQ 1CHQD 4DAVA 4HEDA 4PZ6A 2B2YC 4OWWB 1WCMB 2E76C 1K8OA 2K5WA 2KHIA 3URYA 2A5HA 1LTTD 2MFIA 4U673 2JA8G 4JYAL 4M1UB 1S5CD 4A4IA 3BYTB 2N78A 5FOBB 3NBHA 4DV3Q 2KCTA 4R8NA 2MGSA 2NUCA 1GXDC 1OXSC 2HIVA 3S14B 5IODA 3HKZG 1D1IA 2FXQA 2PI2E 1JCKB 1LTLA 2X6LA 1I4XA 5LMUQ 5EPKA 4JV5L 4BY1B 3O13A 4AQYQ 1EY7A 4F88A 4C2MB 3IAYA 4C3HB 3KLRA 1K8AC 3VDYA 3FEWX 3EBEA 4DUYQ 2JEAI 3K7UC 2MP1A 4KY6A 4X65L 1A63A 1B1ZA 1FGUA 2P5ZX 1NR4A 2EYMA 4IN3A 1RJTA 4GKKQ 1B50A 3S1QH 3HS0C 2AWOA 1GUOA 4DV7L 1AFPA 1EL0A 4HN7A 2ZJPA 5FLMH 1J6QA 4AQYL 4IFDI 4AYBB 4L5SA 2A19A 3HP3A 2RF4A 3CCLA 4A3GB 2LKVA 2F0QA 5M3MG 4XQJA 4B3RL 2NN6H 1IBLL 1R9TB 1H9RA 3DWPA 1LTID 5EKIA 1P8LA 1H95A 2EY6A 1Y1VG 1L0YB 1QB5D 3T53B 1TQOA 2R7ZG 4KJNA 2A69C 4JW0A 3RN2A 4LUOA 2QF7A 3K6OA 1PFMA 5IGEA 5K5PA 3S2DB 4DU9A 4UP8A 2E5LL 4IO9A 3RLFA 4XQQA 2D62A 1SNQA 4HMJA 3PUYA 4CBVA 1WVLA 1EFID 3OSOA 2EQSA 2EYHA 1CKMA 1VQEA 1RIPA 1QZHA 4G4KA 1IBLQ 2PW5A 4RKLA 3I8ZA 4KN7C 1SYCA 2F0JA 2B8FA 5C0XI 5C3EH 2RCNA 4LF4Q 1SE4A 1WD1A 4L5QA 1X3FA 2BH8A 2KHSA 2VQFQ 1Y8PB 2EYOA 2ICIA 3TS0A 4A75A 3C3LA 1JJCB 4V190 2JA6B 3C2PA 4UDUC 3E9IA 3BDOA 3BDCA 4A3BG 5I6WA 1Z9FA 3K5NA 3HOWH 4A93H 4RGTA 1LUZA 4MTNA
chains in the Genus database with same CATH topology
4ZQ3A 3HKZB 4KN4C 3BVMA 1PTOH 1EZ8A 3CRLC 3KLSA 4H7BA 5IOCA 1LABA 1ICWA 3DWQA 5CBEE 2K04A 2L9HA 3DEOA 1SNCA 4WRDA 4XT1B 4K5XA 2OF1A 4A3KB 3NK9A 2RSOA 4IZ8A 1ILQA 2YYZA 1U4LA 3IFTA 5IT9L 1SYDA 1SYFA 1PFBA 2RBMA 4HCSA 1EOTA 3MFYA 3X3MA 4ZUJA 1PMRA 3QWNA 3NP8A 5M3MB 4E6IA 1CK1A 1JC7A 5BN5A 4WFN3 3V2TA 1V1PB 1LT6D 4OL7A 1QNUA 3BG3A 2HQEA 5C5LA 5C5MA 1LTRD 5CMDA 1EY4A 4QUCA 3PV0A 1MSGA 1QCBD 1SMYD 2JA7B 2B8GA 4HSVA 1TKWB 2RSNA 3ZYYX 2EYJA 4IALA 5IGDA 1BO0A 2EY1A 1YNJC 4ZYSA 1MBYA 1CZWA 1TWFB 2IPKD 5CORA 1H9KA 3RMHA 1BCPF 3J80E 2A68C 1VDZA 4PMCA 2A69D 4ZKBB 3P7JA 1FYCA 5FLXL 5CV4A 1F2MA 4K2LA 3S2HB 3C1EA 2B2TA 2B2UC 5G3LD 3VR5A 1ONLA 3MA2B 1DOMA 1EYAA 5CV8A 1IL8A 5ELBA 5FK9C 1HA6A 1STAA 4KY7A 2PZUA 1DYQA 3OPOA 3TN2A 4KK7A 4IUUA 2A6EC 1ZEQX 1ENAA 4R8IA 2D2CC 4RKBA 3U9OA 2QEJC 2QILA 3L9AX 2WINB 4BBRB 3A8IE 4H0LC 2J7ZA 1L0XB 1FGBD 1XWEA 1FNUA 1X3PA 4A93B 2EZVA 2KOLA 4ULLA 4L6TB 2G9DA 1B9MA 2C9OA 1Y1WB 2QDBA 1SDFA 4KJOA 4XYOA 3A7AB 4BA2I 5FO9B 5CR3A 3A56A 2DY8A 4XTCS 4G7ZC 2F0OA 1KABA 2A6ED 1STYA 3BZDB 1SAPA 2DNEA 3K5MA 5CV9A 4QB4A 5DAUA 1PTOD 2F0DA 4RHSA 2VNUD 4DAYA 2BOSA 1HCZA 5DEHA 3WOEA 3M4OB 3WDNA 3G6JB 1I4PA 2F0UA 1D5MC 3M85A 4KHVA 3BVZA 1V43A 3I70A 2VB3X 2EYLA 1G6ZA 1PRTD 4DAPA 1LT3D 4X3KA 1BXTA 3BS1A 1SSOA 1ENFA 1ZYRD 4PNYA 3IKJA 1EU4A 5C3XA 3SE0A 2I07B 3GV6A 3I4NB 1RDPD 2OEOA 1EEID 1HUNA 3FPPA 3FVQA 2LFNA 2NVYB 5K36H 1K83B 1UAPA 1GUWA 3AB9A 1E0BA 1PLFA 4FXGC 1FNVA 5JPNC 5EBDA 2WV6D 1NR2A 1DD2A 3K5LA 2KQ3A 2RDHA 2WIIB 5EPLA 5ELCA 3HOYB 2X6GA 3OWFA 4OIJA 4EQNA 1D2BA 4J6HA 2B63B 3BVGA 2Z4HA 1OXUA 2F0WA 5M9OA 3DM1A 4KMUC 3GTKB 3Q24A 5KEEA 2KEEA 2KEDA 1CZGA 2K05A 3D6CA 4JK1C 5FO8B 5FO7B 1HUMA 2EXZA 4UAIA 3DEPA 3TZDA 2Y0SB 5EJWA 1E2WA 1SNPA 1PTOC 3E6ZX 2KA7A 4DGZA 3L7ZC 1F9QA 5IT9E 4L63B 1PTOF 1EY9A 2K1BA 2C5CA 1SMYC 2D9UA 3KLSX 2I46A 1IKLA 2F0SA 2FHTA 1V8QA 1A3UA 2PW7A 5EKKA 4XQNA 3TZUA 3HOWB 5M3FB 1O7LA 5T1GA 1KAAA 3H09A 5JVH3 1TY2A 3IFDA 4FF2A 1WD0A 5BN3A 3S1QB 4F8MA 2JSOA 5ISRA 4LAAA 3JAML 4H44C 2IT1A 2VB2X 4RH6A 5M5XB 2VUMB 1XX8A 3TDQA 2AQ3B 1BCPC 2EDGA 3DMUA 3C46A 3NTHA 1EY8A 2L4NA 4FVMA 1BOSA 1Z7TA 3VR3A 3P1HA 3RZDB 1STGA 1XXGA 3QO2A 1YNNC 4WJWA 1O78A 1BBXC 3R8BA 4OIKA 4NDXA 4ZAIA 3Q6SA 2AUKA 1H9MA 4ZUIA 2QCPX 1QG7A 3PUWA 5T1IA 5DM73 2SNSA 2O5JC 2NWGA 1VF7A 5LL6S 1TT2A 3R2IA 5G3LF 2K03A 3PMFA 4HMIA 4BWGB 3S1MB 1CQVA 4Z9CB 4RGMA 1PRTF 2BDOA 2PMZB 4CJ0B 1H9SA 1SNDA 3MXPA 1QNKA 2NVQB 4ODGA 4MIUA 2ZXPA 1Q1EA 2JA8B 1JWUD 4N9PA 3VYUA 3HOXB 5CV5A 1IW7C 5CGKA 1GHKA 1CM9A 1ML0D 3H3VC 2MPMA 3J81E 3E5SA 3FPUB 5DM63 4G57A 3AU7A 4J8QA 1I6HB 4FF1A 1A2UA 4XXEA 4CKCA 3H6MA 5C4JB 2XRQD 3KBXA 1YNJD 1NSNS 1W6JA 4C3HG 4KTAA 4ZK9B 5F2DA 2PO4A 2R3ZA 1HTPA 1PZJD 1SNMA 2F0NA 1X3QA 3PO2B 2J0TD 2F0PA 2PZTA 2XVSA 1Q12A 1O80A 2EYPA 4OO1H 1WTVA 1ET9A 1EZ6A 2K28A 3NPPA 3HRZC 5JVG3 5EBCA 1STHA 3MEHA 1CQFA 1KNAA 3P75A 1IW7D 2IW3A 3RD4A 1DCZA 1MSHA 3TP5A 3I3CA 3Q22A 1DOKA 1JOOA 4BBSB 3LX0A 4FXDA 2DY7A 1HFGA 5BN4A 2K5DA 3G7LA 3L3OC 1S5ED 1HQRD 4TKOB 4RCNA 3MVVA 5ELEA 1R4PB 5ELFA 4XDXA 3LWEA 1GUNA 2XNAC 1RD9D 4K14A 3T56B 1JICA 2L12A 3NWSA 5E4WC 1KLUD 2AQ2B 3ND8A 3D4RA 5J1ZA 2LY7A 4HTHA 2F0TA 1HHVA 1TS5A 4RHRA 3BDLA 1EIHA 2CHBD 3D8GA 1EEFD 4DXFA 3K58A 2B2VC 2XRSD 2IL8A 1BCPD 2F0GA 3KF8A 3MC0B 1H9JA 1RHPA 1STEA 1B3AA 1EU3A 3I4LA 2PNRC 1TVXA 2WP8J 1GJXA 3VA7A 1G8ZD 4YIJA 2PQEA 5C3EB 2B2YA 2M9VA 3MTSA 3MXGA 3GTJB 5C4ZA 2RDFA 3SK5A 3D3RA 1B9NA 4ME5A 1NAPA 4KY5A 5KYIA 1TWHB 3VYTA 1WTPA 4C3JG 3NSWA 3KK7A 4FF3A 3WOFA 2R61A 2XWBB 2BE5D 2WACA 5M5YB 1TS2A 1E2VA 5KYLA 1VCIA 1TWCB 3SR1A 3ND9A 1EY6A 1STBA 4PMBA 2F0LA 2NZ1D 5KNDA 2ICEC 2E2JB 4PV1C 4KV6A 1ZYRC 1F2LA 2Z8LA 1S4ZA 1VF5C 1HPCA 1DOLA 2HUGA 3T13A 2F0MA 4CJ1B 1QE6A 2A6HC 2Q8IB 2Q8RE 5JEAG 3HOZB 1V1OA 2FMCA 1IYVA 2NB0A 1Z47A 3OW7A 1U9RA 1YNND 1JE4A 3EJIA 3I4MB 4B9XA 2TSSA 3NTKA 1O7ZA 3CU7A 1HQMC 1BUVT 4MHEA 3MFGA 1SJHD 1MGSA 1G2TA 4C1NI 2E74C 3CKIB 3EA6A 4QMGA 5A35A 4IQZA 4PMWA 1Q1BA 2JEBI 1TS4A 1EWHA 3VYSA 1OO9B 4C1NK 3CRKC 4XYQA 3PO3B 2QKIC 5AFWA 3HEJA 4LK1C 2SNMA 5IIFA 4A3MB 3R2TA 1EIGA 3I90A 3ITPA 2EJFC 4C3JB 3GD7A 3HGBA 4X3SA 4J1MA 1EYDA 1EWCA 1MD2D 5KRUA 5EGTA 2IX1A 1B2TA 2EOTA 1KNEA 5E3FA 2NVXB 1HRJA 3A8JE 4FF4A 2JYOA 3D31A 3TMEA 1JOQA 1TY0A 2B2WC 4Y7NB 4OHJA 4TSSA 1EQTA 1UEAB 1F77A 4IUQA 4HSPA 1JWMD 2BE5C 3GTOB 2J4XA 4C3IG 1DJRD 4A3FB 2F0EA 3E0JA 1FNWA 2EY2A 5C6AA 1LV9A 5D3DA 4K2KA 3SK8A 2NN6G 3SDZA 1Y8OB 1Z6HA 1QOHA 1SE3A 5I4DA 1C4QA 4NW2A 2M00A 4N9TA 3GTLB 1T5XD 3PIP3 1AW7A 2RDGA 3NBIA 4HR7B 1IHZA 1LTSD 1Y1VB 2PZWA 2MUYA 2A73B 2N88A 1WTQA 3T16A 1QWYA 4OO1I 4FNFA 1SFOB 5J39A 3TBIB 4PQXA 1BF4A 3GTGB 4EVOA 4RWSC 1OXVA 2AQ1B 3T51B 1ENCA 3F2UA 1KDCA 2K33A 1LTBD 1RF2D 1T5EA 1D1KA 3FKIB 1JORA 3RZOB 2B2WA 4K5VA 3RUZA 4QCLA 3J80L 2AUJD 4F7XA 2MJ8A 1GUTA 1SBBB 2Z4IA 4KD3A 3HZXA 4DF7A 5KNCA 4QUFA 4A3BB 5HGTA 5C3WA 3GV3A 1XYIA 1C48A 1CA6A 1WTOA 5FLXE 2E2DC 2ENBA 4TRDA 3C1FA 3EROA 2KJXA 1WTWA 1ZXTA 5KGUA 5COYA 4NKLA 2B2VA 3CQZB 1G91A 4IUNA 1TU2B 3D4WA 4X3UA 3I72A 1I4QA 1HFNA 1S5DD 2NN6I 1HXYD 1J8IA 4EQPA 5I2YA 3PIO3 3S15B 3S17B 3NUCA 3QG1A 1SJED 2PYKA 2O4XA 1PTOB 2WKDA 1BDOA 1LACA 2K5QA 1OXXK 3JAME 2GA4B 1II3A 3D6WA 1PFNA 1AEXA 1DONA 4L8JA 3SXHA 1I4GA 4RAUC 4O1NA 4OO1G 2B2UA 3AMUA 2B2TC 2JA5B 3K57A 3A54A 4WORA 5C4XB 2CQAA 5A2QL 2F3WA 4FO2A 4K8JA 1FR3A 4OGQC 1EYCA 1BR9A 4GZYC 1SYEA 4I7ZC 2K01A 4FP5D 2A74C 4C3IB 2TMPA 2AWNA 1LTAD 4RA8A 3A7LA 3OHXC 2WB1B 1EY0A 2L11A 3P20A 2KUMA 1SE2A 3TP7A 3LWUA 2RKSA 2RQXA 2F0KA 4RFBA 5EPJA 5HURA 2F1MA 1CHPD 3OMCA 1B44D 1AP0A 2V4DA 3QOLA 1JR0D 2R7ZB 3PUVA 3VYRA 1G2SA 4X3TA 5C44B 1PRTC 2XWJB 2RVLA 4ILWA 1F9SA 2XIWA 3U9SA 5K36G 3H94A 4G7OC 2KCNA 3NHHA 5I9OA 4KI0A 1Q8IA 3KUPA 1NUCA 3J7AV 4ZLTF 3EFXD 5I2XA 5C0XG 4BY7B 1X32A 1C8CA 1I6VC 1LT4D 4QIWB 4IFDG 2K7VA 4RGNA 2NTSA 1QILA 4H13C 3QOJA 5IGGA 3S1NB 1PZID 2JP1A 4BA1I 1AZQA 2N55A 2EPBA 5E4XA 3NXWA 1G291 5D3IB 1STNA 3DXJC 5CV7A 1CT1D 2NYZD 4NP5A 1A2TA 4B9WA 3MZ5A 2BA1A 3NQIA 3ONAB 4R9WA 2IWHA 2F0IA 3NWTA 5M5WB 1SNOA 3K59A 3W3AA 1XTCD 2OT2A 2EE1A 3UI2A 4Q0FA 1IKMA 3K0YA 4KD4A 4NMZA 2WKCA 2JXMB 2KCCA 3MXUA 2SEBD 1Q90A 2NTTA 3X3NA 4IURA 5CYUA 2K32A 2DN8A 3A8KE 3J81L 1ZKOA 5D65A 1VMCA 2XSCA 2FFKB 3GTPB 4A3DB 3GQBA 3M3YB 1JWSD 2JE6I 2RA4A 1B4OA 3D4DA 1JOKA 3J7AF 1OXTA 1AN8A 4K8IA 4JBWA 2M2LA 2E2IB 4KHZA 4CKEA 1ET6A 1AZPA 1F9PA 1Q3LA 3SK6A 3QJYA 2R92B 4EQOA 1D5XC 1DZ1A 1PZKD 3CHBD 5EQ0A 1BCPB 5CBAE 1TIID 5NUCA 2H4OA 1I4HA 1LLRD 1D5ZC 2E2HB 5LL6X 4DFAA 4S3SA 3S1RB 3M7GA 3HG9A 2CVRA 1I3QB 4RCOA 4RGOS 2LMCB 3Q23A 5JJZA 5JEAH 2L55A 5IGCA 3QIAA 1PDQA 2XN9C 1PRTB 2X69A 3VA5A 1B53A 2WAQB 1UUPA 3GP7A 4DK0A 4P2CB 4A3JB 1I4RA 1ESFA 2R6GA 5FKAC 2CW0D 3EQLC 3SVMA 1WTRA 4XT3B 4I65A 2LS01 3OOCA 5KNBA 4LMQD 2KECA 2SDFA 5TSSA 1R4QB 1BQQT 1LTGD 3ERQA 1SYGA 2HCIA 5JPMC 1GUGA 2EJGC 3OWEB 3HOUB 4ZKCB 4DXGA 2PCFB 1GOZA 3IL8A 2A6HD 5JAVA 3N6RA 1W6KA 5E1FA 4ID6A 4G7HC 1TS3A 2Z1CA 1J9OA 3I73A 5DNFA 1ILPA 2HDMA 1K8MA 5CC4A 1S5BD 3A55A 1GHJA 1A6XA 1LT5D 3NE5B 3M7NA 2EYFA 3HOVB 4DNTB 3SEBA 3M4YA 2HCCA 1SYBA 1V1PA 3I91A 1U4PA 2IJ0A 2FMMA 4IFDJ 3H0GB 2FINB 4BS9A 4KKSA 5ELDA 2SOBA 2NVTB 5C0XH 3OMGA 3N52A 1U4MA 1CFMA 1D6EC 3H91A 3FMCA 3R3OA 5IGFA 4CHTB 2MHVA 1TWAB 1TR5A 4IUTA 1RKNA 2BCOA 2L0CA 1RODA 5LHY1 1A3TA 2D5DA 2IX0A 1PXUA 3KBGA 3VR6A 4XIGS 4F87A 5C4HA 4DA2A 4KKUA 1RTNA 2DNCA 3S16B 3BYYB 3EVQA 1F2ZA 1HTLD 5EKLA 4TQUS 4MN3A 4FYDA 2BA0A 1EY5A 1I50B 3K7AB 1M8AA 2L1BA 3R93A 3MAQA 1KDBA 2F0FA 1PYWD 2B39A 4DNRB 1F2YA 5JEAJ 1BNZA 4V0BA 4C56C 3SK4A 1FD7D 2EJMA 3LNNA 4HAEA 3FRPB 3NQTA 4FXKC 1O7YA 3TSSA 5IGBA 1MI2A 4ZRZA 1UNSA 4IUPA 2L5TA 2OXPA 3NTIA 4KKTA 1SEBD 2Q8TA 2YU9B 4ABNA 2FJ2A 1EQVA 3V96A 2F4IA 1A15A 4LJZC 4EGVA 4IUVA 2EVBA 1CA5A 2KVMA 4CGYB 2ZXRA 3K5OA 4K6LA 4DN4M 3V05A 2R93B 3PUZA 1SXTA 3DWAA 1IYUA 1HA5A 4Q5VA 1H9SB 1Y69U 3MWYW 1VMPA 3DHQA 2ZXOA 1ESRA 1TWGB 3GO5A 2CW0C 1KTKA 2A68D 4M8AA 3SHLA 1DM0B 5JOBA 4CKBA 3MHBA 1QJOA 2O5IC 1RCVD 1JQYD 3OIQA 5J22A 5A2QE 1CI3M 2G9HD 3GTMB 4CJ2C 3OIPA 1KLGD 1F9RA 5KIXA 5CV6A 3Q0AA 1WTXA 2PPBC 1S5FD 5I6YA 2VXWA 4HCEA 3W2DA 1E2ZA 4IFDH 2K6AA 1M4VA 1LO5D 3T4AC 4B08A 2F3VA 4K6DA 3TP6A 1Y8NB 3J7YW 2EY5A 1JB3A 4DK1A 4A3IB 4O42A 1KDAA 3TP8A 1GUSA 2F03A 5D14A 3VR4A 2O2LD 3FDTA 3QB3A 2NBFA 3PUXA 3DUZA 2ZT9C 1U4RA 3GTQB 2F0VA 3S9WA 5C0XJ 2F0HA 1RTOA 1A3VA 3VR2A 4U68A 5I9PA 1DXMA 2H1EA 2ID0A 1CTMA 1NCVA 2BDNA 2HDLA 2IX3A 3MXNA 4K5WA 4QF4A 2E75C 4A3EB 1CHQD 4DAVA 4HEDA 2B2YC 1WCMB 2E76C 1K8OA 2K5WA 3URYA 2A5HA 1LTTD 4U673 4M1UB 1S5CD 3BYTB 5FOBB 3NBHA 4R8NA 2MGSA 2NUCA 1GXDC 1OXSC 3S14B 5IODA 1D1IA 1JCKB 2X6LA 1I4XA 5EPKA 4BY1B 3O13A 1EY7A 4F88A 4C2MB 3IAYA 4C3HB 3KLRA 3FEWX 2JEAI 2MP1A 4KY6A 1B1ZA 1NR4A 2EYMA 4IN3A 1RJTA 1B50A 3HS0C 2AWOA 1GUOA 1AFPA 1EL0A 4HN7A 4IFDI 4AYBB 3HP3A 4A3GB 2LKVA 2F0QA 4XQJA 2NN6H 1R9TB 1H9RA 1LTID 3DWPA 5EKIA 2EY6A 1L0YB 1QB5D 3T53B 1TQOA 4KJNA 2A69C 2QF7A 3K6OA 1PFMA 5IGEA 5K5PA 3S2DB 4DU9A 3RLFA 4XQQA 2D62A 1SNQA 4HMJA 3PUYA 4CBVA 1WVLA 1EFID 3OSOA 2EYHA 4G4KA 2PW5A 4RKLA 3I8ZA 4KN7C 1SYCA 2F0JA 2B8FA 5C0XI 1SE4A 1WD1A 2KHSA 1Y8PB 2EYOA 2ICIA 2JA6B 3C3LA 4V190 3C2PA 4UDUC 3BDOA 3BDCA 5I6WA 3K5NA 4RGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXS C;  4KN4 C;  3CRL C;  1BDO A;  1I6V C;  1LAC A;  1OXX K;  1HTP A;  1LAB A;  4DNR B;  4IFD G;  1E2Z A;  2NN6 G;  4IFD H;  3QJY A;  1K8M A;  2K7V A;  3SDZ A;  1Y8O B;  1Z6H A;  4L8J A;  1Z7T A;  2E74 C;  3VR3 A;  1Q12 A;  3VR5 A;  2EJM A;  4H13 C;  3LNN A;  1ONL A;  1GHJ A;  1A6X A;  4OO1 G;  2YYZ A;  3NE5 B;  4OO1 H;  1HCZ A;  3KLR A;  4HR7 B;  3M7N A;  3IFT A;  1Y8N B;  4BA1 I;  5A35 A;  2JEA I;  1H9J A;  3WDN A;  1OXU A;  4IQZ A;  1YNN C;  1Q1B A;  3I4L A;  4DNT B;  2JEB I;  2PNR C;  1EWH A;  3M4Y A;  4KMU C;  4DK1 A;  1GJX A;  1O78 A;  3VA7 A;  1G29 1;  1FR3 A;  3CRK C;  2AWO A;  1GUO A;  3DXJ C;  3OPO A;  4OGQ C;  4GZY C;  4I7Z C;  3MFY A;  2L5T A;  3M85 A;  4LK1 C;  2A6E C;  1GUS A;  1B9N A;  1V43 A;  1PMR A;  2AUK A;  2EJF C;  1H9M A;  4KKT A;  4JK1 C;  3VR4 A;  2BA1 A;  2LMC B;  3PUW A;  1IW7 D;  2D2C C;  3GD7 A;  1OXV A;  4KKS A;  3HGB A;  3A7L A;  1E2W A;  3PUX A;  3T51 B;  5JEA H;  2O5J C;  3W3A A;  2ZT9 C;  2BE5 D;  2NN6 H;  3QIA A;  1VF7 A;  1DCZ A;  5C0X H;  5BN5 A;  1E2V A;  3P20 A;  1H9R A;  4LJZ C;  2KA7 A;  2K33 A;  3BG3 A;  3L7Z C;  3T53 B;  1VCI A;  1CFM A;  2EVB A;  3A8I E;  2JXM B;  2A69 C;  1T5E A;  2KCC A;  3FMC A;  3LWU A;  4H0L C;  3MXU A;  4DK0 A;  3VR2 A;  3IKJ A;  3ND9 A;  1SMY C;  2QF7 A;  3A8J E;  1Q90 A;  2BDO A;  1DXM A;  1CTM A;  2AUJ D;  3D31 A;  3SE0 A;  1H9S A;  5KND A;  2F1M A;  2R6G A;  3PV0 A;  3RLF A;  1GUT A;  2K32 A;  2DN8 A;  2D62 A;  5BN4 A;  1Q1E A;  3A8K E;  3EQL C;  3PUY A;  3PUZ A;  1V8Q A;  5KNC A;  4PV1 C;  3OOC A;  1ZKO A;  1IYU A;  2V4D A;  1ZYR C;  5KNB A;  2B8G A;  4TKO B;  1TKW B;  3TZU A;  2E75 C;  1H9S B;  4KN7 C;  1VF5 C;  2D5D A;  1HPC A;  1O7L A;  4RCN A;  1Y69 U;  1IW7 C;  3FPP A;  3PUV A;  1GHK A;  2B8F A;  3GQB A;  5BN3 A;  3VR6 A;  4XIG S;  2A6H C;  5K36 H;  2JE6 I;  1GUG A;  2Q8I B;  5JEA G;  2CW0 C;  1YNJ C;  1B9M A;  2A68 D;  2E76 C;  2EJG C;  4H44 C;  1K8O A;  4KKU A;  1IYV A;  1GUN A;  1Y8P B;  2BE5 C;  2DNC A;  2IT1 A;  3U9S A;  3AB9 A;  2PCF B;  3OW7 A;  1QJO A;  3A7A B;  3T56 B;  2O5I C;  5K36 G;  1H9K A;  3H94 A;  4BA2 I;  4G7O C;  1OXT A;  1TU2 B;  2A6H D;  3N6R A;  3I72 A;  4TQU S;  2A68 C;  2BA0 A;  1CI3 M;  3ND8 A;  4KI0 A;  4JBW A;  3D4R A;  1VDZ A;  2A69 D;  2NN6 I;  3BDO A;  4G7H C;  1DD2 A;  4KHZ A;  3QG1 A;  3I73 A;  1HQM C;  4XTC S;  2EDG A;  4G7Z C;  1FYC A;  2A6E D;  2PPB C;  5C0X G;  2DNE A; 
#chains in the Genus database with same CATH topology
 4ZQ3 A;  3HKZ B;  4KN4 C;  3BVM A;  1PTO H;  1EZ8 A;  4LF4 L;  3CRL C;  3KLS A;  4H7B A;  4IPG A;  5IOC A;  1LAB A;  2HHH Q;  1PYB A;  1ICW A;  3DWQ A;  5CBE E;  2K04 A;  2L9H A;  4MTK A;  1NBW A;  3DEO A;  1SNC A;  4WRD A;  4XT1 B;  4K5X A;  2PMZ E;  2OF1 A;  4A3K B;  2HQL A;  3NK9 A;  3J81 c;  4A3F G;  2RSO A;  4IZ8 A;  1ILQ A;  2YYZ A;  5IYC H;  4LF8 Q;  5IYD G;  1BBW A;  4PG3 A;  1U4L A;  4GLX A;  3IFT A;  5IT9 L;  2UUB Q;  1SYD A;  5M5Y H;  1SYF A;  1PFB A;  2RBM A;  3OYY A;  4HCS A;  1EOT A;  4GN3 B;  3MFY A;  3X3M A;  4ZUJ A;  4UY8 C;  3PQI A;  1L1O C;  1PMR A;  2CH4 W;  1NY4 A;  3QWN A;  4X66 Q;  3FP9 A;  3NP8 A;  3T1Y L;  5M3M B;  4J15 A;  4E6I A;  2HT1 A;  1CK1 A;  4DR6 L;  5JJI A;  1JC7 A;  1I6H H;  2PQA A;  5BN5 A;  1K3B C;  4WFN 3;  2JA5 G;  3V2T A;  1V1P B;  4HID A;  1LT6 D;  4OL7 A;  5AJ3 Q;  1QNU A;  3BG3 A;  4A3E H;  2HQE A;  5C5L A;  5C5M A;  1LTR D;  5CMD A;  1MHW C;  1SRO A;  1EY4 A;  4QUC A;  3PV0 A;  4DR4 Q;  4QY7 A;  1KAW A;  1MSG A;  4CDE C;  1QCB D;  1SMY D;  2JA7 B;  2DJF C;  2B8G A;  4HSV A;  1TKW B;  2RSN A;  3ZYY X;  1FL0 A;  2EYJ A;  4OWT B;  4A3J H;  4IAL A;  5IGD A;  1NE3 A;  4LFB L;  1BO0 A;  2EY1 A;  1YNJ C;  4ZYS A;  1MBY A;  1CZW A;  1TWF B;  1V9P A;  1L0W A;  2IPK D;  3M9B A;  5IE8 A;  3GTO H;  5COR A;  1V1Q A;  1H9K A;  3ULL A;  3RMH A;  1BCP F;  3J80 E;  2E2H H;  1K0S A;  4C2M H;  2A68 C;  1VDZ A;  4PMC A;  2A69 D;  4IJH A;  4P72 A;  4ZKB B;  3GTP H;  1EIF A;  1X55 A;  3P7J A;  4HJA A;  1FYC A;  5FLX L;  3L2P A;  5CV4 A;  3CC7 A;  5C4X G;  1F2M A;  3TQY A;  4DR5 Q;  4K2L A;  4DV7 Q;  3S2H B;  2VS1 A;  3C1E A;  4DV4 L;  1WOC A;  2B2T A;  1W3S A;  2B2U C;  5G3L D;  3I4M G;  3VR5 A;  4OX9 L;  2EIF A;  1ONL A;  3CCU A;  3MA2 B;  1DOM A;  1BKB A;  1EYA A;  4B3R Q;  5CV8 A;  1IL8 A;  5ELB A;  5FK9 C;  1HA6 A;  1A0I A;  1STA A;  4KY7 A;  1UE1 A;  2PZU A;  1DYQ A;  3OPO A;  3TN2 A;  2Y0S E;  3J80 c;  4KK7 A;  4IUU A;  2A6E C;  1VQG A;  1ZEQ X;  3FHW A;  1ENA A;  2E5L Q;  4A3J G;  4R8I A;  4A3D H;  2D2C C;  4RKB A;  3U9O A;  2QEJ C;  3GTM H;  3GTQ H;  2QIL A;  3ULP A;  3H3V H;  4JI2 Q;  4DUZ Q;  3KDF B;  3L9A X;  2WIN B;  4BBR B;  1PHJ A;  3GTG H;  4BXX H;  3A8I E;  3S1M H;  1VQB A;  4QQB X;  2Q2I A;  4H0L C;  2J7Z A;  1L0X B;  4YCW A;  2DJG C;  3CCJ A;  1FGB D;  2N8N A;  1YJW A;  1HR0 Q;  1XWE A;  3I4N G;  2EXD A;  1N9W A;  1FNU A;  1X3P A;  4A93 B;  2EZV A;  2KOL A;  2VW9 A;  4ULL A;  4C3J H;  1D7Q A;  4L6T B;  1I50 H;  4YWK A;  3STB C;  1C0A A;  2G9D A;  1B9M A;  2C9O A;  1Y1W B;  2QDB A;  1VQD A;  1SDF A;  4KJO A;  4XYO A;  3A7A B;  4NXM L;  1CSQ A;  5FO9 B;  4BA2 I;  4K0K Q;  1QVF A;  3W1G A;  5M3M H;  5CR3 A;  3A56 A;  2DY8 A;  4GKJ L;  4R4I A;  4XTC S;  4G7Z C;  2F0O A;  1KAB A;  2A6E D;  1STY A;  3BZD B;  1SAP A;  2DNE A;  3K5M A;  1KRS A;  4A3D G;  5CV9 A;  4QB4 A;  5DAU A;  1PTO D;  2F0D A;  4RHS A;  4GOP B;  2VNU D;  1VQK A;  3UDG A;  4DAY A;  4B3M L;  1IXR A;  2BOS A;  1HCZ A;  2CWA A;  5DEH A;  4B3T Q;  3WOE A;  4LW1 A;  3WDN A;  3M4O B;  3G6J B;  4BY7 G;  5M5X H;  1I4P A;  2F0U A;  3J81 i;  1D5M C;  2R7D A;  3CAM A;  3GDE A;  5M5W H;  3M85 A;  2UUC Q;  5HY6 A;  1LYL A;  4KHV A;  1J5E L;  3BVZ A;  4DR7 L;  1V43 A;  3I70 A;  2JJQ A;  4AYB G;  4DR4 L;  3NEM A;  5DLQ E;  4A3K H;  5GQO A;  2VB3 X;  2EYL A;  1G6Z A;  2VUM G;  1PRT D;  4DAP A;  2PNH A;  1LT3 D;  4X3K A;  1BXT A;  2KBN A;  3BS1 A;  1SSO A;  3TRE A;  3A5U A;  1ENF A;  1ZYR D;  4PNY A;  3IKJ A;  3J81 j;  1JE5 A;  1EU4 A;  5C3X A;  1J5E Q;  1IBM L;  2R7Z H;  1S72 A;  1I94 Q;  3SE0 A;  2I07 B;  3GV6 A;  4UHV A;  2ZM6 Q;  3JAM i;  2K4K A;  3I4N B;  1RDP D;  2OEO A;  3S1N H;  1X9N A;  1EEI D;  3S24 A;  1W2B A;  1HUN A;  1CUK A;  3FPP A;  1PH6 A;  3FVQ A;  4LWC A;  3AYH B;  2LFN A;  2NVY B;  4DR2 Q;  1IBK L;  5K36 H;  1N36 L;  1K83 B;  4APV A;  1UAP A;  4P71 A;  1GUW A;  2B29 A;  4HIK A;  2JA6 G;  4NXN Q;  3AB9 A;  1E0B A;  4BY7 H;  1PLF A;  4FXG C;  3CC2 A;  4GNX B;  2CQO A;  1FNV A;  3CCR A;  2K75 A;  5JPN C;  5EBD A;  3CXC A;  2WV6 D;  1T9H A;  2JA5 H;  1NR2 A;  1DD2 A;  4C3I H;  2H5X A;  4GN5 A;  3K5L A;  2KQ3 A;  2RDH A;  2WII B;  5EPL A;  4JC0 A;  4JI3 Q;  5ELC A;  1N33 L;  1X65 A;  3NEL A;  4A3B H;  1UEB A;  3HOY B;  3UE0 A;  2X6G A;  4YWM A;  2A8V A;  3OWF A;  4OIJ A;  2YTV A;  4EQN A;  1D2B A;  4J6H A;  2B63 B;  4HIM A;  3BVG A;  1GVP A;  1IL2 A;  4IOC A;  2WB1 G;  3ERS X;  5LMN W;  2Z4H A;  1OXU A;  2F0W A;  5M9O A;  2MNA A;  2UUA L;  3DM1 A;  4KMU C;  3GTK B;  3Q24 A;  1TWA H;  3MEF A;  5KEE A;  4X64 L;  2KEE A;  2KED A;  1VS0 A;  3CF5 A;  1CZG A;  2K05 A;  1VQ9 A;  3D6C A;  4JK1 C;  5FO8 B;  5FO7 B;  1HUM A;  2EXZ A;  1X3E A;  1B8A A;  2PI2 A;  4UAI A;  3DEP A;  4ME3 A;  2KHJ A;  3TZD A;  2Y0S B;  1XNQ L;  5EJW A;  1E2W A;  1SNP A;  1VQM A;  1PTO C;  3E6Z X;  3U4V A;  1Y1V H;  2KA7 A;  4DGZ A;  2ATW A;  3H0G H;  3L7Z C;  1N32 Q;  1F9Q A;  5IT9 E;  4RMF A;  2UU9 L;  4L63 B;  4X64 Q;  1PTO F;  1EY9 A;  2K1B A;  2C5C A;  1AE3 A;  1SMY C;  2D9U A;  3OW2 A;  4OWX B;  1R9T H;  2Z6K C;  1VQ5 A;  3KLS X;  2I46 A;  1IKL A;  2F0S A;  2FHT A;  4K0K L;  3K0X A;  2JA7 G;  1V8Q A;  1A3U A;  2PW7 A;  5EKK A;  4XQN A;  3TZU A;  3HOW B;  5M3F B;  1UE6 A;  1O7L A;  5T1G A;  1KAA A;  4CDC C;  3H09 A;  5JVH 3;  4LF5 L;  1TY2 A;  3IFD A;  4FF2 A;  1WD0 A;  5BN3 A;  3S1Q B;  4F8M A;  2JSO A;  5ISR A;  4LAA A;  3JAM L;  4H44 C;  1SFO H;  2IT1 A;  2VB2 X;  3M4O H;  4RH6 A;  3A5Z B;  3E0E A;  5M5X B;  4CDF C;  2VUM B;  2D0O A;  1XX8 A;  4LFC L;  2Y0S G;  3M3Y H;  3TDQ A;  2AQ3 B;  1PH8 A;  4IPD A;  2BH2 A;  1BCP C;  2EDG A;  1TXY A;  3DMU A;  1G6P A;  4LF5 Q;  3NTH A;  3C46 A;  3PO2 H;  1EY8 A;  2L4N A;  4FVM A;  1PH3 A;  1BOS A;  1Z7T A;  2B63 G;  2I5H A;  3F2D A;  2UXD Q;  3VR3 A;  2G5D A;  3P1H A;  3RZD B;  1STG A;  4LFC Q;  5IYC G;  3TRZ A;  4LUV A;  1JT8 A;  1XXG A;  4DNI A;  3QO2 A;  2WAQ G;  1YNN C;  3B6Y A;  4WJW A;  1KIX A;  1O78 A;  1BBX C;  5FLM G;  4RG1 A;  4JI8 L;  3R8B A;  4OIK A;  4NDX A;  4ZAI A;  3Q6S A;  4DR1 Q;  2AUK A;  1I94 L;  4A3M H;  1H9M A;  1S3O A;  4ZUI A;  4A3M G;  2QCP X;  1QG7 A;  4QGU A;  3PUW A;  5T1I A;  4LF6 Q;  2JA8 H;  5DM7 3;  2SNS A;  2O5J C;  1X3G A;  2NWG A;  4LF9 L;  1VF7 A;  5LL6 S;  2UUB L;  1E24 A;  4R4O A;  2NZH A;  1TT2 A;  2XGT A;  3R2I A;  5G3L F;  2K03 A;  2OQK A;  3PMF A;  4HMI A;  4BWG B;  3S1M B;  3CCQ A;  4DV6 L;  1WJJ A;  1CQV A;  4Z9C B;  1YEZ A;  3I55 A;  4RGM A;  1PRT F;  4GNX C;  2BDO A;  2JK8 A;  4NXN L;  2PMZ B;  2A1A A;  1HNW L;  4CJ0 B;  1H9S A;  1SND A;  3MXP A;  1QNK A;  2NVQ B;  4ODG A;  4MIU A;  2ZXP A;  1Q1E A;  2JA8 B;  1JWU D;  1YHB A;  4JBM A;  4N9P A;  4HJ8 A;  3VYU A;  3HOX B;  3WWV A;  2DUD A;  4DK6 C;  5CV5 A;  1GO3 E;  1IW7 C;  5CGK A;  1GHK A;  1VQF A;  4R1J A;  4JI3 L;  4A3F H;  3H3V I;  1CM9 A;  1ML0 D;  4DV6 Q;  3H3V C;  2MPM A;  3CMA A;  3J81 E;  5LMU L;  3E5S A;  3FPU B;  5DM6 3;  4G57 A;  3AU7 A;  4J8Q A;  1I6H B;  1ASZ A;  4FF1 A;  3CCV A;  1A2U A;  1EOV A;  4XXE A;  4CKC A;  3H6M A;  5C4J B;  1NJI C;  2XRQ D;  3KBX A;  4DK3 C;  1YNJ D;  1NSN S;  1W6J A;  2GN5 A;  4C3H G;  2UUA Q;  4KTA A;  4ZK9 B;  5F2D A;  2PO4 A;  2R3Z A;  4GOP C;  1HZ9 A;  3CME A;  1HTP A;  1PZJ D;  1SNM A;  2F0N A;  1X3Q A;  3PO2 B;  2J0T D;  3K81 C;  4EQ5 A;  2F0P A;  2PZT A;  2XVS A;  1Q12 A;  4N8F A;  1O80 A;  2EYP A;  1XNQ Q;  4OO1 H;  3TEH B;  2R7F A;  1WTV A;  4A3G G;  2WAQ E;  1K73 C;  1ET9 A;  1EZ6 A;  3E3X A;  2K28 A;  4LNQ A;  3NPP A;  3HRZ C;  5JVG 3;  1K0R A;  2HIX A;  5EBC A;  1STH A;  1JB7 A;  1EQR A;  5C44 H;  3MEH A;  4O2D A;  1CQF A;  1KNA A;  3PO3 H;  3P75 A;  1IW7 D;  2R93 G;  1Q46 A;  2IW3 A;  4A3L G;  3RD4 A;  4JI0 Q;  1DCZ A;  4JI6 L;  1MSH A;  4P74 A;  3I3C A;  3TP5 A;  3Q22 A;  1KQS A;  1UE5 A;  1DOK A;  1JOO A;  4PZ7 A;  3UE1 A;  4BBS B;  4BXX G;  2RCF A;  2OQ0 A;  4UPA A;  3PO2 G;  3FKI G;  3LX0 A;  1JMC A;  4FXD A;  3NBH B;  2DY7 A;  1XPR A;  1CSP A;  1HFG A;  5BN4 A;  2K5D A;  3G7L A;  3K80 C;  3L3O C;  3HFZ B;  1S5E D;  1EUJ A;  1NMF A;  1VQC A;  1HQR D;  3T1H L;  2JQO A;  4OXP A;  4TKO B;  4DUZ L;  4RCN A;  2NVY H;  3MVV A;  3EIV A;  5ELE A;  2MQH A;  1R4P B;  1XTD A;  4WJ3 M;  5ELF A;  4XDX A;  2HHH L;  1QUQ B;  3GTJ H;  3LWE A;  1GUN A;  2XNA C;  1RD9 D;  4K14 A;  3T56 B;  1XPO A;  3CPF A;  3CQZ H;  1JIC A;  3KOJ A;  1TWH H;  2L12 A;  3NWS A;  5E4W C;  1U5K A;  5L37 A;  1KLU D;  4L5T A;  2AQ2 B;  3ND8 A;  4Y52 H;  4LFA L;  1L2F A;  3D4R A;  4JI5 Q;  5FJ8 G;  1NTG A;  5J1Z A;  2LY7 A;  4HTH A;  2F0T A;  1HHV A;  4IOA A;  1AH9 A;  4JBK A;  1WTH A;  1TS5 A;  4X62 Q;  4RHR A;  4JI8 Q;  3BDL A;  3HOU G;  1EIH A;  2CHB D;  2YV5 A;  4B3S Q;  3D8G A;  1EEF D;  4DXF A;  3ZJY C;  2B2V C;  3K58 A;  2XRS D;  4GLV B;  2IL8 A;  2OTJ A;  1BCP D;  5IY0 A;  2F0G A;  2AKW B;  3KF8 A;  3Q8D A;  2UXB L;  4JI5 L;  3HOY H;  3MC0 B;  1H9J A;  1RHP A;  1STE A;  4JI1 Q;  5JJK A;  1B3A A;  1EU3 A;  3I4L A;  2PNR C;  1TVX A;  2WP8 J;  1GJX A;  1FJG L;  3VA7 A;  1G8Z D;  4YIJ A;  2PQE A;  1BBU A;  5C3E B;  2B2Y A;  2M9V A;  3AEV A;  3MTS A;  3MXG A;  3GTJ B;  3SGI A;  5C4Z A;  2RDF A;  3SK5 A;  3D3R A;  1B9N A;  4ME5 A;  1NAP A;  4KY5 A;  1TWH B;  5KYI A;  3VYT A;  1WTP A;  4C3J G;  2CCZ A;  4A3K G;  4BY1 H;  3NSW A;  4BY1 G;  4B3M Q;  3KK7 A;  4FF3 A;  2UXB Q;  3WOF A;  2R61 A;  2XWB B;  1K8G A;  2BE5 D;  3HOV G;  2WAC A;  5M5Y B;  1TS2 A;  1E2V A;  2VL6 A;  1SLJ A;  1NNX A;  5KYL A;  1FJG Q;  1VCI A;  4BBS G;  1TWC B;  3SR1 A;  4LFB Q;  1L1O B;  3ND9 A;  4NB3 A;  1VQ6 A;  1KXL A;  3H0G G;  1EY6 A;  1STB A;  1CKN B;  2F0L A;  2NZ1 D;  4PMB A;  5KND A;  2ICE C;  2E2J B;  1PV4 A;  4PV1 C;  4KV6 A;  1ZYR C;  4TVA B;  1F2L A;  2Z8L A;  1S4Z A;  3JAM c;  4HIO A;  1VF5 C;  1HPC A;  1DOL A;  2HUG A;  3T13 A;  2F0M A;  4CJ1 B;  5IYB H;  1QE6 A;  2A6H C;  2Q8I B;  2Q8R E;  5JEA G;  3HOZ B;  1V1O A;  2CKZ B;  2FMC A;  4DV4 Q;  1IYV A;  2NB0 A;  1Z47 A;  3OW7 A;  5FJ8 H;  1U9R A;  1YNN D;  1JE4 A;  3EJI A;  3I4M B;  3PGZ A;  4B9X A;  2TSS A;  3ULJ A;  3NTK A;  1O7Z A;  2I0Q A;  2F3I A;  3CU7 A;  3KF8 B;  1HQM C;  4A3E G;  3W5O A;  1BUV T;  4MHE A;  3MFG A;  1X6O A;  4DV1 Q;  2IY5 B;  1SJH D;  1MGS A;  4AIM A;  1N36 Q;  4DV2 Q;  1G2T A;  4C1N I;  2E74 C;  4YWL A;  1SMX A;  3CKI B;  4HJ5 A;  3I56 A;  4JOI A;  1MJE A;  3EA6 A;  4QMG A;  4WJ4 A;  3S1R H;  5A35 A;  1C9O A;  4IQZ A;  4PMW A;  2JN4 A;  4JI6 Q;  3F8T A;  1MJC A;  1Q1B A;  2JEB I;  3W1B A;  5IP9 H;  1TS4 A;  1EWH A;  3VYS A;  4A3I H;  4DV1 L;  1N33 Q;  1OO9 B;  4C1N K;  3CRK C;  4XYQ A;  1KD1 C;  3PO3 B;  2QKI C;  5AFW A;  3OTO Q;  3HEJ A;  4LK1 C;  2SNM A;  4DV2 L;  5IIF A;  4A3M B;  3R2T A;  1EIG A;  3I90 A;  3ITP A;  2EJF C;  4A76 A;  1JJG A;  4C3J B;  3U50 C;  3GD7 A;  2I5M X;  1IZ6 A;  3HGB A;  4X3S A;  2K50 A;  5ELO A;  1PH9 A;  4J1M A;  3PF5 A;  1MKH A;  3T1H Q;  1EYD A;  1EWC A;  1MD2 D;  5KRU A;  2Z6K A;  5EGT A;  2IX1 A;  1B2T A;  3I7F A;  2EOT A;  1KNE A;  3J7A 5;  5E3F A;  2NVX B;  1HRJ A;  3A8J E;  3J7Z C;  4FF4 A;  2JYO A;  2D0P A;  1WI5 A;  3D31 A;  2NVQ H;  3TME A;  1JOQ A;  4KHP L;  4LFA Q;  4GKJ Q;  1TY0 A;  3CP0 A;  2NVX H;  1PH5 A;  2B2W C;  4POF A;  4Y7N B;  2K5V A;  4OHJ A;  4TSS A;  1EQT A;  3PCO B;  5C3E G;  1UEA B;  1F77 A;  1HZA A;  4B3S L;  2LXJ A;  4IUQ A;  4HSP A;  1GD7 A;  1JWM D;  2BE5 C;  3GTO B;  2J4X A;  1HNZ L;  1WYD A;  2R93 H;  2UXC L;  4C3I G;  3GTL H;  1DJR D;  1Y14 B;  4A3F B;  4JI4 Q;  2F0E A;  3E0J A;  1FNW A;  4B3T L;  2EY2 A;  5C6A A;  3HOX H;  2QW7 A;  5IP7 H;  4A93 G;  1LV9 A;  3QR8 A;  5IP7 G;  1YNX A;  5D3D A;  5IWA L;  3S2H H;  3F2B A;  1Y1W H;  4K2K A;  3CD6 A;  2UUC L;  3SK8 A;  1E3P A;  2NN6 G;  3SDZ A;  1Y8O B;  1Z6H A;  1QOH A;  1SE3 A;  5I4D A;  2E2I H;  1C4Q A;  4NW2 A;  2M00 A;  4N9T A;  3GTL B;  1T5X D;  5IP9 G;  3PIP 3;  1AW7 A;  2RDG A;  3NBI A;  4HR7 B;  1IHZ A;  1LTS D;  1ICF B;  1Y1V B;  2PZW A;  2OTL A;  1HZB A;  2MUY A;  2A73 B;  1YI2 A;  2N88 A;  1WTQ A;  3T16 A;  1QWY A;  4OO1 I;  4FNF A;  3RLO A;  1TWF H;  1SFO B;  5J39 A;  3TBI B;  4PQX A;  1IBM Q;  1BF4 A;  3GTG B;  1MIU A;  4EVO A;  1VQN A;  1XMO L;  4RWS C;  1OXV A;  2AQ1 B;  3T51 B;  1IYJ B;  1ENC A;  4JI7 Q;  3F2U A;  1KDC A;  2K33 A;  4DR2 L;  1IBK Q;  3UDF A;  1YIT A;  1LTB D;  1RF2 D;  1T5E A;  1D1K A;  3FKI B;  1JOR A;  3RZO B;  2I5L X;  1HR0 W;  2B2W A;  4K5V A;  3RUZ A;  4QCL A;  3J80 L;  2AUJ D;  4F7X A;  1TWC H;  3PIO A;  2MJ8 A;  3M4Q A;  1GUT A;  1SBB B;  2Z4I A;  1VQJ A;  2PQA B;  4KD3 A;  3HZX A;  1XMO Q;  4DF7 A;  5KNC A;  4QUF A;  4A3B B;  5HGT A;  5C3W A;  2LXK A;  4LF9 Q;  3GV3 A;  1HH2 P;  1XYI A;  1C48 A;  1CA6 A;  1WTO A;  2KEN A;  5FLX E;  2E2D C;  4JBJ A;  2ENB A;  4TRD A;  3PO3 G;  3C1F A;  3ERO A;  2KJX A;  1WTW A;  1ZXT A;  3UDX A;  5KGU A;  4H02 A;  3G71 A;  4R4C A;  5COY A;  4NKL A;  2B2V A;  4I7A A;  3CQZ B;  2ASB A;  2YU9 H;  4IUN A;  1G91 A;  2ALY B;  3GTK H;  1TU2 B;  3D4W A;  4X3U A;  3I72 A;  1I4Q A;  5GAE C;  1HFN A;  1S5D D;  4IJL A;  2NN6 I;  1HXY D;  1J8I A;  1PFS A;  4EQP A;  5I2Y A;  3PIO 3;  4HJ9 A;  3S15 B;  3S17 B;  3NUC A;  3QG1 A;  3G48 A;  1XJV A;  1SJE D;  1PYS B;  2PYK A;  1JJ2 A;  2O4X A;  1PTO B;  2WKD A;  1BDO A;  1LAC A;  2K5Q A;  1OXX K;  1N34 L;  3JAM E;  2GA4 B;  3CW2 C;  3OTO L;  1II3 A;  3D6W A;  2ES2 A;  1PFN A;  1AEX A;  1DON A;  4L8J A;  3SXH A;  1I4G A;  1EWI A;  4RAU C;  3KJO A;  1O7I A;  4O1N A;  4JOI C;  3I4M H;  3DLL A;  4OO1 G;  2B2U A;  1M90 C;  3AMU A;  2JA7 H;  2B2T C;  2JA5 B;  3K57 A;  4YCU A;  3A54 A;  4WOR A;  2K52 A;  2CQA A;  5A2Q L;  2F3W A;  5C4X B;  4FO2 A;  4K8J A;  1FR3 A;  4OGQ C;  1EYC A;  1BR9 A;  2UU9 Q;  3M4P A;  4GZY C;  1SYE A;  4I7Z C;  4P75 A;  3KDF A;  2K01 A;  4FP5 D;  1GM5 A;  1XPU A;  2ZTC A;  4IPC A;  2A74 C;  3PSI A;  4C3I B;  4N8X 1;  1PH4 A;  1EYG A;  3S16 H;  1VQP A;  2TMP A;  2AWN A;  1LTA D;  4RA8 A;  4KHP Q;  3A7L A;  3OHX C;  3J80 i;  4OEL B;  2WB1 B;  1EY0 A;  2L11 A;  3P20 A;  4GLA C;  2K5H A;  1S40 A;  1C7Y A;  2JA9 A;  2KUM A;  1SE2 A;  3TP7 A;  3LWU A;  2MO1 A;  2RKS A;  2RQX A;  2F0K A;  5BR8 L;  4RFB A;  1SN8 A;  5EPJ A;  5HUR A;  1YJN A;  1HNZ Q;  2F1M A;  1CHP D;  3OMC A;  1B44 D;  2R92 G;  2UXC Q;  1AP0 A;  1KL9 A;  3G4S A;  1YJ9 A;  3I4N H;  1SRU A;  1YVC A;  2V4D A;  3QOL A;  1JR0 D;  2R7Z B;  3KYH C;  4BBR G;  4GN4 B;  3PUV A;  3VYR A;  1G2S A;  4X3T A;  5C44 B;  1Q8K A;  1PRT C;  2V1C C;  2XWJ B;  2RVL A;  4ILW A;  1F9S A;  5BR8 Q;  2XIW A;  3U9S A;  2GVA A;  5K36 G;  3I4O A;  2CWP A;  3H94 A;  4G7O C;  2KCN A;  3NHH A;  5I9O A;  4KI0 A;  1Q8I A;  2Z0S A;  3KUP A;  1NUC A;  3J7A V;  4ZLT F;  3EFX D;  5I2X A;  4GS3 A;  4ALP A;  5M3F G;  5C0X G;  1Q81 C;  4BY7 B;  1X32 A;  2YTY A;  1YZ6 A;  1QZG A;  1C8C A;  1I6V C;  2RHS B;  1LT4 D;  4QIW B;  4IFD G;  1K83 H;  2VQF L;  1EQQ A;  2K7V A;  4RGN A;  4O0A A;  4DR1 L;  2NTS A;  1A62 A;  3PIP A;  1HZC A;  1QIL A;  4LF6 L;  4H13 C;  2RHQ B;  2CFM A;  3QOJ A;  5IGG A;  3S1N B;  1PZI D;  3F2C A;  2CH4 A;  2JP1 A;  4BA1 I;  1AZQ A;  1VQL A;  2N55 A;  2EPB A;  5E4X A;  3NXW A;  1UE7 A;  1G29 1;  5D3I B;  1STN A;  5C44 G;  3DXJ C;  5CV7 A;  1CT1 D;  2NYZ D;  4NP5 A;  1A2T A;  2AMC B;  3A0J A;  1HNW Q;  5GAH C;  4B9W A;  3MZ5 A;  2BA1 A;  3NQI A;  3ONA B;  4R9W A;  2IWH A;  2F0I A;  3NWT A;  5M5W B;  1CKN A;  5J3B A;  4LF8 L;  1SNO A;  3K59 A;  3W3A A;  3HOV H;  1XTC D;  2OT2 A;  2EE1 A;  3UI2 A;  3RZO H;  4Q0F A;  1IKM A;  3K0Y A;  2DGY A;  4KD4 A;  4NMZ A;  1Y1W G;  4LF7 Q;  4BBS H;  2WKC A;  2JXM B;  2KCC A;  3RZD H;  1YHQ A;  1PH7 A;  1QUQ A;  3MXU A;  2Q2U A;  1A8V A;  2SEB D;  1Q90 A;  2NTT A;  3X3N A;  1VQO A;  3F1Z A;  4IUR A;  5CYU A;  2K32 A;  2DN8 A;  1HNX Q;  5ELN A;  3A8K E;  4KLK A;  4QIW E;  3J81 L;  3T1Y Q;  1ZKO A;  2K5N A;  3CCS A;  5HGQ A;  1KC8 C;  3S15 H;  3S17 H;  5D65 A;  1VMC A;  2XSC A;  2VY3 A;  2FFK B;  3GTP B;  1L1O A;  4A3D B;  2NZO A;  5AJ3 L;  3GQB A;  3M3Y B;  4LF7 L;  1JWS D;  2JE6 I;  2RA4 A;  1B4O A;  3D4D A;  1JOK A;  4JV5 Q;  3J7A F;  3MXN B;  1E22 A;  1XMQ L;  1P16 A;  1OXT A;  1HNX L;  1AN8 A;  3A74 A;  4K8I A;  4JBW A;  2M2L A;  2E2I B;  1VQ4 A;  4KHZ A;  4X65 Q;  4CKE A;  1ET6 A;  4X6A H;  1AZP A;  1F9P A;  1Q3L A;  3SK6 A;  3QJY A;  2R92 B;  3KFU A;  4EQO A;  1D5X C;  1DZ1 A;  1Q7Y C;  1KRT A;  1XMQ Q;  4AYB E;  1PZK D;  3CHB D;  5C4J H;  5EQ0 A;  1BCP B;  4OON A;  5CBA E;  1DGS A;  1TII D;  5NUC A;  4JI0 L;  2H4O A;  1I4H A;  1LLR D;  3CCE A;  3RLN A;  3IRB A;  1D5Z C;  2E2H B;  5LL6 X;  4DFA A;  5JJL A;  4S3S A;  1B3Q A;  3S1R B;  5FLX c;  4JG2 A;  3M7G A;  3HG9 A;  2CVR A;  1I3Q B;  3BZC A;  3CCM A;  4RCO A;  1TWG H;  2LMC B;  4RGO S;  4DKA C;  5JJZ A;  3Q23 A;  3RNU A;  1X56 A;  4R4Q A;  5JEA H;  3HKZ E;  2L55 A;  3NEN A;  5IGC A;  1K3R A;  3QIA A;  4IPH A;  1PDQ A;  2XN9 C;  1PRT B;  2X69 A;  3VA5 A;  1B53 A;  2WAQ B;  1UUP A;  2ZJQ A;  3HOZ H;  3GP7 A;  4DK0 A;  4UP9 A;  4P2C B;  4A3J B;  1I4R A;  1ESF A;  3AQQ A;  1K28 A;  1GKH A;  2R6G A;  5FKA C;  3BJU A;  2CW0 D;  3EQL C;  1E1O A;  3SVM A;  4DV0 L;  4XT3 B;  1WTR A;  2E2J H;  4I65 A;  2LS0 1;  3OOC A;  5KNB A;  4JI2 L;  4LMQ D;  4GNX A;  2KEC A;  2SDF A;  5TSS A;  1R4Q B;  1BQQ T;  1LTG D;  4X62 L;  3ERQ A;  1SYG A;  3K7A H;  2HCI A;  5JPM C;  2VQE L;  1GUG A;  5GAD C;  2EJG C;  3OWE B;  3UDI A;  3HOU B;  4ZKC B;  4DXG A;  2PCF B;  1GOZ A;  3IL8 A;  2A6H D;  5JAV A;  3N6R A;  4YHH L;  1W6K A;  5E1F A;  1HR0 L;  4ID6 A;  1E1T A;  3STB D;  4G7H C;  1TS3 A;  3HOW G;  1N8R C;  2Z1C A;  4Y7N H;  4JI1 L;  1J9O A;  3I73 A;  5DNF A;  1ILP A;  4DV5 Q;  2NVT H;  2KCM A;  4A3C H;  2HDM A;  5C4X H;  1K8M A;  5CC4 A;  1S5B D;  1VQH A;  4NXM Q;  4DPG A;  2B63 H;  4X66 L;  3A55 A;  2N49 A;  1GHJ A;  1A6X A;  4JI4 L;  1LT5 D;  3NE5 B;  1B70 B;  5IYD H;  3M7N A;  4DR6 Q;  2EYF A;  3HOV B;  4DNT B;  1KHI A;  3SEB A;  3M4Y A;  4ZCK A;  1VQI A;  1BVS A;  2HCC A;  4A3G H;  1SYB A;  1V1P A;  3I91 A;  1U4P A;  2IJ0 A;  1CKO A;  4DR3 Q;  3LGJ A;  2FMM A;  2Z9H A;  4IFD J;  3EN2 A;  3H0G B;  2FIN B;  2JA6 H;  2Q2H A;  4BS9 A;  1YIJ A;  4KKS A;  1VQ7 A;  5ELD A;  2SOB A;  2L15 A;  4OEM B;  2NVT B;  5C0X H;  3OMG A;  3N52 A;  1PH1 A;  1U4M A;  3H15 A;  4QL5 A;  3BU2 A;  4EX5 A;  4DAM A;  1CFM A;  1FVI A;  1D6E C;  3H91 A;  3FMC A;  3R3O A;  5IGF A;  1D8L A;  4JPB W;  5GRO A;  4CHT B;  4DR3 L;  4DR7 Q;  1QVG A;  2MHV A;  1TWA B;  1TR5 A;  2WFW A;  4IUT A;  3I2Z A;  3BZK A;  1RKN A;  2BCO A;  2L0C A;  2QA4 A;  1ROD A;  4JI7 L;  4A3C G;  5LHY 1;  1A3T A;  2D5D A;  1G51 A;  2IX0 A;  1K9M C;  4YY3 L;  1PXU A;  2B3G A;  3K8A A;  4DR5 L;  3KBG A;  4POG A;  4CDD C;  3VR6 A;  4XIG S;  4A3I G;  4A3L H;  3ICE A;  4F87 A;  5C4H A;  4DA2 A;  4KKU A;  1RTN A;  2DNC A;  4MNO A;  3S16 B;  3BYY B;  3EVQ A;  1U0L A;  1F2Z A;  1HTL D;  4OX9 Q;  5EKL A;  4TQU S;  4MN3 A;  5EAY A;  2BA0 A;  1PH2 A;  4FYD A;  1EY5 A;  1I50 B;  3K7A B;  1M8A A;  5LMN L;  4C3H H;  1Q86 C;  2L1B A;  3R93 A;  3MAQ A;  1KDB A;  2F0F A;  2F4V L;  1YBY A;  1PYW D;  2B39 A;  3HOZ G;  4DNR B;  2E8G A;  3TS2 A;  1F2Y A;  5JEA J;  3S2D H;  4QJF A;  1BNZ A;  4V0B A;  1SE8 A;  2F52 A;  4C56 C;  2ZTE A;  5IT9 c;  4DV0 Q;  3S14 H;  4JYA Q;  3SK4 A;  1FD7 D;  2EJM A;  3PF4 A;  3LNN A;  1QVC A;  4HAE A;  1LM0 A;  3HKS A;  4MZ9 A;  5LMN Q;  2YTX A;  1HJP A;  3FRP B;  1OTC A;  3NQT A;  1YHA A;  4FXK C;  1EIY B;  1O7Y A;  3TSS A;  5IGB A;  3HOY G;  1MI2 A;  4ZRZ A;  3ER0 A;  3CPW A;  1UNS A;  1N34 Q;  4IUP A;  2VZA A;  3RR5 A;  2L5T A;  2OXP A;  1WCM H;  1WCM G;  3NTI A;  3KLW A;  4NPS A;  5GAG C;  4KKT A;  1SEB D;  2Q8T A;  2YU9 B;  4ABN A;  2FJ2 A;  3AFP A;  4DAY B;  4JVZ A;  2WB1 E;  4UP7 A;  1E7Z A;  4DUY L;  1EQV A;  3V96 A;  3G6E A;  2F4I A;  1ASY A;  1A15 A;  4LJZ C;  4EGV A;  1Q82 C;  4GKK L;  4IUV A;  3AFQ A;  2EVB A;  3CC4 A;  3DM3 A;  1CA5 A;  2KVM A;  5H1S E;  2VQE Q;  4CGY B;  3E9H A;  2ZXR A;  3FKI H;  3K5O A;  1NMG A;  4K6L A;  4DN4 M;  2R92 H;  3V05 A;  2R93 B;  4YHH Q;  3PUZ A;  1SXT A;  1SR3 A;  3DWA A;  4L5R C;  1IYU A;  1HA5 A;  3KJP A;  4Q5V A;  4YCV A;  1H9S B;  1Y69 U;  3MWY W;  1VMP A;  3DHQ A;  1I5F A;  2LSS A;  2ZXO A;  1ESR A;  1TWG B;  5IWA Q;  1N32 L;  3D0F A;  3GO5 A;  4DV5 L;  2CW0 C;  1KTK A;  2A68 D;  4M8A A;  2ZTD A;  3SHL A;  1DM0 B;  5JOB A;  4CKB A;  3MHB A;  5E7N A;  1QJO A;  2O5I C;  1PVO A;  1M1K C;  2AHO B;  2QEX A;  2QGQ A;  1RCV D;  1JQY D;  2Z6B A;  1EFW A;  3OIQ A;  5J22 A;  5A2Q E;  1CI3 M;  2G9H D;  3L0O A;  3GTM B;  4CJ2 C;  2Q2T A;  3U58 A;  2GVB A;  3OIP A;  1KLG D;  1F9R A;  5KIX A;  1B7Y B;  4FDB A;  2QDL A;  5CV6 A;  5M3F H;  3Q0A A;  1WTX A;  1UWV A;  1VQA A;  2PPB C;  1S5F D;  5I6Y A;  2VXW A;  3JC6 6;  4HCE A;  3W2D A;  3KF6 A;  3HOU H;  4P73 A;  1E2Z A;  4IFD H;  2K6A A;  1M4V A;  4JCV E;  1LO5 D;  3U4Z A;  2IHE A;  5IYB G;  3T4A C;  4B08 A;  2F3V A;  4LUZ A;  2ZJR A;  4K6D A;  3TP6 A;  1Y8N B;  3J7Y W;  3KF6 B;  2EY5 A;  1JB3 A;  4DK1 A;  4A3I B;  4O42 A;  4R4T A;  2OCE A;  4AH6 A;  2MO0 A;  1KDA A;  3TP8 A;  1XNR L;  1GUS A;  2F03 A;  2IHF A;  5D14 A;  4BBR H;  2UXD L;  3VR4 A;  2O2L D;  3FDT A;  2ZM6 L;  3QB3 A;  1AE2 A;  2NBF A;  2OWO A;  3PUX A;  2VUM H;  3DUZ A;  2ZT9 C;  1U4R A;  2HD3 A;  3HOX G;  3GTQ B;  2F0V A;  3S9W A;  5C0X J;  4YY3 Q;  2F0H A;  1I3Q H;  1RTO A;  3RN5 A;  4GOP A;  2XTI A;  1A3V A;  1WFQ A;  3VR2 A;  4U68 A;  5I9P A;  1DXM A;  1XNR Q;  2H1E A;  2ID0 A;  1VQ8 A;  1CTM A;  1NCV A;  4HJ7 A;  1X54 A;  4PZ8 A;  1RL2 A;  2BDN A;  2HDL A;  2IX3 A;  1PA6 A;  3MXN A;  4K5W A;  4QF4 A;  2E75 C;  4DV3 L;  2K14 A;  2C35 B;  2N3S A;  4A3E B;  2F4V Q;  1CHQ D;  4DAV A;  4HED A;  4PZ6 A;  2B2Y C;  4OWW B;  1WCM B;  2E76 C;  1K8O A;  2K5W A;  2KHI A;  3URY A;  2A5H A;  1LTT D;  2MFI A;  4U67 3;  2JA8 G;  4JYA L;  4M1U B;  1S5C D;  4A4I A;  3BYT B;  2N78 A;  5FOB B;  3NBH A;  4DV3 Q;  2KCT A;  4R8N A;  2MGS A;  2NUC A;  1GXD C;  1OXS C;  2HIV A;  3S14 B;  5IOD A;  3HKZ G;  1D1I A;  2FXQ A;  2PI2 E;  1JCK B;  1LTL A;  2X6L A;  1I4X A;  5LMU Q;  5EPK A;  4JV5 L;  4BY1 B;  3O13 A;  4AQY Q;  1EY7 A;  4F88 A;  4C2M B;  3IAY A;  4C3H B;  3KLR A;  1K8A C;  3VDY A;  3FEW X;  3EBE A;  4DUY Q;  2JEA I;  3K7U C;  2MP1 A;  4KY6 A;  4X65 L;  1A63 A;  1B1Z A;  1FGU A;  2P5Z X;  1NR4 A;  2EYM A;  4IN3 A;  1RJT A;  4GKK Q;  1B50 A;  3S1Q H;  3HS0 C;  2AWO A;  1GUO A;  4DV7 L;  1AFP A;  1EL0 A;  4HN7 A;  2ZJP A;  5FLM H;  1J6Q A;  4AQY L;  4IFD I;  4AYB B;  4L5S A;  2A19 A;  3HP3 A;  2RF4 A;  3CCL A;  4A3G B;  2LKV A;  2F0Q A;  5M3M G;  4XQJ A;  4B3R L;  2NN6 H;  1IBL L;  1R9T B;  1H9R A;  3DWP A;  1LTI D;  5EKI A;  1P8L A;  1H95 A;  2EY6 A;  1Y1V G;  1L0Y B;  1QB5 D;  3T53 B;  1TQO A;  2R7Z G;  4KJN A;  2A69 C;  4JW0 A;  3RN2 A;  4LUO A;  2QF7 A;  3K6O A;  1PFM A;  5IGE A;  5K5P A;  3S2D B;  4DU9 A;  4UP8 A;  2E5L L;  4IO9 A;  3RLF A;  4XQQ A;  2D62 A;  1SNQ A;  4HMJ A;  3PUY A;  4CBV A;  1WVL A;  1EFI D;  3OSO A;  2EQS A;  2EYH A;  1CKM A;  1VQE A;  1RIP A;  1QZH A;  4G4K A;  1IBL Q;  2PW5 A;  4RKL A;  3I8Z A;  4KN7 C;  1SYC A;  2F0J A;  2B8F A;  5C0X I;  5C3E H;  2RCN A;  4LF4 Q;  1SE4 A;  1WD1 A;  4L5Q A;  1X3F A;  2BH8 A;  2KHS A;  2VQF Q;  1Y8P B;  2EYO A;  2ICI A;  3TS0 A;  4A75 A;  3C3L A;  1JJC B;  4V19 0;  2JA6 B;  3C2P A;  4UDU C;  3E9I A;  3BDO A;  3BDC A;  4A3B G;  5I6W A;  1Z9F A;  3K5N A;  3HOW H;  4A93 H;  4RGT A;  1LUZ A;  4MTN A; 
#chains in the Genus database with same CATH homology
 4ZQ3 A;  3HKZ B;  4KN4 C;  3BVM A;  1PTO H;  1EZ8 A;  3CRL C;  3KLS A;  4H7B A;  5IOC A;  1LAB A;  1ICW A;  3DWQ A;  5CBE E;  2K04 A;  2L9H A;  3DEO A;  1SNC A;  4WRD A;  4XT1 B;  4K5X A;  2OF1 A;  4A3K B;  3NK9 A;  2RSO A;  4IZ8 A;  1ILQ A;  2YYZ A;  1U4L A;  3IFT A;  5IT9 L;  1SYD A;  1SYF A;  1PFB A;  2RBM A;  4HCS A;  1EOT A;  3MFY A;  3X3M A;  4ZUJ A;  1PMR A;  3QWN A;  3NP8 A;  5M3M B;  4E6I A;  1CK1 A;  1JC7 A;  5BN5 A;  4WFN 3;  3V2T A;  1V1P B;  1LT6 D;  4OL7 A;  1QNU A;  3BG3 A;  2HQE A;  5C5L A;  5C5M A;  1LTR D;  5CMD A;  1EY4 A;  4QUC A;  3PV0 A;  1MSG A;  1QCB D;  1SMY D;  2JA7 B;  2B8G A;  4HSV A;  1TKW B;  2RSN A;  3ZYY X;  2EYJ A;  4IAL A;  5IGD A;  1BO0 A;  2EY1 A;  1YNJ C;  4ZYS A;  1MBY A;  1CZW A;  1TWF B;  2IPK D;  5COR A;  1H9K A;  3RMH A;  1BCP F;  3J80 E;  2A68 C;  1VDZ A;  4PMC A;  2A69 D;  4ZKB B;  3P7J A;  1FYC A;  5FLX L;  5CV4 A;  1F2M A;  4K2L A;  3S2H B;  3C1E A;  2B2T A;  2B2U C;  5G3L D;  3VR5 A;  1ONL A;  3MA2 B;  1DOM A;  1EYA A;  5CV8 A;  1IL8 A;  5ELB A;  5FK9 C;  1HA6 A;  1STA A;  4KY7 A;  2PZU A;  1DYQ A;  3OPO A;  3TN2 A;  4KK7 A;  4IUU A;  2A6E C;  1ZEQ X;  1ENA A;  4R8I A;  2D2C C;  4RKB A;  3U9O A;  2QEJ C;  2QIL A;  3L9A X;  2WIN B;  4BBR B;  3A8I E;  4H0L C;  2J7Z A;  1L0X B;  1FGB D;  1XWE A;  1FNU A;  1X3P A;  4A93 B;  2EZV A;  2KOL A;  4ULL A;  4L6T B;  2G9D A;  1B9M A;  2C9O A;  1Y1W B;  2QDB A;  1SDF A;  4KJO A;  4XYO A;  3A7A B;  4BA2 I;  5FO9 B;  5CR3 A;  3A56 A;  2DY8 A;  4XTC S;  4G7Z C;  2F0O A;  1KAB A;  2A6E D;  1STY A;  3BZD B;  1SAP A;  2DNE A;  3K5M A;  5CV9 A;  4QB4 A;  5DAU A;  1PTO D;  2F0D A;  4RHS A;  2VNU D;  4DAY A;  2BOS A;  1HCZ A;  5DEH A;  3WOE A;  3M4O B;  3WDN A;  3G6J B;  1I4P A;  2F0U A;  1D5M C;  3M85 A;  4KHV A;  3BVZ A;  1V43 A;  3I70 A;  2VB3 X;  2EYL A;  1G6Z A;  1PRT D;  4DAP A;  1LT3 D;  4X3K A;  1BXT A;  3BS1 A;  1SSO A;  1ENF A;  1ZYR D;  4PNY A;  3IKJ A;  1EU4 A;  5C3X A;  3SE0 A;  2I07 B;  3GV6 A;  3I4N B;  1RDP D;  2OEO A;  1EEI D;  1HUN A;  3FPP A;  3FVQ A;  2LFN A;  2NVY B;  5K36 H;  1K83 B;  1UAP A;  1GUW A;  3AB9 A;  1E0B A;  1PLF A;  4FXG C;  1FNV A;  5JPN C;  5EBD A;  2WV6 D;  1NR2 A;  1DD2 A;  3K5L A;  2KQ3 A;  2RDH A;  2WII B;  5EPL A;  5ELC A;  3HOY B;  2X6G A;  3OWF A;  4OIJ A;  4EQN A;  1D2B A;  4J6H A;  2B63 B;  3BVG A;  2Z4H A;  1OXU A;  2F0W A;  5M9O A;  3DM1 A;  4KMU C;  3GTK B;  3Q24 A;  5KEE A;  2KEE A;  2KED A;  1CZG A;  2K05 A;  3D6C A;  4JK1 C;  5FO8 B;  5FO7 B;  1HUM A;  2EXZ A;  4UAI A;  3DEP A;  3TZD A;  2Y0S B;  5EJW A;  1E2W A;  1SNP A;  1PTO C;  3E6Z X;  2KA7 A;  4DGZ A;  3L7Z C;  1F9Q A;  5IT9 E;  4L63 B;  1PTO F;  1EY9 A;  2K1B A;  2C5C A;  1SMY C;  2D9U A;  3KLS X;  2I46 A;  1IKL A;  2F0S A;  2FHT A;  1V8Q A;  1A3U A;  2PW7 A;  5EKK A;  4XQN A;  3TZU A;  3HOW B;  5M3F B;  1O7L A;  5T1G A;  1KAA A;  3H09 A;  5JVH 3;  1TY2 A;  3IFD A;  4FF2 A;  1WD0 A;  5BN3 A;  3S1Q B;  4F8M A;  2JSO A;  5ISR A;  4LAA A;  3JAM L;  4H44 C;  2IT1 A;  2VB2 X;  4RH6 A;  5M5X B;  2VUM B;  1XX8 A;  3TDQ A;  2AQ3 B;  1BCP C;  2EDG A;  3DMU A;  3C46 A;  3NTH A;  1EY8 A;  2L4N A;  4FVM A;  1BOS A;  1Z7T A;  3VR3 A;  3P1H A;  3RZD B;  1STG A;  1XXG A;  3QO2 A;  1YNN C;  4WJW A;  1O78 A;  1BBX C;  3R8B A;  4OIK A;  4NDX A;  4ZAI A;  3Q6S A;  2AUK A;  1H9M A;  4ZUI A;  2QCP X;  1QG7 A;  3PUW A;  5T1I A;  5DM7 3;  2SNS A;  2O5J C;  2NWG A;  1VF7 A;  5LL6 S;  1TT2 A;  3R2I A;  5G3L F;  2K03 A;  3PMF A;  4HMI A;  4BWG B;  3S1M B;  1CQV A;  4Z9C B;  4RGM A;  1PRT F;  2BDO A;  2PMZ B;  4CJ0 B;  1H9S A;  1SND A;  3MXP A;  1QNK A;  2NVQ B;  4ODG A;  4MIU A;  2ZXP A;  1Q1E A;  2JA8 B;  1JWU D;  4N9P A;  3VYU A;  3HOX B;  5CV5 A;  1IW7 C;  5CGK A;  1GHK A;  1CM9 A;  1ML0 D;  3H3V C;  2MPM A;  3J81 E;  3E5S A;  3FPU B;  5DM6 3;  4G57 A;  3AU7 A;  4J8Q A;  1I6H B;  4FF1 A;  1A2U A;  4XXE A;  4CKC A;  3H6M A;  5C4J B;  2XRQ D;  3KBX A;  1YNJ D;  1NSN S;  1W6J A;  4C3H G;  4KTA A;  4ZK9 B;  5F2D A;  2PO4 A;  2R3Z A;  1HTP A;  1PZJ D;  1SNM A;  2F0N A;  1X3Q A;  3PO2 B;  2J0T D;  2F0P A;  2PZT A;  2XVS A;  1Q12 A;  1O80 A;  2EYP A;  4OO1 H;  1WTV A;  1ET9 A;  1EZ6 A;  2K28 A;  3NPP A;  3HRZ C;  5JVG 3;  5EBC A;  1STH A;  3MEH A;  1CQF A;  1KNA A;  3P75 A;  1IW7 D;  2IW3 A;  3RD4 A;  1DCZ A;  1MSH A;  3TP5 A;  3I3C A;  3Q22 A;  1DOK A;  1JOO A;  4BBS B;  3LX0 A;  4FXD A;  2DY7 A;  1HFG A;  5BN4 A;  2K5D A;  3G7L A;  3L3O C;  1S5E D;  1HQR D;  4TKO B;  4RCN A;  3MVV A;  5ELE A;  1R4P B;  5ELF A;  4XDX A;  3LWE A;  1GUN A;  2XNA C;  1RD9 D;  4K14 A;  3T56 B;  1JIC A;  2L12 A;  3NWS A;  5E4W C;  1KLU D;  2AQ2 B;  3ND8 A;  3D4R A;  5J1Z A;  2LY7 A;  4HTH A;  2F0T A;  1HHV A;  1TS5 A;  4RHR A;  3BDL A;  1EIH A;  2CHB D;  3D8G A;  1EEF D;  4DXF A;  3K58 A;  2B2V C;  2XRS D;  2IL8 A;  1BCP D;  2F0G A;  3KF8 A;  3MC0 B;  1H9J A;  1RHP A;  1STE A;  1B3A A;  1EU3 A;  3I4L A;  2PNR C;  1TVX A;  2WP8 J;  1GJX A;  3VA7 A;  1G8Z D;  4YIJ A;  2PQE A;  5C3E B;  2B2Y A;  2M9V A;  3MTS A;  3MXG A;  3GTJ B;  5C4Z A;  2RDF A;  3SK5 A;  3D3R A;  1B9N A;  4ME5 A;  1NAP A;  4KY5 A;  5KYI A;  1TWH B;  3VYT A;  1WTP A;  4C3J G;  3NSW A;  3KK7 A;  4FF3 A;  3WOF A;  2R61 A;  2XWB B;  2BE5 D;  2WAC A;  5M5Y B;  1TS2 A;  1E2V A;  5KYL A;  1VCI A;  1TWC B;  3SR1 A;  3ND9 A;  1EY6 A;  1STB A;  4PMB A;  2F0L A;  2NZ1 D;  5KND A;  2ICE C;  2E2J B;  4PV1 C;  4KV6 A;  1ZYR C;  1F2L A;  2Z8L A;  1S4Z A;  1VF5 C;  1HPC A;  1DOL A;  2HUG A;  3T13 A;  2F0M A;  4CJ1 B;  1QE6 A;  2A6H C;  2Q8I B;  2Q8R E;  5JEA G;  3HOZ B;  1V1O A;  2FMC A;  1IYV A;  2NB0 A;  1Z47 A;  3OW7 A;  1U9R A;  1YNN D;  1JE4 A;  3EJI A;  3I4M B;  4B9X A;  2TSS A;  3NTK A;  1O7Z A;  3CU7 A;  1HQM C;  1BUV T;  4MHE A;  3MFG A;  1SJH D;  1MGS A;  1G2T A;  4C1N I;  2E74 C;  3CKI B;  3EA6 A;  4QMG A;  5A35 A;  4IQZ A;  4PMW A;  1Q1B A;  2JEB I;  1TS4 A;  1EWH A;  3VYS A;  1OO9 B;  4C1N K;  3CRK C;  4XYQ A;  3PO3 B;  2QKI C;  5AFW A;  3HEJ A;  4LK1 C;  2SNM A;  5IIF A;  4A3M B;  3R2T A;  1EIG A;  3I90 A;  3ITP A;  2EJF C;  4C3J B;  3GD7 A;  3HGB A;  4X3S A;  4J1M A;  1EYD A;  1EWC A;  1MD2 D;  5KRU A;  5EGT A;  2IX1 A;  1B2T A;  2EOT A;  1KNE A;  5E3F A;  2NVX B;  1HRJ A;  3A8J E;  4FF4 A;  2JYO A;  3D31 A;  3TME A;  1JOQ A;  1TY0 A;  2B2W C;  4Y7N B;  4OHJ A;  4TSS A;  1EQT A;  1UEA B;  1F77 A;  4IUQ A;  4HSP A;  1JWM D;  2BE5 C;  3GTO B;  2J4X A;  4C3I G;  1DJR D;  4A3F B;  2F0E A;  3E0J A;  1FNW A;  2EY2 A;  5C6A A;  1LV9 A;  5D3D A;  4K2K A;  3SK8 A;  2NN6 G;  3SDZ A;  1Y8O B;  1Z6H A;  1QOH A;  1SE3 A;  5I4D A;  1C4Q A;  4NW2 A;  2M00 A;  4N9T A;  3GTL B;  1T5X D;  3PIP 3;  1AW7 A;  2RDG A;  3NBI A;  4HR7 B;  1IHZ A;  1LTS D;  1Y1V B;  2PZW A;  2MUY A;  2A73 B;  2N88 A;  1WTQ A;  3T16 A;  1QWY A;  4OO1 I;  4FNF A;  1SFO B;  5J39 A;  3TBI B;  4PQX A;  1BF4 A;  3GTG B;  4EVO A;  4RWS C;  1OXV A;  2AQ1 B;  3T51 B;  1ENC A;  3F2U A;  1KDC A;  2K33 A;  1LTB D;  1RF2 D;  1T5E A;  1D1K A;  3FKI B;  1JOR A;  3RZO B;  2B2W A;  4K5V A;  3RUZ A;  4QCL A;  3J80 L;  2AUJ D;  4F7X A;  2MJ8 A;  1GUT A;  1SBB B;  2Z4I A;  4KD3 A;  3HZX A;  4DF7 A;  5KNC A;  4QUF A;  4A3B B;  5HGT A;  5C3W A;  3GV3 A;  1XYI A;  1C48 A;  1CA6 A;  1WTO A;  5FLX E;  2E2D C;  2ENB A;  4TRD A;  3C1F A;  3ERO A;  2KJX A;  1WTW A;  1ZXT A;  5KGU A;  5COY A;  4NKL A;  2B2V A;  3CQZ B;  1G91 A;  4IUN A;  1TU2 B;  3D4W A;  4X3U A;  3I72 A;  1I4Q A;  1HFN A;  1S5D D;  2NN6 I;  1HXY D;  1J8I A;  4EQP A;  5I2Y A;  3PIO 3;  3S15 B;  3S17 B;  3NUC A;  3QG1 A;  1SJE D;  2PYK A;  2O4X A;  1PTO B;  2WKD A;  1BDO A;  1LAC A;  2K5Q A;  1OXX K;  3JAM E;  2GA4 B;  1II3 A;  3D6W A;  1PFN A;  1AEX A;  1DON A;  4L8J A;  3SXH A;  1I4G A;  4RAU C;  4O1N A;  4OO1 G;  2B2U A;  3AMU A;  2B2T C;  2JA5 B;  3K57 A;  3A54 A;  4WOR A;  5C4X B;  2CQA A;  5A2Q L;  2F3W A;  4FO2 A;  4K8J A;  1FR3 A;  4OGQ C;  1EYC A;  1BR9 A;  4GZY C;  1SYE A;  4I7Z C;  2K01 A;  4FP5 D;  2A74 C;  4C3I B;  2TMP A;  2AWN A;  1LTA D;  4RA8 A;  3A7L A;  3OHX C;  2WB1 B;  1EY0 A;  2L11 A;  3P20 A;  2KUM A;  1SE2 A;  3TP7 A;  3LWU A;  2RKS A;  2RQX A;  2F0K A;  4RFB A;  5EPJ A;  5HUR A;  2F1M A;  1CHP D;  3OMC A;  1B44 D;  1AP0 A;  2V4D A;  3QOL A;  1JR0 D;  2R7Z B;  3PUV A;  3VYR A;  1G2S A;  4X3T A;  5C44 B;  1PRT C;  2XWJ B;  2RVL A;  4ILW A;  1F9S A;  2XIW A;  3U9S A;  5K36 G;  3H94 A;  4G7O C;  2KCN A;  3NHH A;  5I9O A;  4KI0 A;  1Q8I A;  3KUP A;  1NUC A;  3J7A V;  4ZLT F;  3EFX D;  5I2X A;  5C0X G;  4BY7 B;  1X32 A;  1C8C A;  1I6V C;  1LT4 D;  4QIW B;  4IFD G;  2K7V A;  4RGN A;  2NTS A;  1QIL A;  4H13 C;  3QOJ A;  5IGG A;  3S1N B;  1PZI D;  2JP1 A;  4BA1 I;  1AZQ A;  2N55 A;  2EPB A;  5E4X A;  3NXW A;  1G29 1;  5D3I B;  1STN A;  3DXJ C;  5CV7 A;  1CT1 D;  2NYZ D;  4NP5 A;  1A2T A;  4B9W A;  3MZ5 A;  2BA1 A;  3NQI A;  3ONA B;  4R9W A;  2IWH A;  2F0I A;  3NWT A;  5M5W B;  1SNO A;  3K59 A;  3W3A A;  1XTC D;  2OT2 A;  2EE1 A;  3UI2 A;  4Q0F A;  1IKM A;  3K0Y A;  4KD4 A;  4NMZ A;  2WKC A;  2JXM B;  2KCC A;  3MXU A;  2SEB D;  1Q90 A;  2NTT A;  3X3N A;  4IUR A;  5CYU A;  2K32 A;  2DN8 A;  3A8K E;  3J81 L;  1ZKO A;  5D65 A;  1VMC A;  2XSC A;  2FFK B;  3GTP B;  4A3D B;  3GQB A;  3M3Y B;  1JWS D;  2JE6 I;  2RA4 A;  1B4O A;  3D4D A;  1JOK A;  3J7A F;  1OXT A;  1AN8 A;  4K8I A;  4JBW A;  2M2L A;  2E2I B;  4KHZ A;  4CKE A;  1ET6 A;  1AZP A;  1F9P A;  1Q3L A;  3SK6 A;  3QJY A;  2R92 B;  4EQO A;  1D5X C;  1DZ1 A;  1PZK D;  3CHB D;  5EQ0 A;  1BCP B;  5CBA E;  1TII D;  5NUC A;  2H4O A;  1I4H A;  1LLR D;  1D5Z C;  2E2H B;  5LL6 X;  4DFA A;  4S3S A;  3S1R B;  3M7G A;  3HG9 A;  2CVR A;  1I3Q B;  4RCO A;  4RGO S;  2LMC B;  3Q23 A;  5JJZ A;  5JEA H;  2L55 A;  5IGC A;  3QIA A;  1PDQ A;  2XN9 C;  1PRT B;  2X69 A;  3VA5 A;  1B53 A;  2WAQ B;  1UUP A;  3GP7 A;  4DK0 A;  4P2C B;  4A3J B;  1I4R A;  1ESF A;  2R6G A;  5FKA C;  2CW0 D;  3EQL C;  3SVM A;  1WTR A;  4XT3 B;  4I65 A;  2LS0 1;  3OOC A;  5KNB A;  4LMQ D;  2KEC A;  2SDF A;  5TSS A;  1R4Q B;  1BQQ T;  1LTG D;  3ERQ A;  1SYG A;  2HCI A;  5JPM C;  1GUG A;  2EJG C;  3OWE B;  3HOU B;  4ZKC B;  4DXG A;  2PCF B;  1GOZ A;  3IL8 A;  2A6H D;  5JAV A;  3N6R A;  1W6K A;  5E1F A;  4ID6 A;  4G7H C;  1TS3 A;  2Z1C A;  1J9O A;  3I73 A;  5DNF A;  1ILP A;  2HDM A;  1K8M A;  5CC4 A;  1S5B D;  3A55 A;  1GHJ A;  1A6X A;  1LT5 D;  3NE5 B;  3M7N A;  2EYF A;  3HOV B;  4DNT B;  3SEB A;  3M4Y A;  2HCC A;  1SYB A;  1V1P A;  3I91 A;  1U4P A;  2IJ0 A;  2FMM A;  4IFD J;  3H0G B;  2FIN B;  4BS9 A;  4KKS A;  5ELD A;  2SOB A;  2NVT B;  5C0X H;  3OMG A;  3N52 A;  1U4M A;  1CFM A;  1D6E C;  3H91 A;  3FMC A;  3R3O A;  5IGF A;  4CHT B;  2MHV A;  1TWA B;  1TR5 A;  4IUT A;  1RKN A;  2BCO A;  2L0C A;  1ROD A;  5LHY 1;  1A3T A;  2D5D A;  2IX0 A;  1PXU A;  3KBG A;  3VR6 A;  4XIG S;  4F87 A;  5C4H A;  4DA2 A;  4KKU A;  1RTN A;  2DNC A;  3S16 B;  3BYY B;  3EVQ A;  1F2Z A;  1HTL D;  5EKL A;  4TQU S;  4MN3 A;  4FYD A;  2BA0 A;  1EY5 A;  1I50 B;  3K7A B;  1M8A A;  2L1B A;  3R93 A;  3MAQ A;  1KDB A;  2F0F A;  1PYW D;  2B39 A;  4DNR B;  1F2Y A;  5JEA J;  1BNZ A;  4V0B A;  4C56 C;  3SK4 A;  1FD7 D;  2EJM A;  3LNN A;  4HAE A;  3FRP B;  3NQT A;  4FXK C;  1O7Y A;  3TSS A;  5IGB A;  1MI2 A;  4ZRZ A;  1UNS A;  4IUP A;  2L5T A;  2OXP A;  3NTI A;  4KKT A;  1SEB D;  2Q8T A;  2YU9 B;  4ABN A;  2FJ2 A;  1EQV A;  3V96 A;  2F4I A;  1A15 A;  4LJZ C;  4EGV A;  4IUV A;  2EVB A;  1CA5 A;  2KVM A;  4CGY B;  2ZXR A;  3K5O A;  4K6L A;  4DN4 M;  3V05 A;  2R93 B;  3PUZ A;  1SXT A;  3DWA A;  1IYU A;  1HA5 A;  4Q5V A;  1H9S B;  1Y69 U;  3MWY W;  1VMP A;  3DHQ A;  2ZXO A;  1ESR A;  1TWG B;  3GO5 A;  2CW0 C;  1KTK A;  2A68 D;  4M8A A;  3SHL A;  1DM0 B;  5JOB A;  4CKB A;  3MHB A;  1QJO A;  2O5I C;  1RCV D;  1JQY D;  3OIQ A;  5J22 A;  5A2Q E;  1CI3 M;  2G9H D;  3GTM B;  4CJ2 C;  3OIP A;  1KLG D;  1F9R A;  5KIX A;  5CV6 A;  3Q0A A;  1WTX A;  2PPB C;  1S5F D;  5I6Y A;  2VXW A;  4HCE A;  3W2D A;  1E2Z A;  4IFD H;  2K6A A;  1M4V A;  1LO5 D;  3T4A C;  4B08 A;  2F3V A;  4K6D A;  3TP6 A;  1Y8N B;  3J7Y W;  2EY5 A;  1JB3 A;  4DK1 A;  4A3I B;  4O42 A;  1KDA A;  3TP8 A;  1GUS A;  2F03 A;  5D14 A;  3VR4 A;  2O2L D;  3FDT A;  3QB3 A;  2NBF A;  3PUX A;  3DUZ A;  2ZT9 C;  1U4R A;  3GTQ B;  2F0V A;  3S9W A;  5C0X J;  2F0H A;  1RTO A;  1A3V A;  3VR2 A;  4U68 A;  5I9P A;  1DXM A;  2H1E A;  2ID0 A;  1CTM A;  1NCV A;  2BDN A;  2HDL A;  2IX3 A;  3MXN A;  4K5W A;  4QF4 A;  2E75 C;  4A3E B;  1CHQ D;  4DAV A;  4HED A;  2B2Y C;  1WCM B;  2E76 C;  1K8O A;  2K5W A;  3URY A;  2A5H A;  1LTT D;  4U67 3;  4M1U B;  1S5C D;  3BYT B;  5FOB B;  3NBH A;  4R8N A;  2MGS A;  2NUC A;  1GXD C;  1OXS C;  3S14 B;  5IOD A;  1D1I A;  1JCK B;  2X6L A;  1I4X A;  5EPK A;  4BY1 B;  3O13 A;  1EY7 A;  4F88 A;  4C2M B;  3IAY A;  4C3H B;  3KLR A;  3FEW X;  2JEA I;  2MP1 A;  4KY6 A;  1B1Z A;  1NR4 A;  2EYM A;  4IN3 A;  1RJT A;  1B50 A;  3HS0 C;  2AWO A;  1GUO A;  1AFP A;  1EL0 A;  4HN7 A;  4IFD I;  4AYB B;  3HP3 A;  4A3G B;  2LKV A;  2F0Q A;  4XQJ A;  2NN6 H;  1R9T B;  1H9R A;  1LTI D;  3DWP A;  5EKI A;  2EY6 A;  1L0Y B;  1QB5 D;  3T53 B;  1TQO A;  4KJN A;  2A69 C;  2QF7 A;  3K6O A;  1PFM A;  5IGE A;  5K5P A;  3S2D B;  4DU9 A;  3RLF A;  4XQQ A;  2D62 A;  1SNQ A;  4HMJ A;  3PUY A;  4CBV A;  1WVL A;  1EFI D;  3OSO A;  2EYH A;  4G4K A;  2PW5 A;  4RKL A;  3I8Z A;  4KN7 C;  1SYC A;  2F0J A;  2B8F A;  5C0X I;  1SE4 A;  1WD1 A;  2KHS A;  1Y8P B;  2EYO A;  2ICI A;  2JA6 B;  3C3L A;  4V19 0;  3C2P A;  4UDU C;  3BDO A;  3BDC A;  5I6W A;  3K5N A;  4RGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...