1A6XA

Structure of the apo-biotin carboxyl carrier protein (apo-bccp87) of escherichia coli acetyl-coa carboxylase, nmr, 49 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
MEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the carboxy-terminal fragment of the apo-biotin carboxyl carrier subunit of Escherichia coli acetyl-CoA carboxylase.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Carrier protein
molecule keywords APO-BIOTIN CARBOXYL CARRIER PROTEIN OF ACETYL-COA CARBOXYLAS
total genus 7
structure length 87
sequence length 87
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1998-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a6xA00
5KNBA 3BG3A 2KA7A 2EJGC 1DCZA 1SMYC 1O78A 3ND8A 1Q1EA 1A6XA 2L5TA 3BDOA 3VR6A 1EWHA 3PUZA 2JXMB 2PPBC 1GJXA 3H94A 4JBWA 3MXUA 2E75C 2IT1A 2EJFC 3VR4A 2A69D 5A35A 3RLFA 3W3AA 1Y8OB 3QG1A 1O7LA 1HPCA 1V8QA 4BA1I 1GHKA 2A6HC 3OW7A 4KHZA 5KNDA 3M4YA 1IYUA 1Y69U 3PV0A 1E2VA 1IYVA 1Q1BA 2DN8A 1FYCA 3A7LA 2D2CC 1FR3A 3M85A 2LMCB 2EDGA 2JE6I 3OPOA 2PCFB 2JEBI 1OXVA 1OXSC 2B8GA 3I4LA 2BA0A 4BA2I 1DD2A 3VR5A 1HTPA 3QIAA 1TKWB 3ND9A 1DXMA 2D5DA 2V4DA 3D4RA 3U9SA 4G7OC 2A69C 1IW7D 4G7HC 1VF5C 4PV1C 2JEAI 2A68C 1HQMC 3AB9A 4KN7C 3A8IE 3PUVA 2D62A 2O5IC 2EVBA 2A6EC 2NN6G 4KKSA 3WDNA 4OO1H 5K36H 3TZUA 2BA1A 1GUGA 3VA7A 3PUYA 4DNTB 1OXTA 1Z6HA 2E76C 1Y8PB 3OOCA 3EQLC 1H9JA 2NN6I 1CTMA 2QF7A 2EJMA 3VR2A 5BN4A 4JK1C 2O5JC 1E2WA 2DNEA 1K8OA 1ZYRC 4TKOB 1ZKOA 4OO1G 1LABA 2NN6H 5K36G 2AUKA 1H9SB 1ONLA 3GQBA 1GUOA 1V43A 1T5EA 2KCCA 1HCZA 2CW0C 1GUNA 1CI3M 3VR3A 4LJZC 2A6ED 4KKUA 3M7NA 1BDOA 1Q12A 2K7VA 4TQUS 3IFTA 4DK0A 1LACA 1I6VC 3FMCA 4KKTA 2BE5C 3T51B 3FPPA 2E74C 1Z7TA 4H44C 4I7ZC 1K8MA 1GHJA 4KN4C 3CRKC 3NE5B 3CRLC 1CFMA 1H9RA 3LWUA 4KMUC 2B8FA 2Q8IB 4G7ZC 1OXXK 4IFDG 1H9SA 1PMRA 1VCIA 3KLRA 4DK1A 4OGQC 4H13C 5JEAH 2K32A 3A8JE 1E2ZA 1Q90A 3PUWA 5BN5A 2AUJD 5KNCA 4GZYC 1GUTA 1VDZA 3HGBA 1H9MA 3IKJA 3I72A 4KI0A 4RCNA 3SDZA 2DNCA 2PNRC 1B9NA 2BDOA 3I73A 1VF7A 1TU2B 2BE5D 3MFYA 1YNNC 4IQZA 1QJOA 4XTCS 4XIGS 3P20A 1H9KA 2K33A 3T53B 5BN3A 3DXJC 2F1MA 1GUSA 5C0XG 3T56B 3N6RA 1G291 4IFDH 3SE0A 1OXUA 4DNRB 3GD7A 3L7ZC 3QJYA 3LNNA 1B9MA 5JEAG 1YNJC 4HR7B 1IW7C 4LK1C 3PUXA 4H0LC 3A8KE 2AWOA 2A68D 2R6GA 2A6HD 2ZT9C 4L8JA 3A7AB 5C0XH 3D31A 1Y8NB 2YYZA
chains in the Genus database with same CATH superfamily
1O78A 4ZYSA 3QO2A 5EBDA 4LF7Q 1YHBA 1N33L 2IT1A 4A3KH 3C1EA 4C3JG 1AE2A 1PZJD 4QUFA 4DN4M 2UXBQ 4IUUA 3M85A 4A3IG 1KRTA 1VS0A 1DM0B 1EQQA 2UUAQ 3KF8A 3ND9A 1XPRA 4H02A 2E8GA 1HA5A 1F9RA 2F3VA 1NR4A 3GTOB 2KEDA 3QR8A 4IJLA 1NBWA 2KCTA 1WOCA 4OXPA 1GUGA 1YZ6A 2N78A 3BVGA 2F0NA 3EQLC 5IYDH 2WFWA 4JBKA 3KK7A 4DA2A 3SK4A 2EYJA 1E2WA 1QZGA 1ZYRC 2CH4W 4HMJA 5ELEA 3S9WA 1HFNA 5AJ3Q 4K5VA 4K5WA 3D3RA 4LFAL 2A5HA 2R61A 3AFPA 3RUZA 2E2HH 4DV4L 5EPJA 1I6VC 1SRUA 2WKDA 3BZDB 3I4OA 4PMCA 4B9WA 1A2TA 4YCVA 4A3KB 4X64Q 2EPBA 5ELOA 3H3VI 4LF8L 2RQXA 2JA8B 5IGDA 4OWXB 3J81i 3KUPA 1CUKA 4DR2Q 4L6TB 3UI2A 1HNZL 3OTOL 1XMOQ 3E0JA 1EFWA 2DY7A 3I73A 2NVXH 3NELA 4IQZA 1QJOA 2ZXRA 3HFZB 4QF4A 4LMQD 1RJTA 3K7AH 4DF7A 2UUAL 1O7ZA 1IBKL 4A3GB 1TWGH 3GD7A 3TDQA 3W5OA 4YIJA 1CSQA 2FXQA 3J7YW 2WAQE 4H0LC 2MQHA 4EVOA 1PHJA 2QCPX 4L8JA 1SFOB 4LF7L 1Y8NB 3CCJA 2ALYB 3JAML 1B7YB 2A1AA 4RA8A 3S24A 1TR5A 3VR6A 5C4XG 1HHVA 1VQ6A 2TMPA 3MXNA 5F2DA 3K59A 1G6ZA 4A3CG 4YWMA 1V8QA 3UE1A 3H91A 1GKHA 1Q1BA 4A3MB 4LF6L 3OPOA 4FP5D 3HS0C 3I4LA 4A93B 3RZOH 2EXDA 5FOBB 2JA6G 4JC0A 2YU9B 4N9PA 3I2ZA 4B3TL 1GUWA 3OMCA 4B3TQ 3I8ZA 1XPUA 5CV9A 1LTRD 2D62A 2F52A 1JOOA 3NBHB 4DXGA 2WIIB 4JI6L 3BDCA 2LS01 3K8AA 5T1GA 2ZM6Q 2XRSD 1OXTA 3I4MH 3DMUA 1MIUA 1PH7A 2G5DA 2EJMA 3C3LA 4OIKA 4P2CB 4DV2L 3E9HA 3S2HB 3OIQA 3STBD 1I50B 3L2PA 5I9PA 4GLVB 5CBAE 4LJZC 3M7NA 2R7DA 2JJQA 3PO3G 2VUMG 1WYDA 5DM63 3NENA 4CKBA 2JA7G 4GKJQ 4JOIA 3S17H 4JI0Q 4IURA 2OQ0A 4GOPC 1KLUD 4YY3L 3MAQA 4G7ZC 1D8LA 1FGBD 1H9SA 2F0DA 1LM0A 2NTTA 1PFMA 3MXPA 4PZ8A 3PUWA 3T16A 3G6JB 3V2TA 2E5LQ 5L37A 1H9MA 1TVXA 4KI0A 2O4XA 3BZCA 2DGYA 3I72A 3PO2G 4RWSC 3D6WA 5C3EH 1KD1C 2UUCQ 4YCUA 1ENAA 5JEAJ 4DR3L 1H9KA 3PIOA 1IHZA 3I4MG 2WB1B 1UEBA 3K5MA 3CMAA 2DY8A 2EYFA 1VQGA 1PH9A 3EA6A 4LF8Q 4MTKA 5FO9B 1STAA 4CKEA 3PUXA 1I3QB 5M9OA 1EY6A 4ABNA 2D0PA 2I5LX 4ME5A 5C0XH 1F2MA 1Q8KA 4LNQA 5IOCA 1PTOB 2KA7A 2IX0A 2PYKA 1Q1EA 1EY8A 4M1UB 1STBA 1TWHH 4KD3A 1R9TH 1VQIA 5K5PA 2B29A 2A69D 1EU4A 1F77A 3BYTB 4QMGA 2F0MA 4FXGC 2DN8A 4JV5L 2D2CC 2RF4A 2AQ3B 3EFXD 2PQAA 2JEBI 2MGSA 2PO4A 5D65A 3GTPH 3F1ZA 2WAQG 4P73A 5A2QE 4K2LA 3PMFA 2JEAI 1SNMA 4OIJA 4DV5L 2Z8LA 1PZID 4LUVA 4DR5L 3I70A 3D0FA 4DFAA 1TQOA 3A74A 4XYOA 4V190 1N32L 2NUCA 3T4AC 3F8TA 4DV7L 4PG3A 4DR7Q 2XWJB 4RAUC 1XTDA 5IODA 5J1ZA 2F0TA 1K8OA 4F88A 4C1NK 5CMDA 3GTPB 3VYRA 1BO0A 4OX9Q 2JA7H 3KF6A 1GUOA 4GN5A 3HKSA 1TWFH 2N8NA 4MNOA 4DR3Q 3G48A 2MP1A 3HKZG 4DR6L 4CDEC 4MN3A 3ZJYC 3J80E 1YHQA 2MUYA 3VYTA 2QEJC 1SAPA 5C0XI 1PH5A 1XNQL 2JA7B 1STEA 3L3OC 4A3EB 1ENCA 2GA4B 3A55A 4NXNL 3CRKC 4GNXC 3LWUA 1PTOH 4AH6A 1VCIA 1WTXA 3AFQA 1L1OC 5BN5A 4AYBE 3CCUA 3HGBA 1G8ZD 1AFPA 3BU2A 1B9NA 4ZQ3A 4EGVA 1VQBA 1EYCA 1QILA 1CKNA 1QB5D 3T53B 2PI2E 1Y1VB 1B1ZA 2F1MA 2KENA 3RD4A 2SDFA 5C0XG 3VDYA 2OQKA 4UHVA 5CR3A 1VQCA 5DAUA 1RODA 1SE2A 2F0EA 1JCKB 3QJYA 1EEID 3I4NH 1OO9B 1I4RA 2RHQB 4V0BA 4LK1C 1K0SA 2R6GA 2E2JH 2B2VA 4WJ3M 1AP0A 1NAPA 1S5BD 5JPNC 3OWEB 2R93G 4RGOS 1WFQA 5KRUA 4JW0A 3S2DH 4IN3A 4O42A 2EYHA 1UE7A 1AE3A 2JXMB 3S17B 2OTLA 1RTNA 2L1BA 2ZXPA 2ICEC 4OX9L 4KJNA 5ELFA 3CCLA 5C4HA 3HOVH 5GADC 3PV0A 4IO9A 1FR3A 4ZRZA 1I50H 2F0UA 1A15A 1OXVA 3K81C 4UP9A 1EOTA 3ZYYX 1W6KA 2BDNA 4GLXA 2IX3A 1Y1VG 2A68C 2VB2X 1BCPC 5ISRA 1E1TA 3TS0A 5A2QL 5IYBG 1QZHA 1ESRA 3C2PA 3PUYA 1X32A 1SYEA 2VB3X 2R3ZA 4HTHA 2PQEA 5BN4A 3LGJA 1RDPD 3R3OA 1N9WA 3RZOB 3S1MH 3I91A 4NW2A 4I7AA 2VXWA 5HGQA 1VQOA 2UXDL 4IALA 1EIHA 1SBBB 4Y7NB 2L0CA 2L12A 2O2LD 4OO1I 1NMGA 4A3IH 4PZ7A 1IBML 1B50A 2BE5C 5EGTA 2F0JA 3KJPA 1BBWA 3KFUA 4TVAB 4LF4Q 3NBIA 2UU9Q 3NE5B 4IPHA 1QVGA 4PZ6A 2R93H 2JA8H 4X62Q 2K6AA 1B8AA 2LSSA 4OGQC 1RCVD 4UPAA 3NPPA 2B2TA 3A8JE 1SYDA 2HHHQ 3CPFA 3MVVA 3T1YQ 4QQBX 2RVLA 1S72A 2J7ZA 3U4ZA 1TU2B 2EYLA 3Q6SA 3HOXG 3K7AB 1PRTD 5AJ3L 4A3MH 4DV0L 1XYIA 1EOVA 1BQQT 2FMCA 4KTAA 3HZXA 1DOMA 1SE3A 1YJNA 1FJGL 4LFBL 3A56A 2PMZE 2ZJRA 4AYBB 1J5EQ 1HNWQ 3A8KE 5NUCA 4A3IB 1W3SA 2PZTA 5CV6A 2MNAA 1K3RA 4XT3B 1X3EA 2K03A 1Y1WG 2H4OA 3RLNA 3ICEA 1AW7A 3E6ZX 4A3BG 1VQ7A 4Q0FA 5EJWA 5CV4A 5LMNW 1HPCA 3F2UA 1PFNA 1HJPA 5T1IA 1H95A 3DWQA 1BUVT 4B3RL 4LF5Q 1C9OA 4BA2I 1SE4A 1BKBA 2K50A 4GLAC 3J81E 5JOBA 1Y14B 1F2ZA 3CCMA 2I5HA 4FXKC 1BVSA 2K1BA 4HIMA 4R4IA 1D5XC 3TBIB 2X6LA 1QNKA 3K57A 1W6JA 5IWAQ 1UEAB 2R92G 1ZKOA 3GV3A 3MFGA 3DEPA 4ZUJA 1VQMA 4QGUA 4NXNQ 5CV5A 4NDXA 2NVTB 2CW0C 1CI3M 2BH2A 4C2MH 3Q8DA 2XNAC 4F8MA 1F9SA 3CC2A 4K5XA 5LMNQ 1CT1D 4IZ8A 2TSSA 4DR6Q 3I4NB 2E74C 3FP9A 4IFDI 1GHJA 2YV5A 2WINB 1PH6A 1ESFA 5FK9C 1PMRA 2N49A 1I5FA 2B63G 4TSSA 4IUVA 2UUBQ 2IWHA 1GUTA 3RMHA 4QUCA 1S40A 3IKJA 1UE1A 3GTOH 4RHSA 4R4TA 1L0XB 4IUQA 4NXML 1UUPA 1JJ2A 1SE8A 4ZLTF 5KGUA 1VMCA 4B3MQ 4X62L 3CQZB 1E7ZA 3ER0A 1LT6D 2BH8A 3QOJA 4HEDA 4EQPA 3A7AB 4ZKBB 1E3PA 2BOSA 1FNWA 1A0IA 3M4OB 1QVCA 1LLRD 3R93A 5IP7H 4JI3Q 3S15B 2B2YC 4C3IH 2L4NA 4BWGB 1N34Q 1SNDA 2H1EA 1JOKA 5I6YA 4LFAQ 1G91A 1PTOF 2NZHA 4A3FH 2A6HC 1L1OB 1X3FA 1FL0A 1E2VA 1U9RA 2D9UA 1R4PB 1FYCA 1MKHA 4N8FA 1J8IA 3W2DA 4HJ7A 1TS4A 3MHBA 1OXSC 2BA0A 3KBXA 5D14A 1SROA 3HG9A 4O2DA 4DGZA 3S15H 1CHPD 2CVRA 1RF2D 4GN3B 5COYA 4DV3Q 2F0VA 5C4JB 1WTPA 1HQMC 3AB9A 1SR3A 4KN7C 1HZCA 1VQ9A 1QUQB 5IP9H 3CCVA 2NN6G 5C3EB 1IKLA 3J81L 1Q7YC 3SK6A 3B6YA 5CV7A 1UAPA 1E1OA 4QB4A 5E3FA 3JAMi 3MTSA 4FVMA 2JA5G 2P5ZX 3Q23A 1HTLD 4JK1C 1VMPA 3AYHB 4L63B 4JI1L 5IYCH 3M7GA 1PXUA 1HCZA 3T1HL 2EY5A 4RHRA 2Y0SE 4P75A 4CJ2C 1ET6A 1I6HB 2AQ1B 2F0KA 4LFCL 4JI2Q 4DKAC 1EFID 1JR0D 4X65L 2F0GA 4YWKA 4U673 1K8MA 4A3CH 5EBCA 2VW9A 4KN4C 5J3BA 4CHTB 3OWFA 4KMUC 4IFDG 5IWAL 5ELCA 4DV1Q 1VQDA 2EOTA 1JWUD 1AN8A 3K80C 4M8AA 1N8RC 5C5LA 5M3FG 2N88A 4OL7A 1D1KA 4XXEA 3KBGA 4E6IA 5KYLA 5JJIA 1ZXTA 3QOLA 3DWAA 1YNNC 4DK6C 1F9QA 3I90A 1YBYA 2VY3A 3G4SA 2K33A 3K58A 5DLQE 3J7A5 3T56B 4X3KA 4OWTB 1QE6A 5C5MA 2Q8TA 4ZCKA 4HAEA 5IGEA 1WVLA 4JYAL 1DOLA 3SVMA 4QIWB 2AWOA 4ZUIA 2NWGA 2WV6D 3HKZB 1PRTF 1ICWA 5GROA 1SMYC 4C3JB 4BXXH 1JB7A 4KJOA 4BBSB 3A54A 3MXUA 2QEXA 2E75C 4FDBA 4FO2A 1RL2A 1SDFA 1Z9FA 1Y8OB 2ID0A 4JBJA 1VQKA 1HR0W 3I4MB 5E4WC 1HNWL 4RG1A 3MXGA 3KLSX 3CMEA 1TWFB 4J1MA 3CQZH 2PCFB 2F03A 3IL8A 3H3VC 1TWGB 3GDEA 4L5SA 1LYLA 1DXMA 2D5DA 3HOUH 4G7OC 2V1CC 2F0OA 1IBMQ 1IW7D 3BZKA 2K5HA 3TMEA 2O5IC 3GTJH 1EZ8A 3VYUA 1BCPB 5LMUQ 2A6EC 1HNZQ 3NQTA 4KKSA 3GTQB 1JT8A 3J80L 4PNYA 3J7ZC 1CA5A 3AU7A 2HQLA 4DAYA 3VR2A 3FHWA 2CFMA 4X64L 1LT3D 5IYBH 4LF4L 1KAWA 3R2IA 4BY1G 1HXYD 3HOYG 1U5KA 5KYIA 4RMFA 1QVFA 5IIFA 1Q8IA 5M5XH 1J6QA 2Z6KA 3BVZA 2K7VA 4JOIC 1X3PA 3NQIA 3G71A 2F3WA 4LW1A 4GN4B 4S3SA 2E2HB 5IGFA 1K73C 3PF4A 1LTLA 2WB1G 4C2MB 2OXPA 4CBVA 2RSOA 3OYYA 5IT9L 3TQYA 1S4ZA 1JMCA 4GKKQ 4X6AH 2WB1E 3SGIA 1XXGA 4CKCA 2KHSA 1UWVA 4ZAIA 1TT2A 1YJ9A 4GZYC 4XQJA 3S1NH 3SDZA 1OTCA 4BBRB 2WKCA 5LL6X 4FF1A 2B2UA 2UUBL 1WTWA 4KV6A 1YJWA 3I3CA 2PW5A 1II3A 3MWYW 3BYYB 1GUSA 1KHIA 4HIDA 4JYAQ 3LNNA 3H15A 3PCOB 1HQRD 5JEAG 3OW2A 4BXXG 2VUMB 3ULJA 3NHHA 3U4VA 4DV6L 4BY1H 3OMGA 3OSOA 4DU9A 1IYJB 2JA6H 3KDFB 2KJXA 3UE0A 3K6OA 5J39A 4DUYL 3H94A 5M3MB 4N8X1 1KRSA 2XSCA 1O7LA 5E7NA 3BS1A 3GTKB 1CQVA 1DYQA 5JJLA 5C44B 2KOLA 5FLXc 1LTSD 4IOCA 3HOWH 1WD0A 3SXHA 1A62A 3A7LA 4DAPA 5AFWA 2JQOA 3KYHC 3SR1A 3VR5A 1TS2A 2JA6B 3HOZH 3A0JA 1XNQQ 4A76A 4A93G 3H0GH 1QCBD 3E9IA 1AZQA 1LO5D 3A8IE 1WTVA 4XDXA 1I4PA 3K0XA 3F2BA 2KECA 3VA7A 4RH6A 2E76C 4DAVA 3DEOA 4NPSA 3TN2A 3CW2C 2NN6I 4MZ9A 4A3BH 1CTMA 1RD9D 3R2TA 4R9WA 4LWCA 4BBRH 2HD3A 5CC4A 4F7XA 1SYBA 4TRDA 3D4DA 1STHA 1D5MC 2VNUD 4JI7L 4Q5VA 2AWNA 1EZ6A 3CC4A 3IFTA 1PLFA 3WWVA 3ERQA 1EIGA 4K0KQ 4DR1L 4A3FB 4R1JA 2YTVA 1D6EC 4XT1B 2L15A 1AEXA 2GVAA 2I46A 3CRLC 4FF4A 2B3GA 3LWEA 2PNHA 2Q2TA 4GS3A 5IT9E 1Q90A 2MPMA 4PMWA 2AQ2B 2AUJD 2QILA 1D5ZC 1FNUA 1K83H 1NCVA 2DNCA 2NZ1D 2BDOA 2JA8G 1I4HA 4R8IA 2GVBA 2G9HD 5FJ8G 2EE1A 3OTOQ 2XRQD 1XMOL 2HT1A 4XIGS 2UXDQ 1X6OA 4AQYL 1HR0L 2HCCA 4UP7A 3JAME 1KTKA 4C3JH 4LAAA 3KLWA 3FKIH 3KOJA 3EN2A 4HJ8A 2EY1A 2EYPA 2K04A 1IKMA 4B3ML 3MXNB 2A68D 2K05A 3GTQH 2CKZB 2ZT9C 1KNAA 5ELNA 2K5NA 3D8GA 2CH4A 3D31A 1TS3A 3WOFA 5IGGA 1VQ5A 2R7ZB 3ND8A 1IBLQ 3PUZA 1LUZA 4KY6A 4AIMA 3A5UA 4ZK9B 1X54A 4JPBW 5JJZA 3TRZA 3H0GG 2E2JB 2XGTA 3KJOA 3S16H 2EDGA 4WFN3 1M90C 1YNJD 2KUMA 1VQEA 1GXDC 2ICIA 3QIAA 4OONA 4DK3C 4QJFA 4EQNA 1XPOA 2A69C 3HOYH 1PTOC 5I4DA 1ASYA 1U0LA 3BVMA 4R8NA 3J81c 3I4NG 1PH3A 4K8IA 2BA1A 3K0YA 1I6HH 1TIID 1IL2A 2K14A 5D3IB 1MSGA 4BY7G 3TP8A 5KEEA 4GOPB 1XJVA 5C3XA 1EIFA 1O80A 2YTYA 1D7QA 3TEHB 2IHEA 3PSIA 2QF7A 3N52A 2O5JC 1LTAD 1JOQA 2AUKA 4J15A 5FKAC 5FJ8H 2NVQH 1MJCA 4KD4A 4POFA 1G2SA 4HCEA 4DPGA 1K0RA 4MIUA 5JPMC 1I4XA 5ELBA 2IHFA 3ONAB 1K9MC 1HH2P 4LF6Q 3DM1A 1LT5D 4R4CA 1JJGA 1PFBA 3K5OA 2KEEA 1TY2A 1M1KC 1E2ZA 2NVYH 3M3YH 5EKIA 4B9XA 3FKIG 3CU7A 2FJ2A 1UE6A 1HFGA 1NR2A 3SK8A 3HOYB 1EYGA 4RFBA 1QG7A 2GN5A 4DR4L 1WCMG 1ASZA 4GNXB 4X3TA 1OXUA 3CKIB 3CP0A 2L11A 1Y1WB 4YHHQ 4DV7Q 1I94Q 1F9PA 3UDIA 4DR7L 2B63H 4A3DB 2R92B 2VQEL 1W2BA 1DONA 1F2LA 4AYBG 3GV6A 1Q86C 1TWAH 2Z9HA 3QWNA 4XQNA 3U58A 1CZGA 4DV5Q 1EY5A 1IBLL 1BR9A 1SJHD 2XN9C 3BDOA 1EWHA 2Y0SG 2PI2A 3BDLA 5FLMG 3PGZA 5ELDA 3VA5A 1LTGD 4POGA 3W3AA 2B2YA 2IW3A 1JORA 1IL8A 3TREA 1VQ4A 1BOSA 5C4XH 3HOWB 1D2BA 2UU9L 3D4WA 1K3BC 2MHVA 1HTPA 4C3HB 4L5TA 3PIP3 3HOXH 3T13A 4G7HC 4B3SQ 2MJ8A 4ZKCB 1BXTA 4JI3L 3U50C 1CKMA 2EVBA 1EEFD 2EY6A 2QDLA 4A3BB 2B2UC 3I7FA 2ASBA 1STNA 3MZ5A 4X66Q 2F0WA 4X66L 4CDFC 1L1OA 3NEMA 2Z6BA 2NN6H 1ONLA 2I07B 2F0FA 3BJUA 2PZWA 2K5VA 4KHVA 2CCZA 3H09A 5C6AA 5IP7G 1HA6A 4R4QA 1CZWA 1L0YB 3J80c 3FMCA 3KF6B 1NY4A 5C44H 1A2UA 4HMIA 3FPPA 2FFKB 3M9BA 4A3FG 2Q8IB 2EQSA 2DJGC 1OXXK 1XWEA 3Q22A 2F0SA 2UXBL 3OIPA 3PO3H 2XIWA 4HIKA 4EQ5A 3HOVG 4IUTA 4MHEA 1C7YA 3U9OA 1WTHA 2UUCL 1KABA 2IPKD 1MSHA 3W1GA 2VUMH 2BE5D 1C4QA 4QY7A 2XTIA 3GTLH 1XNRL 5BN3A 5HGTA 5IT9c 3LX0A 4K8JA 3N6RA 1Y1VH 1B44D 1BBUA 1C48A 3L0OA 3SE0A 1VQHA 3HEJA 3MC0B 3S1QB 2JA5B 1AH9A 3E3XA 1I94L 1B9MA 3GTKH 4HR7B 3E5SA 5C3EG 3SEBA 5M3MH 1SYFA 1PH1A 1YNXA 1U4PA 4C56C 1KXLA 3JAMc 1PRTB 1G2TA 2YYZA 2MO1A 5EPLA 1PRTC 3NXWA 3GTJB 3PIO3 1VQLA 3CCSA 2PPBC 1PYWD 1PH4A 1E24A 1U4LA 2F0LA 3P75A 1WTQA 5C44G 5A35A 4DV6Q 3RLFA 4DV2Q 1MBYA 1EY9A 2F4VL 3NWSA 1Y69U 2J0TD 4HJAA 3DUZA 1DOKA 5EAYA 3H6MA 1CSPA 2ZM6L 1KLGD 2K5QA 1MD2D 1UE5A 4JI8L 3A5ZB 2RCFA 2G9DA 1MGSA 5K36H 1X3QA 4FXDA 4DNTB 1LTID 1PVOA 3IRBA 2HUGA 1RHPA 2F0IA 1T5XD 3CPWA 4GKKL 1X65A 1TY0A 2ZJQA 1JWSD 4RCOA 4F87A 3R8BA 2B2TC 4G4KA 5G3LF 2A19A 1JE5A 3S1QH 3GTGB 1GUNA 3CXCA 1KDAA 1XX8A 3NTHA 3GTLB 4GOPA 4KKUA 2C35B 2KHIA 1EL0A 2B63B 4KKTA 3EIVA 1G51A 2K4KA 3T51B 1YITA 1N36L 4DAYB 2CWAA 2RCNA 5JVH3 1B2TA 2VZAA 1V9PA 1GOZA 2Z6KC 3ERSX 1KNEA 1EY0A 1PV4A 2ZXOA 5HURA 1HNXL 2NVYB 1R4QB 1HUMA 2KVMA 1B4OA 1ENFA 4OELB 4DR2L 4YCWA 4DXFA 4JCVE 2F3IA 4OEMB 1BF4A 2QW7A 4H7BA 5FO7B 3L7ZC 4NMZA 1UNSA 2NB0A 4ME3A 4JG2A 5GAGC 2A6HD 2KBNA 1YHAA 2HIVA 4DR1Q 4KLKA 3NTIA 1QNUA 1EQTA 3URYA 4DUZQ 1SSOA 1FGUA 1EY7A 5CV8A 5M5WB 2Y0SB 4JI4Q 2CQOA 2JYOA 2QGQA 4IOAA 2RDFA 3QG1A 2VQEQ 4BA1I 2WACA 3RR5A 3PO2B 2RA4A 1C0AA 1E22A 3HRZC 2JA5H 3S14H 2IX1A 2JSOA 1A63A 2F4IA 1DD2A 1X56A 4QIWE 4K0KL 3D4RA 3S2DB 1MHWC 4A4IA 4DR4Q 2K01A 4A3LG 1VF5C 4WJWA 4DNIA 3DWPA 2A8VA 1ZEQX 1NSNS 3DLLA 4P72A 2BCOA 1WCMB 2IY5B 1V1QA 3TZUA 2F0PA 5EKLA 5M5XB 3PO3B 4KHPQ 1S5FD 5C3WA 3I55A 2R92H 5DM73 4A3DH 1L2FA 3HOXB 1Z47A 5FO8B 3RN2A 2M2LA 2VL6A 1ICFB 1A8VA 2YU9H 2C9OA 4LF9L 2B2WA 2F0HA 5CBEE 1J9OA 1EWIA 1PFSA 2EZVA 4APVA 2JK8A 2MO0A 2OT2A 3T1HQ 1S5ED 2RBMA 1KDBA 1WTRA 2CWPA 1STYA 3K5LA 3G6EA 4HCSA 1F2YA 2B8FA 4C3IB 1KDCA 4NP5A 3AQQA 3NK9A 3NBHA 1SN8A 4HN7A 1GD7A 4ALPA 1CKNB 4A75A 4X65Q 4DUYQ 1G6PA 1FVIA 1SNPA 2K5WA 3C46A 4A3JG 1QOHA 1S5DD 5BR8L 4IPGA 4XTCS 3P20A 1LTTD 4J8QA 4U68A 1EIYB 5TSSA 4A3GH 2LFNA 5C4XB 2NVTH 5I2XA 1J5EL 1FJGQ 1A3VA 1YNJC 2NZOA 3M3YB 1V1PA 5I9OA 1I3QH 1IBKQ 1YNND 4JI4L 3PQIA 1S5CD 3CF5A 2EYOA 3BG3A 3IFDA 3AMUA 1KQSA 4WJ4A 1B53A 1SMXA 4DV3L 3RN5A 2OWOA 4BS9A 3UDGA 1NJIC 2KQ3A 5H1SE 1JQYD 3FDTA 1TS5A 2L55A 4ULLA 3OW7A 3NWTA 1IYVA 4RKBA 2E2IB 3NTKA 4YWLA 2NTSA 1SEBD 1R9TB 1JWMD 4FF3A 5DEHA 1CM9A 1HUNA 4A3JB 1U4MA 3EJIA 4JI5Q 1TKWB 1A3UA 4DV4Q 1EQRA 2QKIC 3EROA 3PF5A 2EIFA 5FLXE 4B3SL 3HKZE 3L9AX 1JC7A 3ULPA 5CYUA 4I65A 1RTOA 3D6CA 3OOCA 1H9JA 3ITPA 2C5CA 5M5WH 3E0EA 4OHJA 2Q2IA 2VQFQ 4OO1G 4A3JH 1LABA 1YVCA 3KLSA 4IUNA 1Q82C 3OHXC 1V43A 3S16B 1SJED 1HR0Q 4BY7H 2OEOA 2SNMA 3VR3A 3CCQA 4L5RC 5C4ZA 4A3GG 2RHSB 4WRDA 5LMNL 2A6ED 4FF2A 4TQUS 3NUCA 1LACA 1NE3A 2E5LL 5G3LD 4I7ZC 1SNOA 1H9RA 2CQAA 4DAMA 3CCRA 2ZJPA 3TSSA 1PH8A 1P8LA 5M3FH 4H13C 2ZTDA 1WD1A 5JEAH 1SYGA 2DUDA 2K32A 4JI0L 1SNCA 3GP7A 2HDMA 4OWWB 5JVG3 2XVSA 3S1NB 5HY6A 1MI2A 4P74A 4A3KG 4C3IG 3TZDA 4CJ0B 3STBC 1VQAA 1P16A 3DXJC 1X9NA 2I5MX 3FEWX 3NSWA 2RKSA 5IE8A 4RGTA 2DJFC 3K5NA 2ATWA 3W1BA 4UDUC 3M4OH 1K83B 2JN4A 2F4VQ 1EU3A 1QUQA 1EUJA 1WJJA 3IAYA 2WAQB 1SXTA 2D0OA 4K14A 5KNBA 2EJGC 3V05A 2Z4HA 2L5TA 5IYDG 2LY7A 5M3MG 1BCPD 2NVXB 2M9VA 4JI1Q 2UXCL 4R4OA 1XMQQ 5EKKA 1KAAA 3J80i 2B2VC 2LMCB 4UP8A 5M5YB 1YI2A 1KIXA 2Q2HA 1FD7D 4PQXA 2AKWB 1C8CA 2V4DA 3U9SA 4IPCA 4FNFA 4LUOA 3S1MB 4PV1C 1SFOH 2RSNA 5GQOA 1TWCB 2ES2A 3J7AV 3WDNA 5EQ0A 4OO1H 4HSPA 2KCNA 4IUPA 3S1RB 4C1NI 3UDFA 4G57A 1WTOA 3VYSA 2IL8A 2VS1A 4J6HA 2E2DC 1V1PB 3UDXA 3HOZB 3AEVA 1BBXC 4TKOB 4BBSH 2YTXA 5K36G 1CK1A 4JBMA 4DV0Q 4K2KA 1H9SB 2L9HA 3CHBD 1CKOA 3X3MA 5EPKA 4P71A 1EYDA 1X3GA 1I4GA 2X69A 5KIXA 4FYDA 1ET9A 3T1YL 2OTJA 5FLMH 1CA6A 5LHY1 2SNSA 1XTCD 3GO5A 1HZBA 2CHBD 2MFIA 3H3VH 4BY1B 5IYCG 1Q3LA 1ML0D 2Q8RE 4AQYQ 4IFDJ 1VDZA 4EQOA 1SLJA 4BY7B 2LXJA 3P7JA 4K6LA 1HNXQ 1EWCA 5E4XA 1LTBD 2LXKA 2SEBD 1VQJA 2RDGA 2QDBA 3TP7A 2AMCB 1G291 1K28A 1GO3E 1IXRA 1YIJA 4XQQA 2N55A 4HIOA 3J81j 2N3SA 5GAEC 1D1IA 1GVPA 5M5YH 1EYAA 2IJ0A 3EVQA 1BCPF 5I2YA 5FLXL 1PA6A 1JE4A 5LMUL 1MJEA 2A73B 5E1FA 1DJRD 1RKNA 3PIPA 4HJ5A 1PYSB 3ULLA 4MTNA 1GJXA 2FHTA 1V1OA 3RLOA 4A3MG 3GTMH 2EJFC 2X6GA 4N9TA 3VR4A 3NP8A 2E2IH 4BBSG 3CCEA 2HDLA 5I6WA 1GHKA 1A3TA 4CDCC 1TWAB 4A3EH 3MEHA 5KNDA 1IYUA 3JC66 3M4PA 1PZKD 4O1NA 3FPUB 4YHHL 2I0QA 1STGA 2AHOB 2JE6I 3G7LA 2B8GA 5C4JH 1AZPA 4X3SA 5DNFA 1Y1WH 1ZYRD 2R93B 2J4XA 1VQNA 1B3AA 4C3HH 1EQVA 2NYZD 1EY4A 3PUVA 3RNUA 2CW0D 2PMZB 3Q0AA 4K6DA 4B3RQ 3CC7A 2K28A 4A3LH 4Y7NH 4HSVA 5CGKA 2FINB 1O7IA 4CGYB 3HOUB 5M3FB 2DNEA 2UXCQ 3TP5A 2NBFA 3K7UC 3I56A 1T5EA 3HOUG 3QB3A 2ZTEA 3RZDB 4LFCQ 1CHQD 1SYCA 1E0BA 4WORA 3WOEA 4QL5A 1Q12A 1BDOA 2LKVA 4DK0A 1PDQA 1ILQA 2B39A 1S3OA 2K75A 3KF8B 4H44C 3X3NA 4LF5L 2Z0SA 4A3EG 1CFMA 3GTMB 2NVQB 2KHJA 4LFBQ 4HJ9A 4IPDA 1PH2A 4RGMA 2ENBA 3O13A 3KLRA 4DK1A 2F0QA 3FRPB 3MA2B 3TP6A 5IP9G 4JVZA 4DUZL 5KNCA 5J22A 4RCNA 3HOVB 1JICA 4C3HG 4QCLA 2PNRC 1VF7A 1TXYA 2HHHL 1JJCB 3Q24A 2OF1A 1K8AC 3KDFA 4Y52H 2FMMA 4DNRB 5IY0A 2VQFL 5D3DA 3SK5A 1NNXA 1IW7C 2Z4IA 1NMFA 2M00A 1K8GA 1N32Q 3M4QA 2HIXA 4DR5Q 1LV9A 2EYMA 1DCZA 1KL9A 2KCMA 1A6XA 2PQAB 2RDHA 4JBWA 1HZAA 3S14B 4KHZA 3M4YA 3CD6A 4JV5Q 1HRJA 3DM3A 1IZ6A 3TS2A 5CORA 3C1FA 1CQFA 4IJHA 3V96A 2HQEA 1N36Q 4UAIA 3EBEA 4EX5A 2H5XA 1N34L 3FKIB 1I4QA 4X3UA 3S2HH 2XWBB 1HZ9A 3HOWG 1YEZA 2EY2A 2K5DA 2A74C 2ZTCA 4KY7A 4JI5L 1B70B 1O7YA 4L5QA 4ODGA 4BBRG 1Z6HA 1Y8PB 3S1RH 5JJKA 2QA4A 1VQ8A 1VQPA 1Q46A 1X55A 1TWCH 1VQFA 4YY3Q 1LT4D 4NKLA 1U4RA 2R7ZH 1T9HA 3GQBA 2KCCA 3HOZG 1FNVA 4RKLA 2Z1CA 4RGNA 4GNXA 4A93H 4NXMQ 4JI7Q 4A3DG 2OCEA 1NTGA 1PYBA 4JI8Q 2K52A 2B2WC 2HCIA 3SHLA 5IGBA 1ILPA 5LL6S 1M4VA 4KY5A 1Z7TA 2EXZA 4KK7A 2Q2UA 1DGSA 1XMQL 1NUCA 1RIPA 5JAVA 3J7AF 4XYQA 4GKJL 5GAHC 4JI6Q 1N33Q 2PZUA 5IGCA 3MEFA 4Z9CB 1M8AA 5BR8Q 3RZDH 2SOBA 3HP3A 1WCMH 1GM5A 3GTGH 3MFYA 4ID6A 1BNZA 1B3QA 2JP1A 3DHQA 3FVQA 1TWHB 4CJ1B 3F2CA 1QWYA 4LF9Q 3H0GB 3P1HA 1KC8C 5C0XJ 1SMYD 1DZ1A 1WI5A 4IFDH 3CAMA 4DV1L 2JA9A 2PW7A 2WP8J 1SNQA 4NB3A 3F2DA 2R7FA 4ILWA 1JB3A 1Q81C 4KHPL 2R7ZG 4B08A 1PTOD 4UY8C 3PO2H 1XNRQ 4CDDC 4LUZA 4O0AA 1L0WA 4JI2L 4PMBA
chains in the Genus database with same CATH topology
1O78A 4ZYSA 3QO2A 5EBDA 2IT1A 3C1EA 4C3JG 1PZJD 4QUFA 4DN4M 4IUUA 3M85A 1DM0B 3KF8A 3ND9A 1HA5A 1F9RA 2F3VA 1NR4A 3GTOB 2KEDA 1GUGA 3BVGA 2F0NA 3EQLC 3KK7A 4DA2A 3SK4A 2EYJA 1E2WA 1ZYRC 4HMJA 5ELEA 3S9WA 1HFNA 4K5VA 4K5WA 3D3RA 2A5HA 2R61A 3RUZA 5EPJA 1I6VC 2WKDA 3BZDB 4PMCA 4B9WA 1A2TA 4A3KB 2EPBA 2RQXA 2JA8B 5IGDA 3KUPA 4L6TB 3UI2A 3E0JA 2DY7A 3I73A 4IQZA 1QJOA 2ZXRA 4QF4A 4LMQD 1RJTA 4DF7A 1O7ZA 4A3GB 3GD7A 3TDQA 4YIJA 3J7YW 4H0LC 4EVOA 2QCPX 4L8JA 1SFOB 1Y8NB 3JAML 4RA8A 1TR5A 3VR6A 1HHVA 2TMPA 3MXNA 5F2DA 3K59A 1G6ZA 1V8QA 3H91A 1Q1BA 4A3MB 3OPOA 4FP5D 3HS0C 3I4LA 4A93B 5FOBB 2YU9B 4N9PA 1GUWA 3OMCA 3I8ZA 5CV9A 1LTRD 2D62A 1JOOA 4DXGA 2WIIB 3BDCA 2LS01 5T1GA 2XRSD 1OXTA 3DMUA 2EJMA 3C3LA 4OIKA 4P2CB 3S2HB 3OIQA 1I50B 5I9PA 5CBAE 4LJZC 3M7NA 5DM63 4CKBA 4IURA 1KLUD 3MAQA 4G7ZC 1FGBD 1H9SA 2F0DA 2NTTA 1PFMA 3MXPA 3PUWA 3T16A 3G6JB 3V2TA 1H9MA 1TVXA 2O4XA 3I72A 4KI0A 4RWSC 3D6WA 1ENAA 5JEAJ 1H9KA 1IHZA 2WB1B 3K5MA 2DY8A 2EYFA 3EA6A 5FO9B 1STAA 4CKEA 3PUXA 1I3QB 5M9OA 1EY6A 4ABNA 4ME5A 5C0XH 1F2MA 5IOCA 1PTOB 2KA7A 2IX0A 2PYKA 1Q1EA 1EY8A 4M1UB 1STBA 4KD3A 5K5PA 2A69D 1EU4A 1F77A 3BYTB 4QMGA 2F0MA 4FXGC 2DN8A 2D2CC 2AQ3B 3EFXD 2JEBI 2MGSA 2PO4A 5D65A 5A2QE 4K2LA 3PMFA 2JEAI 1SNMA 4OIJA 2Z8LA 1PZID 3I70A 4DFAA 1TQOA 4XYOA 4V190 2NUCA 3T4AC 2XWJB 4RAUC 5IODA 5J1ZA 2F0TA 1K8OA 4F88A 4C1NK 5CMDA 3GTPB 3VYRA 1BO0A 1GUOA 2MP1A 4MN3A 3J80E 2MUYA 3VYTA 2QEJC 1SAPA 5C0XI 2JA7B 1STEA 3L3OC 4A3EB 1ENCA 2GA4B 3A55A 3CRKC 3LWUA 1PTOH 1VCIA 1WTXA 5BN5A 3HGBA 1G8ZD 1AFPA 4ZQ3A 1B9NA 4EGVA 1EYCA 1QILA 1QB5D 3T53B 1Y1VB 1B1ZA 2F1MA 3RD4A 2SDFA 5C0XG 5CR3A 5DAUA 1RODA 1SE2A 2F0EA 1JCKB 3QJYA 1EEID 1OO9B 1I4RA 4V0BA 4LK1C 2R6GA 2B2VA 1AP0A 1NAPA 1S5BD 5JPNC 3OWEB 4RGOS 5KRUA 4IN3A 4O42A 2EYHA 2JXMB 3S17B 1RTNA 2L1BA 2ZXPA 2ICEC 4KJNA 5ELFA 5C4HA 3PV0A 1FR3A 4ZRZA 2F0UA 1A15A 1OXVA 1EOTA 3ZYYX 1W6KA 2BDNA 2IX3A 2A68C 2VB2X 1BCPC 5ISRA 3C2PA 5A2QL 1ESRA 3PUYA 1X32A 1SYEA 2VB3X 2R3ZA 4HTHA 2PQEA 5BN4A 1RDPD 3R3OA 3RZOB 3I91A 4NW2A 2VXWA 4IALA 1EIHA 1SBBB 4Y7NB 2L0CA 2L12A 2O2LD 4OO1I 1B50A 2BE5C 5EGTA 2F0JA 3NBIA 3NE5B 2K6AA 4OGQC 1RCVD 3NPPA 2B2TA 3A8JE 1SYDA 3MVVA 2RVLA 2J7ZA 1TU2B 2EYLA 3Q6SA 3K7AB 1PRTD 1XYIA 1BQQT 2FMCA 4KTAA 3HZXA 1DOMA 1SE3A 3A56A 4AYBB 3A8KE 5NUCA 4A3IB 2PZTA 5CV6A 4XT3B 2K03A 2H4OA 1AW7A 3E6ZX 4Q0FA 5EJWA 5CV4A 1HPCA 3F2UA 1PFNA 5T1IA 3DWQA 1BUVT 4BA2I 1SE4A 3J81E 5JOBA 1F2ZA 4FXKC 2K1BA 1D5XC 3TBIB 2X6LA 1QNKA 3K57A 1W6JA 1UEAB 1ZKOA 3GV3A 3MFGA 3DEPA 4ZUJA 5CV5A 4NDXA 2NVTB 2CW0C 1CI3M 2XNAC 4F8MA 1F9SA 4K5XA 1CT1D 4IZ8A 2TSSA 3I4NB 2E74C 4IFDI 1GHJA 2WINB 1ESFA 5FK9C 1PMRA 4TSSA 4IUVA 2IWHA 1GUTA 3RMHA 4QUCA 3IKJA 4RHSA 1L0XB 4IUQA 1UUPA 4ZLTF 5KGUA 1VMCA 3CQZB 1LT6D 3QOJA 4HEDA 4EQPA 3A7AB 4ZKBB 2BOSA 1FNWA 3M4OB 1LLRD 3R93A 3S15B 2B2YC 2L4NA 4BWGB 1SNDA 2H1EA 1JOKA 5I6YA 1G91A 1PTOF 2A6HC 1E2VA 1U9RA 2D9UA 1R4PB 1FYCA 1J8IA 3W2DA 1TS4A 3MHBA 1OXSC 2BA0A 3KBXA 5D14A 3HG9A 4DGZA 1CHPD 2CVRA 1RF2D 5COYA 1WTPA 5C4JB 2F0VA 1HQMC 3AB9A 4KN7C 2NN6G 5C3EB 1IKLA 3J81L 3SK6A 5CV7A 1UAPA 4QB4A 5E3FA 3MTSA 4FVMA 3Q23A 1HTLD 4JK1C 1VMPA 4L63B 3M7GA 1PXUA 1HCZA 2EY5A 4RHRA 4CJ2C 1ET6A 1I6HB 2AQ1B 2F0KA 1EFID 1JR0D 2F0GA 4U673 1K8MA 5EBCA 4KN4C 4CHTB 3OWFA 4KMUC 4IFDG 5ELCA 2EOTA 1JWUD 1AN8A 4M8AA 5C5LA 2N88A 4OL7A 1D1KA 4XXEA 3KBGA 4E6IA 5KYLA 1ZXTA 3QOLA 3DWAA 1YNNC 1F9QA 3I90A 2K33A 3K58A 3T56B 4X3KA 1QE6A 5C5MA 2Q8TA 4HAEA 5IGEA 1WVLA 1DOLA 3SVMA 4QIWB 2AWOA 4ZUIA 2NWGA 2WV6D 3HKZB 1PRTF 1ICWA 1SMYC 4C3JB 4KJOA 4BBSB 3A54A 3MXUA 2E75C 4FO2A 1SDFA 2ID0A 1Y8OB 3I4MB 5E4WC 3MXGA 3KLSX 1TWFB 4J1MA 2PCFB 2F03A 3IL8A 3H3VC 1TWGB 1DXMA 2D5DA 4G7OC 2F0OA 1IW7D 3TMEA 2O5IC 1EZ8A 3VYUA 1BCPB 3GTQB 2A6EC 3NQTA 4KKSA 3J80L 4PNYA 1CA5A 3AU7A 4DAYA 3VR2A 1LT3D 3R2IA 1HXYD 5KYIA 5IIFA 1Q8IA 3BVZA 2K7VA 1X3PA 3NQIA 2F3WA 4S3SA 2E2HB 5IGFA 4C2MB 2OXPA 4CBVA 2RSOA 5IT9L 1S4ZA 4CKCA 1XXGA 2KHSA 4ZAIA 1TT2A 4GZYC 4XQJA 3SDZA 4BBRB 2WKCA 5LL6X 4FF1A 2B2UA 1WTWA 4KV6A 2PW5A 3I3CA 1II3A 3BYYB 3MWYW 1GUSA 3LNNA 1HQRD 5JEAG 2VUMB 3NHHA 3OMGA 3OSOA 4DU9A 2KJXA 3K6OA 5J39A 3H94A 5M3MB 2XSCA 1O7LA 3BS1A 3GTKB 1CQVA 1DYQA 5C44B 2KOLA 1LTSD 1WD0A 3SXHA 3A7LA 4DAPA 5AFWA 3SR1A 3VR5A 1TS2A 2JA6B 1QCBD 1AZQA 1LO5D 3A8IE 1WTVA 4XDXA 1I4PA 2KECA 3VA7A 4RH6A 2E76C 4DAVA 3DEOA 3TN2A 2NN6I 1CTMA 1RD9D 3R2TA 4R9WA 5CC4A 4F7XA 1SYBA 4TRDA 3D4DA 1STHA 1D5MC 2VNUD 4Q5VA 2AWNA 1EZ6A 3IFTA 1PLFA 3ERQA 1EIGA 4A3FB 1D6EC 4XT1B 1AEXA 2I46A 3CRLC 4FF4A 3LWEA 5IT9E 1Q90A 2MPMA 4PMWA 2AQ2B 2AUJD 2QILA 1D5ZC 1FNUA 1NCVA 2DNCA 2NZ1D 2BDOA 1I4HA 4R8IA 2G9HD 2EE1A 2XRQD 4XIGS 2HCCA 3JAME 1KTKA 4LAAA 2EY1A 2EYPA 1IKMA 2A68D 2K05A 2ZT9C 1KNAA 3D8GA 3D31A 1TS3A 3WOFA 5IGGA 2R7ZB 3ND8A 3PUZA 4KY6A 4ZK9B 5JJZA 2E2JB 2EDGA 4WFN3 1YNJD 2KUMA 1GXDC 2ICIA 3QIAA 4EQNA 2A69C 1PTOC 5I4DA 3BVMA 4R8NA 4K8IA 2BA1A 3K0YA 1TIID 5D3IB 1MSGA 3TP8A 5KEEA 5C3XA 1O80A 2QF7A 3N52A 2O5JC 1LTAD 1JOQA 2AUKA 5FKAC 4KD4A 1G2SA 4HCEA 4MIUA 5JPMC 1I4XA 5ELBA 3ONAB 3DM1A 1LT5D 1PFBA 3K5OA 2KEEA 1TY2A 1E2ZA 5EKIA 4B9XA 3CU7A 2FJ2A 1HFGA 1NR2A 3SK8A 3HOYB 4RFBA 1QG7A 4X3TA 1OXUA 3CKIB 2L11A 1Y1WB 1F9PA 4A3DB 2R92B 1DONA 1F2LA 3GV6A 3QWNA 4XQNA 1CZGA 1EY5A 1BR9A 1SJHD 2XN9C 3BDOA 1EWHA 3BDLA 5ELDA 3VA5A 1LTGD 3W3AA 2B2YA 2IW3A 1JORA 1IL8A 1BOSA 3HOWB 1D2BA 3D4WA 2MHVA 1HTPA 4C3HB 3PIP3 3T13A 4G7HC 2MJ8A 4ZKCB 1BXTA 2EVBA 2EY6A 1EEFD 4A3BB 2B2UC 1STNA 3MZ5A 2F0WA 2NN6H 1ONLA 2I07B 2F0FA 2PZWA 4KHVA 3H09A 5C6AA 1HA6A 1CZWA 1L0YB 3FMCA 1A2UA 4HMIA 3FPPA 2FFKB 2Q8IB 1OXXK 1XWEA 3Q22A 2F0SA 3OIPA 2XIWA 4IUTA 4MHEA 3U9OA 1KABA 2IPKD 1MSHA 2BE5D 1C4QA 5BN3A 5HGTA 3LX0A 4K8JA 3N6RA 1B44D 1C48A 2JA5B 3SE0A 3MC0B 3HEJA 3S1QB 1B9MA 4HR7B 3E5SA 3SEBA 1SYFA 1U4PA 4C56C 1PRTB 1G2TA 2YYZA 5EPLA 1PRTC 3NXWA 3GTJB 3PIO3 2PPBC 1PYWD 3P75A 1U4LA 2F0LA 1WTQA 5A35A 3RLFA 1MBYA 1EY9A 3NWSA 1Y69U 2J0TD 3DUZA 1DOKA 3H6MA 1KLGD 2K5QA 1MD2D 2G9DA 1MGSA 5K36H 1X3QA 4FXDA 4DNTB 1LTID 2HUGA 1RHPA 2F0IA 1T5XD 1TY0A 1JWSD 4RCOA 4F87A 3R8BA 2B2TC 4G4KA 5G3LF 3GTGB 1GUNA 1KDAA 1XX8A 3NTHA 3GTLB 4KKUA 1EL0A 2B63B 4KKTA 3T51B 5JVH3 1B2TA 1GOZA 1KNEA 1EY0A 2ZXOA 5HURA 2NVYB 1R4QB 1HUMA 2KVMA 1B4OA 1ENFA 4DXFA 1BF4A 4H7BA 5FO7B 3L7ZC 4NMZA 1UNSA 2NB0A 2A6HD 3NTIA 1QNUA 1EQTA 3URYA 1SSOA 1EY7A 5CV8A 5M5WB 2Y0SB 2JYOA 2RDFA 3QG1A 4BA1I 2WACA 3PO2B 2RA4A 3HRZC 2IX1A 2JSOA 2F4IA 1DD2A 3D4RA 3S2DB 2K01A 1VF5C 4WJWA 3DWPA 1ZEQX 1NSNS 2BCOA 1WCMB 3TZUA 2F0PA 5EKLA 5M5XB 3PO3B 1S5FD 5C3WA 5DM73 3HOXB 1Z47A 5FO8B 2M2LA 2C9OA 2B2WA 2F0HA 5CBEE 1J9OA 2EZVA 2OT2A 1S5ED 2RBMA 1WTRA 1KDBA 1STYA 3K5LA 4HCSA 1F2YA 2B8FA 4C3IB 1KDCA 4NP5A 3NK9A 3NBHA 4HN7A 1SNPA 2K5WA 3C46A 1QOHA 1S5DD 4XTCS 1LTTD 3P20A 4J8QA 4U68A 5TSSA 2LFNA 5C4XB 5I2XA 1A3VA 1YNJC 3M3YB 1V1PA 5I9OA 1YNND 1S5CD 2EYOA 3BG3A 3IFDA 3AMUA 1B53A 4BS9A 2KQ3A 1JQYD 3FDTA 1TS5A 2L55A 4ULLA 3OW7A 3NWTA 1IYVA 4RKBA 2E2IB 3NTKA 2NTSA 1SEBD 1R9TB 1JWMD 4FF3A 5DEHA 1CM9A 1HUNA 4A3JB 1U4MA 3EJIA 1TKWB 1A3UA 2QKIC 3EROA 5FLXE 3L9AX 1JC7A 5CYUA 4I65A 1RTOA 3D6CA 3OOCA 1H9JA 3ITPA 2C5CA 4OHJA 4OO1G 1LABA 3KLSA 4IUNA 3OHXC 1V43A 3S16B 1SJED 2OEOA 2SNMA 3VR3A 5C4ZA 4WRDA 2A6ED 4FF2A 4TQUS 3NUCA 1LACA 5G3LD 4I7ZC 1SNOA 1H9RA 2CQAA 3TSSA 1WD1A 4H13C 5JEAH 1SYGA 2K32A 1SNCA 3GP7A 2HDMA 5JVG3 2XVSA 3S1NB 1MI2A 4C3IG 3TZDA 4CJ0B 3DXJC 3FEWX 3NSWA 2RKSA 4RGTA 3K5NA 4UDUC 1K83B 1EU3A 3IAYA 2WAQB 1SXTA 4K14A 5KNBA 2EJGC 3V05A 2Z4HA 2L5TA 2LY7A 1BCPD 2NVXB 2M9VA 5EKKA 1KAAA 2B2VC 2LMCB 5M5YB 1FD7D 4PQXA 1C8CA 2V4DA 3U9SA 4FNFA 3S1MB 4PV1C 2RSNA 1TWCB 3J7AV 3WDNA 5EQ0A 4OO1H 4HSPA 2KCNA 4IUPA 3S1RB 4C1NI 4G57A 1WTOA 3VYSA 2IL8A 4J6HA 2E2DC 1V1PB 3HOZB 1BBXC 4TKOB 5K36G 1CK1A 4K2KA 1H9SB 2L9HA 3CHBD 3X3MA 5EPKA 1EYDA 1I4GA 2X69A 5KIXA 4FYDA 1ET9A 1CA6A 5LHY1 2SNSA 1XTCD 3GO5A 2CHBD 4BY1B 1Q3LA 1ML0D 2Q8RE 4IFDJ 1VDZA 4EQOA 4BY7B 3P7JA 4K6LA 1EWCA 5E4XA 1LTBD 2SEBD 2RDGA 2QDBA 3TP7A 1G291 4XQQA 2N55A 1D1IA 1EYAA 2IJ0A 3EVQA 1BCPF 5I2YA 5FLXL 1JE4A 2A73B 5E1FA 1DJRD 1RKNA 1GJXA 2FHTA 1V1OA 2EJFC 2X6GA 4N9TA 3VR4A 3NP8A 2HDLA 5I6WA 1GHKA 1A3TA 1TWAB 3MEHA 5KNDA 1IYUA 4O1NA 1PZKD 3FPUB 1STGA 2JE6I 3G7LA 2B8GA 1AZPA 4X3SA 5DNFA 1ZYRD 2R93B 2J4XA 1B3AA 1EQVA 2NYZD 1EY4A 3PUVA 2CW0D 2PMZB 3Q0AA 4K6DA 2K28A 4HSVA 5CGKA 2FINB 4CGYB 3HOUB 5M3FB 2DNEA 3TP5A 2NBFA 1T5EA 3QB3A 3RZDB 1CHQD 1SYCA 1E0BA 4WORA 3WOEA 1Q12A 1BDOA 4DK0A 2LKVA 1PDQA 1ILQA 2B39A 4H44C 3X3NA 1CFMA 3GTMB 2NVQB 4RGMA 2ENBA 3O13A 3KLRA 4DK1A 2F0QA 3FRPB 3MA2B 3TP6A 5KNCA 5J22A 4RCNA 3HOVB 1JICA 4C3HG 4QCLA 2PNRC 1VF7A 3Q24A 2OF1A 2FMMA 4DNRB 5D3DA 3SK5A 1IW7C 2Z4IA 2M00A 1LV9A 2EYMA 1DCZA 1A6XA 2RDHA 4JBWA 3S14B 4KHZA 3M4YA 1HRJA 5CORA 3C1FA 1CQFA 3V96A 2HQEA 4UAIA 3FKIB 1I4QA 4X3UA 2XWBB 2EY2A 2K5DA 2A74C 4KY7A 1O7YA 4ODGA 1Z6HA 1Y8PB 1LT4D 4NKLA 1U4RA 3GQBA 2KCCA 1FNVA 4RKLA 2Z1CA 4RGNA 2B2WC 2HCIA 3SHLA 5IGBA 1ILPA 5LL6S 1M4VA 4KY5A 1Z7TA 2EXZA 4KK7A 1NUCA 5JAVA 3J7AF 4XYQA 2PZUA 5IGCA 4Z9CB 1M8AA 2SOBA 3HP3A 3MFYA 4ID6A 1BNZA 2JP1A 3DHQA 3FVQA 1TWHB 4CJ1B 1QWYA 3H0GB 3P1HA 5C0XJ 1SMYD 1DZ1A 4IFDH 2PW7A 2WP8J 1SNQA 4ILWA 1JB3A 4B08A 1PTOD 2K04A 4PMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KNB A;  3BG3 A;  2KA7 A;  2EJG C;  1DCZ A;  1SMY C;  1O78 A;  3ND8 A;  1Q1E A;  1A6X A;  2L5T A;  3BDO A;  3VR6 A;  1EWH A;  3PUZ A;  2JXM B;  2PPB C;  1GJX A;  3H94 A;  4JBW A;  3MXU A;  2E75 C;  2IT1 A;  2EJF C;  3VR4 A;  2A69 D;  5A35 A;  3RLF A;  3W3A A;  1Y8O B;  3QG1 A;  1O7L A;  1HPC A;  1V8Q A;  4BA1 I;  1GHK A;  2A6H C;  3OW7 A;  4KHZ A;  5KND A;  3M4Y A;  1IYU A;  1Y69 U;  3PV0 A;  1E2V A;  1IYV A;  1Q1B A;  2DN8 A;  1FYC A;  3A7L A;  2D2C C;  1FR3 A;  3M85 A;  2LMC B;  2EDG A;  2JE6 I;  3OPO A;  2PCF B;  2JEB I;  1OXV A;  1OXS C;  2B8G A;  3I4L A;  2BA0 A;  4BA2 I;  1DD2 A;  3VR5 A;  1HTP A;  3QIA A;  1TKW B;  3ND9 A;  1DXM A;  2D5D A;  2V4D A;  3D4R A;  3U9S A;  4G7O C;  2A69 C;  1IW7 D;  4G7H C;  1VF5 C;  4PV1 C;  2JEA I;  2A68 C;  1HQM C;  3AB9 A;  4KN7 C;  3A8I E;  3PUV A;  2D62 A;  2O5I C;  2EVB A;  2A6E C;  2NN6 G;  4KKS A;  3WDN A;  4OO1 H;  5K36 H;  3TZU A;  2BA1 A;  1GUG A;  3VA7 A;  3PUY A;  4DNT B;  1OXT A;  1Z6H A;  2E76 C;  1Y8P B;  3OOC A;  3EQL C;  1H9J A;  2NN6 I;  1CTM A;  2QF7 A;  2EJM A;  3VR2 A;  5BN4 A;  4JK1 C;  2O5J C;  1E2W A;  2DNE A;  1K8O A;  1ZYR C;  4TKO B;  1ZKO A;  4OO1 G;  1LAB A;  2NN6 H;  5K36 G;  2AUK A;  1H9S B;  1ONL A;  3GQB A;  1GUO A;  1V43 A;  1T5E A;  2KCC A;  1HCZ A;  2CW0 C;  1GUN A;  1CI3 M;  3VR3 A;  4LJZ C;  2A6E D;  4KKU A;  3M7N A;  1BDO A;  1Q12 A;  2K7V A;  4TQU S;  3IFT A;  4DK0 A;  1LAC A;  1I6V C;  3FMC A;  4KKT A;  2BE5 C;  3T51 B;  3FPP A;  2E74 C;  1Z7T A;  4H44 C;  4I7Z C;  1K8M A;  1GHJ A;  4KN4 C;  3CRK C;  3NE5 B;  3CRL C;  1CFM A;  1H9R A;  3LWU A;  4KMU C;  2B8F A;  2Q8I B;  4G7Z C;  1OXX K;  4IFD G;  1H9S A;  1PMR A;  1VCI A;  3KLR A;  4DK1 A;  4OGQ C;  4H13 C;  5JEA H;  2K32 A;  3A8J E;  1E2Z A;  1Q90 A;  3PUW A;  5BN5 A;  2AUJ D;  5KNC A;  4GZY C;  1GUT A;  1VDZ A;  3HGB A;  1H9M A;  3IKJ A;  3I72 A;  4KI0 A;  4RCN A;  3SDZ A;  2DNC A;  2PNR C;  1B9N A;  2BDO A;  3I73 A;  1VF7 A;  1TU2 B;  2BE5 D;  3MFY A;  1YNN C;  4IQZ A;  1QJO A;  4XTC S;  4XIG S;  3P20 A;  1H9K A;  2K33 A;  3T53 B;  5BN3 A;  3DXJ C;  2F1M A;  1GUS A;  5C0X G;  3T56 B;  3N6R A;  1G29 1;  4IFD H;  3SE0 A;  1OXU A;  4DNR B;  3GD7 A;  3L7Z C;  3QJY A;  3LNN A;  1B9M A;  5JEA G;  1YNJ C;  4HR7 B;  1IW7 C;  4LK1 C;  3PUX A;  4H0L C;  3A8K E;  2AWO A;  2A68 D;  2R6G A;  2A6H D;  2ZT9 C;  4L8J A;  3A7A B;  5C0X H;  3D31 A;  1Y8N B;  2YYZ A; 
#chains in the Genus database with same CATH topology
 1O78 A;  4ZYS A;  3QO2 A;  5EBD A;  4LF7 Q;  1YHB A;  1N33 L;  2IT1 A;  4A3K H;  3C1E A;  4C3J G;  1AE2 A;  1PZJ D;  4QUF A;  4DN4 M;  2UXB Q;  4IUU A;  3M85 A;  4A3I G;  1KRT A;  1VS0 A;  1DM0 B;  1EQQ A;  2UUA Q;  3KF8 A;  3ND9 A;  1XPR A;  4H02 A;  2E8G A;  1HA5 A;  1F9R A;  2F3V A;  1NR4 A;  3GTO B;  2KED A;  3QR8 A;  4IJL A;  1NBW A;  2KCT A;  1WOC A;  4OXP A;  1GUG A;  1YZ6 A;  2N78 A;  3BVG A;  2F0N A;  3EQL C;  5IYD H;  2WFW A;  4JBK A;  3KK7 A;  4DA2 A;  3SK4 A;  2EYJ A;  1E2W A;  1QZG A;  1ZYR C;  2CH4 W;  4HMJ A;  5ELE A;  3S9W A;  1HFN A;  5AJ3 Q;  4K5V A;  4K5W A;  3D3R A;  4LFA L;  2A5H A;  2R61 A;  3AFP A;  3RUZ A;  2E2H H;  4DV4 L;  5EPJ A;  1I6V C;  1SRU A;  2WKD A;  3BZD B;  3I4O A;  4PMC A;  4B9W A;  1A2T A;  4YCV A;  4A3K B;  4X64 Q;  2EPB A;  5ELO A;  3H3V I;  4LF8 L;  2RQX A;  2JA8 B;  5IGD A;  4OWX B;  3J81 i;  3KUP A;  1CUK A;  4DR2 Q;  4L6T B;  3UI2 A;  1HNZ L;  3OTO L;  1XMO Q;  3E0J A;  1EFW A;  2DY7 A;  3I73 A;  2NVX H;  3NEL A;  4IQZ A;  1QJO A;  2ZXR A;  3HFZ B;  4QF4 A;  4LMQ D;  1RJT A;  3K7A H;  4DF7 A;  2UUA L;  1O7Z A;  1IBK L;  4A3G B;  1TWG H;  3GD7 A;  3TDQ A;  3W5O A;  4YIJ A;  1CSQ A;  2FXQ A;  3J7Y W;  2WAQ E;  4H0L C;  2MQH A;  4EVO A;  1PHJ A;  2QCP X;  4L8J A;  1SFO B;  4LF7 L;  1Y8N B;  3CCJ A;  2ALY B;  3JAM L;  1B7Y B;  2A1A A;  4RA8 A;  3S24 A;  1TR5 A;  3VR6 A;  5C4X G;  1HHV A;  1VQ6 A;  2TMP A;  3MXN A;  5F2D A;  3K59 A;  1G6Z A;  4A3C G;  4YWM A;  1V8Q A;  3UE1 A;  3H91 A;  1GKH A;  1Q1B A;  4A3M B;  4LF6 L;  3OPO A;  4FP5 D;  3HS0 C;  3I4L A;  4A93 B;  3RZO H;  2EXD A;  5FOB B;  2JA6 G;  4JC0 A;  2YU9 B;  4N9P A;  3I2Z A;  4B3T L;  1GUW A;  3OMC A;  4B3T Q;  3I8Z A;  1XPU A;  5CV9 A;  1LTR D;  2D62 A;  2F52 A;  1JOO A;  3NBH B;  4DXG A;  2WII B;  4JI6 L;  3BDC A;  2LS0 1;  3K8A A;  5T1G A;  2ZM6 Q;  2XRS D;  1OXT A;  3I4M H;  3DMU A;  1MIU A;  1PH7 A;  2G5D A;  2EJM A;  3C3L A;  4OIK A;  4P2C B;  4DV2 L;  3E9H A;  3S2H B;  3OIQ A;  3STB D;  1I50 B;  3L2P A;  5I9P A;  4GLV B;  5CBA E;  4LJZ C;  3M7N A;  2R7D A;  2JJQ A;  3PO3 G;  2VUM G;  1WYD A;  5DM6 3;  3NEN A;  4CKB A;  2JA7 G;  4GKJ Q;  4JOI A;  3S17 H;  4JI0 Q;  4IUR A;  2OQ0 A;  4GOP C;  1KLU D;  4YY3 L;  3MAQ A;  4G7Z C;  1D8L A;  1FGB D;  1H9S A;  2F0D A;  1LM0 A;  2NTT A;  1PFM A;  3MXP A;  4PZ8 A;  3PUW A;  3T16 A;  3G6J B;  3V2T A;  2E5L Q;  5L37 A;  1H9M A;  1TVX A;  4KI0 A;  2O4X A;  3BZC A;  2DGY A;  3I72 A;  3PO2 G;  4RWS C;  3D6W A;  5C3E H;  1KD1 C;  2UUC Q;  4YCU A;  1ENA A;  5JEA J;  4DR3 L;  1H9K A;  3PIO A;  1IHZ A;  3I4M G;  2WB1 B;  1UEB A;  3K5M A;  3CMA A;  2DY8 A;  2EYF A;  1VQG A;  1PH9 A;  3EA6 A;  4LF8 Q;  4MTK A;  5FO9 B;  1STA A;  4CKE A;  3PUX A;  1I3Q B;  5M9O A;  1EY6 A;  4ABN A;  2D0P A;  2I5L X;  4ME5 A;  5C0X H;  1F2M A;  1Q8K A;  4LNQ A;  5IOC A;  1PTO B;  2KA7 A;  2IX0 A;  2PYK A;  1Q1E A;  1EY8 A;  4M1U B;  1STB A;  1TWH H;  4KD3 A;  1R9T H;  1VQI A;  5K5P A;  2B29 A;  2A69 D;  1EU4 A;  1F77 A;  3BYT B;  4QMG A;  2F0M A;  4FXG C;  2DN8 A;  4JV5 L;  2D2C C;  2RF4 A;  2AQ3 B;  3EFX D;  2PQA A;  2JEB I;  2MGS A;  2PO4 A;  5D65 A;  3GTP H;  3F1Z A;  2WAQ G;  4P73 A;  5A2Q E;  4K2L A;  3PMF A;  2JEA I;  1SNM A;  4OIJ A;  4DV5 L;  2Z8L A;  1PZI D;  4LUV A;  4DR5 L;  3I70 A;  3D0F A;  4DFA A;  1TQO A;  3A74 A;  4XYO A;  4V19 0;  1N32 L;  2NUC A;  3T4A C;  3F8T A;  4DV7 L;  4PG3 A;  4DR7 Q;  2XWJ B;  4RAU C;  1XTD A;  5IOD A;  5J1Z A;  2F0T A;  1K8O A;  4F88 A;  4C1N K;  5CMD A;  3GTP B;  3VYR A;  1BO0 A;  4OX9 Q;  2JA7 H;  3KF6 A;  1GUO A;  4GN5 A;  3HKS A;  1TWF H;  2N8N A;  4MNO A;  4DR3 Q;  3G48 A;  2MP1 A;  3HKZ G;  4DR6 L;  4CDE C;  4MN3 A;  3ZJY C;  3J80 E;  1YHQ A;  2MUY A;  3VYT A;  2QEJ C;  1SAP A;  5C0X I;  1PH5 A;  1XNQ L;  2JA7 B;  1STE A;  3L3O C;  4A3E B;  1ENC A;  2GA4 B;  3A55 A;  4NXN L;  3CRK C;  4GNX C;  3LWU A;  1PTO H;  4AH6 A;  1VCI A;  1WTX A;  3AFQ A;  1L1O C;  5BN5 A;  4AYB E;  3CCU A;  3HGB A;  1G8Z D;  1AFP A;  3BU2 A;  1B9N A;  4ZQ3 A;  4EGV A;  1VQB A;  1EYC A;  1QIL A;  1CKN A;  1QB5 D;  3T53 B;  2PI2 E;  1Y1V B;  1B1Z A;  2F1M A;  2KEN A;  3RD4 A;  2SDF A;  5C0X G;  3VDY A;  2OQK A;  4UHV A;  5CR3 A;  1VQC A;  5DAU A;  1ROD A;  1SE2 A;  2F0E A;  1JCK B;  3QJY A;  1EEI D;  3I4N H;  1OO9 B;  1I4R A;  2RHQ B;  4V0B A;  4LK1 C;  1K0S A;  2R6G A;  2E2J H;  2B2V A;  4WJ3 M;  1AP0 A;  1NAP A;  1S5B D;  5JPN C;  3OWE B;  2R93 G;  4RGO S;  1WFQ A;  5KRU A;  4JW0 A;  3S2D H;  4IN3 A;  4O42 A;  2EYH A;  1UE7 A;  1AE3 A;  2JXM B;  3S17 B;  2OTL A;  1RTN A;  2L1B A;  2ZXP A;  2ICE C;  4OX9 L;  4KJN A;  5ELF A;  3CCL A;  5C4H A;  3HOV H;  5GAD C;  3PV0 A;  4IO9 A;  1FR3 A;  4ZRZ A;  1I50 H;  2F0U A;  1A15 A;  1OXV A;  3K81 C;  4UP9 A;  1EOT A;  3ZYY X;  1W6K A;  2BDN A;  4GLX A;  2IX3 A;  1Y1V G;  2A68 C;  2VB2 X;  1BCP C;  5ISR A;  1E1T A;  3TS0 A;  5A2Q L;  5IYB G;  1QZH A;  1ESR A;  3C2P A;  3PUY A;  1X32 A;  1SYE A;  2VB3 X;  2R3Z A;  4HTH A;  2PQE A;  5BN4 A;  3LGJ A;  1RDP D;  3R3O A;  1N9W A;  3RZO B;  3S1M H;  3I91 A;  4NW2 A;  4I7A A;  2VXW A;  5HGQ A;  1VQO A;  2UXD L;  4IAL A;  1EIH A;  1SBB B;  4Y7N B;  2L0C A;  2L12 A;  2O2L D;  4OO1 I;  1NMG A;  4A3I H;  4PZ7 A;  1IBM L;  1B50 A;  2BE5 C;  5EGT A;  2F0J A;  3KJP A;  1BBW A;  3KFU A;  4TVA B;  4LF4 Q;  3NBI A;  2UU9 Q;  3NE5 B;  4IPH A;  1QVG A;  4PZ6 A;  2R93 H;  2JA8 H;  4X62 Q;  2K6A A;  1B8A A;  2LSS A;  4OGQ C;  1RCV D;  4UPA A;  3NPP A;  2B2T A;  3A8J E;  1SYD A;  2HHH Q;  3CPF A;  3MVV A;  3T1Y Q;  4QQB X;  2RVL A;  1S72 A;  2J7Z A;  3U4Z A;  1TU2 B;  2EYL A;  3Q6S A;  3HOX G;  3K7A B;  1PRT D;  5AJ3 L;  4A3M H;  4DV0 L;  1XYI A;  1EOV A;  1BQQ T;  2FMC A;  4KTA A;  3HZX A;  1DOM A;  1SE3 A;  1YJN A;  1FJG L;  4LFB L;  3A56 A;  2PMZ E;  2ZJR A;  4AYB B;  1J5E Q;  1HNW Q;  3A8K E;  5NUC A;  4A3I B;  1W3S A;  2PZT A;  5CV6 A;  2MNA A;  1K3R A;  4XT3 B;  1X3E A;  2K03 A;  1Y1W G;  2H4O A;  3RLN A;  3ICE A;  1AW7 A;  3E6Z X;  4A3B G;  1VQ7 A;  4Q0F A;  5EJW A;  5CV4 A;  5LMN W;  1HPC A;  3F2U A;  1PFN A;  1HJP A;  5T1I A;  1H95 A;  3DWQ A;  1BUV T;  4B3R L;  4LF5 Q;  1C9O A;  4BA2 I;  1SE4 A;  1BKB A;  2K50 A;  4GLA C;  3J81 E;  5JOB A;  1Y14 B;  1F2Z A;  3CCM A;  2I5H A;  4FXK C;  1BVS A;  2K1B A;  4HIM A;  4R4I A;  1D5X C;  3TBI B;  2X6L A;  1QNK A;  3K57 A;  1W6J A;  5IWA Q;  1UEA B;  2R92 G;  1ZKO A;  3GV3 A;  3MFG A;  3DEP A;  4ZUJ A;  1VQM A;  4QGU A;  4NXN Q;  5CV5 A;  4NDX A;  2NVT B;  2CW0 C;  1CI3 M;  2BH2 A;  4C2M H;  3Q8D A;  2XNA C;  4F8M A;  1F9S A;  3CC2 A;  4K5X A;  5LMN Q;  1CT1 D;  4IZ8 A;  2TSS A;  4DR6 Q;  3I4N B;  2E74 C;  3FP9 A;  4IFD I;  1GHJ A;  2YV5 A;  2WIN B;  1PH6 A;  1ESF A;  5FK9 C;  1PMR A;  2N49 A;  1I5F A;  2B63 G;  4TSS A;  4IUV A;  2UUB Q;  2IWH A;  1GUT A;  3RMH A;  4QUC A;  1S40 A;  3IKJ A;  1UE1 A;  3GTO H;  4RHS A;  4R4T A;  1L0X B;  4IUQ A;  4NXM L;  1UUP A;  1JJ2 A;  1SE8 A;  4ZLT F;  5KGU A;  1VMC A;  4B3M Q;  4X62 L;  3CQZ B;  1E7Z A;  3ER0 A;  1LT6 D;  2BH8 A;  3QOJ A;  4HED A;  4EQP A;  3A7A B;  4ZKB B;  1E3P A;  2BOS A;  1FNW A;  1A0I A;  3M4O B;  1QVC A;  1LLR D;  3R93 A;  5IP7 H;  4JI3 Q;  3S15 B;  2B2Y C;  4C3I H;  2L4N A;  4BWG B;  1N34 Q;  1SND A;  2H1E A;  1JOK A;  5I6Y A;  4LFA Q;  1G91 A;  1PTO F;  2NZH A;  4A3F H;  2A6H C;  1L1O B;  1X3F A;  1FL0 A;  1E2V A;  1U9R A;  2D9U A;  1R4P B;  1FYC A;  1MKH A;  4N8F A;  1J8I A;  3W2D A;  4HJ7 A;  1TS4 A;  3MHB A;  1OXS C;  2BA0 A;  3KBX A;  5D14 A;  1SRO A;  3HG9 A;  4O2D A;  4DGZ A;  3S15 H;  1CHP D;  2CVR A;  1RF2 D;  4GN3 B;  5COY A;  4DV3 Q;  2F0V A;  5C4J B;  1WTP A;  1HQM C;  3AB9 A;  1SR3 A;  4KN7 C;  1HZC A;  1VQ9 A;  1QUQ B;  5IP9 H;  3CCV A;  2NN6 G;  5C3E B;  1IKL A;  3J81 L;  1Q7Y C;  3SK6 A;  3B6Y A;  5CV7 A;  1UAP A;  1E1O A;  4QB4 A;  5E3F A;  3JAM i;  3MTS A;  4FVM A;  2JA5 G;  2P5Z X;  3Q23 A;  1HTL D;  4JK1 C;  1VMP A;  3AYH B;  4L63 B;  4JI1 L;  5IYC H;  3M7G A;  1PXU A;  1HCZ A;  3T1H L;  2EY5 A;  4RHR A;  2Y0S E;  4P75 A;  4CJ2 C;  1ET6 A;  1I6H B;  2AQ1 B;  2F0K A;  4LFC L;  4JI2 Q;  4DKA C;  1EFI D;  1JR0 D;  4X65 L;  2F0G A;  4YWK A;  4U67 3;  1K8M A;  4A3C H;  5EBC A;  2VW9 A;  4KN4 C;  5J3B A;  4CHT B;  3OWF A;  4KMU C;  4IFD G;  5IWA L;  5ELC A;  4DV1 Q;  1VQD A;  2EOT A;  1JWU D;  1AN8 A;  3K80 C;  4M8A A;  1N8R C;  5C5L A;  5M3F G;  2N88 A;  4OL7 A;  1D1K A;  4XXE A;  3KBG A;  4E6I A;  5KYL A;  5JJI A;  1ZXT A;  3QOL A;  3DWA A;  1YNN C;  4DK6 C;  1F9Q A;  3I90 A;  1YBY A;  2VY3 A;  3G4S A;  2K33 A;  3K58 A;  5DLQ E;  3J7A 5;  3T56 B;  4X3K A;  4OWT B;  1QE6 A;  5C5M A;  2Q8T A;  4ZCK A;  4HAE A;  5IGE A;  1WVL A;  4JYA L;  1DOL A;  3SVM A;  4QIW B;  2AWO A;  4ZUI A;  2NWG A;  2WV6 D;  3HKZ B;  1PRT F;  1ICW A;  5GRO A;  1SMY C;  4C3J B;  4BXX H;  1JB7 A;  4KJO A;  4BBS B;  3A54 A;  3MXU A;  2QEX A;  2E75 C;  4FDB A;  4FO2 A;  1RL2 A;  1SDF A;  1Z9F A;  1Y8O B;  2ID0 A;  4JBJ A;  1VQK A;  1HR0 W;  3I4M B;  5E4W C;  1HNW L;  4RG1 A;  3MXG A;  3KLS X;  3CME A;  1TWF B;  4J1M A;  3CQZ H;  2PCF B;  2F03 A;  3IL8 A;  3H3V C;  1TWG B;  3GDE A;  4L5S A;  1LYL A;  1DXM A;  2D5D A;  3HOU H;  4G7O C;  2V1C C;  2F0O A;  1IBM Q;  1IW7 D;  3BZK A;  2K5H A;  3TME A;  2O5I C;  3GTJ H;  1EZ8 A;  3VYU A;  1BCP B;  5LMU Q;  2A6E C;  1HNZ Q;  3NQT A;  4KKS A;  3GTQ B;  1JT8 A;  3J80 L;  4PNY A;  3J7Z C;  1CA5 A;  3AU7 A;  2HQL A;  4DAY A;  3VR2 A;  3FHW A;  2CFM A;  4X64 L;  1LT3 D;  5IYB H;  4LF4 L;  1KAW A;  3R2I A;  4BY1 G;  1HXY D;  3HOY G;  1U5K A;  5KYI A;  4RMF A;  1QVF A;  5IIF A;  1Q8I A;  5M5X H;  1J6Q A;  2Z6K A;  3BVZ A;  2K7V A;  4JOI C;  1X3P A;  3NQI A;  3G71 A;  2F3W A;  4LW1 A;  4GN4 B;  4S3S A;  2E2H B;  5IGF A;  1K73 C;  3PF4 A;  1LTL A;  2WB1 G;  4C2M B;  2OXP A;  4CBV A;  2RSO A;  3OYY A;  5IT9 L;  3TQY A;  1S4Z A;  1JMC A;  4GKK Q;  4X6A H;  2WB1 E;  3SGI A;  1XXG A;  4CKC A;  2KHS A;  1UWV A;  4ZAI A;  1TT2 A;  1YJ9 A;  4GZY C;  4XQJ A;  3S1N H;  3SDZ A;  1OTC A;  4BBR B;  2WKC A;  5LL6 X;  4FF1 A;  2B2U A;  2UUB L;  1WTW A;  4KV6 A;  1YJW A;  3I3C A;  2PW5 A;  1II3 A;  3MWY W;  3BYY B;  1GUS A;  1KHI A;  4HID A;  4JYA Q;  3LNN A;  3H15 A;  3PCO B;  1HQR D;  5JEA G;  3OW2 A;  4BXX G;  2VUM B;  3ULJ A;  3NHH A;  3U4V A;  4DV6 L;  4BY1 H;  3OMG A;  3OSO A;  4DU9 A;  1IYJ B;  2JA6 H;  3KDF B;  2KJX A;  3UE0 A;  3K6O A;  5J39 A;  4DUY L;  3H94 A;  5M3M B;  4N8X 1;  1KRS A;  2XSC A;  1O7L A;  5E7N A;  3BS1 A;  3GTK B;  1CQV A;  1DYQ A;  5JJL A;  5C44 B;  2KOL A;  5FLX c;  1LTS D;  4IOC A;  3HOW H;  1WD0 A;  3SXH A;  1A62 A;  3A7L A;  4DAP A;  5AFW A;  2JQO A;  3KYH C;  3SR1 A;  3VR5 A;  1TS2 A;  2JA6 B;  3HOZ H;  3A0J A;  1XNQ Q;  4A76 A;  4A93 G;  3H0G H;  1QCB D;  3E9I A;  1AZQ A;  1LO5 D;  3A8I E;  1WTV A;  4XDX A;  1I4P A;  3K0X A;  3F2B A;  2KEC A;  3VA7 A;  4RH6 A;  2E76 C;  4DAV A;  3DEO A;  4NPS A;  3TN2 A;  3CW2 C;  2NN6 I;  4MZ9 A;  4A3B H;  1CTM A;  1RD9 D;  3R2T A;  4R9W A;  4LWC A;  4BBR H;  2HD3 A;  5CC4 A;  4F7X A;  1SYB A;  4TRD A;  3D4D A;  1STH A;  1D5M C;  2VNU D;  4JI7 L;  4Q5V A;  2AWN A;  1EZ6 A;  3CC4 A;  3IFT A;  1PLF A;  3WWV A;  3ERQ A;  1EIG A;  4K0K Q;  4DR1 L;  4A3F B;  4R1J A;  2YTV A;  1D6E C;  4XT1 B;  2L15 A;  1AEX A;  2GVA A;  2I46 A;  3CRL C;  4FF4 A;  2B3G A;  3LWE A;  2PNH A;  2Q2T A;  4GS3 A;  5IT9 E;  1Q90 A;  2MPM A;  4PMW A;  2AQ2 B;  2AUJ D;  2QIL A;  1D5Z C;  1FNU A;  1K83 H;  1NCV A;  2DNC A;  2NZ1 D;  2BDO A;  2JA8 G;  1I4H A;  4R8I A;  2GVB A;  2G9H D;  5FJ8 G;  2EE1 A;  3OTO Q;  2XRQ D;  1XMO L;  2HT1 A;  4XIG S;  2UXD Q;  1X6O A;  4AQY L;  1HR0 L;  2HCC A;  4UP7 A;  3JAM E;  1KTK A;  4C3J H;  4LAA A;  3KLW A;  3FKI H;  3KOJ A;  3EN2 A;  4HJ8 A;  2EY1 A;  2EYP A;  2K04 A;  1IKM A;  4B3M L;  3MXN B;  2A68 D;  2K05 A;  3GTQ H;  2CKZ B;  2ZT9 C;  1KNA A;  5ELN A;  2K5N A;  3D8G A;  2CH4 A;  3D31 A;  1TS3 A;  3WOF A;  5IGG A;  1VQ5 A;  2R7Z B;  3ND8 A;  1IBL Q;  3PUZ A;  1LUZ A;  4KY6 A;  4AIM A;  3A5U A;  4ZK9 B;  1X54 A;  4JPB W;  5JJZ A;  3TRZ A;  3H0G G;  2E2J B;  2XGT A;  3KJO A;  3S16 H;  2EDG A;  4WFN 3;  1M90 C;  1YNJ D;  2KUM A;  1VQE A;  1GXD C;  2ICI A;  3QIA A;  4OON A;  4DK3 C;  4QJF A;  4EQN A;  1XPO A;  2A69 C;  3HOY H;  1PTO C;  5I4D A;  1ASY A;  1U0L A;  3BVM A;  4R8N A;  3J81 c;  3I4N G;  1PH3 A;  4K8I A;  2BA1 A;  3K0Y A;  1I6H H;  1TII D;  1IL2 A;  2K14 A;  5D3I B;  1MSG A;  4BY7 G;  3TP8 A;  5KEE A;  4GOP B;  1XJV A;  5C3X A;  1EIF A;  1O80 A;  2YTY A;  1D7Q A;  3TEH B;  2IHE A;  3PSI A;  2QF7 A;  3N52 A;  2O5J C;  1LTA D;  1JOQ A;  2AUK A;  4J15 A;  5FKA C;  5FJ8 H;  2NVQ H;  1MJC A;  4KD4 A;  4POF A;  1G2S A;  4HCE A;  4DPG A;  1K0R A;  4MIU A;  5JPM C;  1I4X A;  5ELB A;  2IHF A;  3ONA B;  1K9M C;  1HH2 P;  4LF6 Q;  3DM1 A;  1LT5 D;  4R4C A;  1JJG A;  1PFB A;  3K5O A;  2KEE A;  1TY2 A;  1M1K C;  1E2Z A;  2NVY H;  3M3Y H;  5EKI A;  4B9X A;  3FKI G;  3CU7 A;  2FJ2 A;  1UE6 A;  1HFG A;  1NR2 A;  3SK8 A;  3HOY B;  1EYG A;  4RFB A;  1QG7 A;  2GN5 A;  4DR4 L;  1WCM G;  1ASZ A;  4GNX B;  4X3T A;  1OXU A;  3CKI B;  3CP0 A;  2L11 A;  1Y1W B;  4YHH Q;  4DV7 Q;  1I94 Q;  1F9P A;  3UDI A;  4DR7 L;  2B63 H;  4A3D B;  2R92 B;  2VQE L;  1W2B A;  1DON A;  1F2L A;  4AYB G;  3GV6 A;  1Q86 C;  1TWA H;  2Z9H A;  3QWN A;  4XQN A;  3U58 A;  1CZG A;  4DV5 Q;  1EY5 A;  1IBL L;  1BR9 A;  1SJH D;  2XN9 C;  3BDO A;  1EWH A;  2Y0S G;  2PI2 A;  3BDL A;  5FLM G;  3PGZ A;  5ELD A;  3VA5 A;  1LTG D;  4POG A;  3W3A A;  2B2Y A;  2IW3 A;  1JOR A;  1IL8 A;  3TRE A;  1VQ4 A;  1BOS A;  5C4X H;  3HOW B;  1D2B A;  2UU9 L;  3D4W A;  1K3B C;  2MHV A;  1HTP A;  4C3H B;  4L5T A;  3PIP 3;  3HOX H;  3T13 A;  4G7H C;  4B3S Q;  2MJ8 A;  4ZKC B;  1BXT A;  4JI3 L;  3U50 C;  1CKM A;  2EVB A;  1EEF D;  2EY6 A;  2QDL A;  4A3B B;  2B2U C;  3I7F A;  2ASB A;  1STN A;  3MZ5 A;  4X66 Q;  2F0W A;  4X66 L;  4CDF C;  1L1O A;  3NEM A;  2Z6B A;  2NN6 H;  1ONL A;  2I07 B;  2F0F A;  3BJU A;  2PZW A;  2K5V A;  4KHV A;  2CCZ A;  3H09 A;  5C6A A;  5IP7 G;  1HA6 A;  4R4Q A;  1CZW A;  1L0Y B;  3J80 c;  3FMC A;  3KF6 B;  1NY4 A;  5C44 H;  1A2U A;  4HMI A;  3FPP A;  2FFK B;  3M9B A;  4A3F G;  2Q8I B;  2EQS A;  2DJG C;  1OXX K;  1XWE A;  3Q22 A;  2F0S A;  2UXB L;  3OIP A;  3PO3 H;  2XIW A;  4HIK A;  4EQ5 A;  3HOV G;  4IUT A;  4MHE A;  1C7Y A;  3U9O A;  1WTH A;  2UUC L;  1KAB A;  2IPK D;  1MSH A;  3W1G A;  2VUM H;  2BE5 D;  1C4Q A;  4QY7 A;  2XTI A;  3GTL H;  1XNR L;  5BN3 A;  5HGT A;  5IT9 c;  3LX0 A;  4K8J A;  3N6R A;  1Y1V H;  1B44 D;  1BBU A;  1C48 A;  3L0O A;  3SE0 A;  1VQH A;  3HEJ A;  3MC0 B;  3S1Q B;  2JA5 B;  1AH9 A;  3E3X A;  1I94 L;  1B9M A;  3GTK H;  4HR7 B;  3E5S A;  5C3E G;  3SEB A;  5M3M H;  1SYF A;  1PH1 A;  1YNX A;  1U4P A;  4C56 C;  1KXL A;  3JAM c;  1PRT B;  1G2T A;  2YYZ A;  2MO1 A;  5EPL A;  1PRT C;  3NXW A;  3GTJ B;  3PIO 3;  1VQL A;  3CCS A;  2PPB C;  1PYW D;  1PH4 A;  1E24 A;  1U4L A;  2F0L A;  3P75 A;  1WTQ A;  5C44 G;  5A35 A;  4DV6 Q;  3RLF A;  4DV2 Q;  1MBY A;  1EY9 A;  2F4V L;  3NWS A;  1Y69 U;  2J0T D;  4HJA A;  3DUZ A;  1DOK A;  5EAY A;  3H6M A;  1CSP A;  2ZM6 L;  1KLG D;  2K5Q A;  1MD2 D;  1UE5 A;  4JI8 L;  3A5Z B;  2RCF A;  2G9D A;  1MGS A;  5K36 H;  1X3Q A;  4FXD A;  4DNT B;  1LTI D;  1PVO A;  3IRB A;  2HUG A;  1RHP A;  2F0I A;  1T5X D;  3CPW A;  4GKK L;  1X65 A;  1TY0 A;  2ZJQ A;  1JWS D;  4RCO A;  4F87 A;  3R8B A;  2B2T C;  4G4K A;  5G3L F;  2A19 A;  1JE5 A;  3S1Q H;  3GTG B;  1GUN A;  3CXC A;  1KDA A;  1XX8 A;  3NTH A;  3GTL B;  4GOP A;  4KKU A;  2C35 B;  2KHI A;  1EL0 A;  2B63 B;  4KKT A;  3EIV A;  1G51 A;  2K4K A;  3T51 B;  1YIT A;  1N36 L;  4DAY B;  2CWA A;  2RCN A;  5JVH 3;  1B2T A;  2VZA A;  1V9P A;  1GOZ A;  2Z6K C;  3ERS X;  1KNE A;  1EY0 A;  1PV4 A;  2ZXO A;  5HUR A;  1HNX L;  2NVY B;  1R4Q B;  1HUM A;  2KVM A;  1B4O A;  1ENF A;  4OEL B;  4DR2 L;  4YCW A;  4DXF A;  4JCV E;  2F3I A;  4OEM B;  1BF4 A;  2QW7 A;  4H7B A;  5FO7 B;  3L7Z C;  4NMZ A;  1UNS A;  2NB0 A;  4ME3 A;  4JG2 A;  5GAG C;  2A6H D;  2KBN A;  1YHA A;  2HIV A;  4DR1 Q;  4KLK A;  3NTI A;  1QNU A;  1EQT A;  3URY A;  4DUZ Q;  1SSO A;  1FGU A;  1EY7 A;  5CV8 A;  5M5W B;  2Y0S B;  4JI4 Q;  2CQO A;  2JYO A;  2QGQ A;  4IOA A;  2RDF A;  3QG1 A;  2VQE Q;  4BA1 I;  2WAC A;  3RR5 A;  3PO2 B;  2RA4 A;  1C0A A;  1E22 A;  3HRZ C;  2JA5 H;  3S14 H;  2IX1 A;  2JSO A;  1A63 A;  2F4I A;  1DD2 A;  1X56 A;  4QIW E;  4K0K L;  3D4R A;  3S2D B;  1MHW C;  4A4I A;  4DR4 Q;  2K01 A;  4A3L G;  1VF5 C;  4WJW A;  4DNI A;  3DWP A;  2A8V A;  1ZEQ X;  1NSN S;  3DLL A;  4P72 A;  2BCO A;  1WCM B;  2IY5 B;  1V1Q A;  3TZU A;  2F0P A;  5EKL A;  5M5X B;  3PO3 B;  4KHP Q;  1S5F D;  5C3W A;  3I55 A;  2R92 H;  5DM7 3;  4A3D H;  1L2F A;  3HOX B;  1Z47 A;  5FO8 B;  3RN2 A;  2M2L A;  2VL6 A;  1ICF B;  1A8V A;  2YU9 H;  2C9O A;  4LF9 L;  2B2W A;  2F0H A;  5CBE E;  1J9O A;  1EWI A;  1PFS A;  2EZV A;  4APV A;  2JK8 A;  2MO0 A;  2OT2 A;  3T1H Q;  1S5E D;  2RBM A;  1KDB A;  1WTR A;  2CWP A;  1STY A;  3K5L A;  3G6E A;  4HCS A;  1F2Y A;  2B8F A;  4C3I B;  1KDC A;  4NP5 A;  3AQQ A;  3NK9 A;  3NBH A;  1SN8 A;  4HN7 A;  1GD7 A;  4ALP A;  1CKN B;  4A75 A;  4X65 Q;  4DUY Q;  1G6P A;  1FVI A;  1SNP A;  2K5W A;  3C46 A;  4A3J G;  1QOH A;  1S5D D;  5BR8 L;  4IPG A;  4XTC S;  3P20 A;  1LTT D;  4J8Q A;  4U68 A;  1EIY B;  5TSS A;  4A3G H;  2LFN A;  5C4X B;  2NVT H;  5I2X A;  1J5E L;  1FJG Q;  1A3V A;  1YNJ C;  2NZO A;  3M3Y B;  1V1P A;  5I9O A;  1I3Q H;  1IBK Q;  1YNN D;  4JI4 L;  3PQI A;  1S5C D;  3CF5 A;  2EYO A;  3BG3 A;  3IFD A;  3AMU A;  1KQS A;  4WJ4 A;  1B53 A;  1SMX A;  4DV3 L;  3RN5 A;  2OWO A;  4BS9 A;  3UDG A;  1NJI C;  2KQ3 A;  5H1S E;  1JQY D;  3FDT A;  1TS5 A;  2L55 A;  4ULL A;  3OW7 A;  3NWT A;  1IYV A;  4RKB A;  2E2I B;  3NTK A;  4YWL A;  2NTS A;  1SEB D;  1R9T B;  1JWM D;  4FF3 A;  5DEH A;  1CM9 A;  1HUN A;  4A3J B;  1U4M A;  3EJI A;  4JI5 Q;  1TKW B;  1A3U A;  4DV4 Q;  1EQR A;  2QKI C;  3ERO A;  3PF5 A;  2EIF A;  5FLX E;  4B3S L;  3HKZ E;  3L9A X;  1JC7 A;  3ULP A;  5CYU A;  4I65 A;  1RTO A;  3D6C A;  3OOC A;  1H9J A;  3ITP A;  2C5C A;  5M5W H;  3E0E A;  4OHJ A;  2Q2I A;  2VQF Q;  4OO1 G;  4A3J H;  1LAB A;  1YVC A;  3KLS A;  4IUN A;  1Q82 C;  3OHX C;  1V43 A;  3S16 B;  1SJE D;  1HR0 Q;  4BY7 H;  2OEO A;  2SNM A;  3VR3 A;  3CCQ A;  4L5R C;  5C4Z A;  4A3G G;  2RHS B;  4WRD A;  5LMN L;  2A6E D;  4FF2 A;  4TQU S;  3NUC A;  1LAC A;  1NE3 A;  2E5L L;  5G3L D;  4I7Z C;  1SNO A;  1H9R A;  2CQA A;  4DAM A;  3CCR A;  2ZJP A;  3TSS A;  1PH8 A;  1P8L A;  5M3F H;  4H13 C;  2ZTD A;  1WD1 A;  5JEA H;  1SYG A;  2DUD A;  2K32 A;  4JI0 L;  1SNC A;  3GP7 A;  2HDM A;  4OWW B;  5JVG 3;  2XVS A;  3S1N B;  5HY6 A;  1MI2 A;  4P74 A;  4A3K G;  4C3I G;  3TZD A;  4CJ0 B;  3STB C;  1VQA A;  1P16 A;  3DXJ C;  1X9N A;  2I5M X;  3FEW X;  3NSW A;  2RKS A;  5IE8 A;  4RGT A;  2DJF C;  3K5N A;  2ATW A;  3W1B A;  4UDU C;  3M4O H;  1K83 B;  2JN4 A;  2F4V Q;  1EU3 A;  1QUQ A;  1EUJ A;  1WJJ A;  3IAY A;  2WAQ B;  1SXT A;  2D0O A;  4K14 A;  5KNB A;  2EJG C;  3V05 A;  2Z4H A;  2L5T A;  5IYD G;  2LY7 A;  5M3M G;  1BCP D;  2NVX B;  2M9V A;  4JI1 Q;  2UXC L;  4R4O A;  1XMQ Q;  5EKK A;  1KAA A;  3J80 i;  2B2V C;  2LMC B;  4UP8 A;  5M5Y B;  1YI2 A;  1KIX A;  2Q2H A;  1FD7 D;  4PQX A;  2AKW B;  1C8C A;  2V4D A;  3U9S A;  4IPC A;  4FNF A;  4LUO A;  3S1M B;  4PV1 C;  1SFO H;  2RSN A;  5GQO A;  1TWC B;  2ES2 A;  3J7A V;  3WDN A;  5EQ0 A;  4OO1 H;  4HSP A;  2KCN A;  4IUP A;  3S1R B;  4C1N I;  3UDF A;  4G57 A;  1WTO A;  3VYS A;  2IL8 A;  2VS1 A;  4J6H A;  2E2D C;  1V1P B;  3UDX A;  3HOZ B;  3AEV A;  1BBX C;  4TKO B;  4BBS H;  2YTX A;  5K36 G;  1CK1 A;  4JBM A;  4DV0 Q;  4K2K A;  1H9S B;  2L9H A;  3CHB D;  1CKO A;  3X3M A;  5EPK A;  4P71 A;  1EYD A;  1X3G A;  1I4G A;  2X69 A;  5KIX A;  4FYD A;  1ET9 A;  3T1Y L;  2OTJ A;  5FLM H;  1CA6 A;  5LHY 1;  2SNS A;  1XTC D;  3GO5 A;  1HZB A;  2CHB D;  2MFI A;  3H3V H;  4BY1 B;  5IYC G;  1Q3L A;  1ML0 D;  2Q8R E;  4AQY Q;  4IFD J;  1VDZ A;  4EQO A;  1SLJ A;  4BY7 B;  2LXJ A;  3P7J A;  4K6L A;  1HNX Q;  1EWC A;  5E4X A;  1LTB D;  2LXK A;  2SEB D;  1VQJ A;  2RDG A;  2QDB A;  3TP7 A;  2AMC B;  1G29 1;  1K28 A;  1GO3 E;  1IXR A;  1YIJ A;  4XQQ A;  2N55 A;  4HIO A;  3J81 j;  2N3S A;  5GAE C;  1D1I A;  1GVP A;  5M5Y H;  1EYA A;  2IJ0 A;  3EVQ A;  1BCP F;  5I2Y A;  5FLX L;  1PA6 A;  1JE4 A;  5LMU L;  1MJE A;  2A73 B;  5E1F A;  1DJR D;  1RKN A;  3PIP A;  4HJ5 A;  1PYS B;  3ULL A;  4MTN A;  1GJX A;  2FHT A;  1V1O A;  3RLO A;  4A3M G;  3GTM H;  2EJF C;  2X6G A;  4N9T A;  3VR4 A;  3NP8 A;  2E2I H;  4BBS G;  3CCE A;  2HDL A;  5I6W A;  1GHK A;  1A3T A;  4CDC C;  1TWA B;  4A3E H;  3MEH A;  5KND A;  1IYU A;  3JC6 6;  3M4P A;  1PZK D;  4O1N A;  3FPU B;  4YHH L;  2I0Q A;  1STG A;  2AHO B;  2JE6 I;  3G7L A;  2B8G A;  5C4J H;  1AZP A;  4X3S A;  5DNF A;  1Y1W H;  1ZYR D;  2R93 B;  2J4X A;  1VQN A;  1B3A A;  4C3H H;  1EQV A;  2NYZ D;  1EY4 A;  3PUV A;  3RNU A;  2CW0 D;  2PMZ B;  3Q0A A;  4K6D A;  4B3R Q;  3CC7 A;  2K28 A;  4A3L H;  4Y7N H;  4HSV A;  5CGK A;  2FIN B;  1O7I A;  4CGY B;  3HOU B;  5M3F B;  2DNE A;  2UXC Q;  3TP5 A;  2NBF A;  3K7U C;  3I56 A;  1T5E A;  3HOU G;  3QB3 A;  2ZTE A;  3RZD B;  4LFC Q;  1CHQ D;  1SYC A;  1E0B A;  4WOR A;  3WOE A;  4QL5 A;  1Q12 A;  1BDO A;  2LKV A;  4DK0 A;  1PDQ A;  1ILQ A;  2B39 A;  1S3O A;  2K75 A;  3KF8 B;  4H44 C;  3X3N A;  4LF5 L;  2Z0S A;  4A3E G;  1CFM A;  3GTM B;  2NVQ B;  2KHJ A;  4LFB Q;  4HJ9 A;  4IPD A;  1PH2 A;  4RGM A;  2ENB A;  3O13 A;  3KLR A;  4DK1 A;  2F0Q A;  3FRP B;  3MA2 B;  3TP6 A;  5IP9 G;  4JVZ A;  4DUZ L;  5KNC A;  5J22 A;  4RCN A;  3HOV B;  1JIC A;  4C3H G;  4QCL A;  2PNR C;  1VF7 A;  1TXY A;  2HHH L;  1JJC B;  3Q24 A;  2OF1 A;  1K8A C;  3KDF A;  4Y52 H;  2FMM A;  4DNR B;  5IY0 A;  2VQF L;  5D3D A;  3SK5 A;  1NNX A;  1IW7 C;  2Z4I A;  1NMF A;  2M00 A;  1K8G A;  1N32 Q;  3M4Q A;  2HIX A;  4DR5 Q;  1LV9 A;  2EYM A;  1DCZ A;  1KL9 A;  2KCM A;  1A6X A;  2PQA B;  2RDH A;  4JBW A;  1HZA A;  3S14 B;  4KHZ A;  3M4Y A;  3CD6 A;  4JV5 Q;  1HRJ A;  3DM3 A;  1IZ6 A;  3TS2 A;  5COR A;  3C1F A;  1CQF A;  4IJH A;  3V96 A;  2HQE A;  1N36 Q;  4UAI A;  3EBE A;  4EX5 A;  2H5X A;  1N34 L;  3FKI B;  1I4Q A;  4X3U A;  3S2H H;  2XWB B;  1HZ9 A;  3HOW G;  1YEZ A;  2EY2 A;  2K5D A;  2A74 C;  2ZTC A;  4KY7 A;  4JI5 L;  1B70 B;  1O7Y A;  4L5Q A;  4ODG A;  4BBR G;  1Z6H A;  1Y8P B;  3S1R H;  5JJK A;  2QA4 A;  1VQ8 A;  1VQP A;  1Q46 A;  1X55 A;  1TWC H;  1VQF A;  4YY3 Q;  1LT4 D;  4NKL A;  1U4R A;  2R7Z H;  1T9H A;  3GQB A;  2KCC A;  3HOZ G;  1FNV A;  4RKL A;  2Z1C A;  4RGN A;  4GNX A;  4A93 H;  4NXM Q;  4JI7 Q;  4A3D G;  2OCE A;  1NTG A;  1PYB A;  4JI8 Q;  2K52 A;  2B2W C;  2HCI A;  3SHL A;  5IGB A;  1ILP A;  5LL6 S;  1M4V A;  4KY5 A;  1Z7T A;  2EXZ A;  4KK7 A;  2Q2U A;  1DGS A;  1XMQ L;  1NUC A;  1RIP A;  5JAV A;  3J7A F;  4XYQ A;  4GKJ L;  5GAH C;  4JI6 Q;  1N33 Q;  2PZU A;  5IGC A;  3MEF A;  4Z9C B;  1M8A A;  5BR8 Q;  3RZD H;  2SOB A;  3HP3 A;  1WCM H;  1GM5 A;  3GTG H;  3MFY A;  4ID6 A;  1BNZ A;  1B3Q A;  2JP1 A;  3DHQ A;  3FVQ A;  1TWH B;  4CJ1 B;  3F2C A;  1QWY A;  4LF9 Q;  3H0G B;  3P1H A;  1KC8 C;  5C0X J;  1SMY D;  1DZ1 A;  1WI5 A;  4IFD H;  3CAM A;  4DV1 L;  2JA9 A;  2PW7 A;  2WP8 J;  1SNQ A;  4NB3 A;  3F2D A;  2R7F A;  4ILW A;  1JB3 A;  1Q81 C;  4KHP L;  2R7Z G;  4B08 A;  1PTO D;  4UY8 C;  3PO2 H;  1XNR Q;  4CDD C;  4LUZ A;  4O0A A;  1L0W A;  4JI2 L;  4PMB A; 
#chains in the Genus database with same CATH homology
 1O78 A;  4ZYS A;  3QO2 A;  5EBD A;  2IT1 A;  3C1E A;  4C3J G;  1PZJ D;  4QUF A;  4DN4 M;  4IUU A;  3M85 A;  1DM0 B;  3KF8 A;  3ND9 A;  1HA5 A;  1F9R A;  2F3V A;  1NR4 A;  3GTO B;  2KED A;  1GUG A;  3BVG A;  2F0N A;  3EQL C;  3KK7 A;  4DA2 A;  3SK4 A;  2EYJ A;  1E2W A;  1ZYR C;  4HMJ A;  5ELE A;  3S9W A;  1HFN A;  4K5V A;  4K5W A;  3D3R A;  2A5H A;  2R61 A;  3RUZ A;  5EPJ A;  1I6V C;  2WKD A;  3BZD B;  4PMC A;  4B9W A;  1A2T A;  4A3K B;  2EPB A;  2RQX A;  2JA8 B;  5IGD A;  3KUP A;  4L6T B;  3UI2 A;  3E0J A;  2DY7 A;  3I73 A;  4IQZ A;  1QJO A;  2ZXR A;  4QF4 A;  4LMQ D;  1RJT A;  4DF7 A;  1O7Z A;  4A3G B;  3GD7 A;  3TDQ A;  4YIJ A;  3J7Y W;  4H0L C;  4EVO A;  2QCP X;  4L8J A;  1SFO B;  1Y8N B;  3JAM L;  4RA8 A;  1TR5 A;  3VR6 A;  1HHV A;  2TMP A;  3MXN A;  5F2D A;  3K59 A;  1G6Z A;  1V8Q A;  3H91 A;  1Q1B A;  4A3M B;  3OPO A;  4FP5 D;  3HS0 C;  3I4L A;  4A93 B;  5FOB B;  2YU9 B;  4N9P A;  1GUW A;  3OMC A;  3I8Z A;  5CV9 A;  1LTR D;  2D62 A;  1JOO A;  4DXG A;  2WII B;  3BDC A;  2LS0 1;  5T1G A;  2XRS D;  1OXT A;  3DMU A;  2EJM A;  3C3L A;  4OIK A;  4P2C B;  3S2H B;  3OIQ A;  1I50 B;  5I9P A;  5CBA E;  4LJZ C;  3M7N A;  5DM6 3;  4CKB A;  4IUR A;  1KLU D;  3MAQ A;  4G7Z C;  1FGB D;  1H9S A;  2F0D A;  2NTT A;  1PFM A;  3MXP A;  3PUW A;  3T16 A;  3G6J B;  3V2T A;  1H9M A;  1TVX A;  2O4X A;  3I72 A;  4KI0 A;  4RWS C;  3D6W A;  1ENA A;  5JEA J;  1H9K A;  1IHZ A;  2WB1 B;  3K5M A;  2DY8 A;  2EYF A;  3EA6 A;  5FO9 B;  1STA A;  4CKE A;  3PUX A;  1I3Q B;  5M9O A;  1EY6 A;  4ABN A;  4ME5 A;  5C0X H;  1F2M A;  5IOC A;  1PTO B;  2KA7 A;  2IX0 A;  2PYK A;  1Q1E A;  1EY8 A;  4M1U B;  1STB A;  4KD3 A;  5K5P A;  2A69 D;  1EU4 A;  1F77 A;  3BYT B;  4QMG A;  2F0M A;  4FXG C;  2DN8 A;  2D2C C;  2AQ3 B;  3EFX D;  2JEB I;  2MGS A;  2PO4 A;  5D65 A;  5A2Q E;  4K2L A;  3PMF A;  2JEA I;  1SNM A;  4OIJ A;  2Z8L A;  1PZI D;  3I70 A;  4DFA A;  1TQO A;  4XYO A;  4V19 0;  2NUC A;  3T4A C;  2XWJ B;  4RAU C;  5IOD A;  5J1Z A;  2F0T A;  1K8O A;  4F88 A;  4C1N K;  5CMD A;  3GTP B;  3VYR A;  1BO0 A;  1GUO A;  2MP1 A;  4MN3 A;  3J80 E;  2MUY A;  3VYT A;  2QEJ C;  1SAP A;  5C0X I;  2JA7 B;  1STE A;  3L3O C;  4A3E B;  1ENC A;  2GA4 B;  3A55 A;  3CRK C;  3LWU A;  1PTO H;  1VCI A;  1WTX A;  5BN5 A;  3HGB A;  1G8Z D;  1AFP A;  4ZQ3 A;  1B9N A;  4EGV A;  1EYC A;  1QIL A;  1QB5 D;  3T53 B;  1Y1V B;  1B1Z A;  2F1M A;  3RD4 A;  2SDF A;  5C0X G;  5CR3 A;  5DAU A;  1ROD A;  1SE2 A;  2F0E A;  1JCK B;  3QJY A;  1EEI D;  1OO9 B;  1I4R A;  4V0B A;  4LK1 C;  2R6G A;  2B2V A;  1AP0 A;  1NAP A;  1S5B D;  5JPN C;  3OWE B;  4RGO S;  5KRU A;  4IN3 A;  4O42 A;  2EYH A;  2JXM B;  3S17 B;  1RTN A;  2L1B A;  2ZXP A;  2ICE C;  4KJN A;  5ELF A;  5C4H A;  3PV0 A;  1FR3 A;  4ZRZ A;  2F0U A;  1A15 A;  1OXV A;  1EOT A;  3ZYY X;  1W6K A;  2BDN A;  2IX3 A;  2A68 C;  2VB2 X;  1BCP C;  5ISR A;  3C2P A;  5A2Q L;  1ESR A;  3PUY A;  1X32 A;  1SYE A;  2VB3 X;  2R3Z A;  4HTH A;  2PQE A;  5BN4 A;  1RDP D;  3R3O A;  3RZO B;  3I91 A;  4NW2 A;  2VXW A;  4IAL A;  1EIH A;  1SBB B;  4Y7N B;  2L0C A;  2L12 A;  2O2L D;  4OO1 I;  1B50 A;  2BE5 C;  5EGT A;  2F0J A;  3NBI A;  3NE5 B;  2K6A A;  4OGQ C;  1RCV D;  3NPP A;  2B2T A;  3A8J E;  1SYD A;  3MVV A;  2RVL A;  2J7Z A;  1TU2 B;  2EYL A;  3Q6S A;  3K7A B;  1PRT D;  1XYI A;  1BQQ T;  2FMC A;  4KTA A;  3HZX A;  1DOM A;  1SE3 A;  3A56 A;  4AYB B;  3A8K E;  5NUC A;  4A3I B;  2PZT A;  5CV6 A;  4XT3 B;  2K03 A;  2H4O A;  1AW7 A;  3E6Z X;  4Q0F A;  5EJW A;  5CV4 A;  1HPC A;  3F2U A;  1PFN A;  5T1I A;  3DWQ A;  1BUV T;  4BA2 I;  1SE4 A;  3J81 E;  5JOB A;  1F2Z A;  4FXK C;  2K1B A;  1D5X C;  3TBI B;  2X6L A;  1QNK A;  3K57 A;  1W6J A;  1UEA B;  1ZKO A;  3GV3 A;  3MFG A;  3DEP A;  4ZUJ A;  5CV5 A;  4NDX A;  2NVT B;  2CW0 C;  1CI3 M;  2XNA C;  4F8M A;  1F9S A;  4K5X A;  1CT1 D;  4IZ8 A;  2TSS A;  3I4N B;  2E74 C;  4IFD I;  1GHJ A;  2WIN B;  1ESF A;  5FK9 C;  1PMR A;  4TSS A;  4IUV A;  2IWH A;  1GUT A;  3RMH A;  4QUC A;  3IKJ A;  4RHS A;  1L0X B;  4IUQ A;  1UUP A;  4ZLT F;  5KGU A;  1VMC A;  3CQZ B;  1LT6 D;  3QOJ A;  4HED A;  4EQP A;  3A7A B;  4ZKB B;  2BOS A;  1FNW A;  3M4O B;  1LLR D;  3R93 A;  3S15 B;  2B2Y C;  2L4N A;  4BWG B;  1SND A;  2H1E A;  1JOK A;  5I6Y A;  1G91 A;  1PTO F;  2A6H C;  1E2V A;  1U9R A;  2D9U A;  1R4P B;  1FYC A;  1J8I A;  3W2D A;  1TS4 A;  3MHB A;  1OXS C;  2BA0 A;  3KBX A;  5D14 A;  3HG9 A;  4DGZ A;  1CHP D;  2CVR A;  1RF2 D;  5COY A;  1WTP A;  5C4J B;  2F0V A;  1HQM C;  3AB9 A;  4KN7 C;  2NN6 G;  5C3E B;  1IKL A;  3J81 L;  3SK6 A;  5CV7 A;  1UAP A;  4QB4 A;  5E3F A;  3MTS A;  4FVM A;  3Q23 A;  1HTL D;  4JK1 C;  1VMP A;  4L63 B;  3M7G A;  1PXU A;  1HCZ A;  2EY5 A;  4RHR A;  4CJ2 C;  1ET6 A;  1I6H B;  2AQ1 B;  2F0K A;  1EFI D;  1JR0 D;  2F0G A;  4U67 3;  1K8M A;  5EBC A;  4KN4 C;  4CHT B;  3OWF A;  4KMU C;  4IFD G;  5ELC A;  2EOT A;  1JWU D;  1AN8 A;  4M8A A;  5C5L A;  2N88 A;  4OL7 A;  1D1K A;  4XXE A;  3KBG A;  4E6I A;  5KYL A;  1ZXT A;  3QOL A;  3DWA A;  1YNN C;  1F9Q A;  3I90 A;  2K33 A;  3K58 A;  3T56 B;  4X3K A;  1QE6 A;  5C5M A;  2Q8T A;  4HAE A;  5IGE A;  1WVL A;  1DOL A;  3SVM A;  4QIW B;  2AWO A;  4ZUI A;  2NWG A;  2WV6 D;  3HKZ B;  1PRT F;  1ICW A;  1SMY C;  4C3J B;  4KJO A;  4BBS B;  3A54 A;  3MXU A;  2E75 C;  4FO2 A;  1SDF A;  2ID0 A;  1Y8O B;  3I4M B;  5E4W C;  3MXG A;  3KLS X;  1TWF B;  4J1M A;  2PCF B;  2F03 A;  3IL8 A;  3H3V C;  1TWG B;  1DXM A;  2D5D A;  4G7O C;  2F0O A;  1IW7 D;  3TME A;  2O5I C;  1EZ8 A;  3VYU A;  1BCP B;  3GTQ B;  2A6E C;  3NQT A;  4KKS A;  3J80 L;  4PNY A;  1CA5 A;  3AU7 A;  4DAY A;  3VR2 A;  1LT3 D;  3R2I A;  1HXY D;  5KYI A;  5IIF A;  1Q8I A;  3BVZ A;  2K7V A;  1X3P A;  3NQI A;  2F3W A;  4S3S A;  2E2H B;  5IGF A;  4C2M B;  2OXP A;  4CBV A;  2RSO A;  5IT9 L;  1S4Z A;  4CKC A;  1XXG A;  2KHS A;  4ZAI A;  1TT2 A;  4GZY C;  4XQJ A;  3SDZ A;  4BBR B;  2WKC A;  5LL6 X;  4FF1 A;  2B2U A;  1WTW A;  4KV6 A;  2PW5 A;  3I3C A;  1II3 A;  3BYY B;  3MWY W;  1GUS A;  3LNN A;  1HQR D;  5JEA G;  2VUM B;  3NHH A;  3OMG A;  3OSO A;  4DU9 A;  2KJX A;  3K6O A;  5J39 A;  3H94 A;  5M3M B;  2XSC A;  1O7L A;  3BS1 A;  3GTK B;  1CQV A;  1DYQ A;  5C44 B;  2KOL A;  1LTS D;  1WD0 A;  3SXH A;  3A7L A;  4DAP A;  5AFW A;  3SR1 A;  3VR5 A;  1TS2 A;  2JA6 B;  1QCB D;  1AZQ A;  1LO5 D;  3A8I E;  1WTV A;  4XDX A;  1I4P A;  2KEC A;  3VA7 A;  4RH6 A;  2E76 C;  4DAV A;  3DEO A;  3TN2 A;  2NN6 I;  1CTM A;  1RD9 D;  3R2T A;  4R9W A;  5CC4 A;  4F7X A;  1SYB A;  4TRD A;  3D4D A;  1STH A;  1D5M C;  2VNU D;  4Q5V A;  2AWN A;  1EZ6 A;  3IFT A;  1PLF A;  3ERQ A;  1EIG A;  4A3F B;  1D6E C;  4XT1 B;  1AEX A;  2I46 A;  3CRL C;  4FF4 A;  3LWE A;  5IT9 E;  1Q90 A;  2MPM A;  4PMW A;  2AQ2 B;  2AUJ D;  2QIL A;  1D5Z C;  1FNU A;  1NCV A;  2DNC A;  2NZ1 D;  2BDO A;  1I4H A;  4R8I A;  2G9H D;  2EE1 A;  2XRQ D;  4XIG S;  2HCC A;  3JAM E;  1KTK A;  4LAA A;  2EY1 A;  2EYP A;  1IKM A;  2A68 D;  2K05 A;  2ZT9 C;  1KNA A;  3D8G A;  3D31 A;  1TS3 A;  3WOF A;  5IGG A;  2R7Z B;  3ND8 A;  3PUZ A;  4KY6 A;  4ZK9 B;  5JJZ A;  2E2J B;  2EDG A;  4WFN 3;  1YNJ D;  2KUM A;  1GXD C;  2ICI A;  3QIA A;  4EQN A;  2A69 C;  1PTO C;  5I4D A;  3BVM A;  4R8N A;  4K8I A;  2BA1 A;  3K0Y A;  1TII D;  5D3I B;  1MSG A;  3TP8 A;  5KEE A;  5C3X A;  1O80 A;  2QF7 A;  3N52 A;  2O5J C;  1LTA D;  1JOQ A;  2AUK A;  5FKA C;  4KD4 A;  1G2S A;  4HCE A;  4MIU A;  5JPM C;  1I4X A;  5ELB A;  3ONA B;  3DM1 A;  1LT5 D;  1PFB A;  3K5O A;  2KEE A;  1TY2 A;  1E2Z A;  5EKI A;  4B9X A;  3CU7 A;  2FJ2 A;  1HFG A;  1NR2 A;  3SK8 A;  3HOY B;  4RFB A;  1QG7 A;  4X3T A;  1OXU A;  3CKI B;  2L11 A;  1Y1W B;  1F9P A;  4A3D B;  2R92 B;  1DON A;  1F2L A;  3GV6 A;  3QWN A;  4XQN A;  1CZG A;  1EY5 A;  1BR9 A;  1SJH D;  2XN9 C;  3BDO A;  1EWH A;  3BDL A;  5ELD A;  3VA5 A;  1LTG D;  3W3A A;  2B2Y A;  2IW3 A;  1JOR A;  1IL8 A;  1BOS A;  3HOW B;  1D2B A;  3D4W A;  2MHV A;  1HTP A;  4C3H B;  3PIP 3;  3T13 A;  4G7H C;  2MJ8 A;  4ZKC B;  1BXT A;  2EVB A;  2EY6 A;  1EEF D;  4A3B B;  2B2U C;  1STN A;  3MZ5 A;  2F0W A;  2NN6 H;  1ONL A;  2I07 B;  2F0F A;  2PZW A;  4KHV A;  3H09 A;  5C6A A;  1HA6 A;  1CZW A;  1L0Y B;  3FMC A;  1A2U A;  4HMI A;  3FPP A;  2FFK B;  2Q8I B;  1OXX K;  1XWE A;  3Q22 A;  2F0S A;  3OIP A;  2XIW A;  4IUT A;  4MHE A;  3U9O A;  1KAB A;  2IPK D;  1MSH A;  2BE5 D;  1C4Q A;  5BN3 A;  5HGT A;  3LX0 A;  4K8J A;  3N6R A;  1B44 D;  1C48 A;  2JA5 B;  3SE0 A;  3MC0 B;  3HEJ A;  3S1Q B;  1B9M A;  4HR7 B;  3E5S A;  3SEB A;  1SYF A;  1U4P A;  4C56 C;  1PRT B;  1G2T A;  2YYZ A;  5EPL A;  1PRT C;  3NXW A;  3GTJ B;  3PIO 3;  2PPB C;  1PYW D;  3P75 A;  1U4L A;  2F0L A;  1WTQ A;  5A35 A;  3RLF A;  1MBY A;  1EY9 A;  3NWS A;  1Y69 U;  2J0T D;  3DUZ A;  1DOK A;  3H6M A;  1KLG D;  2K5Q A;  1MD2 D;  2G9D A;  1MGS A;  5K36 H;  1X3Q A;  4FXD A;  4DNT B;  1LTI D;  2HUG A;  1RHP A;  2F0I A;  1T5X D;  1TY0 A;  1JWS D;  4RCO A;  4F87 A;  3R8B A;  2B2T C;  4G4K A;  5G3L F;  3GTG B;  1GUN A;  1KDA A;  1XX8 A;  3NTH A;  3GTL B;  4KKU A;  1EL0 A;  2B63 B;  4KKT A;  3T51 B;  5JVH 3;  1B2T A;  1GOZ A;  1KNE A;  1EY0 A;  2ZXO A;  5HUR A;  2NVY B;  1R4Q B;  1HUM A;  2KVM A;  1B4O A;  1ENF A;  4DXF A;  1BF4 A;  4H7B A;  5FO7 B;  3L7Z C;  4NMZ A;  1UNS A;  2NB0 A;  2A6H D;  3NTI A;  1QNU A;  1EQT A;  3URY A;  1SSO A;  1EY7 A;  5CV8 A;  5M5W B;  2Y0S B;  2JYO A;  2RDF A;  3QG1 A;  4BA1 I;  2WAC A;  3PO2 B;  2RA4 A;  3HRZ C;  2IX1 A;  2JSO A;  2F4I A;  1DD2 A;  3D4R A;  3S2D B;  2K01 A;  1VF5 C;  4WJW A;  3DWP A;  1ZEQ X;  1NSN S;  2BCO A;  1WCM B;  3TZU A;  2F0P A;  5EKL A;  5M5X B;  3PO3 B;  1S5F D;  5C3W A;  5DM7 3;  3HOX B;  1Z47 A;  5FO8 B;  2M2L A;  2C9O A;  2B2W A;  2F0H A;  5CBE E;  1J9O A;  2EZV A;  2OT2 A;  1S5E D;  2RBM A;  1WTR A;  1KDB A;  1STY A;  3K5L A;  4HCS A;  1F2Y A;  2B8F A;  4C3I B;  1KDC A;  4NP5 A;  3NK9 A;  3NBH A;  4HN7 A;  1SNP A;  2K5W A;  3C46 A;  1QOH A;  1S5D D;  4XTC S;  1LTT D;  3P20 A;  4J8Q A;  4U68 A;  5TSS A;  2LFN A;  5C4X B;  5I2X A;  1A3V A;  1YNJ C;  3M3Y B;  1V1P A;  5I9O A;  1YNN D;  1S5C D;  2EYO A;  3BG3 A;  3IFD A;  3AMU A;  1B53 A;  4BS9 A;  2KQ3 A;  1JQY D;  3FDT A;  1TS5 A;  2L55 A;  4ULL A;  3OW7 A;  3NWT A;  1IYV A;  4RKB A;  2E2I B;  3NTK A;  2NTS A;  1SEB D;  1R9T B;  1JWM D;  4FF3 A;  5DEH A;  1CM9 A;  1HUN A;  4A3J B;  1U4M A;  3EJI A;  1TKW B;  1A3U A;  2QKI C;  3ERO A;  5FLX E;  3L9A X;  1JC7 A;  5CYU A;  4I65 A;  1RTO A;  3D6C A;  3OOC A;  1H9J A;  3ITP A;  2C5C A;  4OHJ A;  4OO1 G;  1LAB A;  3KLS A;  4IUN A;  3OHX C;  1V43 A;  3S16 B;  1SJE D;  2OEO A;  2SNM A;  3VR3 A;  5C4Z A;  4WRD A;  2A6E D;  4FF2 A;  4TQU S;  3NUC A;  1LAC A;  5G3L D;  4I7Z C;  1SNO A;  1H9R A;  2CQA A;  3TSS A;  1WD1 A;  4H13 C;  5JEA H;  1SYG A;  2K32 A;  1SNC A;  3GP7 A;  2HDM A;  5JVG 3;  2XVS A;  3S1N B;  1MI2 A;  4C3I G;  3TZD A;  4CJ0 B;  3DXJ C;  3FEW X;  3NSW A;  2RKS A;  4RGT A;  3K5N A;  4UDU C;  1K83 B;  1EU3 A;  3IAY A;  2WAQ B;  1SXT A;  4K14 A;  5KNB A;  2EJG C;  3V05 A;  2Z4H A;  2L5T A;  2LY7 A;  1BCP D;  2NVX B;  2M9V A;  5EKK A;  1KAA A;  2B2V C;  2LMC B;  5M5Y B;  1FD7 D;  4PQX A;  1C8C A;  2V4D A;  3U9S A;  4FNF A;  3S1M B;  4PV1 C;  2RSN A;  1TWC B;  3J7A V;  3WDN A;  5EQ0 A;  4OO1 H;  4HSP A;  2KCN A;  4IUP A;  3S1R B;  4C1N I;  4G57 A;  1WTO A;  3VYS A;  2IL8 A;  4J6H A;  2E2D C;  1V1P B;  3HOZ B;  1BBX C;  4TKO B;  5K36 G;  1CK1 A;  4K2K A;  1H9S B;  2L9H A;  3CHB D;  3X3M A;  5EPK A;  1EYD A;  1I4G A;  2X69 A;  5KIX A;  4FYD A;  1ET9 A;  1CA6 A;  5LHY 1;  2SNS A;  1XTC D;  3GO5 A;  2CHB D;  4BY1 B;  1Q3L A;  1ML0 D;  2Q8R E;  4IFD J;  1VDZ A;  4EQO A;  4BY7 B;  3P7J A;  4K6L A;  1EWC A;  5E4X A;  1LTB D;  2SEB D;  2RDG A;  2QDB A;  3TP7 A;  1G29 1;  4XQQ A;  2N55 A;  1D1I A;  1EYA A;  2IJ0 A;  3EVQ A;  1BCP F;  5I2Y A;  5FLX L;  1JE4 A;  2A73 B;  5E1F A;  1DJR D;  1RKN A;  1GJX A;  2FHT A;  1V1O A;  2EJF C;  2X6G A;  4N9T A;  3VR4 A;  3NP8 A;  2HDL A;  5I6W A;  1GHK A;  1A3T A;  1TWA B;  3MEH A;  5KND A;  1IYU A;  4O1N A;  1PZK D;  3FPU B;  1STG A;  2JE6 I;  3G7L A;  2B8G A;  1AZP A;  4X3S A;  5DNF A;  1ZYR D;  2R93 B;  2J4X A;  1B3A A;  1EQV A;  2NYZ D;  1EY4 A;  3PUV A;  2CW0 D;  2PMZ B;  3Q0A A;  4K6D A;  2K28 A;  4HSV A;  5CGK A;  2FIN B;  4CGY B;  3HOU B;  5M3F B;  2DNE A;  3TP5 A;  2NBF A;  1T5E A;  3QB3 A;  3RZD B;  1CHQ D;  1SYC A;  1E0B A;  4WOR A;  3WOE A;  1Q12 A;  1BDO A;  4DK0 A;  2LKV A;  1PDQ A;  1ILQ A;  2B39 A;  4H44 C;  3X3N A;  1CFM A;  3GTM B;  2NVQ B;  4RGM A;  2ENB A;  3O13 A;  3KLR A;  4DK1 A;  2F0Q A;  3FRP B;  3MA2 B;  3TP6 A;  5KNC A;  5J22 A;  4RCN A;  3HOV B;  1JIC A;  4C3H G;  4QCL A;  2PNR C;  1VF7 A;  3Q24 A;  2OF1 A;  2FMM A;  4DNR B;  5D3D A;  3SK5 A;  1IW7 C;  2Z4I A;  2M00 A;  1LV9 A;  2EYM A;  1DCZ A;  1A6X A;  2RDH A;  4JBW A;  3S14 B;  4KHZ A;  3M4Y A;  1HRJ A;  5COR A;  3C1F A;  1CQF A;  3V96 A;  2HQE A;  4UAI A;  3FKI B;  1I4Q A;  4X3U A;  2XWB B;  2EY2 A;  2K5D A;  2A74 C;  4KY7 A;  1O7Y A;  4ODG A;  1Z6H A;  1Y8P B;  1LT4 D;  4NKL A;  1U4R A;  3GQB A;  2KCC A;  1FNV A;  4RKL A;  2Z1C A;  4RGN A;  2B2W C;  2HCI A;  3SHL A;  5IGB A;  1ILP A;  5LL6 S;  1M4V A;  4KY5 A;  1Z7T A;  2EXZ A;  4KK7 A;  1NUC A;  5JAV A;  3J7A F;  4XYQ A;  2PZU A;  5IGC A;  4Z9C B;  1M8A A;  2SOB A;  3HP3 A;  3MFY A;  4ID6 A;  1BNZ A;  2JP1 A;  3DHQ A;  3FVQ A;  1TWH B;  4CJ1 B;  1QWY A;  3H0G B;  3P1H A;  5C0X J;  1SMY D;  1DZ1 A;  4IFD H;  2PW7 A;  2WP8 J;  1SNQ A;  4ILW A;  1JB3 A;  4B08 A;  1PTO D;  2K04 A;  4PMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...