1A6XA

Structure of the apo-biotin carboxyl carrier protein (apo-bccp87) of escherichia coli acetyl-coa carboxylase, nmr, 49 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
MEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carrier protein
molecule keywords APO-BIOTIN CARBOXYL CARRIER PROTEIN OF ACETYL-COA CARBOXYLAS
publication title Structure of the carboxy-terminal fragment of the apo-biotin carboxyl carrier subunit of Escherichia coli acetyl-CoA carboxylase.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
total genus 7
structure length 87
sequence length 87
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1998-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a6xA00
3H94A 3OPOA 2O5JC 3ND9A 4DK0A 1ONLA 1E2WA 1Z6HA 2K32A 3WDNA 3HGBA 2A6ED 2A68D 3BDOA 1OXTA 3TZUA 3VR4A 1IYUA 1B9NA 1GUGA 2LMCB 2V4DA 2AUJD 1GJXA 1GUNA 3MXUA 1HQMC 3AB9A 3D4RA 2ZT9C 4LJZC 1YNJC 3DXJC 4H0LC 1Q12A 1SMYC 3FMCA 4TKOB 4GZYC 1I6VC 1TKWB 4G7OC 1K8MA 1V43A 5JEAH 2EJFC 2F1MA 1K8OA 3CRKC 1IYVA 2D5DA 1Q1EA 2DNEA 2O5IC 3IFTA 1EWHA 3PUXA 3L7ZC 2E76C 3VR6A 4IFDH 5K36H 3PUYA 3PUZA 3P20A 1HCZA 1ZKOA 4KN4C 3I4LA 3T51B 3A7AB 4KKUA 5BN4A 3M4YA 1GHJA 2B8FA 1FYCA 3RLFA 2JXMB 2AUKA 4DNRB 3QIAA 5JEAG 1Y8NB 1Q90A 1Y8OB 4IFDG 2D2CC 3NE5B 3I72A 5KNCA 3M85A 3KLRA 3A7LA 1QJOA 2NN6H 4JK1C 2D62A 3BG3A 3PUWA 2BDOA 2QF7A 1G291 1PMRA 3GQBA 1VF5C 3VA7A 4KN7C 5KNBA 4BA1I 1CI3M 1E2VA 3T53B 1CTMA 1CFMA 3PUVA 1GHKA 2K7VA 2NN6G 1GUSA 1O78A 2BA1A 3QJYA 1Y8PB 1HPCA 1LACA 2PNRC 3A8KE 3PV0A 4RCNA 2AWOA 1BDOA 2CW0C 2Q8IB 2A69D 2KA7A 4XTCS 4H44C 1HTPA 3A8JE 1ZYRC 2B8GA 1H9KA 1OXSC 3EQLC 1H9RA 2K33A 1YNNC 2BE5C 2BA0A 2EJMA 3IKJA 4JBWA 2E75C 4KKTA 4L8JA 4BA2I 5K36G 5BN5A 1H9JA 4G7ZC 1H9MA 2R6GA 3N6RA 3OOCA 3OW7A 4LK1C 2EVBA 4I7ZC 3D31A 3U9SA 2A69C 2JEAI 1VF7A 1T5EA 4OO1H 1DCZA 3CRLC 1DXMA 3A8IE 3GD7A 4KMUC 3VR3A 2EJGC 1DD2A 3FPPA 2BE5D 2NN6I 4KI0A 3W3AA 2DNCA 2A6HC 1OXXK 2E74C 2YYZA 4XIGS 4OO1G 5C0XH 1H9SB 4PV1C 3I73A 3LNNA 3T56B 4OGQC 1B9MA 3VR5A 1GUOA 4KHZA 5BN3A 1V8QA 5A35A 1IW7D 2EDGA 2DN8A 1OXVA 1VCIA 1FR3A 3MFYA 4HR7B 1GUTA 4KKSA 4H13C 4IQZA 2PPBC 2A6HD 3VR2A 3SE0A 1H9SA 1LABA 2L5TA 2IT1A 4TQUS 5C0XG 3M7NA 4DNTB 1E2ZA 1TU2B 2JE6I 3QG1A 1Q1BA 2JEBI 4G7HC 3SDZA 2A6EC 2A68C 4DK1A 2KCCA 1IW7C 2PCFB 5KNDA 1OXUA 1Y69U 1Z7TA 3LWUA 3ND8A 1O7LA 1A6XA 1VDZA
chains in the Genus database with same CATH superfamily
3MEFA 1GVPA 4RA8A 5C4XB 4DK0A 1ONLA 2PQAA 3FDTA 2J4XA 3HKSA 5M3MG 1NSNS 4DR2Q 3BZCA 4OELB 1XMQL 4BS9A 1I50H 4H0LC 4GZYC 2F3IA 4G7OC 4NXMQ 1EQTA 2KHJA 1G2SA 4FXGC 4OONA 2EJFC 4HEDA 3BVGA 4DV4Q 1TWHB 4IURA 5JPNC 5EGTA 4EQ5A 5I9PA 3W5OA 4A3FB 2CQAA 1B3AA 3J81E 3O13A 4C1NK 3TN2A 4KD4A 3C1EA 1II3A 1K8GA 2ZM6Q 1DOMA 4JI8L 1D7QA 5F2DA 3I4MB 4JI1L 2E2JH 4GOPC 3IRBA 1VQIA 3AMUA 5JAVA 1XNRQ 1I4RA 1V1QA 1HH2P 5GADC 4JBMA 3PV0A 1L0YB 2QDLA 3M3YH 2Q8IB 4B3ML 1S5FD 4GNXC 1RCVD 4KLKA 3J7A5 4X64L 2R93B 3I8ZA 3EVQA 1PH3A 2BE5C 2BA0A 2ZXPA 1FJGQ 1WVLA 2JQOA 4YHHL 3S1RB 3U9SA 2XVSA 4RFBA 2ASBA 1EY9A 2SDFA 4IUQA 1N9WA 4OHJA 3D0FA 4OEMB 3HOZH 1N32Q 1A2TA 4J1MA 3PIP3 4K0KL 3HS0C 4JV5L 3R8BA 1GUTA 4X3TA 2WAQE 1H9SA 1PZKD 4JI0L 3GTKH 4DNTB 1Q3LA 4XQNA 5C3XA 1EY4A 3A0JA 1QB5D 4JOIA 5KNDA 4HMJA 1Y69U 4L5QA 1PH2A 4LF9L 2NUCA 2KEDA 1EZ6A 1WTRA 1NR4A 2UUBQ 5CV4A 2I07B 4A3JB 1DOKA 1PXUA 3NQIA 1WTQA 2A68D 4O42A 5ELCA 3D3RA 2V4DA 3HOZG 5C0XI 4QF4A 3TS2A 3PCOB 4V190 1STEA 1TWAH 2C9OA 1MIUA 3I3CA 3TREA 1K8OA 1N36Q 2D5DA 2NTTA 2B3GA 2QA4A 3E9HA 3PUZA 3NK9A 1A3TA 1EQVA 5KEEA 1GUWA 1EYAA 4XYOA 3I7FA 3A7AB 2EZVA 3S15H 1SMYD 2B8FA 5IYDH 4CKEA 1Y8OB 2EYLA 5CORA 3WOEA 2NN6H 5CV6A 1PH5A 2K5WA 4DR2L 4KY6A 1KNEA 3S1MH 5HGTA 4GOPB 1SE3A 1VF5C 1WTVA 2BOSA 2OXPA 1SE4A 5ELFA 1Y14B 4NXML 2N49A 2O4XA 1X3PA 4TRDA 5JVG3 4BY1G 1EOTA 2JA6G 4DV4L 1XNQQ 4DR1Q 4GNXB 4R8IA 1F9RA 5HY6A 3FKIH 1OXSC 2B2VA 2K1BA 3CU7A 1I4HA 2VQEQ 1JICA 2EY6A 2ZM6L 5M5XB 3RLOA 4QIWB 4DXFA 2NYZD 1CKMA 2JA7B 2N8NA 5IYDG 1XNRL 3VR3A 3F2BA 2F0LA 1UAPA 3W3AA 3GTJB 4DAYB 2JA8B 3GTLB 4DV5Q 4RKLA 2F0UA 1FD7D 4RH6A 3VA5A 2E2HB 2F0SA 3NBHA 5BN3A 5C44H 4BY7G 2Z6KA 1PA6A 3C46A 4DF7A 1FJGL 3S17B 1X54A 4R9WA 2K5DA 1JWMD 2RCFA 1LTGD 2Q2UA 3PF4A 4XT1B 2JE6I 4G7HC 1PH4A 2JEBI 4ODGA 4GLVB 3FKIG 4DAPA 4A3EB 3U58A 4O0AA 3K7UC 3K80C 2R7ZB 3MXGA 5LMNW 1SYBA 1SNQA 1B4OA 1BBWA 5JJKA 1N32L 3ND9A 1QNKA 1S40A 3L2PA 4JI7L 3I4NB 2L55A 5ELBA 3S1QH 4DN4M 2YV5A 1PV4A 2VUMG 3RZOB 1JB3A 4UDUC 5IWAQ 4CJ2C 4LW1A 1D8LA 1LT4D 2Y0SB 1TWGB 3F2UA 3KBXA 4QMGA 3AU7A 3S2HH 2HIVA 1Q1EA 5IYCG 3VR6A 4ABNA 1FNUA 3U50C 2K28A 3TS0A 2DJFC 1S5ED 3P20A 2UUBL 1W3SA 1EFID 1K3RA 2A19A 2R92G 4ALPA 2EYMA 4DNRB 1JWUD 4J6HA 2EIFA 5KNCA 2OTLA 5C0XJ 4M8AA 1PYSB 4IJLA 4Z9CB 4KN7C 5CV8A 5C6AA 1CI3M 1TWFB 4K5WA 2KJXA 1F2LA 3NPPA 2BA1A 1N36L 5C3WA 2E2IB 2PZTA 1VQ9A 1U9RA 3L3OC 2KVMA 2R6GA 3N6RA 1A15A 1U4MA 3KF8A 3P7JA 2DY8A 5FJ8H 4A3KB 1BKBA 2NBFA 1ENAA 1EY0A 2I5HA 1XNQL 3GTOB 2GVBA 2YYZA 1NTGA 4DR1L 4OO1G 4XXEA 1R9TB 1GUOA 1V8QA 1WD1A 4UHVA 1IBKQ 4R8NA 3GV3A 2VQEL 4LUZA 2ZTEA 3MFYA 4YWLA 4Y7NH 4A76A 3H3VC 4H13C 4K6LA 3HOVG 5CV7A 2F03A 3M7NA 1KAAA 1JQYD 1SE2A 2J7ZA 4MHEA 2FFKB 3NWTA 5I4DA 2VB3X 1YZ6A 1YJ9A 4WJ4A 3K0XA 1F9SA 2B63B 1L2FA 3GTGH 4NKLA 3PO2G 2JA5G 4DV5L 1UNSA 1VQPA 3R2TA 4C3HB 3S14B 3KFUA 5IT9c 4C3JH 4KHPQ 2K32A 2NVYB 3S16H 1UE6A 4DV6Q 2C35B 1I6HB 2EYOA 3DHQA 1TS3A 1STNA 1DJRD 2AUJD 1B1ZA 3NSWA 1ET6A 5LMNQ 1YNJC 5E1FA 3J7AF 4L5SA 5AJ3Q 3E6ZX 4UAIA 1FGUA 1SNCA 1K0SA 4GKKQ 1EWHA 4IO9A 2E76C 2L4NA 4OXPA 1JOKA 2G9HD 3T16A 4LFBQ 1E22A 1AZQA 4DK3C 1C48A 3OSOA 4LF6L 2O5JC 1B3QA 4HJ7A 1EWCA 1GHJA 1FVIA 2JXMB 3KLSA 5ELNA 3V96A 1O7ZA 5IWAL 2CKZB 2NZHA 2HCIA 4C3JG 3NEMA 3KJOA 3T13A 2EYPA 3GTPB 5JVH3 3MXNA 1I4QA 2KCNA 3QJYA 1PFMA 4S3SA 1Q8KA 4DV3Q 2OQKA 2CW0C 4QJFA 3CMAA 5KGUA 1VQOA 1HTPA 3A8JE 5EBDA 3EQLC 3MA2B 1SYFA 2F0WA 3J80i 4KKTA 3TP8A 4A3DG 1PH9A 4G7ZC 3OOCA 4LK1C 1MD2D 3C2PA 3PO3B 4A4IA 1J5EQ 1X3QA 1O7YA 1SYCA 1DXMA 3EFXD 3D8GA 1NE3A 3FPPA 3EA6A 1DYQA 2DJGC 1AN8A 1X3FA 3ONAB 2K03A 1NCVA 5D65A 3VYTA 3KF6A 5M5YB 1ZEQX 3JAME 4FF4A 5ELEA 4NDXA 4X3KA 1WCMG 1DOLA 1NUCA 3FP9A 4JOIC 3UDFA 4CDCC 1KQSA 1C7YA 3RNUA 2UUCQ 2A6HD 1X32A 1WJJA 3RZDB 3M4OB 5H1SE 5E4XA 3A56A 3URYA 2PQAB 1XWEA 2EOTA 4LUOA 2ZTCA 3VYSA 1A6XA 1ILQA 1B53A 1JR0D 4A3IB 4A3GH 1YIJA 1ZXTA 1SNOA 1CQFA 1HR0W 1PTOH 4BBRH 1IBKL 1I4XA 2IX1A 4HIDA 2NVXB 5IT9L 1Y1WH 1O80A 3MXPA 1SJHD 4TKOB 4JYAQ 4DA2A 5M3FH 2Z1CA 3CRKC 2WAQG 3IFTA 2R61A 2ES2A 5LL6S 4IZ8A 5IOCA 5CC4A 4JI6Q 1HCZA 1Z9FA 1AP0A 2ZJQA 1A3UA 4KKUA 5DM63 3OTOQ 3SK5A 1SE8A 2CVRA 5JOBA 1SJED 3I72A 2B2WA 3PMFA 4JK1C 4HJ5A 3S9WA 5EKIA 3S1NH 4C3IH 3MVVA 1SN8A 5LMNL 1E2VA 2MJ8A 3U4ZA 1BOSA 1KL9A 1PTOF 4IUPA 4C1NI 1VQDA 5AJ3L 2YU9B 4JBKA 4NPSA 3KK7A 2KBNA 2EY5A 2RA4A 2QKIC 1SBBB 4BBRG 3HOWB 2B2VC 2F0KA 2ATWA 4GKKL 1YBYA 2L0CA 3A8KE 1SFOH 2QEXA 3CQZH 1Y1VB 2GN5A 1E7ZA 1X3GA 2KA7A 2PO4A 1XYIA 4LFBL 4FVMA 2NTSA 4EQNA 1RTNA 1G6PA 3HOYH 2UXCQ 3GTMH 4IJHA 1I3QB 4BA2I 3M9BA 4F7XA 1KDCA 4X3SA 1KRSA 2EYHA 1B70B 2RHQB 1LTID 3BJUA 1U5KA 3D31A 2I46A 1UEAB 1VF7A 5J1ZA 1F2MA 4FXKC 4QL5A 1Q46A 2XRSD 1W6JA 2BE5D 1LTBD 2EY1A 2Z6KC 1RTOA 4DXGA 1DONA 4DV3L 5EAYA 2IL8A 1PYBA 1H9SB 2VQFL 4K0KQ 4MNOA 2ZXOA 1IW7D 1SXTA 3AFQA 3TP5A 1OXVA 2OTJA 3ZJYC 3H3VI 4V0BA 1LM0A 2WB1B 4JPBW 2K52A 2L5TA 3WOFA 2Z4HA 1LTLA 1EQQA 1TWCH 3HOYG 3CXCA 4X6AH 4QGUA 4LWCA 4A93B 5M3MH 1VDZA 2KEEA 2Q8TA 1EL0A 2RF4A 4NP5A 3OPOA 4UPAA 1KLUD 3TDQA 1E2WA 1KDBA 3OWEB 2X6GA 3TSSA 4CJ1B 1YHQA 2YTXA 3U9OA 2UUCL 2EXDA 1JJCB 3VYUA 1HQMC 1TS2A 5ISRA 4DUYQ 2JA9A 4K5VA 4A3MB 5A2QE 1HR0Q 1S72A 4NB3A 5FO7B 1JT8A 5K36H 4L6TB 2AQ1B 1ZKOA 3T51B 3F2DA 1SROA 2AUKA 1IBML 1VQMA 3SEBA 2HDLA 1XTDA 5D14A 1NAPA 3BG3A 4CKBA 4DV0Q 3K57A 1PVOA 1EYDA 1V9PA 3GQBA 3VA7A 1QUQA 3T53B 4DNIA 2Q2HA 4KTAA 5C5LA 4JYAL 1CTMA 2F0FA 5ELOA 1KABA 1Y8PB 4BWGB 3RN2A 3TRZA 2PNRC 4BBSG 1ML0D 4FNFA 2BH2A 1I50B 4GN5A 1FNVA 4JI6L 4L5RC 4IPDA 3QOLA 1R4PB 3OTOL 1VQCA 5JJIA 1VS0A 4IFDI 1CZGA 3AFPA 3LGJA 5K36G 1LV9A 3V05A 3J7ZC 4B3RL 4I7ZC 2X6LA 1LT5D 1BCPD 1HUMA 3MZ5A 4YIJA 5IP9G 1IL2A 2EYFA 3NBHB 3PQIA 4KMUC 3RLNA 1MJEA 3NHHA 1DD2A 4KI0A 4U673 2IHFA 2E2JB 2CFMA 1IXRA 1LUZA 5C4XG 5JEAJ 4AYBE 4B08A 2N78A 2UUAL 2UXCL 2AKWB 3J81c 3KJPA 3Q6SA 1M90C 3M3YB 4K14A 4YWMA 2KQ3A 3SE0A 1G51A 2M2LA 5C0XG 2K6AA 3QG1A 3CCJA 1SYDA 3X3NA 3SGIA 2HIXA 3PIOA 1IW7C 3QR8A 1J6QA 5D3IB 4LNQA 2KHIA 4LMQD 5LL6X 4A3FG 4FXDA 4MZ9A 1QCBD 4IOCA 4YWKA 2K14A 4JI7Q 4G4KA 3EROA 2MQHA 2AHOB 1EIHA 3HOZB 4CHTB 3D4RA 4LJZC 3DXJC 4F87A 4CDEC 4PQXA 2PW7A 1NNXA 2PI2E 1R4QB 1SDFA 4KK7A 3GTKB 4IPCA 4WFN3 5IGEA 2F0IA 5EKKA 2KENA 4POGA 1JCKB 1YJNA 2R93G 2K05A 2FHTA 4BY1H 2RHSB 1A2UA 2JA6H 3K7AH 4NXNQ 1AE2A 2OCEA 5KYIA 4BA1I 4DUYL 2A73B 3PSIA 4L5TA 2NVQH 4ILWA 4MTKA 1HR0L 4CKCA 1PH1A 1VQJA 4DV7L 2AWOA 1BDOA 1UE5A 3D4WA 1ILPA 2A69D 3KF8B 1SYEA 1TWAB 1NY4A 2B8GA 2C5CA 3SR1A 4OX9Q 2LSSA 4OWXB 1WTXA 1PRTC 4JBJA 1CSPA 2KUMA 2K5QA 4DV0L 5I6YA 3S15B 1VQKA 2B29A 1I4PA 3PGZA 4BY7H 1GM5A 1IKLA 2M9VA 2DNCA 1K8AC 4KJNA 3S1MB 1D2BA 1LTSD 1KXLA 1BCPC 5CBEE 1LTAD 1RJTA 2VL6A 4A3JG 4ZUIA 4IFDJ 2D0OA 1VQGA 4DPGA 3V2TA 4X65L 5NUCA 2LXJA 4TQUS 3CF5A 1STAA 1AW7A 2B2TA 3FKIB 1JOQA 3CD6A 3J81L 2KCCA 3MAQA 5G3LD 5I2YA 1GD7A 4K2LA 3U4VA 1O7LA 2P5ZX 4TSSA 3DWAA 3K0YA 2VUMH 5EJWA 3UDIA 1ASYA 1PZJD 4A3LG 2F0JA 1UE7A 1S5CD 1YITA 4ZAIA 4X3UA 4DUZQ 3CCRA 1IYUA 3F8TA 5IYCH 4R4CA 1A63A 1Q12A 5C44B 1KD1C 3EN2A 4HCSA 1TY0A 2A74C 2R92H 3CC7A 4XDXA 3I2ZA 2DNEA 2CH4W 4AH6A 5JJLA 4E6IA 5IP7G 2B2WC 3BZKA 3JC66 5T1GA 1MJCA 3E0JA 4Q0FA 3D6WA 4LF6Q 1YNJD 2VZAA 4Q5VA 1VQ8A 2XRQD 1NMFA 4C2MH 2D2CC 1Q7YC 2NZ1D 3R3OA 3MXNB 3HKZE 5C4HA 4PG3A 2R7ZH 2K4KA 3MHBA 2QF7A 2BCOA 2AWNA 2JA7G 2Q8RE 1UE1A 3CW2C 4K2KA 1WYDA 3NXWA 3S1QB 1K9MC 4J8QA 1HRJA 5C3EH 2QCPX 2JA8G 1F2YA 3RZOH 4DR3Q 1SR3A 2VNUD 4A3BH 4RHSA 3P1HA 3G6JB 3W2DA 1TWGH 3J80E 2G9DA 3TMEA 3S2HB 1AZPA 1B44D 1U0LA 2ICIA 1M1KC 1PRTB 4JI5Q 5BN5A 4B3TQ 4NXNL 2WIIB 2CW0D 3SK4A 2A69C 4OO1H 3Q24A 5J39A 4R4TA 2F0PA 3KF6B 1QWYA 2NN6I 2LS01 2R7ZG 4OIKA 3K5MA 2RBMA 3STBD 3HOVH 5E4WC 4XQJA 1BCPB 3FRPB 3R93A 3VR5A 2HDMA 1VQLA 3I4NG 3T1HQ 4JI4Q 2MO1A 4WJWA 3CKIB 5C3EG 4OX9L 1FR3A 3TP6A 1QZGA 3CMEA 1V1PA 1HTLD 4KY7A 4A3BG 3PO2H 2JA5H 1E2ZA 5DLQE 5FOBB 4DK1A 4JC0A 2PMZB 1RF2D 2QILA 2F0QA 2JK8A 4CGYB 3S2DH 1WTHA 4JI2L 1B7YB 4A3KH 1LYLA 4ZLTF 2VW9A 1L1OA 3BVZA 3HGBA 1Q8IA 3CC4A 1VMPA 4HSVA 4FO2A 5COYA 1GJXA 4N9TA 5LHY1 4NW2A 3AB9A 5EPKA 1AE3A 3FMCA 3GDEA 2F1MA 2PQEA 4Y7NB 3CC2A 5FO8B 2RDFA 1DM0B 3L7ZC 3PUXA 4JI3Q 3SXHA 4HSPA 4K8IA 1J9OA 1ICFB 1F9PA 2JJQA 1Y8NB 5LMUL 3NE5B 4DUZL 1HNXQ 3GTGB 1EU3A 3HP3A 3J7YW 1G291 4C3JB 4A3KG 3CCLA 3EIVA 5KNBA 3SK6A 3CCSA 3S16B 1PTOC 3I90A 2XNAC 1PDQA 2A5HA 1CFMA 1YNXA 2B2YA 3L0OA 2V1CC 5FLXE 3HOUH 4A3DH 2Z9HA 3UDXA 1D5XC 3TZDA 1LT6D 1X3EA 4YCUA 2XSCA 4KY5A 1JE4A 1UUPA 1D5ZC 4RHRA 1IBLQ 1STYA 1JJ2A 5GQOA 1JMCA 1BNZA 1VQ7A 4H7BA 3ER0A 2K75A 4IALA 1GXDC 3G71A 1WCMH 1BQQT 1HZ9A 2B63G 4PZ6A 4XYQA 1B50A 4QUFA 1G91A 1HA6A 4A75A 1SYGA 4N9PA 4K6DA 5JJZA 2OQ0A 4DR3L 4ZKCB 1X55A 2VQFQ 4MTNA 1S5BD 2CWPA 1JORA 5A35A 3TP7A 1SLJA 1VQAA 3L9AX 4HR7B 3HOUG 5IY0A 4JI5L 2KHSA 3STBC 2E5LQ 2IT1A 4B3TL 5IE8A 5T1IA 3MEHA 4LAAA 4R4OA 1K83H 3NUCA 2K5NA 2NWGA 1JC7A 5HURA 3HEJA 3T1YL 3H94A 1C0AA 1ESFA 2HQEA 3DMUA 4RGTA 1S3OA 2F0NA 1W6KA 3TZUA 3T1HL 4JI4L 3NBIA 4WRDA 3NQTA 4R1JA 1CKOA 4UP9A 4AYBG 2SOBA 2RDHA 2HCCA 1RDPD 3KLWA 2Z0SA 4EQPA 5FLMG 2CWAA 1IYVA 1EIGA 1SNMA 3PF5A 3K81C 4GN4B 1Q82C 4ZRZA 4RG1A 4QIWE 4H02A 5JEAG 1FYCA 1QUQB 2F52A 1IBMQ 3SK8A 3E5SA 3JAMc 1YJWA 1JJGA 3KLRA 1QJOA 1Z47A 1T9HA 3QOJA 4HIOA 4A3GB 2AQ2B 1PTOB 1TXYA 1D6EC 3CCEA 2LFNA 1O78A 3RR5A 1SEBD 3GTQH 4JI3L 5FO9B 1Y1WB 5ELDA 4I7AA 2WKDA 1STHA 5CV9A 1K0RA 2MHVA 4DU9A 5M3FB 1XX8A 1PLFA 2I0QA 2ZTDA 5EKLA 3OYYA 4L8JA 1HNXL 2HHHQ 1WFQA 2PW5A 4QB4A 5DM73 3OW7A 4B3RQ 1OO9B 2RDGA 1A3VA 2RSNA 4CDDC 1XPOA 3KYHC 2RSOA 2EJGC 2YTVA 2F0EA 3S1NB 4C3IB 3SVMA 1WTWA 3KLSX 3FHWA 2Z6BA 3Q8DA 4PZ7A 4B9XA 2B2TC 5KIXA 3CCMA 2UUAQ 2F3WA 2Y0SE 1F77A 1ET9A 1SFOB 4LF7Q 3CQZB 3BDCA 3NTKA 2HQLA 3ULPA 3CCVA 5IGFA 1IBLL 4F8MA 2OEOA 4Y52H 1STBA 3HOYB 2ALYB 2Q2TA 5K5PA 3GTMB 1AEXA 2CCZA 2PCFB 2Z4IA 3DLLA 2DY7A 2J0TD 4XQQA 3CAMA 5CV5A 1SMXA 4PZ8A 1D1IA 2JN4A 2PZWA 3ERSX 4MIUA 2IPKD 2XWBB 3VR4A 3I55A 1VQ5A 3G6EA 4IUUA 1CQVA 1SSOA 4U68A 2E5LL 2ZT9C 3HOXH 3A5ZB 1I6VC 4BXXG 3HOWG 3T4AC 3SHLA 2HD3A 3DWPA 2KCTA 2TMPA 1U4PA 5CMDA 4DKAC 1QE6A 1Y1VG 3A54A 3IFDA 1TS5A 4QQBX 1HQRD 1TWCB 1X6OA 3EBEA 2BDNA 1BBUA 3QIAA 1RKNA 5M5WH 1MBYA 4IFDG 2H5XA 5M3MB 1UEBA 1EIFA 1EYCA 2WACA 3H0GH 2F4VQ 5E3FA 1KNAA 4BBSH 3W1GA 1E1OA 3QB3A 2L1BA 3RUZA 1CKNA 5EQ0A 5M9OA 3JAML 1FL0A 1DZ1A 4X62Q 1O7IA 4OIJA 4EGVA 2QEJC 5C4ZA 4DV7Q 1ASZA 3HOXG 2NVTH 2SEBD 4FF2A 1KAWA 2KOLA 1ZYRC 5KRUA 4CDFC 5IP9H 4YY3Q 1SRUA 1QNUA 5C4JH 1E3PA 4UY8C 1Q86C 1H9MA 4LF4Q 1X56A 1DCZA 2PI2A 5C4XH 2NB0A 3BZDB 3NTHA 3HKZG 1SNPA 3CPFA 3H0GG 4A93G 1PRTD 1SNDA 3KDFA 5C0XH 2CHBD 3LNNA 1XXGA 4DAMA 1EY5A 1I5FA 1K3BC 4EQOA 2M00A 3G7LA 4YCVA 2KECA 1U4RA 1TWHH 1I94Q 4KKSA 4PMWA 2HHHL 5DEHA 4X65Q 1ICWA 5FKAC 4ME5A 1RL2A 4A3FH 1GO3E 2E2DC 2JYOA 2ZXRA 4C56C 3M4PA 2F0GA 4A3MG 2A6EC 5BR8Q 1TR5A 2VY3A 1L1OC 1Z7TA 1WI5A 1TY2A 4FDBA 3I4MH 2AQ3B 4CJ0B 2XIWA 1QILA 1CA5A 1Z6HA 1JE5A 2G5DA 3AEVA 2F3VA 3GP7A 4LF7L 2MFIA 3MFGA 3TBIB 4CBVA 1TS4A 3BVMA 4APVA 4GN3B 3CP0A 1EZ8A 2FINB 3X3MA 4ZK9B 1WTOA 4QY7A 2I5LX 2LXKA 2R93H 3K5NA 1E0BA 1EY6A 3NTIA 1L0XB 2ZJRA 3UDGA 1ENFA 2F4IA 2F0TA 3DM1A 3NELA 1D1KA 3S1RH 1L0WA 1IKMA 1NBWA 2F0DA 1NJIC 1HFGA 1RD9D 1S4ZA 5FK9C 2D62A 2B2YC 2N55A 3I4MG 1PMRA 4FP5D 4N8FA 3F2CA 3KUPA 4AIMA 1HPCA 1C8CA 1EEID 1KTKA 3H15A 4FF1A 3CCQA 2B2UA 1WOCA 4DR5Q 2MP1A 2VXWA 1N34Q 1CA6A 1H9RA 2K04A 5GROA 3K58A 1W2BA 2IY5B 2SNMA 4ZCKA 2DUDA 2F4VL 5D3DA 4K8JA 1CHPD 4EX5A 3FPUB 4K5XA 1A0IA 5GAHC 3A8IE 4A3JH 4M1UB 4KJOA 4IPGA 3QO2A 2HUGA 4BY1B 2AMCB 2JA6B 3K7AB 4X62L 2A1AA 3K59A 3UE0A 5GAEC 4GLXA 4LFCQ 2EQSA 3TQYA 1V1PB 1BBXC 3I73A 3T56B 1YI2A 4RGOS 2NVQB 1XTCD 4YY3L 2Z8LA 2K50A 5A2QL 1C4QA 2F0VA 1KRTA 4RKBA 4JG2A 4DFAA 4LF4L 5IGDA 4A3LH 4FF3A 1IL8A 3HG9A 1L1OB 1BO0A 1ENCA 4DR6Q 4JI2Q 2XN9C 2TSSA 4XT3B 1CSQA 5EPJA 5C5MA 3DEOA 5TSSA 4BY7B 3WDNA 1OXTA 1GUGA 4KD3A 3PIPA 1I94L 1GUNA 2QGQA 5IP7H 4F88A 2K5HA 5BR8L 2O5IC 4HN7A 2VS1A 3E9IA 1SAPA 1HXYD 1HJPA 4ULLA 5M5XH 1PZID 4RMFA 3WWVA 2ICEC 4OWWB 2X69A 2WV6D 2JA7H 2IX0A 1STGA 3J81i 3K5LA 1J8IA 5LMUQ 3M85A 2ZJPA 2VUMB 1HZBA 3DUZA 5E7NA 3GTJH 2JA8H 3GTLH 3D6CA 2F0OA 3W1BA 1KLGD 2N3SA 2EY2A 2E2HH 2RKSA 2IHEA 1F9QA 1IYJB 2NN6G 3DWQA 1TVXA 3S17H 1QVFA 2Q2IA 4B3SQ 2R92B 1YHAA 4H44C 2WB1E 2IW3A 4DV2Q 2D0PA 1PTOD 4A3EH 4DR7Q 4ZYSA 4MN3A 3CCUA 1H9JA 4WJ3M 4L63B 1Q81C 1BF4A 2UU9Q 2JEAI 3KOJA 1T5EA 1WTPA 1D5MC 1P16A 4C2MB 2CH4A 2K5VA 3I4NH 3DM3A 1XPRA 4JW0A 3UE1A 1VQBA 5CBAE 1EQRA 2H4OA 4J15A 1HHVA 2WP8J 1VQHA 1B9MA 4OGQC 3ULJA 4DR5L 2EDGA 4B9WA 3I70A 4GS3A 5C3EB 1N34L 1CUKA 1EUJA 4IQZA 2R7FA 1BR9A 4O2DA 3Q22A 4A3BB 4AQYQ 1IHZA 4PMBA 1Q1BA 3K5OA 3R2IA 5C44G 3SDZA 5DAUA 1EEFD 2A68C 3G48A 5CR3A 4A3EG 1TQOA 2LY7A 4LF5Q 4G57A 2WINB 2I5MX 3A7LA 1B8AA 4YCWA 3T1YQ 4LFCL 4POFA 2IX3A 4FYDA 2QW7A 2MO0A 4ME3A 4PNYA 1QOHA 1TWFH 4UP7A 2O2LD 1PH7A 3C3LA 1VQNA 1PFSA 3J80c 1B9NA 2L9HA 2LMCB 4TVAB 3HOVB 2RVLA 1TIID 4HJAA 1SMYC 3IL8A 1HZCA 2Y0SG 1TKWB 2E2IH 1V43A 1XPUA 1EWIA 2R7DA 4QUCA 3OIPA 1EY7A 4DR6L 3PO2B 2JA5B 2UXDQ 4EVOA 2L11A 1HZAA 4KN4C 3I4LA 5I2XA 1UWVA 2SNSA 1CK1A 1Q90A 4RGNA 3UI2A 2QDBA 3S2DB 1PRTF 3VDYA 3MC0B 5HGQA 1AH9A 3GTOH 4HTHA 1R9TH 1YNND 1QVGA 2H1EA 4GKJQ 1GUSA 1N8RC 1U4LA 4LFAQ 3OMCA 4GOPA 5IT9E 1M8AA 3C1FA 1T5XD 1MGSA 1BCPF 3VYRA 1CM9A 2EXZA 2PYKA 4HAEA 1H9KA 4JCVE 2CQOA 3ICEA 2D9UA 1X65A 3S24A 4IOAA 2E75C 4R4IA 1C9OA 4GNXA 2B63H 2IWHA 4RCOA 3OHXC 4HIKA 1CHQD 3H91A 4C3HH 3S14H 1KC8C 1EOVA 4X66Q 5IGCA 2UXBQ 3GD7A 1BXTA 2NVYH 4P73A 1I6HH 5L37A 1VQEA 4IPHA 4IN3A 1OXXK 2E74C 4XIGS 5FJ8G 4DR4Q 3TEHB 1I4GA 4PV1C 1E24A 4B3SL 1TT2A 4KHZA 5IODA 4DV2L 1PFNA 2DN8A 1CZWA 4DAYA 3HOUB 1V1OA 1VCIA 4DR7L 4A3DB 2PPBC 3H09A 3VR2A 1EFWA 3I56A 1BUVT 2FMMA 1PH8A 2UU9L 3GV6A 3NP8A 2VB2X 1HNWQ 1DGSA 5IGGA 4P2CB 3ND8A 1RIPA 4N8X1 4ZKBB 1EYGA 3A5UA 4IUNA 4OO1I 5FLXc 4P72A 4C3HG 1EY8A 1YEZA 3HZXA 3GTPH 3BDOA 3KBGA 5FLMH 1WCMB 2N88A 4AYBB 2MNAA 4HJ8A 4P71A 1RODA 2PZUA 5IGBA 4AQYL 3BDLA 4HMIA 1GKHA 1K8MA 4UP8A 1B2TA 5JEAH 3J80L 1JWSD 2MUYA 4RAUC 2EE1A 3I91A 4DV1Q 4LF5L 1QZHA 1KDAA 1G8ZD 2RCNA 3PO3H 3M4YA 1K83B 3LWEA 4HCEA 3RLFA 1CKNB 4HJ9A 1LTTD 3BU2A 5CGKA 1VMCA 1ESRA 2WKCA 2K01A 2MGSA 2BDOA 2JP1A 2XWJB 2L12A 1N33Q 3EJIA 2FJ2A 1FNWA 2XGTA 2B2UC 5KYLA 5M5YH 3AYHB 3PUVA 1HNZQ 2K7VA 1PFBA 1LO5D 2WAQB 3H3VH 1XMOQ 1G2TA 2UXDL 2OF1A 4XTCS 3RZDH 3M4OH 1X9NA 1JOOA 2HT1A 2XTIA 2K33A 5AFWA 1YNNC 2EJMA 4RWSC 2PNHA 3IKJA 1IZ6A 4JBWA 4LF8Q 3K6OA 5IIFA 1LLRD 2EVBA 4DAVA 5JPMC 4A3IH 3PO3G 3KDFB 1QG7A 1ZYRD 3CRLC 3FEWX 5I9OA 1KIXA 4BBRB 4GKJL 3RN5A 2GA4B 3J7AV 3E0EA 5EBCA 4LFAL 3HRZC 2NVXH 3DEPA 4ZQ3A 2JSOA 3H6MA 1K73C 3M7GA 5J3BA 2B39A 2WFWA 4GLAC 4LUVA 5G3LF 1VQFA 1NMGA 2DGYA 3N52A 2MPMA 3Q0AA 3GTQB 1NR2A 3FVQA 1OTCA 1XMQQ 1LABA 1MSHA 1A62A 3MTSA 2BH8A 4X66L 1OXUA 2UXBL 1FGBD 4OL7A 3NENA 1MHWC 3AQQA 4WORA 1F2ZA 1K28A 1XJVA 3B6YA 3CPWA 4A3IG 2OWOA 4DR4L 1MI2A 2RQXA 2EYJA 1BVSA 4KHPL 3A55A 2A6ED 3BYTB 4DV6L 3MWYW 1QVCA 3A74A 3J81j 2YU9H 4BXXH 3HOWH 4JI8Q 4P74A 1VQ6A 4JI1Q 5FLXL 4A3GG 3MXUA 2ENBA 1M4VA 1H95A 1Y1VH 3ERQA 4JVZA 1HA5A 3F1ZA 4IUTA 1HNWL 4R4QA 5J22A 4IFDH 4DK6C 2OT2A 1I3QH 1G6ZA 1MSGA 1E1TA 3PUYA 1Y1WG 4B3MQ 1CT1D 4P75A 2A8VA 5BN4A 2ID0A 4X64Q 5M3FG 1EU4A 2NZOA 1EIYB 3BYYB 2F0HA 5EPLA 3P75A 3OW2A 4O1NA 3D4DA 5I6WA 4YHHQ 4HIMA 4KHVA 3PUWA 4QCLA 2YTYA 3OWFA 3IAYA 3BS1A 1YHBA 3ULLA 4NMZA 1HFNA 2FMCA 3E3XA 5DNFA 1GHKA 1PHJA 3QWNA 4C3IG 1LACA 4RCNA 3RD4A 4DV1L 3Q23A 3HOXB 2GVAA 3HFZB 2LKVA 1A8VA 4A3CH 1AFPA 1HUNA 4KV6A 3I4OA 5IYBH 4JV5Q 3ITPA 5CYUA 1P8LA 1S5DD 1YVCA 2E8GA 2PMZE 3M4QA 4I65A 4JI0Q 4A93H 3NWSA 1GOZA 1J5EL 1N33L 1RHPA 5M5WB 2R3ZA 1PH6A 3HKZB 2EPBA 1HNZL 3ZYYX 3H0GB 1LTRD 3GO5A 4RGMA 4LF9Q 2A6HC 4OWTB 4BBSB 1LT3D 5GAGC 1JB7A 2FXQA 2L15A 1XMOL 3OIQA 4A3MH 4IUVA 3JAMi 2F0MA 4LF8L 3LX0A 3PIO3 4ZUJA 3K8AA 4DGZA 2NVTB 1KHIA 2WB1G 4ID6A 1PYWD 3G4SA 4A3CG 1TU2B 3OMGA 4PMCA 3CHBD 5IYBG 1MKHA 5C4JB 2IJ0A 1VQ4A 3LWUA 3RMHA 2KCMA 1WD0A
chains in the Genus database with same CATH topology
4RA8A 5C4XB 4DK0A 1ONLA 3FDTA 2J4XA 1NSNS 4BS9A 4H0LC 4GZYC 4G7OC 1EQTA 4FXGC 1G2SA 2EJFC 4HEDA 3BVGA 1TWHB 4IURA 5JPNC 5EGTA 5I9PA 4A3FB 2CQAA 1B3AA 3J81E 3O13A 4C1NK 3TN2A 4KD4A 3C1EA 1II3A 1DOMA 5F2DA 3I4MB 3AMUA 5JAVA 1I4RA 3PV0A 1L0YB 2Q8IB 1S5FD 1RCVD 2R93B 3I8ZA 3EVQA 2BE5C 2BA0A 2ZXPA 1WVLA 3S1RB 3U9SA 2XVSA 4RFBA 1EY9A 2SDFA 4IUQA 4OHJA 1A2TA 4J1MA 3PIP3 3HS0C 3R8BA 1GUTA 4X3TA 1H9SA 1PZKD 4DNTB 1Q3LA 4XQNA 5C3XA 1EY4A 1QB5D 5KNDA 4HMJA 1Y69U 2NUCA 2KEDA 1EZ6A 1WTRA 1NR4A 5CV4A 2I07B 4A3JB 1DOKA 1PXUA 3NQIA 1WTQA 2A68D 4O42A 5ELCA 3D3RA 2V4DA 5C0XI 4QF4A 4V190 1STEA 2C9OA 3I3CA 1K8OA 2D5DA 2NTTA 3PUZA 3NK9A 1A3TA 1EQVA 5KEEA 1GUWA 1EYAA 4XYOA 3A7AB 2EZVA 1SMYD 2B8FA 4CKEA 1Y8OB 2EYLA 5CORA 3WOEA 2NN6H 5CV6A 2K5WA 4KY6A 1KNEA 5HGTA 1SE3A 1VF5C 1WTVA 2BOSA 2OXPA 1SE4A 5ELFA 2O4XA 1X3PA 4TRDA 5JVG3 1EOTA 4R8IA 1F9RA 1OXSC 2B2VA 2K1BA 3CU7A 1I4HA 1JICA 2EY6A 5M5XB 4QIWB 4DXFA 2NYZD 2JA7B 3VR3A 2F0LA 1UAPA 3W3AA 3GTJB 2JA8B 3GTLB 4RKLA 2F0UA 1FD7D 4RH6A 3VA5A 2E2HB 2F0SA 3NBHA 5BN3A 3C46A 4DF7A 3S17B 4R9WA 2K5DA 1JWMD 1LTGD 4XT1B 2JE6I 4G7HC 2JEBI 4ODGA 4DAPA 4A3EB 2R7ZB 3MXGA 1SYBA 1SNQA 1B4OA 3ND9A 1QNKA 3I4NB 2L55A 5ELBA 4DN4M 3RZOB 1JB3A 4UDUC 4CJ2C 1LT4D 2Y0SB 1TWGB 3F2UA 3KBXA 4QMGA 3AU7A 1Q1EA 3VR6A 4ABNA 1FNUA 2K28A 1S5ED 3P20A 1EFID 2EYMA 4DNRB 1JWUD 4J6HA 5KNCA 5C0XJ 4M8AA 4Z9CB 4KN7C 5C6AA 5CV8A 1CI3M 1TWFB 4K5WA 2KJXA 1F2LA 3NPPA 2BA1A 5C3WA 2E2IB 2PZTA 1U9RA 3L3OC 2KVMA 2R6GA 3N6RA 1A15A 1U4MA 3KF8A 3P7JA 2DY8A 4A3KB 2NBFA 1ENAA 1EY0A 3GTOB 2YYZA 4OO1G 4XXEA 1R9TB 1GUOA 1V8QA 1WD1A 4R8NA 3GV3A 3MFYA 3H3VC 4H13C 4K6LA 5CV7A 2F03A 3M7NA 1KAAA 1JQYD 1SE2A 2J7ZA 4MHEA 2FFKB 3NWTA 5I4DA 2VB3X 1F9SA 2B63B 4NKLA 1UNSA 3R2TA 4C3HB 3S14B 2K32A 2NVYB 1I6HB 2EYOA 3DHQA 1TS3A 1STNA 1DJRD 2AUJD 1B1ZA 3NSWA 1ET6A 1YNJC 5E1FA 3J7AF 3E6ZX 4UAIA 1SNCA 1EWHA 2E76C 2L4NA 1JOKA 2G9HD 3T16A 1AZQA 1C48A 3OSOA 2O5JC 1EWCA 1GHJA 2JXMB 3KLSA 3V96A 1O7ZA 2HCIA 4C3JG 3T13A 2EYPA 3GTPB 5JVH3 3MXNA 1I4QA 2KCNA 3QJYA 1PFMA 4S3SA 2CW0C 5KGUA 1HTPA 3A8JE 5EBDA 3EQLC 3MA2B 1SYFA 2F0WA 4KKTA 3TP8A 4G7ZC 3OOCA 4LK1C 1MD2D 3C2PA 3PO3B 1X3QA 1O7YA 1SYCA 1DXMA 3EFXD 3D8GA 3FPPA 3EA6A 1DYQA 1AN8A 3ONAB 2K03A 1NCVA 5D65A 3VYTA 5M5YB 1ZEQX 3JAME 4FF4A 5ELEA 4NDXA 4X3KA 1DOLA 1NUCA 2A6HD 1X32A 3RZDB 3M4OB 5E4XA 3A56A 3URYA 1XWEA 2EOTA 3VYSA 1A6XA 1ILQA 1B53A 1JR0D 4A3IB 1ZXTA 1SNOA 1CQFA 1PTOH 1I4XA 2IX1A 2NVXB 5IT9L 1O80A 3MXPA 1SJHD 4TKOB 4DA2A 2Z1CA 3CRKC 3IFTA 2R61A 5LL6S 4IZ8A 5IOCA 5CC4A 1HCZA 1AP0A 1A3UA 4KKUA 5DM63 3SK5A 2CVRA 5JOBA 1SJED 3I72A 2B2WA 3PMFA 4JK1C 3S9WA 5EKIA 3MVVA 1E2VA 2MJ8A 1BOSA 4IUPA 1PTOF 4C1NI 2YU9B 3HOWB 3KK7A 2EY5A 2RA4A 2QKIC 1SBBB 2B2VC 2F0KA 2L0CA 3A8KE 1Y1VB 2KA7A 2PO4A 1XYIA 4FVMA 2NTSA 4EQNA 1RTNA 1I3QB 4BA2I 4F7XA 1KDCA 4X3SA 2EYHA 1LTID 3D31A 2I46A 1UEAB 1VF7A 5J1ZA 1F2MA 4FXKC 2XRSD 1W6JA 2BE5D 1LTBD 2EY1A 1RTOA 4DXGA 1DONA 2IL8A 1H9SB 2ZXOA 1IW7D 1SXTA 3TP5A 1OXVA 4V0BA 2WB1B 2L5TA 3WOFA 2Z4HA 4A93B 1VDZA 2KEEA 2Q8TA 1EL0A 4NP5A 3OPOA 1KLUD 3TDQA 1E2WA 1KDBA 3OWEB 2X6GA 3TSSA 4CJ1B 3U9OA 3VYUA 1HQMC 1TS2A 5ISRA 4K5VA 4A3MB 5A2QE 5FO7B 5K36H 4L6TB 2AQ1B 1ZKOA 3T51B 2AUKA 3SEBA 2HDLA 5D14A 1NAPA 3BG3A 4CKBA 3K57A 1EYDA 3GQBA 3VA7A 3T53B 4KTAA 5C5LA 1CTMA 2F0FA 1KABA 1Y8PB 4BWGB 2PNRC 1ML0D 4FNFA 1I50B 1FNVA 3QOLA 1R4PB 4IFDI 1CZGA 5K36G 1LV9A 3V05A 4I7ZC 2X6LA 1LT5D 1BCPD 1HUMA 3MZ5A 4YIJA 2EYFA 4KMUC 3NHHA 1DD2A 4KI0A 4U673 2E2JB 5JEAJ 4B08A 3Q6SA 3M3YB 4K14A 2KQ3A 3SE0A 2M2LA 5C0XG 2K6AA 3QG1A 1SYDA 3X3NA 1IW7C 5D3IB 4LMQD 5LL6X 4FXDA 1QCBD 4G4KA 3EROA 1EIHA 3HOZB 4CHTB 3D4RA 4LJZC 3DXJC 4F87A 4PQXA 2PW7A 1R4QB 1SDFA 4KK7A 3GTKB 4WFN3 5IGEA 2F0IA 5EKKA 1JCKB 2K05A 2FHTA 1A2UA 5KYIA 4BA1I 2A73B 4ILWA 4CKCA 2AWOA 1BDOA 3D4WA 1ILPA 2A69D 1SYEA 1TWAB 2B8GA 2C5CA 3SR1A 1WTXA 1PRTC 2KUMA 2K5QA 5I6YA 3S15B 1I4PA 1IKLA 2M9VA 2DNCA 4KJNA 3S1MB 1D2BA 1LTSD 1BCPC 5CBEE 1LTAD 1RJTA 4ZUIA 4IFDJ 3V2TA 5NUCA 4TQUS 1STAA 1AW7A 2B2TA 3FKIB 1JOQA 3J81L 2KCCA 3MAQA 5G3LD 5I2YA 4K2LA 1O7LA 4TSSA 3DWAA 3K0YA 5EJWA 1PZJD 2F0JA 1S5CD 4ZAIA 4X3UA 1IYUA 1Q12A 5C44B 4HCSA 1TY0A 2A74C 4XDXA 2DNEA 4E6IA 2B2WC 5T1GA 3E0JA 4Q0FA 3D6WA 1YNJD 4Q5VA 2XRQD 2D2CC 2NZ1D 3R3OA 5C4HA 3MHBA 2QF7A 2BCOA 2AWNA 2Q8RE 4K2KA 3NXWA 3S1QB 4J8QA 1HRJA 2QCPX 1F2YA 2VNUD 4RHSA 3P1HA 3G6JB 3W2DA 3J80E 2G9DA 3TMEA 3S2HB 1AZPA 1B44D 2ICIA 1PRTB 5BN5A 2WIIB 2CW0D 3SK4A 2A69C 4OO1H 3Q24A 5J39A 2F0PA 1QWYA 2NN6I 2LS01 4OIKA 3K5MA 2RBMA 5E4WC 4XQJA 1BCPB 3FRPB 3R93A 3VR5A 2HDMA 4WJWA 3CKIB 1FR3A 3TP6A 1V1PA 1HTLD 4KY7A 1E2ZA 5FOBB 4DK1A 2PMZB 1RF2D 2QILA 2F0QA 4CGYB 4ZLTF 3BVZA 3HGBA 1Q8IA 1VMPA 4HSVA 4FO2A 5COYA 1GJXA 4N9TA 5LHY1 4NW2A 3AB9A 5EPKA 3FMCA 2F1MA 2PQEA 4Y7NB 5FO8B 2RDFA 1DM0B 3L7ZC 3PUXA 3SXHA 4HSPA 4K8IA 1J9OA 1F9PA 1Y8NB 3NE5B 3GTGB 1EU3A 3HP3A 3J7YW 1G291 4C3JB 5KNBA 3SK6A 3S16B 1PTOC 3I90A 2XNAC 1PDQA 2A5HA 1CFMA 2B2YA 5FLXE 1D5XC 3TZDA 1LT6D 2XSCA 4KY5A 1JE4A 1UUPA 1D5ZC 4RHRA 1STYA 1BNZA 4H7BA 4IALA 1GXDC 1BQQT 1B50A 4XYQA 4QUFA 1G91A 1HA6A 1SYGA 4N9PA 4K6DA 5JJZA 4ZKCB 1S5BD 1JORA 5A35A 3TP7A 3L9AX 4HR7B 2KHSA 2IT1A 5T1IA 3MEHA 4LAAA 3NUCA 2NWGA 1JC7A 5HURA 3HEJA 3H94A 1ESFA 2HQEA 3DMUA 4RGTA 2F0NA 1W6KA 3TZUA 3NBIA 4WRDA 3NQTA 2SOBA 2RDHA 2HCCA 1RDPD 4EQPA 1IYVA 1EIGA 1SNMA 4ZRZA 5JEAG 1FYCA 3SK8A 3E5SA 3KLRA 1QJOA 1Z47A 3QOJA 4A3GB 2AQ2B 1PTOB 1D6EC 2LFNA 1O78A 1SEBD 5FO9B 1Y1WB 5ELDA 2WKDA 1STHA 5CV9A 2MHVA 4DU9A 5M3FB 1XX8A 1PLFA 5EKLA 4L8JA 2PW5A 4QB4A 5DM73 3OW7A 1OO9B 2RDGA 1A3VA 2RSNA 2RSOA 2EJGC 2F0EA 3S1NB 4C3IB 3SVMA 1WTWA 3KLSX 4B9XA 2B2TC 5KIXA 2F3WA 1F77A 1ET9A 1SFOB 3CQZB 3BDCA 3NTKA 5IGFA 4F8MA 2OEOA 1STBA 3HOYB 5K5PA 3GTMB 1AEXA 2PCFB 2Z4IA 2DY7A 2J0TD 4XQQA 5CV5A 1D1IA 2PZWA 4MIUA 2IPKD 2XWBB 3VR4A 4IUUA 1CQVA 1SSOA 4U68A 2ZT9C 1I6VC 3T4AC 3SHLA 3DWPA 2TMPA 1U4PA 5CMDA 1QE6A 3A54A 3IFDA 1TS5A 1HQRD 1TWCB 2BDNA 3QIAA 1RKNA 1MBYA 4IFDG 5M3MB 1EYCA 2WACA 5E3FA 1KNAA 3QB3A 2L1BA 3RUZA 5EQ0A 5M9OA 3JAML 1DZ1A 4OIJA 4EGVA 2QEJC 5C4ZA 2SEBD 4FF2A 2KOLA 1ZYRC 5KRUA 1QNUA 1H9MA 1DCZA 2NB0A 3BZDB 3NTHA 1SNPA 1PRTD 1SNDA 5C0XH 2CHBD 3LNNA 1XXGA 1EY5A 4EQOA 2M00A 3G7LA 2KECA 1U4RA 4KKSA 4PMWA 5DEHA 1ICWA 5FKAC 4ME5A 2E2DC 2JYOA 4C56C 2ZXRA 2F0GA 2A6EC 1TR5A 1Z7TA 1TY2A 2AQ3B 4CJ0B 2XIWA 1QILA 1CA5A 1Z6HA 2F3VA 3GP7A 3MFGA 3TBIB 4CBVA 1TS4A 3BVMA 1EZ8A 2FINB 3X3MA 4ZK9B 1WTOA 3K5NA 1E0BA 1EY6A 3NTIA 1L0XB 1ENFA 2F4IA 2F0TA 3DM1A 1D1KA 1IKMA 2F0DA 1HFGA 1RD9D 1S4ZA 5FK9C 2D62A 2B2YC 2N55A 1PMRA 4FP5D 3KUPA 1HPCA 1C8CA 1EEID 1KTKA 4FF1A 2B2UA 2MP1A 2VXWA 1CA6A 1H9RA 2K04A 3K58A 2SNMA 5D3DA 4K8JA 1CHPD 3FPUB 4K5XA 3A8IE 4M1UB 4KJOA 3QO2A 2HUGA 4BY1B 2JA6B 3K7AB 3K59A 1V1PB 1BBXC 3I73A 3T56B 4RGOS 2NVQB 1XTCD 2Z8LA 5A2QL 1C4QA 2F0VA 4RKBA 4DFAA 5IGDA 4FF3A 1IL8A 3HG9A 1BO0A 1ENCA 2XN9C 2TSSA 4XT3B 5C5MA 5EPJA 3DEOA 5TSSA 4BY7B 3WDNA 1OXTA 1GUGA 4KD3A 1GUNA 4F88A 2O5IC 4HN7A 1SAPA 1HXYD 4ULLA 1PZID 2ICEC 2X69A 2WV6D 2IX0A 1STGA 3K5LA 1J8IA 3M85A 2VUMB 3DUZA 3D6CA 2F0OA 1KLGD 2EY2A 2RKSA 1F9QA 2NN6G 3DWQA 1TVXA 2R92B 4H44C 2IW3A 1PTOD 4ZYSA 4MN3A 1H9JA 4L63B 1BF4A 2JEAI 1T5EA 1WTPA 1D5MC 4C2MB 5CBAE 2H4OA 1HHVA 2WP8J 4OGQC 1B9MA 2EDGA 4B9WA 3I70A 5C3EB 4IQZA 1BR9A 4A3BB 3Q22A 1IHZA 4PMBA 1Q1BA 3K5OA 3R2IA 3SDZA 5DAUA 1EEFD 2A68C 5CR3A 1TQOA 2LY7A 4G57A 2WINB 3A7LA 2IX3A 4FYDA 4PNYA 1QOHA 2O2LD 3C3LA 1B9NA 2L9HA 2LMCB 3HOVB 2RVLA 1TIID 1SMYC 3IL8A 1TKWB 1V43A 4QUCA 3OIPA 1EY7A 3PO2B 2JA5B 4EVOA 2L11A 4KN4C 3I4LA 5I2XA 2SNSA 1CK1A 1Q90A 4RGNA 3UI2A 2QDBA 3S2DB 1PRTF 3MC0B 4HTHA 1YNND 2H1EA 1GUSA 1U4LA 3OMCA 5IT9E 1M8AA 3C1FA 1T5XD 1MGSA 1BCPF 3VYRA 1CM9A 2EXZA 2PYKA 4HAEA 1H9KA 2D9UA 2E75C 2IWHA 4RCOA 3OHXC 1CHQD 3H91A 5IGCA 3GD7A 1BXTA 4IN3A 1OXXK 2E74C 4XIGS 1I4GA 4PV1C 1TT2A 4KHZA 5IODA 1PFNA 2DN8A 1CZWA 4DAYA 3HOUB 1V1OA 1VCIA 4A3DB 2PPBC 3H09A 3VR2A 1BUVT 2FMMA 3GV6A 3NP8A 2VB2X 5IGGA 4P2CB 3ND8A 4ZKBB 4IUNA 4OO1I 4C3HG 1EY8A 3HZXA 3BDOA 3KBGA 1WCMB 2N88A 4AYBB 1RODA 2PZUA 5IGBA 3BDLA 4HMIA 1K8MA 1B2TA 5JEAH 3J80L 1JWSD 2MUYA 4RAUC 2EE1A 3I91A 1KDAA 1G8ZD 3M4YA 1K83B 3LWEA 4HCEA 3RLFA 1LTTD 5CGKA 1VMCA 1ESRA 2WKCA 2K01A 2MGSA 2BDOA 2JP1A 2XWJB 2L12A 3EJIA 2FJ2A 1FNWA 2B2UC 5KYLA 3PUVA 2K7VA 1PFBA 1LO5D 2WAQB 1G2TA 2OF1A 4XTCS 1JOOA 2K33A 5AFWA 1YNNC 2EJMA 4RWSC 3IKJA 4JBWA 3K6OA 5IIFA 1LLRD 2EVBA 4DAVA 5JPMC 1QG7A 1ZYRD 3CRLC 3FEWX 5I9OA 4BBRB 2GA4B 3J7AV 5EBCA 3HRZC 3DEPA 4ZQ3A 2JSOA 3H6MA 3M7GA 2B39A 5G3LF 3N52A 2MPMA 3Q0AA 3GTQB 1NR2A 3FVQA 1LABA 1MSHA 3MTSA 1OXUA 1FGBD 4OL7A 4WORA 1F2ZA 1MI2A 2RQXA 2EYJA 3A55A 2A6ED 3BYTB 3MWYW 5FLXL 3MXUA 2ENBA 1M4VA 3ERQA 1HA5A 4IUTA 5J22A 4IFDH 2OT2A 1G6ZA 1MSGA 3PUYA 1CT1D 5BN4A 2ID0A 1EU4A 3BYYB 2F0HA 5EPLA 3P75A 4O1NA 3D4DA 5I6WA 4QCLA 4KHVA 3PUWA 3OWFA 3IAYA 3BS1A 4NMZA 1HFNA 2FMCA 5DNFA 1GHKA 3QWNA 4C3IG 1LACA 4RCNA 3RD4A 3Q23A 3HOXB 2LKVA 1AFPA 1HUNA 4KV6A 3ITPA 5CYUA 1S5DD 4I65A 3NWSA 1GOZA 1RHPA 5M5WB 2R3ZA 3HKZB 2EPBA 3ZYYX 1LTRD 3GO5A 3H0GB 4RGMA 2A6HC 4BBSB 1LT3D 3OIQA 4IUVA 2F0MA 3LX0A 3PIO3 4ZUJA 4DGZA 2NVTB 4ID6A 1PYWD 1TU2B 3OMGA 4PMCA 3CHBD 5C4JB 2IJ0A 3LWUA 3RMHA 1WD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H94 A;  3OPO A;  2O5J C;  3ND9 A;  4DK0 A;  1ONL A;  1E2W A;  1Z6H A;  2K32 A;  3WDN A;  3HGB A;  2A6E D;  2A68 D;  3BDO A;  1OXT A;  3TZU A;  3VR4 A;  1IYU A;  1B9N A;  1GUG A;  2LMC B;  2V4D A;  2AUJ D;  1GJX A;  1GUN A;  3MXU A;  1HQM C;  3AB9 A;  3D4R A;  2ZT9 C;  4LJZ C;  1YNJ C;  3DXJ C;  4H0L C;  1Q12 A;  1SMY C;  3FMC A;  4TKO B;  4GZY C;  1I6V C;  1TKW B;  4G7O C;  1K8M A;  1V43 A;  5JEA H;  2EJF C;  2F1M A;  1K8O A;  3CRK C;  1IYV A;  2D5D A;  1Q1E A;  2DNE A;  2O5I C;  3IFT A;  1EWH A;  3PUX A;  3L7Z C;  2E76 C;  3VR6 A;  4IFD H;  5K36 H;  3PUY A;  3PUZ A;  3P20 A;  1HCZ A;  1ZKO A;  4KN4 C;  3I4L A;  3T51 B;  3A7A B;  4KKU A;  5BN4 A;  3M4Y A;  1GHJ A;  2B8F A;  1FYC A;  3RLF A;  2JXM B;  2AUK A;  4DNR B;  3QIA A;  5JEA G;  1Y8N B;  1Q90 A;  1Y8O B;  4IFD G;  2D2C C;  3NE5 B;  3I72 A;  5KNC A;  3M85 A;  3KLR A;  3A7L A;  1QJO A;  2NN6 H;  4JK1 C;  2D62 A;  3BG3 A;  3PUW A;  2BDO A;  2QF7 A;  1G29 1;  1PMR A;  3GQB A;  1VF5 C;  3VA7 A;  4KN7 C;  5KNB A;  4BA1 I;  1CI3 M;  1E2V A;  3T53 B;  1CTM A;  1CFM A;  3PUV A;  1GHK A;  2K7V A;  2NN6 G;  1GUS A;  1O78 A;  2BA1 A;  3QJY A;  1Y8P B;  1HPC A;  1LAC A;  2PNR C;  3A8K E;  3PV0 A;  4RCN A;  2AWO A;  1BDO A;  2CW0 C;  2Q8I B;  2A69 D;  2KA7 A;  4XTC S;  4H44 C;  1HTP A;  3A8J E;  1ZYR C;  2B8G A;  1H9K A;  1OXS C;  3EQL C;  1H9R A;  2K33 A;  1YNN C;  2BE5 C;  2BA0 A;  2EJM A;  3IKJ A;  4JBW A;  2E75 C;  4KKT A;  4L8J A;  4BA2 I;  5K36 G;  5BN5 A;  1H9J A;  4G7Z C;  1H9M A;  2R6G A;  3N6R A;  3OOC A;  3OW7 A;  4LK1 C;  2EVB A;  4I7Z C;  3D31 A;  3U9S A;  2A69 C;  2JEA I;  1VF7 A;  1T5E A;  4OO1 H;  1DCZ A;  3CRL C;  1DXM A;  3A8I E;  3GD7 A;  4KMU C;  3VR3 A;  2EJG C;  1DD2 A;  3FPP A;  2BE5 D;  2NN6 I;  4KI0 A;  3W3A A;  2DNC A;  2A6H C;  1OXX K;  2E74 C;  2YYZ A;  4XIG S;  4OO1 G;  5C0X H;  1H9S B;  4PV1 C;  3I73 A;  3LNN A;  3T56 B;  4OGQ C;  1B9M A;  3VR5 A;  1GUO A;  4KHZ A;  5BN3 A;  1V8Q A;  5A35 A;  1IW7 D;  2EDG A;  2DN8 A;  1OXV A;  1VCI A;  1FR3 A;  3MFY A;  4HR7 B;  1GUT A;  4KKS A;  4H13 C;  4IQZ A;  2PPB C;  2A6H D;  3VR2 A;  3SE0 A;  1H9S A;  1LAB A;  2L5T A;  2IT1 A;  4TQU S;  5C0X G;  3M7N A;  4DNT B;  1E2Z A;  1TU2 B;  2JE6 I;  3QG1 A;  1Q1B A;  2JEB I;  4G7H C;  3SDZ A;  2A6E C;  2A68 C;  4DK1 A;  2KCC A;  1IW7 C;  2PCF B;  5KND A;  1OXU A;  1Y69 U;  1Z7T A;  3LWU A;  3ND8 A;  1O7L A;  1A6X A;  1VDZ A; 
#chains in the Genus database with same CATH topology
 3MEF A;  1GVP A;  4RA8 A;  5C4X B;  4DK0 A;  1ONL A;  2PQA A;  3FDT A;  2J4X A;  3HKS A;  5M3M G;  1NSN S;  4DR2 Q;  3BZC A;  4OEL B;  1XMQ L;  4BS9 A;  1I50 H;  4H0L C;  4GZY C;  2F3I A;  4G7O C;  4NXM Q;  1EQT A;  2KHJ A;  1G2S A;  4FXG C;  4OON A;  2EJF C;  4HED A;  3BVG A;  4DV4 Q;  1TWH B;  4IUR A;  5JPN C;  5EGT A;  4EQ5 A;  5I9P A;  3W5O A;  4A3F B;  2CQA A;  1B3A A;  3J81 E;  3O13 A;  4C1N K;  3TN2 A;  4KD4 A;  3C1E A;  1II3 A;  1K8G A;  2ZM6 Q;  1DOM A;  4JI8 L;  1D7Q A;  5F2D A;  3I4M B;  4JI1 L;  2E2J H;  4GOP C;  3IRB A;  1VQI A;  3AMU A;  5JAV A;  1XNR Q;  1I4R A;  1V1Q A;  1HH2 P;  5GAD C;  4JBM A;  3PV0 A;  1L0Y B;  2QDL A;  3M3Y H;  2Q8I B;  4B3M L;  1S5F D;  4GNX C;  1RCV D;  4KLK A;  3J7A 5;  4X64 L;  2R93 B;  3I8Z A;  3EVQ A;  1PH3 A;  2BE5 C;  2BA0 A;  2ZXP A;  1FJG Q;  1WVL A;  2JQO A;  4YHH L;  3S1R B;  3U9S A;  2XVS A;  4RFB A;  2ASB A;  1EY9 A;  2SDF A;  4IUQ A;  1N9W A;  4OHJ A;  3D0F A;  4OEM B;  3HOZ H;  1N32 Q;  1A2T A;  4J1M A;  3PIP 3;  4K0K L;  3HS0 C;  4JV5 L;  3R8B A;  1GUT A;  4X3T A;  2WAQ E;  1H9S A;  1PZK D;  4JI0 L;  3GTK H;  4DNT B;  1Q3L A;  4XQN A;  5C3X A;  1EY4 A;  3A0J A;  1QB5 D;  4JOI A;  5KND A;  4HMJ A;  1Y69 U;  4L5Q A;  1PH2 A;  4LF9 L;  2NUC A;  2KED A;  1EZ6 A;  1WTR A;  1NR4 A;  2UUB Q;  5CV4 A;  2I07 B;  4A3J B;  1DOK A;  1PXU A;  3NQI A;  1WTQ A;  2A68 D;  4O42 A;  5ELC A;  3D3R A;  2V4D A;  3HOZ G;  5C0X I;  4QF4 A;  3TS2 A;  3PCO B;  4V19 0;  1STE A;  1TWA H;  2C9O A;  1MIU A;  3I3C A;  3TRE A;  1K8O A;  1N36 Q;  2D5D A;  2NTT A;  2B3G A;  2QA4 A;  3E9H A;  3PUZ A;  3NK9 A;  1A3T A;  1EQV A;  5KEE A;  1GUW A;  1EYA A;  4XYO A;  3I7F A;  3A7A B;  2EZV A;  3S15 H;  1SMY D;  2B8F A;  5IYD H;  4CKE A;  1Y8O B;  2EYL A;  5COR A;  3WOE A;  2NN6 H;  5CV6 A;  1PH5 A;  2K5W A;  4DR2 L;  4KY6 A;  1KNE A;  3S1M H;  5HGT A;  4GOP B;  1SE3 A;  1VF5 C;  1WTV A;  2BOS A;  2OXP A;  1SE4 A;  5ELF A;  1Y14 B;  4NXM L;  2N49 A;  2O4X A;  1X3P A;  4TRD A;  5JVG 3;  4BY1 G;  1EOT A;  2JA6 G;  4DV4 L;  1XNQ Q;  4DR1 Q;  4GNX B;  4R8I A;  1F9R A;  5HY6 A;  3FKI H;  1OXS C;  2B2V A;  2K1B A;  3CU7 A;  1I4H A;  2VQE Q;  1JIC A;  2EY6 A;  2ZM6 L;  5M5X B;  3RLO A;  4QIW B;  4DXF A;  2NYZ D;  1CKM A;  2JA7 B;  2N8N A;  5IYD G;  1XNR L;  3VR3 A;  3F2B A;  2F0L A;  1UAP A;  3W3A A;  3GTJ B;  4DAY B;  2JA8 B;  3GTL B;  4DV5 Q;  4RKL A;  2F0U A;  1FD7 D;  4RH6 A;  3VA5 A;  2E2H B;  2F0S A;  3NBH A;  5BN3 A;  5C44 H;  4BY7 G;  2Z6K A;  1PA6 A;  3C46 A;  4DF7 A;  1FJG L;  3S17 B;  1X54 A;  4R9W A;  2K5D A;  1JWM D;  2RCF A;  1LTG D;  2Q2U A;  3PF4 A;  4XT1 B;  2JE6 I;  4G7H C;  1PH4 A;  2JEB I;  4ODG A;  4GLV B;  3FKI G;  4DAP A;  4A3E B;  3U58 A;  4O0A A;  3K7U C;  3K80 C;  2R7Z B;  3MXG A;  5LMN W;  1SYB A;  1SNQ A;  1B4O A;  1BBW A;  5JJK A;  1N32 L;  3ND9 A;  1QNK A;  1S40 A;  3L2P A;  4JI7 L;  3I4N B;  2L55 A;  5ELB A;  3S1Q H;  4DN4 M;  2YV5 A;  1PV4 A;  2VUM G;  3RZO B;  1JB3 A;  4UDU C;  5IWA Q;  4CJ2 C;  4LW1 A;  1D8L A;  1LT4 D;  2Y0S B;  1TWG B;  3F2U A;  3KBX A;  4QMG A;  3AU7 A;  3S2H H;  2HIV A;  1Q1E A;  5IYC G;  3VR6 A;  4ABN A;  1FNU A;  3U50 C;  2K28 A;  3TS0 A;  2DJF C;  1S5E D;  3P20 A;  2UUB L;  1W3S A;  1EFI D;  1K3R A;  2A19 A;  2R92 G;  4ALP A;  2EYM A;  4DNR B;  1JWU D;  4J6H A;  2EIF A;  5KNC A;  2OTL A;  5C0X J;  4M8A A;  1PYS B;  4IJL A;  4Z9C B;  4KN7 C;  5CV8 A;  5C6A A;  1CI3 M;  1TWF B;  4K5W A;  2KJX A;  1F2L A;  3NPP A;  2BA1 A;  1N36 L;  5C3W A;  2E2I B;  2PZT A;  1VQ9 A;  1U9R A;  3L3O C;  2KVM A;  2R6G A;  3N6R A;  1A15 A;  1U4M A;  3KF8 A;  3P7J A;  2DY8 A;  5FJ8 H;  4A3K B;  1BKB A;  2NBF A;  1ENA A;  1EY0 A;  2I5H A;  1XNQ L;  3GTO B;  2GVB A;  2YYZ A;  1NTG A;  4DR1 L;  4OO1 G;  4XXE A;  1R9T B;  1GUO A;  1V8Q A;  1WD1 A;  4UHV A;  1IBK Q;  4R8N A;  3GV3 A;  2VQE L;  4LUZ A;  2ZTE A;  3MFY A;  4YWL A;  4Y7N H;  4A76 A;  3H3V C;  4H13 C;  4K6L A;  3HOV G;  5CV7 A;  2F03 A;  3M7N A;  1KAA A;  1JQY D;  1SE2 A;  2J7Z A;  4MHE A;  2FFK B;  3NWT A;  5I4D A;  2VB3 X;  1YZ6 A;  1YJ9 A;  4WJ4 A;  3K0X A;  1F9S A;  2B63 B;  1L2F A;  3GTG H;  4NKL A;  3PO2 G;  2JA5 G;  4DV5 L;  1UNS A;  1VQP A;  3R2T A;  4C3H B;  3S14 B;  3KFU A;  5IT9 c;  4C3J H;  4KHP Q;  2K32 A;  2NVY B;  3S16 H;  1UE6 A;  4DV6 Q;  2C35 B;  1I6H B;  2EYO A;  3DHQ A;  1TS3 A;  1STN A;  1DJR D;  2AUJ D;  1B1Z A;  3NSW A;  1ET6 A;  5LMN Q;  1YNJ C;  5E1F A;  3J7A F;  4L5S A;  5AJ3 Q;  3E6Z X;  4UAI A;  1FGU A;  1SNC A;  1K0S A;  4GKK Q;  1EWH A;  4IO9 A;  2E76 C;  2L4N A;  4OXP A;  1JOK A;  2G9H D;  3T16 A;  4LFB Q;  1E22 A;  1AZQ A;  4DK3 C;  1C48 A;  3OSO A;  4LF6 L;  2O5J C;  1B3Q A;  4HJ7 A;  1EWC A;  1GHJ A;  1FVI A;  2JXM B;  3KLS A;  5ELN A;  3V96 A;  1O7Z A;  5IWA L;  2CKZ B;  2NZH A;  2HCI A;  4C3J G;  3NEM A;  3KJO A;  3T13 A;  2EYP A;  3GTP B;  5JVH 3;  3MXN A;  1I4Q A;  2KCN A;  3QJY A;  1PFM A;  4S3S A;  1Q8K A;  4DV3 Q;  2OQK A;  2CW0 C;  4QJF A;  3CMA A;  5KGU A;  1VQO A;  1HTP A;  3A8J E;  5EBD A;  3EQL C;  3MA2 B;  1SYF A;  2F0W A;  3J80 i;  4KKT A;  3TP8 A;  4A3D G;  1PH9 A;  4G7Z C;  3OOC A;  4LK1 C;  1MD2 D;  3C2P A;  3PO3 B;  4A4I A;  1J5E Q;  1X3Q A;  1O7Y A;  1SYC A;  1DXM A;  3EFX D;  3D8G A;  1NE3 A;  3FPP A;  3EA6 A;  1DYQ A;  2DJG C;  1AN8 A;  1X3F A;  3ONA B;  2K03 A;  1NCV A;  5D65 A;  3VYT A;  3KF6 A;  5M5Y B;  1ZEQ X;  3JAM E;  4FF4 A;  5ELE A;  4NDX A;  4X3K A;  1WCM G;  1DOL A;  1NUC A;  3FP9 A;  4JOI C;  3UDF A;  4CDC C;  1KQS A;  1C7Y A;  3RNU A;  2UUC Q;  2A6H D;  1X32 A;  1WJJ A;  3RZD B;  3M4O B;  5H1S E;  5E4X A;  3A56 A;  3URY A;  2PQA B;  1XWE A;  2EOT A;  4LUO A;  2ZTC A;  3VYS A;  1A6X A;  1ILQ A;  1B53 A;  1JR0 D;  4A3I B;  4A3G H;  1YIJ A;  1ZXT A;  1SNO A;  1CQF A;  1HR0 W;  1PTO H;  4BBR H;  1IBK L;  1I4X A;  2IX1 A;  4HID A;  2NVX B;  5IT9 L;  1Y1W H;  1O80 A;  3MXP A;  1SJH D;  4TKO B;  4JYA Q;  4DA2 A;  5M3F H;  2Z1C A;  3CRK C;  2WAQ G;  3IFT A;  2R61 A;  2ES2 A;  5LL6 S;  4IZ8 A;  5IOC A;  5CC4 A;  4JI6 Q;  1HCZ A;  1Z9F A;  1AP0 A;  2ZJQ A;  1A3U A;  4KKU A;  5DM6 3;  3OTO Q;  3SK5 A;  1SE8 A;  2CVR A;  5JOB A;  1SJE D;  3I72 A;  2B2W A;  3PMF A;  4JK1 C;  4HJ5 A;  3S9W A;  5EKI A;  3S1N H;  4C3I H;  3MVV A;  1SN8 A;  5LMN L;  1E2V A;  2MJ8 A;  3U4Z A;  1BOS A;  1KL9 A;  1PTO F;  4IUP A;  4C1N I;  1VQD A;  5AJ3 L;  2YU9 B;  4JBK A;  4NPS A;  3KK7 A;  2KBN A;  2EY5 A;  2RA4 A;  2QKI C;  1SBB B;  4BBR G;  3HOW B;  2B2V C;  2F0K A;  2ATW A;  4GKK L;  1YBY A;  2L0C A;  3A8K E;  1SFO H;  2QEX A;  3CQZ H;  1Y1V B;  2GN5 A;  1E7Z A;  1X3G A;  2KA7 A;  2PO4 A;  1XYI A;  4LFB L;  4FVM A;  2NTS A;  4EQN A;  1RTN A;  1G6P A;  3HOY H;  2UXC Q;  3GTM H;  4IJH A;  1I3Q B;  4BA2 I;  3M9B A;  4F7X A;  1KDC A;  4X3S A;  1KRS A;  2EYH A;  1B70 B;  2RHQ B;  1LTI D;  3BJU A;  1U5K A;  3D31 A;  2I46 A;  1UEA B;  1VF7 A;  5J1Z A;  1F2M A;  4FXK C;  4QL5 A;  1Q46 A;  2XRS D;  1W6J A;  2BE5 D;  1LTB D;  2EY1 A;  2Z6K C;  1RTO A;  4DXG A;  1DON A;  4DV3 L;  5EAY A;  2IL8 A;  1PYB A;  1H9S B;  2VQF L;  4K0K Q;  4MNO A;  2ZXO A;  1IW7 D;  1SXT A;  3AFQ A;  3TP5 A;  1OXV A;  2OTJ A;  3ZJY C;  3H3V I;  4V0B A;  1LM0 A;  2WB1 B;  4JPB W;  2K52 A;  2L5T A;  3WOF A;  2Z4H A;  1LTL A;  1EQQ A;  1TWC H;  3HOY G;  3CXC A;  4X6A H;  4QGU A;  4LWC A;  4A93 B;  5M3M H;  1VDZ A;  2KEE A;  2Q8T A;  1EL0 A;  2RF4 A;  4NP5 A;  3OPO A;  4UPA A;  1KLU D;  3TDQ A;  1E2W A;  1KDB A;  3OWE B;  2X6G A;  3TSS A;  4CJ1 B;  1YHQ A;  2YTX A;  3U9O A;  2UUC L;  2EXD A;  1JJC B;  3VYU A;  1HQM C;  1TS2 A;  5ISR A;  4DUY Q;  2JA9 A;  4K5V A;  4A3M B;  5A2Q E;  1HR0 Q;  1S72 A;  4NB3 A;  5FO7 B;  1JT8 A;  5K36 H;  4L6T B;  2AQ1 B;  1ZKO A;  3T51 B;  3F2D A;  1SRO A;  2AUK A;  1IBM L;  1VQM A;  3SEB A;  2HDL A;  1XTD A;  5D14 A;  1NAP A;  3BG3 A;  4CKB A;  4DV0 Q;  3K57 A;  1PVO A;  1EYD A;  1V9P A;  3GQB A;  3VA7 A;  1QUQ A;  3T53 B;  4DNI A;  2Q2H A;  4KTA A;  5C5L A;  4JYA L;  1CTM A;  2F0F A;  5ELO A;  1KAB A;  1Y8P B;  4BWG B;  3RN2 A;  3TRZ A;  2PNR C;  4BBS G;  1ML0 D;  4FNF A;  2BH2 A;  1I50 B;  4GN5 A;  1FNV A;  4JI6 L;  4L5R C;  4IPD A;  3QOL A;  1R4P B;  3OTO L;  1VQC A;  5JJI A;  1VS0 A;  4IFD I;  1CZG A;  3AFP A;  3LGJ A;  5K36 G;  1LV9 A;  3V05 A;  3J7Z C;  4B3R L;  4I7Z C;  2X6L A;  1LT5 D;  1BCP D;  1HUM A;  3MZ5 A;  4YIJ A;  5IP9 G;  1IL2 A;  2EYF A;  3NBH B;  3PQI A;  4KMU C;  3RLN A;  1MJE A;  3NHH A;  1DD2 A;  4KI0 A;  4U67 3;  2IHF A;  2E2J B;  2CFM A;  1IXR A;  1LUZ A;  5C4X G;  5JEA J;  4AYB E;  4B08 A;  2N78 A;  2UUA L;  2UXC L;  2AKW B;  3J81 c;  3KJP A;  3Q6S A;  1M90 C;  3M3Y B;  4K14 A;  4YWM A;  2KQ3 A;  3SE0 A;  1G51 A;  2M2L A;  5C0X G;  2K6A A;  3QG1 A;  3CCJ A;  1SYD A;  3X3N A;  3SGI A;  2HIX A;  3PIO A;  1IW7 C;  3QR8 A;  1J6Q A;  5D3I B;  4LNQ A;  2KHI A;  4LMQ D;  5LL6 X;  4A3F G;  4FXD A;  4MZ9 A;  1QCB D;  4IOC A;  4YWK A;  2K14 A;  4JI7 Q;  4G4K A;  3ERO A;  2MQH A;  2AHO B;  1EIH A;  3HOZ B;  4CHT B;  3D4R A;  4LJZ C;  3DXJ C;  4F87 A;  4CDE C;  4PQX A;  2PW7 A;  1NNX A;  2PI2 E;  1R4Q B;  1SDF A;  4KK7 A;  3GTK B;  4IPC A;  4WFN 3;  5IGE A;  2F0I A;  5EKK A;  2KEN A;  4POG A;  1JCK B;  1YJN A;  2R93 G;  2K05 A;  2FHT A;  4BY1 H;  2RHS B;  1A2U A;  2JA6 H;  3K7A H;  4NXN Q;  1AE2 A;  2OCE A;  5KYI A;  4BA1 I;  4DUY L;  2A73 B;  3PSI A;  4L5T A;  2NVQ H;  4ILW A;  4MTK A;  1HR0 L;  4CKC A;  1PH1 A;  1VQJ A;  4DV7 L;  2AWO A;  1BDO A;  1UE5 A;  3D4W A;  1ILP A;  2A69 D;  3KF8 B;  1SYE A;  1TWA B;  1NY4 A;  2B8G A;  2C5C A;  3SR1 A;  4OX9 Q;  2LSS A;  4OWX B;  1WTX A;  1PRT C;  4JBJ A;  1CSP A;  2KUM A;  2K5Q A;  4DV0 L;  5I6Y A;  3S15 B;  1VQK A;  2B29 A;  1I4P A;  3PGZ A;  4BY7 H;  1GM5 A;  1IKL A;  2M9V A;  2DNC A;  1K8A C;  4KJN A;  3S1M B;  1D2B A;  1LTS D;  1KXL A;  1BCP C;  5CBE E;  1LTA D;  1RJT A;  2VL6 A;  4A3J G;  4ZUI A;  4IFD J;  2D0O A;  1VQG A;  4DPG A;  3V2T A;  4X65 L;  5NUC A;  2LXJ A;  4TQU S;  3CF5 A;  1STA A;  1AW7 A;  2B2T A;  3FKI B;  1JOQ A;  3CD6 A;  3J81 L;  2KCC A;  3MAQ A;  5G3L D;  5I2Y A;  1GD7 A;  4K2L A;  3U4V A;  1O7L A;  2P5Z X;  4TSS A;  3DWA A;  3K0Y A;  2VUM H;  5EJW A;  3UDI A;  1ASY A;  1PZJ D;  4A3L G;  2F0J A;  1UE7 A;  1S5C D;  1YIT A;  4ZAI A;  4X3U A;  4DUZ Q;  3CCR A;  1IYU A;  3F8T A;  5IYC H;  4R4C A;  1A63 A;  1Q12 A;  5C44 B;  1KD1 C;  3EN2 A;  4HCS A;  1TY0 A;  2A74 C;  2R92 H;  3CC7 A;  4XDX A;  3I2Z A;  2DNE A;  2CH4 W;  4AH6 A;  5JJL A;  4E6I A;  5IP7 G;  2B2W C;  3BZK A;  3JC6 6;  5T1G A;  1MJC A;  3E0J A;  4Q0F A;  3D6W A;  4LF6 Q;  1YNJ D;  2VZA A;  4Q5V A;  1VQ8 A;  2XRQ D;  1NMF A;  4C2M H;  2D2C C;  1Q7Y C;  2NZ1 D;  3R3O A;  3MXN B;  3HKZ E;  5C4H A;  4PG3 A;  2R7Z H;  2K4K A;  3MHB A;  2QF7 A;  2BCO A;  2AWN A;  2JA7 G;  2Q8R E;  1UE1 A;  3CW2 C;  4K2K A;  1WYD A;  3NXW A;  3S1Q B;  1K9M C;  4J8Q A;  1HRJ A;  5C3E H;  2QCP X;  2JA8 G;  1F2Y A;  3RZO H;  4DR3 Q;  1SR3 A;  2VNU D;  4A3B H;  4RHS A;  3P1H A;  3G6J B;  3W2D A;  1TWG H;  3J80 E;  2G9D A;  3TME A;  3S2H B;  1AZP A;  1B44 D;  1U0L A;  2ICI A;  1M1K C;  1PRT B;  4JI5 Q;  5BN5 A;  4B3T Q;  4NXN L;  2WII B;  2CW0 D;  3SK4 A;  2A69 C;  4OO1 H;  3Q24 A;  5J39 A;  4R4T A;  2F0P A;  3KF6 B;  1QWY A;  2NN6 I;  2LS0 1;  2R7Z G;  4OIK A;  3K5M A;  2RBM A;  3STB D;  3HOV H;  5E4W C;  4XQJ A;  1BCP B;  3FRP B;  3R93 A;  3VR5 A;  2HDM A;  1VQL A;  3I4N G;  3T1H Q;  4JI4 Q;  2MO1 A;  4WJW A;  3CKI B;  5C3E G;  4OX9 L;  1FR3 A;  3TP6 A;  1QZG A;  3CME A;  1V1P A;  1HTL D;  4KY7 A;  4A3B G;  3PO2 H;  2JA5 H;  1E2Z A;  5DLQ E;  5FOB B;  4DK1 A;  4JC0 A;  2PMZ B;  1RF2 D;  2QIL A;  2F0Q A;  2JK8 A;  4CGY B;  3S2D H;  1WTH A;  4JI2 L;  1B7Y B;  4A3K H;  1LYL A;  4ZLT F;  2VW9 A;  1L1O A;  3BVZ A;  3HGB A;  1Q8I A;  3CC4 A;  1VMP A;  4HSV A;  4FO2 A;  5COY A;  1GJX A;  4N9T A;  5LHY 1;  4NW2 A;  3AB9 A;  5EPK A;  1AE3 A;  3FMC A;  3GDE A;  2F1M A;  2PQE A;  4Y7N B;  3CC2 A;  5FO8 B;  2RDF A;  1DM0 B;  3L7Z C;  3PUX A;  4JI3 Q;  3SXH A;  4HSP A;  4K8I A;  1J9O A;  1ICF B;  1F9P A;  2JJQ A;  1Y8N B;  5LMU L;  3NE5 B;  4DUZ L;  1HNX Q;  3GTG B;  1EU3 A;  3HP3 A;  3J7Y W;  1G29 1;  4C3J B;  4A3K G;  3CCL A;  3EIV A;  5KNB A;  3SK6 A;  3CCS A;  3S16 B;  1PTO C;  3I90 A;  2XNA C;  1PDQ A;  2A5H A;  1CFM A;  1YNX A;  2B2Y A;  3L0O A;  2V1C C;  5FLX E;  3HOU H;  4A3D H;  2Z9H A;  3UDX A;  1D5X C;  3TZD A;  1LT6 D;  1X3E A;  4YCU A;  2XSC A;  4KY5 A;  1JE4 A;  1UUP A;  1D5Z C;  4RHR A;  1IBL Q;  1STY A;  1JJ2 A;  5GQO A;  1JMC A;  1BNZ A;  1VQ7 A;  4H7B A;  3ER0 A;  2K75 A;  4IAL A;  1GXD C;  3G71 A;  1WCM H;  1BQQ T;  1HZ9 A;  2B63 G;  4PZ6 A;  4XYQ A;  1B50 A;  4QUF A;  1G91 A;  1HA6 A;  4A75 A;  1SYG A;  4N9P A;  4K6D A;  5JJZ A;  2OQ0 A;  4DR3 L;  4ZKC B;  1X55 A;  2VQF Q;  4MTN A;  1S5B D;  2CWP A;  1JOR A;  5A35 A;  3TP7 A;  1SLJ A;  1VQA A;  3L9A X;  4HR7 B;  3HOU G;  5IY0 A;  4JI5 L;  2KHS A;  3STB C;  2E5L Q;  2IT1 A;  4B3T L;  5IE8 A;  5T1I A;  3MEH A;  4LAA A;  4R4O A;  1K83 H;  3NUC A;  2K5N A;  2NWG A;  1JC7 A;  5HUR A;  3HEJ A;  3T1Y L;  3H94 A;  1C0A A;  1ESF A;  2HQE A;  3DMU A;  4RGT A;  1S3O A;  2F0N A;  1W6K A;  3TZU A;  3T1H L;  4JI4 L;  3NBI A;  4WRD A;  3NQT A;  4R1J A;  1CKO A;  4UP9 A;  4AYB G;  2SOB A;  2RDH A;  2HCC A;  1RDP D;  3KLW A;  2Z0S A;  4EQP A;  5FLM G;  2CWA A;  1IYV A;  1EIG A;  1SNM A;  3PF5 A;  3K81 C;  4GN4 B;  1Q82 C;  4ZRZ A;  4RG1 A;  4QIW E;  4H02 A;  5JEA G;  1FYC A;  1QUQ B;  2F52 A;  1IBM Q;  3SK8 A;  3E5S A;  3JAM c;  1YJW A;  1JJG A;  3KLR A;  1QJO A;  1Z47 A;  1T9H A;  3QOJ A;  4HIO A;  4A3G B;  2AQ2 B;  1PTO B;  1TXY A;  1D6E C;  3CCE A;  2LFN A;  1O78 A;  3RR5 A;  1SEB D;  3GTQ H;  4JI3 L;  5FO9 B;  1Y1W B;  5ELD A;  4I7A A;  2WKD A;  1STH A;  5CV9 A;  1K0R A;  2MHV A;  4DU9 A;  5M3F B;  1XX8 A;  1PLF A;  2I0Q A;  2ZTD A;  5EKL A;  3OYY A;  4L8J A;  1HNX L;  2HHH Q;  1WFQ A;  2PW5 A;  4QB4 A;  5DM7 3;  3OW7 A;  4B3R Q;  1OO9 B;  2RDG A;  1A3V A;  2RSN A;  4CDD C;  1XPO A;  3KYH C;  2RSO A;  2EJG C;  2YTV A;  2F0E A;  3S1N B;  4C3I B;  3SVM A;  1WTW A;  3KLS X;  3FHW A;  2Z6B A;  3Q8D A;  4PZ7 A;  4B9X A;  2B2T C;  5KIX A;  3CCM A;  2UUA Q;  2F3W A;  2Y0S E;  1F77 A;  1ET9 A;  1SFO B;  4LF7 Q;  3CQZ B;  3BDC A;  3NTK A;  2HQL A;  3ULP A;  3CCV A;  5IGF A;  1IBL L;  4F8M A;  2OEO A;  4Y52 H;  1STB A;  3HOY B;  2ALY B;  2Q2T A;  5K5P A;  3GTM B;  1AEX A;  2CCZ A;  2PCF B;  2Z4I A;  3DLL A;  2DY7 A;  2J0T D;  4XQQ A;  3CAM A;  5CV5 A;  1SMX A;  4PZ8 A;  1D1I A;  2JN4 A;  2PZW A;  3ERS X;  4MIU A;  2IPK D;  2XWB B;  3VR4 A;  3I55 A;  1VQ5 A;  3G6E A;  4IUU A;  1CQV A;  1SSO A;  4U68 A;  2E5L L;  2ZT9 C;  3HOX H;  3A5Z B;  1I6V C;  4BXX G;  3HOW G;  3T4A C;  3SHL A;  2HD3 A;  3DWP A;  2KCT A;  2TMP A;  1U4P A;  5CMD A;  4DKA C;  1QE6 A;  1Y1V G;  3A54 A;  3IFD A;  1TS5 A;  4QQB X;  1HQR D;  1TWC B;  1X6O A;  3EBE A;  2BDN A;  1BBU A;  3QIA A;  1RKN A;  5M5W H;  1MBY A;  4IFD G;  2H5X A;  5M3M B;  1UEB A;  1EIF A;  1EYC A;  2WAC A;  3H0G H;  2F4V Q;  5E3F A;  1KNA A;  4BBS H;  3W1G A;  1E1O A;  3QB3 A;  2L1B A;  3RUZ A;  1CKN A;  5EQ0 A;  5M9O A;  3JAM L;  1FL0 A;  1DZ1 A;  4X62 Q;  1O7I A;  4OIJ A;  4EGV A;  2QEJ C;  5C4Z A;  4DV7 Q;  1ASZ A;  3HOX G;  2NVT H;  2SEB D;  4FF2 A;  1KAW A;  2KOL A;  1ZYR C;  5KRU A;  4CDF C;  5IP9 H;  4YY3 Q;  1SRU A;  1QNU A;  5C4J H;  1E3P A;  4UY8 C;  1Q86 C;  1H9M A;  4LF4 Q;  1X56 A;  1DCZ A;  2PI2 A;  5C4X H;  2NB0 A;  3BZD B;  3NTH A;  3HKZ G;  1SNP A;  3CPF A;  3H0G G;  4A93 G;  1PRT D;  1SND A;  3KDF A;  5C0X H;  2CHB D;  3LNN A;  1XXG A;  4DAM A;  1EY5 A;  1I5F A;  1K3B C;  4EQO A;  2M00 A;  3G7L A;  4YCV A;  2KEC A;  1U4R A;  1TWH H;  1I94 Q;  4KKS A;  4PMW A;  2HHH L;  5DEH A;  4X65 Q;  1ICW A;  5FKA C;  4ME5 A;  1RL2 A;  4A3F H;  1GO3 E;  2E2D C;  2JYO A;  2ZXR A;  4C56 C;  3M4P A;  2F0G A;  4A3M G;  2A6E C;  5BR8 Q;  1TR5 A;  2VY3 A;  1L1O C;  1Z7T A;  1WI5 A;  1TY2 A;  4FDB A;  3I4M H;  2AQ3 B;  4CJ0 B;  2XIW A;  1QIL A;  1CA5 A;  1Z6H A;  1JE5 A;  2G5D A;  3AEV A;  2F3V A;  3GP7 A;  4LF7 L;  2MFI A;  3MFG A;  3TBI B;  4CBV A;  1TS4 A;  3BVM A;  4APV A;  4GN3 B;  3CP0 A;  1EZ8 A;  2FIN B;  3X3M A;  4ZK9 B;  1WTO A;  4QY7 A;  2I5L X;  2LXK A;  2R93 H;  3K5N A;  1E0B A;  1EY6 A;  3NTI A;  1L0X B;  2ZJR A;  3UDG A;  1ENF A;  2F4I A;  2F0T A;  3DM1 A;  3NEL A;  1D1K A;  3S1R H;  1L0W A;  1IKM A;  1NBW A;  2F0D A;  1NJI C;  1HFG A;  1RD9 D;  1S4Z A;  5FK9 C;  2D62 A;  2B2Y C;  2N55 A;  3I4M G;  1PMR A;  4FP5 D;  4N8F A;  3F2C A;  3KUP A;  4AIM A;  1HPC A;  1C8C A;  1EEI D;  1KTK A;  3H15 A;  4FF1 A;  3CCQ A;  2B2U A;  1WOC A;  4DR5 Q;  2MP1 A;  2VXW A;  1N34 Q;  1CA6 A;  1H9R A;  2K04 A;  5GRO A;  3K58 A;  1W2B A;  2IY5 B;  2SNM A;  4ZCK A;  2DUD A;  2F4V L;  5D3D A;  4K8J A;  1CHP D;  4EX5 A;  3FPU B;  4K5X A;  1A0I A;  5GAH C;  3A8I E;  4A3J H;  4M1U B;  4KJO A;  4IPG A;  3QO2 A;  2HUG A;  4BY1 B;  2AMC B;  2JA6 B;  3K7A B;  4X62 L;  2A1A A;  3K59 A;  3UE0 A;  5GAE C;  4GLX A;  4LFC Q;  2EQS A;  3TQY A;  1V1P B;  1BBX C;  3I73 A;  3T56 B;  1YI2 A;  4RGO S;  2NVQ B;  1XTC D;  4YY3 L;  2Z8L A;  2K50 A;  5A2Q L;  1C4Q A;  2F0V A;  1KRT A;  4RKB A;  4JG2 A;  4DFA A;  4LF4 L;  5IGD A;  4A3L H;  4FF3 A;  1IL8 A;  3HG9 A;  1L1O B;  1BO0 A;  1ENC A;  4DR6 Q;  4JI2 Q;  2XN9 C;  2TSS A;  4XT3 B;  1CSQ A;  5EPJ A;  5C5M A;  3DEO A;  5TSS A;  4BY7 B;  3WDN A;  1OXT A;  1GUG A;  4KD3 A;  3PIP A;  1I94 L;  1GUN A;  2QGQ A;  5IP7 H;  4F88 A;  2K5H A;  5BR8 L;  2O5I C;  4HN7 A;  2VS1 A;  3E9I A;  1SAP A;  1HXY D;  1HJP A;  4ULL A;  5M5X H;  1PZI D;  4RMF A;  3WWV A;  2ICE C;  4OWW B;  2X69 A;  2WV6 D;  2JA7 H;  2IX0 A;  1STG A;  3J81 i;  3K5L A;  1J8I A;  5LMU Q;  3M85 A;  2ZJP A;  2VUM B;  1HZB A;  3DUZ A;  5E7N A;  3GTJ H;  2JA8 H;  3GTL H;  3D6C A;  2F0O A;  3W1B A;  1KLG D;  2N3S A;  2EY2 A;  2E2H H;  2RKS A;  2IHE A;  1F9Q A;  1IYJ B;  2NN6 G;  3DWQ A;  1TVX A;  3S17 H;  1QVF A;  2Q2I A;  4B3S Q;  2R92 B;  1YHA A;  4H44 C;  2WB1 E;  2IW3 A;  4DV2 Q;  2D0P A;  1PTO D;  4A3E H;  4DR7 Q;  4ZYS A;  4MN3 A;  3CCU A;  1H9J A;  4WJ3 M;  4L63 B;  1Q81 C;  1BF4 A;  2UU9 Q;  2JEA I;  3KOJ A;  1T5E A;  1WTP A;  1D5M C;  1P16 A;  4C2M B;  2CH4 A;  2K5V A;  3I4N H;  3DM3 A;  1XPR A;  4JW0 A;  3UE1 A;  1VQB A;  5CBA E;  1EQR A;  2H4O A;  4J15 A;  1HHV A;  2WP8 J;  1VQH A;  1B9M A;  4OGQ C;  3ULJ A;  4DR5 L;  2EDG A;  4B9W A;  3I70 A;  4GS3 A;  5C3E B;  1N34 L;  1CUK A;  1EUJ A;  4IQZ A;  2R7F A;  1BR9 A;  4O2D A;  3Q22 A;  4A3B B;  4AQY Q;  1IHZ A;  4PMB A;  1Q1B A;  3K5O A;  3R2I A;  5C44 G;  3SDZ A;  5DAU A;  1EEF D;  2A68 C;  3G48 A;  5CR3 A;  4A3E G;  1TQO A;  2LY7 A;  4LF5 Q;  4G57 A;  2WIN B;  2I5M X;  3A7L A;  1B8A A;  4YCW A;  3T1Y Q;  4LFC L;  4POF A;  2IX3 A;  4FYD A;  2QW7 A;  2MO0 A;  4ME3 A;  4PNY A;  1QOH A;  1TWF H;  4UP7 A;  2O2L D;  1PH7 A;  3C3L A;  1VQN A;  1PFS A;  3J80 c;  1B9N A;  2L9H A;  2LMC B;  4TVA B;  3HOV B;  2RVL A;  1TII D;  4HJA A;  1SMY C;  3IL8 A;  1HZC A;  2Y0S G;  1TKW B;  2E2I H;  1V43 A;  1XPU A;  1EWI A;  2R7D A;  4QUC A;  3OIP A;  1EY7 A;  4DR6 L;  3PO2 B;  2JA5 B;  2UXD Q;  4EVO A;  2L11 A;  1HZA A;  4KN4 C;  3I4L A;  5I2X A;  1UWV A;  2SNS A;  1CK1 A;  1Q90 A;  4RGN A;  3UI2 A;  2QDB A;  3S2D B;  1PRT F;  3VDY A;  3MC0 B;  5HGQ A;  1AH9 A;  3GTO H;  4HTH A;  1R9T H;  1YNN D;  1QVG A;  2H1E A;  4GKJ Q;  1GUS A;  1N8R C;  1U4L A;  4LFA Q;  3OMC A;  4GOP A;  5IT9 E;  1M8A A;  3C1F A;  1T5X D;  1MGS A;  1BCP F;  3VYR A;  1CM9 A;  2EXZ A;  2PYK A;  4HAE A;  1H9K A;  4JCV E;  2CQO A;  3ICE A;  2D9U A;  1X65 A;  3S24 A;  4IOA A;  2E75 C;  4R4I A;  1C9O A;  4GNX A;  2B63 H;  2IWH A;  4RCO A;  3OHX C;  4HIK A;  1CHQ D;  3H91 A;  4C3H H;  3S14 H;  1KC8 C;  1EOV A;  4X66 Q;  5IGC A;  2UXB Q;  3GD7 A;  1BXT A;  2NVY H;  4P73 A;  1I6H H;  5L37 A;  1VQE A;  4IPH A;  4IN3 A;  1OXX K;  2E74 C;  4XIG S;  5FJ8 G;  4DR4 Q;  3TEH B;  1I4G A;  4PV1 C;  1E24 A;  4B3S L;  1TT2 A;  4KHZ A;  5IOD A;  4DV2 L;  1PFN A;  2DN8 A;  1CZW A;  4DAY A;  3HOU B;  1V1O A;  1VCI A;  4DR7 L;  4A3D B;  2PPB C;  3H09 A;  3VR2 A;  1EFW A;  3I56 A;  1BUV T;  2FMM A;  1PH8 A;  2UU9 L;  3GV6 A;  3NP8 A;  2VB2 X;  1HNW Q;  1DGS A;  5IGG A;  4P2C B;  3ND8 A;  1RIP A;  4N8X 1;  4ZKB B;  1EYG A;  3A5U A;  4IUN A;  4OO1 I;  5FLX c;  4P72 A;  4C3H G;  1EY8 A;  1YEZ A;  3HZX A;  3GTP H;  3BDO A;  3KBG A;  5FLM H;  1WCM B;  2N88 A;  4AYB B;  2MNA A;  4HJ8 A;  4P71 A;  1ROD A;  2PZU A;  5IGB A;  4AQY L;  3BDL A;  4HMI A;  1GKH A;  1K8M A;  4UP8 A;  1B2T A;  5JEA H;  3J80 L;  1JWS D;  2MUY A;  4RAU C;  2EE1 A;  3I91 A;  4DV1 Q;  4LF5 L;  1QZH A;  1KDA A;  1G8Z D;  2RCN A;  3PO3 H;  3M4Y A;  1K83 B;  3LWE A;  4HCE A;  3RLF A;  1CKN B;  4HJ9 A;  1LTT D;  3BU2 A;  5CGK A;  1VMC A;  1ESR A;  2WKC A;  2K01 A;  2MGS A;  2BDO A;  2JP1 A;  2XWJ B;  2L12 A;  1N33 Q;  3EJI A;  2FJ2 A;  1FNW A;  2XGT A;  2B2U C;  5KYL A;  5M5Y H;  3AYH B;  3PUV A;  1HNZ Q;  2K7V A;  1PFB A;  1LO5 D;  2WAQ B;  3H3V H;  1XMO Q;  1G2T A;  2UXD L;  2OF1 A;  4XTC S;  3RZD H;  3M4O H;  1X9N A;  1JOO A;  2HT1 A;  2XTI A;  2K33 A;  5AFW A;  1YNN C;  2EJM A;  4RWS C;  2PNH A;  3IKJ A;  1IZ6 A;  4JBW A;  4LF8 Q;  3K6O A;  5IIF A;  1LLR D;  2EVB A;  4DAV A;  5JPM C;  4A3I H;  3PO3 G;  3KDF B;  1QG7 A;  1ZYR D;  3CRL C;  3FEW X;  5I9O A;  1KIX A;  4BBR B;  4GKJ L;  3RN5 A;  2GA4 B;  3J7A V;  3E0E A;  5EBC A;  4LFA L;  3HRZ C;  2NVX H;  3DEP A;  4ZQ3 A;  2JSO A;  3H6M A;  1K73 C;  3M7G A;  5J3B A;  2B39 A;  2WFW A;  4GLA C;  4LUV A;  5G3L F;  1VQF A;  1NMG A;  2DGY A;  3N52 A;  2MPM A;  3Q0A A;  3GTQ B;  1NR2 A;  3FVQ A;  1OTC A;  1XMQ Q;  1LAB A;  1MSH A;  1A62 A;  3MTS A;  2BH8 A;  4X66 L;  1OXU A;  2UXB L;  1FGB D;  4OL7 A;  3NEN A;  1MHW C;  3AQQ A;  4WOR A;  1F2Z A;  1K28 A;  1XJV A;  3B6Y A;  3CPW A;  4A3I G;  2OWO A;  4DR4 L;  1MI2 A;  2RQX A;  2EYJ A;  1BVS A;  4KHP L;  3A55 A;  2A6E D;  3BYT B;  4DV6 L;  3MWY W;  1QVC A;  3A74 A;  3J81 j;  2YU9 H;  4BXX H;  3HOW H;  4JI8 Q;  4P74 A;  1VQ6 A;  4JI1 Q;  5FLX L;  4A3G G;  3MXU A;  2ENB A;  1M4V A;  1H95 A;  1Y1V H;  3ERQ A;  4JVZ A;  1HA5 A;  3F1Z A;  4IUT A;  1HNW L;  4R4Q A;  5J22 A;  4IFD H;  4DK6 C;  2OT2 A;  1I3Q H;  1G6Z A;  1MSG A;  1E1T A;  3PUY A;  1Y1W G;  4B3M Q;  1CT1 D;  4P75 A;  2A8V A;  5BN4 A;  2ID0 A;  4X64 Q;  5M3F G;  1EU4 A;  2NZO A;  1EIY B;  3BYY B;  2F0H A;  5EPL A;  3P75 A;  3OW2 A;  4O1N A;  3D4D A;  5I6W A;  4YHH Q;  4HIM A;  4KHV A;  3PUW A;  4QCL A;  2YTY A;  3OWF A;  3IAY A;  3BS1 A;  1YHB A;  3ULL A;  4NMZ A;  1HFN A;  2FMC A;  3E3X A;  5DNF A;  1GHK A;  1PHJ A;  3QWN A;  4C3I G;  1LAC A;  4RCN A;  3RD4 A;  4DV1 L;  3Q23 A;  3HOX B;  2GVA A;  3HFZ B;  2LKV A;  1A8V A;  4A3C H;  1AFP A;  1HUN A;  4KV6 A;  3I4O A;  5IYB H;  4JV5 Q;  3ITP A;  5CYU A;  1P8L A;  1S5D D;  1YVC A;  2E8G A;  2PMZ E;  3M4Q A;  4I65 A;  4JI0 Q;  4A93 H;  3NWS A;  1GOZ A;  1J5E L;  1N33 L;  1RHP A;  5M5W B;  2R3Z A;  1PH6 A;  3HKZ B;  2EPB A;  1HNZ L;  3ZYY X;  3H0G B;  1LTR D;  3GO5 A;  4RGM A;  4LF9 Q;  2A6H C;  4OWT B;  4BBS B;  1LT3 D;  5GAG C;  1JB7 A;  2FXQ A;  2L15 A;  1XMO L;  3OIQ A;  4A3M H;  4IUV A;  3JAM i;  2F0M A;  4LF8 L;  3LX0 A;  3PIO 3;  4ZUJ A;  3K8A A;  4DGZ A;  2NVT B;  1KHI A;  2WB1 G;  4ID6 A;  1PYW D;  3G4S A;  4A3C G;  1TU2 B;  3OMG A;  4PMC A;  3CHB D;  5IYB G;  1MKH A;  5C4J B;  2IJ0 A;  1VQ4 A;  3LWU A;  3RMH A;  2KCM A;  1WD0 A; 
#chains in the Genus database with same CATH homology
 4RA8 A;  5C4X B;  4DK0 A;  1ONL A;  3FDT A;  2J4X A;  1NSN S;  4BS9 A;  4H0L C;  4GZY C;  4G7O C;  1EQT A;  4FXG C;  1G2S A;  2EJF C;  4HED A;  3BVG A;  1TWH B;  4IUR A;  5JPN C;  5EGT A;  5I9P A;  4A3F B;  2CQA A;  1B3A A;  3J81 E;  3O13 A;  4C1N K;  3TN2 A;  4KD4 A;  3C1E A;  1II3 A;  1DOM A;  5F2D A;  3I4M B;  3AMU A;  5JAV A;  1I4R A;  3PV0 A;  1L0Y B;  2Q8I B;  1S5F D;  1RCV D;  2R93 B;  3I8Z A;  3EVQ A;  2BE5 C;  2BA0 A;  2ZXP A;  1WVL A;  3S1R B;  3U9S A;  2XVS A;  4RFB A;  1EY9 A;  2SDF A;  4IUQ A;  4OHJ A;  1A2T A;  4J1M A;  3PIP 3;  3HS0 C;  3R8B A;  1GUT A;  4X3T A;  1H9S A;  1PZK D;  4DNT B;  1Q3L A;  4XQN A;  5C3X A;  1EY4 A;  1QB5 D;  5KND A;  4HMJ A;  1Y69 U;  2NUC A;  2KED A;  1EZ6 A;  1WTR A;  1NR4 A;  5CV4 A;  2I07 B;  4A3J B;  1DOK A;  1PXU A;  3NQI A;  1WTQ A;  2A68 D;  4O42 A;  5ELC A;  3D3R A;  2V4D A;  5C0X I;  4QF4 A;  4V19 0;  1STE A;  2C9O A;  3I3C A;  1K8O A;  2D5D A;  2NTT A;  3PUZ A;  3NK9 A;  1A3T A;  1EQV A;  5KEE A;  1GUW A;  1EYA A;  4XYO A;  3A7A B;  2EZV A;  1SMY D;  2B8F A;  4CKE A;  1Y8O B;  2EYL A;  5COR A;  3WOE A;  2NN6 H;  5CV6 A;  2K5W A;  4KY6 A;  1KNE A;  5HGT A;  1SE3 A;  1VF5 C;  1WTV A;  2BOS A;  2OXP A;  1SE4 A;  5ELF A;  2O4X A;  1X3P A;  4TRD A;  5JVG 3;  1EOT A;  4R8I A;  1F9R A;  1OXS C;  2B2V A;  2K1B A;  3CU7 A;  1I4H A;  1JIC A;  2EY6 A;  5M5X B;  4QIW B;  4DXF A;  2NYZ D;  2JA7 B;  3VR3 A;  2F0L A;  1UAP A;  3W3A A;  3GTJ B;  2JA8 B;  3GTL B;  4RKL A;  2F0U A;  1FD7 D;  4RH6 A;  3VA5 A;  2E2H B;  2F0S A;  3NBH A;  5BN3 A;  3C46 A;  4DF7 A;  3S17 B;  4R9W A;  2K5D A;  1JWM D;  1LTG D;  4XT1 B;  2JE6 I;  4G7H C;  2JEB I;  4ODG A;  4DAP A;  4A3E B;  2R7Z B;  3MXG A;  1SYB A;  1SNQ A;  1B4O A;  3ND9 A;  1QNK A;  3I4N B;  2L55 A;  5ELB A;  4DN4 M;  3RZO B;  1JB3 A;  4UDU C;  4CJ2 C;  1LT4 D;  2Y0S B;  1TWG B;  3F2U A;  3KBX A;  4QMG A;  3AU7 A;  1Q1E A;  3VR6 A;  4ABN A;  1FNU A;  2K28 A;  1S5E D;  3P20 A;  1EFI D;  2EYM A;  4DNR B;  1JWU D;  4J6H A;  5KNC A;  5C0X J;  4M8A A;  4Z9C B;  4KN7 C;  5C6A A;  5CV8 A;  1CI3 M;  1TWF B;  4K5W A;  2KJX A;  1F2L A;  3NPP A;  2BA1 A;  5C3W A;  2E2I B;  2PZT A;  1U9R A;  3L3O C;  2KVM A;  2R6G A;  3N6R A;  1A15 A;  1U4M A;  3KF8 A;  3P7J A;  2DY8 A;  4A3K B;  2NBF A;  1ENA A;  1EY0 A;  3GTO B;  2YYZ A;  4OO1 G;  4XXE A;  1R9T B;  1GUO A;  1V8Q A;  1WD1 A;  4R8N A;  3GV3 A;  3MFY A;  3H3V C;  4H13 C;  4K6L A;  5CV7 A;  2F03 A;  3M7N A;  1KAA A;  1JQY D;  1SE2 A;  2J7Z A;  4MHE A;  2FFK B;  3NWT A;  5I4D A;  2VB3 X;  1F9S A;  2B63 B;  4NKL A;  1UNS A;  3R2T A;  4C3H B;  3S14 B;  2K32 A;  2NVY B;  1I6H B;  2EYO A;  3DHQ A;  1TS3 A;  1STN A;  1DJR D;  2AUJ D;  1B1Z A;  3NSW A;  1ET6 A;  1YNJ C;  5E1F A;  3J7A F;  3E6Z X;  4UAI A;  1SNC A;  1EWH A;  2E76 C;  2L4N A;  1JOK A;  2G9H D;  3T16 A;  1AZQ A;  1C48 A;  3OSO A;  2O5J C;  1EWC A;  1GHJ A;  2JXM B;  3KLS A;  3V96 A;  1O7Z A;  2HCI A;  4C3J G;  3T13 A;  2EYP A;  3GTP B;  5JVH 3;  3MXN A;  1I4Q A;  2KCN A;  3QJY A;  1PFM A;  4S3S A;  2CW0 C;  5KGU A;  1HTP A;  3A8J E;  5EBD A;  3EQL C;  3MA2 B;  1SYF A;  2F0W A;  4KKT A;  3TP8 A;  4G7Z C;  3OOC A;  4LK1 C;  1MD2 D;  3C2P A;  3PO3 B;  1X3Q A;  1O7Y A;  1SYC A;  1DXM A;  3EFX D;  3D8G A;  3FPP A;  3EA6 A;  1DYQ A;  1AN8 A;  3ONA B;  2K03 A;  1NCV A;  5D65 A;  3VYT A;  5M5Y B;  1ZEQ X;  3JAM E;  4FF4 A;  5ELE A;  4NDX A;  4X3K A;  1DOL A;  1NUC A;  2A6H D;  1X32 A;  3RZD B;  3M4O B;  5E4X A;  3A56 A;  3URY A;  1XWE A;  2EOT A;  3VYS A;  1A6X A;  1ILQ A;  1B53 A;  1JR0 D;  4A3I B;  1ZXT A;  1SNO A;  1CQF A;  1PTO H;  1I4X A;  2IX1 A;  2NVX B;  5IT9 L;  1O80 A;  3MXP A;  1SJH D;  4TKO B;  4DA2 A;  2Z1C A;  3CRK C;  3IFT A;  2R61 A;  5LL6 S;  4IZ8 A;  5IOC A;  5CC4 A;  1HCZ A;  1AP0 A;  1A3U A;  4KKU A;  5DM6 3;  3SK5 A;  2CVR A;  5JOB A;  1SJE D;  3I72 A;  2B2W A;  3PMF A;  4JK1 C;  3S9W A;  5EKI A;  3MVV A;  1E2V A;  2MJ8 A;  1BOS A;  4IUP A;  1PTO F;  4C1N I;  2YU9 B;  3HOW B;  3KK7 A;  2EY5 A;  2RA4 A;  2QKI C;  1SBB B;  2B2V C;  2F0K A;  2L0C A;  3A8K E;  1Y1V B;  2KA7 A;  2PO4 A;  1XYI A;  4FVM A;  2NTS A;  4EQN A;  1RTN A;  1I3Q B;  4BA2 I;  4F7X A;  1KDC A;  4X3S A;  2EYH A;  1LTI D;  3D31 A;  2I46 A;  1UEA B;  1VF7 A;  5J1Z A;  1F2M A;  4FXK C;  2XRS D;  1W6J A;  2BE5 D;  1LTB D;  2EY1 A;  1RTO A;  4DXG A;  1DON A;  2IL8 A;  1H9S B;  2ZXO A;  1IW7 D;  1SXT A;  3TP5 A;  1OXV A;  4V0B A;  2WB1 B;  2L5T A;  3WOF A;  2Z4H A;  4A93 B;  1VDZ A;  2KEE A;  2Q8T A;  1EL0 A;  4NP5 A;  3OPO A;  1KLU D;  3TDQ A;  1E2W A;  1KDB A;  3OWE B;  2X6G A;  3TSS A;  4CJ1 B;  3U9O A;  3VYU A;  1HQM C;  1TS2 A;  5ISR A;  4K5V A;  4A3M B;  5A2Q E;  5FO7 B;  5K36 H;  4L6T B;  2AQ1 B;  1ZKO A;  3T51 B;  2AUK A;  3SEB A;  2HDL A;  5D14 A;  1NAP A;  3BG3 A;  4CKB A;  3K57 A;  1EYD A;  3GQB A;  3VA7 A;  3T53 B;  4KTA A;  5C5L A;  1CTM A;  2F0F A;  1KAB A;  1Y8P B;  4BWG B;  2PNR C;  1ML0 D;  4FNF A;  1I50 B;  1FNV A;  3QOL A;  1R4P B;  4IFD I;  1CZG A;  5K36 G;  1LV9 A;  3V05 A;  4I7Z C;  2X6L A;  1LT5 D;  1BCP D;  1HUM A;  3MZ5 A;  4YIJ A;  2EYF A;  4KMU C;  3NHH A;  1DD2 A;  4KI0 A;  4U67 3;  2E2J B;  5JEA J;  4B08 A;  3Q6S A;  3M3Y B;  4K14 A;  2KQ3 A;  3SE0 A;  2M2L A;  5C0X G;  2K6A A;  3QG1 A;  1SYD A;  3X3N A;  1IW7 C;  5D3I B;  4LMQ D;  5LL6 X;  4FXD A;  1QCB D;  4G4K A;  3ERO A;  1EIH A;  3HOZ B;  4CHT B;  3D4R A;  4LJZ C;  3DXJ C;  4F87 A;  4PQX A;  2PW7 A;  1R4Q B;  1SDF A;  4KK7 A;  3GTK B;  4WFN 3;  5IGE A;  2F0I A;  5EKK A;  1JCK B;  2K05 A;  2FHT A;  1A2U A;  5KYI A;  4BA1 I;  2A73 B;  4ILW A;  4CKC A;  2AWO A;  1BDO A;  3D4W A;  1ILP A;  2A69 D;  1SYE A;  1TWA B;  2B8G A;  2C5C A;  3SR1 A;  1WTX A;  1PRT C;  2KUM A;  2K5Q A;  5I6Y A;  3S15 B;  1I4P A;  1IKL A;  2M9V A;  2DNC A;  4KJN A;  3S1M B;  1D2B A;  1LTS D;  1BCP C;  5CBE E;  1LTA D;  1RJT A;  4ZUI A;  4IFD J;  3V2T A;  5NUC A;  4TQU S;  1STA A;  1AW7 A;  2B2T A;  3FKI B;  1JOQ A;  3J81 L;  2KCC A;  3MAQ A;  5G3L D;  5I2Y A;  4K2L A;  1O7L A;  4TSS A;  3DWA A;  3K0Y A;  5EJW A;  1PZJ D;  2F0J A;  1S5C D;  4ZAI A;  4X3U A;  1IYU A;  1Q12 A;  5C44 B;  4HCS A;  1TY0 A;  2A74 C;  4XDX A;  2DNE A;  4E6I A;  2B2W C;  5T1G A;  3E0J A;  4Q0F A;  3D6W A;  1YNJ D;  4Q5V A;  2XRQ D;  2D2C C;  2NZ1 D;  3R3O A;  5C4H A;  3MHB A;  2QF7 A;  2BCO A;  2AWN A;  2Q8R E;  4K2K A;  3NXW A;  3S1Q B;  4J8Q A;  1HRJ A;  2QCP X;  1F2Y A;  2VNU D;  4RHS A;  3P1H A;  3G6J B;  3W2D A;  3J80 E;  2G9D A;  3TME A;  3S2H B;  1AZP A;  1B44 D;  2ICI A;  1PRT B;  5BN5 A;  2WII B;  2CW0 D;  3SK4 A;  2A69 C;  4OO1 H;  3Q24 A;  5J39 A;  2F0P A;  1QWY A;  2NN6 I;  2LS0 1;  4OIK A;  3K5M A;  2RBM A;  5E4W C;  4XQJ A;  1BCP B;  3FRP B;  3R93 A;  3VR5 A;  2HDM A;  4WJW A;  3CKI B;  1FR3 A;  3TP6 A;  1V1P A;  1HTL D;  4KY7 A;  1E2Z A;  5FOB B;  4DK1 A;  2PMZ B;  1RF2 D;  2QIL A;  2F0Q A;  4CGY B;  4ZLT F;  3BVZ A;  3HGB A;  1Q8I A;  1VMP A;  4HSV A;  4FO2 A;  5COY A;  1GJX A;  4N9T A;  5LHY 1;  4NW2 A;  3AB9 A;  5EPK A;  3FMC A;  2F1M A;  2PQE A;  4Y7N B;  5FO8 B;  2RDF A;  1DM0 B;  3L7Z C;  3PUX A;  3SXH A;  4HSP A;  4K8I A;  1J9O A;  1F9P A;  1Y8N B;  3NE5 B;  3GTG B;  1EU3 A;  3HP3 A;  3J7Y W;  1G29 1;  4C3J B;  5KNB A;  3SK6 A;  3S16 B;  1PTO C;  3I90 A;  2XNA C;  1PDQ A;  2A5H A;  1CFM A;  2B2Y A;  5FLX E;  1D5X C;  3TZD A;  1LT6 D;  2XSC A;  4KY5 A;  1JE4 A;  1UUP A;  1D5Z C;  4RHR A;  1STY A;  1BNZ A;  4H7B A;  4IAL A;  1GXD C;  1BQQ T;  1B50 A;  4XYQ A;  4QUF A;  1G91 A;  1HA6 A;  1SYG A;  4N9P A;  4K6D A;  5JJZ A;  4ZKC B;  1S5B D;  1JOR A;  5A35 A;  3TP7 A;  3L9A X;  4HR7 B;  2KHS A;  2IT1 A;  5T1I A;  3MEH A;  4LAA A;  3NUC A;  2NWG A;  1JC7 A;  5HUR A;  3HEJ A;  3H94 A;  1ESF A;  2HQE A;  3DMU A;  4RGT A;  2F0N A;  1W6K A;  3TZU A;  3NBI A;  4WRD A;  3NQT A;  2SOB A;  2RDH A;  2HCC A;  1RDP D;  4EQP A;  1IYV A;  1EIG A;  1SNM A;  4ZRZ A;  5JEA G;  1FYC A;  3SK8 A;  3E5S A;  3KLR A;  1QJO A;  1Z47 A;  3QOJ A;  4A3G B;  2AQ2 B;  1PTO B;  1D6E C;  2LFN A;  1O78 A;  1SEB D;  5FO9 B;  1Y1W B;  5ELD A;  2WKD A;  1STH A;  5CV9 A;  2MHV A;  4DU9 A;  5M3F B;  1XX8 A;  1PLF A;  5EKL A;  4L8J A;  2PW5 A;  4QB4 A;  5DM7 3;  3OW7 A;  1OO9 B;  2RDG A;  1A3V A;  2RSN A;  2RSO A;  2EJG C;  2F0E A;  3S1N B;  4C3I B;  3SVM A;  1WTW A;  3KLS X;  4B9X A;  2B2T C;  5KIX A;  2F3W A;  1F77 A;  1ET9 A;  1SFO B;  3CQZ B;  3BDC A;  3NTK A;  5IGF A;  4F8M A;  2OEO A;  1STB A;  3HOY B;  5K5P A;  3GTM B;  1AEX A;  2PCF B;  2Z4I A;  2DY7 A;  2J0T D;  4XQQ A;  5CV5 A;  1D1I A;  2PZW A;  4MIU A;  2IPK D;  2XWB B;  3VR4 A;  4IUU A;  1CQV A;  1SSO A;  4U68 A;  2ZT9 C;  1I6V C;  3T4A C;  3SHL A;  3DWP A;  2TMP A;  1U4P A;  5CMD A;  1QE6 A;  3A54 A;  3IFD A;  1TS5 A;  1HQR D;  1TWC B;  2BDN A;  3QIA A;  1RKN A;  1MBY A;  4IFD G;  5M3M B;  1EYC A;  2WAC A;  5E3F A;  1KNA A;  3QB3 A;  2L1B A;  3RUZ A;  5EQ0 A;  5M9O A;  3JAM L;  1DZ1 A;  4OIJ A;  4EGV A;  2QEJ C;  5C4Z A;  2SEB D;  4FF2 A;  2KOL A;  1ZYR C;  5KRU A;  1QNU A;  1H9M A;  1DCZ A;  2NB0 A;  3BZD B;  3NTH A;  1SNP A;  1PRT D;  1SND A;  5C0X H;  2CHB D;  3LNN A;  1XXG A;  1EY5 A;  4EQO A;  2M00 A;  3G7L A;  2KEC A;  1U4R A;  4KKS A;  4PMW A;  5DEH A;  1ICW A;  5FKA C;  4ME5 A;  2E2D C;  2JYO A;  4C56 C;  2ZXR A;  2F0G A;  2A6E C;  1TR5 A;  1Z7T A;  1TY2 A;  2AQ3 B;  4CJ0 B;  2XIW A;  1QIL A;  1CA5 A;  1Z6H A;  2F3V A;  3GP7 A;  3MFG A;  3TBI B;  4CBV A;  1TS4 A;  3BVM A;  1EZ8 A;  2FIN B;  3X3M A;  4ZK9 B;  1WTO A;  3K5N A;  1E0B A;  1EY6 A;  3NTI A;  1L0X B;  1ENF A;  2F4I A;  2F0T A;  3DM1 A;  1D1K A;  1IKM A;  2F0D A;  1HFG A;  1RD9 D;  1S4Z A;  5FK9 C;  2D62 A;  2B2Y C;  2N55 A;  1PMR A;  4FP5 D;  3KUP A;  1HPC A;  1C8C A;  1EEI D;  1KTK A;  4FF1 A;  2B2U A;  2MP1 A;  2VXW A;  1CA6 A;  1H9R A;  2K04 A;  3K58 A;  2SNM A;  5D3D A;  4K8J A;  1CHP D;  3FPU B;  4K5X A;  3A8I E;  4M1U B;  4KJO A;  3QO2 A;  2HUG A;  4BY1 B;  2JA6 B;  3K7A B;  3K59 A;  1V1P B;  1BBX C;  3I73 A;  3T56 B;  4RGO S;  2NVQ B;  1XTC D;  2Z8L A;  5A2Q L;  1C4Q A;  2F0V A;  4RKB A;  4DFA A;  5IGD A;  4FF3 A;  1IL8 A;  3HG9 A;  1BO0 A;  1ENC A;  2XN9 C;  2TSS A;  4XT3 B;  5C5M A;  5EPJ A;  3DEO A;  5TSS A;  4BY7 B;  3WDN A;  1OXT A;  1GUG A;  4KD3 A;  1GUN A;  4F88 A;  2O5I C;  4HN7 A;  1SAP A;  1HXY D;  4ULL A;  1PZI D;  2ICE C;  2X69 A;  2WV6 D;  2IX0 A;  1STG A;  3K5L A;  1J8I A;  3M85 A;  2VUM B;  3DUZ A;  3D6C A;  2F0O A;  1KLG D;  2EY2 A;  2RKS A;  1F9Q A;  2NN6 G;  3DWQ A;  1TVX A;  2R92 B;  4H44 C;  2IW3 A;  1PTO D;  4ZYS A;  4MN3 A;  1H9J A;  4L63 B;  1BF4 A;  2JEA I;  1T5E A;  1WTP A;  1D5M C;  4C2M B;  5CBA E;  2H4O A;  1HHV A;  2WP8 J;  4OGQ C;  1B9M A;  2EDG A;  4B9W A;  3I70 A;  5C3E B;  4IQZ A;  1BR9 A;  4A3B B;  3Q22 A;  1IHZ A;  4PMB A;  1Q1B A;  3K5O A;  3R2I A;  3SDZ A;  5DAU A;  1EEF D;  2A68 C;  5CR3 A;  1TQO A;  2LY7 A;  4G57 A;  2WIN B;  3A7L A;  2IX3 A;  4FYD A;  4PNY A;  1QOH A;  2O2L D;  3C3L A;  1B9N A;  2L9H A;  2LMC B;  3HOV B;  2RVL A;  1TII D;  1SMY C;  3IL8 A;  1TKW B;  1V43 A;  4QUC A;  3OIP A;  1EY7 A;  3PO2 B;  2JA5 B;  4EVO A;  2L11 A;  4KN4 C;  3I4L A;  5I2X A;  2SNS A;  1CK1 A;  1Q90 A;  4RGN A;  3UI2 A;  2QDB A;  3S2D B;  1PRT F;  3MC0 B;  4HTH A;  1YNN D;  2H1E A;  1GUS A;  1U4L A;  3OMC A;  5IT9 E;  1M8A A;  3C1F A;  1T5X D;  1MGS A;  1BCP F;  3VYR A;  1CM9 A;  2EXZ A;  2PYK A;  4HAE A;  1H9K A;  2D9U A;  2E75 C;  2IWH A;  4RCO A;  3OHX C;  1CHQ D;  3H91 A;  5IGC A;  3GD7 A;  1BXT A;  4IN3 A;  1OXX K;  2E74 C;  4XIG S;  1I4G A;  4PV1 C;  1TT2 A;  4KHZ A;  5IOD A;  1PFN A;  2DN8 A;  1CZW A;  4DAY A;  3HOU B;  1V1O A;  1VCI A;  4A3D B;  2PPB C;  3H09 A;  3VR2 A;  1BUV T;  2FMM A;  3GV6 A;  3NP8 A;  2VB2 X;  5IGG A;  4P2C B;  3ND8 A;  4ZKB B;  4IUN A;  4OO1 I;  4C3H G;  1EY8 A;  3HZX A;  3BDO A;  3KBG A;  1WCM B;  2N88 A;  4AYB B;  1ROD A;  2PZU A;  5IGB A;  3BDL A;  4HMI A;  1K8M A;  1B2T A;  5JEA H;  3J80 L;  1JWS D;  2MUY A;  4RAU C;  2EE1 A;  3I91 A;  1KDA A;  1G8Z D;  3M4Y A;  1K83 B;  3LWE A;  4HCE A;  3RLF A;  1LTT D;  5CGK A;  1VMC A;  1ESR A;  2WKC A;  2K01 A;  2MGS A;  2BDO A;  2JP1 A;  2XWJ B;  2L12 A;  3EJI A;  2FJ2 A;  1FNW A;  2B2U C;  5KYL A;  3PUV A;  2K7V A;  1PFB A;  1LO5 D;  2WAQ B;  1G2T A;  2OF1 A;  4XTC S;  1JOO A;  2K33 A;  5AFW A;  1YNN C;  2EJM A;  4RWS C;  3IKJ A;  4JBW A;  3K6O A;  5IIF A;  1LLR D;  2EVB A;  4DAV A;  5JPM C;  1QG7 A;  1ZYR D;  3CRL C;  3FEW X;  5I9O A;  4BBR B;  2GA4 B;  3J7A V;  5EBC A;  3HRZ C;  3DEP A;  4ZQ3 A;  2JSO A;  3H6M A;  3M7G A;  2B39 A;  5G3L F;  3N52 A;  2MPM A;  3Q0A A;  3GTQ B;  1NR2 A;  3FVQ A;  1LAB A;  1MSH A;  3MTS A;  1OXU A;  1FGB D;  4OL7 A;  4WOR A;  1F2Z A;  1MI2 A;  2RQX A;  2EYJ A;  3A55 A;  2A6E D;  3BYT B;  3MWY W;  5FLX L;  3MXU A;  2ENB A;  1M4V A;  3ERQ A;  1HA5 A;  4IUT A;  5J22 A;  4IFD H;  2OT2 A;  1G6Z A;  1MSG A;  3PUY A;  1CT1 D;  5BN4 A;  2ID0 A;  1EU4 A;  3BYY B;  2F0H A;  5EPL A;  3P75 A;  4O1N A;  3D4D A;  5I6W A;  4QCL A;  4KHV A;  3PUW A;  3OWF A;  3IAY A;  3BS1 A;  4NMZ A;  1HFN A;  2FMC A;  5DNF A;  1GHK A;  3QWN A;  4C3I G;  1LAC A;  4RCN A;  3RD4 A;  3Q23 A;  3HOX B;  2LKV A;  1AFP A;  1HUN A;  4KV6 A;  3ITP A;  5CYU A;  1S5D D;  4I65 A;  3NWS A;  1GOZ A;  1RHP A;  5M5W B;  2R3Z A;  3HKZ B;  2EPB A;  3ZYY X;  1LTR D;  3GO5 A;  3H0G B;  4RGM A;  2A6H C;  4BBS B;  1LT3 D;  3OIQ A;  4IUV A;  2F0M A;  3LX0 A;  3PIO 3;  4ZUJ A;  4DGZ A;  2NVT B;  4ID6 A;  1PYW D;  1TU2 B;  3OMG A;  4PMC A;  3CHB D;  5C4J B;  2IJ0 A;  3LWU A;  3RMH A;  1WD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...