1A6XA

Structure of the apo-biotin carboxyl carrier protein (apo-bccp87) of escherichia coli acetyl-coa carboxylase, nmr, 49 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
MEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the carboxy-terminal fragment of the apo-biotin carboxyl carrier subunit of Escherichia coli acetyl-CoA carboxylase.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Carrier protein
molecule keywords APO-BIOTIN CARBOXYL CARRIER PROTEIN OF ACETYL-COA CARBOXYLAS
total genus 7
structure length 87
sequence length 87
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1998-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a6xA00
1HQMC 4H0LC 1K8OA 2BE5C 2L5TA 3I73A 2KA7A 2A6HD 2E74C 4DNRB 1Z6HA 2A68C 1H9RA 5BN3A 3DXJC 2BDOA 3PUYA 2EJFC 2O5JC 1EWHA 3BDOA 3U9SA 1ZYRC 3VR3A 2EJGC 3FPPA 3ND9A 1QJOA 3PUZA 4IQZA 3CRKC 3GD7A 4HR7B 5JEAG 3T56B 1VF7A 1Y8NB 1SMYC 2NN6G 4H44C 2D5DA 1Z7TA 2K7VA 1O78A 1OXUA 2PPBC 2AWOA 1CFMA 2F1MA 4OO1H 1GHJA 1PMRA 2JEBI 3N6RA 4OO1G 1T5EA 2NN6I 3GQBA 3W3AA 4TKOB 3LWUA 1LABA 4PV1C 1G291 2DNCA 3QG1A 3OPOA 2A69D 1H9KA 3A8KE 1E2VA 3PV0A 1VDZA 1YNNC 2QF7A 3H94A 3I4LA 2IT1A 3M4YA 1IW7D 3ND8A 2CW0C 3CRLC 4I7ZC 2A6HC 2B8GA 3VR5A 3WDNA 4XTCS 1GJXA 4KKSA 1GHKA 5JEAH 1A6XA 1E2ZA 3OW7A 3TZUA 2V4DA 2NN6H 1GUSA 2K33A 3VR6A 1GUNA 3MXUA 1DD2A 4OGQC 4TQUS 1OXSC 5A35A 2D2CC 2PCFB 4H13C 1ONLA 4KMUC 4L8JA 3M7NA 3PUXA 3T51B 3VR4A 4KKUA 1H9JA 1YNJC 1CTMA 2DNEA 2EVBA 4BA2I 4G7OC 1H9MA 1IYVA 1VF5C 5C0XG 2R6GA 4IFDG 1O7LA 5K36G 1Q12A 3KLRA 3A7AB 1BDOA 1Y8PB 3L7ZC 5C0XH 1V8QA 1FR3A 4KHZA 2BA1A 2LMCB 3D4RA 2DN8A 1K8MA 3AB9A 1GUTA 3A8IE 5BN5A 4XIGS 3VA7A 4BA1I 4G7HC 4KI0A 1OXVA 3IFTA 1FYCA 2EJMA 5KNCA 1LACA 4KKTA 1GUGA 1Q90A 1Y69U 4DK0A 1I6VC 1GUOA 4LJZC 3QIAA 2KCCA 2K32A 3OOCA 2AUKA 3FMCA 4JBWA 1DCZA 4IFDH 1B9NA 1HPCA 1HCZA 2A6ED 3RLFA 3I72A 1OXXK 4RCNA 4GZYC 2B8FA 2A6EC 3MFYA 1ZKOA 1H9SA 4KN7C 4DK1A 4LK1C 3QJYA 3T53B 3M85A 4DNTB 1B9MA 2Q8IB 1VCIA 5K36H 2O5IC 3VR2A 1OXTA 3IKJA 1DXMA 1TU2B 2E75C 2PNRC 1Q1BA 2BE5D 3SE0A 2JEAI 1TKWB 2D62A 1CI3M 2EDGA 2AUJD 1H9SB 3BG3A 5KNDA 1E2WA 3D31A 3EQLC 3PUWA 3A8JE 5BN4A 1Y8OB 2E76C 2YYZA 1IW7C 3SDZA 2A68D 2JE6I 3HGBA 3LNNA 2JXMB 2BA0A 3NE5B 3PUVA 2A69C 4JK1C 1IYUA 1Q1EA 1V43A 3P20A 5KNBA 2ZT9C 4KN4C 4G7ZC 1HTPA 3A7LA
chains in the Genus database with same CATH superfamily
2HUGA 3D6WA 3PO2B 2JYOA 1KRSA 3P1HA 2KEEA 2K6AA 4JYAQ 1RTNA 2UXBL 4ZUJA 3KOJA 3MAQA 4MNOA 4A93H 5M3FG 4M1UB 4A3BG 1Q81C 1EOTA 3D8GA 3CRKC 1EY4A 3L9AX 1YVCA 1G91A 3CXCA 2K5HA 4O42A 2DUDA 2XN9C 4B08A 3JAMi 1DJRD 2CH4W 1XJVA 3KLWA 4YIJA 4LF8L 3M4YA 4A75A 4B3TQ 2B8GA 1JC7A 2HD3A 4DAPA 4JI1L 5HY6A 2CKZB 1R4QB 1B1ZA 1PVOA 4RG1A 3A55A 4PMCA 3HOVG 4KJOA 2KVMA 1I3QH 1NAPA 1VQMA 4RHRA 1H9JA 1SYDA 3I90A 1YHQA 1O80A 4G7OC 3S15H 1H9MA 3J7AV 4J6HA 4A3DG 4IJLA 3V05A 1D1IA 1VQHA 4K2LA 4TRDA 1A3TA 2Q2UA 1STYA 2Z0SA 4RGNA 2YTXA 1OXVA 2F0WA 2MO1A 3W5OA 2EJMA 4KY6A 5JEAJ 5C4XB 4AQYQ 5G3LF 1QNKA 3H3VI 1X32A 3OOCA 4A3EG 2HQLA 2F0LA 4A3IH 4A3GH 2VB3X 2L15A 1DOLA 1XPOA 2AHOB 3GDEA 3S1MB 1CKNA 5C3WA 3IKJA 1ICWA 2LKVA 1E0BA 2F0OA 3JAME 1JT8A 1N34Q 4LF5Q 3WOEA 3KK7A 4A3KB 1XYIA 4GLVB 2F52A 3BVMA 2Q8RE 3MXNA 5EJWA 1J8IA 3AQQA 1V43A 2EY2A 4A3CH 3EROA 2Y0SB 1SNMA 2B2VC 2F0PA 2L5TA 2EPBA 4MHEA 5FLXc 2F0UA 4XT1B 3K57A 2A6HD 3IAYA 4CJ0B 4F87A 2PMZE 4JCVE 3T1YQ 5T1GA 4HIKA 4QL5A 3CC4A 3T16A 5M3FH 2UXBQ 2DJFC 2D0OA 2KENA 1TY0A 2NN6G 2R7FA 3KFUA 1TT2A 1OXUA 1FGBD 5HURA 3KYHC 1F9QA 1PMRA 2JEBI 4YWMA 4A4IA 5CBAE 3G71A 3HOZB 3JC66 5IT9E 1V9PA 4CKCA 2A69D 3H3VC 3KLSX 3BZDB 3CRLC 4YCWA 2K04A 4GNXA 5I2YA 4A3LH 2NVYB 3UE1A 2V4DA 3T1HQ 1GUNA 1E3PA 1TWHB 1I3QB 4WFN3 4TQUS 5C0XJ 1AW7A 1SMXA 1PDQA 1KAAA 1RHPA 2PCFB 4H13C 5A35A 4DAMA 5DAUA 2HHHQ 4IPCA 5M9OA 3PUXA 2EYPA 4A3BB 5C4JH 4BBRH 1I94L 1XX8A 1AH9A 1SYCA 3FKIG 1XMQQ 1Q12A 1BDOA 2OTJA 1LT5D 3KDFA 2LMCB 3AB9A 1EIHA 4G7HC 4NP5A 4DXGA 3OIPA 4LF7Q 1Y1WH 2HIVA 4LWCA 1B7YB 2NVXB 3I70A 5IYCH 2B63H 2NBFA 5FO9B 2F0FA 2XSCA 4YCUA 4DUZQ 1IYJB 2ZTCA 3QR8A 1KNEA 2KQ3A 2A6ED 4MTNA 3I72A 1N8RC 1KABA 5LMNW 1W6KA 1KNAA 1VQ9A 2V1CC 4BBSB 3NWSA 1IHZA 3BJUA 4N9TA 4JG2A 4YHHL 3PO2H 2F03A 1FD7D 4LF9L 3TSSA 2JA7B 3TP5A 2JQOA 5KNDA 5IGBA 3H15A 2AMCB 1CA6A 4A93B 3DEPA 3RLOA 1BKBA 4NXNL 1SE4A 4TVAB 5EKIA 3A56A 2ZJPA 2MHVA 2MNAA 2BE5C 4K14A 3CQZH 3TMEA 4DV2L 2L55A 5EPLA 1I4XA 3NTIA 2O5JC 1PRTC 2R61A 3IRBA 4DV6L 1QJOA 3T56B 2FMMA 2E2IH 1XPRA 2OQ0A 4LW1A 2KHJA 1KDAA 1NBWA 3CCSA 1CKOA 1X6OA 4BY1B 1LTRD 1HQRD 2VQFQ 4XXEA 3VYUA 4P71A 2CW0C 2TSSA 1JORA 1PH1A 4DUZL 5BR8Q 4RFBA 4B3RQ 3K7AH 1XMOL 4HJ5A 5DM73 5FOBB 3JAMc 3ULLA 4FXDA 2O4XA 5KRUA 3KF6A 4BA2I 1U0LA 5C3EH 1ENCA 4PNYA 2ES2A 1FJGQ 3EVQA 3NWTA 1EL0A 4DR6L 2R6GA 1HNXL 2NZOA 5C0XH 4P2CB 1PYSB 4POFA 1S5FD 2FHTA 1K28A 4R4TA 2C5CA 2G9DA 4ME5A 3S16B 3NBIA 4C2MB 3K5OA 5C44H 2F0HA 1AFPA 3H91A 3J81E 1ENFA 2CFMA 4R8IA 4I65A 1XXGA 4UP7A 4LF6L 2B29A 3PIPA 3QOLA 5FJ8H 2F3IA 2JA6B 4KLKA 1K83B 1STGA 4B3ML 3GTOB 3KJOA 1OXXK 4A3FH 4A3IG 2B8FA 2K5NA 1KXLA 2HCIA 2N3SA 5I6YA 4PZ8A 2R7ZH 1PZKD 4L5TA 2DJGC 1N33Q 3MXGA 3S9WA 5I6WA 1LV9A 4RKBA 2JEAI 4DV0L 1OTCA 5BN4A 5CR3A 1S5DD 4C3HG 1PHJA 2CH4A 2A68D 4EGVA 2MUYA 1YZ6A 1EWCA 2K4KA 1MHWC 2PNHA 1EWIA 3HKZG 5IE8A 4NB3A 3OSOA 1HZCA 3W1BA 5M5XB 5IYDG 1YIJA 2FJ2A 1S72A 4C1NI 4CDCC 4GS3A 3OMCA 4KV6A 4OWTB 4PMBA 2P5ZX 3PUYA 1BF4A 4WRDA 1BCPB 2K28A 4C2MH 3U4ZA 3GV6A 2JA7H 5EKKA 4FXGC 1PTOF 5DLQE 4OO1H 1PYBA 1P16A 1G2SA 2QKIC 3GQBA 4BY1H 3LWUA 4QY7A 1RTOA 3F1ZA 3U9OA 3GTJH 4HCSA 3DLLA 3TS2A 2F0IA 1W2BA 4DR6Q 1B8AA 4IFDI 4KKSA 1XWEA 4KY7A 4IN3A 1PH8A 3HOWG 3S14H 2O2LD 3GTKB 3C2PA 1EOVA 4QIWB 1A2TA 5FLXL 1WTWA 2QDBA 2KJXA 1LO5D 3AYHB 3VR4A 1MBYA 4XQNA 1G6PA 3CQZB 3HOYB 4B3SL 1WCMH 2XRSD 1EQTA 3K80C 4FO2A 4EQ5A 2Z6KC 3SK4A 4JI6Q 2VQEQ 3WWVA 3ULPA 4APVA 1EIGA 4POGA 4K6LA 3ICEA 1JICA 4PQXA 1A3UA 1A0IA 5F2DA 4DK0A 5I4DA 2QEXA 2H5XA 4DR1L 5IP7H 5LMUL 5M3FB 3DHQA 3KF8A 1HA6A 2RDFA 1PH4A 3BYTB 1U4LA 1HRJA 4DNTB 1VCIA 3HOXB 1C9OA 1XPUA 4OEMB 4IO9A 3EQLC 4RAUC 3CHBD 2HQEA 1JE5A 3GTPB 1IW7C 1DOMA 1LTAD 3D4DA 2JE6I 2E2HH 3PO3B 2NB0A 3NE5B 5DNFA 3HOWB 2B2WC 5M5XH 3J7YW 1SAPA 3KJPA 3MEHA 2ZJRA 4UP9A 1WTOA 1Z47A 3K59A 1PFMA 4QGUA 2G9HD 4DNIA 4CDDC 2R93G 3OIQA 2E74C 2A68C 2RBMA 4HTHA 2ZTDA 3DXJC 2QEJC 4QUFA 1ZYRC 4E6IA 2JJQA 3HOUG 2OCEA 1KRTA 1SMYC 1FNWA 2D5DA 4A3JG 1Z7TA 2NVXH 4A3GB 3I56A 5E4WC 3E3XA 1VQDA 4LF6Q 3PSIA 4QCLA 1MSGA 1TVXA 1AE3A 2H1EA 2N49A 5CMDA 1JOKA 4BY1G 4J1MA 1VDZA 1NNXA 1HHVA 1LT3D 1YNND 1IW7D 3VR5A 2NTSA 1R9TH 4XTCS 2RCNA 3RD4A 5JJIA 5A2QL 2K50A 1KLUD 2QA4A 4EQNA 1GKHA 3PIO3 2LFNA 1SROA 4IUTA 1G6ZA 1IXRA 1BNZA 1JWMD 4L6TB 2UUAQ 2NVQB 1CTMA 1V1QA 5JPNC 5C0XG 1OO9B 3K5NA 3HOYG 3KLRA 1WCMG 4DN4M 5BR8L 2F0DA 1IBLQ 3Q23A 2Q2TA 3OWEB 3MTSA 1N32Q 2CWPA 2WAQE 3UDXA 1O7ZA 4WJ3M 1FYCA 5C44G 3RMHA 4HJ9A 2B2VA 3K0YA 4R9WA 4X3KA 2YU9H 2UXDQ 4JBKA 2WB1G 5IP7G 2B2UA 1JB7A 3GTJB 1HCZA 2NVTH 1D5XC 5IODA 3F2UA 3CMAA 3O13A 2WKDA 1STAA 2E75C 2PNRC 3L0OA 3KBXA 1CUKA 1I4GA 4B3TL 1IBML 3Q6SA 4JBMA 2JA8B 5EPJA 4DK6C 3SEBA 1IKMA 4HIDA 2IWHA 3ER0A 4GNXC 4FF3A 5E1FA 3A7LA 4GKJL 2UXCQ 1CHPD 4JI5L 1YHBA 1LM0A 3S1MH 4IALA 1Q8IA 3LGJA 1CK1A 2AQ1B 2RDGA 1H9RA 1QE6A 1EU4A 5BN3A 1EYCA 2LY7A 3CF5A 5CV5A 2I5LX 3AEVA 3L2PA 2EJGC 1EYAA 4HMIA 1IKLA 4KY5A 4RCOA 4AQYL 4A3JH 1HUMA 3HOVH 4L5QA 3R93A 1JWSD 1VMCA 2EXDA 1T5EA 4A3IB 1Y14B 4YCVA 3QG1A 1AZPA 4DV6Q 2YV5A 2HT1A 3M4OH 4ZK9B 1EY7A 1G8ZD 5C5MA 1V1PA 5KGUA 1A6XA 1JJCB 3I8ZA 1QOHA 4IZ8A 2FINB 1OXSC 3HOWH 3ERQA 4L63B 4RKLA 4KHPQ 1I4HA 1GXDC 3FRPB 2VL6A 4AYBG 5FK9C 4DV7Q 3TP6A 4JI2Q 3J7A5 4A3MH 2QILA 5C4JB 3C46A 5IGDA 4A3GG 1TIID 5M5YB 3I55A 4F88A 1Y1WB 3GTMH 4BY7H 3S1QH 3BDCA 5J22A 2JA5B 2AQ3B 1TS5A 3E9HA 1HZ9A 2IX0A 1X3PA 3C1FA 4JBJA 4HIMA 1QB5D 3CMEA 1U5KA 4X64L 1XTDA 2FFKB 2KCCA 3FKIH 5M3MB 4JBWA 2B63B 1B9NA 1A15A 1MI2A 5CV4A 1PTOB 1WJJA 4RCNA 3ZJYC 4DR3Q 3SVMA 1H9SA 4A3CG 1S40A 4V190 3H6MA 3UI2A 4FP5D 3X3NA 4GOPB 1WFQA 4B3SQ 3H0GB 3PCOB 1TKWB 1EQQA 4JI0Q 4DR4L 3DEOA 1YNJD 2B3GA 3MFGA 3NSWA 1Y1VH 1C4QA 3HOZH 2SNSA 3SDZA 1VQNA 2B2TA 4OL7A 1VS0A 1T5XD 4DV5Q 1WTRA 1FNUA 3LX0A 1HTPA 2HHHL 2VQFL 1KD1C 2E2IB 4ZUIA 5LMUQ 4QJFA 2UU9L 3FPUB 2I07B 1HTLD 2F0EA 4AH6A 3AMUA 4DV0Q 3RN2A 1UE6A 4CGYB 2I5MX 3H0GH 1SNPA 1SXTA 1IBLL 3NBHB 1QWYA 4DAYA 5IP9G 3VA5A 3E0EA 4K0KL 2OEOA 3ND9A 4JI3L 1LUZA 4IQZA 4KHVA 2UUCL 2F0MA 1EY9A 2R7DA 1HR0Q 3AU7A 3D4WA 4KJNA 1CFMA 1SMYD 3J80c 5FLMH 3I91A 3BS1A 1U4RA 5C3EB 4UY8C 3TP7A 3OPOA 4BBRG 3N52A 3A8KE 1A8VA 4LF9Q 2Z6BA 1ENAA 3M3YH 1PH7A 1BXTA 1WOCA 1BCPF 1TWGH 3TZUA 2K5WA 1KDBA 2K33A 2L11A 1LLRD 2OQKA 4ZKCB 5NUCA 1QG7A 1A63A 3STBD 2L9HA 3OYYA 1DONA 2K5VA 3J81j 5EPKA 5E7NA 2F0TA 5M5WH 3J7ZC 4YHHQ 1HNWQ 1WI5A 2K5QA 2WFWA 1EFWA 3SR1A 2MQHA 1X3FA 1SYBA 4XQQA 1A3VA 1FR3A 1IBKQ 2KEDA 1E1TA 4OIJA 4CJ2C 3GV3A 1BBXC 2R7ZB 2C9OA 4KI0A 4DA2A 3IFTA 4C3IB 4N8X1 3CCVA 2WB1B 4DUYL 5KYLA 4LMQD 4A3FB 5M5WB 1EUJA 3FMCA 4IFDH 2ZXOA 5A2QE 3RZOB 3K5LA 1BBUA 1IL2A 1A62A 4F7XA 3F2DA 4DV4L 1B3AA 3I4MH 1QUQB 4FF4A 3H3VH 2EE1A 2UXDL 3GTQH 1Q1BA 3SE0A 5IOCA 5COYA 1H9SB 4MZ9A 4CHTB 4FDBA 1Y1VB 3D31A 3PUWA 4JC0A 1Y8OB 1SNDA 1MD2D 2E76C 4ZCKA 3DWPA 4GOPA 2IHEA 1XMOQ 5CV6A 3LNNA 4N9PA 3WDNA 4A3FG 1IYUA 1VQ4A 2CWAA 1O7IA 1E22A 5I9PA 1PA6A 3MXPA 3S2DB 2ICEC 2L1BA 4RH6A 1STBA 4C56C 1WTPA 2PW7A 2GA4B 1GD7A 1EIYB 2AKWB 2XIWA 1XMQL 3GO5A 2ZXRA 3H0GG 2B2WA 1UNSA 2N78A 4RA8A 2ID0A 3GD7A 1JMCA 3U50C 2L4NA 2TMPA 4JI1Q 5GAGC 3K7UC 4HSVA 4G4KA 1QCBD 3ERSX 1J5EL 4Y7NB 3CCMA 1SJHD 1RJTA 1I4QA 1V1PB 4ZKBB 3JAML 3KDFB 3NELA 1VQBA 2G5DA 2CCZA 2AQ2B 1SR3A 2CQAA 1DGSA 2RHSB 2QF7A 1RL2A 5LL6S 1K0SA 4DR4Q 3VYRA 2L12A 3I7FA 2HIXA 4IOCA 2K05A 1GOZA 5E4XA 1JB3A 4X3UA 4L8JA 4P75A 1M8AA 1I94Q 5KIXA 1VQLA 3NUCA 5AFWA 4UAIA 3M4OB 2MGSA 1Y8PB 3L7ZC 1N32L 2BA1A 3S17H 2EXZA 4R8NA 4BA1I 1IBKL 3RLNA 2MPMA 1W6JA 2VB2X 1E7ZA 1LACA 4KKTA 1SFOB 1I6VC 1YBYA 1J5EQ 2ZM6Q 2I5HA 4N8FA 1EY5A 2M9VA 4Q5VA 2UUCQ 2QCPX 2AUKA 1K0RA 4GZYC 1MJEA 1EIFA 2GVBA 2A6EC 3S1QB 4Y52H 4DK1A 4OX9Q 4HJ8A 2XWBB 4LUOA 1BQQT 4K5WA 3G7LA 3KF8B 3A5ZB 1KHIA 4LFAL 3PIOA 3RZDH 5C4HA 1JOQA 1F2MA 1EZ6A 1HZBA 1YJWA 3E5SA 3PO3H 2RHQB 5C0XI 1Y1VG 2Q8TA 2NTTA 3HG9A 3TDQA 3S1NB 3TS0A 1B50A 4C3HH 4JK1C 2K01A 2DGYA 3NK9A 5JJKA 5D14A 2E2HB 4HMJA 1HQMC 3M4PA 2RSOA 5FKAC 3VDYA 1Q86C 4BBRB 4KK7A 1F2ZA 2I0QA 2EJFC 2YTYA 1EWHA 1L0YB 1TWFB 1D1KA 2CHBD 3HS0C 4GLXA 3DM3A 2JP1A 5GADC 2RQXA 2VUMH 4OO1G 1D5ZC 3DWQA 4K5VA 2WV6D 4ABNA 1XNRL 4JV5Q 4YY3L 2PW5A 5J39A 3H94A 5D3IB 5EBDA 3M7NA 5K36H 2X69A 3TN2A 2OXPA 1GHKA 1O7YA 2B2UC 5GAEC 1MJCA 4ZLTF 1TS4A 5C6AA 2SNMA 3CCRA 1ONLA 2F0VA 1L1OA 1TR5A 3S1NH 1T9HA 4O0AA 1JE4A 1YNJC 4P74A 4RWSC 2OTLA 1JOOA 1MGSA 1QVGA 1KL9A 1CT1D 1V8QA 1M4VA 2A74C 4A3LG 2NYZD 1VQOA 1K8GA 3A8IE 3VA7A 4JOIA 5CV7A 1GVPA 5LL6X 5CV8A 1U4PA 1MIUA 1GUGA 2EYJA 4K0KQ 3W1GA 1PTOD 4JI4L 4YWLA 1ET6A 4LJZC 1II3A 2WAQB 4J15A 4KD3A 3PF4A 4DR3L 1C0AA 1QUQA 4TSSA 1HFGA 1PRTB 1ICFB 5JVH3 3MVVA 3MFYA 2M2LA 4DKAC 2SEBD 4KN7C 5ELEA 1C7YA 4LK1C 3QJYA 3HOXH 5LMNL 1B9MA 3MEFA 4FNFA 1PZJD 3NQTA 5M5YH 2PMZB 1X3EA 2WAQG 2K5DA 2RDHA 3HOUB 2D9UA 2H4OA 1L0WA 4A3BH 3HOUH 2WB1E 2JXMB 1XNRQ 1YEZA 1K9MC 1R4PB 4KN4C 3HOVB 3S17B 3BDLA 1K8OA 4GN4B 1R9TB 3PO2G 3I73A 1HNWL 3CAMA 2ZJQA 1A2UA 1JJ2A 2QDLA 4DV7L 1AN8A 1TY2A 4H44C 2EY6A 2IL8A 4C3JB 3P7JA 1KDCA 2K75A 2SDFA 3ZYYX 1SSOA 1HR0L 2VUMG 1MSHA 4MN3A 2JA6H 4IUNA 1LABA 1ML0D 4RMFA 1HJPA 4JPBW 2IY5B 4GN3B 1K3RA 1E2VA 4A3EB 5CYUA 2WKCA 5LHY1 3HOYH 3MZ5A 2RVLA 3CCEA 2Q2HA 2ASBA 3ITPA 4B9XA 2NN6H 2LS01 2KHIA 4CBVA 1GUWA 1HFNA 4KMUC 1GO3E 3NXWA 1NTGA 2NZ1D 5ELCA 5ELBA 1B70B 1X3QA 1N33L 2RCFA 4A3EH 5D3DA 3A7AB 3J7AF 2K1BA 1F2LA 2WINB 3PIP3 3GTGB 1IBMQ 4DUYQ 1KAWA 4DK3C 1Q90A 5M3MH 4JW0A 1IL8A 1I50B 4F8MA 2XNAC 4ZRZA 3I4NB 1V1OA 3FHWA 3H09A 5I9OA 1I50H 4R4QA 2K14A 3GTGH 1Z9FA 5JOBA 2Q8IB 5ELOA 2O5IC 4IURA 3A74A 3PO3G 4EQOA 2D0PA 4HIOA 5G3LD 3CPFA 1BCPC 2F0NA 1L1OC 1ZEQX 3TQYA 4JI8L 4DR7Q 5EQ0A 2BA0A 5KYIA 3S2HH 4G7ZC 2ZT9C 2NUCA 4DGZA 4X62L 3J81i 1NR2A 4BWGB 4CKEA 2GN5A 4H7BA 2IX1A 2NVTB 4LF4L 1F2YA 4IPHA 3R8BA 3MA2B 3G6EA 5ELNA 2BDOA 1PFSA 2YU9B 1NR4A 1IZ6A 3EN2A 4H02A 1ESRA 1DZ1A 3I4OA 1STHA 3Q8DA 1ZYRD 2ENBA 5JEAG 3HKSA 4V0BA 3TBIB 4C3JH 2XVSA 1M1KC 3C1EA 4DAYB 3OMGA 2F4VL 2E5LQ 4HCEA 2JK8A 1UE7A 1AP0A 3CP0A 3I3CA 2IX3A 4BXXG 3I4NG 1YNNC 3EFXD 3T1HL 4XT3B 4KTAA 1EY0A 1TWHH 2X6GA 1SFOH 1SRUA 3VR6A 2K03A 1DD2A 4OWXB 1FL0A 4MIUA 3CPWA 3ONAB 3EIVA 2CW0D 4JI0L 4IUQA 4X62Q 4KKUA 2B63G 4YY3Q 3PF5A 4YWKA 5FJ8G 3L3OC 1RDPD 3AFPA 1SN8A 2EOTA 5ELFA 1Q3LA 3E9IA 4OXPA 5C44B 4X66Q 1LTGD 2F0QA 1SYFA 3HFZB 4IUUA 4XIGS 3B6YA 3J80L 4P72A 3S1RH 2NVYH 4X65Q 2XTIA 1WTHA 2PI2A 3A0JA 1U4MA 5C3EG 3U58A 1HNXQ 1VQGA 1NE3A 2F0KA 1VQPA 1ASZA 4ZYSA 3P75A 4NPSA 1CHQD 2IPKD 2UUAL 1NCVA 3RN5A 3V2TA 2A19A 2Z6KA 5IYDH 4WJWA 1I5FA 3D6CA 4PMWA 1NY4A 1N34L 4LF5L 1EY8A 1E24A 1OXTA 1DXMA 2EIFA 2A8VA 1STEA 1X54A 2B2YC 4R4CA 1L0XB 3AFQA 2N8NA 3A8JE 4QQBX 2KCTA 3D0FA 4A3MB 3HGBA 3GP7A 3F2BA 1PH5A 2BH2A 2A69C 2F3WA 4EVOA 1N36Q 2IJ0A 2VNUD 2VY3A 4DV2Q 4DV3L 5T1IA 2KA7A 1F9PA 4A3DB 4BBSH 1D6EC 4K6DA 3SHLA 3CKIB 1HR0W 4A3KH 1TS2A 1CKNB 3Q22A 4DR1Q 1X65A 2RKSA 5IGGA 3A54A 1RODA 4OHJA 4ULLA 4OIKA 4HR7B 1W3SA 1Y8NB 2NVQH 3F8TA 1CQFA 1K3BC 4NW2A 1PH3A 2VQEL 1GHJA 2DY7A 5FLMG 2NN6I 1B2TA 5FO8B 2DNCA 3IL8A 1S3OA 4GKJQ 1VQFA 5IY0A 3GTKH 1EEID 1G51A 5C4XH 1E2ZA 1X55A 1GUSA 3RR5A 2RSNA 5IWAL 2XWJB 3K81C 3UDIA 4C3HB 5AJ3L 4L5RC 1TXYA 1WTXA 4JI2L 1AEXA 3STBC 4DV3Q 2EVBA 3NHHA 1VF5C 4FXKC 4IJHA 4IFDG 1BUVT 4KD4A 4IPGA 1VQIA 1H95A 4GKKL 3GTQB 1HZAA 3D4RA 2DN8A 1K8MA 2HDMA 5BN5A 3MC0B 3I4MG 4OX9L 2IHFA 1Q8KA 3M3YB 3FVQA 2EY1A 2KOLA 5M3MG 1X3GA 3DM1A 4GLAC 1Y69U 3J81c 2A73B 1K83H 3X3MA 1AE2A 2E5LL 3BU2A 3UE0A 1KC8C 4A76A 3HEJA 2ZM6L 5JJLA 1HPCA 1TWCH 4JOIC 2BCOA 4NXML 2DY8A 1UE1A 3R2TA 3T4AC 4DR2Q 1CZGA 1PFNA 4RHSA 2YTVA 3BYYB 1HA5A 4C3IG 1N36L 1SNCA 1SE2A 1SNQA 4X6AH 3CC7A 2HCCA 5IWAQ 4EX5A 2D62A 4HN7A 4JI6L 1CI3M 2EDGA 3J80E 4A93G 4NXNQ 1TWAH 2ALYB 1VQ5A 1PV4A 3S1RB 2YYZA 3D3RA 3T13A 2KHSA 2JA7G 1KLGD 4DV4Q 2UU9Q 1UAPA 2KCMA 2EYLA 2EYFA 4H0LC 4HAEA 3TEHB 4DV5L 3GTOH 1SYGA 3CC2A 1WCMB 4K2KA 4B3MQ 1TWFH 3PQIA 4WJ4A 1UEBA 1SNOA 2VXWA 4XQJA 1BOSA 4ZQ3A 1TWAB 1UUPA 2GVAA 4QB4A 2RA4A 3W2DA 1VF7A 2UUBL 2Y0SE 1QVFA 2VUMB 2Z9HA 1SJED 4O2DA 2Z4IA 1VQCA 4Y7NH 2AWOA 4B3RL 2R93H 3N6RA 3DUZA 3W3AA 4KHPL 4LFCQ 4PV1C 1G2TA 3I4NH 4HJAA 5IIFA 1CQVA 3K8AA 3ND8A 2IT1A 4BXXH 4LFBL 4DXFA 1EQVA 2RF4A 1GJXA 3OW7A 3NTHA 5L37A 4I7AA 1UWVA 4OGQC 4ME3A 5GROA 1TQOA 4R1JA 1I4PA 4NXMQ 1QNUA 5CBEE 3CD6A 2JA8G 5TSSA 3S2DH 3GTPH 4RGTA 4JI7L 2E8GA 4RGOS 4ILWA 2QGQA 3DMUA 2EYOA 2ZTEA 5I2XA 2KUMA 5HGTA 5K36G 4OELB 1NMGA 3QWNA 2WACA 2E2JH 1AZQA 4C1NK 4LF4Q 3A5UA 2K52A 1S4ZA 1B3QA 3FDTA 4ZAIA 5IYCG 1RD9D 1CM9A 1PZID 4J8QA 1B44D 4NMZA 2K32A 4A3MG 5KEEA 4IPDA 1DCZA 1JCKB 3CU7A 1EY6A 3NQIA 3KF6B 1WYDA 3K5MA 3Q0AA 2F0JA 1U9RA 2LSSA 1PXUA 3SXHA 3VYTA 3TRZA 1RKNA 1MKHA 1Q82C 1VQ7A 4C3IH 4LNQA 5DEHA 5IGFA 1ESFA 4DFAA 2EYMA 1QZGA 1BCPD 4NKLA 1EEFD 2LXKA 1Q7YC 4IUVA 3BG3A 1RCVD 1N9WA 2BDNA 4IUPA 4L5SA 1YNXA 1FJGL 1Q46A 4NDXA 4XDXA 5IYBG 1PLFA 5KNBA 2KBNA 4AYBB 4DAVA 4ID6A 3NEMA 4JYAL 1TWCB 1YITA 3UDGA 2VZAA 4BBSG 3E0JA 1J6QA 3K6OA 1Z6HA 3EA6A 1NJIC 4K8IA 4LUZA 1D5MC 4LFCL 1C48A 4IFDJ 4OO1I 3U9SA 4M8AA 4HSPA 1BBWA 2JSOA 4GN5A 2R92H 1KIXA 2L0CA 1QVCA 4AYBE 1O78A 1JJGA 3K58A 1I6HB 5C4ZA 5GAHC 4QMGA 2OF1A 2VS1A 1G291 3VYSA 5ELDA 1F9RA 1B53A 4UDUC 2ICIA 2MO0A 3I4LA 2MJ8A 4I7ZC 3TP8A 4JVZA 3OTOQ 5EBCA 3NPPA 4HJ7A 2J7ZA 2KECA 3NP8A 5C4XG 5HGQA 1EU3A 1PRTD 3J81L 1LT6D 2Y0SG 4MTKA 3K7AB 4X3TA 3S2HB 1X56A 2A5HA 1LTBD 4UP8A 4AIMA 5FO7B 2JA8H 4DR5L 2J4XA 1ILQA 1YJ9A 1CA5A 4G57A 1ET9A 4JI7Q 1O7LA 3S24A 1YHAA 2WIIB 1EYDA 3KLSA 4QUCA 1NMFA 1GM5A 1GUTA 4LUVA 5J1ZA 4K8JA 3RNUA 2HDLA 3F2CA 2MFIA 4O1NA 4PZ7A 3QIAA 3LWEA 3MHBA 5E3FA 4GKKQ 3M4QA 4PZ6A 2XRQD 1WVLA 1S5ED 3RLFA 4X66L 4OONA 4S3SA 3BVZA 5GQOA 3SK8A 2PI2E 1LTID 1LTLA 3T53B 1SLJA 3HRZC 1J9OA 3HOXG 4R4OA 4DU9A 2PQAA 2EY5A 2R92B 2BE5D 5IT9L 2Z8LA 1HXYD 1VQ8A 2AUJD 5JAVA 3URYA 2R3ZA 3Q24A 4DR5Q 1QZHA 4XYQA 4LF7L 1DYQA 3EJIA 3HP3A 1PH6A 2PZWA 2Q2IA 3K0XA 3QO2A 1Q1EA 3OWFA 5LMNQ 2ZXPA 2R7ZG 3J80i 4LFAQ 4WORA 5IGCA 4HEDA 4PG3A 1BR9A 2PYKA 2SOBA 4CJ1B 3BDOA 3VR3A 1VMPA 4IOAA 3CCUA 1L2FA 3I4MB 1DM0B 3PUZA 3CW2C 3T1YL 5ISRA 1L1OB 1PRTF 3OTOL 3WOFA 4A3JB 5DM63 4CKBA 1WD1A 2F0GA 2K7VA 4B9WA 2B2TC 5C5LA 3SK5A 1CKMA 1VQEA 1B4OA 2XGTA 4FVMA 4UPAA 1CSPA 2JA6G 2IW3A 2OWOA 5JJZA 3RUZA 1H9KA 2WP8J 1S5CD 1PTOC 2FMCA 5JEAH 4BY7G 4U673 4C3JG 4JI8Q 4DR7L 2MP1A 4U68A 3MXUA 4EQPA 3FP9A 1BVSA 1C8CA 4FF1A 1SEBD 1YI2A 3OHXC 2NWGA 1PTOH 1PFBA 1FGUA 3SGIA 3T51B 5AJ3Q 3TZDA 3IFDA 3G4SA 2M00A 4A3DH 1K8AC 5CORA 1HNZQ 1XNQL 3M9BA 4KHZA 1HNZL 2JA5H 4QIWE 1JWUD 3TREA 2B39A 5IGEA 4JV5L 3DWAA 1WD0A 1EZ8A 3NENA 5JPMC 3FEWX 5KNCA 2CQOA 3HKZB 1WTQA 3BVGA 4P73A 1NUCA 1WTVA 3FKIB 1YJNA 2BOSA 2PO4A 3BZKA 4X65L 1QILA 3E6ZX 3ULJA 3HOZG 1FVIA 3UDFA 1PH9A 3OW2A 1VQKA 3M85A 2F4IA 1LT4D 3S16H 3CCQA 2J0TD 1LYLA 1PYWD 1ILPA 5IT9c 3KBGA 4DR2L 1TU2B 3BZCA 1P8LA 4JI4Q 1LTTD 1KQSA 1KTKA 1SBBB 4Q0FA 3PGZA 5JVG3 3M7GA 5CC4A 5IP9H 1F9SA 1PH2A 5IYBH 4DV1Q 1S5BD 3P20A 2B2YA 3NBHA 4CDEC 2ATWA 3MWYW 2F0SA 2QW7A 3U4VA 2UXCL 4OWWB 4DNRB 5FLXE 1M90C 4JI3Q 4CDFC 4RGMA 1HUNA 3QB3A 1VQAA 4LAAA 2F3VA 3HZXA 2LXJA 3FPPA 4QF4A 5CV9A 1D2BA 2EQSA 3RZDB 2E2DC 3S14B 1LTSD 2R92G 4GOPC 2PPBC 2F1MA 1SDFA 1JQYD 1ASYA 5CGKA 3KUPA 1FNVA 3QOJA 4TKOB 2E2JB 2PZTA 1EQRA 1HH2P 3PV0A 4Z9CB 3G6JB 2A6HC 2EZVA 4LFBQ 3GTMB 4BY7B 2KCNA 1CZWA 5K5PA 4UHVA 2CVRA 2JN4A 5D65A 2D2CC 1E1OA 1I6HH 1XTCD 1UE5A 4GNXB 1F77A 4JI5Q 1VQJA 3NTKA 2PZUA 1CSQA 4FYDA 2DNEA 1EYGA 4X3SA 1IYVA 4X64Q 3CCJA 4ALPA 1I4RA 2BH8A 2OT2A 1JR0D 1ZXTA 4R4IA 3GTLB 2JA5G 3C3LA 1DOKA 1TS3A 1D8LA 1STNA 5EKLA 3HKZE 1SYEA 4DV1L 1Y1WG 1TWGB 2N88A 1EFID 3V96A 4XYOA 4DPGA 1GUOA 1RIPA 2C35B 1K73C 2R93B 2A1AA 3RZOH 1VQ6A 2PQEA 1NSNS 4FF2A 2PQAB 1D7QA 4DF7A 3PMFA 3SK6A 2F4VQ 1ZKOA 2AWNA 3GTLH 1RF2D 2JA9A 5EGTA 3R3OA 3I2ZA 5C3XA 4K5XA 3VR2A 2EYHA 3MXNB 3CCLA 5EAYA 3EBEA 5H1SE 1SE3A 4LF8Q 4BS9A 1X9NA 2NZHA 1E2WA 2X6LA 4A3KG 2N55A 2Z1CA 3R2IA 5J3BA 3G48A 1BO0A 1SE8A 2VW9A 2I46A 2Z4HA 3S15B 3PUVA 1UEAB 1XNQQ 2UUBQ 2FXQA 4ODGA
chains in the Genus database with same CATH topology
2HUGA 3D6WA 3PO2B 2JYOA 3P1HA 2KEEA 2K6AA 1RTNA 4ZUJA 3MAQA 4M1UB 1EOTA 3D8GA 3CRKC 1EY4A 3L9AX 1G91A 4O42A 2XN9C 4B08A 1DJRD 4YIJA 3M4YA 2B8GA 1JC7A 4DAPA 1R4QB 1B1ZA 3A55A 4PMCA 4KJOA 2KVMA 1NAPA 4RHRA 1H9JA 1SYDA 3I90A 1O80A 4G7OC 1H9MA 3J7AV 4J6HA 3V05A 1D1IA 4K2LA 4TRDA 1A3TA 1STYA 4RGNA 1OXVA 2F0WA 2EJMA 4KY6A 5JEAJ 5C4XB 5G3LF 1QNKA 1X32A 3OOCA 2F0LA 2VB3X 1DOLA 3S1MB 5C3WA 3IKJA 1ICWA 2LKVA 1E0BA 2F0OA 3JAME 3WOEA 3KK7A 4A3KB 1XYIA 3BVMA 2Q8RE 3MXNA 5EJWA 1J8IA 1V43A 2EY2A 3EROA 2Y0SB 1SNMA 2B2VC 2F0PA 2L5TA 2EPBA 4MHEA 2F0UA 4XT1B 3K57A 2A6HD 3IAYA 4CJ0B 4F87A 5T1GA 3T16A 1TY0A 2NN6G 1TT2A 1OXUA 1FGBD 5HURA 1F9QA 1PMRA 2JEBI 5CBAE 3HOZB 5IT9E 4CKCA 2A69D 3H3VC 3KLSX 3BZDB 3CRLC 2K04A 5I2YA 2NVYB 2V4DA 1GUNA 1TWHB 1I3QB 4WFN3 4TQUS 5C0XJ 1AW7A 5A35A 1PDQA 1KAAA 1RHPA 2PCFB 4H13C 5DAUA 5M9OA 3PUXA 2EYPA 4A3BB 1XX8A 1SYCA 1Q12A 1BDOA 1LT5D 2LMCB 3AB9A 1EIHA 4G7HC 4NP5A 4DXGA 3OIPA 2NVXB 3I70A 2NBFA 5FO9B 2F0FA 2XSCA 1KNEA 2KQ3A 2A6ED 3I72A 1KABA 1W6KA 1KNAA 4BBSB 3NWSA 1IHZA 4N9TA 2F03A 1FD7D 3TSSA 2JA7B 3TP5A 5KNDA 5IGBA 1CA6A 4A93B 3DEPA 1SE4A 5EKIA 3A56A 2MHVA 2BE5C 4K14A 3TMEA 2L55A 5EPLA 1I4XA 3NTIA 2O5JC 1PRTC 2R61A 1QJOA 3T56B 2FMMA 1KDAA 4BY1B 1LTRD 1HQRD 4XXEA 3VYUA 2CW0C 2TSSA 1JORA 4RFBA 5DM73 5FOBB 4FXDA 2O4XA 5KRUA 4BA2I 1ENCA 4PNYA 3EVQA 3NWTA 1EL0A 2R6GA 5C0XH 4P2CB 1S5FD 2FHTA 2C5CA 2G9DA 4ME5A 3S16B 3NBIA 4C2MB 3K5OA 2F0HA 1AFPA 3H91A 3J81E 1ENFA 4R8IA 4I65A 1XXGA 3QOLA 2JA6B 1K83B 1STGA 3GTOB 1OXXK 2B8FA 2HCIA 5I6YA 1PZKD 3MXGA 3S9WA 5I6WA 1LV9A 4RKBA 2JEAI 5BN4A 5CR3A 1S5DD 4C3HG 2A68D 4EGVA 2MUYA 1EWCA 3OSOA 5M5XB 2FJ2A 4C1NI 3OMCA 4KV6A 4PMBA 1BF4A 3PUYA 4WRDA 1BCPB 2K28A 3GV6A 5EKKA 4FXGC 1PTOF 4OO1H 2QKIC 1G2SA 3GQBA 3LWUA 1RTOA 3U9OA 4HCSA 2F0IA 4IFDI 4KKSA 1XWEA 4KY7A 4IN3A 2O2LD 3GTKB 3C2PA 4QIWB 1A2TA 5FLXL 1WTWA 2QDBA 2KJXA 1LO5D 3VR4A 1MBYA 4XQNA 3CQZB 3HOYB 2XRSD 1EQTA 4FO2A 3SK4A 1EIGA 4K6LA 1JICA 4PQXA 1A3UA 5F2DA 4DK0A 5I4DA 5M3FB 3DHQA 3KF8A 1HA6A 2RDFA 3BYTB 1U4LA 1HRJA 4DNTB 1VCIA 3HOXB 3EQLC 4RAUC 3CHBD 2HQEA 3GTPB 1IW7C 1DOMA 1LTAD 3D4DA 2JE6I 3PO3B 2NB0A 3NE5B 5DNFA 3HOWB 2B2WC 3J7YW 1SAPA 3MEHA 1WTOA 1Z47A 3K59A 1PFMA 2G9HD 3OIQA 2E74C 2A68C 2RBMA 4HTHA 3DXJC 2QEJC 4QUFA 1ZYRC 4E6IA 1SMYC 1FNWA 2D5DA 1Z7TA 4A3GB 5E4WC 4QCLA 1MSGA 1TVXA 2H1EA 5CMDA 1JOKA 4J1MA 1VDZA 1HHVA 1LT3D 1YNND 1IW7D 3VR5A 2NTSA 4XTCS 3RD4A 5A2QL 1KLUD 4EQNA 3PIO3 2LFNA 4IUTA 1G6ZA 1BNZA 1JWMD 4L6TB 2NVQB 1CTMA 5JPNC 5C0XG 1OO9B 3K5NA 3KLRA 4DN4M 2F0DA 3Q23A 3OWEB 3MTSA 1O7ZA 1FYCA 3RMHA 2B2VA 3K0YA 4R9WA 4X3KA 2B2UA 3GTJB 1HCZA 1D5XC 5IODA 3F2UA 3O13A 2WKDA 1STAA 2E75C 2PNRC 3KBXA 1I4GA 3Q6SA 2JA8B 5EPJA 3SEBA 1IKMA 2IWHA 4FF3A 5E1FA 3A7LA 1CHPD 4IALA 1Q8IA 1CK1A 2AQ1B 2RDGA 1H9RA 1QE6A 1EU4A 5BN3A 1EYCA 2LY7A 5CV5A 2EJGC 1EYAA 4HMIA 1IKLA 4KY5A 4RCOA 1HUMA 3R93A 1JWSD 1VMCA 1T5EA 4A3IB 3QG1A 1AZPA 4ZK9B 1EY7A 1G8ZD 5C5MA 1V1PA 5KGUA 1A6XA 3I8ZA 1QOHA 4IZ8A 2FINB 1OXSC 3ERQA 4L63B 4RKLA 1I4HA 1GXDC 3FRPB 5FK9C 3TP6A 2QILA 5C4JB 3C46A 5IGDA 1TIID 5M5YB 4F88A 1Y1WB 3BDCA 5J22A 2JA5B 2AQ3B 1TS5A 2IX0A 1X3PA 3C1FA 1QB5D 2FFKB 2KCCA 5M3MB 4JBWA 2B63B 1B9NA 1A15A 1MI2A 5CV4A 1PTOB 4RCNA 3SVMA 1H9SA 4V190 3H6MA 3UI2A 4FP5D 3X3NA 3H0GB 1TKWB 3DEOA 1YNJD 3MFGA 3NSWA 1C4QA 2SNSA 3SDZA 2B2TA 4OL7A 1T5XD 1WTRA 1FNUA 3LX0A 1HTPA 2E2IB 4ZUIA 3FPUB 2I07B 1HTLD 2F0EA 3AMUA 4CGYB 1SNPA 1SXTA 1QWYA 4DAYA 3VA5A 2OEOA 3ND9A 4IQZA 4KHVA 2F0MA 1EY9A 3AU7A 3D4WA 4KJNA 1CFMA 1SMYD 3I91A 3BS1A 1U4RA 5C3EB 3TP7A 3OPOA 3N52A 3A8KE 1ENAA 1BXTA 1BCPF 3TZUA 2K5WA 1KDBA 2K33A 2L11A 1LLRD 4ZKCB 5NUCA 1QG7A 2L9HA 1DONA 5EPKA 2F0TA 2K5QA 3SR1A 1SYBA 4XQQA 1A3VA 1FR3A 2KEDA 4OIJA 4CJ2C 3GV3A 1BBXC 2R7ZB 2C9OA 4KI0A 4DA2A 3IFTA 4C3IB 2WB1B 5KYLA 4LMQD 4A3FB 5M5WB 3FMCA 4IFDH 2ZXOA 5A2QE 3RZOB 3K5LA 4F7XA 1B3AA 4FF4A 2EE1A 1Q1BA 3SE0A 5IOCA 5COYA 1H9SB 4CHTB 1Y1VB 3D31A 3PUWA 1Y8OB 1SNDA 1MD2D 2E76C 3DWPA 5CV6A 3LNNA 4N9PA 3WDNA 1IYUA 3S2DB 5I9PA 3MXPA 2ICEC 2L1BA 4RH6A 1STBA 4C56C 1WTPA 2PW7A 2GA4B 2XIWA 3GO5A 2ZXRA 2B2WA 1UNSA 4RA8A 2ID0A 3GD7A 2L4NA 2TMPA 4HSVA 4G4KA 1QCBD 4Y7NB 1SJHD 1RJTA 1I4QA 1V1PB 4ZKBB 3JAML 2AQ2B 2CQAA 2QF7A 5LL6S 3VYRA 2L12A 2K05A 1GOZA 5E4XA 1JB3A 4X3UA 4L8JA 1M8AA 5KIXA 3NUCA 5AFWA 4UAIA 3M4OB 2MGSA 1Y8PB 3L7ZC 2BA1A 2EXZA 4R8NA 4BA1I 2MPMA 1W6JA 2VB2X 1LACA 4KKTA 1SFOB 1I6VC 1EY5A 2M9VA 4Q5VA 2QCPX 2AUKA 4GZYC 2A6EC 3S1QB 4DK1A 2XWBB 1BQQT 4K5WA 3G7LA 5C4HA 1JOQA 1F2MA 1EZ6A 3E5SA 5C0XI 2Q8TA 2NTTA 3HG9A 3TDQA 3S1NB 1B50A 4JK1C 2K01A 3NK9A 5D14A 2E2HB 4HMJA 1HQMC 2RSOA 5FKAC 4BBRB 4KK7A 1F2ZA 2EJFC 1EWHA 1L0YB 1TWFB 1D1KA 2CHBD 3HS0C 2JP1A 2RQXA 4OO1G 1D5ZC 3DWQA 4K5VA 2WV6D 4ABNA 2PW5A 5J39A 3H94A 5D3IB 5EBDA 3M7NA 5K36H 2X69A 3TN2A 2OXPA 1GHKA 1O7YA 2B2UC 4ZLTF 1TS4A 5C6AA 2SNMA 1ONLA 2F0VA 1TR5A 1JE4A 1YNJC 4RWSC 1JOOA 1MGSA 1CT1D 1V8QA 1M4VA 2A74C 2NYZD 3A8IE 3VA7A 5CV7A 5LL6X 5CV8A 1U4PA 1GUGA 2EYJA 1PTOD 1ET6A 4LJZC 1II3A 2WAQB 4KD3A 4TSSA 1HFGA 1PRTB 5JVH3 3MVVA 3MFYA 2M2LA 2SEBD 4KN7C 5ELEA 4LK1C 3QJYA 1B9MA 4FNFA 1PZJD 3NQTA 2PMZB 2K5DA 2RDHA 3HOUB 2D9UA 2H4OA 2JXMB 1R4PB 4KN4C 3HOVB 3S17B 3BDLA 1K8OA 1R9TB 3I73A 1A2UA 1AN8A 1TY2A 4H44C 2EY6A 2IL8A 4C3JB 3P7JA 1KDCA 2SDFA 3ZYYX 1SSOA 1MSHA 4MN3A 4IUNA 1LABA 1ML0D 4A3EB 1E2VA 5CYUA 2WKCA 5LHY1 3MZ5A 2RVLA 3ITPA 4B9XA 2NN6H 2LS01 4CBVA 1GUWA 1HFNA 4KMUC 3NXWA 2NZ1D 5ELCA 5ELBA 1X3QA 5D3DA 3A7AB 3J7AF 2K1BA 1F2LA 2WINB 3PIP3 3GTGB 1Q90A 1IL8A 1I50B 4F8MA 2XNAC 4ZRZA 3I4NB 1V1OA 3H09A 5I9OA 5JOBA 2Q8IB 2O5IC 4IURA 4EQOA 5G3LD 1BCPC 2F0NA 1ZEQX 5EQ0A 5KYIA 2BA0A 4G7ZC 2ZT9C 2NUCA 4DGZA 1NR2A 4BWGB 4CKEA 4H7BA 2IX1A 2NVTB 1F2YA 3R8BA 3MA2B 2BDOA 2YU9B 1NR4A 1ESRA 1DZ1A 1STHA 1ZYRD 2ENBA 5JEAG 4V0BA 3TBIB 2XVSA 3C1EA 3OMGA 4HCEA 1AP0A 3I3CA 2IX3A 1YNNC 3EFXD 4XT3B 4KTAA 1EY0A 2X6GA 3VR6A 2K03A 1DD2A 4MIUA 3ONAB 2CW0D 4IUQA 4KKUA 3L3OC 1RDPD 2EOTA 5ELFA 1Q3LA 5C44B 1LTGD 2F0QA 1SYFA 4IUUA 4XIGS 3J80L 1U4MA 2F0KA 4ZYSA 3P75A 1CHQD 2IPKD 1NCVA 3V2TA 4WJWA 3D6CA 4PMWA 1EY8A 1OXTA 1DXMA 1STEA 2B2YC 1L0XB 3A8JE 4A3MB 3HGBA 3GP7A 2A69C 2F3WA 4EVOA 2IJ0A 2VNUD 5T1IA 2KA7A 1F9PA 4A3DB 1D6EC 4K6DA 3SHLA 3CKIB 1TS2A 3Q22A 2RKSA 5IGGA 3A54A 1RODA 4OHJA 4ULLA 4OIKA 4HR7B 1Y8NB 1CQFA 4NW2A 1GHJA 2DY7A 2NN6I 1B2TA 5FO8B 2DNCA 3IL8A 1EEID 1E2ZA 1GUSA 2RSNA 2XWJB 4C3HB 1WTXA 1AEXA 2EVBA 3NHHA 1VF5C 4FXKC 4IFDG 1BUVT 4KD4A 3GTQB 3D4RA 2DN8A 1K8MA 2HDMA 5BN5A 3MC0B 3M3YB 3FVQA 2EY1A 2KOLA 3DM1A 1Y69U 2A73B 3X3MA 3HEJA 1HPCA 2BCOA 2DY8A 3R2TA 3T4AC 1CZGA 1PFNA 4RHSA 4C3IG 3BYYB 1HA5A 1SNCA 1SE2A 1SNQA 2HCCA 2D62A 4HN7A 1CI3M 2EDGA 3J80E 3S1RB 2YYZA 3D3RA 3T13A 2KHSA 1KLGD 1UAPA 2EYLA 2EYFA 4H0LC 4HAEA 1SYGA 1WCMB 4K2KA 1SNOA 2VXWA 4XQJA 1BOSA 4ZQ3A 1TWAB 1UUPA 4QB4A 2RA4A 3W2DA 1VF7A 2VUMB 1SJED 2Z4IA 2AWOA 3N6RA 3DUZA 3W3AA 4PV1C 1G2TA 5IIFA 1CQVA 3ND8A 2IT1A 4DXFA 1EQVA 1GJXA 3OW7A 3NTHA 4OGQC 1TQOA 1I4PA 1QNUA 5CBEE 5TSSA 4RGTA 4RGOS 4ILWA 3DMUA 5I2XA 2EYOA 2KUMA 5HGTA 5K36G 3QWNA 2WACA 1AZQA 4C1NK 1S4ZA 3FDTA 4ZAIA 1RD9D 1CM9A 1PZID 4J8QA 1B44D 4NMZA 2K32A 5KEEA 1DCZA 1JCKB 3CU7A 1EY6A 3NQIA 3K5MA 3Q0AA 2F0JA 1U9RA 3VYTA 1PXUA 3SXHA 1RKNA 5DEHA 5IGFA 1ESFA 4DFAA 2EYMA 1BCPD 4NKLA 1EEFD 4IUVA 3BG3A 1RCVD 2BDNA 4IUPA 4NDXA 4XDXA 1PLFA 5KNBA 4AYBB 4DAVA 4ID6A 1TWCB 3E0JA 3K6OA 1Z6HA 3EA6A 4K8IA 1D5MC 1C48A 4IFDJ 4OO1I 3U9SA 4M8AA 4HSPA 2JSOA 2L0CA 1O78A 3K58A 1I6HB 5C4ZA 4QMGA 2OF1A 1G291 3VYSA 5ELDA 1F9RA 1B53A 4UDUC 2ICIA 3I4LA 2MJ8A 4I7ZC 3TP8A 5EBCA 3NPPA 2J7ZA 2KECA 3NP8A 1EU3A 1PRTD 3J81L 1LT6D 4X3TA 3K7AB 3S2HB 2A5HA 1LTBD 5FO7B 2J4XA 1ILQA 1CA5A 4G57A 1ET9A 1O7LA 2WIIB 1EYDA 3KLSA 4QUCA 1GUTA 5J1ZA 4K8JA 2HDLA 4O1NA 3QIAA 3LWEA 3MHBA 5E3FA 2XRQD 1WVLA 1S5ED 3RLFA 4S3SA 3BVZA 3SK8A 1LTID 3T53B 3HRZC 1J9OA 4DU9A 2EY5A 2R92B 2BE5D 5IT9L 2Z8LA 1HXYD 2AUJD 5JAVA 3URYA 2R3ZA 3Q24A 4XYQA 1DYQA 3EJIA 3HP3A 2PZWA 3QO2A 1Q1EA 3OWFA 2ZXPA 4WORA 5IGCA 4HEDA 1BR9A 2PYKA 2SOBA 4CJ1B 3BDOA 3VR3A 1VMPA 3I4MB 1DM0B 3PUZA 5ISRA 1PRTF 4A3JB 3WOFA 5DM63 4CKBA 1WD1A 2F0GA 2K7VA 4B9WA 2B2TC 5C5LA 3SK5A 1B4OA 4FVMA 2IW3A 5JJZA 3RUZA 1H9KA 2WP8J 1S5CD 1PTOC 2FMCA 5JEAH 4U673 4C3JG 2MP1A 4U68A 3MXUA 4EQPA 1C8CA 4FF1A 1SEBD 3OHXC 2NWGA 1PFBA 1PTOH 3T51B 3TZDA 3IFDA 2M00A 5CORA 4KHZA 1JWUD 2B39A 5IGEA 3DWAA 1WD0A 1EZ8A 5JPMC 3FEWX 5KNCA 3HKZB 1WTQA 3BVGA 1NUCA 1WTVA 3FKIB 2BOSA 2PO4A 1QILA 3E6ZX 3M85A 2F4IA 1LT4D 2J0TD 1PYWD 1ILPA 3KBGA 1TU2B 1LTTD 1KTKA 1SBBB 4Q0FA 5JVG3 3M7GA 5CC4A 1F9SA 1S5BD 3P20A 2B2YA 3NBHA 3MWYW 2F0SA 4DNRB 5FLXE 4RGMA 1HUNA 3QB3A 4LAAA 2F3VA 3HZXA 3FPPA 4QF4A 5CV9A 1D2BA 3RZDB 2E2DC 3S14B 1LTSD 2PPBC 2F1MA 1SDFA 1JQYD 5CGKA 3KUPA 1FNVA 3QOJA 4TKOB 2E2JB 2PZTA 3PV0A 4Z9CB 3G6JB 2A6HC 2EZVA 3GTMB 4BY7B 2KCNA 1CZWA 5K5PA 2CVRA 5D65A 2D2CC 1XTCD 1F77A 3NTKA 2PZUA 4FYDA 2DNEA 4X3SA 1IYVA 1I4RA 2OT2A 1JR0D 1ZXTA 3GTLB 3C3LA 1DOKA 1TS3A 1STNA 5EKLA 1SYEA 1TWGB 2N88A 1EFID 3V96A 4XYOA 1GUOA 2R93B 2PQEA 1NSNS 4FF2A 4DF7A 3PMFA 3SK6A 1ZKOA 2AWNA 1RF2D 5EGTA 3R3OA 5C3XA 4K5XA 3VR2A 2EYHA 1SE3A 4BS9A 1E2WA 2X6LA 2N55A 2Z1CA 3R2IA 1BO0A 2I46A 2Z4HA 3S15B 3PUVA 1UEAB 4ODGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQM C;  4H0L C;  1K8O A;  2BE5 C;  2L5T A;  3I73 A;  2KA7 A;  2A6H D;  2E74 C;  4DNR B;  1Z6H A;  2A68 C;  1H9R A;  5BN3 A;  3DXJ C;  2BDO A;  3PUY A;  2EJF C;  2O5J C;  1EWH A;  3BDO A;  3U9S A;  1ZYR C;  3VR3 A;  2EJG C;  3FPP A;  3ND9 A;  1QJO A;  3PUZ A;  4IQZ A;  3CRK C;  3GD7 A;  4HR7 B;  5JEA G;  3T56 B;  1VF7 A;  1Y8N B;  1SMY C;  2NN6 G;  4H44 C;  2D5D A;  1Z7T A;  2K7V A;  1O78 A;  1OXU A;  2PPB C;  2AWO A;  1CFM A;  2F1M A;  4OO1 H;  1GHJ A;  1PMR A;  2JEB I;  3N6R A;  4OO1 G;  1T5E A;  2NN6 I;  3GQB A;  3W3A A;  4TKO B;  3LWU A;  1LAB A;  4PV1 C;  1G29 1;  2DNC A;  3QG1 A;  3OPO A;  2A69 D;  1H9K A;  3A8K E;  1E2V A;  3PV0 A;  1VDZ A;  1YNN C;  2QF7 A;  3H94 A;  3I4L A;  2IT1 A;  3M4Y A;  1IW7 D;  3ND8 A;  2CW0 C;  3CRL C;  4I7Z C;  2A6H C;  2B8G A;  3VR5 A;  3WDN A;  4XTC S;  1GJX A;  4KKS A;  1GHK A;  5JEA H;  1A6X A;  1E2Z A;  3OW7 A;  3TZU A;  2V4D A;  2NN6 H;  1GUS A;  2K33 A;  3VR6 A;  1GUN A;  3MXU A;  1DD2 A;  4OGQ C;  4TQU S;  1OXS C;  5A35 A;  2D2C C;  2PCF B;  4H13 C;  1ONL A;  4KMU C;  4L8J A;  3M7N A;  3PUX A;  3T51 B;  3VR4 A;  4KKU A;  1H9J A;  1YNJ C;  1CTM A;  2DNE A;  2EVB A;  4BA2 I;  4G7O C;  1H9M A;  1IYV A;  1VF5 C;  5C0X G;  2R6G A;  4IFD G;  1O7L A;  5K36 G;  1Q12 A;  3KLR A;  3A7A B;  1BDO A;  1Y8P B;  3L7Z C;  5C0X H;  1V8Q A;  1FR3 A;  4KHZ A;  2BA1 A;  2LMC B;  3D4R A;  2DN8 A;  1K8M A;  3AB9 A;  1GUT A;  3A8I E;  5BN5 A;  4XIG S;  3VA7 A;  4BA1 I;  4G7H C;  4KI0 A;  1OXV A;  3IFT A;  1FYC A;  2EJM A;  5KNC A;  1LAC A;  4KKT A;  1GUG A;  1Q90 A;  1Y69 U;  4DK0 A;  1I6V C;  1GUO A;  4LJZ C;  3QIA A;  2KCC A;  2K32 A;  3OOC A;  2AUK A;  3FMC A;  4JBW A;  1DCZ A;  4IFD H;  1B9N A;  1HPC A;  1HCZ A;  2A6E D;  3RLF A;  3I72 A;  1OXX K;  4RCN A;  4GZY C;  2B8F A;  2A6E C;  3MFY A;  1ZKO A;  1H9S A;  4KN7 C;  4DK1 A;  4LK1 C;  3QJY A;  3T53 B;  3M85 A;  4DNT B;  1B9M A;  2Q8I B;  1VCI A;  5K36 H;  2O5I C;  3VR2 A;  1OXT A;  3IKJ A;  1DXM A;  1TU2 B;  2E75 C;  2PNR C;  1Q1B A;  2BE5 D;  3SE0 A;  2JEA I;  1TKW B;  2D62 A;  1CI3 M;  2EDG A;  2AUJ D;  1H9S B;  3BG3 A;  5KND A;  1E2W A;  3D31 A;  3EQL C;  3PUW A;  3A8J E;  5BN4 A;  1Y8O B;  2E76 C;  2YYZ A;  1IW7 C;  3SDZ A;  2A68 D;  2JE6 I;  3HGB A;  3LNN A;  2JXM B;  2BA0 A;  3NE5 B;  3PUV A;  2A69 C;  4JK1 C;  1IYU A;  1Q1E A;  1V43 A;  3P20 A;  5KNB A;  2ZT9 C;  4KN4 C;  4G7Z C;  1HTP A;  3A7L A; 
#chains in the Genus database with same CATH topology
 2HUG A;  3D6W A;  3PO2 B;  2JYO A;  1KRS A;  3P1H A;  2KEE A;  2K6A A;  4JYA Q;  1RTN A;  2UXB L;  4ZUJ A;  3KOJ A;  3MAQ A;  4MNO A;  4A93 H;  5M3F G;  4M1U B;  4A3B G;  1Q81 C;  1EOT A;  3D8G A;  3CRK C;  1EY4 A;  3L9A X;  1YVC A;  1G91 A;  3CXC A;  2K5H A;  4O42 A;  2DUD A;  2XN9 C;  4B08 A;  3JAM i;  1DJR D;  2CH4 W;  1XJV A;  3KLW A;  4YIJ A;  4LF8 L;  3M4Y A;  4A75 A;  4B3T Q;  2B8G A;  1JC7 A;  2HD3 A;  4DAP A;  4JI1 L;  5HY6 A;  2CKZ B;  1R4Q B;  1B1Z A;  1PVO A;  4RG1 A;  3A55 A;  4PMC A;  3HOV G;  4KJO A;  2KVM A;  1I3Q H;  1NAP A;  1VQM A;  4RHR A;  1H9J A;  1SYD A;  3I90 A;  1YHQ A;  1O80 A;  4G7O C;  3S15 H;  1H9M A;  3J7A V;  4J6H A;  4A3D G;  4IJL A;  3V05 A;  1D1I A;  1VQH A;  4K2L A;  4TRD A;  1A3T A;  2Q2U A;  1STY A;  2Z0S A;  4RGN A;  2YTX A;  1OXV A;  2F0W A;  2MO1 A;  3W5O A;  2EJM A;  4KY6 A;  5JEA J;  5C4X B;  4AQY Q;  5G3L F;  1QNK A;  3H3V I;  1X32 A;  3OOC A;  4A3E G;  2HQL A;  2F0L A;  4A3I H;  4A3G H;  2VB3 X;  2L15 A;  1DOL A;  1XPO A;  2AHO B;  3GDE A;  3S1M B;  1CKN A;  5C3W A;  3IKJ A;  1ICW A;  2LKV A;  1E0B A;  2F0O A;  3JAM E;  1JT8 A;  1N34 Q;  4LF5 Q;  3WOE A;  3KK7 A;  4A3K B;  1XYI A;  4GLV B;  2F52 A;  3BVM A;  2Q8R E;  3MXN A;  5EJW A;  1J8I A;  3AQQ A;  1V43 A;  2EY2 A;  4A3C H;  3ERO A;  2Y0S B;  1SNM A;  2B2V C;  2F0P A;  2L5T A;  2EPB A;  4MHE A;  5FLX c;  2F0U A;  4XT1 B;  3K57 A;  2A6H D;  3IAY A;  4CJ0 B;  4F87 A;  2PMZ E;  4JCV E;  3T1Y Q;  5T1G A;  4HIK A;  4QL5 A;  3CC4 A;  3T16 A;  5M3F H;  2UXB Q;  2DJF C;  2D0O A;  2KEN A;  1TY0 A;  2NN6 G;  2R7F A;  3KFU A;  1TT2 A;  1OXU A;  1FGB D;  5HUR A;  3KYH C;  1F9Q A;  1PMR A;  2JEB I;  4YWM A;  4A4I A;  5CBA E;  3G71 A;  3HOZ B;  3JC6 6;  5IT9 E;  1V9P A;  4CKC A;  2A69 D;  3H3V C;  3KLS X;  3BZD B;  3CRL C;  4YCW A;  2K04 A;  4GNX A;  5I2Y A;  4A3L H;  2NVY B;  3UE1 A;  2V4D A;  3T1H Q;  1GUN A;  1E3P A;  1TWH B;  1I3Q B;  4WFN 3;  4TQU S;  5C0X J;  1AW7 A;  1SMX A;  1PDQ A;  1KAA A;  1RHP A;  2PCF B;  4H13 C;  5A35 A;  4DAM A;  5DAU A;  2HHH Q;  4IPC A;  5M9O A;  3PUX A;  2EYP A;  4A3B B;  5C4J H;  4BBR H;  1I94 L;  1XX8 A;  1AH9 A;  1SYC A;  3FKI G;  1XMQ Q;  1Q12 A;  1BDO A;  2OTJ A;  1LT5 D;  3KDF A;  2LMC B;  3AB9 A;  1EIH A;  4G7H C;  4NP5 A;  4DXG A;  3OIP A;  4LF7 Q;  1Y1W H;  2HIV A;  4LWC A;  1B7Y B;  2NVX B;  3I70 A;  5IYC H;  2B63 H;  2NBF A;  5FO9 B;  2F0F A;  2XSC A;  4YCU A;  4DUZ Q;  1IYJ B;  2ZTC A;  3QR8 A;  1KNE A;  2KQ3 A;  2A6E D;  4MTN A;  3I72 A;  1N8R C;  1KAB A;  5LMN W;  1W6K A;  1KNA A;  1VQ9 A;  2V1C C;  4BBS B;  3NWS A;  1IHZ A;  3BJU A;  4N9T A;  4JG2 A;  4YHH L;  3PO2 H;  2F03 A;  1FD7 D;  4LF9 L;  3TSS A;  2JA7 B;  3TP5 A;  2JQO A;  5KND A;  5IGB A;  3H15 A;  2AMC B;  1CA6 A;  4A93 B;  3DEP A;  3RLO A;  1BKB A;  4NXN L;  1SE4 A;  4TVA B;  5EKI A;  3A56 A;  2ZJP A;  2MHV A;  2MNA A;  2BE5 C;  4K14 A;  3CQZ H;  3TME A;  4DV2 L;  2L55 A;  5EPL A;  1I4X A;  3NTI A;  2O5J C;  1PRT C;  2R61 A;  3IRB A;  4DV6 L;  1QJO A;  3T56 B;  2FMM A;  2E2I H;  1XPR A;  2OQ0 A;  4LW1 A;  2KHJ A;  1KDA A;  1NBW A;  3CCS A;  1CKO A;  1X6O A;  4BY1 B;  1LTR D;  1HQR D;  2VQF Q;  4XXE A;  3VYU A;  4P71 A;  2CW0 C;  2TSS A;  1JOR A;  1PH1 A;  4DUZ L;  5BR8 Q;  4RFB A;  4B3R Q;  3K7A H;  1XMO L;  4HJ5 A;  5DM7 3;  5FOB B;  3JAM c;  3ULL A;  4FXD A;  2O4X A;  5KRU A;  3KF6 A;  4BA2 I;  1U0L A;  5C3E H;  1ENC A;  4PNY A;  2ES2 A;  1FJG Q;  3EVQ A;  3NWT A;  1EL0 A;  4DR6 L;  2R6G A;  1HNX L;  2NZO A;  5C0X H;  4P2C B;  1PYS B;  4POF A;  1S5F D;  2FHT A;  1K28 A;  4R4T A;  2C5C A;  2G9D A;  4ME5 A;  3S16 B;  3NBI A;  4C2M B;  3K5O A;  5C44 H;  2F0H A;  1AFP A;  3H91 A;  3J81 E;  1ENF A;  2CFM A;  4R8I A;  4I65 A;  1XXG A;  4UP7 A;  4LF6 L;  2B29 A;  3PIP A;  3QOL A;  5FJ8 H;  2F3I A;  2JA6 B;  4KLK A;  1K83 B;  1STG A;  4B3M L;  3GTO B;  3KJO A;  1OXX K;  4A3F H;  4A3I G;  2B8F A;  2K5N A;  1KXL A;  2HCI A;  2N3S A;  5I6Y A;  4PZ8 A;  2R7Z H;  1PZK D;  4L5T A;  2DJG C;  1N33 Q;  3MXG A;  3S9W A;  5I6W A;  1LV9 A;  4RKB A;  2JEA I;  4DV0 L;  1OTC A;  5BN4 A;  5CR3 A;  1S5D D;  4C3H G;  1PHJ A;  2CH4 A;  2A68 D;  4EGV A;  2MUY A;  1YZ6 A;  1EWC A;  2K4K A;  1MHW C;  2PNH A;  1EWI A;  3HKZ G;  5IE8 A;  4NB3 A;  3OSO A;  1HZC A;  3W1B A;  5M5X B;  5IYD G;  1YIJ A;  2FJ2 A;  1S72 A;  4C1N I;  4CDC C;  4GS3 A;  3OMC A;  4KV6 A;  4OWT B;  4PMB A;  2P5Z X;  3PUY A;  1BF4 A;  4WRD A;  1BCP B;  2K28 A;  4C2M H;  3U4Z A;  3GV6 A;  2JA7 H;  5EKK A;  4FXG C;  1PTO F;  5DLQ E;  4OO1 H;  1PYB A;  1P16 A;  1G2S A;  2QKI C;  3GQB A;  4BY1 H;  3LWU A;  4QY7 A;  1RTO A;  3F1Z A;  3U9O A;  3GTJ H;  4HCS A;  3DLL A;  3TS2 A;  2F0I A;  1W2B A;  4DR6 Q;  1B8A A;  4IFD I;  4KKS A;  1XWE A;  4KY7 A;  4IN3 A;  1PH8 A;  3HOW G;  3S14 H;  2O2L D;  3GTK B;  3C2P A;  1EOV A;  4QIW B;  1A2T A;  5FLX L;  1WTW A;  2QDB A;  2KJX A;  1LO5 D;  3AYH B;  3VR4 A;  1MBY A;  4XQN A;  1G6P A;  3CQZ B;  3HOY B;  4B3S L;  1WCM H;  2XRS D;  1EQT A;  3K80 C;  4FO2 A;  4EQ5 A;  2Z6K C;  3SK4 A;  4JI6 Q;  2VQE Q;  3WWV A;  3ULP A;  4APV A;  1EIG A;  4POG A;  4K6L A;  3ICE A;  1JIC A;  4PQX A;  1A3U A;  1A0I A;  5F2D A;  4DK0 A;  5I4D A;  2QEX A;  2H5X A;  4DR1 L;  5IP7 H;  5LMU L;  5M3F B;  3DHQ A;  3KF8 A;  1HA6 A;  2RDF A;  1PH4 A;  3BYT B;  1U4L A;  1HRJ A;  4DNT B;  1VCI A;  3HOX B;  1C9O A;  1XPU A;  4OEM B;  4IO9 A;  3EQL C;  4RAU C;  3CHB D;  2HQE A;  1JE5 A;  3GTP B;  1IW7 C;  1DOM A;  1LTA D;  3D4D A;  2JE6 I;  2E2H H;  3PO3 B;  2NB0 A;  3NE5 B;  5DNF A;  3HOW B;  2B2W C;  5M5X H;  3J7Y W;  1SAP A;  3KJP A;  3MEH A;  2ZJR A;  4UP9 A;  1WTO A;  1Z47 A;  3K59 A;  1PFM A;  4QGU A;  2G9H D;  4DNI A;  4CDD C;  2R93 G;  3OIQ A;  2E74 C;  2A68 C;  2RBM A;  4HTH A;  2ZTD A;  3DXJ C;  2QEJ C;  4QUF A;  1ZYR C;  4E6I A;  2JJQ A;  3HOU G;  2OCE A;  1KRT A;  1SMY C;  1FNW A;  2D5D A;  4A3J G;  1Z7T A;  2NVX H;  4A3G B;  3I56 A;  5E4W C;  3E3X A;  1VQD A;  4LF6 Q;  3PSI A;  4QCL A;  1MSG A;  1TVX A;  1AE3 A;  2H1E A;  2N49 A;  5CMD A;  1JOK A;  4BY1 G;  4J1M A;  1VDZ A;  1NNX A;  1HHV A;  1LT3 D;  1YNN D;  1IW7 D;  3VR5 A;  2NTS A;  1R9T H;  4XTC S;  2RCN A;  3RD4 A;  5JJI A;  5A2Q L;  2K50 A;  1KLU D;  2QA4 A;  4EQN A;  1GKH A;  3PIO 3;  2LFN A;  1SRO A;  4IUT A;  1G6Z A;  1IXR A;  1BNZ A;  1JWM D;  4L6T B;  2UUA Q;  2NVQ B;  1CTM A;  1V1Q A;  5JPN C;  5C0X G;  1OO9 B;  3K5N A;  3HOY G;  3KLR A;  1WCM G;  4DN4 M;  5BR8 L;  2F0D A;  1IBL Q;  3Q23 A;  2Q2T A;  3OWE B;  3MTS A;  1N32 Q;  2CWP A;  2WAQ E;  3UDX A;  1O7Z A;  4WJ3 M;  1FYC A;  5C44 G;  3RMH A;  4HJ9 A;  2B2V A;  3K0Y A;  4R9W A;  4X3K A;  2YU9 H;  2UXD Q;  4JBK A;  2WB1 G;  5IP7 G;  2B2U A;  1JB7 A;  3GTJ B;  1HCZ A;  2NVT H;  1D5X C;  5IOD A;  3F2U A;  3CMA A;  3O13 A;  2WKD A;  1STA A;  2E75 C;  2PNR C;  3L0O A;  3KBX A;  1CUK A;  1I4G A;  4B3T L;  1IBM L;  3Q6S A;  4JBM A;  2JA8 B;  5EPJ A;  4DK6 C;  3SEB A;  1IKM A;  4HID A;  2IWH A;  3ER0 A;  4GNX C;  4FF3 A;  5E1F A;  3A7L A;  4GKJ L;  2UXC Q;  1CHP D;  4JI5 L;  1YHB A;  1LM0 A;  3S1M H;  4IAL A;  1Q8I A;  3LGJ A;  1CK1 A;  2AQ1 B;  2RDG A;  1H9R A;  1QE6 A;  1EU4 A;  5BN3 A;  1EYC A;  2LY7 A;  3CF5 A;  5CV5 A;  2I5L X;  3AEV A;  3L2P A;  2EJG C;  1EYA A;  4HMI A;  1IKL A;  4KY5 A;  4RCO A;  4AQY L;  4A3J H;  1HUM A;  3HOV H;  4L5Q A;  3R93 A;  1JWS D;  1VMC A;  2EXD A;  1T5E A;  4A3I B;  1Y14 B;  4YCV A;  3QG1 A;  1AZP A;  4DV6 Q;  2YV5 A;  2HT1 A;  3M4O H;  4ZK9 B;  1EY7 A;  1G8Z D;  5C5M A;  1V1P A;  5KGU A;  1A6X A;  1JJC B;  3I8Z A;  1QOH A;  4IZ8 A;  2FIN B;  1OXS C;  3HOW H;  3ERQ A;  4L63 B;  4RKL A;  4KHP Q;  1I4H A;  1GXD C;  3FRP B;  2VL6 A;  4AYB G;  5FK9 C;  4DV7 Q;  3TP6 A;  4JI2 Q;  3J7A 5;  4A3M H;  2QIL A;  5C4J B;  3C46 A;  5IGD A;  4A3G G;  1TII D;  5M5Y B;  3I55 A;  4F88 A;  1Y1W B;  3GTM H;  4BY7 H;  3S1Q H;  3BDC A;  5J22 A;  2JA5 B;  2AQ3 B;  1TS5 A;  3E9H A;  1HZ9 A;  2IX0 A;  1X3P A;  3C1F A;  4JBJ A;  4HIM A;  1QB5 D;  3CME A;  1U5K A;  4X64 L;  1XTD A;  2FFK B;  2KCC A;  3FKI H;  5M3M B;  4JBW A;  2B63 B;  1B9N A;  1A15 A;  1MI2 A;  5CV4 A;  1PTO B;  1WJJ A;  4RCN A;  3ZJY C;  4DR3 Q;  3SVM A;  1H9S A;  4A3C G;  1S40 A;  4V19 0;  3H6M A;  3UI2 A;  4FP5 D;  3X3N A;  4GOP B;  1WFQ A;  4B3S Q;  3H0G B;  3PCO B;  1TKW B;  1EQQ A;  4JI0 Q;  4DR4 L;  3DEO A;  1YNJ D;  2B3G A;  3MFG A;  3NSW A;  1Y1V H;  1C4Q A;  3HOZ H;  2SNS A;  3SDZ A;  1VQN A;  2B2T A;  4OL7 A;  1VS0 A;  1T5X D;  4DV5 Q;  1WTR A;  1FNU A;  3LX0 A;  1HTP A;  2HHH L;  2VQF L;  1KD1 C;  2E2I B;  4ZUI A;  5LMU Q;  4QJF A;  2UU9 L;  3FPU B;  2I07 B;  1HTL D;  2F0E A;  4AH6 A;  3AMU A;  4DV0 Q;  3RN2 A;  1UE6 A;  4CGY B;  2I5M X;  3H0G H;  1SNP A;  1SXT A;  1IBL L;  3NBH B;  1QWY A;  4DAY A;  5IP9 G;  3VA5 A;  3E0E A;  4K0K L;  2OEO A;  3ND9 A;  4JI3 L;  1LUZ A;  4IQZ A;  4KHV A;  2UUC L;  2F0M A;  1EY9 A;  2R7D A;  1HR0 Q;  3AU7 A;  3D4W A;  4KJN A;  1CFM A;  1SMY D;  3J80 c;  5FLM H;  3I91 A;  3BS1 A;  1U4R A;  5C3E B;  4UY8 C;  3TP7 A;  3OPO A;  4BBR G;  3N52 A;  3A8K E;  1A8V A;  4LF9 Q;  2Z6B A;  1ENA A;  3M3Y H;  1PH7 A;  1BXT A;  1WOC A;  1BCP F;  1TWG H;  3TZU A;  2K5W A;  1KDB A;  2K33 A;  2L11 A;  1LLR D;  2OQK A;  4ZKC B;  5NUC A;  1QG7 A;  1A63 A;  3STB D;  2L9H A;  3OYY A;  1DON A;  2K5V A;  3J81 j;  5EPK A;  5E7N A;  2F0T A;  5M5W H;  3J7Z C;  4YHH Q;  1HNW Q;  1WI5 A;  2K5Q A;  2WFW A;  1EFW A;  3SR1 A;  2MQH A;  1X3F A;  1SYB A;  4XQQ A;  1A3V A;  1FR3 A;  1IBK Q;  2KED A;  1E1T A;  4OIJ A;  4CJ2 C;  3GV3 A;  1BBX C;  2R7Z B;  2C9O A;  4KI0 A;  4DA2 A;  3IFT A;  4C3I B;  4N8X 1;  3CCV A;  2WB1 B;  4DUY L;  5KYL A;  4LMQ D;  4A3F B;  5M5W B;  1EUJ A;  3FMC A;  4IFD H;  2ZXO A;  5A2Q E;  3RZO B;  3K5L A;  1BBU A;  1IL2 A;  1A62 A;  4F7X A;  3F2D A;  4DV4 L;  1B3A A;  3I4M H;  1QUQ B;  4FF4 A;  3H3V H;  2EE1 A;  2UXD L;  3GTQ H;  1Q1B A;  3SE0 A;  5IOC A;  5COY A;  1H9S B;  4MZ9 A;  4CHT B;  4FDB A;  1Y1V B;  3D31 A;  3PUW A;  4JC0 A;  1Y8O B;  1SND A;  1MD2 D;  2E76 C;  4ZCK A;  3DWP A;  4GOP A;  2IHE A;  1XMO Q;  5CV6 A;  3LNN A;  4N9P A;  3WDN A;  4A3F G;  1IYU A;  1VQ4 A;  2CWA A;  1O7I A;  1E22 A;  5I9P A;  1PA6 A;  3MXP A;  3S2D B;  2ICE C;  2L1B A;  4RH6 A;  1STB A;  4C56 C;  1WTP A;  2PW7 A;  2GA4 B;  1GD7 A;  1EIY B;  2AKW B;  2XIW A;  1XMQ L;  3GO5 A;  2ZXR A;  3H0G G;  2B2W A;  1UNS A;  2N78 A;  4RA8 A;  2ID0 A;  3GD7 A;  1JMC A;  3U50 C;  2L4N A;  2TMP A;  4JI1 Q;  5GAG C;  3K7U C;  4HSV A;  4G4K A;  1QCB D;  3ERS X;  1J5E L;  4Y7N B;  3CCM A;  1SJH D;  1RJT A;  1I4Q A;  1V1P B;  4ZKB B;  3JAM L;  3KDF B;  3NEL A;  1VQB A;  2G5D A;  2CCZ A;  2AQ2 B;  1SR3 A;  2CQA A;  1DGS A;  2RHS B;  2QF7 A;  1RL2 A;  5LL6 S;  1K0S A;  4DR4 Q;  3VYR A;  2L12 A;  3I7F A;  2HIX A;  4IOC A;  2K05 A;  1GOZ A;  5E4X A;  1JB3 A;  4X3U A;  4L8J A;  4P75 A;  1M8A A;  1I94 Q;  5KIX A;  1VQL A;  3NUC A;  5AFW A;  4UAI A;  3M4O B;  2MGS A;  1Y8P B;  3L7Z C;  1N32 L;  2BA1 A;  3S17 H;  2EXZ A;  4R8N A;  4BA1 I;  1IBK L;  3RLN A;  2MPM A;  1W6J A;  2VB2 X;  1E7Z A;  1LAC A;  4KKT A;  1SFO B;  1I6V C;  1YBY A;  1J5E Q;  2ZM6 Q;  2I5H A;  4N8F A;  1EY5 A;  2M9V A;  4Q5V A;  2UUC Q;  2QCP X;  2AUK A;  1K0R A;  4GZY C;  1MJE A;  1EIF A;  2GVB A;  2A6E C;  3S1Q B;  4Y52 H;  4DK1 A;  4OX9 Q;  4HJ8 A;  2XWB B;  4LUO A;  1BQQ T;  4K5W A;  3G7L A;  3KF8 B;  3A5Z B;  1KHI A;  4LFA L;  3PIO A;  3RZD H;  5C4H A;  1JOQ A;  1F2M A;  1EZ6 A;  1HZB A;  1YJW A;  3E5S A;  3PO3 H;  2RHQ B;  5C0X I;  1Y1V G;  2Q8T A;  2NTT A;  3HG9 A;  3TDQ A;  3S1N B;  3TS0 A;  1B50 A;  4C3H H;  4JK1 C;  2K01 A;  2DGY A;  3NK9 A;  5JJK A;  5D14 A;  2E2H B;  4HMJ A;  1HQM C;  3M4P A;  2RSO A;  5FKA C;  3VDY A;  1Q86 C;  4BBR B;  4KK7 A;  1F2Z A;  2I0Q A;  2EJF C;  2YTY A;  1EWH A;  1L0Y B;  1TWF B;  1D1K A;  2CHB D;  3HS0 C;  4GLX A;  3DM3 A;  2JP1 A;  5GAD C;  2RQX A;  2VUM H;  4OO1 G;  1D5Z C;  3DWQ A;  4K5V A;  2WV6 D;  4ABN A;  1XNR L;  4JV5 Q;  4YY3 L;  2PW5 A;  5J39 A;  3H94 A;  5D3I B;  5EBD A;  3M7N A;  5K36 H;  2X69 A;  3TN2 A;  2OXP A;  1GHK A;  1O7Y A;  2B2U C;  5GAE C;  1MJC A;  4ZLT F;  1TS4 A;  5C6A A;  2SNM A;  3CCR A;  1ONL A;  2F0V A;  1L1O A;  1TR5 A;  3S1N H;  1T9H A;  4O0A A;  1JE4 A;  1YNJ C;  4P74 A;  4RWS C;  2OTL A;  1JOO A;  1MGS A;  1QVG A;  1KL9 A;  1CT1 D;  1V8Q A;  1M4V A;  2A74 C;  4A3L G;  2NYZ D;  1VQO A;  1K8G A;  3A8I E;  3VA7 A;  4JOI A;  5CV7 A;  1GVP A;  5LL6 X;  5CV8 A;  1U4P A;  1MIU A;  1GUG A;  2EYJ A;  4K0K Q;  3W1G A;  1PTO D;  4JI4 L;  4YWL A;  1ET6 A;  4LJZ C;  1II3 A;  2WAQ B;  4J15 A;  4KD3 A;  3PF4 A;  4DR3 L;  1C0A A;  1QUQ A;  4TSS A;  1HFG A;  1PRT B;  1ICF B;  5JVH 3;  3MVV A;  3MFY A;  2M2L A;  4DKA C;  2SEB D;  4KN7 C;  5ELE A;  1C7Y A;  4LK1 C;  3QJY A;  3HOX H;  5LMN L;  1B9M A;  3MEF A;  4FNF A;  1PZJ D;  3NQT A;  5M5Y H;  2PMZ B;  1X3E A;  2WAQ G;  2K5D A;  2RDH A;  3HOU B;  2D9U A;  2H4O A;  1L0W A;  4A3B H;  3HOU H;  2WB1 E;  2JXM B;  1XNR Q;  1YEZ A;  1K9M C;  1R4P B;  4KN4 C;  3HOV B;  3S17 B;  3BDL A;  1K8O A;  4GN4 B;  1R9T B;  3PO2 G;  3I73 A;  1HNW L;  3CAM A;  2ZJQ A;  1A2U A;  1JJ2 A;  2QDL A;  4DV7 L;  1AN8 A;  1TY2 A;  4H44 C;  2EY6 A;  2IL8 A;  4C3J B;  3P7J A;  1KDC A;  2K75 A;  2SDF A;  3ZYY X;  1SSO A;  1HR0 L;  2VUM G;  1MSH A;  4MN3 A;  2JA6 H;  4IUN A;  1LAB A;  1ML0 D;  4RMF A;  1HJP A;  4JPB W;  2IY5 B;  4GN3 B;  1K3R A;  1E2V A;  4A3E B;  5CYU A;  2WKC A;  5LHY 1;  3HOY H;  3MZ5 A;  2RVL A;  3CCE A;  2Q2H A;  2ASB A;  3ITP A;  4B9X A;  2NN6 H;  2LS0 1;  2KHI A;  4CBV A;  1GUW A;  1HFN A;  4KMU C;  1GO3 E;  3NXW A;  1NTG A;  2NZ1 D;  5ELC A;  5ELB A;  1B70 B;  1X3Q A;  1N33 L;  2RCF A;  4A3E H;  5D3D A;  3A7A B;  3J7A F;  2K1B A;  1F2L A;  2WIN B;  3PIP 3;  3GTG B;  1IBM Q;  4DUY Q;  1KAW A;  4DK3 C;  1Q90 A;  5M3M H;  4JW0 A;  1IL8 A;  1I50 B;  4F8M A;  2XNA C;  4ZRZ A;  3I4N B;  1V1O A;  3FHW A;  3H09 A;  5I9O A;  1I50 H;  4R4Q A;  2K14 A;  3GTG H;  1Z9F A;  5JOB A;  2Q8I B;  5ELO A;  2O5I C;  4IUR A;  3A74 A;  3PO3 G;  4EQO A;  2D0P A;  4HIO A;  5G3L D;  3CPF A;  1BCP C;  2F0N A;  1L1O C;  1ZEQ X;  3TQY A;  4JI8 L;  4DR7 Q;  5EQ0 A;  2BA0 A;  5KYI A;  3S2H H;  4G7Z C;  2ZT9 C;  2NUC A;  4DGZ A;  4X62 L;  3J81 i;  1NR2 A;  4BWG B;  4CKE A;  2GN5 A;  4H7B A;  2IX1 A;  2NVT B;  4LF4 L;  1F2Y A;  4IPH A;  3R8B A;  3MA2 B;  3G6E A;  5ELN A;  2BDO A;  1PFS A;  2YU9 B;  1NR4 A;  1IZ6 A;  3EN2 A;  4H02 A;  1ESR A;  1DZ1 A;  3I4O A;  1STH A;  3Q8D A;  1ZYR D;  2ENB A;  5JEA G;  3HKS A;  4V0B A;  3TBI B;  4C3J H;  2XVS A;  1M1K C;  3C1E A;  4DAY B;  3OMG A;  2F4V L;  2E5L Q;  4HCE A;  2JK8 A;  1UE7 A;  1AP0 A;  3CP0 A;  3I3C A;  2IX3 A;  4BXX G;  3I4N G;  1YNN C;  3EFX D;  3T1H L;  4XT3 B;  4KTA A;  1EY0 A;  1TWH H;  2X6G A;  1SFO H;  1SRU A;  3VR6 A;  2K03 A;  1DD2 A;  4OWX B;  1FL0 A;  4MIU A;  3CPW A;  3ONA B;  3EIV A;  2CW0 D;  4JI0 L;  4IUQ A;  4X62 Q;  4KKU A;  2B63 G;  4YY3 Q;  3PF5 A;  4YWK A;  5FJ8 G;  3L3O C;  1RDP D;  3AFP A;  1SN8 A;  2EOT A;  5ELF A;  1Q3L A;  3E9I A;  4OXP A;  5C44 B;  4X66 Q;  1LTG D;  2F0Q A;  1SYF A;  3HFZ B;  4IUU A;  4XIG S;  3B6Y A;  3J80 L;  4P72 A;  3S1R H;  2NVY H;  4X65 Q;  2XTI A;  1WTH A;  2PI2 A;  3A0J A;  1U4M A;  5C3E G;  3U58 A;  1HNX Q;  1VQG A;  1NE3 A;  2F0K A;  1VQP A;  1ASZ A;  4ZYS A;  3P75 A;  4NPS A;  1CHQ D;  2IPK D;  2UUA L;  1NCV A;  3RN5 A;  3V2T A;  2A19 A;  2Z6K A;  5IYD H;  4WJW A;  1I5F A;  3D6C A;  4PMW A;  1NY4 A;  1N34 L;  4LF5 L;  1EY8 A;  1E24 A;  1OXT A;  1DXM A;  2EIF A;  2A8V A;  1STE A;  1X54 A;  2B2Y C;  4R4C A;  1L0X B;  3AFQ A;  2N8N A;  3A8J E;  4QQB X;  2KCT A;  3D0F A;  4A3M B;  3HGB A;  3GP7 A;  3F2B A;  1PH5 A;  2BH2 A;  2A69 C;  2F3W A;  4EVO A;  1N36 Q;  2IJ0 A;  2VNU D;  2VY3 A;  4DV2 Q;  4DV3 L;  5T1I A;  2KA7 A;  1F9P A;  4A3D B;  4BBS H;  1D6E C;  4K6D A;  3SHL A;  3CKI B;  1HR0 W;  4A3K H;  1TS2 A;  1CKN B;  3Q22 A;  4DR1 Q;  1X65 A;  2RKS A;  5IGG A;  3A54 A;  1ROD A;  4OHJ A;  4ULL A;  4OIK A;  4HR7 B;  1W3S A;  1Y8N B;  2NVQ H;  3F8T A;  1CQF A;  1K3B C;  4NW2 A;  1PH3 A;  2VQE L;  1GHJ A;  2DY7 A;  5FLM G;  2NN6 I;  1B2T A;  5FO8 B;  2DNC A;  3IL8 A;  1S3O A;  4GKJ Q;  1VQF A;  5IY0 A;  3GTK H;  1EEI D;  1G51 A;  5C4X H;  1E2Z A;  1X55 A;  1GUS A;  3RR5 A;  2RSN A;  5IWA L;  2XWJ B;  3K81 C;  3UDI A;  4C3H B;  5AJ3 L;  4L5R C;  1TXY A;  1WTX A;  4JI2 L;  1AEX A;  3STB C;  4DV3 Q;  2EVB A;  3NHH A;  1VF5 C;  4FXK C;  4IJH A;  4IFD G;  1BUV T;  4KD4 A;  4IPG A;  1VQI A;  1H95 A;  4GKK L;  3GTQ B;  1HZA A;  3D4R A;  2DN8 A;  1K8M A;  2HDM A;  5BN5 A;  3MC0 B;  3I4M G;  4OX9 L;  2IHF A;  1Q8K A;  3M3Y B;  3FVQ A;  2EY1 A;  2KOL A;  5M3M G;  1X3G A;  3DM1 A;  4GLA C;  1Y69 U;  3J81 c;  2A73 B;  1K83 H;  3X3M A;  1AE2 A;  2E5L L;  3BU2 A;  3UE0 A;  1KC8 C;  4A76 A;  3HEJ A;  2ZM6 L;  5JJL A;  1HPC A;  1TWC H;  4JOI C;  2BCO A;  4NXM L;  2DY8 A;  1UE1 A;  3R2T A;  3T4A C;  4DR2 Q;  1CZG A;  1PFN A;  4RHS A;  2YTV A;  3BYY B;  1HA5 A;  4C3I G;  1N36 L;  1SNC A;  1SE2 A;  1SNQ A;  4X6A H;  3CC7 A;  2HCC A;  5IWA Q;  4EX5 A;  2D62 A;  4HN7 A;  4JI6 L;  1CI3 M;  2EDG A;  3J80 E;  4A93 G;  4NXN Q;  1TWA H;  2ALY B;  1VQ5 A;  1PV4 A;  3S1R B;  2YYZ A;  3D3R A;  3T13 A;  2KHS A;  2JA7 G;  1KLG D;  4DV4 Q;  2UU9 Q;  1UAP A;  2KCM A;  2EYL A;  2EYF A;  4H0L C;  4HAE A;  3TEH B;  4DV5 L;  3GTO H;  1SYG A;  3CC2 A;  1WCM B;  4K2K A;  4B3M Q;  1TWF H;  3PQI A;  4WJ4 A;  1UEB A;  1SNO A;  2VXW A;  4XQJ A;  1BOS A;  4ZQ3 A;  1TWA B;  1UUP A;  2GVA A;  4QB4 A;  2RA4 A;  3W2D A;  1VF7 A;  2UUB L;  2Y0S E;  1QVF A;  2VUM B;  2Z9H A;  1SJE D;  4O2D A;  2Z4I A;  1VQC A;  4Y7N H;  2AWO A;  4B3R L;  2R93 H;  3N6R A;  3DUZ A;  3W3A A;  4KHP L;  4LFC Q;  4PV1 C;  1G2T A;  3I4N H;  4HJA A;  5IIF A;  1CQV A;  3K8A A;  3ND8 A;  2IT1 A;  4BXX H;  4LFB L;  4DXF A;  1EQV A;  2RF4 A;  1GJX A;  3OW7 A;  3NTH A;  5L37 A;  4I7A A;  1UWV A;  4OGQ C;  4ME3 A;  5GRO A;  1TQO A;  4R1J A;  1I4P A;  4NXM Q;  1QNU A;  5CBE E;  3CD6 A;  2JA8 G;  5TSS A;  3S2D H;  3GTP H;  4RGT A;  4JI7 L;  2E8G A;  4RGO S;  4ILW A;  2QGQ A;  3DMU A;  2EYO A;  2ZTE A;  5I2X A;  2KUM A;  5HGT A;  5K36 G;  4OEL B;  1NMG A;  3QWN A;  2WAC A;  2E2J H;  1AZQ A;  4C1N K;  4LF4 Q;  3A5U A;  2K52 A;  1S4Z A;  1B3Q A;  3FDT A;  4ZAI A;  5IYC G;  1RD9 D;  1CM9 A;  1PZI D;  4J8Q A;  1B44 D;  4NMZ A;  2K32 A;  4A3M G;  5KEE A;  4IPD A;  1DCZ A;  1JCK B;  3CU7 A;  1EY6 A;  3NQI A;  3KF6 B;  1WYD A;  3K5M A;  3Q0A A;  2F0J A;  1U9R A;  2LSS A;  1PXU A;  3SXH A;  3VYT A;  3TRZ A;  1RKN A;  1MKH A;  1Q82 C;  1VQ7 A;  4C3I H;  4LNQ A;  5DEH A;  5IGF A;  1ESF A;  4DFA A;  2EYM A;  1QZG A;  1BCP D;  4NKL A;  1EEF D;  2LXK A;  1Q7Y C;  4IUV A;  3BG3 A;  1RCV D;  1N9W A;  2BDN A;  4IUP A;  4L5S A;  1YNX A;  1FJG L;  1Q46 A;  4NDX A;  4XDX A;  5IYB G;  1PLF A;  5KNB A;  2KBN A;  4AYB B;  4DAV A;  4ID6 A;  3NEM A;  4JYA L;  1TWC B;  1YIT A;  3UDG A;  2VZA A;  4BBS G;  3E0J A;  1J6Q A;  3K6O A;  1Z6H A;  3EA6 A;  1NJI C;  4K8I A;  4LUZ A;  1D5M C;  4LFC L;  1C48 A;  4IFD J;  4OO1 I;  3U9S A;  4M8A A;  4HSP A;  1BBW A;  2JSO A;  4GN5 A;  2R92 H;  1KIX A;  2L0C A;  1QVC A;  4AYB E;  1O78 A;  1JJG A;  3K58 A;  1I6H B;  5C4Z A;  5GAH C;  4QMG A;  2OF1 A;  2VS1 A;  1G29 1;  3VYS A;  5ELD A;  1F9R A;  1B53 A;  4UDU C;  2ICI A;  2MO0 A;  3I4L A;  2MJ8 A;  4I7Z C;  3TP8 A;  4JVZ A;  3OTO Q;  5EBC A;  3NPP A;  4HJ7 A;  2J7Z A;  2KEC A;  3NP8 A;  5C4X G;  5HGQ A;  1EU3 A;  1PRT D;  3J81 L;  1LT6 D;  2Y0S G;  4MTK A;  3K7A B;  4X3T A;  3S2H B;  1X56 A;  2A5H A;  1LTB D;  4UP8 A;  4AIM A;  5FO7 B;  2JA8 H;  4DR5 L;  2J4X A;  1ILQ A;  1YJ9 A;  1CA5 A;  4G57 A;  1ET9 A;  4JI7 Q;  1O7L A;  3S24 A;  1YHA A;  2WII B;  1EYD A;  3KLS A;  4QUC A;  1NMF A;  1GM5 A;  1GUT A;  4LUV A;  5J1Z A;  4K8J A;  3RNU A;  2HDL A;  3F2C A;  2MFI A;  4O1N A;  4PZ7 A;  3QIA A;  3LWE A;  3MHB A;  5E3F A;  4GKK Q;  3M4Q A;  4PZ6 A;  2XRQ D;  1WVL A;  1S5E D;  3RLF A;  4X66 L;  4OON A;  4S3S A;  3BVZ A;  5GQO A;  3SK8 A;  2PI2 E;  1LTI D;  1LTL A;  3T53 B;  1SLJ A;  3HRZ C;  1J9O A;  3HOX G;  4R4O A;  4DU9 A;  2PQA A;  2EY5 A;  2R92 B;  2BE5 D;  5IT9 L;  2Z8L A;  1HXY D;  1VQ8 A;  2AUJ D;  5JAV A;  3URY A;  2R3Z A;  3Q24 A;  4DR5 Q;  1QZH A;  4XYQ A;  4LF7 L;  1DYQ A;  3EJI A;  3HP3 A;  1PH6 A;  2PZW A;  2Q2I A;  3K0X A;  3QO2 A;  1Q1E A;  3OWF A;  5LMN Q;  2ZXP A;  2R7Z G;  3J80 i;  4LFA Q;  4WOR A;  5IGC A;  4HED A;  4PG3 A;  1BR9 A;  2PYK A;  2SOB A;  4CJ1 B;  3BDO A;  3VR3 A;  1VMP A;  4IOA A;  3CCU A;  1L2F A;  3I4M B;  1DM0 B;  3PUZ A;  3CW2 C;  3T1Y L;  5ISR A;  1L1O B;  1PRT F;  3OTO L;  3WOF A;  4A3J B;  5DM6 3;  4CKB A;  1WD1 A;  2F0G A;  2K7V A;  4B9W A;  2B2T C;  5C5L A;  3SK5 A;  1CKM A;  1VQE A;  1B4O A;  2XGT A;  4FVM A;  4UPA A;  1CSP A;  2JA6 G;  2IW3 A;  2OWO A;  5JJZ A;  3RUZ A;  1H9K A;  2WP8 J;  1S5C D;  1PTO C;  2FMC A;  5JEA H;  4BY7 G;  4U67 3;  4C3J G;  4JI8 Q;  4DR7 L;  2MP1 A;  4U68 A;  3MXU A;  4EQP A;  3FP9 A;  1BVS A;  1C8C A;  4FF1 A;  1SEB D;  1YI2 A;  3OHX C;  2NWG A;  1PTO H;  1PFB A;  1FGU A;  3SGI A;  3T51 B;  5AJ3 Q;  3TZD A;  3IFD A;  3G4S A;  2M00 A;  4A3D H;  1K8A C;  5COR A;  1HNZ Q;  1XNQ L;  3M9B A;  4KHZ A;  1HNZ L;  2JA5 H;  4QIW E;  1JWU D;  3TRE A;  2B39 A;  5IGE A;  4JV5 L;  3DWA A;  1WD0 A;  1EZ8 A;  3NEN A;  5JPM C;  3FEW X;  5KNC A;  2CQO A;  3HKZ B;  1WTQ A;  3BVG A;  4P73 A;  1NUC A;  1WTV A;  3FKI B;  1YJN A;  2BOS A;  2PO4 A;  3BZK A;  4X65 L;  1QIL A;  3E6Z X;  3ULJ A;  3HOZ G;  1FVI A;  3UDF A;  1PH9 A;  3OW2 A;  1VQK A;  3M85 A;  2F4I A;  1LT4 D;  3S16 H;  3CCQ A;  2J0T D;  1LYL A;  1PYW D;  1ILP A;  5IT9 c;  3KBG A;  4DR2 L;  1TU2 B;  3BZC A;  1P8L A;  4JI4 Q;  1LTT D;  1KQS A;  1KTK A;  1SBB B;  4Q0F A;  3PGZ A;  5JVG 3;  3M7G A;  5CC4 A;  5IP9 H;  1F9S A;  1PH2 A;  5IYB H;  4DV1 Q;  1S5B D;  3P20 A;  2B2Y A;  3NBH A;  4CDE C;  2ATW A;  3MWY W;  2F0S A;  2QW7 A;  3U4V A;  2UXC L;  4OWW B;  4DNR B;  5FLX E;  1M90 C;  4JI3 Q;  4CDF C;  4RGM A;  1HUN A;  3QB3 A;  1VQA A;  4LAA A;  2F3V A;  3HZX A;  2LXJ A;  3FPP A;  4QF4 A;  5CV9 A;  1D2B A;  2EQS A;  3RZD B;  2E2D C;  3S14 B;  1LTS D;  2R92 G;  4GOP C;  2PPB C;  2F1M A;  1SDF A;  1JQY D;  1ASY A;  5CGK A;  3KUP A;  1FNV A;  3QOJ A;  4TKO B;  2E2J B;  2PZT A;  1EQR A;  1HH2 P;  3PV0 A;  4Z9C B;  3G6J B;  2A6H C;  2EZV A;  4LFB Q;  3GTM B;  4BY7 B;  2KCN A;  1CZW A;  5K5P A;  4UHV A;  2CVR A;  2JN4 A;  5D65 A;  2D2C C;  1E1O A;  1I6H H;  1XTC D;  1UE5 A;  4GNX B;  1F77 A;  4JI5 Q;  1VQJ A;  3NTK A;  2PZU A;  1CSQ A;  4FYD A;  2DNE A;  1EYG A;  4X3S A;  1IYV A;  4X64 Q;  3CCJ A;  4ALP A;  1I4R A;  2BH8 A;  2OT2 A;  1JR0 D;  1ZXT A;  4R4I A;  3GTL B;  2JA5 G;  3C3L A;  1DOK A;  1TS3 A;  1D8L A;  1STN A;  5EKL A;  3HKZ E;  1SYE A;  4DV1 L;  1Y1W G;  1TWG B;  2N88 A;  1EFI D;  3V96 A;  4XYO A;  4DPG A;  1GUO A;  1RIP A;  2C35 B;  1K73 C;  2R93 B;  2A1A A;  3RZO H;  1VQ6 A;  2PQE A;  1NSN S;  4FF2 A;  2PQA B;  1D7Q A;  4DF7 A;  3PMF A;  3SK6 A;  2F4V Q;  1ZKO A;  2AWN A;  3GTL H;  1RF2 D;  2JA9 A;  5EGT A;  3R3O A;  3I2Z A;  5C3X A;  4K5X A;  3VR2 A;  2EYH A;  3MXN B;  3CCL A;  5EAY A;  3EBE A;  5H1S E;  1SE3 A;  4LF8 Q;  4BS9 A;  1X9N A;  2NZH A;  1E2W A;  2X6L A;  4A3K G;  2N55 A;  2Z1C A;  3R2I A;  5J3B A;  3G48 A;  1BO0 A;  1SE8 A;  2VW9 A;  2I46 A;  2Z4H A;  3S15 B;  3PUV A;  1UEA B;  1XNQ Q;  2UUB Q;  2FXQ A;  4ODG A; 
#chains in the Genus database with same CATH homology
 2HUG A;  3D6W A;  3PO2 B;  2JYO A;  3P1H A;  2KEE A;  2K6A A;  1RTN A;  4ZUJ A;  3MAQ A;  4M1U B;  1EOT A;  3D8G A;  3CRK C;  1EY4 A;  3L9A X;  1G91 A;  4O42 A;  2XN9 C;  4B08 A;  1DJR D;  4YIJ A;  3M4Y A;  2B8G A;  1JC7 A;  4DAP A;  1R4Q B;  1B1Z A;  3A55 A;  4PMC A;  4KJO A;  2KVM A;  1NAP A;  4RHR A;  1H9J A;  1SYD A;  3I90 A;  1O80 A;  4G7O C;  1H9M A;  3J7A V;  4J6H A;  3V05 A;  1D1I A;  4K2L A;  4TRD A;  1A3T A;  1STY A;  4RGN A;  1OXV A;  2F0W A;  2EJM A;  4KY6 A;  5JEA J;  5C4X B;  5G3L F;  1QNK A;  1X32 A;  3OOC A;  2F0L A;  2VB3 X;  1DOL A;  3S1M B;  5C3W A;  3IKJ A;  1ICW A;  2LKV A;  1E0B A;  2F0O A;  3JAM E;  3WOE A;  3KK7 A;  4A3K B;  1XYI A;  3BVM A;  2Q8R E;  3MXN A;  5EJW A;  1J8I A;  1V43 A;  2EY2 A;  3ERO A;  2Y0S B;  1SNM A;  2B2V C;  2F0P A;  2L5T A;  2EPB A;  4MHE A;  2F0U A;  4XT1 B;  3K57 A;  2A6H D;  3IAY A;  4CJ0 B;  4F87 A;  5T1G A;  3T16 A;  1TY0 A;  2NN6 G;  1TT2 A;  1OXU A;  1FGB D;  5HUR A;  1F9Q A;  1PMR A;  2JEB I;  5CBA E;  3HOZ B;  5IT9 E;  4CKC A;  2A69 D;  3H3V C;  3KLS X;  3BZD B;  3CRL C;  2K04 A;  5I2Y A;  2NVY B;  2V4D A;  1GUN A;  1TWH B;  1I3Q B;  4WFN 3;  4TQU S;  5C0X J;  1AW7 A;  5A35 A;  1PDQ A;  1KAA A;  1RHP A;  2PCF B;  4H13 C;  5DAU A;  5M9O A;  3PUX A;  2EYP A;  4A3B B;  1XX8 A;  1SYC A;  1Q12 A;  1BDO A;  1LT5 D;  2LMC B;  3AB9 A;  1EIH A;  4G7H C;  4NP5 A;  4DXG A;  3OIP A;  2NVX B;  3I70 A;  2NBF A;  5FO9 B;  2F0F A;  2XSC A;  1KNE A;  2KQ3 A;  2A6E D;  3I72 A;  1KAB A;  1W6K A;  1KNA A;  4BBS B;  3NWS A;  1IHZ A;  4N9T A;  2F03 A;  1FD7 D;  3TSS A;  2JA7 B;  3TP5 A;  5KND A;  5IGB A;  1CA6 A;  4A93 B;  3DEP A;  1SE4 A;  5EKI A;  3A56 A;  2MHV A;  2BE5 C;  4K14 A;  3TME A;  2L55 A;  5EPL A;  1I4X A;  3NTI A;  2O5J C;  1PRT C;  2R61 A;  1QJO A;  3T56 B;  2FMM A;  1KDA A;  4BY1 B;  1LTR D;  1HQR D;  4XXE A;  3VYU A;  2CW0 C;  2TSS A;  1JOR A;  4RFB A;  5DM7 3;  5FOB B;  4FXD A;  2O4X A;  5KRU A;  4BA2 I;  1ENC A;  4PNY A;  3EVQ A;  3NWT A;  1EL0 A;  2R6G A;  5C0X H;  4P2C B;  1S5F D;  2FHT A;  2C5C A;  2G9D A;  4ME5 A;  3S16 B;  3NBI A;  4C2M B;  3K5O A;  2F0H A;  1AFP A;  3H91 A;  3J81 E;  1ENF A;  4R8I A;  4I65 A;  1XXG A;  3QOL A;  2JA6 B;  1K83 B;  1STG A;  3GTO B;  1OXX K;  2B8F A;  2HCI A;  5I6Y A;  1PZK D;  3MXG A;  3S9W A;  5I6W A;  1LV9 A;  4RKB A;  2JEA I;  5BN4 A;  5CR3 A;  1S5D D;  4C3H G;  2A68 D;  4EGV A;  2MUY A;  1EWC A;  3OSO A;  5M5X B;  2FJ2 A;  4C1N I;  3OMC A;  4KV6 A;  4PMB A;  1BF4 A;  3PUY A;  4WRD A;  1BCP B;  2K28 A;  3GV6 A;  5EKK A;  4FXG C;  1PTO F;  4OO1 H;  2QKI C;  1G2S A;  3GQB A;  3LWU A;  1RTO A;  3U9O A;  4HCS A;  2F0I A;  4IFD I;  4KKS A;  1XWE A;  4KY7 A;  4IN3 A;  2O2L D;  3GTK B;  3C2P A;  4QIW B;  1A2T A;  5FLX L;  1WTW A;  2QDB A;  2KJX A;  1LO5 D;  3VR4 A;  1MBY A;  4XQN A;  3CQZ B;  3HOY B;  2XRS D;  1EQT A;  4FO2 A;  3SK4 A;  1EIG A;  4K6L A;  1JIC A;  4PQX A;  1A3U A;  5F2D A;  4DK0 A;  5I4D A;  5M3F B;  3DHQ A;  3KF8 A;  1HA6 A;  2RDF A;  3BYT B;  1U4L A;  1HRJ A;  4DNT B;  1VCI A;  3HOX B;  3EQL C;  4RAU C;  3CHB D;  2HQE A;  3GTP B;  1IW7 C;  1DOM A;  1LTA D;  3D4D A;  2JE6 I;  3PO3 B;  2NB0 A;  3NE5 B;  5DNF A;  3HOW B;  2B2W C;  3J7Y W;  1SAP A;  3MEH A;  1WTO A;  1Z47 A;  3K59 A;  1PFM A;  2G9H D;  3OIQ A;  2E74 C;  2A68 C;  2RBM A;  4HTH A;  3DXJ C;  2QEJ C;  4QUF A;  1ZYR C;  4E6I A;  1SMY C;  1FNW A;  2D5D A;  1Z7T A;  4A3G B;  5E4W C;  4QCL A;  1MSG A;  1TVX A;  2H1E A;  5CMD A;  1JOK A;  4J1M A;  1VDZ A;  1HHV A;  1LT3 D;  1YNN D;  1IW7 D;  3VR5 A;  2NTS A;  4XTC S;  3RD4 A;  5A2Q L;  1KLU D;  4EQN A;  3PIO 3;  2LFN A;  4IUT A;  1G6Z A;  1BNZ A;  1JWM D;  4L6T B;  2NVQ B;  1CTM A;  5JPN C;  5C0X G;  1OO9 B;  3K5N A;  3KLR A;  4DN4 M;  2F0D A;  3Q23 A;  3OWE B;  3MTS A;  1O7Z A;  1FYC A;  3RMH A;  2B2V A;  3K0Y A;  4R9W A;  4X3K A;  2B2U A;  3GTJ B;  1HCZ A;  1D5X C;  5IOD A;  3F2U A;  3O13 A;  2WKD A;  1STA A;  2E75 C;  2PNR C;  3KBX A;  1I4G A;  3Q6S A;  2JA8 B;  5EPJ A;  3SEB A;  1IKM A;  2IWH A;  4FF3 A;  5E1F A;  3A7L A;  1CHP D;  4IAL A;  1Q8I A;  1CK1 A;  2AQ1 B;  2RDG A;  1H9R A;  1QE6 A;  1EU4 A;  5BN3 A;  1EYC A;  2LY7 A;  5CV5 A;  2EJG C;  1EYA A;  4HMI A;  1IKL A;  4KY5 A;  4RCO A;  1HUM A;  3R93 A;  1JWS D;  1VMC A;  1T5E A;  4A3I B;  3QG1 A;  1AZP A;  4ZK9 B;  1EY7 A;  1G8Z D;  5C5M A;  1V1P A;  5KGU A;  1A6X A;  3I8Z A;  1QOH A;  4IZ8 A;  2FIN B;  1OXS C;  3ERQ A;  4L63 B;  4RKL A;  1I4H A;  1GXD C;  3FRP B;  5FK9 C;  3TP6 A;  2QIL A;  5C4J B;  3C46 A;  5IGD A;  1TII D;  5M5Y B;  4F88 A;  1Y1W B;  3BDC A;  5J22 A;  2JA5 B;  2AQ3 B;  1TS5 A;  2IX0 A;  1X3P A;  3C1F A;  1QB5 D;  2FFK B;  2KCC A;  5M3M B;  4JBW A;  2B63 B;  1B9N A;  1A15 A;  1MI2 A;  5CV4 A;  1PTO B;  4RCN A;  3SVM A;  1H9S A;  4V19 0;  3H6M A;  3UI2 A;  4FP5 D;  3X3N A;  3H0G B;  1TKW B;  3DEO A;  1YNJ D;  3MFG A;  3NSW A;  1C4Q A;  2SNS A;  3SDZ A;  2B2T A;  4OL7 A;  1T5X D;  1WTR A;  1FNU A;  3LX0 A;  1HTP A;  2E2I B;  4ZUI A;  3FPU B;  2I07 B;  1HTL D;  2F0E A;  3AMU A;  4CGY B;  1SNP A;  1SXT A;  1QWY A;  4DAY A;  3VA5 A;  2OEO A;  3ND9 A;  4IQZ A;  4KHV A;  2F0M A;  1EY9 A;  3AU7 A;  3D4W A;  4KJN A;  1CFM A;  1SMY D;  3I91 A;  3BS1 A;  1U4R A;  5C3E B;  3TP7 A;  3OPO A;  3N52 A;  3A8K E;  1ENA A;  1BXT A;  1BCP F;  3TZU A;  2K5W A;  1KDB A;  2K33 A;  2L11 A;  1LLR D;  4ZKC B;  5NUC A;  1QG7 A;  2L9H A;  1DON A;  5EPK A;  2F0T A;  2K5Q A;  3SR1 A;  1SYB A;  4XQQ A;  1A3V A;  1FR3 A;  2KED A;  4OIJ A;  4CJ2 C;  3GV3 A;  1BBX C;  2R7Z B;  2C9O A;  4KI0 A;  4DA2 A;  3IFT A;  4C3I B;  2WB1 B;  5KYL A;  4LMQ D;  4A3F B;  5M5W B;  3FMC A;  4IFD H;  2ZXO A;  5A2Q E;  3RZO B;  3K5L A;  4F7X A;  1B3A A;  4FF4 A;  2EE1 A;  1Q1B A;  3SE0 A;  5IOC A;  5COY A;  1H9S B;  4CHT B;  1Y1V B;  3D31 A;  3PUW A;  1Y8O B;  1SND A;  1MD2 D;  2E76 C;  3DWP A;  5CV6 A;  3LNN A;  4N9P A;  3WDN A;  1IYU A;  3S2D B;  5I9P A;  3MXP A;  2ICE C;  2L1B A;  4RH6 A;  1STB A;  4C56 C;  1WTP A;  2PW7 A;  2GA4 B;  2XIW A;  3GO5 A;  2ZXR A;  2B2W A;  1UNS A;  4RA8 A;  2ID0 A;  3GD7 A;  2L4N A;  2TMP A;  4HSV A;  4G4K A;  1QCB D;  4Y7N B;  1SJH D;  1RJT A;  1I4Q A;  1V1P B;  4ZKB B;  3JAM L;  2AQ2 B;  2CQA A;  2QF7 A;  5LL6 S;  3VYR A;  2L12 A;  2K05 A;  1GOZ A;  5E4X A;  1JB3 A;  4X3U A;  4L8J A;  1M8A A;  5KIX A;  3NUC A;  5AFW A;  4UAI A;  3M4O B;  2MGS A;  1Y8P B;  3L7Z C;  2BA1 A;  2EXZ A;  4R8N A;  4BA1 I;  2MPM A;  1W6J A;  2VB2 X;  1LAC A;  4KKT A;  1SFO B;  1I6V C;  1EY5 A;  2M9V A;  4Q5V A;  2QCP X;  2AUK A;  4GZY C;  2A6E C;  3S1Q B;  4DK1 A;  2XWB B;  1BQQ T;  4K5W A;  3G7L A;  5C4H A;  1JOQ A;  1F2M A;  1EZ6 A;  3E5S A;  5C0X I;  2Q8T A;  2NTT A;  3HG9 A;  3TDQ A;  3S1N B;  1B50 A;  4JK1 C;  2K01 A;  3NK9 A;  5D14 A;  2E2H B;  4HMJ A;  1HQM C;  2RSO A;  5FKA C;  4BBR B;  4KK7 A;  1F2Z A;  2EJF C;  1EWH A;  1L0Y B;  1TWF B;  1D1K A;  2CHB D;  3HS0 C;  2JP1 A;  2RQX A;  4OO1 G;  1D5Z C;  3DWQ A;  4K5V A;  2WV6 D;  4ABN A;  2PW5 A;  5J39 A;  3H94 A;  5D3I B;  5EBD A;  3M7N A;  5K36 H;  2X69 A;  3TN2 A;  2OXP A;  1GHK A;  1O7Y A;  2B2U C;  4ZLT F;  1TS4 A;  5C6A A;  2SNM A;  1ONL A;  2F0V A;  1TR5 A;  1JE4 A;  1YNJ C;  4RWS C;  1JOO A;  1MGS A;  1CT1 D;  1V8Q A;  1M4V A;  2A74 C;  2NYZ D;  3A8I E;  3VA7 A;  5CV7 A;  5LL6 X;  5CV8 A;  1U4P A;  1GUG A;  2EYJ A;  1PTO D;  1ET6 A;  4LJZ C;  1II3 A;  2WAQ B;  4KD3 A;  4TSS A;  1HFG A;  1PRT B;  5JVH 3;  3MVV A;  3MFY A;  2M2L A;  2SEB D;  4KN7 C;  5ELE A;  4LK1 C;  3QJY A;  1B9M A;  4FNF A;  1PZJ D;  3NQT A;  2PMZ B;  2K5D A;  2RDH A;  3HOU B;  2D9U A;  2H4O A;  2JXM B;  1R4P B;  4KN4 C;  3HOV B;  3S17 B;  3BDL A;  1K8O A;  1R9T B;  3I73 A;  1A2U A;  1AN8 A;  1TY2 A;  4H44 C;  2EY6 A;  2IL8 A;  4C3J B;  3P7J A;  1KDC A;  2SDF A;  3ZYY X;  1SSO A;  1MSH A;  4MN3 A;  4IUN A;  1LAB A;  1ML0 D;  4A3E B;  1E2V A;  5CYU A;  2WKC A;  5LHY 1;  3MZ5 A;  2RVL A;  3ITP A;  4B9X A;  2NN6 H;  2LS0 1;  4CBV A;  1GUW A;  1HFN A;  4KMU C;  3NXW A;  2NZ1 D;  5ELC A;  5ELB A;  1X3Q A;  5D3D A;  3A7A B;  3J7A F;  2K1B A;  1F2L A;  2WIN B;  3PIP 3;  3GTG B;  1Q90 A;  1IL8 A;  1I50 B;  4F8M A;  2XNA C;  4ZRZ A;  3I4N B;  1V1O A;  3H09 A;  5I9O A;  5JOB A;  2Q8I B;  2O5I C;  4IUR A;  4EQO A;  5G3L D;  1BCP C;  2F0N A;  1ZEQ X;  5EQ0 A;  5KYI A;  2BA0 A;  4G7Z C;  2ZT9 C;  2NUC A;  4DGZ A;  1NR2 A;  4BWG B;  4CKE A;  4H7B A;  2IX1 A;  2NVT B;  1F2Y A;  3R8B A;  3MA2 B;  2BDO A;  2YU9 B;  1NR4 A;  1ESR A;  1DZ1 A;  1STH A;  1ZYR D;  2ENB A;  5JEA G;  4V0B A;  3TBI B;  2XVS A;  3C1E A;  3OMG A;  4HCE A;  1AP0 A;  3I3C A;  2IX3 A;  1YNN C;  3EFX D;  4XT3 B;  4KTA A;  1EY0 A;  2X6G A;  3VR6 A;  2K03 A;  1DD2 A;  4MIU A;  3ONA B;  2CW0 D;  4IUQ A;  4KKU A;  3L3O C;  1RDP D;  2EOT A;  5ELF A;  1Q3L A;  5C44 B;  1LTG D;  2F0Q A;  1SYF A;  4IUU A;  4XIG S;  3J80 L;  1U4M A;  2F0K A;  4ZYS A;  3P75 A;  1CHQ D;  2IPK D;  1NCV A;  3V2T A;  4WJW A;  3D6C A;  4PMW A;  1EY8 A;  1OXT A;  1DXM A;  1STE A;  2B2Y C;  1L0X B;  3A8J E;  4A3M B;  3HGB A;  3GP7 A;  2A69 C;  2F3W A;  4EVO A;  2IJ0 A;  2VNU D;  5T1I A;  2KA7 A;  1F9P A;  4A3D B;  1D6E C;  4K6D A;  3SHL A;  3CKI B;  1TS2 A;  3Q22 A;  2RKS A;  5IGG A;  3A54 A;  1ROD A;  4OHJ A;  4ULL A;  4OIK A;  4HR7 B;  1Y8N B;  1CQF A;  4NW2 A;  1GHJ A;  2DY7 A;  2NN6 I;  1B2T A;  5FO8 B;  2DNC A;  3IL8 A;  1EEI D;  1E2Z A;  1GUS A;  2RSN A;  2XWJ B;  4C3H B;  1WTX A;  1AEX A;  2EVB A;  3NHH A;  1VF5 C;  4FXK C;  4IFD G;  1BUV T;  4KD4 A;  3GTQ B;  3D4R A;  2DN8 A;  1K8M A;  2HDM A;  5BN5 A;  3MC0 B;  3M3Y B;  3FVQ A;  2EY1 A;  2KOL A;  3DM1 A;  1Y69 U;  2A73 B;  3X3M A;  3HEJ A;  1HPC A;  2BCO A;  2DY8 A;  3R2T A;  3T4A C;  1CZG A;  1PFN A;  4RHS A;  4C3I G;  3BYY B;  1HA5 A;  1SNC A;  1SE2 A;  1SNQ A;  2HCC A;  2D62 A;  4HN7 A;  1CI3 M;  2EDG A;  3J80 E;  3S1R B;  2YYZ A;  3D3R A;  3T13 A;  2KHS A;  1KLG D;  1UAP A;  2EYL A;  2EYF A;  4H0L C;  4HAE A;  1SYG A;  1WCM B;  4K2K A;  1SNO A;  2VXW A;  4XQJ A;  1BOS A;  4ZQ3 A;  1TWA B;  1UUP A;  4QB4 A;  2RA4 A;  3W2D A;  1VF7 A;  2VUM B;  1SJE D;  2Z4I A;  2AWO A;  3N6R A;  3DUZ A;  3W3A A;  4PV1 C;  1G2T A;  5IIF A;  1CQV A;  3ND8 A;  2IT1 A;  4DXF A;  1EQV A;  1GJX A;  3OW7 A;  3NTH A;  4OGQ C;  1TQO A;  1I4P A;  1QNU A;  5CBE E;  5TSS A;  4RGT A;  4RGO S;  4ILW A;  3DMU A;  5I2X A;  2EYO A;  2KUM A;  5HGT A;  5K36 G;  3QWN A;  2WAC A;  1AZQ A;  4C1N K;  1S4Z A;  3FDT A;  4ZAI A;  1RD9 D;  1CM9 A;  1PZI D;  4J8Q A;  1B44 D;  4NMZ A;  2K32 A;  5KEE A;  1DCZ A;  1JCK B;  3CU7 A;  1EY6 A;  3NQI A;  3K5M A;  3Q0A A;  2F0J A;  1U9R A;  3VYT A;  1PXU A;  3SXH A;  1RKN A;  5DEH A;  5IGF A;  1ESF A;  4DFA A;  2EYM A;  1BCP D;  4NKL A;  1EEF D;  4IUV A;  3BG3 A;  1RCV D;  2BDN A;  4IUP A;  4NDX A;  4XDX A;  1PLF A;  5KNB A;  4AYB B;  4DAV A;  4ID6 A;  1TWC B;  3E0J A;  3K6O A;  1Z6H A;  3EA6 A;  4K8I A;  1D5M C;  1C48 A;  4IFD J;  4OO1 I;  3U9S A;  4M8A A;  4HSP A;  2JSO A;  2L0C A;  1O78 A;  3K58 A;  1I6H B;  5C4Z A;  4QMG A;  2OF1 A;  1G29 1;  3VYS A;  5ELD A;  1F9R A;  1B53 A;  4UDU C;  2ICI A;  3I4L A;  2MJ8 A;  4I7Z C;  3TP8 A;  5EBC A;  3NPP A;  2J7Z A;  2KEC A;  3NP8 A;  1EU3 A;  1PRT D;  3J81 L;  1LT6 D;  4X3T A;  3K7A B;  3S2H B;  2A5H A;  1LTB D;  5FO7 B;  2J4X A;  1ILQ A;  1CA5 A;  4G57 A;  1ET9 A;  1O7L A;  2WII B;  1EYD A;  3KLS A;  4QUC A;  1GUT A;  5J1Z A;  4K8J A;  2HDL A;  4O1N A;  3QIA A;  3LWE A;  3MHB A;  5E3F A;  2XRQ D;  1WVL A;  1S5E D;  3RLF A;  4S3S A;  3BVZ A;  3SK8 A;  1LTI D;  3T53 B;  3HRZ C;  1J9O A;  4DU9 A;  2EY5 A;  2R92 B;  2BE5 D;  5IT9 L;  2Z8L A;  1HXY D;  2AUJ D;  5JAV A;  3URY A;  2R3Z A;  3Q24 A;  4XYQ A;  1DYQ A;  3EJI A;  3HP3 A;  2PZW A;  3QO2 A;  1Q1E A;  3OWF A;  2ZXP A;  4WOR A;  5IGC A;  4HED A;  1BR9 A;  2PYK A;  2SOB A;  4CJ1 B;  3BDO A;  3VR3 A;  1VMP A;  3I4M B;  1DM0 B;  3PUZ A;  5ISR A;  1PRT F;  4A3J B;  3WOF A;  5DM6 3;  4CKB A;  1WD1 A;  2F0G A;  2K7V A;  4B9W A;  2B2T C;  5C5L A;  3SK5 A;  1B4O A;  4FVM A;  2IW3 A;  5JJZ A;  3RUZ A;  1H9K A;  2WP8 J;  1S5C D;  1PTO C;  2FMC A;  5JEA H;  4U67 3;  4C3J G;  2MP1 A;  4U68 A;  3MXU A;  4EQP A;  1C8C A;  4FF1 A;  1SEB D;  3OHX C;  2NWG A;  1PFB A;  1PTO H;  3T51 B;  3TZD A;  3IFD A;  2M00 A;  5COR A;  4KHZ A;  1JWU D;  2B39 A;  5IGE A;  3DWA A;  1WD0 A;  1EZ8 A;  5JPM C;  3FEW X;  5KNC A;  3HKZ B;  1WTQ A;  3BVG A;  1NUC A;  1WTV A;  3FKI B;  2BOS A;  2PO4 A;  1QIL A;  3E6Z X;  3M85 A;  2F4I A;  1LT4 D;  2J0T D;  1PYW D;  1ILP A;  3KBG A;  1TU2 B;  1LTT D;  1KTK A;  1SBB B;  4Q0F A;  5JVG 3;  3M7G A;  5CC4 A;  1F9S A;  1S5B D;  3P20 A;  2B2Y A;  3NBH A;  3MWY W;  2F0S A;  4DNR B;  5FLX E;  4RGM A;  1HUN A;  3QB3 A;  4LAA A;  2F3V A;  3HZX A;  3FPP A;  4QF4 A;  5CV9 A;  1D2B A;  3RZD B;  2E2D C;  3S14 B;  1LTS D;  2PPB C;  2F1M A;  1SDF A;  1JQY D;  5CGK A;  3KUP A;  1FNV A;  3QOJ A;  4TKO B;  2E2J B;  2PZT A;  3PV0 A;  4Z9C B;  3G6J B;  2A6H C;  2EZV A;  3GTM B;  4BY7 B;  2KCN A;  1CZW A;  5K5P A;  2CVR A;  5D65 A;  2D2C C;  1XTC D;  1F77 A;  3NTK A;  2PZU A;  4FYD A;  2DNE A;  4X3S A;  1IYV A;  1I4R A;  2OT2 A;  1JR0 D;  1ZXT A;  3GTL B;  3C3L A;  1DOK A;  1TS3 A;  1STN A;  5EKL A;  1SYE A;  1TWG B;  2N88 A;  1EFI D;  3V96 A;  4XYO A;  1GUO A;  2R93 B;  2PQE A;  1NSN S;  4FF2 A;  4DF7 A;  3PMF A;  3SK6 A;  1ZKO A;  2AWN A;  1RF2 D;  5EGT A;  3R3O A;  5C3X A;  4K5X A;  3VR2 A;  2EYH A;  1SE3 A;  4BS9 A;  1E2W A;  2X6L A;  2N55 A;  2Z1C A;  3R2I A;  1BO0 A;  2I46 A;  2Z4H A;  3S15 B;  3PUV A;  1UEA B;  4ODG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...