1A6XA

Structure of the apo-biotin carboxyl carrier protein (apo-bccp87) of escherichia coli acetyl-coa carboxylase, nmr, 49 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
87
structure length
87
Chain Sequence
MEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the carboxy-terminal fragment of the apo-biotin carboxyl carrier subunit of Escherichia coli acetyl-CoA carboxylase.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Carrier protein
molecule keywords APO-BIOTIN CARBOXYL CARRIER PROTEIN OF ACETYL-COA CARBOXYLAS
total genus 7
structure length 87
sequence length 87
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1998-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a6xA00
1O7LA 4KKSA 3DXJC 5JEAH 1FR3A 4KKUA 2DNEA 1IYUA 1GHJA 3T51B 4H0LC 1VF7A 4JBWA 4DNTB 5KNCA 3KLRA 2Q8IB 1Y8OB 3VR5A 4OO1G 3PUWA 1H9KA 3LNNA 2AWOA 3PUVA 1FYCA 3TZUA 2BA1A 5JEAG 4LK1C 3VA7A 1H9SA 2JXMB 4IFDG 2D62A 1OXTA 1OXXK 4I7ZC 2EJGC 3W3AA 3BG3A 2LMCB 1E2ZA 2V4DA 3BDOA 4DK1A 2CW0C 4OGQC 2NN6H 1HCZA 3A7AB 1K8MA 1Q1EA 1G291 5C0XG 1GUSA 1VCIA 3QG1A 4XIGS 5C0XH 1A6XA 1ZYRC 2BE5C 3D4RA 2B8FA 2QF7A 3I4LA 3VR4A 3LWUA 5K36G 1GUNA 1DD2A 1Z6HA 1QJOA 2EVBA 4BA2I 3U9SA 1ONLA 3FMCA 3T53B 3M4YA 4G7HC 3VR6A 1Y8PB 1SMYC 2IT1A 4G7OC 1CTMA 3OOCA 4G7ZC 1O78A 4H44C 3P20A 5KNBA 1BDOA 1E2VA 1CFMA 1Z7TA 2A6HD 1IW7C 2EDGA 4GZYC 1H9MA 1Q90A 3VR2A 2D5DA 1H9SB 4XTCS 1OXSC 1GJXA 4KHZA 1T5EA 2E75C 1LACA 1GUOA 4OO1H 2YYZA 3L7ZC 3HGBA 3PV0A 1DCZA 2D2CC 2DN8A 1Q1BA 3EQLC 3IFTA 2ZT9C 1HPCA 4KKTA 2A68C 2BA0A 1V8QA 2DNCA 2K32A 4H13C 4L8JA 4LJZC 4BA1I 2JEBI 2A69D 3OPOA 1IYVA 3SDZA 1Y8NB 1TKWB 3ND9A 3MFYA 1OXVA 3I73A 3FPPA 3GQBA 1B9NA 1EWHA 4TQUS 5A35A 2BDOA 5BN5A 4KI0A 2KCCA 1B9MA 2EJFC 1TU2B 2A69C 2E74C 1H9RA 2PPBC 5BN3A 2NN6I 4KN7C 4PV1C 3GD7A 1PMRA 3M7NA 1V43A 4DNRB 1GUTA 3N6RA 1GUGA 3WDNA 5BN4A 3A8JE 2A6ED 3T56B 2AUJD 3QIAA 4RCNA 1ZKOA 3PUZA 3CRLC 3A8IE 2JE6I 1LABA 1OXUA 1VDZA 2A68D 2K7VA 3I72A 3M85A 2A6HC 5KNDA 2JEAI 3A8KE 3RLFA 4IFDH 1GHKA 1HQMC 2O5JC 1CI3M 3A7LA 1VF5C 1YNNC 2BE5D 5K36H 1K8OA 4KMUC 4TKOB 1I6VC 2E76C 3NE5B 3AB9A 4DK0A 4HR7B 3PUXA 1H9JA 2A6EC 1IW7D 2NN6G 1YNJC 3IKJA 4IQZA 3SE0A 1Q12A 2O5IC 3ND8A 4JK1C 2B8GA 3H94A 3CRKC 2L5TA 2PNRC 3D31A 2PCFB 3QJYA 1Y69U 1DXMA 1E2WA 2R6GA 3PUYA 2AUKA 2EJMA 2F1MA 3OW7A 2KA7A 3VR3A 1HTPA 4KN4C 3MXUA 2K33A
chains in the Genus database with same CATH superfamily
3SK6A 3BZKA 1B1ZA 4J15A 4DV0L 4JI5Q 2PQAB 4KKUA 4GKKQ 2DNEA 4RHSA 4DN4M 3NQTA 2JN4A 4HMIA 4JI8L 4FYDA 2KEDA 2Z1CA 4FF2A 3J81j 1PH9A 1Y8OB 5IGGA 3S1NH 3PUWA 1STGA 4LFCL 4HAEA 4A93H 2C5CA 3BVZA 4L5SA 3F2CA 1VQ7A 2CW0C 4YIJA 2IHFA 4AQYQ 3DWAA 2QF7A 1YJNA 2R61A 1EIYB 1I6HB 4Q0FA 4NPSA 4B3RQ 1SR3A 4BA2I 3U9SA 1JWUD 1ONLA 1PRTB 1YZ6A 3W1GA 2K5WA 2KEEA 1M1KC 3GTLH 1XWEA 5D3IB 4IO9A 1E2VA 4WJ3M 1ZYRD 5C4XB 2IY5B 4LF8Q 2R92G 3PF4A 3KLWA 3SEBA 1N36Q 1XJVA 4IN3A 3QR8A 3G4SA 1E22A 1DJRD 1HJPA 4KV6A 2ZT9C 3F1ZA 5LMUL 4DV2Q 2BA0A 1HQRD 4DV0Q 2VW9A 3PO3H 1UEBA 2YTYA 1BCPB 1LV9A 3SDZA 4QCLA 5JAVA 1TR5A 1XNQQ 5HY6A 4A3DH 3HG9A 2I07B 4N8FA 3ULPA 2NBFA 2GVAA 5I9PA 1PLFA 1Y14B 3J7ZC 1PH7A 3URYA 2JK8A 1KL9A 3CRLC 5CBEE 5C3EG 3WOFA 2EYFA 3O13A 1KLGD 3E3XA 4C3HH 4QY7A 4HJ9A 1EQQA 2BE5D 2TSSA 1VQAA 1EOVA 2O2LD 2QGQA 5C3WA 3I4NB 4DAYB 1B4OA 5IYCG 4LNQA 4FP5D 4HMJA 1VQIA 5KGUA 3SVMA 1A3VA 4UPAA 1Q86C 1HFGA 3HOUH 2G9HD 1L0WA 1TXYA 4DF7A 3I55A 3DXJC 3MXGA 5EQ0A 2H5XA 3D6WA 3OWEB 4J6HA 1LTRD 1MIUA 2E2IB 3NENA 2PO4A 3HRZC 3MXNA 2F3VA 1LTGD 5FO7B 3UDXA 1HR0L 4HCEA 1RTNA 5C5MA 1B3QA 1IXRA 2FMMA 2NN6H 3A7AB 4XIGS 2SNSA 1RHPA 4PMBA 1ESFA 3KF6B 1A63A 2A5HA 1RD9D 1AFPA 1STEA 4G7OC 5EBCA 2N49A 1CTMA 3UDIA 4DUZL 4A3EH 3EROA 1S4ZA 4DV7L 2OWOA 3R2TA 1Z7TA 2YTVA 3C1FA 3FEWX 3ITPA 1I94L 2QDBA 2VQFL 3HOVH 3ERSX 5C44G 4LF6L 1XTCD 2L1BA 3ER0A 1TWHH 4DR7Q 1HA6A 1BVSA 2D2CC 5CV4A 1MJEA 3GTMH 1F2ZA 2B3GA 2JA7B 3MC0B 1NMGA 1TKWB 2MJ8A 4BBSG 4N9TA 5ELBA 3MFYA 5FLMH 1N32L 5A35A 2K05A 3N52A 1FD7D 2UU9L 4K5VA 5IP7H 3BVGA 4HIMA 1JOOA 4KN7C 1SYGA 2FINB 3S24A 5M3MG 3SK4A 5GADC 1XMOL 4YCWA 2L4NA 5GAGC 2AUJD 2BOSA 1TWCB 3FKIH 1D7QA 2K7VA 1C48A 3S1QH 1JMCA 2F0UA 1C0AA 4NKLA 2A74C 3R2IA 4OELB 1AW7A 1CI3M 1AE3A 1GVPA 2JP1A 2JJQA 5DNFA 5BR8L 4JI4L 5IYDH 2EY6A 4KTAA 2R93G 2CFMA 1Q12A 3GV3A 2F0HA 4NMZA 3MA2B 3BU2A 1SNMA 1LYLA 2F3IA 3A56A 1PFNA 3I4NG 4A3FG 1Q46A 3RN2A 2PZUA 3K5NA 4R4CA 2K33A 1VQJA 1PRTD 3AEVA 5IYBG 1VQEA 4HJ5A 3EA6A 1SNPA 4K8IA 3CW2C 3NP8A 4HN7A 2ALYB 3MWYW 4LFAL 3MZ5A 2UUAQ 4POFA 1LTTD 5JOBA 3KYHC 4FDBA 3H3VH 5CYUA 2YU9H 4IPHA 1F9SA 4LW1A 4QB4A 4IUUA 5JEAG 4OWXB 3PSIA 1YHBA 4ZLTF 5COYA 4A3IB 2XWBB 1CQVA 2ZJRA 1DYQA 1WOCA 2LXJA 4FXKC 2R7DA 3A55A 4P74A 3S1RH 3K5MA 5CV7A 1VQGA 3LWUA 1Z6HA 3U50C 3NXWA 1WTWA 4L6TB 1RIPA 2KCNA 4KLKA 3DEOA 3AQQA 3Q23A 3NUCA 4G4KA 1LT5D 3PIP3 3KUPA 4A3IG 2VS1A 4K6DA 1YITA 2F4IA 1HR0W 4XTCS 1GJXA 3C3LA 1PFSA 5J1ZA 4X6AH 3UDFA 3CC2A 2EYJA 1BQQT 3E0EA 2HHHQ 4BBRH 2K32A 3HOYH 4RHRA 3QO2A 3DWPA 2FFKB 4RFBA 1S5CD 5C5LA 5FLMG 2VQEQ 4KJNA 2BCOA 2L11A 3BJUA 2PNHA 3BZCA 3EVQA 1KIXA 5IWAL 4ZAIA 4H02A 2MFIA 2B2VA 4B9XA 1N33L 4X64Q 1JC7A 3QIAA 4K5XA 3PIO3 1I3QB 3M4OH 1XTDA 1D1KA 5IOCA 3A8IE 4A3EG 3C2PA 2O4XA 1J9OA 3K8AA 3GP7A 4XQJA 2VUMH 3V96A 4CDEC 2NTTA 4OEMB 1RJTA 3IKJA 1SE2A 5C6AA 2JA8H 1JT8A 4UP7A 3J7A5 1RODA 2H1EA 2F4VQ 2AWNA 1VS0A 3SHLA 3NWTA 1WI5A 3OW7A 3MXUA 1S5FD 3DLLA 4GS3A 5JEAH 2IW3A 4X3SA 4C56C 1Y1VG 4DK3C 4HEDA 2PYKA 1JJCB 1ML0D 3CCMA 3PGZA 2AWOA 1X56A 4JI3Q 2N78A 1HZBA 2JYOA 3J7YW 2K5HA 1EY5A 2QCPX 4JYAL 2EOTA 1G2TA 3T16A 3OWFA 4YWMA 1EYCA 5T1GA 1CHPD 1QVCA 1GUNA 1QJOA 1I6HH 3RN5A 4QMGA 3RLOA 1CHQD 2VNUD 2JA7H 4R8IA 1SYBA 4X3KA 1FNUA 5D65A 2ICEC 1R4QB 2L55A 1EY4A 4A3FB 1I94Q 1X3FA 2DY7A 2L12A 2KBNA 4RG1A 3J7AV 2D5DA 4KD4A 1BO0A 4DPGA 2UXCL 2PI2E 2R93B 1GUOA 1ET6A 1J5EQ 3HFZB 4A3CG 1EIGA 1W3SA 4GKKL 3HZXA 4A3DB 4BA1I 4G57A 3PMFA 2Z4IA 1WTHA 1HUNA 4F87A 3FP9A 3EBEA 4FF1A 3I73A 2IWHA 4X65Q 1B9NA 1STAA 3T1HQ 2KENA 1N32Q 1QILA 1ASYA 3HOWG 3RMHA 3AFPA 4MIUA 3CD6A 1GUTA 3MTSA 2PMZB 2RCFA 5BN4A 1NSNS 1N34L 3MFGA 1NCVA 1G91A 4WJ4A 3M85A 4YY3L 5NUCA 5FKAC 3TS0A 1J6QA 4O2DA 1D8LA 1PFMA 5CV6A 3KOJA 3TS2A 5CBAE 4QQBX 5C44B 1SROA 1MD2D 4OWTB 2B8GA 1BXTA 2CH4A 2KUMA 3D31A 2M2LA 1I4PA 1N36L 2KA7A 3K58A 3RNUA 1WD0A 4Y7NH 4A3GB 2ENBA 2F0NA 1PH4A 1X9NA 2IX1A 4DAYA 5E4WC 4B3MQ 1RKNA 1WCMG 1GOZA 1LUZA 2ZTDA 3A0JA 2Q8IB 3C1EA 4IFDI 1SLJA 1WTQA 2B63B 1EEID 5IP7G 1KRSA 5LMNW 4NP5A 1CM9A 4P71A 3CCSA 5JJZA 1OXXK 3S17H 4PZ6A 4ODGA 1I50H 1C7YA 1E24A 3KLSA 1JCKB 2DUDA 2LMCB 4A3GG 1Q8IA 4C3IH 1SJHD 4YY3Q 4X66L 2XSCA 3I4LA 5LMNL 1GXDC 5M5XB 1DD2A 2K6AA 2RA4A 3X3NA 4ZYSA 3DM1A 2F0JA 1HHVA 3OIQA 1CFMA 1QNKA 4GLVB 2UUCQ 1W6KA 4XQNA 3KBXA 2R7ZB 1W2BA 1II3A 1VQFA 3D4WA 3T13A 3ONAB 2QA4A 4OO1H 4FNFA 2KHIA 4XQQA 2C35B 1Q1BA 3HOWH 4IUVA 5IGFA 4H13C 1ET9A 2L0CA 1IYVA 2G5DA 5FJ8H 3RZOH 1STYA 1X3PA 1TS4A 3DEPA 5I2YA 2XVSA 3S1NB 2B2UC 3FPUB 2K5DA 1WCMB 1GUWA 4RGMA 1YNXA 2NN6I 4PV1C 1HR0Q 3HOZH 1K0SA 4LFCQ 4BY7H 1B8AA 1ENCA 2RQXA 1X3QA 3U58A 4R4OA 4DAMA 1K9MC 3PQIA 3J7AF 5I6WA 2NZOA 5FO8B 3NEMA 1SSOA 1PH2A 4JCVE 1GM5A 4AQYL 1GHKA 2XRQD 3H0GG 1HQMC 1VQLA 1T5XD 4MHEA 5K36H 1B2TA 3IFDA 3NE5B 4DUZQ 1PVOA 4HR7B 4WRDA 1JWMD 5KYIA 3M3YH 1DONA 3VA5A 2RKSA 3H94A 4K0KQ 3Q0AA 2YTXA 4EQ5A 2HCCA 1IZ6A 2KCMA 3PIPA 1QWYA 1HNWQ 2NVQB 5C3EH 2AQ1B 5CMDA 3KLSX 3PO2B 5KYLA 3CCUA 4GNXA 2E2JH 4U68A 4LF5Q 2XWJB 4JI3L 4R8NA 1KAWA 2Z8LA 2UU9Q 2LFNA 2BA1A 1IBKL 1HXYD 5M3FG 1JJGA 5A2QE 3S14B 2JXMB 4IFDG 1L0YB 1YJWA 3EIVA 3OHXC 2V1CC 3K7UC 4DV5Q 2Q2TA 4I7AA 1VCIA 4ZCKA 2JA5B 1EY6A 3VR4A 5IP9G 3PIOA 3H3VI 1CQFA 1EZ8A 4IFDJ 3FMCA 5TSSA 3QWNA 3M9BA 3OOCA 3RLNA 1U4LA 4IPGA 3HEJA 1N8RC 5KNBA 1JJ2A 4AYBE 4FF3A 1ENAA 4ALPA 1KNEA 4GLXA 5EBDA 2E75C 1O80A 2B63H 1PH6A 1DCZA 1NJIC 2MP1A 4I65A 1IHZA 2HCIA 3FDTA 2EY1A 2NVYB 1STBA 1YHAA 5JJLA 1Y8NB 3GDEA 1YJ9A 1TY2A 5EKIA 2BDOA 3HKZG 1X54A 1I50B 1NY4A 1Z9FA 5JEAJ 1B9MA 1C8CA 2PPBC 4HSPA 4KK7A 1ZXTA 3I91A 3GTQB 1YBYA 3P75A 3U4ZA 1MKHA 3HOUG 3M7NA 1V43A 3H0GB 4DGZA 5IT9E 3N6RA 1GUGA 5T1IA 3LGJA 2BH8A 3RUZA 4KY7A 3T56B 1XMQL 1SJED 2JE6I 4HTHA 1EIHA 5H1SE 1V1PA 3CCQA 1SFOH 4CKCA 4DXGA 2O5JC 1K0RA 2DGYA 4JV5Q 1STHA 1N9WA 5JVG3 4X3TA 1WTVA 1NTGA 1VQNA 2K75A 3S16H 1DOLA 3CPFA 2B2WC 1NR4A 1CKNB 1AE2A 1UE1A 1DXMA 1FNWA 1K83H 2JA9A 3U4VA 4CBVA 2NYZD 2CQAA 1B44D 3D4DA 2RHQB 1B70B 3G48A 3K0XA 2CH4W 2JA6H 3NPPA 1EY9A 5BR8Q 1YEZA 3TP8A 4F8MA 1QUQB 3K80C 1UE6A 4EQNA 1HZ9A 1PYBA 4HJ7A 1V1QA 4FVMA 1J5EL 1G51A 3F2UA 3W3AA 3JAMc 2PI2A 1JB7A 4MNOA 1E2ZA 4QL5A 4OGQC 3TREA 4JVZA 2IL8A 1QZHA 4OXPA 1GUSA 2G9DA 1WCMH 2Z6KC 2F0MA 4RGNA 1R9TB 3D6CA 3WOEA 2BH2A 1KLUD 1D1IA 1L0XB 1K3BC 3F2DA 3MXPA 4B3TQ 1QE6A 4AYBG 4V0BA 4G7ZC 2K5QA 2P5ZX 3E5SA 1EFWA 4LF8L 3TZDA 2WAQG 2R92B 1H9MA 4N8X1 2B29A 2F0QA 3H3VC 2SDFA 4PG3A 2AMCB 1SNDA 4GNXC 2N8NA 2WB1B 1DOKA 2XRSD 2YYZA 4K2KA 1PH1A 3KJOA 3GTJH 2B39A 1VQOA 4DV5L 1BNZA 4HSVA 1XNQL 1PYWD 2EYOA 2F0LA 4JBJA 2A69D 4KHVA 1SNQA 1EU3A 1EY0A 3KF8B 5I2XA 4L5RC 1EWHA 4BXXG 4O42A 5JPMC 4DR3L 2F0OA 4RGOS 1XX8A 2WAQB 3HKSA 1YNND 4JYAQ 1SDFA 4DNRB 2K04A 2MO1A 4RAUC 5C4JB 4HIKA 3AYHB 3HKZB 4FO2A 1HNZQ 3HOVG 3EN2A 4IUQA 4CGYB 2B2YC 4LF7Q 1GD7A 4QJFA 3L2PA 1LABA 1STNA 1AH9A 2A6HC 3S2DH 3B6YA 3TBIB 1Z47A 2GA4B 1KRTA 3HOZB 1YNNC 3CMEA 3CP0A 2MO0A 4DUYL 1NBWA 3NQIA 2LSSA 1TS3A 2A6EC 3M4OB 1NR2A 3W5OA 2XIWA 3RZOB 4RWSC 3RZDH 1CKOA 1X55A 4K2LA 2ZXRA 4BWGB 4QUCA 4DAPA 2OTLA 1A3UA 2LXKA 3A74A 4F7XA 2WKDA 4N9PA 1IYUA 1ZEQX 4DNIA 2ZTEA 3FHWA 3T4AC 2KECA 1QG7A 2VQEL 1IBKQ 2Z4HA 1H9SA 3HOWB 2M00A 1G6ZA 1Y1WB 4LAAA 1AEXA 4IJLA 4TRDA 4DR6L 4DV1L 2WV6D 1IBML 1O7IA 4DR5Q 1J8IA 1HRJA 5FLXE 1K8MA 1LTAD 1Q1EA 3HOYB 2BE5C 1SN8A 2IPKD 4ZUJA 1Q7YC 1LTSD 3S17B 3STBC 4R9WA 2EY5A 2MHVA 3HP3A 1SMYC 2Q2UA 1CA5A 3BDCA 3D3RA 1O78A 4IPDA 3J80i 4BY1B 2GN5A 4R4TA 2R7FA 2HQLA 2JA8G 1PH3A 2NVXB 1CSPA 2A1AA 5IT9c 1LACA 1I4RA 1EQVA 4IALA 3A54A 4POGA 3NHHA 3E9IA 1U4PA 4JI5L 4B08A 4WORA 4A3KB 2OF1A 5LHY1 2F0SA 1XYIA 3UE0A 4QIWE 1VQHA 4JI2Q 1VMCA 1EFID 4C2MH 1OXVA 1JOQA 3FPPA 5ELCA 5I4DA 5BN5A 1BBUA 1U4MA 3UE1A 1WYDA 2VB2X 3TEHB 3STBD 1D6EC 1RF2D 1TWAH 5CR3A 3K59A 2YU9B 5IE8A 1WD1A 3A8JE 1QOHA 4DR6Q 1A2TA 3CMAA 1QCBD 4B9WA 1EWCA 2PW7A 3I72A 5IGBA 2B2YA 5M5WH 4BBRG 3RZDB 3P1HA 1B50A 4UHVA 4CKBA 1NE3A 1E0BA 1K3RA 4JI4Q 4LMQD 5GAEC 3MXNB 2TMPA 2ICIA 2ATWA 1TWFB 1SYEA 4ME5A 1UAPA 3T1HL 3J81L 4DK0A 5C4HA 4UP8A 3TSSA 1HNXQ 4LUVA 4L5QA 1HZCA 1PFBA 2WFWA 5E7NA 3C46A 4ULLA 1PH8A 3CCVA 1EQTA 1PH5A 1S40A 2WIIB 3FKIG 2A73B 4YCVA 1N33Q 4F88A 2UXBL 2K14A 1SMXA 4JBWA 4DNTB 3TN2A 3G7LA 1VQ6A 1CUKA 1JE5A 4C3JH 2CQOA 4A3BH 4ZKCB 2R7ZG 2PW5A 4A3MG 1BUVT 4DV3Q 3SXHA 5KRUA 1GO3E 4CDFC 2F4VL 2KCTA 1VQKA 1LTID 3QG1A 1HZAA 1MI2A 4UDUC 4CJ2C 2HUGA 4JI8Q 2K5VA 2UUBL 2FXQA 3HKZE 5EKLA 4HJAA 3J81E 4JBMA 2J7ZA 4XXEA 2IT1A 2NZ1D 2UXDL 1C9OA 2NVXH 3D8GA 3OW2A 3CXCA 4A3BB 2EDGA 3G6EA 4K0KL 4BY7G 2XNAC 3SR1A 4TVAB 5JVH3 2DJGC 3QB3A 5J39A 1WTOA 1IL2A 2B63G 3L7ZC 2FHTA 3R93A 2EE1A 3PV0A 2EYMA 4KKTA 1G8ZD 1PA6A 1EYGA 2UXBQ 2D0OA 4GKJL 3KJPA 1F9PA 5JJIA 2QILA 2RDHA 4CJ1B 5FOBB 1Y1WH 2H4OA 1TU2B 1MJCA 1GKHA 5CV8A 2XN9C 3I90A 3PCOB 4RA8A 1I4XA 1BBWA 1BCPF 2E2HB 1TWAB 2VUMG 5FK9C 4IOCA 2RVLA 2ZXOA 5CGKA 1VQCA 2HIXA 1I5FA 1QB5D 3NBHB 1SMYD 4AIMA 1HNZL 1HNWL 1OXUA 1TT2A 2J0TD 5E1FA 3RLFA 4GN4B 4DAVA 5M5WB 2RBMA 4C2MB 5LMNQ 1SXTA 3Q22A 3OSOA 1EL0A 2NUCA 3S16B 2Z6BA 2RSNA 4IOAA 1S5ED 1YVCA 3CKIB 4IQZA 4R4QA 3TP6A 2CCZA 1A15A 3J80L 1A0IA 1SRUA 2UUCL 4ILWA 1UNSA 2PCFB 5ELEA 4C1NI 2R6GA 2VB3X 2AUKA 4XYOA 3S1MB 1M8AA 5C3XA 1SYCA 4KHPQ 4B3TL 4IUPA 2NB0A 2VXWA 1C4QA 4JOIC 4Z9CB 1V9PA 5IY0A 2CWPA 1X3GA 5ISRA 2ES2A 3S1QB 4NXNQ 3OMCA 1TWCH 4DV7Q 1PXUA 3AU7A 4MZ9A 2K01A 3I56A 4P75A 1SE8A 1CZGA 4LUOA 1M90C 4H7BA 2X6GA 4EVOA 1KC8C 1G291 4L5TA 2B8FA 4CJ0B 2F0VA 1IBLL 2E8GA 3J80c 3I70A 2CHBD 1SBBB 1LTLA 1DOMA 3PF5A 4WJWA 3NTIA 4H44C 5IGDA 4DA2A 1FL0A 1IW7C 3V2TA 1B53A 3VR2A 4M1UB 3HOXG 4IUNA 2XGTA 3CF5A 2Y0SB 4JW0A 2I5LX 3F8TA 3IFTA 4LWCA 1HPCA 4A3EB 2DNCA 4C3JB 1R9TH 4A3MB 1V1OA 4O0AA 5ELNA 4LFAQ 3OTOQ 3VYTA 4A93G 3KK7A 2K03A 2NZHA 4TQUS 1MBYA 1WJJA 3I4OA 1PZJD 5DLQE 1S72A 4RGTA 4DXFA 2E2JB 1I4HA 2CKZB 1Y1VH 5KEEA 3CQZB 1I4QA 1ZKOA 1P16A 3S15B 4Y52H 1BCPD 2A68D 3ERQA 2JEAI 3H15A 3A8KE 5C0XJ 1XXGA 1K73C 4IFDH 3S2DB 1RDPD 5M5YB 1HNXL 2HIVA 1EYDA 3NELA 5ELOA 3S15H 2EQSA 1CK1A 5HGQA 4ZKBB 2AQ2B 4P72A 4DR2Q 5E4XA 1BCPC 1VQDA 1K28A 3DMUA 2LKVA 5EKKA 4JI7Q 4WFN3 4DR7L 4KKSA 3KBGA 2KQ3A 1TWHB 2K4KA 5M3FB 3BS1A 3H91A 4BY7B 3CAMA 2IX0A 4QGUA 3T51B 3Q24A 1VF7A 3NSWA 4QIWB 1DM0B 1L1OA 1E1TA 3GV6A 3I4MB 4JBKA 2EZVA 1FYCA 3TZUA 3GTMB 5C4ZA 3MHBA 2N88A 1WTXA 4JPBW 4DV6Q 2SNMA 2WB1G 4UP9A 1H95A 4JI1L 5IODA 2DY8A 4YWKA 2AQ3B 4DK1A 2I46A 1KDCA 2WINB 1RL2A 3D4RA 3GTPH 2JA6B 1IKLA 4GNXB 2D9UA 4KHPL 1AZPA 4GLAC 2Q2IA 1I4GA 4UAIA 1FNVA 3LX0A 1Y8PB 4BY1G 3VR6A 3VYUA 1HTLD 3K5LA 4B3SL 5C4XG 3P20A 1BDOA 1K8AC 5FJ8G 2NWGA 3PO3G 3GTPB 3FRPB 4C3IB 4QF4A 1MSHA 1B7YB 1XPUA 2AKWB 1T5EA 1NMFA 1QNUA 5ELDA 1EU4A 2HDMA 3H09A 4GKJQ 3OMGA 2L15A 2AHOB 1EY7A 1V8QA 1Q82C 5EAYA 3X3MA 3VDYA 4J1MA 3ND9A 5GAHC 3T1YQ 1IL8A 1XPRA 3HOUB 1S5BD 5DAUA 1UUPA 3SK5A 4KI0A 1K83B 4LFBQ 2QKIC 5BN3A 1TS2A 1PHJA 3S14H 4ZUIA 2B2UA 4J8QA 4PMCA 1YHQA 3K6OA 1HUMA 3M4PA 3ICEA 4DU9A 3H0GH 1TVXA 4Y7NB 4A3GH 2A6ED 4MTNA 2RHSB 1SFOB 5KNDA 2ID0A 5GROA 2Y0SG 4PZ8A 2K52A 2E76C 3NBHA 2R3ZA 3HOXB 2LS01 2EYPA 3IAYA 4EQOA 2SEBD 4A3DG 3P7JA 2EIFA 2BDNA 1YNJD 2FMCA 1KD1C 3M3YB 4OO1I 3HOZG 2X69A 4S3SA 3PO3B 1Y69U 4BBSH 1E2WA 4LF9Q 2XTIA 4DV1Q 4LF7L 4DR5L 4OX9L 1VQ4A 2JA6G 4GN3B 5KNCA 4JOIA 4DR4Q 2Y0SE 3BDLA 1ASZA 5FLXL 4OO1G 3HS0C 3NK9A 3LNNA 4DR3Q 3KF8A 3GTLB 5IYBH 3PUVA 3CCJA 3CC4A 3VA7A 4A3BG 2D0PA 1AN8A 4AH6A 1UEAB 3NTHA 3JAME 3Q6SA 5DM73 2KHSA 3L9AX 5LMUQ 1MGSA 4A4IA 2V4DA 4X64L 2R93H 4JI7L 4O1NA 5IYDG 4A3KG 1ZYRC 3I8ZA 5EPJA 5K36G 1A2UA 2Q2HA 1FGUA 1Q81C 1CA6A 3PO2H 2KVMA 2PZWA 2UUAL 2PMZE 1Q90A 1JR0D 3CHBD 3DHQA 1OXSC 5A2QL 4XT3B 4QUFA 4A93B 1E1OA 4A3JB 4P2CB 3HGBA 4KY5A 4LF4Q 3OTOL 3EQLC 2VQFQ 2F0WA 1TY0A 2VZAA 4OONA 4L8JA 5CC4A 2EXDA 4LJZC 4PQXA 3OPOA 2LY7A 2NVQH 4DR4L 1U5KA 2KCCA 1L2FA 2HQEA 3L3OC 4UY8C 1W6JA 2F3WA 1LT6D 3A5ZB 3GD7A 5M5YH 3LWEA 1EQRA 1KQSA 3WDNA 1KABA 3HOXH 1KTKA 2B2VC 3QOLA 2KJXA 4NXMQ 3PUZA 4ABNA 1A3TA 2ZJQA 3MEFA 3H6MA 3ULJA 4KY6A 5CV5A 1DZ1A 2Z9HA 3QOJA 1O7YA 1LT3D 3A7LA 1PV4A 1X32A 1K8OA 4KMUC 4MN3A 2NN6G 4RH6A 1TWGH 2O5IC 3OIPA 2VUMB 2F0DA 2ZM6Q 3Q8DA 4LFBL 4A3MH 4A3LH 2NVTB 2R7ZH 3BYTB 5FO9B 4U673 1ESRA 1O7LA 2F52A 2EPBA 4CHTB 5D14A 2K5NA 5IGEA 3M7GA 4X66Q 5D3DA 1L1OC 5G3LD 1UWVA 2WKCA 5M5XH 3VR5A 4BXXH 4APVA 3K5OA 1WFQA 1EYAA 2DJFC 5HURA 2N55A 4A76A 1OXTA 3IL8A 2E2HH 4I7ZC 3GO5A 5F2DA 2EY2A 2F0IA 5I9OA 5J3BA 4BY1H 3BDOA 4M8AA 3V05A 2OXPA 4DV4L 2B2TA 3KDFB 2IX3A 4RKLA 4IURA 5EJWA 1EOTA 2MPMA 3TQYA 1EY8A 4G7HC 4KD3A 2QEJC 1F9RA 1AP0A 1QVGA 2ZXPA 4GZYC 4B3SQ 1H9SB 1Q8KA 1E3PA 1TS5A 1RTOA 5HGTA 1PZKD 5C44H 3S1MH 4CKEA 2F0TA 1LT4D 4A3IH 4DV4Q 5K5PA 1KXLA 2JEBI 5M3FH 2HT1A 1FGBD 1UE7A 2EJFC 2A8VA 1U4RA 1ILQA 2A69C 3E6ZX 1ILPA 1D5ZC 3I3CA 1PMRA 2QW7A 4ZQ3A 3ZJYC 5IP9H 1YIJA 3WWVA 4PZ7A 1SNCA 1NUCA 5DEHA 5AJ3L 3GTGH 1AZQA 2F0PA 3GTKH 1SE3A 5M3MB 2RF4A 1SNOA 1SAPA 3TMEA 2Q8TA 4A3LG 1VF5C 2MUYA 4TKOB 5L37A 1I6VC 2B2WA 1F9QA 3VYRA 3JAML 1Y1VB 1VQ9A 4JI2L 3GTKB 3PUXA 2M9VA 3NTKA 1IW7D 1LM0A 1YNJC 3RR5A 2JA8B 2WACA 1BOSA 4EX5A 4P73A 5IIFA 1NNXA 3R3OA 3S2HB 4YHHQ 4OX9Q 5AJ3Q 4LF6Q 4RKBA 1SYFA 2JSOA 1VQPA 4KN4C 1TIID 3SK8A 2I0QA 4A3FH 4JI6Q 4DFAA 1PTOH 1KHIA 5M3MH 3J80E 4FF4A 4E6IA 3E0JA 3I4MG 1T9HA 1OO9B 4CDCC 2F0GA 1Y1WG 5IYCH 3K0YA 1XPOA 3I7FA 1XMOQ 5KIXA 2WB1E 4XDXA 2JA5G 3NBIA 3U9OA 2EJGC 1X3EA 3IRBA 1JE4A 2CW0D 4Q5VA 2PQEA 2QEXA 5C0XG 2RDGA 3W2DA 4BBRB 3T1YL 4XT1B 4LF5L 4IZ8A 5E3FA 1SYDA 4OIKA 3T53B 4HCSA 2WAQE 3CCLA 4K8JA 5JJKA 3KF6A 4MTKA 3GTOH 3E9HA 4FXDA 1F77A 4RMFA 2UXCQ 1OTCA 1K8GA 1F2LA 2VL6A 1CKMA 2OTJA 2MGSA 1QUQA 4XYQA 3KDFA 1MSGA 1KDAA 5AFWA 1XMQQ 3NWSA 2K50A 2E5LQ 1IBLQ 1VQMA 5CV9A 3W1BA 2ZTCA 4DR1L 1JB3A 3DM3A 3GQBA 2QDLA 2ASBA 2OT2A 4JI0L 3D0FA 2E74C 1H9RA 1TWFH 5GQOA 4C3JG 1I3QH 2K1BA 2Q8RE 1N34Q 2ZJPA 1M4VA 2B2TC 1PYSB 2IHEA 2OQKA 1MHWC 1O7ZA 1VMPA 1FJGL 5ELFA 4DK6C 2I5HA 4R4IA 1E7ZA 4NXML 4DV2L 1F2MA 1D5XC 3A5UA 2GVBA 3J81c 3RD4A 5LL6X 1PTOB 2CWAA 1YI2A 2HD3A 1JORA 4C3HB 3ND8A 5EGTA 4JK1C 4HJ8A 1QVFA 3QJYA 5LL6S 2K28A 3AMUA 4KJOA 1CSQA 2MNAA 4GN5A 3EFXD 4JI1Q 5G3LF 3JC66 1KAAA 1DGSA 3CCEA 4NB3A 1JICA 3BZDB 4PNYA 4OHJA 3TRZA 4GOPA 4JI0Q 2OEOA 4A3JH 1S5DD 2CVRA 1PTOF 4DKAC 1WVLA 1JWSD 5C4JH 3GTJB 1U9RA 4ZK9B 1F2YA 3BVMA 3G71A 4JC0A 1HCZA 4DV3L 5C0XH 1NAPA 2UUBQ 4B3RL 4X3UA 1A6XA 3S9WA 3TP7A 3GTOB 2F0EA 1X6OA 2KHJA 3UDGA 3MAQA 2C9OA 4L63B 4TSSA 2EVBA 1BR9A 2JA5H 1CKNA 3S1RB 1PZID 3M4YA 3K57A 4YWLA 3UI2A 4ID6A 3HOVB 2JA7G 1BBXC 3J81i 1B3AA 2A6HD 3G6JB 4DR2L 3TDQA 2SOBA 3AFQA 4A3CH 5M9OA 1PRTF 1CZWA 1TWGB 1XNRL 1PTOC 2A68C 3S2HH 1ICFB 1P8LA 2IJ0A 3TP5A 4NDXA 3I2ZA 4X62Q 3ZYYX 4EGVA 2ZM6L 5J22A 1PTOD 3M4QA 4GOPB 4BBSB 1FVIA 4HIDA 4RCOA 5CORA 1A62A 4AYBB 1EWIA 4C3HG 1U0LA 4LF9L 3BYYB 2RCNA 3GTGB 3CPWA 1LO5D 3SGIA 1WTRA 4IUTA 3DWQA 2OCEA 1G6PA 4JG2A 4PMWA 4X62L 5DM63 1D2BA 2EXZA 4DR1Q 1IYJB 5IWAQ 2EYLA 3CRKC 4BS9A 1VQ8A 3MVVA 3ULLA 2MQHA 3L0OA 2F1MA 5EPKA 2E2DC 1HTPA 2VY3A 1IBMQ 4OIJA 4YHHL 4A3JG 3KFUA 1IKMA 3R8BA 1FR3A 2HHHL 1GHJA 4A3KH 4H0LC 1JQYD 4ME3A 3VYSA 1FJGQ 1CT1D 2R92H 3KLRA 4NXNL 4DUYQ 2RSOA 1V1PB 2PZTA 1H9KA 2OQ0A 5FLXc 3K7AH 1EUJA 4JV5L 2EYHA 2I5MX 3OYYA 4LK1C 2HDLA 5IGCA 4HIOA 3HOYG 4K6LA 1KNAA 2D62A 4C1NK 4ZRZA 1HFNA 3FVQA 3BG3A 4K5WA 4K14A 4OWWB 3GTQH 1LTBD 4LF4L 2KOLA 2F03A 1R4PB 4V190 2L9HA 1KDBA 2N3SA 4C3IG 2E2IH 1UE5A 1LLRD 2PQAA 1EZ6A 2JQOA 1HA5A 4X65L 3CCRA 1G2SA 1RCVD 5IT9L 2RDFA 5C4XH 1TQOA 4LUZA 1QZGA 4KHZA 2A19A 5I6YA 1EEFD 1ICWA 3MEHA 4FXGC 2DN8A 4DV6L 4OL7A 5JPNC 1Q3LA 4B3ML 4GOPC 4IPCA 2FJ2A 1BF4A 2E5LL 2YV5A 3K7AB 3PO2G 3CU7A 3K81C 4IJHA 5C0XI 1ENFA 4EQPA 3JAMi 1PRTC 2Z6KA 1L1OB 4A75A 3I4MH 4JI6L 1PDQA 1SE4A 1VQ5A 2NVTH 2F0KA 4RCNA 3I4NH 1BKBA 1X65A 2Z0SA 4R1JA 1EIFA 1VDZA 1VQBA 1D5MC 5EPLA 1SEBD 1XNRQ 4NW2A 1HH2P 1A8VA 2NTSA 2UXDQ 3F2BA 3AB9A 1H9JA 1S3OA 3CQZH 3SE0A 5C3EB 2X6LA 1WTPA 3FKIB 2J4XA 4YCUA 2L5TA 4CDDC 2PNRC 1JOKA 2F0FA 2NVYH 3EJIA 3PUYA 2EJMA 3VR3A 3CC7A 2WP8J 3DUZA
chains in the Genus database with same CATH topology
3SK6A 1B1ZA 4KKUA 2DNEA 4RHSA 4DN4M 3NQTA 4HMIA 4FYDA 2KEDA 2Z1CA 4FF2A 1Y8OB 5IGGA 3PUWA 1STGA 4HAEA 2C5CA 3BVZA 2CW0C 4YIJA 3DWAA 2QF7A 2R61A 1I6HB 4Q0FA 4BA2I 3U9SA 1JWUD 1ONLA 1PRTB 2K5WA 2KEEA 1XWEA 5D3IB 1E2VA 1ZYRD 5C4XB 3SEBA 4IN3A 1DJRD 4KV6A 2ZT9C 2BA0A 1HQRD 1BCPB 1LV9A 3SDZA 4QCLA 5JAVA 1TR5A 3HG9A 2I07B 2NBFA 5I9PA 1PLFA 3URYA 3CRLC 5CBEE 3WOFA 2EYFA 3O13A 1KLGD 2BE5D 2TSSA 2O2LD 5C3WA 3I4NB 1B4OA 4FP5D 4HMJA 5KGUA 3SVMA 1A3VA 1HFGA 2G9HD 4DF7A 3DXJC 3MXGA 5EQ0A 3D6WA 3OWEB 4J6HA 1LTRD 2E2IB 2PO4A 3HRZC 3MXNA 2F3VA 1LTGD 5FO7B 4HCEA 1RTNA 5C5MA 2FMMA 2NN6H 3A7AB 4XIGS 2SNSA 1RHPA 4PMBA 1ESFA 2A5HA 1RD9D 1AFPA 1STEA 4G7OC 5EBCA 1CTMA 3EROA 1S4ZA 3R2TA 1Z7TA 3C1FA 3FEWX 3ITPA 2QDBA 1XTCD 2L1BA 1HA6A 2D2CC 5CV4A 1F2ZA 2JA7B 3MC0B 2MJ8A 1TKWB 4N9TA 5ELBA 3MFYA 5A35A 2K05A 3N52A 1FD7D 4K5VA 3BVGA 1JOOA 4KN7C 1SYGA 2FINB 3SK4A 2L4NA 2AUJD 2BOSA 1TWCB 2K7VA 1C48A 2F0UA 4NKLA 2A74C 3R2IA 1AW7A 1CI3M 2JP1A 5DNFA 2EY6A 4KTAA 1Q12A 3GV3A 2F0HA 4NMZA 3MA2B 1SNMA 3A56A 1PFNA 2PZUA 3K5NA 2K33A 1PRTD 3EA6A 1SNPA 4K8IA 3NP8A 4HN7A 3MWYW 3MZ5A 1LTTD 5JOBA 5CYUA 1F9SA 4QB4A 4IUUA 5JEAG 4ZLTF 5COYA 4A3IB 2XWBB 1CQVA 1DYQA 4FXKC 3A55A 3K5MA 5CV7A 3LWUA 1Z6HA 3NXWA 1WTWA 4L6TB 2KCNA 3DEOA 3Q23A 3NUCA 4G4KA 1LT5D 3PIP3 3KUPA 4K6DA 2F4IA 4XTCS 1GJXA 3C3LA 5J1ZA 2EYJA 1BQQT 2K32A 4RHRA 3QO2A 3DWPA 2FFKB 4RFBA 1S5CD 5C5LA 4KJNA 2BCOA 2L11A 3EVQA 4ZAIA 2B2VA 4B9XA 1JC7A 3QIAA 4K5XA 3PIO3 1I3QB 1D1KA 5IOCA 3A8IE 3C2PA 2O4XA 1J9OA 3GP7A 4XQJA 3V96A 2NTTA 1RJTA 3IKJA 1SE2A 5C6AA 1RODA 2H1EA 2AWNA 3SHLA 3NWTA 3OW7A 3MXUA 1S5FD 5JEAH 2IW3A 4X3SA 4C56C 4HEDA 2PYKA 1ML0D 2AWOA 2JYOA 3J7YW 1EY5A 2QCPX 2EOTA 1G2TA 3T16A 3OWFA 1EYCA 5T1GA 1CHPD 1GUNA 1QJOA 4QMGA 1CHQD 2VNUD 4R8IA 1SYBA 4X3KA 5D65A 1FNUA 2ICEC 1R4QB 2L55A 1EY4A 4A3FB 2DY7A 2L12A 3J7AV 2D5DA 4KD4A 1BO0A 2R93B 1GUOA 1ET6A 1EIGA 3HZXA 4A3DB 4BA1I 4G57A 3PMFA 2Z4IA 1HUNA 4F87A 4FF1A 3I73A 2IWHA 1B9NA 1STAA 1QILA 3RMHA 4MIUA 1GUTA 3MTSA 2PMZB 5BN4A 1NSNS 3MFGA 1NCVA 1G91A 3M85A 5NUCA 5FKAC 1PFMA 5CV6A 5CBAE 5C44B 1MD2D 2B8GA 1BXTA 2KUMA 3D31A 2M2LA 1I4PA 2KA7A 3K58A 1WD0A 4A3GB 2ENBA 2F0NA 2IX1A 4DAYA 5E4WC 1RKNA 1GOZA 2Q8IB 3C1EA 4IFDI 1WTQA 2B63B 1EEID 4NP5A 1CM9A 5JJZA 1OXXK 4ODGA 3KLSA 1JCKB 2LMCB 1Q8IA 1SJHD 2XSCA 3I4LA 1GXDC 5M5XB 1DD2A 2K6AA 2RA4A 3X3NA 4ZYSA 3DM1A 2F0JA 1HHVA 3OIQA 1CFMA 1QNKA 1W6KA 4XQNA 3KBXA 2R7ZB 1II3A 3T13A 3D4WA 3ONAB 4OO1H 4FNFA 4XQQA 1Q1BA 4IUVA 5IGFA 4H13C 1ET9A 2L0CA 1IYVA 1STYA 1X3PA 1TS4A 3DEPA 5I2YA 2XVSA 3S1NB 2B2UC 3FPUB 2K5DA 1WCMB 1GUWA 4RGMA 2NN6I 4PV1C 1ENCA 2RQXA 1X3QA 3J7AF 5I6WA 5FO8B 1SSOA 1GHKA 2XRQD 1HQMC 1T5XD 4MHEA 5K36H 1B2TA 3IFDA 3NE5B 4HR7B 4WRDA 1JWMD 5KYIA 1DONA 3VA5A 2RKSA 3H94A 3Q0AA 2HCCA 1QWYA 2NVQB 2AQ1B 5CMDA 3KLSX 3PO2B 5KYLA 4U68A 2XWJB 4R8NA 2Z8LA 2LFNA 2BA1A 1HXYD 5A2QE 3S14B 2JXMB 4IFDG 1L0YB 3OHXC 1VCIA 2JA5B 1EY6A 3VR4A 1CQFA 1EZ8A 4IFDJ 3FMCA 5TSSA 3QWNA 3OOCA 1U4LA 3HEJA 5KNBA 4FF3A 1ENAA 1KNEA 5EBDA 2E75C 1O80A 1DCZA 2MP1A 4I65A 1IHZA 2HCIA 3FDTA 2EY1A 2NVYB 1STBA 1Y8NB 1TY2A 5EKIA 2BDOA 1I50B 5JEAJ 1B9MA 1C8CA 2PPBC 4HSPA 4KK7A 1ZXTA 3I91A 3GTQB 3P75A 3M7NA 1V43A 3H0GB 4DGZA 5IT9E 3N6RA 1GUGA 5T1IA 3RUZA 4KY7A 3T56B 1SJED 2JE6I 4HTHA 1EIHA 1V1PA 4CKCA 4DXGA 2O5JC 1STHA 5JVG3 4X3TA 1WTVA 1DOLA 2B2WC 1NR4A 1DXMA 1FNWA 4CBVA 2NYZD 2CQAA 1B44D 3D4DA 3NPPA 1EY9A 3TP8A 4F8MA 4EQNA 4FVMA 3F2UA 3W3AA 1E2ZA 4OGQC 2IL8A 1R9TB 1GUSA 4RGNA 2G9DA 2F0MA 3D6CA 3WOEA 1KLUD 1D1IA 1L0XB 3MXPA 1QE6A 4V0BA 4G7ZC 2K5QA 3E5SA 3TZDA 2R92B 1H9MA 2F0QA 3H3VC 2SDFA 1SNDA 2WB1B 1DOKA 2XRSD 2YYZA 4K2KA 2B39A 1BNZA 4HSVA 1PYWD 2EYOA 2F0LA 2A69D 5I2XA 4KHVA 1SNQA 1EU3A 1EY0A 1EWHA 4O42A 5JPMC 2F0OA 4RGOS 1XX8A 2WAQB 1YNND 1SDFA 4DNRB 2K04A 4RAUC 5C4JB 3HKZB 4FO2A 4IUQA 4CGYB 2B2YC 1LABA 1STNA 2A6HC 3TBIB 1Z47A 2GA4B 3HOZB 1YNNC 3NQIA 1TS3A 2A6EC 3M4OB 1NR2A 2XIWA 3RZOB 4RWSC 4K2LA 2ZXRA 4BWGB 4QUCA 4DAPA 1A3UA 4F7XA 2WKDA 4N9PA 1IYUA 1ZEQX 3T4AC 2KECA 1QG7A 2Z4HA 1H9SA 3HOWB 2M00A 1G6ZA 1Y1WB 4LAAA 1AEXA 4TRDA 2WV6D 1J8IA 1HRJA 5FLXE 1K8MA 1LTAD 1Q1EA 3HOYB 2BE5C 2IPKD 4ZUJA 3S17B 1LTSD 4R9WA 2EY5A 2MHVA 3HP3A 1SMYC 1CA5A 3BDCA 3D3RA 1O78A 4BY1B 2NVXB 1LACA 1I4RA 1EQVA 4IALA 3A54A 3NHHA 1U4PA 4B08A 4WORA 4A3KB 2OF1A 5LHY1 1XYIA 2F0SA 1VMCA 1EFID 1OXVA 1JOQA 3FPPA 5ELCA 5I4DA 5BN5A 1U4MA 2VB2X 1D6EC 1RF2D 5CR3A 3K59A 2YU9B 1WD1A 3A8JE 1QOHA 1A2TA 1QCBD 4B9WA 1EWCA 2PW7A 3I72A 5IGBA 2B2YA 1B50A 3RZDB 3P1HA 4CKBA 1E0BA 4LMQD 2TMPA 2ICIA 1TWFB 1SYEA 4ME5A 1UAPA 3J81L 4DK0A 5C4HA 3TSSA 1PFBA 3C46A 4ULLA 1EQTA 2WIIB 2A73B 4F88A 4JBWA 4DNTB 3TN2A 3G7LA 4ZKCB 2PW5A 1BUVT 3SXHA 5KRUA 1LTID 3QG1A 1MI2A 4UDUC 4CJ2C 2HUGA 5EKLA 3J81E 2J7ZA 4XXEA 2IT1A 2NZ1D 3D8GA 4A3BB 2EDGA 2XNAC 3SR1A 5JVH3 3QB3A 5J39A 1WTOA 3L7ZC 2FHTA 3R93A 2EE1A 3PV0A 2EYMA 4KKTA 1G8ZD 1F9PA 2QILA 2RDHA 4CJ1B 5FOBB 2H4OA 1TU2B 5CV8A 2XN9C 3I90A 4RA8A 1I4XA 1BCPF 2E2HB 1TWAB 5FK9C 2RVLA 2ZXOA 5CGKA 1QB5D 1SMYD 1OXUA 1TT2A 2J0TD 5E1FA 3RLFA 4DAVA 5M5WB 2RBMA 4C2MB 1SXTA 3Q22A 3OSOA 1EL0A 2NUCA 3S16B 2RSNA 1S5ED 3CKIB 4IQZA 3TP6A 1A15A 3J80L 4ILWA 1UNSA 2PCFB 5ELEA 4C1NI 2R6GA 2VB3X 2AUKA 4XYOA 3S1MB 1M8AA 5C3XA 1SYCA 4IUPA 2NB0A 2VXWA 1C4QA 4Z9CB 5ISRA 3S1QB 3OMCA 1PXUA 3AU7A 2K01A 1CZGA 4H7BA 2X6GA 4EVOA 1G291 2B8FA 4CJ0B 2F0VA 3I70A 2CHBD 1SBBB 1DOMA 4WJWA 3NTIA 4H44C 5IGDA 4DA2A 1IW7C 3V2TA 1B53A 3VR2A 4M1UB 4IUNA 2Y0SB 3IFTA 1HPCA 4A3EB 2DNCA 4C3JB 4A3MB 1V1OA 3VYTA 3KK7A 2K03A 4TQUS 1MBYA 1PZJD 4RGTA 4DXFA 2E2JB 1I4HA 5KEEA 3CQZB 1I4QA 1ZKOA 3S15B 1BCPD 2A68D 3ERQA 2JEAI 3A8KE 5C0XJ 1XXGA 4IFDH 3S2DB 1RDPD 5M5YB 1EYDA 1CK1A 4ZKBB 2AQ2B 5E4XA 1BCPC 3DMUA 2LKVA 5EKKA 4WFN3 4KKSA 3KBGA 2KQ3A 1TWHB 5M3FB 3BS1A 3H91A 4BY7B 2IX0A 3T51B 3Q24A 1VF7A 3NSWA 4QIWB 1DM0B 3GV6A 3I4MB 2EZVA 1FYCA 3TZUA 3GTMB 5C4ZA 3MHBA 2N88A 1WTXA 2SNMA 5IODA 2DY8A 2AQ3B 4DK1A 2I46A 1KDCA 2WINB 3D4RA 2JA6B 1IKLA 2D9UA 1AZPA 1I4GA 4UAIA 1FNVA 3LX0A 1Y8PB 3VR6A 3VYUA 1HTLD 3K5LA 3P20A 1BDOA 2NWGA 3GTPB 3FRPB 4C3IB 4QF4A 1MSHA 1T5EA 1QNUA 5ELDA 1EU4A 2HDMA 3H09A 3OMGA 1EY7A 1V8QA 3X3MA 4J1MA 3ND9A 3HOUB 1IL8A 1S5BD 5DAUA 1UUPA 3SK5A 4KI0A 1K83B 2QKIC 5BN3A 1TS2A 4ZUIA 2B2UA 4J8QA 4PMCA 3K6OA 1HUMA 4DU9A 1TVXA 4Y7NB 2A6ED 1SFOB 5KNDA 2ID0A 2E76C 3NBHA 2R3ZA 3HOXB 2LS01 2EYPA 3IAYA 4EQOA 2SEBD 3P7JA 2BDNA 1YNJD 2FMCA 3M3YB 4OO1I 2X69A 4S3SA 3PO3B 1Y69U 1E2WA 5KNCA 3BDLA 5FLXL 4OO1G 3HS0C 3NK9A 3LNNA 3KF8A 3GTLB 3PUVA 3VA7A 1AN8A 1UEAB 3NTHA 3JAME 3Q6SA 5DM73 2KHSA 3L9AX 1MGSA 2V4DA 4O1NA 1ZYRC 3I8ZA 5EPJA 5K36G 1A2UA 1CA6A 2KVMA 2PZWA 1Q90A 1JR0D 3CHBD 3DHQA 1OXSC 5A2QL 4XT3B 4QUFA 4A93B 4A3JB 4P2CB 3HGBA 4KY5A 3EQLC 2F0WA 1TY0A 4L8JA 5CC4A 4PQXA 4LJZC 3OPOA 2LY7A 2KCCA 2HQEA 3L3OC 1W6JA 2F3WA 1LT6D 3GD7A 3LWEA 3WDNA 1KABA 1KTKA 2B2VC 3QOLA 2KJXA 3PUZA 4ABNA 1A3TA 3H6MA 4KY6A 5CV5A 1DZ1A 3QOJA 1O7YA 1LT3D 3A7LA 1X32A 1K8OA 4KMUC 4MN3A 2NN6G 4RH6A 2O5IC 3OIPA 2VUMB 2F0DA 2NVTB 3BYTB 5FO9B 4U673 1ESRA 1O7LA 2EPBA 4CHTB 5D14A 5IGEA 3M7GA 5D3DA 5G3LD 2WKCA 3VR5A 3K5OA 1EYAA 5HURA 2N55A 1OXTA 3IL8A 4I7ZC 3GO5A 5F2DA 2EY2A 2F0IA 5I9OA 3BDOA 4M8AA 3V05A 2OXPA 2B2TA 2IX3A 4RKLA 4IURA 5EJWA 1EOTA 2MPMA 1EY8A 4G7HC 4KD3A 2QEJC 1F9RA 1AP0A 2ZXPA 4GZYC 1H9SB 1TS5A 1RTOA 5HGTA 1PZKD 4CKEA 2F0TA 1LT4D 5K5PA 2JEBI 1FGBD 2EJFC 1U4RA 1ILQA 2A69C 3E6ZX 1ILPA 1D5ZC 3I3CA 1PMRA 4ZQ3A 1SNCA 1NUCA 5DEHA 1AZQA 2F0PA 1SE3A 5M3MB 1SNOA 1SAPA 3TMEA 2Q8TA 1VF5C 2MUYA 4TKOB 1I6VC 2B2WA 1F9QA 3VYRA 3JAML 1Y1VB 3GTKB 3PUXA 2M9VA 3NTKA 1IW7D 1YNJC 2JA8B 2WACA 1BOSA 5IIFA 3R3OA 3S2HB 4RKBA 1SYFA 2JSOA 4KN4C 1TIID 3SK8A 4DFAA 1PTOH 3J80E 4FF4A 4E6IA 3E0JA 1OO9B 2F0GA 3K0YA 5KIXA 4XDXA 3NBIA 3U9OA 2EJGC 1JE4A 2CW0D 4Q5VA 2PQEA 5C0XG 2RDGA 3W2DA 4BBRB 4XT1B 4IZ8A 5E3FA 1SYDA 4OIKA 3T53B 4HCSA 4K8JA 4FXDA 1F77A 1F2LA 2MGSA 4XYQA 1MSGA 1KDAA 5AFWA 3NWSA 5CV9A 1JB3A 3GQBA 2OT2A 2E74C 1H9RA 4C3JG 2K1BA 2Q8RE 1M4VA 2B2TC 1O7ZA 1VMPA 5ELFA 1F2MA 1D5XC 3RD4A 5LL6X 1PTOB 1JORA 4C3HB 3ND8A 5EGTA 4JK1C 3QJYA 5LL6S 2K28A 3AMUA 4KJOA 3EFXD 5G3LF 1KAAA 1JICA 3BZDB 4PNYA 4OHJA 2OEOA 1S5DD 2CVRA 1PTOF 1WVLA 1JWSD 3GTJB 1U9RA 4ZK9B 1F2YA 3BVMA 1HCZA 5C0XH 1NAPA 4X3UA 1A6XA 3S9WA 3TP7A 3GTOB 2F0EA 3MAQA 2C9OA 4L63B 4TSSA 2EVBA 1BR9A 3S1RB 1PZID 3M4YA 3K57A 3UI2A 3HOVB 4ID6A 1BBXC 1B3AA 2A6HD 3G6JB 3TDQA 2SOBA 5M9OA 1PRTF 1CZWA 1TWGB 1PTOC 2A68C 2IJ0A 3TP5A 4NDXA 3ZYYX 4EGVA 5J22A 1PTOD 4BBSB 4RCOA 5CORA 4AYBB 4C3HG 3BYYB 3GTGB 1LO5D 1WTRA 4IUTA 3DWQA 4PMWA 5DM63 1D2BA 2EXZA 2EYLA 3CRKC 4BS9A 3MVVA 2F1MA 5EPKA 2E2DC 1HTPA 4OIJA 1IKMA 3R8BA 1FR3A 1GHJA 4H0LC 1JQYD 3VYSA 1CT1D 3KLRA 2RSOA 1V1PB 2PZTA 1H9KA 2EYHA 4LK1C 2HDLA 5IGCA 4K6LA 1KNAA 2D62A 4C1NK 4ZRZA 1HFNA 3FVQA 3BG3A 4K5WA 4K14A 1LTBD 2KOLA 2F03A 1R4PB 4V190 2L9HA 1KDBA 4C3IG 1LLRD 1EZ6A 1HA5A 1G2SA 1RCVD 5IT9L 2RDFA 1TQOA 4KHZA 5I6YA 1EEFD 1ICWA 3MEHA 4FXGC 2DN8A 4OL7A 5JPNC 1Q3LA 2FJ2A 1BF4A 3K7AB 3CU7A 5C0XI 1ENFA 4EQPA 1PRTC 1PDQA 1SE4A 2F0KA 4RCNA 1VDZA 1D5MC 5EPLA 1SEBD 4NW2A 2NTSA 3AB9A 1H9JA 3SE0A 5C3EB 2X6LA 1WTPA 3FKIB 2J4XA 2L5TA 2PNRC 1JOKA 2F0FA 3EJIA 3PUYA 2EJMA 3VR3A 2WP8J 3DUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7L A;  4KKS A;  3DXJ C;  5JEA H;  1FR3 A;  4KKU A;  2DNE A;  1IYU A;  1GHJ A;  3T51 B;  4H0L C;  1VF7 A;  4JBW A;  4DNT B;  5KNC A;  3KLR A;  2Q8I B;  1Y8O B;  3VR5 A;  4OO1 G;  3PUW A;  1H9K A;  3LNN A;  2AWO A;  3PUV A;  1FYC A;  3TZU A;  2BA1 A;  5JEA G;  4LK1 C;  3VA7 A;  1H9S A;  2JXM B;  4IFD G;  2D62 A;  1OXT A;  1OXX K;  4I7Z C;  2EJG C;  3W3A A;  3BG3 A;  2LMC B;  1E2Z A;  2V4D A;  3BDO A;  4DK1 A;  2CW0 C;  4OGQ C;  2NN6 H;  1HCZ A;  3A7A B;  1K8M A;  1Q1E A;  1G29 1;  5C0X G;  1GUS A;  1VCI A;  3QG1 A;  4XIG S;  5C0X H;  1A6X A;  1ZYR C;  2BE5 C;  3D4R A;  2B8F A;  2QF7 A;  3I4L A;  3VR4 A;  3LWU A;  5K36 G;  1GUN A;  1DD2 A;  1Z6H A;  1QJO A;  2EVB A;  4BA2 I;  3U9S A;  1ONL A;  3FMC A;  3T53 B;  3M4Y A;  4G7H C;  3VR6 A;  1Y8P B;  1SMY C;  2IT1 A;  4G7O C;  1CTM A;  3OOC A;  4G7Z C;  1O78 A;  4H44 C;  3P20 A;  5KNB A;  1BDO A;  1E2V A;  1CFM A;  1Z7T A;  2A6H D;  1IW7 C;  2EDG A;  4GZY C;  1H9M A;  1Q90 A;  3VR2 A;  2D5D A;  1H9S B;  4XTC S;  1OXS C;  1GJX A;  4KHZ A;  1T5E A;  2E75 C;  1LAC A;  1GUO A;  4OO1 H;  2YYZ A;  3L7Z C;  3HGB A;  3PV0 A;  1DCZ A;  2D2C C;  2DN8 A;  1Q1B A;  3EQL C;  3IFT A;  2ZT9 C;  1HPC A;  4KKT A;  2A68 C;  2BA0 A;  1V8Q A;  2DNC A;  2K32 A;  4H13 C;  4L8J A;  4LJZ C;  4BA1 I;  2JEB I;  2A69 D;  3OPO A;  1IYV A;  3SDZ A;  1Y8N B;  1TKW B;  3ND9 A;  3MFY A;  1OXV A;  3I73 A;  3FPP A;  3GQB A;  1B9N A;  1EWH A;  4TQU S;  5A35 A;  2BDO A;  5BN5 A;  4KI0 A;  2KCC A;  1B9M A;  2EJF C;  1TU2 B;  2A69 C;  2E74 C;  1H9R A;  2PPB C;  5BN3 A;  2NN6 I;  4KN7 C;  4PV1 C;  3GD7 A;  1PMR A;  3M7N A;  1V43 A;  4DNR B;  1GUT A;  3N6R A;  1GUG A;  3WDN A;  5BN4 A;  3A8J E;  2A6E D;  3T56 B;  2AUJ D;  3QIA A;  4RCN A;  1ZKO A;  3PUZ A;  3CRL C;  3A8I E;  2JE6 I;  1LAB A;  1OXU A;  1VDZ A;  2A68 D;  2K7V A;  3I72 A;  3M85 A;  2A6H C;  5KND A;  2JEA I;  3A8K E;  3RLF A;  4IFD H;  1GHK A;  1HQM C;  2O5J C;  1CI3 M;  3A7L A;  1VF5 C;  1YNN C;  2BE5 D;  5K36 H;  1K8O A;  4KMU C;  4TKO B;  1I6V C;  2E76 C;  3NE5 B;  3AB9 A;  4DK0 A;  4HR7 B;  3PUX A;  1H9J A;  2A6E C;  1IW7 D;  2NN6 G;  1YNJ C;  3IKJ A;  4IQZ A;  3SE0 A;  1Q12 A;  2O5I C;  3ND8 A;  4JK1 C;  2B8G A;  3H94 A;  3CRK C;  2L5T A;  2PNR C;  3D31 A;  2PCF B;  3QJY A;  1Y69 U;  1DXM A;  1E2W A;  2R6G A;  3PUY A;  2AUK A;  2EJM A;  2F1M A;  3OW7 A;  2KA7 A;  3VR3 A;  1HTP A;  4KN4 C;  3MXU A;  2K33 A; 
#chains in the Genus database with same CATH topology
 3SK6 A;  3BZK A;  1B1Z A;  4J15 A;  4DV0 L;  4JI5 Q;  2PQA B;  4KKU A;  4GKK Q;  2DNE A;  4RHS A;  4DN4 M;  3NQT A;  2JN4 A;  4HMI A;  4JI8 L;  4FYD A;  2KED A;  2Z1C A;  4FF2 A;  3J81 j;  1PH9 A;  1Y8O B;  5IGG A;  3S1N H;  3PUW A;  1STG A;  4LFC L;  4HAE A;  4A93 H;  2C5C A;  3BVZ A;  4L5S A;  3F2C A;  1VQ7 A;  2CW0 C;  4YIJ A;  2IHF A;  4AQY Q;  3DWA A;  2QF7 A;  1YJN A;  2R61 A;  1EIY B;  1I6H B;  4Q0F A;  4NPS A;  4B3R Q;  1SR3 A;  4BA2 I;  3U9S A;  1JWU D;  1ONL A;  1PRT B;  1YZ6 A;  3W1G A;  2K5W A;  2KEE A;  1M1K C;  3GTL H;  1XWE A;  5D3I B;  4IO9 A;  1E2V A;  4WJ3 M;  1ZYR D;  5C4X B;  2IY5 B;  4LF8 Q;  2R92 G;  3PF4 A;  3KLW A;  3SEB A;  1N36 Q;  1XJV A;  4IN3 A;  3QR8 A;  3G4S A;  1E22 A;  1DJR D;  1HJP A;  4KV6 A;  2ZT9 C;  3F1Z A;  5LMU L;  4DV2 Q;  2BA0 A;  1HQR D;  4DV0 Q;  2VW9 A;  3PO3 H;  1UEB A;  2YTY A;  1BCP B;  1LV9 A;  3SDZ A;  4QCL A;  5JAV A;  1TR5 A;  1XNQ Q;  5HY6 A;  4A3D H;  3HG9 A;  2I07 B;  4N8F A;  3ULP A;  2NBF A;  2GVA A;  5I9P A;  1PLF A;  1Y14 B;  3J7Z C;  1PH7 A;  3URY A;  2JK8 A;  1KL9 A;  3CRL C;  5CBE E;  5C3E G;  3WOF A;  2EYF A;  3O13 A;  1KLG D;  3E3X A;  4C3H H;  4QY7 A;  4HJ9 A;  1EQQ A;  2BE5 D;  2TSS A;  1VQA A;  1EOV A;  2O2L D;  2QGQ A;  5C3W A;  3I4N B;  4DAY B;  1B4O A;  5IYC G;  4LNQ A;  4FP5 D;  4HMJ A;  1VQI A;  5KGU A;  3SVM A;  1A3V A;  4UPA A;  1Q86 C;  1HFG A;  3HOU H;  2G9H D;  1L0W A;  1TXY A;  4DF7 A;  3I55 A;  3DXJ C;  3MXG A;  5EQ0 A;  2H5X A;  3D6W A;  3OWE B;  4J6H A;  1LTR D;  1MIU A;  2E2I B;  3NEN A;  2PO4 A;  3HRZ C;  3MXN A;  2F3V A;  1LTG D;  5FO7 B;  3UDX A;  1HR0 L;  4HCE A;  1RTN A;  5C5M A;  1B3Q A;  1IXR A;  2FMM A;  2NN6 H;  3A7A B;  4XIG S;  2SNS A;  1RHP A;  4PMB A;  1ESF A;  3KF6 B;  1A63 A;  2A5H A;  1RD9 D;  1AFP A;  1STE A;  4G7O C;  5EBC A;  2N49 A;  1CTM A;  3UDI A;  4DUZ L;  4A3E H;  3ERO A;  1S4Z A;  4DV7 L;  2OWO A;  3R2T A;  1Z7T A;  2YTV A;  3C1F A;  3FEW X;  3ITP A;  1I94 L;  2QDB A;  2VQF L;  3HOV H;  3ERS X;  5C44 G;  4LF6 L;  1XTC D;  2L1B A;  3ER0 A;  1TWH H;  4DR7 Q;  1HA6 A;  1BVS A;  2D2C C;  5CV4 A;  1MJE A;  3GTM H;  1F2Z A;  2B3G A;  2JA7 B;  3MC0 B;  1NMG A;  1TKW B;  2MJ8 A;  4BBS G;  4N9T A;  5ELB A;  3MFY A;  5FLM H;  1N32 L;  5A35 A;  2K05 A;  3N52 A;  1FD7 D;  2UU9 L;  4K5V A;  5IP7 H;  3BVG A;  4HIM A;  1JOO A;  4KN7 C;  1SYG A;  2FIN B;  3S24 A;  5M3M G;  3SK4 A;  5GAD C;  1XMO L;  4YCW A;  2L4N A;  5GAG C;  2AUJ D;  2BOS A;  1TWC B;  3FKI H;  1D7Q A;  2K7V A;  1C48 A;  3S1Q H;  1JMC A;  2F0U A;  1C0A A;  4NKL A;  2A74 C;  3R2I A;  4OEL B;  1AW7 A;  1CI3 M;  1AE3 A;  1GVP A;  2JP1 A;  2JJQ A;  5DNF A;  5BR8 L;  4JI4 L;  5IYD H;  2EY6 A;  4KTA A;  2R93 G;  2CFM A;  1Q12 A;  3GV3 A;  2F0H A;  4NMZ A;  3MA2 B;  3BU2 A;  1SNM A;  1LYL A;  2F3I A;  3A56 A;  1PFN A;  3I4N G;  4A3F G;  1Q46 A;  3RN2 A;  2PZU A;  3K5N A;  4R4C A;  2K33 A;  1VQJ A;  1PRT D;  3AEV A;  5IYB G;  1VQE A;  4HJ5 A;  3EA6 A;  1SNP A;  4K8I A;  3CW2 C;  3NP8 A;  4HN7 A;  2ALY B;  3MWY W;  4LFA L;  3MZ5 A;  2UUA Q;  4POF A;  1LTT D;  5JOB A;  3KYH C;  4FDB A;  3H3V H;  5CYU A;  2YU9 H;  4IPH A;  1F9S A;  4LW1 A;  4QB4 A;  4IUU A;  5JEA G;  4OWX B;  3PSI A;  1YHB A;  4ZLT F;  5COY A;  4A3I B;  2XWB B;  1CQV A;  2ZJR A;  1DYQ A;  1WOC A;  2LXJ A;  4FXK C;  2R7D A;  3A55 A;  4P74 A;  3S1R H;  3K5M A;  5CV7 A;  1VQG A;  3LWU A;  1Z6H A;  3U50 C;  3NXW A;  1WTW A;  4L6T B;  1RIP A;  2KCN A;  4KLK A;  3DEO A;  3AQQ A;  3Q23 A;  3NUC A;  4G4K A;  1LT5 D;  3PIP 3;  3KUP A;  4A3I G;  2VS1 A;  4K6D A;  1YIT A;  2F4I A;  1HR0 W;  4XTC S;  1GJX A;  3C3L A;  1PFS A;  5J1Z A;  4X6A H;  3UDF A;  3CC2 A;  2EYJ A;  1BQQ T;  3E0E A;  2HHH Q;  4BBR H;  2K32 A;  3HOY H;  4RHR A;  3QO2 A;  3DWP A;  2FFK B;  4RFB A;  1S5C D;  5C5L A;  5FLM G;  2VQE Q;  4KJN A;  2BCO A;  2L11 A;  3BJU A;  2PNH A;  3BZC A;  3EVQ A;  1KIX A;  5IWA L;  4ZAI A;  4H02 A;  2MFI A;  2B2V A;  4B9X A;  1N33 L;  4X64 Q;  1JC7 A;  3QIA A;  4K5X A;  3PIO 3;  1I3Q B;  3M4O H;  1XTD A;  1D1K A;  5IOC A;  3A8I E;  4A3E G;  3C2P A;  2O4X A;  1J9O A;  3K8A A;  3GP7 A;  4XQJ A;  2VUM H;  3V96 A;  4CDE C;  2NTT A;  4OEM B;  1RJT A;  3IKJ A;  1SE2 A;  5C6A A;  2JA8 H;  1JT8 A;  4UP7 A;  3J7A 5;  1ROD A;  2H1E A;  2F4V Q;  2AWN A;  1VS0 A;  3SHL A;  3NWT A;  1WI5 A;  3OW7 A;  3MXU A;  1S5F D;  3DLL A;  4GS3 A;  5JEA H;  2IW3 A;  4X3S A;  4C56 C;  1Y1V G;  4DK3 C;  4HED A;  2PYK A;  1JJC B;  1ML0 D;  3CCM A;  3PGZ A;  2AWO A;  1X56 A;  4JI3 Q;  2N78 A;  1HZB A;  2JYO A;  3J7Y W;  2K5H A;  1EY5 A;  2QCP X;  4JYA L;  2EOT A;  1G2T A;  3T16 A;  3OWF A;  4YWM A;  1EYC A;  5T1G A;  1CHP D;  1QVC A;  1GUN A;  1QJO A;  1I6H H;  3RN5 A;  4QMG A;  3RLO A;  1CHQ D;  2VNU D;  2JA7 H;  4R8I A;  1SYB A;  4X3K A;  1FNU A;  5D65 A;  2ICE C;  1R4Q B;  2L55 A;  1EY4 A;  4A3F B;  1I94 Q;  1X3F A;  2DY7 A;  2L12 A;  2KBN A;  4RG1 A;  3J7A V;  2D5D A;  4KD4 A;  1BO0 A;  4DPG A;  2UXC L;  2PI2 E;  2R93 B;  1GUO A;  1ET6 A;  1J5E Q;  3HFZ B;  4A3C G;  1EIG A;  1W3S A;  4GKK L;  3HZX A;  4A3D B;  4BA1 I;  4G57 A;  3PMF A;  2Z4I A;  1WTH A;  1HUN A;  4F87 A;  3FP9 A;  3EBE A;  4FF1 A;  3I73 A;  2IWH A;  4X65 Q;  1B9N A;  1STA A;  3T1H Q;  2KEN A;  1N32 Q;  1QIL A;  1ASY A;  3HOW G;  3RMH A;  3AFP A;  4MIU A;  3CD6 A;  1GUT A;  3MTS A;  2PMZ B;  2RCF A;  5BN4 A;  1NSN S;  1N34 L;  3MFG A;  1NCV A;  1G91 A;  4WJ4 A;  3M85 A;  4YY3 L;  5NUC A;  5FKA C;  3TS0 A;  1J6Q A;  4O2D A;  1D8L A;  1PFM A;  5CV6 A;  3KOJ A;  3TS2 A;  5CBA E;  4QQB X;  5C44 B;  1SRO A;  1MD2 D;  4OWT B;  2B8G A;  1BXT A;  2CH4 A;  2KUM A;  3D31 A;  2M2L A;  1I4P A;  1N36 L;  2KA7 A;  3K58 A;  3RNU A;  1WD0 A;  4Y7N H;  4A3G B;  2ENB A;  2F0N A;  1PH4 A;  1X9N A;  2IX1 A;  4DAY A;  5E4W C;  4B3M Q;  1RKN A;  1WCM G;  1GOZ A;  1LUZ A;  2ZTD A;  3A0J A;  2Q8I B;  3C1E A;  4IFD I;  1SLJ A;  1WTQ A;  2B63 B;  1EEI D;  5IP7 G;  1KRS A;  5LMN W;  4NP5 A;  1CM9 A;  4P71 A;  3CCS A;  5JJZ A;  1OXX K;  3S17 H;  4PZ6 A;  4ODG A;  1I50 H;  1C7Y A;  1E24 A;  3KLS A;  1JCK B;  2DUD A;  2LMC B;  4A3G G;  1Q8I A;  4C3I H;  1SJH D;  4YY3 Q;  4X66 L;  2XSC A;  3I4L A;  5LMN L;  1GXD C;  5M5X B;  1DD2 A;  2K6A A;  2RA4 A;  3X3N A;  4ZYS A;  3DM1 A;  2F0J A;  1HHV A;  3OIQ A;  1CFM A;  1QNK A;  4GLV B;  2UUC Q;  1W6K A;  4XQN A;  3KBX A;  2R7Z B;  1W2B A;  1II3 A;  1VQF A;  3D4W A;  3T13 A;  3ONA B;  2QA4 A;  4OO1 H;  4FNF A;  2KHI A;  4XQQ A;  2C35 B;  1Q1B A;  3HOW H;  4IUV A;  5IGF A;  4H13 C;  1ET9 A;  2L0C A;  1IYV A;  2G5D A;  5FJ8 H;  3RZO H;  1STY A;  1X3P A;  1TS4 A;  3DEP A;  5I2Y A;  2XVS A;  3S1N B;  2B2U C;  3FPU B;  2K5D A;  1WCM B;  1GUW A;  4RGM A;  1YNX A;  2NN6 I;  4PV1 C;  1HR0 Q;  3HOZ H;  1K0S A;  4LFC Q;  4BY7 H;  1B8A A;  1ENC A;  2RQX A;  1X3Q A;  3U58 A;  4R4O A;  4DAM A;  1K9M C;  3PQI A;  3J7A F;  5I6W A;  2NZO A;  5FO8 B;  3NEM A;  1SSO A;  1PH2 A;  4JCV E;  1GM5 A;  4AQY L;  1GHK A;  2XRQ D;  3H0G G;  1HQM C;  1VQL A;  1T5X D;  4MHE A;  5K36 H;  1B2T A;  3IFD A;  3NE5 B;  4DUZ Q;  1PVO A;  4HR7 B;  4WRD A;  1JWM D;  5KYI A;  3M3Y H;  1DON A;  3VA5 A;  2RKS A;  3H94 A;  4K0K Q;  3Q0A A;  2YTX A;  4EQ5 A;  2HCC A;  1IZ6 A;  2KCM A;  3PIP A;  1QWY A;  1HNW Q;  2NVQ B;  5C3E H;  2AQ1 B;  5CMD A;  3KLS X;  3PO2 B;  5KYL A;  3CCU A;  4GNX A;  2E2J H;  4U68 A;  4LF5 Q;  2XWJ B;  4JI3 L;  4R8N A;  1KAW A;  2Z8L A;  2UU9 Q;  2LFN A;  2BA1 A;  1IBK L;  1HXY D;  5M3F G;  1JJG A;  5A2Q E;  3S14 B;  2JXM B;  4IFD G;  1L0Y B;  1YJW A;  3EIV A;  3OHX C;  2V1C C;  3K7U C;  4DV5 Q;  2Q2T A;  4I7A A;  1VCI A;  4ZCK A;  2JA5 B;  1EY6 A;  3VR4 A;  5IP9 G;  3PIO A;  3H3V I;  1CQF A;  1EZ8 A;  4IFD J;  3FMC A;  5TSS A;  3QWN A;  3M9B A;  3OOC A;  3RLN A;  1U4L A;  4IPG A;  3HEJ A;  1N8R C;  5KNB A;  1JJ2 A;  4AYB E;  4FF3 A;  1ENA A;  4ALP A;  1KNE A;  4GLX A;  5EBD A;  2E75 C;  1O80 A;  2B63 H;  1PH6 A;  1DCZ A;  1NJI C;  2MP1 A;  4I65 A;  1IHZ A;  2HCI A;  3FDT A;  2EY1 A;  2NVY B;  1STB A;  1YHA A;  5JJL A;  1Y8N B;  3GDE A;  1YJ9 A;  1TY2 A;  5EKI A;  2BDO A;  3HKZ G;  1X54 A;  1I50 B;  1NY4 A;  1Z9F A;  5JEA J;  1B9M A;  1C8C A;  2PPB C;  4HSP A;  4KK7 A;  1ZXT A;  3I91 A;  3GTQ B;  1YBY A;  3P75 A;  3U4Z A;  1MKH A;  3HOU G;  3M7N A;  1V43 A;  3H0G B;  4DGZ A;  5IT9 E;  3N6R A;  1GUG A;  5T1I A;  3LGJ A;  2BH8 A;  3RUZ A;  4KY7 A;  3T56 B;  1XMQ L;  1SJE D;  2JE6 I;  4HTH A;  1EIH A;  5H1S E;  1V1P A;  3CCQ A;  1SFO H;  4CKC A;  4DXG A;  2O5J C;  1K0R A;  2DGY A;  4JV5 Q;  1STH A;  1N9W A;  5JVG 3;  4X3T A;  1WTV A;  1NTG A;  1VQN A;  2K75 A;  3S16 H;  1DOL A;  3CPF A;  2B2W C;  1NR4 A;  1CKN B;  1AE2 A;  1UE1 A;  1DXM A;  1FNW A;  1K83 H;  2JA9 A;  3U4V A;  4CBV A;  2NYZ D;  2CQA A;  1B44 D;  3D4D A;  2RHQ B;  1B70 B;  3G48 A;  3K0X A;  2CH4 W;  2JA6 H;  3NPP A;  1EY9 A;  5BR8 Q;  1YEZ A;  3TP8 A;  4F8M A;  1QUQ B;  3K80 C;  1UE6 A;  4EQN A;  1HZ9 A;  1PYB A;  4HJ7 A;  1V1Q A;  4FVM A;  1J5E L;  1G51 A;  3F2U A;  3W3A A;  3JAM c;  2PI2 A;  1JB7 A;  4MNO A;  1E2Z A;  4QL5 A;  4OGQ C;  3TRE A;  4JVZ A;  2IL8 A;  1QZH A;  4OXP A;  1GUS A;  2G9D A;  1WCM H;  2Z6K C;  2F0M A;  4RGN A;  1R9T B;  3D6C A;  3WOE A;  2BH2 A;  1KLU D;  1D1I A;  1L0X B;  1K3B C;  3F2D A;  3MXP A;  4B3T Q;  1QE6 A;  4AYB G;  4V0B A;  4G7Z C;  2K5Q A;  2P5Z X;  3E5S A;  1EFW A;  4LF8 L;  3TZD A;  2WAQ G;  2R92 B;  1H9M A;  4N8X 1;  2B29 A;  2F0Q A;  3H3V C;  2SDF A;  4PG3 A;  2AMC B;  1SND A;  4GNX C;  2N8N A;  2WB1 B;  1DOK A;  2XRS D;  2YYZ A;  4K2K A;  1PH1 A;  3KJO A;  3GTJ H;  2B39 A;  1VQO A;  4DV5 L;  1BNZ A;  4HSV A;  1XNQ L;  1PYW D;  2EYO A;  2F0L A;  4JBJ A;  2A69 D;  4KHV A;  1SNQ A;  1EU3 A;  1EY0 A;  3KF8 B;  5I2X A;  4L5R C;  1EWH A;  4BXX G;  4O42 A;  5JPM C;  4DR3 L;  2F0O A;  4RGO S;  1XX8 A;  2WAQ B;  3HKS A;  1YNN D;  4JYA Q;  1SDF A;  4DNR B;  2K04 A;  2MO1 A;  4RAU C;  5C4J B;  4HIK A;  3AYH B;  3HKZ B;  4FO2 A;  1HNZ Q;  3HOV G;  3EN2 A;  4IUQ A;  4CGY B;  2B2Y C;  4LF7 Q;  1GD7 A;  4QJF A;  3L2P A;  1LAB A;  1STN A;  1AH9 A;  2A6H C;  3S2D H;  3B6Y A;  3TBI B;  1Z47 A;  2GA4 B;  1KRT A;  3HOZ B;  1YNN C;  3CME A;  3CP0 A;  2MO0 A;  4DUY L;  1NBW A;  3NQI A;  2LSS A;  1TS3 A;  2A6E C;  3M4O B;  1NR2 A;  3W5O A;  2XIW A;  3RZO B;  4RWS C;  3RZD H;  1CKO A;  1X55 A;  4K2L A;  2ZXR A;  4BWG B;  4QUC A;  4DAP A;  2OTL A;  1A3U A;  2LXK A;  3A74 A;  4F7X A;  2WKD A;  4N9P A;  1IYU A;  1ZEQ X;  4DNI A;  2ZTE A;  3FHW A;  3T4A C;  2KEC A;  1QG7 A;  2VQE L;  1IBK Q;  2Z4H A;  1H9S A;  3HOW B;  2M00 A;  1G6Z A;  1Y1W B;  4LAA A;  1AEX A;  4IJL A;  4TRD A;  4DR6 L;  4DV1 L;  2WV6 D;  1IBM L;  1O7I A;  4DR5 Q;  1J8I A;  1HRJ A;  5FLX E;  1K8M A;  1LTA D;  1Q1E A;  3HOY B;  2BE5 C;  1SN8 A;  2IPK D;  4ZUJ A;  1Q7Y C;  1LTS D;  3S17 B;  3STB C;  4R9W A;  2EY5 A;  2MHV A;  3HP3 A;  1SMY C;  2Q2U A;  1CA5 A;  3BDC A;  3D3R A;  1O78 A;  4IPD A;  3J80 i;  4BY1 B;  2GN5 A;  4R4T A;  2R7F A;  2HQL A;  2JA8 G;  1PH3 A;  2NVX B;  1CSP A;  2A1A A;  5IT9 c;  1LAC A;  1I4R A;  1EQV A;  4IAL A;  3A54 A;  4POG A;  3NHH A;  3E9I A;  1U4P A;  4JI5 L;  4B08 A;  4WOR A;  4A3K B;  2OF1 A;  5LHY 1;  2F0S A;  1XYI A;  3UE0 A;  4QIW E;  1VQH A;  4JI2 Q;  1VMC A;  1EFI D;  4C2M H;  1OXV A;  1JOQ A;  3FPP A;  5ELC A;  5I4D A;  5BN5 A;  1BBU A;  1U4M A;  3UE1 A;  1WYD A;  2VB2 X;  3TEH B;  3STB D;  1D6E C;  1RF2 D;  1TWA H;  5CR3 A;  3K59 A;  2YU9 B;  5IE8 A;  1WD1 A;  3A8J E;  1QOH A;  4DR6 Q;  1A2T A;  3CMA A;  1QCB D;  4B9W A;  1EWC A;  2PW7 A;  3I72 A;  5IGB A;  2B2Y A;  5M5W H;  4BBR G;  3RZD B;  3P1H A;  1B50 A;  4UHV A;  4CKB A;  1NE3 A;  1E0B A;  1K3R A;  4JI4 Q;  4LMQ D;  5GAE C;  3MXN B;  2TMP A;  2ICI A;  2ATW A;  1TWF B;  1SYE A;  4ME5 A;  1UAP A;  3T1H L;  3J81 L;  4DK0 A;  5C4H A;  4UP8 A;  3TSS A;  1HNX Q;  4LUV A;  4L5Q A;  1HZC A;  1PFB A;  2WFW A;  5E7N A;  3C46 A;  4ULL A;  1PH8 A;  3CCV A;  1EQT A;  1PH5 A;  1S40 A;  2WII B;  3FKI G;  2A73 B;  4YCV A;  1N33 Q;  4F88 A;  2UXB L;  2K14 A;  1SMX A;  4JBW A;  4DNT B;  3TN2 A;  3G7L A;  1VQ6 A;  1CUK A;  1JE5 A;  4C3J H;  2CQO A;  4A3B H;  4ZKC B;  2R7Z G;  2PW5 A;  4A3M G;  1BUV T;  4DV3 Q;  3SXH A;  5KRU A;  1GO3 E;  4CDF C;  2F4V L;  2KCT A;  1VQK A;  1LTI D;  3QG1 A;  1HZA A;  1MI2 A;  4UDU C;  4CJ2 C;  2HUG A;  4JI8 Q;  2K5V A;  2UUB L;  2FXQ A;  3HKZ E;  5EKL A;  4HJA A;  3J81 E;  4JBM A;  2J7Z A;  4XXE A;  2IT1 A;  2NZ1 D;  2UXD L;  1C9O A;  2NVX H;  3D8G A;  3OW2 A;  3CXC A;  4A3B B;  2EDG A;  3G6E A;  4K0K L;  4BY7 G;  2XNA C;  3SR1 A;  4TVA B;  5JVH 3;  2DJG C;  3QB3 A;  5J39 A;  1WTO A;  1IL2 A;  2B63 G;  3L7Z C;  2FHT A;  3R93 A;  2EE1 A;  3PV0 A;  2EYM A;  4KKT A;  1G8Z D;  1PA6 A;  1EYG A;  2UXB Q;  2D0O A;  4GKJ L;  3KJP A;  1F9P A;  5JJI A;  2QIL A;  2RDH A;  4CJ1 B;  5FOB B;  1Y1W H;  2H4O A;  1TU2 B;  1MJC A;  1GKH A;  5CV8 A;  2XN9 C;  3I90 A;  3PCO B;  4RA8 A;  1I4X A;  1BBW A;  1BCP F;  2E2H B;  1TWA B;  2VUM G;  5FK9 C;  4IOC A;  2RVL A;  2ZXO A;  5CGK A;  1VQC A;  2HIX A;  1I5F A;  1QB5 D;  3NBH B;  1SMY D;  4AIM A;  1HNZ L;  1HNW L;  1OXU A;  1TT2 A;  2J0T D;  5E1F A;  3RLF A;  4GN4 B;  4DAV A;  5M5W B;  2RBM A;  4C2M B;  5LMN Q;  1SXT A;  3Q22 A;  3OSO A;  1EL0 A;  2NUC A;  3S16 B;  2Z6B A;  2RSN A;  4IOA A;  1S5E D;  1YVC A;  3CKI B;  4IQZ A;  4R4Q A;  3TP6 A;  2CCZ A;  1A15 A;  3J80 L;  1A0I A;  1SRU A;  2UUC L;  4ILW A;  1UNS A;  2PCF B;  5ELE A;  4C1N I;  2R6G A;  2VB3 X;  2AUK A;  4XYO A;  3S1M B;  1M8A A;  5C3X A;  1SYC A;  4KHP Q;  4B3T L;  4IUP A;  2NB0 A;  2VXW A;  1C4Q A;  4JOI C;  4Z9C B;  1V9P A;  5IY0 A;  2CWP A;  1X3G A;  5ISR A;  2ES2 A;  3S1Q B;  4NXN Q;  3OMC A;  1TWC H;  4DV7 Q;  1PXU A;  3AU7 A;  4MZ9 A;  2K01 A;  3I56 A;  4P75 A;  1SE8 A;  1CZG A;  4LUO A;  1M90 C;  4H7B A;  2X6G A;  4EVO A;  1KC8 C;  1G29 1;  4L5T A;  2B8F A;  4CJ0 B;  2F0V A;  1IBL L;  2E8G A;  3J80 c;  3I70 A;  2CHB D;  1SBB B;  1LTL A;  1DOM A;  3PF5 A;  4WJW A;  3NTI A;  4H44 C;  5IGD A;  4DA2 A;  1FL0 A;  1IW7 C;  3V2T A;  1B53 A;  3VR2 A;  4M1U B;  3HOX G;  4IUN A;  2XGT A;  3CF5 A;  2Y0S B;  4JW0 A;  2I5L X;  3F8T A;  3IFT A;  4LWC A;  1HPC A;  4A3E B;  2DNC A;  4C3J B;  1R9T H;  4A3M B;  1V1O A;  4O0A A;  5ELN A;  4LFA Q;  3OTO Q;  3VYT A;  4A93 G;  3KK7 A;  2K03 A;  2NZH A;  4TQU S;  1MBY A;  1WJJ A;  3I4O A;  1PZJ D;  5DLQ E;  1S72 A;  4RGT A;  4DXF A;  2E2J B;  1I4H A;  2CKZ B;  1Y1V H;  5KEE A;  3CQZ B;  1I4Q A;  1ZKO A;  1P16 A;  3S15 B;  4Y52 H;  1BCP D;  2A68 D;  3ERQ A;  2JEA I;  3H15 A;  3A8K E;  5C0X J;  1XXG A;  1K73 C;  4IFD H;  3S2D B;  1RDP D;  5M5Y B;  1HNX L;  2HIV A;  1EYD A;  3NEL A;  5ELO A;  3S15 H;  2EQS A;  1CK1 A;  5HGQ A;  4ZKB B;  2AQ2 B;  4P72 A;  4DR2 Q;  5E4X A;  1BCP C;  1VQD A;  1K28 A;  3DMU A;  2LKV A;  5EKK A;  4JI7 Q;  4WFN 3;  4DR7 L;  4KKS A;  3KBG A;  2KQ3 A;  1TWH B;  2K4K A;  5M3F B;  3BS1 A;  3H91 A;  4BY7 B;  3CAM A;  2IX0 A;  4QGU A;  3T51 B;  3Q24 A;  1VF7 A;  3NSW A;  4QIW B;  1DM0 B;  1L1O A;  1E1T A;  3GV6 A;  3I4M B;  4JBK A;  2EZV A;  1FYC A;  3TZU A;  3GTM B;  5C4Z A;  3MHB A;  2N88 A;  1WTX A;  4JPB W;  4DV6 Q;  2SNM A;  2WB1 G;  4UP9 A;  1H95 A;  4JI1 L;  5IOD A;  2DY8 A;  4YWK A;  2AQ3 B;  4DK1 A;  2I46 A;  1KDC A;  2WIN B;  1RL2 A;  3D4R A;  3GTP H;  2JA6 B;  1IKL A;  4GNX B;  2D9U A;  4KHP L;  1AZP A;  4GLA C;  2Q2I A;  1I4G A;  4UAI A;  1FNV A;  3LX0 A;  1Y8P B;  4BY1 G;  3VR6 A;  3VYU A;  1HTL D;  3K5L A;  4B3S L;  5C4X G;  3P20 A;  1BDO A;  1K8A C;  5FJ8 G;  2NWG A;  3PO3 G;  3GTP B;  3FRP B;  4C3I B;  4QF4 A;  1MSH A;  1B7Y B;  1XPU A;  2AKW B;  1T5E A;  1NMF A;  1QNU A;  5ELD A;  1EU4 A;  2HDM A;  3H09 A;  4GKJ Q;  3OMG A;  2L15 A;  2AHO B;  1EY7 A;  1V8Q A;  1Q82 C;  5EAY A;  3X3M A;  3VDY A;  4J1M A;  3ND9 A;  5GAH C;  3T1Y Q;  1IL8 A;  1XPR A;  3HOU B;  1S5B D;  5DAU A;  1UUP A;  3SK5 A;  4KI0 A;  1K83 B;  4LFB Q;  2QKI C;  5BN3 A;  1TS2 A;  1PHJ A;  3S14 H;  4ZUI A;  2B2U A;  4J8Q A;  4PMC A;  1YHQ A;  3K6O A;  1HUM A;  3M4P A;  3ICE A;  4DU9 A;  3H0G H;  1TVX A;  4Y7N B;  4A3G H;  2A6E D;  4MTN A;  2RHS B;  1SFO B;  5KND A;  2ID0 A;  5GRO A;  2Y0S G;  4PZ8 A;  2K52 A;  2E76 C;  3NBH A;  2R3Z A;  3HOX B;  2LS0 1;  2EYP A;  3IAY A;  4EQO A;  2SEB D;  4A3D G;  3P7J A;  2EIF A;  2BDN A;  1YNJ D;  2FMC A;  1KD1 C;  3M3Y B;  4OO1 I;  3HOZ G;  2X69 A;  4S3S A;  3PO3 B;  1Y69 U;  4BBS H;  1E2W A;  4LF9 Q;  2XTI A;  4DV1 Q;  4LF7 L;  4DR5 L;  4OX9 L;  1VQ4 A;  2JA6 G;  4GN3 B;  5KNC A;  4JOI A;  4DR4 Q;  2Y0S E;  3BDL A;  1ASZ A;  5FLX L;  4OO1 G;  3HS0 C;  3NK9 A;  3LNN A;  4DR3 Q;  3KF8 A;  3GTL B;  5IYB H;  3PUV A;  3CCJ A;  3CC4 A;  3VA7 A;  4A3B G;  2D0P A;  1AN8 A;  4AH6 A;  1UEA B;  3NTH A;  3JAM E;  3Q6S A;  5DM7 3;  2KHS A;  3L9A X;  5LMU Q;  1MGS A;  4A4I A;  2V4D A;  4X64 L;  2R93 H;  4JI7 L;  4O1N A;  5IYD G;  4A3K G;  1ZYR C;  3I8Z A;  5EPJ A;  5K36 G;  1A2U A;  2Q2H A;  1FGU A;  1Q81 C;  1CA6 A;  3PO2 H;  2KVM A;  2PZW A;  2UUA L;  2PMZ E;  1Q90 A;  1JR0 D;  3CHB D;  3DHQ A;  1OXS C;  5A2Q L;  4XT3 B;  4QUF A;  4A93 B;  1E1O A;  4A3J B;  4P2C B;  3HGB A;  4KY5 A;  4LF4 Q;  3OTO L;  3EQL C;  2VQF Q;  2F0W A;  1TY0 A;  2VZA A;  4OON A;  4L8J A;  5CC4 A;  2EXD A;  4LJZ C;  4PQX A;  3OPO A;  2LY7 A;  2NVQ H;  4DR4 L;  1U5K A;  2KCC A;  1L2F A;  2HQE A;  3L3O C;  4UY8 C;  1W6J A;  2F3W A;  1LT6 D;  3A5Z B;  3GD7 A;  5M5Y H;  3LWE A;  1EQR A;  1KQS A;  3WDN A;  1KAB A;  3HOX H;  1KTK A;  2B2V C;  3QOL A;  2KJX A;  4NXM Q;  3PUZ A;  4ABN A;  1A3T A;  2ZJQ A;  3MEF A;  3H6M A;  3ULJ A;  4KY6 A;  5CV5 A;  1DZ1 A;  2Z9H A;  3QOJ A;  1O7Y A;  1LT3 D;  3A7L A;  1PV4 A;  1X32 A;  1K8O A;  4KMU C;  4MN3 A;  2NN6 G;  4RH6 A;  1TWG H;  2O5I C;  3OIP A;  2VUM B;  2F0D A;  2ZM6 Q;  3Q8D A;  4LFB L;  4A3M H;  4A3L H;  2NVT B;  2R7Z H;  3BYT B;  5FO9 B;  4U67 3;  1ESR A;  1O7L A;  2F52 A;  2EPB A;  4CHT B;  5D14 A;  2K5N A;  5IGE A;  3M7G A;  4X66 Q;  5D3D A;  1L1O C;  5G3L D;  1UWV A;  2WKC A;  5M5X H;  3VR5 A;  4BXX H;  4APV A;  3K5O A;  1WFQ A;  1EYA A;  2DJF C;  5HUR A;  2N55 A;  4A76 A;  1OXT A;  3IL8 A;  2E2H H;  4I7Z C;  3GO5 A;  5F2D A;  2EY2 A;  2F0I A;  5I9O A;  5J3B A;  4BY1 H;  3BDO A;  4M8A A;  3V05 A;  2OXP A;  4DV4 L;  2B2T A;  3KDF B;  2IX3 A;  4RKL A;  4IUR A;  5EJW A;  1EOT A;  2MPM A;  3TQY A;  1EY8 A;  4G7H C;  4KD3 A;  2QEJ C;  1F9R A;  1AP0 A;  1QVG A;  2ZXP A;  4GZY C;  4B3S Q;  1H9S B;  1Q8K A;  1E3P A;  1TS5 A;  1RTO A;  5HGT A;  1PZK D;  5C44 H;  3S1M H;  4CKE A;  2F0T A;  1LT4 D;  4A3I H;  4DV4 Q;  5K5P A;  1KXL A;  2JEB I;  5M3F H;  2HT1 A;  1FGB D;  1UE7 A;  2EJF C;  2A8V A;  1U4R A;  1ILQ A;  2A69 C;  3E6Z X;  1ILP A;  1D5Z C;  3I3C A;  1PMR A;  2QW7 A;  4ZQ3 A;  3ZJY C;  5IP9 H;  1YIJ A;  3WWV A;  4PZ7 A;  1SNC A;  1NUC A;  5DEH A;  5AJ3 L;  3GTG H;  1AZQ A;  2F0P A;  3GTK H;  1SE3 A;  5M3M B;  2RF4 A;  1SNO A;  1SAP A;  3TME A;  2Q8T A;  4A3L G;  1VF5 C;  2MUY A;  4TKO B;  5L37 A;  1I6V C;  2B2W A;  1F9Q A;  3VYR A;  3JAM L;  1Y1V B;  1VQ9 A;  4JI2 L;  3GTK B;  3PUX A;  2M9V A;  3NTK A;  1IW7 D;  1LM0 A;  1YNJ C;  3RR5 A;  2JA8 B;  2WAC A;  1BOS A;  4EX5 A;  4P73 A;  5IIF A;  1NNX A;  3R3O A;  3S2H B;  4YHH Q;  4OX9 Q;  5AJ3 Q;  4LF6 Q;  4RKB A;  1SYF A;  2JSO A;  1VQP A;  4KN4 C;  1TII D;  3SK8 A;  2I0Q A;  4A3F H;  4JI6 Q;  4DFA A;  1PTO H;  1KHI A;  5M3M H;  3J80 E;  4FF4 A;  4E6I A;  3E0J A;  3I4M G;  1T9H A;  1OO9 B;  4CDC C;  2F0G A;  1Y1W G;  5IYC H;  3K0Y A;  1XPO A;  3I7F A;  1XMO Q;  5KIX A;  2WB1 E;  4XDX A;  2JA5 G;  3NBI A;  3U9O A;  2EJG C;  1X3E A;  3IRB A;  1JE4 A;  2CW0 D;  4Q5V A;  2PQE A;  2QEX A;  5C0X G;  2RDG A;  3W2D A;  4BBR B;  3T1Y L;  4XT1 B;  4LF5 L;  4IZ8 A;  5E3F A;  1SYD A;  4OIK A;  3T53 B;  4HCS A;  2WAQ E;  3CCL A;  4K8J A;  5JJK A;  3KF6 A;  4MTK A;  3GTO H;  3E9H A;  4FXD A;  1F77 A;  4RMF A;  2UXC Q;  1OTC A;  1K8G A;  1F2L A;  2VL6 A;  1CKM A;  2OTJ A;  2MGS A;  1QUQ A;  4XYQ A;  3KDF A;  1MSG A;  1KDA A;  5AFW A;  1XMQ Q;  3NWS A;  2K50 A;  2E5L Q;  1IBL Q;  1VQM A;  5CV9 A;  3W1B A;  2ZTC A;  4DR1 L;  1JB3 A;  3DM3 A;  3GQB A;  2QDL A;  2ASB A;  2OT2 A;  4JI0 L;  3D0F A;  2E74 C;  1H9R A;  1TWF H;  5GQO A;  4C3J G;  1I3Q H;  2K1B A;  2Q8R E;  1N34 Q;  2ZJP A;  1M4V A;  2B2T C;  1PYS B;  2IHE A;  2OQK A;  1MHW C;  1O7Z A;  1VMP A;  1FJG L;  5ELF A;  4DK6 C;  2I5H A;  4R4I A;  1E7Z A;  4NXM L;  4DV2 L;  1F2M A;  1D5X C;  3A5U A;  2GVB A;  3J81 c;  3RD4 A;  5LL6 X;  1PTO B;  2CWA A;  1YI2 A;  2HD3 A;  1JOR A;  4C3H B;  3ND8 A;  5EGT A;  4JK1 C;  4HJ8 A;  1QVF A;  3QJY A;  5LL6 S;  2K28 A;  3AMU A;  4KJO A;  1CSQ A;  2MNA A;  4GN5 A;  3EFX D;  4JI1 Q;  5G3L F;  3JC6 6;  1KAA A;  1DGS A;  3CCE A;  4NB3 A;  1JIC A;  3BZD B;  4PNY A;  4OHJ A;  3TRZ A;  4GOP A;  4JI0 Q;  2OEO A;  4A3J H;  1S5D D;  2CVR A;  1PTO F;  4DKA C;  1WVL A;  1JWS D;  5C4J H;  3GTJ B;  1U9R A;  4ZK9 B;  1F2Y A;  3BVM A;  3G71 A;  4JC0 A;  1HCZ A;  4DV3 L;  5C0X H;  1NAP A;  2UUB Q;  4B3R L;  4X3U A;  1A6X A;  3S9W A;  3TP7 A;  3GTO B;  2F0E A;  1X6O A;  2KHJ A;  3UDG A;  3MAQ A;  2C9O A;  4L63 B;  4TSS A;  2EVB A;  1BR9 A;  2JA5 H;  1CKN A;  3S1R B;  1PZI D;  3M4Y A;  3K57 A;  4YWL A;  3UI2 A;  4ID6 A;  3HOV B;  2JA7 G;  1BBX C;  3J81 i;  1B3A A;  2A6H D;  3G6J B;  4DR2 L;  3TDQ A;  2SOB A;  3AFQ A;  4A3C H;  5M9O A;  1PRT F;  1CZW A;  1TWG B;  1XNR L;  1PTO C;  2A68 C;  3S2H H;  1ICF B;  1P8L A;  2IJ0 A;  3TP5 A;  4NDX A;  3I2Z A;  4X62 Q;  3ZYY X;  4EGV A;  2ZM6 L;  5J22 A;  1PTO D;  3M4Q A;  4GOP B;  4BBS B;  1FVI A;  4HID A;  4RCO A;  5COR A;  1A62 A;  4AYB B;  1EWI A;  4C3H G;  1U0L A;  4LF9 L;  3BYY B;  2RCN A;  3GTG B;  3CPW A;  1LO5 D;  3SGI A;  1WTR A;  4IUT A;  3DWQ A;  2OCE A;  1G6P A;  4JG2 A;  4PMW A;  4X62 L;  5DM6 3;  1D2B A;  2EXZ A;  4DR1 Q;  1IYJ B;  5IWA Q;  2EYL A;  3CRK C;  4BS9 A;  1VQ8 A;  3MVV A;  3ULL A;  2MQH A;  3L0O A;  2F1M A;  5EPK A;  2E2D C;  1HTP A;  2VY3 A;  1IBM Q;  4OIJ A;  4YHH L;  4A3J G;  3KFU A;  1IKM A;  3R8B A;  1FR3 A;  2HHH L;  1GHJ A;  4A3K H;  4H0L C;  1JQY D;  4ME3 A;  3VYS A;  1FJG Q;  1CT1 D;  2R92 H;  3KLR A;  4NXN L;  4DUY Q;  2RSO A;  1V1P B;  2PZT A;  1H9K A;  2OQ0 A;  5FLX c;  3K7A H;  1EUJ A;  4JV5 L;  2EYH A;  2I5M X;  3OYY A;  4LK1 C;  2HDL A;  5IGC A;  4HIO A;  3HOY G;  4K6L A;  1KNA A;  2D62 A;  4C1N K;  4ZRZ A;  1HFN A;  3FVQ A;  3BG3 A;  4K5W A;  4K14 A;  4OWW B;  3GTQ H;  1LTB D;  4LF4 L;  2KOL A;  2F03 A;  1R4P B;  4V19 0;  2L9H A;  1KDB A;  2N3S A;  4C3I G;  2E2I H;  1UE5 A;  1LLR D;  2PQA A;  1EZ6 A;  2JQO A;  1HA5 A;  4X65 L;  3CCR A;  1G2S A;  1RCV D;  5IT9 L;  2RDF A;  5C4X H;  1TQO A;  4LUZ A;  1QZG A;  4KHZ A;  2A19 A;  5I6Y A;  1EEF D;  1ICW A;  3MEH A;  4FXG C;  2DN8 A;  4DV6 L;  4OL7 A;  5JPN C;  1Q3L A;  4B3M L;  4GOP C;  4IPC A;  2FJ2 A;  1BF4 A;  2E5L L;  2YV5 A;  3K7A B;  3PO2 G;  3CU7 A;  3K81 C;  4IJH A;  5C0X I;  1ENF A;  4EQP A;  3JAM i;  1PRT C;  2Z6K A;  1L1O B;  4A75 A;  3I4M H;  4JI6 L;  1PDQ A;  1SE4 A;  1VQ5 A;  2NVT H;  2F0K A;  4RCN A;  3I4N H;  1BKB A;  1X65 A;  2Z0S A;  4R1J A;  1EIF A;  1VDZ A;  1VQB A;  1D5M C;  5EPL A;  1SEB D;  1XNR Q;  4NW2 A;  1HH2 P;  1A8V A;  2NTS A;  2UXD Q;  3F2B A;  3AB9 A;  1H9J A;  1S3O A;  3CQZ H;  3SE0 A;  5C3E B;  2X6L A;  1WTP A;  3FKI B;  2J4X A;  4YCU A;  2L5T A;  4CDD C;  2PNR C;  1JOK A;  2F0F A;  2NVY H;  3EJI A;  3PUY A;  2EJM A;  3VR3 A;  3CC7 A;  2WP8 J;  3DUZ A; 
#chains in the Genus database with same CATH homology
 3SK6 A;  1B1Z A;  4KKU A;  2DNE A;  4RHS A;  4DN4 M;  3NQT A;  4HMI A;  4FYD A;  2KED A;  2Z1C A;  4FF2 A;  1Y8O B;  5IGG A;  3PUW A;  1STG A;  4HAE A;  2C5C A;  3BVZ A;  2CW0 C;  4YIJ A;  3DWA A;  2QF7 A;  2R61 A;  1I6H B;  4Q0F A;  4BA2 I;  3U9S A;  1JWU D;  1ONL A;  1PRT B;  2K5W A;  2KEE A;  1XWE A;  5D3I B;  1E2V A;  1ZYR D;  5C4X B;  3SEB A;  4IN3 A;  1DJR D;  4KV6 A;  2ZT9 C;  2BA0 A;  1HQR D;  1BCP B;  1LV9 A;  3SDZ A;  4QCL A;  5JAV A;  1TR5 A;  3HG9 A;  2I07 B;  2NBF A;  5I9P A;  1PLF A;  3URY A;  3CRL C;  5CBE E;  3WOF A;  2EYF A;  3O13 A;  1KLG D;  2BE5 D;  2TSS A;  2O2L D;  5C3W A;  3I4N B;  1B4O A;  4FP5 D;  4HMJ A;  5KGU A;  3SVM A;  1A3V A;  1HFG A;  2G9H D;  4DF7 A;  3DXJ C;  3MXG A;  5EQ0 A;  3D6W A;  3OWE B;  4J6H A;  1LTR D;  2E2I B;  2PO4 A;  3HRZ C;  3MXN A;  2F3V A;  1LTG D;  5FO7 B;  4HCE A;  1RTN A;  5C5M A;  2FMM A;  2NN6 H;  3A7A B;  4XIG S;  2SNS A;  1RHP A;  4PMB A;  1ESF A;  2A5H A;  1RD9 D;  1AFP A;  1STE A;  4G7O C;  5EBC A;  1CTM A;  3ERO A;  1S4Z A;  3R2T A;  1Z7T A;  3C1F A;  3FEW X;  3ITP A;  2QDB A;  1XTC D;  2L1B A;  1HA6 A;  2D2C C;  5CV4 A;  1F2Z A;  2JA7 B;  3MC0 B;  2MJ8 A;  1TKW B;  4N9T A;  5ELB A;  3MFY A;  5A35 A;  2K05 A;  3N52 A;  1FD7 D;  4K5V A;  3BVG A;  1JOO A;  4KN7 C;  1SYG A;  2FIN B;  3SK4 A;  2L4N A;  2AUJ D;  2BOS A;  1TWC B;  2K7V A;  1C48 A;  2F0U A;  4NKL A;  2A74 C;  3R2I A;  1AW7 A;  1CI3 M;  2JP1 A;  5DNF A;  2EY6 A;  4KTA A;  1Q12 A;  3GV3 A;  2F0H A;  4NMZ A;  3MA2 B;  1SNM A;  3A56 A;  1PFN A;  2PZU A;  3K5N A;  2K33 A;  1PRT D;  3EA6 A;  1SNP A;  4K8I A;  3NP8 A;  4HN7 A;  3MWY W;  3MZ5 A;  1LTT D;  5JOB A;  5CYU A;  1F9S A;  4QB4 A;  4IUU A;  5JEA G;  4ZLT F;  5COY A;  4A3I B;  2XWB B;  1CQV A;  1DYQ A;  4FXK C;  3A55 A;  3K5M A;  5CV7 A;  3LWU A;  1Z6H A;  3NXW A;  1WTW A;  4L6T B;  2KCN A;  3DEO A;  3Q23 A;  3NUC A;  4G4K A;  1LT5 D;  3PIP 3;  3KUP A;  4K6D A;  2F4I A;  4XTC S;  1GJX A;  3C3L A;  5J1Z A;  2EYJ A;  1BQQ T;  2K32 A;  4RHR A;  3QO2 A;  3DWP A;  2FFK B;  4RFB A;  1S5C D;  5C5L A;  4KJN A;  2BCO A;  2L11 A;  3EVQ A;  4ZAI A;  2B2V A;  4B9X A;  1JC7 A;  3QIA A;  4K5X A;  3PIO 3;  1I3Q B;  1D1K A;  5IOC A;  3A8I E;  3C2P A;  2O4X A;  1J9O A;  3GP7 A;  4XQJ A;  3V96 A;  2NTT A;  1RJT A;  3IKJ A;  1SE2 A;  5C6A A;  1ROD A;  2H1E A;  2AWN A;  3SHL A;  3NWT A;  3OW7 A;  3MXU A;  1S5F D;  5JEA H;  2IW3 A;  4X3S A;  4C56 C;  4HED A;  2PYK A;  1ML0 D;  2AWO A;  2JYO A;  3J7Y W;  1EY5 A;  2QCP X;  2EOT A;  1G2T A;  3T16 A;  3OWF A;  1EYC A;  5T1G A;  1CHP D;  1GUN A;  1QJO A;  4QMG A;  1CHQ D;  2VNU D;  4R8I A;  1SYB A;  4X3K A;  5D65 A;  1FNU A;  2ICE C;  1R4Q B;  2L55 A;  1EY4 A;  4A3F B;  2DY7 A;  2L12 A;  3J7A V;  2D5D A;  4KD4 A;  1BO0 A;  2R93 B;  1GUO A;  1ET6 A;  1EIG A;  3HZX A;  4A3D B;  4BA1 I;  4G57 A;  3PMF A;  2Z4I A;  1HUN A;  4F87 A;  4FF1 A;  3I73 A;  2IWH A;  1B9N A;  1STA A;  1QIL A;  3RMH A;  4MIU A;  1GUT A;  3MTS A;  2PMZ B;  5BN4 A;  1NSN S;  3MFG A;  1NCV A;  1G91 A;  3M85 A;  5NUC A;  5FKA C;  1PFM A;  5CV6 A;  5CBA E;  5C44 B;  1MD2 D;  2B8G A;  1BXT A;  2KUM A;  3D31 A;  2M2L A;  1I4P A;  2KA7 A;  3K58 A;  1WD0 A;  4A3G B;  2ENB A;  2F0N A;  2IX1 A;  4DAY A;  5E4W C;  1RKN A;  1GOZ A;  2Q8I B;  3C1E A;  4IFD I;  1WTQ A;  2B63 B;  1EEI D;  4NP5 A;  1CM9 A;  5JJZ A;  1OXX K;  4ODG A;  3KLS A;  1JCK B;  2LMC B;  1Q8I A;  1SJH D;  2XSC A;  3I4L A;  1GXD C;  5M5X B;  1DD2 A;  2K6A A;  2RA4 A;  3X3N A;  4ZYS A;  3DM1 A;  2F0J A;  1HHV A;  3OIQ A;  1CFM A;  1QNK A;  1W6K A;  4XQN A;  3KBX A;  2R7Z B;  1II3 A;  3T13 A;  3D4W A;  3ONA B;  4OO1 H;  4FNF A;  4XQQ A;  1Q1B A;  4IUV A;  5IGF A;  4H13 C;  1ET9 A;  2L0C A;  1IYV A;  1STY A;  1X3P A;  1TS4 A;  3DEP A;  5I2Y A;  2XVS A;  3S1N B;  2B2U C;  3FPU B;  2K5D A;  1WCM B;  1GUW A;  4RGM A;  2NN6 I;  4PV1 C;  1ENC A;  2RQX A;  1X3Q A;  3J7A F;  5I6W A;  5FO8 B;  1SSO A;  1GHK A;  2XRQ D;  1HQM C;  1T5X D;  4MHE A;  5K36 H;  1B2T A;  3IFD A;  3NE5 B;  4HR7 B;  4WRD A;  1JWM D;  5KYI A;  1DON A;  3VA5 A;  2RKS A;  3H94 A;  3Q0A A;  2HCC A;  1QWY A;  2NVQ B;  2AQ1 B;  5CMD A;  3KLS X;  3PO2 B;  5KYL A;  4U68 A;  2XWJ B;  4R8N A;  2Z8L A;  2LFN A;  2BA1 A;  1HXY D;  5A2Q E;  3S14 B;  2JXM B;  4IFD G;  1L0Y B;  3OHX C;  1VCI A;  2JA5 B;  1EY6 A;  3VR4 A;  1CQF A;  1EZ8 A;  4IFD J;  3FMC A;  5TSS A;  3QWN A;  3OOC A;  1U4L A;  3HEJ A;  5KNB A;  4FF3 A;  1ENA A;  1KNE A;  5EBD A;  2E75 C;  1O80 A;  1DCZ A;  2MP1 A;  4I65 A;  1IHZ A;  2HCI A;  3FDT A;  2EY1 A;  2NVY B;  1STB A;  1Y8N B;  1TY2 A;  5EKI A;  2BDO A;  1I50 B;  5JEA J;  1B9M A;  1C8C A;  2PPB C;  4HSP A;  4KK7 A;  1ZXT A;  3I91 A;  3GTQ B;  3P75 A;  3M7N A;  1V43 A;  3H0G B;  4DGZ A;  5IT9 E;  3N6R A;  1GUG A;  5T1I A;  3RUZ A;  4KY7 A;  3T56 B;  1SJE D;  2JE6 I;  4HTH A;  1EIH A;  1V1P A;  4CKC A;  4DXG A;  2O5J C;  1STH A;  5JVG 3;  4X3T A;  1WTV A;  1DOL A;  2B2W C;  1NR4 A;  1DXM A;  1FNW A;  4CBV A;  2NYZ D;  2CQA A;  1B44 D;  3D4D A;  3NPP A;  1EY9 A;  3TP8 A;  4F8M A;  4EQN A;  4FVM A;  3F2U A;  3W3A A;  1E2Z A;  4OGQ C;  2IL8 A;  1R9T B;  1GUS A;  4RGN A;  2G9D A;  2F0M A;  3D6C A;  3WOE A;  1KLU D;  1D1I A;  1L0X B;  3MXP A;  1QE6 A;  4V0B A;  4G7Z C;  2K5Q A;  3E5S A;  3TZD A;  2R92 B;  1H9M A;  2F0Q A;  3H3V C;  2SDF A;  1SND A;  2WB1 B;  1DOK A;  2XRS D;  2YYZ A;  4K2K A;  2B39 A;  1BNZ A;  4HSV A;  1PYW D;  2EYO A;  2F0L A;  2A69 D;  5I2X A;  4KHV A;  1SNQ A;  1EU3 A;  1EY0 A;  1EWH A;  4O42 A;  5JPM C;  2F0O A;  4RGO S;  1XX8 A;  2WAQ B;  1YNN D;  1SDF A;  4DNR B;  2K04 A;  4RAU C;  5C4J B;  3HKZ B;  4FO2 A;  4IUQ A;  4CGY B;  2B2Y C;  1LAB A;  1STN A;  2A6H C;  3TBI B;  1Z47 A;  2GA4 B;  3HOZ B;  1YNN C;  3NQI A;  1TS3 A;  2A6E C;  3M4O B;  1NR2 A;  2XIW A;  3RZO B;  4RWS C;  4K2L A;  2ZXR A;  4BWG B;  4QUC A;  4DAP A;  1A3U A;  4F7X A;  2WKD A;  4N9P A;  1IYU A;  1ZEQ X;  3T4A C;  2KEC A;  1QG7 A;  2Z4H A;  1H9S A;  3HOW B;  2M00 A;  1G6Z A;  1Y1W B;  4LAA A;  1AEX A;  4TRD A;  2WV6 D;  1J8I A;  1HRJ A;  5FLX E;  1K8M A;  1LTA D;  1Q1E A;  3HOY B;  2BE5 C;  2IPK D;  4ZUJ A;  3S17 B;  1LTS D;  4R9W A;  2EY5 A;  2MHV A;  3HP3 A;  1SMY C;  1CA5 A;  3BDC A;  3D3R A;  1O78 A;  4BY1 B;  2NVX B;  1LAC A;  1I4R A;  1EQV A;  4IAL A;  3A54 A;  3NHH A;  1U4P A;  4B08 A;  4WOR A;  4A3K B;  2OF1 A;  5LHY 1;  1XYI A;  2F0S A;  1VMC A;  1EFI D;  1OXV A;  1JOQ A;  3FPP A;  5ELC A;  5I4D A;  5BN5 A;  1U4M A;  2VB2 X;  1D6E C;  1RF2 D;  5CR3 A;  3K59 A;  2YU9 B;  1WD1 A;  3A8J E;  1QOH A;  1A2T A;  1QCB D;  4B9W A;  1EWC A;  2PW7 A;  3I72 A;  5IGB A;  2B2Y A;  1B50 A;  3RZD B;  3P1H A;  4CKB A;  1E0B A;  4LMQ D;  2TMP A;  2ICI A;  1TWF B;  1SYE A;  4ME5 A;  1UAP A;  3J81 L;  4DK0 A;  5C4H A;  3TSS A;  1PFB A;  3C46 A;  4ULL A;  1EQT A;  2WII B;  2A73 B;  4F88 A;  4JBW A;  4DNT B;  3TN2 A;  3G7L A;  4ZKC B;  2PW5 A;  1BUV T;  3SXH A;  5KRU A;  1LTI D;  3QG1 A;  1MI2 A;  4UDU C;  4CJ2 C;  2HUG A;  5EKL A;  3J81 E;  2J7Z A;  4XXE A;  2IT1 A;  2NZ1 D;  3D8G A;  4A3B B;  2EDG A;  2XNA C;  3SR1 A;  5JVH 3;  3QB3 A;  5J39 A;  1WTO A;  3L7Z C;  2FHT A;  3R93 A;  2EE1 A;  3PV0 A;  2EYM A;  4KKT A;  1G8Z D;  1F9P A;  2QIL A;  2RDH A;  4CJ1 B;  5FOB B;  2H4O A;  1TU2 B;  5CV8 A;  2XN9 C;  3I90 A;  4RA8 A;  1I4X A;  1BCP F;  2E2H B;  1TWA B;  5FK9 C;  2RVL A;  2ZXO A;  5CGK A;  1QB5 D;  1SMY D;  1OXU A;  1TT2 A;  2J0T D;  5E1F A;  3RLF A;  4DAV A;  5M5W B;  2RBM A;  4C2M B;  1SXT A;  3Q22 A;  3OSO A;  1EL0 A;  2NUC A;  3S16 B;  2RSN A;  1S5E D;  3CKI B;  4IQZ A;  3TP6 A;  1A15 A;  3J80 L;  4ILW A;  1UNS A;  2PCF B;  5ELE A;  4C1N I;  2R6G A;  2VB3 X;  2AUK A;  4XYO A;  3S1M B;  1M8A A;  5C3X A;  1SYC A;  4IUP A;  2NB0 A;  2VXW A;  1C4Q A;  4Z9C B;  5ISR A;  3S1Q B;  3OMC A;  1PXU A;  3AU7 A;  2K01 A;  1CZG A;  4H7B A;  2X6G A;  4EVO A;  1G29 1;  2B8F A;  4CJ0 B;  2F0V A;  3I70 A;  2CHB D;  1SBB B;  1DOM A;  4WJW A;  3NTI A;  4H44 C;  5IGD A;  4DA2 A;  1IW7 C;  3V2T A;  1B53 A;  3VR2 A;  4M1U B;  4IUN A;  2Y0S B;  3IFT A;  1HPC A;  4A3E B;  2DNC A;  4C3J B;  4A3M B;  1V1O A;  3VYT A;  3KK7 A;  2K03 A;  4TQU S;  1MBY A;  1PZJ D;  4RGT A;  4DXF A;  2E2J B;  1I4H A;  5KEE A;  3CQZ B;  1I4Q A;  1ZKO A;  3S15 B;  1BCP D;  2A68 D;  3ERQ A;  2JEA I;  3A8K E;  5C0X J;  1XXG A;  4IFD H;  3S2D B;  1RDP D;  5M5Y B;  1EYD A;  1CK1 A;  4ZKB B;  2AQ2 B;  5E4X A;  1BCP C;  3DMU A;  2LKV A;  5EKK A;  4WFN 3;  4KKS A;  3KBG A;  2KQ3 A;  1TWH B;  5M3F B;  3BS1 A;  3H91 A;  4BY7 B;  2IX0 A;  3T51 B;  3Q24 A;  1VF7 A;  3NSW A;  4QIW B;  1DM0 B;  3GV6 A;  3I4M B;  2EZV A;  1FYC A;  3TZU A;  3GTM B;  5C4Z A;  3MHB A;  2N88 A;  1WTX A;  2SNM A;  5IOD A;  2DY8 A;  2AQ3 B;  4DK1 A;  2I46 A;  1KDC A;  2WIN B;  3D4R A;  2JA6 B;  1IKL A;  2D9U A;  1AZP A;  1I4G A;  4UAI A;  1FNV A;  3LX0 A;  1Y8P B;  3VR6 A;  3VYU A;  1HTL D;  3K5L A;  3P20 A;  1BDO A;  2NWG A;  3GTP B;  3FRP B;  4C3I B;  4QF4 A;  1MSH A;  1T5E A;  1QNU A;  5ELD A;  1EU4 A;  2HDM A;  3H09 A;  3OMG A;  1EY7 A;  1V8Q A;  3X3M A;  4J1M A;  3ND9 A;  3HOU B;  1IL8 A;  1S5B D;  5DAU A;  1UUP A;  3SK5 A;  4KI0 A;  1K83 B;  2QKI C;  5BN3 A;  1TS2 A;  4ZUI A;  2B2U A;  4J8Q A;  4PMC A;  3K6O A;  1HUM A;  4DU9 A;  1TVX A;  4Y7N B;  2A6E D;  1SFO B;  5KND A;  2ID0 A;  2E76 C;  3NBH A;  2R3Z A;  3HOX B;  2LS0 1;  2EYP A;  3IAY A;  4EQO A;  2SEB D;  3P7J A;  2BDN A;  1YNJ D;  2FMC A;  3M3Y B;  4OO1 I;  2X69 A;  4S3S A;  3PO3 B;  1Y69 U;  1E2W A;  5KNC A;  3BDL A;  5FLX L;  4OO1 G;  3HS0 C;  3NK9 A;  3LNN A;  3KF8 A;  3GTL B;  3PUV A;  3VA7 A;  1AN8 A;  1UEA B;  3NTH A;  3JAM E;  3Q6S A;  5DM7 3;  2KHS A;  3L9A X;  1MGS A;  2V4D A;  4O1N A;  1ZYR C;  3I8Z A;  5EPJ A;  5K36 G;  1A2U A;  1CA6 A;  2KVM A;  2PZW A;  1Q90 A;  1JR0 D;  3CHB D;  3DHQ A;  1OXS C;  5A2Q L;  4XT3 B;  4QUF A;  4A93 B;  4A3J B;  4P2C B;  3HGB A;  4KY5 A;  3EQL C;  2F0W A;  1TY0 A;  4L8J A;  5CC4 A;  4PQX A;  4LJZ C;  3OPO A;  2LY7 A;  2KCC A;  2HQE A;  3L3O C;  1W6J A;  2F3W A;  1LT6 D;  3GD7 A;  3LWE A;  3WDN A;  1KAB A;  1KTK A;  2B2V C;  3QOL A;  2KJX A;  3PUZ A;  4ABN A;  1A3T A;  3H6M A;  4KY6 A;  5CV5 A;  1DZ1 A;  3QOJ A;  1O7Y A;  1LT3 D;  3A7L A;  1X32 A;  1K8O A;  4KMU C;  4MN3 A;  2NN6 G;  4RH6 A;  2O5I C;  3OIP A;  2VUM B;  2F0D A;  2NVT B;  3BYT B;  5FO9 B;  4U67 3;  1ESR A;  1O7L A;  2EPB A;  4CHT B;  5D14 A;  5IGE A;  3M7G A;  5D3D A;  5G3L D;  2WKC A;  3VR5 A;  3K5O A;  1EYA A;  5HUR A;  2N55 A;  1OXT A;  3IL8 A;  4I7Z C;  3GO5 A;  5F2D A;  2EY2 A;  2F0I A;  5I9O A;  3BDO A;  4M8A A;  3V05 A;  2OXP A;  2B2T A;  2IX3 A;  4RKL A;  4IUR A;  5EJW A;  1EOT A;  2MPM A;  1EY8 A;  4G7H C;  4KD3 A;  2QEJ C;  1F9R A;  1AP0 A;  2ZXP A;  4GZY C;  1H9S B;  1TS5 A;  1RTO A;  5HGT A;  1PZK D;  4CKE A;  2F0T A;  1LT4 D;  5K5P A;  2JEB I;  1FGB D;  2EJF C;  1U4R A;  1ILQ A;  2A69 C;  3E6Z X;  1ILP A;  1D5Z C;  3I3C A;  1PMR A;  4ZQ3 A;  1SNC A;  1NUC A;  5DEH A;  1AZQ A;  2F0P A;  1SE3 A;  5M3M B;  1SNO A;  1SAP A;  3TME A;  2Q8T A;  1VF5 C;  2MUY A;  4TKO B;  1I6V C;  2B2W A;  1F9Q A;  3VYR A;  3JAM L;  1Y1V B;  3GTK B;  3PUX A;  2M9V A;  3NTK A;  1IW7 D;  1YNJ C;  2JA8 B;  2WAC A;  1BOS A;  5IIF A;  3R3O A;  3S2H B;  4RKB A;  1SYF A;  2JSO A;  4KN4 C;  1TII D;  3SK8 A;  4DFA A;  1PTO H;  3J80 E;  4FF4 A;  4E6I A;  3E0J A;  1OO9 B;  2F0G A;  3K0Y A;  5KIX A;  4XDX A;  3NBI A;  3U9O A;  2EJG C;  1JE4 A;  2CW0 D;  4Q5V A;  2PQE A;  5C0X G;  2RDG A;  3W2D A;  4BBR B;  4XT1 B;  4IZ8 A;  5E3F A;  1SYD A;  4OIK A;  3T53 B;  4HCS A;  4K8J A;  4FXD A;  1F77 A;  1F2L A;  2MGS A;  4XYQ A;  1MSG A;  1KDA A;  5AFW A;  3NWS A;  5CV9 A;  1JB3 A;  3GQB A;  2OT2 A;  2E74 C;  1H9R A;  4C3J G;  2K1B A;  2Q8R E;  1M4V A;  2B2T C;  1O7Z A;  1VMP A;  5ELF A;  1F2M A;  1D5X C;  3RD4 A;  5LL6 X;  1PTO B;  1JOR A;  4C3H B;  3ND8 A;  5EGT A;  4JK1 C;  3QJY A;  5LL6 S;  2K28 A;  3AMU A;  4KJO A;  3EFX D;  5G3L F;  1KAA A;  1JIC A;  3BZD B;  4PNY A;  4OHJ A;  2OEO A;  1S5D D;  2CVR A;  1PTO F;  1WVL A;  1JWS D;  3GTJ B;  1U9R A;  4ZK9 B;  1F2Y A;  3BVM A;  1HCZ A;  5C0X H;  1NAP A;  4X3U A;  1A6X A;  3S9W A;  3TP7 A;  3GTO B;  2F0E A;  3MAQ A;  2C9O A;  4L63 B;  4TSS A;  2EVB A;  1BR9 A;  3S1R B;  1PZI D;  3M4Y A;  3K57 A;  3UI2 A;  3HOV B;  4ID6 A;  1BBX C;  1B3A A;  2A6H D;  3G6J B;  3TDQ A;  2SOB A;  5M9O A;  1PRT F;  1CZW A;  1TWG B;  1PTO C;  2A68 C;  2IJ0 A;  3TP5 A;  4NDX A;  3ZYY X;  4EGV A;  5J22 A;  1PTO D;  4BBS B;  4RCO A;  5COR A;  4AYB B;  4C3H G;  3BYY B;  3GTG B;  1LO5 D;  1WTR A;  4IUT A;  3DWQ A;  4PMW A;  5DM6 3;  1D2B A;  2EXZ A;  2EYL A;  3CRK C;  4BS9 A;  3MVV A;  2F1M A;  5EPK A;  2E2D C;  1HTP A;  4OIJ A;  1IKM A;  3R8B A;  1FR3 A;  1GHJ A;  4H0L C;  1JQY D;  3VYS A;  1CT1 D;  3KLR A;  2RSO A;  1V1P B;  2PZT A;  1H9K A;  2EYH A;  4LK1 C;  2HDL A;  5IGC A;  4K6L A;  1KNA A;  2D62 A;  4C1N K;  4ZRZ A;  1HFN A;  3FVQ A;  3BG3 A;  4K5W A;  4K14 A;  1LTB D;  2KOL A;  2F03 A;  1R4P B;  4V19 0;  2L9H A;  1KDB A;  4C3I G;  1LLR D;  1EZ6 A;  1HA5 A;  1G2S A;  1RCV D;  5IT9 L;  2RDF A;  1TQO A;  4KHZ A;  5I6Y A;  1EEF D;  1ICW A;  3MEH A;  4FXG C;  2DN8 A;  4OL7 A;  5JPN C;  1Q3L A;  2FJ2 A;  1BF4 A;  3K7A B;  3CU7 A;  5C0X I;  1ENF A;  4EQP A;  1PRT C;  1PDQ A;  1SE4 A;  2F0K A;  4RCN A;  1VDZ A;  1D5M C;  5EPL A;  1SEB D;  4NW2 A;  2NTS A;  3AB9 A;  1H9J A;  3SE0 A;  5C3E B;  2X6L A;  1WTP A;  3FKI B;  2J4X A;  2L5T A;  2PNR C;  1JOK A;  2F0F A;  3EJI A;  3PUY A;  2EJM A;  3VR3 A;  2WP8 J;  3DUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...