2OT2A

Solution structure of hypc
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVINEAEARDTLDALQNMFDVEPDVGALLYGEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Escherichia coli HypC
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Chaperone
molecule keywords Hydrogenase isoenzymes formation protein hypC
total genus 24
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01455 HupF_HypC HupF/HypC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ot2A01
2OT2A 3VYTA 2Z1CA 3D3RA 3VYSA 3VYUA 3VYRA
chains in the Genus database with same CATH superfamily
1X9NA 3LX0A 2K32A 3PIPA 4JBWA 1IYVA 3VR5A 3ICEA 1NE3A 2PW5A 2IX3A 4X3UA 4G7HC 3DM3A 3CC2A 2CCZA 5IT9L 2R7ZH 1RD9D 5D65A 2ES2A 1B3QA 4YCVA 1Y1WH 3HZXA 2M9VA 4DV4L 4BBSG 4F88A 1A62A 3AMUA 3H94A 4RGNA 1H9MA 3CRKC 3HKZG 5EKLA 1L1OB 3RZDB 4ZCKA 1EZ6A 5IGCA 4S3SA 1WI5A 4HJ5A 1DOMA 2I5LX 1EY4A 2MO0A 4RH6A 2C9OA 1GD7A 4RHSA 3GO5A 3PF4A 1C48A 1VQCA 2IT1A 4A75A 3HOZG 1WTHA 5M5YH 1MD2D 4X3KA 1S5CD 3DHQA 5IGDA 5M5XH 1SNQA 4X64L 2R6GA 3UE0A 1WTVA 4DR2L 4ID6A 4K5WA 1GUGA 2AWOA 3MC0B 2EXZA 3EN2A 1CTMA 2RCFA 3S15H 4X62L 4IPCA 3L7ZC 4XQNA 4V190 3A0JA 3EVQA 3JC66 1EY0A 1D6EC 1IYJB 4JI0Q 2C5CA 2B2TC 3BJUA 3OSOA 1CA5A 3MXUA 4X66Q 3DWQA 3I4OA 1PFBA 3BZCA 1JB3A 3OWEB 1MI2A 3BVMA 4PZ7A 3I72A 2D5DA 4LF6Q 4FF4A 1VQFA 2PCFB 4AYBE 1S4ZA 2ZXPA 4A3JH 1VQ7A 4DNIA 1OXUA 3L3OC 3U9OA 1L1OA 3T1YL 3BZKA 2EY1A 5C4JH 4DV2L 5JEAH 1B50A 1KLUD 4GZYC 4DV4Q 4IN3A 1VQ5A 5C4XB 1TWGB 5KEEA 5FJ8G 2VQFQ 3NBHA 3MXNA 5JVG3 1CHQD 2K5DA 3CD6A 4CDFC 1JOKA 4KHVA 3IFTA 2D62A 1XPOA 2ZJRA 1VQ9A 2L12A 3WDNA 2BH8A 2XRSD 1SLJA 1KNEA 4J1MA 3A5ZB 5EPKA 4JI2Q 1LTAD 4DU9A 4X6AH 4ILWA 5GAEC 2BH2A 2FFKB 1MHWC 1TY2A 2B2YC 1XYIA 1C0AA 3NQTA 1T5XD 1LT6D 4QUCA 3AQQA 5HURA 2UUBQ 3E9HA 3ULJA 1KAWA 1X6OA 2V1CC 1JC7A 4A3CH 2E75C 2MP1A 2I5HA 2CH4W 1R9TH 1HXYD 2UXBL 3OIPA 1N34L 2VUMH 2PNRC 1D5MC 3J80L 4DR1L 3KBGA 1SMXA 1QB5D 2B2YA 3MWYW 4GNXA 3GTQB 4J6HA 1OXXK 2DY7A 2IHEA 1DJRD 2R3ZA 3MEFA 4DAYB 1BDOA 3F8TA 5AJ3L 1YHAA 5LL6S 5M3MB 1ENCA 3PIOA 1EQTA 3H09A 2Q2IA 3VYSA 2MFIA 4YWMA 1K8OA 1BOSA 1FYCA 5DAUA 3ZJYC 1XWEA 4JOIA 4DV3Q 1PZKD 4QMGA 1B2TA 2ENBA 4DV5Q 3VYTA 3MXPA 3D0FA 5M3MG 3I4NG 4DR7Q 1QZHA 4ULLA 4LFBL 4B3SQ 4K5XA 4H0LC 4EVOA 2HQEA 4CJ1B 2UXDQ 2BOSA 4PMBA 1S5FD 2F0MA 1VQBA 2VUMB 5M5WB 5M9OA 3CKIB 1O80A 1QVFA 4JI6Q 4FXDA 4A3DH 5JEAJ 2R93B 4LF9Q 5IIFA 5EBDA 1SROA 1TT2A 3BYTB 2SNMA 1X3GA 3C3LA 3RMHA 1BBUA 5I2YA 4R4IA 1JJ2A 1IBKQ 1DXMA 1Q90A 2A74C 1TWCH 1PH8A 4FF1A 3HP3A 2MHVA 3IL8A 3CU7A 2A5HA 1EYCA 2VB2X 3J80c 2F4IA 2O2LD 1LYLA 5IGBA 1F9RA 5IYCH 4LF9L 3K7UC 1L2FA 2L1BA 3E0EA 3KLRA 4AIMA 3AB9A 1LT4D 2NN6I 1Q86C 1JE4A 3A8IE 4IURA 1SYDA 2LKVA 2B8GA 5FK9C 1CI3M 2JE6I 1EFWA 4JI3L 4DN4M 1I94L 3CHBD 4KHPQ 1STYA 2F3VA 3I4MB 5CV7A 4A3DG 1EYGA 1QZGA 4LF8Q 2KEDA 3ER0A 4JI1Q 4A3KG 1AEXA 2I5MX 4FP5D 2OXPA 4O1NA 5JOBA 5C4ZA 4PQXA 1L0XB 2AMCB 5D14A 4KY5A 2I0QA 3H0GB 1PTOC 1AZPA 2E2IB 4LF8L 3HOVG 1X65A 1K83H 2N49A 1B7YB 2Q2HA 4LMQD 1XPUA 3U9SA 3GTJH 1GO3E 1TWHB 3NXWA 3TMEA 2VS1A 2ID0A 2F4VQ 5M5XB 1NMFA 2B3GA 2CQAA 5C3XA 3MFYA 1EU4A 2JA8G 5IP9H 3HOZB 4HJ9A 1NSNS 2N8NA 3BVZA 1WD0A 4JI2L 3D6WA 3I8ZA 2MJ8A 5J1ZA 5J39A 2A69D 1PDQA 3RNUA 1B8AA 1DGSA 4RCNA 1D5XC 1EQQA 2I46A 1PZJD 5JVH3 3ERQA 1VQMA 3S2HH 2O4XA 3U50C 3SHLA 3ND9A 3NBHB 1EOVA 5IE8A 2RF4A 2Z0SA 3FKIH 2K5WA 2BE5D 3S1QB 1STNA 2DN8A 1Q12A 3M3YB 3J81j 2XGTA 1H9SB 1EFID 2JQOA 4OONA 2SNSA 2QW7A 2AUJD 3D4WA 4KJNA 1HZAA 1WTXA 1EWCA 3GTLH 2EE1A 4OX9L 4NP5A 1EQVA 5J3BA 1FGUA 5FLMH 2NVTB 3NWSA 1H9SA 3U4ZA 4UDUC 1LT3D 1HNXQ 2RDHA 1YJ9A 2PQEA 3CCEA 2GN5A 1QNKA 1LM0A 5C4XH 1UAPA 2NWGA 1SBBB 1LACA 2UXDL 3K0YA 1Z9FA 4LFAL 4X3TA 1CKOA 2JA5G 3KF8A 4RFBA 1KNAA 3RR5A 2L9HA 1Q8KA 3F2BA 1IBKL 4DR5L 1XXGA 4K14A 5FJ8H 2NN6H 1V1PA 5I9OA 5ELOA 2UXCQ 5G3LF 2NZ1D 5JEAG 4CHTB 2F0QA 2P5ZX 3HRZC 3PUYA 5CV9A 5FO7B 2B63H 1N32Q 4DV7Q 5CR3A 3M3YH 1R9TB 3K59A 1PH5A 1DYQA 5HY6A 1B53A 2X69A 4TQUS 2HHHL 1K3BC 4KN4C 1WCMG 3MEHA 5FLMG 5H1SE 1XX8A 5JJIA 4UY8C 2E5LL 3I73A 1O78A 5IT9c 1BCPD 2AQ2B 5I6YA 3P20A 1A8VA 2DUDA 1H9RA 3QOJA 4GKKQ 1TXYA 5KNBA 2C35B 1HHVA 3F1ZA 3NENA 4OIKA 2ATWA 1A3UA 1LTLA 3ONAB 4LW1A 2R7ZG 4NB3A 2CKZB 1F9QA 2VQEL 2RA4A 1K0SA 1HNWL 3MFGA 5AJ3Q 2JXMB 5KRUA 3KDFB 3A8JE 4GKJL 1I6HH 3A55A 1RKNA 3G7LA 2YU9H 5EQ0A 3SGIA 4LUVA 3PUZA 1YNND 4BBRB 3HKSA 1HA5A 4A3JB 1UEAB 2DY8A 3EQLC 3SVMA 2B63G 2H1EA 3G4SA 4LAAA 3GTPH 1PTOF 3OHXC 1DONA 3FKIG 1X3PA 1R4QB 4GN3B 5KNCA 1PRTB 4EQPA 1GOZA 2LY7A 3SXHA 3DXJC 4AH6A 3EROA 3GTKB 4ZKBB 3TN2A 1B9NA 4QQBX 4JW0A 3K5NA 5JJLA 4HEDA 1Q46A 2WKDA 1E1TA 1YBYA 1N33L 1I50H 3NPPA 4BA2I 3TP7A 2JN4A 1Y8NB 1SN8A 3F2DA 3T13A 3J7ZC 4DR3Q 4DV1L 1BUVT 4ODGA 1IL2A 1F2LA 3A74A 1SJED 3FVQA 4DR3L 1IBMQ 5IGFA 5IYDG 3S14B 4K6LA 3O13A 2K04A 2R92H 2EYMA 2Z6KA 1EY6A 3HG9A 2B63B 2RKSA 4C3IH 2WB1E 4OL7A 1EU3A 4HCSA 2EYOA 2DNCA 2EY6A 4L6TB 5M5YB 5FLXc 2JA5H 4UHVA 5C0XG 4A3IG 2B2UC 1D8LA 4RGTA 1EIHA 1PH6A 1I4GA 3E6ZX 4IJLA 2NYZD 2PZUA 1N32L 1Z6HA 2KJXA 2L15A 1E22A 2Z6KC 2HDLA 1G8ZD 1UWVA 1PH7A 3Q24A 1IBLL 3HOUB 4IJHA 1PYSB 4ZAIA 1WJJA 3S16B 2OCEA 3J80i 2B2VA 3TDQA 4BBSH 2D9UA 3K81C 2NVTH 2MPMA 2LMCB 1ZYRC 4GKJQ 2IX1A 4X64Q 2F0OA 4NDXA 1AFPA 5E3FA 1AZQA 4A3KH 1SSOA 2RHSB 2PI2E 3I4LA 1L0YB 3S2DH 3NEMA 4B3RL 3WOFA 3E3XA 4CJ0B 2H4OA 4GLAC 2ZT9C 3H15A 1XTDA 1V1QA 2K5QA 1IHZA 1KXLA 3S1NH 4XQQA 2J0TD 3KF6A 4BY7H 4JYAQ 1VDZA 1LTID 2K05A 4POFA 4HSVA 1CSQA 1WD1A 4JC0A 3HOXH 4EQOA 5C4HA 3Q0AA 1VMCA 1C7YA 4APVA 1VMPA 2QA4A 1K3RA 2Z8LA 3N52A 4JV5Q 2B8FA 1EQRA 1VQJA 2B2VC 3HOWB 2NB0A 4IUPA 4RMFA 5AFWA 3KLSX 3D4DA 4G7OC 2VNUD 3K5LA 4RCOA 3MXGA 1EWIA 5C44G 4GOPC 5DM63 3P1HA 4DKAC 3C1FA 3QWNA 1PH1A 2RQXA 1KHIA 4HSPA 2KENA 3DM1A 3QG1A 3OMCA 4DAVA 4LFAQ 3BVGA 4Z9CB 3K6OA 2KCNA 3VR2A 1X3EA 1LV9A 1STHA 3IFDA 4QJFA 1TWHH 3HS0C 1J8IA 2SDFA 2UU9L 4DUZL 2K33A 1M4VA 4N9PA 2E2HB 1JOOA 1PH2A 3U58A 4K0KQ 1Q8IA 2OT2A 1NMGA 1SXTA 4IPDA 3KFUA 4C3HH 3DEPA 5LMNW 3TS2A 5KGUA 2JA7G 2OTLA 4TRDA 1F9PA 1X56A 1DCZA 2UUAQ 4C3HG 3Q6SA 5JPMC 4LF7L 1ZEQX 4HTHA 4A3MH 1LT5D 5JPNC 1J5EQ 3M4QA 4A3KB 3SK5A 4LF5L 1IYUA 1I4RA 1SNPA 3FEWX 3NWTA 1LTBD 3W1BA 4BY7G 4U68A 4A93G 2K4KA 1V8QA 5IWAQ 5C0XH 2B29A 2EY5A 1QNUA 1STBA 3OW2A 2F0PA 3QB3A 3TS0A 1BVSA 5TSSA 2MNAA 1YNNC 3IKJA 1XNRL 4FXKC 4PZ6A 4JI4Q 1DOLA 3PO2G 3CC7A 3S15B 4ZUIA 1RF2D 1WFQA 1HNXL 2F0HA 5CV4A 4C1NI 1A15A 1Q1BA 1N36L 3UI2A 1N8RC 3HOWH 3T1HQ 3P7JA 4B08A 4IUUA 1YVCA 1K0RA 1TWCB 3MZ5A 5BR8L 1XJVA 1KDCA 2Z6BA 5KYIA 1VQKA 2A6ED 2ZXRA 5FO8B 3BDCA 1NNXA 1Q1EA 4G57A 2NUCA 1CKNB 1G2SA 1HTPA 2F3IA 4LF4L 3GQBA 1RTNA 3HOZH 1CSPA 1ESRA 4A3LH 4YY3L 1SJHD 1E2VA 1HQRD 1Y1WG 1PFNA 2ZTCA 3RZDH 4NXNQ 2F0JA 5KYLA 2QKIC 4B3SL 2K1BA 1JICA 1BKBA 2KUMA 4F87A 2ICIA 1JOQA 1SNDA 1QCBD 4RGMA 2E74C 5CMDA 4PV1C 1RJTA 2PZWA 5ELNA 2F0DA 2KOLA 4RGOS 4OXPA 1PV4A 3CAMA 4XYQA 4LNQA 3T53B 4K8JA 5EPJA 4Y7NH 1IXRA 2KCCA 2VUMG 3PSIA 4A3GB 2EYHA 1SE3A 3BZDB 3N6RA 5K36H 2VL6A 1ET6A 1CKMA 2F0UA 3NHHA 2AKWB 1DD2A 3C46A 3D4RA 5HGQA 3M4OH 3BS1A 1WTOA 4P72A 2TSSA 4O0AA 3SDZA 4QB4A 4BBRH 5K36G 1I94Q 4K2KA 3HOVH 1Q3LA 1TS4A 1GUOA 1STGA 5D3DA 4AYBB 2JA6H 4DR6Q 4J15A 4YIJA 4C56C 1Y1VG 1YZ6A 1ZKOA 4PNYA 2PYKA 1VQIA 4A3GG 4KTAA 4JI4L 4AYBG 4YHHQ 1FL0A 4B9WA 4KV6A 1WVLA 1CA6A 1I50B 4DR7L 1U4PA 3F2UA 4DV5L 2CW0D 5EKIA 2EYFA 3CQZB 2R93G 1YNJC 2WINB 4JBKA 4NPSA 1FR3A 2EYJA 4DR6L 2QDBA 4QY7A 4K2LA 2XRQD 5F2DA 2F0WA 4PG3A 5C4XG 3QO2A 1YJNA 3MAQA 3FDTA 4A3FH 5I4DA 1PZID 3KF8B 1SFOB 3S1MB 3FRPB 2N78A 5E1FA 4LFCL 4P74A 4N8FA 3J81c 1U4RA 4B3MQ 1VQLA 4A3IB 4HJ8A 4G4KA 5LL6X 3HOVB 1HUNA 4RG1A 1UE7A 3FP9A 4M1UB 2F0EA 5K5PA 1GJXA 1XNRQ 2K01A 4KLKA 1EIGA 1XMOQ 1JWMD 3DWPA 4P75A 1GHKA 4R8NA 1C4QA 4JOIC 1PVOA 1EOTA 3URYA 1TIID 3M4YA 4G7ZC 5FOBB 2RCNA 1HFGA 5GAGC 1XNQL 4K8IA 1QUQA 3L2PA 1EZ8A 4LFBQ 1O7ZA 2KCTA 3D6CA 3GTLB 3PIP3 5LMUQ 2K6AA 1KAAA 2FXQA 1H9JA 1JB7A 4JV5L 3I56A 2CFMA 2K50A 4A3BH 1BF4A 4JBMA 2EY2A 3SK6A 4C3JG 2HT1A 2EIFA 3EFXD 4M8AA 3G6EA 4DUZQ 2OEOA 4DNTB 1PYBA 3S1NB 3AFPA 4LF6L 4R4QA 1KRTA 2QEXA 3CPWA 1S72A 1HR0W 2ZTEA 4TVAB 2HQLA 3P75A 3I4MG 1IW7C 3UDFA 3S1RH 5JJKA 2DJGC 3H3VI 4JI7L 4O2DA 3T4AC 4C3JH 3AYHB 3VR3A 4JI5L 4CKCA 4ZKCB 3PUXA 4DAPA 1HJPA 1JWSD 3LWUA 4H7BA 4RWSC 1BCPB 1K83B 4WJ3M 1E2WA 3SR1A 2BA0A 2WP8J 3HOXG 5EBCA 3TZUA 3S1MH 1QVCA 1IBLQ 1II3A 4LUOA 4HJ7A 4UP7A 5C44B 4JI8Q 2UUCQ 3K7AH 4A3MG 4MIUA 4A3FB 2E2IH 1SYCA 5IODA 4LK1C 1WTWA 3H3VC 3CXCA 4FF3A 1Z7TA 2ZM6Q 5ELFA 1AE3A 3J7AF 1KQSA 3TSSA 3X3MA 1VQOA 5C3EH 1GUWA 4HN7A 3KOJA 4HMJA 5DLQE 3J7A5 3HOWG 1LTGD 5ELBA 2J7ZA 3QJYA 2UU9Q 2WB1G 4NXML 2N3SA 4X66L 2MO1A 5C0XI 4JG2A 1I3QH 4GS3A 2Q8IB 4I65A 1S5DD 1Z47A 3PO3H 1KLGD 3GP7A 4QCLA 4IQZA 1RCVD 1X32A 4FVMA 1BBWA 1W2BA 2PO4A 5EKKA 1C9OA 2CWAA 4MZ9A 1DM0B 2PI2A 1D5ZC 1F2YA 5CORA 4B3TQ 2NVYB 3I4NH 1HZBA 3S24A 4ZLTF 1PRTC 2XWBB 4CDCC 3S17B 1PH9A 4BXXH 4LWCA 5LMNL 3H3VH 1M8AA 4DR4Q 2KECA 3TBIB 4IALA 1ENAA 3JAMi 2MGSA 4GN5A 1EL0A 2XSCA 1B1ZA 4R8IA 5C44H 1Q82C 4GNXC 1CQFA 1K8MA 1NJIC 1EWHA 2GVBA 3VDYA 4R9WA 3FHWA 3PUVA 5T1IA 4OO1I 2LS01 5EPLA 3KLWA 4DAYA 2R92G 1NCVA 2MQHA 1OXSC 3T56B 2Z4HA 5LMUL 4X3SA 2JA8B 3I55A 2E5LQ 3MTSA 2TMPA 1HNZL 4BBSB 3GTOB 1Q81C 4OO1G 1XNQQ 3EJIA 2FMMA 2KA7A 4A3EB 4JCVE 3CCJA 2NVXB 2Q8TA 1W6JA 1YEZA 1TQOA 2E2DC 5KIXA 1U9RA 1YI2A 3X3NA 4ZK9B 2WV6D 2G5DA 1AW7A 2D2CC 1PRTF 3CCRA 1SMYD 1ICWA 2Q2TA 1BXTA 3S17H 4A3DB 5KNDA 2YTXA 1R4PB 1VQHA 4NKLA 4XXEA 5IOCA 5C3EG 3R2IA 1BCPF 3UDGA 4BBRG 1CZWA 2AHOB 3I3CA 3ERSX 1JCKB 1TY0A 2NN6G 5IYCG 2NVQB 2HCCA 2R7FA 4BWGB 1S5ED 5GROA 1HQMC 2XTIA 4DV1Q 4GOPA 1KDAA 2Z9HA 5CGKA 4A93B 2MUYA 1MJCA 4Y52H 2QILA 2FHTA 4OO1H 3LWEA 2NTTA 4JI5Q 4QF4A 4KY7A 4OX9Q 3GV3A 4DAMA 1NR2A 4OIJA 1PYWD 4XYOA 2JA8H 3S9WA 3Q23A 1E1OA 4ME5A 4K5VA 2XVSA 3OYYA 4HAEA 1EEID 3SEBA 3RZOB 3R2TA 4HIOA 1FGBD 1OXTA 1PH3A 4OHJA 2UUCL 5JJZA 2XIWA 1IZ6A 3G48A 1NAPA 1T9HA 3A54A 1Y1VH 1ZXTA 1VQDA 1VS0A 2ZJPA 3GTKH 2IWHA 4A3LG 4DGZA 1W6KA 1YJWA 4DK1A 2WKCA 2YU9B 3PGZA 2PQAA 1VQEA 4MNOA 4ZQ3A 3GD7A 1PFSA 4HR7B 2RDGA 5GAHC 2BDNA 2F0FA 1IL8A 4A3BB 1HR0L 1A0IA 1WCMH 2RSNA 2FMCA 5ELCA 2M2LA 4WFN3 2CQOA 1NUCA 3CCUA 1ILQA 4IUVA 5E7NA 1IKMA 1A2TA 2OQKA 5ELDA 2O5IC 1WCMB 5C5MA 1SYFA 3W1GA 1WTQA 1V1PB 4RAUC 3DMUA 1LABA 2CWPA 4PZ8A 1I4HA 3R93A 1PFMA 1I4QA 1Y8PB 3NQIA 1KIXA 3QIAA 1HR0Q 2XWJB 4YY3Q 1V9PA 1VQ8A 3W2DA 4FDBA 2WB1B 1U5KA 4AQYQ 4IFDI 1WTRA 1LTRD 1Y8OB 2HIXA 3RZOH 1MIUA 2LSSA 2RSOA 4ZUJA 4MTNA 2YYZA 1YNJD 1GM5A 1B70B 4H02A 5CC4A 4ZRZA 1YIJA 1JMCA 1FJGQ 3K5OA 3KBXA 3OTOQ 1VQGA 5BN3A 4L5RC 1SNOA 4MN3A 4Q0FA 5FLXE 3QR8A 3JAMc 2BA1A 3OOCA 3TQYA 2K5VA 3CCMA 3S16H 1A63A 4YCWA 1BO0A 3MXNB 1B4OA 5CV6A 3K58A 3IRBA 2Q2UA 2RBMA 3MVVA 1QE6A 4F8MA 4J8QA 1E24A 4WRDA 2IPKD 4B3ML 2GVAA 4DNRB 4LFCQ 1SE4A 4BXXG 3OTOL 3NTIA 4N8X1 3GV6A 1VF5C 3E5SA 2EJGC 2CH4A 4CKEA 2PMZE 4A4IA 1FVIA 3S1RB 1BBXC 3I4MH 2F0KA 1K8GA 5EJWA 2K5NA 5DM73 1AN8A 3V05A 1U4LA 3SK8A 2ZTDA 5C3WA 3CCVA 2R93H 3HGBA 2SEBD 4JI3Q 3H0GG 5A35A 1HH2P 4DPGA 1NY4A 2VZAA 5IP7G 3BG3A 2EQSA 1PTOD 5IGEA 1ET9A 4H13C 3J7AV 3H6MA 1I4PA 4IPHA 1E7ZA 2BCOA 2F0SA 1VQPA 3CP0A 1E3PA 5GADC 2EYPA 2VY3A 4DK6C 2CVRA 1TU2B 1Y1WB 4KKSA 4DFAA 2E2JB 2OF1A 1SEBD 1EIFA 3FPUB 4UAIA 2J4XA 2QEJC 3M4OB 3V2TA 3R3OA 1A3TA 1TWAB 1K28A 1JR0D 4GN4B 1GUNA 4P73A 5C6AA 3GTPB 1KD1C 1S3OA 3CCSA 1TR5A 4BA1I 1VCIA 4AQYL 1SYGA 4P71A 4DXFA 4QUFA 4FXGC 4A3FG 4GOPB 2UXBQ 2KHJA 4ME3A 3I70A 2A6HC 5HGTA 4K0KL 5T1GA 4DK3C 2KHSA 4A3JG 5FO9B 2NTSA 1KL9A 1UE5A 4A3IH 1QWYA 2NVYH 4MHEA 2B2UA 1NBWA 2PZTA 2OQ0A 2A8VA 1B3AA 1YHBA 4DUYQ 4H44C 2B2TA 4QIWB 2G9HD 3NTHA 4A93H 1HRJA 4ALPA 1EEFD 4QGUA 1SDFA 1EY9A 3VYUA 1MGSA 1MJEA 1TWAH 3OIQA 1E2ZA 5IWAL 1GXDC 2KVMA 1O7LA 1KC8C 1EUJA 3TZDA 4V0BA 1H95A 1V43A 3M9BA 4R4OA 2VQFL 2E2JH 4XT1B 5IP7H 1FD7D 4CJ2C 2KCMA 3ND8A 1J5EL 4LF5Q 4XTCS 1G2TA 1QG7A 1L1OC 2EOTA 3ZYYX 4I7AA 2A69C 2K5HA 3HOUH 3T1YQ 2F52A 1DZ1A 1WYDA 4LJZC 2JA6B 1SE8A 1N36Q 2IX0A 4K6DA 5M3FG 4HIDA 3VA7A 1GHJA 3HEJA 3RN2A 3CCLA 4IUTA 2YV5A 3DWAA 2E76C 3B6YA 1B44D 1M1KC 3KJOA 1JQYD 1QILA 1I5FA 3TEHB 2JA5B 1LTSD 2ICEC 1L0WA 4A3GH 2Z1CA 1SYBA 1D1KA 1ESFA 3STBD 3WOEA 4JI8L 2EVBA 5M3FH 3ITPA 1VQNA 3K5MA 3ULPA 2PNHA 4DXGA 4DR2Q 4JI0L 4C1NK 4EGVA 1MKHA 2WACA 3E9IA 3K8AA 1CHPD 3NSWA 1HZ9A 4KKTA 4LF7Q 4DV2Q 3TRZA 1SRUA 4ZYSA 3C2PA 1EY7A 4IZ8A 2AQ3B 3A7LA 4KMUC 3HKZB 3IAYA 5GQOA 3LGJA 1STEA 4XDXA 5A2QL 2M00A 2RHQB 1HCZA 4P2CB 2X6LA 1SFOH 1TWFH 2JP1A 2B2WA 1B9MA 4IUNA 1PMRA 4KJOA 2ZM6L 4C2MB 3GTGB 3DUZA 3RLNA 1JE5A 3UDXA 4F7XA 3J81E 4GLVB 1CKNA 2F03A 3M7NA 5EAYA 1EIYB 4DR4L 3TP5A 1CT1D 3MA2B 2K03A 2ZXOA 2DGYA 1D1IA 1ICFB 4OWWB 1CK1A 4EQ5A 2KQ3A 3T51B 4EQNA 3SE0A 3HOXB 4L5TA 2VB3X 2D0OA 3RLFA 3TP6A 4X62Q 1WTPA 2XN9C 4XT3B 5DNFA 3NK9A 3VYRA 2F0IA 2EZVA 3D3RA 1LO5D 1VQAA 1FNWA 1HZCA 2B39A 5CV5A 4L8JA 2K75A 2K28A 3U4VA 4IUQA 4KKUA 2N88A 4JBJA 1JT8A 2LXJA 4N9TA 5CYUA 1Y14B 3VR6A 3BDLA 1SR3A 2HDMA 3AU7A 3C1EA 5M3FB 1KDBA 1S5BD 4NW2A 5G3LD 1S40A 1VQ6A 4L63B 1TS5A 3M7GA 4FO2A 2HHHQ 4A3MB 4UPAA 1ILPA 4B3RQ 2CW0C 3KYHC 4DV7L 2JJQA 2N55A 3J7YW 1GUTA 3A5UA 2JA7B 2EXDA 3OWFA 5D3IB 4HCEA 2EYLA 3KUPA 2VQEQ 2VXWA 1P16A 4EX5A 3BDOA 3UDIA 4DR5Q 1PHJA 1IBML 5ISRA 4OWXB 3NBIA 4NXMQ 1RTOA 3QOLA 1TKWB 2WFWA 4PMWA 2D0PA 1BNZA 1HPCA 3DEOA 5E4WC 1U0LA 4C3IG 1HA6A 1UE1A 2I07B 1TS3A 3EIVA 4JI7Q 4JPBW 2OTJA 2EJMA 4DUYL 2L4NA 1N33Q 1O7IA 4BS9A 4KN7C 5I2XA 5C3EB 2FINB 1PTOB 2X6GA 4DV0L 4WJWA 4OELB 2YTVA 1CM9A 1J9OA 1I4XA 2PW7A 3PIO3 3EBEA 4A76A 1G91A 4RKBA 3AFQA 3PO2B 3EA6A 3S14H 2F0VA 2UXCL 4RKLA 4DV6Q 1EYAA 2HIVA 1P8LA 4PMCA 2NZHA 1QJOA 1I6VC 2A6EC 3A8KE 3PQIA 4CDDC 5M5WH 3JAML 3L9AX 1GUSA 1X3QA 4A3EH 3VR4A 2R7ZB 1A3VA 3GDEA 3VA5A 2OWOA 3K57A 1FNVA 3GTOH 3K0XA 1EY5A 1K8AC 2L11A 1G6PA 4IFDG 3H91A 2KBNA 3OPOA 1ONLA 3CF5A 4KI0A 4LUZA 1YITA 2NVXH 4X65L 5M3MH 4C3JB 2RDFA 3F2CA 1AH9A 4I7ZC 3T16A 3FMCA 5IGGA 3M85A 3S2DB 3RUZA 3NP8A 3UE1A 4IOAA 1AP0A 1OXVA 1Y69U 2XNAC 2AWNA 4U673 4QIWE 3KDFA 3R8BA 3RD4A 4NXNL 3GTMB 2A1AA 3W5OA 5BN5A 1BR9A 1HTLD 3RLOA 2ZJQA 1MSGA 4LF4Q 1JWUD 3J81i 1JJGA 1STAA 3HOYB 2AUKA 2A68D 3PV0A 1NR4A 1UEBA 4FF2A 4A3CG 1PLFA 3G6JB 2L5TA 2GA4B 1XMQQ 1DOKA 5IYBH 4FNFA 3I4NB 1HNWQ 5DEHA 2Y0SE 1IW7D 3J81L 1FNUA 1CUKA 3RN5A 5C0XJ 2FJ2A 2PPBC 1PTOH 1SYEA 2JA6G 2Z4IA 2DJFC 1LUZA 4GKKL 3STBC 1OTCA 5C4JB 2BE5C 4RHRA 2F4VL 3NUCA 3KJPA 1XMOL 2RVLA 2IW3A 3PO3B 4YHHL 1SMYC 1TWGH 4KD3A 4OWTB 4XIGS 4TSSA 1D7QA 1I3QB 1UUPA 1J6QA 4NMZA 4WORA 4DK0A 2ASBA 1UNSA 3I91A 3NE5B 4HJAA 5I9PA 1BQQT 1C8CA 2ALYB 4MTKA 3I7FA 1F77A 3J80E 4CGYB 1ASYA 2AQ1B 2EDGA 2EJFC 1KTKA 4R4CA 3PMFA 3CCQA 1TWFB 5BR8Q 3KF6B 2QCPX 4ABNA 5COYA 1KRSA 2K14A 3PO3G 3L0OA 2WIIB 1T5EA 2K7VA 1SE2A 3NELA 4BY1B 2IL8A 1WOCA 2F0NA 4IPGA 3K7AB 4KD4A 4WJ4A 3FKIB 3PCOB 2H5XA 4OGQC 4C3HB 4OEMB 4YCUA 4JI6L 3Q8DA 4R4TA 2F1MA 1YNXA 3G71A 3BU2A 1YHQA 1ASZA 1X3FA 2QDLA 2QGQA 2QF7A 1FJGL 2O5JC 2A6HD 5C5LA 2JEAI 5IYDH 1VF7A 1G291 3AEVA 2Q8RE 4DA2A 1NTGA 5IY0A 1RDPD 1QUQB 1GVPA 3A56A 4HMIA 4IOCA 4DV3L 4KK7A 1BCPC 4DF7A 5FKAC 2LFNA 1IKLA 3V96A 3I90A 3PUWA 5E4XA 1PRTD 1D2BA 3LNNA 1ENFA 4TKOB 3PF5A 3HOYH 1CFMA 3S2HB 2E8GA 3HFZB 3MHBA 4RA8A 2E2HH 1XMQL 4C3IB 1W3SA 4POGA 1O7YA 4YWKA 5ELEA 3D31A 4JI1L 1RHPA 5I6WA 1N34Q 1PH4A 4KHZA 4JVZA 1AE2A 4C2MH 3GTGH 1XTCD 2CHBD 1E0BA 2HD3A 1MSHA 1OO9B 4E6IA 5JAVA 4JYAL 1LLRD 1HNZQ 3E0JA 2F0TA 5J22A 2KEEA 4KHPL 4X65Q 5LHY1 4IFDJ 4CBVA 4BY7B 1SNCA 5EGTA 2VW9A 5FLXL 5BN4A 4HIMA 2NBFA 3JAME 4IO9A 3SK4A 1XPRA 5L37A 2IY5B 4CKBA 1F2ZA 4R1JA 2IHFA 3TP8A 2BDOA 4KY6A 3A7AB 3NTKA 3WWVA 3CC4A 4BY1G 2JSOA 4Q5VA 1G6ZA 4B9XA 2WAQG 2Y0SB 1RL2A 1A6XA 1GKHA 3KLSA 3DLLA 1QVGA 1JJCB 1RIPA 2IJ0A 2V4DA 3OMGA 4DR1Q 2NVQH 4O42A 3GTQH 4BY1H 2DNEA 2HUGA 2L55A 5NUCA 3GTMH 3PO2H 5A2QE 1Y1VB 1V1OA 2JYOA 3T1HL 2JEBI 4DV0Q 2JA9A 4DV6L 1X54A 3W3AA 4FYDA 4L5QA 3TREA 4A3BG 3ULLA 2R7DA 1HFNA 1Q7YC 4B3TL 1ML0D 1TVXA 1K73C 4IFDH 3S1QH 2PMZB 1F9SA 1CZGA 5CBEE 3HOUG 1N9WA 3I2ZA 2F0GA 3CQZH 3OW7A 4GLXA 1JORA 4L5SA 3K80C 1PXUA 1A2UA 4GNXB 4CDEC 3CMAA 2JK8A 2EPBA 4HIKA 2WAQE 1EY8A 3M4PA 2A68C 2A19A 2K52A 1U4MA 2UUAL 1H9KA 3CRLC 1SAPA 1X55A 1UE6A 1F2MA 2YTYA 2LXKA 1M90C 1MBYA 5CBAE 5CV8A 2NZOA 4UP9A 3KK7A 1CQVA 1EYDA 4A3EG 2F3WA 1K9MC 2F0LA 2G9DA 3CW2C 1ZYRD 5IYBG 3GTJB 1G51A 1KABA 1RODA 3CMEA 2HCIA 4JK1C 2JA7H 3HOYG 4UP8A 3H0GH 1TS2A 4XQJA 2R61A 2R92B 3CPFA 1HUMA 5LMNQ 2A73B 4QL5A 2SOBA 3D8GA 2UUBL 4Y7NB 1I6HB 2B2WC 3BYYB 2WAQB 1SNMA 2Y0SG 5IT9E 4YWLA 5IP9G 1QOHA 3HKZE 2L0CA 2PQAB 1PA6A 3FPPA 3Q22A 1LTTD 1VQ4A 2KHIA
chains in the Genus database with same CATH topology
3LX0A 2K32A 4JBWA 1IYVA 3VR5A 2PW5A 2IX3A 4X3UA 4G7HC 5IT9L 1RD9D 5D65A 3HZXA 2M9VA 4F88A 3AMUA 3H94A 4RGNA 1H9MA 3CRKC 5EKLA 3RZDB 1EZ6A 5IGCA 4S3SA 1DOMA 1EY4A 4RH6A 2C9OA 4RHSA 3GO5A 1C48A 2IT1A 1MD2D 4X3KA 1S5CD 3DHQA 5IGDA 1SNQA 2R6GA 1WTVA 4ID6A 4K5WA 1GUGA 2AWOA 3MC0B 2EXZA 1CTMA 3L7ZC 4XQNA 4V190 3EVQA 1EY0A 1D6EC 2C5CA 2B2TC 3OSOA 1CA5A 3MXUA 3DWQA 1PFBA 1JB3A 3OWEB 1MI2A 3BVMA 3I72A 2D5DA 4FF4A 2PCFB 1S4ZA 2ZXPA 1OXUA 3L3OC 3U9OA 2EY1A 5JEAH 1B50A 1KLUD 4GZYC 4IN3A 5C4XB 1TWGB 5KEEA 3NBHA 3MXNA 5JVG3 1CHQD 2K5DA 1JOKA 4KHVA 3IFTA 2D62A 2L12A 3WDNA 2XRSD 1KNEA 4J1MA 5EPKA 1LTAD 4DU9A 4ILWA 2FFKB 1TY2A 2B2YC 1XYIA 3NQTA 1T5XD 1LT6D 4QUCA 5HURA 1JC7A 2E75C 2MP1A 1HXYD 3OIPA 2PNRC 1D5MC 3J80L 3KBGA 1QB5D 2B2YA 3MWYW 3GTQB 4J6HA 1OXXK 2DY7A 2R3ZA 1DJRD 1BDOA 5LL6S 5M3MB 1ENCA 1EQTA 3H09A 3VYSA 1K8OA 1BOSA 1FYCA 5DAUA 1XWEA 1PZKD 4QMGA 1B2TA 2ENBA 3VYTA 3MXPA 4ULLA 4K5XA 4H0LC 4EVOA 2HQEA 4CJ1B 2BOSA 4PMBA 1S5FD 2F0MA 2VUMB 5M5WB 5M9OA 3CKIB 1O80A 4FXDA 5JEAJ 2R93B 5IIFA 5EBDA 1TT2A 3BYTB 2SNMA 3C3LA 3RMHA 5I2YA 1DXMA 1Q90A 2A74C 4FF1A 3HP3A 2MHVA 3IL8A 3CU7A 2A5HA 1EYCA 2VB2X 2F4IA 2O2LD 5IGBA 1F9RA 2L1BA 3KLRA 3AB9A 1LT4D 2NN6I 1JE4A 3A8IE 4IURA 1SYDA 2LKVA 2B8GA 5FK9C 1CI3M 2JE6I 4DN4M 3CHBD 1STYA 2F3VA 3I4MB 5CV7A 2KEDA 1AEXA 4FP5D 2OXPA 4O1NA 5JOBA 5C4ZA 4PQXA 1L0XB 5D14A 4KY5A 3H0GB 1PTOC 1AZPA 2E2IB 4LMQD 3U9SA 1TWHB 3NXWA 3TMEA 2ID0A 5M5XB 2CQAA 5C3XA 3MFYA 1EU4A 3HOZB 1NSNS 3BVZA 1WD0A 3D6WA 3I8ZA 2MJ8A 5J1ZA 5J39A 2A69D 1PDQA 4RCNA 1D5XC 2I46A 1PZJD 5JVH3 3ERQA 2O4XA 3SHLA 3ND9A 2K5WA 2BE5D 3S1QB 1STNA 2DN8A 1Q12A 3M3YB 1H9SB 1EFID 2SNSA 3D4WA 2AUJD 4KJNA 1WTXA 1EWCA 2EE1A 4NP5A 1EQVA 2NVTB 3NWSA 1H9SA 4UDUC 1LT3D 2RDHA 2PQEA 1QNKA 1UAPA 2NWGA 1SBBB 1LACA 3K0YA 4X3TA 3KF8A 4RFBA 1KNAA 2L9HA 1XXGA 4K14A 2NN6H 1V1PA 5I9OA 5G3LF 2NZ1D 5JEAG 4CHTB 2F0QA 3HRZC 3PUYA 5CV9A 5FO7B 5CR3A 1R9TB 3K59A 1DYQA 1B53A 2X69A 4TQUS 4KN4C 3MEHA 1XX8A 3I73A 1O78A 1BCPD 2AQ2B 5I6YA 3P20A 1H9RA 3QOJA 5KNBA 1HHVA 4OIKA 1A3UA 3ONAB 1F9QA 2RA4A 3MFGA 2JXMB 5KRUA 3A8JE 3A55A 1RKNA 3G7LA 5EQ0A 3PUZA 4BBRB 1YNND 4A3JB 1HA5A 1UEAB 2DY8A 3EQLC 3SVMA 2H1EA 4LAAA 1PTOF 3OHXC 1DONA 1X3PA 1R4QB 5KNCA 1PRTB 4EQPA 1GOZA 2LY7A 3SXHA 3DXJC 3EROA 3GTKB 4ZKBB 3TN2A 1B9NA 3K5NA 4HEDA 2WKDA 3NPPA 4BA2I 3TP7A 1Y8NB 3T13A 1BUVT 4ODGA 1F2LA 1SJED 3FVQA 5IGFA 3S14B 4K6LA 3O13A 2K04A 2EYMA 1EY6A 3HG9A 2B63B 2RKSA 4OL7A 1EU3A 4HCSA 2EYOA 2DNCA 2EY6A 4L6TB 5M5YB 5C0XG 2B2UC 4RGTA 1EIHA 1I4GA 3E6ZX 2NYZD 2PZUA 1Z6HA 2KJXA 2HDLA 1G8ZD 3Q24A 3HOUB 4ZAIA 3S16B 2B2VA 3TDQA 2D9UA 2MPMA 2LMCB 1ZYRC 2IX1A 2F0OA 4NDXA 1AFPA 5E3FA 1AZQA 1SSOA 3I4LA 1L0YB 3WOFA 4CJ0B 2H4OA 2ZT9C 2K5QA 1IHZA 4XQQA 2J0TD 1VDZA 1LTID 2K05A 4HSVA 1WD1A 4EQOA 5C4HA 3Q0AA 1VMCA 1VMPA 2Z8LA 3N52A 2B8FA 2B2VC 3HOWB 2NB0A 4IUPA 5AFWA 3KLSX 3D4DA 4G7OC 2VNUD 3K5LA 4RCOA 3MXGA 5DM63 3P1HA 3C1FA 3QWNA 2RQXA 4HSPA 3DM1A 3QG1A 3OMCA 4DAVA 3BVGA 4Z9CB 3K6OA 2KCNA 3VR2A 1LV9A 1STHA 3IFDA 3HS0C 1J8IA 2SDFA 2K33A 1M4VA 4N9PA 2E2HB 1JOOA 1Q8IA 2OT2A 1SXTA 3DEPA 5KGUA 4TRDA 1F9PA 1DCZA 4C3HG 3Q6SA 5JPMC 1ZEQX 4HTHA 1LT5D 5JPNC 4A3KB 3SK5A 1IYUA 1I4RA 1SNPA 3FEWX 3NWTA 1LTBD 4U68A 1V8QA 5C0XH 2EY5A 1QNUA 1STBA 2F0PA 3QB3A 5TSSA 1YNNC 3IKJA 4FXKC 1DOLA 3S15B 4ZUIA 1RF2D 2F0HA 5CV4A 4C1NI 1A15A 1Q1BA 3UI2A 3P7JA 4B08A 4IUUA 1TWCB 3MZ5A 1KDCA 5KYIA 2A6ED 2ZXRA 5FO8B 3BDCA 1Q1EA 4G57A 2NUCA 1G2SA 1HTPA 3GQBA 1RTNA 1ESRA 1SJHD 1E2VA 1HQRD 1PFNA 2F0JA 5KYLA 2QKIC 2K1BA 1JICA 2KUMA 4F87A 2ICIA 1JOQA 1SNDA 1QCBD 4RGMA 2E74C 5CMDA 4PV1C 1RJTA 2PZWA 2F0DA 2KOLA 4RGOS 4XYQA 3T53B 4K8JA 5EPJA 2KCCA 4A3GB 2EYHA 1SE3A 3BZDB 3N6RA 5K36H 1ET6A 2F0UA 3NHHA 1DD2A 3C46A 3D4RA 3BS1A 1WTOA 2TSSA 3SDZA 4QB4A 5K36G 4K2KA 1Q3LA 1TS4A 1GUOA 1STGA 5D3DA 4AYBB 4YIJA 4C56C 1ZKOA 4PNYA 2PYKA 4KTAA 4B9WA 4KV6A 1WVLA 1CA6A 1I50B 1U4PA 3F2UA 2CW0D 5EKIA 2EYFA 3CQZB 1YNJC 2WINB 1FR3A 2EYJA 2QDBA 4K2LA 2XRQD 5F2DA 2F0WA 3QO2A 3MAQA 3FDTA 5I4DA 1PZID 1SFOB 3S1MB 3FRPB 5E1FA 1U4RA 4A3IB 4G4KA 5LL6X 3HOVB 1HUNA 4M1UB 2F0EA 5K5PA 1GJXA 2K01A 1EIGA 1JWMD 3DWPA 1GHKA 4R8NA 1C4QA 1EOTA 3URYA 1TIID 3M4YA 4G7ZC 5FOBB 1HFGA 4K8IA 1EZ8A 1O7ZA 3D6CA 3GTLB 3PIP3 2K6AA 1KAAA 1H9JA 1BF4A 2EY2A 3SK6A 4C3JG 3EFXD 4M8AA 2OEOA 4DNTB 3S1NB 3P75A 1IW7C 3T4AC 3VR3A 4CKCA 4ZKCB 3PUXA 4DAPA 1JWSD 3LWUA 4H7BA 4RWSC 1BCPB 1K83B 1E2WA 3SR1A 2BA0A 2WP8J 5EBCA 3TZUA 1II3A 5C44B 4MIUA 4A3FB 1SYCA 5IODA 4LK1C 1WTWA 3H3VC 4FF3A 1Z7TA 5ELFA 3J7AF 3TSSA 3X3MA 1GUWA 4HN7A 4HMJA 1LTGD 5ELBA 2J7ZA 3QJYA 5C0XI 2Q8IB 4I65A 1S5DD 1Z47A 1KLGD 3GP7A 4QCLA 4IQZA 1RCVD 1X32A 4FVMA 2PO4A 5EKKA 1DM0B 1D5ZC 1F2YA 5CORA 2NVYB 4ZLTF 1PRTC 2XWBB 3S17B 1M8AA 2KECA 3TBIB 4IALA 1ENAA 2MGSA 1EL0A 2XSCA 1B1ZA 4R8IA 1CQFA 1K8MA 1EWHA 4R9WA 3PUVA 5T1IA 4OO1I 2LS01 5EPLA 4DAYA 1NCVA 1OXSC 3T56B 2Z4HA 4X3SA 2JA8B 3MTSA 2TMPA 4BBSB 3GTOB 4OO1G 3EJIA 2FMMA 2KA7A 4A3EB 2NVXB 2Q8TA 1W6JA 1TQOA 2E2DC 5KIXA 1U9RA 3X3NA 4ZK9B 2WV6D 1AW7A 2D2CC 1PRTF 1SMYD 1ICWA 1BXTA 4A3DB 5KNDA 1R4PB 4NKLA 4XXEA 5IOCA 3R2IA 1BCPF 1CZWA 3I3CA 1JCKB 1TY0A 2NN6G 2NVQB 2HCCA 4BWGB 1S5ED 1HQMC 1KDAA 5CGKA 4A93B 2MUYA 2QILA 2FHTA 4OO1H 3LWEA 2NTTA 4QF4A 4KY7A 3GV3A 1NR2A 4OIJA 1PYWD 4XYOA 3S9WA 3Q23A 4ME5A 4K5VA 2XVSA 4HAEA 1EEID 3SEBA 3RZOB 3R2TA 1FGBD 1OXTA 4OHJA 5JJZA 2XIWA 1NAPA 3A54A 1ZXTA 2IWHA 4DGZA 1W6KA 4DK1A 2WKCA 2YU9B 4ZQ3A 3GD7A 4HR7B 2RDGA 2BDNA 2F0FA 1IL8A 4A3BB 2RSNA 2FMCA 5ELCA 2M2LA 4WFN3 1NUCA 1ILQA 4IUVA 1IKMA 1A2TA 5ELDA 2O5IC 1WCMB 5C5MA 1SYFA 1WTQA 1V1PB 4RAUC 1LABA 3DMUA 1I4HA 3R93A 1PFMA 1I4QA 1Y8PB 3NQIA 3QIAA 2XWJB 3W2DA 2WB1B 4IFDI 1WTRA 1LTRD 1Y8OB 2RSOA 4ZUJA 2YYZA 1YNJD 5CC4A 4ZRZA 3K5OA 3KBXA 5BN3A 1SNOA 4MN3A 4Q0FA 5FLXE 2BA1A 3OOCA 1BO0A 1B4OA 5CV6A 3K58A 2RBMA 3MVVA 1QE6A 4F8MA 4J8QA 4WRDA 2IPKD 4DNRB 1SE4A 3NTIA 3GV6A 1VF5C 3E5SA 2EJGC 4CKEA 3S1RB 1BBXC 2F0KA 5EJWA 5DM73 1AN8A 3V05A 1U4LA 3SK8A 5C3WA 3HGBA 2SEBD 5A35A 3BG3A 1PTOD 5IGEA 1ET9A 4H13C 3J7AV 3H6MA 1I4PA 2BCOA 2F0SA 2EYPA 2CVRA 1TU2B 1Y1WB 4DFAA 4KKSA 2E2JB 2OF1A 1SEBD 3FPUB 4UAIA 2J4XA 2QEJC 3M4OB 3V2TA 3R3OA 1A3TA 1TWAB 1JR0D 1GUNA 5C6AA 3GTPB 1TR5A 4BA1I 1VCIA 1SYGA 4DXFA 4QUFA 4FXGC 3I70A 2A6HC 5HGTA 5T1GA 2KHSA 5FO9B 2NTSA 1QWYA 4MHEA 2B2UA 2PZTA 1B3AA 4H44C 2B2TA 4QIWB 2G9HD 3NTHA 1HRJA 1EEFD 1SDFA 1EY9A 3VYUA 1MGSA 3OIQA 1E2ZA 1GXDC 2KVMA 1O7LA 3TZDA 4V0BA 1V43A 4XT1B 1FD7D 4CJ2C 3ND8A 4XTCS 1G2TA 1QG7A 3ZYYX 2EOTA 2A69C 1DZ1A 4LJZC 2JA6B 2IX0A 4K6DA 3VA7A 1GHJA 3HEJA 4IUTA 3DWAA 2E76C 1B44D 1JQYD 1QILA 2JA5B 1LTSD 2ICEC 2Z1CA 1SYBA 1D1KA 1ESFA 3WOEA 2EVBA 3ITPA 3K5MA 4DXGA 4C1NK 4EGVA 2WACA 1CHPD 3NSWA 4KKTA 4ZYSA 3C2PA 1EY7A 4IZ8A 2AQ3B 3A7LA 4KMUC 3HKZB 3IAYA 1STEA 4XDXA 5A2QL 2M00A 1HCZA 4P2CB 2X6LA 2JP1A 2B2WA 1B9MA 4IUNA 1PMRA 4KJOA 4C2MB 3GTGB 3DUZA 3J81E 4F7XA 2F03A 3M7NA 3TP5A 1CT1D 3MA2B 2K03A 2ZXOA 1D1IA 1CK1A 2KQ3A 3T51B 4EQNA 3SE0A 3HOXB 2VB3X 3RLFA 3TP6A 1WTPA 2XN9C 4XT3B 5DNFA 3NK9A 3VYRA 2F0IA 2EZVA 3D3RA 1LO5D 1FNWA 2B39A 5CV5A 4L8JA 2K28A 4IUQA 4KKUA 2N88A 4N9TA 5CYUA 3VR6A 3BDLA 2HDMA 3AU7A 3C1EA 5M3FB 1KDBA 1S5BD 4NW2A 5G3LD 4L63B 1TS5A 3M7GA 4FO2A 4A3MB 1ILPA 2CW0C 2N55A 3J7YW 1GUTA 2JA7B 3OWFA 5D3IB 4HCEA 2EYLA 3KUPA 2VXWA 3BDOA 5ISRA 3NBIA 1RTOA 3QOLA 1TKWB 4PMWA 1BNZA 1HPCA 3DEOA 5E4WC 4C3IG 1HA6A 2I07B 1TS3A 2EJMA 2L4NA 4BS9A 4KN7C 5I2XA 5C3EB 2FINB 1PTOB 2X6GA 4WJWA 1CM9A 1J9OA 1I4XA 2PW7A 3PIO3 1G91A 4RKBA 3PO2B 3EA6A 2F0VA 4RKLA 1EYAA 4PMCA 1QJOA 1I6VC 2A6EC 3A8KE 3JAML 3L9AX 1GUSA 1X3QA 3VR4A 2R7ZB 1A3VA 3VA5A 3K57A 1FNVA 1EY5A 2L11A 4IFDG 3H91A 3OPOA 1ONLA 4KI0A 4C3JB 2RDFA 4I7ZC 3T16A 3FMCA 5IGGA 3M85A 3S2DB 3RUZA 3NP8A 1AP0A 1OXVA 1Y69U 2XNAC 2AWNA 4U673 3R8BA 3RD4A 3GTMB 5BN5A 1BR9A 1HTLD 1MSGA 1JWUD 1STAA 3HOYB 2AUKA 2A68D 3PV0A 1NR4A 4FF2A 1PLFA 3G6JB 2L5TA 2GA4B 1DOKA 4FNFA 3I4NB 5DEHA 1IW7D 3J81L 1FNUA 5C0XJ 2FJ2A 2PPBC 1PTOH 1SYEA 2Z4IA 5C4JB 2BE5C 4RHRA 3NUCA 2RVLA 2IW3A 3PO3B 1SMYC 4KD3A 4XIGS 4TSSA 1I3QB 1UUPA 4NMZA 4WORA 4DK0A 1UNSA 3I91A 3NE5B 5I9PA 1BQQT 1C8CA 1F77A 3J80E 4CGYB 2AQ1B 2EDGA 2EJFC 1KTKA 3PMFA 1TWFB 2QCPX 4ABNA 5COYA 2WIIB 1T5EA 2K7VA 1SE2A 4BY1B 2IL8A 2F0NA 3K7AB 4KD4A 3FKIB 4OGQC 4C3HB 2F1MA 2QF7A 2O5JC 2A6HD 5C5LA 2JEAI 1VF7A 1G291 2Q8RE 4DA2A 1RDPD 3A56A 4HMIA 4KK7A 1BCPC 4DF7A 5FKAC 2LFNA 1IKLA 3V96A 3I90A 3PUWA 5E4XA 1PRTD 1D2BA 3LNNA 1ENFA 4TKOB 1CFMA 3S2HB 3MHBA 4RA8A 4C3IB 1O7YA 5ELEA 3D31A 5I6WA 1RHPA 4KHZA 1XTCD 2CHBD 1E0BA 1MSHA 1OO9B 4E6IA 5JAVA 1LLRD 3E0JA 2F0TA 5J22A 2KEEA 5LHY1 4IFDJ 4CBVA 4BY7B 1SNCA 5EGTA 5FLXL 5BN4A 2NBFA 3JAME 3SK4A 4CKBA 1F2ZA 3TP8A 2BDOA 4KY6A 3A7AB 3NTKA 4Q5VA 2JSOA 1G6ZA 4B9XA 2Y0SB 1A6XA 3KLSA 2V4DA 2IJ0A 3OMGA 4O42A 2DNEA 2HUGA 2L55A 5NUCA 5A2QE 1Y1VB 1V1OA 2JYOA 2JEBI 3W3AA 4FYDA 1HFNA 1ML0D 1TVXA 4IFDH 2PMZB 1F9SA 1CZGA 5CBEE 2F0GA 3OW7A 1JORA 1PXUA 1A2UA 2EPBA 1EY8A 2A68C 1U4MA 1H9KA 3CRLC 1SAPA 1F2MA 1MBYA 5CBAE 5CV8A 3KK7A 1CQVA 1EYDA 2F3WA 2F0LA 2G9DA 1ZYRD 3GTJB 1KABA 1RODA 2HCIA 4JK1C 1TS2A 4XQJA 2R61A 2R92B 1HUMA 2A73B 2SOBA 3D8GA 1I6HB 4Y7NB 2B2WC 3BYYB 2WAQB 1SNMA 5IT9E 1QOHA 2L0CA 3FPPA 3Q22A 1LTTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OT2 A;  3VYT A;  2Z1C A;  3D3R A;  3VYS A;  3VYU A;  3VYR A; 
#chains in the Genus database with same CATH topology
 1X9N A;  3LX0 A;  2K32 A;  3PIP A;  4JBW A;  1IYV A;  3VR5 A;  3ICE A;  1NE3 A;  2PW5 A;  2IX3 A;  4X3U A;  4G7H C;  3DM3 A;  3CC2 A;  2CCZ A;  5IT9 L;  2R7Z H;  1RD9 D;  5D65 A;  2ES2 A;  1B3Q A;  4YCV A;  1Y1W H;  3HZX A;  2M9V A;  4DV4 L;  4BBS G;  4F88 A;  1A62 A;  3AMU A;  3H94 A;  4RGN A;  1H9M A;  3CRK C;  3HKZ G;  5EKL A;  1L1O B;  3RZD B;  4ZCK A;  1EZ6 A;  5IGC A;  4S3S A;  1WI5 A;  4HJ5 A;  1DOM A;  2I5L X;  1EY4 A;  2MO0 A;  4RH6 A;  2C9O A;  1GD7 A;  4RHS A;  3GO5 A;  3PF4 A;  1C48 A;  1VQC A;  2IT1 A;  4A75 A;  3HOZ G;  1WTH A;  5M5Y H;  1MD2 D;  4X3K A;  1S5C D;  3DHQ A;  5IGD A;  5M5X H;  1SNQ A;  4X64 L;  2R6G A;  3UE0 A;  1WTV A;  4DR2 L;  4ID6 A;  4K5W A;  1GUG A;  2AWO A;  3MC0 B;  2EXZ A;  3EN2 A;  1CTM A;  2RCF A;  3S15 H;  4X62 L;  4IPC A;  3L7Z C;  4XQN A;  4V19 0;  3A0J A;  3EVQ A;  3JC6 6;  1EY0 A;  1D6E C;  1IYJ B;  4JI0 Q;  2C5C A;  2B2T C;  3BJU A;  3OSO A;  1CA5 A;  3MXU A;  4X66 Q;  3DWQ A;  3I4O A;  1PFB A;  3BZC A;  1JB3 A;  3OWE B;  1MI2 A;  3BVM A;  4PZ7 A;  3I72 A;  2D5D A;  4LF6 Q;  4FF4 A;  1VQF A;  2PCF B;  4AYB E;  1S4Z A;  2ZXP A;  4A3J H;  1VQ7 A;  4DNI A;  1OXU A;  3L3O C;  3U9O A;  1L1O A;  3T1Y L;  3BZK A;  2EY1 A;  5C4J H;  4DV2 L;  5JEA H;  1B50 A;  1KLU D;  4GZY C;  4DV4 Q;  4IN3 A;  1VQ5 A;  5C4X B;  1TWG B;  5KEE A;  5FJ8 G;  2VQF Q;  3NBH A;  3MXN A;  5JVG 3;  1CHQ D;  2K5D A;  3CD6 A;  4CDF C;  1JOK A;  4KHV A;  3IFT A;  2D62 A;  1XPO A;  2ZJR A;  1VQ9 A;  2L12 A;  3WDN A;  2BH8 A;  2XRS D;  1SLJ A;  1KNE A;  4J1M A;  3A5Z B;  5EPK A;  4JI2 Q;  1LTA D;  4DU9 A;  4X6A H;  4ILW A;  5GAE C;  2BH2 A;  2FFK B;  1MHW C;  1TY2 A;  2B2Y C;  1XYI A;  1C0A A;  3NQT A;  1T5X D;  1LT6 D;  4QUC A;  3AQQ A;  5HUR A;  2UUB Q;  3E9H A;  3ULJ A;  1KAW A;  1X6O A;  2V1C C;  1JC7 A;  4A3C H;  2E75 C;  2MP1 A;  2I5H A;  2CH4 W;  1R9T H;  1HXY D;  2UXB L;  3OIP A;  1N34 L;  2VUM H;  2PNR C;  1D5M C;  3J80 L;  4DR1 L;  3KBG A;  1SMX A;  1QB5 D;  2B2Y A;  3MWY W;  4GNX A;  3GTQ B;  4J6H A;  1OXX K;  2DY7 A;  2IHE A;  1DJR D;  2R3Z A;  3MEF A;  4DAY B;  1BDO A;  3F8T A;  5AJ3 L;  1YHA A;  5LL6 S;  5M3M B;  1ENC A;  3PIO A;  1EQT A;  3H09 A;  2Q2I A;  3VYS A;  2MFI A;  4YWM A;  1K8O A;  1BOS A;  1FYC A;  5DAU A;  3ZJY C;  1XWE A;  4JOI A;  4DV3 Q;  1PZK D;  4QMG A;  1B2T A;  2ENB A;  4DV5 Q;  3VYT A;  3MXP A;  3D0F A;  5M3M G;  3I4N G;  4DR7 Q;  1QZH A;  4ULL A;  4LFB L;  4B3S Q;  4K5X A;  4H0L C;  4EVO A;  2HQE A;  4CJ1 B;  2UXD Q;  2BOS A;  4PMB A;  1S5F D;  2F0M A;  1VQB A;  2VUM B;  5M5W B;  5M9O A;  3CKI B;  1O80 A;  1QVF A;  4JI6 Q;  4FXD A;  4A3D H;  5JEA J;  2R93 B;  4LF9 Q;  5IIF A;  5EBD A;  1SRO A;  1TT2 A;  3BYT B;  2SNM A;  1X3G A;  3C3L A;  3RMH A;  1BBU A;  5I2Y A;  4R4I A;  1JJ2 A;  1IBK Q;  1DXM A;  1Q90 A;  2A74 C;  1TWC H;  1PH8 A;  4FF1 A;  3HP3 A;  2MHV A;  3IL8 A;  3CU7 A;  2A5H A;  1EYC A;  2VB2 X;  3J80 c;  2F4I A;  2O2L D;  1LYL A;  5IGB A;  1F9R A;  5IYC H;  4LF9 L;  3K7U C;  1L2F A;  2L1B A;  3E0E A;  3KLR A;  4AIM A;  3AB9 A;  1LT4 D;  2NN6 I;  1Q86 C;  1JE4 A;  3A8I E;  4IUR A;  1SYD A;  2LKV A;  2B8G A;  5FK9 C;  1CI3 M;  2JE6 I;  1EFW A;  4JI3 L;  4DN4 M;  1I94 L;  3CHB D;  4KHP Q;  1STY A;  2F3V A;  3I4M B;  5CV7 A;  4A3D G;  1EYG A;  1QZG A;  4LF8 Q;  2KED A;  3ER0 A;  4JI1 Q;  4A3K G;  1AEX A;  2I5M X;  4FP5 D;  2OXP A;  4O1N A;  5JOB A;  5C4Z A;  4PQX A;  1L0X B;  2AMC B;  5D14 A;  4KY5 A;  2I0Q A;  3H0G B;  1PTO C;  1AZP A;  2E2I B;  4LF8 L;  3HOV G;  1X65 A;  1K83 H;  2N49 A;  1B7Y B;  2Q2H A;  4LMQ D;  1XPU A;  3U9S A;  3GTJ H;  1GO3 E;  1TWH B;  3NXW A;  3TME A;  2VS1 A;  2ID0 A;  2F4V Q;  5M5X B;  1NMF A;  2B3G A;  2CQA A;  5C3X A;  3MFY A;  1EU4 A;  2JA8 G;  5IP9 H;  3HOZ B;  4HJ9 A;  1NSN S;  2N8N A;  3BVZ A;  1WD0 A;  4JI2 L;  3D6W A;  3I8Z A;  2MJ8 A;  5J1Z A;  5J39 A;  2A69 D;  1PDQ A;  3RNU A;  1B8A A;  1DGS A;  4RCN A;  1D5X C;  1EQQ A;  2I46 A;  1PZJ D;  5JVH 3;  3ERQ A;  1VQM A;  3S2H H;  2O4X A;  3U50 C;  3SHL A;  3ND9 A;  3NBH B;  1EOV A;  5IE8 A;  2RF4 A;  2Z0S A;  3FKI H;  2K5W A;  2BE5 D;  3S1Q B;  1STN A;  2DN8 A;  1Q12 A;  3M3Y B;  3J81 j;  2XGT A;  1H9S B;  1EFI D;  2JQO A;  4OON A;  2SNS A;  2QW7 A;  2AUJ D;  3D4W A;  4KJN A;  1HZA A;  1WTX A;  1EWC A;  3GTL H;  2EE1 A;  4OX9 L;  4NP5 A;  1EQV A;  5J3B A;  1FGU A;  5FLM H;  2NVT B;  3NWS A;  1H9S A;  3U4Z A;  4UDU C;  1LT3 D;  1HNX Q;  2RDH A;  1YJ9 A;  2PQE A;  3CCE A;  2GN5 A;  1QNK A;  1LM0 A;  5C4X H;  1UAP A;  2NWG A;  1SBB B;  1LAC A;  2UXD L;  3K0Y A;  1Z9F A;  4LFA L;  4X3T A;  1CKO A;  2JA5 G;  3KF8 A;  4RFB A;  1KNA A;  3RR5 A;  2L9H A;  1Q8K A;  3F2B A;  1IBK L;  4DR5 L;  1XXG A;  4K14 A;  5FJ8 H;  2NN6 H;  1V1P A;  5I9O A;  5ELO A;  2UXC Q;  5G3L F;  2NZ1 D;  5JEA G;  4CHT B;  2F0Q A;  2P5Z X;  3HRZ C;  3PUY A;  5CV9 A;  5FO7 B;  2B63 H;  1N32 Q;  4DV7 Q;  5CR3 A;  3M3Y H;  1R9T B;  3K59 A;  1PH5 A;  1DYQ A;  5HY6 A;  1B53 A;  2X69 A;  4TQU S;  2HHH L;  1K3B C;  4KN4 C;  1WCM G;  3MEH A;  5FLM G;  5H1S E;  1XX8 A;  5JJI A;  4UY8 C;  2E5L L;  3I73 A;  1O78 A;  5IT9 c;  1BCP D;  2AQ2 B;  5I6Y A;  3P20 A;  1A8V A;  2DUD A;  1H9R A;  3QOJ A;  4GKK Q;  1TXY A;  5KNB A;  2C35 B;  1HHV A;  3F1Z A;  3NEN A;  4OIK A;  2ATW A;  1A3U A;  1LTL A;  3ONA B;  4LW1 A;  2R7Z G;  4NB3 A;  2CKZ B;  1F9Q A;  2VQE L;  2RA4 A;  1K0S A;  1HNW L;  3MFG A;  5AJ3 Q;  2JXM B;  5KRU A;  3KDF B;  3A8J E;  4GKJ L;  1I6H H;  3A55 A;  1RKN A;  3G7L A;  2YU9 H;  5EQ0 A;  3SGI A;  4LUV A;  3PUZ A;  1YNN D;  4BBR B;  3HKS A;  1HA5 A;  4A3J B;  1UEA B;  2DY8 A;  3EQL C;  3SVM A;  2B63 G;  2H1E A;  3G4S A;  4LAA A;  3GTP H;  1PTO F;  3OHX C;  1DON A;  3FKI G;  1X3P A;  1R4Q B;  4GN3 B;  5KNC A;  1PRT B;  4EQP A;  1GOZ A;  2LY7 A;  3SXH A;  3DXJ C;  4AH6 A;  3ERO A;  3GTK B;  4ZKB B;  3TN2 A;  1B9N A;  4QQB X;  4JW0 A;  3K5N A;  5JJL A;  4HED A;  1Q46 A;  2WKD A;  1E1T A;  1YBY A;  1N33 L;  1I50 H;  3NPP A;  4BA2 I;  3TP7 A;  2JN4 A;  1Y8N B;  1SN8 A;  3F2D A;  3T13 A;  3J7Z C;  4DR3 Q;  4DV1 L;  1BUV T;  4ODG A;  1IL2 A;  1F2L A;  3A74 A;  1SJE D;  3FVQ A;  4DR3 L;  1IBM Q;  5IGF A;  5IYD G;  3S14 B;  4K6L A;  3O13 A;  2K04 A;  2R92 H;  2EYM A;  2Z6K A;  1EY6 A;  3HG9 A;  2B63 B;  2RKS A;  4C3I H;  2WB1 E;  4OL7 A;  1EU3 A;  4HCS A;  2EYO A;  2DNC A;  2EY6 A;  4L6T B;  5M5Y B;  5FLX c;  2JA5 H;  4UHV A;  5C0X G;  4A3I G;  2B2U C;  1D8L A;  4RGT A;  1EIH A;  1PH6 A;  1I4G A;  3E6Z X;  4IJL A;  2NYZ D;  2PZU A;  1N32 L;  1Z6H A;  2KJX A;  2L15 A;  1E22 A;  2Z6K C;  2HDL A;  1G8Z D;  1UWV A;  1PH7 A;  3Q24 A;  1IBL L;  3HOU B;  4IJH A;  1PYS B;  4ZAI A;  1WJJ A;  3S16 B;  2OCE A;  3J80 i;  2B2V A;  3TDQ A;  4BBS H;  2D9U A;  3K81 C;  2NVT H;  2MPM A;  2LMC B;  1ZYR C;  4GKJ Q;  2IX1 A;  4X64 Q;  2F0O A;  4NDX A;  1AFP A;  5E3F A;  1AZQ A;  4A3K H;  1SSO A;  2RHS B;  2PI2 E;  3I4L A;  1L0Y B;  3S2D H;  3NEM A;  4B3R L;  3WOF A;  3E3X A;  4CJ0 B;  2H4O A;  4GLA C;  2ZT9 C;  3H15 A;  1XTD A;  1V1Q A;  2K5Q A;  1IHZ A;  1KXL A;  3S1N H;  4XQQ A;  2J0T D;  3KF6 A;  4BY7 H;  4JYA Q;  1VDZ A;  1LTI D;  2K05 A;  4POF A;  4HSV A;  1CSQ A;  1WD1 A;  4JC0 A;  3HOX H;  4EQO A;  5C4H A;  3Q0A A;  1VMC A;  1C7Y A;  4APV A;  1VMP A;  2QA4 A;  1K3R A;  2Z8L A;  3N52 A;  4JV5 Q;  2B8F A;  1EQR A;  1VQJ A;  2B2V C;  3HOW B;  2NB0 A;  4IUP A;  4RMF A;  5AFW A;  3KLS X;  3D4D A;  4G7O C;  2VNU D;  3K5L A;  4RCO A;  3MXG A;  1EWI A;  5C44 G;  4GOP C;  5DM6 3;  3P1H A;  4DKA C;  3C1F A;  3QWN A;  1PH1 A;  2RQX A;  1KHI A;  4HSP A;  2KEN A;  3DM1 A;  3QG1 A;  3OMC A;  4DAV A;  4LFA Q;  3BVG A;  4Z9C B;  3K6O A;  2KCN A;  3VR2 A;  1X3E A;  1LV9 A;  1STH A;  3IFD A;  4QJF A;  1TWH H;  3HS0 C;  1J8I A;  2SDF A;  2UU9 L;  4DUZ L;  2K33 A;  1M4V A;  4N9P A;  2E2H B;  1JOO A;  1PH2 A;  3U58 A;  4K0K Q;  1Q8I A;  2OT2 A;  1NMG A;  1SXT A;  4IPD A;  3KFU A;  4C3H H;  3DEP A;  5LMN W;  3TS2 A;  5KGU A;  2JA7 G;  2OTL A;  4TRD A;  1F9P A;  1X56 A;  1DCZ A;  2UUA Q;  4C3H G;  3Q6S A;  5JPM C;  4LF7 L;  1ZEQ X;  4HTH A;  4A3M H;  1LT5 D;  5JPN C;  1J5E Q;  3M4Q A;  4A3K B;  3SK5 A;  4LF5 L;  1IYU A;  1I4R A;  1SNP A;  3FEW X;  3NWT A;  1LTB D;  3W1B A;  4BY7 G;  4U68 A;  4A93 G;  2K4K A;  1V8Q A;  5IWA Q;  5C0X H;  2B29 A;  2EY5 A;  1QNU A;  1STB A;  3OW2 A;  2F0P A;  3QB3 A;  3TS0 A;  1BVS A;  5TSS A;  2MNA A;  1YNN C;  3IKJ A;  1XNR L;  4FXK C;  4PZ6 A;  4JI4 Q;  1DOL A;  3PO2 G;  3CC7 A;  3S15 B;  4ZUI A;  1RF2 D;  1WFQ A;  1HNX L;  2F0H A;  5CV4 A;  4C1N I;  1A15 A;  1Q1B A;  1N36 L;  3UI2 A;  1N8R C;  3HOW H;  3T1H Q;  3P7J A;  4B08 A;  4IUU A;  1YVC A;  1K0R A;  1TWC B;  3MZ5 A;  5BR8 L;  1XJV A;  1KDC A;  2Z6B A;  5KYI A;  1VQK A;  2A6E D;  2ZXR A;  5FO8 B;  3BDC A;  1NNX A;  1Q1E A;  4G57 A;  2NUC A;  1CKN B;  1G2S A;  1HTP A;  2F3I A;  4LF4 L;  3GQB A;  1RTN A;  3HOZ H;  1CSP A;  1ESR A;  4A3L H;  4YY3 L;  1SJH D;  1E2V A;  1HQR D;  1Y1W G;  1PFN A;  2ZTC A;  3RZD H;  4NXN Q;  2F0J A;  5KYL A;  2QKI C;  4B3S L;  2K1B A;  1JIC A;  1BKB A;  2KUM A;  4F87 A;  2ICI A;  1JOQ A;  1SND A;  1QCB D;  4RGM A;  2E74 C;  5CMD A;  4PV1 C;  1RJT A;  2PZW A;  5ELN A;  2F0D A;  2KOL A;  4RGO S;  4OXP A;  1PV4 A;  3CAM A;  4XYQ A;  4LNQ A;  3T53 B;  4K8J A;  5EPJ A;  4Y7N H;  1IXR A;  2KCC A;  2VUM G;  3PSI A;  4A3G B;  2EYH A;  1SE3 A;  3BZD B;  3N6R A;  5K36 H;  2VL6 A;  1ET6 A;  1CKM A;  2F0U A;  3NHH A;  2AKW B;  1DD2 A;  3C46 A;  3D4R A;  5HGQ A;  3M4O H;  3BS1 A;  1WTO A;  4P72 A;  2TSS A;  4O0A A;  3SDZ A;  4QB4 A;  4BBR H;  5K36 G;  1I94 Q;  4K2K A;  3HOV H;  1Q3L A;  1TS4 A;  1GUO A;  1STG A;  5D3D A;  4AYB B;  2JA6 H;  4DR6 Q;  4J15 A;  4YIJ A;  4C56 C;  1Y1V G;  1YZ6 A;  1ZKO A;  4PNY A;  2PYK A;  1VQI A;  4A3G G;  4KTA A;  4JI4 L;  4AYB G;  4YHH Q;  1FL0 A;  4B9W A;  4KV6 A;  1WVL A;  1CA6 A;  1I50 B;  4DR7 L;  1U4P A;  3F2U A;  4DV5 L;  2CW0 D;  5EKI A;  2EYF A;  3CQZ B;  2R93 G;  1YNJ C;  2WIN B;  4JBK A;  4NPS A;  1FR3 A;  2EYJ A;  4DR6 L;  2QDB A;  4QY7 A;  4K2L A;  2XRQ D;  5F2D A;  2F0W A;  4PG3 A;  5C4X G;  3QO2 A;  1YJN A;  3MAQ A;  3FDT A;  4A3F H;  5I4D A;  1PZI D;  3KF8 B;  1SFO B;  3S1M B;  3FRP B;  2N78 A;  5E1F A;  4LFC L;  4P74 A;  4N8F A;  3J81 c;  1U4R A;  4B3M Q;  1VQL A;  4A3I B;  4HJ8 A;  4G4K A;  5LL6 X;  3HOV B;  1HUN A;  4RG1 A;  1UE7 A;  3FP9 A;  4M1U B;  2F0E A;  5K5P A;  1GJX A;  1XNR Q;  2K01 A;  4KLK A;  1EIG A;  1XMO Q;  1JWM D;  3DWP A;  4P75 A;  1GHK A;  4R8N A;  1C4Q A;  4JOI C;  1PVO A;  1EOT A;  3URY A;  1TII D;  3M4Y A;  4G7Z C;  5FOB B;  2RCN A;  1HFG A;  5GAG C;  1XNQ L;  4K8I A;  1QUQ A;  3L2P A;  1EZ8 A;  4LFB Q;  1O7Z A;  2KCT A;  3D6C A;  3GTL B;  3PIP 3;  5LMU Q;  2K6A A;  1KAA A;  2FXQ A;  1H9J A;  1JB7 A;  4JV5 L;  3I56 A;  2CFM A;  2K50 A;  4A3B H;  1BF4 A;  4JBM A;  2EY2 A;  3SK6 A;  4C3J G;  2HT1 A;  2EIF A;  3EFX D;  4M8A A;  3G6E A;  4DUZ Q;  2OEO A;  4DNT B;  1PYB A;  3S1N B;  3AFP A;  4LF6 L;  4R4Q A;  1KRT A;  2QEX A;  3CPW A;  1S72 A;  1HR0 W;  2ZTE A;  4TVA B;  2HQL A;  3P75 A;  3I4M G;  1IW7 C;  3UDF A;  3S1R H;  5JJK A;  2DJG C;  3H3V I;  4JI7 L;  4O2D A;  3T4A C;  4C3J H;  3AYH B;  3VR3 A;  4JI5 L;  4CKC A;  4ZKC B;  3PUX A;  4DAP A;  1HJP A;  1JWS D;  3LWU A;  4H7B A;  4RWS C;  1BCP B;  1K83 B;  4WJ3 M;  1E2W A;  3SR1 A;  2BA0 A;  2WP8 J;  3HOX G;  5EBC A;  3TZU A;  3S1M H;  1QVC A;  1IBL Q;  1II3 A;  4LUO A;  4HJ7 A;  4UP7 A;  5C44 B;  4JI8 Q;  2UUC Q;  3K7A H;  4A3M G;  4MIU A;  4A3F B;  2E2I H;  1SYC A;  5IOD A;  4LK1 C;  1WTW A;  3H3V C;  3CXC A;  4FF3 A;  1Z7T A;  2ZM6 Q;  5ELF A;  1AE3 A;  3J7A F;  1KQS A;  3TSS A;  3X3M A;  1VQO A;  5C3E H;  1GUW A;  4HN7 A;  3KOJ A;  4HMJ A;  5DLQ E;  3J7A 5;  3HOW G;  1LTG D;  5ELB A;  2J7Z A;  3QJY A;  2UU9 Q;  2WB1 G;  4NXM L;  2N3S A;  4X66 L;  2MO1 A;  5C0X I;  4JG2 A;  1I3Q H;  4GS3 A;  2Q8I B;  4I65 A;  1S5D D;  1Z47 A;  3PO3 H;  1KLG D;  3GP7 A;  4QCL A;  4IQZ A;  1RCV D;  1X32 A;  4FVM A;  1BBW A;  1W2B A;  2PO4 A;  5EKK A;  1C9O A;  2CWA A;  4MZ9 A;  1DM0 B;  2PI2 A;  1D5Z C;  1F2Y A;  5COR A;  4B3T Q;  2NVY B;  3I4N H;  1HZB A;  3S24 A;  4ZLT F;  1PRT C;  2XWB B;  4CDC C;  3S17 B;  1PH9 A;  4BXX H;  4LWC A;  5LMN L;  3H3V H;  1M8A A;  4DR4 Q;  2KEC A;  3TBI B;  4IAL A;  1ENA A;  3JAM i;  2MGS A;  4GN5 A;  1EL0 A;  2XSC A;  1B1Z A;  4R8I A;  5C44 H;  1Q82 C;  4GNX C;  1CQF A;  1K8M A;  1NJI C;  1EWH A;  2GVB A;  3VDY A;  4R9W A;  3FHW A;  3PUV A;  5T1I A;  4OO1 I;  2LS0 1;  5EPL A;  3KLW A;  4DAY A;  2R92 G;  1NCV A;  2MQH A;  1OXS C;  3T56 B;  2Z4H A;  5LMU L;  4X3S A;  2JA8 B;  3I55 A;  2E5L Q;  3MTS A;  2TMP A;  1HNZ L;  4BBS B;  3GTO B;  1Q81 C;  4OO1 G;  1XNQ Q;  3EJI A;  2FMM A;  2KA7 A;  4A3E B;  4JCV E;  3CCJ A;  2NVX B;  2Q8T A;  1W6J A;  1YEZ A;  1TQO A;  2E2D C;  5KIX A;  1U9R A;  1YI2 A;  3X3N A;  4ZK9 B;  2WV6 D;  2G5D A;  1AW7 A;  2D2C C;  1PRT F;  3CCR A;  1SMY D;  1ICW A;  2Q2T A;  1BXT A;  3S17 H;  4A3D B;  5KND A;  2YTX A;  1R4P B;  1VQH A;  4NKL A;  4XXE A;  5IOC A;  5C3E G;  3R2I A;  1BCP F;  3UDG A;  4BBR G;  1CZW A;  2AHO B;  3I3C A;  3ERS X;  1JCK B;  1TY0 A;  2NN6 G;  5IYC G;  2NVQ B;  2HCC A;  2R7F A;  4BWG B;  1S5E D;  5GRO A;  1HQM C;  2XTI A;  4DV1 Q;  4GOP A;  1KDA A;  2Z9H A;  5CGK A;  4A93 B;  2MUY A;  1MJC A;  4Y52 H;  2QIL A;  2FHT A;  4OO1 H;  3LWE A;  2NTT A;  4JI5 Q;  4QF4 A;  4KY7 A;  4OX9 Q;  3GV3 A;  4DAM A;  1NR2 A;  4OIJ A;  1PYW D;  4XYO A;  2JA8 H;  3S9W A;  3Q23 A;  1E1O A;  4ME5 A;  4K5V A;  2XVS A;  3OYY A;  4HAE A;  1EEI D;  3SEB A;  3RZO B;  3R2T A;  4HIO A;  1FGB D;  1OXT A;  1PH3 A;  4OHJ A;  2UUC L;  5JJZ A;  2XIW A;  1IZ6 A;  3G48 A;  1NAP A;  1T9H A;  3A54 A;  1Y1V H;  1ZXT A;  1VQD A;  1VS0 A;  2ZJP A;  3GTK H;  2IWH A;  4A3L G;  4DGZ A;  1W6K A;  1YJW A;  4DK1 A;  2WKC A;  2YU9 B;  3PGZ A;  2PQA A;  1VQE A;  4MNO A;  4ZQ3 A;  3GD7 A;  1PFS A;  4HR7 B;  2RDG A;  5GAH C;  2BDN A;  2F0F A;  1IL8 A;  4A3B B;  1HR0 L;  1A0I A;  1WCM H;  2RSN A;  2FMC A;  5ELC A;  2M2L A;  4WFN 3;  2CQO A;  1NUC A;  3CCU A;  1ILQ A;  4IUV A;  5E7N A;  1IKM A;  1A2T A;  2OQK A;  5ELD A;  2O5I C;  1WCM B;  5C5M A;  1SYF A;  3W1G A;  1WTQ A;  1V1P B;  4RAU C;  3DMU A;  1LAB A;  2CWP A;  4PZ8 A;  1I4H A;  3R93 A;  1PFM A;  1I4Q A;  1Y8P B;  3NQI A;  1KIX A;  3QIA A;  1HR0 Q;  2XWJ B;  4YY3 Q;  1V9P A;  1VQ8 A;  3W2D A;  4FDB A;  2WB1 B;  1U5K A;  4AQY Q;  4IFD I;  1WTR A;  1LTR D;  1Y8O B;  2HIX A;  3RZO H;  1MIU A;  2LSS A;  2RSO A;  4ZUJ A;  4MTN A;  2YYZ A;  1YNJ D;  1GM5 A;  1B70 B;  4H02 A;  5CC4 A;  4ZRZ A;  1YIJ A;  1JMC A;  1FJG Q;  3K5O A;  3KBX A;  3OTO Q;  1VQG A;  5BN3 A;  4L5R C;  1SNO A;  4MN3 A;  4Q0F A;  5FLX E;  3QR8 A;  3JAM c;  2BA1 A;  3OOC A;  3TQY A;  2K5V A;  3CCM A;  3S16 H;  1A63 A;  4YCW A;  1BO0 A;  3MXN B;  1B4O A;  5CV6 A;  3K58 A;  3IRB A;  2Q2U A;  2RBM A;  3MVV A;  1QE6 A;  4F8M A;  4J8Q A;  1E24 A;  4WRD A;  2IPK D;  4B3M L;  2GVA A;  4DNR B;  4LFC Q;  1SE4 A;  4BXX G;  3OTO L;  3NTI A;  4N8X 1;  3GV6 A;  1VF5 C;  3E5S A;  2EJG C;  2CH4 A;  4CKE A;  2PMZ E;  4A4I A;  1FVI A;  3S1R B;  1BBX C;  3I4M H;  2F0K A;  1K8G A;  5EJW A;  2K5N A;  5DM7 3;  1AN8 A;  3V05 A;  1U4L A;  3SK8 A;  2ZTD A;  5C3W A;  3CCV A;  2R93 H;  3HGB A;  2SEB D;  4JI3 Q;  3H0G G;  5A35 A;  1HH2 P;  4DPG A;  1NY4 A;  2VZA A;  5IP7 G;  3BG3 A;  2EQS A;  1PTO D;  5IGE A;  1ET9 A;  4H13 C;  3J7A V;  3H6M A;  1I4P A;  4IPH A;  1E7Z A;  2BCO A;  2F0S A;  1VQP A;  3CP0 A;  1E3P A;  5GAD C;  2EYP A;  2VY3 A;  4DK6 C;  2CVR A;  1TU2 B;  1Y1W B;  4KKS A;  4DFA A;  2E2J B;  2OF1 A;  1SEB D;  1EIF A;  3FPU B;  4UAI A;  2J4X A;  2QEJ C;  3M4O B;  3V2T A;  3R3O A;  1A3T A;  1TWA B;  1K28 A;  1JR0 D;  4GN4 B;  1GUN A;  4P73 A;  5C6A A;  3GTP B;  1KD1 C;  1S3O A;  3CCS A;  1TR5 A;  4BA1 I;  1VCI A;  4AQY L;  1SYG A;  4P71 A;  4DXF A;  4QUF A;  4FXG C;  4A3F G;  4GOP B;  2UXB Q;  2KHJ A;  4ME3 A;  3I70 A;  2A6H C;  5HGT A;  4K0K L;  5T1G A;  4DK3 C;  2KHS A;  4A3J G;  5FO9 B;  2NTS A;  1KL9 A;  1UE5 A;  4A3I H;  1QWY A;  2NVY H;  4MHE A;  2B2U A;  1NBW A;  2PZT A;  2OQ0 A;  2A8V A;  1B3A A;  1YHB A;  4DUY Q;  4H44 C;  2B2T A;  4QIW B;  2G9H D;  3NTH A;  4A93 H;  1HRJ A;  4ALP A;  1EEF D;  4QGU A;  1SDF A;  1EY9 A;  3VYU A;  1MGS A;  1MJE A;  1TWA H;  3OIQ A;  1E2Z A;  5IWA L;  1GXD C;  2KVM A;  1O7L A;  1KC8 C;  1EUJ A;  3TZD A;  4V0B A;  1H95 A;  1V43 A;  3M9B A;  4R4O A;  2VQF L;  2E2J H;  4XT1 B;  5IP7 H;  1FD7 D;  4CJ2 C;  2KCM A;  3ND8 A;  1J5E L;  4LF5 Q;  4XTC S;  1G2T A;  1QG7 A;  1L1O C;  2EOT A;  3ZYY X;  4I7A A;  2A69 C;  2K5H A;  3HOU H;  3T1Y Q;  2F52 A;  1DZ1 A;  1WYD A;  4LJZ C;  2JA6 B;  1SE8 A;  1N36 Q;  2IX0 A;  4K6D A;  5M3F G;  4HID A;  3VA7 A;  1GHJ A;  3HEJ A;  3RN2 A;  3CCL A;  4IUT A;  2YV5 A;  3DWA A;  2E76 C;  3B6Y A;  1B44 D;  1M1K C;  3KJO A;  1JQY D;  1QIL A;  1I5F A;  3TEH B;  2JA5 B;  1LTS D;  2ICE C;  1L0W A;  4A3G H;  2Z1C A;  1SYB A;  1D1K A;  1ESF A;  3STB D;  3WOE A;  4JI8 L;  2EVB A;  5M3F H;  3ITP A;  1VQN A;  3K5M A;  3ULP A;  2PNH A;  4DXG A;  4DR2 Q;  4JI0 L;  4C1N K;  4EGV A;  1MKH A;  2WAC A;  3E9I A;  3K8A A;  1CHP D;  3NSW A;  1HZ9 A;  4KKT A;  4LF7 Q;  4DV2 Q;  3TRZ A;  1SRU A;  4ZYS A;  3C2P A;  1EY7 A;  4IZ8 A;  2AQ3 B;  3A7L A;  4KMU C;  3HKZ B;  3IAY A;  5GQO A;  3LGJ A;  1STE A;  4XDX A;  5A2Q L;  2M00 A;  2RHQ B;  1HCZ A;  4P2C B;  2X6L A;  1SFO H;  1TWF H;  2JP1 A;  2B2W A;  1B9M A;  4IUN A;  1PMR A;  4KJO A;  2ZM6 L;  4C2M B;  3GTG B;  3DUZ A;  3RLN A;  1JE5 A;  3UDX A;  4F7X A;  3J81 E;  4GLV B;  1CKN A;  2F03 A;  3M7N A;  5EAY A;  1EIY B;  4DR4 L;  3TP5 A;  1CT1 D;  3MA2 B;  2K03 A;  2ZXO A;  2DGY A;  1D1I A;  1ICF B;  4OWW B;  1CK1 A;  4EQ5 A;  2KQ3 A;  3T51 B;  4EQN A;  3SE0 A;  3HOX B;  4L5T A;  2VB3 X;  2D0O A;  3RLF A;  3TP6 A;  4X62 Q;  1WTP A;  2XN9 C;  4XT3 B;  5DNF A;  3NK9 A;  3VYR A;  2F0I A;  2EZV A;  3D3R A;  1LO5 D;  1VQA A;  1FNW A;  1HZC A;  2B39 A;  5CV5 A;  4L8J A;  2K75 A;  2K28 A;  3U4V A;  4IUQ A;  4KKU A;  2N88 A;  4JBJ A;  1JT8 A;  2LXJ A;  4N9T A;  5CYU A;  1Y14 B;  3VR6 A;  3BDL A;  1SR3 A;  2HDM A;  3AU7 A;  3C1E A;  5M3F B;  1KDB A;  1S5B D;  4NW2 A;  5G3L D;  1S40 A;  1VQ6 A;  4L63 B;  1TS5 A;  3M7G A;  4FO2 A;  2HHH Q;  4A3M B;  4UPA A;  1ILP A;  4B3R Q;  2CW0 C;  3KYH C;  4DV7 L;  2JJQ A;  2N55 A;  3J7Y W;  1GUT A;  3A5U A;  2JA7 B;  2EXD A;  3OWF A;  5D3I B;  4HCE A;  2EYL A;  3KUP A;  2VQE Q;  2VXW A;  1P16 A;  4EX5 A;  3BDO A;  3UDI A;  4DR5 Q;  1PHJ A;  1IBM L;  5ISR A;  4OWX B;  3NBI A;  4NXM Q;  1RTO A;  3QOL A;  1TKW B;  2WFW A;  4PMW A;  2D0P A;  1BNZ A;  1HPC A;  3DEO A;  5E4W C;  1U0L A;  4C3I G;  1HA6 A;  1UE1 A;  2I07 B;  1TS3 A;  3EIV A;  4JI7 Q;  4JPB W;  2OTJ A;  2EJM A;  4DUY L;  2L4N A;  1N33 Q;  1O7I A;  4BS9 A;  4KN7 C;  5I2X A;  5C3E B;  2FIN B;  1PTO B;  2X6G A;  4DV0 L;  4WJW A;  4OEL B;  2YTV A;  1CM9 A;  1J9O A;  1I4X A;  2PW7 A;  3PIO 3;  3EBE A;  4A76 A;  1G91 A;  4RKB A;  3AFQ A;  3PO2 B;  3EA6 A;  3S14 H;  2F0V A;  2UXC L;  4RKL A;  4DV6 Q;  1EYA A;  2HIV A;  1P8L A;  4PMC A;  2NZH A;  1QJO A;  1I6V C;  2A6E C;  3A8K E;  3PQI A;  4CDD C;  5M5W H;  3JAM L;  3L9A X;  1GUS A;  1X3Q A;  4A3E H;  3VR4 A;  2R7Z B;  1A3V A;  3GDE A;  3VA5 A;  2OWO A;  3K57 A;  1FNV A;  3GTO H;  3K0X A;  1EY5 A;  1K8A C;  2L11 A;  1G6P A;  4IFD G;  3H91 A;  2KBN A;  3OPO A;  1ONL A;  3CF5 A;  4KI0 A;  4LUZ A;  1YIT A;  2NVX H;  4X65 L;  5M3M H;  4C3J B;  2RDF A;  3F2C A;  1AH9 A;  4I7Z C;  3T16 A;  3FMC A;  5IGG A;  3M85 A;  3S2D B;  3RUZ A;  3NP8 A;  3UE1 A;  4IOA A;  1AP0 A;  1OXV A;  1Y69 U;  2XNA C;  2AWN A;  4U67 3;  4QIW E;  3KDF A;  3R8B A;  3RD4 A;  4NXN L;  3GTM B;  2A1A A;  3W5O A;  5BN5 A;  1BR9 A;  1HTL D;  3RLO A;  2ZJQ A;  1MSG A;  4LF4 Q;  1JWU D;  3J81 i;  1JJG A;  1STA A;  3HOY B;  2AUK A;  2A68 D;  3PV0 A;  1NR4 A;  1UEB A;  4FF2 A;  4A3C G;  1PLF A;  3G6J B;  2L5T A;  2GA4 B;  1XMQ Q;  1DOK A;  5IYB H;  4FNF A;  3I4N B;  1HNW Q;  5DEH A;  2Y0S E;  1IW7 D;  3J81 L;  1FNU A;  1CUK A;  3RN5 A;  5C0X J;  2FJ2 A;  2PPB C;  1PTO H;  1SYE A;  2JA6 G;  2Z4I A;  2DJF C;  1LUZ A;  4GKK L;  3STB C;  1OTC A;  5C4J B;  2BE5 C;  4RHR A;  2F4V L;  3NUC A;  3KJP A;  1XMO L;  2RVL A;  2IW3 A;  3PO3 B;  4YHH L;  1SMY C;  1TWG H;  4KD3 A;  4OWT B;  4XIG S;  4TSS A;  1D7Q A;  1I3Q B;  1UUP A;  1J6Q A;  4NMZ A;  4WOR A;  4DK0 A;  2ASB A;  1UNS A;  3I91 A;  3NE5 B;  4HJA A;  5I9P A;  1BQQ T;  1C8C A;  2ALY B;  4MTK A;  3I7F A;  1F77 A;  3J80 E;  4CGY B;  1ASY A;  2AQ1 B;  2EDG A;  2EJF C;  1KTK A;  4R4C A;  3PMF A;  3CCQ A;  1TWF B;  5BR8 Q;  3KF6 B;  2QCP X;  4ABN A;  5COY A;  1KRS A;  2K14 A;  3PO3 G;  3L0O A;  2WII B;  1T5E A;  2K7V A;  1SE2 A;  3NEL A;  4BY1 B;  2IL8 A;  1WOC A;  2F0N A;  4IPG A;  3K7A B;  4KD4 A;  4WJ4 A;  3FKI B;  3PCO B;  2H5X A;  4OGQ C;  4C3H B;  4OEM B;  4YCU A;  4JI6 L;  3Q8D A;  4R4T A;  2F1M A;  1YNX A;  3G71 A;  3BU2 A;  1YHQ A;  1ASZ A;  1X3F A;  2QDL A;  2QGQ A;  2QF7 A;  1FJG L;  2O5J C;  2A6H D;  5C5L A;  2JEA I;  5IYD H;  1VF7 A;  1G29 1;  3AEV A;  2Q8R E;  4DA2 A;  1NTG A;  5IY0 A;  1RDP D;  1QUQ B;  1GVP A;  3A56 A;  4HMI A;  4IOC A;  4DV3 L;  4KK7 A;  1BCP C;  4DF7 A;  5FKA C;  2LFN A;  1IKL A;  3V96 A;  3I90 A;  3PUW A;  5E4X A;  1PRT D;  1D2B A;  3LNN A;  1ENF A;  4TKO B;  3PF5 A;  3HOY H;  1CFM A;  3S2H B;  2E8G A;  3HFZ B;  3MHB A;  4RA8 A;  2E2H H;  1XMQ L;  4C3I B;  1W3S A;  4POG A;  1O7Y A;  4YWK A;  5ELE A;  3D31 A;  4JI1 L;  1RHP A;  5I6W A;  1N34 Q;  1PH4 A;  4KHZ A;  4JVZ A;  1AE2 A;  4C2M H;  3GTG H;  1XTC D;  2CHB D;  1E0B A;  2HD3 A;  1MSH A;  1OO9 B;  4E6I A;  5JAV A;  4JYA L;  1LLR D;  1HNZ Q;  3E0J A;  2F0T A;  5J22 A;  2KEE A;  4KHP L;  4X65 Q;  5LHY 1;  4IFD J;  4CBV A;  4BY7 B;  1SNC A;  5EGT A;  2VW9 A;  5FLX L;  5BN4 A;  4HIM A;  2NBF A;  3JAM E;  4IO9 A;  3SK4 A;  1XPR A;  5L37 A;  2IY5 B;  4CKB A;  1F2Z A;  4R1J A;  2IHF A;  3TP8 A;  2BDO A;  4KY6 A;  3A7A B;  3NTK A;  3WWV A;  3CC4 A;  4BY1 G;  2JSO A;  4Q5V A;  1G6Z A;  4B9X A;  2WAQ G;  2Y0S B;  1RL2 A;  1A6X A;  1GKH A;  3KLS A;  3DLL A;  1QVG A;  1JJC B;  1RIP A;  2IJ0 A;  2V4D A;  3OMG A;  4DR1 Q;  2NVQ H;  4O42 A;  3GTQ H;  4BY1 H;  2DNE A;  2HUG A;  2L55 A;  5NUC A;  3GTM H;  3PO2 H;  5A2Q E;  1Y1V B;  1V1O A;  2JYO A;  3T1H L;  2JEB I;  4DV0 Q;  2JA9 A;  4DV6 L;  1X54 A;  3W3A A;  4FYD A;  4L5Q A;  3TRE A;  4A3B G;  3ULL A;  2R7D A;  1HFN A;  1Q7Y C;  4B3T L;  1ML0 D;  1TVX A;  1K73 C;  4IFD H;  3S1Q H;  2PMZ B;  1F9S A;  1CZG A;  5CBE E;  3HOU G;  1N9W A;  3I2Z A;  2F0G A;  3CQZ H;  3OW7 A;  4GLX A;  1JOR A;  4L5S A;  3K80 C;  1PXU A;  1A2U A;  4GNX B;  4CDE C;  3CMA A;  2JK8 A;  2EPB A;  4HIK A;  2WAQ E;  1EY8 A;  3M4P A;  2A68 C;  2A19 A;  2K52 A;  1U4M A;  2UUA L;  1H9K A;  3CRL C;  1SAP A;  1X55 A;  1UE6 A;  1F2M A;  2YTY A;  2LXK A;  1M90 C;  1MBY A;  5CBA E;  5CV8 A;  2NZO A;  4UP9 A;  3KK7 A;  1CQV A;  1EYD A;  4A3E G;  2F3W A;  1K9M C;  2F0L A;  2G9D A;  3CW2 C;  1ZYR D;  5IYB G;  3GTJ B;  1G51 A;  1KAB A;  1ROD A;  3CME A;  2HCI A;  4JK1 C;  2JA7 H;  3HOY G;  4UP8 A;  3H0G H;  1TS2 A;  4XQJ A;  2R61 A;  2R92 B;  3CPF A;  1HUM A;  5LMN Q;  2A73 B;  4QL5 A;  2SOB A;  3D8G A;  2UUB L;  4Y7N B;  1I6H B;  2B2W C;  3BYY B;  2WAQ B;  1SNM A;  2Y0S G;  5IT9 E;  4YWL A;  5IP9 G;  1QOH A;  3HKZ E;  2L0C A;  2PQA B;  1PA6 A;  3FPP A;  3Q22 A;  1LTT D;  1VQ4 A;  2KHI A; 
#chains in the Genus database with same CATH homology
 3LX0 A;  2K32 A;  4JBW A;  1IYV A;  3VR5 A;  2PW5 A;  2IX3 A;  4X3U A;  4G7H C;  5IT9 L;  1RD9 D;  5D65 A;  3HZX A;  2M9V A;  4F88 A;  3AMU A;  3H94 A;  4RGN A;  1H9M A;  3CRK C;  5EKL A;  3RZD B;  1EZ6 A;  5IGC A;  4S3S A;  1DOM A;  1EY4 A;  4RH6 A;  2C9O A;  4RHS A;  3GO5 A;  1C48 A;  2IT1 A;  1MD2 D;  4X3K A;  1S5C D;  3DHQ A;  5IGD A;  1SNQ A;  2R6G A;  1WTV A;  4ID6 A;  4K5W A;  1GUG A;  2AWO A;  3MC0 B;  2EXZ A;  1CTM A;  3L7Z C;  4XQN A;  4V19 0;  3EVQ A;  1EY0 A;  1D6E C;  2C5C A;  2B2T C;  3OSO A;  1CA5 A;  3MXU A;  3DWQ A;  1PFB A;  1JB3 A;  3OWE B;  1MI2 A;  3BVM A;  3I72 A;  2D5D A;  4FF4 A;  2PCF B;  1S4Z A;  2ZXP A;  1OXU A;  3L3O C;  3U9O A;  2EY1 A;  5JEA H;  1B50 A;  1KLU D;  4GZY C;  4IN3 A;  5C4X B;  1TWG B;  5KEE A;  3NBH A;  3MXN A;  5JVG 3;  1CHQ D;  2K5D A;  1JOK A;  4KHV A;  3IFT A;  2D62 A;  2L12 A;  3WDN A;  2XRS D;  1KNE A;  4J1M A;  5EPK A;  1LTA D;  4DU9 A;  4ILW A;  2FFK B;  1TY2 A;  2B2Y C;  1XYI A;  3NQT A;  1T5X D;  1LT6 D;  4QUC A;  5HUR A;  1JC7 A;  2E75 C;  2MP1 A;  1HXY D;  3OIP A;  2PNR C;  1D5M C;  3J80 L;  3KBG A;  1QB5 D;  2B2Y A;  3MWY W;  3GTQ B;  4J6H A;  1OXX K;  2DY7 A;  2R3Z A;  1DJR D;  1BDO A;  5LL6 S;  5M3M B;  1ENC A;  1EQT A;  3H09 A;  3VYS A;  1K8O A;  1BOS A;  1FYC A;  5DAU A;  1XWE A;  1PZK D;  4QMG A;  1B2T A;  2ENB A;  3VYT A;  3MXP A;  4ULL A;  4K5X A;  4H0L C;  4EVO A;  2HQE A;  4CJ1 B;  2BOS A;  4PMB A;  1S5F D;  2F0M A;  2VUM B;  5M5W B;  5M9O A;  3CKI B;  1O80 A;  4FXD A;  5JEA J;  2R93 B;  5IIF A;  5EBD A;  1TT2 A;  3BYT B;  2SNM A;  3C3L A;  3RMH A;  5I2Y A;  1DXM A;  1Q90 A;  2A74 C;  4FF1 A;  3HP3 A;  2MHV A;  3IL8 A;  3CU7 A;  2A5H A;  1EYC A;  2VB2 X;  2F4I A;  2O2L D;  5IGB A;  1F9R A;  2L1B A;  3KLR A;  3AB9 A;  1LT4 D;  2NN6 I;  1JE4 A;  3A8I E;  4IUR A;  1SYD A;  2LKV A;  2B8G A;  5FK9 C;  1CI3 M;  2JE6 I;  4DN4 M;  3CHB D;  1STY A;  2F3V A;  3I4M B;  5CV7 A;  2KED A;  1AEX A;  4FP5 D;  2OXP A;  4O1N A;  5JOB A;  5C4Z A;  4PQX A;  1L0X B;  5D14 A;  4KY5 A;  3H0G B;  1PTO C;  1AZP A;  2E2I B;  4LMQ D;  3U9S A;  1TWH B;  3NXW A;  3TME A;  2ID0 A;  5M5X B;  2CQA A;  5C3X A;  3MFY A;  1EU4 A;  3HOZ B;  1NSN S;  3BVZ A;  1WD0 A;  3D6W A;  3I8Z A;  2MJ8 A;  5J1Z A;  5J39 A;  2A69 D;  1PDQ A;  4RCN A;  1D5X C;  2I46 A;  1PZJ D;  5JVH 3;  3ERQ A;  2O4X A;  3SHL A;  3ND9 A;  2K5W A;  2BE5 D;  3S1Q B;  1STN A;  2DN8 A;  1Q12 A;  3M3Y B;  1H9S B;  1EFI D;  2SNS A;  3D4W A;  2AUJ D;  4KJN A;  1WTX A;  1EWC A;  2EE1 A;  4NP5 A;  1EQV A;  2NVT B;  3NWS A;  1H9S A;  4UDU C;  1LT3 D;  2RDH A;  2PQE A;  1QNK A;  1UAP A;  2NWG A;  1SBB B;  1LAC A;  3K0Y A;  4X3T A;  3KF8 A;  4RFB A;  1KNA A;  2L9H A;  1XXG A;  4K14 A;  2NN6 H;  1V1P A;  5I9O A;  5G3L F;  2NZ1 D;  5JEA G;  4CHT B;  2F0Q A;  3HRZ C;  3PUY A;  5CV9 A;  5FO7 B;  5CR3 A;  1R9T B;  3K59 A;  1DYQ A;  1B53 A;  2X69 A;  4TQU S;  4KN4 C;  3MEH A;  1XX8 A;  3I73 A;  1O78 A;  1BCP D;  2AQ2 B;  5I6Y A;  3P20 A;  1H9R A;  3QOJ A;  5KNB A;  1HHV A;  4OIK A;  1A3U A;  3ONA B;  1F9Q A;  2RA4 A;  3MFG A;  2JXM B;  5KRU A;  3A8J E;  3A55 A;  1RKN A;  3G7L A;  5EQ0 A;  3PUZ A;  4BBR B;  1YNN D;  4A3J B;  1HA5 A;  1UEA B;  2DY8 A;  3EQL C;  3SVM A;  2H1E A;  4LAA A;  1PTO F;  3OHX C;  1DON A;  1X3P A;  1R4Q B;  5KNC A;  1PRT B;  4EQP A;  1GOZ A;  2LY7 A;  3SXH A;  3DXJ C;  3ERO A;  3GTK B;  4ZKB B;  3TN2 A;  1B9N A;  3K5N A;  4HED A;  2WKD A;  3NPP A;  4BA2 I;  3TP7 A;  1Y8N B;  3T13 A;  1BUV T;  4ODG A;  1F2L A;  1SJE D;  3FVQ A;  5IGF A;  3S14 B;  4K6L A;  3O13 A;  2K04 A;  2EYM A;  1EY6 A;  3HG9 A;  2B63 B;  2RKS A;  4OL7 A;  1EU3 A;  4HCS A;  2EYO A;  2DNC A;  2EY6 A;  4L6T B;  5M5Y B;  5C0X G;  2B2U C;  4RGT A;  1EIH A;  1I4G A;  3E6Z X;  2NYZ D;  2PZU A;  1Z6H A;  2KJX A;  2HDL A;  1G8Z D;  3Q24 A;  3HOU B;  4ZAI A;  3S16 B;  2B2V A;  3TDQ A;  2D9U A;  2MPM A;  2LMC B;  1ZYR C;  2IX1 A;  2F0O A;  4NDX A;  1AFP A;  5E3F A;  1AZQ A;  1SSO A;  3I4L A;  1L0Y B;  3WOF A;  4CJ0 B;  2H4O A;  2ZT9 C;  2K5Q A;  1IHZ A;  4XQQ A;  2J0T D;  1VDZ A;  1LTI D;  2K05 A;  4HSV A;  1WD1 A;  4EQO A;  5C4H A;  3Q0A A;  1VMC A;  1VMP A;  2Z8L A;  3N52 A;  2B8F A;  2B2V C;  3HOW B;  2NB0 A;  4IUP A;  5AFW A;  3KLS X;  3D4D A;  4G7O C;  2VNU D;  3K5L A;  4RCO A;  3MXG A;  5DM6 3;  3P1H A;  3C1F A;  3QWN A;  2RQX A;  4HSP A;  3DM1 A;  3QG1 A;  3OMC A;  4DAV A;  3BVG A;  4Z9C B;  3K6O A;  2KCN A;  3VR2 A;  1LV9 A;  1STH A;  3IFD A;  3HS0 C;  1J8I A;  2SDF A;  2K33 A;  1M4V A;  4N9P A;  2E2H B;  1JOO A;  1Q8I A;  2OT2 A;  1SXT A;  3DEP A;  5KGU A;  4TRD A;  1F9P A;  1DCZ A;  4C3H G;  3Q6S A;  5JPM C;  1ZEQ X;  4HTH A;  1LT5 D;  5JPN C;  4A3K B;  3SK5 A;  1IYU A;  1I4R A;  1SNP A;  3FEW X;  3NWT A;  1LTB D;  4U68 A;  1V8Q A;  5C0X H;  2EY5 A;  1QNU A;  1STB A;  2F0P A;  3QB3 A;  5TSS A;  1YNN C;  3IKJ A;  4FXK C;  1DOL A;  3S15 B;  4ZUI A;  1RF2 D;  2F0H A;  5CV4 A;  4C1N I;  1A15 A;  1Q1B A;  3UI2 A;  3P7J A;  4B08 A;  4IUU A;  1TWC B;  3MZ5 A;  1KDC A;  5KYI A;  2A6E D;  2ZXR A;  5FO8 B;  3BDC A;  1Q1E A;  4G57 A;  2NUC A;  1G2S A;  1HTP A;  3GQB A;  1RTN A;  1ESR A;  1SJH D;  1E2V A;  1HQR D;  1PFN A;  2F0J A;  5KYL A;  2QKI C;  2K1B A;  1JIC A;  2KUM A;  4F87 A;  2ICI A;  1JOQ A;  1SND A;  1QCB D;  4RGM A;  2E74 C;  5CMD A;  4PV1 C;  1RJT A;  2PZW A;  2F0D A;  2KOL A;  4RGO S;  4XYQ A;  3T53 B;  4K8J A;  5EPJ A;  2KCC A;  4A3G B;  2EYH A;  1SE3 A;  3BZD B;  3N6R A;  5K36 H;  1ET6 A;  2F0U A;  3NHH A;  1DD2 A;  3C46 A;  3D4R A;  3BS1 A;  1WTO A;  2TSS A;  3SDZ A;  4QB4 A;  5K36 G;  4K2K A;  1Q3L A;  1TS4 A;  1GUO A;  1STG A;  5D3D A;  4AYB B;  4YIJ A;  4C56 C;  1ZKO A;  4PNY A;  2PYK A;  4KTA A;  4B9W A;  4KV6 A;  1WVL A;  1CA6 A;  1I50 B;  1U4P A;  3F2U A;  2CW0 D;  5EKI A;  2EYF A;  3CQZ B;  1YNJ C;  2WIN B;  1FR3 A;  2EYJ A;  2QDB A;  4K2L A;  2XRQ D;  5F2D A;  2F0W A;  3QO2 A;  3MAQ A;  3FDT A;  5I4D A;  1PZI D;  1SFO B;  3S1M B;  3FRP B;  5E1F A;  1U4R A;  4A3I B;  4G4K A;  5LL6 X;  3HOV B;  1HUN A;  4M1U B;  2F0E A;  5K5P A;  1GJX A;  2K01 A;  1EIG A;  1JWM D;  3DWP A;  1GHK A;  4R8N A;  1C4Q A;  1EOT A;  3URY A;  1TII D;  3M4Y A;  4G7Z C;  5FOB B;  1HFG A;  4K8I A;  1EZ8 A;  1O7Z A;  3D6C A;  3GTL B;  3PIP 3;  2K6A A;  1KAA A;  1H9J A;  1BF4 A;  2EY2 A;  3SK6 A;  4C3J G;  3EFX D;  4M8A A;  2OEO A;  4DNT B;  3S1N B;  3P75 A;  1IW7 C;  3T4A C;  3VR3 A;  4CKC A;  4ZKC B;  3PUX A;  4DAP A;  1JWS D;  3LWU A;  4H7B A;  4RWS C;  1BCP B;  1K83 B;  1E2W A;  3SR1 A;  2BA0 A;  2WP8 J;  5EBC A;  3TZU A;  1II3 A;  5C44 B;  4MIU A;  4A3F B;  1SYC A;  5IOD A;  4LK1 C;  1WTW A;  3H3V C;  4FF3 A;  1Z7T A;  5ELF A;  3J7A F;  3TSS A;  3X3M A;  1GUW A;  4HN7 A;  4HMJ A;  1LTG D;  5ELB A;  2J7Z A;  3QJY A;  5C0X I;  2Q8I B;  4I65 A;  1S5D D;  1Z47 A;  1KLG D;  3GP7 A;  4QCL A;  4IQZ A;  1RCV D;  1X32 A;  4FVM A;  2PO4 A;  5EKK A;  1DM0 B;  1D5Z C;  1F2Y A;  5COR A;  2NVY B;  4ZLT F;  1PRT C;  2XWB B;  3S17 B;  1M8A A;  2KEC A;  3TBI B;  4IAL A;  1ENA A;  2MGS A;  1EL0 A;  2XSC A;  1B1Z A;  4R8I A;  1CQF A;  1K8M A;  1EWH A;  4R9W A;  3PUV A;  5T1I A;  4OO1 I;  2LS0 1;  5EPL A;  4DAY A;  1NCV A;  1OXS C;  3T56 B;  2Z4H A;  4X3S A;  2JA8 B;  3MTS A;  2TMP A;  4BBS B;  3GTO B;  4OO1 G;  3EJI A;  2FMM A;  2KA7 A;  4A3E B;  2NVX B;  2Q8T A;  1W6J A;  1TQO A;  2E2D C;  5KIX A;  1U9R A;  3X3N A;  4ZK9 B;  2WV6 D;  1AW7 A;  2D2C C;  1PRT F;  1SMY D;  1ICW A;  1BXT A;  4A3D B;  5KND A;  1R4P B;  4NKL A;  4XXE A;  5IOC A;  3R2I A;  1BCP F;  1CZW A;  3I3C A;  1JCK B;  1TY0 A;  2NN6 G;  2NVQ B;  2HCC A;  4BWG B;  1S5E D;  1HQM C;  1KDA A;  5CGK A;  4A93 B;  2MUY A;  2QIL A;  2FHT A;  4OO1 H;  3LWE A;  2NTT A;  4QF4 A;  4KY7 A;  3GV3 A;  1NR2 A;  4OIJ A;  1PYW D;  4XYO A;  3S9W A;  3Q23 A;  4ME5 A;  4K5V A;  2XVS A;  4HAE A;  1EEI D;  3SEB A;  3RZO B;  3R2T A;  1FGB D;  1OXT A;  4OHJ A;  5JJZ A;  2XIW A;  1NAP A;  3A54 A;  1ZXT A;  2IWH A;  4DGZ A;  1W6K A;  4DK1 A;  2WKC A;  2YU9 B;  4ZQ3 A;  3GD7 A;  4HR7 B;  2RDG A;  2BDN A;  2F0F A;  1IL8 A;  4A3B B;  2RSN A;  2FMC A;  5ELC A;  2M2L A;  4WFN 3;  1NUC A;  1ILQ A;  4IUV A;  1IKM A;  1A2T A;  5ELD A;  2O5I C;  1WCM B;  5C5M A;  1SYF A;  1WTQ A;  1V1P B;  4RAU C;  1LAB A;  3DMU A;  1I4H A;  3R93 A;  1PFM A;  1I4Q A;  1Y8P B;  3NQI A;  3QIA A;  2XWJ B;  3W2D A;  2WB1 B;  4IFD I;  1WTR A;  1LTR D;  1Y8O B;  2RSO A;  4ZUJ A;  2YYZ A;  1YNJ D;  5CC4 A;  4ZRZ A;  3K5O A;  3KBX A;  5BN3 A;  1SNO A;  4MN3 A;  4Q0F A;  5FLX E;  2BA1 A;  3OOC A;  1BO0 A;  1B4O A;  5CV6 A;  3K58 A;  2RBM A;  3MVV A;  1QE6 A;  4F8M A;  4J8Q A;  4WRD A;  2IPK D;  4DNR B;  1SE4 A;  3NTI A;  3GV6 A;  1VF5 C;  3E5S A;  2EJG C;  4CKE A;  3S1R B;  1BBX C;  2F0K A;  5EJW A;  5DM7 3;  1AN8 A;  3V05 A;  1U4L A;  3SK8 A;  5C3W A;  3HGB A;  2SEB D;  5A35 A;  3BG3 A;  1PTO D;  5IGE A;  1ET9 A;  4H13 C;  3J7A V;  3H6M A;  1I4P A;  2BCO A;  2F0S A;  2EYP A;  2CVR A;  1TU2 B;  1Y1W B;  4DFA A;  4KKS A;  2E2J B;  2OF1 A;  1SEB D;  3FPU B;  4UAI A;  2J4X A;  2QEJ C;  3M4O B;  3V2T A;  3R3O A;  1A3T A;  1TWA B;  1JR0 D;  1GUN A;  5C6A A;  3GTP B;  1TR5 A;  4BA1 I;  1VCI A;  1SYG A;  4DXF A;  4QUF A;  4FXG C;  3I70 A;  2A6H C;  5HGT A;  5T1G A;  2KHS A;  5FO9 B;  2NTS A;  1QWY A;  4MHE A;  2B2U A;  2PZT A;  1B3A A;  4H44 C;  2B2T A;  4QIW B;  2G9H D;  3NTH A;  1HRJ A;  1EEF D;  1SDF A;  1EY9 A;  3VYU A;  1MGS A;  3OIQ A;  1E2Z A;  1GXD C;  2KVM A;  1O7L A;  3TZD A;  4V0B A;  1V43 A;  4XT1 B;  1FD7 D;  4CJ2 C;  3ND8 A;  4XTC S;  1G2T A;  1QG7 A;  3ZYY X;  2EOT A;  2A69 C;  1DZ1 A;  4LJZ C;  2JA6 B;  2IX0 A;  4K6D A;  3VA7 A;  1GHJ A;  3HEJ A;  4IUT A;  3DWA A;  2E76 C;  1B44 D;  1JQY D;  1QIL A;  2JA5 B;  1LTS D;  2ICE C;  2Z1C A;  1SYB A;  1D1K A;  1ESF A;  3WOE A;  2EVB A;  3ITP A;  3K5M A;  4DXG A;  4C1N K;  4EGV A;  2WAC A;  1CHP D;  3NSW A;  4KKT A;  4ZYS A;  3C2P A;  1EY7 A;  4IZ8 A;  2AQ3 B;  3A7L A;  4KMU C;  3HKZ B;  3IAY A;  1STE A;  4XDX A;  5A2Q L;  2M00 A;  1HCZ A;  4P2C B;  2X6L A;  2JP1 A;  2B2W A;  1B9M A;  4IUN A;  1PMR A;  4KJO A;  4C2M B;  3GTG B;  3DUZ A;  3J81 E;  4F7X A;  2F03 A;  3M7N A;  3TP5 A;  1CT1 D;  3MA2 B;  2K03 A;  2ZXO A;  1D1I A;  1CK1 A;  2KQ3 A;  3T51 B;  4EQN A;  3SE0 A;  3HOX B;  2VB3 X;  3RLF A;  3TP6 A;  1WTP A;  2XN9 C;  4XT3 B;  5DNF A;  3NK9 A;  3VYR A;  2F0I A;  2EZV A;  3D3R A;  1LO5 D;  1FNW A;  2B39 A;  5CV5 A;  4L8J A;  2K28 A;  4IUQ A;  4KKU A;  2N88 A;  4N9T A;  5CYU A;  3VR6 A;  3BDL A;  2HDM A;  3AU7 A;  3C1E A;  5M3F B;  1KDB A;  1S5B D;  4NW2 A;  5G3L D;  4L63 B;  1TS5 A;  3M7G A;  4FO2 A;  4A3M B;  1ILP A;  2CW0 C;  2N55 A;  3J7Y W;  1GUT A;  2JA7 B;  3OWF A;  5D3I B;  4HCE A;  2EYL A;  3KUP A;  2VXW A;  3BDO A;  5ISR A;  3NBI A;  1RTO A;  3QOL A;  1TKW B;  4PMW A;  1BNZ A;  1HPC A;  3DEO A;  5E4W C;  4C3I G;  1HA6 A;  2I07 B;  1TS3 A;  2EJM A;  2L4N A;  4BS9 A;  4KN7 C;  5I2X A;  5C3E B;  2FIN B;  1PTO B;  2X6G A;  4WJW A;  1CM9 A;  1J9O A;  1I4X A;  2PW7 A;  3PIO 3;  1G91 A;  4RKB A;  3PO2 B;  3EA6 A;  2F0V A;  4RKL A;  1EYA A;  4PMC A;  1QJO A;  1I6V C;  2A6E C;  3A8K E;  3JAM L;  3L9A X;  1GUS A;  1X3Q A;  3VR4 A;  2R7Z B;  1A3V A;  3VA5 A;  3K57 A;  1FNV A;  1EY5 A;  2L11 A;  4IFD G;  3H91 A;  3OPO A;  1ONL A;  4KI0 A;  4C3J B;  2RDF A;  4I7Z C;  3T16 A;  3FMC A;  5IGG A;  3M85 A;  3S2D B;  3RUZ A;  3NP8 A;  1AP0 A;  1OXV A;  1Y69 U;  2XNA C;  2AWN A;  4U67 3;  3R8B A;  3RD4 A;  3GTM B;  5BN5 A;  1BR9 A;  1HTL D;  1MSG A;  1JWU D;  1STA A;  3HOY B;  2AUK A;  2A68 D;  3PV0 A;  1NR4 A;  4FF2 A;  1PLF A;  3G6J B;  2L5T A;  2GA4 B;  1DOK A;  4FNF A;  3I4N B;  5DEH A;  1IW7 D;  3J81 L;  1FNU A;  5C0X J;  2FJ2 A;  2PPB C;  1PTO H;  1SYE A;  2Z4I A;  5C4J B;  2BE5 C;  4RHR A;  3NUC A;  2RVL A;  2IW3 A;  3PO3 B;  1SMY C;  4KD3 A;  4XIG S;  4TSS A;  1I3Q B;  1UUP A;  4NMZ A;  4WOR A;  4DK0 A;  1UNS A;  3I91 A;  3NE5 B;  5I9P A;  1BQQ T;  1C8C A;  1F77 A;  3J80 E;  4CGY B;  2AQ1 B;  2EDG A;  2EJF C;  1KTK A;  3PMF A;  1TWF B;  2QCP X;  4ABN A;  5COY A;  2WII B;  1T5E A;  2K7V A;  1SE2 A;  4BY1 B;  2IL8 A;  2F0N A;  3K7A B;  4KD4 A;  3FKI B;  4OGQ C;  4C3H B;  2F1M A;  2QF7 A;  2O5J C;  2A6H D;  5C5L A;  2JEA I;  1VF7 A;  1G29 1;  2Q8R E;  4DA2 A;  1RDP D;  3A56 A;  4HMI A;  4KK7 A;  1BCP C;  4DF7 A;  5FKA C;  2LFN A;  1IKL A;  3V96 A;  3I90 A;  3PUW A;  5E4X A;  1PRT D;  1D2B A;  3LNN A;  1ENF A;  4TKO B;  1CFM A;  3S2H B;  3MHB A;  4RA8 A;  4C3I B;  1O7Y A;  5ELE A;  3D31 A;  5I6W A;  1RHP A;  4KHZ A;  1XTC D;  2CHB D;  1E0B A;  1MSH A;  1OO9 B;  4E6I A;  5JAV A;  1LLR D;  3E0J A;  2F0T A;  5J22 A;  2KEE A;  5LHY 1;  4IFD J;  4CBV A;  4BY7 B;  1SNC A;  5EGT A;  5FLX L;  5BN4 A;  2NBF A;  3JAM E;  3SK4 A;  4CKB A;  1F2Z A;  3TP8 A;  2BDO A;  4KY6 A;  3A7A B;  3NTK A;  4Q5V A;  2JSO A;  1G6Z A;  4B9X A;  2Y0S B;  1A6X A;  3KLS A;  2V4D A;  2IJ0 A;  3OMG A;  4O42 A;  2DNE A;  2HUG A;  2L55 A;  5NUC A;  5A2Q E;  1Y1V B;  1V1O A;  2JYO A;  2JEB I;  3W3A A;  4FYD A;  1HFN A;  1ML0 D;  1TVX A;  4IFD H;  2PMZ B;  1F9S A;  1CZG A;  5CBE E;  2F0G A;  3OW7 A;  1JOR A;  1PXU A;  1A2U A;  2EPB A;  1EY8 A;  2A68 C;  1U4M A;  1H9K A;  3CRL C;  1SAP A;  1F2M A;  1MBY A;  5CBA E;  5CV8 A;  3KK7 A;  1CQV A;  1EYD A;  2F3W A;  2F0L A;  2G9D A;  1ZYR D;  3GTJ B;  1KAB A;  1ROD A;  2HCI A;  4JK1 C;  1TS2 A;  4XQJ A;  2R61 A;  2R92 B;  1HUM A;  2A73 B;  2SOB A;  3D8G A;  1I6H B;  4Y7N B;  2B2W C;  3BYY B;  2WAQ B;  1SNM A;  5IT9 E;  1QOH A;  2L0C A;  3FPP A;  3Q22 A;  1LTT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...