2OT2A

Solution structure of hypc
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVINEAEARDTLDALQNMFDVEPDVGALLYGEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Hydrogenase isoenzymes formation protein hypC
publication title Solution structure of Escherichia coli HypC
pubmed doi rcsb
source organism Escherichia coli k12
total genus 24
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01455 HupF_HypC HupF/HypC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ot2A01
3VYRA 3VYTA 3VYSA 2OT2A 2Z1CA 3VYUA 3D3RA
chains in the Genus database with same CATH superfamily
4DV6Q 1V1PA 2R92G 1JOKA 4OWXB 2F0PA 2VS1A 2NZHA 4OX9L 3HKZE 4J15A 5DEHA 1ENCA 3NTHA 1P16A 2OXPA 3M85A 3H91A 1IBMQ 4OO1G 4MIUA 1TWHB 4POFA 3K58A 1DCZA 2PI2E 5AJ3L 2UU9L 3J81L 3BYYB 4DR3L 2PNHA 2NVQB 3M4PA 1SYFA 2FMMA 1UE7A 1XTDA 1QE6A 1N33L 2CQAA 4QY7A 1JMCA 4QUCA 5FO7B 2F0QA 2RDHA 2EY1A 1AW7A 3P7JA 4HTHA 4RKLA 3F2DA 1EY9A 4R4OA 2B2TA 1I4PA 2JEBI 4F87A 2E5LL 1HR0L 1PRTB 3AEVA 5A35A 4DV1L 1DD2A 2EIFA 4DKAC 3S16B 4ZYSA 1Y1VG 2B8FA 1XNQQ 1I4QA 3PUYA 3FKIH 2RCFA 3VR3A 2JA9A 4JBJA 2CHBD 1L1OC 3BZDB 4H13C 3HOWB 4QMGA 3OPOA 2E2JB 2Z1CA 2EJFC 2K03A 5CR3A 1Y1WG 5NUCA 1Q3LA 1PFNA 3OOCA 2UUAL 2EZVA 4Y7NB 3NELA 4DUYQ 4OONA 1GHJA 3T51B 1A63A 3MZ5A 3PUVA 4C3IH 1XMQQ 3CQZB 2IHEA 1TXYA 4JOIA 1TY0A 4B3MQ 3I90A 4IFDG 1PRTC 1ICFB 5K5PA 1EY6A 3J81i 2R92B 4JI0L 5EPLA 1H9JA 5D3IB 4DV5L 1MKHA 2V4DA 1VQHA 2MQHA 4DV6L 2F0KA 1LTAD 1SEBD 4TSSA 4ZUIA 2F4VQ 2RSOA 1N8RC 4LF7Q 2FMCA 3RD4A 3BZKA 1PRTD 3FP9A 4BBSG 4IUVA 1XPUA 4NPSA 3A0JA 1YNJC 1W2BA 1SROA 1W6JA 1IBML 1YEZA 2H5XA 2F0GA 3CC2A 2KECA 4ZAIA 5JJLA 1JJ2A 5JOBA 4LF6Q 1DOKA 4CKCA 1ENAA 1YNJD 1H9SB 1K83H 3VA5A 1ET9A 2R61A 1Q1EA 4DAYB 1DYQA 1PZKD 3W1GA 2K33A 4LWCA 1O7LA 2BDOA 4LMQD 2IX3A 5LMNW 3ND9A 1V9PA 4GN5A 1Y1VB 2I07B 1N36Q 5J1ZA 2WB1G 4OEMB 3QJYA 1EWIA 1PRTF 1K3BC 3SHLA 1Y1WB 2K5VA 3HOXG 1XJVA 1VMPA 2NBFA 1HFGA 2KQ3A 3BVGA 4FXKC 1AH9A 3RZDH 5G3LD 2Q2HA 3OTOL 2F0SA 2X6GA 1Y8PB 2UXDL 4DUYL 3G48A 4DPGA 1QZHA 2EJMA 1FD7D 1J9OA 2L15A 4B3ML 4RH6A 3V05A 1K9MC 3OMGA 3S17H 3OYYA 4YCWA 1MIUA 3K7AB 1QVGA 2K5HA 5M5YH 1KNEA 3CW2C 4C3JH 1KNAA 1TIID 4PNYA 1BQQT 2K05A 3GV3A 2VQFQ 4G57A 2A6HC 4BBSB 1TWFH 3SK5A 4HJ8A 2L4NA 4YWLA 1GXDC 1HZ9A 1R4PB 4N9PA 4LF7L 1B8AA 2A73B 3LWEA 4HJAA 5A2QL 1VS0A 2EQSA 1BO0A 1KABA 2ID0A 2X6LA 3O13A 4KHPQ 2QEJC 1BCPC 1IZ6A 1L1OA 3NBHB 2A6HD 5IP7H 2SDFA 2K1BA 4DK6C 4E6IA 3D8GA 4K8JA 1U4LA 2NTSA 5FOBB 4A3KG 3AU7A 3W1BA 1N34Q 3SK8A 2E8GA 2MUYA 1EZ8A 2CWAA 4K5VA 5FLMH 1HZBA 5JVG3 1AEXA 1ASZA 1BCPD 3GTMH 3JAME 4ZQ3A 1A3UA 3VYRA 3TN2A 4DV2Q 2LY7A 2J0TD 1Y69U 3SDZA 4J1MA 2K7VA 2WB1B 4BY1G 1PYWD 3T1HQ 2YU9H 3BU2A 1ZXTA 1LACA 4FXGC 2NZOA 1PTOF 1T5EA 3E9IA 2CQOA 1EYDA 4IUQA 4YY3Q 2SNMA 1N36L 2NVTH 1II3A 3HOXB 4DR5Q 3QOJA 1HZAA 1M8AA 4X3UA 1VQOA 3VR2A 3CPWA 2PCFB 4IUNA 4JG2A 1G6ZA 4A3GH 1I4XA 1I3QB 2XRSD 3K6OA 2HIXA 5C6AA 3RNUA 5AFWA 2N49A 4KY6A 3U50C 1EL0A 3DWAA 2VW9A 2K5WA 4L5QA 1EFWA 3NXWA 4EGVA 2UUBQ 2I5MX 2HIVA 4KMUC 2M9VA 1DGSA 3PQIA 1FVIA 1QVFA 3TP7A 3CC4A 3DLLA 2F03A 5IT9E 1TY2A 4DK0A 1FNWA 2R7ZH 1CFMA 1J5EQ 1JORA 2XNAC 2I5LX 4RGOS 2VQFL 5HURA 2RCNA 1I5FA 1K8GA 1B53A 3BDCA 1L2FA 1STYA 3K5OA 3D3RA 3G71A 4KHPL 3CRKC 1B9NA 1Y14B 3PO2G 3PO3H 4NXMQ 4A3KB 4HR7B 2Z6BA 1SNOA 1CZGA 4IPDA 5C0XH 3BZCA 1N34L 1LT3D 3FDTA 4LF9L 2QF7A 2D62A 3MFGA 4OIJA 1Q86C 1SNDA 3HFZB 3RN2A 4DV2L 4BY1B 2ICIA 1JC7A 4BS9A 2KVMA 1EWHA 2PMZB 3KLRA 2K52A 1SE8A 3FKIG 1FYCA 1BR9A 3T1HL 2Z4HA 2E75C 1UE1A 4IQZA 2DY7A 2F0EA 4A3MH 4KKSA 4YY3L 4UDUC 4QL5A 4DR5L 2M2LA 2VB3X 5JPMC 3M4YA 5C3EH 1ML0D 2OTLA 5HGQA 3Q23A 1AZPA 1FNVA 2OT2A 4A3DG 1FR3A 5J3BA 5J22A 1B1ZA 1G51A 3KLSA 1SYGA 4IZ8A 3I4NH 1FNUA 3NBIA 2B2WA 3PIO3 2KEDA 2K5NA 4CDDC 4B3TQ 3SR1A 2D0PA 4RGMA 1BDOA 2JQOA 3EQLC 4LNQA 1MJCA 4I7ZC 1GUNA 2UUBL 2JSOA 2O2LD 4IUPA 4IUUA 3A55A 2KCMA 3V96A 4GKKQ 3GTOH 2RDFA 1X32A 5M3MH 5ISRA 5JJKA 3J7A5 1TS3A 4KJOA 2QDBA 4K5WA 5CV8A 1NBWA 1J5EL 2EYMA 4CDCC 5H1SE 1W6KA 3TP8A 2I5HA 2PW7A 1M1KC 1F9RA 3MEFA 2EOTA 3PO2B 2IY5B 4KJNA 1S40A 3CP0A 3I4LA 2BE5C 4ZKBB 2HHHQ 4Y52H 2E2IH 1GD7A 1S5BD 5E7NA 4NXML 5I6WA 3ERQA 2VUMH 3CXCA 1IL2A 2Q8TA 1CKMA 2ZXPA 1Q8KA 4RG1A 1R4QB 2WV6D 4RCOA 2BE5D 4X3KA 2MO1A 5FJ8H 3S1NH 2OQKA 2VZAA 5GAEC 1RCVD 1C0AA 4A3EH 3J7YW 3S2HH 1I50B 4PQXA 3A54A 5EJWA 4X62Q 3F2BA 5LL6S 1GOZA 1HTLD 5FKAC 3NE5B 2Q2TA 1K73C 4LFBQ 4X3SA 4C2MB 3KOJA 3H3VI 1KDCA 2ZJPA 2BCOA 1V1QA 2JK8A 4LF8Q 1JJCB 3JAML 4A76A 1BBXC 3FMCA 5KYIA 2XGTA 4G7OC 4YCVA 3RUZA 4A3DB 4B3RQ 3KF8B 4OXPA 1SSOA 2UUCQ 5JEAH 2R93H 1WTHA 1LYLA 1Q46A 4XQJA 4PZ7A 3PIP3 2H4OA 1QOHA 3GTQH 3S24A 3EBEA 1IHZA 4B3TL 5K36H 1JQYD 4IUTA 4RGNA 2UXCQ 1QUQA 1LTTD 1RIPA 2WACA 1K8AC 1K3RA 4P72A 4GKKL 4JI4Q 4X66Q 5COYA 1BUVT 1WVLA 1CUKA 2N55A 2K14A 3SEBA 3U9SA 1HR0W 2EY2A 4JBWA 5KIXA 1WTQA 2KENA 1G291 1EY4A 5JPNC 1EYGA 1GKHA 3PIOA 1WOCA 1D5XC 2QGQA 1RL2A 2HHHL 3S2DH 3K0YA 4RHRA 1F77A 1CKNB 3H6MA 4P2CB 4K0KQ 3E6ZX 4NB3A 3JAMi 2EYFA 5C0XI 4LFCQ 4UY8C 4LUZA 1SFOB 3K8AA 3K80C 4YWKA 4BWGB 4CBVA 1H9MA 4JI2Q 3K7UC 3NWTA 2H1EA 4X62L 1BBUA 1A8VA 1LTBD 3KJOA 4DV0Q 2Z6KA 2B2YC 3AYHB 4AIMA 1WTXA 2C5CA 4N8X1 4LFBL 5L37A 2QCPX 4A3IH 3KF6B 3R3OA 5GAGC 4KN4C 1BVSA 2JA5G 4A3GG 4LF8L 4QB4A 4XQNA 2F52A 5C5LA 5EPKA 1YVCA 2R7DA 3K5LA 4A3JG 3CCUA 3I4MG 5C3XA 4DR1Q 1TT2A 3SK4A 1LV9A 2UUCL 5IYDH 1HCZA 1I4HA 2VB2X 2KHJA 4DR2Q 4AQYQ 1S5DD 2ICEC 2B63H 2I46A 3M4OB 2K75A 1PH7A 2GA4B 2JA6G 4GLXA 3J80E 5IYBH 4HJ5A 2ZTDA 5M9OA 5M5XH 1EY5A 2AUKA 2MO0A 2UXCL 1HFNA 4KKUA 3OWFA 5M3FG 4JBMA 1PZJD 4PG3A 5IIFA 4ZK9B 4OO1I 2UXBQ 1L0WA 1RD9D 2KCTA 2AUJD 4DA2A 3S1MB 2ZTCA 3I70A 1TS4A 3PIPA 3RZOB 3A56A 1EIFA 2LXJA 1WTVA 1LT6D 3HG9A 4V190 1L0YB 1PFMA 1XWEA 2G9HD 3FPUB 2WP8J 1CSQA 2MHVA 3RMHA 3A5ZB 1I4GA 5IWAQ 3AQQA 1BOSA 3CCEA 4JI5Q 1B44D 4U68A 1I94Q 3C46A 4LF4Q 1XXGA 2GVAA 3UE1A 1HZCA 2X69A 4LFCL 5IE8A 1EIGA 5C4HA 3NENA 1S72A 5GQOA 1X3FA 3KFUA 1STAA 3NHHA 1MSGA 4JI2L 4BY7H 4FNFA 2L11A 3F1ZA 4A3GB 2JA5B 4X6AH 4DV0L 2QEXA 3E0EA 1IYJB 3BJUA 2DNCA 4C3HB 4A3JB 3I4MB 1X65A 1F9PA 3M4QA 4IPHA 1E2WA 2LXKA 5IP9H 1VQDA 4DR1L 1F2MA 1ZEQX 2RVLA 3N52A 1XMOQ 2KBNA 1HRJA 4POGA 3S1QB 3KDFA 1SE4A 2JA6B 2FINB 3I72A 4GLVB 2PI2A 1YHBA 3DHQA 4AQYL 3CU7A 1GO3E 1KLUD 3ND8A 5M3FB 4UAIA 2MGSA 2VL6A 3DEPA 4N8FA 2L0CA 3HOVB 2BH2A 4DU9A 1WD1A 2JA7H 3RLFA 3QOLA 2OWOA 4BA1I 1ESFA 2UXBL 3CRLC 3T13A 4A3BG 1EY8A 3PMFA 4DR7L 3RLNA 1M90C 4IALA 4UP9A 3UE0A 1GUGA 2NN6H 2DGYA 1KQSA 1Q1BA 1IKMA 2QA4A 5IYCH 5FJ8G 1WI5A 1A2UA 3B6YA 3TMEA 2B3GA 3S1RH 1JWSD 4JYAQ 3GP7A 4L5TA 3TDQA 4A3EG 5IWAL 5E4WC 3BDLA 3M9BA 3KUPA 4X3TA 1I94L 5JJZA 4LF4L 3STBD 5KRUA 1PH3A 4HCEA 3VR5A 1K28A 2WAQE 4XIGS 1ENFA 1TWCH 4GNXA 4RGTA 3HOUG 3KBGA 3A8IE 1NCVA 5ELBA 2G5DA 5CC4A 2AWNA 1F2LA 4BXXH 1SR3A 3GTJH 5EKLA 3CMEA 3ITPA 1TR5A 1PFSA 2NVYH 3GTGH 4ZUJA 4GOPA 5C44G 1OO9B 1VQLA 2BDNA 3OW7A 1DXMA 4NXNQ 1ASYA 1YIJA 1A15A 2I0QA 4QF4A 5KEEA 4B3SQ 1C4QA 3DM3A 2LS01 3HOYH 3E0JA 3QWNA 2IPKD 1QB5D 2GVBA 1Q12A 2AMCB 4LF5Q 4K6DA 2N88A 1PTOB 1H9KA 1CZWA 3CKIB 4A3LH 2EY6A 3BS1A 1CK1A 5DNFA 1EIHA 4A3BB 1DM0B 4FF2A 1XNQL 4GZYC 2E74C 1TWGB 4APVA 1C48A 2VNUD 2ZTEA 1EY7A 3PUZA 3TZUA 2CFMA 1V1OA 2OEOA 4KY7A 5KNCA 1GJXA 4HMJA 1PH2A 2F0MA 4NDXA 5E3FA 3OMCA 4XYOA 4DAPA 2KHIA 4ME5A 4KHZA 4A3EB 1UAPA 4KD4A 4CHTB 1LT4D 4AYBE 4ULLA 4HCSA 1XMQL 2IW3A 3H0GG 2HCCA 1PTOC 4JYAL 2Z9HA 1WCMH 4JI3Q 3TQYA 4WJWA 3HOZH 4B9WA 2B8GA 1NSNS 3OWEB 4H7BA 2ZJRA 2QW7A 3S14B 2JA8H 3K57A 1SXTA 3HOUB 4CKEA 4H44C 4A3IG 3MHBA 4OGQC 4BBRH 4L63B 1PTOD 3LWUA 2AWOA 1AE2A 2Z0SA 2PQAB 1O7ZA 1RF2D 1FGUA 5GADC 2F4VL 3GTPB 4IFDJ 1EOTA 1SYDA 3MVVA 3GTQB 3J7ZC 5C44B 1SDFA 5IYDG 3NQTA 2GN5A 1SN8A 2J4XA 2NB0A 4N9TA 1LUZA 2B63G 1HA6A 3P75A 4Q0FA 5F2DA 2WKCA 1YZ6A 1XPRA 4B3SL 4LF6L 3CCQA 4JC0A 1SYCA 1YJNA 2Z8LA 1IYVA 1OXTA 3R8BA 3DEOA 1WJJA 3NQIA 1D5MC 4K2LA 3I55A 3H3VH 1K0SA 1DOLA 2Z4IA 4MNOA 3T4AC 2E2HH 1VF7A 3WDNA 3S2DB 3MXNB 5C4XG 2DNEA 4B9XA 1R9TB 1AZQA 5LMNQ 1RODA 3X3NA 3VA7A 1EY0A 3CCMA 2PW5A 2F0VA 4GLAC 4MZ9A 1EYCA 3H0GB 2NN6I 3NTIA 5M5WB 2QDLA 4HIDA 3OIQA 4U673 4UP8A 1JB3A 3BVMA 1STHA 3OIPA 5C4JH 4EX5A 2JEAI 4JI3L 4DR4Q 3ULJA 4BY7G 4CJ1B 2A74C 1IKLA 3MA2B 2EXZA 1Y8NB 4IN3A 1CHQD 3IAYA 5BN4A 4A3FH 4LFAQ 1NR2A 1TWHH 2XWJB 1JOOA 4OELB 3R2IA 2A1AA 1NY4A 3MC0B 4HJ9A 5FO9B 2NVQH 2O4XA 1N9WA 5IP9G 1YHQA 1HNWQ 2F0JA 3GTLB 4EQPA 2B63B 2B2UC 3MXGA 3RLOA 2B2VC 1RTOA 1VQCA 1E2ZA 1PH9A 5M5XB 3S15B 4LUOA 1NJIC 4DR6Q 3GQBA 2VXWA 4K6LA 3MWYW 2WIIB 3ZYYX 3V2TA 2SOBA 2IX1A 4DAYA 1WTWA 1M4VA 3L9AX 4ZCKA 3WOFA 3S16H 4JV5Q 2CKZB 2F0TA 1X55A 4YHHQ 4LAAA 2RKSA 3G7LA 5I9PA 1OXVA 1HA5A 4PMBA 2PO4A 3HOWH 5C4XB 3D0FA 3EVQA 2E2JH 1KIXA 4PMCA 2L1BA 2Y0SE 3WOEA 3DMUA 1UUPA 1X56A 1CQVA 4XT1B 3KLWA 1HPCA 1O80A 1Z47A 4Y7NH 1KD1C 4TQUS 1UWVA 2K6AA 2JN4A 2OQ0A 3PUXA 4JI8Q 4C56C 1TQOA 4NMZA 5LMNL 3AB9A 5IYCG 4C3IG 3K59A 1SBBB 1LTSD 3CQZH 1JICA 4J6HA 2DY8A 4RWSC 3KBXA 1KRTA 3MEHA 3JAMc 4DNIA 4K8IA 5IGGA 5CV4A 1I6VC 3BDOA 2NTTA 3K81C 4XT3B 4OHJA 1SE2A 1SE3A 3NSWA 2BOSA 4L8JA 2R92H 1KHIA 3TREA 4WFN3 4G4KA 4G7HC 1A0IA 3EFXD 4DR4L 1RKNA 2AKWB 2EYOA 1MJEA 4OO1H 5FLXE 1O7IA 4PV1C 3E9HA 3ERSX 3HEJA 4JI7Q 2RHQB 3UDGA 1EEID 1ZKOA 4LFAL 1CA6A 1ET6A 1VQGA 4LJZC 1D5ZC 1IW7C 1PZID 4A4IA 1Q90A 2EVBA 3A7AB 4R4CA 1HNWL 4P71A 3NBHA 1PH8A 3PV0A 3KYHC 5BR8Q 4ZKCB 2KA7A 1IW7D 1PYSB 2F0IA 1JR0D 1X3QA 5IT9c 4DR6L 1HHVA 4FVMA 1WD0A 5IGCA 3M7NA 4A3LG 1ZYRC 3FKIB 3PUWA 1OXUA 1T5XD 3AFQA 2V1CC 1LT5D 2F0OA 2PZUA 3CMAA 3PF5A 4JV5L 3EA6A 1VCIA 4O42A 4YHHL 3DXJC 1Y1WH 4ALPA 1TWAH 4GS3A 4DFAA 4IOCA 4CJ2C 4F7XA 1PH4A 1ZYRD 4P75A 1S5CD 1YJWA 4C3IB 1VMCA 5JVH3 3S1RB 1B4OA 2WAQG 4JI8L 1GUTA 3NWSA 5DM73 1YHAA 4IFDH 4HEDA 3QR8A 4O2DA 4EQ5A 1V1PB 1TVXA 3D6CA 4JVZA 1SLJA 1EU4A 1C9OA 1QCBD 4WRDA 4H02A 4DNTB 1I6HH 5EKIA 4OIKA 4C3JG 4M8AA 3E3XA 4CDFC 4BBSH 3TEHB 1GUWA 2DN8A 1PFBA 2TMPA 4IURA 2WINB 2A8VA 1ONLA 4FO2A 2SNSA 4DNRB 1X9NA 3I73A 1IYUA 2YTXA 3FEWX 3AFPA 4K5XA 4JI7L 3C1EA 3I2ZA 5IP7G 3IKJA 1DZ1A 1H95A 1E22A 3GDEA 5IT9L 1AFPA 1K83B 4O1NA 2XIWA 3JC66 5IGBA 3D4RA 4LUVA 4ABNA 2F4IA 5FLMG 2OTJA 1IL8A 1D6EC 4XDXA 1VQ6A 3Q0AA 5EPJA 5BR8L 1Q82C 3VR6A 4I65A 2FFKB 4X65Q 2KHSA 3G6EA 3DM1A 5FLXc 1NMGA 1X3PA 4KV6A 4HAEA 2IL8A 4KY5A 4Q5VA 1F9SA 2DUDA 2B39A 4RAUC 5E4XA 5ELCA 5HY6A 1U4MA 1CSPA 4KN7C 5DM63 2OCEA 1KL9A 1IBKQ 1CM9A 3HOXH 4AYBG 3OHXC 1GHKA 1D7QA 2K04A 2YV5A 5CORA 1VQMA 1ILPA 3RZDB 4ME3A 3QIAA 3MXPA 2B2TC 4R4QA 2WAQB 4CKBA 3W5OA 1D1KA 3MXUA 1EEFD 2NYZD 3LNNA 5IGDA 3I56A 2RSNA 5JJIA 5CV6A 3PF4A 3TBIB 4B3RL 2VY3A 4RFBA 3H09A 1VQAA 3S17B 3GV6A 4Z9CB 5GAHC 1A3TA 4UP7A 3ULLA 3H15A 5M5YB 2JYOA 1A3VA 1B9MA 1JB7A 2R7FA 4C3JB 3TZDA 1A6XA 2R7ZG 1TWFB 5FK9C 1TKWB 1PVOA 2UU9Q 4DR3Q 1QNUA 4A3FG 4XYQA 2EDGA 4JOIC 1NMFA 4G7ZC 1JCKB 3DWPA 3L0OA 1K8MA 3CD6A 1Q8IA 4JI4L 1VF5C 2CW0C 4X66L 4QCLA 2A69D 3VYSA 2MP1A 1KDBA 1NE3A 5C5MA 1EIYB 3CCJA 1FGBD 4JK1C 3PO3G 4A3KH 4RMFA 3NEMA 3SE0A 1JE5A 2AHOB 4EVOA 2XVSA 2CW0D 3GTMB 2EY5A 4FYDA 5FLXL 5C0XG 3L7ZC 2L9HA 3K5NA 3DWQA 3M7GA 4NKLA 3TSSA 1Y8OB 4UPAA 3PCOB 1SNMA 4A3CH 4K0KL 4DV7Q 1B70B 1GVPA 2YU9B 5IGFA 4AH6A 1BF4A 5CYUA 1U0LA 3N6RA 3D6WA 4X65L 2NVTB 3GD7A 2E2HB 4AYBB 1GUSA 1DOMA 4V0BA 5JAVA 4X64Q 1JJGA 3SVMA 4A3MG 3CC7A 1PDQA 1IBKL 5T1GA 1ICWA 1JOQA 1D1IA 4EQOA 1VQ8A 3RN5A 4LW1A 2F0HA 4IPGA 5C3EG 3BYTB 5DLQE 1X3GA 4HIKA 2EYJA 3KF8A 3IL8A 3NP8A 1H9RA 4HIMA 3I4NG 3J7AF 1PLFA 2ZJQA 3HZXA 2HDMA 4R9WA 4IFDI 4UHVA 2HQEA 1STGA 4DR2L 1JT8A 2CCZA 2R7ZB 2C35B 4GN4B 5EQ0A 3CCRA 5M3MG 2IWHA 4A3FB 1B2TA 4XTCS 3T56B 1L1OB 4FXDA 3CPFA 1G2SA 4DUZQ 2M00A 2ATWA 2XTIA 3F2CA 3PO2H 3PO3B 4DAVA 2LMCB 1WTOA 1E3PA 1VQKA 3I3CA 2B2YA 1GM5A 2JJQA 2VUMG 1PHJA 3KK7A 3STBC 4DGZA 2LSSA 4JCVE 1I4RA 3J80c 2EYPA 1YITA 2Y0SG 5CMDA 1CKNA 2A5HA 4MN3A 3ZJYC 1I50H 4JI5L 2A19A 3SK6A 4RKBA 4DV7L 3A7LA 5D3DA 1S3OA 1HJPA 3KJPA 4KI0A 4A3MB 5I4DA 1MGSA 1XNRQ 4C2MH 5C0XJ 3OTOQ 2VQEQ 1B7YB 3ICEA 4JW0A 4B08A 4X64L 2UXDQ 1XYIA 1E1TA 5E1FA 2CWPA 3OSOA 3DUZA 5C3EB 5CBEE 1HTPA 4GKJQ 4A3DH 2XSCA 3KF6A 3L3OC 1TS2A 5ELOA 5JEAG 2IX0A 2R93G 4RCNA 4FF1A 3I4NB 3MFYA 3TP5A 1UE6A 3MTSA 3J81j 1K0RA 2WKDA 1G91A 3IFTA 4MHEA 3EN2A 3TP6A 1HH2P 4OWWB 5K36G 1PH5A 3GTOB 4IJHA 4IJLA 1XMOL 4A93H 5M3MB 3M3YH 1A2TA 4DV4Q 5D65A 4ID6A 2HDLA 5IY0A 2D9UA 5EAYA 2ZXOA 1YNXA 4L6TB 2DJGC 1E2VA 3TRZA 2HCIA 4PMWA 1Z7TA 1VQFA 4M1UB 1STNA 4J8QA 1UNSA 3W3AA 2LKVA 2PZTA 4DUZL 3QO2A 5TSSA 3Q8DA 1SAPA 2E2IB 2KUMA 4KLKA 3J80L 2VUMB 3HP3A 2F0NA 2QKIC 3A8KE 2N3SA 1YJ9A 1HXYD 2K5DA 2MNAA 3EJIA 2Y0SB 3S1NB 2XWBB 4C1NI 4O0AA 3CCVA 3ER0A 3S2HB 3A8JE 1ESRA 1LTRD 4DN4M 4QGUA 3VDYA 3C1FA 3RR5A 1D8LA 1B3AA 3C2PA 1YI2A 1SFOH 4QJFA 1O7YA 3I91A 1U9RA 2N78A 2D0OA 4QIWE 2JE6I 1TWAB 2RBMA 3URYA 5EKKA 1HQRD 3UDXA 1MI2A 3KLSX 1QJOA 5KNDA 1SJHD 1STBA 1XNRL 2F3VA 2VQEL 3Q6SA 4C1NK 5C3WA 1OXSC 2EPBA 1SJED 1BCPB 2Q8RE 3UDIA 1PH6A 2R93B 2C9OA 4I7AA 5I2YA 3UDFA 4GKJL 5LMUQ 1U4PA 1BNZA 3P1HA 1E0BA 5IOCA 3D4DA 2EJGC 1QZGA 1EFID 1KDAA 2RA4A 1I6HB 1X54A 1FL0A 3CF5A 1YNNC 1S5ED 1WYDA 1EU3A 4TKOB 3P20A 3M4OH 1VQ9A 4NXNL 1VQPA 2L12A 1VQEA 2EE1A 2N8NA 5IYBG 3K0XA 1QILA 2ES2A 2WFWA 1A62A 3J80i 5J39A 1UE5A 4DV4L 3T1YQ 5JEAJ 1HQMC 1X6OA 3FPPA 4HSVA 2A6EC 1LTID 5ELEA 1YNND 2YTVA 1WTPA 2IHFA 2XRQD 4K14A 2B2WC 4R8IA 4LF5L 3I7FA 2PNRC 1EYAA 2NZ1D 3CHBD 4MTKA 5G3LF 2NVXH 1EUJA 2EYHA 4TVAB 3S1MH 1SMXA 1LO5D 2K5QA 3RZOH 2L5TA 2AQ1B 4LF9Q 1P8LA 3A74A 5LHY1 1S5FD 2A6ED 4EQNA 1XX8A 1B50A 2CVRA 1HUMA 5CBAE 2RQXA 5CV5A 1VQJA 2K50A 4A3CG 1C7YA 1Q7YC 3TS2A 1FJGQ 2KEEA 2O5IC 4H0LC 4A75A 1LTLA 1UEAB 3U58A 3SXHA 4OL7A 2FXQA 4IPCA 3SGIA 1OXXK 4KD3A 3GTKH 5BN3A 4A3IB 2E76C 2B29A 1HNXQ 3R2TA 2JA5H 4L5RC 1NAPA 4WORA 2XN9C 4C3HH 4A3JH 3I4MH 1TU2B 1MSHA 3LX0A 1MBYA 3MAQA 1CI3M 1B3QA 1BCPF 2BA0A 4PZ6A 5LMUL 1QUQB 3S1QH 2JA6H 1SRUA 2K4KA 2R3ZA 2OF1A 4WJ3M 2D5DA 1U5KA 4JI1Q 1HUNA 1ILQA 1LM0A 5M3FH 1H9SA 3A5UA 2Q2UA 3T1YL 2RHSB 3HOVH 1XPOA 5CGKA 4R1JA 2JA7G 3VYUA 3CCLA 2MPMA 3T53B 4KTAA 2F0LA 1EZ6A 3J7AV 4P73A 1BXTA 4NP5A 1F2ZA 4R8NA 1D2BA 2Q2IA 1LTGD 1AE3A 2NN6G 2MJ8A 2RDGA 2YTYA 1IXRA 5DAUA 1SYBA 2ZXRA 1RHPA 1KTKA 4XXEA 4YWMA 4BA2I 2DJFC 3VYTA 4HSPA 3TS0A 1FJGL 2IT1A 3ONAB 4JPBW 2KOLA 1KC8C 1X3EA 1CQFA 4BY7B 1CT1D 4P74A 1RTNA 3IRBA 1OTCA 4ILWA 1QVCA 2SEBD 3EIVA 1J8IA 1EQRA 1HNXL 1QG7A 1Z9FA 2A68C 4L5SA 4BXXG 1SMYC 4KK7A 3NPPA 3HKZG 3EROA 3F8TA 3C3LA 2NWGA 2PQAA 1KXLA 4MTNA 1AN8A 1MD2D 2Z6KC 2A68D 1SMYD 3NTKA 1EOVA 2KJXA 4A93G 4YIJA 3HOYG 4ODGA 2BA1A 2HUGA 1L0XB 3X3MA 5EBCA 4DV3Q 4JI6Q 3W2DA 1PTOH 4JI1L 3IFDA 1W3SA 4HJ7A 4WJ4A 2F3WA 2R6GA 1XTCD 1Y1VH 3S9WA 2JA7B 1KAAA 5CV9A 1O78A 2PYKA 4A3BH 3FRPB 1SNQA 3T16A 1TWGH 2F0DA 1BBWA 2BH8A 3NUCA 2F3IA 1TS5A 3PGZA 1YBYA 5KNBA 1PMRA 1E7ZA 2FJ2A 2WB1E 1CTMA 2PZWA 2KCNA 3MXNA 2NUCA 4HIOA 1NTGA 3WWVA 4IOAA 2O5JC 3D4WA 2ENBA 3LGJA 4JBKA 1VQ7A 1KLGD 1QWYA 2HT1A 1NNXA 4FF4A 2K32A 3J81E 4F8MA 2EYLA 1VQNA 1WCMG 4ZRZA 1EQTA 5I9OA 2ASBA 3HOZG 1G6PA 4DK1A 1HNZQ 4RHSA 4CGYB 3CCSA 2B2UA 1AP0A 2PQEA 2B2VA 3S14H 3HOUH 2JA8G 1SNPA 1TWCB 3K7AH 4PZ8A 1RDPD 5GROA 1VQ4A 4BBRG 1EQQA 3QG1A 4R4TA 5BN5A 3HKZB 1F9QA 2AQ2B 3BVZA 3GTJB 3GTPH 1F2YA 4FF3A 3HRZC 4OWTB 2NVYB 3GTGB 1BKBA 3KDFB 1DONA 3OW2A 4QUFA 5C44H 5D14A 3FHWA 2JXMB 5FO8B 4IO9A 2FHTA 1UEBA 2KCCA 5C4ZA 2K01A 1VQ5A 4A93B 3M3YB 4CDEC 3HOYB 1WTRA 3D31A 2Q8IB 3FVQA 1VQBA 1U4RA 1GUOA 2LFNA 4CJ0B 1E1OA 4RA8A 3Q22A 1Z6HA 1G2TA 3G6JB 4DV3L 1RJTA 3HGBA 3G4SA 1V8QA 1CKOA 1KRSA 4HMIA 4JI6L 1VQIA 3UI2A 3R93A 1PH1A 2ALYB 1SYEA 1Q81C 1J6QA 5ELFA 4YCUA 1K8OA 1N32Q 2HD3A 1R9TH 3CAMA 2F0WA 2CH4A 2PMZE 5LL6X 1I3QH 5EBDA 2ZM6Q 2HQLA 4R4IA 1EQVA 1SNCA 3AMUA 1IBLQ 3H0GH 5CV7A 4KKTA 3QB3A 5HGTA 5M5WH 2CH4W 1WCMB 3HOZB 5I2XA 4GNXB 1JE4A 1LLRD 1PV4A 5KYLA 2JA8B 1LABA 3E5SA 3K5MA 4GN3B 3U4VA 4OX9Q 3F2UA 1JWMD 1HNZL 5ELDA 2A69C 4FDBA 4BBRB 1S4ZA 5KGUA 1EWCA 2F0UA 5AJ3Q 4C3HG 4GOPB 3NK9A 4ZLTF 3HKSA 2TSSA 5IGEA 3I8ZA 2F1MA 4S3SA 1NR4A 3GO5A 4DAMA 2EXDA 1N33Q 5I6YA 2P5ZX 5ELNA 3PSIA 3GTLH 3I4OA 3J81c 2K28A 4DK3C 2L55A 4GNXC 1JWUD 4QQBX 2D2CC 1KAWA 3Q24A 3S15H 2E5LQ 4XQQA 4FP5D 1CA5A 1HR0Q 2MFIA 4DV1Q 3ULPA 1CHPD 2G9DA 3VR4A 4HN7A 3U4ZA 1C8CA 4DXFA 4K2KA 4BY1H 2AQ3B 3H94A 2NVXB 4GOPC 1PA6A 3HOVG 4DR7Q 2QILA 1PXUA 3L2PA 5T1IA 2UUAQ 2E2DC 2IJ0A 4LK1C 5C4XH 5IODA 3HOWG 1WFQA 2RF4A 3HS0C 4QIWB 1N32L 1QNKA 2ZT9C 4DF7A 2J7ZA 2PPBC 1T9HA 2YYZA 4TRDA 4NW2A 1NUCA 2JP1A 4F88A 4KHVA 1E24A 5EGTA 1V43A 1PYBA 1STEA 1DJRD 2ZM6L 5A2QE 1G8ZD 2F0FA 4JI0Q 1VDZA 1MHWC 3BG3A 4DXGA 1IBLL 5C4JB 3U9OA 4DV5Q 3GTKB 3H3VC
chains in the Genus database with same CATH topology
1V1PA 1JOKA 2F0PA 5DEHA 1ENCA 3NTHA 2OXPA 3M85A 3H91A 4OO1G 4MIUA 1TWHB 3K58A 1DCZA 3J81L 3BYYB 2NVQB 1SYFA 2FMMA 1QE6A 2CQAA 4QUCA 5FO7B 2F0QA 2RDHA 2EY1A 1AW7A 3P7JA 4HTHA 4RKLA 1EY9A 2B2TA 1I4PA 2JEBI 4F87A 1DD2A 1PRTB 5A35A 3S16B 4ZYSA 2B8FA 1I4QA 3PUYA 3VR3A 2CHBD 4H13C 3BZDB 3HOWB 4QMGA 3OPOA 2E2JB 2Z1CA 2EJFC 2K03A 5CR3A 5NUCA 1Q3LA 1PFNA 3OOCA 2EZVA 4Y7NB 1GHJA 3T51B 3MZ5A 3PUVA 3CQZB 1TY0A 3I90A 4IFDG 1PRTC 5K5PA 1EY6A 2R92B 5EPLA 1H9JA 5D3IB 2V4DA 2F0KA 1LTAD 1SEBD 4ZUIA 4TSSA 2RSOA 2FMCA 3RD4A 1PRTD 4IUVA 1YNJC 1W6JA 2F0GA 2KECA 4ZAIA 5JOBA 1DOKA 4CKCA 1ENAA 1YNJD 1H9SB 3VA5A 1ET9A 2R61A 1Q1EA 1DYQA 1PZKD 2K33A 1O7LA 2BDOA 4LMQD 2IX3A 3ND9A 1Y1VB 2I07B 5J1ZA 3QJYA 1PRTF 3SHLA 1Y1WB 1VMPA 2NBFA 1HFGA 2KQ3A 3BVGA 4FXKC 5G3LD 2F0SA 2X6GA 1Y8PB 2EJMA 1FD7D 1J9OA 4RH6A 3V05A 3OMGA 3K7AB 1KNEA 1KNAA 1TIID 4PNYA 1BQQT 2K05A 3GV3A 4G57A 2A6HC 4BBSB 3SK5A 2L4NA 1GXDC 4N9PA 1R4PB 2A73B 3LWEA 5A2QL 1BO0A 1KABA 2ID0A 2X6LA 3O13A 2QEJC 1BCPC 2A6HD 2SDFA 2K1BA 4E6IA 3D8GA 4K8JA 1U4LA 2NTSA 5FOBB 3AU7A 3SK8A 2MUYA 1EZ8A 4K5VA 5JVG3 1AEXA 1BCPD 3JAME 4ZQ3A 1A3UA 3VYRA 3TN2A 2LY7A 2J0TD 1Y69U 3SDZA 4J1MA 2K7VA 2WB1B 1PYWD 1ZXTA 1LACA 4FXGC 1PTOF 1T5EA 4IUQA 1EYDA 2SNMA 1II3A 3HOXB 3QOJA 1M8AA 4X3UA 3VR2A 2PCFB 4IUNA 1G6ZA 1I4XA 1I3QB 2XRSD 3K6OA 5C6AA 5AFWA 4KY6A 1EL0A 3DWAA 2K5WA 3NXWA 4EGVA 4KMUC 2M9VA 3TP7A 2F03A 5IT9E 1TY2A 4DK0A 1FNWA 1CFMA 1JORA 2XNAC 4RGOS 5HURA 1B53A 3BDCA 1STYA 3K5OA 3D3RA 3CRKC 1B9NA 4A3KB 4HR7B 1SNOA 1CZGA 5C0XH 1LT3D 3FDTA 2QF7A 2D62A 3MFGA 4OIJA 1SNDA 4BY1B 2ICIA 1JC7A 4BS9A 2KVMA 1EWHA 2PMZB 3KLRA 1FYCA 1BR9A 2Z4HA 2E75C 4IQZA 2DY7A 2F0EA 4KKSA 4UDUC 2M2LA 2VB3X 5JPMC 3M4YA 1ML0D 3Q23A 1AZPA 1FNVA 2OT2A 1FR3A 5J22A 1B1ZA 3KLSA 1SYGA 4IZ8A 1FNUA 3NBIA 2B2WA 3PIO3 2KEDA 3SR1A 4RGMA 1BDOA 3EQLC 4I7ZC 1GUNA 2JSOA 2O2LD 4IUPA 4IUUA 3A55A 3V96A 2RDFA 1X32A 5ISRA 1TS3A 4KJOA 2QDBA 4K5WA 5CV8A 2EYMA 1W6KA 3TP8A 2PW7A 1F9RA 2EOTA 3PO2B 4KJNA 3I4LA 2BE5C 4ZKBB 1S5BD 5I6WA 3ERQA 2Q8TA 2ZXPA 1R4QB 2WV6D 4RCOA 2BE5D 4X3KA 1RCVD 3J7YW 1I50B 4PQXA 3A54A 5EJWA 5LL6S 1GOZA 1HTLD 5FKAC 3NE5B 4X3SA 4C2MB 1KDCA 2BCOA 3JAML 1BBXC 3FMCA 5KYIA 4G7OC 3RUZA 4A3DB 1SSOA 5JEAH 4XQJA 3PIP3 2H4OA 1QOHA 1IHZA 5K36H 1JQYD 4IUTA 4RGNA 1LTTD 2WACA 5COYA 1BUVT 1WVLA 2N55A 3SEBA 3U9SA 2EY2A 4JBWA 5KIXA 1WTQA 1G291 1EY4A 5JPNC 1D5XC 3K0YA 4RHRA 1F77A 3H6MA 4P2CB 3E6ZX 2EYFA 5C0XI 1SFOB 4BWGB 4CBVA 1H9MA 3NWTA 2H1EA 1LTBD 2B2YC 1WTXA 2C5CA 2QCPX 3R3OA 4KN4C 4QB4A 4XQNA 5C5LA 5EPKA 3K5LA 5C3XA 1TT2A 3SK4A 1LV9A 1HCZA 1I4HA 2VB2X 1S5DD 2ICEC 2I46A 3M4OB 2GA4B 3J80E 5M9OA 1EY5A 2AUKA 1HFNA 4KKUA 3OWFA 1PZJD 5IIFA 4ZK9B 4OO1I 1RD9D 2AUJD 4DA2A 3S1MB 3I70A 1TS4A 3RZOB 3A56A 1WTVA 1LT6D 3HG9A 4V190 1L0YB 1PFMA 1XWEA 2G9HD 3FPUB 2WP8J 2MHVA 3RMHA 1I4GA 1BOSA 1B44D 4U68A 3C46A 1XXGA 2X69A 1EIGA 5C4HA 1STAA 3NHHA 1MSGA 4FNFA 2L11A 4A3GB 2JA5B 4A3JB 4C3HB 2DNCA 3I4MB 1F9PA 1E2WA 1F2MA 1ZEQX 2RVLA 3N52A 1HRJA 3S1QB 1SE4A 2JA6B 2FINB 3I72A 3DHQA 3CU7A 1KLUD 3ND8A 5M3FB 4UAIA 2MGSA 3DEPA 2L0CA 3HOVB 4DU9A 1WD1A 3RLFA 3QOLA 4BA1I 1ESFA 3CRLC 3T13A 1EY8A 3PMFA 4IALA 1GUGA 2NN6H 1Q1BA 1IKMA 1A2UA 3TMEA 1JWSD 3GP7A 3TDQA 5E4WC 3BDLA 3KUPA 4X3TA 5JJZA 5KRUA 4HCEA 3VR5A 4XIGS 1ENFA 4RGTA 3KBGA 3A8IE 1NCVA 5ELBA 5CC4A 2AWNA 1F2LA 5EKLA 3ITPA 1TR5A 4ZUJA 1OO9B 2BDNA 3OW7A 1DXMA 1A15A 4QF4A 5KEEA 1C4QA 2LS01 3E0JA 3QWNA 2IPKD 1QB5D 1Q12A 4K6DA 2N88A 1PTOB 1H9KA 1CZWA 3CKIB 2EY6A 3BS1A 1CK1A 5DNFA 1EIHA 4A3BB 1DM0B 4FF2A 4GZYC 2E74C 1TWGB 1C48A 2VNUD 1EY7A 3PUZA 3TZUA 1V1OA 2OEOA 4KY7A 5KNCA 1GJXA 4HMJA 2F0MA 4NDXA 5E3FA 3OMCA 4XYOA 4DAPA 4ME5A 4KHZA 4A3EB 1UAPA 4KD4A 4CHTB 1LT4D 4ULLA 4HCSA 2IW3A 2HCCA 1PTOC 4WJWA 4B9WA 2B8GA 1NSNS 3OWEB 4H7BA 3S14B 3K57A 1SXTA 3HOUB 4CKEA 4H44C 3MHBA 4OGQC 4L63B 1PTOD 3LWUA 2AWOA 1O7ZA 1RF2D 3GTPB 4IFDJ 1EOTA 1SYDA 3MVVA 3GTQB 5C44B 1SDFA 3NQTA 2J4XA 2NB0A 4N9TA 1HA6A 3P75A 4Q0FA 5F2DA 2WKCA 1SYCA 2Z8LA 1IYVA 1OXTA 3R8BA 3DEOA 3NQIA 1D5MC 4K2LA 1DOLA 2Z4IA 3T4AC 1VF7A 3WDNA 3S2DB 2DNEA 4B9XA 1R9TB 1AZQA 1RODA 3X3NA 3VA7A 1EY0A 2PW5A 2F0VA 1EYCA 3H0GB 2NN6I 3NTIA 5M5WB 3OIQA 4U673 1JB3A 3BVMA 1STHA 3OIPA 2JEAI 4CJ1B 2A74C 1IKLA 3MA2B 2EXZA 1Y8NB 4IN3A 1CHQD 3IAYA 5BN4A 1NR2A 2XWJB 1JOOA 3R2IA 3MC0B 5FO9B 2O4XA 2F0JA 3GTLB 4EQPA 2B63B 2B2UC 3MXGA 2B2VC 1RTOA 1E2ZA 5M5XB 3S15B 3GQBA 2VXWA 4K6LA 3MWYW 2WIIB 3ZYYX 3V2TA 2SOBA 2IX1A 4DAYA 1WTWA 1M4VA 3L9AX 3WOFA 2F0TA 4LAAA 2RKSA 3G7LA 5I9PA 1OXVA 1HA5A 4PMBA 2PO4A 5C4XB 3EVQA 4PMCA 2L1BA 3WOEA 3DMUA 1UUPA 4XT1B 1CQVA 1HPCA 1O80A 1Z47A 4TQUS 2K6AA 4C56C 3PUXA 1TQOA 4NMZA 3AB9A 3K59A 4C3IG 1SBBB 1LTSD 1JICA 4J6HA 2DY8A 4RWSC 3KBXA 3MEHA 4K8IA 5IGGA 5CV4A 1I6VC 3BDOA 2NTTA 4XT3B 4OHJA 1SE2A 1SE3A 3NSWA 2BOSA 4L8JA 4WFN3 4G4KA 4G7HC 3EFXD 1RKNA 2EYOA 4OO1H 5FLXE 4PV1C 3HEJA 1EEID 1ZKOA 1CA6A 1ET6A 4LJZC 1D5ZC 1IW7C 1PZID 1Q90A 2EVBA 3A7AB 3NBHA 3PV0A 4ZKCB 2KA7A 1IW7D 2F0IA 1JR0D 1X3QA 1HHVA 4FVMA 1WD0A 5IGCA 3M7NA 1ZYRC 3FKIB 3PUWA 1OXUA 1T5XD 1LT5D 2F0OA 2PZUA 3EA6A 1VCIA 4O42A 3DXJC 4DFAA 4CJ2C 4F7XA 1ZYRD 1S5CD 4C3IB 1VMCA 5JVH3 3S1RB 1B4OA 1GUTA 3NWSA 5DM73 4IFDH 4HEDA 1V1PB 1TVXA 3D6CA 1EU4A 1QCBD 4WRDA 4DNTB 5EKIA 4OIKA 4C3JG 4M8AA 1GUWA 2DN8A 1PFBA 2TMPA 4IURA 2WINB 1ONLA 4FO2A 2SNSA 4DNRB 3I73A 1IYUA 3FEWX 4K5XA 3C1EA 3IKJA 1DZ1A 5IT9L 1AFPA 1K83B 4O1NA 2XIWA 5IGBA 3D4RA 4ABNA 2F4IA 1IL8A 1D6EC 4XDXA 3Q0AA 5EPJA 3VR6A 4I65A 2FFKB 2KHSA 3DM1A 1X3PA 4KV6A 4HAEA 2IL8A 4KY5A 4Q5VA 1F9SA 2B39A 4RAUC 5E4XA 5ELCA 1U4MA 4KN7C 5DM63 1CM9A 3OHXC 1GHKA 2K04A 5CORA 1ILPA 3RZDB 3QIAA 3MXPA 2B2TC 4CKBA 2WAQB 1D1KA 3MXUA 1EEFD 2NYZD 3LNNA 5IGDA 2RSNA 5CV6A 3TBIB 4RFBA 3H09A 3S17B 3GV6A 4Z9CB 1A3TA 5M5YB 2JYOA 1A3VA 1B9MA 4C3JB 3TZDA 1A6XA 1TWFB 5FK9C 1TKWB 1QNUA 4XYQA 2EDGA 4G7ZC 1JCKB 3DWPA 1K8MA 1Q8IA 1VF5C 2CW0C 4QCLA 2A69D 3VYSA 2MP1A 1KDBA 5C5MA 1FGBD 4JK1C 3SE0A 4EVOA 2XVSA 2CW0D 3GTMB 2EY5A 4FYDA 5FLXL 5C0XG 3L7ZC 2L9HA 3K5NA 3DWQA 3M7GA 4NKLA 3TSSA 1Y8OB 1SNMA 2YU9B 5IGFA 1BF4A 5CYUA 3N6RA 3D6WA 2NVTB 3GD7A 2E2HB 4AYBB 1GUSA 1DOMA 4V0BA 5JAVA 3SVMA 1PDQA 1JOQA 5T1GA 1ICWA 1D1IA 4EQOA 2F0HA 3BYTB 2EYJA 3KF8A 3IL8A 3NP8A 1H9RA 3J7AF 1PLFA 3HZXA 2HDMA 4R9WA 4IFDI 2HQEA 1STGA 2R7ZB 5EQ0A 2IWHA 4A3FB 1B2TA 4XTCS 3T56B 4FXDA 1G2SA 2M00A 3PO3B 4DAVA 2LMCB 1WTOA 3I3CA 2B2YA 3KK7A 4DGZA 1I4RA 2EYPA 5CMDA 2A5HA 4MN3A 3SK6A 4RKBA 3A7LA 5D3DA 4KI0A 4A3MB 5I4DA 1MGSA 5C0XJ 4B08A 1XYIA 5E1FA 3OSOA 3DUZA 5C3EB 5CBEE 1HTPA 2XSCA 3L3OC 1TS2A 5JEAG 2IX0A 4RCNA 4FF1A 3I4NB 3MFYA 3TP5A 3MTSA 2WKDA 1G91A 3IFTA 4MHEA 3TP6A 5K36G 3GTOB 5M3MB 1A2TA 5D65A 4ID6A 2HDLA 2D9UA 2ZXOA 4L6TB 1E2VA 2HCIA 4PMWA 1Z7TA 4M1UB 1STNA 4J8QA 1UNSA 3W3AA 2LKVA 2PZTA 3QO2A 5TSSA 1SAPA 2E2IB 2KUMA 3J80L 2VUMB 3HP3A 2F0NA 2QKIC 3A8KE 1HXYD 2K5DA 3EJIA 2Y0SB 3S1NB 2XWBB 4C1NI 3S2HB 3A8JE 1ESRA 4DN4M 1LTRD 3C1FA 1B3AA 3C2PA 1O7YA 3I91A 1U9RA 2JE6I 1TWAB 2RBMA 3URYA 5EKKA 1HQRD 1MI2A 3KLSX 1QJOA 5KNDA 1SJHD 1STBA 2F3VA 3Q6SA 4C1NK 5C3WA 1OXSC 2EPBA 1SJED 1BCPB 2Q8RE 2R93B 2C9OA 5I2YA 1U4PA 1BNZA 3P1HA 1E0BA 5IOCA 3D4DA 2EJGC 1EFID 1KDAA 2RA4A 1I6HB 1YNNC 1S5ED 1EU3A 4TKOB 3P20A 2L12A 2EE1A 1QILA 5J39A 5JEAJ 1HQMC 4HSVA 3FPPA 2A6EC 1LTID 5ELEA 1YNND 1WTPA 2XRQD 4K14A 2B2WC 4R8IA 2PNRC 1EYAA 2NZ1D 3CHBD 5G3LF 2EYHA 1LO5D 2K5QA 2L5TA 2AQ1B 5LHY1 1S5FD 2A6ED 4EQNA 1XX8A 1B50A 2CVRA 1HUMA 5CBAE 2RQXA 5CV5A 2KEEA 2O5IC 4H0LC 1UEAB 3SXHA 4OL7A 1OXXK 4KD3A 5BN3A 4A3IB 2E76C 3R2TA 1NAPA 4WORA 2XN9C 1TU2B 1MSHA 3LX0A 1MBYA 3MAQA 1CI3M 1BCPF 2BA0A 2R3ZA 2OF1A 2D5DA 1HUNA 1ILQA 1H9SA 5CGKA 3VYUA 2MPMA 3T53B 4KTAA 2F0LA 1EZ6A 3J7AV 1BXTA 4NP5A 1F2ZA 4R8NA 1D2BA 1LTGD 2NN6G 2MJ8A 2RDGA 5DAUA 1SYBA 2ZXRA 1RHPA 1KTKA 4XXEA 4BA2I 3VYTA 4HSPA 2IT1A 3ONAB 2KOLA 1CQFA 4BY7B 1CT1D 1RTNA 4ILWA 2SEBD 1J8IA 1QG7A 2A68C 1SMYC 4KK7A 3NPPA 3EROA 3C3LA 2NWGA 1AN8A 1MD2D 2A68D 1SMYD 3NTKA 2KJXA 4YIJA 4ODGA 2BA1A 2HUGA 1L0XB 3X3MA 5EBCA 3W2DA 1PTOH 3IFDA 2F3WA 2R6GA 1XTCD 2JA7B 3S9WA 1KAAA 5CV9A 1O78A 2PYKA 3FRPB 1SNQA 3T16A 2F0DA 3NUCA 1TS5A 5KNBA 1PMRA 2FJ2A 1CTMA 2PZWA 2KCNA 3MXNA 2NUCA 2O5JC 3D4WA 2ENBA 1KLGD 1QWYA 4FF4A 2K32A 3J81E 4F8MA 2EYLA 4ZRZA 1EQTA 5I9OA 4DK1A 4RHSA 4CGYB 2B2UA 1AP0A 2PQEA 2B2VA 1SNPA 1TWCB 1RDPD 3QG1A 5BN5A 3HKZB 1F9QA 2AQ2B 3BVZA 3GTJB 1F2YA 4FF3A 3HRZC 2NVYB 3GTGB 1DONA 4QUFA 5D14A 2JXMB 5FO8B 2FHTA 2KCCA 5C4ZA 2K01A 4A93B 3M3YB 3HOYB 1WTRA 3D31A 2Q8IB 3FVQA 1U4RA 1GUOA 2LFNA 4CJ0B 4RA8A 3Q22A 1Z6HA 1G2TA 3G6JB 1RJTA 3HGBA 1V8QA 4HMIA 3UI2A 3R93A 1SYEA 5ELFA 1K8OA 2F0WA 5LL6X 5EBDA 1EQVA 1SNCA 3AMUA 5CV7A 4KKTA 3QB3A 5HGTA 1WCMB 3HOZB 5I2XA 1JE4A 1LLRD 5KYLA 2JA8B 1LABA 3E5SA 3K5MA 3F2UA 1JWMD 5ELDA 2A69C 4BBRB 1S4ZA 5KGUA 1EWCA 2F0UA 4C3HG 3NK9A 4ZLTF 2TSSA 5IGEA 3I8ZA 2F1MA 4S3SA 1NR4A 3GO5A 5I6YA 2K28A 2L55A 1JWUD 2D2CC 3Q24A 4XQQA 4FP5D 1CA5A 1CHPD 2G9DA 3VR4A 4HN7A 1C8CA 4DXFA 4K2KA 2AQ3B 3H94A 2NVXB 2QILA 1PXUA 5T1IA 2E2DC 2IJ0A 4LK1C 5IODA 3HS0C 4QIWB 1QNKA 2ZT9C 4DF7A 2J7ZA 2PPBC 2YYZA 4TRDA 4NW2A 1NUCA 4F88A 2JP1A 4KHVA 5EGTA 1V43A 1STEA 1DJRD 5A2QE 1G8ZD 2F0FA 1VDZA 3BG3A 4DXGA 5C4JB 3U9OA 3GTKB 3H3VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYR A;  3VYT A;  3VYS A;  2OT2 A;  2Z1C A;  3VYU A;  3D3R A; 
#chains in the Genus database with same CATH topology
 4DV6 Q;  1V1P A;  2R92 G;  1JOK A;  4OWX B;  2F0P A;  2VS1 A;  2NZH A;  4OX9 L;  3HKZ E;  4J15 A;  5DEH A;  1ENC A;  3NTH A;  1P16 A;  2OXP A;  3M85 A;  3H91 A;  1IBM Q;  4OO1 G;  4MIU A;  1TWH B;  4POF A;  3K58 A;  1DCZ A;  2PI2 E;  5AJ3 L;  2UU9 L;  3J81 L;  3BYY B;  4DR3 L;  2PNH A;  2NVQ B;  3M4P A;  1SYF A;  2FMM A;  1UE7 A;  1XTD A;  1QE6 A;  1N33 L;  2CQA A;  4QY7 A;  1JMC A;  4QUC A;  5FO7 B;  2F0Q A;  2RDH A;  2EY1 A;  1AW7 A;  3P7J A;  4HTH A;  4RKL A;  3F2D A;  1EY9 A;  4R4O A;  2B2T A;  1I4P A;  2JEB I;  4F87 A;  2E5L L;  1HR0 L;  1PRT B;  3AEV A;  5A35 A;  4DV1 L;  1DD2 A;  2EIF A;  4DKA C;  3S16 B;  4ZYS A;  1Y1V G;  2B8F A;  1XNQ Q;  1I4Q A;  3PUY A;  3FKI H;  2RCF A;  3VR3 A;  2JA9 A;  4JBJ A;  2CHB D;  1L1O C;  3BZD B;  4H13 C;  3HOW B;  4QMG A;  3OPO A;  2E2J B;  2Z1C A;  2EJF C;  2K03 A;  5CR3 A;  1Y1W G;  5NUC A;  1Q3L A;  1PFN A;  3OOC A;  2UUA L;  2EZV A;  4Y7N B;  3NEL A;  4DUY Q;  4OON A;  1GHJ A;  3T51 B;  1A63 A;  3MZ5 A;  3PUV A;  4C3I H;  1XMQ Q;  3CQZ B;  2IHE A;  1TXY A;  4JOI A;  1TY0 A;  4B3M Q;  3I90 A;  4IFD G;  1PRT C;  1ICF B;  5K5P A;  1EY6 A;  3J81 i;  2R92 B;  4JI0 L;  5EPL A;  1H9J A;  5D3I B;  4DV5 L;  1MKH A;  2V4D A;  1VQH A;  2MQH A;  4DV6 L;  2F0K A;  1LTA D;  1SEB D;  4TSS A;  4ZUI A;  2F4V Q;  2RSO A;  1N8R C;  4LF7 Q;  2FMC A;  3RD4 A;  3BZK A;  1PRT D;  3FP9 A;  4BBS G;  4IUV A;  1XPU A;  4NPS A;  3A0J A;  1YNJ C;  1W2B A;  1SRO A;  1W6J A;  1IBM L;  1YEZ A;  2H5X A;  2F0G A;  3CC2 A;  2KEC A;  4ZAI A;  5JJL A;  1JJ2 A;  5JOB A;  4LF6 Q;  1DOK A;  4CKC A;  1ENA A;  1YNJ D;  1H9S B;  1K83 H;  3VA5 A;  1ET9 A;  2R61 A;  1Q1E A;  4DAY B;  1DYQ A;  1PZK D;  3W1G A;  2K33 A;  4LWC A;  1O7L A;  2BDO A;  4LMQ D;  2IX3 A;  5LMN W;  3ND9 A;  1V9P A;  4GN5 A;  1Y1V B;  2I07 B;  1N36 Q;  5J1Z A;  2WB1 G;  4OEM B;  3QJY A;  1EWI A;  1PRT F;  1K3B C;  3SHL A;  1Y1W B;  2K5V A;  3HOX G;  1XJV A;  1VMP A;  2NBF A;  1HFG A;  2KQ3 A;  3BVG A;  4FXK C;  1AH9 A;  3RZD H;  5G3L D;  2Q2H A;  3OTO L;  2F0S A;  2X6G A;  1Y8P B;  2UXD L;  4DUY L;  3G48 A;  4DPG A;  1QZH A;  2EJM A;  1FD7 D;  1J9O A;  2L15 A;  4B3M L;  4RH6 A;  3V05 A;  1K9M C;  3OMG A;  3S17 H;  3OYY A;  4YCW A;  1MIU A;  3K7A B;  1QVG A;  2K5H A;  5M5Y H;  1KNE A;  3CW2 C;  4C3J H;  1KNA A;  1TII D;  4PNY A;  1BQQ T;  2K05 A;  3GV3 A;  2VQF Q;  4G57 A;  2A6H C;  4BBS B;  1TWF H;  3SK5 A;  4HJ8 A;  2L4N A;  4YWL A;  1GXD C;  1HZ9 A;  1R4P B;  4N9P A;  4LF7 L;  1B8A A;  2A73 B;  3LWE A;  4HJA A;  5A2Q L;  1VS0 A;  2EQS A;  1BO0 A;  1KAB A;  2ID0 A;  2X6L A;  3O13 A;  4KHP Q;  2QEJ C;  1BCP C;  1IZ6 A;  1L1O A;  3NBH B;  2A6H D;  5IP7 H;  2SDF A;  2K1B A;  4DK6 C;  4E6I A;  3D8G A;  4K8J A;  1U4L A;  2NTS A;  5FOB B;  4A3K G;  3AU7 A;  3W1B A;  1N34 Q;  3SK8 A;  2E8G A;  2MUY A;  1EZ8 A;  2CWA A;  4K5V A;  5FLM H;  1HZB A;  5JVG 3;  1AEX A;  1ASZ A;  1BCP D;  3GTM H;  3JAM E;  4ZQ3 A;  1A3U A;  3VYR A;  3TN2 A;  4DV2 Q;  2LY7 A;  2J0T D;  1Y69 U;  3SDZ A;  4J1M A;  2K7V A;  2WB1 B;  4BY1 G;  1PYW D;  3T1H Q;  2YU9 H;  3BU2 A;  1ZXT A;  1LAC A;  4FXG C;  2NZO A;  1PTO F;  1T5E A;  3E9I A;  2CQO A;  1EYD A;  4IUQ A;  4YY3 Q;  2SNM A;  1N36 L;  2NVT H;  1II3 A;  3HOX B;  4DR5 Q;  3QOJ A;  1HZA A;  1M8A A;  4X3U A;  1VQO A;  3VR2 A;  3CPW A;  2PCF B;  4IUN A;  4JG2 A;  1G6Z A;  4A3G H;  1I4X A;  1I3Q B;  2XRS D;  3K6O A;  2HIX A;  5C6A A;  3RNU A;  5AFW A;  2N49 A;  4KY6 A;  3U50 C;  1EL0 A;  3DWA A;  2VW9 A;  2K5W A;  4L5Q A;  1EFW A;  3NXW A;  4EGV A;  2UUB Q;  2I5M X;  2HIV A;  4KMU C;  2M9V A;  1DGS A;  3PQI A;  1FVI A;  1QVF A;  3TP7 A;  3CC4 A;  3DLL A;  2F03 A;  5IT9 E;  1TY2 A;  4DK0 A;  1FNW A;  2R7Z H;  1CFM A;  1J5E Q;  1JOR A;  2XNA C;  2I5L X;  4RGO S;  2VQF L;  5HUR A;  2RCN A;  1I5F A;  1K8G A;  1B53 A;  3BDC A;  1L2F A;  1STY A;  3K5O A;  3D3R A;  3G71 A;  4KHP L;  3CRK C;  1B9N A;  1Y14 B;  3PO2 G;  3PO3 H;  4NXM Q;  4A3K B;  4HR7 B;  2Z6B A;  1SNO A;  1CZG A;  4IPD A;  5C0X H;  3BZC A;  1N34 L;  1LT3 D;  3FDT A;  4LF9 L;  2QF7 A;  2D62 A;  3MFG A;  4OIJ A;  1Q86 C;  1SND A;  3HFZ B;  3RN2 A;  4DV2 L;  4BY1 B;  2ICI A;  1JC7 A;  4BS9 A;  2KVM A;  1EWH A;  2PMZ B;  3KLR A;  2K52 A;  1SE8 A;  3FKI G;  1FYC A;  1BR9 A;  3T1H L;  2Z4H A;  2E75 C;  1UE1 A;  4IQZ A;  2DY7 A;  2F0E A;  4A3M H;  4KKS A;  4YY3 L;  4UDU C;  4QL5 A;  4DR5 L;  2M2L A;  2VB3 X;  5JPM C;  3M4Y A;  5C3E H;  1ML0 D;  2OTL A;  5HGQ A;  3Q23 A;  1AZP A;  1FNV A;  2OT2 A;  4A3D G;  1FR3 A;  5J3B A;  5J22 A;  1B1Z A;  1G51 A;  3KLS A;  1SYG A;  4IZ8 A;  3I4N H;  1FNU A;  3NBI A;  2B2W A;  3PIO 3;  2KED A;  2K5N A;  4CDD C;  4B3T Q;  3SR1 A;  2D0P A;  4RGM A;  1BDO A;  2JQO A;  3EQL C;  4LNQ A;  1MJC A;  4I7Z C;  1GUN A;  2UUB L;  2JSO A;  2O2L D;  4IUP A;  4IUU A;  3A55 A;  2KCM A;  3V96 A;  4GKK Q;  3GTO H;  2RDF A;  1X32 A;  5M3M H;  5ISR A;  5JJK A;  3J7A 5;  1TS3 A;  4KJO A;  2QDB A;  4K5W A;  5CV8 A;  1NBW A;  1J5E L;  2EYM A;  4CDC C;  5H1S E;  1W6K A;  3TP8 A;  2I5H A;  2PW7 A;  1M1K C;  1F9R A;  3MEF A;  2EOT A;  3PO2 B;  2IY5 B;  4KJN A;  1S40 A;  3CP0 A;  3I4L A;  2BE5 C;  4ZKB B;  2HHH Q;  4Y52 H;  2E2I H;  1GD7 A;  1S5B D;  5E7N A;  4NXM L;  5I6W A;  3ERQ A;  2VUM H;  3CXC A;  1IL2 A;  2Q8T A;  1CKM A;  2ZXP A;  1Q8K A;  4RG1 A;  1R4Q B;  2WV6 D;  4RCO A;  2BE5 D;  4X3K A;  2MO1 A;  5FJ8 H;  3S1N H;  2OQK A;  2VZA A;  5GAE C;  1RCV D;  1C0A A;  4A3E H;  3J7Y W;  3S2H H;  1I50 B;  4PQX A;  3A54 A;  5EJW A;  4X62 Q;  3F2B A;  5LL6 S;  1GOZ A;  1HTL D;  5FKA C;  3NE5 B;  2Q2T A;  1K73 C;  4LFB Q;  4X3S A;  4C2M B;  3KOJ A;  3H3V I;  1KDC A;  2ZJP A;  2BCO A;  1V1Q A;  2JK8 A;  4LF8 Q;  1JJC B;  3JAM L;  4A76 A;  1BBX C;  3FMC A;  5KYI A;  2XGT A;  4G7O C;  4YCV A;  3RUZ A;  4A3D B;  4B3R Q;  3KF8 B;  4OXP A;  1SSO A;  2UUC Q;  5JEA H;  2R93 H;  1WTH A;  1LYL A;  1Q46 A;  4XQJ A;  4PZ7 A;  3PIP 3;  2H4O A;  1QOH A;  3GTQ H;  3S24 A;  3EBE A;  1IHZ A;  4B3T L;  5K36 H;  1JQY D;  4IUT A;  4RGN A;  2UXC Q;  1QUQ A;  1LTT D;  1RIP A;  2WAC A;  1K8A C;  1K3R A;  4P72 A;  4GKK L;  4JI4 Q;  4X66 Q;  5COY A;  1BUV T;  1WVL A;  1CUK A;  2N55 A;  2K14 A;  3SEB A;  3U9S A;  1HR0 W;  2EY2 A;  4JBW A;  5KIX A;  1WTQ A;  2KEN A;  1G29 1;  1EY4 A;  5JPN C;  1EYG A;  1GKH A;  3PIO A;  1WOC A;  1D5X C;  2QGQ A;  1RL2 A;  2HHH L;  3S2D H;  3K0Y A;  4RHR A;  1F77 A;  1CKN B;  3H6M A;  4P2C B;  4K0K Q;  3E6Z X;  4NB3 A;  3JAM i;  2EYF A;  5C0X I;  4LFC Q;  4UY8 C;  4LUZ A;  1SFO B;  3K8A A;  3K80 C;  4YWK A;  4BWG B;  4CBV A;  1H9M A;  4JI2 Q;  3K7U C;  3NWT A;  2H1E A;  4X62 L;  1BBU A;  1A8V A;  1LTB D;  3KJO A;  4DV0 Q;  2Z6K A;  2B2Y C;  3AYH B;  4AIM A;  1WTX A;  2C5C A;  4N8X 1;  4LFB L;  5L37 A;  2QCP X;  4A3I H;  3KF6 B;  3R3O A;  5GAG C;  4KN4 C;  1BVS A;  2JA5 G;  4A3G G;  4LF8 L;  4QB4 A;  4XQN A;  2F52 A;  5C5L A;  5EPK A;  1YVC A;  2R7D A;  3K5L A;  4A3J G;  3CCU A;  3I4M G;  5C3X A;  4DR1 Q;  1TT2 A;  3SK4 A;  1LV9 A;  2UUC L;  5IYD H;  1HCZ A;  1I4H A;  2VB2 X;  2KHJ A;  4DR2 Q;  4AQY Q;  1S5D D;  2ICE C;  2B63 H;  2I46 A;  3M4O B;  2K75 A;  1PH7 A;  2GA4 B;  2JA6 G;  4GLX A;  3J80 E;  5IYB H;  4HJ5 A;  2ZTD A;  5M9O A;  5M5X H;  1EY5 A;  2AUK A;  2MO0 A;  2UXC L;  1HFN A;  4KKU A;  3OWF A;  5M3F G;  4JBM A;  1PZJ D;  4PG3 A;  5IIF A;  4ZK9 B;  4OO1 I;  2UXB Q;  1L0W A;  1RD9 D;  2KCT A;  2AUJ D;  4DA2 A;  3S1M B;  2ZTC A;  3I70 A;  1TS4 A;  3PIP A;  3RZO B;  3A56 A;  1EIF A;  2LXJ A;  1WTV A;  1LT6 D;  3HG9 A;  4V19 0;  1L0Y B;  1PFM A;  1XWE A;  2G9H D;  3FPU B;  2WP8 J;  1CSQ A;  2MHV A;  3RMH A;  3A5Z B;  1I4G A;  5IWA Q;  3AQQ A;  1BOS A;  3CCE A;  4JI5 Q;  1B44 D;  4U68 A;  1I94 Q;  3C46 A;  4LF4 Q;  1XXG A;  2GVA A;  3UE1 A;  1HZC A;  2X69 A;  4LFC L;  5IE8 A;  1EIG A;  5C4H A;  3NEN A;  1S72 A;  5GQO A;  1X3F A;  3KFU A;  1STA A;  3NHH A;  1MSG A;  4JI2 L;  4BY7 H;  4FNF A;  2L11 A;  3F1Z A;  4A3G B;  2JA5 B;  4X6A H;  4DV0 L;  2QEX A;  3E0E A;  1IYJ B;  3BJU A;  2DNC A;  4C3H B;  4A3J B;  3I4M B;  1X65 A;  1F9P A;  3M4Q A;  4IPH A;  1E2W A;  2LXK A;  5IP9 H;  1VQD A;  4DR1 L;  1F2M A;  1ZEQ X;  2RVL A;  3N52 A;  1XMO Q;  2KBN A;  1HRJ A;  4POG A;  3S1Q B;  3KDF A;  1SE4 A;  2JA6 B;  2FIN B;  3I72 A;  4GLV B;  2PI2 A;  1YHB A;  3DHQ A;  4AQY L;  3CU7 A;  1GO3 E;  1KLU D;  3ND8 A;  5M3F B;  4UAI A;  2MGS A;  2VL6 A;  3DEP A;  4N8F A;  2L0C A;  3HOV B;  2BH2 A;  4DU9 A;  1WD1 A;  2JA7 H;  3RLF A;  3QOL A;  2OWO A;  4BA1 I;  1ESF A;  2UXB L;  3CRL C;  3T13 A;  4A3B G;  1EY8 A;  3PMF A;  4DR7 L;  3RLN A;  1M90 C;  4IAL A;  4UP9 A;  3UE0 A;  1GUG A;  2NN6 H;  2DGY A;  1KQS A;  1Q1B A;  1IKM A;  2QA4 A;  5IYC H;  5FJ8 G;  1WI5 A;  1A2U A;  3B6Y A;  3TME A;  2B3G A;  3S1R H;  1JWS D;  4JYA Q;  3GP7 A;  4L5T A;  3TDQ A;  4A3E G;  5IWA L;  5E4W C;  3BDL A;  3M9B A;  3KUP A;  4X3T A;  1I94 L;  5JJZ A;  4LF4 L;  3STB D;  5KRU A;  1PH3 A;  4HCE A;  3VR5 A;  1K28 A;  2WAQ E;  4XIG S;  1ENF A;  1TWC H;  4GNX A;  4RGT A;  3HOU G;  3KBG A;  3A8I E;  1NCV A;  5ELB A;  2G5D A;  5CC4 A;  2AWN A;  1F2L A;  4BXX H;  1SR3 A;  3GTJ H;  5EKL A;  3CME A;  3ITP A;  1TR5 A;  1PFS A;  2NVY H;  3GTG H;  4ZUJ A;  4GOP A;  5C44 G;  1OO9 B;  1VQL A;  2BDN A;  3OW7 A;  1DXM A;  4NXN Q;  1ASY A;  1YIJ A;  1A15 A;  2I0Q A;  4QF4 A;  5KEE A;  4B3S Q;  1C4Q A;  3DM3 A;  2LS0 1;  3HOY H;  3E0J A;  3QWN A;  2IPK D;  1QB5 D;  2GVB A;  1Q12 A;  2AMC B;  4LF5 Q;  4K6D A;  2N88 A;  1PTO B;  1H9K A;  1CZW A;  3CKI B;  4A3L H;  2EY6 A;  3BS1 A;  1CK1 A;  5DNF A;  1EIH A;  4A3B B;  1DM0 B;  4FF2 A;  1XNQ L;  4GZY C;  2E74 C;  1TWG B;  4APV A;  1C48 A;  2VNU D;  2ZTE A;  1EY7 A;  3PUZ A;  3TZU A;  2CFM A;  1V1O A;  2OEO A;  4KY7 A;  5KNC A;  1GJX A;  4HMJ A;  1PH2 A;  2F0M A;  4NDX A;  5E3F A;  3OMC A;  4XYO A;  4DAP A;  2KHI A;  4ME5 A;  4KHZ A;  4A3E B;  1UAP A;  4KD4 A;  4CHT B;  1LT4 D;  4AYB E;  4ULL A;  4HCS A;  1XMQ L;  2IW3 A;  3H0G G;  2HCC A;  1PTO C;  4JYA L;  2Z9H A;  1WCM H;  4JI3 Q;  3TQY A;  4WJW A;  3HOZ H;  4B9W A;  2B8G A;  1NSN S;  3OWE B;  4H7B A;  2ZJR A;  2QW7 A;  3S14 B;  2JA8 H;  3K57 A;  1SXT A;  3HOU B;  4CKE A;  4H44 C;  4A3I G;  3MHB A;  4OGQ C;  4BBR H;  4L63 B;  1PTO D;  3LWU A;  2AWO A;  1AE2 A;  2Z0S A;  2PQA B;  1O7Z A;  1RF2 D;  1FGU A;  5GAD C;  2F4V L;  3GTP B;  4IFD J;  1EOT A;  1SYD A;  3MVV A;  3GTQ B;  3J7Z C;  5C44 B;  1SDF A;  5IYD G;  3NQT A;  2GN5 A;  1SN8 A;  2J4X A;  2NB0 A;  4N9T A;  1LUZ A;  2B63 G;  1HA6 A;  3P75 A;  4Q0F A;  5F2D A;  2WKC A;  1YZ6 A;  1XPR A;  4B3S L;  4LF6 L;  3CCQ A;  4JC0 A;  1SYC A;  1YJN A;  2Z8L A;  1IYV A;  1OXT A;  3R8B A;  3DEO A;  1WJJ A;  3NQI A;  1D5M C;  4K2L A;  3I55 A;  3H3V H;  1K0S A;  1DOL A;  2Z4I A;  4MNO A;  3T4A C;  2E2H H;  1VF7 A;  3WDN A;  3S2D B;  3MXN B;  5C4X G;  2DNE A;  4B9X A;  1R9T B;  1AZQ A;  5LMN Q;  1ROD A;  3X3N A;  3VA7 A;  1EY0 A;  3CCM A;  2PW5 A;  2F0V A;  4GLA C;  4MZ9 A;  1EYC A;  3H0G B;  2NN6 I;  3NTI A;  5M5W B;  2QDL A;  4HID A;  3OIQ A;  4U67 3;  4UP8 A;  1JB3 A;  3BVM A;  1STH A;  3OIP A;  5C4J H;  4EX5 A;  2JEA I;  4JI3 L;  4DR4 Q;  3ULJ A;  4BY7 G;  4CJ1 B;  2A74 C;  1IKL A;  3MA2 B;  2EXZ A;  1Y8N B;  4IN3 A;  1CHQ D;  3IAY A;  5BN4 A;  4A3F H;  4LFA Q;  1NR2 A;  1TWH H;  2XWJ B;  1JOO A;  4OEL B;  3R2I A;  2A1A A;  1NY4 A;  3MC0 B;  4HJ9 A;  5FO9 B;  2NVQ H;  2O4X A;  1N9W A;  5IP9 G;  1YHQ A;  1HNW Q;  2F0J A;  3GTL B;  4EQP A;  2B63 B;  2B2U C;  3MXG A;  3RLO A;  2B2V C;  1RTO A;  1VQC A;  1E2Z A;  1PH9 A;  5M5X B;  3S15 B;  4LUO A;  1NJI C;  4DR6 Q;  3GQB A;  2VXW A;  4K6L A;  3MWY W;  2WII B;  3ZYY X;  3V2T A;  2SOB A;  2IX1 A;  4DAY A;  1WTW A;  1M4V A;  3L9A X;  4ZCK A;  3WOF A;  3S16 H;  4JV5 Q;  2CKZ B;  2F0T A;  1X55 A;  4YHH Q;  4LAA A;  2RKS A;  3G7L A;  5I9P A;  1OXV A;  1HA5 A;  4PMB A;  2PO4 A;  3HOW H;  5C4X B;  3D0F A;  3EVQ A;  2E2J H;  1KIX A;  4PMC A;  2L1B A;  2Y0S E;  3WOE A;  3DMU A;  1UUP A;  1X56 A;  1CQV A;  4XT1 B;  3KLW A;  1HPC A;  1O80 A;  1Z47 A;  4Y7N H;  1KD1 C;  4TQU S;  1UWV A;  2K6A A;  2JN4 A;  2OQ0 A;  3PUX A;  4JI8 Q;  4C56 C;  1TQO A;  4NMZ A;  5LMN L;  3AB9 A;  5IYC G;  4C3I G;  3K59 A;  1SBB B;  1LTS D;  3CQZ H;  1JIC A;  4J6H A;  2DY8 A;  4RWS C;  3KBX A;  1KRT A;  3MEH A;  3JAM c;  4DNI A;  4K8I A;  5IGG A;  5CV4 A;  1I6V C;  3BDO A;  2NTT A;  3K81 C;  4XT3 B;  4OHJ A;  1SE2 A;  1SE3 A;  3NSW A;  2BOS A;  4L8J A;  2R92 H;  1KHI A;  3TRE A;  4WFN 3;  4G4K A;  4G7H C;  1A0I A;  3EFX D;  4DR4 L;  1RKN A;  2AKW B;  2EYO A;  1MJE A;  4OO1 H;  5FLX E;  1O7I A;  4PV1 C;  3E9H A;  3ERS X;  3HEJ A;  4JI7 Q;  2RHQ B;  3UDG A;  1EEI D;  1ZKO A;  4LFA L;  1CA6 A;  1ET6 A;  1VQG A;  4LJZ C;  1D5Z C;  1IW7 C;  1PZI D;  4A4I A;  1Q90 A;  2EVB A;  3A7A B;  4R4C A;  1HNW L;  4P71 A;  3NBH A;  1PH8 A;  3PV0 A;  3KYH C;  5BR8 Q;  4ZKC B;  2KA7 A;  1IW7 D;  1PYS B;  2F0I A;  1JR0 D;  1X3Q A;  5IT9 c;  4DR6 L;  1HHV A;  4FVM A;  1WD0 A;  5IGC A;  3M7N A;  4A3L G;  1ZYR C;  3FKI B;  3PUW A;  1OXU A;  1T5X D;  3AFQ A;  2V1C C;  1LT5 D;  2F0O A;  2PZU A;  3CMA A;  3PF5 A;  4JV5 L;  3EA6 A;  1VCI A;  4O42 A;  4YHH L;  3DXJ C;  1Y1W H;  4ALP A;  1TWA H;  4GS3 A;  4DFA A;  4IOC A;  4CJ2 C;  4F7X A;  1PH4 A;  1ZYR D;  4P75 A;  1S5C D;  1YJW A;  4C3I B;  1VMC A;  5JVH 3;  3S1R B;  1B4O A;  2WAQ G;  4JI8 L;  1GUT A;  3NWS A;  5DM7 3;  1YHA A;  4IFD H;  4HED A;  3QR8 A;  4O2D A;  4EQ5 A;  1V1P B;  1TVX A;  3D6C A;  4JVZ A;  1SLJ A;  1EU4 A;  1C9O A;  1QCB D;  4WRD A;  4H02 A;  4DNT B;  1I6H H;  5EKI A;  4OIK A;  4C3J G;  4M8A A;  3E3X A;  4CDF C;  4BBS H;  3TEH B;  1GUW A;  2DN8 A;  1PFB A;  2TMP A;  4IUR A;  2WIN B;  2A8V A;  1ONL A;  4FO2 A;  2SNS A;  4DNR B;  1X9N A;  3I73 A;  1IYU A;  2YTX A;  3FEW X;  3AFP A;  4K5X A;  4JI7 L;  3C1E A;  3I2Z A;  5IP7 G;  3IKJ A;  1DZ1 A;  1H95 A;  1E22 A;  3GDE A;  5IT9 L;  1AFP A;  1K83 B;  4O1N A;  2XIW A;  3JC6 6;  5IGB A;  3D4R A;  4LUV A;  4ABN A;  2F4I A;  5FLM G;  2OTJ A;  1IL8 A;  1D6E C;  4XDX A;  1VQ6 A;  3Q0A A;  5EPJ A;  5BR8 L;  1Q82 C;  3VR6 A;  4I65 A;  2FFK B;  4X65 Q;  2KHS A;  3G6E A;  3DM1 A;  5FLX c;  1NMG A;  1X3P A;  4KV6 A;  4HAE A;  2IL8 A;  4KY5 A;  4Q5V A;  1F9S A;  2DUD A;  2B39 A;  4RAU C;  5E4X A;  5ELC A;  5HY6 A;  1U4M A;  1CSP A;  4KN7 C;  5DM6 3;  2OCE A;  1KL9 A;  1IBK Q;  1CM9 A;  3HOX H;  4AYB G;  3OHX C;  1GHK A;  1D7Q A;  2K04 A;  2YV5 A;  5COR A;  1VQM A;  1ILP A;  3RZD B;  4ME3 A;  3QIA A;  3MXP A;  2B2T C;  4R4Q A;  2WAQ B;  4CKB A;  3W5O A;  1D1K A;  3MXU A;  1EEF D;  2NYZ D;  3LNN A;  5IGD A;  3I56 A;  2RSN A;  5JJI A;  5CV6 A;  3PF4 A;  3TBI B;  4B3R L;  2VY3 A;  4RFB A;  3H09 A;  1VQA A;  3S17 B;  3GV6 A;  4Z9C B;  5GAH C;  1A3T A;  4UP7 A;  3ULL A;  3H15 A;  5M5Y B;  2JYO A;  1A3V A;  1B9M A;  1JB7 A;  2R7F A;  4C3J B;  3TZD A;  1A6X A;  2R7Z G;  1TWF B;  5FK9 C;  1TKW B;  1PVO A;  2UU9 Q;  4DR3 Q;  1QNU A;  4A3F G;  4XYQ A;  2EDG A;  4JOI C;  1NMF A;  4G7Z C;  1JCK B;  3DWP A;  3L0O A;  1K8M A;  3CD6 A;  1Q8I A;  4JI4 L;  1VF5 C;  2CW0 C;  4X66 L;  4QCL A;  2A69 D;  3VYS A;  2MP1 A;  1KDB A;  1NE3 A;  5C5M A;  1EIY B;  3CCJ A;  1FGB D;  4JK1 C;  3PO3 G;  4A3K H;  4RMF A;  3NEM A;  3SE0 A;  1JE5 A;  2AHO B;  4EVO A;  2XVS A;  2CW0 D;  3GTM B;  2EY5 A;  4FYD A;  5FLX L;  5C0X G;  3L7Z C;  2L9H A;  3K5N A;  3DWQ A;  3M7G A;  4NKL A;  3TSS A;  1Y8O B;  4UPA A;  3PCO B;  1SNM A;  4A3C H;  4K0K L;  4DV7 Q;  1B70 B;  1GVP A;  2YU9 B;  5IGF A;  4AH6 A;  1BF4 A;  5CYU A;  1U0L A;  3N6R A;  3D6W A;  4X65 L;  2NVT B;  3GD7 A;  2E2H B;  4AYB B;  1GUS A;  1DOM A;  4V0B A;  5JAV A;  4X64 Q;  1JJG A;  3SVM A;  4A3M G;  3CC7 A;  1PDQ A;  1IBK L;  5T1G A;  1ICW A;  1JOQ A;  1D1I A;  4EQO A;  1VQ8 A;  3RN5 A;  4LW1 A;  2F0H A;  4IPG A;  5C3E G;  3BYT B;  5DLQ E;  1X3G A;  4HIK A;  2EYJ A;  3KF8 A;  3IL8 A;  3NP8 A;  1H9R A;  4HIM A;  3I4N G;  3J7A F;  1PLF A;  2ZJQ A;  3HZX A;  2HDM A;  4R9W A;  4IFD I;  4UHV A;  2HQE A;  1STG A;  4DR2 L;  1JT8 A;  2CCZ A;  2R7Z B;  2C35 B;  4GN4 B;  5EQ0 A;  3CCR A;  5M3M G;  2IWH A;  4A3F B;  1B2T A;  4XTC S;  3T56 B;  1L1O B;  4FXD A;  3CPF A;  1G2S A;  4DUZ Q;  2M00 A;  2ATW A;  2XTI A;  3F2C A;  3PO2 H;  3PO3 B;  4DAV A;  2LMC B;  1WTO A;  1E3P A;  1VQK A;  3I3C A;  2B2Y A;  1GM5 A;  2JJQ A;  2VUM G;  1PHJ A;  3KK7 A;  3STB C;  4DGZ A;  2LSS A;  4JCV E;  1I4R A;  3J80 c;  2EYP A;  1YIT A;  2Y0S G;  5CMD A;  1CKN A;  2A5H A;  4MN3 A;  3ZJY C;  1I50 H;  4JI5 L;  2A19 A;  3SK6 A;  4RKB A;  4DV7 L;  3A7L A;  5D3D A;  1S3O A;  1HJP A;  3KJP A;  4KI0 A;  4A3M B;  5I4D A;  1MGS A;  1XNR Q;  4C2M H;  5C0X J;  3OTO Q;  2VQE Q;  1B7Y B;  3ICE A;  4JW0 A;  4B08 A;  4X64 L;  2UXD Q;  1XYI A;  1E1T A;  5E1F A;  2CWP A;  3OSO A;  3DUZ A;  5C3E B;  5CBE E;  1HTP A;  4GKJ Q;  4A3D H;  2XSC A;  3KF6 A;  3L3O C;  1TS2 A;  5ELO A;  5JEA G;  2IX0 A;  2R93 G;  4RCN A;  4FF1 A;  3I4N B;  3MFY A;  3TP5 A;  1UE6 A;  3MTS A;  3J81 j;  1K0R A;  2WKD A;  1G91 A;  3IFT A;  4MHE A;  3EN2 A;  3TP6 A;  1HH2 P;  4OWW B;  5K36 G;  1PH5 A;  3GTO B;  4IJH A;  4IJL A;  1XMO L;  4A93 H;  5M3M B;  3M3Y H;  1A2T A;  4DV4 Q;  5D65 A;  4ID6 A;  2HDL A;  5IY0 A;  2D9U A;  5EAY A;  2ZXO A;  1YNX A;  4L6T B;  2DJG C;  1E2V A;  3TRZ A;  2HCI A;  4PMW A;  1Z7T A;  1VQF A;  4M1U B;  1STN A;  4J8Q A;  1UNS A;  3W3A A;  2LKV A;  2PZT A;  4DUZ L;  3QO2 A;  5TSS A;  3Q8D A;  1SAP A;  2E2I B;  2KUM A;  4KLK A;  3J80 L;  2VUM B;  3HP3 A;  2F0N A;  2QKI C;  3A8K E;  2N3S A;  1YJ9 A;  1HXY D;  2K5D A;  2MNA A;  3EJI A;  2Y0S B;  3S1N B;  2XWB B;  4C1N I;  4O0A A;  3CCV A;  3ER0 A;  3S2H B;  3A8J E;  1ESR A;  1LTR D;  4DN4 M;  4QGU A;  3VDY A;  3C1F A;  3RR5 A;  1D8L A;  1B3A A;  3C2P A;  1YI2 A;  1SFO H;  4QJF A;  1O7Y A;  3I91 A;  1U9R A;  2N78 A;  2D0O A;  4QIW E;  2JE6 I;  1TWA B;  2RBM A;  3URY A;  5EKK A;  1HQR D;  3UDX A;  1MI2 A;  3KLS X;  1QJO A;  5KND A;  1SJH D;  1STB A;  1XNR L;  2F3V A;  2VQE L;  3Q6S A;  4C1N K;  5C3W A;  1OXS C;  2EPB A;  1SJE D;  1BCP B;  2Q8R E;  3UDI A;  1PH6 A;  2R93 B;  2C9O A;  4I7A A;  5I2Y A;  3UDF A;  4GKJ L;  5LMU Q;  1U4P A;  1BNZ A;  3P1H A;  1E0B A;  5IOC A;  3D4D A;  2EJG C;  1QZG A;  1EFI D;  1KDA A;  2RA4 A;  1I6H B;  1X54 A;  1FL0 A;  3CF5 A;  1YNN C;  1S5E D;  1WYD A;  1EU3 A;  4TKO B;  3P20 A;  3M4O H;  1VQ9 A;  4NXN L;  1VQP A;  2L12 A;  1VQE A;  2EE1 A;  2N8N A;  5IYB G;  3K0X A;  1QIL A;  2ES2 A;  2WFW A;  1A62 A;  3J80 i;  5J39 A;  1UE5 A;  4DV4 L;  3T1Y Q;  5JEA J;  1HQM C;  1X6O A;  3FPP A;  4HSV A;  2A6E C;  1LTI D;  5ELE A;  1YNN D;  2YTV A;  1WTP A;  2IHF A;  2XRQ D;  4K14 A;  2B2W C;  4R8I A;  4LF5 L;  3I7F A;  2PNR C;  1EYA A;  2NZ1 D;  3CHB D;  4MTK A;  5G3L F;  2NVX H;  1EUJ A;  2EYH A;  4TVA B;  3S1M H;  1SMX A;  1LO5 D;  2K5Q A;  3RZO H;  2L5T A;  2AQ1 B;  4LF9 Q;  1P8L A;  3A74 A;  5LHY 1;  1S5F D;  2A6E D;  4EQN A;  1XX8 A;  1B50 A;  2CVR A;  1HUM A;  5CBA E;  2RQX A;  5CV5 A;  1VQJ A;  2K50 A;  4A3C G;  1C7Y A;  1Q7Y C;  3TS2 A;  1FJG Q;  2KEE A;  2O5I C;  4H0L C;  4A75 A;  1LTL A;  1UEA B;  3U58 A;  3SXH A;  4OL7 A;  2FXQ A;  4IPC A;  3SGI A;  1OXX K;  4KD3 A;  3GTK H;  5BN3 A;  4A3I B;  2E76 C;  2B29 A;  1HNX Q;  3R2T A;  2JA5 H;  4L5R C;  1NAP A;  4WOR A;  2XN9 C;  4C3H H;  4A3J H;  3I4M H;  1TU2 B;  1MSH A;  3LX0 A;  1MBY A;  3MAQ A;  1CI3 M;  1B3Q A;  1BCP F;  2BA0 A;  4PZ6 A;  5LMU L;  1QUQ B;  3S1Q H;  2JA6 H;  1SRU A;  2K4K A;  2R3Z A;  2OF1 A;  4WJ3 M;  2D5D A;  1U5K A;  4JI1 Q;  1HUN A;  1ILQ A;  1LM0 A;  5M3F H;  1H9S A;  3A5U A;  2Q2U A;  3T1Y L;  2RHS B;  3HOV H;  1XPO A;  5CGK A;  4R1J A;  2JA7 G;  3VYU A;  3CCL A;  2MPM A;  3T53 B;  4KTA A;  2F0L A;  1EZ6 A;  3J7A V;  4P73 A;  1BXT A;  4NP5 A;  1F2Z A;  4R8N A;  1D2B A;  2Q2I A;  1LTG D;  1AE3 A;  2NN6 G;  2MJ8 A;  2RDG A;  2YTY A;  1IXR A;  5DAU A;  1SYB A;  2ZXR A;  1RHP A;  1KTK A;  4XXE A;  4YWM A;  4BA2 I;  2DJF C;  3VYT A;  4HSP A;  3TS0 A;  1FJG L;  2IT1 A;  3ONA B;  4JPB W;  2KOL A;  1KC8 C;  1X3E A;  1CQF A;  4BY7 B;  1CT1 D;  4P74 A;  1RTN A;  3IRB A;  1OTC A;  4ILW A;  1QVC A;  2SEB D;  3EIV A;  1J8I A;  1EQR A;  1HNX L;  1QG7 A;  1Z9F A;  2A68 C;  4L5S A;  4BXX G;  1SMY C;  4KK7 A;  3NPP A;  3HKZ G;  3ERO A;  3F8T A;  3C3L A;  2NWG A;  2PQA A;  1KXL A;  4MTN A;  1AN8 A;  1MD2 D;  2Z6K C;  2A68 D;  1SMY D;  3NTK A;  1EOV A;  2KJX A;  4A93 G;  4YIJ A;  3HOY G;  4ODG A;  2BA1 A;  2HUG A;  1L0X B;  3X3M A;  5EBC A;  4DV3 Q;  4JI6 Q;  3W2D A;  1PTO H;  4JI1 L;  3IFD A;  1W3S A;  4HJ7 A;  4WJ4 A;  2F3W A;  2R6G A;  1XTC D;  1Y1V H;  3S9W A;  2JA7 B;  1KAA A;  5CV9 A;  1O78 A;  2PYK A;  4A3B H;  3FRP B;  1SNQ A;  3T16 A;  1TWG H;  2F0D A;  1BBW A;  2BH8 A;  3NUC A;  2F3I A;  1TS5 A;  3PGZ A;  1YBY A;  5KNB A;  1PMR A;  1E7Z A;  2FJ2 A;  2WB1 E;  1CTM A;  2PZW A;  2KCN A;  3MXN A;  2NUC A;  4HIO A;  1NTG A;  3WWV A;  4IOA A;  2O5J C;  3D4W A;  2ENB A;  3LGJ A;  4JBK A;  1VQ7 A;  1KLG D;  1QWY A;  2HT1 A;  1NNX A;  4FF4 A;  2K32 A;  3J81 E;  4F8M A;  2EYL A;  1VQN A;  1WCM G;  4ZRZ A;  1EQT A;  5I9O A;  2ASB A;  3HOZ G;  1G6P A;  4DK1 A;  1HNZ Q;  4RHS A;  4CGY B;  3CCS A;  2B2U A;  1AP0 A;  2PQE A;  2B2V A;  3S14 H;  3HOU H;  2JA8 G;  1SNP A;  1TWC B;  3K7A H;  4PZ8 A;  1RDP D;  5GRO A;  1VQ4 A;  4BBR G;  1EQQ A;  3QG1 A;  4R4T A;  5BN5 A;  3HKZ B;  1F9Q A;  2AQ2 B;  3BVZ A;  3GTJ B;  3GTP H;  1F2Y A;  4FF3 A;  3HRZ C;  4OWT B;  2NVY B;  3GTG B;  1BKB A;  3KDF B;  1DON A;  3OW2 A;  4QUF A;  5C44 H;  5D14 A;  3FHW A;  2JXM B;  5FO8 B;  4IO9 A;  2FHT A;  1UEB A;  2KCC A;  5C4Z A;  2K01 A;  1VQ5 A;  4A93 B;  3M3Y B;  4CDE C;  3HOY B;  1WTR A;  3D31 A;  2Q8I B;  3FVQ A;  1VQB A;  1U4R A;  1GUO A;  2LFN A;  4CJ0 B;  1E1O A;  4RA8 A;  3Q22 A;  1Z6H A;  1G2T A;  3G6J B;  4DV3 L;  1RJT A;  3HGB A;  3G4S A;  1V8Q A;  1CKO A;  1KRS A;  4HMI A;  4JI6 L;  1VQI A;  3UI2 A;  3R93 A;  1PH1 A;  2ALY B;  1SYE A;  1Q81 C;  1J6Q A;  5ELF A;  4YCU A;  1K8O A;  1N32 Q;  2HD3 A;  1R9T H;  3CAM A;  2F0W A;  2CH4 A;  2PMZ E;  5LL6 X;  1I3Q H;  5EBD A;  2ZM6 Q;  2HQL A;  4R4I A;  1EQV A;  1SNC A;  3AMU A;  1IBL Q;  3H0G H;  5CV7 A;  4KKT A;  3QB3 A;  5HGT A;  5M5W H;  2CH4 W;  1WCM B;  3HOZ B;  5I2X A;  4GNX B;  1JE4 A;  1LLR D;  1PV4 A;  5KYL A;  2JA8 B;  1LAB A;  3E5S A;  3K5M A;  4GN3 B;  3U4V A;  4OX9 Q;  3F2U A;  1JWM D;  1HNZ L;  5ELD A;  2A69 C;  4FDB A;  4BBR B;  1S4Z A;  5KGU A;  1EWC A;  2F0U A;  5AJ3 Q;  4C3H G;  4GOP B;  3NK9 A;  4ZLT F;  3HKS A;  2TSS A;  5IGE A;  3I8Z A;  2F1M A;  4S3S A;  1NR4 A;  3GO5 A;  4DAM A;  2EXD A;  1N33 Q;  5I6Y A;  2P5Z X;  5ELN A;  3PSI A;  3GTL H;  3I4O A;  3J81 c;  2K28 A;  4DK3 C;  2L55 A;  4GNX C;  1JWU D;  4QQB X;  2D2C C;  1KAW A;  3Q24 A;  3S15 H;  2E5L Q;  4XQQ A;  4FP5 D;  1CA5 A;  1HR0 Q;  2MFI A;  4DV1 Q;  3ULP A;  1CHP D;  2G9D A;  3VR4 A;  4HN7 A;  3U4Z A;  1C8C A;  4DXF A;  4K2K A;  4BY1 H;  2AQ3 B;  3H94 A;  2NVX B;  4GOP C;  1PA6 A;  3HOV G;  4DR7 Q;  2QIL A;  1PXU A;  3L2P A;  5T1I A;  2UUA Q;  2E2D C;  2IJ0 A;  4LK1 C;  5C4X H;  5IOD A;  3HOW G;  1WFQ A;  2RF4 A;  3HS0 C;  4QIW B;  1N32 L;  1QNK A;  2ZT9 C;  4DF7 A;  2J7Z A;  2PPB C;  1T9H A;  2YYZ A;  4TRD A;  4NW2 A;  1NUC A;  2JP1 A;  4F88 A;  4KHV A;  1E24 A;  5EGT A;  1V43 A;  1PYB A;  1STE A;  1DJR D;  2ZM6 L;  5A2Q E;  1G8Z D;  2F0F A;  4JI0 Q;  1VDZ A;  1MHW C;  3BG3 A;  4DXG A;  1IBL L;  5C4J B;  3U9O A;  4DV5 Q;  3GTK B;  3H3V C; 
#chains in the Genus database with same CATH homology
 1V1P A;  1JOK A;  2F0P A;  5DEH A;  1ENC A;  3NTH A;  2OXP A;  3M85 A;  3H91 A;  4OO1 G;  4MIU A;  1TWH B;  3K58 A;  1DCZ A;  3J81 L;  3BYY B;  2NVQ B;  1SYF A;  2FMM A;  1QE6 A;  2CQA A;  4QUC A;  5FO7 B;  2F0Q A;  2RDH A;  2EY1 A;  1AW7 A;  3P7J A;  4HTH A;  4RKL A;  1EY9 A;  2B2T A;  1I4P A;  2JEB I;  4F87 A;  1DD2 A;  1PRT B;  5A35 A;  3S16 B;  4ZYS A;  2B8F A;  1I4Q A;  3PUY A;  3VR3 A;  2CHB D;  4H13 C;  3BZD B;  3HOW B;  4QMG A;  3OPO A;  2E2J B;  2Z1C A;  2EJF C;  2K03 A;  5CR3 A;  5NUC A;  1Q3L A;  1PFN A;  3OOC A;  2EZV A;  4Y7N B;  1GHJ A;  3T51 B;  3MZ5 A;  3PUV A;  3CQZ B;  1TY0 A;  3I90 A;  4IFD G;  1PRT C;  5K5P A;  1EY6 A;  2R92 B;  5EPL A;  1H9J A;  5D3I B;  2V4D A;  2F0K A;  1LTA D;  1SEB D;  4ZUI A;  4TSS A;  2RSO A;  2FMC A;  3RD4 A;  1PRT D;  4IUV A;  1YNJ C;  1W6J A;  2F0G A;  2KEC A;  4ZAI A;  5JOB A;  1DOK A;  4CKC A;  1ENA A;  1YNJ D;  1H9S B;  3VA5 A;  1ET9 A;  2R61 A;  1Q1E A;  1DYQ A;  1PZK D;  2K33 A;  1O7L A;  2BDO A;  4LMQ D;  2IX3 A;  3ND9 A;  1Y1V B;  2I07 B;  5J1Z A;  3QJY A;  1PRT F;  3SHL A;  1Y1W B;  1VMP A;  2NBF A;  1HFG A;  2KQ3 A;  3BVG A;  4FXK C;  5G3L D;  2F0S A;  2X6G A;  1Y8P B;  2EJM A;  1FD7 D;  1J9O A;  4RH6 A;  3V05 A;  3OMG A;  3K7A B;  1KNE A;  1KNA A;  1TII D;  4PNY A;  1BQQ T;  2K05 A;  3GV3 A;  4G57 A;  2A6H C;  4BBS B;  3SK5 A;  2L4N A;  1GXD C;  4N9P A;  1R4P B;  2A73 B;  3LWE A;  5A2Q L;  1BO0 A;  1KAB A;  2ID0 A;  2X6L A;  3O13 A;  2QEJ C;  1BCP C;  2A6H D;  2SDF A;  2K1B A;  4E6I A;  3D8G A;  4K8J A;  1U4L A;  2NTS A;  5FOB B;  3AU7 A;  3SK8 A;  2MUY A;  1EZ8 A;  4K5V A;  5JVG 3;  1AEX A;  1BCP D;  3JAM E;  4ZQ3 A;  1A3U A;  3VYR A;  3TN2 A;  2LY7 A;  2J0T D;  1Y69 U;  3SDZ A;  4J1M A;  2K7V A;  2WB1 B;  1PYW D;  1ZXT A;  1LAC A;  4FXG C;  1PTO F;  1T5E A;  4IUQ A;  1EYD A;  2SNM A;  1II3 A;  3HOX B;  3QOJ A;  1M8A A;  4X3U A;  3VR2 A;  2PCF B;  4IUN A;  1G6Z A;  1I4X A;  1I3Q B;  2XRS D;  3K6O A;  5C6A A;  5AFW A;  4KY6 A;  1EL0 A;  3DWA A;  2K5W A;  3NXW A;  4EGV A;  4KMU C;  2M9V A;  3TP7 A;  2F03 A;  5IT9 E;  1TY2 A;  4DK0 A;  1FNW A;  1CFM A;  1JOR A;  2XNA C;  4RGO S;  5HUR A;  1B53 A;  3BDC A;  1STY A;  3K5O A;  3D3R A;  3CRK C;  1B9N A;  4A3K B;  4HR7 B;  1SNO A;  1CZG A;  5C0X H;  1LT3 D;  3FDT A;  2QF7 A;  2D62 A;  3MFG A;  4OIJ A;  1SND A;  4BY1 B;  2ICI A;  1JC7 A;  4BS9 A;  2KVM A;  1EWH A;  2PMZ B;  3KLR A;  1FYC A;  1BR9 A;  2Z4H A;  2E75 C;  4IQZ A;  2DY7 A;  2F0E A;  4KKS A;  4UDU C;  2M2L A;  2VB3 X;  5JPM C;  3M4Y A;  1ML0 D;  3Q23 A;  1AZP A;  1FNV A;  2OT2 A;  1FR3 A;  5J22 A;  1B1Z A;  3KLS A;  1SYG A;  4IZ8 A;  1FNU A;  3NBI A;  2B2W A;  3PIO 3;  2KED A;  3SR1 A;  4RGM A;  1BDO A;  3EQL C;  4I7Z C;  1GUN A;  2JSO A;  2O2L D;  4IUP A;  4IUU A;  3A55 A;  3V96 A;  2RDF A;  1X32 A;  5ISR A;  1TS3 A;  4KJO A;  2QDB A;  4K5W A;  5CV8 A;  2EYM A;  1W6K A;  3TP8 A;  2PW7 A;  1F9R A;  2EOT A;  3PO2 B;  4KJN A;  3I4L A;  2BE5 C;  4ZKB B;  1S5B D;  5I6W A;  3ERQ A;  2Q8T A;  2ZXP A;  1R4Q B;  2WV6 D;  4RCO A;  2BE5 D;  4X3K A;  1RCV D;  3J7Y W;  1I50 B;  4PQX A;  3A54 A;  5EJW A;  5LL6 S;  1GOZ A;  1HTL D;  5FKA C;  3NE5 B;  4X3S A;  4C2M B;  1KDC A;  2BCO A;  3JAM L;  1BBX C;  3FMC A;  5KYI A;  4G7O C;  3RUZ A;  4A3D B;  1SSO A;  5JEA H;  4XQJ A;  3PIP 3;  2H4O A;  1QOH A;  1IHZ A;  5K36 H;  1JQY D;  4IUT A;  4RGN A;  1LTT D;  2WAC A;  5COY A;  1BUV T;  1WVL A;  2N55 A;  3SEB A;  3U9S A;  2EY2 A;  4JBW A;  5KIX A;  1WTQ A;  1G29 1;  1EY4 A;  5JPN C;  1D5X C;  3K0Y A;  4RHR A;  1F77 A;  3H6M A;  4P2C B;  3E6Z X;  2EYF A;  5C0X I;  1SFO B;  4BWG B;  4CBV A;  1H9M A;  3NWT A;  2H1E A;  1LTB D;  2B2Y C;  1WTX A;  2C5C A;  2QCP X;  3R3O A;  4KN4 C;  4QB4 A;  4XQN A;  5C5L A;  5EPK A;  3K5L A;  5C3X A;  1TT2 A;  3SK4 A;  1LV9 A;  1HCZ A;  1I4H A;  2VB2 X;  1S5D D;  2ICE C;  2I46 A;  3M4O B;  2GA4 B;  3J80 E;  5M9O A;  1EY5 A;  2AUK A;  1HFN A;  4KKU A;  3OWF A;  1PZJ D;  5IIF A;  4ZK9 B;  4OO1 I;  1RD9 D;  2AUJ D;  4DA2 A;  3S1M B;  3I70 A;  1TS4 A;  3RZO B;  3A56 A;  1WTV A;  1LT6 D;  3HG9 A;  4V19 0;  1L0Y B;  1PFM A;  1XWE A;  2G9H D;  3FPU B;  2WP8 J;  2MHV A;  3RMH A;  1I4G A;  1BOS A;  1B44 D;  4U68 A;  3C46 A;  1XXG A;  2X69 A;  1EIG A;  5C4H A;  1STA A;  3NHH A;  1MSG A;  4FNF A;  2L11 A;  4A3G B;  2JA5 B;  4A3J B;  4C3H B;  2DNC A;  3I4M B;  1F9P A;  1E2W A;  1F2M A;  1ZEQ X;  2RVL A;  3N52 A;  1HRJ A;  3S1Q B;  1SE4 A;  2JA6 B;  2FIN B;  3I72 A;  3DHQ A;  3CU7 A;  1KLU D;  3ND8 A;  5M3F B;  4UAI A;  2MGS A;  3DEP A;  2L0C A;  3HOV B;  4DU9 A;  1WD1 A;  3RLF A;  3QOL A;  4BA1 I;  1ESF A;  3CRL C;  3T13 A;  1EY8 A;  3PMF A;  4IAL A;  1GUG A;  2NN6 H;  1Q1B A;  1IKM A;  1A2U A;  3TME A;  1JWS D;  3GP7 A;  3TDQ A;  5E4W C;  3BDL A;  3KUP A;  4X3T A;  5JJZ A;  5KRU A;  4HCE A;  3VR5 A;  4XIG S;  1ENF A;  4RGT A;  3KBG A;  3A8I E;  1NCV A;  5ELB A;  5CC4 A;  2AWN A;  1F2L A;  5EKL A;  3ITP A;  1TR5 A;  4ZUJ A;  1OO9 B;  2BDN A;  3OW7 A;  1DXM A;  1A15 A;  4QF4 A;  5KEE A;  1C4Q A;  2LS0 1;  3E0J A;  3QWN A;  2IPK D;  1QB5 D;  1Q12 A;  4K6D A;  2N88 A;  1PTO B;  1H9K A;  1CZW A;  3CKI B;  2EY6 A;  3BS1 A;  1CK1 A;  5DNF A;  1EIH A;  4A3B B;  1DM0 B;  4FF2 A;  4GZY C;  2E74 C;  1TWG B;  1C48 A;  2VNU D;  1EY7 A;  3PUZ A;  3TZU A;  1V1O A;  2OEO A;  4KY7 A;  5KNC A;  1GJX A;  4HMJ A;  2F0M A;  4NDX A;  5E3F A;  3OMC A;  4XYO A;  4DAP A;  4ME5 A;  4KHZ A;  4A3E B;  1UAP A;  4KD4 A;  4CHT B;  1LT4 D;  4ULL A;  4HCS A;  2IW3 A;  2HCC A;  1PTO C;  4WJW A;  4B9W A;  2B8G A;  1NSN S;  3OWE B;  4H7B A;  3S14 B;  3K57 A;  1SXT A;  3HOU B;  4CKE A;  4H44 C;  3MHB A;  4OGQ C;  4L63 B;  1PTO D;  3LWU A;  2AWO A;  1O7Z A;  1RF2 D;  3GTP B;  4IFD J;  1EOT A;  1SYD A;  3MVV A;  3GTQ B;  5C44 B;  1SDF A;  3NQT A;  2J4X A;  2NB0 A;  4N9T A;  1HA6 A;  3P75 A;  4Q0F A;  5F2D A;  2WKC A;  1SYC A;  2Z8L A;  1IYV A;  1OXT A;  3R8B A;  3DEO A;  3NQI A;  1D5M C;  4K2L A;  1DOL A;  2Z4I A;  3T4A C;  1VF7 A;  3WDN A;  3S2D B;  2DNE A;  4B9X A;  1R9T B;  1AZQ A;  1ROD A;  3X3N A;  3VA7 A;  1EY0 A;  2PW5 A;  2F0V A;  1EYC A;  3H0G B;  2NN6 I;  3NTI A;  5M5W B;  3OIQ A;  4U67 3;  1JB3 A;  3BVM A;  1STH A;  3OIP A;  2JEA I;  4CJ1 B;  2A74 C;  1IKL A;  3MA2 B;  2EXZ A;  1Y8N B;  4IN3 A;  1CHQ D;  3IAY A;  5BN4 A;  1NR2 A;  2XWJ B;  1JOO A;  3R2I A;  3MC0 B;  5FO9 B;  2O4X A;  2F0J A;  3GTL B;  4EQP A;  2B63 B;  2B2U C;  3MXG A;  2B2V C;  1RTO A;  1E2Z A;  5M5X B;  3S15 B;  3GQB A;  2VXW A;  4K6L A;  3MWY W;  2WII B;  3ZYY X;  3V2T A;  2SOB A;  2IX1 A;  4DAY A;  1WTW A;  1M4V A;  3L9A X;  3WOF A;  2F0T A;  4LAA A;  2RKS A;  3G7L A;  5I9P A;  1OXV A;  1HA5 A;  4PMB A;  2PO4 A;  5C4X B;  3EVQ A;  4PMC A;  2L1B A;  3WOE A;  3DMU A;  1UUP A;  4XT1 B;  1CQV A;  1HPC A;  1O80 A;  1Z47 A;  4TQU S;  2K6A A;  4C56 C;  3PUX A;  1TQO A;  4NMZ A;  3AB9 A;  3K59 A;  4C3I G;  1SBB B;  1LTS D;  1JIC A;  4J6H A;  2DY8 A;  4RWS C;  3KBX A;  3MEH A;  4K8I A;  5IGG A;  5CV4 A;  1I6V C;  3BDO A;  2NTT A;  4XT3 B;  4OHJ A;  1SE2 A;  1SE3 A;  3NSW A;  2BOS A;  4L8J A;  4WFN 3;  4G4K A;  4G7H C;  3EFX D;  1RKN A;  2EYO A;  4OO1 H;  5FLX E;  4PV1 C;  3HEJ A;  1EEI D;  1ZKO A;  1CA6 A;  1ET6 A;  4LJZ C;  1D5Z C;  1IW7 C;  1PZI D;  1Q90 A;  2EVB A;  3A7A B;  3NBH A;  3PV0 A;  4ZKC B;  2KA7 A;  1IW7 D;  2F0I A;  1JR0 D;  1X3Q A;  1HHV A;  4FVM A;  1WD0 A;  5IGC A;  3M7N A;  1ZYR C;  3FKI B;  3PUW A;  1OXU A;  1T5X D;  1LT5 D;  2F0O A;  2PZU A;  3EA6 A;  1VCI A;  4O42 A;  3DXJ C;  4DFA A;  4CJ2 C;  4F7X A;  1ZYR D;  1S5C D;  4C3I B;  1VMC A;  5JVH 3;  3S1R B;  1B4O A;  1GUT A;  3NWS A;  5DM7 3;  4IFD H;  4HED A;  1V1P B;  1TVX A;  3D6C A;  1EU4 A;  1QCB D;  4WRD A;  4DNT B;  5EKI A;  4OIK A;  4C3J G;  4M8A A;  1GUW A;  2DN8 A;  1PFB A;  2TMP A;  4IUR A;  2WIN B;  1ONL A;  4FO2 A;  2SNS A;  4DNR B;  3I73 A;  1IYU A;  3FEW X;  4K5X A;  3C1E A;  3IKJ A;  1DZ1 A;  5IT9 L;  1AFP A;  1K83 B;  4O1N A;  2XIW A;  5IGB A;  3D4R A;  4ABN A;  2F4I A;  1IL8 A;  1D6E C;  4XDX A;  3Q0A A;  5EPJ A;  3VR6 A;  4I65 A;  2FFK B;  2KHS A;  3DM1 A;  1X3P A;  4KV6 A;  4HAE A;  2IL8 A;  4KY5 A;  4Q5V A;  1F9S A;  2B39 A;  4RAU C;  5E4X A;  5ELC A;  1U4M A;  4KN7 C;  5DM6 3;  1CM9 A;  3OHX C;  1GHK A;  2K04 A;  5COR A;  1ILP A;  3RZD B;  3QIA A;  3MXP A;  2B2T C;  4CKB A;  2WAQ B;  1D1K A;  3MXU A;  1EEF D;  2NYZ D;  3LNN A;  5IGD A;  2RSN A;  5CV6 A;  3TBI B;  4RFB A;  3H09 A;  3S17 B;  3GV6 A;  4Z9C B;  1A3T A;  5M5Y B;  2JYO A;  1A3V A;  1B9M A;  4C3J B;  3TZD A;  1A6X A;  1TWF B;  5FK9 C;  1TKW B;  1QNU A;  4XYQ A;  2EDG A;  4G7Z C;  1JCK B;  3DWP A;  1K8M A;  1Q8I A;  1VF5 C;  2CW0 C;  4QCL A;  2A69 D;  3VYS A;  2MP1 A;  1KDB A;  5C5M A;  1FGB D;  4JK1 C;  3SE0 A;  4EVO A;  2XVS A;  2CW0 D;  3GTM B;  2EY5 A;  4FYD A;  5FLX L;  5C0X G;  3L7Z C;  2L9H A;  3K5N A;  3DWQ A;  3M7G A;  4NKL A;  3TSS A;  1Y8O B;  1SNM A;  2YU9 B;  5IGF A;  1BF4 A;  5CYU A;  3N6R A;  3D6W A;  2NVT B;  3GD7 A;  2E2H B;  4AYB B;  1GUS A;  1DOM A;  4V0B A;  5JAV A;  3SVM A;  1PDQ A;  1JOQ A;  5T1G A;  1ICW A;  1D1I A;  4EQO A;  2F0H A;  3BYT B;  2EYJ A;  3KF8 A;  3IL8 A;  3NP8 A;  1H9R A;  3J7A F;  1PLF A;  3HZX A;  2HDM A;  4R9W A;  4IFD I;  2HQE A;  1STG A;  2R7Z B;  5EQ0 A;  2IWH A;  4A3F B;  1B2T A;  4XTC S;  3T56 B;  4FXD A;  1G2S A;  2M00 A;  3PO3 B;  4DAV A;  2LMC B;  1WTO A;  3I3C A;  2B2Y A;  3KK7 A;  4DGZ A;  1I4R A;  2EYP A;  5CMD A;  2A5H A;  4MN3 A;  3SK6 A;  4RKB A;  3A7L A;  5D3D A;  4KI0 A;  4A3M B;  5I4D A;  1MGS A;  5C0X J;  4B08 A;  1XYI A;  5E1F A;  3OSO A;  3DUZ A;  5C3E B;  5CBE E;  1HTP A;  2XSC A;  3L3O C;  1TS2 A;  5JEA G;  2IX0 A;  4RCN A;  4FF1 A;  3I4N B;  3MFY A;  3TP5 A;  3MTS A;  2WKD A;  1G91 A;  3IFT A;  4MHE A;  3TP6 A;  5K36 G;  3GTO B;  5M3M B;  1A2T A;  5D65 A;  4ID6 A;  2HDL A;  2D9U A;  2ZXO A;  4L6T B;  1E2V A;  2HCI A;  4PMW A;  1Z7T A;  4M1U B;  1STN A;  4J8Q A;  1UNS A;  3W3A A;  2LKV A;  2PZT A;  3QO2 A;  5TSS A;  1SAP A;  2E2I B;  2KUM A;  3J80 L;  2VUM B;  3HP3 A;  2F0N A;  2QKI C;  3A8K E;  1HXY D;  2K5D A;  3EJI A;  2Y0S B;  3S1N B;  2XWB B;  4C1N I;  3S2H B;  3A8J E;  1ESR A;  4DN4 M;  1LTR D;  3C1F A;  1B3A A;  3C2P A;  1O7Y A;  3I91 A;  1U9R A;  2JE6 I;  1TWA B;  2RBM A;  3URY A;  5EKK A;  1HQR D;  1MI2 A;  3KLS X;  1QJO A;  5KND A;  1SJH D;  1STB A;  2F3V A;  3Q6S A;  4C1N K;  5C3W A;  1OXS C;  2EPB A;  1SJE D;  1BCP B;  2Q8R E;  2R93 B;  2C9O A;  5I2Y A;  1U4P A;  1BNZ A;  3P1H A;  1E0B A;  5IOC A;  3D4D A;  2EJG C;  1EFI D;  1KDA A;  2RA4 A;  1I6H B;  1YNN C;  1S5E D;  1EU3 A;  4TKO B;  3P20 A;  2L12 A;  2EE1 A;  1QIL A;  5J39 A;  5JEA J;  1HQM C;  4HSV A;  3FPP A;  2A6E C;  1LTI D;  5ELE A;  1YNN D;  1WTP A;  2XRQ D;  4K14 A;  2B2W C;  4R8I A;  2PNR C;  1EYA A;  2NZ1 D;  3CHB D;  5G3L F;  2EYH A;  1LO5 D;  2K5Q A;  2L5T A;  2AQ1 B;  5LHY 1;  1S5F D;  2A6E D;  4EQN A;  1XX8 A;  1B50 A;  2CVR A;  1HUM A;  5CBA E;  2RQX A;  5CV5 A;  2KEE A;  2O5I C;  4H0L C;  1UEA B;  3SXH A;  4OL7 A;  1OXX K;  4KD3 A;  5BN3 A;  4A3I B;  2E76 C;  3R2T A;  1NAP A;  4WOR A;  2XN9 C;  1TU2 B;  1MSH A;  3LX0 A;  1MBY A;  3MAQ A;  1CI3 M;  1BCP F;  2BA0 A;  2R3Z A;  2OF1 A;  2D5D A;  1HUN A;  1ILQ A;  1H9S A;  5CGK A;  3VYU A;  2MPM A;  3T53 B;  4KTA A;  2F0L A;  1EZ6 A;  3J7A V;  1BXT A;  4NP5 A;  1F2Z A;  4R8N A;  1D2B A;  1LTG D;  2NN6 G;  2MJ8 A;  2RDG A;  5DAU A;  1SYB A;  2ZXR A;  1RHP A;  1KTK A;  4XXE A;  4BA2 I;  3VYT A;  4HSP A;  2IT1 A;  3ONA B;  2KOL A;  1CQF A;  4BY7 B;  1CT1 D;  1RTN A;  4ILW A;  2SEB D;  1J8I A;  1QG7 A;  2A68 C;  1SMY C;  4KK7 A;  3NPP A;  3ERO A;  3C3L A;  2NWG A;  1AN8 A;  1MD2 D;  2A68 D;  1SMY D;  3NTK A;  2KJX A;  4YIJ A;  4ODG A;  2BA1 A;  2HUG A;  1L0X B;  3X3M A;  5EBC A;  3W2D A;  1PTO H;  3IFD A;  2F3W A;  2R6G A;  1XTC D;  2JA7 B;  3S9W A;  1KAA A;  5CV9 A;  1O78 A;  2PYK A;  3FRP B;  1SNQ A;  3T16 A;  2F0D A;  3NUC A;  1TS5 A;  5KNB A;  1PMR A;  2FJ2 A;  1CTM A;  2PZW A;  2KCN A;  3MXN A;  2NUC A;  2O5J C;  3D4W A;  2ENB A;  1KLG D;  1QWY A;  4FF4 A;  2K32 A;  3J81 E;  4F8M A;  2EYL A;  4ZRZ A;  1EQT A;  5I9O A;  4DK1 A;  4RHS A;  4CGY B;  2B2U A;  1AP0 A;  2PQE A;  2B2V A;  1SNP A;  1TWC B;  1RDP D;  3QG1 A;  5BN5 A;  3HKZ B;  1F9Q A;  2AQ2 B;  3BVZ A;  3GTJ B;  1F2Y A;  4FF3 A;  3HRZ C;  2NVY B;  3GTG B;  1DON A;  4QUF A;  5D14 A;  2JXM B;  5FO8 B;  2FHT A;  2KCC A;  5C4Z A;  2K01 A;  4A93 B;  3M3Y B;  3HOY B;  1WTR A;  3D31 A;  2Q8I B;  3FVQ A;  1U4R A;  1GUO A;  2LFN A;  4CJ0 B;  4RA8 A;  3Q22 A;  1Z6H A;  1G2T A;  3G6J B;  1RJT A;  3HGB A;  1V8Q A;  4HMI A;  3UI2 A;  3R93 A;  1SYE A;  5ELF A;  1K8O A;  2F0W A;  5LL6 X;  5EBD A;  1EQV A;  1SNC A;  3AMU A;  5CV7 A;  4KKT A;  3QB3 A;  5HGT A;  1WCM B;  3HOZ B;  5I2X A;  1JE4 A;  1LLR D;  5KYL A;  2JA8 B;  1LAB A;  3E5S A;  3K5M A;  3F2U A;  1JWM D;  5ELD A;  2A69 C;  4BBR B;  1S4Z A;  5KGU A;  1EWC A;  2F0U A;  4C3H G;  3NK9 A;  4ZLT F;  2TSS A;  5IGE A;  3I8Z A;  2F1M A;  4S3S A;  1NR4 A;  3GO5 A;  5I6Y A;  2K28 A;  2L55 A;  1JWU D;  2D2C C;  3Q24 A;  4XQQ A;  4FP5 D;  1CA5 A;  1CHP D;  2G9D A;  3VR4 A;  4HN7 A;  1C8C A;  4DXF A;  4K2K A;  2AQ3 B;  3H94 A;  2NVX B;  2QIL A;  1PXU A;  5T1I A;  2E2D C;  2IJ0 A;  4LK1 C;  5IOD A;  3HS0 C;  4QIW B;  1QNK A;  2ZT9 C;  4DF7 A;  2J7Z A;  2PPB C;  2YYZ A;  4TRD A;  4NW2 A;  1NUC A;  4F88 A;  2JP1 A;  4KHV A;  5EGT A;  1V43 A;  1STE A;  1DJR D;  5A2Q E;  1G8Z D;  2F0F A;  1VDZ A;  3BG3 A;  4DXG A;  5C4J B;  3U9O A;  3GTK B;  3H3V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...