2OT2A

Solution structure of hypc
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
b'MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVINEAEARDTLDALQNMFDVEPDVGALLYGEEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase isoenzymes formation protein hypC
publication title Solution structure of Escherichia coli HypC
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Chaperone
total genus 24
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01455 HupF_HypC HupF/HypC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ot2A01
3VYUA 3VYTA 3D3RA 3VYRA 2OT2A 2Z1CA 3VYSA
chains in the Genus database with same CATH superfamily
2ZXRA 3I4MB 4RKBA 1GHKA 3PUYA 1EY6A 1EYAA 3CPFA 2K52A 1IYVA 1AH9A 1RJTA 3EBEA 4O42A 1FNVA 1NR4A 1XMQQ 1Q81C 2KA7A 4Y7NB 5IOCA 2R3ZA 1QVFA 1R9TH 1PXUA 3WOEA 3H0GH 3I4NG 2B2YA 1D1IA 2GVAA 3MXNB 5EKLA 4FYDA 4A3KH 1TWCH 4DR7L 1VQ8A 1STNA 2ZTCA 4B9WA 1CQVA 4E6IA 4AYBB 5EPKA 3D4RA 3AEVA 3BZDB 2AQ3B 3FPPA 3W3AA 5C4XB 5CMDA 2K28A 5C3EH 3RZOB 4JV5L 2N3SA 1Z47A 1N33Q 2E2JH 5T1GA 2Z8LA 4B3RQ 2G9DA 1HA6A 4ABNA 3KJPA 2EYJA 3S16H 1PZJD 4A3LG 3U9SA 3P20A 3S17H 1NBWA 3TSSA 4X64L 1HFGA 1X3FA 2Z4IA 1AEXA 2LXKA 3BYTB 1F2MA 2SDFA 4HIMA 4HMJA 4PQXA 2RSOA 2EE1A 3S2HB 3K8AA 5JAVA 2Q8RE 4AIMA 1SYEA 5I2XA 2NVQH 4HJAA 1JJ2A 2A6ED 4A3EH 4A3JB 3TZUA 1KC8C 5KEEA 1Q3LA 5I9OA 1Y8PB 2CH4W 4TKOB 5A2QL 4BY1G 5CBAE 3H3VH 4N8X1 3J81c 1FR3A 3HKZB 4IPGA 2Y0SE 4LFBL 2K03A 3D6WA 4DNRB 4DN4M 1I4XA 3P75A 3T16A 1LO5D 1QE6A 4C3IG 4ZLTF 4K2KA 4BY7B 2K5HA 2VS1A 1TWGB 1B1ZA 4A4IA 4GLXA 2NVXB 4XQQA 1PH3A 2VB2X 2QF7A 3UDFA 4L5RC 5IYCH 4EVOA 3ERSX 2H5XA 2LXJA 4HIDA 3Q23A 3CCEA 4DR6Q 2R7ZB 1EWCA 5BR8L 2CWPA 2ICIA 2QKIC 4A93H 1LTTD 4IURA 5BN5A 1WTRA 3SEBA 3S1NB 2TSSA 1DOLA 3K0YA 3CD6A 4QCLA 1K0SA 5DM73 3PUVA 4KI0A 2RVLA 2ZXOA 3C46A 3L9AX 3EROA 1SNPA 3F8TA 5C4XG 4R1JA 4JK1C 4MNOA 1G8ZD 4X66L 3CPWA 3VR4A 4B3ML 1RDPD 2CQAA 3GTPB 1YNND 3NTKA 4KV6A 2MUYA 1I4HA 3I73A 3RMHA 3DWAA 3I72A 4KMUC 1PH2A 1EQRA 1HZAA 3M4PA 4JI2L 3F2CA 2IY5B 3PSIA 1XMOL 3RLNA 2DN8A 2NZ1D 4DAYB 1W6KA 2AQ2B 1IBKQ 2JA6H 2WAQG 3NQIA 1L1OA 3MEFA 1HZ9A 2IX1A 2WFWA 4YWKA 1EY4A 4C3HB 1WTPA 4L6TB 2NTSA 4DR3L 4B3SQ 4GLVB 2P5ZX 4R4TA 1TS2A 1E3PA 2YU9H 2EPBA 5T1IA 2B8FA 4LFAL 3K7UC 2RDFA 4H13C 2WB1B 1AW7A 1U9RA 4G7ZC 4BBSB 1HR0L 1JR0D 2JE6I 3K0XA 1SSOA 3T1HL 3IFTA 5J22A 4XQNA 1VQEA 3SK5A 5FLMH 3NEMA 2EIFA 2ES2A 1SYDA 1S72A 3J7ZC 1HFNA 3PO3H 3FRPB 3HOWB 4NDXA 3Q22A 1BCPC 4L8JA 1GOZA 4DUYQ 3EJIA 1BNZA 3X3MA 3G48A 4DV2L 1Q8IA 4JOIC 1JE5A 3ND9A 3BDLA 1IL2A 3L0OA 1VQDA 2Q2UA 1B8AA 2R7DA 3BG3A 1M1KC 4IFDJ 1WCMB 4O2DA 4DNTB 1LTSD 2CH4A 3CCJA 2K05A 1UE5A 1K0RA 3EVQA 2VZAA 1CKMA 2O4XA 2GN5A 2NBFA 1K83H 3NK9A 2WACA 5C3EB 4LF9L 4ZCKA 1U0LA 1E2ZA 2RDGA 1JJCB 3CHBD 1RODA 2F0WA 2F0MA 3H09A 1UNSA 2XIWA 1QVCA 2I07B 4LF7Q 2K01A 4DAVA 1N36L 3QB3A 4WJWA 1II3A 3K81C 4BBRH 3LWEA 1TY0A 1JWMD 2HDMA 1SLJA 5CR3A 1RF2D 4RAUC 1WTWA 2IT1A 4JC0A 1LTLA 3HOVH 4A3DG 4LJZC 3SGIA 1D5XC 4P74A 1XNRQ 2VB3X 2NB0A 3N52A 4RGOS 3W1BA 2UUAL 4ODGA 1TKWB 1F2YA 3A54A 1I6HH 4JI5Q 3PGZA 1X32A 1CKNB 1JB3A 3D0FA 2H1EA 2NVYH 4C3JH 2EYFA 1MBYA 1X9NA 5LMNW 1HUNA 1EQVA 3NENA 2L15A 1Q7YC 2R93H 5M5YH 1Q1EA 4A3GB 3OTOL 2L12A 5G3LF 2NWGA 1JB7A 4CJ1B 1SNOA 2MJ8A 2JA8B 3H0GG 4RWSC 2NVTH 4QIWE 3VYUA 4FO2A 5C5MA 1EIGA 2TMPA 4QMGA 4DR4Q 4X65L 1ILPA 4A3KG 1CTMA 4IPHA 3STBC 3S14B 1LT5D 4V190 1B2TA 3TEHB 1SE4A 4HN7A 2Q2IA 1LTID 1NMGA 2A8VA 2SOBA 2XSCA 4X3SA 5FKAC 5IT9E 2XWJB 1SJHD 4TSSA 2K5NA 4AQYQ 2XWBB 4IUVA 2UXDL 4FVMA 3BJUA 1E2VA 1O80A 2L5TA 4JI8L 4CKBA 1FYCA 4CDDC 5I2YA 1CSPA 2A6HD 4FDBA 3BU2A 4PV1C 2FFKB 5I6WA 2N55A 1ML0D 3U50C 2WKCA 4K8IA 4NP5A 5LMNQ 1O78A 3CC2A 1H9SB 4QJFA 4DV0Q 3OYYA 4A76A 2VQEQ 3SR1A 3CCUA 4NXML 3HG9A 3I4NH 2K1BA 1HNZQ 1F9PA 4DK1A 3WWVA 1AZQA 2VUMH 2PI2E 2F0EA 3T1YQ 1KHIA 4A3EG 1GO3E 1B44D 1VDZA 1G51A 3J7AF 3NHHA 5C6AA 4DUZQ 2QDBA 3U4VA 1DXMA 2ZTEA 1SNCA 5M3FB 1V1QA 4A3MB 3BVMA 4BA2I 2WINB 1BR9A 2BDNA 4IN3A 1SNDA 4LF5L 4OX9Q 3BZCA 1KTKA 1LLRD 3A5UA 3PO3B 5IYCG 1QOHA 3AU7A 2RQXA 1MD2D 4K0KQ 1H95A 2VNUD 1HNXQ 4UY8C 4JW0A 1XTDA 2OT2A 5C44B 4KHPL 4BXXH 4XYQA 4A93G 1GXDC 2EYPA 5JVG3 2JA9A 2ICEC 4QGUA 2JXMB 3E3XA 1STYA 2RDHA 2EJMA 5ELDA 5HGQA 1V1PB 2EJGC 3RN2A 1VQ7A 5K5PA 3H91A 3C1EA 3M4QA 1ICFB 4XXEA 2SNMA 3TREA 5FO8B 2JJQA 1CA5A 4POFA 1PFNA 3IRBA 1SR3A 2F0HA 1KDBA 3RUZA 1XNQQ 1PTOB 1KLUD 1X3QA 1ZYRC 4DV1Q 1K8OA 2O5IC 4HJ5A 4R4QA 1WVLA 5TSSA 2J0TD 1M90C 1EY9A 4JI7L 2IL8A 2UUBQ 2XGTA 4JBJA 5IGEA 4UAIA 1KAAA 1A62A 1NE3A 2JA6G 2OXPA 3TN2A 3NBIA 4JI0L 2K4KA 4ZUJA 1VQ5A 3W1GA 2QCPX 2DGYA 1I94L 2PZWA 1STBA 1IKMA 2D62A 3S1RB 1PYBA 3KF6B 4LK1C 5D14A 1LTAD 4J8QA 4ZQ3A 3MXNA 1C4QA 4HSVA 3CXCA 1PTOF 2HCIA 1QZGA 1F9SA 3HOUH 4K5WA 1ZEQX 1XWEA 2L55A 2DNCA 1EYDA 2RSNA 3GTQH 1YNXA 3J7AV 4U68A 5K36H 2ZJPA 1EYGA 2HIXA 5E3FA 5FLMG 1EL0A 2KBNA 3ULLA 1NUCA 1TVXA 1SMXA 1LT6D 4B3TQ 3URYA 2KUMA 4TVAB 3JAMi 1DZ1A 1JCKB 1YZ6A 2EDGA 3G7LA 4KKUA 1SFOH 2PCFB 1KAWA 4IUQA 1DOMA 1OXUA 3FEWX 3M85A 4KJOA 3NWTA 3VDYA 3QR8A 1IZ6A 2AQ1B 3HOYH 1PA6A 3M4OH 2JA7B 2F0TA 3FPUB 2UU9L 1OTCA 4GKKQ 1S3OA 2KJXA 4UP9A 1XMQL 4A3BB 2DY7A 4CBVA 4EX5A 3RNUA 3J81E 4N9PA 4LUOA 4PG3A 1FVIA 3GTLH 5F2DA 1JJGA 4CJ0B 2ATWA 5KYLA 4DGZA 3DWPA 3HOZH 1XPOA 3SK6A 4NXNQ 4DAPA 1I6VC 4DV3Q 1JQYD 4CDFC 1HZBA 4BBRG 2Y0SB 3K7AB 4MN3A 1EEID 3KBGA 5EBDA 2L1BA 1N33L 1S5CD 3I4NB 1PYWD 2YTXA 4B3RL 3A7AB 3TZDA 1GD7A 5KGUA 3HOVG 1PDQA 4M8AA 3J81L 1EIYB 1GUNA 3ERQA 1RD9D 2CWAA 3I4LA 1SJED 4A3FH 2RA4A 1PH8A 2Z6KA 1PH1A 3H3VC 4C3JG 2CKZB 1EIFA 1Q12A 1VQFA 2XRSD 3AFQA 3VR5A 1TWAH 2HQLA 2MO1A 1HA5A 2R93G 5EGTA 4KN4C 1BXTA 1BUVT 3VA7A 4JI4Q 3L7ZC 1LTBD 2J7ZA 4DAYA 1AFPA 1B3QA 1I50H 4CGYB 4J1MA 3DLLA 1J8IA 1M8AA 1DYQA 4GN5A 4C2MB 1D7QA 3CRKC 1K73C 4A3IH 3T13A 3EFXD 4HMIA 1MJEA 1SNQA 4XDXA 4IUPA 1HHVA 1YBYA 2LS01 1MGSA 4KD4A 4BY1B 3GDEA 1K8AC 4OWTB 2I0QA 2IPKD 4DV4Q 2R92H 1Y1VH 2JYOA 1TWFH 3TP5A 4HJ8A 3GTGB 2X69A 3ZYYX 5COYA 3N6RA 2F0GA 4C3IB 4JI1L 3FMCA 1PFBA 1YITA 1AE2A 1ET6A 2BH8A 1GHJA 4X6AH 3KUPA 5LMUQ 4XT1B 4HJ9A 2MNAA 3S15H 2Y0SG 4G7HC 2ZTDA 2ZXPA 2EYHA 3GTOH 3QO2A 3PO2H 1KXLA 2JN4A 2EYMA 2F4IA 2VUMG 3GV6A 2UXBL 1LM0A 2EYLA 5IGGA 2K5DA 3CC7A 2HUGA 2HHHL 4KK7A 2E5LQ 5A2QE 3ULJA 1IBKL 4HIOA 2B2TA 4PMWA 4O1NA 4DF7A 1STAA 3E0EA 3UDGA 3FKIH 4IOCA 1C0AA 3LNNA 1JOOA 1VQKA 4KY7A 2BH2A 4DFAA 4B3SL 1X3PA 4X3TA 5C4HA 2JSOA 1EY5A 3QWNA 5ISRA 2Z4HA 3S24A 3Q0AA 1IL8A 5HURA 3BZKA 3PUZA 2UUCQ 3UE0A 1YHQA 3MWYW 2AWNA 1LT4D 4BXXG 2WAQB 5IGBA 4OIKA 2AKWB 3NWSA 1ILQA 3OWEB 4U673 4JI3L 1GUGA 5FLXE 1DOKA 4HCEA 1E1TA 4RA8A 2B2VC 2PPBC 4KKSA 4LFCQ 3CP0A 1QJOA 2XN9C 3JC66 1CZWA 3HOYB 2NZHA 4RH6A 3M4OB 4MHEA 4EQOA 4S3SA 5C3WA 1BCPD 3MFGA 4BA1I 3PQIA 3KYHC 4YIJA 4L5TA 4O0AA 3E9IA 2KVMA 2SNSA 1CKNA 1J5EQ 1RHPA 1RTOA 4F87A 1TS3A 2QEXA 1STEA 1BKBA 5E7NA 1YHBA 2DUDA 3S2DH 1TWHB 4LUVA 4A75A 1YIJA 5IYDH 5C4ZA 2ZJQA 1VQCA 3R93A 2PQEA 3GV3A 5FLXL 1IBLL 3NTIA 2VQFL 1GVPA 1SBBB 1VQ4A 4DK6C 2D0OA 4F8MA 1G6PA 3HKSA 3B6YA 1QUQA 3HOUG 4YHHL 1VMPA 1FD7D 3R2IA 2F3IA 4HCSA 3SXHA 4YCUA 4DV7Q 4LF7L 3RZDH 4GKJL 1WOCA 4OELB 5K36G 3D4WA 4RGNA 2PYKA 5KNCA 4GLAC 2F0NA 1VQ6A 1KABA 1S5DD 2FHTA 2KCNA 3S1MH 2D2CC 3OW2A 1SXTA 4R4CA 4DKAC 4ME5A 1U4LA 3CF5A 1CUKA 2KHSA 1Y69U 5FO7B 5M5WH 4RGTA 3T56B 1XNRL 3K80C 4YY3L 2F0JA 1K9MC 1MSHA 4KHVA 3KDFB 1I50B 3KK7A 4JI5L 5DAUA 1H9SA 5FK9C 2NN6G 3I3CA 5JJZA 2E76C 3HOYG 3E0JA 1Z9FA 3UDXA 2KENA 4A3DB 4KTAA 4TQUS 1PH5A 5E1FA 2C5CA 4FNFA 4JV5Q 2EY5A 4MTNA 1WFQA 1FNUA 3BYYB 4R9WA 4I65A 5ELNA 4DR4L 1VF7A 3DM3A 3ULPA 1D1KA 1S40A 5M5XH 3STBD 3HOZG 4NMZA 3A5ZB 2Z0SA 4IOAA 3GO5A 1LV9A 4FXGC 1R9TB 1MIUA 1N34Q 1NSNS 1KL9A 2F3WA 3H94A 3H0GB 5FJ8H 5JPNC 4DV6L 4AQYL 1B53A 2K14A 5E4XA 3SE0A 2JEAI 4N9TA 1NTGA 3HGBA 4A3KB 3ND8A 1TWCB 2QILA 1RCVD 5HGTA 1EQQA 5C4JH 4FXKC 1WTXA 1BO0A 4HTHA 1V1PA 3AQQA 1A2UA 4K6DA 5LMNL 4A3FG 1CZGA 1KRSA 4DV0L 1HUMA 2B63H 1K28A 2OWOA 1EYCA 2PO4A 2VQEL 3GTKH 2E2JB 4GS3A 1HNZL 2E2IH 1FL0A 3M7NA 4DK3C 2B2WC 3T1YL 3M3YH 3S16B 4Q5VA 4IFDI 4JVZA 1VF5C 1WD0A 1U5KA 3TMEA 1CHPD 3S17B 1STHA 4CDEC 5M3MH 1TIID 1F9QA 1PVOA 2GA4B 4DUZL 1QB5D 2I46A 2A68C 1BQQT 3J7A5 2E8GA 3BDCA 4OWWB 5FLXc 4A3IG 5J3BA 3KF8A 4JPBW 3KLSX 4I7AA 2NVQB 2VW9A 3KF6A 5EBCA 3MXPA 4A3EB 2K32A 3F2DA 1XTCD 1VQLA 1GM5A 4KLKA 5CV5A 4GOPB 4K0KL 5JJKA 1YJNA 1HNXL 1SMYC 3I4OA 2R92G 1Y1VG 4N8FA 2MQHA 1EWHA 1VQHA 5IWAQ 4GNXB 4XTCS 5LHY1 1X3EA 5CV4A 2BA0A 5D3IB 3V96A 2PZUA 4F7XA 1HXYD 1HH2P 2ALYB 2NUCA 3EQLC 3IL8A 4Y52H 3MAQA 1WTVA 1YJWA 1HTPA 2B3GA 3CW2C 2PNRC 3DMUA 1QVGA 2AMCB 2DJFC 5CV8A 3T51B 3NXWA 1WTQA 1T9HA 3U58A 3PO2G 4A93B 1XNQL 4DV1L 4GZYC 3H15A 1QUQB 2A73B 3MXGA 1ZYRD 3E5SA 3P7JA 3I8ZA 2IWHA 1B70B 1ENCA 3CCLA 3OWFA 5M9OA 2UUBL 2PMZE 3D8GA 5CGKA 5IODA 3SK8A 3FKIG 3OMCA 3T1HQ 1TS4A 4DR2L 1CKOA 2B2UC 2M2LA 2ZM6Q 2UXCQ 1IBMQ 1X6OA 3PF5A 5C0XJ 4KHZA 3T4AC 2FINB 4DXGA 3FHWA 2OQ0A 3DEOA 3KOJA 4IPCA 1Q82C 2JA6B 5JPMC 1EOVA 4DV5Q 1PYSB 1DM0B 5ELCA 5CV6A 2A19A 3LX0A 2F3VA 3KLSA 2WV6D 1E2WA 3UI2A 4APVA 4HJ7A 3MA2B 3X3NA 2YU9B 4LF6L 3GTMH 4DU9A 1L2FA 1BF4A 3FP9A 1BBXC 4IUUA 2K7VA 2RBMA 2YTVA 4ZRZA 4LF9Q 3PV0A 2FXQA 1IW7C 1CA6A 2A5HA 3E9HA 4FXDA 3OSOA 1LTGD 1PHJA 1N36Q 5M5XB 4BWGB 3DHQA 5IYDG 4GKKL 1N8RC 3RD4A 1I4GA 2FMCA 4J15A 2YYZA 1OXVA 4GN4B 3K57A 4K8JA 5J39A 4IQZA 4P71A 4IUTA 2VXWA 1AP0A 2AUKA 4KN7C 5GAHC 1YEZA 2ZT9C 3VR2A 2BE5C 3TP8A 1FGUA 2CCZA 4QUCA 5C0XH 1K83B 4DV3L 1FGBD 3Q8DA 3GTKB 5EKKA 5C5LA 4K5XA 1V8QA 4PZ8A 3OTOQ 2B39A 4OWXB 3HRZC 1VQGA 5J1ZA 4UP7A 2ID0A 2ENBA 1KNAA 1Y8NB 3K5MA 4KKTA 5CV9A 1PFMA 1CSQA 3QIAA 3KF8B 4WORA 1D2BA 4BBRB 1YI2A 4GN3B 1QZHA 1E24A 2QA4A 2A74C 3I4MH 4X65Q 2F0IA 2HQEA 3OIQA 4YCVA 1VQPA 2LKVA 1ICWA 1D5ZC 3VYSA 3D3RA 3JAME 2A1AA 5IYBH 4QUFA 1AN8A 3HOVB 3NPPA 3J80E 4DR1L 4Y7NH 1P16A 1LT3D 2F0KA 1VQJA 1R4PB 4JI4L 1I6HB 1CI3M 2A69C 1Y1WG 4LF4Q 1UE7A 2IHEA 1QILA 3MHBA 2NVYB 1LYLA 1TXYA 4C3JB 2F0QA 1PH4A 5CORA 5AJ3Q 1JORA 1TS5A 2R93B 1EQTA 5M5YB 3I7FA 5ELBA 2YTYA 1MJCA 3A8JE 4CKCA 2K50A 2RCFA 3OW7A 1WJJA 3RZOH 1VQOA 3S9WA 4JI6Q 4NXMQ 4OO1H 1Q46A 3K59A 2NVTB 2KEEA 5FJ8G 1VCIA 2F0DA 1HNWQ 4X62Q 1N32Q 2IHFA 2NN6H 1RKNA 5I9PA 3JAML 1Q90A 3A0JA 3J80L 1SE2A 2X6LA 5LMUL 3NBHB 3LWUA 2MGSA 3CCMA 4HIKA 3CCQA 4WJ3M 2B63G 1ZXTA 1NJIC 2B2YC 3BVZA 5JEAG 4LF5Q 1BCPB 1I4QA 4A3JH 1XPUA 1UEBA 2RKSA 1K8GA 4UPAA 4CDCC 4R8IA 1K3BC 3HP3A 5M3MG 2E5LL 2XRQD 5JOBA 4I7ZC 5DM63 4MTKA 1W6JA 2OQKA 5CYUA 3DUZA 3NTHA 4BY7H 1B9MA 1TWGH 3CKIB 2NVXH 2VUMB 3TS0A 3KFUA 4KJNA 1MSGA 3TBIB 5KNDA 1OXXK 1BCPF 2R7ZH 2C9OA 1VQIA 3KBXA 3J81i 1VQBA 1MI2A 4HSPA 1Q86C 2PW5A 1XJVA 3S1NH 1PZKD 2L4NA 2IX3A 3DEPA 4L63B 2RHSB 1ESFA 4P2CB 4ZK9B 5ELFA 2LY7A 4LFCL 2AUJD 3QJYA 1SYGA 4FP5D 3GP7A 1F9RA 4RG1A 2Q2TA 1ZKOA 1PRTC 1SDFA 2EXZA 1S4ZA 1MHWC 2I5HA 3UE1A 1IKLA 1RIPA 3KDFA 5GADC 4YWMA 2QW7A 1S5BD 2EVBA 3O13A 2Q8IB 1PH6A 3CCRA 2HD3A 4DR5Q 2K5VA 1FJGQ 3M4YA 1LTRD 3ONAB 3G4SA 3CU7A 5GAEC 4BS9A 1WYDA 3SHLA 3HFZB 4RCNA 1OXTA 4DR6L 2DNEA 4Z9CB 4C3HH 4EGVA 4LMQD 3HS0C 1I5FA 4FF2A 2PW7A 3PMFA 2N49A 2F0OA 2MP1A 1V9PA 1MKHA 1A3VA 2PI2A 1L0YB 4KD3A 1H9JA 2IJ0A 4DPGA 4BBSH 2V4DA 4DV7L 1SYFA 2LFNA 1Q8KA 1WI5A 5IE8A 1P8LA 1CM9A 2F4VQ 3C3LA 4G57A 4IALA 4LF8Q 1UUPA 3HOWH 1NR2A 3JAMc 1IYUA 4JYAQ 2UU9Q 1DD2A 5CBEE 3J80c 3HOUB 1FNWA 1IHZA 3H3VI 1U4RA 3GTQB 1YJ9A 1XXGA 1L1OC 3PUXA 5JJLA 3J81j 2FJ2A 1WCMH 3MEHA 1IXRA 1T5EA 1STGA 5DNFA 3QG1A 2Z6BA 2N8NA 1VS0A 5EPLA 2K5QA 3Q6SA 1W2BA 5A35A 1EU3A 1SFOB 1D8LA 3CQZH 3V05A 1JE4A 3C2PA 3A74A 3TP6A 2JEBI 1GKHA 1WD1A 1SEBD 2NZOA 2K5WA 1PZID 4K5VA 3PIO3 1JMCA 1T5XD 3PIP3 4B9XA 2E2DC 4K2LA 1TT2A 1GUSA 4OL7A 4RKLA 4DUYL 5C0XG 1Y14B 2EZVA 4IUNA 3D31A 4GOPA 1PH7A 2DY8A 5DEHA 1N34L 1F2ZA 3A7LA 2OF1A 3DXJC 3GTLB 3HOXH 3J7YW 2CW0C 3RLOA 1B50A 2RCNA 2HIVA 1SRUA 3TS2A 5IGCA 1HJPA 2EY6A 4GNXA 3GD7A 2Z1CA 3CAMA 4P73A 4DNIA 1C9OA 3HOZB 2F0LA 1SYBA 2MFIA 5CC4A 4LNQA 1A0IA 2KEDA 2MHVA 1EZ8A 5IY0A 4X3UA 3I56A 3PCOB 3I4MG 1F77A 4R8NA 3UDIA 1HPCA 4A3CH 2B29A 3NQTA 1PTOC 2C35B 4A3GH 3TRZA 3K58A 3RN5A 5GAGC 4ID6A 4PZ6A 5IYBG 3KLWA 2L9HA 2CQOA 1S5ED 1ASYA 2GVBA 4PNYA 1TU2B 1O7IA 2JA8H 4C1NK 4LW1A 4AH6A 4A3FB 5IP7H 3DM1A 2F52A 2B8GA 4QIWB 1X54A 4JI1Q 4JBWA 3NE5B 2X6GA 1BBUA 2A68D 1U4MA 2JA5H 3S14H 1TQOA 1TWAB 3W2DA 3WDNA 2EOTA 4AYBG 1VQNA 2Q8TA 5IIFA 2JP1A 2PMZB 3W5OA 2R61A 2O2LD 2NTTA 1EY0A 4OO1G 3ZJYC 5JEAJ 2ASBA 2WP8J 3KJOA 1SMYD 4DR7Q 5IWAL 4A3IB 2UXBQ 3GTJH 1VQ9A 1I4RA 2PQAB 5I6YA 1XYIA 2G5DA 1A8VA 2VY3A 3ITPA 5FO9B 2HHHQ 3LGJA 5IGFA 2CVRA 4FF1A 2XVSA 4PMCA 2YV5A 2BOSA 3U9OA 1JWUD 1Y1WH 2R92B 1Y1VB 1TWFB 3RLFA 1ASZA 3TDQA 2OEOA 3R2TA 5E4WC 4A3JG 2OCEA 3V2TA 2F0FA 4X64Q 4JBMA 2JK8A 4H02A 1NNXA 3HKZG 2F03A 3S15B 4ZUIA 4A3MH 5M3FH 4JI3Q 5BN4A 3QOJA 3GTOB 2CFMA 4BY7G 3PO2B 2MPMA 2A6EC 4H0LC 2B2VA 2ZM6L 1DGSA 2UXCL 4KY6A 4QY7A 1TY2A 1M4VA 1IBML 2XNAC 3PUWA 1J6QA 4AYBE 3VYTA 4OONA 3L2PA 1K3RA 2R7ZG 4DAMA 5EAYA 5C44H 4LFBQ 4F88A 2IX0A 1UWVA 5CV7A 2PZTA 2XTIA 3FKIB 2RF4A 1H9MA 4QB4A 5HY6A 4DV5L 1QG7A 4K6LA 1ONLA 5JEAH 2E2HH 1I3QH 1CK1A 1IYJB 3RR5A 5EPJA 1JICA 3DWQA 3FVQA 1EZ6A 2JQOA 1EY7A 3I55A 1W3SA 3AMUA 3VR6A 2F1MA 3I90A 5BR8Q 4G4KA 3CQZB 2WAQE 4C1NI 1EY8A 1PTOH 2EY1A 2KCCA 1UE1A 3I70A 4OGQC 4RMFA 1IBLQ 2VQFQ 1ESRA 4RHSA 2KOLA 1JWSD 3PF4A 1HR0W 1PLFA 1IW7D 4OX9L 2HT1A 4YHHQ 3CRLC 2EY2A 1HTLD 1PV4A 5LL6X 2I5LX 3K5LA 2HDLA 1SROA 4GKJQ 1YNNC 3Q24A 3HKZE 5D65A 4X66Q 4B3MQ 1VQAA 2K04A 4OHJA 4JBKA 4C3HG 3I2ZA 3S1RH 1HQMC 2I5MX 3E6ZX 4HR7B 1AZPA 3HOXB 3ICEA 3D6CA 3K6OA 4JI2Q 1BDOA 1G291 3G6EA 1G2SA 1B7YB 3A8KE 4PMBA 1XMOQ 1JOQA 3P1HA 3M7GA 3T53B 1PRTB 1H9RA 1SAPA 4P72A 4LUZA 3OHXC 1PH9A 2WB1G 1KLGD 4YY3Q 3S2DB 3K5OA 4L5SA 4BBSG 2BE5D 5KNBA 4ILWA 4J6HA 1QWYA 1D6EC 1EU4A 1V1OA 4DR3Q 5IP9H 1A6XA 1ENAA 4IO9A 2R7FA 4TRDA 4IJHA 1KRTA 3HOWG 4IFDH 1DCZA 4LFAQ 2CHBD 2SEBD 1CT1D 4G7OC 4H7BA 2AHOB 1LUZA 1HR0Q 4RHRA 3RZDB 1PRTF 3GQBA 1CQFA 2DJGC 4NW2A 3NBHA 1WCMG 1RL2A 4QF4A 1EUJA 2BA1A 3CCSA 2JA5B 3S1MB 2F0PA 2JA7H 2EXDA 1E0BA 1CHQD 1E1OA 1SNMA 4JCVE 2ZJRA 4A3BH 1UE6A 4DV2Q 1Z6HA 2IW3A 1VMCA 3G6JB 3EN2A 4JOIA 5IGDA 5M5WB 1YNJD 4HAEA 4IPDA 5C3EG 1O7YA 5C3XA 1LABA 4NKLA 4DV6Q 4LF4L 2A69D 4C56C 4IJLA 2EYOA 1ENFA 3GTJB 2BDOA 5AJ3L 1E22A 4WRDA 3TP7A 3H6MA 4NPSA 4B3TL 1GUWA 2L0CA 2EQSA 4RFBA 3BS1A 1L1OB 2LSSA 2WB1E 1J9OA 1V43A 4JG2A 1X56A 4LAAA 1DONA 1CFMA 1HCZA 3K7AH 5C0XI 5KRUA 4UDUC 4JI6L 5DLQE 1BVSA 1Y1WB 3HEJA 3BVGA 1QNKA 3HOXG 4R4IA 5KYIA 1HNWL 4X62L 1OO9B 2B2WA 1N32L 1KQSA 1LACA 4QL5A 2D0PA 2R6GA 2LMCB 2NYZD 1KNEA 4OXPA 1KDCA 4CHTB 1UAPA 4V0BA 3F2UA 3CC4A 4H44C 3PIOA 5IT9L 1A15A 4ME3A 3PIPA 2OTLA 4DK0A 4EQNA 3EA6A 4FF3A 1WTHA 5ELOA 1JT8A 5KIXA 5EKIA 1D5MC 3G71A 4A3CG 3IAYA 1A63A 4A3GG 1EWIA 3BDOA 4A3LH 3R3OA 2QEJC 5C4JB 2UUAQ 4MIUA 4NXNL 1L0WA 2JA8G 4YWLA 4C2MH 5IP7G 1A3TA 2KHJA 1EFWA 2B63B 1O7LA 1KDAA 3F1ZA 4DA2A 2QGQA 2JA5G 2E2HB 1I3QB 2AWOA 2E2IB 1HRJA 2M9VA 3ER0A 1EIHA 1Z7TA 3M3YB 3S1QH 2K75A 4BY1H 1K8MA 2OTJA 4PZ7A 1WTOA 3A56A 5M3MB 3VA5A 4NB3A 5GQOA 1C48A 3GTGH 3I91A 5NUCA 4OO1I 2N88A 2Z6KC 2VL6A 4C3IH 5FOBB 2NN6I 1BOSA 1EOTA 1G2TA 1YNJC 3AFPA 4LWCA 2WKDA 4CJ2C 5G3LD 2G9HD 1VQMA 3R8BA 4UP8A 1X3GA 2MO0A 4ZKCB 2E74C 4DR2Q 1EFID 5JJIA 2B2UA 1PRTD 2Q2HA 2UXDQ 2F0UA 1C7YA 2A6HC 4XIGS 4JI8Q 1Q1BA 1B9NA 2QDLA 3EIVA 4Q0FA 2FMMA 5JVH3 1XX8A 2M00A 1S5FD 4QQBX 4DR5L 3L3OC 4RGMA 4ZAIA 5C4XH 1FJGL 3WOFA 1NMFA 1OXSC 1AE3A 1A2TA 4DV4L 1KIXA 4A3MG 5M3FG 1UEAB 5I4DA 4WJ4A 1GUOA 3TQYA 2F0SA 5BN3A 2HCCA 3PO3G 2WIIB 3KLRA 2F0VA 4DXFA 4LF6Q 1B4OA 4UHVA 3J80i 5C44G 2D5DA 3HZXA 3K5NA 3S2HH 1RTNA 4XT3B 1TR5A 1YVCA 2KECA 3NSWA 2F4VL 3OPOA 5L37A 4P75A 4LF8L 1H9KA 3VR3A 4EQ5A 4JYAL 1QCBD 2PNHA 4M1UB 3C1FA 1N9WA 3MTSA 2E75C 5EQ0A 2BCOA 1SE8A 4KHPQ 1GJXA 1NCVA 1NY4A 2B2TC 5IT9c 3MVVA 4MZ9A 4ZKBB 2KCTA 2EJFC 4ZYSA 2L11A 1BBWA 2Z9HA 3CCVA 3A8IE 1HZCA 1SYCA 3MXUA 1X65A 4POGA 2RHQB 1O7ZA 3NUCA 1L0XB 3A55A 1TWHH 3IKJA 3GTMB 2K6AA 3VYRA 1SN8A 4XYOA 3AYHB 4OEMB 2UUCL 5ELEA 3SVMA 5AFWA 1JOKA 5D3DA 2KQ3A 1I4PA 5H1SE 1NAPA 3F2BA 1GUTA 1R4QB 3QOLA 2V1CC 3CMAA 2H4OA 2KHIA 5LL6S 4JI7Q 1YHAA 1JC7A 1G6ZA 3M9BA 1HQRD 3NELA 4EQPA 4FF4A 4WFN3 4JI0Q 4ULLA 4R4OA 4B08A 1I94Q 3GTPH 1DJRD 5IP9G 3CMEA 4GOPC 3MFYA 2D9UA 4X3KA 3OMGA 1J5EL 3AB9A 4K14A 1KD1C 1B3AA 1U4PA 3FDTA 4IFDG 1PMRA 2CW0D 4GNXC 2PQAA 4ALPA 1A3UA 1EEFD 4DR1Q 1SE3A 1XPRA 3IFDA 1X55A 3SK4A 3MC0B 4RCOA 3D4DA 1E7ZA 3NP8A 3MZ5A 2KCMA 4YCWA 3OOCA 1PFSA 4HEDA 1ET9A 4IZ8A 4XQJA 1Y8OB 3OIPA 5EJWA 4L5QA 2N78A 2JA7G 2J4XA 1C8CA 4A3DH 1PTOD 1QNUA 4OIJA 1G91A 3S1QB 4A3BG 3U4ZA 4KY5A 1F2LA 3SDZA 2O5JC 5GROA 2K33A 4CKEA
chains in the Genus database with same CATH topology
2ZXRA 3I4MB 4RKBA 1GHKA 3PUYA 1EY6A 1EYAA 1IYVA 1RJTA 4O42A 1FNVA 1NR4A 2KA7A 4Y7NB 5IOCA 2R3ZA 1PXUA 3WOEA 2B2YA 1D1IA 5EKLA 4FYDA 1STNA 4B9WA 1CQVA 4E6IA 4AYBB 5EPKA 3D4RA 3BZDB 2AQ3B 3FPPA 3W3AA 5C4XB 5CMDA 2K28A 3RZOB 1Z47A 5T1GA 2Z8LA 2G9DA 1HA6A 4ABNA 2EYJA 1PZJD 3U9SA 3P20A 3TSSA 1HFGA 2Z4IA 1AEXA 3BYTB 1F2MA 2SDFA 4HMJA 4PQXA 2RSOA 2EE1A 3S2HB 5JAVA 2Q8RE 1SYEA 5I2XA 2A6ED 4A3JB 3TZUA 5KEEA 1Q3LA 5I9OA 1Y8PB 4TKOB 5A2QL 5CBAE 1FR3A 3HKZB 2K03A 3D6WA 4DNRB 4DN4M 1I4XA 3P75A 3T16A 1LO5D 1QE6A 4C3IG 4ZLTF 4K2KA 4BY7B 1TWGB 1B1ZA 2NVXB 4XQQA 2VB2X 2QF7A 4EVOA 3Q23A 2R7ZB 1EWCA 2ICIA 2QKIC 1LTTD 4IURA 5BN5A 1WTRA 3SEBA 3S1NB 2TSSA 1DOLA 3K0YA 4QCLA 5DM73 3PUVA 4KI0A 2RVLA 2ZXOA 3C46A 3L9AX 3EROA 1SNPA 4JK1C 1G8ZD 3VR4A 1RDPD 2CQAA 3GTPB 1YNND 3NTKA 4KV6A 2MUYA 1I4HA 3I73A 3RMHA 3DWAA 3I72A 4KMUC 2DN8A 2NZ1D 1W6KA 2AQ2B 3NQIA 2IX1A 1EY4A 4C3HB 1WTPA 4L6TB 2NTSA 1TS2A 2EPBA 5T1IA 2B8FA 2RDFA 4H13C 2WB1B 1AW7A 1U9RA 4G7ZC 4BBSB 1JR0D 2JE6I 1SSOA 3IFTA 5J22A 4XQNA 3SK5A 1SYDA 1HFNA 3FRPB 3HOWB 4NDXA 3Q22A 1BCPC 4L8JA 1GOZA 3EJIA 1BNZA 3X3MA 1Q8IA 3ND9A 3BDLA 3BG3A 4IFDJ 1WCMB 4DNTB 1LTSD 2K05A 3EVQA 2O4XA 2NBFA 3NK9A 2WACA 5C3EB 1E2ZA 2RDGA 3CHBD 1RODA 2F0WA 2F0MA 3H09A 1UNSA 2XIWA 2I07B 2K01A 4DAVA 3QB3A 4WJWA 1II3A 3LWEA 1TY0A 1JWMD 2HDMA 5CR3A 1RF2D 4RAUC 1WTWA 2IT1A 4LJZC 1D5XC 2VB3X 2NB0A 3N52A 4RGOS 4ODGA 1TKWB 1F2YA 3A54A 1X32A 1JB3A 2H1EA 2EYFA 1MBYA 1HUNA 1EQVA 1Q1EA 4A3GB 2L12A 5G3LF 2NWGA 4CJ1B 1SNOA 2MJ8A 2JA8B 4RWSC 3VYUA 4FO2A 5C5MA 1EIGA 2TMPA 4QMGA 1ILPA 1CTMA 3S14B 1LT5D 4V190 1B2TA 1SE4A 4HN7A 1LTID 2SOBA 2XSCA 4X3SA 5FKAC 5IT9E 2XWJB 1SJHD 4TSSA 2XWBB 4IUVA 4FVMA 1E2VA 1O80A 2L5TA 4CKBA 1FYCA 5I2YA 2A6HD 4PV1C 2FFKB 5I6WA 2N55A 1ML0D 2WKCA 4K8IA 4NP5A 1O78A 1H9SB 3SR1A 3HG9A 2K1BA 1F9PA 4DK1A 1AZQA 2F0EA 1B44D 1VDZA 3J7AF 3NHHA 5C6AA 2QDBA 1DXMA 1SNCA 5M3FB 4A3MB 3BVMA 4BA2I 2WINB 1BR9A 2BDNA 4IN3A 1SNDA 1KTKA 1LLRD 3PO3B 1QOHA 3AU7A 2RQXA 1MD2D 2VNUD 2OT2A 5C44B 4XYQA 1GXDC 2EYPA 5JVG3 2ICEC 2JXMB 1STYA 2RDHA 2EJMA 5ELDA 1V1PB 2EJGC 5K5PA 3H91A 3C1EA 4XXEA 2SNMA 5FO8B 1CA5A 1PFNA 2F0HA 1KDBA 3RUZA 1PTOB 1KLUD 1X3QA 1ZYRC 1K8OA 2O5IC 1WVLA 5TSSA 2J0TD 1EY9A 2IL8A 5IGEA 4UAIA 1KAAA 2OXPA 3TN2A 3NBIA 4ZUJA 2QCPX 2PZWA 1STBA 1IKMA 2D62A 3S1RB 4LK1C 5D14A 1LTAD 4J8QA 4ZQ3A 3MXNA 1C4QA 4HSVA 1PTOF 2HCIA 1F9SA 4K5WA 1ZEQX 1XWEA 2L55A 2DNCA 1EYDA 2RSNA 3J7AV 4U68A 5K36H 5E3FA 1EL0A 1NUCA 1TVXA 1LT6D 3URYA 2KUMA 1DZ1A 1JCKB 2EDGA 3G7LA 4KKUA 2PCFB 4IUQA 1DOMA 1OXUA 3FEWX 3M85A 4KJOA 3NWTA 2AQ1B 2JA7B 2F0TA 3FPUB 2KJXA 4A3BB 2DY7A 4CBVA 3J81E 4N9PA 5F2DA 4CJ0B 5KYLA 4DGZA 3DWPA 3SK6A 4DAPA 1I6VC 1JQYD 2Y0SB 3K7AB 4MN3A 1EEID 3KBGA 5EBDA 2L1BA 1S5CD 3I4NB 1PYWD 3A7AB 3TZDA 5KGUA 1PDQA 4M8AA 3J81L 1GUNA 3ERQA 1RD9D 3I4LA 1SJED 2RA4A 3H3VC 4C3JG 1Q12A 3VR5A 2XRSD 1HA5A 5EGTA 4KN4C 1BXTA 1BUVT 3VA7A 3L7ZC 1LTBD 2J7ZA 4DAYA 1AFPA 4CGYB 4J1MA 1J8IA 1M8AA 1DYQA 4C2MB 3CRKC 3T13A 3EFXD 4HMIA 1SNQA 4XDXA 4IUPA 1HHVA 2LS01 1MGSA 4KD4A 4BY1B 2IPKD 2JYOA 3TP5A 3GTGB 2X69A 3ZYYX 5COYA 3N6RA 2F0GA 4C3IB 3FMCA 1PFBA 1ET6A 1GHJA 3KUPA 4XT1B 4G7HC 2ZXPA 2EYHA 3QO2A 2EYMA 2F4IA 3GV6A 2EYLA 5IGGA 2K5DA 2HUGA 4KK7A 5A2QE 2B2TA 4PMWA 4O1NA 4DF7A 1STAA 3LNNA 1JOOA 4KY7A 4DFAA 1X3PA 4X3TA 5C4HA 2JSOA 1EY5A 3QWNA 5ISRA 2Z4HA 3Q0AA 1IL8A 5HURA 3PUZA 3MWYW 2AWNA 1LT4D 2WAQB 5IGBA 4OIKA 3NWSA 3OWEB 1ILQA 4U673 1GUGA 5FLXE 1DOKA 4HCEA 4RA8A 2B2VC 2PPBC 4KKSA 1QJOA 2XN9C 1CZWA 3HOYB 4RH6A 3M4OB 4MHEA 4EQOA 4S3SA 5C3WA 1BCPD 3MFGA 4BA1I 4YIJA 2KVMA 2SNSA 1RHPA 1RTOA 4F87A 1TS3A 1STEA 1TWHB 5C4ZA 3R93A 2PQEA 3GV3A 5FLXL 3NTIA 1SBBB 4F8MA 1VMPA 1FD7D 3R2IA 4HCSA 3SXHA 5K36G 3D4WA 4RGNA 2PYKA 5KNCA 2F0NA 1KABA 1S5DD 2FHTA 2KCNA 2D2CC 1SXTA 4ME5A 1U4LA 2KHSA 1Y69U 5FO7B 4RGTA 3T56B 2F0JA 1MSHA 4KHVA 1I50B 3KK7A 5DAUA 1H9SA 5FK9C 2NN6G 3I3CA 5JJZA 2E76C 3E0JA 4A3DB 4KTAA 4TQUS 5E1FA 2C5CA 4FNFA 2EY5A 1FNUA 3BYYB 4R9WA 4I65A 1VF7A 1D1KA 4NMZA 3GO5A 1LV9A 4FXGC 1R9TB 1NSNS 2F3WA 3H0GB 3H94A 5JPNC 1B53A 5E4XA 3SE0A 2JEAI 4N9TA 3HGBA 4A3KB 3ND8A 1TWCB 2QILA 1RCVD 5HGTA 4FXKC 1WTXA 1BO0A 4HTHA 1V1PA 1A2UA 4K6DA 1CZGA 1HUMA 1EYCA 2PO4A 2E2JB 3M7NA 2B2WC 3S16B 4Q5VA 4IFDI 1VF5C 1WD0A 3S17B 3TMEA 1CHPD 1STHA 1TIID 1F9QA 2GA4B 1QB5D 2I46A 2A68C 1BQQT 3BDCA 3KF8A 3KLSX 2NVQB 5EBCA 3MXPA 4A3EB 2K32A 1XTCD 5CV5A 1SMYC 1EWHA 4XTCS 5LHY1 5CV4A 2BA0A 5D3IB 3V96A 2PZUA 4F7XA 1HXYD 2NUCA 3IL8A 3EQLC 3MAQA 1WTVA 1HTPA 2PNRC 3DMUA 5CV8A 3T51B 3NXWA 1WTQA 4A93B 4GZYC 2A73B 3MXGA 1ZYRD 3E5SA 3P7JA 3I8ZA 2IWHA 1ENCA 3OWFA 5M9OA 3D8GA 5CGKA 5IODA 3SK8A 3OMCA 1TS4A 2B2UC 2M2LA 5C0XJ 4KHZA 3T4AC 2FINB 4DXGA 3DEOA 2JA6B 5JPMC 1DM0B 5ELCA 5CV6A 3LX0A 2F3VA 3KLSA 2WV6D 1E2WA 3UI2A 3MA2B 3X3NA 2YU9B 4DU9A 1BF4A 1BBXC 4IUUA 2K7VA 2RBMA 4ZRZA 3PV0A 1IW7C 1CA6A 2A5HA 4FXDA 3OSOA 1LTGD 5M5XB 4BWGB 3DHQA 3RD4A 1I4GA 2FMCA 2YYZA 1OXVA 3K57A 4K8JA 5J39A 4IQZA 4IUTA 2VXWA 1AP0A 2AUKA 4KN7C 2ZT9C 3VR2A 2BE5C 3TP8A 4QUCA 5C0XH 1K83B 1FGBD 3GTKB 5EKKA 5C5LA 4K5XA 1V8QA 2B39A 3HRZC 5J1ZA 2ID0A 2ENBA 1KNAA 1Y8NB 3K5MA 4KKTA 5CV9A 1PFMA 3QIAA 4WORA 1D2BA 4BBRB 2A74C 2F0IA 2HQEA 3OIQA 2LKVA 1ICWA 1D5ZC 3VYSA 3D3RA 3JAME 4QUFA 1AN8A 3HOVB 3NPPA 3J80E 1LT3D 2F0KA 1R4PB 1I6HB 1CI3M 2A69C 1QILA 3MHBA 2NVYB 4C3JB 2F0QA 5CORA 1JORA 1TS5A 2R93B 1EQTA 5M5YB 5ELBA 3A8JE 4CKCA 3OW7A 3S9WA 4OO1H 3K59A 2NVTB 2KEEA 1VCIA 2F0DA 2NN6H 1RKNA 5I9PA 3JAML 1Q90A 3J80L 1SE2A 2X6LA 3LWUA 2MGSA 1ZXTA 2B2YC 3BVZA 5JEAG 1BCPB 1I4QA 2RKSA 4R8IA 3HP3A 2XRQD 5JOBA 4I7ZC 5DM63 1W6JA 5CYUA 3DUZA 3NTHA 1B9MA 3CKIB 2VUMB 4KJNA 1MSGA 3TBIB 5KNDA 1OXXK 1BCPF 2C9OA 3KBXA 1MI2A 4HSPA 2PW5A 1PZKD 2L4NA 2IX3A 3DEPA 4L63B 1ESFA 4P2CB 4ZK9B 5ELFA 2LY7A 2AUJD 3QJYA 1SYGA 4FP5D 3GP7A 1F9RA 1ZKOA 1PRTC 1SDFA 2EXZA 1S4ZA 1IKLA 1S5BD 2EVBA 3O13A 2Q8IB 3M4YA 1LTRD 3ONAB 3CU7A 4BS9A 3SHLA 4RCNA 1OXTA 2DNEA 4Z9CB 4EGVA 4LMQD 3HS0C 4FF2A 2PW7A 3PMFA 2F0OA 2MP1A 1A3VA 1L0YB 4KD3A 1H9JA 2IJ0A 2V4DA 1SYFA 2LFNA 1CM9A 3C3LA 4G57A 4IALA 1UUPA 1NR2A 1IYUA 1DD2A 5CBEE 3HOUB 1FNWA 1IHZA 1U4RA 3GTQB 1XXGA 3PUXA 2FJ2A 3MEHA 1T5EA 1STGA 5DNFA 3QG1A 5EPLA 2K5QA 3Q6SA 5A35A 1EU3A 1SFOB 3V05A 1JE4A 3C2PA 3TP6A 2JEBI 1WD1A 1SEBD 2K5WA 1PZID 4K5VA 3PIO3 1T5XD 3PIP3 4B9XA 2E2DC 4K2LA 1TT2A 1GUSA 4OL7A 4RKLA 5C0XG 2EZVA 4IUNA 3D31A 2DY8A 5DEHA 1F2ZA 3A7LA 2OF1A 3DXJC 3GTLB 3J7YW 2CW0C 1B50A 5IGCA 2EY6A 3GD7A 2Z1CA 3HOZB 2F0LA 1SYBA 5CC4A 2KEDA 2MHVA 1EZ8A 4X3UA 1F77A 4R8NA 1HPCA 3NQTA 1PTOC 3K58A 4ID6A 2L9HA 1S5ED 4PNYA 1TU2B 4C1NK 4A3FB 3DM1A 2B8GA 4QIWB 4JBWA 3NE5B 2X6GA 2A68D 1U4MA 1TQOA 1TWAB 3W2DA 3WDNA 2EOTA 2Q8TA 5IIFA 2JP1A 2PMZB 2R61A 2O2LD 2NTTA 1EY0A 4OO1G 5JEAJ 2WP8J 1SMYD 4A3IB 1I4RA 5I6YA 1XYIA 3ITPA 5FO9B 5IGFA 2CVRA 4FF1A 2XVSA 4PMCA 2BOSA 3U9OA 1JWUD 2R92B 1Y1VB 1TWFB 3RLFA 3TDQA 2OEOA 3R2TA 5E4WC 3V2TA 2F0FA 2F03A 3S15B 4ZUIA 5BN4A 3QOJA 3GTOB 3PO2B 2MPMA 2A6EC 4H0LC 2B2VA 4KY6A 1TY2A 1M4VA 2XNAC 3PUWA 3VYTA 4F88A 2IX0A 5CV7A 2PZTA 3FKIB 1H9MA 4QB4A 1QG7A 4K6LA 1ONLA 5JEAH 1CK1A 5EPJA 1JICA 3DWQA 3FVQA 1EZ6A 1EY7A 3AMUA 3VR6A 2F1MA 3I90A 4G4KA 3CQZB 4C1NI 1EY8A 1PTOH 2EY1A 2KCCA 3I70A 4OGQC 1ESRA 4RHSA 2KOLA 1JWSD 1PLFA 1IW7D 3CRLC 2EY2A 1HTLD 5LL6X 3K5LA 2HDLA 1YNNC 3Q24A 5D65A 2K04A 4OHJA 4C3HG 1HQMC 3E6ZX 4HR7B 1AZPA 3HOXB 3D6CA 3K6OA 1BDOA 1G291 1G2SA 3A8KE 4PMBA 1JOQA 3P1HA 3M7GA 3T53B 1PRTB 1H9RA 1SAPA 3OHXC 1KLGD 3S2DB 3K5OA 2BE5D 5KNBA 4ILWA 4J6HA 1QWYA 1D6EC 1EU4A 1V1OA 1A6XA 1ENAA 4TRDA 4IFDH 1DCZA 2CHBD 2SEBD 1CT1D 4G7OC 4H7BA 4RHRA 3RZDB 1PRTF 3GQBA 1CQFA 4NW2A 3NBHA 4QF4A 2BA1A 2JA5B 3S1MB 2F0PA 1E0BA 1CHQD 1SNMA 1Z6HA 2IW3A 1VMCA 3G6JB 5IGDA 5M5WB 1YNJD 4HAEA 1O7YA 5C3XA 1LABA 4NKLA 2A69D 4C56C 2EYOA 1ENFA 3GTJB 2BDOA 4WRDA 3TP7A 3H6MA 1GUWA 2L0CA 4RFBA 3BS1A 1J9OA 1V43A 4LAAA 1DONA 1CFMA 1HCZA 5C0XI 5KRUA 4UDUC 1Y1WB 3HEJA 3BVGA 1QNKA 5KYIA 1OO9B 2B2WA 1LACA 2R6GA 2LMCB 2NYZD 1KNEA 1KDCA 4CHTB 1UAPA 4V0BA 3F2UA 4H44C 5IT9L 1A15A 4DK0A 4EQNA 3EA6A 4FF3A 5KIXA 5EKIA 1D5MC 3IAYA 3BDOA 3R3OA 2QEJC 5C4JB 4MIUA 1A3TA 2B63B 1O7LA 1KDAA 4DA2A 2E2IB 2E2HB 1I3QB 2AWOA 1HRJA 2M9VA 1EIHA 1Z7TA 3M3YB 1K8MA 1WTOA 3A56A 5M3MB 3VA5A 1C48A 3I91A 5NUCA 4OO1I 2N88A 5FOBB 2NN6I 1BOSA 1EOTA 1G2TA 1YNJC 2WKDA 4CJ2C 5G3LD 2G9HD 3R8BA 4ZKCB 2E74C 1EFID 2B2UA 1PRTD 2F0UA 2A6HC 4XIGS 1Q1BA 1B9NA 4Q0FA 2FMMA 5JVH3 1XX8A 2M00A 1S5FD 3L3OC 4RGMA 4ZAIA 3WOFA 1OXSC 1A2TA 1UEAB 5I4DA 1GUOA 2F0SA 5BN3A 2HCCA 2WIIB 3KLRA 2F0VA 4DXFA 1B4OA 2D5DA 3HZXA 3K5NA 1RTNA 4XT3B 1TR5A 2KECA 3NSWA 3OPOA 1H9KA 3VR3A 1QCBD 4M1UB 3C1FA 3MTSA 2E75C 5EQ0A 2BCOA 1GJXA 1NCVA 2B2TC 3MVVA 4ZKBB 2EJFC 4ZYSA 2L11A 3A8IE 1SYCA 3MXUA 1O7ZA 3NUCA 1L0XB 3A55A 3IKJA 3GTMB 2K6AA 3VYRA 4XYOA 5ELEA 3SVMA 5AFWA 1JOKA 5D3DA 2KQ3A 1I4PA 1NAPA 1GUTA 1R4QB 3QOLA 2H4OA 5LL6S 1JC7A 1G6ZA 1HQRD 4EQPA 4FF4A 4WFN3 4ULLA 4B08A 1DJRD 3MFYA 2D9UA 4X3KA 3OMGA 3AB9A 4K14A 1B3AA 1U4PA 3FDTA 4IFDG 1PMRA 2CW0D 1A3UA 1EEFD 1SE3A 3IFDA 3SK4A 3MC0B 4RCOA 3D4DA 3NP8A 3MZ5A 3OOCA 4HEDA 1ET9A 4IZ8A 4XQJA 1Y8OB 3OIPA 5EJWA 2J4XA 1C8CA 1PTOD 1QNUA 4OIJA 1G91A 3S1QB 4KY5A 1F2LA 3SDZA 2O5JC 2K33A 4CKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYU A;  3VYT A;  3D3R A;  3VYR A;  2OT2 A;  2Z1C A;  3VYS A; 
#chains in the Genus database with same CATH topology
 2ZXR A;  3I4M B;  4RKB A;  1GHK A;  3PUY A;  1EY6 A;  1EYA A;  3CPF A;  2K52 A;  1IYV A;  1AH9 A;  1RJT A;  3EBE A;  4O42 A;  1FNV A;  1NR4 A;  1XMQ Q;  1Q81 C;  2KA7 A;  4Y7N B;  5IOC A;  2R3Z A;  1QVF A;  1R9T H;  1PXU A;  3WOE A;  3H0G H;  3I4N G;  2B2Y A;  1D1I A;  2GVA A;  3MXN B;  5EKL A;  4FYD A;  4A3K H;  1TWC H;  4DR7 L;  1VQ8 A;  1STN A;  2ZTC A;  4B9W A;  1CQV A;  4E6I A;  4AYB B;  5EPK A;  3D4R A;  3AEV A;  3BZD B;  2AQ3 B;  3FPP A;  3W3A A;  5C4X B;  5CMD A;  2K28 A;  5C3E H;  3RZO B;  4JV5 L;  2N3S A;  1Z47 A;  1N33 Q;  2E2J H;  5T1G A;  2Z8L A;  4B3R Q;  2G9D A;  1HA6 A;  4ABN A;  3KJP A;  2EYJ A;  3S16 H;  1PZJ D;  4A3L G;  3U9S A;  3P20 A;  3S17 H;  1NBW A;  3TSS A;  4X64 L;  1HFG A;  1X3F A;  2Z4I A;  1AEX A;  2LXK A;  3BYT B;  1F2M A;  2SDF A;  4HIM A;  4HMJ A;  4PQX A;  2RSO A;  2EE1 A;  3S2H B;  3K8A A;  5JAV A;  2Q8R E;  4AIM A;  1SYE A;  5I2X A;  2NVQ H;  4HJA A;  1JJ2 A;  2A6E D;  4A3E H;  4A3J B;  3TZU A;  1KC8 C;  5KEE A;  1Q3L A;  5I9O A;  1Y8P B;  2CH4 W;  4TKO B;  5A2Q L;  4BY1 G;  5CBA E;  3H3V H;  4N8X 1;  3J81 c;  1FR3 A;  3HKZ B;  4IPG A;  2Y0S E;  4LFB L;  2K03 A;  3D6W A;  4DNR B;  4DN4 M;  1I4X A;  3P75 A;  3T16 A;  1LO5 D;  1QE6 A;  4C3I G;  4ZLT F;  4K2K A;  4BY7 B;  2K5H A;  2VS1 A;  1TWG B;  1B1Z A;  4A4I A;  4GLX A;  2NVX B;  4XQQ A;  1PH3 A;  2VB2 X;  2QF7 A;  3UDF A;  4L5R C;  5IYC H;  4EVO A;  3ERS X;  2H5X A;  2LXJ A;  4HID A;  3Q23 A;  3CCE A;  4DR6 Q;  2R7Z B;  1EWC A;  5BR8 L;  2CWP A;  2ICI A;  2QKI C;  4A93 H;  1LTT D;  4IUR A;  5BN5 A;  1WTR A;  3SEB A;  3S1N B;  2TSS A;  1DOL A;  3K0Y A;  3CD6 A;  4QCL A;  1K0S A;  5DM7 3;  3PUV A;  4KI0 A;  2RVL A;  2ZXO A;  3C46 A;  3L9A X;  3ERO A;  1SNP A;  3F8T A;  5C4X G;  4R1J A;  4JK1 C;  4MNO A;  1G8Z D;  4X66 L;  3CPW A;  3VR4 A;  4B3M L;  1RDP D;  2CQA A;  3GTP B;  1YNN D;  3NTK A;  4KV6 A;  2MUY A;  1I4H A;  3I73 A;  3RMH A;  3DWA A;  3I72 A;  4KMU C;  1PH2 A;  1EQR A;  1HZA A;  3M4P A;  4JI2 L;  3F2C A;  2IY5 B;  3PSI A;  1XMO L;  3RLN A;  2DN8 A;  2NZ1 D;  4DAY B;  1W6K A;  2AQ2 B;  1IBK Q;  2JA6 H;  2WAQ G;  3NQI A;  1L1O A;  3MEF A;  1HZ9 A;  2IX1 A;  2WFW A;  4YWK A;  1EY4 A;  4C3H B;  1WTP A;  4L6T B;  2NTS A;  4DR3 L;  4B3S Q;  4GLV B;  2P5Z X;  4R4T A;  1TS2 A;  1E3P A;  2YU9 H;  2EPB A;  5T1I A;  2B8F A;  4LFA L;  3K7U C;  2RDF A;  4H13 C;  2WB1 B;  1AW7 A;  1U9R A;  4G7Z C;  4BBS B;  1HR0 L;  1JR0 D;  2JE6 I;  3K0X A;  1SSO A;  3T1H L;  3IFT A;  5J22 A;  4XQN A;  1VQE A;  3SK5 A;  5FLM H;  3NEM A;  2EIF A;  2ES2 A;  1SYD A;  1S72 A;  3J7Z C;  1HFN A;  3PO3 H;  3FRP B;  3HOW B;  4NDX A;  3Q22 A;  1BCP C;  4L8J A;  1GOZ A;  4DUY Q;  3EJI A;  1BNZ A;  3X3M A;  3G48 A;  4DV2 L;  1Q8I A;  4JOI C;  1JE5 A;  3ND9 A;  3BDL A;  1IL2 A;  3L0O A;  1VQD A;  2Q2U A;  1B8A A;  2R7D A;  3BG3 A;  1M1K C;  4IFD J;  1WCM B;  4O2D A;  4DNT B;  1LTS D;  2CH4 A;  3CCJ A;  2K05 A;  1UE5 A;  1K0R A;  3EVQ A;  2VZA A;  1CKM A;  2O4X A;  2GN5 A;  2NBF A;  1K83 H;  3NK9 A;  2WAC A;  5C3E B;  4LF9 L;  4ZCK A;  1U0L A;  1E2Z A;  2RDG A;  1JJC B;  3CHB D;  1ROD A;  2F0W A;  2F0M A;  3H09 A;  1UNS A;  2XIW A;  1QVC A;  2I07 B;  4LF7 Q;  2K01 A;  4DAV A;  1N36 L;  3QB3 A;  4WJW A;  1II3 A;  3K81 C;  4BBR H;  3LWE A;  1TY0 A;  1JWM D;  2HDM A;  1SLJ A;  5CR3 A;  1RF2 D;  4RAU C;  1WTW A;  2IT1 A;  4JC0 A;  1LTL A;  3HOV H;  4A3D G;  4LJZ C;  3SGI A;  1D5X C;  4P74 A;  1XNR Q;  2VB3 X;  2NB0 A;  3N52 A;  4RGO S;  3W1B A;  2UUA L;  4ODG A;  1TKW B;  1F2Y A;  3A54 A;  1I6H H;  4JI5 Q;  3PGZ A;  1X32 A;  1CKN B;  1JB3 A;  3D0F A;  2H1E A;  2NVY H;  4C3J H;  2EYF A;  1MBY A;  1X9N A;  5LMN W;  1HUN A;  1EQV A;  3NEN A;  2L15 A;  1Q7Y C;  2R93 H;  5M5Y H;  1Q1E A;  4A3G B;  3OTO L;  2L12 A;  5G3L F;  2NWG A;  1JB7 A;  4CJ1 B;  1SNO A;  2MJ8 A;  2JA8 B;  3H0G G;  4RWS C;  2NVT H;  4QIW E;  3VYU A;  4FO2 A;  5C5M A;  1EIG A;  2TMP A;  4QMG A;  4DR4 Q;  4X65 L;  1ILP A;  4A3K G;  1CTM A;  4IPH A;  3STB C;  3S14 B;  1LT5 D;  4V19 0;  1B2T A;  3TEH B;  1SE4 A;  4HN7 A;  2Q2I A;  1LTI D;  1NMG A;  2A8V A;  2SOB A;  2XSC A;  4X3S A;  5FKA C;  5IT9 E;  2XWJ B;  1SJH D;  4TSS A;  2K5N A;  4AQY Q;  2XWB B;  4IUV A;  2UXD L;  4FVM A;  3BJU A;  1E2V A;  1O80 A;  2L5T A;  4JI8 L;  4CKB A;  1FYC A;  4CDD C;  5I2Y A;  1CSP A;  2A6H D;  4FDB A;  3BU2 A;  4PV1 C;  2FFK B;  5I6W A;  2N55 A;  1ML0 D;  3U50 C;  2WKC A;  4K8I A;  4NP5 A;  5LMN Q;  1O78 A;  3CC2 A;  1H9S B;  4QJF A;  4DV0 Q;  3OYY A;  4A76 A;  2VQE Q;  3SR1 A;  3CCU A;  4NXM L;  3HG9 A;  3I4N H;  2K1B A;  1HNZ Q;  1F9P A;  4DK1 A;  3WWV A;  1AZQ A;  2VUM H;  2PI2 E;  2F0E A;  3T1Y Q;  1KHI A;  4A3E G;  1GO3 E;  1B44 D;  1VDZ A;  1G51 A;  3J7A F;  3NHH A;  5C6A A;  4DUZ Q;  2QDB A;  3U4V A;  1DXM A;  2ZTE A;  1SNC A;  5M3F B;  1V1Q A;  4A3M B;  3BVM A;  4BA2 I;  2WIN B;  1BR9 A;  2BDN A;  4IN3 A;  1SND A;  4LF5 L;  4OX9 Q;  3BZC A;  1KTK A;  1LLR D;  3A5U A;  3PO3 B;  5IYC G;  1QOH A;  3AU7 A;  2RQX A;  1MD2 D;  4K0K Q;  1H95 A;  2VNU D;  1HNX Q;  4UY8 C;  4JW0 A;  1XTD A;  2OT2 A;  5C44 B;  4KHP L;  4BXX H;  4XYQ A;  4A93 G;  1GXD C;  2EYP A;  5JVG 3;  2JA9 A;  2ICE C;  4QGU A;  2JXM B;  3E3X A;  1STY A;  2RDH A;  2EJM A;  5ELD A;  5HGQ A;  1V1P B;  2EJG C;  3RN2 A;  1VQ7 A;  5K5P A;  3H91 A;  3C1E A;  3M4Q A;  1ICF B;  4XXE A;  2SNM A;  3TRE A;  5FO8 B;  2JJQ A;  1CA5 A;  4POF A;  1PFN A;  3IRB A;  1SR3 A;  2F0H A;  1KDB A;  3RUZ A;  1XNQ Q;  1PTO B;  1KLU D;  1X3Q A;  1ZYR C;  4DV1 Q;  1K8O A;  2O5I C;  4HJ5 A;  4R4Q A;  1WVL A;  5TSS A;  2J0T D;  1M90 C;  1EY9 A;  4JI7 L;  2IL8 A;  2UUB Q;  2XGT A;  4JBJ A;  5IGE A;  4UAI A;  1KAA A;  1A62 A;  1NE3 A;  2JA6 G;  2OXP A;  3TN2 A;  3NBI A;  4JI0 L;  2K4K A;  4ZUJ A;  1VQ5 A;  3W1G A;  2QCP X;  2DGY A;  1I94 L;  2PZW A;  1STB A;  1IKM A;  2D62 A;  3S1R B;  1PYB A;  3KF6 B;  4LK1 C;  5D14 A;  1LTA D;  4J8Q A;  4ZQ3 A;  3MXN A;  1C4Q A;  4HSV A;  3CXC A;  1PTO F;  2HCI A;  1QZG A;  1F9S A;  3HOU H;  4K5W A;  1ZEQ X;  1XWE A;  2L55 A;  2DNC A;  1EYD A;  2RSN A;  3GTQ H;  1YNX A;  3J7A V;  4U68 A;  5K36 H;  2ZJP A;  1EYG A;  2HIX A;  5E3F A;  5FLM G;  1EL0 A;  2KBN A;  3ULL A;  1NUC A;  1TVX A;  1SMX A;  1LT6 D;  4B3T Q;  3URY A;  2KUM A;  4TVA B;  3JAM i;  1DZ1 A;  1JCK B;  1YZ6 A;  2EDG A;  3G7L A;  4KKU A;  1SFO H;  2PCF B;  1KAW A;  4IUQ A;  1DOM A;  1OXU A;  3FEW X;  3M85 A;  4KJO A;  3NWT A;  3VDY A;  3QR8 A;  1IZ6 A;  2AQ1 B;  3HOY H;  1PA6 A;  3M4O H;  2JA7 B;  2F0T A;  3FPU B;  2UU9 L;  1OTC A;  4GKK Q;  1S3O A;  2KJX A;  4UP9 A;  1XMQ L;  4A3B B;  2DY7 A;  4CBV A;  4EX5 A;  3RNU A;  3J81 E;  4N9P A;  4LUO A;  4PG3 A;  1FVI A;  3GTL H;  5F2D A;  1JJG A;  4CJ0 B;  2ATW A;  5KYL A;  4DGZ A;  3DWP A;  3HOZ H;  1XPO A;  3SK6 A;  4NXN Q;  4DAP A;  1I6V C;  4DV3 Q;  1JQY D;  4CDF C;  1HZB A;  4BBR G;  2Y0S B;  3K7A B;  4MN3 A;  1EEI D;  3KBG A;  5EBD A;  2L1B A;  1N33 L;  1S5C D;  3I4N B;  1PYW D;  2YTX A;  4B3R L;  3A7A B;  3TZD A;  1GD7 A;  5KGU A;  3HOV G;  1PDQ A;  4M8A A;  3J81 L;  1EIY B;  1GUN A;  3ERQ A;  1RD9 D;  2CWA A;  3I4L A;  1SJE D;  4A3F H;  2RA4 A;  1PH8 A;  2Z6K A;  1PH1 A;  3H3V C;  4C3J G;  2CKZ B;  1EIF A;  1Q12 A;  1VQF A;  2XRS D;  3AFQ A;  3VR5 A;  1TWA H;  2HQL A;  2MO1 A;  1HA5 A;  2R93 G;  5EGT A;  4KN4 C;  1BXT A;  1BUV T;  3VA7 A;  4JI4 Q;  3L7Z C;  1LTB D;  2J7Z A;  4DAY A;  1AFP A;  1B3Q A;  1I50 H;  4CGY B;  4J1M A;  3DLL A;  1J8I A;  1M8A A;  1DYQ A;  4GN5 A;  4C2M B;  1D7Q A;  3CRK C;  1K73 C;  4A3I H;  3T13 A;  3EFX D;  4HMI A;  1MJE A;  1SNQ A;  4XDX A;  4IUP A;  1HHV A;  1YBY A;  2LS0 1;  1MGS A;  4KD4 A;  4BY1 B;  3GDE A;  1K8A C;  4OWT B;  2I0Q A;  2IPK D;  4DV4 Q;  2R92 H;  1Y1V H;  2JYO A;  1TWF H;  3TP5 A;  4HJ8 A;  3GTG B;  2X69 A;  3ZYY X;  5COY A;  3N6R A;  2F0G A;  4C3I B;  4JI1 L;  3FMC A;  1PFB A;  1YIT A;  1AE2 A;  1ET6 A;  2BH8 A;  1GHJ A;  4X6A H;  3KUP A;  5LMU Q;  4XT1 B;  4HJ9 A;  2MNA A;  3S15 H;  2Y0S G;  4G7H C;  2ZTD A;  2ZXP A;  2EYH A;  3GTO H;  3QO2 A;  3PO2 H;  1KXL A;  2JN4 A;  2EYM A;  2F4I A;  2VUM G;  3GV6 A;  2UXB L;  1LM0 A;  2EYL A;  5IGG A;  2K5D A;  3CC7 A;  2HUG A;  2HHH L;  4KK7 A;  2E5L Q;  5A2Q E;  3ULJ A;  1IBK L;  4HIO A;  2B2T A;  4PMW A;  4O1N A;  4DF7 A;  1STA A;  3E0E A;  3UDG A;  3FKI H;  4IOC A;  1C0A A;  3LNN A;  1JOO A;  1VQK A;  4KY7 A;  2BH2 A;  4DFA A;  4B3S L;  1X3P A;  4X3T A;  5C4H A;  2JSO A;  1EY5 A;  3QWN A;  5ISR A;  2Z4H A;  3S24 A;  3Q0A A;  1IL8 A;  5HUR A;  3BZK A;  3PUZ A;  2UUC Q;  3UE0 A;  1YHQ A;  3MWY W;  2AWN A;  1LT4 D;  4BXX G;  2WAQ B;  5IGB A;  4OIK A;  2AKW B;  3NWS A;  1ILQ A;  3OWE B;  4U67 3;  4JI3 L;  1GUG A;  5FLX E;  1DOK A;  4HCE A;  1E1T A;  4RA8 A;  2B2V C;  2PPB C;  4KKS A;  4LFC Q;  3CP0 A;  1QJO A;  2XN9 C;  3JC6 6;  1CZW A;  3HOY B;  2NZH A;  4RH6 A;  3M4O B;  4MHE A;  4EQO A;  4S3S A;  5C3W A;  1BCP D;  3MFG A;  4BA1 I;  3PQI A;  3KYH C;  4YIJ A;  4L5T A;  4O0A A;  3E9I A;  2KVM A;  2SNS A;  1CKN A;  1J5E Q;  1RHP A;  1RTO A;  4F87 A;  1TS3 A;  2QEX A;  1STE A;  1BKB A;  5E7N A;  1YHB A;  2DUD A;  3S2D H;  1TWH B;  4LUV A;  4A75 A;  1YIJ A;  5IYD H;  5C4Z A;  2ZJQ A;  1VQC A;  3R93 A;  2PQE A;  3GV3 A;  5FLX L;  1IBL L;  3NTI A;  2VQF L;  1GVP A;  1SBB B;  1VQ4 A;  4DK6 C;  2D0O A;  4F8M A;  1G6P A;  3HKS A;  3B6Y A;  1QUQ A;  3HOU G;  4YHH L;  1VMP A;  1FD7 D;  3R2I A;  2F3I A;  4HCS A;  3SXH A;  4YCU A;  4DV7 Q;  4LF7 L;  3RZD H;  4GKJ L;  1WOC A;  4OEL B;  5K36 G;  3D4W A;  4RGN A;  2PYK A;  5KNC A;  4GLA C;  2F0N A;  1VQ6 A;  1KAB A;  1S5D D;  2FHT A;  2KCN A;  3S1M H;  2D2C C;  3OW2 A;  1SXT A;  4R4C A;  4DKA C;  4ME5 A;  1U4L A;  3CF5 A;  1CUK A;  2KHS A;  1Y69 U;  5FO7 B;  5M5W H;  4RGT A;  3T56 B;  1XNR L;  3K80 C;  4YY3 L;  2F0J A;  1K9M C;  1MSH A;  4KHV A;  3KDF B;  1I50 B;  3KK7 A;  4JI5 L;  5DAU A;  1H9S A;  5FK9 C;  2NN6 G;  3I3C A;  5JJZ A;  2E76 C;  3HOY G;  3E0J A;  1Z9F A;  3UDX A;  2KEN A;  4A3D B;  4KTA A;  4TQU S;  1PH5 A;  5E1F A;  2C5C A;  4FNF A;  4JV5 Q;  2EY5 A;  4MTN A;  1WFQ A;  1FNU A;  3BYY B;  4R9W A;  4I65 A;  5ELN A;  4DR4 L;  1VF7 A;  3DM3 A;  3ULP A;  1D1K A;  1S40 A;  5M5X H;  3STB D;  3HOZ G;  4NMZ A;  3A5Z B;  2Z0S A;  4IOA A;  3GO5 A;  1LV9 A;  4FXG C;  1R9T B;  1MIU A;  1N34 Q;  1NSN S;  1KL9 A;  2F3W A;  3H94 A;  3H0G B;  5FJ8 H;  5JPN C;  4DV6 L;  4AQY L;  1B53 A;  2K14 A;  5E4X A;  3SE0 A;  2JEA I;  4N9T A;  1NTG A;  3HGB A;  4A3K B;  3ND8 A;  1TWC B;  2QIL A;  1RCV D;  5HGT A;  1EQQ A;  5C4J H;  4FXK C;  1WTX A;  1BO0 A;  4HTH A;  1V1P A;  3AQQ A;  1A2U A;  4K6D A;  5LMN L;  4A3F G;  1CZG A;  1KRS A;  4DV0 L;  1HUM A;  2B63 H;  1K28 A;  2OWO A;  1EYC A;  2PO4 A;  2VQE L;  3GTK H;  2E2J B;  4GS3 A;  1HNZ L;  2E2I H;  1FL0 A;  3M7N A;  4DK3 C;  2B2W C;  3T1Y L;  3M3Y H;  3S16 B;  4Q5V A;  4IFD I;  4JVZ A;  1VF5 C;  1WD0 A;  1U5K A;  3TME A;  1CHP D;  3S17 B;  1STH A;  4CDE C;  5M3M H;  1TII D;  1F9Q A;  1PVO A;  2GA4 B;  4DUZ L;  1QB5 D;  2I46 A;  2A68 C;  1BQQ T;  3J7A 5;  2E8G A;  3BDC A;  4OWW B;  5FLX c;  4A3I G;  5J3B A;  3KF8 A;  4JPB W;  3KLS X;  4I7A A;  2NVQ B;  2VW9 A;  3KF6 A;  5EBC A;  3MXP A;  4A3E B;  2K32 A;  3F2D A;  1XTC D;  1VQL A;  1GM5 A;  4KLK A;  5CV5 A;  4GOP B;  4K0K L;  5JJK A;  1YJN A;  1HNX L;  1SMY C;  3I4O A;  2R92 G;  1Y1V G;  4N8F A;  2MQH A;  1EWH A;  1VQH A;  5IWA Q;  4GNX B;  4XTC S;  5LHY 1;  1X3E A;  5CV4 A;  2BA0 A;  5D3I B;  3V96 A;  2PZU A;  4F7X A;  1HXY D;  1HH2 P;  2ALY B;  2NUC A;  3EQL C;  3IL8 A;  4Y52 H;  3MAQ A;  1WTV A;  1YJW A;  1HTP A;  2B3G A;  3CW2 C;  2PNR C;  3DMU A;  1QVG A;  2AMC B;  2DJF C;  5CV8 A;  3T51 B;  3NXW A;  1WTQ A;  1T9H A;  3U58 A;  3PO2 G;  4A93 B;  1XNQ L;  4DV1 L;  4GZY C;  3H15 A;  1QUQ B;  2A73 B;  3MXG A;  1ZYR D;  3E5S A;  3P7J A;  3I8Z A;  2IWH A;  1B70 B;  1ENC A;  3CCL A;  3OWF A;  5M9O A;  2UUB L;  2PMZ E;  3D8G A;  5CGK A;  5IOD A;  3SK8 A;  3FKI G;  3OMC A;  3T1H Q;  1TS4 A;  4DR2 L;  1CKO A;  2B2U C;  2M2L A;  2ZM6 Q;  2UXC Q;  1IBM Q;  1X6O A;  3PF5 A;  5C0X J;  4KHZ A;  3T4A C;  2FIN B;  4DXG A;  3FHW A;  2OQ0 A;  3DEO A;  3KOJ A;  4IPC A;  1Q82 C;  2JA6 B;  5JPM C;  1EOV A;  4DV5 Q;  1PYS B;  1DM0 B;  5ELC A;  5CV6 A;  2A19 A;  3LX0 A;  2F3V A;  3KLS A;  2WV6 D;  1E2W A;  3UI2 A;  4APV A;  4HJ7 A;  3MA2 B;  3X3N A;  2YU9 B;  4LF6 L;  3GTM H;  4DU9 A;  1L2F A;  1BF4 A;  3FP9 A;  1BBX C;  4IUU A;  2K7V A;  2RBM A;  2YTV A;  4ZRZ A;  4LF9 Q;  3PV0 A;  2FXQ A;  1IW7 C;  1CA6 A;  2A5H A;  3E9H A;  4FXD A;  3OSO A;  1LTG D;  1PHJ A;  1N36 Q;  5M5X B;  4BWG B;  3DHQ A;  5IYD G;  4GKK L;  1N8R C;  3RD4 A;  1I4G A;  2FMC A;  4J15 A;  2YYZ A;  1OXV A;  4GN4 B;  3K57 A;  4K8J A;  5J39 A;  4IQZ A;  4P71 A;  4IUT A;  2VXW A;  1AP0 A;  2AUK A;  4KN7 C;  5GAH C;  1YEZ A;  2ZT9 C;  3VR2 A;  2BE5 C;  3TP8 A;  1FGU A;  2CCZ A;  4QUC A;  5C0X H;  1K83 B;  4DV3 L;  1FGB D;  3Q8D A;  3GTK B;  5EKK A;  5C5L A;  4K5X A;  1V8Q A;  4PZ8 A;  3OTO Q;  2B39 A;  4OWX B;  3HRZ C;  1VQG A;  5J1Z A;  4UP7 A;  2ID0 A;  2ENB A;  1KNA A;  1Y8N B;  3K5M A;  4KKT A;  5CV9 A;  1PFM A;  1CSQ A;  3QIA A;  3KF8 B;  4WOR A;  1D2B A;  4BBR B;  1YI2 A;  4GN3 B;  1QZH A;  1E24 A;  2QA4 A;  2A74 C;  3I4M H;  4X65 Q;  2F0I A;  2HQE A;  3OIQ A;  4YCV A;  1VQP A;  2LKV A;  1ICW A;  1D5Z C;  3VYS A;  3D3R A;  3JAM E;  2A1A A;  5IYB H;  4QUF A;  1AN8 A;  3HOV B;  3NPP A;  3J80 E;  4DR1 L;  4Y7N H;  1P16 A;  1LT3 D;  2F0K A;  1VQJ A;  1R4P B;  4JI4 L;  1I6H B;  1CI3 M;  2A69 C;  1Y1W G;  4LF4 Q;  1UE7 A;  2IHE A;  1QIL A;  3MHB A;  2NVY B;  1LYL A;  1TXY A;  4C3J B;  2F0Q A;  1PH4 A;  5COR A;  5AJ3 Q;  1JOR A;  1TS5 A;  2R93 B;  1EQT A;  5M5Y B;  3I7F A;  5ELB A;  2YTY A;  1MJC A;  3A8J E;  4CKC A;  2K50 A;  2RCF A;  3OW7 A;  1WJJ A;  3RZO H;  1VQO A;  3S9W A;  4JI6 Q;  4NXM Q;  4OO1 H;  1Q46 A;  3K59 A;  2NVT B;  2KEE A;  5FJ8 G;  1VCI A;  2F0D A;  1HNW Q;  4X62 Q;  1N32 Q;  2IHF A;  2NN6 H;  1RKN A;  5I9P A;  3JAM L;  1Q90 A;  3A0J A;  3J80 L;  1SE2 A;  2X6L A;  5LMU L;  3NBH B;  3LWU A;  2MGS A;  3CCM A;  4HIK A;  3CCQ A;  4WJ3 M;  2B63 G;  1ZXT A;  1NJI C;  2B2Y C;  3BVZ A;  5JEA G;  4LF5 Q;  1BCP B;  1I4Q A;  4A3J H;  1XPU A;  1UEB A;  2RKS A;  1K8G A;  4UPA A;  4CDC C;  4R8I A;  1K3B C;  3HP3 A;  5M3M G;  2E5L L;  2XRQ D;  5JOB A;  4I7Z C;  5DM6 3;  4MTK A;  1W6J A;  2OQK A;  5CYU A;  3DUZ A;  3NTH A;  4BY7 H;  1B9M A;  1TWG H;  3CKI B;  2NVX H;  2VUM B;  3TS0 A;  3KFU A;  4KJN A;  1MSG A;  3TBI B;  5KND A;  1OXX K;  1BCP F;  2R7Z H;  2C9O A;  1VQI A;  3KBX A;  3J81 i;  1VQB A;  1MI2 A;  4HSP A;  1Q86 C;  2PW5 A;  1XJV A;  3S1N H;  1PZK D;  2L4N A;  2IX3 A;  3DEP A;  4L63 B;  2RHS B;  1ESF A;  4P2C B;  4ZK9 B;  5ELF A;  2LY7 A;  4LFC L;  2AUJ D;  3QJY A;  1SYG A;  4FP5 D;  3GP7 A;  1F9R A;  4RG1 A;  2Q2T A;  1ZKO A;  1PRT C;  1SDF A;  2EXZ A;  1S4Z A;  1MHW C;  2I5H A;  3UE1 A;  1IKL A;  1RIP A;  3KDF A;  5GAD C;  4YWM A;  2QW7 A;  1S5B D;  2EVB A;  3O13 A;  2Q8I B;  1PH6 A;  3CCR A;  2HD3 A;  4DR5 Q;  2K5V A;  1FJG Q;  3M4Y A;  1LTR D;  3ONA B;  3G4S A;  3CU7 A;  5GAE C;  4BS9 A;  1WYD A;  3SHL A;  3HFZ B;  4RCN A;  1OXT A;  4DR6 L;  2DNE A;  4Z9C B;  4C3H H;  4EGV A;  4LMQ D;  3HS0 C;  1I5F A;  4FF2 A;  2PW7 A;  3PMF A;  2N49 A;  2F0O A;  2MP1 A;  1V9P A;  1MKH A;  1A3V A;  2PI2 A;  1L0Y B;  4KD3 A;  1H9J A;  2IJ0 A;  4DPG A;  4BBS H;  2V4D A;  4DV7 L;  1SYF A;  2LFN A;  1Q8K A;  1WI5 A;  5IE8 A;  1P8L A;  1CM9 A;  2F4V Q;  3C3L A;  4G57 A;  4IAL A;  4LF8 Q;  1UUP A;  3HOW H;  1NR2 A;  3JAM c;  1IYU A;  4JYA Q;  2UU9 Q;  1DD2 A;  5CBE E;  3J80 c;  3HOU B;  1FNW A;  1IHZ A;  3H3V I;  1U4R A;  3GTQ B;  1YJ9 A;  1XXG A;  1L1O C;  3PUX A;  5JJL A;  3J81 j;  2FJ2 A;  1WCM H;  3MEH A;  1IXR A;  1T5E A;  1STG A;  5DNF A;  3QG1 A;  2Z6B A;  2N8N A;  1VS0 A;  5EPL A;  2K5Q A;  3Q6S A;  1W2B A;  5A35 A;  1EU3 A;  1SFO B;  1D8L A;  3CQZ H;  3V05 A;  1JE4 A;  3C2P A;  3A74 A;  3TP6 A;  2JEB I;  1GKH A;  1WD1 A;  1SEB D;  2NZO A;  2K5W A;  1PZI D;  4K5V A;  3PIO 3;  1JMC A;  1T5X D;  3PIP 3;  4B9X A;  2E2D C;  4K2L A;  1TT2 A;  1GUS A;  4OL7 A;  4RKL A;  4DUY L;  5C0X G;  1Y14 B;  2EZV A;  4IUN A;  3D31 A;  4GOP A;  1PH7 A;  2DY8 A;  5DEH A;  1N34 L;  1F2Z A;  3A7L A;  2OF1 A;  3DXJ C;  3GTL B;  3HOX H;  3J7Y W;  2CW0 C;  3RLO A;  1B50 A;  2RCN A;  2HIV A;  1SRU A;  3TS2 A;  5IGC A;  1HJP A;  2EY6 A;  4GNX A;  3GD7 A;  2Z1C A;  3CAM A;  4P73 A;  4DNI A;  1C9O A;  3HOZ B;  2F0L A;  1SYB A;  2MFI A;  5CC4 A;  4LNQ A;  1A0I A;  2KED A;  2MHV A;  1EZ8 A;  5IY0 A;  4X3U A;  3I56 A;  3PCO B;  3I4M G;  1F77 A;  4R8N A;  3UDI A;  1HPC A;  4A3C H;  2B29 A;  3NQT A;  1PTO C;  2C35 B;  4A3G H;  3TRZ A;  3K58 A;  3RN5 A;  5GAG C;  4ID6 A;  4PZ6 A;  5IYB G;  3KLW A;  2L9H A;  2CQO A;  1S5E D;  1ASY A;  2GVB A;  4PNY A;  1TU2 B;  1O7I A;  2JA8 H;  4C1N K;  4LW1 A;  4AH6 A;  4A3F B;  5IP7 H;  3DM1 A;  2F52 A;  2B8G A;  4QIW B;  1X54 A;  4JI1 Q;  4JBW A;  3NE5 B;  2X6G A;  1BBU A;  2A68 D;  1U4M A;  2JA5 H;  3S14 H;  1TQO A;  1TWA B;  3W2D A;  3WDN A;  2EOT A;  4AYB G;  1VQN A;  2Q8T A;  5IIF A;  2JP1 A;  2PMZ B;  3W5O A;  2R61 A;  2O2L D;  2NTT A;  1EY0 A;  4OO1 G;  3ZJY C;  5JEA J;  2ASB A;  2WP8 J;  3KJO A;  1SMY D;  4DR7 Q;  5IWA L;  4A3I B;  2UXB Q;  3GTJ H;  1VQ9 A;  1I4R A;  2PQA B;  5I6Y A;  1XYI A;  2G5D A;  1A8V A;  2VY3 A;  3ITP A;  5FO9 B;  2HHH Q;  3LGJ A;  5IGF A;  2CVR A;  4FF1 A;  2XVS A;  4PMC A;  2YV5 A;  2BOS A;  3U9O A;  1JWU D;  1Y1W H;  2R92 B;  1Y1V B;  1TWF B;  3RLF A;  1ASZ A;  3TDQ A;  2OEO A;  3R2T A;  5E4W C;  4A3J G;  2OCE A;  3V2T A;  2F0F A;  4X64 Q;  4JBM A;  2JK8 A;  4H02 A;  1NNX A;  3HKZ G;  2F03 A;  3S15 B;  4ZUI A;  4A3M H;  5M3F H;  4JI3 Q;  5BN4 A;  3QOJ A;  3GTO B;  2CFM A;  4BY7 G;  3PO2 B;  2MPM A;  2A6E C;  4H0L C;  2B2V A;  2ZM6 L;  1DGS A;  2UXC L;  4KY6 A;  4QY7 A;  1TY2 A;  1M4V A;  1IBM L;  2XNA C;  3PUW A;  1J6Q A;  4AYB E;  3VYT A;  4OON A;  3L2P A;  1K3R A;  2R7Z G;  4DAM A;  5EAY A;  5C44 H;  4LFB Q;  4F88 A;  2IX0 A;  1UWV A;  5CV7 A;  2PZT A;  2XTI A;  3FKI B;  2RF4 A;  1H9M A;  4QB4 A;  5HY6 A;  4DV5 L;  1QG7 A;  4K6L A;  1ONL A;  5JEA H;  2E2H H;  1I3Q H;  1CK1 A;  1IYJ B;  3RR5 A;  5EPJ A;  1JIC A;  3DWQ A;  3FVQ A;  1EZ6 A;  2JQO A;  1EY7 A;  3I55 A;  1W3S A;  3AMU A;  3VR6 A;  2F1M A;  3I90 A;  5BR8 Q;  4G4K A;  3CQZ B;  2WAQ E;  4C1N I;  1EY8 A;  1PTO H;  2EY1 A;  2KCC A;  1UE1 A;  3I70 A;  4OGQ C;  4RMF A;  1IBL Q;  2VQF Q;  1ESR A;  4RHS A;  2KOL A;  1JWS D;  3PF4 A;  1HR0 W;  1PLF A;  1IW7 D;  4OX9 L;  2HT1 A;  4YHH Q;  3CRL C;  2EY2 A;  1HTL D;  1PV4 A;  5LL6 X;  2I5L X;  3K5L A;  2HDL A;  1SRO A;  4GKJ Q;  1YNN C;  3Q24 A;  3HKZ E;  5D65 A;  4X66 Q;  4B3M Q;  1VQA A;  2K04 A;  4OHJ A;  4JBK A;  4C3H G;  3I2Z A;  3S1R H;  1HQM C;  2I5M X;  3E6Z X;  4HR7 B;  1AZP A;  3HOX B;  3ICE A;  3D6C A;  3K6O A;  4JI2 Q;  1BDO A;  1G29 1;  3G6E A;  1G2S A;  1B7Y B;  3A8K E;  4PMB A;  1XMO Q;  1JOQ A;  3P1H A;  3M7G A;  3T53 B;  1PRT B;  1H9R A;  1SAP A;  4P72 A;  4LUZ A;  3OHX C;  1PH9 A;  2WB1 G;  1KLG D;  4YY3 Q;  3S2D B;  3K5O A;  4L5S A;  4BBS G;  2BE5 D;  5KNB A;  4ILW A;  4J6H A;  1QWY A;  1D6E C;  1EU4 A;  1V1O A;  4DR3 Q;  5IP9 H;  1A6X A;  1ENA A;  4IO9 A;  2R7F A;  4TRD A;  4IJH A;  1KRT A;  3HOW G;  4IFD H;  1DCZ A;  4LFA Q;  2CHB D;  2SEB D;  1CT1 D;  4G7O C;  4H7B A;  2AHO B;  1LUZ A;  1HR0 Q;  4RHR A;  3RZD B;  1PRT F;  3GQB A;  1CQF A;  2DJG C;  4NW2 A;  3NBH A;  1WCM G;  1RL2 A;  4QF4 A;  1EUJ A;  2BA1 A;  3CCS A;  2JA5 B;  3S1M B;  2F0P A;  2JA7 H;  2EXD A;  1E0B A;  1CHQ D;  1E1O A;  1SNM A;  4JCV E;  2ZJR A;  4A3B H;  1UE6 A;  4DV2 Q;  1Z6H A;  2IW3 A;  1VMC A;  3G6J B;  3EN2 A;  4JOI A;  5IGD A;  5M5W B;  1YNJ D;  4HAE A;  4IPD A;  5C3E G;  1O7Y A;  5C3X A;  1LAB A;  4NKL A;  4DV6 Q;  4LF4 L;  2A69 D;  4C56 C;  4IJL A;  2EYO A;  1ENF A;  3GTJ B;  2BDO A;  5AJ3 L;  1E22 A;  4WRD A;  3TP7 A;  3H6M A;  4NPS A;  4B3T L;  1GUW A;  2L0C A;  2EQS A;  4RFB A;  3BS1 A;  1L1O B;  2LSS A;  2WB1 E;  1J9O A;  1V43 A;  4JG2 A;  1X56 A;  4LAA A;  1DON A;  1CFM A;  1HCZ A;  3K7A H;  5C0X I;  5KRU A;  4UDU C;  4JI6 L;  5DLQ E;  1BVS A;  1Y1W B;  3HEJ A;  3BVG A;  1QNK A;  3HOX G;  4R4I A;  5KYI A;  1HNW L;  4X62 L;  1OO9 B;  2B2W A;  1N32 L;  1KQS A;  1LAC A;  4QL5 A;  2D0P A;  2R6G A;  2LMC B;  2NYZ D;  1KNE A;  4OXP A;  1KDC A;  4CHT B;  1UAP A;  4V0B A;  3F2U A;  3CC4 A;  4H44 C;  3PIO A;  5IT9 L;  1A15 A;  4ME3 A;  3PIP A;  2OTL A;  4DK0 A;  4EQN A;  3EA6 A;  4FF3 A;  1WTH A;  5ELO A;  1JT8 A;  5KIX A;  5EKI A;  1D5M C;  3G71 A;  4A3C G;  3IAY A;  1A63 A;  4A3G G;  1EWI A;  3BDO A;  4A3L H;  3R3O A;  2QEJ C;  5C4J B;  2UUA Q;  4MIU A;  4NXN L;  1L0W A;  2JA8 G;  4YWL A;  4C2M H;  5IP7 G;  1A3T A;  2KHJ A;  1EFW A;  2B63 B;  1O7L A;  1KDA A;  3F1Z A;  4DA2 A;  2QGQ A;  2JA5 G;  2E2H B;  1I3Q B;  2AWO A;  2E2I B;  1HRJ A;  2M9V A;  3ER0 A;  1EIH A;  1Z7T A;  3M3Y B;  3S1Q H;  2K75 A;  4BY1 H;  1K8M A;  2OTJ A;  4PZ7 A;  1WTO A;  3A56 A;  5M3M B;  3VA5 A;  4NB3 A;  5GQO A;  1C48 A;  3GTG H;  3I91 A;  5NUC A;  4OO1 I;  2N88 A;  2Z6K C;  2VL6 A;  4C3I H;  5FOB B;  2NN6 I;  1BOS A;  1EOT A;  1G2T A;  1YNJ C;  3AFP A;  4LWC A;  2WKD A;  4CJ2 C;  5G3L D;  2G9H D;  1VQM A;  3R8B A;  4UP8 A;  1X3G A;  2MO0 A;  4ZKC B;  2E74 C;  4DR2 Q;  1EFI D;  5JJI A;  2B2U A;  1PRT D;  2Q2H A;  2UXD Q;  2F0U A;  1C7Y A;  2A6H C;  4XIG S;  4JI8 Q;  1Q1B A;  1B9N A;  2QDL A;  3EIV A;  4Q0F A;  2FMM A;  5JVH 3;  1XX8 A;  2M00 A;  1S5F D;  4QQB X;  4DR5 L;  3L3O C;  4RGM A;  4ZAI A;  5C4X H;  1FJG L;  3WOF A;  1NMF A;  1OXS C;  1AE3 A;  1A2T A;  4DV4 L;  1KIX A;  4A3M G;  5M3F G;  1UEA B;  5I4D A;  4WJ4 A;  1GUO A;  3TQY A;  2F0S A;  5BN3 A;  2HCC A;  3PO3 G;  2WII B;  3KLR A;  2F0V A;  4DXF A;  4LF6 Q;  1B4O A;  4UHV A;  3J80 i;  5C44 G;  2D5D A;  3HZX A;  3K5N A;  3S2H H;  1RTN A;  4XT3 B;  1TR5 A;  1YVC A;  2KEC A;  3NSW A;  2F4V L;  3OPO A;  5L37 A;  4P75 A;  4LF8 L;  1H9K A;  3VR3 A;  4EQ5 A;  4JYA L;  1QCB D;  2PNH A;  4M1U B;  3C1F A;  1N9W A;  3MTS A;  2E75 C;  5EQ0 A;  2BCO A;  1SE8 A;  4KHP Q;  1GJX A;  1NCV A;  1NY4 A;  2B2T C;  5IT9 c;  3MVV A;  4MZ9 A;  4ZKB B;  2KCT A;  2EJF C;  4ZYS A;  2L11 A;  1BBW A;  2Z9H A;  3CCV A;  3A8I E;  1HZC A;  1SYC A;  3MXU A;  1X65 A;  4POG A;  2RHQ B;  1O7Z A;  3NUC A;  1L0X B;  3A55 A;  1TWH H;  3IKJ A;  3GTM B;  2K6A A;  3VYR A;  1SN8 A;  4XYO A;  3AYH B;  4OEM B;  2UUC L;  5ELE A;  3SVM A;  5AFW A;  1JOK A;  5D3D A;  2KQ3 A;  1I4P A;  5H1S E;  1NAP A;  3F2B A;  1GUT A;  1R4Q B;  3QOL A;  2V1C C;  3CMA A;  2H4O A;  2KHI A;  5LL6 S;  4JI7 Q;  1YHA A;  1JC7 A;  1G6Z A;  3M9B A;  1HQR D;  3NEL A;  4EQP A;  4FF4 A;  4WFN 3;  4JI0 Q;  4ULL A;  4R4O A;  4B08 A;  1I94 Q;  3GTP H;  1DJR D;  5IP9 G;  3CME A;  4GOP C;  3MFY A;  2D9U A;  4X3K A;  3OMG A;  1J5E L;  3AB9 A;  4K14 A;  1KD1 C;  1B3A A;  1U4P A;  3FDT A;  4IFD G;  1PMR A;  2CW0 D;  4GNX C;  2PQA A;  4ALP A;  1A3U A;  1EEF D;  4DR1 Q;  1SE3 A;  1XPR A;  3IFD A;  1X55 A;  3SK4 A;  3MC0 B;  4RCO A;  3D4D A;  1E7Z A;  3NP8 A;  3MZ5 A;  2KCM A;  4YCW A;  3OOC A;  1PFS A;  4HED A;  1ET9 A;  4IZ8 A;  4XQJ A;  1Y8O B;  3OIP A;  5EJW A;  4L5Q A;  2N78 A;  2JA7 G;  2J4X A;  1C8C A;  4A3D H;  1PTO D;  1QNU A;  4OIJ A;  1G91 A;  3S1Q B;  4A3B G;  3U4Z A;  4KY5 A;  1F2L A;  3SDZ A;  2O5J C;  5GRO A;  2K33 A;  4CKE A; 
#chains in the Genus database with same CATH homology
 2ZXR A;  3I4M B;  4RKB A;  1GHK A;  3PUY A;  1EY6 A;  1EYA A;  1IYV A;  1RJT A;  4O42 A;  1FNV A;  1NR4 A;  2KA7 A;  4Y7N B;  5IOC A;  2R3Z A;  1PXU A;  3WOE A;  2B2Y A;  1D1I A;  5EKL A;  4FYD A;  1STN A;  4B9W A;  1CQV A;  4E6I A;  4AYB B;  5EPK A;  3D4R A;  3BZD B;  2AQ3 B;  3FPP A;  3W3A A;  5C4X B;  5CMD A;  2K28 A;  3RZO B;  1Z47 A;  5T1G A;  2Z8L A;  2G9D A;  1HA6 A;  4ABN A;  2EYJ A;  1PZJ D;  3U9S A;  3P20 A;  3TSS A;  1HFG A;  2Z4I A;  1AEX A;  3BYT B;  1F2M A;  2SDF A;  4HMJ A;  4PQX A;  2RSO A;  2EE1 A;  3S2H B;  5JAV A;  2Q8R E;  1SYE A;  5I2X A;  2A6E D;  4A3J B;  3TZU A;  5KEE A;  1Q3L A;  5I9O A;  1Y8P B;  4TKO B;  5A2Q L;  5CBA E;  1FR3 A;  3HKZ B;  2K03 A;  3D6W A;  4DNR B;  4DN4 M;  1I4X A;  3P75 A;  3T16 A;  1LO5 D;  1QE6 A;  4C3I G;  4ZLT F;  4K2K A;  4BY7 B;  1TWG B;  1B1Z A;  2NVX B;  4XQQ A;  2VB2 X;  2QF7 A;  4EVO A;  3Q23 A;  2R7Z B;  1EWC A;  2ICI A;  2QKI C;  1LTT D;  4IUR A;  5BN5 A;  1WTR A;  3SEB A;  3S1N B;  2TSS A;  1DOL A;  3K0Y A;  4QCL A;  5DM7 3;  3PUV A;  4KI0 A;  2RVL A;  2ZXO A;  3C46 A;  3L9A X;  3ERO A;  1SNP A;  4JK1 C;  1G8Z D;  3VR4 A;  1RDP D;  2CQA A;  3GTP B;  1YNN D;  3NTK A;  4KV6 A;  2MUY A;  1I4H A;  3I73 A;  3RMH A;  3DWA A;  3I72 A;  4KMU C;  2DN8 A;  2NZ1 D;  1W6K A;  2AQ2 B;  3NQI A;  2IX1 A;  1EY4 A;  4C3H B;  1WTP A;  4L6T B;  2NTS A;  1TS2 A;  2EPB A;  5T1I A;  2B8F A;  2RDF A;  4H13 C;  2WB1 B;  1AW7 A;  1U9R A;  4G7Z C;  4BBS B;  1JR0 D;  2JE6 I;  1SSO A;  3IFT A;  5J22 A;  4XQN A;  3SK5 A;  1SYD A;  1HFN A;  3FRP B;  3HOW B;  4NDX A;  3Q22 A;  1BCP C;  4L8J A;  1GOZ A;  3EJI A;  1BNZ A;  3X3M A;  1Q8I A;  3ND9 A;  3BDL A;  3BG3 A;  4IFD J;  1WCM B;  4DNT B;  1LTS D;  2K05 A;  3EVQ A;  2O4X A;  2NBF A;  3NK9 A;  2WAC A;  5C3E B;  1E2Z A;  2RDG A;  3CHB D;  1ROD A;  2F0W A;  2F0M A;  3H09 A;  1UNS A;  2XIW A;  2I07 B;  2K01 A;  4DAV A;  3QB3 A;  4WJW A;  1II3 A;  3LWE A;  1TY0 A;  1JWM D;  2HDM A;  5CR3 A;  1RF2 D;  4RAU C;  1WTW A;  2IT1 A;  4LJZ C;  1D5X C;  2VB3 X;  2NB0 A;  3N52 A;  4RGO S;  4ODG A;  1TKW B;  1F2Y A;  3A54 A;  1X32 A;  1JB3 A;  2H1E A;  2EYF A;  1MBY A;  1HUN A;  1EQV A;  1Q1E A;  4A3G B;  2L12 A;  5G3L F;  2NWG A;  4CJ1 B;  1SNO A;  2MJ8 A;  2JA8 B;  4RWS C;  3VYU A;  4FO2 A;  5C5M A;  1EIG A;  2TMP A;  4QMG A;  1ILP A;  1CTM A;  3S14 B;  1LT5 D;  4V19 0;  1B2T A;  1SE4 A;  4HN7 A;  1LTI D;  2SOB A;  2XSC A;  4X3S A;  5FKA C;  5IT9 E;  2XWJ B;  1SJH D;  4TSS A;  2XWB B;  4IUV A;  4FVM A;  1E2V A;  1O80 A;  2L5T A;  4CKB A;  1FYC A;  5I2Y A;  2A6H D;  4PV1 C;  2FFK B;  5I6W A;  2N55 A;  1ML0 D;  2WKC A;  4K8I A;  4NP5 A;  1O78 A;  1H9S B;  3SR1 A;  3HG9 A;  2K1B A;  1F9P A;  4DK1 A;  1AZQ A;  2F0E A;  1B44 D;  1VDZ A;  3J7A F;  3NHH A;  5C6A A;  2QDB A;  1DXM A;  1SNC A;  5M3F B;  4A3M B;  3BVM A;  4BA2 I;  2WIN B;  1BR9 A;  2BDN A;  4IN3 A;  1SND A;  1KTK A;  1LLR D;  3PO3 B;  1QOH A;  3AU7 A;  2RQX A;  1MD2 D;  2VNU D;  2OT2 A;  5C44 B;  4XYQ A;  1GXD C;  2EYP A;  5JVG 3;  2ICE C;  2JXM B;  1STY A;  2RDH A;  2EJM A;  5ELD A;  1V1P B;  2EJG C;  5K5P A;  3H91 A;  3C1E A;  4XXE A;  2SNM A;  5FO8 B;  1CA5 A;  1PFN A;  2F0H A;  1KDB A;  3RUZ A;  1PTO B;  1KLU D;  1X3Q A;  1ZYR C;  1K8O A;  2O5I C;  1WVL A;  5TSS A;  2J0T D;  1EY9 A;  2IL8 A;  5IGE A;  4UAI A;  1KAA A;  2OXP A;  3TN2 A;  3NBI A;  4ZUJ A;  2QCP X;  2PZW A;  1STB A;  1IKM A;  2D62 A;  3S1R B;  4LK1 C;  5D14 A;  1LTA D;  4J8Q A;  4ZQ3 A;  3MXN A;  1C4Q A;  4HSV A;  1PTO F;  2HCI A;  1F9S A;  4K5W A;  1ZEQ X;  1XWE A;  2L55 A;  2DNC A;  1EYD A;  2RSN A;  3J7A V;  4U68 A;  5K36 H;  5E3F A;  1EL0 A;  1NUC A;  1TVX A;  1LT6 D;  3URY A;  2KUM A;  1DZ1 A;  1JCK B;  2EDG A;  3G7L A;  4KKU A;  2PCF B;  4IUQ A;  1DOM A;  1OXU A;  3FEW X;  3M85 A;  4KJO A;  3NWT A;  2AQ1 B;  2JA7 B;  2F0T A;  3FPU B;  2KJX A;  4A3B B;  2DY7 A;  4CBV A;  3J81 E;  4N9P A;  5F2D A;  4CJ0 B;  5KYL A;  4DGZ A;  3DWP A;  3SK6 A;  4DAP A;  1I6V C;  1JQY D;  2Y0S B;  3K7A B;  4MN3 A;  1EEI D;  3KBG A;  5EBD A;  2L1B A;  1S5C D;  3I4N B;  1PYW D;  3A7A B;  3TZD A;  5KGU A;  1PDQ A;  4M8A A;  3J81 L;  1GUN A;  3ERQ A;  1RD9 D;  3I4L A;  1SJE D;  2RA4 A;  3H3V C;  4C3J G;  1Q12 A;  3VR5 A;  2XRS D;  1HA5 A;  5EGT A;  4KN4 C;  1BXT A;  1BUV T;  3VA7 A;  3L7Z C;  1LTB D;  2J7Z A;  4DAY A;  1AFP A;  4CGY B;  4J1M A;  1J8I A;  1M8A A;  1DYQ A;  4C2M B;  3CRK C;  3T13 A;  3EFX D;  4HMI A;  1SNQ A;  4XDX A;  4IUP A;  1HHV A;  2LS0 1;  1MGS A;  4KD4 A;  4BY1 B;  2IPK D;  2JYO A;  3TP5 A;  3GTG B;  2X69 A;  3ZYY X;  5COY A;  3N6R A;  2F0G A;  4C3I B;  3FMC A;  1PFB A;  1ET6 A;  1GHJ A;  3KUP A;  4XT1 B;  4G7H C;  2ZXP A;  2EYH A;  3QO2 A;  2EYM A;  2F4I A;  3GV6 A;  2EYL A;  5IGG A;  2K5D A;  2HUG A;  4KK7 A;  5A2Q E;  2B2T A;  4PMW A;  4O1N A;  4DF7 A;  1STA A;  3LNN A;  1JOO A;  4KY7 A;  4DFA A;  1X3P A;  4X3T A;  5C4H A;  2JSO A;  1EY5 A;  3QWN A;  5ISR A;  2Z4H A;  3Q0A A;  1IL8 A;  5HUR A;  3PUZ A;  3MWY W;  2AWN A;  1LT4 D;  2WAQ B;  5IGB A;  4OIK A;  3NWS A;  3OWE B;  1ILQ A;  4U67 3;  1GUG A;  5FLX E;  1DOK A;  4HCE A;  4RA8 A;  2B2V C;  2PPB C;  4KKS A;  1QJO A;  2XN9 C;  1CZW A;  3HOY B;  4RH6 A;  3M4O B;  4MHE A;  4EQO A;  4S3S A;  5C3W A;  1BCP D;  3MFG A;  4BA1 I;  4YIJ A;  2KVM A;  2SNS A;  1RHP A;  1RTO A;  4F87 A;  1TS3 A;  1STE A;  1TWH B;  5C4Z A;  3R93 A;  2PQE A;  3GV3 A;  5FLX L;  3NTI A;  1SBB B;  4F8M A;  1VMP A;  1FD7 D;  3R2I A;  4HCS A;  3SXH A;  5K36 G;  3D4W A;  4RGN A;  2PYK A;  5KNC A;  2F0N A;  1KAB A;  1S5D D;  2FHT A;  2KCN A;  2D2C C;  1SXT A;  4ME5 A;  1U4L A;  2KHS A;  1Y69 U;  5FO7 B;  4RGT A;  3T56 B;  2F0J A;  1MSH A;  4KHV A;  1I50 B;  3KK7 A;  5DAU A;  1H9S A;  5FK9 C;  2NN6 G;  3I3C A;  5JJZ A;  2E76 C;  3E0J A;  4A3D B;  4KTA A;  4TQU S;  5E1F A;  2C5C A;  4FNF A;  2EY5 A;  1FNU A;  3BYY B;  4R9W A;  4I65 A;  1VF7 A;  1D1K A;  4NMZ A;  3GO5 A;  1LV9 A;  4FXG C;  1R9T B;  1NSN S;  2F3W A;  3H0G B;  3H94 A;  5JPN C;  1B53 A;  5E4X A;  3SE0 A;  2JEA I;  4N9T A;  3HGB A;  4A3K B;  3ND8 A;  1TWC B;  2QIL A;  1RCV D;  5HGT A;  4FXK C;  1WTX A;  1BO0 A;  4HTH A;  1V1P A;  1A2U A;  4K6D A;  1CZG A;  1HUM A;  1EYC A;  2PO4 A;  2E2J B;  3M7N A;  2B2W C;  3S16 B;  4Q5V A;  4IFD I;  1VF5 C;  1WD0 A;  3S17 B;  3TME A;  1CHP D;  1STH A;  1TII D;  1F9Q A;  2GA4 B;  1QB5 D;  2I46 A;  2A68 C;  1BQQ T;  3BDC A;  3KF8 A;  3KLS X;  2NVQ B;  5EBC A;  3MXP A;  4A3E B;  2K32 A;  1XTC D;  5CV5 A;  1SMY C;  1EWH A;  4XTC S;  5LHY 1;  5CV4 A;  2BA0 A;  5D3I B;  3V96 A;  2PZU A;  4F7X A;  1HXY D;  2NUC A;  3IL8 A;  3EQL C;  3MAQ A;  1WTV A;  1HTP A;  2PNR C;  3DMU A;  5CV8 A;  3T51 B;  3NXW A;  1WTQ A;  4A93 B;  4GZY C;  2A73 B;  3MXG A;  1ZYR D;  3E5S A;  3P7J A;  3I8Z A;  2IWH A;  1ENC A;  3OWF A;  5M9O A;  3D8G A;  5CGK A;  5IOD A;  3SK8 A;  3OMC A;  1TS4 A;  2B2U C;  2M2L A;  5C0X J;  4KHZ A;  3T4A C;  2FIN B;  4DXG A;  3DEO A;  2JA6 B;  5JPM C;  1DM0 B;  5ELC A;  5CV6 A;  3LX0 A;  2F3V A;  3KLS A;  2WV6 D;  1E2W A;  3UI2 A;  3MA2 B;  3X3N A;  2YU9 B;  4DU9 A;  1BF4 A;  1BBX C;  4IUU A;  2K7V A;  2RBM A;  4ZRZ A;  3PV0 A;  1IW7 C;  1CA6 A;  2A5H A;  4FXD A;  3OSO A;  1LTG D;  5M5X B;  4BWG B;  3DHQ A;  3RD4 A;  1I4G A;  2FMC A;  2YYZ A;  1OXV A;  3K57 A;  4K8J A;  5J39 A;  4IQZ A;  4IUT A;  2VXW A;  1AP0 A;  2AUK A;  4KN7 C;  2ZT9 C;  3VR2 A;  2BE5 C;  3TP8 A;  4QUC A;  5C0X H;  1K83 B;  1FGB D;  3GTK B;  5EKK A;  5C5L A;  4K5X A;  1V8Q A;  2B39 A;  3HRZ C;  5J1Z A;  2ID0 A;  2ENB A;  1KNA A;  1Y8N B;  3K5M A;  4KKT A;  5CV9 A;  1PFM A;  3QIA A;  4WOR A;  1D2B A;  4BBR B;  2A74 C;  2F0I A;  2HQE A;  3OIQ A;  2LKV A;  1ICW A;  1D5Z C;  3VYS A;  3D3R A;  3JAM E;  4QUF A;  1AN8 A;  3HOV B;  3NPP A;  3J80 E;  1LT3 D;  2F0K A;  1R4P B;  1I6H B;  1CI3 M;  2A69 C;  1QIL A;  3MHB A;  2NVY B;  4C3J B;  2F0Q A;  5COR A;  1JOR A;  1TS5 A;  2R93 B;  1EQT A;  5M5Y B;  5ELB A;  3A8J E;  4CKC A;  3OW7 A;  3S9W A;  4OO1 H;  3K59 A;  2NVT B;  2KEE A;  1VCI A;  2F0D A;  2NN6 H;  1RKN A;  5I9P A;  3JAM L;  1Q90 A;  3J80 L;  1SE2 A;  2X6L A;  3LWU A;  2MGS A;  1ZXT A;  2B2Y C;  3BVZ A;  5JEA G;  1BCP B;  1I4Q A;  2RKS A;  4R8I A;  3HP3 A;  2XRQ D;  5JOB A;  4I7Z C;  5DM6 3;  1W6J A;  5CYU A;  3DUZ A;  3NTH A;  1B9M A;  3CKI B;  2VUM B;  4KJN A;  1MSG A;  3TBI B;  5KND A;  1OXX K;  1BCP F;  2C9O A;  3KBX A;  1MI2 A;  4HSP A;  2PW5 A;  1PZK D;  2L4N A;  2IX3 A;  3DEP A;  4L63 B;  1ESF A;  4P2C B;  4ZK9 B;  5ELF A;  2LY7 A;  2AUJ D;  3QJY A;  1SYG A;  4FP5 D;  3GP7 A;  1F9R A;  1ZKO A;  1PRT C;  1SDF A;  2EXZ A;  1S4Z A;  1IKL A;  1S5B D;  2EVB A;  3O13 A;  2Q8I B;  3M4Y A;  1LTR D;  3ONA B;  3CU7 A;  4BS9 A;  3SHL A;  4RCN A;  1OXT A;  2DNE A;  4Z9C B;  4EGV A;  4LMQ D;  3HS0 C;  4FF2 A;  2PW7 A;  3PMF A;  2F0O A;  2MP1 A;  1A3V A;  1L0Y B;  4KD3 A;  1H9J A;  2IJ0 A;  2V4D A;  1SYF A;  2LFN A;  1CM9 A;  3C3L A;  4G57 A;  4IAL A;  1UUP A;  1NR2 A;  1IYU A;  1DD2 A;  5CBE E;  3HOU B;  1FNW A;  1IHZ A;  1U4R A;  3GTQ B;  1XXG A;  3PUX A;  2FJ2 A;  3MEH A;  1T5E A;  1STG A;  5DNF A;  3QG1 A;  5EPL A;  2K5Q A;  3Q6S A;  5A35 A;  1EU3 A;  1SFO B;  3V05 A;  1JE4 A;  3C2P A;  3TP6 A;  2JEB I;  1WD1 A;  1SEB D;  2K5W A;  1PZI D;  4K5V A;  3PIO 3;  1T5X D;  3PIP 3;  4B9X A;  2E2D C;  4K2L A;  1TT2 A;  1GUS A;  4OL7 A;  4RKL A;  5C0X G;  2EZV A;  4IUN A;  3D31 A;  2DY8 A;  5DEH A;  1F2Z A;  3A7L A;  2OF1 A;  3DXJ C;  3GTL B;  3J7Y W;  2CW0 C;  1B50 A;  5IGC A;  2EY6 A;  3GD7 A;  2Z1C A;  3HOZ B;  2F0L A;  1SYB A;  5CC4 A;  2KED A;  2MHV A;  1EZ8 A;  4X3U A;  1F77 A;  4R8N A;  1HPC A;  3NQT A;  1PTO C;  3K58 A;  4ID6 A;  2L9H A;  1S5E D;  4PNY A;  1TU2 B;  4C1N K;  4A3F B;  3DM1 A;  2B8G A;  4QIW B;  4JBW A;  3NE5 B;  2X6G A;  2A68 D;  1U4M A;  1TQO A;  1TWA B;  3W2D A;  3WDN A;  2EOT A;  2Q8T A;  5IIF A;  2JP1 A;  2PMZ B;  2R61 A;  2O2L D;  2NTT A;  1EY0 A;  4OO1 G;  5JEA J;  2WP8 J;  1SMY D;  4A3I B;  1I4R A;  5I6Y A;  1XYI A;  3ITP A;  5FO9 B;  5IGF A;  2CVR A;  4FF1 A;  2XVS A;  4PMC A;  2BOS A;  3U9O A;  1JWU D;  2R92 B;  1Y1V B;  1TWF B;  3RLF A;  3TDQ A;  2OEO A;  3R2T A;  5E4W C;  3V2T A;  2F0F A;  2F03 A;  3S15 B;  4ZUI A;  5BN4 A;  3QOJ A;  3GTO B;  3PO2 B;  2MPM A;  2A6E C;  4H0L C;  2B2V A;  4KY6 A;  1TY2 A;  1M4V A;  2XNA C;  3PUW A;  3VYT A;  4F88 A;  2IX0 A;  5CV7 A;  2PZT A;  3FKI B;  1H9M A;  4QB4 A;  1QG7 A;  4K6L A;  1ONL A;  5JEA H;  1CK1 A;  5EPJ A;  1JIC A;  3DWQ A;  3FVQ A;  1EZ6 A;  1EY7 A;  3AMU A;  3VR6 A;  2F1M A;  3I90 A;  4G4K A;  3CQZ B;  4C1N I;  1EY8 A;  1PTO H;  2EY1 A;  2KCC A;  3I70 A;  4OGQ C;  1ESR A;  4RHS A;  2KOL A;  1JWS D;  1PLF A;  1IW7 D;  3CRL C;  2EY2 A;  1HTL D;  5LL6 X;  3K5L A;  2HDL A;  1YNN C;  3Q24 A;  5D65 A;  2K04 A;  4OHJ A;  4C3H G;  1HQM C;  3E6Z X;  4HR7 B;  1AZP A;  3HOX B;  3D6C A;  3K6O A;  1BDO A;  1G29 1;  1G2S A;  3A8K E;  4PMB A;  1JOQ A;  3P1H A;  3M7G A;  3T53 B;  1PRT B;  1H9R A;  1SAP A;  3OHX C;  1KLG D;  3S2D B;  3K5O A;  2BE5 D;  5KNB A;  4ILW A;  4J6H A;  1QWY A;  1D6E C;  1EU4 A;  1V1O A;  1A6X A;  1ENA A;  4TRD A;  4IFD H;  1DCZ A;  2CHB D;  2SEB D;  1CT1 D;  4G7O C;  4H7B A;  4RHR A;  3RZD B;  1PRT F;  3GQB A;  1CQF A;  4NW2 A;  3NBH A;  4QF4 A;  2BA1 A;  2JA5 B;  3S1M B;  2F0P A;  1E0B A;  1CHQ D;  1SNM A;  1Z6H A;  2IW3 A;  1VMC A;  3G6J B;  5IGD A;  5M5W B;  1YNJ D;  4HAE A;  1O7Y A;  5C3X A;  1LAB A;  4NKL A;  2A69 D;  4C56 C;  2EYO A;  1ENF A;  3GTJ B;  2BDO A;  4WRD A;  3TP7 A;  3H6M A;  1GUW A;  2L0C A;  4RFB A;  3BS1 A;  1J9O A;  1V43 A;  4LAA A;  1DON A;  1CFM A;  1HCZ A;  5C0X I;  5KRU A;  4UDU C;  1Y1W B;  3HEJ A;  3BVG A;  1QNK A;  5KYI A;  1OO9 B;  2B2W A;  1LAC A;  2R6G A;  2LMC B;  2NYZ D;  1KNE A;  1KDC A;  4CHT B;  1UAP A;  4V0B A;  3F2U A;  4H44 C;  5IT9 L;  1A15 A;  4DK0 A;  4EQN A;  3EA6 A;  4FF3 A;  5KIX A;  5EKI A;  1D5M C;  3IAY A;  3BDO A;  3R3O A;  2QEJ C;  5C4J B;  4MIU A;  1A3T A;  2B63 B;  1O7L A;  1KDA A;  4DA2 A;  2E2I B;  2E2H B;  1I3Q B;  2AWO A;  1HRJ A;  2M9V A;  1EIH A;  1Z7T A;  3M3Y B;  1K8M A;  1WTO A;  3A56 A;  5M3M B;  3VA5 A;  1C48 A;  3I91 A;  5NUC A;  4OO1 I;  2N88 A;  5FOB B;  2NN6 I;  1BOS A;  1EOT A;  1G2T A;  1YNJ C;  2WKD A;  4CJ2 C;  5G3L D;  2G9H D;  3R8B A;  4ZKC B;  2E74 C;  1EFI D;  2B2U A;  1PRT D;  2F0U A;  2A6H C;  4XIG S;  1Q1B A;  1B9N A;  4Q0F A;  2FMM A;  5JVH 3;  1XX8 A;  2M00 A;  1S5F D;  3L3O C;  4RGM A;  4ZAI A;  3WOF A;  1OXS C;  1A2T A;  1UEA B;  5I4D A;  1GUO A;  2F0S A;  5BN3 A;  2HCC A;  2WII B;  3KLR A;  2F0V A;  4DXF A;  1B4O A;  2D5D A;  3HZX A;  3K5N A;  1RTN A;  4XT3 B;  1TR5 A;  2KEC A;  3NSW A;  3OPO A;  1H9K A;  3VR3 A;  1QCB D;  4M1U B;  3C1F A;  3MTS A;  2E75 C;  5EQ0 A;  2BCO A;  1GJX A;  1NCV A;  2B2T C;  3MVV A;  4ZKB B;  2EJF C;  4ZYS A;  2L11 A;  3A8I E;  1SYC A;  3MXU A;  1O7Z A;  3NUC A;  1L0X B;  3A55 A;  3IKJ A;  3GTM B;  2K6A A;  3VYR A;  4XYO A;  5ELE A;  3SVM A;  5AFW A;  1JOK A;  5D3D A;  2KQ3 A;  1I4P A;  1NAP A;  1GUT A;  1R4Q B;  3QOL A;  2H4O A;  5LL6 S;  1JC7 A;  1G6Z A;  1HQR D;  4EQP A;  4FF4 A;  4WFN 3;  4ULL A;  4B08 A;  1DJR D;  3MFY A;  2D9U A;  4X3K A;  3OMG A;  3AB9 A;  4K14 A;  1B3A A;  1U4P A;  3FDT A;  4IFD G;  1PMR A;  2CW0 D;  1A3U A;  1EEF D;  1SE3 A;  3IFD A;  3SK4 A;  3MC0 B;  4RCO A;  3D4D A;  3NP8 A;  3MZ5 A;  3OOC A;  4HED A;  1ET9 A;  4IZ8 A;  4XQJ A;  1Y8O B;  3OIP A;  5EJW A;  2J4X A;  1C8C A;  1PTO D;  1QNU A;  4OIJ A;  1G91 A;  3S1Q B;  4KY5 A;  1F2L A;  3SDZ A;  2O5J C;  2K33 A;  4CKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...