2OT2A

Solution structure of hypc
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVINEAEARDTLDALQNMFDVEPDVGALLYGEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Escherichia coli HypC
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Chaperone
molecule keywords Hydrogenase isoenzymes formation protein hypC
total genus 24
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01455 HupF_HypC HupF/HypC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ot2A01
2OT2A 3VYUA 3VYRA 2Z1CA 3VYSA 3D3RA 3VYTA
chains in the Genus database with same CATH superfamily
3S16H 2K5NA 4E6IA 4Y7NH 1EIFA 3FPPA 3UDGA 3CKIB 3PF4A 4DAYB 1CTMA 1LABA 3CCVA 4LF9Q 4CBVA 1MHWC 2A68C 4LFBL 1JB3A 1KABA 3PO2G 4JYAL 4HJ7A 4LF5Q 4F87A 2E76C 1TY2A 2JA8H 4DV5Q 5GROA 4IJHA 4PMBA 1IKMA 2K7VA 4FO2A 4JI0Q 1WCMB 3H3VC 4DR4Q 3AB9A 4IPDA 3P7JA 3F2BA 1DYQA 4FP5D 2NZHA 3N6RA 2L15A 4L8JA 1KC8C 3K7AH 4P71A 1AH9A 3L9AX 3DEPA 2EPBA 4DR6L 4JCVE 5M3FH 4HEDA 5IIFA 3D6WA 4IPGA 1KDBA 3KF6B 2EYMA 3I55A 4IJLA 1O7YA 4RFBA 2XVSA 2MHVA 1LACA 2Q2IA 2N88A 1Q1EA 2A74C 1V8QA 1SROA 1A62A 3CD6A 4AYBG 1GHJA 4HMJA 5M3MB 2F03A 3HOUH 1Z7TA 3HS0C 2JA5H 1WOCA 3K0XA 5CBEE 1F2ZA 1N33L 4GN5A 2KBNA 4GNXB 3A5ZB 1WTWA 5C0XH 3G4SA 1TT2A 4G4KA 4B08A 1A8VA 1XWEA 1PV4A 1BO0A 2Z8LA 2B2VC 4QUFA 3ULLA 5JPMC 3J7A5 3E0EA 4WJWA 1HA5A 3LNNA 1PZID 1U4MA 3GTOH 1VQ5A 2YTYA 2J0TD 1CA5A 2VUMG 4C3HB 2R92G 1C9OA 2SEBD 4DK3C 2F0OA 2F0QA 3OTOQ 1DM0B 3EIVA 4IALA 3CQZB 1ET6A 1VQIA 1XPUA 5FOBB 1CHQD 3EN2A 3MZ5A 4RHRA 1KAAA 2WACA 1WYDA 3CCQA 4CKBA 2ZXRA 2R3ZA 5IE8A 1CA6A 1W6JA 1Q8KA 3PV0A 4LNQA 5HGQA 5IP9H 3QB3A 4LF8Q 2A1AA 4TSSA 3FEWX 3MC0B 1EEID 1SXTA 4QF4A 2OQKA 2UXDQ 4BBRG 4QGUA 4LF6L 1HQMC 3UE0A 4B3RQ 3GV6A 1C0AA 5IGGA 4L5SA 3M4YA 3CMAA 5DAUA 1QUQA 3EBEA 3PUVA 1JORA 5EKKA 4A3LH 4N8FA 2R93H 1JQYD 1SFOB 1QILA 1QVGA 2BH2A 4P2CB 2VZAA 4NXNL 2F0FA 4AYBE 1EUJA 1OXXK 4HSPA 5JJZA 4GKKQ 5ELDA 2Z1CA 5CORA 3OSOA 5JEAH 1VQMA 5EAYA 1PH5A 2E5LL 4J1MA 3K5LA 4DNIA 1YNJD 4DV1Q 4WJ3M 2R92B 2RF4A 1Q82C 4POFA 3JAMi 2EJFC 4DR1Q 4R4TA 3DUZA 1JB7A 2LS01 2RHSB 2WFWA 1SR3A 3KLSA 5CV8A 2R7ZG 4QIWB 3S15B 2PNHA 2F0NA 3WWVA 4QIWE 3GTKH 3KF6A 4FVMA 3S16B 3KJPA 3TP8A 3K7UC 2E5LQ 2ICEC 1I3QH 3HOZG 4A3EH 1FD7D 3ULPA 3URYA 2Z6BA 3L3OC 2F3WA 2PI2A 1SJHD 1AZQA 4XT1B 2MGSA 1EY8A 1G6PA 3D4RA 3TQYA 3BU2A 1LYLA 4G7HC 2VB2X 1JJGA 4H0LC 1Y1VH 4QJFA 1X3FA 4IOAA 4QUCA 4A3FB 1SMYC 1CZWA 1LTTD 2LY7A 3NP8A 2R7ZB 4A3BG 2YYZA 1QNUA 1U4LA 2I5HA 4GKJQ 3QOLA 1PZKD 3K0YA 3RZDB 3VR6A 1GUGA 4LAAA 4A93G 4ZLTF 2F0WA 2AUKA 4ZRZA 1E2VA 3D8GA 4LF5L 4U673 2EY6A 1UE7A 2B2TC 4LF4Q 5ELCA 2DNEA 1N34L 3CMEA 5D14A 2K5DA 2R61A 4KY7A 4XTCS 4DAYA 1N8RC 3VR2A 5M5XH 4LJZC 2PQAB 2ASBA 4YY3Q 4ME5A 4EQOA 5C4XB 2PZTA 3MXGA 3HOXH 3UDFA 3U58A 3SR1A 2OF1A 3KJOA 2PW7A 3KF8A 2WKDA 4A3BH 2PI2E 4HR7B 1J5EQ 4IPCA 1C4QA 5IYCG 3DWQA 4KY5A 1H9SB 4A75A 1HZBA 5T1GA 2RQXA 2VB3X 3DMUA 1S5FD 3I4OA 1S5DD 4DN4M 4EQNA 3PO3G 3CRKC 1UNSA 4UDUC 5IT9L 1V1PA 5LMUL 3I4NG 3OW7A 4HSVA 3ND9A 3K57A 1SNDA 1VQNA 3S9WA 1HZCA 1JOOA 4FDBA 4LMQD 2AWNA 2F3VA 1CK1A 2WINB 4QB4A 3NTIA 4KMUC 5EKIA 4N9TA 5A2QE 2K03A 2RA4A 3C2PA 4LF6Q 4OWTB 2ZJQA 3HOZH 3CCRA 1KIXA 4HIMA 4AIMA 2VS1A 3OWFA 1Y1WH 4P72A 5JOBA 1MI2A 2QDBA 4ILWA 3DHQA 3MFGA 1N33Q 1BOSA 4A3CH 4B9XA 1MJEA 1BCPB 1GUSA 1SYFA 3HG9A 4YWLA 2K28A 4KHZA 4ID6A 4JK1C 3DM1A 1VQKA 5M5WB 4CJ2C 2CCZA 4KN7C 3BYYB 1HUMA 2GVBA 1K8GA 3OW2A 2A69D 3RN5A 4KTAA 1VQDA 4R4QA 3HKZB 3E0JA 1V1PB 4KHVA 2F0IA 3EVQA 1XYIA 3A7AB 3BDCA 1RKNA 3JAML 1JR0D 4ZKBB 5C44G 1SBBB 2RHQB 1GO3E 3FKIH 1D6EC 3CRLC 4CJ0B 2KCNA 1K0RA 2EJMA 1EY6A 1PYBA 1LTSD 3K5MA 3I3CA 1EFWA 4FXDA 1LTID 2I0QA 2G9HD 1SMXA 5COYA 5D3DA 4C3JH 3S1RB 4HJAA 3C3LA 4FF3A 2AQ2B 3CC2A 1TXYA 1J5EL 3TZUA 3S1MB 2UUBQ 2HQEA 4BXXG 5CV9A 5E1FA 1NMFA 2VQEQ 2F0KA 2KJXA 2VQFQ 3ULJA 3MVVA 2H5XA 2OXPA 4JI1Q 4MN3A 3OIQA 3I4MH 1SYDA 1CI3M 5TSSA 4JOIA 2F4IA 5LMUQ 4DAPA 2MPMA 4XQJA 2IX0A 1B44D 1TWAH 2E2DC 3T1HL 3D0FA 1E1OA 2ZXPA 1SNOA 1IYVA 4JBWA 2PZWA 5D3IB 1YBYA 4OIKA 2VQEL 4JOIC 3OMCA 2PQAA 1JE4A 3H0GG 4C3IB 2JA6H 3TZDA 1VQBA 1SN8A 1PH6A 2RDHA 3ERQA 3CAMA 4DUZQ 4JI7L 3VA7A 4LF4L 2F4VQ 2RSNA 1HH2P 1TWCB 5C4JH 3TSSA 4LW1A 2HHHQ 1E0BA 1UWVA 3S1QH 2KEEA 1GM5A 3S14H 4DFAA 1V1OA 2WAQE 4LUOA 2IX1A 1SNMA 2EY2A 4XIGS 1TQOA 5FO7B 1CQVA 3HOWH 5FLXL 3HOWB 4X66Q 2F0MA 3J80E 3S17H 2EQSA 4KJNA 3KBGA 2F0LA 3S2HH 3M9BA 2KEDA 2NB0A 1VS0A 1XNRL 2A5HA 4JI6L 1R9TH 2AMCB 5KNDA 1UE5A 2A69C 2OT2A 4KKSA 1KQSA 3S2DB 3ER0A 1EFID 4M1UB 2K04A 1I4GA 1H9RA 3BYTB 2LKVA 1X3GA 3AFPA 1U9RA 2NTSA 1D5ZC 2EY5A 1I4HA 3S2HB 4K6DA 2QA4A 2EZVA 1LTAD 4PZ7A 1GOZA 1O78A 1PH7A 1L0XB 1TU2B 2QW7A 4JC0A 4K2KA 4A3FH 1QE6A 1QB5D 4JI3Q 3J81j 4JI5Q 1D2BA 1HR0Q 3PIOA 1GD7A 3FRPB 4C1NI 3K81C 2WIIB 3NQTA 4A76A 2R7DA 1HRJA 3HFZB 1S72A 3J7AV 3KOJA 4AH6A 3DXJC 2K33A 2A8VA 1F2YA 2L9HA 5ELNA 1D1KA 5E4WC 2I5MX 1CQFA 5FKAC 4A3DB 3J80c 2JEAI 4P73A 2V1CC 4DPGA 1IYUA 3BG3A 1VDZA 3NTKA 4DK0A 1HUNA 2D0OA 3I4MG 3CCLA 4KHPL 4QY7A 4BY1B 3S1RH 3RR5A 2B3GA 2QKIC 4TVAB 2UXDL 1E2ZA 5C6AA 1YJ9A 5CR3A 1SFOH 3BZCA 3GTLB 2NZOA 2WB1G 5KNCA 4QCLA 2NVTB 4FF2A 1G2TA 2MJ8A 4BA2I 4DV6L 2RSOA 4K8JA 4JYAQ 5FLMH 3T53B 1DGSA 3HOYH 4IZ8A 4JI2L 1IL2A 2Y0SE 3GTOB 1YNNC 3VR5A 1AZPA 2SNSA 5M5WH 3GTPH 1ET9A 1SNQA 4IUVA 1EWCA 2ES2A 4HIKA 4OX9L 5CYUA 1ICWA 4DAMA 1JOKA 3SDZA 3AEVA 5JJLA 1DOLA 3OMGA 2F1MA 3OWEB 3E6ZX 1FL0A 4A3EG 2A6EC 3L7ZC 5I2XA 4C3HH 1M4VA 5FLXE 1AE2A 5IP7G 3VYRA 1BCPF 4RKBA 1CFMA 2H1EA 1OXSC 3T1HQ 4PNYA 4OHJA 2EXDA 3GTMB 1IKLA 3RN2A 3J81L 5C4XH 1BF4A 1S5ED 2RCNA 3UDIA 5FJ8G 2CH4A 3KUPA 2N49A 3AMUA 1LTRD 1XMQQ 1BNZA 5HURA 2B2WA 2EVBA 1PFBA 5I9OA 1SE4A 1K3RA 1ESRA 3HEJA 5JJIA 1AW7A 1D5XC 1ENCA 2M00A 1WCMH 4CHTB 3PIP3 4K8IA 2MFIA 3CF5A 3SXHA 3UI2A 1I4XA 4OWXB 4G7ZC 3I91A 2A19A 2EYHA 2JA8B 2ENBA 1STEA 4CDDC 4B3ML 2KCCA 4LF7Q 3S2DH 1EY9A 1EZ6A 1G291 1Q90A 1HNWL 5M3FB 5IYBG 2ALYB 4GZYC 3HOXG 3TS2A 2F0JA 1BR9A 2Y0SG 4KKUA 3E3XA 2VUMH 3H6MA 1B7YB 2JA7H 3F8TA 4MHEA 4DK6C 3FDTA 5G3LF 1ASZA 2OCEA 1WTXA 1STBA 2Z4IA 4BBSB 4X62L 5FLMG 4IO9A 1PFMA 4OO1G 1KL9A 5LMNQ 3M4OH 4IUUA 2NN6H 3H94A 3RZOB 1AE3A 1TS5A 1YEZA 4A3JG 5IGDA 2UUCL 4K0KQ 4JI7Q 1ZYRC 2UXBL 1L1OA 1ASYA 4K5VA 2HCIA 1VQ8A 4A3KB 3FMCA 1PXUA 1H9SA 1K9MC 1I94L 2HHHL 4PMCA 2K1BA 3MAQA 1VF5C 1FGUA 4KHPQ 4NXNQ 1EYAA 3M7GA 2KQ3A 3JC66 1JWMD 4O42A 4IFDI 3QO2A 4C3HG 2NVXB 1XMOL 2DJFC 2SDFA 3M4OB 3A56A 3P20A 2UUBL 3K6OA 4GKJL 3RLOA 1VQ6A 5A2QL 3GO5A 1VQ9A 5BR8Q 1A2UA 2HCCA 2C9OA 4KY6A 4KN4C 1HHVA 1PRTD 1F9QA 2KOLA 3TMEA 2O5JC 3R2TA 5LMNL 4RGMA 5IT9E 1I6VC 1DOMA 4TRDA 2K50A 4OONA 1PH9A 4NXML 1EU4A 3H15A 5IODA 3M4PA 1E2WA 1NSNS 4KJOA 4OL7A 2BA1A 3HGBA 4KKTA 1LT4D 5G3LD 3A0JA 5EJWA 3RZOH 2NVYB 2ZJPA 1CM9A 1I50B 3NQIA 2KHJA 3FP9A 3HOWG 3IFDA 1TS3A 1HR0L 2DUDA 3O13A 3VR3A 4JI3L 3I56A 2AUJD 3ZYYX 3KDFB 4YCVA 3GDEA 2WKCA 4FXGC 4RGOS 1XNQL 2TMPA 4X62Q 3SE0A 1Y69U 4DK1A 2JEBI 1B9MA 1B50A 4CGYB 4L5QA 3I8ZA 2BH8A 3D3RA 3M7NA 3KBXA 3B6YA 4PZ6A 1YNND 5E3FA 4LWCA 4A93B 4DV5L 3Q8DA 2XSCA 1TWCH 2K5QA 1CHPD 2B63B 1OXVA 1YNXA 3J81i 4IUQA 4R4CA 3GTJB 4L5RC 1EYDA 4BY1H 1EZ8A 4KD4A 3SK6A 2NUCA 3J7AF 2L12A 3PIPA 2O4XA 4FXKC 2EYLA 4DKAC 1BDOA 3U4ZA 1S5CD 4DGZA 5C3WA 1PA6A 1F2LA 2WAQB 4XQNA 1LM0A 1YI2A 5I6WA 4UP7A 1KDCA 1HQRD 3T16A 1HA6A 5DEHA 2G9DA 2XWBB 3D6CA 4POGA 3TS0A 3S1NH 4BWGB 1B2TA 1Y8OB 3PMFA 3GTQB 5C44B 1VQJA 2F0HA 2K6AA 4IFDH 1DXMA 4Y52H 1JE5A 4HAEA 3WOEA 1RDPD 1TY0A 2E2JB 4A3GB 4JI2Q 2MO1A 3WOFA 2K32A 1VQPA 3I2ZA 3HOZB 1YVCA 3NBHB 2PO4A 1X3EA 3PUZA 2GA4B 1X9NA 3MXNB 1VQCA 4DAVA 1VQOA 3S1MH 3A54A 1IW7C 1M8AA 2EOTA 1KLGD 4NDXA 4X64Q 4KV6A 4ALPA 3W5OA 1CT1D 1VMCA 1SAPA 2JSOA 4P74A 3F2DA 4C1NK 4HMIA 4UP8A 1AFPA 2R6GA 2QILA 5IGFA 3RZDH 4IOCA 4JI8Q 1K8OA 1EWIA 1DCZA 2YU9B 1STYA 2KHIA 3PCOB 3HRZC 4JI0L 3OYYA 2R7ZH 1VQ7A 2UUCQ 5K36H 3M3YB 2XN9C 5FLXc 4EX5A 1Q8IA 3U4VA 3BVZA 1JICA 1Q86C 1ICFB 5C5MA 4RGTA 4X64L 2BE5D 5D65A 5C4HA 3M4QA 3RUZA 4JI4L 4YWKA 1G91A 1F9PA 3IFTA 5EPKA 1SSOA 5EKLA 1Y14B 2E2IH 5DM63 1RIPA 3KYHC 4AYBB 1QVFA 2OTJA 4GLVB 2EYFA 2C35B 3D4DA 1WTOA 1PTOB 1YHQA 5IYDG 1QJOA 4HIOA 2Q2TA 3G7LA 1EIYB 1UE6A 4KLKA 3F2CA 4NKLA 4ZKCB 3PO3H 1BKBA 4R9WA 2B2YA 3QR8A 2F0VA 1LO5D 2E2HB 3PUYA 2NTTA 3TDQA 3SHLA 5C3EB 3J81E 4A3KH 2KCMA 2QGQA 3CCMA 1RCVD 1XXGA 1GUWA 3D31A 1E7ZA 1YJWA 2LXJA 3S24A 3NBHA 4UAIA 3U9OA 3CU7A 2R7FA 2B2TA 5CV4A 3OIPA 2CVRA 4HTHA 2IW3A 4BS9A 2F0DA 4J8QA 2D62A 4XYOA 1M90C 3KFUA 1HZ9A 2IPKD 3QWNA 3I4MB 4A3DH 5C0XG 2Y0SB 4DR5Q 1PH8A 4IFDG 3BZKA 2ZM6Q 4DUYL 1PFSA 3F1ZA 2J4XA 3PQIA 1PTOD 4HJ8A 1VQLA 1FJGQ 1FR3A 4EQPA 4GLXA 4KK7A 1YZ6A 1B53A 4Q5VA 2XRSD 1N36Q 1GUOA 1K8AC 1KRTA 1VQGA 4X65Q 4GOPC 3EA6A 3CXCA 4CDEC 1K3BC 2K01A 3EJIA 4XQQA 3V96A 1SLJA 2K5WA 2F52A 4K6LA 3L2PA 3LWUA 4BY1G 5IYBH 2AHOB 4X3UA 2KECA 4YWMA 1WTQA 2CQOA 3H3VI 1CSPA 1EY5A 1K83B 4DF7A 4BBSH 3FHWA 5KEEA 5IYCH 1WTPA 1W2BA 1U5KA 5KYLA 2F0SA 1IZ6A 4IUTA 3BZDB 1N9WA 4NPSA 5I6YA 4XDXA 1KRSA 3EROA 2VUMB 2B63G 4FF4A 3Q23A 1BUVT 4V190 3I4NH 4OO1H 1JT8A 5CC4A 1K28A 3M85A 1L0WA 2NN6I 1KHIA 2B39A 4GKKL 1I4PA 5JVH3 3CCEA 1X65A 2Q8TA 1H9KA 1TWFH 3ZJYC 2FMCA 2VNUD 3OOCA 1X3PA 1XJVA 1QG7A 3R93A 3PF5A 4R1JA 1PH2A 4C2MB 2HDMA 5C0XI 1F77A 3R3OA 2FJ2A 1C8CA 3J81c 2YU9H 4BY7B 3T56B 4A3EB 2ZTDA 1S40A 1IBKQ 2IL8A 1QNKA 2LXKA 3Q24A 1Y8NB 2Q2UA 1RHPA 1J6QA 4RAUC 3GTKB 3J7YW 1Q46A 5L37A 3UE1A 2X69A 1Q12A 3GTQH 2XNAC 3RLFA 1VCIA 2B63H 4UHVA 1VF7A 1SYGA 4NW2A 4A3GH 1YHBA 2KENA 1F9RA 2JQOA 1E22A 3OPOA 3TN2A 2L55A 5BR8L 4RA8A 1EQTA 2Z4HA 3OHXC 3V2TA 1BBWA 5CBAE 4DR5L 3J80L 2DGYA 3HOVG 4OGQC 1OO9B 3W2DA 2NVTH 1GXDC 2FHTA 5ISRA 4C56C 3HKZE 1X54A 2NWGA 1I4QA 3GTJH 1MSGA 3A74A 2XGTA 2B2UA 1IXRA 4HCSA 4C3IG 3DLLA 1IHZA 4UY8C 2UXBQ 3KLRA 1A2TA 5EPLA 5E4XA 3E9HA 2E74C 1TWHH 2VW9A 1JCKB 1X32A 1A6XA 1NCVA 3FVQA 4A3FG 1E1TA 3KF8B 4PZ8A 1LV9A 2F0EA 3VYUA 4GNXA 4A3IH 4B3SQ 4NP5A 4WORA 2GVAA 2QCPX 5IGCA 1TS2A 3G6JB 3PSIA 4A4IA 1UEAB 4X6AH 1KNAA 2FFKB 1ONLA 1XX8A 3AU7A 4Q0FA 3HOVH 4HJ9A 1SE2A 4N9PA 1Y1WG 3GTGH 1SMYD 3RNUA 3HOXB 1QUQB 4B3TL 1HFGA 5NUCA 1SYBA 2D2CC 3LWEA 2EIFA 3I72A 4ZK9B 4XT3B 2RCFA 4O0AA 5IWAQ 3K80C 2NYZD 3U50C 2B2UC 4J6HA 1FNUA 1MSHA 4YCUA 5BN5A 3U9SA 1BCPD 4EVOA 2OWOA 3STBD 3BVGA 4GNXC 4NXMQ 1CUKA 1J9OA 1GUTA 3I7FA 2FXQA 1II3A 2MP1A 4O1NA 4G7OC 2HIXA 4I7ZC 2MQHA 4BA1I 4A3IG 4B3SL 1SE3A 4ME3A 1X55A 3TBIB 4L5TA 1K73C 1XTDA 3JAME 1PTOH 2HD3A 3T1YL 4LFCQ 2X6GA 4DR1L 3S17B 5GAHC 3VYTA 4ZYSA 3I90A 5JEAJ 3PO3B 4MZ9A 2BA0A 5A35A 4DR6Q 3HP3A 4RGNA 4BY7G 1AEXA 3L0OA 3HKZG 2UU9L 2WV6D 1BBUA 4TKOB 1UAPA 1H95A 1XPOA 3FPUB 1JC7A 1DONA 4A3GG 1B3QA 2BDNA 4PQXA 4IURA 4DR2L 1XPRA 1TIID 4I65A 1S3OA 1T5EA 2IWHA 2NVXH 4B3RL 5M5YB 1MIUA 3M3YH 5KNBA 1IBMQ 2B2WC 2N78A 3H09A 1U4RA 1DJRD 4YIJA 1NE3A 3SVMA 1HTPA 1L2FA 1K83H 3G6EA 1CKNB 3RLNA 3MHBA 2OTLA 1TWAB 2WAQG 1RD9D 4RCOA 2ZT9C 1G2SA 4KI0A 4BBSG 2JJQA 5C4JB 2CHBD 3K58A 2ATWA 1IL8A 3MEHA 4ZQ3A 1ILPA 1Q1BA 2YTVA 1AP0A 1PHJA 1G8ZD 5GQOA 1WVLA 3S1NB 3T13A 4LUVA 2E8GA 2K5VA 3BVMA 4X3TA 5K5PA 3MXUA 2J7ZA 4XXEA 2QF7A 3GD7A 3EQLC 4DV2Q 1BXTA 1QZHA 4R4IA 1EIHA 3NE5B 1EY4A 5KYIA 1OTCA 2QEXA 1QWYA 1PH3A 4U68A 2K4KA 5CV5A 4DUZL 3T4AC 4C3JB 1QOHA 4RKLA 1D7QA 3NUCA 3VYSA 5DNFA 3GP7A 2HQLA 1FGBD 1QVCA 3P1HA 4S3SA 4LFCL 1TS4A 5CV6A 1HZAA 1LT5D 2KHSA 1ZKOA 1IBKL 3H0GH 3G71A 1BCPC 4IQZA 5GADC 2D5DA 3NHHA 5ELBA 1IBLL 1B9NA 1EQVA 3ONAB 5ELOA 5K36G 4LF9L 2UU9Q 1YJNA 3HOYB 2CW0C 1BBXC 1RL2A 1E3PA 2A6HD 2F0TA 1NJIC 4UP9A 2XTIA 3T51B 2XIWA 1N32Q 2I07B 4L63B 5LL6S 5J3BA 4LFAQ 1VQ4A 2PCFB 4CDFC 4C3JG 4OEMB 1FNVA 2CW0D 4UPAA 1K8MA 2DY8A 1R4PB 1CKOA 3SGIA 4MTKA 2V4DA 1B8AA 1EIGA 4BXXH 2CQAA 4JI1L 1LTBD 3CHBD 2JK8A 2NBFA 2KVMA 2B29A 1STHA 2Z6KC 4PG3A 3CCJA 2EYPA 4JI5L 1L0YB 4JI8L 2N55A 1P16A 2QDLA 3HOUB 2JP1A 3KK7A 2BDOA 3QOJA 4I7AA 4B3MQ 1ZEQX 4GOPB 4LF7L 3PUXA 4DV6Q 4A3MH 4BY7H 2EDGA 1CSQA 5H1SE 2A68D 1X6OA 3R2IA 2HT1A 1PVOA 1ZYRD 3ND8A 1D8LA 1HNWQ 4K5WA 1C48A 1Z9FA 2EE1A 2RKSA 1VQHA 2B2VA 2IJ0A 2Z9HA 3R8BA 1HJPA 4ABNA 2ZM6L 1AN8A 5IP9G 4L6TB 1A15A 3NSWA 3NPPA 4RWSC 1R4QB 1RTOA 1TKWB 3K7AB 1N36L 3PO2B 1I6HH 3BDOA 2L4NA 1X56A 2JA9A 4DV2L 1X3QA 4H02A 5M3MH 5J39A 2C5CA 1DD2A 1W6KA 3ITPA 4RHSA 4A3LG 1IW7D 1V43A 4JW0A 2JA5G 4ZCKA 3TRZA 1ML0D 1O80A 4IPHA 5M5XB 1A3UA 1UE1A 3MXPA 1XMQL 1H9MA 5JAVA 2AQ1B 2EYJA 1TVXA 1XTCD 1HCZA 2LMCB 4H7BA 1RF2D 3ERSX 1S4ZA 4X3KA 4JVZA 3SEBA 5I9PA 3CC4A 3NENA 1STGA 2WB1E 3UDXA 5LHY1 5C5LA 3VR4A 2ZTCA 1EEFD 2FMMA 4OX9Q 5E7NA 1HR0W 1B3AA 1U0LA 5C3EG 1CKNA 1WJJA 3BDLA 4WFN3 1SNPA 5ELEA 5M3MG 1EU3A 4IN3A 3T1YQ 4JI4Q 1EWHA 3PO2H 2Q8RE 2F0PA 1UEBA 2PMZE 4LFAL 1TR5A 2JA8G 2PZUA 5HGTA 3EFXD 1R9TB 3J80i 4B9WA 4J15A 1GJXA 2N3SA 5J1ZA 2E75C 3KLWA 4ULLA 2R92H 4OWWB 2JA7B 1WTVA 5IOCA 4DR7L 3NXWA 3H3VH 1NUCA 1OXTA 4KD3A 1YIJA 4JBKA 5FO8B 4ZAIA 5IP7H 1IBML 1ZXTA 5EBDA 4A3CG 1PH1A 4F88A 4HN7A 1L1OB 5EGTA 1IBLQ 1KAWA 2L1BA 2DNCA 3VDYA 2RDFA 1MBYA 4GN3B 4DNTB 5CMDA 5I4DA 1RODA 5JJKA 1NR4A 3CC7A 4JI6Q 3MFYA 1ENAA 1Q7YC 3FKIB 3Q6SA 1IYJB 1N32L 4K0KL 3GTGB 2L5TA 4A3JB 2QEJC 2CKZB 1WFQA 1O7LA 1HNXL 2HIVA 2PQEA 2DJGC 4BBRB 4A3KG 4O2DA 2CWAA 4PMWA 5C3XA 2R93B 1WTRA 2XRQD 2OEOA 3C1FA 4MNOA 3K5OA 1FYCA 4OO1I 3HZXA 1EOTA 4AQYL 1B70B 5IYDH 4DR3L 4YY3L 3K8AA 3J7ZC 1PTOF 1Z6HA 1J8IA 3IKJA 2XWJB 1Y1WB 2PPBC 3AQQA 5T1IA 3KDFA 1NAPA 4N8X1 4NMZA 4YHHL 3PGZA 3RD4A 1MGSA 5JEAG 3BJUA 2PW5A 1PRTB 1HPCA 1BQQT 1JJCB 4TQUS 3A55A 2EY1A 1CZGA 4YCWA 3Q22A 4CDCC 5FK9C 2I5LX 4V0BA 1YITA 2PNRC 1HNZL 4EQ5A 5BN4A 3NWSA 2IT1A 1DZ1A 2LFNA 4ZUJA 3IRBA 3GTPB 3A8IE 5FJ8H 4CKCA 3NTHA 1Y8PB 4BBRH 3NELA 5BN3A 2N8NA 1XMOQ 4DV7Q 3QG1A 3K59A 4DR3Q 1FVIA 4A3JH 4QL5A 2BE5C 3E5SA 2AKWB 2LSSA 1XNQQ 2F4VL 1MJCA 3W3AA 2CWPA 3N52A 3NWTA 2RDGA 1G51A 5HY6A 1EL0A 3HKSA 4H13C 3H0GB 2O2LD 4JPBW 3I70A 4DR7Q 2ZJRA 4FF1A 1K0SA 1QZGA 3DWAA 2DY7A 4X66L 5CGKA 3GQBA 4MIUA 3BS1A 4IUPA 1SEBD 1NR2A 2D9UA 4DXGA 3MA2B 5GAGC 3CCUA 5EPJA 1DOKA 3QJYA 2EYOA 2IY5B 1M1KC 1V9PA 2IX3A 3X3MA 1LT3D 2KCTA 5C44H 2ZTEA 4ZUIA 4Z9CB 1I50H 4DV7L 2Q8IB 2WP8J 3I4NB 1SJED 2JN4A 1EQRA 5M5YH 2F3IA 1PLFA 5I2YA 1RJTA 1Z47A 5J22A 1LLRD 1D5MC 4DV3L 1N34Q 4A3BB 1D1IA 3MEFA 1SDFA 2VQFL 1JJ2A 4A3DG 1EY0A 2AWOA 4Y7NB 1KLUD 5IWAL 1STNA 4M8AA 5DM73 4OELB 5IY0A 3F2UA 5GAEC 3DWPA 4EGVA 2Z6KA 4PV1C 4DU9A 2UUAL 1JWSD 3OTOL 1U4PA 2ID0A 4OXPA 1ILQA 1PH4A 1JWUD 2SOBA 5AJ3L 4DUYQ 2RVLA 2UXCL 1MD2D 4JG2A 3TP5A 2VL6A 2WB1B 1BVSA 1A3VA 3STBC 1MKHA 3DEOA 3S15H 3H91A 3KLSX 2JYOA 1PYSB 4DNRB 4C3IH 2JA6B 1HNZQ 4HJ5A 1HXYD 4FYDA 1O7ZA 3AFQA 2H4OA 1KNEA 1I3QB 1E24A 3SK8A 1EOVA 5C3EH 4R8IA 1GVPA 1NY4A 1O7IA 2A6ED 1STAA 3MTSA 1SRUA 2K5HA 2UXCQ 1L1OC 3C1EA 4HCEA 5DLQE 1H9JA 1LUZA 1KD1C 3FKIG 4B3TQ 1VMPA 5IGBA 3I73A 1WD1A 4XYQA 5IT9c 2KUMA 3NEMA 5LMNW 1S5BD 2MO0A 2M9VA 1XNRQ 3CCSA 4LFBQ 1W3SA 3HOYG 4DA2A 3IAYA 1FNWA 1YNJC 1SE8A 3X3NA 3TP6A 5JPNC 1GUNA 3CP0A 3MXNA 4YHHQ 1I6HB 1TWHB 5KGUA 1LT6D 4MTNA 2ZXOA 4LK1C 4LF8L 1V1QA 1C7YA 2ICIA 1A0IA 3NK9A 2K05A 4RMFA 5C0XJ 4A3IB 1A3TA 4GLAC 2CFMA 4IFDJ 3CPWA 2KA7A 5EBCA 4HIDA 3A8JE 2L11A 4A3MG 2E2HH 2UUAQ 1OXUA 4NB3A 4DV3Q 2P5ZX 4WRDA 2MUYA 2E2IB 1JOQA 2DN8A 2JA6G 2O5IC 3HOVB 3E9IA 2RBMA 2F0UA 1T5XD 4LUZA 2K52A 4DV4Q 3SK5A 3S14B 1VQEA 3S1QB 2TSSA 1KDAA 4QQBX 4K5XA 1RTNA 2HUGA 4FNFA 1NNXA 1Q81C 3C46A 3CQZH 4DR4L 2K75A 4DV0Q 4DV1L 2EXZA 1WCMG 1PRTF 2Q2HA 1P8LA 1ESFA 2EJGC 3GV3A 1Y1VG 3GTMH 3CPFA 4AQYQ 3PIO3 5IGEA 1NMGA 4RG1A 4RCNA 2JA5B 1HFNA 2E2JH 3A8KE 2YV5A 4K14A 2AQ3B 3W1GA 3P75A 4DXFA 3D4WA 4RH6A 2X6LA 1CKMA 4X3SA 4APVA 2OQ0A 2CH4W 4C2MH 1I94Q 4IUNA 1TWGB 1GKHA 3VA5A 3CW2C 2A6HC 3PUWA 2IHFA 2MNAA 1PFNA 1PYWD 2PMZB 3DM3A 4A3MB 2Z0SA 3K5NA 2SNMA 1NTGA 1LTLA 3W1BA 3RMHA 2BCOA 3ICEA 4K2LA 1B1ZA 2B8GA 3G48A 2NN6G 1TWGH 1TWFB 1KXLA 1FJGL 1GHKA 2K14A 2I46A 1I5FA 2B2YC 2NZ1D 4X65L 1PMRA 3A7LA 2VXWA 4F7XA 4F8MA 1EYGA 1WTHA 3A5UA 1WI5A 1F9SA 1UUPA 5KRUA 1PTOC 2JE6I 3NBIA 1YHAA 3TP7A 5FO9B 4GOPA 5LL6X 5C4ZA 1G6ZA 3HOUG 4A93H 1HTLD 1LTGD 3GTLH 5EQ0A 4R8NA 4GN4B 2NVQH 1Q3LA 1SYEA 1QCBD 5F2DA 3JAMc 5M9OA 3IL8A 2PYKA 1WD0A 1B4OA 2VY3A 1PDQA 5JVG3 3QIAA 4GS3A 4JBMA 2YTXA 4ODGA 3I4LA 1EYCA 2F0GA 3LGJA 1ENFA 4CJ1B 3MWYW 4CKEA 1HNXQ 4JBJA 1EQQA 4JV5L 4DR2Q 2B8FA 1SYCA 2L0CA 4G57A 1NBWA 3LX0A 4DV0L 3V05A 5AJ3Q 2BOSA 1PRTC 4QMGA 5ELFA 3Q0AA 2JXMB 2NVYH 3TEHB 3WDNA 1Y1VB 1A63A 3SK4A 1I4RA 2IHEA 2FINB 1JMCA 4OIJA 2HDLA 2M2LA 4P75A 2R93G 4JV5Q 2NVQB 1VQFA 4WJ4A 1KTKA 1SNCA 3TREA 2G5DA 5CV7A 4H44C 1PZJD 5M3FG 1EY7A 2JA7G 2A73B 2GN5A 1VQAA 4DV4L 5KIXA 1F2MA 3AYHB 2D0PA 5C4XG 5AFWA 1T9HA 4R4OA
chains in the Genus database with same CATH topology
4E6IA 3FPPA 3CKIB 1CTMA 1LABA 4CBVA 2A68C 1JB3A 1KABA 4F87A 2E76C 1TY2A 4PMBA 1IKMA 2K7VA 4FO2A 1WCMB 3H3VC 3AB9A 3P7JA 1DYQA 4FP5D 3N6RA 4L8JA 3L9AX 3DEPA 2EPBA 4HEDA 5IIFA 3D6WA 1KDBA 2EYMA 1O7YA 4RFBA 2XVSA 2MHVA 1LACA 2N88A 1Q1EA 2A74C 1V8QA 1GHJA 4HMJA 5M3MB 2F03A 1Z7TA 3HS0C 5CBEE 1F2ZA 1WTWA 5C0XH 1TT2A 4G4KA 4B08A 1XWEA 1BO0A 2Z8LA 2B2VC 4QUFA 5JPMC 4WJWA 1HA5A 3LNNA 1PZID 1U4MA 2J0TD 1CA5A 4C3HB 2SEBD 2F0OA 2F0QA 1DM0B 4IALA 3CQZB 1ET6A 5FOBB 1CHQD 3MZ5A 4RHRA 1KAAA 2WACA 1CA6A 4CKBA 2ZXRA 2R3ZA 1W6JA 3PV0A 3QB3A 4TSSA 3FEWX 3MC0B 1EEID 1SXTA 4QF4A 1HQMC 3GV6A 5IGGA 3M4YA 5DAUA 3PUVA 1JORA 5EKKA 1JQYD 1SFOB 1QILA 4P2CB 2F0FA 1OXXK 4HSPA 5JJZA 5ELDA 2Z1CA 5CORA 3OSOA 5JEAH 4J1MA 3K5LA 1YNJD 2R92B 2EJFC 3DUZA 2LS01 3KLSA 5CV8A 4QIWB 3S15B 2F0NA 4FVMA 3S16B 3TP8A 2ICEC 1FD7D 3URYA 3L3OC 2F3WA 1SJHD 1AZQA 4XT1B 2MGSA 1EY8A 3D4RA 4G7HC 2VB2X 4H0LC 4QUCA 4A3FB 1SMYC 1CZWA 1LTTD 2LY7A 3NP8A 2R7ZB 2YYZA 1QNUA 1U4LA 3QOLA 1PZKD 3K0YA 3RZDB 3VR6A 1GUGA 4LAAA 4ZLTF 2F0WA 2AUKA 4ZRZA 1E2VA 3D8GA 4U673 2EY6A 2B2TC 5ELCA 2DNEA 5D14A 2K5DA 2R61A 4KY7A 4XTCS 4DAYA 3VR2A 4LJZC 5C4XB 4ME5A 4EQOA 2PZTA 3MXGA 3SR1A 2OF1A 2PW7A 3KF8A 2WKDA 4HR7B 1C4QA 3DWQA 4KY5A 1H9SB 5T1GA 2RQXA 2VB3X 3DMUA 1S5FD 1S5DD 4DN4M 4EQNA 3CRKC 1UNSA 4UDUC 5IT9L 1V1PA 3OW7A 4HSVA 3ND9A 3K57A 1SNDA 3S9WA 1JOOA 4LMQD 2AWNA 2F3VA 1CK1A 2WINB 4QB4A 3NTIA 4KMUC 5EKIA 4N9TA 5A2QE 2K03A 2RA4A 3C2PA 3OWFA 5JOBA 1MI2A 2QDBA 4ILWA 3DHQA 3MFGA 1BOSA 4B9XA 1BCPB 1GUSA 1SYFA 3HG9A 2K28A 4KHZA 4ID6A 4JK1C 3DM1A 5M5WB 4CJ2C 4KN7C 3BYYB 1HUMA 2A69D 4KTAA 3HKZB 3E0JA 1V1PB 4KHVA 2F0IA 3EVQA 1XYIA 3A7AB 3BDCA 1RKNA 3JAML 1JR0D 4ZKBB 1SBBB 1D6EC 3CRLC 4CJ0B 2KCNA 2EJMA 1EY6A 1LTSD 3K5MA 3I3CA 4FXDA 1LTID 2G9HD 5COYA 5D3DA 3S1RB 3C3LA 4FF3A 2AQ2B 3TZUA 3S1MB 2HQEA 5CV9A 5E1FA 2F0KA 2KJXA 3MVVA 2OXPA 4MN3A 3OIQA 1SYDA 1CI3M 5TSSA 2F4IA 4DAPA 2MPMA 4XQJA 2IX0A 1B44D 2E2DC 2ZXPA 1SNOA 1IYVA 4JBWA 2PZWA 5D3IB 4OIKA 3OMCA 1JE4A 4C3IB 3TZDA 2RDHA 3ERQA 3VA7A 2RSNA 1TWCB 3TSSA 1E0BA 2KEEA 4DFAA 1V1OA 2IX1A 1SNMA 2EY2A 4XIGS 1TQOA 5FO7B 1CQVA 5FLXL 3HOWB 2F0MA 3J80E 4KJNA 3KBGA 2F0LA 2KEDA 2NB0A 2A5HA 5KNDA 2A69C 2OT2A 4KKSA 3S2DB 1EFID 4M1UB 2K04A 1I4GA 1H9RA 3BYTB 2LKVA 2NTSA 1U9RA 1D5ZC 2EY5A 1I4HA 3S2HB 4K6DA 2EZVA 1LTAD 1GOZA 1O78A 1L0XB 1TU2B 4K2KA 1QE6A 1QB5D 1D2BA 3FRPB 4C1NI 2WIIB 3NQTA 1HRJA 3J7AV 3DXJC 2K33A 1F2YA 2L9HA 1D1KA 5E4WC 1CQFA 5FKAC 4A3DB 2JEAI 1IYUA 3BG3A 1VDZA 3NTKA 4DK0A 1HUNA 4BY1B 2QKIC 1E2ZA 5C6AA 5CR3A 3GTLB 5KNCA 4QCLA 2NVTB 4FF2A 1G2TA 2MJ8A 4BA2I 2RSOA 4K8JA 3T53B 4IZ8A 3GTOB 1YNNC 3VR5A 1AZPA 2SNSA 1ET9A 1SNQA 4IUVA 1EWCA 5CYUA 1ICWA 1JOKA 3SDZA 1DOLA 3OMGA 2F1MA 3OWEB 3E6ZX 2A6EC 3L7ZC 5I2XA 1M4VA 5FLXE 3VYRA 1BCPF 4RKBA 1CFMA 2H1EA 1OXSC 4PNYA 4OHJA 3GTMB 1IKLA 3J81L 1BF4A 1S5ED 3KUPA 3AMUA 1LTRD 1BNZA 5HURA 2B2WA 2EVBA 1PFBA 5I9OA 1SE4A 1ESRA 3HEJA 1AW7A 1D5XC 1ENCA 2M00A 4CHTB 3PIP3 4K8IA 3SXHA 3UI2A 1I4XA 4G7ZC 3I91A 2EYHA 2JA8B 2ENBA 1STEA 2KCCA 1EY9A 1EZ6A 1G291 1Q90A 5M3FB 4GZYC 2F0JA 1BR9A 4KKUA 3H6MA 4MHEA 3FDTA 5G3LF 1WTXA 1STBA 2Z4IA 4BBSB 1PFMA 4OO1G 4IUUA 2NN6H 3H94A 3RZOB 1TS5A 5IGDA 1ZYRC 4K5VA 2HCIA 4A3KB 3FMCA 1PXUA 1H9SA 4PMCA 2K1BA 3MAQA 1VF5C 1EYAA 3M7GA 2KQ3A 4O42A 1JWMD 4IFDI 2NVXB 3QO2A 4C3HG 2SDFA 3M4OB 3A56A 3P20A 3K6OA 5A2QL 3GO5A 1A2UA 2HCCA 2C9OA 4KY6A 4KN4C 1HHVA 1PRTD 1F9QA 2KOLA 3TMEA 2O5JC 3R2TA 5IT9E 4RGMA 1I6VC 1DOMA 4TRDA 1EU4A 5IODA 1E2WA 1NSNS 4KJOA 4OL7A 2BA1A 3HGBA 4KKTA 1LT4D 5G3LD 5EJWA 2NVYB 1CM9A 1I50B 3NQIA 3IFDA 1TS3A 3O13A 3VR3A 2AUJD 3ZYYX 2WKCA 4FXGC 4RGOS 2TMPA 1Y69U 3SE0A 4DK1A 2JEBI 1B9MA 1B50A 4CGYB 3I8ZA 3M7NA 3D3RA 3KBXA 5E3FA 1YNND 4A93B 2XSCA 2K5QA 1CHPD 2B63B 1OXVA 4IUQA 3GTJB 1EYDA 1EZ8A 4KD4A 3SK6A 2NUCA 3J7AF 2L12A 2O4XA 4FXKC 2EYLA 1BDOA 1S5CD 4DGZA 5C3WA 1F2LA 2WAQB 4XQNA 5I6WA 1KDCA 1HQRD 3T16A 1HA6A 5DEHA 2G9DA 2XWBB 3D6CA 4BWGB 1B2TA 1Y8OB 3PMFA 3GTQB 5C44B 2F0HA 2K6AA 4IFDH 1DXMA 4HAEA 3WOEA 1RDPD 1TY0A 2E2JB 4A3GB 3WOFA 2K32A 3HOZB 2PO4A 2GA4B 3PUZA 4DAVA 3A54A 1IW7C 1M8AA 2EOTA 1KLGD 4NDXA 4KV6A 1CT1D 1VMCA 1SAPA 2JSOA 4C1NK 4HMIA 1AFPA 2R6GA 2QILA 5IGFA 1K8OA 1DCZA 2YU9B 1STYA 3HRZC 5K36H 3M3YB 2XN9C 1Q8IA 3BVZA 1JICA 5C5MA 4RGTA 2BE5D 5D65A 5C4HA 3RUZA 1G91A 1F9PA 3IFTA 5EPKA 1SSOA 5EKLA 5DM63 4AYBB 2EYFA 3D4DA 1WTOA 1PTOB 1QJOA 3G7LA 4NKLA 4ZKCB 4R9WA 2B2YA 2F0VA 1LO5D 2E2HB 5C3EB 2NTTA 3PUYA 3SHLA 3TDQA 3J81E 1RCVD 1XXGA 1GUWA 3D31A 3U9OA 3NBHA 4UAIA 3CU7A 5CV4A 2B2TA 3OIPA 2CVRA 4HTHA 2IW3A 4BS9A 2F0DA 4J8QA 2D62A 4XYOA 2IPKD 3QWNA 3I4MB 5C0XG 2Y0SB 4IFDG 2J4XA 1PTOD 1FR3A 4EQPA 4KK7A 1B53A 4Q5VA 2XRSD 1GUOA 3EA6A 2K01A 3EJIA 4XQQA 3V96A 2K5WA 4K6LA 3LWUA 4X3UA 2KECA 1WTQA 1EY5A 1K83B 4DF7A 1WTPA 5KEEA 5KYLA 2F0SA 4IUTA 3BZDB 5I6YA 4XDXA 3EROA 2VUMB 4FF4A 3Q23A 1BUVT 4V190 4OO1H 5CC4A 3M85A 2NN6I 2B39A 1I4PA 5JVH3 2Q8TA 1H9KA 2FMCA 2VNUD 3OOCA 1X3PA 1QG7A 3R93A 4C2MB 2HDMA 5C0XI 1F77A 3R3OA 2FJ2A 1C8CA 4BY7B 3T56B 4A3EB 2IL8A 1QNKA 3Q24A 1Y8NB 1RHPA 4RAUC 3GTKB 3J7YW 2X69A 1Q12A 2XNAC 3RLFA 1VCIA 1VF7A 1SYGA 4NW2A 1F9RA 3OPOA 3TN2A 2L55A 4RA8A 1EQTA 2Z4HA 3OHXC 3V2TA 5CBAE 3J80L 4OGQC 1OO9B 3W2DA 1GXDC 2FHTA 5ISRA 4C56C 2NWGA 1I4QA 1MSGA 2B2UA 4HCSA 4C3IG 1IHZA 3KLRA 1A2TA 5EPLA 5E4XA 2E74C 1JCKB 1X32A 1A6XA 1NCVA 3FVQA 1LV9A 2F0EA 3VYUA 4NP5A 4WORA 2QCPX 5IGCA 1TS2A 3G6JB 1UEAB 1KNAA 2FFKB 1ONLA 1XX8A 3AU7A 4Q0FA 1SE2A 4N9PA 1SMYD 3HOXB 1HFGA 5NUCA 1SYBA 2D2CC 3LWEA 3I72A 4ZK9B 4XT3B 2NYZD 2B2UC 4J6HA 1FNUA 1MSHA 5BN5A 3U9SA 1BCPD 4EVOA 3BVGA 1GUTA 1J9OA 4O1NA 1II3A 2MP1A 4G7OC 4I7ZC 4BA1I 1SE3A 3TBIB 3JAME 1PTOH 2X6GA 3S17B 3VYTA 4ZYSA 3I90A 5JEAJ 3PO3B 2BA0A 5A35A 3HP3A 4RGNA 1AEXA 2WV6D 4TKOB 1UAPA 3FPUB 1JC7A 1DONA 2BDNA 4PQXA 4IURA 1TIID 4I65A 1T5EA 2IWHA 5M5YB 5KNBA 2B2WC 3H09A 1U4RA 1DJRD 4YIJA 3SVMA 1HTPA 3MHBA 1TWAB 1RD9D 4RCOA 2ZT9C 1G2SA 4KI0A 5C4JB 2CHBD 3K58A 1IL8A 3MEHA 4ZQ3A 1ILPA 1Q1BA 1AP0A 1G8ZD 1WVLA 3S1NB 3T13A 3BVMA 5K5PA 4X3TA 3MXUA 2J7ZA 4XXEA 2QF7A 3GD7A 3EQLC 1BXTA 1EIHA 3NE5B 1EY4A 5KYIA 1QWYA 4U68A 5CV5A 3T4AC 4C3JB 1QOHA 4RKLA 3NUCA 3VYSA 5DNFA 3GP7A 1FGBD 3P1HA 4S3SA 1TS4A 5CV6A 1LT5D 2KHSA 1ZKOA 1BCPC 4IQZA 2D5DA 3NHHA 5ELBA 1B9NA 1EQVA 3ONAB 5K36G 3HOYB 2CW0C 1BBXC 2A6HD 2F0TA 3T51B 2XIWA 2I07B 4L63B 5LL6S 2PCFB 4C3JG 1FNVA 2CW0D 1K8MA 2DY8A 1R4PB 2V4DA 1EIGA 2CQAA 1LTBD 3CHBD 2NBFA 2KVMA 1STHA 2EYPA 1L0YB 2N55A 3HOUB 2JP1A 3KK7A 2BDOA 3QOJA 1ZEQX 3PUXA 2EDGA 2A68D 3R2IA 1ZYRD 3ND8A 4K5WA 1C48A 2EE1A 2RKSA 2B2VA 2IJ0A 3R8BA 4ABNA 1AN8A 4L6TB 1A15A 3NSWA 3NPPA 4RWSC 1R4QB 1RTOA 1TKWB 3K7AB 3PO2B 3BDOA 2L4NA 1X3QA 5J39A 2C5CA 1DD2A 1W6KA 3ITPA 4RHSA 1IW7D 1V43A 1ML0D 1O80A 5M5XB 1A3UA 3MXPA 1H9MA 5JAVA 2AQ1B 2EYJA 1TVXA 1XTCD 1HCZA 2LMCB 4H7BA 1RF2D 1S4ZA 4X3KA 3SEBA 5I9PA 1STGA 5LHY1 5C5LA 3VR4A 1EEFD 2FMMA 1B3AA 4WFN3 3BDLA 1SNPA 5ELEA 1EU3A 4IN3A 1EWHA 2Q8RE 2F0PA 1TR5A 2PZUA 5HGTA 3EFXD 1R9TB 4B9WA 1GJXA 5J1ZA 2E75C 4ULLA 2JA7B 1WTVA 5IOCA 3NXWA 1NUCA 1OXTA 4KD3A 5FO8B 4ZAIA 1ZXTA 5EBDA 4F88A 4HN7A 5EGTA 2L1BA 2DNCA 2RDFA 1MBYA 4DNTB 5CMDA 5I4DA 1RODA 1NR4A 3MFYA 1ENAA 3FKIB 3Q6SA 3GTGB 2L5TA 4A3JB 2QEJC 1O7LA 2PQEA 4BBRB 4PMWA 5C3XA 2R93B 1WTRA 2XRQD 2OEOA 3C1FA 3K5OA 1FYCA 4OO1I 3HZXA 1EOTA 1PTOF 1Z6HA 1J8IA 3IKJA 2XWJB 1Y1WB 2PPBC 5T1IA 1NAPA 4NMZA 3RD4A 1MGSA 5JEAG 2PW5A 1PRTB 1HPCA 1BQQT 4TQUS 3A55A 2EY1A 1CZGA 3Q22A 5FK9C 4V0BA 2PNRC 5BN4A 3NWSA 2IT1A 1DZ1A 2LFNA 4ZUJA 3GTPB 3A8IE 4CKCA 3NTHA 1Y8PB 5BN3A 3QG1A 3K59A 2BE5C 3E5SA 3W3AA 3N52A 3NWTA 2RDGA 1EL0A 4H13C 3H0GB 2O2LD 3I70A 4FF1A 3DWAA 2DY7A 5CGKA 3GQBA 4MIUA 3BS1A 4IUPA 1SEBD 1NR2A 2D9UA 4DXGA 3MA2B 5EPJA 1DOKA 3QJYA 2EYOA 2IX3A 3X3MA 1LT3D 4ZUIA 4Z9CB 2Q8IB 2WP8J 3I4NB 1SJED 1PLFA 5I2YA 1RJTA 1Z47A 5J22A 1LLRD 1D5MC 4A3BB 1D1IA 1SDFA 1EY0A 2AWOA 4Y7NB 1KLUD 1STNA 4M8AA 5DM73 3F2UA 3DWPA 4EGVA 4PV1C 4DU9A 1JWSD 1U4PA 2ID0A 1ILQA 1JWUD 2SOBA 2RVLA 1MD2D 3TP5A 2WB1B 1A3VA 3DEOA 3H91A 3KLSX 2JYOA 4DNRB 2JA6B 1HXYD 4FYDA 1O7ZA 2H4OA 1KNEA 1I3QB 3SK8A 4R8IA 2A6ED 1STAA 3MTSA 3C1EA 4HCEA 1H9JA 1VMPA 5IGBA 3I73A 1WD1A 4XYQA 2KUMA 1S5BD 2M9VA 4DA2A 3IAYA 1FNWA 1YNJC 3X3NA 3TP6A 5JPNC 1GUNA 3MXNA 1I6HB 1TWHB 5KGUA 1LT6D 4LK1C 2ZXOA 2ICIA 3NK9A 2K05A 5C0XJ 4A3IB 1A3TA 4IFDJ 2KA7A 5EBCA 3A8JE 2L11A 1OXUA 4WRDA 2MUYA 2E2IB 1JOQA 2DN8A 2O5IC 3HOVB 2RBMA 2F0UA 1T5XD 3SK5A 3S14B 3S1QB 2TSSA 1KDAA 1RTNA 4K5XA 2HUGA 4FNFA 3C46A 2EXZA 1PRTF 1ESFA 2EJGC 3GV3A 3PIO3 5IGEA 4RCNA 2JA5B 1HFNA 3A8KE 4K14A 2AQ3B 4DXFA 3P75A 3D4WA 4RH6A 2X6LA 4X3SA 4IUNA 1TWGB 3VA5A 2A6HC 3PUWA 1PFNA 1PYWD 2PMZB 4A3MB 3K5NA 2SNMA 3RMHA 2BCOA 4K2LA 1B1ZA 2B8GA 2NN6G 1TWFB 1GHKA 2I46A 2B2YC 2NZ1D 1PMRA 3A7LA 2VXWA 4F7XA 4F8MA 5KRUA 1F9SA 1UUPA 1PTOC 2JE6I 3NBIA 5FO9B 3TP7A 5LL6X 5C4ZA 1G6ZA 1HTLD 1LTGD 5EQ0A 4R8NA 1Q3LA 1SYEA 1QCBD 5F2DA 5M9OA 3IL8A 2PYKA 1WD0A 1B4OA 1PDQA 5JVG3 3QIAA 4ODGA 3I4LA 1EYCA 2F0GA 1ENFA 4CJ1B 3MWYW 4CKEA 2B8FA 1SYCA 2L0CA 4G57A 3LX0A 3V05A 2BOSA 1PRTC 4QMGA 5ELFA 3Q0AA 2JXMB 3WDNA 1Y1VB 3SK4A 1I4RA 2FINB 4OIJA 2HDLA 2M2LA 2NVQB 1KTKA 1SNCA 5CV7A 4H44C 1PZJD 1EY7A 2A73B 5KIXA 1F2MA 5AFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OT2 A;  3VYU A;  3VYR A;  2Z1C A;  3VYS A;  3D3R A;  3VYT A; 
#chains in the Genus database with same CATH topology
 3S16 H;  2K5N A;  4E6I A;  4Y7N H;  1EIF A;  3FPP A;  3UDG A;  3CKI B;  3PF4 A;  4DAY B;  1CTM A;  1LAB A;  3CCV A;  4LF9 Q;  4CBV A;  1MHW C;  2A68 C;  4LFB L;  1JB3 A;  1KAB A;  3PO2 G;  4JYA L;  4HJ7 A;  4LF5 Q;  4F87 A;  2E76 C;  1TY2 A;  2JA8 H;  4DV5 Q;  5GRO A;  4IJH A;  4PMB A;  1IKM A;  2K7V A;  4FO2 A;  4JI0 Q;  1WCM B;  3H3V C;  4DR4 Q;  3AB9 A;  4IPD A;  3P7J A;  3F2B A;  1DYQ A;  4FP5 D;  2NZH A;  3N6R A;  2L15 A;  4L8J A;  1KC8 C;  3K7A H;  4P71 A;  1AH9 A;  3L9A X;  3DEP A;  2EPB A;  4DR6 L;  4JCV E;  5M3F H;  4HED A;  5IIF A;  3D6W A;  4IPG A;  1KDB A;  3KF6 B;  2EYM A;  3I55 A;  4IJL A;  1O7Y A;  4RFB A;  2XVS A;  2MHV A;  1LAC A;  2Q2I A;  2N88 A;  1Q1E A;  2A74 C;  1V8Q A;  1SRO A;  1A62 A;  3CD6 A;  4AYB G;  1GHJ A;  4HMJ A;  5M3M B;  2F03 A;  3HOU H;  1Z7T A;  3HS0 C;  2JA5 H;  1WOC A;  3K0X A;  5CBE E;  1F2Z A;  1N33 L;  4GN5 A;  2KBN A;  4GNX B;  3A5Z B;  1WTW A;  5C0X H;  3G4S A;  1TT2 A;  4G4K A;  4B08 A;  1A8V A;  1XWE A;  1PV4 A;  1BO0 A;  2Z8L A;  2B2V C;  4QUF A;  3ULL A;  5JPM C;  3J7A 5;  3E0E A;  4WJW A;  1HA5 A;  3LNN A;  1PZI D;  1U4M A;  3GTO H;  1VQ5 A;  2YTY A;  2J0T D;  1CA5 A;  2VUM G;  4C3H B;  2R92 G;  1C9O A;  2SEB D;  4DK3 C;  2F0O A;  2F0Q A;  3OTO Q;  1DM0 B;  3EIV A;  4IAL A;  3CQZ B;  1ET6 A;  1VQI A;  1XPU A;  5FOB B;  1CHQ D;  3EN2 A;  3MZ5 A;  4RHR A;  1KAA A;  2WAC A;  1WYD A;  3CCQ A;  4CKB A;  2ZXR A;  2R3Z A;  5IE8 A;  1CA6 A;  1W6J A;  1Q8K A;  3PV0 A;  4LNQ A;  5HGQ A;  5IP9 H;  3QB3 A;  4LF8 Q;  2A1A A;  4TSS A;  3FEW X;  3MC0 B;  1EEI D;  1SXT A;  4QF4 A;  2OQK A;  2UXD Q;  4BBR G;  4QGU A;  4LF6 L;  1HQM C;  3UE0 A;  4B3R Q;  3GV6 A;  1C0A A;  5IGG A;  4L5S A;  3M4Y A;  3CMA A;  5DAU A;  1QUQ A;  3EBE A;  3PUV A;  1JOR A;  5EKK A;  4A3L H;  4N8F A;  2R93 H;  1JQY D;  1SFO B;  1QIL A;  1QVG A;  2BH2 A;  4P2C B;  2VZA A;  4NXN L;  2F0F A;  4AYB E;  1EUJ A;  1OXX K;  4HSP A;  5JJZ A;  4GKK Q;  5ELD A;  2Z1C A;  5COR A;  3OSO A;  5JEA H;  1VQM A;  5EAY A;  1PH5 A;  2E5L L;  4J1M A;  3K5L A;  4DNI A;  1YNJ D;  4DV1 Q;  4WJ3 M;  2R92 B;  2RF4 A;  1Q82 C;  4POF A;  3JAM i;  2EJF C;  4DR1 Q;  4R4T A;  3DUZ A;  1JB7 A;  2LS0 1;  2RHS B;  2WFW A;  1SR3 A;  3KLS A;  5CV8 A;  2R7Z G;  4QIW B;  3S15 B;  2PNH A;  2F0N A;  3WWV A;  4QIW E;  3GTK H;  3KF6 A;  4FVM A;  3S16 B;  3KJP A;  3TP8 A;  3K7U C;  2E5L Q;  2ICE C;  1I3Q H;  3HOZ G;  4A3E H;  1FD7 D;  3ULP A;  3URY A;  2Z6B A;  3L3O C;  2F3W A;  2PI2 A;  1SJH D;  1AZQ A;  4XT1 B;  2MGS A;  1EY8 A;  1G6P A;  3D4R A;  3TQY A;  3BU2 A;  1LYL A;  4G7H C;  2VB2 X;  1JJG A;  4H0L C;  1Y1V H;  4QJF A;  1X3F A;  4IOA A;  4QUC A;  4A3F B;  1SMY C;  1CZW A;  1LTT D;  2LY7 A;  3NP8 A;  2R7Z B;  4A3B G;  2YYZ A;  1QNU A;  1U4L A;  2I5H A;  4GKJ Q;  3QOL A;  1PZK D;  3K0Y A;  3RZD B;  3VR6 A;  1GUG A;  4LAA A;  4A93 G;  4ZLT F;  2F0W A;  2AUK A;  4ZRZ A;  1E2V A;  3D8G A;  4LF5 L;  4U67 3;  2EY6 A;  1UE7 A;  2B2T C;  4LF4 Q;  5ELC A;  2DNE A;  1N34 L;  3CME A;  5D14 A;  2K5D A;  2R61 A;  4KY7 A;  4XTC S;  4DAY A;  1N8R C;  3VR2 A;  5M5X H;  4LJZ C;  2PQA B;  2ASB A;  4YY3 Q;  4ME5 A;  4EQO A;  5C4X B;  2PZT A;  3MXG A;  3HOX H;  3UDF A;  3U58 A;  3SR1 A;  2OF1 A;  3KJO A;  2PW7 A;  3KF8 A;  2WKD A;  4A3B H;  2PI2 E;  4HR7 B;  1J5E Q;  4IPC A;  1C4Q A;  5IYC G;  3DWQ A;  4KY5 A;  1H9S B;  4A75 A;  1HZB A;  5T1G A;  2RQX A;  2VB3 X;  3DMU A;  1S5F D;  3I4O A;  1S5D D;  4DN4 M;  4EQN A;  3PO3 G;  3CRK C;  1UNS A;  4UDU C;  5IT9 L;  1V1P A;  5LMU L;  3I4N G;  3OW7 A;  4HSV A;  3ND9 A;  3K57 A;  1SND A;  1VQN A;  3S9W A;  1HZC A;  1JOO A;  4FDB A;  4LMQ D;  2AWN A;  2F3V A;  1CK1 A;  2WIN B;  4QB4 A;  3NTI A;  4KMU C;  5EKI A;  4N9T A;  5A2Q E;  2K03 A;  2RA4 A;  3C2P A;  4LF6 Q;  4OWT B;  2ZJQ A;  3HOZ H;  3CCR A;  1KIX A;  4HIM A;  4AIM A;  2VS1 A;  3OWF A;  1Y1W H;  4P72 A;  5JOB A;  1MI2 A;  2QDB A;  4ILW A;  3DHQ A;  3MFG A;  1N33 Q;  1BOS A;  4A3C H;  4B9X A;  1MJE A;  1BCP B;  1GUS A;  1SYF A;  3HG9 A;  4YWL A;  2K28 A;  4KHZ A;  4ID6 A;  4JK1 C;  3DM1 A;  1VQK A;  5M5W B;  4CJ2 C;  2CCZ A;  4KN7 C;  3BYY B;  1HUM A;  2GVB A;  1K8G A;  3OW2 A;  2A69 D;  3RN5 A;  4KTA A;  1VQD A;  4R4Q A;  3HKZ B;  3E0J A;  1V1P B;  4KHV A;  2F0I A;  3EVQ A;  1XYI A;  3A7A B;  3BDC A;  1RKN A;  3JAM L;  1JR0 D;  4ZKB B;  5C44 G;  1SBB B;  2RHQ B;  1GO3 E;  3FKI H;  1D6E C;  3CRL C;  4CJ0 B;  2KCN A;  1K0R A;  2EJM A;  1EY6 A;  1PYB A;  1LTS D;  3K5M A;  3I3C A;  1EFW A;  4FXD A;  1LTI D;  2I0Q A;  2G9H D;  1SMX A;  5COY A;  5D3D A;  4C3J H;  3S1R B;  4HJA A;  3C3L A;  4FF3 A;  2AQ2 B;  3CC2 A;  1TXY A;  1J5E L;  3TZU A;  3S1M B;  2UUB Q;  2HQE A;  4BXX G;  5CV9 A;  5E1F A;  1NMF A;  2VQE Q;  2F0K A;  2KJX A;  2VQF Q;  3ULJ A;  3MVV A;  2H5X A;  2OXP A;  4JI1 Q;  4MN3 A;  3OIQ A;  3I4M H;  1SYD A;  1CI3 M;  5TSS A;  4JOI A;  2F4I A;  5LMU Q;  4DAP A;  2MPM A;  4XQJ A;  2IX0 A;  1B44 D;  1TWA H;  2E2D C;  3T1H L;  3D0F A;  1E1O A;  2ZXP A;  1SNO A;  1IYV A;  4JBW A;  2PZW A;  5D3I B;  1YBY A;  4OIK A;  2VQE L;  4JOI C;  3OMC A;  2PQA A;  1JE4 A;  3H0G G;  4C3I B;  2JA6 H;  3TZD A;  1VQB A;  1SN8 A;  1PH6 A;  2RDH A;  3ERQ A;  3CAM A;  4DUZ Q;  4JI7 L;  3VA7 A;  4LF4 L;  2F4V Q;  2RSN A;  1HH2 P;  1TWC B;  5C4J H;  3TSS A;  4LW1 A;  2HHH Q;  1E0B A;  1UWV A;  3S1Q H;  2KEE A;  1GM5 A;  3S14 H;  4DFA A;  1V1O A;  2WAQ E;  4LUO A;  2IX1 A;  1SNM A;  2EY2 A;  4XIG S;  1TQO A;  5FO7 B;  1CQV A;  3HOW H;  5FLX L;  3HOW B;  4X66 Q;  2F0M A;  3J80 E;  3S17 H;  2EQS A;  4KJN A;  3KBG A;  2F0L A;  3S2H H;  3M9B A;  2KED A;  2NB0 A;  1VS0 A;  1XNR L;  2A5H A;  4JI6 L;  1R9T H;  2AMC B;  5KND A;  1UE5 A;  2A69 C;  2OT2 A;  4KKS A;  1KQS A;  3S2D B;  3ER0 A;  1EFI D;  4M1U B;  2K04 A;  1I4G A;  1H9R A;  3BYT B;  2LKV A;  1X3G A;  3AFP A;  1U9R A;  2NTS A;  1D5Z C;  2EY5 A;  1I4H A;  3S2H B;  4K6D A;  2QA4 A;  2EZV A;  1LTA D;  4PZ7 A;  1GOZ A;  1O78 A;  1PH7 A;  1L0X B;  1TU2 B;  2QW7 A;  4JC0 A;  4K2K A;  4A3F H;  1QE6 A;  1QB5 D;  4JI3 Q;  3J81 j;  4JI5 Q;  1D2B A;  1HR0 Q;  3PIO A;  1GD7 A;  3FRP B;  4C1N I;  3K81 C;  2WII B;  3NQT A;  4A76 A;  2R7D A;  1HRJ A;  3HFZ B;  1S72 A;  3J7A V;  3KOJ A;  4AH6 A;  3DXJ C;  2K33 A;  2A8V A;  1F2Y A;  2L9H A;  5ELN A;  1D1K A;  5E4W C;  2I5M X;  1CQF A;  5FKA C;  4A3D B;  3J80 c;  2JEA I;  4P73 A;  2V1C C;  4DPG A;  1IYU A;  3BG3 A;  1VDZ A;  3NTK A;  4DK0 A;  1HUN A;  2D0O A;  3I4M G;  3CCL A;  4KHP L;  4QY7 A;  4BY1 B;  3S1R H;  3RR5 A;  2B3G A;  2QKI C;  4TVA B;  2UXD L;  1E2Z A;  5C6A A;  1YJ9 A;  5CR3 A;  1SFO H;  3BZC A;  3GTL B;  2NZO A;  2WB1 G;  5KNC A;  4QCL A;  2NVT B;  4FF2 A;  1G2T A;  2MJ8 A;  4BA2 I;  4DV6 L;  2RSO A;  4K8J A;  4JYA Q;  5FLM H;  3T53 B;  1DGS A;  3HOY H;  4IZ8 A;  4JI2 L;  1IL2 A;  2Y0S E;  3GTO B;  1YNN C;  3VR5 A;  1AZP A;  2SNS A;  5M5W H;  3GTP H;  1ET9 A;  1SNQ A;  4IUV A;  1EWC A;  2ES2 A;  4HIK A;  4OX9 L;  5CYU A;  1ICW A;  4DAM A;  1JOK A;  3SDZ A;  3AEV A;  5JJL A;  1DOL A;  3OMG A;  2F1M A;  3OWE B;  3E6Z X;  1FL0 A;  4A3E G;  2A6E C;  3L7Z C;  5I2X A;  4C3H H;  1M4V A;  5FLX E;  1AE2 A;  5IP7 G;  3VYR A;  1BCP F;  4RKB A;  1CFM A;  2H1E A;  1OXS C;  3T1H Q;  4PNY A;  4OHJ A;  2EXD A;  3GTM B;  1IKL A;  3RN2 A;  3J81 L;  5C4X H;  1BF4 A;  1S5E D;  2RCN A;  3UDI A;  5FJ8 G;  2CH4 A;  3KUP A;  2N49 A;  3AMU A;  1LTR D;  1XMQ Q;  1BNZ A;  5HUR A;  2B2W A;  2EVB A;  1PFB A;  5I9O A;  1SE4 A;  1K3R A;  1ESR A;  3HEJ A;  5JJI A;  1AW7 A;  1D5X C;  1ENC A;  2M00 A;  1WCM H;  4CHT B;  3PIP 3;  4K8I A;  2MFI A;  3CF5 A;  3SXH A;  3UI2 A;  1I4X A;  4OWX B;  4G7Z C;  3I91 A;  2A19 A;  2EYH A;  2JA8 B;  2ENB A;  1STE A;  4CDD C;  4B3M L;  2KCC A;  4LF7 Q;  3S2D H;  1EY9 A;  1EZ6 A;  1G29 1;  1Q90 A;  1HNW L;  5M3F B;  5IYB G;  2ALY B;  4GZY C;  3HOX G;  3TS2 A;  2F0J A;  1BR9 A;  2Y0S G;  4KKU A;  3E3X A;  2VUM H;  3H6M A;  1B7Y B;  2JA7 H;  3F8T A;  4MHE A;  4DK6 C;  3FDT A;  5G3L F;  1ASZ A;  2OCE A;  1WTX A;  1STB A;  2Z4I A;  4BBS B;  4X62 L;  5FLM G;  4IO9 A;  1PFM A;  4OO1 G;  1KL9 A;  5LMN Q;  3M4O H;  4IUU A;  2NN6 H;  3H94 A;  3RZO B;  1AE3 A;  1TS5 A;  1YEZ A;  4A3J G;  5IGD A;  2UUC L;  4K0K Q;  4JI7 Q;  1ZYR C;  2UXB L;  1L1O A;  1ASY A;  4K5V A;  2HCI A;  1VQ8 A;  4A3K B;  3FMC A;  1PXU A;  1H9S A;  1K9M C;  1I94 L;  2HHH L;  4PMC A;  2K1B A;  3MAQ A;  1VF5 C;  1FGU A;  4KHP Q;  4NXN Q;  1EYA A;  3M7G A;  2KQ3 A;  3JC6 6;  1JWM D;  4O42 A;  4IFD I;  3QO2 A;  4C3H G;  2NVX B;  1XMO L;  2DJF C;  2SDF A;  3M4O B;  3A56 A;  3P20 A;  2UUB L;  3K6O A;  4GKJ L;  3RLO A;  1VQ6 A;  5A2Q L;  3GO5 A;  1VQ9 A;  5BR8 Q;  1A2U A;  2HCC A;  2C9O A;  4KY6 A;  4KN4 C;  1HHV A;  1PRT D;  1F9Q A;  2KOL A;  3TME A;  2O5J C;  3R2T A;  5LMN L;  4RGM A;  5IT9 E;  1I6V C;  1DOM A;  4TRD A;  2K50 A;  4OON A;  1PH9 A;  4NXM L;  1EU4 A;  3H15 A;  5IOD A;  3M4P A;  1E2W A;  1NSN S;  4KJO A;  4OL7 A;  2BA1 A;  3HGB A;  4KKT A;  1LT4 D;  5G3L D;  3A0J A;  5EJW A;  3RZO H;  2NVY B;  2ZJP A;  1CM9 A;  1I50 B;  3NQI A;  2KHJ A;  3FP9 A;  3HOW G;  3IFD A;  1TS3 A;  1HR0 L;  2DUD A;  3O13 A;  3VR3 A;  4JI3 L;  3I56 A;  2AUJ D;  3ZYY X;  3KDF B;  4YCV A;  3GDE A;  2WKC A;  4FXG C;  4RGO S;  1XNQ L;  2TMP A;  4X62 Q;  3SE0 A;  1Y69 U;  4DK1 A;  2JEB I;  1B9M A;  1B50 A;  4CGY B;  4L5Q A;  3I8Z A;  2BH8 A;  3D3R A;  3M7N A;  3KBX A;  3B6Y A;  4PZ6 A;  1YNN D;  5E3F A;  4LWC A;  4A93 B;  4DV5 L;  3Q8D A;  2XSC A;  1TWC H;  2K5Q A;  1CHP D;  2B63 B;  1OXV A;  1YNX A;  3J81 i;  4IUQ A;  4R4C A;  3GTJ B;  4L5R C;  1EYD A;  4BY1 H;  1EZ8 A;  4KD4 A;  3SK6 A;  2NUC A;  3J7A F;  2L12 A;  3PIP A;  2O4X A;  4FXK C;  2EYL A;  4DKA C;  1BDO A;  3U4Z A;  1S5C D;  4DGZ A;  5C3W A;  1PA6 A;  1F2L A;  2WAQ B;  4XQN A;  1LM0 A;  1YI2 A;  5I6W A;  4UP7 A;  1KDC A;  1HQR D;  3T16 A;  1HA6 A;  5DEH A;  2G9D A;  2XWB B;  3D6C A;  4POG A;  3TS0 A;  3S1N H;  4BWG B;  1B2T A;  1Y8O B;  3PMF A;  3GTQ B;  5C44 B;  1VQJ A;  2F0H A;  2K6A A;  4IFD H;  1DXM A;  4Y52 H;  1JE5 A;  4HAE A;  3WOE A;  1RDP D;  1TY0 A;  2E2J B;  4A3G B;  4JI2 Q;  2MO1 A;  3WOF A;  2K32 A;  1VQP A;  3I2Z A;  3HOZ B;  1YVC A;  3NBH B;  2PO4 A;  1X3E A;  3PUZ A;  2GA4 B;  1X9N A;  3MXN B;  1VQC A;  4DAV A;  1VQO A;  3S1M H;  3A54 A;  1IW7 C;  1M8A A;  2EOT A;  1KLG D;  4NDX A;  4X64 Q;  4KV6 A;  4ALP A;  3W5O A;  1CT1 D;  1VMC A;  1SAP A;  2JSO A;  4P74 A;  3F2D A;  4C1N K;  4HMI A;  4UP8 A;  1AFP A;  2R6G A;  2QIL A;  5IGF A;  3RZD H;  4IOC A;  4JI8 Q;  1K8O A;  1EWI A;  1DCZ A;  2YU9 B;  1STY A;  2KHI A;  3PCO B;  3HRZ C;  4JI0 L;  3OYY A;  2R7Z H;  1VQ7 A;  2UUC Q;  5K36 H;  3M3Y B;  2XN9 C;  5FLX c;  4EX5 A;  1Q8I A;  3U4V A;  3BVZ A;  1JIC A;  1Q86 C;  1ICF B;  5C5M A;  4RGT A;  4X64 L;  2BE5 D;  5D65 A;  5C4H A;  3M4Q A;  3RUZ A;  4JI4 L;  4YWK A;  1G91 A;  1F9P A;  3IFT A;  5EPK A;  1SSO A;  5EKL A;  1Y14 B;  2E2I H;  5DM6 3;  1RIP A;  3KYH C;  4AYB B;  1QVF A;  2OTJ A;  4GLV B;  2EYF A;  2C35 B;  3D4D A;  1WTO A;  1PTO B;  1YHQ A;  5IYD G;  1QJO A;  4HIO A;  2Q2T A;  3G7L A;  1EIY B;  1UE6 A;  4KLK A;  3F2C A;  4NKL A;  4ZKC B;  3PO3 H;  1BKB A;  4R9W A;  2B2Y A;  3QR8 A;  2F0V A;  1LO5 D;  2E2H B;  3PUY A;  2NTT A;  3TDQ A;  3SHL A;  5C3E B;  3J81 E;  4A3K H;  2KCM A;  2QGQ A;  3CCM A;  1RCV D;  1XXG A;  1GUW A;  3D31 A;  1E7Z A;  1YJW A;  2LXJ A;  3S24 A;  3NBH A;  4UAI A;  3U9O A;  3CU7 A;  2R7F A;  2B2T A;  5CV4 A;  3OIP A;  2CVR A;  4HTH A;  2IW3 A;  4BS9 A;  2F0D A;  4J8Q A;  2D62 A;  4XYO A;  1M90 C;  3KFU A;  1HZ9 A;  2IPK D;  3QWN A;  3I4M B;  4A3D H;  5C0X G;  2Y0S B;  4DR5 Q;  1PH8 A;  4IFD G;  3BZK A;  2ZM6 Q;  4DUY L;  1PFS A;  3F1Z A;  2J4X A;  3PQI A;  1PTO D;  4HJ8 A;  1VQL A;  1FJG Q;  1FR3 A;  4EQP A;  4GLX A;  4KK7 A;  1YZ6 A;  1B53 A;  4Q5V A;  2XRS D;  1N36 Q;  1GUO A;  1K8A C;  1KRT A;  1VQG A;  4X65 Q;  4GOP C;  3EA6 A;  3CXC A;  4CDE C;  1K3B C;  2K01 A;  3EJI A;  4XQQ A;  3V96 A;  1SLJ A;  2K5W A;  2F52 A;  4K6L A;  3L2P A;  3LWU A;  4BY1 G;  5IYB H;  2AHO B;  4X3U A;  2KEC A;  4YWM A;  1WTQ A;  2CQO A;  3H3V I;  1CSP A;  1EY5 A;  1K83 B;  4DF7 A;  4BBS H;  3FHW A;  5KEE A;  5IYC H;  1WTP A;  1W2B A;  1U5K A;  5KYL A;  2F0S A;  1IZ6 A;  4IUT A;  3BZD B;  1N9W A;  4NPS A;  5I6Y A;  4XDX A;  1KRS A;  3ERO A;  2VUM B;  2B63 G;  4FF4 A;  3Q23 A;  1BUV T;  4V19 0;  3I4N H;  4OO1 H;  1JT8 A;  5CC4 A;  1K28 A;  3M85 A;  1L0W A;  2NN6 I;  1KHI A;  2B39 A;  4GKK L;  1I4P A;  5JVH 3;  3CCE A;  1X65 A;  2Q8T A;  1H9K A;  1TWF H;  3ZJY C;  2FMC A;  2VNU D;  3OOC A;  1X3P A;  1XJV A;  1QG7 A;  3R93 A;  3PF5 A;  4R1J A;  1PH2 A;  4C2M B;  2HDM A;  5C0X I;  1F77 A;  3R3O A;  2FJ2 A;  1C8C A;  3J81 c;  2YU9 H;  4BY7 B;  3T56 B;  4A3E B;  2ZTD A;  1S40 A;  1IBK Q;  2IL8 A;  1QNK A;  2LXK A;  3Q24 A;  1Y8N B;  2Q2U A;  1RHP A;  1J6Q A;  4RAU C;  3GTK B;  3J7Y W;  1Q46 A;  5L37 A;  3UE1 A;  2X69 A;  1Q12 A;  3GTQ H;  2XNA C;  3RLF A;  1VCI A;  2B63 H;  4UHV A;  1VF7 A;  1SYG A;  4NW2 A;  4A3G H;  1YHB A;  2KEN A;  1F9R A;  2JQO A;  1E22 A;  3OPO A;  3TN2 A;  2L55 A;  5BR8 L;  4RA8 A;  1EQT A;  2Z4H A;  3OHX C;  3V2T A;  1BBW A;  5CBA E;  4DR5 L;  3J80 L;  2DGY A;  3HOV G;  4OGQ C;  1OO9 B;  3W2D A;  2NVT H;  1GXD C;  2FHT A;  5ISR A;  4C56 C;  3HKZ E;  1X54 A;  2NWG A;  1I4Q A;  3GTJ H;  1MSG A;  3A74 A;  2XGT A;  2B2U A;  1IXR A;  4HCS A;  4C3I G;  3DLL A;  1IHZ A;  4UY8 C;  2UXB Q;  3KLR A;  1A2T A;  5EPL A;  5E4X A;  3E9H A;  2E74 C;  1TWH H;  2VW9 A;  1JCK B;  1X32 A;  1A6X A;  1NCV A;  3FVQ A;  4A3F G;  1E1T A;  3KF8 B;  4PZ8 A;  1LV9 A;  2F0E A;  3VYU A;  4GNX A;  4A3I H;  4B3S Q;  4NP5 A;  4WOR A;  2GVA A;  2QCP X;  5IGC A;  1TS2 A;  3G6J B;  3PSI A;  4A4I A;  1UEA B;  4X6A H;  1KNA A;  2FFK B;  1ONL A;  1XX8 A;  3AU7 A;  4Q0F A;  3HOV H;  4HJ9 A;  1SE2 A;  4N9P A;  1Y1W G;  3GTG H;  1SMY D;  3RNU A;  3HOX B;  1QUQ B;  4B3T L;  1HFG A;  5NUC A;  1SYB A;  2D2C C;  3LWE A;  2EIF A;  3I72 A;  4ZK9 B;  4XT3 B;  2RCF A;  4O0A A;  5IWA Q;  3K80 C;  2NYZ D;  3U50 C;  2B2U C;  4J6H A;  1FNU A;  1MSH A;  4YCU A;  5BN5 A;  3U9S A;  1BCP D;  4EVO A;  2OWO A;  3STB D;  3BVG A;  4GNX C;  4NXM Q;  1CUK A;  1J9O A;  1GUT A;  3I7F A;  2FXQ A;  1II3 A;  2MP1 A;  4O1N A;  4G7O C;  2HIX A;  4I7Z C;  2MQH A;  4BA1 I;  4A3I G;  4B3S L;  1SE3 A;  4ME3 A;  1X55 A;  3TBI B;  4L5T A;  1K73 C;  1XTD A;  3JAM E;  1PTO H;  2HD3 A;  3T1Y L;  4LFC Q;  2X6G A;  4DR1 L;  3S17 B;  5GAH C;  3VYT A;  4ZYS A;  3I90 A;  5JEA J;  3PO3 B;  4MZ9 A;  2BA0 A;  5A35 A;  4DR6 Q;  3HP3 A;  4RGN A;  4BY7 G;  1AEX A;  3L0O A;  3HKZ G;  2UU9 L;  2WV6 D;  1BBU A;  4TKO B;  1UAP A;  1H95 A;  1XPO A;  3FPU B;  1JC7 A;  1DON A;  4A3G G;  1B3Q A;  2BDN A;  4PQX A;  4IUR A;  4DR2 L;  1XPR A;  1TII D;  4I65 A;  1S3O A;  1T5E A;  2IWH A;  2NVX H;  4B3R L;  5M5Y B;  1MIU A;  3M3Y H;  5KNB A;  1IBM Q;  2B2W C;  2N78 A;  3H09 A;  1U4R A;  1DJR D;  4YIJ A;  1NE3 A;  3SVM A;  1HTP A;  1L2F A;  1K83 H;  3G6E A;  1CKN B;  3RLN A;  3MHB A;  2OTL A;  1TWA B;  2WAQ G;  1RD9 D;  4RCO A;  2ZT9 C;  1G2S A;  4KI0 A;  4BBS G;  2JJQ A;  5C4J B;  2CHB D;  3K58 A;  2ATW A;  1IL8 A;  3MEH A;  4ZQ3 A;  1ILP A;  1Q1B A;  2YTV A;  1AP0 A;  1PHJ A;  1G8Z D;  5GQO A;  1WVL A;  3S1N B;  3T13 A;  4LUV A;  2E8G A;  2K5V A;  3BVM A;  4X3T A;  5K5P A;  3MXU A;  2J7Z A;  4XXE A;  2QF7 A;  3GD7 A;  3EQL C;  4DV2 Q;  1BXT A;  1QZH A;  4R4I A;  1EIH A;  3NE5 B;  1EY4 A;  5KYI A;  1OTC A;  2QEX A;  1QWY A;  1PH3 A;  4U68 A;  2K4K A;  5CV5 A;  4DUZ L;  3T4A C;  4C3J B;  1QOH A;  4RKL A;  1D7Q A;  3NUC A;  3VYS A;  5DNF A;  3GP7 A;  2HQL A;  1FGB D;  1QVC A;  3P1H A;  4S3S A;  4LFC L;  1TS4 A;  5CV6 A;  1HZA A;  1LT5 D;  2KHS A;  1ZKO A;  1IBK L;  3H0G H;  3G71 A;  1BCP C;  4IQZ A;  5GAD C;  2D5D A;  3NHH A;  5ELB A;  1IBL L;  1B9N A;  1EQV A;  3ONA B;  5ELO A;  5K36 G;  4LF9 L;  2UU9 Q;  1YJN A;  3HOY B;  2CW0 C;  1BBX C;  1RL2 A;  1E3P A;  2A6H D;  2F0T A;  1NJI C;  4UP9 A;  2XTI A;  3T51 B;  2XIW A;  1N32 Q;  2I07 B;  4L63 B;  5LL6 S;  5J3B A;  4LFA Q;  1VQ4 A;  2PCF B;  4CDF C;  4C3J G;  4OEM B;  1FNV A;  2CW0 D;  4UPA A;  1K8M A;  2DY8 A;  1R4P B;  1CKO A;  3SGI A;  4MTK A;  2V4D A;  1B8A A;  1EIG A;  4BXX H;  2CQA A;  4JI1 L;  1LTB D;  3CHB D;  2JK8 A;  2NBF A;  2KVM A;  2B29 A;  1STH A;  2Z6K C;  4PG3 A;  3CCJ A;  2EYP A;  4JI5 L;  1L0Y B;  4JI8 L;  2N55 A;  1P16 A;  2QDL A;  3HOU B;  2JP1 A;  3KK7 A;  2BDO A;  3QOJ A;  4I7A A;  4B3M Q;  1ZEQ X;  4GOP B;  4LF7 L;  3PUX A;  4DV6 Q;  4A3M H;  4BY7 H;  2EDG A;  1CSQ A;  5H1S E;  2A68 D;  1X6O A;  3R2I A;  2HT1 A;  1PVO A;  1ZYR D;  3ND8 A;  1D8L A;  1HNW Q;  4K5W A;  1C48 A;  1Z9F A;  2EE1 A;  2RKS A;  1VQH A;  2B2V A;  2IJ0 A;  2Z9H A;  3R8B A;  1HJP A;  4ABN A;  2ZM6 L;  1AN8 A;  5IP9 G;  4L6T B;  1A15 A;  3NSW A;  3NPP A;  4RWS C;  1R4Q B;  1RTO A;  1TKW B;  3K7A B;  1N36 L;  3PO2 B;  1I6H H;  3BDO A;  2L4N A;  1X56 A;  2JA9 A;  4DV2 L;  1X3Q A;  4H02 A;  5M3M H;  5J39 A;  2C5C A;  1DD2 A;  1W6K A;  3ITP A;  4RHS A;  4A3L G;  1IW7 D;  1V43 A;  4JW0 A;  2JA5 G;  4ZCK A;  3TRZ A;  1ML0 D;  1O80 A;  4IPH A;  5M5X B;  1A3U A;  1UE1 A;  3MXP A;  1XMQ L;  1H9M A;  5JAV A;  2AQ1 B;  2EYJ A;  1TVX A;  1XTC D;  1HCZ A;  2LMC B;  4H7B A;  1RF2 D;  3ERS X;  1S4Z A;  4X3K A;  4JVZ A;  3SEB A;  5I9P A;  3CC4 A;  3NEN A;  1STG A;  2WB1 E;  3UDX A;  5LHY 1;  5C5L A;  3VR4 A;  2ZTC A;  1EEF D;  2FMM A;  4OX9 Q;  5E7N A;  1HR0 W;  1B3A A;  1U0L A;  5C3E G;  1CKN A;  1WJJ A;  3BDL A;  4WFN 3;  1SNP A;  5ELE A;  5M3M G;  1EU3 A;  4IN3 A;  3T1Y Q;  4JI4 Q;  1EWH A;  3PO2 H;  2Q8R E;  2F0P A;  1UEB A;  2PMZ E;  4LFA L;  1TR5 A;  2JA8 G;  2PZU A;  5HGT A;  3EFX D;  1R9T B;  3J80 i;  4B9W A;  4J15 A;  1GJX A;  2N3S A;  5J1Z A;  2E75 C;  3KLW A;  4ULL A;  2R92 H;  4OWW B;  2JA7 B;  1WTV A;  5IOC A;  4DR7 L;  3NXW A;  3H3V H;  1NUC A;  1OXT A;  4KD3 A;  1YIJ A;  4JBK A;  5FO8 B;  4ZAI A;  5IP7 H;  1IBM L;  1ZXT A;  5EBD A;  4A3C G;  1PH1 A;  4F88 A;  4HN7 A;  1L1O B;  5EGT A;  1IBL Q;  1KAW A;  2L1B A;  2DNC A;  3VDY A;  2RDF A;  1MBY A;  4GN3 B;  4DNT B;  5CMD A;  5I4D A;  1ROD A;  5JJK A;  1NR4 A;  3CC7 A;  4JI6 Q;  3MFY A;  1ENA A;  1Q7Y C;  3FKI B;  3Q6S A;  1IYJ B;  1N32 L;  4K0K L;  3GTG B;  2L5T A;  4A3J B;  2QEJ C;  2CKZ B;  1WFQ A;  1O7L A;  1HNX L;  2HIV A;  2PQE A;  2DJG C;  4BBR B;  4A3K G;  4O2D A;  2CWA A;  4PMW A;  5C3X A;  2R93 B;  1WTR A;  2XRQ D;  2OEO A;  3C1F A;  4MNO A;  3K5O A;  1FYC A;  4OO1 I;  3HZX A;  1EOT A;  4AQY L;  1B70 B;  5IYD H;  4DR3 L;  4YY3 L;  3K8A A;  3J7Z C;  1PTO F;  1Z6H A;  1J8I A;  3IKJ A;  2XWJ B;  1Y1W B;  2PPB C;  3AQQ A;  5T1I A;  3KDF A;  1NAP A;  4N8X 1;  4NMZ A;  4YHH L;  3PGZ A;  3RD4 A;  1MGS A;  5JEA G;  3BJU A;  2PW5 A;  1PRT B;  1HPC A;  1BQQ T;  1JJC B;  4TQU S;  3A55 A;  2EY1 A;  1CZG A;  4YCW A;  3Q22 A;  4CDC C;  5FK9 C;  2I5L X;  4V0B A;  1YIT A;  2PNR C;  1HNZ L;  4EQ5 A;  5BN4 A;  3NWS A;  2IT1 A;  1DZ1 A;  2LFN A;  4ZUJ A;  3IRB A;  3GTP B;  3A8I E;  5FJ8 H;  4CKC A;  3NTH A;  1Y8P B;  4BBR H;  3NEL A;  5BN3 A;  2N8N A;  1XMO Q;  4DV7 Q;  3QG1 A;  3K59 A;  4DR3 Q;  1FVI A;  4A3J H;  4QL5 A;  2BE5 C;  3E5S A;  2AKW B;  2LSS A;  1XNQ Q;  2F4V L;  1MJC A;  3W3A A;  2CWP A;  3N52 A;  3NWT A;  2RDG A;  1G51 A;  5HY6 A;  1EL0 A;  3HKS A;  4H13 C;  3H0G B;  2O2L D;  4JPB W;  3I70 A;  4DR7 Q;  2ZJR A;  4FF1 A;  1K0S A;  1QZG A;  3DWA A;  2DY7 A;  4X66 L;  5CGK A;  3GQB A;  4MIU A;  3BS1 A;  4IUP A;  1SEB D;  1NR2 A;  2D9U A;  4DXG A;  3MA2 B;  5GAG C;  3CCU A;  5EPJ A;  1DOK A;  3QJY A;  2EYO A;  2IY5 B;  1M1K C;  1V9P A;  2IX3 A;  3X3M A;  1LT3 D;  2KCT A;  5C44 H;  2ZTE A;  4ZUI A;  4Z9C B;  1I50 H;  4DV7 L;  2Q8I B;  2WP8 J;  3I4N B;  1SJE D;  2JN4 A;  1EQR A;  5M5Y H;  2F3I A;  1PLF A;  5I2Y A;  1RJT A;  1Z47 A;  5J22 A;  1LLR D;  1D5M C;  4DV3 L;  1N34 Q;  4A3B B;  1D1I A;  3MEF A;  1SDF A;  2VQF L;  1JJ2 A;  4A3D G;  1EY0 A;  2AWO A;  4Y7N B;  1KLU D;  5IWA L;  1STN A;  4M8A A;  5DM7 3;  4OEL B;  5IY0 A;  3F2U A;  5GAE C;  3DWP A;  4EGV A;  2Z6K A;  4PV1 C;  4DU9 A;  2UUA L;  1JWS D;  3OTO L;  1U4P A;  2ID0 A;  4OXP A;  1ILQ A;  1PH4 A;  1JWU D;  2SOB A;  5AJ3 L;  4DUY Q;  2RVL A;  2UXC L;  1MD2 D;  4JG2 A;  3TP5 A;  2VL6 A;  2WB1 B;  1BVS A;  1A3V A;  3STB C;  1MKH A;  3DEO A;  3S15 H;  3H91 A;  3KLS X;  2JYO A;  1PYS B;  4DNR B;  4C3I H;  2JA6 B;  1HNZ Q;  4HJ5 A;  1HXY D;  4FYD A;  1O7Z A;  3AFQ A;  2H4O A;  1KNE A;  1I3Q B;  1E24 A;  3SK8 A;  1EOV A;  5C3E H;  4R8I A;  1GVP A;  1NY4 A;  1O7I A;  2A6E D;  1STA A;  3MTS A;  1SRU A;  2K5H A;  2UXC Q;  1L1O C;  3C1E A;  4HCE A;  5DLQ E;  1H9J A;  1LUZ A;  1KD1 C;  3FKI G;  4B3T Q;  1VMP A;  5IGB A;  3I73 A;  1WD1 A;  4XYQ A;  5IT9 c;  2KUM A;  3NEM A;  5LMN W;  1S5B D;  2MO0 A;  2M9V A;  1XNR Q;  3CCS A;  4LFB Q;  1W3S A;  3HOY G;  4DA2 A;  3IAY A;  1FNW A;  1YNJ C;  1SE8 A;  3X3N A;  3TP6 A;  5JPN C;  1GUN A;  3CP0 A;  3MXN A;  4YHH Q;  1I6H B;  1TWH B;  5KGU A;  1LT6 D;  4MTN A;  2ZXO A;  4LK1 C;  4LF8 L;  1V1Q A;  1C7Y A;  2ICI A;  1A0I A;  3NK9 A;  2K05 A;  4RMF A;  5C0X J;  4A3I B;  1A3T A;  4GLA C;  2CFM A;  4IFD J;  3CPW A;  2KA7 A;  5EBC A;  4HID A;  3A8J E;  2L11 A;  4A3M G;  2E2H H;  2UUA Q;  1OXU A;  4NB3 A;  4DV3 Q;  2P5Z X;  4WRD A;  2MUY A;  2E2I B;  1JOQ A;  2DN8 A;  2JA6 G;  2O5I C;  3HOV B;  3E9I A;  2RBM A;  2F0U A;  1T5X D;  4LUZ A;  2K52 A;  4DV4 Q;  3SK5 A;  3S14 B;  1VQE A;  3S1Q B;  2TSS A;  1KDA A;  4QQB X;  4K5X A;  1RTN A;  2HUG A;  4FNF A;  1NNX A;  1Q81 C;  3C46 A;  3CQZ H;  4DR4 L;  2K75 A;  4DV0 Q;  4DV1 L;  2EXZ A;  1WCM G;  1PRT F;  2Q2H A;  1P8L A;  1ESF A;  2EJG C;  3GV3 A;  1Y1V G;  3GTM H;  3CPF A;  4AQY Q;  3PIO 3;  5IGE A;  1NMG A;  4RG1 A;  4RCN A;  2JA5 B;  1HFN A;  2E2J H;  3A8K E;  2YV5 A;  4K14 A;  2AQ3 B;  3W1G A;  3P75 A;  4DXF A;  3D4W A;  4RH6 A;  2X6L A;  1CKM A;  4X3S A;  4APV A;  2OQ0 A;  2CH4 W;  4C2M H;  1I94 Q;  4IUN A;  1TWG B;  1GKH A;  3VA5 A;  3CW2 C;  2A6H C;  3PUW A;  2IHF A;  2MNA A;  1PFN A;  1PYW D;  2PMZ B;  3DM3 A;  4A3M B;  2Z0S A;  3K5N A;  2SNM A;  1NTG A;  1LTL A;  3W1B A;  3RMH A;  2BCO A;  3ICE A;  4K2L A;  1B1Z A;  2B8G A;  3G48 A;  2NN6 G;  1TWG H;  1TWF B;  1KXL A;  1FJG L;  1GHK A;  2K14 A;  2I46 A;  1I5F A;  2B2Y C;  2NZ1 D;  4X65 L;  1PMR A;  3A7L A;  2VXW A;  4F7X A;  4F8M A;  1EYG A;  1WTH A;  3A5U A;  1WI5 A;  1F9S A;  1UUP A;  5KRU A;  1PTO C;  2JE6 I;  3NBI A;  1YHA A;  3TP7 A;  5FO9 B;  4GOP A;  5LL6 X;  5C4Z A;  1G6Z A;  3HOU G;  4A93 H;  1HTL D;  1LTG D;  3GTL H;  5EQ0 A;  4R8N A;  4GN4 B;  2NVQ H;  1Q3L A;  1SYE A;  1QCB D;  5F2D A;  3JAM c;  5M9O A;  3IL8 A;  2PYK A;  1WD0 A;  1B4O A;  2VY3 A;  1PDQ A;  5JVG 3;  3QIA A;  4GS3 A;  4JBM A;  2YTX A;  4ODG A;  3I4L A;  1EYC A;  2F0G A;  3LGJ A;  1ENF A;  4CJ1 B;  3MWY W;  4CKE A;  1HNX Q;  4JBJ A;  1EQQ A;  4JV5 L;  4DR2 Q;  2B8F A;  1SYC A;  2L0C A;  4G57 A;  1NBW A;  3LX0 A;  4DV0 L;  3V05 A;  5AJ3 Q;  2BOS A;  1PRT C;  4QMG A;  5ELF A;  3Q0A A;  2JXM B;  2NVY H;  3TEH B;  3WDN A;  1Y1V B;  1A63 A;  3SK4 A;  1I4R A;  2IHE A;  2FIN B;  1JMC A;  4OIJ A;  2HDL A;  2M2L A;  4P75 A;  2R93 G;  4JV5 Q;  2NVQ B;  1VQF A;  4WJ4 A;  1KTK A;  1SNC A;  3TRE A;  2G5D A;  5CV7 A;  4H44 C;  1PZJ D;  5M3F G;  1EY7 A;  2JA7 G;  2A73 B;  2GN5 A;  1VQA A;  4DV4 L;  5KIX A;  1F2M A;  3AYH B;  2D0P A;  5C4X G;  5AFW A;  1T9H A;  4R4O A; 
#chains in the Genus database with same CATH homology
 4E6I A;  3FPP A;  3CKI B;  1CTM A;  1LAB A;  4CBV A;  2A68 C;  1JB3 A;  1KAB A;  4F87 A;  2E76 C;  1TY2 A;  4PMB A;  1IKM A;  2K7V A;  4FO2 A;  1WCM B;  3H3V C;  3AB9 A;  3P7J A;  1DYQ A;  4FP5 D;  3N6R A;  4L8J A;  3L9A X;  3DEP A;  2EPB A;  4HED A;  5IIF A;  3D6W A;  1KDB A;  2EYM A;  1O7Y A;  4RFB A;  2XVS A;  2MHV A;  1LAC A;  2N88 A;  1Q1E A;  2A74 C;  1V8Q A;  1GHJ A;  4HMJ A;  5M3M B;  2F03 A;  1Z7T A;  3HS0 C;  5CBE E;  1F2Z A;  1WTW A;  5C0X H;  1TT2 A;  4G4K A;  4B08 A;  1XWE A;  1BO0 A;  2Z8L A;  2B2V C;  4QUF A;  5JPM C;  4WJW A;  1HA5 A;  3LNN A;  1PZI D;  1U4M A;  2J0T D;  1CA5 A;  4C3H B;  2SEB D;  2F0O A;  2F0Q A;  1DM0 B;  4IAL A;  3CQZ B;  1ET6 A;  5FOB B;  1CHQ D;  3MZ5 A;  4RHR A;  1KAA A;  2WAC A;  1CA6 A;  4CKB A;  2ZXR A;  2R3Z A;  1W6J A;  3PV0 A;  3QB3 A;  4TSS A;  3FEW X;  3MC0 B;  1EEI D;  1SXT A;  4QF4 A;  1HQM C;  3GV6 A;  5IGG A;  3M4Y A;  5DAU A;  3PUV A;  1JOR A;  5EKK A;  1JQY D;  1SFO B;  1QIL A;  4P2C B;  2F0F A;  1OXX K;  4HSP A;  5JJZ A;  5ELD A;  2Z1C A;  5COR A;  3OSO A;  5JEA H;  4J1M A;  3K5L A;  1YNJ D;  2R92 B;  2EJF C;  3DUZ A;  2LS0 1;  3KLS A;  5CV8 A;  4QIW B;  3S15 B;  2F0N A;  4FVM A;  3S16 B;  3TP8 A;  2ICE C;  1FD7 D;  3URY A;  3L3O C;  2F3W A;  1SJH D;  1AZQ A;  4XT1 B;  2MGS A;  1EY8 A;  3D4R A;  4G7H C;  2VB2 X;  4H0L C;  4QUC A;  4A3F B;  1SMY C;  1CZW A;  1LTT D;  2LY7 A;  3NP8 A;  2R7Z B;  2YYZ A;  1QNU A;  1U4L A;  3QOL A;  1PZK D;  3K0Y A;  3RZD B;  3VR6 A;  1GUG A;  4LAA A;  4ZLT F;  2F0W A;  2AUK A;  4ZRZ A;  1E2V A;  3D8G A;  4U67 3;  2EY6 A;  2B2T C;  5ELC A;  2DNE A;  5D14 A;  2K5D A;  2R61 A;  4KY7 A;  4XTC S;  4DAY A;  3VR2 A;  4LJZ C;  5C4X B;  4ME5 A;  4EQO A;  2PZT A;  3MXG A;  3SR1 A;  2OF1 A;  2PW7 A;  3KF8 A;  2WKD A;  4HR7 B;  1C4Q A;  3DWQ A;  4KY5 A;  1H9S B;  5T1G A;  2RQX A;  2VB3 X;  3DMU A;  1S5F D;  1S5D D;  4DN4 M;  4EQN A;  3CRK C;  1UNS A;  4UDU C;  5IT9 L;  1V1P A;  3OW7 A;  4HSV A;  3ND9 A;  3K57 A;  1SND A;  3S9W A;  1JOO A;  4LMQ D;  2AWN A;  2F3V A;  1CK1 A;  2WIN B;  4QB4 A;  3NTI A;  4KMU C;  5EKI A;  4N9T A;  5A2Q E;  2K03 A;  2RA4 A;  3C2P A;  3OWF A;  5JOB A;  1MI2 A;  2QDB A;  4ILW A;  3DHQ A;  3MFG A;  1BOS A;  4B9X A;  1BCP B;  1GUS A;  1SYF A;  3HG9 A;  2K28 A;  4KHZ A;  4ID6 A;  4JK1 C;  3DM1 A;  5M5W B;  4CJ2 C;  4KN7 C;  3BYY B;  1HUM A;  2A69 D;  4KTA A;  3HKZ B;  3E0J A;  1V1P B;  4KHV A;  2F0I A;  3EVQ A;  1XYI A;  3A7A B;  3BDC A;  1RKN A;  3JAM L;  1JR0 D;  4ZKB B;  1SBB B;  1D6E C;  3CRL C;  4CJ0 B;  2KCN A;  2EJM A;  1EY6 A;  1LTS D;  3K5M A;  3I3C A;  4FXD A;  1LTI D;  2G9H D;  5COY A;  5D3D A;  3S1R B;  3C3L A;  4FF3 A;  2AQ2 B;  3TZU A;  3S1M B;  2HQE A;  5CV9 A;  5E1F A;  2F0K A;  2KJX A;  3MVV A;  2OXP A;  4MN3 A;  3OIQ A;  1SYD A;  1CI3 M;  5TSS A;  2F4I A;  4DAP A;  2MPM A;  4XQJ A;  2IX0 A;  1B44 D;  2E2D C;  2ZXP A;  1SNO A;  1IYV A;  4JBW A;  2PZW A;  5D3I B;  4OIK A;  3OMC A;  1JE4 A;  4C3I B;  3TZD A;  2RDH A;  3ERQ A;  3VA7 A;  2RSN A;  1TWC B;  3TSS A;  1E0B A;  2KEE A;  4DFA A;  1V1O A;  2IX1 A;  1SNM A;  2EY2 A;  4XIG S;  1TQO A;  5FO7 B;  1CQV A;  5FLX L;  3HOW B;  2F0M A;  3J80 E;  4KJN A;  3KBG A;  2F0L A;  2KED A;  2NB0 A;  2A5H A;  5KND A;  2A69 C;  2OT2 A;  4KKS A;  3S2D B;  1EFI D;  4M1U B;  2K04 A;  1I4G A;  1H9R A;  3BYT B;  2LKV A;  2NTS A;  1U9R A;  1D5Z C;  2EY5 A;  1I4H A;  3S2H B;  4K6D A;  2EZV A;  1LTA D;  1GOZ A;  1O78 A;  1L0X B;  1TU2 B;  4K2K A;  1QE6 A;  1QB5 D;  1D2B A;  3FRP B;  4C1N I;  2WII B;  3NQT A;  1HRJ A;  3J7A V;  3DXJ C;  2K33 A;  1F2Y A;  2L9H A;  1D1K A;  5E4W C;  1CQF A;  5FKA C;  4A3D B;  2JEA I;  1IYU A;  3BG3 A;  1VDZ A;  3NTK A;  4DK0 A;  1HUN A;  4BY1 B;  2QKI C;  1E2Z A;  5C6A A;  5CR3 A;  3GTL B;  5KNC A;  4QCL A;  2NVT B;  4FF2 A;  1G2T A;  2MJ8 A;  4BA2 I;  2RSO A;  4K8J A;  3T53 B;  4IZ8 A;  3GTO B;  1YNN C;  3VR5 A;  1AZP A;  2SNS A;  1ET9 A;  1SNQ A;  4IUV A;  1EWC A;  5CYU A;  1ICW A;  1JOK A;  3SDZ A;  1DOL A;  3OMG A;  2F1M A;  3OWE B;  3E6Z X;  2A6E C;  3L7Z C;  5I2X A;  1M4V A;  5FLX E;  3VYR A;  1BCP F;  4RKB A;  1CFM A;  2H1E A;  1OXS C;  4PNY A;  4OHJ A;  3GTM B;  1IKL A;  3J81 L;  1BF4 A;  1S5E D;  3KUP A;  3AMU A;  1LTR D;  1BNZ A;  5HUR A;  2B2W A;  2EVB A;  1PFB A;  5I9O A;  1SE4 A;  1ESR A;  3HEJ A;  1AW7 A;  1D5X C;  1ENC A;  2M00 A;  4CHT B;  3PIP 3;  4K8I A;  3SXH A;  3UI2 A;  1I4X A;  4G7Z C;  3I91 A;  2EYH A;  2JA8 B;  2ENB A;  1STE A;  2KCC A;  1EY9 A;  1EZ6 A;  1G29 1;  1Q90 A;  5M3F B;  4GZY C;  2F0J A;  1BR9 A;  4KKU A;  3H6M A;  4MHE A;  3FDT A;  5G3L F;  1WTX A;  1STB A;  2Z4I A;  4BBS B;  1PFM A;  4OO1 G;  4IUU A;  2NN6 H;  3H94 A;  3RZO B;  1TS5 A;  5IGD A;  1ZYR C;  4K5V A;  2HCI A;  4A3K B;  3FMC A;  1PXU A;  1H9S A;  4PMC A;  2K1B A;  3MAQ A;  1VF5 C;  1EYA A;  3M7G A;  2KQ3 A;  4O42 A;  1JWM D;  4IFD I;  2NVX B;  3QO2 A;  4C3H G;  2SDF A;  3M4O B;  3A56 A;  3P20 A;  3K6O A;  5A2Q L;  3GO5 A;  1A2U A;  2HCC A;  2C9O A;  4KY6 A;  4KN4 C;  1HHV A;  1PRT D;  1F9Q A;  2KOL A;  3TME A;  2O5J C;  3R2T A;  5IT9 E;  4RGM A;  1I6V C;  1DOM A;  4TRD A;  1EU4 A;  5IOD A;  1E2W A;  1NSN S;  4KJO A;  4OL7 A;  2BA1 A;  3HGB A;  4KKT A;  1LT4 D;  5G3L D;  5EJW A;  2NVY B;  1CM9 A;  1I50 B;  3NQI A;  3IFD A;  1TS3 A;  3O13 A;  3VR3 A;  2AUJ D;  3ZYY X;  2WKC A;  4FXG C;  4RGO S;  2TMP A;  1Y69 U;  3SE0 A;  4DK1 A;  2JEB I;  1B9M A;  1B50 A;  4CGY B;  3I8Z A;  3M7N A;  3D3R A;  3KBX A;  5E3F A;  1YNN D;  4A93 B;  2XSC A;  2K5Q A;  1CHP D;  2B63 B;  1OXV A;  4IUQ A;  3GTJ B;  1EYD A;  1EZ8 A;  4KD4 A;  3SK6 A;  2NUC A;  3J7A F;  2L12 A;  2O4X A;  4FXK C;  2EYL A;  1BDO A;  1S5C D;  4DGZ A;  5C3W A;  1F2L A;  2WAQ B;  4XQN A;  5I6W A;  1KDC A;  1HQR D;  3T16 A;  1HA6 A;  5DEH A;  2G9D A;  2XWB B;  3D6C A;  4BWG B;  1B2T A;  1Y8O B;  3PMF A;  3GTQ B;  5C44 B;  2F0H A;  2K6A A;  4IFD H;  1DXM A;  4HAE A;  3WOE A;  1RDP D;  1TY0 A;  2E2J B;  4A3G B;  3WOF A;  2K32 A;  3HOZ B;  2PO4 A;  2GA4 B;  3PUZ A;  4DAV A;  3A54 A;  1IW7 C;  1M8A A;  2EOT A;  1KLG D;  4NDX A;  4KV6 A;  1CT1 D;  1VMC A;  1SAP A;  2JSO A;  4C1N K;  4HMI A;  1AFP A;  2R6G A;  2QIL A;  5IGF A;  1K8O A;  1DCZ A;  2YU9 B;  1STY A;  3HRZ C;  5K36 H;  3M3Y B;  2XN9 C;  1Q8I A;  3BVZ A;  1JIC A;  5C5M A;  4RGT A;  2BE5 D;  5D65 A;  5C4H A;  3RUZ A;  1G91 A;  1F9P A;  3IFT A;  5EPK A;  1SSO A;  5EKL A;  5DM6 3;  4AYB B;  2EYF A;  3D4D A;  1WTO A;  1PTO B;  1QJO A;  3G7L A;  4NKL A;  4ZKC B;  4R9W A;  2B2Y A;  2F0V A;  1LO5 D;  2E2H B;  5C3E B;  2NTT A;  3PUY A;  3SHL A;  3TDQ A;  3J81 E;  1RCV D;  1XXG A;  1GUW A;  3D31 A;  3U9O A;  3NBH A;  4UAI A;  3CU7 A;  5CV4 A;  2B2T A;  3OIP A;  2CVR A;  4HTH A;  2IW3 A;  4BS9 A;  2F0D A;  4J8Q A;  2D62 A;  4XYO A;  2IPK D;  3QWN A;  3I4M B;  5C0X G;  2Y0S B;  4IFD G;  2J4X A;  1PTO D;  1FR3 A;  4EQP A;  4KK7 A;  1B53 A;  4Q5V A;  2XRS D;  1GUO A;  3EA6 A;  2K01 A;  3EJI A;  4XQQ A;  3V96 A;  2K5W A;  4K6L A;  3LWU A;  4X3U A;  2KEC A;  1WTQ A;  1EY5 A;  1K83 B;  4DF7 A;  1WTP A;  5KEE A;  5KYL A;  2F0S A;  4IUT A;  3BZD B;  5I6Y A;  4XDX A;  3ERO A;  2VUM B;  4FF4 A;  3Q23 A;  1BUV T;  4V19 0;  4OO1 H;  5CC4 A;  3M85 A;  2NN6 I;  2B39 A;  1I4P A;  5JVH 3;  2Q8T A;  1H9K A;  2FMC A;  2VNU D;  3OOC A;  1X3P A;  1QG7 A;  3R93 A;  4C2M B;  2HDM A;  5C0X I;  1F77 A;  3R3O A;  2FJ2 A;  1C8C A;  4BY7 B;  3T56 B;  4A3E B;  2IL8 A;  1QNK A;  3Q24 A;  1Y8N B;  1RHP A;  4RAU C;  3GTK B;  3J7Y W;  2X69 A;  1Q12 A;  2XNA C;  3RLF A;  1VCI A;  1VF7 A;  1SYG A;  4NW2 A;  1F9R A;  3OPO A;  3TN2 A;  2L55 A;  4RA8 A;  1EQT A;  2Z4H A;  3OHX C;  3V2T A;  5CBA E;  3J80 L;  4OGQ C;  1OO9 B;  3W2D A;  1GXD C;  2FHT A;  5ISR A;  4C56 C;  2NWG A;  1I4Q A;  1MSG A;  2B2U A;  4HCS A;  4C3I G;  1IHZ A;  3KLR A;  1A2T A;  5EPL A;  5E4X A;  2E74 C;  1JCK B;  1X32 A;  1A6X A;  1NCV A;  3FVQ A;  1LV9 A;  2F0E A;  3VYU A;  4NP5 A;  4WOR A;  2QCP X;  5IGC A;  1TS2 A;  3G6J B;  1UEA B;  1KNA A;  2FFK B;  1ONL A;  1XX8 A;  3AU7 A;  4Q0F A;  1SE2 A;  4N9P A;  1SMY D;  3HOX B;  1HFG A;  5NUC A;  1SYB A;  2D2C C;  3LWE A;  3I72 A;  4ZK9 B;  4XT3 B;  2NYZ D;  2B2U C;  4J6H A;  1FNU A;  1MSH A;  5BN5 A;  3U9S A;  1BCP D;  4EVO A;  3BVG A;  1GUT A;  1J9O A;  4O1N A;  1II3 A;  2MP1 A;  4G7O C;  4I7Z C;  4BA1 I;  1SE3 A;  3TBI B;  3JAM E;  1PTO H;  2X6G A;  3S17 B;  3VYT A;  4ZYS A;  3I90 A;  5JEA J;  3PO3 B;  2BA0 A;  5A35 A;  3HP3 A;  4RGN A;  1AEX A;  2WV6 D;  4TKO B;  1UAP A;  3FPU B;  1JC7 A;  1DON A;  2BDN A;  4PQX A;  4IUR A;  1TII D;  4I65 A;  1T5E A;  2IWH A;  5M5Y B;  5KNB A;  2B2W C;  3H09 A;  1U4R A;  1DJR D;  4YIJ A;  3SVM A;  1HTP A;  3MHB A;  1TWA B;  1RD9 D;  4RCO A;  2ZT9 C;  1G2S A;  4KI0 A;  5C4J B;  2CHB D;  3K58 A;  1IL8 A;  3MEH A;  4ZQ3 A;  1ILP A;  1Q1B A;  1AP0 A;  1G8Z D;  1WVL A;  3S1N B;  3T13 A;  3BVM A;  5K5P A;  4X3T A;  3MXU A;  2J7Z A;  4XXE A;  2QF7 A;  3GD7 A;  3EQL C;  1BXT A;  1EIH A;  3NE5 B;  1EY4 A;  5KYI A;  1QWY A;  4U68 A;  5CV5 A;  3T4A C;  4C3J B;  1QOH A;  4RKL A;  3NUC A;  3VYS A;  5DNF A;  3GP7 A;  1FGB D;  3P1H A;  4S3S A;  1TS4 A;  5CV6 A;  1LT5 D;  2KHS A;  1ZKO A;  1BCP C;  4IQZ A;  2D5D A;  3NHH A;  5ELB A;  1B9N A;  1EQV A;  3ONA B;  5K36 G;  3HOY B;  2CW0 C;  1BBX C;  2A6H D;  2F0T A;  3T51 B;  2XIW A;  2I07 B;  4L63 B;  5LL6 S;  2PCF B;  4C3J G;  1FNV A;  2CW0 D;  1K8M A;  2DY8 A;  1R4P B;  2V4D A;  1EIG A;  2CQA A;  1LTB D;  3CHB D;  2NBF A;  2KVM A;  1STH A;  2EYP A;  1L0Y B;  2N55 A;  3HOU B;  2JP1 A;  3KK7 A;  2BDO A;  3QOJ A;  1ZEQ X;  3PUX A;  2EDG A;  2A68 D;  3R2I A;  1ZYR D;  3ND8 A;  4K5W A;  1C48 A;  2EE1 A;  2RKS A;  2B2V A;  2IJ0 A;  3R8B A;  4ABN A;  1AN8 A;  4L6T B;  1A15 A;  3NSW A;  3NPP A;  4RWS C;  1R4Q B;  1RTO A;  1TKW B;  3K7A B;  3PO2 B;  3BDO A;  2L4N A;  1X3Q A;  5J39 A;  2C5C A;  1DD2 A;  1W6K A;  3ITP A;  4RHS A;  1IW7 D;  1V43 A;  1ML0 D;  1O80 A;  5M5X B;  1A3U A;  3MXP A;  1H9M A;  5JAV A;  2AQ1 B;  2EYJ A;  1TVX A;  1XTC D;  1HCZ A;  2LMC B;  4H7B A;  1RF2 D;  1S4Z A;  4X3K A;  3SEB A;  5I9P A;  1STG A;  5LHY 1;  5C5L A;  3VR4 A;  1EEF D;  2FMM A;  1B3A A;  4WFN 3;  3BDL A;  1SNP A;  5ELE A;  1EU3 A;  4IN3 A;  1EWH A;  2Q8R E;  2F0P A;  1TR5 A;  2PZU A;  5HGT A;  3EFX D;  1R9T B;  4B9W A;  1GJX A;  5J1Z A;  2E75 C;  4ULL A;  2JA7 B;  1WTV A;  5IOC A;  3NXW A;  1NUC A;  1OXT A;  4KD3 A;  5FO8 B;  4ZAI A;  1ZXT A;  5EBD A;  4F88 A;  4HN7 A;  5EGT A;  2L1B A;  2DNC A;  2RDF A;  1MBY A;  4DNT B;  5CMD A;  5I4D A;  1ROD A;  1NR4 A;  3MFY A;  1ENA A;  3FKI B;  3Q6S A;  3GTG B;  2L5T A;  4A3J B;  2QEJ C;  1O7L A;  2PQE A;  4BBR B;  4PMW A;  5C3X A;  2R93 B;  1WTR A;  2XRQ D;  2OEO A;  3C1F A;  3K5O A;  1FYC A;  4OO1 I;  3HZX A;  1EOT A;  1PTO F;  1Z6H A;  1J8I A;  3IKJ A;  2XWJ B;  1Y1W B;  2PPB C;  5T1I A;  1NAP A;  4NMZ A;  3RD4 A;  1MGS A;  5JEA G;  2PW5 A;  1PRT B;  1HPC A;  1BQQ T;  4TQU S;  3A55 A;  2EY1 A;  1CZG A;  3Q22 A;  5FK9 C;  4V0B A;  2PNR C;  5BN4 A;  3NWS A;  2IT1 A;  1DZ1 A;  2LFN A;  4ZUJ A;  3GTP B;  3A8I E;  4CKC A;  3NTH A;  1Y8P B;  5BN3 A;  3QG1 A;  3K59 A;  2BE5 C;  3E5S A;  3W3A A;  3N52 A;  3NWT A;  2RDG A;  1EL0 A;  4H13 C;  3H0G B;  2O2L D;  3I70 A;  4FF1 A;  3DWA A;  2DY7 A;  5CGK A;  3GQB A;  4MIU A;  3BS1 A;  4IUP A;  1SEB D;  1NR2 A;  2D9U A;  4DXG A;  3MA2 B;  5EPJ A;  1DOK A;  3QJY A;  2EYO A;  2IX3 A;  3X3M A;  1LT3 D;  4ZUI A;  4Z9C B;  2Q8I B;  2WP8 J;  3I4N B;  1SJE D;  1PLF A;  5I2Y A;  1RJT A;  1Z47 A;  5J22 A;  1LLR D;  1D5M C;  4A3B B;  1D1I A;  1SDF A;  1EY0 A;  2AWO A;  4Y7N B;  1KLU D;  1STN A;  4M8A A;  5DM7 3;  3F2U A;  3DWP A;  4EGV A;  4PV1 C;  4DU9 A;  1JWS D;  1U4P A;  2ID0 A;  1ILQ A;  1JWU D;  2SOB A;  2RVL A;  1MD2 D;  3TP5 A;  2WB1 B;  1A3V A;  3DEO A;  3H91 A;  3KLS X;  2JYO A;  4DNR B;  2JA6 B;  1HXY D;  4FYD A;  1O7Z A;  2H4O A;  1KNE A;  1I3Q B;  3SK8 A;  4R8I A;  2A6E D;  1STA A;  3MTS A;  3C1E A;  4HCE A;  1H9J A;  1VMP A;  5IGB A;  3I73 A;  1WD1 A;  4XYQ A;  2KUM A;  1S5B D;  2M9V A;  4DA2 A;  3IAY A;  1FNW A;  1YNJ C;  3X3N A;  3TP6 A;  5JPN C;  1GUN A;  3MXN A;  1I6H B;  1TWH B;  5KGU A;  1LT6 D;  4LK1 C;  2ZXO A;  2ICI A;  3NK9 A;  2K05 A;  5C0X J;  4A3I B;  1A3T A;  4IFD J;  2KA7 A;  5EBC A;  3A8J E;  2L11 A;  1OXU A;  4WRD A;  2MUY A;  2E2I B;  1JOQ A;  2DN8 A;  2O5I C;  3HOV B;  2RBM A;  2F0U A;  1T5X D;  3SK5 A;  3S14 B;  3S1Q B;  2TSS A;  1KDA A;  1RTN A;  4K5X A;  2HUG A;  4FNF A;  3C46 A;  2EXZ A;  1PRT F;  1ESF A;  2EJG C;  3GV3 A;  3PIO 3;  5IGE A;  4RCN A;  2JA5 B;  1HFN A;  3A8K E;  4K14 A;  2AQ3 B;  4DXF A;  3P75 A;  3D4W A;  4RH6 A;  2X6L A;  4X3S A;  4IUN A;  1TWG B;  3VA5 A;  2A6H C;  3PUW A;  1PFN A;  1PYW D;  2PMZ B;  4A3M B;  3K5N A;  2SNM A;  3RMH A;  2BCO A;  4K2L A;  1B1Z A;  2B8G A;  2NN6 G;  1TWF B;  1GHK A;  2I46 A;  2B2Y C;  2NZ1 D;  1PMR A;  3A7L A;  2VXW A;  4F7X A;  4F8M A;  5KRU A;  1F9S A;  1UUP A;  1PTO C;  2JE6 I;  3NBI A;  5FO9 B;  3TP7 A;  5LL6 X;  5C4Z A;  1G6Z A;  1HTL D;  1LTG D;  5EQ0 A;  4R8N A;  1Q3L A;  1SYE A;  1QCB D;  5F2D A;  5M9O A;  3IL8 A;  2PYK A;  1WD0 A;  1B4O A;  1PDQ A;  5JVG 3;  3QIA A;  4ODG A;  3I4L A;  1EYC A;  2F0G A;  1ENF A;  4CJ1 B;  3MWY W;  4CKE A;  2B8F A;  1SYC A;  2L0C A;  4G57 A;  3LX0 A;  3V05 A;  2BOS A;  1PRT C;  4QMG A;  5ELF A;  3Q0A A;  2JXM B;  3WDN A;  1Y1V B;  3SK4 A;  1I4R A;  2FIN B;  4OIJ A;  2HDL A;  2M2L A;  2NVQ B;  1KTK A;  1SNC A;  5CV7 A;  4H44 C;  1PZJ D;  1EY7 A;  2A73 B;  5KIX A;  1F2M A;  5AFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...