2NBFA

Structure of calcium-bound form of penicillium antifungal protein (paf)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium binding and the role of aspartic acids in the antifungal function of PAF
rcsb
source organism Penicillium chrysogenum
molecule tags Antifungal protein
molecule keywords Antifungal protein
total genus 5
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2016-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nbfA00
1AFPA 2KCNA 2NBFA 2MHVA 2NB0A
chains in the Genus database with same CATH superfamily
3T1YL 1QJOA 4JYAQ 5IYCG 1YNND 2WB1G 4J15A 1S72A 2ZM6Q 1DXMA 4KKUA 2JXMB 1DOKA 4FF4A 2JA8B 4N8FA 1BNZA 3R2IA 5DM73 4Y52H 4HSPA 1U9RA 3BS1A 1MKHA 4YWMA 4BWGB 4LW1A 4C1NK 1VDZA 2VQEL 3ULJA 3O13A 4EQPA 1ILPA 3NENA 1ZKOA 1PH1A 2FXQA 1FNUA 1PDQA 4WRDA 4RCNA 2VUMB 4CBVA 2LMCB 2Z6BA 3SE0A 2O4XA 2EYHA 3W2DA 3NTIA 4A3KG 4BY7B 1CQVA 2VXWA 4YY3Q 4DV5L 1EWCA 2N8NA 4GZYC 4L8JA 3I70A 4A3CG 4ID6A 4IFDJ 4GNXB 3BZDB 5LMNL 1EYCA 1NMFA 3OSOA 1IBMQ 3E0JA 1KDCA 1Q12A 1EEFD 1X6OA 3NTHA 1STAA 1VQ6A 4OIKA 1B8AA 1BR9A 5LMUL 3CPWA 4F88A 5T1GA 4RHRA 5LL6S 3HOZB 4ZUJA 2RSOA 1FYCA 2F52A 4DK6C 1CK1A 4DUYQ 1MSHA 4QF4A 1HJPA 3VYRA 2NVTH 5ELEA 2EJFC 3FDTA 5KNBA 1L0XB 4A3KB 2YU9B 5C4XH 1DD2A 3S9WA 4C1NI 1K28A 1I4GA 1XWEA 2L0CA 4RGNA 3BDLA 4A3LH 3EFXD 4YCWA 2XNAC 3A8IE 1EY4A 5M3FG 1GUNA 1AFPA 2XRQD 5K36G 3WOFA 4POGA 2PI2E 2G9HD 2KECA 4QCLA 4KHZA 4DV7L 1ASZA 3U58A 1WOCA 1XXGA 5C44B 1EEID 2C9OA 4A3BH 3I73A 1JB3A 4A3JG 1F9SA 1VQKA 3IAYA 2F0MA 2B8GA 2I46A 4DNIA 4LF5L 4C2MB 3J7ZC 2NN6G 3BYYB 1S4ZA 4LFCQ 4NXNQ 3I4MG 1RTNA 2MGSA 2PQEA 2E2HB 2YV5A 1JQYD 4LFCL 1EY9A 4JBKA 4C56C 1S5DD 3G71A 4A3FH 1PRTF 5GAHC 4RGMA 1P16A 3ND8A 4FXGC 4CKBA 1IKLA 4C3JB 3I90A 4NPSA 2EY2A 2LS01 4A3FG 1U4MA 1B70B 2Z4HA 2KOLA 2UXCQ 2RHQB 1MJCA 2QILA 2R93B 3M4QA 4LWCA 4BXXH 1A8VA 1ESFA 1XMQL 3TZUA 4WFN3 2VNUD 2WINB 4DGZA 4LUZA 2HQLA 1TWFH 2B29A 5HGTA 3H91A 1EQTA 1LT6D 1JJ2A 3P1HA 4ILWA 1V1OA 4DR4L 5M3MH 1A0IA 3STBC 1PH3A 1WCMB 2BCOA 1XPOA 4UP7A 1TWHB 4A93B 4NP5A 3J81i 1TIID 2F4VL 4HCEA 3FKIH 4P72A 5EBDA 5GAGC 4X65Q 1L1OA 2QA4A 2B63B 1TWFB 1MBYA 5GQOA 1KD1C 3HOVH 3RLOA 2ZTDA 1AZQA 1XPUA 4DR3L 4RCOA 3PIOA 1DOLA 1Y1VB 1YHQA 3TP7A 3QO2A 2DNEA 1BBXC 5T1IA 3S24A 2NTTA 1EWIA 4TSSA 1VQLA 5A35A 1HTLD 2NB0A 3BDOA 2VUMH 2PZTA 5CGKA 4YWLA 5JVG3 2OTJA 4I7ZC 3LWUA 3F1ZA 3GTGH 4Q0FA 2HCCA 4P75A 3NTKA 1PZID 1JMCA 4G4KA 1NNXA 3P20A 4KN7C 2B2UA 3GTMH 4O1NA 3GTQH 1TY0A 1RD9D 1YNJD 1TWAB 4X64L 1HNZL 5H1SE 4JI4Q 3OW7A 3UDIA 1Q8KA 4IPCA 2LXKA 3KDFB 4UHVA 2OCEA 2PQAB 3M4YA 3FVQA 3R3OA 5LL6X 1K3BC 1CZGA 3BG3A 2BH8A 3P75A 1BBWA 4XDXA 4A3MB 4KKTA 5FJ8H 1ET6A 2K05A 2OEOA 2YYZA 4LF8Q 1CSQA 4DUZQ 1IW7D 3S1RB 4JOIA 4A3EG 2X69A 1HA6A 5IP9H 3DLLA 3RLFA 2AQ1B 2K03A 4LF9L 3PIPA 1MHWC 1LTSD 1XMOL 3PUVA 4ULLA 1PH8A 1FL0A 2A1AA 1F2YA 4BBSB 3KLSX 3DMUA 1VQ8A 3EJIA 4RGOS 1J5EL 3HOWH 1E3PA 4L63B 4I7AA 1RDPD 5LMUQ 1I6HB 1UE7A 2A6EC 5K5PA 4HJ7A 1LT5D 4JBWA 1HZCA 3MXUA 2NN6H 3ZYYX 1YVCA 3OPOA 2CHBD 1BCPF 4R8IA 2YTXA 1PXUA 4IN3A 5C3EG 3WOEA 3TQYA 1CFMA 1VQFA 4J8QA 1EQQA 5JJKA 2RDHA 5IYCH 1VQCA 4PZ6A 3HP3A 1NE3A 1HNWQ 4JI8L 3EIVA 4CJ2C 2G9DA 3OMCA 2WFWA 2I0QA 3GTGB 4H44C 4YCUA 2CKZB 2BA0A 1X3FA 1GM5A 1B44D 1DOMA 3W5OA 1IBLL 4OIJA 1TY2A 1BBUA 1FR3A 4FF1A 3T4AC 1SNMA 3OWFA 2EZVA 3CAMA 5ELOA 2EY6A 3A55A 1LACA 3SK6A 3S1QH 3HOUB 2F3VA 1B4OA 1SMXA 3MA2B 4OX9Q 2KCMA 4J6HA 2IT1A 2KCTA 2SNMA 1VQEA 4YCVA 4OX9L 2F0NA 4JI3L 1NR4A 3A8KE 1HCZA 4U673 3S1NB 5L37A 2KJXA 3CU7A 1LUZA 4HJ9A 2CCZA 3L9AX 2A74C 2CFMA 2L11A 1TQOA 1EWHA 4O2DA 3M4OB 1I94Q 3M9BA 4XQQA 1U4RA 3TSSA 5KNCA 3PIO3 3K7AH 3C3LA 3RMHA 4QUCA 4EVOA 1O80A 3KJPA 1JWSD 3PV0A 3SDZA 1H9KA 2QDBA 2F0LA 2ZXRA 2RSNA 4C3HG 1N32L 4BA2I 2OXPA 1U0LA 5JJIA 5D65A 5IYDG 4LF6Q 3C1FA 4BBRB 2MQHA 4PV1C 1T5EA 3TBIB 4CHTB 3DHQA 4I65A 5EAYA 5FLXc 5IP9G 5CR3A 1YJWA 2E5LL 1IW7C 2CWPA 2FMCA 1YJNA 2XGTA 2E5LQ 3ITPA 5C0XI 1I3QH 1CZWA 1NY4A 1PFMA 1Y8NB 4A3GH 5K36H 1HQMC 1KXLA 1KLUD 4GLAC 5EKKA 1Y1WB 4NW2A 3PO2G 4ZYSA 1SE2A 4IUTA 4IPHA 2F0IA 3GTQB 3CPFA 3H0GB 1G6PA 2MO1A 1ASYA 2VS1A 5DNFA 2Q8RE 1O7ZA 3A74A 4LFAQ 3Q8DA 3HOUH 2ZTEA 2A68D 4DPGA 2NUCA 3E9IA 5EPLA 4DV4Q 4DU9A 2EY1A 3NUCA 3TN2A 1HUNA 3KBGA 2B2YA 4IJHA 3OW2A 1ONLA 2JE6I 4HIDA 3GTPB 3F2BA 4APVA 4IZ8A 3OHXC 1P8LA 4DXFA 3GV3A 1I50B 4IOAA 4MHEA 1HZAA 2HIXA 1TWGB 2KQ3A 1PYSB 1X3PA 1CM9A 1SYDA 5CYUA 4DFAA 4C3JH 4CJ0B 3Q6SA 5EPJA 2A6HC 2GVBA 4JK1C 3G7LA 1EIYB 4A3EH 3JAML 3X3MA 4BBSG 2NVQH 2KBNA 3D3RA 5ELCA 2JA7G 4L5SA 1ENAA 4HTHA 1IXRA 3D8GA 1OXVA 1RTOA 2WB1B 2WAQB 1BCPD 2PMZB 3KBXA 2B2VA 1MIUA 1L1OB 3NK9A 2V1CC 3I4NG 2GA4B 3I56A 4GOPC 2K1BA 3DXJC 1N36L 2JA7B 1TWGH 5J1ZA 3CCVA 1GHKA 3N52A 1EZ8A 3NBHB 3E5SA 4FF2A 4BY1B 2XRSD 1JICA 3FRPB 1B3AA 2RBMA 1TU2B 3KLRA 4UAIA 2JYOA 5E1FA 1B1ZA 2EQSA 3CMEA 2EXZA 1LTID 4WJ4A 3L7ZC 4B3ML 1QZHA 1TS4A 1ZXTA 1YEZA 1XYIA 1VQDA 2QEJC 3T51B 2A6HD 1J8IA 4RG1A 4WJ3M 1L0YB 2K50A 1GJXA 3M3YB 3HKSA 3FPUB 2UUCL 4B3SQ 3SK5A 3MVVA 1HNWL 3KLSA 2VB3X 2QKIC 4JI8Q 4JI7Q 2EY5A 2A19A 1BCPC 1PRTB 2UUCQ 4HEDA 4A3IB 1PFBA 2FINB 4JI6L 1IYJB 4IUPA 3J81j 2KEDA 2PNRC 3HKZE 4A76A 4AIMA 2L4NA 1AN8A 3J80i 4DAYA 2JEBI 3A5UA 4K8JA 4MTKA 2MPMA 3HOYG 1X9NA 1ZYRD 1E24A 3RUZA 1G51A 5J22A 3MXNB 3LX0A 4AQYQ 1JB7A 1PH4A 2OQ0A 5C0XJ 5KYLA 3URYA 1WTHA 3T1HQ 1W3SA 3VR2A 3IKJA 5IY0A 2QGQA 3IRBA 3BZKA 4V0BA 4F8MA 1NSNS 2DJFC 1F2MA 2L55A 4NKLA 3V05A 3T53B 2A68C 3C1EA 1E1TA 2BDNA 3HS0C 1U4PA 5JPMC 4A3DB 1C48A 4Y7NH 5JVH3 1N9WA 1Y8OB 2AQ2B 3HKZG 4BY1G 4FXKC 1TVXA 3I2ZA 1H9SA 4P74A 4L5TA 2L1BA 4DV6L 2ICIA 4XYOA 3BVZA 2IX1A 2TMPA 4DV6Q 1HNZQ 1KABA 1E22A 5F2DA 1KDBA 1L1OC 2FHTA 1H9MA 2XVSA 5M9OA 2CQAA 4A3LG 3K57A 2JEAI 1PYWD 3E6ZX 4ODGA 4GLXA 3H15A 1VCIA 2IY5B 2D0PA 2FFKB 2JA6B 5ELDA 2PQAA 4KK7A 1R9TH 1TKWB 2R92B 4LFBQ 1Y1VH 4LF7Q 3CCQA 1A6XA 1G2SA 4DV5Q 4OGQC 2YU9H 3KLWA 3GTLB 2O5JC 1MD2D 2Z6KA 5GROA 4HIKA 4FNFA 3KF8A 1CI3M 4F87A 2NZ1D 2HD3A 5C5MA 3Q0AA 3IL8A 1XNQL 1ICFB 5FLXL 2Z6KC 3MHBA 1LLRD 3QJYA 1EOVA 1QVGA 4CGYB 1G8ZD 3M4PA 2K7VA 2ZT9C 3GTKB 4K6DA 1HNXL 3A7AB 1XTCD 5C5LA 3I3CA 4H13C 2SDFA 1VQMA 1TR5A 3V96A 3JAME 1VQGA 2OT2A 5IP7H 4ALPA 2WACA 4BS9A 3A54A 1DCZA 1DM0B 2LSSA 1HZ9A 4DR1L 1I5FA 1PH2A 1GXDC 4A3CH 1I6VC 2ICEC 1RIPA 2KHIA 4KMUC 3J81c 1W2BA 4UY8C 5LMNW 2B3GA 1PV4A 2IW3A 1GUTA 4BA1I 4IFDG 4PZ7A 1K8GA 2UUAL 1LTTD 2NYZD 3KK7A 4DV3L 4HIMA 3PUWA 3JC66 1LTRD 1SYCA 2RA4A 2HHHL 3VYTA 1LM0A 1HQRD 2XN9C 1B9NA 1OXXK 2BA1A 4L5RC 5C6AA 4B3TQ 2DUDA 4H0LC 3AFQA 4BBRG 4CDEC 4K5VA 5EBCA 5ELNA 4KHVA 3EROA 5C4JH 1WCMH 1X56A 4DK3C 4UP8A 1UEAB 2CW0C 1KRSA 2QCPX 3SGIA 2K5DA 1D2BA 4OWTB 4RKBA 3HEJA 3ONAB 1NBWA 4B3RQ 5C44G 5I9PA 1ET9A 3PUXA 2B2VC 1UE6A 2B2WA 1VF7A 1F77A 2EYLA 3ERSX 3A5ZB 1M8AA 1SYGA 2UXCL 3A8JE 5NUCA 3GV6A 1Z47A 1GUOA 4QIWE 4JBMA 1U4LA 1XMQQ 1Q82C 5KRUA 3MFGA 2F0PA 4M8AA 4UP9A 3RZDB 4GN4B 2YTYA 4Y7NB 4RFBA 5C4HA 5CV4A 1HFGA 3CRKC 5GAEC 2Y0SE 4DAPA 4HCSA 2WAQE 2EYJA 2QEXA 1QNUA 2PMZE 2Q8TA 5M3MG 2RKSA 1BOSA 3BVGA 4X65L 3MXPA 1D5MC 1B53A 4IOCA 2B2YC 2AQ3B 1MSGA 3NHHA 3AU7A 4DAVA 4DV0Q 1PA6A 3FP9A 2UUBL 1HRJA 2K28A 3SVMA 4K0KL 3DM1A 2H1EA 4C3IH 5M5YH 3J81L 3FPPA 4L6TB 5FO7B 2N78A 1JOQA 3T16A 4CKEA 3MC0B 2JA9A 4P2CB 1BVSA 4XXEA 4DV4L 2ENBA 2OF1A 1N34L 3H3VC 2DN8A 3GTOB 2IWHA 4TRDA 1PLFA 3DWPA 3L2PA 4X6AH 5IWAL 1S40A 1N34Q 5E7NA 1JJGA 5IGBA 1NCVA 4A3FB 4L5QA 3PO3B 4YWKA 1SROA 2M00A 1KHIA 2F4IA 3TEHB 4FP5D 2BDOA 2JA5B 1SXTA 3P7JA 3HRZC 2JN4A 4C3IB 4R8NA 5M5YB 1HHVA 2SNSA 1K9MC 3QR8A 3DWQA 1F9QA 4DV7Q 3K0YA 2O2LD 1II3A 1VQ4A 2MO0A 5M5WH 2R7ZH 3SK4A 2KCNA 1T5XD 2PI2A 4LUVA 2RHSB 1VMCA 3TP8A 3NE5B 4DKAC 5M3FH 4JV5Q 2K5QA 2PNHA 2AWNA 4LF8L 4DUZL 3RR5A 5CV7A 4XQNA 1GUWA 4FDBA 1N36Q 4LF5Q 2M2LA 1Q46A 3PO3H 1GKHA 4N9TA 3CMAA 3S2HB 4DV1Q 3N6RA 1D7QA 1FVIA 4JVZA 4QB4A 4UDUC 2NN6I 1R4PB 3BYTB 2I5LX 2QW7A 4O0AA 1IBKL 5EKIA 2AHOB 3I7FA 1SFOB 5DM63 2DY8A 2GN5A 1X54A 3CW2C 2K52A 4A3MH 5BN3A 2X6LA 1VQPA 1L2FA 3HOVB 2F0WA 1C7YA 3HOWG 3AFPA 4ZRZA 4QJFA 5IIFA 3HOXG 1LT3D 1Q7YC 1DZ1A 2QF7A 3D4RA 2D9UA 1CQFA 1QNKA 1Z6HA 4IO9A 2F0OA 1G91A 4A3EB 1HH2P 2NWGA 3F2UA 3HOXH 3G4SA 3S2HH 2QDLA 5CMDA 5JEAG 3J80c 2EVBA 3DEOA 1HR0L 3E0EA 1RJTA 1LTBD 2UU9Q 2HT1A 3QOJA 2Z8LA 3EA6A 4RKLA 1VMPA 3S15B 4OHJA 1SN8A 3K5OA 1EY7A 1B2TA 4GOPA 5E4WC 3KDFA 1BO0A 2NVYB 1JCKB 4Q5VA 4BY1H 2L9HA 5I6WA 3RN5A 2MFIA 4ZKBB 3MEHA 1SEBD 2M9VA 1QWYA 1SE4A 2K5NA 1ZYRC 2VZAA 4KD4A 3VA7A 3J7AF 5DAUA 2LFNA 1GOZA 4J1MA 3QIAA 3GTPH 1J9OA 1YZ6A 2LKVA 3T1YQ 1QCBD 3BU2A 3K7UC 3E3XA 1EIFA 2R92H 1YNNC 5D3IB 2OTLA 4G7HC 1SE3A 3HOYH 1VQ9A 3VR4A 4CDDC 1S5ED 1JWUD 4KJOA 2RDFA 4FF3A 1C8CA 3H3VH 2R7DA 1WVLA 1G291 4DK0A 3CKIB 4K5WA 5JAVA 3S17B 4IJLA 1Y1WH 2AWOA 3VYSA 2Q2HA 5KGUA 1STNA 3AYHB 4R4OA 5I9OA 3CCLA 3GDEA 3R2TA 4GN3B 2K6AA 1WYDA 4QUFA 3I4MB 4DF7A 1UAPA 3CRLC 3CCUA 1K0RA 4N8X1 2LY7A 3GTJB 2K32A 3U50C 3MWYW 4A3KH 2H4OA 4GLVB 4IUNA 1Z7TA 1X3QA 1Q90A 1CHQD 4X66L 1XNRL 3A7LA 3H6MA 1DGSA 4RHSA 5CV9A 5HY6A 1SMYC 4G57A 3J7YW 4JPBW 5IGDA 4LF9Q 3NXWA 5LMNQ 1PMRA 1XMOQ 1QE6A 4HN7A 2BE5D 1V43A 5M3FB 3PGZA 2E8GA 1A2UA 2KEEA 1IHZA 3VR5A 1TS3A 4AH6A 4DN4M 2JA8H 2EXDA 4N9PA 3K7AB 3M85A 4DR2Q 1LYLA 2B63G 2WKDA 5IGFA 1K83H 3I4NB 4DR2L 3ULLA 2XSCA 3NP8A 1NMGA 5IYBH 3FMCA 1SSOA 1Y8PB 5IP7G 1K0SA 4KD3A 4JOIC 1G2TA 2KENA 2IJ0A 1FJGQ 1BUVT 3CCRA 1IL2A 5BN5A 1XJVA 3EBEA 1Q8IA 2Q2IA 2XTIA 3IFDA 4OXPA 4ZUIA 2CQOA 1X3GA 5C4XG 5EGTA 1R9TB 1E2VA 2F0QA 5ISRA 3J81E 2O5IC 2Y0SB 1SFOH 1N33Q 4OWXB 2F0TA 4PMBA 1SNPA 1VQNA 1V8QA 3K5NA 1CT1D 3GO5A 2NVXH 3NWSA 4RMFA 3SHLA 2EOTA 1AH9A 3UDGA 3S15H 5M3MB 4KHPL 2VB2X 3HOZH 2F0KA 4DV3Q 4NXNL 3KF8B 3RZDH 1E2WA 1N8RC 4OO1G 3HOXB 4KHPQ 2E76C 3U4ZA 4QL5A 3UE1A 4TKOB 3CD6A 4XYQA 3U4VA 4JI0L 2MP1A 2MHVA 3K6OA 5C3EH 1OTCA 1S5FD 3CF5A 4QQBX 2MNAA 1WFQA 1YHBA 5C3WA 4AYBB 4B3MQ 1I94L 5G3LF 1PHJA 1NAPA 2F1MA 5HGQA 4JG2A 4JI5L 5EPKA 4DR7L 1EUJA 1KNAA 4KN4C 5FO9B 1TWCH 3WDNA 1ICWA 5IODA 2FJ2A 4DR4Q 2RCFA 4JI7L 3QG1A 3LGJA 2E2IH 1HR0W 2GVAA 4B3SL 2N49A 1SYEA 3GQBA 4C3HH 1YBYA 1FNVA 2WKCA 4R4TA 1Y1WG 2WV6D 4R9WA 4GNXC 2AUKA 3ND9A 1E0BA 1A63A 1TWAH 2JQOA 3X3NA 3OIPA 1PZKD 1I4HA 1RF2D 3S17H 5C0XG 1W6KA 2B39A 4A3DH 1KTKA 1VQJA 2X6GA 3BVMA 2EPBA 2N3SA 2F0HA 1RL2A 3FKIG 3CCSA 1LT4D 3C2PA 3OTOQ 4IUUA 1QOHA 2RDGA 3S1RH 1PH6A 4RWSC 5ELBA 2IX3A 2ZXOA 2B2UC 2EDGA 1M1KC 4OEMB 3KFUA 4K14A 4XTCS 3D6WA 4JYAL 1EU3A 1FNWA 1Q86C 3Q24A 4ZCKA 5IWAQ 4LJZC 1JR0D 1JT8A 4A93G 5FLMG 2PYKA 1WD0A 2JA8G 4HMIA 3R8BA 1SNOA 1E1OA 4JI1L 1QVCA 5I2XA 4MNOA 5IYBG 4A3GG 5KEEA 1G6ZA 1SAPA 2F0FA 1CKNB 2UXBL 5IYDH 3DEPA 1ZEQX 2J7ZA 1EFID 4LFBL 1WTOA 2UXDL 3CC7A 4OO1H 2XWBB 2HCIA 3CQZH 3S2DB 3CCJA 2UXDQ 4KKSA 4DXGA 4JW0A 1A15A 1GD7A 2B2TA 2R7ZG 4PZ8A 2D0OA 1WTWA 4AYBG 4FXDA 4O42A 1VS0A 4OL7A 4DV1L 4IQZA 3J7A5 3BDCA 1GVPA 3TP5A 3AEVA 4JC0A 5M5WB 2H5XA 1J5EQ 1OO9B 3RLNA 3ER0A 4LF4Q 1SNQA 4OWWB 1S3OA 5CV8A 3HOUG 1VQAA 1STEA 1B9MA 2DNCA 1CKNA 4DR5L 3S14B 3NQIA 2A69C 4ZLTF 5BN4A 4JI2Q 1FD7D 3D6CA 1D1KA 4RAUC 1STHA 4C2MH 1EYAA 4JI2L 4PNYA 3HG9A 1CKMA 2PZWA 5A2QL 3AB9A 1Z9FA 4NMZA 1CA6A 1HTPA 1BXTA 3D4WA 3M7GA 3UE0A 1YIJA 2NZOA 1NTGA 2ZTCA 1Q1BA 1X3EA 3F2DA 4GKJQ 4GKKQ 4KY5A 5EKLA 3PUYA 5JEAJ 4NXMQ 4OONA 4H7BA 1A3TA 5FKAC 3K5MA 4EQNA 3CC4A 4R4IA 1YNJC 1VQIA 2PZUA 4JI3Q 4RA8A 3I4OA 2L15A 4V190 4YHHQ 2IHFA 5IOCA 2JA6H 2L5TA 3H3VI 3SEBA 1EQVA 4RGTA 3FHWA 4P71A 3J80E 1I3QB 1E7ZA 4DR6Q 4A93H 4LNQA 2R7FA 2OWOA 2P5ZX 4A3BB 1X32A 3JAMi 1BDOA 2JA5H 1PFNA 3PO2B 3PCOB 2F0VA 3TREA 3I91A 4TVAB 5IE8A 2B8FA 3MEFA 1AEXA 5I2YA 5EJWA 1N32Q 1EL0A 3F8TA 4CKCA 2ZM6L 3HZXA 1QVFA 1PTOF 4EGVA 4X62Q 5AJ3Q 4JCVE 4IFDH 5D14A 1B7YB 1TS5A 2B63H 3GTLH 5C44H 4HJAA 1PTOH 2PW5A 3SXHA 2PW7A 1A3UA 1EYDA 4LF6L 1AE3A 3NPPA 5C4XB 2ZJQA 4DAYB 1PZJD 2EYMA 1PTOD 3SR1A 1XNRQ 1BQQT 4MTNA 3NELA 4YY3L 3MXNA 2K75A 2KHJA 1CUKA 3K8AA 1V1QA 3OOCA 4WORA 4CDFC 1VQOA 3HFZB 4DV2Q 4PMCA 2IPKD 2F3WA 1O78A 4QMGA 2UUBQ 2J4XA 1SYFA 3UDXA 4K0KQ 1X65A 1VQBA 1CSPA 2C5CA 3A56A 3NQTA 3EQLC 4X3TA 1OXTA 5CC4A 1K3RA 1VQ5A 2E75C 1PH7A 1EOTA 3PO3G 4LFAL 1TWHH 2R93H 4IUVA 4UPAA 2ZJRA 1SDFA 3HGBA 2RCNA 4H02A 3IFTA 3PUZA 4A3JB 2R93G 3I4MH 3TS2A 3SK8A 5C3XA 1UUPA 3PSIA 1F9RA 3EN2A 1EY8A 4DK1A 1LTAD 2SOBA 4XT1B 1IYVA 1AW7A 4JI1Q 1V1PA 2K33A 1FJGL 4IURA 5IGCA 2R3ZA 5A2QE 4DR1Q 1T9HA 5FJ8G 5TSSA 2UXBQ 4IPGA 4ME3A 1U5KA 4JV5L 4R4CA 2BOSA 2V4DA 3MZ5A 4JBJA 3T13A 2F0DA 1N33L 1SLJA 5KNDA 1EZ6A 2WP8J 3CHBD 3CC2A 3KF6A 1CHPD 4X3KA 4DAMA 4B3TL 1WJJA 1C4QA 1Y1VG 4A3MG 1ML0D 5KYIA 1KIXA 1HZBA 3KOJA 2CWAA 4KJNA 3W1GA 3D31A 3NSWA 5J39A 2CH4A 3K59A 1UEBA 4HR7B 4WJWA 2HDLA 3DUZA 1I50H 1YNXA 1K8AC 2JA5G 3MAQA 1YITA 1FGUA 1AZPA 3RZOB 1LV9A 1J6QA 5JOBA 5JEAH 1QZGA 1H9JA 3D0FA 1HPCA 3LWEA 5KIXA 2VQFL 5JJLA 1WTRA 1SYBA 2JK8A 4X3UA 3VDYA 3G6EA 1LTLA 1OXUA 1SE8A 2JA6G 2R92G 2E74C 2HDMA 2I07B 3CXCA 1KAWA 2UU9L 3GP7A 1KAAA 2HUGA 2WAQG 4CJ1B 2IL8A 2A8VA 3S1MH 3UI2A 2AMCB 1CKOA 3S1NH 1DONA 3VYUA 2EJGC 4PQXA 2EYPA 4B08A 1PTOC 3E9HA 1ESRA 2B2TC 1RKNA 3HOYB 1V9PA 3RNUA 3M4OH 2ZJPA 3WWVA 1WTVA 1IKMA 3B6YA 3HOVG 1C9OA 1D5XC 2DGYA 3PMFA 5E3FA 5M5XB 3HOWB 1UE5A 1PVOA 4K6LA 4QGUA 1D6EC 1STYA 5E4XA 2RQXA 4AQYL 3NBHA 5LHY1 5CORA 1VF5C 2PO4A 2VUMG 1S5CD 2K01A 2Z1CA 4BY7H 1NJIC 1H95A 4PMWA 3T1HL 4F7XA 3GTJH 1AE2A 4ABNA 2R61A 3PQIA 4A3DG 2LXJA 2NVYH 1Q81C 1STBA 1SMYD 4HSVA 5J3BA 4MZ9A 2KHSA 3ULPA 2A5HA 3AMUA 1A3VA 1YI2A 2E2HH 1F9PA 1WI5A 2K5HA 3K0XA 3UDFA 2N55A 3VR3A 4KI0A 3U9OA 2PCFB 3K5LA 4X62L 5AJ3L 3Q22A 3RD4A 3TRZA 4BBSH 1VQHA 3KYHC 1JC7A 2BE5C 1F2LA 4OELB 1H9RA 2VL6A 4MN3A 2AKWB 5C0XH 2KCCA 2E2DC 1E2ZA 1DJRD 1GUSA 2ALYB 4TQUS 1UE1A 2N88A 3NEMA 4GOPB 3PF5A 2WB1E 4DNTB 4K2KA 2D2CC 1JE5A 4KLKA 2I5MX 1TS2A 4R4QA 3PF4A 2NBFA 1EU4A 3FEWX 2F03A 3H94A 4E6IA 4YIJA 3JAMc 2ES2A 1QB5D 4EQOA 1K73C 1KNEA 5G3LD 4POFA 1O7LA 3ICEA 1Q3LA 2EIFA 4FO2A 4ZQ3A 1EIGA 1PRTD 2DJGC 1JE4A 1SR3A 1Y69U 2RVLA 1HXYD 2D62A 1MJEA 3M7NA 1NR2A 1OXSC 2Z0SA 1UNSA 1PYBA 4LK1C 2Q2TA 2F0GA 1KLGD 2R7ZB 4KY6A 1I4PA 2Z9HA 1IL8A 5CV6A 1HNXQ 1GUGA 3GD7A 4PG3A 2EE1A 3MXGA 4DA2A 4GN5A 3TZDA 2CW0D 2ZXPA 4KTAA 4IUQA 2NTSA 3I55A 2J0TD 4KY7A 4ZK9B 2F0SA 1SRUA 3RN2A 5JPNC 2K5WA 5COYA 3TDQA 2F3IA 3DM3A 1EY0A 3CCEA 3CCMA 1I6HH 1IBLQ 1BKBA 1Y14B 3I4NH 3RZOH 1F2ZA 2EJMA 2F0UA 4GKJL 1K8OA 1QG7A 3VR6A 4M1UB 1PTOB 2XIWA 4G7ZC 1B3QA 5D3DA 4CDCC 1NUCA 4HIOA 3MFYA 2MUYA 5IT9L 4BY7G 4A75A 3L0OA 1WCMG 4XIGS 5AFWA 3A0JA 1WTXA 1S5BD 1YHAA 3S14H 3BZCA 5M5XH 1WD1A 1A62A 1I4XA 2R6GA 1IZ6A 4ZAIA 1A2TA 3HOZG 5JJZA 4A3GB 3H0GG 1KQSA 1SJHD 3K81C 4DR6L 1B50A 3TP6A 4BXXG 4Z9CB 2ID0A 2K5VA 4B3RL 1WTPA 3H0GH 3W3AA 1K8MA 4XQJA 5FO8B 4NDXA 2VQFQ 1D5ZC 4IALA 3ZJYC 2A73B 4JI5Q 5FOBB 1JWMD 2JJQA 1V1PB 1WTQA 1EYGA 1M90C 4RH6A 3S16B 4HAEA 5IT9c 1KDAA 1TXYA 4EQ5A 2NZHA 3D4DA 3CP0A 3R93A 5IGEA 2VQEQ 1D8LA 4A4IA 1HFNA 4P73A 2VW9A 1STGA 1VQ7A 3STBD 2E2JH 2XWJB 1UWVA 1EY6A 2F4VQ 3Q23A 4JI6Q 5FK9C 4X66Q 4K8IA 3PO2H 2KVMA 1K83B 5C4JB 1H9SB 4U68A 5BR8Q 1JOOA 5C3EB 3AQQA 1KC8C 5DLQE 2Q8IB 1JOKA 5BR8L 1EQRA 5GADC 3W1BA 1SJED 4DR3Q 4DV0L 3L3OC 4LUOA 3M3YH 2I5HA 4S3SA 5CBEE 3TMEA 3OTOL 2SEBD 4C3IG 1IBML 1Q1EA 3I4LA 4DV2L 3GTMB 1M4VA 1MGSA 2JSOA 2K14A 2C35B 3KF6B 2NVXB 2Z4IA 2Q2UA 4C3HB 5FLMH 1RCVD 5IT9E 2ATWA 4X3SA 3TS0A 2EYOA 2NVQB 4FYDA 1I4RA 2IX0A 4AYBE 2TSSA 1IYUA 3CQZB 1HA5A 4DUYL 1CTMA 1EY5A 1O7IA 1YJ9A 2CH4W 2KA7A 2VY3A 3LNNA 4C3JG 2OQKA 2ASBA 5C4ZA 4A3IH 1R4QB 4X64Q 1QILA 3KJOA 4ME5A 3G6JB 1JJCB 2FMMA 2BH2A 1EIHA 4A3IG 2EYFA 3FKIB 4B9XA 5HURA 1RODA 1SBBB 3OWEB 4K5XA 3BJUA 4JI4L 2PPBC 4QY7A 3DWAA 2A6ED 3HKZB 2KUMA 1KRTA 1O7YA 3VA5A 4HJ8A 3OIQA 2IHEA 3H09A 4KV6A 3S1MB 5I6YA 1XPRA 2E2IB 1ENCA 4HMJA 4NB3A 1ENFA 2DY7A 2AUJD 2B2WC 4LF7L 4BBRH 1TT2A 3ERQA 5FLXE 2E2JB 4R1JA 1AP0A 2K4KA 4OO1I 1KL9A 1TWCB 3I8ZA 2Y0SG 2HQEA 4JI0Q 3GTOH 3S1QB 4K2LA 1EFWA 1XNQQ 2NVTB 1IBKQ 3OYYA 4LMQD 3I72A 3QWNA 4DR5Q 4B9WA 1GHJA 3PIP3 1JORA 4LF4L 2G5DA 1I4QA 3S2DH 5I4DA 4DR7Q 1LO5D 4LAAA 1FGBD 4XT3B 5CV5A 5CBAE 1CA5A 3V2TA 4MIUA 3C46A 1XX8A 1HUMA 1D1IA 4G7OC 2F0JA 3K58A 1QUQA 4DNRB 4QIWB 1HR0Q 1PH5A 1PFSA 2WIIB 3T56B 1BF4A 3MTSA 2JA7H 3KUPA 1LABA 1XTDA 2HIVA 4HJ5A 1L0WA 1SNCA 3NBIA 1MI2A 1GO3E 5IGGA 2F0EA 1RHPA 3U9SA 3J7AV 2MJ8A 4IPDA 1LTGD 1X55A 2CVRA 1C0AA 4EX5A 4GKKL 1PH9A 4GS3A 4IFDI 4NXML 3QOLA 2A69D 2YTVA 3QB3A 4FVMA 2K04A 1SNDA 3K80C 5DEHA 2UUAQ 5EQ0A 3F2CA 2D5DA 2L12A 3NWTA 2HHHQ 2JP1A 1BCPB 1PRTC 4A3BG 5ELFA 4GNXA 3S16H 3J80L 4A3JH 1DYQA 3EVQA 1ILQA 4YHHL 3GTKH 3G48A 3OMGA 1QUQB 1W6JA 2RF4A 4ZKCB
chains in the Genus database with same CATH topology
1QJOA 1YNND 1DXMA 4KKUA 2JXMB 1DOKA 4FF4A 2JA8B 1BNZA 3R2IA 5DM73 4HSPA 1U9RA 3BS1A 4BWGB 4C1NK 1VDZA 3O13A 4EQPA 1ILPA 1ZKOA 1FNUA 1PDQA 4WRDA 4RCNA 2VUMB 4CBVA 2LMCB 3SE0A 2O4XA 2EYHA 3W2DA 3NTIA 4BY7B 1CQVA 2VXWA 1EWCA 4GZYC 4L8JA 3I70A 4ID6A 4IFDJ 3BZDB 1EYCA 3OSOA 3E0JA 1KDCA 1Q12A 1EEFD 3NTHA 1STAA 4OIKA 1BR9A 4F88A 5T1GA 4RHRA 5LL6S 3HOZB 4ZUJA 2RSOA 1FYCA 1CK1A 1MSHA 4QF4A 3VYRA 5ELEA 2EJFC 3FDTA 5KNBA 1L0XB 4A3KB 2YU9B 1DD2A 3S9WA 4C1NI 1I4GA 1XWEA 2L0CA 4RGNA 3BDLA 3EFXD 2XNAC 3A8IE 1EY4A 1GUNA 1AFPA 2XRQD 5K36G 3WOFA 2G9HD 2KECA 4QCLA 4KHZA 1XXGA 5C44B 1EEID 2C9OA 3I73A 1JB3A 1F9SA 3IAYA 2F0MA 2B8GA 2I46A 4C2MB 2NN6G 3BYYB 1S4ZA 1RTNA 2MGSA 2PQEA 2E2HB 1JQYD 1EY9A 4C56C 1S5DD 1PRTF 4RGMA 3ND8A 4FXGC 4CKBA 1IKLA 4C3JB 3I90A 2EY2A 2LS01 1U4MA 2Z4HA 2KOLA 2QILA 2R93B 1ESFA 3TZUA 4WFN3 2VNUD 2WINB 4DGZA 5HGTA 3H91A 1EQTA 1LT6D 3P1HA 4ILWA 1V1OA 1WCMB 2BCOA 1TWHB 4A93B 4NP5A 1TIID 4HCEA 5EBDA 2B63B 1TWFB 1MBYA 1AZQA 4RCOA 1DOLA 1Y1VB 3TP7A 3QO2A 2DNEA 1BBXC 5T1IA 2NTTA 4TSSA 5A35A 1HTLD 2NB0A 3BDOA 2PZTA 5CGKA 5JVG3 4I7ZC 3LWUA 4Q0FA 2HCCA 3NTKA 1PZID 4G4KA 3P20A 4KN7C 2B2UA 4O1NA 1TY0A 1RD9D 1YNJD 1TWAB 3OW7A 3M4YA 3FVQA 3R3OA 5LL6X 1CZGA 3BG3A 3P75A 4XDXA 4A3MB 4KKTA 1ET6A 2K05A 2OEOA 2YYZA 1IW7D 3S1RB 2X69A 1HA6A 3RLFA 2AQ1B 2K03A 1LTSD 3PUVA 4ULLA 1F2YA 4BBSB 3KLSX 3DMUA 3EJIA 4RGOS 4L63B 1I6HB 1RDPD 2A6EC 5K5PA 1LT5D 4JBWA 3MXUA 2NN6H 3ZYYX 3OPOA 2CHBD 1BCPF 4R8IA 1PXUA 4IN3A 3WOEA 1CFMA 4J8QA 2RDHA 3HP3A 4CJ2C 2G9DA 3OMCA 3GTGB 4H44C 2BA0A 1B44D 1DOMA 4OIJA 1TY2A 1FR3A 4FF1A 3T4AC 1SNMA 3OWFA 2EZVA 2EY6A 3A55A 1LACA 3SK6A 3HOUB 2F3VA 1B4OA 3MA2B 4J6HA 2IT1A 2SNMA 2F0NA 1NR4A 3A8KE 1HCZA 4U673 3S1NB 2KJXA 3CU7A 3L9AX 2A74C 2L11A 1TQOA 1EWHA 3M4OB 4XQQA 1U4RA 3TSSA 5KNCA 3PIO3 3C3LA 3RMHA 4QUCA 4EVOA 1O80A 1JWSD 3PV0A 3SDZA 1H9KA 2QDBA 2F0LA 2ZXRA 2RSNA 4C3HG 4BA2I 2OXPA 5D65A 3C1FA 4BBRB 4PV1C 1T5EA 3TBIB 4CHTB 3DHQA 4I65A 5CR3A 1IW7C 2FMCA 3ITPA 5C0XI 1CZWA 1PFMA 1Y8NB 5K36H 1HQMC 1KLUD 5EKKA 1Y1WB 4NW2A 4ZYSA 1SE2A 4IUTA 2F0IA 3GTQB 3H0GB 5DNFA 2Q8RE 1O7ZA 2A68D 2NUCA 5EPLA 4DU9A 2EY1A 3NUCA 3TN2A 1HUNA 3KBGA 2B2YA 1ONLA 2JE6I 3GTPB 4IZ8A 3OHXC 4DXFA 3GV3A 1I50B 4MHEA 1TWGB 2KQ3A 1X3PA 1CM9A 1SYDA 5CYUA 4DFAA 4CJ0B 3Q6SA 5EPJA 2A6HC 4JK1C 3G7LA 3JAML 3X3MA 3D3RA 5ELCA 1ENAA 4HTHA 3D8GA 1OXVA 1RTOA 2WB1B 2WAQB 1BCPD 2PMZB 3KBXA 2B2VA 3NK9A 2GA4B 2K1BA 3DXJC 2JA7B 5J1ZA 1GHKA 3N52A 1EZ8A 3E5SA 4FF2A 4BY1B 2XRSD 1JICA 3FRPB 1B3AA 2RBMA 1TU2B 3KLRA 4UAIA 2JYOA 5E1FA 1B1ZA 2EXZA 1LTID 3L7ZC 1TS4A 1ZXTA 1XYIA 2QEJC 3T51B 2A6HD 1J8IA 1L0YB 1GJXA 3M3YB 3FPUB 3SK5A 3MVVA 3KLSA 2VB3X 2QKIC 2EY5A 1BCPC 1PRTB 4HEDA 4A3IB 1PFBA 2FINB 4IUPA 2KEDA 2PNRC 2L4NA 1AN8A 4DAYA 2JEBI 4K8JA 2MPMA 1ZYRD 3RUZA 5J22A 3LX0A 5C0XJ 5KYLA 3URYA 3VR2A 3IKJA 4V0BA 4F8MA 1NSNS 1F2MA 2L55A 4NKLA 3V05A 3T53B 2A68C 3C1EA 2BDNA 3HS0C 1U4PA 5JPMC 4A3DB 1C48A 5JVH3 1Y8OB 2AQ2B 4FXKC 1TVXA 1H9SA 2L1BA 2ICIA 4XYOA 3BVZA 2IX1A 2TMPA 1KABA 5F2DA 1KDBA 2FHTA 1H9MA 2XVSA 5M9OA 2CQAA 3K57A 2JEAI 1PYWD 3E6ZX 4ODGA 1VCIA 2FFKB 2JA6B 5ELDA 4KK7A 1TKWB 2R92B 1A6XA 1G2SA 4OGQC 3GTLB 2O5JC 1MD2D 3KF8A 4FNFA 1CI3M 4F87A 2NZ1D 5C5MA 3Q0AA 3IL8A 5FLXL 3MHBA 1LLRD 3QJYA 4CGYB 1G8ZD 2K7VA 2ZT9C 3GTKB 4K6DA 3A7AB 1XTCD 5C5LA 3I3CA 4H13C 2SDFA 1TR5A 3V96A 3JAME 2OT2A 2WACA 4BS9A 3A54A 1DCZA 1DM0B 1GXDC 1I6VC 2ICEC 4KMUC 2IW3A 1GUTA 4BA1I 4IFDG 1LTTD 2NYZD 3KK7A 3PUWA 1LTRD 1SYCA 2RA4A 3VYTA 1HQRD 2XN9C 1B9NA 1OXXK 2BA1A 5C6AA 4H0LC 4K5VA 5EBCA 4KHVA 3EROA 1UEAB 2CW0C 2QCPX 2K5DA 1D2BA 4RKBA 3HEJA 3ONAB 5I9PA 1ET9A 3PUXA 2B2VC 2B2WA 1VF7A 1F77A 2EYLA 1M8AA 1SYGA 3A8JE 5NUCA 3GV6A 1Z47A 1GUOA 1U4LA 5KRUA 3MFGA 2F0PA 4M8AA 3RZDB 4Y7NB 4RFBA 5C4HA 5CV4A 1HFGA 3CRKC 4DAPA 4HCSA 2EYJA 1QNUA 2Q8TA 2RKSA 1BOSA 3BVGA 3MXPA 1D5MC 1B53A 2B2YC 2AQ3B 1MSGA 3NHHA 3AU7A 4DAVA 1HRJA 2K28A 3SVMA 3DM1A 2H1EA 3J81L 3FPPA 4L6TB 5FO7B 1JOQA 3T16A 4CKEA 3MC0B 4P2CB 4XXEA 2ENBA 2OF1A 3H3VC 2DN8A 3GTOB 2IWHA 4TRDA 1PLFA 3DWPA 5IGBA 1NCVA 4A3FB 3PO3B 2M00A 2F4IA 4FP5D 2BDOA 2JA5B 1SXTA 3P7JA 3HRZC 4C3IB 4R8NA 5M5YB 1HHVA 2SNSA 3DWQA 1F9QA 3K0YA 2O2LD 1II3A 3SK4A 2KCNA 1T5XD 1K8OA 1VMCA 3TP8A 3NE5B 2K5QA 2AWNA 5CV7A 4XQNA 1GUWA 2M2LA 4N9TA 3S2HB 3N6RA 4QB4A 4UDUC 2NN6I 1R4PB 3BYTB 5EKIA 1SFOB 5DM63 2DY8A 5BN3A 2X6LA 3HOVB 2F0WA 5IIFA 4ZRZA 1LT3D 1DZ1A 2QF7A 3D4RA 2D9UA 1CQFA 1QNKA 1Z6HA 2F0OA 1G91A 4A3EB 2NWGA 3F2UA 5CMDA 5JEAG 2EVBA 3DEOA 1RJTA 1LTBD 3QOJA 2Z8LA 3EA6A 4RKLA 1VMPA 3S15B 4OHJA 3K5OA 1EY7A 1B2TA 5E4WC 1BO0A 4Q5VA 1JCKB 2NVYB 2L9HA 5I6WA 4ZKBB 3MEHA 1SEBD 2M9VA 1QWYA 1SE4A 1ZYRC 4KD4A 3VA7A 3J7AF 5DAUA 2LFNA 1GOZA 4J1MA 3QIAA 1J9OA 2LKVA 1QCBD 1YNNC 5D3IB 4G7HC 1SE3A 3VR4A 1S5ED 1JWUD 4KJOA 2RDFA 4FF3A 1C8CA 1WVLA 1G291 4DK0A 3CKIB 4K5WA 5JAVA 3S17B 2AWOA 3VYSA 5KGUA 1STNA 5I9OA 3R2TA 2K6AA 4QUFA 3I4MB 4DF7A 1UAPA 3CRLC 2LY7A 3GTJB 2K32A 3MWYW 2H4OA 4IUNA 1Z7TA 1X3QA 1Q90A 1CHQD 3A7LA 3H6MA 4RHSA 5CV9A 1SMYC 4G57A 3J7YW 5IGDA 3NXWA 1PMRA 1QE6A 4HN7A 2BE5D 1V43A 5M3FB 1A2UA 2KEEA 1IHZA 3VR5A 1TS3A 4DN4M 4N9PA 3K7AB 3M85A 2WKDA 5IGFA 3I4NB 2XSCA 3NP8A 3FMCA 1SSOA 1Y8PB 4KD3A 1G2TA 2IJ0A 1BUVT 5BN5A 1Q8IA 3IFDA 4ZUIA 5EGTA 1R9TB 1E2VA 2F0QA 5ISRA 3J81E 2O5IC 2Y0SB 2F0TA 4PMBA 1SNPA 1V8QA 3K5NA 1CT1D 3GO5A 3NWSA 3SHLA 2EOTA 5M3MB 2VB2X 2F0KA 1E2WA 4OO1G 3HOXB 2E76C 4TKOB 4XYQA 2MP1A 2MHVA 3K6OA 1S5FD 5C3WA 4AYBB 5G3LF 1NAPA 2F1MA 5EPKA 1KNAA 4KN4C 5FO9B 3WDNA 1ICWA 5IODA 2FJ2A 3QG1A 1SYEA 3GQBA 1FNVA 2WKCA 2WV6D 4R9WA 2AUKA 3ND9A 1E0BA 3X3NA 3OIPA 1PZKD 1I4HA 1RF2D 5C0XG 1W6KA 2B39A 1KTKA 2X6GA 3BVMA 2EPBA 2F0HA 1LT4D 3C2PA 4IUUA 1QOHA 2RDGA 4RWSC 5ELBA 2IX3A 2ZXOA 2B2UC 2EDGA 4K14A 4XTCS 3D6WA 1EU3A 1FNWA 3Q24A 4LJZC 1JR0D 2PYKA 1WD0A 4HMIA 3R8BA 1SNOA 5I2XA 5KEEA 1G6ZA 1SAPA 2F0FA 3DEPA 1ZEQX 2J7ZA 1EFID 1WTOA 4OO1H 2XWBB 2HCIA 3S2DB 4KKSA 4DXGA 1A15A 2B2TA 1WTWA 4FXDA 4O42A 4OL7A 4IQZA 3BDCA 3TP5A 5M5WB 1OO9B 1SNQA 5CV8A 1STEA 1B9MA 2DNCA 3S14B 3NQIA 2A69C 4ZLTF 5BN4A 1FD7D 3D6CA 1D1KA 4RAUC 1STHA 1EYAA 4PNYA 3HG9A 2PZWA 5A2QL 3AB9A 4NMZA 1CA6A 1HTPA 1BXTA 3D4WA 3M7GA 1Q1BA 4KY5A 5EKLA 3PUYA 5JEAJ 4H7BA 1A3TA 5FKAC 3K5MA 4EQNA 1YNJC 2PZUA 4RA8A 4V190 5IOCA 2L5TA 3SEBA 1EQVA 4RGTA 3J80E 1I3QB 4A3BB 1X32A 1BDOA 1PFNA 3PO2B 2F0VA 3I91A 2B8FA 1AEXA 5I2YA 5EJWA 1EL0A 4CKCA 3HZXA 1PTOF 4EGVA 4IFDH 5D14A 1TS5A 1PTOH 2PW5A 3SXHA 2PW7A 1A3UA 1EYDA 3NPPA 5C4XB 1PZJD 2EYMA 1PTOD 3SR1A 1BQQT 3MXNA 3OOCA 4WORA 4PMCA 2IPKD 2F3WA 1O78A 4QMGA 2J4XA 1SYFA 2C5CA 3A56A 3NQTA 3EQLC 4X3TA 1OXTA 5CC4A 2E75C 1EOTA 4IUVA 1SDFA 3HGBA 3IFTA 3PUZA 4A3JB 3SK8A 5C3XA 1UUPA 1F9RA 1EY8A 4DK1A 1LTAD 2SOBA 4XT1B 1IYVA 1AW7A 1V1PA 2K33A 4IURA 5IGCA 2R3ZA 5A2QE 5TSSA 2BOSA 2V4DA 3MZ5A 3T13A 2F0DA 5KNDA 1EZ6A 2WP8J 3CHBD 1CHPD 4X3KA 1C4QA 1ML0D 5KYIA 4KJNA 3D31A 3NSWA 5J39A 3K59A 4HR7B 4WJWA 2HDLA 3DUZA 3MAQA 1AZPA 3RZOB 1LV9A 5JOBA 5JEAH 1H9JA 3LWEA 1HPCA 5KIXA 1WTRA 1SYBA 4X3UA 1OXUA 2E74C 2HDMA 2I07B 3GP7A 1KAAA 2HUGA 4CJ1B 2IL8A 3UI2A 1DONA 3VYUA 2EJGC 4PQXA 2EYPA 4B08A 1PTOC 1ESRA 2B2TC 1RKNA 3HOYB 1WTVA 1IKMA 1D5XC 3PMFA 5M5XB 5E3FA 3HOWB 4K6LA 1D6EC 1STYA 5E4XA 2RQXA 3NBHA 5LHY1 5CORA 1VF5C 2PO4A 1S5CD 2K01A 2Z1CA 4PMWA 4F7XA 4ABNA 2R61A 1STBA 1SMYD 4HSVA 2KHSA 2A5HA 3AMUA 1A3VA 1F9PA 2N55A 3VR3A 4KI0A 3U9OA 2PCFB 3K5LA 3Q22A 3RD4A 1JC7A 2BE5C 1F2LA 1H9RA 4MN3A 5C0XH 2KCCA 2E2DC 1E2ZA 1DJRD 1GUSA 4TQUS 2N88A 4DNTB 4K2KA 2D2CC 1TS2A 2NBFA 1EU4A 3FEWX 2F03A 3H94A 4E6IA 4YIJA 1QB5D 4EQOA 1KNEA 5G3LD 1O7LA 1Q3LA 4FO2A 4ZQ3A 1EIGA 1PRTD 1JE4A 1Y69U 2RVLA 1HXYD 2D62A 3M7NA 1NR2A 1OXSC 1UNSA 4LK1C 2F0GA 1KLGD 2R7ZB 4KY6A 1I4PA 1IL8A 5CV6A 1GUGA 3GD7A 2EE1A 3MXGA 4DA2A 3TZDA 2CW0D 2ZXPA 4KTAA 4IUQA 2NTSA 2J0TD 4KY7A 4ZK9B 2F0SA 5JPNC 2K5WA 5COYA 3TDQA 1EY0A 1F2ZA 2EJMA 2F0UA 1QG7A 3VR6A 4M1UB 1PTOB 2XIWA 4G7ZC 5D3DA 1NUCA 3MFYA 2MUYA 5IT9L 4XIGS 5AFWA 1WTXA 1S5BD 1WD1A 1I4XA 2R6GA 4ZAIA 1A2TA 5JJZA 4A3GB 1SJHD 1B50A 3TP6A 4Z9CB 2ID0A 1WTPA 3W3AA 4XQJA 1K8MA 5FO8B 4NDXA 1D5ZC 4IALA 2A73B 5FOBB 1JWMD 1V1PB 1WTQA 4RH6A 3S16B 4HAEA 1KDAA 3D4DA 3R93A 5IGEA 1HFNA 1STGA 2XWJB 1EY6A 3Q23A 5FK9C 4K8IA 2KVMA 1K83B 5C4JB 1H9SB 4U68A 1JOOA 5C3EB 2Q8IB 1JOKA 1SJED 3L3OC 4S3SA 5CBEE 3TMEA 2SEBD 4C3IG 1Q1EA 3I4LA 3GTMB 1M4VA 1MGSA 2JSOA 2NVXB 2Z4IA 4C3HB 1RCVD 5IT9E 4X3SA 2EYOA 2NVQB 4FYDA 1I4RA 2IX0A 2TSSA 1IYUA 3CQZB 1HA5A 1CTMA 1EY5A 2KA7A 3LNNA 4C3JG 5C4ZA 1R4QB 1QILA 4ME5A 3G6JB 2FMMA 1EIHA 2EYFA 3FKIB 4B9XA 5HURA 1RODA 1SBBB 3OWEB 4K5XA 2PPBC 3DWAA 2A6ED 3HKZB 2KUMA 3VA5A 1O7YA 3OIQA 3H09A 4KV6A 3S1MB 5I6YA 2E2IB 1ENCA 4HMJA 1ENFA 2DY7A 2AUJD 2B2WC 1TT2A 3ERQA 5FLXE 2E2JB 1AP0A 4OO1I 1TWCB 3I8ZA 2HQEA 3S1QB 4K2LA 2NVTB 4LMQD 3I72A 3QWNA 4B9WA 1GHJA 3PIP3 1JORA 1I4QA 5I4DA 1LO5D 4LAAA 1FGBD 4XT3B 5CV5A 5CBAE 1CA5A 3V2TA 4MIUA 3C46A 1XX8A 1HUMA 1D1IA 4G7OC 2F0JA 3K58A 4DNRB 4QIWB 1BF4A 3T56B 2WIIB 3MTSA 3KUPA 1LABA 1SNCA 3NBIA 1MI2A 5IGGA 2F0EA 1RHPA 3U9SA 3J7AV 2MJ8A 1LTGD 2CVRA 4IFDI 3QOLA 2A69D 3QB3A 4FVMA 2K04A 1SNDA 5DEHA 5EQ0A 2D5DA 2L12A 3NWTA 2JP1A 1BCPB 1PRTC 5ELFA 3J80L 1DYQA 3EVQA 1ILQA 3OMGA 1W6JA 4ZKCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFP A;  2KCN A;  2NBF A;  2MHV A;  2NB0 A; 
#chains in the Genus database with same CATH topology
 3T1Y L;  1QJO A;  4JYA Q;  5IYC G;  1YNN D;  2WB1 G;  4J15 A;  1S72 A;  2ZM6 Q;  1DXM A;  4KKU A;  2JXM B;  1DOK A;  4FF4 A;  2JA8 B;  4N8F A;  1BNZ A;  3R2I A;  5DM7 3;  4Y52 H;  4HSP A;  1U9R A;  3BS1 A;  1MKH A;  4YWM A;  4BWG B;  4LW1 A;  4C1N K;  1VDZ A;  2VQE L;  3ULJ A;  3O13 A;  4EQP A;  1ILP A;  3NEN A;  1ZKO A;  1PH1 A;  2FXQ A;  1FNU A;  1PDQ A;  4WRD A;  4RCN A;  2VUM B;  4CBV A;  2LMC B;  2Z6B A;  3SE0 A;  2O4X A;  2EYH A;  3W2D A;  3NTI A;  4A3K G;  4BY7 B;  1CQV A;  2VXW A;  4YY3 Q;  4DV5 L;  1EWC A;  2N8N A;  4GZY C;  4L8J A;  3I70 A;  4A3C G;  4ID6 A;  4IFD J;  4GNX B;  3BZD B;  5LMN L;  1EYC A;  1NMF A;  3OSO A;  1IBM Q;  3E0J A;  1KDC A;  1Q12 A;  1EEF D;  1X6O A;  3NTH A;  1STA A;  1VQ6 A;  4OIK A;  1B8A A;  1BR9 A;  5LMU L;  3CPW A;  4F88 A;  5T1G A;  4RHR A;  5LL6 S;  3HOZ B;  4ZUJ A;  2RSO A;  1FYC A;  2F52 A;  4DK6 C;  1CK1 A;  4DUY Q;  1MSH A;  4QF4 A;  1HJP A;  3VYR A;  2NVT H;  5ELE A;  2EJF C;  3FDT A;  5KNB A;  1L0X B;  4A3K B;  2YU9 B;  5C4X H;  1DD2 A;  3S9W A;  4C1N I;  1K28 A;  1I4G A;  1XWE A;  2L0C A;  4RGN A;  3BDL A;  4A3L H;  3EFX D;  4YCW A;  2XNA C;  3A8I E;  1EY4 A;  5M3F G;  1GUN A;  1AFP A;  2XRQ D;  5K36 G;  3WOF A;  4POG A;  2PI2 E;  2G9H D;  2KEC A;  4QCL A;  4KHZ A;  4DV7 L;  1ASZ A;  3U58 A;  1WOC A;  1XXG A;  5C44 B;  1EEI D;  2C9O A;  4A3B H;  3I73 A;  1JB3 A;  4A3J G;  1F9S A;  1VQK A;  3IAY A;  2F0M A;  2B8G A;  2I46 A;  4DNI A;  4LF5 L;  4C2M B;  3J7Z C;  2NN6 G;  3BYY B;  1S4Z A;  4LFC Q;  4NXN Q;  3I4M G;  1RTN A;  2MGS A;  2PQE A;  2E2H B;  2YV5 A;  1JQY D;  4LFC L;  1EY9 A;  4JBK A;  4C56 C;  1S5D D;  3G71 A;  4A3F H;  1PRT F;  5GAH C;  4RGM A;  1P16 A;  3ND8 A;  4FXG C;  4CKB A;  1IKL A;  4C3J B;  3I90 A;  4NPS A;  2EY2 A;  2LS0 1;  4A3F G;  1U4M A;  1B70 B;  2Z4H A;  2KOL A;  2UXC Q;  2RHQ B;  1MJC A;  2QIL A;  2R93 B;  3M4Q A;  4LWC A;  4BXX H;  1A8V A;  1ESF A;  1XMQ L;  3TZU A;  4WFN 3;  2VNU D;  2WIN B;  4DGZ A;  4LUZ A;  2HQL A;  1TWF H;  2B29 A;  5HGT A;  3H91 A;  1EQT A;  1LT6 D;  1JJ2 A;  3P1H A;  4ILW A;  1V1O A;  4DR4 L;  5M3M H;  1A0I A;  3STB C;  1PH3 A;  1WCM B;  2BCO A;  1XPO A;  4UP7 A;  1TWH B;  4A93 B;  4NP5 A;  3J81 i;  1TII D;  2F4V L;  4HCE A;  3FKI H;  4P72 A;  5EBD A;  5GAG C;  4X65 Q;  1L1O A;  2QA4 A;  2B63 B;  1TWF B;  1MBY A;  5GQO A;  1KD1 C;  3HOV H;  3RLO A;  2ZTD A;  1AZQ A;  1XPU A;  4DR3 L;  4RCO A;  3PIO A;  1DOL A;  1Y1V B;  1YHQ A;  3TP7 A;  3QO2 A;  2DNE A;  1BBX C;  5T1I A;  3S24 A;  2NTT A;  1EWI A;  4TSS A;  1VQL A;  5A35 A;  1HTL D;  2NB0 A;  3BDO A;  2VUM H;  2PZT A;  5CGK A;  4YWL A;  5JVG 3;  2OTJ A;  4I7Z C;  3LWU A;  3F1Z A;  3GTG H;  4Q0F A;  2HCC A;  4P75 A;  3NTK A;  1PZI D;  1JMC A;  4G4K A;  1NNX A;  3P20 A;  4KN7 C;  2B2U A;  3GTM H;  4O1N A;  3GTQ H;  1TY0 A;  1RD9 D;  1YNJ D;  1TWA B;  4X64 L;  1HNZ L;  5H1S E;  4JI4 Q;  3OW7 A;  3UDI A;  1Q8K A;  4IPC A;  2LXK A;  3KDF B;  4UHV A;  2OCE A;  2PQA B;  3M4Y A;  3FVQ A;  3R3O A;  5LL6 X;  1K3B C;  1CZG A;  3BG3 A;  2BH8 A;  3P75 A;  1BBW A;  4XDX A;  4A3M B;  4KKT A;  5FJ8 H;  1ET6 A;  2K05 A;  2OEO A;  2YYZ A;  4LF8 Q;  1CSQ A;  4DUZ Q;  1IW7 D;  3S1R B;  4JOI A;  4A3E G;  2X69 A;  1HA6 A;  5IP9 H;  3DLL A;  3RLF A;  2AQ1 B;  2K03 A;  4LF9 L;  3PIP A;  1MHW C;  1LTS D;  1XMO L;  3PUV A;  4ULL A;  1PH8 A;  1FL0 A;  2A1A A;  1F2Y A;  4BBS B;  3KLS X;  3DMU A;  1VQ8 A;  3EJI A;  4RGO S;  1J5E L;  3HOW H;  1E3P A;  4L63 B;  4I7A A;  1RDP D;  5LMU Q;  1I6H B;  1UE7 A;  2A6E C;  5K5P A;  4HJ7 A;  1LT5 D;  4JBW A;  1HZC A;  3MXU A;  2NN6 H;  3ZYY X;  1YVC A;  3OPO A;  2CHB D;  1BCP F;  4R8I A;  2YTX A;  1PXU A;  4IN3 A;  5C3E G;  3WOE A;  3TQY A;  1CFM A;  1VQF A;  4J8Q A;  1EQQ A;  5JJK A;  2RDH A;  5IYC H;  1VQC A;  4PZ6 A;  3HP3 A;  1NE3 A;  1HNW Q;  4JI8 L;  3EIV A;  4CJ2 C;  2G9D A;  3OMC A;  2WFW A;  2I0Q A;  3GTG B;  4H44 C;  4YCU A;  2CKZ B;  2BA0 A;  1X3F A;  1GM5 A;  1B44 D;  1DOM A;  3W5O A;  1IBL L;  4OIJ A;  1TY2 A;  1BBU A;  1FR3 A;  4FF1 A;  3T4A C;  1SNM A;  3OWF A;  2EZV A;  3CAM A;  5ELO A;  2EY6 A;  3A55 A;  1LAC A;  3SK6 A;  3S1Q H;  3HOU B;  2F3V A;  1B4O A;  1SMX A;  3MA2 B;  4OX9 Q;  2KCM A;  4J6H A;  2IT1 A;  2KCT A;  2SNM A;  1VQE A;  4YCV A;  4OX9 L;  2F0N A;  4JI3 L;  1NR4 A;  3A8K E;  1HCZ A;  4U67 3;  3S1N B;  5L37 A;  2KJX A;  3CU7 A;  1LUZ A;  4HJ9 A;  2CCZ A;  3L9A X;  2A74 C;  2CFM A;  2L11 A;  1TQO A;  1EWH A;  4O2D A;  3M4O B;  1I94 Q;  3M9B A;  4XQQ A;  1U4R A;  3TSS A;  5KNC A;  3PIO 3;  3K7A H;  3C3L A;  3RMH A;  4QUC A;  4EVO A;  1O80 A;  3KJP A;  1JWS D;  3PV0 A;  3SDZ A;  1H9K A;  2QDB A;  2F0L A;  2ZXR A;  2RSN A;  4C3H G;  1N32 L;  4BA2 I;  2OXP A;  1U0L A;  5JJI A;  5D65 A;  5IYD G;  4LF6 Q;  3C1F A;  4BBR B;  2MQH A;  4PV1 C;  1T5E A;  3TBI B;  4CHT B;  3DHQ A;  4I65 A;  5EAY A;  5FLX c;  5IP9 G;  5CR3 A;  1YJW A;  2E5L L;  1IW7 C;  2CWP A;  2FMC A;  1YJN A;  2XGT A;  2E5L Q;  3ITP A;  5C0X I;  1I3Q H;  1CZW A;  1NY4 A;  1PFM A;  1Y8N B;  4A3G H;  5K36 H;  1HQM C;  1KXL A;  1KLU D;  4GLA C;  5EKK A;  1Y1W B;  4NW2 A;  3PO2 G;  4ZYS A;  1SE2 A;  4IUT A;  4IPH A;  2F0I A;  3GTQ B;  3CPF A;  3H0G B;  1G6P A;  2MO1 A;  1ASY A;  2VS1 A;  5DNF A;  2Q8R E;  1O7Z A;  3A74 A;  4LFA Q;  3Q8D A;  3HOU H;  2ZTE A;  2A68 D;  4DPG A;  2NUC A;  3E9I A;  5EPL A;  4DV4 Q;  4DU9 A;  2EY1 A;  3NUC A;  3TN2 A;  1HUN A;  3KBG A;  2B2Y A;  4IJH A;  3OW2 A;  1ONL A;  2JE6 I;  4HID A;  3GTP B;  3F2B A;  4APV A;  4IZ8 A;  3OHX C;  1P8L A;  4DXF A;  3GV3 A;  1I50 B;  4IOA A;  4MHE A;  1HZA A;  2HIX A;  1TWG B;  2KQ3 A;  1PYS B;  1X3P A;  1CM9 A;  1SYD A;  5CYU A;  4DFA A;  4C3J H;  4CJ0 B;  3Q6S A;  5EPJ A;  2A6H C;  2GVB A;  4JK1 C;  3G7L A;  1EIY B;  4A3E H;  3JAM L;  3X3M A;  4BBS G;  2NVQ H;  2KBN A;  3D3R A;  5ELC A;  2JA7 G;  4L5S A;  1ENA A;  4HTH A;  1IXR A;  3D8G A;  1OXV A;  1RTO A;  2WB1 B;  2WAQ B;  1BCP D;  2PMZ B;  3KBX A;  2B2V A;  1MIU A;  1L1O B;  3NK9 A;  2V1C C;  3I4N G;  2GA4 B;  3I56 A;  4GOP C;  2K1B A;  3DXJ C;  1N36 L;  2JA7 B;  1TWG H;  5J1Z A;  3CCV A;  1GHK A;  3N52 A;  1EZ8 A;  3NBH B;  3E5S A;  4FF2 A;  4BY1 B;  2XRS D;  1JIC A;  3FRP B;  1B3A A;  2RBM A;  1TU2 B;  3KLR A;  4UAI A;  2JYO A;  5E1F A;  1B1Z A;  2EQS A;  3CME A;  2EXZ A;  1LTI D;  4WJ4 A;  3L7Z C;  4B3M L;  1QZH A;  1TS4 A;  1ZXT A;  1YEZ A;  1XYI A;  1VQD A;  2QEJ C;  3T51 B;  2A6H D;  1J8I A;  4RG1 A;  4WJ3 M;  1L0Y B;  2K50 A;  1GJX A;  3M3Y B;  3HKS A;  3FPU B;  2UUC L;  4B3S Q;  3SK5 A;  3MVV A;  1HNW L;  3KLS A;  2VB3 X;  2QKI C;  4JI8 Q;  4JI7 Q;  2EY5 A;  2A19 A;  1BCP C;  1PRT B;  2UUC Q;  4HED A;  4A3I B;  1PFB A;  2FIN B;  4JI6 L;  1IYJ B;  4IUP A;  3J81 j;  2KED A;  2PNR C;  3HKZ E;  4A76 A;  4AIM A;  2L4N A;  1AN8 A;  3J80 i;  4DAY A;  2JEB I;  3A5U A;  4K8J A;  4MTK A;  2MPM A;  3HOY G;  1X9N A;  1ZYR D;  1E24 A;  3RUZ A;  1G51 A;  5J22 A;  3MXN B;  3LX0 A;  4AQY Q;  1JB7 A;  1PH4 A;  2OQ0 A;  5C0X J;  5KYL A;  3URY A;  1WTH A;  3T1H Q;  1W3S A;  3VR2 A;  3IKJ A;  5IY0 A;  2QGQ A;  3IRB A;  3BZK A;  4V0B A;  4F8M A;  1NSN S;  2DJF C;  1F2M A;  2L55 A;  4NKL A;  3V05 A;  3T53 B;  2A68 C;  3C1E A;  1E1T A;  2BDN A;  3HS0 C;  1U4P A;  5JPM C;  4A3D B;  1C48 A;  4Y7N H;  5JVH 3;  1N9W A;  1Y8O B;  2AQ2 B;  3HKZ G;  4BY1 G;  4FXK C;  1TVX A;  3I2Z A;  1H9S A;  4P74 A;  4L5T A;  2L1B A;  4DV6 L;  2ICI A;  4XYO A;  3BVZ A;  2IX1 A;  2TMP A;  4DV6 Q;  1HNZ Q;  1KAB A;  1E22 A;  5F2D A;  1KDB A;  1L1O C;  2FHT A;  1H9M A;  2XVS A;  5M9O A;  2CQA A;  4A3L G;  3K57 A;  2JEA I;  1PYW D;  3E6Z X;  4ODG A;  4GLX A;  3H15 A;  1VCI A;  2IY5 B;  2D0P A;  2FFK B;  2JA6 B;  5ELD A;  2PQA A;  4KK7 A;  1R9T H;  1TKW B;  2R92 B;  4LFB Q;  1Y1V H;  4LF7 Q;  3CCQ A;  1A6X A;  1G2S A;  4DV5 Q;  4OGQ C;  2YU9 H;  3KLW A;  3GTL B;  2O5J C;  1MD2 D;  2Z6K A;  5GRO A;  4HIK A;  4FNF A;  3KF8 A;  1CI3 M;  4F87 A;  2NZ1 D;  2HD3 A;  5C5M A;  3Q0A A;  3IL8 A;  1XNQ L;  1ICF B;  5FLX L;  2Z6K C;  3MHB A;  1LLR D;  3QJY A;  1EOV A;  1QVG A;  4CGY B;  1G8Z D;  3M4P A;  2K7V A;  2ZT9 C;  3GTK B;  4K6D A;  1HNX L;  3A7A B;  1XTC D;  5C5L A;  3I3C A;  4H13 C;  2SDF A;  1VQM A;  1TR5 A;  3V96 A;  3JAM E;  1VQG A;  2OT2 A;  5IP7 H;  4ALP A;  2WAC A;  4BS9 A;  3A54 A;  1DCZ A;  1DM0 B;  2LSS A;  1HZ9 A;  4DR1 L;  1I5F A;  1PH2 A;  1GXD C;  4A3C H;  1I6V C;  2ICE C;  1RIP A;  2KHI A;  4KMU C;  3J81 c;  1W2B A;  4UY8 C;  5LMN W;  2B3G A;  1PV4 A;  2IW3 A;  1GUT A;  4BA1 I;  4IFD G;  4PZ7 A;  1K8G A;  2UUA L;  1LTT D;  2NYZ D;  3KK7 A;  4DV3 L;  4HIM A;  3PUW A;  3JC6 6;  1LTR D;  1SYC A;  2RA4 A;  2HHH L;  3VYT A;  1LM0 A;  1HQR D;  2XN9 C;  1B9N A;  1OXX K;  2BA1 A;  4L5R C;  5C6A A;  4B3T Q;  2DUD A;  4H0L C;  3AFQ A;  4BBR G;  4CDE C;  4K5V A;  5EBC A;  5ELN A;  4KHV A;  3ERO A;  5C4J H;  1WCM H;  1X56 A;  4DK3 C;  4UP8 A;  1UEA B;  2CW0 C;  1KRS A;  2QCP X;  3SGI A;  2K5D A;  1D2B A;  4OWT B;  4RKB A;  3HEJ A;  3ONA B;  1NBW A;  4B3R Q;  5C44 G;  5I9P A;  1ET9 A;  3PUX A;  2B2V C;  1UE6 A;  2B2W A;  1VF7 A;  1F77 A;  2EYL A;  3ERS X;  3A5Z B;  1M8A A;  1SYG A;  2UXC L;  3A8J E;  5NUC A;  3GV6 A;  1Z47 A;  1GUO A;  4QIW E;  4JBM A;  1U4L A;  1XMQ Q;  1Q82 C;  5KRU A;  3MFG A;  2F0P A;  4M8A A;  4UP9 A;  3RZD B;  4GN4 B;  2YTY A;  4Y7N B;  4RFB A;  5C4H A;  5CV4 A;  1HFG A;  3CRK C;  5GAE C;  2Y0S E;  4DAP A;  4HCS A;  2WAQ E;  2EYJ A;  2QEX A;  1QNU A;  2PMZ E;  2Q8T A;  5M3M G;  2RKS A;  1BOS A;  3BVG A;  4X65 L;  3MXP A;  1D5M C;  1B53 A;  4IOC A;  2B2Y C;  2AQ3 B;  1MSG A;  3NHH A;  3AU7 A;  4DAV A;  4DV0 Q;  1PA6 A;  3FP9 A;  2UUB L;  1HRJ A;  2K28 A;  3SVM A;  4K0K L;  3DM1 A;  2H1E A;  4C3I H;  5M5Y H;  3J81 L;  3FPP A;  4L6T B;  5FO7 B;  2N78 A;  1JOQ A;  3T16 A;  4CKE A;  3MC0 B;  2JA9 A;  4P2C B;  1BVS A;  4XXE A;  4DV4 L;  2ENB A;  2OF1 A;  1N34 L;  3H3V C;  2DN8 A;  3GTO B;  2IWH A;  4TRD A;  1PLF A;  3DWP A;  3L2P A;  4X6A H;  5IWA L;  1S40 A;  1N34 Q;  5E7N A;  1JJG A;  5IGB A;  1NCV A;  4A3F B;  4L5Q A;  3PO3 B;  4YWK A;  1SRO A;  2M00 A;  1KHI A;  2F4I A;  3TEH B;  4FP5 D;  2BDO A;  2JA5 B;  1SXT A;  3P7J A;  3HRZ C;  2JN4 A;  4C3I B;  4R8N A;  5M5Y B;  1HHV A;  2SNS A;  1K9M C;  3QR8 A;  3DWQ A;  1F9Q A;  4DV7 Q;  3K0Y A;  2O2L D;  1II3 A;  1VQ4 A;  2MO0 A;  5M5W H;  2R7Z H;  3SK4 A;  2KCN A;  1T5X D;  2PI2 A;  4LUV A;  2RHS B;  1VMC A;  3TP8 A;  3NE5 B;  4DKA C;  5M3F H;  4JV5 Q;  2K5Q A;  2PNH A;  2AWN A;  4LF8 L;  4DUZ L;  3RR5 A;  5CV7 A;  4XQN A;  1GUW A;  4FDB A;  1N36 Q;  4LF5 Q;  2M2L A;  1Q46 A;  3PO3 H;  1GKH A;  4N9T A;  3CMA A;  3S2H B;  4DV1 Q;  3N6R A;  1D7Q A;  1FVI A;  4JVZ A;  4QB4 A;  4UDU C;  2NN6 I;  1R4P B;  3BYT B;  2I5L X;  2QW7 A;  4O0A A;  1IBK L;  5EKI A;  2AHO B;  3I7F A;  1SFO B;  5DM6 3;  2DY8 A;  2GN5 A;  1X54 A;  3CW2 C;  2K52 A;  4A3M H;  5BN3 A;  2X6L A;  1VQP A;  1L2F A;  3HOV B;  2F0W A;  1C7Y A;  3HOW G;  3AFP A;  4ZRZ A;  4QJF A;  5IIF A;  3HOX G;  1LT3 D;  1Q7Y C;  1DZ1 A;  2QF7 A;  3D4R A;  2D9U A;  1CQF A;  1QNK A;  1Z6H A;  4IO9 A;  2F0O A;  1G91 A;  4A3E B;  1HH2 P;  2NWG A;  3F2U A;  3HOX H;  3G4S A;  3S2H H;  2QDL A;  5CMD A;  5JEA G;  3J80 c;  2EVB A;  3DEO A;  1HR0 L;  3E0E A;  1RJT A;  1LTB D;  2UU9 Q;  2HT1 A;  3QOJ A;  2Z8L A;  3EA6 A;  4RKL A;  1VMP A;  3S15 B;  4OHJ A;  1SN8 A;  3K5O A;  1EY7 A;  1B2T A;  4GOP A;  5E4W C;  3KDF A;  1BO0 A;  2NVY B;  1JCK B;  4Q5V A;  4BY1 H;  2L9H A;  5I6W A;  3RN5 A;  2MFI A;  4ZKB B;  3MEH A;  1SEB D;  2M9V A;  1QWY A;  1SE4 A;  2K5N A;  1ZYR C;  2VZA A;  4KD4 A;  3VA7 A;  3J7A F;  5DAU A;  2LFN A;  1GOZ A;  4J1M A;  3QIA A;  3GTP H;  1J9O A;  1YZ6 A;  2LKV A;  3T1Y Q;  1QCB D;  3BU2 A;  3K7U C;  3E3X A;  1EIF A;  2R92 H;  1YNN C;  5D3I B;  2OTL A;  4G7H C;  1SE3 A;  3HOY H;  1VQ9 A;  3VR4 A;  4CDD C;  1S5E D;  1JWU D;  4KJO A;  2RDF A;  4FF3 A;  1C8C A;  3H3V H;  2R7D A;  1WVL A;  1G29 1;  4DK0 A;  3CKI B;  4K5W A;  5JAV A;  3S17 B;  4IJL A;  1Y1W H;  2AWO A;  3VYS A;  2Q2H A;  5KGU A;  1STN A;  3AYH B;  4R4O A;  5I9O A;  3CCL A;  3GDE A;  3R2T A;  4GN3 B;  2K6A A;  1WYD A;  4QUF A;  3I4M B;  4DF7 A;  1UAP A;  3CRL C;  3CCU A;  1K0R A;  4N8X 1;  2LY7 A;  3GTJ B;  2K32 A;  3U50 C;  3MWY W;  4A3K H;  2H4O A;  4GLV B;  4IUN A;  1Z7T A;  1X3Q A;  1Q90 A;  1CHQ D;  4X66 L;  1XNR L;  3A7L A;  3H6M A;  1DGS A;  4RHS A;  5CV9 A;  5HY6 A;  1SMY C;  4G57 A;  3J7Y W;  4JPB W;  5IGD A;  4LF9 Q;  3NXW A;  5LMN Q;  1PMR A;  1XMO Q;  1QE6 A;  4HN7 A;  2BE5 D;  1V43 A;  5M3F B;  3PGZ A;  2E8G A;  1A2U A;  2KEE A;  1IHZ A;  3VR5 A;  1TS3 A;  4AH6 A;  4DN4 M;  2JA8 H;  2EXD A;  4N9P A;  3K7A B;  3M85 A;  4DR2 Q;  1LYL A;  2B63 G;  2WKD A;  5IGF A;  1K83 H;  3I4N B;  4DR2 L;  3ULL A;  2XSC A;  3NP8 A;  1NMG A;  5IYB H;  3FMC A;  1SSO A;  1Y8P B;  5IP7 G;  1K0S A;  4KD3 A;  4JOI C;  1G2T A;  2KEN A;  2IJ0 A;  1FJG Q;  1BUV T;  3CCR A;  1IL2 A;  5BN5 A;  1XJV A;  3EBE A;  1Q8I A;  2Q2I A;  2XTI A;  3IFD A;  4OXP A;  4ZUI A;  2CQO A;  1X3G A;  5C4X G;  5EGT A;  1R9T B;  1E2V A;  2F0Q A;  5ISR A;  3J81 E;  2O5I C;  2Y0S B;  1SFO H;  1N33 Q;  4OWX B;  2F0T A;  4PMB A;  1SNP A;  1VQN A;  1V8Q A;  3K5N A;  1CT1 D;  3GO5 A;  2NVX H;  3NWS A;  4RMF A;  3SHL A;  2EOT A;  1AH9 A;  3UDG A;  3S15 H;  5M3M B;  4KHP L;  2VB2 X;  3HOZ H;  2F0K A;  4DV3 Q;  4NXN L;  3KF8 B;  3RZD H;  1E2W A;  1N8R C;  4OO1 G;  3HOX B;  4KHP Q;  2E76 C;  3U4Z A;  4QL5 A;  3UE1 A;  4TKO B;  3CD6 A;  4XYQ A;  3U4V A;  4JI0 L;  2MP1 A;  2MHV A;  3K6O A;  5C3E H;  1OTC A;  1S5F D;  3CF5 A;  4QQB X;  2MNA A;  1WFQ A;  1YHB A;  5C3W A;  4AYB B;  4B3M Q;  1I94 L;  5G3L F;  1PHJ A;  1NAP A;  2F1M A;  5HGQ A;  4JG2 A;  4JI5 L;  5EPK A;  4DR7 L;  1EUJ A;  1KNA A;  4KN4 C;  5FO9 B;  1TWC H;  3WDN A;  1ICW A;  5IOD A;  2FJ2 A;  4DR4 Q;  2RCF A;  4JI7 L;  3QG1 A;  3LGJ A;  2E2I H;  1HR0 W;  2GVA A;  4B3S L;  2N49 A;  1SYE A;  3GQB A;  4C3H H;  1YBY A;  1FNV A;  2WKC A;  4R4T A;  1Y1W G;  2WV6 D;  4R9W A;  4GNX C;  2AUK A;  3ND9 A;  1E0B A;  1A63 A;  1TWA H;  2JQO A;  3X3N A;  3OIP A;  1PZK D;  1I4H A;  1RF2 D;  3S17 H;  5C0X G;  1W6K A;  2B39 A;  4A3D H;  1KTK A;  1VQJ A;  2X6G A;  3BVM A;  2EPB A;  2N3S A;  2F0H A;  1RL2 A;  3FKI G;  3CCS A;  1LT4 D;  3C2P A;  3OTO Q;  4IUU A;  1QOH A;  2RDG A;  3S1R H;  1PH6 A;  4RWS C;  5ELB A;  2IX3 A;  2ZXO A;  2B2U C;  2EDG A;  1M1K C;  4OEM B;  3KFU A;  4K14 A;  4XTC S;  3D6W A;  4JYA L;  1EU3 A;  1FNW A;  1Q86 C;  3Q24 A;  4ZCK A;  5IWA Q;  4LJZ C;  1JR0 D;  1JT8 A;  4A93 G;  5FLM G;  2PYK A;  1WD0 A;  2JA8 G;  4HMI A;  3R8B A;  1SNO A;  1E1O A;  4JI1 L;  1QVC A;  5I2X A;  4MNO A;  5IYB G;  4A3G G;  5KEE A;  1G6Z A;  1SAP A;  2F0F A;  1CKN B;  2UXB L;  5IYD H;  3DEP A;  1ZEQ X;  2J7Z A;  1EFI D;  4LFB L;  1WTO A;  2UXD L;  3CC7 A;  4OO1 H;  2XWB B;  2HCI A;  3CQZ H;  3S2D B;  3CCJ A;  2UXD Q;  4KKS A;  4DXG A;  4JW0 A;  1A15 A;  1GD7 A;  2B2T A;  2R7Z G;  4PZ8 A;  2D0O A;  1WTW A;  4AYB G;  4FXD A;  4O42 A;  1VS0 A;  4OL7 A;  4DV1 L;  4IQZ A;  3J7A 5;  3BDC A;  1GVP A;  3TP5 A;  3AEV A;  4JC0 A;  5M5W B;  2H5X A;  1J5E Q;  1OO9 B;  3RLN A;  3ER0 A;  4LF4 Q;  1SNQ A;  4OWW B;  1S3O A;  5CV8 A;  3HOU G;  1VQA A;  1STE A;  1B9M A;  2DNC A;  1CKN A;  4DR5 L;  3S14 B;  3NQI A;  2A69 C;  4ZLT F;  5BN4 A;  4JI2 Q;  1FD7 D;  3D6C A;  1D1K A;  4RAU C;  1STH A;  4C2M H;  1EYA A;  4JI2 L;  4PNY A;  3HG9 A;  1CKM A;  2PZW A;  5A2Q L;  3AB9 A;  1Z9F A;  4NMZ A;  1CA6 A;  1HTP A;  1BXT A;  3D4W A;  3M7G A;  3UE0 A;  1YIJ A;  2NZO A;  1NTG A;  2ZTC A;  1Q1B A;  1X3E A;  3F2D A;  4GKJ Q;  4GKK Q;  4KY5 A;  5EKL A;  3PUY A;  5JEA J;  4NXM Q;  4OON A;  4H7B A;  1A3T A;  5FKA C;  3K5M A;  4EQN A;  3CC4 A;  4R4I A;  1YNJ C;  1VQI A;  2PZU A;  4JI3 Q;  4RA8 A;  3I4O A;  2L15 A;  4V19 0;  4YHH Q;  2IHF A;  5IOC A;  2JA6 H;  2L5T A;  3H3V I;  3SEB A;  1EQV A;  4RGT A;  3FHW A;  4P71 A;  3J80 E;  1I3Q B;  1E7Z A;  4DR6 Q;  4A93 H;  4LNQ A;  2R7F A;  2OWO A;  2P5Z X;  4A3B B;  1X32 A;  3JAM i;  1BDO A;  2JA5 H;  1PFN A;  3PO2 B;  3PCO B;  2F0V A;  3TRE A;  3I91 A;  4TVA B;  5IE8 A;  2B8F A;  3MEF A;  1AEX A;  5I2Y A;  5EJW A;  1N32 Q;  1EL0 A;  3F8T A;  4CKC A;  2ZM6 L;  3HZX A;  1QVF A;  1PTO F;  4EGV A;  4X62 Q;  5AJ3 Q;  4JCV E;  4IFD H;  5D14 A;  1B7Y B;  1TS5 A;  2B63 H;  3GTL H;  5C44 H;  4HJA A;  1PTO H;  2PW5 A;  3SXH A;  2PW7 A;  1A3U A;  1EYD A;  4LF6 L;  1AE3 A;  3NPP A;  5C4X B;  2ZJQ A;  4DAY B;  1PZJ D;  2EYM A;  1PTO D;  3SR1 A;  1XNR Q;  1BQQ T;  4MTN A;  3NEL A;  4YY3 L;  3MXN A;  2K75 A;  2KHJ A;  1CUK A;  3K8A A;  1V1Q A;  3OOC A;  4WOR A;  4CDF C;  1VQO A;  3HFZ B;  4DV2 Q;  4PMC A;  2IPK D;  2F3W A;  1O78 A;  4QMG A;  2UUB Q;  2J4X A;  1SYF A;  3UDX A;  4K0K Q;  1X65 A;  1VQB A;  1CSP A;  2C5C A;  3A56 A;  3NQT A;  3EQL C;  4X3T A;  1OXT A;  5CC4 A;  1K3R A;  1VQ5 A;  2E75 C;  1PH7 A;  1EOT A;  3PO3 G;  4LFA L;  1TWH H;  2R93 H;  4IUV A;  4UPA A;  2ZJR A;  1SDF A;  3HGB A;  2RCN A;  4H02 A;  3IFT A;  3PUZ A;  4A3J B;  2R93 G;  3I4M H;  3TS2 A;  3SK8 A;  5C3X A;  1UUP A;  3PSI A;  1F9R A;  3EN2 A;  1EY8 A;  4DK1 A;  1LTA D;  2SOB A;  4XT1 B;  1IYV A;  1AW7 A;  4JI1 Q;  1V1P A;  2K33 A;  1FJG L;  4IUR A;  5IGC A;  2R3Z A;  5A2Q E;  4DR1 Q;  1T9H A;  5FJ8 G;  5TSS A;  2UXB Q;  4IPG A;  4ME3 A;  1U5K A;  4JV5 L;  4R4C A;  2BOS A;  2V4D A;  3MZ5 A;  4JBJ A;  3T13 A;  2F0D A;  1N33 L;  1SLJ A;  5KND A;  1EZ6 A;  2WP8 J;  3CHB D;  3CC2 A;  3KF6 A;  1CHP D;  4X3K A;  4DAM A;  4B3T L;  1WJJ A;  1C4Q A;  1Y1V G;  4A3M G;  1ML0 D;  5KYI A;  1KIX A;  1HZB A;  3KOJ A;  2CWA A;  4KJN A;  3W1G A;  3D31 A;  3NSW A;  5J39 A;  2CH4 A;  3K59 A;  1UEB A;  4HR7 B;  4WJW A;  2HDL A;  3DUZ A;  1I50 H;  1YNX A;  1K8A C;  2JA5 G;  3MAQ A;  1YIT A;  1FGU A;  1AZP A;  3RZO B;  1LV9 A;  1J6Q A;  5JOB A;  5JEA H;  1QZG A;  1H9J A;  3D0F A;  1HPC A;  3LWE A;  5KIX A;  2VQF L;  5JJL A;  1WTR A;  1SYB A;  2JK8 A;  4X3U A;  3VDY A;  3G6E A;  1LTL A;  1OXU A;  1SE8 A;  2JA6 G;  2R92 G;  2E74 C;  2HDM A;  2I07 B;  3CXC A;  1KAW A;  2UU9 L;  3GP7 A;  1KAA A;  2HUG A;  2WAQ G;  4CJ1 B;  2IL8 A;  2A8V A;  3S1M H;  3UI2 A;  2AMC B;  1CKO A;  3S1N H;  1DON A;  3VYU A;  2EJG C;  4PQX A;  2EYP A;  4B08 A;  1PTO C;  3E9H A;  1ESR A;  2B2T C;  1RKN A;  3HOY B;  1V9P A;  3RNU A;  3M4O H;  2ZJP A;  3WWV A;  1WTV A;  1IKM A;  3B6Y A;  3HOV G;  1C9O A;  1D5X C;  2DGY A;  3PMF A;  5E3F A;  5M5X B;  3HOW B;  1UE5 A;  1PVO A;  4K6L A;  4QGU A;  1D6E C;  1STY A;  5E4X A;  2RQX A;  4AQY L;  3NBH A;  5LHY 1;  5COR A;  1VF5 C;  2PO4 A;  2VUM G;  1S5C D;  2K01 A;  2Z1C A;  4BY7 H;  1NJI C;  1H95 A;  4PMW A;  3T1H L;  4F7X A;  3GTJ H;  1AE2 A;  4ABN A;  2R61 A;  3PQI A;  4A3D G;  2LXJ A;  2NVY H;  1Q81 C;  1STB A;  1SMY D;  4HSV A;  5J3B A;  4MZ9 A;  2KHS A;  3ULP A;  2A5H A;  3AMU A;  1A3V A;  1YI2 A;  2E2H H;  1F9P A;  1WI5 A;  2K5H A;  3K0X A;  3UDF A;  2N55 A;  3VR3 A;  4KI0 A;  3U9O A;  2PCF B;  3K5L A;  4X62 L;  5AJ3 L;  3Q22 A;  3RD4 A;  3TRZ A;  4BBS H;  1VQH A;  3KYH C;  1JC7 A;  2BE5 C;  1F2L A;  4OEL B;  1H9R A;  2VL6 A;  4MN3 A;  2AKW B;  5C0X H;  2KCC A;  2E2D C;  1E2Z A;  1DJR D;  1GUS A;  2ALY B;  4TQU S;  1UE1 A;  2N88 A;  3NEM A;  4GOP B;  3PF5 A;  2WB1 E;  4DNT B;  4K2K A;  2D2C C;  1JE5 A;  4KLK A;  2I5M X;  1TS2 A;  4R4Q A;  3PF4 A;  2NBF A;  1EU4 A;  3FEW X;  2F03 A;  3H94 A;  4E6I A;  4YIJ A;  3JAM c;  2ES2 A;  1QB5 D;  4EQO A;  1K73 C;  1KNE A;  5G3L D;  4POF A;  1O7L A;  3ICE A;  1Q3L A;  2EIF A;  4FO2 A;  4ZQ3 A;  1EIG A;  1PRT D;  2DJG C;  1JE4 A;  1SR3 A;  1Y69 U;  2RVL A;  1HXY D;  2D62 A;  1MJE A;  3M7N A;  1NR2 A;  1OXS C;  2Z0S A;  1UNS A;  1PYB A;  4LK1 C;  2Q2T A;  2F0G A;  1KLG D;  2R7Z B;  4KY6 A;  1I4P A;  2Z9H A;  1IL8 A;  5CV6 A;  1HNX Q;  1GUG A;  3GD7 A;  4PG3 A;  2EE1 A;  3MXG A;  4DA2 A;  4GN5 A;  3TZD A;  2CW0 D;  2ZXP A;  4KTA A;  4IUQ A;  2NTS A;  3I55 A;  2J0T D;  4KY7 A;  4ZK9 B;  2F0S A;  1SRU A;  3RN2 A;  5JPN C;  2K5W A;  5COY A;  3TDQ A;  2F3I A;  3DM3 A;  1EY0 A;  3CCE A;  3CCM A;  1I6H H;  1IBL Q;  1BKB A;  1Y14 B;  3I4N H;  3RZO H;  1F2Z A;  2EJM A;  2F0U A;  4GKJ L;  1K8O A;  1QG7 A;  3VR6 A;  4M1U B;  1PTO B;  2XIW A;  4G7Z C;  1B3Q A;  5D3D A;  4CDC C;  1NUC A;  4HIO A;  3MFY A;  2MUY A;  5IT9 L;  4BY7 G;  4A75 A;  3L0O A;  1WCM G;  4XIG S;  5AFW A;  3A0J A;  1WTX A;  1S5B D;  1YHA A;  3S14 H;  3BZC A;  5M5X H;  1WD1 A;  1A62 A;  1I4X A;  2R6G A;  1IZ6 A;  4ZAI A;  1A2T A;  3HOZ G;  5JJZ A;  4A3G B;  3H0G G;  1KQS A;  1SJH D;  3K81 C;  4DR6 L;  1B50 A;  3TP6 A;  4BXX G;  4Z9C B;  2ID0 A;  2K5V A;  4B3R L;  1WTP A;  3H0G H;  3W3A A;  1K8M A;  4XQJ A;  5FO8 B;  4NDX A;  2VQF Q;  1D5Z C;  4IAL A;  3ZJY C;  2A73 B;  4JI5 Q;  5FOB B;  1JWM D;  2JJQ A;  1V1P B;  1WTQ A;  1EYG A;  1M90 C;  4RH6 A;  3S16 B;  4HAE A;  5IT9 c;  1KDA A;  1TXY A;  4EQ5 A;  2NZH A;  3D4D A;  3CP0 A;  3R93 A;  5IGE A;  2VQE Q;  1D8L A;  4A4I A;  1HFN A;  4P73 A;  2VW9 A;  1STG A;  1VQ7 A;  3STB D;  2E2J H;  2XWJ B;  1UWV A;  1EY6 A;  2F4V Q;  3Q23 A;  4JI6 Q;  5FK9 C;  4X66 Q;  4K8I A;  3PO2 H;  2KVM A;  1K83 B;  5C4J B;  1H9S B;  4U68 A;  5BR8 Q;  1JOO A;  5C3E B;  3AQQ A;  1KC8 C;  5DLQ E;  2Q8I B;  1JOK A;  5BR8 L;  1EQR A;  5GAD C;  3W1B A;  1SJE D;  4DR3 Q;  4DV0 L;  3L3O C;  4LUO A;  3M3Y H;  2I5H A;  4S3S A;  5CBE E;  3TME A;  3OTO L;  2SEB D;  4C3I G;  1IBM L;  1Q1E A;  3I4L A;  4DV2 L;  3GTM B;  1M4V A;  1MGS A;  2JSO A;  2K14 A;  2C35 B;  3KF6 B;  2NVX B;  2Z4I A;  2Q2U A;  4C3H B;  5FLM H;  1RCV D;  5IT9 E;  2ATW A;  4X3S A;  3TS0 A;  2EYO A;  2NVQ B;  4FYD A;  1I4R A;  2IX0 A;  4AYB E;  2TSS A;  1IYU A;  3CQZ B;  1HA5 A;  4DUY L;  1CTM A;  1EY5 A;  1O7I A;  1YJ9 A;  2CH4 W;  2KA7 A;  2VY3 A;  3LNN A;  4C3J G;  2OQK A;  2ASB A;  5C4Z A;  4A3I H;  1R4Q B;  4X64 Q;  1QIL A;  3KJO A;  4ME5 A;  3G6J B;  1JJC B;  2FMM A;  2BH2 A;  1EIH A;  4A3I G;  2EYF A;  3FKI B;  4B9X A;  5HUR A;  1ROD A;  1SBB B;  3OWE B;  4K5X A;  3BJU A;  4JI4 L;  2PPB C;  4QY7 A;  3DWA A;  2A6E D;  3HKZ B;  2KUM A;  1KRT A;  1O7Y A;  3VA5 A;  4HJ8 A;  3OIQ A;  2IHE A;  3H09 A;  4KV6 A;  3S1M B;  5I6Y A;  1XPR A;  2E2I B;  1ENC A;  4HMJ A;  4NB3 A;  1ENF A;  2DY7 A;  2AUJ D;  2B2W C;  4LF7 L;  4BBR H;  1TT2 A;  3ERQ A;  5FLX E;  2E2J B;  4R1J A;  1AP0 A;  2K4K A;  4OO1 I;  1KL9 A;  1TWC B;  3I8Z A;  2Y0S G;  2HQE A;  4JI0 Q;  3GTO H;  3S1Q B;  4K2L A;  1EFW A;  1XNQ Q;  2NVT B;  1IBK Q;  3OYY A;  4LMQ D;  3I72 A;  3QWN A;  4DR5 Q;  4B9W A;  1GHJ A;  3PIP 3;  1JOR A;  4LF4 L;  2G5D A;  1I4Q A;  3S2D H;  5I4D A;  4DR7 Q;  1LO5 D;  4LAA A;  1FGB D;  4XT3 B;  5CV5 A;  5CBA E;  1CA5 A;  3V2T A;  4MIU A;  3C46 A;  1XX8 A;  1HUM A;  1D1I A;  4G7O C;  2F0J A;  3K58 A;  1QUQ A;  4DNR B;  4QIW B;  1HR0 Q;  1PH5 A;  1PFS A;  2WII B;  3T56 B;  1BF4 A;  3MTS A;  2JA7 H;  3KUP A;  1LAB A;  1XTD A;  2HIV A;  4HJ5 A;  1L0W A;  1SNC A;  3NBI A;  1MI2 A;  1GO3 E;  5IGG A;  2F0E A;  1RHP A;  3U9S A;  3J7A V;  2MJ8 A;  4IPD A;  1LTG D;  1X55 A;  2CVR A;  1C0A A;  4EX5 A;  4GKK L;  1PH9 A;  4GS3 A;  4IFD I;  4NXM L;  3QOL A;  2A69 D;  2YTV A;  3QB3 A;  4FVM A;  2K04 A;  1SND A;  3K80 C;  5DEH A;  2UUA Q;  5EQ0 A;  3F2C A;  2D5D A;  2L12 A;  3NWT A;  2HHH Q;  2JP1 A;  1BCP B;  1PRT C;  4A3B G;  5ELF A;  4GNX A;  3S16 H;  3J80 L;  4A3J H;  1DYQ A;  3EVQ A;  1ILQ A;  4YHH L;  3GTK H;  3G48 A;  3OMG A;  1QUQ B;  1W6J A;  2RF4 A;  4ZKC B; 
#chains in the Genus database with same CATH homology
 1QJO A;  1YNN D;  1DXM A;  4KKU A;  2JXM B;  1DOK A;  4FF4 A;  2JA8 B;  1BNZ A;  3R2I A;  5DM7 3;  4HSP A;  1U9R A;  3BS1 A;  4BWG B;  4C1N K;  1VDZ A;  3O13 A;  4EQP A;  1ILP A;  1ZKO A;  1FNU A;  1PDQ A;  4WRD A;  4RCN A;  2VUM B;  4CBV A;  2LMC B;  3SE0 A;  2O4X A;  2EYH A;  3W2D A;  3NTI A;  4BY7 B;  1CQV A;  2VXW A;  1EWC A;  4GZY C;  4L8J A;  3I70 A;  4ID6 A;  4IFD J;  3BZD B;  1EYC A;  3OSO A;  3E0J A;  1KDC A;  1Q12 A;  1EEF D;  3NTH A;  1STA A;  4OIK A;  1BR9 A;  4F88 A;  5T1G A;  4RHR A;  5LL6 S;  3HOZ B;  4ZUJ A;  2RSO A;  1FYC A;  1CK1 A;  1MSH A;  4QF4 A;  3VYR A;  5ELE A;  2EJF C;  3FDT A;  5KNB A;  1L0X B;  4A3K B;  2YU9 B;  1DD2 A;  3S9W A;  4C1N I;  1I4G A;  1XWE A;  2L0C A;  4RGN A;  3BDL A;  3EFX D;  2XNA C;  3A8I E;  1EY4 A;  1GUN A;  1AFP A;  2XRQ D;  5K36 G;  3WOF A;  2G9H D;  2KEC A;  4QCL A;  4KHZ A;  1XXG A;  5C44 B;  1EEI D;  2C9O A;  3I73 A;  1JB3 A;  1F9S A;  3IAY A;  2F0M A;  2B8G A;  2I46 A;  4C2M B;  2NN6 G;  3BYY B;  1S4Z A;  1RTN A;  2MGS A;  2PQE A;  2E2H B;  1JQY D;  1EY9 A;  4C56 C;  1S5D D;  1PRT F;  4RGM A;  3ND8 A;  4FXG C;  4CKB A;  1IKL A;  4C3J B;  3I90 A;  2EY2 A;  2LS0 1;  1U4M A;  2Z4H A;  2KOL A;  2QIL A;  2R93 B;  1ESF A;  3TZU A;  4WFN 3;  2VNU D;  2WIN B;  4DGZ A;  5HGT A;  3H91 A;  1EQT A;  1LT6 D;  3P1H A;  4ILW A;  1V1O A;  1WCM B;  2BCO A;  1TWH B;  4A93 B;  4NP5 A;  1TII D;  4HCE A;  5EBD A;  2B63 B;  1TWF B;  1MBY A;  1AZQ A;  4RCO A;  1DOL A;  1Y1V B;  3TP7 A;  3QO2 A;  2DNE A;  1BBX C;  5T1I A;  2NTT A;  4TSS A;  5A35 A;  1HTL D;  2NB0 A;  3BDO A;  2PZT A;  5CGK A;  5JVG 3;  4I7Z C;  3LWU A;  4Q0F A;  2HCC A;  3NTK A;  1PZI D;  4G4K A;  3P20 A;  4KN7 C;  2B2U A;  4O1N A;  1TY0 A;  1RD9 D;  1YNJ D;  1TWA B;  3OW7 A;  3M4Y A;  3FVQ A;  3R3O A;  5LL6 X;  1CZG A;  3BG3 A;  3P75 A;  4XDX A;  4A3M B;  4KKT A;  1ET6 A;  2K05 A;  2OEO A;  2YYZ A;  1IW7 D;  3S1R B;  2X69 A;  1HA6 A;  3RLF A;  2AQ1 B;  2K03 A;  1LTS D;  3PUV A;  4ULL A;  1F2Y A;  4BBS B;  3KLS X;  3DMU A;  3EJI A;  4RGO S;  4L63 B;  1I6H B;  1RDP D;  2A6E C;  5K5P A;  1LT5 D;  4JBW A;  3MXU A;  2NN6 H;  3ZYY X;  3OPO A;  2CHB D;  1BCP F;  4R8I A;  1PXU A;  4IN3 A;  3WOE A;  1CFM A;  4J8Q A;  2RDH A;  3HP3 A;  4CJ2 C;  2G9D A;  3OMC A;  3GTG B;  4H44 C;  2BA0 A;  1B44 D;  1DOM A;  4OIJ A;  1TY2 A;  1FR3 A;  4FF1 A;  3T4A C;  1SNM A;  3OWF A;  2EZV A;  2EY6 A;  3A55 A;  1LAC A;  3SK6 A;  3HOU B;  2F3V A;  1B4O A;  3MA2 B;  4J6H A;  2IT1 A;  2SNM A;  2F0N A;  1NR4 A;  3A8K E;  1HCZ A;  4U67 3;  3S1N B;  2KJX A;  3CU7 A;  3L9A X;  2A74 C;  2L11 A;  1TQO A;  1EWH A;  3M4O B;  4XQQ A;  1U4R A;  3TSS A;  5KNC A;  3PIO 3;  3C3L A;  3RMH A;  4QUC A;  4EVO A;  1O80 A;  1JWS D;  3PV0 A;  3SDZ A;  1H9K A;  2QDB A;  2F0L A;  2ZXR A;  2RSN A;  4C3H G;  4BA2 I;  2OXP A;  5D65 A;  3C1F A;  4BBR B;  4PV1 C;  1T5E A;  3TBI B;  4CHT B;  3DHQ A;  4I65 A;  5CR3 A;  1IW7 C;  2FMC A;  3ITP A;  5C0X I;  1CZW A;  1PFM A;  1Y8N B;  5K36 H;  1HQM C;  1KLU D;  5EKK A;  1Y1W B;  4NW2 A;  4ZYS A;  1SE2 A;  4IUT A;  2F0I A;  3GTQ B;  3H0G B;  5DNF A;  2Q8R E;  1O7Z A;  2A68 D;  2NUC A;  5EPL A;  4DU9 A;  2EY1 A;  3NUC A;  3TN2 A;  1HUN A;  3KBG A;  2B2Y A;  1ONL A;  2JE6 I;  3GTP B;  4IZ8 A;  3OHX C;  4DXF A;  3GV3 A;  1I50 B;  4MHE A;  1TWG B;  2KQ3 A;  1X3P A;  1CM9 A;  1SYD A;  5CYU A;  4DFA A;  4CJ0 B;  3Q6S A;  5EPJ A;  2A6H C;  4JK1 C;  3G7L A;  3JAM L;  3X3M A;  3D3R A;  5ELC A;  1ENA A;  4HTH A;  3D8G A;  1OXV A;  1RTO A;  2WB1 B;  2WAQ B;  1BCP D;  2PMZ B;  3KBX A;  2B2V A;  3NK9 A;  2GA4 B;  2K1B A;  3DXJ C;  2JA7 B;  5J1Z A;  1GHK A;  3N52 A;  1EZ8 A;  3E5S A;  4FF2 A;  4BY1 B;  2XRS D;  1JIC A;  3FRP B;  1B3A A;  2RBM A;  1TU2 B;  3KLR A;  4UAI A;  2JYO A;  5E1F A;  1B1Z A;  2EXZ A;  1LTI D;  3L7Z C;  1TS4 A;  1ZXT A;  1XYI A;  2QEJ C;  3T51 B;  2A6H D;  1J8I A;  1L0Y B;  1GJX A;  3M3Y B;  3FPU B;  3SK5 A;  3MVV A;  3KLS A;  2VB3 X;  2QKI C;  2EY5 A;  1BCP C;  1PRT B;  4HED A;  4A3I B;  1PFB A;  2FIN B;  4IUP A;  2KED A;  2PNR C;  2L4N A;  1AN8 A;  4DAY A;  2JEB I;  4K8J A;  2MPM A;  1ZYR D;  3RUZ A;  5J22 A;  3LX0 A;  5C0X J;  5KYL A;  3URY A;  3VR2 A;  3IKJ A;  4V0B A;  4F8M A;  1NSN S;  1F2M A;  2L55 A;  4NKL A;  3V05 A;  3T53 B;  2A68 C;  3C1E A;  2BDN A;  3HS0 C;  1U4P A;  5JPM C;  4A3D B;  1C48 A;  5JVH 3;  1Y8O B;  2AQ2 B;  4FXK C;  1TVX A;  1H9S A;  2L1B A;  2ICI A;  4XYO A;  3BVZ A;  2IX1 A;  2TMP A;  1KAB A;  5F2D A;  1KDB A;  2FHT A;  1H9M A;  2XVS A;  5M9O A;  2CQA A;  3K57 A;  2JEA I;  1PYW D;  3E6Z X;  4ODG A;  1VCI A;  2FFK B;  2JA6 B;  5ELD A;  4KK7 A;  1TKW B;  2R92 B;  1A6X A;  1G2S A;  4OGQ C;  3GTL B;  2O5J C;  1MD2 D;  3KF8 A;  4FNF A;  1CI3 M;  4F87 A;  2NZ1 D;  5C5M A;  3Q0A A;  3IL8 A;  5FLX L;  3MHB A;  1LLR D;  3QJY A;  4CGY B;  1G8Z D;  2K7V A;  2ZT9 C;  3GTK B;  4K6D A;  3A7A B;  1XTC D;  5C5L A;  3I3C A;  4H13 C;  2SDF A;  1TR5 A;  3V96 A;  3JAM E;  2OT2 A;  2WAC A;  4BS9 A;  3A54 A;  1DCZ A;  1DM0 B;  1GXD C;  1I6V C;  2ICE C;  4KMU C;  2IW3 A;  1GUT A;  4BA1 I;  4IFD G;  1LTT D;  2NYZ D;  3KK7 A;  3PUW A;  1LTR D;  1SYC A;  2RA4 A;  3VYT A;  1HQR D;  2XN9 C;  1B9N A;  1OXX K;  2BA1 A;  5C6A A;  4H0L C;  4K5V A;  5EBC A;  4KHV A;  3ERO A;  1UEA B;  2CW0 C;  2QCP X;  2K5D A;  1D2B A;  4RKB A;  3HEJ A;  3ONA B;  5I9P A;  1ET9 A;  3PUX A;  2B2V C;  2B2W A;  1VF7 A;  1F77 A;  2EYL A;  1M8A A;  1SYG A;  3A8J E;  5NUC A;  3GV6 A;  1Z47 A;  1GUO A;  1U4L A;  5KRU A;  3MFG A;  2F0P A;  4M8A A;  3RZD B;  4Y7N B;  4RFB A;  5C4H A;  5CV4 A;  1HFG A;  3CRK C;  4DAP A;  4HCS A;  2EYJ A;  1QNU A;  2Q8T A;  2RKS A;  1BOS A;  3BVG A;  3MXP A;  1D5M C;  1B53 A;  2B2Y C;  2AQ3 B;  1MSG A;  3NHH A;  3AU7 A;  4DAV A;  1HRJ A;  2K28 A;  3SVM A;  3DM1 A;  2H1E A;  3J81 L;  3FPP A;  4L6T B;  5FO7 B;  1JOQ A;  3T16 A;  4CKE A;  3MC0 B;  4P2C B;  4XXE A;  2ENB A;  2OF1 A;  3H3V C;  2DN8 A;  3GTO B;  2IWH A;  4TRD A;  1PLF A;  3DWP A;  5IGB A;  1NCV A;  4A3F B;  3PO3 B;  2M00 A;  2F4I A;  4FP5 D;  2BDO A;  2JA5 B;  1SXT A;  3P7J A;  3HRZ C;  4C3I B;  4R8N A;  5M5Y B;  1HHV A;  2SNS A;  3DWQ A;  1F9Q A;  3K0Y A;  2O2L D;  1II3 A;  3SK4 A;  2KCN A;  1T5X D;  1K8O A;  1VMC A;  3TP8 A;  3NE5 B;  2K5Q A;  2AWN A;  5CV7 A;  4XQN A;  1GUW A;  2M2L A;  4N9T A;  3S2H B;  3N6R A;  4QB4 A;  4UDU C;  2NN6 I;  1R4P B;  3BYT B;  5EKI A;  1SFO B;  5DM6 3;  2DY8 A;  5BN3 A;  2X6L A;  3HOV B;  2F0W A;  5IIF A;  4ZRZ A;  1LT3 D;  1DZ1 A;  2QF7 A;  3D4R A;  2D9U A;  1CQF A;  1QNK A;  1Z6H A;  2F0O A;  1G91 A;  4A3E B;  2NWG A;  3F2U A;  5CMD A;  5JEA G;  2EVB A;  3DEO A;  1RJT A;  1LTB D;  3QOJ A;  2Z8L A;  3EA6 A;  4RKL A;  1VMP A;  3S15 B;  4OHJ A;  3K5O A;  1EY7 A;  1B2T A;  5E4W C;  1BO0 A;  4Q5V A;  1JCK B;  2NVY B;  2L9H A;  5I6W A;  4ZKB B;  3MEH A;  1SEB D;  2M9V A;  1QWY A;  1SE4 A;  1ZYR C;  4KD4 A;  3VA7 A;  3J7A F;  5DAU A;  2LFN A;  1GOZ A;  4J1M A;  3QIA A;  1J9O A;  2LKV A;  1QCB D;  1YNN C;  5D3I B;  4G7H C;  1SE3 A;  3VR4 A;  1S5E D;  1JWU D;  4KJO A;  2RDF A;  4FF3 A;  1C8C A;  1WVL A;  1G29 1;  4DK0 A;  3CKI B;  4K5W A;  5JAV A;  3S17 B;  2AWO A;  3VYS A;  5KGU A;  1STN A;  5I9O A;  3R2T A;  2K6A A;  4QUF A;  3I4M B;  4DF7 A;  1UAP A;  3CRL C;  2LY7 A;  3GTJ B;  2K32 A;  3MWY W;  2H4O A;  4IUN A;  1Z7T A;  1X3Q A;  1Q90 A;  1CHQ D;  3A7L A;  3H6M A;  4RHS A;  5CV9 A;  1SMY C;  4G57 A;  3J7Y W;  5IGD A;  3NXW A;  1PMR A;  1QE6 A;  4HN7 A;  2BE5 D;  1V43 A;  5M3F B;  1A2U A;  2KEE A;  1IHZ A;  3VR5 A;  1TS3 A;  4DN4 M;  4N9P A;  3K7A B;  3M85 A;  2WKD A;  5IGF A;  3I4N B;  2XSC A;  3NP8 A;  3FMC A;  1SSO A;  1Y8P B;  4KD3 A;  1G2T A;  2IJ0 A;  1BUV T;  5BN5 A;  1Q8I A;  3IFD A;  4ZUI A;  5EGT A;  1R9T B;  1E2V A;  2F0Q A;  5ISR A;  3J81 E;  2O5I C;  2Y0S B;  2F0T A;  4PMB A;  1SNP A;  1V8Q A;  3K5N A;  1CT1 D;  3GO5 A;  3NWS A;  3SHL A;  2EOT A;  5M3M B;  2VB2 X;  2F0K A;  1E2W A;  4OO1 G;  3HOX B;  2E76 C;  4TKO B;  4XYQ A;  2MP1 A;  2MHV A;  3K6O A;  1S5F D;  5C3W A;  4AYB B;  5G3L F;  1NAP A;  2F1M A;  5EPK A;  1KNA A;  4KN4 C;  5FO9 B;  3WDN A;  1ICW A;  5IOD A;  2FJ2 A;  3QG1 A;  1SYE A;  3GQB A;  1FNV A;  2WKC A;  2WV6 D;  4R9W A;  2AUK A;  3ND9 A;  1E0B A;  3X3N A;  3OIP A;  1PZK D;  1I4H A;  1RF2 D;  5C0X G;  1W6K A;  2B39 A;  1KTK A;  2X6G A;  3BVM A;  2EPB A;  2F0H A;  1LT4 D;  3C2P A;  4IUU A;  1QOH A;  2RDG A;  4RWS C;  5ELB A;  2IX3 A;  2ZXO A;  2B2U C;  2EDG A;  4K14 A;  4XTC S;  3D6W A;  1EU3 A;  1FNW A;  3Q24 A;  4LJZ C;  1JR0 D;  2PYK A;  1WD0 A;  4HMI A;  3R8B A;  1SNO A;  5I2X A;  5KEE A;  1G6Z A;  1SAP A;  2F0F A;  3DEP A;  1ZEQ X;  2J7Z A;  1EFI D;  1WTO A;  4OO1 H;  2XWB B;  2HCI A;  3S2D B;  4KKS A;  4DXG A;  1A15 A;  2B2T A;  1WTW A;  4FXD A;  4O42 A;  4OL7 A;  4IQZ A;  3BDC A;  3TP5 A;  5M5W B;  1OO9 B;  1SNQ A;  5CV8 A;  1STE A;  1B9M A;  2DNC A;  3S14 B;  3NQI A;  2A69 C;  4ZLT F;  5BN4 A;  1FD7 D;  3D6C A;  1D1K A;  4RAU C;  1STH A;  1EYA A;  4PNY A;  3HG9 A;  2PZW A;  5A2Q L;  3AB9 A;  4NMZ A;  1CA6 A;  1HTP A;  1BXT A;  3D4W A;  3M7G A;  1Q1B A;  4KY5 A;  5EKL A;  3PUY A;  5JEA J;  4H7B A;  1A3T A;  5FKA C;  3K5M A;  4EQN A;  1YNJ C;  2PZU A;  4RA8 A;  4V19 0;  5IOC A;  2L5T A;  3SEB A;  1EQV A;  4RGT A;  3J80 E;  1I3Q B;  4A3B B;  1X32 A;  1BDO A;  1PFN A;  3PO2 B;  2F0V A;  3I91 A;  2B8F A;  1AEX A;  5I2Y A;  5EJW A;  1EL0 A;  4CKC A;  3HZX A;  1PTO F;  4EGV A;  4IFD H;  5D14 A;  1TS5 A;  1PTO H;  2PW5 A;  3SXH A;  2PW7 A;  1A3U A;  1EYD A;  3NPP A;  5C4X B;  1PZJ D;  2EYM A;  1PTO D;  3SR1 A;  1BQQ T;  3MXN A;  3OOC A;  4WOR A;  4PMC A;  2IPK D;  2F3W A;  1O78 A;  4QMG A;  2J4X A;  1SYF A;  2C5C A;  3A56 A;  3NQT A;  3EQL C;  4X3T A;  1OXT A;  5CC4 A;  2E75 C;  1EOT A;  4IUV A;  1SDF A;  3HGB A;  3IFT A;  3PUZ A;  4A3J B;  3SK8 A;  5C3X A;  1UUP A;  1F9R A;  1EY8 A;  4DK1 A;  1LTA D;  2SOB A;  4XT1 B;  1IYV A;  1AW7 A;  1V1P A;  2K33 A;  4IUR A;  5IGC A;  2R3Z A;  5A2Q E;  5TSS A;  2BOS A;  2V4D A;  3MZ5 A;  3T13 A;  2F0D A;  5KND A;  1EZ6 A;  2WP8 J;  3CHB D;  1CHP D;  4X3K A;  1C4Q A;  1ML0 D;  5KYI A;  4KJN A;  3D31 A;  3NSW A;  5J39 A;  3K59 A;  4HR7 B;  4WJW A;  2HDL A;  3DUZ A;  3MAQ A;  1AZP A;  3RZO B;  1LV9 A;  5JOB A;  5JEA H;  1H9J A;  3LWE A;  1HPC A;  5KIX A;  1WTR A;  1SYB A;  4X3U A;  1OXU A;  2E74 C;  2HDM A;  2I07 B;  3GP7 A;  1KAA A;  2HUG A;  4CJ1 B;  2IL8 A;  3UI2 A;  1DON A;  3VYU A;  2EJG C;  4PQX A;  2EYP A;  4B08 A;  1PTO C;  1ESR A;  2B2T C;  1RKN A;  3HOY B;  1WTV A;  1IKM A;  1D5X C;  3PMF A;  5M5X B;  5E3F A;  3HOW B;  4K6L A;  1D6E C;  1STY A;  5E4X A;  2RQX A;  3NBH A;  5LHY 1;  5COR A;  1VF5 C;  2PO4 A;  1S5C D;  2K01 A;  2Z1C A;  4PMW A;  4F7X A;  4ABN A;  2R61 A;  1STB A;  1SMY D;  4HSV A;  2KHS A;  2A5H A;  3AMU A;  1A3V A;  1F9P A;  2N55 A;  3VR3 A;  4KI0 A;  3U9O A;  2PCF B;  3K5L A;  3Q22 A;  3RD4 A;  1JC7 A;  2BE5 C;  1F2L A;  1H9R A;  4MN3 A;  5C0X H;  2KCC A;  2E2D C;  1E2Z A;  1DJR D;  1GUS A;  4TQU S;  2N88 A;  4DNT B;  4K2K A;  2D2C C;  1TS2 A;  2NBF A;  1EU4 A;  3FEW X;  2F03 A;  3H94 A;  4E6I A;  4YIJ A;  1QB5 D;  4EQO A;  1KNE A;  5G3L D;  1O7L A;  1Q3L A;  4FO2 A;  4ZQ3 A;  1EIG A;  1PRT D;  1JE4 A;  1Y69 U;  2RVL A;  1HXY D;  2D62 A;  3M7N A;  1NR2 A;  1OXS C;  1UNS A;  4LK1 C;  2F0G A;  1KLG D;  2R7Z B;  4KY6 A;  1I4P A;  1IL8 A;  5CV6 A;  1GUG A;  3GD7 A;  2EE1 A;  3MXG A;  4DA2 A;  3TZD A;  2CW0 D;  2ZXP A;  4KTA A;  4IUQ A;  2NTS A;  2J0T D;  4KY7 A;  4ZK9 B;  2F0S A;  5JPN C;  2K5W A;  5COY A;  3TDQ A;  1EY0 A;  1F2Z A;  2EJM A;  2F0U A;  1QG7 A;  3VR6 A;  4M1U B;  1PTO B;  2XIW A;  4G7Z C;  5D3D A;  1NUC A;  3MFY A;  2MUY A;  5IT9 L;  4XIG S;  5AFW A;  1WTX A;  1S5B D;  1WD1 A;  1I4X A;  2R6G A;  4ZAI A;  1A2T A;  5JJZ A;  4A3G B;  1SJH D;  1B50 A;  3TP6 A;  4Z9C B;  2ID0 A;  1WTP A;  3W3A A;  4XQJ A;  1K8M A;  5FO8 B;  4NDX A;  1D5Z C;  4IAL A;  2A73 B;  5FOB B;  1JWM D;  1V1P B;  1WTQ A;  4RH6 A;  3S16 B;  4HAE A;  1KDA A;  3D4D A;  3R93 A;  5IGE A;  1HFN A;  1STG A;  2XWJ B;  1EY6 A;  3Q23 A;  5FK9 C;  4K8I A;  2KVM A;  1K83 B;  5C4J B;  1H9S B;  4U68 A;  1JOO A;  5C3E B;  2Q8I B;  1JOK A;  1SJE D;  3L3O C;  4S3S A;  5CBE E;  3TME A;  2SEB D;  4C3I G;  1Q1E A;  3I4L A;  3GTM B;  1M4V A;  1MGS A;  2JSO A;  2NVX B;  2Z4I A;  4C3H B;  1RCV D;  5IT9 E;  4X3S A;  2EYO A;  2NVQ B;  4FYD A;  1I4R A;  2IX0 A;  2TSS A;  1IYU A;  3CQZ B;  1HA5 A;  1CTM A;  1EY5 A;  2KA7 A;  3LNN A;  4C3J G;  5C4Z A;  1R4Q B;  1QIL A;  4ME5 A;  3G6J B;  2FMM A;  1EIH A;  2EYF A;  3FKI B;  4B9X A;  5HUR A;  1ROD A;  1SBB B;  3OWE B;  4K5X A;  2PPB C;  3DWA A;  2A6E D;  3HKZ B;  2KUM A;  3VA5 A;  1O7Y A;  3OIQ A;  3H09 A;  4KV6 A;  3S1M B;  5I6Y A;  2E2I B;  1ENC A;  4HMJ A;  1ENF A;  2DY7 A;  2AUJ D;  2B2W C;  1TT2 A;  3ERQ A;  5FLX E;  2E2J B;  1AP0 A;  4OO1 I;  1TWC B;  3I8Z A;  2HQE A;  3S1Q B;  4K2L A;  2NVT B;  4LMQ D;  3I72 A;  3QWN A;  4B9W A;  1GHJ A;  3PIP 3;  1JOR A;  1I4Q A;  5I4D A;  1LO5 D;  4LAA A;  1FGB D;  4XT3 B;  5CV5 A;  5CBA E;  1CA5 A;  3V2T A;  4MIU A;  3C46 A;  1XX8 A;  1HUM A;  1D1I A;  4G7O C;  2F0J A;  3K58 A;  4DNR B;  4QIW B;  1BF4 A;  3T56 B;  2WII B;  3MTS A;  3KUP A;  1LAB A;  1SNC A;  3NBI A;  1MI2 A;  5IGG A;  2F0E A;  1RHP A;  3U9S A;  3J7A V;  2MJ8 A;  1LTG D;  2CVR A;  4IFD I;  3QOL A;  2A69 D;  3QB3 A;  4FVM A;  2K04 A;  1SND A;  5DEH A;  5EQ0 A;  2D5D A;  2L12 A;  3NWT A;  2JP1 A;  1BCP B;  1PRT C;  5ELF A;  3J80 L;  1DYQ A;  3EVQ A;  1ILQ A;  3OMG A;  1W6J A;  4ZKC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...