2NBFA

Structure of calcium-bound form of penicillium antifungal protein (paf)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifungal protein
molecule keywords Antifungal protein
publication title Calcium binding and the role of aspartic acids in the antifungal function of PAF
rcsb
source organism Penicillium chrysogenum
total genus 5
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2016-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nbfA00
2MHVA 2NBFA 2KCNA 2NB0A 1AFPA
chains in the Genus database with same CATH superfamily
1NJIC 3Q23A 3HOWG 2EY5A 4JOIA 1LUZA 2GVAA 1A63A 1OO9B 1PZJD 3GDEA 4IO9A 2ZTDA 4DR2L 1STAA 2BH2A 1ICWA 5IYCG 3DWQA 5CGKA 5IGDA 2HDLA 4AH6A 3TBIB 3J80i 5LMNW 3MFYA 4OIKA 2BDOA 1YHAA 3KYHC 4X6AH 5I9PA 4ZUIA 3PIP3 4ZKCB 1LT3D 1ENCA 2C9OA 1VQGA 5IYCH 1K8OA 4A3MH 3HOUB 5FO8B 2K5VA 1MSGA 3CAMA 1HQMC 3D0FA 1CKMA 1Z9FA 1MJEA 1KLGD 1B9MA 1EL0A 2WIIB 1FYCA 4TKOB 4WRDA 4PG3A 4EX5A 4FO2A 1UE1A 4A93G 1E2VA 1UAPA 4LAAA 4BA1I 1PYBA 2Z9HA 3VYRA 2VQFQ 2Z8LA 1YNXA 2B29A 3CP0A 1VQNA 5CC4A 3JAML 3K5OA 4QMGA 5C3XA 1ENAA 3OIQA 1AN8A 2Y0SG 4G57A 1VQAA 1HR0Q 3SHLA 4A93H 1B70B 4A3DH 2LKVA 1XNQQ 3S1QB 2LXJA 1M8AA 1RTOA 2G9DA 4GN3B 1STNA 4WJ3M 3NENA 3AB9A 5CV8A 3MXUA 1N34L 2WKCA 4GKJL 2EJMA 1A2TA 1G8ZD 4ZYSA 3HOXG 2EY6A 2RA4A 1KXLA 4H0LC 4DR2Q 1JICA 3PCOB 4K2LA 1PTOB 4X64L 1VQBA 4X3KA 1V1OA 4ABNA 1I6HB 2F0TA 2HCIA 2UU9L 1U4MA 2K05A 3A54A 3FDTA 4X65L 5M5XB 1STBA 3FRPB 1HXYD 4NKLA 2JA5B 4V0BA 4DAMA 1Q90A 1KRTA 3H3VI 5GAEC 4DV0L 2Q8TA 3NTHA 4HMJA 3J7AF 2CWAA 4X3TA 1W2BA 3BYTB 1B8AA 1QZHA 5M5WB 1PH3A 1I4QA 1YJWA 5IT9E 1XPUA 4P2CB 4FDBA 2E75C 4XXEA 2TMPA 3CPFA 2KENA 4MTKA 3QOLA 3A7AB 2XNAC 1I5FA 4KTAA 3E5SA 1ICFB 2YTVA 5C44H 1F9PA 2R3ZA 3QR8A 4IOCA 4XQNA 4MHEA 2Q8RE 3NBIA 1Q7YC 2VNUD 3UE1A 1XMOL 4HJ8A 3NPPA 4O42A 4JI7L 3DEPA 1W6KA 4GLVB 1XMQL 4ME3A 1YI2A 4GKJQ 3BDOA 4I7AA 5C0XI 1UE7A 2LS01 2E2IB 2B39A 1IBKL 5COYA 5ELEA 4KKTA 2ZT9C 4X64Q 2F0IA 3GTKH 5IP7G 1PMRA 3H91A 5D3IB 1PFNA 2K32A 2NBFA 5AFWA 2ZJPA 2UU9Q 2DNCA 3OSOA 1DOKA 1N32L 2SOBA 3UE0A 3RLNA 4A3FG 5JEAH 4NB3A 4A3KG 5IP7H 1A8VA 5DNFA 4DV0Q 1J5EL 5BR8Q 4JVZA 2KECA 1FD7D 4IN3A 2MGSA 1YZ6A 4EVOA 1HRJA 3WOEA 3OOCA 3I56A 1H9RA 2VY3A 3FKIG 5M3FH 1F2LA 2OTJA 4A3EG 2PZUA 3F2CA 4A3KH 3GQBA 2XRQD 3SK4A 5I4DA 1A3VA 3HOYH 3WDNA 4JI2L 2RQXA 3HGBA 1I4GA 3DM1A 5TSSA 1F2ZA 1VDZA 4KHVA 3K59A 2CWPA 3GTLH 2XWJB 3FKIH 4HAEA 5M3MH 3PF5A 4BBSG 1Q3LA 2PQAA 3E3XA 3EFXD 1XMOQ 3OTOL 3BJUA 1MGSA 4JI7Q 3KOJA 2RBMA 2FXQA 1XMQQ 2F0NA 4FF1A 2BH8A 3C2PA 5JJZA 3BG3A 1HJPA 3L9AX 1GUWA 3V96A 1KRSA 1UEAB 2ZM6Q 1IBKQ 4DV1L 4BBSH 1PRTB 3EA6A 4KHPL 3SVMA 2EYHA 4IPDA 4JI6L 3NTIA 1LT5D 4LUOA 1CI3M 5HURA 2MNAA 2VW9A 4JI4L 5AJ3L 1GM5A 2F4IA 2F4VL 1N32Q 5IIFA 2PZTA 4JYAQ 4R8NA 2VUMH 2YV5A 1CQVA 4N8FA 4GOPC 4R1JA 2F03A 1J5EQ 3NK9A 5EKLA 3H09A 3I91A 1ENFA 2Q2IA 4A3MB 4RFBA 2JEAI 1Q81C 1EU3A 4RG1A 2MQHA 2EOTA 3S2HH 1JORA 1TQOA 1SDFA 2IJ0A 1ILPA 1LTBD 1MKHA 4JI2Q 1Y1VG 2K14A 2F0DA 4JPBW 3KJOA 1VF5C 1AW7A 1I4XA 1HH2P 2CHBD 2N88A 1SE8A 3A5UA 3OTOQ 4UY8C 2CH4W 1LO5D 4HJ9A 3NWSA 4A93B 4DAVA 4A3DB 1Y1VH 2JA9A 4QCLA 3BVGA 3A8IE 3D8GA 4DV1Q 1D2BA 4KHPQ 5IGFA 4JI6Q 3TP7A 2Y0SB 1SE2A 3NP8A 5KIXA 3S16H 3UDXA 1I4RA 4JI4Q 2UUAL 3CMAA 3VDYA 3CF5A 2F4VQ 3LWEA 5EPJA 4PMWA 1GOZA 4K8JA 4EGVA 2WKDA 2ZJQA 4B3RL 1CKNA 2F0SA 4QGUA 3GP7A 5LMNL 2XVSA 1Q46A 4ALPA 3I90A 5IYBH 1E2ZA 1VQFA 3SK5A 2N78A 1TS3A 3KLWA 3PV0A 3RLOA 2PI2E 3GTPH 1LT4D 2NZOA 3DEOA 4K5WA 1WD0A 2ZXPA 3NXWA 2VQEL 1QUQA 2B2VA 2CFMA 1I4PA 4K5XA 1X65A 2ZTCA 3GTQH 1TU2B 2BOSA 2D2CC 4KJNA 4LFAQ 4YCVA 2M00A 3NQTA 5C44B 1WCMB 3X3NA 3VR2A 4DUZL 2NVXH 2B2WA 1BXTA 2UXCL 4JOIC 4LF7Q 1XYIA 1TS5A 4IURA 3J80E 1EUJA 1GUSA 4R4IA 1WYDA 4U673 4LF4Q 2NZ1D 4C3HH 2E2JH 4DA2A 1FL0A 2RDFA 1VCIA 2IT1A 2UUAQ 2R93H 1C9OA 2EQSA 3GTKB 1NMFA 2AUKA 1KL9A 3I4NH 2QCPX 1HUMA 3OMGA 2X6GA 4MNOA 5IGCA 2K03A 3WWVA 4XQQA 2QDBA 4B3RQ 4OHJA 1FJGQ 1SRUA 2Z4IA 5LMNQ 3J7YW 2F0QA 1GO3E 1CTMA 1IW7D 5HGQA 5F2DA 3F8TA 2XTIA 3CCSA 1CZWA 3S1RB 4OL7A 1Y1WG 1RTNA 1JQYD 1X3EA 4DAYB 2F0GA 4BXXG 4APVA 4UDUC 5M3FB 1RKNA 2VQEQ 2Z1CA 5BN4A 3A0JA 1H9MA 3L2PA 4A3KB 1OXSC 2E2HH 4B08A 1NUCA 2BA1A 1WTRA 3HOYB 1Y1WH 1U9RA 2O5JC 4KV6A 3QJYA 4A4IA 5T1IA 2IY5B 3PIO3 3HKZE 1SEBD 2DJGC 3GTLB 1TWFH 3FKIB 1AEXA 5M3MB 5JEAJ 4DUZQ 2UXCQ 3G6EA 2VXWA 1YHQA 3K0YA 2C35B 2RCFA 2BDNA 3I72A 1MJCA 4GS3A 3PIPA 3MFGA 1B50A 1AE2A 1L0YB 4P75A 1EIHA 4IUQA 3KF6A 1M1KC 1ML0D 3UI2A 4BBSB 3RN2A 4KY7A 4DK0A 4DR1Q 4HIDA 3ERQA 3RZOH 3L0OA 2K5QA 2EJGC 1S5BD 4BBRH 1G6ZA 2A69C 4ULLA 4C3JG 2K1BA 2WAQE 1D5ZC 3LGJA 3S15H 4G7ZC 5K36G 2VUMB 1KLUD 1N33L 3PO3G 2QF7A 3CHBD 1CT1D 1TXYA 1SNOA 1CHPD 1B4OA 1L0XB 2E76C 5C4XG 1PH5A 4CKBA 2OXPA 4C3JH 2Z6KA 3R3OA 1F2MA 2CH4A 5T1GA 1EYAA 3S2HB 5FLMG 3AEVA 4BY7H 1XWEA 4XT3B 3VR5A 2JA8H 3PO3H 1GUGA 5CR3A 5EBDA 4LF9L 1JOOA 2JA7G 2E2DC 1CFMA 2M9VA 5GAHC 5IT9L 5JAVA 1K8MA 2RSOA 3A8KE 3QOJA 1A3TA 4GLAC 3TEHB 3M7NA 3MEHA 1Y1VB 3MXPA 4CJ1B 3RUZA 5C3EH 4QJFA 3M85A 3I4MG 1QCBD 1IYJB 5IODA 3J7ZC 4J15A 3S16B 1T5EA 4UP8A 3PGZA 3I73A 3OHXC 1SBBB 1UEBA 3H94A 2NN6H 2E8GA 2O5IC 4DR6L 4AYBE 3I4MH 2A6HD 4CDCC 1GUNA 3C1FA 1L2FA 4EQPA 1N9WA 3FPPA 1LTRD 4JG2A 1VQ8A 3ULPA 1MSHA 1RCVD 5I6WA 3ULLA 2RF4A 3WOFA 4GLXA 2JK8A 1LTGD 4AQYL 2N3SA 2ZXOA 2JQOA 2EIFA 3K8AA 3OW2A 2Z0SA 5IE8A 3KLSA 2IX3A 3GTPB 4N8X1 1O7YA 4LF9Q 2JYOA 1KDAA 3S1MH 3BZCA 1XNRL 1FGUA 4ZAIA 4QQBX 3GTQB 4QY7A 2AQ3B 1B3AA 3EIVA 3TN2A 1Q1BA 4C2MH 3E9HA 1N8RC 5E1FA 2A6HC 3I55A 2XGTA 2JP1A 2NVXB 4DV4L 2MUYA 3E0EA 2WB1E 1K83H 4RHSA 4N9PA 3ULJA 2AUJD 1WFQA 1SNQA 2YTYA 1JJ2A 3H6MA 3W3AA 2R7ZG 1D5MC 4C3HB 2E2JB 4N9TA 3D6WA 2Z4HA 5IP9G 5EJWA 1XNQL 2A1AA 2R93B 4L8JA 1GXDC 1SJHD 4FXGC 2A73B 4DR6Q 4GOPB 1DXMA 4ILWA 2HIVA 3NBHB 3I4NB 1C8CA 1W3SA 4C3IG 4A3IG 3DMUA 3HFZB 4LJZC 1K0RA 1E22A 2WAQG 3D4WA 2PI2A 5ELBA 4ZLTF 4KJOA 5KYLA 4DU9A 1S5ED 1TWHH 4DNRB 2N8NA 1S5FD 4AQYQ 4C3IH 3HOWH 4P73A 2RHQB 3IKJA 1O80A 5J22A 1IZ6A 3L7ZC 4L5TA 1XNRQ 1IHZA 2N49A 1K3RA 2E2HB 2ALYB 4B9WA 1Y1WB 2YTXA 4L5SA 5EQ0A 4HJAA 2F0UA 3A8JE 5DM63 3T56B 3UDGA 5E7NA 1TWFB 1D1IA 4ODGA 4DV4Q 4BY1B 2UUBL 3SK6A 2X69A 2K52A 1IYVA 1WTPA 2B2YA 1EIYB 1PH4A 2FMCA 4B9XA 2EPBA 3A74A 1BCPC 1O7ZA 5KGUA 3A5ZB 4ZKBB 3ND9A 3ER0A 3P75A 3KDFA 1HZ9A 3DUZA 1EYDA 2PYKA 4DKAC 3TP8A 4LFCQ 2PMZE 2R92G 3RZOB 4PZ7A 3KJPA 4BBRB 1VF7A 5LL6X 5FO9B 4Q0FA 3S15B 2XRSD 5KNCA 4Y52H 3K7AH 1TY0A 2TSSA 3VA5A 1SYBA 2B2VC 4S3SA 4DN4M 2L9HA 5DM73 1SNDA 3HOXH 2JXMB 1JB3A 2MP1A 4WJ4A 4ZK9B 1IKMA 2HUGA 1QWYA 2L1BA 3BS1A 4BY7B 1XXGA 3PO3B 2KHSA 2JA8B 1X6OA 4QIWE 2ICIA 5BR8L 2B2WC 1TY2A 4DGZA 1CZGA 4DV6L 4UP9A 3S17H 5EPKA 4POFA 2UUBQ 1Y69U 4FF3A 1ESRA 5C5LA 2ZTEA 4K2KA 2RKSA 2JE6I 2IW3A 3ERSX 4HN7A 5JJLA 5C3EB 1A15A 2Q8IB 2VL6A 1VQOA 1GJXA 2RSNA 1L1OA 1K8AC 4JI1L 4JBJA 4NP5A 5CORA 2NVQH 3J80L 1BF4A 3OPOA 4LFBQ 2P5ZX 3CCQA 4KD4A 1PYWD 2RDHA 2PCFB 1H9SA 3RLFA 1TIID 2K5WA 1CKOA 2ZM6L 4LF6L 2KOLA 4OO1G 1A62A 2YU9H 1GHKA 1V9PA 5EPLA 2EYJA 1EWIA 5ELDA 2LFNA 2NUCA 2KUMA 4HEDA 2J4XA 4NPSA 2F0JA 1FGBD 5C4JH 4U68A 4KMUC 4DF7A 1PH2A 3MVVA 4ZUJA 1BBUA 4NXML 4GNXA 4OO1H 2Q2UA 4JYAL 2AMCB 4HJ5A 4BA2I 1SLJA 4IQZA 4UAIA 3X3MA 4CBVA 1YEZA 2K4KA 1I6VC 3S1MB 4A3JG 4DV6Q 3R2TA 1U4RA 3OMCA 1PH1A 4TVAB 4DV2L 2JA6G 1B7YB 4A3FH 1CQFA 1ZKOA 4C2MB 1EFWA 5CV7A 2A5HA 4PZ6A 1HFNA 3RZDH 3H0GG 1EY6A 4A3JH 1N36L 1SE3A 4C1NI 3HOZG 4F88A 2L5TA 3A7LA 1SAPA 1K83B 1ET9A 2LSSA 2JA6H 4JI1Q 2B8GA 1TWCH 4WORA 1TR5A 4K6DA 4A3EH 4H44C 4FF4A 5DAUA 4DNIA 5NUCA 1KAWA 3G7LA 5HGTA 4JC0A 1EZ6A 5KNDA 3CCEA 4DV3L 1R9TB 3K58A 1NE3A 1HUNA 1MIUA 3PSIA 2FHTA 3IRBA 1VQPA 1TWGH 4M1UB 2RDGA 4LF6Q 4LUZA 4JI3L 2F52A 1KHIA 3VR6A 3ZJYC 3MZ5A 3KLSX 3BU2A 4DR3L 4P72A 4CDFC 5BN5A 2Z6KC 3J7A5 4QUCA 3PO2G 1VQHA 1TWHB 3TZDA 4NXMQ 1A2UA 1JWUD 3AYHB 3N52A 4C3IB 3HOWB 2IX1A 3U58A 1NTGA 3VYSA 1EY4A 2F3WA 3F2BA 4XTCS 3DLLA 1DYQA 3QO2A 2IHFA 3DWAA 1FNWA 1EY5A 1S4ZA 2ENBA 3PUWA 3PO2H 3Q0AA 1Q8KA 4DV2Q 1R4PB 1Z6HA 4KHZA 2F3VA 3S14H 4UHVA 1IL2A 2UXBL 4MTNA 1VQ4A 2OF1A 1N36Q 2JJQA 1S72A 1TKWB 4PV1C 3H15A 5ELNA 4RAUC 2EXZA 3PQIA 3AU7A 4LFAL 4OWTB 4G7OC 2LY7A 3PUVA 3R8BA 2RVLA 4DV3Q 4LF8L 4LF7L 3CW2C 4HIKA 2D9UA 1E2WA 1TT2A 2KVMA 4HMIA 4AIMA 1O78A 2KJXA 2EYPA 4JI3Q 4LF4L 4FYDA 1JWSD 1GHJA 4DR3Q 4GZYC 1SYCA 1VQ6A 5C0XG 4XYOA 1HHVA 1JMCA 4DR4L 3SE0A 3PMFA 3UDIA 1VQDA 1STEA 1V1PA 2WFWA 3KFUA 3A55A 1VQ9A 3K7AB 1VQCA 1S40A 1NR2A 2R61A 1X56A 3K0XA 2PQAB 2EVBA 3ITPA 1Q8IA 3HOXB 5C0XH 1FJGL 3W5OA 1ASYA 5LHY1 1PFBA 1CK1A 4IJHA 1BQQT 1M90C 1QVCA 5I2YA 1RODA 2PNRC 4A3LG 5GADC 1HNZL 4RMFA 1PH6A 4JW0A 5A35A 4WJWA 5K5PA 3S17B 2KQ3A 2V1CC 4QL5A 1K73C 4A3BG 2UXBQ 3EBEA 1DGSA 4IZ8A 1OXXK 4DUYL 4O1NA 4LWCA 2EDGA 1GUTA 4A3LH 2HQLA 4OONA 2HT1A 2SDFA 2KCNA 2QGQA 4CJ2C 5M5YH 4C1NK 3T1YL 1IBLL 4F87A 1W6JA 1LACA 4A3BH 1F2YA 1UE5A 1TS2A 4LF8Q 2NVQB 5FK9C 3RR5A 1V1QA 4DV5L 5IGBA 1C48A 2MPMA 2NTSA 2R7DA 2EYOA 1JB7A 1LLRD 4BWGB 1WTHA 4JI5Q 3KF8A 2K5NA 4O2DA 3MXNA 2YU9B 4DR4Q 3U50C 4QUFA 3OWFA 3P1HA 4KN4C 1WTQA 4FVMA 2EJFC 4RGNA 4DR1L 2NN6I 1A6XA 1K3BC 3BYYB 5H1SE 1G6PA 1SNCA 2QEXA 3T16A 5FOBB 3TDQA 1KQSA 4IUVA 1D7QA 5C4JB 1HNXL 2ZJRA 1RF2D 1IKLA 1ZEQX 1Q12A 1D6EC 3I3CA 3GTMH 4LMQD 2KBNA 3G4SA 1HNZQ 4FXDA 1NCVA 2LXKA 1HQRD 2XSCA 1BR9A 3PF4A 2B2YC 4GN4B 1C4QA 3JC66 1SYFA 4DUYQ 2PNHA 4A3FB 3CQZH 4BS9A 1LTTD 1G91A 5CMDA 4A3CG 4DK1A 1STHA 4DXFA 3AFPA 3OYYA 2AWOA 2A69D 5JJKA 1ET6A 4HTHA 4A3JB 3HOUG 1H9KA 4A76A 3T1YQ 5IY0A 1IBLQ 4BXXH 3HOVG 1M4VA 1CKNB 1SMXA 2WINB 2JA6B 4B3ML 4K6LA 2GA4B 4A75A 1TWCB 3OIPA 4A3EB 1NSNS 1QE6A 3I70A 4IUNA 4EQOA 5I2XA 4DV5Q 2K50A 5I9OA 1G51A 1B2TA 3IAYA 3TRZA 1VQ5A 3M9BA 3HOVH 1TWGB 1VMCA 2F3IA 3E9IA 3CPWA 2G9HD 3K57A 3UDFA 1QUQB 2K33A 2R7FA 1U4LA 2H5XA 4Q5VA 3EVQA 5JPMC 3MHBA 3PUYA 4CKCA 4DXGA 4YWLA 1G2TA 4DV7Q 1HNXQ 3J81E 2VS1A 5A2QE 2KEDA 3GTGH 2L4NA 2F1MA 5HY6A 2B2UA 2K28A 1B1ZA 1HZBA 4JI8L 3PO2B 2VB3X 4HSPA 1EY8A 1LTSD 4O0AA 1S5DD 1PVOA 1ZYRD 3V2TA 2ES2A 4OEMB 4C56C 2M2LA 5K36H 1VQJA 2GN5A 4UP7A 1EZ8A 1OTCA 4DR7L 3E6ZX 2WACA 4OELB 1L1OC 2I5LX 4J6HA 3S14B 1UWVA 3F1ZA 2EYLA 4R9WA 3K5MA 2JA5G 1R4QB 2EY2A 4IOAA 1LT6D 3K5LA 3CCJA 3QIAA 5C4XH 2DNEA 1MI2A 2HHHL 1DONA 4K14A 1KNAA 3T53B 1WVLA 4B3MQ 2CQAA 4R4TA 1YNND 2ZXRA 2GVBA 4KN7C 4KY5A 5FLMH 2DY8A 5M5XH 4YIJA 3GO5A 2HQEA 4G4KA 1SE4A 2AHOB 2IPKD 2JA5H 3R2IA 2JA7H 3G48A 3EQLC 1RJTA 3Q8DA 3MTSA 1XX8A 2BA0A 2NB0A 5J39A 2PQEA 2C5CA 1NMGA 3QB3A 4YCUA 1ZYRC 4IUTA 5C5MA 1WJJA 2K5HA 4A3GG 4GNXC 1BO0A 1X54A 1BUVT 5KNBA 4RH6A 5CV5A 1SROA 3A56A 1C7YA 1WTOA 3SK8A 3LX0A 1II3A 1VQ7A 3CC2A 3NE5B 2J7ZA 1KDBA 2Y0SE 3TZUA 4A3GH 1YNNC 2KCTA 1BCPF 3BDCA 2K01A 1UUPA 4JI8Q 2IHEA 4RKLA 2MHVA 3EROA 5KYIA 3NELA 2EE1A 3KF6B 4MN3A 1SMYD 1ESFA 1CHQD 4DR7Q 1PH8A 3QWNA 3CKIB 2MO1A 2E5LL 3D3RA 1Y8NB 4L5RC 2ID0A 2G5DA 2HHHQ 3M4OH 2NZHA 1EOTA 3BZKA 5M5YB 1CM9A 2JN4A 5FJ8G 3HKZG 1YJNA 1EY0A 5C4HA 1WTVA 3T4AC 3STBC 1X3FA 4IFDG 2K04A 3AFQA 1IBML 5KRUA 1BNZA 1T9HA 4F7XA 4DAPA 1SR3A 2O4XA 2WP8J 1A0IA 3FMCA 1EEFD 1NY4A 1HZCA 1Z7TA 1GD7A 1SMYC 2MJ8A 1DM0B 3I7FA 5CV6A 1QOHA 2I5MX 4IFDH 2F0WA 4CJ0B 4V190 2F0LA 3LNNA 3S2DH 3PUZA 4LFCL 3GD7A 4Z9CB 2R7ZH 2D0PA 5DEHA 5JJIA 1F77A 5IP9H 2OEOA 3DWPA 3U4ZA 4KKUA 1BDOA 1RL2A 4RA8A 1EWHA 2Q2TA 1BCPD 1HFGA 1PA6A 1PZID 4H13C 1AZPA 3NWTA 4A3IH 4P71A 1ASZA 3T51B 3DM3A 4OO1I 1PDQA 2E5LQ 3CQZB 5D14A 2DJFC 2K7VA 3W1GA 1MD2D 4R4CA 1FNUA 3Q22A 1D8LA 1DOMA 2WV6D 1J8IA 3EN2A 1L0WA 1HNWQ 4TSSA 1LTID 4A3MG 4HCSA 2CW0D 5EKIA 1E0BA 3J81c 1F9SA 4DK3C 5EGTA 3M4PA 3S9WA 1H9JA 2HD3A 2XWBB 4DPGA 2EYMA 1VQLA 3E0JA 3RD4A 3AMUA 4GN5A 3GTJH 1DCZA 1IBMQ 2EY1A 4LUVA 1CUKA 3G71A 2A6ED 4ZRZA 4DNTB 3HOVB 3FPUB 4FNFA 2HCCA 1BVSA 4ZQ3A 2QW7A 1O7IA 4JI0L 3CCLA 4LFBL 5ELFA 5GQOA 1G2SA 3BZDB 5BN3A 4A3DG 3Q6SA 2IX0A 5IWAL 3FVQA 1BBXC 1JE4A 2F0KA 2AQ1B 4LK1C 4AYBG 1STYA 3DHQA 1QB5D 1DOLA 3C46A 2A74C 2CW0C 4OIJA 1PFSA 3K81C 4PZ8A 3GTGB 1CA6A 4IPGA 1JOQA 4NXNL 3F2DA 1EFID 3DXJC 1EQQA 2F0FA 2R92H 1IYUA 2ATWA 2RCNA 3MXGA 1UE6A 3NSWA 5JPNC 1K8GA 3M7GA 4C3JB 2A6EC 3IFDA 4YHHL 1G291 2D62A 1J9OA 1TWAH 2EXDA 4KY6A 3U9SA 1E1TA 4RGOS 2B63G 4X3UA 1X3PA 4JK1C 5C4XB 3CRLC 2B2TA 4P74A 3GTOH 4NDXA 3J81i 1EWCA 2B63H 3CCRA 2A68D 1DJRD 2NVYH 2JA7B 2WB1G 4QB4A 2L0CA 1GVPA 2CVRA 1WTXA 4KK7A 2YYZA 2Q2HA 1MHWC 5C44G 1C0AA 4JI0Q 3TMEA 1WCMG 3B6YA 5JVH3 4LF5L 3H3VC 5GAGC 1RD9D 2EYFA 1E3PA 3VYUA 5IWAQ 1HZAA 3VA7A 1O7LA 1U0LA 1LYLA 3I4MB 3CD6A 3MAQA 1PZKD 3S24A 1I3QH 1WCMH 1EEID 4OWWB 3RMHA 4NXNQ 4A3GB 1Q1EA 4IPCA 2XIWA 2F0HA 4KLKA 2KCMA 4J1MA 5FLXE 1EQVA 3IL8A 4ID6A 5FO7B 5C3WA 2A68C 1N34Q 4YHHQ 3KDFB 4EQNA 1LTLA 4Y7NH 3TP6A 1QVGA 2F0EA 2BE5D 2L11A 3C1EA 5D65A 5JVG3 5JEAG 3OWEB 1JT8A 2F0OA 2R6GA 4YWKA 4RWSC 1RIPA 4K8IA 3D31A 4K5VA 3M4OB 1Y8OB 3I2ZA 3HP3A 5E4WC 4X62L 4X65Q 3OW7A 2KEEA 1JJGA 1VQMA 5M3FG 1AH9A 5CBAE 1X32A 5GROA 3D4DA 3HOYG 4DR5L 1SFOH 4M8AA 3S1RH 3HRZC 1BKBA 1U4PA 2B8FA 1EIFA 2PPBC 5IGGA 3KBGA 4LF5Q 3HKZB 4YY3L 4IJLA 4NW2A 5M3MG 3H0GH 1U5KA 2BE5C 3M3YH 5ISRA 3HOZH 2OQ0A 1F9RA 1AE3A 2B2UC 3N6RA 1Q86C 1EQTA 3HKSA 3W2DA 3S2DB 3PUXA 1WD1A 1JJCB 4CDEC 1K28A 4JBWA 2R7ZB 2KHJA 5IYDG 1HA6A 1P8LA 4L6TB 3T13A 3NQIA 3PIOA 3CCMA 1PTOF 1P16A 2OTLA 4CDDC 3J81L 1L1OB 1QG7A 5A2QL 3CRKC 4A3IB 2B3GA 1KIXA 3FP9A 2UUCL 4HJ7A 5IYDH 2WAQB 3D6CA 3KUPA 1E7ZA 2A8VA 4IFDJ 2VUMG 1CA5A 4PMBA 4RCOA 1H9SB 3K80C 4I7ZC 3MA2B 2NWGA 1PV4A 1SXTA 4CHTB 1VQKA 4B3TL 1KTKA 3SDZA 2L12A 4X62Q 3J81j 2OQKA 1EU4A 1XJVA 1D5XC 1QNUA 1Y14B 4IALA 4OGQC 3GTJB 4DR5Q 1ILQA 3H3VH 5L37A 1JE5A 4GNXB 1SN8A 1DD2A 4B3SL 1VMPA 4K0KL 3L3OC 4YY3Q 2MO0A 4CGYB 1B44D 1KD1C 5ELOA 3EJIA 3LWUA 1X3QA 3TS0A 2D0OA 4TQUS 4J8QA 2I0QA 3GV3A 3ICEA 1I50H 1I94L 4XIGS 5D3DA 2NVTH 3I8ZA 5CV4A 4JI5L 3JAME 3NUCA 4HR7B 4XYQA 3VR4A 2FFKB 4F8MA 1JR0D 2I46A 3ZYYX 5KEEA 3G6JB 1XPOA 1EYGA 4JCVE 5EKKA 3U4VA 1WOCA 5LMUL 1PTOD 2X6LA 4IPHA 2R92B 1EY9A 4AYBB 4X3SA 3HEJA 2UUCQ 3K6OA 2DUDA 1YJ9A 1EYCA 1HR0W 1OXTA 1SYEA 3NHHA 4QF4A 4R4QA 4DAYA 3M4QA 5DLQE 5IT9c 4FXKC 4UPAA 4I65A 1ONLA 1TWAB 1WI5A 2FINB 2SEBD 3K7UC 2CCZA 5AJ3Q 4YWMA 3CXCA 1VQIA 4RCNA 2QEJC 1PH9A 4B3TQ 5IYBG 3AQQA 1QILA 2DGYA 3MEFA 5CBEE 1EQRA 4RKBA 3CC4A 3P7JA 5I6YA 3GTOB 1E1OA 1FR3A 4RGTA 5FLXc 2B63B 4DK6C 2NVYB 4B3SQ 1QZGA 5FKAC 4K0KQ 2LMCB 3T1HL 4FF2A 1E24A 1PTOC 1QJOA 4DFAA 1QNKA 1HPCA 2AQ2B 1OXVA 1AFPA 5EBCA 2I5HA 5C4ZA 3GV6A 1I94Q 1JC7A 4NMZA 2WB1B 1V8QA 1KNEA 4IUUA 5ELCA 3KK7A 4H02A 3R93A 1PLFA 1PRTF 2VB2X 1I3QB 1NBWA 4C3HG 2HIXA 4IUPA 1V43A 4YCWA 4PQXA 1RDPD 2R93G 5LMUQ 3S1NH 2I07B 2KHIA 4HIOA 1JWMD 3O13A 4L63B 5CV9A 4EQ5A 2FMMA 3I4NG 3CC7A 4DV7L 3BDLA 3IFTA 2H1EA 2CQOA 3TP5A 2V4DA 4Y7NB 1QVFA 5CYUA 1KABA 3M4YA 1LV9A 2SNMA 3HG9A 4PMCA 1YVCA 2F0MA 3SGIA 3J7AV 3MWYW 3SEBA 5IOCA 1V1PB 1BCPB 1YHBA 3RZDB 3HS0C 2OCEA 5C6AA 2OT2A 2PW5A 3TREA 3T1HQ 1SFOB 3TS2A 1GUOA 2MFIA 1A3UA 2F0PA 1DZ1A 4A3CH 2IWHA 4HCEA 1X55A 1KDCA 4BY1G 3H0GB 3M3YB 4FP5D 3HOUH 3HOZB 1IL8A 2JEBI 3CU7A 1D1KA 1SSOA 1Z47A 3CMEA 1B9NA 2PZWA 2EZVA 1SJED 3U9OA 4IFDI 1LTAD 4BY1H 1PRTD 5M9OA 3URYA 2DY7A 3ONAB 1XPRA 3RN5A 4GKKL 2FJ2A 2KCCA 4R8IA 1FNVA 2PMZB 1YIJA 1IW7C 2QILA 2PW7A 4BBRG 4HIMA 1X3GA 3F2UA 1VS0A 1I4HA 1T5XD 2B2TC 1Y8PB 2SNSA 3S1QH 4ZCKA 1EOVA 5J3BA 2QKIC 1NNXA 4L5QA 2UXDL 3KF8B 4X66L 1MBYA 1LM0A 1YITA 2JSOA 3NTKA 3MXNB 4G7HC 1FVIA 1WTWA 1VQEA 1K9MC 3JAMc 4OXPA 1EIGA 3BVMA 4H7BA 1PTOH 3VR3A 2K5DA 4JBKA 4XDXA 4LNQA 4BY7G 2JA8G 4QIWB 1PRTC 4ME5A 4OX9L 5G3LF 1I6HH 3SXHA 4JV5L 3TQYA 1OXUA 2H4OA 2L15A 1BBWA 4WFN3 2OWOA 3VYTA 3C3LA 3NEMA 4OWXB 3QG1A 1NAPA 4RGMA 1I50B 4JBMA 3TSSA 2NVTB 5C3EG 4GOPA 3KLRA 5M5WH 3NBHA 1TVXA 1CSPA 5IGEA 3D4RA 3V05A 3W1BA 1J6QA 4KKSA 4GKKQ 4CKEA 2NN6G 5LL6S 3K5NA 1YBYA 3KBXA 1B3QA 3STBD 3RNUA 4KD3A 5JOBA 1GKHA 1UNSA 2DN8A 2VZAA 5FLXL 2D5DA 2HDMA 1PYSB 2KA7A 3SR1A 2UXDQ 3ND8A 4X66Q 2A19A 4XT1B 2E2IH 1HTPA 4HSVA 1EY7A 5J1ZA 1PXUA 2CKZB 2L55A 1N33Q 4KI0A 1STGA 1SYGA 3J80c 3MC0B 1PFMA 3JAMi 4OX9Q 1SNMA 1S3OA 1HNWL 1CSQA 2E74C 3CCVA 3CCUA 1PHJA 1ZXTA 1YNJD 4JV5Q 2K75A 4XQJA 1AZQA 1JCKB 3I4LA 5G3LD 4E6IA 5C0XJ 5EAYA 4A3BB 4PNYA 2O2LD 3I4OA 1BOSA 3FEWX 4TRDA 2BCOA 1X9NA 3Q24A 1HTLD 2N55A 5E3FA 2XN9C 2ASBA 1AP0A 1XTDA 4MIUA 1F9QA 5FJ8H 4R4OA 3BVZA 1TS4A 1KAAA 2AWNA 1HA5A 2QDLA 1NR4A 2ICEC 1H95A 1RHPA 2J0TD 2F0VA 1XTCD 1LABA 2VQFL 3S1NB 4LW1A 1S5CD 1HCZA 2PO4A 1IXRA 1JOKA 3FHWA 4POGA 1SNPA 2RHSB 2K6AA 2NTTA 1SYDA 1YNJC 2QA4A 1B53A 5E4XA 3HZXA 2IL8A 3P20A 1HR0L 2NYZD 4RHRA 2AKWB 3GTMB 1R9TH 1PH7A 1K0SA 1Q82C 1KC8C 4MZ9A 2Z6BA
chains in the Genus database with same CATH topology
3Q23A 2EY5A 1OO9B 1PZJD 1STAA 1ICWA 3DWQA 5CGKA 5IGDA 2HDLA 3TBIB 3MFYA 4OIKA 2BDOA 5I9PA 4ZUIA 3PIP3 4ZKCB 1LT3D 1ENCA 2C9OA 1K8OA 3HOUB 5FO8B 1MSGA 1HQMC 1KLGD 1B9MA 1EL0A 2WIIB 1FYCA 4TKOB 4WRDA 4FO2A 1E2VA 1UAPA 4LAAA 4BA1I 3VYRA 2Z8LA 5CC4A 3JAML 3K5OA 4QMGA 5C3XA 1ENAA 3OIQA 1AN8A 4G57A 3SHLA 2LKVA 3S1QB 1M8AA 1RTOA 2G9DA 1STNA 3AB9A 5CV8A 3MXUA 2WKCA 2EJMA 1A2TA 1G8ZD 4ZYSA 2EY6A 2RA4A 4H0LC 1JICA 4K2LA 1PTOB 4X3KA 1V1OA 4ABNA 1I6HB 2F0TA 2HCIA 1U4MA 2K05A 3A54A 3FDTA 5M5XB 1STBA 3FRPB 1HXYD 4NKLA 2JA5B 4V0BA 1Q90A 2Q8TA 3NTHA 4HMJA 3J7AF 4X3TA 3BYTB 5M5WB 1I4QA 5IT9E 4P2CB 2E75C 4XXEA 2TMPA 3QOLA 3A7AB 2XNAC 4KTAA 3E5SA 1F9PA 2R3ZA 4XQNA 4MHEA 2Q8RE 3NBIA 2VNUD 3NPPA 4O42A 3DEPA 1W6KA 3BDOA 5C0XI 2LS01 2E2IB 2B39A 5COYA 5ELEA 4KKTA 2ZT9C 2F0IA 1PMRA 3H91A 5D3IB 1PFNA 2K32A 2NBFA 5AFWA 2DNCA 3OSOA 1DOKA 2SOBA 5JEAH 5DNFA 2KECA 1FD7D 4IN3A 2MGSA 4EVOA 1HRJA 3WOEA 3OOCA 1H9RA 1F2LA 2PZUA 3GQBA 2XRQD 3SK4A 5I4DA 1A3VA 3WDNA 2RQXA 3HGBA 1I4GA 3DM1A 5TSSA 1F2ZA 1VDZA 4KHVA 3K59A 2XWJB 4HAEA 1Q3LA 3EFXD 1MGSA 2RBMA 2F0NA 4FF1A 3C2PA 5JJZA 3BG3A 3L9AX 1GUWA 3V96A 1UEAB 1PRTB 3EA6A 3SVMA 2EYHA 3NTIA 1LT5D 1CI3M 5HURA 2F4IA 5IIFA 2PZTA 4R8NA 1CQVA 2F03A 3NK9A 5EKLA 3H09A 3I91A 1ENFA 4A3MB 4RFBA 2JEAI 1EU3A 2EOTA 1JORA 1TQOA 1SDFA 2IJ0A 1ILPA 1LTBD 2F0DA 1VF5C 1AW7A 1I4XA 2CHBD 2N88A 1LO5D 4A93B 3NWSA 4DAVA 4A3DB 4QCLA 3BVGA 3A8IE 3D8GA 1D2BA 5IGFA 3TP7A 2Y0SB 1SE2A 3NP8A 5KIXA 1I4RA 3LWEA 5EPJA 4PMWA 1GOZA 4K8JA 4EGVA 2WKDA 2F0SA 3GP7A 2XVSA 3I90A 1E2ZA 3SK5A 1TS3A 3PV0A 1LT4D 3DEOA 4K5WA 1WD0A 2ZXPA 3NXWA 2B2VA 1I4PA 4K5XA 1TU2B 2BOSA 2D2CC 4KJNA 2M00A 3NQTA 5C44B 1WCMB 3X3NA 3VR2A 2B2WA 1BXTA 1XYIA 1TS5A 4IURA 3J80E 1GUSA 4U673 2NZ1D 4DA2A 2RDFA 1VCIA 2IT1A 3GTKB 2AUKA 2QCPX 1HUMA 3OMGA 2X6GA 5IGCA 2K03A 4XQQA 2QDBA 4OHJA 2Z4IA 3J7YW 2F0QA 1CTMA 1IW7D 5F2DA 1CZWA 3S1RB 4OL7A 1RTNA 1JQYD 2F0GA 4UDUC 5M3FB 1RKNA 2Z1CA 5BN4A 1H9MA 4A3KB 1OXSC 4B08A 1NUCA 2BA1A 1WTRA 3HOYB 1U9RA 2O5JC 4KV6A 3QJYA 5T1IA 3PIO3 1SEBD 3GTLB 3FKIB 5M3MB 1AEXA 5JEAJ 2VXWA 3K0YA 2BDNA 3I72A 3MFGA 1B50A 1L0YB 1EIHA 4IUQA 1ML0D 3UI2A 4BBSB 4KY7A 4DK0A 3ERQA 2K5QA 2EJGC 1S5BD 1G6ZA 2A69C 4ULLA 4C3JG 2K1BA 1D5ZC 4G7ZC 5K36G 2VUMB 1KLUD 2QF7A 3CHBD 1CT1D 1SNOA 1CHPD 1B4OA 1L0XB 2E76C 4CKBA 2OXPA 3R3OA 1F2MA 5T1GA 1EYAA 3S2HB 1XWEA 4XT3B 3VR5A 1GUGA 5CR3A 5EBDA 1JOOA 2E2DC 1CFMA 2M9VA 5IT9L 5JAVA 1K8MA 2RSOA 3A8KE 3QOJA 1A3TA 3M7NA 3MEHA 1Y1VB 3MXPA 4CJ1B 3RUZA 3M85A 1QCBD 5IODA 3S16B 1T5EA 3I73A 3OHXC 1SBBB 3H94A 2NN6H 2O5IC 2A6HD 1GUNA 3C1FA 4EQPA 3FPPA 1LTRD 1MSHA 1RCVD 5I6WA 3WOFA 1LTGD 2ZXOA 3KLSA 2IX3A 3GTPB 1O7YA 2JYOA 1KDAA 4ZAIA 3GTQB 2AQ3B 1B3AA 3TN2A 1Q1BA 5E1FA 2A6HC 2JP1A 2NVXB 2MUYA 4RHSA 4N9PA 2AUJD 1SNQA 3H6MA 3W3AA 1D5MC 4C3HB 2E2JB 4N9TA 3D6WA 2Z4HA 5EJWA 2R93B 4L8JA 1GXDC 1SJHD 4FXGC 2A73B 1DXMA 4ILWA 3I4NB 1C8CA 4C3IG 3DMUA 4LJZC 3D4WA 5ELBA 4ZLTF 4KJOA 5KYLA 4DU9A 1S5ED 4DNRB 1S5FD 3IKJA 1O80A 5J22A 3L7ZC 1IHZA 2E2HB 4B9WA 1Y1WB 5EQ0A 2F0UA 3A8JE 5DM63 3T56B 1TWFB 1D1IA 4ODGA 4BY1B 3SK6A 2X69A 1IYVA 1WTPA 2B2YA 2FMCA 4B9XA 2EPBA 1BCPC 1O7ZA 5KGUA 4ZKBB 3ND9A 3P75A 3DUZA 1EYDA 2PYKA 3TP8A 3RZOB 4BBRB 1VF7A 5LL6X 5FO9B 4Q0FA 3S15B 2XRSD 5KNCA 1TY0A 2TSSA 3VA5A 1SYBA 2B2VC 4S3SA 4DN4M 2L9HA 5DM73 1SNDA 2JXMB 1JB3A 2MP1A 4ZK9B 1IKMA 2HUGA 1QWYA 2L1BA 3BS1A 4BY7B 1XXGA 3PO3B 2KHSA 2JA8B 2ICIA 2B2WC 1TY2A 4DGZA 1CZGA 5EPKA 1Y69U 4FF3A 1ESRA 5C5LA 4K2KA 2RKSA 2JE6I 2IW3A 4HN7A 5C3EB 1A15A 2Q8IB 1GJXA 2RSNA 4NP5A 5CORA 3J80L 1BF4A 3OPOA 4KD4A 1PYWD 2RDHA 2PCFB 1H9SA 3RLFA 1TIID 2K5WA 2KOLA 4OO1G 1GHKA 5EPLA 2EYJA 5ELDA 2LFNA 2NUCA 2KUMA 4HEDA 2J4XA 2F0JA 1FGBD 4U68A 4KMUC 4DF7A 3MVVA 4ZUJA 4OO1H 4BA2I 4IQZA 4UAIA 3X3MA 4CBVA 1I6VC 3S1MB 3R2TA 1U4RA 3OMCA 1CQFA 1ZKOA 4C2MB 5CV7A 2A5HA 1HFNA 1EY6A 1SE3A 4C1NI 4F88A 2L5TA 3A7LA 1SAPA 1K83B 1ET9A 2B8GA 4WORA 1TR5A 4K6DA 4H44C 4FF4A 5DAUA 5NUCA 3G7LA 5HGTA 1EZ6A 5KNDA 1R9TB 3K58A 1HUNA 2FHTA 4M1UB 2RDGA 3VR6A 3MZ5A 3KLSX 5BN5A 4QUCA 1TWHB 3TZDA 1A2UA 1JWUD 4C3IB 3N52A 3HOWB 2IX1A 3VYSA 1EY4A 2F3WA 4XTCS 1DYQA 3QO2A 3DWAA 1FNWA 1EY5A 1S4ZA 2ENBA 3PUWA 3Q0AA 1R4PB 1Z6HA 4KHZA 2F3VA 2OF1A 1TKWB 4PV1C 4RAUC 2EXZA 3AU7A 4G7OC 2LY7A 3PUVA 3R8BA 2RVLA 2D9UA 1E2WA 1TT2A 2KVMA 4HMIA 1O78A 2KJXA 2EYPA 4FYDA 1JWSD 1GHJA 4GZYC 1SYCA 5C0XG 4XYOA 1HHVA 3SE0A 3PMFA 1STEA 1V1PA 3A55A 3K7AB 1NR2A 2R61A 2EVBA 3ITPA 1Q8IA 3HOXB 5C0XH 5LHY1 1PFBA 1CK1A 1BQQT 5I2YA 1RODA 2PNRC 5A35A 4WJWA 5K5PA 3S17B 2KQ3A 4IZ8A 1OXXK 4O1NA 2EDGA 1GUTA 2SDFA 2KCNA 4CJ2C 4C1NK 4F87A 1W6JA 1LACA 1F2YA 1TS2A 2NVQB 5FK9C 5IGBA 1C48A 2MPMA 2NTSA 2EYOA 1LLRD 4BWGB 3KF8A 3MXNA 2YU9B 4QUFA 3OWFA 3P1HA 4KN4C 1WTQA 4FVMA 2EJFC 4RGNA 2NN6I 1A6XA 3BYYB 1SNCA 3T16A 5FOBB 3TDQA 4IUVA 5C4JB 1RF2D 1IKLA 1ZEQX 1Q12A 1D6EC 3I3CA 4LMQD 4FXDA 1NCVA 2XSCA 1HQRD 1BR9A 2B2YC 1C4QA 1SYFA 4A3FB 4BS9A 1LTTD 1G91A 5CMDA 4DK1A 1STHA 4DXFA 2AWOA 2A69D 1ET6A 4HTHA 4A3JB 1H9KA 1M4VA 2WINB 2JA6B 4K6LA 2GA4B 1TWCB 3OIPA 4A3EB 1NSNS 1QE6A 3I70A 4IUNA 4EQOA 5I2XA 5I9OA 1B2TA 3IAYA 1TWGB 1VMCA 2G9HD 3K57A 2K33A 1U4LA 4Q5VA 3EVQA 5JPMC 3MHBA 3PUYA 4CKCA 4DXGA 1G2TA 3J81E 5A2QE 2KEDA 2L4NA 2F1MA 2B2UA 2K28A 1B1ZA 3PO2B 2VB3X 4HSPA 1EY8A 1LTSD 1S5DD 1ZYRD 3V2TA 4C56C 2M2LA 5K36H 1EZ8A 3E6ZX 2WACA 3S14B 4J6HA 2EYLA 4R9WA 3K5MA 1R4QB 2EY2A 1LT6D 3K5LA 3QIAA 2DNEA 1MI2A 1DONA 4K14A 1KNAA 3T53B 1WVLA 2CQAA 1YNND 2ZXRA 4KN7C 4KY5A 2DY8A 4YIJA 3GO5A 2HQEA 2IPKD 1SE4A 4G4KA 3R2IA 3EQLC 1RJTA 3MTSA 1XX8A 2BA0A 2NB0A 5J39A 2PQEA 2C5CA 3QB3A 1ZYRC 4IUTA 5C5MA 1BO0A 1BUVT 5KNBA 4RH6A 5CV5A 3A56A 1WTOA 3SK8A 3LX0A 1II3A 3NE5B 2J7ZA 1KDBA 3TZUA 1YNNC 1BCPF 3BDCA 2K01A 1UUPA 4RKLA 2MHVA 3EROA 5KYIA 2EE1A 4MN3A 1SMYD 1ESFA 1CHQD 3QWNA 3CKIB 3D3RA 1Y8NB 2ID0A 1EOTA 5M5YB 1CM9A 1EY0A 5C4HA 1WTVA 3T4AC 4IFDG 2K04A 5KRUA 1BNZA 4F7XA 4DAPA 2O4XA 2WP8J 3FMCA 1EEFD 1Z7TA 1SMYC 2MJ8A 1DM0B 5CV6A 1QOHA 4IFDH 2F0WA 4CJ0B 4V190 2F0LA 3LNNA 3PUZA 3GD7A 4Z9CB 5DEHA 1F77A 2OEOA 3DWPA 4KKUA 1BDOA 4RA8A 1EWHA 1BCPD 1HFGA 1PZID 4H13C 1AZPA 3NWTA 3T51B 4OO1I 1PDQA 3CQZB 5D14A 2K7VA 1MD2D 1FNUA 3Q22A 1DOMA 2WV6D 1J8IA 4TSSA 1LTID 4HCSA 2CW0D 5EKIA 1E0BA 1F9SA 5EGTA 3S9WA 1H9JA 2XWBB 2EYMA 3E0JA 3RD4A 3AMUA 1DCZA 2EY1A 2A6ED 4ZRZA 4DNTB 3HOVB 3FPUB 4FNFA 2HCCA 4ZQ3A 5ELFA 1G2SA 3BZDB 5BN3A 3Q6SA 2IX0A 3FVQA 1BBXC 1JE4A 2F0KA 2AQ1B 4LK1C 1STYA 3DHQA 1QB5D 1DOLA 3C46A 2A74C 2CW0C 4OIJA 3GTGB 1CA6A 1JOQA 1EFID 3DXJC 2F0FA 1IYUA 3MXGA 3NSWA 5JPNC 3M7GA 4C3JB 2A6EC 3IFDA 1G291 2D62A 1J9OA 4KY6A 3U9SA 4RGOS 4X3UA 1X3PA 4JK1C 5C4XB 3CRLC 2B2TA 4NDXA 1EWCA 2A68D 1DJRD 2JA7B 4QB4A 2L0CA 2CVRA 1WTXA 4KK7A 2YYZA 3TMEA 5JVH3 3H3VC 1RD9D 2EYFA 3VYUA 3VA7A 1O7LA 3I4MB 3MAQA 1PZKD 1EEID 3RMHA 4A3GB 1Q1EA 2XIWA 2F0HA 4J1MA 5FLXE 1EQVA 3IL8A 4ID6A 5FO7B 5C3WA 2A68C 4EQNA 3TP6A 2F0EA 2BE5D 2L11A 3C1EA 5D65A 5JVG3 5JEAG 3OWEB 2F0OA 2R6GA 4RWSC 4K8IA 3D31A 4K5VA 3M4OB 1Y8OB 5E4WC 3HP3A 3OW7A 2KEEA 5CBAE 1X32A 3D4DA 4M8AA 3HRZC 1U4PA 2B8FA 2PPBC 5IGGA 3KBGA 3HKZB 4NW2A 2BE5C 5ISRA 1F9RA 3N6RA 2B2UC 1EQTA 3W2DA 3S2DB 3PUXA 1WD1A 4JBWA 2R7ZB 1HA6A 4L6TB 3T13A 3NQIA 1PTOF 3J81L 1QG7A 5A2QL 3CRKC 4A3IB 2WAQB 3D6CA 3KUPA 4IFDJ 1CA5A 4PMBA 4RCOA 1H9SB 4I7ZC 3MA2B 2NWGA 1SXTA 4CHTB 1KTKA 3SDZA 2L12A 1EU4A 1D5XC 1QNUA 4IALA 4OGQC 3GTJB 1ILQA 1DD2A 1VMPA 3L3OC 4CGYB 1B44D 3EJIA 3LWUA 1X3QA 4TQUS 4J8QA 3GV3A 4XIGS 5D3DA 3I8ZA 5CV4A 3JAME 3NUCA 4HR7B 4XYQA 3VR4A 2FFKB 4F8MA 1JR0D 2I46A 3ZYYX 5KEEA 3G6JB 5EKKA 1PTOD 2X6LA 2R92B 1EY9A 4AYBB 4X3SA 3HEJA 3K6OA 1EYCA 1OXTA 1SYEA 3NHHA 4QF4A 4DAYA 4FXKC 4I65A 1ONLA 1TWAB 2FINB 2SEBD 4RCNA 2QEJC 1QILA 5CBEE 4RKBA 3P7JA 5I6YA 3GTOB 1FR3A 4RGTA 2B63B 2NVYB 5FKAC 2LMCB 4FF2A 1PTOC 1QJOA 4DFAA 1QNKA 1HPCA 2AQ2B 1OXVA 1AFPA 5EBCA 5C4ZA 3GV6A 1JC7A 4NMZA 2WB1B 1V8QA 1KNEA 4IUUA 5ELCA 3KK7A 3R93A 1PLFA 1PRTF 2VB2X 1I3QB 4C3HG 4IUPA 1V43A 4PQXA 1RDPD 2I07B 1JWMD 3O13A 4L63B 5CV9A 2FMMA 3BDLA 3IFTA 2H1EA 3TP5A 2V4DA 4Y7NB 5CYUA 1KABA 3M4YA 1LV9A 2SNMA 3HG9A 4PMCA 2F0MA 3J7AV 3MWYW 3SEBA 5IOCA 1V1PB 1BCPB 3RZDB 3HS0C 5C6AA 2OT2A 2PW5A 1SFOB 1GUOA 1A3UA 2F0PA 1DZ1A 2IWHA 4HCEA 1KDCA 3H0GB 3M3YB 4FP5D 3HOZB 1IL8A 2JEBI 3CU7A 1D1KA 1SSOA 1Z47A 1B9NA 2PZWA 2EZVA 1SJED 3U9OA 4IFDI 1LTAD 1PRTD 5M9OA 3URYA 2DY7A 3ONAB 2FJ2A 2KCCA 4R8IA 1FNVA 2PMZB 1IW7C 2QILA 2PW7A 3F2UA 1I4HA 1T5XD 2B2TC 1Y8PB 2SNSA 2QKIC 1MBYA 1WTWA 2JSOA 3NTKA 4G7HC 1EIGA 3BVMA 4H7BA 1PTOH 3VR3A 2K5DA 4XDXA 4QIWB 1PRTC 4ME5A 5G3LF 3SXHA 1OXUA 2H4OA 4WFN3 3VYTA 3C3LA 3QG1A 1NAPA 4RGMA 1I50B 3TSSA 2NVTB 3KLRA 3NBHA 1TVXA 5IGEA 3D4RA 3V05A 4KKSA 4CKEA 2NN6G 5LL6S 3K5NA 3KBXA 4KD3A 5JOBA 1UNSA 2DN8A 5FLXL 2D5DA 2HDMA 2KA7A 3SR1A 3ND8A 4XT1B 1HTPA 4HSVA 1EY7A 5J1ZA 1PXUA 2L55A 4KI0A 1STGA 1SYGA 3MC0B 1PFMA 1SNMA 2E74C 1ZXTA 1YNJD 4XQJA 1AZQA 1JCKB 3I4LA 5G3LD 4E6IA 5C0XJ 4A3BB 4PNYA 2O2LD 1BOSA 3FEWX 4TRDA 2BCOA 3Q24A 1HTLD 2N55A 5E3FA 2XN9C 1AP0A 4MIUA 1F9QA 3BVZA 1TS4A 1KAAA 2AWNA 1HA5A 1NR4A 2ICEC 1RHPA 2J0TD 2F0VA 1XTCD 1LABA 3S1NB 1S5CD 1HCZA 2PO4A 1JOKA 1SNPA 2K6AA 2NTTA 1SYDA 1YNJC 1B53A 5E4XA 3HZXA 2IL8A 3P20A 2NYZD 4RHRA 3GTMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHV A;  2NBF A;  2KCN A;  2NB0 A;  1AFP A; 
#chains in the Genus database with same CATH topology
 1NJI C;  3Q23 A;  3HOW G;  2EY5 A;  4JOI A;  1LUZ A;  2GVA A;  1A63 A;  1OO9 B;  1PZJ D;  3GDE A;  4IO9 A;  2ZTD A;  4DR2 L;  1STA A;  2BH2 A;  1ICW A;  5IYC G;  3DWQ A;  5CGK A;  5IGD A;  2HDL A;  4AH6 A;  3TBI B;  3J80 i;  5LMN W;  3MFY A;  4OIK A;  2BDO A;  1YHA A;  3KYH C;  4X6A H;  5I9P A;  4ZUI A;  3PIP 3;  4ZKC B;  1LT3 D;  1ENC A;  2C9O A;  1VQG A;  5IYC H;  1K8O A;  4A3M H;  3HOU B;  5FO8 B;  2K5V A;  1MSG A;  3CAM A;  1HQM C;  3D0F A;  1CKM A;  1Z9F A;  1MJE A;  1KLG D;  1B9M A;  1EL0 A;  2WII B;  1FYC A;  4TKO B;  4WRD A;  4PG3 A;  4EX5 A;  4FO2 A;  1UE1 A;  4A93 G;  1E2V A;  1UAP A;  4LAA A;  4BA1 I;  1PYB A;  2Z9H A;  3VYR A;  2VQF Q;  2Z8L A;  1YNX A;  2B29 A;  3CP0 A;  1VQN A;  5CC4 A;  3JAM L;  3K5O A;  4QMG A;  5C3X A;  1ENA A;  3OIQ A;  1AN8 A;  2Y0S G;  4G57 A;  1VQA A;  1HR0 Q;  3SHL A;  4A93 H;  1B70 B;  4A3D H;  2LKV A;  1XNQ Q;  3S1Q B;  2LXJ A;  1M8A A;  1RTO A;  2G9D A;  4GN3 B;  1STN A;  4WJ3 M;  3NEN A;  3AB9 A;  5CV8 A;  3MXU A;  1N34 L;  2WKC A;  4GKJ L;  2EJM A;  1A2T A;  1G8Z D;  4ZYS A;  3HOX G;  2EY6 A;  2RA4 A;  1KXL A;  4H0L C;  4DR2 Q;  1JIC A;  3PCO B;  4K2L A;  1PTO B;  4X64 L;  1VQB A;  4X3K A;  1V1O A;  4ABN A;  1I6H B;  2F0T A;  2HCI A;  2UU9 L;  1U4M A;  2K05 A;  3A54 A;  3FDT A;  4X65 L;  5M5X B;  1STB A;  3FRP B;  1HXY D;  4NKL A;  2JA5 B;  4V0B A;  4DAM A;  1Q90 A;  1KRT A;  3H3V I;  5GAE C;  4DV0 L;  2Q8T A;  3NTH A;  4HMJ A;  3J7A F;  2CWA A;  4X3T A;  1W2B A;  3BYT B;  1B8A A;  1QZH A;  5M5W B;  1PH3 A;  1I4Q A;  1YJW A;  5IT9 E;  1XPU A;  4P2C B;  4FDB A;  2E75 C;  4XXE A;  2TMP A;  3CPF A;  2KEN A;  4MTK A;  3QOL A;  3A7A B;  2XNA C;  1I5F A;  4KTA A;  3E5S A;  1ICF B;  2YTV A;  5C44 H;  1F9P A;  2R3Z A;  3QR8 A;  4IOC A;  4XQN A;  4MHE A;  2Q8R E;  3NBI A;  1Q7Y C;  2VNU D;  3UE1 A;  1XMO L;  4HJ8 A;  3NPP A;  4O42 A;  4JI7 L;  3DEP A;  1W6K A;  4GLV B;  1XMQ L;  4ME3 A;  1YI2 A;  4GKJ Q;  3BDO A;  4I7A A;  5C0X I;  1UE7 A;  2LS0 1;  2E2I B;  2B39 A;  1IBK L;  5COY A;  5ELE A;  4KKT A;  2ZT9 C;  4X64 Q;  2F0I A;  3GTK H;  5IP7 G;  1PMR A;  3H91 A;  5D3I B;  1PFN A;  2K32 A;  2NBF A;  5AFW A;  2ZJP A;  2UU9 Q;  2DNC A;  3OSO A;  1DOK A;  1N32 L;  2SOB A;  3UE0 A;  3RLN A;  4A3F G;  5JEA H;  4NB3 A;  4A3K G;  5IP7 H;  1A8V A;  5DNF A;  4DV0 Q;  1J5E L;  5BR8 Q;  4JVZ A;  2KEC A;  1FD7 D;  4IN3 A;  2MGS A;  1YZ6 A;  4EVO A;  1HRJ A;  3WOE A;  3OOC A;  3I56 A;  1H9R A;  2VY3 A;  3FKI G;  5M3F H;  1F2L A;  2OTJ A;  4A3E G;  2PZU A;  3F2C A;  4A3K H;  3GQB A;  2XRQ D;  3SK4 A;  5I4D A;  1A3V A;  3HOY H;  3WDN A;  4JI2 L;  2RQX A;  3HGB A;  1I4G A;  3DM1 A;  5TSS A;  1F2Z A;  1VDZ A;  4KHV A;  3K59 A;  2CWP A;  3GTL H;  2XWJ B;  3FKI H;  4HAE A;  5M3M H;  3PF5 A;  4BBS G;  1Q3L A;  2PQA A;  3E3X A;  3EFX D;  1XMO Q;  3OTO L;  3BJU A;  1MGS A;  4JI7 Q;  3KOJ A;  2RBM A;  2FXQ A;  1XMQ Q;  2F0N A;  4FF1 A;  2BH8 A;  3C2P A;  5JJZ A;  3BG3 A;  1HJP A;  3L9A X;  1GUW A;  3V96 A;  1KRS A;  1UEA B;  2ZM6 Q;  1IBK Q;  4DV1 L;  4BBS H;  1PRT B;  3EA6 A;  4KHP L;  3SVM A;  2EYH A;  4IPD A;  4JI6 L;  3NTI A;  1LT5 D;  4LUO A;  1CI3 M;  5HUR A;  2MNA A;  2VW9 A;  4JI4 L;  5AJ3 L;  1GM5 A;  2F4I A;  2F4V L;  1N32 Q;  5IIF A;  2PZT A;  4JYA Q;  4R8N A;  2VUM H;  2YV5 A;  1CQV A;  4N8F A;  4GOP C;  4R1J A;  2F03 A;  1J5E Q;  3NK9 A;  5EKL A;  3H09 A;  3I91 A;  1ENF A;  2Q2I A;  4A3M B;  4RFB A;  2JEA I;  1Q81 C;  1EU3 A;  4RG1 A;  2MQH A;  2EOT A;  3S2H H;  1JOR A;  1TQO A;  1SDF A;  2IJ0 A;  1ILP A;  1LTB D;  1MKH A;  4JI2 Q;  1Y1V G;  2K14 A;  2F0D A;  4JPB W;  3KJO A;  1VF5 C;  1AW7 A;  1I4X A;  1HH2 P;  2CHB D;  2N88 A;  1SE8 A;  3A5U A;  3OTO Q;  4UY8 C;  2CH4 W;  1LO5 D;  4HJ9 A;  3NWS A;  4A93 B;  4DAV A;  4A3D B;  1Y1V H;  2JA9 A;  4QCL A;  3BVG A;  3A8I E;  3D8G A;  4DV1 Q;  1D2B A;  4KHP Q;  5IGF A;  4JI6 Q;  3TP7 A;  2Y0S B;  1SE2 A;  3NP8 A;  5KIX A;  3S16 H;  3UDX A;  1I4R A;  4JI4 Q;  2UUA L;  3CMA A;  3VDY A;  3CF5 A;  2F4V Q;  3LWE A;  5EPJ A;  4PMW A;  1GOZ A;  4K8J A;  4EGV A;  2WKD A;  2ZJQ A;  4B3R L;  1CKN A;  2F0S A;  4QGU A;  3GP7 A;  5LMN L;  2XVS A;  1Q46 A;  4ALP A;  3I90 A;  5IYB H;  1E2Z A;  1VQF A;  3SK5 A;  2N78 A;  1TS3 A;  3KLW A;  3PV0 A;  3RLO A;  2PI2 E;  3GTP H;  1LT4 D;  2NZO A;  3DEO A;  4K5W A;  1WD0 A;  2ZXP A;  3NXW A;  2VQE L;  1QUQ A;  2B2V A;  2CFM A;  1I4P A;  4K5X A;  1X65 A;  2ZTC A;  3GTQ H;  1TU2 B;  2BOS A;  2D2C C;  4KJN A;  4LFA Q;  4YCV A;  2M00 A;  3NQT A;  5C44 B;  1WCM B;  3X3N A;  3VR2 A;  4DUZ L;  2NVX H;  2B2W A;  1BXT A;  2UXC L;  4JOI C;  4LF7 Q;  1XYI A;  1TS5 A;  4IUR A;  3J80 E;  1EUJ A;  1GUS A;  4R4I A;  1WYD A;  4U67 3;  4LF4 Q;  2NZ1 D;  4C3H H;  2E2J H;  4DA2 A;  1FL0 A;  2RDF A;  1VCI A;  2IT1 A;  2UUA Q;  2R93 H;  1C9O A;  2EQS A;  3GTK B;  1NMF A;  2AUK A;  1KL9 A;  3I4N H;  2QCP X;  1HUM A;  3OMG A;  2X6G A;  4MNO A;  5IGC A;  2K03 A;  3WWV A;  4XQQ A;  2QDB A;  4B3R Q;  4OHJ A;  1FJG Q;  1SRU A;  2Z4I A;  5LMN Q;  3J7Y W;  2F0Q A;  1GO3 E;  1CTM A;  1IW7 D;  5HGQ A;  5F2D A;  3F8T A;  2XTI A;  3CCS A;  1CZW A;  3S1R B;  4OL7 A;  1Y1W G;  1RTN A;  1JQY D;  1X3E A;  4DAY B;  2F0G A;  4BXX G;  4APV A;  4UDU C;  5M3F B;  1RKN A;  2VQE Q;  2Z1C A;  5BN4 A;  3A0J A;  1H9M A;  3L2P A;  4A3K B;  1OXS C;  2E2H H;  4B08 A;  1NUC A;  2BA1 A;  1WTR A;  3HOY B;  1Y1W H;  1U9R A;  2O5J C;  4KV6 A;  3QJY A;  4A4I A;  5T1I A;  2IY5 B;  3PIO 3;  3HKZ E;  1SEB D;  2DJG C;  3GTL B;  1TWF H;  3FKI B;  1AEX A;  5M3M B;  5JEA J;  4DUZ Q;  2UXC Q;  3G6E A;  2VXW A;  1YHQ A;  3K0Y A;  2C35 B;  2RCF A;  2BDN A;  3I72 A;  1MJC A;  4GS3 A;  3PIP A;  3MFG A;  1B50 A;  1AE2 A;  1L0Y B;  4P75 A;  1EIH A;  4IUQ A;  3KF6 A;  1M1K C;  1ML0 D;  3UI2 A;  4BBS B;  3RN2 A;  4KY7 A;  4DK0 A;  4DR1 Q;  4HID A;  3ERQ A;  3RZO H;  3L0O A;  2K5Q A;  2EJG C;  1S5B D;  4BBR H;  1G6Z A;  2A69 C;  4ULL A;  4C3J G;  2K1B A;  2WAQ E;  1D5Z C;  3LGJ A;  3S15 H;  4G7Z C;  5K36 G;  2VUM B;  1KLU D;  1N33 L;  3PO3 G;  2QF7 A;  3CHB D;  1CT1 D;  1TXY A;  1SNO A;  1CHP D;  1B4O A;  1L0X B;  2E76 C;  5C4X G;  1PH5 A;  4CKB A;  2OXP A;  4C3J H;  2Z6K A;  3R3O A;  1F2M A;  2CH4 A;  5T1G A;  1EYA A;  3S2H B;  5FLM G;  3AEV A;  4BY7 H;  1XWE A;  4XT3 B;  3VR5 A;  2JA8 H;  3PO3 H;  1GUG A;  5CR3 A;  5EBD A;  4LF9 L;  1JOO A;  2JA7 G;  2E2D C;  1CFM A;  2M9V A;  5GAH C;  5IT9 L;  5JAV A;  1K8M A;  2RSO A;  3A8K E;  3QOJ A;  1A3T A;  4GLA C;  3TEH B;  3M7N A;  3MEH A;  1Y1V B;  3MXP A;  4CJ1 B;  3RUZ A;  5C3E H;  4QJF A;  3M85 A;  3I4M G;  1QCB D;  1IYJ B;  5IOD A;  3J7Z C;  4J15 A;  3S16 B;  1T5E A;  4UP8 A;  3PGZ A;  3I73 A;  3OHX C;  1SBB B;  1UEB A;  3H94 A;  2NN6 H;  2E8G A;  2O5I C;  4DR6 L;  4AYB E;  3I4M H;  2A6H D;  4CDC C;  1GUN A;  3C1F A;  1L2F A;  4EQP A;  1N9W A;  3FPP A;  1LTR D;  4JG2 A;  1VQ8 A;  3ULP A;  1MSH A;  1RCV D;  5I6W A;  3ULL A;  2RF4 A;  3WOF A;  4GLX A;  2JK8 A;  1LTG D;  4AQY L;  2N3S A;  2ZXO A;  2JQO A;  2EIF A;  3K8A A;  3OW2 A;  2Z0S A;  5IE8 A;  3KLS A;  2IX3 A;  3GTP B;  4N8X 1;  1O7Y A;  4LF9 Q;  2JYO A;  1KDA A;  3S1M H;  3BZC A;  1XNR L;  1FGU A;  4ZAI A;  4QQB X;  3GTQ B;  4QY7 A;  2AQ3 B;  1B3A A;  3EIV A;  3TN2 A;  1Q1B A;  4C2M H;  3E9H A;  1N8R C;  5E1F A;  2A6H C;  3I55 A;  2XGT A;  2JP1 A;  2NVX B;  4DV4 L;  2MUY A;  3E0E A;  2WB1 E;  1K83 H;  4RHS A;  4N9P A;  3ULJ A;  2AUJ D;  1WFQ A;  1SNQ A;  2YTY A;  1JJ2 A;  3H6M A;  3W3A A;  2R7Z G;  1D5M C;  4C3H B;  2E2J B;  4N9T A;  3D6W A;  2Z4H A;  5IP9 G;  5EJW A;  1XNQ L;  2A1A A;  2R93 B;  4L8J A;  1GXD C;  1SJH D;  4FXG C;  2A73 B;  4DR6 Q;  4GOP B;  1DXM A;  4ILW A;  2HIV A;  3NBH B;  3I4N B;  1C8C A;  1W3S A;  4C3I G;  4A3I G;  3DMU A;  3HFZ B;  4LJZ C;  1K0R A;  1E22 A;  2WAQ G;  3D4W A;  2PI2 A;  5ELB A;  4ZLT F;  4KJO A;  5KYL A;  4DU9 A;  1S5E D;  1TWH H;  4DNR B;  2N8N A;  1S5F D;  4AQY Q;  4C3I H;  3HOW H;  4P73 A;  2RHQ B;  3IKJ A;  1O80 A;  5J22 A;  1IZ6 A;  3L7Z C;  4L5T A;  1XNR Q;  1IHZ A;  2N49 A;  1K3R A;  2E2H B;  2ALY B;  4B9W A;  1Y1W B;  2YTX A;  4L5S A;  5EQ0 A;  4HJA A;  2F0U A;  3A8J E;  5DM6 3;  3T56 B;  3UDG A;  5E7N A;  1TWF B;  1D1I A;  4ODG A;  4DV4 Q;  4BY1 B;  2UUB L;  3SK6 A;  2X69 A;  2K52 A;  1IYV A;  1WTP A;  2B2Y A;  1EIY B;  1PH4 A;  2FMC A;  4B9X A;  2EPB A;  3A74 A;  1BCP C;  1O7Z A;  5KGU A;  3A5Z B;  4ZKB B;  3ND9 A;  3ER0 A;  3P75 A;  3KDF A;  1HZ9 A;  3DUZ A;  1EYD A;  2PYK A;  4DKA C;  3TP8 A;  4LFC Q;  2PMZ E;  2R92 G;  3RZO B;  4PZ7 A;  3KJP A;  4BBR B;  1VF7 A;  5LL6 X;  5FO9 B;  4Q0F A;  3S15 B;  2XRS D;  5KNC A;  4Y52 H;  3K7A H;  1TY0 A;  2TSS A;  3VA5 A;  1SYB A;  2B2V C;  4S3S A;  4DN4 M;  2L9H A;  5DM7 3;  1SND A;  3HOX H;  2JXM B;  1JB3 A;  2MP1 A;  4WJ4 A;  4ZK9 B;  1IKM A;  2HUG A;  1QWY A;  2L1B A;  3BS1 A;  4BY7 B;  1XXG A;  3PO3 B;  2KHS A;  2JA8 B;  1X6O A;  4QIW E;  2ICI A;  5BR8 L;  2B2W C;  1TY2 A;  4DGZ A;  1CZG A;  4DV6 L;  4UP9 A;  3S17 H;  5EPK A;  4POF A;  2UUB Q;  1Y69 U;  4FF3 A;  1ESR A;  5C5L A;  2ZTE A;  4K2K A;  2RKS A;  2JE6 I;  2IW3 A;  3ERS X;  4HN7 A;  5JJL A;  5C3E B;  1A15 A;  2Q8I B;  2VL6 A;  1VQO A;  1GJX A;  2RSN A;  1L1O A;  1K8A C;  4JI1 L;  4JBJ A;  4NP5 A;  5COR A;  2NVQ H;  3J80 L;  1BF4 A;  3OPO A;  4LFB Q;  2P5Z X;  3CCQ A;  4KD4 A;  1PYW D;  2RDH A;  2PCF B;  1H9S A;  3RLF A;  1TII D;  2K5W A;  1CKO A;  2ZM6 L;  4LF6 L;  2KOL A;  4OO1 G;  1A62 A;  2YU9 H;  1GHK A;  1V9P A;  5EPL A;  2EYJ A;  1EWI A;  5ELD A;  2LFN A;  2NUC A;  2KUM A;  4HED A;  2J4X A;  4NPS A;  2F0J A;  1FGB D;  5C4J H;  4U68 A;  4KMU C;  4DF7 A;  1PH2 A;  3MVV A;  4ZUJ A;  1BBU A;  4NXM L;  4GNX A;  4OO1 H;  2Q2U A;  4JYA L;  2AMC B;  4HJ5 A;  4BA2 I;  1SLJ A;  4IQZ A;  4UAI A;  3X3M A;  4CBV A;  1YEZ A;  2K4K A;  1I6V C;  3S1M B;  4A3J G;  4DV6 Q;  3R2T A;  1U4R A;  3OMC A;  1PH1 A;  4TVA B;  4DV2 L;  2JA6 G;  1B7Y B;  4A3F H;  1CQF A;  1ZKO A;  4C2M B;  1EFW A;  5CV7 A;  2A5H A;  4PZ6 A;  1HFN A;  3RZD H;  3H0G G;  1EY6 A;  4A3J H;  1N36 L;  1SE3 A;  4C1N I;  3HOZ G;  4F88 A;  2L5T A;  3A7L A;  1SAP A;  1K83 B;  1ET9 A;  2LSS A;  2JA6 H;  4JI1 Q;  2B8G A;  1TWC H;  4WOR A;  1TR5 A;  4K6D A;  4A3E H;  4H44 C;  4FF4 A;  5DAU A;  4DNI A;  5NUC A;  1KAW A;  3G7L A;  5HGT A;  4JC0 A;  1EZ6 A;  5KND A;  3CCE A;  4DV3 L;  1R9T B;  3K58 A;  1NE3 A;  1HUN A;  1MIU A;  3PSI A;  2FHT A;  3IRB A;  1VQP A;  1TWG H;  4M1U B;  2RDG A;  4LF6 Q;  4LUZ A;  4JI3 L;  2F52 A;  1KHI A;  3VR6 A;  3ZJY C;  3MZ5 A;  3KLS X;  3BU2 A;  4DR3 L;  4P72 A;  4CDF C;  5BN5 A;  2Z6K C;  3J7A 5;  4QUC A;  3PO2 G;  1VQH A;  1TWH B;  3TZD A;  4NXM Q;  1A2U A;  1JWU D;  3AYH B;  3N52 A;  4C3I B;  3HOW B;  2IX1 A;  3U58 A;  1NTG A;  3VYS A;  1EY4 A;  2F3W A;  3F2B A;  4XTC S;  3DLL A;  1DYQ A;  3QO2 A;  2IHF A;  3DWA A;  1FNW A;  1EY5 A;  1S4Z A;  2ENB A;  3PUW A;  3PO2 H;  3Q0A A;  1Q8K A;  4DV2 Q;  1R4P B;  1Z6H A;  4KHZ A;  2F3V A;  3S14 H;  4UHV A;  1IL2 A;  2UXB L;  4MTN A;  1VQ4 A;  2OF1 A;  1N36 Q;  2JJQ A;  1S72 A;  1TKW B;  4PV1 C;  3H15 A;  5ELN A;  4RAU C;  2EXZ A;  3PQI A;  3AU7 A;  4LFA L;  4OWT B;  4G7O C;  2LY7 A;  3PUV A;  3R8B A;  2RVL A;  4DV3 Q;  4LF8 L;  4LF7 L;  3CW2 C;  4HIK A;  2D9U A;  1E2W A;  1TT2 A;  2KVM A;  4HMI A;  4AIM A;  1O78 A;  2KJX A;  2EYP A;  4JI3 Q;  4LF4 L;  4FYD A;  1JWS D;  1GHJ A;  4DR3 Q;  4GZY C;  1SYC A;  1VQ6 A;  5C0X G;  4XYO A;  1HHV A;  1JMC A;  4DR4 L;  3SE0 A;  3PMF A;  3UDI A;  1VQD A;  1STE A;  1V1P A;  2WFW A;  3KFU A;  3A55 A;  1VQ9 A;  3K7A B;  1VQC A;  1S40 A;  1NR2 A;  2R61 A;  1X56 A;  3K0X A;  2PQA B;  2EVB A;  3ITP A;  1Q8I A;  3HOX B;  5C0X H;  1FJG L;  3W5O A;  1ASY A;  5LHY 1;  1PFB A;  1CK1 A;  4IJH A;  1BQQ T;  1M90 C;  1QVC A;  5I2Y A;  1ROD A;  2PNR C;  4A3L G;  5GAD C;  1HNZ L;  4RMF A;  1PH6 A;  4JW0 A;  5A35 A;  4WJW A;  5K5P A;  3S17 B;  2KQ3 A;  2V1C C;  4QL5 A;  1K73 C;  4A3B G;  2UXB Q;  3EBE A;  1DGS A;  4IZ8 A;  1OXX K;  4DUY L;  4O1N A;  4LWC A;  2EDG A;  1GUT A;  4A3L H;  2HQL A;  4OON A;  2HT1 A;  2SDF A;  2KCN A;  2QGQ A;  4CJ2 C;  5M5Y H;  4C1N K;  3T1Y L;  1IBL L;  4F87 A;  1W6J A;  1LAC A;  4A3B H;  1F2Y A;  1UE5 A;  1TS2 A;  4LF8 Q;  2NVQ B;  5FK9 C;  3RR5 A;  1V1Q A;  4DV5 L;  5IGB A;  1C48 A;  2MPM A;  2NTS A;  2R7D A;  2EYO A;  1JB7 A;  1LLR D;  4BWG B;  1WTH A;  4JI5 Q;  3KF8 A;  2K5N A;  4O2D A;  3MXN A;  2YU9 B;  4DR4 Q;  3U50 C;  4QUF A;  3OWF A;  3P1H A;  4KN4 C;  1WTQ A;  4FVM A;  2EJF C;  4RGN A;  4DR1 L;  2NN6 I;  1A6X A;  1K3B C;  3BYY B;  5H1S E;  1G6P A;  1SNC A;  2QEX A;  3T16 A;  5FOB B;  3TDQ A;  1KQS A;  4IUV A;  1D7Q A;  5C4J B;  1HNX L;  2ZJR A;  1RF2 D;  1IKL A;  1ZEQ X;  1Q12 A;  1D6E C;  3I3C A;  3GTM H;  4LMQ D;  2KBN A;  3G4S A;  1HNZ Q;  4FXD A;  1NCV A;  2LXK A;  1HQR D;  2XSC A;  1BR9 A;  3PF4 A;  2B2Y C;  4GN4 B;  1C4Q A;  3JC6 6;  1SYF A;  4DUY Q;  2PNH A;  4A3F B;  3CQZ H;  4BS9 A;  1LTT D;  1G91 A;  5CMD A;  4A3C G;  4DK1 A;  1STH A;  4DXF A;  3AFP A;  3OYY A;  2AWO A;  2A69 D;  5JJK A;  1ET6 A;  4HTH A;  4A3J B;  3HOU G;  1H9K A;  4A76 A;  3T1Y Q;  5IY0 A;  1IBL Q;  4BXX H;  3HOV G;  1M4V A;  1CKN B;  1SMX A;  2WIN B;  2JA6 B;  4B3M L;  4K6L A;  2GA4 B;  4A75 A;  1TWC B;  3OIP A;  4A3E B;  1NSN S;  1QE6 A;  3I70 A;  4IUN A;  4EQO A;  5I2X A;  4DV5 Q;  2K50 A;  5I9O A;  1G51 A;  1B2T A;  3IAY A;  3TRZ A;  1VQ5 A;  3M9B A;  3HOV H;  1TWG B;  1VMC A;  2F3I A;  3E9I A;  3CPW A;  2G9H D;  3K57 A;  3UDF A;  1QUQ B;  2K33 A;  2R7F A;  1U4L A;  2H5X A;  4Q5V A;  3EVQ A;  5JPM C;  3MHB A;  3PUY A;  4CKC A;  4DXG A;  4YWL A;  1G2T A;  4DV7 Q;  1HNX Q;  3J81 E;  2VS1 A;  5A2Q E;  2KED A;  3GTG H;  2L4N A;  2F1M A;  5HY6 A;  2B2U A;  2K28 A;  1B1Z A;  1HZB A;  4JI8 L;  3PO2 B;  2VB3 X;  4HSP A;  1EY8 A;  1LTS D;  4O0A A;  1S5D D;  1PVO A;  1ZYR D;  3V2T A;  2ES2 A;  4OEM B;  4C56 C;  2M2L A;  5K36 H;  1VQJ A;  2GN5 A;  4UP7 A;  1EZ8 A;  1OTC A;  4DR7 L;  3E6Z X;  2WAC A;  4OEL B;  1L1O C;  2I5L X;  4J6H A;  3S14 B;  1UWV A;  3F1Z A;  2EYL A;  4R9W A;  3K5M A;  2JA5 G;  1R4Q B;  2EY2 A;  4IOA A;  1LT6 D;  3K5L A;  3CCJ A;  3QIA A;  5C4X H;  2DNE A;  1MI2 A;  2HHH L;  1DON A;  4K14 A;  1KNA A;  3T53 B;  1WVL A;  4B3M Q;  2CQA A;  4R4T A;  1YNN D;  2ZXR A;  2GVB A;  4KN7 C;  4KY5 A;  5FLM H;  2DY8 A;  5M5X H;  4YIJ A;  3GO5 A;  2HQE A;  4G4K A;  1SE4 A;  2AHO B;  2IPK D;  2JA5 H;  3R2I A;  2JA7 H;  3G48 A;  3EQL C;  1RJT A;  3Q8D A;  3MTS A;  1XX8 A;  2BA0 A;  2NB0 A;  5J39 A;  2PQE A;  2C5C A;  1NMG A;  3QB3 A;  4YCU A;  1ZYR C;  4IUT A;  5C5M A;  1WJJ A;  2K5H A;  4A3G G;  4GNX C;  1BO0 A;  1X54 A;  1BUV T;  5KNB A;  4RH6 A;  5CV5 A;  1SRO A;  3A56 A;  1C7Y A;  1WTO A;  3SK8 A;  3LX0 A;  1II3 A;  1VQ7 A;  3CC2 A;  3NE5 B;  2J7Z A;  1KDB A;  2Y0S E;  3TZU A;  4A3G H;  1YNN C;  2KCT A;  1BCP F;  3BDC A;  2K01 A;  1UUP A;  4JI8 Q;  2IHE A;  4RKL A;  2MHV A;  3ERO A;  5KYI A;  3NEL A;  2EE1 A;  3KF6 B;  4MN3 A;  1SMY D;  1ESF A;  1CHQ D;  4DR7 Q;  1PH8 A;  3QWN A;  3CKI B;  2MO1 A;  2E5L L;  3D3R A;  1Y8N B;  4L5R C;  2ID0 A;  2G5D A;  2HHH Q;  3M4O H;  2NZH A;  1EOT A;  3BZK A;  5M5Y B;  1CM9 A;  2JN4 A;  5FJ8 G;  3HKZ G;  1YJN A;  1EY0 A;  5C4H A;  1WTV A;  3T4A C;  3STB C;  1X3F A;  4IFD G;  2K04 A;  3AFQ A;  1IBM L;  5KRU A;  1BNZ A;  1T9H A;  4F7X A;  4DAP A;  1SR3 A;  2O4X A;  2WP8 J;  1A0I A;  3FMC A;  1EEF D;  1NY4 A;  1HZC A;  1Z7T A;  1GD7 A;  1SMY C;  2MJ8 A;  1DM0 B;  3I7F A;  5CV6 A;  1QOH A;  2I5M X;  4IFD H;  2F0W A;  4CJ0 B;  4V19 0;  2F0L A;  3LNN A;  3S2D H;  3PUZ A;  4LFC L;  3GD7 A;  4Z9C B;  2R7Z H;  2D0P A;  5DEH A;  5JJI A;  1F77 A;  5IP9 H;  2OEO A;  3DWP A;  3U4Z A;  4KKU A;  1BDO A;  1RL2 A;  4RA8 A;  1EWH A;  2Q2T A;  1BCP D;  1HFG A;  1PA6 A;  1PZI D;  4H13 C;  1AZP A;  3NWT A;  4A3I H;  4P71 A;  1ASZ A;  3T51 B;  3DM3 A;  4OO1 I;  1PDQ A;  2E5L Q;  3CQZ B;  5D14 A;  2DJF C;  2K7V A;  3W1G A;  1MD2 D;  4R4C A;  1FNU A;  3Q22 A;  1D8L A;  1DOM A;  2WV6 D;  1J8I A;  3EN2 A;  1L0W A;  1HNW Q;  4TSS A;  1LTI D;  4A3M G;  4HCS A;  2CW0 D;  5EKI A;  1E0B A;  3J81 c;  1F9S A;  4DK3 C;  5EGT A;  3M4P A;  3S9W A;  1H9J A;  2HD3 A;  2XWB B;  4DPG A;  2EYM A;  1VQL A;  3E0J A;  3RD4 A;  3AMU A;  4GN5 A;  3GTJ H;  1DCZ A;  1IBM Q;  2EY1 A;  4LUV A;  1CUK A;  3G71 A;  2A6E D;  4ZRZ A;  4DNT B;  3HOV B;  3FPU B;  4FNF A;  2HCC A;  1BVS A;  4ZQ3 A;  2QW7 A;  1O7I A;  4JI0 L;  3CCL A;  4LFB L;  5ELF A;  5GQO A;  1G2S A;  3BZD B;  5BN3 A;  4A3D G;  3Q6S A;  2IX0 A;  5IWA L;  3FVQ A;  1BBX C;  1JE4 A;  2F0K A;  2AQ1 B;  4LK1 C;  4AYB G;  1STY A;  3DHQ A;  1QB5 D;  1DOL A;  3C46 A;  2A74 C;  2CW0 C;  4OIJ A;  1PFS A;  3K81 C;  4PZ8 A;  3GTG B;  1CA6 A;  4IPG A;  1JOQ A;  4NXN L;  3F2D A;  1EFI D;  3DXJ C;  1EQQ A;  2F0F A;  2R92 H;  1IYU A;  2ATW A;  2RCN A;  3MXG A;  1UE6 A;  3NSW A;  5JPN C;  1K8G A;  3M7G A;  4C3J B;  2A6E C;  3IFD A;  4YHH L;  1G29 1;  2D62 A;  1J9O A;  1TWA H;  2EXD A;  4KY6 A;  3U9S A;  1E1T A;  4RGO S;  2B63 G;  4X3U A;  1X3P A;  4JK1 C;  5C4X B;  3CRL C;  2B2T A;  4P74 A;  3GTO H;  4NDX A;  3J81 i;  1EWC A;  2B63 H;  3CCR A;  2A68 D;  1DJR D;  2NVY H;  2JA7 B;  2WB1 G;  4QB4 A;  2L0C A;  1GVP A;  2CVR A;  1WTX A;  4KK7 A;  2YYZ A;  2Q2H A;  1MHW C;  5C44 G;  1C0A A;  4JI0 Q;  3TME A;  1WCM G;  3B6Y A;  5JVH 3;  4LF5 L;  3H3V C;  5GAG C;  1RD9 D;  2EYF A;  1E3P A;  3VYU A;  5IWA Q;  1HZA A;  3VA7 A;  1O7L A;  1U0L A;  1LYL A;  3I4M B;  3CD6 A;  3MAQ A;  1PZK D;  3S24 A;  1I3Q H;  1WCM H;  1EEI D;  4OWW B;  3RMH A;  4NXN Q;  4A3G B;  1Q1E A;  4IPC A;  2XIW A;  2F0H A;  4KLK A;  2KCM A;  4J1M A;  5FLX E;  1EQV A;  3IL8 A;  4ID6 A;  5FO7 B;  5C3W A;  2A68 C;  1N34 Q;  4YHH Q;  3KDF B;  4EQN A;  1LTL A;  4Y7N H;  3TP6 A;  1QVG A;  2F0E A;  2BE5 D;  2L11 A;  3C1E A;  5D65 A;  5JVG 3;  5JEA G;  3OWE B;  1JT8 A;  2F0O A;  2R6G A;  4YWK A;  4RWS C;  1RIP A;  4K8I A;  3D31 A;  4K5V A;  3M4O B;  1Y8O B;  3I2Z A;  3HP3 A;  5E4W C;  4X62 L;  4X65 Q;  3OW7 A;  2KEE A;  1JJG A;  1VQM A;  5M3F G;  1AH9 A;  5CBA E;  1X32 A;  5GRO A;  3D4D A;  3HOY G;  4DR5 L;  1SFO H;  4M8A A;  3S1R H;  3HRZ C;  1BKB A;  1U4P A;  2B8F A;  1EIF A;  2PPB C;  5IGG A;  3KBG A;  4LF5 Q;  3HKZ B;  4YY3 L;  4IJL A;  4NW2 A;  5M3M G;  3H0G H;  1U5K A;  2BE5 C;  3M3Y H;  5ISR A;  3HOZ H;  2OQ0 A;  1F9R A;  1AE3 A;  2B2U C;  3N6R A;  1Q86 C;  1EQT A;  3HKS A;  3W2D A;  3S2D B;  3PUX A;  1WD1 A;  1JJC B;  4CDE C;  1K28 A;  4JBW A;  2R7Z B;  2KHJ A;  5IYD G;  1HA6 A;  1P8L A;  4L6T B;  3T13 A;  3NQI A;  3PIO A;  3CCM A;  1PTO F;  1P16 A;  2OTL A;  4CDD C;  3J81 L;  1L1O B;  1QG7 A;  5A2Q L;  3CRK C;  4A3I B;  2B3G A;  1KIX A;  3FP9 A;  2UUC L;  4HJ7 A;  5IYD H;  2WAQ B;  3D6C A;  3KUP A;  1E7Z A;  2A8V A;  4IFD J;  2VUM G;  1CA5 A;  4PMB A;  4RCO A;  1H9S B;  3K80 C;  4I7Z C;  3MA2 B;  2NWG A;  1PV4 A;  1SXT A;  4CHT B;  1VQK A;  4B3T L;  1KTK A;  3SDZ A;  2L12 A;  4X62 Q;  3J81 j;  2OQK A;  1EU4 A;  1XJV A;  1D5X C;  1QNU A;  1Y14 B;  4IAL A;  4OGQ C;  3GTJ B;  4DR5 Q;  1ILQ A;  3H3V H;  5L37 A;  1JE5 A;  4GNX B;  1SN8 A;  1DD2 A;  4B3S L;  1VMP A;  4K0K L;  3L3O C;  4YY3 Q;  2MO0 A;  4CGY B;  1B44 D;  1KD1 C;  5ELO A;  3EJI A;  3LWU A;  1X3Q A;  3TS0 A;  2D0O A;  4TQU S;  4J8Q A;  2I0Q A;  3GV3 A;  3ICE A;  1I50 H;  1I94 L;  4XIG S;  5D3D A;  2NVT H;  3I8Z A;  5CV4 A;  4JI5 L;  3JAM E;  3NUC A;  4HR7 B;  4XYQ A;  3VR4 A;  2FFK B;  4F8M A;  1JR0 D;  2I46 A;  3ZYY X;  5KEE A;  3G6J B;  1XPO A;  1EYG A;  4JCV E;  5EKK A;  3U4V A;  1WOC A;  5LMU L;  1PTO D;  2X6L A;  4IPH A;  2R92 B;  1EY9 A;  4AYB B;  4X3S A;  3HEJ A;  2UUC Q;  3K6O A;  2DUD A;  1YJ9 A;  1EYC A;  1HR0 W;  1OXT A;  1SYE A;  3NHH A;  4QF4 A;  4R4Q A;  4DAY A;  3M4Q A;  5DLQ E;  5IT9 c;  4FXK C;  4UPA A;  4I65 A;  1ONL A;  1TWA B;  1WI5 A;  2FIN B;  2SEB D;  3K7U C;  2CCZ A;  5AJ3 Q;  4YWM A;  3CXC A;  1VQI A;  4RCN A;  2QEJ C;  1PH9 A;  4B3T Q;  5IYB G;  3AQQ A;  1QIL A;  2DGY A;  3MEF A;  5CBE E;  1EQR A;  4RKB A;  3CC4 A;  3P7J A;  5I6Y A;  3GTO B;  1E1O A;  1FR3 A;  4RGT A;  5FLX c;  2B63 B;  4DK6 C;  2NVY B;  4B3S Q;  1QZG A;  5FKA C;  4K0K Q;  2LMC B;  3T1H L;  4FF2 A;  1E24 A;  1PTO C;  1QJO A;  4DFA A;  1QNK A;  1HPC A;  2AQ2 B;  1OXV A;  1AFP A;  5EBC A;  2I5H A;  5C4Z A;  3GV6 A;  1I94 Q;  1JC7 A;  4NMZ A;  2WB1 B;  1V8Q A;  1KNE A;  4IUU A;  5ELC A;  3KK7 A;  4H02 A;  3R93 A;  1PLF A;  1PRT F;  2VB2 X;  1I3Q B;  1NBW A;  4C3H G;  2HIX A;  4IUP A;  1V43 A;  4YCW A;  4PQX A;  1RDP D;  2R93 G;  5LMU Q;  3S1N H;  2I07 B;  2KHI A;  4HIO A;  1JWM D;  3O13 A;  4L63 B;  5CV9 A;  4EQ5 A;  2FMM A;  3I4N G;  3CC7 A;  4DV7 L;  3BDL A;  3IFT A;  2H1E A;  2CQO A;  3TP5 A;  2V4D A;  4Y7N B;  1QVF A;  5CYU A;  1KAB A;  3M4Y A;  1LV9 A;  2SNM A;  3HG9 A;  4PMC A;  1YVC A;  2F0M A;  3SGI A;  3J7A V;  3MWY W;  3SEB A;  5IOC A;  1V1P B;  1BCP B;  1YHB A;  3RZD B;  3HS0 C;  2OCE A;  5C6A A;  2OT2 A;  2PW5 A;  3TRE A;  3T1H Q;  1SFO B;  3TS2 A;  1GUO A;  2MFI A;  1A3U A;  2F0P A;  1DZ1 A;  4A3C H;  2IWH A;  4HCE A;  1X55 A;  1KDC A;  4BY1 G;  3H0G B;  3M3Y B;  4FP5 D;  3HOU H;  3HOZ B;  1IL8 A;  2JEB I;  3CU7 A;  1D1K A;  1SSO A;  1Z47 A;  3CME A;  1B9N A;  2PZW A;  2EZV A;  1SJE D;  3U9O A;  4IFD I;  1LTA D;  4BY1 H;  1PRT D;  5M9O A;  3URY A;  2DY7 A;  3ONA B;  1XPR A;  3RN5 A;  4GKK L;  2FJ2 A;  2KCC A;  4R8I A;  1FNV A;  2PMZ B;  1YIJ A;  1IW7 C;  2QIL A;  2PW7 A;  4BBR G;  4HIM A;  1X3G A;  3F2U A;  1VS0 A;  1I4H A;  1T5X D;  2B2T C;  1Y8P B;  2SNS A;  3S1Q H;  4ZCK A;  1EOV A;  5J3B A;  2QKI C;  1NNX A;  4L5Q A;  2UXD L;  3KF8 B;  4X66 L;  1MBY A;  1LM0 A;  1YIT A;  2JSO A;  3NTK A;  3MXN B;  4G7H C;  1FVI A;  1WTW A;  1VQE A;  1K9M C;  3JAM c;  4OXP A;  1EIG A;  3BVM A;  4H7B A;  1PTO H;  3VR3 A;  2K5D A;  4JBK A;  4XDX A;  4LNQ A;  4BY7 G;  2JA8 G;  4QIW B;  1PRT C;  4ME5 A;  4OX9 L;  5G3L F;  1I6H H;  3SXH A;  4JV5 L;  3TQY A;  1OXU A;  2H4O A;  2L15 A;  1BBW A;  4WFN 3;  2OWO A;  3VYT A;  3C3L A;  3NEM A;  4OWX B;  3QG1 A;  1NAP A;  4RGM A;  1I50 B;  4JBM A;  3TSS A;  2NVT B;  5C3E G;  4GOP A;  3KLR A;  5M5W H;  3NBH A;  1TVX A;  1CSP A;  5IGE A;  3D4R A;  3V05 A;  3W1B A;  1J6Q A;  4KKS A;  4GKK Q;  4CKE A;  2NN6 G;  5LL6 S;  3K5N A;  1YBY A;  3KBX A;  1B3Q A;  3STB D;  3RNU A;  4KD3 A;  5JOB A;  1GKH A;  1UNS A;  2DN8 A;  2VZA A;  5FLX L;  2D5D A;  2HDM A;  1PYS B;  2KA7 A;  3SR1 A;  2UXD Q;  3ND8 A;  4X66 Q;  2A19 A;  4XT1 B;  2E2I H;  1HTP A;  4HSV A;  1EY7 A;  5J1Z A;  1PXU A;  2CKZ B;  2L55 A;  1N33 Q;  4KI0 A;  1STG A;  1SYG A;  3J80 c;  3MC0 B;  1PFM A;  3JAM i;  4OX9 Q;  1SNM A;  1S3O A;  1HNW L;  1CSQ A;  2E74 C;  3CCV A;  3CCU A;  1PHJ A;  1ZXT A;  1YNJ D;  4JV5 Q;  2K75 A;  4XQJ A;  1AZQ A;  1JCK B;  3I4L A;  5G3L D;  4E6I A;  5C0X J;  5EAY A;  4A3B B;  4PNY A;  2O2L D;  3I4O A;  1BOS A;  3FEW X;  4TRD A;  2BCO A;  1X9N A;  3Q24 A;  1HTL D;  2N55 A;  5E3F A;  2XN9 C;  2ASB A;  1AP0 A;  1XTD A;  4MIU A;  1F9Q A;  5FJ8 H;  4R4O A;  3BVZ A;  1TS4 A;  1KAA A;  2AWN A;  1HA5 A;  2QDL A;  1NR4 A;  2ICE C;  1H95 A;  1RHP A;  2J0T D;  2F0V A;  1XTC D;  1LAB A;  2VQF L;  3S1N B;  4LW1 A;  1S5C D;  1HCZ A;  2PO4 A;  1IXR A;  1JOK A;  3FHW A;  4POG A;  1SNP A;  2RHS B;  2K6A A;  2NTT A;  1SYD A;  1YNJ C;  2QA4 A;  1B53 A;  5E4X A;  3HZX A;  2IL8 A;  3P20 A;  1HR0 L;  2NYZ D;  4RHR A;  2AKW B;  3GTM B;  1R9T H;  1PH7 A;  1K0S A;  1Q82 C;  1KC8 C;  4MZ9 A;  2Z6B A; 
#chains in the Genus database with same CATH homology
 3Q23 A;  2EY5 A;  1OO9 B;  1PZJ D;  1STA A;  1ICW A;  3DWQ A;  5CGK A;  5IGD A;  2HDL A;  3TBI B;  3MFY A;  4OIK A;  2BDO A;  5I9P A;  4ZUI A;  3PIP 3;  4ZKC B;  1LT3 D;  1ENC A;  2C9O A;  1K8O A;  3HOU B;  5FO8 B;  1MSG A;  1HQM C;  1KLG D;  1B9M A;  1EL0 A;  2WII B;  1FYC A;  4TKO B;  4WRD A;  4FO2 A;  1E2V A;  1UAP A;  4LAA A;  4BA1 I;  3VYR A;  2Z8L A;  5CC4 A;  3JAM L;  3K5O A;  4QMG A;  5C3X A;  1ENA A;  3OIQ A;  1AN8 A;  4G57 A;  3SHL A;  2LKV A;  3S1Q B;  1M8A A;  1RTO A;  2G9D A;  1STN A;  3AB9 A;  5CV8 A;  3MXU A;  2WKC A;  2EJM A;  1A2T A;  1G8Z D;  4ZYS A;  2EY6 A;  2RA4 A;  4H0L C;  1JIC A;  4K2L A;  1PTO B;  4X3K A;  1V1O A;  4ABN A;  1I6H B;  2F0T A;  2HCI A;  1U4M A;  2K05 A;  3A54 A;  3FDT A;  5M5X B;  1STB A;  3FRP B;  1HXY D;  4NKL A;  2JA5 B;  4V0B A;  1Q90 A;  2Q8T A;  3NTH A;  4HMJ A;  3J7A F;  4X3T A;  3BYT B;  5M5W B;  1I4Q A;  5IT9 E;  4P2C B;  2E75 C;  4XXE A;  2TMP A;  3QOL A;  3A7A B;  2XNA C;  4KTA A;  3E5S A;  1F9P A;  2R3Z A;  4XQN A;  4MHE A;  2Q8R E;  3NBI A;  2VNU D;  3NPP A;  4O42 A;  3DEP A;  1W6K A;  3BDO A;  5C0X I;  2LS0 1;  2E2I B;  2B39 A;  5COY A;  5ELE A;  4KKT A;  2ZT9 C;  2F0I A;  1PMR A;  3H91 A;  5D3I B;  1PFN A;  2K32 A;  2NBF A;  5AFW A;  2DNC A;  3OSO A;  1DOK A;  2SOB A;  5JEA H;  5DNF A;  2KEC A;  1FD7 D;  4IN3 A;  2MGS A;  4EVO A;  1HRJ A;  3WOE A;  3OOC A;  1H9R A;  1F2L A;  2PZU A;  3GQB A;  2XRQ D;  3SK4 A;  5I4D A;  1A3V A;  3WDN A;  2RQX A;  3HGB A;  1I4G A;  3DM1 A;  5TSS A;  1F2Z A;  1VDZ A;  4KHV A;  3K59 A;  2XWJ B;  4HAE A;  1Q3L A;  3EFX D;  1MGS A;  2RBM A;  2F0N A;  4FF1 A;  3C2P A;  5JJZ A;  3BG3 A;  3L9A X;  1GUW A;  3V96 A;  1UEA B;  1PRT B;  3EA6 A;  3SVM A;  2EYH A;  3NTI A;  1LT5 D;  1CI3 M;  5HUR A;  2F4I A;  5IIF A;  2PZT A;  4R8N A;  1CQV A;  2F03 A;  3NK9 A;  5EKL A;  3H09 A;  3I91 A;  1ENF A;  4A3M B;  4RFB A;  2JEA I;  1EU3 A;  2EOT A;  1JOR A;  1TQO A;  1SDF A;  2IJ0 A;  1ILP A;  1LTB D;  2F0D A;  1VF5 C;  1AW7 A;  1I4X A;  2CHB D;  2N88 A;  1LO5 D;  4A93 B;  3NWS A;  4DAV A;  4A3D B;  4QCL A;  3BVG A;  3A8I E;  3D8G A;  1D2B A;  5IGF A;  3TP7 A;  2Y0S B;  1SE2 A;  3NP8 A;  5KIX A;  1I4R A;  3LWE A;  5EPJ A;  4PMW A;  1GOZ A;  4K8J A;  4EGV A;  2WKD A;  2F0S A;  3GP7 A;  2XVS A;  3I90 A;  1E2Z A;  3SK5 A;  1TS3 A;  3PV0 A;  1LT4 D;  3DEO A;  4K5W A;  1WD0 A;  2ZXP A;  3NXW A;  2B2V A;  1I4P A;  4K5X A;  1TU2 B;  2BOS A;  2D2C C;  4KJN A;  2M00 A;  3NQT A;  5C44 B;  1WCM B;  3X3N A;  3VR2 A;  2B2W A;  1BXT A;  1XYI A;  1TS5 A;  4IUR A;  3J80 E;  1GUS A;  4U67 3;  2NZ1 D;  4DA2 A;  2RDF A;  1VCI A;  2IT1 A;  3GTK B;  2AUK A;  2QCP X;  1HUM A;  3OMG A;  2X6G A;  5IGC A;  2K03 A;  4XQQ A;  2QDB A;  4OHJ A;  2Z4I A;  3J7Y W;  2F0Q A;  1CTM A;  1IW7 D;  5F2D A;  1CZW A;  3S1R B;  4OL7 A;  1RTN A;  1JQY D;  2F0G A;  4UDU C;  5M3F B;  1RKN A;  2Z1C A;  5BN4 A;  1H9M A;  4A3K B;  1OXS C;  4B08 A;  1NUC A;  2BA1 A;  1WTR A;  3HOY B;  1U9R A;  2O5J C;  4KV6 A;  3QJY A;  5T1I A;  3PIO 3;  1SEB D;  3GTL B;  3FKI B;  5M3M B;  1AEX A;  5JEA J;  2VXW A;  3K0Y A;  2BDN A;  3I72 A;  3MFG A;  1B50 A;  1L0Y B;  1EIH A;  4IUQ A;  1ML0 D;  3UI2 A;  4BBS B;  4KY7 A;  4DK0 A;  3ERQ A;  2K5Q A;  2EJG C;  1S5B D;  1G6Z A;  2A69 C;  4ULL A;  4C3J G;  2K1B A;  1D5Z C;  4G7Z C;  5K36 G;  2VUM B;  1KLU D;  2QF7 A;  3CHB D;  1CT1 D;  1SNO A;  1CHP D;  1B4O A;  1L0X B;  2E76 C;  4CKB A;  2OXP A;  3R3O A;  1F2M A;  5T1G A;  1EYA A;  3S2H B;  1XWE A;  4XT3 B;  3VR5 A;  1GUG A;  5CR3 A;  5EBD A;  1JOO A;  2E2D C;  1CFM A;  2M9V A;  5IT9 L;  5JAV A;  1K8M A;  2RSO A;  3A8K E;  3QOJ A;  1A3T A;  3M7N A;  3MEH A;  1Y1V B;  3MXP A;  4CJ1 B;  3RUZ A;  3M85 A;  1QCB D;  5IOD A;  3S16 B;  1T5E A;  3I73 A;  3OHX C;  1SBB B;  3H94 A;  2NN6 H;  2O5I C;  2A6H D;  1GUN A;  3C1F A;  4EQP A;  3FPP A;  1LTR D;  1MSH A;  1RCV D;  5I6W A;  3WOF A;  1LTG D;  2ZXO A;  3KLS A;  2IX3 A;  3GTP B;  1O7Y A;  2JYO A;  1KDA A;  4ZAI A;  3GTQ B;  2AQ3 B;  1B3A A;  3TN2 A;  1Q1B A;  5E1F A;  2A6H C;  2JP1 A;  2NVX B;  2MUY A;  4RHS A;  4N9P A;  2AUJ D;  1SNQ A;  3H6M A;  3W3A A;  1D5M C;  4C3H B;  2E2J B;  4N9T A;  3D6W A;  2Z4H A;  5EJW A;  2R93 B;  4L8J A;  1GXD C;  1SJH D;  4FXG C;  2A73 B;  1DXM A;  4ILW A;  3I4N B;  1C8C A;  4C3I G;  3DMU A;  4LJZ C;  3D4W A;  5ELB A;  4ZLT F;  4KJO A;  5KYL A;  4DU9 A;  1S5E D;  4DNR B;  1S5F D;  3IKJ A;  1O80 A;  5J22 A;  3L7Z C;  1IHZ A;  2E2H B;  4B9W A;  1Y1W B;  5EQ0 A;  2F0U A;  3A8J E;  5DM6 3;  3T56 B;  1TWF B;  1D1I A;  4ODG A;  4BY1 B;  3SK6 A;  2X69 A;  1IYV A;  1WTP A;  2B2Y A;  2FMC A;  4B9X A;  2EPB A;  1BCP C;  1O7Z A;  5KGU A;  4ZKB B;  3ND9 A;  3P75 A;  3DUZ A;  1EYD A;  2PYK A;  3TP8 A;  3RZO B;  4BBR B;  1VF7 A;  5LL6 X;  5FO9 B;  4Q0F A;  3S15 B;  2XRS D;  5KNC A;  1TY0 A;  2TSS A;  3VA5 A;  1SYB A;  2B2V C;  4S3S A;  4DN4 M;  2L9H A;  5DM7 3;  1SND A;  2JXM B;  1JB3 A;  2MP1 A;  4ZK9 B;  1IKM A;  2HUG A;  1QWY A;  2L1B A;  3BS1 A;  4BY7 B;  1XXG A;  3PO3 B;  2KHS A;  2JA8 B;  2ICI A;  2B2W C;  1TY2 A;  4DGZ A;  1CZG A;  5EPK A;  1Y69 U;  4FF3 A;  1ESR A;  5C5L A;  4K2K A;  2RKS A;  2JE6 I;  2IW3 A;  4HN7 A;  5C3E B;  1A15 A;  2Q8I B;  1GJX A;  2RSN A;  4NP5 A;  5COR A;  3J80 L;  1BF4 A;  3OPO A;  4KD4 A;  1PYW D;  2RDH A;  2PCF B;  1H9S A;  3RLF A;  1TII D;  2K5W A;  2KOL A;  4OO1 G;  1GHK A;  5EPL A;  2EYJ A;  5ELD A;  2LFN A;  2NUC A;  2KUM A;  4HED A;  2J4X A;  2F0J A;  1FGB D;  4U68 A;  4KMU C;  4DF7 A;  3MVV A;  4ZUJ A;  4OO1 H;  4BA2 I;  4IQZ A;  4UAI A;  3X3M A;  4CBV A;  1I6V C;  3S1M B;  3R2T A;  1U4R A;  3OMC A;  1CQF A;  1ZKO A;  4C2M B;  5CV7 A;  2A5H A;  1HFN A;  1EY6 A;  1SE3 A;  4C1N I;  4F88 A;  2L5T A;  3A7L A;  1SAP A;  1K83 B;  1ET9 A;  2B8G A;  4WOR A;  1TR5 A;  4K6D A;  4H44 C;  4FF4 A;  5DAU A;  5NUC A;  3G7L A;  5HGT A;  1EZ6 A;  5KND A;  1R9T B;  3K58 A;  1HUN A;  2FHT A;  4M1U B;  2RDG A;  3VR6 A;  3MZ5 A;  3KLS X;  5BN5 A;  4QUC A;  1TWH B;  3TZD A;  1A2U A;  1JWU D;  4C3I B;  3N52 A;  3HOW B;  2IX1 A;  3VYS A;  1EY4 A;  2F3W A;  4XTC S;  1DYQ A;  3QO2 A;  3DWA A;  1FNW A;  1EY5 A;  1S4Z A;  2ENB A;  3PUW A;  3Q0A A;  1R4P B;  1Z6H A;  4KHZ A;  2F3V A;  2OF1 A;  1TKW B;  4PV1 C;  4RAU C;  2EXZ A;  3AU7 A;  4G7O C;  2LY7 A;  3PUV A;  3R8B A;  2RVL A;  2D9U A;  1E2W A;  1TT2 A;  2KVM A;  4HMI A;  1O78 A;  2KJX A;  2EYP A;  4FYD A;  1JWS D;  1GHJ A;  4GZY C;  1SYC A;  5C0X G;  4XYO A;  1HHV A;  3SE0 A;  3PMF A;  1STE A;  1V1P A;  3A55 A;  3K7A B;  1NR2 A;  2R61 A;  2EVB A;  3ITP A;  1Q8I A;  3HOX B;  5C0X H;  5LHY 1;  1PFB A;  1CK1 A;  1BQQ T;  5I2Y A;  1ROD A;  2PNR C;  5A35 A;  4WJW A;  5K5P A;  3S17 B;  2KQ3 A;  4IZ8 A;  1OXX K;  4O1N A;  2EDG A;  1GUT A;  2SDF A;  2KCN A;  4CJ2 C;  4C1N K;  4F87 A;  1W6J A;  1LAC A;  1F2Y A;  1TS2 A;  2NVQ B;  5FK9 C;  5IGB A;  1C48 A;  2MPM A;  2NTS A;  2EYO A;  1LLR D;  4BWG B;  3KF8 A;  3MXN A;  2YU9 B;  4QUF A;  3OWF A;  3P1H A;  4KN4 C;  1WTQ A;  4FVM A;  2EJF C;  4RGN A;  2NN6 I;  1A6X A;  3BYY B;  1SNC A;  3T16 A;  5FOB B;  3TDQ A;  4IUV A;  5C4J B;  1RF2 D;  1IKL A;  1ZEQ X;  1Q12 A;  1D6E C;  3I3C A;  4LMQ D;  4FXD A;  1NCV A;  2XSC A;  1HQR D;  1BR9 A;  2B2Y C;  1C4Q A;  1SYF A;  4A3F B;  4BS9 A;  1LTT D;  1G91 A;  5CMD A;  4DK1 A;  1STH A;  4DXF A;  2AWO A;  2A69 D;  1ET6 A;  4HTH A;  4A3J B;  1H9K A;  1M4V A;  2WIN B;  2JA6 B;  4K6L A;  2GA4 B;  1TWC B;  3OIP A;  4A3E B;  1NSN S;  1QE6 A;  3I70 A;  4IUN A;  4EQO A;  5I2X A;  5I9O A;  1B2T A;  3IAY A;  1TWG B;  1VMC A;  2G9H D;  3K57 A;  2K33 A;  1U4L A;  4Q5V A;  3EVQ A;  5JPM C;  3MHB A;  3PUY A;  4CKC A;  4DXG A;  1G2T A;  3J81 E;  5A2Q E;  2KED A;  2L4N A;  2F1M A;  2B2U A;  2K28 A;  1B1Z A;  3PO2 B;  2VB3 X;  4HSP A;  1EY8 A;  1LTS D;  1S5D D;  1ZYR D;  3V2T A;  4C56 C;  2M2L A;  5K36 H;  1EZ8 A;  3E6Z X;  2WAC A;  3S14 B;  4J6H A;  2EYL A;  4R9W A;  3K5M A;  1R4Q B;  2EY2 A;  1LT6 D;  3K5L A;  3QIA A;  2DNE A;  1MI2 A;  1DON A;  4K14 A;  1KNA A;  3T53 B;  1WVL A;  2CQA A;  1YNN D;  2ZXR A;  4KN7 C;  4KY5 A;  2DY8 A;  4YIJ A;  3GO5 A;  2HQE A;  2IPK D;  1SE4 A;  4G4K A;  3R2I A;  3EQL C;  1RJT A;  3MTS A;  1XX8 A;  2BA0 A;  2NB0 A;  5J39 A;  2PQE A;  2C5C A;  3QB3 A;  1ZYR C;  4IUT A;  5C5M A;  1BO0 A;  1BUV T;  5KNB A;  4RH6 A;  5CV5 A;  3A56 A;  1WTO A;  3SK8 A;  3LX0 A;  1II3 A;  3NE5 B;  2J7Z A;  1KDB A;  3TZU A;  1YNN C;  1BCP F;  3BDC A;  2K01 A;  1UUP A;  4RKL A;  2MHV A;  3ERO A;  5KYI A;  2EE1 A;  4MN3 A;  1SMY D;  1ESF A;  1CHQ D;  3QWN A;  3CKI B;  3D3R A;  1Y8N B;  2ID0 A;  1EOT A;  5M5Y B;  1CM9 A;  1EY0 A;  5C4H A;  1WTV A;  3T4A C;  4IFD G;  2K04 A;  5KRU A;  1BNZ A;  4F7X A;  4DAP A;  2O4X A;  2WP8 J;  3FMC A;  1EEF D;  1Z7T A;  1SMY C;  2MJ8 A;  1DM0 B;  5CV6 A;  1QOH A;  4IFD H;  2F0W A;  4CJ0 B;  4V19 0;  2F0L A;  3LNN A;  3PUZ A;  3GD7 A;  4Z9C B;  5DEH A;  1F77 A;  2OEO A;  3DWP A;  4KKU A;  1BDO A;  4RA8 A;  1EWH A;  1BCP D;  1HFG A;  1PZI D;  4H13 C;  1AZP A;  3NWT A;  3T51 B;  4OO1 I;  1PDQ A;  3CQZ B;  5D14 A;  2K7V A;  1MD2 D;  1FNU A;  3Q22 A;  1DOM A;  2WV6 D;  1J8I A;  4TSS A;  1LTI D;  4HCS A;  2CW0 D;  5EKI A;  1E0B A;  1F9S A;  5EGT A;  3S9W A;  1H9J A;  2XWB B;  2EYM A;  3E0J A;  3RD4 A;  3AMU A;  1DCZ A;  2EY1 A;  2A6E D;  4ZRZ A;  4DNT B;  3HOV B;  3FPU B;  4FNF A;  2HCC A;  4ZQ3 A;  5ELF A;  1G2S A;  3BZD B;  5BN3 A;  3Q6S A;  2IX0 A;  3FVQ A;  1BBX C;  1JE4 A;  2F0K A;  2AQ1 B;  4LK1 C;  1STY A;  3DHQ A;  1QB5 D;  1DOL A;  3C46 A;  2A74 C;  2CW0 C;  4OIJ A;  3GTG B;  1CA6 A;  1JOQ A;  1EFI D;  3DXJ C;  2F0F A;  1IYU A;  3MXG A;  3NSW A;  5JPN C;  3M7G A;  4C3J B;  2A6E C;  3IFD A;  1G29 1;  2D62 A;  1J9O A;  4KY6 A;  3U9S A;  4RGO S;  4X3U A;  1X3P A;  4JK1 C;  5C4X B;  3CRL C;  2B2T A;  4NDX A;  1EWC A;  2A68 D;  1DJR D;  2JA7 B;  4QB4 A;  2L0C A;  2CVR A;  1WTX A;  4KK7 A;  2YYZ A;  3TME A;  5JVH 3;  3H3V C;  1RD9 D;  2EYF A;  3VYU A;  3VA7 A;  1O7L A;  3I4M B;  3MAQ A;  1PZK D;  1EEI D;  3RMH A;  4A3G B;  1Q1E A;  2XIW A;  2F0H A;  4J1M A;  5FLX E;  1EQV A;  3IL8 A;  4ID6 A;  5FO7 B;  5C3W A;  2A68 C;  4EQN A;  3TP6 A;  2F0E A;  2BE5 D;  2L11 A;  3C1E A;  5D65 A;  5JVG 3;  5JEA G;  3OWE B;  2F0O A;  2R6G A;  4RWS C;  4K8I A;  3D31 A;  4K5V A;  3M4O B;  1Y8O B;  5E4W C;  3HP3 A;  3OW7 A;  2KEE A;  5CBA E;  1X32 A;  3D4D A;  4M8A A;  3HRZ C;  1U4P A;  2B8F A;  2PPB C;  5IGG A;  3KBG A;  3HKZ B;  4NW2 A;  2BE5 C;  5ISR A;  1F9R A;  3N6R A;  2B2U C;  1EQT A;  3W2D A;  3S2D B;  3PUX A;  1WD1 A;  4JBW A;  2R7Z B;  1HA6 A;  4L6T B;  3T13 A;  3NQI A;  1PTO F;  3J81 L;  1QG7 A;  5A2Q L;  3CRK C;  4A3I B;  2WAQ B;  3D6C A;  3KUP A;  4IFD J;  1CA5 A;  4PMB A;  4RCO A;  1H9S B;  4I7Z C;  3MA2 B;  2NWG A;  1SXT A;  4CHT B;  1KTK A;  3SDZ A;  2L12 A;  1EU4 A;  1D5X C;  1QNU A;  4IAL A;  4OGQ C;  3GTJ B;  1ILQ A;  1DD2 A;  1VMP A;  3L3O C;  4CGY B;  1B44 D;  3EJI A;  3LWU A;  1X3Q A;  4TQU S;  4J8Q A;  3GV3 A;  4XIG S;  5D3D A;  3I8Z A;  5CV4 A;  3JAM E;  3NUC A;  4HR7 B;  4XYQ A;  3VR4 A;  2FFK B;  4F8M A;  1JR0 D;  2I46 A;  3ZYY X;  5KEE A;  3G6J B;  5EKK A;  1PTO D;  2X6L A;  2R92 B;  1EY9 A;  4AYB B;  4X3S A;  3HEJ A;  3K6O A;  1EYC A;  1OXT A;  1SYE A;  3NHH A;  4QF4 A;  4DAY A;  4FXK C;  4I65 A;  1ONL A;  1TWA B;  2FIN B;  2SEB D;  4RCN A;  2QEJ C;  1QIL A;  5CBE E;  4RKB A;  3P7J A;  5I6Y A;  3GTO B;  1FR3 A;  4RGT A;  2B63 B;  2NVY B;  5FKA C;  2LMC B;  4FF2 A;  1PTO C;  1QJO A;  4DFA A;  1QNK A;  1HPC A;  2AQ2 B;  1OXV A;  1AFP A;  5EBC A;  5C4Z A;  3GV6 A;  1JC7 A;  4NMZ A;  2WB1 B;  1V8Q A;  1KNE A;  4IUU A;  5ELC A;  3KK7 A;  3R93 A;  1PLF A;  1PRT F;  2VB2 X;  1I3Q B;  4C3H G;  4IUP A;  1V43 A;  4PQX A;  1RDP D;  2I07 B;  1JWM D;  3O13 A;  4L63 B;  5CV9 A;  2FMM A;  3BDL A;  3IFT A;  2H1E A;  3TP5 A;  2V4D A;  4Y7N B;  5CYU A;  1KAB A;  3M4Y A;  1LV9 A;  2SNM A;  3HG9 A;  4PMC A;  2F0M A;  3J7A V;  3MWY W;  3SEB A;  5IOC A;  1V1P B;  1BCP B;  3RZD B;  3HS0 C;  5C6A A;  2OT2 A;  2PW5 A;  1SFO B;  1GUO A;  1A3U A;  2F0P A;  1DZ1 A;  2IWH A;  4HCE A;  1KDC A;  3H0G B;  3M3Y B;  4FP5 D;  3HOZ B;  1IL8 A;  2JEB I;  3CU7 A;  1D1K A;  1SSO A;  1Z47 A;  1B9N A;  2PZW A;  2EZV A;  1SJE D;  3U9O A;  4IFD I;  1LTA D;  1PRT D;  5M9O A;  3URY A;  2DY7 A;  3ONA B;  2FJ2 A;  2KCC A;  4R8I A;  1FNV A;  2PMZ B;  1IW7 C;  2QIL A;  2PW7 A;  3F2U A;  1I4H A;  1T5X D;  2B2T C;  1Y8P B;  2SNS A;  2QKI C;  1MBY A;  1WTW A;  2JSO A;  3NTK A;  4G7H C;  1EIG A;  3BVM A;  4H7B A;  1PTO H;  3VR3 A;  2K5D A;  4XDX A;  4QIW B;  1PRT C;  4ME5 A;  5G3L F;  3SXH A;  1OXU A;  2H4O A;  4WFN 3;  3VYT A;  3C3L A;  3QG1 A;  1NAP A;  4RGM A;  1I50 B;  3TSS A;  2NVT B;  3KLR A;  3NBH A;  1TVX A;  5IGE A;  3D4R A;  3V05 A;  4KKS A;  4CKE A;  2NN6 G;  5LL6 S;  3K5N A;  3KBX A;  4KD3 A;  5JOB A;  1UNS A;  2DN8 A;  5FLX L;  2D5D A;  2HDM A;  2KA7 A;  3SR1 A;  3ND8 A;  4XT1 B;  1HTP A;  4HSV A;  1EY7 A;  5J1Z A;  1PXU A;  2L55 A;  4KI0 A;  1STG A;  1SYG A;  3MC0 B;  1PFM A;  1SNM A;  2E74 C;  1ZXT A;  1YNJ D;  4XQJ A;  1AZQ A;  1JCK B;  3I4L A;  5G3L D;  4E6I A;  5C0X J;  4A3B B;  4PNY A;  2O2L D;  1BOS A;  3FEW X;  4TRD A;  2BCO A;  3Q24 A;  1HTL D;  2N55 A;  5E3F A;  2XN9 C;  1AP0 A;  4MIU A;  1F9Q A;  3BVZ A;  1TS4 A;  1KAA A;  2AWN A;  1HA5 A;  1NR4 A;  2ICE C;  1RHP A;  2J0T D;  2F0V A;  1XTC D;  1LAB A;  3S1N B;  1S5C D;  1HCZ A;  2PO4 A;  1JOK A;  1SNP A;  2K6A A;  2NTT A;  1SYD A;  1YNJ C;  1B53 A;  5E4X A;  3HZX A;  2IL8 A;  3P20 A;  2NYZ D;  4RHR A;  3GTM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...