2NBFA

Structure of calcium-bound form of penicillium antifungal protein (paf)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antifungal protein
publication title Calcium binding and the role of aspartic acids in the antifungal function of PAF
rcsb
source organism Penicillium chrysogenum
molecule tags Antifungal protein
total genus 5
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2016-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nbfA00
2NB0A 2KCNA 1AFPA 2MHVA 2NBFA
chains in the Genus database with same CATH superfamily
4L8JA 3KLSX 3S17H 1JJCB 3FMCA 2E2JH 1L0YB 5IYDH 3M7NA 3P7JA 4YIJA 4B9XA 1BQQT 3DMUA 1F9RA 1Q7YC 3HOXH 5I4DA 1K83H 3P20A 4DR1Q 4DV6L 1YHQA 1V9PA 3D3RA 2B8GA 1VQNA 1TWCB 3A7AB 4KKUA 4NP5A 2RVLA 3NP8A 2ZM6Q 1N32L 5CV5A 3BYYB 4PMWA 1M4VA 3ERQA 4RKLA 2KHIA 4WFN3 4DV0Q 1QILA 2QDLA 2R7DA 1B2TA 1F9SA 4FVMA 3J80i 1F2MA 4DF7A 5LMNL 4QMGA 3STBC 2NVQH 2Z4HA 1EYGA 3SHLA 4DV5L 2VQEQ 1XMQQ 1EQQA 3J7ZC 1H9JA 3NELA 4F87A 2NZ1D 2K7VA 2PO4A 3CC7A 3D4RA 4NW2A 3CPWA 5NUCA 2C35B 1VF5C 2SEBD 4X62L 4GNXA 2ES2A 5EAYA 2CKZB 4IFDJ 4BA2I 2WB1E 4JCVE 4A3JB 4UY8C 3GTPH 4RHRA 5C3WA 3BG3A 2ALYB 4DR3L 2DY7A 2UUAQ 3VYTA 3K7AB 4CDEC 1VQLA 1YNNC 1XMOL 4RGOS 2IPKD 3SDZA 1Q8IA 4R1JA 1VQGA 3GQBA 4X3KA 2EYPA 5KGUA 1XNRL 3AYHB 1I4PA 5F2DA 4YWLA 5C6AA 3S1QB 2R93B 3G6EA 1L2FA 4B3RL 1EOTA 1SNDA 1QG7A 2WKCA 4U68A 1QUQB 3OMGA 1VQHA 1FGBD 2UXBL 2IL8A 4POGA 2JA9A 1TS3A 3RLFA 1EZ6A 3BZCA 4FF3A 1PTOC 1KRTA 2V1CC 5CV6A 2VW9A 1U0LA 4NDXA 2IHFA 4R4OA 1FL0A 4C1NI 2NVXH 4BS9A 1J8IA 3KUPA 1B9NA 1S4ZA 1A15A 2G9DA 4LF9Q 5IGBA 1BOSA 5LMUQ 1CK1A 1LTAD 3CCQA 1LTLA 1R9TB 4LW1A 4DV4Q 3A55A 3A8JE 3NQTA 5IWAQ 4I65A 2Z0SA 1KD1C 4UP8A 4JK1C 1X3EA 1STHA 2WAQE 2B3GA 1E22A 2K5DA 5IOCA 1Y1WG 2UXCL 1PTOF 1Q1BA 1IYUA 1LM0A 2XN9C 5CV8A 5K36G 4GNXB 2JJQA 4H13C 1UE1A 5E4XA 3S16H 5C3EH 1GUOA 5DLQE 3KLSA 3EN2A 5IGDA 1JB7A 2K01A 1DOLA 3FRPB 2JQOA 4KD4A 5FJ8H 1TT2A 2WV6D 3SK4A 4A3IH 2VB3X 2P5ZX 4CDDC 2F03A 1VQMA 3K7UC 5GROA 5CYUA 3QB3A 3IFDA 3PSIA 1PH7A 1ZEQX 1I3QH 4JI6Q 2NWGA 1YITA 1PH3A 1A3UA 2RKSA 2XSCA 5EQ0A 3CMAA 3H3VC 3IL8A 3T1YQ 3K81C 4DNRB 2G5DA 1HUMA 2SNSA 2ZT9C 5CR3A 4A4IA 2AWNA 5DNFA 3W3AA 3K5OA 4L6TB 1EY0A 3JAME 2A6HD 1SYGA 2K1BA 2VS1A 4JV5Q 3MAQA 1OXVA 2WB1G 1KAWA 1Q3LA 5D65A 1SFOH 1XWEA 5EGTA 5EKLA 1AZQA 1A2TA 3R3OA 3D8GA 3HOZB 4OONA 3AU7A 5DM63 2UUBL 1STBA 2JEAI 4J1MA 3CF5A 2MFIA 1XNQL 3S14B 2RDGA 2EYMA 2KOLA 2KCMA 4PMBA 4XTCS 2EJMA 3DWPA 4CKEA 3K5LA 3CQZH 4HTHA 1LTGD 1OXSC 3VR4A 1EY4A 1UUPA 1YIJA 3U4ZA 5M3FH 2FINB 2QDBA 5E4WC 3S2HB 1U4RA 1PTOB 2D9UA 4LF5Q 4QUFA 4K5XA 5FK9C 1T5XD 4DV1L 2F4VQ 4JBMA 1F2YA 1HNXL 1IBLL 4DK6C 2E5LL 3K58A 4K5WA 4C3IB 2A19A 2O5IC 2QGQA 4PZ8A 3RZOB 2Q8TA 1YZ6A 2YV5A 2F0PA 1EFID 1YVCA 1QVFA 1EUJA 2Z4IA 1WCMH 4XDXA 2F52A 3TZDA 3GTLB 1G51A 2XWJB 1I4QA 3OTOL 1S40A 4DUYQ 1MI2A 1TWAB 1HRJA 2FFKB 1B9MA 1DCZA 1GUNA 2WAQG 5M3FG 3S2DB 1E24A 4A3MG 2UU9Q 2Q8RE 3BVMA 5JJZA 1K73C 5IY0A 2AQ2B 2D2CC 1X3FA 1PH1A 3S24A 3PCOB 4X3UA 2A69D 2K33A 2B63B 2QEXA 4OXPA 3MEHA 4YCVA 1MSHA 1HTLD 1GO3E 1WCMG 2F0VA 4JI1Q 1D6EC 4LAAA 2ID0A 5EBDA 5C4XB 2WACA 3DUZA 1SJED 1Y8OB 1MSGA 2YU9B 4JI0L 4CDFC 4KHPQ 1QE6A 3UDXA 5K5PA 2UXDL 3NSWA 2DJFC 1A3VA 2JXMB 4G7HC 1H95A 1B3QA 2RHSB 1HXYD 2ZXPA 2OCEA 1SEBD 4GN5A 2LMCB 1WYDA 4DKAC 1N32Q 2KUMA 4DAVA 1Q8KA 2Q8IB 5CMDA 1SE4A 5AJ3L 4LMQD 4FNFA 4K6DA 4RA8A 3X3MA 2DNEA 2K14A 1M1KC 4BBSB 3RNUA 2D0PA 2R7ZB 2HCCA 1Y69U 5BR8L 3DEOA 3UDGA 1PYSB 2DNCA 1JOQA 1HQMC 4L5SA 3M4OH 2NB0A 2NTTA 4DV5Q 5IP9H 4JI7L 4LF6L 2KCTA 3CCSA 2R93G 5G3LD 3PF5A 1VQ4A 2B29A 4F88A 4ALPA 3CW2C 5CGKA 4K14A 2VQFL 2HUGA 4IUUA 4X66L 1JJ2A 2VQEL 4X62Q 2F0MA 2CWAA 1LT4D 2FMMA 1U4PA 2E2IB 1NCVA 1BBWA 4DR3Q 4QIWB 2F0LA 1XMOQ 3R8BA 4JI3Q 1Y8PB 2XVSA 2EYLA 3H0GH 3Q23A 1QB5D 1U4LA 4C3JH 1IYJB 1XNRQ 1GD7A 5M9OA 2NVYB 2UUAL 3G4SA 4B3TQ 4OO1G 1F2LA 2MQHA 5A2QE 3HOYH 2RSNA 1LT5D 1ONLA 2F0DA 5IP9G 1G2SA 4HIKA 3OIQA 4X3SA 3KFUA 4Y7NH 3S17B 3IKJA 1E2ZA 1WTHA 2E2JB 2PMZB 3TDQA 4BWGB 1A0IA 4XIGS 2EVBA 3C2PA 4NB3A 1NMFA 1STEA 1K83B 5JPNC 3J81E 5T1IA 3JAMi 1EQVA 1XPUA 1RJTA 4K8IA 3LWEA 3H0GG 4KY7A 3K80C 4B08A 1TS5A 4A3BG 2J7ZA 1N33L 3HOYG 1WTQA 1ZYRD 1JQYD 1WTRA 2EY6A 2B39A 1B7YB 4OWXB 5JEAJ 4QCLA 1BUVT 2NVQB 2GN5A 1JMCA 3URYA 1LTSD 1SRUA 2A1AA 5IWAL 4DR4L 4A3LG 4QGUA 4N8FA 3H09A 2UXCQ 1KNAA 2XGTA 3BZKA 3GTPB 1FVIA 2R6GA 3BDOA 2CW0D 4GS3A 2ASBA 2TMPA 1DZ1A 2M9VA 4E6IA 3TS0A 1VQEA 1CSQA 3NBHA 3K5NA 1I50H 3K5MA 1ESRA 3UDFA 3E3XA 3ONAB 3DLLA 3GTKH 3QWNA 5C4HA 2XRSD 4R4CA 1QCBD 4ID6A 3CMEA 2B2TC 5J3BA 1DD2A 3LX0A 5DM73 1FD7D 1IKMA 3HFZB 1S72A 3SEBA 4A76A 1IBKL 2R92H 3GV6A 1G2TA 1NBWA 5IP7H 4JBJA 2NVXB 1BF4A 2I5LX 3PO3H 1ASZA 2MJ8A 1B53A 4A3EH 1PV4A 2F4IA 1EY8A 5IE8A 3NTHA 3W5OA 3ULJA 4IPDA 3A8KE 1RODA 4NKLA 2H1EA 1CKMA 2MUYA 2F0HA 2E2HB 3FEWX 1XX8A 5KYIA 2N49A 4V0BA 1JC7A 4KN4C 3BDCA 4AH6A 1OTCA 3A0JA 4MTNA 1VQDA 3EIVA 4XT1B 5ELOA 1TKWB 3K6OA 1A2UA 4H7BA 2R92G 1ENCA 1T5EA 5IP7G 3OMCA 1HPCA 3S1NH 1TS4A 2UUBQ 2AMCB 4A93H 3CPFA 1PZJD 5A35A 1GXDC 4C3IG 1EWHA 2B2TA 2PMZE 4RGMA 3S16B 1SROA 1QNKA 1Z7TA 1HR0W 1HFGA 1TWFH 3BS1A 2F0TA 3T56B 1K3RA 3NBHB 3TBIB 3K0XA 4OIJA 2EY5A 4K6LA 5G3LF 4R8IA 3J80L 2NN6I 4YWKA 1VQBA 3M4QA 2FJ2A 1Q1EA 2WB1B 3BZDB 4C2MH 3HEJA 1I5FA 1CHPD 4YY3L 1RKNA 4XYOA 1IBLQ 1HNXQ 1S3OA 1KLGD 4LF5L 2E5LQ 5IODA 4RH6A 2F4VL 4A3KG 4UPAA 1Y1VH 3NE5B 2RBMA 1ZYRC 4DNTB 4CKCA 1CKNA 1J9OA 1UEBA 4EQ5A 1STGA 4LJZC 1UEAB 3A74A 1H9SB 5JOBA 1I6VC 5M3MH 3OTOQ 3GTOB 3Q24A 1N34Q 2EYFA 2BA0A 1U9RA 1XTCD 5C4XG 2L55A 4ZK9B 2B2UA 3PIO3 4IFDH 3S1MH 1E2WA 2XWBB 5EKIA 4DR2L 2CW0C 1EY6A 3VYSA 1C0AA 5D3DA 1SFOB 4B3SL 3TREA 3KDFB 5GADC 3ULLA 1AE2A 1I6HH 4X65L 4KMUC 3LNNA 3LGJA 1PH2A 3G48A 4PZ6A 5KYLA 1B8AA 1Y1VG 4P73A 2OQ0A 4AQYQ 5IT9c 1LV9A 4LK1C 1NR4A 2A6EC 4HIDA 1L1OC 3OWEB 1EY7A 2O4XA 1LTBD 1LO5D 2MO1A 2I0QA 4JPBW 5M5WH 3CQZB 3I56A 4JI1L 1YI2A 2UXDQ 1TQOA 3L2PA 2WAQB 3DXJC 5M3FB 2JSOA 3VYUA 3F2UA 4KHPL 4EGVA 1UNSA 4X64L 3RUZA 2X6LA 3NTIA 3RN2A 5BN3A 2IT1A 5J1ZA 1NJIC 1Z6HA 2A8VA 3NEMA 1QNUA 1ZXTA 5AJ3Q 3HS0C 3M4YA 3HG9A 5EPLA 4B9WA 2JA6G 3H91A 4IUNA 5BR8Q 1WCMB 2DJGC 3RD4A 3NK9A 4IUPA 1SE3A 1SNPA 3CU7A 3P1HA 1ENAA 1G8ZD 4IZ8A 4G57A 1VQ5A 3TP5A 5ISRA 4JI7Q 4R4IA 4LF6Q 3L9AX 2VXWA 4N8X1 3CCMA 2CWPA 3ZYYX 2E76C 4P72A 2VQFQ 4GOPC 4A3FG 4X6AH 4X66Q 2BDNA 4UHVA 3M3YB 1KABA 1L1OA 5IYDG 1S5CD 4BA1I 2F1MA 1YNXA 2EY2A 5I9PA 3A56A 2NVTH 3HOXG 1UE5A 4QQBX 3GTJH 1D7QA 3PUXA 2YTVA 5COYA 4YWMA 1X3QA 3KOJA 1K0RA 1LTID 4I7AA 1CFMA 4JI3L 2IJ0A 1SYEA 1D1KA 2O5JC 4QL5A 3HOVH 5C4ZA 4DR7L 4B3TL 3I70A 4GLAC 4HCSA 5EPKA 3MFGA 4O42A 4HCEA 2M00A 4KHZA 2TSSA 1HZBA 1EEID 3U4VA 5C0XJ 1E1OA 2MGSA 4JBWA 3KF8A 4L5QA 1TY0A 3MHBA 3EFXD 4WJWA 3CCJA 2PZUA 1ET6A 3GO5A 5C44H 3OW2A 1IW7D 3KLRA 1YHAA 4JI5Q 1BVSA 4GOPA 1N33Q 1JOKA 2A5HA 3M4OB 2EE1A 1PRTD 3HKZB 1UE7A 3HOVG 2F0WA 1PDQA 1TXYA 1YJ9A 3X3NA 3TP7A 3ICEA 5CC4A 1KDCA 3J81c 4DR4Q 4IURA 1P16A 1KNEA 4C3HH 1RIPA 1FYCA 2NZOA 2I46A 4KY5A 5CBEE 3UE1A 1X32A 5E1FA 4DK1A 2NUCA 1L1OB 3SK6A 2BH2A 2RF4A 3I8ZA 5T1GA 5C44G 2A68D 1GHKA 1CKOA 3H0GB 4DAMA 3LWUA 4C3JB 1YBYA 2Q2IA 3PMFA 4A3BB 3ERSX 1QJOA 1C9OA 4IPHA 2Z8LA 1B50A 5C4JB 3R2TA 3HOYB 3OYYA 2FXQA 2DN8A 5BN5A 3WOEA 2KA7A 2YYZA 5ELNA 2ZJQA 2JA7H 2IX1A 1PA6A 1EQTA 1IBKQ 1HR0Q 5HURA 1P8LA 1R4QB 3T1HQ 1A6XA 4C3HG 1YNJD 4QY7A 4QUCA 3E9HA 1X9NA 4FP5D 3VR3A 1WD1A 4JI4Q 3H6MA 1HZAA 5C3EG 4G7OC 2F0JA 3PUYA 2HT1A 1XPOA 3EJIA 4R8NA 4GOPB 2SDFA 3PIP3 5KNDA 1GJXA 4XQQA 1EOVA 4OWTB 4TVAB 5CORA 2OXPA 2R3ZA 1SDFA 1VQJA 3CCUA 1OO9B 3ER0A 3PO2H 5FJ8G 4DU9A 4RHSA 4A3IG 5LHY1 4KJOA 1Q12A 1JE4A 4DR5L 3K57A 4A3GH 1BKBA 3UE0A 2LY7A 1XPRA 2F0SA 3S15H 2QEJC 1QVGA 1YHBA 1PFBA 1I50B 4DA2A 4RCNA 2EJGC 3E5SA 4MTKA 1K9MC 1X56A 3C46A 5EJWA 4NXML 3GTKB 3HP3A 2OTLA 3P75A 2F0GA 2PNRC 1OXUA 1TWGH 4HN7A 3GV3A 3SE0A 5CV9A 1STNA 3MEFA 4F8MA 5BN4A 3CC4A 1WTVA 1O80A 4AYBB 2KEEA 1VQ7A 1Q81C 4YY3Q 1QOHA 4OWWB 3V05A 3PO2G 3FPUB 1IW7C 4HJ8A 2R92B 4ZUIA 2R61A 3HKZE 2K52A 1D5ZC 4A3GG 3NTKA 1EQRA 1Q82C 3PO3B 2JA8H 2Q2UA 2ICIA 4UP7A 1NTGA 3S1RH 5FLMH 1XJVA 2OT2A 1JWUD 2K28A 4O1NA 4DUZQ 2AUKA 4K0KQ 1OXTA 4IUQA 2NBFA 2B2YC 1JORA 5FLXc 2MP1A 5IT9E 4GKJL 1AEXA 2CFMA 4DR2Q 1BCPD 1SR3A 3GD7A 1N34L 1FNVA 4B3SQ 1AFPA 2ZTDA 3I2ZA 1ICWA 1CI3M 3CP0A 3OHXC 5H1SE 4X65Q 4LF4Q 3L0OA 4JW0A 2K5WA 1EIGA 3CCRA 2F0NA 4A3KB 1HA6A 1GUSA 3S1NB 1PH5A 1NY4A 2H5XA 4A93B 3JAML 3BVZA 1K3BC 2OEOA 4I7ZC 3D31A 1KHIA 4FDBA 4C56C 1E2VA 4P71A 1TWFB 2ZTEA 1CZWA 4AQYL 2Y0SE 3BYTB 2F0QA 2A73B 2CH4A 1U5KA 3AFPA 1K8AC 1JOOA 4KD3A 4KTAA 1MJCA 2QILA 2Z9HA 4C2MB 1AH9A 3HOWH 3VR5A 3CHBD 4KLKA 4X64Q 2F0OA 1V1QA 5JVH3 4IPGA 3VYRA 1UWVA 2EOTA 1Y1VB 4LUOA 5C5MA 2B2YA 5JEAH 1NSNS 4B3MQ 3PQIA 3ND8A 4GZYC 2N78A 2A6HC 4FYDA 3KF6A 3S1QH 4ZYSA 1V1PA 5LL6X 2JA5H 1HZCA 1CQVA 4IOCA 3S1MB 3HOWG 4IALA 2PQAA 3TZUA 5ELBA 2X69A 4HJ5A 5HGTA 4DK3C 1I6HB 4LFCL 1D8LA 1E1TA 1B44D 3MZ5A 3TP6A 3RZDH 4FO2A 4HJ9A 2IY5B 3U50C 1EIFA 4AYBE 4KJNA 1DM0B 1EY9A 1T9HA 2JYOA 4R9WA 3NQIA 2JA6B 1NMGA 4APVA 4KY6A 3ITPA 3EBEA 1ML0D 2DY8A 3EQLC 3W1GA 4H0LC 3R93A 1H9MA 2D62A 4HMJA 4DFAA 5M5YH 5M5WB 3CCVA 1R9TH 4XQJA 4DR7Q 4BY1H 2C5CA 3I4MH 1CSPA 1YJWA 2PI2E 3CCEA 3HKZG 1HCZA 2RDHA 1A62A 1F2ZA 1STAA 2Z1CA 1ASYA 5D14A 4A3FB 1WVLA 3VR6A 5KNBA 1RF2D 2KHJA 5EBCA 4CHTB 1CT1D 1NAPA 3M9BA 2BCOA 2E75C 4HEDA 1U4MA 1RTNA 1DOKA 2QA4A 1ICFB 4OEMB 3H15A 2A74C 1KC8C 3HOXB 3GTQH 4LNQA 2KJXA 4ILWA 3SXHA 1STYA 1TY2A 1VQAA 1EU4A 2HIXA 1GUTA 5D3IB 1BCPC 1CM9A 3I73A 3EVQA 1X6OA 4CBVA 1IZ6A 4C3JG 2KENA 4JI2L 4A3DH 4BY1G 4JI5L 2HHHL 3OSOA 2K03A 3KYHC 1RL2A 4CKBA 2XNAC 5JJIA 4ZRZA 1G291 2RSOA 3MFYA 1I4RA 1VQ9A 3H3VI 1PYWD 4TSSA 3I90A 1LYLA 1NR2A 3PV0A 2A69C 1PYBA 4IPCA 5IIFA 2EQSA 2PQAB 4HSPA 2YTYA 4K5VA 2QF7A 2NVTB 5GQOA 2Y0SG 2KQ3A 4R4QA 2EDGA 4LFAL 1NUCA 2E8GA 4OX9Q 1HHVA 4KI0A 2MHVA 3J7A5 2B2WA 5C0XI 2HQEA 3BU2A 1KTKA 1F9PA 2K50A 3T13A 3VA7A 3Q0AA 4GN3B 1JICA 1TIID 1PH9A 3RR5A 4FXGC 1VQIA 2OF1A 1MJEA 4OHJA 2ZXRA 1A3TA 4XYQA 3QO2A 3HOVB 1BCPF 4PG3A 3I91A 4XXEA 1AZPA 1PVOA 3FKIH 3NUCA 1TWHH 1WOCA 1D1IA 4PV1C 1TS2A 3J7AV 2OTJA 2H4OA 1M90C 4G4KA 1B70B 2LXJA 3FHWA 3QR8A 1C48A 1HR0L 2AHOB 5A2QL 4YCWA 3RMHA 3T1HL 1CTMA 5C44B 2YTXA 4HSVA 4QJFA 1PH6A 4WRDA 2F0IA 1HZ9A 5I9OA 2JN4A 3DM1A 1NNXA 2VB2X 4A3CH 2JK8A 2WKDA 1LTRD 3E9IA 2DGYA 2QKIC 3DWQA 2BOSA 1EIYB 4EQNA 4JI4L 1SJHD 2BH8A 1VMPA 1PTOH 3FKIG 4KV6A 4AYBG 5IGCA 4POFA 3U58A 1HA5A 4BY7H 4NXNL 1BBXC 3CD6A 3U9SA 4C3HB 5KIXA 4DR5Q 1HQRD 1K8OA 3DEPA 3DM3A 1WTWA 2L11A 2WP8J 3F1ZA 4ME3A 1I94L 2B2UC 3RZOH 2K6AA 3S9WA 2R7FA 4V190 1KDAA 1PH8A 3AFQA 4MN3A 3PO3G 4NXMQ 3HOUH 2GA4B 4A3EG 5C3EB 1F77A 4MZ9A 3WDNA 4WJ3M 3HGBA 2F0FA 1II3A 1GVPA 3Q8DA 1EEFD 2RCFA 1PZID 2JA7B 1EYCA 2EJFC 1I4GA 2X6GA 4BBRH 3UDIA 4JI8L 3O13A 3STBD 4BY7G 1SLJA 2IW3A 4O2DA 1X3PA 4RWSC 3FDTA 5FLXE 4A3IB 3NENA 5KNCA 3E6ZX 4NMZA 2MO0A 1V8QA 3EROA 2RDFA 4LF7L 4K8JA 1BCPB 1UE6A 1I3QB 2OQKA 2QW7A 4MHEA 3CKIB 4JOIA 4A93G 4TQUS 1SN8A 3W2DA 1L0XB 1CHQD 4IJLA 4S3SA 2F0KA 1FJGQ 3I3CA 1YNND 5KRUA 3SK8A 2YU9H 2HCIA 4GKJQ 4DUZL 1VQPA 3OW7A 5I6WA 4K0KL 4ABNA 5I2XA 2KBNA 1K8GA 3WOFA 1JWSD 4BBRG 2J0TD 3PO2B 4HAEA 4ZUJA 3I55A 4JG2A 4A3GB 3KBGA 4LF4L 1PTOD 2LXKA 3MWYW 3S15B 4JC0A 4DXGA 1PXUA 1LACA 3VDYA 3B6YA 2K32A 4LWCA 3TP8A 1DYQA 3PF4A 1TWGB 2Q2HA 5C0XH 1FNWA 5M3MG 4QB4A 2NZHA 2WINB 2PZWA 3J81i 2EXZA 1X55A 4DK0A 4IFDG 4RGNA 2BE5D 2Q2TA 1KIXA 2XIWA 4Y52H 3CC2A 4L5RC 2E2IH 1WTOA 4J8QA 1IL2A 1Z47A 5L37A 2D5DA 2XTIA 4RG1A 1MIUA 2BDOA 2K4KA 1KL9A 2AWOA 1MGSA 3S1RB 3GTGH 4B3ML 3K8AA 5FKAC 1EFWA 4EVOA 1SNQA 1J6QA 4C1NK 3IAYA 1L0WA 3TQYA 1CKNB 5JAVA 3MXNA 3C3LA 3K59A 3MVVA 3R2IA 3KLWA 1JJGA 1S5ED 1V43A 2PPBC 2D0OA 3BDLA 3I4NH 4FXDA 3H94A 4JVZA 4LFCQ 1GOZA 2WIIB 2ICEC 4Q0FA 1PHJA 2CH4W 2J4XA 1HH2P 3T16A 5JJLA 2PW7A 4ZKCB 1A8VA 4RMFA 3NWTA 3T4AC 3PGZA 1I4XA 4XQNA 3G71A 3N52A 2HDLA 1VF7A 1GKHA 5IYCH 1QZHA 2E2DC 4DV3L 1D5MC 3HOWB 2IX0A 4M8AA 3SGIA 4YHHL 3I4NG 4P75A 1ESFA 1O7ZA 4ZAIA 2NN6H 1Q90A 4FF4A 3SK5A 1MBYA 1SNOA 5JPMC 1HNZL 1GHJA 4ZLTF 4TRDA 2VUMH 1ET9A 3MXUA 4JI2Q 3KJOA 3RN5A 5IGFA 1TR5A 4HR7B 1Q46A 4Z9CB 3K0YA 2HHHQ 2JA5B 1RD9D 4N9PA 5IYCG 1XXGA 5JJKA 2JEBI 4YCUA 3MXNB 5LMNW 2Z6KC 5EPJA 2L9HA 1Y1WH 2NN6G 1O78A 5FO7B 5IGGA 2OWOA 3RZDB 3J7YW 5K36H 1N8RC 2EPBA 4LFAQ 1EYAA 1SBBB 3BVGA 2AUJD 1XYIA 1E0BA 1Q86C 1D5XC 3HRZC 1SNCA 2VUMG 2BA1A 4DV2Q 5M5YB 4OX9L 2L5TA 3A8IE 1B1ZA 2ZJPA 2E2HH 2L0CA 2BE5C 4BY1B 3I4MB 1BO0A 3KJPA 1CA5A 3TMEA 3NWSA 1DONA 3G6JB 4UDUC 2GVAA 4Y7NB 1JB3A 1OXXK 5TSSA 1JE5A 4IO9A 1PH4A 3CXCA 4DN4M 2F3WA 2PI2A 2Y0SB 1IBML 3UI2A 3GTQB 4HJ7A 1KXLA 5FOBB 1CZGA 1JR0D 2N8NA 4DR6L 1VQKA 3KF8B 4G7ZC 1W2BA 2UUCL 4UAIA 4A3DB 2Z6KA 3ZJYC 1FGUA 2CHBD 4RKBA 4FF1A 3GTMH 1AW7A 1TVXA 4EQOA 1RHPA 3J80c 4DPGA 2FMCA 2C9OA 2IWHA 1EL0A 1AE3A 3TEHB 4N9TA 2JA7G 1F9QA 4NXNQ 1HNWL 3FPPA 5JVG3 1KLUD 3JC66 4BXXH 1W6JA 4CDCC 1I94Q 4OO1I 4X3TA 1LLRD 4KK7A 1CUKA 3CAMA 3NXWA 1KRSA 2KVMA 5CV4A 4RCOA 1YEZA 3J7AF 3GTOH 4DAYA 1SYDA 3D4DA 3A54A 1DOMA 1IYVA 1IKLA 2IHEA 3QOLA 1O7YA 4J6HA 3FKIB 1C4QA 1H9KA 1TWHB 4JI8Q 1LTTD 1VQ6A 3OIPA 4J15A 1VCIA 3MXPA 4LFBQ 2JP1A 1LUZA 3F2CA 1N36Q 2L15A 3A7LA 2K5NA 3HKSA 4IOAA 1FR3A 2N88A 3C1EA 4JYAL 4LF8L 3I72A 4BXXG 5M5XH 4LF7Q 4GKKL 2EYOA 2SNMA 2AKWB 2LFNA 5KEEA 1BR9A 2KECA 1QWYA 1PRTC 5CBAE 3L7ZC 4EX5A 1SNMA 4ZQ3A 1SE2A 3QIAA 4A3EB 2LS01 3L3OC 1SMYD 1Z9FA 2DUDA 1ILPA 1FJGL 4A3MH 2N55A 1D2BA 3FVQA 4FXKC 1AN8A 3A5ZB 2ENBA 3KK7A 4BY7B 3E0EA 3EA6A 1TU2B 2A68C 3M4PA 4DV7Q 3IRBA 3MC0B 1X65A 2Z6BA 1TWCH 4KKSA 4LUVA 3PUVA 3CCLA 3ULPA 1VQCA 2JA8G 2HIVA 4CJ0B 3HOUB 4KHVA 4F7XA 1JCKB 1J5EL 5J22A 1WJJA 5FLMG 3PIOA 1PRTF 5IYBH 5FO8B 1JWMD 3RLOA 1K8MA 3M7GA 3U9OA 4XT3B 4DAYB 2IX3A 4GLXA 2JE6I 3M3YH 4BBRB 4DNIA 1YNJC 3F2DA 4IUTA 3Q22A 1BDOA 1WI5A 2ZTCA 3T53B 4EQPA 1VQ8A 1RCVD 1PFSA 3MXGA 4PNYA 1CQFA 4A3JH 1GUWA 2MNAA 2PQEA 2HQLA 3OWFA 3K7AH 2V4DA 1KQSA 1W3SA 4FF2A 3C1FA 4ULLA 4KKTA 1DXMA 3D6CA 2ZXOA 4ME5A 1PFMA 5IYBG 5M3MB 2EXDA 3QOJA 2R93H 2EIFA 2SOBA 4P2CB 3D6WA 2I07B 1SYFA 4DV6Q 5I2YA 2KHSA 2HDMA 1XTDA 1BNZA 5ELCA 1DJRD 1SXTA 4DR1L 4A3JG 1WTXA 2VNUD 4NPSA 2RQXA 3NHHA 4OL7A 5IT9L 1JT8A 2PYKA 3VR2A 2ZM6L 5JEAG 2PNHA 2WFWA 4OO1H 4DV0L 5LMNQ 1ILQA 5I6YA 2MPMA 3NPPA 4DV3Q 2G9HD 1Y8NB 2JA5G 4YHHQ 1KAAA 1Y14B 2B2WC 4IUVA 1XMQL 3TSSA 1O7IA 2K05A 3AQQA 2EY1A 2KCNA 4PMCA 3AEVA 3Q6SA 5DEHA 4CGYB 2F3VA 1MD2D 1PRTB 2M2LA 1HNZQ 3D4WA 4PQXA 1SMYC 4IQZA 1B3AA 4PZ7A 5HY6A 4A3BH 3GTGB 2F0EA 3MA2B 5C4JH 4B3RQ 4IN3A 1VDZA 1PMRA 4DAPA 2UXBQ 5IGEA 4HJAA 1MHWC 1SAPA 3I4MG 3DWAA 1IL8A 2N3SA 3AMUA 2EZVA 3KF6B 1EY5A 3HZXA 4H02A 4A3LH 1SYCA 3I4NB 1QVCA 1V1PB 1A63A 1EZ8A 2L4NA 1PFNA 2AQ3B 2F3IA 2VY3A 4U673 1I4HA 2K75A 2XRQD 3V2TA 1H9RA 2LKVA 1CA6A 4L5TA 5GAHC 2L1BA 1EWCA 2I5HA 3GTJB 4IFDI 4P74A 2LSSA 3SVMA 1M8AA 1E3PA 3CRKC 3E0JA 4LF9L 4GLVB 5E7NA 1IHZA 1WD0A 4DV2L 4MIUA 1SMXA 5GAGC 5LMUL 1X54A 1HJPA 4A3DG 3TN2A 4ZCKA 3SR1A 2VL6A 3RLNA 4DV4L 4DXFA 1K28A 1DGSA 4KN7C 2B2VC 2FHTA 1G91A 1V1OA 1PLFA 4HMIA 5AFWA 3J80E 1IBMQ 2GVBA 4IJHA 3HOZH 1S5BD 1SYBA 2K5QA 3GP7A 3A5UA 4UP9A 4DR6Q 2ZJRA 4TKOB 4RFBA 5CV7A 1E7ZA 2VUMB 1IXRA 3S14H 2UUCQ 2K5VA 4HIMA 1HUNA 2A6ED 1R4PB 3J81j 3VA5A 4WJ4A 2EYJA 2NYZD 3OOCA 4L63B 3KBXA 3S2HH 1HNWQ 3D0FA 3J81L 4JOIC 2AQ1B 1LABA 5C3XA 1VQOA 1YJNA 1Y1WB 3N6RA 4QF4A 4O0AA 2PZTA 1G6PA 1ZKOA 2QCPX 3HOZG 1MKHA 1H9SA 3AB9A 5E3FA 2CVRA 3QG1A 4C3IH 3I7FA 4OELB 4Q5VA 1W6KA 1AP0A 3G7LA 4JI6L 1EU3A 2RCNA 1B4OA 1HTPA 2F0UA 3T51B 2O2LD 3PIPA 3T1YL 3GTLH 1BBUA 2B2VA 4DGZA 4A3CG 3I4LA 4QIWE 2RHQB 3KDFA 1TWAH 2PCFB 4JV5L 5ELDA 2HD3A 5LL6S 3S2DH 4RGTA 3BJUA 4HIOA 4M1UB 4JYAQ 1EWIA 4LF8Q 4A3KH 4H44C 2B8FA 5FO9B 4GKKQ 4LFBL 1XNQQ 1EYDA 1S5FD 1N36L 3JAMc 1VS0A 2RA4A 1ENFA 2B63H 4MNOA 1WTPA 4RAUC 3WWVA 1C7YA 3NBIA 3HOUG 5C4XH 3GTMB 2CCZA 2NTSA 4K2KA 4OGQC 4CJ2C 1HFNA 1K0SA 2K04A 4DV1Q 2CQAA 1VMCA 5HGQA 2CQOA 4GN4B 1QZGA 3MTSA 2PW5A 1O7LA 3F2BA 3CRLC 5EKKA 5DAUA 4R4TA 5ELFA 4ODGA 3H3VH 2L12A 4DV7L 3TS2A 1GUGA 3DHQA 2B63G 1SSOA 1GM5A 3IFTA 2I5MX 1J5EQ 4JBKA 2R7ZH 4BBSH 2KEDA 1C8CA 1EIHA 2VZAA 5ELEA 2K5HA 1FNUA 2ATWA 4WORA 3QJYA 4ZKBB 3PUZA 1PZKD 3OPOA 4AIMA 4DUYL 3M85A 3PUWA 4A75A 1VQFA 3TRZA 2KCCA 1NE3A 3F8TA 1RTOA 5GAEC 1BXTA 2UU9L 1KDBA 1SE8A 3V96A 1LT3D 4LUZA 5M5XB 1S5DD 1X3GA 3FP9A 2JA6H 1RDPD 2E74C 2EYHA 2JA8B 5C5LA 2R7ZG 4BBSG 5J39A 4GNXC 1G6ZA 4JI0Q 1QUQA 1N9WA 1UAPA 3W1BA 2NVYH 3GDEA 3ND9A 4K2LA 5FLXL 4OIKA 4CJ1B 5C0XG 3I4OA 1WFQA 4A3FH 4A3MB 1LT6D
chains in the Genus database with same CATH topology
4L8JA 3KLSX 3FMCA 1L0YB 3M7NA 3P7JA 4YIJA 4B9XA 1BQQT 3DMUA 1F9RA 5I4DA 3P20A 3D3RA 2B8GA 1TWCB 3A7AB 4KKUA 4NP5A 2RVLA 3NP8A 5CV5A 3BYYB 4PMWA 1M4VA 3ERQA 4RKLA 4WFN3 1QILA 1B2TA 1F9SA 4FVMA 1F2MA 4DF7A 4QMGA 2Z4HA 3SHLA 1H9JA 4F87A 2NZ1D 2K7VA 2PO4A 3D4RA 4NW2A 5NUCA 1VF5C 2SEBD 4IFDJ 4BA2I 4A3JB 4RHRA 5C3WA 3BG3A 2DY7A 3VYTA 3K7AB 1YNNC 4RGOS 2IPKD 3SDZA 1Q8IA 3GQBA 4X3KA 2EYPA 5KGUA 1I4PA 5F2DA 5C6AA 3S1QB 2R93B 1EOTA 1SNDA 1QG7A 2WKCA 4U68A 3OMGA 1FGBD 2IL8A 1TS3A 3RLFA 1EZ6A 4FF3A 1PTOC 5CV6A 4NDXA 4C1NI 4BS9A 1J8IA 3KUPA 1B9NA 1S4ZA 1A15A 2G9DA 5IGBA 1BOSA 1CK1A 1LTAD 1R9TB 3A55A 3A8JE 3NQTA 4I65A 4JK1C 1STHA 2K5DA 5IOCA 1PTOF 1Q1BA 1IYUA 2XN9C 5CV8A 5K36G 4H13C 5E4XA 1GUOA 3KLSA 5IGDA 2K01A 1DOLA 3FRPB 4KD4A 1TT2A 2WV6D 3SK4A 2VB3X 2F03A 5CYUA 3QB3A 3IFDA 1ZEQX 2NWGA 1A3UA 2RKSA 2XSCA 5EQ0A 3H3VC 3IL8A 4DNRB 1HUMA 2SNSA 2ZT9C 5CR3A 2AWNA 5DNFA 3W3AA 3K5OA 4L6TB 1EY0A 3JAME 2A6HD 1SYGA 2K1BA 3MAQA 1OXVA 1Q3LA 5D65A 1XWEA 5EGTA 5EKLA 1AZQA 1A2TA 3R3OA 3D8GA 3HOZB 3AU7A 5DM63 1STBA 2JEAI 4J1MA 3S14B 2RDGA 2EYMA 2KOLA 4PMBA 4XTCS 2EJMA 3DWPA 4CKEA 3K5LA 4HTHA 1LTGD 1OXSC 3VR4A 1EY4A 1UUPA 2FINB 2QDBA 5E4WC 3S2HB 1U4RA 1PTOB 2D9UA 4QUFA 4K5XA 5FK9C 1T5XD 1F2YA 3K58A 4K5WA 4C3IB 2O5IC 3RZOB 2Q8TA 2F0PA 1EFID 2Z4IA 4XDXA 3TZDA 3GTLB 2XWJB 1I4QA 1MI2A 1TWAB 1HRJA 2FFKB 1B9MA 1DCZA 1GUNA 3S2DB 2Q8RE 3BVMA 5JJZA 2AQ2B 2D2CC 4X3UA 2A69D 2K33A 2B63B 3MEHA 1MSHA 1HTLD 2F0VA 1D6EC 4LAAA 2ID0A 5EBDA 5C4XB 2WACA 3DUZA 1SJED 1Y8OB 1MSGA 2YU9B 1QE6A 5K5PA 3NSWA 1A3VA 2JXMB 4G7HC 1HXYD 2ZXPA 1SEBD 2LMCB 2KUMA 4DAVA 5CMDA 2Q8IB 1SE4A 4LMQD 4FNFA 4K6DA 4RA8A 3X3MA 2DNEA 2R7ZB 4BBSB 2HCCA 1Y69U 3DEOA 2DNCA 1JOQA 1HQMC 2NB0A 2NTTA 5G3LD 4F88A 5CGKA 4K14A 2HUGA 4IUUA 2F0MA 1LT4D 2FMMA 1U4PA 2E2IB 1NCVA 4QIWB 2F0LA 3R8BA 1Y8PB 2XVSA 2EYLA 3Q23A 1QB5D 1U4LA 5M9OA 2NVYB 4OO1G 1F2LA 5A2QE 2RSNA 1LT5D 1ONLA 2F0DA 1G2SA 3OIQA 4X3SA 3S17B 3IKJA 1E2ZA 2E2JB 2PMZB 3TDQA 4BWGB 4XIGS 2EVBA 3C2PA 1STEA 1K83B 5JPNC 3J81E 5T1IA 1EQVA 1RJTA 4K8IA 3LWEA 4KY7A 4B08A 1TS5A 2J7ZA 1WTQA 1ZYRD 1JQYD 1WTRA 2EY6A 2B39A 5JEAJ 4QCLA 1BUVT 2NVQB 3URYA 1LTSD 3H09A 1KNAA 3GTPB 2R6GA 3BDOA 2CW0D 2TMPA 1DZ1A 2M9VA 4E6IA 3NBHA 3K5NA 3K5MA 1ESRA 3ONAB 3QWNA 5C4HA 2XRSD 1QCBD 4ID6A 2B2TC 1DD2A 3LX0A 5DM73 1FD7D 1IKMA 3SEBA 3GV6A 1G2TA 2NVXB 1BF4A 2MJ8A 1B53A 2F4IA 1EY8A 3NTHA 3A8KE 1RODA 4NKLA 2H1EA 2MUYA 2F0HA 2E2HB 3FEWX 1XX8A 5KYIA 4V0BA 1JC7A 4KN4C 3BDCA 4XT1B 1TKWB 3K6OA 1A2UA 4H7BA 1ENCA 1T5EA 3OMCA 1HPCA 1TS4A 1PZJD 5A35A 1GXDC 4C3IG 1EWHA 2B2TA 4RGMA 3S16B 1QNKA 1Z7TA 1HFGA 3BS1A 2F0TA 3T56B 3TBIB 4OIJA 2EY5A 4K6LA 5G3LF 4R8IA 3J80L 2NN6I 2FJ2A 1Q1EA 2WB1B 3BZDB 3HEJA 1CHPD 1RKNA 4XYOA 1KLGD 5IODA 4RH6A 3NE5B 2RBMA 1ZYRC 4DNTB 4CKCA 1J9OA 1STGA 4LJZC 1UEAB 1H9SB 5JOBA 1I6VC 3GTOB 3Q24A 2EYFA 2BA0A 1U9RA 1XTCD 2L55A 4ZK9B 2B2UA 3PIO3 4IFDH 1E2WA 2XWBB 5EKIA 2CW0C 1EY6A 3VYSA 5D3DA 1SFOB 4KMUC 3LNNA 5KYLA 1LV9A 4LK1C 1NR4A 2A6EC 3OWEB 1EY7A 2O4XA 1LTBD 1LO5D 3CQZB 1TQOA 2WAQB 3DXJC 5M3FB 2JSOA 3VYUA 3F2UA 4EGVA 1UNSA 3RUZA 2X6LA 3NTIA 5BN3A 2IT1A 5J1ZA 1Z6HA 1QNUA 1ZXTA 3HS0C 3M4YA 3HG9A 5EPLA 4B9WA 3H91A 4IUNA 1WCMB 3RD4A 3NK9A 4IUPA 1SE3A 1SNPA 3CU7A 3P1HA 1ENAA 1G8ZD 4IZ8A 4G57A 3TP5A 5ISRA 3L9AX 2VXWA 3ZYYX 2E76C 2BDNA 3M3YB 1KABA 1S5CD 4BA1I 2F1MA 2EY2A 5I9PA 3A56A 3PUXA 5COYA 1X3QA 1LTID 1CFMA 2IJ0A 1SYEA 1D1KA 2O5JC 5C4ZA 3I70A 4HCSA 5EPKA 3MFGA 4O42A 4HCEA 2M00A 4KHZA 2TSSA 1EEID 5C0XJ 2MGSA 4JBWA 3KF8A 1TY0A 3MHBA 3EFXD 4WJWA 2PZUA 1ET6A 3GO5A 1IW7D 3KLRA 1JOKA 2A5HA 3M4OB 2EE1A 1PRTD 3HKZB 2F0WA 1PDQA 3X3NA 3TP7A 5CC4A 1KDCA 4IURA 1KNEA 5CBEE 1FYCA 4KY5A 2I46A 1X32A 5E1FA 4DK1A 2NUCA 3SK6A 3I8ZA 5T1GA 2A68D 1GHKA 3H0GB 3LWUA 4C3JB 3PMFA 4A3BB 1QJOA 2Z8LA 1B50A 5C4JB 3R2TA 3HOYB 2DN8A 5BN5A 3WOEA 2KA7A 2YYZA 2IX1A 1EQTA 5HURA 1R4QB 1A6XA 4C3HG 1YNJD 4QUCA 4FP5D 3VR3A 1WD1A 3H6MA 4G7OC 2F0JA 3PUYA 3EJIA 4R8NA 2SDFA 3PIP3 5KNDA 1GJXA 4XQQA 5CORA 2OXPA 2R3ZA 1SDFA 1OO9B 4DU9A 4RHSA 5LHY1 4KJOA 1Q12A 1JE4A 3K57A 2LY7A 2F0SA 2QEJC 1PFBA 1I50B 4DA2A 4RCNA 2EJGC 3E5SA 3C46A 5EJWA 3GTKB 3HP3A 3P75A 2F0GA 2PNRC 1OXUA 4HN7A 3SE0A 3GV3A 5CV9A 1STNA 4F8MA 5BN4A 1WTVA 1O80A 4AYBB 2KEEA 1QOHA 3V05A 3FPUB 1IW7C 2R92B 4ZUIA 2R61A 1D5ZC 3NTKA 3PO3B 2ICIA 2OT2A 1JWUD 2K28A 4O1NA 2AUKA 1OXTA 4IUQA 2NBFA 2B2YC 1JORA 2MP1A 5IT9E 1AEXA 1BCPD 3GD7A 1FNVA 1AFPA 1ICWA 1CI3M 3OHXC 2K5WA 1EIGA 2F0NA 4A3KB 1HA6A 1GUSA 3S1NB 4A93B 3JAML 3BVZA 4I7ZC 2OEOA 3D31A 4C56C 1E2VA 1TWFB 1CZWA 3BYTB 2F0QA 2A73B 1JOOA 4KD3A 4KTAA 2QILA 4C2MB 3VR5A 3CHBD 2F0OA 5JVH3 3VYRA 2EOTA 1Y1VB 5C5MA 2B2YA 5JEAH 1NSNS 3ND8A 4GZYC 2A6HC 4FYDA 4ZYSA 1V1PA 5LL6X 1CQVA 3S1MB 4IALA 3TZUA 5ELBA 2X69A 5HGTA 1I6HB 1B44D 3MZ5A 3TP6A 4FO2A 4KJNA 1DM0B 1EY9A 2JYOA 4R9WA 3NQIA 2JA6B 4KY6A 3ITPA 1ML0D 2DY8A 3EQLC 4H0LC 3R93A 1H9MA 2D62A 4HMJA 4DFAA 5M5WB 4XQJA 2C5CA 1HCZA 2RDHA 1F2ZA 1STAA 2Z1CA 5D14A 4A3FB 1WVLA 3VR6A 5KNBA 1RF2D 5EBCA 4CHTB 1CT1D 1NAPA 2BCOA 2E75C 4HEDA 1U4MA 1RTNA 1DOKA 3HOXB 2A74C 2KJXA 4ILWA 3SXHA 1STYA 1TY2A 1EU4A 1GUTA 5D3IB 1BCPC 1CM9A 3I73A 3EVQA 4CBVA 4C3JG 3OSOA 2K03A 4CKBA 2XNAC 4ZRZA 1G291 2RSOA 3MFYA 1I4RA 1PYWD 4TSSA 3I90A 1NR2A 3PV0A 2A69C 5IIFA 4HSPA 4K5VA 2QF7A 2NVTB 2KQ3A 2EDGA 1NUCA 1HHVA 4KI0A 2MHVA 2B2WA 5C0XI 2HQEA 1KTKA 1F9PA 3T13A 3VA7A 3Q0AA 1JICA 1TIID 4FXGC 2OF1A 4OHJA 2ZXRA 1A3TA 4XYQA 3QO2A 3HOVB 1BCPF 3I91A 4XXEA 1AZPA 3NUCA 1D1IA 4PV1C 1TS2A 3J7AV 2H4OA 4G4KA 1C48A 5A2QL 3RMHA 1CTMA 5C44B 4HSVA 4WRDA 2F0IA 5I9OA 3DM1A 2VB2X 2WKDA 1LTRD 2QKIC 3DWQA 2BOSA 4EQNA 1SJHD 1VMPA 1PTOH 4KV6A 5IGCA 1HA5A 1BBXC 5KIXA 3U9SA 4C3HB 1K8OA 1HQRD 3DEPA 1WTWA 2L11A 2WP8J 2B2UC 2K6AA 3S9WA 4V190 1KDAA 4MN3A 2GA4B 5C3EB 1F77A 3WDNA 3HGBA 2F0FA 1II3A 1EEFD 1PZID 2JA7B 1EYCA 2EJFC 1I4GA 2X6GA 3O13A 2IW3A 1X3PA 4RWSC 3FDTA 5FLXE 4A3IB 5KNCA 3E6ZX 4NMZA 1V8QA 3EROA 2RDFA 4K8JA 1BCPB 1I3QB 4MHEA 3CKIB 4TQUS 3W2DA 1L0XB 1CHQD 4S3SA 2F0KA 3I3CA 1YNND 5KRUA 3SK8A 2HCIA 3OW7A 5I6WA 4ABNA 5I2XA 3WOFA 1JWSD 2J0TD 3PO2B 4HAEA 4ZUJA 4A3GB 3KBGA 1PTOD 3MWYW 3S15B 4DXGA 1PXUA 1LACA 2K32A 3TP8A 1DYQA 1TWGB 5C0XH 1FNWA 4QB4A 2WINB 2PZWA 2EXZA 4DK0A 4IFDG 4RGNA 2BE5D 2XIWA 1WTOA 4J8QA 1Z47A 2D5DA 2BDOA 2AWOA 1MGSA 3S1RB 5FKAC 4EVOA 1SNQA 4C1NK 3IAYA 5JAVA 3MXNA 3C3LA 3K59A 3MVVA 3R2IA 1S5ED 1V43A 2PPBC 3BDLA 4FXDA 3H94A 1GOZA 2WIIB 2ICEC 4Q0FA 2J4XA 3T16A 2PW7A 4ZKCB 3NWTA 3T4AC 1I4XA 4XQNA 3N52A 2HDLA 1VF7A 2E2DC 1D5MC 3HOWB 2IX0A 4M8AA 1ESFA 1O7ZA 4ZAIA 2NN6H 1Q90A 4FF4A 3SK5A 1MBYA 1SNOA 5JPMC 1GHJA 4ZLTF 4TRDA 1ET9A 3MXUA 5IGFA 1TR5A 4HR7B 4Z9CB 3K0YA 2JA5B 1RD9D 4N9PA 1XXGA 2JEBI 5EPJA 2L9HA 2NN6G 1O78A 5FO7B 5IGGA 3RZDB 3J7YW 5K36H 2EPBA 1EYAA 1SBBB 3BVGA 2AUJD 1XYIA 1E0BA 1D5XC 3HRZC 1SNCA 2BA1A 5M5YB 2L5TA 3A8IE 1B1ZA 2L0CA 2BE5C 4BY1B 3I4MB 1BO0A 1CA5A 3TMEA 3NWSA 1DONA 3G6JB 4UDUC 4Y7NB 1JB3A 1OXXK 5TSSA 4DN4M 2F3WA 2Y0SB 3GTQB 3UI2A 5FOBB 1CZGA 1JR0D 4G7ZC 4UAIA 4A3DB 4RKBA 2CHBD 4FF1A 1AW7A 1TVXA 4EQOA 1RHPA 2FMCA 2C9OA 2IWHA 1EL0A 4N9TA 1F9QA 3FPPA 5JVG3 1KLUD 1W6JA 4OO1I 4X3TA 1LLRD 4KK7A 3NXWA 5CV4A 2KVMA 4RCOA 3J7AF 4DAYA 1SYDA 3D4DA 3A54A 1DOMA 1IYVA 1IKLA 3QOLA 1O7YA 4J6HA 3FKIB 1C4QA 1H9KA 1TWHB 1LTTD 3OIPA 1VCIA 3MXPA 2JP1A 3A7LA 1FR3A 2N88A 3C1EA 3I72A 2EYOA 2SNMA 2LFNA 5KEEA 1BR9A 2KECA 1QWYA 1PRTC 5CBAE 3L7ZC 1SNMA 4ZQ3A 1SE2A 3QIAA 4A3EB 2LS01 3L3OC 1SMYD 1ILPA 2N55A 1D2BA 3FVQA 4FXKC 1AN8A 2ENBA 3KK7A 4BY7B 3EA6A 1TU2B 2A68C 3MC0B 4KKSA 3PUVA 4CJ0B 3HOUB 4KHVA 4F7XA 1JCKB 5J22A 1PRTF 5FO8B 1JWMD 1K8MA 3M7GA 3U9OA 4XT3B 2IX3A 2JE6I 4BBRB 1YNJC 4IUTA 3Q22A 1BDOA 3T53B 4EQPA 1RCVD 3MXGA 4PNYA 1CQFA 1GUWA 2PQEA 3OWFA 2V4DA 4FF2A 3C1FA 4ULLA 4KKTA 1DXMA 3D6CA 2ZXOA 4ME5A 1PFMA 5M3MB 3QOJA 2SOBA 4P2CB 3D6WA 2I07B 1SYFA 5I2YA 2KHSA 2HDMA 1BNZA 5ELCA 1DJRD 1SXTA 1WTXA 2VNUD 2RQXA 3NHHA 4OL7A 5IT9L 2PYKA 3VR2A 5JEAG 4OO1H 1ILQA 5I6YA 2MPMA 3NPPA 2G9HD 1Y8NB 1KAAA 2B2WC 4IUVA 3TSSA 2K05A 2EY1A 2KCNA 4PMCA 3Q6SA 5DEHA 4CGYB 2F3VA 1MD2D 1PRTB 2M2LA 3D4WA 4PQXA 1SMYC 4IQZA 1B3AA 3GTGB 2F0EA 3MA2B 4IN3A 1VDZA 1PMRA 4DAPA 5IGEA 1SAPA 3DWAA 1IL8A 3AMUA 2EZVA 1EY5A 3HZXA 1SYCA 3I4NB 1V1PB 1EZ8A 2L4NA 1PFNA 2AQ3B 4U673 1I4HA 2XRQD 3V2TA 1H9RA 2LKVA 1CA6A 2L1BA 1EWCA 3GTJB 4IFDI 3SVMA 1M8AA 3CRKC 3E0JA 1IHZA 1WD0A 4MIUA 3TN2A 3SR1A 4DXFA 4KN7C 2B2VC 2FHTA 1G91A 1V1OA 1PLFA 4HMIA 5AFWA 3J80E 1S5BD 1SYBA 2K5QA 3GP7A 4TKOB 4RFBA 5CV7A 2VUMB 1HUNA 2A6ED 1R4PB 3VA5A 2EYJA 2NYZD 3OOCA 4L63B 3KBXA 3J81L 2AQ1B 1LABA 5C3XA 1Y1WB 3N6RA 4QF4A 2PZTA 1ZKOA 2QCPX 1H9SA 3AB9A 5E3FA 2CVRA 3QG1A 4Q5VA 1W6KA 1AP0A 3G7LA 1EU3A 1B4OA 1HTPA 2F0UA 3T51B 2O2LD 2B2VA 4DGZA 3I4LA 2PCFB 5ELDA 5LL6S 4RGTA 4M1UB 4H44C 2B8FA 5FO9B 1EYDA 1S5FD 2RA4A 1ENFA 1WTPA 4RAUC 3NBIA 3GTMB 2NTSA 4K2KA 4OGQC 4CJ2C 1HFNA 2K04A 2CQAA 1VMCA 3MTSA 2PW5A 1O7LA 3CRLC 5EKKA 5DAUA 5ELFA 4ODGA 2L12A 1GUGA 3DHQA 1SSOA 3IFTA 2KEDA 1C8CA 1EIHA 5ELEA 1FNUA 4ZKBB 4WORA 3QJYA 3PUZA 1PZKD 3OPOA 3M85A 3PUWA 2KCCA 1RTOA 1BXTA 1KDBA 3V96A 1LT3D 5M5XB 1S5DD 1RDPD 2E74C 2EYHA 2JA8B 5C5LA 5J39A 1G6ZA 1UAPA 3ND9A 4K2LA 5FLXL 4OIKA 4CJ1B 5C0XG 4A3MB 1LT6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NB0 A;  2KCN A;  1AFP A;  2MHV A;  2NBF A; 
#chains in the Genus database with same CATH topology
 4L8J A;  3KLS X;  3S17 H;  1JJC B;  3FMC A;  2E2J H;  1L0Y B;  5IYD H;  3M7N A;  3P7J A;  4YIJ A;  4B9X A;  1BQQ T;  3DMU A;  1F9R A;  1Q7Y C;  3HOX H;  5I4D A;  1K83 H;  3P20 A;  4DR1 Q;  4DV6 L;  1YHQ A;  1V9P A;  3D3R A;  2B8G A;  1VQN A;  1TWC B;  3A7A B;  4KKU A;  4NP5 A;  2RVL A;  3NP8 A;  2ZM6 Q;  1N32 L;  5CV5 A;  3BYY B;  4PMW A;  1M4V A;  3ERQ A;  4RKL A;  2KHI A;  4WFN 3;  4DV0 Q;  1QIL A;  2QDL A;  2R7D A;  1B2T A;  1F9S A;  4FVM A;  3J80 i;  1F2M A;  4DF7 A;  5LMN L;  4QMG A;  3STB C;  2NVQ H;  2Z4H A;  1EYG A;  3SHL A;  4DV5 L;  2VQE Q;  1XMQ Q;  1EQQ A;  3J7Z C;  1H9J A;  3NEL A;  4F87 A;  2NZ1 D;  2K7V A;  2PO4 A;  3CC7 A;  3D4R A;  4NW2 A;  3CPW A;  5NUC A;  2C35 B;  1VF5 C;  2SEB D;  4X62 L;  4GNX A;  2ES2 A;  5EAY A;  2CKZ B;  4IFD J;  4BA2 I;  2WB1 E;  4JCV E;  4A3J B;  4UY8 C;  3GTP H;  4RHR A;  5C3W A;  3BG3 A;  2ALY B;  4DR3 L;  2DY7 A;  2UUA Q;  3VYT A;  3K7A B;  4CDE C;  1VQL A;  1YNN C;  1XMO L;  4RGO S;  2IPK D;  3SDZ A;  1Q8I A;  4R1J A;  1VQG A;  3GQB A;  4X3K A;  2EYP A;  5KGU A;  1XNR L;  3AYH B;  1I4P A;  5F2D A;  4YWL A;  5C6A A;  3S1Q B;  2R93 B;  3G6E A;  1L2F A;  4B3R L;  1EOT A;  1SND A;  1QG7 A;  2WKC A;  4U68 A;  1QUQ B;  3OMG A;  1VQH A;  1FGB D;  2UXB L;  2IL8 A;  4POG A;  2JA9 A;  1TS3 A;  3RLF A;  1EZ6 A;  3BZC A;  4FF3 A;  1PTO C;  1KRT A;  2V1C C;  5CV6 A;  2VW9 A;  1U0L A;  4NDX A;  2IHF A;  4R4O A;  1FL0 A;  4C1N I;  2NVX H;  4BS9 A;  1J8I A;  3KUP A;  1B9N A;  1S4Z A;  1A15 A;  2G9D A;  4LF9 Q;  5IGB A;  1BOS A;  5LMU Q;  1CK1 A;  1LTA D;  3CCQ A;  1LTL A;  1R9T B;  4LW1 A;  4DV4 Q;  3A55 A;  3A8J E;  3NQT A;  5IWA Q;  4I65 A;  2Z0S A;  1KD1 C;  4UP8 A;  4JK1 C;  1X3E A;  1STH A;  2WAQ E;  2B3G A;  1E22 A;  2K5D A;  5IOC A;  1Y1W G;  2UXC L;  1PTO F;  1Q1B A;  1IYU A;  1LM0 A;  2XN9 C;  5CV8 A;  5K36 G;  4GNX B;  2JJQ A;  4H13 C;  1UE1 A;  5E4X A;  3S16 H;  5C3E H;  1GUO A;  5DLQ E;  3KLS A;  3EN2 A;  5IGD A;  1JB7 A;  2K01 A;  1DOL A;  3FRP B;  2JQO A;  4KD4 A;  5FJ8 H;  1TT2 A;  2WV6 D;  3SK4 A;  4A3I H;  2VB3 X;  2P5Z X;  4CDD C;  2F03 A;  1VQM A;  3K7U C;  5GRO A;  5CYU A;  3QB3 A;  3IFD A;  3PSI A;  1PH7 A;  1ZEQ X;  1I3Q H;  4JI6 Q;  2NWG A;  1YIT A;  1PH3 A;  1A3U A;  2RKS A;  2XSC A;  5EQ0 A;  3CMA A;  3H3V C;  3IL8 A;  3T1Y Q;  3K81 C;  4DNR B;  2G5D A;  1HUM A;  2SNS A;  2ZT9 C;  5CR3 A;  4A4I A;  2AWN A;  5DNF A;  3W3A A;  3K5O A;  4L6T B;  1EY0 A;  3JAM E;  2A6H D;  1SYG A;  2K1B A;  2VS1 A;  4JV5 Q;  3MAQ A;  1OXV A;  2WB1 G;  1KAW A;  1Q3L A;  5D65 A;  1SFO H;  1XWE A;  5EGT A;  5EKL A;  1AZQ A;  1A2T A;  3R3O A;  3D8G A;  3HOZ B;  4OON A;  3AU7 A;  5DM6 3;  2UUB L;  1STB A;  2JEA I;  4J1M A;  3CF5 A;  2MFI A;  1XNQ L;  3S14 B;  2RDG A;  2EYM A;  2KOL A;  2KCM A;  4PMB A;  4XTC S;  2EJM A;  3DWP A;  4CKE A;  3K5L A;  3CQZ H;  4HTH A;  1LTG D;  1OXS C;  3VR4 A;  1EY4 A;  1UUP A;  1YIJ A;  3U4Z A;  5M3F H;  2FIN B;  2QDB A;  5E4W C;  3S2H B;  1U4R A;  1PTO B;  2D9U A;  4LF5 Q;  4QUF A;  4K5X A;  5FK9 C;  1T5X D;  4DV1 L;  2F4V Q;  4JBM A;  1F2Y A;  1HNX L;  1IBL L;  4DK6 C;  2E5L L;  3K58 A;  4K5W A;  4C3I B;  2A19 A;  2O5I C;  2QGQ A;  4PZ8 A;  3RZO B;  2Q8T A;  1YZ6 A;  2YV5 A;  2F0P A;  1EFI D;  1YVC A;  1QVF A;  1EUJ A;  2Z4I A;  1WCM H;  4XDX A;  2F52 A;  3TZD A;  3GTL B;  1G51 A;  2XWJ B;  1I4Q A;  3OTO L;  1S40 A;  4DUY Q;  1MI2 A;  1TWA B;  1HRJ A;  2FFK B;  1B9M A;  1DCZ A;  1GUN A;  2WAQ G;  5M3F G;  3S2D B;  1E24 A;  4A3M G;  2UU9 Q;  2Q8R E;  3BVM A;  5JJZ A;  1K73 C;  5IY0 A;  2AQ2 B;  2D2C C;  1X3F A;  1PH1 A;  3S24 A;  3PCO B;  4X3U A;  2A69 D;  2K33 A;  2B63 B;  2QEX A;  4OXP A;  3MEH A;  4YCV A;  1MSH A;  1HTL D;  1GO3 E;  1WCM G;  2F0V A;  4JI1 Q;  1D6E C;  4LAA A;  2ID0 A;  5EBD A;  5C4X B;  2WAC A;  3DUZ A;  1SJE D;  1Y8O B;  1MSG A;  2YU9 B;  4JI0 L;  4CDF C;  4KHP Q;  1QE6 A;  3UDX A;  5K5P A;  2UXD L;  3NSW A;  2DJF C;  1A3V A;  2JXM B;  4G7H C;  1H95 A;  1B3Q A;  2RHS B;  1HXY D;  2ZXP A;  2OCE A;  1SEB D;  4GN5 A;  2LMC B;  1WYD A;  4DKA C;  1N32 Q;  2KUM A;  4DAV A;  1Q8K A;  2Q8I B;  5CMD A;  1SE4 A;  5AJ3 L;  4LMQ D;  4FNF A;  4K6D A;  4RA8 A;  3X3M A;  2DNE A;  2K14 A;  1M1K C;  4BBS B;  3RNU A;  2D0P A;  2R7Z B;  2HCC A;  1Y69 U;  5BR8 L;  3DEO A;  3UDG A;  1PYS B;  2DNC A;  1JOQ A;  1HQM C;  4L5S A;  3M4O H;  2NB0 A;  2NTT A;  4DV5 Q;  5IP9 H;  4JI7 L;  4LF6 L;  2KCT A;  3CCS A;  2R93 G;  5G3L D;  3PF5 A;  1VQ4 A;  2B29 A;  4F88 A;  4ALP A;  3CW2 C;  5CGK A;  4K14 A;  2VQF L;  2HUG A;  4IUU A;  4X66 L;  1JJ2 A;  2VQE L;  4X62 Q;  2F0M A;  2CWA A;  1LT4 D;  2FMM A;  1U4P A;  2E2I B;  1NCV A;  1BBW A;  4DR3 Q;  4QIW B;  2F0L A;  1XMO Q;  3R8B A;  4JI3 Q;  1Y8P B;  2XVS A;  2EYL A;  3H0G H;  3Q23 A;  1QB5 D;  1U4L A;  4C3J H;  1IYJ B;  1XNR Q;  1GD7 A;  5M9O A;  2NVY B;  2UUA L;  3G4S A;  4B3T Q;  4OO1 G;  1F2L A;  2MQH A;  5A2Q E;  3HOY H;  2RSN A;  1LT5 D;  1ONL A;  2F0D A;  5IP9 G;  1G2S A;  4HIK A;  3OIQ A;  4X3S A;  3KFU A;  4Y7N H;  3S17 B;  3IKJ A;  1E2Z A;  1WTH A;  2E2J B;  2PMZ B;  3TDQ A;  4BWG B;  1A0I A;  4XIG S;  2EVB A;  3C2P A;  4NB3 A;  1NMF A;  1STE A;  1K83 B;  5JPN C;  3J81 E;  5T1I A;  3JAM i;  1EQV A;  1XPU A;  1RJT A;  4K8I A;  3LWE A;  3H0G G;  4KY7 A;  3K80 C;  4B08 A;  1TS5 A;  4A3B G;  2J7Z A;  1N33 L;  3HOY G;  1WTQ A;  1ZYR D;  1JQY D;  1WTR A;  2EY6 A;  2B39 A;  1B7Y B;  4OWX B;  5JEA J;  4QCL A;  1BUV T;  2NVQ B;  2GN5 A;  1JMC A;  3URY A;  1LTS D;  1SRU A;  2A1A A;  5IWA L;  4DR4 L;  4A3L G;  4QGU A;  4N8F A;  3H09 A;  2UXC Q;  1KNA A;  2XGT A;  3BZK A;  3GTP B;  1FVI A;  2R6G A;  3BDO A;  2CW0 D;  4GS3 A;  2ASB A;  2TMP A;  1DZ1 A;  2M9V A;  4E6I A;  3TS0 A;  1VQE A;  1CSQ A;  3NBH A;  3K5N A;  1I50 H;  3K5M A;  1ESR A;  3UDF A;  3E3X A;  3ONA B;  3DLL A;  3GTK H;  3QWN A;  5C4H A;  2XRS D;  4R4C A;  1QCB D;  4ID6 A;  3CME A;  2B2T C;  5J3B A;  1DD2 A;  3LX0 A;  5DM7 3;  1FD7 D;  1IKM A;  3HFZ B;  1S72 A;  3SEB A;  4A76 A;  1IBK L;  2R92 H;  3GV6 A;  1G2T A;  1NBW A;  5IP7 H;  4JBJ A;  2NVX B;  1BF4 A;  2I5L X;  3PO3 H;  1ASZ A;  2MJ8 A;  1B53 A;  4A3E H;  1PV4 A;  2F4I A;  1EY8 A;  5IE8 A;  3NTH A;  3W5O A;  3ULJ A;  4IPD A;  3A8K E;  1ROD A;  4NKL A;  2H1E A;  1CKM A;  2MUY A;  2F0H A;  2E2H B;  3FEW X;  1XX8 A;  5KYI A;  2N49 A;  4V0B A;  1JC7 A;  4KN4 C;  3BDC A;  4AH6 A;  1OTC A;  3A0J A;  4MTN A;  1VQD A;  3EIV A;  4XT1 B;  5ELO A;  1TKW B;  3K6O A;  1A2U A;  4H7B A;  2R92 G;  1ENC A;  1T5E A;  5IP7 G;  3OMC A;  1HPC A;  3S1N H;  1TS4 A;  2UUB Q;  2AMC B;  4A93 H;  3CPF A;  1PZJ D;  5A35 A;  1GXD C;  4C3I G;  1EWH A;  2B2T A;  2PMZ E;  4RGM A;  3S16 B;  1SRO A;  1QNK A;  1Z7T A;  1HR0 W;  1HFG A;  1TWF H;  3BS1 A;  2F0T A;  3T56 B;  1K3R A;  3NBH B;  3TBI B;  3K0X A;  4OIJ A;  2EY5 A;  4K6L A;  5G3L F;  4R8I A;  3J80 L;  2NN6 I;  4YWK A;  1VQB A;  3M4Q A;  2FJ2 A;  1Q1E A;  2WB1 B;  3BZD B;  4C2M H;  3HEJ A;  1I5F A;  1CHP D;  4YY3 L;  1RKN A;  4XYO A;  1IBL Q;  1HNX Q;  1S3O A;  1KLG D;  4LF5 L;  2E5L Q;  5IOD A;  4RH6 A;  2F4V L;  4A3K G;  4UPA A;  1Y1V H;  3NE5 B;  2RBM A;  1ZYR C;  4DNT B;  4CKC A;  1CKN A;  1J9O A;  1UEB A;  4EQ5 A;  1STG A;  4LJZ C;  1UEA B;  3A74 A;  1H9S B;  5JOB A;  1I6V C;  5M3M H;  3OTO Q;  3GTO B;  3Q24 A;  1N34 Q;  2EYF A;  2BA0 A;  1U9R A;  1XTC D;  5C4X G;  2L55 A;  4ZK9 B;  2B2U A;  3PIO 3;  4IFD H;  3S1M H;  1E2W A;  2XWB B;  5EKI A;  4DR2 L;  2CW0 C;  1EY6 A;  3VYS A;  1C0A A;  5D3D A;  1SFO B;  4B3S L;  3TRE A;  3KDF B;  5GAD C;  3ULL A;  1AE2 A;  1I6H H;  4X65 L;  4KMU C;  3LNN A;  3LGJ A;  1PH2 A;  3G48 A;  4PZ6 A;  5KYL A;  1B8A A;  1Y1V G;  4P73 A;  2OQ0 A;  4AQY Q;  5IT9 c;  1LV9 A;  4LK1 C;  1NR4 A;  2A6E C;  4HID A;  1L1O C;  3OWE B;  1EY7 A;  2O4X A;  1LTB D;  1LO5 D;  2MO1 A;  2I0Q A;  4JPB W;  5M5W H;  3CQZ B;  3I56 A;  4JI1 L;  1YI2 A;  2UXD Q;  1TQO A;  3L2P A;  2WAQ B;  3DXJ C;  5M3F B;  2JSO A;  3VYU A;  3F2U A;  4KHP L;  4EGV A;  1UNS A;  4X64 L;  3RUZ A;  2X6L A;  3NTI A;  3RN2 A;  5BN3 A;  2IT1 A;  5J1Z A;  1NJI C;  1Z6H A;  2A8V A;  3NEM A;  1QNU A;  1ZXT A;  5AJ3 Q;  3HS0 C;  3M4Y A;  3HG9 A;  5EPL A;  4B9W A;  2JA6 G;  3H91 A;  4IUN A;  5BR8 Q;  1WCM B;  2DJG C;  3RD4 A;  3NK9 A;  4IUP A;  1SE3 A;  1SNP A;  3CU7 A;  3P1H A;  1ENA A;  1G8Z D;  4IZ8 A;  4G57 A;  1VQ5 A;  3TP5 A;  5ISR A;  4JI7 Q;  4R4I A;  4LF6 Q;  3L9A X;  2VXW A;  4N8X 1;  3CCM A;  2CWP A;  3ZYY X;  2E76 C;  4P72 A;  2VQF Q;  4GOP C;  4A3F G;  4X6A H;  4X66 Q;  2BDN A;  4UHV A;  3M3Y B;  1KAB A;  1L1O A;  5IYD G;  1S5C D;  4BA1 I;  2F1M A;  1YNX A;  2EY2 A;  5I9P A;  3A56 A;  2NVT H;  3HOX G;  1UE5 A;  4QQB X;  3GTJ H;  1D7Q A;  3PUX A;  2YTV A;  5COY A;  4YWM A;  1X3Q A;  3KOJ A;  1K0R A;  1LTI D;  4I7A A;  1CFM A;  4JI3 L;  2IJ0 A;  1SYE A;  1D1K A;  2O5J C;  4QL5 A;  3HOV H;  5C4Z A;  4DR7 L;  4B3T L;  3I70 A;  4GLA C;  4HCS A;  5EPK A;  3MFG A;  4O42 A;  4HCE A;  2M00 A;  4KHZ A;  2TSS A;  1HZB A;  1EEI D;  3U4V A;  5C0X J;  1E1O A;  2MGS A;  4JBW A;  3KF8 A;  4L5Q A;  1TY0 A;  3MHB A;  3EFX D;  4WJW A;  3CCJ A;  2PZU A;  1ET6 A;  3GO5 A;  5C44 H;  3OW2 A;  1IW7 D;  3KLR A;  1YHA A;  4JI5 Q;  1BVS A;  4GOP A;  1N33 Q;  1JOK A;  2A5H A;  3M4O B;  2EE1 A;  1PRT D;  3HKZ B;  1UE7 A;  3HOV G;  2F0W A;  1PDQ A;  1TXY A;  1YJ9 A;  3X3N A;  3TP7 A;  3ICE A;  5CC4 A;  1KDC A;  3J81 c;  4DR4 Q;  4IUR A;  1P16 A;  1KNE A;  4C3H H;  1RIP A;  1FYC A;  2NZO A;  2I46 A;  4KY5 A;  5CBE E;  3UE1 A;  1X32 A;  5E1F A;  4DK1 A;  2NUC A;  1L1O B;  3SK6 A;  2BH2 A;  2RF4 A;  3I8Z A;  5T1G A;  5C44 G;  2A68 D;  1GHK A;  1CKO A;  3H0G B;  4DAM A;  3LWU A;  4C3J B;  1YBY A;  2Q2I A;  3PMF A;  4A3B B;  3ERS X;  1QJO A;  1C9O A;  4IPH A;  2Z8L A;  1B50 A;  5C4J B;  3R2T A;  3HOY B;  3OYY A;  2FXQ A;  2DN8 A;  5BN5 A;  3WOE A;  2KA7 A;  2YYZ A;  5ELN A;  2ZJQ A;  2JA7 H;  2IX1 A;  1PA6 A;  1EQT A;  1IBK Q;  1HR0 Q;  5HUR A;  1P8L A;  1R4Q B;  3T1H Q;  1A6X A;  4C3H G;  1YNJ D;  4QY7 A;  4QUC A;  3E9H A;  1X9N A;  4FP5 D;  3VR3 A;  1WD1 A;  4JI4 Q;  3H6M A;  1HZA A;  5C3E G;  4G7O C;  2F0J A;  3PUY A;  2HT1 A;  1XPO A;  3EJI A;  4R8N A;  4GOP B;  2SDF A;  3PIP 3;  5KND A;  1GJX A;  4XQQ A;  1EOV A;  4OWT B;  4TVA B;  5COR A;  2OXP A;  2R3Z A;  1SDF A;  1VQJ A;  3CCU A;  1OO9 B;  3ER0 A;  3PO2 H;  5FJ8 G;  4DU9 A;  4RHS A;  4A3I G;  5LHY 1;  4KJO A;  1Q12 A;  1JE4 A;  4DR5 L;  3K57 A;  4A3G H;  1BKB A;  3UE0 A;  2LY7 A;  1XPR A;  2F0S A;  3S15 H;  2QEJ C;  1QVG A;  1YHB A;  1PFB A;  1I50 B;  4DA2 A;  4RCN A;  2EJG C;  3E5S A;  4MTK A;  1K9M C;  1X56 A;  3C46 A;  5EJW A;  4NXM L;  3GTK B;  3HP3 A;  2OTL A;  3P75 A;  2F0G A;  2PNR C;  1OXU A;  1TWG H;  4HN7 A;  3GV3 A;  3SE0 A;  5CV9 A;  1STN A;  3MEF A;  4F8M A;  5BN4 A;  3CC4 A;  1WTV A;  1O80 A;  4AYB B;  2KEE A;  1VQ7 A;  1Q81 C;  4YY3 Q;  1QOH A;  4OWW B;  3V05 A;  3PO2 G;  3FPU B;  1IW7 C;  4HJ8 A;  2R92 B;  4ZUI A;  2R61 A;  3HKZ E;  2K52 A;  1D5Z C;  4A3G G;  3NTK A;  1EQR A;  1Q82 C;  3PO3 B;  2JA8 H;  2Q2U A;  2ICI A;  4UP7 A;  1NTG A;  3S1R H;  5FLM H;  1XJV A;  2OT2 A;  1JWU D;  2K28 A;  4O1N A;  4DUZ Q;  2AUK A;  4K0K Q;  1OXT A;  4IUQ A;  2NBF A;  2B2Y C;  1JOR A;  5FLX c;  2MP1 A;  5IT9 E;  4GKJ L;  1AEX A;  2CFM A;  4DR2 Q;  1BCP D;  1SR3 A;  3GD7 A;  1N34 L;  1FNV A;  4B3S Q;  1AFP A;  2ZTD A;  3I2Z A;  1ICW A;  1CI3 M;  3CP0 A;  3OHX C;  5H1S E;  4X65 Q;  4LF4 Q;  3L0O A;  4JW0 A;  2K5W A;  1EIG A;  3CCR A;  2F0N A;  4A3K B;  1HA6 A;  1GUS A;  3S1N B;  1PH5 A;  1NY4 A;  2H5X A;  4A93 B;  3JAM L;  3BVZ A;  1K3B C;  2OEO A;  4I7Z C;  3D31 A;  1KHI A;  4FDB A;  4C56 C;  1E2V A;  4P71 A;  1TWF B;  2ZTE A;  1CZW A;  4AQY L;  2Y0S E;  3BYT B;  2F0Q A;  2A73 B;  2CH4 A;  1U5K A;  3AFP A;  1K8A C;  1JOO A;  4KD3 A;  4KTA A;  1MJC A;  2QIL A;  2Z9H A;  4C2M B;  1AH9 A;  3HOW H;  3VR5 A;  3CHB D;  4KLK A;  4X64 Q;  2F0O A;  1V1Q A;  5JVH 3;  4IPG A;  3VYR A;  1UWV A;  2EOT A;  1Y1V B;  4LUO A;  5C5M A;  2B2Y A;  5JEA H;  1NSN S;  4B3M Q;  3PQI A;  3ND8 A;  4GZY C;  2N78 A;  2A6H C;  4FYD A;  3KF6 A;  3S1Q H;  4ZYS A;  1V1P A;  5LL6 X;  2JA5 H;  1HZC A;  1CQV A;  4IOC A;  3S1M B;  3HOW G;  4IAL A;  2PQA A;  3TZU A;  5ELB A;  2X69 A;  4HJ5 A;  5HGT A;  4DK3 C;  1I6H B;  4LFC L;  1D8L A;  1E1T A;  1B44 D;  3MZ5 A;  3TP6 A;  3RZD H;  4FO2 A;  4HJ9 A;  2IY5 B;  3U50 C;  1EIF A;  4AYB E;  4KJN A;  1DM0 B;  1EY9 A;  1T9H A;  2JYO A;  4R9W A;  3NQI A;  2JA6 B;  1NMG A;  4APV A;  4KY6 A;  3ITP A;  3EBE A;  1ML0 D;  2DY8 A;  3EQL C;  3W1G A;  4H0L C;  3R93 A;  1H9M A;  2D62 A;  4HMJ A;  4DFA A;  5M5Y H;  5M5W B;  3CCV A;  1R9T H;  4XQJ A;  4DR7 Q;  4BY1 H;  2C5C A;  3I4M H;  1CSP A;  1YJW A;  2PI2 E;  3CCE A;  3HKZ G;  1HCZ A;  2RDH A;  1A62 A;  1F2Z A;  1STA A;  2Z1C A;  1ASY A;  5D14 A;  4A3F B;  1WVL A;  3VR6 A;  5KNB A;  1RF2 D;  2KHJ A;  5EBC A;  4CHT B;  1CT1 D;  1NAP A;  3M9B A;  2BCO A;  2E75 C;  4HED A;  1U4M A;  1RTN A;  1DOK A;  2QA4 A;  1ICF B;  4OEM B;  3H15 A;  2A74 C;  1KC8 C;  3HOX B;  3GTQ H;  4LNQ A;  2KJX A;  4ILW A;  3SXH A;  1STY A;  1TY2 A;  1VQA A;  1EU4 A;  2HIX A;  1GUT A;  5D3I B;  1BCP C;  1CM9 A;  3I73 A;  3EVQ A;  1X6O A;  4CBV A;  1IZ6 A;  4C3J G;  2KEN A;  4JI2 L;  4A3D H;  4BY1 G;  4JI5 L;  2HHH L;  3OSO A;  2K03 A;  3KYH C;  1RL2 A;  4CKB A;  2XNA C;  5JJI A;  4ZRZ A;  1G29 1;  2RSO A;  3MFY A;  1I4R A;  1VQ9 A;  3H3V I;  1PYW D;  4TSS A;  3I90 A;  1LYL A;  1NR2 A;  3PV0 A;  2A69 C;  1PYB A;  4IPC A;  5IIF A;  2EQS A;  2PQA B;  4HSP A;  2YTY A;  4K5V A;  2QF7 A;  2NVT B;  5GQO A;  2Y0S G;  2KQ3 A;  4R4Q A;  2EDG A;  4LFA L;  1NUC A;  2E8G A;  4OX9 Q;  1HHV A;  4KI0 A;  2MHV A;  3J7A 5;  2B2W A;  5C0X I;  2HQE A;  3BU2 A;  1KTK A;  1F9P A;  2K50 A;  3T13 A;  3VA7 A;  3Q0A A;  4GN3 B;  1JIC A;  1TII D;  1PH9 A;  3RR5 A;  4FXG C;  1VQI A;  2OF1 A;  1MJE A;  4OHJ A;  2ZXR A;  1A3T A;  4XYQ A;  3QO2 A;  3HOV B;  1BCP F;  4PG3 A;  3I91 A;  4XXE A;  1AZP A;  1PVO A;  3FKI H;  3NUC A;  1TWH H;  1WOC A;  1D1I A;  4PV1 C;  1TS2 A;  3J7A V;  2OTJ A;  2H4O A;  1M90 C;  4G4K A;  1B70 B;  2LXJ A;  3FHW A;  3QR8 A;  1C48 A;  1HR0 L;  2AHO B;  5A2Q L;  4YCW A;  3RMH A;  3T1H L;  1CTM A;  5C44 B;  2YTX A;  4HSV A;  4QJF A;  1PH6 A;  4WRD A;  2F0I A;  1HZ9 A;  5I9O A;  2JN4 A;  3DM1 A;  1NNX A;  2VB2 X;  4A3C H;  2JK8 A;  2WKD A;  1LTR D;  3E9I A;  2DGY A;  2QKI C;  3DWQ A;  2BOS A;  1EIY B;  4EQN A;  4JI4 L;  1SJH D;  2BH8 A;  1VMP A;  1PTO H;  3FKI G;  4KV6 A;  4AYB G;  5IGC A;  4POF A;  3U58 A;  1HA5 A;  4BY7 H;  4NXN L;  1BBX C;  3CD6 A;  3U9S A;  4C3H B;  5KIX A;  4DR5 Q;  1HQR D;  1K8O A;  3DEP A;  3DM3 A;  1WTW A;  2L11 A;  2WP8 J;  3F1Z A;  4ME3 A;  1I94 L;  2B2U C;  3RZO H;  2K6A A;  3S9W A;  2R7F A;  4V19 0;  1KDA A;  1PH8 A;  3AFQ A;  4MN3 A;  3PO3 G;  4NXM Q;  3HOU H;  2GA4 B;  4A3E G;  5C3E B;  1F77 A;  4MZ9 A;  3WDN A;  4WJ3 M;  3HGB A;  2F0F A;  1II3 A;  1GVP A;  3Q8D A;  1EEF D;  2RCF A;  1PZI D;  2JA7 B;  1EYC A;  2EJF C;  1I4G A;  2X6G A;  4BBR H;  3UDI A;  4JI8 L;  3O13 A;  3STB D;  4BY7 G;  1SLJ A;  2IW3 A;  4O2D A;  1X3P A;  4RWS C;  3FDT A;  5FLX E;  4A3I B;  3NEN A;  5KNC A;  3E6Z X;  4NMZ A;  2MO0 A;  1V8Q A;  3ERO A;  2RDF A;  4LF7 L;  4K8J A;  1BCP B;  1UE6 A;  1I3Q B;  2OQK A;  2QW7 A;  4MHE A;  3CKI B;  4JOI A;  4A93 G;  4TQU S;  1SN8 A;  3W2D A;  1L0X B;  1CHQ D;  4IJL A;  4S3S A;  2F0K A;  1FJG Q;  3I3C A;  1YNN D;  5KRU A;  3SK8 A;  2YU9 H;  2HCI A;  4GKJ Q;  4DUZ L;  1VQP A;  3OW7 A;  5I6W A;  4K0K L;  4ABN A;  5I2X A;  2KBN A;  1K8G A;  3WOF A;  1JWS D;  4BBR G;  2J0T D;  3PO2 B;  4HAE A;  4ZUJ A;  3I55 A;  4JG2 A;  4A3G B;  3KBG A;  4LF4 L;  1PTO D;  2LXK A;  3MWY W;  3S15 B;  4JC0 A;  4DXG A;  1PXU A;  1LAC A;  3VDY A;  3B6Y A;  2K32 A;  4LWC A;  3TP8 A;  1DYQ A;  3PF4 A;  1TWG B;  2Q2H A;  5C0X H;  1FNW A;  5M3M G;  4QB4 A;  2NZH A;  2WIN B;  2PZW A;  3J81 i;  2EXZ A;  1X55 A;  4DK0 A;  4IFD G;  4RGN A;  2BE5 D;  2Q2T A;  1KIX A;  2XIW A;  4Y52 H;  3CC2 A;  4L5R C;  2E2I H;  1WTO A;  4J8Q A;  1IL2 A;  1Z47 A;  5L37 A;  2D5D A;  2XTI A;  4RG1 A;  1MIU A;  2BDO A;  2K4K A;  1KL9 A;  2AWO A;  1MGS A;  3S1R B;  3GTG H;  4B3M L;  3K8A A;  5FKA C;  1EFW A;  4EVO A;  1SNQ A;  1J6Q A;  4C1N K;  3IAY A;  1L0W A;  3TQY A;  1CKN B;  5JAV A;  3MXN A;  3C3L A;  3K59 A;  3MVV A;  3R2I A;  3KLW A;  1JJG A;  1S5E D;  1V43 A;  2PPB C;  2D0O A;  3BDL A;  3I4N H;  4FXD A;  3H94 A;  4JVZ A;  4LFC Q;  1GOZ A;  2WII B;  2ICE C;  4Q0F A;  1PHJ A;  2CH4 W;  2J4X A;  1HH2 P;  3T16 A;  5JJL A;  2PW7 A;  4ZKC B;  1A8V A;  4RMF A;  3NWT A;  3T4A C;  3PGZ A;  1I4X A;  4XQN A;  3G71 A;  3N52 A;  2HDL A;  1VF7 A;  1GKH A;  5IYC H;  1QZH A;  2E2D C;  4DV3 L;  1D5M C;  3HOW B;  2IX0 A;  4M8A A;  3SGI A;  4YHH L;  3I4N G;  4P75 A;  1ESF A;  1O7Z A;  4ZAI A;  2NN6 H;  1Q90 A;  4FF4 A;  3SK5 A;  1MBY A;  1SNO A;  5JPM C;  1HNZ L;  1GHJ A;  4ZLT F;  4TRD A;  2VUM H;  1ET9 A;  3MXU A;  4JI2 Q;  3KJO A;  3RN5 A;  5IGF A;  1TR5 A;  4HR7 B;  1Q46 A;  4Z9C B;  3K0Y A;  2HHH Q;  2JA5 B;  1RD9 D;  4N9P A;  5IYC G;  1XXG A;  5JJK A;  2JEB I;  4YCU A;  3MXN B;  5LMN W;  2Z6K C;  5EPJ A;  2L9H A;  1Y1W H;  2NN6 G;  1O78 A;  5FO7 B;  5IGG A;  2OWO A;  3RZD B;  3J7Y W;  5K36 H;  1N8R C;  2EPB A;  4LFA Q;  1EYA A;  1SBB B;  3BVG A;  2AUJ D;  1XYI A;  1E0B A;  1Q86 C;  1D5X C;  3HRZ C;  1SNC A;  2VUM G;  2BA1 A;  4DV2 Q;  5M5Y B;  4OX9 L;  2L5T A;  3A8I E;  1B1Z A;  2ZJP A;  2E2H H;  2L0C A;  2BE5 C;  4BY1 B;  3I4M B;  1BO0 A;  3KJP A;  1CA5 A;  3TME A;  3NWS A;  1DON A;  3G6J B;  4UDU C;  2GVA A;  4Y7N B;  1JB3 A;  1OXX K;  5TSS A;  1JE5 A;  4IO9 A;  1PH4 A;  3CXC A;  4DN4 M;  2F3W A;  2PI2 A;  2Y0S B;  1IBM L;  3UI2 A;  3GTQ B;  4HJ7 A;  1KXL A;  5FOB B;  1CZG A;  1JR0 D;  2N8N A;  4DR6 L;  1VQK A;  3KF8 B;  4G7Z C;  1W2B A;  2UUC L;  4UAI A;  4A3D B;  2Z6K A;  3ZJY C;  1FGU A;  2CHB D;  4RKB A;  4FF1 A;  3GTM H;  1AW7 A;  1TVX A;  4EQO A;  1RHP A;  3J80 c;  4DPG A;  2FMC A;  2C9O A;  2IWH A;  1EL0 A;  1AE3 A;  3TEH B;  4N9T A;  2JA7 G;  1F9Q A;  4NXN Q;  1HNW L;  3FPP A;  5JVG 3;  1KLU D;  3JC6 6;  4BXX H;  1W6J A;  4CDC C;  1I94 Q;  4OO1 I;  4X3T A;  1LLR D;  4KK7 A;  1CUK A;  3CAM A;  3NXW A;  1KRS A;  2KVM A;  5CV4 A;  4RCO A;  1YEZ A;  3J7A F;  3GTO H;  4DAY A;  1SYD A;  3D4D A;  3A54 A;  1DOM A;  1IYV A;  1IKL A;  2IHE A;  3QOL A;  1O7Y A;  4J6H A;  3FKI B;  1C4Q A;  1H9K A;  1TWH B;  4JI8 Q;  1LTT D;  1VQ6 A;  3OIP A;  4J15 A;  1VCI A;  3MXP A;  4LFB Q;  2JP1 A;  1LUZ A;  3F2C A;  1N36 Q;  2L15 A;  3A7L A;  2K5N A;  3HKS A;  4IOA A;  1FR3 A;  2N88 A;  3C1E A;  4JYA L;  4LF8 L;  3I72 A;  4BXX G;  5M5X H;  4LF7 Q;  4GKK L;  2EYO A;  2SNM A;  2AKW B;  2LFN A;  5KEE A;  1BR9 A;  2KEC A;  1QWY A;  1PRT C;  5CBA E;  3L7Z C;  4EX5 A;  1SNM A;  4ZQ3 A;  1SE2 A;  3QIA A;  4A3E B;  2LS0 1;  3L3O C;  1SMY D;  1Z9F A;  2DUD A;  1ILP A;  1FJG L;  4A3M H;  2N55 A;  1D2B A;  3FVQ A;  4FXK C;  1AN8 A;  3A5Z B;  2ENB A;  3KK7 A;  4BY7 B;  3E0E A;  3EA6 A;  1TU2 B;  2A68 C;  3M4P A;  4DV7 Q;  3IRB A;  3MC0 B;  1X65 A;  2Z6B A;  1TWC H;  4KKS A;  4LUV A;  3PUV A;  3CCL A;  3ULP A;  1VQC A;  2JA8 G;  2HIV A;  4CJ0 B;  3HOU B;  4KHV A;  4F7X A;  1JCK B;  1J5E L;  5J22 A;  1WJJ A;  5FLM G;  3PIO A;  1PRT F;  5IYB H;  5FO8 B;  1JWM D;  3RLO A;  1K8M A;  3M7G A;  3U9O A;  4XT3 B;  4DAY B;  2IX3 A;  4GLX A;  2JE6 I;  3M3Y H;  4BBR B;  4DNI A;  1YNJ C;  3F2D A;  4IUT A;  3Q22 A;  1BDO A;  1WI5 A;  2ZTC A;  3T53 B;  4EQP A;  1VQ8 A;  1RCV D;  1PFS A;  3MXG A;  4PNY A;  1CQF A;  4A3J H;  1GUW A;  2MNA A;  2PQE A;  2HQL A;  3OWF A;  3K7A H;  2V4D A;  1KQS A;  1W3S A;  4FF2 A;  3C1F A;  4ULL A;  4KKT A;  1DXM A;  3D6C A;  2ZXO A;  4ME5 A;  1PFM A;  5IYB G;  5M3M B;  2EXD A;  3QOJ A;  2R93 H;  2EIF A;  2SOB A;  4P2C B;  3D6W A;  2I07 B;  1SYF A;  4DV6 Q;  5I2Y A;  2KHS A;  2HDM A;  1XTD A;  1BNZ A;  5ELC A;  1DJR D;  1SXT A;  4DR1 L;  4A3J G;  1WTX A;  2VNU D;  4NPS A;  2RQX A;  3NHH A;  4OL7 A;  5IT9 L;  1JT8 A;  2PYK A;  3VR2 A;  2ZM6 L;  5JEA G;  2PNH A;  2WFW A;  4OO1 H;  4DV0 L;  5LMN Q;  1ILQ A;  5I6Y A;  2MPM A;  3NPP A;  4DV3 Q;  2G9H D;  1Y8N B;  2JA5 G;  4YHH Q;  1KAA A;  1Y14 B;  2B2W C;  4IUV A;  1XMQ L;  3TSS A;  1O7I A;  2K05 A;  3AQQ A;  2EY1 A;  2KCN A;  4PMC A;  3AEV A;  3Q6S A;  5DEH A;  4CGY B;  2F3V A;  1MD2 D;  1PRT B;  2M2L A;  1HNZ Q;  3D4W A;  4PQX A;  1SMY C;  4IQZ A;  1B3A A;  4PZ7 A;  5HY6 A;  4A3B H;  3GTG B;  2F0E A;  3MA2 B;  5C4J H;  4B3R Q;  4IN3 A;  1VDZ A;  1PMR A;  4DAP A;  2UXB Q;  5IGE A;  4HJA A;  1MHW C;  1SAP A;  3I4M G;  3DWA A;  1IL8 A;  2N3S A;  3AMU A;  2EZV A;  3KF6 B;  1EY5 A;  3HZX A;  4H02 A;  4A3L H;  1SYC A;  3I4N B;  1QVC A;  1V1P B;  1A63 A;  1EZ8 A;  2L4N A;  1PFN A;  2AQ3 B;  2F3I A;  2VY3 A;  4U67 3;  1I4H A;  2K75 A;  2XRQ D;  3V2T A;  1H9R A;  2LKV A;  1CA6 A;  4L5T A;  5GAH C;  2L1B A;  1EWC A;  2I5H A;  3GTJ B;  4IFD I;  4P74 A;  2LSS A;  3SVM A;  1M8A A;  1E3P A;  3CRK C;  3E0J A;  4LF9 L;  4GLV B;  5E7N A;  1IHZ A;  1WD0 A;  4DV2 L;  4MIU A;  1SMX A;  5GAG C;  5LMU L;  1X54 A;  1HJP A;  4A3D G;  3TN2 A;  4ZCK A;  3SR1 A;  2VL6 A;  3RLN A;  4DV4 L;  4DXF A;  1K28 A;  1DGS A;  4KN7 C;  2B2V C;  2FHT A;  1G91 A;  1V1O A;  1PLF A;  4HMI A;  5AFW A;  3J80 E;  1IBM Q;  2GVB A;  4IJH A;  3HOZ H;  1S5B D;  1SYB A;  2K5Q A;  3GP7 A;  3A5U A;  4UP9 A;  4DR6 Q;  2ZJR A;  4TKO B;  4RFB A;  5CV7 A;  1E7Z A;  2VUM B;  1IXR A;  3S14 H;  2UUC Q;  2K5V A;  4HIM A;  1HUN A;  2A6E D;  1R4P B;  3J81 j;  3VA5 A;  4WJ4 A;  2EYJ A;  2NYZ D;  3OOC A;  4L63 B;  3KBX A;  3S2H H;  1HNW Q;  3D0F A;  3J81 L;  4JOI C;  2AQ1 B;  1LAB A;  5C3X A;  1VQO A;  1YJN A;  1Y1W B;  3N6R A;  4QF4 A;  4O0A A;  2PZT A;  1G6P A;  1ZKO A;  2QCP X;  3HOZ G;  1MKH A;  1H9S A;  3AB9 A;  5E3F A;  2CVR A;  3QG1 A;  4C3I H;  3I7F A;  4OEL B;  4Q5V A;  1W6K A;  1AP0 A;  3G7L A;  4JI6 L;  1EU3 A;  2RCN A;  1B4O A;  1HTP A;  2F0U A;  3T51 B;  2O2L D;  3PIP A;  3T1Y L;  3GTL H;  1BBU A;  2B2V A;  4DGZ A;  4A3C G;  3I4L A;  4QIW E;  2RHQ B;  3KDF A;  1TWA H;  2PCF B;  4JV5 L;  5ELD A;  2HD3 A;  5LL6 S;  3S2D H;  4RGT A;  3BJU A;  4HIO A;  4M1U B;  4JYA Q;  1EWI A;  4LF8 Q;  4A3K H;  4H44 C;  2B8F A;  5FO9 B;  4GKK Q;  4LFB L;  1XNQ Q;  1EYD A;  1S5F D;  1N36 L;  3JAM c;  1VS0 A;  2RA4 A;  1ENF A;  2B63 H;  4MNO A;  1WTP A;  4RAU C;  3WWV A;  1C7Y A;  3NBI A;  3HOU G;  5C4X H;  3GTM B;  2CCZ A;  2NTS A;  4K2K A;  4OGQ C;  4CJ2 C;  1HFN A;  1K0S A;  2K04 A;  4DV1 Q;  2CQA A;  1VMC A;  5HGQ A;  2CQO A;  4GN4 B;  1QZG A;  3MTS A;  2PW5 A;  1O7L A;  3F2B A;  3CRL C;  5EKK A;  5DAU A;  4R4T A;  5ELF A;  4ODG A;  3H3V H;  2L12 A;  4DV7 L;  3TS2 A;  1GUG A;  3DHQ A;  2B63 G;  1SSO A;  1GM5 A;  3IFT A;  2I5M X;  1J5E Q;  4JBK A;  2R7Z H;  4BBS H;  2KED A;  1C8C A;  1EIH A;  2VZA A;  5ELE A;  2K5H A;  1FNU A;  2ATW A;  4WOR A;  3QJY A;  4ZKB B;  3PUZ A;  1PZK D;  3OPO A;  4AIM A;  4DUY L;  3M85 A;  3PUW A;  4A75 A;  1VQF A;  3TRZ A;  2KCC A;  1NE3 A;  3F8T A;  1RTO A;  5GAE C;  1BXT A;  2UU9 L;  1KDB A;  1SE8 A;  3V96 A;  1LT3 D;  4LUZ A;  5M5X B;  1S5D D;  1X3G A;  3FP9 A;  2JA6 H;  1RDP D;  2E74 C;  2EYH A;  2JA8 B;  5C5L A;  2R7Z G;  4BBS G;  5J39 A;  4GNX C;  1G6Z A;  4JI0 Q;  1QUQ A;  1N9W A;  1UAP A;  3W1B A;  2NVY H;  3GDE A;  3ND9 A;  4K2L A;  5FLX L;  4OIK A;  4CJ1 B;  5C0X G;  3I4O A;  1WFQ A;  4A3F H;  4A3M B;  1LT6 D; 
#chains in the Genus database with same CATH homology
 4L8J A;  3KLS X;  3FMC A;  1L0Y B;  3M7N A;  3P7J A;  4YIJ A;  4B9X A;  1BQQ T;  3DMU A;  1F9R A;  5I4D A;  3P20 A;  3D3R A;  2B8G A;  1TWC B;  3A7A B;  4KKU A;  4NP5 A;  2RVL A;  3NP8 A;  5CV5 A;  3BYY B;  4PMW A;  1M4V A;  3ERQ A;  4RKL A;  4WFN 3;  1QIL A;  1B2T A;  1F9S A;  4FVM A;  1F2M A;  4DF7 A;  4QMG A;  2Z4H A;  3SHL A;  1H9J A;  4F87 A;  2NZ1 D;  2K7V A;  2PO4 A;  3D4R A;  4NW2 A;  5NUC A;  1VF5 C;  2SEB D;  4IFD J;  4BA2 I;  4A3J B;  4RHR A;  5C3W A;  3BG3 A;  2DY7 A;  3VYT A;  3K7A B;  1YNN C;  4RGO S;  2IPK D;  3SDZ A;  1Q8I A;  3GQB A;  4X3K A;  2EYP A;  5KGU A;  1I4P A;  5F2D A;  5C6A A;  3S1Q B;  2R93 B;  1EOT A;  1SND A;  1QG7 A;  2WKC A;  4U68 A;  3OMG A;  1FGB D;  2IL8 A;  1TS3 A;  3RLF A;  1EZ6 A;  4FF3 A;  1PTO C;  5CV6 A;  4NDX A;  4C1N I;  4BS9 A;  1J8I A;  3KUP A;  1B9N A;  1S4Z A;  1A15 A;  2G9D A;  5IGB A;  1BOS A;  1CK1 A;  1LTA D;  1R9T B;  3A55 A;  3A8J E;  3NQT A;  4I65 A;  4JK1 C;  1STH A;  2K5D A;  5IOC A;  1PTO F;  1Q1B A;  1IYU A;  2XN9 C;  5CV8 A;  5K36 G;  4H13 C;  5E4X A;  1GUO A;  3KLS A;  5IGD A;  2K01 A;  1DOL A;  3FRP B;  4KD4 A;  1TT2 A;  2WV6 D;  3SK4 A;  2VB3 X;  2F03 A;  5CYU A;  3QB3 A;  3IFD A;  1ZEQ X;  2NWG A;  1A3U A;  2RKS A;  2XSC A;  5EQ0 A;  3H3V C;  3IL8 A;  4DNR B;  1HUM A;  2SNS A;  2ZT9 C;  5CR3 A;  2AWN A;  5DNF A;  3W3A A;  3K5O A;  4L6T B;  1EY0 A;  3JAM E;  2A6H D;  1SYG A;  2K1B A;  3MAQ A;  1OXV A;  1Q3L A;  5D65 A;  1XWE A;  5EGT A;  5EKL A;  1AZQ A;  1A2T A;  3R3O A;  3D8G A;  3HOZ B;  3AU7 A;  5DM6 3;  1STB A;  2JEA I;  4J1M A;  3S14 B;  2RDG A;  2EYM A;  2KOL A;  4PMB A;  4XTC S;  2EJM A;  3DWP A;  4CKE A;  3K5L A;  4HTH A;  1LTG D;  1OXS C;  3VR4 A;  1EY4 A;  1UUP A;  2FIN B;  2QDB A;  5E4W C;  3S2H B;  1U4R A;  1PTO B;  2D9U A;  4QUF A;  4K5X A;  5FK9 C;  1T5X D;  1F2Y A;  3K58 A;  4K5W A;  4C3I B;  2O5I C;  3RZO B;  2Q8T A;  2F0P A;  1EFI D;  2Z4I A;  4XDX A;  3TZD A;  3GTL B;  2XWJ B;  1I4Q A;  1MI2 A;  1TWA B;  1HRJ A;  2FFK B;  1B9M A;  1DCZ A;  1GUN A;  3S2D B;  2Q8R E;  3BVM A;  5JJZ A;  2AQ2 B;  2D2C C;  4X3U A;  2A69 D;  2K33 A;  2B63 B;  3MEH A;  1MSH A;  1HTL D;  2F0V A;  1D6E C;  4LAA A;  2ID0 A;  5EBD A;  5C4X B;  2WAC A;  3DUZ A;  1SJE D;  1Y8O B;  1MSG A;  2YU9 B;  1QE6 A;  5K5P A;  3NSW A;  1A3V A;  2JXM B;  4G7H C;  1HXY D;  2ZXP A;  1SEB D;  2LMC B;  2KUM A;  4DAV A;  5CMD A;  2Q8I B;  1SE4 A;  4LMQ D;  4FNF A;  4K6D A;  4RA8 A;  3X3M A;  2DNE A;  2R7Z B;  4BBS B;  2HCC A;  1Y69 U;  3DEO A;  2DNC A;  1JOQ A;  1HQM C;  2NB0 A;  2NTT A;  5G3L D;  4F88 A;  5CGK A;  4K14 A;  2HUG A;  4IUU A;  2F0M A;  1LT4 D;  2FMM A;  1U4P A;  2E2I B;  1NCV A;  4QIW B;  2F0L A;  3R8B A;  1Y8P B;  2XVS A;  2EYL A;  3Q23 A;  1QB5 D;  1U4L A;  5M9O A;  2NVY B;  4OO1 G;  1F2L A;  5A2Q E;  2RSN A;  1LT5 D;  1ONL A;  2F0D A;  1G2S A;  3OIQ A;  4X3S A;  3S17 B;  3IKJ A;  1E2Z A;  2E2J B;  2PMZ B;  3TDQ A;  4BWG B;  4XIG S;  2EVB A;  3C2P A;  1STE A;  1K83 B;  5JPN C;  3J81 E;  5T1I A;  1EQV A;  1RJT A;  4K8I A;  3LWE A;  4KY7 A;  4B08 A;  1TS5 A;  2J7Z A;  1WTQ A;  1ZYR D;  1JQY D;  1WTR A;  2EY6 A;  2B39 A;  5JEA J;  4QCL A;  1BUV T;  2NVQ B;  3URY A;  1LTS D;  3H09 A;  1KNA A;  3GTP B;  2R6G A;  3BDO A;  2CW0 D;  2TMP A;  1DZ1 A;  2M9V A;  4E6I A;  3NBH A;  3K5N A;  3K5M A;  1ESR A;  3ONA B;  3QWN A;  5C4H A;  2XRS D;  1QCB D;  4ID6 A;  2B2T C;  1DD2 A;  3LX0 A;  5DM7 3;  1FD7 D;  1IKM A;  3SEB A;  3GV6 A;  1G2T A;  2NVX B;  1BF4 A;  2MJ8 A;  1B53 A;  2F4I A;  1EY8 A;  3NTH A;  3A8K E;  1ROD A;  4NKL A;  2H1E A;  2MUY A;  2F0H A;  2E2H B;  3FEW X;  1XX8 A;  5KYI A;  4V0B A;  1JC7 A;  4KN4 C;  3BDC A;  4XT1 B;  1TKW B;  3K6O A;  1A2U A;  4H7B A;  1ENC A;  1T5E A;  3OMC A;  1HPC A;  1TS4 A;  1PZJ D;  5A35 A;  1GXD C;  4C3I G;  1EWH A;  2B2T A;  4RGM A;  3S16 B;  1QNK A;  1Z7T A;  1HFG A;  3BS1 A;  2F0T A;  3T56 B;  3TBI B;  4OIJ A;  2EY5 A;  4K6L A;  5G3L F;  4R8I A;  3J80 L;  2NN6 I;  2FJ2 A;  1Q1E A;  2WB1 B;  3BZD B;  3HEJ A;  1CHP D;  1RKN A;  4XYO A;  1KLG D;  5IOD A;  4RH6 A;  3NE5 B;  2RBM A;  1ZYR C;  4DNT B;  4CKC A;  1J9O A;  1STG A;  4LJZ C;  1UEA B;  1H9S B;  5JOB A;  1I6V C;  3GTO B;  3Q24 A;  2EYF A;  2BA0 A;  1U9R A;  1XTC D;  2L55 A;  4ZK9 B;  2B2U A;  3PIO 3;  4IFD H;  1E2W A;  2XWB B;  5EKI A;  2CW0 C;  1EY6 A;  3VYS A;  5D3D A;  1SFO B;  4KMU C;  3LNN A;  5KYL A;  1LV9 A;  4LK1 C;  1NR4 A;  2A6E C;  3OWE B;  1EY7 A;  2O4X A;  1LTB D;  1LO5 D;  3CQZ B;  1TQO A;  2WAQ B;  3DXJ C;  5M3F B;  2JSO A;  3VYU A;  3F2U A;  4EGV A;  1UNS A;  3RUZ A;  2X6L A;  3NTI A;  5BN3 A;  2IT1 A;  5J1Z A;  1Z6H A;  1QNU A;  1ZXT A;  3HS0 C;  3M4Y A;  3HG9 A;  5EPL A;  4B9W A;  3H91 A;  4IUN A;  1WCM B;  3RD4 A;  3NK9 A;  4IUP A;  1SE3 A;  1SNP A;  3CU7 A;  3P1H A;  1ENA A;  1G8Z D;  4IZ8 A;  4G57 A;  3TP5 A;  5ISR A;  3L9A X;  2VXW A;  3ZYY X;  2E76 C;  2BDN A;  3M3Y B;  1KAB A;  1S5C D;  4BA1 I;  2F1M A;  2EY2 A;  5I9P A;  3A56 A;  3PUX A;  5COY A;  1X3Q A;  1LTI D;  1CFM A;  2IJ0 A;  1SYE A;  1D1K A;  2O5J C;  5C4Z A;  3I70 A;  4HCS A;  5EPK A;  3MFG A;  4O42 A;  4HCE A;  2M00 A;  4KHZ A;  2TSS A;  1EEI D;  5C0X J;  2MGS A;  4JBW A;  3KF8 A;  1TY0 A;  3MHB A;  3EFX D;  4WJW A;  2PZU A;  1ET6 A;  3GO5 A;  1IW7 D;  3KLR A;  1JOK A;  2A5H A;  3M4O B;  2EE1 A;  1PRT D;  3HKZ B;  2F0W A;  1PDQ A;  3X3N A;  3TP7 A;  5CC4 A;  1KDC A;  4IUR A;  1KNE A;  5CBE E;  1FYC A;  4KY5 A;  2I46 A;  1X32 A;  5E1F A;  4DK1 A;  2NUC A;  3SK6 A;  3I8Z A;  5T1G A;  2A68 D;  1GHK A;  3H0G B;  3LWU A;  4C3J B;  3PMF A;  4A3B B;  1QJO A;  2Z8L A;  1B50 A;  5C4J B;  3R2T A;  3HOY B;  2DN8 A;  5BN5 A;  3WOE A;  2KA7 A;  2YYZ A;  2IX1 A;  1EQT A;  5HUR A;  1R4Q B;  1A6X A;  4C3H G;  1YNJ D;  4QUC A;  4FP5 D;  3VR3 A;  1WD1 A;  3H6M A;  4G7O C;  2F0J A;  3PUY A;  3EJI A;  4R8N A;  2SDF A;  3PIP 3;  5KND A;  1GJX A;  4XQQ A;  5COR A;  2OXP A;  2R3Z A;  1SDF A;  1OO9 B;  4DU9 A;  4RHS A;  5LHY 1;  4KJO A;  1Q12 A;  1JE4 A;  3K57 A;  2LY7 A;  2F0S A;  2QEJ C;  1PFB A;  1I50 B;  4DA2 A;  4RCN A;  2EJG C;  3E5S A;  3C46 A;  5EJW A;  3GTK B;  3HP3 A;  3P75 A;  2F0G A;  2PNR C;  1OXU A;  4HN7 A;  3SE0 A;  3GV3 A;  5CV9 A;  1STN A;  4F8M A;  5BN4 A;  1WTV A;  1O80 A;  4AYB B;  2KEE A;  1QOH A;  3V05 A;  3FPU B;  1IW7 C;  2R92 B;  4ZUI A;  2R61 A;  1D5Z C;  3NTK A;  3PO3 B;  2ICI A;  2OT2 A;  1JWU D;  2K28 A;  4O1N A;  2AUK A;  1OXT A;  4IUQ A;  2NBF A;  2B2Y C;  1JOR A;  2MP1 A;  5IT9 E;  1AEX A;  1BCP D;  3GD7 A;  1FNV A;  1AFP A;  1ICW A;  1CI3 M;  3OHX C;  2K5W A;  1EIG A;  2F0N A;  4A3K B;  1HA6 A;  1GUS A;  3S1N B;  4A93 B;  3JAM L;  3BVZ A;  4I7Z C;  2OEO A;  3D31 A;  4C56 C;  1E2V A;  1TWF B;  1CZW A;  3BYT B;  2F0Q A;  2A73 B;  1JOO A;  4KD3 A;  4KTA A;  2QIL A;  4C2M B;  3VR5 A;  3CHB D;  2F0O A;  5JVH 3;  3VYR A;  2EOT A;  1Y1V B;  5C5M A;  2B2Y A;  5JEA H;  1NSN S;  3ND8 A;  4GZY C;  2A6H C;  4FYD A;  4ZYS A;  1V1P A;  5LL6 X;  1CQV A;  3S1M B;  4IAL A;  3TZU A;  5ELB A;  2X69 A;  5HGT A;  1I6H B;  1B44 D;  3MZ5 A;  3TP6 A;  4FO2 A;  4KJN A;  1DM0 B;  1EY9 A;  2JYO A;  4R9W A;  3NQI A;  2JA6 B;  4KY6 A;  3ITP A;  1ML0 D;  2DY8 A;  3EQL C;  4H0L C;  3R93 A;  1H9M A;  2D62 A;  4HMJ A;  4DFA A;  5M5W B;  4XQJ A;  2C5C A;  1HCZ A;  2RDH A;  1F2Z A;  1STA A;  2Z1C A;  5D14 A;  4A3F B;  1WVL A;  3VR6 A;  5KNB A;  1RF2 D;  5EBC A;  4CHT B;  1CT1 D;  1NAP A;  2BCO A;  2E75 C;  4HED A;  1U4M A;  1RTN A;  1DOK A;  3HOX B;  2A74 C;  2KJX A;  4ILW A;  3SXH A;  1STY A;  1TY2 A;  1EU4 A;  1GUT A;  5D3I B;  1BCP C;  1CM9 A;  3I73 A;  3EVQ A;  4CBV A;  4C3J G;  3OSO A;  2K03 A;  4CKB A;  2XNA C;  4ZRZ A;  1G29 1;  2RSO A;  3MFY A;  1I4R A;  1PYW D;  4TSS A;  3I90 A;  1NR2 A;  3PV0 A;  2A69 C;  5IIF A;  4HSP A;  4K5V A;  2QF7 A;  2NVT B;  2KQ3 A;  2EDG A;  1NUC A;  1HHV A;  4KI0 A;  2MHV A;  2B2W A;  5C0X I;  2HQE A;  1KTK A;  1F9P A;  3T13 A;  3VA7 A;  3Q0A A;  1JIC A;  1TII D;  4FXG C;  2OF1 A;  4OHJ A;  2ZXR A;  1A3T A;  4XYQ A;  3QO2 A;  3HOV B;  1BCP F;  3I91 A;  4XXE A;  1AZP A;  3NUC A;  1D1I A;  4PV1 C;  1TS2 A;  3J7A V;  2H4O A;  4G4K A;  1C48 A;  5A2Q L;  3RMH A;  1CTM A;  5C44 B;  4HSV A;  4WRD A;  2F0I A;  5I9O A;  3DM1 A;  2VB2 X;  2WKD A;  1LTR D;  2QKI C;  3DWQ A;  2BOS A;  4EQN A;  1SJH D;  1VMP A;  1PTO H;  4KV6 A;  5IGC A;  1HA5 A;  1BBX C;  5KIX A;  3U9S A;  4C3H B;  1K8O A;  1HQR D;  3DEP A;  1WTW A;  2L11 A;  2WP8 J;  2B2U C;  2K6A A;  3S9W A;  4V19 0;  1KDA A;  4MN3 A;  2GA4 B;  5C3E B;  1F77 A;  3WDN A;  3HGB A;  2F0F A;  1II3 A;  1EEF D;  1PZI D;  2JA7 B;  1EYC A;  2EJF C;  1I4G A;  2X6G A;  3O13 A;  2IW3 A;  1X3P A;  4RWS C;  3FDT A;  5FLX E;  4A3I B;  5KNC A;  3E6Z X;  4NMZ A;  1V8Q A;  3ERO A;  2RDF A;  4K8J A;  1BCP B;  1I3Q B;  4MHE A;  3CKI B;  4TQU S;  3W2D A;  1L0X B;  1CHQ D;  4S3S A;  2F0K A;  3I3C A;  1YNN D;  5KRU A;  3SK8 A;  2HCI A;  3OW7 A;  5I6W A;  4ABN A;  5I2X A;  3WOF A;  1JWS D;  2J0T D;  3PO2 B;  4HAE A;  4ZUJ A;  4A3G B;  3KBG A;  1PTO D;  3MWY W;  3S15 B;  4DXG A;  1PXU A;  1LAC A;  2K32 A;  3TP8 A;  1DYQ A;  1TWG B;  5C0X H;  1FNW A;  4QB4 A;  2WIN B;  2PZW A;  2EXZ A;  4DK0 A;  4IFD G;  4RGN A;  2BE5 D;  2XIW A;  1WTO A;  4J8Q A;  1Z47 A;  2D5D A;  2BDO A;  2AWO A;  1MGS A;  3S1R B;  5FKA C;  4EVO A;  1SNQ A;  4C1N K;  3IAY A;  5JAV A;  3MXN A;  3C3L A;  3K59 A;  3MVV A;  3R2I A;  1S5E D;  1V43 A;  2PPB C;  3BDL A;  4FXD A;  3H94 A;  1GOZ A;  2WII B;  2ICE C;  4Q0F A;  2J4X A;  3T16 A;  2PW7 A;  4ZKC B;  3NWT A;  3T4A C;  1I4X A;  4XQN A;  3N52 A;  2HDL A;  1VF7 A;  2E2D C;  1D5M C;  3HOW B;  2IX0 A;  4M8A A;  1ESF A;  1O7Z A;  4ZAI A;  2NN6 H;  1Q90 A;  4FF4 A;  3SK5 A;  1MBY A;  1SNO A;  5JPM C;  1GHJ A;  4ZLT F;  4TRD A;  1ET9 A;  3MXU A;  5IGF A;  1TR5 A;  4HR7 B;  4Z9C B;  3K0Y A;  2JA5 B;  1RD9 D;  4N9P A;  1XXG A;  2JEB I;  5EPJ A;  2L9H A;  2NN6 G;  1O78 A;  5FO7 B;  5IGG A;  3RZD B;  3J7Y W;  5K36 H;  2EPB A;  1EYA A;  1SBB B;  3BVG A;  2AUJ D;  1XYI A;  1E0B A;  1D5X C;  3HRZ C;  1SNC A;  2BA1 A;  5M5Y B;  2L5T A;  3A8I E;  1B1Z A;  2L0C A;  2BE5 C;  4BY1 B;  3I4M B;  1BO0 A;  1CA5 A;  3TME A;  3NWS A;  1DON A;  3G6J B;  4UDU C;  4Y7N B;  1JB3 A;  1OXX K;  5TSS A;  4DN4 M;  2F3W A;  2Y0S B;  3GTQ B;  3UI2 A;  5FOB B;  1CZG A;  1JR0 D;  4G7Z C;  4UAI A;  4A3D B;  4RKB A;  2CHB D;  4FF1 A;  1AW7 A;  1TVX A;  4EQO A;  1RHP A;  2FMC A;  2C9O A;  2IWH A;  1EL0 A;  4N9T A;  1F9Q A;  3FPP A;  5JVG 3;  1KLU D;  1W6J A;  4OO1 I;  4X3T A;  1LLR D;  4KK7 A;  3NXW A;  5CV4 A;  2KVM A;  4RCO A;  3J7A F;  4DAY A;  1SYD A;  3D4D A;  3A54 A;  1DOM A;  1IYV A;  1IKL A;  3QOL A;  1O7Y A;  4J6H A;  3FKI B;  1C4Q A;  1H9K A;  1TWH B;  1LTT D;  3OIP A;  1VCI A;  3MXP A;  2JP1 A;  3A7L A;  1FR3 A;  2N88 A;  3C1E A;  3I72 A;  2EYO A;  2SNM A;  2LFN A;  5KEE A;  1BR9 A;  2KEC A;  1QWY A;  1PRT C;  5CBA E;  3L7Z C;  1SNM A;  4ZQ3 A;  1SE2 A;  3QIA A;  4A3E B;  2LS0 1;  3L3O C;  1SMY D;  1ILP A;  2N55 A;  1D2B A;  3FVQ A;  4FXK C;  1AN8 A;  2ENB A;  3KK7 A;  4BY7 B;  3EA6 A;  1TU2 B;  2A68 C;  3MC0 B;  4KKS A;  3PUV A;  4CJ0 B;  3HOU B;  4KHV A;  4F7X A;  1JCK B;  5J22 A;  1PRT F;  5FO8 B;  1JWM D;  1K8M A;  3M7G A;  3U9O A;  4XT3 B;  2IX3 A;  2JE6 I;  4BBR B;  1YNJ C;  4IUT A;  3Q22 A;  1BDO A;  3T53 B;  4EQP A;  1RCV D;  3MXG A;  4PNY A;  1CQF A;  1GUW A;  2PQE A;  3OWF A;  2V4D A;  4FF2 A;  3C1F A;  4ULL A;  4KKT A;  1DXM A;  3D6C A;  2ZXO A;  4ME5 A;  1PFM A;  5M3M B;  3QOJ A;  2SOB A;  4P2C B;  3D6W A;  2I07 B;  1SYF A;  5I2Y A;  2KHS A;  2HDM A;  1BNZ A;  5ELC A;  1DJR D;  1SXT A;  1WTX A;  2VNU D;  2RQX A;  3NHH A;  4OL7 A;  5IT9 L;  2PYK A;  3VR2 A;  5JEA G;  4OO1 H;  1ILQ A;  5I6Y A;  2MPM A;  3NPP A;  2G9H D;  1Y8N B;  1KAA A;  2B2W C;  4IUV A;  3TSS A;  2K05 A;  2EY1 A;  2KCN A;  4PMC A;  3Q6S A;  5DEH A;  4CGY B;  2F3V A;  1MD2 D;  1PRT B;  2M2L A;  3D4W A;  4PQX A;  1SMY C;  4IQZ A;  1B3A A;  3GTG B;  2F0E A;  3MA2 B;  4IN3 A;  1VDZ A;  1PMR A;  4DAP A;  5IGE A;  1SAP A;  3DWA A;  1IL8 A;  3AMU A;  2EZV A;  1EY5 A;  3HZX A;  1SYC A;  3I4N B;  1V1P B;  1EZ8 A;  2L4N A;  1PFN A;  2AQ3 B;  4U67 3;  1I4H A;  2XRQ D;  3V2T A;  1H9R A;  2LKV A;  1CA6 A;  2L1B A;  1EWC A;  3GTJ B;  4IFD I;  3SVM A;  1M8A A;  3CRK C;  3E0J A;  1IHZ A;  1WD0 A;  4MIU A;  3TN2 A;  3SR1 A;  4DXF A;  4KN7 C;  2B2V C;  2FHT A;  1G91 A;  1V1O A;  1PLF A;  4HMI A;  5AFW A;  3J80 E;  1S5B D;  1SYB A;  2K5Q A;  3GP7 A;  4TKO B;  4RFB A;  5CV7 A;  2VUM B;  1HUN A;  2A6E D;  1R4P B;  3VA5 A;  2EYJ A;  2NYZ D;  3OOC A;  4L63 B;  3KBX A;  3J81 L;  2AQ1 B;  1LAB A;  5C3X A;  1Y1W B;  3N6R A;  4QF4 A;  2PZT A;  1ZKO A;  2QCP X;  1H9S A;  3AB9 A;  5E3F A;  2CVR A;  3QG1 A;  4Q5V A;  1W6K A;  1AP0 A;  3G7L A;  1EU3 A;  1B4O A;  1HTP A;  2F0U A;  3T51 B;  2O2L D;  2B2V A;  4DGZ A;  3I4L A;  2PCF B;  5ELD A;  5LL6 S;  4RGT A;  4M1U B;  4H44 C;  2B8F A;  5FO9 B;  1EYD A;  1S5F D;  2RA4 A;  1ENF A;  1WTP A;  4RAU C;  3NBI A;  3GTM B;  2NTS A;  4K2K A;  4OGQ C;  4CJ2 C;  1HFN A;  2K04 A;  2CQA A;  1VMC A;  3MTS A;  2PW5 A;  1O7L A;  3CRL C;  5EKK A;  5DAU A;  5ELF A;  4ODG A;  2L12 A;  1GUG A;  3DHQ A;  1SSO A;  3IFT A;  2KED A;  1C8C A;  1EIH A;  5ELE A;  1FNU A;  4ZKB B;  4WOR A;  3QJY A;  3PUZ A;  1PZK D;  3OPO A;  3M85 A;  3PUW A;  2KCC A;  1RTO A;  1BXT A;  1KDB A;  3V96 A;  1LT3 D;  5M5X B;  1S5D D;  1RDP D;  2E74 C;  2EYH A;  2JA8 B;  5C5L A;  5J39 A;  1G6Z A;  1UAP A;  3ND9 A;  4K2L A;  5FLX L;  4OIK A;  4CJ1 B;  5C0X G;  4A3M B;  1LT6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...