4KD3A

Crystal structure of staphylococcal nuclease variant delta+phs l25a/v66a/i92a at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4kd3A00
3D4WA 4QB4A 1SNQA 5C5MA 3ITPA 4EVOA 4K5XA 1SYFA 2PYKA 4EQOA 2EYOA 4NDXA 5C5LA 4ODGA 4ZUJA 2EYLA 2SNSA 5DEHA 5IOCA 2PW7A 4G57A 3LX0A 1STHA 5IIFA 1STBA 4R8NA 5C4ZA 3P1HA 2F0OA 3OMCA 3SR1A 2O4XA 5HURA 1A3TA 2SNMA 3TP6A 3SXHA 4ZUIA 5J22A 3SK6A 2EYPA 3HZXA 5CR3A 3MZ5A 1SNMA 4IALA 1JOKA 2PZTA 5E1FA 4KJOA 5IGEA 2F0SA 4E6IA 4EQPA 3TP5A 1F2ZA 2PZUA 3RUZA 3VA5A 1JORA 1SNCA 5IGBA 3SHLA 2EYFA 4IUNA 5EGTA 5JOBA 5CV6A 1NUCA 3DHQA 3NK9A 4ME5A 4KY7A 5NUCA 4N9PA 1U9RA 3QOJA 1EY0A 5E3FA 4KY6A 3QOLA 1ENAA 3TP8A 1STYA 4WORA 5IGGA 5C3WA 5K5PA 2QDBA 4K2LA 4LAAA 4K6DA 1EYCA 2F0IA 1EYAA 4KJNA 2HQEA 1EZ8A 1A2TA 3OMGA 1TR5A 3BDCA 3PMFA 5ISRA 4HTHA 3DMUA 1EY8A 1AEXA 2EY6A 2EXZA 4B9WA 5C3XA 1KAAA 2M00A 1F2YA 3MEHA 4EQNA 1SNDA 5I9PA 5M9OA 1SYBA 3SK5A 4KY5A 1STGA 4F8MA 3MVVA 4DF7A 1A3VA 4NKLA 1EYDA 1A2UA 3MHBA 2PQEA 3EJIA 1SNPA 2ENBA 3S9WA 5IGDA 1STAA 2F0JA 3EVQA 5IODA 4KD3A 1JOOA 1EY9A 2SOBA 4PMCA 4KD4A 5KEEA 1TQOA 1SYCA 3MXPA 4ZQ3A 2RBMA 2F0FA 5J1ZA 4HMIA 1KDCA 2RDFA 1A3UA 2EYJA 2F3VA 4HMJA 4K14A 4YIJA 2F0UA 2F0GA 5EKLA 4QMGA 2EYHA 4J6HA 1EQVA 2EY1A 2F0HA 5CV5A 5IGCA 1SYEA 1TT2A 1KABA 3V2TA 3ERQA 2EY5A 4K8JA 1EY4A 4I65A 4PNYA 5EKKA 1EY7A 1RKNA 4K5VA 5KYLA 3D8GA 2EYMA 3SK4A 2F0QA 4TRDA 3SK8A 2F0DA 5IGFA 5KYIA 3NXWA 3U9OA 5I6WA 1IHZA 1NSNS 3QB3A 2NUCA 5KGUA 4NP5A 1SYGA 2F0NA 2F0VA 4KHVA 3C1EA 2RKSA 2WACA 3T16A 2F0PA 3H6MA 2OEOA 5C6AA 3NHHA 4DGZA 4DFAA 4RKBA 4MIUA 1JOQA 3EROA 4ID6A 3D4DA 4J1MA 3C1FA 1KDAA 4KTAA 5CV8A 4F7XA 1ENCA 2F0LA 3R3OA 4K8IA 4RKLA 3TMEA 5I6YA 5KRUA 2EY2A 3E5SA 2KQ3A 3T13A 4DU9A 4B9XA 5I9OA 1EY5A 3NQTA 3BDLA 3NUCA 2F0KA 4WRDA 2KHSA 3P75A 4PMBA 4QF4A 2LKVA 2OF1A 2OXPA 3TP7A 5C4HA 5CC4A 1EZ6A 2PW5A 5JAVA 4NMZA 5CV9A 5CV7A 3OSOA 4KV6A 3OWFA 2F3WA 2PZWA 1SNOA 1EY6A 1STNA 1KDBA 2F0MA 2F0WA 3D6CA 4S3SA 1F2MA 5F2DA 1II3A 5KIXA 5HGTA 4K5WA 5CGKA 1SYDA 4H7BA 5J39A 3HEJA 5CV4A 3NP8A 4N9TA 4OL7A 5DAUA 4K2KA 4IZ8A 2F0TA 2F0EA
chains in the Genus database with same CATH superfamily
1D2BA 1XX8A 4EVOA 4DV7L 1E22A 1PDQA 4K5XA 4R4OA 5IP7H 1ZKOA 3HOWB 4ODGA 1J6QA 1PYSB 5C4XH 4A3FG 1PRTC 4DV6L 4FYDA 2KOLA 3VR3A 3FPPA 2KECA 2JA6G 1QOHA 3TS0A 1KTKA 3DWAA 4MNOA 3ULLA 1QVFA 4LWCA 4OONA 1UE5A 1SN8A 3ERSX 4HJAA 1HZBA 1QE6A 2JN4A 3SHLA 4OX9Q 1A6XA 1KNAA 1U9RA 5C3EH 1Q3LA 2K52A 4KY6A 1LTGD 1JWSD 1Z7TA 1BCPB 2K5VA 5ISRA 4JOIC 2TSSA 1EIHA 1HQMC 5C3XA 2VY3A 1QB5D 4C3HB 1RIPA 1SJED 3B6YA 3OPOA 3NTIA 1PTOH 3NSWA 4DUYQ 4K6LA 1NMFA 4OO1I 1DONA 5EBDA 1TQOA 2F0FA 1PH3A 2WP8J 3AFPA 1VQFA 4DR1L 1SEBD 2XSCA 1EIFA 4YWMA 4IPHA 4P73A 1V1PB 1VS0A 1WFQA 4LF5Q 2VUMB 2VZAA 4A3MH 4KN7C 2K5WA 1N32Q 2M2LA 3X3MA 2F0PA 1M90C 3M4OH 1XTCD 5EJWA 5FO8B 2X6GA 2D0PA 4DPGA 3PO2B 3PSIA 2WINB 3FKIH 4PQXA 2K33A 1X32A 1XTDA 1AH9A 3GTKB 2EY2A 1S5ED 5T1GA 5M5WB 1V8QA 3RZOB 5M5XB 2OF1A 2QDLA 4LUOA 1HQRD 3S14B 4BBRH 2RF4A 3PO3H 1KC8C 5F2DA 5G3LF 5HGTA 1SYDA 4B3RL 1OXXK 2NVYH 5EKIA 3WDNA 2TMPA 1HA5A 2MNAA 1PRTF 1WTRA 1VQCA 1SYFA 4LF8Q 4O2DA 2YU9H 4K0KQ 5C5LA 1AW7A 4A3GG 3HKZE 5IIFA 5GAEC 5KNBA 1UE7A 3TP6A 3VR5A 5GROA 1Y1WG 1Q86C 5EBCA 4LNQA 2JA5B 4FDBA 5GAHC 1Y1VH 1TWGB 4DV2L 2A1AA 1SNCA 1H9MA 4ME5A 1JT8A 3RZDB 1PTOC 4BA1I 4ZCKA 4C1NI 3KYHC 1YHBA 4KLKA 1HR0W 3Q6SA 3HOYG 1JJGA 1JR0D 1SE8A 2NWGA 4CBVA 1UAPA 1EZ8A 1ASYA 5C44H 2KCMA 2EXZA 1YNNC 4IOCA 3K7UC 2M00A 5FLXL 1S5FD 1VF7A 4POFA 1QWYA 2IW3A 1Q8KA 2R7FA 3R8BA 3V96A 3BS1A 1F9RA 2JA8H 2Z9HA 2AQ1B 1U5KA 3TSSA 3CP0A 3FEWX 1X9NA 1VQDA 4A3FH 3S1NH 1RKNA 1Q1BA 2EDGA 4MHEA 3I2ZA 1F9PA 2RQXA 2A73B 4JI0L 1U4LA 4BY7B 3C46A 2DY8A 2F4VL 4EX5A 1TXYA 4IUUA 3VYUA 1WTPA 2L1BA 1SFOH 4LF9L 5ELCA 3J80i 2VB2X 4RCNA 3M85A 1YIJA 2N49A 5JPNC 3TP7A 3DEPA 2PW5A 1KD1C 4JI6L 4JG2A 3GTPB 1GHJA 4LF7L 1D1KA 1G2SA 1F2MA 4IPDA 4M1UB 2N78A 3H3VC 3VR6A 3PUXA 3NP8A 2K32A 4IPGA 3FVQA 3EIVA 4A3JG 4PMWA 4C3JG 3AU7A 3T4AC 1C8CA 1S3OA 1STHA 2IT1A 1QG7A 2EJFC 2FMMA 4OO1G 1SMYD 4U673 1S4ZA 2A19A 1JB3A 4B3SQ 2LSSA 2K03A 2EXDA 3E0JA 4IALA 1ESRA 2L4NA 5GAGC 4QCLA 2F0SA 1GUOA 3E0EA 4FF4A 1K9MC 4DKAC 3NELA 1CHPD 5ELFA 1GO3E 3BVZA 4IFDI 5FLXE 4U68A 2HQEA 2NYZD 2L11A 4X65Q 1Q90A 5J3BA 2B63G 5IYDH 2E2JH 1RTNA 1HNWL 1SSOA 3DM1A 1R4PB 3G6JB 5BN4A 3M4PA 4QGUA 1A2UA 2R93B 2ID0A 4AYBG 2NZOA 4GLXA 1D6EC 2F0JA 1HNXL 1MBYA 1B4OA 4ZQ3A 4IN3A 4LUZA 1CUKA 2Q8IB 2IX0A 1ZEQX 2YTVA 2O5IC 1WI5A 1PTOD 4A3GH 3ERQA 4PZ6A 2UUBQ 4IUVA 1CFMA 1BCPF 2MHVA 5E4WC 5KYIA 3FHWA 2QA4A 4JI2Q 1Y1WH 3A0JA 1NTGA 3CCSA 1EWIA 2CHBD 3NEMA 2F0NA 2HCCA 3CD6A 2B2UC 2JE6I 1YNND 4JYAL 3F8TA 1TY0A 1Q12A 1VQOA 5BR8L 1TWAB 4IOAA 2FMCA 3C1FA 1ICWA 1Z47A 2PMZB 2B2YA 2MPMA 2PI2A 3AQQA 4A76A 1I4HA 1LT6D 1A0IA 2JA9A 3MFGA 3RR5A 3S15H 4CDFC 3D6CA 1JMCA 3HOXG 1PVOA 4EQOA 1LTRD 2RDHA 4DR5L 1TKWB 4L5RC 4KHPL 1DZ1A 2A5HA 4JW0A 3T53B 1LACA 5A35A 1EQRA 5C4ZA 1VQMA 1UNSA 2F0OA 2O4XA 1HR0L 1TS5A 4QL5A 3A56A 3I91A 1CA5A 3OYYA 1JOKA 2RHQB 3FRPB 4R1JA 1UE1A 1N34L 1BQQT 1CTMA 2MO1A 3UDIA 2MO0A 3X3NA 1K8AC 1HFGA 4H44C 1AE2A 2GN5A 4PZ8A 4XT3B 2D62A 2JP1A 4XDXA 4A75A 4V0BA 2XN9C 4DV1L 4X64L 1PFMA 1AEXA 4B9WA 3LGJA 3S2DH 1XWEA 1NNXA 5L37A 1SBBB 1MJEA 5IODA 4G7OC 2N8NA 4RHRA 3E9IA 5IT9L 2UU9L 5J1ZA 1KDCA 4JOIA 2WAQB 1SE2A 4K14A 3PUYA 2Y0SB 4C3JH 1H9SA 5IGCA 4XTCS 3CCVA 5EKKA 1EY7A 4BBSG 1JORA 2CWPA 1ZYRC 4OO1H 2CKZB 1LO5D 4X6AH 3T1YL 5LL6X 1FD7D 2BOSA 1GUWA 1PZKD 1TWFB 2B2VC 4LFCL 4DV6Q 1WOCA 2E2HH 2R7ZG 4GLVB 3LNNA 1I94L 2H1EA 3H09A 3M4QA 4HIOA 1WCMG 1K83B 2C5CA 2DJGC 2B39A 3A8IE 5LL6S 2NVQB 3J7A5 2B2WC 5C4XG 5DM63 3L9AX 2IJ0A 2B2TC 5D3IB 4RMFA 3KDFA 2F0KA 2B63H 4L5QA 2F3WA 2HDLA 4S3SA 1SNOA 1XNQQ 4IFDG 1ESFA 5IWAL 1PRTB 1V43A 1VQKA 1VQJA 2NVXB 3BU2A 4X3KA 4ABNA 2I07B 1A15A 2AWNA 3BZCA 1IBMQ 4A3EB 5C3EG 1SNQA 1NCVA 4KKSA 5IYBG 1EU3A 2NTSA 3K5NA 3CPWA 2KCCA 4A3BB 1UEAB 1XMQL 3R93A 1AZQA 5E7NA 4GS3A 3KFUA 4A3IG 1FJGL 3GTJH 3CQZH 1D8LA 4GN5A 4JI8L 4R8NA 4CJ2C 2BDNA 4M8AA 2WFWA 4OIJA 2QILA 1NY4A 2K4KA 4A93B 2NZ1D 3PIP3 2EYPA 1E1OA 2CH4W 3P20A 1UWVA 2PZTA 1KLGD 1DXMA 3VYSA 2BA1A 4A3KH 1U4MA 3VYRA 3M7NA 1NUCA 3KLSX 1PYWD 4IUTA 2UXDL 1H9SB 2E75C 2DGYA 2G9HD 5IYCH 1MSGA 2JQOA 4FP5D 2R92G 2AUKA 4HJ5A 3OMGA 2NZHA 3GQBA 1CQFA 2QKIC 4HTHA 3DMUA 1VQNA 3SDZA 5ELBA 4B3TL 4NPSA 4C2MB 5M9OA 1B9MA 4A3MG 1GKHA 4GKJL 3GV6A 5IT9E 2K50A 4JV5L 4ALPA 4TSSA 4X66L 3I56A 1WTVA 1IL8A 2RHSB 4KHZA 3KDFB 3FKIG 4HR7B 3HS0C 1A62A 2JA7B 1D1IA 1TWCB 4R9WA 4KKTA 1FR3A 1SYEA 3MXNA 3K59A 4B3RQ 3W2DA 4OWXB 2LS01 4TRDA 3SK8A 4BBRG 3PO3G 1VQ8A 4Z9CB 4I7AA 2FXQA 2XRQD 5M5YH 1PFBA 4KHVA 4Y7NB 3C1EA 4YCUA 5ELNA 2HHHL 3S2HB 3H6MA 3I8ZA 1MHWC 1I6HH 1GJXA 5FLXc 3HOZB 4WJ3M 2F0LA 4CDEC 3MAQA 1VQ6A 1EUJA 1SE3A 4DV2Q 4JI5Q 3HOUH 2O5JC 4QF4A 3UDXA 3K0XA 1PH8A 4HCSA 5JAVA 5CV9A 1Y1VG 2Q8RE 4QJFA 4DAVA 4DV4L 1MGSA 1I4PA 2RA4A 1ZYRD 3H15A 5AJ3L 4AQYL 2UUAL 1FVIA 3NBIA 3S1RH 1X56A 1F9QA 5LMNW 4IJLA 5I2YA 2HD3A 3HFZB 3F2BA 1R9TH 3P1HA 2Q2IA 4OWTB 3W3AA 3MWYW 3OOCA 5C0XJ 4BBSH 2BH8A 2VNUD 2JJQA 1ET9A 4FF1A 1EFWA 2VUMG 1K8OA 2ICEC 3IKJA 2E2IH 3RN5A 3D6WA 3MXNB 2LY7A 3NE5B 3RD4A 1K3BC 1DYQA 2R61A 3OIPA 4O0AA 3S17B 1WCMH 1VMCA 3DM3A 4LAAA 1EYAA 1HH2P 3PO2G 2VW9A 4JI0Q 4HEDA 4MN3A 3A5UA 2IPKD 1PH9A 2AHOB 2MJ8A 1SMXA 2J4XA 2AQ2B 3HP3A 2BA0A 3J7ZC 4CKBA 2F4VQ 2FHTA 2VXWA 3W5OA 3EJIA 1HNZL 2JXMB 1X54A 3I90A 4C3IB 2ZJPA 4DV3L 4LF9Q 4IFDH 3DLLA 1I6VC 3EVQA 1BBXC 2SOBA 2Q2HA 1TIID 4PMCA 4DV0L 3RN2A 5IYBH 4GOPC 4JI6Q 1XPUA 4BA2I 2EYHA 2EY1A 5CV5A 5JEAJ 1D5XC 2Z6KC 4A3IH 1NAPA 3C2PA 2Z8LA 2PNRC 1U4PA 2RSNA 4X62L 2NVYB 1J8IA 1PH1A 1U4RA 3VR4A 5I6WA 1HTPA 2JA5G 3Q24A 3A54A 2WACA 3DWQA 2YU9B 4CHTB 2K5DA 3BZKA 1NMGA 5FOBB 1JOQA 3EROA 5C4JH 1I4QA 3L3OC 3DEOA 1MIUA 2R92H 4CJ1B 3BDLA 1IBKL 2KHSA 2K05A 2EJGC 4PMBA 4BS9A 1CI3M 3K58A 2B2UA 2K5HA 3I4MH 5M3FB 5CV7A 3K5MA 1LLRD 2PI2E 4NXNL 2ZXPA 2WAQE 4HSPA 2Y0SE 1CKMA 3NPPA 3Q22A 2QW7A 2B8FA 4YY3L 2DNEA 3Q0AA 4LF6L 1X3FA 1IYVA 1DD2A 1HNWQ 1SMYC 3AEVA 4IUQA 2XTIA 3F2DA 2X69A 2RCFA 1G2TA 4DR6Q 3KLRA 1STBA 2DNCA 4QUCA 5IYDG 2VQFL 1TS4A 3OMCA 4A3CH 3HOWH 1A3TA 2OTLA 4ZUIA 1DCZA 3F2UA 3HZXA 1J9OA 1JC7A 2X6LA 1E3PA 2R3ZA 1GUGA 1UE6A 1CM9A 2EYFA 2VL6A 3DHQA 4N8X1 2CCZA 1FNWA 2H4OA 1N8RC 3QOJA 1SE4A 2NBFA 4A3FB 1SAPA 1STYA 4UHVA 3ZJYC 3N52A 1S5BD 2MQHA 4GNXC 3MC0B 1W6JA 3NBHA 2JA6B 1Y69U 3QIAA 3WWVA 4KMUC 1EY8A 3GTQH 1O7YA 4JYAQ 2L55A 1EL0A 2OQ0A 5BN5A 3ND9A 5BR8Q 5HY6A 4F8MA 1N33L 4YHHL 3BYYB 2ENBA 4XYQA 4C3HH 1WTXA 1VQ7A 1N9WA 4KD3A 2F1MA 1JOOA 3K80C 4KD4A 4XT1B 3KBGA 1GVPA 2A69C 4HMJA 4QMGA 1F2LA 3IFDA 3GD7A 1CKNA 4PNYA 2R7ZH 4DV5L 1X55A 1SRUA 2XGTA 4DR5Q 1B9NA 1IHZA 4KHPQ 1QILA 3L0OA 4DR4L 1NR2A 4P74A 4ILWA 2VUMH 1K73C 5C6AA 1HR0Q 3VYTA 3DXJC 1XPRA 4AIMA 1WYDA 4FXKC 2CVRA 1I50H 4JI1L 5CV8A 4JI7L 5JJZA 3AB9A 3U4VA 1IYUA 5G3LD 3CCEA 4RHSA 1N34Q 3PO2H 1IZ6A 1H95A 2B2VA 4P2CB 3GTKH 3GTMB 1LT5D 5LMNL 3NTKA 1JWUD 5IT9c 3OSOA 3RZOH 1FNVA 2KENA 3S14H 3JAML 3OW7A 2L0CA 2MUYA 4UDUC 4DV1Q 1C9OA 2EVBA 2B2WA 1W2BA 4B08A 4X64Q 3NBHB 5C5MA 1BDOA 2B2TA 1LTTD 2PYKA 4GKKL 4DAYA 3FDTA 2E2JB 4LFAL 1PH6A 1UEBA 2EYLA 1XNRL 1Q1EA 3TDQA 4NXML 3P7JA 5IY0A 3HOVB 5J22A 1E2ZA 4QIWE 5CR3A 5EPKA 2UU9Q 4L5TA 2ZXRA 1V1OA 4KJOA 2AKWB 3GDEA 2WB1G 3ND8A 2JA5H 1BKBA 3A8JE 1L2FA 1SJHD 3E9HA 3D3RA 1WTWA 1TWGH 1KAWA 4ZKBB 2SDFA 4JBKA 1VQGA 1CKNB 3TP8A 5IGGA 3T1YQ 1VMPA 3RZDH 2QDBA 4BXXG 1Y1WB 3UDGA 1OO9B 3D4RA 4LFCQ 4CDCC 1TR5A 3PMFA 3GTOB 5K36H 1BNZA 1I94Q 2A68D 3MEHA 1R4QB 4UPAA 1GOZA 1SROA 4XQQA 1PTOF 3MHBA 2PQEA 1SXTA 4ULLA 3CKIB 3CU7A 2BH2A 1STAA 3HOYB 4IQZA 2LXKA 1ENFA 1QVGA 1S72A 2XWBB 2L9HA 4J8QA 1K3RA 2I46A 4H02A 3PF5A 1I4XA 5IWAQ 4BWGB 4APVA 4QQBX 3S15B 1EY4A 1W6KA 4FO2A 4I7ZC 3TEHB 1VDZA 1JB7A 2DUDA 3OTOL 1XMQQ 2NUCA 3OWEB 1FJGQ 4DAYB 2D0OA 1E2WA 2WKDA 5IE8A 1D5ZC 3D0FA 4ID6A 4J1MA 2ZXOA 4UP8A 1Y8OB 5I6YA 2KVMA 4BY7H 2BCOA 2IWHA 3TMEA 1QZHA 3E5SA 1IXRA 5GQOA 3CMAA 5I9OA 1EY5A 1EEFD 2B8GA 3NUCA 4OHJA 2HT1A 5CC4A 2A69D 4XXEA 3JAME 2MGSA 5JVH3 3CCLA 4KV6A 2N55A 3T51B 2YV5A 4A3KG 3S16B 2ZT9C 3URYA 1J5EQ 2OWOA 5J39A 5LHY1 4HIKA 3HEJA 5CV4A 3GTPH 5IYCG 4IZ8A 2CW0D 4B3TQ 4DXGA 1XYIA 1HZAA 3BG3A 4GN3B 2FJ2A 2NVTB 1PH2A 4GKJQ 3GP7A 3S2DB 4JI3L 3K6OA 4JV5Q 1K28A 2WV6D 3GTGB 1D7QA 4R4QA 5GADC 4DR3L 1A8VA 4CDDC 5IGEA 2ATWA 1NBWA 5IGBA 3I70A 4A3JB 4C3JB 3NQIA 1GUNA 2E5LL 3J80L 2M9VA 3BYTB 4H13C 3H94A 1K8GA 1H9KA 1BOSA 1P16A 1OXSC 4WFN3 1B3QA 1EYCA 1SLJA 2N88A 4R8IA 1MJCA 2KA7A 2JEAI 1PZJD 2HHHQ 4LFBL 3BDCA 1L1OC 4LF4L 1X6OA 2CQOA 5I9PA 4KY5A 2CFMA 1LTLA 3CAMA 1GXDC 2LXJA 2CWAA 4YCWA 3HKZG 4AH6A 4G7HC 4QY7A 3K7AB 2KEEA 2OT2A 5AFWA 2NN6I 4DAMA 2R93H 1I4GA 4HMIA 4QUFA 2RDFA 4L8JA 4A3EG 1BCPD 1WD1A 1VQHA 3VA7A 3ER0A 4A3BG 4DV4Q 4CKCA 3HOUG 3LWEA 4I65A 3F2CA 4A3DG 5AJ3Q 3UE1A 4AQYQ 2ZJRA 2UUAQ 1DM0B 3QB3A 2EOTA 2IX1A 1B50A 3H0GG 1DJRD 4ZRZA 1BXTA 1RJTA 2K6AA 3T16A 4GOPA 3H3VI 3GTJB 1EOTA 4DR7L 2Z6KA 1PYBA 3RNUA 3STBD 3PF4A 4KTAA 1AFPA 1I3QB 3CXCA 4BXXH 1TWAH 4B9XA 5FKAC 3R2TA 1KNEA 1S5CD 1EZ6A 5FK9C 4DV7Q 4RGMA 2NTTA 1EY6A 1QCBD 4UP9A 5KIXA 2QEXA 3ONAB 1L0YB 1K0SA 3M3YB 2R7DA 4OL7A 1GM5A 3C3LA 4WJ4A 1CSPA 1YVCA 4OWWB 1AN8A 3TZDA 5IOCA 2SNSA 1D5MC 2MFIA 1G6PA 3LX0A 4IJHA 1HNZQ 4DV3Q 5HURA 2CH4A 1K0RA 3I3CA 3TRZA 4DNTB 4HIDA 3M9BA 4LMQD 3HOXB 3NENA 4DV0Q 2KUMA 2K1BA 3J80E 2A74C 4A3LG 2UUCL 1EWCA 2QCPX 3GTLB 3Q23A 5M3MB 1C0AA 5JOBA 5CV6A 4B3SL 3LWUA 4JCVE 4X62Q 1EEID 3VDYA 3AYHB 2E8GA 4WORA 2YTYA 2XNAC 4DUZL 3HOZG 1LABA 2JK8A 3I73A 1TWHB 1VQPA 3DUZA 2VB3X 4HSVA 4UAIA 4GOPB 1A3VA 3S1QB 1I6HB 2KBNA 5IGDA 4DR1Q 5JJKA 4NW2A 3OIQA 1QUQA 3BZDB 4GNXA 1IBKQ 3KJPA 3T56B 4BY1B 1VF5C 3I72A 4RAUC 4YCVA 1EQVA 3K8AA 1LTBD 4K8JA 5D14A 1YEZA 2K75A 1X3EA 1PH7A 4JBMA 4YY3Q 4LF6Q 3I4MG 1QVCA 3EQLC 3I4NG 1BO0A 2RKSA 3NWTA 3UDFA 5BN3A 4LJZC 2VQFQ 4CGYB 4N8FA 3CCQA 3BDOA 1N36L 1NE3A 1TWFH 4XIGS 2K04A 4G7ZC 4DK1A 1ENCA 2B3GA 2MP1A 5KRUA 4A3CG 3HOWG 3E3XA 1K83H 2NVQH 2O2LD 2C35B 4R4CA 2YYZA 1PA6A 4XQJA 4JI4L 1B3AA 3M7GA 4NMZA 1YJWA 3W1BA 2R7ZB 2PZWA 2F0WA 1DOKA 4MTNA 4TVAB 5CGKA 4WJWA 4XQNA 1WCMB 1XMOL 1KIXA 4GN4B 4RGNA 1FNUA 3PGZA 4QIWB 3S1MH 5C4XB 5CBAE 1YHAA 1RTOA 1N33Q 1PHJA 4A3EH 3L7ZC 4YHHQ 2PW7A 5FO7B 1AZPA 4JBJA 1OXUA 2IHEA 3CMEA 4A3BH 3MFYA 3U4ZA 1HXYD 1JJCB 4HN7A 4RWSC 5T1IA 4TKOB 4TQUS 5JJLA 2B29A 4A3DH 1QUQB 1SNMA 4GNXB 3TQYA 5C3EB 3RUZA 4A93H 4C3HG 1XJVA 3H0GH 4IUNA 5EGTA 5JJIA 4FNFA 3QR8A 4N9PA 4MZ9A 4A3IB 3MTSA 5CMDA 4DA2A 4RG1A 1JJ2A 2J7ZA 2IY5B 4K6DA 3ULPA 4KJNA 3U50C 4DR4Q 1PZID 3K81C 1PTOB 3JAMc 3J81L 1F2YA 2WKCA 3G48A 2I0QA 2PQAA 3E6ZX 3KBXA 4JI1Q 4JI7Q 3K5OA 2RCNA 5M3FG 1HRJA 4C2MH 4YWLA 4MTKA 2QGQA 1SYCA 3MXPA 4R4TA 1HHVA 2KCTA 2R92B 4IO9A 5LMNQ 1Z6HA 1S5DD 5FLMG 3I55A 4H0LC 2K14A 4PG3A 2NB0A 4J6HA 1BUVT 1C48A 2EY5A 4A3MB 2JA7H 4JVZA 5LMUL 1IBLL 1F9SA 1EOVA 2H5XA 1YNJD 4RGOS 4L5SA 4GKKQ 1JCKB 4LFAQ 1YHQA 3M4OB 4NP5A 5I2XA 2AWOA 1WTQA 1Q82C 4A3LH 5A2QL 4NXMQ 2Z1CA 3FKIB 3QJYA 1PH4A 2OEOA 3KLSA 4Y7NH 4MIUA 2J0TD 3S2HH 4GLAC 4F7XA 3G71A 1A63A 4RKLA 4LF7Q 4BBRB 1VQ4A 4DU9A 2IL8A 3SVMA 3HOZH 3PO3B 1EU4A 2ZM6L 3P75A 2LKVA 4DK6C 2I5HA 3KJOA 5CYUA 4C56C 3OWFA 2F0MA 5EPLA 4R4IA 2KEDA 3I7FA 4N9TA 5ELEA 2DY7A 3D4WA 3ITPA 3BVMA 1PMRA 4FF3A 1XNQL 2EYOA 4ZK9B 3GTQB 3IRBA 1L0WA 3CC7A 4AYBE 3A5ZB 1T9HA 1ILQA 3HKSA 2PQAB 1IBML 1JE4A 2PPBC 5K36G 4OIKA 1Y1VB 2EE1A 2SNMA 1X3QA 1KXLA 4DR2L 3SK6A 1PFSA 3L2PA 1IKMA 2L5TA 5E1FA 1WTHA 4OELB 1WD0A 4E6IA 2Q2UA 1Q7YC 5JVG3 3GV3A 3I4NH 3JC66 3A7LA 3ULJA 1BVSA 4NB3A 3PQIA 3RLOA 4ZYSA 2Q2TA 5C44B 2A68C 3OTOQ 3JAMi 3J81E 1WJJA 3UE0A 1BR9A 2ZTDA 3S17H 2I5MX 4B3ML 4KN4C 1HNXQ 3M4YA 1KAAA 2Z4IA 1EQTA 1EYDA 3I4OA 3CC4A 1IL2A 2JA8B 1HA6A 1HZCA 3CHBD 4C1NK 3Q8DA 1RHPA 2KJXA 1I50B 5EPJA 1LM0A 2E74C 3MA2B 3S9WA 1E24A 1KL9A 1HZ9A 5KEEA 1YZ6A 4IFDJ 4RGTA 1X3PA 4C3IH 3WOFA 1A3UA 1PXUA 4BY7G 2KCNA 1L1OA 3S1NB 2F0UA 3TREA 3AFQA 1E7ZA 4O42A 1B70B 1O80A 3QG1A 4RH6A 1OTCA 2F0QA 2G5DA 4POGA 1LT3D 3U9OA 3J80c 1AE3A 1EFID 1HUMA 2NN6H 5A2QE 3HOVG 1G51A 1NSNS 3J81j 2F0VA 2F03A 1YI2A 2SEBD 4JI3Q 1VQEA 1Y8NB 3MXUA 1SFOB 4RKBA 1B7YB 4A4IA 1FGUA 4FVMA 3CCMA 2ZTCA 3D4DA 4DR3Q 5DNFA 4X3SA 3G4SA 3PV0A 1O7IA 2EJMA 4WRDA 2E5LQ 3H3VH 2CW0C 4IURA 4LK1C 4P71A 2R6GA 1Q81C 4JI5L 1KDBA 5FO9B 5C0XI 1II3A 1VCIA 1B2TA 1X3GA 1O7LA 5M3FH 2VQEL 4LFBQ 2A6HC 4K2KA 2EIFA 4OXPA 2F0EA 4QB4A 2F4IA 1CA6A 4LF4Q 3TS2A 2UXBL 4EGVA 1T5XD 3HGBA 2XVSA 5FLMH 3T1HL 4G57A 2UXCL 1HCZA 1BBWA 1I4RA 2OQKA 1IYJB 4DK0A 3I4LA 5M5WH 1PRTD 4LW1A 5M5XH 3CC2A 1LV9A 3HRZC 1L1OB 1HTLD 2WIIB 4G4KA 2IX3A 1DOLA 1Y14B 4KY7A 3AMUA 5E4XA 2R93G 1OXVA 3NWSA 3CCRA 1ML0D 1Q8IA 3QOLA 4KK7A 1HUNA 3EBEA 1XPOA 2XIWA 2ALYB 4K2LA 1YBYA 4PV1C 3PUVA 1A2TA 1GHKA 2JA6H 1SYBA 3SK5A 4DR7Q 1ILPA 1STGA 3MVVA 5EAYA 1BCPC 3KF8A 1EYGA 1UUPA 4JK1C 1ZXTA 1Y8PB 2JEBI 4A3GB 2RVLA 5FJ8G 3K57A 1G91A 2EYJA 4OGQC 2F0GA 2IHFA 1YJ9A 2PO4A 1F77A 1TT2A 4OX9L 1VQLA 1KRSA 4UP7A 2E2DC 3SK4A 5IGFA 4YWKA 4HAEA 3NXWA 4X3UA 4V190 3W1GA 4L6TB 1RCVD 1G8ZD 4DXFA 2HCIA 3STBC 4JC0A 1KRTA 3G6EA 4PZ7A 4ZAIA 4DGZA 3J7AV 1V9PA 4FXDA 1S40A 2OCEA 4DUYL 2BDOA 2UUCQ 1IKLA 4KI0A 3K5LA 1LTSD 3PIO3 1DOMA 1EIGA 4DNRB 4F87A 2AUJD 1VQAA 2DJFC 2K5QA 4DUZQ 1B8AA 1FGBD 3GTMH 4H7BA 2GA4B 3PIOA 2HDMA 3BJUA 4JI8Q 4Q0FA 2CQAA 4LF5L 1K8MA 4CJ0B 5TSSA 2A8VA 2K5NA 3F1ZA 2A6EC 5DEHA 2D5DA 3EA6A 3ZYYX 1N32L 4DAPA 1YJNA 3SR1A 3PUWA 4DK3C 3KK7A 1GUTA 3KF8B 2AQ3B 2UXDQ 3K0YA 1PH5A 4DR6L 1JQYD 1CQVA 3TP5A 3HOVH 3RLFA 5COYA 1KLUD 1DGSA 4GZYC 2F3IA 4OEMB 3RMHA 3EN2A 2PNHA 5ELOA 1OXTA 5K5PA 4XYOA 1GUSA 1T5EA 4HJ9A 3DWPA 2RSOA 2WAQG 2A6HD 2PCFB 1RF2D 2Y0SG 4HCEA 3PCOB 4Q5VA 2HIVA 1LYLA 1P8LA 1N36Q 4LUVA 4X66Q 4LF8L 2WB1B 5KNDA 4K0KL 3GTOH 1VQ9A 1V1QA 1EWHA 3SGIA 5D65A 4ZLTF 2ES2A 1LTAD 2K01A 1L0XB 3A74A 2EPBA 1TS3A 3CCUA 4JI4Q 1KHIA 2F3VA 3HOYH 3UI2A 5EKLA 5IP9G 5C0XG 2K7VA 1X65A 1SR3A 1KABA 1XMOQ 3BVGA 3D8GA 4UY8C 1VQBA 2F0DA 4CKEA 5KNCA 1BBUA 5D3DA 2N3SA 4JPBW 2E2HB 5KGUA 1LTID 1SYGA 2JSOA 3TN2A 1M4VA 1AP0A 4O1NA 3HG9A 3NTHA 3GO5A 5M3MG 1JE5A 1PLFA 3J81c 1YITA 3OW2A 3KF6A 3R3OA 4K8IA 2B63B 4EQ5A 3T13A 2AMCB 3FP9A 4ZKCB 4Y52H 3CRKC 4FF2A 5C4HA 1H9RA 5ELDA 2D9UA 4AYBB 1TVXA 4A93G 1STNA 1U0LA 2BE5C 1B53A 3A7AB 3QO2A 4K5WA 4FXGC 2GVAA 3RLNA 1STEA 1QNUA 3TBIB 1VQIA 4NKLA 1RODA 3MXGA 3S16H 3CQZB 2C9OA 1HJPA 5JEAG 3MEFA 3CPFA 1LUZA 1O7ZA 4NDXA 4BY1G 1G291 4ZUJA 5FJ8H 1E0BA 4DN4M 1H9JA 1B44D 2NVTH 4ME3A 3SXHA 1GD7A 4A3KB 1Z9FA 3VR2A 5HGQA 1F2ZA 3GTGH 3VA5A 2GVBA 4RA8A 2QEJC 1YNXA 2KHIA 5LMUQ 2JYOA 1TY2A 1IW7C 1ENAA 1IBLQ 4A3JH 1ICFB 1QZGA 3G7LA 1M1KC 1NJIC 3KUPA 4RFBA 1W3SA 2JA7G 2K28A 1CKOA 1TU2B 4EQNA 1ONLA 4IPCA 2A6ED 2RDGA 4DF7A 1I5FA 1SNPA 1LT4D 4HJ8A 2HUGA 3KF6B 1EY9A 2ZM6Q 5IP7G 2RBMA 3U9SA 3PUZA 1PV4A 5CORA 1G6ZA 2Q8TA 3SEBA 1YNJC 3K7AH 1WTOA 3V2TA 5DM73 3D31A 5KYLA 5M5YB 2OTJA 2FFKB 2ASBA 2DN8A 3FMCA 3A55A 3S1MB 3HKZB 3S24A 3CCJA 4X65L 3H91A 3J81i 3NHHA 4DFAA 4DR2Q 1CZWA 5JPMC 3N6RA 3HOUB 1RL2A 1E1TA 2I5LX 3EFXD 4A3DB 2ZTEA 1E2VA 4NXNQ 5CBEE 1B1ZA 3CW2C 3KLWA 1O78A 1FYCA 2OXPA 3H0GB 3IL8A 1I3QH 3A8KE 1JWMD 2UUBL 3S1RB 3PIPA 2P5ZX 5DAUA 4B3MQ 4JI2L 3CF5A 1R9TB 2D2CC 3M3YH 4JBWA 1FL0A 1J5EL 4BBSB 5IP9H 5C0XH 2LFNA 1CSQA 3MZ5A 2E2IB 1SDFA 4EQPA 2XWJB 2PZUA 2QF7A 3J7YW 2Z0SA 5I4DA 3WOEA 5NUCA 3HOXH 3NK9A 1VQ5A 1C7YA 1ET6A 3CRLC 1QJOA 4X3TA 4C3IG 1EY0A 3ICEA 2FINB 5E3FA 2ZJQA 3TZUA 3GTLH 5M3MH 2NVXH 2BE5D 2YTXA 5C3WA 2F0IA 2XRSD 4HJ7A 3R2IA 3QWNA 2EY6A 1CZGA 1PFNA 2VS1A 1SNDA 2NN6G 1TWHH 1EQQA 1ASZA 2Z6BA 2F52A 3S1QH 1CK1A 3IAYA 4DV5Q 4YIJA 5JEAH 1KQSA 1HPCA 1Q46A 1TS2A 3V05A 2F0HA 2L15A 1BF4A 1WVLA 4BY1H 4F88A 2HQLA 4L63B 2V1CC 1CT1D 1M8AA 5H1SE 4K5VA 2KHJA 2VQEQ 2EYMA 1IW7D 5DLQE 3IFTA 3FPUB 3J7AF 2B2YC 4KKUA 3KOJA 2G9DA 2E76C 2UXBQ 1JICA 1MD2D 3OHXC 3T1HQ 2EQSA 2UXCQ 4P72A 1EIYB 1HFNA 1RD9D 4J15A 5C4JB 4RCOA 1MKHA 2L12A 1QNKA 1KDAA 2WB1E 1MI2A 4IUPA 1NR4A 5C44G 3U58A 3I4MB 2KQ3A 1RDPD 3NQTA 1XXGA 1CHQD 3I4NB 2EZVA 4DNIA 1TWCH 3O13A 4HIMA 2LMCB 3SE0A 2HIXA 2Z4HA 1MSHA 1XNRQ 2V4DA 1V1PA 2JA8G 2PMZE 4P75A 1C4QA 5EQ0A 2F0TA 2ICIA
chains in the Genus database with same CATH topology
1D2BA 1XX8A 4EVOA 1PDQA 4K5XA 1ZKOA 3HOWB 4ODGA 1PRTC 4FYDA 2KOLA 3VR3A 3FPPA 2KECA 1QOHA 1KTKA 3DWAA 1QE6A 3SHLA 1A6XA 1KNAA 1U9RA 1Q3LA 4KY6A 1LTGD 1JWSD 1Z7TA 1BCPB 5ISRA 2TSSA 1EIHA 1HQMC 5C3XA 1QB5D 4C3HB 1SJED 3OPOA 3NTIA 1PTOH 3NSWA 4K6LA 4OO1I 1DONA 5EBDA 1TQOA 2F0FA 2WP8J 1SEBD 2XSCA 1V1PB 2VUMB 4KN7C 2K5WA 2M2LA 3X3MA 2F0PA 1XTCD 5EJWA 5FO8B 2X6GA 3PO2B 2WINB 4PQXA 2K33A 1X32A 3GTKB 2EY2A 1S5ED 5T1GA 5M5WB 1V8QA 3RZOB 5M5XB 2OF1A 1HQRD 3S14B 5F2DA 5G3LF 5HGTA 1SYDA 1OXXK 5EKIA 3WDNA 2TMPA 1HA5A 1PRTF 1WTRA 1SYFA 5C5LA 1AW7A 5IIFA 5KNBA 3TP6A 3VR5A 5EBCA 2JA5B 1TWGB 1SNCA 1H9MA 4ME5A 3RZDB 1PTOC 4BA1I 4C1NI 3Q6SA 1JR0D 2NWGA 4CBVA 1UAPA 1EZ8A 2EXZA 1YNNC 5FLXL 2M00A 1S5FD 1VF7A 1QWYA 2IW3A 3R8BA 3V96A 3BS1A 1F9RA 2AQ1B 3TSSA 3FEWX 1RKNA 1Q1BA 2EDGA 4MHEA 1F9PA 2RQXA 2A73B 1U4LA 4BY7B 3C46A 2DY8A 4IUUA 3VYUA 1WTPA 2L1BA 5ELCA 2VB2X 4RCNA 3M85A 5JPNC 3TP7A 3DEPA 2PW5A 3GTPB 1GHJA 1D1KA 1G2SA 1F2MA 4M1UB 3H3VC 3VR6A 3PUXA 3NP8A 2K32A 3FVQA 4PMWA 4C3JG 3AU7A 3T4AC 1C8CA 1STHA 2IT1A 1QG7A 2EJFC 2FMMA 4OO1G 1SMYD 4U673 1S4ZA 1JB3A 2K03A 3E0JA 4IALA 1ESRA 2L4NA 4QCLA 2F0SA 1GUOA 4FF4A 1CHPD 5ELFA 3BVZA 4IFDI 5FLXE 4U68A 2HQEA 2NYZD 2L11A 1Q90A 1RTNA 1SSOA 3DM1A 1R4PB 3G6JB 5BN4A 1A2UA 2R93B 2ID0A 1D6EC 2F0JA 1MBYA 1B4OA 4ZQ3A 4IN3A 2Q8IB 2IX0A 1ZEQX 2O5IC 1PTOD 3ERQA 4IUVA 1CFMA 1BCPF 2MHVA 5E4WC 5KYIA 2CHBD 2F0NA 2HCCA 2B2UC 2JE6I 1YNND 1TY0A 1Q12A 1TWAB 2FMCA 3C1FA 1ICWA 1Z47A 2PMZB 2B2YA 2MPMA 1I4HA 1LT6D 3MFGA 3D6CA 4EQOA 1LTRD 2RDHA 1TKWB 1DZ1A 2A5HA 3T53B 1LACA 5A35A 5C4ZA 1UNSA 2F0OA 2O4XA 1TS5A 3A56A 3I91A 1CA5A 1JOKA 3FRPB 1BQQT 1CTMA 3X3NA 1HFGA 4H44C 4XT3B 2D62A 2JP1A 4XDXA 4V0BA 2XN9C 1PFMA 1AEXA 4B9WA 1XWEA 1SBBB 5IODA 4G7OC 4RHRA 5IT9L 5J1ZA 1KDCA 2WAQB 1SE2A 4K14A 3PUYA 2Y0SB 1H9SA 5IGCA 4XTCS 5EKKA 1EY7A 1JORA 1ZYRC 4OO1H 1LO5D 5LL6X 1FD7D 2BOSA 1GUWA 1PZKD 1TWFB 2B2VC 3LNNA 2H1EA 3H09A 1K83B 2C5CA 2B39A 3A8IE 5LL6S 2NVQB 2B2WC 5DM63 3L9AX 2IJ0A 2B2TC 5D3IB 2F0KA 2F3WA 2HDLA 4S3SA 1SNOA 4IFDG 1ESFA 1PRTB 1V43A 2NVXB 4X3KA 4ABNA 2I07B 1A15A 2AWNA 4A3EB 1SNQA 1NCVA 4KKSA 1EU3A 2NTSA 3K5NA 2KCCA 4A3BB 1UEAB 3R93A 1AZQA 4R8NA 4CJ2C 2BDNA 4M8AA 4OIJA 2QILA 4A93B 2NZ1D 3PIP3 2EYPA 3P20A 2PZTA 1KLGD 1DXMA 3VYSA 2BA1A 1U4MA 3VYRA 3M7NA 1NUCA 3KLSX 1PYWD 4IUTA 1H9SB 2E75C 2G9HD 1MSGA 4FP5D 2AUKA 3OMGA 3GQBA 1CQFA 2QKIC 4HTHA 3DMUA 3SDZA 5ELBA 4C2MB 5M9OA 1B9MA 3GV6A 5IT9E 4TSSA 1WTVA 1IL8A 4KHZA 4HR7B 3HS0C 2JA7B 1D1IA 1TWCB 4R9WA 4KKTA 1FR3A 1SYEA 3MXNA 3K59A 3W2DA 2LS01 4TRDA 3SK8A 4Z9CB 2XRQD 1PFBA 4KHVA 4Y7NB 3C1EA 3S2HB 3H6MA 3I8ZA 1GJXA 3HOZB 2F0LA 3MAQA 1SE3A 2O5JC 4QF4A 4HCSA 5JAVA 5CV9A 2Q8RE 4DAVA 1MGSA 1I4PA 2RA4A 1ZYRD 3NBIA 1F9QA 5I2YA 3P1HA 3W3AA 3MWYW 3OOCA 5C0XJ 2VNUD 1ET9A 4FF1A 1K8OA 2ICEC 3IKJA 3D6WA 2LY7A 3NE5B 3RD4A 1DYQA 2R61A 3OIPA 3S17B 1VMCA 4LAAA 1EYAA 4HEDA 4MN3A 2IPKD 2MJ8A 2J4XA 2AQ2B 3HP3A 2BA0A 4CKBA 2FHTA 2VXWA 3EJIA 2JXMB 4C3IB 3I90A 4IFDH 1I6VC 3EVQA 1BBXC 2SOBA 1TIID 4PMCA 4BA2I 2EYHA 2EY1A 5CV5A 5JEAJ 1D5XC 1NAPA 3C2PA 2Z8LA 2PNRC 1U4PA 2RSNA 2NVYB 1J8IA 1U4RA 3VR4A 5I6WA 1HTPA 3Q24A 3A54A 2WACA 3DWQA 2YU9B 4CHTB 2K5DA 5FOBB 1JOQA 3EROA 1I4QA 3L3OC 3DEOA 4CJ1B 3BDLA 2KHSA 2K05A 2EJGC 4PMBA 4BS9A 1CI3M 3K58A 2B2UA 5M3FB 5CV7A 3K5MA 1LLRD 2ZXPA 4HSPA 3NPPA 3Q22A 2B8FA 2DNEA 3Q0AA 1DD2A 1IYVA 1SMYC 4IUQA 2X69A 1G2TA 3KLRA 1STBA 2DNCA 4QUCA 1TS4A 3OMCA 1A3TA 4ZUIA 1DCZA 3F2UA 3HZXA 1J9OA 1JC7A 2X6LA 2R3ZA 1GUGA 1CM9A 2EYFA 3DHQA 1FNWA 2H4OA 3QOJA 1SE4A 2NBFA 4A3FB 1SAPA 1STYA 3N52A 1S5BD 3MC0B 1W6JA 3NBHA 2JA6B 1Y69U 3QIAA 4KMUC 1EY8A 1O7YA 2L55A 1EL0A 5BN5A 3ND9A 4F8MA 3BYYB 2ENBA 4XYQA 1WTXA 4KD3A 2F1MA 1JOOA 4KD4A 4XT1B 3KBGA 2A69C 4HMJA 4QMGA 1F2LA 3IFDA 3GD7A 4PNYA 1B9NA 1IHZA 1QILA 1NR2A 4ILWA 5C6AA 3VYTA 3DXJC 4FXKC 2CVRA 5CV8A 5JJZA 3AB9A 1IYUA 5G3LD 4RHSA 2B2VA 4P2CB 3GTMB 1LT5D 3NTKA 1JWUD 3OSOA 1FNVA 3JAML 3OW7A 2L0CA 2MUYA 4UDUC 2EVBA 2B2WA 4B08A 5C5MA 1BDOA 2B2TA 1LTTD 2PYKA 4DAYA 3FDTA 2E2JB 2EYLA 1Q1EA 3TDQA 3P7JA 3HOVB 5J22A 1E2ZA 5CR3A 5EPKA 2ZXRA 1V1OA 4KJOA 3ND8A 3A8JE 1SJHD 1WTWA 3D3RA 4ZKBB 2SDFA 3TP8A 5IGGA 1VMPA 2QDBA 1Y1WB 1OO9B 3D4RA 1TR5A 3PMFA 3GTOB 5K36H 1BNZA 2A68D 3MEHA 1R4QB 1GOZA 4XQQA 1PTOF 3MHBA 2PQEA 1SXTA 4ULLA 3CKIB 3CU7A 1STAA 3HOYB 4IQZA 1ENFA 2XWBB 2L9HA 4J8QA 2I46A 1I4XA 4BWGB 3S15B 1EY4A 1W6KA 4FO2A 4I7ZC 1VDZA 2NUCA 3OWEB 1E2WA 2WKDA 1D5ZC 4J1MA 4ID6A 2ZXOA 1Y8OB 5I6YA 2KVMA 2BCOA 2IWHA 3TMEA 3E5SA 5I9OA 1EY5A 1EEFD 2B8GA 3NUCA 4OHJA 5CC4A 2A69D 4XXEA 3JAME 2MGSA 5JVH3 4KV6A 2N55A 3T51B 3S16B 2ZT9C 3URYA 5J39A 5LHY1 3HEJA 5CV4A 4IZ8A 2CW0D 4DXGA 1XYIA 3BG3A 2FJ2A 2NVTB 3GP7A 3S2DB 3K6OA 2WV6D 3GTGB 5IGEA 5IGBA 3I70A 4A3JB 4C3JB 3NQIA 1GUNA 3J80L 2M9VA 3BYTB 4H13C 3H94A 1H9KA 1BOSA 1OXSC 4WFN3 1EYCA 2N88A 4R8IA 2KA7A 2JEAI 1PZJD 3BDCA 5I9PA 4KY5A 1GXDC 4G7HC 3K7AB 2KEEA 2OT2A 5AFWA 2NN6I 1I4GA 4HMIA 4QUFA 2RDFA 4L8JA 1BCPD 1WD1A 3VA7A 4CKCA 3LWEA 4I65A 1DM0B 3QB3A 2EOTA 2IX1A 1B50A 1DJRD 4ZRZA 1BXTA 1RJTA 2K6AA 3T16A 3GTJB 1EOTA 4KTAA 1AFPA 1I3QB 4B9XA 5FKAC 3R2TA 1KNEA 1S5CD 1EZ6A 5FK9C 4RGMA 2NTTA 1EY6A 1QCBD 5KIXA 3ONAB 1L0YB 3M3YB 4OL7A 3C3LA 1AN8A 3TZDA 5IOCA 2SNSA 1D5MC 3LX0A 5HURA 3I3CA 4DNTB 4LMQD 3HOXB 2KUMA 2K1BA 3J80E 2A74C 1EWCA 2QCPX 3GTLB 3Q23A 5M3MB 5JOBA 5CV6A 3LWUA 1EEID 4WORA 2XNAC 1LABA 3I73A 1TWHB 3DUZA 2VB3X 4HSVA 4UAIA 1A3VA 3S1QB 1I6HB 5IGDA 4NW2A 3OIQA 3BZDB 3T56B 4BY1B 1VF5C 3I72A 4RAUC 1EQVA 1LTBD 4K8JA 5D14A 3EQLC 1BO0A 2RKSA 3NWTA 5BN3A 4LJZC 4CGYB 3BDOA 4XIGS 2K04A 4G7ZC 4DK1A 1ENCA 2MP1A 5KRUA 2O2LD 2YYZA 4XQJA 1B3AA 3M7GA 4NMZA 2R7ZB 2PZWA 2F0WA 1DOKA 5CGKA 4WJWA 4XQNA 1WCMB 4RGNA 1FNUA 4QIWB 5C4XB 5CBAE 1RTOA 3L7ZC 2PW7A 5FO7B 1AZPA 1OXUA 3MFYA 1HXYD 4HN7A 4RWSC 5T1IA 4TKOB 4TQUS 1SNMA 5C3EB 3RUZA 4C3HG 5EGTA 4IUNA 4FNFA 4N9PA 4A3IB 3MTSA 5CMDA 4DA2A 2J7ZA 4K6DA 4KJNA 1PZID 1PTOB 3J81L 1F2YA 2WKCA 3E6ZX 3KBXA 3K5OA 1HRJA 1SYCA 3MXPA 1HHVA 2R92B 1Z6HA 1S5DD 4H0LC 2NB0A 4J6HA 1BUVT 1C48A 2EY5A 4A3MB 1F9SA 1YNJD 4RGOS 1JCKB 3M4OB 4NP5A 5I2XA 2AWOA 1WTQA 5A2QL 2Z1CA 3FKIB 3QJYA 2OEOA 3KLSA 4MIUA 2J0TD 4F7XA 4RKLA 4BBRB 4DU9A 2IL8A 3SVMA 3PO3B 1EU4A 3P75A 2LKVA 5CYUA 4C56C 3OWFA 2F0MA 5EPLA 2KEDA 4N9TA 5ELEA 2DY7A 3D4WA 3ITPA 3BVMA 1PMRA 4FF3A 2EYOA 4ZK9B 3GTQB 1ILQA 1JE4A 2PPBC 5K36G 4OIKA 1Y1VB 2EE1A 2SNMA 1X3QA 3SK6A 1IKMA 2L5TA 5E1FA 1WD0A 4E6IA 5JVG3 3GV3A 3A7LA 4ZYSA 5C44B 2A68C 3J81E 1BR9A 4KN4C 3M4YA 1KAAA 2Z4IA 1EQTA 1EYDA 2JA8B 1HA6A 3CHBD 4C1NK 5EPJA 1RHPA 2KJXA 1I50B 3S9WA 2E74C 3MA2B 5KEEA 4IFDJ 4RGTA 1X3PA 3WOFA 1A3UA 1PXUA 3S1NB 2KCNA 2F0UA 4O42A 1O80A 3QG1A 4RH6A 2F0QA 1LT3D 3U9OA 1HUMA 1EFID 2NN6H 5A2QE 1NSNS 2F0VA 2F03A 2SEBD 1Y8NB 3MXUA 1SFOB 4RKBA 4FVMA 3D4DA 5DNFA 4X3SA 3PV0A 2EJMA 4WRDA 2CW0C 4IURA 4LK1C 2R6GA 1KDBA 5FO9B 5C0XI 1II3A 1VCIA 1B2TA 1O7LA 2A6HC 4K2KA 1CA6A 2F0EA 4QB4A 2F4IA 4EGVA 1T5XD 3HGBA 2XVSA 4G57A 1HCZA 1I4RA 4DK0A 3I4LA 1PRTD 1LV9A 3HRZC 1HTLD 2WIIB 2IX3A 4G4KA 3AMUA 1DOLA 4KY7A 5E4XA 1OXVA 3NWSA 1ML0D 1Q8IA 3QOLA 4KK7A 1HUNA 2XIWA 4K2LA 4PV1C 3PUVA 1A2TA 1GHKA 1SYBA 3SK5A 1ILPA 1STGA 3MVVA 1BCPC 3KF8A 1UUPA 4JK1C 1ZXTA 1Y8PB 2JEBI 4A3GB 2RVLA 3K57A 1G91A 2EYJA 4OGQC 2F0GA 2PO4A 1F77A 1TT2A 2E2DC 3SK4A 5IGFA 4HAEA 3NXWA 4X3UA 4V190 4L6TB 1RCVD 1G8ZD 4DXFA 2HCIA 4ZAIA 4DGZA 3J7AV 4FXDA 2BDOA 1IKLA 4KI0A 3K5LA 1LTSD 3PIO3 1DOMA 1EIGA 4DNRB 4F87A 2AUJD 2K5QA 1FGBD 4H7BA 2GA4B 2HDMA 4Q0FA 2CQAA 1K8MA 4CJ0B 5TSSA 2A6EC 5DEHA 2D5DA 3EA6A 3ZYYX 4DAPA 3SR1A 3PUWA 3KK7A 1GUTA 2AQ3B 3K0YA 1JQYD 1CQVA 3TP5A 3RLFA 5COYA 1KLUD 4GZYC 3RMHA 1OXTA 5K5PA 4XYOA 1GUSA 1T5EA 3DWPA 2RSOA 2A6HD 2PCFB 1RF2D 4HCEA 4Q5VA 2WB1B 5KNDA 1EWHA 5D65A 4ZLTF 1LTAD 2K01A 1L0XB 2EPBA 1TS3A 2F3VA 3UI2A 5EKLA 5C0XG 2K7VA 1KABA 3BVGA 3D8GA 2F0DA 4CKEA 5KNCA 5D3DA 2E2HB 5KGUA 1LTID 1SYGA 2JSOA 3TN2A 1M4VA 1AP0A 4O1NA 3HG9A 3NTHA 3GO5A 1PLFA 3R3OA 4K8IA 2B63B 3T13A 4ZKCB 3CRKC 4FF2A 5C4HA 1H9RA 5ELDA 2D9UA 4AYBB 1TVXA 1STNA 2BE5C 1B53A 3A7AB 3QO2A 4K5WA 4FXGC 1STEA 1QNUA 3TBIB 4NKLA 1RODA 3MXGA 3CQZB 2C9OA 5JEAG 1O7ZA 4NDXA 1G291 4ZUJA 1E0BA 4DN4M 1H9JA 1B44D 3SXHA 4A3KB 3VR2A 1F2ZA 3VA5A 4RA8A 2QEJC 2JYOA 1TY2A 1IW7C 1ENAA 3G7LA 3KUPA 4RFBA 2K28A 1TU2B 4EQNA 1ONLA 2A6ED 2RDGA 4DF7A 1SNPA 1LT4D 2HUGA 1EY9A 2RBMA 3U9SA 3PUZA 5CORA 1G6ZA 2Q8TA 3SEBA 1YNJC 1WTOA 3V2TA 5DM73 3D31A 5KYLA 5M5YB 2FFKB 2DN8A 3FMCA 3A55A 3S1MB 3HKZB 3H91A 3NHHA 4DFAA 1CZWA 5JPMC 3N6RA 3HOUB 3EFXD 4A3DB 1E2VA 5CBEE 1B1ZA 1O78A 1FYCA 2OXPA 3H0GB 3IL8A 3A8KE 1JWMD 3S1RB 5DAUA 1R9TB 2D2CC 4JBWA 4BBSB 5C0XH 2LFNA 3MZ5A 2E2IB 1SDFA 4EQPA 2XWJB 2PZUA 2QF7A 3J7YW 5I4DA 3WOEA 5NUCA 3NK9A 1ET6A 1QJOA 3CRLC 4X3TA 4C3IG 1EY0A 2FINB 5E3FA 3TZUA 2BE5D 5C3WA 2F0IA 2XRSD 3R2IA 3QWNA 2EY6A 1CZGA 1PFNA 1SNDA 2NN6G 1CK1A 3IAYA 4YIJA 5JEAH 1HPCA 1TS2A 3V05A 2F0HA 1BF4A 1WVLA 4F88A 4L63B 1CT1D 1M8AA 4K5VA 2EYMA 1IW7D 3IFTA 3FPUB 3J7AF 2B2YC 4KKUA 2G9DA 2E76C 1JICA 1MD2D 3OHXC 1HFNA 1RD9D 5C4JB 4RCOA 2L12A 1QNKA 1KDAA 1MI2A 4IUPA 1NR4A 3I4MB 2KQ3A 1RDPD 3NQTA 1XXGA 1CHQD 3I4NB 2EZVA 3O13A 2LMCB 3SE0A 2Z4HA 1MSHA 2V4DA 1V1PA 1C4QA 5EQ0A 2F0TA 2ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4W A;  4QB4 A;  1SNQ A;  5C5M A;  3ITP A;  4EVO A;  4K5X A;  1SYF A;  2PYK A;  4EQO A;  2EYO A;  4NDX A;  5C5L A;  4ODG A;  4ZUJ A;  2EYL A;  2SNS A;  5DEH A;  5IOC A;  2PW7 A;  4G57 A;  3LX0 A;  1STH A;  5IIF A;  1STB A;  4R8N A;  5C4Z A;  3P1H A;  2F0O A;  3OMC A;  3SR1 A;  2O4X A;  5HUR A;  1A3T A;  2SNM A;  3TP6 A;  3SXH A;  4ZUI A;  5J22 A;  3SK6 A;  2EYP A;  3HZX A;  5CR3 A;  3MZ5 A;  1SNM A;  4IAL A;  1JOK A;  2PZT A;  5E1F A;  4KJO A;  5IGE A;  2F0S A;  4E6I A;  4EQP A;  3TP5 A;  1F2Z A;  2PZU A;  3RUZ A;  3VA5 A;  1JOR A;  1SNC A;  5IGB A;  3SHL A;  2EYF A;  4IUN A;  5EGT A;  5JOB A;  5CV6 A;  1NUC A;  3DHQ A;  3NK9 A;  4ME5 A;  4KY7 A;  5NUC A;  4N9P A;  1U9R A;  3QOJ A;  1EY0 A;  5E3F A;  4KY6 A;  3QOL A;  1ENA A;  3TP8 A;  1STY A;  4WOR A;  5IGG A;  5C3W A;  5K5P A;  2QDB A;  4K2L A;  4LAA A;  4K6D A;  1EYC A;  2F0I A;  1EYA A;  4KJN A;  2HQE A;  1EZ8 A;  1A2T A;  3OMG A;  1TR5 A;  3BDC A;  3PMF A;  5ISR A;  4HTH A;  3DMU A;  1EY8 A;  1AEX A;  2EY6 A;  2EXZ A;  4B9W A;  5C3X A;  1KAA A;  2M00 A;  1F2Y A;  3MEH A;  4EQN A;  1SND A;  5I9P A;  5M9O A;  1SYB A;  3SK5 A;  4KY5 A;  1STG A;  4F8M A;  3MVV A;  4DF7 A;  1A3V A;  4NKL A;  1EYD A;  1A2U A;  3MHB A;  2PQE A;  3EJI A;  1SNP A;  2ENB A;  3S9W A;  5IGD A;  1STA A;  2F0J A;  3EVQ A;  5IOD A;  4KD3 A;  1JOO A;  1EY9 A;  2SOB A;  4PMC A;  4KD4 A;  5KEE A;  1TQO A;  1SYC A;  3MXP A;  4ZQ3 A;  2RBM A;  2F0F A;  5J1Z A;  4HMI A;  1KDC A;  2RDF A;  1A3U A;  2EYJ A;  2F3V A;  4HMJ A;  4K14 A;  4YIJ A;  2F0U A;  2F0G A;  5EKL A;  4QMG A;  2EYH A;  4J6H A;  1EQV A;  2EY1 A;  2F0H A;  5CV5 A;  5IGC A;  1SYE A;  1TT2 A;  1KAB A;  3V2T A;  3ERQ A;  2EY5 A;  4K8J A;  1EY4 A;  4I65 A;  4PNY A;  5EKK A;  1EY7 A;  1RKN A;  4K5V A;  5KYL A;  3D8G A;  2EYM A;  3SK4 A;  2F0Q A;  4TRD A;  3SK8 A;  2F0D A;  5IGF A;  5KYI A;  3NXW A;  3U9O A;  5I6W A;  1IHZ A;  1NSN S;  3QB3 A;  2NUC A;  5KGU A;  4NP5 A;  1SYG A;  2F0N A;  2F0V A;  4KHV A;  3C1E A;  2RKS A;  2WAC A;  3T16 A;  2F0P A;  3H6M A;  2OEO A;  5C6A A;  3NHH A;  4DGZ A;  4DFA A;  4RKB A;  4MIU A;  1JOQ A;  3ERO A;  4ID6 A;  3D4D A;  4J1M A;  3C1F A;  1KDA A;  4KTA A;  5CV8 A;  4F7X A;  1ENC A;  2F0L A;  3R3O A;  4K8I A;  4RKL A;  3TME A;  5I6Y A;  5KRU A;  2EY2 A;  3E5S A;  2KQ3 A;  3T13 A;  4DU9 A;  4B9X A;  5I9O A;  1EY5 A;  3NQT A;  3BDL A;  3NUC A;  2F0K A;  4WRD A;  2KHS A;  3P75 A;  4PMB A;  4QF4 A;  2LKV A;  2OF1 A;  2OXP A;  3TP7 A;  5C4H A;  5CC4 A;  1EZ6 A;  2PW5 A;  5JAV A;  4NMZ A;  5CV9 A;  5CV7 A;  3OSO A;  4KV6 A;  3OWF A;  2F3W A;  2PZW A;  1SNO A;  1EY6 A;  1STN A;  1KDB A;  2F0M A;  2F0W A;  3D6C A;  4S3S A;  1F2M A;  5F2D A;  1II3 A;  5KIX A;  5HGT A;  4K5W A;  5CGK A;  1SYD A;  4H7B A;  5J39 A;  3HEJ A;  5CV4 A;  3NP8 A;  4N9T A;  4OL7 A;  5DAU A;  4K2K A;  4IZ8 A;  2F0T A;  2F0E A; 
#chains in the Genus database with same CATH topology
 1D2B A;  1XX8 A;  4EVO A;  4DV7 L;  1E22 A;  1PDQ A;  4K5X A;  4R4O A;  5IP7 H;  1ZKO A;  3HOW B;  4ODG A;  1J6Q A;  1PYS B;  5C4X H;  4A3F G;  1PRT C;  4DV6 L;  4FYD A;  2KOL A;  3VR3 A;  3FPP A;  2KEC A;  2JA6 G;  1QOH A;  3TS0 A;  1KTK A;  3DWA A;  4MNO A;  3ULL A;  1QVF A;  4LWC A;  4OON A;  1UE5 A;  1SN8 A;  3ERS X;  4HJA A;  1HZB A;  1QE6 A;  2JN4 A;  3SHL A;  4OX9 Q;  1A6X A;  1KNA A;  1U9R A;  5C3E H;  1Q3L A;  2K52 A;  4KY6 A;  1LTG D;  1JWS D;  1Z7T A;  1BCP B;  2K5V A;  5ISR A;  4JOI C;  2TSS A;  1EIH A;  1HQM C;  5C3X A;  2VY3 A;  1QB5 D;  4C3H B;  1RIP A;  1SJE D;  3B6Y A;  3OPO A;  3NTI A;  1PTO H;  3NSW A;  4DUY Q;  4K6L A;  1NMF A;  4OO1 I;  1DON A;  5EBD A;  1TQO A;  2F0F A;  1PH3 A;  2WP8 J;  3AFP A;  1VQF A;  4DR1 L;  1SEB D;  2XSC A;  1EIF A;  4YWM A;  4IPH A;  4P73 A;  1V1P B;  1VS0 A;  1WFQ A;  4LF5 Q;  2VUM B;  2VZA A;  4A3M H;  4KN7 C;  2K5W A;  1N32 Q;  2M2L A;  3X3M A;  2F0P A;  1M90 C;  3M4O H;  1XTC D;  5EJW A;  5FO8 B;  2X6G A;  2D0P A;  4DPG A;  3PO2 B;  3PSI A;  2WIN B;  3FKI H;  4PQX A;  2K33 A;  1X32 A;  1XTD A;  1AH9 A;  3GTK B;  2EY2 A;  1S5E D;  5T1G A;  5M5W B;  1V8Q A;  3RZO B;  5M5X B;  2OF1 A;  2QDL A;  4LUO A;  1HQR D;  3S14 B;  4BBR H;  2RF4 A;  3PO3 H;  1KC8 C;  5F2D A;  5G3L F;  5HGT A;  1SYD A;  4B3R L;  1OXX K;  2NVY H;  5EKI A;  3WDN A;  2TMP A;  1HA5 A;  2MNA A;  1PRT F;  1WTR A;  1VQC A;  1SYF A;  4LF8 Q;  4O2D A;  2YU9 H;  4K0K Q;  5C5L A;  1AW7 A;  4A3G G;  3HKZ E;  5IIF A;  5GAE C;  5KNB A;  1UE7 A;  3TP6 A;  3VR5 A;  5GRO A;  1Y1W G;  1Q86 C;  5EBC A;  4LNQ A;  2JA5 B;  4FDB A;  5GAH C;  1Y1V H;  1TWG B;  4DV2 L;  2A1A A;  1SNC A;  1H9M A;  4ME5 A;  1JT8 A;  3RZD B;  1PTO C;  4BA1 I;  4ZCK A;  4C1N I;  3KYH C;  1YHB A;  4KLK A;  1HR0 W;  3Q6S A;  3HOY G;  1JJG A;  1JR0 D;  1SE8 A;  2NWG A;  4CBV A;  1UAP A;  1EZ8 A;  1ASY A;  5C44 H;  2KCM A;  2EXZ A;  1YNN C;  4IOC A;  3K7U C;  2M00 A;  5FLX L;  1S5F D;  1VF7 A;  4POF A;  1QWY A;  2IW3 A;  1Q8K A;  2R7F A;  3R8B A;  3V96 A;  3BS1 A;  1F9R A;  2JA8 H;  2Z9H A;  2AQ1 B;  1U5K A;  3TSS A;  3CP0 A;  3FEW X;  1X9N A;  1VQD A;  4A3F H;  3S1N H;  1RKN A;  1Q1B A;  2EDG A;  4MHE A;  3I2Z A;  1F9P A;  2RQX A;  2A73 B;  4JI0 L;  1U4L A;  4BY7 B;  3C46 A;  2DY8 A;  2F4V L;  4EX5 A;  1TXY A;  4IUU A;  3VYU A;  1WTP A;  2L1B A;  1SFO H;  4LF9 L;  5ELC A;  3J80 i;  2VB2 X;  4RCN A;  3M85 A;  1YIJ A;  2N49 A;  5JPN C;  3TP7 A;  3DEP A;  2PW5 A;  1KD1 C;  4JI6 L;  4JG2 A;  3GTP B;  1GHJ A;  4LF7 L;  1D1K A;  1G2S A;  1F2M A;  4IPD A;  4M1U B;  2N78 A;  3H3V C;  3VR6 A;  3PUX A;  3NP8 A;  2K32 A;  4IPG A;  3FVQ A;  3EIV A;  4A3J G;  4PMW A;  4C3J G;  3AU7 A;  3T4A C;  1C8C A;  1S3O A;  1STH A;  2IT1 A;  1QG7 A;  2EJF C;  2FMM A;  4OO1 G;  1SMY D;  4U67 3;  1S4Z A;  2A19 A;  1JB3 A;  4B3S Q;  2LSS A;  2K03 A;  2EXD A;  3E0J A;  4IAL A;  1ESR A;  2L4N A;  5GAG C;  4QCL A;  2F0S A;  1GUO A;  3E0E A;  4FF4 A;  1K9M C;  4DKA C;  3NEL A;  1CHP D;  5ELF A;  1GO3 E;  3BVZ A;  4IFD I;  5FLX E;  4U68 A;  2HQE A;  2NYZ D;  2L11 A;  4X65 Q;  1Q90 A;  5J3B A;  2B63 G;  5IYD H;  2E2J H;  1RTN A;  1HNW L;  1SSO A;  3DM1 A;  1R4P B;  3G6J B;  5BN4 A;  3M4P A;  4QGU A;  1A2U A;  2R93 B;  2ID0 A;  4AYB G;  2NZO A;  4GLX A;  1D6E C;  2F0J A;  1HNX L;  1MBY A;  1B4O A;  4ZQ3 A;  4IN3 A;  4LUZ A;  1CUK A;  2Q8I B;  2IX0 A;  1ZEQ X;  2YTV A;  2O5I C;  1WI5 A;  1PTO D;  4A3G H;  3ERQ A;  4PZ6 A;  2UUB Q;  4IUV A;  1CFM A;  1BCP F;  2MHV A;  5E4W C;  5KYI A;  3FHW A;  2QA4 A;  4JI2 Q;  1Y1W H;  3A0J A;  1NTG A;  3CCS A;  1EWI A;  2CHB D;  3NEM A;  2F0N A;  2HCC A;  3CD6 A;  2B2U C;  2JE6 I;  1YNN D;  4JYA L;  3F8T A;  1TY0 A;  1Q12 A;  1VQO A;  5BR8 L;  1TWA B;  4IOA A;  2FMC A;  3C1F A;  1ICW A;  1Z47 A;  2PMZ B;  2B2Y A;  2MPM A;  2PI2 A;  3AQQ A;  4A76 A;  1I4H A;  1LT6 D;  1A0I A;  2JA9 A;  3MFG A;  3RR5 A;  3S15 H;  4CDF C;  3D6C A;  1JMC A;  3HOX G;  1PVO A;  4EQO A;  1LTR D;  2RDH A;  4DR5 L;  1TKW B;  4L5R C;  4KHP L;  1DZ1 A;  2A5H A;  4JW0 A;  3T53 B;  1LAC A;  5A35 A;  1EQR A;  5C4Z A;  1VQM A;  1UNS A;  2F0O A;  2O4X A;  1HR0 L;  1TS5 A;  4QL5 A;  3A56 A;  3I91 A;  1CA5 A;  3OYY A;  1JOK A;  2RHQ B;  3FRP B;  4R1J A;  1UE1 A;  1N34 L;  1BQQ T;  1CTM A;  2MO1 A;  3UDI A;  2MO0 A;  3X3N A;  1K8A C;  1HFG A;  4H44 C;  1AE2 A;  2GN5 A;  4PZ8 A;  4XT3 B;  2D62 A;  2JP1 A;  4XDX A;  4A75 A;  4V0B A;  2XN9 C;  4DV1 L;  4X64 L;  1PFM A;  1AEX A;  4B9W A;  3LGJ A;  3S2D H;  1XWE A;  1NNX A;  5L37 A;  1SBB B;  1MJE A;  5IOD A;  4G7O C;  2N8N A;  4RHR A;  3E9I A;  5IT9 L;  2UU9 L;  5J1Z A;  1KDC A;  4JOI A;  2WAQ B;  1SE2 A;  4K14 A;  3PUY A;  2Y0S B;  4C3J H;  1H9S A;  5IGC A;  4XTC S;  3CCV A;  5EKK A;  1EY7 A;  4BBS G;  1JOR A;  2CWP A;  1ZYR C;  4OO1 H;  2CKZ B;  1LO5 D;  4X6A H;  3T1Y L;  5LL6 X;  1FD7 D;  2BOS A;  1GUW A;  1PZK D;  1TWF B;  2B2V C;  4LFC L;  4DV6 Q;  1WOC A;  2E2H H;  2R7Z G;  4GLV B;  3LNN A;  1I94 L;  2H1E A;  3H09 A;  3M4Q A;  4HIO A;  1WCM G;  1K83 B;  2C5C A;  2DJG C;  2B39 A;  3A8I E;  5LL6 S;  2NVQ B;  3J7A 5;  2B2W C;  5C4X G;  5DM6 3;  3L9A X;  2IJ0 A;  2B2T C;  5D3I B;  4RMF A;  3KDF A;  2F0K A;  2B63 H;  4L5Q A;  2F3W A;  2HDL A;  4S3S A;  1SNO A;  1XNQ Q;  4IFD G;  1ESF A;  5IWA L;  1PRT B;  1V43 A;  1VQK A;  1VQJ A;  2NVX B;  3BU2 A;  4X3K A;  4ABN A;  2I07 B;  1A15 A;  2AWN A;  3BZC A;  1IBM Q;  4A3E B;  5C3E G;  1SNQ A;  1NCV A;  4KKS A;  5IYB G;  1EU3 A;  2NTS A;  3K5N A;  3CPW A;  2KCC A;  4A3B B;  1UEA B;  1XMQ L;  3R93 A;  1AZQ A;  5E7N A;  4GS3 A;  3KFU A;  4A3I G;  1FJG L;  3GTJ H;  3CQZ H;  1D8L A;  4GN5 A;  4JI8 L;  4R8N A;  4CJ2 C;  2BDN A;  4M8A A;  2WFW A;  4OIJ A;  2QIL A;  1NY4 A;  2K4K A;  4A93 B;  2NZ1 D;  3PIP 3;  2EYP A;  1E1O A;  2CH4 W;  3P20 A;  1UWV A;  2PZT A;  1KLG D;  1DXM A;  3VYS A;  2BA1 A;  4A3K H;  1U4M A;  3VYR A;  3M7N A;  1NUC A;  3KLS X;  1PYW D;  4IUT A;  2UXD L;  1H9S B;  2E75 C;  2DGY A;  2G9H D;  5IYC H;  1MSG A;  2JQO A;  4FP5 D;  2R92 G;  2AUK A;  4HJ5 A;  3OMG A;  2NZH A;  3GQB A;  1CQF A;  2QKI C;  4HTH A;  3DMU A;  1VQN A;  3SDZ A;  5ELB A;  4B3T L;  4NPS A;  4C2M B;  5M9O A;  1B9M A;  4A3M G;  1GKH A;  4GKJ L;  3GV6 A;  5IT9 E;  2K50 A;  4JV5 L;  4ALP A;  4TSS A;  4X66 L;  3I56 A;  1WTV A;  1IL8 A;  2RHS B;  4KHZ A;  3KDF B;  3FKI G;  4HR7 B;  3HS0 C;  1A62 A;  2JA7 B;  1D1I A;  1TWC B;  4R9W A;  4KKT A;  1FR3 A;  1SYE A;  3MXN A;  3K59 A;  4B3R Q;  3W2D A;  4OWX B;  2LS0 1;  4TRD A;  3SK8 A;  4BBR G;  3PO3 G;  1VQ8 A;  4Z9C B;  4I7A A;  2FXQ A;  2XRQ D;  5M5Y H;  1PFB A;  4KHV A;  4Y7N B;  3C1E A;  4YCU A;  5ELN A;  2HHH L;  3S2H B;  3H6M A;  3I8Z A;  1MHW C;  1I6H H;  1GJX A;  5FLX c;  3HOZ B;  4WJ3 M;  2F0L A;  4CDE C;  3MAQ A;  1VQ6 A;  1EUJ A;  1SE3 A;  4DV2 Q;  4JI5 Q;  3HOU H;  2O5J C;  4QF4 A;  3UDX A;  3K0X A;  1PH8 A;  4HCS A;  5JAV A;  5CV9 A;  1Y1V G;  2Q8R E;  4QJF A;  4DAV A;  4DV4 L;  1MGS A;  1I4P A;  2RA4 A;  1ZYR D;  3H15 A;  5AJ3 L;  4AQY L;  2UUA L;  1FVI A;  3NBI A;  3S1R H;  1X56 A;  1F9Q A;  5LMN W;  4IJL A;  5I2Y A;  2HD3 A;  3HFZ B;  3F2B A;  1R9T H;  3P1H A;  2Q2I A;  4OWT B;  3W3A A;  3MWY W;  3OOC A;  5C0X J;  4BBS H;  2BH8 A;  2VNU D;  2JJQ A;  1ET9 A;  4FF1 A;  1EFW A;  2VUM G;  1K8O A;  2ICE C;  3IKJ A;  2E2I H;  3RN5 A;  3D6W A;  3MXN B;  2LY7 A;  3NE5 B;  3RD4 A;  1K3B C;  1DYQ A;  2R61 A;  3OIP A;  4O0A A;  3S17 B;  1WCM H;  1VMC A;  3DM3 A;  4LAA A;  1EYA A;  1HH2 P;  3PO2 G;  2VW9 A;  4JI0 Q;  4HED A;  4MN3 A;  3A5U A;  2IPK D;  1PH9 A;  2AHO B;  2MJ8 A;  1SMX A;  2J4X A;  2AQ2 B;  3HP3 A;  2BA0 A;  3J7Z C;  4CKB A;  2F4V Q;  2FHT A;  2VXW A;  3W5O A;  3EJI A;  1HNZ L;  2JXM B;  1X54 A;  3I90 A;  4C3I B;  2ZJP A;  4DV3 L;  4LF9 Q;  4IFD H;  3DLL A;  1I6V C;  3EVQ A;  1BBX C;  2SOB A;  2Q2H A;  1TII D;  4PMC A;  4DV0 L;  3RN2 A;  5IYB H;  4GOP C;  4JI6 Q;  1XPU A;  4BA2 I;  2EYH A;  2EY1 A;  5CV5 A;  5JEA J;  1D5X C;  2Z6K C;  4A3I H;  1NAP A;  3C2P A;  2Z8L A;  2PNR C;  1U4P A;  2RSN A;  4X62 L;  2NVY B;  1J8I A;  1PH1 A;  1U4R A;  3VR4 A;  5I6W A;  1HTP A;  2JA5 G;  3Q24 A;  3A54 A;  2WAC A;  3DWQ A;  2YU9 B;  4CHT B;  2K5D A;  3BZK A;  1NMG A;  5FOB B;  1JOQ A;  3ERO A;  5C4J H;  1I4Q A;  3L3O C;  3DEO A;  1MIU A;  2R92 H;  4CJ1 B;  3BDL A;  1IBK L;  2KHS A;  2K05 A;  2EJG C;  4PMB A;  4BS9 A;  1CI3 M;  3K58 A;  2B2U A;  2K5H A;  3I4M H;  5M3F B;  5CV7 A;  3K5M A;  1LLR D;  2PI2 E;  4NXN L;  2ZXP A;  2WAQ E;  4HSP A;  2Y0S E;  1CKM A;  3NPP A;  3Q22 A;  2QW7 A;  2B8F A;  4YY3 L;  2DNE A;  3Q0A A;  4LF6 L;  1X3F A;  1IYV A;  1DD2 A;  1HNW Q;  1SMY C;  3AEV A;  4IUQ A;  2XTI A;  3F2D A;  2X69 A;  2RCF A;  1G2T A;  4DR6 Q;  3KLR A;  1STB A;  2DNC A;  4QUC A;  5IYD G;  2VQF L;  1TS4 A;  3OMC A;  4A3C H;  3HOW H;  1A3T A;  2OTL A;  4ZUI A;  1DCZ A;  3F2U A;  3HZX A;  1J9O A;  1JC7 A;  2X6L A;  1E3P A;  2R3Z A;  1GUG A;  1UE6 A;  1CM9 A;  2EYF A;  2VL6 A;  3DHQ A;  4N8X 1;  2CCZ A;  1FNW A;  2H4O A;  1N8R C;  3QOJ A;  1SE4 A;  2NBF A;  4A3F B;  1SAP A;  1STY A;  4UHV A;  3ZJY C;  3N52 A;  1S5B D;  2MQH A;  4GNX C;  3MC0 B;  1W6J A;  3NBH A;  2JA6 B;  1Y69 U;  3QIA A;  3WWV A;  4KMU C;  1EY8 A;  3GTQ H;  1O7Y A;  4JYA Q;  2L55 A;  1EL0 A;  2OQ0 A;  5BN5 A;  3ND9 A;  5BR8 Q;  5HY6 A;  4F8M A;  1N33 L;  4YHH L;  3BYY B;  2ENB A;  4XYQ A;  4C3H H;  1WTX A;  1VQ7 A;  1N9W A;  4KD3 A;  2F1M A;  1JOO A;  3K80 C;  4KD4 A;  4XT1 B;  3KBG A;  1GVP A;  2A69 C;  4HMJ A;  4QMG A;  1F2L A;  3IFD A;  3GD7 A;  1CKN A;  4PNY A;  2R7Z H;  4DV5 L;  1X55 A;  1SRU A;  2XGT A;  4DR5 Q;  1B9N A;  1IHZ A;  4KHP Q;  1QIL A;  3L0O A;  4DR4 L;  1NR2 A;  4P74 A;  4ILW A;  2VUM H;  1K73 C;  5C6A A;  1HR0 Q;  3VYT A;  3DXJ C;  1XPR A;  4AIM A;  1WYD A;  4FXK C;  2CVR A;  1I50 H;  4JI1 L;  5CV8 A;  4JI7 L;  5JJZ A;  3AB9 A;  3U4V A;  1IYU A;  5G3L D;  3CCE A;  4RHS A;  1N34 Q;  3PO2 H;  1IZ6 A;  1H95 A;  2B2V A;  4P2C B;  3GTK H;  3GTM B;  1LT5 D;  5LMN L;  3NTK A;  1JWU D;  5IT9 c;  3OSO A;  3RZO H;  1FNV A;  2KEN A;  3S14 H;  3JAM L;  3OW7 A;  2L0C A;  2MUY A;  4UDU C;  4DV1 Q;  1C9O A;  2EVB A;  2B2W A;  1W2B A;  4B08 A;  4X64 Q;  3NBH B;  5C5M A;  1BDO A;  2B2T A;  1LTT D;  2PYK A;  4GKK L;  4DAY A;  3FDT A;  2E2J B;  4LFA L;  1PH6 A;  1UEB A;  2EYL A;  1XNR L;  1Q1E A;  3TDQ A;  4NXM L;  3P7J A;  5IY0 A;  3HOV B;  5J22 A;  1E2Z A;  4QIW E;  5CR3 A;  5EPK A;  2UU9 Q;  4L5T A;  2ZXR A;  1V1O A;  4KJO A;  2AKW B;  3GDE A;  2WB1 G;  3ND8 A;  2JA5 H;  1BKB A;  3A8J E;  1L2F A;  1SJH D;  3E9H A;  3D3R A;  1WTW A;  1TWG H;  1KAW A;  4ZKB B;  2SDF A;  4JBK A;  1VQG A;  1CKN B;  3TP8 A;  5IGG A;  3T1Y Q;  1VMP A;  3RZD H;  2QDB A;  4BXX G;  1Y1W B;  3UDG A;  1OO9 B;  3D4R A;  4LFC Q;  4CDC C;  1TR5 A;  3PMF A;  3GTO B;  5K36 H;  1BNZ A;  1I94 Q;  2A68 D;  3MEH A;  1R4Q B;  4UPA A;  1GOZ A;  1SRO A;  4XQQ A;  1PTO F;  3MHB A;  2PQE A;  1SXT A;  4ULL A;  3CKI B;  3CU7 A;  2BH2 A;  1STA A;  3HOY B;  4IQZ A;  2LXK A;  1ENF A;  1QVG A;  1S72 A;  2XWB B;  2L9H A;  4J8Q A;  1K3R A;  2I46 A;  4H02 A;  3PF5 A;  1I4X A;  5IWA Q;  4BWG B;  4APV A;  4QQB X;  3S15 B;  1EY4 A;  1W6K A;  4FO2 A;  4I7Z C;  3TEH B;  1VDZ A;  1JB7 A;  2DUD A;  3OTO L;  1XMQ Q;  2NUC A;  3OWE B;  1FJG Q;  4DAY B;  2D0O A;  1E2W A;  2WKD A;  5IE8 A;  1D5Z C;  3D0F A;  4ID6 A;  4J1M A;  2ZXO A;  4UP8 A;  1Y8O B;  5I6Y A;  2KVM A;  4BY7 H;  2BCO A;  2IWH A;  3TME A;  1QZH A;  3E5S A;  1IXR A;  5GQO A;  3CMA A;  5I9O A;  1EY5 A;  1EEF D;  2B8G A;  3NUC A;  4OHJ A;  2HT1 A;  5CC4 A;  2A69 D;  4XXE A;  3JAM E;  2MGS A;  5JVH 3;  3CCL A;  4KV6 A;  2N55 A;  3T51 B;  2YV5 A;  4A3K G;  3S16 B;  2ZT9 C;  3URY A;  1J5E Q;  2OWO A;  5J39 A;  5LHY 1;  4HIK A;  3HEJ A;  5CV4 A;  3GTP H;  5IYC G;  4IZ8 A;  2CW0 D;  4B3T Q;  4DXG A;  1XYI A;  1HZA A;  3BG3 A;  4GN3 B;  2FJ2 A;  2NVT B;  1PH2 A;  4GKJ Q;  3GP7 A;  3S2D B;  4JI3 L;  3K6O A;  4JV5 Q;  1K28 A;  2WV6 D;  3GTG B;  1D7Q A;  4R4Q A;  5GAD C;  4DR3 L;  1A8V A;  4CDD C;  5IGE A;  2ATW A;  1NBW A;  5IGB A;  3I70 A;  4A3J B;  4C3J B;  3NQI A;  1GUN A;  2E5L L;  3J80 L;  2M9V A;  3BYT B;  4H13 C;  3H94 A;  1K8G A;  1H9K A;  1BOS A;  1P16 A;  1OXS C;  4WFN 3;  1B3Q A;  1EYC A;  1SLJ A;  2N88 A;  4R8I A;  1MJC A;  2KA7 A;  2JEA I;  1PZJ D;  2HHH Q;  4LFB L;  3BDC A;  1L1O C;  4LF4 L;  1X6O A;  2CQO A;  5I9P A;  4KY5 A;  2CFM A;  1LTL A;  3CAM A;  1GXD C;  2LXJ A;  2CWA A;  4YCW A;  3HKZ G;  4AH6 A;  4G7H C;  4QY7 A;  3K7A B;  2KEE A;  2OT2 A;  5AFW A;  2NN6 I;  4DAM A;  2R93 H;  1I4G A;  4HMI A;  4QUF A;  2RDF A;  4L8J A;  4A3E G;  1BCP D;  1WD1 A;  1VQH A;  3VA7 A;  3ER0 A;  4A3B G;  4DV4 Q;  4CKC A;  3HOU G;  3LWE A;  4I65 A;  3F2C A;  4A3D G;  5AJ3 Q;  3UE1 A;  4AQY Q;  2ZJR A;  2UUA Q;  1DM0 B;  3QB3 A;  2EOT A;  2IX1 A;  1B50 A;  3H0G G;  1DJR D;  4ZRZ A;  1BXT A;  1RJT A;  2K6A A;  3T16 A;  4GOP A;  3H3V I;  3GTJ B;  1EOT A;  4DR7 L;  2Z6K A;  1PYB A;  3RNU A;  3STB D;  3PF4 A;  4KTA A;  1AFP A;  1I3Q B;  3CXC A;  4BXX H;  1TWA H;  4B9X A;  5FKA C;  3R2T A;  1KNE A;  1S5C D;  1EZ6 A;  5FK9 C;  4DV7 Q;  4RGM A;  2NTT A;  1EY6 A;  1QCB D;  4UP9 A;  5KIX A;  2QEX A;  3ONA B;  1L0Y B;  1K0S A;  3M3Y B;  2R7D A;  4OL7 A;  1GM5 A;  3C3L A;  4WJ4 A;  1CSP A;  1YVC A;  4OWW B;  1AN8 A;  3TZD A;  5IOC A;  2SNS A;  1D5M C;  2MFI A;  1G6P A;  3LX0 A;  4IJH A;  1HNZ Q;  4DV3 Q;  5HUR A;  2CH4 A;  1K0R A;  3I3C A;  3TRZ A;  4DNT B;  4HID A;  3M9B A;  4LMQ D;  3HOX B;  3NEN A;  4DV0 Q;  2KUM A;  2K1B A;  3J80 E;  2A74 C;  4A3L G;  2UUC L;  1EWC A;  2QCP X;  3GTL B;  3Q23 A;  5M3M B;  1C0A A;  5JOB A;  5CV6 A;  4B3S L;  3LWU A;  4JCV E;  4X62 Q;  1EEI D;  3VDY A;  3AYH B;  2E8G A;  4WOR A;  2YTY A;  2XNA C;  4DUZ L;  3HOZ G;  1LAB A;  2JK8 A;  3I73 A;  1TWH B;  1VQP A;  3DUZ A;  2VB3 X;  4HSV A;  4UAI A;  4GOP B;  1A3V A;  3S1Q B;  1I6H B;  2KBN A;  5IGD A;  4DR1 Q;  5JJK A;  4NW2 A;  3OIQ A;  1QUQ A;  3BZD B;  4GNX A;  1IBK Q;  3KJP A;  3T56 B;  4BY1 B;  1VF5 C;  3I72 A;  4RAU C;  4YCV A;  1EQV A;  3K8A A;  1LTB D;  4K8J A;  5D14 A;  1YEZ A;  2K75 A;  1X3E A;  1PH7 A;  4JBM A;  4YY3 Q;  4LF6 Q;  3I4M G;  1QVC A;  3EQL C;  3I4N G;  1BO0 A;  2RKS A;  3NWT A;  3UDF A;  5BN3 A;  4LJZ C;  2VQF Q;  4CGY B;  4N8F A;  3CCQ A;  3BDO A;  1N36 L;  1NE3 A;  1TWF H;  4XIG S;  2K04 A;  4G7Z C;  4DK1 A;  1ENC A;  2B3G A;  2MP1 A;  5KRU A;  4A3C G;  3HOW G;  3E3X A;  1K83 H;  2NVQ H;  2O2L D;  2C35 B;  4R4C A;  2YYZ A;  1PA6 A;  4XQJ A;  4JI4 L;  1B3A A;  3M7G A;  4NMZ A;  1YJW A;  3W1B A;  2R7Z B;  2PZW A;  2F0W A;  1DOK A;  4MTN A;  4TVA B;  5CGK A;  4WJW A;  4XQN A;  1WCM B;  1XMO L;  1KIX A;  4GN4 B;  4RGN A;  1FNU A;  3PGZ A;  4QIW B;  3S1M H;  5C4X B;  5CBA E;  1YHA A;  1RTO A;  1N33 Q;  1PHJ A;  4A3E H;  3L7Z C;  4YHH Q;  2PW7 A;  5FO7 B;  1AZP A;  4JBJ A;  1OXU A;  2IHE A;  3CME A;  4A3B H;  3MFY A;  3U4Z A;  1HXY D;  1JJC B;  4HN7 A;  4RWS C;  5T1I A;  4TKO B;  4TQU S;  5JJL A;  2B29 A;  4A3D H;  1QUQ B;  1SNM A;  4GNX B;  3TQY A;  5C3E B;  3RUZ A;  4A93 H;  4C3H G;  1XJV A;  3H0G H;  4IUN A;  5EGT A;  5JJI A;  4FNF A;  3QR8 A;  4N9P A;  4MZ9 A;  4A3I B;  3MTS A;  5CMD A;  4DA2 A;  4RG1 A;  1JJ2 A;  2J7Z A;  2IY5 B;  4K6D A;  3ULP A;  4KJN A;  3U50 C;  4DR4 Q;  1PZI D;  3K81 C;  1PTO B;  3JAM c;  3J81 L;  1F2Y A;  2WKC A;  3G48 A;  2I0Q A;  2PQA A;  3E6Z X;  3KBX A;  4JI1 Q;  4JI7 Q;  3K5O A;  2RCN A;  5M3F G;  1HRJ A;  4C2M H;  4YWL A;  4MTK A;  2QGQ A;  1SYC A;  3MXP A;  4R4T A;  1HHV A;  2KCT A;  2R92 B;  4IO9 A;  5LMN Q;  1Z6H A;  1S5D D;  5FLM G;  3I55 A;  4H0L C;  2K14 A;  4PG3 A;  2NB0 A;  4J6H A;  1BUV T;  1C48 A;  2EY5 A;  4A3M B;  2JA7 H;  4JVZ A;  5LMU L;  1IBL L;  1F9S A;  1EOV A;  2H5X A;  1YNJ D;  4RGO S;  4L5S A;  4GKK Q;  1JCK B;  4LFA Q;  1YHQ A;  3M4O B;  4NP5 A;  5I2X A;  2AWO A;  1WTQ A;  1Q82 C;  4A3L H;  5A2Q L;  4NXM Q;  2Z1C A;  3FKI B;  3QJY A;  1PH4 A;  2OEO A;  3KLS A;  4Y7N H;  4MIU A;  2J0T D;  3S2H H;  4GLA C;  4F7X A;  3G71 A;  1A63 A;  4RKL A;  4LF7 Q;  4BBR B;  1VQ4 A;  4DU9 A;  2IL8 A;  3SVM A;  3HOZ H;  3PO3 B;  1EU4 A;  2ZM6 L;  3P75 A;  2LKV A;  4DK6 C;  2I5H A;  3KJO A;  5CYU A;  4C56 C;  3OWF A;  2F0M A;  5EPL A;  4R4I A;  2KED A;  3I7F A;  4N9T A;  5ELE A;  2DY7 A;  3D4W A;  3ITP A;  3BVM A;  1PMR A;  4FF3 A;  1XNQ L;  2EYO A;  4ZK9 B;  3GTQ B;  3IRB A;  1L0W A;  3CC7 A;  4AYB E;  3A5Z B;  1T9H A;  1ILQ A;  3HKS A;  2PQA B;  1IBM L;  1JE4 A;  2PPB C;  5K36 G;  4OIK A;  1Y1V B;  2EE1 A;  2SNM A;  1X3Q A;  1KXL A;  4DR2 L;  3SK6 A;  1PFS A;  3L2P A;  1IKM A;  2L5T A;  5E1F A;  1WTH A;  4OEL B;  1WD0 A;  4E6I A;  2Q2U A;  1Q7Y C;  5JVG 3;  3GV3 A;  3I4N H;  3JC6 6;  3A7L A;  3ULJ A;  1BVS A;  4NB3 A;  3PQI A;  3RLO A;  4ZYS A;  2Q2T A;  5C44 B;  2A68 C;  3OTO Q;  3JAM i;  3J81 E;  1WJJ A;  3UE0 A;  1BR9 A;  2ZTD A;  3S17 H;  2I5M X;  4B3M L;  4KN4 C;  1HNX Q;  3M4Y A;  1KAA A;  2Z4I A;  1EQT A;  1EYD A;  3I4O A;  3CC4 A;  1IL2 A;  2JA8 B;  1HA6 A;  1HZC A;  3CHB D;  4C1N K;  3Q8D A;  1RHP A;  2KJX A;  1I50 B;  5EPJ A;  1LM0 A;  2E74 C;  3MA2 B;  3S9W A;  1E24 A;  1KL9 A;  1HZ9 A;  5KEE A;  1YZ6 A;  4IFD J;  4RGT A;  1X3P A;  4C3I H;  3WOF A;  1A3U A;  1PXU A;  4BY7 G;  2KCN A;  1L1O A;  3S1N B;  2F0U A;  3TRE A;  3AFQ A;  1E7Z A;  4O42 A;  1B70 B;  1O80 A;  3QG1 A;  4RH6 A;  1OTC A;  2F0Q A;  2G5D A;  4POG A;  1LT3 D;  3U9O A;  3J80 c;  1AE3 A;  1EFI D;  1HUM A;  2NN6 H;  5A2Q E;  3HOV G;  1G51 A;  1NSN S;  3J81 j;  2F0V A;  2F03 A;  1YI2 A;  2SEB D;  4JI3 Q;  1VQE A;  1Y8N B;  3MXU A;  1SFO B;  4RKB A;  1B7Y B;  4A4I A;  1FGU A;  4FVM A;  3CCM A;  2ZTC A;  3D4D A;  4DR3 Q;  5DNF A;  4X3S A;  3G4S A;  3PV0 A;  1O7I A;  2EJM A;  4WRD A;  2E5L Q;  3H3V H;  2CW0 C;  4IUR A;  4LK1 C;  4P71 A;  2R6G A;  1Q81 C;  4JI5 L;  1KDB A;  5FO9 B;  5C0X I;  1II3 A;  1VCI A;  1B2T A;  1X3G A;  1O7L A;  5M3F H;  2VQE L;  4LFB Q;  2A6H C;  4K2K A;  2EIF A;  4OXP A;  2F0E A;  4QB4 A;  2F4I A;  1CA6 A;  4LF4 Q;  3TS2 A;  2UXB L;  4EGV A;  1T5X D;  3HGB A;  2XVS A;  5FLM H;  3T1H L;  4G57 A;  2UXC L;  1HCZ A;  1BBW A;  1I4R A;  2OQK A;  1IYJ B;  4DK0 A;  3I4L A;  5M5W H;  1PRT D;  4LW1 A;  5M5X H;  3CC2 A;  1LV9 A;  3HRZ C;  1L1O B;  1HTL D;  2WII B;  4G4K A;  2IX3 A;  1DOL A;  1Y14 B;  4KY7 A;  3AMU A;  5E4X A;  2R93 G;  1OXV A;  3NWS A;  3CCR A;  1ML0 D;  1Q8I A;  3QOL A;  4KK7 A;  1HUN A;  3EBE A;  1XPO A;  2XIW A;  2ALY B;  4K2L A;  1YBY A;  4PV1 C;  3PUV A;  1A2T A;  1GHK A;  2JA6 H;  1SYB A;  3SK5 A;  4DR7 Q;  1ILP A;  1STG A;  3MVV A;  5EAY A;  1BCP C;  3KF8 A;  1EYG A;  1UUP A;  4JK1 C;  1ZXT A;  1Y8P B;  2JEB I;  4A3G B;  2RVL A;  5FJ8 G;  3K57 A;  1G91 A;  2EYJ A;  4OGQ C;  2F0G A;  2IHF A;  1YJ9 A;  2PO4 A;  1F77 A;  1TT2 A;  4OX9 L;  1VQL A;  1KRS A;  4UP7 A;  2E2D C;  3SK4 A;  5IGF A;  4YWK A;  4HAE A;  3NXW A;  4X3U A;  4V19 0;  3W1G A;  4L6T B;  1RCV D;  1G8Z D;  4DXF A;  2HCI A;  3STB C;  4JC0 A;  1KRT A;  3G6E A;  4PZ7 A;  4ZAI A;  4DGZ A;  3J7A V;  1V9P A;  4FXD A;  1S40 A;  2OCE A;  4DUY L;  2BDO A;  2UUC Q;  1IKL A;  4KI0 A;  3K5L A;  1LTS D;  3PIO 3;  1DOM A;  1EIG A;  4DNR B;  4F87 A;  2AUJ D;  1VQA A;  2DJF C;  2K5Q A;  4DUZ Q;  1B8A A;  1FGB D;  3GTM H;  4H7B A;  2GA4 B;  3PIO A;  2HDM A;  3BJU A;  4JI8 Q;  4Q0F A;  2CQA A;  4LF5 L;  1K8M A;  4CJ0 B;  5TSS A;  2A8V A;  2K5N A;  3F1Z A;  2A6E C;  5DEH A;  2D5D A;  3EA6 A;  3ZYY X;  1N32 L;  4DAP A;  1YJN A;  3SR1 A;  3PUW A;  4DK3 C;  3KK7 A;  1GUT A;  3KF8 B;  2AQ3 B;  2UXD Q;  3K0Y A;  1PH5 A;  4DR6 L;  1JQY D;  1CQV A;  3TP5 A;  3HOV H;  3RLF A;  5COY A;  1KLU D;  1DGS A;  4GZY C;  2F3I A;  4OEM B;  3RMH A;  3EN2 A;  2PNH A;  5ELO A;  1OXT A;  5K5P A;  4XYO A;  1GUS A;  1T5E A;  4HJ9 A;  3DWP A;  2RSO A;  2WAQ G;  2A6H D;  2PCF B;  1RF2 D;  2Y0S G;  4HCE A;  3PCO B;  4Q5V A;  2HIV A;  1LYL A;  1P8L A;  1N36 Q;  4LUV A;  4X66 Q;  4LF8 L;  2WB1 B;  5KND A;  4K0K L;  3GTO H;  1VQ9 A;  1V1Q A;  1EWH A;  3SGI A;  5D65 A;  4ZLT F;  2ES2 A;  1LTA D;  2K01 A;  1L0X B;  3A74 A;  2EPB A;  1TS3 A;  3CCU A;  4JI4 Q;  1KHI A;  2F3V A;  3HOY H;  3UI2 A;  5EKL A;  5IP9 G;  5C0X G;  2K7V A;  1X65 A;  1SR3 A;  1KAB A;  1XMO Q;  3BVG A;  3D8G A;  4UY8 C;  1VQB A;  2F0D A;  4CKE A;  5KNC A;  1BBU A;  5D3D A;  2N3S A;  4JPB W;  2E2H B;  5KGU A;  1LTI D;  1SYG A;  2JSO A;  3TN2 A;  1M4V A;  1AP0 A;  4O1N A;  3HG9 A;  3NTH A;  3GO5 A;  5M3M G;  1JE5 A;  1PLF A;  3J81 c;  1YIT A;  3OW2 A;  3KF6 A;  3R3O A;  4K8I A;  2B63 B;  4EQ5 A;  3T13 A;  2AMC B;  3FP9 A;  4ZKC B;  4Y52 H;  3CRK C;  4FF2 A;  5C4H A;  1H9R A;  5ELD A;  2D9U A;  4AYB B;  1TVX A;  4A93 G;  1STN A;  1U0L A;  2BE5 C;  1B53 A;  3A7A B;  3QO2 A;  4K5W A;  4FXG C;  2GVA A;  3RLN A;  1STE A;  1QNU A;  3TBI B;  1VQI A;  4NKL A;  1ROD A;  3MXG A;  3S16 H;  3CQZ B;  2C9O A;  1HJP A;  5JEA G;  3MEF A;  3CPF A;  1LUZ A;  1O7Z A;  4NDX A;  4BY1 G;  1G29 1;  4ZUJ A;  5FJ8 H;  1E0B A;  4DN4 M;  1H9J A;  1B44 D;  2NVT H;  4ME3 A;  3SXH A;  1GD7 A;  4A3K B;  1Z9F A;  3VR2 A;  5HGQ A;  1F2Z A;  3GTG H;  3VA5 A;  2GVB A;  4RA8 A;  2QEJ C;  1YNX A;  2KHI A;  5LMU Q;  2JYO A;  1TY2 A;  1IW7 C;  1ENA A;  1IBL Q;  4A3J H;  1ICF B;  1QZG A;  3G7L A;  1M1K C;  1NJI C;  3KUP A;  4RFB A;  1W3S A;  2JA7 G;  2K28 A;  1CKO A;  1TU2 B;  4EQN A;  1ONL A;  4IPC A;  2A6E D;  2RDG A;  4DF7 A;  1I5F A;  1SNP A;  1LT4 D;  4HJ8 A;  2HUG A;  3KF6 B;  1EY9 A;  2ZM6 Q;  5IP7 G;  2RBM A;  3U9S A;  3PUZ A;  1PV4 A;  5COR A;  1G6Z A;  2Q8T A;  3SEB A;  1YNJ C;  3K7A H;  1WTO A;  3V2T A;  5DM7 3;  3D31 A;  5KYL A;  5M5Y B;  2OTJ A;  2FFK B;  2ASB A;  2DN8 A;  3FMC A;  3A55 A;  3S1M B;  3HKZ B;  3S24 A;  3CCJ A;  4X65 L;  3H91 A;  3J81 i;  3NHH A;  4DFA A;  4DR2 Q;  1CZW A;  5JPM C;  3N6R A;  3HOU B;  1RL2 A;  1E1T A;  2I5L X;  3EFX D;  4A3D B;  2ZTE A;  1E2V A;  4NXN Q;  5CBE E;  1B1Z A;  3CW2 C;  3KLW A;  1O78 A;  1FYC A;  2OXP A;  3H0G B;  3IL8 A;  1I3Q H;  3A8K E;  1JWM D;  2UUB L;  3S1R B;  3PIP A;  2P5Z X;  5DAU A;  4B3M Q;  4JI2 L;  3CF5 A;  1R9T B;  2D2C C;  3M3Y H;  4JBW A;  1FL0 A;  1J5E L;  4BBS B;  5IP9 H;  5C0X H;  2LFN A;  1CSQ A;  3MZ5 A;  2E2I B;  1SDF A;  4EQP A;  2XWJ B;  2PZU A;  2QF7 A;  3J7Y W;  2Z0S A;  5I4D A;  3WOE A;  5NUC A;  3HOX H;  3NK9 A;  1VQ5 A;  1C7Y A;  1ET6 A;  3CRL C;  1QJO A;  4X3T A;  4C3I G;  1EY0 A;  3ICE A;  2FIN B;  5E3F A;  2ZJQ A;  3TZU A;  3GTL H;  5M3M H;  2NVX H;  2BE5 D;  2YTX A;  5C3W A;  2F0I A;  2XRS D;  4HJ7 A;  3R2I A;  3QWN A;  2EY6 A;  1CZG A;  1PFN A;  2VS1 A;  1SND A;  2NN6 G;  1TWH H;  1EQQ A;  1ASZ A;  2Z6B A;  2F52 A;  3S1Q H;  1CK1 A;  3IAY A;  4DV5 Q;  4YIJ A;  5JEA H;  1KQS A;  1HPC A;  1Q46 A;  1TS2 A;  3V05 A;  2F0H A;  2L15 A;  1BF4 A;  1WVL A;  4BY1 H;  4F88 A;  2HQL A;  4L63 B;  2V1C C;  1CT1 D;  1M8A A;  5H1S E;  4K5V A;  2KHJ A;  2VQE Q;  2EYM A;  1IW7 D;  5DLQ E;  3IFT A;  3FPU B;  3J7A F;  2B2Y C;  4KKU A;  3KOJ A;  2G9D A;  2E76 C;  2UXB Q;  1JIC A;  1MD2 D;  3OHX C;  3T1H Q;  2EQS A;  2UXC Q;  4P72 A;  1EIY B;  1HFN A;  1RD9 D;  4J15 A;  5C4J B;  4RCO A;  1MKH A;  2L12 A;  1QNK A;  1KDA A;  2WB1 E;  1MI2 A;  4IUP A;  1NR4 A;  5C44 G;  3U58 A;  3I4M B;  2KQ3 A;  1RDP D;  3NQT A;  1XXG A;  1CHQ D;  3I4N B;  2EZV A;  4DNI A;  1TWC H;  3O13 A;  4HIM A;  2LMC B;  3SE0 A;  2HIX A;  2Z4H A;  1MSH A;  1XNR Q;  2V4D A;  1V1P A;  2JA8 G;  2PMZ E;  4P75 A;  1C4Q A;  5EQ0 A;  2F0T A;  2ICI A; 
#chains in the Genus database with same CATH homology
 1D2B A;  1XX8 A;  4EVO A;  1PDQ A;  4K5X A;  1ZKO A;  3HOW B;  4ODG A;  1PRT C;  4FYD A;  2KOL A;  3VR3 A;  3FPP A;  2KEC A;  1QOH A;  1KTK A;  3DWA A;  1QE6 A;  3SHL A;  1A6X A;  1KNA A;  1U9R A;  1Q3L A;  4KY6 A;  1LTG D;  1JWS D;  1Z7T A;  1BCP B;  5ISR A;  2TSS A;  1EIH A;  1HQM C;  5C3X A;  1QB5 D;  4C3H B;  1SJE D;  3OPO A;  3NTI A;  1PTO H;  3NSW A;  4K6L A;  4OO1 I;  1DON A;  5EBD A;  1TQO A;  2F0F A;  2WP8 J;  1SEB D;  2XSC A;  1V1P B;  2VUM B;  4KN7 C;  2K5W A;  2M2L A;  3X3M A;  2F0P A;  1XTC D;  5EJW A;  5FO8 B;  2X6G A;  3PO2 B;  2WIN B;  4PQX A;  2K33 A;  1X32 A;  3GTK B;  2EY2 A;  1S5E D;  5T1G A;  5M5W B;  1V8Q A;  3RZO B;  5M5X B;  2OF1 A;  1HQR D;  3S14 B;  5F2D A;  5G3L F;  5HGT A;  1SYD A;  1OXX K;  5EKI A;  3WDN A;  2TMP A;  1HA5 A;  1PRT F;  1WTR A;  1SYF A;  5C5L A;  1AW7 A;  5IIF A;  5KNB A;  3TP6 A;  3VR5 A;  5EBC A;  2JA5 B;  1TWG B;  1SNC A;  1H9M A;  4ME5 A;  3RZD B;  1PTO C;  4BA1 I;  4C1N I;  3Q6S A;  1JR0 D;  2NWG A;  4CBV A;  1UAP A;  1EZ8 A;  2EXZ A;  1YNN C;  5FLX L;  2M00 A;  1S5F D;  1VF7 A;  1QWY A;  2IW3 A;  3R8B A;  3V96 A;  3BS1 A;  1F9R A;  2AQ1 B;  3TSS A;  3FEW X;  1RKN A;  1Q1B A;  2EDG A;  4MHE A;  1F9P A;  2RQX A;  2A73 B;  1U4L A;  4BY7 B;  3C46 A;  2DY8 A;  4IUU A;  3VYU A;  1WTP A;  2L1B A;  5ELC A;  2VB2 X;  4RCN A;  3M85 A;  5JPN C;  3TP7 A;  3DEP A;  2PW5 A;  3GTP B;  1GHJ A;  1D1K A;  1G2S A;  1F2M A;  4M1U B;  3H3V C;  3VR6 A;  3PUX A;  3NP8 A;  2K32 A;  3FVQ A;  4PMW A;  4C3J G;  3AU7 A;  3T4A C;  1C8C A;  1STH A;  2IT1 A;  1QG7 A;  2EJF C;  2FMM A;  4OO1 G;  1SMY D;  4U67 3;  1S4Z A;  1JB3 A;  2K03 A;  3E0J A;  4IAL A;  1ESR A;  2L4N A;  4QCL A;  2F0S A;  1GUO A;  4FF4 A;  1CHP D;  5ELF A;  3BVZ A;  4IFD I;  5FLX E;  4U68 A;  2HQE A;  2NYZ D;  2L11 A;  1Q90 A;  1RTN A;  1SSO A;  3DM1 A;  1R4P B;  3G6J B;  5BN4 A;  1A2U A;  2R93 B;  2ID0 A;  1D6E C;  2F0J A;  1MBY A;  1B4O A;  4ZQ3 A;  4IN3 A;  2Q8I B;  2IX0 A;  1ZEQ X;  2O5I C;  1PTO D;  3ERQ A;  4IUV A;  1CFM A;  1BCP F;  2MHV A;  5E4W C;  5KYI A;  2CHB D;  2F0N A;  2HCC A;  2B2U C;  2JE6 I;  1YNN D;  1TY0 A;  1Q12 A;  1TWA B;  2FMC A;  3C1F A;  1ICW A;  1Z47 A;  2PMZ B;  2B2Y A;  2MPM A;  1I4H A;  1LT6 D;  3MFG A;  3D6C A;  4EQO A;  1LTR D;  2RDH A;  1TKW B;  1DZ1 A;  2A5H A;  3T53 B;  1LAC A;  5A35 A;  5C4Z A;  1UNS A;  2F0O A;  2O4X A;  1TS5 A;  3A56 A;  3I91 A;  1CA5 A;  1JOK A;  3FRP B;  1BQQ T;  1CTM A;  3X3N A;  1HFG A;  4H44 C;  4XT3 B;  2D62 A;  2JP1 A;  4XDX A;  4V0B A;  2XN9 C;  1PFM A;  1AEX A;  4B9W A;  1XWE A;  1SBB B;  5IOD A;  4G7O C;  4RHR A;  5IT9 L;  5J1Z A;  1KDC A;  2WAQ B;  1SE2 A;  4K14 A;  3PUY A;  2Y0S B;  1H9S A;  5IGC A;  4XTC S;  5EKK A;  1EY7 A;  1JOR A;  1ZYR C;  4OO1 H;  1LO5 D;  5LL6 X;  1FD7 D;  2BOS A;  1GUW A;  1PZK D;  1TWF B;  2B2V C;  3LNN A;  2H1E A;  3H09 A;  1K83 B;  2C5C A;  2B39 A;  3A8I E;  5LL6 S;  2NVQ B;  2B2W C;  5DM6 3;  3L9A X;  2IJ0 A;  2B2T C;  5D3I B;  2F0K A;  2F3W A;  2HDL A;  4S3S A;  1SNO A;  4IFD G;  1ESF A;  1PRT B;  1V43 A;  2NVX B;  4X3K A;  4ABN A;  2I07 B;  1A15 A;  2AWN A;  4A3E B;  1SNQ A;  1NCV A;  4KKS A;  1EU3 A;  2NTS A;  3K5N A;  2KCC A;  4A3B B;  1UEA B;  3R93 A;  1AZQ A;  4R8N A;  4CJ2 C;  2BDN A;  4M8A A;  4OIJ A;  2QIL A;  4A93 B;  2NZ1 D;  3PIP 3;  2EYP A;  3P20 A;  2PZT A;  1KLG D;  1DXM A;  3VYS A;  2BA1 A;  1U4M A;  3VYR A;  3M7N A;  1NUC A;  3KLS X;  1PYW D;  4IUT A;  1H9S B;  2E75 C;  2G9H D;  1MSG A;  4FP5 D;  2AUK A;  3OMG A;  3GQB A;  1CQF A;  2QKI C;  4HTH A;  3DMU A;  3SDZ A;  5ELB A;  4C2M B;  5M9O A;  1B9M A;  3GV6 A;  5IT9 E;  4TSS A;  1WTV A;  1IL8 A;  4KHZ A;  4HR7 B;  3HS0 C;  2JA7 B;  1D1I A;  1TWC B;  4R9W A;  4KKT A;  1FR3 A;  1SYE A;  3MXN A;  3K59 A;  3W2D A;  2LS0 1;  4TRD A;  3SK8 A;  4Z9C B;  2XRQ D;  1PFB A;  4KHV A;  4Y7N B;  3C1E A;  3S2H B;  3H6M A;  3I8Z A;  1GJX A;  3HOZ B;  2F0L A;  3MAQ A;  1SE3 A;  2O5J C;  4QF4 A;  4HCS A;  5JAV A;  5CV9 A;  2Q8R E;  4DAV A;  1MGS A;  1I4P A;  2RA4 A;  1ZYR D;  3NBI A;  1F9Q A;  5I2Y A;  3P1H A;  3W3A A;  3MWY W;  3OOC A;  5C0X J;  2VNU D;  1ET9 A;  4FF1 A;  1K8O A;  2ICE C;  3IKJ A;  3D6W A;  2LY7 A;  3NE5 B;  3RD4 A;  1DYQ A;  2R61 A;  3OIP A;  3S17 B;  1VMC A;  4LAA A;  1EYA A;  4HED A;  4MN3 A;  2IPK D;  2MJ8 A;  2J4X A;  2AQ2 B;  3HP3 A;  2BA0 A;  4CKB A;  2FHT A;  2VXW A;  3EJI A;  2JXM B;  4C3I B;  3I90 A;  4IFD H;  1I6V C;  3EVQ A;  1BBX C;  2SOB A;  1TII D;  4PMC A;  4BA2 I;  2EYH A;  2EY1 A;  5CV5 A;  5JEA J;  1D5X C;  1NAP A;  3C2P A;  2Z8L A;  2PNR C;  1U4P A;  2RSN A;  2NVY B;  1J8I A;  1U4R A;  3VR4 A;  5I6W A;  1HTP A;  3Q24 A;  3A54 A;  2WAC A;  3DWQ A;  2YU9 B;  4CHT B;  2K5D A;  5FOB B;  1JOQ A;  3ERO A;  1I4Q A;  3L3O C;  3DEO A;  4CJ1 B;  3BDL A;  2KHS A;  2K05 A;  2EJG C;  4PMB A;  4BS9 A;  1CI3 M;  3K58 A;  2B2U A;  5M3F B;  5CV7 A;  3K5M A;  1LLR D;  2ZXP A;  4HSP A;  3NPP A;  3Q22 A;  2B8F A;  2DNE A;  3Q0A A;  1DD2 A;  1IYV A;  1SMY C;  4IUQ A;  2X69 A;  1G2T A;  3KLR A;  1STB A;  2DNC A;  4QUC A;  1TS4 A;  3OMC A;  1A3T A;  4ZUI A;  1DCZ A;  3F2U A;  3HZX A;  1J9O A;  1JC7 A;  2X6L A;  2R3Z A;  1GUG A;  1CM9 A;  2EYF A;  3DHQ A;  1FNW A;  2H4O A;  3QOJ A;  1SE4 A;  2NBF A;  4A3F B;  1SAP A;  1STY A;  3N52 A;  1S5B D;  3MC0 B;  1W6J A;  3NBH A;  2JA6 B;  1Y69 U;  3QIA A;  4KMU C;  1EY8 A;  1O7Y A;  2L55 A;  1EL0 A;  5BN5 A;  3ND9 A;  4F8M A;  3BYY B;  2ENB A;  4XYQ A;  1WTX A;  4KD3 A;  2F1M A;  1JOO A;  4KD4 A;  4XT1 B;  3KBG A;  2A69 C;  4HMJ A;  4QMG A;  1F2L A;  3IFD A;  3GD7 A;  4PNY A;  1B9N A;  1IHZ A;  1QIL A;  1NR2 A;  4ILW A;  5C6A A;  3VYT A;  3DXJ C;  4FXK C;  2CVR A;  5CV8 A;  5JJZ A;  3AB9 A;  1IYU A;  5G3L D;  4RHS A;  2B2V A;  4P2C B;  3GTM B;  1LT5 D;  3NTK A;  1JWU D;  3OSO A;  1FNV A;  3JAM L;  3OW7 A;  2L0C A;  2MUY A;  4UDU C;  2EVB A;  2B2W A;  4B08 A;  5C5M A;  1BDO A;  2B2T A;  1LTT D;  2PYK A;  4DAY A;  3FDT A;  2E2J B;  2EYL A;  1Q1E A;  3TDQ A;  3P7J A;  3HOV B;  5J22 A;  1E2Z A;  5CR3 A;  5EPK A;  2ZXR A;  1V1O A;  4KJO A;  3ND8 A;  3A8J E;  1SJH D;  1WTW A;  3D3R A;  4ZKB B;  2SDF A;  3TP8 A;  5IGG A;  1VMP A;  2QDB A;  1Y1W B;  1OO9 B;  3D4R A;  1TR5 A;  3PMF A;  3GTO B;  5K36 H;  1BNZ A;  2A68 D;  3MEH A;  1R4Q B;  1GOZ A;  4XQQ A;  1PTO F;  3MHB A;  2PQE A;  1SXT A;  4ULL A;  3CKI B;  3CU7 A;  1STA A;  3HOY B;  4IQZ A;  1ENF A;  2XWB B;  2L9H A;  4J8Q A;  2I46 A;  1I4X A;  4BWG B;  3S15 B;  1EY4 A;  1W6K A;  4FO2 A;  4I7Z C;  1VDZ A;  2NUC A;  3OWE B;  1E2W A;  2WKD A;  1D5Z C;  4J1M A;  4ID6 A;  2ZXO A;  1Y8O B;  5I6Y A;  2KVM A;  2BCO A;  2IWH A;  3TME A;  3E5S A;  5I9O A;  1EY5 A;  1EEF D;  2B8G A;  3NUC A;  4OHJ A;  5CC4 A;  2A69 D;  4XXE A;  3JAM E;  2MGS A;  5JVH 3;  4KV6 A;  2N55 A;  3T51 B;  3S16 B;  2ZT9 C;  3URY A;  5J39 A;  5LHY 1;  3HEJ A;  5CV4 A;  4IZ8 A;  2CW0 D;  4DXG A;  1XYI A;  3BG3 A;  2FJ2 A;  2NVT B;  3GP7 A;  3S2D B;  3K6O A;  2WV6 D;  3GTG B;  5IGE A;  5IGB A;  3I70 A;  4A3J B;  4C3J B;  3NQI A;  1GUN A;  3J80 L;  2M9V A;  3BYT B;  4H13 C;  3H94 A;  1H9K A;  1BOS A;  1OXS C;  4WFN 3;  1EYC A;  2N88 A;  4R8I A;  2KA7 A;  2JEA I;  1PZJ D;  3BDC A;  5I9P A;  4KY5 A;  1GXD C;  4G7H C;  3K7A B;  2KEE A;  2OT2 A;  5AFW A;  2NN6 I;  1I4G A;  4HMI A;  4QUF A;  2RDF A;  4L8J A;  1BCP D;  1WD1 A;  3VA7 A;  4CKC A;  3LWE A;  4I65 A;  1DM0 B;  3QB3 A;  2EOT A;  2IX1 A;  1B50 A;  1DJR D;  4ZRZ A;  1BXT A;  1RJT A;  2K6A A;  3T16 A;  3GTJ B;  1EOT A;  4KTA A;  1AFP A;  1I3Q B;  4B9X A;  5FKA C;  3R2T A;  1KNE A;  1S5C D;  1EZ6 A;  5FK9 C;  4RGM A;  2NTT A;  1EY6 A;  1QCB D;  5KIX A;  3ONA B;  1L0Y B;  3M3Y B;  4OL7 A;  3C3L A;  1AN8 A;  3TZD A;  5IOC A;  2SNS A;  1D5M C;  3LX0 A;  5HUR A;  3I3C A;  4DNT B;  4LMQ D;  3HOX B;  2KUM A;  2K1B A;  3J80 E;  2A74 C;  1EWC A;  2QCP X;  3GTL B;  3Q23 A;  5M3M B;  5JOB A;  5CV6 A;  3LWU A;  1EEI D;  4WOR A;  2XNA C;  1LAB A;  3I73 A;  1TWH B;  3DUZ A;  2VB3 X;  4HSV A;  4UAI A;  1A3V A;  3S1Q B;  1I6H B;  5IGD A;  4NW2 A;  3OIQ A;  3BZD B;  3T56 B;  4BY1 B;  1VF5 C;  3I72 A;  4RAU C;  1EQV A;  1LTB D;  4K8J A;  5D14 A;  3EQL C;  1BO0 A;  2RKS A;  3NWT A;  5BN3 A;  4LJZ C;  4CGY B;  3BDO A;  4XIG S;  2K04 A;  4G7Z C;  4DK1 A;  1ENC A;  2MP1 A;  5KRU A;  2O2L D;  2YYZ A;  4XQJ A;  1B3A A;  3M7G A;  4NMZ A;  2R7Z B;  2PZW A;  2F0W A;  1DOK A;  5CGK A;  4WJW A;  4XQN A;  1WCM B;  4RGN A;  1FNU A;  4QIW B;  5C4X B;  5CBA E;  1RTO A;  3L7Z C;  2PW7 A;  5FO7 B;  1AZP A;  1OXU A;  3MFY A;  1HXY D;  4HN7 A;  4RWS C;  5T1I A;  4TKO B;  4TQU S;  1SNM A;  5C3E B;  3RUZ A;  4C3H G;  5EGT A;  4IUN A;  4FNF A;  4N9P A;  4A3I B;  3MTS A;  5CMD A;  4DA2 A;  2J7Z A;  4K6D A;  4KJN A;  1PZI D;  1PTO B;  3J81 L;  1F2Y A;  2WKC A;  3E6Z X;  3KBX A;  3K5O A;  1HRJ A;  1SYC A;  3MXP A;  1HHV A;  2R92 B;  1Z6H A;  1S5D D;  4H0L C;  2NB0 A;  4J6H A;  1BUV T;  1C48 A;  2EY5 A;  4A3M B;  1F9S A;  1YNJ D;  4RGO S;  1JCK B;  3M4O B;  4NP5 A;  5I2X A;  2AWO A;  1WTQ A;  5A2Q L;  2Z1C A;  3FKI B;  3QJY A;  2OEO A;  3KLS A;  4MIU A;  2J0T D;  4F7X A;  4RKL A;  4BBR B;  4DU9 A;  2IL8 A;  3SVM A;  3PO3 B;  1EU4 A;  3P75 A;  2LKV A;  5CYU A;  4C56 C;  3OWF A;  2F0M A;  5EPL A;  2KED A;  4N9T A;  5ELE A;  2DY7 A;  3D4W A;  3ITP A;  3BVM A;  1PMR A;  4FF3 A;  2EYO A;  4ZK9 B;  3GTQ B;  1ILQ A;  1JE4 A;  2PPB C;  5K36 G;  4OIK A;  1Y1V B;  2EE1 A;  2SNM A;  1X3Q A;  3SK6 A;  1IKM A;  2L5T A;  5E1F A;  1WD0 A;  4E6I A;  5JVG 3;  3GV3 A;  3A7L A;  4ZYS A;  5C44 B;  2A68 C;  3J81 E;  1BR9 A;  4KN4 C;  3M4Y A;  1KAA A;  2Z4I A;  1EQT A;  1EYD A;  2JA8 B;  1HA6 A;  3CHB D;  4C1N K;  5EPJ A;  1RHP A;  2KJX A;  1I50 B;  3S9W A;  2E74 C;  3MA2 B;  5KEE A;  4IFD J;  4RGT A;  1X3P A;  3WOF A;  1A3U A;  1PXU A;  3S1N B;  2KCN A;  2F0U A;  4O42 A;  1O80 A;  3QG1 A;  4RH6 A;  2F0Q A;  1LT3 D;  3U9O A;  1HUM A;  1EFI D;  2NN6 H;  5A2Q E;  1NSN S;  2F0V A;  2F03 A;  2SEB D;  1Y8N B;  3MXU A;  1SFO B;  4RKB A;  4FVM A;  3D4D A;  5DNF A;  4X3S A;  3PV0 A;  2EJM A;  4WRD A;  2CW0 C;  4IUR A;  4LK1 C;  2R6G A;  1KDB A;  5FO9 B;  5C0X I;  1II3 A;  1VCI A;  1B2T A;  1O7L A;  2A6H C;  4K2K A;  1CA6 A;  2F0E A;  4QB4 A;  2F4I A;  4EGV A;  1T5X D;  3HGB A;  2XVS A;  4G57 A;  1HCZ A;  1I4R A;  4DK0 A;  3I4L A;  1PRT D;  1LV9 A;  3HRZ C;  1HTL D;  2WII B;  2IX3 A;  4G4K A;  3AMU A;  1DOL A;  4KY7 A;  5E4X A;  1OXV A;  3NWS A;  1ML0 D;  1Q8I A;  3QOL A;  4KK7 A;  1HUN A;  2XIW A;  4K2L A;  4PV1 C;  3PUV A;  1A2T A;  1GHK A;  1SYB A;  3SK5 A;  1ILP A;  1STG A;  3MVV A;  1BCP C;  3KF8 A;  1UUP A;  4JK1 C;  1ZXT A;  1Y8P B;  2JEB I;  4A3G B;  2RVL A;  3K57 A;  1G91 A;  2EYJ A;  4OGQ C;  2F0G A;  2PO4 A;  1F77 A;  1TT2 A;  2E2D C;  3SK4 A;  5IGF A;  4HAE A;  3NXW A;  4X3U A;  4V19 0;  4L6T B;  1RCV D;  1G8Z D;  4DXF A;  2HCI A;  4ZAI A;  4DGZ A;  3J7A V;  4FXD A;  2BDO A;  1IKL A;  4KI0 A;  3K5L A;  1LTS D;  3PIO 3;  1DOM A;  1EIG A;  4DNR B;  4F87 A;  2AUJ D;  2K5Q A;  1FGB D;  4H7B A;  2GA4 B;  2HDM A;  4Q0F A;  2CQA A;  1K8M A;  4CJ0 B;  5TSS A;  2A6E C;  5DEH A;  2D5D A;  3EA6 A;  3ZYY X;  4DAP A;  3SR1 A;  3PUW A;  3KK7 A;  1GUT A;  2AQ3 B;  3K0Y A;  1JQY D;  1CQV A;  3TP5 A;  3RLF A;  5COY A;  1KLU D;  4GZY C;  3RMH A;  1OXT A;  5K5P A;  4XYO A;  1GUS A;  1T5E A;  3DWP A;  2RSO A;  2A6H D;  2PCF B;  1RF2 D;  4HCE A;  4Q5V A;  2WB1 B;  5KND A;  1EWH A;  5D65 A;  4ZLT F;  1LTA D;  2K01 A;  1L0X B;  2EPB A;  1TS3 A;  2F3V A;  3UI2 A;  5EKL A;  5C0X G;  2K7V A;  1KAB A;  3BVG A;  3D8G A;  2F0D A;  4CKE A;  5KNC A;  5D3D A;  2E2H B;  5KGU A;  1LTI D;  1SYG A;  2JSO A;  3TN2 A;  1M4V A;  1AP0 A;  4O1N A;  3HG9 A;  3NTH A;  3GO5 A;  1PLF A;  3R3O A;  4K8I A;  2B63 B;  3T13 A;  4ZKC B;  3CRK C;  4FF2 A;  5C4H A;  1H9R A;  5ELD A;  2D9U A;  4AYB B;  1TVX A;  1STN A;  2BE5 C;  1B53 A;  3A7A B;  3QO2 A;  4K5W A;  4FXG C;  1STE A;  1QNU A;  3TBI B;  4NKL A;  1ROD A;  3MXG A;  3CQZ B;  2C9O A;  5JEA G;  1O7Z A;  4NDX A;  1G29 1;  4ZUJ A;  1E0B A;  4DN4 M;  1H9J A;  1B44 D;  3SXH A;  4A3K B;  3VR2 A;  1F2Z A;  3VA5 A;  4RA8 A;  2QEJ C;  2JYO A;  1TY2 A;  1IW7 C;  1ENA A;  3G7L A;  3KUP A;  4RFB A;  2K28 A;  1TU2 B;  4EQN A;  1ONL A;  2A6E D;  2RDG A;  4DF7 A;  1SNP A;  1LT4 D;  2HUG A;  1EY9 A;  2RBM A;  3U9S A;  3PUZ A;  5COR A;  1G6Z A;  2Q8T A;  3SEB A;  1YNJ C;  1WTO A;  3V2T A;  5DM7 3;  3D31 A;  5KYL A;  5M5Y B;  2FFK B;  2DN8 A;  3FMC A;  3A55 A;  3S1M B;  3HKZ B;  3H91 A;  3NHH A;  4DFA A;  1CZW A;  5JPM C;  3N6R A;  3HOU B;  3EFX D;  4A3D B;  1E2V A;  5CBE E;  1B1Z A;  1O78 A;  1FYC A;  2OXP A;  3H0G B;  3IL8 A;  3A8K E;  1JWM D;  3S1R B;  5DAU A;  1R9T B;  2D2C C;  4JBW A;  4BBS B;  5C0X H;  2LFN A;  3MZ5 A;  2E2I B;  1SDF A;  4EQP A;  2XWJ B;  2PZU A;  2QF7 A;  3J7Y W;  5I4D A;  3WOE A;  5NUC A;  3NK9 A;  1ET6 A;  1QJO A;  3CRL C;  4X3T A;  4C3I G;  1EY0 A;  2FIN B;  5E3F A;  3TZU A;  2BE5 D;  5C3W A;  2F0I A;  2XRS D;  3R2I A;  3QWN A;  2EY6 A;  1CZG A;  1PFN A;  1SND A;  2NN6 G;  1CK1 A;  3IAY A;  4YIJ A;  5JEA H;  1HPC A;  1TS2 A;  3V05 A;  2F0H A;  1BF4 A;  1WVL A;  4F88 A;  4L63 B;  1CT1 D;  1M8A A;  4K5V A;  2EYM A;  1IW7 D;  3IFT A;  3FPU B;  3J7A F;  2B2Y C;  4KKU A;  2G9D A;  2E76 C;  1JIC A;  1MD2 D;  3OHX C;  1HFN A;  1RD9 D;  5C4J B;  4RCO A;  2L12 A;  1QNK A;  1KDA A;  1MI2 A;  4IUP A;  1NR4 A;  3I4M B;  2KQ3 A;  1RDP D;  3NQT A;  1XXG A;  1CHQ D;  3I4N B;  2EZV A;  3O13 A;  2LMC B;  3SE0 A;  2Z4H A;  1MSH A;  2V4D A;  1V1P A;  1C4Q A;  5EQ0 A;  2F0T A;  2ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...