4KD3A

Crystal structure of staphylococcal nuclease variant delta+phs l25a/v66a/i92a at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4kd3A00
4K2LA 2RKSA 1EZ6A 5E3FA 2SNMA 5C5LA 1F2YA 5J22A 2LKVA 2EYMA 4HMJA 2OF1A 4N9TA 3OMGA 5DEHA 1EY9A 3TP5A 4KTAA 5KRUA 3QOJA 4KY6A 3R3OA 4NDXA 4K5WA 3SXHA 5IIFA 5IGEA 4F8MA 2EYHA 3OWFA 4E6IA 3VA5A 4I65A 3DHQA 4ID6A 3NHHA 5CV9A 5J39A 1SYDA 3MZ5A 2RDFA 4PMBA 1SNMA 3LX0A 4HTHA 2F0TA 1SYGA 5C5MA 5F2DA 4K5XA 5CV7A 3P1HA 1STGA 4DGZA 3SK8A 5K5PA 4LAAA 1JORA 3E5SA 1A2UA 3MHBA 3MXPA 1EYAA 2F0UA 3NUCA 3H6MA 3OMCA 1NSNS 4NP5A 3TP7A 3TP6A 2F3VA 3TP8A 1A3TA 5I6YA 4DFAA 4ZUIA 4J6HA 5JAVA 3DMUA 4MIUA 4ZQ3A 3NP8A 4KHVA 3ERQA 1SNOA 4RKLA 2QDBA 4DU9A 5J1ZA 4QB4A 4K8IA 4YIJA 1STAA 5E1FA 2PYKA 1EY7A 4K8JA 1F2MA 5HGTA 1SYEA 5I9PA 3HZXA 1TQOA 2PW5A 2F0GA 2F3WA 1A3VA 1A3UA 1SNDA 1U9RA 1EY8A 1SNQA 2F0JA 2O4XA 1ENCA 1TT2A 5KIXA 5CV8A 4K6DA 1STHA 1SYBA 4PNYA 4R8NA 3SK4A 1EZ8A 2F0HA 4IZ8A 5EKLA 4QF4A 5JOBA 3V2TA 5I9OA 3BDLA 5IGGA 3EROA 2SOBA 1EY4A 4ZUJA 5C4ZA 3HEJA 1SNCA 5IGFA 2F0OA 5KEEA 5NUCA 1NUCA 2F0EA 2EY6A 4KJNA 5CV6A 5EGTA 2PZWA 3C1EA 4WORA 2F0MA 4WRDA 2F0LA 2PZUA 3U9OA 5M9OA 4K5VA 2F0SA 2EY2A 2NUCA 5C6AA 2KHSA 4EQNA 5CC4A 5I6WA 2EYPA 2F0KA 4F7XA 2EYOA 5IOCA 5KGUA 5KYIA 5CGKA 3EJIA 3S9WA 4DF7A 3EVQA 5DAUA 2M00A 5C3WA 4EQPA 2KQ3A 1AEXA 2EXZA 2OXPA 2PZTA 3BDCA 5C3XA 3D4WA 2RBMA 1TR5A 1ENAA 3SK5A 1KDAA 2F0WA 4B9WA 1STNA 4KY7A 2EY1A 4N9PA 5CV4A 1SYCA 4ODGA 4HMIA 3PMFA 1KDCA 5IGDA 4QMGA 3MVVA 5C4HA 3QOLA 3MEHA 1RKNA 3T16A 5CV5A 3C1FA 4EQOA 2F0NA 3D8GA 4IALA 4K14A 2F0FA 3SHLA 2F0VA 1EYCA 2SNSA 1II3A 2F0QA 4J1MA 1EQVA 4OL7A 3P75A 3SR1A 1EYDA 1STYA 4H7BA 3NQTA 2PQEA 2HQEA 2ENBA 3TMEA 3QB3A 5KYLA 2PW7A 3OSOA 4KD4A 4KY5A 4IUNA 3T13A 5IODA 1IHZA 1SYFA 5ISRA 2F0DA 2F0PA 1KABA 2EYJA 5EKKA 1EY5A 2EYFA 4B9XA 1JOQA 1KDBA 5IGCA 1A2TA 3D4DA 4KJOA 4ME5A 4NKLA 2OEOA 3RUZA 1KAAA 4S3SA 1EY0A 4NMZA 1JOKA 3ITPA 3D6CA 1EY6A 2EY5A 3NXWA 4K2KA 2EYLA 2WACA 4G57A 5HURA 1SNPA 3NK9A 4KD3A 4KV6A 4RKBA 2F0IA 1F2ZA 4PMCA 5CR3A 3SK6A 4TRDA 1JOOA 5IGBA 4EVOA 1STBA
chains in the Genus database with same CATH superfamily
1WTWA 3CCUA 5M3MB 4UY8C 3H0GG 3JC66 4KLKA 1HHVA 1SROA 3ND8A 2NWGA 3HOVH 2A6EC 3Q24A 1D6EC 1OXXK 5FLMH 4ZCKA 5GAHC 2WB1B 3MFGA 1SBBB 4JCVE 1HA5A 3DLLA 5J39A 3HG9A 3CMEA 5C5MA 1LUZA 3EN2A 3SK8A 4JI4Q 1PZID 2I5HA 2PI2A 3L9AX 2JA8B 3CXCA 3K6OA 5IY0A 5IP7G 3MXNA 3J81E 1A3TA 4DFAA 5DNFA 3NP8A 3BJUA 3I56A 2NN6G 4G7OC 2PPBC 1F2MA 1LLRD 1Q86C 2ICIA 3J81c 1A3VA 1GO3E 1LYLA 2FXQA 1FL0A 1UAPA 3S17B 4X3TA 5L37A 4R4TA 5C3EG 1XYIA 2OTJA 5IGFA 4DAPA 1X3PA 4KN4C 5JEAJ 2EY6A 4AIMA 2J0TD 2F0MA 4IJHA 3PUZA 1HH2P 3NENA 4UP7A 2BA1A 2Q2IA 5CORA 4JV5Q 4A3MG 2F4VL 2K03A 3S9WA 1PZJD 4L5RC 1H9MA 3R2TA 4GZYC 2PZTA 2LMCB 3M4YA 3SK5A 1EIYB 1AZPA 1BBXC 2E5LL 4DXGA 3GTPB 2OCEA 2A69C 3HOWG 1VQ5A 3M4QA 4C2MH 2YTYA 4DN4M 1VQPA 4LF4Q 4O2DA 4JVZA 3D8GA 3F2BA 2B3GA 1WCMG 2WB1E 4R4CA 1B4OA 3HKSA 2ENBA 2E8GA 2PCFB 5M3MH 4CDEC 3J81L 1Q12A 3ND9A 3TZDA 4A3CH 1B2TA 2VUMG 2D0OA 4K0KQ 4S3SA 2UUBQ 4O1NA 3P7JA 3ITPA 2ZTEA 2HHHL 1I94Q 2XSCA 3HKZB 2VXWA 1O7IA 2QEJC 1K73C 1CZWA 4LFCL 5GAGC 2IWHA 4LF8L 3BS1A 1Q90A 5IYDH 3U4VA 1I6HB 1ZXTA 2MP1A 4KTAA 1PH7A 1H9JA 1HFGA 4K5WA 1VF7A 1K28A 1SE3A 2A74C 4CDFC 3SEBA 1W6KA 4PMBA 3HOXG 4DV0Q 1PFBA 3HOYB 1ET9A 2JA5G 2L9HA 4LFAL 3NSWA 3NBIA 1QVGA 3BG3A 1PH8A 2ZTDA 3H15A 5ELDA 4RGOS 4JI6Q 1E22A 2K6AA 4OIJA 4X62Q 2MNAA 2JN4A 3A5ZB 2ZTCA 2NYZD 1SNQA 5BR8L 3S2HB 1ENCA 1B9NA 1QJOA 2QF7A 4DR5Q 1K0SA 4LUVA 3V2TA 4DV7L 2Y0SB 3S24A 1FNUA 3PIO3 2EVBA 1G6PA 2VQEQ 1KAWA 1U0LA 3AYHB 1UEAB 2IW3A 2L55A 3G4SA 2P5ZX 2D0PA 1S40A 5AJ3Q 2VNUD 1TS4A 1SRUA 4BA2I 1GUNA 1TWHB 4OO1I 3KK7A 2N3SA 1X3GA 5M5YH 3U9SA 3AU7A 3ZYYX 4CBVA 3HKZE 4DV3Q 3I4NH 1T5XD 5EPKA 4RHRA 4H02A 1NMGA 3A56A 2K14A 1UE6A 4K14A 4EQ5A 1KTKA 2FMMA 2L0CA 4C3JB 1QVFA 4OL7A 1SJED 3HOWH 2R7ZH 4GN4B 3OSOA 1Q82C 1Q8IA 2H1EA 4RWSC 4MTKA 1K8AC 3CCEA 2BOSA 2E2JB 3S2DB 1GUWA 1I6HH 1BCPD 4A3EB 3NTKA 4NMZA 3UI2A 1BQQT 2VY3A 4C56C 1XJVA 4DNTB 1EEFD 1LM0A 1RJTA 2OQKA 3H94A 2JEBI 4N8X1 3OW2A 1LTTD 1TWGB 2KCNA 1M8AA 1E2WA 4BXXG 5C44G 3AMUA 3GTOB 3DEOA 2CQOA 3KFUA 4RH6A 5EBCA 2QEXA 2R61A 4JG2A 1B1ZA 2Y0SE 3VR6A 4DUYL 2XRSD 3I4LA 1HZAA 4I65A 3L7ZC 4UDUC 5C0XG 4DR1Q 1L0YB 2R93B 1NR2A 5F2DA 2XWBB 1MKHA 4A93B 1LT6D 1EUJA 3S2HH 2AQ3B 3S1MH 1A0IA 4X66L 5EBDA 2F3VA 1IZ6A 3NWSA 2CWPA 4J6HA 3DMUA 2EDGA 1VMCA 3GP7A 1SNOA 4XQJA 4A3DH 4DU9A 4C3HB 4GOPB 4GKKL 1DZ1A 1CZGA 1I6VC 1D1KA 1BXTA 1TQOA 4A76A 1K8GA 1S5DD 4L63B 4RHSA 1EY8A 3SK4A 4HJ5A 2E76C 1K83H 2C9OA 4BY1B 1LTGD 5ELNA 4B3ML 2CH4W 2F0OA 3D6WA 3K0YA 4JI1Q 4ALPA 4OWWB 4ULLA 2UU9L 4WRDA 1A62A 1YIJA 4JI5L 1FGBD 1JWSD 1NCVA 4ZAIA 4HR7B 3NE5B 3G71A 1HZCA 3IFDA 2ZXOA 4JI8Q 4DPGA 2A1AA 1STNA 3QR8A 4DV5L 1NAPA 1FJGQ 4LWCA 4QMGA 1ICFB 2FHTA 3S2DH 2K05A 3GTQH 4EQOA 1Q1BA 1QILA 1F77A 4A3EH 1N33Q 1XTCD 1WI5A 4WJ4A 4FF3A 4YHHL 3C2PA 1EQVA 1HQRD 1B44D 1NY4A 1EYDA 4DXFA 1IKLA 1MSHA 3TMEA 4GKJL 1TWGH 1B53A 1VQMA 2X69A 2XIWA 3G6EA 2KOLA 2EYJA 4B9XA 2A69D 3EQLC 4KJOA 4ME5A 4A3GB 2IHFA 1KAAA 3I72A 1YNNC 1GHKA 3NXWA 1Q3LA 1X56A 2RDGA 2JA6G 3PO3B 3UDXA 1F2ZA 4OGQC 4A93H 4G4KA 1PRTB 4IJLA 4K2LA 1IW7C 2CVRA 3CCJA 3QG1A 4HMJA 3RR5A 2L12A 4X64L 5DEHA 3TP5A 1EY9A 4CHTB 3R3OA 2KA7A 1LACA 5JVH3 2EYHA 1KQSA 4C3HH 2NN6I 4MZ9A 5T1IA 1J5EL 4NXMQ 3EBEA 4IURA 2RCNA 3KLSX 4M1UB 1PTOB 2A68C 4A3IB 5I6YA 1BKBA 4KI0A 4OWTB 4MIUA 1PV4A 1CM9A 1PRTF 3A55A 1Z9FA 3NELA 1B3QA 1JC7A 4DR2Q 1TWAB 4IO9A 2PW5A 1U9RA 3I4MB 1IL8A 3ER0A 4K6DA 1X3EA 4H0LC 1EZ8A 5EKLA 3PV0A 1JR0D 3BDLA 4JI2Q 2B2YC 1PTOF 3ICEA 1AE2A 4JC0A 2G5DA 4QUCA 3JAME 4F87A 2EY2A 4HEDA 1ESRA 5CC4A 2JA7B 1ZEQX 3W3AA 1N34Q 1SAPA 4QL5A 5CGKA 4XQNA 4FF2A 1G91A 4L6TB 2M00A 5C3WA 4V190 3I55A 2SEBD 1C7YA 4AYBB 3MFYA 3JAMc 1B3AA 1H9SB 1E24A 2EY1A 4FDBA 3ULLA 1Q46A 4JI4L 5E4WC 4QJFA 1B7YB 2KEEA 4BBRH 1QUQA 4I7AA 3FKIB 4X65Q 1K9MC 2GVAA 1SE4A 4J1MA 4XYOA 1STYA 1SXTA 1LTRD 1GVPA 2CW0C 5HY6A 5EPJA 4OX9Q 3S14H 2RHQB 3D3RA 3KOJA 1RL2A 3RUZA 3GTLB 3PO2H 4IUUA 3TREA 2JK8A 3KBGA 5EKIA 4BBSG 1ESFA 2MGSA 4OXPA 2WACA 3PIOA 5JEAH 4YCWA 4TRDA 1HNXQ 4OO1G 4JV5L 1PTOH 3D31A 2RKSA 5K36H 1RD9D 4BY7G 5EQ0A 2OF1A 4H13C 1O80A 3OMGA 4X6AH 2CCZA 2NTSA 2DN8A 5IGEA 1Q81C 3ERSX 2R7DA 4XDXA 1GJXA 3X3NA 4HCSA 4HJ9A 1SNMA 1X32A 4QIWB 4R9WA 4KHPQ 4LF4L 1RTNA 1MSGA 3S1QB 3TP7A 3HOVG 1AFPA 4RA8A 2K28A 5FLMG 3TP6A 3S1NB 3K5OA 1PDQA 3J7AF 2VQFQ 2B63H 4AYBE 1YHBA 4A3KH 2MO0A 2Q8TA 3H91A 1CQVA 3HOZG 1HNZL 1HZBA 3D4RA 4AQYQ 5FJ8H 5I4DA 2JA7H 1A3UA 1VF5C 2R92B 4K0KL 2B2UC 1ZKOA 2HDLA 2MFIA 2UUBL 5JOBA 4QF4A 5T1GA 2BH8A 1I94L 1EY4A 1ET6A 4GOPC 1DJRD 3G6JB 1LTAD 2VZAA 5CV6A 1CFMA 1Y1WH 1ICWA 2NUCA 5C6AA 2KUMA 1SMYC 2UUCQ 1AP0A 3KF8A 1V1PB 3STBC 4DV4Q 3FKIH 3M4OH 3I73A 3Q6SA 2NZ1D 4MN3A 2ES2A 3UE1A 2E2DC 4DV0L 5DM73 3NBHA 2Z4IA 4A3BH 5D3DA 1NBWA 2NZHA 1I4PA 5C4XH 5M3FB 1TS2A 4IALA 4WJWA 5IYCH 5H1SE 3FEWX 1E7ZA 4JI6L 1T5EA 1HTPA 1VQFA 3PQIA 4OWXB 4X62L 4B3TQ 2HUGA 4QIWE 3RLFA 1UNSA 1TU2B 4OHJA 4KKUA 4DR5L 4DR6Q 4Q0FA 4A3FB 3D4DA 4NKLA 4G7ZC 2QILA 5JJIA 1CQFA 1HZ9A 3T56B 4OELB 1Y1VB 2EY5A 3KLSA 1S72A 1SFOB 2N49A 1SE2A 5C0XI 3M4PA 2F0IA 2RCFA 3FDTA 2AUKA 5M3MG 3FP9A 4LUZA 4MNOA 5AJ3L 3OIQA 1EZ6A 4A3CG 2KECA 3CPWA 3W1GA 4HIMA 3GV6A 2WB1G 4GN3B 1LTSD 5TSSA 2AQ2B 2A6HC 4DV3L 5FOBB 4JI0Q 4KMUC 4LF6Q 3HS0C 4L5TA 1E3PA 4KN7C 2Z8LA 1PRTC 4JBKA 1L2FA 4B3SQ 1CK1A 2K5NA 3JAMi 1A2UA 3NUCA 2KBNA 1PYSB 1MIUA 1H9KA 1Q8KA 1YBYA 2Q8IB 5E7NA 1FR3A 2K7VA 1PTOC 3HZXA 4DR3Q 5GQOA 3QJYA 5CBAE 3T1YQ 2L5TA 1ZYRC 4K6LA 1YNJC 1SE8A 3CQZB 4JI7L 4P2CB 1K8MA 5JJLA 3G7LA 3HOZH 1SNCA 4NPSA 1LTLA 2FMCA 2XVSA 1CUKA 4K5VA 5ELCA 4YWMA 3FVQA 1D2BA 1PH5A 4DV1Q 1WOCA 2ALYB 5KGUA 2KEDA 4HN7A 3OPOA 2OXPA 4GNXB 4FO2A 4FF4A 4JYAQ 3I4OA 1EEID 4IOAA 5M5WH 4DR1L 2E75C 3UDGA 1CSQA 5G3LD 1EU3A 2B2VC 5ELFA 2DY8A 4A3FH 1DXMA 1S5FD 1RODA 1YITA 2A8VA 1YNXA 3S15B 1II3A 1Y1VH 4RGNA 3MXNB 4GS3A 1S3OA 3SR1A 3H0GB 4CKBA 4LF7Q 3F1ZA 3I4NG 1PFNA 5IODA 3ULJA 2HCIA 1KABA 2WV6D 3TDQA 1EY5A 1I50H 4A3LH 1HA6A 4A3JB 3HKZG 4JI1L 2E2IH 1SNPA 2R7ZG 2PMZB 3G48A 4X3KA 4PMCA 4YWLA 1EIHA 2D5DA 2SNMA 2HQLA 1BUVT 1WTHA 4L8JA 3OYYA 4GLVB 3KDFB 3E0EA 4JI8L 5LMUQ 1LV9A 3OHXC 1PZKD 1D8LA 4HSVA 3KF6B 1FJGL 3HOYG 2CFMA 4LF5Q 1XNRQ 1HTLD 3TSSA 1N33L 3H6MA 3IKJA 1SEBD 3PUVA 5FK9C 1X55A 3ERQA 3N52A 4YCVA 2ZJPA 4A3MB 1SR3A 2JA8H 2NVTB 4ZKCB 2CKZB 3S16B 3LWUA 1HPCA 1IL2A 3TQYA 4AH6A 2RSNA 1FD7D 1CI3M 2Y0SG 3J80E 5IGGA 3EROA 2HIVA 4A3DG 2UUAQ 2K50A 1OXSC 2B2YA 4DNRB 4ZLTF 4HJAA 1R9TB 1CA6A 3S17H 1WCMB 4OIKA 1JJCB 3CPFA 3J80c 3BVGA 3TS0A 3UDFA 5HGQA 2RBMA 3DXJC 3KLWA 3RD4A 1RCVD 2PMZE 3I2ZA 2VUMB 1O7ZA 5IYBH 4KKTA 1DCZA 5IGDA 2K04A 3NWTA 2Z0SA 2EOTA 3C1FA 3B6YA 4GN5A 1JB3A 2ID0A 1EWHA 1PH2A 5LHY1 1SMYD 1QNUA 3HP3A 3SHLA 2RDHA 1IBMQ 3GTPH 4A3JH 1VQLA 2HIXA 1VQ8A 1JWMD 5ELEA 2GVBA 3LNNA 4DK0A 1W2BA 1IYVA 3L2PA 4DR2L 1QG7A 4PZ8A 3CF5A 1GUTA 1I3QB 1O7LA 4R8IA 3C3LA 4A3EG 4PZ7A 4JBMA 3HOXB 2OEOA 3K80C 4APVA 4JI2L 2D9UA 5KNDA 3I8ZA 4ILWA 2J4XA 4KD3A 2K5DA 1NR4A 2GN5A 2IL8A 1EIFA 1VQCA 2FFKB 2JSOA 3FPPA 1N34L 1NE3A 3J80L 1X54A 1EL0A 4KY6A 4DK1A 5DLQE 1GD7A 1WJJA 1YJNA 1PFMA 5CV9A 3RMHA 3K7AB 3S16H 3PIP3 1JCKB 2FINB 4A93G 1XX8A 2EJGC 1UE7A 1STGA 2CQAA 5IWAQ 3J81i 2R7FA 4X65L 2F0UA 1B70B 3HOYH 3Q0AA 4POFA 4ZQ3A 3Q23A 4C3HG 4RKLA 2QDBA 1TKWB 1Z6HA 2N78A 3K5LA 5E1FA 4DR7Q 4FYDA 3CC2A 4OX9L 5JPMC 1SYEA 3VR4A 3A7AB 3KYHC 1U4RA 4R8NA 3BYTB 2NTTA 1AE3A 2B2UA 1MJEA 4M8AA 4ZUJA 1A15A 1VQ9A 2BE5C 4KJNA 3F8TA 4HJ8A 1HNXL 3MA2B 5CBEE 4GOPA 1JE4A 2OQ0A 4DK6C 1CA5A 2A6ED 2F0KA 1D5ZC 3EJIA 2AWOA 3RLNA 3RZDB 3T4AC 4Z9CB 5C3XA 1C0AA 1YNJD 1CHPD 3CP0A 4B9WA 4KHPL 1Z47A 1TWHH 2F4IA 3WWVA 4JI3Q 1CKMA 4JOIC 1I3QH 4R1JA 3OW7A 5C4HA 5EPLA 2K5HA 3K7UC 4GNXC 4DV2Q 2VQFL 4BWGB 5M5XB 1C8CA 2KENA 5C44B 4C1NK 5GROA 3V05A 4AQYL 3T13A 1S5CD 4C3JH 3CCRA 4L5QA 4LFBQ 4IUVA 3T1HQ 1GHJA 3MAQA 2ZXRA 4BBRG 3DEPA 3VA7A 1XTDA 1KLUD 2E5LQ 1RHPA 2HT1A 5IP9H 2UXBQ 1VQBA 3NK9A 3VYSA 2E2JH 1W3SA 2GA4B 1M4VA 4KV6A 4ABNA 5CR3A 1U5KA 2K4KA 4C3IB 1STBA 2JJQA 2UUCL 3PUWA 4KK7A 1PMRA 3HRZC 4DV4L 2LKVA 3H09A 3PO2G 1LO5D 4IPHA 2JP1A 3RN2A 3QOJA 5IIFA 1PFSA 2DNEA 5LMNQ 3PGZA 4DUZQ 1PXUA 3GTOH 1SYDA 5JEAG 3H3VC 2QKIC 3A8KE 4HTHA 3M9BA 5K36G 3GTKB 1HFNA 3E5SA 3MHBA 4NP5A 1C48A 2EJFC 2R93H 1BCPB 3QO2A 1VQJA 2KJXA 4B3TL 5LMNW 2UXDQ 3SGIA 2BDOA 1VQDA 1PH9A 1L1OB 1EIGA 4HAEA 1EQRA 5HGTA 2XRQD 4DR6L 3I4MG 1CKNB 2PNRC 1RTOA 5D3IB 4LMQD 5CV8A 1S5BD 1YVCA 2LSSA 4JK1C 5IT9E 1K3BC 2WKDA 1J6QA 2B63G 1DOKA 3F2CA 3X3MA 2RQXA 4A3KG 2Q2UA 5I2YA 1JT8A 5FJ8G 2YTXA 2JA7G 1Y8OB 4IPCA 4BY1H 4EQNA 2EYPA 4F7XA 5IT9c 2K5WA 1HR0Q 2KHJA 4EQPA 1TR5A 1H9RA 2I5MX 3A54A 1KDAA 2K33A 1EQQA 1LTID 1U4PA 4LF6L 5J3BA 5CV4A 4B3SL 1Y1WG 3UDIA 4CKEA 1B8AA 2O5JC 1L0XB 3FKIG 2KCMA 2B2VA 2F0VA 2SNSA 1HR0W 1OO9B 4U68A 4IUQA 1YHAA 4A3BG 3NQTA 4C3IH 2JE6I 1HJPA 2F03A 4XT1B 1H9SA 1KRSA 3K0XA 3T1YL 5C4XG 2LFNA 3HGBA 2DJFC 4RCNA 5IYCG 1LT4D 1E0BA 3FMCA 1ILQA 1A63A 2TSSA 3KBXA 4FXDA 2EYLA 4P75A 1JWUD 2E2HB 1BO0A 4A3GH 1DM0B 3TS2A 1WTQA 3V96A 4DV1L 1IBLQ 4LJZC 3GTJB 5IT9L 3PO3H 1DYQA 1I4QA 3QWNA 1D7QA 4JYAL 2C5CA 1VQNA 1GKHA 4NDXA 4RG1A 1KXLA 3VYUA 1XNQQ 3DHQA 1QZGA 1KD1C 2AKWB 2K32A 3MZ5A 4X3SA 2AHOB 1JICA 2YTVA 1F2LA 4XXEA 4RGMA 3DWPA 2NB0A 1W6JA 3J81j 3HOUB 3MXPA 3VR3A 3RZOB 4IUPA 1S5ED 4ZUIA 4A3IH 3IL8A 4NW2A 3R2IA 1WVLA 4O42A 2ZT9C 2MUYA 2F0GA 4DUYQ 2OT2A 2V1CC 4XYQA 2F0HA 3J7YW 2MPMA 2WAQB 2O5IC 1TWAH 2VB3X 2DY7A 4N8FA 3E9HA 3URYA 3HEJA 1VQEA 4IFDJ 3I4MH 2KHIA 2F0EA 3CCMA 5EGTA 3C1EA 2F0LA 1HRJA 4U673 1TIID 3J7A5 5I6WA 2ZM6Q 3DUZA 1N36Q 5LMUL 3PUYA 3ZJYC 1DOMA 4XIGS 4LF5L 4KY7A 1EOVA 1QWYA 1XNRL 1XMQQ 1PYWD 4WJ3M 1VQ7A 2RVLA 4ODGA 1KDCA 2MO1A 3RN5A 1CSPA 2Z4HA 4BBSB 3C46A 2G9HD 3SDZA 1G2TA 1V1PA 3DWQA 3VR2A 1KIXA 1WD1A 2DGYA 2JA9A 2EJMA 4QGUA 2JXMB 3I91A 2H5XA 1Z7TA 3KUPA 5KYLA 1WTOA 3IFTA 4OONA 1D5XC 4IUNA 3U4ZA 1DOLA 3NEMA 5ISRA 4A3FG 1X3FA 3GTJH 1XPOA 1AH9A 2Z6BA 3OWEB 1CHQD 2B2TC 4B3RQ 1Y1VG 4YY3Q 1AN8A 4IOCA 2UUAL 1OXTA 1A6XA 4DAYB 3KJPA 3DM1A 5D14A 3GTLH 1YI2A 4IPDA 5E3FA 2PQAB 3VR5A 3HOUH 4A3LG 5J22A 2EYMA 1TY2A 2EXDA 2WAQE 3MWYW 1IYUA 2E74C 4F8MA 4PQXA 4E6IA 1F9PA 3CW2C 4QQBX 2FJ2A 2MJ8A 1TWCB 3LX0A 1HCZA 2XGTA 5C4JB 3CKIB 3P1HA 2K52A 3FRPB 3PSIA 4DV6Q 4LAAA 1GOZA 1T9HA 2VQEL 2I46A 1EU4A 1EYAA 4IPGA 1IBML 1KNEA 2IT1A 3TP8A 4FP5D 2XWJB 3BYYB 2NVQB 4IUTA 4CJ2C 1UE1A 2LS01 1I5FA 2Z6KC 1ONLA 3DM3A 3S1QH 5A35A 5J1ZA 2L1BA 3OIPA 2MHVA 1BBUA 3BDOA 1GUOA 4K8IA 1V8QA 3OOCA 3S1NH 1YJWA 3CMAA 2EIFA 1TT2A 2D2CC 1B50A 1YNND 5I9OA 1SDFA 4NXNQ 1BCPC 3OTOQ 5C4ZA 1M90C 2JA8G 4RGTA 3KJOA 1TS5A 2R92H 3AQQA 2Q2HA 3VDYA 2N8NA 2PZUA 1IW7D 1HNWQ 1GM5A 3E6ZX 2KHSA 1NNXA 5KYIA 1B9MA 3I90A 1I4RA 3BDCA 3VYTA 1BBWA 3EFXD 1SJHD 2V4DA 5IWAL 2A68D 3PMFA 3M7NA 3Q22A 3MVVA 1V1QA 3GDEA 3U50C 4L5SA 2WINB 4JOIA 2IX1A 4RMFA 2QW7A 4CJ1B 4PV1C 1PH4A 4CDCC 4GNXA 3CU7A 2YU9B 5M3FH 3J7AV 1SMXA 4DR7L 4IN3A 3QB3A 1ILPA 2PNHA 5IYBG 1MD2D 4KD4A 5FKAC 1KNAA 5JVG3 1MI2A 2F0PA 3SVMA 1U4LA 1RDPD 2C35B 1KLGD 2NVYB 1VQKA 4A3JG 2UXCQ 3TBIB 4RCOA 3W2DA 1WTVA 2QCPX 5FO7B 5HURA 1PH3A 1TWCH 5KNCA 4JW0A 2N88A 4JPBW 5C4JH 1JOOA 4EVOA 1VQ4A 1MJCA 1N9WA 3K5NA 3T51B 5GADC 1SFOH 3GTMB 2B2WA 3GTGB 1X9NA 1G6ZA 2HDMA 2NVQH 3SXHA 3OWFA 4CKCA 3VA5A 4ID6A 4JI3L 2IX0A 5CV7A 1WTPA 2JYOA 1FNWA 3CCSA 1XXGA 3J7ZC 4A4IA 3OMCA 4DV2L 4BS9A 3KDFA 3A0JA 4DNIA 4F88A 2KCTA 2CW0D 4WFN3 3NTIA 2IY5B 2JQOA 4YIJA 3KF6A 1IYJB 1HUMA 2PYKA 4LFBL 2QGQA 1FVIA 4ZRZA 1J8IA 3T1HL 3Q8DA 1SNDA 2RA4A 3CD6A 1XWEA 1STHA 4PNYA 3AFQA 4UAIA 4HIOA 2L11A 1G8ZD 4EGVA 1Y14B 2UXBL 1XMOQ 3D0FA 5C3EB 4PG3A 2LY7A 5NUCA 1GUSA 4XQQA 5JAVA 3CQZH 3M3YB 5M5YB 2K5QA 2Z1CA 3A74A 2EYOA 5EAYA 3ULPA 2J7ZA 3I4NB 5LMNL 4LF9Q 1HNZQ 1UEBA 3QIAA 3D4WA 2A73B 4DUZL 4DR4Q 2WFWA 2EPBA 2YU9H 5CMDA 4POGA 1BDOA 1UUPA 1HXYD 2PI2E 4A75A 1K3RA 1QVCA 3QOLA 1JJ2A 3HOWB 2R7ZB 4LW1A 1QB5D 2JEAI 2NVYH 3CHBD 5ELBA 2ZJRA 2ASBA 1X65A 2UXDL 1YEZA 2WP8J 3IAYA 1VS0A 4RAUC 4B08A 3MXGA 3S15H 2BH2A 4IFDG 1WD0A 2DUDA 4RFBA 3GTMH 3H0GH 3K57A 3GTGH 5IGCA 4NXML 1A2TA 3PUXA 3I7FA 4ME3A 1FNVA 3D6CA 3GV3A 4DA2A 1IKMA 1E2VA 3HFZB 5AFWA 5LL6X 2F1MA 4ZYSA 2YV5A 4Y7NB 3DWAA 4C3JG 3GQBA 2HCCA 3I70A 3STBD 1HR0L 2ZXPA 2AQ1B 3H3VH 5GAEC 5IP7H 1KC8C 3F2UA 5IP9G 1TXYA 1VMPA 3S1MB 4Y52H 1N32Q 1R4PB 3KLRA 2F0TA 1SYGA 2NN6H 2Q2TA 5DM63 4I7ZC 4A3DB 5JJKA 3AFPA 2JA5B 1CKOA 1WYDA 1PHJA 2B39A 5JJZA 1ENFA 2AUJD 5C3EH 1P16A 1EWIA 1HQMC 2PO4A 1EFID 5G3LF 2EZVA 1K83B 2AWNA 3M3YH 2EQSA 1DD2A 1PH6A 1VCIA 2F0JA 2NVTH 4A3MH 3S1RB 2R93G 3LGJA 4DK3C 3CAMA 1IBKQ 3K5MA 3BZCA 3SE0A 3E9IA 3PF5A 2EE1A 2R6GA 4QY7A 1IBLL 2ICEC 3E0JA 2K75A 2ZJQA 3M85A 2QDLA 1V43A 1CT1D 3L0OA 1EWCA 2HD3A 4ZKBB 2CWAA 1F9QA 1R9TH 1AEXA 5FLXE 5JPNC 2A6HD 1XNQL 1G51A 1WCMH 4PZ6A 3GTQB 1PVOA 1PRTD 4FNFA 3BVMA 2IX3A 1Y69U 4JI7Q 4BY1G 2A5HA 3MEHA 3T16A 2KCCA 4P74A 5FLXc 1SLJA 2VUMH 4HIKA 4NB3A 1R4QB 2PQEA 5ELOA 1K0RA 3BZDB 4Y7NH 1DONA 1PTOD 3AEVA 1ZYRD 1VQ6A 2Q8RE 5IE8A 2EYFA 1X3QA 5COYA 1JOQA 1KDBA 1LABA 2X6GA 4J15A 2M2LA 3A5UA 3CC7A 1BOSA 2B2TA 2VW9A 4UP9A 4IFDH 4C3IG 1YZ6A 3HOXH 1U4MA 4ZK9B 1J9OA 1PA6A 1EQTA 2ZM6L 1BR9A 4BA1I 1N36L 2XNAC 2JA5H 3W5OA 3I3CA 2F4VQ 3BVZA 4C1NI 4TSSA 3WDNA 4P71A 4CJ0B 5KRUA 3CCVA 4CDDC 2OWOA 1XMQL 3NHHA 1E1TA 4A3GG 2YYZA 4YWKA 2IPKD 1JORA 3S1RH 3PO3G 3K7AH 3BU2A 5FLXL 4HSPA 3TZUA 1JJGA 2B2WC 4GLAC 3PF4A 2I5LX 4QB4A 1STAA 2Z6KA 5I9PA 3CC4A 3J80i 4XT3B 2RF4A 5EJWA 4B3RL 4HCEA 4YY3L 5KIXA 1MGSA 4KKSA 1JE5A 3EIVA 4MHEA 1C4QA 4A3IG 3P20A 1DGSA 2HHHQ 4TQUS 3U9OA 4WORA 3K58A 2CHBD 3T53B 1L1OA 1JB7A 1I4GA 1CKNA 4LFCQ 5BN5A 1NTGA 4LF8Q 2KVMA 5DAUA 1JMCA 2KQ3A 2R3ZA 5BN3A 2LXKA 1GXDC 1C9OA 1F9SA 3VYRA 1PYBA 3NPPA 1E2ZA 3W1BA 4N9PA 1SSOA 4BBRB 1TWFB 4JBJA 3RZDH 2IHEA 1OTCA 4DV6L 2QA4A 2BA0A 3M7GA 2VB2X 1RKNA 4FVMA 1BF4A 1EOTA 2F0NA 3A7LA 1QE6A 3A8JE 4LFAQ 1N8RC 3H3VI 3S14B 3NTHA 3MC0B 3P75A 4TKOB 1BCPF 2B8FA 4XTCS 1TY0A 3RLOA 1OXVA 2PW7A 5BN4A 1EFWA 3PO2B 1AW7A 1STEA 1XPRA 1IHZA 2K01A 5M5XH 1F9RA 4AYBG 1BNZA 4JI0L 4BXXH 4LNQA 5C44H 4NXNL 3O13A 5BR8Q 3OTOL 1JOKA 1VQHA 4DV7Q 1EY6A 5FO9B 2OTLA 4LK1C 4K2KA 3NQIA 1WTXA 4IQZA 4RKBA 3K8AA 2DJGC 2JA6B 1HNWL 2XTIA 3SK6A 5C0XH 4FXKC 2TMPA 3BZKA 5C5LA 3AB9A 4MTNA 1D1IA 1L0WA 4DR3L 3MTSA 4H44C 4HIDA 4O0AA 2I07B 4UPAA 2A19A 4Q5VA 1VQAA 4DGZA 1OXUA 3HOUG 2B63B 3R8BA 2WKCA 4R4IA 2MQHA 1NSNS 4A3KB 5A2QE 1RF2D 3TEHB 2SDFA 1NJIC 1Y8NB 3GTKH 1X6OA 1M1KC 2L4NA 1EY7A 2BCOA 3PCOB 2O4XA 2K1BA 2NBFA 2WAQG 2UXCL 1Y1WB 5KNBA 1UE5A 2SOBA 4R4QA 4X3UA 4V0BA 1QZHA 1ASZA 1TWFH 4TVAB 3M4OB 2DNCA 2X6LA 1P8LA 1QUQB 4OEMB 4LF7L 4A3BB 3CCQA 2I0QA 1G2SA 3EVQA 1EYGA 4DKAC 2NVXB 4CGYB 4EX5A 1ENAA 5C4XB 2F0WA 2R92G 4LUOA 4YCUA 1SYCA 1YHQA 4HMIA 4IFDI 1UWVA 1MHWC 4DAVA 3WOFA 1QCBD 2LXJA 3U58A 3UE0A 1WTRA 2F0FA 4X66Q 1LTBD 1VQIA 1ASYA 1Q1EA 2HQEA 2JA6H 2B29A 1K8OA 4GKKQ 4KY5A 2F52A 4QCLA 1Y8PB 5EKKA 2AMCB 5A2QL 3JAML 2CH4A 2WIIB 1VDZA 3GD7A 1XMOL 3EA6A 2BE5D 4G57A 3PIPA 5M3FG 3TRZA 4B3MQ 5IGBA 2UU9Q 3FHWA 4P73A 1RIPA 2K5VA 1F2YA 4JI5Q 3MEFA 4BY7B 4N9TA 2E2HH 4LF9L 3F2DA 4DR4L 1TVXA 5D65A 3CCLA 1HUNA 2L15A 3E3XA 1PH1A 2RDFA 2Z9HA 4DAYA 1LT3D 1IXRA 4DV5Q 4K5XA 3CRKC 1KRTA 1FYCA 2D62A 2RHSB 3GO5A 5K5PA 3ONAB 4FF1A 4KHZA 3LWEA 2PQAA 3K59A 1D5MC 3HOVB 1QOHA 4J8QA 4JBWA 4HJ7A 4YHHQ 4KHVA 1KL9A 1VQOA 4UHVA 3CRLC 4K8JA 3RZOH 2NZOA 4GKJQ 1PLFA 3KF8B 3HOZB 3IRBA 2F3WA 2IJ0A 1GUGA 2F3IA 4G7HC 5CYUA 1KHIA 1SYBA 5LL6S 4IZ8A 1LT5D 1YJ9A 2NVXH 3NBHB 3FPUB 1NUCA 2PZWA 5M9OA 4DAMA 3RNUA 2F0SA 1WFQA 5M5WB 5IOCA 2RSOA 2N55A 3L3OC 4DF7A 4QUFA 1QNKA 1S4ZA 4X64Q 4P72A 2EXZA 4FXGC 2G9DA 1NMFA 2B8GA 1N32L 1H95A 2XN9C 1AZQA 5E4XA 1J5EQ 5I2XA 2BDNA 4UP8A 4PMWA 1Q7YC 1XPUA 5CV5A 2ATWA 3TN2A 1E1OA 2VL6A 1CTMA 1BVSA 4R4OA 3A8IE 1I4HA 1L1OC 3K81C 1EYCA 5C0XJ 1FGUA 2F0QA 1V9PA 1I4XA 4BBSH 1I50B 1ML0D 4H7BA 5FO8B 3WOEA 2H4OA 3MXUA 3R93A 1SYFA 2M9VA 1O78A 3N6RA 4OO1H 2F0DA 2E2IB 4C2MB 1TS3A 1SN8A 2VS1A 2O2LD 1VQGA 4BY7H 1IBKL 1O7YA 1V1OA 1EY0A 4GLXA 1MBYA 1G291 5IYDG 1A8VA 5KEEA 1JQYD
chains in the Genus database with same CATH topology
1WTWA 5M3MB 1HHVA 3ND8A 2NWGA 2A6EC 3Q24A 1D6EC 1OXXK 2WB1B 3MFGA 1SBBB 1HA5A 5J39A 3HG9A 5C5MA 3SK8A 1PZID 3L9AX 2JA8B 3K6OA 3J81E 3MXNA 1A3TA 4DFAA 5DNFA 3NP8A 2NN6G 4G7OC 2PPBC 1F2MA 1LLRD 2ICIA 1A3VA 1UAPA 3S17B 4X3TA 1XYIA 5IGFA 4DAPA 1X3PA 4KN4C 5JEAJ 2EY6A 2J0TD 2F0MA 3PUZA 2BA1A 5CORA 2K03A 3S9WA 1PZJD 1H9MA 3R2TA 4GZYC 2PZTA 2LMCB 3M4YA 3SK5A 1AZPA 1BBXC 4DXGA 3GTPB 2A69C 4DN4M 3D8GA 1B4OA 2ENBA 2PCFB 3J81L 1Q12A 3ND9A 3TZDA 1B2TA 4S3SA 4O1NA 3P7JA 3ITPA 2XSCA 3HKZB 2VXWA 2QEJC 1CZWA 2IWHA 3BS1A 1Q90A 1I6HB 1ZXTA 2MP1A 4KTAA 1H9JA 1HFGA 4K5WA 1VF7A 2A74C 1SE3A 3SEBA 1W6KA 4PMBA 1PFBA 3HOYB 1ET9A 2L9HA 3NSWA 3NBIA 3BG3A 5ELDA 4RGOS 2K6AA 4OIJA 2NYZD 1SNQA 3S2HB 1ENCA 1B9NA 1QJOA 2QF7A 3V2TA 2Y0SB 1FNUA 3PIO3 2EVBA 1UEAB 2IW3A 2L55A 2VNUD 1TS4A 4BA2I 1GUNA 1TWHB 4OO1I 3KK7A 3U9SA 3AU7A 3ZYYX 4CBVA 1T5XD 5EPKA 4RHRA 3A56A 4K14A 1KTKA 2FMMA 2L0CA 4C3JB 4OL7A 1SJED 3OSOA 1Q8IA 2H1EA 4RWSC 2BOSA 2E2JB 3S2DB 1GUWA 1BCPD 4A3EB 3NTKA 4NMZA 3UI2A 1BQQT 4C56C 4DNTB 1EEFD 1RJTA 3H94A 2JEBI 1LTTD 1TWGB 2KCNA 1M8AA 1E2WA 3AMUA 3GTOB 3DEOA 4RH6A 5EBCA 2R61A 1B1ZA 3VR6A 2XRSD 3I4LA 4I65A 3L7ZC 4UDUC 5C0XG 1L0YB 2R93B 1NR2A 5F2DA 2XWBB 4A93B 1LT6D 2AQ3B 5EBDA 2F3VA 3NWSA 4J6HA 3DMUA 2EDGA 1VMCA 3GP7A 1SNOA 4XQJA 4DU9A 4C3HB 1DZ1A 1CZGA 1I6VC 1D1KA 1BXTA 1TQOA 1S5DD 4L63B 4RHSA 1EY8A 3SK4A 2E76C 2C9OA 4BY1B 1LTGD 2F0OA 3D6WA 3K0YA 4ULLA 4WRDA 1FGBD 1JWSD 1NCVA 4ZAIA 4HR7B 3NE5B 3IFDA 2ZXOA 1STNA 1NAPA 4QMGA 2FHTA 2K05A 4EQOA 1Q1BA 1QILA 1F77A 1XTCD 4FF3A 3C2PA 1EQVA 1HQRD 1B44D 4DXFA 1EYDA 1IKLA 1MSHA 3TMEA 1B53A 2X69A 2XIWA 2KOLA 2EYJA 4B9XA 2A69D 3EQLC 4KJOA 4ME5A 4A3GB 1KAAA 3I72A 1YNNC 1GHKA 3NXWA 1Q3LA 2RDGA 3PO3B 1F2ZA 4OGQC 4G4KA 1PRTB 4K2LA 1IW7C 2CVRA 3QG1A 4HMJA 2L12A 5DEHA 3TP5A 1EY9A 4CHTB 3R3OA 2KA7A 1LACA 5JVH3 2EYHA 2NN6I 5T1IA 4IURA 3KLSX 4M1UB 1PTOB 2A68C 4A3IB 5I6YA 4KI0A 4MIUA 1CM9A 1PRTF 3A55A 1JC7A 1TWAB 2PW5A 1U9RA 3I4MB 1IL8A 4K6DA 4H0LC 1EZ8A 5EKLA 3PV0A 1JR0D 3BDLA 2B2YC 1PTOF 4QUCA 3JAME 4F87A 2EY2A 4HEDA 1ESRA 5CC4A 2JA7B 1ZEQX 3W3AA 1SAPA 5CGKA 4XQNA 4FF2A 1G91A 4L6TB 2M00A 5C3WA 4V190 2SEBD 4AYBB 3MFYA 1B3AA 1H9SB 2EY1A 5E4WC 2KEEA 3FKIB 1SE4A 4J1MA 4XYOA 1STYA 1SXTA 1LTRD 2CW0C 5EPJA 3D3RA 3GTLB 3RUZA 4IUUA 3KBGA 5EKIA 1ESFA 2MGSA 2WACA 5JEAH 4TRDA 4OO1G 1PTOH 3D31A 2RKSA 5K36H 1RD9D 5EQ0A 2OF1A 4H13C 1O80A 3OMGA 2NTSA 2DN8A 5IGEA 4XDXA 1GJXA 3X3NA 4HCSA 1SNMA 1X32A 4QIWB 4R9WA 1RTNA 1MSGA 3S1QB 3TP7A 1AFPA 4RA8A 2K28A 3TP6A 3S1NB 3K5OA 1PDQA 3J7AF 2Q8TA 3H91A 1CQVA 3D4RA 5I4DA 1A3UA 1VF5C 2R92B 2B2UC 1ZKOA 2HDLA 5JOBA 4QF4A 5T1GA 1EY4A 1ET6A 1DJRD 3G6JB 1LTAD 5CV6A 1CFMA 1ICWA 2NUCA 5C6AA 2KUMA 1SMYC 1AP0A 3KF8A 1V1PB 3I73A 3Q6SA 2NZ1D 4MN3A 2E2DC 5DM73 3NBHA 2Z4IA 5D3DA 1I4PA 5M3FB 1TS2A 4IALA 4WJWA 3FEWX 1T5EA 1HTPA 2HUGA 3RLFA 1UNSA 1TU2B 4OHJA 4KKUA 4Q0FA 4A3FB 3D4DA 4NKLA 4G7ZC 2QILA 1CQFA 3T56B 1Y1VB 2EY5A 3KLSA 1SFOB 1SE2A 5C0XI 2F0IA 3FDTA 2AUKA 3OIQA 1EZ6A 2KECA 3GV6A 1LTSD 5TSSA 2AQ2B 2A6HC 5FOBB 4KMUC 3HS0C 4KN7C 2Z8LA 1PRTC 1CK1A 1A2UA 3NUCA 1H9KA 2Q8IB 1FR3A 2K7VA 1PTOC 3HZXA 3QJYA 5CBAE 2L5TA 1ZYRC 4K6LA 1YNJC 3CQZB 4P2CB 1K8MA 3G7LA 1SNCA 2FMCA 2XVSA 4K5VA 5ELCA 3FVQA 1D2BA 5KGUA 2KEDA 4HN7A 3OPOA 2OXPA 4FO2A 4FF4A 1EEID 2E75C 5G3LD 1EU3A 2B2VC 5ELFA 2DY8A 1DXMA 1S5FD 1RODA 3S15B 1II3A 4RGNA 3SR1A 3H0GB 4CKBA 1PFNA 5IODA 2HCIA 1KABA 2WV6D 3TDQA 1EY5A 1HA6A 4A3JB 1SNPA 2PMZB 4X3KA 4PMCA 1EIHA 2D5DA 2SNMA 1BUVT 4L8JA 1LV9A 1PZKD 3OHXC 4HSVA 1HTLD 3TSSA 3H6MA 3IKJA 1SEBD 3PUVA 5FK9C 3ERQA 3N52A 2NVTB 4A3MB 4ZKCB 3S16B 3LWUA 1HPCA 2RSNA 1FD7D 1CI3M 3J80E 5IGGA 3EROA 1OXSC 2B2YA 4DNRB 4ZLTF 1R9TB 1CA6A 1WCMB 4OIKA 3BVGA 2RBMA 3DXJC 3RD4A 1RCVD 2VUMB 1O7ZA 4KKTA 1DCZA 5IGDA 2K04A 3NWTA 2EOTA 3C1FA 1JB3A 2ID0A 1EWHA 5LHY1 1SMYD 1QNUA 3HP3A 3SHLA 2RDHA 1JWMD 5ELEA 3LNNA 4DK0A 1IYVA 1QG7A 1GUTA 1I3QB 1O7LA 4R8IA 3C3LA 3HOXB 2OEOA 2D9UA 5KNDA 3I8ZA 4ILWA 2J4XA 4KD3A 2K5DA 1NR4A 2IL8A 2FFKB 2JSOA 3FPPA 3J80L 1EL0A 4KY6A 4DK1A 1PFMA 5CV9A 3RMHA 3K7AB 3PIP3 1JCKB 2FINB 1XX8A 2EJGC 2CQAA 1STGA 2F0UA 3Q0AA 4ZQ3A 3Q23A 4C3HG 4RKLA 2QDBA 1TKWB 1Z6HA 3K5LA 5E1FA 4FYDA 5JPMC 1SYEA 3VR4A 3A7AB 1U4RA 4R8NA 3BYTB 2NTTA 2B2UA 4M8AA 4ZUJA 1A15A 2BE5C 4KJNA 3MA2B 5CBEE 1JE4A 1CA5A 2A6ED 2F0KA 1D5ZC 3EJIA 2AWOA 3RZDB 3T4AC 4Z9CB 5C3XA 1YNJD 1CHPD 4B9WA 1Z47A 2F4IA 5C4HA 3OW7A 5EPLA 4BWGB 5M5XB 1C8CA 5C44B 4C1NK 3V05A 3T13A 1S5CD 4IUVA 1GHJA 3MAQA 2ZXRA 3DEPA 3VA7A 1KLUD 1RHPA 3NK9A 3VYSA 2GA4B 4KV6A 1M4VA 4ABNA 5CR3A 4C3IB 1STBA 3PUWA 4KK7A 1PMRA 3HRZC 2LKVA 3H09A 1LO5D 2JP1A 3QOJA 5IIFA 2DNEA 3H3VC 1PXUA 1SYDA 5JEAG 2QKIC 3A8KE 4HTHA 5K36G 3GTKB 1HFNA 3E5SA 3MHBA 4NP5A 1C48A 2EJFC 1BCPB 3QO2A 2KJXA 2BDOA 1EIGA 4HAEA 5HGTA 2XRQD 2PNRC 1RTOA 5D3IB 4LMQD 5CV8A 1S5BD 5IT9E 4JK1C 2WKDA 1DOKA 3X3MA 2RQXA 5I2YA 1Y8OB 4EQNA 2EYPA 4F7XA 2K5WA 4EQPA 1TR5A 1H9RA 3A54A 1KDAA 2K33A 1LTID 1U4PA 5CV4A 4CKEA 2O5JC 1L0XB 2B2VA 2F0VA 2SNSA 1OO9B 4U68A 4IUQA 3NQTA 2JE6I 2F03A 4XT1B 1H9SA 2LFNA 3HGBA 4RCNA 1LT4D 1E0BA 3FMCA 1ILQA 2TSSA 3KBXA 4FXDA 2EYLA 1JWUD 2E2HB 1BO0A 1DM0B 1WTQA 3V96A 4LJZC 3GTJB 5IT9L 1DYQA 1I4QA 3QWNA 2C5CA 4NDXA 3VYUA 3DHQA 2K32A 3MZ5A 4X3SA 1JICA 1F2LA 4XXEA 4RGMA 3DWPA 2NB0A 1W6JA 3HOUB 3MXPA 3VR3A 3RZOB 4IUPA 1S5ED 4ZUIA 3IL8A 4NW2A 3R2IA 1WVLA 4O42A 2ZT9C 2MUYA 2F0GA 2OT2A 4XYQA 2F0HA 3J7YW 2MPMA 2WAQB 2O5IC 2VB3X 2DY7A 3URYA 3HEJA 4IFDJ 2F0EA 5EGTA 3C1EA 2F0LA 1HRJA 4U673 1TIID 5I6WA 3DUZA 3PUYA 1DOMA 4XIGS 4KY7A 1QWYA 1PYWD 2RVLA 4ODGA 1KDCA 2Z4HA 4BBSB 3C46A 2G9HD 3SDZA 1G2TA 1V1PA 3DWQA 3VR2A 1WD1A 2EJMA 2JXMB 3I91A 1Z7TA 3KUPA 5KYLA 1WTOA 3IFTA 1D5XC 4IUNA 1DOLA 5ISRA 3OWEB 1CHQD 2B2TC 1AN8A 1OXTA 1A6XA 3DM1A 5D14A 5E3FA 3VR5A 5J22A 2EYMA 1TY2A 3MWYW 1IYUA 4F8MA 2E74C 4PQXA 4E6IA 1F9PA 2FJ2A 2MJ8A 1TWCB 3LX0A 1HCZA 5C4JB 3CKIB 3P1HA 3FRPB 4LAAA 1GOZA 2I46A 1EU4A 1EYAA 1KNEA 2IT1A 3TP8A 4FP5D 2XWJB 3BYYB 2NVQB 4IUTA 4CJ2C 2LS01 1ONLA 5A35A 5J1ZA 2L1BA 3OIPA 2MHVA 3BDOA 4K8IA 1GUOA 1V8QA 3OOCA 1TT2A 2D2CC 1B50A 1YNND 5I9OA 1SDFA 1BCPC 5C4ZA 4RGTA 1TS5A 2PZUA 1IW7D 3E6ZX 2KHSA 5KYIA 1B9MA 3I90A 1I4RA 3BDCA 3VYTA 3EFXD 1SJHD 2V4DA 2A68D 3PMFA 3M7NA 3Q22A 3MVVA 2WINB 2IX1A 4CJ1B 4PV1C 3CU7A 2YU9B 3J7AV 4IN3A 3QB3A 1ILPA 1MD2D 4KD4A 5FKAC 1KNAA 5JVG3 1MI2A 2F0PA 3SVMA 1U4LA 1RDPD 1KLGD 2NVYB 3TBIB 4RCOA 3W2DA 1WTVA 2QCPX 5FO7B 5HURA 5KNCA 2N88A 1JOOA 4EVOA 3K5NA 3T51B 3GTMB 2B2WA 3GTGB 1G6ZA 2HDMA 3SXHA 3OWFA 4CKCA 3VA5A 4ID6A 2IX0A 5CV7A 1WTPA 2JYOA 1FNWA 1XXGA 3OMCA 4BS9A 4F88A 2CW0D 4WFN3 3NTIA 4YIJA 2PYKA 1HUMA 4ZRZA 1J8IA 1SNDA 2RA4A 1XWEA 4UAIA 4PNYA 1STHA 2L11A 1G8ZD 4EGVA 5C3EB 2LY7A 5NUCA 1GUSA 4XQQA 5JAVA 3M3YB 5M5YB 2K5QA 2Z1CA 2EYOA 2J7ZA 3I4NB 3QIAA 3D4WA 2A73B 2EPBA 5CMDA 1BDOA 1UUPA 1HXYD 3QOLA 3HOWB 2R7ZB 1QB5D 2JEAI 3CHBD 5ELBA 2WP8J 3IAYA 4RAUC 4B08A 3MXGA 4IFDG 1WD0A 4RFBA 3K57A 5IGCA 1A2TA 3PUXA 1FNVA 3D6CA 3GV3A 4DA2A 1IKMA 1E2VA 5AFWA 5LL6X 2F1MA 4ZYSA 4Y7NB 3DWAA 4C3JG 3GQBA 2HCCA 3I70A 2ZXPA 2AQ1B 3F2UA 1VMPA 3S1MB 1R4PB 3KLRA 2F0TA 1SYGA 2NN6H 5DM63 4I7ZC 4A3DB 2JA5B 2B39A 5JJZA 1ENFA 2AUJD 1HQMC 2PO4A 1EFID 5G3LF 2EZVA 1K83B 2AWNA 1DD2A 1VCIA 2F0JA 3S1RB 3K5MA 3SE0A 2EE1A 2R6GA 2ICEC 3E0JA 3M85A 1V43A 1CT1D 4ZKBB 1EWCA 1F9QA 1AEXA 5FLXE 5JPNC 2A6HD 3GTQB 1PRTD 4FNFA 3BVMA 2IX3A 1Y69U 2A5HA 3MEHA 3T16A 2KCCA 1R4QB 2PQEA 3BZDB 1DONA 1PTOD 1ZYRD 2Q8RE 2EYFA 1X3QA 5COYA 1JOQA 1KDBA 1LABA 2X6GA 2M2LA 1BOSA 2B2TA 4IFDH 4C3IG 1U4MA 4ZK9B 1J9OA 1EQTA 1BR9A 4BA1I 2XNAC 3I3CA 3BVZA 4C1NI 4TSSA 3WDNA 4CJ0B 5KRUA 3NHHA 2YYZA 2IPKD 1JORA 5FLXL 4HSPA 3TZUA 2B2WC 4QB4A 1STAA 5I9PA 4XT3B 5EJWA 4HCEA 5KIXA 1MGSA 4KKSA 4MHEA 1C4QA 3P20A 4TQUS 3U9OA 4WORA 3K58A 2CHBD 3T53B 1I4GA 5BN5A 2KVMA 5DAUA 2KQ3A 2R3ZA 5BN3A 1GXDC 1F9SA 3VYRA 3NPPA 1E2ZA 4N9PA 1SSOA 4BBRB 1TWFB 2BA0A 3M7GA 2VB2X 1RKNA 4FVMA 1BF4A 1EOTA 2F0NA 3A7LA 1QE6A 3A8JE 3S14B 3NTHA 3MC0B 3P75A 4TKOB 1BCPF 2B8FA 4XTCS 1TY0A 1OXVA 2PW7A 5BN4A 3PO2B 1AW7A 1STEA 1IHZA 2K01A 1F9RA 1BNZA 3O13A 1JOKA 1EY6A 5FO9B 4LK1C 4K2KA 3NQIA 1WTXA 4IQZA 4RKBA 2JA6B 3SK6A 5C0XH 4FXKC 2TMPA 5C5LA 3AB9A 1D1IA 3MTSA 4H44C 2I07B 4Q5VA 4DGZA 1OXUA 2B63B 3R8BA 2WKCA 1NSNS 4A3KB 5A2QE 1RF2D 2SDFA 1Y8NB 2L4NA 1EY7A 2BCOA 2O4XA 2K1BA 2NBFA 1Y1WB 5KNBA 2SOBA 4X3UA 4V0BA 3M4OB 2DNCA 2X6LA 4A3BB 1G2SA 3EVQA 2NVXB 4CGYB 1ENAA 5C4XB 2F0WA 1SYCA 4HMIA 4IFDI 4DAVA 3WOFA 1QCBD 1WTRA 2F0FA 1LTBD 1Q1EA 2HQEA 1K8OA 4KY5A 4QCLA 1Y8PB 5EKKA 5A2QL 3JAML 2WIIB 1VDZA 3GD7A 3EA6A 2BE5D 4G57A 5IGBA 1F2YA 4BY7B 4N9TA 1TVXA 5D65A 1HUNA 2RDFA 4DAYA 1LT3D 4K5XA 3CRKC 1FYCA 2D62A 5K5PA 3GO5A 3ONAB 4FF1A 4KHZA 3LWEA 3K59A 1D5MC 3HOVB 1QOHA 4J8QA 4JBWA 4KHVA 3CRLC 4K8JA 1PLFA 3HOZB 2F3WA 2IJ0A 1GUGA 4G7HC 5CYUA 1SYBA 5LL6S 4IZ8A 1LT5D 3FPUB 1NUCA 2PZWA 5M9OA 2F0SA 5M5WB 5IOCA 2RSOA 2N55A 3L3OC 4DF7A 4QUFA 1QNKA 1S4ZA 2EXZA 2G9DA 4FXGC 2B8GA 2XN9C 1AZQA 5E4XA 5I2XA 2BDNA 4PMWA 5CV5A 3TN2A 1CTMA 3A8IE 1I4HA 1EYCA 5C0XJ 2F0QA 1I4XA 1I50B 1ML0D 4H7BA 5FO8B 3WOEA 2H4OA 3MXUA 3R93A 1SYFA 2M9VA 1O78A 3N6RA 4OO1H 2F0DA 2E2IB 4C2MB 1TS3A 2O2LD 1O7YA 1V1OA 1EY0A 1MBYA 1G291 5KEEA 1JQYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2L A;  2RKS A;  1EZ6 A;  5E3F A;  2SNM A;  5C5L A;  1F2Y A;  5J22 A;  2LKV A;  2EYM A;  4HMJ A;  2OF1 A;  4N9T A;  3OMG A;  5DEH A;  1EY9 A;  3TP5 A;  4KTA A;  5KRU A;  3QOJ A;  4KY6 A;  3R3O A;  4NDX A;  4K5W A;  3SXH A;  5IIF A;  5IGE A;  4F8M A;  2EYH A;  3OWF A;  4E6I A;  3VA5 A;  4I65 A;  3DHQ A;  4ID6 A;  3NHH A;  5CV9 A;  5J39 A;  1SYD A;  3MZ5 A;  2RDF A;  4PMB A;  1SNM A;  3LX0 A;  4HTH A;  2F0T A;  1SYG A;  5C5M A;  5F2D A;  4K5X A;  5CV7 A;  3P1H A;  1STG A;  4DGZ A;  3SK8 A;  5K5P A;  4LAA A;  1JOR A;  3E5S A;  1A2U A;  3MHB A;  3MXP A;  1EYA A;  2F0U A;  3NUC A;  3H6M A;  3OMC A;  1NSN S;  4NP5 A;  3TP7 A;  3TP6 A;  2F3V A;  3TP8 A;  1A3T A;  5I6Y A;  4DFA A;  4ZUI A;  4J6H A;  5JAV A;  3DMU A;  4MIU A;  4ZQ3 A;  3NP8 A;  4KHV A;  3ERQ A;  1SNO A;  4RKL A;  2QDB A;  4DU9 A;  5J1Z A;  4QB4 A;  4K8I A;  4YIJ A;  1STA A;  5E1F A;  2PYK A;  1EY7 A;  4K8J A;  1F2M A;  5HGT A;  1SYE A;  5I9P A;  3HZX A;  1TQO A;  2PW5 A;  2F0G A;  2F3W A;  1A3V A;  1A3U A;  1SND A;  1U9R A;  1EY8 A;  1SNQ A;  2F0J A;  2O4X A;  1ENC A;  1TT2 A;  5KIX A;  5CV8 A;  4K6D A;  1STH A;  1SYB A;  4PNY A;  4R8N A;  3SK4 A;  1EZ8 A;  2F0H A;  4IZ8 A;  5EKL A;  4QF4 A;  5JOB A;  3V2T A;  5I9O A;  3BDL A;  5IGG A;  3ERO A;  2SOB A;  1EY4 A;  4ZUJ A;  5C4Z A;  3HEJ A;  1SNC A;  5IGF A;  2F0O A;  5KEE A;  5NUC A;  1NUC A;  2F0E A;  2EY6 A;  4KJN A;  5CV6 A;  5EGT A;  2PZW A;  3C1E A;  4WOR A;  2F0M A;  4WRD A;  2F0L A;  2PZU A;  3U9O A;  5M9O A;  4K5V A;  2F0S A;  2EY2 A;  2NUC A;  5C6A A;  2KHS A;  4EQN A;  5CC4 A;  5I6W A;  2EYP A;  2F0K A;  4F7X A;  2EYO A;  5IOC A;  5KGU A;  5KYI A;  5CGK A;  3EJI A;  3S9W A;  4DF7 A;  3EVQ A;  5DAU A;  2M00 A;  5C3W A;  4EQP A;  2KQ3 A;  1AEX A;  2EXZ A;  2OXP A;  2PZT A;  3BDC A;  5C3X A;  3D4W A;  2RBM A;  1TR5 A;  1ENA A;  3SK5 A;  1KDA A;  2F0W A;  4B9W A;  1STN A;  4KY7 A;  2EY1 A;  4N9P A;  5CV4 A;  1SYC A;  4ODG A;  4HMI A;  3PMF A;  1KDC A;  5IGD A;  4QMG A;  3MVV A;  5C4H A;  3QOL A;  3MEH A;  1RKN A;  3T16 A;  5CV5 A;  3C1F A;  4EQO A;  2F0N A;  3D8G A;  4IAL A;  4K14 A;  2F0F A;  3SHL A;  2F0V A;  1EYC A;  2SNS A;  1II3 A;  2F0Q A;  4J1M A;  1EQV A;  4OL7 A;  3P75 A;  3SR1 A;  1EYD A;  1STY A;  4H7B A;  3NQT A;  2PQE A;  2HQE A;  2ENB A;  3TME A;  3QB3 A;  5KYL A;  2PW7 A;  3OSO A;  4KD4 A;  4KY5 A;  4IUN A;  3T13 A;  5IOD A;  1IHZ A;  1SYF A;  5ISR A;  2F0D A;  2F0P A;  1KAB A;  2EYJ A;  5EKK A;  1EY5 A;  2EYF A;  4B9X A;  1JOQ A;  1KDB A;  5IGC A;  1A2T A;  3D4D A;  4KJO A;  4ME5 A;  4NKL A;  2OEO A;  3RUZ A;  1KAA A;  4S3S A;  1EY0 A;  4NMZ A;  1JOK A;  3ITP A;  3D6C A;  1EY6 A;  2EY5 A;  3NXW A;  4K2K A;  2EYL A;  2WAC A;  4G57 A;  5HUR A;  1SNP A;  3NK9 A;  4KD3 A;  4KV6 A;  4RKB A;  2F0I A;  1F2Z A;  4PMC A;  5CR3 A;  3SK6 A;  4TRD A;  1JOO A;  5IGB A;  4EVO A;  1STB A; 
#chains in the Genus database with same CATH topology
 1WTW A;  3CCU A;  5M3M B;  4UY8 C;  3H0G G;  3JC6 6;  4KLK A;  1HHV A;  1SRO A;  3ND8 A;  2NWG A;  3HOV H;  2A6E C;  3Q24 A;  1D6E C;  1OXX K;  5FLM H;  4ZCK A;  5GAH C;  2WB1 B;  3MFG A;  1SBB B;  4JCV E;  1HA5 A;  3DLL A;  5J39 A;  3HG9 A;  3CME A;  5C5M A;  1LUZ A;  3EN2 A;  3SK8 A;  4JI4 Q;  1PZI D;  2I5H A;  2PI2 A;  3L9A X;  2JA8 B;  3CXC A;  3K6O A;  5IY0 A;  5IP7 G;  3MXN A;  3J81 E;  1A3T A;  4DFA A;  5DNF A;  3NP8 A;  3BJU A;  3I56 A;  2NN6 G;  4G7O C;  2PPB C;  1F2M A;  1LLR D;  1Q86 C;  2ICI A;  3J81 c;  1A3V A;  1GO3 E;  1LYL A;  2FXQ A;  1FL0 A;  1UAP A;  3S17 B;  4X3T A;  5L37 A;  4R4T A;  5C3E G;  1XYI A;  2OTJ A;  5IGF A;  4DAP A;  1X3P A;  4KN4 C;  5JEA J;  2EY6 A;  4AIM A;  2J0T D;  2F0M A;  4IJH A;  3PUZ A;  1HH2 P;  3NEN A;  4UP7 A;  2BA1 A;  2Q2I A;  5COR A;  4JV5 Q;  4A3M G;  2F4V L;  2K03 A;  3S9W A;  1PZJ D;  4L5R C;  1H9M A;  3R2T A;  4GZY C;  2PZT A;  2LMC B;  3M4Y A;  3SK5 A;  1EIY B;  1AZP A;  1BBX C;  2E5L L;  4DXG A;  3GTP B;  2OCE A;  2A69 C;  3HOW G;  1VQ5 A;  3M4Q A;  4C2M H;  2YTY A;  4DN4 M;  1VQP A;  4LF4 Q;  4O2D A;  4JVZ A;  3D8G A;  3F2B A;  2B3G A;  1WCM G;  2WB1 E;  4R4C A;  1B4O A;  3HKS A;  2ENB A;  2E8G A;  2PCF B;  5M3M H;  4CDE C;  3J81 L;  1Q12 A;  3ND9 A;  3TZD A;  4A3C H;  1B2T A;  2VUM G;  2D0O A;  4K0K Q;  4S3S A;  2UUB Q;  4O1N A;  3P7J A;  3ITP A;  2ZTE A;  2HHH L;  1I94 Q;  2XSC A;  3HKZ B;  2VXW A;  1O7I A;  2QEJ C;  1K73 C;  1CZW A;  4LFC L;  5GAG C;  2IWH A;  4LF8 L;  3BS1 A;  1Q90 A;  5IYD H;  3U4V A;  1I6H B;  1ZXT A;  2MP1 A;  4KTA A;  1PH7 A;  1H9J A;  1HFG A;  4K5W A;  1VF7 A;  1K28 A;  1SE3 A;  2A74 C;  4CDF C;  3SEB A;  1W6K A;  4PMB A;  3HOX G;  4DV0 Q;  1PFB A;  3HOY B;  1ET9 A;  2JA5 G;  2L9H A;  4LFA L;  3NSW A;  3NBI A;  1QVG A;  3BG3 A;  1PH8 A;  2ZTD A;  3H15 A;  5ELD A;  4RGO S;  4JI6 Q;  1E22 A;  2K6A A;  4OIJ A;  4X62 Q;  2MNA A;  2JN4 A;  3A5Z B;  2ZTC A;  2NYZ D;  1SNQ A;  5BR8 L;  3S2H B;  1ENC A;  1B9N A;  1QJO A;  2QF7 A;  4DR5 Q;  1K0S A;  4LUV A;  3V2T A;  4DV7 L;  2Y0S B;  3S24 A;  1FNU A;  3PIO 3;  2EVB A;  1G6P A;  2VQE Q;  1KAW A;  1U0L A;  3AYH B;  1UEA B;  2IW3 A;  2L55 A;  3G4S A;  2P5Z X;  2D0P A;  1S40 A;  5AJ3 Q;  2VNU D;  1TS4 A;  1SRU A;  4BA2 I;  1GUN A;  1TWH B;  4OO1 I;  3KK7 A;  2N3S A;  1X3G A;  5M5Y H;  3U9S A;  3AU7 A;  3ZYY X;  4CBV A;  3HKZ E;  4DV3 Q;  3I4N H;  1T5X D;  5EPK A;  4RHR A;  4H02 A;  1NMG A;  3A56 A;  2K14 A;  1UE6 A;  4K14 A;  4EQ5 A;  1KTK A;  2FMM A;  2L0C A;  4C3J B;  1QVF A;  4OL7 A;  1SJE D;  3HOW H;  2R7Z H;  4GN4 B;  3OSO A;  1Q82 C;  1Q8I A;  2H1E A;  4RWS C;  4MTK A;  1K8A C;  3CCE A;  2BOS A;  2E2J B;  3S2D B;  1GUW A;  1I6H H;  1BCP D;  4A3E B;  3NTK A;  4NMZ A;  3UI2 A;  1BQQ T;  2VY3 A;  4C56 C;  1XJV A;  4DNT B;  1EEF D;  1LM0 A;  1RJT A;  2OQK A;  3H94 A;  2JEB I;  4N8X 1;  3OW2 A;  1LTT D;  1TWG B;  2KCN A;  1M8A A;  1E2W A;  4BXX G;  5C44 G;  3AMU A;  3GTO B;  3DEO A;  2CQO A;  3KFU A;  4RH6 A;  5EBC A;  2QEX A;  2R61 A;  4JG2 A;  1B1Z A;  2Y0S E;  3VR6 A;  4DUY L;  2XRS D;  3I4L A;  1HZA A;  4I65 A;  3L7Z C;  4UDU C;  5C0X G;  4DR1 Q;  1L0Y B;  2R93 B;  1NR2 A;  5F2D A;  2XWB B;  1MKH A;  4A93 B;  1LT6 D;  1EUJ A;  3S2H H;  2AQ3 B;  3S1M H;  1A0I A;  4X66 L;  5EBD A;  2F3V A;  1IZ6 A;  3NWS A;  2CWP A;  4J6H A;  3DMU A;  2EDG A;  1VMC A;  3GP7 A;  1SNO A;  4XQJ A;  4A3D H;  4DU9 A;  4C3H B;  4GOP B;  4GKK L;  1DZ1 A;  1CZG A;  1I6V C;  1D1K A;  1BXT A;  1TQO A;  4A76 A;  1K8G A;  1S5D D;  4L63 B;  4RHS A;  1EY8 A;  3SK4 A;  4HJ5 A;  2E76 C;  1K83 H;  2C9O A;  4BY1 B;  1LTG D;  5ELN A;  4B3M L;  2CH4 W;  2F0O A;  3D6W A;  3K0Y A;  4JI1 Q;  4ALP A;  4OWW B;  4ULL A;  2UU9 L;  4WRD A;  1A62 A;  1YIJ A;  4JI5 L;  1FGB D;  1JWS D;  1NCV A;  4ZAI A;  4HR7 B;  3NE5 B;  3G71 A;  1HZC A;  3IFD A;  2ZXO A;  4JI8 Q;  4DPG A;  2A1A A;  1STN A;  3QR8 A;  4DV5 L;  1NAP A;  1FJG Q;  4LWC A;  4QMG A;  1ICF B;  2FHT A;  3S2D H;  2K05 A;  3GTQ H;  4EQO A;  1Q1B A;  1QIL A;  1F77 A;  4A3E H;  1N33 Q;  1XTC D;  1WI5 A;  4WJ4 A;  4FF3 A;  4YHH L;  3C2P A;  1EQV A;  1HQR D;  1B44 D;  1NY4 A;  1EYD A;  4DXF A;  1IKL A;  1MSH A;  3TME A;  4GKJ L;  1TWG H;  1B53 A;  1VQM A;  2X69 A;  2XIW A;  3G6E A;  2KOL A;  2EYJ A;  4B9X A;  2A69 D;  3EQL C;  4KJO A;  4ME5 A;  4A3G B;  2IHF A;  1KAA A;  3I72 A;  1YNN C;  1GHK A;  3NXW A;  1Q3L A;  1X56 A;  2RDG A;  2JA6 G;  3PO3 B;  3UDX A;  1F2Z A;  4OGQ C;  4A93 H;  4G4K A;  1PRT B;  4IJL A;  4K2L A;  1IW7 C;  2CVR A;  3CCJ A;  3QG1 A;  4HMJ A;  3RR5 A;  2L12 A;  4X64 L;  5DEH A;  3TP5 A;  1EY9 A;  4CHT B;  3R3O A;  2KA7 A;  1LAC A;  5JVH 3;  2EYH A;  1KQS A;  4C3H H;  2NN6 I;  4MZ9 A;  5T1I A;  1J5E L;  4NXM Q;  3EBE A;  4IUR A;  2RCN A;  3KLS X;  4M1U B;  1PTO B;  2A68 C;  4A3I B;  5I6Y A;  1BKB A;  4KI0 A;  4OWT B;  4MIU A;  1PV4 A;  1CM9 A;  1PRT F;  3A55 A;  1Z9F A;  3NEL A;  1B3Q A;  1JC7 A;  4DR2 Q;  1TWA B;  4IO9 A;  2PW5 A;  1U9R A;  3I4M B;  1IL8 A;  3ER0 A;  4K6D A;  1X3E A;  4H0L C;  1EZ8 A;  5EKL A;  3PV0 A;  1JR0 D;  3BDL A;  4JI2 Q;  2B2Y C;  1PTO F;  3ICE A;  1AE2 A;  4JC0 A;  2G5D A;  4QUC A;  3JAM E;  4F87 A;  2EY2 A;  4HED A;  1ESR A;  5CC4 A;  2JA7 B;  1ZEQ X;  3W3A A;  1N34 Q;  1SAP A;  4QL5 A;  5CGK A;  4XQN A;  4FF2 A;  1G91 A;  4L6T B;  2M00 A;  5C3W A;  4V19 0;  3I55 A;  2SEB D;  1C7Y A;  4AYB B;  3MFY A;  3JAM c;  1B3A A;  1H9S B;  1E24 A;  2EY1 A;  4FDB A;  3ULL A;  1Q46 A;  4JI4 L;  5E4W C;  4QJF A;  1B7Y B;  2KEE A;  4BBR H;  1QUQ A;  4I7A A;  3FKI B;  4X65 Q;  1K9M C;  2GVA A;  1SE4 A;  4J1M A;  4XYO A;  1STY A;  1SXT A;  1LTR D;  1GVP A;  2CW0 C;  5HY6 A;  5EPJ A;  4OX9 Q;  3S14 H;  2RHQ B;  3D3R A;  3KOJ A;  1RL2 A;  3RUZ A;  3GTL B;  3PO2 H;  4IUU A;  3TRE A;  2JK8 A;  3KBG A;  5EKI A;  4BBS G;  1ESF A;  2MGS A;  4OXP A;  2WAC A;  3PIO A;  5JEA H;  4YCW A;  4TRD A;  1HNX Q;  4OO1 G;  4JV5 L;  1PTO H;  3D31 A;  2RKS A;  5K36 H;  1RD9 D;  4BY7 G;  5EQ0 A;  2OF1 A;  4H13 C;  1O80 A;  3OMG A;  4X6A H;  2CCZ A;  2NTS A;  2DN8 A;  5IGE A;  1Q81 C;  3ERS X;  2R7D A;  4XDX A;  1GJX A;  3X3N A;  4HCS A;  4HJ9 A;  1SNM A;  1X32 A;  4QIW B;  4R9W A;  4KHP Q;  4LF4 L;  1RTN A;  1MSG A;  3S1Q B;  3TP7 A;  3HOV G;  1AFP A;  4RA8 A;  2K28 A;  5FLM G;  3TP6 A;  3S1N B;  3K5O A;  1PDQ A;  3J7A F;  2VQF Q;  2B63 H;  4AYB E;  1YHB A;  4A3K H;  2MO0 A;  2Q8T A;  3H91 A;  1CQV A;  3HOZ G;  1HNZ L;  1HZB A;  3D4R A;  4AQY Q;  5FJ8 H;  5I4D A;  2JA7 H;  1A3U A;  1VF5 C;  2R92 B;  4K0K L;  2B2U C;  1ZKO A;  2HDL A;  2MFI A;  2UUB L;  5JOB A;  4QF4 A;  5T1G A;  2BH8 A;  1I94 L;  1EY4 A;  1ET6 A;  4GOP C;  1DJR D;  3G6J B;  1LTA D;  2VZA A;  5CV6 A;  1CFM A;  1Y1W H;  1ICW A;  2NUC A;  5C6A A;  2KUM A;  1SMY C;  2UUC Q;  1AP0 A;  3KF8 A;  1V1P B;  3STB C;  4DV4 Q;  3FKI H;  3M4O H;  3I73 A;  3Q6S A;  2NZ1 D;  4MN3 A;  2ES2 A;  3UE1 A;  2E2D C;  4DV0 L;  5DM7 3;  3NBH A;  2Z4I A;  4A3B H;  5D3D A;  1NBW A;  2NZH A;  1I4P A;  5C4X H;  5M3F B;  1TS2 A;  4IAL A;  4WJW A;  5IYC H;  5H1S E;  3FEW X;  1E7Z A;  4JI6 L;  1T5E A;  1HTP A;  1VQF A;  3PQI A;  4OWX B;  4X62 L;  4B3T Q;  2HUG A;  4QIW E;  3RLF A;  1UNS A;  1TU2 B;  4OHJ A;  4KKU A;  4DR5 L;  4DR6 Q;  4Q0F A;  4A3F B;  3D4D A;  4NKL A;  4G7Z C;  2QIL A;  5JJI A;  1CQF A;  1HZ9 A;  3T56 B;  4OEL B;  1Y1V B;  2EY5 A;  3KLS A;  1S72 A;  1SFO B;  2N49 A;  1SE2 A;  5C0X I;  3M4P A;  2F0I A;  2RCF A;  3FDT A;  2AUK A;  5M3M G;  3FP9 A;  4LUZ A;  4MNO A;  5AJ3 L;  3OIQ A;  1EZ6 A;  4A3C G;  2KEC A;  3CPW A;  3W1G A;  4HIM A;  3GV6 A;  2WB1 G;  4GN3 B;  1LTS D;  5TSS A;  2AQ2 B;  2A6H C;  4DV3 L;  5FOB B;  4JI0 Q;  4KMU C;  4LF6 Q;  3HS0 C;  4L5T A;  1E3P A;  4KN7 C;  2Z8L A;  1PRT C;  4JBK A;  1L2F A;  4B3S Q;  1CK1 A;  2K5N A;  3JAM i;  1A2U A;  3NUC A;  2KBN A;  1PYS B;  1MIU A;  1H9K A;  1Q8K A;  1YBY A;  2Q8I B;  5E7N A;  1FR3 A;  2K7V A;  1PTO C;  3HZX A;  4DR3 Q;  5GQO A;  3QJY A;  5CBA E;  3T1Y Q;  2L5T A;  1ZYR C;  4K6L A;  1YNJ C;  1SE8 A;  3CQZ B;  4JI7 L;  4P2C B;  1K8M A;  5JJL A;  3G7L A;  3HOZ H;  1SNC A;  4NPS A;  1LTL A;  2FMC A;  2XVS A;  1CUK A;  4K5V A;  5ELC A;  4YWM A;  3FVQ A;  1D2B A;  1PH5 A;  4DV1 Q;  1WOC A;  2ALY B;  5KGU A;  2KED A;  4HN7 A;  3OPO A;  2OXP A;  4GNX B;  4FO2 A;  4FF4 A;  4JYA Q;  3I4O A;  1EEI D;  4IOA A;  5M5W H;  4DR1 L;  2E75 C;  3UDG A;  1CSQ A;  5G3L D;  1EU3 A;  2B2V C;  5ELF A;  2DY8 A;  4A3F H;  1DXM A;  1S5F D;  1ROD A;  1YIT A;  2A8V A;  1YNX A;  3S15 B;  1II3 A;  1Y1V H;  4RGN A;  3MXN B;  4GS3 A;  1S3O A;  3SR1 A;  3H0G B;  4CKB A;  4LF7 Q;  3F1Z A;  3I4N G;  1PFN A;  5IOD A;  3ULJ A;  2HCI A;  1KAB A;  2WV6 D;  3TDQ A;  1EY5 A;  1I50 H;  4A3L H;  1HA6 A;  4A3J B;  3HKZ G;  4JI1 L;  2E2I H;  1SNP A;  2R7Z G;  2PMZ B;  3G48 A;  4X3K A;  4PMC A;  4YWL A;  1EIH A;  2D5D A;  2SNM A;  2HQL A;  1BUV T;  1WTH A;  4L8J A;  3OYY A;  4GLV B;  3KDF B;  3E0E A;  4JI8 L;  5LMU Q;  1LV9 A;  3OHX C;  1PZK D;  1D8L A;  4HSV A;  3KF6 B;  1FJG L;  3HOY G;  2CFM A;  4LF5 Q;  1XNR Q;  1HTL D;  3TSS A;  1N33 L;  3H6M A;  3IKJ A;  1SEB D;  3PUV A;  5FK9 C;  1X55 A;  3ERQ A;  3N52 A;  4YCV A;  2ZJP A;  4A3M B;  1SR3 A;  2JA8 H;  2NVT B;  4ZKC B;  2CKZ B;  3S16 B;  3LWU A;  1HPC A;  1IL2 A;  3TQY A;  4AH6 A;  2RSN A;  1FD7 D;  1CI3 M;  2Y0S G;  3J80 E;  5IGG A;  3ERO A;  2HIV A;  4A3D G;  2UUA Q;  2K50 A;  1OXS C;  2B2Y A;  4DNR B;  4ZLT F;  4HJA A;  1R9T B;  1CA6 A;  3S17 H;  1WCM B;  4OIK A;  1JJC B;  3CPF A;  3J80 c;  3BVG A;  3TS0 A;  3UDF A;  5HGQ A;  2RBM A;  3DXJ C;  3KLW A;  3RD4 A;  1RCV D;  2PMZ E;  3I2Z A;  2VUM B;  1O7Z A;  5IYB H;  4KKT A;  1DCZ A;  5IGD A;  2K04 A;  3NWT A;  2Z0S A;  2EOT A;  3C1F A;  3B6Y A;  4GN5 A;  1JB3 A;  2ID0 A;  1EWH A;  1PH2 A;  5LHY 1;  1SMY D;  1QNU A;  3HP3 A;  3SHL A;  2RDH A;  1IBM Q;  3GTP H;  4A3J H;  1VQL A;  2HIX A;  1VQ8 A;  1JWM D;  5ELE A;  2GVB A;  3LNN A;  4DK0 A;  1W2B A;  1IYV A;  3L2P A;  4DR2 L;  1QG7 A;  4PZ8 A;  3CF5 A;  1GUT A;  1I3Q B;  1O7L A;  4R8I A;  3C3L A;  4A3E G;  4PZ7 A;  4JBM A;  3HOX B;  2OEO A;  3K80 C;  4APV A;  4JI2 L;  2D9U A;  5KND A;  3I8Z A;  4ILW A;  2J4X A;  4KD3 A;  2K5D A;  1NR4 A;  2GN5 A;  2IL8 A;  1EIF A;  1VQC A;  2FFK B;  2JSO A;  3FPP A;  1N34 L;  1NE3 A;  3J80 L;  1X54 A;  1EL0 A;  4KY6 A;  4DK1 A;  5DLQ E;  1GD7 A;  1WJJ A;  1YJN A;  1PFM A;  5CV9 A;  3RMH A;  3K7A B;  3S16 H;  3PIP 3;  1JCK B;  2FIN B;  4A93 G;  1XX8 A;  2EJG C;  1UE7 A;  1STG A;  2CQA A;  5IWA Q;  3J81 i;  2R7F A;  4X65 L;  2F0U A;  1B70 B;  3HOY H;  3Q0A A;  4POF A;  4ZQ3 A;  3Q23 A;  4C3H G;  4RKL A;  2QDB A;  1TKW B;  1Z6H A;  2N78 A;  3K5L A;  5E1F A;  4DR7 Q;  4FYD A;  3CC2 A;  4OX9 L;  5JPM C;  1SYE A;  3VR4 A;  3A7A B;  3KYH C;  1U4R A;  4R8N A;  3BYT B;  2NTT A;  1AE3 A;  2B2U A;  1MJE A;  4M8A A;  4ZUJ A;  1A15 A;  1VQ9 A;  2BE5 C;  4KJN A;  3F8T A;  4HJ8 A;  1HNX L;  3MA2 B;  5CBE E;  4GOP A;  1JE4 A;  2OQ0 A;  4DK6 C;  1CA5 A;  2A6E D;  2F0K A;  1D5Z C;  3EJI A;  2AWO A;  3RLN A;  3RZD B;  3T4A C;  4Z9C B;  5C3X A;  1C0A A;  1YNJ D;  1CHP D;  3CP0 A;  4B9W A;  4KHP L;  1Z47 A;  1TWH H;  2F4I A;  3WWV A;  4JI3 Q;  1CKM A;  4JOI C;  1I3Q H;  4R1J A;  3OW7 A;  5C4H A;  5EPL A;  2K5H A;  3K7U C;  4GNX C;  4DV2 Q;  2VQF L;  4BWG B;  5M5X B;  1C8C A;  2KEN A;  5C44 B;  4C1N K;  5GRO A;  3V05 A;  4AQY L;  3T13 A;  1S5C D;  4C3J H;  3CCR A;  4L5Q A;  4LFB Q;  4IUV A;  3T1H Q;  1GHJ A;  3MAQ A;  2ZXR A;  4BBR G;  3DEP A;  3VA7 A;  1XTD A;  1KLU D;  2E5L Q;  1RHP A;  2HT1 A;  5IP9 H;  2UXB Q;  1VQB A;  3NK9 A;  3VYS A;  2E2J H;  1W3S A;  2GA4 B;  1M4V A;  4KV6 A;  4ABN A;  5CR3 A;  1U5K A;  2K4K A;  4C3I B;  1STB A;  2JJQ A;  2UUC L;  3PUW A;  4KK7 A;  1PMR A;  3HRZ C;  4DV4 L;  2LKV A;  3H09 A;  3PO2 G;  1LO5 D;  4IPH A;  2JP1 A;  3RN2 A;  3QOJ A;  5IIF A;  1PFS A;  2DNE A;  5LMN Q;  3PGZ A;  4DUZ Q;  1PXU A;  3GTO H;  1SYD A;  5JEA G;  3H3V C;  2QKI C;  3A8K E;  4HTH A;  3M9B A;  5K36 G;  3GTK B;  1HFN A;  3E5S A;  3MHB A;  4NP5 A;  1C48 A;  2EJF C;  2R93 H;  1BCP B;  3QO2 A;  1VQJ A;  2KJX A;  4B3T L;  5LMN W;  2UXD Q;  3SGI A;  2BDO A;  1VQD A;  1PH9 A;  1L1O B;  1EIG A;  4HAE A;  1EQR A;  5HGT A;  2XRQ D;  4DR6 L;  3I4M G;  1CKN B;  2PNR C;  1RTO A;  5D3I B;  4LMQ D;  5CV8 A;  1S5B D;  1YVC A;  2LSS A;  4JK1 C;  5IT9 E;  1K3B C;  2WKD A;  1J6Q A;  2B63 G;  1DOK A;  3F2C A;  3X3M A;  2RQX A;  4A3K G;  2Q2U A;  5I2Y A;  1JT8 A;  5FJ8 G;  2YTX A;  2JA7 G;  1Y8O B;  4IPC A;  4BY1 H;  4EQN A;  2EYP A;  4F7X A;  5IT9 c;  2K5W A;  1HR0 Q;  2KHJ A;  4EQP A;  1TR5 A;  1H9R A;  2I5M X;  3A54 A;  1KDA A;  2K33 A;  1EQQ A;  1LTI D;  1U4P A;  4LF6 L;  5J3B A;  5CV4 A;  4B3S L;  1Y1W G;  3UDI A;  4CKE A;  1B8A A;  2O5J C;  1L0X B;  3FKI G;  2KCM A;  2B2V A;  2F0V A;  2SNS A;  1HR0 W;  1OO9 B;  4U68 A;  4IUQ A;  1YHA A;  4A3B G;  3NQT A;  4C3I H;  2JE6 I;  1HJP A;  2F03 A;  4XT1 B;  1H9S A;  1KRS A;  3K0X A;  3T1Y L;  5C4X G;  2LFN A;  3HGB A;  2DJF C;  4RCN A;  5IYC G;  1LT4 D;  1E0B A;  3FMC A;  1ILQ A;  1A63 A;  2TSS A;  3KBX A;  4FXD A;  2EYL A;  4P75 A;  1JWU D;  2E2H B;  1BO0 A;  4A3G H;  1DM0 B;  3TS2 A;  1WTQ A;  3V96 A;  4DV1 L;  1IBL Q;  4LJZ C;  3GTJ B;  5IT9 L;  3PO3 H;  1DYQ A;  1I4Q A;  3QWN A;  1D7Q A;  4JYA L;  2C5C A;  1VQN A;  1GKH A;  4NDX A;  4RG1 A;  1KXL A;  3VYU A;  1XNQ Q;  3DHQ A;  1QZG A;  1KD1 C;  2AKW B;  2K32 A;  3MZ5 A;  4X3S A;  2AHO B;  1JIC A;  2YTV A;  1F2L A;  4XXE A;  4RGM A;  3DWP A;  2NB0 A;  1W6J A;  3J81 j;  3HOU B;  3MXP A;  3VR3 A;  3RZO B;  4IUP A;  1S5E D;  4ZUI A;  4A3I H;  3IL8 A;  4NW2 A;  3R2I A;  1WVL A;  4O42 A;  2ZT9 C;  2MUY A;  2F0G A;  4DUY Q;  2OT2 A;  2V1C C;  4XYQ A;  2F0H A;  3J7Y W;  2MPM A;  2WAQ B;  2O5I C;  1TWA H;  2VB3 X;  2DY7 A;  4N8F A;  3E9H A;  3URY A;  3HEJ A;  1VQE A;  4IFD J;  3I4M H;  2KHI A;  2F0E A;  3CCM A;  5EGT A;  3C1E A;  2F0L A;  1HRJ A;  4U67 3;  1TII D;  3J7A 5;  5I6W A;  2ZM6 Q;  3DUZ A;  1N36 Q;  5LMU L;  3PUY A;  3ZJY C;  1DOM A;  4XIG S;  4LF5 L;  4KY7 A;  1EOV A;  1QWY A;  1XNR L;  1XMQ Q;  1PYW D;  4WJ3 M;  1VQ7 A;  2RVL A;  4ODG A;  1KDC A;  2MO1 A;  3RN5 A;  1CSP A;  2Z4H A;  4BBS B;  3C46 A;  2G9H D;  3SDZ A;  1G2T A;  1V1P A;  3DWQ A;  3VR2 A;  1KIX A;  1WD1 A;  2DGY A;  2JA9 A;  2EJM A;  4QGU A;  2JXM B;  3I91 A;  2H5X A;  1Z7T A;  3KUP A;  5KYL A;  1WTO A;  3IFT A;  4OON A;  1D5X C;  4IUN A;  3U4Z A;  1DOL A;  3NEM A;  5ISR A;  4A3F G;  1X3F A;  3GTJ H;  1XPO A;  1AH9 A;  2Z6B A;  3OWE B;  1CHQ D;  2B2T C;  4B3R Q;  1Y1V G;  4YY3 Q;  1AN8 A;  4IOC A;  2UUA L;  1OXT A;  1A6X A;  4DAY B;  3KJP A;  3DM1 A;  5D14 A;  3GTL H;  1YI2 A;  4IPD A;  5E3F A;  2PQA B;  3VR5 A;  3HOU H;  4A3L G;  5J22 A;  2EYM A;  1TY2 A;  2EXD A;  2WAQ E;  3MWY W;  1IYU A;  2E74 C;  4F8M A;  4PQX A;  4E6I A;  1F9P A;  3CW2 C;  4QQB X;  2FJ2 A;  2MJ8 A;  1TWC B;  3LX0 A;  1HCZ A;  2XGT A;  5C4J B;  3CKI B;  3P1H A;  2K52 A;  3FRP B;  3PSI A;  4DV6 Q;  4LAA A;  1GOZ A;  1T9H A;  2VQE L;  2I46 A;  1EU4 A;  1EYA A;  4IPG A;  1IBM L;  1KNE A;  2IT1 A;  3TP8 A;  4FP5 D;  2XWJ B;  3BYY B;  2NVQ B;  4IUT A;  4CJ2 C;  1UE1 A;  2LS0 1;  1I5F A;  2Z6K C;  1ONL A;  3DM3 A;  3S1Q H;  5A35 A;  5J1Z A;  2L1B A;  3OIP A;  2MHV A;  1BBU A;  3BDO A;  1GUO A;  4K8I A;  1V8Q A;  3OOC A;  3S1N H;  1YJW A;  3CMA A;  2EIF A;  1TT2 A;  2D2C C;  1B50 A;  1YNN D;  5I9O A;  1SDF A;  4NXN Q;  1BCP C;  3OTO Q;  5C4Z A;  1M90 C;  2JA8 G;  4RGT A;  3KJO A;  1TS5 A;  2R92 H;  3AQQ A;  2Q2H A;  3VDY A;  2N8N A;  2PZU A;  1IW7 D;  1HNW Q;  1GM5 A;  3E6Z X;  2KHS A;  1NNX A;  5KYI A;  1B9M A;  3I90 A;  1I4R A;  3BDC A;  3VYT A;  1BBW A;  3EFX D;  1SJH D;  2V4D A;  5IWA L;  2A68 D;  3PMF A;  3M7N A;  3Q22 A;  3MVV A;  1V1Q A;  3GDE A;  3U50 C;  4L5S A;  2WIN B;  4JOI A;  2IX1 A;  4RMF A;  2QW7 A;  4CJ1 B;  4PV1 C;  1PH4 A;  4CDC C;  4GNX A;  3CU7 A;  2YU9 B;  5M3F H;  3J7A V;  1SMX A;  4DR7 L;  4IN3 A;  3QB3 A;  1ILP A;  2PNH A;  5IYB G;  1MD2 D;  4KD4 A;  5FKA C;  1KNA A;  5JVG 3;  1MI2 A;  2F0P A;  3SVM A;  1U4L A;  1RDP D;  2C35 B;  1KLG D;  2NVY B;  1VQK A;  4A3J G;  2UXC Q;  3TBI B;  4RCO A;  3W2D A;  1WTV A;  2QCP X;  5FO7 B;  5HUR A;  1PH3 A;  1TWC H;  5KNC A;  4JW0 A;  2N88 A;  4JPB W;  5C4J H;  1JOO A;  4EVO A;  1VQ4 A;  1MJC A;  1N9W A;  3K5N A;  3T51 B;  5GAD C;  1SFO H;  3GTM B;  2B2W A;  3GTG B;  1X9N A;  1G6Z A;  2HDM A;  2NVQ H;  3SXH A;  3OWF A;  4CKC A;  3VA5 A;  4ID6 A;  4JI3 L;  2IX0 A;  5CV7 A;  1WTP A;  2JYO A;  1FNW A;  3CCS A;  1XXG A;  3J7Z C;  4A4I A;  3OMC A;  4DV2 L;  4BS9 A;  3KDF A;  3A0J A;  4DNI A;  4F88 A;  2KCT A;  2CW0 D;  4WFN 3;  3NTI A;  2IY5 B;  2JQO A;  4YIJ A;  3KF6 A;  1IYJ B;  1HUM A;  2PYK A;  4LFB L;  2QGQ A;  1FVI A;  4ZRZ A;  1J8I A;  3T1H L;  3Q8D A;  1SND A;  2RA4 A;  3CD6 A;  1XWE A;  1STH A;  4PNY A;  3AFQ A;  4UAI A;  4HIO A;  2L11 A;  1G8Z D;  4EGV A;  1Y14 B;  2UXB L;  1XMO Q;  3D0F A;  5C3E B;  4PG3 A;  2LY7 A;  5NUC A;  1GUS A;  4XQQ A;  5JAV A;  3CQZ H;  3M3Y B;  5M5Y B;  2K5Q A;  2Z1C A;  3A74 A;  2EYO A;  5EAY A;  3ULP A;  2J7Z A;  3I4N B;  5LMN L;  4LF9 Q;  1HNZ Q;  1UEB A;  3QIA A;  3D4W A;  2A73 B;  4DUZ L;  4DR4 Q;  2WFW A;  2EPB A;  2YU9 H;  5CMD A;  4POG A;  1BDO A;  1UUP A;  1HXY D;  2PI2 E;  4A75 A;  1K3R A;  1QVC A;  3QOL A;  1JJ2 A;  3HOW B;  2R7Z B;  4LW1 A;  1QB5 D;  2JEA I;  2NVY H;  3CHB D;  5ELB A;  2ZJR A;  2ASB A;  1X65 A;  2UXD L;  1YEZ A;  2WP8 J;  3IAY A;  1VS0 A;  4RAU C;  4B08 A;  3MXG A;  3S15 H;  2BH2 A;  4IFD G;  1WD0 A;  2DUD A;  4RFB A;  3GTM H;  3H0G H;  3K57 A;  3GTG H;  5IGC A;  4NXM L;  1A2T A;  3PUX A;  3I7F A;  4ME3 A;  1FNV A;  3D6C A;  3GV3 A;  4DA2 A;  1IKM A;  1E2V A;  3HFZ B;  5AFW A;  5LL6 X;  2F1M A;  4ZYS A;  2YV5 A;  4Y7N B;  3DWA A;  4C3J G;  3GQB A;  2HCC A;  3I70 A;  3STB D;  1HR0 L;  2ZXP A;  2AQ1 B;  3H3V H;  5GAE C;  5IP7 H;  1KC8 C;  3F2U A;  5IP9 G;  1TXY A;  1VMP A;  3S1M B;  4Y52 H;  1N32 Q;  1R4P B;  3KLR A;  2F0T A;  1SYG A;  2NN6 H;  2Q2T A;  5DM6 3;  4I7Z C;  4A3D B;  5JJK A;  3AFP A;  2JA5 B;  1CKO A;  1WYD A;  1PHJ A;  2B39 A;  5JJZ A;  1ENF A;  2AUJ D;  5C3E H;  1P16 A;  1EWI A;  1HQM C;  2PO4 A;  1EFI D;  5G3L F;  2EZV A;  1K83 B;  2AWN A;  3M3Y H;  2EQS A;  1DD2 A;  1PH6 A;  1VCI A;  2F0J A;  2NVT H;  4A3M H;  3S1R B;  2R93 G;  3LGJ A;  4DK3 C;  3CAM A;  1IBK Q;  3K5M A;  3BZC A;  3SE0 A;  3E9I A;  3PF5 A;  2EE1 A;  2R6G A;  4QY7 A;  1IBL L;  2ICE C;  3E0J A;  2K75 A;  2ZJQ A;  3M85 A;  2QDL A;  1V43 A;  1CT1 D;  3L0O A;  1EWC A;  2HD3 A;  4ZKB B;  2CWA A;  1F9Q A;  1R9T H;  1AEX A;  5FLX E;  5JPN C;  2A6H D;  1XNQ L;  1G51 A;  1WCM H;  4PZ6 A;  3GTQ B;  1PVO A;  1PRT D;  4FNF A;  3BVM A;  2IX3 A;  1Y69 U;  4JI7 Q;  4BY1 G;  2A5H A;  3MEH A;  3T16 A;  2KCC A;  4P74 A;  5FLX c;  1SLJ A;  2VUM H;  4HIK A;  4NB3 A;  1R4Q B;  2PQE A;  5ELO A;  1K0R A;  3BZD B;  4Y7N H;  1DON A;  1PTO D;  3AEV A;  1ZYR D;  1VQ6 A;  2Q8R E;  5IE8 A;  2EYF A;  1X3Q A;  5COY A;  1JOQ A;  1KDB A;  1LAB A;  2X6G A;  4J15 A;  2M2L A;  3A5U A;  3CC7 A;  1BOS A;  2B2T A;  2VW9 A;  4UP9 A;  4IFD H;  4C3I G;  1YZ6 A;  3HOX H;  1U4M A;  4ZK9 B;  1J9O A;  1PA6 A;  1EQT A;  2ZM6 L;  1BR9 A;  4BA1 I;  1N36 L;  2XNA C;  2JA5 H;  3W5O A;  3I3C A;  2F4V Q;  3BVZ A;  4C1N I;  4TSS A;  3WDN A;  4P71 A;  4CJ0 B;  5KRU A;  3CCV A;  4CDD C;  2OWO A;  1XMQ L;  3NHH A;  1E1T A;  4A3G G;  2YYZ A;  4YWK A;  2IPK D;  1JOR A;  3S1R H;  3PO3 G;  3K7A H;  3BU2 A;  5FLX L;  4HSP A;  3TZU A;  1JJG A;  2B2W C;  4GLA C;  3PF4 A;  2I5L X;  4QB4 A;  1STA A;  2Z6K A;  5I9P A;  3CC4 A;  3J80 i;  4XT3 B;  2RF4 A;  5EJW A;  4B3R L;  4HCE A;  4YY3 L;  5KIX A;  1MGS A;  4KKS A;  1JE5 A;  3EIV A;  4MHE A;  1C4Q A;  4A3I G;  3P20 A;  1DGS A;  2HHH Q;  4TQU S;  3U9O A;  4WOR A;  3K58 A;  2CHB D;  3T53 B;  1L1O A;  1JB7 A;  1I4G A;  1CKN A;  4LFC Q;  5BN5 A;  1NTG A;  4LF8 Q;  2KVM A;  5DAU A;  1JMC A;  2KQ3 A;  2R3Z A;  5BN3 A;  2LXK A;  1GXD C;  1C9O A;  1F9S A;  3VYR A;  1PYB A;  3NPP A;  1E2Z A;  3W1B A;  4N9P A;  1SSO A;  4BBR B;  1TWF B;  4JBJ A;  3RZD H;  2IHE A;  1OTC A;  4DV6 L;  2QA4 A;  2BA0 A;  3M7G A;  2VB2 X;  1RKN A;  4FVM A;  1BF4 A;  1EOT A;  2F0N A;  3A7L A;  1QE6 A;  3A8J E;  4LFA Q;  1N8R C;  3H3V I;  3S14 B;  3NTH A;  3MC0 B;  3P75 A;  4TKO B;  1BCP F;  2B8F A;  4XTC S;  1TY0 A;  3RLO A;  1OXV A;  2PW7 A;  5BN4 A;  1EFW A;  3PO2 B;  1AW7 A;  1STE A;  1XPR A;  1IHZ A;  2K01 A;  5M5X H;  1F9R A;  4AYB G;  1BNZ A;  4JI0 L;  4BXX H;  4LNQ A;  5C44 H;  4NXN L;  3O13 A;  5BR8 Q;  3OTO L;  1JOK A;  1VQH A;  4DV7 Q;  1EY6 A;  5FO9 B;  2OTL A;  4LK1 C;  4K2K A;  3NQI A;  1WTX A;  4IQZ A;  4RKB A;  3K8A A;  2DJG C;  2JA6 B;  1HNW L;  2XTI A;  3SK6 A;  5C0X H;  4FXK C;  2TMP A;  3BZK A;  5C5L A;  3AB9 A;  4MTN A;  1D1I A;  1L0W A;  4DR3 L;  3MTS A;  4H44 C;  4HID A;  4O0A A;  2I07 B;  4UPA A;  2A19 A;  4Q5V A;  1VQA A;  4DGZ A;  1OXU A;  3HOU G;  2B63 B;  3R8B A;  2WKC A;  4R4I A;  2MQH A;  1NSN S;  4A3K B;  5A2Q E;  1RF2 D;  3TEH B;  2SDF A;  1NJI C;  1Y8N B;  3GTK H;  1X6O A;  1M1K C;  2L4N A;  1EY7 A;  2BCO A;  3PCO B;  2O4X A;  2K1B A;  2NBF A;  2WAQ G;  2UXC L;  1Y1W B;  5KNB A;  1UE5 A;  2SOB A;  4R4Q A;  4X3U A;  4V0B A;  1QZH A;  1ASZ A;  1TWF H;  4TVA B;  3M4O B;  2DNC A;  2X6L A;  1P8L A;  1QUQ B;  4OEM B;  4LF7 L;  4A3B B;  3CCQ A;  2I0Q A;  1G2S A;  3EVQ A;  1EYG A;  4DKA C;  2NVX B;  4CGY B;  4EX5 A;  1ENA A;  5C4X B;  2F0W A;  2R92 G;  4LUO A;  4YCU A;  1SYC A;  1YHQ A;  4HMI A;  4IFD I;  1UWV A;  1MHW C;  4DAV A;  3WOF A;  1QCB D;  2LXJ A;  3U58 A;  3UE0 A;  1WTR A;  2F0F A;  4X66 Q;  1LTB D;  1VQI A;  1ASY A;  1Q1E A;  2HQE A;  2JA6 H;  2B29 A;  1K8O A;  4GKK Q;  4KY5 A;  2F52 A;  4QCL A;  1Y8P B;  5EKK A;  2AMC B;  5A2Q L;  3JAM L;  2CH4 A;  2WII B;  1VDZ A;  3GD7 A;  1XMO L;  3EA6 A;  2BE5 D;  4G57 A;  3PIP A;  5M3F G;  3TRZ A;  4B3M Q;  5IGB A;  2UU9 Q;  3FHW A;  4P73 A;  1RIP A;  2K5V A;  1F2Y A;  4JI5 Q;  3MEF A;  4BY7 B;  4N9T A;  2E2H H;  4LF9 L;  3F2D A;  4DR4 L;  1TVX A;  5D65 A;  3CCL A;  1HUN A;  2L15 A;  3E3X A;  1PH1 A;  2RDF A;  2Z9H A;  4DAY A;  1LT3 D;  1IXR A;  4DV5 Q;  4K5X A;  3CRK C;  1KRT A;  1FYC A;  2D62 A;  2RHS B;  3GO5 A;  5K5P A;  3ONA B;  4FF1 A;  4KHZ A;  3LWE A;  2PQA A;  3K59 A;  1D5M C;  3HOV B;  1QOH A;  4J8Q A;  4JBW A;  4HJ7 A;  4YHH Q;  4KHV A;  1KL9 A;  1VQO A;  4UHV A;  3CRL C;  4K8J A;  3RZO H;  2NZO A;  4GKJ Q;  1PLF A;  3KF8 B;  3HOZ B;  3IRB A;  2F3W A;  2IJ0 A;  1GUG A;  2F3I A;  4G7H C;  5CYU A;  1KHI A;  1SYB A;  5LL6 S;  4IZ8 A;  1LT5 D;  1YJ9 A;  2NVX H;  3NBH B;  3FPU B;  1NUC A;  2PZW A;  5M9O A;  4DAM A;  3RNU A;  2F0S A;  1WFQ A;  5M5W B;  5IOC A;  2RSO A;  2N55 A;  3L3O C;  4DF7 A;  4QUF A;  1QNK A;  1S4Z A;  4X64 Q;  4P72 A;  2EXZ A;  4FXG C;  2G9D A;  1NMF A;  2B8G A;  1N32 L;  1H95 A;  2XN9 C;  1AZQ A;  5E4X A;  1J5E Q;  5I2X A;  2BDN A;  4UP8 A;  4PMW A;  1Q7Y C;  1XPU A;  5CV5 A;  2ATW A;  3TN2 A;  1E1O A;  2VL6 A;  1CTM A;  1BVS A;  4R4O A;  3A8I E;  1I4H A;  1L1O C;  3K81 C;  1EYC A;  5C0X J;  1FGU A;  2F0Q A;  1V9P A;  1I4X A;  4BBS H;  1I50 B;  1ML0 D;  4H7B A;  5FO8 B;  3WOE A;  2H4O A;  3MXU A;  3R93 A;  1SYF A;  2M9V A;  1O78 A;  3N6R A;  4OO1 H;  2F0D A;  2E2I B;  4C2M B;  1TS3 A;  1SN8 A;  2VS1 A;  2O2L D;  1VQG A;  4BY7 H;  1IBK L;  1O7Y A;  1V1O A;  1EY0 A;  4GLX A;  1MBY A;  1G29 1;  5IYD G;  1A8V A;  5KEE A;  1JQY D; 
#chains in the Genus database with same CATH homology
 1WTW A;  5M3M B;  1HHV A;  3ND8 A;  2NWG A;  2A6E C;  3Q24 A;  1D6E C;  1OXX K;  2WB1 B;  3MFG A;  1SBB B;  1HA5 A;  5J39 A;  3HG9 A;  5C5M A;  3SK8 A;  1PZI D;  3L9A X;  2JA8 B;  3K6O A;  3J81 E;  3MXN A;  1A3T A;  4DFA A;  5DNF A;  3NP8 A;  2NN6 G;  4G7O C;  2PPB C;  1F2M A;  1LLR D;  2ICI A;  1A3V A;  1UAP A;  3S17 B;  4X3T A;  1XYI A;  5IGF A;  4DAP A;  1X3P A;  4KN4 C;  5JEA J;  2EY6 A;  2J0T D;  2F0M A;  3PUZ A;  2BA1 A;  5COR A;  2K03 A;  3S9W A;  1PZJ D;  1H9M A;  3R2T A;  4GZY C;  2PZT A;  2LMC B;  3M4Y A;  3SK5 A;  1AZP A;  1BBX C;  4DXG A;  3GTP B;  2A69 C;  4DN4 M;  3D8G A;  1B4O A;  2ENB A;  2PCF B;  3J81 L;  1Q12 A;  3ND9 A;  3TZD A;  1B2T A;  4S3S A;  4O1N A;  3P7J A;  3ITP A;  2XSC A;  3HKZ B;  2VXW A;  2QEJ C;  1CZW A;  2IWH A;  3BS1 A;  1Q90 A;  1I6H B;  1ZXT A;  2MP1 A;  4KTA A;  1H9J A;  1HFG A;  4K5W A;  1VF7 A;  2A74 C;  1SE3 A;  3SEB A;  1W6K A;  4PMB A;  1PFB A;  3HOY B;  1ET9 A;  2L9H A;  3NSW A;  3NBI A;  3BG3 A;  5ELD A;  4RGO S;  2K6A A;  4OIJ A;  2NYZ D;  1SNQ A;  3S2H B;  1ENC A;  1B9N A;  1QJO A;  2QF7 A;  3V2T A;  2Y0S B;  1FNU A;  3PIO 3;  2EVB A;  1UEA B;  2IW3 A;  2L55 A;  2VNU D;  1TS4 A;  4BA2 I;  1GUN A;  1TWH B;  4OO1 I;  3KK7 A;  3U9S A;  3AU7 A;  3ZYY X;  4CBV A;  1T5X D;  5EPK A;  4RHR A;  3A56 A;  4K14 A;  1KTK A;  2FMM A;  2L0C A;  4C3J B;  4OL7 A;  1SJE D;  3OSO A;  1Q8I A;  2H1E A;  4RWS C;  2BOS A;  2E2J B;  3S2D B;  1GUW A;  1BCP D;  4A3E B;  3NTK A;  4NMZ A;  3UI2 A;  1BQQ T;  4C56 C;  4DNT B;  1EEF D;  1RJT A;  3H94 A;  2JEB I;  1LTT D;  1TWG B;  2KCN A;  1M8A A;  1E2W A;  3AMU A;  3GTO B;  3DEO A;  4RH6 A;  5EBC A;  2R61 A;  1B1Z A;  3VR6 A;  2XRS D;  3I4L A;  4I65 A;  3L7Z C;  4UDU C;  5C0X G;  1L0Y B;  2R93 B;  1NR2 A;  5F2D A;  2XWB B;  4A93 B;  1LT6 D;  2AQ3 B;  5EBD A;  2F3V A;  3NWS A;  4J6H A;  3DMU A;  2EDG A;  1VMC A;  3GP7 A;  1SNO A;  4XQJ A;  4DU9 A;  4C3H B;  1DZ1 A;  1CZG A;  1I6V C;  1D1K A;  1BXT A;  1TQO A;  1S5D D;  4L63 B;  4RHS A;  1EY8 A;  3SK4 A;  2E76 C;  2C9O A;  4BY1 B;  1LTG D;  2F0O A;  3D6W A;  3K0Y A;  4ULL A;  4WRD A;  1FGB D;  1JWS D;  1NCV A;  4ZAI A;  4HR7 B;  3NE5 B;  3IFD A;  2ZXO A;  1STN A;  1NAP A;  4QMG A;  2FHT A;  2K05 A;  4EQO A;  1Q1B A;  1QIL A;  1F77 A;  1XTC D;  4FF3 A;  3C2P A;  1EQV A;  1HQR D;  1B44 D;  4DXF A;  1EYD A;  1IKL A;  1MSH A;  3TME A;  1B53 A;  2X69 A;  2XIW A;  2KOL A;  2EYJ A;  4B9X A;  2A69 D;  3EQL C;  4KJO A;  4ME5 A;  4A3G B;  1KAA A;  3I72 A;  1YNN C;  1GHK A;  3NXW A;  1Q3L A;  2RDG A;  3PO3 B;  1F2Z A;  4OGQ C;  4G4K A;  1PRT B;  4K2L A;  1IW7 C;  2CVR A;  3QG1 A;  4HMJ A;  2L12 A;  5DEH A;  3TP5 A;  1EY9 A;  4CHT B;  3R3O A;  2KA7 A;  1LAC A;  5JVH 3;  2EYH A;  2NN6 I;  5T1I A;  4IUR A;  3KLS X;  4M1U B;  1PTO B;  2A68 C;  4A3I B;  5I6Y A;  4KI0 A;  4MIU A;  1CM9 A;  1PRT F;  3A55 A;  1JC7 A;  1TWA B;  2PW5 A;  1U9R A;  3I4M B;  1IL8 A;  4K6D A;  4H0L C;  1EZ8 A;  5EKL A;  3PV0 A;  1JR0 D;  3BDL A;  2B2Y C;  1PTO F;  4QUC A;  3JAM E;  4F87 A;  2EY2 A;  4HED A;  1ESR A;  5CC4 A;  2JA7 B;  1ZEQ X;  3W3A A;  1SAP A;  5CGK A;  4XQN A;  4FF2 A;  1G91 A;  4L6T B;  2M00 A;  5C3W A;  4V19 0;  2SEB D;  4AYB B;  3MFY A;  1B3A A;  1H9S B;  2EY1 A;  5E4W C;  2KEE A;  3FKI B;  1SE4 A;  4J1M A;  4XYO A;  1STY A;  1SXT A;  1LTR D;  2CW0 C;  5EPJ A;  3D3R A;  3GTL B;  3RUZ A;  4IUU A;  3KBG A;  5EKI A;  1ESF A;  2MGS A;  2WAC A;  5JEA H;  4TRD A;  4OO1 G;  1PTO H;  3D31 A;  2RKS A;  5K36 H;  1RD9 D;  5EQ0 A;  2OF1 A;  4H13 C;  1O80 A;  3OMG A;  2NTS A;  2DN8 A;  5IGE A;  4XDX A;  1GJX A;  3X3N A;  4HCS A;  1SNM A;  1X32 A;  4QIW B;  4R9W A;  1RTN A;  1MSG A;  3S1Q B;  3TP7 A;  1AFP A;  4RA8 A;  2K28 A;  3TP6 A;  3S1N B;  3K5O A;  1PDQ A;  3J7A F;  2Q8T A;  3H91 A;  1CQV A;  3D4R A;  5I4D A;  1A3U A;  1VF5 C;  2R92 B;  2B2U C;  1ZKO A;  2HDL A;  5JOB A;  4QF4 A;  5T1G A;  1EY4 A;  1ET6 A;  1DJR D;  3G6J B;  1LTA D;  5CV6 A;  1CFM A;  1ICW A;  2NUC A;  5C6A A;  2KUM A;  1SMY C;  1AP0 A;  3KF8 A;  1V1P B;  3I73 A;  3Q6S A;  2NZ1 D;  4MN3 A;  2E2D C;  5DM7 3;  3NBH A;  2Z4I A;  5D3D A;  1I4P A;  5M3F B;  1TS2 A;  4IAL A;  4WJW A;  3FEW X;  1T5E A;  1HTP A;  2HUG A;  3RLF A;  1UNS A;  1TU2 B;  4OHJ A;  4KKU A;  4Q0F A;  4A3F B;  3D4D A;  4NKL A;  4G7Z C;  2QIL A;  1CQF A;  3T56 B;  1Y1V B;  2EY5 A;  3KLS A;  1SFO B;  1SE2 A;  5C0X I;  2F0I A;  3FDT A;  2AUK A;  3OIQ A;  1EZ6 A;  2KEC A;  3GV6 A;  1LTS D;  5TSS A;  2AQ2 B;  2A6H C;  5FOB B;  4KMU C;  3HS0 C;  4KN7 C;  2Z8L A;  1PRT C;  1CK1 A;  1A2U A;  3NUC A;  1H9K A;  2Q8I B;  1FR3 A;  2K7V A;  1PTO C;  3HZX A;  3QJY A;  5CBA E;  2L5T A;  1ZYR C;  4K6L A;  1YNJ C;  3CQZ B;  4P2C B;  1K8M A;  3G7L A;  1SNC A;  2FMC A;  2XVS A;  4K5V A;  5ELC A;  3FVQ A;  1D2B A;  5KGU A;  2KED A;  4HN7 A;  3OPO A;  2OXP A;  4FO2 A;  4FF4 A;  1EEI D;  2E75 C;  5G3L D;  1EU3 A;  2B2V C;  5ELF A;  2DY8 A;  1DXM A;  1S5F D;  1ROD A;  3S15 B;  1II3 A;  4RGN A;  3SR1 A;  3H0G B;  4CKB A;  1PFN A;  5IOD A;  2HCI A;  1KAB A;  2WV6 D;  3TDQ A;  1EY5 A;  1HA6 A;  4A3J B;  1SNP A;  2PMZ B;  4X3K A;  4PMC A;  1EIH A;  2D5D A;  2SNM A;  1BUV T;  4L8J A;  1LV9 A;  1PZK D;  3OHX C;  4HSV A;  1HTL D;  3TSS A;  3H6M A;  3IKJ A;  1SEB D;  3PUV A;  5FK9 C;  3ERQ A;  3N52 A;  2NVT B;  4A3M B;  4ZKC B;  3S16 B;  3LWU A;  1HPC A;  2RSN A;  1FD7 D;  1CI3 M;  3J80 E;  5IGG A;  3ERO A;  1OXS C;  2B2Y A;  4DNR B;  4ZLT F;  1R9T B;  1CA6 A;  1WCM B;  4OIK A;  3BVG A;  2RBM A;  3DXJ C;  3RD4 A;  1RCV D;  2VUM B;  1O7Z A;  4KKT A;  1DCZ A;  5IGD A;  2K04 A;  3NWT A;  2EOT A;  3C1F A;  1JB3 A;  2ID0 A;  1EWH A;  5LHY 1;  1SMY D;  1QNU A;  3HP3 A;  3SHL A;  2RDH A;  1JWM D;  5ELE A;  3LNN A;  4DK0 A;  1IYV A;  1QG7 A;  1GUT A;  1I3Q B;  1O7L A;  4R8I A;  3C3L A;  3HOX B;  2OEO A;  2D9U A;  5KND A;  3I8Z A;  4ILW A;  2J4X A;  4KD3 A;  2K5D A;  1NR4 A;  2IL8 A;  2FFK B;  2JSO A;  3FPP A;  3J80 L;  1EL0 A;  4KY6 A;  4DK1 A;  1PFM A;  5CV9 A;  3RMH A;  3K7A B;  3PIP 3;  1JCK B;  2FIN B;  1XX8 A;  2EJG C;  2CQA A;  1STG A;  2F0U A;  3Q0A A;  4ZQ3 A;  3Q23 A;  4C3H G;  4RKL A;  2QDB A;  1TKW B;  1Z6H A;  3K5L A;  5E1F A;  4FYD A;  5JPM C;  1SYE A;  3VR4 A;  3A7A B;  1U4R A;  4R8N A;  3BYT B;  2NTT A;  2B2U A;  4M8A A;  4ZUJ A;  1A15 A;  2BE5 C;  4KJN A;  3MA2 B;  5CBE E;  1JE4 A;  1CA5 A;  2A6E D;  2F0K A;  1D5Z C;  3EJI A;  2AWO A;  3RZD B;  3T4A C;  4Z9C B;  5C3X A;  1YNJ D;  1CHP D;  4B9W A;  1Z47 A;  2F4I A;  5C4H A;  3OW7 A;  5EPL A;  4BWG B;  5M5X B;  1C8C A;  5C44 B;  4C1N K;  3V05 A;  3T13 A;  1S5C D;  4IUV A;  1GHJ A;  3MAQ A;  2ZXR A;  3DEP A;  3VA7 A;  1KLU D;  1RHP A;  3NK9 A;  3VYS A;  2GA4 B;  4KV6 A;  1M4V A;  4ABN A;  5CR3 A;  4C3I B;  1STB A;  3PUW A;  4KK7 A;  1PMR A;  3HRZ C;  2LKV A;  3H09 A;  1LO5 D;  2JP1 A;  3QOJ A;  5IIF A;  2DNE A;  3H3V C;  1PXU A;  1SYD A;  5JEA G;  2QKI C;  3A8K E;  4HTH A;  5K36 G;  3GTK B;  1HFN A;  3E5S A;  3MHB A;  4NP5 A;  1C48 A;  2EJF C;  1BCP B;  3QO2 A;  2KJX A;  2BDO A;  1EIG A;  4HAE A;  5HGT A;  2XRQ D;  2PNR C;  1RTO A;  5D3I B;  4LMQ D;  5CV8 A;  1S5B D;  5IT9 E;  4JK1 C;  2WKD A;  1DOK A;  3X3M A;  2RQX A;  5I2Y A;  1Y8O B;  4EQN A;  2EYP A;  4F7X A;  2K5W A;  4EQP A;  1TR5 A;  1H9R A;  3A54 A;  1KDA A;  2K33 A;  1LTI D;  1U4P A;  5CV4 A;  4CKE A;  2O5J C;  1L0X B;  2B2V A;  2F0V A;  2SNS A;  1OO9 B;  4U68 A;  4IUQ A;  3NQT A;  2JE6 I;  2F03 A;  4XT1 B;  1H9S A;  2LFN A;  3HGB A;  4RCN A;  1LT4 D;  1E0B A;  3FMC A;  1ILQ A;  2TSS A;  3KBX A;  4FXD A;  2EYL A;  1JWU D;  2E2H B;  1BO0 A;  1DM0 B;  1WTQ A;  3V96 A;  4LJZ C;  3GTJ B;  5IT9 L;  1DYQ A;  1I4Q A;  3QWN A;  2C5C A;  4NDX A;  3VYU A;  3DHQ A;  2K32 A;  3MZ5 A;  4X3S A;  1JIC A;  1F2L A;  4XXE A;  4RGM A;  3DWP A;  2NB0 A;  1W6J A;  3HOU B;  3MXP A;  3VR3 A;  3RZO B;  4IUP A;  1S5E D;  4ZUI A;  3IL8 A;  4NW2 A;  3R2I A;  1WVL A;  4O42 A;  2ZT9 C;  2MUY A;  2F0G A;  2OT2 A;  4XYQ A;  2F0H A;  3J7Y W;  2MPM A;  2WAQ B;  2O5I C;  2VB3 X;  2DY7 A;  3URY A;  3HEJ A;  4IFD J;  2F0E A;  5EGT A;  3C1E A;  2F0L A;  1HRJ A;  4U67 3;  1TII D;  5I6W A;  3DUZ A;  3PUY A;  1DOM A;  4XIG S;  4KY7 A;  1QWY A;  1PYW D;  2RVL A;  4ODG A;  1KDC A;  2Z4H A;  4BBS B;  3C46 A;  2G9H D;  3SDZ A;  1G2T A;  1V1P A;  3DWQ A;  3VR2 A;  1WD1 A;  2EJM A;  2JXM B;  3I91 A;  1Z7T A;  3KUP A;  5KYL A;  1WTO A;  3IFT A;  1D5X C;  4IUN A;  1DOL A;  5ISR A;  3OWE B;  1CHQ D;  2B2T C;  1AN8 A;  1OXT A;  1A6X A;  3DM1 A;  5D14 A;  5E3F A;  3VR5 A;  5J22 A;  2EYM A;  1TY2 A;  3MWY W;  1IYU A;  4F8M A;  2E74 C;  4PQX A;  4E6I A;  1F9P A;  2FJ2 A;  2MJ8 A;  1TWC B;  3LX0 A;  1HCZ A;  5C4J B;  3CKI B;  3P1H A;  3FRP B;  4LAA A;  1GOZ A;  2I46 A;  1EU4 A;  1EYA A;  1KNE A;  2IT1 A;  3TP8 A;  4FP5 D;  2XWJ B;  3BYY B;  2NVQ B;  4IUT A;  4CJ2 C;  2LS0 1;  1ONL A;  5A35 A;  5J1Z A;  2L1B A;  3OIP A;  2MHV A;  3BDO A;  4K8I A;  1GUO A;  1V8Q A;  3OOC A;  1TT2 A;  2D2C C;  1B50 A;  1YNN D;  5I9O A;  1SDF A;  1BCP C;  5C4Z A;  4RGT A;  1TS5 A;  2PZU A;  1IW7 D;  3E6Z X;  2KHS A;  5KYI A;  1B9M A;  3I90 A;  1I4R A;  3BDC A;  3VYT A;  3EFX D;  1SJH D;  2V4D A;  2A68 D;  3PMF A;  3M7N A;  3Q22 A;  3MVV A;  2WIN B;  2IX1 A;  4CJ1 B;  4PV1 C;  3CU7 A;  2YU9 B;  3J7A V;  4IN3 A;  3QB3 A;  1ILP A;  1MD2 D;  4KD4 A;  5FKA C;  1KNA A;  5JVG 3;  1MI2 A;  2F0P A;  3SVM A;  1U4L A;  1RDP D;  1KLG D;  2NVY B;  3TBI B;  4RCO A;  3W2D A;  1WTV A;  2QCP X;  5FO7 B;  5HUR A;  5KNC A;  2N88 A;  1JOO A;  4EVO A;  3K5N A;  3T51 B;  3GTM B;  2B2W A;  3GTG B;  1G6Z A;  2HDM A;  3SXH A;  3OWF A;  4CKC A;  3VA5 A;  4ID6 A;  2IX0 A;  5CV7 A;  1WTP A;  2JYO A;  1FNW A;  1XXG A;  3OMC A;  4BS9 A;  4F88 A;  2CW0 D;  4WFN 3;  3NTI A;  4YIJ A;  2PYK A;  1HUM A;  4ZRZ A;  1J8I A;  1SND A;  2RA4 A;  1XWE A;  4UAI A;  4PNY A;  1STH A;  2L11 A;  1G8Z D;  4EGV A;  5C3E B;  2LY7 A;  5NUC A;  1GUS A;  4XQQ A;  5JAV A;  3M3Y B;  5M5Y B;  2K5Q A;  2Z1C A;  2EYO A;  2J7Z A;  3I4N B;  3QIA A;  3D4W A;  2A73 B;  2EPB A;  5CMD A;  1BDO A;  1UUP A;  1HXY D;  3QOL A;  3HOW B;  2R7Z B;  1QB5 D;  2JEA I;  3CHB D;  5ELB A;  2WP8 J;  3IAY A;  4RAU C;  4B08 A;  3MXG A;  4IFD G;  1WD0 A;  4RFB A;  3K57 A;  5IGC A;  1A2T A;  3PUX A;  1FNV A;  3D6C A;  3GV3 A;  4DA2 A;  1IKM A;  1E2V A;  5AFW A;  5LL6 X;  2F1M A;  4ZYS A;  4Y7N B;  3DWA A;  4C3J G;  3GQB A;  2HCC A;  3I70 A;  2ZXP A;  2AQ1 B;  3F2U A;  1VMP A;  3S1M B;  1R4P B;  3KLR A;  2F0T A;  1SYG A;  2NN6 H;  5DM6 3;  4I7Z C;  4A3D B;  2JA5 B;  2B39 A;  5JJZ A;  1ENF A;  2AUJ D;  1HQM C;  2PO4 A;  1EFI D;  5G3L F;  2EZV A;  1K83 B;  2AWN A;  1DD2 A;  1VCI A;  2F0J A;  3S1R B;  3K5M A;  3SE0 A;  2EE1 A;  2R6G A;  2ICE C;  3E0J A;  3M85 A;  1V43 A;  1CT1 D;  4ZKB B;  1EWC A;  1F9Q A;  1AEX A;  5FLX E;  5JPN C;  2A6H D;  3GTQ B;  1PRT D;  4FNF A;  3BVM A;  2IX3 A;  1Y69 U;  2A5H A;  3MEH A;  3T16 A;  2KCC A;  1R4Q B;  2PQE A;  3BZD B;  1DON A;  1PTO D;  1ZYR D;  2Q8R E;  2EYF A;  1X3Q A;  5COY A;  1JOQ A;  1KDB A;  1LAB A;  2X6G A;  2M2L A;  1BOS A;  2B2T A;  4IFD H;  4C3I G;  1U4M A;  4ZK9 B;  1J9O A;  1EQT A;  1BR9 A;  4BA1 I;  2XNA C;  3I3C A;  3BVZ A;  4C1N I;  4TSS A;  3WDN A;  4CJ0 B;  5KRU A;  3NHH A;  2YYZ A;  2IPK D;  1JOR A;  5FLX L;  4HSP A;  3TZU A;  2B2W C;  4QB4 A;  1STA A;  5I9P A;  4XT3 B;  5EJW A;  4HCE A;  5KIX A;  1MGS A;  4KKS A;  4MHE A;  1C4Q A;  3P20 A;  4TQU S;  3U9O A;  4WOR A;  3K58 A;  2CHB D;  3T53 B;  1I4G A;  5BN5 A;  2KVM A;  5DAU A;  2KQ3 A;  2R3Z A;  5BN3 A;  1GXD C;  1F9S A;  3VYR A;  3NPP A;  1E2Z A;  4N9P A;  1SSO A;  4BBR B;  1TWF B;  2BA0 A;  3M7G A;  2VB2 X;  1RKN A;  4FVM A;  1BF4 A;  1EOT A;  2F0N A;  3A7L A;  1QE6 A;  3A8J E;  3S14 B;  3NTH A;  3MC0 B;  3P75 A;  4TKO B;  1BCP F;  2B8F A;  4XTC S;  1TY0 A;  1OXV A;  2PW7 A;  5BN4 A;  3PO2 B;  1AW7 A;  1STE A;  1IHZ A;  2K01 A;  1F9R A;  1BNZ A;  3O13 A;  1JOK A;  1EY6 A;  5FO9 B;  4LK1 C;  4K2K A;  3NQI A;  1WTX A;  4IQZ A;  4RKB A;  2JA6 B;  3SK6 A;  5C0X H;  4FXK C;  2TMP A;  5C5L A;  3AB9 A;  1D1I A;  3MTS A;  4H44 C;  2I07 B;  4Q5V A;  4DGZ A;  1OXU A;  2B63 B;  3R8B A;  2WKC A;  1NSN S;  4A3K B;  5A2Q E;  1RF2 D;  2SDF A;  1Y8N B;  2L4N A;  1EY7 A;  2BCO A;  2O4X A;  2K1B A;  2NBF A;  1Y1W B;  5KNB A;  2SOB A;  4X3U A;  4V0B A;  3M4O B;  2DNC A;  2X6L A;  4A3B B;  1G2S A;  3EVQ A;  2NVX B;  4CGY B;  1ENA A;  5C4X B;  2F0W A;  1SYC A;  4HMI A;  4IFD I;  4DAV A;  3WOF A;  1QCB D;  1WTR A;  2F0F A;  1LTB D;  1Q1E A;  2HQE A;  1K8O A;  4KY5 A;  4QCL A;  1Y8P B;  5EKK A;  5A2Q L;  3JAM L;  2WII B;  1VDZ A;  3GD7 A;  3EA6 A;  2BE5 D;  4G57 A;  5IGB A;  1F2Y A;  4BY7 B;  4N9T A;  1TVX A;  5D65 A;  1HUN A;  2RDF A;  4DAY A;  1LT3 D;  4K5X A;  3CRK C;  1FYC A;  2D62 A;  5K5P A;  3GO5 A;  3ONA B;  4FF1 A;  4KHZ A;  3LWE A;  3K59 A;  1D5M C;  3HOV B;  1QOH A;  4J8Q A;  4JBW A;  4KHV A;  3CRL C;  4K8J A;  1PLF A;  3HOZ B;  2F3W A;  2IJ0 A;  1GUG A;  4G7H C;  5CYU A;  1SYB A;  5LL6 S;  4IZ8 A;  1LT5 D;  3FPU B;  1NUC A;  2PZW A;  5M9O A;  2F0S A;  5M5W B;  5IOC A;  2RSO A;  2N55 A;  3L3O C;  4DF7 A;  4QUF A;  1QNK A;  1S4Z A;  2EXZ A;  2G9D A;  4FXG C;  2B8G A;  2XN9 C;  1AZQ A;  5E4X A;  5I2X A;  2BDN A;  4PMW A;  5CV5 A;  3TN2 A;  1CTM A;  3A8I E;  1I4H A;  1EYC A;  5C0X J;  2F0Q A;  1I4X A;  1I50 B;  1ML0 D;  4H7B A;  5FO8 B;  3WOE A;  2H4O A;  3MXU A;  3R93 A;  1SYF A;  2M9V A;  1O78 A;  3N6R A;  4OO1 H;  2F0D A;  2E2I B;  4C2M B;  1TS3 A;  2O2L D;  1O7Y A;  1V1O A;  1EY0 A;  1MBY A;  1G29 1;  5KEE A;  1JQY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...