4KD3A

Crystal structure of staphylococcal nuclease variant delta+phs l25a/v66a/i92a at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4kd3A00
4S3SA 1EQVA 1U9RA 3D4WA 3D8GA 1TT2A 3EROA 4HMJA 5KIXA 4KD4A 1EY4A 3MHBA 2F0LA 4N9TA 5CV8A 5IOCA 2EYLA 4LAAA 2NUCA 3HEJA 4J1MA 3S9WA 1A2TA 4DGZA 5DAUA 4DFAA 4ZUJA 5F2DA 1STNA 4ID6A 1EY5A 5ISRA 2ENBA 1SNPA 3TP8A 3DMUA 1STAA 5EGTA 4PMCA 5C5LA 3P1HA 1JOOA 1STHA 4IUNA 5C4HA 3ITPA 2PZWA 3HZXA 1KDCA 2EYJA 3EVQA 4NDXA 4OL7A 5IGEA 3ERQA 4K5VA 5I9OA 5IIFA 3U9OA 1STYA 5IGBA 5JAVA 3SR1A 5NUCA 3C1EA 1KAAA 1TQOA 2F3VA 3TP5A 3P75A 4WORA 1AEXA 4PMBA 5IODA 1EY9A 3DHQA 5J22A 5J39A 4HTHA 3TP6A 1SYDA 4HMIA 4B9XA 3NQTA 1EY6A 3SHLA 4F7XA 1KABA 3C1FA 3NP8A 3EJIA 4PNYA 2F0HA 4KHVA 1II3A 3V2TA 2SOBA 4RKBA 5C5MA 1TR5A 3D4DA 4R8NA 2EYHA 2O4XA 3OMGA 2LKVA 2F0EA 5C6AA 4ZUIA 2F0FA 4B9WA 5I9PA 1A3VA 2F0GA 2SNSA 3MZ5A 1SNQA 2F0MA 2HQEA 3QB3A 3E5SA 4QF4A 5KRUA 1ENAA 2QDBA 2PZTA 1SNOA 4J6HA 5KYIA 2EY5A 5HURA 2WACA 4IALA 2EY6A 3LX0A 1STBA 1SYEA 4K5XA 2EY1A 1EY0A 2PZUA 5K5PA 1EZ6A 3OWFA 3MXPA 4EQOA 2PYKA 3RUZA 4E6IA 2F0KA 1SNMA 5C4ZA 5KEEA 2F0TA 2EXZA 4EQNA 3SK8A 2PW5A 3D6CA 2RBMA 2RDFA 2F0QA 3MEHA 3TP7A 1F2YA 2F0JA 2KHSA 5DEHA 4ZQ3A 2EY2A 3H6MA 3NUCA 4QMGA 5E1FA 2RKSA 2EYFA 1SYGA 4F8MA 2M00A 4EVOA 2PW7A 1JORA 3OSOA 5EKKA 4K6DA 3SXHA 1EYDA 1F2ZA 2F0NA 5CV6A 1RKNA 1A3UA 4WRDA 3TMEA 3BDCA 4K14A 5CV9A 4KTAA 2F0WA 4NMZA 2F0OA 1ENCA 2SNMA 3PMFA 5J1ZA 1IHZA 4NP5A 5CV7A 5IGCA 5KYLA 4H7BA 4KJOA 4RKLA 5CV4A 3VA5A 5I6YA 2OEOA 1EZ8A 5E3FA 2F0PA 4YIJA 2F0IA 4ODGA 4KJNA 5C3XA 3T13A 1SYCA 4KY7A 3BDLA 4MIUA 5CR3A 2F0SA 4K8IA 5CV5A 1SYBA 3NK9A 4TRDA 1JOKA 5I6WA 1NUCA 4QB4A 4G57A 3T16A 2PQEA 1KDBA 4I65A 3QOJA 4DU9A 5M9OA 3NXWA 1KDAA 1STGA 4K2LA 4N9PA 5JOBA 2KQ3A 2EYOA 2F0UA 3SK5A 4K5WA 4IZ8A 3SK4A 5C3WA 1SNCA 5HGTA 5CC4A 3OMCA 1A3TA 5CGKA 4KY6A 5IGGA 1SNDA 2F3WA 1EY7A 1A2UA 5IGFA 1EYAA 3MVVA 4KY5A 4K2KA 1EY8A 4NKLA 1JOQA 4KD3A 2EYPA 4ME5A 4K8JA 5KGUA 2EYMA 1NSNS 2OF1A 3NHHA 1F2MA 2F0DA 3QOLA 3SK6A 4KV6A 5EKLA 4DF7A 5IGDA 1EYCA 4EQPA 2OXPA 3R3OA 1SYFA 2F0VA
chains in the Genus database with same CATH superfamily
4OXPA 1BUVT 2IW3A 1FJGL 2F0LA 5EKIA 3LWUA 4IFDG 3FKIB 3J80L 4FYDA 1PZID 3HEJA 4J1MA 3I4LA 4BWGB 1JJ2A 4UAIA 1IW7C 2AQ1B 4LFCL 2B2YC 2C35B 4DV1Q 4X66L 4RAUC 4OL7A 4H0LC 1RJTA 3DEOA 1HR0Q 1MBYA 1PV4A 2R92H 1UEAB 5KNCA 1AEXA 2HCCA 1K9MC 3VYRA 4JI0L 3BG3A 5L37A 3C1FA 3EJIA 2JE6I 1PH8A 4KKTA 3NWTA 5CORA 2NVYB 2QW7A 4ALPA 1ML0D 3KLSA 2JYOA 3MFGA 2HQLA 3KDFB 3PO3B 4DR5L 2VW9A 1YZ6A 3CAMA 3LX0A 2R7ZB 4IPDA 4X62L 3RNUA 2PYKA 1CUKA 3DLLA 2VY3A 3TREA 5FLMG 2F0JA 4HIDA 5FO9B 1B7YB 1B3AA 3OHXC 1EYDA 3BZCA 4OONA 2ES2A 3J7AF 2K7VA 2F0WA 2H5XA 1VQ4A 1QVFA 2QCPX 1WCMB 3VA5A 3RZOH 1HQRD 3NENA 1P8LA 1EIGA 4DR4L 3UE0A 2NZOA 5CR3A 2QGQA 1BCPD 5CV5A 2R7FA 4PZ8A 2ZXOA 1PA6A 3NK9A 1Q1EA 5I6WA 5JPNC 1E2ZA 2VUMB 4A93H 3I4NB 3MXNA 4N9PA 1B53A 3SE0A 2NVQB 1CA6A 2R7ZG 4HCSA 2AQ2B 3TEHB 4NKLA 2B8FA 4ME5A 5KGUA 1NSNS 2LY7A 4KKSA 1RTOA 4DV6Q 3J80i 3GTJB 4J8QA 1ASZA 1I3QH 4C3JG 3E6ZX 2R7DA 1HZ9A 5IOCA 1EU4A 2UXCQ 2VQFL 1GUGA 1U0LA 4JI3Q 3I4MH 5EJWA 4CDDC 2BA0A 5ELDA 4ZUJA 3A5UA 1SNPA 3IFDA 1JB7A 5IYDG 2N55A 3J81E 2B39A 3P1HA 3MFYA 4DR1L 5JJKA 1D5XC 1YJ9A 3CCRA 5C4XG 5IIFA 3FVQA 4YWMA 1KAAA 2CCZA 1DOLA 4JYAQ 2VUMG 3TP6A 1SYDA 4R4TA 4A3FH 3I4NG 3TZDA 3A74A 3KF6A 4APVA 3S1NB 4OHJA 1HNXQ 4CGYB 4R4QA 1X3FA 2ALYB 4JVZA 4ZUIA 4Y7NH 4O0AA 1YJNA 4QIWB 3STBD 2K5DA 1SMYD 3WWVA 2WAQG 3L3OC 1CFMA 3C46A 3EA6A 5IP7H 3HOYH 2I5MX 3S2HH 4NW2A 4XQQA 4QL5A 5M3MB 5K5PA 1EZ6A 3A55A 3VYSA 1TXYA 4IPCA 2EXZA 3GTQB 5ELFA 3MTSA 2RDFA 3S2DH 1IKMA 1VQOA 3TRZA 3CKIB 3KLSX 2KBNA 1D7QA 1LACA 1K0RA 4WRDA 1PRTC 1ET6A 2KHJA 2BH2A 5C0XI 4XDXA 4DK3C 2EPBA 1R9TB 4QCLA 3BU2A 5IGFA 1SXTA 1F9QA 1JE5A 3I56A 1HNWL 4KY7A 1T9HA 3MAQA 1EOVA 1HRJA 1AW7A 2HD3A 4K8IA 3PO2B 2D62A 5AJ3Q 2A74C 1SYBA 4B3SQ 1LTBD 3BYTB 4KN4C 4P2CB 1WTQA 4YY3Q 5D14A 4BY7G 2IT1A 4CKEA 5JOBA 1ZYRC 1GHJA 1E24A 2KQ3A 4KK7A 2EZVA 1SE2A 5CBEE 5IGGA 2F3WA 4FF1A 4X65Q 3Q8DA 2WV6D 2PQAA 3ICEA 2BE5C 1EIFA 1UUPA 1Q8IA 2OF1A 1ILQA 2A73B 4C3IB 2A6HC 4EQPA 1JE4A 4A3EH 1TS3A 2MHVA 2J7ZA 1V9PA 1CKNA 1DCZA 1LLRD 1X3QA 4KHPQ 1IBKQ 4RGTA 2WB1G 4JV5Q 4IUPA 3RR5A 4JOIA 1JR0D 1WOCA 4BY1B 1KLGD 1Q8KA 1KXLA 4A3KH 1VF5C 4IUQA 4GKKL 1C48A 4ZCKA 2HT1A 3MA2B 3N52A 3EVQA 5I4DA 2MNAA 2PQAB 1MD2D 5CYUA 2L15A 3BVZA 3PF4A 2PPBC 4DXFA 4DV2L 4HJ5A 1VQEA 3A8KE 2BA1A 3AB9A 2SOBA 3K0YA 3QB3A 5DM73 3E5SA 3H91A 2QDBA 3M3YB 1W3SA 4X64L 2ICEC 1XXGA 4I7ZC 1IYVA 2IPKD 4A3DB 3OWFA 1N36Q 1XJVA 3I7FA 1PTOC 1E2VA 4A3JG 5BN5A 3J81i 2F0QA 4QMGA 2M9VA 5GAEC 2D0PA 4O1NA 2NB0A 1XMOL 2F0NA 5AFWA 4L5SA 1XNRQ 5G3LF 1DONA 4DA2A 5TSSA 1GOZA 2SNMA 4NP5A 2OQKA 4H7BA 4IFDH 4ODGA 3WOEA 4YWLA 2MJ8A 2QEXA 3OPOA 2VQEL 3EQLC 1Y14B 4A3BG 3J81c 1QUQA 1HJPA 4M8AA 1VQIA 3OIQA 1QOHA 2G9HD 3NWSA 1MGSA 4ME3A 1KDAA 1N34Q 1I94L 1HZBA 2EYOA 1U4RA 3S1MB 2BH8A 4X6AH 3PIP3 1LTRD 2UXBL 4XIGS 3HKZB 4C3HB 1DOMA 2XIWA 4K8JA 2NN6G 2EYMA 2ZJQA 1Z47A 1ICFB 3PUXA 1EYCA 4U68A 1ONLA 4A3GG 1HXYD 1P16A 3D4WA 3D8GA 3DWAA 1B3QA 4JC0A 4L5TA 3K5NA 1DD2A 4LAAA 3HOVB 1O7ZA 1QUQB 1C8CA 1D1KA 3UDFA 2JA6H 4YCWA 4PMCA 3X3MA 3X3NA 3DXJC 1VQ5A 3FKIH 1LT5D 1Z6HA 1ZKOA 3CMAA 2ZTCA 1N33Q 3HG9A 3A54A 2F3VA 1IBLQ 2PMZE 1VDZA 2Z8LA 3GV3A 1BDOA 1VQJA 1WYDA 5CBAE 1BBWA 1YNND 2KHIA 2CVRA 2Y0SG 4P71A 5FLXL 2EQSA 4X3KA 5C6AA 1Q7YC 3HOXB 4OEMB 1H9SB 1GUOA 1PTOB 4B3ML 5ELEA 1DXMA 1L1OA 3HOZB 2HCIA 3LWEA 2NVYH 4JI4L 3AFPA 4EQOA 4FNFA 4DR3L 3HGBA 2I07B 3H3VI 4CJ1B 3PO3H 2VXWA 3C3LA 3D6CA 2JA5G 4Y7NB 2RQXA 3HOVG 1TWAB 4R9WA 1VQKA 2R7ZH 4V190 3I70A 1IW7D 4PZ6A 5ELOA 5EKKA 4HSPA 1F2ZA 3CQZH 1FD7D 4F88A 2WAQE 4JI2Q 5CMDA 1QG7A 2H4OA 3PIO3 2IHFA 5E3FA 3IRBA 3S2DB 1AZPA 2UUAL 2OWOA 1SRUA 4DAMA 2UUBQ 3BVMA 3EIVA 3PGZA 2JP1A 1JOKA 1V1PB 3PSIA 3H0GB 3HOUG 4G57A 1WCMH 1VQBA 3H15A 3QOJA 4B08A 2MQHA 3CC2A 3J7YW 4A3MB 2A68C 1PFMA 1VQAA 2RHQB 3R2TA 1H9JA 4GN4B 1SNDA 2VUMH 3HOZG 2BCOA 1UE6A 1G2SA 3G7LA 4L5RC 3I4NH 2QILA 4Y52H 3T56B 2JA8B 2F0DA 1O7LA 2NVQH 1WI5A 3TSSA 2F0VA 1KC8C 5JJIA 1UNSA 3RLOA 4C1NI 2EYLA 4LF8Q 1Z9FA 2UU9L 2ENBA 3GTJH 3DMUA 3V05A 4IJHA 1BKBA 1SSOA 1CZWA 5C4HA 4A3EB 1RL2A 4B3RL 4B3TQ 5C44B 4FDBA 4BXXG 4DR2Q 1WTPA 5JAVA 1X55A 5IYCH 5A35A 3S16B 2RDGA 4MZ9A 3P75A 3CCMA 1FNWA 4UP8A 2VNUD 2Q2UA 1S5CD 2F52A 5LMNQ 2FMCA 1Q86C 3BDOA 2E74C 2O4XA 1TWGB 3WOFA 3SK6A 4DR7L 3T1HL 1O7YA 1TIID 4NPSA 3S1NH 3I3CA 1HHVA 1V1QA 3TS2A 4RG1A 3UDIA 1UE1A 2X69A 5JVH3 2PZUA 2JEAI 1NBWA 3CU7A 4E6IA 4RFBA 5EQ0A 1LM0A 4DV7Q 2WP8J 1C7YA 5E1FA 3G4SA 1LT4D 2K5HA 5M3MH 1HTPA 4K6DA 1RKNA 3GTQH 1EFWA 2PCFB 2F0OA 3K5MA 5EPLA 1K8GA 1A62A 4GOPA 5LMNW 1U5KA 3K5OA 4FVMA 2Q8RE 1SYCA 3M9BA 2ATWA 1OTCA 2XSCA 1I4PA 2AKWB 1JWSD 2NVTH 4DK0A 3ULPA 1IXRA 1J5EQ 2UUCQ 3L9AX 1A63A 3NXWA 1PH7A 3NSWA 3PO2H 5C3WA 1KTKA 1SNCA 4AQYQ 3J80E 4XYOA 1UEBA 2YU9H 4DR6L 2Q2IA 3JC66 3SDZA 4KD3A 2AWOA 4GKJL 1KL9A 3GD7A 1A0IA 4DF7A 1VQ7A 1HCZA 5JEAG 1IYJB 3R3OA 2MPMA 3BDCA 5DLQE 1ENCA 2IX1A 1Q46A 1EQVA 1CHPD 2A6EC 2HIVA 4HJAA 2K03A 3I72A 4IUVA 1N32L 3AYHB 3JAML 5C0XJ 4C3IH 4C2MB 4A3IG 2VB2X 1GUTA 1JOOA 1STHA 4A3JH 1V8QA 4OX9L 3S15B 3U50C 4O42A 1WTHA 1LTAD 3QG1A 4K0KQ 4Q5VA 2D5DA 4BY1H 1TQOA 1A15A 3OOCA 2Z6BA 1O78A 2V4DA 5EPJA 4AH6A 3W2DA 2Z1CA 1FGBD 4B9XA 1T5XD 3V96A 2F4VQ 2TSSA 3H3VC 4DV5L 1PXUA 1ZYRD 4YHHL 2EIFA 3HS0C 2ZM6L 1SMXA 2ZJPA 3KFUA 3KDFA 4QF4A 4CDCC 3CCVA 4A3BH 4LW1A 5KYIA 1XPUA 2BE5D 1STBA 4Z9CB 4GNXC 3GTOB 3Q24A 5J3BA 3I55A 1TWFB 3GTGB 2JA7G 2JK8A 1BCPF 2A6HD 1F2LA 4RH6A 2Y0SE 3M3YH 2RBMA 4U673 1G51A 4IFDJ 2B2TA 4JI8L 1HPCA 4A3DH 2NN6H 2WINB 4L5QA 1SN8A 4UHVA 3VYUA 1CHQD 3ERSX 1STEA 5I6YA 4DV6L 2E5LQ 1B8AA 3OW7A 3DEPA 3BDLA 2Z6KC 1E7ZA 1E3PA 4JI3L 1SE3A 1GUNA 4N8FA 4QB4A 4ZLTF 3CQZB 3CRKC 1Y8NB 3K7AH 5GAHC 3GTMB 4C3JB 1GJXA 3A0JA 4JG2A 4MN3A 2PMZB 1L0YB 4UY8C 1HR0W 1V43A 4BBRG 1Y69U 2E76C 1HUNA 3RLNA 3UE1A 3G71A 1Y1VG 3K7UC 2OQ0A 4ZK9B 4JYAL 2FINB 2JXMB 2UXDQ 1VQCA 2K5WA 3S1MH 2KJXA 2B2YA 5C4XB 3E3XA 1PTOD 2OEOA 3MEFA 3S1RB 3JAMi 1HNXL 5KIXA 4DV3Q 4C3HH 3K0XA 2K01A 1SJHD 4LF7Q 3L2PA 2NTTA 5JPMC 2N3SA 1JC7A 4ZAIA 4DNRB 1LABA 1CQVA 5JJLA 2NBFA 3FPUB 4BA1I 4JBKA 1YITA 2NWGA 3HOVH 1PZJD 3IKJA 2K5QA 3K59A 1KD1C 3SR1A 1BO0A 4UDUC 4FP5D 1B9NA 2WKCA 2WAQB 5IODA 4HTHA 1CKMA 4F7XA 4JI0Q 1H9KA 1KIXA 1CQFA 4R8NA 2EYHA 3K80C 1NR4A 3RN5A 1XYIA 4LJZC 1VQLA 2CQAA 2D9UA 1BF4A 3A7AB 3VR5A 1SLJA 3CPWA 1KQSA 4B3SL 1J6QA 4CBVA 3HOXH 2BDNA 4DR5Q 4YY3L 4P73A 1VS0A 3BS1A 1PTOH 4RMFA 1K8AC 3J80c 4UP7A 1WD0A 3HOWG 3HOZH 4F87A 1MJCA 1PLFA 2CW0C 1F77A 1HA5A 5IYBH 3VA7A 3A56A 4XQNA 4BY7B 1XWEA 2PNHA 3B6YA 3CCSA 5IT9L 3GTLH 1NTGA 2I0QA 1S5FD 1H95A 4DV4L 1TWAH 3PMFA 4V0BA 1HUMA 1I4GA 3F2DA 4LUVA 2R93G 1RODA 2HDMA 4LF9L 3E0EA 4JI7Q 3M4OB 3GTPB 2RCFA 4KHPL 4JI1L 1IBKL 4DR4Q 4IOAA 2Z9HA 4JV5L 4PV1C 1GVPA 1NUCA 1KAWA 5COYA 4HEDA 2RCNA 3UDGA 4OO1I 5K36G 2L1BA 1V1OA 4QGUA 3S14B 4JCVE 2WB1B 2I5LX 1YEZA 5CC4A 3KF8B 3H0GH 2XGTA 1EY7A 1A2UA 3T1YL 1PHJA 5BN3A 4HCEA 2NVTB 2DNEA 1S5DD 4A3MH 1IYUA 4JOIC 4GLVB 2G9DA 3BZDB 4KV6A 1LTID 3URYA 3EROA 1TT2A 4DUZL 1XPOA 1CI3M 2A8VA 1J8IA 1EOTA 2NUCA 1G8ZD 2YU9B 2JA8H 1AE3A 5DAUA 4DFAA 1EQRA 4RCOA 5HGQA 1ASYA 1STAA 1YNJC 1RHPA 3KBGA 5M5XH 4DUYQ 1EIHA 1K8MA 4QQBX 2A5HA 1N36L 4N8X1 3K6OA 2L11A 3LGJA 4DR1Q 1QNKA 1K28A 1JWUD 2B63G 2ID0A 1MI2A 4BS9A 1EWIA 4HMIA 5C44H 2CFMA 2KEEA 4A3JB 4PNYA 3S16H 1B2TA 1II3A 2CH4W 2A68D 2CQOA 2X6GA 2YV5A 2N78A 2F0FA 3S17B 4B9WA 2F0GA 3H09A 3NQIA 2F3IA 4CJ2C 1E22A 2DJFC 1GUWA 1TWGH 4LF6L 2EY1A 4CDEC 5C0XH 1CSQA 1LTSD 5FO8B 1XTDA 4OELB 4PZ7A 3E9IA 1NCVA 4BA2I 3K58A 3L0OA 1XTCD 1XMQL 4A3BB 1PH6A 1KHIA 2KOLA 1TWHB 1PVOA 2AUKA 2B2UA 1JORA 5GROA 2KUMA 4IO9A 2AMCB 5JEAH 1PYBA 4K14A 1IHZA 4FO2A 4YCVA 1ILPA 2ZT9C 2F0IA 3KLRA 4MTKA 1Y1WG 2E2IH 1JJCB 1PH2A 3C2PA 1I6HB 1HNWQ 4TRDA 3FEWX 4FXDA 3NBIA 1NE3A 3EBEA 4A3GB 3D31A 3DM1A 1PRTB 3TQYA 2KENA 1STGA 3TZUA 1EWCA 3KBXA 2QA4A 4IZ8A 5HGTA 2DJGC 2VZAA 1L0WA 2KVMA 2HHHL 3G6JB 3RD4A 2ZXPA 3MVVA 3F2UA 4K2KA 5I2YA 1VQFA 1BQQT 3K7AB 1FVIA 3ULLA 2DY7A 1F9SA 3OW2A 1SBBB 1HQMC 4KJNA 3GO5A 3S1QB 2B2VA 1OO9B 4EX5A 4KD4A 1EY4A 3CCLA 2R61A 1PYWD 1G291 4RHSA 2RVLA 1A2TA 3CPFA 1JCKB 4ID6A 2EXDA 5F2DA 2Y0SB 2VS1A 3ND8A 1YHQA 4GKKQ 5I9OA 4C2MH 2YTYA 1E0BA 5A2QL 1IL2A 3CC4A 1CT1D 1F9RA 5J22A 3CCQA 5J39A 2XWBB 3J7AV 3S15H 4K6LA 1L1OC 1I50B 1TS4A 3Q23A 2IJ0A 2JA5B 2R92G 2WIIB 1IBML 1S5ED 3CC7A 4XYQA 5M5WB 1H9SA 2SNSA 3QWNA 5LMUQ 2A69C 2FXQA 1JICA 4R4OA 1VQ8A 2EY6A 4L63B 5FLMH 1JJGA 4DNTB 2NZHA 2HIXA 2RHSB 2HUGA 1X56A 2A6ED 2PW5A 1D6EC 4HIOA 3CCEA 1F2YA 5DEHA 2EYFA 4HN7A 3GTOH 3HOUB 3VR4A 4LFAL 1TWFH 3GTGH 2P5ZX 2YYZA 1RCVD 3SXHA 1PYSB 4IN3A 5CV6A 4KKUA 1BR9A 5G3LD 4DV0Q 5IGCA 1TS5A 4RWSC 3CXCA 1I4QA 1T5EA 4JI6Q 3ZJYC 1HA6A 1UE7A 3AMUA 5C4JB 3PQIA 1YHAA 1V1PA 4KI0A 2GN5A 3OTOQ 4LF5Q 2DUDA 2XVSA 5ELCA 3GTLB 4JI5Q 4DU9A 2BOSA 2F0UA 4LUOA 4K5WA 1D2BA 4B3TL 4CJ0B 4DR2L 1I94Q 2OTJA 3M4YA 1JT8A 1FGUA 4TSSA 4A93G 2FHTA 1EWHA 3GTMH 4C3JH 3RZDB 3KJOA 2EJMA 1B44D 1C9OA 4GS3A 3OYYA 2JN4A 2UXBQ 2MUYA 2E2JB 5LMNL 2AQ3B 1NMFA 2JSOA 5FO7B 4S3SA 1U9RA 4PG3A 3MHBA 3J81j 5IYDH 1RDPD 5T1GA 1SE8A 5C4XH 3HFZB 5ISRA 4OIKA 3U4VA 5FOBB 3S1RH 1DOKA 3AU7A 1Q81C 1JQYD 2K4KA 2EYJA 3HOWH 2MGSA 3GP7A 1M90C 1E1OA 1STYA 4H44C 5IGBA 1OXSC 3KK7A 1OXTA 1HTLD 1DGSA 2G5DA 2IY5B 4P74A 1U4MA 1YHBA 3FP9A 1K8OA 3I91A 2JEBI 5M5XB 3EN2A 2OTLA 2F0HA 2Z4IA 4LF4Q 3H3VH 4FF3A 2KECA 2OT2A 2LKVA 3FMCA 5I9PA 2E2HH 2F0MA 4GZYC 1PH9A 4LFBQ 2NYZD 1WVLA 3T4AC 1AZQA 1EEID 2F03A 4B3MQ 1PH3A 2FMMA 2IL8A 2RF4A 3MXPA 2E75C 1X3GA 3NBHB 5IY0A 2ZTDA 4GOPC 3TP7A 4DR3Q 2B2WA 2F4IA 1ET9A 3HOYG 2KHSA 4ZQ3A 2EY2A 3H6MA 2A1AA 3K81C 4QIWE 4TVAB 5FK9C 1IZ6A 3N6RA 4DK1A 5IWAL 1UWVA 5BR8L 3CF5A 1ESFA 3M4QA 1QNUA 1WTOA 4BY7H 1O80A 4NXNQ 3U58A 5H1SE 1XNQL 2UUAQ 1AP0A 1SJED 4IUTA 1LYLA 1D1IA 1SFOB 1OXXK 1E2WA 3M4OH 3GTPH 1JWMD 1PH5A 2E2IB 1G2TA 5CGKA 4K0KL 2VB3X 3JAME 1NJIC 4A3IB 3UI2A 1EYAA 1LTTD 2IWHA 1ZXTA 1EY8A 1GKHA 1IKLA 2EJFC 3S14H 1FNVA 4DAPA 3FPPA 4OO1G 4PQXA 1S4ZA 2QF7A 3TN2A 5KNDA 4WFN3 5FKAC 3NELA 2C9OA 5E7NA 3CRLC 2CW0D 1OXVA 2MO1A 4DV1L 4DGZA 3I8ZA 4RGMA 3PUWA 1GD7A 2JQOA 3A5ZB 3TP8A 5C5LA 2UU9Q 4ABNA 1SROA 2PZWA 3HZXA 4X3TA 1HR0L 3GV6A 3ND9A 1Q90A 1WTXA 4A3KG 4B3RQ 3OWEB 2A19A 3PF5A 1R4QB 4LMQD 4PMBA 4C56C 1LUZA 1EY9A 3I73A 1I4XA 3J7A5 2JA7B 5JVG3 3AEVA 3BZKA 1B70B 5C5MA 4ZKCB 1QVCA 1X54A 1Y1WH 2L9HA 1VQ6A 4BBSB 2E5LL 2JA9A 1PRTD 2CWAA 5KRUA 1FNUA 1SNOA 3QIAA 2LXKA 2CWPA 4WJWA 4R4CA 2B2TC 3T1HQ 1EL0A 4IALA 5DM63 2LSSA 2SDFA 1EY0A 3S17H 5I2XA 1RF2D 5JEAJ 4XXEA 5EAYA 1VQDA 4NXMQ 3W1BA 1YNNC 3NUCA 4DPGA 4QUCA 3VR6A 2O5JC 1EEFD 2GVAA 1N9WA 2LFNA 3OSOA 2TMPA 4R4IA 4IPHA 4TQUS 1YNJD 1HNZQ 1WFQA 5J1ZA 3L7ZC 4BBRB 1K0SA 5KYLA 1TWHH 1ZEQX 1Z7TA 2EOTA 3PV0A 4RGOS 1Y1VB 1PH4A 2PI2A 3M7NA 1SE4A 2Q2TA 2K33A 4AYBE 4WJ3M 3CHBD 4PMWA 1FYCA 4DAYA 4LF7L 4A76A 2K28A 1XX8A 3W5OA 3J7ZC 3P20A 2EVBA 2K1BA 4K2LA 4BBSG 1I6HH 3SK5A 4XTCS 1ESRA 2XRQD 3PIPA 2NVXH 4MTNA 2D0OA 4A3GH 1HFNA 4IJLA 1H9RA 1GXDC 5DNFA 2K14A 4JBMA 1W6JA 1JOQA 1D8LA 2KCTA 1A6XA 3NHHA 3G6EA 4DR6Q 3F8TA 2R6GA 4HR7B 1F9PA 2OXPA 1QZGA 2UXCL 3PUYA 4GKJQ 3Q22A 4LNQA 1TVXA 3NPPA 1PMRA 3P7JA 4DAYB 2FJ2A 1VQHA 3HKZE 3SGIA 1W6KA 1X3EA 4OWWB 1YBYA 4JK1C 3S1QH 1N32Q 4DN4M 1KNEA 1JMCA 2RDHA 4EGVA 1I6VC 1EUJA 5IE8A 2DY8A 4K5VA 4OX9Q 2JA6G 1X6OA 4QJFA 4WORA 3D0FA 2V1CC 3NTIA 4HAEA 5IP9G 3FKIG 1PDQA 2ZTEA 1KRTA 4YWKA 3SHLA 3NP8A 5E4WC 2QKIC 3SVMA 2L4NA 3HOWB 4GNXA 1J9OA 1MHWC 1FJGQ 2BDOA 4DNIA 4DV5Q 1M8AA 4YHHQ 4KMUC 1ENAA 1I50H 2ZM6Q 2N88A 4JI7L 1AFPA 4LFCQ 2RSNA 1B9MA 5C3EB 5ELNA 5HURA 2JA5H 1NNXA 2AHOB 3T53B 5IT9E 4X66Q 4A3LG 3BYYB 3HKSA 4OIJA 5M5WH 4IUUA 5M3FB 1FL0A 1TWCB 2R93B 4C1NK 1EFID 1XPRA 4OWTB 3MEHA 4GLXA 2E2HB 3JAMc 3H94A 2RKSA 4EQ5A 5BN4A 1TU2B 4RCNA 1N8RC 3PO3G 2Z6KA 1WTWA 3I2ZA 4JI8Q 2L0CA 4GNXB 3TS0A 1KRSA 5CV9A 2Q2HA 3PIOA 2IX0A 4NMZA 4NB3A 1JB3A 3VYTA 4KJOA 3K8AA 3LNNA 3HOUH 1Q12A 5AJ3L 1E1TA 2NZ1D 4MIUA 4FF4A 1EQQA 1YIJA 4X62Q 4CDFC 4FXKC 4QUFA 2I46A 4I65A 1B1ZA 1B50A 2M2LA 2SEBD 2B8GA 5C4JH 4DUYL 3BJUA 2LMCB 3KF8A 4X65L 3MXNB 1S72A 1X9NA 1WCMG 4G4KA 1SR3A 5C3EG 2DNCA 4IPGA 2A69D 1LT6D 4KY5A 3IL8A 5GADC 4HSVA 5M3FG 1BXTA 1SYFA 4HJ9A 4R1JA 3W1GA 4RGNA 1RD9D 1CM9A 1EQTA 3RZDH 2B63B 2LS01 1K83B 3S9WA 1LT3D 3KJPA 1STNA 2E2JH 4BXXH 2XWJB 1EY5A 5D3DA 2VL6A 1BVSA 3MXUA 4M1UB 1WTVA 2K05A 2MFIA 3R93A 4G7HC 2KEDA 3C1EA 3W3AA 1DM0B 1GUSA 3MWYW 1VQNA 3DHQA 4G7ZC 3QJYA 2ZJRA 4AIMA 5IYCG 1VQ9A 3KLWA 3J81L 3KF6B 4GN3B 3D4DA 3OMGA 2H1EA 2VQFQ 3DWPA 1CTMA 4J6HA 1QZHA 2B2UC 4IQZA 3A8JE 3O13A 5EPKA 2PO4A 1CSPA 1X65A 4P72A 1Y1WB 4X3SA 1AH9A 3SK8A 1NAPA 1W2BA 2B29A 1QCBD 5M5YB 4FXGC 1QE6A 1XNRL 2PW7A 1QWYA 3DM3A 2EJGC 4OO1H 3TMEA 3GTKB 3KOJA 1B4OA 5CV7A 4DK6C 5M3MG 5CV4A 5LL6S 1EZ8A 4YIJA 4DV4Q 2K04A 3M7GA 1YJWA 4GLAC 4LF9Q 1LV9A 1N34L 1YNXA 1KDBA 4JI1Q 3RN2A 1M4VA 3VR2A 5M9OA 5JJZA 4HJ8A 3SK4A 2B2VC 2F1MA 2N8NA 4IFDI 5LL6X 1S3OA 4G7OC 2XTIA 1SFOH 3T1YQ 3PO2G 4P75A 1F2MA 4MHEA 1FR3A 4ILWA 4A3IH 4HMJA 5KNBA 5T1IA 2ASBA 5A2QE 4N9TA 5CV8A 2NVXB 3Q6SA 1VQGA 1CKNB 5FJ8G 1Q82C 4DUZQ 2I5HA 1WTRA 5LMUL 1QILA 2E8GA 5EBCA 5IT9c 3QO2A 4IOCA 2R92B 3MXGA 4IURA 4LK1C 1N33L 1U4LA 1MSHA 2HDLA 1IBLL 4NDXA 4C3IG 1C0AA 5NUCA 3A8IE 3G48A 2K5NA 1BCPC 1PZKD 3KUPA 4JBJA 4A3CG 2CH4A 3D4RA 4WJ4A 2FFKB 3NQTA 1KABA 4BY1G 1BNZA 1TY2A 2Q8IB 4AYBB 3V2TA 4RKBA 3RLFA 4DV0L 2F0EA 1TY0A 4JI6L 1A3VA 2JA7H 2XN9C 2PZTA 5FLXE 3UDXA 1CK1A 3OTOL 1PH1A 4LF5L 1X3PA 1SYEA 4K5XA 3TDQA 3GQBA 4BBSH 3CD6A 4JI5L 2F0KA 2RSOA 5KEEA 4CKCA 2F0TA 4LF6Q 1LO5D 2K52A 2GVBA 1UAPA 1TS2A 5HY6A 1G91A 1PFSA 1EYGA 4XQJA 4DV2Q 3RZOB 1VQMA 1XMQQ 3CCUA 1M1KC 4X3UA 4HJ7A 1BOSA 2KA7A 4JI2L 3F2CA 4KHZA 1CA5A 1HFGA 4OGQC 3CMEA 1GM5A 1VF7A 1G6ZA 4JPBW 1C4QA 2UUBL 2R3ZA 4A3DG 2F0PA 4A93B 3T13A 1HZAA 1H9MA 1ICWA 2F0SA 4LUZA 1D5ZC 3WDNA 4X64Q 1YI2A 1YVCA 3FHWA 4BBRH 4CKBA 2PQEA 4AYBG 1Y1VH 3S24A 2MO0A 3PCOB 2E2DC 1RTNA 2PI2E 4ULLA 3CCJA 3OMCA 5IP9H 2MP1A 2IX3A 1I3QB 1XMOQ 2J4XA 1HH2P 3STBC 2ZXRA 1SMYC 4JW0A 2HHHQ 2EYPA 2DN8A 1AN8A 3I4MB 1R4PB 2JJQA 5EKLA 3ULJA 3MC0B 3VR3A 4DKAC 4LF4L 2K5VA 1MKHA 1DJRD 2VQEQ 3VDYA 4LF8L 1RIPA 1UE5A 4XT1B 1S40A 1G6PA 1KNAA 2AWNA 4A3LH 3T51B 3I90A 2IHEA 4HIKA 4LFBL 1K73C 3I4OA 5EGTA 3HKZG 4C3HG 2RA4A 2OCEA 1BCPB 3PUZA 4IUNA 2KCMA 3ITPA 5D3IB 1EU3A 5IGEA 4A3FB 2AUJD 2KCNA 5GQOA 1ENFA 2GA4B 3ER0A 4R8IA 4A75A 3CW2C 4DXGA 1D5MC 3NE5B 3S2HB 1TR5A 4H13C 3HOYB 3CP0A 2Z0SA 4J15A 1VQPA 2YTVA 1QVGA 4POGA 3ONAB 1IBMQ 3U4ZA 2B3GA 3DWQA 2HQEA 1SAPA 2B2WC 1A8VA 4NXNL 3ZYYX 3K57A 3I4MG 3HP3A 3M85A 1L1OB 4DV7L 2NTSA 3NBHA 3RUZA 2DGYA 4EQNA 3U9SA 2PNRC 5C3EH 4POFA 3R2IA 3OIPA 1SDFA 1Y8PB 1GHKA 3HOXG 1SYGA 4F8MA 3Q0AA 5E4XA 3IFTA 5M3FH 3PUVA 3R8BA 4EVOA 1TWCH 2R93H 3AQQA 3NEMA 4LFAQ 1A3UA 2K6AA 4A3FG 4L8JA 3TBIB 4RKLA 4ZRZA 5IYBG 3EFXD 4JBWA 5C3XA 1EIYB 1QJOA 5K36H 2XRSD 2XNAC 3HRZC 3A7LA 4H02A 3NTKA 3E0JA 2QDLA 3FRPB 1J5EL 2UUCL 4JI4Q 4O2DA 1Q3LA 1MSGA 5IP7G 1BBXC 4AQYL 2X6LA 2L12A 3DUZA 1HZCA 1A3TA 4KY6A 2WKDA 1AE2A 3IAYA 1Q1BA 1PFBA 2CKZB 4LWCA 2K32A 5LHY1 1BBUA 4RA8A 2O5IC 3GDEA 3QOLA 1CKOA 3H0GG 2ICIA 2N49A 2K75A 1LTGD 2WB1E 3SEBA 4A3KB 1WD1A 2CHBD 4KLKA 4I7AA 4A3MG 1S5BD 3D6WA 5FLXc 1VCIA 1NMGA 2EDGA 2Q8TA 1VMCA 2QEJC 4ZKBB 1MIUA 1MJEA 1KLUD 1PRTF 4YCUA 2B63H 1I4HA 1NR2A 2JA8G 1KDCA 1K83H 3FDTA 4TKOB 3ERQA 2D2CC 3U9OA 1K3RA 4NXML 3TP5A 1WJJA 3F1ZA 2YTXA 2F4VL 3KYHC 4MNOA 4KN7C 1EY6A 3D3RA 4UPAA 4KHVA 1HNZL 1L2FA 4A4IA 1CZGA 4A3EG 1QB5D 3MZ5A 5C44G 1SNQA 3BVGA 4L6TB 1L0XB 4HIMA 1NY4A 2EY5A 2J0TD 2WACA 4ZYSA 2KCCA 2L5TA 4QY7A 3F2BA 2EE1A 4FF2A 1IL8A 1SNMA 5C4ZA 1R9TH 5ELBA 1VMPA 1U4PA 1X32A 1TKWB 5C0XG 2M00A 1GO3E 3K5LA 2C5CA 5D65A 1I4RA 4DAVA 1O7IA 4GN5A 1SEBD 3QR8A 4KTAA 3M4PA 5IWAQ 3RMHA 2K50A 1DZ1A 5BR8Q 5M5YH 4DR7Q 5EBDA 5FJ8H 4GOPB 1K3BC 5GAGC 4CHTB 1LTLA 4Q0FA 3E9HA 3GTKH 2LXJA 2O2LD 2NN6I 4RHRA 3T16A 1XNQQ 3AFQA 1DYQA 2WFWA 4OWXB 3NTHA 2Z4HA 1I5FA 1PFNA 4A3CH 2UXDL 1OXUA 1Y8OB 2L55A 4XT3B 4DV3L 5IGDA 4UP9A 2JA6B 1PTOF
chains in the Genus database with same CATH topology
1BUVT 2IW3A 2F0LA 5EKIA 3LWUA 4IFDG 3FKIB 3J80L 4FYDA 1PZID 3HEJA 4J1MA 3I4LA 4BWGB 4UAIA 1IW7C 2AQ1B 2B2YC 4RAUC 4OL7A 4H0LC 1RJTA 3DEOA 1MBYA 1UEAB 5KNCA 1AEXA 2HCCA 3VYRA 3BG3A 3C1FA 3EJIA 2JE6I 4KKTA 3NWTA 5CORA 2NVYB 1ML0D 3KLSA 2JYOA 3MFGA 3PO3B 2R7ZB 3LX0A 2PYKA 2F0JA 5FO9B 1B3AA 3OHXC 1EYDA 3J7AF 2K7VA 2F0WA 2QCPX 1WCMB 3VA5A 1HQRD 1EIGA 5CR3A 1BCPD 5CV5A 2ZXOA 3NK9A 1Q1EA 5I6WA 5JPNC 1E2ZA 2VUMB 3I4NB 3MXNA 4N9PA 1B53A 3SE0A 2NVQB 1CA6A 4HCSA 2AQ2B 4NKLA 2B8FA 4ME5A 5KGUA 1NSNS 2LY7A 4KKSA 1RTOA 3GTJB 4J8QA 4C3JG 3E6ZX 5IOCA 1EU4A 1GUGA 5EJWA 2BA0A 5ELDA 4ZUJA 1SNPA 3IFDA 2N55A 3J81E 2B39A 3P1HA 3MFYA 1D5XC 5IIFA 3FVQA 1KAAA 1DOLA 3TP6A 1SYDA 3TZDA 3S1NB 4OHJA 4CGYB 4ZUIA 4QIWB 2K5DA 1SMYD 3L3OC 3C46A 1CFMA 3EA6A 4NW2A 4XQQA 5M3MB 5K5PA 1EZ6A 3A55A 3VYSA 2EXZA 3GTQB 5ELFA 3MTSA 2RDFA 1IKMA 3CKIB 3KLSX 1LACA 4WRDA 1PRTC 1ET6A 5C0XI 4XDXA 2EPBA 1R9TB 4QCLA 5IGFA 1SXTA 1F9QA 4KY7A 3MAQA 1HRJA 1AW7A 4K8IA 3PO2B 2D62A 2A74C 1SYBA 1LTBD 3BYTB 4KN4C 4P2CB 1WTQA 5D14A 2IT1A 4CKEA 5JOBA 1ZYRC 1GHJA 2KQ3A 4KK7A 2EZVA 1SE2A 5CBEE 5IGGA 2F3WA 4FF1A 2WV6D 2BE5C 1UUPA 1Q8IA 2OF1A 1ILQA 2A73B 4C3IB 2A6HC 4EQPA 1JE4A 1TS3A 2MHVA 2J7ZA 1DCZA 1LLRD 1X3QA 4RGTA 4IUPA 1JR0D 4BY1B 1KLGD 1VF5C 4IUQA 1C48A 3MA2B 3N52A 3EVQA 5I4DA 1MD2D 5CYUA 3BVZA 2PPBC 4DXFA 3A8KE 2BA1A 3AB9A 2SOBA 3K0YA 3QB3A 5DM73 3E5SA 3H91A 2QDBA 3M3YB 2ICEC 1XXGA 4I7ZC 1IYVA 2IPKD 4A3DB 3OWFA 1PTOC 1E2VA 5BN5A 2F0QA 4QMGA 2M9VA 4O1NA 2NB0A 2F0NA 5AFWA 5G3LF 1DONA 4DA2A 5TSSA 1GOZA 2SNMA 4NP5A 4H7BA 4IFDH 4ODGA 3WOEA 2MJ8A 3OPOA 3EQLC 4M8AA 3OIQA 1QOHA 2G9HD 3NWSA 1MGSA 1KDAA 2EYOA 1U4RA 3S1MB 3PIP3 1LTRD 4XIGS 3HKZB 4C3HB 1DOMA 2XIWA 4K8JA 2NN6G 2EYMA 1Z47A 3PUXA 1EYCA 4U68A 1ONLA 1HXYD 3D4WA 3D8GA 3DWAA 1DD2A 3K5NA 4LAAA 3HOVB 1O7ZA 1C8CA 1D1KA 4PMCA 3X3MA 3X3NA 3DXJC 1LT5D 1Z6HA 1ZKOA 3HG9A 3A54A 2F3VA 1VDZA 2Z8LA 3GV3A 1BDOA 5CBAE 1YNND 2CVRA 5FLXL 4X3KA 5C6AA 3HOXB 1H9SB 1GUOA 1PTOB 5ELEA 1DXMA 3HOZB 2HCIA 3LWEA 4EQOA 4FNFA 3HGBA 2I07B 4CJ1B 2VXWA 3C3LA 3D6CA 4Y7NB 2RQXA 1TWAB 4R9WA 4V190 3I70A 1IW7D 5EKKA 4HSPA 1F2ZA 1FD7D 4F88A 5CMDA 1QG7A 2H4OA 3PIO3 5E3FA 3S2DB 1AZPA 3BVMA 2JP1A 1JOKA 1V1PB 3H0GB 4G57A 3QOJA 4B08A 3J7YW 4A3MB 2A68C 1PFMA 3R2TA 1H9JA 1SNDA 2BCOA 1G2SA 3G7LA 2QILA 3T56B 2JA8B 2F0DA 1O7LA 3TSSA 2F0VA 1UNSA 4C1NI 2EYLA 2ENBA 3DMUA 3V05A 1SSOA 1CZWA 5C4HA 4A3EB 5C44B 1WTPA 5JAVA 5A35A 3S16B 2RDGA 3P75A 1FNWA 2VNUD 1S5CD 2FMCA 3BDOA 2E74C 2O4XA 1TWGB 3WOFA 3SK6A 1O7YA 1TIID 3I3CA 1HHVA 2X69A 5JVH3 2PZUA 2JEAI 3CU7A 4E6IA 4RFBA 5EQ0A 2WP8J 5E1FA 1LT4D 1HTPA 4K6DA 1RKNA 2PCFB 2F0OA 3K5MA 5EPLA 4FVMA 3K5OA 2Q8RE 1SYCA 2XSCA 1I4PA 1JWSD 4DK0A 3L9AX 3NXWA 3NSWA 5C3WA 1KTKA 1SNCA 3J80E 4XYOA 3SDZA 4KD3A 2AWOA 3GD7A 4DF7A 1HCZA 5JEAG 3R3OA 2MPMA 3BDCA 2IX1A 1ENCA 1EQVA 1CHPD 2A6EC 2K03A 3I72A 4IUVA 3JAML 5C0XJ 4C2MB 2VB2X 1GUTA 1JOOA 1STHA 1V8QA 3S15B 4O42A 1LTAD 3QG1A 4Q5VA 2D5DA 1TQOA 1A15A 3OOCA 1O78A 2V4DA 5EPJA 3W2DA 2Z1CA 1FGBD 4B9XA 1T5XD 3V96A 2TSSA 3H3VC 1PXUA 1ZYRD 3HS0C 4QF4A 5KYIA 2BE5D 1STBA 4Z9CB 3GTOB 3Q24A 1TWFB 3GTGB 1BCPF 2A6HD 1F2LA 4RH6A 2RBMA 4U673 4IFDJ 2B2TA 1HPCA 2NN6H 2WINB 3VYUA 1CHQD 1STEA 5I6YA 3OW7A 3DEPA 3BDLA 1SE3A 1GUNA 4QB4A 4ZLTF 3CQZB 3CRKC 1Y8NB 3GTMB 4C3JB 1GJXA 4MN3A 2PMZB 1L0YB 1V43A 1Y69U 2E76C 1HUNA 4ZK9B 2FINB 2JXMB 2K5WA 2KJXA 2B2YA 5C4XB 1PTOD 2OEOA 3S1RB 5KIXA 2K01A 1SJHD 2NTTA 5JPMC 1JC7A 4ZAIA 4DNRB 1LABA 1CQVA 2NBFA 3FPUB 4BA1I 2NWGA 1PZJD 3IKJA 2K5QA 3K59A 3SR1A 1BO0A 4UDUC 4FP5D 1B9NA 2WKCA 2WAQB 5IODA 4HTHA 4F7XA 1H9KA 1CQFA 4R8NA 2EYHA 1NR4A 1XYIA 4LJZC 2CQAA 2D9UA 1BF4A 3A7AB 3VR5A 4CBVA 2BDNA 3BS1A 1PTOH 1WD0A 4F87A 1PLFA 2CW0C 1F77A 1HA5A 3VA7A 3A56A 4XQNA 4BY7B 1XWEA 5IT9L 1S5FD 3PMFA 4V0BA 1HUMA 1I4GA 1RODA 2HDMA 3M4OB 3GTPB 4PV1C 1NUCA 5COYA 4HEDA 4OO1I 5K36G 2L1BA 1V1OA 3S14B 2WB1B 5CC4A 1EY7A 1A2UA 5BN3A 4HCEA 2NVTB 2DNEA 1S5DD 1IYUA 2G9DA 3BZDB 4KV6A 1LTID 3URYA 3EROA 1TT2A 1CI3M 1J8IA 1EOTA 2NUCA 1G8ZD 2YU9B 5DAUA 4DFAA 4RCOA 1STAA 1YNJC 1RHPA 3KBGA 1EIHA 1K8MA 2A5HA 3K6OA 2L11A 1QNKA 1JWUD 2ID0A 1MI2A 4BS9A 4HMIA 2KEEA 4A3JB 4PNYA 1B2TA 1II3A 2A68D 2X6GA 2F0FA 3S17B 4B9WA 2F0GA 3H09A 3NQIA 4CJ2C 1GUWA 2EY1A 5C0XH 1LTSD 5FO8B 1NCVA 4BA2I 3K58A 1XTCD 4A3BB 2KOLA 1TWHB 2AUKA 2B2UA 1JORA 2KUMA 5JEAH 4K14A 1IHZA 4FO2A 1ILPA 2ZT9C 2F0IA 3KLRA 3C2PA 1I6HB 4TRDA 3FEWX 4FXDA 3NBIA 4A3GB 3D31A 3DM1A 1PRTB 1STGA 3TZUA 1EWCA 3KBXA 4IZ8A 5HGTA 2KVMA 3G6JB 3RD4A 2ZXPA 3MVVA 3F2UA 4K2KA 5I2YA 1BQQT 3K7AB 2DY7A 1F9SA 1SBBB 1HQMC 4KJNA 3GO5A 3S1QB 2B2VA 1OO9B 4KD4A 1EY4A 2R61A 1PYWD 1G291 4RHSA 2RVLA 1A2TA 1JCKB 4ID6A 5F2DA 2Y0SB 3ND8A 5I9OA 1E0BA 5A2QL 1CT1D 1F9RA 5J22A 5J39A 2XWBB 3J7AV 4K6LA 1I50B 1TS4A 3Q23A 2IJ0A 2JA5B 2WIIB 1S5ED 4XYQA 5M5WB 1H9SA 2SNSA 3QWNA 2A69C 1JICA 2EY6A 4L63B 4DNTB 2HUGA 2A6ED 2PW5A 1D6EC 1F2YA 5DEHA 2EYFA 4HN7A 3HOUB 3VR4A 2YYZA 1RCVD 3SXHA 4IN3A 5CV6A 4KKUA 1BR9A 5G3LD 5IGCA 1TS5A 4RWSC 1I4QA 1T5EA 1HA6A 3AMUA 5C4JB 1V1PA 4KI0A 2XVSA 5ELCA 3GTLB 4DU9A 2BOSA 2F0UA 1D2BA 4K5WA 4CJ0B 3M4YA 4TSSA 2FHTA 1EWHA 3RZDB 2EJMA 1B44D 2MUYA 2E2JB 2AQ3B 5FO7B 2JSOA 4S3SA 1U9RA 3MHBA 1RDPD 5T1GA 5ISRA 4OIKA 5FOBB 1DOKA 3AU7A 1JQYD 2EYJA 2MGSA 3GP7A 1STYA 4H44C 5IGBA 1OXSC 3KK7A 1OXTA 1HTLD 1U4MA 1K8OA 3I91A 2JEBI 5M5XB 2F0HA 2Z4IA 4FF3A 2KECA 2OT2A 2LKVA 3FMCA 5I9PA 2F0MA 4GZYC 2NYZD 1WVLA 3T4AC 1AZQA 1EEID 2F03A 2FMMA 2IL8A 3MXPA 2E75C 3TP7A 2B2WA 2F4IA 1ET9A 2KHSA 4ZQ3A 2EY2A 3H6MA 5FK9C 3N6RA 4DK1A 1ESFA 1QNUA 1WTOA 1O80A 1AP0A 1SJED 4IUTA 1D1IA 1SFOB 1OXXK 1E2WA 1JWMD 2E2IB 1G2TA 5CGKA 2VB3X 3JAME 4A3IB 3UI2A 1EYAA 1LTTD 2IWHA 1ZXTA 1EY8A 1IKLA 2EJFC 1FNVA 4DAPA 3FPPA 4OO1G 4PQXA 1S4ZA 2QF7A 3TN2A 5KNDA 4WFN3 5FKAC 2C9OA 3CRLC 2CW0D 1OXVA 4DGZA 3I8ZA 4RGMA 3PUWA 3TP8A 5C5LA 4ABNA 2PZWA 3HZXA 4X3TA 3GV6A 3ND9A 1Q90A 1WTXA 3OWEB 1R4QB 4LMQD 4PMBA 4C56C 1EY9A 3I73A 1I4XA 2JA7B 5JVG3 5C5MA 4ZKCB 2L9HA 4BBSB 5KRUA 1PRTD 1FNUA 1SNOA 3QIAA 4WJWA 2B2TC 1EL0A 4IALA 5DM63 2SDFA 1EY0A 5I2XA 1RF2D 5JEAJ 4XXEA 1YNNC 3NUCA 4QUCA 3VR6A 2O5JC 1EEFD 2LFNA 3OSOA 2TMPA 4TQUS 1YNJD 5J1ZA 3L7ZC 4BBRB 5KYLA 1ZEQX 1Z7TA 2EOTA 3PV0A 4RGOS 1Y1VB 3M7NA 1SE4A 2K33A 3CHBD 4PMWA 1FYCA 4DAYA 2K28A 1XX8A 3P20A 2EVBA 2K1BA 4K2LA 3SK5A 4XTCS 1ESRA 2XRQD 1HFNA 1H9RA 1GXDC 5DNFA 1W6JA 1JOQA 1A6XA 3NHHA 2R6GA 4HR7B 1F9PA 2OXPA 3PUYA 3Q22A 1TVXA 3NPPA 1PMRA 3P7JA 2FJ2A 1W6KA 4JK1C 4DN4M 1KNEA 2RDHA 4EGVA 1I6VC 2DY8A 4K5VA 4WORA 3NTIA 4HAEA 1PDQA 3SHLA 3NP8A 5E4WC 2QKIC 3SVMA 2L4NA 3HOWB 1J9OA 2BDOA 1M8AA 4KMUC 1ENAA 2N88A 1AFPA 2RSNA 1B9MA 5C3EB 5HURA 3T53B 5IT9E 3BYYB 4OIJA 4IUUA 5M3FB 1TWCB 2R93B 4C1NK 1EFID 3MEHA 2E2HB 3H94A 2RKSA 5BN4A 1TU2B 4RCNA 1WTWA 2L0CA 5CV9A 2IX0A 4NMZA 3VYTA 1JB3A 4KJOA 3LNNA 1Q12A 2NZ1D 4MIUA 4FF4A 4FXKC 4QUFA 2I46A 4I65A 1B1ZA 1B50A 2M2LA 2SEBD 2B8GA 2LMCB 3KF8A 4G4KA 2DNCA 2A69D 1LT6D 4KY5A 3IL8A 4HSVA 1BXTA 1SYFA 4RGNA 1RD9D 1CM9A 1EQTA 2B63B 2LS01 1K83B 3S9WA 1LT3D 1STNA 2XWJB 1EY5A 5D3DA 3MXUA 4M1UB 1WTVA 2K05A 3R93A 4G7HC 2KEDA 3C1EA 3W3AA 1DM0B 1GUSA 3MWYW 3DHQA 4G7ZC 3QJYA 3J81L 3D4DA 3OMGA 2H1EA 3DWPA 1CTMA 4J6HA 2B2UC 4IQZA 3A8JE 3O13A 5EPKA 2PO4A 1Y1WB 4X3SA 3SK8A 1NAPA 1QCBD 5M5YB 4FXGC 1QE6A 2PW7A 1QWYA 2EJGC 4OO1H 3TMEA 3GTKB 1B4OA 5CV7A 5CV4A 5LL6S 1EZ8A 4YIJA 2K04A 3M7GA 1LV9A 1KDBA 1M4VA 3VR2A 5M9OA 5JJZA 3SK4A 2B2VC 2F1MA 4IFDI 5LL6X 4G7OC 1F2MA 4MHEA 1FR3A 4ILWA 4HMJA 5KNBA 5T1IA 5A2QE 4N9TA 5CV8A 2NVXB 3Q6SA 1WTRA 1QILA 5EBCA 3QO2A 2R92B 3MXGA 4IURA 4LK1C 1U4LA 1MSHA 2HDLA 4NDXA 4C3IG 5NUCA 3A8IE 3KUPA 1BCPC 1PZKD 3D4RA 2FFKB 3NQTA 1KABA 1BNZA 1TY2A 2Q8IB 4AYBB 3V2TA 4RKBA 3RLFA 2F0EA 1TY0A 1A3VA 2XN9C 2PZTA 5FLXE 1CK1A 1X3PA 1SYEA 4K5XA 3TDQA 3GQBA 2F0KA 2RSOA 5KEEA 4CKCA 2F0TA 1LO5D 1UAPA 1TS2A 1G91A 4XQJA 3RZOB 4X3UA 1BOSA 2KA7A 4KHZA 1CA5A 1HFGA 4OGQC 1VF7A 1G6ZA 1C4QA 2R3ZA 2F0PA 4A93B 3T13A 1H9MA 1ICWA 2F0SA 1D5ZC 3WDNA 4CKBA 2PQEA 2E2DC 1RTNA 4ULLA 3OMCA 2MP1A 2IX3A 1I3QB 2J4XA 2ZXRA 1SMYC 2EYPA 2DN8A 1AN8A 3I4MB 1R4PB 5EKLA 3MC0B 3VR3A 1DJRD 4XT1B 1KNAA 2AWNA 3T51B 3I90A 5EGTA 4C3HG 2RA4A 1BCPB 3PUZA 4IUNA 3ITPA 5D3IB 5IGEA 1EU3A 4A3FB 2AUJD 2KCNA 1ENFA 2GA4B 4R8IA 4DXGA 1D5MC 3NE5B 3S2HB 1TR5A 4H13C 3HOYB 3ONAB 2HQEA 3DWQA 1SAPA 2B2WC 3ZYYX 3K57A 3HP3A 3M85A 2NTSA 3NBHA 3RUZA 4EQNA 3U9SA 2PNRC 3R2IA 3OIPA 1SDFA 1Y8PB 1GHKA 1SYGA 4F8MA 3Q0AA 5E4XA 3IFTA 3PUVA 3R8BA 4EVOA 1A3UA 2K6AA 4L8JA 3TBIB 4ZRZA 4RKLA 3EFXD 4JBWA 5C3XA 1QJOA 5K36H 2XRSD 2XNAC 3HRZC 3A7LA 3NTKA 3E0JA 3FRPB 1Q3LA 1MSGA 1BBXC 2X6LA 2L12A 3DUZA 1A3TA 4KY6A 2WKDA 3IAYA 1Q1BA 1PFBA 2K32A 5LHY1 2O5IC 4RA8A 3QOLA 2ICIA 3SEBA 4A3KB 1LTGD 1WD1A 2CHBD 1S5BD 3D6WA 1VCIA 2Q8TA 2EDGA 1VMCA 2QEJC 4ZKBB 1KLUD 1PRTF 1I4HA 1NR2A 1KDCA 4TKOB 3FDTA 3ERQA 2D2CC 3U9OA 3TP5A 4KN7C 1EY6A 3D3RA 4KHVA 1CZGA 1QB5D 3MZ5A 1SNQA 3BVGA 4L6TB 1L0XB 2EY5A 2J0TD 2WACA 4ZYSA 2KCCA 2L5TA 2EE1A 4FF2A 1IL8A 1SNMA 5C4ZA 5ELBA 1VMPA 1U4PA 1X32A 1TKWB 5C0XG 2M00A 3K5LA 2C5CA 5D65A 1I4RA 4DAVA 1SEBD 4KTAA 3RMHA 1DZ1A 5EBDA 4CHTB 4Q0FA 2O2LD 2NN6I 4RHRA 3T16A 1DYQA 3NTHA 2Z4HA 1PFNA 1OXUA 1Y8OB 2L55A 4XT3B 5IGDA 2JA6B 1PTOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S3S A;  1EQV A;  1U9R A;  3D4W A;  3D8G A;  1TT2 A;  3ERO A;  4HMJ A;  5KIX A;  4KD4 A;  1EY4 A;  3MHB A;  2F0L A;  4N9T A;  5CV8 A;  5IOC A;  2EYL A;  4LAA A;  2NUC A;  3HEJ A;  4J1M A;  3S9W A;  1A2T A;  4DGZ A;  5DAU A;  4DFA A;  4ZUJ A;  5F2D A;  1STN A;  4ID6 A;  1EY5 A;  5ISR A;  2ENB A;  1SNP A;  3TP8 A;  3DMU A;  1STA A;  5EGT A;  4PMC A;  5C5L A;  3P1H A;  1JOO A;  1STH A;  4IUN A;  5C4H A;  3ITP A;  2PZW A;  3HZX A;  1KDC A;  2EYJ A;  3EVQ A;  4NDX A;  4OL7 A;  5IGE A;  3ERQ A;  4K5V A;  5I9O A;  5IIF A;  3U9O A;  1STY A;  5IGB A;  5JAV A;  3SR1 A;  5NUC A;  3C1E A;  1KAA A;  1TQO A;  2F3V A;  3TP5 A;  3P75 A;  4WOR A;  1AEX A;  4PMB A;  5IOD A;  1EY9 A;  3DHQ A;  5J22 A;  5J39 A;  4HTH A;  3TP6 A;  1SYD A;  4HMI A;  4B9X A;  3NQT A;  1EY6 A;  3SHL A;  4F7X A;  1KAB A;  3C1F A;  3NP8 A;  3EJI A;  4PNY A;  2F0H A;  4KHV A;  1II3 A;  3V2T A;  2SOB A;  4RKB A;  5C5M A;  1TR5 A;  3D4D A;  4R8N A;  2EYH A;  2O4X A;  3OMG A;  2LKV A;  2F0E A;  5C6A A;  4ZUI A;  2F0F A;  4B9W A;  5I9P A;  1A3V A;  2F0G A;  2SNS A;  3MZ5 A;  1SNQ A;  2F0M A;  2HQE A;  3QB3 A;  3E5S A;  4QF4 A;  5KRU A;  1ENA A;  2QDB A;  2PZT A;  1SNO A;  4J6H A;  5KYI A;  2EY5 A;  5HUR A;  2WAC A;  4IAL A;  2EY6 A;  3LX0 A;  1STB A;  1SYE A;  4K5X A;  2EY1 A;  1EY0 A;  2PZU A;  5K5P A;  1EZ6 A;  3OWF A;  3MXP A;  4EQO A;  2PYK A;  3RUZ A;  4E6I A;  2F0K A;  1SNM A;  5C4Z A;  5KEE A;  2F0T A;  2EXZ A;  4EQN A;  3SK8 A;  2PW5 A;  3D6C A;  2RBM A;  2RDF A;  2F0Q A;  3MEH A;  3TP7 A;  1F2Y A;  2F0J A;  2KHS A;  5DEH A;  4ZQ3 A;  2EY2 A;  3H6M A;  3NUC A;  4QMG A;  5E1F A;  2RKS A;  2EYF A;  1SYG A;  4F8M A;  2M00 A;  4EVO A;  2PW7 A;  1JOR A;  3OSO A;  5EKK A;  4K6D A;  3SXH A;  1EYD A;  1F2Z A;  2F0N A;  5CV6 A;  1RKN A;  1A3U A;  4WRD A;  3TME A;  3BDC A;  4K14 A;  5CV9 A;  4KTA A;  2F0W A;  4NMZ A;  2F0O A;  1ENC A;  2SNM A;  3PMF A;  5J1Z A;  1IHZ A;  4NP5 A;  5CV7 A;  5IGC A;  5KYL A;  4H7B A;  4KJO A;  4RKL A;  5CV4 A;  3VA5 A;  5I6Y A;  2OEO A;  1EZ8 A;  5E3F A;  2F0P A;  4YIJ A;  2F0I A;  4ODG A;  4KJN A;  5C3X A;  3T13 A;  1SYC A;  4KY7 A;  3BDL A;  4MIU A;  5CR3 A;  2F0S A;  4K8I A;  5CV5 A;  1SYB A;  3NK9 A;  4TRD A;  1JOK A;  5I6W A;  1NUC A;  4QB4 A;  4G57 A;  3T16 A;  2PQE A;  1KDB A;  4I65 A;  3QOJ A;  4DU9 A;  5M9O A;  3NXW A;  1KDA A;  1STG A;  4K2L A;  4N9P A;  5JOB A;  2KQ3 A;  2EYO A;  2F0U A;  3SK5 A;  4K5W A;  4IZ8 A;  3SK4 A;  5C3W A;  1SNC A;  5HGT A;  5CC4 A;  3OMC A;  1A3T A;  5CGK A;  4KY6 A;  5IGG A;  1SND A;  2F3W A;  1EY7 A;  1A2U A;  5IGF A;  1EYA A;  3MVV A;  4KY5 A;  4K2K A;  1EY8 A;  4NKL A;  1JOQ A;  4KD3 A;  2EYP A;  4ME5 A;  4K8J A;  5KGU A;  2EYM A;  1NSN S;  2OF1 A;  3NHH A;  1F2M A;  2F0D A;  3QOL A;  3SK6 A;  4KV6 A;  5EKL A;  4DF7 A;  5IGD A;  1EYC A;  4EQP A;  2OXP A;  3R3O A;  1SYF A;  2F0V A; 
#chains in the Genus database with same CATH topology
 4OXP A;  1BUV T;  2IW3 A;  1FJG L;  2F0L A;  5EKI A;  3LWU A;  4IFD G;  3FKI B;  3J80 L;  4FYD A;  1PZI D;  3HEJ A;  4J1M A;  3I4L A;  4BWG B;  1JJ2 A;  4UAI A;  1IW7 C;  2AQ1 B;  4LFC L;  2B2Y C;  2C35 B;  4DV1 Q;  4X66 L;  4RAU C;  4OL7 A;  4H0L C;  1RJT A;  3DEO A;  1HR0 Q;  1MBY A;  1PV4 A;  2R92 H;  1UEA B;  5KNC A;  1AEX A;  2HCC A;  1K9M C;  3VYR A;  4JI0 L;  3BG3 A;  5L37 A;  3C1F A;  3EJI A;  2JE6 I;  1PH8 A;  4KKT A;  3NWT A;  5COR A;  2NVY B;  2QW7 A;  4ALP A;  1ML0 D;  3KLS A;  2JYO A;  3MFG A;  2HQL A;  3KDF B;  3PO3 B;  4DR5 L;  2VW9 A;  1YZ6 A;  3CAM A;  3LX0 A;  2R7Z B;  4IPD A;  4X62 L;  3RNU A;  2PYK A;  1CUK A;  3DLL A;  2VY3 A;  3TRE A;  5FLM G;  2F0J A;  4HID A;  5FO9 B;  1B7Y B;  1B3A A;  3OHX C;  1EYD A;  3BZC A;  4OON A;  2ES2 A;  3J7A F;  2K7V A;  2F0W A;  2H5X A;  1VQ4 A;  1QVF A;  2QCP X;  1WCM B;  3VA5 A;  3RZO H;  1HQR D;  3NEN A;  1P8L A;  1EIG A;  4DR4 L;  3UE0 A;  2NZO A;  5CR3 A;  2QGQ A;  1BCP D;  5CV5 A;  2R7F A;  4PZ8 A;  2ZXO A;  1PA6 A;  3NK9 A;  1Q1E A;  5I6W A;  5JPN C;  1E2Z A;  2VUM B;  4A93 H;  3I4N B;  3MXN A;  4N9P A;  1B53 A;  3SE0 A;  2NVQ B;  1CA6 A;  2R7Z G;  4HCS A;  2AQ2 B;  3TEH B;  4NKL A;  2B8F A;  4ME5 A;  5KGU A;  1NSN S;  2LY7 A;  4KKS A;  1RTO A;  4DV6 Q;  3J80 i;  3GTJ B;  4J8Q A;  1ASZ A;  1I3Q H;  4C3J G;  3E6Z X;  2R7D A;  1HZ9 A;  5IOC A;  1EU4 A;  2UXC Q;  2VQF L;  1GUG A;  1U0L A;  4JI3 Q;  3I4M H;  5EJW A;  4CDD C;  2BA0 A;  5ELD A;  4ZUJ A;  3A5U A;  1SNP A;  3IFD A;  1JB7 A;  5IYD G;  2N55 A;  3J81 E;  2B39 A;  3P1H A;  3MFY A;  4DR1 L;  5JJK A;  1D5X C;  1YJ9 A;  3CCR A;  5C4X G;  5IIF A;  3FVQ A;  4YWM A;  1KAA A;  2CCZ A;  1DOL A;  4JYA Q;  2VUM G;  3TP6 A;  1SYD A;  4R4T A;  4A3F H;  3I4N G;  3TZD A;  3A74 A;  3KF6 A;  4APV A;  3S1N B;  4OHJ A;  1HNX Q;  4CGY B;  4R4Q A;  1X3F A;  2ALY B;  4JVZ A;  4ZUI A;  4Y7N H;  4O0A A;  1YJN A;  4QIW B;  3STB D;  2K5D A;  1SMY D;  3WWV A;  2WAQ G;  3L3O C;  1CFM A;  3C46 A;  3EA6 A;  5IP7 H;  3HOY H;  2I5M X;  3S2H H;  4NW2 A;  4XQQ A;  4QL5 A;  5M3M B;  5K5P A;  1EZ6 A;  3A55 A;  3VYS A;  1TXY A;  4IPC A;  2EXZ A;  3GTQ B;  5ELF A;  3MTS A;  2RDF A;  3S2D H;  1IKM A;  1VQO A;  3TRZ A;  3CKI B;  3KLS X;  2KBN A;  1D7Q A;  1LAC A;  1K0R A;  4WRD A;  1PRT C;  1ET6 A;  2KHJ A;  2BH2 A;  5C0X I;  4XDX A;  4DK3 C;  2EPB A;  1R9T B;  4QCL A;  3BU2 A;  5IGF A;  1SXT A;  1F9Q A;  1JE5 A;  3I56 A;  1HNW L;  4KY7 A;  1T9H A;  3MAQ A;  1EOV A;  1HRJ A;  1AW7 A;  2HD3 A;  4K8I A;  3PO2 B;  2D62 A;  5AJ3 Q;  2A74 C;  1SYB A;  4B3S Q;  1LTB D;  3BYT B;  4KN4 C;  4P2C B;  1WTQ A;  4YY3 Q;  5D14 A;  4BY7 G;  2IT1 A;  4CKE A;  5JOB A;  1ZYR C;  1GHJ A;  1E24 A;  2KQ3 A;  4KK7 A;  2EZV A;  1SE2 A;  5CBE E;  5IGG A;  2F3W A;  4FF1 A;  4X65 Q;  3Q8D A;  2WV6 D;  2PQA A;  3ICE A;  2BE5 C;  1EIF A;  1UUP A;  1Q8I A;  2OF1 A;  1ILQ A;  2A73 B;  4C3I B;  2A6H C;  4EQP A;  1JE4 A;  4A3E H;  1TS3 A;  2MHV A;  2J7Z A;  1V9P A;  1CKN A;  1DCZ A;  1LLR D;  1X3Q A;  4KHP Q;  1IBK Q;  4RGT A;  2WB1 G;  4JV5 Q;  4IUP A;  3RR5 A;  4JOI A;  1JR0 D;  1WOC A;  4BY1 B;  1KLG D;  1Q8K A;  1KXL A;  4A3K H;  1VF5 C;  4IUQ A;  4GKK L;  1C48 A;  4ZCK A;  2HT1 A;  3MA2 B;  3N52 A;  3EVQ A;  5I4D A;  2MNA A;  2PQA B;  1MD2 D;  5CYU A;  2L15 A;  3BVZ A;  3PF4 A;  2PPB C;  4DXF A;  4DV2 L;  4HJ5 A;  1VQE A;  3A8K E;  2BA1 A;  3AB9 A;  2SOB A;  3K0Y A;  3QB3 A;  5DM7 3;  3E5S A;  3H91 A;  2QDB A;  3M3Y B;  1W3S A;  4X64 L;  2ICE C;  1XXG A;  4I7Z C;  1IYV A;  2IPK D;  4A3D B;  3OWF A;  1N36 Q;  1XJV A;  3I7F A;  1PTO C;  1E2V A;  4A3J G;  5BN5 A;  3J81 i;  2F0Q A;  4QMG A;  2M9V A;  5GAE C;  2D0P A;  4O1N A;  2NB0 A;  1XMO L;  2F0N A;  5AFW A;  4L5S A;  1XNR Q;  5G3L F;  1DON A;  4DA2 A;  5TSS A;  1GOZ A;  2SNM A;  4NP5 A;  2OQK A;  4H7B A;  4IFD H;  4ODG A;  3WOE A;  4YWL A;  2MJ8 A;  2QEX A;  3OPO A;  2VQE L;  3EQL C;  1Y14 B;  4A3B G;  3J81 c;  1QUQ A;  1HJP A;  4M8A A;  1VQI A;  3OIQ A;  1QOH A;  2G9H D;  3NWS A;  1MGS A;  4ME3 A;  1KDA A;  1N34 Q;  1I94 L;  1HZB A;  2EYO A;  1U4R A;  3S1M B;  2BH8 A;  4X6A H;  3PIP 3;  1LTR D;  2UXB L;  4XIG S;  3HKZ B;  4C3H B;  1DOM A;  2XIW A;  4K8J A;  2NN6 G;  2EYM A;  2ZJQ A;  1Z47 A;  1ICF B;  3PUX A;  1EYC A;  4U68 A;  1ONL A;  4A3G G;  1HXY D;  1P16 A;  3D4W A;  3D8G A;  3DWA A;  1B3Q A;  4JC0 A;  4L5T A;  3K5N A;  1DD2 A;  4LAA A;  3HOV B;  1O7Z A;  1QUQ B;  1C8C A;  1D1K A;  3UDF A;  2JA6 H;  4YCW A;  4PMC A;  3X3M A;  3X3N A;  3DXJ C;  1VQ5 A;  3FKI H;  1LT5 D;  1Z6H A;  1ZKO A;  3CMA A;  2ZTC A;  1N33 Q;  3HG9 A;  3A54 A;  2F3V A;  1IBL Q;  2PMZ E;  1VDZ A;  2Z8L A;  3GV3 A;  1BDO A;  1VQJ A;  1WYD A;  5CBA E;  1BBW A;  1YNN D;  2KHI A;  2CVR A;  2Y0S G;  4P71 A;  5FLX L;  2EQS A;  4X3K A;  5C6A A;  1Q7Y C;  3HOX B;  4OEM B;  1H9S B;  1GUO A;  1PTO B;  4B3M L;  5ELE A;  1DXM A;  1L1O A;  3HOZ B;  2HCI A;  3LWE A;  2NVY H;  4JI4 L;  3AFP A;  4EQO A;  4FNF A;  4DR3 L;  3HGB A;  2I07 B;  3H3V I;  4CJ1 B;  3PO3 H;  2VXW A;  3C3L A;  3D6C A;  2JA5 G;  4Y7N B;  2RQX A;  3HOV G;  1TWA B;  4R9W A;  1VQK A;  2R7Z H;  4V19 0;  3I70 A;  1IW7 D;  4PZ6 A;  5ELO A;  5EKK A;  4HSP A;  1F2Z A;  3CQZ H;  1FD7 D;  4F88 A;  2WAQ E;  4JI2 Q;  5CMD A;  1QG7 A;  2H4O A;  3PIO 3;  2IHF A;  5E3F A;  3IRB A;  3S2D B;  1AZP A;  2UUA L;  2OWO A;  1SRU A;  4DAM A;  2UUB Q;  3BVM A;  3EIV A;  3PGZ A;  2JP1 A;  1JOK A;  1V1P B;  3PSI A;  3H0G B;  3HOU G;  4G57 A;  1WCM H;  1VQB A;  3H15 A;  3QOJ A;  4B08 A;  2MQH A;  3CC2 A;  3J7Y W;  4A3M B;  2A68 C;  1PFM A;  1VQA A;  2RHQ B;  3R2T A;  1H9J A;  4GN4 B;  1SND A;  2VUM H;  3HOZ G;  2BCO A;  1UE6 A;  1G2S A;  3G7L A;  4L5R C;  3I4N H;  2QIL A;  4Y52 H;  3T56 B;  2JA8 B;  2F0D A;  1O7L A;  2NVQ H;  1WI5 A;  3TSS A;  2F0V A;  1KC8 C;  5JJI A;  1UNS A;  3RLO A;  4C1N I;  2EYL A;  4LF8 Q;  1Z9F A;  2UU9 L;  2ENB A;  3GTJ H;  3DMU A;  3V05 A;  4IJH A;  1BKB A;  1SSO A;  1CZW A;  5C4H A;  4A3E B;  1RL2 A;  4B3R L;  4B3T Q;  5C44 B;  4FDB A;  4BXX G;  4DR2 Q;  1WTP A;  5JAV A;  1X55 A;  5IYC H;  5A35 A;  3S16 B;  2RDG A;  4MZ9 A;  3P75 A;  3CCM A;  1FNW A;  4UP8 A;  2VNU D;  2Q2U A;  1S5C D;  2F52 A;  5LMN Q;  2FMC A;  1Q86 C;  3BDO A;  2E74 C;  2O4X A;  1TWG B;  3WOF A;  3SK6 A;  4DR7 L;  3T1H L;  1O7Y A;  1TII D;  4NPS A;  3S1N H;  3I3C A;  1HHV A;  1V1Q A;  3TS2 A;  4RG1 A;  3UDI A;  1UE1 A;  2X69 A;  5JVH 3;  2PZU A;  2JEA I;  1NBW A;  3CU7 A;  4E6I A;  4RFB A;  5EQ0 A;  1LM0 A;  4DV7 Q;  2WP8 J;  1C7Y A;  5E1F A;  3G4S A;  1LT4 D;  2K5H A;  5M3M H;  1HTP A;  4K6D A;  1RKN A;  3GTQ H;  1EFW A;  2PCF B;  2F0O A;  3K5M A;  5EPL A;  1K8G A;  1A62 A;  4GOP A;  5LMN W;  1U5K A;  3K5O A;  4FVM A;  2Q8R E;  1SYC A;  3M9B A;  2ATW A;  1OTC A;  2XSC A;  1I4P A;  2AKW B;  1JWS D;  2NVT H;  4DK0 A;  3ULP A;  1IXR A;  1J5E Q;  2UUC Q;  3L9A X;  1A63 A;  3NXW A;  1PH7 A;  3NSW A;  3PO2 H;  5C3W A;  1KTK A;  1SNC A;  4AQY Q;  3J80 E;  4XYO A;  1UEB A;  2YU9 H;  4DR6 L;  2Q2I A;  3JC6 6;  3SDZ A;  4KD3 A;  2AWO A;  4GKJ L;  1KL9 A;  3GD7 A;  1A0I A;  4DF7 A;  1VQ7 A;  1HCZ A;  5JEA G;  1IYJ B;  3R3O A;  2MPM A;  3BDC A;  5DLQ E;  1ENC A;  2IX1 A;  1Q46 A;  1EQV A;  1CHP D;  2A6E C;  2HIV A;  4HJA A;  2K03 A;  3I72 A;  4IUV A;  1N32 L;  3AYH B;  3JAM L;  5C0X J;  4C3I H;  4C2M B;  4A3I G;  2VB2 X;  1GUT A;  1JOO A;  1STH A;  4A3J H;  1V8Q A;  4OX9 L;  3S15 B;  3U50 C;  4O42 A;  1WTH A;  1LTA D;  3QG1 A;  4K0K Q;  4Q5V A;  2D5D A;  4BY1 H;  1TQO A;  1A15 A;  3OOC A;  2Z6B A;  1O78 A;  2V4D A;  5EPJ A;  4AH6 A;  3W2D A;  2Z1C A;  1FGB D;  4B9X A;  1T5X D;  3V96 A;  2F4V Q;  2TSS A;  3H3V C;  4DV5 L;  1PXU A;  1ZYR D;  4YHH L;  2EIF A;  3HS0 C;  2ZM6 L;  1SMX A;  2ZJP A;  3KFU A;  3KDF A;  4QF4 A;  4CDC C;  3CCV A;  4A3B H;  4LW1 A;  5KYI A;  1XPU A;  2BE5 D;  1STB A;  4Z9C B;  4GNX C;  3GTO B;  3Q24 A;  5J3B A;  3I55 A;  1TWF B;  3GTG B;  2JA7 G;  2JK8 A;  1BCP F;  2A6H D;  1F2L A;  4RH6 A;  2Y0S E;  3M3Y H;  2RBM A;  4U67 3;  1G51 A;  4IFD J;  2B2T A;  4JI8 L;  1HPC A;  4A3D H;  2NN6 H;  2WIN B;  4L5Q A;  1SN8 A;  4UHV A;  3VYU A;  1CHQ D;  3ERS X;  1STE A;  5I6Y A;  4DV6 L;  2E5L Q;  1B8A A;  3OW7 A;  3DEP A;  3BDL A;  2Z6K C;  1E7Z A;  1E3P A;  4JI3 L;  1SE3 A;  1GUN A;  4N8F A;  4QB4 A;  4ZLT F;  3CQZ B;  3CRK C;  1Y8N B;  3K7A H;  5GAH C;  3GTM B;  4C3J B;  1GJX A;  3A0J A;  4JG2 A;  4MN3 A;  2PMZ B;  1L0Y B;  4UY8 C;  1HR0 W;  1V43 A;  4BBR G;  1Y69 U;  2E76 C;  1HUN A;  3RLN A;  3UE1 A;  3G71 A;  1Y1V G;  3K7U C;  2OQ0 A;  4ZK9 B;  4JYA L;  2FIN B;  2JXM B;  2UXD Q;  1VQC A;  2K5W A;  3S1M H;  2KJX A;  2B2Y A;  5C4X B;  3E3X A;  1PTO D;  2OEO A;  3MEF A;  3S1R B;  3JAM i;  1HNX L;  5KIX A;  4DV3 Q;  4C3H H;  3K0X A;  2K01 A;  1SJH D;  4LF7 Q;  3L2P A;  2NTT A;  5JPM C;  2N3S A;  1JC7 A;  4ZAI A;  4DNR B;  1LAB A;  1CQV A;  5JJL A;  2NBF A;  3FPU B;  4BA1 I;  4JBK A;  1YIT A;  2NWG A;  3HOV H;  1PZJ D;  3IKJ A;  2K5Q A;  3K59 A;  1KD1 C;  3SR1 A;  1BO0 A;  4UDU C;  4FP5 D;  1B9N A;  2WKC A;  2WAQ B;  5IOD A;  4HTH A;  1CKM A;  4F7X A;  4JI0 Q;  1H9K A;  1KIX A;  1CQF A;  4R8N A;  2EYH A;  3K80 C;  1NR4 A;  3RN5 A;  1XYI A;  4LJZ C;  1VQL A;  2CQA A;  2D9U A;  1BF4 A;  3A7A B;  3VR5 A;  1SLJ A;  3CPW A;  1KQS A;  4B3S L;  1J6Q A;  4CBV A;  3HOX H;  2BDN A;  4DR5 Q;  4YY3 L;  4P73 A;  1VS0 A;  3BS1 A;  1PTO H;  4RMF A;  1K8A C;  3J80 c;  4UP7 A;  1WD0 A;  3HOW G;  3HOZ H;  4F87 A;  1MJC A;  1PLF A;  2CW0 C;  1F77 A;  1HA5 A;  5IYB H;  3VA7 A;  3A56 A;  4XQN A;  4BY7 B;  1XWE A;  2PNH A;  3B6Y A;  3CCS A;  5IT9 L;  3GTL H;  1NTG A;  2I0Q A;  1S5F D;  1H95 A;  4DV4 L;  1TWA H;  3PMF A;  4V0B A;  1HUM A;  1I4G A;  3F2D A;  4LUV A;  2R93 G;  1ROD A;  2HDM A;  4LF9 L;  3E0E A;  4JI7 Q;  3M4O B;  3GTP B;  2RCF A;  4KHP L;  4JI1 L;  1IBK L;  4DR4 Q;  4IOA A;  2Z9H A;  4JV5 L;  4PV1 C;  1GVP A;  1NUC A;  1KAW A;  5COY A;  4HED A;  2RCN A;  3UDG A;  4OO1 I;  5K36 G;  2L1B A;  1V1O A;  4QGU A;  3S14 B;  4JCV E;  2WB1 B;  2I5L X;  1YEZ A;  5CC4 A;  3KF8 B;  3H0G H;  2XGT A;  1EY7 A;  1A2U A;  3T1Y L;  1PHJ A;  5BN3 A;  4HCE A;  2NVT B;  2DNE A;  1S5D D;  4A3M H;  1IYU A;  4JOI C;  4GLV B;  2G9D A;  3BZD B;  4KV6 A;  1LTI D;  3URY A;  3ERO A;  1TT2 A;  4DUZ L;  1XPO A;  1CI3 M;  2A8V A;  1J8I A;  1EOT A;  2NUC A;  1G8Z D;  2YU9 B;  2JA8 H;  1AE3 A;  5DAU A;  4DFA A;  1EQR A;  4RCO A;  5HGQ A;  1ASY A;  1STA A;  1YNJ C;  1RHP A;  3KBG A;  5M5X H;  4DUY Q;  1EIH A;  1K8M A;  4QQB X;  2A5H A;  1N36 L;  4N8X 1;  3K6O A;  2L11 A;  3LGJ A;  4DR1 Q;  1QNK A;  1K28 A;  1JWU D;  2B63 G;  2ID0 A;  1MI2 A;  4BS9 A;  1EWI A;  4HMI A;  5C44 H;  2CFM A;  2KEE A;  4A3J B;  4PNY A;  3S16 H;  1B2T A;  1II3 A;  2CH4 W;  2A68 D;  2CQO A;  2X6G A;  2YV5 A;  2N78 A;  2F0F A;  3S17 B;  4B9W A;  2F0G A;  3H09 A;  3NQI A;  2F3I A;  4CJ2 C;  1E22 A;  2DJF C;  1GUW A;  1TWG H;  4LF6 L;  2EY1 A;  4CDE C;  5C0X H;  1CSQ A;  1LTS D;  5FO8 B;  1XTD A;  4OEL B;  4PZ7 A;  3E9I A;  1NCV A;  4BA2 I;  3K58 A;  3L0O A;  1XTC D;  1XMQ L;  4A3B B;  1PH6 A;  1KHI A;  2KOL A;  1TWH B;  1PVO A;  2AUK A;  2B2U A;  1JOR A;  5GRO A;  2KUM A;  4IO9 A;  2AMC B;  5JEA H;  1PYB A;  4K14 A;  1IHZ A;  4FO2 A;  4YCV A;  1ILP A;  2ZT9 C;  2F0I A;  3KLR A;  4MTK A;  1Y1W G;  2E2I H;  1JJC B;  1PH2 A;  3C2P A;  1I6H B;  1HNW Q;  4TRD A;  3FEW X;  4FXD A;  3NBI A;  1NE3 A;  3EBE A;  4A3G B;  3D31 A;  3DM1 A;  1PRT B;  3TQY A;  2KEN A;  1STG A;  3TZU A;  1EWC A;  3KBX A;  2QA4 A;  4IZ8 A;  5HGT A;  2DJG C;  2VZA A;  1L0W A;  2KVM A;  2HHH L;  3G6J B;  3RD4 A;  2ZXP A;  3MVV A;  3F2U A;  4K2K A;  5I2Y A;  1VQF A;  1BQQ T;  3K7A B;  1FVI A;  3ULL A;  2DY7 A;  1F9S A;  3OW2 A;  1SBB B;  1HQM C;  4KJN A;  3GO5 A;  3S1Q B;  2B2V A;  1OO9 B;  4EX5 A;  4KD4 A;  1EY4 A;  3CCL A;  2R61 A;  1PYW D;  1G29 1;  4RHS A;  2RVL A;  1A2T A;  3CPF A;  1JCK B;  4ID6 A;  2EXD A;  5F2D A;  2Y0S B;  2VS1 A;  3ND8 A;  1YHQ A;  4GKK Q;  5I9O A;  4C2M H;  2YTY A;  1E0B A;  5A2Q L;  1IL2 A;  3CC4 A;  1CT1 D;  1F9R A;  5J22 A;  3CCQ A;  5J39 A;  2XWB B;  3J7A V;  3S15 H;  4K6L A;  1L1O C;  1I50 B;  1TS4 A;  3Q23 A;  2IJ0 A;  2JA5 B;  2R92 G;  2WII B;  1IBM L;  1S5E D;  3CC7 A;  4XYQ A;  5M5W B;  1H9S A;  2SNS A;  3QWN A;  5LMU Q;  2A69 C;  2FXQ A;  1JIC A;  4R4O A;  1VQ8 A;  2EY6 A;  4L63 B;  5FLM H;  1JJG A;  4DNT B;  2NZH A;  2HIX A;  2RHS B;  2HUG A;  1X56 A;  2A6E D;  2PW5 A;  1D6E C;  4HIO A;  3CCE A;  1F2Y A;  5DEH A;  2EYF A;  4HN7 A;  3GTO H;  3HOU B;  3VR4 A;  4LFA L;  1TWF H;  3GTG H;  2P5Z X;  2YYZ A;  1RCV D;  3SXH A;  1PYS B;  4IN3 A;  5CV6 A;  4KKU A;  1BR9 A;  5G3L D;  4DV0 Q;  5IGC A;  1TS5 A;  4RWS C;  3CXC A;  1I4Q A;  1T5E A;  4JI6 Q;  3ZJY C;  1HA6 A;  1UE7 A;  3AMU A;  5C4J B;  3PQI A;  1YHA A;  1V1P A;  4KI0 A;  2GN5 A;  3OTO Q;  4LF5 Q;  2DUD A;  2XVS A;  5ELC A;  3GTL B;  4JI5 Q;  4DU9 A;  2BOS A;  2F0U A;  4LUO A;  4K5W A;  1D2B A;  4B3T L;  4CJ0 B;  4DR2 L;  1I94 Q;  2OTJ A;  3M4Y A;  1JT8 A;  1FGU A;  4TSS A;  4A93 G;  2FHT A;  1EWH A;  3GTM H;  4C3J H;  3RZD B;  3KJO A;  2EJM A;  1B44 D;  1C9O A;  4GS3 A;  3OYY A;  2JN4 A;  2UXB Q;  2MUY A;  2E2J B;  5LMN L;  2AQ3 B;  1NMF A;  2JSO A;  5FO7 B;  4S3S A;  1U9R A;  4PG3 A;  3MHB A;  3J81 j;  5IYD H;  1RDP D;  5T1G A;  1SE8 A;  5C4X H;  3HFZ B;  5ISR A;  4OIK A;  3U4V A;  5FOB B;  3S1R H;  1DOK A;  3AU7 A;  1Q81 C;  1JQY D;  2K4K A;  2EYJ A;  3HOW H;  2MGS A;  3GP7 A;  1M90 C;  1E1O A;  1STY A;  4H44 C;  5IGB A;  1OXS C;  3KK7 A;  1OXT A;  1HTL D;  1DGS A;  2G5D A;  2IY5 B;  4P74 A;  1U4M A;  1YHB A;  3FP9 A;  1K8O A;  3I91 A;  2JEB I;  5M5X B;  3EN2 A;  2OTL A;  2F0H A;  2Z4I A;  4LF4 Q;  3H3V H;  4FF3 A;  2KEC A;  2OT2 A;  2LKV A;  3FMC A;  5I9P A;  2E2H H;  2F0M A;  4GZY C;  1PH9 A;  4LFB Q;  2NYZ D;  1WVL A;  3T4A C;  1AZQ A;  1EEI D;  2F03 A;  4B3M Q;  1PH3 A;  2FMM A;  2IL8 A;  2RF4 A;  3MXP A;  2E75 C;  1X3G A;  3NBH B;  5IY0 A;  2ZTD A;  4GOP C;  3TP7 A;  4DR3 Q;  2B2W A;  2F4I A;  1ET9 A;  3HOY G;  2KHS A;  4ZQ3 A;  2EY2 A;  3H6M A;  2A1A A;  3K81 C;  4QIW E;  4TVA B;  5FK9 C;  1IZ6 A;  3N6R A;  4DK1 A;  5IWA L;  1UWV A;  5BR8 L;  3CF5 A;  1ESF A;  3M4Q A;  1QNU A;  1WTO A;  4BY7 H;  1O80 A;  4NXN Q;  3U58 A;  5H1S E;  1XNQ L;  2UUA Q;  1AP0 A;  1SJE D;  4IUT A;  1LYL A;  1D1I A;  1SFO B;  1OXX K;  1E2W A;  3M4O H;  3GTP H;  1JWM D;  1PH5 A;  2E2I B;  1G2T A;  5CGK A;  4K0K L;  2VB3 X;  3JAM E;  1NJI C;  4A3I B;  3UI2 A;  1EYA A;  1LTT D;  2IWH A;  1ZXT A;  1EY8 A;  1GKH A;  1IKL A;  2EJF C;  3S14 H;  1FNV A;  4DAP A;  3FPP A;  4OO1 G;  4PQX A;  1S4Z A;  2QF7 A;  3TN2 A;  5KND A;  4WFN 3;  5FKA C;  3NEL A;  2C9O A;  5E7N A;  3CRL C;  2CW0 D;  1OXV A;  2MO1 A;  4DV1 L;  4DGZ A;  3I8Z A;  4RGM A;  3PUW A;  1GD7 A;  2JQO A;  3A5Z B;  3TP8 A;  5C5L A;  2UU9 Q;  4ABN A;  1SRO A;  2PZW A;  3HZX A;  4X3T A;  1HR0 L;  3GV6 A;  3ND9 A;  1Q90 A;  1WTX A;  4A3K G;  4B3R Q;  3OWE B;  2A19 A;  3PF5 A;  1R4Q B;  4LMQ D;  4PMB A;  4C56 C;  1LUZ A;  1EY9 A;  3I73 A;  1I4X A;  3J7A 5;  2JA7 B;  5JVG 3;  3AEV A;  3BZK A;  1B70 B;  5C5M A;  4ZKC B;  1QVC A;  1X54 A;  1Y1W H;  2L9H A;  1VQ6 A;  4BBS B;  2E5L L;  2JA9 A;  1PRT D;  2CWA A;  5KRU A;  1FNU A;  1SNO A;  3QIA A;  2LXK A;  2CWP A;  4WJW A;  4R4C A;  2B2T C;  3T1H Q;  1EL0 A;  4IAL A;  5DM6 3;  2LSS A;  2SDF A;  1EY0 A;  3S17 H;  5I2X A;  1RF2 D;  5JEA J;  4XXE A;  5EAY A;  1VQD A;  4NXM Q;  3W1B A;  1YNN C;  3NUC A;  4DPG A;  4QUC A;  3VR6 A;  2O5J C;  1EEF D;  2GVA A;  1N9W A;  2LFN A;  3OSO A;  2TMP A;  4R4I A;  4IPH A;  4TQU S;  1YNJ D;  1HNZ Q;  1WFQ A;  5J1Z A;  3L7Z C;  4BBR B;  1K0S A;  5KYL A;  1TWH H;  1ZEQ X;  1Z7T A;  2EOT A;  3PV0 A;  4RGO S;  1Y1V B;  1PH4 A;  2PI2 A;  3M7N A;  1SE4 A;  2Q2T A;  2K33 A;  4AYB E;  4WJ3 M;  3CHB D;  4PMW A;  1FYC A;  4DAY A;  4LF7 L;  4A76 A;  2K28 A;  1XX8 A;  3W5O A;  3J7Z C;  3P20 A;  2EVB A;  2K1B A;  4K2L A;  4BBS G;  1I6H H;  3SK5 A;  4XTC S;  1ESR A;  2XRQ D;  3PIP A;  2NVX H;  4MTN A;  2D0O A;  4A3G H;  1HFN A;  4IJL A;  1H9R A;  1GXD C;  5DNF A;  2K14 A;  4JBM A;  1W6J A;  1JOQ A;  1D8L A;  2KCT A;  1A6X A;  3NHH A;  3G6E A;  4DR6 Q;  3F8T A;  2R6G A;  4HR7 B;  1F9P A;  2OXP A;  1QZG A;  2UXC L;  3PUY A;  4GKJ Q;  3Q22 A;  4LNQ A;  1TVX A;  3NPP A;  1PMR A;  3P7J A;  4DAY B;  2FJ2 A;  1VQH A;  3HKZ E;  3SGI A;  1W6K A;  1X3E A;  4OWW B;  1YBY A;  4JK1 C;  3S1Q H;  1N32 Q;  4DN4 M;  1KNE A;  1JMC A;  2RDH A;  4EGV A;  1I6V C;  1EUJ A;  5IE8 A;  2DY8 A;  4K5V A;  4OX9 Q;  2JA6 G;  1X6O A;  4QJF A;  4WOR A;  3D0F A;  2V1C C;  3NTI A;  4HAE A;  5IP9 G;  3FKI G;  1PDQ A;  2ZTE A;  1KRT A;  4YWK A;  3SHL A;  3NP8 A;  5E4W C;  2QKI C;  3SVM A;  2L4N A;  3HOW B;  4GNX A;  1J9O A;  1MHW C;  1FJG Q;  2BDO A;  4DNI A;  4DV5 Q;  1M8A A;  4YHH Q;  4KMU C;  1ENA A;  1I50 H;  2ZM6 Q;  2N88 A;  4JI7 L;  1AFP A;  4LFC Q;  2RSN A;  1B9M A;  5C3E B;  5ELN A;  5HUR A;  2JA5 H;  1NNX A;  2AHO B;  3T53 B;  5IT9 E;  4X66 Q;  4A3L G;  3BYY B;  3HKS A;  4OIJ A;  5M5W H;  4IUU A;  5M3F B;  1FL0 A;  1TWC B;  2R93 B;  4C1N K;  1EFI D;  1XPR A;  4OWT B;  3MEH A;  4GLX A;  2E2H B;  3JAM c;  3H94 A;  2RKS A;  4EQ5 A;  5BN4 A;  1TU2 B;  4RCN A;  1N8R C;  3PO3 G;  2Z6K A;  1WTW A;  3I2Z A;  4JI8 Q;  2L0C A;  4GNX B;  3TS0 A;  1KRS A;  5CV9 A;  2Q2H A;  3PIO A;  2IX0 A;  4NMZ A;  4NB3 A;  1JB3 A;  3VYT A;  4KJO A;  3K8A A;  3LNN A;  3HOU H;  1Q12 A;  5AJ3 L;  1E1T A;  2NZ1 D;  4MIU A;  4FF4 A;  1EQQ A;  1YIJ A;  4X62 Q;  4CDF C;  4FXK C;  4QUF A;  2I46 A;  4I65 A;  1B1Z A;  1B50 A;  2M2L A;  2SEB D;  2B8G A;  5C4J H;  4DUY L;  3BJU A;  2LMC B;  3KF8 A;  4X65 L;  3MXN B;  1S72 A;  1X9N A;  1WCM G;  4G4K A;  1SR3 A;  5C3E G;  2DNC A;  4IPG A;  2A69 D;  1LT6 D;  4KY5 A;  3IL8 A;  5GAD C;  4HSV A;  5M3F G;  1BXT A;  1SYF A;  4HJ9 A;  4R1J A;  3W1G A;  4RGN A;  1RD9 D;  1CM9 A;  1EQT A;  3RZD H;  2B63 B;  2LS0 1;  1K83 B;  3S9W A;  1LT3 D;  3KJP A;  1STN A;  2E2J H;  4BXX H;  2XWJ B;  1EY5 A;  5D3D A;  2VL6 A;  1BVS A;  3MXU A;  4M1U B;  1WTV A;  2K05 A;  2MFI A;  3R93 A;  4G7H C;  2KED A;  3C1E A;  3W3A A;  1DM0 B;  1GUS A;  3MWY W;  1VQN A;  3DHQ A;  4G7Z C;  3QJY A;  2ZJR A;  4AIM A;  5IYC G;  1VQ9 A;  3KLW A;  3J81 L;  3KF6 B;  4GN3 B;  3D4D A;  3OMG A;  2H1E A;  2VQF Q;  3DWP A;  1CTM A;  4J6H A;  1QZH A;  2B2U C;  4IQZ A;  3A8J E;  3O13 A;  5EPK A;  2PO4 A;  1CSP A;  1X65 A;  4P72 A;  1Y1W B;  4X3S A;  1AH9 A;  3SK8 A;  1NAP A;  1W2B A;  2B29 A;  1QCB D;  5M5Y B;  4FXG C;  1QE6 A;  1XNR L;  2PW7 A;  1QWY A;  3DM3 A;  2EJG C;  4OO1 H;  3TME A;  3GTK B;  3KOJ A;  1B4O A;  5CV7 A;  4DK6 C;  5M3M G;  5CV4 A;  5LL6 S;  1EZ8 A;  4YIJ A;  4DV4 Q;  2K04 A;  3M7G A;  1YJW A;  4GLA C;  4LF9 Q;  1LV9 A;  1N34 L;  1YNX A;  1KDB A;  4JI1 Q;  3RN2 A;  1M4V A;  3VR2 A;  5M9O A;  5JJZ A;  4HJ8 A;  3SK4 A;  2B2V C;  2F1M A;  2N8N A;  4IFD I;  5LL6 X;  1S3O A;  4G7O C;  2XTI A;  1SFO H;  3T1Y Q;  3PO2 G;  4P75 A;  1F2M A;  4MHE A;  1FR3 A;  4ILW A;  4A3I H;  4HMJ A;  5KNB A;  5T1I A;  2ASB A;  5A2Q E;  4N9T A;  5CV8 A;  2NVX B;  3Q6S A;  1VQG A;  1CKN B;  5FJ8 G;  1Q82 C;  4DUZ Q;  2I5H A;  1WTR A;  5LMU L;  1QIL A;  2E8G A;  5EBC A;  5IT9 c;  3QO2 A;  4IOC A;  2R92 B;  3MXG A;  4IUR A;  4LK1 C;  1N33 L;  1U4L A;  1MSH A;  2HDL A;  1IBL L;  4NDX A;  4C3I G;  1C0A A;  5NUC A;  3A8I E;  3G48 A;  2K5N A;  1BCP C;  1PZK D;  3KUP A;  4JBJ A;  4A3C G;  2CH4 A;  3D4R A;  4WJ4 A;  2FFK B;  3NQT A;  1KAB A;  4BY1 G;  1BNZ A;  1TY2 A;  2Q8I B;  4AYB B;  3V2T A;  4RKB A;  3RLF A;  4DV0 L;  2F0E A;  1TY0 A;  4JI6 L;  1A3V A;  2JA7 H;  2XN9 C;  2PZT A;  5FLX E;  3UDX A;  1CK1 A;  3OTO L;  1PH1 A;  4LF5 L;  1X3P A;  1SYE A;  4K5X A;  3TDQ A;  3GQB A;  4BBS H;  3CD6 A;  4JI5 L;  2F0K A;  2RSO A;  5KEE A;  4CKC A;  2F0T A;  4LF6 Q;  1LO5 D;  2K52 A;  2GVB A;  1UAP A;  1TS2 A;  5HY6 A;  1G91 A;  1PFS A;  1EYG A;  4XQJ A;  4DV2 Q;  3RZO B;  1VQM A;  1XMQ Q;  3CCU A;  1M1K C;  4X3U A;  4HJ7 A;  1BOS A;  2KA7 A;  4JI2 L;  3F2C A;  4KHZ A;  1CA5 A;  1HFG A;  4OGQ C;  3CME A;  1GM5 A;  1VF7 A;  1G6Z A;  4JPB W;  1C4Q A;  2UUB L;  2R3Z A;  4A3D G;  2F0P A;  4A93 B;  3T13 A;  1HZA A;  1H9M A;  1ICW A;  2F0S A;  4LUZ A;  1D5Z C;  3WDN A;  4X64 Q;  1YI2 A;  1YVC A;  3FHW A;  4BBR H;  4CKB A;  2PQE A;  4AYB G;  1Y1V H;  3S24 A;  2MO0 A;  3PCO B;  2E2D C;  1RTN A;  2PI2 E;  4ULL A;  3CCJ A;  3OMC A;  5IP9 H;  2MP1 A;  2IX3 A;  1I3Q B;  1XMO Q;  2J4X A;  1HH2 P;  3STB C;  2ZXR A;  1SMY C;  4JW0 A;  2HHH Q;  2EYP A;  2DN8 A;  1AN8 A;  3I4M B;  1R4P B;  2JJQ A;  5EKL A;  3ULJ A;  3MC0 B;  3VR3 A;  4DKA C;  4LF4 L;  2K5V A;  1MKH A;  1DJR D;  2VQE Q;  3VDY A;  4LF8 L;  1RIP A;  1UE5 A;  4XT1 B;  1S40 A;  1G6P A;  1KNA A;  2AWN A;  4A3L H;  3T51 B;  3I90 A;  2IHE A;  4HIK A;  4LFB L;  1K73 C;  3I4O A;  5EGT A;  3HKZ G;  4C3H G;  2RA4 A;  2OCE A;  1BCP B;  3PUZ A;  4IUN A;  2KCM A;  3ITP A;  5D3I B;  1EU3 A;  5IGE A;  4A3F B;  2AUJ D;  2KCN A;  5GQO A;  1ENF A;  2GA4 B;  3ER0 A;  4R8I A;  4A75 A;  3CW2 C;  4DXG A;  1D5M C;  3NE5 B;  3S2H B;  1TR5 A;  4H13 C;  3HOY B;  3CP0 A;  2Z0S A;  4J15 A;  1VQP A;  2YTV A;  1QVG A;  4POG A;  3ONA B;  1IBM Q;  3U4Z A;  2B3G A;  3DWQ A;  2HQE A;  1SAP A;  2B2W C;  1A8V A;  4NXN L;  3ZYY X;  3K57 A;  3I4M G;  3HP3 A;  3M85 A;  1L1O B;  4DV7 L;  2NTS A;  3NBH A;  3RUZ A;  2DGY A;  4EQN A;  3U9S A;  2PNR C;  5C3E H;  4POF A;  3R2I A;  3OIP A;  1SDF A;  1Y8P B;  1GHK A;  3HOX G;  1SYG A;  4F8M A;  3Q0A A;  5E4X A;  3IFT A;  5M3F H;  3PUV A;  3R8B A;  4EVO A;  1TWC H;  2R93 H;  3AQQ A;  3NEM A;  4LFA Q;  1A3U A;  2K6A A;  4A3F G;  4L8J A;  3TBI B;  4RKL A;  4ZRZ A;  5IYB G;  3EFX D;  4JBW A;  5C3X A;  1EIY B;  1QJO A;  5K36 H;  2XRS D;  2XNA C;  3HRZ C;  3A7L A;  4H02 A;  3NTK A;  3E0J A;  2QDL A;  3FRP B;  1J5E L;  2UUC L;  4JI4 Q;  4O2D A;  1Q3L A;  1MSG A;  5IP7 G;  1BBX C;  4AQY L;  2X6L A;  2L12 A;  3DUZ A;  1HZC A;  1A3T A;  4KY6 A;  2WKD A;  1AE2 A;  3IAY A;  1Q1B A;  1PFB A;  2CKZ B;  4LWC A;  2K32 A;  5LHY 1;  1BBU A;  4RA8 A;  2O5I C;  3GDE A;  3QOL A;  1CKO A;  3H0G G;  2ICI A;  2N49 A;  2K75 A;  1LTG D;  2WB1 E;  3SEB A;  4A3K B;  1WD1 A;  2CHB D;  4KLK A;  4I7A A;  4A3M G;  1S5B D;  3D6W A;  5FLX c;  1VCI A;  1NMG A;  2EDG A;  2Q8T A;  1VMC A;  2QEJ C;  4ZKB B;  1MIU A;  1MJE A;  1KLU D;  1PRT F;  4YCU A;  2B63 H;  1I4H A;  1NR2 A;  2JA8 G;  1KDC A;  1K83 H;  3FDT A;  4TKO B;  3ERQ A;  2D2C C;  3U9O A;  1K3R A;  4NXM L;  3TP5 A;  1WJJ A;  3F1Z A;  2YTX A;  2F4V L;  3KYH C;  4MNO A;  4KN7 C;  1EY6 A;  3D3R A;  4UPA A;  4KHV A;  1HNZ L;  1L2F A;  4A4I A;  1CZG A;  4A3E G;  1QB5 D;  3MZ5 A;  5C44 G;  1SNQ A;  3BVG A;  4L6T B;  1L0X B;  4HIM A;  1NY4 A;  2EY5 A;  2J0T D;  2WAC A;  4ZYS A;  2KCC A;  2L5T A;  4QY7 A;  3F2B A;  2EE1 A;  4FF2 A;  1IL8 A;  1SNM A;  5C4Z A;  1R9T H;  5ELB A;  1VMP A;  1U4P A;  1X32 A;  1TKW B;  5C0X G;  2M00 A;  1GO3 E;  3K5L A;  2C5C A;  5D65 A;  1I4R A;  4DAV A;  1O7I A;  4GN5 A;  1SEB D;  3QR8 A;  4KTA A;  3M4P A;  5IWA Q;  3RMH A;  2K50 A;  1DZ1 A;  5BR8 Q;  5M5Y H;  4DR7 Q;  5EBD A;  5FJ8 H;  4GOP B;  1K3B C;  5GAG C;  4CHT B;  1LTL A;  4Q0F A;  3E9H A;  3GTK H;  2LXJ A;  2O2L D;  2NN6 I;  4RHR A;  3T16 A;  1XNQ Q;  3AFQ A;  1DYQ A;  2WFW A;  4OWX B;  3NTH A;  2Z4H A;  1I5F A;  1PFN A;  4A3C H;  2UXD L;  1OXU A;  1Y8O B;  2L55 A;  4XT3 B;  4DV3 L;  5IGD A;  4UP9 A;  2JA6 B;  1PTO F; 
#chains in the Genus database with same CATH homology
 1BUV T;  2IW3 A;  2F0L A;  5EKI A;  3LWU A;  4IFD G;  3FKI B;  3J80 L;  4FYD A;  1PZI D;  3HEJ A;  4J1M A;  3I4L A;  4BWG B;  4UAI A;  1IW7 C;  2AQ1 B;  2B2Y C;  4RAU C;  4OL7 A;  4H0L C;  1RJT A;  3DEO A;  1MBY A;  1UEA B;  5KNC A;  1AEX A;  2HCC A;  3VYR A;  3BG3 A;  3C1F A;  3EJI A;  2JE6 I;  4KKT A;  3NWT A;  5COR A;  2NVY B;  1ML0 D;  3KLS A;  2JYO A;  3MFG A;  3PO3 B;  2R7Z B;  3LX0 A;  2PYK A;  2F0J A;  5FO9 B;  1B3A A;  3OHX C;  1EYD A;  3J7A F;  2K7V A;  2F0W A;  2QCP X;  1WCM B;  3VA5 A;  1HQR D;  1EIG A;  5CR3 A;  1BCP D;  5CV5 A;  2ZXO A;  3NK9 A;  1Q1E A;  5I6W A;  5JPN C;  1E2Z A;  2VUM B;  3I4N B;  3MXN A;  4N9P A;  1B53 A;  3SE0 A;  2NVQ B;  1CA6 A;  4HCS A;  2AQ2 B;  4NKL A;  2B8F A;  4ME5 A;  5KGU A;  1NSN S;  2LY7 A;  4KKS A;  1RTO A;  3GTJ B;  4J8Q A;  4C3J G;  3E6Z X;  5IOC A;  1EU4 A;  1GUG A;  5EJW A;  2BA0 A;  5ELD A;  4ZUJ A;  1SNP A;  3IFD A;  2N55 A;  3J81 E;  2B39 A;  3P1H A;  3MFY A;  1D5X C;  5IIF A;  3FVQ A;  1KAA A;  1DOL A;  3TP6 A;  1SYD A;  3TZD A;  3S1N B;  4OHJ A;  4CGY B;  4ZUI A;  4QIW B;  2K5D A;  1SMY D;  3L3O C;  3C46 A;  1CFM A;  3EA6 A;  4NW2 A;  4XQQ A;  5M3M B;  5K5P A;  1EZ6 A;  3A55 A;  3VYS A;  2EXZ A;  3GTQ B;  5ELF A;  3MTS A;  2RDF A;  1IKM A;  3CKI B;  3KLS X;  1LAC A;  4WRD A;  1PRT C;  1ET6 A;  5C0X I;  4XDX A;  2EPB A;  1R9T B;  4QCL A;  5IGF A;  1SXT A;  1F9Q A;  4KY7 A;  3MAQ A;  1HRJ A;  1AW7 A;  4K8I A;  3PO2 B;  2D62 A;  2A74 C;  1SYB A;  1LTB D;  3BYT B;  4KN4 C;  4P2C B;  1WTQ A;  5D14 A;  2IT1 A;  4CKE A;  5JOB A;  1ZYR C;  1GHJ A;  2KQ3 A;  4KK7 A;  2EZV A;  1SE2 A;  5CBE E;  5IGG A;  2F3W A;  4FF1 A;  2WV6 D;  2BE5 C;  1UUP A;  1Q8I A;  2OF1 A;  1ILQ A;  2A73 B;  4C3I B;  2A6H C;  4EQP A;  1JE4 A;  1TS3 A;  2MHV A;  2J7Z A;  1DCZ A;  1LLR D;  1X3Q A;  4RGT A;  4IUP A;  1JR0 D;  4BY1 B;  1KLG D;  1VF5 C;  4IUQ A;  1C48 A;  3MA2 B;  3N52 A;  3EVQ A;  5I4D A;  1MD2 D;  5CYU A;  3BVZ A;  2PPB C;  4DXF A;  3A8K E;  2BA1 A;  3AB9 A;  2SOB A;  3K0Y A;  3QB3 A;  5DM7 3;  3E5S A;  3H91 A;  2QDB A;  3M3Y B;  2ICE C;  1XXG A;  4I7Z C;  1IYV A;  2IPK D;  4A3D B;  3OWF A;  1PTO C;  1E2V A;  5BN5 A;  2F0Q A;  4QMG A;  2M9V A;  4O1N A;  2NB0 A;  2F0N A;  5AFW A;  5G3L F;  1DON A;  4DA2 A;  5TSS A;  1GOZ A;  2SNM A;  4NP5 A;  4H7B A;  4IFD H;  4ODG A;  3WOE A;  2MJ8 A;  3OPO A;  3EQL C;  4M8A A;  3OIQ A;  1QOH A;  2G9H D;  3NWS A;  1MGS A;  1KDA A;  2EYO A;  1U4R A;  3S1M B;  3PIP 3;  1LTR D;  4XIG S;  3HKZ B;  4C3H B;  1DOM A;  2XIW A;  4K8J A;  2NN6 G;  2EYM A;  1Z47 A;  3PUX A;  1EYC A;  4U68 A;  1ONL A;  1HXY D;  3D4W A;  3D8G A;  3DWA A;  1DD2 A;  3K5N A;  4LAA A;  3HOV B;  1O7Z A;  1C8C A;  1D1K A;  4PMC A;  3X3M A;  3X3N A;  3DXJ C;  1LT5 D;  1Z6H A;  1ZKO A;  3HG9 A;  3A54 A;  2F3V A;  1VDZ A;  2Z8L A;  3GV3 A;  1BDO A;  5CBA E;  1YNN D;  2CVR A;  5FLX L;  4X3K A;  5C6A A;  3HOX B;  1H9S B;  1GUO A;  1PTO B;  5ELE A;  1DXM A;  3HOZ B;  2HCI A;  3LWE A;  4EQO A;  4FNF A;  3HGB A;  2I07 B;  4CJ1 B;  2VXW A;  3C3L A;  3D6C A;  4Y7N B;  2RQX A;  1TWA B;  4R9W A;  4V19 0;  3I70 A;  1IW7 D;  5EKK A;  4HSP A;  1F2Z A;  1FD7 D;  4F88 A;  5CMD A;  1QG7 A;  2H4O A;  3PIO 3;  5E3F A;  3S2D B;  1AZP A;  3BVM A;  2JP1 A;  1JOK A;  1V1P B;  3H0G B;  4G57 A;  3QOJ A;  4B08 A;  3J7Y W;  4A3M B;  2A68 C;  1PFM A;  3R2T A;  1H9J A;  1SND A;  2BCO A;  1G2S A;  3G7L A;  2QIL A;  3T56 B;  2JA8 B;  2F0D A;  1O7L A;  3TSS A;  2F0V A;  1UNS A;  4C1N I;  2EYL A;  2ENB A;  3DMU A;  3V05 A;  1SSO A;  1CZW A;  5C4H A;  4A3E B;  5C44 B;  1WTP A;  5JAV A;  5A35 A;  3S16 B;  2RDG A;  3P75 A;  1FNW A;  2VNU D;  1S5C D;  2FMC A;  3BDO A;  2E74 C;  2O4X A;  1TWG B;  3WOF A;  3SK6 A;  1O7Y A;  1TII D;  3I3C A;  1HHV A;  2X69 A;  5JVH 3;  2PZU A;  2JEA I;  3CU7 A;  4E6I A;  4RFB A;  5EQ0 A;  2WP8 J;  5E1F A;  1LT4 D;  1HTP A;  4K6D A;  1RKN A;  2PCF B;  2F0O A;  3K5M A;  5EPL A;  4FVM A;  3K5O A;  2Q8R E;  1SYC A;  2XSC A;  1I4P A;  1JWS D;  4DK0 A;  3L9A X;  3NXW A;  3NSW A;  5C3W A;  1KTK A;  1SNC A;  3J80 E;  4XYO A;  3SDZ A;  4KD3 A;  2AWO A;  3GD7 A;  4DF7 A;  1HCZ A;  5JEA G;  3R3O A;  2MPM A;  3BDC A;  2IX1 A;  1ENC A;  1EQV A;  1CHP D;  2A6E C;  2K03 A;  3I72 A;  4IUV A;  3JAM L;  5C0X J;  4C2M B;  2VB2 X;  1GUT A;  1JOO A;  1STH A;  1V8Q A;  3S15 B;  4O42 A;  1LTA D;  3QG1 A;  4Q5V A;  2D5D A;  1TQO A;  1A15 A;  3OOC A;  1O78 A;  2V4D A;  5EPJ A;  3W2D A;  2Z1C A;  1FGB D;  4B9X A;  1T5X D;  3V96 A;  2TSS A;  3H3V C;  1PXU A;  1ZYR D;  3HS0 C;  4QF4 A;  5KYI A;  2BE5 D;  1STB A;  4Z9C B;  3GTO B;  3Q24 A;  1TWF B;  3GTG B;  1BCP F;  2A6H D;  1F2L A;  4RH6 A;  2RBM A;  4U67 3;  4IFD J;  2B2T A;  1HPC A;  2NN6 H;  2WIN B;  3VYU A;  1CHQ D;  1STE A;  5I6Y A;  3OW7 A;  3DEP A;  3BDL A;  1SE3 A;  1GUN A;  4QB4 A;  4ZLT F;  3CQZ B;  3CRK C;  1Y8N B;  3GTM B;  4C3J B;  1GJX A;  4MN3 A;  2PMZ B;  1L0Y B;  1V43 A;  1Y69 U;  2E76 C;  1HUN A;  4ZK9 B;  2FIN B;  2JXM B;  2K5W A;  2KJX A;  2B2Y A;  5C4X B;  1PTO D;  2OEO A;  3S1R B;  5KIX A;  2K01 A;  1SJH D;  2NTT A;  5JPM C;  1JC7 A;  4ZAI A;  4DNR B;  1LAB A;  1CQV A;  2NBF A;  3FPU B;  4BA1 I;  2NWG A;  1PZJ D;  3IKJ A;  2K5Q A;  3K59 A;  3SR1 A;  1BO0 A;  4UDU C;  4FP5 D;  1B9N A;  2WKC A;  2WAQ B;  5IOD A;  4HTH A;  4F7X A;  1H9K A;  1CQF A;  4R8N A;  2EYH A;  1NR4 A;  1XYI A;  4LJZ C;  2CQA A;  2D9U A;  1BF4 A;  3A7A B;  3VR5 A;  4CBV A;  2BDN A;  3BS1 A;  1PTO H;  1WD0 A;  4F87 A;  1PLF A;  2CW0 C;  1F77 A;  1HA5 A;  3VA7 A;  3A56 A;  4XQN A;  4BY7 B;  1XWE A;  5IT9 L;  1S5F D;  3PMF A;  4V0B A;  1HUM A;  1I4G A;  1ROD A;  2HDM A;  3M4O B;  3GTP B;  4PV1 C;  1NUC A;  5COY A;  4HED A;  4OO1 I;  5K36 G;  2L1B A;  1V1O A;  3S14 B;  2WB1 B;  5CC4 A;  1EY7 A;  1A2U A;  5BN3 A;  4HCE A;  2NVT B;  2DNE A;  1S5D D;  1IYU A;  2G9D A;  3BZD B;  4KV6 A;  1LTI D;  3URY A;  3ERO A;  1TT2 A;  1CI3 M;  1J8I A;  1EOT A;  2NUC A;  1G8Z D;  2YU9 B;  5DAU A;  4DFA A;  4RCO A;  1STA A;  1YNJ C;  1RHP A;  3KBG A;  1EIH A;  1K8M A;  2A5H A;  3K6O A;  2L11 A;  1QNK A;  1JWU D;  2ID0 A;  1MI2 A;  4BS9 A;  4HMI A;  2KEE A;  4A3J B;  4PNY A;  1B2T A;  1II3 A;  2A68 D;  2X6G A;  2F0F A;  3S17 B;  4B9W A;  2F0G A;  3H09 A;  3NQI A;  4CJ2 C;  1GUW A;  2EY1 A;  5C0X H;  1LTS D;  5FO8 B;  1NCV A;  4BA2 I;  3K58 A;  1XTC D;  4A3B B;  2KOL A;  1TWH B;  2AUK A;  2B2U A;  1JOR A;  2KUM A;  5JEA H;  4K14 A;  1IHZ A;  4FO2 A;  1ILP A;  2ZT9 C;  2F0I A;  3KLR A;  3C2P A;  1I6H B;  4TRD A;  3FEW X;  4FXD A;  3NBI A;  4A3G B;  3D31 A;  3DM1 A;  1PRT B;  1STG A;  3TZU A;  1EWC A;  3KBX A;  4IZ8 A;  5HGT A;  2KVM A;  3G6J B;  3RD4 A;  2ZXP A;  3MVV A;  3F2U A;  4K2K A;  5I2Y A;  1BQQ T;  3K7A B;  2DY7 A;  1F9S A;  1SBB B;  1HQM C;  4KJN A;  3GO5 A;  3S1Q B;  2B2V A;  1OO9 B;  4KD4 A;  1EY4 A;  2R61 A;  1PYW D;  1G29 1;  4RHS A;  2RVL A;  1A2T A;  1JCK B;  4ID6 A;  5F2D A;  2Y0S B;  3ND8 A;  5I9O A;  1E0B A;  5A2Q L;  1CT1 D;  1F9R A;  5J22 A;  5J39 A;  2XWB B;  3J7A V;  4K6L A;  1I50 B;  1TS4 A;  3Q23 A;  2IJ0 A;  2JA5 B;  2WII B;  1S5E D;  4XYQ A;  5M5W B;  1H9S A;  2SNS A;  3QWN A;  2A69 C;  1JIC A;  2EY6 A;  4L63 B;  4DNT B;  2HUG A;  2A6E D;  2PW5 A;  1D6E C;  1F2Y A;  5DEH A;  2EYF A;  4HN7 A;  3HOU B;  3VR4 A;  2YYZ A;  1RCV D;  3SXH A;  4IN3 A;  5CV6 A;  4KKU A;  1BR9 A;  5G3L D;  5IGC A;  1TS5 A;  4RWS C;  1I4Q A;  1T5E A;  1HA6 A;  3AMU A;  5C4J B;  1V1P A;  4KI0 A;  2XVS A;  5ELC A;  3GTL B;  4DU9 A;  2BOS A;  2F0U A;  1D2B A;  4K5W A;  4CJ0 B;  3M4Y A;  4TSS A;  2FHT A;  1EWH A;  3RZD B;  2EJM A;  1B44 D;  2MUY A;  2E2J B;  2AQ3 B;  5FO7 B;  2JSO A;  4S3S A;  1U9R A;  3MHB A;  1RDP D;  5T1G A;  5ISR A;  4OIK A;  5FOB B;  1DOK A;  3AU7 A;  1JQY D;  2EYJ A;  2MGS A;  3GP7 A;  1STY A;  4H44 C;  5IGB A;  1OXS C;  3KK7 A;  1OXT A;  1HTL D;  1U4M A;  1K8O A;  3I91 A;  2JEB I;  5M5X B;  2F0H A;  2Z4I A;  4FF3 A;  2KEC A;  2OT2 A;  2LKV A;  3FMC A;  5I9P A;  2F0M A;  4GZY C;  2NYZ D;  1WVL A;  3T4A C;  1AZQ A;  1EEI D;  2F03 A;  2FMM A;  2IL8 A;  3MXP A;  2E75 C;  3TP7 A;  2B2W A;  2F4I A;  1ET9 A;  2KHS A;  4ZQ3 A;  2EY2 A;  3H6M A;  5FK9 C;  3N6R A;  4DK1 A;  1ESF A;  1QNU A;  1WTO A;  1O80 A;  1AP0 A;  1SJE D;  4IUT A;  1D1I A;  1SFO B;  1OXX K;  1E2W A;  1JWM D;  2E2I B;  1G2T A;  5CGK A;  2VB3 X;  3JAM E;  4A3I B;  3UI2 A;  1EYA A;  1LTT D;  2IWH A;  1ZXT A;  1EY8 A;  1IKL A;  2EJF C;  1FNV A;  4DAP A;  3FPP A;  4OO1 G;  4PQX A;  1S4Z A;  2QF7 A;  3TN2 A;  5KND A;  4WFN 3;  5FKA C;  2C9O A;  3CRL C;  2CW0 D;  1OXV A;  4DGZ A;  3I8Z A;  4RGM A;  3PUW A;  3TP8 A;  5C5L A;  4ABN A;  2PZW A;  3HZX A;  4X3T A;  3GV6 A;  3ND9 A;  1Q90 A;  1WTX A;  3OWE B;  1R4Q B;  4LMQ D;  4PMB A;  4C56 C;  1EY9 A;  3I73 A;  1I4X A;  2JA7 B;  5JVG 3;  5C5M A;  4ZKC B;  2L9H A;  4BBS B;  5KRU A;  1PRT D;  1FNU A;  1SNO A;  3QIA A;  4WJW A;  2B2T C;  1EL0 A;  4IAL A;  5DM6 3;  2SDF A;  1EY0 A;  5I2X A;  1RF2 D;  5JEA J;  4XXE A;  1YNN C;  3NUC A;  4QUC A;  3VR6 A;  2O5J C;  1EEF D;  2LFN A;  3OSO A;  2TMP A;  4TQU S;  1YNJ D;  5J1Z A;  3L7Z C;  4BBR B;  5KYL A;  1ZEQ X;  1Z7T A;  2EOT A;  3PV0 A;  4RGO S;  1Y1V B;  3M7N A;  1SE4 A;  2K33 A;  3CHB D;  4PMW A;  1FYC A;  4DAY A;  2K28 A;  1XX8 A;  3P20 A;  2EVB A;  2K1B A;  4K2L A;  3SK5 A;  4XTC S;  1ESR A;  2XRQ D;  1HFN A;  1H9R A;  1GXD C;  5DNF A;  1W6J A;  1JOQ A;  1A6X A;  3NHH A;  2R6G A;  4HR7 B;  1F9P A;  2OXP A;  3PUY A;  3Q22 A;  1TVX A;  3NPP A;  1PMR A;  3P7J A;  2FJ2 A;  1W6K A;  4JK1 C;  4DN4 M;  1KNE A;  2RDH A;  4EGV A;  1I6V C;  2DY8 A;  4K5V A;  4WOR A;  3NTI A;  4HAE A;  1PDQ A;  3SHL A;  3NP8 A;  5E4W C;  2QKI C;  3SVM A;  2L4N A;  3HOW B;  1J9O A;  2BDO A;  1M8A A;  4KMU C;  1ENA A;  2N88 A;  1AFP A;  2RSN A;  1B9M A;  5C3E B;  5HUR A;  3T53 B;  5IT9 E;  3BYY B;  4OIJ A;  4IUU A;  5M3F B;  1TWC B;  2R93 B;  4C1N K;  1EFI D;  3MEH A;  2E2H B;  3H94 A;  2RKS A;  5BN4 A;  1TU2 B;  4RCN A;  1WTW A;  2L0C A;  5CV9 A;  2IX0 A;  4NMZ A;  3VYT A;  1JB3 A;  4KJO A;  3LNN A;  1Q12 A;  2NZ1 D;  4MIU A;  4FF4 A;  4FXK C;  4QUF A;  2I46 A;  4I65 A;  1B1Z A;  1B50 A;  2M2L A;  2SEB D;  2B8G A;  2LMC B;  3KF8 A;  4G4K A;  2DNC A;  2A69 D;  1LT6 D;  4KY5 A;  3IL8 A;  4HSV A;  1BXT A;  1SYF A;  4RGN A;  1RD9 D;  1CM9 A;  1EQT A;  2B63 B;  2LS0 1;  1K83 B;  3S9W A;  1LT3 D;  1STN A;  2XWJ B;  1EY5 A;  5D3D A;  3MXU A;  4M1U B;  1WTV A;  2K05 A;  3R93 A;  4G7H C;  2KED A;  3C1E A;  3W3A A;  1DM0 B;  1GUS A;  3MWY W;  3DHQ A;  4G7Z C;  3QJY A;  3J81 L;  3D4D A;  3OMG A;  2H1E A;  3DWP A;  1CTM A;  4J6H A;  2B2U C;  4IQZ A;  3A8J E;  3O13 A;  5EPK A;  2PO4 A;  1Y1W B;  4X3S A;  3SK8 A;  1NAP A;  1QCB D;  5M5Y B;  4FXG C;  1QE6 A;  2PW7 A;  1QWY A;  2EJG C;  4OO1 H;  3TME A;  3GTK B;  1B4O A;  5CV7 A;  5CV4 A;  5LL6 S;  1EZ8 A;  4YIJ A;  2K04 A;  3M7G A;  1LV9 A;  1KDB A;  1M4V A;  3VR2 A;  5M9O A;  5JJZ A;  3SK4 A;  2B2V C;  2F1M A;  4IFD I;  5LL6 X;  4G7O C;  1F2M A;  4MHE A;  1FR3 A;  4ILW A;  4HMJ A;  5KNB A;  5T1I A;  5A2Q E;  4N9T A;  5CV8 A;  2NVX B;  3Q6S A;  1WTR A;  1QIL A;  5EBC A;  3QO2 A;  2R92 B;  3MXG A;  4IUR A;  4LK1 C;  1U4L A;  1MSH A;  2HDL A;  4NDX A;  4C3I G;  5NUC A;  3A8I E;  3KUP A;  1BCP C;  1PZK D;  3D4R A;  2FFK B;  3NQT A;  1KAB A;  1BNZ A;  1TY2 A;  2Q8I B;  4AYB B;  3V2T A;  4RKB A;  3RLF A;  2F0E A;  1TY0 A;  1A3V A;  2XN9 C;  2PZT A;  5FLX E;  1CK1 A;  1X3P A;  1SYE A;  4K5X A;  3TDQ A;  3GQB A;  2F0K A;  2RSO A;  5KEE A;  4CKC A;  2F0T A;  1LO5 D;  1UAP A;  1TS2 A;  1G91 A;  4XQJ A;  3RZO B;  4X3U A;  1BOS A;  2KA7 A;  4KHZ A;  1CA5 A;  1HFG A;  4OGQ C;  1VF7 A;  1G6Z A;  1C4Q A;  2R3Z A;  2F0P A;  4A93 B;  3T13 A;  1H9M A;  1ICW A;  2F0S A;  1D5Z C;  3WDN A;  4CKB A;  2PQE A;  2E2D C;  1RTN A;  4ULL A;  3OMC A;  2MP1 A;  2IX3 A;  1I3Q B;  2J4X A;  2ZXR A;  1SMY C;  2EYP A;  2DN8 A;  1AN8 A;  3I4M B;  1R4P B;  5EKL A;  3MC0 B;  3VR3 A;  1DJR D;  4XT1 B;  1KNA A;  2AWN A;  3T51 B;  3I90 A;  5EGT A;  4C3H G;  2RA4 A;  1BCP B;  3PUZ A;  4IUN A;  3ITP A;  5D3I B;  5IGE A;  1EU3 A;  4A3F B;  2AUJ D;  2KCN A;  1ENF A;  2GA4 B;  4R8I A;  4DXG A;  1D5M C;  3NE5 B;  3S2H B;  1TR5 A;  4H13 C;  3HOY B;  3ONA B;  2HQE A;  3DWQ A;  1SAP A;  2B2W C;  3ZYY X;  3K57 A;  3HP3 A;  3M85 A;  2NTS A;  3NBH A;  3RUZ A;  4EQN A;  3U9S A;  2PNR C;  3R2I A;  3OIP A;  1SDF A;  1Y8P B;  1GHK A;  1SYG A;  4F8M A;  3Q0A A;  5E4X A;  3IFT A;  3PUV A;  3R8B A;  4EVO A;  1A3U A;  2K6A A;  4L8J A;  3TBI B;  4ZRZ A;  4RKL A;  3EFX D;  4JBW A;  5C3X A;  1QJO A;  5K36 H;  2XRS D;  2XNA C;  3HRZ C;  3A7L A;  3NTK A;  3E0J A;  3FRP B;  1Q3L A;  1MSG A;  1BBX C;  2X6L A;  2L12 A;  3DUZ A;  1A3T A;  4KY6 A;  2WKD A;  3IAY A;  1Q1B A;  1PFB A;  2K32 A;  5LHY 1;  2O5I C;  4RA8 A;  3QOL A;  2ICI A;  3SEB A;  4A3K B;  1LTG D;  1WD1 A;  2CHB D;  1S5B D;  3D6W A;  1VCI A;  2Q8T A;  2EDG A;  1VMC A;  2QEJ C;  4ZKB B;  1KLU D;  1PRT F;  1I4H A;  1NR2 A;  1KDC A;  4TKO B;  3FDT A;  3ERQ A;  2D2C C;  3U9O A;  3TP5 A;  4KN7 C;  1EY6 A;  3D3R A;  4KHV A;  1CZG A;  1QB5 D;  3MZ5 A;  1SNQ A;  3BVG A;  4L6T B;  1L0X B;  2EY5 A;  2J0T D;  2WAC A;  4ZYS A;  2KCC A;  2L5T A;  2EE1 A;  4FF2 A;  1IL8 A;  1SNM A;  5C4Z A;  5ELB A;  1VMP A;  1U4P A;  1X32 A;  1TKW B;  5C0X G;  2M00 A;  3K5L A;  2C5C A;  5D65 A;  1I4R A;  4DAV A;  1SEB D;  4KTA A;  3RMH A;  1DZ1 A;  5EBD A;  4CHT B;  4Q0F A;  2O2L D;  2NN6 I;  4RHR A;  3T16 A;  1DYQ A;  3NTH A;  2Z4H A;  1PFN A;  1OXU A;  1Y8O B;  2L55 A;  4XT3 B;  5IGD A;  2JA6 B;  1PTO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...