4X64Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x64Q00
2VUMG 4ALPA 2HIVA 4DR2L 3EIVA 1QVCA 1OXTA 2WAQE 4R4IA 4IJLA 3W1GA 3GTQH 3LGJA 1EIYB 4POFA 2K75A 1EQQA 3H15A 2YTXA 1L0WA 2CWAA 3K80C 4QGUA 1C9OA 1L2FA 4HIKA 4P73A 5IYBG 4A3EH 4HIMA 1E7ZA 1YBYA 1A8VA 4DR2Q 1MKHA 2UXDL 4BXXH 5GAEC 1FJGQ 5IY0A 4IFDJ 4JC0A 4A4IA 1E22A 5IT9c 3PUVA 2R7FA 4A3LG 3PCOB 2JK8A 4X66L 3RN5A 5M5WH 1VQAA 3HKZG 4GNXC 4JI5L 4HJ8A 4TQUS 2VW9A 4LFBL 2Q2HA 3CCMA 2K4KA 4OWTB 5JEAJ 4A75A 1K8GA 4C3HH 1Y1WG 4P71A 4JI1L 3G4SA 2RCNA 1N34L 1VQNA 4DR6L 1K3RA 4OWWB 4GOPC 3L7ZC 4LWCA 1PH8A 1YVCA 4B3SL 4K0KL 4X66Q 3BJUA 1WCMH 4JI5Q 2I0QA 3HFZB 1X54A 4A3MH 3I4OA 4OO1I 2HHHL 2ALYB 4LFBQ 2NN6G 2N78A 1VQ6A 2KHIA 2JQOA 1VQDA 1YHAA 1N34Q 3GTKH 1NE3A 4DKAC 4DR1L 4GNXA 2HQLA 1SROA 5IP9H 1PVOA 1VQEA 4P74A 4A3IG 1KC8C 2JE6I 4HJAA 2B3GA 1NBWA 1FGUA 4C2MH 1XNQQ 5E7NA 4YHHQ 5M5XH 1FL0A 3F2CA 1TWAH 4GOPA 1QVFA 2C35B 4AH6A 1X3GA 1UE1A 5BR8L 1A0IA 1E3PA 1P8LA 3FKIG 1I94Q 1VS0A 2E2IH 4PZ8A 2WFWA 4A76A 1PH9A 3NEMA 4APVA 4IPGA 1YHBA 5HGQA 3KJPA 3D0FA 3CW2C 4JYAQ 1PYSB 4B3RQ 2K14A 2R6GA 1NJIC 1HNXQ 2D0PA 4B3TL 3KF6B 1V1QA 3OYYA 3HOXG 2I5MX 3FKIH 2IX1A 1VQ9A 4QIWE 5M3MG 1EQRA 1O7IA 1OXSC 2UUAL 1GVPA 2PMZE 2OQKA 2NVYH 2YV5A 1VQBA 3CMAA 4GLAC 3HOXH 4A3DH 3HKSA 3WWVA 1X3EA 4B3TQ 4OO1G 1NMFA 1RIPA 1E24A 2AWOA 4IOAA 2DGYA 4YWLA 5C4JH 1YNXA 3EN2A 1D7QA 5LMNW 2FXQA 2N49A 1J5EL 3H0GG 1HR0L 4IPDA 4A3BG 5GAHC 3CCSA 2UUBL 3S16H 1U0LA 4C3JH 1X65A 1TWHH 3CCEA 4LFAQ 1X56A 4DUZL 3I4MH 2CCZA 1PH2A 1XJVA 5FLMH 1Q82C 2I5HA 3CC2A 4A3JG 2UU9L 4B3ML 4BY7H 4LF9L 3ICEA 1B7YB 1QZGA 5M3FH 1UE7A 2R7ZG 2WAQG 2JA6G 2D0OA 2E5LL 1IBLL 3JAMc 5IYCH 4XTCS 4AIMA 3HOYG 3J7A5 3KFUA 1JJ2A 4A3BH 1Z9FA 1J5EQ 4A93G 1PH1A 4YY3L 2EQSA 2ZJPA 1HR0Q 4LF7L 1LTLA 3I55A 3PO2G 3HOZG 4YWMA 4Y7NH 4DUZQ 2YYZA 4A3JH 4IFDI 5IE8A 1YJNA 4B3MQ 2ZJQA 1QUQA 2NZOA 3HOYH 1SR3A 3PIPA 1K83H 1IBLQ 2DUDA 3MEFA 3JAMi 3PO2H 4KHZA 2Z6KC 1GO3E 3HOZH 4IOCA 3K7AH 4YY3Q 4LF7Q 1B70B 2GN5A 4OXPA 2Y0SE 3PUXA 1Q12A 3PV0A 2JA7H 5GQOA 2R93G 4JI6Q 3ERSX 5C3EH 2OTLA 1GM5A 2B63H 2V1CC 1S40A 1HZAA 3S2HH 4PZ6A 1EWIA 4LF6Q 1G51A 4NXNQ 1FJGL 4YWKA 4JI7L 1OXXK 2R93H 4GNXB 5C44G 4O2DA 1V43A 2E2HH 2JEBI 1SMXA 5FLXc 4NXML 2VUMH 1S72A 2PI2E 1NTGA 4GN3B 4L5QA 1XPUA 4QL5A 4PZ7A 1BVSA 3W5OA 2Z6KA 4JI8Q 1KD1C 3E9HA 4DR5L 5C0XI 3TS2A 4GOPB 3ULLA 4MZ9A 1I3QH 4UY8C 3PF4A 3BU2A 4JI7Q 1EYGA 3M4PA 1Q81C 4IJHA 3TRZA 3CC4A 1VCIA 2LXJA 2ZTEA 5J3BA 3UDXA 5IYBH 4JI4L 4IFDG 4NXMQ 4X6AH 1T9HA 3K0XA 2RHQB 3UDIA 4WJ4A 1EOVA 1MJCA 1L1OB 3RLNA 1TWCH 3CAMA 3AEVA 4DR5Q 4OX9Q 4DV2Q 1N36Q 1ASZA 4A3LH 3JC66 3RNUA 3RLFA 5IP7G 3S17H 3S1NH 1TXYA 4R4QA 5LMUL 2CKZB 3T1YQ 2UUCL 3T1HQ 1VQ4A 4GKJL 1VQFA 3F8TA 3PUWA 3CCJA 1PH6A 1KXLA 3RZOH 4JI4Q 1HNWL 4R4OA 1Y1WH 1XNQL 1JMCA 2QEXA 4YHHL 1TWGH 4L5TA 1CSQA 1JT8A 3RN2A 2F52A 1L1OC 4DR3L 2N8NA 4DR7Q 3S1RH 1KAWA 1PFSA 2Z0SA 1I94L 3HOUG 5LMUQ 2UUCQ 4GLVB 1LYLA 1ASYA 4GKJQ 2YTVA 1JJGA 3TREA 4DV1L 4DV3Q 2RHSB 4YCWA 1CKNA 4JV5Q 4A3FG 5C0XJ 4JYAL 1HNWQ 4B3RL 1HNXL 2NZHA 3HOWG 2NVQH 2JJQA 3K81C 4UP7A 4QQBX 4JCVE 1VQHA 2IHFA 1N9WA 2PNHA 4YCVA 3F1ZA 2F3IA 4DR3Q 3HOUH 1Q1EA 2K5HA 2ZTDA 2IX0A 4X64Q 1GKHA 2WB1E 2I5LX 1P16A 1W3SA 4A3IH 2WP8J 4GS3A 2KHJA 3U50C 3U4VA 1I5FA 2BH8A 1WOCA 4GN4B 1G291 1HZ9A 4DV1Q 1IL2A 3E0EA 1UEBA 1IXRA 4BA2I 3G6EA 1C0AA 1L1OA 4DK3C 3I2ZA 3J81j 1CKOA 1QVGA 1IBML 1QUQB 1A63A 4LF8Q 2VS1A 4DV0Q 2JA9A 4RMFA 4BY1G 3U4ZA 3GTOH 3NBHB 2PI2A 1K0RA 1YHQA 4WJ3M 1JB7A 1HH2P 1HZBA 4R4TA 3CPFA 3W1BA 3OW2A 1S3OA 4DV6L 1KQSA 5JJKA 1XPRA 5GAGC 3J81c 4LFAL 2E8GA 5M5YH 1PV4A 1C7YA 1VQGA 4ME3A 3CMEA 1YI2A 1VQCA 2JA8G 4MTNA 4LNQA 1IBMQ 1J6QA 5M3MH 4PMWA 3GDEA 3UE1A 1X6OA 1HNZL 3CD6A 5IYDG 4Y52H 4JBJA 3H3VI 1UE5A 2Y0SG 4DV6Q 1HR0W 3BZKA 3A5UA 4O0AA 3S15H 2JA8H 5HY6A 3J81i 1N36L 1VQLA 4GN5A 2F4VL 1BBUA 3F2BA 3GTLH 3CCRA 3PSIA 3FHWA 1VQKA 2XGTA 4RG1A 3PUYA 2GVAA 2VNUD 4LW1A 3B6YA 1HNZQ 3H0GH 2ASBA 4EQ5A 3G48A 2ZJRA 2CWPA 4LF5Q 1YZ6A 2ZM6L 2OQ0A 4L5RC 2A19A 1NMGA 3M9BA 2CQOA 3RLOA 2KENA 1X9NA 3CXCA 1DGSA 4JI6L 2F4VQ 1K73C 3AQQA 1QZHA 4KI0A 3UE0A 2R7ZH 2JA6H 3PO3G 3G71A 5C4XG 1CUKA 1VQOA 4LF6L 4KLKA 1SFOH 4OWXB 4A93H 3SGIA 4DAYB 2QA4A 4NXNL 3STBC 1N8RC 2JA5G 1PHJA 3KOJA 2MFIA 2ZM6Q 4A3GG 4LFCL 4PG3A 4DAMA 1I6HH 5EAYA 1KRSA 4UP9A 1YEZA 4A3CG 3CF5A 2B29A 4J15A 1BKBA 4IPHA 3CQZH 3KYHC 5IWAQ 3AFPA 4KHPL 2Q2UA 3I4NG 4YCUA 3MXNB 1N33L 4MNOA 5JJLA 3KDFB 4JI8L 1E1TA 2PQAA 1WYDA 4LUOA 3PUZA 5AJ3L 1JJCB 3M4OH 2R92G 4HJ7A 2UXBL 2N3SA 4A3CH 2LSSA 3STBD 4LFCQ 1Q7YC 1N32L 1YJ9A 4KHPQ 4QY7A 4GKKL 1CKNB 4BA1I 1PH4A 4C3IH 1N33Q 5ELNA 2HIXA 2IY5B 4OX9L 1V9PA 2ZTCA 3K8AA 1X3FA 4NPSA 5AJ3Q 4DV2L 3TS0A 3ULPA 1VQPA 2VL6A 2A1AA 4AQYQ 2ID0A 3NELA 5C44H 2UXBQ 2NN6I 3T1YL 2AHOB 3T1HL 2MO1A 4LUZA 5ELOA 3L2PA 3U58A 2Q2TA 1N32Q 2HT1A 4JI3L 4A3EG 4LF4L 4XIGS 3DM3A 2GVBA 4GKKQ 5GADC 4BXXG 4DV7L 4TVAB 4A3KG 1YITA 3VDYA 1R9TH 1TWFH 3E9IA 4HJ5A 3IRBA 4DR7L 3S24A 2BA0A 2WB1G 3UDFA 1BBWA 5JEAG 3CPWA 1Y1VG 4HJ9A 2R7DA 3Q8DA 1OXVA 3FP9A 4AYBE 4HIDA 4X65L 4DV3L 4HIOA 4JI3Q 4LF4Q 3NENA 1G6PA 4JV5L 4LUVA 4X62L 4A3KH 2OCEA 1KL9A 1WI5A 3KDFA 1PH3A 1D8LA 4DV7Q 2K5NA 3I56A 5IP7H 1JE5A 1MIUA 2UXCL 1Y1VH 3KJOA 1Q1BA 1SN8A 1YIJA 1VQMA 4X64L 1WCMG 1XNRL 4OONA 4A3MG 1WJJA 1LUZA 4IPCA 3CCLA 4JI0L 2YTYA 3UDGA 3S2DH 2UXDQ 1UE6A 4X65Q 2OTJA 1B8AA 4JBWA 3EBEA 4X62Q 1K8AC 3RZDH 3J80c 4LF8L 3A5ZB 4DV0L 4BY7G 1PH5A 4QJFA 2ATWA 5C0XG 2QGQA 5IP9G 2UXCQ 4BBSG 1FVIA 1XNRQ 4JI0Q 4NB3A 1I50H 4A3FH 1AH9A 3CCVA 4DUYL 4JI1Q 4JBMA 3HOWH 1XTDA 2MO0A 4DR6Q 2KCMA 5FJ8G 1AE2A 3D31A 3A74A 2MNAA 1AE3A 3RR5A 4DV4L 3GTGH 3S14H 4B3SQ 4K0KQ 3J80i 4EX5A 4DV5L 5H1SE 1KIXA 2JEAI 5GROA 4IO9A 3HKZE 2AMCB 4JI2L 2A8VA 2HHHQ 4JOIC 1RL2A 1VQ5A 2L15A 1K9MC 5FJ8H 4R1JA 3ULJA 4DUYQ 1VQ7A 3ER0A 2CFMA 1YJWA 1Y14B 4DR1Q 4DV4Q 2OWOA 4BY1H 3DLLA 2IT1A 3M7NA 4JBKA 4DV5Q 2NVXH 1EFWA 2PQAB 1IZ6A 1XMQL 2D62A 1KRTA 4JI2Q 4P72A 2VQEL 4LF5L 1LM0A 1SRUA 3K7UC 3BZCA 3PIOA 2K50A 4UP8A 3KF8B 4A3DG 2ES2A 3CC7A 1W2BA 2Q2IA 3PGZA 2E2JH 4POGA 1KHIA 5BR8Q 3M3YH 1PA6A 1Q8KA 2KCTA 1E1OA 2VZAA 3GO5A 3I7FA 4DNIA 3S1QH 3GTMH 5IYDH 4JOIA 4DPGA 1XMQQ 1EIFA 3GD7A 4H02A 2VQEQ 3PF5A 3I4MG 3L0OA 5FLMG 1GD7A 3TQYA 4UPAA 2BH2A 4DK6C 3M85A 5LMNL 2YU9H 4GLXA 5IWAL 4R4CA 2AKWB 1OTCA 2BA1A 1X55A 2KBNA 2XTIA 5M3FG 4L5SA 2K5VA 1XMOL 5IYCG 2UUAQ 1MJEA 1VQ8A 2NVTH 1IBKL 3CP0A 3TEHB 4JG2A 2H5XA 3ZJYC 3A0JA 4BBSH 2EIFA 1Z47A 3AYHB 3CCQA 3HOVG 2IHEA 2AWNA 5LMNQ 1M1KC 3F2DA 1IYJB 2K52A 3PO3H 5C4XH 4DR4L 2LXKA 1XMOQ 1PH7A 1PYBA 1VQJA 2UUBQ 3CCUA 2EXDA 5K36G 1NY4A 1H95A 2JA5H 1M90C 1SLJA 1WFQA 2VQFL 1IBKQ 1Q46A 4A3GH 4BBRG 4AQYL 4FDBA 2UU9Q 3OTOL 3HOVH 1VQIA 3KF6A 3KLWA 5DLQE 4LF9Q 2JA7G 4AYBG 5C3EG 2B63G 2MQHA 3I4NH 4P75A 1XPOA 2E5LQ 3GTPH 1Q86C 3S1MH 3GTJH 3M4QA 3J7ZC 1OXUA 4DR4Q 1HJPA 1EUJA 1SE8A 4BBRH 2R92H 1CKMA 1UWVA 2VQFQ 2RF4A 1A62A 1HZCA 3H3VH 5JJIA 3AFQA 1CSPA 1U5KA 3OTOQ 2VY3A
chains in the Genus database with same CATH superfamily
4ALPA 2HIVA 3EIVA 1GUWA 1X3PA 3S16B 5D65A 1NR2A 1EQTA 3D4WA 1B3QA 3GTLB 2CWAA 4QMGA 4L8JA 1E7ZA 1YBYA 3DUZA 3J80L 5I6WA 1HUNA 1JWMD 1E22A 5IT9c 4A3JB 4Y7NB 2JK8A 3DWQA 5M5WH 1QNKA 2JA6B 1JICA 4TQUS 2Q2HA 2K4KA 3HP3A 4RCOA 4CDDC 4P71A 2RCNA 1PRTF 1I6HB 1PH8A 2JA7B 5CGKA 4HR7B 4KTAA 4AYBB 3HFZB 1STGA 4A3MH 3S2HB 3R2TA 2ALYB 2NN6G 4DA2A 1BO0A 2NTSA 2B2UC 1K0SA 1VQDA 3JAME 1N34Q 2R93B 1ZKOA 2H4OA 2E2HB 5CR3A 4A3IG 2GA4B 2JE6I 1STEA 4C3IB 2B3GA 1KC8C 2F0FA 4K8IA 2Q8TA 2C35B 2WIIB 1X3GA 1UE1A 3DXJC 1A0IA 3VR2A 3DM1A 2A68D 2WFWA 1PH9A 4APVA 2PNRC 3PIO3 5HGQA 2B2UA 1HUMA 3CW2C 3MFYA 2O4XA 1PRTD 3OYYA 1DONA 1GXDC 3S17B 3ERQA 3FKIH 2BE5C 4OELB 1GVPA 1LTSD 2OQKA 2NVYH 1C48A 1EEID 4GLAC 3HOXH 3K5OA 3HKSA 1TWGB 1GUOA 1X3EA 5E4XA 2AQ1B 1E24A 4KKUA 2PZTA 1VF5C 1YNXA 1D7QA 4R9WA 2FXQA 2N49A 1VDZA 4XQQA 1U4RA 5KNDA 5GAHC 1SSOA 5G3LF 1U0LA 1RODA 1K3BC 4QIWB 3S9WA 4A3JG 2UU9L 3I4LA 4LF9L 1WVLA 1B7YB 1UE7A 2WAQG 2JA6G 1XYIA 2E5LL 3KFUA 3DEOA 2K5WA 1S5ED 1WD0A 4A93G 1HR0Q 4IFDI 1LT3D 1D1KA 1SR3A 1TVXA 3SK4A 3NBHA 1IBLQ 3NTHA 3PO2H 2Z6KC 1GOZA 4CKBA 4LF7Q 1B70B 3HRZC 3PUXA 3T13A 3PV0A 2R93G 2EYMA 5IT9L 2IWHA 4LF6Q 1G51A 2RKSA 4C3IG 5DAUA 3WDNA 4V0BA 2Z9HA 5C4ZA 1OXXK 3TDQA 4GNXB 2JEBI 5CYUA 3BZDB 5FLXc 1CA5A 4GN3B 3BYTB 1XPUA 3GTMB 3VYUA 2Z6KA 5C0XI 1HA6A 3SDZA 3NHHA 3PF4A 4E6IA 1WTPA 3TRZA 4IJHA 3CC4A 2LXJA 2HD3A 3A54A 4KY5A 4IFDG 2NZ1D 4BS9A 3BYYB 1T9HA 3K0XA 3UDIA 1EOVA 1MJCA 3Q0AA 2K03A 1YNNC 3CAMA 3AEVA 2G5DA 1ASZA 3JC66 4NW2A 3RLFA 4ZLTF 3S1NH 1BCPB 2LY7A 1QWYA 2CKZB 4O42A 1VQFA 3F8TA 3CQZB 5KRUA 1KXLA 3RZOH 4JI4Q 1HNWL 2NYZD 2OF1A 3M7GA 3RN2A 2EYFA 3LWUA 1ESRA 2UUCQ 3GTPB 4GKJQ 1TY2A 1O7YA 2KUMA 2H1EA 3TREA 3P75A 2NN6H 5C0XJ 4FF4A 4R8NA 2K1BA 2NZHA 5A2QL 2JJQA 3K81C 3J7AF 4YCVA 4TRDA 5IODA 2RQXA 3I3CA 4X64Q 2WB1E 4A3IH 2WP8J 1FNUA 1I4RA 2KEDA 2KHJA 3Q23A 4GN4B 4DV1Q 1QILA 3QO2A 3SK8A 1C0AA 1S5BD 1PFBA 1QVGA 1IBML 2A6HC 4LF8Q 1R9TB 2VS1A 4DV0Q 2JA9A 1MHWC 2EZVA 2OEOA 2PI2A 2I46A 4M1UB 1HZBA 3U9OA 1O7LA 4KN4C 1EYCA 1C7YA 1IKLA 4ME3A 2XN9C 4FO2A 4P2CB 1VQCA 1U4LA 4K5WA 3OHXC 3EFXD 3CKIB 1E2ZA 1BUVT 2ENBA 3H94A 3CD6A 1X6OA 1WTWA 2IPKD 5FOBB 1F2YA 4H13C 5HY6A 1VQLA 4GN5A 1BBUA 3GTLH 3T4AC 3PSIA 3FHWA 3CCRA 4RG1A 2GVAA 2KQ3A 1HNZQ 2ASBA 1MBYA 4EQ5A 2ZJRA 2ZM6L 3M9BA 3RLOA 1X9NA 3HOWB 1BXTA 3AQQA 1K73C 4KI0A 2JA6H 4IQZA 4LF6L 3P20A 1SFOH 4A93H 3VR5A 1N8RC 5FLXL 4JK1C 4RCNA 4PG3A 2OXPA 4DAMA 2G9DA 1I6HH 1KRSA 3D8GA 3DHQA 4A3CG 2FJ2A 1SYDA 2E2IB 1V1PB 4PMCA 3MXNB 2NVXB 4MNOA 3J80E 2PQAA 5C4HA 2J4XA 4ABNA 4HCSA 2LSSA 3STBD 3R8BA 2E2JB 4KY6A 4QY7A 5NUCA 2XRSD 5FO7B 2DN8A 4C3IH 1KTKA 2IY5B 1SAPA 2ZTCA 1VQPA 3TS0A 2A1AA 3NELA 2UXBQ 2AHOB 2BCOA 1QNUA 2Q2TA 2RBMA 4XIGS 1I4QA 4GKKQ 3AMUA 1PXUA 3QOLA 4DK1A 4DV7L 3C46A 1FNVA 4TVAB 1BCPF 4XYQA 1TWFH 4BY7B 4BBSB 2BA0A 1JOOA 1BBWA 1F9PA 3C1FA 5JEAG 5M3FB 1HQMC 4IFDH 3Q8DA 1ICFB 3FP9A 3PO3B 2E76C 4HIOA 1CFMA 4LUVA 2B2VC 4OL7A 2NWGA 1WI5A 1PH3A 1D8LA 3OMCA 2MHVA 3I56A 4A3GB 1JE5A 4IUPA 4DU9A 1H9RA 3KJOA 4X64L 4OONA 3AB9A 2O2LD 3I4NB 1L0XB 1LUZA 4JI0L 3S1MB 2UXDQ 2KCCA 3K7AB 4IUUA 3EBEA 4LF8L 4DV0L 4RH6A 2B2YC 2B63B 4QJFA 2UXCQ 1TWHB 2QGQA 3QIAA 4CDFC 2N88A 2HUGA 1HFNA 4NB3A 1I50H 3CCVA 2SNMA 4DUYL 5JVG3 1CHPD 1BCPD 4DR6Q 2TSSA 3D31A 2HCIA 2HQEA 4CJ2C 4K0KQ 2JEAI 3EVQA 4IO9A 3H3VC 4JI2L 2A8VA 1RL2A 4RFBA 2AUJD 2L15A 1K9MC 2RSNA 2BOSA 3A7LA 5FO8B 1RTNA 3F2UA 1KLUD 2B2YA 4HEDA 3TBIB 5KNCA 4DV4Q 5M5WB 2WB1B 3DLLA 1SE4A 2IT1A 4JBKA 3M7NA 1SMYD 4DV5Q 4IURA 1KRTA 2VQEL 1LM0A 3K7UC 3FRPB 2K50A 4UP8A 3CC7A 4KD3A 2Q2IA 2P5ZX 5ELDA 4L6TB 3SVMA 1ZXTA 3M3YH 1RKNA 4XDXA 1UAPA 2VZAA 3D4RA 4DAVA 4DNIA 3GTMH 4A3MB 2KOLA 3FMCA 3TSSA 1MI2A 1R4QB 3I4MG 3L0OA 5FLMG 2KVMA 1GD7A 4BY7G 3T16A 2BH2A 4BBSG 3S1RB 1OTCA 2MJ8A 3SEBA 5M3FG 4HSPA 2XTIA 3PIP3 5IT9E 1XMOL 5IYCG 3HEJA 5FKAC 1IBKL 1Z6HA 3TEHB 4JG2A 2H5XA 3ZJYC 3KBXA 3AYHB 1JOQA 4K5XA 1JR0D 1EY7A 1NY4A 5K36G 1X3QA 1H95A 4C56C 1Q46A 4IZ8A 5IGFA 3NWSA 1MSGA 2XVSA 4FDBA 2WACA 1VQIA 2B63G 3FKIB 1DOLA 2FFKB 3SXHA 5KNBA 4P75A 1XPOA 3GTPH 3BDCA 1Q86C 4L63B 3GTJH 3M4QA 3N6RA 2NVYB 2CHBD 3Q24A 5M5YB 1KNEA 2F0HA 3A55A 1GHJA 2RDGA 5DEHA 3HOXB 2VQFQ 1A62A 3MA2B 4CJ0B 4FNFA 1CK1A 3OTOQ 2SNSA 3P7JA 1BDOA 1ZYRC 1SBBB 2WAQE 2B2WC 3LGJA 4CDCC 4DAPA 1A15A 1EQQA 3H15A 1L0WA 4C1NI 2E75C 2C5CA 3K80C 4QGUA 2K6AA 4P73A 4J6HA 1Q3LA 3K5NA 2UXDL 1MKHA 5A2QE 4JC0A 4A4IA 4NDXA 5T1GA 4X66L 3RN5A 3PQIA 4GNXC 4LFBL 2X69A 4K2LA 2B2WA 3PO2B 4R8IA 5C3XA 3C3LA 1VQNA 4DR6L 4OWWB 3L7ZC 4XQJA 1K28A 4JPBW 4K0KL 1PRTB 1IW7C 1V1OA 1X54A 3I4OA 2N78A 4IUNA 1VQ6A 5IGDA 2JQOA 3GTKH 1NE3A 4DKAC 4GNXA 2HQLA 1PVOA 3T53B 1H9SB 1Z7TA 2K5DA 4HJAA 1NBWA 4HTHA 5E7NA 5M5XH 1SYGA 1QVFA 3FKIG 1S5CD 2E2IH 3T51B 5I4DA 4A76A 3NEMA 4YIJA 4Q0FA 4B3RQ 2K14A 1NJIC 1HNXQ 4B3TL 4NKLA 3HOXG 2N55A 4QIWE 1LTTD 1D5ZC 1TS5A 2K32A 3RZOB 1B9NA 2XRQD 3V05A 5FLXE 4CKCA 3WWVA 2JXMB 1RIPA 2F0IA 3OOCA 1ESFA 3BS1A 2EY5A 1J5EL 5LHY1 5E3FA 2K04A 3DMUA 1X65A 4LFAQ 1X56A 3I4MH 2RA4A 5FLMH 1F2ZA 1LTRD 4BY7H 3I73A 3K5LA 2PMZB 4V190 3ICEA 1L0YB 5M3FH 2R7ZG 2EE1A 5IYCH 4A3BH 1CT1D 3OWEB 1JJ2A 4A3IB 4YY3L 2EQSA 1TR5A 5EPKA 1QJOA 3I55A 5ELCA 3PO2G 4WORA 4YWMA 4J1MA 3ND9A 5IE8A 2F0NA 1YJNA 3IL8A 5KYIA 2CQAA 2I07B 3HOYH 1B1ZA 3PIPA 2DUDA 3K59A 1GO3E 4IOCA 2F0SA 3K7AH 2NTTA 1SJHD 3I90A 4OXPA 4JW0A 4JI6Q 3ERSX 2B63H 1GM5A 1S40A 4KHVA 4PZ6A 4U68A 5EPLA 4NXNQ 2B2TC 4YWKA 5EGTA 4JI7L 5CV8A 5C44G 1TS2A 1KAAA 4NXML 1A2TA 1SNPA 2EOTA 3W5OA 1KD1C 4DR5L 4MZ9A 1I3QH 1A3UA 3BU2A 3EJIA 4OIKA 3M4PA 4RGMA 2FMMA 2YU9B 3UDXA 1T5XD 2WAQB 2HCCA 2SDFA 5KIXA 4WJ4A 5I2XA 1SFOB 4A93B 1L1OB 2B2TA 5I2YA 2NVTB 1TWCH 3J7AV 4OX9Q 4DV2Q 1STYA 4LMQD 3TZDA 1N36Q 5IP7G 1SYFA 1TXYA 3D4DA 3T1HQ 1VQ4A 4MIUA 4RHRA 3CCJA 1PH6A 4KMUC 1EIGA 1V1PA 1D1IA 3H91A 3MXNA 4G7HC 1JMCA 3D6CA 1TT2A 3NTIA 4HMIA 2N8NA 3S1RH 1PFSA 1LYLA 4KJNA 1JB3A 1JJGA 4YCWA 1HPCA 4JV5Q 1HNWQ 4B3RL 1HNXL 2NVQH 4IUTA 4JCVE 1VQHA 1DOMA 3F1ZA 3J81L 2FHTA 4RKLA 1XTCD 5D3IB 2IX3A 1P16A 1W3SA 3BDOA 4GS3A 1QCBD 2F0GA 2BH8A 1G291 1HZ9A 3E0EA 3I2ZA 1QG7A 1QUQB 4H44C 5HURA 1O78A 1TWFB 4BY1G 3DWPA 1PZJD 1JB7A 1HH2P 1LV9A 1S3OA 3RUZA 5GAGC 4LFAL 2E8GA 1EU4A 5M5YH 3MFGA 1SNCA 1B9MA 4LNQA 1EZ6A 1IBMQ 4PMWA 1G91A 2KCNA 5CV7A 3H3VI 4DN4M 4CGYB 2Y0SG 4PMBA 2RDFA 1PTOB 3A5UA 3S15H 2JA8H 3J81i 3F2BA 4ULLA 5CV4A 1QOHA 1VQKA 4KN7C 2EJGC 1RJTA 1A2UA 3VYRA 4LF5Q 1I50B 1FGBD 2OQ0A 4L5RC 2A19A 2QCPX 2CQOA 2KENA 3NBIA 3A56A 3CXCA 1DGSA 4JI6L 1RD9D 2EYJA 2R7ZH 3G71A 1ENFA 1CUKA 4FXDA 2QA4A 2QKIC 4NXNL 2J0TD 2MFIA 2ZM6Q 4K6DA 4LFCL 2DJFC 2B29A 2K01A 1BKBA 3DWAA 3KYHC 4KHPL 1PFNA 1F9RA 2K7VA 4LJZC 5EJWA 1N33L 3KDFB 3P1HA 2Z4IA 2N3SA 3R93A 5ELFA 1YJ9A 3M3YB 2A69C 1CKNB 1JE4A 4BA1I 4RA8A 5A35A 2C9OA 2B39A 3TP5A 2CH4A 4OX9L 4DV2L 3K8AA 1N36L 1X3FA 3VA5A 5CBEE 1ILPA 5C44H 1DCZA 3T1HL 5C4JB 2MO1A 4LUZA 5ELOA 4DNRB 1AFPA 4JI3L 1Q90A 1HRJA 3NQIA 2IJ0A 1QB5D 1FNWA 3VDYA 3S24A 4KKSA 3CPWA 3OIQA 3V2TA 1GHKA 2R7DA 1OXVA 2MGSA 1G6PA 1ZEQX 4JV5L 4C3HG 5M9OA 2A74C 1PYWD 1KL9A 4DV7Q 2K5NA 2DY8A 5IP7H 3QB3A 2EY6A 1Q1BA 1SN8A 4K6LA 1VQMA 3A8KE 2NUCA 1U4PA 1XNRL 3ZYYX 4IPCA 4FP5D 3GTJB 3S2DH 2EVBA 4JBWA 1K8AC 2R3ZA 5EBDA 1PH5A 5C3EB 3K0YA 1SNMA 5F2DA 3VYSA 5C0XG 5IP9G 2A5HA 2PO4A 5HGTA 4JI0Q 1SNQA 1XTDA 2A68C 1KNAA 2MO0A 1AE2A 3A74A 2MNAA 5IGBA 1PZID 3M4YA 2VB3X 3KBGA 3LWEA 2VUMB 1PRTC 2AMCB 2HHHQ 1VQ5A 4B9WA 3MAQA 3MTSA 3NUCA 5FJ8H 1D5XC 1AN8A 4R1JA 3ULJA 4DUYQ 2AQ2B 2CFMA 1GUTA 1Y14B 1YJWA 1TIID 4DR1Q 4BY1H 1EYAA 5BN3A 1I6VC 2EDGA 4JI2Q 4LF5L 1PTOF 1SRUA 3PIOA 3KF8B 1W2BA 1TS3A 1E2VA 3HKZB 1H9JA 1Q8KA 2CW0D 2KCTA 1E1OA 1TU2B 2IL8A 1EWCA 1CTMA 4DPGA 1F9SA 2VQEQ 3PF5A 1U9RA 3I70A 3TQYA 4UPAA 3GTKB 2F0MA 2L11A 4GLXA 4ZRZA 2YU9H 3I72A 2IW3A 4DK0A 2F0QA 1ML0D 1HXYD 1PZKD 3QR8A 2BDOA 2NVTH 2JP1A 2EYLA 3IAYA 5M5XB 3G6JB 5CC4A 2EIFA 3CCQA 1XMOQ 1PH7A 1VQJA 1JCKB 1BQQT 1PTOD 1M90C 1IBKQ 3T56B 1VMCA 1U4MA 3OIPA 5DLQE 4NMZA 1LTGD 5C3EG 1EZ8A 2F3VA 3MC0B 1HCZA 5E1FA 3J7ZC 5C5LA 2LFNA 1SNOA 1EUJA 4BBRH 1CKMA 5JJZA 3H3VH 2F0OA 4ODGA 1CSPA 4KK7A 2VUMG 4DR2L 1QVCA 3MXUA 3W1GA 1JWSD 3GTQH 2L55A 1EIYB 3MXGA 3HS0C 4POFA 1NAPA 2K75A 3I4MB 3VR3A 3NK9A 1C9OA 1L2FA 2PCFB 3VYTA 5AFWA 1CQFA 4A3BB 1LO5D 2WKCA 4RAUC 5GAEC 1WD1A 4FF3A 4RWSC 1EEFD 3ND8A 1SNDA 4ZUJA 2R7FA 4ZK9B 3PCOB 4FVMA 1T5EA 4PV1C 3HKZG 4HJ8A 4JI5L 3VR6A 3HOYB 4I7AA 3CCMA 4OWTB 3RD4A 4MN3A 5JEAJ 1EU3A 4C3HH 1K8GA 2A73B 3G4SA 1SE3A 1PTOH 2PW5A 4LWCA 3TN2A 4X66Q 3BVGA 3KK7A 4OO1I 5BN4A 2HHHL 3CHBD 4LFBQ 1I4XA 3BVMA 1LACA 2F4IA 4MTKA 2PZUA 4DR1L 1RCVD 1MSHA 5C0XH 3FVQA 5IP9H 1OO9B 1VQEA 3BVZA 5CMDA 3AU7A 1XX8A 2FINB 2K5QA 4CDEC 3BG3A 1XNQQ 1FL0A 3F2CA 1I3QB 4EGVA 5I9PA 2WKDA 1E3PA 2O5IC 1VS0A 1WTHA 4PZ8A 1EOTA 3GV3A 4IPGA 4XYOA 3D0FA 2EYPA 4JYAQ 4UDUC 1TWCB 3WOEA 2X6LA 3NXWA 2F3WA 1EY8A 2MP1A 3NP8A 4CJ1B 1O7IA 1DOKA 2PMZE 2K28A 3TP6A 4ILWA 3JAML 3D3RA 5EBCA 4B3TQ 4OO1G 1EIHA 1A3TA 2AWOA 4IOAA 2X6GA 4YWLA 5C4JH 1B4OA 3EN2A 1DYQA 5LMNW 1I4PA 1VMPA 3H0GG 1B53A 4A3BG 3CCSA 1IYVA 1JOKA 4C3JH 3CCEA 5C6AA 4DUZL 2CCZA 4B3ML 2NVQB 1BNZA 5JOBA 1QZGA 1J8IA 3J7A5 1UNSA 2G9HD 3KUPA 4XTCS 4AIMA 3HOYG 1J5EQ 2ZJPA 1LTLA 5EPJA 2RCFA 1QUQA 2NZOA 2BDNA 2XNAC 1C8CA 3RMHA 1K83H 1ICWA 1B2TA 3JAMi 1DXMA 4KHZA 3EQLC 3HOZH 4NP5A 5EKIA 4YY3Q 1Y8PB 2GN5A 2Q8RE 2Y0SE 1Q12A 5GQOA 5C3EH 1XXGA 2OTLA 1DM0B 1A3VA 2QW7A 3D6WA 4RKBA 1V8QA 4I65A 3HG9A 1KDAA 4ZQ3A 3S15B 2JA8B 4O2DA 1V43A 2VUMH 1S72A 1YNJC 2DNCA 1BVSA 4JI8Q 3E9HA 1STNA 3QG1A 4GOPB 3ULLA 2E74C 3SE0A 4HAEA 1WTRA 4JI7Q 2TMPA 1Q81C 2EY1A 2K33A 2ZTEA 4HMJA 2R7ZB 4NXMQ 2RHQB 1ET9A 1GUGA 2M9VA 3RLNA 1II3A 1SYCA 4DR5Q 2PZWA 4O1NA 1K8MA 3RNUA 1ET6A 4XT3B 4R4QA 1LTBD 5LMUL 3T1YQ 1K8OA 3PUWA 4U673 1BBXC 4FF1A 1W6JA 2NBFA 4R4OA 5DM73 5IGCA 1XNQL 1CSQA 1SYBA 2F52A 2F1MA 4DR3L 2F0WA 4DR7Q 1KAWA 2Z0SA 1R4PB 4GLVB 1ASYA 4K14A 1BCPC 4TKOB 3HZXA 4DV3Q 1CKNA 3Q6SA 4A3FG 4JYAL 4UP7A 4RGNA 2IHFA 2PNHA 1SE2A 3FPPA 4IUVA 2F3IA 4ZCKA 5C44B 3HOUH 1Q1EA 2EY2A 2IX0A 1GKHA 1EY0A 5JVH3 1RHPA 3W2DA 1TS4A 3U4VA 1I5FA 5CV6A 2E2DC 1IL2A 4BA2I 1IXRA 1SMYC 3C1EA 5J1ZA 3J81j 1ILQA 2EYOA 5JAVA 2CVRA 4N9TA 3U4ZA 3GTOH 4WFN3 4A3EB 5JPMC 4OGQC 1RDPD 4R4TA 3W1BA 4DV6L 1XPRA 3J81c 3FEWX 4ZKCB 4H0LC 3VA7A 2JA8G 1AP0A 5I9OA 4Q5VA 2DY7A 5IYDG 3E3XA 4MHEA 3SK5A 1UE5A 3S2DB 1HR0W 2BE5D 5DM63 4OO1H 4Z9CB 2F4VL 1E0BA 5CORA 3K6OA 3H0GH 2ICIA 1EFID 4XXEA 1NMGA 4UAIA 5KGUA 1AZPA 2Z6BA 4EQNA 1RTOA 1HTPA 3UE0A 2V4DA 1VQOA 4ID6A 4OWXB 2L0CA 4DAYB 4C2MB 4UP9A 1NUCA 4J15A 5IWAQ 3AFPA 4BY1B 5JJLA 4QCLA 2EXZA 4JI8L 1WYDA 1EYDA 3PUZA 5AJ3L 1JJCB 2R92G 3H6MA 4HJ7A 3MVVA 2ZXRA 3KF8A 4LFCQ 1Q7YC 1N32L 1AW7A 4KHPQ 1EY6A 4ZYSA 3K5MA 1PH4A 1N33Q 2Y0SB 4A3DB 1V9PA 4XQNA 3EA6A 4AQYQ 2ID0A 2NN6I 1S5FD 4IALA 3T1YL 4B9XA 1LT6D 3L2PA 3U58A 2HT1A 2LKVA 4A3EG 1LTAD 4LF4L 3DM3A 3MZ5A 5CV5A 5GADC 4BXXG 2LS01 2A69D 1GJXA 3E9IA 3FDTA 4F8MA 2PPBC 4DR7L 4HJ9A 4QUFA 4X65L 4DV3L 4JI3Q 3IFTA 4X62L 3K58A 4A3KH 1DZ1A 2EJMA 1FYCA 1LLRD 4F88A 1Y1VH 4X3KA 1YIJA 1YNND 4IN3A 1B50A 1WCMG 2EJFC 1C4QA 3CCLA 3QOJA 2YTYA 3UDGA 4FYDA 1UE6A 2OTJA 4BBRB 3RZDH 4H7BA 3A5ZB 1S4ZA 2K05A 1TKWB 2HDMA 1XNRQ 1LT4D 3G7LA 4A3FH 3GTQB 4JI1Q 1ENCA 4JBMA 2KCMA 5FJ8G 1AE3A 3RR5A 4B3SQ 3J80i 4EX5A 5H1SE 1WTXA 1ONLA 5GROA 3MWYW 3HKZE 4JOIC 4QB4A 3SHLA 2KHSA 3LNNA 2M00A 1G2SA 3E0JA 1NSNS 4OIJA 3BDLA 1D5MC 1IZ6A 3H09A 1XMQL 2A6HD 4P72A 2ZXPA 4C3HB 4A3DG 2ES2A 3PGZA 1KDBA 5TSSA 4POGA 4DGZA 1KHIA 1H9KA 5BR8Q 2EYHA 3S1QH 3GO5A 3I7FA 5IYDH 4JOIA 2FMCA 4HCEA 1QE6A 1EIFA 1Y1WB 2B8GA 1NR4A 5I6YA 1HA5A 1SJED 4DK6C 5LMNL 5IWAL 4R4CA 4L5SA 2BA1A 1VF7A 1W6KA 2KBNA 1CZGA 2UUAQ 1S5DD 1MJEA 2HDLA 1VQ8A 5D3DA 3CP0A 4ZAIA 1CHQD 2A6EC 3NPPA 2IHEA 1JQYD 3F2DA 5EKKA 4DR4L 1PYBA 4B08A 2UUBQ 4DF7A 2EXDA 4EQPA 1CA6A 4TSSA 1SLJA 4ME5A 5LL6S 4BBRG 2WV6D 4AQYL 3HOVH 2R61A 3KLWA 2JA7G 4AYBG 2MQHA 4S3SA 5IIFA 4PNYA 1HJPA 1SE8A 1HQRD 5IGEA 4FF2A 2R92H 1UWVA 2J7ZA 5JJIA 1HZCA 1HFGA 1U5KA 5M3MB 2DGYA 4KY7A 1H9MA 1NNXA 1AEXA 1OXTA 4N9PA 4R4IA 4IJLA 5G3LD 4C3JB 3MXPA 4CBVA 2YTXA 3ITPA 2RDHA 4HIKA 5IYBG 4A3EH 4HIMA 4DR2Q 1STBA 1A8VA 4BXXH 1O80A 1FJGQ 5E4WC 3X3NA 5IY0A 3WOFA 2D2CC 4IFDJ 3K57A 3PUVA 4RGTA 4A3LG 2F0JA 2F0EA 1A6XA 1VQAA 3OW7A 2VW9A 1X32A 4KD4A 1K83B 1LABA 3MEHA 4A75A 4G57A 1Y1WG 2NB0A 3E5SA 3GV6A 4JI1L 3HOZB 1N34L 3GQBA 1B3AA 1K3RA 4GOPC 1JORA 1YVCA 2QF7A 4B3SL 1CZWA 3BJUA 2D9UA 1WCMH 4JI5Q 2I0QA 4K8JA 4DXFA 1MD2D 5ELBA 5ISRA 3M4OB 2KHIA 1YHAA 2MUYA 3MHBA 1O7ZA 4HN7A 1SROA 5C3WA 4G7ZC 4P74A 5EQ0A 3C2PA 5C5MA 1STHA 3IFDA 1FGUA 4C2MH 4YHHQ 1Y8OB 1TWAH 5IGGA 1D6EC 4GOPA 2RVLA 4AH6A 2QILA 5BR8L 1P8LA 1I94Q 1MGSA 1CI3M 2ZT9C 3TP8A 5K5PA 2F0VA 2PW7A 4ZUIA 3KJPA 1YHBA 1PYSB 3UI2A 2R6GA 2D0PA 3KF6B 1V1QA 1GUSA 2I5MX 1IL8A 3QWNA 2IX1A 3L9AX 1VQ9A 5M3MG 1EQRA 4J8QA 1OXSC 2UUAL 2YV5A 1VQBA 1UEAB 3CMAA 4C3JG 4A3DH 2D5DA 4DFAA 1TY0A 3TP7A 1NMFA 2SOBA 4KJOA 1HR0L 4IPDA 1F2MA 2UUBL 3S16H 4K2KA 5IOCA 1SXTA 1H9SA 1PH2A 2F0DA 2I5HA 3CC2A 2CH4W 2F0TA 4DNTB 3HOUB 4OEMB 2D0OA 1HTLD 3JAMc 1IBLL 1Z9FA 3U9SA 1PH1A 2L12A 4LF7L 4KKTA 3HOZG 3CU7A 4A3JH 4Y7NH 4DUZQ 2YYZA 3S14B 3GTGB 4B3MQ 2ZJQA 4EVOA 3GTOB 3MEFA 1EY4A 4HSVA 3R3OA 4N8FA 1DD2A 2ZXOA 2JA7H 3OSOA 2V1CC 4G7OC 1HZAA 3S2HH 1EWIA 2F0PA 1Q8IA 4IUQA 1WTOA 1FJGL 2LMCB 5JPNC 2QEJC 2R93H 5CBAE 2E2HH 3GP7A 4X3SA 1SMXA 2F0KA 2PI2E 1NTGA 4L5QA 4QL5A 4PZ7A 3H0GB 3R2IA 2MPMA 3TS2A 3SR1A 4UY8C 1SDFA 1ZYRD 1EYGA 3Q22A 1VCIA 2KEEA 5J3BA 3J81E 2WINB 5IYBH 4JI4L 5D14A 2JYOA 2XWJB 4X6AH 1STAA 2QDLA 3KLSA 1EQVA 1DJRD 2F0LA 4DAYA 4RHSA 1M4VA 1YNJD 3URYA 4A3LH 3S17H 2UUCL 4GKJL 5J22A 5C4XB 3A8JE 2Q8IB 1Y1WH 1B44D 2JA5B 2QEXA 4YHHL 1I4GA 1TWGH 4L5TA 1JT8A 1L1OC 3VR4A 5FO9B 1I94L 3HOUG 5LMUQ 1XWEA 3I91A 2YTVA 4DV1L 2RHSB 2JN4A 1IW7D 3HOWG 1FD7D 4QQBX 3LX0A 1N9WA 1EL0A 4DR3Q 2K5HA 2ZTDA 2AUKA 2I5LX 1E2WA 2B2VA 3U50C 1BF4A 1WOCA 1KLGD 1UEBA 3O13A 3G6EA 1GUNA 1L1OA 4DK3C 1UUPA 1A63A 1CKOA 4RMFA 3L3OC 3TMEA 3I8ZA 3NBHB 2L5TA 1K0RA 3A7AB 1YHQA 4WJ3M 4G4KA 3FPUB 3OW2A 3CPFA 1KQSA 1FR3A 5JJKA 3ONAB 2CW0C 1IYUA 1HHVA 4A3KB 1PV4A 2RSOA 4EQOA 1VQGA 1M8AA 3CMEA 1YI2A 4MTNA 1J9OA 4X3UA 1J6QA 5M3MH 1Y1VB 3GDEA 5CV9A 3UE1A 2XSCA 3SK6A 1HNZL 1BOSA 2F03A 1EY5A 4Y52H 3N52A 4JBJA 4ZKBB 2L9HA 4DV6Q 3OPOA 4QUCA 3BZKA 4GZYC 4O0AA 5KYLA 3RZDB 4RGOS 2XGTA 3PUYA 4FXKC 5L37A 2VNUD 1PFMA 4LW1A 3B6YA 2PYKA 1F9QA 3G48A 2CWPA 1YZ6A 4A3FB 1D2BA 2VB2X 3J7YW 3PMFA 2F4VQ 1PTOC 1QZHA 3NTKA 3PO3G 4WJWA 2EPBA 5C4XG 4KLKA 3SGIA 3STBC 1F2LA 2JA5G 3KOJA 4A3GG 1I4HA 5EAYA 1YEZA 3CF5A 4IPHA 3CQZH 5FK9C 2Q2UA 3I4NG 4YCUA 2XIWA 1E1TA 4LUOA 3M4OH 2UXBL 1RF2D 3KLSX 4A3CH 1KDCA 4C1NK 4GKKL 3S1QB 5ELNA 2HIXA 1PHJA 1Q82C 4NPSA 5AJ3Q 1PDQA 4FXGC 3ULPA 2VL6A 1WTVA 3X3MA 3NWTA 1TQOA 1N32Q 2F0UA 2GVBA 4X3TA 2QDBA 4DXGA 4A3KG 1YITA 2L1BA 1R9TH 4HJ5A 3IRBA 2WB1G 1WTQA 3UDFA 1Y1VG 1Y69U 4AYBE 4HIDA 4LF4Q 3NENA 2AQ3B 1CM9A 2L4NA 4K5VA 2OCEA 3HGBA 3KDFA 5KEEA 1MIUA 5JEAH 2UXCL 3HOVB 4N8X1 5T1IA 4A3MG 1WJJA 4JVZA 4X65Q 1B8AA 5EKLA 4X62Q 2R92B 3J80c 2Z1CA 3DEPA 2DNEA 2ATWA 2Z8LA 1PLFA 2OT2A 4M8AA 1FVIA 5BN5A 1LTID 4F7XA 1AH9A 1JC7A 3KLRA 4CKEA 3QJYA 5DNFA 3HOWH 4LK1C 3OWFA 3S14H 3GTGH 4OHJA 2B8FA 4DV4L 2VXWA 4DV5L 1KIXA 1JWUD 1EWHA 1SEBD 3NQTA 1EY9A 2KA7A 2O5JC 1SYEA 1G8ZD 3ER0A 1VQ7A 2OWOA 1IHZA 2NVXH 1EFWA 2PQAB 1NCVA 2D62A 3CRLC 3BZCA 2XWBB 2E2JH 3S1NB 1G2TA 2ICEC 1PA6A 2DJGC 3NSWA 2PQEA 1LT5D 1WCMB 4PQXA 4QF4A 1XMQQ 1PMRA 3GD7A 4H02A 3E6ZX 2M2LA 4UHVA 3M85A 2JSOA 2AKWB 1X55A 2K5VA 5LL6X 1G6ZA 4KV6A 1IKMA 4I7ZC 5COYA 3IKJA 1CQVA 1F77A 3A0JA 4BBSH 1TWAB 3NE5B 1Z47A 4LAAA 3HOVG 4WRDA 2AWNA 5LMNQ 1M1KC 3PO3H 1IYJB 2K52A 3TZUA 5C4XH 2LXKA 4CHTB 5J39A 1KABA 3CCUA 2Z4HA 2JA5H 1Y8NB 2VQFL 1WFQA 3V96A 4A3GH 4F87A 3CRKC 2UU9Q 4BWGB 3OTOL 4LF9Q 3KF6A 5ELEA 2SEBD 3OMGA 4XT1B 3I4NH 2E5LQ 3S1MH 5K36H 1OXUA 2A6ED 4DR4Q 3A8IE 2KECA 3EROA 1BR9A 2RF4A 2KJXA 3AFQA 1AZQA 3W3AA 1TWHH 1XJVA 1ENAA 2VY3A
chains in the Genus database with same CATH topology
2VUMG 4ALPA 2HIVA 4DR2L 3EIVA 1QVCA 1OXTA 2WAQE 4R4IA 4IJLA 3W1GA 3GTQH 3LGJA 1EIYB 4POFA 2K75A 1EQQA 3H15A 2YTXA 1L0WA 2CWAA 3K80C 4QGUA 1C9OA 1L2FA 4HIKA 4P73A 5IYBG 4A3EH 4HIMA 1E7ZA 1YBYA 1A8VA 4DR2Q 1MKHA 2UXDL 4BXXH 5GAEC 1FJGQ 5IY0A 4IFDJ 4JC0A 4A4IA 1E22A 5IT9c 3PUVA 2R7FA 4A3LG 3PCOB 2JK8A 4X66L 3RN5A 5M5WH 1VQAA 3HKZG 4GNXC 4JI5L 4HJ8A 4TQUS 2VW9A 4LFBL 2Q2HA 3CCMA 2K4KA 4OWTB 5JEAJ 4A75A 1K8GA 4C3HH 1Y1WG 4P71A 4JI1L 3G4SA 2RCNA 1N34L 1VQNA 4DR6L 1K3RA 4OWWB 4GOPC 3L7ZC 4LWCA 1PH8A 1YVCA 4B3SL 4K0KL 4X66Q 3BJUA 1WCMH 4JI5Q 2I0QA 3HFZB 1X54A 4A3MH 3I4OA 4OO1I 2HHHL 2ALYB 4LFBQ 2NN6G 2N78A 1VQ6A 2KHIA 2JQOA 1VQDA 1YHAA 1N34Q 3GTKH 1NE3A 4DKAC 4DR1L 4GNXA 2HQLA 1SROA 5IP9H 1PVOA 1VQEA 4P74A 4A3IG 1KC8C 2JE6I 4HJAA 2B3GA 1NBWA 1FGUA 4C2MH 1XNQQ 5E7NA 4YHHQ 5M5XH 1FL0A 3F2CA 1TWAH 4GOPA 1QVFA 2C35B 4AH6A 1X3GA 1UE1A 5BR8L 1A0IA 1E3PA 1P8LA 3FKIG 1I94Q 1VS0A 2E2IH 4PZ8A 2WFWA 4A76A 1PH9A 3NEMA 4APVA 4IPGA 1YHBA 5HGQA 3KJPA 3D0FA 3CW2C 4JYAQ 1PYSB 4B3RQ 2K14A 2R6GA 1NJIC 1HNXQ 2D0PA 4B3TL 3KF6B 1V1QA 3OYYA 3HOXG 2I5MX 3FKIH 2IX1A 1VQ9A 4QIWE 5M3MG 1EQRA 1O7IA 1OXSC 2UUAL 1GVPA 2PMZE 2OQKA 2NVYH 2YV5A 1VQBA 3CMAA 4GLAC 3HOXH 4A3DH 3HKSA 3WWVA 1X3EA 4B3TQ 4OO1G 1NMFA 1RIPA 1E24A 2AWOA 4IOAA 2DGYA 4YWLA 5C4JH 1YNXA 3EN2A 1D7QA 5LMNW 2FXQA 2N49A 1J5EL 3H0GG 1HR0L 4IPDA 4A3BG 5GAHC 3CCSA 2UUBL 3S16H 1U0LA 4C3JH 1X65A 1TWHH 3CCEA 4LFAQ 1X56A 4DUZL 3I4MH 2CCZA 1PH2A 1XJVA 5FLMH 1Q82C 2I5HA 3CC2A 4A3JG 2UU9L 4B3ML 4BY7H 4LF9L 3ICEA 1B7YB 1QZGA 5M3FH 1UE7A 2R7ZG 2WAQG 2JA6G 2D0OA 2E5LL 1IBLL 3JAMc 5IYCH 4XTCS 4AIMA 3HOYG 3J7A5 3KFUA 1JJ2A 4A3BH 1Z9FA 1J5EQ 4A93G 1PH1A 4YY3L 2EQSA 2ZJPA 1HR0Q 4LF7L 1LTLA 3I55A 3PO2G 3HOZG 4YWMA 4Y7NH 4DUZQ 2YYZA 4A3JH 4IFDI 5IE8A 1YJNA 4B3MQ 2ZJQA 1QUQA 2NZOA 3HOYH 1SR3A 3PIPA 1K83H 1IBLQ 2DUDA 3MEFA 3JAMi 3PO2H 4KHZA 2Z6KC 1GO3E 3HOZH 4IOCA 3K7AH 4YY3Q 4LF7Q 1B70B 2GN5A 4OXPA 2Y0SE 3PUXA 1Q12A 3PV0A 2JA7H 5GQOA 2R93G 4JI6Q 3ERSX 5C3EH 2OTLA 1GM5A 2B63H 2V1CC 1S40A 1HZAA 3S2HH 4PZ6A 1EWIA 4LF6Q 1G51A 4NXNQ 1FJGL 4YWKA 4JI7L 1OXXK 2R93H 4GNXB 5C44G 4O2DA 1V43A 2E2HH 2JEBI 1SMXA 5FLXc 4NXML 2VUMH 1S72A 2PI2E 1NTGA 4GN3B 4L5QA 1XPUA 4QL5A 4PZ7A 1BVSA 3W5OA 2Z6KA 4JI8Q 1KD1C 3E9HA 4DR5L 5C0XI 3TS2A 4GOPB 3ULLA 4MZ9A 1I3QH 4UY8C 3PF4A 3BU2A 4JI7Q 1EYGA 3M4PA 1Q81C 4IJHA 3TRZA 3CC4A 1VCIA 2LXJA 2ZTEA 5J3BA 3UDXA 5IYBH 4JI4L 4IFDG 4NXMQ 4X6AH 1T9HA 3K0XA 2RHQB 3UDIA 4WJ4A 1EOVA 1MJCA 1L1OB 3RLNA 1TWCH 3CAMA 3AEVA 4DR5Q 4OX9Q 4DV2Q 1N36Q 1ASZA 4A3LH 3JC66 3RNUA 3RLFA 5IP7G 3S17H 3S1NH 1TXYA 4R4QA 5LMUL 2CKZB 3T1YQ 2UUCL 3T1HQ 1VQ4A 4GKJL 1VQFA 3F8TA 3PUWA 3CCJA 1PH6A 1KXLA 3RZOH 4JI4Q 1HNWL 4R4OA 1Y1WH 1XNQL 1JMCA 2QEXA 4YHHL 1TWGH 4L5TA 1CSQA 1JT8A 3RN2A 2F52A 1L1OC 4DR3L 2N8NA 4DR7Q 3S1RH 1KAWA 1PFSA 2Z0SA 1I94L 3HOUG 5LMUQ 2UUCQ 4GLVB 1LYLA 1ASYA 4GKJQ 2YTVA 1JJGA 3TREA 4DV1L 4DV3Q 2RHSB 4YCWA 1CKNA 4JV5Q 4A3FG 5C0XJ 4JYAL 1HNWQ 4B3RL 1HNXL 2NZHA 3HOWG 2NVQH 2JJQA 3K81C 4UP7A 4QQBX 4JCVE 1VQHA 2IHFA 1N9WA 2PNHA 4YCVA 3F1ZA 2F3IA 4DR3Q 3HOUH 1Q1EA 2K5HA 2ZTDA 2IX0A 4X64Q 1GKHA 2WB1E 2I5LX 1P16A 1W3SA 4A3IH 2WP8J 4GS3A 2KHJA 3U50C 3U4VA 1I5FA 2BH8A 1WOCA 4GN4B 1G291 1HZ9A 4DV1Q 1IL2A 3E0EA 1UEBA 1IXRA 4BA2I 3G6EA 1C0AA 1L1OA 4DK3C 3I2ZA 3J81j 1CKOA 1QVGA 1IBML 1QUQB 1A63A 4LF8Q 2VS1A 4DV0Q 2JA9A 4RMFA 4BY1G 3U4ZA 3GTOH 3NBHB 2PI2A 1K0RA 1YHQA 4WJ3M 1JB7A 1HH2P 1HZBA 4R4TA 3CPFA 3W1BA 3OW2A 1S3OA 4DV6L 1KQSA 5JJKA 1XPRA 5GAGC 3J81c 4LFAL 2E8GA 5M5YH 1PV4A 1C7YA 1VQGA 4ME3A 3CMEA 1YI2A 1VQCA 2JA8G 4MTNA 4LNQA 1IBMQ 1J6QA 5M3MH 4PMWA 3GDEA 3UE1A 1X6OA 1HNZL 3CD6A 5IYDG 4Y52H 4JBJA 3H3VI 1UE5A 2Y0SG 4DV6Q 1HR0W 3BZKA 3A5UA 4O0AA 3S15H 2JA8H 5HY6A 3J81i 1N36L 1VQLA 4GN5A 2F4VL 1BBUA 3F2BA 3GTLH 3CCRA 3PSIA 3FHWA 1VQKA 2XGTA 4RG1A 3PUYA 2GVAA 2VNUD 4LW1A 3B6YA 1HNZQ 3H0GH 2ASBA 4EQ5A 3G48A 2ZJRA 2CWPA 4LF5Q 1YZ6A 2ZM6L 2OQ0A 4L5RC 2A19A 1NMGA 3M9BA 2CQOA 3RLOA 2KENA 1X9NA 3CXCA 1DGSA 4JI6L 2F4VQ 1K73C 3AQQA 1QZHA 4KI0A 3UE0A 2R7ZH 2JA6H 3PO3G 3G71A 5C4XG 1CUKA 1VQOA 4LF6L 4KLKA 1SFOH 4OWXB 4A93H 3SGIA 4DAYB 2QA4A 4NXNL 3STBC 1N8RC 2JA5G 1PHJA 3KOJA 2MFIA 2ZM6Q 4A3GG 4LFCL 4PG3A 4DAMA 1I6HH 5EAYA 1KRSA 4UP9A 1YEZA 4A3CG 3CF5A 2B29A 4J15A 1BKBA 4IPHA 3CQZH 3KYHC 5IWAQ 3AFPA 4KHPL 2Q2UA 3I4NG 4YCUA 3MXNB 1N33L 4MNOA 5JJLA 3KDFB 4JI8L 1E1TA 2PQAA 1WYDA 4LUOA 3PUZA 5AJ3L 1JJCB 3M4OH 2R92G 4HJ7A 2UXBL 2N3SA 4A3CH 2LSSA 3STBD 4LFCQ 1Q7YC 1N32L 1YJ9A 4KHPQ 4QY7A 4GKKL 1CKNB 4BA1I 1PH4A 4C3IH 1N33Q 5ELNA 2HIXA 2IY5B 4OX9L 1V9PA 2ZTCA 3K8AA 1X3FA 4NPSA 5AJ3Q 4DV2L 3TS0A 3ULPA 1VQPA 2VL6A 2A1AA 4AQYQ 2ID0A 3NELA 5C44H 2UXBQ 2NN6I 3T1YL 2AHOB 3T1HL 2MO1A 4LUZA 5ELOA 3L2PA 3U58A 2Q2TA 1N32Q 2HT1A 4JI3L 4A3EG 4LF4L 4XIGS 3DM3A 2GVBA 4GKKQ 5GADC 4BXXG 4DV7L 4TVAB 4A3KG 1YITA 3VDYA 1R9TH 1TWFH 3E9IA 4HJ5A 3IRBA 4DR7L 3S24A 2BA0A 2WB1G 3UDFA 1BBWA 5JEAG 3CPWA 1Y1VG 4HJ9A 2R7DA 3Q8DA 1OXVA 3FP9A 4AYBE 4HIDA 4X65L 4DV3L 4HIOA 4JI3Q 4LF4Q 3NENA 1G6PA 4JV5L 4LUVA 4X62L 4A3KH 2OCEA 1KL9A 1WI5A 3KDFA 1PH3A 1D8LA 4DV7Q 2K5NA 3I56A 5IP7H 1JE5A 1MIUA 2UXCL 1Y1VH 3KJOA 1Q1BA 1SN8A 1YIJA 1VQMA 4X64L 1WCMG 1XNRL 4OONA 4A3MG 1WJJA 1LUZA 4IPCA 3CCLA 4JI0L 2YTYA 3UDGA 3S2DH 2UXDQ 1UE6A 4X65Q 2OTJA 1B8AA 4JBWA 3EBEA 4X62Q 1K8AC 3RZDH 3J80c 4LF8L 3A5ZB 4DV0L 4BY7G 1PH5A 4QJFA 2ATWA 5C0XG 2QGQA 5IP9G 2UXCQ 4BBSG 1FVIA 1XNRQ 4JI0Q 4NB3A 1I50H 4A3FH 1AH9A 3CCVA 4DUYL 4JI1Q 4JBMA 3HOWH 1XTDA 2MO0A 4DR6Q 2KCMA 5FJ8G 1AE2A 3D31A 3A74A 2MNAA 1AE3A 3RR5A 4DV4L 3GTGH 3S14H 4B3SQ 4K0KQ 3J80i 4EX5A 4DV5L 5H1SE 1KIXA 2JEAI 5GROA 4IO9A 3HKZE 2AMCB 4JI2L 2A8VA 2HHHQ 4JOIC 1RL2A 1VQ5A 2L15A 1K9MC 5FJ8H 4R1JA 3ULJA 4DUYQ 1VQ7A 3ER0A 2CFMA 1YJWA 1Y14B 4DR1Q 4DV4Q 2OWOA 4BY1H 3DLLA 2IT1A 3M7NA 4JBKA 4DV5Q 2NVXH 1EFWA 2PQAB 1IZ6A 1XMQL 2D62A 1KRTA 4JI2Q 4P72A 2VQEL 4LF5L 1LM0A 1SRUA 3K7UC 3BZCA 3PIOA 2K50A 4UP8A 3KF8B 4A3DG 2ES2A 3CC7A 1W2BA 2Q2IA 3PGZA 2E2JH 4POGA 1KHIA 5BR8Q 3M3YH 1PA6A 1Q8KA 2KCTA 1E1OA 2VZAA 3GO5A 3I7FA 4DNIA 3S1QH 3GTMH 5IYDH 4JOIA 4DPGA 1XMQQ 1EIFA 3GD7A 4H02A 2VQEQ 3PF5A 3I4MG 3L0OA 5FLMG 1GD7A 3TQYA 4UPAA 2BH2A 4DK6C 3M85A 5LMNL 2YU9H 4GLXA 5IWAL 4R4CA 2AKWB 1OTCA 2BA1A 1X55A 2KBNA 2XTIA 5M3FG 4L5SA 2K5VA 1XMOL 5IYCG 2UUAQ 1MJEA 1VQ8A 2NVTH 1IBKL 3CP0A 3TEHB 4JG2A 2H5XA 3ZJYC 3A0JA 4BBSH 2EIFA 1Z47A 3AYHB 3CCQA 3HOVG 2IHEA 2AWNA 5LMNQ 1M1KC 3F2DA 1IYJB 2K52A 3PO3H 5C4XH 4DR4L 2LXKA 1XMOQ 1PH7A 1PYBA 1VQJA 2UUBQ 3CCUA 2EXDA 5K36G 1NY4A 1H95A 2JA5H 1M90C 1SLJA 1WFQA 2VQFL 1IBKQ 1Q46A 4A3GH 4BBRG 4AQYL 4FDBA 2UU9Q 3OTOL 3HOVH 1VQIA 3KF6A 3KLWA 5DLQE 4LF9Q 2JA7G 4AYBG 5C3EG 2B63G 2MQHA 3I4NH 4P75A 1XPOA 2E5LQ 3GTPH 1Q86C 3S1MH 3GTJH 3M4QA 3J7ZC 1OXUA 4DR4Q 1HJPA 1EUJA 1SE8A 4BBRH 2R92H 1CKMA 1UWVA 2VQFQ 2RF4A 1A62A 1HZCA 3H3VH 5JJIA 3AFQA 1CSPA 1U5KA 3OTOQ 2VY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUM G;  4ALP A;  2HIV A;  4DR2 L;  3EIV A;  1QVC A;  1OXT A;  2WAQ E;  4R4I A;  4IJL A;  3W1G A;  3GTQ H;  3LGJ A;  1EIY B;  4POF A;  2K75 A;  1EQQ A;  3H15 A;  2YTX A;  1L0W A;  2CWA A;  3K80 C;  4QGU A;  1C9O A;  1L2F A;  4HIK A;  4P73 A;  5IYB G;  4A3E H;  4HIM A;  1E7Z A;  1YBY A;  1A8V A;  4DR2 Q;  1MKH A;  2UXD L;  4BXX H;  5GAE C;  1FJG Q;  5IY0 A;  4IFD J;  4JC0 A;  4A4I A;  1E22 A;  5IT9 c;  3PUV A;  2R7F A;  4A3L G;  3PCO B;  2JK8 A;  4X66 L;  3RN5 A;  5M5W H;  1VQA A;  3HKZ G;  4GNX C;  4JI5 L;  4HJ8 A;  4TQU S;  2VW9 A;  4LFB L;  2Q2H A;  3CCM A;  2K4K A;  4OWT B;  5JEA J;  4A75 A;  1K8G A;  4C3H H;  1Y1W G;  4P71 A;  4JI1 L;  3G4S A;  2RCN A;  1N34 L;  1VQN A;  4DR6 L;  1K3R A;  4OWW B;  4GOP C;  3L7Z C;  4LWC A;  1PH8 A;  1YVC A;  4B3S L;  4K0K L;  4X66 Q;  3BJU A;  1WCM H;  4JI5 Q;  2I0Q A;  3HFZ B;  1X54 A;  4A3M H;  3I4O A;  4OO1 I;  2HHH L;  2ALY B;  4LFB Q;  2NN6 G;  2N78 A;  1VQ6 A;  2KHI A;  2JQO A;  1VQD A;  1YHA A;  1N34 Q;  3GTK H;  1NE3 A;  4DKA C;  4DR1 L;  4GNX A;  2HQL A;  1SRO A;  5IP9 H;  1PVO A;  1VQE A;  4P74 A;  4A3I G;  1KC8 C;  2JE6 I;  4HJA A;  2B3G A;  1NBW A;  1FGU A;  4C2M H;  1XNQ Q;  5E7N A;  4YHH Q;  5M5X H;  1FL0 A;  3F2C A;  1TWA H;  4GOP A;  1QVF A;  2C35 B;  4AH6 A;  1X3G A;  1UE1 A;  5BR8 L;  1A0I A;  1E3P A;  1P8L A;  3FKI G;  1I94 Q;  1VS0 A;  2E2I H;  4PZ8 A;  2WFW A;  4A76 A;  1PH9 A;  3NEM A;  4APV A;  4IPG A;  1YHB A;  5HGQ A;  3KJP A;  3D0F A;  3CW2 C;  4JYA Q;  1PYS B;  4B3R Q;  2K14 A;  2R6G A;  1NJI C;  1HNX Q;  2D0P A;  4B3T L;  3KF6 B;  1V1Q A;  3OYY A;  3HOX G;  2I5M X;  3FKI H;  2IX1 A;  1VQ9 A;  4QIW E;  5M3M G;  1EQR A;  1O7I A;  1OXS C;  2UUA L;  1GVP A;  2PMZ E;  2OQK A;  2NVY H;  2YV5 A;  1VQB A;  3CMA A;  4GLA C;  3HOX H;  4A3D H;  3HKS A;  3WWV A;  1X3E A;  4B3T Q;  4OO1 G;  1NMF A;  1RIP A;  1E24 A;  2AWO A;  4IOA A;  2DGY A;  4YWL A;  5C4J H;  1YNX A;  3EN2 A;  1D7Q A;  5LMN W;  2FXQ A;  2N49 A;  1J5E L;  3H0G G;  1HR0 L;  4IPD A;  4A3B G;  5GAH C;  3CCS A;  2UUB L;  3S16 H;  1U0L A;  4C3J H;  1X65 A;  1TWH H;  3CCE A;  4LFA Q;  1X56 A;  4DUZ L;  3I4M H;  2CCZ A;  1PH2 A;  1XJV A;  5FLM H;  1Q82 C;  2I5H A;  3CC2 A;  4A3J G;  2UU9 L;  4B3M L;  4BY7 H;  4LF9 L;  3ICE A;  1B7Y B;  1QZG A;  5M3F H;  1UE7 A;  2R7Z G;  2WAQ G;  2JA6 G;  2D0O A;  2E5L L;  1IBL L;  3JAM c;  5IYC H;  4XTC S;  4AIM A;  3HOY G;  3J7A 5;  3KFU A;  1JJ2 A;  4A3B H;  1Z9F A;  1J5E Q;  4A93 G;  1PH1 A;  4YY3 L;  2EQS A;  2ZJP A;  1HR0 Q;  4LF7 L;  1LTL A;  3I55 A;  3PO2 G;  3HOZ G;  4YWM A;  4Y7N H;  4DUZ Q;  2YYZ A;  4A3J H;  4IFD I;  5IE8 A;  1YJN A;  4B3M Q;  2ZJQ A;  1QUQ A;  2NZO A;  3HOY H;  1SR3 A;  3PIP A;  1K83 H;  1IBL Q;  2DUD A;  3MEF A;  3JAM i;  3PO2 H;  4KHZ A;  2Z6K C;  1GO3 E;  3HOZ H;  4IOC A;  3K7A H;  4YY3 Q;  4LF7 Q;  1B70 B;  2GN5 A;  4OXP A;  2Y0S E;  3PUX A;  1Q12 A;  3PV0 A;  2JA7 H;  5GQO A;  2R93 G;  4JI6 Q;  3ERS X;  5C3E H;  2OTL A;  1GM5 A;  2B63 H;  2V1C C;  1S40 A;  1HZA A;  3S2H H;  4PZ6 A;  1EWI A;  4LF6 Q;  1G51 A;  4NXN Q;  1FJG L;  4YWK A;  4JI7 L;  1OXX K;  2R93 H;  4GNX B;  5C44 G;  4O2D A;  1V43 A;  2E2H H;  2JEB I;  1SMX A;  5FLX c;  4NXM L;  2VUM H;  1S72 A;  2PI2 E;  1NTG A;  4GN3 B;  4L5Q A;  1XPU A;  4QL5 A;  4PZ7 A;  1BVS A;  3W5O A;  2Z6K A;  4JI8 Q;  1KD1 C;  3E9H A;  4DR5 L;  5C0X I;  3TS2 A;  4GOP B;  3ULL A;  4MZ9 A;  1I3Q H;  4UY8 C;  3PF4 A;  3BU2 A;  4JI7 Q;  1EYG A;  3M4P A;  1Q81 C;  4IJH A;  3TRZ A;  3CC4 A;  1VCI A;  2LXJ A;  2ZTE A;  5J3B A;  3UDX A;  5IYB H;  4JI4 L;  4IFD G;  4NXM Q;  4X6A H;  1T9H A;  3K0X A;  2RHQ B;  3UDI A;  4WJ4 A;  1EOV A;  1MJC A;  1L1O B;  3RLN A;  1TWC H;  3CAM A;  3AEV A;  4DR5 Q;  4OX9 Q;  4DV2 Q;  1N36 Q;  1ASZ A;  4A3L H;  3JC6 6;  3RNU A;  3RLF A;  5IP7 G;  3S17 H;  3S1N H;  1TXY A;  4R4Q A;  5LMU L;  2CKZ B;  3T1Y Q;  2UUC L;  3T1H Q;  1VQ4 A;  4GKJ L;  1VQF A;  3F8T A;  3PUW A;  3CCJ A;  1PH6 A;  1KXL A;  3RZO H;  4JI4 Q;  1HNW L;  4R4O A;  1Y1W H;  1XNQ L;  1JMC A;  2QEX A;  4YHH L;  1TWG H;  4L5T A;  1CSQ A;  1JT8 A;  3RN2 A;  2F52 A;  1L1O C;  4DR3 L;  2N8N A;  4DR7 Q;  3S1R H;  1KAW A;  1PFS A;  2Z0S A;  1I94 L;  3HOU G;  5LMU Q;  2UUC Q;  4GLV B;  1LYL A;  1ASY A;  4GKJ Q;  2YTV A;  1JJG A;  3TRE A;  4DV1 L;  4DV3 Q;  2RHS B;  4YCW A;  1CKN A;  4JV5 Q;  4A3F G;  5C0X J;  4JYA L;  1HNW Q;  4B3R L;  1HNX L;  2NZH A;  3HOW G;  2NVQ H;  2JJQ A;  3K81 C;  4UP7 A;  4QQB X;  4JCV E;  1VQH A;  2IHF A;  1N9W A;  2PNH A;  4YCV A;  3F1Z A;  2F3I A;  4DR3 Q;  3HOU H;  1Q1E A;  2K5H A;  2ZTD A;  2IX0 A;  4X64 Q;  1GKH A;  2WB1 E;  2I5L X;  1P16 A;  1W3S A;  4A3I H;  2WP8 J;  4GS3 A;  2KHJ A;  3U50 C;  3U4V A;  1I5F A;  2BH8 A;  1WOC A;  4GN4 B;  1G29 1;  1HZ9 A;  4DV1 Q;  1IL2 A;  3E0E A;  1UEB A;  1IXR A;  4BA2 I;  3G6E A;  1C0A A;  1L1O A;  4DK3 C;  3I2Z A;  3J81 j;  1CKO A;  1QVG A;  1IBM L;  1QUQ B;  1A63 A;  4LF8 Q;  2VS1 A;  4DV0 Q;  2JA9 A;  4RMF A;  4BY1 G;  3U4Z A;  3GTO H;  3NBH B;  2PI2 A;  1K0R A;  1YHQ A;  4WJ3 M;  1JB7 A;  1HH2 P;  1HZB A;  4R4T A;  3CPF A;  3W1B A;  3OW2 A;  1S3O A;  4DV6 L;  1KQS A;  5JJK A;  1XPR A;  5GAG C;  3J81 c;  4LFA L;  2E8G A;  5M5Y H;  1PV4 A;  1C7Y A;  1VQG A;  4ME3 A;  3CME A;  1YI2 A;  1VQC A;  2JA8 G;  4MTN A;  4LNQ A;  1IBM Q;  1J6Q A;  5M3M H;  4PMW A;  3GDE A;  3UE1 A;  1X6O A;  1HNZ L;  3CD6 A;  5IYD G;  4Y52 H;  4JBJ A;  3H3V I;  1UE5 A;  2Y0S G;  4DV6 Q;  1HR0 W;  3BZK A;  3A5U A;  4O0A A;  3S15 H;  2JA8 H;  5HY6 A;  3J81 i;  1N36 L;  1VQL A;  4GN5 A;  2F4V L;  1BBU A;  3F2B A;  3GTL H;  3CCR A;  3PSI A;  3FHW A;  1VQK A;  2XGT A;  4RG1 A;  3PUY A;  2GVA A;  2VNU D;  4LW1 A;  3B6Y A;  1HNZ Q;  3H0G H;  2ASB A;  4EQ5 A;  3G48 A;  2ZJR A;  2CWP A;  4LF5 Q;  1YZ6 A;  2ZM6 L;  2OQ0 A;  4L5R C;  2A19 A;  1NMG A;  3M9B A;  2CQO A;  3RLO A;  2KEN A;  1X9N A;  3CXC A;  1DGS A;  4JI6 L;  2F4V Q;  1K73 C;  3AQQ A;  1QZH A;  4KI0 A;  3UE0 A;  2R7Z H;  2JA6 H;  3PO3 G;  3G71 A;  5C4X G;  1CUK A;  1VQO A;  4LF6 L;  4KLK A;  1SFO H;  4OWX B;  4A93 H;  3SGI A;  4DAY B;  2QA4 A;  4NXN L;  3STB C;  1N8R C;  2JA5 G;  1PHJ A;  3KOJ A;  2MFI A;  2ZM6 Q;  4A3G G;  4LFC L;  4PG3 A;  4DAM A;  1I6H H;  5EAY A;  1KRS A;  4UP9 A;  1YEZ A;  4A3C G;  3CF5 A;  2B29 A;  4J15 A;  1BKB A;  4IPH A;  3CQZ H;  3KYH C;  5IWA Q;  3AFP A;  4KHP L;  2Q2U A;  3I4N G;  4YCU A;  3MXN B;  1N33 L;  4MNO A;  5JJL A;  3KDF B;  4JI8 L;  1E1T A;  2PQA A;  1WYD A;  4LUO A;  3PUZ A;  5AJ3 L;  1JJC B;  3M4O H;  2R92 G;  4HJ7 A;  2UXB L;  2N3S A;  4A3C H;  2LSS A;  3STB D;  4LFC Q;  1Q7Y C;  1N32 L;  1YJ9 A;  4KHP Q;  4QY7 A;  4GKK L;  1CKN B;  4BA1 I;  1PH4 A;  4C3I H;  1N33 Q;  5ELN A;  2HIX A;  2IY5 B;  4OX9 L;  1V9P A;  2ZTC A;  3K8A A;  1X3F A;  4NPS A;  5AJ3 Q;  4DV2 L;  3TS0 A;  3ULP A;  1VQP A;  2VL6 A;  2A1A A;  4AQY Q;  2ID0 A;  3NEL A;  5C44 H;  2UXB Q;  2NN6 I;  3T1Y L;  2AHO B;  3T1H L;  2MO1 A;  4LUZ A;  5ELO A;  3L2P A;  3U58 A;  2Q2T A;  1N32 Q;  2HT1 A;  4JI3 L;  4A3E G;  4LF4 L;  4XIG S;  3DM3 A;  2GVB A;  4GKK Q;  5GAD C;  4BXX G;  4DV7 L;  4TVA B;  4A3K G;  1YIT A;  3VDY A;  1R9T H;  1TWF H;  3E9I A;  4HJ5 A;  3IRB A;  4DR7 L;  3S24 A;  2BA0 A;  2WB1 G;  3UDF A;  1BBW A;  5JEA G;  3CPW A;  1Y1V G;  4HJ9 A;  2R7D A;  3Q8D A;  1OXV A;  3FP9 A;  4AYB E;  4HID A;  4X65 L;  4DV3 L;  4HIO A;  4JI3 Q;  4LF4 Q;  3NEN A;  1G6P A;  4JV5 L;  4LUV A;  4X62 L;  4A3K H;  2OCE A;  1KL9 A;  1WI5 A;  3KDF A;  1PH3 A;  1D8L A;  4DV7 Q;  2K5N A;  3I56 A;  5IP7 H;  1JE5 A;  1MIU A;  2UXC L;  1Y1V H;  3KJO A;  1Q1B A;  1SN8 A;  1YIJ A;  1VQM A;  4X64 L;  1WCM G;  1XNR L;  4OON A;  4A3M G;  1WJJ A;  1LUZ A;  4IPC A;  3CCL A;  4JI0 L;  2YTY A;  3UDG A;  3S2D H;  2UXD Q;  1UE6 A;  4X65 Q;  2OTJ A;  1B8A A;  4JBW A;  3EBE A;  4X62 Q;  1K8A C;  3RZD H;  3J80 c;  4LF8 L;  3A5Z B;  4DV0 L;  4BY7 G;  1PH5 A;  4QJF A;  2ATW A;  5C0X G;  2QGQ A;  5IP9 G;  2UXC Q;  4BBS G;  1FVI A;  1XNR Q;  4JI0 Q;  4NB3 A;  1I50 H;  4A3F H;  1AH9 A;  3CCV A;  4DUY L;  4JI1 Q;  4JBM A;  3HOW H;  1XTD A;  2MO0 A;  4DR6 Q;  2KCM A;  5FJ8 G;  1AE2 A;  3D31 A;  3A74 A;  2MNA A;  1AE3 A;  3RR5 A;  4DV4 L;  3GTG H;  3S14 H;  4B3S Q;  4K0K Q;  3J80 i;  4EX5 A;  4DV5 L;  5H1S E;  1KIX A;  2JEA I;  5GRO A;  4IO9 A;  3HKZ E;  2AMC B;  4JI2 L;  2A8V A;  2HHH Q;  4JOI C;  1RL2 A;  1VQ5 A;  2L15 A;  1K9M C;  5FJ8 H;  4R1J A;  3ULJ A;  4DUY Q;  1VQ7 A;  3ER0 A;  2CFM A;  1YJW A;  1Y14 B;  4DR1 Q;  4DV4 Q;  2OWO A;  4BY1 H;  3DLL A;  2IT1 A;  3M7N A;  4JBK A;  4DV5 Q;  2NVX H;  1EFW A;  2PQA B;  1IZ6 A;  1XMQ L;  2D62 A;  1KRT A;  4JI2 Q;  4P72 A;  2VQE L;  4LF5 L;  1LM0 A;  1SRU A;  3K7U C;  3BZC A;  3PIO A;  2K50 A;  4UP8 A;  3KF8 B;  4A3D G;  2ES2 A;  3CC7 A;  1W2B A;  2Q2I A;  3PGZ A;  2E2J H;  4POG A;  1KHI A;  5BR8 Q;  3M3Y H;  1PA6 A;  1Q8K A;  2KCT A;  1E1O A;  2VZA A;  3GO5 A;  3I7F A;  4DNI A;  3S1Q H;  3GTM H;  5IYD H;  4JOI A;  4DPG A;  1XMQ Q;  1EIF A;  3GD7 A;  4H02 A;  2VQE Q;  3PF5 A;  3I4M G;  3L0O A;  5FLM G;  1GD7 A;  3TQY A;  4UPA A;  2BH2 A;  4DK6 C;  3M85 A;  5LMN L;  2YU9 H;  4GLX A;  5IWA L;  4R4C A;  2AKW B;  1OTC A;  2BA1 A;  1X55 A;  2KBN A;  2XTI A;  5M3F G;  4L5S A;  2K5V A;  1XMO L;  5IYC G;  2UUA Q;  1MJE A;  1VQ8 A;  2NVT H;  1IBK L;  3CP0 A;  3TEH B;  4JG2 A;  2H5X A;  3ZJY C;  3A0J A;  4BBS H;  2EIF A;  1Z47 A;  3AYH B;  3CCQ A;  3HOV G;  2IHE A;  2AWN A;  5LMN Q;  1M1K C;  3F2D A;  1IYJ B;  2K52 A;  3PO3 H;  5C4X H;  4DR4 L;  2LXK A;  1XMO Q;  1PH7 A;  1PYB A;  1VQJ A;  2UUB Q;  3CCU A;  2EXD A;  5K36 G;  1NY4 A;  1H95 A;  2JA5 H;  1M90 C;  1SLJ A;  1WFQ A;  2VQF L;  1IBK Q;  1Q46 A;  4A3G H;  4BBR G;  4AQY L;  4FDB A;  2UU9 Q;  3OTO L;  3HOV H;  1VQI A;  3KF6 A;  3KLW A;  5DLQ E;  4LF9 Q;  2JA7 G;  4AYB G;  5C3E G;  2B63 G;  2MQH A;  3I4N H;  4P75 A;  1XPO A;  2E5L Q;  3GTP H;  1Q86 C;  3S1M H;  3GTJ H;  3M4Q A;  3J7Z C;  1OXU A;  4DR4 Q;  1HJP A;  1EUJ A;  1SE8 A;  4BBR H;  2R92 H;  1CKM A;  1UWV A;  2VQF Q;  2RF4 A;  1A62 A;  1HZC A;  3H3V H;  5JJI A;  3AFQ A;  1CSP A;  1U5K A;  3OTO Q;  2VY3 A; 
#chains in the Genus database with same CATH topology
 4ALP A;  2HIV A;  3EIV A;  1GUW A;  1X3P A;  3S16 B;  5D65 A;  1NR2 A;  1EQT A;  3D4W A;  1B3Q A;  3GTL B;  2CWA A;  4QMG A;  4L8J A;  1E7Z A;  1YBY A;  3DUZ A;  3J80 L;  5I6W A;  1HUN A;  1JWM D;  1E22 A;  5IT9 c;  4A3J B;  4Y7N B;  2JK8 A;  3DWQ A;  5M5W H;  1QNK A;  2JA6 B;  1JIC A;  4TQU S;  2Q2H A;  2K4K A;  3HP3 A;  4RCO A;  4CDD C;  4P71 A;  2RCN A;  1PRT F;  1I6H B;  1PH8 A;  2JA7 B;  5CGK A;  4HR7 B;  4KTA A;  4AYB B;  3HFZ B;  1STG A;  4A3M H;  3S2H B;  3R2T A;  2ALY B;  2NN6 G;  4DA2 A;  1BO0 A;  2NTS A;  2B2U C;  1K0S A;  1VQD A;  3JAM E;  1N34 Q;  2R93 B;  1ZKO A;  2H4O A;  2E2H B;  5CR3 A;  4A3I G;  2GA4 B;  2JE6 I;  1STE A;  4C3I B;  2B3G A;  1KC8 C;  2F0F A;  4K8I A;  2Q8T A;  2C35 B;  2WII B;  1X3G A;  1UE1 A;  3DXJ C;  1A0I A;  3VR2 A;  3DM1 A;  2A68 D;  2WFW A;  1PH9 A;  4APV A;  2PNR C;  3PIO 3;  5HGQ A;  2B2U A;  1HUM A;  3CW2 C;  3MFY A;  2O4X A;  1PRT D;  3OYY A;  1DON A;  1GXD C;  3S17 B;  3ERQ A;  3FKI H;  2BE5 C;  4OEL B;  1GVP A;  1LTS D;  2OQK A;  2NVY H;  1C48 A;  1EEI D;  4GLA C;  3HOX H;  3K5O A;  3HKS A;  1TWG B;  1GUO A;  1X3E A;  5E4X A;  2AQ1 B;  1E24 A;  4KKU A;  2PZT A;  1VF5 C;  1YNX A;  1D7Q A;  4R9W A;  2FXQ A;  2N49 A;  1VDZ A;  4XQQ A;  1U4R A;  5KND A;  5GAH C;  1SSO A;  5G3L F;  1U0L A;  1ROD A;  1K3B C;  4QIW B;  3S9W A;  4A3J G;  2UU9 L;  3I4L A;  4LF9 L;  1WVL A;  1B7Y B;  1UE7 A;  2WAQ G;  2JA6 G;  1XYI A;  2E5L L;  3KFU A;  3DEO A;  2K5W A;  1S5E D;  1WD0 A;  4A93 G;  1HR0 Q;  4IFD I;  1LT3 D;  1D1K A;  1SR3 A;  1TVX A;  3SK4 A;  3NBH A;  1IBL Q;  3NTH A;  3PO2 H;  2Z6K C;  1GOZ A;  4CKB A;  4LF7 Q;  1B70 B;  3HRZ C;  3PUX A;  3T13 A;  3PV0 A;  2R93 G;  2EYM A;  5IT9 L;  2IWH A;  4LF6 Q;  1G51 A;  2RKS A;  4C3I G;  5DAU A;  3WDN A;  4V0B A;  2Z9H A;  5C4Z A;  1OXX K;  3TDQ A;  4GNX B;  2JEB I;  5CYU A;  3BZD B;  5FLX c;  1CA5 A;  4GN3 B;  3BYT B;  1XPU A;  3GTM B;  3VYU A;  2Z6K A;  5C0X I;  1HA6 A;  3SDZ A;  3NHH A;  3PF4 A;  4E6I A;  1WTP A;  3TRZ A;  4IJH A;  3CC4 A;  2LXJ A;  2HD3 A;  3A54 A;  4KY5 A;  4IFD G;  2NZ1 D;  4BS9 A;  3BYY B;  1T9H A;  3K0X A;  3UDI A;  1EOV A;  1MJC A;  3Q0A A;  2K03 A;  1YNN C;  3CAM A;  3AEV A;  2G5D A;  1ASZ A;  3JC6 6;  4NW2 A;  3RLF A;  4ZLT F;  3S1N H;  1BCP B;  2LY7 A;  1QWY A;  2CKZ B;  4O42 A;  1VQF A;  3F8T A;  3CQZ B;  5KRU A;  1KXL A;  3RZO H;  4JI4 Q;  1HNW L;  2NYZ D;  2OF1 A;  3M7G A;  3RN2 A;  2EYF A;  3LWU A;  1ESR A;  2UUC Q;  3GTP B;  4GKJ Q;  1TY2 A;  1O7Y A;  2KUM A;  2H1E A;  3TRE A;  3P75 A;  2NN6 H;  5C0X J;  4FF4 A;  4R8N A;  2K1B A;  2NZH A;  5A2Q L;  2JJQ A;  3K81 C;  3J7A F;  4YCV A;  4TRD A;  5IOD A;  2RQX A;  3I3C A;  4X64 Q;  2WB1 E;  4A3I H;  2WP8 J;  1FNU A;  1I4R A;  2KED A;  2KHJ A;  3Q23 A;  4GN4 B;  4DV1 Q;  1QIL A;  3QO2 A;  3SK8 A;  1C0A A;  1S5B D;  1PFB A;  1QVG A;  1IBM L;  2A6H C;  4LF8 Q;  1R9T B;  2VS1 A;  4DV0 Q;  2JA9 A;  1MHW C;  2EZV A;  2OEO A;  2PI2 A;  2I46 A;  4M1U B;  1HZB A;  3U9O A;  1O7L A;  4KN4 C;  1EYC A;  1C7Y A;  1IKL A;  4ME3 A;  2XN9 C;  4FO2 A;  4P2C B;  1VQC A;  1U4L A;  4K5W A;  3OHX C;  3EFX D;  3CKI B;  1E2Z A;  1BUV T;  2ENB A;  3H94 A;  3CD6 A;  1X6O A;  1WTW A;  2IPK D;  5FOB B;  1F2Y A;  4H13 C;  5HY6 A;  1VQL A;  4GN5 A;  1BBU A;  3GTL H;  3T4A C;  3PSI A;  3FHW A;  3CCR A;  4RG1 A;  2GVA A;  2KQ3 A;  1HNZ Q;  2ASB A;  1MBY A;  4EQ5 A;  2ZJR A;  2ZM6 L;  3M9B A;  3RLO A;  1X9N A;  3HOW B;  1BXT A;  3AQQ A;  1K73 C;  4KI0 A;  2JA6 H;  4IQZ A;  4LF6 L;  3P20 A;  1SFO H;  4A93 H;  3VR5 A;  1N8R C;  5FLX L;  4JK1 C;  4RCN A;  4PG3 A;  2OXP A;  4DAM A;  2G9D A;  1I6H H;  1KRS A;  3D8G A;  3DHQ A;  4A3C G;  2FJ2 A;  1SYD A;  2E2I B;  1V1P B;  4PMC A;  3MXN B;  2NVX B;  4MNO A;  3J80 E;  2PQA A;  5C4H A;  2J4X A;  4ABN A;  4HCS A;  2LSS A;  3STB D;  3R8B A;  2E2J B;  4KY6 A;  4QY7 A;  5NUC A;  2XRS D;  5FO7 B;  2DN8 A;  4C3I H;  1KTK A;  2IY5 B;  1SAP A;  2ZTC A;  1VQP A;  3TS0 A;  2A1A A;  3NEL A;  2UXB Q;  2AHO B;  2BCO A;  1QNU A;  2Q2T A;  2RBM A;  4XIG S;  1I4Q A;  4GKK Q;  3AMU A;  1PXU A;  3QOL A;  4DK1 A;  4DV7 L;  3C46 A;  1FNV A;  4TVA B;  1BCP F;  4XYQ A;  1TWF H;  4BY7 B;  4BBS B;  2BA0 A;  1JOO A;  1BBW A;  1F9P A;  3C1F A;  5JEA G;  5M3F B;  1HQM C;  4IFD H;  3Q8D A;  1ICF B;  3FP9 A;  3PO3 B;  2E76 C;  4HIO A;  1CFM A;  4LUV A;  2B2V C;  4OL7 A;  2NWG A;  1WI5 A;  1PH3 A;  1D8L A;  3OMC A;  2MHV A;  3I56 A;  4A3G B;  1JE5 A;  4IUP A;  4DU9 A;  1H9R A;  3KJO A;  4X64 L;  4OON A;  3AB9 A;  2O2L D;  3I4N B;  1L0X B;  1LUZ A;  4JI0 L;  3S1M B;  2UXD Q;  2KCC A;  3K7A B;  4IUU A;  3EBE A;  4LF8 L;  4DV0 L;  4RH6 A;  2B2Y C;  2B63 B;  4QJF A;  2UXC Q;  1TWH B;  2QGQ A;  3QIA A;  4CDF C;  2N88 A;  2HUG A;  1HFN A;  4NB3 A;  1I50 H;  3CCV A;  2SNM A;  4DUY L;  5JVG 3;  1CHP D;  1BCP D;  4DR6 Q;  2TSS A;  3D31 A;  2HCI A;  2HQE A;  4CJ2 C;  4K0K Q;  2JEA I;  3EVQ A;  4IO9 A;  3H3V C;  4JI2 L;  2A8V A;  1RL2 A;  4RFB A;  2AUJ D;  2L15 A;  1K9M C;  2RSN A;  2BOS A;  3A7L A;  5FO8 B;  1RTN A;  3F2U A;  1KLU D;  2B2Y A;  4HED A;  3TBI B;  5KNC A;  4DV4 Q;  5M5W B;  2WB1 B;  3DLL A;  1SE4 A;  2IT1 A;  4JBK A;  3M7N A;  1SMY D;  4DV5 Q;  4IUR A;  1KRT A;  2VQE L;  1LM0 A;  3K7U C;  3FRP B;  2K50 A;  4UP8 A;  3CC7 A;  4KD3 A;  2Q2I A;  2P5Z X;  5ELD A;  4L6T B;  3SVM A;  1ZXT A;  3M3Y H;  1RKN A;  4XDX A;  1UAP A;  2VZA A;  3D4R A;  4DAV A;  4DNI A;  3GTM H;  4A3M B;  2KOL A;  3FMC A;  3TSS A;  1MI2 A;  1R4Q B;  3I4M G;  3L0O A;  5FLM G;  2KVM A;  1GD7 A;  4BY7 G;  3T16 A;  2BH2 A;  4BBS G;  3S1R B;  1OTC A;  2MJ8 A;  3SEB A;  5M3F G;  4HSP A;  2XTI A;  3PIP 3;  5IT9 E;  1XMO L;  5IYC G;  3HEJ A;  5FKA C;  1IBK L;  1Z6H A;  3TEH B;  4JG2 A;  2H5X A;  3ZJY C;  3KBX A;  3AYH B;  1JOQ A;  4K5X A;  1JR0 D;  1EY7 A;  1NY4 A;  5K36 G;  1X3Q A;  1H95 A;  4C56 C;  1Q46 A;  4IZ8 A;  5IGF A;  3NWS A;  1MSG A;  2XVS A;  4FDB A;  2WAC A;  1VQI A;  2B63 G;  3FKI B;  1DOL A;  2FFK B;  3SXH A;  5KNB A;  4P75 A;  1XPO A;  3GTP H;  3BDC A;  1Q86 C;  4L63 B;  3GTJ H;  3M4Q A;  3N6R A;  2NVY B;  2CHB D;  3Q24 A;  5M5Y B;  1KNE A;  2F0H A;  3A55 A;  1GHJ A;  2RDG A;  5DEH A;  3HOX B;  2VQF Q;  1A62 A;  3MA2 B;  4CJ0 B;  4FNF A;  1CK1 A;  3OTO Q;  2SNS A;  3P7J A;  1BDO A;  1ZYR C;  1SBB B;  2WAQ E;  2B2W C;  3LGJ A;  4CDC C;  4DAP A;  1A15 A;  1EQQ A;  3H15 A;  1L0W A;  4C1N I;  2E75 C;  2C5C A;  3K80 C;  4QGU A;  2K6A A;  4P73 A;  4J6H A;  1Q3L A;  3K5N A;  2UXD L;  1MKH A;  5A2Q E;  4JC0 A;  4A4I A;  4NDX A;  5T1G A;  4X66 L;  3RN5 A;  3PQI A;  4GNX C;  4LFB L;  2X69 A;  4K2L A;  2B2W A;  3PO2 B;  4R8I A;  5C3X A;  3C3L A;  1VQN A;  4DR6 L;  4OWW B;  3L7Z C;  4XQJ A;  1K28 A;  4JPB W;  4K0K L;  1PRT B;  1IW7 C;  1V1O A;  1X54 A;  3I4O A;  2N78 A;  4IUN A;  1VQ6 A;  5IGD A;  2JQO A;  3GTK H;  1NE3 A;  4DKA C;  4GNX A;  2HQL A;  1PVO A;  3T53 B;  1H9S B;  1Z7T A;  2K5D A;  4HJA A;  1NBW A;  4HTH A;  5E7N A;  5M5X H;  1SYG A;  1QVF A;  3FKI G;  1S5C D;  2E2I H;  3T51 B;  5I4D A;  4A76 A;  3NEM A;  4YIJ A;  4Q0F A;  4B3R Q;  2K14 A;  1NJI C;  1HNX Q;  4B3T L;  4NKL A;  3HOX G;  2N55 A;  4QIW E;  1LTT D;  1D5Z C;  1TS5 A;  2K32 A;  3RZO B;  1B9N A;  2XRQ D;  3V05 A;  5FLX E;  4CKC A;  3WWV A;  2JXM B;  1RIP A;  2F0I A;  3OOC A;  1ESF A;  3BS1 A;  2EY5 A;  1J5E L;  5LHY 1;  5E3F A;  2K04 A;  3DMU A;  1X65 A;  4LFA Q;  1X56 A;  3I4M H;  2RA4 A;  5FLM H;  1F2Z A;  1LTR D;  4BY7 H;  3I73 A;  3K5L A;  2PMZ B;  4V19 0;  3ICE A;  1L0Y B;  5M3F H;  2R7Z G;  2EE1 A;  5IYC H;  4A3B H;  1CT1 D;  3OWE B;  1JJ2 A;  4A3I B;  4YY3 L;  2EQS A;  1TR5 A;  5EPK A;  1QJO A;  3I55 A;  5ELC A;  3PO2 G;  4WOR A;  4YWM A;  4J1M A;  3ND9 A;  5IE8 A;  2F0N A;  1YJN A;  3IL8 A;  5KYI A;  2CQA A;  2I07 B;  3HOY H;  1B1Z A;  3PIP A;  2DUD A;  3K59 A;  1GO3 E;  4IOC A;  2F0S A;  3K7A H;  2NTT A;  1SJH D;  3I90 A;  4OXP A;  4JW0 A;  4JI6 Q;  3ERS X;  2B63 H;  1GM5 A;  1S40 A;  4KHV A;  4PZ6 A;  4U68 A;  5EPL A;  4NXN Q;  2B2T C;  4YWK A;  5EGT A;  4JI7 L;  5CV8 A;  5C44 G;  1TS2 A;  1KAA A;  4NXM L;  1A2T A;  1SNP A;  2EOT A;  3W5O A;  1KD1 C;  4DR5 L;  4MZ9 A;  1I3Q H;  1A3U A;  3BU2 A;  3EJI A;  4OIK A;  3M4P A;  4RGM A;  2FMM A;  2YU9 B;  3UDX A;  1T5X D;  2WAQ B;  2HCC A;  2SDF A;  5KIX A;  4WJ4 A;  5I2X A;  1SFO B;  4A93 B;  1L1O B;  2B2T A;  5I2Y A;  2NVT B;  1TWC H;  3J7A V;  4OX9 Q;  4DV2 Q;  1STY A;  4LMQ D;  3TZD A;  1N36 Q;  5IP7 G;  1SYF A;  1TXY A;  3D4D A;  3T1H Q;  1VQ4 A;  4MIU A;  4RHR A;  3CCJ A;  1PH6 A;  4KMU C;  1EIG A;  1V1P A;  1D1I A;  3H91 A;  3MXN A;  4G7H C;  1JMC A;  3D6C A;  1TT2 A;  3NTI A;  4HMI A;  2N8N A;  3S1R H;  1PFS A;  1LYL A;  4KJN A;  1JB3 A;  1JJG A;  4YCW A;  1HPC A;  4JV5 Q;  1HNW Q;  4B3R L;  1HNX L;  2NVQ H;  4IUT A;  4JCV E;  1VQH A;  1DOM A;  3F1Z A;  3J81 L;  2FHT A;  4RKL A;  1XTC D;  5D3I B;  2IX3 A;  1P16 A;  1W3S A;  3BDO A;  4GS3 A;  1QCB D;  2F0G A;  2BH8 A;  1G29 1;  1HZ9 A;  3E0E A;  3I2Z A;  1QG7 A;  1QUQ B;  4H44 C;  5HUR A;  1O78 A;  1TWF B;  4BY1 G;  3DWP A;  1PZJ D;  1JB7 A;  1HH2 P;  1LV9 A;  1S3O A;  3RUZ A;  5GAG C;  4LFA L;  2E8G A;  1EU4 A;  5M5Y H;  3MFG A;  1SNC A;  1B9M A;  4LNQ A;  1EZ6 A;  1IBM Q;  4PMW A;  1G91 A;  2KCN A;  5CV7 A;  3H3V I;  4DN4 M;  4CGY B;  2Y0S G;  4PMB A;  2RDF A;  1PTO B;  3A5U A;  3S15 H;  2JA8 H;  3J81 i;  3F2B A;  4ULL A;  5CV4 A;  1QOH A;  1VQK A;  4KN7 C;  2EJG C;  1RJT A;  1A2U A;  3VYR A;  4LF5 Q;  1I50 B;  1FGB D;  2OQ0 A;  4L5R C;  2A19 A;  2QCP X;  2CQO A;  2KEN A;  3NBI A;  3A56 A;  3CXC A;  1DGS A;  4JI6 L;  1RD9 D;  2EYJ A;  2R7Z H;  3G71 A;  1ENF A;  1CUK A;  4FXD A;  2QA4 A;  2QKI C;  4NXN L;  2J0T D;  2MFI A;  2ZM6 Q;  4K6D A;  4LFC L;  2DJF C;  2B29 A;  2K01 A;  1BKB A;  3DWA A;  3KYH C;  4KHP L;  1PFN A;  1F9R A;  2K7V A;  4LJZ C;  5EJW A;  1N33 L;  3KDF B;  3P1H A;  2Z4I A;  2N3S A;  3R93 A;  5ELF A;  1YJ9 A;  3M3Y B;  2A69 C;  1CKN B;  1JE4 A;  4BA1 I;  4RA8 A;  5A35 A;  2C9O A;  2B39 A;  3TP5 A;  2CH4 A;  4OX9 L;  4DV2 L;  3K8A A;  1N36 L;  1X3F A;  3VA5 A;  5CBE E;  1ILP A;  5C44 H;  1DCZ A;  3T1H L;  5C4J B;  2MO1 A;  4LUZ A;  5ELO A;  4DNR B;  1AFP A;  4JI3 L;  1Q90 A;  1HRJ A;  3NQI A;  2IJ0 A;  1QB5 D;  1FNW A;  3VDY A;  3S24 A;  4KKS A;  3CPW A;  3OIQ A;  3V2T A;  1GHK A;  2R7D A;  1OXV A;  2MGS A;  1G6P A;  1ZEQ X;  4JV5 L;  4C3H G;  5M9O A;  2A74 C;  1PYW D;  1KL9 A;  4DV7 Q;  2K5N A;  2DY8 A;  5IP7 H;  3QB3 A;  2EY6 A;  1Q1B A;  1SN8 A;  4K6L A;  1VQM A;  3A8K E;  2NUC A;  1U4P A;  1XNR L;  3ZYY X;  4IPC A;  4FP5 D;  3GTJ B;  3S2D H;  2EVB A;  4JBW A;  1K8A C;  2R3Z A;  5EBD A;  1PH5 A;  5C3E B;  3K0Y A;  1SNM A;  5F2D A;  3VYS A;  5C0X G;  5IP9 G;  2A5H A;  2PO4 A;  5HGT A;  4JI0 Q;  1SNQ A;  1XTD A;  2A68 C;  1KNA A;  2MO0 A;  1AE2 A;  3A74 A;  2MNA A;  5IGB A;  1PZI D;  3M4Y A;  2VB3 X;  3KBG A;  3LWE A;  2VUM B;  1PRT C;  2AMC B;  2HHH Q;  1VQ5 A;  4B9W A;  3MAQ A;  3MTS A;  3NUC A;  5FJ8 H;  1D5X C;  1AN8 A;  4R1J A;  3ULJ A;  4DUY Q;  2AQ2 B;  2CFM A;  1GUT A;  1Y14 B;  1YJW A;  1TII D;  4DR1 Q;  4BY1 H;  1EYA A;  5BN3 A;  1I6V C;  2EDG A;  4JI2 Q;  4LF5 L;  1PTO F;  1SRU A;  3PIO A;  3KF8 B;  1W2B A;  1TS3 A;  1E2V A;  3HKZ B;  1H9J A;  1Q8K A;  2CW0 D;  2KCT A;  1E1O A;  1TU2 B;  2IL8 A;  1EWC A;  1CTM A;  4DPG A;  1F9S A;  2VQE Q;  3PF5 A;  1U9R A;  3I70 A;  3TQY A;  4UPA A;  3GTK B;  2F0M A;  2L11 A;  4GLX A;  4ZRZ A;  2YU9 H;  3I72 A;  2IW3 A;  4DK0 A;  2F0Q A;  1ML0 D;  1HXY D;  1PZK D;  3QR8 A;  2BDO A;  2NVT H;  2JP1 A;  2EYL A;  3IAY A;  5M5X B;  3G6J B;  5CC4 A;  2EIF A;  3CCQ A;  1XMO Q;  1PH7 A;  1VQJ A;  1JCK B;  1BQQ T;  1PTO D;  1M90 C;  1IBK Q;  3T56 B;  1VMC A;  1U4M A;  3OIP A;  5DLQ E;  4NMZ A;  1LTG D;  5C3E G;  1EZ8 A;  2F3V A;  3MC0 B;  1HCZ A;  5E1F A;  3J7Z C;  5C5L A;  2LFN A;  1SNO A;  1EUJ A;  4BBR H;  1CKM A;  5JJZ A;  3H3V H;  2F0O A;  4ODG A;  1CSP A;  4KK7 A;  2VUM G;  4DR2 L;  1QVC A;  3MXU A;  3W1G A;  1JWS D;  3GTQ H;  2L55 A;  1EIY B;  3MXG A;  3HS0 C;  4POF A;  1NAP A;  2K75 A;  3I4M B;  3VR3 A;  3NK9 A;  1C9O A;  1L2F A;  2PCF B;  3VYT A;  5AFW A;  1CQF A;  4A3B B;  1LO5 D;  2WKC A;  4RAU C;  5GAE C;  1WD1 A;  4FF3 A;  4RWS C;  1EEF D;  3ND8 A;  1SND A;  4ZUJ A;  2R7F A;  4ZK9 B;  3PCO B;  4FVM A;  1T5E A;  4PV1 C;  3HKZ G;  4HJ8 A;  4JI5 L;  3VR6 A;  3HOY B;  4I7A A;  3CCM A;  4OWT B;  3RD4 A;  4MN3 A;  5JEA J;  1EU3 A;  4C3H H;  1K8G A;  2A73 B;  3G4S A;  1SE3 A;  1PTO H;  2PW5 A;  4LWC A;  3TN2 A;  4X66 Q;  3BVG A;  3KK7 A;  4OO1 I;  5BN4 A;  2HHH L;  3CHB D;  4LFB Q;  1I4X A;  3BVM A;  1LAC A;  2F4I A;  4MTK A;  2PZU A;  4DR1 L;  1RCV D;  1MSH A;  5C0X H;  3FVQ A;  5IP9 H;  1OO9 B;  1VQE A;  3BVZ A;  5CMD A;  3AU7 A;  1XX8 A;  2FIN B;  2K5Q A;  4CDE C;  3BG3 A;  1XNQ Q;  1FL0 A;  3F2C A;  1I3Q B;  4EGV A;  5I9P A;  2WKD A;  1E3P A;  2O5I C;  1VS0 A;  1WTH A;  4PZ8 A;  1EOT A;  3GV3 A;  4IPG A;  4XYO A;  3D0F A;  2EYP A;  4JYA Q;  4UDU C;  1TWC B;  3WOE A;  2X6L A;  3NXW A;  2F3W A;  1EY8 A;  2MP1 A;  3NP8 A;  4CJ1 B;  1O7I A;  1DOK A;  2PMZ E;  2K28 A;  3TP6 A;  4ILW A;  3JAM L;  3D3R A;  5EBC A;  4B3T Q;  4OO1 G;  1EIH A;  1A3T A;  2AWO A;  4IOA A;  2X6G A;  4YWL A;  5C4J H;  1B4O A;  3EN2 A;  1DYQ A;  5LMN W;  1I4P A;  1VMP A;  3H0G G;  1B53 A;  4A3B G;  3CCS A;  1IYV A;  1JOK A;  4C3J H;  3CCE A;  5C6A A;  4DUZ L;  2CCZ A;  4B3M L;  2NVQ B;  1BNZ A;  5JOB A;  1QZG A;  1J8I A;  3J7A 5;  1UNS A;  2G9H D;  3KUP A;  4XTC S;  4AIM A;  3HOY G;  1J5E Q;  2ZJP A;  1LTL A;  5EPJ A;  2RCF A;  1QUQ A;  2NZO A;  2BDN A;  2XNA C;  1C8C A;  3RMH A;  1K83 H;  1ICW A;  1B2T A;  3JAM i;  1DXM A;  4KHZ A;  3EQL C;  3HOZ H;  4NP5 A;  5EKI A;  4YY3 Q;  1Y8P B;  2GN5 A;  2Q8R E;  2Y0S E;  1Q12 A;  5GQO A;  5C3E H;  1XXG A;  2OTL A;  1DM0 B;  1A3V A;  2QW7 A;  3D6W A;  4RKB A;  1V8Q A;  4I65 A;  3HG9 A;  1KDA A;  4ZQ3 A;  3S15 B;  2JA8 B;  4O2D A;  1V43 A;  2VUM H;  1S72 A;  1YNJ C;  2DNC A;  1BVS A;  4JI8 Q;  3E9H A;  1STN A;  3QG1 A;  4GOP B;  3ULL A;  2E74 C;  3SE0 A;  4HAE A;  1WTR A;  4JI7 Q;  2TMP A;  1Q81 C;  2EY1 A;  2K33 A;  2ZTE A;  4HMJ A;  2R7Z B;  4NXM Q;  2RHQ B;  1ET9 A;  1GUG A;  2M9V A;  3RLN A;  1II3 A;  1SYC A;  4DR5 Q;  2PZW A;  4O1N A;  1K8M A;  3RNU A;  1ET6 A;  4XT3 B;  4R4Q A;  1LTB D;  5LMU L;  3T1Y Q;  1K8O A;  3PUW A;  4U67 3;  1BBX C;  4FF1 A;  1W6J A;  2NBF A;  4R4O A;  5DM7 3;  5IGC A;  1XNQ L;  1CSQ A;  1SYB A;  2F52 A;  2F1M A;  4DR3 L;  2F0W A;  4DR7 Q;  1KAW A;  2Z0S A;  1R4P B;  4GLV B;  1ASY A;  4K14 A;  1BCP C;  4TKO B;  3HZX A;  4DV3 Q;  1CKN A;  3Q6S A;  4A3F G;  4JYA L;  4UP7 A;  4RGN A;  2IHF A;  2PNH A;  1SE2 A;  3FPP A;  4IUV A;  2F3I A;  4ZCK A;  5C44 B;  3HOU H;  1Q1E A;  2EY2 A;  2IX0 A;  1GKH A;  1EY0 A;  5JVH 3;  1RHP A;  3W2D A;  1TS4 A;  3U4V A;  1I5F A;  5CV6 A;  2E2D C;  1IL2 A;  4BA2 I;  1IXR A;  1SMY C;  3C1E A;  5J1Z A;  3J81 j;  1ILQ A;  2EYO A;  5JAV A;  2CVR A;  4N9T A;  3U4Z A;  3GTO H;  4WFN 3;  4A3E B;  5JPM C;  4OGQ C;  1RDP D;  4R4T A;  3W1B A;  4DV6 L;  1XPR A;  3J81 c;  3FEW X;  4ZKC B;  4H0L C;  3VA7 A;  2JA8 G;  1AP0 A;  5I9O A;  4Q5V A;  2DY7 A;  5IYD G;  3E3X A;  4MHE A;  3SK5 A;  1UE5 A;  3S2D B;  1HR0 W;  2BE5 D;  5DM6 3;  4OO1 H;  4Z9C B;  2F4V L;  1E0B A;  5COR A;  3K6O A;  3H0G H;  2ICI A;  1EFI D;  4XXE A;  1NMG A;  4UAI A;  5KGU A;  1AZP A;  2Z6B A;  4EQN A;  1RTO A;  1HTP A;  3UE0 A;  2V4D A;  1VQO A;  4ID6 A;  4OWX B;  2L0C A;  4DAY B;  4C2M B;  4UP9 A;  1NUC A;  4J15 A;  5IWA Q;  3AFP A;  4BY1 B;  5JJL A;  4QCL A;  2EXZ A;  4JI8 L;  1WYD A;  1EYD A;  3PUZ A;  5AJ3 L;  1JJC B;  2R92 G;  3H6M A;  4HJ7 A;  3MVV A;  2ZXR A;  3KF8 A;  4LFC Q;  1Q7Y C;  1N32 L;  1AW7 A;  4KHP Q;  1EY6 A;  4ZYS A;  3K5M A;  1PH4 A;  1N33 Q;  2Y0S B;  4A3D B;  1V9P A;  4XQN A;  3EA6 A;  4AQY Q;  2ID0 A;  2NN6 I;  1S5F D;  4IAL A;  3T1Y L;  4B9X A;  1LT6 D;  3L2P A;  3U58 A;  2HT1 A;  2LKV A;  4A3E G;  1LTA D;  4LF4 L;  3DM3 A;  3MZ5 A;  5CV5 A;  5GAD C;  4BXX G;  2LS0 1;  2A69 D;  1GJX A;  3E9I A;  3FDT A;  4F8M A;  2PPB C;  4DR7 L;  4HJ9 A;  4QUF A;  4X65 L;  4DV3 L;  4JI3 Q;  3IFT A;  4X62 L;  3K58 A;  4A3K H;  1DZ1 A;  2EJM A;  1FYC A;  1LLR D;  4F88 A;  1Y1V H;  4X3K A;  1YIJ A;  1YNN D;  4IN3 A;  1B50 A;  1WCM G;  2EJF C;  1C4Q A;  3CCL A;  3QOJ A;  2YTY A;  3UDG A;  4FYD A;  1UE6 A;  2OTJ A;  4BBR B;  3RZD H;  4H7B A;  3A5Z B;  1S4Z A;  2K05 A;  1TKW B;  2HDM A;  1XNR Q;  1LT4 D;  3G7L A;  4A3F H;  3GTQ B;  4JI1 Q;  1ENC A;  4JBM A;  2KCM A;  5FJ8 G;  1AE3 A;  3RR5 A;  4B3S Q;  3J80 i;  4EX5 A;  5H1S E;  1WTX A;  1ONL A;  5GRO A;  3MWY W;  3HKZ E;  4JOI C;  4QB4 A;  3SHL A;  2KHS A;  3LNN A;  2M00 A;  1G2S A;  3E0J A;  1NSN S;  4OIJ A;  3BDL A;  1D5M C;  1IZ6 A;  3H09 A;  1XMQ L;  2A6H D;  4P72 A;  2ZXP A;  4C3H B;  4A3D G;  2ES2 A;  3PGZ A;  1KDB A;  5TSS A;  4POG A;  4DGZ A;  1KHI A;  1H9K A;  5BR8 Q;  2EYH A;  3S1Q H;  3GO5 A;  3I7F A;  5IYD H;  4JOI A;  2FMC A;  4HCE A;  1QE6 A;  1EIF A;  1Y1W B;  2B8G A;  1NR4 A;  5I6Y A;  1HA5 A;  1SJE D;  4DK6 C;  5LMN L;  5IWA L;  4R4C A;  4L5S A;  2BA1 A;  1VF7 A;  1W6K A;  2KBN A;  1CZG A;  2UUA Q;  1S5D D;  1MJE A;  2HDL A;  1VQ8 A;  5D3D A;  3CP0 A;  4ZAI A;  1CHQ D;  2A6E C;  3NPP A;  2IHE A;  1JQY D;  3F2D A;  5EKK A;  4DR4 L;  1PYB A;  4B08 A;  2UUB Q;  4DF7 A;  2EXD A;  4EQP A;  1CA6 A;  4TSS A;  1SLJ A;  4ME5 A;  5LL6 S;  4BBR G;  2WV6 D;  4AQY L;  3HOV H;  2R61 A;  3KLW A;  2JA7 G;  4AYB G;  2MQH A;  4S3S A;  5IIF A;  4PNY A;  1HJP A;  1SE8 A;  1HQR D;  5IGE A;  4FF2 A;  2R92 H;  1UWV A;  2J7Z A;  5JJI A;  1HZC A;  1HFG A;  1U5K A;  5M3M B;  2DGY A;  4KY7 A;  1H9M A;  1NNX A;  1AEX A;  1OXT A;  4N9P A;  4R4I A;  4IJL A;  5G3L D;  4C3J B;  3MXP A;  4CBV A;  2YTX A;  3ITP A;  2RDH A;  4HIK A;  5IYB G;  4A3E H;  4HIM A;  4DR2 Q;  1STB A;  1A8V A;  4BXX H;  1O80 A;  1FJG Q;  5E4W C;  3X3N A;  5IY0 A;  3WOF A;  2D2C C;  4IFD J;  3K57 A;  3PUV A;  4RGT A;  4A3L G;  2F0J A;  2F0E A;  1A6X A;  1VQA A;  3OW7 A;  2VW9 A;  1X32 A;  4KD4 A;  1K83 B;  1LAB A;  3MEH A;  4A75 A;  4G57 A;  1Y1W G;  2NB0 A;  3E5S A;  3GV6 A;  4JI1 L;  3HOZ B;  1N34 L;  3GQB A;  1B3A A;  1K3R A;  4GOP C;  1JOR A;  1YVC A;  2QF7 A;  4B3S L;  1CZW A;  3BJU A;  2D9U A;  1WCM H;  4JI5 Q;  2I0Q A;  4K8J A;  4DXF A;  1MD2 D;  5ELB A;  5ISR A;  3M4O B;  2KHI A;  1YHA A;  2MUY A;  3MHB A;  1O7Z A;  4HN7 A;  1SRO A;  5C3W A;  4G7Z C;  4P74 A;  5EQ0 A;  3C2P A;  5C5M A;  1STH A;  3IFD A;  1FGU A;  4C2M H;  4YHH Q;  1Y8O B;  1TWA H;  5IGG A;  1D6E C;  4GOP A;  2RVL A;  4AH6 A;  2QIL A;  5BR8 L;  1P8L A;  1I94 Q;  1MGS A;  1CI3 M;  2ZT9 C;  3TP8 A;  5K5P A;  2F0V A;  2PW7 A;  4ZUI A;  3KJP A;  1YHB A;  1PYS B;  3UI2 A;  2R6G A;  2D0P A;  3KF6 B;  1V1Q A;  1GUS A;  2I5M X;  1IL8 A;  3QWN A;  2IX1 A;  3L9A X;  1VQ9 A;  5M3M G;  1EQR A;  4J8Q A;  1OXS C;  2UUA L;  2YV5 A;  1VQB A;  1UEA B;  3CMA A;  4C3J G;  4A3D H;  2D5D A;  4DFA A;  1TY0 A;  3TP7 A;  1NMF A;  2SOB A;  4KJO A;  1HR0 L;  4IPD A;  1F2M A;  2UUB L;  3S16 H;  4K2K A;  5IOC A;  1SXT A;  1H9S A;  1PH2 A;  2F0D A;  2I5H A;  3CC2 A;  2CH4 W;  2F0T A;  4DNT B;  3HOU B;  4OEM B;  2D0O A;  1HTL D;  3JAM c;  1IBL L;  1Z9F A;  3U9S A;  1PH1 A;  2L12 A;  4LF7 L;  4KKT A;  3HOZ G;  3CU7 A;  4A3J H;  4Y7N H;  4DUZ Q;  2YYZ A;  3S14 B;  3GTG B;  4B3M Q;  2ZJQ A;  4EVO A;  3GTO B;  3MEF A;  1EY4 A;  4HSV A;  3R3O A;  4N8F A;  1DD2 A;  2ZXO A;  2JA7 H;  3OSO A;  2V1C C;  4G7O C;  1HZA A;  3S2H H;  1EWI A;  2F0P A;  1Q8I A;  4IUQ A;  1WTO A;  1FJG L;  2LMC B;  5JPN C;  2QEJ C;  2R93 H;  5CBA E;  2E2H H;  3GP7 A;  4X3S A;  1SMX A;  2F0K A;  2PI2 E;  1NTG A;  4L5Q A;  4QL5 A;  4PZ7 A;  3H0G B;  3R2I A;  2MPM A;  3TS2 A;  3SR1 A;  4UY8 C;  1SDF A;  1ZYR D;  1EYG A;  3Q22 A;  1VCI A;  2KEE A;  5J3B A;  3J81 E;  2WIN B;  5IYB H;  4JI4 L;  5D14 A;  2JYO A;  2XWJ B;  4X6A H;  1STA A;  2QDL A;  3KLS A;  1EQV A;  1DJR D;  2F0L A;  4DAY A;  4RHS A;  1M4V A;  1YNJ D;  3URY A;  4A3L H;  3S17 H;  2UUC L;  4GKJ L;  5J22 A;  5C4X B;  3A8J E;  2Q8I B;  1Y1W H;  1B44 D;  2JA5 B;  2QEX A;  4YHH L;  1I4G A;  1TWG H;  4L5T A;  1JT8 A;  1L1O C;  3VR4 A;  5FO9 B;  1I94 L;  3HOU G;  5LMU Q;  1XWE A;  3I91 A;  2YTV A;  4DV1 L;  2RHS B;  2JN4 A;  1IW7 D;  3HOW G;  1FD7 D;  4QQB X;  3LX0 A;  1N9W A;  1EL0 A;  4DR3 Q;  2K5H A;  2ZTD A;  2AUK A;  2I5L X;  1E2W A;  2B2V A;  3U50 C;  1BF4 A;  1WOC A;  1KLG D;  1UEB A;  3O13 A;  3G6E A;  1GUN A;  1L1O A;  4DK3 C;  1UUP A;  1A63 A;  1CKO A;  4RMF A;  3L3O C;  3TME A;  3I8Z A;  3NBH B;  2L5T A;  1K0R A;  3A7A B;  1YHQ A;  4WJ3 M;  4G4K A;  3FPU B;  3OW2 A;  3CPF A;  1KQS A;  1FR3 A;  5JJK A;  3ONA B;  2CW0 C;  1IYU A;  1HHV A;  4A3K B;  1PV4 A;  2RSO A;  4EQO A;  1VQG A;  1M8A A;  3CME A;  1YI2 A;  4MTN A;  1J9O A;  4X3U A;  1J6Q A;  5M3M H;  1Y1V B;  3GDE A;  5CV9 A;  3UE1 A;  2XSC A;  3SK6 A;  1HNZ L;  1BOS A;  2F03 A;  1EY5 A;  4Y52 H;  3N52 A;  4JBJ A;  4ZKB B;  2L9H A;  4DV6 Q;  3OPO A;  4QUC A;  3BZK A;  4GZY C;  4O0A A;  5KYL A;  3RZD B;  4RGO S;  2XGT A;  3PUY A;  4FXK C;  5L37 A;  2VNU D;  1PFM A;  4LW1 A;  3B6Y A;  2PYK A;  1F9Q A;  3G48 A;  2CWP A;  1YZ6 A;  4A3F B;  1D2B A;  2VB2 X;  3J7Y W;  3PMF A;  2F4V Q;  1PTO C;  1QZH A;  3NTK A;  3PO3 G;  4WJW A;  2EPB A;  5C4X G;  4KLK A;  3SGI A;  3STB C;  1F2L A;  2JA5 G;  3KOJ A;  4A3G G;  1I4H A;  5EAY A;  1YEZ A;  3CF5 A;  4IPH A;  3CQZ H;  5FK9 C;  2Q2U A;  3I4N G;  4YCU A;  2XIW A;  1E1T A;  4LUO A;  3M4O H;  2UXB L;  1RF2 D;  3KLS X;  4A3C H;  1KDC A;  4C1N K;  4GKK L;  3S1Q B;  5ELN A;  2HIX A;  1PHJ A;  1Q82 C;  4NPS A;  5AJ3 Q;  1PDQ A;  4FXG C;  3ULP A;  2VL6 A;  1WTV A;  3X3M A;  3NWT A;  1TQO A;  1N32 Q;  2F0U A;  2GVB A;  4X3T A;  2QDB A;  4DXG A;  4A3K G;  1YIT A;  2L1B A;  1R9T H;  4HJ5 A;  3IRB A;  2WB1 G;  1WTQ A;  3UDF A;  1Y1V G;  1Y69 U;  4AYB E;  4HID A;  4LF4 Q;  3NEN A;  2AQ3 B;  1CM9 A;  2L4N A;  4K5V A;  2OCE A;  3HGB A;  3KDF A;  5KEE A;  1MIU A;  5JEA H;  2UXC L;  3HOV B;  4N8X 1;  5T1I A;  4A3M G;  1WJJ A;  4JVZ A;  4X65 Q;  1B8A A;  5EKL A;  4X62 Q;  2R92 B;  3J80 c;  2Z1C A;  3DEP A;  2DNE A;  2ATW A;  2Z8L A;  1PLF A;  2OT2 A;  4M8A A;  1FVI A;  5BN5 A;  1LTI D;  4F7X A;  1AH9 A;  1JC7 A;  3KLR A;  4CKE A;  3QJY A;  5DNF A;  3HOW H;  4LK1 C;  3OWF A;  3S14 H;  3GTG H;  4OHJ A;  2B8F A;  4DV4 L;  2VXW A;  4DV5 L;  1KIX A;  1JWU D;  1EWH A;  1SEB D;  3NQT A;  1EY9 A;  2KA7 A;  2O5J C;  1SYE A;  1G8Z D;  3ER0 A;  1VQ7 A;  2OWO A;  1IHZ A;  2NVX H;  1EFW A;  2PQA B;  1NCV A;  2D62 A;  3CRL C;  3BZC A;  2XWB B;  2E2J H;  3S1N B;  1G2T A;  2ICE C;  1PA6 A;  2DJG C;  3NSW A;  2PQE A;  1LT5 D;  1WCM B;  4PQX A;  4QF4 A;  1XMQ Q;  1PMR A;  3GD7 A;  4H02 A;  3E6Z X;  2M2L A;  4UHV A;  3M85 A;  2JSO A;  2AKW B;  1X55 A;  2K5V A;  5LL6 X;  1G6Z A;  4KV6 A;  1IKM A;  4I7Z C;  5COY A;  3IKJ A;  1CQV A;  1F77 A;  3A0J A;  4BBS H;  1TWA B;  3NE5 B;  1Z47 A;  4LAA A;  3HOV G;  4WRD A;  2AWN A;  5LMN Q;  1M1K C;  3PO3 H;  1IYJ B;  2K52 A;  3TZU A;  5C4X H;  2LXK A;  4CHT B;  5J39 A;  1KAB A;  3CCU A;  2Z4H A;  2JA5 H;  1Y8N B;  2VQF L;  1WFQ A;  3V96 A;  4A3G H;  4F87 A;  3CRK C;  2UU9 Q;  4BWG B;  3OTO L;  4LF9 Q;  3KF6 A;  5ELE A;  2SEB D;  3OMG A;  4XT1 B;  3I4N H;  2E5L Q;  3S1M H;  5K36 H;  1OXU A;  2A6E D;  4DR4 Q;  3A8I E;  2KEC A;  3ERO A;  1BR9 A;  2RF4 A;  2KJX A;  3AFQ A;  1AZQ A;  3W3A A;  1TWH H;  1XJV A;  1ENA A;  2VY3 A; 
#chains in the Genus database with same CATH homology
 2VUM G;  4ALP A;  2HIV A;  4DR2 L;  3EIV A;  1QVC A;  1OXT A;  2WAQ E;  4R4I A;  4IJL A;  3W1G A;  3GTQ H;  3LGJ A;  1EIY B;  4POF A;  2K75 A;  1EQQ A;  3H15 A;  2YTX A;  1L0W A;  2CWA A;  3K80 C;  4QGU A;  1C9O A;  1L2F A;  4HIK A;  4P73 A;  5IYB G;  4A3E H;  4HIM A;  1E7Z A;  1YBY A;  1A8V A;  4DR2 Q;  1MKH A;  2UXD L;  4BXX H;  5GAE C;  1FJG Q;  5IY0 A;  4IFD J;  4JC0 A;  4A4I A;  1E22 A;  5IT9 c;  3PUV A;  2R7F A;  4A3L G;  3PCO B;  2JK8 A;  4X66 L;  3RN5 A;  5M5W H;  1VQA A;  3HKZ G;  4GNX C;  4JI5 L;  4HJ8 A;  4TQU S;  2VW9 A;  4LFB L;  2Q2H A;  3CCM A;  2K4K A;  4OWT B;  5JEA J;  4A75 A;  1K8G A;  4C3H H;  1Y1W G;  4P71 A;  4JI1 L;  3G4S A;  2RCN A;  1N34 L;  1VQN A;  4DR6 L;  1K3R A;  4OWW B;  4GOP C;  3L7Z C;  4LWC A;  1PH8 A;  1YVC A;  4B3S L;  4K0K L;  4X66 Q;  3BJU A;  1WCM H;  4JI5 Q;  2I0Q A;  3HFZ B;  1X54 A;  4A3M H;  3I4O A;  4OO1 I;  2HHH L;  2ALY B;  4LFB Q;  2NN6 G;  2N78 A;  1VQ6 A;  2KHI A;  2JQO A;  1VQD A;  1YHA A;  1N34 Q;  3GTK H;  1NE3 A;  4DKA C;  4DR1 L;  4GNX A;  2HQL A;  1SRO A;  5IP9 H;  1PVO A;  1VQE A;  4P74 A;  4A3I G;  1KC8 C;  2JE6 I;  4HJA A;  2B3G A;  1NBW A;  1FGU A;  4C2M H;  1XNQ Q;  5E7N A;  4YHH Q;  5M5X H;  1FL0 A;  3F2C A;  1TWA H;  4GOP A;  1QVF A;  2C35 B;  4AH6 A;  1X3G A;  1UE1 A;  5BR8 L;  1A0I A;  1E3P A;  1P8L A;  3FKI G;  1I94 Q;  1VS0 A;  2E2I H;  4PZ8 A;  2WFW A;  4A76 A;  1PH9 A;  3NEM A;  4APV A;  4IPG A;  1YHB A;  5HGQ A;  3KJP A;  3D0F A;  3CW2 C;  4JYA Q;  1PYS B;  4B3R Q;  2K14 A;  2R6G A;  1NJI C;  1HNX Q;  2D0P A;  4B3T L;  3KF6 B;  1V1Q A;  3OYY A;  3HOX G;  2I5M X;  3FKI H;  2IX1 A;  1VQ9 A;  4QIW E;  5M3M G;  1EQR A;  1O7I A;  1OXS C;  2UUA L;  1GVP A;  2PMZ E;  2OQK A;  2NVY H;  2YV5 A;  1VQB A;  3CMA A;  4GLA C;  3HOX H;  4A3D H;  3HKS A;  3WWV A;  1X3E A;  4B3T Q;  4OO1 G;  1NMF A;  1RIP A;  1E24 A;  2AWO A;  4IOA A;  2DGY A;  4YWL A;  5C4J H;  1YNX A;  3EN2 A;  1D7Q A;  5LMN W;  2FXQ A;  2N49 A;  1J5E L;  3H0G G;  1HR0 L;  4IPD A;  4A3B G;  5GAH C;  3CCS A;  2UUB L;  3S16 H;  1U0L A;  4C3J H;  1X65 A;  1TWH H;  3CCE A;  4LFA Q;  1X56 A;  4DUZ L;  3I4M H;  2CCZ A;  1PH2 A;  1XJV A;  5FLM H;  1Q82 C;  2I5H A;  3CC2 A;  4A3J G;  2UU9 L;  4B3M L;  4BY7 H;  4LF9 L;  3ICE A;  1B7Y B;  1QZG A;  5M3F H;  1UE7 A;  2R7Z G;  2WAQ G;  2JA6 G;  2D0O A;  2E5L L;  1IBL L;  3JAM c;  5IYC H;  4XTC S;  4AIM A;  3HOY G;  3J7A 5;  3KFU A;  1JJ2 A;  4A3B H;  1Z9F A;  1J5E Q;  4A93 G;  1PH1 A;  4YY3 L;  2EQS A;  2ZJP A;  1HR0 Q;  4LF7 L;  1LTL A;  3I55 A;  3PO2 G;  3HOZ G;  4YWM A;  4Y7N H;  4DUZ Q;  2YYZ A;  4A3J H;  4IFD I;  5IE8 A;  1YJN A;  4B3M Q;  2ZJQ A;  1QUQ A;  2NZO A;  3HOY H;  1SR3 A;  3PIP A;  1K83 H;  1IBL Q;  2DUD A;  3MEF A;  3JAM i;  3PO2 H;  4KHZ A;  2Z6K C;  1GO3 E;  3HOZ H;  4IOC A;  3K7A H;  4YY3 Q;  4LF7 Q;  1B70 B;  2GN5 A;  4OXP A;  2Y0S E;  3PUX A;  1Q12 A;  3PV0 A;  2JA7 H;  5GQO A;  2R93 G;  4JI6 Q;  3ERS X;  5C3E H;  2OTL A;  1GM5 A;  2B63 H;  2V1C C;  1S40 A;  1HZA A;  3S2H H;  4PZ6 A;  1EWI A;  4LF6 Q;  1G51 A;  4NXN Q;  1FJG L;  4YWK A;  4JI7 L;  1OXX K;  2R93 H;  4GNX B;  5C44 G;  4O2D A;  1V43 A;  2E2H H;  2JEB I;  1SMX A;  5FLX c;  4NXM L;  2VUM H;  1S72 A;  2PI2 E;  1NTG A;  4GN3 B;  4L5Q A;  1XPU A;  4QL5 A;  4PZ7 A;  1BVS A;  3W5O A;  2Z6K A;  4JI8 Q;  1KD1 C;  3E9H A;  4DR5 L;  5C0X I;  3TS2 A;  4GOP B;  3ULL A;  4MZ9 A;  1I3Q H;  4UY8 C;  3PF4 A;  3BU2 A;  4JI7 Q;  1EYG A;  3M4P A;  1Q81 C;  4IJH A;  3TRZ A;  3CC4 A;  1VCI A;  2LXJ A;  2ZTE A;  5J3B A;  3UDX A;  5IYB H;  4JI4 L;  4IFD G;  4NXM Q;  4X6A H;  1T9H A;  3K0X A;  2RHQ B;  3UDI A;  4WJ4 A;  1EOV A;  1MJC A;  1L1O B;  3RLN A;  1TWC H;  3CAM A;  3AEV A;  4DR5 Q;  4OX9 Q;  4DV2 Q;  1N36 Q;  1ASZ A;  4A3L H;  3JC6 6;  3RNU A;  3RLF A;  5IP7 G;  3S17 H;  3S1N H;  1TXY A;  4R4Q A;  5LMU L;  2CKZ B;  3T1Y Q;  2UUC L;  3T1H Q;  1VQ4 A;  4GKJ L;  1VQF A;  3F8T A;  3PUW A;  3CCJ A;  1PH6 A;  1KXL A;  3RZO H;  4JI4 Q;  1HNW L;  4R4O A;  1Y1W H;  1XNQ L;  1JMC A;  2QEX A;  4YHH L;  1TWG H;  4L5T A;  1CSQ A;  1JT8 A;  3RN2 A;  2F52 A;  1L1O C;  4DR3 L;  2N8N A;  4DR7 Q;  3S1R H;  1KAW A;  1PFS A;  2Z0S A;  1I94 L;  3HOU G;  5LMU Q;  2UUC Q;  4GLV B;  1LYL A;  1ASY A;  4GKJ Q;  2YTV A;  1JJG A;  3TRE A;  4DV1 L;  4DV3 Q;  2RHS B;  4YCW A;  1CKN A;  4JV5 Q;  4A3F G;  5C0X J;  4JYA L;  1HNW Q;  4B3R L;  1HNX L;  2NZH A;  3HOW G;  2NVQ H;  2JJQ A;  3K81 C;  4UP7 A;  4QQB X;  4JCV E;  1VQH A;  2IHF A;  1N9W A;  2PNH A;  4YCV A;  3F1Z A;  2F3I A;  4DR3 Q;  3HOU H;  1Q1E A;  2K5H A;  2ZTD A;  2IX0 A;  4X64 Q;  1GKH A;  2WB1 E;  2I5L X;  1P16 A;  1W3S A;  4A3I H;  2WP8 J;  4GS3 A;  2KHJ A;  3U50 C;  3U4V A;  1I5F A;  2BH8 A;  1WOC A;  4GN4 B;  1G29 1;  1HZ9 A;  4DV1 Q;  1IL2 A;  3E0E A;  1UEB A;  1IXR A;  4BA2 I;  3G6E A;  1C0A A;  1L1O A;  4DK3 C;  3I2Z A;  3J81 j;  1CKO A;  1QVG A;  1IBM L;  1QUQ B;  1A63 A;  4LF8 Q;  2VS1 A;  4DV0 Q;  2JA9 A;  4RMF A;  4BY1 G;  3U4Z A;  3GTO H;  3NBH B;  2PI2 A;  1K0R A;  1YHQ A;  4WJ3 M;  1JB7 A;  1HH2 P;  1HZB A;  4R4T A;  3CPF A;  3W1B A;  3OW2 A;  1S3O A;  4DV6 L;  1KQS A;  5JJK A;  1XPR A;  5GAG C;  3J81 c;  4LFA L;  2E8G A;  5M5Y H;  1PV4 A;  1C7Y A;  1VQG A;  4ME3 A;  3CME A;  1YI2 A;  1VQC A;  2JA8 G;  4MTN A;  4LNQ A;  1IBM Q;  1J6Q A;  5M3M H;  4PMW A;  3GDE A;  3UE1 A;  1X6O A;  1HNZ L;  3CD6 A;  5IYD G;  4Y52 H;  4JBJ A;  3H3V I;  1UE5 A;  2Y0S G;  4DV6 Q;  1HR0 W;  3BZK A;  3A5U A;  4O0A A;  3S15 H;  2JA8 H;  5HY6 A;  3J81 i;  1N36 L;  1VQL A;  4GN5 A;  2F4V L;  1BBU A;  3F2B A;  3GTL H;  3CCR A;  3PSI A;  3FHW A;  1VQK A;  2XGT A;  4RG1 A;  3PUY A;  2GVA A;  2VNU D;  4LW1 A;  3B6Y A;  1HNZ Q;  3H0G H;  2ASB A;  4EQ5 A;  3G48 A;  2ZJR A;  2CWP A;  4LF5 Q;  1YZ6 A;  2ZM6 L;  2OQ0 A;  4L5R C;  2A19 A;  1NMG A;  3M9B A;  2CQO A;  3RLO A;  2KEN A;  1X9N A;  3CXC A;  1DGS A;  4JI6 L;  2F4V Q;  1K73 C;  3AQQ A;  1QZH A;  4KI0 A;  3UE0 A;  2R7Z H;  2JA6 H;  3PO3 G;  3G71 A;  5C4X G;  1CUK A;  1VQO A;  4LF6 L;  4KLK A;  1SFO H;  4OWX B;  4A93 H;  3SGI A;  4DAY B;  2QA4 A;  4NXN L;  3STB C;  1N8R C;  2JA5 G;  1PHJ A;  3KOJ A;  2MFI A;  2ZM6 Q;  4A3G G;  4LFC L;  4PG3 A;  4DAM A;  1I6H H;  5EAY A;  1KRS A;  4UP9 A;  1YEZ A;  4A3C G;  3CF5 A;  2B29 A;  4J15 A;  1BKB A;  4IPH A;  3CQZ H;  3KYH C;  5IWA Q;  3AFP A;  4KHP L;  2Q2U A;  3I4N G;  4YCU A;  3MXN B;  1N33 L;  4MNO A;  5JJL A;  3KDF B;  4JI8 L;  1E1T A;  2PQA A;  1WYD A;  4LUO A;  3PUZ A;  5AJ3 L;  1JJC B;  3M4O H;  2R92 G;  4HJ7 A;  2UXB L;  2N3S A;  4A3C H;  2LSS A;  3STB D;  4LFC Q;  1Q7Y C;  1N32 L;  1YJ9 A;  4KHP Q;  4QY7 A;  4GKK L;  1CKN B;  4BA1 I;  1PH4 A;  4C3I H;  1N33 Q;  5ELN A;  2HIX A;  2IY5 B;  4OX9 L;  1V9P A;  2ZTC A;  3K8A A;  1X3F A;  4NPS A;  5AJ3 Q;  4DV2 L;  3TS0 A;  3ULP A;  1VQP A;  2VL6 A;  2A1A A;  4AQY Q;  2ID0 A;  3NEL A;  5C44 H;  2UXB Q;  2NN6 I;  3T1Y L;  2AHO B;  3T1H L;  2MO1 A;  4LUZ A;  5ELO A;  3L2P A;  3U58 A;  2Q2T A;  1N32 Q;  2HT1 A;  4JI3 L;  4A3E G;  4LF4 L;  4XIG S;  3DM3 A;  2GVB A;  4GKK Q;  5GAD C;  4BXX G;  4DV7 L;  4TVA B;  4A3K G;  1YIT A;  3VDY A;  1R9T H;  1TWF H;  3E9I A;  4HJ5 A;  3IRB A;  4DR7 L;  3S24 A;  2BA0 A;  2WB1 G;  3UDF A;  1BBW A;  5JEA G;  3CPW A;  1Y1V G;  4HJ9 A;  2R7D A;  3Q8D A;  1OXV A;  3FP9 A;  4AYB E;  4HID A;  4X65 L;  4DV3 L;  4HIO A;  4JI3 Q;  4LF4 Q;  3NEN A;  1G6P A;  4JV5 L;  4LUV A;  4X62 L;  4A3K H;  2OCE A;  1KL9 A;  1WI5 A;  3KDF A;  1PH3 A;  1D8L A;  4DV7 Q;  2K5N A;  3I56 A;  5IP7 H;  1JE5 A;  1MIU A;  2UXC L;  1Y1V H;  3KJO A;  1Q1B A;  1SN8 A;  1YIJ A;  1VQM A;  4X64 L;  1WCM G;  1XNR L;  4OON A;  4A3M G;  1WJJ A;  1LUZ A;  4IPC A;  3CCL A;  4JI0 L;  2YTY A;  3UDG A;  3S2D H;  2UXD Q;  1UE6 A;  4X65 Q;  2OTJ A;  1B8A A;  4JBW A;  3EBE A;  4X62 Q;  1K8A C;  3RZD H;  3J80 c;  4LF8 L;  3A5Z B;  4DV0 L;  4BY7 G;  1PH5 A;  4QJF A;  2ATW A;  5C0X G;  2QGQ A;  5IP9 G;  2UXC Q;  4BBS G;  1FVI A;  1XNR Q;  4JI0 Q;  4NB3 A;  1I50 H;  4A3F H;  1AH9 A;  3CCV A;  4DUY L;  4JI1 Q;  4JBM A;  3HOW H;  1XTD A;  2MO0 A;  4DR6 Q;  2KCM A;  5FJ8 G;  1AE2 A;  3D31 A;  3A74 A;  2MNA A;  1AE3 A;  3RR5 A;  4DV4 L;  3GTG H;  3S14 H;  4B3S Q;  4K0K Q;  3J80 i;  4EX5 A;  4DV5 L;  5H1S E;  1KIX A;  2JEA I;  5GRO A;  4IO9 A;  3HKZ E;  2AMC B;  4JI2 L;  2A8V A;  2HHH Q;  4JOI C;  1RL2 A;  1VQ5 A;  2L15 A;  1K9M C;  5FJ8 H;  4R1J A;  3ULJ A;  4DUY Q;  1VQ7 A;  3ER0 A;  2CFM A;  1YJW A;  1Y14 B;  4DR1 Q;  4DV4 Q;  2OWO A;  4BY1 H;  3DLL A;  2IT1 A;  3M7N A;  4JBK A;  4DV5 Q;  2NVX H;  1EFW A;  2PQA B;  1IZ6 A;  1XMQ L;  2D62 A;  1KRT A;  4JI2 Q;  4P72 A;  2VQE L;  4LF5 L;  1LM0 A;  1SRU A;  3K7U C;  3BZC A;  3PIO A;  2K50 A;  4UP8 A;  3KF8 B;  4A3D G;  2ES2 A;  3CC7 A;  1W2B A;  2Q2I A;  3PGZ A;  2E2J H;  4POG A;  1KHI A;  5BR8 Q;  3M3Y H;  1PA6 A;  1Q8K A;  2KCT A;  1E1O A;  2VZA A;  3GO5 A;  3I7F A;  4DNI A;  3S1Q H;  3GTM H;  5IYD H;  4JOI A;  4DPG A;  1XMQ Q;  1EIF A;  3GD7 A;  4H02 A;  2VQE Q;  3PF5 A;  3I4M G;  3L0O A;  5FLM G;  1GD7 A;  3TQY A;  4UPA A;  2BH2 A;  4DK6 C;  3M85 A;  5LMN L;  2YU9 H;  4GLX A;  5IWA L;  4R4C A;  2AKW B;  1OTC A;  2BA1 A;  1X55 A;  2KBN A;  2XTI A;  5M3F G;  4L5S A;  2K5V A;  1XMO L;  5IYC G;  2UUA Q;  1MJE A;  1VQ8 A;  2NVT H;  1IBK L;  3CP0 A;  3TEH B;  4JG2 A;  2H5X A;  3ZJY C;  3A0J A;  4BBS H;  2EIF A;  1Z47 A;  3AYH B;  3CCQ A;  3HOV G;  2IHE A;  2AWN A;  5LMN Q;  1M1K C;  3F2D A;  1IYJ B;  2K52 A;  3PO3 H;  5C4X H;  4DR4 L;  2LXK A;  1XMO Q;  1PH7 A;  1PYB A;  1VQJ A;  2UUB Q;  3CCU A;  2EXD A;  5K36 G;  1NY4 A;  1H95 A;  2JA5 H;  1M90 C;  1SLJ A;  1WFQ A;  2VQF L;  1IBK Q;  1Q46 A;  4A3G H;  4BBR G;  4AQY L;  4FDB A;  2UU9 Q;  3OTO L;  3HOV H;  1VQI A;  3KF6 A;  3KLW A;  5DLQ E;  4LF9 Q;  2JA7 G;  4AYB G;  5C3E G;  2B63 G;  2MQH A;  3I4N H;  4P75 A;  1XPO A;  2E5L Q;  3GTP H;  1Q86 C;  3S1M H;  3GTJ H;  3M4Q A;  3J7Z C;  1OXU A;  4DR4 Q;  1HJP A;  1EUJ A;  1SE8 A;  4BBR H;  2R92 H;  1CKM A;  1UWV A;  2VQF Q;  2RF4 A;  1A62 A;  1HZC A;  3H3V H;  5JJI A;  3AFQ A;  1CSP A;  1U5K A;  3OTO Q;  2VY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...