4X64Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x64Q00
1SE8A 3JC66 1OXUA 5LMNQ 1HNXQ 4YY3Q 4JC0A 5IWAQ 3TRZA 1V9PA 1PH2A 2KHJA 3F2DA 4A3FH 1G291 1X9NA 1X54A 1KQSA 4DR4L 4ME3A 2AHOB 4DNIA 4NXMQ 4P72A 4PZ6A 1TWAH 1WOCA 4K0KL 4DUYL 3KJOA 1X6OA 1JJCB 1EOVA 4NXNL 4ALPA 3M85A 1LTLA 2WB1G 3CCVA 1VQLA 1EIYB 3K80C 3ULJA 1T9HA 4LUOA 1NMGA 3OTOL 2JEBI 3NBHB 2LXJA 1L1OB 3HFZB 4IOCA 1VQ5A 3TS2A 4BBSH 4DV4Q 2F4VL 4KHPQ 4JBKA 4A3LG 3TREA 2ALYB 4DAYB 4BY1H 3KF8B 4WJ4A 1Y14B 5IYCH 1P8LA 3GO5A 4R4QA 1I94L 1X3GA 2JJQA 5C44G 3HOYH 5BR8L 1UE1A 3HOWG 2NVYH 2KENA 1XJVA 1C7YA 1CUKA 3RLNA 2HIXA 5JJKA 5JEAJ 1YBYA 1Q82C 1EYGA 1SFOH 1GM5A 3U4VA 4Y52H 2VQEL 4DR6Q 3U58A 3HOZG 4IFDJ 2BH2A 1A0IA 4AH6A 4DV6L 5M3FG 1MJCA 3F2CA 4HJ9A 3FP9A 1VQPA 4DR5L 2KCTA 3S1RH 3RZOH 4X6AH 2BA1A 3GTKH 3I2ZA 1E22A 4FDBA 1C0AA 4DV0L 2UUBL 3CCEA 1AE3A 2RHSB 3HOZH 2ZTCA 2OQKA 4JI3Q 1NE3A 4IJLA 2KBNA 1PYSB 4A3KG 2UXDQ 1KL9A 2MNAA 2ZJRA 5M3MG 3TEHB 1V43A 1K8GA 4LNQA 4OO1I 2UUAQ 4JI5Q 2JE6I 4OX9L 2Q2HA 4LW1A 4JI6L 1VQEA 5FLMH 1EFWA 2UUAL 3KFUA 5ELNA 5C0XG 1JT8A 3PUWA 2PQAB 4X64Q 1I5FA 4DV3Q 4GOPC 1PH5A 1VQIA 2UXBL 2OTJA 3I7FA 3CF5A 4OO1G 3H3VH 1XPOA 2VQFQ 4DR3Q 4KLKA 3TS0A 1ASYA 1VQBA 3CMAA 5J3BA 3KJPA 2CQOA 2ZTDA 2Q2UA 4LFCQ 1KC8C 3EN2A 4UP7A 3M9BA 3RZDH 4GNXB 4GLAC 4DKAC 1QUQB 4DV6Q 1NJIC 2F3IA 4OWXB 2IHFA 3H0GG 5ELOA 2GVBA 3MXNB 3K0XA 4QGUA 4HJ7A 3AYHB 1W2BA 4JG2A 2VW9A 2JA5G 4BXXH 3GDEA 3M4PA 1Y1WH 3MEFA 3H3VI 1RL2A 1VQ7A 3CP0A 2VL6A 3H0GH 1FJGL 3S17H 3CCUA 3OW2A 1PVOA 2WB1E 4LF8Q 3CD6A 1OXXK 3S1QH 1XPUA 2JA5H 4A93H 3STBC 2EIFA 5LMNL 1YITA 1HNXL 3KF6B 3PIPA 1KAWA 4JI1Q 2ATWA 1V1QA 5LMNW 3FKIH 2VZAA 4LUZA 1IBLL 1IZ6A 1YNXA 1FL0A 1FVIA 1SR3A 1ASZA 2MFIA 3CW2C 5FLMG 1XMQL 1W3SA 3F8TA 1O7IA 3E9IA 4LF7L 1SROA 2EQSA 2I0QA 4LF9L 3CCMA 5HGQA 4JI0Q 4DV7Q 4OWWB 1Q8KA 1UE7A 1PH9A 4YCWA 4DV4L 1PYBA 4JCVE 3UDXA 1UE6A 4R4OA 5FJ8H 4GOPB 1PH6A 4LF7Q 4A3DG 4IFDI 1OXVA 1IBKL 3SGIA 4LFAQ 3BJUA 1KRSA 1QZGA 4UP9A 5GQOA 4A3KH 1VQKA 4LFBQ 2WP8J 1CKOA 4JI8Q 5K36G 1E3PA 1U0LA 4NXNQ 1KD1C 4BXXG 1L1OA 3I4OA 1XNQQ 1I6HH 1UWVA 3DLLA 1MIUA 1KXLA 3A74A 4R4TA 3PF5A 1OTCA 4B3TQ 4X66L 2IX0A 3L0OA 1RIPA 4OONA 2N3SA 3G6EA 2C35B 1K3RA 1FJGQ 2B63G 3UE0A 1MKHA 3E0EA 4X65Q 1E1TA 2F4VQ 1SMXA 2D0PA 1VQ9A 4A3LH 2K75A 2YV5A 3T1YL 2H5XA 3OYYA 2GVAA 5IT9c 3RN2A 1L2FA 2Q2IA 3AFQA 4PMWA 4DR7L 3FHWA 3HOWH 4XTCS 4LFBL 3CCLA 5C0XI 3UE1A 1LM0A 2NN6I 3KYHC 1CSPA 3LGJA 3T1YQ 4UY8C 1XNRL 3GTOH 4JBJA 1X55A 3HOXH 2WAQG 1TWCH 3M4OH 5IP9H 3B6YA 5H1SE 2UXCL 2B63H 4PZ8A 2YYZA 2AKWB 1HR0W 1VQ4A 2EXDA 3BU2A 4AYBG 4DV3L 1Z9FA 4P71A 1N36L 4YHHQ 3PO3H 3ULLA 2QEXA 4A3BG 1YHBA 3ER0A 1JB7A 4TVAB 3ZJYC 1YJNA 1K83H 4X62L 3NENA 3HKZG 4MTNA 1EIFA 4GKKQ 4A3IH 1GKHA 3WWVA 4R4CA 2V1CC 1VQNA 3HOUH 1J5EQ 2R93H 4YWKA 4YWLA 1E24A 1CKMA 2AMCB 4JI3L 4A3FG 1Q1EA 3CQZH 1YHQA 1YI2A 1YZ6A 5M3FH 1SRUA 5FJ8G 4A4IA 2D0OA 4GN5A 2VQFL 4GOPA 5GROA 4P73A 5LMUL 4OWTB 4A3CH 5IP9G 3J81j 2YTVA 2ZJPA 3KF6A 4LUVA 4L5RC 1NBWA 4X62Q 4DR7Q 2I5LX 2K5HA 1Y1VG 2JA6H 5M5YH 3K7UC 3A5ZB 4JV5Q 1TXYA 4L5SA 4B3SQ 4XIGS 1X65A 1QUQA 4JI2L 4A3MG 2Q2TA 1XTDA 1P16A 2ASBA 1Z47A 4HIDA 3GTQH 3Q8DA 4R1JA 2IY5B 4WJ3M 4KHPL 2YU9H 2B3GA 4H02A 3K7AH 3J80i 1MJEA 4BBRG 4IO9A 1HNWQ 3JAMi 1J5EL 3RLFA 3UDGA 1NTGA 3HKSA 2UUCQ 4L5QA 4LF5Q 5IP7G 2A8VA 4J15A 4GKJL 4DV2Q 4JI5L 4OX9Q 1VQGA 1YVCA 3VDYA 4IJHA 2KCMA 1Y1VH 2JA6G 1KRTA 2JK8A 3EBEA 1N9WA 5C4JH 1HR0Q 2E2IH 5C3EH 4DV0Q 4BA1I 4DR4Q 1HNZL 4JOIA 3KLWA 1VQAA 4YCVA 3U4ZA 4IOAA 4B3RL 5GAHC 3BZKA 4A3JG 4YCUA 3I4MH 4A3CG 3PUZA 3FKIG 1WI5A 3PO2G 3HOVG 5M3MH 1A62A 1Q1BA 3GTLH 4PG3A 1IBLQ 1S3OA 3U50C 2R93G 2I5HA 4C3IH 1K0RA 1HZCA 2N78A 4A3IG 3CC4A 5JJIA 4GNXC 2E8GA 2HQLA 2XTIA 3J81i 3UDIA 3BZCA 2VS1A 3IRBA 2AWOA 3F2BA 2HHHQ 1EWIA 1CSQA 2BA0A 1X56A 1Q86C 1NY4A 1Q12A 2NVQH 2ZM6L 1PH1A 4YY3L 4RMFA 3DM3A 5IWAL 1PH7A 4Y7NH 2HIVA 4YWMA 3I56A 1R9TH 2JA8G 2OCEA 5IP7H 2CKZB 4DV2L 3ERSX 4DV1L 3AFPA 2CWPA 3CCRA 4DV1Q 4O0AA 2R7ZG 2NVTH 2Z6KC 1HH2P 4LFAL 3PUVA 2VUMH 1G51A 1BBUA 2KHIA 4DV5L 4MNOA 3M3YH 2CCZA 1VQDA 4JI4L 1C9OA 3UDFA 4B3RQ 3PUXA 3RLOA 3W1GA 4A3GH 1OXTA 1E1OA 2YTXA 4X66Q 4BA2I 1G6PA 4O2DA 2R7ZH 5IYDH 1HR0L 2LSSA 1WJJA 3RNUA 1NMFA 3W1BA 2R6GA 2L15A 3CC2A 3PGZA 3HKZE 4IPHA 3CCSA 5HY6A 3K8AA 1KHIA 1WCMG 2JA7G 4JBMA 5C4XH 3T1HQ 4JYAQ 2K14A 3M4QA 3STBD 1YJWA 4DUZL 2UUCL 4A76A 3CMEA 4HJAA 3PV0A 4KI0A 1VCIA 3H15A 2RCNA 2PI2A 3I4NG 2A19A 4NB3A 1N34L 2ZJQA 4OXPA 4DV7L 4DR5Q 1M90C 1BVSA 1VS0A 4R4IA 1Q7YC 2WAQE 5AJ3Q 4LF6L 2ID0A 2K5VA 5GAGC 5JEAG 1D8LA 3NEMA 1VQCA 1XMQQ 3GTGH 3HOXG 1GO3E 4JYAL 1CKNA 4IFDG 1N32L 3S1NH 1QVGA 4A3BH 3CC7A 5JJLA 2HT1A 4LF5L 4QL5A 4A75A 1HZ9A 5BR8Q 5LMUQ 4QQBX 2FXQA 1WCMH 2PI2E 5FLXc 1I94Q 2NZOA 4LF8L 4A3JH 4HJ5A 2E2JH 1E7ZA 5IE8A 4LF4L 3JAMc 4DR3L 5C44H 3HOYG 1JE5A 3D31A 4POFA 1S72A 1KIXA 1OXSC 4B3SL 1SLJA 1IYJB 4DK6C 1HZBA 2Z6KA 1VQ6A 4C3HH 5IYBH 2JA8H 1K73C 1LUZA 5M5XH 4UPAA 1BKBA 1EQRA 1M1KC 1N33Q 4YHHL 4DK3C 4AYBE 1IBML 3GD7A 4K0KQ 4AIMA 4P74A 4A3MH 1X3EA 3G4SA 4LF4Q 4NXML 2UXCQ 4LFCL 2MO0A 1TWHH 2LXKA 3K81C 2VNUD 4C3JH 3J7ZC 4HIMA 4X64L 3D0FA 1JJ2A 2OTLA 2CWAA 4EQ5A 2PMZE 2GN5A 1BBWA 3T1HL 2DUDA 1A8VA 2RHQB 3W5OA 1XPRA 4POGA 3I4MG 1N32Q 1VQ8A 4LWCA 1FGUA 1XMOL 2QGQA 4JI7L 3AEVA 1D7QA 2I5MX 4C2MH 2F52A 5DLQE 1HNZQ 3KDFB 2UUBQ 5M5WH 3KDFA 4B3TL 1N34Q 3J80c 2K4KA 4LF9Q 4MZ9A 3E9HA 1GVPA 1VQMA 1PHJA 3EIVA 2UU9Q 3CPWA 4EX5A 4B3MQ 1Q46A 1YJ9A 4DUZQ 2N8NA 1Q81C 3PO3G 4HIOA 1HZAA 3HOUG 1VQHA 3S2DH 2IX1A 1YHAA 1Y1WG 4A93G 2E2HH 2K50A 4JI1L 1K9MC 1B7YB 1J6QA 3TQYA 1TWGH 3PIOA 3RN5A 2QA4A 1PFSA 3I4NH 3GTJH 2RF4A 2AWNA 2IHEA 3ULPA 4QY7A 4JOIC 2ZTEA 1QZHA 4DR2Q 4A3EH 3F1ZA 4BBRH 4BY7G 1VQFA 4BY1G 1XMOQ 2NVXH 1PA6A 1XNRQ 2JA7H 2R92G 1K8AC 5IYBG 4IPGA 4BBSG 3S2HH 4TQUS 2JEAI 5GADC 4DR1Q 4P75A 1EUJA 2XGTA 4A3EG 5IYDG 3S15H 4GLXA 3G48A 2UU9L 3J81c 1AH9A 1I3QH 2ZM6Q 1CKNB 1HJPA 1QVCA 4QJFA 4AQYL 1YIJA 2R92H 3GTPH 3RR5A 3ICEA 1PH3A 1IXRA 2E5LL 2VUMG 1YEZA 3CCJA 3I55A 4BY7H 1JJGA 3PF4A 1WFQA 1QVFA 4JI7Q 4DPGA 1WYDA 3L2PA 4JV5L 2OQ0A 2IT1A 2JQOA 1AE2A 2YTYA 4GN4B 1N33L 2PNHA 4A3DH 1PH8A 1L1OC 3GTMH 2A1AA 2UXDL 1SN8A 2CFMA 2K52A 3PUYA 1N36Q 5C4XG 5AJ3L 2Z0SA 4QIWE 4KHZA 1LYLA 4NPSA 5EAYA 1B70B 3J7A5 1GD7A 2B29A 2OWOA 5IY0A 5IYCG 2VY3A 4JI2Q 1IBMQ 4A3GG 2ES2A 2Y0SE 3PSIA 1X3FA 2VQEQ 5E7NA 2MQHA 2BH8A 4RG1A 3PO2H 4UP8A 1VQOA 4GKJQ 1A63A 1B8AA 3AQQA 2N49A 4DAMA 3PCOB 4PZ7A 4HJ8A 2WFWA 3S16H 4LF6Q 1H95A 1IL2A 1HNWL 3S1MH 4GS3A 1U5KA 1N8RC 4IPDA 2DGYA 4JBWA 3M7NA 1VQJA 2D62A 2PQAA 3S14H 3G71A 4DR6L 4GKKL 2R7DA 4JI8L 2NN6G 3S24A 1JMCA 4GN3B 1L0WA 5GAEC 1TWFH 2UXBQ 3A0JA 1IBKQ 3KOJA 1PH4A 4L5TA 2MO1A 4DUYQ 3L7ZC 4X65L 1S40A 4DR2L 2JA9A 3NELA 3HOVH 2HHHL 4APVA 1UE5A 2E5LQ 4JI0L 1DGSA 3CXCA 4GNXA 2R7FA 4GLVB 4AQYQ 4JI4Q 3CPFA 5C0XJ 3CCQA 4DV5Q 1XNQL 3OTOQ 1UEBA 2Y0SG 5C3EG 2NZHA 2K5NA 3A5UA 4HIKA 4DR1L 4IPCA 4JI6Q 1I50H 1PV4A 1EQQA 3CAMA 4B3ML
chains in the Genus database with same CATH superfamily
3DWAA 4JC0A 1V9PA 1PH2A 4K8JA 3F2DA 1X9NA 1EY7A 4WRDA 4DR4L 2AHOB 1HFNA 1JJCB 4ALPA 3M85A 2WB1G 1VQLA 1SXTA 2QCPX 3CRLC 1EWCA 1EIYB 1NMGA 2IL8A 2JEBI 3NBHB 2LXJA 1L1OB 3TS2A 1E2VA 5JAVA 4A3LG 2K28A 4FF3A 1AW7A 4R4QA 5IYCH 3W3AA 3KBXA 3HOXB 2IWHA 3J7YW 5JEAJ 3U4VA 4HMJA 1SDFA 4NW2A 5CMDA 2BH2A 3DWPA 4IFDJ 3L3OC 4DV6L 2KCTA 3RZOH 3C1FA 1NR4A 4K6LA 2XRQD 1E22A 4L63B 1C0AA 4DV0L 3HOZH 5LL6S 2K1BA 3X3NA 5C5LA 1I6HB 5M3MG 4LNQA 3NK9A 5I2XA 3LNNA 1VQEA 4EVOA 4QIWB 3PUWA 1PH5A 4PMCA 4H13C 2F0NA 4OO1G 3H3VH 2VQFQ 1G8ZD 1ASYA 2L12A 2X6GA 2ZXPA 4RKLA 1RHPA 4LFCQ 2XSCA 1KC8C 4XQQA 1TWGB 3M9BA 4DKAC 1QUQB 2K33A 2GVBA 2PZUA 2NWGA 3K0XA 2L9HA 4QGUA 3IAYA 1SYBA 4N8X1 3NPPA 2A6HC 3FKIB 4U673 4LK1C 3MEFA 4C56C 3CP0A 3UI2A 3H0GH 3PIO3 1PVOA 2ICIA 1I3QB 3SK6A 2E76C 4A93H 3STBC 1YITA 1EY0A 1KAWA 4JI1Q 2B2TA 2ATWA 4R9WA 3LWUA 1A6XA 2EJGC 1ASZA 5FLMG 1XMQL 4KJNA 3F8TA 3E9IA 1SROA 1PRTF 2I0QA 2F0TA 3JAML 1EZ6A 2WB1B 1LTBD 4JCVE 1UE6A 4A3DG 1AN8A 1JOOA 1OXVA 3SGIA 3BJUA 4F7XA 3QOLA 1QZGA 4UP9A 1RODA 4IUUA 2F3VA 4HTHA 4HR7B 2F0OA 5K36G 1U0LA 4NXNQ 1KD1C 1L0XB 3BS1A 2I07B 3A74A 3PF5A 4ODGA 3L0OA 1RIPA 1EU4A 2R61A 3E0EA 1E1TA 4X65Q 1VQ9A 2OF1A 1KNEA 3RN2A 1L2FA 4XT3B 1A2UA 3FHWA 3HOWH 2AQ1B 1CSPA 4UY8C 1X3PA 2QF7A 4RGTA 3B6YA 5H1SE 3SHLA 5IT9E 2AKWB 4CKCA 1N36L 1HR0W 4A3BG 1Z9FA 3Q22A 3NTIA 3RUZA 1TWFB 4X62L 3HKZG 4A3IH 2V1CC 4YWLA 2AMCB 3HS0C 4A3FG 3FEWX 1WTOA 1L0YB 5ELEA 5M3FH 1SRUA 1EEFD 3VYUA 5FJ8G 1O80A 4OGQC 5IGFA 2VQFL 5GROA 4P73A 2BDOA 2ZJPA 2JSOA 4XXEA 5IOCA 4DR7Q 3ONAB 5KYIA 5IGBA 1X65A 1B50A 5DEHA 4AYBB 1S5DD 4DAYA 3Q8DA 4K2LA 2K5WA 2PO4A 5CBAE 3K7AH 5ELDA 1HXYD 4FXKC 4IALA 4IO9A 4CBVA 1HA6A 2CQAA 1DM0B 4L5QA 5IP7G 2JYOA 3GTMB 2F3WA 3NXWA 2PMZB 1RCVD 4K2KA 4IJHA 1HCZA 1Y1VH 3R93A 1KRTA 3HGBA 1HR0Q 5C4JH 3VA7A 4DR4Q 1PLFA 1HNZL 5KGUA 1NAPA 1VQAA 4IOAA 2F0DA 3MTSA 3BZKA 4YCUA 3I4MH 2K6AA 1KLGD 3FKIG 4FF2A 2BE5C 4QUFA 4KN4C 2QEJC 3U50C 2R93G 2I5HA 3CC4A 1K0RA 5FK9C 1CHPD 1J8IA 4OHJA 3S2HB 2EZVA 1KLUD 2F1MA 2VS1A 3IRBA 3KF8A 3OSOA 4A3EB 3IL8A 1JICA 3CHBD 1PDQA 1HQMC 1VMPA 4Z9CB 2NVQH 4RMFA 4Y7NH 2HIVA 4YWMA 3I56A 2OCEA 5IP7H 5IGCA 2O4XA 4KY6A 5KIXA 2CWPA 3NQIA 4O0AA 2NVTH 5A2QE 1G51A 1STNA 4MNOA 2CCZA 1VQDA 1SBBB 1C9OA 4B3RQ 2FFKB 3K0YA 3RLOA 5C3EB 4A3GH 2YTXA 4BA2I 2DNCA 3EVQA 4FVMA 2R6GA 2L15A 3CC2A 1TS3A 2MGSA 3CCSA 1TR5A 1XYIA 4I7AA 4JBMA 5C4XH 3T1HQ 1CI3M 3I91A 3STBD 4IURA 3RMHA 1YJWA 2UUCL 3CMEA 3E5SA 1E2ZA 1VCIA 1FD7D 1GOZA 3I4NG 2A19A 2H4OA 1N34L 5J39A 1JWMD 4DR5Q 1VS0A 1PYWD 2ID0A 2K5VA 5CGKA 2F0LA 1XMQQ 3GTGH 3MAQA 5M5YB 4XQNA 3HOXG 3C1EA 4A3BH 2HDMA 1GUWA 3J81E 1S5CD 2X69A 1PRTB 3OMCA 1HZ9A 4CDDC 5LMUQ 4MHEA 1SNQA 3CQZB 2E2JH 1E7ZA 4X3KA 1JQYD 1WD0A 1JE5A 1OXSC 5JPMC 4B3SL 1IYJB 4DK6C 2JA8H 2FMCA 2ZXOA 4UPAA 1C4QA 1D1IA 1M1KC 1N33Q 2C9OA 2I46A 1EY9A 4C1NK 3GD7A 4K0KQ 1PTOC 2PPBC 3H94A 1U9RA 1I4XA 1VDZA 4NXML 1R4QB 1X3EA 4LFCL 1EYDA 2LXKA 3K81C 5TSSA 2F0EA 3D0FA 2CWAA 4EQ5A 1WTHA 2DUDA 4RHRA 3W5OA 1O7YA 3IFDA 3LWEA 1VQ8A 1N32Q 2JA5B 1DJRD 2P5ZX 4JI7L 3AEVA 4IUTA 4MTKA 5M5WH 3KDFA 3S17B 4QCLA 2BCOA 3J80c 3EIVA 3M3YB 3E6ZX 3DHQA 5C3XA 4ILWA 3PO3G 1DZ1A 3QJYA 3S2DH 2E2HH 3ND8A 1J6QA 3RN5A 4G7HC 1SE3A 4NMZA 3GTJH 2EY1A 2RF4A 2PW7A 1XXGA 2IHEA 1HTPA 1XMOQ 3OWFA 3EFXD 4IPGA 5LHY1 1WD1A 2F0IA 4DR1Q 2XGTA 4HMIA 4A3EG 4R8IA 5IYDG 3DEPA 2DJFC 3G48A 1AH9A 4CJ1B 4QJFA 2F0QA 3ICEA 5IODA 1PMRA 3CCJA 4BY7H 2KEDA 1G91A 1Y1WB 1WYDA 1LT6D 2FMMA 4JV5L 1AE2A 1HQRD 4A3DH 1ESFA 2WV6D 1L1OC 4CKBA 2UXDL 5C4XG 4K14A 3S9WA 3MC0B 3TN2A 4OIKA 5IY0A 5IYCG 3T16A 2VY3A 1IBMQ 2Z4HA 4A3GG 1UAPA 5E7NA 2F0SA 2MQHA 3A7LA 4RG1A 4UP8A 2LFNA 1H9SA 3IFTA 2JA6B 2X6LA 4C3IB 3VR2A 2SNMA 3I3CA 2WFWA 3D6WA 4EGVA 4GS3A 4JBWA 1VQJA 1D2BA 3FMCA 3S14H 3G71A 4DR6L 2F0FA 4L6TB 2NN6G 1KNAA 3S24A 3QR8A 3NP8A 3KLSA 4ZRZA 5DNFA 4L5TA 4DUYQ 3PO3B 4DU9A 4KN7C 4KV6A 2HHHL 4APVA 2B63B 4JI0L 5J22A 2R7FA 1K28A 4DV5Q 1UEBA 4XDXA 2VB2X 4HCSA 4CDFC 1X32A 4IPCA 1I50H 4DXGA 1EQQA 4A3CH 2SEBD 5KNCA 1HNXQ 5IWAQ 2MJ8A 3TRZA 2N88A 3S1MB 2XNAC 2QDLA 4NXMQ 4PZ6A 1WOCA 4K0KL 1EL0A 4KY7A 1G2SA 5EJWA 1EOVA 2CW0D 3PO2B 1NCVA 1YNJD 3MXGA 1JWSD 3HEJA 1AZPA 3CCVA 4CJ2C 3ULJA 3T56B 4IOCA 2ENBA 1W6KA 4BBSH 2F4VL 5T1GA 4BY1H 2KEEA 1P8LA 4DN4M 1Y8PB 2EYFA 2JJQA 5C44G 1UE1A 1I4GA 4B08A 1RD9D 2IPKD 1K8MA 1C7YA 2M9VA 4IFDH 3RLNA 1Y8NB 5FKAC 5EQ0A 1LTAD 1Q82C 1SFOH 4DR6Q 2PCFB 1A0IA 1UUPA 5M3FG 1MJCA 1B3AA 3FP9A 3U9OA 4HJ9A 4DR5L 3S1RH 3GTPB 2R92B 3I2ZA 3S1QB 1DD2A 4IZ8A 2QW7A 4XQJA 1EIHA 3CCEA 4XYOA 2OQKA 4IJLA 3K57A 4A3KG 2ZJRA 1FNVA 2UUAQ 3OIQA 3KFUA 4ABNA 1JT8A 4X64Q 1I5FA 4DV3Q 4GOPC 2UXBL 1VQIA 3CF5A 3BG3A 3RZDB 2A5HA 1PFBA 2CQOA 1LTRD 3EN2A 4UP7A 1DOLA 1IYUA 4KKUA 1GUGA 5G3LF 1NJIC 1F2ZA 1JB3A 4HJ7A 3AYHB 2K01A 2VW9A 1SNOA 4DNTB 1G6ZA 1Y1WH 1SSOA 1BF4A 1RL2A 4IUVA 1FJGL 5BN3A 1WVLA 1M8AA 3CD6A 2OXPA 4HCEA 2JXMB 5CC4A 3PIPA 5CYUA 2H1EA 1V1QA 2VZAA 1IZ6A 4Q0FA 1TY0A 1QNUA 3ITPA 4LF7L 4K8IA 4LF9L 1KDAA 1M4VA 2B8FA 4OWWB 5K5PA 1PH9A 4WFN3 3GTJB 4YCWA 3NHHA 4DV4L 3NTKA 1PYBA 1H9MA 3UDXA 4R4OA 1PH6A 2E2HB 3EQLC 3S2DB 4LFBQ 1LTSD 3D4WA 4JI8Q 1CKOA 5EKIA 1E3PA 1PTOH 1WTRA 3I4OA 1BO0A 1MIUA 1KXLA 5M5WB 5HGTA 4HSVA 4OONA 4UAIA 3G6EA 3UE0A 1MKHA 2F4VQ 1GUNA 4A3FB 1O7LA 2YV5A 1LACA 3T1YL 4ZKBB 5IT9c 5AFWA 3HKZB 3AFQA 3KLSX 4KKSA 4PMWA 4DR7L 4XTCS 1TT2A 1IW7C 1JCKB 2LKVA 3GTOH 5E4WC 1TWCH 1ICWA 3A55A 4KJOA 3KLRA 2YYZA 1VQ4A 2EXDA 4P71A 1V1PB 1Q8IA 2JA8B 1F2MA 5I9PA 4RGOS 4FF4A 1K83H 2FHTA 2KHSA 4GKKQ 2NB0A 1GKHA 4HEDA 4R4CA 1VQNA 2A6EC 3HOUH 3J80E 3CQZH 2MP1A 1EOTA 2F03A 4GN5A 4GOPA 3Q6SA 5LMUL 2F0KA 4OWTB 1SNDA 4ZKCB 3J81j 2YTVA 4V190 3BVMA 1B2TA 2Z8LA 3KF6A 1NBWA 4X62Q 4XYQA 1Y1VG 1SMYC 4G4KA 2ZXRA 5M5YH 1ET9A 5JVH3 3QO2A 4B3SQ 4JI2L 1C48A 4A3MG 1MD2D 3K5MA 1Z47A 4R1JA 2IY5B 2KA7A 3JAMi 3R8BA 1J5EL 1SYDA 2UUCQ 5C4XB 2LMCB 1RTOA 5M3MB 4JI5L 4OX9Q 5ELFA 3HZXA 4DNRB 1S5ED 2JA6G 5FLXE 2R3ZA 3BDCA 4A3GB 5C3EH 4JOIA 4B3RL 5GAHC 1MHWC 4YIJA 1WI5A 5M3MH 1A62A 1Q1BA 1SMYD 4O1NA 4PG3A 1DYQA 3NBIA 4C3IH 1HZCA 2N78A 5IGDA 3V05A 1F9RA 2NVQB 1HFGA 1D1KA 3UDIA 1LO5D 3F2BA 2EY2A 1EWIA 5L37A 2EYPA 1Q12A 1NUCA 3M7NA 3E3XA 1LT4D 5C5MA 3ERSX 1VF7A 1BR9A 3H3VC 3CCRA 2K7VA 2R7ZG 4LFAL 3I4MB 2KHIA 1BBUA 3MXNA 3PUXA 4X66Q 1G6PA 4O2DA 4CDCC 3HOUB 5IYDH 1BCPF 1HR0L 1QJOA 1WJJA 2RSOA 1A3VA 5ELCA 1K83B 3PGZA 3HKZE 3TBIB 2NYZD 1WCMG 4OO1H 3TP8A 3J7AF 5DAUA 2K32A 4A76A 3MHBA 3WDNA 4HJAA 5FOBB 4KI0A 3H15A 2RCNA 1TWCB 2PI2A 1HPCA 4DV7L 1M90C 1JB7A 5AJ3Q 4LF6L 2B2UA 1BCPD 5JEAG 2EPBA 3BYYB 3MVVA 4DGZA 5I9OA 1S5FD 1CA6A 1N32L 2PNRC 4JYAL 4IFDG 3PIP3 3CRKC 1ZYRC 2EOTA 4DXFA 1D5ZC 4QQBX 3CKIB 2EY6A 5IE8A 1TY2A 3A54A 4ZYSA 1SLJA 2J7ZA 4R8NA 4LAAA 5IYBH 1EQRA 1X3QA 3C2PA 3TP5A 4DK3C 3Q0AA 2RVLA 3MXUA 2DY7A 4P74A 1TIID 1F9QA 4DFAA 1JR0D 1JWUD 3FDTA 4H44C 2PYKA 2VNUD 1QOHA 3J7ZC 4HIMA 2PMZE 2F0MA 2AQ2B 3A7AB 3I4MG 2EXZA 4JVZA 3I8ZA 4LWCA 2PQEA 5DLQE 2DY8A 3AU7A 1N34Q 2E2JB 4LF9Q 3E9HA 2O2LD 1VQMA 2UU9Q 4B3MQ 1YJ9A 3D6CA 4HIOA 1HZAA 4MIUA 2IX1A 1YHAA 1Y1WG 4NKLA 2K50A 1K9MC 4A3BB 3TQYA 1GUSA 1SNMA 2AWNA 2KQ3A 3MZ5A 3ULPA 4DAVA 2CVRA 1QNKA 1QZHA 4DR2Q 4WJWA 3MFYA 4RGMA 3DM1A 1H9RA 5I2YA 1PA6A 1XNRQ 1K8AC 5EBDA 5HURA 3DMUA 1EUJA 1MSGA 2LY7A 1QE6A 2UU9L 3J81c 1I3QH 1CKNB 4AQYL 2R92H 3GTPH 5JOBA 3S1RB 1IXRA 1YEZA 1IHZA 3SK4A 1EU3A 4DPGA 3L2PA 2OQ0A 4GN4B 2JQOA 2NVTB 1PH8A 3T51B 3FRPB 1SN8A 2K52A 4QIWE 4KHZA 4BY1B 1LTGD 5EKLA 1B70B 2M00A 4OIJA 1CQVA 2Q8RE 3J7A5 3NSWA 2OWOA 3I4LA 1LV9A 4JI2Q 1WTQA 2Y0SE 1X3FA 4HSPA 3QIAA 3PO2H 2A69D 2LS01 1A63A 1B8AA 2WINB 2N49A 4PZ7A 3HOZB 2AQ3B 1GUOA 3S1MH 3SE0A 3K5LA 1N8RC 4K5VA 4IUNA 1ENCA 5C4JB 1UNSA 4GKKL 2TSSA 3ND9A 1JMCA 1L0WA 4H7BA 1IBKQ 3KOJA 4FXGC 2K5DA 2MO1A 3NELA 2B2TC 2E5LQ 2Q8TA 3BZDB 4GLVB 4JI4Q 1CFMA 3CPFA 5C0XJ 3GTOB 2Y0SG 5A35A 1AEXA 4C3JG 2KUMA 1ZYRD 2V4DA 1SE8A 3BVZA 2DNEA 4QMGA 5LMNQ 4YY3Q 4A3FH 1G291 4OEMB 4ME3A 4P72A 5M3FB 4DUYL 2IX3A 1X6OA 2KCNA 1PTOB 3D4RA 1LTLA 3D8GA 1V1OA 2SOBA 1STAA 3K80C 1T9HA 1IL8A 2L4NA 2EY5A 3NTHA 4DV4Q 4KHPQ 4JBKA 3KF8B 4WJ4A 5JJLA 3GO5A 1I94L 1X3GA 4BS9A 3HOWG 3DXJC 1RF2D 3FVQA 4EQOA 2FINB 4A3DB 2HIXA 3KK7A 4Y52H 3I90A 3U58A 4HN7A 3HOZG 5CV4A 4EQNA 1IKMA 1STGA 4AH6A 4TSSA 2RKSA 3F2CA 3I72A 4X6AH 3RD4A 1GHKA 3GTKH 5CV7A 4KKTA 3T53B 2UUBL 1AE3A 2ZTCA 4JI3Q 1HUMA 5FO7B 3P75A 2UXDQ 2MNAA 1K8GA 1JOQA 2VB3X 2JE6I 2F0JA 4JI5Q 4OX9L 4JI6L 5FLMH 2UUAL 4HAEA 5ELNA 4OELB 2PQAB 2OTJA 1TQOA 1XPOA 5G3LD 4DR3Q 4KLKA 1VQBA 3KJPA 2Q2UA 3NWSA 4GNXB 3RZDH 5CBEE 2NN6H 1I4PA 4OWXB 2IHFA 3H0GG 3MXNB 2NUCA 1W2BA 1BUVT 4RFBA 4JG2A 2JA5G 4BXXH 3GDEA 3M4PA 1IW7D 1VQ7A 3JAME 1PZKD 3S17H 3R2TA 4CJ0B 3URYA 1OO9B 4DA2A 5FO9B 4A93B 4LF8Q 3TZDA 3S1QH 1XPUA 2XVSA 2JA5H 5LMNL 5LL6X 2F4IA 1SYEA 4FP5D 3FKIH 1SFOB 3VR3A 1YNXA 1SR3A 1HHVA 2MFIA 3CW2C 1W3SA 1O7IA 4BBRB 4F88A 2EQSA 1SYGA 5HGQA 1STEA 5ELBA 1SEBD 2B2WA 3G7LA 2EJMA 5FJ8H 1EIGA 4BBSB 4IFDI 2G9HD 1IBKL 1DOMA 5D3DA 5GQOA 1D5XC 2KVMA 3VYSA 2Z6BA 1NR2A 1ZXTA 2G5DA 1I6HH 1UWVA 1WTXA 1TKWB 3EJIA 4R4TA 1OTCA 2IX0A 4C2MB 2N3SA 2C35B 1K3RA 2B63G 1H9SB 1E2WA 2TMPA 1PTOD 5E1FA 1SMXA 2ZT9C 4A3LH 2K75A 5C4ZA 2H5XA 3OYYA 4BWGB 2GVAA 2F0GA 5J1ZA 4JK1C 1HTLD 3A8KE 2L5TA 1I50B 3MWYW 4LFBL 2OEOA 3CCLA 5C0XI 3UE1A 1LM0A 2NN6I 3KYHC 3LGJA 3T1YQ 3HG9A 3R3OA 4JBJA 1YNND 2JP1A 3HOXH 2WAQG 2UXCL 2B63H 5C3WA 4PZ8A 1B44D 5EPLA 1E0BA 3PO3H 1SNPA 3ER0A 3NWTA 1BNZA 4TVAB 1I6VC 1SAPA 2KCCA 4ID6A 4NP5A 3GQBA 5K36H 2F0PA 1STBA 4PMBA 1SNCA 4JI3L 1CKMA 5DM63 3S14B 1Q1EA 1YHQA 1YI2A 3SEBA 2XN9C 1YZ6A 3TZUA 4RGNA 3J80L 5DM73 5IP9G 1Y8OB 4LUVA 2F0WA 2JA6H 4Y7NB 3A5ZB 4JV5Q 1TXYA 1ENFA 4XIGS 1A3UA 1PRTD 3A56A 1CK1A 2ASBA 4HIDA 1VF5C 5BN5A 3SR1A 4KHPL 4H02A 3J80i 1MJEA 4BBRG 1K8OA 3TP6A 1EEID 3RLFA 3UDGA 1NTGA 3OWEB 5F2DA 4J15A 5CV6A 1EFID 2WKDA 2O5JC 1VQGA 3VDYA 2KCMA 1I4HA 2JK8A 4BA1I 4BY7B 3KLWA 3U4ZA 1Y1VB 4FYDA 2Z4IA 4A3CG 3PO2G 3HOVG 4RA8A 2HQEA 5COYA 3GTLH 1IBLQ 1S3OA 2B2YC 2B8GA 5JJIA 4U68A 4GNXC 3K7AB 1MGSA 1TVXA 4CGYB 2HD3A 1EYCA 4C1NI 3A8IE 4M1UB 5CV8A 1SJED 1ZKOA 1CSQA 3SK8A 1FNUA 3L9AX 5KEEA 1CM9A 1PH1A 4YY3L 3DM3A 1PZID 4GZYC 1AZQA 4RCNA 3AFPA 3J81L 4DV1Q 3I70A 2Z6KC 3K58A 3PUVA 3D3RA 5NUCA 3M3YH 4JI4L 1DONA 2E2IB 1E1OA 1OXTA 3P7JA 4H0LC 4A3IB 1WTVA 1NMFA 1STYA 3W1BA 3H6MA 4IPHA 5HY6A 1XWEA 1ONLA 1KHIA 4TKOB 2JA7G 4KTAA 3S15B 4JYAQ 2HCIA 2K14A 4DUZL 1KDCA 3AB9A 2YU9B 4S3SA 1ZEQX 3PQIA 3GTQB 4NB3A 4G7OC 3K6OA 4OXPA 2RQXA 4R4IA 2WAQE 4RWSC 2IW3A 5GAGC 3NEMA 1VQCA 5A2QL 1CKNA 5I6YA 3S1NH 3TP7A 3OOCA 1HUNA 4LF5L 3KBGA 4A75A 1XTCD 1Q90A 5BR8Q 2FXQA 1WCMH 2PI2E 5FLXc 3P1HA 1CQFA 4RHSA 4LF8L 4HJ5A 4LF4L 1TS4A 4DR3L 1CHQD 1KABA 5C44H 2J4XA 3HOYG 1KIXA 5IIFA 3Q23A 1S72A 1C8CA 1GXDC 4TRDA 2Z6KA 4C3HH 1LUZA 3GP7A 5M5XH 3M4YA 4YHHL 3GTGB 1IBML 1A15A 1KAAA 1D5MC 2M2LA 5KYLA 3G4SA 3K5NA 1STHA 3ZYYX 1ESRA 3Q24A 4K6DA 4C3JH 4C3IG 1JJ2A 4OL7A 2OTLA 1TU2B 3QOJA 2GN5A 5EPKA 2NBFA 1I4QA 3V2TA 3T1HL 1A8VA 4POGA 2BOSA 4ZAIA 3KDFB 2UUBQ 1YNNC 3H0GB 4B3TL 1NSNS 1GVPA 1PXUA 3CPWA 1GHJA 1GJXA 2N8NA 1VQHA 3O13A 4A93G 4JI1L 1TWGH 2F0VA 2QA4A 1CZWA 4F87A 4C3HG 1U4PA 3VR5A 2ZTEA 2WACA 3PMFA 4M8AA 4LJZC 4A3EH 2RDFA 4BY1G 3V96A 2NVXH 2R92G 4BBSG 3S2HH 1ILPA 3NE5B 5GADC 3HP3A 4RKBA 4J1MA 1HRJA 2ZM6Q 1HJPA 1SYCA 1YIJA 2HCCA 3RZOB 3DUZA 2E5LL 2VUMG 3MA2B 4DF7A 3I55A 1JC7A 1JJGA 2AUJD 3PF4A 4V0BA 1WFQA 1QVFA 4JI7Q 1QB5D 1LABA 1U4RA 5D3IB 5BN4A 3GTMH 2WIIB 2A1AA 1KDBA 3PUYA 1EQTA 5AJ3L 2Z0SA 1R9TB 3VYRA 2A73B 2WAQB 4KD4A 5EAYA 1EWHA 2ICEC 1GD7A 1B4OA 1PTOF 2E74C 1SYFA 3PSIA 2RBMA 2BH8A 4PQXA 1CA5A 4GKJQ 1F9SA 3AQQA 4KMUC 4DAMA 4HJ8A 3F2UA 3S16H 1JOKA 4LF6Q 1XX8A 1H95A 4Q5VA 1HNWL 3N6RA 5ISRA 4IPDA 1PFNA 2SDFA 3WOEA 3ERQA 2F0UA 3QB3A 2Y0SB 2D62A 2D5DA 2PQAA 1AP0A 2GA4B 4JI8L 5GAEC 1T5XD 1TWFH 4J8QA 3A0JA 2E2DC 1PH4A 4L8JA 3L7ZC 1EY6A 4X65L 4DK0A 3HOVH 1CTMA 1O78A 4X3SA 2D2CC 4AQYQ 2RA4A 3VA5A 1RJTA 3OTOQ 5IGEA 3G6JB 2NZHA 3A5UA 4B3ML 2K05A 4JI6Q 1PV4A 3HOWB 3JC66 1OXUA 1TWAB 1GUTA 4FF1A 2KHJA 1KQSA 1X54A 1LLRD 2DN8A 1U4LA 4DNIA 4CDEC 4O42A 2N55A 3EROA 3MXPA 1F2LA 1TWAH 2EYJA 3SVMA 3FPPA 1ENAA 3KJOA 2B39A 4J6HA 4IQZA 4NXNL 3C3LA 1MI2A 3QWNA 1EY8A 2A68D 1H9KA 2XRSD 5CORA 4LUOA 4ZLTF 3OTOL 2MUYA 1R4PB 3HFZB 1LT5D 1VQ5A 3TREA 2ALYB 3W2DA 4DAYB 1Y14B 3VYTA 3HOYH 3E0JA 5BR8L 2NVYH 2KENA 1XJVA 1CUKA 3BYTB 5JJKA 2EDGA 1YBYA 1EYGA 1GM5A 2VQEL 1FYCA 1VQPA 5M9OA 2Z9HA 2BA1A 2CHBD 1A3TA 4FDBA 2RHSB 3S16B 1NE3A 4ULLA 2KBNA 1PYSB 4B9WA 1V8QA 1KL9A 2B2YA 4OO1I 3TEHB 1V43A 1YNJC 3NQTA 2Q2HA 4LW1A 1EFWA 4KD3A 4RAUC 2WKCA 3BDLA 4CKEA 4E6IA 3J7AV 2JA7B 5C0XG 1JE4A 1RDPD 1QWYA 2G9DA 3I7FA 4MN3A 3TS0A 2BE5D 3CMAA 5J3BA 2ZTDA 3I4NB 2C5CA 4GLAC 4DV6Q 2EJFC 2F3IA 5ELOA 4ZK9B 1FNWA 3U9SA 1O7ZA 2D9UA 4LMQD 3H3VI 2VL6A 4B9XA 1TS5A 3TDQA 3CCUA 3OMGA 3OW2A 2WB1E 1OXXK 4KHVA 1HNXL 2EIFA 4IUPA 5EKKA 3KF6B 1B9MA 1Y69U 1A2TA 4ZCKA 5LMNW 4LUZA 4CHTB 2QILA 1IBLL 4ZQ3A 1FL0A 1FVIA 4IN3A 3OHXC 1TWHB 3EA6A 1WTPA 3CCMA 4JI0Q 3CU7A 4DV7Q 5D65A 1Q8KA 1UE7A 2KECA 4DAPA 4GOPB 4LF7Q 1D7QA 3OIPA 1LT3D 4LFAQ 1KRSA 4A3KH 1VQKA 3TSSA 4ZUIA 3QG1A 1S5BD 2WP8J 1ICFB 4BXXG 1L1OA 4RCOA 4A3JB 1XNQQ 3DLLA 3FPUB 1PRTC 4B3TQ 4X66L 1B1ZA 1FJGQ 1QG7A 4IUQA 2K04A 2D0PA 5JPNC 1EY4A 3NBHA 5EGTA 2CH4W 2A74C 4WORA 1HA5A 1AFPA 2Q2IA 1D6EC 4C3JB 2A6HD 1XNRL 1X55A 2NVYB 3M4OH 2QDBA 5IP9H 3HOYB 5I6WA 3A8JE 4NDXA 3R2IA 3BU2A 4DV3L 4AYBG 2UXBQ 4YHHQ 1CT1D 3ULLA 2QEXA 3X3MA 1YHBA 5M5XB 1LTTD 3ZJYC 1BCPB 1YJNA 3NENA 4MTNA 1BQQT 1EIFA 1J9OA 3WWVA 2R93H 2R7ZB 1J5EQ 3OW7A 4YWKA 1E24A 2HDLA 2DJGC 4FO2A 4PV1C 1WCMB 2D0OA 4KY5A 4UHVA 4A4IA 2VUMB 3SXHA 1FGBD 2XIWA 3NUCA 1I4RA 4L5RC 3S1NB 2I5LX 2K5HA 2A68C 3K7UC 1UEAB 3IKJA 2K03A 1B3QA 4L5SA 1QUQA 2Q2TA 1XTDA 1P16A 3GTQH 2B2VC 4WJ3M 4KK7A 2YU9H 2B3GA 2A6ED 2K5QA 1HNWQ 1G2TA 3HOVB 3HKSA 2MPMA 4LF5Q 2A8VA 4GKJL 4DV2Q 3GV6A 1YVCA 2SNSA 3EBEA 1N9WA 2E2IH 4XT1B 4DV0Q 4RH6A 2RDHA 4YCVA 3H91A 2J0TD 4PNYA 4A3JG 3PUZA 1PZJD 3DEOA 1II3A 5JEAH 2KOLA 4A3IG 1WTWA 2E8GA 2HQLA 1DOKA 2XTIA 3H09A 3J81i 3BZCA 2AWOA 2EVBA 2HHHQ 2BA0A 5T1IA 1X56A 1Q86C 1NY4A 1QCBD 5D14A 1Q3LA 2OT2A 2ZM6L 5IWAL 1PH7A 1R9TH 2JA8G 5FO8B 3K59A 1V1PA 2CKZB 4DV2L 1LTID 2Q8IB 4DV1L 5EBCA 3GTLB 1HH2P 2VUMH 1IKLA 4DV5L 1F2YA 1EYAA 1RKNA 1BCPC 3UDFA 2EYLA 3W1GA 2L0CA 2R7ZH 2R93B 2LSSA 2EE1A 3RNUA 4N8FA 4K5WA 3K8AA 4QUCA 2EYOA 5JVG3 3M4QA 1W6JA 4N9TA 2NTTA 3TMEA 3PV0A 1K3BC 1TS2A 4ME5A 2NVXB 4G7ZC 2ZJQA 4QF4A 1BVSA 1T5EA 5KRUA 5KNDA 1Q7YC 4A3MB 5C4HA 1MBYA 1D8LA 5CR3A 2EYMA 1GO3E 1RTNA 1QVGA 3I73A 1JORA 3CC7A 1ML0D 2HT1A 2XWJB 4QL5A 4P2CB 1I94Q 2NZOA 5E3FA 4A3JH 3JAMc 1EQVA 3D31A 4POFA 2B2VA 1HZBA 4A3KB 3BDOA 1VQ6A 1K73C 4I7ZC 1BKBA 4EQPA 5I4DA 3MEHA 2PZWA 2Z1CA 4N9PA 4AYBE 3HRZC 4AIMA 4A3MH 2UXCQ 4LF4Q 4X3UA 2MO0A 2E75C 1TWHH 1Z6HA 2F0HA 1SE4A 1ILQA 4X64L 1BBWA 2BDNA 3WOFA 3DWQA 2RHQB 1XPRA 5JJZA 2RCFA 3GV3A 4JW0A 4C3HB 1FGUA 1XMOL 2QGQA 2I5MX 4QB4A 2L55A 4F8MA 4C2MH 2F52A 1HNZQ 5C44B 1QILA 2K4KA 4MZ9A 1SJHD 1PHJA 2FJ2A 1ET6A 1F77A 3AMUA 4EX5A 3SDZA 1Q46A 4DUZQ 1Q81C 1K0SA 2AUKA 3HOUG 5CV5A 1B7YB 3PIOA 1KTKA 1PFSA 1EY5A 3I4NH 4FXDA 3VR4A 2HUGA 2KJXA 3M7GA 4QY7A 4JOIC 3MFGA 2A69C 4BY7G 3F1ZA 4BBRH 1VQFA 1BOSA 2JA7H 2PW5A 5IYBG 4TQUS 3BVGA 2JEAI 1Z7TA 4P75A 2EYHA 1U4MA 3S15H 1FR3A 1S4ZA 4GLXA 3OPOA 1QVCA 5KNBA 4JPBW 5CV9A 3RR5A 3LX0A 1PH3A 2CH4A 5C0XH 4G57A 2YTYA 2IT1A 1N33L 1BDOA 4ZUJA 3SK5A 1NNXA 2PNHA 1B9NA 3K5OA 2CFMA 1N36Q 1H9JA 2XWBB 3C46A 4DK1A 1BBXC 2JN4A 1LYLA 4NPSA 5IGGA 4X3TA 2B29A 2IJ0A 1VMCA 2CW0C 2ES2A 1BXTA 3D4DA 2VQEQ 3P20A 5E4XA 2NZ1D 1VQOA 3T13A 3T4AC 2B2WC 2L11A 3VR6A 1DXMA 3KUPA 2PZTA 1B53A 3PCOB 1DCZA 2RDGA 1IL2A 5EPJA 3GTKB 1U5KA 2DGYA 2L1BA 2VXWA 5FLXL 1SE2A 1F9PA 2QKIC 2R7DA 1PFMA 4GN3B 5C6AA 2B2UC 1S40A 4DR2L 1IYVA 4K5XA 2JA9A 1EZ8A 1UE5A 1DGSA 3CXCA 4GNXA 3M4OB 3CCQA 1XNQL 2RSNA 5IT9L 5C3EG 4UDUC 4FNFA 3N52A 2K5NA 2MHVA 2NTSA 1CZGA 4HIKA 1MSHA 4DR1L 2O5IC 3CAMA 4I65A
chains in the Genus database with same CATH topology
1SE8A 3JC66 1OXUA 5LMNQ 1HNXQ 4YY3Q 4JC0A 5IWAQ 3TRZA 1V9PA 1PH2A 2KHJA 3F2DA 4A3FH 1G291 1X9NA 1X54A 1KQSA 4DR4L 4ME3A 2AHOB 4DNIA 4NXMQ 4P72A 4PZ6A 1TWAH 1WOCA 4K0KL 4DUYL 3KJOA 1X6OA 1JJCB 1EOVA 4NXNL 4ALPA 3M85A 1LTLA 2WB1G 3CCVA 1VQLA 1EIYB 3K80C 3ULJA 1T9HA 4LUOA 1NMGA 3OTOL 2JEBI 3NBHB 2LXJA 1L1OB 3HFZB 4IOCA 1VQ5A 3TS2A 4BBSH 4DV4Q 2F4VL 4KHPQ 4JBKA 4A3LG 3TREA 2ALYB 4DAYB 4BY1H 3KF8B 4WJ4A 1Y14B 5IYCH 1P8LA 3GO5A 4R4QA 1I94L 1X3GA 2JJQA 5C44G 3HOYH 5BR8L 1UE1A 3HOWG 2NVYH 2KENA 1XJVA 1C7YA 1CUKA 3RLNA 2HIXA 5JJKA 5JEAJ 1YBYA 1Q82C 1EYGA 1SFOH 1GM5A 3U4VA 4Y52H 2VQEL 4DR6Q 3U58A 3HOZG 4IFDJ 2BH2A 1A0IA 4AH6A 4DV6L 5M3FG 1MJCA 3F2CA 4HJ9A 3FP9A 1VQPA 4DR5L 2KCTA 3S1RH 3RZOH 4X6AH 2BA1A 3GTKH 3I2ZA 1E22A 4FDBA 1C0AA 4DV0L 2UUBL 3CCEA 1AE3A 2RHSB 3HOZH 2ZTCA 2OQKA 4JI3Q 1NE3A 4IJLA 2KBNA 1PYSB 4A3KG 2UXDQ 1KL9A 2MNAA 2ZJRA 5M3MG 3TEHB 1V43A 1K8GA 4LNQA 4OO1I 2UUAQ 4JI5Q 2JE6I 4OX9L 2Q2HA 4LW1A 4JI6L 1VQEA 5FLMH 1EFWA 2UUAL 3KFUA 5ELNA 5C0XG 1JT8A 3PUWA 2PQAB 4X64Q 1I5FA 4DV3Q 4GOPC 1PH5A 1VQIA 2UXBL 2OTJA 3I7FA 3CF5A 4OO1G 3H3VH 1XPOA 2VQFQ 4DR3Q 4KLKA 3TS0A 1ASYA 1VQBA 3CMAA 5J3BA 3KJPA 2CQOA 2ZTDA 2Q2UA 4LFCQ 1KC8C 3EN2A 4UP7A 3M9BA 3RZDH 4GNXB 4GLAC 4DKAC 1QUQB 4DV6Q 1NJIC 2F3IA 4OWXB 2IHFA 3H0GG 5ELOA 2GVBA 3MXNB 3K0XA 4QGUA 4HJ7A 3AYHB 1W2BA 4JG2A 2VW9A 2JA5G 4BXXH 3GDEA 3M4PA 1Y1WH 3MEFA 3H3VI 1RL2A 1VQ7A 3CP0A 2VL6A 3H0GH 1FJGL 3S17H 3CCUA 3OW2A 1PVOA 2WB1E 4LF8Q 3CD6A 1OXXK 3S1QH 1XPUA 2JA5H 4A93H 3STBC 2EIFA 5LMNL 1YITA 1HNXL 3KF6B 3PIPA 1KAWA 4JI1Q 2ATWA 1V1QA 5LMNW 3FKIH 2VZAA 4LUZA 1IBLL 1IZ6A 1YNXA 1FL0A 1FVIA 1SR3A 1ASZA 2MFIA 3CW2C 5FLMG 1XMQL 1W3SA 3F8TA 1O7IA 3E9IA 4LF7L 1SROA 2EQSA 2I0QA 4LF9L 3CCMA 5HGQA 4JI0Q 4DV7Q 4OWWB 1Q8KA 1UE7A 1PH9A 4YCWA 4DV4L 1PYBA 4JCVE 3UDXA 1UE6A 4R4OA 5FJ8H 4GOPB 1PH6A 4LF7Q 4A3DG 4IFDI 1OXVA 1IBKL 3SGIA 4LFAQ 3BJUA 1KRSA 1QZGA 4UP9A 5GQOA 4A3KH 1VQKA 4LFBQ 2WP8J 1CKOA 4JI8Q 5K36G 1E3PA 1U0LA 4NXNQ 1KD1C 4BXXG 1L1OA 3I4OA 1XNQQ 1I6HH 1UWVA 3DLLA 1MIUA 1KXLA 3A74A 4R4TA 3PF5A 1OTCA 4B3TQ 4X66L 2IX0A 3L0OA 1RIPA 4OONA 2N3SA 3G6EA 2C35B 1K3RA 1FJGQ 2B63G 3UE0A 1MKHA 3E0EA 4X65Q 1E1TA 2F4VQ 1SMXA 2D0PA 1VQ9A 4A3LH 2K75A 2YV5A 3T1YL 2H5XA 3OYYA 2GVAA 5IT9c 3RN2A 1L2FA 2Q2IA 3AFQA 4PMWA 4DR7L 3FHWA 3HOWH 4XTCS 4LFBL 3CCLA 5C0XI 3UE1A 1LM0A 2NN6I 3KYHC 1CSPA 3LGJA 3T1YQ 4UY8C 1XNRL 3GTOH 4JBJA 1X55A 3HOXH 2WAQG 1TWCH 3M4OH 5IP9H 3B6YA 5H1SE 2UXCL 2B63H 4PZ8A 2YYZA 2AKWB 1HR0W 1VQ4A 2EXDA 3BU2A 4AYBG 4DV3L 1Z9FA 4P71A 1N36L 4YHHQ 3PO3H 3ULLA 2QEXA 4A3BG 1YHBA 3ER0A 1JB7A 4TVAB 3ZJYC 1YJNA 1K83H 4X62L 3NENA 3HKZG 4MTNA 1EIFA 4GKKQ 4A3IH 1GKHA 3WWVA 4R4CA 2V1CC 1VQNA 3HOUH 1J5EQ 2R93H 4YWKA 4YWLA 1E24A 1CKMA 2AMCB 4JI3L 4A3FG 1Q1EA 3CQZH 1YHQA 1YI2A 1YZ6A 5M3FH 1SRUA 5FJ8G 4A4IA 2D0OA 4GN5A 2VQFL 4GOPA 5GROA 4P73A 5LMUL 4OWTB 4A3CH 5IP9G 3J81j 2YTVA 2ZJPA 3KF6A 4LUVA 4L5RC 1NBWA 4X62Q 4DR7Q 2I5LX 2K5HA 1Y1VG 2JA6H 5M5YH 3K7UC 3A5ZB 4JV5Q 1TXYA 4L5SA 4B3SQ 4XIGS 1X65A 1QUQA 4JI2L 4A3MG 2Q2TA 1XTDA 1P16A 2ASBA 1Z47A 4HIDA 3GTQH 3Q8DA 4R1JA 2IY5B 4WJ3M 4KHPL 2YU9H 2B3GA 4H02A 3K7AH 3J80i 1MJEA 4BBRG 4IO9A 1HNWQ 3JAMi 1J5EL 3RLFA 3UDGA 1NTGA 3HKSA 2UUCQ 4L5QA 4LF5Q 5IP7G 2A8VA 4J15A 4GKJL 4DV2Q 4JI5L 4OX9Q 1VQGA 1YVCA 3VDYA 4IJHA 2KCMA 1Y1VH 2JA6G 1KRTA 2JK8A 3EBEA 1N9WA 5C4JH 1HR0Q 2E2IH 5C3EH 4DV0Q 4BA1I 4DR4Q 1HNZL 4JOIA 3KLWA 1VQAA 4YCVA 3U4ZA 4IOAA 4B3RL 5GAHC 3BZKA 4A3JG 4YCUA 3I4MH 4A3CG 3PUZA 3FKIG 1WI5A 3PO2G 3HOVG 5M3MH 1A62A 1Q1BA 3GTLH 4PG3A 1IBLQ 1S3OA 3U50C 2R93G 2I5HA 4C3IH 1K0RA 1HZCA 2N78A 4A3IG 3CC4A 5JJIA 4GNXC 2E8GA 2HQLA 2XTIA 3J81i 3UDIA 3BZCA 2VS1A 3IRBA 2AWOA 3F2BA 2HHHQ 1EWIA 1CSQA 2BA0A 1X56A 1Q86C 1NY4A 1Q12A 2NVQH 2ZM6L 1PH1A 4YY3L 4RMFA 3DM3A 5IWAL 1PH7A 4Y7NH 2HIVA 4YWMA 3I56A 1R9TH 2JA8G 2OCEA 5IP7H 2CKZB 4DV2L 3ERSX 4DV1L 3AFPA 2CWPA 3CCRA 4DV1Q 4O0AA 2R7ZG 2NVTH 2Z6KC 1HH2P 4LFAL 3PUVA 2VUMH 1G51A 1BBUA 2KHIA 4DV5L 4MNOA 3M3YH 2CCZA 1VQDA 4JI4L 1C9OA 3UDFA 4B3RQ 3PUXA 3RLOA 3W1GA 4A3GH 1OXTA 1E1OA 2YTXA 4X66Q 4BA2I 1G6PA 4O2DA 2R7ZH 5IYDH 1HR0L 2LSSA 1WJJA 3RNUA 1NMFA 3W1BA 2R6GA 2L15A 3CC2A 3PGZA 3HKZE 4IPHA 3CCSA 5HY6A 3K8AA 1KHIA 1WCMG 2JA7G 4JBMA 5C4XH 3T1HQ 4JYAQ 2K14A 3M4QA 3STBD 1YJWA 4DUZL 2UUCL 4A76A 3CMEA 4HJAA 3PV0A 4KI0A 1VCIA 3H15A 2RCNA 2PI2A 3I4NG 2A19A 4NB3A 1N34L 2ZJQA 4OXPA 4DV7L 4DR5Q 1M90C 1BVSA 1VS0A 4R4IA 1Q7YC 2WAQE 5AJ3Q 4LF6L 2ID0A 2K5VA 5GAGC 5JEAG 1D8LA 3NEMA 1VQCA 1XMQQ 3GTGH 3HOXG 1GO3E 4JYAL 1CKNA 4IFDG 1N32L 3S1NH 1QVGA 4A3BH 3CC7A 5JJLA 2HT1A 4LF5L 4QL5A 4A75A 1HZ9A 5BR8Q 5LMUQ 4QQBX 2FXQA 1WCMH 2PI2E 5FLXc 1I94Q 2NZOA 4LF8L 4A3JH 4HJ5A 2E2JH 1E7ZA 5IE8A 4LF4L 3JAMc 4DR3L 5C44H 3HOYG 1JE5A 3D31A 4POFA 1S72A 1KIXA 1OXSC 4B3SL 1SLJA 1IYJB 4DK6C 1HZBA 2Z6KA 1VQ6A 4C3HH 5IYBH 2JA8H 1K73C 1LUZA 5M5XH 4UPAA 1BKBA 1EQRA 1M1KC 1N33Q 4YHHL 4DK3C 4AYBE 1IBML 3GD7A 4K0KQ 4AIMA 4P74A 4A3MH 1X3EA 3G4SA 4LF4Q 4NXML 2UXCQ 4LFCL 2MO0A 1TWHH 2LXKA 3K81C 2VNUD 4C3JH 3J7ZC 4HIMA 4X64L 3D0FA 1JJ2A 2OTLA 2CWAA 4EQ5A 2PMZE 2GN5A 1BBWA 3T1HL 2DUDA 1A8VA 2RHQB 3W5OA 1XPRA 4POGA 3I4MG 1N32Q 1VQ8A 4LWCA 1FGUA 1XMOL 2QGQA 4JI7L 3AEVA 1D7QA 2I5MX 4C2MH 2F52A 5DLQE 1HNZQ 3KDFB 2UUBQ 5M5WH 3KDFA 4B3TL 1N34Q 3J80c 2K4KA 4LF9Q 4MZ9A 3E9HA 1GVPA 1VQMA 1PHJA 3EIVA 2UU9Q 3CPWA 4EX5A 4B3MQ 1Q46A 1YJ9A 4DUZQ 2N8NA 1Q81C 3PO3G 4HIOA 1HZAA 3HOUG 1VQHA 3S2DH 2IX1A 1YHAA 1Y1WG 4A93G 2E2HH 2K50A 4JI1L 1K9MC 1B7YB 1J6QA 3TQYA 1TWGH 3PIOA 3RN5A 2QA4A 1PFSA 3I4NH 3GTJH 2RF4A 2AWNA 2IHEA 3ULPA 4QY7A 4JOIC 2ZTEA 1QZHA 4DR2Q 4A3EH 3F1ZA 4BBRH 4BY7G 1VQFA 4BY1G 1XMOQ 2NVXH 1PA6A 1XNRQ 2JA7H 2R92G 1K8AC 5IYBG 4IPGA 4BBSG 3S2HH 4TQUS 2JEAI 5GADC 4DR1Q 4P75A 1EUJA 2XGTA 4A3EG 5IYDG 3S15H 4GLXA 3G48A 2UU9L 3J81c 1AH9A 1I3QH 2ZM6Q 1CKNB 1HJPA 1QVCA 4QJFA 4AQYL 1YIJA 2R92H 3GTPH 3RR5A 3ICEA 1PH3A 1IXRA 2E5LL 2VUMG 1YEZA 3CCJA 3I55A 4BY7H 1JJGA 3PF4A 1WFQA 1QVFA 4JI7Q 4DPGA 1WYDA 3L2PA 4JV5L 2OQ0A 2IT1A 2JQOA 1AE2A 2YTYA 4GN4B 1N33L 2PNHA 4A3DH 1PH8A 1L1OC 3GTMH 2A1AA 2UXDL 1SN8A 2CFMA 2K52A 3PUYA 1N36Q 5C4XG 5AJ3L 2Z0SA 4QIWE 4KHZA 1LYLA 4NPSA 5EAYA 1B70B 3J7A5 1GD7A 2B29A 2OWOA 5IY0A 5IYCG 2VY3A 4JI2Q 1IBMQ 4A3GG 2ES2A 2Y0SE 3PSIA 1X3FA 2VQEQ 5E7NA 2MQHA 2BH8A 4RG1A 3PO2H 4UP8A 1VQOA 4GKJQ 1A63A 1B8AA 3AQQA 2N49A 4DAMA 3PCOB 4PZ7A 4HJ8A 2WFWA 3S16H 4LF6Q 1H95A 1IL2A 1HNWL 3S1MH 4GS3A 1U5KA 1N8RC 4IPDA 2DGYA 4JBWA 3M7NA 1VQJA 2D62A 2PQAA 3S14H 3G71A 4DR6L 4GKKL 2R7DA 4JI8L 2NN6G 3S24A 1JMCA 4GN3B 1L0WA 5GAEC 1TWFH 2UXBQ 3A0JA 1IBKQ 3KOJA 1PH4A 4L5TA 2MO1A 4DUYQ 3L7ZC 4X65L 1S40A 4DR2L 2JA9A 3NELA 3HOVH 2HHHL 4APVA 1UE5A 2E5LQ 4JI0L 1DGSA 3CXCA 4GNXA 2R7FA 4GLVB 4AQYQ 4JI4Q 3CPFA 5C0XJ 3CCQA 4DV5Q 1XNQL 3OTOQ 1UEBA 2Y0SG 5C3EG 2NZHA 2K5NA 3A5UA 4HIKA 4DR1L 4IPCA 4JI6Q 1I50H 1PV4A 1EQQA 3CAMA 4B3ML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE8 A;  3JC6 6;  1OXU A;  5LMN Q;  1HNX Q;  4YY3 Q;  4JC0 A;  5IWA Q;  3TRZ A;  1V9P A;  1PH2 A;  2KHJ A;  3F2D A;  4A3F H;  1G29 1;  1X9N A;  1X54 A;  1KQS A;  4DR4 L;  4ME3 A;  2AHO B;  4DNI A;  4NXM Q;  4P72 A;  4PZ6 A;  1TWA H;  1WOC A;  4K0K L;  4DUY L;  3KJO A;  1X6O A;  1JJC B;  1EOV A;  4NXN L;  4ALP A;  3M85 A;  1LTL A;  2WB1 G;  3CCV A;  1VQL A;  1EIY B;  3K80 C;  3ULJ A;  1T9H A;  4LUO A;  1NMG A;  3OTO L;  2JEB I;  3NBH B;  2LXJ A;  1L1O B;  3HFZ B;  4IOC A;  1VQ5 A;  3TS2 A;  4BBS H;  4DV4 Q;  2F4V L;  4KHP Q;  4JBK A;  4A3L G;  3TRE A;  2ALY B;  4DAY B;  4BY1 H;  3KF8 B;  4WJ4 A;  1Y14 B;  5IYC H;  1P8L A;  3GO5 A;  4R4Q A;  1I94 L;  1X3G A;  2JJQ A;  5C44 G;  3HOY H;  5BR8 L;  1UE1 A;  3HOW G;  2NVY H;  2KEN A;  1XJV A;  1C7Y A;  1CUK A;  3RLN A;  2HIX A;  5JJK A;  5JEA J;  1YBY A;  1Q82 C;  1EYG A;  1SFO H;  1GM5 A;  3U4V A;  4Y52 H;  2VQE L;  4DR6 Q;  3U58 A;  3HOZ G;  4IFD J;  2BH2 A;  1A0I A;  4AH6 A;  4DV6 L;  5M3F G;  1MJC A;  3F2C A;  4HJ9 A;  3FP9 A;  1VQP A;  4DR5 L;  2KCT A;  3S1R H;  3RZO H;  4X6A H;  2BA1 A;  3GTK H;  3I2Z A;  1E22 A;  4FDB A;  1C0A A;  4DV0 L;  2UUB L;  3CCE A;  1AE3 A;  2RHS B;  3HOZ H;  2ZTC A;  2OQK A;  4JI3 Q;  1NE3 A;  4IJL A;  2KBN A;  1PYS B;  4A3K G;  2UXD Q;  1KL9 A;  2MNA A;  2ZJR A;  5M3M G;  3TEH B;  1V43 A;  1K8G A;  4LNQ A;  4OO1 I;  2UUA Q;  4JI5 Q;  2JE6 I;  4OX9 L;  2Q2H A;  4LW1 A;  4JI6 L;  1VQE A;  5FLM H;  1EFW A;  2UUA L;  3KFU A;  5ELN A;  5C0X G;  1JT8 A;  3PUW A;  2PQA B;  4X64 Q;  1I5F A;  4DV3 Q;  4GOP C;  1PH5 A;  1VQI A;  2UXB L;  2OTJ A;  3I7F A;  3CF5 A;  4OO1 G;  3H3V H;  1XPO A;  2VQF Q;  4DR3 Q;  4KLK A;  3TS0 A;  1ASY A;  1VQB A;  3CMA A;  5J3B A;  3KJP A;  2CQO A;  2ZTD A;  2Q2U A;  4LFC Q;  1KC8 C;  3EN2 A;  4UP7 A;  3M9B A;  3RZD H;  4GNX B;  4GLA C;  4DKA C;  1QUQ B;  4DV6 Q;  1NJI C;  2F3I A;  4OWX B;  2IHF A;  3H0G G;  5ELO A;  2GVB A;  3MXN B;  3K0X A;  4QGU A;  4HJ7 A;  3AYH B;  1W2B A;  4JG2 A;  2VW9 A;  2JA5 G;  4BXX H;  3GDE A;  3M4P A;  1Y1W H;  3MEF A;  3H3V I;  1RL2 A;  1VQ7 A;  3CP0 A;  2VL6 A;  3H0G H;  1FJG L;  3S17 H;  3CCU A;  3OW2 A;  1PVO A;  2WB1 E;  4LF8 Q;  3CD6 A;  1OXX K;  3S1Q H;  1XPU A;  2JA5 H;  4A93 H;  3STB C;  2EIF A;  5LMN L;  1YIT A;  1HNX L;  3KF6 B;  3PIP A;  1KAW A;  4JI1 Q;  2ATW A;  1V1Q A;  5LMN W;  3FKI H;  2VZA A;  4LUZ A;  1IBL L;  1IZ6 A;  1YNX A;  1FL0 A;  1FVI A;  1SR3 A;  1ASZ A;  2MFI A;  3CW2 C;  5FLM G;  1XMQ L;  1W3S A;  3F8T A;  1O7I A;  3E9I A;  4LF7 L;  1SRO A;  2EQS A;  2I0Q A;  4LF9 L;  3CCM A;  5HGQ A;  4JI0 Q;  4DV7 Q;  4OWW B;  1Q8K A;  1UE7 A;  1PH9 A;  4YCW A;  4DV4 L;  1PYB A;  4JCV E;  3UDX A;  1UE6 A;  4R4O A;  5FJ8 H;  4GOP B;  1PH6 A;  4LF7 Q;  4A3D G;  4IFD I;  1OXV A;  1IBK L;  3SGI A;  4LFA Q;  3BJU A;  1KRS A;  1QZG A;  4UP9 A;  5GQO A;  4A3K H;  1VQK A;  4LFB Q;  2WP8 J;  1CKO A;  4JI8 Q;  5K36 G;  1E3P A;  1U0L A;  4NXN Q;  1KD1 C;  4BXX G;  1L1O A;  3I4O A;  1XNQ Q;  1I6H H;  1UWV A;  3DLL A;  1MIU A;  1KXL A;  3A74 A;  4R4T A;  3PF5 A;  1OTC A;  4B3T Q;  4X66 L;  2IX0 A;  3L0O A;  1RIP A;  4OON A;  2N3S A;  3G6E A;  2C35 B;  1K3R A;  1FJG Q;  2B63 G;  3UE0 A;  1MKH A;  3E0E A;  4X65 Q;  1E1T A;  2F4V Q;  1SMX A;  2D0P A;  1VQ9 A;  4A3L H;  2K75 A;  2YV5 A;  3T1Y L;  2H5X A;  3OYY A;  2GVA A;  5IT9 c;  3RN2 A;  1L2F A;  2Q2I A;  3AFQ A;  4PMW A;  4DR7 L;  3FHW A;  3HOW H;  4XTC S;  4LFB L;  3CCL A;  5C0X I;  3UE1 A;  1LM0 A;  2NN6 I;  3KYH C;  1CSP A;  3LGJ A;  3T1Y Q;  4UY8 C;  1XNR L;  3GTO H;  4JBJ A;  1X55 A;  3HOX H;  2WAQ G;  1TWC H;  3M4O H;  5IP9 H;  3B6Y A;  5H1S E;  2UXC L;  2B63 H;  4PZ8 A;  2YYZ A;  2AKW B;  1HR0 W;  1VQ4 A;  2EXD A;  3BU2 A;  4AYB G;  4DV3 L;  1Z9F A;  4P71 A;  1N36 L;  4YHH Q;  3PO3 H;  3ULL A;  2QEX A;  4A3B G;  1YHB A;  3ER0 A;  1JB7 A;  4TVA B;  3ZJY C;  1YJN A;  1K83 H;  4X62 L;  3NEN A;  3HKZ G;  4MTN A;  1EIF A;  4GKK Q;  4A3I H;  1GKH A;  3WWV A;  4R4C A;  2V1C C;  1VQN A;  3HOU H;  1J5E Q;  2R93 H;  4YWK A;  4YWL A;  1E24 A;  1CKM A;  2AMC B;  4JI3 L;  4A3F G;  1Q1E A;  3CQZ H;  1YHQ A;  1YI2 A;  1YZ6 A;  5M3F H;  1SRU A;  5FJ8 G;  4A4I A;  2D0O A;  4GN5 A;  2VQF L;  4GOP A;  5GRO A;  4P73 A;  5LMU L;  4OWT B;  4A3C H;  5IP9 G;  3J81 j;  2YTV A;  2ZJP A;  3KF6 A;  4LUV A;  4L5R C;  1NBW A;  4X62 Q;  4DR7 Q;  2I5L X;  2K5H A;  1Y1V G;  2JA6 H;  5M5Y H;  3K7U C;  3A5Z B;  4JV5 Q;  1TXY A;  4L5S A;  4B3S Q;  4XIG S;  1X65 A;  1QUQ A;  4JI2 L;  4A3M G;  2Q2T A;  1XTD A;  1P16 A;  2ASB A;  1Z47 A;  4HID A;  3GTQ H;  3Q8D A;  4R1J A;  2IY5 B;  4WJ3 M;  4KHP L;  2YU9 H;  2B3G A;  4H02 A;  3K7A H;  3J80 i;  1MJE A;  4BBR G;  4IO9 A;  1HNW Q;  3JAM i;  1J5E L;  3RLF A;  3UDG A;  1NTG A;  3HKS A;  2UUC Q;  4L5Q A;  4LF5 Q;  5IP7 G;  2A8V A;  4J15 A;  4GKJ L;  4DV2 Q;  4JI5 L;  4OX9 Q;  1VQG A;  1YVC A;  3VDY A;  4IJH A;  2KCM A;  1Y1V H;  2JA6 G;  1KRT A;  2JK8 A;  3EBE A;  1N9W A;  5C4J H;  1HR0 Q;  2E2I H;  5C3E H;  4DV0 Q;  4BA1 I;  4DR4 Q;  1HNZ L;  4JOI A;  3KLW A;  1VQA A;  4YCV A;  3U4Z A;  4IOA A;  4B3R L;  5GAH C;  3BZK A;  4A3J G;  4YCU A;  3I4M H;  4A3C G;  3PUZ A;  3FKI G;  1WI5 A;  3PO2 G;  3HOV G;  5M3M H;  1A62 A;  1Q1B A;  3GTL H;  4PG3 A;  1IBL Q;  1S3O A;  3U50 C;  2R93 G;  2I5H A;  4C3I H;  1K0R A;  1HZC A;  2N78 A;  4A3I G;  3CC4 A;  5JJI A;  4GNX C;  2E8G A;  2HQL A;  2XTI A;  3J81 i;  3UDI A;  3BZC A;  2VS1 A;  3IRB A;  2AWO A;  3F2B A;  2HHH Q;  1EWI A;  1CSQ A;  2BA0 A;  1X56 A;  1Q86 C;  1NY4 A;  1Q12 A;  2NVQ H;  2ZM6 L;  1PH1 A;  4YY3 L;  4RMF A;  3DM3 A;  5IWA L;  1PH7 A;  4Y7N H;  2HIV A;  4YWM A;  3I56 A;  1R9T H;  2JA8 G;  2OCE A;  5IP7 H;  2CKZ B;  4DV2 L;  3ERS X;  4DV1 L;  3AFP A;  2CWP A;  3CCR A;  4DV1 Q;  4O0A A;  2R7Z G;  2NVT H;  2Z6K C;  1HH2 P;  4LFA L;  3PUV A;  2VUM H;  1G51 A;  1BBU A;  2KHI A;  4DV5 L;  4MNO A;  3M3Y H;  2CCZ A;  1VQD A;  4JI4 L;  1C9O A;  3UDF A;  4B3R Q;  3PUX A;  3RLO A;  3W1G A;  4A3G H;  1OXT A;  1E1O A;  2YTX A;  4X66 Q;  4BA2 I;  1G6P A;  4O2D A;  2R7Z H;  5IYD H;  1HR0 L;  2LSS A;  1WJJ A;  3RNU A;  1NMF A;  3W1B A;  2R6G A;  2L15 A;  3CC2 A;  3PGZ A;  3HKZ E;  4IPH A;  3CCS A;  5HY6 A;  3K8A A;  1KHI A;  1WCM G;  2JA7 G;  4JBM A;  5C4X H;  3T1H Q;  4JYA Q;  2K14 A;  3M4Q A;  3STB D;  1YJW A;  4DUZ L;  2UUC L;  4A76 A;  3CME A;  4HJA A;  3PV0 A;  4KI0 A;  1VCI A;  3H15 A;  2RCN A;  2PI2 A;  3I4N G;  2A19 A;  4NB3 A;  1N34 L;  2ZJQ A;  4OXP A;  4DV7 L;  4DR5 Q;  1M90 C;  1BVS A;  1VS0 A;  4R4I A;  1Q7Y C;  2WAQ E;  5AJ3 Q;  4LF6 L;  2ID0 A;  2K5V A;  5GAG C;  5JEA G;  1D8L A;  3NEM A;  1VQC A;  1XMQ Q;  3GTG H;  3HOX G;  1GO3 E;  4JYA L;  1CKN A;  4IFD G;  1N32 L;  3S1N H;  1QVG A;  4A3B H;  3CC7 A;  5JJL A;  2HT1 A;  4LF5 L;  4QL5 A;  4A75 A;  1HZ9 A;  5BR8 Q;  5LMU Q;  4QQB X;  2FXQ A;  1WCM H;  2PI2 E;  5FLX c;  1I94 Q;  2NZO A;  4LF8 L;  4A3J H;  4HJ5 A;  2E2J H;  1E7Z A;  5IE8 A;  4LF4 L;  3JAM c;  4DR3 L;  5C44 H;  3HOY G;  1JE5 A;  3D31 A;  4POF A;  1S72 A;  1KIX A;  1OXS C;  4B3S L;  1SLJ A;  1IYJ B;  4DK6 C;  1HZB A;  2Z6K A;  1VQ6 A;  4C3H H;  5IYB H;  2JA8 H;  1K73 C;  1LUZ A;  5M5X H;  4UPA A;  1BKB A;  1EQR A;  1M1K C;  1N33 Q;  4YHH L;  4DK3 C;  4AYB E;  1IBM L;  3GD7 A;  4K0K Q;  4AIM A;  4P74 A;  4A3M H;  1X3E A;  3G4S A;  4LF4 Q;  4NXM L;  2UXC Q;  4LFC L;  2MO0 A;  1TWH H;  2LXK A;  3K81 C;  2VNU D;  4C3J H;  3J7Z C;  4HIM A;  4X64 L;  3D0F A;  1JJ2 A;  2OTL A;  2CWA A;  4EQ5 A;  2PMZ E;  2GN5 A;  1BBW A;  3T1H L;  2DUD A;  1A8V A;  2RHQ B;  3W5O A;  1XPR A;  4POG A;  3I4M G;  1N32 Q;  1VQ8 A;  4LWC A;  1FGU A;  1XMO L;  2QGQ A;  4JI7 L;  3AEV A;  1D7Q A;  2I5M X;  4C2M H;  2F52 A;  5DLQ E;  1HNZ Q;  3KDF B;  2UUB Q;  5M5W H;  3KDF A;  4B3T L;  1N34 Q;  3J80 c;  2K4K A;  4LF9 Q;  4MZ9 A;  3E9H A;  1GVP A;  1VQM A;  1PHJ A;  3EIV A;  2UU9 Q;  3CPW A;  4EX5 A;  4B3M Q;  1Q46 A;  1YJ9 A;  4DUZ Q;  2N8N A;  1Q81 C;  3PO3 G;  4HIO A;  1HZA A;  3HOU G;  1VQH A;  3S2D H;  2IX1 A;  1YHA A;  1Y1W G;  4A93 G;  2E2H H;  2K50 A;  4JI1 L;  1K9M C;  1B7Y B;  1J6Q A;  3TQY A;  1TWG H;  3PIO A;  3RN5 A;  2QA4 A;  1PFS A;  3I4N H;  3GTJ H;  2RF4 A;  2AWN A;  2IHE A;  3ULP A;  4QY7 A;  4JOI C;  2ZTE A;  1QZH A;  4DR2 Q;  4A3E H;  3F1Z A;  4BBR H;  4BY7 G;  1VQF A;  4BY1 G;  1XMO Q;  2NVX H;  1PA6 A;  1XNR Q;  2JA7 H;  2R92 G;  1K8A C;  5IYB G;  4IPG A;  4BBS G;  3S2H H;  4TQU S;  2JEA I;  5GAD C;  4DR1 Q;  4P75 A;  1EUJ A;  2XGT A;  4A3E G;  5IYD G;  3S15 H;  4GLX A;  3G48 A;  2UU9 L;  3J81 c;  1AH9 A;  1I3Q H;  2ZM6 Q;  1CKN B;  1HJP A;  1QVC A;  4QJF A;  4AQY L;  1YIJ A;  2R92 H;  3GTP H;  3RR5 A;  3ICE A;  1PH3 A;  1IXR A;  2E5L L;  2VUM G;  1YEZ A;  3CCJ A;  3I55 A;  4BY7 H;  1JJG A;  3PF4 A;  1WFQ A;  1QVF A;  4JI7 Q;  4DPG A;  1WYD A;  3L2P A;  4JV5 L;  2OQ0 A;  2IT1 A;  2JQO A;  1AE2 A;  2YTY A;  4GN4 B;  1N33 L;  2PNH A;  4A3D H;  1PH8 A;  1L1O C;  3GTM H;  2A1A A;  2UXD L;  1SN8 A;  2CFM A;  2K52 A;  3PUY A;  1N36 Q;  5C4X G;  5AJ3 L;  2Z0S A;  4QIW E;  4KHZ A;  1LYL A;  4NPS A;  5EAY A;  1B70 B;  3J7A 5;  1GD7 A;  2B29 A;  2OWO A;  5IY0 A;  5IYC G;  2VY3 A;  4JI2 Q;  1IBM Q;  4A3G G;  2ES2 A;  2Y0S E;  3PSI A;  1X3F A;  2VQE Q;  5E7N A;  2MQH A;  2BH8 A;  4RG1 A;  3PO2 H;  4UP8 A;  1VQO A;  4GKJ Q;  1A63 A;  1B8A A;  3AQQ A;  2N49 A;  4DAM A;  3PCO B;  4PZ7 A;  4HJ8 A;  2WFW A;  3S16 H;  4LF6 Q;  1H95 A;  1IL2 A;  1HNW L;  3S1M H;  4GS3 A;  1U5K A;  1N8R C;  4IPD A;  2DGY A;  4JBW A;  3M7N A;  1VQJ A;  2D62 A;  2PQA A;  3S14 H;  3G71 A;  4DR6 L;  4GKK L;  2R7D A;  4JI8 L;  2NN6 G;  3S24 A;  1JMC A;  4GN3 B;  1L0W A;  5GAE C;  1TWF H;  2UXB Q;  3A0J A;  1IBK Q;  3KOJ A;  1PH4 A;  4L5T A;  2MO1 A;  4DUY Q;  3L7Z C;  4X65 L;  1S40 A;  4DR2 L;  2JA9 A;  3NEL A;  3HOV H;  2HHH L;  4APV A;  1UE5 A;  2E5L Q;  4JI0 L;  1DGS A;  3CXC A;  4GNX A;  2R7F A;  4GLV B;  4AQY Q;  4JI4 Q;  3CPF A;  5C0X J;  3CCQ A;  4DV5 Q;  1XNQ L;  3OTO Q;  1UEB A;  2Y0S G;  5C3E G;  2NZH A;  2K5N A;  3A5U A;  4HIK A;  4DR1 L;  4IPC A;  4JI6 Q;  1I50 H;  1PV4 A;  1EQQ A;  3CAM A;  4B3M L; 
#chains in the Genus database with same CATH topology
 3DWA A;  4JC0 A;  1V9P A;  1PH2 A;  4K8J A;  3F2D A;  1X9N A;  1EY7 A;  4WRD A;  4DR4 L;  2AHO B;  1HFN A;  1JJC B;  4ALP A;  3M85 A;  2WB1 G;  1VQL A;  1SXT A;  2QCP X;  3CRL C;  1EWC A;  1EIY B;  1NMG A;  2IL8 A;  2JEB I;  3NBH B;  2LXJ A;  1L1O B;  3TS2 A;  1E2V A;  5JAV A;  4A3L G;  2K28 A;  4FF3 A;  1AW7 A;  4R4Q A;  5IYC H;  3W3A A;  3KBX A;  3HOX B;  2IWH A;  3J7Y W;  5JEA J;  3U4V A;  4HMJ A;  1SDF A;  4NW2 A;  5CMD A;  2BH2 A;  3DWP A;  4IFD J;  3L3O C;  4DV6 L;  2KCT A;  3RZO H;  3C1F A;  1NR4 A;  4K6L A;  2XRQ D;  1E22 A;  4L63 B;  1C0A A;  4DV0 L;  3HOZ H;  5LL6 S;  2K1B A;  3X3N A;  5C5L A;  1I6H B;  5M3M G;  4LNQ A;  3NK9 A;  5I2X A;  3LNN A;  1VQE A;  4EVO A;  4QIW B;  3PUW A;  1PH5 A;  4PMC A;  4H13 C;  2F0N A;  4OO1 G;  3H3V H;  2VQF Q;  1G8Z D;  1ASY A;  2L12 A;  2X6G A;  2ZXP A;  4RKL A;  1RHP A;  4LFC Q;  2XSC A;  1KC8 C;  4XQQ A;  1TWG B;  3M9B A;  4DKA C;  1QUQ B;  2K33 A;  2GVB A;  2PZU A;  2NWG A;  3K0X A;  2L9H A;  4QGU A;  3IAY A;  1SYB A;  4N8X 1;  3NPP A;  2A6H C;  3FKI B;  4U67 3;  4LK1 C;  3MEF A;  4C56 C;  3CP0 A;  3UI2 A;  3H0G H;  3PIO 3;  1PVO A;  2ICI A;  1I3Q B;  3SK6 A;  2E76 C;  4A93 H;  3STB C;  1YIT A;  1EY0 A;  1KAW A;  4JI1 Q;  2B2T A;  2ATW A;  4R9W A;  3LWU A;  1A6X A;  2EJG C;  1ASZ A;  5FLM G;  1XMQ L;  4KJN A;  3F8T A;  3E9I A;  1SRO A;  1PRT F;  2I0Q A;  2F0T A;  3JAM L;  1EZ6 A;  2WB1 B;  1LTB D;  4JCV E;  1UE6 A;  4A3D G;  1AN8 A;  1JOO A;  1OXV A;  3SGI A;  3BJU A;  4F7X A;  3QOL A;  1QZG A;  4UP9 A;  1ROD A;  4IUU A;  2F3V A;  4HTH A;  4HR7 B;  2F0O A;  5K36 G;  1U0L A;  4NXN Q;  1KD1 C;  1L0X B;  3BS1 A;  2I07 B;  3A74 A;  3PF5 A;  4ODG A;  3L0O A;  1RIP A;  1EU4 A;  2R61 A;  3E0E A;  1E1T A;  4X65 Q;  1VQ9 A;  2OF1 A;  1KNE A;  3RN2 A;  1L2F A;  4XT3 B;  1A2U A;  3FHW A;  3HOW H;  2AQ1 B;  1CSP A;  4UY8 C;  1X3P A;  2QF7 A;  4RGT A;  3B6Y A;  5H1S E;  3SHL A;  5IT9 E;  2AKW B;  4CKC A;  1N36 L;  1HR0 W;  4A3B G;  1Z9F A;  3Q22 A;  3NTI A;  3RUZ A;  1TWF B;  4X62 L;  3HKZ G;  4A3I H;  2V1C C;  4YWL A;  2AMC B;  3HS0 C;  4A3F G;  3FEW X;  1WTO A;  1L0Y B;  5ELE A;  5M3F H;  1SRU A;  1EEF D;  3VYU A;  5FJ8 G;  1O80 A;  4OGQ C;  5IGF A;  2VQF L;  5GRO A;  4P73 A;  2BDO A;  2ZJP A;  2JSO A;  4XXE A;  5IOC A;  4DR7 Q;  3ONA B;  5KYI A;  5IGB A;  1X65 A;  1B50 A;  5DEH A;  4AYB B;  1S5D D;  4DAY A;  3Q8D A;  4K2L A;  2K5W A;  2PO4 A;  5CBA E;  3K7A H;  5ELD A;  1HXY D;  4FXK C;  4IAL A;  4IO9 A;  4CBV A;  1HA6 A;  2CQA A;  1DM0 B;  4L5Q A;  5IP7 G;  2JYO A;  3GTM B;  2F3W A;  3NXW A;  2PMZ B;  1RCV D;  4K2K A;  4IJH A;  1HCZ A;  1Y1V H;  3R93 A;  1KRT A;  3HGB A;  1HR0 Q;  5C4J H;  3VA7 A;  4DR4 Q;  1PLF A;  1HNZ L;  5KGU A;  1NAP A;  1VQA A;  4IOA A;  2F0D A;  3MTS A;  3BZK A;  4YCU A;  3I4M H;  2K6A A;  1KLG D;  3FKI G;  4FF2 A;  2BE5 C;  4QUF A;  4KN4 C;  2QEJ C;  3U50 C;  2R93 G;  2I5H A;  3CC4 A;  1K0R A;  5FK9 C;  1CHP D;  1J8I A;  4OHJ A;  3S2H B;  2EZV A;  1KLU D;  2F1M A;  2VS1 A;  3IRB A;  3KF8 A;  3OSO A;  4A3E B;  3IL8 A;  1JIC A;  3CHB D;  1PDQ A;  1HQM C;  1VMP A;  4Z9C B;  2NVQ H;  4RMF A;  4Y7N H;  2HIV A;  4YWM A;  3I56 A;  2OCE A;  5IP7 H;  5IGC A;  2O4X A;  4KY6 A;  5KIX A;  2CWP A;  3NQI A;  4O0A A;  2NVT H;  5A2Q E;  1G51 A;  1STN A;  4MNO A;  2CCZ A;  1VQD A;  1SBB B;  1C9O A;  4B3R Q;  2FFK B;  3K0Y A;  3RLO A;  5C3E B;  4A3G H;  2YTX A;  4BA2 I;  2DNC A;  3EVQ A;  4FVM A;  2R6G A;  2L15 A;  3CC2 A;  1TS3 A;  2MGS A;  3CCS A;  1TR5 A;  1XYI A;  4I7A A;  4JBM A;  5C4X H;  3T1H Q;  1CI3 M;  3I91 A;  3STB D;  4IUR A;  3RMH A;  1YJW A;  2UUC L;  3CME A;  3E5S A;  1E2Z A;  1VCI A;  1FD7 D;  1GOZ A;  3I4N G;  2A19 A;  2H4O A;  1N34 L;  5J39 A;  1JWM D;  4DR5 Q;  1VS0 A;  1PYW D;  2ID0 A;  2K5V A;  5CGK A;  2F0L A;  1XMQ Q;  3GTG H;  3MAQ A;  5M5Y B;  4XQN A;  3HOX G;  3C1E A;  4A3B H;  2HDM A;  1GUW A;  3J81 E;  1S5C D;  2X69 A;  1PRT B;  3OMC A;  1HZ9 A;  4CDD C;  5LMU Q;  4MHE A;  1SNQ A;  3CQZ B;  2E2J H;  1E7Z A;  4X3K A;  1JQY D;  1WD0 A;  1JE5 A;  1OXS C;  5JPM C;  4B3S L;  1IYJ B;  4DK6 C;  2JA8 H;  2FMC A;  2ZXO A;  4UPA A;  1C4Q A;  1D1I A;  1M1K C;  1N33 Q;  2C9O A;  2I46 A;  1EY9 A;  4C1N K;  3GD7 A;  4K0K Q;  1PTO C;  2PPB C;  3H94 A;  1U9R A;  1I4X A;  1VDZ A;  4NXM L;  1R4Q B;  1X3E A;  4LFC L;  1EYD A;  2LXK A;  3K81 C;  5TSS A;  2F0E A;  3D0F A;  2CWA A;  4EQ5 A;  1WTH A;  2DUD A;  4RHR A;  3W5O A;  1O7Y A;  3IFD A;  3LWE A;  1VQ8 A;  1N32 Q;  2JA5 B;  1DJR D;  2P5Z X;  4JI7 L;  3AEV A;  4IUT A;  4MTK A;  5M5W H;  3KDF A;  3S17 B;  4QCL A;  2BCO A;  3J80 c;  3EIV A;  3M3Y B;  3E6Z X;  3DHQ A;  5C3X A;  4ILW A;  3PO3 G;  1DZ1 A;  3QJY A;  3S2D H;  2E2H H;  3ND8 A;  1J6Q A;  3RN5 A;  4G7H C;  1SE3 A;  4NMZ A;  3GTJ H;  2EY1 A;  2RF4 A;  2PW7 A;  1XXG A;  2IHE A;  1HTP A;  1XMO Q;  3OWF A;  3EFX D;  4IPG A;  5LHY 1;  1WD1 A;  2F0I A;  4DR1 Q;  2XGT A;  4HMI A;  4A3E G;  4R8I A;  5IYD G;  3DEP A;  2DJF C;  3G48 A;  1AH9 A;  4CJ1 B;  4QJF A;  2F0Q A;  3ICE A;  5IOD A;  1PMR A;  3CCJ A;  4BY7 H;  2KED A;  1G91 A;  1Y1W B;  1WYD A;  1LT6 D;  2FMM A;  4JV5 L;  1AE2 A;  1HQR D;  4A3D H;  1ESF A;  2WV6 D;  1L1O C;  4CKB A;  2UXD L;  5C4X G;  4K14 A;  3S9W A;  3MC0 B;  3TN2 A;  4OIK A;  5IY0 A;  5IYC G;  3T16 A;  2VY3 A;  1IBM Q;  2Z4H A;  4A3G G;  1UAP A;  5E7N A;  2F0S A;  2MQH A;  3A7L A;  4RG1 A;  4UP8 A;  2LFN A;  1H9S A;  3IFT A;  2JA6 B;  2X6L A;  4C3I B;  3VR2 A;  2SNM A;  3I3C A;  2WFW A;  3D6W A;  4EGV A;  4GS3 A;  4JBW A;  1VQJ A;  1D2B A;  3FMC A;  3S14 H;  3G71 A;  4DR6 L;  2F0F A;  4L6T B;  2NN6 G;  1KNA A;  3S24 A;  3QR8 A;  3NP8 A;  3KLS A;  4ZRZ A;  5DNF A;  4L5T A;  4DUY Q;  3PO3 B;  4DU9 A;  4KN7 C;  4KV6 A;  2HHH L;  4APV A;  2B63 B;  4JI0 L;  5J22 A;  2R7F A;  1K28 A;  4DV5 Q;  1UEB A;  4XDX A;  2VB2 X;  4HCS A;  4CDF C;  1X32 A;  4IPC A;  1I50 H;  4DXG A;  1EQQ A;  4A3C H;  2SEB D;  5KNC A;  1HNX Q;  5IWA Q;  2MJ8 A;  3TRZ A;  2N88 A;  3S1M B;  2XNA C;  2QDL A;  4NXM Q;  4PZ6 A;  1WOC A;  4K0K L;  1EL0 A;  4KY7 A;  1G2S A;  5EJW A;  1EOV A;  2CW0 D;  3PO2 B;  1NCV A;  1YNJ D;  3MXG A;  1JWS D;  3HEJ A;  1AZP A;  3CCV A;  4CJ2 C;  3ULJ A;  3T56 B;  4IOC A;  2ENB A;  1W6K A;  4BBS H;  2F4V L;  5T1G A;  4BY1 H;  2KEE A;  1P8L A;  4DN4 M;  1Y8P B;  2EYF A;  2JJQ A;  5C44 G;  1UE1 A;  1I4G A;  4B08 A;  1RD9 D;  2IPK D;  1K8M A;  1C7Y A;  2M9V A;  4IFD H;  3RLN A;  1Y8N B;  5FKA C;  5EQ0 A;  1LTA D;  1Q82 C;  1SFO H;  4DR6 Q;  2PCF B;  1A0I A;  1UUP A;  5M3F G;  1MJC A;  1B3A A;  3FP9 A;  3U9O A;  4HJ9 A;  4DR5 L;  3S1R H;  3GTP B;  2R92 B;  3I2Z A;  3S1Q B;  1DD2 A;  4IZ8 A;  2QW7 A;  4XQJ A;  1EIH A;  3CCE A;  4XYO A;  2OQK A;  4IJL A;  3K57 A;  4A3K G;  2ZJR A;  1FNV A;  2UUA Q;  3OIQ A;  3KFU A;  4ABN A;  1JT8 A;  4X64 Q;  1I5F A;  4DV3 Q;  4GOP C;  2UXB L;  1VQI A;  3CF5 A;  3BG3 A;  3RZD B;  2A5H A;  1PFB A;  2CQO A;  1LTR D;  3EN2 A;  4UP7 A;  1DOL A;  1IYU A;  4KKU A;  1GUG A;  5G3L F;  1NJI C;  1F2Z A;  1JB3 A;  4HJ7 A;  3AYH B;  2K01 A;  2VW9 A;  1SNO A;  4DNT B;  1G6Z A;  1Y1W H;  1SSO A;  1BF4 A;  1RL2 A;  4IUV A;  1FJG L;  5BN3 A;  1WVL A;  1M8A A;  3CD6 A;  2OXP A;  4HCE A;  2JXM B;  5CC4 A;  3PIP A;  5CYU A;  2H1E A;  1V1Q A;  2VZA A;  1IZ6 A;  4Q0F A;  1TY0 A;  1QNU A;  3ITP A;  4LF7 L;  4K8I A;  4LF9 L;  1KDA A;  1M4V A;  2B8F A;  4OWW B;  5K5P A;  1PH9 A;  4WFN 3;  3GTJ B;  4YCW A;  3NHH A;  4DV4 L;  3NTK A;  1PYB A;  1H9M A;  3UDX A;  4R4O A;  1PH6 A;  2E2H B;  3EQL C;  3S2D B;  4LFB Q;  1LTS D;  3D4W A;  4JI8 Q;  1CKO A;  5EKI A;  1E3P A;  1PTO H;  1WTR A;  3I4O A;  1BO0 A;  1MIU A;  1KXL A;  5M5W B;  5HGT A;  4HSV A;  4OON A;  4UAI A;  3G6E A;  3UE0 A;  1MKH A;  2F4V Q;  1GUN A;  4A3F B;  1O7L A;  2YV5 A;  1LAC A;  3T1Y L;  4ZKB B;  5IT9 c;  5AFW A;  3HKZ B;  3AFQ A;  3KLS X;  4KKS A;  4PMW A;  4DR7 L;  4XTC S;  1TT2 A;  1IW7 C;  1JCK B;  2LKV A;  3GTO H;  5E4W C;  1TWC H;  1ICW A;  3A55 A;  4KJO A;  3KLR A;  2YYZ A;  1VQ4 A;  2EXD A;  4P71 A;  1V1P B;  1Q8I A;  2JA8 B;  1F2M A;  5I9P A;  4RGO S;  4FF4 A;  1K83 H;  2FHT A;  2KHS A;  4GKK Q;  2NB0 A;  1GKH A;  4HED A;  4R4C A;  1VQN A;  2A6E C;  3HOU H;  3J80 E;  3CQZ H;  2MP1 A;  1EOT A;  2F03 A;  4GN5 A;  4GOP A;  3Q6S A;  5LMU L;  2F0K A;  4OWT B;  1SND A;  4ZKC B;  3J81 j;  2YTV A;  4V19 0;  3BVM A;  1B2T A;  2Z8L A;  3KF6 A;  1NBW A;  4X62 Q;  4XYQ A;  1Y1V G;  1SMY C;  4G4K A;  2ZXR A;  5M5Y H;  1ET9 A;  5JVH 3;  3QO2 A;  4B3S Q;  4JI2 L;  1C48 A;  4A3M G;  1MD2 D;  3K5M A;  1Z47 A;  4R1J A;  2IY5 B;  2KA7 A;  3JAM i;  3R8B A;  1J5E L;  1SYD A;  2UUC Q;  5C4X B;  2LMC B;  1RTO A;  5M3M B;  4JI5 L;  4OX9 Q;  5ELF A;  3HZX A;  4DNR B;  1S5E D;  2JA6 G;  5FLX E;  2R3Z A;  3BDC A;  4A3G B;  5C3E H;  4JOI A;  4B3R L;  5GAH C;  1MHW C;  4YIJ A;  1WI5 A;  5M3M H;  1A62 A;  1Q1B A;  1SMY D;  4O1N A;  4PG3 A;  1DYQ A;  3NBI A;  4C3I H;  1HZC A;  2N78 A;  5IGD A;  3V05 A;  1F9R A;  2NVQ B;  1HFG A;  1D1K A;  3UDI A;  1LO5 D;  3F2B A;  2EY2 A;  1EWI A;  5L37 A;  2EYP A;  1Q12 A;  1NUC A;  3M7N A;  3E3X A;  1LT4 D;  5C5M A;  3ERS X;  1VF7 A;  1BR9 A;  3H3V C;  3CCR A;  2K7V A;  2R7Z G;  4LFA L;  3I4M B;  2KHI A;  1BBU A;  3MXN A;  3PUX A;  4X66 Q;  1G6P A;  4O2D A;  4CDC C;  3HOU B;  5IYD H;  1BCP F;  1HR0 L;  1QJO A;  1WJJ A;  2RSO A;  1A3V A;  5ELC A;  1K83 B;  3PGZ A;  3HKZ E;  3TBI B;  2NYZ D;  1WCM G;  4OO1 H;  3TP8 A;  3J7A F;  5DAU A;  2K32 A;  4A76 A;  3MHB A;  3WDN A;  4HJA A;  5FOB B;  4KI0 A;  3H15 A;  2RCN A;  1TWC B;  2PI2 A;  1HPC A;  4DV7 L;  1M90 C;  1JB7 A;  5AJ3 Q;  4LF6 L;  2B2U A;  1BCP D;  5JEA G;  2EPB A;  3BYY B;  3MVV A;  4DGZ A;  5I9O A;  1S5F D;  1CA6 A;  1N32 L;  2PNR C;  4JYA L;  4IFD G;  3PIP 3;  3CRK C;  1ZYR C;  2EOT A;  4DXF A;  1D5Z C;  4QQB X;  3CKI B;  2EY6 A;  5IE8 A;  1TY2 A;  3A54 A;  4ZYS A;  1SLJ A;  2J7Z A;  4R8N A;  4LAA A;  5IYB H;  1EQR A;  1X3Q A;  3C2P A;  3TP5 A;  4DK3 C;  3Q0A A;  2RVL A;  3MXU A;  2DY7 A;  4P74 A;  1TII D;  1F9Q A;  4DFA A;  1JR0 D;  1JWU D;  3FDT A;  4H44 C;  2PYK A;  2VNU D;  1QOH A;  3J7Z C;  4HIM A;  2PMZ E;  2F0M A;  2AQ2 B;  3A7A B;  3I4M G;  2EXZ A;  4JVZ A;  3I8Z A;  4LWC A;  2PQE A;  5DLQ E;  2DY8 A;  3AU7 A;  1N34 Q;  2E2J B;  4LF9 Q;  3E9H A;  2O2L D;  1VQM A;  2UU9 Q;  4B3M Q;  1YJ9 A;  3D6C A;  4HIO A;  1HZA A;  4MIU A;  2IX1 A;  1YHA A;  1Y1W G;  4NKL A;  2K50 A;  1K9M C;  4A3B B;  3TQY A;  1GUS A;  1SNM A;  2AWN A;  2KQ3 A;  3MZ5 A;  3ULP A;  4DAV A;  2CVR A;  1QNK A;  1QZH A;  4DR2 Q;  4WJW A;  3MFY A;  4RGM A;  3DM1 A;  1H9R A;  5I2Y A;  1PA6 A;  1XNR Q;  1K8A C;  5EBD A;  5HUR A;  3DMU A;  1EUJ A;  1MSG A;  2LY7 A;  1QE6 A;  2UU9 L;  3J81 c;  1I3Q H;  1CKN B;  4AQY L;  2R92 H;  3GTP H;  5JOB A;  3S1R B;  1IXR A;  1YEZ A;  1IHZ A;  3SK4 A;  1EU3 A;  4DPG A;  3L2P A;  2OQ0 A;  4GN4 B;  2JQO A;  2NVT B;  1PH8 A;  3T51 B;  3FRP B;  1SN8 A;  2K52 A;  4QIW E;  4KHZ A;  4BY1 B;  1LTG D;  5EKL A;  1B70 B;  2M00 A;  4OIJ A;  1CQV A;  2Q8R E;  3J7A 5;  3NSW A;  2OWO A;  3I4L A;  1LV9 A;  4JI2 Q;  1WTQ A;  2Y0S E;  1X3F A;  4HSP A;  3QIA A;  3PO2 H;  2A69 D;  2LS0 1;  1A63 A;  1B8A A;  2WIN B;  2N49 A;  4PZ7 A;  3HOZ B;  2AQ3 B;  1GUO A;  3S1M H;  3SE0 A;  3K5L A;  1N8R C;  4K5V A;  4IUN A;  1ENC A;  5C4J B;  1UNS A;  4GKK L;  2TSS A;  3ND9 A;  1JMC A;  1L0W A;  4H7B A;  1IBK Q;  3KOJ A;  4FXG C;  2K5D A;  2MO1 A;  3NEL A;  2B2T C;  2E5L Q;  2Q8T A;  3BZD B;  4GLV B;  4JI4 Q;  1CFM A;  3CPF A;  5C0X J;  3GTO B;  2Y0S G;  5A35 A;  1AEX A;  4C3J G;  2KUM A;  1ZYR D;  2V4D A;  1SE8 A;  3BVZ A;  2DNE A;  4QMG A;  5LMN Q;  4YY3 Q;  4A3F H;  1G29 1;  4OEM B;  4ME3 A;  4P72 A;  5M3F B;  4DUY L;  2IX3 A;  1X6O A;  2KCN A;  1PTO B;  3D4R A;  1LTL A;  3D8G A;  1V1O A;  2SOB A;  1STA A;  3K80 C;  1T9H A;  1IL8 A;  2L4N A;  2EY5 A;  3NTH A;  4DV4 Q;  4KHP Q;  4JBK A;  3KF8 B;  4WJ4 A;  5JJL A;  3GO5 A;  1I94 L;  1X3G A;  4BS9 A;  3HOW G;  3DXJ C;  1RF2 D;  3FVQ A;  4EQO A;  2FIN B;  4A3D B;  2HIX A;  3KK7 A;  4Y52 H;  3I90 A;  3U58 A;  4HN7 A;  3HOZ G;  5CV4 A;  4EQN A;  1IKM A;  1STG A;  4AH6 A;  4TSS A;  2RKS A;  3F2C A;  3I72 A;  4X6A H;  3RD4 A;  1GHK A;  3GTK H;  5CV7 A;  4KKT A;  3T53 B;  2UUB L;  1AE3 A;  2ZTC A;  4JI3 Q;  1HUM A;  5FO7 B;  3P75 A;  2UXD Q;  2MNA A;  1K8G A;  1JOQ A;  2VB3 X;  2JE6 I;  2F0J A;  4JI5 Q;  4OX9 L;  4JI6 L;  5FLM H;  2UUA L;  4HAE A;  5ELN A;  4OEL B;  2PQA B;  2OTJ A;  1TQO A;  1XPO A;  5G3L D;  4DR3 Q;  4KLK A;  1VQB A;  3KJP A;  2Q2U A;  3NWS A;  4GNX B;  3RZD H;  5CBE E;  2NN6 H;  1I4P A;  4OWX B;  2IHF A;  3H0G G;  3MXN B;  2NUC A;  1W2B A;  1BUV T;  4RFB A;  4JG2 A;  2JA5 G;  4BXX H;  3GDE A;  3M4P A;  1IW7 D;  1VQ7 A;  3JAM E;  1PZK D;  3S17 H;  3R2T A;  4CJ0 B;  3URY A;  1OO9 B;  4DA2 A;  5FO9 B;  4A93 B;  4LF8 Q;  3TZD A;  3S1Q H;  1XPU A;  2XVS A;  2JA5 H;  5LMN L;  5LL6 X;  2F4I A;  1SYE A;  4FP5 D;  3FKI H;  1SFO B;  3VR3 A;  1YNX A;  1SR3 A;  1HHV A;  2MFI A;  3CW2 C;  1W3S A;  1O7I A;  4BBR B;  4F88 A;  2EQS A;  1SYG A;  5HGQ A;  1STE A;  5ELB A;  1SEB D;  2B2W A;  3G7L A;  2EJM A;  5FJ8 H;  1EIG A;  4BBS B;  4IFD I;  2G9H D;  1IBK L;  1DOM A;  5D3D A;  5GQO A;  1D5X C;  2KVM A;  3VYS A;  2Z6B A;  1NR2 A;  1ZXT A;  2G5D A;  1I6H H;  1UWV A;  1WTX A;  1TKW B;  3EJI A;  4R4T A;  1OTC A;  2IX0 A;  4C2M B;  2N3S A;  2C35 B;  1K3R A;  2B63 G;  1H9S B;  1E2W A;  2TMP A;  1PTO D;  5E1F A;  1SMX A;  2ZT9 C;  4A3L H;  2K75 A;  5C4Z A;  2H5X A;  3OYY A;  4BWG B;  2GVA A;  2F0G A;  5J1Z A;  4JK1 C;  1HTL D;  3A8K E;  2L5T A;  1I50 B;  3MWY W;  4LFB L;  2OEO A;  3CCL A;  5C0X I;  3UE1 A;  1LM0 A;  2NN6 I;  3KYH C;  3LGJ A;  3T1Y Q;  3HG9 A;  3R3O A;  4JBJ A;  1YNN D;  2JP1 A;  3HOX H;  2WAQ G;  2UXC L;  2B63 H;  5C3W A;  4PZ8 A;  1B44 D;  5EPL A;  1E0B A;  3PO3 H;  1SNP A;  3ER0 A;  3NWT A;  1BNZ A;  4TVA B;  1I6V C;  1SAP A;  2KCC A;  4ID6 A;  4NP5 A;  3GQB A;  5K36 H;  2F0P A;  1STB A;  4PMB A;  1SNC A;  4JI3 L;  1CKM A;  5DM6 3;  3S14 B;  1Q1E A;  1YHQ A;  1YI2 A;  3SEB A;  2XN9 C;  1YZ6 A;  3TZU A;  4RGN A;  3J80 L;  5DM7 3;  5IP9 G;  1Y8O B;  4LUV A;  2F0W A;  2JA6 H;  4Y7N B;  3A5Z B;  4JV5 Q;  1TXY A;  1ENF A;  4XIG S;  1A3U A;  1PRT D;  3A56 A;  1CK1 A;  2ASB A;  4HID A;  1VF5 C;  5BN5 A;  3SR1 A;  4KHP L;  4H02 A;  3J80 i;  1MJE A;  4BBR G;  1K8O A;  3TP6 A;  1EEI D;  3RLF A;  3UDG A;  1NTG A;  3OWE B;  5F2D A;  4J15 A;  5CV6 A;  1EFI D;  2WKD A;  2O5J C;  1VQG A;  3VDY A;  2KCM A;  1I4H A;  2JK8 A;  4BA1 I;  4BY7 B;  3KLW A;  3U4Z A;  1Y1V B;  4FYD A;  2Z4I A;  4A3C G;  3PO2 G;  3HOV G;  4RA8 A;  2HQE A;  5COY A;  3GTL H;  1IBL Q;  1S3O A;  2B2Y C;  2B8G A;  5JJI A;  4U68 A;  4GNX C;  3K7A B;  1MGS A;  1TVX A;  4CGY B;  2HD3 A;  1EYC A;  4C1N I;  3A8I E;  4M1U B;  5CV8 A;  1SJE D;  1ZKO A;  1CSQ A;  3SK8 A;  1FNU A;  3L9A X;  5KEE A;  1CM9 A;  1PH1 A;  4YY3 L;  3DM3 A;  1PZI D;  4GZY C;  1AZQ A;  4RCN A;  3AFP A;  3J81 L;  4DV1 Q;  3I70 A;  2Z6K C;  3K58 A;  3PUV A;  3D3R A;  5NUC A;  3M3Y H;  4JI4 L;  1DON A;  2E2I B;  1E1O A;  1OXT A;  3P7J A;  4H0L C;  4A3I B;  1WTV A;  1NMF A;  1STY A;  3W1B A;  3H6M A;  4IPH A;  5HY6 A;  1XWE A;  1ONL A;  1KHI A;  4TKO B;  2JA7 G;  4KTA A;  3S15 B;  4JYA Q;  2HCI A;  2K14 A;  4DUZ L;  1KDC A;  3AB9 A;  2YU9 B;  4S3S A;  1ZEQ X;  3PQI A;  3GTQ B;  4NB3 A;  4G7O C;  3K6O A;  4OXP A;  2RQX A;  4R4I A;  2WAQ E;  4RWS C;  2IW3 A;  5GAG C;  3NEM A;  1VQC A;  5A2Q L;  1CKN A;  5I6Y A;  3S1N H;  3TP7 A;  3OOC A;  1HUN A;  4LF5 L;  3KBG A;  4A75 A;  1XTC D;  1Q90 A;  5BR8 Q;  2FXQ A;  1WCM H;  2PI2 E;  5FLX c;  3P1H A;  1CQF A;  4RHS A;  4LF8 L;  4HJ5 A;  4LF4 L;  1TS4 A;  4DR3 L;  1CHQ D;  1KAB A;  5C44 H;  2J4X A;  3HOY G;  1KIX A;  5IIF A;  3Q23 A;  1S72 A;  1C8C A;  1GXD C;  4TRD A;  2Z6K A;  4C3H H;  1LUZ A;  3GP7 A;  5M5X H;  3M4Y A;  4YHH L;  3GTG B;  1IBM L;  1A15 A;  1KAA A;  1D5M C;  2M2L A;  5KYL A;  3G4S A;  3K5N A;  1STH A;  3ZYY X;  1ESR A;  3Q24 A;  4K6D A;  4C3J H;  4C3I G;  1JJ2 A;  4OL7 A;  2OTL A;  1TU2 B;  3QOJ A;  2GN5 A;  5EPK A;  2NBF A;  1I4Q A;  3V2T A;  3T1H L;  1A8V A;  4POG A;  2BOS A;  4ZAI A;  3KDF B;  2UUB Q;  1YNN C;  3H0G B;  4B3T L;  1NSN S;  1GVP A;  1PXU A;  3CPW A;  1GHJ A;  1GJX A;  2N8N A;  1VQH A;  3O13 A;  4A93 G;  4JI1 L;  1TWG H;  2F0V A;  2QA4 A;  1CZW A;  4F87 A;  4C3H G;  1U4P A;  3VR5 A;  2ZTE A;  2WAC A;  3PMF A;  4M8A A;  4LJZ C;  4A3E H;  2RDF A;  4BY1 G;  3V96 A;  2NVX H;  2R92 G;  4BBS G;  3S2H H;  1ILP A;  3NE5 B;  5GAD C;  3HP3 A;  4RKB A;  4J1M A;  1HRJ A;  2ZM6 Q;  1HJP A;  1SYC A;  1YIJ A;  2HCC A;  3RZO B;  3DUZ A;  2E5L L;  2VUM G;  3MA2 B;  4DF7 A;  3I55 A;  1JC7 A;  1JJG A;  2AUJ D;  3PF4 A;  4V0B A;  1WFQ A;  1QVF A;  4JI7 Q;  1QB5 D;  1LAB A;  1U4R A;  5D3I B;  5BN4 A;  3GTM H;  2WII B;  2A1A A;  1KDB A;  3PUY A;  1EQT A;  5AJ3 L;  2Z0S A;  1R9T B;  3VYR A;  2A73 B;  2WAQ B;  4KD4 A;  5EAY A;  1EWH A;  2ICE C;  1GD7 A;  1B4O A;  1PTO F;  2E74 C;  1SYF A;  3PSI A;  2RBM A;  2BH8 A;  4PQX A;  1CA5 A;  4GKJ Q;  1F9S A;  3AQQ A;  4KMU C;  4DAM A;  4HJ8 A;  3F2U A;  3S16 H;  1JOK A;  4LF6 Q;  1XX8 A;  1H95 A;  4Q5V A;  1HNW L;  3N6R A;  5ISR A;  4IPD A;  1PFN A;  2SDF A;  3WOE A;  3ERQ A;  2F0U A;  3QB3 A;  2Y0S B;  2D62 A;  2D5D A;  2PQA A;  1AP0 A;  2GA4 B;  4JI8 L;  5GAE C;  1T5X D;  1TWF H;  4J8Q A;  3A0J A;  2E2D C;  1PH4 A;  4L8J A;  3L7Z C;  1EY6 A;  4X65 L;  4DK0 A;  3HOV H;  1CTM A;  1O78 A;  4X3S A;  2D2C C;  4AQY Q;  2RA4 A;  3VA5 A;  1RJT A;  3OTO Q;  5IGE A;  3G6J B;  2NZH A;  3A5U A;  4B3M L;  2K05 A;  4JI6 Q;  1PV4 A;  3HOW B;  3JC6 6;  1OXU A;  1TWA B;  1GUT A;  4FF1 A;  2KHJ A;  1KQS A;  1X54 A;  1LLR D;  2DN8 A;  1U4L A;  4DNI A;  4CDE C;  4O42 A;  2N55 A;  3ERO A;  3MXP A;  1F2L A;  1TWA H;  2EYJ A;  3SVM A;  3FPP A;  1ENA A;  3KJO A;  2B39 A;  4J6H A;  4IQZ A;  4NXN L;  3C3L A;  1MI2 A;  3QWN A;  1EY8 A;  2A68 D;  1H9K A;  2XRS D;  5COR A;  4LUO A;  4ZLT F;  3OTO L;  2MUY A;  1R4P B;  3HFZ B;  1LT5 D;  1VQ5 A;  3TRE A;  2ALY B;  3W2D A;  4DAY B;  1Y14 B;  3VYT A;  3HOY H;  3E0J A;  5BR8 L;  2NVY H;  2KEN A;  1XJV A;  1CUK A;  3BYT B;  5JJK A;  2EDG A;  1YBY A;  1EYG A;  1GM5 A;  2VQE L;  1FYC A;  1VQP A;  5M9O A;  2Z9H A;  2BA1 A;  2CHB D;  1A3T A;  4FDB A;  2RHS B;  3S16 B;  1NE3 A;  4ULL A;  2KBN A;  1PYS B;  4B9W A;  1V8Q A;  1KL9 A;  2B2Y A;  4OO1 I;  3TEH B;  1V43 A;  1YNJ C;  3NQT A;  2Q2H A;  4LW1 A;  1EFW A;  4KD3 A;  4RAU C;  2WKC A;  3BDL A;  4CKE A;  4E6I A;  3J7A V;  2JA7 B;  5C0X G;  1JE4 A;  1RDP D;  1QWY A;  2G9D A;  3I7F A;  4MN3 A;  3TS0 A;  2BE5 D;  3CMA A;  5J3B A;  2ZTD A;  3I4N B;  2C5C A;  4GLA C;  4DV6 Q;  2EJF C;  2F3I A;  5ELO A;  4ZK9 B;  1FNW A;  3U9S A;  1O7Z A;  2D9U A;  4LMQ D;  3H3V I;  2VL6 A;  4B9X A;  1TS5 A;  3TDQ A;  3CCU A;  3OMG A;  3OW2 A;  2WB1 E;  1OXX K;  4KHV A;  1HNX L;  2EIF A;  4IUP A;  5EKK A;  3KF6 B;  1B9M A;  1Y69 U;  1A2T A;  4ZCK A;  5LMN W;  4LUZ A;  4CHT B;  2QIL A;  1IBL L;  4ZQ3 A;  1FL0 A;  1FVI A;  4IN3 A;  3OHX C;  1TWH B;  3EA6 A;  1WTP A;  3CCM A;  4JI0 Q;  3CU7 A;  4DV7 Q;  5D65 A;  1Q8K A;  1UE7 A;  2KEC A;  4DAP A;  4GOP B;  4LF7 Q;  1D7Q A;  3OIP A;  1LT3 D;  4LFA Q;  1KRS A;  4A3K H;  1VQK A;  3TSS A;  4ZUI A;  3QG1 A;  1S5B D;  2WP8 J;  1ICF B;  4BXX G;  1L1O A;  4RCO A;  4A3J B;  1XNQ Q;  3DLL A;  3FPU B;  1PRT C;  4B3T Q;  4X66 L;  1B1Z A;  1FJG Q;  1QG7 A;  4IUQ A;  2K04 A;  2D0P A;  5JPN C;  1EY4 A;  3NBH A;  5EGT A;  2CH4 W;  2A74 C;  4WOR A;  1HA5 A;  1AFP A;  2Q2I A;  1D6E C;  4C3J B;  2A6H D;  1XNR L;  1X55 A;  2NVY B;  3M4O H;  2QDB A;  5IP9 H;  3HOY B;  5I6W A;  3A8J E;  4NDX A;  3R2I A;  3BU2 A;  4DV3 L;  4AYB G;  2UXB Q;  4YHH Q;  1CT1 D;  3ULL A;  2QEX A;  3X3M A;  1YHB A;  5M5X B;  1LTT D;  3ZJY C;  1BCP B;  1YJN A;  3NEN A;  4MTN A;  1BQQ T;  1EIF A;  1J9O A;  3WWV A;  2R93 H;  2R7Z B;  1J5E Q;  3OW7 A;  4YWK A;  1E24 A;  2HDL A;  2DJG C;  4FO2 A;  4PV1 C;  1WCM B;  2D0O A;  4KY5 A;  4UHV A;  4A4I A;  2VUM B;  3SXH A;  1FGB D;  2XIW A;  3NUC A;  1I4R A;  4L5R C;  3S1N B;  2I5L X;  2K5H A;  2A68 C;  3K7U C;  1UEA B;  3IKJ A;  2K03 A;  1B3Q A;  4L5S A;  1QUQ A;  2Q2T A;  1XTD A;  1P16 A;  3GTQ H;  2B2V C;  4WJ3 M;  4KK7 A;  2YU9 H;  2B3G A;  2A6E D;  2K5Q A;  1HNW Q;  1G2T A;  3HOV B;  3HKS A;  2MPM A;  4LF5 Q;  2A8V A;  4GKJ L;  4DV2 Q;  3GV6 A;  1YVC A;  2SNS A;  3EBE A;  1N9W A;  2E2I H;  4XT1 B;  4DV0 Q;  4RH6 A;  2RDH A;  4YCV A;  3H91 A;  2J0T D;  4PNY A;  4A3J G;  3PUZ A;  1PZJ D;  3DEO A;  1II3 A;  5JEA H;  2KOL A;  4A3I G;  1WTW A;  2E8G A;  2HQL A;  1DOK A;  2XTI A;  3H09 A;  3J81 i;  3BZC A;  2AWO A;  2EVB A;  2HHH Q;  2BA0 A;  5T1I A;  1X56 A;  1Q86 C;  1NY4 A;  1QCB D;  5D14 A;  1Q3L A;  2OT2 A;  2ZM6 L;  5IWA L;  1PH7 A;  1R9T H;  2JA8 G;  5FO8 B;  3K59 A;  1V1P A;  2CKZ B;  4DV2 L;  1LTI D;  2Q8I B;  4DV1 L;  5EBC A;  3GTL B;  1HH2 P;  2VUM H;  1IKL A;  4DV5 L;  1F2Y A;  1EYA A;  1RKN A;  1BCP C;  3UDF A;  2EYL A;  3W1G A;  2L0C A;  2R7Z H;  2R93 B;  2LSS A;  2EE1 A;  3RNU A;  4N8F A;  4K5W A;  3K8A A;  4QUC A;  2EYO A;  5JVG 3;  3M4Q A;  1W6J A;  4N9T A;  2NTT A;  3TME A;  3PV0 A;  1K3B C;  1TS2 A;  4ME5 A;  2NVX B;  4G7Z C;  2ZJQ A;  4QF4 A;  1BVS A;  1T5E A;  5KRU A;  5KND A;  1Q7Y C;  4A3M B;  5C4H A;  1MBY A;  1D8L A;  5CR3 A;  2EYM A;  1GO3 E;  1RTN A;  1QVG A;  3I73 A;  1JOR A;  3CC7 A;  1ML0 D;  2HT1 A;  2XWJ B;  4QL5 A;  4P2C B;  1I94 Q;  2NZO A;  5E3F A;  4A3J H;  3JAM c;  1EQV A;  3D31 A;  4POF A;  2B2V A;  1HZB A;  4A3K B;  3BDO A;  1VQ6 A;  1K73 C;  4I7Z C;  1BKB A;  4EQP A;  5I4D A;  3MEH A;  2PZW A;  2Z1C A;  4N9P A;  4AYB E;  3HRZ C;  4AIM A;  4A3M H;  2UXC Q;  4LF4 Q;  4X3U A;  2MO0 A;  2E75 C;  1TWH H;  1Z6H A;  2F0H A;  1SE4 A;  1ILQ A;  4X64 L;  1BBW A;  2BDN A;  3WOF A;  3DWQ A;  2RHQ B;  1XPR A;  5JJZ A;  2RCF A;  3GV3 A;  4JW0 A;  4C3H B;  1FGU A;  1XMO L;  2QGQ A;  2I5M X;  4QB4 A;  2L55 A;  4F8M A;  4C2M H;  2F52 A;  1HNZ Q;  5C44 B;  1QIL A;  2K4K A;  4MZ9 A;  1SJH D;  1PHJ A;  2FJ2 A;  1ET6 A;  1F77 A;  3AMU A;  4EX5 A;  3SDZ A;  1Q46 A;  4DUZ Q;  1Q81 C;  1K0S A;  2AUK A;  3HOU G;  5CV5 A;  1B7Y B;  3PIO A;  1KTK A;  1PFS A;  1EY5 A;  3I4N H;  4FXD A;  3VR4 A;  2HUG A;  2KJX A;  3M7G A;  4QY7 A;  4JOI C;  3MFG A;  2A69 C;  4BY7 G;  3F1Z A;  4BBR H;  1VQF A;  1BOS A;  2JA7 H;  2PW5 A;  5IYB G;  4TQU S;  3BVG A;  2JEA I;  1Z7T A;  4P75 A;  2EYH A;  1U4M A;  3S15 H;  1FR3 A;  1S4Z A;  4GLX A;  3OPO A;  1QVC A;  5KNB A;  4JPB W;  5CV9 A;  3RR5 A;  3LX0 A;  1PH3 A;  2CH4 A;  5C0X H;  4G57 A;  2YTY A;  2IT1 A;  1N33 L;  1BDO A;  4ZUJ A;  3SK5 A;  1NNX A;  2PNH A;  1B9N A;  3K5O A;  2CFM A;  1N36 Q;  1H9J A;  2XWB B;  3C46 A;  4DK1 A;  1BBX C;  2JN4 A;  1LYL A;  4NPS A;  5IGG A;  4X3T A;  2B29 A;  2IJ0 A;  1VMC A;  2CW0 C;  2ES2 A;  1BXT A;  3D4D A;  2VQE Q;  3P20 A;  5E4X A;  2NZ1 D;  1VQO A;  3T13 A;  3T4A C;  2B2W C;  2L11 A;  3VR6 A;  1DXM A;  3KUP A;  2PZT A;  1B53 A;  3PCO B;  1DCZ A;  2RDG A;  1IL2 A;  5EPJ A;  3GTK B;  1U5K A;  2DGY A;  2L1B A;  2VXW A;  5FLX L;  1SE2 A;  1F9P A;  2QKI C;  2R7D A;  1PFM A;  4GN3 B;  5C6A A;  2B2U C;  1S40 A;  4DR2 L;  1IYV A;  4K5X A;  2JA9 A;  1EZ8 A;  1UE5 A;  1DGS A;  3CXC A;  4GNX A;  3M4O B;  3CCQ A;  1XNQ L;  2RSN A;  5IT9 L;  5C3E G;  4UDU C;  4FNF A;  3N52 A;  2K5N A;  2MHV A;  2NTS A;  1CZG A;  4HIK A;  1MSH A;  4DR1 L;  2O5I C;  3CAM A;  4I65 A; 
#chains in the Genus database with same CATH homology
 1SE8 A;  3JC6 6;  1OXU A;  5LMN Q;  1HNX Q;  4YY3 Q;  4JC0 A;  5IWA Q;  3TRZ A;  1V9P A;  1PH2 A;  2KHJ A;  3F2D A;  4A3F H;  1G29 1;  1X9N A;  1X54 A;  1KQS A;  4DR4 L;  4ME3 A;  2AHO B;  4DNI A;  4NXM Q;  4P72 A;  4PZ6 A;  1TWA H;  1WOC A;  4K0K L;  4DUY L;  3KJO A;  1X6O A;  1JJC B;  1EOV A;  4NXN L;  4ALP A;  3M85 A;  1LTL A;  2WB1 G;  3CCV A;  1VQL A;  1EIY B;  3K80 C;  3ULJ A;  1T9H A;  4LUO A;  1NMG A;  3OTO L;  2JEB I;  3NBH B;  2LXJ A;  1L1O B;  3HFZ B;  4IOC A;  1VQ5 A;  3TS2 A;  4BBS H;  4DV4 Q;  2F4V L;  4KHP Q;  4JBK A;  4A3L G;  3TRE A;  2ALY B;  4DAY B;  4BY1 H;  3KF8 B;  4WJ4 A;  1Y14 B;  5IYC H;  1P8L A;  3GO5 A;  4R4Q A;  1I94 L;  1X3G A;  2JJQ A;  5C44 G;  3HOY H;  5BR8 L;  1UE1 A;  3HOW G;  2NVY H;  2KEN A;  1XJV A;  1C7Y A;  1CUK A;  3RLN A;  2HIX A;  5JJK A;  5JEA J;  1YBY A;  1Q82 C;  1EYG A;  1SFO H;  1GM5 A;  3U4V A;  4Y52 H;  2VQE L;  4DR6 Q;  3U58 A;  3HOZ G;  4IFD J;  2BH2 A;  1A0I A;  4AH6 A;  4DV6 L;  5M3F G;  1MJC A;  3F2C A;  4HJ9 A;  3FP9 A;  1VQP A;  4DR5 L;  2KCT A;  3S1R H;  3RZO H;  4X6A H;  2BA1 A;  3GTK H;  3I2Z A;  1E22 A;  4FDB A;  1C0A A;  4DV0 L;  2UUB L;  3CCE A;  1AE3 A;  2RHS B;  3HOZ H;  2ZTC A;  2OQK A;  4JI3 Q;  1NE3 A;  4IJL A;  2KBN A;  1PYS B;  4A3K G;  2UXD Q;  1KL9 A;  2MNA A;  2ZJR A;  5M3M G;  3TEH B;  1V43 A;  1K8G A;  4LNQ A;  4OO1 I;  2UUA Q;  4JI5 Q;  2JE6 I;  4OX9 L;  2Q2H A;  4LW1 A;  4JI6 L;  1VQE A;  5FLM H;  1EFW A;  2UUA L;  3KFU A;  5ELN A;  5C0X G;  1JT8 A;  3PUW A;  2PQA B;  4X64 Q;  1I5F A;  4DV3 Q;  4GOP C;  1PH5 A;  1VQI A;  2UXB L;  2OTJ A;  3I7F A;  3CF5 A;  4OO1 G;  3H3V H;  1XPO A;  2VQF Q;  4DR3 Q;  4KLK A;  3TS0 A;  1ASY A;  1VQB A;  3CMA A;  5J3B A;  3KJP A;  2CQO A;  2ZTD A;  2Q2U A;  4LFC Q;  1KC8 C;  3EN2 A;  4UP7 A;  3M9B A;  3RZD H;  4GNX B;  4GLA C;  4DKA C;  1QUQ B;  4DV6 Q;  1NJI C;  2F3I A;  4OWX B;  2IHF A;  3H0G G;  5ELO A;  2GVB A;  3MXN B;  3K0X A;  4QGU A;  4HJ7 A;  3AYH B;  1W2B A;  4JG2 A;  2VW9 A;  2JA5 G;  4BXX H;  3GDE A;  3M4P A;  1Y1W H;  3MEF A;  3H3V I;  1RL2 A;  1VQ7 A;  3CP0 A;  2VL6 A;  3H0G H;  1FJG L;  3S17 H;  3CCU A;  3OW2 A;  1PVO A;  2WB1 E;  4LF8 Q;  3CD6 A;  1OXX K;  3S1Q H;  1XPU A;  2JA5 H;  4A93 H;  3STB C;  2EIF A;  5LMN L;  1YIT A;  1HNX L;  3KF6 B;  3PIP A;  1KAW A;  4JI1 Q;  2ATW A;  1V1Q A;  5LMN W;  3FKI H;  2VZA A;  4LUZ A;  1IBL L;  1IZ6 A;  1YNX A;  1FL0 A;  1FVI A;  1SR3 A;  1ASZ A;  2MFI A;  3CW2 C;  5FLM G;  1XMQ L;  1W3S A;  3F8T A;  1O7I A;  3E9I A;  4LF7 L;  1SRO A;  2EQS A;  2I0Q A;  4LF9 L;  3CCM A;  5HGQ A;  4JI0 Q;  4DV7 Q;  4OWW B;  1Q8K A;  1UE7 A;  1PH9 A;  4YCW A;  4DV4 L;  1PYB A;  4JCV E;  3UDX A;  1UE6 A;  4R4O A;  5FJ8 H;  4GOP B;  1PH6 A;  4LF7 Q;  4A3D G;  4IFD I;  1OXV A;  1IBK L;  3SGI A;  4LFA Q;  3BJU A;  1KRS A;  1QZG A;  4UP9 A;  5GQO A;  4A3K H;  1VQK A;  4LFB Q;  2WP8 J;  1CKO A;  4JI8 Q;  5K36 G;  1E3P A;  1U0L A;  4NXN Q;  1KD1 C;  4BXX G;  1L1O A;  3I4O A;  1XNQ Q;  1I6H H;  1UWV A;  3DLL A;  1MIU A;  1KXL A;  3A74 A;  4R4T A;  3PF5 A;  1OTC A;  4B3T Q;  4X66 L;  2IX0 A;  3L0O A;  1RIP A;  4OON A;  2N3S A;  3G6E A;  2C35 B;  1K3R A;  1FJG Q;  2B63 G;  3UE0 A;  1MKH A;  3E0E A;  4X65 Q;  1E1T A;  2F4V Q;  1SMX A;  2D0P A;  1VQ9 A;  4A3L H;  2K75 A;  2YV5 A;  3T1Y L;  2H5X A;  3OYY A;  2GVA A;  5IT9 c;  3RN2 A;  1L2F A;  2Q2I A;  3AFQ A;  4PMW A;  4DR7 L;  3FHW A;  3HOW H;  4XTC S;  4LFB L;  3CCL A;  5C0X I;  3UE1 A;  1LM0 A;  2NN6 I;  3KYH C;  1CSP A;  3LGJ A;  3T1Y Q;  4UY8 C;  1XNR L;  3GTO H;  4JBJ A;  1X55 A;  3HOX H;  2WAQ G;  1TWC H;  3M4O H;  5IP9 H;  3B6Y A;  5H1S E;  2UXC L;  2B63 H;  4PZ8 A;  2YYZ A;  2AKW B;  1HR0 W;  1VQ4 A;  2EXD A;  3BU2 A;  4AYB G;  4DV3 L;  1Z9F A;  4P71 A;  1N36 L;  4YHH Q;  3PO3 H;  3ULL A;  2QEX A;  4A3B G;  1YHB A;  3ER0 A;  1JB7 A;  4TVA B;  3ZJY C;  1YJN A;  1K83 H;  4X62 L;  3NEN A;  3HKZ G;  4MTN A;  1EIF A;  4GKK Q;  4A3I H;  1GKH A;  3WWV A;  4R4C A;  2V1C C;  1VQN A;  3HOU H;  1J5E Q;  2R93 H;  4YWK A;  4YWL A;  1E24 A;  1CKM A;  2AMC B;  4JI3 L;  4A3F G;  1Q1E A;  3CQZ H;  1YHQ A;  1YI2 A;  1YZ6 A;  5M3F H;  1SRU A;  5FJ8 G;  4A4I A;  2D0O A;  4GN5 A;  2VQF L;  4GOP A;  5GRO A;  4P73 A;  5LMU L;  4OWT B;  4A3C H;  5IP9 G;  3J81 j;  2YTV A;  2ZJP A;  3KF6 A;  4LUV A;  4L5R C;  1NBW A;  4X62 Q;  4DR7 Q;  2I5L X;  2K5H A;  1Y1V G;  2JA6 H;  5M5Y H;  3K7U C;  3A5Z B;  4JV5 Q;  1TXY A;  4L5S A;  4B3S Q;  4XIG S;  1X65 A;  1QUQ A;  4JI2 L;  4A3M G;  2Q2T A;  1XTD A;  1P16 A;  2ASB A;  1Z47 A;  4HID A;  3GTQ H;  3Q8D A;  4R1J A;  2IY5 B;  4WJ3 M;  4KHP L;  2YU9 H;  2B3G A;  4H02 A;  3K7A H;  3J80 i;  1MJE A;  4BBR G;  4IO9 A;  1HNW Q;  3JAM i;  1J5E L;  3RLF A;  3UDG A;  1NTG A;  3HKS A;  2UUC Q;  4L5Q A;  4LF5 Q;  5IP7 G;  2A8V A;  4J15 A;  4GKJ L;  4DV2 Q;  4JI5 L;  4OX9 Q;  1VQG A;  1YVC A;  3VDY A;  4IJH A;  2KCM A;  1Y1V H;  2JA6 G;  1KRT A;  2JK8 A;  3EBE A;  1N9W A;  5C4J H;  1HR0 Q;  2E2I H;  5C3E H;  4DV0 Q;  4BA1 I;  4DR4 Q;  1HNZ L;  4JOI A;  3KLW A;  1VQA A;  4YCV A;  3U4Z A;  4IOA A;  4B3R L;  5GAH C;  3BZK A;  4A3J G;  4YCU A;  3I4M H;  4A3C G;  3PUZ A;  3FKI G;  1WI5 A;  3PO2 G;  3HOV G;  5M3M H;  1A62 A;  1Q1B A;  3GTL H;  4PG3 A;  1IBL Q;  1S3O A;  3U50 C;  2R93 G;  2I5H A;  4C3I H;  1K0R A;  1HZC A;  2N78 A;  4A3I G;  3CC4 A;  5JJI A;  4GNX C;  2E8G A;  2HQL A;  2XTI A;  3J81 i;  3UDI A;  3BZC A;  2VS1 A;  3IRB A;  2AWO A;  3F2B A;  2HHH Q;  1EWI A;  1CSQ A;  2BA0 A;  1X56 A;  1Q86 C;  1NY4 A;  1Q12 A;  2NVQ H;  2ZM6 L;  1PH1 A;  4YY3 L;  4RMF A;  3DM3 A;  5IWA L;  1PH7 A;  4Y7N H;  2HIV A;  4YWM A;  3I56 A;  1R9T H;  2JA8 G;  2OCE A;  5IP7 H;  2CKZ B;  4DV2 L;  3ERS X;  4DV1 L;  3AFP A;  2CWP A;  3CCR A;  4DV1 Q;  4O0A A;  2R7Z G;  2NVT H;  2Z6K C;  1HH2 P;  4LFA L;  3PUV A;  2VUM H;  1G51 A;  1BBU A;  2KHI A;  4DV5 L;  4MNO A;  3M3Y H;  2CCZ A;  1VQD A;  4JI4 L;  1C9O A;  3UDF A;  4B3R Q;  3PUX A;  3RLO A;  3W1G A;  4A3G H;  1OXT A;  1E1O A;  2YTX A;  4X66 Q;  4BA2 I;  1G6P A;  4O2D A;  2R7Z H;  5IYD H;  1HR0 L;  2LSS A;  1WJJ A;  3RNU A;  1NMF A;  3W1B A;  2R6G A;  2L15 A;  3CC2 A;  3PGZ A;  3HKZ E;  4IPH A;  3CCS A;  5HY6 A;  3K8A A;  1KHI A;  1WCM G;  2JA7 G;  4JBM A;  5C4X H;  3T1H Q;  4JYA Q;  2K14 A;  3M4Q A;  3STB D;  1YJW A;  4DUZ L;  2UUC L;  4A76 A;  3CME A;  4HJA A;  3PV0 A;  4KI0 A;  1VCI A;  3H15 A;  2RCN A;  2PI2 A;  3I4N G;  2A19 A;  4NB3 A;  1N34 L;  2ZJQ A;  4OXP A;  4DV7 L;  4DR5 Q;  1M90 C;  1BVS A;  1VS0 A;  4R4I A;  1Q7Y C;  2WAQ E;  5AJ3 Q;  4LF6 L;  2ID0 A;  2K5V A;  5GAG C;  5JEA G;  1D8L A;  3NEM A;  1VQC A;  1XMQ Q;  3GTG H;  3HOX G;  1GO3 E;  4JYA L;  1CKN A;  4IFD G;  1N32 L;  3S1N H;  1QVG A;  4A3B H;  3CC7 A;  5JJL A;  2HT1 A;  4LF5 L;  4QL5 A;  4A75 A;  1HZ9 A;  5BR8 Q;  5LMU Q;  4QQB X;  2FXQ A;  1WCM H;  2PI2 E;  5FLX c;  1I94 Q;  2NZO A;  4LF8 L;  4A3J H;  4HJ5 A;  2E2J H;  1E7Z A;  5IE8 A;  4LF4 L;  3JAM c;  4DR3 L;  5C44 H;  3HOY G;  1JE5 A;  3D31 A;  4POF A;  1S72 A;  1KIX A;  1OXS C;  4B3S L;  1SLJ A;  1IYJ B;  4DK6 C;  1HZB A;  2Z6K A;  1VQ6 A;  4C3H H;  5IYB H;  2JA8 H;  1K73 C;  1LUZ A;  5M5X H;  4UPA A;  1BKB A;  1EQR A;  1M1K C;  1N33 Q;  4YHH L;  4DK3 C;  4AYB E;  1IBM L;  3GD7 A;  4K0K Q;  4AIM A;  4P74 A;  4A3M H;  1X3E A;  3G4S A;  4LF4 Q;  4NXM L;  2UXC Q;  4LFC L;  2MO0 A;  1TWH H;  2LXK A;  3K81 C;  2VNU D;  4C3J H;  3J7Z C;  4HIM A;  4X64 L;  3D0F A;  1JJ2 A;  2OTL A;  2CWA A;  4EQ5 A;  2PMZ E;  2GN5 A;  1BBW A;  3T1H L;  2DUD A;  1A8V A;  2RHQ B;  3W5O A;  1XPR A;  4POG A;  3I4M G;  1N32 Q;  1VQ8 A;  4LWC A;  1FGU A;  1XMO L;  2QGQ A;  4JI7 L;  3AEV A;  1D7Q A;  2I5M X;  4C2M H;  2F52 A;  5DLQ E;  1HNZ Q;  3KDF B;  2UUB Q;  5M5W H;  3KDF A;  4B3T L;  1N34 Q;  3J80 c;  2K4K A;  4LF9 Q;  4MZ9 A;  3E9H A;  1GVP A;  1VQM A;  1PHJ A;  3EIV A;  2UU9 Q;  3CPW A;  4EX5 A;  4B3M Q;  1Q46 A;  1YJ9 A;  4DUZ Q;  2N8N A;  1Q81 C;  3PO3 G;  4HIO A;  1HZA A;  3HOU G;  1VQH A;  3S2D H;  2IX1 A;  1YHA A;  1Y1W G;  4A93 G;  2E2H H;  2K50 A;  4JI1 L;  1K9M C;  1B7Y B;  1J6Q A;  3TQY A;  1TWG H;  3PIO A;  3RN5 A;  2QA4 A;  1PFS A;  3I4N H;  3GTJ H;  2RF4 A;  2AWN A;  2IHE A;  3ULP A;  4QY7 A;  4JOI C;  2ZTE A;  1QZH A;  4DR2 Q;  4A3E H;  3F1Z A;  4BBR H;  4BY7 G;  1VQF A;  4BY1 G;  1XMO Q;  2NVX H;  1PA6 A;  1XNR Q;  2JA7 H;  2R92 G;  1K8A C;  5IYB G;  4IPG A;  4BBS G;  3S2H H;  4TQU S;  2JEA I;  5GAD C;  4DR1 Q;  4P75 A;  1EUJ A;  2XGT A;  4A3E G;  5IYD G;  3S15 H;  4GLX A;  3G48 A;  2UU9 L;  3J81 c;  1AH9 A;  1I3Q H;  2ZM6 Q;  1CKN B;  1HJP A;  1QVC A;  4QJF A;  4AQY L;  1YIJ A;  2R92 H;  3GTP H;  3RR5 A;  3ICE A;  1PH3 A;  1IXR A;  2E5L L;  2VUM G;  1YEZ A;  3CCJ A;  3I55 A;  4BY7 H;  1JJG A;  3PF4 A;  1WFQ A;  1QVF A;  4JI7 Q;  4DPG A;  1WYD A;  3L2P A;  4JV5 L;  2OQ0 A;  2IT1 A;  2JQO A;  1AE2 A;  2YTY A;  4GN4 B;  1N33 L;  2PNH A;  4A3D H;  1PH8 A;  1L1O C;  3GTM H;  2A1A A;  2UXD L;  1SN8 A;  2CFM A;  2K52 A;  3PUY A;  1N36 Q;  5C4X G;  5AJ3 L;  2Z0S A;  4QIW E;  4KHZ A;  1LYL A;  4NPS A;  5EAY A;  1B70 B;  3J7A 5;  1GD7 A;  2B29 A;  2OWO A;  5IY0 A;  5IYC G;  2VY3 A;  4JI2 Q;  1IBM Q;  4A3G G;  2ES2 A;  2Y0S E;  3PSI A;  1X3F A;  2VQE Q;  5E7N A;  2MQH A;  2BH8 A;  4RG1 A;  3PO2 H;  4UP8 A;  1VQO A;  4GKJ Q;  1A63 A;  1B8A A;  3AQQ A;  2N49 A;  4DAM A;  3PCO B;  4PZ7 A;  4HJ8 A;  2WFW A;  3S16 H;  4LF6 Q;  1H95 A;  1IL2 A;  1HNW L;  3S1M H;  4GS3 A;  1U5K A;  1N8R C;  4IPD A;  2DGY A;  4JBW A;  3M7N A;  1VQJ A;  2D62 A;  2PQA A;  3S14 H;  3G71 A;  4DR6 L;  4GKK L;  2R7D A;  4JI8 L;  2NN6 G;  3S24 A;  1JMC A;  4GN3 B;  1L0W A;  5GAE C;  1TWF H;  2UXB Q;  3A0J A;  1IBK Q;  3KOJ A;  1PH4 A;  4L5T A;  2MO1 A;  4DUY Q;  3L7Z C;  4X65 L;  1S40 A;  4DR2 L;  2JA9 A;  3NEL A;  3HOV H;  2HHH L;  4APV A;  1UE5 A;  2E5L Q;  4JI0 L;  1DGS A;  3CXC A;  4GNX A;  2R7F A;  4GLV B;  4AQY Q;  4JI4 Q;  3CPF A;  5C0X J;  3CCQ A;  4DV5 Q;  1XNQ L;  3OTO Q;  1UEB A;  2Y0S G;  5C3E G;  2NZH A;  2K5N A;  3A5U A;  4HIK A;  4DR1 L;  4IPC A;  4JI6 Q;  1I50 H;  1PV4 A;  1EQQ A;  3CAM A;  4B3M L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...