4X64Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x64Q00
1TWFH 2R92G 2UUCQ 1YNXA 2LXKA 4JI1Q 2HHHL 4B3SQ 4HJ7A 4LF9Q 3HOXG 4P74A 3CAMA 1WCMG 4BBSG 2Z6KA 1IBLL 3H0GG 3M9BA 2VY3A 1LM0A 2E2IH 4DR6L 3U4VA 4MTNA 4DV1L 1XNQL 2N49A 3UDFA 4UPAA 1VQOA 4IFDI 2FXQA 4Y7NH 2R92H 2R93G 4JV5L 4P75A 2NVXH 3HOZG 1N36L 3TS0A 3HOXH 2VQEL 2PQAB 4DR4Q 3S15H 4KI0A 1WCMH 4JI0L 4BBSH 3HFZB 1CKNA 5E7NA 3UDXA 4A3MG 2OTLA 2R7ZH 3I7FA 1KQSA 1WYDA 5IWAQ 1XPRA 3S2DH 1X3GA 3J7ZC 5IY0A 1BVSA 4X64Q 2R93H 1G51A 1VQGA 2VZAA 1KRSA 2UXCL 2NVYH 3ER0A 4DV6Q 1IBKQ 3FHWA 3HKZE 1LUZA 1E24A 4O2DA 4A3MH 4A3LG 4JI3L 4LNQA 2I5HA 1OXTA 4DR2L 2D62A 4AQYQ 1X55A 4OXPA 3G4SA 4DR7L 4X65Q 2MQHA 3D31A 5M5WH 4HIDA 4POFA 4JBKA 4X66Q 1X65A 4X64L 5C0XI 4DR3Q 2JEBI 3KJOA 2AHOB 3GTQH 4A3LH 5JEAJ 4JBJA 4KHZA 1WI5A 3FP9A 1K8GA 2NVTH 3RLFA 4A3EG 2Z0SA 2E8GA 4LF8L 3OTOQ 1D8LA 1E1OA 1UWVA 2AMCB 2JA5G 1XJVA 2ASBA 2GVBA 2LXJA 3KF8B 2UXBL 2RHSB 1IZ6A 4DK3C 4C3IH 4LF5L 4IPCA 4JCVE 3S24A 4A3EH 3GTMH 1NE3A 1FL0A 4LUOA 3PO2G 2VS1A 4DUZL 4HJ5A 4JYAL 4GOPC 2NZHA 4OWTB 3CCUA 4NB3A 4A3CG 1KL9A 5IYBG 2K75A 2ZJQA 1PFSA 3IRBA 1GVPA 1VQ5A 2OWOA 1DGSA 4WJ3M 4DV5L 3L2PA 4B3MQ 3GTOH 3CCEA 3ULLA 1NMGA 2WFWA 4GOPA 3PO2H 1NY4A 3F2DA 1YZ6A 3W1BA 4AH6A 3UDGA 3PCOB 3RLNA 4A3CH 4GKJQ 1EQQA 1N34L 2E2JH 1YHQA 1PH5A 1L2FA 2WP8J 4YWMA 2F52A 3A5UA 5EAYA 1Y1VG 4DKAC 1GM5A 2HIVA 4JOIC 2K14A 4RMFA 1KXLA 3UDIA 4P72A 1FJGQ 4IPGA 4JI7L 4Y52H 2ALYB 4KHPL 1GD7A 2K5VA 4EX5A 4DV0L 4DV2Q 2IT1A 4DR6Q 3T1YQ 2JJQA 3ERSX 3F8TA 2WAQE 1Q86C 1E22A 2MNAA 1B70B 2XGTA 4JOIA 1X56A 4LUZA 2BH8A 1B7YB 1HJPA 1KAWA 3T1HQ 1K73C 3HOYG 2MFIA 4LFAL 2ZJPA 3A0JA 1PYBA 3EBEA 4R4CA 4AIMA 3GTPH 1SN8A 3D0FA 3H3VH 3OW2A 1HZCA 4GN4B 3S1NH 4C3JH 2Q2UA 1VQCA 1Z47A 4A3DG 3KDFA 4GKKQ 2UXDL 5IP9G 4BY1G 3HOYH 4IPHA 4R4QA 4A3KG 1XMQQ 5ELNA 1QZGA 1SRUA 2ZM6Q 4LF4L 1CKNB 2IX0A 1IBMQ 5GAHC 4QGUA 2N3SA 1YJNA 4A3DH 1WOCA 4GLXA 2JK8A 1O7IA 1OXVA 4FDBA 4JBMA 4X62L 3I56A 2AKWB 1AH9A 3PO3G 3GDEA 1HNZQ 2DGYA 4A93G 4A3BG 4NXNQ 4GS3A 1N8RC 4EQ5A 1I50H 1BBUA 3EIVA 4YHHL 4A75A 3K80C 4A76A 4LF7L 4XTCS 1KIXA 1GO3E 4LUVA 4JI8Q 1MJEA 4POGA 3TEHB 3PO3H 1V9PA 2EIFA 3CPFA 2R6GA 3M4PA 4YY3Q 1XMOL 1Q81C 4A93H 1N32Q 4A3BH 1NMFA 1QUQB 2ZTEA 2JQOA 4NPSA 4C3HH 5C3EG 1SROA 4QIWE 2IY5B 3F2BA 4LFBL 3ULJA 4JI5Q 5C4XH 3AYHB 5LMUL 2VQFL 1EIFA 4DR5L 3I4NG 3M4QA 1K83H 4PG3A 5JEAG 4DUYL 2BA0A 1YHAA 3RNUA 3BJUA 4JI8L 2H5XA 3HKSA 5M5YH 2UUCL 4JI1L 1OXXK 3H0GH 3FKIG 4YCUA 1HR0Q 4B3SL 2NZOA 4OO1G 4HIKA 4LF9L 2UUAQ 1PH6A 3M85A 2F4VQ 5M3FG 1PH4A 1V1QA 1PYSB 3K0XA 1Q12A 3H3VI 3I4MG 3OYYA 3J81j 3I4NH 3DLLA 4IJHA 3JC66 4HIMA 2I0QA 5HGQA 2IX1A 3HOZH 4QL5A 1MJCA 3NBHB 4BY7G 4ALPA 1HH2P 3PUYA 5AJ3Q 1KHIA 3PUVA 1CSPA 3CCMA 1VQ4A 1YITA 4WJ4A 4B3TQ 4DR4L 4GOPB 4H02A 1Y14B 4A3JG 2RF4A 4JI6Q 5IYDG 2UUBQ 1VQLA 5IWAL 3G48A 3CCVA 4OO1I 3I4OA 1VQ6A 4DAYB 2KHJA 1W2BA 1EWIA 3E9IA 3S1QH 4IPDA 3KYHC 2K52A 2ZTCA 3HOVG 4IFDJ 4DV6L 1IBKL 3RR5A 2ES2A 1MIUA 2NN6G 4A3JH 5K36G 4X6AH 1U0LA 4OX9Q 1IL2A 4QJFA 4AQYL 5IP7G 4B3TL 1SMXA 4RG1A 4AYBG 3S14H 2YTYA 3KLWA 3HOVH 4X65L 1Q46A 5BR8Q 1JJGA 1CKMA 3KF6A 5IE8A 2ZJRA 3B6YA 4K0KQ 4OONA 4LFCQ 1K3RA 1VQIA 2YV5A 4X66L 4HIOA 4LWCA 1E1TA 4DR3L 1HNWQ 3CXCA 2YYZA 3H15A 3HOUG 5GROA 2OTJA 3TS2A 2JA5H 1YHBA 2VUMG 1HR0W 2JA7G 5FLXc 3OTOL 3KDFB 5LMNQ 4O0AA 2I5MX 2KBNA 3RN2A 3J7A5 1JMCA 5C0XJ 1HNXQ 2K5HA 3CP0A 4IO9A 1XTDA 2QGQA 2CWPA 3K81C 1ASZA 4DV3Q 1L0WA 1IYJB 4UP7A 5HY6A 4APVA 1VCIA 4DK6C 5IYBH 3CC7A 1VQKA 4OWWB 1SFOH 3E9HA 1UEBA 1Z9FA 2E5LQ 3S1MH 1N9WA 5GAGC 1W3SA 1VQ8A 1PH1A 3HOWG 4B3ML 2V1CC 1HNWL 4QQBX 1NTGA 3DM3A 5C4JH 4DV4Q 1K0RA 4XIGS 4DV7Q 3KFUA 1EIYB 1TWGH 3TQYA 3UE1A 1Y1VH 4YWKA 4GKJL 3F1ZA 3G6EA 3BZCA 1VQBA 3CC4A 3HOWH 2A1AA 4A3FG 3L7ZC 3S16H 1N33Q 1AE3A 3SGIA 1Q7YC 1FJGL 2AWOA 2JA9A 4GN5A 2Q2TA 1TWHH 5GQOA 3PUZA 3ICEA 2VL6A 4DV2L 2YU9H 3CCLA 3T1YL 1PVOA 4DR1Q 4BBRG 2UU9Q 1SE8A 3AQQA 2HQLA 2WAQG 5FJ8G 1TWCH 1E7ZA 3CMEA 4TQUS 2B63G 3BU2A 4JI2Q 5LMNW 3T1HL 4L5SA 1XNRQ 2CCZA 5J3BA 1J5EQ 3VDYA 4PZ6A 4DNIA 4R4TA 1RIPA 1SR3A 1TWAH 3CW2C 4L5TA 3GTJH 2NVQH 1L1OC 1Q8KA 5IP9H 1XPUA 4YCWA 4BY1H 4BBRH 1GKHA 4TVAB 4A3KH 3S1RH 2B63H 2K4KA 1CSQA 2PI2E 5JJKA 3KOJA 4PZ7A 4GKKL 2QA4A 4NXMQ 4MZ9A 3WWVA 4PZ8A 4LF6Q 1JJCB 1XMQL 1VQ7A 2KCMA 1L1OA 2ZM6L 3CCQA 1M1KC 1T9HA 2WB1E 2R7FA 1IBML 2ATWA 3MXNB 1YBYA 1JT8A 3RZOH 3NELA 4B3RQ 3PGZA 1G291 4JI4Q 5JJLA 4A4IA 4QY7A 2CFMA 4P73A 2GVAA 5FLMG 2HHHQ 1U5KA 4BXXG 1ASYA 1HNZL 5C44G 3J81i 3CQZH 4A3GG 3CCSA 1Q82C 1YJWA 2VNUD 4YWLA 3PSIA 2LSSA 1IBLQ 1VQNA 2Y0SG 4NXNL 1JJ2A 3AFPA 3J81c 1P16A 3CCRA 2YTXA 4DV1Q 1XNQQ 4KLKA 3M4OH 1E3PA 4IFDG 4C2MH 5C3EH 2D0PA 3KF6B 3CCJA 3GTKH 5FLMH 2Z6KC 3PF4A 4JV5Q 4BXXH 4B3RL 3PUWA 4YY3L 1N36Q 2VQEQ 5C44H 4JI4L 2VUMH 1N32L 4JI0Q 2IHEA 1I3QH 4GNXC 2N78A 1VQDA 3PIOA 1YJ9A 4UY8C 5JJIA 4A3IG 4JI5L 1HZ9A 2R7ZG 3M7NA 1B8AA 2UXCQ 3GD7A 2IHFA 3FKIH 1OXSC 3CD6A 2CQOA 4GNXA 2VW9A 4JI3Q 1EQRA 3Q8DA 5M3FH 4DR2Q 3STBC 3I4MH 3K7AH 3K7UC 1QVCA 2PI2A 4GN3B 4A3IH 1YI2A 1HR0L 2UUAL 1X3EA 2AWNA 2N8NA 2F4VL 4BY7H 4DR7Q 3NENA 1Y1WG 3UE0A 5C0XG 1TXYA 1SLJA 3HKZG 2MO0A 2R7DA 3PUXA 4HJ8A 1D7QA 1NBWA 2YTVA 1A0IA 5AJ3L 3CPWA 4IJLA 1RL2A 2B3GA 2OQ0A 5IYDH 1UE1A 3U58A 1M90C 2OCEA 2QEXA 4HJ9A 4JG2A 1BBWA 3CF5A 1PHJA 4LF8Q 4JI6L 1S40A 2UUBL 1Y1WH 4AYBE 4L5RC 3MEFA 3CC2A 2JA6G 2UXBQ 1YVCA 1FVIA 2C35B 4LF5Q 5IP7H 3RN5A 1VS0A 1HZAA 4HJAA 1QUQA 2NN6I 1LTLA 4DUZQ 4OX9L 4JYAQ 1JB7A 2CKZB 2JA6H 3S2HH 1C9OA 3K8AA 5DLQE 2BH2A 2OQKA 3RLOA 5GAEC 2HT1A 5BR8L 1FGUA 4DV5Q 3HOUH 4R4OA 3F2CA 4K0KL 2D0OA 1CUKA 1X54A 1WJJA 4LFCL 1P8LA 1UE6A 2EQSA 2PQAA 3JAMi 1K9MC 1EYGA 2JA7H 1KD1C 4DPGA 2MO1A 4BA1I 1C7YA 1BKBA 4IOAA 1WFQA 1PA6A 3W5OA 3JAMc 2I5LX 1VQHA 1N34Q 2E2HH 1OTCA 1C0AA 5LMNL 3NEMA 1AE2A 4UP8A 1MKHA 1X9NA 3ULPA 5GADC 1HNXL 3GTLH 1L1OB 4JI7Q 3PV0A 4KHPQ 1UE5A 4DV0Q 1I5FA 2EXDA 3U50C 4DV3L 1VQJA 2K5NA 2A19A 3L0OA 5M5XH 1H95A 1VQFA 2PMZE 3I55A 1Q1BA 1VQAA 2KHIA 5H1SE 3PF5A 1R9TH 1K8AC 4JC0A 2E5LL 4LFAQ 3AEVA 3PIPA 1V43A 1A62A 2RCNA 2K50A 2HIXA 4J15A 5M3MG 1A8VA 1YIJA 1EFWA 2RHQB 1KRTA 1VQEA 1I6HH 4DV4L 3TREA 4DV7L 1EUJA 4LW1A 1VQ9A 2UXDQ 4A3FH 4R1JA 1J6QA 4P71A 1A63A 2F3IA 2Q2IA 3A5ZB 2ZTDA 3EN2A 1PH3A 1EOVA 2KCTA 2JA8G 4DAMA 3G71A 1VQMA 5M3MH 4LF4Q 4GLVB 3U4ZA 3W1GA 2PNHA 1IXRA 2B29A 4MNOA 5IT9c 1N33L 1S72A 3S17H 1G6PA 2DUDA 2BA1A 1S3OA 1X3FA 4UP9A 4GLAC 5FJ8H 4BA2I 3STBD 4X62Q 4OWXB 1CKOA 1I94Q 4DR1L 3KJPA 2JA8H 2UU9L 4ME3A 1QVFA 1XPOA 4GNXB 1QZHA 3BZKA 2JE6I 4IOCA 2XTIA 4JI2L 2A8VA 1PV4A 3A74A 1XNRL 3RZDH 1PH9A 1J5EL 1UE7A 4JBWA 1LYLA 1JE5A 1HZBA 1PH8A 3TRZA 3E0EA 4L5QA 1PH7A 3AFQA 4LF7Q 4YHHQ 3GTGH 2CWAA 3LGJA 2KENA 1VQPA 1XMOQ 1Q1EA 2Q2HA 1KC8C 3ZJYC 2JEAI 5IYCG 1I94L 4NXML 2GN5A 2ID0A 4LF6L 4LFBQ 2L15A 5LMUQ 1X6OA 2VQFQ 2WB1G 3I2ZA 4DR5Q 5ELOA 2Y0SE 1PH2A 1OXUA 4R4IA 3J80i 4DUYQ 4YCVA 1YEZA 3CMAA 5C4XG 4A3GH 5IYCH 4PMWA 3GO5A 1QVGA 1NJIC 3M3YH 3J80c
chains in the Genus database with same CATH superfamily
4JI1Q 5CR3A 2HHHL 4CBVA 2B2WA 2EYLA 3HOXG 4LF9Q 3I4NB 4BBSG 1STNA 5JJZA 2Z6KA 1IBLL 3H0GG 3A54A 4KN7C 3K57A 1QNUA 5KNCA 1FD7D 1PRTF 4E6IA 2FXQA 3BG3A 3DEPA 2Z4HA 3HFZB 5E7NA 4A3MG 3D4DA 1X3GA 3IFDA 3BS1A 4KKTA 4P2CB 2NVYH 1E24A 1FR3A 2I5HA 1K8MA 3IKJA 2Q8IB 4AQYQ 1X55A 3CU7A 4OXPA 4DR7L 1STYA 4X65Q 1XXGA 2KHSA 4WJWA 1O7YA 4HIDA 4POFA 4FXDA 4DXFA 1TIID 1LTID 1K8GA 3WDNA 2X6LA 1Q90A 2Q8RE 3H3VC 5DNFA 1HRJA 5LHY1 2HUGA 2MJ8A 1D8LA 1UWVA 2AMCB 1JOKA 2GVBA 2LXJA 1BQQT 1IZ6A 2VUMB 4DF7A 3P75A 4LF5L 1SFOB 3GTMH 1NE3A 3I8ZA 2VS1A 4JYAL 2K05A 2E2HB 4GOPC 4KD4A 1KL9A 5IYBG 4FYDA 1D6EC 1GVPA 1VQ5A 2OWOA 1DGSA 4CKEA 4B3MQ 3URYA 1NMGA 4X3SA 1BR9A 3DMUA 3LWEA 1G91A 2WP8J 1B50A 4XYOA 5EAYA 1KLUD 4QUFA 5CBEE 3NPPA 1MBYA 1TWHB 2K14A 2PMZB 3SEBA 1DZ1A 4DK1A 2F0IA 2Z4IA 1TWCB 2B39A 1HFGA 4R9WA 3P7JA 1E22A 2MNAA 1B70B 4IQZA 4JOIA 4LUZA 3T1HQ 1TWAB 4LFAL 4I65A 4KY7A 1PYBA 1QE6A 3GTJB 2L1BA 3D3RA 3S1RB 3FVQA 3S1NH 2DY7A 4GKKQ 2UXDL 1JOQA 3BDCA 4BY1G 3HOYH 4A3KG 4LF4L 2ZM6Q 2IX0A 1AFPA 4B08A 5G3LF 1PRTC 2CW0C 4GLXA 2JK8A 1PXUA 3I56A 3I70A 1LV9A 2GA4B 3GDEA 4A93G 1WVLA 3F2UA 3MAQA 1VMCA 4XQJA 1R4PB 4C1NI 4DAPA 4A3GB 2CH4W 4RGMA 2DY8A 3M4PA 2QDLA 4OIKA 1NMFA 1QUQB 4NPSA 2JQOA 1RTOA 3SXHA 1SROA 4QIWE 2G9HD 3F2BA 5CV5A 5C4XH 3M4QA 2BA0A 4RKBA 1Q8IA 1SYGA 1YHAA 4ILWA 3RNUA 3K7AB 4ULLA 4A3IB 4JI8L 3D6WA 5M5YH 4X3UA 4JI1L 3H0GH 1HR0Q 3K0YA 3MXGA 1NCVA 4HIKA 4LF9L 4PQXA 1C4QA 5M3FG 1QWYA 1Q12A 3R93A 3OYYA 3DLLA 5JEAH 3JC66 4V0BA 2NVYB 1Z7TA 5HGQA 4DN4M 5IGDA 1MJCA 3NBHB 2I0QA 3OHXC 4BY7G 1TKWB 2K1BA 4WJ4A 2XN9C 1SNCA 4H02A 1Y14B 3HRZC 2RF4A 3MWYW 4A3JG 1I4GA 4JI6Q 3MXNA 2UUBQ 3PQIA 3S9WA 5J22A 5I9OA 3I4OA 1VQ6A 3HGBA 2KHJA 1EWIA 5IOCA 4JW0A 1CA5A 2ES2A 2NN6G 1GUOA 1SYEA 4OX9Q 1JB3A 4QJFA 4AQYL 3OSOA 4X3TA 4R8IA 4AYBG 3S14H 2YTYA 3HOVH 4X65L 5BR8Q 1IYUA 5IE8A 4LFCQ 1K3RA 2YV5A 1E1TA 5BN3A 2KVMA 5KYIA 3CXCA 3HOUG 2OTJA 1DYQA 3E0JA 2F3WA 2JA7G 3BYYB 1CA6A 1D1IA 5T1GA 1HNXQ 1TS3A 1ASZA 1YNNC 1L0WA 3NWTA 5HY6A 1VQKA 2JN4A 5IYBH 1R9TB 4OWWB 2EE1A 3NP8A 1BO0A 4O1NA 1UEBA 3MFGA 1STGA 3EJIA 1K0SA 3K6OA 4U673 1Z9FA 1VQ8A 3BVGA 1WD0A 4FO2A 4ABNA 4B3ML 1NTGA 1JOOA 3DM3A 4DV4Q 4XIGS 4DV7Q 3EROA 4NMZA 3F1ZA 3TN2A 3BZCA 3S16H 3I90A 1SNOA 1AE3A 1NR4A 3SGIA 3MXUA 3H09A 1EWHA 2JA8B 3ICEA 3CCLA 4KY5A 2HQLA 1E7ZA 1K3BC 2PCFB 2BE5C 3P1HA 4TQUS 5FO8B 5LMNW 3T1HL 1EY0A 1J5EQ 1H9JA 1SR3A 4BY1H 4BBRH 1RKNA 4A3KH 4JK1C 2L12A 5JJKA 1D5ZC 1SYFA 4GKKL 3BZDB 3QIAA 1A2TA 3WWVA 5I2YA 1VQ7A 1L1OA 2ZM6L 1O80A 3CCQA 1M1KC 2ICEC 3BDOA 1YBYA 1HA5A 4ZUJA 2MUYA 3PGZA 5EPLA 4B3RQ 1G291 3TZUA 4A4IA 3MFYA 2GVAA 4P73A 4BXXG 5IGEA 3EVQA 3CQZH 3J81i 1AN8A 3AB9A 2E2IB 4DK0A 5C4XB 1VQNA 1G2TA 2C5CA 2Y0SG 1DM0B 3J81c 4Y7NB 4DR6Q 2YTXA 1XNQQ 2RCFA 1E3PA 2NVXB 3HOXB 2D0PA 3KF6B 3GTKH 4JV5Q 4BBSB 1D5XC 3U9SA 3H0GB 1EQVA 4JI0Q 4GNXC 1VQDA 3VYSA 1EFID 4EQOA 5JJIA 4HCEA 1ML0D 2DN8A 2R7ZG 1B8AA 4A3MB 2IHFA 1B4OA 5M3FH 2K33A 4DR2Q 4B9WA 4GN3B 2PI2A 1HR0L 3TP5A 4BY7H 1LTBD 5A2QL 3I73A 3EA6A 3KK7A 1TXYA 1SLJA 2B2YA 3L9AX 2R7DA 2QKIC 2YTVA 4KJOA 3VYUA 2OQ0A 1UE1A 3K58A 2F0EA 2QEXA 4JG2A 3S14B 4LF8Q 4JI6L 1IKLA 1S40A 2RDHA 1Y1WH 2UUBL 5C0XH 4HMIA 2UXBQ 2NN6H 3DEOA 1GUSA 2KEDA 3TDQA 3RN5A 1VS0A 2NTSA 1QUQA 4CDDC 4OX9L 2CKZB 1C9OA 4ZKBB 4IUQA 4KN4C 5BR8L 4BWGB 4DV5Q 3HOUH 3I91A 2D0OA 1CUKA 1X54A 4LFCL 3KLSX 3JAMi 2JA7H 2K5QA 1BKBA 1MSGA 4IUNA 3JAMc 2DNCA 1OTCA 2X6GA 3NEMA 1MKHA 2IWHA 1HNXL 5HGTA 4KHPQ 3VYRA 2A6HD 1EEFD 1VQJA 2B2VA 3K5NA 3L0OA 5M5XH 2EJFC 1H9KA 4HN7A 2F3VA 2XRSD 1V43A 2K50A 2HIXA 5M3MG 1A8VA 3GV6A 1S5CD 4DV4L 3TREA 4DV7L 1VQ9A 1M8AA 4MIUA 5L37A 4P71A 1A63A 5CV7A 3A5ZB 3EN2A 1HTLD 4CDFC 4DAMA 3G71A 1VQMA 1U4LA 4G7HC 2C9OA 5IT9c 1D5MC 4BY1B 4GLAC 5IGBA 2RQXA 4A3KB 4BA2I 3STBD 4OWXB 1CKOA 1ILQA 1I94Q 2NZ1D 2L11A 3HZXA 1XPOA 1QVFA 5CV8A 4RCOA 1J5EL 4JBWA 5BN5A 3E0EA 5C4ZA 3KBXA 1XX8A 4YHHQ 1XYIA 2CWAA 4A93B 2KENA 1V1OA 1VQPA 5I9PA 2EY1A 4QMGA 1GUNA 1SJHD 3CQZB 1DD2A 4LFBQ 5LMUQ 2B2WC 2F0GA 5CV6A 4DR5Q 5C3WA 2EYJA 1ET9A 4HAEA 4R4IA 1G8ZD 3J80i 3GTKB 4KKSA 4X3KA 1YEZA 3CMAA 2O5JC 5EPJA 1ENAA 3J80c 1TWFH 1YNXA 1PZKD 3NE5B 1BCPF 1DCZA 4GZYC 5DM73 2JXMB 2IW3A 1F9QA 2VY3A 1LM0A 4DR6L 1XNQL 1HPCA 1VQOA 2R92H 4JV5L 4P75A 5M3FB 3VR4A 1CI3M 2PQAB 4DR4Q 4JVZA 4JI0L 1C8CA 1CKNA 2OTLA 3H3VH 2R7ZH 1WTPA 1WYDA 4BY7B 1XPRA 5IY0A 5K5PA 1KAAA 1SNPA 1VQGA 1KRSA 4A3JB 1IBKQ 1OXTA 4DR2L 4K5VA 2AUJD 3D31A 4CDCC 1ILPA 3C46A 3TSSA 4JBKA 5C0XI 4X64L 3NQTA 4DR3Q 3T13A 4AYBB 5JEAJ 3OWFA 4KHZA 1II3A 2Z9HA 1KTKA 3WOFA 2NVTH 3TBIB 4ID6A 1I4HA 2E8GA 4LF8L 4LJZC 3OTOQ 1PYWD 1SNQA 3H91A 1E1OA 1XJVA 3HOUB 2ASBA 2UXBL 2RHSB 4DK3C 2JA7B 1ET6A 4A3EH 4LUOA 2NZHA 3S1MB 4OWTB 3CCUA 4NDXA 4NB3A 2ZJQA 5C5LA 4DV5L 3CCEA 2RKSA 1H9MA 1CZWA 4KV6A 2AQ2B 3UDGA 2CVRA 4DAYA 1YHQA 1PH5A 1BCPB 2F52A 4HSVA 1Y1VG 4DKAC 4DXGA 4JOIC 5JPMC 1KXLA 1I4RA 2ALYB 4UDUC 4KHPL 1GD7A 3TMEA 1H9RA 3NWSA 2D5DA 2XGTA 2E2DC 1B7YB 1KAWA 1K73C 3HOYG 3A0JA 3C2PA 1SN8A 3D0FA 1HHVA 3MVVA 5FLXE 3RD4A 2EVBA 2KEEA 5IP9G 1F77A 1S4ZA 4R4QA 4FF4A 1QZGA 1JE4A 3CKIB 1IBMQ 5GAHC 2H4OA 1U4PA 2AKWB 2ZT9C 1DOKA 3O13A 2K7VA 1TY2A 5JAVA 1PTOD 3FEWX 5CBAE 4TRDA 3M4OB 4I7ZC 4NXNQ 4GS3A 2F0HA 4M1UB 4YHHL 2F0MA 1KIXA 4JI8Q 1MJEA 1STBA 4K6LA 3PO3H 1V9PA 2EIFA 2PZWA 2R6GA 4YY3Q 1N32Q 5JJLA 2Y0SB 4A3BH 1FNWA 3A8JE 5HURA 3FMCA 4XT1B 2IY5B 3T4AC 1H9SB 4LFBL 4JI5Q 3AYHB 5LMUL 4DR5L 4FNFA 3FPUB 1W6KA 3DM1A 5JEAG 4H0LC 3FDTA 3VR5A 3HKSA 3HEJA 3FKIG 5JVH3 2R7ZB 1UEAB 4I7AA 4RGNA 4ZCKA 2F4VQ 1PH4A 3C1EA 3H3VI 3I4MG 3ERQA 4CJ0B 2SDFA 1ZEQX 2NUCA 1HH2P 3SK8A 5AJ3Q 1VQ4A 1CSPA 5IIFA 1YITA 5FK9C 4DR4L 4GOPB 4C1NK 5LL6X 4FF3A 1UAPA 2AUKA 1WD1A 1VQLA 2WIIB 4OO1I 2K6AA 3S1QH 2PO4A 3HOVG 4RCNA 1BOSA 3SK6A 2EOTA 4K6DA 2F03A 1IBKL 3RR5A 4PMCA 4X6AH 2NVTB 1U0LA 5JPNC 4NKLA 4YIJA 2FFKB 1SMXA 2P5ZX 1HFNA 2BDNA 1Q46A 2RA4A 1JQYD 1B3QA 2ZJRA 3B6YA 2EXZA 4F8MA 1VQIA 3QOLA 1NNXA 4DR3L 2YYZA 2SNMA 3TS2A 3A55A 1EY6A 1HR0W 1SMYD 3OTOL 3KDFB 2OT2A 3A8KE 1WTHA 1JMCA 2I07B 5C0XJ 2K5HA 4IURA 3T51B 4IO9A 2QGQA 2CWPA 5CC4A 4DV3Q 5FO7B 3CC7A 3QO2A 1MSHA 1ESFA 2EYMA 1MI2A 4IUUA 1W3SA 1L0XB 1PH1A 1I6HB 2IL8A 4G4KA 3DHQA 1PRTB 2V1CC 4CKCA 5A2QE 5C4JH 3KFUA 3TQYA 1Y1VH 4EQNA 5M3MB 2RDGA 4YWKA 1VQBA 3CC4A 1LLRD 3HOWH 3RUZA 1B53A 4FF1A 2VXWA 1TY0A 1O7LA 2AWOA 4MTKA 4RAUC 4OL7A 5CORA 2YU9H 2D9UA 1KNAA 2E74C 4BBRG 2KOLA 5FJ8G 3RZDB 2EYFA 3BU2A 3GQBA 2QEJC 1XNRQ 2X69A 4IZ8A 2CCZA 2EPBA 3VDYA 3NHHA 3GTGB 2AQ3B 3CRLC 4R8NA 1L1OC 1Q8KA 5IP9H 2FJ2A 4QF4A 2B63H 1CSQA 2PI2E 3KOJA 4PZ7A 4G7OC 4NXMQ 1LO5D 1JJCB 4IALA 4ZLTF 3T16A 3OIQA 3LNNA 2R7FA 1IBML 2F1MA 2NYZD 3RZOH 2F0KA 4KK7A 4ZKCB 3V05A 4ME5A 1U5KA 2A6HC 1Q82C 2L0CA 4ODGA 4YWLA 4NXNL 4CJ1B 4DV1Q 4KLKA 3RMHA 4QIWB 4C2MH 1PFMA 1TR5A 1RDPD 3R3OA 4YY3L 5C44H 3VYTA 2VQEQ 1N32L 1D2BA 1I3QH 4JI5L 4IFDH 5ELFA 1C48A 2UXCQ 4CDEC 1PTOH 5C4HA 3FKIH 1OXSC 1S5BD 3CD6A 1EYDA 2B2YC 1O78A 3STBC 3I4MH 1QVCA 1YI2A 1HQRD 1CQVA 2ZXOA 2AWNA 2N8NA 2F4VL 3S1QB 1Y1WG 2EY2A 5C0XG 2A73B 5EBDA 2MO0A 2MHVA 2V4DA 5EKIA 1EZ6A 2F0FA 4IJLA 5C5MA 5AJ3L 3PIP3 1RJTA 2OCEA 4HJ9A 1PHJA 1BBWA 4DFAA 5FLXL 3MEFA 1A15A 4KJNA 5C6AA 3CC2A 2J0TD 5NUCA 3TP7A 1PZID 5IODA 3GTMB 2C35B 2EY5A 1CK1A 4B9XA 1V8QA 5TSSA 4G7ZC 3GV3A 1HZAA 4DUZQ 1LTLA 5ISRA 1S5ED 2JA6H 3S2HH 1E2WA 5DLQE 1Y8NB 3BDLA 3JAML 3RLOA 1DJRD 2HT1A 4K14A 1WJJA 1D1KA 2WINB 1K9MC 1EYGA 1FNUA 2F0LA 4BA1I 4F7XA 1KD1C 3VR3A 1A6XA 2L5TA 1N34Q 1VQHA 2LFNA 2B2VC 4MHEA 1WTXA 1C0AA 1PTOF 3J7YW 1X9NA 3GTLH 4JI7Q 1PFNA 4OHJA 3U50C 4DV3L 2K5NA 1CT1D 1Y1VB 4L6TB 1DXMA 2A19A 1H95A 1VQFA 3J7AV 1S5FD 1DONA 1ONLA 2F0OA 3S1NB 5KRUA 4J8QA 3HOYB 4LW1A 2EYPA 3SDZA 3NQIA 1EOVA 3U4ZA 3W1GA 2PNHA 2B29A 4G57A 3S17H 2DUDA 1S3OA 5FJ8H 2RSOA 4CHTB 1Y8OB 1GJXA 1V1PB 4RFBA 5ELEA 4ZK9B 1G2SA 4GNXB 3TZDA 3BZKA 5JOBA 4IOCA 1IKMA 1PV4A 1XNRL 1LYLA 2HD3A 3RZOB 4LK1C 5IGGA 1BUVT 1KDCA 3VR6A 1LTSD 1I4PA 1XMOQ 3M4YA 1QG7A 4NXML 2GN5A 2ID0A 4KD3A 1GUWA 4RGOS 1STEA 2L9HA 1X6OA 2K01A 1PH2A 1ZYRD 5M5YB 2M9VA 4RH6A 4PMWA 3GO5A 5IYCH 2QF7A 4J1MA 2R3ZA 3M3YH 2R92G 1I3QB 5FO9B 3NUCA 4B3SQ 4HJ7A 4P74A 1LTAD 3OIPA 2EDGA 3GP7A 3IAYA 4DV1L 4MTNA 3FKIB 1KLGD 2N49A 3UDFA 4UPAA 4IFDI 4HCSA 2VQEL 3I4MB 5F2DA 3S15H 1WCMH 1ENCA 3S2DH 3I7FA 1F2LA 3I3CA 3MTSA 3NK9A 4WORA 3J7ZC 2NBFA 1BVSA 4X64Q 2R93H 2UXCL 1ZXTA 3FHWA 3HKZE 4K2LA 1GHKA 2B8FA 1F9PA 1UNSA 1STHA 2BOSA 2QCPX 5CMDA 4ZAIA 1BXTA 3HOVB 2PPBC 1F9SA 1SEBD 1E2ZA 3G4SA 5ELDA 2PZUA 1PTOC 1EU4A 5M5WH 1HQMC 4X66Q 1X65A 2A5HA 1Z6HA 2JEBI 1U4RA 3GTQH 4A3LH 3DUZA 3FP9A 1NUCA 3S2HB 3RLFA 4A3EG 1AZPA 5KEEA 3N6RA 5LL6S 2JA5G 3KF8B 3VA5A 2XIWA 4C3IH 4IPCA 4JCVE 5FKAC 1O7ZA 3NTIA 5I6YA 4DUZL 5I6WA 5CV9A 4TKOB 2K75A 3NBHA 1PFSA 3IRBA 4WJ3M 3L2PA 2PQEA 2NWGA 3ULLA 2WFWA 1GUTA 3PO2H 1NY4A 3K5LA 3ND9A 2RSNA 1YZ6A 1ICWA 3H6MA 3W1BA 3PCOB 3RLNA 4AH6A 4A3CH 1EQQA 1N34L 2E2JH 3S16B 2A69D 1L2FA 2DJFC 2XRQD 1GM5A 5CGKA 2HCCA 3UDIA 4JI7L 4EX5A 2ZXRA 2F0NA 3T1YQ 3NSWA 2JJQA 3QG1A 3F8TA 3MZ5A 1Q86C 4DGZA 1A2UA 2EJMA 1X56A 2BH8A 1HJPA 2F0QA 1EYCA 2ZJPA 2KECA 3EBEA 2MP1A 4R4CA 4AIMA 4BBRB 2B2UA 2WACA 1HZCA 4C3JH 2FHTA 1W6JA 4L63B 1WTOA 2SNSA 4IPHA 3NBIA 1XMQQ 4N9PA 5ELNA 2VB2X 3Q22A 2F0TA 1SMYC 1S5DD 1HXYD 4QGUA 2N3SA 1YJNA 2BCOA 4A3DH 1O7IA 4JBMA 2M2LA 4DNTB 4CGYB 3PO3G 1I4XA 4A3BG 1GHJA 3K59A 1I50H 1BBUA 3K80C 4XTCS 1T5XD 1GO3E 1JWSD 3TEHB 4POGA 1XMOL 3SE0A 3X3NA 1IW7D 5C3EG 2F0SA 4C3HH 1SYBA 3KLSA 2QW7A 4EGVA 2LKVA 1K83H 3IL8A 5E1FA 1KNEA 2OEOA 4FP5D 3S2DB 4MN3A 4B3SL 2NZOA 3X3MA 2UUAQ 1PH6A 3M85A 1V1QA 3K0XA 3MEHA 3I4NH 3J81j 4Q5VA 4IJHA 1WTVA 2IX1A 4QL5A 4FXKC 3NTKA 4ALPA 3PUYA 4OO1H 1SNDA 1KHIA 1WTRA 1Y1WB 3K5OA 5IYDG 1DOMA 3CCVA 5G3LD 3EQLC 4IFDJ 3E3XA 2DJGC 1MIUA 2OXPA 1IHZA 2BDOA 1YNJD 3OOCA 1IL2A 4Q0FA 1XWEA 3J81E 3QJYA 4B3TL 1KABA 4RG1A 1MD2D 3KF6A 3LX0A 1JWUD 4X66L 4HIOA 4FF2A 1HNWQ 5K36H 4F88A 1FNVA 2QILA 4IUTA 3H15A 2K5WA 2XWBB 2JA5H 2PYKA 3MC0B 1B44D 4CJ2C 3J7A5 4XXEA 2EYOA 5ELCA 2ICIA 3D6CA 1XTDA 1VF5C 4IN3A 5M5XB 2J4XA 1IYJB 3BVZA 3HP3A 4UP7A 1VCIA 4DK6C 2KA7A 1SFOH 3E9HA 4BS9A 2E5LQ 1N9WA 5GAGC 3HOWG 3V2TA 3D4WA 5DAUA 3OPOA 1K0RA 1MHWC 1FYCA 3EFXD 3MA2B 1EIYB 3UE1A 2F4IA 2A1AA 4A3FG 1TT2A 3L7ZC 2A74C 1N33Q 1SNMA 1EEID 1Q7YC 2JA9A 4GN5A 1TWHH 5GQOA 3PIO3 2VL6A 5EKKA 2F0UA 3T1YL 1PVOA 2WAQG 2JYOA 3E5SA 1TWCH 2B63G 2F0VA 4N8X1 4JI2Q 3A7AB 4L5SA 5J3BA 4PZ6A 4DNIA 1RIPA 1TWAH 4L5TA 3GTJH 2NVQH 3JAME 4YCWA 2PNRC 2KQ3A 4TVAB 3S1RH 1PFBA 4KTAA 3HS0C 4PZ8A 4XQNA 4LF6Q 1XMQL 1CTMA 1RD9D 2KCMA 2KCCA 2KCNA 2A6ED 1SYCA 2ATWA 3MXNB 3NELA 5BN4A 1TWFB 4U68A 3OW7A 2O5IC 1SE4A 4HMJA 5C44G 5M9OA 3CCSA 1YJWA 2VNUD 1WTWA 2R92B 1P16A 5IGCA 4IFDG 4S3SA 5C3EH 1VF7A 1HA6A 1SJED 3CCJA 3PF4A 5FLMH 4Y52H 1EOTA 1N36Q 4JI4L 5IT9E 2IHEA 2N78A 3DWQA 1YJ9A 4UY8C 5EKLA 2N88A 3T56B 4H44C 2VW9A 4HEDA 4JI3Q 3Q8DA 3K7AH 4A3IH 4N8FA 5D3DA 2UUAL 4IUVA 1X3EA 2F0WA 1VMPA 3UE0A 1SXTA 3HKZG 4UHVA 4ZYSA 5KYLA 2F0JA 4K5XA 1GXDC 4HJ8A 1D7QA 1U4MA 3VA7A 3CPWA 1A0IA 5IYDH 4IUPA 2DNEA 2EZVA 3U58A 1M90C 5CV4A 1HUMA 3CF5A 5KIXA 1Y69U 4L5RC 2Q8TA 2JA6G 1EZ8A 4HTHA 4K2KA 4RHRA 1KDAA 3J80E 1CFMA 1YVCA 1FVIA 4A3EB 4HJAA 5T1IA 1ZYRC 2JA5B 1F2ZA 1B1ZA 3K8AA 4KMUC 1RHPA 2O4XA 2LMCB 1Y8PB 2OQKA 5GAEC 1FGUA 5AFWA 3A7LA 3NTHA 3F2CA 1DOLA 1P8LA 1UE6A 2PQAA 1HNWL 2MO1A 1BBXC 2L4NA 1C7YA 4DU9A 4IOAA 2HCIA 3QB3A 1PA6A 5E4XA 3W5OA 3MXPA 1B2TA 2I5LX 2A68D 1CHPD 2RVLA 1AE2A 4UP8A 1FGBD 1F9RA 3SVMA 2ENBA 1L1OB 5GADC 1UE5A 4DV0Q 1I5FA 1EU3A 2VB3X 2PMZE 1Q1BA 2KHIA 1J9OA 3PF5A 1R9TH 2HDMA 2E5LL 3AEVA 3Q0AA 3PIPA 2FMCA 1RTNA 4J15A 2J7ZA 1YIJA 4PV1C 2RHQB 5EQ0A 1KRTA 2OF1A 1EUJA 3ITPA 4DA2A 4A3FH 1J6QA 2F3IA 1PH3A 2ZTDA 2KJXA 4GLVB 4XYQA 4MNOA 1N33L 4WFN3 2NVQB 2BA1A 1X3FA 4UP9A 1AEXA 3SK5A 5JVG3 4X62Q 4LMQD 1PLFA 2JA8H 1QZHA 2JE6I 5FOBB 2XTIA 4JI2L 2A8VA 3TRZA 1UE7A 1PH8A 4TSSA 1NSNS 4LF7Q 3PO3B 3J81L 4A3BB 4HR7B 2JEAI 1SE3A 5IYCG 4LF6L 2E76C 1I4QA 2FMMA 2A69C 2VQFQ 2WB1G 3I2ZA 3TP8A 4K5WA 5C3EB 4DUYQ 3H94A 4YCVA 1QVGA 2UUCQ 2LXKA 2AQ1B 3QR8A 5KNDA 3CAMA 1WCMG 2IPKD 2K03A 3Q24A 3I4LA 3M9BA 4KHVA 2E2IH 3U4VA 2TSSA 1QNKA 2R93G 4Y7NH 2NVXH 3HOZG 3V96A 3TS0A 3HOXH 1N36L 4KI0A 4BBSH 3UDXA 3M7GA 1KQSA 1LTGD 2B2TC 1EY8A 3DXJC 5IWAQ 3PMFA 2EYHA 1PMRA 3N52A 1G51A 2VZAA 2PZTA 4CKBA 1TU2B 3ER0A 5D65A 4DV6Q 1A3UA 1LUZA 4F87A 4O2DA 4A3MH 4A3LG 4JI3L 2WKDA 4ZQ3A 4LNQA 2D62A 2JSOA 2NB0A 2I46A 3AU7A 1X3PA 2MQHA 3A56A 1CHQD 2WKCA 3KJOA 2AHOB 4JBJA 2JP1A 1WI5A 4C3IG 2PW7A 1H9SA 2Z0SA 3D4RA 1IW7C 2IX3A 1LT5D 3S24A 1FL0A 3U9OA 2G5DA 2SOBA 3PO2G 1BCPD 1TVXA 3L3OC 4HJ5A 3C1FA 4PNYA 4A3CG 2TMPA 4OEMB 1MGSA 5C4JB 3GTOH 1U9RA 4GOPA 4RA8A 4K8IA 3F2DA 1EIHA 4OELB 3HOWB 1GUGA 4GKJQ 4YWMA 3P20A 3SHLA 3D8GA 3A5UA 3SK4A 5A35A 5D14A 2HIVA 4RMFA 4UAIA 1EY7A 5IT9L 4P72A 2YU9B 1FJGQ 4IPGA 2LY7A 1XTCD 2K5VA 4DV0L 4DV2Q 2IT1A 2Z1CA 2B2UC 1ICFB 4A3FB 3ERSX 3R8BA 2WAQE 4C3JG 1YNJC 2WV6D 2MFIA 4NP5A 3GTPH 2NTTA 1HCZA 2WAQB 3OW2A 3OMGA 2B63B 2XSCA 4GN4B 1T5EA 1LABA 2Q2UA 1VQCA 1JCKB 1I6VC 1Z47A 4A3DG 3KDFA 1LT3D 2R61A 1SRUA 2EY6A 1G6ZA 3TP6A 1CKNB 2K5DA 1UUPA 3NXWA 1SE2A 3W2DA 1WOCA 1OXVA 3KBGA 4FDBA 4J6HA 4X62L 1AH9A 3J80L 1NAPA 1HNZQ 2DGYA 1JWMD 3BVMA 1EIGA 1PZJD 4C3HG 1AZQA 5COYA 4C2MB 4DNRB 2EJGC 1N8RC 4EQ5A 3KLRA 4LF7L 3EIVA 4A75A 4A76A 2H1EA 5C44B 4LUVA 4PMBA 4M8AA 3CPFA 4A93H 1Q81C 2ZTEA 5E3FA 1A3TA 3Q6SA 3ULJA 1PTOB 2VQFL 1EIFA 4FXGC 3ND8A 5EJWA 2M00A 3I4NG 4PG3A 4DUYL 1E0BA 4RHSA 3BJUA 2K32A 2O2LD 2H5XA 2UUCL 1OXXK 4YCUA 4OO1G 4RKLA 1QILA 1LTTD 1QOHA 3ZYYX 1PYSB 4XQQA 4HIMA 4NW2A 3HOZH 1BNZA 2CHBD 1JICA 1TS4A 4QB4A 2B2TA 3PUVA 3R2TA 3CCMA 4B3TQ 3LWUA 1LT6D 3HKZB 1ENFA 1RODA 2MPMA 5IWAL 3G48A 4DAYB 1W2BA 3E9IA 4IPDA 3KYHC 2K52A 2A6EC 2ZTCA 1KDBA 4DV6L 1HTPA 4A3JH 2JA6B 5K36G 2PW5A 2K04A 5IP7G 1STAA 3W3AA 3KLWA 1JJGA 2F0PA 1CKMA 4N9TA 4K0KQ 3DWAA 4OONA 1X3QA 1IYVA 2HDLA 4LWCA 3OWEB 1EWCA 5GROA 1YHBA 2VUMG 2IJ0A 1RF2D 5CYUA 5FLXc 5LMNQ 2CH4A 4O0AA 2I5MX 2KBNA 4RWSC 3RN2A 2SEBD 1PRTD 2CW0D 3GTLB 3SR1A 3GTOB 3CP0A 3K81C 4H7BA 4RGTA 4APVA 1JR0D 5EBCA 1LTRD 3S1MH 4Z9CB 1EY9A 1Q3LA 4KKUA 4QQBX 2Z8LA 3WOEA 3ONAB 4V190 1TWGH 1E2VA 1CM9A 1B9NA 4GKJL 3E6ZX 3S17B 3G6EA 2XWJB 3GTPB 4EQPA 1FJGL 2FINB 2Q2TA 3C3LA 3PUZA 4DV2L 4DR1Q 2UU9Q 3AQQA 1SE8A 1BDOA 4K8JA 4O42A 3CMEA 5IGFA 1EL0A 4R4TA 3QOJA 3CW2C 3CHBD 1XPUA 3FRPB 1GKHA 1SAPA 1BF4A 2K4KA 2QDBA 3BYTB 2QA4A 1NR2A 4MZ9A 4QCLA 3VR2A 1T9HA 2A68C 2WB1E 1JT8A 3M3YB 4JI4Q 2XNAC 5DEHA 1LACA 4QY7A 2CFMA 2WB1B 5FLMG 2HHHQ 1ASYA 1HNZL 4A3GG 2HQEA 2LSSA 3PSIA 1IBLQ 1JJ2A 5C3XA 3AFPA 3CCRA 3M4OH 1ESRA 1R4QB 3FPPA 1VDZA 3S15B 1TS2A 1WCMB 2Z6KC 4B3RL 4BXXH 3PUWA 2K28A 3QWNA 1TQOA 5ELBA 3PIOA 2R93B 4A3IG 1QB5D 3HOZB 1TS5A 1V1PA 1HZ9A 1YNND 3M7NA 3GD7A 1ZKOA 3IFTA 2CQOA 3K5MA 4GNXA 1EQRA 3K7UC 3OMCA 5M5WB 5KGUA 1SSOA 4DR7Q 1K8OA 3NENA 1EQTA 3GTQB 3Q23A 2F0DA 3PUXA 5EPKA 1NBWA 1RL2A 2B3GA 3CRKC 4WRDA 1AP0A 3KUPA 3I72A 1F2YA 4AYBE 1OO9B 1EY5A 3R2IA 4C3IB 4LF5Q 5IP7H 4FVMA 2BE5D 3DWPA 2NN6I 4JYAQ 1CZGA 4LAAA 1JB7A 1EYAA 3J7AF 2BH2A 1F2MA 1A3VA 1EY4A 4OGQC 2RBMA 3PO2B 4R4OA 1SBBB 4K0KL 1L0YB 2ZXPA 4XT3B 2VUMH 2EQSA 4DPGA 2E2JB 1WFQA 2RDFA 2XVSA 1HUNA 2E2HH 1GOZA 2L55A 1QJOA 3HG9A 5LMNL 2Z6BA 1B3AA 3ULPA 3PV0A 2EXDA 1QCBD 4L8JA 1TWGB 2KUMA 3MHBA 3UI2A 3I55A 1AW7A 1B9MA 1VQAA 5H1SE 4ZUIA 1K8AC 4JC0A 1JORA 4LFAQ 1A62A 2RCNA 4C3JB 1EFWA 1IL8A 2LS01 1VQEA 1I6HH 2D2CC 1WTQA 2N55A 2G9DA 2CQAA 2UXDQ 4R1JA 1K28A 2Q2IA 4KY6A 5I2XA 3KF8A 1PDQA 2KCTA 4C56C 2JA8G 5EGTA 4LF4Q 3G6JB 5M3MH 4A3DB 1IXRA 1G6PA 1S72A 1J8IA 3G7LA 2MGSA 2B8GA 4DR1L 3KJPA 2UU9L 4ME3A 4OIJA 5J39A 1JC7A 1SYDA 4H13C 5I4DA 1BCPC 4ZRZA 3A74A 4XDXA 1I50B 3RZDH 1PH9A 1X32A 1JE5A 1HZBA 2E75C 4HSPA 5D3IB 1RCVD 4L5QA 1PH7A 3AFQA 4EVOA 3GTGH 3LGJA 4C3HB 5KNBA 1Q1EA 1CQFA 2Q2HA 1KC8C 3ZJYC 1I94L 5DM63 3T53B 2L15A 4DAVA 3AMUA 1SDFA 1K83B 4QUCA 5ELOA 2Y0SE 1M4VA 1OXUA 5E4WC 4JPBW 5C4XG 4A3GH 5J1ZA 1NJIC 3A8IE 1LT4D
chains in the Genus database with same CATH topology
1TWFH 2R92G 2UUCQ 1YNXA 2LXKA 4JI1Q 2HHHL 4B3SQ 4HJ7A 4LF9Q 3HOXG 4P74A 3CAMA 1WCMG 4BBSG 2Z6KA 1IBLL 3H0GG 3M9BA 2VY3A 1LM0A 2E2IH 4DR6L 3U4VA 4MTNA 4DV1L 1XNQL 2N49A 3UDFA 4UPAA 1VQOA 4IFDI 2FXQA 4Y7NH 2R92H 2R93G 4JV5L 4P75A 2NVXH 3HOZG 1N36L 3TS0A 3HOXH 2VQEL 2PQAB 4DR4Q 3S15H 4KI0A 1WCMH 4JI0L 4BBSH 3HFZB 1CKNA 5E7NA 3UDXA 4A3MG 2OTLA 2R7ZH 3I7FA 1KQSA 1WYDA 5IWAQ 1XPRA 3S2DH 1X3GA 3J7ZC 5IY0A 1BVSA 4X64Q 2R93H 1G51A 1VQGA 2VZAA 1KRSA 2UXCL 2NVYH 3ER0A 4DV6Q 1IBKQ 3FHWA 3HKZE 1LUZA 1E24A 4O2DA 4A3MH 4A3LG 4JI3L 4LNQA 2I5HA 1OXTA 4DR2L 2D62A 4AQYQ 1X55A 4OXPA 3G4SA 4DR7L 4X65Q 2MQHA 3D31A 5M5WH 4HIDA 4POFA 4JBKA 4X66Q 1X65A 4X64L 5C0XI 4DR3Q 2JEBI 3KJOA 2AHOB 3GTQH 4A3LH 5JEAJ 4JBJA 4KHZA 1WI5A 3FP9A 1K8GA 2NVTH 3RLFA 4A3EG 2Z0SA 2E8GA 4LF8L 3OTOQ 1D8LA 1E1OA 1UWVA 2AMCB 2JA5G 1XJVA 2ASBA 2GVBA 2LXJA 3KF8B 2UXBL 2RHSB 1IZ6A 4DK3C 4C3IH 4LF5L 4IPCA 4JCVE 3S24A 4A3EH 3GTMH 1NE3A 1FL0A 4LUOA 3PO2G 2VS1A 4DUZL 4HJ5A 4JYAL 4GOPC 2NZHA 4OWTB 3CCUA 4NB3A 4A3CG 1KL9A 5IYBG 2K75A 2ZJQA 1PFSA 3IRBA 1GVPA 1VQ5A 2OWOA 1DGSA 4WJ3M 4DV5L 3L2PA 4B3MQ 3GTOH 3CCEA 3ULLA 1NMGA 2WFWA 4GOPA 3PO2H 1NY4A 3F2DA 1YZ6A 3W1BA 4AH6A 3UDGA 3PCOB 3RLNA 4A3CH 4GKJQ 1EQQA 1N34L 2E2JH 1YHQA 1PH5A 1L2FA 2WP8J 4YWMA 2F52A 3A5UA 5EAYA 1Y1VG 4DKAC 1GM5A 2HIVA 4JOIC 2K14A 4RMFA 1KXLA 3UDIA 4P72A 1FJGQ 4IPGA 4JI7L 4Y52H 2ALYB 4KHPL 1GD7A 2K5VA 4EX5A 4DV0L 4DV2Q 2IT1A 4DR6Q 3T1YQ 2JJQA 3ERSX 3F8TA 2WAQE 1Q86C 1E22A 2MNAA 1B70B 2XGTA 4JOIA 1X56A 4LUZA 2BH8A 1B7YB 1HJPA 1KAWA 3T1HQ 1K73C 3HOYG 2MFIA 4LFAL 2ZJPA 3A0JA 1PYBA 3EBEA 4R4CA 4AIMA 3GTPH 1SN8A 3D0FA 3H3VH 3OW2A 1HZCA 4GN4B 3S1NH 4C3JH 2Q2UA 1VQCA 1Z47A 4A3DG 3KDFA 4GKKQ 2UXDL 5IP9G 4BY1G 3HOYH 4IPHA 4R4QA 4A3KG 1XMQQ 5ELNA 1QZGA 1SRUA 2ZM6Q 4LF4L 1CKNB 2IX0A 1IBMQ 5GAHC 4QGUA 2N3SA 1YJNA 4A3DH 1WOCA 4GLXA 2JK8A 1O7IA 1OXVA 4FDBA 4JBMA 4X62L 3I56A 2AKWB 1AH9A 3PO3G 3GDEA 1HNZQ 2DGYA 4A93G 4A3BG 4NXNQ 4GS3A 1N8RC 4EQ5A 1I50H 1BBUA 3EIVA 4YHHL 4A75A 3K80C 4A76A 4LF7L 4XTCS 1KIXA 1GO3E 4LUVA 4JI8Q 1MJEA 4POGA 3TEHB 3PO3H 1V9PA 2EIFA 3CPFA 2R6GA 3M4PA 4YY3Q 1XMOL 1Q81C 4A93H 1N32Q 4A3BH 1NMFA 1QUQB 2ZTEA 2JQOA 4NPSA 4C3HH 5C3EG 1SROA 4QIWE 2IY5B 3F2BA 4LFBL 3ULJA 4JI5Q 5C4XH 3AYHB 5LMUL 2VQFL 1EIFA 4DR5L 3I4NG 3M4QA 1K83H 4PG3A 5JEAG 4DUYL 2BA0A 1YHAA 3RNUA 3BJUA 4JI8L 2H5XA 3HKSA 5M5YH 2UUCL 4JI1L 1OXXK 3H0GH 3FKIG 4YCUA 1HR0Q 4B3SL 2NZOA 4OO1G 4HIKA 4LF9L 2UUAQ 1PH6A 3M85A 2F4VQ 5M3FG 1PH4A 1V1QA 1PYSB 3K0XA 1Q12A 3H3VI 3I4MG 3OYYA 3J81j 3I4NH 3DLLA 4IJHA 3JC66 4HIMA 2I0QA 5HGQA 2IX1A 3HOZH 4QL5A 1MJCA 3NBHB 4BY7G 4ALPA 1HH2P 3PUYA 5AJ3Q 1KHIA 3PUVA 1CSPA 3CCMA 1VQ4A 1YITA 4WJ4A 4B3TQ 4DR4L 4GOPB 4H02A 1Y14B 4A3JG 2RF4A 4JI6Q 5IYDG 2UUBQ 1VQLA 5IWAL 3G48A 3CCVA 4OO1I 3I4OA 1VQ6A 4DAYB 2KHJA 1W2BA 1EWIA 3E9IA 3S1QH 4IPDA 3KYHC 2K52A 2ZTCA 3HOVG 4IFDJ 4DV6L 1IBKL 3RR5A 2ES2A 1MIUA 2NN6G 4A3JH 5K36G 4X6AH 1U0LA 4OX9Q 1IL2A 4QJFA 4AQYL 5IP7G 4B3TL 1SMXA 4RG1A 4AYBG 3S14H 2YTYA 3KLWA 3HOVH 4X65L 1Q46A 5BR8Q 1JJGA 1CKMA 3KF6A 5IE8A 2ZJRA 3B6YA 4K0KQ 4OONA 4LFCQ 1K3RA 1VQIA 2YV5A 4X66L 4HIOA 4LWCA 1E1TA 4DR3L 1HNWQ 3CXCA 2YYZA 3H15A 3HOUG 5GROA 2OTJA 3TS2A 2JA5H 1YHBA 2VUMG 1HR0W 2JA7G 5FLXc 3OTOL 3KDFB 5LMNQ 4O0AA 2I5MX 2KBNA 3RN2A 3J7A5 1JMCA 5C0XJ 1HNXQ 2K5HA 3CP0A 4IO9A 1XTDA 2QGQA 2CWPA 3K81C 1ASZA 4DV3Q 1L0WA 1IYJB 4UP7A 5HY6A 4APVA 1VCIA 4DK6C 5IYBH 3CC7A 1VQKA 4OWWB 1SFOH 3E9HA 1UEBA 1Z9FA 2E5LQ 3S1MH 1N9WA 5GAGC 1W3SA 1VQ8A 1PH1A 3HOWG 4B3ML 2V1CC 1HNWL 4QQBX 1NTGA 3DM3A 5C4JH 4DV4Q 1K0RA 4XIGS 4DV7Q 3KFUA 1EIYB 1TWGH 3TQYA 3UE1A 1Y1VH 4YWKA 4GKJL 3F1ZA 3G6EA 3BZCA 1VQBA 3CC4A 3HOWH 2A1AA 4A3FG 3L7ZC 3S16H 1N33Q 1AE3A 3SGIA 1Q7YC 1FJGL 2AWOA 2JA9A 4GN5A 2Q2TA 1TWHH 5GQOA 3PUZA 3ICEA 2VL6A 4DV2L 2YU9H 3CCLA 3T1YL 1PVOA 4DR1Q 4BBRG 2UU9Q 1SE8A 3AQQA 2HQLA 2WAQG 5FJ8G 1TWCH 1E7ZA 3CMEA 4TQUS 2B63G 3BU2A 4JI2Q 5LMNW 3T1HL 4L5SA 1XNRQ 2CCZA 5J3BA 1J5EQ 3VDYA 4PZ6A 4DNIA 4R4TA 1RIPA 1SR3A 1TWAH 3CW2C 4L5TA 3GTJH 2NVQH 1L1OC 1Q8KA 5IP9H 1XPUA 4YCWA 4BY1H 4BBRH 1GKHA 4TVAB 4A3KH 3S1RH 2B63H 2K4KA 1CSQA 2PI2E 5JJKA 3KOJA 4PZ7A 4GKKL 2QA4A 4NXMQ 4MZ9A 3WWVA 4PZ8A 4LF6Q 1JJCB 1XMQL 1VQ7A 2KCMA 1L1OA 2ZM6L 3CCQA 1M1KC 1T9HA 2WB1E 2R7FA 1IBML 2ATWA 3MXNB 1YBYA 1JT8A 3RZOH 3NELA 4B3RQ 3PGZA 1G291 4JI4Q 5JJLA 4A4IA 4QY7A 2CFMA 4P73A 2GVAA 5FLMG 2HHHQ 1U5KA 4BXXG 1ASYA 1HNZL 5C44G 3J81i 3CQZH 4A3GG 3CCSA 1Q82C 1YJWA 2VNUD 4YWLA 3PSIA 2LSSA 1IBLQ 1VQNA 2Y0SG 4NXNL 1JJ2A 3AFPA 3J81c 1P16A 3CCRA 2YTXA 4DV1Q 1XNQQ 4KLKA 3M4OH 1E3PA 4IFDG 4C2MH 5C3EH 2D0PA 3KF6B 3CCJA 3GTKH 5FLMH 2Z6KC 3PF4A 4JV5Q 4BXXH 4B3RL 3PUWA 4YY3L 1N36Q 2VQEQ 5C44H 4JI4L 2VUMH 1N32L 4JI0Q 2IHEA 1I3QH 4GNXC 2N78A 1VQDA 3PIOA 1YJ9A 4UY8C 5JJIA 4A3IG 4JI5L 1HZ9A 2R7ZG 3M7NA 1B8AA 2UXCQ 3GD7A 2IHFA 3FKIH 1OXSC 3CD6A 2CQOA 4GNXA 2VW9A 4JI3Q 1EQRA 3Q8DA 5M3FH 4DR2Q 3STBC 3I4MH 3K7AH 3K7UC 1QVCA 2PI2A 4GN3B 4A3IH 1YI2A 1HR0L 2UUAL 1X3EA 2AWNA 2N8NA 2F4VL 4BY7H 4DR7Q 3NENA 1Y1WG 3UE0A 5C0XG 1TXYA 1SLJA 3HKZG 2MO0A 2R7DA 3PUXA 4HJ8A 1D7QA 1NBWA 2YTVA 1A0IA 5AJ3L 3CPWA 4IJLA 1RL2A 2B3GA 2OQ0A 5IYDH 1UE1A 3U58A 1M90C 2OCEA 2QEXA 4HJ9A 4JG2A 1BBWA 3CF5A 1PHJA 4LF8Q 4JI6L 1S40A 2UUBL 1Y1WH 4AYBE 4L5RC 3MEFA 3CC2A 2JA6G 2UXBQ 1YVCA 1FVIA 2C35B 4LF5Q 5IP7H 3RN5A 1VS0A 1HZAA 4HJAA 1QUQA 2NN6I 1LTLA 4DUZQ 4OX9L 4JYAQ 1JB7A 2CKZB 2JA6H 3S2HH 1C9OA 3K8AA 5DLQE 2BH2A 2OQKA 3RLOA 5GAEC 2HT1A 5BR8L 1FGUA 4DV5Q 3HOUH 4R4OA 3F2CA 4K0KL 2D0OA 1CUKA 1X54A 1WJJA 4LFCL 1P8LA 1UE6A 2EQSA 2PQAA 3JAMi 1K9MC 1EYGA 2JA7H 1KD1C 4DPGA 2MO1A 4BA1I 1C7YA 1BKBA 4IOAA 1WFQA 1PA6A 3W5OA 3JAMc 2I5LX 1VQHA 1N34Q 2E2HH 1OTCA 1C0AA 5LMNL 3NEMA 1AE2A 4UP8A 1MKHA 1X9NA 3ULPA 5GADC 1HNXL 3GTLH 1L1OB 4JI7Q 3PV0A 4KHPQ 1UE5A 4DV0Q 1I5FA 2EXDA 3U50C 4DV3L 1VQJA 2K5NA 2A19A 3L0OA 5M5XH 1H95A 1VQFA 2PMZE 3I55A 1Q1BA 1VQAA 2KHIA 5H1SE 3PF5A 1R9TH 1K8AC 4JC0A 2E5LL 4LFAQ 3AEVA 3PIPA 1V43A 1A62A 2RCNA 2K50A 2HIXA 4J15A 5M3MG 1A8VA 1YIJA 1EFWA 2RHQB 1KRTA 1VQEA 1I6HH 4DV4L 3TREA 4DV7L 1EUJA 4LW1A 1VQ9A 2UXDQ 4A3FH 4R1JA 1J6QA 4P71A 1A63A 2F3IA 2Q2IA 3A5ZB 2ZTDA 3EN2A 1PH3A 1EOVA 2KCTA 2JA8G 4DAMA 3G71A 1VQMA 5M3MH 4LF4Q 4GLVB 3U4ZA 3W1GA 2PNHA 1IXRA 2B29A 4MNOA 5IT9c 1N33L 1S72A 3S17H 1G6PA 2DUDA 2BA1A 1S3OA 1X3FA 4UP9A 4GLAC 5FJ8H 4BA2I 3STBD 4X62Q 4OWXB 1CKOA 1I94Q 4DR1L 3KJPA 2JA8H 2UU9L 4ME3A 1QVFA 1XPOA 4GNXB 1QZHA 3BZKA 2JE6I 4IOCA 2XTIA 4JI2L 2A8VA 1PV4A 3A74A 1XNRL 3RZDH 1PH9A 1J5EL 1UE7A 4JBWA 1LYLA 1JE5A 1HZBA 1PH8A 3TRZA 3E0EA 4L5QA 1PH7A 3AFQA 4LF7Q 4YHHQ 3GTGH 2CWAA 3LGJA 2KENA 1VQPA 1XMOQ 1Q1EA 2Q2HA 1KC8C 3ZJYC 2JEAI 5IYCG 1I94L 4NXML 2GN5A 2ID0A 4LF6L 4LFBQ 2L15A 5LMUQ 1X6OA 2VQFQ 2WB1G 3I2ZA 4DR5Q 5ELOA 2Y0SE 1PH2A 1OXUA 4R4IA 3J80i 4DUYQ 4YCVA 1YEZA 3CMAA 5C4XG 4A3GH 5IYCH 4PMWA 3GO5A 1QVGA 1NJIC 3M3YH 3J80c
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF H;  2R92 G;  2UUC Q;  1YNX A;  2LXK A;  4JI1 Q;  2HHH L;  4B3S Q;  4HJ7 A;  4LF9 Q;  3HOX G;  4P74 A;  3CAM A;  1WCM G;  4BBS G;  2Z6K A;  1IBL L;  3H0G G;  3M9B A;  2VY3 A;  1LM0 A;  2E2I H;  4DR6 L;  3U4V A;  4MTN A;  4DV1 L;  1XNQ L;  2N49 A;  3UDF A;  4UPA A;  1VQO A;  4IFD I;  2FXQ A;  4Y7N H;  2R92 H;  2R93 G;  4JV5 L;  4P75 A;  2NVX H;  3HOZ G;  1N36 L;  3TS0 A;  3HOX H;  2VQE L;  2PQA B;  4DR4 Q;  3S15 H;  4KI0 A;  1WCM H;  4JI0 L;  4BBS H;  3HFZ B;  1CKN A;  5E7N A;  3UDX A;  4A3M G;  2OTL A;  2R7Z H;  3I7F A;  1KQS A;  1WYD A;  5IWA Q;  1XPR A;  3S2D H;  1X3G A;  3J7Z C;  5IY0 A;  1BVS A;  4X64 Q;  2R93 H;  1G51 A;  1VQG A;  2VZA A;  1KRS A;  2UXC L;  2NVY H;  3ER0 A;  4DV6 Q;  1IBK Q;  3FHW A;  3HKZ E;  1LUZ A;  1E24 A;  4O2D A;  4A3M H;  4A3L G;  4JI3 L;  4LNQ A;  2I5H A;  1OXT A;  4DR2 L;  2D62 A;  4AQY Q;  1X55 A;  4OXP A;  3G4S A;  4DR7 L;  4X65 Q;  2MQH A;  3D31 A;  5M5W H;  4HID A;  4POF A;  4JBK A;  4X66 Q;  1X65 A;  4X64 L;  5C0X I;  4DR3 Q;  2JEB I;  3KJO A;  2AHO B;  3GTQ H;  4A3L H;  5JEA J;  4JBJ A;  4KHZ A;  1WI5 A;  3FP9 A;  1K8G A;  2NVT H;  3RLF A;  4A3E G;  2Z0S A;  2E8G A;  4LF8 L;  3OTO Q;  1D8L A;  1E1O A;  1UWV A;  2AMC B;  2JA5 G;  1XJV A;  2ASB A;  2GVB A;  2LXJ A;  3KF8 B;  2UXB L;  2RHS B;  1IZ6 A;  4DK3 C;  4C3I H;  4LF5 L;  4IPC A;  4JCV E;  3S24 A;  4A3E H;  3GTM H;  1NE3 A;  1FL0 A;  4LUO A;  3PO2 G;  2VS1 A;  4DUZ L;  4HJ5 A;  4JYA L;  4GOP C;  2NZH A;  4OWT B;  3CCU A;  4NB3 A;  4A3C G;  1KL9 A;  5IYB G;  2K75 A;  2ZJQ A;  1PFS A;  3IRB A;  1GVP A;  1VQ5 A;  2OWO A;  1DGS A;  4WJ3 M;  4DV5 L;  3L2P A;  4B3M Q;  3GTO H;  3CCE A;  3ULL A;  1NMG A;  2WFW A;  4GOP A;  3PO2 H;  1NY4 A;  3F2D A;  1YZ6 A;  3W1B A;  4AH6 A;  3UDG A;  3PCO B;  3RLN A;  4A3C H;  4GKJ Q;  1EQQ A;  1N34 L;  2E2J H;  1YHQ A;  1PH5 A;  1L2F A;  2WP8 J;  4YWM A;  2F52 A;  3A5U A;  5EAY A;  1Y1V G;  4DKA C;  1GM5 A;  2HIV A;  4JOI C;  2K14 A;  4RMF A;  1KXL A;  3UDI A;  4P72 A;  1FJG Q;  4IPG A;  4JI7 L;  4Y52 H;  2ALY B;  4KHP L;  1GD7 A;  2K5V A;  4EX5 A;  4DV0 L;  4DV2 Q;  2IT1 A;  4DR6 Q;  3T1Y Q;  2JJQ A;  3ERS X;  3F8T A;  2WAQ E;  1Q86 C;  1E22 A;  2MNA A;  1B70 B;  2XGT A;  4JOI A;  1X56 A;  4LUZ A;  2BH8 A;  1B7Y B;  1HJP A;  1KAW A;  3T1H Q;  1K73 C;  3HOY G;  2MFI A;  4LFA L;  2ZJP A;  3A0J A;  1PYB A;  3EBE A;  4R4C A;  4AIM A;  3GTP H;  1SN8 A;  3D0F A;  3H3V H;  3OW2 A;  1HZC A;  4GN4 B;  3S1N H;  4C3J H;  2Q2U A;  1VQC A;  1Z47 A;  4A3D G;  3KDF A;  4GKK Q;  2UXD L;  5IP9 G;  4BY1 G;  3HOY H;  4IPH A;  4R4Q A;  4A3K G;  1XMQ Q;  5ELN A;  1QZG A;  1SRU A;  2ZM6 Q;  4LF4 L;  1CKN B;  2IX0 A;  1IBM Q;  5GAH C;  4QGU A;  2N3S A;  1YJN A;  4A3D H;  1WOC A;  4GLX A;  2JK8 A;  1O7I A;  1OXV A;  4FDB A;  4JBM A;  4X62 L;  3I56 A;  2AKW B;  1AH9 A;  3PO3 G;  3GDE A;  1HNZ Q;  2DGY A;  4A93 G;  4A3B G;  4NXN Q;  4GS3 A;  1N8R C;  4EQ5 A;  1I50 H;  1BBU A;  3EIV A;  4YHH L;  4A75 A;  3K80 C;  4A76 A;  4LF7 L;  4XTC S;  1KIX A;  1GO3 E;  4LUV A;  4JI8 Q;  1MJE A;  4POG A;  3TEH B;  3PO3 H;  1V9P A;  2EIF A;  3CPF A;  2R6G A;  3M4P A;  4YY3 Q;  1XMO L;  1Q81 C;  4A93 H;  1N32 Q;  4A3B H;  1NMF A;  1QUQ B;  2ZTE A;  2JQO A;  4NPS A;  4C3H H;  5C3E G;  1SRO A;  4QIW E;  2IY5 B;  3F2B A;  4LFB L;  3ULJ A;  4JI5 Q;  5C4X H;  3AYH B;  5LMU L;  2VQF L;  1EIF A;  4DR5 L;  3I4N G;  3M4Q A;  1K83 H;  4PG3 A;  5JEA G;  4DUY L;  2BA0 A;  1YHA A;  3RNU A;  3BJU A;  4JI8 L;  2H5X A;  3HKS A;  5M5Y H;  2UUC L;  4JI1 L;  1OXX K;  3H0G H;  3FKI G;  4YCU A;  1HR0 Q;  4B3S L;  2NZO A;  4OO1 G;  4HIK A;  4LF9 L;  2UUA Q;  1PH6 A;  3M85 A;  2F4V Q;  5M3F G;  1PH4 A;  1V1Q A;  1PYS B;  3K0X A;  1Q12 A;  3H3V I;  3I4M G;  3OYY A;  3J81 j;  3I4N H;  3DLL A;  4IJH A;  3JC6 6;  4HIM A;  2I0Q A;  5HGQ A;  2IX1 A;  3HOZ H;  4QL5 A;  1MJC A;  3NBH B;  4BY7 G;  4ALP A;  1HH2 P;  3PUY A;  5AJ3 Q;  1KHI A;  3PUV A;  1CSP A;  3CCM A;  1VQ4 A;  1YIT A;  4WJ4 A;  4B3T Q;  4DR4 L;  4GOP B;  4H02 A;  1Y14 B;  4A3J G;  2RF4 A;  4JI6 Q;  5IYD G;  2UUB Q;  1VQL A;  5IWA L;  3G48 A;  3CCV A;  4OO1 I;  3I4O A;  1VQ6 A;  4DAY B;  2KHJ A;  1W2B A;  1EWI A;  3E9I A;  3S1Q H;  4IPD A;  3KYH C;  2K52 A;  2ZTC A;  3HOV G;  4IFD J;  4DV6 L;  1IBK L;  3RR5 A;  2ES2 A;  1MIU A;  2NN6 G;  4A3J H;  5K36 G;  4X6A H;  1U0L A;  4OX9 Q;  1IL2 A;  4QJF A;  4AQY L;  5IP7 G;  4B3T L;  1SMX A;  4RG1 A;  4AYB G;  3S14 H;  2YTY A;  3KLW A;  3HOV H;  4X65 L;  1Q46 A;  5BR8 Q;  1JJG A;  1CKM A;  3KF6 A;  5IE8 A;  2ZJR A;  3B6Y A;  4K0K Q;  4OON A;  4LFC Q;  1K3R A;  1VQI A;  2YV5 A;  4X66 L;  4HIO A;  4LWC A;  1E1T A;  4DR3 L;  1HNW Q;  3CXC A;  2YYZ A;  3H15 A;  3HOU G;  5GRO A;  2OTJ A;  3TS2 A;  2JA5 H;  1YHB A;  2VUM G;  1HR0 W;  2JA7 G;  5FLX c;  3OTO L;  3KDF B;  5LMN Q;  4O0A A;  2I5M X;  2KBN A;  3RN2 A;  3J7A 5;  1JMC A;  5C0X J;  1HNX Q;  2K5H A;  3CP0 A;  4IO9 A;  1XTD A;  2QGQ A;  2CWP A;  3K81 C;  1ASZ A;  4DV3 Q;  1L0W A;  1IYJ B;  4UP7 A;  5HY6 A;  4APV A;  1VCI A;  4DK6 C;  5IYB H;  3CC7 A;  1VQK A;  4OWW B;  1SFO H;  3E9H A;  1UEB A;  1Z9F A;  2E5L Q;  3S1M H;  1N9W A;  5GAG C;  1W3S A;  1VQ8 A;  1PH1 A;  3HOW G;  4B3M L;  2V1C C;  1HNW L;  4QQB X;  1NTG A;  3DM3 A;  5C4J H;  4DV4 Q;  1K0R A;  4XIG S;  4DV7 Q;  3KFU A;  1EIY B;  1TWG H;  3TQY A;  3UE1 A;  1Y1V H;  4YWK A;  4GKJ L;  3F1Z A;  3G6E A;  3BZC A;  1VQB A;  3CC4 A;  3HOW H;  2A1A A;  4A3F G;  3L7Z C;  3S16 H;  1N33 Q;  1AE3 A;  3SGI A;  1Q7Y C;  1FJG L;  2AWO A;  2JA9 A;  4GN5 A;  2Q2T A;  1TWH H;  5GQO A;  3PUZ A;  3ICE A;  2VL6 A;  4DV2 L;  2YU9 H;  3CCL A;  3T1Y L;  1PVO A;  4DR1 Q;  4BBR G;  2UU9 Q;  1SE8 A;  3AQQ A;  2HQL A;  2WAQ G;  5FJ8 G;  1TWC H;  1E7Z A;  3CME A;  4TQU S;  2B63 G;  3BU2 A;  4JI2 Q;  5LMN W;  3T1H L;  4L5S A;  1XNR Q;  2CCZ A;  5J3B A;  1J5E Q;  3VDY A;  4PZ6 A;  4DNI A;  4R4T A;  1RIP A;  1SR3 A;  1TWA H;  3CW2 C;  4L5T A;  3GTJ H;  2NVQ H;  1L1O C;  1Q8K A;  5IP9 H;  1XPU A;  4YCW A;  4BY1 H;  4BBR H;  1GKH A;  4TVA B;  4A3K H;  3S1R H;  2B63 H;  2K4K A;  1CSQ A;  2PI2 E;  5JJK A;  3KOJ A;  4PZ7 A;  4GKK L;  2QA4 A;  4NXM Q;  4MZ9 A;  3WWV A;  4PZ8 A;  4LF6 Q;  1JJC B;  1XMQ L;  1VQ7 A;  2KCM A;  1L1O A;  2ZM6 L;  3CCQ A;  1M1K C;  1T9H A;  2WB1 E;  2R7F A;  1IBM L;  2ATW A;  3MXN B;  1YBY A;  1JT8 A;  3RZO H;  3NEL A;  4B3R Q;  3PGZ A;  1G29 1;  4JI4 Q;  5JJL A;  4A4I A;  4QY7 A;  2CFM A;  4P73 A;  2GVA A;  5FLM G;  2HHH Q;  1U5K A;  4BXX G;  1ASY A;  1HNZ L;  5C44 G;  3J81 i;  3CQZ H;  4A3G G;  3CCS A;  1Q82 C;  1YJW A;  2VNU D;  4YWL A;  3PSI A;  2LSS A;  1IBL Q;  1VQN A;  2Y0S G;  4NXN L;  1JJ2 A;  3AFP A;  3J81 c;  1P16 A;  3CCR A;  2YTX A;  4DV1 Q;  1XNQ Q;  4KLK A;  3M4O H;  1E3P A;  4IFD G;  4C2M H;  5C3E H;  2D0P A;  3KF6 B;  3CCJ A;  3GTK H;  5FLM H;  2Z6K C;  3PF4 A;  4JV5 Q;  4BXX H;  4B3R L;  3PUW A;  4YY3 L;  1N36 Q;  2VQE Q;  5C44 H;  4JI4 L;  2VUM H;  1N32 L;  4JI0 Q;  2IHE A;  1I3Q H;  4GNX C;  2N78 A;  1VQD A;  3PIO A;  1YJ9 A;  4UY8 C;  5JJI A;  4A3I G;  4JI5 L;  1HZ9 A;  2R7Z G;  3M7N A;  1B8A A;  2UXC Q;  3GD7 A;  2IHF A;  3FKI H;  1OXS C;  3CD6 A;  2CQO A;  4GNX A;  2VW9 A;  4JI3 Q;  1EQR A;  3Q8D A;  5M3F H;  4DR2 Q;  3STB C;  3I4M H;  3K7A H;  3K7U C;  1QVC A;  2PI2 A;  4GN3 B;  4A3I H;  1YI2 A;  1HR0 L;  2UUA L;  1X3E A;  2AWN A;  2N8N A;  2F4V L;  4BY7 H;  4DR7 Q;  3NEN A;  1Y1W G;  3UE0 A;  5C0X G;  1TXY A;  1SLJ A;  3HKZ G;  2MO0 A;  2R7D A;  3PUX A;  4HJ8 A;  1D7Q A;  1NBW A;  2YTV A;  1A0I A;  5AJ3 L;  3CPW A;  4IJL A;  1RL2 A;  2B3G A;  2OQ0 A;  5IYD H;  1UE1 A;  3U58 A;  1M90 C;  2OCE A;  2QEX A;  4HJ9 A;  4JG2 A;  1BBW A;  3CF5 A;  1PHJ A;  4LF8 Q;  4JI6 L;  1S40 A;  2UUB L;  1Y1W H;  4AYB E;  4L5R C;  3MEF A;  3CC2 A;  2JA6 G;  2UXB Q;  1YVC A;  1FVI A;  2C35 B;  4LF5 Q;  5IP7 H;  3RN5 A;  1VS0 A;  1HZA A;  4HJA A;  1QUQ A;  2NN6 I;  1LTL A;  4DUZ Q;  4OX9 L;  4JYA Q;  1JB7 A;  2CKZ B;  2JA6 H;  3S2H H;  1C9O A;  3K8A A;  5DLQ E;  2BH2 A;  2OQK A;  3RLO A;  5GAE C;  2HT1 A;  5BR8 L;  1FGU A;  4DV5 Q;  3HOU H;  4R4O A;  3F2C A;  4K0K L;  2D0O A;  1CUK A;  1X54 A;  1WJJ A;  4LFC L;  1P8L A;  1UE6 A;  2EQS A;  2PQA A;  3JAM i;  1K9M C;  1EYG A;  2JA7 H;  1KD1 C;  4DPG A;  2MO1 A;  4BA1 I;  1C7Y A;  1BKB A;  4IOA A;  1WFQ A;  1PA6 A;  3W5O A;  3JAM c;  2I5L X;  1VQH A;  1N34 Q;  2E2H H;  1OTC A;  1C0A A;  5LMN L;  3NEM A;  1AE2 A;  4UP8 A;  1MKH A;  1X9N A;  3ULP A;  5GAD C;  1HNX L;  3GTL H;  1L1O B;  4JI7 Q;  3PV0 A;  4KHP Q;  1UE5 A;  4DV0 Q;  1I5F A;  2EXD A;  3U50 C;  4DV3 L;  1VQJ A;  2K5N A;  2A19 A;  3L0O A;  5M5X H;  1H95 A;  1VQF A;  2PMZ E;  3I55 A;  1Q1B A;  1VQA A;  2KHI A;  5H1S E;  3PF5 A;  1R9T H;  1K8A C;  4JC0 A;  2E5L L;  4LFA Q;  3AEV A;  3PIP A;  1V43 A;  1A62 A;  2RCN A;  2K50 A;  2HIX A;  4J15 A;  5M3M G;  1A8V A;  1YIJ A;  1EFW A;  2RHQ B;  1KRT A;  1VQE A;  1I6H H;  4DV4 L;  3TRE A;  4DV7 L;  1EUJ A;  4LW1 A;  1VQ9 A;  2UXD Q;  4A3F H;  4R1J A;  1J6Q A;  4P71 A;  1A63 A;  2F3I A;  2Q2I A;  3A5Z B;  2ZTD A;  3EN2 A;  1PH3 A;  1EOV A;  2KCT A;  2JA8 G;  4DAM A;  3G71 A;  1VQM A;  5M3M H;  4LF4 Q;  4GLV B;  3U4Z A;  3W1G A;  2PNH A;  1IXR A;  2B29 A;  4MNO A;  5IT9 c;  1N33 L;  1S72 A;  3S17 H;  1G6P A;  2DUD A;  2BA1 A;  1S3O A;  1X3F A;  4UP9 A;  4GLA C;  5FJ8 H;  4BA2 I;  3STB D;  4X62 Q;  4OWX B;  1CKO A;  1I94 Q;  4DR1 L;  3KJP A;  2JA8 H;  2UU9 L;  4ME3 A;  1QVF A;  1XPO A;  4GNX B;  1QZH A;  3BZK A;  2JE6 I;  4IOC A;  2XTI A;  4JI2 L;  2A8V A;  1PV4 A;  3A74 A;  1XNR L;  3RZD H;  1PH9 A;  1J5E L;  1UE7 A;  4JBW A;  1LYL A;  1JE5 A;  1HZB A;  1PH8 A;  3TRZ A;  3E0E A;  4L5Q A;  1PH7 A;  3AFQ A;  4LF7 Q;  4YHH Q;  3GTG H;  2CWA A;  3LGJ A;  2KEN A;  1VQP A;  1XMO Q;  1Q1E A;  2Q2H A;  1KC8 C;  3ZJY C;  2JEA I;  5IYC G;  1I94 L;  4NXM L;  2GN5 A;  2ID0 A;  4LF6 L;  4LFB Q;  2L15 A;  5LMU Q;  1X6O A;  2VQF Q;  2WB1 G;  3I2Z A;  4DR5 Q;  5ELO A;  2Y0S E;  1PH2 A;  1OXU A;  4R4I A;  3J80 i;  4DUY Q;  4YCV A;  1YEZ A;  3CMA A;  5C4X G;  4A3G H;  5IYC H;  4PMW A;  3GO5 A;  1QVG A;  1NJI C;  3M3Y H;  3J80 c; 
#chains in the Genus database with same CATH topology
 4JI1 Q;  5CR3 A;  2HHH L;  4CBV A;  2B2W A;  2EYL A;  3HOX G;  4LF9 Q;  3I4N B;  4BBS G;  1STN A;  5JJZ A;  2Z6K A;  1IBL L;  3H0G G;  3A54 A;  4KN7 C;  3K57 A;  1QNU A;  5KNC A;  1FD7 D;  1PRT F;  4E6I A;  2FXQ A;  3BG3 A;  3DEP A;  2Z4H A;  3HFZ B;  5E7N A;  4A3M G;  3D4D A;  1X3G A;  3IFD A;  3BS1 A;  4KKT A;  4P2C B;  2NVY H;  1E24 A;  1FR3 A;  2I5H A;  1K8M A;  3IKJ A;  2Q8I B;  4AQY Q;  1X55 A;  3CU7 A;  4OXP A;  4DR7 L;  1STY A;  4X65 Q;  1XXG A;  2KHS A;  4WJW A;  1O7Y A;  4HID A;  4POF A;  4FXD A;  4DXF A;  1TII D;  1LTI D;  1K8G A;  3WDN A;  2X6L A;  1Q90 A;  2Q8R E;  3H3V C;  5DNF A;  1HRJ A;  5LHY 1;  2HUG A;  2MJ8 A;  1D8L A;  1UWV A;  2AMC B;  1JOK A;  2GVB A;  2LXJ A;  1BQQ T;  1IZ6 A;  2VUM B;  4DF7 A;  3P75 A;  4LF5 L;  1SFO B;  3GTM H;  1NE3 A;  3I8Z A;  2VS1 A;  4JYA L;  2K05 A;  2E2H B;  4GOP C;  4KD4 A;  1KL9 A;  5IYB G;  4FYD A;  1D6E C;  1GVP A;  1VQ5 A;  2OWO A;  1DGS A;  4CKE A;  4B3M Q;  3URY A;  1NMG A;  4X3S A;  1BR9 A;  3DMU A;  3LWE A;  1G91 A;  2WP8 J;  1B50 A;  4XYO A;  5EAY A;  1KLU D;  4QUF A;  5CBE E;  3NPP A;  1MBY A;  1TWH B;  2K14 A;  2PMZ B;  3SEB A;  1DZ1 A;  4DK1 A;  2F0I A;  2Z4I A;  1TWC B;  2B39 A;  1HFG A;  4R9W A;  3P7J A;  1E22 A;  2MNA A;  1B70 B;  4IQZ A;  4JOI A;  4LUZ A;  3T1H Q;  1TWA B;  4LFA L;  4I65 A;  4KY7 A;  1PYB A;  1QE6 A;  3GTJ B;  2L1B A;  3D3R A;  3S1R B;  3FVQ A;  3S1N H;  2DY7 A;  4GKK Q;  2UXD L;  1JOQ A;  3BDC A;  4BY1 G;  3HOY H;  4A3K G;  4LF4 L;  2ZM6 Q;  2IX0 A;  1AFP A;  4B08 A;  5G3L F;  1PRT C;  2CW0 C;  4GLX A;  2JK8 A;  1PXU A;  3I56 A;  3I70 A;  1LV9 A;  2GA4 B;  3GDE A;  4A93 G;  1WVL A;  3F2U A;  3MAQ A;  1VMC A;  4XQJ A;  1R4P B;  4C1N I;  4DAP A;  4A3G B;  2CH4 W;  4RGM A;  2DY8 A;  3M4P A;  2QDL A;  4OIK A;  1NMF A;  1QUQ B;  4NPS A;  2JQO A;  1RTO A;  3SXH A;  1SRO A;  4QIW E;  2G9H D;  3F2B A;  5CV5 A;  5C4X H;  3M4Q A;  2BA0 A;  4RKB A;  1Q8I A;  1SYG A;  1YHA A;  4ILW A;  3RNU A;  3K7A B;  4ULL A;  4A3I B;  4JI8 L;  3D6W A;  5M5Y H;  4X3U A;  4JI1 L;  3H0G H;  1HR0 Q;  3K0Y A;  3MXG A;  1NCV A;  4HIK A;  4LF9 L;  4PQX A;  1C4Q A;  5M3F G;  1QWY A;  1Q12 A;  3R93 A;  3OYY A;  3DLL A;  5JEA H;  3JC6 6;  4V0B A;  2NVY B;  1Z7T A;  5HGQ A;  4DN4 M;  5IGD A;  1MJC A;  3NBH B;  2I0Q A;  3OHX C;  4BY7 G;  1TKW B;  2K1B A;  4WJ4 A;  2XN9 C;  1SNC A;  4H02 A;  1Y14 B;  3HRZ C;  2RF4 A;  3MWY W;  4A3J G;  1I4G A;  4JI6 Q;  3MXN A;  2UUB Q;  3PQI A;  3S9W A;  5J22 A;  5I9O A;  3I4O A;  1VQ6 A;  3HGB A;  2KHJ A;  1EWI A;  5IOC A;  4JW0 A;  1CA5 A;  2ES2 A;  2NN6 G;  1GUO A;  1SYE A;  4OX9 Q;  1JB3 A;  4QJF A;  4AQY L;  3OSO A;  4X3T A;  4R8I A;  4AYB G;  3S14 H;  2YTY A;  3HOV H;  4X65 L;  5BR8 Q;  1IYU A;  5IE8 A;  4LFC Q;  1K3R A;  2YV5 A;  1E1T A;  5BN3 A;  2KVM A;  5KYI A;  3CXC A;  3HOU G;  2OTJ A;  1DYQ A;  3E0J A;  2F3W A;  2JA7 G;  3BYY B;  1CA6 A;  1D1I A;  5T1G A;  1HNX Q;  1TS3 A;  1ASZ A;  1YNN C;  1L0W A;  3NWT A;  5HY6 A;  1VQK A;  2JN4 A;  5IYB H;  1R9T B;  4OWW B;  2EE1 A;  3NP8 A;  1BO0 A;  4O1N A;  1UEB A;  3MFG A;  1STG A;  3EJI A;  1K0S A;  3K6O A;  4U67 3;  1Z9F A;  1VQ8 A;  3BVG A;  1WD0 A;  4FO2 A;  4ABN A;  4B3M L;  1NTG A;  1JOO A;  3DM3 A;  4DV4 Q;  4XIG S;  4DV7 Q;  3ERO A;  4NMZ A;  3F1Z A;  3TN2 A;  3BZC A;  3S16 H;  3I90 A;  1SNO A;  1AE3 A;  1NR4 A;  3SGI A;  3MXU A;  3H09 A;  1EWH A;  2JA8 B;  3ICE A;  3CCL A;  4KY5 A;  2HQL A;  1E7Z A;  1K3B C;  2PCF B;  2BE5 C;  3P1H A;  4TQU S;  5FO8 B;  5LMN W;  3T1H L;  1EY0 A;  1J5E Q;  1H9J A;  1SR3 A;  4BY1 H;  4BBR H;  1RKN A;  4A3K H;  4JK1 C;  2L12 A;  5JJK A;  1D5Z C;  1SYF A;  4GKK L;  3BZD B;  3QIA A;  1A2T A;  3WWV A;  5I2Y A;  1VQ7 A;  1L1O A;  2ZM6 L;  1O80 A;  3CCQ A;  1M1K C;  2ICE C;  3BDO A;  1YBY A;  1HA5 A;  4ZUJ A;  2MUY A;  3PGZ A;  5EPL A;  4B3R Q;  1G29 1;  3TZU A;  4A4I A;  3MFY A;  2GVA A;  4P73 A;  4BXX G;  5IGE A;  3EVQ A;  3CQZ H;  3J81 i;  1AN8 A;  3AB9 A;  2E2I B;  4DK0 A;  5C4X B;  1VQN A;  1G2T A;  2C5C A;  2Y0S G;  1DM0 B;  3J81 c;  4Y7N B;  4DR6 Q;  2YTX A;  1XNQ Q;  2RCF A;  1E3P A;  2NVX B;  3HOX B;  2D0P A;  3KF6 B;  3GTK H;  4JV5 Q;  4BBS B;  1D5X C;  3U9S A;  3H0G B;  1EQV A;  4JI0 Q;  4GNX C;  1VQD A;  3VYS A;  1EFI D;  4EQO A;  5JJI A;  4HCE A;  1ML0 D;  2DN8 A;  2R7Z G;  1B8A A;  4A3M B;  2IHF A;  1B4O A;  5M3F H;  2K33 A;  4DR2 Q;  4B9W A;  4GN3 B;  2PI2 A;  1HR0 L;  3TP5 A;  4BY7 H;  1LTB D;  5A2Q L;  3I73 A;  3EA6 A;  3KK7 A;  1TXY A;  1SLJ A;  2B2Y A;  3L9A X;  2R7D A;  2QKI C;  2YTV A;  4KJO A;  3VYU A;  2OQ0 A;  1UE1 A;  3K58 A;  2F0E A;  2QEX A;  4JG2 A;  3S14 B;  4LF8 Q;  4JI6 L;  1IKL A;  1S40 A;  2RDH A;  1Y1W H;  2UUB L;  5C0X H;  4HMI A;  2UXB Q;  2NN6 H;  3DEO A;  1GUS A;  2KED A;  3TDQ A;  3RN5 A;  1VS0 A;  2NTS A;  1QUQ A;  4CDD C;  4OX9 L;  2CKZ B;  1C9O A;  4ZKB B;  4IUQ A;  4KN4 C;  5BR8 L;  4BWG B;  4DV5 Q;  3HOU H;  3I91 A;  2D0O A;  1CUK A;  1X54 A;  4LFC L;  3KLS X;  3JAM i;  2JA7 H;  2K5Q A;  1BKB A;  1MSG A;  4IUN A;  3JAM c;  2DNC A;  1OTC A;  2X6G A;  3NEM A;  1MKH A;  2IWH A;  1HNX L;  5HGT A;  4KHP Q;  3VYR A;  2A6H D;  1EEF D;  1VQJ A;  2B2V A;  3K5N A;  3L0O A;  5M5X H;  2EJF C;  1H9K A;  4HN7 A;  2F3V A;  2XRS D;  1V43 A;  2K50 A;  2HIX A;  5M3M G;  1A8V A;  3GV6 A;  1S5C D;  4DV4 L;  3TRE A;  4DV7 L;  1VQ9 A;  1M8A A;  4MIU A;  5L37 A;  4P71 A;  1A63 A;  5CV7 A;  3A5Z B;  3EN2 A;  1HTL D;  4CDF C;  4DAM A;  3G71 A;  1VQM A;  1U4L A;  4G7H C;  2C9O A;  5IT9 c;  1D5M C;  4BY1 B;  4GLA C;  5IGB A;  2RQX A;  4A3K B;  4BA2 I;  3STB D;  4OWX B;  1CKO A;  1ILQ A;  1I94 Q;  2NZ1 D;  2L11 A;  3HZX A;  1XPO A;  1QVF A;  5CV8 A;  4RCO A;  1J5E L;  4JBW A;  5BN5 A;  3E0E A;  5C4Z A;  3KBX A;  1XX8 A;  4YHH Q;  1XYI A;  2CWA A;  4A93 B;  2KEN A;  1V1O A;  1VQP A;  5I9P A;  2EY1 A;  4QMG A;  1GUN A;  1SJH D;  3CQZ B;  1DD2 A;  4LFB Q;  5LMU Q;  2B2W C;  2F0G A;  5CV6 A;  4DR5 Q;  5C3W A;  2EYJ A;  1ET9 A;  4HAE A;  4R4I A;  1G8Z D;  3J80 i;  3GTK B;  4KKS A;  4X3K A;  1YEZ A;  3CMA A;  2O5J C;  5EPJ A;  1ENA A;  3J80 c;  1TWF H;  1YNX A;  1PZK D;  3NE5 B;  1BCP F;  1DCZ A;  4GZY C;  5DM7 3;  2JXM B;  2IW3 A;  1F9Q A;  2VY3 A;  1LM0 A;  4DR6 L;  1XNQ L;  1HPC A;  1VQO A;  2R92 H;  4JV5 L;  4P75 A;  5M3F B;  3VR4 A;  1CI3 M;  2PQA B;  4DR4 Q;  4JVZ A;  4JI0 L;  1C8C A;  1CKN A;  2OTL A;  3H3V H;  2R7Z H;  1WTP A;  1WYD A;  4BY7 B;  1XPR A;  5IY0 A;  5K5P A;  1KAA A;  1SNP A;  1VQG A;  1KRS A;  4A3J B;  1IBK Q;  1OXT A;  4DR2 L;  4K5V A;  2AUJ D;  3D31 A;  4CDC C;  1ILP A;  3C46 A;  3TSS A;  4JBK A;  5C0X I;  4X64 L;  3NQT A;  4DR3 Q;  3T13 A;  4AYB B;  5JEA J;  3OWF A;  4KHZ A;  1II3 A;  2Z9H A;  1KTK A;  3WOF A;  2NVT H;  3TBI B;  4ID6 A;  1I4H A;  2E8G A;  4LF8 L;  4LJZ C;  3OTO Q;  1PYW D;  1SNQ A;  3H91 A;  1E1O A;  1XJV A;  3HOU B;  2ASB A;  2UXB L;  2RHS B;  4DK3 C;  2JA7 B;  1ET6 A;  4A3E H;  4LUO A;  2NZH A;  3S1M B;  4OWT B;  3CCU A;  4NDX A;  4NB3 A;  2ZJQ A;  5C5L A;  4DV5 L;  3CCE A;  2RKS A;  1H9M A;  1CZW A;  4KV6 A;  2AQ2 B;  3UDG A;  2CVR A;  4DAY A;  1YHQ A;  1PH5 A;  1BCP B;  2F52 A;  4HSV A;  1Y1V G;  4DKA C;  4DXG A;  4JOI C;  5JPM C;  1KXL A;  1I4R A;  2ALY B;  4UDU C;  4KHP L;  1GD7 A;  3TME A;  1H9R A;  3NWS A;  2D5D A;  2XGT A;  2E2D C;  1B7Y B;  1KAW A;  1K73 C;  3HOY G;  3A0J A;  3C2P A;  1SN8 A;  3D0F A;  1HHV A;  3MVV A;  5FLX E;  3RD4 A;  2EVB A;  2KEE A;  5IP9 G;  1F77 A;  1S4Z A;  4R4Q A;  4FF4 A;  1QZG A;  1JE4 A;  3CKI B;  1IBM Q;  5GAH C;  2H4O A;  1U4P A;  2AKW B;  2ZT9 C;  1DOK A;  3O13 A;  2K7V A;  1TY2 A;  5JAV A;  1PTO D;  3FEW X;  5CBA E;  4TRD A;  3M4O B;  4I7Z C;  4NXN Q;  4GS3 A;  2F0H A;  4M1U B;  4YHH L;  2F0M A;  1KIX A;  4JI8 Q;  1MJE A;  1STB A;  4K6L A;  3PO3 H;  1V9P A;  2EIF A;  2PZW A;  2R6G A;  4YY3 Q;  1N32 Q;  5JJL A;  2Y0S B;  4A3B H;  1FNW A;  3A8J E;  5HUR A;  3FMC A;  4XT1 B;  2IY5 B;  3T4A C;  1H9S B;  4LFB L;  4JI5 Q;  3AYH B;  5LMU L;  4DR5 L;  4FNF A;  3FPU B;  1W6K A;  3DM1 A;  5JEA G;  4H0L C;  3FDT A;  3VR5 A;  3HKS A;  3HEJ A;  3FKI G;  5JVH 3;  2R7Z B;  1UEA B;  4I7A A;  4RGN A;  4ZCK A;  2F4V Q;  1PH4 A;  3C1E A;  3H3V I;  3I4M G;  3ERQ A;  4CJ0 B;  2SDF A;  1ZEQ X;  2NUC A;  1HH2 P;  3SK8 A;  5AJ3 Q;  1VQ4 A;  1CSP A;  5IIF A;  1YIT A;  5FK9 C;  4DR4 L;  4GOP B;  4C1N K;  5LL6 X;  4FF3 A;  1UAP A;  2AUK A;  1WD1 A;  1VQL A;  2WII B;  4OO1 I;  2K6A A;  3S1Q H;  2PO4 A;  3HOV G;  4RCN A;  1BOS A;  3SK6 A;  2EOT A;  4K6D A;  2F03 A;  1IBK L;  3RR5 A;  4PMC A;  4X6A H;  2NVT B;  1U0L A;  5JPN C;  4NKL A;  4YIJ A;  2FFK B;  1SMX A;  2P5Z X;  1HFN A;  2BDN A;  1Q46 A;  2RA4 A;  1JQY D;  1B3Q A;  2ZJR A;  3B6Y A;  2EXZ A;  4F8M A;  1VQI A;  3QOL A;  1NNX A;  4DR3 L;  2YYZ A;  2SNM A;  3TS2 A;  3A55 A;  1EY6 A;  1HR0 W;  1SMY D;  3OTO L;  3KDF B;  2OT2 A;  3A8K E;  1WTH A;  1JMC A;  2I07 B;  5C0X J;  2K5H A;  4IUR A;  3T51 B;  4IO9 A;  2QGQ A;  2CWP A;  5CC4 A;  4DV3 Q;  5FO7 B;  3CC7 A;  3QO2 A;  1MSH A;  1ESF A;  2EYM A;  1MI2 A;  4IUU A;  1W3S A;  1L0X B;  1PH1 A;  1I6H B;  2IL8 A;  4G4K A;  3DHQ A;  1PRT B;  2V1C C;  4CKC A;  5A2Q E;  5C4J H;  3KFU A;  3TQY A;  1Y1V H;  4EQN A;  5M3M B;  2RDG A;  4YWK A;  1VQB A;  3CC4 A;  1LLR D;  3HOW H;  3RUZ A;  1B53 A;  4FF1 A;  2VXW A;  1TY0 A;  1O7L A;  2AWO A;  4MTK A;  4RAU C;  4OL7 A;  5COR A;  2YU9 H;  2D9U A;  1KNA A;  2E74 C;  4BBR G;  2KOL A;  5FJ8 G;  3RZD B;  2EYF A;  3BU2 A;  3GQB A;  2QEJ C;  1XNR Q;  2X69 A;  4IZ8 A;  2CCZ A;  2EPB A;  3VDY A;  3NHH A;  3GTG B;  2AQ3 B;  3CRL C;  4R8N A;  1L1O C;  1Q8K A;  5IP9 H;  2FJ2 A;  4QF4 A;  2B63 H;  1CSQ A;  2PI2 E;  3KOJ A;  4PZ7 A;  4G7O C;  4NXM Q;  1LO5 D;  1JJC B;  4IAL A;  4ZLT F;  3T16 A;  3OIQ A;  3LNN A;  2R7F A;  1IBM L;  2F1M A;  2NYZ D;  3RZO H;  2F0K A;  4KK7 A;  4ZKC B;  3V05 A;  4ME5 A;  1U5K A;  2A6H C;  1Q82 C;  2L0C A;  4ODG A;  4YWL A;  4NXN L;  4CJ1 B;  4DV1 Q;  4KLK A;  3RMH A;  4QIW B;  4C2M H;  1PFM A;  1TR5 A;  1RDP D;  3R3O A;  4YY3 L;  5C44 H;  3VYT A;  2VQE Q;  1N32 L;  1D2B A;  1I3Q H;  4JI5 L;  4IFD H;  5ELF A;  1C48 A;  2UXC Q;  4CDE C;  1PTO H;  5C4H A;  3FKI H;  1OXS C;  1S5B D;  3CD6 A;  1EYD A;  2B2Y C;  1O78 A;  3STB C;  3I4M H;  1QVC A;  1YI2 A;  1HQR D;  1CQV A;  2ZXO A;  2AWN A;  2N8N A;  2F4V L;  3S1Q B;  1Y1W G;  2EY2 A;  5C0X G;  2A73 B;  5EBD A;  2MO0 A;  2MHV A;  2V4D A;  5EKI A;  1EZ6 A;  2F0F A;  4IJL A;  5C5M A;  5AJ3 L;  3PIP 3;  1RJT A;  2OCE A;  4HJ9 A;  1PHJ A;  1BBW A;  4DFA A;  5FLX L;  3MEF A;  1A15 A;  4KJN A;  5C6A A;  3CC2 A;  2J0T D;  5NUC A;  3TP7 A;  1PZI D;  5IOD A;  3GTM B;  2C35 B;  2EY5 A;  1CK1 A;  4B9X A;  1V8Q A;  5TSS A;  4G7Z C;  3GV3 A;  1HZA A;  4DUZ Q;  1LTL A;  5ISR A;  1S5E D;  2JA6 H;  3S2H H;  1E2W A;  5DLQ E;  1Y8N B;  3BDL A;  3JAM L;  3RLO A;  1DJR D;  2HT1 A;  4K14 A;  1WJJ A;  1D1K A;  2WIN B;  1K9M C;  1EYG A;  1FNU A;  2F0L A;  4BA1 I;  4F7X A;  1KD1 C;  3VR3 A;  1A6X A;  2L5T A;  1N34 Q;  1VQH A;  2LFN A;  2B2V C;  4MHE A;  1WTX A;  1C0A A;  1PTO F;  3J7Y W;  1X9N A;  3GTL H;  4JI7 Q;  1PFN A;  4OHJ A;  3U50 C;  4DV3 L;  2K5N A;  1CT1 D;  1Y1V B;  4L6T B;  1DXM A;  2A19 A;  1H95 A;  1VQF A;  3J7A V;  1S5F D;  1DON A;  1ONL A;  2F0O A;  3S1N B;  5KRU A;  4J8Q A;  3HOY B;  4LW1 A;  2EYP A;  3SDZ A;  3NQI A;  1EOV A;  3U4Z A;  3W1G A;  2PNH A;  2B29 A;  4G57 A;  3S17 H;  2DUD A;  1S3O A;  5FJ8 H;  2RSO A;  4CHT B;  1Y8O B;  1GJX A;  1V1P B;  4RFB A;  5ELE A;  4ZK9 B;  1G2S A;  4GNX B;  3TZD A;  3BZK A;  5JOB A;  4IOC A;  1IKM A;  1PV4 A;  1XNR L;  1LYL A;  2HD3 A;  3RZO B;  4LK1 C;  5IGG A;  1BUV T;  1KDC A;  3VR6 A;  1LTS D;  1I4P A;  1XMO Q;  3M4Y A;  1QG7 A;  4NXM L;  2GN5 A;  2ID0 A;  4KD3 A;  1GUW A;  4RGO S;  1STE A;  2L9H A;  1X6O A;  2K01 A;  1PH2 A;  1ZYR D;  5M5Y B;  2M9V A;  4RH6 A;  4PMW A;  3GO5 A;  5IYC H;  2QF7 A;  4J1M A;  2R3Z A;  3M3Y H;  2R92 G;  1I3Q B;  5FO9 B;  3NUC A;  4B3S Q;  4HJ7 A;  4P74 A;  1LTA D;  3OIP A;  2EDG A;  3GP7 A;  3IAY A;  4DV1 L;  4MTN A;  3FKI B;  1KLG D;  2N49 A;  3UDF A;  4UPA A;  4IFD I;  4HCS A;  2VQE L;  3I4M B;  5F2D A;  3S15 H;  1WCM H;  1ENC A;  3S2D H;  3I7F A;  1F2L A;  3I3C A;  3MTS A;  3NK9 A;  4WOR A;  3J7Z C;  2NBF A;  1BVS A;  4X64 Q;  2R93 H;  2UXC L;  1ZXT A;  3FHW A;  3HKZ E;  4K2L A;  1GHK A;  2B8F A;  1F9P A;  1UNS A;  1STH A;  2BOS A;  2QCP X;  5CMD A;  4ZAI A;  1BXT A;  3HOV B;  2PPB C;  1F9S A;  1SEB D;  1E2Z A;  3G4S A;  5ELD A;  2PZU A;  1PTO C;  1EU4 A;  5M5W H;  1HQM C;  4X66 Q;  1X65 A;  2A5H A;  1Z6H A;  2JEB I;  1U4R A;  3GTQ H;  4A3L H;  3DUZ A;  3FP9 A;  1NUC A;  3S2H B;  3RLF A;  4A3E G;  1AZP A;  5KEE A;  3N6R A;  5LL6 S;  2JA5 G;  3KF8 B;  3VA5 A;  2XIW A;  4C3I H;  4IPC A;  4JCV E;  5FKA C;  1O7Z A;  3NTI A;  5I6Y A;  4DUZ L;  5I6W A;  5CV9 A;  4TKO B;  2K75 A;  3NBH A;  1PFS A;  3IRB A;  4WJ3 M;  3L2P A;  2PQE A;  2NWG A;  3ULL A;  2WFW A;  1GUT A;  3PO2 H;  1NY4 A;  3K5L A;  3ND9 A;  2RSN A;  1YZ6 A;  1ICW A;  3H6M A;  3W1B A;  3PCO B;  3RLN A;  4AH6 A;  4A3C H;  1EQQ A;  1N34 L;  2E2J H;  3S16 B;  2A69 D;  1L2F A;  2DJF C;  2XRQ D;  1GM5 A;  5CGK A;  2HCC A;  3UDI A;  4JI7 L;  4EX5 A;  2ZXR A;  2F0N A;  3T1Y Q;  3NSW A;  2JJQ A;  3QG1 A;  3F8T A;  3MZ5 A;  1Q86 C;  4DGZ A;  1A2U A;  2EJM A;  1X56 A;  2BH8 A;  1HJP A;  2F0Q A;  1EYC A;  2ZJP A;  2KEC A;  3EBE A;  2MP1 A;  4R4C A;  4AIM A;  4BBR B;  2B2U A;  2WAC A;  1HZC A;  4C3J H;  2FHT A;  1W6J A;  4L63 B;  1WTO A;  2SNS A;  4IPH A;  3NBI A;  1XMQ Q;  4N9P A;  5ELN A;  2VB2 X;  3Q22 A;  2F0T A;  1SMY C;  1S5D D;  1HXY D;  4QGU A;  2N3S A;  1YJN A;  2BCO A;  4A3D H;  1O7I A;  4JBM A;  2M2L A;  4DNT B;  4CGY B;  3PO3 G;  1I4X A;  4A3B G;  1GHJ A;  3K59 A;  1I50 H;  1BBU A;  3K80 C;  4XTC S;  1T5X D;  1GO3 E;  1JWS D;  3TEH B;  4POG A;  1XMO L;  3SE0 A;  3X3N A;  1IW7 D;  5C3E G;  2F0S A;  4C3H H;  1SYB A;  3KLS A;  2QW7 A;  4EGV A;  2LKV A;  1K83 H;  3IL8 A;  5E1F A;  1KNE A;  2OEO A;  4FP5 D;  3S2D B;  4MN3 A;  4B3S L;  2NZO A;  3X3M A;  2UUA Q;  1PH6 A;  3M85 A;  1V1Q A;  3K0X A;  3MEH A;  3I4N H;  3J81 j;  4Q5V A;  4IJH A;  1WTV A;  2IX1 A;  4QL5 A;  4FXK C;  3NTK A;  4ALP A;  3PUY A;  4OO1 H;  1SND A;  1KHI A;  1WTR A;  1Y1W B;  3K5O A;  5IYD G;  1DOM A;  3CCV A;  5G3L D;  3EQL C;  4IFD J;  3E3X A;  2DJG C;  1MIU A;  2OXP A;  1IHZ A;  2BDO A;  1YNJ D;  3OOC A;  1IL2 A;  4Q0F A;  1XWE A;  3J81 E;  3QJY A;  4B3T L;  1KAB A;  4RG1 A;  1MD2 D;  3KF6 A;  3LX0 A;  1JWU D;  4X66 L;  4HIO A;  4FF2 A;  1HNW Q;  5K36 H;  4F88 A;  1FNV A;  2QIL A;  4IUT A;  3H15 A;  2K5W A;  2XWB B;  2JA5 H;  2PYK A;  3MC0 B;  1B44 D;  4CJ2 C;  3J7A 5;  4XXE A;  2EYO A;  5ELC A;  2ICI A;  3D6C A;  1XTD A;  1VF5 C;  4IN3 A;  5M5X B;  2J4X A;  1IYJ B;  3BVZ A;  3HP3 A;  4UP7 A;  1VCI A;  4DK6 C;  2KA7 A;  1SFO H;  3E9H A;  4BS9 A;  2E5L Q;  1N9W A;  5GAG C;  3HOW G;  3V2T A;  3D4W A;  5DAU A;  3OPO A;  1K0R A;  1MHW C;  1FYC A;  3EFX D;  3MA2 B;  1EIY B;  3UE1 A;  2F4I A;  2A1A A;  4A3F G;  1TT2 A;  3L7Z C;  2A74 C;  1N33 Q;  1SNM A;  1EEI D;  1Q7Y C;  2JA9 A;  4GN5 A;  1TWH H;  5GQO A;  3PIO 3;  2VL6 A;  5EKK A;  2F0U A;  3T1Y L;  1PVO A;  2WAQ G;  2JYO A;  3E5S A;  1TWC H;  2B63 G;  2F0V A;  4N8X 1;  4JI2 Q;  3A7A B;  4L5S A;  5J3B A;  4PZ6 A;  4DNI A;  1RIP A;  1TWA H;  4L5T A;  3GTJ H;  2NVQ H;  3JAM E;  4YCW A;  2PNR C;  2KQ3 A;  4TVA B;  3S1R H;  1PFB A;  4KTA A;  3HS0 C;  4PZ8 A;  4XQN A;  4LF6 Q;  1XMQ L;  1CTM A;  1RD9 D;  2KCM A;  2KCC A;  2KCN A;  2A6E D;  1SYC A;  2ATW A;  3MXN B;  3NEL A;  5BN4 A;  1TWF B;  4U68 A;  3OW7 A;  2O5I C;  1SE4 A;  4HMJ A;  5C44 G;  5M9O A;  3CCS A;  1YJW A;  2VNU D;  1WTW A;  2R92 B;  1P16 A;  5IGC A;  4IFD G;  4S3S A;  5C3E H;  1VF7 A;  1HA6 A;  1SJE D;  3CCJ A;  3PF4 A;  5FLM H;  4Y52 H;  1EOT A;  1N36 Q;  4JI4 L;  5IT9 E;  2IHE A;  2N78 A;  3DWQ A;  1YJ9 A;  4UY8 C;  5EKL A;  2N88 A;  3T56 B;  4H44 C;  2VW9 A;  4HED A;  4JI3 Q;  3Q8D A;  3K7A H;  4A3I H;  4N8F A;  5D3D A;  2UUA L;  4IUV A;  1X3E A;  2F0W A;  1VMP A;  3UE0 A;  1SXT A;  3HKZ G;  4UHV A;  4ZYS A;  5KYL A;  2F0J A;  4K5X A;  1GXD C;  4HJ8 A;  1D7Q A;  1U4M A;  3VA7 A;  3CPW A;  1A0I A;  5IYD H;  4IUP A;  2DNE A;  2EZV A;  3U58 A;  1M90 C;  5CV4 A;  1HUM A;  3CF5 A;  5KIX A;  1Y69 U;  4L5R C;  2Q8T A;  2JA6 G;  1EZ8 A;  4HTH A;  4K2K A;  4RHR A;  1KDA A;  3J80 E;  1CFM A;  1YVC A;  1FVI A;  4A3E B;  4HJA A;  5T1I A;  1ZYR C;  2JA5 B;  1F2Z A;  1B1Z A;  3K8A A;  4KMU C;  1RHP A;  2O4X A;  2LMC B;  1Y8P B;  2OQK A;  5GAE C;  1FGU A;  5AFW A;  3A7L A;  3NTH A;  3F2C A;  1DOL A;  1P8L A;  1UE6 A;  2PQA A;  1HNW L;  2MO1 A;  1BBX C;  2L4N A;  1C7Y A;  4DU9 A;  4IOA A;  2HCI A;  3QB3 A;  1PA6 A;  5E4X A;  3W5O A;  3MXP A;  1B2T A;  2I5L X;  2A68 D;  1CHP D;  2RVL A;  1AE2 A;  4UP8 A;  1FGB D;  1F9R A;  3SVM A;  2ENB A;  1L1O B;  5GAD C;  1UE5 A;  4DV0 Q;  1I5F A;  1EU3 A;  2VB3 X;  2PMZ E;  1Q1B A;  2KHI A;  1J9O A;  3PF5 A;  1R9T H;  2HDM A;  2E5L L;  3AEV A;  3Q0A A;  3PIP A;  2FMC A;  1RTN A;  4J15 A;  2J7Z A;  1YIJ A;  4PV1 C;  2RHQ B;  5EQ0 A;  1KRT A;  2OF1 A;  1EUJ A;  3ITP A;  4DA2 A;  4A3F H;  1J6Q A;  2F3I A;  1PH3 A;  2ZTD A;  2KJX A;  4GLV B;  4XYQ A;  4MNO A;  1N33 L;  4WFN 3;  2NVQ B;  2BA1 A;  1X3F A;  4UP9 A;  1AEX A;  3SK5 A;  5JVG 3;  4X62 Q;  4LMQ D;  1PLF A;  2JA8 H;  1QZH A;  2JE6 I;  5FOB B;  2XTI A;  4JI2 L;  2A8V A;  3TRZ A;  1UE7 A;  1PH8 A;  4TSS A;  1NSN S;  4LF7 Q;  3PO3 B;  3J81 L;  4A3B B;  4HR7 B;  2JEA I;  1SE3 A;  5IYC G;  4LF6 L;  2E76 C;  1I4Q A;  2FMM A;  2A69 C;  2VQF Q;  2WB1 G;  3I2Z A;  3TP8 A;  4K5W A;  5C3E B;  4DUY Q;  3H94 A;  4YCV A;  1QVG A;  2UUC Q;  2LXK A;  2AQ1 B;  3QR8 A;  5KND A;  3CAM A;  1WCM G;  2IPK D;  2K03 A;  3Q24 A;  3I4L A;  3M9B A;  4KHV A;  2E2I H;  3U4V A;  2TSS A;  1QNK A;  2R93 G;  4Y7N H;  2NVX H;  3HOZ G;  3V96 A;  3TS0 A;  3HOX H;  1N36 L;  4KI0 A;  4BBS H;  3UDX A;  3M7G A;  1KQS A;  1LTG D;  2B2T C;  1EY8 A;  3DXJ C;  5IWA Q;  3PMF A;  2EYH A;  1PMR A;  3N52 A;  1G51 A;  2VZA A;  2PZT A;  4CKB A;  1TU2 B;  3ER0 A;  5D65 A;  4DV6 Q;  1A3U A;  1LUZ A;  4F87 A;  4O2D A;  4A3M H;  4A3L G;  4JI3 L;  2WKD A;  4ZQ3 A;  4LNQ A;  2D62 A;  2JSO A;  2NB0 A;  2I46 A;  3AU7 A;  1X3P A;  2MQH A;  3A56 A;  1CHQ D;  2WKC A;  3KJO A;  2AHO B;  4JBJ A;  2JP1 A;  1WI5 A;  4C3I G;  2PW7 A;  1H9S A;  2Z0S A;  3D4R A;  1IW7 C;  2IX3 A;  1LT5 D;  3S24 A;  1FL0 A;  3U9O A;  2G5D A;  2SOB A;  3PO2 G;  1BCP D;  1TVX A;  3L3O C;  4HJ5 A;  3C1F A;  4PNY A;  4A3C G;  2TMP A;  4OEM B;  1MGS A;  5C4J B;  3GTO H;  1U9R A;  4GOP A;  4RA8 A;  4K8I A;  3F2D A;  1EIH A;  4OEL B;  3HOW B;  1GUG A;  4GKJ Q;  4YWM A;  3P20 A;  3SHL A;  3D8G A;  3A5U A;  3SK4 A;  5A35 A;  5D14 A;  2HIV A;  4RMF A;  4UAI A;  1EY7 A;  5IT9 L;  4P72 A;  2YU9 B;  1FJG Q;  4IPG A;  2LY7 A;  1XTC D;  2K5V A;  4DV0 L;  4DV2 Q;  2IT1 A;  2Z1C A;  2B2U C;  1ICF B;  4A3F B;  3ERS X;  3R8B A;  2WAQ E;  4C3J G;  1YNJ C;  2WV6 D;  2MFI A;  4NP5 A;  3GTP H;  2NTT A;  1HCZ A;  2WAQ B;  3OW2 A;  3OMG A;  2B63 B;  2XSC A;  4GN4 B;  1T5E A;  1LAB A;  2Q2U A;  1VQC A;  1JCK B;  1I6V C;  1Z47 A;  4A3D G;  3KDF A;  1LT3 D;  2R61 A;  1SRU A;  2EY6 A;  1G6Z A;  3TP6 A;  1CKN B;  2K5D A;  1UUP A;  3NXW A;  1SE2 A;  3W2D A;  1WOC A;  1OXV A;  3KBG A;  4FDB A;  4J6H A;  4X62 L;  1AH9 A;  3J80 L;  1NAP A;  1HNZ Q;  2DGY A;  1JWM D;  3BVM A;  1EIG A;  1PZJ D;  4C3H G;  1AZQ A;  5COY A;  4C2M B;  4DNR B;  2EJG C;  1N8R C;  4EQ5 A;  3KLR A;  4LF7 L;  3EIV A;  4A75 A;  4A76 A;  2H1E A;  5C44 B;  4LUV A;  4PMB A;  4M8A A;  3CPF A;  4A93 H;  1Q81 C;  2ZTE A;  5E3F A;  1A3T A;  3Q6S A;  3ULJ A;  1PTO B;  2VQF L;  1EIF A;  4FXG C;  3ND8 A;  5EJW A;  2M00 A;  3I4N G;  4PG3 A;  4DUY L;  1E0B A;  4RHS A;  3BJU A;  2K32 A;  2O2L D;  2H5X A;  2UUC L;  1OXX K;  4YCU A;  4OO1 G;  4RKL A;  1QIL A;  1LTT D;  1QOH A;  3ZYY X;  1PYS B;  4XQQ A;  4HIM A;  4NW2 A;  3HOZ H;  1BNZ A;  2CHB D;  1JIC A;  1TS4 A;  4QB4 A;  2B2T A;  3PUV A;  3R2T A;  3CCM A;  4B3T Q;  3LWU A;  1LT6 D;  3HKZ B;  1ENF A;  1ROD A;  2MPM A;  5IWA L;  3G48 A;  4DAY B;  1W2B A;  3E9I A;  4IPD A;  3KYH C;  2K52 A;  2A6E C;  2ZTC A;  1KDB A;  4DV6 L;  1HTP A;  4A3J H;  2JA6 B;  5K36 G;  2PW5 A;  2K04 A;  5IP7 G;  1STA A;  3W3A A;  3KLW A;  1JJG A;  2F0P A;  1CKM A;  4N9T A;  4K0K Q;  3DWA A;  4OON A;  1X3Q A;  1IYV A;  2HDL A;  4LWC A;  3OWE B;  1EWC A;  5GRO A;  1YHB A;  2VUM G;  2IJ0 A;  1RF2 D;  5CYU A;  5FLX c;  5LMN Q;  2CH4 A;  4O0A A;  2I5M X;  2KBN A;  4RWS C;  3RN2 A;  2SEB D;  1PRT D;  2CW0 D;  3GTL B;  3SR1 A;  3GTO B;  3CP0 A;  3K81 C;  4H7B A;  4RGT A;  4APV A;  1JR0 D;  5EBC A;  1LTR D;  3S1M H;  4Z9C B;  1EY9 A;  1Q3L A;  4KKU A;  4QQB X;  2Z8L A;  3WOE A;  3ONA B;  4V19 0;  1TWG H;  1E2V A;  1CM9 A;  1B9N A;  4GKJ L;  3E6Z X;  3S17 B;  3G6E A;  2XWJ B;  3GTP B;  4EQP A;  1FJG L;  2FIN B;  2Q2T A;  3C3L A;  3PUZ A;  4DV2 L;  4DR1 Q;  2UU9 Q;  3AQQ A;  1SE8 A;  1BDO A;  4K8J A;  4O42 A;  3CME A;  5IGF A;  1EL0 A;  4R4T A;  3QOJ A;  3CW2 C;  3CHB D;  1XPU A;  3FRP B;  1GKH A;  1SAP A;  1BF4 A;  2K4K A;  2QDB A;  3BYT B;  2QA4 A;  1NR2 A;  4MZ9 A;  4QCL A;  3VR2 A;  1T9H A;  2A68 C;  2WB1 E;  1JT8 A;  3M3Y B;  4JI4 Q;  2XNA C;  5DEH A;  1LAC A;  4QY7 A;  2CFM A;  2WB1 B;  5FLM G;  2HHH Q;  1ASY A;  1HNZ L;  4A3G G;  2HQE A;  2LSS A;  3PSI A;  1IBL Q;  1JJ2 A;  5C3X A;  3AFP A;  3CCR A;  3M4O H;  1ESR A;  1R4Q B;  3FPP A;  1VDZ A;  3S15 B;  1TS2 A;  1WCM B;  2Z6K C;  4B3R L;  4BXX H;  3PUW A;  2K28 A;  3QWN A;  1TQO A;  5ELB A;  3PIO A;  2R93 B;  4A3I G;  1QB5 D;  3HOZ B;  1TS5 A;  1V1P A;  1HZ9 A;  1YNN D;  3M7N A;  3GD7 A;  1ZKO A;  3IFT A;  2CQO A;  3K5M A;  4GNX A;  1EQR A;  3K7U C;  3OMC A;  5M5W B;  5KGU A;  1SSO A;  4DR7 Q;  1K8O A;  3NEN A;  1EQT A;  3GTQ B;  3Q23 A;  2F0D A;  3PUX A;  5EPK A;  1NBW A;  1RL2 A;  2B3G A;  3CRK C;  4WRD A;  1AP0 A;  3KUP A;  3I72 A;  1F2Y A;  4AYB E;  1OO9 B;  1EY5 A;  3R2I A;  4C3I B;  4LF5 Q;  5IP7 H;  4FVM A;  2BE5 D;  3DWP A;  2NN6 I;  4JYA Q;  1CZG A;  4LAA A;  1JB7 A;  1EYA A;  3J7A F;  2BH2 A;  1F2M A;  1A3V A;  1EY4 A;  4OGQ C;  2RBM A;  3PO2 B;  4R4O A;  1SBB B;  4K0K L;  1L0Y B;  2ZXP A;  4XT3 B;  2VUM H;  2EQS A;  4DPG A;  2E2J B;  1WFQ A;  2RDF A;  2XVS A;  1HUN A;  2E2H H;  1GOZ A;  2L55 A;  1QJO A;  3HG9 A;  5LMN L;  2Z6B A;  1B3A A;  3ULP A;  3PV0 A;  2EXD A;  1QCB D;  4L8J A;  1TWG B;  2KUM A;  3MHB A;  3UI2 A;  3I55 A;  1AW7 A;  1B9M A;  1VQA A;  5H1S E;  4ZUI A;  1K8A C;  4JC0 A;  1JOR A;  4LFA Q;  1A62 A;  2RCN A;  4C3J B;  1EFW A;  1IL8 A;  2LS0 1;  1VQE A;  1I6H H;  2D2C C;  1WTQ A;  2N55 A;  2G9D A;  2CQA A;  2UXD Q;  4R1J A;  1K28 A;  2Q2I A;  4KY6 A;  5I2X A;  3KF8 A;  1PDQ A;  2KCT A;  4C56 C;  2JA8 G;  5EGT A;  4LF4 Q;  3G6J B;  5M3M H;  4A3D B;  1IXR A;  1G6P A;  1S72 A;  1J8I A;  3G7L A;  2MGS A;  2B8G A;  4DR1 L;  3KJP A;  2UU9 L;  4ME3 A;  4OIJ A;  5J39 A;  1JC7 A;  1SYD A;  4H13 C;  5I4D A;  1BCP C;  4ZRZ A;  3A74 A;  4XDX A;  1I50 B;  3RZD H;  1PH9 A;  1X32 A;  1JE5 A;  1HZB A;  2E75 C;  4HSP A;  5D3I B;  1RCV D;  4L5Q A;  1PH7 A;  3AFQ A;  4EVO A;  3GTG H;  3LGJ A;  4C3H B;  5KNB A;  1Q1E A;  1CQF A;  2Q2H A;  1KC8 C;  3ZJY C;  1I94 L;  5DM6 3;  3T53 B;  2L15 A;  4DAV A;  3AMU A;  1SDF A;  1K83 B;  4QUC A;  5ELO A;  2Y0S E;  1M4V A;  1OXU A;  5E4W C;  4JPB W;  5C4X G;  4A3G H;  5J1Z A;  1NJI C;  3A8I E;  1LT4 D; 
#chains in the Genus database with same CATH homology
 1TWF H;  2R92 G;  2UUC Q;  1YNX A;  2LXK A;  4JI1 Q;  2HHH L;  4B3S Q;  4HJ7 A;  4LF9 Q;  3HOX G;  4P74 A;  3CAM A;  1WCM G;  4BBS G;  2Z6K A;  1IBL L;  3H0G G;  3M9B A;  2VY3 A;  1LM0 A;  2E2I H;  4DR6 L;  3U4V A;  4MTN A;  4DV1 L;  1XNQ L;  2N49 A;  3UDF A;  4UPA A;  1VQO A;  4IFD I;  2FXQ A;  4Y7N H;  2R92 H;  2R93 G;  4JV5 L;  4P75 A;  2NVX H;  3HOZ G;  1N36 L;  3TS0 A;  3HOX H;  2VQE L;  2PQA B;  4DR4 Q;  3S15 H;  4KI0 A;  1WCM H;  4JI0 L;  4BBS H;  3HFZ B;  1CKN A;  5E7N A;  3UDX A;  4A3M G;  2OTL A;  2R7Z H;  3I7F A;  1KQS A;  1WYD A;  5IWA Q;  1XPR A;  3S2D H;  1X3G A;  3J7Z C;  5IY0 A;  1BVS A;  4X64 Q;  2R93 H;  1G51 A;  1VQG A;  2VZA A;  1KRS A;  2UXC L;  2NVY H;  3ER0 A;  4DV6 Q;  1IBK Q;  3FHW A;  3HKZ E;  1LUZ A;  1E24 A;  4O2D A;  4A3M H;  4A3L G;  4JI3 L;  4LNQ A;  2I5H A;  1OXT A;  4DR2 L;  2D62 A;  4AQY Q;  1X55 A;  4OXP A;  3G4S A;  4DR7 L;  4X65 Q;  2MQH A;  3D31 A;  5M5W H;  4HID A;  4POF A;  4JBK A;  4X66 Q;  1X65 A;  4X64 L;  5C0X I;  4DR3 Q;  2JEB I;  3KJO A;  2AHO B;  3GTQ H;  4A3L H;  5JEA J;  4JBJ A;  4KHZ A;  1WI5 A;  3FP9 A;  1K8G A;  2NVT H;  3RLF A;  4A3E G;  2Z0S A;  2E8G A;  4LF8 L;  3OTO Q;  1D8L A;  1E1O A;  1UWV A;  2AMC B;  2JA5 G;  1XJV A;  2ASB A;  2GVB A;  2LXJ A;  3KF8 B;  2UXB L;  2RHS B;  1IZ6 A;  4DK3 C;  4C3I H;  4LF5 L;  4IPC A;  4JCV E;  3S24 A;  4A3E H;  3GTM H;  1NE3 A;  1FL0 A;  4LUO A;  3PO2 G;  2VS1 A;  4DUZ L;  4HJ5 A;  4JYA L;  4GOP C;  2NZH A;  4OWT B;  3CCU A;  4NB3 A;  4A3C G;  1KL9 A;  5IYB G;  2K75 A;  2ZJQ A;  1PFS A;  3IRB A;  1GVP A;  1VQ5 A;  2OWO A;  1DGS A;  4WJ3 M;  4DV5 L;  3L2P A;  4B3M Q;  3GTO H;  3CCE A;  3ULL A;  1NMG A;  2WFW A;  4GOP A;  3PO2 H;  1NY4 A;  3F2D A;  1YZ6 A;  3W1B A;  4AH6 A;  3UDG A;  3PCO B;  3RLN A;  4A3C H;  4GKJ Q;  1EQQ A;  1N34 L;  2E2J H;  1YHQ A;  1PH5 A;  1L2F A;  2WP8 J;  4YWM A;  2F52 A;  3A5U A;  5EAY A;  1Y1V G;  4DKA C;  1GM5 A;  2HIV A;  4JOI C;  2K14 A;  4RMF A;  1KXL A;  3UDI A;  4P72 A;  1FJG Q;  4IPG A;  4JI7 L;  4Y52 H;  2ALY B;  4KHP L;  1GD7 A;  2K5V A;  4EX5 A;  4DV0 L;  4DV2 Q;  2IT1 A;  4DR6 Q;  3T1Y Q;  2JJQ A;  3ERS X;  3F8T A;  2WAQ E;  1Q86 C;  1E22 A;  2MNA A;  1B70 B;  2XGT A;  4JOI A;  1X56 A;  4LUZ A;  2BH8 A;  1B7Y B;  1HJP A;  1KAW A;  3T1H Q;  1K73 C;  3HOY G;  2MFI A;  4LFA L;  2ZJP A;  3A0J A;  1PYB A;  3EBE A;  4R4C A;  4AIM A;  3GTP H;  1SN8 A;  3D0F A;  3H3V H;  3OW2 A;  1HZC A;  4GN4 B;  3S1N H;  4C3J H;  2Q2U A;  1VQC A;  1Z47 A;  4A3D G;  3KDF A;  4GKK Q;  2UXD L;  5IP9 G;  4BY1 G;  3HOY H;  4IPH A;  4R4Q A;  4A3K G;  1XMQ Q;  5ELN A;  1QZG A;  1SRU A;  2ZM6 Q;  4LF4 L;  1CKN B;  2IX0 A;  1IBM Q;  5GAH C;  4QGU A;  2N3S A;  1YJN A;  4A3D H;  1WOC A;  4GLX A;  2JK8 A;  1O7I A;  1OXV A;  4FDB A;  4JBM A;  4X62 L;  3I56 A;  2AKW B;  1AH9 A;  3PO3 G;  3GDE A;  1HNZ Q;  2DGY A;  4A93 G;  4A3B G;  4NXN Q;  4GS3 A;  1N8R C;  4EQ5 A;  1I50 H;  1BBU A;  3EIV A;  4YHH L;  4A75 A;  3K80 C;  4A76 A;  4LF7 L;  4XTC S;  1KIX A;  1GO3 E;  4LUV A;  4JI8 Q;  1MJE A;  4POG A;  3TEH B;  3PO3 H;  1V9P A;  2EIF A;  3CPF A;  2R6G A;  3M4P A;  4YY3 Q;  1XMO L;  1Q81 C;  4A93 H;  1N32 Q;  4A3B H;  1NMF A;  1QUQ B;  2ZTE A;  2JQO A;  4NPS A;  4C3H H;  5C3E G;  1SRO A;  4QIW E;  2IY5 B;  3F2B A;  4LFB L;  3ULJ A;  4JI5 Q;  5C4X H;  3AYH B;  5LMU L;  2VQF L;  1EIF A;  4DR5 L;  3I4N G;  3M4Q A;  1K83 H;  4PG3 A;  5JEA G;  4DUY L;  2BA0 A;  1YHA A;  3RNU A;  3BJU A;  4JI8 L;  2H5X A;  3HKS A;  5M5Y H;  2UUC L;  4JI1 L;  1OXX K;  3H0G H;  3FKI G;  4YCU A;  1HR0 Q;  4B3S L;  2NZO A;  4OO1 G;  4HIK A;  4LF9 L;  2UUA Q;  1PH6 A;  3M85 A;  2F4V Q;  5M3F G;  1PH4 A;  1V1Q A;  1PYS B;  3K0X A;  1Q12 A;  3H3V I;  3I4M G;  3OYY A;  3J81 j;  3I4N H;  3DLL A;  4IJH A;  3JC6 6;  4HIM A;  2I0Q A;  5HGQ A;  2IX1 A;  3HOZ H;  4QL5 A;  1MJC A;  3NBH B;  4BY7 G;  4ALP A;  1HH2 P;  3PUY A;  5AJ3 Q;  1KHI A;  3PUV A;  1CSP A;  3CCM A;  1VQ4 A;  1YIT A;  4WJ4 A;  4B3T Q;  4DR4 L;  4GOP B;  4H02 A;  1Y14 B;  4A3J G;  2RF4 A;  4JI6 Q;  5IYD G;  2UUB Q;  1VQL A;  5IWA L;  3G48 A;  3CCV A;  4OO1 I;  3I4O A;  1VQ6 A;  4DAY B;  2KHJ A;  1W2B A;  1EWI A;  3E9I A;  3S1Q H;  4IPD A;  3KYH C;  2K52 A;  2ZTC A;  3HOV G;  4IFD J;  4DV6 L;  1IBK L;  3RR5 A;  2ES2 A;  1MIU A;  2NN6 G;  4A3J H;  5K36 G;  4X6A H;  1U0L A;  4OX9 Q;  1IL2 A;  4QJF A;  4AQY L;  5IP7 G;  4B3T L;  1SMX A;  4RG1 A;  4AYB G;  3S14 H;  2YTY A;  3KLW A;  3HOV H;  4X65 L;  1Q46 A;  5BR8 Q;  1JJG A;  1CKM A;  3KF6 A;  5IE8 A;  2ZJR A;  3B6Y A;  4K0K Q;  4OON A;  4LFC Q;  1K3R A;  1VQI A;  2YV5 A;  4X66 L;  4HIO A;  4LWC A;  1E1T A;  4DR3 L;  1HNW Q;  3CXC A;  2YYZ A;  3H15 A;  3HOU G;  5GRO A;  2OTJ A;  3TS2 A;  2JA5 H;  1YHB A;  2VUM G;  1HR0 W;  2JA7 G;  5FLX c;  3OTO L;  3KDF B;  5LMN Q;  4O0A A;  2I5M X;  2KBN A;  3RN2 A;  3J7A 5;  1JMC A;  5C0X J;  1HNX Q;  2K5H A;  3CP0 A;  4IO9 A;  1XTD A;  2QGQ A;  2CWP A;  3K81 C;  1ASZ A;  4DV3 Q;  1L0W A;  1IYJ B;  4UP7 A;  5HY6 A;  4APV A;  1VCI A;  4DK6 C;  5IYB H;  3CC7 A;  1VQK A;  4OWW B;  1SFO H;  3E9H A;  1UEB A;  1Z9F A;  2E5L Q;  3S1M H;  1N9W A;  5GAG C;  1W3S A;  1VQ8 A;  1PH1 A;  3HOW G;  4B3M L;  2V1C C;  1HNW L;  4QQB X;  1NTG A;  3DM3 A;  5C4J H;  4DV4 Q;  1K0R A;  4XIG S;  4DV7 Q;  3KFU A;  1EIY B;  1TWG H;  3TQY A;  3UE1 A;  1Y1V H;  4YWK A;  4GKJ L;  3F1Z A;  3G6E A;  3BZC A;  1VQB A;  3CC4 A;  3HOW H;  2A1A A;  4A3F G;  3L7Z C;  3S16 H;  1N33 Q;  1AE3 A;  3SGI A;  1Q7Y C;  1FJG L;  2AWO A;  2JA9 A;  4GN5 A;  2Q2T A;  1TWH H;  5GQO A;  3PUZ A;  3ICE A;  2VL6 A;  4DV2 L;  2YU9 H;  3CCL A;  3T1Y L;  1PVO A;  4DR1 Q;  4BBR G;  2UU9 Q;  1SE8 A;  3AQQ A;  2HQL A;  2WAQ G;  5FJ8 G;  1TWC H;  1E7Z A;  3CME A;  4TQU S;  2B63 G;  3BU2 A;  4JI2 Q;  5LMN W;  3T1H L;  4L5S A;  1XNR Q;  2CCZ A;  5J3B A;  1J5E Q;  3VDY A;  4PZ6 A;  4DNI A;  4R4T A;  1RIP A;  1SR3 A;  1TWA H;  3CW2 C;  4L5T A;  3GTJ H;  2NVQ H;  1L1O C;  1Q8K A;  5IP9 H;  1XPU A;  4YCW A;  4BY1 H;  4BBR H;  1GKH A;  4TVA B;  4A3K H;  3S1R H;  2B63 H;  2K4K A;  1CSQ A;  2PI2 E;  5JJK A;  3KOJ A;  4PZ7 A;  4GKK L;  2QA4 A;  4NXM Q;  4MZ9 A;  3WWV A;  4PZ8 A;  4LF6 Q;  1JJC B;  1XMQ L;  1VQ7 A;  2KCM A;  1L1O A;  2ZM6 L;  3CCQ A;  1M1K C;  1T9H A;  2WB1 E;  2R7F A;  1IBM L;  2ATW A;  3MXN B;  1YBY A;  1JT8 A;  3RZO H;  3NEL A;  4B3R Q;  3PGZ A;  1G29 1;  4JI4 Q;  5JJL A;  4A4I A;  4QY7 A;  2CFM A;  4P73 A;  2GVA A;  5FLM G;  2HHH Q;  1U5K A;  4BXX G;  1ASY A;  1HNZ L;  5C44 G;  3J81 i;  3CQZ H;  4A3G G;  3CCS A;  1Q82 C;  1YJW A;  2VNU D;  4YWL A;  3PSI A;  2LSS A;  1IBL Q;  1VQN A;  2Y0S G;  4NXN L;  1JJ2 A;  3AFP A;  3J81 c;  1P16 A;  3CCR A;  2YTX A;  4DV1 Q;  1XNQ Q;  4KLK A;  3M4O H;  1E3P A;  4IFD G;  4C2M H;  5C3E H;  2D0P A;  3KF6 B;  3CCJ A;  3GTK H;  5FLM H;  2Z6K C;  3PF4 A;  4JV5 Q;  4BXX H;  4B3R L;  3PUW A;  4YY3 L;  1N36 Q;  2VQE Q;  5C44 H;  4JI4 L;  2VUM H;  1N32 L;  4JI0 Q;  2IHE A;  1I3Q H;  4GNX C;  2N78 A;  1VQD A;  3PIO A;  1YJ9 A;  4UY8 C;  5JJI A;  4A3I G;  4JI5 L;  1HZ9 A;  2R7Z G;  3M7N A;  1B8A A;  2UXC Q;  3GD7 A;  2IHF A;  3FKI H;  1OXS C;  3CD6 A;  2CQO A;  4GNX A;  2VW9 A;  4JI3 Q;  1EQR A;  3Q8D A;  5M3F H;  4DR2 Q;  3STB C;  3I4M H;  3K7A H;  3K7U C;  1QVC A;  2PI2 A;  4GN3 B;  4A3I H;  1YI2 A;  1HR0 L;  2UUA L;  1X3E A;  2AWN A;  2N8N A;  2F4V L;  4BY7 H;  4DR7 Q;  3NEN A;  1Y1W G;  3UE0 A;  5C0X G;  1TXY A;  1SLJ A;  3HKZ G;  2MO0 A;  2R7D A;  3PUX A;  4HJ8 A;  1D7Q A;  1NBW A;  2YTV A;  1A0I A;  5AJ3 L;  3CPW A;  4IJL A;  1RL2 A;  2B3G A;  2OQ0 A;  5IYD H;  1UE1 A;  3U58 A;  1M90 C;  2OCE A;  2QEX A;  4HJ9 A;  4JG2 A;  1BBW A;  3CF5 A;  1PHJ A;  4LF8 Q;  4JI6 L;  1S40 A;  2UUB L;  1Y1W H;  4AYB E;  4L5R C;  3MEF A;  3CC2 A;  2JA6 G;  2UXB Q;  1YVC A;  1FVI A;  2C35 B;  4LF5 Q;  5IP7 H;  3RN5 A;  1VS0 A;  1HZA A;  4HJA A;  1QUQ A;  2NN6 I;  1LTL A;  4DUZ Q;  4OX9 L;  4JYA Q;  1JB7 A;  2CKZ B;  2JA6 H;  3S2H H;  1C9O A;  3K8A A;  5DLQ E;  2BH2 A;  2OQK A;  3RLO A;  5GAE C;  2HT1 A;  5BR8 L;  1FGU A;  4DV5 Q;  3HOU H;  4R4O A;  3F2C A;  4K0K L;  2D0O A;  1CUK A;  1X54 A;  1WJJ A;  4LFC L;  1P8L A;  1UE6 A;  2EQS A;  2PQA A;  3JAM i;  1K9M C;  1EYG A;  2JA7 H;  1KD1 C;  4DPG A;  2MO1 A;  4BA1 I;  1C7Y A;  1BKB A;  4IOA A;  1WFQ A;  1PA6 A;  3W5O A;  3JAM c;  2I5L X;  1VQH A;  1N34 Q;  2E2H H;  1OTC A;  1C0A A;  5LMN L;  3NEM A;  1AE2 A;  4UP8 A;  1MKH A;  1X9N A;  3ULP A;  5GAD C;  1HNX L;  3GTL H;  1L1O B;  4JI7 Q;  3PV0 A;  4KHP Q;  1UE5 A;  4DV0 Q;  1I5F A;  2EXD A;  3U50 C;  4DV3 L;  1VQJ A;  2K5N A;  2A19 A;  3L0O A;  5M5X H;  1H95 A;  1VQF A;  2PMZ E;  3I55 A;  1Q1B A;  1VQA A;  2KHI A;  5H1S E;  3PF5 A;  1R9T H;  1K8A C;  4JC0 A;  2E5L L;  4LFA Q;  3AEV A;  3PIP A;  1V43 A;  1A62 A;  2RCN A;  2K50 A;  2HIX A;  4J15 A;  5M3M G;  1A8V A;  1YIJ A;  1EFW A;  2RHQ B;  1KRT A;  1VQE A;  1I6H H;  4DV4 L;  3TRE A;  4DV7 L;  1EUJ A;  4LW1 A;  1VQ9 A;  2UXD Q;  4A3F H;  4R1J A;  1J6Q A;  4P71 A;  1A63 A;  2F3I A;  2Q2I A;  3A5Z B;  2ZTD A;  3EN2 A;  1PH3 A;  1EOV A;  2KCT A;  2JA8 G;  4DAM A;  3G71 A;  1VQM A;  5M3M H;  4LF4 Q;  4GLV B;  3U4Z A;  3W1G A;  2PNH A;  1IXR A;  2B29 A;  4MNO A;  5IT9 c;  1N33 L;  1S72 A;  3S17 H;  1G6P A;  2DUD A;  2BA1 A;  1S3O A;  1X3F A;  4UP9 A;  4GLA C;  5FJ8 H;  4BA2 I;  3STB D;  4X62 Q;  4OWX B;  1CKO A;  1I94 Q;  4DR1 L;  3KJP A;  2JA8 H;  2UU9 L;  4ME3 A;  1QVF A;  1XPO A;  4GNX B;  1QZH A;  3BZK A;  2JE6 I;  4IOC A;  2XTI A;  4JI2 L;  2A8V A;  1PV4 A;  3A74 A;  1XNR L;  3RZD H;  1PH9 A;  1J5E L;  1UE7 A;  4JBW A;  1LYL A;  1JE5 A;  1HZB A;  1PH8 A;  3TRZ A;  3E0E A;  4L5Q A;  1PH7 A;  3AFQ A;  4LF7 Q;  4YHH Q;  3GTG H;  2CWA A;  3LGJ A;  2KEN A;  1VQP A;  1XMO Q;  1Q1E A;  2Q2H A;  1KC8 C;  3ZJY C;  2JEA I;  5IYC G;  1I94 L;  4NXM L;  2GN5 A;  2ID0 A;  4LF6 L;  4LFB Q;  2L15 A;  5LMU Q;  1X6O A;  2VQF Q;  2WB1 G;  3I2Z A;  4DR5 Q;  5ELO A;  2Y0S E;  1PH2 A;  1OXU A;  4R4I A;  3J80 i;  4DUY Q;  4YCV A;  1YEZ A;  3CMA A;  5C4X G;  4A3G H;  5IYC H;  4PMW A;  3GO5 A;  1QVG A;  1NJI C;  3M3Y H;  3J80 c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...