4X64Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x64Q00
2UUBL 1P16A 3PUVA 4YCWA 1GVPA 2H5XA 2R7DA 3HKZE 2ZJPA 1QVFA 2VY3A 4BBRG 1VCIA 5C4JH 1B70B 3AFQA 3UDGA 3KF8B 4X65Q 3OTOL 3KOJA 3I56A 1X3GA 2ID0A 4OO1G 1NMGA 1SMXA 4DNIA 4YY3L 1T9HA 4A3GH 4P73A 3CCVA 1SN8A 3PUYA 4JI6Q 1UE6A 1ASZA 2JA6G 1CSQA 1PA6A 2PQAB 4B3SL 3CCSA 4AYBE 1SFOH 3CCLA 4LFBL 2VW9A 5ELOA 4A3DG 2ZM6L 2UXCQ 2D0PA 3BZKA 3M9BA 4A3EG 4B3TQ 4PZ6A 3CD6A 1Q12A 1Q1BA 5M3MH 1UEBA 1OXSC 3L7ZC 1VQMA 2UUAL 4HJ8A 1N36L 2VZAA 1U0LA 4A4IA 3I4MG 1I94L 4BXXH 4NXNQ 4IO9A 4AIMA 2VQEQ 5BR8L 2ZTEA 3EBEA 1J6QA 1MKHA 2KHIA 2AHOB 2OQ0A 3KDFB 3TQYA 1WOCA 2QA4A 4KLKA 1VQLA 1N33Q 1G51A 3GTJH 2CQOA 1XMOL 4JOIA 1OXTA 4YWMA 1PH2A 2UUCQ 4BY1H 3PO3H 2ATWA 3K80C 3CPFA 2QGQA 3G6EA 4OXPA 4A3IH 2MO0A 1S72A 5HGQA 1YHBA 2MNAA 3UE1A 1JB7A 1LM0A 3F2CA 3U58A 1YVCA 1I6HH 1YZ6A 4APVA 4POFA 4DR6L 2Z6KA 2V1CC 5GAGC 4HIOA 2LSSA 1PH1A 1TWFH 3JAMc 4HJAA 1WCMG 3U4ZA 1EIFA 1NMFA 1TWGH 3BJUA 4PMWA 4BBSG 2GVAA 2IY5B 1AE2A 3HOUG 4DR7Q 3W5OA 4AH6A 3PIOA 2E2HH 4LF9Q 2K4KA 3F2DA 3I2ZA 3S24A 4JI7Q 4JI0L 1KHIA 1L0WA 1RL2A 1B7YB 2DGYA 3RR5A 4BA2I 1VQGA 1HZAA 1E24A 3BZCA 1CKMA 1VQ4A 1L1OA 1YHQA 4TVAB 3FHWA 1UE1A 2K5HA 5GQOA 5IYDH 1Y1VH 1EIYB 1XJVA 1VQ9A 2JEAI 2E8GA 4A3MH 2JA5H 1LYLA 1IBLL 3S1NH 4JYAL 1AE3A 1HNXL 4LUZA 4A3JG 4JOIC 1YJWA 4Y52H 2ZJRA 2VNUD 4AQYQ 2R7ZG 3NENA 1X54A 1IL2A 4DV5L 2NVTH 5GAHC 3W1GA 4IFDJ 3H0GG 3K81C 4A3LG 2JA7G 1PYSB 2OWOA 2JA9A 2ZTCA 3D0FA 1E1TA 2L15A 5LMNL 1VQDA 2K75A 2A19A 3E0EA 2Z6KC 3JAMi 4YHHL 1ASYA 4A3BH 1TWHH 1HJPA 1N9WA 2HIXA 1XNQL 1PH5A 3T1YQ 1QUQB 5IP7H 3J80c 3RZDH 4LF6Q 4LFCQ 2PNHA 1TXYA 3K7UC 4DKAC 2UXDQ 3AEVA 1HZ9A 2HT1A 1XNRL 1C9OA 4DAMA 4L5TA 3CMEA 1PH8A 2R93H 2RHSB 2XGTA 4OWTB 2N8NA 1HNWQ 3W1BA 4IPHA 4IOCA 1IXRA 4C3HH 4HJ5A 4LF7Q 5C44H 1X3EA 2VUMH 2GN5A 3GDEA 4DR4Q 1YITA 4QY7A 2OQKA 1FGUA 3UDIA 3HOYH 1BKBA 1WYDA 4C3IH 1YHAA 3MEFA 1WFQA 3E9IA 3CCEA 1S40A 2UU9Q 1UE7A 4A93G 1PVOA 4R4TA 5FJ8G 4IPCA 4C3JH 4JBMA 4IJLA 4EQ5A 2Q2HA 3CCJA 4L5RC 2BA0A 3PSIA 4R4QA 4RG1A 2F52A 2Y0SE 5E7NA 5FLMH 1J5EQ 2IHFA 4B3MQ 4QGUA 4X65L 3KYHC 3CCUA 1HR0Q 2VL6A 2YV5A 1FL0A 2CKZB 2R6GA 5M5WH 5C3EH 1M1KC 1IBKQ 1X65A 3DM3A 5J3BA 2C35B 4QJFA 3PO2G 2IT1A 4LUOA 3HOVG 1L1OB 2B63H 1TWAH 2K5VA 1Q46A 5IYBH 1NY4A 4QIWE 1OXXK 2B3GA 3UE0A 4DV0Q 4HIDA 1KRSA 1V43A 1K83H 3I7FA 4P72A 1PH3A 4JI5Q 4BA1I 3CC7A 3S2DH 3EN2A 5IY0A 3S1MH 2UXCL 2Z0SA 2WB1G 1RIPA 4OO1I 1O7IA 3ZJYC 4ME3A 3S1QH 4X6AH 1LTLA 3HOZG 4X66Q 3I4NH 3S17H 1JJGA 2F4VQ 1G291 4BY7H 1E7ZA 1VQ8A 4JI1Q 4NXNL 1OTCA 1IZ6A 3EIVA 1FJGQ 1EOVA 1BVSA 4A3CG 2VQEL 4O2DA 4KI0A 4Y7NH 1XTDA 1Z9FA 1IBMQ 2HIVA 1KIXA 3CW2C 1XPRA 4GKJQ 1N33L 2ZTDA 4UP8A 2ES2A 1G6PA 4A75A 5AJ3Q 4JI4Q 4B3RQ 2UUCL 2FXQA 4P75A 4X64Q 2JQOA 1QVGA 1YI2A 2A8VA 1KAWA 3L0OA 2VQFQ 3I4MH 3S14H 2XTIA 3B6YA 1MIUA 3IRBA 3AFPA 5GADC 4DK6C 4OX9Q 1NE3A 4BXXG 4H02A 3FP9A 2GVBA 3RN2A 1YNXA 2CWAA 4DR7L 1HH2P 1PH9A 1CSPA 4LF9L 2QEXA 1D7QA 4JI7L 5IWAQ 2PI2E 3K0XA 4LFBQ 3KF6A 2A1AA 3J7A5 1JE5A 2K5NA 4R4CA 2CFMA 2KCTA 3GD7A 2WB1E 3PV0A 1XMQQ 2I5LX 4BY1G 1YEZA 1K0RA 3WWVA 1Q1EA 4A3IG 1EQRA 5IYCG 1KC8C 4NPSA 1N32Q 1Q82C 1NBWA 4BBSH 2R7FA 3CPWA 4AQYL 3HOUH 1VQHA 4GKKQ 4KHPQ 1E1OA 5DLQE 4JV5Q 1TWCH 1K73C 3UDFA 2E5LQ 2BA1A 1IYJB 1FVIA 3ER0A 3F1ZA 4JCVE 3ULJA 3PUZA 3M85A 2CWPA 2Y0SG 4GS3A 4DR1Q 1GD7A 2I5MX 2UXBQ 1N34Q 1A63A 1KQSA 4DR5Q 5JJIA 3STBC 3T1HQ 1PYBA 1MJEA 3ICEA 1Q86C 1VQ5A 3M3YH 4LF6L 4LFCL 3HOWG 4A76A 2UXDL 4A3JH 1KD1C 1WJJA 4DV4Q 4DV1Q 1Y1VG 4HJ9A 1X55A 1QVCA 1VQFA 1N8RC 2MFIA 5JEAG 1HNWL 4QL5A 2JA5G 1HNZQ 1HZBA 2AKWB 2KENA 2YTYA 3H0GH 4DV6Q 2NZHA 4GN4B 4L5SA 2JA7H 3PGZA 2JA8H 2KHJA 3LGJA 4LF7L 2K52A 3RNUA 4DUZQ 3CAMA 3CCMA 1LUZA 5M3FG 4DR4L 3RLFA 5ELNA 1XPUA 2UU9L 4LW1A 1P8LA 4IFDG 1A8VA 2DUDA 3D31A 1PH7A 2BH2A 3GTMH 4A3BG 4UP7A 2RHQB 5LMNW 3VDYA 3J81c 3H3VI 1GKHA 3DLLA 1EFWA 1VQNA 4UY8C 4K0KL 1J5EL 2F3IA 4MNOA 1GM5A 3HOXG 4POGA 4DPGA 3AQQA 4P71A 4UP9A 4LFAQ 4B3ML 1EUJA 3S16H 1HR0L 2PMZE 4A3FH 4LF5Q 1Y1WH 4J15A 3RZOH 4DV7Q 3CF5A 1I50H 2EIFA 3F2BA 3KF6B 2AWOA 5C44G 4IJHA 5LMUQ 2VUMG 4K0KQ 4DUYQ 3A74A 4OONA 2KBNA 5FLXc 2R92G 1B8AA 3Q8DA 4JG2A 5IP9H 4TQUS 4DV0L 4A3KH 3KFUA 3TS0A 2Q2IA 2NZOA 4JI5L 4GLXA 3J80i 5C0XG 4R4OA 3I4OA 1L2FA 4JI6L 5C4XH 4A3GG 2MQHA 3NEMA 4NXMQ 2EXDA 5C0XI 2JJQA 4X66L 5M5YH 1VQOA 2ZJQA 3CC2A 2NVYH 3UDXA 1K8GA 3NBHB 2JK8A 2F4VL 2I0QA 4JI1L 4JI8Q 3HOVH 1C7YA 1YJ9A 1YJNA 1FJGL 1VQJA 4BBRH 4DV2Q 3FKIG 3PUWA 2K14A 1E22A 2NN6G 1VQKA 4JI3Q 1VQPA 4B3TL 3CCRA 4DR2Q 1IBML 2ASBA 3A0JA 1X9NA 1C0AA 2WP8J 1D8LA 2RF4A 3GTLH 1X6OA 4GKJL 3GTPH 2B63G 2AWNA 4JI4L 5AJ3L 1JJCB 1SE8A 1H95A 2HHHQ 3PCOB 2JA6H 3TRZA 4LF4Q 2D62A 3HOZH 2IHEA 2N78A 1V1QA 1VQIA 4R1JA 4YWKA 4X62Q 3STBD 4X64L 4P74A 5JJLA 5H1SE 4DV3Q 4LUVA 4MTNA 2VQFL 4LF8Q 2YTVA 1R9TH 4HJ7A 4JI2Q 4A3CH 2ALYB 4A3DH 3A5ZB 3I4NG 4GLAC 4DR3Q 4C2MH 4ALPA 1W3SA 4A3EH 2PI2A 2UUBQ 4OX9L 2N49A 4BY7G 1VQAA 5EAYA 3CCQA 3S1RH 1U5KA 4GOPA 1UWVA 1W2BA 3GTKH 1V9PA 2AMCB 3RLOA 4GNXA 3OTOQ 4IOAA 1Y14B 4R4IA 1SR3A 5IWAL 5M3MG 2BH8A 1A0IA 4JC0A 4YY3Q 1OXUA 4FDBA 1JT8A 1SRUA 1XMQL 1NTGA 2K50A 3GO5A 3GTOH 1A62A 4XIGS 3CP0A 1JMCA 1VQCA 4B3SQ 3PF4A 2JE6I 1QUQA 1N32L 4NB3A 2KCMA 1PH4A 4YCUA 1VQEA 4UPAA 2LXJA 3ULLA 3HKSA 2ZM6Q 4GKKL 3HFZB 3ULPA 4KHPL 3CC4A 1CKNA 4EX5A 3I55A 4KHZA 3RN5A 3PO3G 4JV5L 3E9HA 3KLWA 2E5LL 3U50C 2N3SA 2Q2UA 2UUAQ 1WCMH 1N36Q 4DR1L 1I94Q 2UXBL 1EWIA 1N34L 1M90C 1VQBA 2E2JH 1WI5A 3TEHB 3CMAA 4DR5L 3T1HL 5BR8Q 3OW2A 1EQQA 1K8AC 1EYGA 3GTGH 5HY6A 1OXVA 5IYCH 3K7AH 1Q7YC 4RMFA 2YYZA 3CXCA 4GOPC 1XPOA 4DV4L 4DV1L 3G71A 2EQSA 4GNXC 4YCVA 1KXLA 1XMOQ 1K3RA 1PFSA 1UE5A 3RLNA 1DGSA 1HNZL 3F8TA 3OYYA 4JBWA 4MZ9A 3PF5A 4DV6L 1S3OA 2MO1A 3ERSX 3T1YL 1X3FA 3AYHB 3U4VA 3KJOA 4DUZL 4HIMA 4L5QA 1BBUA 1VS0A 5IYDG 1SLJA 2R7ZH 4DR6Q 1AH9A 1BBWA 2IX1A 1Q8KA 5JEAJ 4A3MG 4PG3A 1Q81C 3HOWH 4A3LH 1VQ6A 4HIKA 3GTQH 3L2PA 2JEBI 1YBYA 3PUXA 3TREA 2OTJA 1CKOA 4JI0Q 1YIJA 2Q2TA 4LFAL 2WAQG 3S15H 1CUKA 4GOPB 5K36G 1QZHA 2YU9H 4GNXB 4LF5L 3S2HH 2PQAA 1SROA 5M3FH 4DV7L 2NVQH 4IPDA 5IT9c 2VS1A 2JA8G 4QQBX 5IP7G 5LMUL 2LXKA 1I3QH 4LWCA 1IBLQ 4XTCS 4DUYL 1PV4A 1HNXQ 3H3VH 3HKZG 4IFDI 4JYAQ 1KL9A 3NELA 1GO3E 3G48A 3M4PA 4O0AA 3J81j 2R93G 1QZGA 1X56A 2YTXA 4DV5Q 4YWLA 3H15A 3G4SA 2NVXH 4GLVB 4GN5A 3KJPA 3A5UA 1IBKL 3M7NA 4OWXB 3HOXH 4DAYB 3CQZH 4A93H 3J7ZC 4NXML 5LMNQ 5FJ8H 4LNQA 1CKNB 1KRTA 3KDFA 4YHHQ 4OWWB 2E2IH 1VQ7A 1L1OC 4AYBG 5IE8A 3HOYG 1XNQQ 4IPGA 5GAEC 1I5FA 2OCEA 4JI8L 3SGIA 3K8AA 1PHJA 5JJKA 2I5HA 5C0XJ 4A3FG 1E3PA 4DV2L 1Y1WG 1K9MC 2R92H 1HZCA 4JI3L 1XNRQ 1HR0W 3M4OH 5M5XH 2CCZA 3JC66 4PZ7A 4DR2L 2D0OA 5GROA 1NJIC 1JJ2A 4WJ4A 5FLMG 2OTLA 1MJCA 5IP9G 2HHHL 3PO2H 4GN3B 2B29A 4A3KG 3TS2A 3BU2A 2HQLA 3J81i 4LF4L 4WJ3M 5C3EG 1PH6A 4JBJA 4X62L 4JBKA 4DK3C 4DV3L 4LF8L 2WAQE 5C4XG 2IX0A 2WFWA 1Z47A 4JI2L 2NN6I 5IYBG 2RCNA 3M4QA 3FKIH 3MXNB 4PZ8A 4B3RL 4DR3L 3PIPA
chains in the Genus database with same CATH superfamily
3PUVA 2R7DA 2ZJPA 1QVFA 1I6HB 2VY3A 4BBRG 5C4JH 3AFQA 3D6CA 1GXDC 3UDGA 2OXPA 3TMEA 1TWFB 1GUTA 1SMXA 4YY3L 1SN8A 2CH4W 3KLSX 4JI6Q 1ASZA 3A55A 2PQAB 5C4ZA 4LFBL 3HOWB 2NYZD 4A3DG 2ZM6L 4LK1C 1DD2A 5F2DA 4B3TQ 2JA5B 1Q12A 1OXSC 4IUTA 5IGBA 4N8X1 4BXXH 1D6EC 1U0LA 1I94L 4AIMA 3MWYW 2F1MA 3KBGA 2VQEQ 5J22A 3L9AX 3NK9A 1A15A 2XNAC 1G51A 3GTJH 4A3BB 1OXTA 4YWMA 1PH2A 4BY1H 2XN9C 2ATWA 3CPFA 4FP5D 3BYTB 4OXPA 2NB0A 3VR6A 2MO0A 4A3IH 2MNAA 3UE1A 2ICEC 3TP6A 1LM0A 3U58A 1HUNA 1QB5D 3NWSA 1YZ6A 1QG7A 2A73B 3OMCA 4HIOA 2QDLA 3U4ZA 1TWGH 1NMFA 4ABNA 3HOUG 3W5OA 3DWAA 1SNCA 1IYVA 2BDOA 1KHIA 1L0WA 1HZAA 3DM1A 1DJRD 4RFBA 2JSOA 1UE1A 5GQOA 1Y1VH 2XSCA 1H9RA 2E8GA 3NBHA 1A2TA 4DXGA 2SOBA 5EBCA 3FDTA 1IBLL 4JYAL 4Y52H 3OSOA 1IL2A 1X54A 1GUOA 5DM73 2NVTH 1JR0D 4A3LG 2JA7G 2EYMA 3DWQA 3I91A 5K36H 2A19A 1K83B 3NE5B 4QF4A 1ASYA 1TKWB 1HXYD 4HN7A 1U9RA 1N9WA 2Q8TA 3J80c 3RZDH 5KYIA 2PNHA 3NBIA 5CV9A 4LFCQ 3T53B 2L4NA 4DAMA 3CMEA 2R93H 1CHPD 1STYA 2K01A 2XGTA 4OWTB 1SFOB 2E76C 4C1NK 1HFNA 4IPHA 1MI2A 1IXRA 4LF7Q 1H9SA 1X3EA 2FINB 5M3MB 5I2YA 2K1BA 4EVOA 4C3IH 1UE7A 3NTIA 1A2UA 3VR5A 4EQ5A 2BA0A 4R4QA 5E7NA 1ICFB 4X65L 5KNDA 1FL0A 2CKZB 5M5WH 5I2XA 1IBKQ 3PO2G 2B2TA 3H94A 2B2WA 4KY7A 4N9PA 5E4XA 4DAVA 3JAME 5IYBH 1S4ZA 2B3GA 3UE0A 1KRSA 1Y69U 1PH3A 3CC7A 3S2DH 3J7YW 4JVZA 3BS1A 1RIPA 1O7IA 4ILWA 1LTLA 1JJGA 2JN4A 2KQ3A 1RKNA 4PV1C 4JI1Q 3EIVA 2EXZA 2N88A 4KI0A 4Y7NH 4DK1A 1O80A 1NSNS 4A3MB 2HIVA 5C5LA 1KIXA 3S1NB 3D4RA 2ZTDA 3U9OA 1G6PA 5AJ3Q 2UUCL 2FXQA 5J39A 3M3YB 2B2TC 2JQOA 1YI2A 2B2WC 5BN4A 1BF4A 2SEBD 3B6YA 1RDPD 2F0PA 4OIKA 3IRBA 3A7LA 1LTAD 2QW7A 1TWHB 3AFPA 4DK6C 4OX9Q 2QF7A 4H02A 3J81L 1YNXA 4FF4A 1A3VA 1HH2P 4XYQA 1PH9A 1ILQA 2KCCA 2PI2E 3TDQA 2CW0C 4DAYA 1JE5A 3GD7A 1DOMA 3H6MA 3J7AV 2KVMA 3I90A 4KY6A 5T1GA 2A5HA 3DMUA 1KC8C 1N32Q 1LTTD 3S16B 1EYAA 4NKLA 3V96A 1VQHA 4KHPQ 1E1OA 5DLQE 1TWCH 1IYJB 4QUFA 3QIAA 3PUZA 4FNFA 3M85A 4GS3A 2EYLA 1BBXC 2UXBQ 1WD0A 2EYFA 1VQ5A 1PRTD 3TP7A 4KD4A 4LF6L 3HOWG 4GZYC 1BR9A 2UXDL 4A3JH 4DV1Q 2BCOA 1X55A 1HFGA 3GV6A 5JEAG 1HNWL 4QL5A 2JA5G 2YTYA 3H0GH 1LACA 5NUCA 2NZHA 4DV6Q 4QUCA 2KHJA 4DUZQ 3VYTA 4HSPA 1GJXA 3S17B 1XPUA 2UU9L 1P8LA 3DWPA 2JA6B 1BNZA 1A8VA 4A3BG 4UP7A 1RTOA 5DM63 1GKHA 3DLLA 1EFWA 4UY8C 3RUZA 1J5EL 4MNOA 3TP8A 4HCSA 4DPGA 3AQQA 4PMCA 2XVSA 2DY7A 3J7AF 4J1MA 1XYIA 1V8QA 4A3FH 2X6GA 2R61A 3KF6B 4TRDA 1CQVA 3P1HA 2AWOA 5A2QL 2EJGC 3NTKA 4L63B 4OONA 1CHQD 4JG2A 5IP9H 2XRSD 4KJOA 1YNJC 2Q2IA 4JI5L 3J80i 1DONA 1PMRA 4JI6L 3UI2A 3NEMA 4K14A 1VQOA 1EYDA 2A6ED 3UDXA 1K8GA 1HHVA 4OHJA 2I0QA 1SNQA 1AW7A 2FHTA 2K14A 4H13C 2JP1A 2NN6G 1AZQA 3Q23A 4IUUA 4B3TL 1X9NA 4OO1H 1X6OA 3GTPH 2AWNA 2K04A 1SAPA 2E2JB 1H95A 3PCOB 3SEBA 2D62A 1J9OA 2A69D 1STAA 2F0OA 3HOZH 2IHEA 1V1QA 4X62Q 3STBD 4HMJA 4LUVA 1KTKA 2L0CA 3VYSA 2ALYB 3A5ZB 3H3VC 3KUPA 4DR3Q 4ALPA 4A3EH 3ND8A 1UWVA 3OOCA 2JYOA 2R7ZB 4GNXA 5IWAL 5K5PA 5M3MG 1WTXA 2F0WA 5CGKA 4YY3Q 3A8JE 4FDBA 1JT8A 1NTGA 2K50A 5EKLA 5IGCA 3GTOH 2VXWA 3X3NA 3CP0A 1STBA 1QOHA 1QUQA 2I46A 2TMPA 1QILA 1PH4A 3S15B 1Y8OB 4UPAA 3ULLA 4WFN3 2ZM6Q 3GTMB 1RODA 3HEJA 2E5LL 1E0BA 2C5CA 2RCFA 1K28A 4RGTA 4J6HA 2N3SA 1WCMH 2BOSA 1I94Q 4HEDA 5IODA 1VQBA 1WI5A 1K8AC 3T1HL 5FLXE 3OW2A 5I6YA 4FYDA 4KK7A 1Q7YC 1OXVA 4J8QA 3CQZB 1D5ZC 4A93B 4DV4L 4GNXC 1KXLA 2F0LA 1O78A 1K3RA 1PFSA 1UE5A 3NWTA 4KTAA 1Q8IA 5I9PA 1HNZL 4JBWA 3PF5A 3MTSA 2MO1A 1B3AA 4MN3A 1X3FA 3U4VA 1PTOC 1C48A 2DJGC 3MAQA 1AH9A 4A3MG 5FO7B 3CKIB 4PG3A 2F0DA 2KEDA 2F0EA 3D3RA 3L2PA 3WDNA 3QOLA 1B53A 3V2TA 1YBYA 3PUXA 3QB3A 2LFNA 3VYUA 1LTRD 1TY2A 5EJWA 3OPOA 1QZHA 4LF5L 2G9DA 2RDGA 1LABA 1SNOA 5C4JB 3H3VH 1IBLQ 4XTCS 4DUYL 4JYAQ 2NZ1D 4RHSA 1STEA 2YTXA 4C2MB 4RAUC 1IBKL 1JOKA 1WTHA 1SJHD 2L9HA 2K5DA 1R4PB 4ZLTF 4IPGA 3E6ZX 3MXUA 4FF3A 2I5HA 2CVRA 2R92H 5CMDA 5C5MA 4EQPA 5BN5A 2A68C 2CCZA 3JC66 3NHHA 1NJIC 1ENAA 5ELEA 1SXTA 1VF5C 2HHHL 3K57A 4LF4L 2HQLA 1GOZA 3DXJC 1SNPA 4U673 2DN8A 2WAQE 2IX0A 4BY1B 2OT2A 1MHWC 3MXNB 4PZ8A 1DXMA 3JAML 3S14H 4RKLA 2UUBL 4A3IB 1EQVA 1LLRD 1HQRD 4YCWA 1F2ZA 3MVVA 1VCIA 3GP7A 3HP3A 1EY5A 3KF8B 4X65Q 1PRTC 5ELBA 1X32A 1PTOH 2ID0A 1SYGA 1T9HA 2J7ZA 3CCVA 3PUYA 2JA6G 3EFXD 1ILPA 1TS5A 4G57A 2ICIA 4B3SL 3CCSA 4LMQD 1ZYRC 4AYBE 3CCLA 1SMYC 5ELOA 3IFTA 1CT1D 1Y1VB 5IGEA 4PZ6A 3CD6A 1Q1BA 5I4DA 1UEBA 1S5FD 4ZK9B 2UUAL 2R3ZA 3QR8A 1N36L 2YU9B 4XQQA 3KDFB 1SE3A 3CHBD 3TSSA 3SK8A 3EVQA 2UUCQ 1X3QA 5HGQA 1JC7A 4K5WA 1L0YB 4JK1C 4APVA 4POFA 2Z6KA 2V1CC 3OMGA 2LSSA 1L0XB 1U4RA 1EIFA 4PMWA 1T5EA 1XTCD 2IY5B 4AH6A 2E2HH 5M5XB 3M4OB 3S24A 4C3IB 1G8ZD 1EY8A 1RL2A 2WV6D 1VQGA 1E24A 1PFNA 3BZCA 1L1OA 2K05A 1EIYB 2JEAI 1S5DD 2HUGA 3SXHA 1ET6A 4DK0A 2R7ZG 1DOKA 4K2LA 1SNDA 1RCVD 3W1GA 1TT2A 1YNNC 3K81C 4FXGC 1IW7C 3Q0AA 1PYSB 2OWOA 1O7YA 2ZTCA 1AEXA 3E0EA 1GUNA 2Z6KC 4V190 4IFDH 1ZEQX 4YHHL 4A3GB 1V1PA 3I3CA 2HIXA 1XNQL 3T1YQ 5IP7H 4LF6Q 3A54A 1TXYA 3NTHA 4OEMB 2UXDQ 3AEVA 1F2MA 2HT1A 2RHSB 4HTHA 1HNWQ 1EZ6A 4RHRA 1LO5D 4C3HH 5C44H 4Y7NB 2WKDA 3HG9A 5EGTA 3HOYH 1BKBA 1WYDA 3BYYB 1YHAA 3MEFA 2UU9Q 1S40A 4A93G 4JBMA 5IOCA 3S9WA 4IUVA 3PSIA 1WD1A 2Y0SE 5FLMH 1J5EQ 3HZXA 2F3WA 4MHEA 2VL6A 4CHTB 3PO3B 3FPUB 1H9JA 2B63H 1Q46A 4OIJA 4DAPA 5FK9C 4IURA 2XWBB 4P72A 4JI5Q 4BA1I 3S1MH 2UXCL 2Z0SA 4FXDA 3FRPB 4C1NI 4Q0FA 1STNA 2CHBD 1E2ZA 3K0YA 1G291 4BY7H 1VQ8A 3QWNA 4A3CG 4O2DA 1TWCB 3E0JA 5EPKA 5CBEE 2F0VA 1XPRA 1N33L 2ES2A 2Q8RE 1BCPC 3FVQA 3ERQA 1G6ZA 1QVGA 2A8VA 4N8FA 2MGSA 3R8BA 2WAQB 2K6AA 1H9SB 1JWUD 1CK1A 2EJFC 1JB3A 2XTIA 3T4AC 1MIUA 4DN4M 3J80E 5E3FA 3H0GB 2XWJB 5ISRA 5GADC 1NE3A 4BXXG 2P5ZX 3PIP3 4DR7L 1FGBD 1CSPA 3ONAB 5IGFA 2QEXA 5IWAQ 4G7ZC 3J7A5 2A1AA 1STHA 3SE0A 3TZDA 2B2UA 2WB1E 3PV0A 1V1OA 3MFGA 2I5LX 4BY1G 1YEZA 4RGMA 4G7HC 1ESRA 3WWVA 1Q1EA 4A3IG 3FPPA 4AYBB 5FLXL 2B8FA 1AN8A 1S5BD 2KOLA 1Q82C 1NBWA 2R7FA 2L12A 3CPWA 4A3FB 4AQYL 3HOUH 3K5MA 4OGQC 1LTSD 5C3WA 2E5LQ 1JWSD 1FVIA 2BA1A 3ULJA 2F0JA 1PZJD 1TVXA 2H4OA 2CWPA 3AU7A 4XQNA 1GD7A 5C3EB 3T1HQ 3ICEA 1MJEA 2O4XA 4NDXA 1M4VA 2VB2X 4ZAIA 4DV4Q 1Y1VG 1VDZA 4HR7B 2CQAA 2MFIA 1F9RA 2A6HC 1GHJA 1HNZQ 1UAPA 2AQ3B 2AKWB 2KENA 1EEFD 4GN4B 2JA7H 4TKOB 2B2UC 1LTID 2JA8H 3LGJA 1B50A 3RNUA 1SE4A 3FEWX 5CC4A 3RLFA 4N9TA 1F9QA 4U68A 4IQZA 4K8JA 3RD4A 5JPMC 2I07B 4XT1B 4EQNA 2RHQB 1K8MA 1GM5A 4P71A 4UP9A 4B3ML 1NUCA 3T51B 2EYOA 1HR0L 4CJ0B 1EIHA 2PMZE 4A3EB 4LF5Q 3RZOH 3OWEB 2N55A 2EPBA 2F03A 1ESFA 3NSWA 2AQ2B 1STGA 3I4MB 1B9NA 4DUYQ 2KBNA 2EY5A 1B8AA 2LY7A 4DV0L 4A3KH 4V0BA 3CU7A 3KFUA 1RJTA 4C3IG 4CJ1B 4GLXA 3RMHA 1PZID 5C4XH 1KDAA 2EXDA 2JJQA 4X66L 2ZJQA 2Z8LA 4ULLA 2MUYA 1C7YA 1YJ9A 1FJGL 1EYCA 1IBML 1C0AA 1D8LA 1WCMB 3GTLH 2K33A 3QJYA 4BBSB 4HCEA 1SE8A 2HHHQ 4LF4Q 4A3GG 4YWKA 4OELB 4MTNA 2VQFL 2QDBA 1PFMA 1TS2A 2HCCA 5D65A 2UUBQ 1B4OA 1VQAA 4ODGA 1HPCA 3CCQA 1U5KA 3R93A 1V9PA 3RLOA 2RKSA 1MBYA 2LMCB 1SR3A 3NQTA 2K5WA 4JC0A 2EOTA 1SRUA 1A62A 2F4IA 1BUVT 4B3SQ 3PF4A 4NB3A 2B2VC 4CDFC 5IT9E 1SYDA 3HKSA 1FNUA 3HFZB 3CRLC 4G4KA 3PO3G 3RN5A 4JV5L 4CKCA 4B08A 5J1ZA 3CRKC 3TBIB 2Q2UA 4CKEA 2UUAQ 1N36Q 3VR4A 4DR1L 2J0TD 1EWIA 1N34L 4O42A 4DR5L 3TEHB 1EYGA 1K8OA 1HQMC 1I50B 4ID6A 5KYLA 5HY6A 3GTGH 2YYZA 3CXCA 1XPOA 2KCNA 2HDLA 2BE5D 2RA4A 1DGSA 1SYEA 3OYYA 2FJ2A 3K6OA 3P75A 1BOSA 3T1YL 3KJOA 4KJNA 1VS0A 5IYDG 5M5YB 1Q8KA 2NVYB 4L6TB 3H91A 1M8AA 3HOWH 2RDFA 3U9SA 1CTMA 3HOVB 1EU3A 1ZKOA 3VA7A 3GTQH 3LNNA 2G9HD 2Q2TA 2WAQG 2WB1B 4GNXB 1SROA 2F0SA 2K32A 2VS1A 5IT9c 2F0NA 2HDMA 2RQXA 5G3LF 1C8CA 5LMUL 2HQEA 1CZWA 1I3QH 4LWCA 5HGTA 1PV4A 3SR1A 1PTOB 4CKBA 2IJ0A 2NBFA 1LTBD 3VYRA 3ZYYX 3I8ZA 4K8IA 4F8MA 3KJPA 4O1NA 1FNWA 2NVXH 4OWXB 3S1RB 4NXML 1B44D 2OF1A 2F0IA 5FJ8H 4LNQA 1KRTA 4YHHQ 4OWWB 2F0HA 4AYBG 1XNQQ 5GAEC 1CQFA 1I5FA 3SGIA 5JAVA 3K8AA 1PHJA 5JJKA 5C0XJ 4A3FG 1E3PA 1I4GA 4IN3A 1RHPA 4DFAA 1HR0W 4DR2L 3BVZA 1SYBA 5IP9G 4GN3B 2B29A 3TS2A 4WJ3M 4XQJA 5C3EG 3KLRA 2F3VA 3OIQA 4B9XA 4DV3L 2NN6I 2RCNA 3M4QA 4LJZC 2SNMA 4RG1A 2NN6H 4DU9A 1D2BA 3HRZC 1F2YA 2A74C 2H5XA 4X3SA 1F9PA 2F0KA 1B70B 2AQ1B 3KOJA 3I56A 2KUMA 2PMZB 1X3GA 2B39A 5EBDA 3MZ5A 1Z7TA 1A3TA 4OO1G 4DNIA 4DNRB 4P73A 4FXKC 2AUKA 4LAAA 2E2HB 1CSQA 1EU4A 1SFOH 5JJZA 2QKIC 5I9OA 4ZRZA 5G3LD 2VW9A 2L11A 1IHZA 2UXCQ 4WJWA 2O2LD 4X3TA 4A3EG 1F2LA 3VR2A 4R8NA 1IL8A 5M3MH 3V05A 3DEOA 3DUZA 3L7ZC 1VQMA 4HJ8A 3I4MG 2FFKB 1DCZA 2KJXA 4IO9A 4DXFA 3S2HB 5M3FB 5BR8L 2NVQB 3J80L 1J6QA 1MKHA 2OQ0A 1BXTA 2AHOB 4IUPA 3TQYA 4KLKA 1SBBB 1N33Q 5LL6X 1XMOL 5M9OA 2KEEA 3BVGA 3K80C 3HOXB 1S72A 3TN2A 1YVCA 1GUWA 2E2IB 4EGVA 1PH1A 4RWSC 4HJAA 1WCMG 5C44B 2RDHA 3I73A 1OO9B 3FMCA 4BBSG 2GVAA 1AE2A 4DR7Q 3PIOA 3F2DA 1GHKA 4JI0L 3RR5A 1B7YB 2DGYA 2X6LA 1CKMA 2NUCA 1YHQA 4TVAB 3FHWA 1VQ9A 2ZXRA 4A3MH 1LYLA 3S1NH 1QNKA 1YJWA 2VNUD 3FKIB 4AQYQ 3NENA 4DV5L 5GAHC 4KKUA 3N52A 1GUGA 3MC0B 4H0LC 3K5OA 2JA9A 2B63B 4NP5A 3D0FA 1E1TA 2L15A 2K7VA 2K75A 4XDXA 4IZ8A 3JAMi 1TWHH 1HJPA 3S1MB 1DM0B 4CDEC 3SDZA 1PH5A 4CDDC 3K7UC 4DKAC 2MPMA 1HZ9A 4WRDA 1C9OA 1XNRL 1ENFA 1PH8A 4FF2A 1D1IA 1SE2A 2N8NA 3C3LA 1E2WA 4BY7B 1KLGD 4IOCA 2F0MA 3BVMA 3LWEA 4HJ5A 4IUQA 5A35A 1WTWA 2GN5A 2VUMH 2PW7A 2TSSA 3GDEA 5COYA 2OQKA 3D4DA 2CH4A 1H9MA 2Q8IB 1EFID 1WFQA 1HA6A 1SEBD 4R4TA 5CYUA 1FD7D 4C3JH 4IJLA 4ZQ3A 3CCJA 4YIJA 2RSOA 1BO0A 2F52A 2IHFA 3S14B 4B3MQ 3GTJB 4QGUA 3N6RA 4DGZA 2IL8A 3KYHC 3CCUA 1HR0Q 3I70A 2YV5A 2ZXOA 1M1KC 1X65A 3DM3A 2C35B 4QJFA 3I4LA 3HOVG 1L1OB 1TWAH 1PYWD 1NY4A 4ZKCB 4DV0Q 4HIDA 1V43A 1TWGB 5IY0A 3PQIA 3T56B 4I7AA 2WB1G 4P2CB 3TP5A 1NCVA 2ZXPA 3ZJYC 3S1QH 4X66Q 3I4NH 3S17H 1NR4A 2E74C 1FYCA 4NXNL 1IZ6A 2L5TA 1FJGQ 5EKIA 1XTDA 1V1PB 1IBMQ 1HTLD 5KNBA 3CW2C 5E4WC 4UP8A 1WTPA 4DF7A 2NVTB 1ML0D 1TU2B 3SK6A 3F2UA 5FO9B 1KAWA 3L0OA 2VQFQ 4KN7C 4I65A 2SNSA 3MA2B 4KD3A 3SVMA 2JA8B 3KBXA 3VR3A 3RZDB 2GVBA 2RBMA 2CWAA 5KIXA 2E2DC 2R93B 3LX0A 4LF9L 4JI7L 3K0XA 4NMZA 4R4CA 2CFMA 3SK5A 4K6DA 2A6EC 1S5CD 1BCPB 4ZUJA 5IYCG 4FF1A 2XIWA 3A8KE 3RZOB 5T1IA 4I7ZC 4RKBA 4M1UB 1TR5A 2MP1A 4JV5Q 1K73C 3UDFA 3ER0A 3F1ZA 2H1EA 4JCVE 5D14A 2PZUA 4X3KA 1LT5D 4A3KB 4DR1Q 2A69C 1N34Q 5M5WB 3MEHA 4DR5Q 3STBC 1PYBA 3EROA 4KY5A 1Q86C 2B2YA 4IUNA 5C4XB 4A76A 1KD1C 1WJJA 3EQLC 5BN3A 1VQFA 1EEID 3I72A 4L5SA 3S2DB 5I6WA 3PGZA 3KF8A 2K52A 1EIGA 2LKVA 3CAMA 2KA7A 3D8GA 2NWGA 5M3FG 4DR4L 4QCLA 5ELNA 1MSGA 4OL7A 4LW1A 4NW2A 4M8AA 4IFDG 1QCBD 2BH2A 3OHXC 3GTMH 3K5LA 4ZYSA 3VDYA 3AB9A 3J81c 2F3IA 3HOXG 4POGA 5DEHA 4TSSA 1D1KA 4KMUC 1Y1WH 1ONLA 2Z6BA 2B2YC 3F2BA 5FKAC 4IJHA 5C44G 5LMUQ 1CI3M 3Q8DA 2AUJD 3W3AA 2NZOA 4UHVA 5C0XG 2CW0D 4CGYB 2PZTA 3I4OA 4NXMQ 2X69A 5C0XI 1EZ8A 3CC2A 1WVLA 1CA5A 2F4VL 3NBHB 4BBRH 5CV4A 1KABA 3FKIG 3Q24A 1VQKA 1VQPA 3R2IA 4BS9A 1MD2D 4DR2Q 2ASBA 3A0JA 4GKJL 2B63G 4JI4L 1WTQA 3TRZA 1D5XC 3GTGB 3D4WA 4X64L 4K6LA 1VQIA 2HCIA 4R1JA 5JJLA 5H1SE 4DV3Q 1PXUA 4XXEA 1R9TH 4A3CH 4A3DH 2F0TA 3SK4A 1Q3LA 4GLAC 3DEPA 3MHBA 1U4LA 4C2MH 4BY7G 2N49A 2NTTA 1WTVA 4A3JB 4WORA 4GOPA 1W2BA 3GTKH 2AMCB 1B9MA 1DYQA 1PZKD 2M2LA 1BDOA 4MTKA 2EVBA 1IKMA 1OXUA 1XMQL 3GTQB 3GO5A 1JOOA 4XIGS 3ND9A 1VQCA 2JE6I 2KCMA 4YCUA 1VQEA 4RGNA 1G91A 4GKKL 3ULPA 2KHSA 3CC4A 1CKNA 3EJIA 3I55A 4KHZA 3E9HA 1I3QB 1C4QA 1E2VA 3U50C 4K5XA 2HD3A 2NVXB 5BR8Q 1EQQA 3K7AH 1YNJD 4GOPC 3DHQA 1XMOQ 1JICA 3RLNA 4MZ9A 1EQTA 1RF2D 3ERSX 2DJFC 3LWUA 4KKSA 1DOLA 4HIMA 4L5QA 1BBUA 1BBWA 2IX1A 2K28A 3OW7A 4A3LH 5C6AA 1PTOF 1EY6A 1Y8NB 5EPLA 5CV7A 4RCNA 2DY8A 3BDLA 3TREA 4JI0Q 3GTPB 1YIJA 4LFAL 1KAAA 5K36G 2YU9H 2PQAA 4DV7L 3HOZB 1TIID 2JA8G 3SHLA 3WOEA 2O5JC 1SYFA 2LXKA 1JQYD 4K0KL 4F7XA 1KL9A 1HTPA 1GO3E 3M4PA 3J81j 2R93G 3GV3A 1X56A 1QZGA 5C4HA 4DV5Q 3HGBA 5DNFA 2Z4HA 5FOBB 3G4SA 1H9KA 3P7JA 4GLVB 4GN5A 3A5UA 1ICWA 4DAYB 3J7ZC 2SDFA 1HA5A 5HURA 3MXPA 1AP0A 2OCEA 4JI8L 3GTOB 4DV2L 1S5ED 4RA8A 4JI3L 1XNRQ 3M4OH 5CV6A 5M5XH 4PZ7A 2D0OA 5GROA 1JJ2A 3X3MA 2PCFB 1R4QB 2OTLA 1MGSA 2WIIB 3PO2H 4K2KA 4A3KG 3J81i 2ENBA 5DAUA 1PH6A 2MHVA 1D5MC 2JXMB 4JBKA 3Q6SA 4DK3C 5CR3A 4LF8L 5C4XG 2B2VA 2WFWA 1Z47A 4JI2L 5IYBG 3NUCA 4RGOS 1P16A 3NPPA 3AMUA 3MXGA 1GVPA 3HKZE 1U4PA 3NXWA 1PTOD 3OTOL 2QEJC 1NMGA 1VMCA 4A3GH 4Z9CB 2EYHA 3QO2A 1UE6A 1RD9D 1B1ZA 2Y0SB 1PA6A 1PRTF 1J8IA 4HSVA 5KGUA 3R2TA 5D3IB 2VB3X 3M7GA 2O5IC 1LV9A 2D0PA 4R9WA 3BZKA 3G6JB 3M9BA 2L1BA 5EPJA 2F0GA 2IWHA 2GA4B 1B2TA 1UNSA 5FO8B 2VZAA 4A4IA 2EZVA 4NXNQ 2K03A 2ZTEA 3EBEA 2KHIA 1WOCA 2QA4A 1VQLA 5KNCA 1G2SA 1XWEA 2CQOA 4BWGB 4JOIA 1QJOA 3PO3H 1UUPA 1LT4D 2QGQA 3G6EA 1YHBA 1JB7A 3F2CA 5IIFA 3HS0C 1I6HH 5D3DA 1AZPA 1U4MA 4DR6L 1XXGA 4PMBA 5GAGC 2A68D 2DNEA 1TWFH 3JAMc 3BJUA 3OWFA 3R3OA 2VUMB 1I4RA 2R92B 1LT3D 2PO4A 5C3XA 1SNMA 1Q90A 4LF9Q 1KDCA 2K4KA 3I2ZA 4JI7Q 2LS01 4BA2I 4E6IA 1KNAA 4C3JB 1VQ4A 3A8IE 3L3OC 1A6XA 2K5HA 1EY0A 5IYDH 5LHY1 1XJVA 1LTGD 5JEAH 2JA5H 1AE3A 1HNXL 4LUZA 4A3JG 4JOIC 2ZJRA 2F0QA 4IFDJ 1JOQA 3H0GG 1QWYA 2E75C 2V4DA 1TWAB 5LMNL 1VQDA 4A3BH 1DZ1A 3C1EA 3E3XA 1ZYRD 1QUQB 4F87A 3EA6A 1QNUA 5ELDA 1SMYD 5CV5A 3S1QB 4L5TA 3I4NB 5CORA 2QCPX 3W1BA 1I6VC 1EL0A 2RSNA 1O7ZA 3NP8A 3BG3A 4DR4Q 1YITA 4QY7A 3UDIA 1FGUA 1IKLA 1JE4A 1PVOA 3WOFA 3CCEA 3E9IA 3BDCA 1TY0A 2D2CC 4IPCA 5FJ8G 4FO2A 2Q2HA 4L5RC 1UEAB 2WINB 3VA5A 2R6GA 5C3EH 1K3BC 5J3BA 1G2TA 2IT1A 4LUOA 4EQOA 2K5VA 5ELFA 4QIWE 1OXXK 2MJ8A 3KLSA 1K83H 3I7FA 1O7LA 3EN2A 3E5SA 3K59A 4HMIA 3ITPA 4OO1I 4X6AH 1W6KA 4ME3A 5JVG3 3HOZG 4JPBW 5JPNC 2F4VQ 1E7ZA 3C1FA 1OTCA 1BVSA 1EOVA 1EY7A 2VQEL 1I4PA 1KLUD 1Z9FA 4ZUIA 1JWMD 1ZXTA 4K5VA 1NR2A 1YNND 4GKJQ 2M9VA 1IW7D 1GUSA 4RCOA 4A75A 4JI4Q 2XRQD 5IGGA 4B3RQ 2C9OA 1JORA 4P75A 1NNXA 4X64Q 1PRTB 1NAPA 4PQXA 3I4MH 4ZCKA 1X3PA 5EQ0A 4C56C 1BCPF 2EE1A 2EYPA 3C2PA 3PMFA 3FP9A 3HKZB 1TQOA 3RN2A 1D7QA 1BQQT 4LFBQ 3KF6A 2K5NA 4C3HB 2KCTA 1PDQA 1XMQQ 1I4QA 2QILA 4X3UA 1K0RA 4UDUC 1TS3A 1EQRA 3HOYB 2EY6A 4NPSA 4Q5VA 1ENCA 4QMGA 3BZDB 1Z6HA 3H09A 4BBSH 1Y1WB 4GKKQ 4G7OC 3A7AB 2OEOA 1Y8PB 1VMPA 2Z4IA 2Y0SG 1I4XA 2I5MX 1A63A 1KQSA 3T16A 5JJIA 4UAIA 1I4HA 3M3YH 4LFCL 4B9WA 4MIUA 1W6JA 1PFBA 4HJ9A 1QVCA 1N8RC 4CJ2C 2PW5A 1HZBA 4CDCC 3M4YA 4KV6A 4BBRB 4LF7L 1A3UA 3CCMA 3OIPA 1LUZA 2DNCA 1FNVA 1CZGA 1FR3A 1PLFA 4FVMA 4RH6A 3D31A 2DUDA 1PH7A 4ME5A 5LMNW 3H3VI 3G7LA 1BCPD 1VQNA 1R9TB 5EKKA 4LFAQ 4A3DB 1EUJA 3PIO3 3S16H 1WTOA 4J15A 4DV7Q 1EY9A 3NQIA 2EJMA 2Z9HA 2IX3A 3CF5A 1I50H 2EIFA 3BDOA 3GTKB 2VUMG 4K0KQ 2PYKA 3A74A 1XX8A 5FLXc 2R92G 4TQUS 5IGDA 4KHVA 3TS0A 5ELCA 4R4OA 2BE5C 5CV8A 4C3JG 1L2FA 1CM9A 1EOTA 2MQHA 2M00A 2FMMA 5M5YH 4XYOA 2NVYH 2JK8A 4DNTB 4JI1L 4JI8Q 3HOVH 1YJNA 1VQJA 4DV2Q 3PUWA 1E22A 4JI3Q 3IL8A 3CCRA 2WP8J 2RF4A 1AFPA 1RTNA 1EY4A 1JJCB 2ZT9C 2KECA 5AJ3L 3HOUB 4PNYA 1SJED 2JA6H 3K7AB 2F0UA 2N78A 4XT3B 5L37A 2WACA 4P74A 4LF8Q 2YTVA 1HUMA 4HJ7A 4JI2Q 1KNEA 3I4NG 1W3SA 2A6HD 2PI2A 4OX9L 5EAYA 1MSHA 3S1RH 1LT6D 1CA6A 3O13A 2PQEA 1SSOA 3OTOQ 4IOAA 1EWHA 1Y14B 4R4IA 2BH8A 1A0IA 2EY1A 2JA7B 2BDNA 1JCKB 3TZUA 5IT9L 1WTRA 2L55A 1JMCA 4QIWB 3A56A 4CBVA 1N32L 5KRUA 3J81E 1HCZA 2LXJA 4S3SA 5JVH3 4JW0A 4KHPL 3MFYA 4EX5A 1ET9A 3KLWA 2FMCA 3K5NA 1TS4A 4H7BA 1F77A 5LL6S 2UXBL 1M90C 4R8IA 2E2JH 3CMAA 2IPKD 1KDBA 5IYCH 2F0FA 4RMFA 3QG1A 5CBAE 4DA2A 4DV1L 3G71A 2EDGA 2EQSA 4YCVA 2EYJA 4HAEA 4QB4A 3F8TA 4H44C 4DV6L 1S3OA 2IW3A 4ZKBB 3AYHB 3W2DA 4DUZL 1B3QA 3MXNA 1T5XD 3P20A 2RVLA 1SLJA 2R7ZH 4DR6Q 2D9UA 5JEAJ 3PO2B 1Q81C 1VQ6A 4HIKA 1SYCA 2JEBI 1QE6A 2NTSA 2OTJA 5TSSA 1CKOA 3GTLB 4KKTA 2Z1CA 3S15H 1CUKA 2K5QA 4GOPB 5JOBA 3S2HH 1F9SA 3URYA 5M3FH 2NVQH 4IPDA 1K0SA 2PNRC 4QQBX 5IP7G 4IFDI 1HNXQ 3HKZG 3NELA 3G48A 4O0AA 5KEEA 1CFMA 4YWLA 3H15A 2D5DA 1VF7A 4IALA 3M7NA 3IFDA 2J4XA 3HOXH 4C3HG 3CQZH 3GQBA 4A93H 4F88A 5LMNQ 1CKNB 3KDFA 5AFWA 2E2IH 5A2QE 1VQ7A 1L1OC 5IE8A 3HOYG 5E1FA 1EWCA 3IAYA 1Y1WG 1K9MC 1HZCA 4L8JA 3Q22A 2B8GA 3T13A 1HRJA 3IKJA 4WJ4A 3KK7A 5C0XH 1IYUA 5FLMG 1MJCA 3K58A 2PZWA 2PPBC 3C46A 3BU2A 2G5DA 3D6WA 4JBJA 2WKCA 4X62L 2EY2A 3QOJA 4KN4C 1II3A 1SDFA 3FKIH 4B3RL 4DR3L 3PIPA
chains in the Genus database with same CATH topology
2UUBL 1P16A 3PUVA 4YCWA 1GVPA 2H5XA 2R7DA 3HKZE 2ZJPA 1QVFA 2VY3A 4BBRG 1VCIA 5C4JH 1B70B 3AFQA 3UDGA 3KF8B 4X65Q 3OTOL 3KOJA 3I56A 1X3GA 2ID0A 4OO1G 1NMGA 1SMXA 4DNIA 4YY3L 1T9HA 4A3GH 4P73A 3CCVA 1SN8A 3PUYA 4JI6Q 1UE6A 1ASZA 2JA6G 1CSQA 1PA6A 2PQAB 4B3SL 3CCSA 4AYBE 1SFOH 3CCLA 4LFBL 2VW9A 5ELOA 4A3DG 2ZM6L 2UXCQ 2D0PA 3BZKA 3M9BA 4A3EG 4B3TQ 4PZ6A 3CD6A 1Q12A 1Q1BA 5M3MH 1UEBA 1OXSC 3L7ZC 1VQMA 2UUAL 4HJ8A 1N36L 2VZAA 1U0LA 4A4IA 3I4MG 1I94L 4BXXH 4NXNQ 4IO9A 4AIMA 2VQEQ 5BR8L 2ZTEA 3EBEA 1J6QA 1MKHA 2KHIA 2AHOB 2OQ0A 3KDFB 3TQYA 1WOCA 2QA4A 4KLKA 1VQLA 1N33Q 1G51A 3GTJH 2CQOA 1XMOL 4JOIA 1OXTA 4YWMA 1PH2A 2UUCQ 4BY1H 3PO3H 2ATWA 3K80C 3CPFA 2QGQA 3G6EA 4OXPA 4A3IH 2MO0A 1S72A 5HGQA 1YHBA 2MNAA 3UE1A 1JB7A 1LM0A 3F2CA 3U58A 1YVCA 1I6HH 1YZ6A 4APVA 4POFA 4DR6L 2Z6KA 2V1CC 5GAGC 4HIOA 2LSSA 1PH1A 1TWFH 3JAMc 4HJAA 1WCMG 3U4ZA 1EIFA 1NMFA 1TWGH 3BJUA 4PMWA 4BBSG 2GVAA 2IY5B 1AE2A 3HOUG 4DR7Q 3W5OA 4AH6A 3PIOA 2E2HH 4LF9Q 2K4KA 3F2DA 3I2ZA 3S24A 4JI7Q 4JI0L 1KHIA 1L0WA 1RL2A 1B7YB 2DGYA 3RR5A 4BA2I 1VQGA 1HZAA 1E24A 3BZCA 1CKMA 1VQ4A 1L1OA 1YHQA 4TVAB 3FHWA 1UE1A 2K5HA 5GQOA 5IYDH 1Y1VH 1EIYB 1XJVA 1VQ9A 2JEAI 2E8GA 4A3MH 2JA5H 1LYLA 1IBLL 3S1NH 4JYAL 1AE3A 1HNXL 4LUZA 4A3JG 4JOIC 1YJWA 4Y52H 2ZJRA 2VNUD 4AQYQ 2R7ZG 3NENA 1X54A 1IL2A 4DV5L 2NVTH 5GAHC 3W1GA 4IFDJ 3H0GG 3K81C 4A3LG 2JA7G 1PYSB 2OWOA 2JA9A 2ZTCA 3D0FA 1E1TA 2L15A 5LMNL 1VQDA 2K75A 2A19A 3E0EA 2Z6KC 3JAMi 4YHHL 1ASYA 4A3BH 1TWHH 1HJPA 1N9WA 2HIXA 1XNQL 1PH5A 3T1YQ 1QUQB 5IP7H 3J80c 3RZDH 4LF6Q 4LFCQ 2PNHA 1TXYA 3K7UC 4DKAC 2UXDQ 3AEVA 1HZ9A 2HT1A 1XNRL 1C9OA 4DAMA 4L5TA 3CMEA 1PH8A 2R93H 2RHSB 2XGTA 4OWTB 2N8NA 1HNWQ 3W1BA 4IPHA 4IOCA 1IXRA 4C3HH 4HJ5A 4LF7Q 5C44H 1X3EA 2VUMH 2GN5A 3GDEA 4DR4Q 1YITA 4QY7A 2OQKA 1FGUA 3UDIA 3HOYH 1BKBA 1WYDA 4C3IH 1YHAA 3MEFA 1WFQA 3E9IA 3CCEA 1S40A 2UU9Q 1UE7A 4A93G 1PVOA 4R4TA 5FJ8G 4IPCA 4C3JH 4JBMA 4IJLA 4EQ5A 2Q2HA 3CCJA 4L5RC 2BA0A 3PSIA 4R4QA 4RG1A 2F52A 2Y0SE 5E7NA 5FLMH 1J5EQ 2IHFA 4B3MQ 4QGUA 4X65L 3KYHC 3CCUA 1HR0Q 2VL6A 2YV5A 1FL0A 2CKZB 2R6GA 5M5WH 5C3EH 1M1KC 1IBKQ 1X65A 3DM3A 5J3BA 2C35B 4QJFA 3PO2G 2IT1A 4LUOA 3HOVG 1L1OB 2B63H 1TWAH 2K5VA 1Q46A 5IYBH 1NY4A 4QIWE 1OXXK 2B3GA 3UE0A 4DV0Q 4HIDA 1KRSA 1V43A 1K83H 3I7FA 4P72A 1PH3A 4JI5Q 4BA1I 3CC7A 3S2DH 3EN2A 5IY0A 3S1MH 2UXCL 2Z0SA 2WB1G 1RIPA 4OO1I 1O7IA 3ZJYC 4ME3A 3S1QH 4X6AH 1LTLA 3HOZG 4X66Q 3I4NH 3S17H 1JJGA 2F4VQ 1G291 4BY7H 1E7ZA 1VQ8A 4JI1Q 4NXNL 1OTCA 1IZ6A 3EIVA 1FJGQ 1EOVA 1BVSA 4A3CG 2VQEL 4O2DA 4KI0A 4Y7NH 1XTDA 1Z9FA 1IBMQ 2HIVA 1KIXA 3CW2C 1XPRA 4GKJQ 1N33L 2ZTDA 4UP8A 2ES2A 1G6PA 4A75A 5AJ3Q 4JI4Q 4B3RQ 2UUCL 2FXQA 4P75A 4X64Q 2JQOA 1QVGA 1YI2A 2A8VA 1KAWA 3L0OA 2VQFQ 3I4MH 3S14H 2XTIA 3B6YA 1MIUA 3IRBA 3AFPA 5GADC 4DK6C 4OX9Q 1NE3A 4BXXG 4H02A 3FP9A 2GVBA 3RN2A 1YNXA 2CWAA 4DR7L 1HH2P 1PH9A 1CSPA 4LF9L 2QEXA 1D7QA 4JI7L 5IWAQ 2PI2E 3K0XA 4LFBQ 3KF6A 2A1AA 3J7A5 1JE5A 2K5NA 4R4CA 2CFMA 2KCTA 3GD7A 2WB1E 3PV0A 1XMQQ 2I5LX 4BY1G 1YEZA 1K0RA 3WWVA 1Q1EA 4A3IG 1EQRA 5IYCG 1KC8C 4NPSA 1N32Q 1Q82C 1NBWA 4BBSH 2R7FA 3CPWA 4AQYL 3HOUH 1VQHA 4GKKQ 4KHPQ 1E1OA 5DLQE 4JV5Q 1TWCH 1K73C 3UDFA 2E5LQ 2BA1A 1IYJB 1FVIA 3ER0A 3F1ZA 4JCVE 3ULJA 3PUZA 3M85A 2CWPA 2Y0SG 4GS3A 4DR1Q 1GD7A 2I5MX 2UXBQ 1N34Q 1A63A 1KQSA 4DR5Q 5JJIA 3STBC 3T1HQ 1PYBA 1MJEA 3ICEA 1Q86C 1VQ5A 3M3YH 4LF6L 4LFCL 3HOWG 4A76A 2UXDL 4A3JH 1KD1C 1WJJA 4DV4Q 4DV1Q 1Y1VG 4HJ9A 1X55A 1QVCA 1VQFA 1N8RC 2MFIA 5JEAG 1HNWL 4QL5A 2JA5G 1HNZQ 1HZBA 2AKWB 2KENA 2YTYA 3H0GH 4DV6Q 2NZHA 4GN4B 4L5SA 2JA7H 3PGZA 2JA8H 2KHJA 3LGJA 4LF7L 2K52A 3RNUA 4DUZQ 3CAMA 3CCMA 1LUZA 5M3FG 4DR4L 3RLFA 5ELNA 1XPUA 2UU9L 4LW1A 1P8LA 4IFDG 1A8VA 2DUDA 3D31A 1PH7A 2BH2A 3GTMH 4A3BG 4UP7A 2RHQB 5LMNW 3VDYA 3J81c 3H3VI 1GKHA 3DLLA 1EFWA 1VQNA 4UY8C 4K0KL 1J5EL 2F3IA 4MNOA 1GM5A 3HOXG 4POGA 4DPGA 3AQQA 4P71A 4UP9A 4LFAQ 4B3ML 1EUJA 3S16H 1HR0L 2PMZE 4A3FH 4LF5Q 1Y1WH 4J15A 3RZOH 4DV7Q 3CF5A 1I50H 2EIFA 3F2BA 3KF6B 2AWOA 5C44G 4IJHA 5LMUQ 2VUMG 4K0KQ 4DUYQ 3A74A 4OONA 2KBNA 5FLXc 2R92G 1B8AA 3Q8DA 4JG2A 5IP9H 4TQUS 4DV0L 4A3KH 3KFUA 3TS0A 2Q2IA 2NZOA 4JI5L 4GLXA 3J80i 5C0XG 4R4OA 3I4OA 1L2FA 4JI6L 5C4XH 4A3GG 2MQHA 3NEMA 4NXMQ 2EXDA 5C0XI 2JJQA 4X66L 5M5YH 1VQOA 2ZJQA 3CC2A 2NVYH 3UDXA 1K8GA 3NBHB 2JK8A 2F4VL 2I0QA 4JI1L 4JI8Q 3HOVH 1C7YA 1YJ9A 1YJNA 1FJGL 1VQJA 4BBRH 4DV2Q 3FKIG 3PUWA 2K14A 1E22A 2NN6G 1VQKA 4JI3Q 1VQPA 4B3TL 3CCRA 4DR2Q 1IBML 2ASBA 3A0JA 1X9NA 1C0AA 2WP8J 1D8LA 2RF4A 3GTLH 1X6OA 4GKJL 3GTPH 2B63G 2AWNA 4JI4L 5AJ3L 1JJCB 1SE8A 1H95A 2HHHQ 3PCOB 2JA6H 3TRZA 4LF4Q 2D62A 3HOZH 2IHEA 2N78A 1V1QA 1VQIA 4R1JA 4YWKA 4X62Q 3STBD 4X64L 4P74A 5JJLA 5H1SE 4DV3Q 4LUVA 4MTNA 2VQFL 4LF8Q 2YTVA 1R9TH 4HJ7A 4JI2Q 4A3CH 2ALYB 4A3DH 3A5ZB 3I4NG 4GLAC 4DR3Q 4C2MH 4ALPA 1W3SA 4A3EH 2PI2A 2UUBQ 4OX9L 2N49A 4BY7G 1VQAA 5EAYA 3CCQA 3S1RH 1U5KA 4GOPA 1UWVA 1W2BA 3GTKH 1V9PA 2AMCB 3RLOA 4GNXA 3OTOQ 4IOAA 1Y14B 4R4IA 1SR3A 5IWAL 5M3MG 2BH8A 1A0IA 4JC0A 4YY3Q 1OXUA 4FDBA 1JT8A 1SRUA 1XMQL 1NTGA 2K50A 3GO5A 3GTOH 1A62A 4XIGS 3CP0A 1JMCA 1VQCA 4B3SQ 3PF4A 2JE6I 1QUQA 1N32L 4NB3A 2KCMA 1PH4A 4YCUA 1VQEA 4UPAA 2LXJA 3ULLA 3HKSA 2ZM6Q 4GKKL 3HFZB 3ULPA 4KHPL 3CC4A 1CKNA 4EX5A 3I55A 4KHZA 3RN5A 3PO3G 4JV5L 3E9HA 3KLWA 2E5LL 3U50C 2N3SA 2Q2UA 2UUAQ 1WCMH 1N36Q 4DR1L 1I94Q 2UXBL 1EWIA 1N34L 1M90C 1VQBA 2E2JH 1WI5A 3TEHB 3CMAA 4DR5L 3T1HL 5BR8Q 3OW2A 1EQQA 1K8AC 1EYGA 3GTGH 5HY6A 1OXVA 5IYCH 3K7AH 1Q7YC 4RMFA 2YYZA 3CXCA 4GOPC 1XPOA 4DV4L 4DV1L 3G71A 2EQSA 4GNXC 4YCVA 1KXLA 1XMOQ 1K3RA 1PFSA 1UE5A 3RLNA 1DGSA 1HNZL 3F8TA 3OYYA 4JBWA 4MZ9A 3PF5A 4DV6L 1S3OA 2MO1A 3ERSX 3T1YL 1X3FA 3AYHB 3U4VA 3KJOA 4DUZL 4HIMA 4L5QA 1BBUA 1VS0A 5IYDG 1SLJA 2R7ZH 4DR6Q 1AH9A 1BBWA 2IX1A 1Q8KA 5JEAJ 4A3MG 4PG3A 1Q81C 3HOWH 4A3LH 1VQ6A 4HIKA 3GTQH 3L2PA 2JEBI 1YBYA 3PUXA 3TREA 2OTJA 1CKOA 4JI0Q 1YIJA 2Q2TA 4LFAL 2WAQG 3S15H 1CUKA 4GOPB 5K36G 1QZHA 2YU9H 4GNXB 4LF5L 3S2HH 2PQAA 1SROA 5M3FH 4DV7L 2NVQH 4IPDA 5IT9c 2VS1A 2JA8G 4QQBX 5IP7G 5LMUL 2LXKA 1I3QH 4LWCA 1IBLQ 4XTCS 4DUYL 1PV4A 1HNXQ 3H3VH 3HKZG 4IFDI 4JYAQ 1KL9A 3NELA 1GO3E 3G48A 3M4PA 4O0AA 3J81j 2R93G 1QZGA 1X56A 2YTXA 4DV5Q 4YWLA 3H15A 3G4SA 2NVXH 4GLVB 4GN5A 3KJPA 3A5UA 1IBKL 3M7NA 4OWXB 3HOXH 4DAYB 3CQZH 4A93H 3J7ZC 4NXML 5LMNQ 5FJ8H 4LNQA 1CKNB 1KRTA 3KDFA 4YHHQ 4OWWB 2E2IH 1VQ7A 1L1OC 4AYBG 5IE8A 3HOYG 1XNQQ 4IPGA 5GAEC 1I5FA 2OCEA 4JI8L 3SGIA 3K8AA 1PHJA 5JJKA 2I5HA 5C0XJ 4A3FG 1E3PA 4DV2L 1Y1WG 1K9MC 2R92H 1HZCA 4JI3L 1XNRQ 1HR0W 3M4OH 5M5XH 2CCZA 3JC66 4PZ7A 4DR2L 2D0OA 5GROA 1NJIC 1JJ2A 4WJ4A 5FLMG 2OTLA 1MJCA 5IP9G 2HHHL 3PO2H 4GN3B 2B29A 4A3KG 3TS2A 3BU2A 2HQLA 3J81i 4LF4L 4WJ3M 5C3EG 1PH6A 4JBJA 4X62L 4JBKA 4DK3C 4DV3L 4LF8L 2WAQE 5C4XG 2IX0A 2WFWA 1Z47A 4JI2L 2NN6I 5IYBG 2RCNA 3M4QA 3FKIH 3MXNB 4PZ8A 4B3RL 4DR3L 3PIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB L;  1P16 A;  3PUV A;  4YCW A;  1GVP A;  2H5X A;  2R7D A;  3HKZ E;  2ZJP A;  1QVF A;  2VY3 A;  4BBR G;  1VCI A;  5C4J H;  1B70 B;  3AFQ A;  3UDG A;  3KF8 B;  4X65 Q;  3OTO L;  3KOJ A;  3I56 A;  1X3G A;  2ID0 A;  4OO1 G;  1NMG A;  1SMX A;  4DNI A;  4YY3 L;  1T9H A;  4A3G H;  4P73 A;  3CCV A;  1SN8 A;  3PUY A;  4JI6 Q;  1UE6 A;  1ASZ A;  2JA6 G;  1CSQ A;  1PA6 A;  2PQA B;  4B3S L;  3CCS A;  4AYB E;  1SFO H;  3CCL A;  4LFB L;  2VW9 A;  5ELO A;  4A3D G;  2ZM6 L;  2UXC Q;  2D0P A;  3BZK A;  3M9B A;  4A3E G;  4B3T Q;  4PZ6 A;  3CD6 A;  1Q12 A;  1Q1B A;  5M3M H;  1UEB A;  1OXS C;  3L7Z C;  1VQM A;  2UUA L;  4HJ8 A;  1N36 L;  2VZA A;  1U0L A;  4A4I A;  3I4M G;  1I94 L;  4BXX H;  4NXN Q;  4IO9 A;  4AIM A;  2VQE Q;  5BR8 L;  2ZTE A;  3EBE A;  1J6Q A;  1MKH A;  2KHI A;  2AHO B;  2OQ0 A;  3KDF B;  3TQY A;  1WOC A;  2QA4 A;  4KLK A;  1VQL A;  1N33 Q;  1G51 A;  3GTJ H;  2CQO A;  1XMO L;  4JOI A;  1OXT A;  4YWM A;  1PH2 A;  2UUC Q;  4BY1 H;  3PO3 H;  2ATW A;  3K80 C;  3CPF A;  2QGQ A;  3G6E A;  4OXP A;  4A3I H;  2MO0 A;  1S72 A;  5HGQ A;  1YHB A;  2MNA A;  3UE1 A;  1JB7 A;  1LM0 A;  3F2C A;  3U58 A;  1YVC A;  1I6H H;  1YZ6 A;  4APV A;  4POF A;  4DR6 L;  2Z6K A;  2V1C C;  5GAG C;  4HIO A;  2LSS A;  1PH1 A;  1TWF H;  3JAM c;  4HJA A;  1WCM G;  3U4Z A;  1EIF A;  1NMF A;  1TWG H;  3BJU A;  4PMW A;  4BBS G;  2GVA A;  2IY5 B;  1AE2 A;  3HOU G;  4DR7 Q;  3W5O A;  4AH6 A;  3PIO A;  2E2H H;  4LF9 Q;  2K4K A;  3F2D A;  3I2Z A;  3S24 A;  4JI7 Q;  4JI0 L;  1KHI A;  1L0W A;  1RL2 A;  1B7Y B;  2DGY A;  3RR5 A;  4BA2 I;  1VQG A;  1HZA A;  1E24 A;  3BZC A;  1CKM A;  1VQ4 A;  1L1O A;  1YHQ A;  4TVA B;  3FHW A;  1UE1 A;  2K5H A;  5GQO A;  5IYD H;  1Y1V H;  1EIY B;  1XJV A;  1VQ9 A;  2JEA I;  2E8G A;  4A3M H;  2JA5 H;  1LYL A;  1IBL L;  3S1N H;  4JYA L;  1AE3 A;  1HNX L;  4LUZ A;  4A3J G;  4JOI C;  1YJW A;  4Y52 H;  2ZJR A;  2VNU D;  4AQY Q;  2R7Z G;  3NEN A;  1X54 A;  1IL2 A;  4DV5 L;  2NVT H;  5GAH C;  3W1G A;  4IFD J;  3H0G G;  3K81 C;  4A3L G;  2JA7 G;  1PYS B;  2OWO A;  2JA9 A;  2ZTC A;  3D0F A;  1E1T A;  2L15 A;  5LMN L;  1VQD A;  2K75 A;  2A19 A;  3E0E A;  2Z6K C;  3JAM i;  4YHH L;  1ASY A;  4A3B H;  1TWH H;  1HJP A;  1N9W A;  2HIX A;  1XNQ L;  1PH5 A;  3T1Y Q;  1QUQ B;  5IP7 H;  3J80 c;  3RZD H;  4LF6 Q;  4LFC Q;  2PNH A;  1TXY A;  3K7U C;  4DKA C;  2UXD Q;  3AEV A;  1HZ9 A;  2HT1 A;  1XNR L;  1C9O A;  4DAM A;  4L5T A;  3CME A;  1PH8 A;  2R93 H;  2RHS B;  2XGT A;  4OWT B;  2N8N A;  1HNW Q;  3W1B A;  4IPH A;  4IOC A;  1IXR A;  4C3H H;  4HJ5 A;  4LF7 Q;  5C44 H;  1X3E A;  2VUM H;  2GN5 A;  3GDE A;  4DR4 Q;  1YIT A;  4QY7 A;  2OQK A;  1FGU A;  3UDI A;  3HOY H;  1BKB A;  1WYD A;  4C3I H;  1YHA A;  3MEF A;  1WFQ A;  3E9I A;  3CCE A;  1S40 A;  2UU9 Q;  1UE7 A;  4A93 G;  1PVO A;  4R4T A;  5FJ8 G;  4IPC A;  4C3J H;  4JBM A;  4IJL A;  4EQ5 A;  2Q2H A;  3CCJ A;  4L5R C;  2BA0 A;  3PSI A;  4R4Q A;  4RG1 A;  2F52 A;  2Y0S E;  5E7N A;  5FLM H;  1J5E Q;  2IHF A;  4B3M Q;  4QGU A;  4X65 L;  3KYH C;  3CCU A;  1HR0 Q;  2VL6 A;  2YV5 A;  1FL0 A;  2CKZ B;  2R6G A;  5M5W H;  5C3E H;  1M1K C;  1IBK Q;  1X65 A;  3DM3 A;  5J3B A;  2C35 B;  4QJF A;  3PO2 G;  2IT1 A;  4LUO A;  3HOV G;  1L1O B;  2B63 H;  1TWA H;  2K5V A;  1Q46 A;  5IYB H;  1NY4 A;  4QIW E;  1OXX K;  2B3G A;  3UE0 A;  4DV0 Q;  4HID A;  1KRS A;  1V43 A;  1K83 H;  3I7F A;  4P72 A;  1PH3 A;  4JI5 Q;  4BA1 I;  3CC7 A;  3S2D H;  3EN2 A;  5IY0 A;  3S1M H;  2UXC L;  2Z0S A;  2WB1 G;  1RIP A;  4OO1 I;  1O7I A;  3ZJY C;  4ME3 A;  3S1Q H;  4X6A H;  1LTL A;  3HOZ G;  4X66 Q;  3I4N H;  3S17 H;  1JJG A;  2F4V Q;  1G29 1;  4BY7 H;  1E7Z A;  1VQ8 A;  4JI1 Q;  4NXN L;  1OTC A;  1IZ6 A;  3EIV A;  1FJG Q;  1EOV A;  1BVS A;  4A3C G;  2VQE L;  4O2D A;  4KI0 A;  4Y7N H;  1XTD A;  1Z9F A;  1IBM Q;  2HIV A;  1KIX A;  3CW2 C;  1XPR A;  4GKJ Q;  1N33 L;  2ZTD A;  4UP8 A;  2ES2 A;  1G6P A;  4A75 A;  5AJ3 Q;  4JI4 Q;  4B3R Q;  2UUC L;  2FXQ A;  4P75 A;  4X64 Q;  2JQO A;  1QVG A;  1YI2 A;  2A8V A;  1KAW A;  3L0O A;  2VQF Q;  3I4M H;  3S14 H;  2XTI A;  3B6Y A;  1MIU A;  3IRB A;  3AFP A;  5GAD C;  4DK6 C;  4OX9 Q;  1NE3 A;  4BXX G;  4H02 A;  3FP9 A;  2GVB A;  3RN2 A;  1YNX A;  2CWA A;  4DR7 L;  1HH2 P;  1PH9 A;  1CSP A;  4LF9 L;  2QEX A;  1D7Q A;  4JI7 L;  5IWA Q;  2PI2 E;  3K0X A;  4LFB Q;  3KF6 A;  2A1A A;  3J7A 5;  1JE5 A;  2K5N A;  4R4C A;  2CFM A;  2KCT A;  3GD7 A;  2WB1 E;  3PV0 A;  1XMQ Q;  2I5L X;  4BY1 G;  1YEZ A;  1K0R A;  3WWV A;  1Q1E A;  4A3I G;  1EQR A;  5IYC G;  1KC8 C;  4NPS A;  1N32 Q;  1Q82 C;  1NBW A;  4BBS H;  2R7F A;  3CPW A;  4AQY L;  3HOU H;  1VQH A;  4GKK Q;  4KHP Q;  1E1O A;  5DLQ E;  4JV5 Q;  1TWC H;  1K73 C;  3UDF A;  2E5L Q;  2BA1 A;  1IYJ B;  1FVI A;  3ER0 A;  3F1Z A;  4JCV E;  3ULJ A;  3PUZ A;  3M85 A;  2CWP A;  2Y0S G;  4GS3 A;  4DR1 Q;  1GD7 A;  2I5M X;  2UXB Q;  1N34 Q;  1A63 A;  1KQS A;  4DR5 Q;  5JJI A;  3STB C;  3T1H Q;  1PYB A;  1MJE A;  3ICE A;  1Q86 C;  1VQ5 A;  3M3Y H;  4LF6 L;  4LFC L;  3HOW G;  4A76 A;  2UXD L;  4A3J H;  1KD1 C;  1WJJ A;  4DV4 Q;  4DV1 Q;  1Y1V G;  4HJ9 A;  1X55 A;  1QVC A;  1VQF A;  1N8R C;  2MFI A;  5JEA G;  1HNW L;  4QL5 A;  2JA5 G;  1HNZ Q;  1HZB A;  2AKW B;  2KEN A;  2YTY A;  3H0G H;  4DV6 Q;  2NZH A;  4GN4 B;  4L5S A;  2JA7 H;  3PGZ A;  2JA8 H;  2KHJ A;  3LGJ A;  4LF7 L;  2K52 A;  3RNU A;  4DUZ Q;  3CAM A;  3CCM A;  1LUZ A;  5M3F G;  4DR4 L;  3RLF A;  5ELN A;  1XPU A;  2UU9 L;  4LW1 A;  1P8L A;  4IFD G;  1A8V A;  2DUD A;  3D31 A;  1PH7 A;  2BH2 A;  3GTM H;  4A3B G;  4UP7 A;  2RHQ B;  5LMN W;  3VDY A;  3J81 c;  3H3V I;  1GKH A;  3DLL A;  1EFW A;  1VQN A;  4UY8 C;  4K0K L;  1J5E L;  2F3I A;  4MNO A;  1GM5 A;  3HOX G;  4POG A;  4DPG A;  3AQQ A;  4P71 A;  4UP9 A;  4LFA Q;  4B3M L;  1EUJ A;  3S16 H;  1HR0 L;  2PMZ E;  4A3F H;  4LF5 Q;  1Y1W H;  4J15 A;  3RZO H;  4DV7 Q;  3CF5 A;  1I50 H;  2EIF A;  3F2B A;  3KF6 B;  2AWO A;  5C44 G;  4IJH A;  5LMU Q;  2VUM G;  4K0K Q;  4DUY Q;  3A74 A;  4OON A;  2KBN A;  5FLX c;  2R92 G;  1B8A A;  3Q8D A;  4JG2 A;  5IP9 H;  4TQU S;  4DV0 L;  4A3K H;  3KFU A;  3TS0 A;  2Q2I A;  2NZO A;  4JI5 L;  4GLX A;  3J80 i;  5C0X G;  4R4O A;  3I4O A;  1L2F A;  4JI6 L;  5C4X H;  4A3G G;  2MQH A;  3NEM A;  4NXM Q;  2EXD A;  5C0X I;  2JJQ A;  4X66 L;  5M5Y H;  1VQO A;  2ZJQ A;  3CC2 A;  2NVY H;  3UDX A;  1K8G A;  3NBH B;  2JK8 A;  2F4V L;  2I0Q A;  4JI1 L;  4JI8 Q;  3HOV H;  1C7Y A;  1YJ9 A;  1YJN A;  1FJG L;  1VQJ A;  4BBR H;  4DV2 Q;  3FKI G;  3PUW A;  2K14 A;  1E22 A;  2NN6 G;  1VQK A;  4JI3 Q;  1VQP A;  4B3T L;  3CCR A;  4DR2 Q;  1IBM L;  2ASB A;  3A0J A;  1X9N A;  1C0A A;  2WP8 J;  1D8L A;  2RF4 A;  3GTL H;  1X6O A;  4GKJ L;  3GTP H;  2B63 G;  2AWN A;  4JI4 L;  5AJ3 L;  1JJC B;  1SE8 A;  1H95 A;  2HHH Q;  3PCO B;  2JA6 H;  3TRZ A;  4LF4 Q;  2D62 A;  3HOZ H;  2IHE A;  2N78 A;  1V1Q A;  1VQI A;  4R1J A;  4YWK A;  4X62 Q;  3STB D;  4X64 L;  4P74 A;  5JJL A;  5H1S E;  4DV3 Q;  4LUV A;  4MTN A;  2VQF L;  4LF8 Q;  2YTV A;  1R9T H;  4HJ7 A;  4JI2 Q;  4A3C H;  2ALY B;  4A3D H;  3A5Z B;  3I4N G;  4GLA C;  4DR3 Q;  4C2M H;  4ALP A;  1W3S A;  4A3E H;  2PI2 A;  2UUB Q;  4OX9 L;  2N49 A;  4BY7 G;  1VQA A;  5EAY A;  3CCQ A;  3S1R H;  1U5K A;  4GOP A;  1UWV A;  1W2B A;  3GTK H;  1V9P A;  2AMC B;  3RLO A;  4GNX A;  3OTO Q;  4IOA A;  1Y14 B;  4R4I A;  1SR3 A;  5IWA L;  5M3M G;  2BH8 A;  1A0I A;  4JC0 A;  4YY3 Q;  1OXU A;  4FDB A;  1JT8 A;  1SRU A;  1XMQ L;  1NTG A;  2K50 A;  3GO5 A;  3GTO H;  1A62 A;  4XIG S;  3CP0 A;  1JMC A;  1VQC A;  4B3S Q;  3PF4 A;  2JE6 I;  1QUQ A;  1N32 L;  4NB3 A;  2KCM A;  1PH4 A;  4YCU A;  1VQE A;  4UPA A;  2LXJ A;  3ULL A;  3HKS A;  2ZM6 Q;  4GKK L;  3HFZ B;  3ULP A;  4KHP L;  3CC4 A;  1CKN A;  4EX5 A;  3I55 A;  4KHZ A;  3RN5 A;  3PO3 G;  4JV5 L;  3E9H A;  3KLW A;  2E5L L;  3U50 C;  2N3S A;  2Q2U A;  2UUA Q;  1WCM H;  1N36 Q;  4DR1 L;  1I94 Q;  2UXB L;  1EWI A;  1N34 L;  1M90 C;  1VQB A;  2E2J H;  1WI5 A;  3TEH B;  3CMA A;  4DR5 L;  3T1H L;  5BR8 Q;  3OW2 A;  1EQQ A;  1K8A C;  1EYG A;  3GTG H;  5HY6 A;  1OXV A;  5IYC H;  3K7A H;  1Q7Y C;  4RMF A;  2YYZ A;  3CXC A;  4GOP C;  1XPO A;  4DV4 L;  4DV1 L;  3G71 A;  2EQS A;  4GNX C;  4YCV A;  1KXL A;  1XMO Q;  1K3R A;  1PFS A;  1UE5 A;  3RLN A;  1DGS A;  1HNZ L;  3F8T A;  3OYY A;  4JBW A;  4MZ9 A;  3PF5 A;  4DV6 L;  1S3O A;  2MO1 A;  3ERS X;  3T1Y L;  1X3F A;  3AYH B;  3U4V A;  3KJO A;  4DUZ L;  4HIM A;  4L5Q A;  1BBU A;  1VS0 A;  5IYD G;  1SLJ A;  2R7Z H;  4DR6 Q;  1AH9 A;  1BBW A;  2IX1 A;  1Q8K A;  5JEA J;  4A3M G;  4PG3 A;  1Q81 C;  3HOW H;  4A3L H;  1VQ6 A;  4HIK A;  3GTQ H;  3L2P A;  2JEB I;  1YBY A;  3PUX A;  3TRE A;  2OTJ A;  1CKO A;  4JI0 Q;  1YIJ A;  2Q2T A;  4LFA L;  2WAQ G;  3S15 H;  1CUK A;  4GOP B;  5K36 G;  1QZH A;  2YU9 H;  4GNX B;  4LF5 L;  3S2H H;  2PQA A;  1SRO A;  5M3F H;  4DV7 L;  2NVQ H;  4IPD A;  5IT9 c;  2VS1 A;  2JA8 G;  4QQB X;  5IP7 G;  5LMU L;  2LXK A;  1I3Q H;  4LWC A;  1IBL Q;  4XTC S;  4DUY L;  1PV4 A;  1HNX Q;  3H3V H;  3HKZ G;  4IFD I;  4JYA Q;  1KL9 A;  3NEL A;  1GO3 E;  3G48 A;  3M4P A;  4O0A A;  3J81 j;  2R93 G;  1QZG A;  1X56 A;  2YTX A;  4DV5 Q;  4YWL A;  3H15 A;  3G4S A;  2NVX H;  4GLV B;  4GN5 A;  3KJP A;  3A5U A;  1IBK L;  3M7N A;  4OWX B;  3HOX H;  4DAY B;  3CQZ H;  4A93 H;  3J7Z C;  4NXM L;  5LMN Q;  5FJ8 H;  4LNQ A;  1CKN B;  1KRT A;  3KDF A;  4YHH Q;  4OWW B;  2E2I H;  1VQ7 A;  1L1O C;  4AYB G;  5IE8 A;  3HOY G;  1XNQ Q;  4IPG A;  5GAE C;  1I5F A;  2OCE A;  4JI8 L;  3SGI A;  3K8A A;  1PHJ A;  5JJK A;  2I5H A;  5C0X J;  4A3F G;  1E3P A;  4DV2 L;  1Y1W G;  1K9M C;  2R92 H;  1HZC A;  4JI3 L;  1XNR Q;  1HR0 W;  3M4O H;  5M5X H;  2CCZ A;  3JC6 6;  4PZ7 A;  4DR2 L;  2D0O A;  5GRO A;  1NJI C;  1JJ2 A;  4WJ4 A;  5FLM G;  2OTL A;  1MJC A;  5IP9 G;  2HHH L;  3PO2 H;  4GN3 B;  2B29 A;  4A3K G;  3TS2 A;  3BU2 A;  2HQL A;  3J81 i;  4LF4 L;  4WJ3 M;  5C3E G;  1PH6 A;  4JBJ A;  4X62 L;  4JBK A;  4DK3 C;  4DV3 L;  4LF8 L;  2WAQ E;  5C4X G;  2IX0 A;  2WFW A;  1Z47 A;  4JI2 L;  2NN6 I;  5IYB G;  2RCN A;  3M4Q A;  3FKI H;  3MXN B;  4PZ8 A;  4B3R L;  4DR3 L;  3PIP A; 
#chains in the Genus database with same CATH topology
 3PUV A;  2R7D A;  2ZJP A;  1QVF A;  1I6H B;  2VY3 A;  4BBR G;  5C4J H;  3AFQ A;  3D6C A;  1GXD C;  3UDG A;  2OXP A;  3TME A;  1TWF B;  1GUT A;  1SMX A;  4YY3 L;  1SN8 A;  2CH4 W;  3KLS X;  4JI6 Q;  1ASZ A;  3A55 A;  2PQA B;  5C4Z A;  4LFB L;  3HOW B;  2NYZ D;  4A3D G;  2ZM6 L;  4LK1 C;  1DD2 A;  5F2D A;  4B3T Q;  2JA5 B;  1Q12 A;  1OXS C;  4IUT A;  5IGB A;  4N8X 1;  4BXX H;  1D6E C;  1U0L A;  1I94 L;  4AIM A;  3MWY W;  2F1M A;  3KBG A;  2VQE Q;  5J22 A;  3L9A X;  3NK9 A;  1A15 A;  2XNA C;  1G51 A;  3GTJ H;  4A3B B;  1OXT A;  4YWM A;  1PH2 A;  4BY1 H;  2XN9 C;  2ATW A;  3CPF A;  4FP5 D;  3BYT B;  4OXP A;  2NB0 A;  3VR6 A;  2MO0 A;  4A3I H;  2MNA A;  3UE1 A;  2ICE C;  3TP6 A;  1LM0 A;  3U58 A;  1HUN A;  1QB5 D;  3NWS A;  1YZ6 A;  1QG7 A;  2A73 B;  3OMC A;  4HIO A;  2QDL A;  3U4Z A;  1TWG H;  1NMF A;  4ABN A;  3HOU G;  3W5O A;  3DWA A;  1SNC A;  1IYV A;  2BDO A;  1KHI A;  1L0W A;  1HZA A;  3DM1 A;  1DJR D;  4RFB A;  2JSO A;  1UE1 A;  5GQO A;  1Y1V H;  2XSC A;  1H9R A;  2E8G A;  3NBH A;  1A2T A;  4DXG A;  2SOB A;  5EBC A;  3FDT A;  1IBL L;  4JYA L;  4Y52 H;  3OSO A;  1IL2 A;  1X54 A;  1GUO A;  5DM7 3;  2NVT H;  1JR0 D;  4A3L G;  2JA7 G;  2EYM A;  3DWQ A;  3I91 A;  5K36 H;  2A19 A;  1K83 B;  3NE5 B;  4QF4 A;  1ASY A;  1TKW B;  1HXY D;  4HN7 A;  1U9R A;  1N9W A;  2Q8T A;  3J80 c;  3RZD H;  5KYI A;  2PNH A;  3NBI A;  5CV9 A;  4LFC Q;  3T53 B;  2L4N A;  4DAM A;  3CME A;  2R93 H;  1CHP D;  1STY A;  2K01 A;  2XGT A;  4OWT B;  1SFO B;  2E76 C;  4C1N K;  1HFN A;  4IPH A;  1MI2 A;  1IXR A;  4LF7 Q;  1H9S A;  1X3E A;  2FIN B;  5M3M B;  5I2Y A;  2K1B A;  4EVO A;  4C3I H;  1UE7 A;  3NTI A;  1A2U A;  3VR5 A;  4EQ5 A;  2BA0 A;  4R4Q A;  5E7N A;  1ICF B;  4X65 L;  5KND A;  1FL0 A;  2CKZ B;  5M5W H;  5I2X A;  1IBK Q;  3PO2 G;  2B2T A;  3H94 A;  2B2W A;  4KY7 A;  4N9P A;  5E4X A;  4DAV A;  3JAM E;  5IYB H;  1S4Z A;  2B3G A;  3UE0 A;  1KRS A;  1Y69 U;  1PH3 A;  3CC7 A;  3S2D H;  3J7Y W;  4JVZ A;  3BS1 A;  1RIP A;  1O7I A;  4ILW A;  1LTL A;  1JJG A;  2JN4 A;  2KQ3 A;  1RKN A;  4PV1 C;  4JI1 Q;  3EIV A;  2EXZ A;  2N88 A;  4KI0 A;  4Y7N H;  4DK1 A;  1O80 A;  1NSN S;  4A3M B;  2HIV A;  5C5L A;  1KIX A;  3S1N B;  3D4R A;  2ZTD A;  3U9O A;  1G6P A;  5AJ3 Q;  2UUC L;  2FXQ A;  5J39 A;  3M3Y B;  2B2T C;  2JQO A;  1YI2 A;  2B2W C;  5BN4 A;  1BF4 A;  2SEB D;  3B6Y A;  1RDP D;  2F0P A;  4OIK A;  3IRB A;  3A7L A;  1LTA D;  2QW7 A;  1TWH B;  3AFP A;  4DK6 C;  4OX9 Q;  2QF7 A;  4H02 A;  3J81 L;  1YNX A;  4FF4 A;  1A3V A;  1HH2 P;  4XYQ A;  1PH9 A;  1ILQ A;  2KCC A;  2PI2 E;  3TDQ A;  2CW0 C;  4DAY A;  1JE5 A;  3GD7 A;  1DOM A;  3H6M A;  3J7A V;  2KVM A;  3I90 A;  4KY6 A;  5T1G A;  2A5H A;  3DMU A;  1KC8 C;  1N32 Q;  1LTT D;  3S16 B;  1EYA A;  4NKL A;  3V96 A;  1VQH A;  4KHP Q;  1E1O A;  5DLQ E;  1TWC H;  1IYJ B;  4QUF A;  3QIA A;  3PUZ A;  4FNF A;  3M85 A;  4GS3 A;  2EYL A;  1BBX C;  2UXB Q;  1WD0 A;  2EYF A;  1VQ5 A;  1PRT D;  3TP7 A;  4KD4 A;  4LF6 L;  3HOW G;  4GZY C;  1BR9 A;  2UXD L;  4A3J H;  4DV1 Q;  2BCO A;  1X55 A;  1HFG A;  3GV6 A;  5JEA G;  1HNW L;  4QL5 A;  2JA5 G;  2YTY A;  3H0G H;  1LAC A;  5NUC A;  2NZH A;  4DV6 Q;  4QUC A;  2KHJ A;  4DUZ Q;  3VYT A;  4HSP A;  1GJX A;  3S17 B;  1XPU A;  2UU9 L;  1P8L A;  3DWP A;  2JA6 B;  1BNZ A;  1A8V A;  4A3B G;  4UP7 A;  1RTO A;  5DM6 3;  1GKH A;  3DLL A;  1EFW A;  4UY8 C;  3RUZ A;  1J5E L;  4MNO A;  3TP8 A;  4HCS A;  4DPG A;  3AQQ A;  4PMC A;  2XVS A;  2DY7 A;  3J7A F;  4J1M A;  1XYI A;  1V8Q A;  4A3F H;  2X6G A;  2R61 A;  3KF6 B;  4TRD A;  1CQV A;  3P1H A;  2AWO A;  5A2Q L;  2EJG C;  3NTK A;  4L63 B;  4OON A;  1CHQ D;  4JG2 A;  5IP9 H;  2XRS D;  4KJO A;  1YNJ C;  2Q2I A;  4JI5 L;  3J80 i;  1DON A;  1PMR A;  4JI6 L;  3UI2 A;  3NEM A;  4K14 A;  1VQO A;  1EYD A;  2A6E D;  3UDX A;  1K8G A;  1HHV A;  4OHJ A;  2I0Q A;  1SNQ A;  1AW7 A;  2FHT A;  2K14 A;  4H13 C;  2JP1 A;  2NN6 G;  1AZQ A;  3Q23 A;  4IUU A;  4B3T L;  1X9N A;  4OO1 H;  1X6O A;  3GTP H;  2AWN A;  2K04 A;  1SAP A;  2E2J B;  1H95 A;  3PCO B;  3SEB A;  2D62 A;  1J9O A;  2A69 D;  1STA A;  2F0O A;  3HOZ H;  2IHE A;  1V1Q A;  4X62 Q;  3STB D;  4HMJ A;  4LUV A;  1KTK A;  2L0C A;  3VYS A;  2ALY B;  3A5Z B;  3H3V C;  3KUP A;  4DR3 Q;  4ALP A;  4A3E H;  3ND8 A;  1UWV A;  3OOC A;  2JYO A;  2R7Z B;  4GNX A;  5IWA L;  5K5P A;  5M3M G;  1WTX A;  2F0W A;  5CGK A;  4YY3 Q;  3A8J E;  4FDB A;  1JT8 A;  1NTG A;  2K50 A;  5EKL A;  5IGC A;  3GTO H;  2VXW A;  3X3N A;  3CP0 A;  1STB A;  1QOH A;  1QUQ A;  2I46 A;  2TMP A;  1QIL A;  1PH4 A;  3S15 B;  1Y8O B;  4UPA A;  3ULL A;  4WFN 3;  2ZM6 Q;  3GTM B;  1ROD A;  3HEJ A;  2E5L L;  1E0B A;  2C5C A;  2RCF A;  1K28 A;  4RGT A;  4J6H A;  2N3S A;  1WCM H;  2BOS A;  1I94 Q;  4HED A;  5IOD A;  1VQB A;  1WI5 A;  1K8A C;  3T1H L;  5FLX E;  3OW2 A;  5I6Y A;  4FYD A;  4KK7 A;  1Q7Y C;  1OXV A;  4J8Q A;  3CQZ B;  1D5Z C;  4A93 B;  4DV4 L;  4GNX C;  1KXL A;  2F0L A;  1O78 A;  1K3R A;  1PFS A;  1UE5 A;  3NWT A;  4KTA A;  1Q8I A;  5I9P A;  1HNZ L;  4JBW A;  3PF5 A;  3MTS A;  2MO1 A;  1B3A A;  4MN3 A;  1X3F A;  3U4V A;  1PTO C;  1C48 A;  2DJG C;  3MAQ A;  1AH9 A;  4A3M G;  5FO7 B;  3CKI B;  4PG3 A;  2F0D A;  2KED A;  2F0E A;  3D3R A;  3L2P A;  3WDN A;  3QOL A;  1B53 A;  3V2T A;  1YBY A;  3PUX A;  3QB3 A;  2LFN A;  3VYU A;  1LTR D;  1TY2 A;  5EJW A;  3OPO A;  1QZH A;  4LF5 L;  2G9D A;  2RDG A;  1LAB A;  1SNO A;  5C4J B;  3H3V H;  1IBL Q;  4XTC S;  4DUY L;  4JYA Q;  2NZ1 D;  4RHS A;  1STE A;  2YTX A;  4C2M B;  4RAU C;  1IBK L;  1JOK A;  1WTH A;  1SJH D;  2L9H A;  2K5D A;  1R4P B;  4ZLT F;  4IPG A;  3E6Z X;  3MXU A;  4FF3 A;  2I5H A;  2CVR A;  2R92 H;  5CMD A;  5C5M A;  4EQP A;  5BN5 A;  2A68 C;  2CCZ A;  3JC6 6;  3NHH A;  1NJI C;  1ENA A;  5ELE A;  1SXT A;  1VF5 C;  2HHH L;  3K57 A;  4LF4 L;  2HQL A;  1GOZ A;  3DXJ C;  1SNP A;  4U67 3;  2DN8 A;  2WAQ E;  2IX0 A;  4BY1 B;  2OT2 A;  1MHW C;  3MXN B;  4PZ8 A;  1DXM A;  3JAM L;  3S14 H;  4RKL A;  2UUB L;  4A3I B;  1EQV A;  1LLR D;  1HQR D;  4YCW A;  1F2Z A;  3MVV A;  1VCI A;  3GP7 A;  3HP3 A;  1EY5 A;  3KF8 B;  4X65 Q;  1PRT C;  5ELB A;  1X32 A;  1PTO H;  2ID0 A;  1SYG A;  1T9H A;  2J7Z A;  3CCV A;  3PUY A;  2JA6 G;  3EFX D;  1ILP A;  1TS5 A;  4G57 A;  2ICI A;  4B3S L;  3CCS A;  4LMQ D;  1ZYR C;  4AYB E;  3CCL A;  1SMY C;  5ELO A;  3IFT A;  1CT1 D;  1Y1V B;  5IGE A;  4PZ6 A;  3CD6 A;  1Q1B A;  5I4D A;  1UEB A;  1S5F D;  4ZK9 B;  2UUA L;  2R3Z A;  3QR8 A;  1N36 L;  2YU9 B;  4XQQ A;  3KDF B;  1SE3 A;  3CHB D;  3TSS A;  3SK8 A;  3EVQ A;  2UUC Q;  1X3Q A;  5HGQ A;  1JC7 A;  4K5W A;  1L0Y B;  4JK1 C;  4APV A;  4POF A;  2Z6K A;  2V1C C;  3OMG A;  2LSS A;  1L0X B;  1U4R A;  1EIF A;  4PMW A;  1T5E A;  1XTC D;  2IY5 B;  4AH6 A;  2E2H H;  5M5X B;  3M4O B;  3S24 A;  4C3I B;  1G8Z D;  1EY8 A;  1RL2 A;  2WV6 D;  1VQG A;  1E24 A;  1PFN A;  3BZC A;  1L1O A;  2K05 A;  1EIY B;  2JEA I;  1S5D D;  2HUG A;  3SXH A;  1ET6 A;  4DK0 A;  2R7Z G;  1DOK A;  4K2L A;  1SND A;  1RCV D;  3W1G A;  1TT2 A;  1YNN C;  3K81 C;  4FXG C;  1IW7 C;  3Q0A A;  1PYS B;  2OWO A;  1O7Y A;  2ZTC A;  1AEX A;  3E0E A;  1GUN A;  2Z6K C;  4V19 0;  4IFD H;  1ZEQ X;  4YHH L;  4A3G B;  1V1P A;  3I3C A;  2HIX A;  1XNQ L;  3T1Y Q;  5IP7 H;  4LF6 Q;  3A54 A;  1TXY A;  3NTH A;  4OEM B;  2UXD Q;  3AEV A;  1F2M A;  2HT1 A;  2RHS B;  4HTH A;  1HNW Q;  1EZ6 A;  4RHR A;  1LO5 D;  4C3H H;  5C44 H;  4Y7N B;  2WKD A;  3HG9 A;  5EGT A;  3HOY H;  1BKB A;  1WYD A;  3BYY B;  1YHA A;  3MEF A;  2UU9 Q;  1S40 A;  4A93 G;  4JBM A;  5IOC A;  3S9W A;  4IUV A;  3PSI A;  1WD1 A;  2Y0S E;  5FLM H;  1J5E Q;  3HZX A;  2F3W A;  4MHE A;  2VL6 A;  4CHT B;  3PO3 B;  3FPU B;  1H9J A;  2B63 H;  1Q46 A;  4OIJ A;  4DAP A;  5FK9 C;  4IUR A;  2XWB B;  4P72 A;  4JI5 Q;  4BA1 I;  3S1M H;  2UXC L;  2Z0S A;  4FXD A;  3FRP B;  4C1N I;  4Q0F A;  1STN A;  2CHB D;  1E2Z A;  3K0Y A;  1G29 1;  4BY7 H;  1VQ8 A;  3QWN A;  4A3C G;  4O2D A;  1TWC B;  3E0J A;  5EPK A;  5CBE E;  2F0V A;  1XPR A;  1N33 L;  2ES2 A;  2Q8R E;  1BCP C;  3FVQ A;  3ERQ A;  1G6Z A;  1QVG A;  2A8V A;  4N8F A;  2MGS A;  3R8B A;  2WAQ B;  2K6A A;  1H9S B;  1JWU D;  1CK1 A;  2EJF C;  1JB3 A;  2XTI A;  3T4A C;  1MIU A;  4DN4 M;  3J80 E;  5E3F A;  3H0G B;  2XWJ B;  5ISR A;  5GAD C;  1NE3 A;  4BXX G;  2P5Z X;  3PIP 3;  4DR7 L;  1FGB D;  1CSP A;  3ONA B;  5IGF A;  2QEX A;  5IWA Q;  4G7Z C;  3J7A 5;  2A1A A;  1STH A;  3SE0 A;  3TZD A;  2B2U A;  2WB1 E;  3PV0 A;  1V1O A;  3MFG A;  2I5L X;  4BY1 G;  1YEZ A;  4RGM A;  4G7H C;  1ESR A;  3WWV A;  1Q1E A;  4A3I G;  3FPP A;  4AYB B;  5FLX L;  2B8F A;  1AN8 A;  1S5B D;  2KOL A;  1Q82 C;  1NBW A;  2R7F A;  2L12 A;  3CPW A;  4A3F B;  4AQY L;  3HOU H;  3K5M A;  4OGQ C;  1LTS D;  5C3W A;  2E5L Q;  1JWS D;  1FVI A;  2BA1 A;  3ULJ A;  2F0J A;  1PZJ D;  1TVX A;  2H4O A;  2CWP A;  3AU7 A;  4XQN A;  1GD7 A;  5C3E B;  3T1H Q;  3ICE A;  1MJE A;  2O4X A;  4NDX A;  1M4V A;  2VB2 X;  4ZAI A;  4DV4 Q;  1Y1V G;  1VDZ A;  4HR7 B;  2CQA A;  2MFI A;  1F9R A;  2A6H C;  1GHJ A;  1HNZ Q;  1UAP A;  2AQ3 B;  2AKW B;  2KEN A;  1EEF D;  4GN4 B;  2JA7 H;  4TKO B;  2B2U C;  1LTI D;  2JA8 H;  3LGJ A;  1B50 A;  3RNU A;  1SE4 A;  3FEW X;  5CC4 A;  3RLF A;  4N9T A;  1F9Q A;  4U68 A;  4IQZ A;  4K8J A;  3RD4 A;  5JPM C;  2I07 B;  4XT1 B;  4EQN A;  2RHQ B;  1K8M A;  1GM5 A;  4P71 A;  4UP9 A;  4B3M L;  1NUC A;  3T51 B;  2EYO A;  1HR0 L;  4CJ0 B;  1EIH A;  2PMZ E;  4A3E B;  4LF5 Q;  3RZO H;  3OWE B;  2N55 A;  2EPB A;  2F03 A;  1ESF A;  3NSW A;  2AQ2 B;  1STG A;  3I4M B;  1B9N A;  4DUY Q;  2KBN A;  2EY5 A;  1B8A A;  2LY7 A;  4DV0 L;  4A3K H;  4V0B A;  3CU7 A;  3KFU A;  1RJT A;  4C3I G;  4CJ1 B;  4GLX A;  3RMH A;  1PZI D;  5C4X H;  1KDA A;  2EXD A;  2JJQ A;  4X66 L;  2ZJQ A;  2Z8L A;  4ULL A;  2MUY A;  1C7Y A;  1YJ9 A;  1FJG L;  1EYC A;  1IBM L;  1C0A A;  1D8L A;  1WCM B;  3GTL H;  2K33 A;  3QJY A;  4BBS B;  4HCE A;  1SE8 A;  2HHH Q;  4LF4 Q;  4A3G G;  4YWK A;  4OEL B;  4MTN A;  2VQF L;  2QDB A;  1PFM A;  1TS2 A;  2HCC A;  5D65 A;  2UUB Q;  1B4O A;  1VQA A;  4ODG A;  1HPC A;  3CCQ A;  1U5K A;  3R93 A;  1V9P A;  3RLO A;  2RKS A;  1MBY A;  2LMC B;  1SR3 A;  3NQT A;  2K5W A;  4JC0 A;  2EOT A;  1SRU A;  1A62 A;  2F4I A;  1BUV T;  4B3S Q;  3PF4 A;  4NB3 A;  2B2V C;  4CDF C;  5IT9 E;  1SYD A;  3HKS A;  1FNU A;  3HFZ B;  3CRL C;  4G4K A;  3PO3 G;  3RN5 A;  4JV5 L;  4CKC A;  4B08 A;  5J1Z A;  3CRK C;  3TBI B;  2Q2U A;  4CKE A;  2UUA Q;  1N36 Q;  3VR4 A;  4DR1 L;  2J0T D;  1EWI A;  1N34 L;  4O42 A;  4DR5 L;  3TEH B;  1EYG A;  1K8O A;  1HQM C;  1I50 B;  4ID6 A;  5KYL A;  5HY6 A;  3GTG H;  2YYZ A;  3CXC A;  1XPO A;  2KCN A;  2HDL A;  2BE5 D;  2RA4 A;  1DGS A;  1SYE A;  3OYY A;  2FJ2 A;  3K6O A;  3P75 A;  1BOS A;  3T1Y L;  3KJO A;  4KJN A;  1VS0 A;  5IYD G;  5M5Y B;  1Q8K A;  2NVY B;  4L6T B;  3H91 A;  1M8A A;  3HOW H;  2RDF A;  3U9S A;  1CTM A;  3HOV B;  1EU3 A;  1ZKO A;  3VA7 A;  3GTQ H;  3LNN A;  2G9H D;  2Q2T A;  2WAQ G;  2WB1 B;  4GNX B;  1SRO A;  2F0S A;  2K32 A;  2VS1 A;  5IT9 c;  2F0N A;  2HDM A;  2RQX A;  5G3L F;  1C8C A;  5LMU L;  2HQE A;  1CZW A;  1I3Q H;  4LWC A;  5HGT A;  1PV4 A;  3SR1 A;  1PTO B;  4CKB A;  2IJ0 A;  2NBF A;  1LTB D;  3VYR A;  3ZYY X;  3I8Z A;  4K8I A;  4F8M A;  3KJP A;  4O1N A;  1FNW A;  2NVX H;  4OWX B;  3S1R B;  4NXM L;  1B44 D;  2OF1 A;  2F0I A;  5FJ8 H;  4LNQ A;  1KRT A;  4YHH Q;  4OWW B;  2F0H A;  4AYB G;  1XNQ Q;  5GAE C;  1CQF A;  1I5F A;  3SGI A;  5JAV A;  3K8A A;  1PHJ A;  5JJK A;  5C0X J;  4A3F G;  1E3P A;  1I4G A;  4IN3 A;  1RHP A;  4DFA A;  1HR0 W;  4DR2 L;  3BVZ A;  1SYB A;  5IP9 G;  4GN3 B;  2B29 A;  3TS2 A;  4WJ3 M;  4XQJ A;  5C3E G;  3KLR A;  2F3V A;  3OIQ A;  4B9X A;  4DV3 L;  2NN6 I;  2RCN A;  3M4Q A;  4LJZ C;  2SNM A;  4RG1 A;  2NN6 H;  4DU9 A;  1D2B A;  3HRZ C;  1F2Y A;  2A74 C;  2H5X A;  4X3S A;  1F9P A;  2F0K A;  1B70 B;  2AQ1 B;  3KOJ A;  3I56 A;  2KUM A;  2PMZ B;  1X3G A;  2B39 A;  5EBD A;  3MZ5 A;  1Z7T A;  1A3T A;  4OO1 G;  4DNI A;  4DNR B;  4P73 A;  4FXK C;  2AUK A;  4LAA A;  2E2H B;  1CSQ A;  1EU4 A;  1SFO H;  5JJZ A;  2QKI C;  5I9O A;  4ZRZ A;  5G3L D;  2VW9 A;  2L11 A;  1IHZ A;  2UXC Q;  4WJW A;  2O2L D;  4X3T A;  4A3E G;  1F2L A;  3VR2 A;  4R8N A;  1IL8 A;  5M3M H;  3V05 A;  3DEO A;  3DUZ A;  3L7Z C;  1VQM A;  4HJ8 A;  3I4M G;  2FFK B;  1DCZ A;  2KJX A;  4IO9 A;  4DXF A;  3S2H B;  5M3F B;  5BR8 L;  2NVQ B;  3J80 L;  1J6Q A;  1MKH A;  2OQ0 A;  1BXT A;  2AHO B;  4IUP A;  3TQY A;  4KLK A;  1SBB B;  1N33 Q;  5LL6 X;  1XMO L;  5M9O A;  2KEE A;  3BVG A;  3K80 C;  3HOX B;  1S72 A;  3TN2 A;  1YVC A;  1GUW A;  2E2I B;  4EGV A;  1PH1 A;  4RWS C;  4HJA A;  1WCM G;  5C44 B;  2RDH A;  3I73 A;  1OO9 B;  3FMC A;  4BBS G;  2GVA A;  1AE2 A;  4DR7 Q;  3PIO A;  3F2D A;  1GHK A;  4JI0 L;  3RR5 A;  1B7Y B;  2DGY A;  2X6L A;  1CKM A;  2NUC A;  1YHQ A;  4TVA B;  3FHW A;  1VQ9 A;  2ZXR A;  4A3M H;  1LYL A;  3S1N H;  1QNK A;  1YJW A;  2VNU D;  3FKI B;  4AQY Q;  3NEN A;  4DV5 L;  5GAH C;  4KKU A;  3N52 A;  1GUG A;  3MC0 B;  4H0L C;  3K5O A;  2JA9 A;  2B63 B;  4NP5 A;  3D0F A;  1E1T A;  2L15 A;  2K7V A;  2K75 A;  4XDX A;  4IZ8 A;  3JAM i;  1TWH H;  1HJP A;  3S1M B;  1DM0 B;  4CDE C;  3SDZ A;  1PH5 A;  4CDD C;  3K7U C;  4DKA C;  2MPM A;  1HZ9 A;  4WRD A;  1C9O A;  1XNR L;  1ENF A;  1PH8 A;  4FF2 A;  1D1I A;  1SE2 A;  2N8N A;  3C3L A;  1E2W A;  4BY7 B;  1KLG D;  4IOC A;  2F0M A;  3BVM A;  3LWE A;  4HJ5 A;  4IUQ A;  5A35 A;  1WTW A;  2GN5 A;  2VUM H;  2PW7 A;  2TSS A;  3GDE A;  5COY A;  2OQK A;  3D4D A;  2CH4 A;  1H9M A;  2Q8I B;  1EFI D;  1WFQ A;  1HA6 A;  1SEB D;  4R4T A;  5CYU A;  1FD7 D;  4C3J H;  4IJL A;  4ZQ3 A;  3CCJ A;  4YIJ A;  2RSO A;  1BO0 A;  2F52 A;  2IHF A;  3S14 B;  4B3M Q;  3GTJ B;  4QGU A;  3N6R A;  4DGZ A;  2IL8 A;  3KYH C;  3CCU A;  1HR0 Q;  3I70 A;  2YV5 A;  2ZXO A;  1M1K C;  1X65 A;  3DM3 A;  2C35 B;  4QJF A;  3I4L A;  3HOV G;  1L1O B;  1TWA H;  1PYW D;  1NY4 A;  4ZKC B;  4DV0 Q;  4HID A;  1V43 A;  1TWG B;  5IY0 A;  3PQI A;  3T56 B;  4I7A A;  2WB1 G;  4P2C B;  3TP5 A;  1NCV A;  2ZXP A;  3ZJY C;  3S1Q H;  4X66 Q;  3I4N H;  3S17 H;  1NR4 A;  2E74 C;  1FYC A;  4NXN L;  1IZ6 A;  2L5T A;  1FJG Q;  5EKI A;  1XTD A;  1V1P B;  1IBM Q;  1HTL D;  5KNB A;  3CW2 C;  5E4W C;  4UP8 A;  1WTP A;  4DF7 A;  2NVT B;  1ML0 D;  1TU2 B;  3SK6 A;  3F2U A;  5FO9 B;  1KAW A;  3L0O A;  2VQF Q;  4KN7 C;  4I65 A;  2SNS A;  3MA2 B;  4KD3 A;  3SVM A;  2JA8 B;  3KBX A;  3VR3 A;  3RZD B;  2GVB A;  2RBM A;  2CWA A;  5KIX A;  2E2D C;  2R93 B;  3LX0 A;  4LF9 L;  4JI7 L;  3K0X A;  4NMZ A;  4R4C A;  2CFM A;  3SK5 A;  4K6D A;  2A6E C;  1S5C D;  1BCP B;  4ZUJ A;  5IYC G;  4FF1 A;  2XIW A;  3A8K E;  3RZO B;  5T1I A;  4I7Z C;  4RKB A;  4M1U B;  1TR5 A;  2MP1 A;  4JV5 Q;  1K73 C;  3UDF A;  3ER0 A;  3F1Z A;  2H1E A;  4JCV E;  5D14 A;  2PZU A;  4X3K A;  1LT5 D;  4A3K B;  4DR1 Q;  2A69 C;  1N34 Q;  5M5W B;  3MEH A;  4DR5 Q;  3STB C;  1PYB A;  3ERO A;  4KY5 A;  1Q86 C;  2B2Y A;  4IUN A;  5C4X B;  4A76 A;  1KD1 C;  1WJJ A;  3EQL C;  5BN3 A;  1VQF A;  1EEI D;  3I72 A;  4L5S A;  3S2D B;  5I6W A;  3PGZ A;  3KF8 A;  2K52 A;  1EIG A;  2LKV A;  3CAM A;  2KA7 A;  3D8G A;  2NWG A;  5M3F G;  4DR4 L;  4QCL A;  5ELN A;  1MSG A;  4OL7 A;  4LW1 A;  4NW2 A;  4M8A A;  4IFD G;  1QCB D;  2BH2 A;  3OHX C;  3GTM H;  3K5L A;  4ZYS A;  3VDY A;  3AB9 A;  3J81 c;  2F3I A;  3HOX G;  4POG A;  5DEH A;  4TSS A;  1D1K A;  4KMU C;  1Y1W H;  1ONL A;  2Z6B A;  2B2Y C;  3F2B A;  5FKA C;  4IJH A;  5C44 G;  5LMU Q;  1CI3 M;  3Q8D A;  2AUJ D;  3W3A A;  2NZO A;  4UHV A;  5C0X G;  2CW0 D;  4CGY B;  2PZT A;  3I4O A;  4NXM Q;  2X69 A;  5C0X I;  1EZ8 A;  3CC2 A;  1WVL A;  1CA5 A;  2F4V L;  3NBH B;  4BBR H;  5CV4 A;  1KAB A;  3FKI G;  3Q24 A;  1VQK A;  1VQP A;  3R2I A;  4BS9 A;  1MD2 D;  4DR2 Q;  2ASB A;  3A0J A;  4GKJ L;  2B63 G;  4JI4 L;  1WTQ A;  3TRZ A;  1D5X C;  3GTG B;  3D4W A;  4X64 L;  4K6L A;  1VQI A;  2HCI A;  4R1J A;  5JJL A;  5H1S E;  4DV3 Q;  1PXU A;  4XXE A;  1R9T H;  4A3C H;  4A3D H;  2F0T A;  3SK4 A;  1Q3L A;  4GLA C;  3DEP A;  3MHB A;  1U4L A;  4C2M H;  4BY7 G;  2N49 A;  2NTT A;  1WTV A;  4A3J B;  4WOR A;  4GOP A;  1W2B A;  3GTK H;  2AMC B;  1B9M A;  1DYQ A;  1PZK D;  2M2L A;  1BDO A;  4MTK A;  2EVB A;  1IKM A;  1OXU A;  1XMQ L;  3GTQ B;  3GO5 A;  1JOO A;  4XIG S;  3ND9 A;  1VQC A;  2JE6 I;  2KCM A;  4YCU A;  1VQE A;  4RGN A;  1G91 A;  4GKK L;  3ULP A;  2KHS A;  3CC4 A;  1CKN A;  3EJI A;  3I55 A;  4KHZ A;  3E9H A;  1I3Q B;  1C4Q A;  1E2V A;  3U50 C;  4K5X A;  2HD3 A;  2NVX B;  5BR8 Q;  1EQQ A;  3K7A H;  1YNJ D;  4GOP C;  3DHQ A;  1XMO Q;  1JIC A;  3RLN A;  4MZ9 A;  1EQT A;  1RF2 D;  3ERS X;  2DJF C;  3LWU A;  4KKS A;  1DOL A;  4HIM A;  4L5Q A;  1BBU A;  1BBW A;  2IX1 A;  2K28 A;  3OW7 A;  4A3L H;  5C6A A;  1PTO F;  1EY6 A;  1Y8N B;  5EPL A;  5CV7 A;  4RCN A;  2DY8 A;  3BDL A;  3TRE A;  4JI0 Q;  3GTP B;  1YIJ A;  4LFA L;  1KAA A;  5K36 G;  2YU9 H;  2PQA A;  4DV7 L;  3HOZ B;  1TII D;  2JA8 G;  3SHL A;  3WOE A;  2O5J C;  1SYF A;  2LXK A;  1JQY D;  4K0K L;  4F7X A;  1KL9 A;  1HTP A;  1GO3 E;  3M4P A;  3J81 j;  2R93 G;  3GV3 A;  1X56 A;  1QZG A;  5C4H A;  4DV5 Q;  3HGB A;  5DNF A;  2Z4H A;  5FOB B;  3G4S A;  1H9K A;  3P7J A;  4GLV B;  4GN5 A;  3A5U A;  1ICW A;  4DAY B;  3J7Z C;  2SDF A;  1HA5 A;  5HUR A;  3MXP A;  1AP0 A;  2OCE A;  4JI8 L;  3GTO B;  4DV2 L;  1S5E D;  4RA8 A;  4JI3 L;  1XNR Q;  3M4O H;  5CV6 A;  5M5X H;  4PZ7 A;  2D0O A;  5GRO A;  1JJ2 A;  3X3M A;  2PCF B;  1R4Q B;  2OTL A;  1MGS A;  2WII B;  3PO2 H;  4K2K A;  4A3K G;  3J81 i;  2ENB A;  5DAU A;  1PH6 A;  2MHV A;  1D5M C;  2JXM B;  4JBK A;  3Q6S A;  4DK3 C;  5CR3 A;  4LF8 L;  5C4X G;  2B2V A;  2WFW A;  1Z47 A;  4JI2 L;  5IYB G;  3NUC A;  4RGO S;  1P16 A;  3NPP A;  3AMU A;  3MXG A;  1GVP A;  3HKZ E;  1U4P A;  3NXW A;  1PTO D;  3OTO L;  2QEJ C;  1NMG A;  1VMC A;  4A3G H;  4Z9C B;  2EYH A;  3QO2 A;  1UE6 A;  1RD9 D;  1B1Z A;  2Y0S B;  1PA6 A;  1PRT F;  1J8I A;  4HSV A;  5KGU A;  3R2T A;  5D3I B;  2VB3 X;  3M7G A;  2O5I C;  1LV9 A;  2D0P A;  4R9W A;  3BZK A;  3G6J B;  3M9B A;  2L1B A;  5EPJ A;  2F0G A;  2IWH A;  2GA4 B;  1B2T A;  1UNS A;  5FO8 B;  2VZA A;  4A4I A;  2EZV A;  4NXN Q;  2K03 A;  2ZTE A;  3EBE A;  2KHI A;  1WOC A;  2QA4 A;  1VQL A;  5KNC A;  1G2S A;  1XWE A;  2CQO A;  4BWG B;  4JOI A;  1QJO A;  3PO3 H;  1UUP A;  1LT4 D;  2QGQ A;  3G6E A;  1YHB A;  1JB7 A;  3F2C A;  5IIF A;  3HS0 C;  1I6H H;  5D3D A;  1AZP A;  1U4M A;  4DR6 L;  1XXG A;  4PMB A;  5GAG C;  2A68 D;  2DNE A;  1TWF H;  3JAM c;  3BJU A;  3OWF A;  3R3O A;  2VUM B;  1I4R A;  2R92 B;  1LT3 D;  2PO4 A;  5C3X A;  1SNM A;  1Q90 A;  4LF9 Q;  1KDC A;  2K4K A;  3I2Z A;  4JI7 Q;  2LS0 1;  4BA2 I;  4E6I A;  1KNA A;  4C3J B;  1VQ4 A;  3A8I E;  3L3O C;  1A6X A;  2K5H A;  1EY0 A;  5IYD H;  5LHY 1;  1XJV A;  1LTG D;  5JEA H;  2JA5 H;  1AE3 A;  1HNX L;  4LUZ A;  4A3J G;  4JOI C;  2ZJR A;  2F0Q A;  4IFD J;  1JOQ A;  3H0G G;  1QWY A;  2E75 C;  2V4D A;  1TWA B;  5LMN L;  1VQD A;  4A3B H;  1DZ1 A;  3C1E A;  3E3X A;  1ZYR D;  1QUQ B;  4F87 A;  3EA6 A;  1QNU A;  5ELD A;  1SMY D;  5CV5 A;  3S1Q B;  4L5T A;  3I4N B;  5COR A;  2QCP X;  3W1B A;  1I6V C;  1EL0 A;  2RSN A;  1O7Z A;  3NP8 A;  3BG3 A;  4DR4 Q;  1YIT A;  4QY7 A;  3UDI A;  1FGU A;  1IKL A;  1JE4 A;  1PVO A;  3WOF A;  3CCE A;  3E9I A;  3BDC A;  1TY0 A;  2D2C C;  4IPC A;  5FJ8 G;  4FO2 A;  2Q2H A;  4L5R C;  1UEA B;  2WIN B;  3VA5 A;  2R6G A;  5C3E H;  1K3B C;  5J3B A;  1G2T A;  2IT1 A;  4LUO A;  4EQO A;  2K5V A;  5ELF A;  4QIW E;  1OXX K;  2MJ8 A;  3KLS A;  1K83 H;  3I7F A;  1O7L A;  3EN2 A;  3E5S A;  3K59 A;  4HMI A;  3ITP A;  4OO1 I;  4X6A H;  1W6K A;  4ME3 A;  5JVG 3;  3HOZ G;  4JPB W;  5JPN C;  2F4V Q;  1E7Z A;  3C1F A;  1OTC A;  1BVS A;  1EOV A;  1EY7 A;  2VQE L;  1I4P A;  1KLU D;  1Z9F A;  4ZUI A;  1JWM D;  1ZXT A;  4K5V A;  1NR2 A;  1YNN D;  4GKJ Q;  2M9V A;  1IW7 D;  1GUS A;  4RCO A;  4A75 A;  4JI4 Q;  2XRQ D;  5IGG A;  4B3R Q;  2C9O A;  1JOR A;  4P75 A;  1NNX A;  4X64 Q;  1PRT B;  1NAP A;  4PQX A;  3I4M H;  4ZCK A;  1X3P A;  5EQ0 A;  4C56 C;  1BCP F;  2EE1 A;  2EYP A;  3C2P A;  3PMF A;  3FP9 A;  3HKZ B;  1TQO A;  3RN2 A;  1D7Q A;  1BQQ T;  4LFB Q;  3KF6 A;  2K5N A;  4C3H B;  2KCT A;  1PDQ A;  1XMQ Q;  1I4Q A;  2QIL A;  4X3U A;  1K0R A;  4UDU C;  1TS3 A;  1EQR A;  3HOY B;  2EY6 A;  4NPS A;  4Q5V A;  1ENC A;  4QMG A;  3BZD B;  1Z6H A;  3H09 A;  4BBS H;  1Y1W B;  4GKK Q;  4G7O C;  3A7A B;  2OEO A;  1Y8P B;  1VMP A;  2Z4I A;  2Y0S G;  1I4X A;  2I5M X;  1A63 A;  1KQS A;  3T16 A;  5JJI A;  4UAI A;  1I4H A;  3M3Y H;  4LFC L;  4B9W A;  4MIU A;  1W6J A;  1PFB A;  4HJ9 A;  1QVC A;  1N8R C;  4CJ2 C;  2PW5 A;  1HZB A;  4CDC C;  3M4Y A;  4KV6 A;  4BBR B;  4LF7 L;  1A3U A;  3CCM A;  3OIP A;  1LUZ A;  2DNC A;  1FNV A;  1CZG A;  1FR3 A;  1PLF A;  4FVM A;  4RH6 A;  3D31 A;  2DUD A;  1PH7 A;  4ME5 A;  5LMN W;  3H3V I;  3G7L A;  1BCP D;  1VQN A;  1R9T B;  5EKK A;  4LFA Q;  4A3D B;  1EUJ A;  3PIO 3;  3S16 H;  1WTO A;  4J15 A;  4DV7 Q;  1EY9 A;  3NQI A;  2EJM A;  2Z9H A;  2IX3 A;  3CF5 A;  1I50 H;  2EIF A;  3BDO A;  3GTK B;  2VUM G;  4K0K Q;  2PYK A;  3A74 A;  1XX8 A;  5FLX c;  2R92 G;  4TQU S;  5IGD A;  4KHV A;  3TS0 A;  5ELC A;  4R4O A;  2BE5 C;  5CV8 A;  4C3J G;  1L2F A;  1CM9 A;  1EOT A;  2MQH A;  2M00 A;  2FMM A;  5M5Y H;  4XYO A;  2NVY H;  2JK8 A;  4DNT B;  4JI1 L;  4JI8 Q;  3HOV H;  1YJN A;  1VQJ A;  4DV2 Q;  3PUW A;  1E22 A;  4JI3 Q;  3IL8 A;  3CCR A;  2WP8 J;  2RF4 A;  1AFP A;  1RTN A;  1EY4 A;  1JJC B;  2ZT9 C;  2KEC A;  5AJ3 L;  3HOU B;  4PNY A;  1SJE D;  2JA6 H;  3K7A B;  2F0U A;  2N78 A;  4XT3 B;  5L37 A;  2WAC A;  4P74 A;  4LF8 Q;  2YTV A;  1HUM A;  4HJ7 A;  4JI2 Q;  1KNE A;  3I4N G;  1W3S A;  2A6H D;  2PI2 A;  4OX9 L;  5EAY A;  1MSH A;  3S1R H;  1LT6 D;  1CA6 A;  3O13 A;  2PQE A;  1SSO A;  3OTO Q;  4IOA A;  1EWH A;  1Y14 B;  4R4I A;  2BH8 A;  1A0I A;  2EY1 A;  2JA7 B;  2BDN A;  1JCK B;  3TZU A;  5IT9 L;  1WTR A;  2L55 A;  1JMC A;  4QIW B;  3A56 A;  4CBV A;  1N32 L;  5KRU A;  3J81 E;  1HCZ A;  2LXJ A;  4S3S A;  5JVH 3;  4JW0 A;  4KHP L;  3MFY A;  4EX5 A;  1ET9 A;  3KLW A;  2FMC A;  3K5N A;  1TS4 A;  4H7B A;  1F77 A;  5LL6 S;  2UXB L;  1M90 C;  4R8I A;  2E2J H;  3CMA A;  2IPK D;  1KDB A;  5IYC H;  2F0F A;  4RMF A;  3QG1 A;  5CBA E;  4DA2 A;  4DV1 L;  3G71 A;  2EDG A;  2EQS A;  4YCV A;  2EYJ A;  4HAE A;  4QB4 A;  3F8T A;  4H44 C;  4DV6 L;  1S3O A;  2IW3 A;  4ZKB B;  3AYH B;  3W2D A;  4DUZ L;  1B3Q A;  3MXN A;  1T5X D;  3P20 A;  2RVL A;  1SLJ A;  2R7Z H;  4DR6 Q;  2D9U A;  5JEA J;  3PO2 B;  1Q81 C;  1VQ6 A;  4HIK A;  1SYC A;  2JEB I;  1QE6 A;  2NTS A;  2OTJ A;  5TSS A;  1CKO A;  3GTL B;  4KKT A;  2Z1C A;  3S15 H;  1CUK A;  2K5Q A;  4GOP B;  5JOB A;  3S2H H;  1F9S A;  3URY A;  5M3F H;  2NVQ H;  4IPD A;  1K0S A;  2PNR C;  4QQB X;  5IP7 G;  4IFD I;  1HNX Q;  3HKZ G;  3NEL A;  3G48 A;  4O0A A;  5KEE A;  1CFM A;  4YWL A;  3H15 A;  2D5D A;  1VF7 A;  4IAL A;  3M7N A;  3IFD A;  2J4X A;  3HOX H;  4C3H G;  3CQZ H;  3GQB A;  4A93 H;  4F88 A;  5LMN Q;  1CKN B;  3KDF A;  5AFW A;  2E2I H;  5A2Q E;  1VQ7 A;  1L1O C;  5IE8 A;  3HOY G;  5E1F A;  1EWC A;  3IAY A;  1Y1W G;  1K9M C;  1HZC A;  4L8J A;  3Q22 A;  2B8G A;  3T13 A;  1HRJ A;  3IKJ A;  4WJ4 A;  3KK7 A;  5C0X H;  1IYU A;  5FLM G;  1MJC A;  3K58 A;  2PZW A;  2PPB C;  3C46 A;  3BU2 A;  2G5D A;  3D6W A;  4JBJ A;  2WKC A;  4X62 L;  2EY2 A;  3QOJ A;  4KN4 C;  1II3 A;  1SDF A;  3FKI H;  4B3R L;  4DR3 L;  3PIP A; 
#chains in the Genus database with same CATH homology
 2UUB L;  1P16 A;  3PUV A;  4YCW A;  1GVP A;  2H5X A;  2R7D A;  3HKZ E;  2ZJP A;  1QVF A;  2VY3 A;  4BBR G;  1VCI A;  5C4J H;  1B70 B;  3AFQ A;  3UDG A;  3KF8 B;  4X65 Q;  3OTO L;  3KOJ A;  3I56 A;  1X3G A;  2ID0 A;  4OO1 G;  1NMG A;  1SMX A;  4DNI A;  4YY3 L;  1T9H A;  4A3G H;  4P73 A;  3CCV A;  1SN8 A;  3PUY A;  4JI6 Q;  1UE6 A;  1ASZ A;  2JA6 G;  1CSQ A;  1PA6 A;  2PQA B;  4B3S L;  3CCS A;  4AYB E;  1SFO H;  3CCL A;  4LFB L;  2VW9 A;  5ELO A;  4A3D G;  2ZM6 L;  2UXC Q;  2D0P A;  3BZK A;  3M9B A;  4A3E G;  4B3T Q;  4PZ6 A;  3CD6 A;  1Q12 A;  1Q1B A;  5M3M H;  1UEB A;  1OXS C;  3L7Z C;  1VQM A;  2UUA L;  4HJ8 A;  1N36 L;  2VZA A;  1U0L A;  4A4I A;  3I4M G;  1I94 L;  4BXX H;  4NXN Q;  4IO9 A;  4AIM A;  2VQE Q;  5BR8 L;  2ZTE A;  3EBE A;  1J6Q A;  1MKH A;  2KHI A;  2AHO B;  2OQ0 A;  3KDF B;  3TQY A;  1WOC A;  2QA4 A;  4KLK A;  1VQL A;  1N33 Q;  1G51 A;  3GTJ H;  2CQO A;  1XMO L;  4JOI A;  1OXT A;  4YWM A;  1PH2 A;  2UUC Q;  4BY1 H;  3PO3 H;  2ATW A;  3K80 C;  3CPF A;  2QGQ A;  3G6E A;  4OXP A;  4A3I H;  2MO0 A;  1S72 A;  5HGQ A;  1YHB A;  2MNA A;  3UE1 A;  1JB7 A;  1LM0 A;  3F2C A;  3U58 A;  1YVC A;  1I6H H;  1YZ6 A;  4APV A;  4POF A;  4DR6 L;  2Z6K A;  2V1C C;  5GAG C;  4HIO A;  2LSS A;  1PH1 A;  1TWF H;  3JAM c;  4HJA A;  1WCM G;  3U4Z A;  1EIF A;  1NMF A;  1TWG H;  3BJU A;  4PMW A;  4BBS G;  2GVA A;  2IY5 B;  1AE2 A;  3HOU G;  4DR7 Q;  3W5O A;  4AH6 A;  3PIO A;  2E2H H;  4LF9 Q;  2K4K A;  3F2D A;  3I2Z A;  3S24 A;  4JI7 Q;  4JI0 L;  1KHI A;  1L0W A;  1RL2 A;  1B7Y B;  2DGY A;  3RR5 A;  4BA2 I;  1VQG A;  1HZA A;  1E24 A;  3BZC A;  1CKM A;  1VQ4 A;  1L1O A;  1YHQ A;  4TVA B;  3FHW A;  1UE1 A;  2K5H A;  5GQO A;  5IYD H;  1Y1V H;  1EIY B;  1XJV A;  1VQ9 A;  2JEA I;  2E8G A;  4A3M H;  2JA5 H;  1LYL A;  1IBL L;  3S1N H;  4JYA L;  1AE3 A;  1HNX L;  4LUZ A;  4A3J G;  4JOI C;  1YJW A;  4Y52 H;  2ZJR A;  2VNU D;  4AQY Q;  2R7Z G;  3NEN A;  1X54 A;  1IL2 A;  4DV5 L;  2NVT H;  5GAH C;  3W1G A;  4IFD J;  3H0G G;  3K81 C;  4A3L G;  2JA7 G;  1PYS B;  2OWO A;  2JA9 A;  2ZTC A;  3D0F A;  1E1T A;  2L15 A;  5LMN L;  1VQD A;  2K75 A;  2A19 A;  3E0E A;  2Z6K C;  3JAM i;  4YHH L;  1ASY A;  4A3B H;  1TWH H;  1HJP A;  1N9W A;  2HIX A;  1XNQ L;  1PH5 A;  3T1Y Q;  1QUQ B;  5IP7 H;  3J80 c;  3RZD H;  4LF6 Q;  4LFC Q;  2PNH A;  1TXY A;  3K7U C;  4DKA C;  2UXD Q;  3AEV A;  1HZ9 A;  2HT1 A;  1XNR L;  1C9O A;  4DAM A;  4L5T A;  3CME A;  1PH8 A;  2R93 H;  2RHS B;  2XGT A;  4OWT B;  2N8N A;  1HNW Q;  3W1B A;  4IPH A;  4IOC A;  1IXR A;  4C3H H;  4HJ5 A;  4LF7 Q;  5C44 H;  1X3E A;  2VUM H;  2GN5 A;  3GDE A;  4DR4 Q;  1YIT A;  4QY7 A;  2OQK A;  1FGU A;  3UDI A;  3HOY H;  1BKB A;  1WYD A;  4C3I H;  1YHA A;  3MEF A;  1WFQ A;  3E9I A;  3CCE A;  1S40 A;  2UU9 Q;  1UE7 A;  4A93 G;  1PVO A;  4R4T A;  5FJ8 G;  4IPC A;  4C3J H;  4JBM A;  4IJL A;  4EQ5 A;  2Q2H A;  3CCJ A;  4L5R C;  2BA0 A;  3PSI A;  4R4Q A;  4RG1 A;  2F52 A;  2Y0S E;  5E7N A;  5FLM H;  1J5E Q;  2IHF A;  4B3M Q;  4QGU A;  4X65 L;  3KYH C;  3CCU A;  1HR0 Q;  2VL6 A;  2YV5 A;  1FL0 A;  2CKZ B;  2R6G A;  5M5W H;  5C3E H;  1M1K C;  1IBK Q;  1X65 A;  3DM3 A;  5J3B A;  2C35 B;  4QJF A;  3PO2 G;  2IT1 A;  4LUO A;  3HOV G;  1L1O B;  2B63 H;  1TWA H;  2K5V A;  1Q46 A;  5IYB H;  1NY4 A;  4QIW E;  1OXX K;  2B3G A;  3UE0 A;  4DV0 Q;  4HID A;  1KRS A;  1V43 A;  1K83 H;  3I7F A;  4P72 A;  1PH3 A;  4JI5 Q;  4BA1 I;  3CC7 A;  3S2D H;  3EN2 A;  5IY0 A;  3S1M H;  2UXC L;  2Z0S A;  2WB1 G;  1RIP A;  4OO1 I;  1O7I A;  3ZJY C;  4ME3 A;  3S1Q H;  4X6A H;  1LTL A;  3HOZ G;  4X66 Q;  3I4N H;  3S17 H;  1JJG A;  2F4V Q;  1G29 1;  4BY7 H;  1E7Z A;  1VQ8 A;  4JI1 Q;  4NXN L;  1OTC A;  1IZ6 A;  3EIV A;  1FJG Q;  1EOV A;  1BVS A;  4A3C G;  2VQE L;  4O2D A;  4KI0 A;  4Y7N H;  1XTD A;  1Z9F A;  1IBM Q;  2HIV A;  1KIX A;  3CW2 C;  1XPR A;  4GKJ Q;  1N33 L;  2ZTD A;  4UP8 A;  2ES2 A;  1G6P A;  4A75 A;  5AJ3 Q;  4JI4 Q;  4B3R Q;  2UUC L;  2FXQ A;  4P75 A;  4X64 Q;  2JQO A;  1QVG A;  1YI2 A;  2A8V A;  1KAW A;  3L0O A;  2VQF Q;  3I4M H;  3S14 H;  2XTI A;  3B6Y A;  1MIU A;  3IRB A;  3AFP A;  5GAD C;  4DK6 C;  4OX9 Q;  1NE3 A;  4BXX G;  4H02 A;  3FP9 A;  2GVB A;  3RN2 A;  1YNX A;  2CWA A;  4DR7 L;  1HH2 P;  1PH9 A;  1CSP A;  4LF9 L;  2QEX A;  1D7Q A;  4JI7 L;  5IWA Q;  2PI2 E;  3K0X A;  4LFB Q;  3KF6 A;  2A1A A;  3J7A 5;  1JE5 A;  2K5N A;  4R4C A;  2CFM A;  2KCT A;  3GD7 A;  2WB1 E;  3PV0 A;  1XMQ Q;  2I5L X;  4BY1 G;  1YEZ A;  1K0R A;  3WWV A;  1Q1E A;  4A3I G;  1EQR A;  5IYC G;  1KC8 C;  4NPS A;  1N32 Q;  1Q82 C;  1NBW A;  4BBS H;  2R7F A;  3CPW A;  4AQY L;  3HOU H;  1VQH A;  4GKK Q;  4KHP Q;  1E1O A;  5DLQ E;  4JV5 Q;  1TWC H;  1K73 C;  3UDF A;  2E5L Q;  2BA1 A;  1IYJ B;  1FVI A;  3ER0 A;  3F1Z A;  4JCV E;  3ULJ A;  3PUZ A;  3M85 A;  2CWP A;  2Y0S G;  4GS3 A;  4DR1 Q;  1GD7 A;  2I5M X;  2UXB Q;  1N34 Q;  1A63 A;  1KQS A;  4DR5 Q;  5JJI A;  3STB C;  3T1H Q;  1PYB A;  1MJE A;  3ICE A;  1Q86 C;  1VQ5 A;  3M3Y H;  4LF6 L;  4LFC L;  3HOW G;  4A76 A;  2UXD L;  4A3J H;  1KD1 C;  1WJJ A;  4DV4 Q;  4DV1 Q;  1Y1V G;  4HJ9 A;  1X55 A;  1QVC A;  1VQF A;  1N8R C;  2MFI A;  5JEA G;  1HNW L;  4QL5 A;  2JA5 G;  1HNZ Q;  1HZB A;  2AKW B;  2KEN A;  2YTY A;  3H0G H;  4DV6 Q;  2NZH A;  4GN4 B;  4L5S A;  2JA7 H;  3PGZ A;  2JA8 H;  2KHJ A;  3LGJ A;  4LF7 L;  2K52 A;  3RNU A;  4DUZ Q;  3CAM A;  3CCM A;  1LUZ A;  5M3F G;  4DR4 L;  3RLF A;  5ELN A;  1XPU A;  2UU9 L;  4LW1 A;  1P8L A;  4IFD G;  1A8V A;  2DUD A;  3D31 A;  1PH7 A;  2BH2 A;  3GTM H;  4A3B G;  4UP7 A;  2RHQ B;  5LMN W;  3VDY A;  3J81 c;  3H3V I;  1GKH A;  3DLL A;  1EFW A;  1VQN A;  4UY8 C;  4K0K L;  1J5E L;  2F3I A;  4MNO A;  1GM5 A;  3HOX G;  4POG A;  4DPG A;  3AQQ A;  4P71 A;  4UP9 A;  4LFA Q;  4B3M L;  1EUJ A;  3S16 H;  1HR0 L;  2PMZ E;  4A3F H;  4LF5 Q;  1Y1W H;  4J15 A;  3RZO H;  4DV7 Q;  3CF5 A;  1I50 H;  2EIF A;  3F2B A;  3KF6 B;  2AWO A;  5C44 G;  4IJH A;  5LMU Q;  2VUM G;  4K0K Q;  4DUY Q;  3A74 A;  4OON A;  2KBN A;  5FLX c;  2R92 G;  1B8A A;  3Q8D A;  4JG2 A;  5IP9 H;  4TQU S;  4DV0 L;  4A3K H;  3KFU A;  3TS0 A;  2Q2I A;  2NZO A;  4JI5 L;  4GLX A;  3J80 i;  5C0X G;  4R4O A;  3I4O A;  1L2F A;  4JI6 L;  5C4X H;  4A3G G;  2MQH A;  3NEM A;  4NXM Q;  2EXD A;  5C0X I;  2JJQ A;  4X66 L;  5M5Y H;  1VQO A;  2ZJQ A;  3CC2 A;  2NVY H;  3UDX A;  1K8G A;  3NBH B;  2JK8 A;  2F4V L;  2I0Q A;  4JI1 L;  4JI8 Q;  3HOV H;  1C7Y A;  1YJ9 A;  1YJN A;  1FJG L;  1VQJ A;  4BBR H;  4DV2 Q;  3FKI G;  3PUW A;  2K14 A;  1E22 A;  2NN6 G;  1VQK A;  4JI3 Q;  1VQP A;  4B3T L;  3CCR A;  4DR2 Q;  1IBM L;  2ASB A;  3A0J A;  1X9N A;  1C0A A;  2WP8 J;  1D8L A;  2RF4 A;  3GTL H;  1X6O A;  4GKJ L;  3GTP H;  2B63 G;  2AWN A;  4JI4 L;  5AJ3 L;  1JJC B;  1SE8 A;  1H95 A;  2HHH Q;  3PCO B;  2JA6 H;  3TRZ A;  4LF4 Q;  2D62 A;  3HOZ H;  2IHE A;  2N78 A;  1V1Q A;  1VQI A;  4R1J A;  4YWK A;  4X62 Q;  3STB D;  4X64 L;  4P74 A;  5JJL A;  5H1S E;  4DV3 Q;  4LUV A;  4MTN A;  2VQF L;  4LF8 Q;  2YTV A;  1R9T H;  4HJ7 A;  4JI2 Q;  4A3C H;  2ALY B;  4A3D H;  3A5Z B;  3I4N G;  4GLA C;  4DR3 Q;  4C2M H;  4ALP A;  1W3S A;  4A3E H;  2PI2 A;  2UUB Q;  4OX9 L;  2N49 A;  4BY7 G;  1VQA A;  5EAY A;  3CCQ A;  3S1R H;  1U5K A;  4GOP A;  1UWV A;  1W2B A;  3GTK H;  1V9P A;  2AMC B;  3RLO A;  4GNX A;  3OTO Q;  4IOA A;  1Y14 B;  4R4I A;  1SR3 A;  5IWA L;  5M3M G;  2BH8 A;  1A0I A;  4JC0 A;  4YY3 Q;  1OXU A;  4FDB A;  1JT8 A;  1SRU A;  1XMQ L;  1NTG A;  2K50 A;  3GO5 A;  3GTO H;  1A62 A;  4XIG S;  3CP0 A;  1JMC A;  1VQC A;  4B3S Q;  3PF4 A;  2JE6 I;  1QUQ A;  1N32 L;  4NB3 A;  2KCM A;  1PH4 A;  4YCU A;  1VQE A;  4UPA A;  2LXJ A;  3ULL A;  3HKS A;  2ZM6 Q;  4GKK L;  3HFZ B;  3ULP A;  4KHP L;  3CC4 A;  1CKN A;  4EX5 A;  3I55 A;  4KHZ A;  3RN5 A;  3PO3 G;  4JV5 L;  3E9H A;  3KLW A;  2E5L L;  3U50 C;  2N3S A;  2Q2U A;  2UUA Q;  1WCM H;  1N36 Q;  4DR1 L;  1I94 Q;  2UXB L;  1EWI A;  1N34 L;  1M90 C;  1VQB A;  2E2J H;  1WI5 A;  3TEH B;  3CMA A;  4DR5 L;  3T1H L;  5BR8 Q;  3OW2 A;  1EQQ A;  1K8A C;  1EYG A;  3GTG H;  5HY6 A;  1OXV A;  5IYC H;  3K7A H;  1Q7Y C;  4RMF A;  2YYZ A;  3CXC A;  4GOP C;  1XPO A;  4DV4 L;  4DV1 L;  3G71 A;  2EQS A;  4GNX C;  4YCV A;  1KXL A;  1XMO Q;  1K3R A;  1PFS A;  1UE5 A;  3RLN A;  1DGS A;  1HNZ L;  3F8T A;  3OYY A;  4JBW A;  4MZ9 A;  3PF5 A;  4DV6 L;  1S3O A;  2MO1 A;  3ERS X;  3T1Y L;  1X3F A;  3AYH B;  3U4V A;  3KJO A;  4DUZ L;  4HIM A;  4L5Q A;  1BBU A;  1VS0 A;  5IYD G;  1SLJ A;  2R7Z H;  4DR6 Q;  1AH9 A;  1BBW A;  2IX1 A;  1Q8K A;  5JEA J;  4A3M G;  4PG3 A;  1Q81 C;  3HOW H;  4A3L H;  1VQ6 A;  4HIK A;  3GTQ H;  3L2P A;  2JEB I;  1YBY A;  3PUX A;  3TRE A;  2OTJ A;  1CKO A;  4JI0 Q;  1YIJ A;  2Q2T A;  4LFA L;  2WAQ G;  3S15 H;  1CUK A;  4GOP B;  5K36 G;  1QZH A;  2YU9 H;  4GNX B;  4LF5 L;  3S2H H;  2PQA A;  1SRO A;  5M3F H;  4DV7 L;  2NVQ H;  4IPD A;  5IT9 c;  2VS1 A;  2JA8 G;  4QQB X;  5IP7 G;  5LMU L;  2LXK A;  1I3Q H;  4LWC A;  1IBL Q;  4XTC S;  4DUY L;  1PV4 A;  1HNX Q;  3H3V H;  3HKZ G;  4IFD I;  4JYA Q;  1KL9 A;  3NEL A;  1GO3 E;  3G48 A;  3M4P A;  4O0A A;  3J81 j;  2R93 G;  1QZG A;  1X56 A;  2YTX A;  4DV5 Q;  4YWL A;  3H15 A;  3G4S A;  2NVX H;  4GLV B;  4GN5 A;  3KJP A;  3A5U A;  1IBK L;  3M7N A;  4OWX B;  3HOX H;  4DAY B;  3CQZ H;  4A93 H;  3J7Z C;  4NXM L;  5LMN Q;  5FJ8 H;  4LNQ A;  1CKN B;  1KRT A;  3KDF A;  4YHH Q;  4OWW B;  2E2I H;  1VQ7 A;  1L1O C;  4AYB G;  5IE8 A;  3HOY G;  1XNQ Q;  4IPG A;  5GAE C;  1I5F A;  2OCE A;  4JI8 L;  3SGI A;  3K8A A;  1PHJ A;  5JJK A;  2I5H A;  5C0X J;  4A3F G;  1E3P A;  4DV2 L;  1Y1W G;  1K9M C;  2R92 H;  1HZC A;  4JI3 L;  1XNR Q;  1HR0 W;  3M4O H;  5M5X H;  2CCZ A;  3JC6 6;  4PZ7 A;  4DR2 L;  2D0O A;  5GRO A;  1NJI C;  1JJ2 A;  4WJ4 A;  5FLM G;  2OTL A;  1MJC A;  5IP9 G;  2HHH L;  3PO2 H;  4GN3 B;  2B29 A;  4A3K G;  3TS2 A;  3BU2 A;  2HQL A;  3J81 i;  4LF4 L;  4WJ3 M;  5C3E G;  1PH6 A;  4JBJ A;  4X62 L;  4JBK A;  4DK3 C;  4DV3 L;  4LF8 L;  2WAQ E;  5C4X G;  2IX0 A;  2WFW A;  1Z47 A;  4JI2 L;  2NN6 I;  5IYB G;  2RCN A;  3M4Q A;  3FKI H;  3MXN B;  4PZ8 A;  4B3R L;  4DR3 L;  3PIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...