4X64Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x64Q00
2ASBA 1HNZL 1EQRA 1OXTA 3U58A 4PZ8A 2AKWB 5IE8A 4DR7L 3J81i 1KL9A 3M85A 1S40A 1X3FA 3EIVA 2EXDA 4FDBA 1E1OA 5C4XH 2K5VA 2EIFA 4OX9Q 2NVQH 3HOUG 2UXBL 4IO9A 1WOCA 4DK3C 2Z6KA 1PH7A 2HHHQ 4ME3A 2LSSA 2PMZE 3E0EA 3S15H 4LW1A 4X64Q 4DR2Q 1Z9FA 5LMNQ 4HIMA 1Y1WH 3KDFA 4H02A 4DV6L 4JI8Q 4X65Q 1IL2A 2GVAA 5LMUL 1HR0L 1A62A 4R1JA 1IBMQ 4K0KL 3FKIH 3W5OA 4BA1I 2F3IA 4DV7Q 1NY4A 1KIXA 3CC4A 1MKHA 3PSIA 2VQFQ 3L7ZC 3ULLA 3CC2A 4P71A 1YJNA 1MJEA 4GLXA 1YI2A 4GKJL 1UE6A 3F2CA 2WFWA 3PF4A 2ZM6Q 1XMOQ 4BBRH 1K0RA 3UE1A 1Y14B 1QVFA 5JJLA 4R4CA 2MO0A 3PGZA 2CCZA 1MJCA 1SE8A 2D62A 1SFOH 1Q8KA 2R92G 5IYDH 2N3SA 1U5KA 4RMFA 2NVTH 1FVIA 4A3FH 1YHBA 2GN5A 4PMWA 4GN5A 3RN2A 3BZKA 2HQLA 2R7ZG 1YIJA 5EAYA 1NE3A 1YBYA 5BR8Q 3D31A 2B63G 4JI4Q 1IBLL 3PUVA 1GD7A 4A3KG 4GOPA 2E2HH 3ZJYC 4IOCA 1BBWA 5C44G 3T1HQ 1N34Q 3U4ZA 1I94Q 4JI5Q 3GTQH 1HNWL 3ERSX 5FLXc 3K80C 3M4OH 2YU9H 2JEBI 3PCOB 1Q1EA 4GS3A 4A76A 3RZDH 1K83H 1HZAA 1UE1A 2OQKA 3PUXA 4DNIA 4DV0L 1CUKA 4DV1L 4HIDA 2ES2A 4OO1G 4DUZQ 4KLKA 4JI1Q 5C3EH 4Y52H 4GNXC 3AFPA 3KLWA 5IT9c 1IBKL 4JI6L 3I4OA 4HJ5A 1O7IA 1XTDA 4P72A 4DV3L 1XPRA 3S1NH 3OW2A 4PG3A 4DK6C 4JBWA 1FL0A 2VL6A 1LTLA 2Z0SA 2K4KA 4LWCA 4TQUS 4DR3Q 1EOVA 1VQMA 1P8LA 2KHIA 1PFSA 4LUVA 4A3BH 2JA5G 1HNXL 5M5YH 2R93H 1TWAH 3RN5A 4LF9L 4GNXA 1PVOA 4LF5Q 3HKZE 3HOVG 4PZ7A 4JI4L 2WP8J 3CCUA 5IYDG 2R92H 2Q2TA 4DR5L 2RCNA 3CCMA 3S14H 1K8GA 4JI3Q 1W2BA 1WJJA 2DGYA 3ULPA 3L0OA 1N8RC 2OTLA 3HOXH 4QQBX 3UE0A 1KC8C 4POGA 1B8AA 1VQ6A 2KENA 1PYSB 4EX5A 4HJ7A 1Y1VH 1VQOA 4MTNA 4LF9Q 1IZ6A 4OO1I 4LF8L 3FP9A 1HNXQ 4DR1Q 4LFBL 2PQAA 4R4QA 2ZJQA 4DV4L 2Q2UA 4WJ3M 2VZAA 2EQSA 2Y0SE 1XMOL 2L15A 2E5LQ 4GN4B 1VQ4A 3BU2A 4GN3B 1L0WA 1EIFA 1HZCA 3T1YQ 4JBMA 1Q12A 3PO3G 4IPDA 5K36G 1L1OB 1AE3A 4A3GG 2JJQA 4BXXG 2UUCL 1HR0Q 4DR4L 4C3IH 1I50H 1Q7YC 1OXUA 1X3GA 5DLQE 5C44H 3NEMA 3G71A 1ASZA 2I5HA 2HHHL 1VQJA 2MO1A 1X3EA 2NZHA 2ZJRA 1N34L 2YTYA 1XMQL 3BJUA 1VQ5A 4A3CH 1FGUA 4OX9L 1A0IA 1WFQA 2K14A 3CMEA 2NVYH 4L5SA 1PH5A 2B29A 1LM0A 4A3EG 2I0QA 4BY7G 3HKZG 2Q2HA 2PNHA 3KF6A 1KRSA 3AFQA 3PUWA 5C0XI 2JA9A 4DR4Q 4Y7NH 4JI0Q 4X62L 3M3YH 4GKKL 1PYBA 2QGQA 4JC0A 4YWMA 3CCJA 1VQ8A 2NVXH 3PO2H 3T1YL 3OTOQ 1G291 5M5XH 4JI7L 1WCMG 1KQSA 4BBSG 4UY8C 3ULJA 4DKAC 3S16H 2WAQE 5IP9H 1PH9A 1JMCA 5FLMG 4NXML 5GQOA 4LF8Q 4YCWA 2ZTCA 3M9BA 1P16A 5IYBG 2BH8A 1JB7A 2JK8A 1K8AC 4HJ8A 3KJOA 2Y0SG 3NELA 3HOWG 1IXRA 1PH8A 2H5XA 4X62Q 5M5WH 2JA7G 3LGJA 5IWAL 2MFIA 1VQEA 1E1TA 4KHPQ 1OXXK 4DV6Q 1Y1VG 4R4TA 4GLVB 3A5UA 3J80c 1N33Q 3PO3H 4PZ6A 2IT1A 1E3PA 2BA1A 2XTIA 2UXBQ 2WAQG 3EBEA 3JC66 1YHQA 4IFDG 4JI0L 3IRBA 3A0JA 1QZGA 3H15A 4POFA 4MNOA 4X66L 2R7DA 4AH6A 4BY1H 2A1AA 2KHJA 3KF6B 4L5TA 1X65A 2D0PA 3PF5A 4KI0A 1PH2A 5JJIA 3CMAA 1Q86C 2HIVA 1Q82C 1N36L 1YVCA 4B3MQ 4IPHA 1N33L 4R4OA 5FJ8G 4YY3Q 1SROA 4LNQA 1EUJA 1T9HA 3UDFA 1OXSC 4KHPL 3RZOH 4DR1L 4LFBQ 3FHWA 2QA4A 4NPSA 1VQKA 4NXNQ 5IWAQ 3M4PA 4JI2Q 1NMGA 5M3FG 1BKBA 5GAGC 1GM5A 1QUQA 1JT8A 1I3QH 5IY0A 2N49A 3GTJH 3J7ZC 5JEAG 2B3GA 2C35B 3GTKH 4L5QA 3I4MG 3MXNB 3U50C 3AEVA 4BBSH 4GOPB 1I6HH 4JOIA 1HH2P 4DV4Q 1L1OC 4IFDI 3UDXA 4YWLA 4BY1G 3Q8DA 3S1QH 1XNRQ 1GO3E 3MEFA 4UP9A 3GDEA 4A3MH 3H3VI 2R7ZH 1E22A 3I7FA 5C0XJ 4JI3L 1VQBA 4TVAB 1PHJA 3K81C 2NN6G 3I56A 1TXYA 4ALPA 1X9NA 4JOIC 1QZHA 4OWWB 4OWTB 1G51A 1JJGA 4MZ9A 4XTCS 1K3RA 3KDFB 5IP7H 1FJGL 3H0GG 1ASYA 2F52A 5JJKA 5FJ8H 4LFCQ 1KXLA 1IBKQ 4JI6Q 1UWVA 5AJ3L 2YV5A 2MNAA 2JEAI 4JI2L 3CF5A 5LMUQ 1EFWA 3STBD 3HOWH 4GLAC 1PH4A 4WJ4A 3K8AA 4QJFA 1J6QA 1V43A 4A3FG 1NTGA 1N32Q 4DR3L 3PUYA 2VW9A 5FLMH 1HZ9A 4YY3L 3GTLH 2YTVA 4B3ML 2IHEA 4QY7A 3CC7A 1N36Q 2KCMA 3GD7A 3GO5A 4OONA 3KF8B 1YEZA 1FJGQ 1SR3A 4JI1L 2PI2A 5C4JH 1VCIA 4O0AA 1PH6A 2OQ0A 3RNUA 4A75A 2E5LL 3HOYH 2AWNA 3CCVA 2JA5H 1PV4A 4X66Q 1Q1BA 1AH9A 3F8TA 1CKNA 5HY6A 1HZBA 3G48A 3BZCA 1VQDA 3HFZB 3WWVA 2OTJA 3TQYA 1Q81C 3I55A 3F2DA 2JA8H 2ZJPA 2CKZB 3HOZG 1HNWQ 3ER0A 2CWPA 4DR6L 2ZTEA 3K0XA 1XNQQ 1IYJB 4B3RL 3STBC 4DPGA 2DUDA 3A5ZB 1AE2A 1N9WA 2UXCQ 2ZM6L 1Z47A 1LYLA 3RLOA 1C0AA 3K7AH 1E24A 1PH1A 1VQ7A 3F2BA 2Q2IA 4DV2Q 4DV7L 2RF4A 4K0KQ 3RLNA 1IBML 1VQGA 2VS1A 3PIPA 1RL2A 1MIUA 4J15A 3HKSA 1WYDA 1X54A 1V1QA 5LMNL 5C0XG 1NMFA 4JYAL 2IX0A 3W1BA 3U4VA 3M7NA 3H0GH 3GTGH 3OTOL 4JI7Q 2JA6G 1TWGH 3TREA 2LXKA 1J5EQ 1QVCA 2CFMA 4LUZA 1WCMH 3DLLA 1Y1WG 1KAWA 3HOVH 2BA0A 1M1KC 2K5HA 4DV0Q 4DV1Q 2E2IH 4JBKA 4A3LG 1YITA 4OXPA 1VQCA 4O2DA 4YCUA 3HOZH 3HOUH 3CXCA 2BH2A 2OWOA 1B70B 2D0OA 1HJPA 5GROA 1VS0A 3HOYG 2YTXA 3AYHB 1A8VA 1NBWA 3PV0A 4GOPC 3J80i 1IBLQ 4YHHL 4BY7H 1C9OA 1D8LA 2AHOB 1XPUA 3FKIG 4A93H 4JV5L 5ELNA 4HJAA 2I5LX 3EN2A 4X6AH 4KHZA 4IOAA 1VQIA 1R9TH 3I2ZA 2UUCQ 4YCVA 1U0LA 4QL5A 2UXDQ 2K75A 3H3VH 3E9IA 1VQHA 2ZTDA 1K73C 1BVSA 2N78A 3NENA 4JYAQ 1CSPA 3PUZA 5M3MH 4B3SL 4B3SQ 4LF7Q 1SN8A 1JJ2A 4LF7L 2UUAL 5C4XG 3J7A5 3DM3A 4IPCA 2VNUD 1CSQA 3KOJA 4P74A 2R6GA 4HIKA 1S72A 1LUZA 4UP7A 1OTCA 4GKKQ 3K7UC 4IJLA 4A93G 5GAEC 3PO2G 1L2FA 4A3JG 2VQEL 4P73A 3S1MH 2UXCL 3CQZH 4DR5Q 4P75A 1TWFH 1I5FA 2PI2E 4DR2L 4A3IH 4A3BG 3S2HH 5GADC 2Z6KC 4BBRG 1PA6A 3S24A 3I4NH 2K5NA 2CQOA 4A3LH 1GVPA 4LFAQ 1XMQQ 4A3DG 2UUBL 4IPGA 2ALYB 3TEHB 2MQHA 3UDGA 3F1ZA 1JE5A 3GTMH 2JA7H 3CD6A 1CKOA 2AWOA 5IP9G 4A4IA 4LUOA 4DV3Q 2JQOA 1QVGA 1H95A 4QGUA 1EQQA 2N8NA 1J5EL 1C7YA 1M90C 4RG1A 3RR5A 5ELOA 2F4VQ 1CKMA 3KJPA 1VQAA 2GVBA 1DGSA 4A3JH 3SGIA 2QEXA 5M3FH 1UEBA 4NXNL 2UU9Q 3GTPH 1N32L 4B3TQ 1YJWA 3PIOA 3J81c 2VY3A 3L2PA 2B63H 4DUYQ 5JEAJ 3G6EA 3NBHB 5AJ3Q 1TWCH 3T1HL 4LFCL 1X6OA 2RHQB 4DV2L 3J81j 2WB1G 3OYYA 1D7QA 1S3OA 5M3MG 4DV5Q 4LF6Q 3JAMc 4AQYQ 3CCSA 2JE6I 4A3MG 3HOXG 4DAYB 3CW2C 3VDYA 1XNQL 1VQ9A 4B3RQ 4IJHA 2AMCB 2ATWA 5IYCG 2RHSB 3I4MH 4DR6Q 4HIOA 1EIYB 4LF5L 1VQFA 1EYGA 1NJIC 2R7FA 3CPFA 5J3BA 1XNRL 4DUYL 1B7YB 3S2DH 1Q46A 1BBUA 4A3EH 4GNXB 3G4SA 4AQYL 4DV5L 4LF6L 2A19A 3RLFA 2HIXA 5HGQA 2NN6I 4A3DH 2F4VL 2R93G 4GKJQ 2VQFL 4IFDJ 4HJ9A 4XIGS 2A8VA 1YNXA 3AQQA 4A3IG 2VUMH 1JJCB 3CPWA 4DUZL 2ID0A 4UPAA 5IP7G 3CCRA 1KHIA 3D0FA 1K9MC 1GKHA 4C2MH 3A74A 4JV5Q 4BXXH 4X64L 4A3GH 4R4IA 4YHHQ 2E2JH 3E9HA 1SRUA 1HR0W 5LMNW 3TRZA 3KYHC 5H1SE 1TWHH 4AIMA 4JCVE 4JI5L 1I94L 4LFAL 4AYBG 1VQNA 3TS0A 3CP0A 3ICEA 4A3CG 4OWXB 2HT1A 4QIWE 1VQPA 3S17H 1YJ9A 4DAMA 1V9PA 5BR8L 2IX1A 3S1RH 4APVA 2K50A 2OCEA 1L1OA 2WB1E 2VQEQ 3CCLA 2JA8G 4DR7Q 1A63A 3CCEA 1SLJA 2FXQA 4A3KH 1HNZQ 3I4NG 2KBNA 4NB3A 2I5MX 2PQAB 2UUBQ 1YZ6A 1E7ZA 2VUMG 1PH3A 1W3SA 4UP8A 5E7NA 4JBJA 2LXJA 3W1GA 2KCTA 5IYBH 1KD1C 4LF4Q 4AYBE 5GAHC 4C3HH 3JAMi 2NZOA 1XPOA 2JA6H 1X55A 3KFUA 1WI5A 1VQLA 1EWIA 2UXDL 2E8GA 2XGTA 1G6PA 3CCQA 4EQ5A 2YYZA 1UE5A 4JG2A 1SMXA 1OXVA 1UE7A 1KRTA 4BA2I 3TS2A 4NXMQ 1XJVA 1X56A 5IYCH 2UUAQ 3B6YA 2IHFA 4JI8L 4X65L 4B3TL 2IY5B 4LF4L 4C3JH 5C3EG 2K52A 1YHAA 2UU9L 1QUQB 2V1CC 3CAMA 3M4QA 4L5RC 3GTOH 1RIPA 2CWAA 4YWKA 3UDIA 1CKNB
chains in the Genus database with same CATH superfamily
1EQRA 3U58A 5IE8A 1EY0A 2KCNA 3M85A 3EIVA 5C4XH 2K5VA 2L4NA 5DAUA 1EY5A 2AUKA 3HOUG 1MHWC 4OL7A 4IO9A 1WD1A 1S5ED 2R93B 4ME3A 3E0EA 4X64Q 1SE4A 4XDXA 3T53B 5CR3A 5KNBA 1PRTB 4QUFA 5LMUL 4RKLA 1IBMQ 4DNTB 1SJED 1MKHA 3MFYA 3NUCA 1WTOA 3FKIB 3L7ZC 1MJEA 1YJNA 2CH4A 4GLXA 2F0MA 2ZM6Q 2DNEA 2X6GA 3DWPA 3UE1A 1QVFA 2MO0A 1MJCA 1SE8A 4FF4A 2NVTH 4A3FH 4LJZC 4PMWA 2F3WA 1QJOA 3BZKA 1C4QA 1NE3A 5BR8Q 4G7HC 2B63G 3IL8A 1PLFA 3T1HQ 4IOCA 1SYBA 1HNWL 3GTQH 2XN9C 3ERSX 2ICEC 3K80C 3TP7A 2ZXOA 1EWCA 4GS3A 4C3JB 4BBRB 4HIDA 3ULPA 2OQKA 3EA6A 4DUZQ 4ZRZA 4C3JG 3AFPA 3I91A 1IBKL 4XQQA 4HJ5A 4O42A 1CFMA 1XTDA 1XPRA 3D4WA 1OO9B 3D4DA 4C3HB 4DR3Q 4LWCA 1Y8NB 1DONA 4IUTA 1MBYA 2J4XA 2BCOA 3HOVG 1A15A 2KJXA 1W6KA 3E5SA 2R92H 3FPUB 2WAQB 1YNND 3S14H 1K8GA 4JI3Q 3S17B 2BE5D 3L0OA 5A2QE 1DOLA 5IT9L 4POGA 1B8AA 2OT2A 4HJ7A 5E4XA 4OO1I 4HAEA 2E2JB 2EY6A 2EYJA 3FEWX 2PQAA 4N9TA 4C2MB 5FLXL 1PXUA 2Y0SE 1K28A 4KY7A 4ZUIA 3HEJA 5LHY1 4DA2A 1RKNA 3T1YQ 1EIFA 3PO3G 5ELDA 1LTSD 4U68A 1L1OB 4L6TB 4DR4L 2F0SA 4TRDA 1EIHA 2VB3X 4L63B 1ASZA 3SK4A 3WDNA 2EYPA 1VQ5A 1FGUA 4A3KB 1WFQA 2EYOA 1HA5A 1SSOA 3HGBA 4JW0A 2ZXRA 2I0QA 4BY7G 1TU2B 4EQOA 3OPOA 1KRSA 4JI0Q 4ZKBB 3M3YH 1RCVD 3CCJA 1K8MA 3PO2H 1TWCB 2AUJD 3OTOQ 3MHBA 2WV6D 3HG9A 1KQSA 1EU3A 3KBXA 4KJOA 3S16H 1VMPA 2WAQE 2HQEA 4Q5VA 4Z9CB 1BNZA 1CQFA 4RFBA 1LACA 3EROA 1JB7A 2FJ2A 2JK8A 3KJOA 1PH8A 2H5XA 1EZ8A 3CRLC 4J1MA 2PNRC 4KHPQ 2JA7B 1F9SA 3S2DB 3J80c 4PZ6A 3PIP3 1E3PA 2WAQG 3JC66 4IFDG 1JR0D 3IRBA 3I4NB 2OEOA 2C9OA 3S2HB 4MNOA 1KDCA 3BVZA 4BY1H 5CV5A 3KF6B 1SNDA 2D0PA 3PF5A 3CMAA 1Q86C 1EYDA 1XX8A 3MTSA 4LNQA 2D9UA 1EY6A 2L5TA 1OXSC 4DR1L 4LFBQ 3FHWA 2QA4A 2NZ1D 1KTKA 4JI2Q 2LY7A 1CA6A 1NMGA 2RQXA 1JT8A 1BKBA 1I3QH 5IY0A 4M1UB 1PTOB 3J7ZC 3GTJH 3GTKH 5KGUA 1B1ZA 3U50C 4BBSH 1I6HH 2E75C 1AZQA 4HMJA 5G3LD 3UDXA 4YWLA 3S1QH 3V2TA 5CMDA 4P2CB 3K5NA 2D5DA 4UP9A 1RDPD 3I7FA 3M7GA 5C0XJ 3I8ZA 1TWFB 4TVAB 2NN6G 3K0YA 4V190 2NWGA 1X9NA 2A73B 1JE4A 1JJGA 4MZ9A 2B39A 1LTRD 1KXLA 5I9OA 4JI6Q 5EKIA 5AJ3L 2YV5A 4XXEA 1EFWA 3HOWH 4QJFA 1J6QA 1V43A 1NTGA 1CA5A 2VW9A 2A69D 2D2CC 2KEDA 4JI1L 1LT3D 2DJGC 2L1BA 3RNUA 4A75A 3CHBD 2JA5H 1PV4A 3F8TA 3WWVA 4CDEC 4DAVA 3TQYA 1HNWQ 3HOZG 3CKIB 4DR6L 2ZTEA 1SNOA 1XNQQ 1IYJB 4B3RL 4KKTA 3HOZB 1EEID 5I6YA 2E2IB 2ZM6L 1C0AA 5C4JB 4FP5D 3L3OC 1E24A 2DY7A 2QKIC 4CGYB 1FGBD 1VQ7A 2Q2IA 1GUOA 1BCPB 1RL2A 3U9OA 3GTLB 3QWNA 4WJWA 4CJ0B 5J1ZA 2PZWA 1NMFA 3T4AC 3M7NA 1SYEA 3GTGH 1TKWB 4WORA 1E0BA 1TWGH 2LXKA 1QVCA 1WCMH 3ND9A 4DV1Q 2KQ3A 2E2IH 2EXZA 2QILA 2PPBC 3HOZH 3BS1A 3HOUH 2OWOA 2M00A 1B70B 2D0OA 1HJPA 5GROA 1VS0A 2YTXA 4K5WA 4GOPC 4EGVA 1IBLQ 4BY7H 4I65A 2I46A 3FKIG 3R2IA 4S3SA 3HOYB 4IOAA 1JB3A 3TMEA 1U0LA 3H3VH 1E2ZA 1CSPA 5M3MH 4B3SL 2HCIA 4LF7Q 3C1EA 3URYA 5C5LA 3J7A5 3I73A 4HMIA 1S72A 1HTLD 1OTCA 4DU9A 2B2YC 3PO2G 4RA8A 4A3JG 1SYGA 3S1MH 2PZUA 2UXCL 4P75A 1TWFH 4DR2L 1D1IA 1LABA 2Y0SB 2R7ZB 3MVVA 2F0UA 2XRSD 2E76C 4A3DG 4HR7B 2NUCA 1G8ZD 3I90A 4K8JA 2EE1A 1CZGA 1I6HB 1LT6D 1CKOA 2AWOA 2I07B 3G7LA 1CHQD 1F9PA 3NTHA 1PTOH 3GTJB 4LUOA 5M5WB 2HUGA 1F9QA 1QVGA 1I3QB 1C7YA 3AU7A 3A7LA 3RR5A 4XYQA 1CKMA 2X6LA 1VQAA 2GVBA 1AW7A 1UUPA 4NXNL 4B3TQ 3N52A 1YJWA 3PIOA 1HFNA 2B63H 4FYDA 4DUYQ 3MWYW 1ESRA 2F0HA 4XQNA 1ESFA 1HHVA 3W3AA 5FKAC 4IUNA 1FNUA 3MXUA 2A74C 2NVYB 3VDYA 2ATWA 2RHSB 2RSNA 5BN4A 4HIOA 1EIYB 1EYGA 5J3BA 1BBUA 4A3EH 4GNXB 5F2DA 3G4SA 2FMCA 5DM73 3K59A 2HIXA 2NN6I 2F4VL 2R93G 2VQFL 1SNCA 2LKVA 1DM0B 3AQQA 4A3IG 3H91A 4UPAA 3VA7A 5IP7G 1KHIA 2KEEA 1D1KA 2F0FA 3S16B 4A3GH 4RCNA 1EY8A 3DXJC 5IGGA 3KYHC 2GA4B 5C3WA 5K5PA 5ELEA 2R61A 3M3YB 4Y7NB 4A3CG 4OWXB 1YJ9A 4DAMA 5HGTA 2K50A 3Q22A 2VQEQ 3K58A 1IYUA 2FXQA 1YZ6A 5CBEE 1FD7D 1ET9A 2CW0D 1LT5D 4A3BB 1KD1C 5C44B 4G57A 3JAMi 4OO1H 2XGTA 1TT2A 1A3TA 1GHKA 2YYZA 1UE5A 1AEXA 1SMXA 1DJRD 4NXMQ 2J7ZA 1X56A 3B6YA 4X65L 1JOOA 4B3TL 2IY5B 3J7YW 2V4DA 2F1MA 3GTOH 4K2LA 5CV9A 3UDIA 4K14A 1HNZL 3TP8A 2AKWB 1S40A 1X3FA 3V05A 1GUGA 3VYUA 1D5XC 3KF8A 2K32A 4FDBA 2NVQH 4WFN3 4DK3C 2HHHQ 3D6WA 4DR2Q 1Z9FA 5EBCA 5LMNQ 3AB9A 3KDFA 4H02A 4HIMA 1Y1WH 4JI8Q 1IL2A 1PTOC 4OELB 4RWSC 1A62A 3NQTA 4R1JA 4K0KL 3R3OA 4DV7Q 3CC2A 4GKJL 1YI2A 3F2CA 2WFWA 4ODGA 1K0RA 4ZLTF 2YU9B 4CKCA 3PGZA 2IL8A 3GTQB 2R92G 1Q8KA 1JCKB 3IFDA 2Z4HA 2N3SA 1HUMA 2E2HB 2B2VC 1HQMC 1KLGD 2GN5A 1M4VA 5C4ZA 5ELCA 1YIJA 5EAYA 1IBLL 3PUVA 4A3FB 4RH6A 1GD7A 2MHVA 4A3KG 1HPCA 4GOPA 1BCPF 4KKUA 4JI5Q 5C44G 1SNQA 2K04A 2F0WA 1SFOB 3GTOB 5FLXc 1JOQA 3M4OH 3RMHA 1SYCA 2JEBI 1EY9A 1HZAA 4DV1L 5CGKA 1CUKA 4RGNA 2ES2A 1Y69U 5C3EH 4GNXC 3D3RA 1GUSA 3DEOA 4DV3L 2DN8A 4I7ZC 1BOSA 1Z7TA 1YNJD 5IGEA 5C3XA 2RKSA 1PYWD 1L0XB 2VL6A 2Z0SA 4JBWA 1B50A 1G6ZA 4A3BH 2KHIA 4K8IA 3EJIA 1EYCA 3A8IE 4LF5Q 4PZ7A 4DN4M 1L0YB 2WP8J 4WRDA 3CCMA 1JWSD 5KRUA 3Q24A 1N8RC 4QQBX 1KC8C 1VQ6A 3NWSA 5E1FA 4LF9Q 1HUNA 1TWHB 4MTNA 5E4WC 1CTMA 1I4QA 2MPMA 2KHSA 2ZJQA 1SMYD 4DV4L 3BDLA 2VZAA 1SDFA 5CC4A 4GN4B 4HCEA 1K3BC 4NMZA 1HA6A 4GN3B 1E2WA 1EYAA 2HD3A 1AE3A 1PRTC 2JJQA 5I6WA 3J80E 1HR0Q 3OMCA 2F0TA 2JA6B 4C3IH 1I50H 2L9HA 4G4KA 4FF1A 1OXUA 1X3GA 5DLQE 2ENBA 2I5HA 3E0JA 2MO1A 1GJXA 2YTYA 4A3CH 3BJUA 1G91A 2PCFB 3CMEA 2NVYH 2B29A 1H9SB 4R8NA 2L55A 2F0VA 2Q2HA 1CQVA 2PNHA 3KF6A 5C0XI 1B44D 2JA9A 4DR4Q 5CORA 5DNFA 4GKKL 2AQ3B 2K5WA 1VQ8A 1QILA 5JEAH 3T1YL 4JI7L 1G291 1ZKOA 5M5XH 1WCMG 1PZID 2O4XA 3ULJA 2B63B 3FMCA 3C1FA 1PH9A 4NXML 5FLMG 5GQOA 4YCWA 3M9BA 1P16A 2Y0SG 1PDQA 2SNSA 1D2BA 2XSCA 1AP0A 2B2UC 2MFIA 1E1TA 1OXXK 4J8QA 2KVMA 4R4TA 4GLVB 5E3FA 5EJWA 2UXBQ 1YNNC 5IODA 4HEDA 4X66L 4N9PA 3S1MB 2R7DA 4AH6A 3TBIB 2KHJA 1X65A 5CV7A 4X3UA 1N36L 1QE6A 4CDDC 4QIWB 4IPHA 4R4OA 2M2LA 5JVH3 1EUJA 2PO4A 2XWBB 4KHPL 3GTPB 3FPPA 1PFMA 1H9MA 3S9WA 4NPSA 1VQKA 4OHJA 4IUQA 2NTSA 5IWAQ 1GUWA 1UEAB 5M3FG 1GM5A 1QUQA 1KDBA 4HSVA 4IFDH 3PMFA 2BOSA 4FF3A 2B3GA 2C35B 4L5QA 3I4MG 1T5EA 3MXNB 5I2YA 4JOIA 3P20A 3GTMB 1L1OC 2ZXPA 4BY7B 1GXDC 3MEFA 4DAYA 1B2TA 3GDEA 4A3MH 2RDHA 1RD9D 3K5LA 2XIWA 2K5QA 1S5DD 1BDOA 4A3IB 1VQBA 2JSOA 1TXYA 3P75A 3K57A 2OF1A 5AFWA 1XYIA 4FO2A 5FJ8H 4LFCQ 5ELFA 4R9WA 3CF5A 3STBD 5ELBA 3K8AA 5D3DA 5FLMH 4FVMA 3QIAA 4KD4A 3ZYYX 2IHEA 3GD7A 5IGDA 3KF8B 5FO8B 2PI2A 2OQ0A 2E5LL 2EJMA 2O2LD 2OTJA 1RF2D 4A93B 1I6VC 3EFXD 1D5ZC 3F2DA 2F0LA 3OMGA 2JA8B 3ERQA 4TKOB 1IL8A 1AE2A 2UXCQ 2Z4IA 3A54A 3LWEA 5J39A 3VYSA 1PH1A 4DV2Q 4DV7L 1VQGA 2VS1A 3QO2A 4PMBA 4J15A 3HKSA 2RDGA 1GUTA 1TIID 1W6JA 4OIKA 1I4GA 1D5MC 1I4PA 3OTOL 2JA6G 4LMQD 3TREA 4PV1C 2CFMA 3HOVH 2O5IC 2BA0A 1M1KC 3N6RA 4A3LG 4OGQC 2HDMA 4JBKA 2QDBA 4KY6A 4O2DA 3CXCA 2B2UA 2BH2A 1GUNA 1ILPA 4BS9A 1ZYRC 3T51B 4QUCA 4CJ1B 3MXPA 4F88A 1D8LA 2AHOB 3Q0AA 1WTWA 1VQIA 1R9TH 2UUCQ 4QL5A 1TS4A 2K75A 2MGSA 3MXNA 2EY5A 3DWAA 1SN8A 1RTNA 4IPCA 1SAPA 3KOJA 4P74A 2OXPA 4FXDA 3P7JA 3K7UC 2XWJB 5GAEC 4ZQ3A 1O80A 3CQZH 2Q8IB 4A3IH 5GADC 3I4NH 2CQOA 2FMMA 2H1EA 3LX0A 1XMQQ 1SJHD 2UUBL 1SMYC 1AFPA 2MQHA 3Q23A 4HSPA 2QEJC 1PRTF 2JQOA 4QGUA 1J5EL 2IX3A 2F4VQ 1IYVA 2RSOA 2WB1B 5M3FH 2X69A 2UU9Q 3RZOB 3UI2A 1N32L 5JJZA 2MUYA 1HRJA 4K2KA 2K1BA 3J81c 3L2PA 5JEAJ 4G7ZC 1STBA 3NBHB 5AJ3Q 3NP8A 3T1HL 1X6OA 5KEEA 3H6MA 1D7QA 1S3OA 4HTHA 4LF6Q 1STGA 2EY2A 4DAYB 2MP1A 3NHHA 2EYMA 2RBMA 4IJHA 2AMCB 4FXGC 5IYCG 1F9RA 4LF5L 3OHXC 4ZCKA 4DUYL 3ITPA 4PQXA 1SE3A 5FO9B 2ICIA 1HCZA 3H94A 4KD3A 5HGQA 1FR3A 4A3DH 4IFDJ 3KBGA 3J81L 2F0QA 4HJ9A 1YNXA 1JJCB 1S4ZA 1GHJA 4H7BA 3CCRA 1EQTA 1K9MC 3VYTA 4C2MH 4X64L 1SRUA 1HR0W 3TRZA 2HDLA 5M5XB 5H1SE 1I94L 4FXKC 4IURA 3ICEA 1YNJC 3S17H 3J81E 1TS2A 4APVA 2OCEA 1L1OA 3CCLA 4B9WA 4DR7Q 1EZ6A 1HTPA 1ZXTA 2KBNA 4NB3A 2I5MX 1E7ZA 3IAYA 2SOBA 4UP8A 1PH3A 2G5DA 2LXJA 2KCTA 5IYBH 1LO5D 1S5BD 4CDCC 4C3HH 2NZOA 1XTCD 1X55A 2DNCA 2A69C 1VQLA 1EWIA 2E8GA 2P5ZX 5DM63 5IGFA 1XJVA 2UUAQ 1U9RA 2IHFA 4OEMB 3VR3A 3A8KE 4YWKA 1PZKD 2ASBA 2RCFA 4DR7L 1LTTD 2M9VA 1K8OA 3J81i 1F77A 1TVXA 1SXTA 2EXDA 3DMUA 1E1OA 3TP5A 3NXWA 2EIFA 4OX9Q 3GQBA 2UXBL 4KY5A 4EQNA 3OW7A 3MXGA 2LSSA 2PMZE 1HFGA 3S15H 4LW1A 3TSSA 4DV6L 4X65Q 4F8MA 5COYA 4DFAA 3SK8A 1STYA 2EYLA 3D6CA 3FKIH 3W5OA 2F3IA 4BA1I 3DM1A 3CC4A 1LLRD 3PSIA 1B4OA 3VR4A 4GZYC 3PF4A 5A35A 3RZDB 1A3UA 1IHZA 2B8FA 5JJLA 4R4CA 2CCZA 4QCLA 1SFOH 2D62A 1TY0A 1K0SA 4RMFA 1VMCA 4CBVA 2TMPA 1YHBA 5C4XB 2HQLA 1NAPA 1YBYA 3D31A 3NTKA 4JI4Q 2EDGA 5FK9C 2E2HH 1BBWA 2NB0A 3U4ZA 3FVQA 5K36H 1STAA 1V1OA 2YU9H 3H09A 3PCOB 1Q1EA 2N88A 4A76A 1SEBD 1K83H 3GP7A 1UE1A 3MC0B 4DNIA 4OO1G 2B2WA 4KLKA 4JI1Q 1JOKA 1NR4A 1U4LA 4XQJA 5IT9c 4JI6L 3KK7A 4RGMA 3EQLC 1STHA 5EKKA 3T13A 1FL0A 3CRKC 1LTLA 2K4KA 2PW5A 4TQUS 4ULLA 1EOVA 1VQMA 1P8LA 1V8QA 2KUMA 1HNXL 2JA5G 1ZEQX 1TWAH 3RN5A 5LL6S 4LF9L 1PVOA 5EBDA 3HKZE 1VF7A 1G2TA 2NVQB 1I4HA 3GV3A 4JI4L 1PZJD 2WACA 2K6AA 2PQEA 5IYDG 3CCUA 4DR5L 2RCNA 1SNPA 1PTOD 1B3QA 1W2BA 1I4XA 1CT1D 1QNUA 5T1GA 3HOXH 2RDFA 3SVMA 3A8JE 1Y1VH 1VQOA 4LF8L 3PIO3 4HCSA 4DR1Q 4LFBL 4R4QA 4WJ3M 2Q2UA 2EQSA 1R4PB 2BDOA 2L15A 3Q6SA 3K5MA 2E5LQ 5JPMC 4F87A 1L0WA 3DWQA 4JBMA 3I4LA 5K36G 4IPDA 4A3GG 5LL6X 2UUCL 1B9NA 1Q7YC 1KNAA 2G9HD 5C44H 2XNAC 3G71A 3NEMA 3JAME 2B2TA 2B2YA 4XT3B 1VQJA 2NZHA 2ZJRA 1N34L 1EOTA 1J8IA 3I4MB 4OX9L 4L5SA 1PH5A 4A3EG 4JVZA 3AFQA 4Y7NH 2TSSA 1FNWA 1PYBA 2NVXH 1IW7C 4ZYSA 4IALA 2JYOA 3DHQA 1J9OA 5DEHA 5TSSA 1AN8A 1EWHA 3SDZA 2JXMB 2VUMB 2BH8A 4CKEA 4HJ8A 3NELA 1STNA 3HOWG 4C3HG 4I7AA 2JA7G 1H9SA 3LGJA 5IWAL 3FDTA 3IFTA 1VQEA 2EJFC 3F2UA 4QMGA 4MTKA 1ML0D 4KK7A 5CYUA 5IIFA 3R2TA 4K6LA 5D3IB 1N33Q 3PO3H 4M8AA 2IT1A 2BA1A 4RHSA 2G9DA 2XTIA 5EPLA 3EBEA 1YHQA 2Q8TA 1ET6A 4JI0L 3WOFA 2L11A 3NPPA 1B53A 4POFA 2O5JC 4V0BA 3CQZB 2FFKB 4L5TA 1HXYD 4R8IA 5KNDA 1JICA 1MSGA 4YIJA 4KHVA 4B3MQ 3ONAB 1ENAA 3UDFA 1T9HA 1WTHA 2NYZD 1UAPA 3NE5B 2F0JA 4B9XA 3DUZA 1R9TB 2N49A 5JEAG 5BN3A 1CI3M 1IW7D 2EYFA 3KLSA 1HH2P 4BY1G 1EL0A 2CHBD 1XNRQ 1RJTA 4CJ2C 3H3VI 2R7ZH 4JI3L 2K28A 4U673 1U4MA 1F2ZA 4JOIC 5C5MA 1QZHA 1BCPC 1FNVA 2C5CA 1K3RA 3KDFB 4RGTA 4XTCS 2A5HA 3H0GG 1ASYA 1LV9A 1IBKQ 1UWVA 2MNAA 4H13C 2ZT9C 3H0GB 4GLAC 1PH4A 4WJ4A 2EZVA 4A3FG 1N32Q 4DR3L 1HZ9A 4IUVA 4YY3L 2YTVA 3CC7A 1N36Q 4C1NI 2KCMA 3GO5A 3LWUA 4OONA 1YEZA 1SR3A 3K7AB 2SDFA 1X32A 1PH6A 3HOYH 3TP6A 1NUCA 4X66Q 1AH9A 4ILWA 4PMCA 1CKNA 1MGSA 1HZBA 3G48A 3I55A 2JA8H 2CKZB 1KDAA 3K0XA 2E74C 2H4OA 3STBC 4DPGA 3A5ZB 1BBXC 1BF4A 3RLOA 1KAAA 5JVG3 1IKLA 3C3LA 3RLNA 1IBML 3PIPA 1V1PB 5CV6A 1S5FD 5FO7B 1JC7A 2IWHA 1WYDA 4RKBA 1V1QA 5C0XG 4JYAL 2IX0A 3A56A 3W1BA 5EPKA 3CU7A 1RHPA 3E6ZX 4JI7Q 1MD2D 4IQZA 5I9PA 3DLLA 1GOZA 4DV0Q 3BVMA 1O7YA 1YITA 4OXPA 1VQCA 3I3CA 1BQQT 4A3MB 3TDQA 1A8VA 1ICFB 1NBWA 3PV0A 4EVOA 4YHHL 1XPUA 1SYFA 3T56B 5ELNA 2I5LX 3EN2A 4KHZA 2EY1A 4UAIA 4YCVA 1Q8IA 1I4RA 1VQHA 3HKZB 2ZTDA 5M9OA 3OSOA 1V1PA 3V96A 2N78A 1A6XA 3OOCA 3PUZA 4B3SQ 4LF7L 2UUAL 3R93A 5C4XG 3HOWB 1C48A 3DM3A 2VNUD 1Y8OB 2IW3A 2R6GA 3X3NA 4UP7A 2F0IA 4UHVA 4IJLA 4BWGB 1L2FA 1B9MA 1BR9A 5JPNC 1I5FA 2BDNA 2Z6KC 4IUPA 4BBRG 3S24A 4A3LH 1GVPA 4LFAQ 3QG1A 4RCOA 4IPGA 1TQOA 2ALYB 2K01A 3TEHB 3F1ZA 1JE5A 1TS5A 2WINB 5CV8A 3CD6A 5HURA 4BBSB 4JK1C 4A4IA 4DV3Q 3PQIA 1JWMD 2L12A 1H95A 2SNMA 2N8NA 5C4HA 5ELOA 3KJPA 1DGSA 4A3JH 3SGIA 2QEXA 4DK1A 3TZUA 1LTID 2VY3A 3G6EA 2A6HC 2Z9HA 4LFCL 2RHQB 3E3XA 2WB1G 1KABA 5M3MG 1KLUD 4BY1B 1TS3A 4DV5Q 1ENCA 1PRTD 4C56C 4F7XA 3HOXG 4A3MG 3CW2C 1XNQL 5D14A 4B3RQ 5G3LF 4DR6Q 3HRZC 5L37A 3PO3B 4X3TA 3S2DH 4O1NA 3KLSX 3W2DA 2F0KA 3OWEB 4AQYL 4C3IB 2WKCA 4LF6L 1BCPD 3KUPA 4GKJQ 5CV4A 3QR8A 4XIGS 2VUMH 4DUZL 2ID0A 3NK9A 4LK1C 3BYYB 3HZXA 1GKHA 4R4IA 4YHHQ 3E9HA 1WD0A 4IUUA 1PFNA 5LMNW 1PMRA 1TWHH 3PO2B 4H44C 2NVXB 3SEBA 4AYBG 3CP0A 3RUZA 1VQPA 1A2TA 1V9PA 5BR8L 2PMZB 3S1RH 2IX1A 3BYTB 2EYHA 5ISRA 1A63A 1SLJA 4ABNA 4A3KH 1HNZQ 3I4NG 2PQAB 2UUBQ 2LS01 2VUMG 5IT9E 5M5YB 1QG7A 3W1GA 4NP5A 3GV6A 4AYBE 2A6HD 1DD2A 1JORA 3U9SA 3S1NB 5FLXE 2UXDL 2F0OA 5C0XH 1G6PA 3CCQA 4EQ5A 5C3EB 1OXVA 1UE7A 5T1IA 2DJFC 1KRTA 3TS2A 3D8GA 1Y8PB 5C3EG 2K52A 1YHAA 2V1CC 3DEPA 2WIIB 4L5RC 3M4OB 3IKJA 3HP3A 2CWAA 1Y1VB 1II3A 2SEBD 1OXTA 3HOXB 4PZ8A 1KL9A 4NW2A 3S14B 5BN5A 1WTVA 3MZ5A 4KN4C 1WOCA 1PH7A 2Z6KA 1R4QB 3G6JB 4G7OC 2GVAA 4DNRB 1HR0L 2A68D 1KIXA 1NY4A 1A2UA 2VQFQ 3ULLA 4P71A 1UE6A 1FYCA 1PTOF 3NWTA 1XMOQ 1STEA 4BBRH 3R8BA 5IGBA 2LMCB 4PNYA 1Z6HA 1Y14B 1Y1WB 4AYBB 1QCBD 5I2XA 3AMUA 1NCVA 1C8CA 4RHRA 5IYDH 2N55A 2VB2X 4X3SA 1U5KA 1FVIA 3J7AV 4GN5A 3WOEA 5IGCA 3RN2A 2F0PA 2R7ZG 3K6OA 2NVTB 4B08A 2IJ0A 3ZJYC 1I94Q 3BDOA 1N34Q 2B2TC 3C2PA 3X3MA 4QF4A 4DXGA 4ZAIA 5D65A 3SE0A 1WVLA 3NBHA 3RZDH 3M4YA 3SK5A 3PUXA 4NXNQ 4DV0L 4IZ8A 3J7AF 1WTPA 1TR5A 4Y52H 3KLWA 3I4OA 5KYIA 1MI2A 1O7IA 4K6DA 4P72A 3S1NH 3OW2A 4PG3A 2MJ8A 1QB5D 4DK6C 4CHTB 5EGTA 3S15B 1PFSA 4LUVA 1U4RA 5M5YH 2R93H 4GNXA 4KTAA 1CK1A 3SXHA 1ENFA 4QB4A 2Q2TA 1ZYRD 3S1RB 5J22A 1WJJA 2DGYA 2OTLA 3BVGA 3UE0A 2KENA 1PYSB 4EX5A 1IZ6A 1JQYD 3SK6A 3FP9A 1HNXQ 3QB3A 4A3GB 1HQRD 4N8X1 5KNCA 1QNKA 1XMOL 4EQPA 2JN4A 1VQ4A 3BU2A 2F0DA 2K5DA 1HZCA 1Q12A 4BXXG 1SBBB 1EEFD 1X3PA 4X3KA 2KOLA 4A3EB 3LNNA 1O7LA 2HHHL 2PZTA 1X3EA 1H9RA 1XMQL 3SHLA 1A0IA 2K14A 1NNXA 2DY8A 1LM0A 1LT4D 2KECA 2A68C 2XRQD 2AQ1B 3A7AB 3HKZG 3ND8A 3PUWA 3HS0C 4X62L 1TY2A 4JC0A 2QGQA 3NSWA 4YWMA 1E2VA 4KJNA 4BBSG 2HCCA 4UY8C 4DKAC 3H3VC 1BO0A 5IP9H 1JMCA 4A3JB 4LF8Q 2ZTCA 4KMUC 5IYBG 1K8AC 4IN3A 5NUCA 1IXRA 1O78A 4J6HA 4X62Q 1WTRA 5M5WH 4A3DB 4DV6Q 1Y1VG 4HN7A 3A5UA 2PYKA 1DOKA 1NR2A 1X3QA 2RA4A 2WKDA 5CBAE 3A0JA 1QZGA 2K03A 3H15A 3L9AX 3SR1A 2JP1A 1XWEA 1CZWA 2A1AA 1U4PA 1SYDA 2FHTA 5JJIA 4KI0A 1PH2A 2Z1CA 2HIVA 1Q82C 3VYRA 4K5VA 1YVCA 4CDFC 3RD4A 1N33L 5FJ8G 4YY3Q 5KYLA 1SROA 3I72A 1MSHA 1QOHA 5M3MB 4KKSA 5M3FB 3RZOH 1SNMA 3M4PA 1D6EC 5EQ0A 5GAGC 1LTGD 2FINB 3MEHA 3AEVA 4GOPB 4DV4Q 4IFDI 1T5XD 2QCPX 3Q8DA 2CQAA 1GO3E 4ME5A 5I4DA 1G2SA 4FF2A 1WTXA 1E22A 5KIXA 3HOUB 4DK0A 1PHJA 3K81C 3I56A 4ALPA 2F0GA 4OWWB 2EOTA 4OWTB 1G51A 4ID6A 1WCMB 5IP7H 1FJGL 5JJKA 2F3VA 2F52A 1TWGB 1BUVT 2JEAI 1F2YA 2K7VA 4JI2L 4KV6A 1H9JA 5LMUQ 3GTGB 4ZUJA 3PUYA 3GTLH 3VR2A 4OIJA 4B3ML 4XYOA 4QY7A 3OIQA 1DCZA 1FJGQ 4FNFA 5C4JH 1VCIA 4O0AA 3JAML 2AWNA 2J0TD 3CCVA 3NQIA 1Q1BA 5HY6A 2BE5C 3BZCA 1VQDA 3HFZB 4DGZA 1Q81C 4DAPA 2ZJPA 3ER0A 2CWPA 4ZK9B 2QW7A 4N8FA 2Z8LA 3O13A 2DUDA 2JA5B 1DZ1A 1N9WA 4RGOS 1QWYA 1Z47A 1LYLA 1NSNS 3BZDB 4H0LC 2Z6BA 3K7AH 3HOVB 1DXMA 2RVLA 1RTOA 3F2BA 1O7ZA 2RF4A 5EPJA 3P1HA 4K0KQ 2F4IA 2IPKD 1MIUA 3J80L 1X54A 5LMNL 5JAVA 3U4VA 2A6EC 2EJGC 3H0GH 3OIPA 2F0NA 1J5EQ 4LUZA 3MFGA 1Y1WG 1KAWA 2AQ2B 1UNSA 2K5HA 4YCUA 2EPBA 3T16A 2VXWA 1VDZA 2NTTA 3HOYG 3QJYA 4C3IG 1ILQA 3AYHB 4Q0FA 3J80i 3S1QB 1C9OA 1EU4A 4A93H 2E2DC 3TN2A 4JV5L 5FOBB 4X6AH 4HJAA 4JPBW 3GTKB 3NTIA 3I2ZA 1A3VA 2CH4W 2UXDQ 1F2LA 2K33A 4UDUC 3E9IA 1EY7A 1XXGA 4XT1B 3K5OA 1K73C 1BVSA 4JYAQ 3NENA 3D4RA 4K5XA 3BG3A 3VA5A 1JJ2A 2F03A 1BXTA 4ZKCB 1CSQA 1PFBA 4HIKA 1LUZA 4GKKQ 3QOLA 2QF7A 3OWFA 1IKMA 4A93G 1LTAD 2VQEL 4P73A 2Q8RE 4CKBA 3EVQA 4DR5Q 2PI2E 4A3BG 3S2HH 3NBIA 2PW7A 1PA6A 2L0CA 2K5NA 4L8JA 3KLRA 3UDGA 3TZDA 2XVSA 3GTMH 2JA7H 5IP9G 3C46A 1KNEA 1AZPA 3MA2B 5EKLA 1EIGA 3QOJA 4LAAA 1EQQA 1M90C 4RG1A 1B3AA 3FRPB 1F2MA 2CVRA 5A2QL 2B2WC 1UEBA 3GTPH 2K05A 4MIUA 1ONLA 1TWCH 2LFNA 4DV2L 3J81j 3OYYA 1CM9A 1EQVA 3JAMc 4AQYQ 3CCSA 2EVBA 2JE6I 2QDLA 1VQ9A 1Q90A 3I4MH 3I70A 1VQFA 1NJIC 2R7FA 1CHPD 3CPFA 1XNRL 4NKLA 1B7YB 2KCCA 1Q46A 2F0EA 1M8AA 4RAUC 4DV5L 2A19A 3RLFA 4KN7C 2A6ED 2A8VA 2B8GA 3CPWA 1H9KA 3D0FA 3A74A 4JV5Q 4BXXH 2E2JH 2NBFA 2NN6H 2B2VA 4DF7A 1VF5C 4AIMA 4JCVE 4JI5L 1DOMA 4NDXA 4LFAL 1VQNA 2CW0C 3TS0A 1RODA 1ICWA 2HT1A 4QIWE 1Q3LA 2KA7A 2WB1E 2R92B 1WTQA 2JA8G 3CCEA 4TSSA 1TWAB 1S5CD 1W3SA 5E7NA 5IOCA 3MAQA 4JBJA 1EY4A 4E6IA 4LF4Q 5GAHC 3A55A 1I50B 1DYQA 4C1NK 1XPOA 2JA6H 3KFUA 1WI5A 3VR6A 1JWUD 4JG2A 4BA2I 1SE2A 4MHEA 5C6AA 4JI8L 1K83B 3BDCA 5IYCH 3VR5A 4LF4L 4C3JH 1EFID 2UU9L 1QUQB 3CAMA 2R3ZA 3M4QA 1LTBD 4DXFA 1RIPA 5JOBA 4MN3A 1CKNB
chains in the Genus database with same CATH topology
2ASBA 1HNZL 1EQRA 1OXTA 3U58A 4PZ8A 2AKWB 5IE8A 4DR7L 3J81i 1KL9A 3M85A 1S40A 1X3FA 3EIVA 2EXDA 4FDBA 1E1OA 5C4XH 2K5VA 2EIFA 4OX9Q 2NVQH 3HOUG 2UXBL 4IO9A 1WOCA 4DK3C 2Z6KA 1PH7A 2HHHQ 4ME3A 2LSSA 2PMZE 3E0EA 3S15H 4LW1A 4X64Q 4DR2Q 1Z9FA 5LMNQ 4HIMA 1Y1WH 3KDFA 4H02A 4DV6L 4JI8Q 4X65Q 1IL2A 2GVAA 5LMUL 1HR0L 1A62A 4R1JA 1IBMQ 4K0KL 3FKIH 3W5OA 4BA1I 2F3IA 4DV7Q 1NY4A 1KIXA 3CC4A 1MKHA 3PSIA 2VQFQ 3L7ZC 3ULLA 3CC2A 4P71A 1YJNA 1MJEA 4GLXA 1YI2A 4GKJL 1UE6A 3F2CA 2WFWA 3PF4A 2ZM6Q 1XMOQ 4BBRH 1K0RA 3UE1A 1Y14B 1QVFA 5JJLA 4R4CA 2MO0A 3PGZA 2CCZA 1MJCA 1SE8A 2D62A 1SFOH 1Q8KA 2R92G 5IYDH 2N3SA 1U5KA 4RMFA 2NVTH 1FVIA 4A3FH 1YHBA 2GN5A 4PMWA 4GN5A 3RN2A 3BZKA 2HQLA 2R7ZG 1YIJA 5EAYA 1NE3A 1YBYA 5BR8Q 3D31A 2B63G 4JI4Q 1IBLL 3PUVA 1GD7A 4A3KG 4GOPA 2E2HH 3ZJYC 4IOCA 1BBWA 5C44G 3T1HQ 1N34Q 3U4ZA 1I94Q 4JI5Q 3GTQH 1HNWL 3ERSX 5FLXc 3K80C 3M4OH 2YU9H 2JEBI 3PCOB 1Q1EA 4GS3A 4A76A 3RZDH 1K83H 1HZAA 1UE1A 2OQKA 3PUXA 4DNIA 4DV0L 1CUKA 4DV1L 4HIDA 2ES2A 4OO1G 4DUZQ 4KLKA 4JI1Q 5C3EH 4Y52H 4GNXC 3AFPA 3KLWA 5IT9c 1IBKL 4JI6L 3I4OA 4HJ5A 1O7IA 1XTDA 4P72A 4DV3L 1XPRA 3S1NH 3OW2A 4PG3A 4DK6C 4JBWA 1FL0A 2VL6A 1LTLA 2Z0SA 2K4KA 4LWCA 4TQUS 4DR3Q 1EOVA 1VQMA 1P8LA 2KHIA 1PFSA 4LUVA 4A3BH 2JA5G 1HNXL 5M5YH 2R93H 1TWAH 3RN5A 4LF9L 4GNXA 1PVOA 4LF5Q 3HKZE 3HOVG 4PZ7A 4JI4L 2WP8J 3CCUA 5IYDG 2R92H 2Q2TA 4DR5L 2RCNA 3CCMA 3S14H 1K8GA 4JI3Q 1W2BA 1WJJA 2DGYA 3ULPA 3L0OA 1N8RC 2OTLA 3HOXH 4QQBX 3UE0A 1KC8C 4POGA 1B8AA 1VQ6A 2KENA 1PYSB 4EX5A 4HJ7A 1Y1VH 1VQOA 4MTNA 4LF9Q 1IZ6A 4OO1I 4LF8L 3FP9A 1HNXQ 4DR1Q 4LFBL 2PQAA 4R4QA 2ZJQA 4DV4L 2Q2UA 4WJ3M 2VZAA 2EQSA 2Y0SE 1XMOL 2L15A 2E5LQ 4GN4B 1VQ4A 3BU2A 4GN3B 1L0WA 1EIFA 1HZCA 3T1YQ 4JBMA 1Q12A 3PO3G 4IPDA 5K36G 1L1OB 1AE3A 4A3GG 2JJQA 4BXXG 2UUCL 1HR0Q 4DR4L 4C3IH 1I50H 1Q7YC 1OXUA 1X3GA 5DLQE 5C44H 3NEMA 3G71A 1ASZA 2I5HA 2HHHL 1VQJA 2MO1A 1X3EA 2NZHA 2ZJRA 1N34L 2YTYA 1XMQL 3BJUA 1VQ5A 4A3CH 1FGUA 4OX9L 1A0IA 1WFQA 2K14A 3CMEA 2NVYH 4L5SA 1PH5A 2B29A 1LM0A 4A3EG 2I0QA 4BY7G 3HKZG 2Q2HA 2PNHA 3KF6A 1KRSA 3AFQA 3PUWA 5C0XI 2JA9A 4DR4Q 4Y7NH 4JI0Q 4X62L 3M3YH 4GKKL 1PYBA 2QGQA 4JC0A 4YWMA 3CCJA 1VQ8A 2NVXH 3PO2H 3T1YL 3OTOQ 1G291 5M5XH 4JI7L 1WCMG 1KQSA 4BBSG 4UY8C 3ULJA 4DKAC 3S16H 2WAQE 5IP9H 1PH9A 1JMCA 5FLMG 4NXML 5GQOA 4LF8Q 4YCWA 2ZTCA 3M9BA 1P16A 5IYBG 2BH8A 1JB7A 2JK8A 1K8AC 4HJ8A 3KJOA 2Y0SG 3NELA 3HOWG 1IXRA 1PH8A 2H5XA 4X62Q 5M5WH 2JA7G 3LGJA 5IWAL 2MFIA 1VQEA 1E1TA 4KHPQ 1OXXK 4DV6Q 1Y1VG 4R4TA 4GLVB 3A5UA 3J80c 1N33Q 3PO3H 4PZ6A 2IT1A 1E3PA 2BA1A 2XTIA 2UXBQ 2WAQG 3EBEA 3JC66 1YHQA 4IFDG 4JI0L 3IRBA 3A0JA 1QZGA 3H15A 4POFA 4MNOA 4X66L 2R7DA 4AH6A 4BY1H 2A1AA 2KHJA 3KF6B 4L5TA 1X65A 2D0PA 3PF5A 4KI0A 1PH2A 5JJIA 3CMAA 1Q86C 2HIVA 1Q82C 1N36L 1YVCA 4B3MQ 4IPHA 1N33L 4R4OA 5FJ8G 4YY3Q 1SROA 4LNQA 1EUJA 1T9HA 3UDFA 1OXSC 4KHPL 3RZOH 4DR1L 4LFBQ 3FHWA 2QA4A 4NPSA 1VQKA 4NXNQ 5IWAQ 3M4PA 4JI2Q 1NMGA 5M3FG 1BKBA 5GAGC 1GM5A 1QUQA 1JT8A 1I3QH 5IY0A 2N49A 3GTJH 3J7ZC 5JEAG 2B3GA 2C35B 3GTKH 4L5QA 3I4MG 3MXNB 3U50C 3AEVA 4BBSH 4GOPB 1I6HH 4JOIA 1HH2P 4DV4Q 1L1OC 4IFDI 3UDXA 4YWLA 4BY1G 3Q8DA 3S1QH 1XNRQ 1GO3E 3MEFA 4UP9A 3GDEA 4A3MH 3H3VI 2R7ZH 1E22A 3I7FA 5C0XJ 4JI3L 1VQBA 4TVAB 1PHJA 3K81C 2NN6G 3I56A 1TXYA 4ALPA 1X9NA 4JOIC 1QZHA 4OWWB 4OWTB 1G51A 1JJGA 4MZ9A 4XTCS 1K3RA 3KDFB 5IP7H 1FJGL 3H0GG 1ASYA 2F52A 5JJKA 5FJ8H 4LFCQ 1KXLA 1IBKQ 4JI6Q 1UWVA 5AJ3L 2YV5A 2MNAA 2JEAI 4JI2L 3CF5A 5LMUQ 1EFWA 3STBD 3HOWH 4GLAC 1PH4A 4WJ4A 3K8AA 4QJFA 1J6QA 1V43A 4A3FG 1NTGA 1N32Q 4DR3L 3PUYA 2VW9A 5FLMH 1HZ9A 4YY3L 3GTLH 2YTVA 4B3ML 2IHEA 4QY7A 3CC7A 1N36Q 2KCMA 3GD7A 3GO5A 4OONA 3KF8B 1YEZA 1FJGQ 1SR3A 4JI1L 2PI2A 5C4JH 1VCIA 4O0AA 1PH6A 2OQ0A 3RNUA 4A75A 2E5LL 3HOYH 2AWNA 3CCVA 2JA5H 1PV4A 4X66Q 1Q1BA 1AH9A 3F8TA 1CKNA 5HY6A 1HZBA 3G48A 3BZCA 1VQDA 3HFZB 3WWVA 2OTJA 3TQYA 1Q81C 3I55A 3F2DA 2JA8H 2ZJPA 2CKZB 3HOZG 1HNWQ 3ER0A 2CWPA 4DR6L 2ZTEA 3K0XA 1XNQQ 1IYJB 4B3RL 3STBC 4DPGA 2DUDA 3A5ZB 1AE2A 1N9WA 2UXCQ 2ZM6L 1Z47A 1LYLA 3RLOA 1C0AA 3K7AH 1E24A 1PH1A 1VQ7A 3F2BA 2Q2IA 4DV2Q 4DV7L 2RF4A 4K0KQ 3RLNA 1IBML 1VQGA 2VS1A 3PIPA 1RL2A 1MIUA 4J15A 3HKSA 1WYDA 1X54A 1V1QA 5LMNL 5C0XG 1NMFA 4JYAL 2IX0A 3W1BA 3U4VA 3M7NA 3H0GH 3GTGH 3OTOL 4JI7Q 2JA6G 1TWGH 3TREA 2LXKA 1J5EQ 1QVCA 2CFMA 4LUZA 1WCMH 3DLLA 1Y1WG 1KAWA 3HOVH 2BA0A 1M1KC 2K5HA 4DV0Q 4DV1Q 2E2IH 4JBKA 4A3LG 1YITA 4OXPA 1VQCA 4O2DA 4YCUA 3HOZH 3HOUH 3CXCA 2BH2A 2OWOA 1B70B 2D0OA 1HJPA 5GROA 1VS0A 3HOYG 2YTXA 3AYHB 1A8VA 1NBWA 3PV0A 4GOPC 3J80i 1IBLQ 4YHHL 4BY7H 1C9OA 1D8LA 2AHOB 1XPUA 3FKIG 4A93H 4JV5L 5ELNA 4HJAA 2I5LX 3EN2A 4X6AH 4KHZA 4IOAA 1VQIA 1R9TH 3I2ZA 2UUCQ 4YCVA 1U0LA 4QL5A 2UXDQ 2K75A 3H3VH 3E9IA 1VQHA 2ZTDA 1K73C 1BVSA 2N78A 3NENA 4JYAQ 1CSPA 3PUZA 5M3MH 4B3SL 4B3SQ 4LF7Q 1SN8A 1JJ2A 4LF7L 2UUAL 5C4XG 3J7A5 3DM3A 4IPCA 2VNUD 1CSQA 3KOJA 4P74A 2R6GA 4HIKA 1S72A 1LUZA 4UP7A 1OTCA 4GKKQ 3K7UC 4IJLA 4A93G 5GAEC 3PO2G 1L2FA 4A3JG 2VQEL 4P73A 3S1MH 2UXCL 3CQZH 4DR5Q 4P75A 1TWFH 1I5FA 2PI2E 4DR2L 4A3IH 4A3BG 3S2HH 5GADC 2Z6KC 4BBRG 1PA6A 3S24A 3I4NH 2K5NA 2CQOA 4A3LH 1GVPA 4LFAQ 1XMQQ 4A3DG 2UUBL 4IPGA 2ALYB 3TEHB 2MQHA 3UDGA 3F1ZA 1JE5A 3GTMH 2JA7H 3CD6A 1CKOA 2AWOA 5IP9G 4A4IA 4LUOA 4DV3Q 2JQOA 1QVGA 1H95A 4QGUA 1EQQA 2N8NA 1J5EL 1C7YA 1M90C 4RG1A 3RR5A 5ELOA 2F4VQ 1CKMA 3KJPA 1VQAA 2GVBA 1DGSA 4A3JH 3SGIA 2QEXA 5M3FH 1UEBA 4NXNL 2UU9Q 3GTPH 1N32L 4B3TQ 1YJWA 3PIOA 3J81c 2VY3A 3L2PA 2B63H 4DUYQ 5JEAJ 3G6EA 3NBHB 5AJ3Q 1TWCH 3T1HL 4LFCL 1X6OA 2RHQB 4DV2L 3J81j 2WB1G 3OYYA 1D7QA 1S3OA 5M3MG 4DV5Q 4LF6Q 3JAMc 4AQYQ 3CCSA 2JE6I 4A3MG 3HOXG 4DAYB 3CW2C 3VDYA 1XNQL 1VQ9A 4B3RQ 4IJHA 2AMCB 2ATWA 5IYCG 2RHSB 3I4MH 4DR6Q 4HIOA 1EIYB 4LF5L 1VQFA 1EYGA 1NJIC 2R7FA 3CPFA 5J3BA 1XNRL 4DUYL 1B7YB 3S2DH 1Q46A 1BBUA 4A3EH 4GNXB 3G4SA 4AQYL 4DV5L 4LF6L 2A19A 3RLFA 2HIXA 5HGQA 2NN6I 4A3DH 2F4VL 2R93G 4GKJQ 2VQFL 4IFDJ 4HJ9A 4XIGS 2A8VA 1YNXA 3AQQA 4A3IG 2VUMH 1JJCB 3CPWA 4DUZL 2ID0A 4UPAA 5IP7G 3CCRA 1KHIA 3D0FA 1K9MC 1GKHA 4C2MH 3A74A 4JV5Q 4BXXH 4X64L 4A3GH 4R4IA 4YHHQ 2E2JH 3E9HA 1SRUA 1HR0W 5LMNW 3TRZA 3KYHC 5H1SE 1TWHH 4AIMA 4JCVE 4JI5L 1I94L 4LFAL 4AYBG 1VQNA 3TS0A 3CP0A 3ICEA 4A3CG 4OWXB 2HT1A 4QIWE 1VQPA 3S17H 1YJ9A 4DAMA 1V9PA 5BR8L 2IX1A 3S1RH 4APVA 2K50A 2OCEA 1L1OA 2WB1E 2VQEQ 3CCLA 2JA8G 4DR7Q 1A63A 3CCEA 1SLJA 2FXQA 4A3KH 1HNZQ 3I4NG 2KBNA 4NB3A 2I5MX 2PQAB 2UUBQ 1YZ6A 1E7ZA 2VUMG 1PH3A 1W3SA 4UP8A 5E7NA 4JBJA 2LXJA 3W1GA 2KCTA 5IYBH 1KD1C 4LF4Q 4AYBE 5GAHC 4C3HH 3JAMi 2NZOA 1XPOA 2JA6H 1X55A 3KFUA 1WI5A 1VQLA 1EWIA 2UXDL 2E8GA 2XGTA 1G6PA 3CCQA 4EQ5A 2YYZA 1UE5A 4JG2A 1SMXA 1OXVA 1UE7A 1KRTA 4BA2I 3TS2A 4NXMQ 1XJVA 1X56A 5IYCH 2UUAQ 3B6YA 2IHFA 4JI8L 4X65L 4B3TL 2IY5B 4LF4L 4C3JH 5C3EG 2K52A 1YHAA 2UU9L 1QUQB 2V1CC 3CAMA 3M4QA 4L5RC 3GTOH 1RIPA 2CWAA 4YWKA 3UDIA 1CKNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ASB A;  1HNZ L;  1EQR A;  1OXT A;  3U58 A;  4PZ8 A;  2AKW B;  5IE8 A;  4DR7 L;  3J81 i;  1KL9 A;  3M85 A;  1S40 A;  1X3F A;  3EIV A;  2EXD A;  4FDB A;  1E1O A;  5C4X H;  2K5V A;  2EIF A;  4OX9 Q;  2NVQ H;  3HOU G;  2UXB L;  4IO9 A;  1WOC A;  4DK3 C;  2Z6K A;  1PH7 A;  2HHH Q;  4ME3 A;  2LSS A;  2PMZ E;  3E0E A;  3S15 H;  4LW1 A;  4X64 Q;  4DR2 Q;  1Z9F A;  5LMN Q;  4HIM A;  1Y1W H;  3KDF A;  4H02 A;  4DV6 L;  4JI8 Q;  4X65 Q;  1IL2 A;  2GVA A;  5LMU L;  1HR0 L;  1A62 A;  4R1J A;  1IBM Q;  4K0K L;  3FKI H;  3W5O A;  4BA1 I;  2F3I A;  4DV7 Q;  1NY4 A;  1KIX A;  3CC4 A;  1MKH A;  3PSI A;  2VQF Q;  3L7Z C;  3ULL A;  3CC2 A;  4P71 A;  1YJN A;  1MJE A;  4GLX A;  1YI2 A;  4GKJ L;  1UE6 A;  3F2C A;  2WFW A;  3PF4 A;  2ZM6 Q;  1XMO Q;  4BBR H;  1K0R A;  3UE1 A;  1Y14 B;  1QVF A;  5JJL A;  4R4C A;  2MO0 A;  3PGZ A;  2CCZ A;  1MJC A;  1SE8 A;  2D62 A;  1SFO H;  1Q8K A;  2R92 G;  5IYD H;  2N3S A;  1U5K A;  4RMF A;  2NVT H;  1FVI A;  4A3F H;  1YHB A;  2GN5 A;  4PMW A;  4GN5 A;  3RN2 A;  3BZK A;  2HQL A;  2R7Z G;  1YIJ A;  5EAY A;  1NE3 A;  1YBY A;  5BR8 Q;  3D31 A;  2B63 G;  4JI4 Q;  1IBL L;  3PUV A;  1GD7 A;  4A3K G;  4GOP A;  2E2H H;  3ZJY C;  4IOC A;  1BBW A;  5C44 G;  3T1H Q;  1N34 Q;  3U4Z A;  1I94 Q;  4JI5 Q;  3GTQ H;  1HNW L;  3ERS X;  5FLX c;  3K80 C;  3M4O H;  2YU9 H;  2JEB I;  3PCO B;  1Q1E A;  4GS3 A;  4A76 A;  3RZD H;  1K83 H;  1HZA A;  1UE1 A;  2OQK A;  3PUX A;  4DNI A;  4DV0 L;  1CUK A;  4DV1 L;  4HID A;  2ES2 A;  4OO1 G;  4DUZ Q;  4KLK A;  4JI1 Q;  5C3E H;  4Y52 H;  4GNX C;  3AFP A;  3KLW A;  5IT9 c;  1IBK L;  4JI6 L;  3I4O A;  4HJ5 A;  1O7I A;  1XTD A;  4P72 A;  4DV3 L;  1XPR A;  3S1N H;  3OW2 A;  4PG3 A;  4DK6 C;  4JBW A;  1FL0 A;  2VL6 A;  1LTL A;  2Z0S A;  2K4K A;  4LWC A;  4TQU S;  4DR3 Q;  1EOV A;  1VQM A;  1P8L A;  2KHI A;  1PFS A;  4LUV A;  4A3B H;  2JA5 G;  1HNX L;  5M5Y H;  2R93 H;  1TWA H;  3RN5 A;  4LF9 L;  4GNX A;  1PVO A;  4LF5 Q;  3HKZ E;  3HOV G;  4PZ7 A;  4JI4 L;  2WP8 J;  3CCU A;  5IYD G;  2R92 H;  2Q2T A;  4DR5 L;  2RCN A;  3CCM A;  3S14 H;  1K8G A;  4JI3 Q;  1W2B A;  1WJJ A;  2DGY A;  3ULP A;  3L0O A;  1N8R C;  2OTL A;  3HOX H;  4QQB X;  3UE0 A;  1KC8 C;  4POG A;  1B8A A;  1VQ6 A;  2KEN A;  1PYS B;  4EX5 A;  4HJ7 A;  1Y1V H;  1VQO A;  4MTN A;  4LF9 Q;  1IZ6 A;  4OO1 I;  4LF8 L;  3FP9 A;  1HNX Q;  4DR1 Q;  4LFB L;  2PQA A;  4R4Q A;  2ZJQ A;  4DV4 L;  2Q2U A;  4WJ3 M;  2VZA A;  2EQS A;  2Y0S E;  1XMO L;  2L15 A;  2E5L Q;  4GN4 B;  1VQ4 A;  3BU2 A;  4GN3 B;  1L0W A;  1EIF A;  1HZC A;  3T1Y Q;  4JBM A;  1Q12 A;  3PO3 G;  4IPD A;  5K36 G;  1L1O B;  1AE3 A;  4A3G G;  2JJQ A;  4BXX G;  2UUC L;  1HR0 Q;  4DR4 L;  4C3I H;  1I50 H;  1Q7Y C;  1OXU A;  1X3G A;  5DLQ E;  5C44 H;  3NEM A;  3G71 A;  1ASZ A;  2I5H A;  2HHH L;  1VQJ A;  2MO1 A;  1X3E A;  2NZH A;  2ZJR A;  1N34 L;  2YTY A;  1XMQ L;  3BJU A;  1VQ5 A;  4A3C H;  1FGU A;  4OX9 L;  1A0I A;  1WFQ A;  2K14 A;  3CME A;  2NVY H;  4L5S A;  1PH5 A;  2B29 A;  1LM0 A;  4A3E G;  2I0Q A;  4BY7 G;  3HKZ G;  2Q2H A;  2PNH A;  3KF6 A;  1KRS A;  3AFQ A;  3PUW A;  5C0X I;  2JA9 A;  4DR4 Q;  4Y7N H;  4JI0 Q;  4X62 L;  3M3Y H;  4GKK L;  1PYB A;  2QGQ A;  4JC0 A;  4YWM A;  3CCJ A;  1VQ8 A;  2NVX H;  3PO2 H;  3T1Y L;  3OTO Q;  1G29 1;  5M5X H;  4JI7 L;  1WCM G;  1KQS A;  4BBS G;  4UY8 C;  3ULJ A;  4DKA C;  3S16 H;  2WAQ E;  5IP9 H;  1PH9 A;  1JMC A;  5FLM G;  4NXM L;  5GQO A;  4LF8 Q;  4YCW A;  2ZTC A;  3M9B A;  1P16 A;  5IYB G;  2BH8 A;  1JB7 A;  2JK8 A;  1K8A C;  4HJ8 A;  3KJO A;  2Y0S G;  3NEL A;  3HOW G;  1IXR A;  1PH8 A;  2H5X A;  4X62 Q;  5M5W H;  2JA7 G;  3LGJ A;  5IWA L;  2MFI A;  1VQE A;  1E1T A;  4KHP Q;  1OXX K;  4DV6 Q;  1Y1V G;  4R4T A;  4GLV B;  3A5U A;  3J80 c;  1N33 Q;  3PO3 H;  4PZ6 A;  2IT1 A;  1E3P A;  2BA1 A;  2XTI A;  2UXB Q;  2WAQ G;  3EBE A;  3JC6 6;  1YHQ A;  4IFD G;  4JI0 L;  3IRB A;  3A0J A;  1QZG A;  3H15 A;  4POF A;  4MNO A;  4X66 L;  2R7D A;  4AH6 A;  4BY1 H;  2A1A A;  2KHJ A;  3KF6 B;  4L5T A;  1X65 A;  2D0P A;  3PF5 A;  4KI0 A;  1PH2 A;  5JJI A;  3CMA A;  1Q86 C;  2HIV A;  1Q82 C;  1N36 L;  1YVC A;  4B3M Q;  4IPH A;  1N33 L;  4R4O A;  5FJ8 G;  4YY3 Q;  1SRO A;  4LNQ A;  1EUJ A;  1T9H A;  3UDF A;  1OXS C;  4KHP L;  3RZO H;  4DR1 L;  4LFB Q;  3FHW A;  2QA4 A;  4NPS A;  1VQK A;  4NXN Q;  5IWA Q;  3M4P A;  4JI2 Q;  1NMG A;  5M3F G;  1BKB A;  5GAG C;  1GM5 A;  1QUQ A;  1JT8 A;  1I3Q H;  5IY0 A;  2N49 A;  3GTJ H;  3J7Z C;  5JEA G;  2B3G A;  2C35 B;  3GTK H;  4L5Q A;  3I4M G;  3MXN B;  3U50 C;  3AEV A;  4BBS H;  4GOP B;  1I6H H;  4JOI A;  1HH2 P;  4DV4 Q;  1L1O C;  4IFD I;  3UDX A;  4YWL A;  4BY1 G;  3Q8D A;  3S1Q H;  1XNR Q;  1GO3 E;  3MEF A;  4UP9 A;  3GDE A;  4A3M H;  3H3V I;  2R7Z H;  1E22 A;  3I7F A;  5C0X J;  4JI3 L;  1VQB A;  4TVA B;  1PHJ A;  3K81 C;  2NN6 G;  3I56 A;  1TXY A;  4ALP A;  1X9N A;  4JOI C;  1QZH A;  4OWW B;  4OWT B;  1G51 A;  1JJG A;  4MZ9 A;  4XTC S;  1K3R A;  3KDF B;  5IP7 H;  1FJG L;  3H0G G;  1ASY A;  2F52 A;  5JJK A;  5FJ8 H;  4LFC Q;  1KXL A;  1IBK Q;  4JI6 Q;  1UWV A;  5AJ3 L;  2YV5 A;  2MNA A;  2JEA I;  4JI2 L;  3CF5 A;  5LMU Q;  1EFW A;  3STB D;  3HOW H;  4GLA C;  1PH4 A;  4WJ4 A;  3K8A A;  4QJF A;  1J6Q A;  1V43 A;  4A3F G;  1NTG A;  1N32 Q;  4DR3 L;  3PUY A;  2VW9 A;  5FLM H;  1HZ9 A;  4YY3 L;  3GTL H;  2YTV A;  4B3M L;  2IHE A;  4QY7 A;  3CC7 A;  1N36 Q;  2KCM A;  3GD7 A;  3GO5 A;  4OON A;  3KF8 B;  1YEZ A;  1FJG Q;  1SR3 A;  4JI1 L;  2PI2 A;  5C4J H;  1VCI A;  4O0A A;  1PH6 A;  2OQ0 A;  3RNU A;  4A75 A;  2E5L L;  3HOY H;  2AWN A;  3CCV A;  2JA5 H;  1PV4 A;  4X66 Q;  1Q1B A;  1AH9 A;  3F8T A;  1CKN A;  5HY6 A;  1HZB A;  3G48 A;  3BZC A;  1VQD A;  3HFZ B;  3WWV A;  2OTJ A;  3TQY A;  1Q81 C;  3I55 A;  3F2D A;  2JA8 H;  2ZJP A;  2CKZ B;  3HOZ G;  1HNW Q;  3ER0 A;  2CWP A;  4DR6 L;  2ZTE A;  3K0X A;  1XNQ Q;  1IYJ B;  4B3R L;  3STB C;  4DPG A;  2DUD A;  3A5Z B;  1AE2 A;  1N9W A;  2UXC Q;  2ZM6 L;  1Z47 A;  1LYL A;  3RLO A;  1C0A A;  3K7A H;  1E24 A;  1PH1 A;  1VQ7 A;  3F2B A;  2Q2I A;  4DV2 Q;  4DV7 L;  2RF4 A;  4K0K Q;  3RLN A;  1IBM L;  1VQG A;  2VS1 A;  3PIP A;  1RL2 A;  1MIU A;  4J15 A;  3HKS A;  1WYD A;  1X54 A;  1V1Q A;  5LMN L;  5C0X G;  1NMF A;  4JYA L;  2IX0 A;  3W1B A;  3U4V A;  3M7N A;  3H0G H;  3GTG H;  3OTO L;  4JI7 Q;  2JA6 G;  1TWG H;  3TRE A;  2LXK A;  1J5E Q;  1QVC A;  2CFM A;  4LUZ A;  1WCM H;  3DLL A;  1Y1W G;  1KAW A;  3HOV H;  2BA0 A;  1M1K C;  2K5H A;  4DV0 Q;  4DV1 Q;  2E2I H;  4JBK A;  4A3L G;  1YIT A;  4OXP A;  1VQC A;  4O2D A;  4YCU A;  3HOZ H;  3HOU H;  3CXC A;  2BH2 A;  2OWO A;  1B70 B;  2D0O A;  1HJP A;  5GRO A;  1VS0 A;  3HOY G;  2YTX A;  3AYH B;  1A8V A;  1NBW A;  3PV0 A;  4GOP C;  3J80 i;  1IBL Q;  4YHH L;  4BY7 H;  1C9O A;  1D8L A;  2AHO B;  1XPU A;  3FKI G;  4A93 H;  4JV5 L;  5ELN A;  4HJA A;  2I5L X;  3EN2 A;  4X6A H;  4KHZ A;  4IOA A;  1VQI A;  1R9T H;  3I2Z A;  2UUC Q;  4YCV A;  1U0L A;  4QL5 A;  2UXD Q;  2K75 A;  3H3V H;  3E9I A;  1VQH A;  2ZTD A;  1K73 C;  1BVS A;  2N78 A;  3NEN A;  4JYA Q;  1CSP A;  3PUZ A;  5M3M H;  4B3S L;  4B3S Q;  4LF7 Q;  1SN8 A;  1JJ2 A;  4LF7 L;  2UUA L;  5C4X G;  3J7A 5;  3DM3 A;  4IPC A;  2VNU D;  1CSQ A;  3KOJ A;  4P74 A;  2R6G A;  4HIK A;  1S72 A;  1LUZ A;  4UP7 A;  1OTC A;  4GKK Q;  3K7U C;  4IJL A;  4A93 G;  5GAE C;  3PO2 G;  1L2F A;  4A3J G;  2VQE L;  4P73 A;  3S1M H;  2UXC L;  3CQZ H;  4DR5 Q;  4P75 A;  1TWF H;  1I5F A;  2PI2 E;  4DR2 L;  4A3I H;  4A3B G;  3S2H H;  5GAD C;  2Z6K C;  4BBR G;  1PA6 A;  3S24 A;  3I4N H;  2K5N A;  2CQO A;  4A3L H;  1GVP A;  4LFA Q;  1XMQ Q;  4A3D G;  2UUB L;  4IPG A;  2ALY B;  3TEH B;  2MQH A;  3UDG A;  3F1Z A;  1JE5 A;  3GTM H;  2JA7 H;  3CD6 A;  1CKO A;  2AWO A;  5IP9 G;  4A4I A;  4LUO A;  4DV3 Q;  2JQO A;  1QVG A;  1H95 A;  4QGU A;  1EQQ A;  2N8N A;  1J5E L;  1C7Y A;  1M90 C;  4RG1 A;  3RR5 A;  5ELO A;  2F4V Q;  1CKM A;  3KJP A;  1VQA A;  2GVB A;  1DGS A;  4A3J H;  3SGI A;  2QEX A;  5M3F H;  1UEB A;  4NXN L;  2UU9 Q;  3GTP H;  1N32 L;  4B3T Q;  1YJW A;  3PIO A;  3J81 c;  2VY3 A;  3L2P A;  2B63 H;  4DUY Q;  5JEA J;  3G6E A;  3NBH B;  5AJ3 Q;  1TWC H;  3T1H L;  4LFC L;  1X6O A;  2RHQ B;  4DV2 L;  3J81 j;  2WB1 G;  3OYY A;  1D7Q A;  1S3O A;  5M3M G;  4DV5 Q;  4LF6 Q;  3JAM c;  4AQY Q;  3CCS A;  2JE6 I;  4A3M G;  3HOX G;  4DAY B;  3CW2 C;  3VDY A;  1XNQ L;  1VQ9 A;  4B3R Q;  4IJH A;  2AMC B;  2ATW A;  5IYC G;  2RHS B;  3I4M H;  4DR6 Q;  4HIO A;  1EIY B;  4LF5 L;  1VQF A;  1EYG A;  1NJI C;  2R7F A;  3CPF A;  5J3B A;  1XNR L;  4DUY L;  1B7Y B;  3S2D H;  1Q46 A;  1BBU A;  4A3E H;  4GNX B;  3G4S A;  4AQY L;  4DV5 L;  4LF6 L;  2A19 A;  3RLF A;  2HIX A;  5HGQ A;  2NN6 I;  4A3D H;  2F4V L;  2R93 G;  4GKJ Q;  2VQF L;  4IFD J;  4HJ9 A;  4XIG S;  2A8V A;  1YNX A;  3AQQ A;  4A3I G;  2VUM H;  1JJC B;  3CPW A;  4DUZ L;  2ID0 A;  4UPA A;  5IP7 G;  3CCR A;  1KHI A;  3D0F A;  1K9M C;  1GKH A;  4C2M H;  3A74 A;  4JV5 Q;  4BXX H;  4X64 L;  4A3G H;  4R4I A;  4YHH Q;  2E2J H;  3E9H A;  1SRU A;  1HR0 W;  5LMN W;  3TRZ A;  3KYH C;  5H1S E;  1TWH H;  4AIM A;  4JCV E;  4JI5 L;  1I94 L;  4LFA L;  4AYB G;  1VQN A;  3TS0 A;  3CP0 A;  3ICE A;  4A3C G;  4OWX B;  2HT1 A;  4QIW E;  1VQP A;  3S17 H;  1YJ9 A;  4DAM A;  1V9P A;  5BR8 L;  2IX1 A;  3S1R H;  4APV A;  2K50 A;  2OCE A;  1L1O A;  2WB1 E;  2VQE Q;  3CCL A;  2JA8 G;  4DR7 Q;  1A63 A;  3CCE A;  1SLJ A;  2FXQ A;  4A3K H;  1HNZ Q;  3I4N G;  2KBN A;  4NB3 A;  2I5M X;  2PQA B;  2UUB Q;  1YZ6 A;  1E7Z A;  2VUM G;  1PH3 A;  1W3S A;  4UP8 A;  5E7N A;  4JBJ A;  2LXJ A;  3W1G A;  2KCT A;  5IYB H;  1KD1 C;  4LF4 Q;  4AYB E;  5GAH C;  4C3H H;  3JAM i;  2NZO A;  1XPO A;  2JA6 H;  1X55 A;  3KFU A;  1WI5 A;  1VQL A;  1EWI A;  2UXD L;  2E8G A;  2XGT A;  1G6P A;  3CCQ A;  4EQ5 A;  2YYZ A;  1UE5 A;  4JG2 A;  1SMX A;  1OXV A;  1UE7 A;  1KRT A;  4BA2 I;  3TS2 A;  4NXM Q;  1XJV A;  1X56 A;  5IYC H;  2UUA Q;  3B6Y A;  2IHF A;  4JI8 L;  4X65 L;  4B3T L;  2IY5 B;  4LF4 L;  4C3J H;  5C3E G;  2K52 A;  1YHA A;  2UU9 L;  1QUQ B;  2V1C C;  3CAM A;  3M4Q A;  4L5R C;  3GTO H;  1RIP A;  2CWA A;  4YWK A;  3UDI A;  1CKN B; 
#chains in the Genus database with same CATH topology
 1EQR A;  3U58 A;  5IE8 A;  1EY0 A;  2KCN A;  3M85 A;  3EIV A;  5C4X H;  2K5V A;  2L4N A;  5DAU A;  1EY5 A;  2AUK A;  3HOU G;  1MHW C;  4OL7 A;  4IO9 A;  1WD1 A;  1S5E D;  2R93 B;  4ME3 A;  3E0E A;  4X64 Q;  1SE4 A;  4XDX A;  3T53 B;  5CR3 A;  5KNB A;  1PRT B;  4QUF A;  5LMU L;  4RKL A;  1IBM Q;  4DNT B;  1SJE D;  1MKH A;  3MFY A;  3NUC A;  1WTO A;  3FKI B;  3L7Z C;  1MJE A;  1YJN A;  2CH4 A;  4GLX A;  2F0M A;  2ZM6 Q;  2DNE A;  2X6G A;  3DWP A;  3UE1 A;  1QVF A;  2MO0 A;  1MJC A;  1SE8 A;  4FF4 A;  2NVT H;  4A3F H;  4LJZ C;  4PMW A;  2F3W A;  1QJO A;  3BZK A;  1C4Q A;  1NE3 A;  5BR8 Q;  4G7H C;  2B63 G;  3IL8 A;  1PLF A;  3T1H Q;  4IOC A;  1SYB A;  1HNW L;  3GTQ H;  2XN9 C;  3ERS X;  2ICE C;  3K80 C;  3TP7 A;  2ZXO A;  1EWC A;  4GS3 A;  4C3J B;  4BBR B;  4HID A;  3ULP A;  2OQK A;  3EA6 A;  4DUZ Q;  4ZRZ A;  4C3J G;  3AFP A;  3I91 A;  1IBK L;  4XQQ A;  4HJ5 A;  4O42 A;  1CFM A;  1XTD A;  1XPR A;  3D4W A;  1OO9 B;  3D4D A;  4C3H B;  4DR3 Q;  4LWC A;  1Y8N B;  1DON A;  4IUT A;  1MBY A;  2J4X A;  2BCO A;  3HOV G;  1A15 A;  2KJX A;  1W6K A;  3E5S A;  2R92 H;  3FPU B;  2WAQ B;  1YNN D;  3S14 H;  1K8G A;  4JI3 Q;  3S17 B;  2BE5 D;  3L0O A;  5A2Q E;  1DOL A;  5IT9 L;  4POG A;  1B8A A;  2OT2 A;  4HJ7 A;  5E4X A;  4OO1 I;  4HAE A;  2E2J B;  2EY6 A;  2EYJ A;  3FEW X;  2PQA A;  4N9T A;  4C2M B;  5FLX L;  1PXU A;  2Y0S E;  1K28 A;  4KY7 A;  4ZUI A;  3HEJ A;  5LHY 1;  4DA2 A;  1RKN A;  3T1Y Q;  1EIF A;  3PO3 G;  5ELD A;  1LTS D;  4U68 A;  1L1O B;  4L6T B;  4DR4 L;  2F0S A;  4TRD A;  1EIH A;  2VB3 X;  4L63 B;  1ASZ A;  3SK4 A;  3WDN A;  2EYP A;  1VQ5 A;  1FGU A;  4A3K B;  1WFQ A;  2EYO A;  1HA5 A;  1SSO A;  3HGB A;  4JW0 A;  2ZXR A;  2I0Q A;  4BY7 G;  1TU2 B;  4EQO A;  3OPO A;  1KRS A;  4JI0 Q;  4ZKB B;  3M3Y H;  1RCV D;  3CCJ A;  1K8M A;  3PO2 H;  1TWC B;  2AUJ D;  3OTO Q;  3MHB A;  2WV6 D;  3HG9 A;  1KQS A;  1EU3 A;  3KBX A;  4KJO A;  3S16 H;  1VMP A;  2WAQ E;  2HQE A;  4Q5V A;  4Z9C B;  1BNZ A;  1CQF A;  4RFB A;  1LAC A;  3ERO A;  1JB7 A;  2FJ2 A;  2JK8 A;  3KJO A;  1PH8 A;  2H5X A;  1EZ8 A;  3CRL C;  4J1M A;  2PNR C;  4KHP Q;  2JA7 B;  1F9S A;  3S2D B;  3J80 c;  4PZ6 A;  3PIP 3;  1E3P A;  2WAQ G;  3JC6 6;  4IFD G;  1JR0 D;  3IRB A;  3I4N B;  2OEO A;  2C9O A;  3S2H B;  4MNO A;  1KDC A;  3BVZ A;  4BY1 H;  5CV5 A;  3KF6 B;  1SND A;  2D0P A;  3PF5 A;  3CMA A;  1Q86 C;  1EYD A;  1XX8 A;  3MTS A;  4LNQ A;  2D9U A;  1EY6 A;  2L5T A;  1OXS C;  4DR1 L;  4LFB Q;  3FHW A;  2QA4 A;  2NZ1 D;  1KTK A;  4JI2 Q;  2LY7 A;  1CA6 A;  1NMG A;  2RQX A;  1JT8 A;  1BKB A;  1I3Q H;  5IY0 A;  4M1U B;  1PTO B;  3J7Z C;  3GTJ H;  3GTK H;  5KGU A;  1B1Z A;  3U50 C;  4BBS H;  1I6H H;  2E75 C;  1AZQ A;  4HMJ A;  5G3L D;  3UDX A;  4YWL A;  3S1Q H;  3V2T A;  5CMD A;  4P2C B;  3K5N A;  2D5D A;  4UP9 A;  1RDP D;  3I7F A;  3M7G A;  5C0X J;  3I8Z A;  1TWF B;  4TVA B;  2NN6 G;  3K0Y A;  4V19 0;  2NWG A;  1X9N A;  2A73 B;  1JE4 A;  1JJG A;  4MZ9 A;  2B39 A;  1LTR D;  1KXL A;  5I9O A;  4JI6 Q;  5EKI A;  5AJ3 L;  2YV5 A;  4XXE A;  1EFW A;  3HOW H;  4QJF A;  1J6Q A;  1V43 A;  1NTG A;  1CA5 A;  2VW9 A;  2A69 D;  2D2C C;  2KED A;  4JI1 L;  1LT3 D;  2DJG C;  2L1B A;  3RNU A;  4A75 A;  3CHB D;  2JA5 H;  1PV4 A;  3F8T A;  3WWV A;  4CDE C;  4DAV A;  3TQY A;  1HNW Q;  3HOZ G;  3CKI B;  4DR6 L;  2ZTE A;  1SNO A;  1XNQ Q;  1IYJ B;  4B3R L;  4KKT A;  3HOZ B;  1EEI D;  5I6Y A;  2E2I B;  2ZM6 L;  1C0A A;  5C4J B;  4FP5 D;  3L3O C;  1E24 A;  2DY7 A;  2QKI C;  4CGY B;  1FGB D;  1VQ7 A;  2Q2I A;  1GUO A;  1BCP B;  1RL2 A;  3U9O A;  3GTL B;  3QWN A;  4WJW A;  4CJ0 B;  5J1Z A;  2PZW A;  1NMF A;  3T4A C;  3M7N A;  1SYE A;  3GTG H;  1TKW B;  4WOR A;  1E0B A;  1TWG H;  2LXK A;  1QVC A;  1WCM H;  3ND9 A;  4DV1 Q;  2KQ3 A;  2E2I H;  2EXZ A;  2QIL A;  2PPB C;  3HOZ H;  3BS1 A;  3HOU H;  2OWO A;  2M00 A;  1B70 B;  2D0O A;  1HJP A;  5GRO A;  1VS0 A;  2YTX A;  4K5W A;  4GOP C;  4EGV A;  1IBL Q;  4BY7 H;  4I65 A;  2I46 A;  3FKI G;  3R2I A;  4S3S A;  3HOY B;  4IOA A;  1JB3 A;  3TME A;  1U0L A;  3H3V H;  1E2Z A;  1CSP A;  5M3M H;  4B3S L;  2HCI A;  4LF7 Q;  3C1E A;  3URY A;  5C5L A;  3J7A 5;  3I73 A;  4HMI A;  1S72 A;  1HTL D;  1OTC A;  4DU9 A;  2B2Y C;  3PO2 G;  4RA8 A;  4A3J G;  1SYG A;  3S1M H;  2PZU A;  2UXC L;  4P75 A;  1TWF H;  4DR2 L;  1D1I A;  1LAB A;  2Y0S B;  2R7Z B;  3MVV A;  2F0U A;  2XRS D;  2E76 C;  4A3D G;  4HR7 B;  2NUC A;  1G8Z D;  3I90 A;  4K8J A;  2EE1 A;  1CZG A;  1I6H B;  1LT6 D;  1CKO A;  2AWO A;  2I07 B;  3G7L A;  1CHQ D;  1F9P A;  3NTH A;  1PTO H;  3GTJ B;  4LUO A;  5M5W B;  2HUG A;  1F9Q A;  1QVG A;  1I3Q B;  1C7Y A;  3AU7 A;  3A7L A;  3RR5 A;  4XYQ A;  1CKM A;  2X6L A;  1VQA A;  2GVB A;  1AW7 A;  1UUP A;  4NXN L;  4B3T Q;  3N52 A;  1YJW A;  3PIO A;  1HFN A;  2B63 H;  4FYD A;  4DUY Q;  3MWY W;  1ESR A;  2F0H A;  4XQN A;  1ESF A;  1HHV A;  3W3A A;  5FKA C;  4IUN A;  1FNU A;  3MXU A;  2A74 C;  2NVY B;  3VDY A;  2ATW A;  2RHS B;  2RSN A;  5BN4 A;  4HIO A;  1EIY B;  1EYG A;  5J3B A;  1BBU A;  4A3E H;  4GNX B;  5F2D A;  3G4S A;  2FMC A;  5DM7 3;  3K59 A;  2HIX A;  2NN6 I;  2F4V L;  2R93 G;  2VQF L;  1SNC A;  2LKV A;  1DM0 B;  3AQQ A;  4A3I G;  3H91 A;  4UPA A;  3VA7 A;  5IP7 G;  1KHI A;  2KEE A;  1D1K A;  2F0F A;  3S16 B;  4A3G H;  4RCN A;  1EY8 A;  3DXJ C;  5IGG A;  3KYH C;  2GA4 B;  5C3W A;  5K5P A;  5ELE A;  2R61 A;  3M3Y B;  4Y7N B;  4A3C G;  4OWX B;  1YJ9 A;  4DAM A;  5HGT A;  2K50 A;  3Q22 A;  2VQE Q;  3K58 A;  1IYU A;  2FXQ A;  1YZ6 A;  5CBE E;  1FD7 D;  1ET9 A;  2CW0 D;  1LT5 D;  4A3B B;  1KD1 C;  5C44 B;  4G57 A;  3JAM i;  4OO1 H;  2XGT A;  1TT2 A;  1A3T A;  1GHK A;  2YYZ A;  1UE5 A;  1AEX A;  1SMX A;  1DJR D;  4NXM Q;  2J7Z A;  1X56 A;  3B6Y A;  4X65 L;  1JOO A;  4B3T L;  2IY5 B;  3J7Y W;  2V4D A;  2F1M A;  3GTO H;  4K2L A;  5CV9 A;  3UDI A;  4K14 A;  1HNZ L;  3TP8 A;  2AKW B;  1S40 A;  1X3F A;  3V05 A;  1GUG A;  3VYU A;  1D5X C;  3KF8 A;  2K32 A;  4FDB A;  2NVQ H;  4WFN 3;  4DK3 C;  2HHH Q;  3D6W A;  4DR2 Q;  1Z9F A;  5EBC A;  5LMN Q;  3AB9 A;  3KDF A;  4H02 A;  4HIM A;  1Y1W H;  4JI8 Q;  1IL2 A;  1PTO C;  4OEL B;  4RWS C;  1A62 A;  3NQT A;  4R1J A;  4K0K L;  3R3O A;  4DV7 Q;  3CC2 A;  4GKJ L;  1YI2 A;  3F2C A;  2WFW A;  4ODG A;  1K0R A;  4ZLT F;  2YU9 B;  4CKC A;  3PGZ A;  2IL8 A;  3GTQ B;  2R92 G;  1Q8K A;  1JCK B;  3IFD A;  2Z4H A;  2N3S A;  1HUM A;  2E2H B;  2B2V C;  1HQM C;  1KLG D;  2GN5 A;  1M4V A;  5C4Z A;  5ELC A;  1YIJ A;  5EAY A;  1IBL L;  3PUV A;  4A3F B;  4RH6 A;  1GD7 A;  2MHV A;  4A3K G;  1HPC A;  4GOP A;  1BCP F;  4KKU A;  4JI5 Q;  5C44 G;  1SNQ A;  2K04 A;  2F0W A;  1SFO B;  3GTO B;  5FLX c;  1JOQ A;  3M4O H;  3RMH A;  1SYC A;  2JEB I;  1EY9 A;  1HZA A;  4DV1 L;  5CGK A;  1CUK A;  4RGN A;  2ES2 A;  1Y69 U;  5C3E H;  4GNX C;  3D3R A;  1GUS A;  3DEO A;  4DV3 L;  2DN8 A;  4I7Z C;  1BOS A;  1Z7T A;  1YNJ D;  5IGE A;  5C3X A;  2RKS A;  1PYW D;  1L0X B;  2VL6 A;  2Z0S A;  4JBW A;  1B50 A;  1G6Z A;  4A3B H;  2KHI A;  4K8I A;  3EJI A;  1EYC A;  3A8I E;  4LF5 Q;  4PZ7 A;  4DN4 M;  1L0Y B;  2WP8 J;  4WRD A;  3CCM A;  1JWS D;  5KRU A;  3Q24 A;  1N8R C;  4QQB X;  1KC8 C;  1VQ6 A;  3NWS A;  5E1F A;  4LF9 Q;  1HUN A;  1TWH B;  4MTN A;  5E4W C;  1CTM A;  1I4Q A;  2MPM A;  2KHS A;  2ZJQ A;  1SMY D;  4DV4 L;  3BDL A;  2VZA A;  1SDF A;  5CC4 A;  4GN4 B;  4HCE A;  1K3B C;  4NMZ A;  1HA6 A;  4GN3 B;  1E2W A;  1EYA A;  2HD3 A;  1AE3 A;  1PRT C;  2JJQ A;  5I6W A;  3J80 E;  1HR0 Q;  3OMC A;  2F0T A;  2JA6 B;  4C3I H;  1I50 H;  2L9H A;  4G4K A;  4FF1 A;  1OXU A;  1X3G A;  5DLQ E;  2ENB A;  2I5H A;  3E0J A;  2MO1 A;  1GJX A;  2YTY A;  4A3C H;  3BJU A;  1G91 A;  2PCF B;  3CME A;  2NVY H;  2B29 A;  1H9S B;  4R8N A;  2L55 A;  2F0V A;  2Q2H A;  1CQV A;  2PNH A;  3KF6 A;  5C0X I;  1B44 D;  2JA9 A;  4DR4 Q;  5COR A;  5DNF A;  4GKK L;  2AQ3 B;  2K5W A;  1VQ8 A;  1QIL A;  5JEA H;  3T1Y L;  4JI7 L;  1G29 1;  1ZKO A;  5M5X H;  1WCM G;  1PZI D;  2O4X A;  3ULJ A;  2B63 B;  3FMC A;  3C1F A;  1PH9 A;  4NXM L;  5FLM G;  5GQO A;  4YCW A;  3M9B A;  1P16 A;  2Y0S G;  1PDQ A;  2SNS A;  1D2B A;  2XSC A;  1AP0 A;  2B2U C;  2MFI A;  1E1T A;  1OXX K;  4J8Q A;  2KVM A;  4R4T A;  4GLV B;  5E3F A;  5EJW A;  2UXB Q;  1YNN C;  5IOD A;  4HED A;  4X66 L;  4N9P A;  3S1M B;  2R7D A;  4AH6 A;  3TBI B;  2KHJ A;  1X65 A;  5CV7 A;  4X3U A;  1N36 L;  1QE6 A;  4CDD C;  4QIW B;  4IPH A;  4R4O A;  2M2L A;  5JVH 3;  1EUJ A;  2PO4 A;  2XWB B;  4KHP L;  3GTP B;  3FPP A;  1PFM A;  1H9M A;  3S9W A;  4NPS A;  1VQK A;  4OHJ A;  4IUQ A;  2NTS A;  5IWA Q;  1GUW A;  1UEA B;  5M3F G;  1GM5 A;  1QUQ A;  1KDB A;  4HSV A;  4IFD H;  3PMF A;  2BOS A;  4FF3 A;  2B3G A;  2C35 B;  4L5Q A;  3I4M G;  1T5E A;  3MXN B;  5I2Y A;  4JOI A;  3P20 A;  3GTM B;  1L1O C;  2ZXP A;  4BY7 B;  1GXD C;  3MEF A;  4DAY A;  1B2T A;  3GDE A;  4A3M H;  2RDH A;  1RD9 D;  3K5L A;  2XIW A;  2K5Q A;  1S5D D;  1BDO A;  4A3I B;  1VQB A;  2JSO A;  1TXY A;  3P75 A;  3K57 A;  2OF1 A;  5AFW A;  1XYI A;  4FO2 A;  5FJ8 H;  4LFC Q;  5ELF A;  4R9W A;  3CF5 A;  3STB D;  5ELB A;  3K8A A;  5D3D A;  5FLM H;  4FVM A;  3QIA A;  4KD4 A;  3ZYY X;  2IHE A;  3GD7 A;  5IGD A;  3KF8 B;  5FO8 B;  2PI2 A;  2OQ0 A;  2E5L L;  2EJM A;  2O2L D;  2OTJ A;  1RF2 D;  4A93 B;  1I6V C;  3EFX D;  1D5Z C;  3F2D A;  2F0L A;  3OMG A;  2JA8 B;  3ERQ A;  4TKO B;  1IL8 A;  1AE2 A;  2UXC Q;  2Z4I A;  3A54 A;  3LWE A;  5J39 A;  3VYS A;  1PH1 A;  4DV2 Q;  4DV7 L;  1VQG A;  2VS1 A;  3QO2 A;  4PMB A;  4J15 A;  3HKS A;  2RDG A;  1GUT A;  1TII D;  1W6J A;  4OIK A;  1I4G A;  1D5M C;  1I4P A;  3OTO L;  2JA6 G;  4LMQ D;  3TRE A;  4PV1 C;  2CFM A;  3HOV H;  2O5I C;  2BA0 A;  1M1K C;  3N6R A;  4A3L G;  4OGQ C;  2HDM A;  4JBK A;  2QDB A;  4KY6 A;  4O2D A;  3CXC A;  2B2U A;  2BH2 A;  1GUN A;  1ILP A;  4BS9 A;  1ZYR C;  3T51 B;  4QUC A;  4CJ1 B;  3MXP A;  4F88 A;  1D8L A;  2AHO B;  3Q0A A;  1WTW A;  1VQI A;  1R9T H;  2UUC Q;  4QL5 A;  1TS4 A;  2K75 A;  2MGS A;  3MXN A;  2EY5 A;  3DWA A;  1SN8 A;  1RTN A;  4IPC A;  1SAP A;  3KOJ A;  4P74 A;  2OXP A;  4FXD A;  3P7J A;  3K7U C;  2XWJ B;  5GAE C;  4ZQ3 A;  1O80 A;  3CQZ H;  2Q8I B;  4A3I H;  5GAD C;  3I4N H;  2CQO A;  2FMM A;  2H1E A;  3LX0 A;  1XMQ Q;  1SJH D;  2UUB L;  1SMY C;  1AFP A;  2MQH A;  3Q23 A;  4HSP A;  2QEJ C;  1PRT F;  2JQO A;  4QGU A;  1J5E L;  2IX3 A;  2F4V Q;  1IYV A;  2RSO A;  2WB1 B;  5M3F H;  2X69 A;  2UU9 Q;  3RZO B;  3UI2 A;  1N32 L;  5JJZ A;  2MUY A;  1HRJ A;  4K2K A;  2K1B A;  3J81 c;  3L2P A;  5JEA J;  4G7Z C;  1STB A;  3NBH B;  5AJ3 Q;  3NP8 A;  3T1H L;  1X6O A;  5KEE A;  3H6M A;  1D7Q A;  1S3O A;  4HTH A;  4LF6 Q;  1STG A;  2EY2 A;  4DAY B;  2MP1 A;  3NHH A;  2EYM A;  2RBM A;  4IJH A;  2AMC B;  4FXG C;  5IYC G;  1F9R A;  4LF5 L;  3OHX C;  4ZCK A;  4DUY L;  3ITP A;  4PQX A;  1SE3 A;  5FO9 B;  2ICI A;  1HCZ A;  3H94 A;  4KD3 A;  5HGQ A;  1FR3 A;  4A3D H;  4IFD J;  3KBG A;  3J81 L;  2F0Q A;  4HJ9 A;  1YNX A;  1JJC B;  1S4Z A;  1GHJ A;  4H7B A;  3CCR A;  1EQT A;  1K9M C;  3VYT A;  4C2M H;  4X64 L;  1SRU A;  1HR0 W;  3TRZ A;  2HDL A;  5M5X B;  5H1S E;  1I94 L;  4FXK C;  4IUR A;  3ICE A;  1YNJ C;  3S17 H;  3J81 E;  1TS2 A;  4APV A;  2OCE A;  1L1O A;  3CCL A;  4B9W A;  4DR7 Q;  1EZ6 A;  1HTP A;  1ZXT A;  2KBN A;  4NB3 A;  2I5M X;  1E7Z A;  3IAY A;  2SOB A;  4UP8 A;  1PH3 A;  2G5D A;  2LXJ A;  2KCT A;  5IYB H;  1LO5 D;  1S5B D;  4CDC C;  4C3H H;  2NZO A;  1XTC D;  1X55 A;  2DNC A;  2A69 C;  1VQL A;  1EWI A;  2E8G A;  2P5Z X;  5DM6 3;  5IGF A;  1XJV A;  2UUA Q;  1U9R A;  2IHF A;  4OEM B;  3VR3 A;  3A8K E;  4YWK A;  1PZK D;  2ASB A;  2RCF A;  4DR7 L;  1LTT D;  2M9V A;  1K8O A;  3J81 i;  1F77 A;  1TVX A;  1SXT A;  2EXD A;  3DMU A;  1E1O A;  3TP5 A;  3NXW A;  2EIF A;  4OX9 Q;  3GQB A;  2UXB L;  4KY5 A;  4EQN A;  3OW7 A;  3MXG A;  2LSS A;  2PMZ E;  1HFG A;  3S15 H;  4LW1 A;  3TSS A;  4DV6 L;  4X65 Q;  4F8M A;  5COY A;  4DFA A;  3SK8 A;  1STY A;  2EYL A;  3D6C A;  3FKI H;  3W5O A;  2F3I A;  4BA1 I;  3DM1 A;  3CC4 A;  1LLR D;  3PSI A;  1B4O A;  3VR4 A;  4GZY C;  3PF4 A;  5A35 A;  3RZD B;  1A3U A;  1IHZ A;  2B8F A;  5JJL A;  4R4C A;  2CCZ A;  4QCL A;  1SFO H;  2D62 A;  1TY0 A;  1K0S A;  4RMF A;  1VMC A;  4CBV A;  2TMP A;  1YHB A;  5C4X B;  2HQL A;  1NAP A;  1YBY A;  3D31 A;  3NTK A;  4JI4 Q;  2EDG A;  5FK9 C;  2E2H H;  1BBW A;  2NB0 A;  3U4Z A;  3FVQ A;  5K36 H;  1STA A;  1V1O A;  2YU9 H;  3H09 A;  3PCO B;  1Q1E A;  2N88 A;  4A76 A;  1SEB D;  1K83 H;  3GP7 A;  1UE1 A;  3MC0 B;  4DNI A;  4OO1 G;  2B2W A;  4KLK A;  4JI1 Q;  1JOK A;  1NR4 A;  1U4L A;  4XQJ A;  5IT9 c;  4JI6 L;  3KK7 A;  4RGM A;  3EQL C;  1STH A;  5EKK A;  3T13 A;  1FL0 A;  3CRK C;  1LTL A;  2K4K A;  2PW5 A;  4TQU S;  4ULL A;  1EOV A;  1VQM A;  1P8L A;  1V8Q A;  2KUM A;  1HNX L;  2JA5 G;  1ZEQ X;  1TWA H;  3RN5 A;  5LL6 S;  4LF9 L;  1PVO A;  5EBD A;  3HKZ E;  1VF7 A;  1G2T A;  2NVQ B;  1I4H A;  3GV3 A;  4JI4 L;  1PZJ D;  2WAC A;  2K6A A;  2PQE A;  5IYD G;  3CCU A;  4DR5 L;  2RCN A;  1SNP A;  1PTO D;  1B3Q A;  1W2B A;  1I4X A;  1CT1 D;  1QNU A;  5T1G A;  3HOX H;  2RDF A;  3SVM A;  3A8J E;  1Y1V H;  1VQO A;  4LF8 L;  3PIO 3;  4HCS A;  4DR1 Q;  4LFB L;  4R4Q A;  4WJ3 M;  2Q2U A;  2EQS A;  1R4P B;  2BDO A;  2L15 A;  3Q6S A;  3K5M A;  2E5L Q;  5JPM C;  4F87 A;  1L0W A;  3DWQ A;  4JBM A;  3I4L A;  5K36 G;  4IPD A;  4A3G G;  5LL6 X;  2UUC L;  1B9N A;  1Q7Y C;  1KNA A;  2G9H D;  5C44 H;  2XNA C;  3G71 A;  3NEM A;  3JAM E;  2B2T A;  2B2Y A;  4XT3 B;  1VQJ A;  2NZH A;  2ZJR A;  1N34 L;  1EOT A;  1J8I A;  3I4M B;  4OX9 L;  4L5S A;  1PH5 A;  4A3E G;  4JVZ A;  3AFQ A;  4Y7N H;  2TSS A;  1FNW A;  1PYB A;  2NVX H;  1IW7 C;  4ZYS A;  4IAL A;  2JYO A;  3DHQ A;  1J9O A;  5DEH A;  5TSS A;  1AN8 A;  1EWH A;  3SDZ A;  2JXM B;  2VUM B;  2BH8 A;  4CKE A;  4HJ8 A;  3NEL A;  1STN A;  3HOW G;  4C3H G;  4I7A A;  2JA7 G;  1H9S A;  3LGJ A;  5IWA L;  3FDT A;  3IFT A;  1VQE A;  2EJF C;  3F2U A;  4QMG A;  4MTK A;  1ML0 D;  4KK7 A;  5CYU A;  5IIF A;  3R2T A;  4K6L A;  5D3I B;  1N33 Q;  3PO3 H;  4M8A A;  2IT1 A;  2BA1 A;  4RHS A;  2G9D A;  2XTI A;  5EPL A;  3EBE A;  1YHQ A;  2Q8T A;  1ET6 A;  4JI0 L;  3WOF A;  2L11 A;  3NPP A;  1B53 A;  4POF A;  2O5J C;  4V0B A;  3CQZ B;  2FFK B;  4L5T A;  1HXY D;  4R8I A;  5KND A;  1JIC A;  1MSG A;  4YIJ A;  4KHV A;  4B3M Q;  3ONA B;  1ENA A;  3UDF A;  1T9H A;  1WTH A;  2NYZ D;  1UAP A;  3NE5 B;  2F0J A;  4B9X A;  3DUZ A;  1R9T B;  2N49 A;  5JEA G;  5BN3 A;  1CI3 M;  1IW7 D;  2EYF A;  3KLS A;  1HH2 P;  4BY1 G;  1EL0 A;  2CHB D;  1XNR Q;  1RJT A;  4CJ2 C;  3H3V I;  2R7Z H;  4JI3 L;  2K28 A;  4U67 3;  1U4M A;  1F2Z A;  4JOI C;  5C5M A;  1QZH A;  1BCP C;  1FNV A;  2C5C A;  1K3R A;  3KDF B;  4RGT A;  4XTC S;  2A5H A;  3H0G G;  1ASY A;  1LV9 A;  1IBK Q;  1UWV A;  2MNA A;  4H13 C;  2ZT9 C;  3H0G B;  4GLA C;  1PH4 A;  4WJ4 A;  2EZV A;  4A3F G;  1N32 Q;  4DR3 L;  1HZ9 A;  4IUV A;  4YY3 L;  2YTV A;  3CC7 A;  1N36 Q;  4C1N I;  2KCM A;  3GO5 A;  3LWU A;  4OON A;  1YEZ A;  1SR3 A;  3K7A B;  2SDF A;  1X32 A;  1PH6 A;  3HOY H;  3TP6 A;  1NUC A;  4X66 Q;  1AH9 A;  4ILW A;  4PMC A;  1CKN A;  1MGS A;  1HZB A;  3G48 A;  3I55 A;  2JA8 H;  2CKZ B;  1KDA A;  3K0X A;  2E74 C;  2H4O A;  3STB C;  4DPG A;  3A5Z B;  1BBX C;  1BF4 A;  3RLO A;  1KAA A;  5JVG 3;  1IKL A;  3C3L A;  3RLN A;  1IBM L;  3PIP A;  1V1P B;  5CV6 A;  1S5F D;  5FO7 B;  1JC7 A;  2IWH A;  1WYD A;  4RKB A;  1V1Q A;  5C0X G;  4JYA L;  2IX0 A;  3A56 A;  3W1B A;  5EPK A;  3CU7 A;  1RHP A;  3E6Z X;  4JI7 Q;  1MD2 D;  4IQZ A;  5I9P A;  3DLL A;  1GOZ A;  4DV0 Q;  3BVM A;  1O7Y A;  1YIT A;  4OXP A;  1VQC A;  3I3C A;  1BQQ T;  4A3M B;  3TDQ A;  1A8V A;  1ICF B;  1NBW A;  3PV0 A;  4EVO A;  4YHH L;  1XPU A;  1SYF A;  3T56 B;  5ELN A;  2I5L X;  3EN2 A;  4KHZ A;  2EY1 A;  4UAI A;  4YCV A;  1Q8I A;  1I4R A;  1VQH A;  3HKZ B;  2ZTD A;  5M9O A;  3OSO A;  1V1P A;  3V96 A;  2N78 A;  1A6X A;  3OOC A;  3PUZ A;  4B3S Q;  4LF7 L;  2UUA L;  3R93 A;  5C4X G;  3HOW B;  1C48 A;  3DM3 A;  2VNU D;  1Y8O B;  2IW3 A;  2R6G A;  3X3N A;  4UP7 A;  2F0I A;  4UHV A;  4IJL A;  4BWG B;  1L2F A;  1B9M A;  1BR9 A;  5JPN C;  1I5F A;  2BDN A;  2Z6K C;  4IUP A;  4BBR G;  3S24 A;  4A3L H;  1GVP A;  4LFA Q;  3QG1 A;  4RCO A;  4IPG A;  1TQO A;  2ALY B;  2K01 A;  3TEH B;  3F1Z A;  1JE5 A;  1TS5 A;  2WIN B;  5CV8 A;  3CD6 A;  5HUR A;  4BBS B;  4JK1 C;  4A4I A;  4DV3 Q;  3PQI A;  1JWM D;  2L12 A;  1H95 A;  2SNM A;  2N8N A;  5C4H A;  5ELO A;  3KJP A;  1DGS A;  4A3J H;  3SGI A;  2QEX A;  4DK1 A;  3TZU A;  1LTI D;  2VY3 A;  3G6E A;  2A6H C;  2Z9H A;  4LFC L;  2RHQ B;  3E3X A;  2WB1 G;  1KAB A;  5M3M G;  1KLU D;  4BY1 B;  1TS3 A;  4DV5 Q;  1ENC A;  1PRT D;  4C56 C;  4F7X A;  3HOX G;  4A3M G;  3CW2 C;  1XNQ L;  5D14 A;  4B3R Q;  5G3L F;  4DR6 Q;  3HRZ C;  5L37 A;  3PO3 B;  4X3T A;  3S2D H;  4O1N A;  3KLS X;  3W2D A;  2F0K A;  3OWE B;  4AQY L;  4C3I B;  2WKC A;  4LF6 L;  1BCP D;  3KUP A;  4GKJ Q;  5CV4 A;  3QR8 A;  4XIG S;  2VUM H;  4DUZ L;  2ID0 A;  3NK9 A;  4LK1 C;  3BYY B;  3HZX A;  1GKH A;  4R4I A;  4YHH Q;  3E9H A;  1WD0 A;  4IUU A;  1PFN A;  5LMN W;  1PMR A;  1TWH H;  3PO2 B;  4H44 C;  2NVX B;  3SEB A;  4AYB G;  3CP0 A;  3RUZ A;  1VQP A;  1A2T A;  1V9P A;  5BR8 L;  2PMZ B;  3S1R H;  2IX1 A;  3BYT B;  2EYH A;  5ISR A;  1A63 A;  1SLJ A;  4ABN A;  4A3K H;  1HNZ Q;  3I4N G;  2PQA B;  2UUB Q;  2LS0 1;  2VUM G;  5IT9 E;  5M5Y B;  1QG7 A;  3W1G A;  4NP5 A;  3GV6 A;  4AYB E;  2A6H D;  1DD2 A;  1JOR A;  3U9S A;  3S1N B;  5FLX E;  2UXD L;  2F0O A;  5C0X H;  1G6P A;  3CCQ A;  4EQ5 A;  5C3E B;  1OXV A;  1UE7 A;  5T1I A;  2DJF C;  1KRT A;  3TS2 A;  3D8G A;  1Y8P B;  5C3E G;  2K52 A;  1YHA A;  2V1C C;  3DEP A;  2WII B;  4L5R C;  3M4O B;  3IKJ A;  3HP3 A;  2CWA A;  1Y1V B;  1II3 A;  2SEB D;  1OXT A;  3HOX B;  4PZ8 A;  1KL9 A;  4NW2 A;  3S14 B;  5BN5 A;  1WTV A;  3MZ5 A;  4KN4 C;  1WOC A;  1PH7 A;  2Z6K A;  1R4Q B;  3G6J B;  4G7O C;  2GVA A;  4DNR B;  1HR0 L;  2A68 D;  1KIX A;  1NY4 A;  1A2U A;  2VQF Q;  3ULL A;  4P71 A;  1UE6 A;  1FYC A;  1PTO F;  3NWT A;  1XMO Q;  1STE A;  4BBR H;  3R8B A;  5IGB A;  2LMC B;  4PNY A;  1Z6H A;  1Y14 B;  1Y1W B;  4AYB B;  1QCB D;  5I2X A;  3AMU A;  1NCV A;  1C8C A;  4RHR A;  5IYD H;  2N55 A;  2VB2 X;  4X3S A;  1U5K A;  1FVI A;  3J7A V;  4GN5 A;  3WOE A;  5IGC A;  3RN2 A;  2F0P A;  2R7Z G;  3K6O A;  2NVT B;  4B08 A;  2IJ0 A;  3ZJY C;  1I94 Q;  3BDO A;  1N34 Q;  2B2T C;  3C2P A;  3X3M A;  4QF4 A;  4DXG A;  4ZAI A;  5D65 A;  3SE0 A;  1WVL A;  3NBH A;  3RZD H;  3M4Y A;  3SK5 A;  3PUX A;  4NXN Q;  4DV0 L;  4IZ8 A;  3J7A F;  1WTP A;  1TR5 A;  4Y52 H;  3KLW A;  3I4O A;  5KYI A;  1MI2 A;  1O7I A;  4K6D A;  4P72 A;  3S1N H;  3OW2 A;  4PG3 A;  2MJ8 A;  1QB5 D;  4DK6 C;  4CHT B;  5EGT A;  3S15 B;  1PFS A;  4LUV A;  1U4R A;  5M5Y H;  2R93 H;  4GNX A;  4KTA A;  1CK1 A;  3SXH A;  1ENF A;  4QB4 A;  2Q2T A;  1ZYR D;  3S1R B;  5J22 A;  1WJJ A;  2DGY A;  2OTL A;  3BVG A;  3UE0 A;  2KEN A;  1PYS B;  4EX5 A;  1IZ6 A;  1JQY D;  3SK6 A;  3FP9 A;  1HNX Q;  3QB3 A;  4A3G B;  1HQR D;  4N8X 1;  5KNC A;  1QNK A;  1XMO L;  4EQP A;  2JN4 A;  1VQ4 A;  3BU2 A;  2F0D A;  2K5D A;  1HZC A;  1Q12 A;  4BXX G;  1SBB B;  1EEF D;  1X3P A;  4X3K A;  2KOL A;  4A3E B;  3LNN A;  1O7L A;  2HHH L;  2PZT A;  1X3E A;  1H9R A;  1XMQ L;  3SHL A;  1A0I A;  2K14 A;  1NNX A;  2DY8 A;  1LM0 A;  1LT4 D;  2KEC A;  2A68 C;  2XRQ D;  2AQ1 B;  3A7A B;  3HKZ G;  3ND8 A;  3PUW A;  3HS0 C;  4X62 L;  1TY2 A;  4JC0 A;  2QGQ A;  3NSW A;  4YWM A;  1E2V A;  4KJN A;  4BBS G;  2HCC A;  4UY8 C;  4DKA C;  3H3V C;  1BO0 A;  5IP9 H;  1JMC A;  4A3J B;  4LF8 Q;  2ZTC A;  4KMU C;  5IYB G;  1K8A C;  4IN3 A;  5NUC A;  1IXR A;  1O78 A;  4J6H A;  4X62 Q;  1WTR A;  5M5W H;  4A3D B;  4DV6 Q;  1Y1V G;  4HN7 A;  3A5U A;  2PYK A;  1DOK A;  1NR2 A;  1X3Q A;  2RA4 A;  2WKD A;  5CBA E;  3A0J A;  1QZG A;  2K03 A;  3H15 A;  3L9A X;  3SR1 A;  2JP1 A;  1XWE A;  1CZW A;  2A1A A;  1U4P A;  1SYD A;  2FHT A;  5JJI A;  4KI0 A;  1PH2 A;  2Z1C A;  2HIV A;  1Q82 C;  3VYR A;  4K5V A;  1YVC A;  4CDF C;  3RD4 A;  1N33 L;  5FJ8 G;  4YY3 Q;  5KYL A;  1SRO A;  3I72 A;  1MSH A;  1QOH A;  5M3M B;  4KKS A;  5M3F B;  3RZO H;  1SNM A;  3M4P A;  1D6E C;  5EQ0 A;  5GAG C;  1LTG D;  2FIN B;  3MEH A;  3AEV A;  4GOP B;  4DV4 Q;  4IFD I;  1T5X D;  2QCP X;  3Q8D A;  2CQA A;  1GO3 E;  4ME5 A;  5I4D A;  1G2S A;  4FF2 A;  1WTX A;  1E22 A;  5KIX A;  3HOU B;  4DK0 A;  1PHJ A;  3K81 C;  3I56 A;  4ALP A;  2F0G A;  4OWW B;  2EOT A;  4OWT B;  1G51 A;  4ID6 A;  1WCM B;  5IP7 H;  1FJG L;  5JJK A;  2F3V A;  2F52 A;  1TWG B;  1BUV T;  2JEA I;  1F2Y A;  2K7V A;  4JI2 L;  4KV6 A;  1H9J A;  5LMU Q;  3GTG B;  4ZUJ A;  3PUY A;  3GTL H;  3VR2 A;  4OIJ A;  4B3M L;  4XYO A;  4QY7 A;  3OIQ A;  1DCZ A;  1FJG Q;  4FNF A;  5C4J H;  1VCI A;  4O0A A;  3JAM L;  2AWN A;  2J0T D;  3CCV A;  3NQI A;  1Q1B A;  5HY6 A;  2BE5 C;  3BZC A;  1VQD A;  3HFZ B;  4DGZ A;  1Q81 C;  4DAP A;  2ZJP A;  3ER0 A;  2CWP A;  4ZK9 B;  2QW7 A;  4N8F A;  2Z8L A;  3O13 A;  2DUD A;  2JA5 B;  1DZ1 A;  1N9W A;  4RGO S;  1QWY A;  1Z47 A;  1LYL A;  1NSN S;  3BZD B;  4H0L C;  2Z6B A;  3K7A H;  3HOV B;  1DXM A;  2RVL A;  1RTO A;  3F2B A;  1O7Z A;  2RF4 A;  5EPJ A;  3P1H A;  4K0K Q;  2F4I A;  2IPK D;  1MIU A;  3J80 L;  1X54 A;  5LMN L;  5JAV A;  3U4V A;  2A6E C;  2EJG C;  3H0G H;  3OIP A;  2F0N A;  1J5E Q;  4LUZ A;  3MFG A;  1Y1W G;  1KAW A;  2AQ2 B;  1UNS A;  2K5H A;  4YCU A;  2EPB A;  3T16 A;  2VXW A;  1VDZ A;  2NTT A;  3HOY G;  3QJY A;  4C3I G;  1ILQ A;  3AYH B;  4Q0F A;  3J80 i;  3S1Q B;  1C9O A;  1EU4 A;  4A93 H;  2E2D C;  3TN2 A;  4JV5 L;  5FOB B;  4X6A H;  4HJA A;  4JPB W;  3GTK B;  3NTI A;  3I2Z A;  1A3V A;  2CH4 W;  2UXD Q;  1F2L A;  2K33 A;  4UDU C;  3E9I A;  1EY7 A;  1XXG A;  4XT1 B;  3K5O A;  1K73 C;  1BVS A;  4JYA Q;  3NEN A;  3D4R A;  4K5X A;  3BG3 A;  3VA5 A;  1JJ2 A;  2F03 A;  1BXT A;  4ZKC B;  1CSQ A;  1PFB A;  4HIK A;  1LUZ A;  4GKK Q;  3QOL A;  2QF7 A;  3OWF A;  1IKM A;  4A93 G;  1LTA D;  2VQE L;  4P73 A;  2Q8R E;  4CKB A;  3EVQ A;  4DR5 Q;  2PI2 E;  4A3B G;  3S2H H;  3NBI A;  2PW7 A;  1PA6 A;  2L0C A;  2K5N A;  4L8J A;  3KLR A;  3UDG A;  3TZD A;  2XVS A;  3GTM H;  2JA7 H;  5IP9 G;  3C46 A;  1KNE A;  1AZP A;  3MA2 B;  5EKL A;  1EIG A;  3QOJ A;  4LAA A;  1EQQ A;  1M90 C;  4RG1 A;  1B3A A;  3FRP B;  1F2M A;  2CVR A;  5A2Q L;  2B2W C;  1UEB A;  3GTP H;  2K05 A;  4MIU A;  1ONL A;  1TWC H;  2LFN A;  4DV2 L;  3J81 j;  3OYY A;  1CM9 A;  1EQV A;  3JAM c;  4AQY Q;  3CCS A;  2EVB A;  2JE6 I;  2QDL A;  1VQ9 A;  1Q90 A;  3I4M H;  3I70 A;  1VQF A;  1NJI C;  2R7F A;  1CHP D;  3CPF A;  1XNR L;  4NKL A;  1B7Y B;  2KCC A;  1Q46 A;  2F0E A;  1M8A A;  4RAU C;  4DV5 L;  2A19 A;  3RLF A;  4KN7 C;  2A6E D;  2A8V A;  2B8G A;  3CPW A;  1H9K A;  3D0F A;  3A74 A;  4JV5 Q;  4BXX H;  2E2J H;  2NBF A;  2NN6 H;  2B2V A;  4DF7 A;  1VF5 C;  4AIM A;  4JCV E;  4JI5 L;  1DOM A;  4NDX A;  4LFA L;  1VQN A;  2CW0 C;  3TS0 A;  1ROD A;  1ICW A;  2HT1 A;  4QIW E;  1Q3L A;  2KA7 A;  2WB1 E;  2R92 B;  1WTQ A;  2JA8 G;  3CCE A;  4TSS A;  1TWA B;  1S5C D;  1W3S A;  5E7N A;  5IOC A;  3MAQ A;  4JBJ A;  1EY4 A;  4E6I A;  4LF4 Q;  5GAH C;  3A55 A;  1I50 B;  1DYQ A;  4C1N K;  1XPO A;  2JA6 H;  3KFU A;  1WI5 A;  3VR6 A;  1JWU D;  4JG2 A;  4BA2 I;  1SE2 A;  4MHE A;  5C6A A;  4JI8 L;  1K83 B;  3BDC A;  5IYC H;  3VR5 A;  4LF4 L;  4C3J H;  1EFI D;  2UU9 L;  1QUQ B;  3CAM A;  2R3Z A;  3M4Q A;  1LTB D;  4DXF A;  1RIP A;  5JOB A;  4MN3 A;  1CKN B; 
#chains in the Genus database with same CATH homology
 2ASB A;  1HNZ L;  1EQR A;  1OXT A;  3U58 A;  4PZ8 A;  2AKW B;  5IE8 A;  4DR7 L;  3J81 i;  1KL9 A;  3M85 A;  1S40 A;  1X3F A;  3EIV A;  2EXD A;  4FDB A;  1E1O A;  5C4X H;  2K5V A;  2EIF A;  4OX9 Q;  2NVQ H;  3HOU G;  2UXB L;  4IO9 A;  1WOC A;  4DK3 C;  2Z6K A;  1PH7 A;  2HHH Q;  4ME3 A;  2LSS A;  2PMZ E;  3E0E A;  3S15 H;  4LW1 A;  4X64 Q;  4DR2 Q;  1Z9F A;  5LMN Q;  4HIM A;  1Y1W H;  3KDF A;  4H02 A;  4DV6 L;  4JI8 Q;  4X65 Q;  1IL2 A;  2GVA A;  5LMU L;  1HR0 L;  1A62 A;  4R1J A;  1IBM Q;  4K0K L;  3FKI H;  3W5O A;  4BA1 I;  2F3I A;  4DV7 Q;  1NY4 A;  1KIX A;  3CC4 A;  1MKH A;  3PSI A;  2VQF Q;  3L7Z C;  3ULL A;  3CC2 A;  4P71 A;  1YJN A;  1MJE A;  4GLX A;  1YI2 A;  4GKJ L;  1UE6 A;  3F2C A;  2WFW A;  3PF4 A;  2ZM6 Q;  1XMO Q;  4BBR H;  1K0R A;  3UE1 A;  1Y14 B;  1QVF A;  5JJL A;  4R4C A;  2MO0 A;  3PGZ A;  2CCZ A;  1MJC A;  1SE8 A;  2D62 A;  1SFO H;  1Q8K A;  2R92 G;  5IYD H;  2N3S A;  1U5K A;  4RMF A;  2NVT H;  1FVI A;  4A3F H;  1YHB A;  2GN5 A;  4PMW A;  4GN5 A;  3RN2 A;  3BZK A;  2HQL A;  2R7Z G;  1YIJ A;  5EAY A;  1NE3 A;  1YBY A;  5BR8 Q;  3D31 A;  2B63 G;  4JI4 Q;  1IBL L;  3PUV A;  1GD7 A;  4A3K G;  4GOP A;  2E2H H;  3ZJY C;  4IOC A;  1BBW A;  5C44 G;  3T1H Q;  1N34 Q;  3U4Z A;  1I94 Q;  4JI5 Q;  3GTQ H;  1HNW L;  3ERS X;  5FLX c;  3K80 C;  3M4O H;  2YU9 H;  2JEB I;  3PCO B;  1Q1E A;  4GS3 A;  4A76 A;  3RZD H;  1K83 H;  1HZA A;  1UE1 A;  2OQK A;  3PUX A;  4DNI A;  4DV0 L;  1CUK A;  4DV1 L;  4HID A;  2ES2 A;  4OO1 G;  4DUZ Q;  4KLK A;  4JI1 Q;  5C3E H;  4Y52 H;  4GNX C;  3AFP A;  3KLW A;  5IT9 c;  1IBK L;  4JI6 L;  3I4O A;  4HJ5 A;  1O7I A;  1XTD A;  4P72 A;  4DV3 L;  1XPR A;  3S1N H;  3OW2 A;  4PG3 A;  4DK6 C;  4JBW A;  1FL0 A;  2VL6 A;  1LTL A;  2Z0S A;  2K4K A;  4LWC A;  4TQU S;  4DR3 Q;  1EOV A;  1VQM A;  1P8L A;  2KHI A;  1PFS A;  4LUV A;  4A3B H;  2JA5 G;  1HNX L;  5M5Y H;  2R93 H;  1TWA H;  3RN5 A;  4LF9 L;  4GNX A;  1PVO A;  4LF5 Q;  3HKZ E;  3HOV G;  4PZ7 A;  4JI4 L;  2WP8 J;  3CCU A;  5IYD G;  2R92 H;  2Q2T A;  4DR5 L;  2RCN A;  3CCM A;  3S14 H;  1K8G A;  4JI3 Q;  1W2B A;  1WJJ A;  2DGY A;  3ULP A;  3L0O A;  1N8R C;  2OTL A;  3HOX H;  4QQB X;  3UE0 A;  1KC8 C;  4POG A;  1B8A A;  1VQ6 A;  2KEN A;  1PYS B;  4EX5 A;  4HJ7 A;  1Y1V H;  1VQO A;  4MTN A;  4LF9 Q;  1IZ6 A;  4OO1 I;  4LF8 L;  3FP9 A;  1HNX Q;  4DR1 Q;  4LFB L;  2PQA A;  4R4Q A;  2ZJQ A;  4DV4 L;  2Q2U A;  4WJ3 M;  2VZA A;  2EQS A;  2Y0S E;  1XMO L;  2L15 A;  2E5L Q;  4GN4 B;  1VQ4 A;  3BU2 A;  4GN3 B;  1L0W A;  1EIF A;  1HZC A;  3T1Y Q;  4JBM A;  1Q12 A;  3PO3 G;  4IPD A;  5K36 G;  1L1O B;  1AE3 A;  4A3G G;  2JJQ A;  4BXX G;  2UUC L;  1HR0 Q;  4DR4 L;  4C3I H;  1I50 H;  1Q7Y C;  1OXU A;  1X3G A;  5DLQ E;  5C44 H;  3NEM A;  3G71 A;  1ASZ A;  2I5H A;  2HHH L;  1VQJ A;  2MO1 A;  1X3E A;  2NZH A;  2ZJR A;  1N34 L;  2YTY A;  1XMQ L;  3BJU A;  1VQ5 A;  4A3C H;  1FGU A;  4OX9 L;  1A0I A;  1WFQ A;  2K14 A;  3CME A;  2NVY H;  4L5S A;  1PH5 A;  2B29 A;  1LM0 A;  4A3E G;  2I0Q A;  4BY7 G;  3HKZ G;  2Q2H A;  2PNH A;  3KF6 A;  1KRS A;  3AFQ A;  3PUW A;  5C0X I;  2JA9 A;  4DR4 Q;  4Y7N H;  4JI0 Q;  4X62 L;  3M3Y H;  4GKK L;  1PYB A;  2QGQ A;  4JC0 A;  4YWM A;  3CCJ A;  1VQ8 A;  2NVX H;  3PO2 H;  3T1Y L;  3OTO Q;  1G29 1;  5M5X H;  4JI7 L;  1WCM G;  1KQS A;  4BBS G;  4UY8 C;  3ULJ A;  4DKA C;  3S16 H;  2WAQ E;  5IP9 H;  1PH9 A;  1JMC A;  5FLM G;  4NXM L;  5GQO A;  4LF8 Q;  4YCW A;  2ZTC A;  3M9B A;  1P16 A;  5IYB G;  2BH8 A;  1JB7 A;  2JK8 A;  1K8A C;  4HJ8 A;  3KJO A;  2Y0S G;  3NEL A;  3HOW G;  1IXR A;  1PH8 A;  2H5X A;  4X62 Q;  5M5W H;  2JA7 G;  3LGJ A;  5IWA L;  2MFI A;  1VQE A;  1E1T A;  4KHP Q;  1OXX K;  4DV6 Q;  1Y1V G;  4R4T A;  4GLV B;  3A5U A;  3J80 c;  1N33 Q;  3PO3 H;  4PZ6 A;  2IT1 A;  1E3P A;  2BA1 A;  2XTI A;  2UXB Q;  2WAQ G;  3EBE A;  3JC6 6;  1YHQ A;  4IFD G;  4JI0 L;  3IRB A;  3A0J A;  1QZG A;  3H15 A;  4POF A;  4MNO A;  4X66 L;  2R7D A;  4AH6 A;  4BY1 H;  2A1A A;  2KHJ A;  3KF6 B;  4L5T A;  1X65 A;  2D0P A;  3PF5 A;  4KI0 A;  1PH2 A;  5JJI A;  3CMA A;  1Q86 C;  2HIV A;  1Q82 C;  1N36 L;  1YVC A;  4B3M Q;  4IPH A;  1N33 L;  4R4O A;  5FJ8 G;  4YY3 Q;  1SRO A;  4LNQ A;  1EUJ A;  1T9H A;  3UDF A;  1OXS C;  4KHP L;  3RZO H;  4DR1 L;  4LFB Q;  3FHW A;  2QA4 A;  4NPS A;  1VQK A;  4NXN Q;  5IWA Q;  3M4P A;  4JI2 Q;  1NMG A;  5M3F G;  1BKB A;  5GAG C;  1GM5 A;  1QUQ A;  1JT8 A;  1I3Q H;  5IY0 A;  2N49 A;  3GTJ H;  3J7Z C;  5JEA G;  2B3G A;  2C35 B;  3GTK H;  4L5Q A;  3I4M G;  3MXN B;  3U50 C;  3AEV A;  4BBS H;  4GOP B;  1I6H H;  4JOI A;  1HH2 P;  4DV4 Q;  1L1O C;  4IFD I;  3UDX A;  4YWL A;  4BY1 G;  3Q8D A;  3S1Q H;  1XNR Q;  1GO3 E;  3MEF A;  4UP9 A;  3GDE A;  4A3M H;  3H3V I;  2R7Z H;  1E22 A;  3I7F A;  5C0X J;  4JI3 L;  1VQB A;  4TVA B;  1PHJ A;  3K81 C;  2NN6 G;  3I56 A;  1TXY A;  4ALP A;  1X9N A;  4JOI C;  1QZH A;  4OWW B;  4OWT B;  1G51 A;  1JJG A;  4MZ9 A;  4XTC S;  1K3R A;  3KDF B;  5IP7 H;  1FJG L;  3H0G G;  1ASY A;  2F52 A;  5JJK A;  5FJ8 H;  4LFC Q;  1KXL A;  1IBK Q;  4JI6 Q;  1UWV A;  5AJ3 L;  2YV5 A;  2MNA A;  2JEA I;  4JI2 L;  3CF5 A;  5LMU Q;  1EFW A;  3STB D;  3HOW H;  4GLA C;  1PH4 A;  4WJ4 A;  3K8A A;  4QJF A;  1J6Q A;  1V43 A;  4A3F G;  1NTG A;  1N32 Q;  4DR3 L;  3PUY A;  2VW9 A;  5FLM H;  1HZ9 A;  4YY3 L;  3GTL H;  2YTV A;  4B3M L;  2IHE A;  4QY7 A;  3CC7 A;  1N36 Q;  2KCM A;  3GD7 A;  3GO5 A;  4OON A;  3KF8 B;  1YEZ A;  1FJG Q;  1SR3 A;  4JI1 L;  2PI2 A;  5C4J H;  1VCI A;  4O0A A;  1PH6 A;  2OQ0 A;  3RNU A;  4A75 A;  2E5L L;  3HOY H;  2AWN A;  3CCV A;  2JA5 H;  1PV4 A;  4X66 Q;  1Q1B A;  1AH9 A;  3F8T A;  1CKN A;  5HY6 A;  1HZB A;  3G48 A;  3BZC A;  1VQD A;  3HFZ B;  3WWV A;  2OTJ A;  3TQY A;  1Q81 C;  3I55 A;  3F2D A;  2JA8 H;  2ZJP A;  2CKZ B;  3HOZ G;  1HNW Q;  3ER0 A;  2CWP A;  4DR6 L;  2ZTE A;  3K0X A;  1XNQ Q;  1IYJ B;  4B3R L;  3STB C;  4DPG A;  2DUD A;  3A5Z B;  1AE2 A;  1N9W A;  2UXC Q;  2ZM6 L;  1Z47 A;  1LYL A;  3RLO A;  1C0A A;  3K7A H;  1E24 A;  1PH1 A;  1VQ7 A;  3F2B A;  2Q2I A;  4DV2 Q;  4DV7 L;  2RF4 A;  4K0K Q;  3RLN A;  1IBM L;  1VQG A;  2VS1 A;  3PIP A;  1RL2 A;  1MIU A;  4J15 A;  3HKS A;  1WYD A;  1X54 A;  1V1Q A;  5LMN L;  5C0X G;  1NMF A;  4JYA L;  2IX0 A;  3W1B A;  3U4V A;  3M7N A;  3H0G H;  3GTG H;  3OTO L;  4JI7 Q;  2JA6 G;  1TWG H;  3TRE A;  2LXK A;  1J5E Q;  1QVC A;  2CFM A;  4LUZ A;  1WCM H;  3DLL A;  1Y1W G;  1KAW A;  3HOV H;  2BA0 A;  1M1K C;  2K5H A;  4DV0 Q;  4DV1 Q;  2E2I H;  4JBK A;  4A3L G;  1YIT A;  4OXP A;  1VQC A;  4O2D A;  4YCU A;  3HOZ H;  3HOU H;  3CXC A;  2BH2 A;  2OWO A;  1B70 B;  2D0O A;  1HJP A;  5GRO A;  1VS0 A;  3HOY G;  2YTX A;  3AYH B;  1A8V A;  1NBW A;  3PV0 A;  4GOP C;  3J80 i;  1IBL Q;  4YHH L;  4BY7 H;  1C9O A;  1D8L A;  2AHO B;  1XPU A;  3FKI G;  4A93 H;  4JV5 L;  5ELN A;  4HJA A;  2I5L X;  3EN2 A;  4X6A H;  4KHZ A;  4IOA A;  1VQI A;  1R9T H;  3I2Z A;  2UUC Q;  4YCV A;  1U0L A;  4QL5 A;  2UXD Q;  2K75 A;  3H3V H;  3E9I A;  1VQH A;  2ZTD A;  1K73 C;  1BVS A;  2N78 A;  3NEN A;  4JYA Q;  1CSP A;  3PUZ A;  5M3M H;  4B3S L;  4B3S Q;  4LF7 Q;  1SN8 A;  1JJ2 A;  4LF7 L;  2UUA L;  5C4X G;  3J7A 5;  3DM3 A;  4IPC A;  2VNU D;  1CSQ A;  3KOJ A;  4P74 A;  2R6G A;  4HIK A;  1S72 A;  1LUZ A;  4UP7 A;  1OTC A;  4GKK Q;  3K7U C;  4IJL A;  4A93 G;  5GAE C;  3PO2 G;  1L2F A;  4A3J G;  2VQE L;  4P73 A;  3S1M H;  2UXC L;  3CQZ H;  4DR5 Q;  4P75 A;  1TWF H;  1I5F A;  2PI2 E;  4DR2 L;  4A3I H;  4A3B G;  3S2H H;  5GAD C;  2Z6K C;  4BBR G;  1PA6 A;  3S24 A;  3I4N H;  2K5N A;  2CQO A;  4A3L H;  1GVP A;  4LFA Q;  1XMQ Q;  4A3D G;  2UUB L;  4IPG A;  2ALY B;  3TEH B;  2MQH A;  3UDG A;  3F1Z A;  1JE5 A;  3GTM H;  2JA7 H;  3CD6 A;  1CKO A;  2AWO A;  5IP9 G;  4A4I A;  4LUO A;  4DV3 Q;  2JQO A;  1QVG A;  1H95 A;  4QGU A;  1EQQ A;  2N8N A;  1J5E L;  1C7Y A;  1M90 C;  4RG1 A;  3RR5 A;  5ELO A;  2F4V Q;  1CKM A;  3KJP A;  1VQA A;  2GVB A;  1DGS A;  4A3J H;  3SGI A;  2QEX A;  5M3F H;  1UEB A;  4NXN L;  2UU9 Q;  3GTP H;  1N32 L;  4B3T Q;  1YJW A;  3PIO A;  3J81 c;  2VY3 A;  3L2P A;  2B63 H;  4DUY Q;  5JEA J;  3G6E A;  3NBH B;  5AJ3 Q;  1TWC H;  3T1H L;  4LFC L;  1X6O A;  2RHQ B;  4DV2 L;  3J81 j;  2WB1 G;  3OYY A;  1D7Q A;  1S3O A;  5M3M G;  4DV5 Q;  4LF6 Q;  3JAM c;  4AQY Q;  3CCS A;  2JE6 I;  4A3M G;  3HOX G;  4DAY B;  3CW2 C;  3VDY A;  1XNQ L;  1VQ9 A;  4B3R Q;  4IJH A;  2AMC B;  2ATW A;  5IYC G;  2RHS B;  3I4M H;  4DR6 Q;  4HIO A;  1EIY B;  4LF5 L;  1VQF A;  1EYG A;  1NJI C;  2R7F A;  3CPF A;  5J3B A;  1XNR L;  4DUY L;  1B7Y B;  3S2D H;  1Q46 A;  1BBU A;  4A3E H;  4GNX B;  3G4S A;  4AQY L;  4DV5 L;  4LF6 L;  2A19 A;  3RLF A;  2HIX A;  5HGQ A;  2NN6 I;  4A3D H;  2F4V L;  2R93 G;  4GKJ Q;  2VQF L;  4IFD J;  4HJ9 A;  4XIG S;  2A8V A;  1YNX A;  3AQQ A;  4A3I G;  2VUM H;  1JJC B;  3CPW A;  4DUZ L;  2ID0 A;  4UPA A;  5IP7 G;  3CCR A;  1KHI A;  3D0F A;  1K9M C;  1GKH A;  4C2M H;  3A74 A;  4JV5 Q;  4BXX H;  4X64 L;  4A3G H;  4R4I A;  4YHH Q;  2E2J H;  3E9H A;  1SRU A;  1HR0 W;  5LMN W;  3TRZ A;  3KYH C;  5H1S E;  1TWH H;  4AIM A;  4JCV E;  4JI5 L;  1I94 L;  4LFA L;  4AYB G;  1VQN A;  3TS0 A;  3CP0 A;  3ICE A;  4A3C G;  4OWX B;  2HT1 A;  4QIW E;  1VQP A;  3S17 H;  1YJ9 A;  4DAM A;  1V9P A;  5BR8 L;  2IX1 A;  3S1R H;  4APV A;  2K50 A;  2OCE A;  1L1O A;  2WB1 E;  2VQE Q;  3CCL A;  2JA8 G;  4DR7 Q;  1A63 A;  3CCE A;  1SLJ A;  2FXQ A;  4A3K H;  1HNZ Q;  3I4N G;  2KBN A;  4NB3 A;  2I5M X;  2PQA B;  2UUB Q;  1YZ6 A;  1E7Z A;  2VUM G;  1PH3 A;  1W3S A;  4UP8 A;  5E7N A;  4JBJ A;  2LXJ A;  3W1G A;  2KCT A;  5IYB H;  1KD1 C;  4LF4 Q;  4AYB E;  5GAH C;  4C3H H;  3JAM i;  2NZO A;  1XPO A;  2JA6 H;  1X55 A;  3KFU A;  1WI5 A;  1VQL A;  1EWI A;  2UXD L;  2E8G A;  2XGT A;  1G6P A;  3CCQ A;  4EQ5 A;  2YYZ A;  1UE5 A;  4JG2 A;  1SMX A;  1OXV A;  1UE7 A;  1KRT A;  4BA2 I;  3TS2 A;  4NXM Q;  1XJV A;  1X56 A;  5IYC H;  2UUA Q;  3B6Y A;  2IHF A;  4JI8 L;  4X65 L;  4B3T L;  2IY5 B;  4LF4 L;  4C3J H;  5C3E G;  2K52 A;  1YHA A;  2UU9 L;  1QUQ B;  2V1C C;  3CAM A;  3M4Q A;  4L5R C;  3GTO H;  1RIP A;  2CWA A;  4YWK A;  3UDI A;  1CKN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...