2UUCQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 22
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uucQ00
2AWOA 4DR3L 4OWXB 1B8AA 3PUWA 4QIWE 4DAMA 4C3JH 1RL2A 3HOXG 5H1SE 5M3FG 2E5LQ 1HJPA 1CKNA 2WP8J 3E9IA 4BY1G 4IFDG 2MO0A 4EQ5A 4DR6Q 4QJFA 1VS0A 4BBRH 2IX1A 2Z6KC 1VQDA 4DV3Q 1U0LA 2EQSA 3RLFA 3G6EA 1QVFA 1A63A 2JA6H 1Q82C 4X64Q 1IBKQ 4X62Q 3I2ZA 4YCUA 1AE2A 5C4XH 3CCJA 4BBSH 4JOIA 1PV4A 1EQRA 1HNWQ 1KAWA 3CQZH 1PHJA 1VQLA 3FP9A 4OO1I 1NY4A 3HOXH 3NBHB 3K7UC 1EQQA 1XPOA 1EOVA 4DR7Q 3RNUA 1Q46A 2E8GA 3EBEA 1XMQL 1PH3A 4BY1H 2VNUD 4NB3A 3PV0A 2Z0SA 1SFOH 4B3TL 3M3YH 1KD1C 4DV6Q 4JBJA 4JI8Q 2LSSA 3CPWA 4GN5A 2YTVA 4DV1L 4A3LG 2ZJPA 4B3RQ 2Q2IA 1VQGA 3ULJA 5FLXc 4JOIC 2E2IH 3HFZB 3GTGH 1LUZA 2A1AA 1Q81C 3NELA 5JJKA 1E24A 1SMXA 2A8VA 2IX0A 1UE6A 3GO5A 1E7ZA 1PYSB 3W1BA 2PI2A 5GADC 3KF6B 1I5FA 4LFBQ 1I94Q 4LF9L 3DLLA 3KLWA 1N36Q 1EUJA 2R7FA 3OW2A 4JI1L 2F4VL 1KC8C 3I4MG 1SN8A 4A3EG 5C0XG 2HHHQ 1VQAA 3RZOH 5ELNA 4X66L 4AH6A 1VQKA 2LXJA 1E22A 4A3LH 2JJQA 5E7NA 3CC4A 4PMWA 1XNRQ 4P74A 4HJAA 3UDXA 1J5EQ 4A3FG 4R4IA 2I0QA 3G71A 1N33Q 4DR1L 1QVGA 2OCEA 4OX9L 4JI3Q 1JJCB 4AIMA 5C0XJ 3AFPA 1WOCA 2WFWA 3K8AA 2IY5B 2Q2UA 2VUMH 3KFUA 1K73C 2K5VA 4OWTB 1PA6A 2UUCL 3GTPH 3RN5A 2I5MX 3GTLH 1SRUA 5AJ3L 2OTJA 3A0JA 2K52A 3M9BA 1UWVA 3HOVG 1Q12A 1VQHA 2JQOA 3RLOA 1X9NA 2QA4A 1VQ7A 1HR0Q 4LFAL 4A3KG 3A74A 2YYZA 4A3EH 3ZJYC 2MQHA 5LMNL 5EAYA 1QVCA 4YCWA 3CCRA 2ZTDA 3VDYA 2AMCB 4HIKA 4BXXG 2MFIA 2JA5G 4HIOA 2NZHA 3D0FA 2ATWA 4R4QA 4DUYQ 1PH7A 1CSPA 2VQFL 3S2DH 3PCOB 1PYBA 4IOCA 4A3MG 2C35B 2UUBL 4NXNL 2OWOA 4LF5L 3FHWA 2UXDQ 4XIGS 5IYCG 2R93G 5GAEC 4X6AH 1N9WA 4RG1A 1DGSA 1QUQA 4RMFA 3UDIA 4GLXA 1PH1A 4LFCQ 1YHBA 3PF4A 1HZAA 4KHZA 4A3IH 5DLQE 3RZDH 1L1OA 2F52A 4DV4Q 2K5NA 4HJ7A 1HR0W 1E1OA 3HOZH 4DV5L 1G51A 2UXCQ 3EN2A 4NXML 5BR8Q 5JJIA 1N32L 3S15H 3A5UA 3S24A 3TRZA 4DV2Q 3J80c 4H02A 3RR5A 2E2HH 4JI4Q 4KHPQ 2XGTA 1X65A 4K0KQ 2ZTCA 1UE7A 2K75A 1VQ5A 5IY0A 2CWAA 4A4IA 2JA5H 3CD6A 3PO3G 3S16H 4GKKL 2VY3A 2E2JH 1FJGL 1MJCA 1JMCA 4JBMA 4QQBX 1IXRA 5K36G 4OONA 4A3MH 1L1OC 1TWCH 1IL2A 1E3PA 1VQIA 2KCTA 5IYCH 1EYGA 4LUVA 1G6PA 4DV3L 1YJWA 5FLMG 1WFQA 1OXUA 1L0WA 3TQYA 1VQ6A 2OQ0A 4R4OA 1PH4A 4UP7A 4DKAC 1XNQL 4YY3L 3HOUH 4OO1G 1EWIA 4LUZA 2K50A 4DR5L 3S1QH 2JA8H 4POGA 1PVOA 2D0OA 2YTYA 5LMUQ 1OXTA 5C4JH 1KQSA 2UU9Q 3HOWG 3J80i 3CC7A 3S17H 5IWAQ 4WJ4A 1BKBA 2JK8A 2AKWB 4X65Q 3PO3H 1D8LA 1A62A 1YIJA 2AWNA 1TWFH 1NJIC 2ZJQA 4C2MH 1Y1VG 3K7AH 3B6YA 2R92G 3MEFA 3M4QA 5IP7G 3J81c 1VCIA 4IPHA 4GN3B 2PMZE 2IHEA 1YBYA 3F1ZA 4BY7G 4GN4B 3WWVA 5IP9G 3GTKH 1TWAH 1BBWA 3KDFA 4O2DA 4A3CG 3S14H 1Z9FA 2H5XA 2UXBL 4JI5L 5LMNW 2NVQH 2ZJRA 4GKJQ 1NE3A 1JJ2A 5FJ8G 5GQOA 4ME3A 1K8GA 3W5OA 4LW1A 2I5HA 3PGZA 1N36L 3TS2A 3EIVA 4R4CA 2OTLA 1K0RA 3K81C 4JI2Q 4GOPB 2PQAB 1IBLQ 3CCSA 5M3FH 3T1HQ 2JEAI 3J81i 1TWGH 4LUOA 1IYJB 1XJVA 4PG3A 1YNXA 1ASYA 1K8AC 1WYDA 1P8LA 1IBMQ 4BY7H 1J5EL 1N33L 4DV7Q 2ASBA 4AQYL 1SROA 1HZBA 4B3SL 3J7A5 1GKHA 1D7QA 2RHSB 2ES2A 1VQFA 4QGUA 3RLNA 5FJ8H 4JC0A 1X3FA 2CWPA 2KHJA 3KF8B 3PF5A 3CCEA 3NEMA 1PFSA 4C3HH 4DR3Q 1CKNB 2BH8A 1P16A 1PH8A 1YZ6A 4PZ6A 1VQ8A 4JYAL 4KLKA 5HY6A 1WJJA 3BJUA 3PUYA 1PH6A 4UPAA 1C0AA 2JE6I 4YHHQ 1KIXA 5IYBG 3AFQA 5IYDG 2UUAL 3KDFB 1CSQA 3H3VI 1KRSA 1XPRA 2PNHA 4JI0Q 2GVBA 3MXNB 3GD7A 1V1QA 3T1YL 2CFMA 2ZM6L 1HZ9A 3PO2G 1Z47A 4JI6L 3UE0A 5M3MG 4HIMA 4A3DG 3F2CA 2VZAA 1HNZL 1Q1BA 2JEBI 1Y1WG 4HJ5A 2V1CC 2EXDA 1VQJA 1SLJA 4DUZQ 4HJ8A 4B3ML 1XMQQ 3I4MH 4TQUS 4GLAC 4DPGA 1W2BA 4B3TQ 1TWHH 4BA1I 4KHPL 4P72A 2NVYH 4JBKA 1YVCA 1KHIA 1LM0A 3KYHC 4QY7A 5M5XH 4UY8C 1S72A 1FVIA 2XTIA 1KRTA 1VQCA 1YITA 4GNXA 2KCMA 4A3FH 2QGQA 1L2FA 1MIUA 1UE1A 5M5WH 4Y52H 3W1GA 1SE8A 3KOJA 4DK6C 4YWKA 1S3OA 5ELOA 3CCQA 1YJ9A 4DR2L 4LF6L 5M3MH 1C9OA 3I55A 1XMOQ 4LF7L 2HQLA 1HNXL 1N34L 3OTOL 1AE3A 2YU9H 1Y1WH 4BA2I 4JI1Q 2NZOA 2F4VQ 1U5KA 3CCLA 2YTXA 4QL5A 3TEHB 3HOVH 4GNXC 3L2PA 1B7YB 1TXYA 4OWWB 4A3KH 4X66Q 4GS3A 2B63G 2VS1A 2KHIA 2VQEL 4BXXH 1X55A 4FDBA 4IJHA 1VQMA 1OXSC 1H95A 4MNOA 3J81j 3BZCA 4DR1Q 1LYLA 4OX9Q 3E0EA 3IRBA 4PZ8A 4HJ9A 4IO9A 1MJEA 2E5LL 1PH2A 2JA7G 4P71A 4A75A 4DR6L 1A8VA 1X6OA 3H0GG 2JA9A 3ERSX 4A3JG 2R93H 4A93G 2B29A 2UUCQ 3FKIG 4R4TA 4L5RC 3I7FA 1WCMG 1K3RA 4MTNA 3JAMc 5AJ3Q 4X64L 4UP9A 2A19A 2I5LX 1IBKL 5J3BA 3BU2A 4X62L 4LFAQ 3SGIA 2MNAA 3G4SA 4DV0Q 2BA0A 1YHQA 3A5ZB 2D62A 1A0IA 4JI7Q 2R7DA 5LMNQ 5JEAJ 1HNWL 3M4OH 2ID0A 5IE8A 2ZTEA 1K83H 3ER0A 1O7IA 1N8RC 1R9TH 1HH2P 2VQFQ 1IBLL 1NMGA 4DR7L 1FGUA 1QUQB 2UUBQ 1G291 4LF5Q 4NXNQ 3M4PA 1HZCA 4JV5Q 3CC2A 1Q7YC 3H0GH 4DR4Q 1CKMA 1IZ6A 4IPGA 4XTCS 4JI8L 4JBWA 4DV6L 3M7NA 4A3BG 1L1OB 4LWCA 4A93H 4B3RL 3PUVA 2NN6G 5FLMH 3H15A 3JAMi 3U4VA 4J15A 4POFA 1Q86C 4YWLA 1XPUA 3PIPA 4LF4Q 4DV5Q 1GVPA 2N3SA 3PSIA 2NVTH 1NBWA 4BBSG 2CKZB 3I4NG 4APVA 1QZGA 1GD7A 1BBUA 3CP0A 1I94L 1C7YA 4LFBL 2HT1A 3HOWH 3PUXA 3KF6A 4GKKQ 2IHFA 2PI2E 4JG2A 1E1TA 2VL6A 1FJGQ 3DM3A 3I56A 3CCMA 2F3IA 1Y1VH 2R92H 4YHHL 1J6QA 3F2DA 3UDGA 1X54A 2OQKA 2WAQG 2HHHL 5IP7H 4UP8A 1QZHA 4A3BH 2D0PA 2Y0SE 4LF8Q 3CW2C 1XNRL 1KXLA 3HKZE 4JI0L 5IP9H 4IFDJ 1YJNA 4A3CH 1XNQQ 4L5TA 4JI3L 4YY3Q 2N78A 1X3GA 3CXCA 1YHAA 4PZ7A 4DR5Q 1JB7A 1EFWA 2KENA 2R7ZG 3ULLA 3AQQA 3I4NH 4AYBE 3HOYG 2NN6I 2B3GA 2DGYA 3CCUA 3F8TA 4DUZL 2YV5A 4P75A 2VW9A 1FL0A 3H3VH 1K9MC 4L5SA 1HR0L 3S1NH 2WB1G 2IT1A 4OXPA 1GO3E 4L5QA 4A76A 1KL9A 4IFDI 2RF4A 4IJLA 3Q8DA 3CF5A 3I4OA 4DUYL 2MO1A 3U50C 2UXBQ 1VQPA 4JI5Q 3CPFA 2VUMG 4DAYB 3CCVA 2UXDL 2CQOA 2Y0SG 2BH2A 2R7ZH 3U58A 3HOYH 1NMFA 1YEZA 1Y14B 1CKOA 3AYHB 3HKZG 4LFCL 4HIDA 1XMOL 3ICEA 3S1MH 5C3EG 5HGQA 1OTCA 1M1KC 4DV4L 3J7ZC 1XTDA 3GDEA 4EX5A 4ALPA 3PUZA 4YCVA 2N8NA 2UXCL 4AYBG 2LXKA 5BR8L 1NTGA 1Q8KA 5GROA 3GTOH 4DV2L 5IYBH 4DV1Q 4JI4L 5IYDH 1Q1EA 4K0KL 1VQOA 5GAHC 4A3GG 2Q2HA 2RHQB 3PIOA 5GAGC 1GM5A 3STBC 4AQYQ 1CUKA 4WJ3M 4B3SQ 3KJOA 4KI0A 1V9PA 1PH9A 1AH9A 1MKHA 1OXXK 4TVAB 3TS0A 2R6GA 4Y7NH 3PO2H 1X56A 2AHOB 3M85A 3G48A 3CMAA 2ALYB 2CCZA 1I6HH 1VQEA 3TREA 4A3DH 4IPDA 4A3IG 4LF9Q 3S2HH 5C3EH 3K0XA 3STBD 2L15A 3HOZG 2KBNA 4JYAQ 1S40A 1ASZA 1OXVA 4GLVB 5IT9c 4DV0L 2NVXH 1W3SA 2FXQA 3S1RH 4JI7L 1T9HA 3GTMH 5LMUL 2UUAQ 2UU9L 1VQBA 1SR3A 4P73A 4YWMA 3LGJA 3U4ZA 5IWAL 3D31A 4A3GH 1JJGA 4X65L 1X3EA 2N49A 3T1YQ 5C0XI 2HIXA 5C44G 2ZM6Q 1PH5A 4JV5L 4JI6Q 4DR4L 1I3QH 2HIVA 3BZKA 4C3IH 5M5YH 1VQNA 3UDFA 2Q2TA 1HNZQ 3RN2A 5JEAG 1V43A 3ULPA 4O0AA 4IPCA 4R1JA 4B3MQ 3GTJH 3L0OA 4LF4L 4LNQA 3HOUG 3OYYA 2BA1A 2JA8G 4GKJL 3CMEA 1EIFA 2WAQE 3KJPA 2B63H 1B70B 3L7ZC 4GNXB 1RIPA 1YI2A 2K4KA 4IOAA 1UE5A 2GVAA 4DNIA 1JE5A 1I50H 4JI2L 3K80C 5C44H 3T1HL 2EIFA 3NENA 1LTLA 4JCVE 1VQ9A 3HKSA 4BBRG 2JA7H 4DR2Q 2PQAA 4GOPA 4A3JH 4MZ9A 4LF6Q 4LF8L 3JC66 2RCNA 2QEXA 3UE1A 3F2BA 4LF7Q 5JJLA 1BVSA 1HNXQ 3FKIH 4DK3C 3OTOQ 4NPSA 1N34Q 1WCMH 1IBML 1EIYB 2JA6G 4DV7L 1JT8A 3E9HA 1WI5A 1UEBA 3CAMA 2Z6KA 1VQ4A 4NXMQ 5C4XG 1N32Q 1M90C 2GN5A 2K14A 3GTQH 2VQEQ 2WB1E 4GOPC 3AEVA 2DUDA 2K5HA
chains in the Genus database with same CATH superfamily
2AWOA 3A8KE 1TY0A 1B8AA 4QIWE 3TZDA 1YNJD 1LTBD 4O1NA 3X3MA 1VS0A 1VQDA 4RH6A 4DV3Q 1ESRA 5E4XA 4DA2A 1TS5A 2JA6H 2NN6H 1Q82C 5CV6A 2EPBA 4K6DA 1IBKQ 4X62Q 1TS3A 2A6ED 1B53A 4YCUA 4BBSH 2NVTB 2B2TC 1KAAA 3FP9A 4CHTB 2MHVA 3HOXH 1SEBD 3NBHB 5CV9A 2PW5A 3JAME 2BCOA 3K57A 1RCVD 2E8GA 2EY2A 4B3TL 2R92B 1LV9A 3M3YH 1KD1C 4JBJA 1F2LA 4DV1L 2DNCA 2E75C 2Q2IA 1DOKA 2E2IH 3GTGH 1LTID 1LUZA 4YIJA 2IX0A 5ELFA 3KF6B 3J7AF 1N36Q 1EUJA 2R7FA 4KHVA 4FF2A 4UHVA 5C3WA 1SN8A 4HN7A 2HHHQ 5ELNA 2LXJA 1XNRQ 2J0TD 3F2UA 1J5EQ 4A3FG 4R4IA 2I0QA 3G71A 1QVGA 2OCEA 1JQYD 4OX9L 3AFPA 3K8AA 3MZ5A 2IY5B 2VUMH 4OGQC 4M8AA 3GTPH 2UUCL 1EQVA 4F88A 3RN5A 1SRUA 3S1MB 5CBAE 3K5NA 1Q12A 3LWEA 2JQOA 5KYIA 2QA4A 3A74A 1TR5A 2KJXA 5LMNL 5EAYA 4YCWA 4HIKA 4IUVA 4HIOA 3D0FA 4FF4A 3QOLA 1ESFA 1PYBA 2C35B 2UXDQ 1IYVA 4XIGS 2R93G 1N9WA 4RG1A 5FO7B 4Y7NB 1YHBA 3PF4A 4XT1B 1EU3A 1HZAA 2F0OA 4KHZA 4DK1A 5DLQE 4A3IH 3RZDH 4A3DB 3C2PA 5CORA 5C3EB 1G51A 4CKCA 3BDLA 3S15H 3S24A 4WFN3 3RR5A 2RDFA 4OEMB 1UE7A 2MP1A 5IY0A 2JA5H 4GKKL 1WD0A 4QF4A 1MJCA 4QQBX 1IXRA 1RTNA 1E3PA 3BYTB 1CA5A 3DXJC 1EY8A 2XRQD 4DV3L 2G9HD 4C3IB 1YJWA 5FLMG 3IL8A 1WD1A 1PH4A 2PNRC 3HOUH 2F1MA 3HGBA 4LMQD 2D0OA 5LMUQ 1PVOA 3MEHA 3J80i 2AKWB 1X3PA 1U4MA 2B2YC 4C2MH 1NJIC 1Y1VG 3B6YA 1HFGA 5I9OA 2HUGA 3J81c 1VCIA 4IPHA 4B9WA 1BCPD 4BY7G 3HG9A 4GN4B 4K8JA 5IP9G 1TWAH 5C3XA 3KDFA 2LS01 2O4XA 3BVGA 2NVQH 1CTMA 1I4RA 4XYQA 1RHPA 1Z7TA 3VYRA 1K8GA 3W5OA 1FYCA 3GTQB 1N36L 4R4CA 4O42A 1K0RA 2FMMA 3HRZC 2PQAB 3T1HQ 1KDBA 2IX3A 1ASYA 2EY5A 1IBMQ 1P8LA 1J5EL 4DV7Q 3MXUA 1HZBA 4B3SL 4MN3A 1X32A 2RHSB 1F77A 3RLNA 1JOOA 2CWPA 1CKNB 4RGOS 2BH8A 4FF1A 1YZ6A 4KLKA 2JE6I 4YHHQ 3AFQA 5IYDG 3KDFB 2VB2X 4KY7A 2GVBA 2EYJA 3OMGA 4JI6L 4IALA 3FMCA 2NUCA 4DGZA 3F2CA 5CV8A 2PYKA 3G6JB 4ZKBB 1GUWA 4DUZQ 1BCPF 2B2VC 2FMCA 4GLAC 3NHHA 4BA1I 4P72A 2D5DA 3OWFA 1YVCA 1LM0A 3KYHC 4UY8C 1YITA 3NTKA 2QGQA 4QIWB 1LT6D 2LKVA 3QB3A 1E2ZA 4YWKA 5ELOA 3P75A 3E5SA 2HQLA 2A68D 1AE3A 2NWGA 2EOTA 4BA2I 4JI1Q 1U5KA 2X6GA 3CCLA 2YTXA 3TEHB 3KBGA 2M9VA 2VS1A 2KHIA 3DWQA 4FDBA 4IJHA 1JR0D 1OXSC 1RTOA 1YNNC 2K5QA 2KEEA 3MXPA 1PH2A 4NP5A 3H0GG 2JA9A 3P20A 2PCFB 4XDXA 5DAUA 4P2CB 3P7JA 1K3RA 4K14A 1F9RA 4RKLA 1UEAB 4HMIA 5J3BA 4LFAQ 2BA0A 3A5ZB 3SXHA 2R7DA 1SNPA 2PW7A 5IE8A 1K83H 3ER0A 2E2HB 1V8QA 2VQFQ 1NMGA 1U4RA 3A56A 1FNWA 1TWCB 4IPGA 5C44B 5K36G 4L63B 3PUVA 2NN6G 4DXFA 3H15A 3JAMi 4XQQA 4POFA 1Q86C 3PIPA 3PSIA 1NBWA 1LT3D 3CKIB 4BBSG 5E4WC 2FHTA 1LLRD 1DJRD 2P5ZX 2Q8RE 1QZGA 3S1QB 2JA8B 3HZXA 3HOWH 5IT9L 5TSSA 1SE2A 2ENBA 3DM3A 1BCPB 4YHHL 5JAVA 3K7AB 2WAQG 2OQKA 5KIXA 1SNOA 4N9PA 5A2QE 1PFNA 3S9WA 4K2KA 4A3BH 4LF8Q 1CQVA 4BBRB 3HKZE 3KBXA 3NSWA 1S5FD 3GTKB 4A3CH 3R8BA 1X3GA 3BDOA 2KENA 2NN6I 3VYUA 1SBBB 1Z6HA 5LHY1 3F8TA 2F0KA 3M4OB 4DUZL 1PTOD 1F9SA 1FL0A 2OXPA 1KNAA 3SDZA 2F0LA 3ND8A 4F7XA 3H3VH 2XWBB 5ISRA 5M3FB 3NQIA 2IT1A 1TY2A 4R8NA 3V96A 3MVVA 4BY7B 1SNQA 5KNBA 5E3FA 2VUMG 1EZ8A 5CC4A 2BH2A 1YEZA 3HKZG 3J81E 4HIDA 5HURA 1WTHA 5C4ZA 1NR2A 2WINB 3BG3A 1NTGA 1Q8KA 5GROA 1ILQA 3GTOH 4J8QA 5IYBH 2L5TA 1ET9A 1H9MA 1Q1EA 5NUCA 1VQOA 4FXDA 3SR1A 2E76C 2QEJC 4AQYQ 2IWHA 3I73A 2B2UC 4KN4C 3M85A 3CMAA 1VQEA 4A3IG 3S2HH 4OHJA 4JYAQ 4IZ8A 4GLVB 5D3IB 1SYBA 3TN2A 2NVXH 1Y69U 1T9HA 2L0CA 3I4MB 3CHBD 3RMHA 1HHVA 4P73A 4YWMA 1TWHB 2KVMA 2TMPA 2NVYB 2A6HC 2KHSA 4S3SA 3O13A 5C0XI 2XNAC 1MI2A 5FLXL 2F0QA 1PTOF 3BZKA 4C1NK 1F2ZA 1DCZA 3ULPA 4B3MQ 3GTJH 3HOUG 2DJGC 2BA1A 4PQXA 3MFYA 5FO9B 4GNXB 1YI2A 2L12A 1DZ1A 4IOAA 3L9AX 3TP8A 3K80C 5C44H 2EIFA 5IODA 4JCVE 1VQ9A 4CDCC 4JK1C 4MZ9A 4LF6Q 3JC66 1HUMA 2RCNA 3KK7A 3UE1A 4LF7Q 4LF8L 3C46A 4DAPA 3OTOQ 1WCMH 1EIYB 1SYFA 3OOCA 5C4XG 2F0TA 2G9DA 2VQEQ 1JJGA 3AEVA 2DUDA 4DR3L 3KF8A 1RL2A 5H1SE 1IHZA 2E5LQ 1R9TB 2MO0A 4EQ5A 1EY0A 4Z9CB 4BBRH 2IX1A 2Z6KC 3IFDA 1ONLA 5IOCA 3H0GB 3RLFA 3G6EA 4X64Q 5J1ZA 2RQXA 3WOFA 4WJWA 3I2ZA 4BWGB 1HQRD 1AE2A 1NCVA 5CV5A 3CCJA 1PV4A 1EQRA 3CQZH 4N8X1 3D6CA 1S5ED 1NY4A 2AUJD 1EQQA 2GA4B 1XMQL 4BY1H 4NB3A 1L0XB 2Z0SA 3PV0A 2XRSD 4DV6Q 2C9OA 4JI8Q 2LSSA 3GQBA 3CPWA 2YTVA 2DY8A 2NBFA 3R93A 2ZJPA 1SE3A 3ULJA 3D4DA 4JOIC 3NELA 2A8VA 1UE6A 2J4XA 1GUNA 2RDHA 3GO5A 1HTLD 3W1BA 3MA2B 4LFBQ 4EGVA 1I94Q 3KLWA 4ZLTF 1GUOA 2F4VL 1FGBD 1BXTA 1KC8C 2DJFC 4DF7A 4A3EG 1BNZA 4UDUC 3S1NB 1VQKA 4A3LH 4IUQA 2JJQA 2HDLA 5E7NA 4QMGA 1N33Q 4DR1L 5JPMC 4AIMA 3C3LA 3J7YW 4V0BA 1WOCA 1PRTC 1DOLA 1K73C 2K5VA 2SNMA 2OTJA 2Z8LA 1HQMC 3A0JA 1UWVA 1X9NA 2YYZA 2K5DA 3I8ZA 3ZJYC 1IW7D 2ZTDA 3VDYA 2MFIA 2A68C 4DUYQ 1PH7A 3PCOB 2UUBL 1XWEA 1SYEA 4NXNL 5GAEC 4X6AH 1QUQA 4GLXA 4LFCQ 3PO2B 3HKZB 2F52A 4DV4Q 2Z6BA 1E1OA 3I3CA 4DV5L 1Y1WB 1D1KA 2UXCQ 2SOBA 1D6EC 3K0YA 3TRZA 4H02A 4XT3B 3PIP3 4JI4Q 4KHPQ 4K0KQ 1IL8A 1VQ5A 4Q0FA 3PO3G 2VY3A 1FJGL 3R3OA 4ODGA 3V2TA 4A3MH 1L1OC 2CHBD 2WACA 5IYCH 5ELCA 2B2YA 5D14A 1OXUA 1KLUD 4RAUC 3T13A 4R4OA 3LWUA 1XNQL 1B44D 1EWIA 2K50A 1NAPA 4POGA 4KD3A 2YTYA 1KQSA 3HOWG 1QCBD 4HEDA 5IWAQ 4WJ4A 1BKBA 2B63B 2V4DA 1A62A 4EQNA 2AWNA 1TWFH 3K5MA 1EY6A 2L9HA 4CKEA 1LACA 4KY6A 2XVSA 3EQLC 1EIGA 4GN3B 2JA7B 5CMDA 1K0SA 3F1ZA 3N52A 1TVXA 4DK0A 4A3JB 1BBWA 4O2DA 3FKIB 4A3CG 3S14H 5KRUA 3GV3A 1Z9FA 5LMNW 2ZJRA 4WORA 4GKJQ 1FNVA 1LT4D 2Z4HA 4C3HG 1O7YA 2NYZD 1TKWB 4FXGC 4GOPB 3CCSA 2Z9HA 4C3JB 3J81i 2L1BA 1RKNA 1QG7A 3T53B 1YNXA 1K8AC 1N33L 1B3AA 2CH4A 2ASBA 2J7ZA 2PZTA 1PTOC 1XTCD 1O80A 1GKHA 1D7QA 1PTOH 5LL6S 1VQFA 3IKJA 5FJ8H 2F0EA 1CHQD 4JC0A 5C4XB 5EJWA 3PF5A 3EA6A 3SK5A 1EWHA 3X3NA 1PH8A 5HY6A 5DM63 1WJJA 3KLSX 3BJUA 1T5EA 5IYBG 1K3BC 3DWAA 1BF4A 1SFOB 2ZT9C 3H3VI 1KRSA 4UAIA 2B2VA 4LK1C 3NK9A 1Z47A 2EY6A 5M3MG 1WTXA 1HRJA 1HNZL 4RFBA 4HJ5A 2V1CC 2O5JC 1VQJA 3LNNA 3E6ZX 2IJ0A 2NZ1D 2SDFA 1WVLA 5C0XH 4KHPL 3RZOB 2FINB 1EWCA 3TP6A 1S72A 1VQCA 5I9PA 4Y52H 1MIUA 2XSCA 5M5WH 4DK6C 1YJ9A 1S3OA 1ML0D 4DR2L 1EY7A 1C9OA 1DOMA 1HNXL 4B08A 1TS4A 1DXMA 4IUPA 1Y1WH 4HSVA 1I6HB 3BZDB 2NZOA 3GTLB 4QL5A 3HOVH 4A3KH 4X66Q 4GS3A 5EKIA 4A3EB 3GTMB 1VQMA 1GOZA 4K5WA 4DFAA 1H95A 4PNYA 1NNXA 5T1IA 2EJMA 3BDCA 4HJ9A 4PZ8A 3FPPA 1MJEA 3SHLA 4I7ZC 3EVQA 4P71A 3S2DB 1X6OA 1JWUD 1TIID 4A93G 2F3VA 4L5RC 1WCMG 5AJ3Q 3ONAB 5EPKA 4UP9A 2A19A 1IBKL 1XYIA 2IL8A 3BU2A 4X62L 3SGIA 3DHQA 1YHQA 3HOZB 5C5MA 2D62A 4HAEA 5JEAJ 4MTKA 3M4OH 1K28A 1O7IA 1N8RC 3DUZA 2NTSA 3S16B 5BN3A 4ILWA 4LF5Q 2WKDA 2PO4A 2E2JB 3M4PA 4G7HC 3TMEA 4XTCS 1IZ6A 4JBWA 3VR4A 4U673 2JP1A 1HXYD 1E2WA 4ABNA 1ICWA 2BE5D 3I91A 4YWLA 1XPUA 1HFNA 2N3SA 2NVTH 5EGTA 2F0UA 3I4NG 3A54A 3ZYYX 1SE4A 4APVA 1GD7A 1C7YA 5C4JB 4JG2A 3S17B 1E1TA 1VMPA 2FJ2A 4ZK9B 3I56A 3PO3B 2F3IA 1TT2A 2R92H 3F2DA 1J6QA 2VXWA 2HHHL 1S5CD 5LL6X 1QZHA 3CW2C 1XNRL 3U9SA 1PZJD 1G8ZD 1YJNA 4V190 2F4IA 4YY3Q 1YHAA 2RSNA 4DR5Q 1EFWA 1JB7A 2R7ZG 1E0BA 3HOYG 2B3GA 2K7VA 1GHJA 2DGYA 4FF3A 5CBEE 1EYCA 2IPKD 1B50A 4P75A 4K8IA 1K9MC 4L5SA 2QILA 1JOKA 2WB1G 2K1BA 1TWGB 3KUPA 1KL9A 5ELBA 4IFDI 3Q8DA 3DMUA 3U50C 2UXBQ 4JI5Q 3CPFA 5FOBB 2UXDL 3TDQA 1Y8PB 1OO9B 2EJFC 3ICEA 3S1MH 1WTRA 2FFKB 2B2UA 2K28A 3GDEA 4C3HB 3NUCA 4J6HA 2HQEA 2CH4W 1AFPA 1HA6A 3SK8A 4ZKCB 5IGCA 4A3GG 1ICFB 2Q2HA 4EQOA 4TRDA 3STBC 1CUKA 5KGUA 1X3QA 1SYDA 1V9PA 1PH9A 1OXXK 2KEDA 4HTHA 2R6GA 4Y7NH 2K33A 1IW7C 4RHRA 1I6HH 4A3DH 4LF9Q 2ZXOA 5C3EH 3T56B 2RBMA 3TSSA 5IT9c 5T1GA 3GTMH 5LMUL 3NP8A 2UUAQ 1UUPA 1H9SA 5CV7A 2N49A 5M5XB 5D3DA 3T1YQ 2ZM6Q 1PH5A 4A3FB 1B2TA 1VQNA 4C3IH 3UDFA 2Q2TA 1SDFA 3SE0A 5JEAG 4QUFA 5M3MB 1V43A 4IPCA 4R1JA 2YU9B 1ENFA 1O7ZA 3OYYA 2QKIC 3Q23A 4IUNA 3CMEA 1EIFA 1KLGD 2WAQE 5IGDA 3KJPA 4HCSA 3L7ZC 1RIPA 2K4KA 1UE5A 1JE5A 4RHSA 1H9KA 3T1HL 1F2YA 3NENA 4M1UB 3HKSA 1F9QA 3K58A 2OEOA 1DYQA 3T16A 3F2BA 4G57A 1JCKB 1BVSA 2ZXRA 3HP3A 1N34Q 3KLSA 1IBML 2JA6G 2R93B 4DV7L 5EQ0A 1STHA 1UEBA 3BVMA 1YNJC 2Z6KA 1VQ4A 4RGMA 1N32Q 1M90C 2K14A 2EVBA 3OPOA 3GTQH 5L37A 3ITPA 1AEXA 1KDCA 4R9WA 4RA8A 4DAMA 3PUWA 3HOXG 3IFTA 4DR6Q 2A6EC 1U0LA 2E2DC 1B4OA 2PZUA 2EQSA 4XYOA 1QVFA 4A93B 3SVMA 1O7LA 1QNUA 3MXNA 4TSSA 4KD4A 2HD3A 3NTHA 4JOIA 1HNWQ 3BS1A 2LFNA 4OO1I 3H91A 3H3VC 1PMRA 1R4QB 4DR7Q 3J80L 1EOVA 3RNUA 1Q46A 4CBVA 1PFMA 2O2LD 1Y1VB 3AMUA 4B3RQ 5ELEA 5IGFA 5FLXc 1PXUA 3HFZB 3D4WA 2EYLA 1PZKD 5EPJA 5GADC 3NE5B 4LF9L 3I4NB 3DLLA 4HCEA 5JPNC 1R4PB 3OW2A 4JI1L 2EDGA 1TU2B 5M9OA 5C0XG 4ULLA 1VQAA 3QJYA 3SK4A 3EROA 1E22A 2K04A 1I4GA 4HJAA 1QWYA 2JN4A 3CRKC 4NW2A 4JI3Q 2WFWA 1G2TA 4TKOB 3ND9A 1PA6A 3M4YA 4DN4M 2EJGC 4G7ZC 3HOYB 2KUMA 1I4HA 1W6KA 2K52A 3NWTA 3HOVG 5FO8B 2B2WC 3FPUB 1HR0Q 1VQ7A 4LFAL 4A3KG 3E3XA 3OWEB 3PQIA 5EKLA 2G5DA 3D3RA 2JA5G 3OSOA 2F0FA 3FDTA 2VQFL 5KEEA 4N9TA 5ELDA 3ERQA 1SYCA 3FHWA 4DNTB 4RMFA 3UDIA 1PH1A 3WOEA 1W6JA 1FNUA 1A2UA 3N6RA 1L1OA 1HR0W 3D8GA 3EN2A 5JJIA 5BR8Q 5IIFA 1N32L 3A5UA 4DV2Q 2E2HH 4RKBA 2XGTA 1X65A 3S1RB 2ZTCA 2SNSA 2X69A 2CWAA 4A4IA 4R8IA 4JBMA 2K5WA 4KK7A 1SMYD 4A3GB 1SNMA 4OONA 5A35A 3NBIA 1TWCH 1IL2A 1EYGA 4LUVA 4CDFC 1G6PA 3K5OA 1I3QB 5M5YB 4LAAA 1L0WA 3TQYA 5G3LD 1EIHA 4XXEA 4DKAC 1AZQA 3S1QH 3A7LA 2JA8H 1OXTA 2UU9Q 1C4QA 3CC7A 2EY1A 2K05A 2F0HA 1BCPC 3QOJA 4X65Q 1YIJA 2D9UA 1DM0B 3WDNA 3K7AH 2R92G 4CDDC 2OT2A 2B2TA 1I50B 2PMZE 1E2VA 2BDNA 2IHEA 5IT9E 4NMZA 4ZUJA 3WWVA 2IW3A 5DEHA 3GTKH 1I6VC 3L3OC 3VYSA 1V1OA 5HGTA 3KLRA 1NE3A 1JJ2A 1BUVT 2AUKA 5GQOA 1EU4A 4KJOA 3H94A 4RCOA 2I5HA 3PGZA 3TS2A 1SJED 2OTLA 1II3A 1IKMA 4JI2Q 1IBLQ 5M3FH 4IFDH 5C5LA 4LUOA 1IYJB 1JC7A 1RD9D 4K5VA 1XJVA 1WYDA 4BY7H 2PZWA 5D65A 1V1PA 1EQTA 4AQYL 1SROA 4KN7C 2JA6B 4IUUA 2XIWA 3JAML 1X3FA 1JE4A 3KF8B 4BBSB 1SAPA 3H09A 1PFSA 4HMJA 3TBIB 1G91A 3Q0AA 1VQ8A 4JYAL 3PUYA 1PH6A 4UPAA 5G3LF 3HOXB 4CGYB 5KYLA 3BVZA 1CSQA 2WAQB 1JWSD 3M3YB 2XWJB 1XPRA 2PNHA 2E2IB 2L55A 3GTGB 3GD7A 3DEPA 2ICIA 2CFMA 1Y8NB 3UE0A 3QO2A 4A3DG 2Q8IB 2F3WA 2VZAA 2JEBI 4K6LA 2TSSA 1QE6A 2EXDA 5I2XA 4B3ML 2H4OA 3MXGA 3I4MH 3NWSA 1WTQA 4B3TQ 1W2BA 1HTPA 1JORA 1TWHH 1V1PB 2NVYH 4JBKA 1KHIA 4QY7A 1FR3A 5FK9C 2XTIA 1KRTA 1UE1A 1I4XA 2A69D 4DNRB 1EY9A 2N88A 3W1GA 3KOJA 4CJ1B 4C3IG 4ID6A 4QCLA 4LF6L 2F03A 3I55A 2VUMB 1XMOQ 1STEA 4LF7L 2RA4A 3E0JA 3OTOL 1STYA 1SJHD 3GTPB 2A74C 2AQ2B 3VR2A 5FLXE 1D5MC 1UAPA 4H13C 5I6YA 4PMBA 4GNXC 3L2PA 1B7YB 1TXYA 4OWWB 1STAA 2F0MA 2VQEL 4BXXH 1X55A 2KCNA 2JXMB 3Q22A 3J81j 4KTAA 3BZCA 1LYLA 2VB3X 4OX9Q 1CZWA 2R3ZA 2E5LL 1A8VA 3TZUA 1M8AA 3ERSX 3SK6A 2B29A 2UUCQ 1TQOA 4R4TA 2F0WA 3I7FA 1CHPD 2EE1A 2JSOA 1ZXTA 5J22A 3PMFA 2LY7A 4X64L 4A3IB 1WTOA 3RZDB 1IKLA 1QB5D 3VA5A 2C5CA 2MNAA 3G4SA 5I4DA 1A0IA 4JI7Q 5LMNQ 2ID0A 2ZTEA 3S15B 3A8IE 2Z4IA 4L8JA 1R9TH 3IAYA 2JA5B 4L6TB 1IBLL 1FGUA 1QUQB 1FD7D 3K6OA 3H0GH 4X3SA 1CKMA 4A3BG 4DV6L 4JI8L 4LWCA 2A73B 3D4RA 5F2DA 1D1IA 2E74C 4LF4Q 2AQ3B 4OO1H 2CKZB 3HOUB 2KECA 4LFBL 1I94L 3CP0A 5KNDA 2HT1A 3PUXA 1AW7A 3EFXD 3KF6A 4GKKQ 2IHFA 2PI2E 3K59A 2VL6A 1D2BA 5E1FA 3A8JE 4C2MB 3UDGA 5CGKA 5IP7H 5EKKA 2D0PA 3QG1A 2Y0SE 5K36H 1Q90A 3Q24A 4LJZC 2I07B 4IFDJ 4BS9A 1WTPA 4CDEC 1TWAB 3CXCA 2CW0D 3NXWA 4PMCA 4PZ7A 1ENAA 3ULLA 3AQQA 2NVQB 4AYBE 2EYHA 1CI3M 2EYPA 2YV5A 2VW9A 1NUCA 3S1NH 1JOQA 1K8OA 1K8MA 4KV6A 4X3UA 3GV6A 1HUNA 4OXPA 4L5QA 3URYA 4A76A 4DUYL 2MO1A 1EYDA 3CCVA 5CR3A 2Y0SG 1G6ZA 3U58A 1NMFA 3AYHB 1Y14B 1CKOA 4FNFA 1BDOA 4LFCL 4CJ0B 1XMOL 1M4VA 1OTCA 1M1KC 4DV4L 3J7ZC 1XTDA 1KDAA 2L4NA 4ALPA 1ZKOA 3PUZA 4YCVA 2N8NA 2UXCL 4N8FA 4AYBG 1VF5C 3A7AB 4JI4L 4K0KL 3PIOA 1EZ6A 1GM5A 4KMUC 4B3SQ 4RCNA 3KJOA 4KI0A 2XN9C 4NDXA 1MKHA 3TS0A 3PO2H 2EYOA 2PMZB 3TREA 4B9XA 1CQFA 3K0XA 3M7GA 4U68A 3CU7A 2DNEA 2KBNA 1EEFD 2FXQA 4JI7L 1EL0A 1XX8A 1STGA 1VQBA 2WIIB 2RVLA 5IWAL 1NSNS 1CT1D 3TP5A 1S4ZA 5C44G 4DAVA 1BOSA 3HS0C 3TP7A 4ZUIA 4JI6Q 2HIVA 2QDLA 1F9PA 3DM1A 2MPMA 4KKSA 1SNDA 1MGSA 2A6HD 4LNQA 4LF4L 1SMYC 4X3TA 2F0SA 3DWPA 4GKJL 2JA8G 3MTSA 2B63H 1B70B 2BOSA 4DNIA 4RGNA 2O5IC 5EPLA 2X6LA 1BR9A 1LTLA 4ZQ3A 4BBRG 2JA7H 2PQAA 4A3JH 3LX0A 2QEXA 2EZVA 5JJLA 3D6WA 1ZYRD 3FKIH 4NPSA 4G7OC 3E9HA 1WI5A 1I4PA 2CQAA 3CAMA 4FO2A 4NXMQ 2GN5A 1T5XD 2WB1E 4QUCA 4GOPC 2JYOA 1K83B 4OWXB 3P1HA 1QNKA 4KKUA 4C3JH 5M3FG 1HJPA 1CKNA 2WP8J 3E9IA 4BY1G 1I4QA 4IFDG 5EBCA 5IGEA 5C6AA 4QJFA 3OHXC 1A3UA 4CJ2C 4OELB 4JW0A 4ZRZA 1A63A 5FKAC 1IYUA 4C56C 1B9NA 3OIPA 1KTKA 5C4XH 4I65A 1U4LA 5A2QL 1KAWA 3C1EA 1KABA 3NPPA 1PHJA 1VQLA 4DU9A 3HOWB 2MUYA 3I90A 2F0NA 3K7UC 1XPOA 3EBEA 1PH3A 2VNUD 1SFOH 4A3LG 4GN5A 4PV1C 1VQGA 1C48A 4A3BB 3BYYB 2A1AA 2Z1CA 1Q81C 4HR7B 5JJKA 1E24A 1SMXA 3R2IA 1LTGD 4Q5VA 3OIQA 1E7ZA 1PYSB 4HSPA 2PI2A 2EYFA 1I5FA 5JVH3 3W3AA 2DN8A 5IGGA 3I4MG 1LTAD 1PZID 3RZOH 4X66L 4AH6A 3CC4A 4PMWA 4P74A 3J81L 3UDXA 2B2WA 2M2LA 1JJCB 5C0XJ 1D5ZC 4FYDA 5AFWA 2Q2UA 3KFUA 1GUGA 4OWTB 2ZXPA 2I5MX 3GTLH 5AJ3L 1J8IA 3FRPB 3T4AC 1STBA 3M9BA 2A69C 1VQHA 3MFGA 3RLOA 3UI2A 1BO0A 1PRTD 1HCZA 4A3EH 2MQHA 2QDBA 1QVCA 4BXXG 3CCRA 2AMCB 2EYMA 2ICEC 5BN5A 3A55A 3GTOB 2NZHA 2ATWA 4R4QA 1TS2A 1C8CA 1CSPA 3S2DH 4IOCA 4A3MG 2OWOA 4J1MA 4LF5L 5JJZA 1EY4A 4XQJA 5IYCG 4K5XA 1DGSA 2KOLA 2Y0SB 3VYTA 3S2HB 2K5NA 2B39A 2QCPX 5BN4A 3MAQA 4HJ7A 4OIJA 3HOZH 4NXML 3G7LA 3MC0B 3J80c 2NVXB 3V05A 4AYBB 1UNSA 2K75A 2L11A 3CD6A 3S16H 2E2JH 1JMCA 1U9RA 1S5DD 2HDMA 1VQIA 2KCTA 4MIUA 1ZEQX 1MHWC 1BQQT 3VR5A 5DM73 1LABA 1WFQA 1VQ6A 1LT5D 1JB3A 2OQ0A 1MSHA 4UP7A 4YY3L 4IN3A 4OO1G 4LUZA 3GTJB 2M00A 4DR5L 2RDGA 5C4JH 1H9SB 3S17H 3OW7A 5COYA 1VDZA 2JK8A 3PO3H 1D8LA 2ZJQA 1GHKA 4KY5A 3VR3A 3MEFA 5I2YA 3M4QA 5IP7G 1YBYA 1PRTF 4JPBW 1A3TA 1WCMB 2N55A 2SEBD 4OIKA 2H5XA 2UXBL 4JI5L 1H9RA 5FJ8G 4G4KA 1RJTA 4ME3A 2WKCA 1KNEA 4LW1A 1J9OA 3EIVA 3K81C 4RGTA 2JEAI 2CW0C 1LO5D 1TWGH 2QF7A 1Y8OB 1CM9A 4PG3A 1EEID 2K6AA 3NQTA 3J7A5 2ES2A 4QGUA 2F0PA 2K32A 2RKSA 3PIO3 1DONA 2NB0A 2KHJA 3CCEA 3NEMA 4C3HH 4DR3Q 3CQZB 5JOBA 1P16A 3U9OA 2PQEA 4PZ6A 3SEBA 5C4HA 1C0AA 1KIXA 3I4LA 4BY1B 2UUAL 4IUTA 4JI0Q 3MXNB 2MGSA 1V1QA 5I6WA 3T1YL 2ZM6L 1HZ9A 4ZYSA 3PO2G 1Q8IA 4HIMA 3DEOA 4ME5A 1Q1BA 2R7ZB 1G2SA 1Y1WG 1SLJA 4HJ8A 2F0DA 1AN8A 1XMQQ 1Q3LA 2B8FA 4TQUS 4DPGA 4C1NI 4ZCKA 3EJIA 5M5XH 2WB1B 4JVZA 1FVIA 4GNXA 2KCMA 4A3FH 1L2FA 1SE8A 2EXZA 3CCQA 4XQNA 1QILA 5M3MH 4K2LA 1VMCA 1PRTB 1N34L 2YU9H 2WV6D 2F4VQ 1EY5A 2OF1A 1EFID 2HCIA 3FVQA 1QJOA 3W2DA 2Q8TA 1B9MA 1ILPA 2B63G 1GUTA 2K03A 4H0LC 4MNOA 4DR1Q 1GJXA 3E0EA 3IRBA 1RDPD 4IO9A 3R2TA 2JA7G 1WTWA 4FVMA 4A75A 4DR6L 4A3JG 2R93H 3FKIG 3MHBA 3JAMc 4MTNA 1A15A 5CYUA 2I5LX 4DV0Q 4GZYC 1HNWL 1ZYRC 2PPBC 4C3JG 2BE5C 1HH2P 4DR7L 2A5HA 3AU7A 2UUBQ 1G291 4NXNQ 4JV5Q 1HZCA 1STNA 3CC2A 1Q7YC 4DR4Q 4A3MB 3M7NA 4IURA 4A93H 1VF7A 2K01A 1L1OB 1PDQA 4B3RL 1U4PA 5J39A 5FLMH 4QB4A 3U4VA 3QR8A 4J15A 4F8MA 2H1EA 3I72A 4DV5Q 1GVPA 1BBXC 2QW7A 1S5BD 4IQZA 3Q6SA 1CZGA 1EOTA 1BBUA 2HCCA 4DAYA 1HPCA 1B1ZA 2KCCA 5EBDA 1FJGQ 3CCMA 1SXTA 1TWFB 1Y1VH 1EYAA 3VR6A 1X54A 1CFMA 3AB9A 4UP8A 1JICA 4EVOA 1KXLA 4JI0L 1D5XC 1ENCA 1LTRD 3NTIA 5IP9H 3J80E 1QOHA 2B8GA 4OL7A 1XNQQ 4L5TA 4JI3L 2N78A 1A3VA 3S14B 3I4NH 1L0YB 3T51B 3CCUA 1XXGA 3QIAA 1HA5A 5JVG3 2KA7A 1HR0L 1DD2A 2RCFA 1GO3E 1A6XA 1LTSD 1AZPA 2RF4A 4IJLA 3CF5A 3I4OA 1RF2D 1VQPA 4DAYB 5KNCA 2CQOA 4KJNA 2KQ3A 2R7ZH 1PTOB 3HOYH 5DNFA 4F87A 5C3EG 5HGQA 1JWMD 1PLFA 1SYGA 4X3KA 4EX5A 4DXGA 5BR8L 2LXKA 4NKLA 4DV2L 4DV1Q 5IYDH 2BDOA 5GAHC 2RHQB 5GAGC 4WJ3M 1F2MA 2NTTA 3GP7A 1SSOA 1AH9A 4TVAB 1PYWD 4EQPA 1X56A 2AHOB 3FEWX 3G48A 5CV4A 2ALYB 2D2CC 2CCZA 5K5PA 4IPDA 2F0GA 5IGBA 3H6MA 3HEJA 3CRLC 2F0VA 3STBD 2L15A 3HOZG 2AQ1B 1S40A 3RUZA 1ASZA 1OXVA 4DV0L 4WRDA 1W3SA 3RD4A 1ET6A 3S1RH 1MBYA 2UU9L 1PFBA 4MHEA 1SR3A 4KKTA 3LGJA 3U4ZA 2F0IA 3D31A 4A3GH 4X65L 1X3EA 4FP5D 1GUSA 1GXDC 2HIXA 4ZAIA 3VA7A 4JV5L 1MD2D 4DR4L 5M5WB 1I3QH 5M5YH 3J7AV 1MSGA 1HNZQ 3RN2A 4RWSC 1AP0A 4CKBA 1LTTD 4O0AA 3L0OA 4H7BA 1YNND 3MWYW 3HOVB 1SNCA 1B3QA 3OMCA 4H44C 3C1FA 1CK1A 1WTVA 2CVRA 4A3KB 2R61A 2F0JA 1O78A 2GVAA 2DY7A 1I50H 4JI2L 2LMCB 3K5LA 1CA6A 1H9JA 3NBHA 4DR2Q 4E6IA 4GOPA 3I70A 1HNXQ 4DK3C 5JEAH 1JT8A 3QWNA 2I46A 1A2TA 4I7AA 2MJ8A 1RODA 2RSOA 1NR4A 4FXKC 2K5HA
chains in the Genus database with same CATH topology
2AWOA 4DR3L 4OWXB 1B8AA 3PUWA 4QIWE 4DAMA 4C3JH 1RL2A 3HOXG 5H1SE 5M3FG 2E5LQ 1HJPA 1CKNA 2WP8J 3E9IA 4BY1G 4IFDG 2MO0A 4EQ5A 4DR6Q 4QJFA 1VS0A 4BBRH 2IX1A 2Z6KC 1VQDA 4DV3Q 1U0LA 2EQSA 3RLFA 3G6EA 1QVFA 1A63A 2JA6H 1Q82C 4X64Q 1IBKQ 4X62Q 3I2ZA 4YCUA 1AE2A 5C4XH 3CCJA 4BBSH 4JOIA 1PV4A 1EQRA 1HNWQ 1KAWA 3CQZH 1PHJA 1VQLA 3FP9A 4OO1I 1NY4A 3HOXH 3NBHB 3K7UC 1EQQA 1XPOA 1EOVA 4DR7Q 3RNUA 1Q46A 2E8GA 3EBEA 1XMQL 1PH3A 4BY1H 2VNUD 4NB3A 3PV0A 2Z0SA 1SFOH 4B3TL 3M3YH 1KD1C 4DV6Q 4JBJA 4JI8Q 2LSSA 3CPWA 4GN5A 2YTVA 4DV1L 4A3LG 2ZJPA 4B3RQ 2Q2IA 1VQGA 3ULJA 5FLXc 4JOIC 2E2IH 3HFZB 3GTGH 1LUZA 2A1AA 1Q81C 3NELA 5JJKA 1E24A 1SMXA 2A8VA 2IX0A 1UE6A 3GO5A 1E7ZA 1PYSB 3W1BA 2PI2A 5GADC 3KF6B 1I5FA 4LFBQ 1I94Q 4LF9L 3DLLA 3KLWA 1N36Q 1EUJA 2R7FA 3OW2A 4JI1L 2F4VL 1KC8C 3I4MG 1SN8A 4A3EG 5C0XG 2HHHQ 1VQAA 3RZOH 5ELNA 4X66L 4AH6A 1VQKA 2LXJA 1E22A 4A3LH 2JJQA 5E7NA 3CC4A 4PMWA 1XNRQ 4P74A 4HJAA 3UDXA 1J5EQ 4A3FG 4R4IA 2I0QA 3G71A 1N33Q 4DR1L 1QVGA 2OCEA 4OX9L 4JI3Q 1JJCB 4AIMA 5C0XJ 3AFPA 1WOCA 2WFWA 3K8AA 2IY5B 2Q2UA 2VUMH 3KFUA 1K73C 2K5VA 4OWTB 1PA6A 2UUCL 3GTPH 3RN5A 2I5MX 3GTLH 1SRUA 5AJ3L 2OTJA 3A0JA 2K52A 3M9BA 1UWVA 3HOVG 1Q12A 1VQHA 2JQOA 3RLOA 1X9NA 2QA4A 1VQ7A 1HR0Q 4LFAL 4A3KG 3A74A 2YYZA 4A3EH 3ZJYC 2MQHA 5LMNL 5EAYA 1QVCA 4YCWA 3CCRA 2ZTDA 3VDYA 2AMCB 4HIKA 4BXXG 2MFIA 2JA5G 4HIOA 2NZHA 3D0FA 2ATWA 4R4QA 4DUYQ 1PH7A 1CSPA 2VQFL 3S2DH 3PCOB 1PYBA 4IOCA 4A3MG 2C35B 2UUBL 4NXNL 2OWOA 4LF5L 3FHWA 2UXDQ 4XIGS 5IYCG 2R93G 5GAEC 4X6AH 1N9WA 4RG1A 1DGSA 1QUQA 4RMFA 3UDIA 4GLXA 1PH1A 4LFCQ 1YHBA 3PF4A 1HZAA 4KHZA 4A3IH 5DLQE 3RZDH 1L1OA 2F52A 4DV4Q 2K5NA 4HJ7A 1HR0W 1E1OA 3HOZH 4DV5L 1G51A 2UXCQ 3EN2A 4NXML 5BR8Q 5JJIA 1N32L 3S15H 3A5UA 3S24A 3TRZA 4DV2Q 3J80c 4H02A 3RR5A 2E2HH 4JI4Q 4KHPQ 2XGTA 1X65A 4K0KQ 2ZTCA 1UE7A 2K75A 1VQ5A 5IY0A 2CWAA 4A4IA 2JA5H 3CD6A 3PO3G 3S16H 4GKKL 2VY3A 2E2JH 1FJGL 1MJCA 1JMCA 4JBMA 4QQBX 1IXRA 5K36G 4OONA 4A3MH 1L1OC 1TWCH 1IL2A 1E3PA 1VQIA 2KCTA 5IYCH 1EYGA 4LUVA 1G6PA 4DV3L 1YJWA 5FLMG 1WFQA 1OXUA 1L0WA 3TQYA 1VQ6A 2OQ0A 4R4OA 1PH4A 4UP7A 4DKAC 1XNQL 4YY3L 3HOUH 4OO1G 1EWIA 4LUZA 2K50A 4DR5L 3S1QH 2JA8H 4POGA 1PVOA 2D0OA 2YTYA 5LMUQ 1OXTA 5C4JH 1KQSA 2UU9Q 3HOWG 3J80i 3CC7A 3S17H 5IWAQ 4WJ4A 1BKBA 2JK8A 2AKWB 4X65Q 3PO3H 1D8LA 1A62A 1YIJA 2AWNA 1TWFH 1NJIC 2ZJQA 4C2MH 1Y1VG 3K7AH 3B6YA 2R92G 3MEFA 3M4QA 5IP7G 3J81c 1VCIA 4IPHA 4GN3B 2PMZE 2IHEA 1YBYA 3F1ZA 4BY7G 4GN4B 3WWVA 5IP9G 3GTKH 1TWAH 1BBWA 3KDFA 4O2DA 4A3CG 3S14H 1Z9FA 2H5XA 2UXBL 4JI5L 5LMNW 2NVQH 2ZJRA 4GKJQ 1NE3A 1JJ2A 5FJ8G 5GQOA 4ME3A 1K8GA 3W5OA 4LW1A 2I5HA 3PGZA 1N36L 3TS2A 3EIVA 4R4CA 2OTLA 1K0RA 3K81C 4JI2Q 4GOPB 2PQAB 1IBLQ 3CCSA 5M3FH 3T1HQ 2JEAI 3J81i 1TWGH 4LUOA 1IYJB 1XJVA 4PG3A 1YNXA 1ASYA 1K8AC 1WYDA 1P8LA 1IBMQ 4BY7H 1J5EL 1N33L 4DV7Q 2ASBA 4AQYL 1SROA 1HZBA 4B3SL 3J7A5 1GKHA 1D7QA 2RHSB 2ES2A 1VQFA 4QGUA 3RLNA 5FJ8H 4JC0A 1X3FA 2CWPA 2KHJA 3KF8B 3PF5A 3CCEA 3NEMA 1PFSA 4C3HH 4DR3Q 1CKNB 2BH8A 1P16A 1PH8A 1YZ6A 4PZ6A 1VQ8A 4JYAL 4KLKA 5HY6A 1WJJA 3BJUA 3PUYA 1PH6A 4UPAA 1C0AA 2JE6I 4YHHQ 1KIXA 5IYBG 3AFQA 5IYDG 2UUAL 3KDFB 1CSQA 3H3VI 1KRSA 1XPRA 2PNHA 4JI0Q 2GVBA 3MXNB 3GD7A 1V1QA 3T1YL 2CFMA 2ZM6L 1HZ9A 3PO2G 1Z47A 4JI6L 3UE0A 5M3MG 4HIMA 4A3DG 3F2CA 2VZAA 1HNZL 1Q1BA 2JEBI 1Y1WG 4HJ5A 2V1CC 2EXDA 1VQJA 1SLJA 4DUZQ 4HJ8A 4B3ML 1XMQQ 3I4MH 4TQUS 4GLAC 4DPGA 1W2BA 4B3TQ 1TWHH 4BA1I 4KHPL 4P72A 2NVYH 4JBKA 1YVCA 1KHIA 1LM0A 3KYHC 4QY7A 5M5XH 4UY8C 1S72A 1FVIA 2XTIA 1KRTA 1VQCA 1YITA 4GNXA 2KCMA 4A3FH 2QGQA 1L2FA 1MIUA 1UE1A 5M5WH 4Y52H 3W1GA 1SE8A 3KOJA 4DK6C 4YWKA 1S3OA 5ELOA 3CCQA 1YJ9A 4DR2L 4LF6L 5M3MH 1C9OA 3I55A 1XMOQ 4LF7L 2HQLA 1HNXL 1N34L 3OTOL 1AE3A 2YU9H 1Y1WH 4BA2I 4JI1Q 2NZOA 2F4VQ 1U5KA 3CCLA 2YTXA 4QL5A 3TEHB 3HOVH 4GNXC 3L2PA 1B7YB 1TXYA 4OWWB 4A3KH 4X66Q 4GS3A 2B63G 2VS1A 2KHIA 2VQEL 4BXXH 1X55A 4FDBA 4IJHA 1VQMA 1OXSC 1H95A 4MNOA 3J81j 3BZCA 4DR1Q 1LYLA 4OX9Q 3E0EA 3IRBA 4PZ8A 4HJ9A 4IO9A 1MJEA 2E5LL 1PH2A 2JA7G 4P71A 4A75A 4DR6L 1A8VA 1X6OA 3H0GG 2JA9A 3ERSX 4A3JG 2R93H 4A93G 2B29A 2UUCQ 3FKIG 4R4TA 4L5RC 3I7FA 1WCMG 1K3RA 4MTNA 3JAMc 5AJ3Q 4X64L 4UP9A 2A19A 2I5LX 1IBKL 5J3BA 3BU2A 4X62L 4LFAQ 3SGIA 2MNAA 3G4SA 4DV0Q 2BA0A 1YHQA 3A5ZB 2D62A 1A0IA 4JI7Q 2R7DA 5LMNQ 5JEAJ 1HNWL 3M4OH 2ID0A 5IE8A 2ZTEA 1K83H 3ER0A 1O7IA 1N8RC 1R9TH 1HH2P 2VQFQ 1IBLL 1NMGA 4DR7L 1FGUA 1QUQB 2UUBQ 1G291 4LF5Q 4NXNQ 3M4PA 1HZCA 4JV5Q 3CC2A 1Q7YC 3H0GH 4DR4Q 1CKMA 1IZ6A 4IPGA 4XTCS 4JI8L 4JBWA 4DV6L 3M7NA 4A3BG 1L1OB 4LWCA 4A93H 4B3RL 3PUVA 2NN6G 5FLMH 3H15A 3JAMi 3U4VA 4J15A 4POFA 1Q86C 4YWLA 1XPUA 3PIPA 4LF4Q 4DV5Q 1GVPA 2N3SA 3PSIA 2NVTH 1NBWA 4BBSG 2CKZB 3I4NG 4APVA 1QZGA 1GD7A 1BBUA 3CP0A 1I94L 1C7YA 4LFBL 2HT1A 3HOWH 3PUXA 3KF6A 4GKKQ 2IHFA 2PI2E 4JG2A 1E1TA 2VL6A 1FJGQ 3DM3A 3I56A 3CCMA 2F3IA 1Y1VH 2R92H 4YHHL 1J6QA 3F2DA 3UDGA 1X54A 2OQKA 2WAQG 2HHHL 5IP7H 4UP8A 1QZHA 4A3BH 2D0PA 2Y0SE 4LF8Q 3CW2C 1XNRL 1KXLA 3HKZE 4JI0L 5IP9H 4IFDJ 1YJNA 4A3CH 1XNQQ 4L5TA 4JI3L 4YY3Q 2N78A 1X3GA 3CXCA 1YHAA 4PZ7A 4DR5Q 1JB7A 1EFWA 2KENA 2R7ZG 3ULLA 3AQQA 3I4NH 4AYBE 3HOYG 2NN6I 2B3GA 2DGYA 3CCUA 3F8TA 4DUZL 2YV5A 4P75A 2VW9A 1FL0A 3H3VH 1K9MC 4L5SA 1HR0L 3S1NH 2WB1G 2IT1A 4OXPA 1GO3E 4L5QA 4A76A 1KL9A 4IFDI 2RF4A 4IJLA 3Q8DA 3CF5A 3I4OA 4DUYL 2MO1A 3U50C 2UXBQ 1VQPA 4JI5Q 3CPFA 2VUMG 4DAYB 3CCVA 2UXDL 2CQOA 2Y0SG 2BH2A 2R7ZH 3U58A 3HOYH 1NMFA 1YEZA 1Y14B 1CKOA 3AYHB 3HKZG 4LFCL 4HIDA 1XMOL 3ICEA 3S1MH 5C3EG 5HGQA 1OTCA 1M1KC 4DV4L 3J7ZC 1XTDA 3GDEA 4EX5A 4ALPA 3PUZA 4YCVA 2N8NA 2UXCL 4AYBG 2LXKA 5BR8L 1NTGA 1Q8KA 5GROA 3GTOH 4DV2L 5IYBH 4DV1Q 4JI4L 5IYDH 1Q1EA 4K0KL 1VQOA 5GAHC 4A3GG 2Q2HA 2RHQB 3PIOA 5GAGC 1GM5A 3STBC 4AQYQ 1CUKA 4WJ3M 4B3SQ 3KJOA 4KI0A 1V9PA 1PH9A 1AH9A 1MKHA 1OXXK 4TVAB 3TS0A 2R6GA 4Y7NH 3PO2H 1X56A 2AHOB 3M85A 3G48A 3CMAA 2ALYB 2CCZA 1I6HH 1VQEA 3TREA 4A3DH 4IPDA 4A3IG 4LF9Q 3S2HH 5C3EH 3K0XA 3STBD 2L15A 3HOZG 2KBNA 4JYAQ 1S40A 1ASZA 1OXVA 4GLVB 5IT9c 4DV0L 2NVXH 1W3SA 2FXQA 3S1RH 4JI7L 1T9HA 3GTMH 5LMUL 2UUAQ 2UU9L 1VQBA 1SR3A 4P73A 4YWMA 3LGJA 3U4ZA 5IWAL 3D31A 4A3GH 1JJGA 4X65L 1X3EA 2N49A 3T1YQ 5C0XI 2HIXA 5C44G 2ZM6Q 1PH5A 4JV5L 4JI6Q 4DR4L 1I3QH 2HIVA 3BZKA 4C3IH 5M5YH 1VQNA 3UDFA 2Q2TA 1HNZQ 3RN2A 5JEAG 1V43A 3ULPA 4O0AA 4IPCA 4R1JA 4B3MQ 3GTJH 3L0OA 4LF4L 4LNQA 3HOUG 3OYYA 2BA1A 2JA8G 4GKJL 3CMEA 1EIFA 2WAQE 3KJPA 2B63H 1B70B 3L7ZC 4GNXB 1RIPA 1YI2A 2K4KA 4IOAA 1UE5A 2GVAA 4DNIA 1JE5A 1I50H 4JI2L 3K80C 5C44H 3T1HL 2EIFA 3NENA 1LTLA 4JCVE 1VQ9A 3HKSA 4BBRG 2JA7H 4DR2Q 2PQAA 4GOPA 4A3JH 4MZ9A 4LF6Q 4LF8L 3JC66 2RCNA 2QEXA 3UE1A 3F2BA 4LF7Q 5JJLA 1BVSA 1HNXQ 3FKIH 4DK3C 3OTOQ 4NPSA 1N34Q 1WCMH 1IBML 1EIYB 2JA6G 4DV7L 1JT8A 3E9HA 1WI5A 1UEBA 3CAMA 2Z6KA 1VQ4A 4NXMQ 5C4XG 1N32Q 1M90C 2GN5A 2K14A 3GTQH 2VQEQ 2WB1E 4GOPC 3AEVA 2DUDA 2K5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWO A;  4DR3 L;  4OWX B;  1B8A A;  3PUW A;  4QIW E;  4DAM A;  4C3J H;  1RL2 A;  3HOX G;  5H1S E;  5M3F G;  2E5L Q;  1HJP A;  1CKN A;  2WP8 J;  3E9I A;  4BY1 G;  4IFD G;  2MO0 A;  4EQ5 A;  4DR6 Q;  4QJF A;  1VS0 A;  4BBR H;  2IX1 A;  2Z6K C;  1VQD A;  4DV3 Q;  1U0L A;  2EQS A;  3RLF A;  3G6E A;  1QVF A;  1A63 A;  2JA6 H;  1Q82 C;  4X64 Q;  1IBK Q;  4X62 Q;  3I2Z A;  4YCU A;  1AE2 A;  5C4X H;  3CCJ A;  4BBS H;  4JOI A;  1PV4 A;  1EQR A;  1HNW Q;  1KAW A;  3CQZ H;  1PHJ A;  1VQL A;  3FP9 A;  4OO1 I;  1NY4 A;  3HOX H;  3NBH B;  3K7U C;  1EQQ A;  1XPO A;  1EOV A;  4DR7 Q;  3RNU A;  1Q46 A;  2E8G A;  3EBE A;  1XMQ L;  1PH3 A;  4BY1 H;  2VNU D;  4NB3 A;  3PV0 A;  2Z0S A;  1SFO H;  4B3T L;  3M3Y H;  1KD1 C;  4DV6 Q;  4JBJ A;  4JI8 Q;  2LSS A;  3CPW A;  4GN5 A;  2YTV A;  4DV1 L;  4A3L G;  2ZJP A;  4B3R Q;  2Q2I A;  1VQG A;  3ULJ A;  5FLX c;  4JOI C;  2E2I H;  3HFZ B;  3GTG H;  1LUZ A;  2A1A A;  1Q81 C;  3NEL A;  5JJK A;  1E24 A;  1SMX A;  2A8V A;  2IX0 A;  1UE6 A;  3GO5 A;  1E7Z A;  1PYS B;  3W1B A;  2PI2 A;  5GAD C;  3KF6 B;  1I5F A;  4LFB Q;  1I94 Q;  4LF9 L;  3DLL A;  3KLW A;  1N36 Q;  1EUJ A;  2R7F A;  3OW2 A;  4JI1 L;  2F4V L;  1KC8 C;  3I4M G;  1SN8 A;  4A3E G;  5C0X G;  2HHH Q;  1VQA A;  3RZO H;  5ELN A;  4X66 L;  4AH6 A;  1VQK A;  2LXJ A;  1E22 A;  4A3L H;  2JJQ A;  5E7N A;  3CC4 A;  4PMW A;  1XNR Q;  4P74 A;  4HJA A;  3UDX A;  1J5E Q;  4A3F G;  4R4I A;  2I0Q A;  3G71 A;  1N33 Q;  4DR1 L;  1QVG A;  2OCE A;  4OX9 L;  4JI3 Q;  1JJC B;  4AIM A;  5C0X J;  3AFP A;  1WOC A;  2WFW A;  3K8A A;  2IY5 B;  2Q2U A;  2VUM H;  3KFU A;  1K73 C;  2K5V A;  4OWT B;  1PA6 A;  2UUC L;  3GTP H;  3RN5 A;  2I5M X;  3GTL H;  1SRU A;  5AJ3 L;  2OTJ A;  3A0J A;  2K52 A;  3M9B A;  1UWV A;  3HOV G;  1Q12 A;  1VQH A;  2JQO A;  3RLO A;  1X9N A;  2QA4 A;  1VQ7 A;  1HR0 Q;  4LFA L;  4A3K G;  3A74 A;  2YYZ A;  4A3E H;  3ZJY C;  2MQH A;  5LMN L;  5EAY A;  1QVC A;  4YCW A;  3CCR A;  2ZTD A;  3VDY A;  2AMC B;  4HIK A;  4BXX G;  2MFI A;  2JA5 G;  4HIO A;  2NZH A;  3D0F A;  2ATW A;  4R4Q A;  4DUY Q;  1PH7 A;  1CSP A;  2VQF L;  3S2D H;  3PCO B;  1PYB A;  4IOC A;  4A3M G;  2C35 B;  2UUB L;  4NXN L;  2OWO A;  4LF5 L;  3FHW A;  2UXD Q;  4XIG S;  5IYC G;  2R93 G;  5GAE C;  4X6A H;  1N9W A;  4RG1 A;  1DGS A;  1QUQ A;  4RMF A;  3UDI A;  4GLX A;  1PH1 A;  4LFC Q;  1YHB A;  3PF4 A;  1HZA A;  4KHZ A;  4A3I H;  5DLQ E;  3RZD H;  1L1O A;  2F52 A;  4DV4 Q;  2K5N A;  4HJ7 A;  1HR0 W;  1E1O A;  3HOZ H;  4DV5 L;  1G51 A;  2UXC Q;  3EN2 A;  4NXM L;  5BR8 Q;  5JJI A;  1N32 L;  3S15 H;  3A5U A;  3S24 A;  3TRZ A;  4DV2 Q;  3J80 c;  4H02 A;  3RR5 A;  2E2H H;  4JI4 Q;  4KHP Q;  2XGT A;  1X65 A;  4K0K Q;  2ZTC A;  1UE7 A;  2K75 A;  1VQ5 A;  5IY0 A;  2CWA A;  4A4I A;  2JA5 H;  3CD6 A;  3PO3 G;  3S16 H;  4GKK L;  2VY3 A;  2E2J H;  1FJG L;  1MJC A;  1JMC A;  4JBM A;  4QQB X;  1IXR A;  5K36 G;  4OON A;  4A3M H;  1L1O C;  1TWC H;  1IL2 A;  1E3P A;  1VQI A;  2KCT A;  5IYC H;  1EYG A;  4LUV A;  1G6P A;  4DV3 L;  1YJW A;  5FLM G;  1WFQ A;  1OXU A;  1L0W A;  3TQY A;  1VQ6 A;  2OQ0 A;  4R4O A;  1PH4 A;  4UP7 A;  4DKA C;  1XNQ L;  4YY3 L;  3HOU H;  4OO1 G;  1EWI A;  4LUZ A;  2K50 A;  4DR5 L;  3S1Q H;  2JA8 H;  4POG A;  1PVO A;  2D0O A;  2YTY A;  5LMU Q;  1OXT A;  5C4J H;  1KQS A;  2UU9 Q;  3HOW G;  3J80 i;  3CC7 A;  3S17 H;  5IWA Q;  4WJ4 A;  1BKB A;  2JK8 A;  2AKW B;  4X65 Q;  3PO3 H;  1D8L A;  1A62 A;  1YIJ A;  2AWN A;  1TWF H;  1NJI C;  2ZJQ A;  4C2M H;  1Y1V G;  3K7A H;  3B6Y A;  2R92 G;  3MEF A;  3M4Q A;  5IP7 G;  3J81 c;  1VCI A;  4IPH A;  4GN3 B;  2PMZ E;  2IHE A;  1YBY A;  3F1Z A;  4BY7 G;  4GN4 B;  3WWV A;  5IP9 G;  3GTK H;  1TWA H;  1BBW A;  3KDF A;  4O2D A;  4A3C G;  3S14 H;  1Z9F A;  2H5X A;  2UXB L;  4JI5 L;  5LMN W;  2NVQ H;  2ZJR A;  4GKJ Q;  1NE3 A;  1JJ2 A;  5FJ8 G;  5GQO A;  4ME3 A;  1K8G A;  3W5O A;  4LW1 A;  2I5H A;  3PGZ A;  1N36 L;  3TS2 A;  3EIV A;  4R4C A;  2OTL A;  1K0R A;  3K81 C;  4JI2 Q;  4GOP B;  2PQA B;  1IBL Q;  3CCS A;  5M3F H;  3T1H Q;  2JEA I;  3J81 i;  1TWG H;  4LUO A;  1IYJ B;  1XJV A;  4PG3 A;  1YNX A;  1ASY A;  1K8A C;  1WYD A;  1P8L A;  1IBM Q;  4BY7 H;  1J5E L;  1N33 L;  4DV7 Q;  2ASB A;  4AQY L;  1SRO A;  1HZB A;  4B3S L;  3J7A 5;  1GKH A;  1D7Q A;  2RHS B;  2ES2 A;  1VQF A;  4QGU A;  3RLN A;  5FJ8 H;  4JC0 A;  1X3F A;  2CWP A;  2KHJ A;  3KF8 B;  3PF5 A;  3CCE A;  3NEM A;  1PFS A;  4C3H H;  4DR3 Q;  1CKN B;  2BH8 A;  1P16 A;  1PH8 A;  1YZ6 A;  4PZ6 A;  1VQ8 A;  4JYA L;  4KLK A;  5HY6 A;  1WJJ A;  3BJU A;  3PUY A;  1PH6 A;  4UPA A;  1C0A A;  2JE6 I;  4YHH Q;  1KIX A;  5IYB G;  3AFQ A;  5IYD G;  2UUA L;  3KDF B;  1CSQ A;  3H3V I;  1KRS A;  1XPR A;  2PNH A;  4JI0 Q;  2GVB A;  3MXN B;  3GD7 A;  1V1Q A;  3T1Y L;  2CFM A;  2ZM6 L;  1HZ9 A;  3PO2 G;  1Z47 A;  4JI6 L;  3UE0 A;  5M3M G;  4HIM A;  4A3D G;  3F2C A;  2VZA A;  1HNZ L;  1Q1B A;  2JEB I;  1Y1W G;  4HJ5 A;  2V1C C;  2EXD A;  1VQJ A;  1SLJ A;  4DUZ Q;  4HJ8 A;  4B3M L;  1XMQ Q;  3I4M H;  4TQU S;  4GLA C;  4DPG A;  1W2B A;  4B3T Q;  1TWH H;  4BA1 I;  4KHP L;  4P72 A;  2NVY H;  4JBK A;  1YVC A;  1KHI A;  1LM0 A;  3KYH C;  4QY7 A;  5M5X H;  4UY8 C;  1S72 A;  1FVI A;  2XTI A;  1KRT A;  1VQC A;  1YIT A;  4GNX A;  2KCM A;  4A3F H;  2QGQ A;  1L2F A;  1MIU A;  1UE1 A;  5M5W H;  4Y52 H;  3W1G A;  1SE8 A;  3KOJ A;  4DK6 C;  4YWK A;  1S3O A;  5ELO A;  3CCQ A;  1YJ9 A;  4DR2 L;  4LF6 L;  5M3M H;  1C9O A;  3I55 A;  1XMO Q;  4LF7 L;  2HQL A;  1HNX L;  1N34 L;  3OTO L;  1AE3 A;  2YU9 H;  1Y1W H;  4BA2 I;  4JI1 Q;  2NZO A;  2F4V Q;  1U5K A;  3CCL A;  2YTX A;  4QL5 A;  3TEH B;  3HOV H;  4GNX C;  3L2P A;  1B7Y B;  1TXY A;  4OWW B;  4A3K H;  4X66 Q;  4GS3 A;  2B63 G;  2VS1 A;  2KHI A;  2VQE L;  4BXX H;  1X55 A;  4FDB A;  4IJH A;  1VQM A;  1OXS C;  1H95 A;  4MNO A;  3J81 j;  3BZC A;  4DR1 Q;  1LYL A;  4OX9 Q;  3E0E A;  3IRB A;  4PZ8 A;  4HJ9 A;  4IO9 A;  1MJE A;  2E5L L;  1PH2 A;  2JA7 G;  4P71 A;  4A75 A;  4DR6 L;  1A8V A;  1X6O A;  3H0G G;  2JA9 A;  3ERS X;  4A3J G;  2R93 H;  4A93 G;  2B29 A;  2UUC Q;  3FKI G;  4R4T A;  4L5R C;  3I7F A;  1WCM G;  1K3R A;  4MTN A;  3JAM c;  5AJ3 Q;  4X64 L;  4UP9 A;  2A19 A;  2I5L X;  1IBK L;  5J3B A;  3BU2 A;  4X62 L;  4LFA Q;  3SGI A;  2MNA A;  3G4S A;  4DV0 Q;  2BA0 A;  1YHQ A;  3A5Z B;  2D62 A;  1A0I A;  4JI7 Q;  2R7D A;  5LMN Q;  5JEA J;  1HNW L;  3M4O H;  2ID0 A;  5IE8 A;  2ZTE A;  1K83 H;  3ER0 A;  1O7I A;  1N8R C;  1R9T H;  1HH2 P;  2VQF Q;  1IBL L;  1NMG A;  4DR7 L;  1FGU A;  1QUQ B;  2UUB Q;  1G29 1;  4LF5 Q;  4NXN Q;  3M4P A;  1HZC A;  4JV5 Q;  3CC2 A;  1Q7Y C;  3H0G H;  4DR4 Q;  1CKM A;  1IZ6 A;  4IPG A;  4XTC S;  4JI8 L;  4JBW A;  4DV6 L;  3M7N A;  4A3B G;  1L1O B;  4LWC A;  4A93 H;  4B3R L;  3PUV A;  2NN6 G;  5FLM H;  3H15 A;  3JAM i;  3U4V A;  4J15 A;  4POF A;  1Q86 C;  4YWL A;  1XPU A;  3PIP A;  4LF4 Q;  4DV5 Q;  1GVP A;  2N3S A;  3PSI A;  2NVT H;  1NBW A;  4BBS G;  2CKZ B;  3I4N G;  4APV A;  1QZG A;  1GD7 A;  1BBU A;  3CP0 A;  1I94 L;  1C7Y A;  4LFB L;  2HT1 A;  3HOW H;  3PUX A;  3KF6 A;  4GKK Q;  2IHF A;  2PI2 E;  4JG2 A;  1E1T A;  2VL6 A;  1FJG Q;  3DM3 A;  3I56 A;  3CCM A;  2F3I A;  1Y1V H;  2R92 H;  4YHH L;  1J6Q A;  3F2D A;  3UDG A;  1X54 A;  2OQK A;  2WAQ G;  2HHH L;  5IP7 H;  4UP8 A;  1QZH A;  4A3B H;  2D0P A;  2Y0S E;  4LF8 Q;  3CW2 C;  1XNR L;  1KXL A;  3HKZ E;  4JI0 L;  5IP9 H;  4IFD J;  1YJN A;  4A3C H;  1XNQ Q;  4L5T A;  4JI3 L;  4YY3 Q;  2N78 A;  1X3G A;  3CXC A;  1YHA A;  4PZ7 A;  4DR5 Q;  1JB7 A;  1EFW A;  2KEN A;  2R7Z G;  3ULL A;  3AQQ A;  3I4N H;  4AYB E;  3HOY G;  2NN6 I;  2B3G A;  2DGY A;  3CCU A;  3F8T A;  4DUZ L;  2YV5 A;  4P75 A;  2VW9 A;  1FL0 A;  3H3V H;  1K9M C;  4L5S A;  1HR0 L;  3S1N H;  2WB1 G;  2IT1 A;  4OXP A;  1GO3 E;  4L5Q A;  4A76 A;  1KL9 A;  4IFD I;  2RF4 A;  4IJL A;  3Q8D A;  3CF5 A;  3I4O A;  4DUY L;  2MO1 A;  3U50 C;  2UXB Q;  1VQP A;  4JI5 Q;  3CPF A;  2VUM G;  4DAY B;  3CCV A;  2UXD L;  2CQO A;  2Y0S G;  2BH2 A;  2R7Z H;  3U58 A;  3HOY H;  1NMF A;  1YEZ A;  1Y14 B;  1CKO A;  3AYH B;  3HKZ G;  4LFC L;  4HID A;  1XMO L;  3ICE A;  3S1M H;  5C3E G;  5HGQ A;  1OTC A;  1M1K C;  4DV4 L;  3J7Z C;  1XTD A;  3GDE A;  4EX5 A;  4ALP A;  3PUZ A;  4YCV A;  2N8N A;  2UXC L;  4AYB G;  2LXK A;  5BR8 L;  1NTG A;  1Q8K A;  5GRO A;  3GTO H;  4DV2 L;  5IYB H;  4DV1 Q;  4JI4 L;  5IYD H;  1Q1E A;  4K0K L;  1VQO A;  5GAH C;  4A3G G;  2Q2H A;  2RHQ B;  3PIO A;  5GAG C;  1GM5 A;  3STB C;  4AQY Q;  1CUK A;  4WJ3 M;  4B3S Q;  3KJO A;  4KI0 A;  1V9P A;  1PH9 A;  1AH9 A;  1MKH A;  1OXX K;  4TVA B;  3TS0 A;  2R6G A;  4Y7N H;  3PO2 H;  1X56 A;  2AHO B;  3M85 A;  3G48 A;  3CMA A;  2ALY B;  2CCZ A;  1I6H H;  1VQE A;  3TRE A;  4A3D H;  4IPD A;  4A3I G;  4LF9 Q;  3S2H H;  5C3E H;  3K0X A;  3STB D;  2L15 A;  3HOZ G;  2KBN A;  4JYA Q;  1S40 A;  1ASZ A;  1OXV A;  4GLV B;  5IT9 c;  4DV0 L;  2NVX H;  1W3S A;  2FXQ A;  3S1R H;  4JI7 L;  1T9H A;  3GTM H;  5LMU L;  2UUA Q;  2UU9 L;  1VQB A;  1SR3 A;  4P73 A;  4YWM A;  3LGJ A;  3U4Z A;  5IWA L;  3D31 A;  4A3G H;  1JJG A;  4X65 L;  1X3E A;  2N49 A;  3T1Y Q;  5C0X I;  2HIX A;  5C44 G;  2ZM6 Q;  1PH5 A;  4JV5 L;  4JI6 Q;  4DR4 L;  1I3Q H;  2HIV A;  3BZK A;  4C3I H;  5M5Y H;  1VQN A;  3UDF A;  2Q2T A;  1HNZ Q;  3RN2 A;  5JEA G;  1V43 A;  3ULP A;  4O0A A;  4IPC A;  4R1J A;  4B3M Q;  3GTJ H;  3L0O A;  4LF4 L;  4LNQ A;  3HOU G;  3OYY A;  2BA1 A;  2JA8 G;  4GKJ L;  3CME A;  1EIF A;  2WAQ E;  3KJP A;  2B63 H;  1B70 B;  3L7Z C;  4GNX B;  1RIP A;  1YI2 A;  2K4K A;  4IOA A;  1UE5 A;  2GVA A;  4DNI A;  1JE5 A;  1I50 H;  4JI2 L;  3K80 C;  5C44 H;  3T1H L;  2EIF A;  3NEN A;  1LTL A;  4JCV E;  1VQ9 A;  3HKS A;  4BBR G;  2JA7 H;  4DR2 Q;  2PQA A;  4GOP A;  4A3J H;  4MZ9 A;  4LF6 Q;  4LF8 L;  3JC6 6;  2RCN A;  2QEX A;  3UE1 A;  3F2B A;  4LF7 Q;  5JJL A;  1BVS A;  1HNX Q;  3FKI H;  4DK3 C;  3OTO Q;  4NPS A;  1N34 Q;  1WCM H;  1IBM L;  1EIY B;  2JA6 G;  4DV7 L;  1JT8 A;  3E9H A;  1WI5 A;  1UEB A;  3CAM A;  2Z6K A;  1VQ4 A;  4NXM Q;  5C4X G;  1N32 Q;  1M90 C;  2GN5 A;  2K14 A;  3GTQ H;  2VQE Q;  2WB1 E;  4GOP C;  3AEV A;  2DUD A;  2K5H A; 
#chains in the Genus database with same CATH topology
 2AWO A;  3A8K E;  1TY0 A;  1B8A A;  4QIW E;  3TZD A;  1YNJ D;  1LTB D;  4O1N A;  3X3M A;  1VS0 A;  1VQD A;  4RH6 A;  4DV3 Q;  1ESR A;  5E4X A;  4DA2 A;  1TS5 A;  2JA6 H;  2NN6 H;  1Q82 C;  5CV6 A;  2EPB A;  4K6D A;  1IBK Q;  4X62 Q;  1TS3 A;  2A6E D;  1B53 A;  4YCU A;  4BBS H;  2NVT B;  2B2T C;  1KAA A;  3FP9 A;  4CHT B;  2MHV A;  3HOX H;  1SEB D;  3NBH B;  5CV9 A;  2PW5 A;  3JAM E;  2BCO A;  3K57 A;  1RCV D;  2E8G A;  2EY2 A;  4B3T L;  2R92 B;  1LV9 A;  3M3Y H;  1KD1 C;  4JBJ A;  1F2L A;  4DV1 L;  2DNC A;  2E75 C;  2Q2I A;  1DOK A;  2E2I H;  3GTG H;  1LTI D;  1LUZ A;  4YIJ A;  2IX0 A;  5ELF A;  3KF6 B;  3J7A F;  1N36 Q;  1EUJ A;  2R7F A;  4KHV A;  4FF2 A;  4UHV A;  5C3W A;  1SN8 A;  4HN7 A;  2HHH Q;  5ELN A;  2LXJ A;  1XNR Q;  2J0T D;  3F2U A;  1J5E Q;  4A3F G;  4R4I A;  2I0Q A;  3G71 A;  1QVG A;  2OCE A;  1JQY D;  4OX9 L;  3AFP A;  3K8A A;  3MZ5 A;  2IY5 B;  2VUM H;  4OGQ C;  4M8A A;  3GTP H;  2UUC L;  1EQV A;  4F88 A;  3RN5 A;  1SRU A;  3S1M B;  5CBA E;  3K5N A;  1Q12 A;  3LWE A;  2JQO A;  5KYI A;  2QA4 A;  3A74 A;  1TR5 A;  2KJX A;  5LMN L;  5EAY A;  4YCW A;  4HIK A;  4IUV A;  4HIO A;  3D0F A;  4FF4 A;  3QOL A;  1ESF A;  1PYB A;  2C35 B;  2UXD Q;  1IYV A;  4XIG S;  2R93 G;  1N9W A;  4RG1 A;  5FO7 B;  4Y7N B;  1YHB A;  3PF4 A;  4XT1 B;  1EU3 A;  1HZA A;  2F0O A;  4KHZ A;  4DK1 A;  5DLQ E;  4A3I H;  3RZD H;  4A3D B;  3C2P A;  5COR A;  5C3E B;  1G51 A;  4CKC A;  3BDL A;  3S15 H;  3S24 A;  4WFN 3;  3RR5 A;  2RDF A;  4OEM B;  1UE7 A;  2MP1 A;  5IY0 A;  2JA5 H;  4GKK L;  1WD0 A;  4QF4 A;  1MJC A;  4QQB X;  1IXR A;  1RTN A;  1E3P A;  3BYT B;  1CA5 A;  3DXJ C;  1EY8 A;  2XRQ D;  4DV3 L;  2G9H D;  4C3I B;  1YJW A;  5FLM G;  3IL8 A;  1WD1 A;  1PH4 A;  2PNR C;  3HOU H;  2F1M A;  3HGB A;  4LMQ D;  2D0O A;  5LMU Q;  1PVO A;  3MEH A;  3J80 i;  2AKW B;  1X3P A;  1U4M A;  2B2Y C;  4C2M H;  1NJI C;  1Y1V G;  3B6Y A;  1HFG A;  5I9O A;  2HUG A;  3J81 c;  1VCI A;  4IPH A;  4B9W A;  1BCP D;  4BY7 G;  3HG9 A;  4GN4 B;  4K8J A;  5IP9 G;  1TWA H;  5C3X A;  3KDF A;  2LS0 1;  2O4X A;  3BVG A;  2NVQ H;  1CTM A;  1I4R A;  4XYQ A;  1RHP A;  1Z7T A;  3VYR A;  1K8G A;  3W5O A;  1FYC A;  3GTQ B;  1N36 L;  4R4C A;  4O42 A;  1K0R A;  2FMM A;  3HRZ C;  2PQA B;  3T1H Q;  1KDB A;  2IX3 A;  1ASY A;  2EY5 A;  1IBM Q;  1P8L A;  1J5E L;  4DV7 Q;  3MXU A;  1HZB A;  4B3S L;  4MN3 A;  1X32 A;  2RHS B;  1F77 A;  3RLN A;  1JOO A;  2CWP A;  1CKN B;  4RGO S;  2BH8 A;  4FF1 A;  1YZ6 A;  4KLK A;  2JE6 I;  4YHH Q;  3AFQ A;  5IYD G;  3KDF B;  2VB2 X;  4KY7 A;  2GVB A;  2EYJ A;  3OMG A;  4JI6 L;  4IAL A;  3FMC A;  2NUC A;  4DGZ A;  3F2C A;  5CV8 A;  2PYK A;  3G6J B;  4ZKB B;  1GUW A;  4DUZ Q;  1BCP F;  2B2V C;  2FMC A;  4GLA C;  3NHH A;  4BA1 I;  4P72 A;  2D5D A;  3OWF A;  1YVC A;  1LM0 A;  3KYH C;  4UY8 C;  1YIT A;  3NTK A;  2QGQ A;  4QIW B;  1LT6 D;  2LKV A;  3QB3 A;  1E2Z A;  4YWK A;  5ELO A;  3P75 A;  3E5S A;  2HQL A;  2A68 D;  1AE3 A;  2NWG A;  2EOT A;  4BA2 I;  4JI1 Q;  1U5K A;  2X6G A;  3CCL A;  2YTX A;  3TEH B;  3KBG A;  2M9V A;  2VS1 A;  2KHI A;  3DWQ A;  4FDB A;  4IJH A;  1JR0 D;  1OXS C;  1RTO A;  1YNN C;  2K5Q A;  2KEE A;  3MXP A;  1PH2 A;  4NP5 A;  3H0G G;  2JA9 A;  3P20 A;  2PCF B;  4XDX A;  5DAU A;  4P2C B;  3P7J A;  1K3R A;  4K14 A;  1F9R A;  4RKL A;  1UEA B;  4HMI A;  5J3B A;  4LFA Q;  2BA0 A;  3A5Z B;  3SXH A;  2R7D A;  1SNP A;  2PW7 A;  5IE8 A;  1K83 H;  3ER0 A;  2E2H B;  1V8Q A;  2VQF Q;  1NMG A;  1U4R A;  3A56 A;  1FNW A;  1TWC B;  4IPG A;  5C44 B;  5K36 G;  4L63 B;  3PUV A;  2NN6 G;  4DXF A;  3H15 A;  3JAM i;  4XQQ A;  4POF A;  1Q86 C;  3PIP A;  3PSI A;  1NBW A;  1LT3 D;  3CKI B;  4BBS G;  5E4W C;  2FHT A;  1LLR D;  1DJR D;  2P5Z X;  2Q8R E;  1QZG A;  3S1Q B;  2JA8 B;  3HZX A;  3HOW H;  5IT9 L;  5TSS A;  1SE2 A;  2ENB A;  3DM3 A;  1BCP B;  4YHH L;  5JAV A;  3K7A B;  2WAQ G;  2OQK A;  5KIX A;  1SNO A;  4N9P A;  5A2Q E;  1PFN A;  3S9W A;  4K2K A;  4A3B H;  4LF8 Q;  1CQV A;  4BBR B;  3HKZ E;  3KBX A;  3NSW A;  1S5F D;  3GTK B;  4A3C H;  3R8B A;  1X3G A;  3BDO A;  2KEN A;  2NN6 I;  3VYU A;  1SBB B;  1Z6H A;  5LHY 1;  3F8T A;  2F0K A;  3M4O B;  4DUZ L;  1PTO D;  1F9S A;  1FL0 A;  2OXP A;  1KNA A;  3SDZ A;  2F0L A;  3ND8 A;  4F7X A;  3H3V H;  2XWB B;  5ISR A;  5M3F B;  3NQI A;  2IT1 A;  1TY2 A;  4R8N A;  3V96 A;  3MVV A;  4BY7 B;  1SNQ A;  5KNB A;  5E3F A;  2VUM G;  1EZ8 A;  5CC4 A;  2BH2 A;  1YEZ A;  3HKZ G;  3J81 E;  4HID A;  5HUR A;  1WTH A;  5C4Z A;  1NR2 A;  2WIN B;  3BG3 A;  1NTG A;  1Q8K A;  5GRO A;  1ILQ A;  3GTO H;  4J8Q A;  5IYB H;  2L5T A;  1ET9 A;  1H9M A;  1Q1E A;  5NUC A;  1VQO A;  4FXD A;  3SR1 A;  2E76 C;  2QEJ C;  4AQY Q;  2IWH A;  3I73 A;  2B2U C;  4KN4 C;  3M85 A;  3CMA A;  1VQE A;  4A3I G;  3S2H H;  4OHJ A;  4JYA Q;  4IZ8 A;  4GLV B;  5D3I B;  1SYB A;  3TN2 A;  2NVX H;  1Y69 U;  1T9H A;  2L0C A;  3I4M B;  3CHB D;  3RMH A;  1HHV A;  4P73 A;  4YWM A;  1TWH B;  2KVM A;  2TMP A;  2NVY B;  2A6H C;  2KHS A;  4S3S A;  3O13 A;  5C0X I;  2XNA C;  1MI2 A;  5FLX L;  2F0Q A;  1PTO F;  3BZK A;  4C1N K;  1F2Z A;  1DCZ A;  3ULP A;  4B3M Q;  3GTJ H;  3HOU G;  2DJG C;  2BA1 A;  4PQX A;  3MFY A;  5FO9 B;  4GNX B;  1YI2 A;  2L12 A;  1DZ1 A;  4IOA A;  3L9A X;  3TP8 A;  3K80 C;  5C44 H;  2EIF A;  5IOD A;  4JCV E;  1VQ9 A;  4CDC C;  4JK1 C;  4MZ9 A;  4LF6 Q;  3JC6 6;  1HUM A;  2RCN A;  3KK7 A;  3UE1 A;  4LF7 Q;  4LF8 L;  3C46 A;  4DAP A;  3OTO Q;  1WCM H;  1EIY B;  1SYF A;  3OOC A;  5C4X G;  2F0T A;  2G9D A;  2VQE Q;  1JJG A;  3AEV A;  2DUD A;  4DR3 L;  3KF8 A;  1RL2 A;  5H1S E;  1IHZ A;  2E5L Q;  1R9T B;  2MO0 A;  4EQ5 A;  1EY0 A;  4Z9C B;  4BBR H;  2IX1 A;  2Z6K C;  3IFD A;  1ONL A;  5IOC A;  3H0G B;  3RLF A;  3G6E A;  4X64 Q;  5J1Z A;  2RQX A;  3WOF A;  4WJW A;  3I2Z A;  4BWG B;  1HQR D;  1AE2 A;  1NCV A;  5CV5 A;  3CCJ A;  1PV4 A;  1EQR A;  3CQZ H;  4N8X 1;  3D6C A;  1S5E D;  1NY4 A;  2AUJ D;  1EQQ A;  2GA4 B;  1XMQ L;  4BY1 H;  4NB3 A;  1L0X B;  2Z0S A;  3PV0 A;  2XRS D;  4DV6 Q;  2C9O A;  4JI8 Q;  2LSS A;  3GQB A;  3CPW A;  2YTV A;  2DY8 A;  2NBF A;  3R93 A;  2ZJP A;  1SE3 A;  3ULJ A;  3D4D A;  4JOI C;  3NEL A;  2A8V A;  1UE6 A;  2J4X A;  1GUN A;  2RDH A;  3GO5 A;  1HTL D;  3W1B A;  3MA2 B;  4LFB Q;  4EGV A;  1I94 Q;  3KLW A;  4ZLT F;  1GUO A;  2F4V L;  1FGB D;  1BXT A;  1KC8 C;  2DJF C;  4DF7 A;  4A3E G;  1BNZ A;  4UDU C;  3S1N B;  1VQK A;  4A3L H;  4IUQ A;  2JJQ A;  2HDL A;  5E7N A;  4QMG A;  1N33 Q;  4DR1 L;  5JPM C;  4AIM A;  3C3L A;  3J7Y W;  4V0B A;  1WOC A;  1PRT C;  1DOL A;  1K73 C;  2K5V A;  2SNM A;  2OTJ A;  2Z8L A;  1HQM C;  3A0J A;  1UWV A;  1X9N A;  2YYZ A;  2K5D A;  3I8Z A;  3ZJY C;  1IW7 D;  2ZTD A;  3VDY A;  2MFI A;  2A68 C;  4DUY Q;  1PH7 A;  3PCO B;  2UUB L;  1XWE A;  1SYE A;  4NXN L;  5GAE C;  4X6A H;  1QUQ A;  4GLX A;  4LFC Q;  3PO2 B;  3HKZ B;  2F52 A;  4DV4 Q;  2Z6B A;  1E1O A;  3I3C A;  4DV5 L;  1Y1W B;  1D1K A;  2UXC Q;  2SOB A;  1D6E C;  3K0Y A;  3TRZ A;  4H02 A;  4XT3 B;  3PIP 3;  4JI4 Q;  4KHP Q;  4K0K Q;  1IL8 A;  1VQ5 A;  4Q0F A;  3PO3 G;  2VY3 A;  1FJG L;  3R3O A;  4ODG A;  3V2T A;  4A3M H;  1L1O C;  2CHB D;  2WAC A;  5IYC H;  5ELC A;  2B2Y A;  5D14 A;  1OXU A;  1KLU D;  4RAU C;  3T13 A;  4R4O A;  3LWU A;  1XNQ L;  1B44 D;  1EWI A;  2K50 A;  1NAP A;  4POG A;  4KD3 A;  2YTY A;  1KQS A;  3HOW G;  1QCB D;  4HED A;  5IWA Q;  4WJ4 A;  1BKB A;  2B63 B;  2V4D A;  1A62 A;  4EQN A;  2AWN A;  1TWF H;  3K5M A;  1EY6 A;  2L9H A;  4CKE A;  1LAC A;  4KY6 A;  2XVS A;  3EQL C;  1EIG A;  4GN3 B;  2JA7 B;  5CMD A;  1K0S A;  3F1Z A;  3N52 A;  1TVX A;  4DK0 A;  4A3J B;  1BBW A;  4O2D A;  3FKI B;  4A3C G;  3S14 H;  5KRU A;  3GV3 A;  1Z9F A;  5LMN W;  2ZJR A;  4WOR A;  4GKJ Q;  1FNV A;  1LT4 D;  2Z4H A;  4C3H G;  1O7Y A;  2NYZ D;  1TKW B;  4FXG C;  4GOP B;  3CCS A;  2Z9H A;  4C3J B;  3J81 i;  2L1B A;  1RKN A;  1QG7 A;  3T53 B;  1YNX A;  1K8A C;  1N33 L;  1B3A A;  2CH4 A;  2ASB A;  2J7Z A;  2PZT A;  1PTO C;  1XTC D;  1O80 A;  1GKH A;  1D7Q A;  1PTO H;  5LL6 S;  1VQF A;  3IKJ A;  5FJ8 H;  2F0E A;  1CHQ D;  4JC0 A;  5C4X B;  5EJW A;  3PF5 A;  3EA6 A;  3SK5 A;  1EWH A;  3X3N A;  1PH8 A;  5HY6 A;  5DM6 3;  1WJJ A;  3KLS X;  3BJU A;  1T5E A;  5IYB G;  1K3B C;  3DWA A;  1BF4 A;  1SFO B;  2ZT9 C;  3H3V I;  1KRS A;  4UAI A;  2B2V A;  4LK1 C;  3NK9 A;  1Z47 A;  2EY6 A;  5M3M G;  1WTX A;  1HRJ A;  1HNZ L;  4RFB A;  4HJ5 A;  2V1C C;  2O5J C;  1VQJ A;  3LNN A;  3E6Z X;  2IJ0 A;  2NZ1 D;  2SDF A;  1WVL A;  5C0X H;  4KHP L;  3RZO B;  2FIN B;  1EWC A;  3TP6 A;  1S72 A;  1VQC A;  5I9P A;  4Y52 H;  1MIU A;  2XSC A;  5M5W H;  4DK6 C;  1YJ9 A;  1S3O A;  1ML0 D;  4DR2 L;  1EY7 A;  1C9O A;  1DOM A;  1HNX L;  4B08 A;  1TS4 A;  1DXM A;  4IUP A;  1Y1W H;  4HSV A;  1I6H B;  3BZD B;  2NZO A;  3GTL B;  4QL5 A;  3HOV H;  4A3K H;  4X66 Q;  4GS3 A;  5EKI A;  4A3E B;  3GTM B;  1VQM A;  1GOZ A;  4K5W A;  4DFA A;  1H95 A;  4PNY A;  1NNX A;  5T1I A;  2EJM A;  3BDC A;  4HJ9 A;  4PZ8 A;  3FPP A;  1MJE A;  3SHL A;  4I7Z C;  3EVQ A;  4P71 A;  3S2D B;  1X6O A;  1JWU D;  1TII D;  4A93 G;  2F3V A;  4L5R C;  1WCM G;  5AJ3 Q;  3ONA B;  5EPK A;  4UP9 A;  2A19 A;  1IBK L;  1XYI A;  2IL8 A;  3BU2 A;  4X62 L;  3SGI A;  3DHQ A;  1YHQ A;  3HOZ B;  5C5M A;  2D62 A;  4HAE A;  5JEA J;  4MTK A;  3M4O H;  1K28 A;  1O7I A;  1N8R C;  3DUZ A;  2NTS A;  3S16 B;  5BN3 A;  4ILW A;  4LF5 Q;  2WKD A;  2PO4 A;  2E2J B;  3M4P A;  4G7H C;  3TME A;  4XTC S;  1IZ6 A;  4JBW A;  3VR4 A;  4U67 3;  2JP1 A;  1HXY D;  1E2W A;  4ABN A;  1ICW A;  2BE5 D;  3I91 A;  4YWL A;  1XPU A;  1HFN A;  2N3S A;  2NVT H;  5EGT A;  2F0U A;  3I4N G;  3A54 A;  3ZYY X;  1SE4 A;  4APV A;  1GD7 A;  1C7Y A;  5C4J B;  4JG2 A;  3S17 B;  1E1T A;  1VMP A;  2FJ2 A;  4ZK9 B;  3I56 A;  3PO3 B;  2F3I A;  1TT2 A;  2R92 H;  3F2D A;  1J6Q A;  2VXW A;  2HHH L;  1S5C D;  5LL6 X;  1QZH A;  3CW2 C;  1XNR L;  3U9S A;  1PZJ D;  1G8Z D;  1YJN A;  4V19 0;  2F4I A;  4YY3 Q;  1YHA A;  2RSN A;  4DR5 Q;  1EFW A;  1JB7 A;  2R7Z G;  1E0B A;  3HOY G;  2B3G A;  2K7V A;  1GHJ A;  2DGY A;  4FF3 A;  5CBE E;  1EYC A;  2IPK D;  1B50 A;  4P75 A;  4K8I A;  1K9M C;  4L5S A;  2QIL A;  1JOK A;  2WB1 G;  2K1B A;  1TWG B;  3KUP A;  1KL9 A;  5ELB A;  4IFD I;  3Q8D A;  3DMU A;  3U50 C;  2UXB Q;  4JI5 Q;  3CPF A;  5FOB B;  2UXD L;  3TDQ A;  1Y8P B;  1OO9 B;  2EJF C;  3ICE A;  3S1M H;  1WTR A;  2FFK B;  2B2U A;  2K28 A;  3GDE A;  4C3H B;  3NUC A;  4J6H A;  2HQE A;  2CH4 W;  1AFP A;  1HA6 A;  3SK8 A;  4ZKC B;  5IGC A;  4A3G G;  1ICF B;  2Q2H A;  4EQO A;  4TRD A;  3STB C;  1CUK A;  5KGU A;  1X3Q A;  1SYD A;  1V9P A;  1PH9 A;  1OXX K;  2KED A;  4HTH A;  2R6G A;  4Y7N H;  2K33 A;  1IW7 C;  4RHR A;  1I6H H;  4A3D H;  4LF9 Q;  2ZXO A;  5C3E H;  3T56 B;  2RBM A;  3TSS A;  5IT9 c;  5T1G A;  3GTM H;  5LMU L;  3NP8 A;  2UUA Q;  1UUP A;  1H9S A;  5CV7 A;  2N49 A;  5M5X B;  5D3D A;  3T1Y Q;  2ZM6 Q;  1PH5 A;  4A3F B;  1B2T A;  1VQN A;  4C3I H;  3UDF A;  2Q2T A;  1SDF A;  3SE0 A;  5JEA G;  4QUF A;  5M3M B;  1V43 A;  4IPC A;  4R1J A;  2YU9 B;  1ENF A;  1O7Z A;  3OYY A;  2QKI C;  3Q23 A;  4IUN A;  3CME A;  1EIF A;  1KLG D;  2WAQ E;  5IGD A;  3KJP A;  4HCS A;  3L7Z C;  1RIP A;  2K4K A;  1UE5 A;  1JE5 A;  4RHS A;  1H9K A;  3T1H L;  1F2Y A;  3NEN A;  4M1U B;  3HKS A;  1F9Q A;  3K58 A;  2OEO A;  1DYQ A;  3T16 A;  3F2B A;  4G57 A;  1JCK B;  1BVS A;  2ZXR A;  3HP3 A;  1N34 Q;  3KLS A;  1IBM L;  2JA6 G;  2R93 B;  4DV7 L;  5EQ0 A;  1STH A;  1UEB A;  3BVM A;  1YNJ C;  2Z6K A;  1VQ4 A;  4RGM A;  1N32 Q;  1M90 C;  2K14 A;  2EVB A;  3OPO A;  3GTQ H;  5L37 A;  3ITP A;  1AEX A;  1KDC A;  4R9W A;  4RA8 A;  4DAM A;  3PUW A;  3HOX G;  3IFT A;  4DR6 Q;  2A6E C;  1U0L A;  2E2D C;  1B4O A;  2PZU A;  2EQS A;  4XYO A;  1QVF A;  4A93 B;  3SVM A;  1O7L A;  1QNU A;  3MXN A;  4TSS A;  4KD4 A;  2HD3 A;  3NTH A;  4JOI A;  1HNW Q;  3BS1 A;  2LFN A;  4OO1 I;  3H91 A;  3H3V C;  1PMR A;  1R4Q B;  4DR7 Q;  3J80 L;  1EOV A;  3RNU A;  1Q46 A;  4CBV A;  1PFM A;  2O2L D;  1Y1V B;  3AMU A;  4B3R Q;  5ELE A;  5IGF A;  5FLX c;  1PXU A;  3HFZ B;  3D4W A;  2EYL A;  1PZK D;  5EPJ A;  5GAD C;  3NE5 B;  4LF9 L;  3I4N B;  3DLL A;  4HCE A;  5JPN C;  1R4P B;  3OW2 A;  4JI1 L;  2EDG A;  1TU2 B;  5M9O A;  5C0X G;  4ULL A;  1VQA A;  3QJY A;  3SK4 A;  3ERO A;  1E22 A;  2K04 A;  1I4G A;  4HJA A;  1QWY A;  2JN4 A;  3CRK C;  4NW2 A;  4JI3 Q;  2WFW A;  1G2T A;  4TKO B;  3ND9 A;  1PA6 A;  3M4Y A;  4DN4 M;  2EJG C;  4G7Z C;  3HOY B;  2KUM A;  1I4H A;  1W6K A;  2K52 A;  3NWT A;  3HOV G;  5FO8 B;  2B2W C;  3FPU B;  1HR0 Q;  1VQ7 A;  4LFA L;  4A3K G;  3E3X A;  3OWE B;  3PQI A;  5EKL A;  2G5D A;  3D3R A;  2JA5 G;  3OSO A;  2F0F A;  3FDT A;  2VQF L;  5KEE A;  4N9T A;  5ELD A;  3ERQ A;  1SYC A;  3FHW A;  4DNT B;  4RMF A;  3UDI A;  1PH1 A;  3WOE A;  1W6J A;  1FNU A;  1A2U A;  3N6R A;  1L1O A;  1HR0 W;  3D8G A;  3EN2 A;  5JJI A;  5BR8 Q;  5IIF A;  1N32 L;  3A5U A;  4DV2 Q;  2E2H H;  4RKB A;  2XGT A;  1X65 A;  3S1R B;  2ZTC A;  2SNS A;  2X69 A;  2CWA A;  4A4I A;  4R8I A;  4JBM A;  2K5W A;  4KK7 A;  1SMY D;  4A3G B;  1SNM A;  4OON A;  5A35 A;  3NBI A;  1TWC H;  1IL2 A;  1EYG A;  4LUV A;  4CDF C;  1G6P A;  3K5O A;  1I3Q B;  5M5Y B;  4LAA A;  1L0W A;  3TQY A;  5G3L D;  1EIH A;  4XXE A;  4DKA C;  1AZQ A;  3S1Q H;  3A7L A;  2JA8 H;  1OXT A;  2UU9 Q;  1C4Q A;  3CC7 A;  2EY1 A;  2K05 A;  2F0H A;  1BCP C;  3QOJ A;  4X65 Q;  1YIJ A;  2D9U A;  1DM0 B;  3WDN A;  3K7A H;  2R92 G;  4CDD C;  2OT2 A;  2B2T A;  1I50 B;  2PMZ E;  1E2V A;  2BDN A;  2IHE A;  5IT9 E;  4NMZ A;  4ZUJ A;  3WWV A;  2IW3 A;  5DEH A;  3GTK H;  1I6V C;  3L3O C;  3VYS A;  1V1O A;  5HGT A;  3KLR A;  1NE3 A;  1JJ2 A;  1BUV T;  2AUK A;  5GQO A;  1EU4 A;  4KJO A;  3H94 A;  4RCO A;  2I5H A;  3PGZ A;  3TS2 A;  1SJE D;  2OTL A;  1II3 A;  1IKM A;  4JI2 Q;  1IBL Q;  5M3F H;  4IFD H;  5C5L A;  4LUO A;  1IYJ B;  1JC7 A;  1RD9 D;  4K5V A;  1XJV A;  1WYD A;  4BY7 H;  2PZW A;  5D65 A;  1V1P A;  1EQT A;  4AQY L;  1SRO A;  4KN7 C;  2JA6 B;  4IUU A;  2XIW A;  3JAM L;  1X3F A;  1JE4 A;  3KF8 B;  4BBS B;  1SAP A;  3H09 A;  1PFS A;  4HMJ A;  3TBI B;  1G91 A;  3Q0A A;  1VQ8 A;  4JYA L;  3PUY A;  1PH6 A;  4UPA A;  5G3L F;  3HOX B;  4CGY B;  5KYL A;  3BVZ A;  1CSQ A;  2WAQ B;  1JWS D;  3M3Y B;  2XWJ B;  1XPR A;  2PNH A;  2E2I B;  2L55 A;  3GTG B;  3GD7 A;  3DEP A;  2ICI A;  2CFM A;  1Y8N B;  3UE0 A;  3QO2 A;  4A3D G;  2Q8I B;  2F3W A;  2VZA A;  2JEB I;  4K6L A;  2TSS A;  1QE6 A;  2EXD A;  5I2X A;  4B3M L;  2H4O A;  3MXG A;  3I4M H;  3NWS A;  1WTQ A;  4B3T Q;  1W2B A;  1HTP A;  1JOR A;  1TWH H;  1V1P B;  2NVY H;  4JBK A;  1KHI A;  4QY7 A;  1FR3 A;  5FK9 C;  2XTI A;  1KRT A;  1UE1 A;  1I4X A;  2A69 D;  4DNR B;  1EY9 A;  2N88 A;  3W1G A;  3KOJ A;  4CJ1 B;  4C3I G;  4ID6 A;  4QCL A;  4LF6 L;  2F03 A;  3I55 A;  2VUM B;  1XMO Q;  1STE A;  4LF7 L;  2RA4 A;  3E0J A;  3OTO L;  1STY A;  1SJH D;  3GTP B;  2A74 C;  2AQ2 B;  3VR2 A;  5FLX E;  1D5M C;  1UAP A;  4H13 C;  5I6Y A;  4PMB A;  4GNX C;  3L2P A;  1B7Y B;  1TXY A;  4OWW B;  1STA A;  2F0M A;  2VQE L;  4BXX H;  1X55 A;  2KCN A;  2JXM B;  3Q22 A;  3J81 j;  4KTA A;  3BZC A;  1LYL A;  2VB3 X;  4OX9 Q;  1CZW A;  2R3Z A;  2E5L L;  1A8V A;  3TZU A;  1M8A A;  3ERS X;  3SK6 A;  2B29 A;  2UUC Q;  1TQO A;  4R4T A;  2F0W A;  3I7F A;  1CHP D;  2EE1 A;  2JSO A;  1ZXT A;  5J22 A;  3PMF A;  2LY7 A;  4X64 L;  4A3I B;  1WTO A;  3RZD B;  1IKL A;  1QB5 D;  3VA5 A;  2C5C A;  2MNA A;  3G4S A;  5I4D A;  1A0I A;  4JI7 Q;  5LMN Q;  2ID0 A;  2ZTE A;  3S15 B;  3A8I E;  2Z4I A;  4L8J A;  1R9T H;  3IAY A;  2JA5 B;  4L6T B;  1IBL L;  1FGU A;  1QUQ B;  1FD7 D;  3K6O A;  3H0G H;  4X3S A;  1CKM A;  4A3B G;  4DV6 L;  4JI8 L;  4LWC A;  2A73 B;  3D4R A;  5F2D A;  1D1I A;  2E74 C;  4LF4 Q;  2AQ3 B;  4OO1 H;  2CKZ B;  3HOU B;  2KEC A;  4LFB L;  1I94 L;  3CP0 A;  5KND A;  2HT1 A;  3PUX A;  1AW7 A;  3EFX D;  3KF6 A;  4GKK Q;  2IHF A;  2PI2 E;  3K59 A;  2VL6 A;  1D2B A;  5E1F A;  3A8J E;  4C2M B;  3UDG A;  5CGK A;  5IP7 H;  5EKK A;  2D0P A;  3QG1 A;  2Y0S E;  5K36 H;  1Q90 A;  3Q24 A;  4LJZ C;  2I07 B;  4IFD J;  4BS9 A;  1WTP A;  4CDE C;  1TWA B;  3CXC A;  2CW0 D;  3NXW A;  4PMC A;  4PZ7 A;  1ENA A;  3ULL A;  3AQQ A;  2NVQ B;  4AYB E;  2EYH A;  1CI3 M;  2EYP A;  2YV5 A;  2VW9 A;  1NUC A;  3S1N H;  1JOQ A;  1K8O A;  1K8M A;  4KV6 A;  4X3U A;  3GV6 A;  1HUN A;  4OXP A;  4L5Q A;  3URY A;  4A76 A;  4DUY L;  2MO1 A;  1EYD A;  3CCV A;  5CR3 A;  2Y0S G;  1G6Z A;  3U58 A;  1NMF A;  3AYH B;  1Y14 B;  1CKO A;  4FNF A;  1BDO A;  4LFC L;  4CJ0 B;  1XMO L;  1M4V A;  1OTC A;  1M1K C;  4DV4 L;  3J7Z C;  1XTD A;  1KDA A;  2L4N A;  4ALP A;  1ZKO A;  3PUZ A;  4YCV A;  2N8N A;  2UXC L;  4N8F A;  4AYB G;  1VF5 C;  3A7A B;  4JI4 L;  4K0K L;  3PIO A;  1EZ6 A;  1GM5 A;  4KMU C;  4B3S Q;  4RCN A;  3KJO A;  4KI0 A;  2XN9 C;  4NDX A;  1MKH A;  3TS0 A;  3PO2 H;  2EYO A;  2PMZ B;  3TRE A;  4B9X A;  1CQF A;  3K0X A;  3M7G A;  4U68 A;  3CU7 A;  2DNE A;  2KBN A;  1EEF D;  2FXQ A;  4JI7 L;  1EL0 A;  1XX8 A;  1STG A;  1VQB A;  2WII B;  2RVL A;  5IWA L;  1NSN S;  1CT1 D;  3TP5 A;  1S4Z A;  5C44 G;  4DAV A;  1BOS A;  3HS0 C;  3TP7 A;  4ZUI A;  4JI6 Q;  2HIV A;  2QDL A;  1F9P A;  3DM1 A;  2MPM A;  4KKS A;  1SND A;  1MGS A;  2A6H D;  4LNQ A;  4LF4 L;  1SMY C;  4X3T A;  2F0S A;  3DWP A;  4GKJ L;  2JA8 G;  3MTS A;  2B63 H;  1B70 B;  2BOS A;  4DNI A;  4RGN A;  2O5I C;  5EPL A;  2X6L A;  1BR9 A;  1LTL A;  4ZQ3 A;  4BBR G;  2JA7 H;  2PQA A;  4A3J H;  3LX0 A;  2QEX A;  2EZV A;  5JJL A;  3D6W A;  1ZYR D;  3FKI H;  4NPS A;  4G7O C;  3E9H A;  1WI5 A;  1I4P A;  2CQA A;  3CAM A;  4FO2 A;  4NXM Q;  2GN5 A;  1T5X D;  2WB1 E;  4QUC A;  4GOP C;  2JYO A;  1K83 B;  4OWX B;  3P1H A;  1QNK A;  4KKU A;  4C3J H;  5M3F G;  1HJP A;  1CKN A;  2WP8 J;  3E9I A;  4BY1 G;  1I4Q A;  4IFD G;  5EBC A;  5IGE A;  5C6A A;  4QJF A;  3OHX C;  1A3U A;  4CJ2 C;  4OEL B;  4JW0 A;  4ZRZ A;  1A63 A;  5FKA C;  1IYU A;  4C56 C;  1B9N A;  3OIP A;  1KTK A;  5C4X H;  4I65 A;  1U4L A;  5A2Q L;  1KAW A;  3C1E A;  1KAB A;  3NPP A;  1PHJ A;  1VQL A;  4DU9 A;  3HOW B;  2MUY A;  3I90 A;  2F0N A;  3K7U C;  1XPO A;  3EBE A;  1PH3 A;  2VNU D;  1SFO H;  4A3L G;  4GN5 A;  4PV1 C;  1VQG A;  1C48 A;  4A3B B;  3BYY B;  2A1A A;  2Z1C A;  1Q81 C;  4HR7 B;  5JJK A;  1E24 A;  1SMX A;  3R2I A;  1LTG D;  4Q5V A;  3OIQ A;  1E7Z A;  1PYS B;  4HSP A;  2PI2 A;  2EYF A;  1I5F A;  5JVH 3;  3W3A A;  2DN8 A;  5IGG A;  3I4M G;  1LTA D;  1PZI D;  3RZO H;  4X66 L;  4AH6 A;  3CC4 A;  4PMW A;  4P74 A;  3J81 L;  3UDX A;  2B2W A;  2M2L A;  1JJC B;  5C0X J;  1D5Z C;  4FYD A;  5AFW A;  2Q2U A;  3KFU A;  1GUG A;  4OWT B;  2ZXP A;  2I5M X;  3GTL H;  5AJ3 L;  1J8I A;  3FRP B;  3T4A C;  1STB A;  3M9B A;  2A69 C;  1VQH A;  3MFG A;  3RLO A;  3UI2 A;  1BO0 A;  1PRT D;  1HCZ A;  4A3E H;  2MQH A;  2QDB A;  1QVC A;  4BXX G;  3CCR A;  2AMC B;  2EYM A;  2ICE C;  5BN5 A;  3A55 A;  3GTO B;  2NZH A;  2ATW A;  4R4Q A;  1TS2 A;  1C8C A;  1CSP A;  3S2D H;  4IOC A;  4A3M G;  2OWO A;  4J1M A;  4LF5 L;  5JJZ A;  1EY4 A;  4XQJ A;  5IYC G;  4K5X A;  1DGS A;  2KOL A;  2Y0S B;  3VYT A;  3S2H B;  2K5N A;  2B39 A;  2QCP X;  5BN4 A;  3MAQ A;  4HJ7 A;  4OIJ A;  3HOZ H;  4NXM L;  3G7L A;  3MC0 B;  3J80 c;  2NVX B;  3V05 A;  4AYB B;  1UNS A;  2K75 A;  2L11 A;  3CD6 A;  3S16 H;  2E2J H;  1JMC A;  1U9R A;  1S5D D;  2HDM A;  1VQI A;  2KCT A;  4MIU A;  1ZEQ X;  1MHW C;  1BQQ T;  3VR5 A;  5DM7 3;  1LAB A;  1WFQ A;  1VQ6 A;  1LT5 D;  1JB3 A;  2OQ0 A;  1MSH A;  4UP7 A;  4YY3 L;  4IN3 A;  4OO1 G;  4LUZ A;  3GTJ B;  2M00 A;  4DR5 L;  2RDG A;  5C4J H;  1H9S B;  3S17 H;  3OW7 A;  5COY A;  1VDZ A;  2JK8 A;  3PO3 H;  1D8L A;  2ZJQ A;  1GHK A;  4KY5 A;  3VR3 A;  3MEF A;  5I2Y A;  3M4Q A;  5IP7 G;  1YBY A;  1PRT F;  4JPB W;  1A3T A;  1WCM B;  2N55 A;  2SEB D;  4OIK A;  2H5X A;  2UXB L;  4JI5 L;  1H9R A;  5FJ8 G;  4G4K A;  1RJT A;  4ME3 A;  2WKC A;  1KNE A;  4LW1 A;  1J9O A;  3EIV A;  3K81 C;  4RGT A;  2JEA I;  2CW0 C;  1LO5 D;  1TWG H;  2QF7 A;  1Y8O B;  1CM9 A;  4PG3 A;  1EEI D;  2K6A A;  3NQT A;  3J7A 5;  2ES2 A;  4QGU A;  2F0P A;  2K32 A;  2RKS A;  3PIO 3;  1DON A;  2NB0 A;  2KHJ A;  3CCE A;  3NEM A;  4C3H H;  4DR3 Q;  3CQZ B;  5JOB A;  1P16 A;  3U9O A;  2PQE A;  4PZ6 A;  3SEB A;  5C4H A;  1C0A A;  1KIX A;  3I4L A;  4BY1 B;  2UUA L;  4IUT A;  4JI0 Q;  3MXN B;  2MGS A;  1V1Q A;  5I6W A;  3T1Y L;  2ZM6 L;  1HZ9 A;  4ZYS A;  3PO2 G;  1Q8I A;  4HIM A;  3DEO A;  4ME5 A;  1Q1B A;  2R7Z B;  1G2S A;  1Y1W G;  1SLJ A;  4HJ8 A;  2F0D A;  1AN8 A;  1XMQ Q;  1Q3L A;  2B8F A;  4TQU S;  4DPG A;  4C1N I;  4ZCK A;  3EJI A;  5M5X H;  2WB1 B;  4JVZ A;  1FVI A;  4GNX A;  2KCM A;  4A3F H;  1L2F A;  1SE8 A;  2EXZ A;  3CCQ A;  4XQN A;  1QIL A;  5M3M H;  4K2L A;  1VMC A;  1PRT B;  1N34 L;  2YU9 H;  2WV6 D;  2F4V Q;  1EY5 A;  2OF1 A;  1EFI D;  2HCI A;  3FVQ A;  1QJO A;  3W2D A;  2Q8T A;  1B9M A;  1ILP A;  2B63 G;  1GUT A;  2K03 A;  4H0L C;  4MNO A;  4DR1 Q;  1GJX A;  3E0E A;  3IRB A;  1RDP D;  4IO9 A;  3R2T A;  2JA7 G;  1WTW A;  4FVM A;  4A75 A;  4DR6 L;  4A3J G;  2R93 H;  3FKI G;  3MHB A;  3JAM c;  4MTN A;  1A15 A;  5CYU A;  2I5L X;  4DV0 Q;  4GZY C;  1HNW L;  1ZYR C;  2PPB C;  4C3J G;  2BE5 C;  1HH2 P;  4DR7 L;  2A5H A;  3AU7 A;  2UUB Q;  1G29 1;  4NXN Q;  4JV5 Q;  1HZC A;  1STN A;  3CC2 A;  1Q7Y C;  4DR4 Q;  4A3M B;  3M7N A;  4IUR A;  4A93 H;  1VF7 A;  2K01 A;  1L1O B;  1PDQ A;  4B3R L;  1U4P A;  5J39 A;  5FLM H;  4QB4 A;  3U4V A;  3QR8 A;  4J15 A;  4F8M A;  2H1E A;  3I72 A;  4DV5 Q;  1GVP A;  1BBX C;  2QW7 A;  1S5B D;  4IQZ A;  3Q6S A;  1CZG A;  1EOT A;  1BBU A;  2HCC A;  4DAY A;  1HPC A;  1B1Z A;  2KCC A;  5EBD A;  1FJG Q;  3CCM A;  1SXT A;  1TWF B;  1Y1V H;  1EYA A;  3VR6 A;  1X54 A;  1CFM A;  3AB9 A;  4UP8 A;  1JIC A;  4EVO A;  1KXL A;  4JI0 L;  1D5X C;  1ENC A;  1LTR D;  3NTI A;  5IP9 H;  3J80 E;  1QOH A;  2B8G A;  4OL7 A;  1XNQ Q;  4L5T A;  4JI3 L;  2N78 A;  1A3V A;  3S14 B;  3I4N H;  1L0Y B;  3T51 B;  3CCU A;  1XXG A;  3QIA A;  1HA5 A;  5JVG 3;  2KA7 A;  1HR0 L;  1DD2 A;  2RCF A;  1GO3 E;  1A6X A;  1LTS D;  1AZP A;  2RF4 A;  4IJL A;  3CF5 A;  3I4O A;  1RF2 D;  1VQP A;  4DAY B;  5KNC A;  2CQO A;  4KJN A;  2KQ3 A;  2R7Z H;  1PTO B;  3HOY H;  5DNF A;  4F87 A;  5C3E G;  5HGQ A;  1JWM D;  1PLF A;  1SYG A;  4X3K A;  4EX5 A;  4DXG A;  5BR8 L;  2LXK A;  4NKL A;  4DV2 L;  4DV1 Q;  5IYD H;  2BDO A;  5GAH C;  2RHQ B;  5GAG C;  4WJ3 M;  1F2M A;  2NTT A;  3GP7 A;  1SSO A;  1AH9 A;  4TVA B;  1PYW D;  4EQP A;  1X56 A;  2AHO B;  3FEW X;  3G48 A;  5CV4 A;  2ALY B;  2D2C C;  2CCZ A;  5K5P A;  4IPD A;  2F0G A;  5IGB A;  3H6M A;  3HEJ A;  3CRL C;  2F0V A;  3STB D;  2L15 A;  3HOZ G;  2AQ1 B;  1S40 A;  3RUZ A;  1ASZ A;  1OXV A;  4DV0 L;  4WRD A;  1W3S A;  3RD4 A;  1ET6 A;  3S1R H;  1MBY A;  2UU9 L;  1PFB A;  4MHE A;  1SR3 A;  4KKT A;  3LGJ A;  3U4Z A;  2F0I A;  3D31 A;  4A3G H;  4X65 L;  1X3E A;  4FP5 D;  1GUS A;  1GXD C;  2HIX A;  4ZAI A;  3VA7 A;  4JV5 L;  1MD2 D;  4DR4 L;  5M5W B;  1I3Q H;  5M5Y H;  3J7A V;  1MSG A;  1HNZ Q;  3RN2 A;  4RWS C;  1AP0 A;  4CKB A;  1LTT D;  4O0A A;  3L0O A;  4H7B A;  1YNN D;  3MWY W;  3HOV B;  1SNC A;  1B3Q A;  3OMC A;  4H44 C;  3C1F A;  1CK1 A;  1WTV A;  2CVR A;  4A3K B;  2R61 A;  2F0J A;  1O78 A;  2GVA A;  2DY7 A;  1I50 H;  4JI2 L;  2LMC B;  3K5L A;  1CA6 A;  1H9J A;  3NBH A;  4DR2 Q;  4E6I A;  4GOP A;  3I70 A;  1HNX Q;  4DK3 C;  5JEA H;  1JT8 A;  3QWN A;  2I46 A;  1A2T A;  4I7A A;  2MJ8 A;  1ROD A;  2RSO A;  1NR4 A;  4FXK C;  2K5H A; 
#chains in the Genus database with same CATH homology
 2AWO A;  4DR3 L;  4OWX B;  1B8A A;  3PUW A;  4QIW E;  4DAM A;  4C3J H;  1RL2 A;  3HOX G;  5H1S E;  5M3F G;  2E5L Q;  1HJP A;  1CKN A;  2WP8 J;  3E9I A;  4BY1 G;  4IFD G;  2MO0 A;  4EQ5 A;  4DR6 Q;  4QJF A;  1VS0 A;  4BBR H;  2IX1 A;  2Z6K C;  1VQD A;  4DV3 Q;  1U0L A;  2EQS A;  3RLF A;  3G6E A;  1QVF A;  1A63 A;  2JA6 H;  1Q82 C;  4X64 Q;  1IBK Q;  4X62 Q;  3I2Z A;  4YCU A;  1AE2 A;  5C4X H;  3CCJ A;  4BBS H;  4JOI A;  1PV4 A;  1EQR A;  1HNW Q;  1KAW A;  3CQZ H;  1PHJ A;  1VQL A;  3FP9 A;  4OO1 I;  1NY4 A;  3HOX H;  3NBH B;  3K7U C;  1EQQ A;  1XPO A;  1EOV A;  4DR7 Q;  3RNU A;  1Q46 A;  2E8G A;  3EBE A;  1XMQ L;  1PH3 A;  4BY1 H;  2VNU D;  4NB3 A;  3PV0 A;  2Z0S A;  1SFO H;  4B3T L;  3M3Y H;  1KD1 C;  4DV6 Q;  4JBJ A;  4JI8 Q;  2LSS A;  3CPW A;  4GN5 A;  2YTV A;  4DV1 L;  4A3L G;  2ZJP A;  4B3R Q;  2Q2I A;  1VQG A;  3ULJ A;  5FLX c;  4JOI C;  2E2I H;  3HFZ B;  3GTG H;  1LUZ A;  2A1A A;  1Q81 C;  3NEL A;  5JJK A;  1E24 A;  1SMX A;  2A8V A;  2IX0 A;  1UE6 A;  3GO5 A;  1E7Z A;  1PYS B;  3W1B A;  2PI2 A;  5GAD C;  3KF6 B;  1I5F A;  4LFB Q;  1I94 Q;  4LF9 L;  3DLL A;  3KLW A;  1N36 Q;  1EUJ A;  2R7F A;  3OW2 A;  4JI1 L;  2F4V L;  1KC8 C;  3I4M G;  1SN8 A;  4A3E G;  5C0X G;  2HHH Q;  1VQA A;  3RZO H;  5ELN A;  4X66 L;  4AH6 A;  1VQK A;  2LXJ A;  1E22 A;  4A3L H;  2JJQ A;  5E7N A;  3CC4 A;  4PMW A;  1XNR Q;  4P74 A;  4HJA A;  3UDX A;  1J5E Q;  4A3F G;  4R4I A;  2I0Q A;  3G71 A;  1N33 Q;  4DR1 L;  1QVG A;  2OCE A;  4OX9 L;  4JI3 Q;  1JJC B;  4AIM A;  5C0X J;  3AFP A;  1WOC A;  2WFW A;  3K8A A;  2IY5 B;  2Q2U A;  2VUM H;  3KFU A;  1K73 C;  2K5V A;  4OWT B;  1PA6 A;  2UUC L;  3GTP H;  3RN5 A;  2I5M X;  3GTL H;  1SRU A;  5AJ3 L;  2OTJ A;  3A0J A;  2K52 A;  3M9B A;  1UWV A;  3HOV G;  1Q12 A;  1VQH A;  2JQO A;  3RLO A;  1X9N A;  2QA4 A;  1VQ7 A;  1HR0 Q;  4LFA L;  4A3K G;  3A74 A;  2YYZ A;  4A3E H;  3ZJY C;  2MQH A;  5LMN L;  5EAY A;  1QVC A;  4YCW A;  3CCR A;  2ZTD A;  3VDY A;  2AMC B;  4HIK A;  4BXX G;  2MFI A;  2JA5 G;  4HIO A;  2NZH A;  3D0F A;  2ATW A;  4R4Q A;  4DUY Q;  1PH7 A;  1CSP A;  2VQF L;  3S2D H;  3PCO B;  1PYB A;  4IOC A;  4A3M G;  2C35 B;  2UUB L;  4NXN L;  2OWO A;  4LF5 L;  3FHW A;  2UXD Q;  4XIG S;  5IYC G;  2R93 G;  5GAE C;  4X6A H;  1N9W A;  4RG1 A;  1DGS A;  1QUQ A;  4RMF A;  3UDI A;  4GLX A;  1PH1 A;  4LFC Q;  1YHB A;  3PF4 A;  1HZA A;  4KHZ A;  4A3I H;  5DLQ E;  3RZD H;  1L1O A;  2F52 A;  4DV4 Q;  2K5N A;  4HJ7 A;  1HR0 W;  1E1O A;  3HOZ H;  4DV5 L;  1G51 A;  2UXC Q;  3EN2 A;  4NXM L;  5BR8 Q;  5JJI A;  1N32 L;  3S15 H;  3A5U A;  3S24 A;  3TRZ A;  4DV2 Q;  3J80 c;  4H02 A;  3RR5 A;  2E2H H;  4JI4 Q;  4KHP Q;  2XGT A;  1X65 A;  4K0K Q;  2ZTC A;  1UE7 A;  2K75 A;  1VQ5 A;  5IY0 A;  2CWA A;  4A4I A;  2JA5 H;  3CD6 A;  3PO3 G;  3S16 H;  4GKK L;  2VY3 A;  2E2J H;  1FJG L;  1MJC A;  1JMC A;  4JBM A;  4QQB X;  1IXR A;  5K36 G;  4OON A;  4A3M H;  1L1O C;  1TWC H;  1IL2 A;  1E3P A;  1VQI A;  2KCT A;  5IYC H;  1EYG A;  4LUV A;  1G6P A;  4DV3 L;  1YJW A;  5FLM G;  1WFQ A;  1OXU A;  1L0W A;  3TQY A;  1VQ6 A;  2OQ0 A;  4R4O A;  1PH4 A;  4UP7 A;  4DKA C;  1XNQ L;  4YY3 L;  3HOU H;  4OO1 G;  1EWI A;  4LUZ A;  2K50 A;  4DR5 L;  3S1Q H;  2JA8 H;  4POG A;  1PVO A;  2D0O A;  2YTY A;  5LMU Q;  1OXT A;  5C4J H;  1KQS A;  2UU9 Q;  3HOW G;  3J80 i;  3CC7 A;  3S17 H;  5IWA Q;  4WJ4 A;  1BKB A;  2JK8 A;  2AKW B;  4X65 Q;  3PO3 H;  1D8L A;  1A62 A;  1YIJ A;  2AWN A;  1TWF H;  1NJI C;  2ZJQ A;  4C2M H;  1Y1V G;  3K7A H;  3B6Y A;  2R92 G;  3MEF A;  3M4Q A;  5IP7 G;  3J81 c;  1VCI A;  4IPH A;  4GN3 B;  2PMZ E;  2IHE A;  1YBY A;  3F1Z A;  4BY7 G;  4GN4 B;  3WWV A;  5IP9 G;  3GTK H;  1TWA H;  1BBW A;  3KDF A;  4O2D A;  4A3C G;  3S14 H;  1Z9F A;  2H5X A;  2UXB L;  4JI5 L;  5LMN W;  2NVQ H;  2ZJR A;  4GKJ Q;  1NE3 A;  1JJ2 A;  5FJ8 G;  5GQO A;  4ME3 A;  1K8G A;  3W5O A;  4LW1 A;  2I5H A;  3PGZ A;  1N36 L;  3TS2 A;  3EIV A;  4R4C A;  2OTL A;  1K0R A;  3K81 C;  4JI2 Q;  4GOP B;  2PQA B;  1IBL Q;  3CCS A;  5M3F H;  3T1H Q;  2JEA I;  3J81 i;  1TWG H;  4LUO A;  1IYJ B;  1XJV A;  4PG3 A;  1YNX A;  1ASY A;  1K8A C;  1WYD A;  1P8L A;  1IBM Q;  4BY7 H;  1J5E L;  1N33 L;  4DV7 Q;  2ASB A;  4AQY L;  1SRO A;  1HZB A;  4B3S L;  3J7A 5;  1GKH A;  1D7Q A;  2RHS B;  2ES2 A;  1VQF A;  4QGU A;  3RLN A;  5FJ8 H;  4JC0 A;  1X3F A;  2CWP A;  2KHJ A;  3KF8 B;  3PF5 A;  3CCE A;  3NEM A;  1PFS A;  4C3H H;  4DR3 Q;  1CKN B;  2BH8 A;  1P16 A;  1PH8 A;  1YZ6 A;  4PZ6 A;  1VQ8 A;  4JYA L;  4KLK A;  5HY6 A;  1WJJ A;  3BJU A;  3PUY A;  1PH6 A;  4UPA A;  1C0A A;  2JE6 I;  4YHH Q;  1KIX A;  5IYB G;  3AFQ A;  5IYD G;  2UUA L;  3KDF B;  1CSQ A;  3H3V I;  1KRS A;  1XPR A;  2PNH A;  4JI0 Q;  2GVB A;  3MXN B;  3GD7 A;  1V1Q A;  3T1Y L;  2CFM A;  2ZM6 L;  1HZ9 A;  3PO2 G;  1Z47 A;  4JI6 L;  3UE0 A;  5M3M G;  4HIM A;  4A3D G;  3F2C A;  2VZA A;  1HNZ L;  1Q1B A;  2JEB I;  1Y1W G;  4HJ5 A;  2V1C C;  2EXD A;  1VQJ A;  1SLJ A;  4DUZ Q;  4HJ8 A;  4B3M L;  1XMQ Q;  3I4M H;  4TQU S;  4GLA C;  4DPG A;  1W2B A;  4B3T Q;  1TWH H;  4BA1 I;  4KHP L;  4P72 A;  2NVY H;  4JBK A;  1YVC A;  1KHI A;  1LM0 A;  3KYH C;  4QY7 A;  5M5X H;  4UY8 C;  1S72 A;  1FVI A;  2XTI A;  1KRT A;  1VQC A;  1YIT A;  4GNX A;  2KCM A;  4A3F H;  2QGQ A;  1L2F A;  1MIU A;  1UE1 A;  5M5W H;  4Y52 H;  3W1G A;  1SE8 A;  3KOJ A;  4DK6 C;  4YWK A;  1S3O A;  5ELO A;  3CCQ A;  1YJ9 A;  4DR2 L;  4LF6 L;  5M3M H;  1C9O A;  3I55 A;  1XMO Q;  4LF7 L;  2HQL A;  1HNX L;  1N34 L;  3OTO L;  1AE3 A;  2YU9 H;  1Y1W H;  4BA2 I;  4JI1 Q;  2NZO A;  2F4V Q;  1U5K A;  3CCL A;  2YTX A;  4QL5 A;  3TEH B;  3HOV H;  4GNX C;  3L2P A;  1B7Y B;  1TXY A;  4OWW B;  4A3K H;  4X66 Q;  4GS3 A;  2B63 G;  2VS1 A;  2KHI A;  2VQE L;  4BXX H;  1X55 A;  4FDB A;  4IJH A;  1VQM A;  1OXS C;  1H95 A;  4MNO A;  3J81 j;  3BZC A;  4DR1 Q;  1LYL A;  4OX9 Q;  3E0E A;  3IRB A;  4PZ8 A;  4HJ9 A;  4IO9 A;  1MJE A;  2E5L L;  1PH2 A;  2JA7 G;  4P71 A;  4A75 A;  4DR6 L;  1A8V A;  1X6O A;  3H0G G;  2JA9 A;  3ERS X;  4A3J G;  2R93 H;  4A93 G;  2B29 A;  2UUC Q;  3FKI G;  4R4T A;  4L5R C;  3I7F A;  1WCM G;  1K3R A;  4MTN A;  3JAM c;  5AJ3 Q;  4X64 L;  4UP9 A;  2A19 A;  2I5L X;  1IBK L;  5J3B A;  3BU2 A;  4X62 L;  4LFA Q;  3SGI A;  2MNA A;  3G4S A;  4DV0 Q;  2BA0 A;  1YHQ A;  3A5Z B;  2D62 A;  1A0I A;  4JI7 Q;  2R7D A;  5LMN Q;  5JEA J;  1HNW L;  3M4O H;  2ID0 A;  5IE8 A;  2ZTE A;  1K83 H;  3ER0 A;  1O7I A;  1N8R C;  1R9T H;  1HH2 P;  2VQF Q;  1IBL L;  1NMG A;  4DR7 L;  1FGU A;  1QUQ B;  2UUB Q;  1G29 1;  4LF5 Q;  4NXN Q;  3M4P A;  1HZC A;  4JV5 Q;  3CC2 A;  1Q7Y C;  3H0G H;  4DR4 Q;  1CKM A;  1IZ6 A;  4IPG A;  4XTC S;  4JI8 L;  4JBW A;  4DV6 L;  3M7N A;  4A3B G;  1L1O B;  4LWC A;  4A93 H;  4B3R L;  3PUV A;  2NN6 G;  5FLM H;  3H15 A;  3JAM i;  3U4V A;  4J15 A;  4POF A;  1Q86 C;  4YWL A;  1XPU A;  3PIP A;  4LF4 Q;  4DV5 Q;  1GVP A;  2N3S A;  3PSI A;  2NVT H;  1NBW A;  4BBS G;  2CKZ B;  3I4N G;  4APV A;  1QZG A;  1GD7 A;  1BBU A;  3CP0 A;  1I94 L;  1C7Y A;  4LFB L;  2HT1 A;  3HOW H;  3PUX A;  3KF6 A;  4GKK Q;  2IHF A;  2PI2 E;  4JG2 A;  1E1T A;  2VL6 A;  1FJG Q;  3DM3 A;  3I56 A;  3CCM A;  2F3I A;  1Y1V H;  2R92 H;  4YHH L;  1J6Q A;  3F2D A;  3UDG A;  1X54 A;  2OQK A;  2WAQ G;  2HHH L;  5IP7 H;  4UP8 A;  1QZH A;  4A3B H;  2D0P A;  2Y0S E;  4LF8 Q;  3CW2 C;  1XNR L;  1KXL A;  3HKZ E;  4JI0 L;  5IP9 H;  4IFD J;  1YJN A;  4A3C H;  1XNQ Q;  4L5T A;  4JI3 L;  4YY3 Q;  2N78 A;  1X3G A;  3CXC A;  1YHA A;  4PZ7 A;  4DR5 Q;  1JB7 A;  1EFW A;  2KEN A;  2R7Z G;  3ULL A;  3AQQ A;  3I4N H;  4AYB E;  3HOY G;  2NN6 I;  2B3G A;  2DGY A;  3CCU A;  3F8T A;  4DUZ L;  2YV5 A;  4P75 A;  2VW9 A;  1FL0 A;  3H3V H;  1K9M C;  4L5S A;  1HR0 L;  3S1N H;  2WB1 G;  2IT1 A;  4OXP A;  1GO3 E;  4L5Q A;  4A76 A;  1KL9 A;  4IFD I;  2RF4 A;  4IJL A;  3Q8D A;  3CF5 A;  3I4O A;  4DUY L;  2MO1 A;  3U50 C;  2UXB Q;  1VQP A;  4JI5 Q;  3CPF A;  2VUM G;  4DAY B;  3CCV A;  2UXD L;  2CQO A;  2Y0S G;  2BH2 A;  2R7Z H;  3U58 A;  3HOY H;  1NMF A;  1YEZ A;  1Y14 B;  1CKO A;  3AYH B;  3HKZ G;  4LFC L;  4HID A;  1XMO L;  3ICE A;  3S1M H;  5C3E G;  5HGQ A;  1OTC A;  1M1K C;  4DV4 L;  3J7Z C;  1XTD A;  3GDE A;  4EX5 A;  4ALP A;  3PUZ A;  4YCV A;  2N8N A;  2UXC L;  4AYB G;  2LXK A;  5BR8 L;  1NTG A;  1Q8K A;  5GRO A;  3GTO H;  4DV2 L;  5IYB H;  4DV1 Q;  4JI4 L;  5IYD H;  1Q1E A;  4K0K L;  1VQO A;  5GAH C;  4A3G G;  2Q2H A;  2RHQ B;  3PIO A;  5GAG C;  1GM5 A;  3STB C;  4AQY Q;  1CUK A;  4WJ3 M;  4B3S Q;  3KJO A;  4KI0 A;  1V9P A;  1PH9 A;  1AH9 A;  1MKH A;  1OXX K;  4TVA B;  3TS0 A;  2R6G A;  4Y7N H;  3PO2 H;  1X56 A;  2AHO B;  3M85 A;  3G48 A;  3CMA A;  2ALY B;  2CCZ A;  1I6H H;  1VQE A;  3TRE A;  4A3D H;  4IPD A;  4A3I G;  4LF9 Q;  3S2H H;  5C3E H;  3K0X A;  3STB D;  2L15 A;  3HOZ G;  2KBN A;  4JYA Q;  1S40 A;  1ASZ A;  1OXV A;  4GLV B;  5IT9 c;  4DV0 L;  2NVX H;  1W3S A;  2FXQ A;  3S1R H;  4JI7 L;  1T9H A;  3GTM H;  5LMU L;  2UUA Q;  2UU9 L;  1VQB A;  1SR3 A;  4P73 A;  4YWM A;  3LGJ A;  3U4Z A;  5IWA L;  3D31 A;  4A3G H;  1JJG A;  4X65 L;  1X3E A;  2N49 A;  3T1Y Q;  5C0X I;  2HIX A;  5C44 G;  2ZM6 Q;  1PH5 A;  4JV5 L;  4JI6 Q;  4DR4 L;  1I3Q H;  2HIV A;  3BZK A;  4C3I H;  5M5Y H;  1VQN A;  3UDF A;  2Q2T A;  1HNZ Q;  3RN2 A;  5JEA G;  1V43 A;  3ULP A;  4O0A A;  4IPC A;  4R1J A;  4B3M Q;  3GTJ H;  3L0O A;  4LF4 L;  4LNQ A;  3HOU G;  3OYY A;  2BA1 A;  2JA8 G;  4GKJ L;  3CME A;  1EIF A;  2WAQ E;  3KJP A;  2B63 H;  1B70 B;  3L7Z C;  4GNX B;  1RIP A;  1YI2 A;  2K4K A;  4IOA A;  1UE5 A;  2GVA A;  4DNI A;  1JE5 A;  1I50 H;  4JI2 L;  3K80 C;  5C44 H;  3T1H L;  2EIF A;  3NEN A;  1LTL A;  4JCV E;  1VQ9 A;  3HKS A;  4BBR G;  2JA7 H;  4DR2 Q;  2PQA A;  4GOP A;  4A3J H;  4MZ9 A;  4LF6 Q;  4LF8 L;  3JC6 6;  2RCN A;  2QEX A;  3UE1 A;  3F2B A;  4LF7 Q;  5JJL A;  1BVS A;  1HNX Q;  3FKI H;  4DK3 C;  3OTO Q;  4NPS A;  1N34 Q;  1WCM H;  1IBM L;  1EIY B;  2JA6 G;  4DV7 L;  1JT8 A;  3E9H A;  1WI5 A;  1UEB A;  3CAM A;  2Z6K A;  1VQ4 A;  4NXM Q;  5C4X G;  1N32 Q;  1M90 C;  2GN5 A;  2K14 A;  3GTQ H;  2VQE Q;  2WB1 E;  4GOP C;  3AEV A;  2DUD A;  2K5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...