2UUCQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gua-codon in the a-site and paromomycin.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uucQ00
4BBRH 1QZHA 1VQMA 5GADC 2YV5A 2N3SA 4DV7Q 3T1YQ 1Y1VH 3PO3G 3KDFB 1PYBA 4R4IA 1C9OA 5IP7H 5IYBH 5C0XI 4GOPB 5M3FH 1AE3A 2IT1A 1N32L 5M3MH 1K0RA 2BA0A 1QUQA 2JK8A 4HIKA 1EQRA 4L5QA 3UDXA 1XMQQ 4JI7Q 4JBKA 2H5XA 1PH1A 1K9MC 1Q7YC 3TRZA 1VQBA 2WFWA 3A5UA 2UU9L 3HOVG 1TWFH 4DR4L 3U4VA 1PFSA 4BY7G 4GLXA 3I56A 2R7DA 1SE8A 4GS3A 1EYGA 4LFAQ 3GTMH 4EQ5A 4IJHA 4KHPL 4XIGS 1IBML 3KOJA 1AE2A 1PA6A 1SR3A 4X65L 4AYBE 4GNXA 1MKHA 4BXXG 2UXDQ 1VQ5A 4YCVA 1YHBA 2K52A 3U4ZA 4JCVE 5HGQA 3HOVH 2B63G 4RG1A 2XGTA 2E2HH 3D31A 4UP8A 1N32Q 4P72A 5JJLA 2GN5A 2K4KA 2VUMG 1O7IA 1NBWA 2ATWA 4DV1Q 3CC2A 5ELNA 1LM0A 1X65A 5GAGC 2ZM6Q 1GKHA 1Y1WH 1KRSA 4BY1G 3A74A 3PF5A 2UUCQ 1TWAH 4J15A 2LXKA 2RHQB 4C3JH 2I0QA 4DR4Q 2NN6I 5LMNL 1XNQQ 3PO2G 1JJ2A 1UE7A 2LXJA 2MQHA 4DUZL 2B63H 4JYAL 1IBKL 2E8GA 1VQGA 1WJJA 4YWKA 1IBMQ 1A63A 3PIPA 4IFDG 2VUMH 3I4MG 4B3RL 4A3KH 2KBNA 1Q1BA 4X65Q 4LUZA 2RCNA 4LUVA 2B3GA 4OWWB 2KENA 5JEAJ 1CSQA 3ULJA 3OYYA 2WAQE 1YITA 2NVTH 1XNRL 5C0XJ 2AHOB 2RHSB 2YU9H 2MO0A 3RZOH 4A3CH 3PO2H 1E22A 2QGQA 2NZHA 3JAMi 4JI3Q 3CPFA 3A5ZB 3W1BA 2EQSA 2E2JH 1YJNA 3I4MH 2JA6G 2VQEL 1Q82C 4DKAC 3PCOB 1Z47A 5C4XG 5FLXc 3E9HA 1VQOA 2OWOA 5LMNQ 4A3LG 2OQKA 2Z6KC 1HR0W 4JYAQ 1IBKQ 2NVXH 3ULLA 3CCQA 1MIUA 5IYCG 1YJWA 3KF8B 2JA8H 4A3FH 1NJIC 4B3MQ 4WJ3M 3PUXA 3I55A 1K8GA 2UUAL 2JA6H 4HIDA 5C4XH 1BKBA 1K73C 1N34L 1VQ8A 4PZ6A 1J5EQ 1QUQB 2Z0SA 4A3EG 4A3LH 4BBSH 2JA8G 4HJ7A 2ZJRA 2UXBL 2VNUD 4BA1I 3BZKA 3J81j 4DV5L 3K8AA 3KF6A 4P74A 3WWVA 5IYCH 4DR3L 4GKKQ 4A3IG 1S72A 1H95A 4APVA 4P71A 4C3HH 4R1JA 1X6OA 3JC66 4QIWE 1J6QA 1IBLQ 4JI0L 1HNZL 1L0WA 4YWMA 4A3EH 1VQKA 3KJOA 4A76A 4JBMA 3S1NH 4GNXB 4HIMA 4DAYB 1CKNA 4LF4L 1SLJA 2ALYB 2K14A 3MEFA 3BZCA 5FJ8G 3J7ZC 4DV3L 4X66Q 1XPRA 3GTGH 1HNWQ 1N34Q 5IP9G 2IHEA 1X56A 2PI2A 2F52A 3T1HQ 4A3IH 3RZDH 1PH2A 5FLMH 2GVBA 1M90C 5C3EG 1E24A 4PG3A 3S24A 1VS0A 1VQ6A 3KLWA 2GVAA 4A3BG 2UXBQ 4AYBG 2N49A 1HZBA 1L1OC 5IYDG 1N8RC 4GKJL 4DV5Q 1WCMG 4LFCL 2I5MX 1YHQA 3RN5A 5IWAQ 5FJ8H 1I50H 2V1CC 4R4QA 3E9IA 1D8LA 1PVOA 5IP9H 4FDBA 4DK6C 4JI0Q 2ZTCA 4AH6A 4DAMA 1HNZQ 1I6HH 4Y52H 5C3EH 1VQNA 2Y0SE 1YBYA 3M9BA 3JAMc 1NY4A 1A8VA 4C2MH 1EIYB 3I2ZA 2HQLA 3OTOL 1CSPA 3S16H 4A3BH 3D0FA 5IYDH 3CW2C 5DLQE 2KHIA 3CD6A 1P8LA 2PNHA 1E1OA 2KCMA 3NENA 1BBUA 2YTXA 1IXRA 5H1SE 1LUZA 1VQAA 1YZ6A 2IHFA 2JQOA 2MNAA 4NXML 3PIOA 2A19A 4DV6Q 2MO1A 3B6YA 4DV4Q 4GKJQ 1TWCH 1E1TA 2QA4A 1TWHH 2WAQG 5LMUL 2K50A 4IPCA 2KCTA 3M3YH 4DR6L 4JBWA 1FGUA 1PYSB 2NN6G 1X54A 2F4VL 4JOIC 2BA1A 3L0OA 3J80c 1JB7A 1EIFA 5IT9c 3LGJA 1FJGL 1LTLA 1YI2A 3HOWH 3OTOQ 3H0GH 2Q2UA 1V1QA 3RR5A 1SRUA 1N33L 3GDEA 2WB1E 4X62L 4GOPC 1E7ZA 1KIXA 1Q46A 2R7FA 1Y1WG 1R9TH 3CCVA 3GTKH 3KJPA 4NXMQ 4GN5A 3CPWA 3HKZG 3IRBA 3KF6B 4DV0L 4DR2L 4UP9A 1YIJA 3HOZH 2OCEA 3PF4A 1CUKA 2K5NA 3S15H 3TS0A 2HHHL 4MNOA 4AQYL 2CCZA 4DR6Q 4A3KG 4OX9L 4A93G 2F4VQ 1PH7A 3MXNB 4PZ7A 2R93G 2JEBI 4B3TL 1CKNB 3TEHB 5C4JH 2UU9Q 3H3VH 2VY3A 4GN4B 4A3CG 2VZAA 1FJGQ 1C0AA 3E0EA 4R4CA 4KHPQ 1XMOL 4X62Q 1KQSA 5J3BA 3UDGA 4HJAA 3CCRA 4OWXB 3OW2A 4A93H 4BA2I 1I5FA 1KC8C 4X6AH 1PH8A 2XTIA 2PQAA 2R93H 1WFQA 3F8TA 4DUYL 1X3EA 4P73A 2I5HA 2LSSA 3CMAA 1VQ4A 4AQYQ 2B29A 1GO3E 4X64L 3H3VI 3F1ZA 4OX9Q 4JC0A 4A3FG 1FL0A 1UEBA 1YVCA 4DR7L 3UDFA 4B3TQ 4LWCA 1HR0L 1AH9A 5IE8A 5LMNW 4BBSG 4DR1L 4QY7A 3U50C 1PH4A 4DUZQ 1VQ7A 1WOCA 2K5VA 1TWGH 5AJ3L 4DR5L 1Q81C 1N36L 2UXCL 4JI4L 3HOYG 2R7ZG 4B3RQ 2BH2A 1K83H 3HKZE 2Y0SG 2FXQA 4EX5A 4NB3A 3G4SA 2AWOA 5HY6A 1E3PA 4QQBX 2HIVA 3J80i 3CCSA 4JV5L 4DUYQ 3GD7A 4JI2L 3H15A 1XNRQ 3M7NA 1EFWA 3Q8DA 1VQEA 1XPUA 2K75A 4X64Q 4IOCA 2JEAI 3AEVA 3CCEA 3PUYA 1IZ6A 2CWPA 2R7ZH 3FKIH 3HOYH 4OXPA 1HZ9A 5ELOA 2VQEQ 3M4PA 4UPAA 1VQPA 2A1AA 1LYLA 1WI5A 4JI8L 1VQCA 5FLMG 4IPHA 2Q2IA 1XTDA 3GTLH 1JT8A 4LF9L 1DGSA 4A75A 4DR5Q 1N36Q 4OO1I 4IJLA 2UXCQ 3CCMA 1JJGA 1M1KC 2K5HA 1WYDA 1KHIA 2UUAQ 1Q86C 4JV5Q 4Y7NH 2UUBL 5M5YH 1TXYA 4JI2Q 2WB1G 4MZ9A 4B3SL 1S3OA 5M5XH 1V9PA 2OTLA 3PV0A 2MFIA 1ASZA 4LFBL 1QVFA 2NVYH 3L7ZC 4DV2L 4DR3Q 3S1RH 1KXLA 5JJIA 1BBWA 3EIVA 3CCJA 3RLFA 4LF6L 4TQUS 4GNXC 1VQHA 1EOVA 4H02A 2YTYA 3CQZH 3AFPA 1EWIA 1RL2A 2ZJPA 3S1QH 3S1MH 1SN8A 1HZAA 1A0IA 1VCIA 4JBJA 1IL2A 2PQAB 1HJPA 2IX1A 1PH6A 4LF4Q 3F2DA 1JMCA 4DV3Q 3CAMA 2E5LL 1K8AC 1EQQA 2VS1A 3TQYA 2L15A 2QEXA 3K80C 3UDIA 4OONA 2Z6KA 1XJVA 2JA7H 3HOWG 2N8NA 3AYHB 3PUZA 3H0GG 5GAHC 1D7QA 4LFBQ 1HZCA 3J7A5 4LFCQ 1QZGA 3S14H 1ASYA 3G6EA 3RN2A 1CKOA 3CP0A 3EN2A 3CCLA 4YCWA 4LF6Q 1N9WA 4YY3L 1NE3A 3TREA 3HKSA 3GTQH 1P16A 2HT1A 3HOZG 1QVGA 4LFAL 5GAEC 1OXXK 3M4OH 2ZTDA 2PMZE 2I5LX 4HJ8A 3M85A 1GM5A 1U0LA 5K36G 1VQFA 3GTPH 2DGYA 4PZ8A 2CQOA 4AIMA 2AWNA 3DM3A 2UXDL 2F3IA 4QJFA 3UE0A 1X3GA 4IOAA 4LNQA 4POGA 4RMFA 4JI6L 3CCUA 1VQIA 2OQ0A 1VQDA 3F2BA 1QVCA 3ZJYC 4DV1L 5LMUQ 5GQOA 2AMCB 3S17H 2ZM6L 4P75A 1KAWA 1SMXA 5GROA 4YY3Q 2UUCL 4K0KL 3A0JA 1B8AA 3CC4A 3F2CA 1UWVA 2EXDA 3PO3H 2ID0A 4A4IA 1XNQL 1NMFA 4R4OA 2RF4A 4YHHL 1JJCB 4KHZA 1SFOH 1L1OA 1KD1C 1OXTA 3SGIA 1PH5A 5IY0A 2ZJQA 1N33Q 1V43A 4HJ5A 2N78A 2JA5G 2NVQH 2NZOA 3CMEA 3PSIA 2R6GA 2OTJA 3EBEA 3G48A 4XTCS 4A3GG 1MJEA 1KL9A 3I4OA 4A3JG 4JI6Q 4BY7H 1HH2P 4DV0Q 3HOXG 1IYJB 3AQQA 4JI3L 1K3RA 4DR2Q 1PH3A 1G51A 1U5KA 2HHHQ 2BH8A 4O2DA 1C7YA 4UY8C 3ICEA 2JA5H 2EIFA 4K0KQ 2CWAA 1BVSA 4BXXH 1OTCA 1Q8KA 4A3GH 2WP8J 4YHHQ 4A3JH 2JA9A 4OWTB 3HOXH 4LF7L 4OO1G 3K7UC 4IPDA 1VQ9A 2Q2TA 1I3QH 1XMOQ 2KHJA 4B3ML 4L5SA 1YNXA 3FKIG 1OXVA 1MJCA 2VQFL 4BY1H 3W5OA 2AKWB 4GN3B 4JOIA 4DK3C 3DLLA 3U58A 1J5EL 3PUWA 1NTGA 3STBC 4A3MG 3RNUA 1OXUA 3FP9A 3J81i 4HJ9A 3HOUG 2JJQA 4KI0A 3I4NG 4GKKL 2ZTEA 3KDFA 4DR7Q 4GOPA 3VDYA 1NMGA 5BR8L 2R92G 1CKMA 1GVPA 1SROA 1IBLL 5E7NA 3CXCA 1PV4A 1PH9A 1HR0Q 1VQJA 4LF7Q 3ULPA 2YTVA 2ES2A 4ALPA 4DR1Q 2IX0A 4MTNA 4A3MH 4LF8L 1Q1EA 1KRTA 3TS2A 2IY5B 3HOUH 4DNIA 5AJ3Q 4LF5L 4NXNL 2E2IH 4JI4Q 1HNXL 1EUJA 4X66L 2DUDA 3I4NH 2VQFQ 1HNWL 5JJKA 4O0AA 1Y14B 4IO9A 1T9HA 2CFMA 2YYZA 4GLAC 3T1HL 3STBD 4IFDI 3CC7A 3AFQA 2R92H 3PUVA 4YWLA 4A3DG 4LW1A 2JE6I 3UE1A 1X3FA 1GD7A 4ME3A 4R4TA 1W2BA 1X9NA 5IWAL 3PGZA 5BR8Q 1I94L 2HIXA 2D0PA 1L1OB 4L5TA 3CF5A 4IPGA 4QL5A 3BU2A 4JI8Q 2A8VA 2C35B 3K0XA 3K7AH 4A3DH 1UE6A 4JI1L 4JI5L 4L5RC 4LUOA 4GLVB 3RLOA 1JE5A 2VW9A 1A62A 1FVIA 4LF8Q 4LF9Q 2JA7G 4LF5Q 1YJ9A 4JG2A 4NXNQ 3ER0A 2CKZB 5C44G 4TVAB 1G291 1OXSC 1RIPA 1HNXQ 3KFUA 3NBHB 1G6PA 5JEAG 2ASBA 4WJ4A 3M4QA 4KLKA 3W1GA 5C0XG 1YEZA 4HIOA 4YCUA 2UUBQ 3S2HH 2PI2E 1Z9FA 4DV7L 3T1YL 1PHJA 1UE1A 3HFZB 3G71A 2D0OA 4DV6L 4DV4L 4B3SQ 3RLNA 1UE5A 1W3SA 4C3IH 2VL6A 3BJUA 5C44H 1YHAA 1X55A 3S2DH 4UP7A 4DV2Q 3GO5A 1I94Q 1XMQL 4JI7L 4BBRG 4NPSA 3K81C 1Y1VG 3NELA 4PMWA 1S40A 5IP7G 4JI1Q 5IYBG 4JI5Q 3GTJH 1Q12A 1XPOA 5M3FG 2D62A 5M3MG 5M5WH 3L2PA 1VQLA 3J81c 1WCMH 3FHWA 4QGUA 1B7YB 3ERSX 5EAYA 4DPGA 2Q2HA 4POFA 1B70B 1L2FA 3NEMA 3I7FA 4IFDJ 2E5LQ 3GTOH 3KYHC
chains in the Genus database with same CATH superfamily
4BBRH 4DV7Q 3T1YQ 1Y1VH 2F0IA 4R4IA 5M3FH 1QNUA 2BA0A 1I4GA 5CV7A 3UDXA 1XMQQ 4JI7Q 1PTOH 2H5XA 1PH1A 2UU9L 1TWFH 1PDQA 4N9TA 3J7YW 3I56A 1SE8A 3OHXC 4LFAQ 4KHPL 1VDZA 3KOJA 2WV6D 1AE2A 2BCOA 1SR3A 4X65L 3FRPB 4C3JG 4GNXA 1MKHA 2UXDQ 3D8GA 1YHBA 2K1BA 5DEHA 2KECA 3NBHA 2F3WA 3D31A 1TIID 1SE2A 5JJLA 1O7IA 2R7ZB 2ATWA 5ELNA 1X65A 1WTOA 4HCEA 3DMUA 1GKHA 1AW7A 4RGOS 1Y1WH 1KRSA 2UUCQ 3PF5A 2RHQB 1R4PB 2NN6I 3IFTA 1EWHA 1UE7A 4ZYSA 3VR5A 1A63A 2KBNA 2D2CC 4LUZA 1ENCA 1F9PA 2A69D 3ULJA 1YITA 1XNRL 1AZPA 3RZOH 2MO0A 3PO2H 3VYUA 3A5ZB 3I4MH 2MJ8A 3KBXA 1Q82C 1Z47A 1PMRA 3K7AB 1U4MA 1VQOA 5LMNQ 3WOFA 2OQKA 1HR0W 1DOMA 3NSWA 1XWEA 1KABA 5KYLA 1YJWA 4WJWA 3TMEA 3I55A 1K8GA 5C4XH 1BKBA 2KCNA 1SYDA 2Z1CA 2L5TA 4A3LH 2JA7B 4C3IB 4BBSH 5C44B 1HTLD 1A3UA 2UXBL 4J1MA 4XXEA 3J80L 1SNPA 2QW7A 3J81j 1WTVA 3KF6A 4PNYA 2O5IC 1S72A 4K2KA 5J39A 1DOKA 1CQVA 3M4OB 1E2VA 3S1NH 2A6EC 3MXNA 4JBMA 1STGA 3BZCA 1HNWQ 4X66Q 1X3QA 4DAPA 1N34Q 3GV3A 3T4AC 2E74C 4PG3A 5M3MB 1EY7A 1VQ6A 4AYBG 2N49A 5IYDG 4BWGB 1WCMG 5IGDA 1EYAA 5FJ8H 2V1CC 2F0QA 3E9IA 1PVOA 1F2LA 5IP9H 1EQTA 4JI0Q 4Y52H 4FF1A 5AFWA 2G5DA 1VQKA 4A3BH 2NTTA 3CW2C 3TSSA 1VF7A 1V1OA 4C1NI 2PZUA 5KRUA 1BCPD 2KHSA 1CK1A 4U673 3BYTB 1LUZA 4BY7B 1EIHA 1KDAA 2PZTA 3B6YA 4GKJQ 3HGBA 2K50A 4IPCA 1WTPA 1DD2A 2F4VL 2BA1A 1JB7A 4LK1C 5IT9c 3Q23A 1LTLA 3OTOQ 1V1QA 1SRUA 5FKAC 5LL6X 3MVVA 3GDEA 4K6DA 2K5QA 4BY1B 2NVTB 1K28A 3NTHA 4X62L 5JVH3 4GOPC 1Q46A 2R7FA 1R9TH 2L4NA 2J4XA 2XWJB 4DV0L 4C1NK 1C4QA 4DR2L 4UP9A 2L0CA 3W2DA 2F03A 3R93A 2NBFA 5CBEE 1PH7A 4RHSA 1CKNB 1MSGA 2K5WA 3DWPA 3TEHB 1TKWB 4A3CG 2VZAA 3H09A 4PMCA 3E0EA 4K8IA 4DK0A 2E2IB 2JA6B 3OW2A 4X6AH 1SE4A 1I5FA 2XTIA 1F2ZA 1WFQA 4MHEA 1B2TA 2I5HA 2LSSA 4AQYQ 5FK9C 4FXDA 1Q90A 1G91A 3P7JA 4CDCC 4A3EB 2PQEA 5LMNW 2A73B 1PH4A 1H9JA 4QY7A 1VQ7A 4DUZQ 1WOCA 2K5VA 1TWGH 1N36L 2UXCL 4JI4L 2R7ZG 3VR3A 3QR8A 3RZDB 2FXQA 1RTOA 2AWOA 2FINB 2H1EA 3H15A 5IGFA 2JEAI 3AEVA 1CI3M 2CWPA 1Z7TA 4EQNA 3HOYH 5IIFA 4OXPA 1HZ9A 5ELOA 2VQEQ 5IT9E 4UPAA 2B2YC 4FXKC 2XRSD 1WI5A 2F0OA 3GTJB 1SDFA 4LF9L 2X6GA 4ME5A 1EY6A 2F0WA 2CHBD 1M1KC 2I07B 4BBRB 2K5HA 1KHIA 3TN2A 2EE1A 1STYA 1Q86C 1L0XB 1TXYA 1NNXA 5M3FB 4B3SL 1TWHB 5IODA 2JN4A 5M5XH 3M3YB 3S1RH 1PTOB 4DV2L 1ILQA 3RLFA 4TQUS 5EPLA 3KLSX 1EY9A 2B2UA 2KEDA 2PO4A 3S1QH 3BDOA 3IKJA 3S1MH 1K0SA 2WAQB 1HZAA 4JBJA 1VCIA 2PQAB 4L63B 1SE3A 4DK1A 4DV3Q 1LV9A 1HUNA 4IUVA 2L15A 3E0JA 3QO2A 4JW0A 3UDIA 4QB4A 2Z6KA 3AYHB 4FO2A 3QJYA 1Y1WB 3S14H 2MHVA 3G6EA 3CCLA 1LTSD 3OMGA 1LO5D 4RHRA 1NE3A 3TREA 5EBDA 3GTQH 1A2TA 2EYLA 5ELEA 2HT1A 3HOZG 4OL7A 2I5LX 5DM73 1MI2A 1S5DD 3K5OA 3GTPH 3NXWA 1BOSA 3VYSA 4AIMA 1WTRA 4RGMA 2MGSA 2BOSA 3PO2B 4UAIA 1RKNA 4RMFA 4JI6L 1ENAA 1GJXA 4UDUC 3BVZA 2OQ0A 3VR6A 3EJIA 4P75A 4F87A 2ENBA 4YY3Q 3A54A 1BF4A 3F2CA 3PO3H 1JWUD 5CMDA 4KN7C 3NWTA 1O7ZA 1SFOH 3EFXD 3K0YA 3PQIA 2SEBD 5CV9A 2N78A 5C4XB 1EL0A 3CMEA 2R6GA 2DJFC 3FMCA 4BBSB 2PNRC 4JI3L 4CBVA 3LX0A 1PH3A 4IUQA 1D5XC 4O2DA 3VR4A 1SYEA 4UY8C 5I9PA 2X6LA 1OTCA 4B9WA 4KN4C 4XDXA 3S1NB 1IHZA 1F9QA 2JA9A 2E2DC 3OOCA 1VQ9A 3GP7A 2VXWA 3FKIG 5KNDA 3W5OA 3I70A 1LTTD 1PZKD 3OWEB 1NTGA 2F0SA 1BBXC 3C3LA 4I7AA 3J81i 1ENFA 4OO1H 2EYHA 4GKKL 4DR7Q 4N9PA 1RCVD 2WB1B 1CKMA 1GVPA 1SROA 4OEMB 5DNFA 4ZUJA 5G3LF 3R2IA 4CJ2C 4ALPA 4DR1Q 2ES2A 1JORA 2FHTA 4ID6A 3TS2A 5CBAE 2IY5B 3E6ZX 1HPCA 1I4PA 2EYOA 5JJKA 2VQFQ 4IO9A 1QNKA 1X3PA 1Y14B 3T1HL 1F2MA 3STBD 4IFDI 3PUVA 4DU9A 4ME3A 5TSSA 1DM0B 3TP7A 1EY4A 3VYRA 2ZXPA 3D6CA 1HXYD 5BR8Q 1HQMC 1I94L 1GUSA 4K5VA 1L1OB 1I6VC 2A5HA 4QL5A 3VYTA 1ZYRC 1STEA 3K0XA 1YNJC 3K7AH 4KD3A 5ELBA 4KY5A 1SMYD 1JE5A 1PRTF 4ILWA 4LF5Q 4NXNQ 3NTKA 1HNXQ 5E1FA 4WJ4A 4CDFC 4KLKA 3W1GA 4DAVA 4YCUA 2UUBQ 3ERQA 2PI2E 4XYQA 5KNCA 1UE1A 3HFZB 4DV6L 2D0OA 2RDHA 1BDOA 1W3SA 3RLNA 4C3IH 3QOLA 2A68C 3BJUA 5C44H 5C4ZA 3GO5A 4BBRG 5C0XH 1Y1VG 3A8KE 4RGTA 5C3XA 1A3TA 5JOBA 3I3CA 5M3FG 2D62A 4TRDA 3G6JB 3L2PA 5EAYA 2Q2HA 2K03A 3NEMA 4IFDJ 4IZ8A 2E5LQ 1PTOD 5LHY1 2N3SA 3J7AV 4CDDC 5IP7H 4F88A 2IT1A 5M3MH 4FNFA 2JA5B 3DEOA 4HIKA 1EQRA 4EQPA 3KLSA 2QDBA 5EQ0A 3A5UA 3TP6A 4DR4L 1PFSA 1GHJA 4GLXA 1TWGB 2AQ2B 4CHTB 4EQ5A 4IJHA 4NMZA 1UNSA 1IBML 1TS2A 1XYIA 1ILPA 4AYBE 3H6MA 4CJ1B 4BXXG 2C9OA 2K52A 5HGQA 3D4RA 3X3MA 4P72A 3MZ5A 3HOYB 4DV1Q 5BN4A 1J9OA 2ZM6Q 3F2UA 4X3SA 2DNEA 3A74A 1FNUA 1XNQQ 1SAPA 3PO2G 3HOUB 2HCCA 1JJ2A 1LT3D 3R2TA 2E8GA 1VQGA 3A8IE 1T5XD 4YWKA 1IBKL 3I4MG 4A3KH 4DA2A 4X65Q 1FR3A 1TQOA 3ND9A 4CGYB 3MFYA 1BQQT 2RCNA 4LUVA 2NVTH 2KENA 1CSQA 2AHOB 2O4XA 1M4VA 5CGKA 3FEWX 1HA6A 2EQSA 2E2JH 4G57A 1CA5A 1RDPD 1YJNA 1EWCA 1MBYA 1LT6D 5C4XG 3PCOB 5EKKA 4A3DB 2L9HA 2OWOA 4A3LG 3S1QB 3MAQA 4G4KA 4RH6A 4IURA 3CCQA 1DONA 1MIUA 2EOTA 4B3MQ 3PUXA 2JA6H 1G8ZD 3BVMA 4IQZA 1K73C 1EYCA 4IUUA 1SSOA 2B2WC 2JA8G 4HJ7A 2VNUD 1SYGA 3BZKA 1DYQA 1EEFD 4DV5L 1QJOA 2D9UA 2N55A 2VB3X 5IT9L 5IYCH 4DR3L 2LFNA 4ZAIA 4DXGA 4XYOA 1H95A 2DN8A 1KLUD 4R1JA 5M5WB 1IBLQ 4A3EH 4KY6A 4JK1C 4GNXB 4HIMA 1SLJA 3OSOA 3MEFA 5FJ8G 1WTQA 2G9DA 5IP9G 1DCZA 2PI2A 3RZDH 1M90C 3Q0AA 4DXFA 5FLMH 4F8MA 1BCPC 2TSSA 3KLWA 4A3BG 2UXBQ 4KJNA 1N8RC 1TU2B 3NWSA 3O13A 4LFCL 1EU3A 5ELFA 3RN5A 1D8LA 2EY6A 3PO3B 4FDBA 1WTXA 4DAMA 4MTKA 2F0NA 5C3EH 1VQNA 3GTMB 3JAMc 1IKMA 2EYFA 1W6JA 3D0FA 2KHIA 1E1OA 2KCMA 3HOVB 1YZ6A 2IHFA 2MNAA 4NXML 2E2HB 1RD9D 3I4LA 2A68D 4CJ0B 4DV4Q 1TWCH 5KIXA 1TWHH 5LMUL 1AFPA 3WDNA 3M3YH 2NN6G 3OW7A 1X54A 4C56C 2QDLA 4JOIC 3D6WA 3LGJA 2JSOA 1FJGL 3HOWH 2VUMB 3H0GH 4IALA 2Q2UA 3RR5A 4P2CB 3I73A 2CH4W 2FMCA 1E7ZA 2K04A 5A35A 4GN5A 2VB2X 3KF6B 4X3UA 3IL8A 2K32A 4I7ZC 2OCEA 2RA4A 2K5NA 3S15H 2K01A 4V0BA 2HHHL 4MNOA 4OGQC 1XX8A 2F4VQ 4EVOA 3MXNB 1WTHA 2B2VC 2EJGC 2JEBI 1TS4A 4B3TL 3SR1A 4DFAA 1TS3A 5I4DA 3H3VH 2CW0D 4FP5D 2B2TA 5JPNC 4R4CA 2IJ0A 4X62Q 4H7BA 1KQSA 2MUYA 1SNOA 5J3BA 5JAVA 3CCRA 4HJAA 1ET6A 4BA2I 2EY1A 1KC8C 1JWMD 2R93H 2PW5A 4DUYL 2KQ3A 2B29A 1GO3E 1UUPA 4A3FG 1UEBA 4O42A 2F1MA 3CRKC 4LWCA 3JAME 1LTID 1HR0L 3U50C 3P75A 5AJ3L 5IGEA 4DR5L 2F0LA 3HOYG 4B3RQ 4A3IB 2Q8RE 1K83H 3HKZE 3G4SA 2XWBB 4L8JA 5HY6A 1E3PA 3HRZC 4QQBX 4I65A 3CCSA 4JI2L 1BUVT 5JVG3 2WACA 3HEJA 4TKOB 3FVQA 1XPUA 1I50B 2EZVA 3I90A 3CCEA 1BXTA 4RFBA 3MFGA 1VQCA 4IPHA 3S16B 2NWGA 4QF4A 3VA7A 1BO0A 3SK6A 1N36Q 3EROA 2UXCQ 1JICA 1JE4A 1JJGA 2UUAQ 2LY7A 1C8CA 4MZ9A 3HG9A 2HUGA 3N52A 2M2LA 2J0TD 3PV0A 2MFIA 4KKSA 1ASZA 2JP1A 2NVYH 3DUZA 5JJIA 1BBWA 1HA5A 3EIVA 4LF6L 2M00A 2YTYA 3AFPA 1A0IA 1HJPA 2RQXA 1LTRD 2IX1A 1CHPD 1PH6A 1ML0D 4LF4Q 3MC0B 1GHKA 1EQQA 1SYCA 1JC7A 2F0HA 2Z6BA 3A8JE 1D7QA 3NPPA 1GUTA 3RN2A 1CKOA 3CP0A 3EN2A 3T51B 5C4JB 1N9WA 2F0VA 5T1GA 4ZRZA 4QUCA 1CQFA 4X3TA 1QVGA 4LFAL 5GAEC 1OXXK 4A3KB 2PMZE 1T5EA 2RSNA 2B8GA 4PZ8A 5CV8A 4EQOA 1G2SA 3I72A 2UXDL 2F3IA 3UE0A 1UAPA 1X3GA 4IOAA 4HSPA 4POGA 1PLFA 2E2JB 1VQIA 2KA7A 1VQDA 3F2BA 1QVCA 5K36H 1D1IA 1EYDA 1U4PA 2DY7A 2UUCL 3A0JA 4LAAA 3CC4A 1YNND 2ID0A 3V2TA 1KNAA 2F0DA 1RF2D 1OXTA 1N33Q 2ZJQA 4ABNA 3C2PA 3FPPA 2J7ZA 5EKIA 1TT2A 4JI6Q 3WOEA 4FF3A 4F7XA 1K3RA 1SJED 3Q22A 2JYOA 1G51A 1U5KA 2BH8A 4PMBA 1C7YA 3VR2A 3ICEA 1KNEA 2JA5H 2EIFA 3G7LA 3GTLB 5EBCA 3LWEA 2KJXA 3HOXH 4OO1G 3HP3A 1MGSA 4JVZA 4RA8A 1I3QH 1XMOQ 2KHJA 4Y7NB 1OXVA 1MJCA 4PQXA 3PIP3 4DK3C 3PUWA 1LACA 3STBC 1OXUA 2AQ3B 2A6HD 5HGTA 2EDGA 3E3XA 1IYUA 1STNA 2ZTEA 3MEHA 3KDFA 4NW2A 3P20A 4RAUC 4GOPA 3CQZB 4XQJA 3NP8A 5C3EB 3QWNA 3SHLA 3U9SA 1PV4A 3TP8A 4K8JA 3ULPA 2EPBA 2IX0A 4A3MH 1ZXTA 3HOUH 2P5ZX 1SMYC 1HNWL 1EUJA 4X66L 2DUDA 4OO1I 1T9HA 3FPUB 4YWLA 4DF7A 3UE1A 1X3FA 1TWCB 1IKLA 2AQ1B 1IL8A 1PZJD 3SVMA 1S5BD 2D0PA 4IPGA 5CV6A 2K7VA 4JI8Q 1SYBA 3HOWB 4A3DH 3H0GB 4JI1L 1JR0D 4JI5L 3RLOA 1F9RA 2VW9A 1A62A 4C3IG 2JA7G 3W3AA 3ER0A 2CKZB 5C44G 1OXSC 3M4QA 5C0XG 2DJGC 1LTAD 1YEZA 2EYJA 1PTOC 2H4OA 3G71A 3S15B 4GZYC 3S17B 2AUKA 1CHQD 1X55A 2WINB 4UP7A 1EY5A 1I94Q 5JEAH 3PMFA 1L0YB 4NPSA 5IP7G 3MXPA 1Q12A 4G7HC 5EPJA 5M3MG 5M5WH 3K5MA 5JPMC 1WCMH 3FHWA 4QGUA 2HD3A 1L2FA 2K6AA 2IWHA 2B2YA 1U9RA 3KYHC 2R93B 1VQMA 3OIQA 2EXZA 3KF8A 5F2DA 1PYBA 5IYBH 5C0XI 3H3VC 1N32L 3FDTA 4XT1B 1QUQA 4L5QA 3K5NA 2M9VA 4JBKA 1CA6A 4A3GB 1K9MC 4A3JB 1Q7YC 2WFWA 4L6TB 3U4VA 4BY7G 4GS3A 1LT5D 3HZXA 1EYGA 3GTMH 1K83B 2RDGA 2ICEC 3CHBD 1PA6A 2ZT9C 2V4DA 4DAYA 3TDQA 4E6IA 1VQ5A 1U4LA 3U4ZA 4JCVE 3HOVH 2KUMA 1EZ6A 2E2HH 2NUCA 5A2QE 2GN5A 2K4KA 2NZ1D 3CC2A 3MHBA 1LM0A 2Y0SB 1AZQA 1TS5A 5IGGA 4BY1G 3LNNA 2EVBA 4J15A 2I0QA 4DR4Q 2HQEA 5CC4A 2L1BA 1C48A 2MQHA 2B63H 4DUZL 1SNDA 4JYAL 3I4NB 1WJJA 2DY8A 1IBMQ 4IFDG 2VUMH 2R92B 3AU7A 3QG1A 2XVSA 4RCOA 3K5LA 2B3GA 4LMQD 3OYYA 5C0XJ 3CKIB 4A3CH 3CU7A 2QGQA 3CPFA 1CZWA 3W1BA 2NVYB 2EYPA 3BS1A 2JA6G 2VQEL 4DKAC 1RODA 3JAML 4V190 5FLXc 3V05A 1A15A 1S5ED 4CDEC 4DNRB 2QKIC 1IBKQ 2K33A 1NSNS 2IX3A 1CM9A 1X32A 5IYCG 1NJIC 1UEAB 4HIDA 3S2HB 5E4XA 3EQLC 1VQ8A 5FOBB 4PZ6A 1J5EQ 4A3EG 2L12A 4K2LA 2QCPX 4FXGC 3S2DB 4BA1I 3K8AA 4P74A 3RD4A 2BE5D 5EJWA 4P71A 4C3HH 1J8IA 1X6OA 3JC66 4QIWE 1J6QA 2BDOA 1HNZL 2DNCA 1VMCA 1SBBB 3KJOA 4HTHA 5HURA 3BVGA 3GTOB 2ALYB 3J7ZC 3NK9A 4DV3L 5I2YA 2IHEA 1X56A 4R8NA 2F52A 5C5MA 4A3IH 2XNAC 2GVBA 5C3EG 1E24A 1VS0A 1WD0A 1L1OC 1FNVA 4DV5Q 1O78A 1YHQA 5IWAQ 1I50H 2TMPA 4QCLA 1EY8A 1PRTB 3T16A 3MWYW 4DK6C 2ZTCA 1AN8A 3QOJA 1I6HH 2F0EA 3L9AX 2Z4HA 1YBYA 3J7AF 1NY4A 4Q5VA 4C2MH 3S16H 3I2ZA 3D4DA 3SK4A 3CD6A 2PNHA 1BBUA 1O7LA 2YTXA 2Z4IA 5H1SE 3OIPA 3SE0A 2A19A 3UI2A 2MO1A 4FF2A 1E1TA 3M7GA 2QA4A 1WVLA 2WAQG 5FLXE 5ISRA 1TWAB 4DR6L 1FGUA 1TY0A 2IW3A 3L0OA 1EIFA 3NBIA 3HOXB 2WKCA 4R8IA 4MN3A 5KNBA 2CW0C 1I3QB 5D3DA 1H9RA 1LLRD 5FO8B 1Y1WG 3CCVA 4OELB 4Q0FA 3KJPA 4NXMQ 3IRBA 1STBA 2XIWA 3HOZH 1B4OA 1CUKA 3TS0A 4HCSA 1CT1D 1G2TA 4OX9L 5E3FA 2R93G 5C4JH 2UU9Q 2NVXB 2VY3A 1Y8PB 4GN4B 4A3MB 1FJGQ 4DGZA 2F0TA 5I6YA 4JPBW 1A3VA 4KHPQ 3SK5A 4A93H 4OWXB 3R8BA 4XT3B 4P73A 1WTWA 1EFID 2Z8LA 3D4WA 3DWAA 4X64L 3H3VI 3F1ZA 2K5DA 2AUJD 4JC0A 5KEEA 1STHA 1YVCA 5LL6S 4RKLA 4DR7L 3UDFA 4B3TQ 1B44D 1H9KA 2RDFA 3DXJC 3SDZA 1SYFA 1AH9A 5IE8A 4BBSG 4DR1L 4HEDA 4ZQ3A 2Z9HA 1Y8OB 5COYA 2XSCA 4B08A 2Y0SG 1SXTA 2NB0A 5CYUA 1LTGD 3J80i 4JV5L 4DUYQ 4N8X1 2X69A 3GD7A 1XNRQ 3M7NA 3DHQA 2EY2A 1EFWA 4G7OC 3ZYYX 4K5XA 1XTCD 2K75A 4LJZC 4UHVA 3PUYA 3NTIA 1IZ6A 2O5JC 3FKIH 3MXGA 2HDLA 2NYZD 5CORA 2A1AA 3L3OC 1BCPF 5I6WA 4AYBB 1XTDA 4O1NA 3GTLH 1JT8A 2R61A 1KAAA 1WCMB 4A75A 4DR5Q 2O2LD 3CCMA 1QCBD 1PXUA 2KOLA 4K14A 1I4HA 4Z9CB 4Y7NH 1LTBD 2UUBL 5M5YH 4JI2Q 2WB1G 3P1HA 2D5DA 1S3OA 4B9XA 1RHPA 3BZDB 3Q6SA 2OTLA 4LFBL 1MD2D 5KYIA 1LABA 4XQQA 3CCJA 1O80A 4GNXC 1KDCA 3CQZH 2ZJPA 1EWIA 2E76C 1JB3A 1SN8A 4NP5A 1RTNA 1IL2A 3GTKB 1PZID 1JMCA 4KMUC 2E5LL 4H0LC 4FF4A 2VS1A 1JOOA 3TQYA 4OHJA 3QB3A 5G3LD 2QEXA 2FJ2A 3LWUA 4R9WA 3PUZA 5GAHC 1AEXA 1HZCA 3J7A5 1ASYA 4LF6Q 1V1PB 4K6LA 2Q8TA 4DNTB 3RUZA 5DM63 2B63B 5C3WA 2B2WA 1YNNC 5EPKA 2LKVA 2ZTDA 5DAUA 1GM5A 5K36G 1VQFA 2DGYA 3ND8A 4ZKCB 1PRTD 4NDXA 4LNQA 2K05A 3A7LA 4YIJA 2XRQD 4DV1L 2RCFA 4CKEA 2AMCB 3S17H 2ZM6L 1SMXA 4HR7B 5ELDA 4K0KL 1B8AA 5D3IB 1UWVA 2EXDA 1XNQL 4J8QA 4CKBA 4YHHL 3SGIA 1PH5A 2XN9C 4EGVA 1V43A 3TP5A 1GUWA 2JA5G 2NVQH 3A55A 2JXMB 3EBEA 3G48A 4XTCS 2QF7A 3I4OA 1FNWA 1HH2P 3HOXG 1IYJB 3NUCA 5A2QL 4DV0Q 4DR2Q 1E2WA 4RCNA 1TY2A 3H91A 3NQIA 5IGBA 2A6HC 4C3HB 2CWAA 1BVSA 4BXXH 1Q8KA 4A3GH 1S4ZA 1H9SB 4A3JH 4OWTB 4LF7L 1B50A 1V1PA 2Q2TA 3T53B 4B3ML 1IW7D 1YNXA 1Y69U 2AKWB 4JOIA 3U58A 1B3QA 3I8ZA 2N88A 4HSVA 1EEID 4KHVA 3BG3A 4X3KA 3RNUA 4A3MG 3HOUG 3TZDA 3MA2B 2LMCB 4KI0A 3DM1A 5M9OA 3VDYA 1I6HB 1IBLL 5E7NA 3CXCA 1PH9A 5C5LA 1R4QB 1EQVA 1VQJA 4C2MB 3ONAB 4LF8L 4MTNA 1Q1EA 1SJHD 2RVLA 4DNIA 4JI4Q 3I4NH 5D14A 4O0AA 2CFMA 2F0MA 2YYZA 3C1FA 3CC7A 2B2VA 2R92H 5JJZA 4A3DG 2OEOA 4LW1A 4R4TA 1W2BA 5KGUA 3CF5A 5BN5A 3TBIB 4DN4M 5FO9B 1UE6A 4L5RC 4LF9Q 4LUOA 4GLVB 2JA8H 4MIUA 2FFKB 3KFUA 4PV1C 1G291 4TVAB 1G6PA 5JEAG 1KTKA 1H9SA 1OO9B 2QEJC 3KLRA 3S2HH 4DV7L 3T1YL 3HOZB 4B3SQ 4DV4L 2VL6A 3S2DH 1YHAA 4S3SA 4DV2Q 3K58A 2EY5A 2F0JA 1XMQL 4JI7L 3HKZB 3K81C 1HQRD 3NQTA 3NELA 1S40A 4JI1Q 5IYBG 4JI5Q 1XPOA 4TSSA 1VQLA 3J81c 2B39A 1CTMA 1HTPA 1ICFB 3ERSX 4DPGA 4A93B 1B70B 3I7FA 2F0FA 5K5PA 3GTOH 1QZHA 5GADC 1FYCA 2YV5A 2PPBC 3PO3G 3KDFB 4GOPB 1C9OA 5CV5A 1JCKB 2NTSA 1AE3A 1QB5D 5IGCA 5FLXL 1K0RA 2JK8A 2EYMA 1HFGA 2LS01 1S5FD 3TRZA 1VQBA 4ZLTF 1NAPA 3HOVG 2L11A 1FD7D 2R7DA 1SNMA 4XIGS 1B53A 1PFMA 2NN6H 2ZXRA 1Z6HA 2F0PA 1QWYA 3A7AB 4YCVA 3AB9A 2OF1A 4H13C 2B63G 4RG1A 2PYKA 2XGTA 2RBMA 3DWQA 1N32Q 4UP8A 5IOCA 2VUMG 3KUPA 1NBWA 3FKIB 3CRLC 5E4WC 2RSOA 5GAGC 2RKSA 1TWAH 1JOQA 2LXKA 1GOZA 4C3JH 5LMNL 2LXJA 2Q8IB 1D5ZC 3PIPA 2K28A 4B3RL 4HAEA 1Q1BA 3OMCA 5M5YB 3R3OA 4OWWB 5JEAJ 2B2UC 1JQYD 2F0UA 2WAQE 2RHSB 5BN3A 2OT2A 2YU9H 4IN3A 2ICIA 1E22A 4WORA 2NZHA 3JAMi 4JI3Q 3T56B 1IYVA 2EJMA 2PMZB 1JOKA 1SNQA 3E9HA 2BE5C 3J81E 3V96A 2Z6KC 4JYAQ 3ITPA 2NVXH 3ULLA 3KF8B 4A3FH 4WJ3M 1DZ1A 2UUAL 4C3HG 1N34L 1QUQB 3K57A 2Z0SA 2QILA 1SNCA 1WD1A 2ZJRA 3D3RA 3WWVA 3SXHA 4GKKQ 4A3IG 1GUOA 1NR4A 4APVA 1PTOF 1RJTA 4JI0L 1L0WA 4YWMA 1Q3LA 3MXUA 4A76A 4QUFA 3AMUA 4ULLA 4DAYB 1CKNA 4LF4L 1W6KA 2K14A 3GTGH 1K8OA 1XPRA 1XXGA 1Y1VB 3T1HQ 1PH2A 1F2YA 3S24A 1NCVA 2GVAA 1HZBA 4GKJL 2I5MX 1EU4A 3I91A 4R4QA 1Q8IA 1TWFB 3T13A 1F77A 3IFDA 2A6ED 4AH6A 1D5MC 1HNZQ 3OPOA 1A6XA 2Y0SE 1PFNA 3M9BA 1A8VA 1EIYB 1O7YA 2HQLA 3OTOL 1CSPA 3E5SA 2BDNA 5IYDH 5DLQE 2NVQB 1P8LA 3NENA 4RKBA 1IXRA 4KY7A 1VQAA 2JQOA 1H9MA 3PIOA 3DEPA 4DV6Q 1TVXA 5D65A 1LT4D 3PIO3 1NR2A 2KCTA 3EVQA 4JBWA 1PYSB 2A74C 5J1ZA 4ZUIA 3J80c 3MTSA 3A56A 2FMMA 4KKTA 2SNSA 1YI2A 1N33L 2WB1E 1U4RA 4HMIA 1DXMA 3GTKH 1KIXA 1BNZA 4U68A 2EJFC 3RZOB 3CPWA 3HKZG 4OIJA 2CVRA 1YIJA 3PF4A 3I4MB 2KEEA 4AQYL 2CCZA 4DR6Q 4A3KG 4A93G 1BR9A 2WIIB 3HS0C 1QILA 4PZ7A 4RGNA 1VF5C 4IUTA 1C0AA 3K6OA 2KVMA 1K3BC 5I9OA 3RMHA 1XMOL 5CR3A 3UDGA 1ICWA 1PH8A 2PQAA 3KBGA 3F8TA 2R3ZA 1ESRA 3U9OA 1G6ZA 1X3EA 4M1UB 3CMAA 2HCIA 2SNMA 1VQ4A 2GA4B 4KKUA 1B9NA 4OX9Q 1FL0A 5NUCA 2JA8B 1AP0A 1QOHA 2IPKD 1Q81C 2BH2A 4RWSC 4EX5A 4NB3A 1D6EC 3BDCA 2HIVA 1HUMA 3Q8DA 1MHWC 1VQEA 4X64Q 4IOCA 1EIGA 3J80E 4K5WA 2R7ZH 3M4PA 1VQPA 1FGBD 1LYLA 1ONLA 4JI8L 5FLMG 2PCFB 2Q2IA 4A3BB 1DGSA 4OIKA 1JWSD 4IJLA 2I46A 3URYA 1WYDA 4JV5Q 2E75C 2F4IA 5I2XA 1DOLA 1ET9A 1V9PA 3QIAA 4HN7A 1QVFA 2SOBA 1EOTA 3L7ZC 4DR3Q 1KXLA 1VQHA 1EOVA 4H02A 2IL8A 1SEBD 3K59A 1RL2A 3X3NA 1R9TB 2CH4A 3F2DA 3CAMA 1K8AC 3GQBA 3SK8A 1CZGA 4J6HA 3K80C 4WRDA 4OONA 3VA5A 4ODGA 3EA6A 1XJVA 3OWFA 2JA7H 2N8NA 3HOWG 3H0GG 1PRTC 4LFBQ 4H44C 4LFCQ 4NKLA 1QZGA 1STAA 1KLGD 1MSHA 4C3JB 4YCWA 4YY3L 3C46A 1D1KA 3HKSA 4XQNA 1P16A 1VMPA 2MP1A 1NUCA 3M4OH 4HJ8A 3M85A 1U0LA 2CQOA 2AWNA 3DM3A 1B9MA 2YU9B 2WKDA 4QJFA 3SEBA 3NHHA 2PW7A 5EGTA 3CCUA 4QIWB 3IAYA 3GV6A 4ZCKA 3ZJYC 1E2ZA 5LMUQ 5GQOA 1KAWA 5GROA 4ZK9B 4A4IA 1NMFA 1ZEQX 4R4OA 2RF4A 1K8MA 1JJCB 4KHZA 1I4RA 4ZKBB 1L1OA 1KD1C 4A3FB 2PZWA 5IY0A 3C1EA 4HJ5A 4HMJA 3TZUA 2NZOA 4QMGA 5L37A 1HCZA 3PSIA 1ZKOA 2OTJA 1V8QA 4A3GG 1IW7C 1MJEA 1KL9A 4A3JG 2A69C 4BY7H 3AQQA 4CKCA 1I4QA 3KK7A 2HHHQ 4N8FA 2CQAA 4K0KQ 4KK7A 4G7ZC 3BDLA 2WP8J 4YHHQ 1PYWD 3K7UC 4IPDA 3GTGB 1PFBA 4L5SA 5FO7B 2VQFL 4BY1H 1D2BA 4GN3B 2KCCA 3DLLA 1J5EL 1EZ8A 5M5XB 4WFN3 4KJOA 2G9HD 3S1RB 3FP9A 3S9WA 2MPMA 4HJ9A 3NE5B 4KTAA 2JJQA 4IFDH 3I4NG 4KD4A 4M8AA 1NMGA 5BR8L 2R92G 3J81L 3S1MB 4IUNA 4BS9A 2F3VA 1HR0Q 5ELCA 1I4XA 3M4YA 4LF7Q 2YTVA 1KRTA 5AJ3Q 4LF5L 4NXNL 2E2IH 1HNXL 1EY0A 4IUPA 4FYDA 4GLAC 2B8FA 1ESFA 3AFQA 2F0GA 2JE6I 5C6AA 1GD7A 2OXPA 1TR5A 3S14B 1X9NA 1BCPB 1HRJA 5IWAL 3PGZA 5C4HA 3GTQB 5T1IA 2HIXA 4L5TA 1F9SA 3BU2A 2F0KA 2A8VA 2C35B 2ZXOA 4LF8Q 1B1ZA 1FVIA 1YJ9A 1CFMA 1M8AA 1QE6A 3N6RA 4JG2A 3Q24A 1QG7A 1RIPA 3GTPB 5EKLA 3BYYB 3NBHB 4KV6A 2ASBA 2SDFA 4HIOA 1KDBA 1Z9FA 1E0BA 1PHJA 5J22A 1UE5A 1Y8NB 2B2TC 2HDMA 3H94A 5CV4A 4FVMA 1HFNA 1HHVA 1ZYRD 1GUNA 1YNJD 1GUGA 1A2UA 1SFOB 4PMWA 1II3A 3GTJH 2C5CA 1DJRD 2L55A 1B7YB 1GXDC 4POFA 1B3AA 1S5CD
chains in the Genus database with same CATH topology
4BBRH 1QZHA 1VQMA 5GADC 2YV5A 2N3SA 4DV7Q 3T1YQ 1Y1VH 3PO3G 3KDFB 1PYBA 4R4IA 1C9OA 5IP7H 5IYBH 5C0XI 4GOPB 5M3FH 1AE3A 2IT1A 1N32L 5M3MH 1K0RA 2BA0A 1QUQA 2JK8A 4HIKA 1EQRA 4L5QA 3UDXA 1XMQQ 4JI7Q 4JBKA 2H5XA 1PH1A 1K9MC 1Q7YC 3TRZA 1VQBA 2WFWA 3A5UA 2UU9L 3HOVG 1TWFH 4DR4L 3U4VA 1PFSA 4BY7G 4GLXA 3I56A 2R7DA 1SE8A 4GS3A 1EYGA 4LFAQ 3GTMH 4EQ5A 4IJHA 4KHPL 4XIGS 1IBML 3KOJA 1AE2A 1PA6A 1SR3A 4X65L 4AYBE 4GNXA 1MKHA 4BXXG 2UXDQ 1VQ5A 4YCVA 1YHBA 2K52A 3U4ZA 4JCVE 5HGQA 3HOVH 2B63G 4RG1A 2XGTA 2E2HH 3D31A 4UP8A 1N32Q 4P72A 5JJLA 2GN5A 2K4KA 2VUMG 1O7IA 1NBWA 2ATWA 4DV1Q 3CC2A 5ELNA 1LM0A 1X65A 5GAGC 2ZM6Q 1GKHA 1Y1WH 1KRSA 4BY1G 3A74A 3PF5A 2UUCQ 1TWAH 4J15A 2LXKA 2RHQB 4C3JH 2I0QA 4DR4Q 2NN6I 5LMNL 1XNQQ 3PO2G 1JJ2A 1UE7A 2LXJA 2MQHA 4DUZL 2B63H 4JYAL 1IBKL 2E8GA 1VQGA 1WJJA 4YWKA 1IBMQ 1A63A 3PIPA 4IFDG 2VUMH 3I4MG 4B3RL 4A3KH 2KBNA 1Q1BA 4X65Q 4LUZA 2RCNA 4LUVA 2B3GA 4OWWB 2KENA 5JEAJ 1CSQA 3ULJA 3OYYA 2WAQE 1YITA 2NVTH 1XNRL 5C0XJ 2AHOB 2RHSB 2YU9H 2MO0A 3RZOH 4A3CH 3PO2H 1E22A 2QGQA 2NZHA 3JAMi 4JI3Q 3CPFA 3A5ZB 3W1BA 2EQSA 2E2JH 1YJNA 3I4MH 2JA6G 2VQEL 1Q82C 4DKAC 3PCOB 1Z47A 5C4XG 5FLXc 3E9HA 1VQOA 2OWOA 5LMNQ 4A3LG 2OQKA 2Z6KC 1HR0W 4JYAQ 1IBKQ 2NVXH 3ULLA 3CCQA 1MIUA 5IYCG 1YJWA 3KF8B 2JA8H 4A3FH 1NJIC 4B3MQ 4WJ3M 3PUXA 3I55A 1K8GA 2UUAL 2JA6H 4HIDA 5C4XH 1BKBA 1K73C 1N34L 1VQ8A 4PZ6A 1J5EQ 1QUQB 2Z0SA 4A3EG 4A3LH 4BBSH 2JA8G 4HJ7A 2ZJRA 2UXBL 2VNUD 4BA1I 3BZKA 3J81j 4DV5L 3K8AA 3KF6A 4P74A 3WWVA 5IYCH 4DR3L 4GKKQ 4A3IG 1S72A 1H95A 4APVA 4P71A 4C3HH 4R1JA 1X6OA 3JC66 4QIWE 1J6QA 1IBLQ 4JI0L 1HNZL 1L0WA 4YWMA 4A3EH 1VQKA 3KJOA 4A76A 4JBMA 3S1NH 4GNXB 4HIMA 4DAYB 1CKNA 4LF4L 1SLJA 2ALYB 2K14A 3MEFA 3BZCA 5FJ8G 3J7ZC 4DV3L 4X66Q 1XPRA 3GTGH 1HNWQ 1N34Q 5IP9G 2IHEA 1X56A 2PI2A 2F52A 3T1HQ 4A3IH 3RZDH 1PH2A 5FLMH 2GVBA 1M90C 5C3EG 1E24A 4PG3A 3S24A 1VS0A 1VQ6A 3KLWA 2GVAA 4A3BG 2UXBQ 4AYBG 2N49A 1HZBA 1L1OC 5IYDG 1N8RC 4GKJL 4DV5Q 1WCMG 4LFCL 2I5MX 1YHQA 3RN5A 5IWAQ 5FJ8H 1I50H 2V1CC 4R4QA 3E9IA 1D8LA 1PVOA 5IP9H 4FDBA 4DK6C 4JI0Q 2ZTCA 4AH6A 4DAMA 1HNZQ 1I6HH 4Y52H 5C3EH 1VQNA 2Y0SE 1YBYA 3M9BA 3JAMc 1NY4A 1A8VA 4C2MH 1EIYB 3I2ZA 2HQLA 3OTOL 1CSPA 3S16H 4A3BH 3D0FA 5IYDH 3CW2C 5DLQE 2KHIA 3CD6A 1P8LA 2PNHA 1E1OA 2KCMA 3NENA 1BBUA 2YTXA 1IXRA 5H1SE 1LUZA 1VQAA 1YZ6A 2IHFA 2JQOA 2MNAA 4NXML 3PIOA 2A19A 4DV6Q 2MO1A 3B6YA 4DV4Q 4GKJQ 1TWCH 1E1TA 2QA4A 1TWHH 2WAQG 5LMUL 2K50A 4IPCA 2KCTA 3M3YH 4DR6L 4JBWA 1FGUA 1PYSB 2NN6G 1X54A 2F4VL 4JOIC 2BA1A 3L0OA 3J80c 1JB7A 1EIFA 5IT9c 3LGJA 1FJGL 1LTLA 1YI2A 3HOWH 3OTOQ 3H0GH 2Q2UA 1V1QA 3RR5A 1SRUA 1N33L 3GDEA 2WB1E 4X62L 4GOPC 1E7ZA 1KIXA 1Q46A 2R7FA 1Y1WG 1R9TH 3CCVA 3GTKH 3KJPA 4NXMQ 4GN5A 3CPWA 3HKZG 3IRBA 3KF6B 4DV0L 4DR2L 4UP9A 1YIJA 3HOZH 2OCEA 3PF4A 1CUKA 2K5NA 3S15H 3TS0A 2HHHL 4MNOA 4AQYL 2CCZA 4DR6Q 4A3KG 4OX9L 4A93G 2F4VQ 1PH7A 3MXNB 4PZ7A 2R93G 2JEBI 4B3TL 1CKNB 3TEHB 5C4JH 2UU9Q 3H3VH 2VY3A 4GN4B 4A3CG 2VZAA 1FJGQ 1C0AA 3E0EA 4R4CA 4KHPQ 1XMOL 4X62Q 1KQSA 5J3BA 3UDGA 4HJAA 3CCRA 4OWXB 3OW2A 4A93H 4BA2I 1I5FA 1KC8C 4X6AH 1PH8A 2XTIA 2PQAA 2R93H 1WFQA 3F8TA 4DUYL 1X3EA 4P73A 2I5HA 2LSSA 3CMAA 1VQ4A 4AQYQ 2B29A 1GO3E 4X64L 3H3VI 3F1ZA 4OX9Q 4JC0A 4A3FG 1FL0A 1UEBA 1YVCA 4DR7L 3UDFA 4B3TQ 4LWCA 1HR0L 1AH9A 5IE8A 5LMNW 4BBSG 4DR1L 4QY7A 3U50C 1PH4A 4DUZQ 1VQ7A 1WOCA 2K5VA 1TWGH 5AJ3L 4DR5L 1Q81C 1N36L 2UXCL 4JI4L 3HOYG 2R7ZG 4B3RQ 2BH2A 1K83H 3HKZE 2Y0SG 2FXQA 4EX5A 4NB3A 3G4SA 2AWOA 5HY6A 1E3PA 4QQBX 2HIVA 3J80i 3CCSA 4JV5L 4DUYQ 3GD7A 4JI2L 3H15A 1XNRQ 3M7NA 1EFWA 3Q8DA 1VQEA 1XPUA 2K75A 4X64Q 4IOCA 2JEAI 3AEVA 3CCEA 3PUYA 1IZ6A 2CWPA 2R7ZH 3FKIH 3HOYH 4OXPA 1HZ9A 5ELOA 2VQEQ 3M4PA 4UPAA 1VQPA 2A1AA 1LYLA 1WI5A 4JI8L 1VQCA 5FLMG 4IPHA 2Q2IA 1XTDA 3GTLH 1JT8A 4LF9L 1DGSA 4A75A 4DR5Q 1N36Q 4OO1I 4IJLA 2UXCQ 3CCMA 1JJGA 1M1KC 2K5HA 1WYDA 1KHIA 2UUAQ 1Q86C 4JV5Q 4Y7NH 2UUBL 5M5YH 1TXYA 4JI2Q 2WB1G 4MZ9A 4B3SL 1S3OA 5M5XH 1V9PA 2OTLA 3PV0A 2MFIA 1ASZA 4LFBL 1QVFA 2NVYH 3L7ZC 4DV2L 4DR3Q 3S1RH 1KXLA 5JJIA 1BBWA 3EIVA 3CCJA 3RLFA 4LF6L 4TQUS 4GNXC 1VQHA 1EOVA 4H02A 2YTYA 3CQZH 3AFPA 1EWIA 1RL2A 2ZJPA 3S1QH 3S1MH 1SN8A 1HZAA 1A0IA 1VCIA 4JBJA 1IL2A 2PQAB 1HJPA 2IX1A 1PH6A 4LF4Q 3F2DA 1JMCA 4DV3Q 3CAMA 2E5LL 1K8AC 1EQQA 2VS1A 3TQYA 2L15A 2QEXA 3K80C 3UDIA 4OONA 2Z6KA 1XJVA 2JA7H 3HOWG 2N8NA 3AYHB 3PUZA 3H0GG 5GAHC 1D7QA 4LFBQ 1HZCA 3J7A5 4LFCQ 1QZGA 3S14H 1ASYA 3G6EA 3RN2A 1CKOA 3CP0A 3EN2A 3CCLA 4YCWA 4LF6Q 1N9WA 4YY3L 1NE3A 3TREA 3HKSA 3GTQH 1P16A 2HT1A 3HOZG 1QVGA 4LFAL 5GAEC 1OXXK 3M4OH 2ZTDA 2PMZE 2I5LX 4HJ8A 3M85A 1GM5A 1U0LA 5K36G 1VQFA 3GTPH 2DGYA 4PZ8A 2CQOA 4AIMA 2AWNA 3DM3A 2UXDL 2F3IA 4QJFA 3UE0A 1X3GA 4IOAA 4LNQA 4POGA 4RMFA 4JI6L 3CCUA 1VQIA 2OQ0A 1VQDA 3F2BA 1QVCA 3ZJYC 4DV1L 5LMUQ 5GQOA 2AMCB 3S17H 2ZM6L 4P75A 1KAWA 1SMXA 5GROA 4YY3Q 2UUCL 4K0KL 3A0JA 1B8AA 3CC4A 3F2CA 1UWVA 2EXDA 3PO3H 2ID0A 4A4IA 1XNQL 1NMFA 4R4OA 2RF4A 4YHHL 1JJCB 4KHZA 1SFOH 1L1OA 1KD1C 1OXTA 3SGIA 1PH5A 5IY0A 2ZJQA 1N33Q 1V43A 4HJ5A 2N78A 2JA5G 2NVQH 2NZOA 3CMEA 3PSIA 2R6GA 2OTJA 3EBEA 3G48A 4XTCS 4A3GG 1MJEA 1KL9A 3I4OA 4A3JG 4JI6Q 4BY7H 1HH2P 4DV0Q 3HOXG 1IYJB 3AQQA 4JI3L 1K3RA 4DR2Q 1PH3A 1G51A 1U5KA 2HHHQ 2BH8A 4O2DA 1C7YA 4UY8C 3ICEA 2JA5H 2EIFA 4K0KQ 2CWAA 1BVSA 4BXXH 1OTCA 1Q8KA 4A3GH 2WP8J 4YHHQ 4A3JH 2JA9A 4OWTB 3HOXH 4LF7L 4OO1G 3K7UC 4IPDA 1VQ9A 2Q2TA 1I3QH 1XMOQ 2KHJA 4B3ML 4L5SA 1YNXA 3FKIG 1OXVA 1MJCA 2VQFL 4BY1H 3W5OA 2AKWB 4GN3B 4JOIA 4DK3C 3DLLA 3U58A 1J5EL 3PUWA 1NTGA 3STBC 4A3MG 3RNUA 1OXUA 3FP9A 3J81i 4HJ9A 3HOUG 2JJQA 4KI0A 3I4NG 4GKKL 2ZTEA 3KDFA 4DR7Q 4GOPA 3VDYA 1NMGA 5BR8L 2R92G 1CKMA 1GVPA 1SROA 1IBLL 5E7NA 3CXCA 1PV4A 1PH9A 1HR0Q 1VQJA 4LF7Q 3ULPA 2YTVA 2ES2A 4ALPA 4DR1Q 2IX0A 4MTNA 4A3MH 4LF8L 1Q1EA 1KRTA 3TS2A 2IY5B 3HOUH 4DNIA 5AJ3Q 4LF5L 4NXNL 2E2IH 4JI4Q 1HNXL 1EUJA 4X66L 2DUDA 3I4NH 2VQFQ 1HNWL 5JJKA 4O0AA 1Y14B 4IO9A 1T9HA 2CFMA 2YYZA 4GLAC 3T1HL 3STBD 4IFDI 3CC7A 3AFQA 2R92H 3PUVA 4YWLA 4A3DG 4LW1A 2JE6I 3UE1A 1X3FA 1GD7A 4ME3A 4R4TA 1W2BA 1X9NA 5IWAL 3PGZA 5BR8Q 1I94L 2HIXA 2D0PA 1L1OB 4L5TA 3CF5A 4IPGA 4QL5A 3BU2A 4JI8Q 2A8VA 2C35B 3K0XA 3K7AH 4A3DH 1UE6A 4JI1L 4JI5L 4L5RC 4LUOA 4GLVB 3RLOA 1JE5A 2VW9A 1A62A 1FVIA 4LF8Q 4LF9Q 2JA7G 4LF5Q 1YJ9A 4JG2A 4NXNQ 3ER0A 2CKZB 5C44G 4TVAB 1G291 1OXSC 1RIPA 1HNXQ 3KFUA 3NBHB 1G6PA 5JEAG 2ASBA 4WJ4A 3M4QA 4KLKA 3W1GA 5C0XG 1YEZA 4HIOA 4YCUA 2UUBQ 3S2HH 2PI2E 1Z9FA 4DV7L 3T1YL 1PHJA 1UE1A 3HFZB 3G71A 2D0OA 4DV6L 4DV4L 4B3SQ 3RLNA 1UE5A 1W3SA 4C3IH 2VL6A 3BJUA 5C44H 1YHAA 1X55A 3S2DH 4UP7A 4DV2Q 3GO5A 1I94Q 1XMQL 4JI7L 4BBRG 4NPSA 3K81C 1Y1VG 3NELA 4PMWA 1S40A 5IP7G 4JI1Q 5IYBG 4JI5Q 3GTJH 1Q12A 1XPOA 5M3FG 2D62A 5M3MG 5M5WH 3L2PA 1VQLA 3J81c 1WCMH 3FHWA 4QGUA 1B7YB 3ERSX 5EAYA 4DPGA 2Q2HA 4POFA 1B70B 1L2FA 3NEMA 3I7FA 4IFDJ 2E5LQ 3GTOH 3KYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBR H;  1QZH A;  1VQM A;  5GAD C;  2YV5 A;  2N3S A;  4DV7 Q;  3T1Y Q;  1Y1V H;  3PO3 G;  3KDF B;  1PYB A;  4R4I A;  1C9O A;  5IP7 H;  5IYB H;  5C0X I;  4GOP B;  5M3F H;  1AE3 A;  2IT1 A;  1N32 L;  5M3M H;  1K0R A;  2BA0 A;  1QUQ A;  2JK8 A;  4HIK A;  1EQR A;  4L5Q A;  3UDX A;  1XMQ Q;  4JI7 Q;  4JBK A;  2H5X A;  1PH1 A;  1K9M C;  1Q7Y C;  3TRZ A;  1VQB A;  2WFW A;  3A5U A;  2UU9 L;  3HOV G;  1TWF H;  4DR4 L;  3U4V A;  1PFS A;  4BY7 G;  4GLX A;  3I56 A;  2R7D A;  1SE8 A;  4GS3 A;  1EYG A;  4LFA Q;  3GTM H;  4EQ5 A;  4IJH A;  4KHP L;  4XIG S;  1IBM L;  3KOJ A;  1AE2 A;  1PA6 A;  1SR3 A;  4X65 L;  4AYB E;  4GNX A;  1MKH A;  4BXX G;  2UXD Q;  1VQ5 A;  4YCV A;  1YHB A;  2K52 A;  3U4Z A;  4JCV E;  5HGQ A;  3HOV H;  2B63 G;  4RG1 A;  2XGT A;  2E2H H;  3D31 A;  4UP8 A;  1N32 Q;  4P72 A;  5JJL A;  2GN5 A;  2K4K A;  2VUM G;  1O7I A;  1NBW A;  2ATW A;  4DV1 Q;  3CC2 A;  5ELN A;  1LM0 A;  1X65 A;  5GAG C;  2ZM6 Q;  1GKH A;  1Y1W H;  1KRS A;  4BY1 G;  3A74 A;  3PF5 A;  2UUC Q;  1TWA H;  4J15 A;  2LXK A;  2RHQ B;  4C3J H;  2I0Q A;  4DR4 Q;  2NN6 I;  5LMN L;  1XNQ Q;  3PO2 G;  1JJ2 A;  1UE7 A;  2LXJ A;  2MQH A;  4DUZ L;  2B63 H;  4JYA L;  1IBK L;  2E8G A;  1VQG A;  1WJJ A;  4YWK A;  1IBM Q;  1A63 A;  3PIP A;  4IFD G;  2VUM H;  3I4M G;  4B3R L;  4A3K H;  2KBN A;  1Q1B A;  4X65 Q;  4LUZ A;  2RCN A;  4LUV A;  2B3G A;  4OWW B;  2KEN A;  5JEA J;  1CSQ A;  3ULJ A;  3OYY A;  2WAQ E;  1YIT A;  2NVT H;  1XNR L;  5C0X J;  2AHO B;  2RHS B;  2YU9 H;  2MO0 A;  3RZO H;  4A3C H;  3PO2 H;  1E22 A;  2QGQ A;  2NZH A;  3JAM i;  4JI3 Q;  3CPF A;  3A5Z B;  3W1B A;  2EQS A;  2E2J H;  1YJN A;  3I4M H;  2JA6 G;  2VQE L;  1Q82 C;  4DKA C;  3PCO B;  1Z47 A;  5C4X G;  5FLX c;  3E9H A;  1VQO A;  2OWO A;  5LMN Q;  4A3L G;  2OQK A;  2Z6K C;  1HR0 W;  4JYA Q;  1IBK Q;  2NVX H;  3ULL A;  3CCQ A;  1MIU A;  5IYC G;  1YJW A;  3KF8 B;  2JA8 H;  4A3F H;  1NJI C;  4B3M Q;  4WJ3 M;  3PUX A;  3I55 A;  1K8G A;  2UUA L;  2JA6 H;  4HID A;  5C4X H;  1BKB A;  1K73 C;  1N34 L;  1VQ8 A;  4PZ6 A;  1J5E Q;  1QUQ B;  2Z0S A;  4A3E G;  4A3L H;  4BBS H;  2JA8 G;  4HJ7 A;  2ZJR A;  2UXB L;  2VNU D;  4BA1 I;  3BZK A;  3J81 j;  4DV5 L;  3K8A A;  3KF6 A;  4P74 A;  3WWV A;  5IYC H;  4DR3 L;  4GKK Q;  4A3I G;  1S72 A;  1H95 A;  4APV A;  4P71 A;  4C3H H;  4R1J A;  1X6O A;  3JC6 6;  4QIW E;  1J6Q A;  1IBL Q;  4JI0 L;  1HNZ L;  1L0W A;  4YWM A;  4A3E H;  1VQK A;  3KJO A;  4A76 A;  4JBM A;  3S1N H;  4GNX B;  4HIM A;  4DAY B;  1CKN A;  4LF4 L;  1SLJ A;  2ALY B;  2K14 A;  3MEF A;  3BZC A;  5FJ8 G;  3J7Z C;  4DV3 L;  4X66 Q;  1XPR A;  3GTG H;  1HNW Q;  1N34 Q;  5IP9 G;  2IHE A;  1X56 A;  2PI2 A;  2F52 A;  3T1H Q;  4A3I H;  3RZD H;  1PH2 A;  5FLM H;  2GVB A;  1M90 C;  5C3E G;  1E24 A;  4PG3 A;  3S24 A;  1VS0 A;  1VQ6 A;  3KLW A;  2GVA A;  4A3B G;  2UXB Q;  4AYB G;  2N49 A;  1HZB A;  1L1O C;  5IYD G;  1N8R C;  4GKJ L;  4DV5 Q;  1WCM G;  4LFC L;  2I5M X;  1YHQ A;  3RN5 A;  5IWA Q;  5FJ8 H;  1I50 H;  2V1C C;  4R4Q A;  3E9I A;  1D8L A;  1PVO A;  5IP9 H;  4FDB A;  4DK6 C;  4JI0 Q;  2ZTC A;  4AH6 A;  4DAM A;  1HNZ Q;  1I6H H;  4Y52 H;  5C3E H;  1VQN A;  2Y0S E;  1YBY A;  3M9B A;  3JAM c;  1NY4 A;  1A8V A;  4C2M H;  1EIY B;  3I2Z A;  2HQL A;  3OTO L;  1CSP A;  3S16 H;  4A3B H;  3D0F A;  5IYD H;  3CW2 C;  5DLQ E;  2KHI A;  3CD6 A;  1P8L A;  2PNH A;  1E1O A;  2KCM A;  3NEN A;  1BBU A;  2YTX A;  1IXR A;  5H1S E;  1LUZ A;  1VQA A;  1YZ6 A;  2IHF A;  2JQO A;  2MNA A;  4NXM L;  3PIO A;  2A19 A;  4DV6 Q;  2MO1 A;  3B6Y A;  4DV4 Q;  4GKJ Q;  1TWC H;  1E1T A;  2QA4 A;  1TWH H;  2WAQ G;  5LMU L;  2K50 A;  4IPC A;  2KCT A;  3M3Y H;  4DR6 L;  4JBW A;  1FGU A;  1PYS B;  2NN6 G;  1X54 A;  2F4V L;  4JOI C;  2BA1 A;  3L0O A;  3J80 c;  1JB7 A;  1EIF A;  5IT9 c;  3LGJ A;  1FJG L;  1LTL A;  1YI2 A;  3HOW H;  3OTO Q;  3H0G H;  2Q2U A;  1V1Q A;  3RR5 A;  1SRU A;  1N33 L;  3GDE A;  2WB1 E;  4X62 L;  4GOP C;  1E7Z A;  1KIX A;  1Q46 A;  2R7F A;  1Y1W G;  1R9T H;  3CCV A;  3GTK H;  3KJP A;  4NXM Q;  4GN5 A;  3CPW A;  3HKZ G;  3IRB A;  3KF6 B;  4DV0 L;  4DR2 L;  4UP9 A;  1YIJ A;  3HOZ H;  2OCE A;  3PF4 A;  1CUK A;  2K5N A;  3S15 H;  3TS0 A;  2HHH L;  4MNO A;  4AQY L;  2CCZ A;  4DR6 Q;  4A3K G;  4OX9 L;  4A93 G;  2F4V Q;  1PH7 A;  3MXN B;  4PZ7 A;  2R93 G;  2JEB I;  4B3T L;  1CKN B;  3TEH B;  5C4J H;  2UU9 Q;  3H3V H;  2VY3 A;  4GN4 B;  4A3C G;  2VZA A;  1FJG Q;  1C0A A;  3E0E A;  4R4C A;  4KHP Q;  1XMO L;  4X62 Q;  1KQS A;  5J3B A;  3UDG A;  4HJA A;  3CCR A;  4OWX B;  3OW2 A;  4A93 H;  4BA2 I;  1I5F A;  1KC8 C;  4X6A H;  1PH8 A;  2XTI A;  2PQA A;  2R93 H;  1WFQ A;  3F8T A;  4DUY L;  1X3E A;  4P73 A;  2I5H A;  2LSS A;  3CMA A;  1VQ4 A;  4AQY Q;  2B29 A;  1GO3 E;  4X64 L;  3H3V I;  3F1Z A;  4OX9 Q;  4JC0 A;  4A3F G;  1FL0 A;  1UEB A;  1YVC A;  4DR7 L;  3UDF A;  4B3T Q;  4LWC A;  1HR0 L;  1AH9 A;  5IE8 A;  5LMN W;  4BBS G;  4DR1 L;  4QY7 A;  3U50 C;  1PH4 A;  4DUZ Q;  1VQ7 A;  1WOC A;  2K5V A;  1TWG H;  5AJ3 L;  4DR5 L;  1Q81 C;  1N36 L;  2UXC L;  4JI4 L;  3HOY G;  2R7Z G;  4B3R Q;  2BH2 A;  1K83 H;  3HKZ E;  2Y0S G;  2FXQ A;  4EX5 A;  4NB3 A;  3G4S A;  2AWO A;  5HY6 A;  1E3P A;  4QQB X;  2HIV A;  3J80 i;  3CCS A;  4JV5 L;  4DUY Q;  3GD7 A;  4JI2 L;  3H15 A;  1XNR Q;  3M7N A;  1EFW A;  3Q8D A;  1VQE A;  1XPU A;  2K75 A;  4X64 Q;  4IOC A;  2JEA I;  3AEV A;  3CCE A;  3PUY A;  1IZ6 A;  2CWP A;  2R7Z H;  3FKI H;  3HOY H;  4OXP A;  1HZ9 A;  5ELO A;  2VQE Q;  3M4P A;  4UPA A;  1VQP A;  2A1A A;  1LYL A;  1WI5 A;  4JI8 L;  1VQC A;  5FLM G;  4IPH A;  2Q2I A;  1XTD A;  3GTL H;  1JT8 A;  4LF9 L;  1DGS A;  4A75 A;  4DR5 Q;  1N36 Q;  4OO1 I;  4IJL A;  2UXC Q;  3CCM A;  1JJG A;  1M1K C;  2K5H A;  1WYD A;  1KHI A;  2UUA Q;  1Q86 C;  4JV5 Q;  4Y7N H;  2UUB L;  5M5Y H;  1TXY A;  4JI2 Q;  2WB1 G;  4MZ9 A;  4B3S L;  1S3O A;  5M5X H;  1V9P A;  2OTL A;  3PV0 A;  2MFI A;  1ASZ A;  4LFB L;  1QVF A;  2NVY H;  3L7Z C;  4DV2 L;  4DR3 Q;  3S1R H;  1KXL A;  5JJI A;  1BBW A;  3EIV A;  3CCJ A;  3RLF A;  4LF6 L;  4TQU S;  4GNX C;  1VQH A;  1EOV A;  4H02 A;  2YTY A;  3CQZ H;  3AFP A;  1EWI A;  1RL2 A;  2ZJP A;  3S1Q H;  3S1M H;  1SN8 A;  1HZA A;  1A0I A;  1VCI A;  4JBJ A;  1IL2 A;  2PQA B;  1HJP A;  2IX1 A;  1PH6 A;  4LF4 Q;  3F2D A;  1JMC A;  4DV3 Q;  3CAM A;  2E5L L;  1K8A C;  1EQQ A;  2VS1 A;  3TQY A;  2L15 A;  2QEX A;  3K80 C;  3UDI A;  4OON A;  2Z6K A;  1XJV A;  2JA7 H;  3HOW G;  2N8N A;  3AYH B;  3PUZ A;  3H0G G;  5GAH C;  1D7Q A;  4LFB Q;  1HZC A;  3J7A 5;  4LFC Q;  1QZG A;  3S14 H;  1ASY A;  3G6E A;  3RN2 A;  1CKO A;  3CP0 A;  3EN2 A;  3CCL A;  4YCW A;  4LF6 Q;  1N9W A;  4YY3 L;  1NE3 A;  3TRE A;  3HKS A;  3GTQ H;  1P16 A;  2HT1 A;  3HOZ G;  1QVG A;  4LFA L;  5GAE C;  1OXX K;  3M4O H;  2ZTD A;  2PMZ E;  2I5L X;  4HJ8 A;  3M85 A;  1GM5 A;  1U0L A;  5K36 G;  1VQF A;  3GTP H;  2DGY A;  4PZ8 A;  2CQO A;  4AIM A;  2AWN A;  3DM3 A;  2UXD L;  2F3I A;  4QJF A;  3UE0 A;  1X3G A;  4IOA A;  4LNQ A;  4POG A;  4RMF A;  4JI6 L;  3CCU A;  1VQI A;  2OQ0 A;  1VQD A;  3F2B A;  1QVC A;  3ZJY C;  4DV1 L;  5LMU Q;  5GQO A;  2AMC B;  3S17 H;  2ZM6 L;  4P75 A;  1KAW A;  1SMX A;  5GRO A;  4YY3 Q;  2UUC L;  4K0K L;  3A0J A;  1B8A A;  3CC4 A;  3F2C A;  1UWV A;  2EXD A;  3PO3 H;  2ID0 A;  4A4I A;  1XNQ L;  1NMF A;  4R4O A;  2RF4 A;  4YHH L;  1JJC B;  4KHZ A;  1SFO H;  1L1O A;  1KD1 C;  1OXT A;  3SGI A;  1PH5 A;  5IY0 A;  2ZJQ A;  1N33 Q;  1V43 A;  4HJ5 A;  2N78 A;  2JA5 G;  2NVQ H;  2NZO A;  3CME A;  3PSI A;  2R6G A;  2OTJ A;  3EBE A;  3G48 A;  4XTC S;  4A3G G;  1MJE A;  1KL9 A;  3I4O A;  4A3J G;  4JI6 Q;  4BY7 H;  1HH2 P;  4DV0 Q;  3HOX G;  1IYJ B;  3AQQ A;  4JI3 L;  1K3R A;  4DR2 Q;  1PH3 A;  1G51 A;  1U5K A;  2HHH Q;  2BH8 A;  4O2D A;  1C7Y A;  4UY8 C;  3ICE A;  2JA5 H;  2EIF A;  4K0K Q;  2CWA A;  1BVS A;  4BXX H;  1OTC A;  1Q8K A;  4A3G H;  2WP8 J;  4YHH Q;  4A3J H;  2JA9 A;  4OWT B;  3HOX H;  4LF7 L;  4OO1 G;  3K7U C;  4IPD A;  1VQ9 A;  2Q2T A;  1I3Q H;  1XMO Q;  2KHJ A;  4B3M L;  4L5S A;  1YNX A;  3FKI G;  1OXV A;  1MJC A;  2VQF L;  4BY1 H;  3W5O A;  2AKW B;  4GN3 B;  4JOI A;  4DK3 C;  3DLL A;  3U58 A;  1J5E L;  3PUW A;  1NTG A;  3STB C;  4A3M G;  3RNU A;  1OXU A;  3FP9 A;  3J81 i;  4HJ9 A;  3HOU G;  2JJQ A;  4KI0 A;  3I4N G;  4GKK L;  2ZTE A;  3KDF A;  4DR7 Q;  4GOP A;  3VDY A;  1NMG A;  5BR8 L;  2R92 G;  1CKM A;  1GVP A;  1SRO A;  1IBL L;  5E7N A;  3CXC A;  1PV4 A;  1PH9 A;  1HR0 Q;  1VQJ A;  4LF7 Q;  3ULP A;  2YTV A;  2ES2 A;  4ALP A;  4DR1 Q;  2IX0 A;  4MTN A;  4A3M H;  4LF8 L;  1Q1E A;  1KRT A;  3TS2 A;  2IY5 B;  3HOU H;  4DNI A;  5AJ3 Q;  4LF5 L;  4NXN L;  2E2I H;  4JI4 Q;  1HNX L;  1EUJ A;  4X66 L;  2DUD A;  3I4N H;  2VQF Q;  1HNW L;  5JJK A;  4O0A A;  1Y14 B;  4IO9 A;  1T9H A;  2CFM A;  2YYZ A;  4GLA C;  3T1H L;  3STB D;  4IFD I;  3CC7 A;  3AFQ A;  2R92 H;  3PUV A;  4YWL A;  4A3D G;  4LW1 A;  2JE6 I;  3UE1 A;  1X3F A;  1GD7 A;  4ME3 A;  4R4T A;  1W2B A;  1X9N A;  5IWA L;  3PGZ A;  5BR8 Q;  1I94 L;  2HIX A;  2D0P A;  1L1O B;  4L5T A;  3CF5 A;  4IPG A;  4QL5 A;  3BU2 A;  4JI8 Q;  2A8V A;  2C35 B;  3K0X A;  3K7A H;  4A3D H;  1UE6 A;  4JI1 L;  4JI5 L;  4L5R C;  4LUO A;  4GLV B;  3RLO A;  1JE5 A;  2VW9 A;  1A62 A;  1FVI A;  4LF8 Q;  4LF9 Q;  2JA7 G;  4LF5 Q;  1YJ9 A;  4JG2 A;  4NXN Q;  3ER0 A;  2CKZ B;  5C44 G;  4TVA B;  1G29 1;  1OXS C;  1RIP A;  1HNX Q;  3KFU A;  3NBH B;  1G6P A;  5JEA G;  2ASB A;  4WJ4 A;  3M4Q A;  4KLK A;  3W1G A;  5C0X G;  1YEZ A;  4HIO A;  4YCU A;  2UUB Q;  3S2H H;  2PI2 E;  1Z9F A;  4DV7 L;  3T1Y L;  1PHJ A;  1UE1 A;  3HFZ B;  3G71 A;  2D0O A;  4DV6 L;  4DV4 L;  4B3S Q;  3RLN A;  1UE5 A;  1W3S A;  4C3I H;  2VL6 A;  3BJU A;  5C44 H;  1YHA A;  1X55 A;  3S2D H;  4UP7 A;  4DV2 Q;  3GO5 A;  1I94 Q;  1XMQ L;  4JI7 L;  4BBR G;  4NPS A;  3K81 C;  1Y1V G;  3NEL A;  4PMW A;  1S40 A;  5IP7 G;  4JI1 Q;  5IYB G;  4JI5 Q;  3GTJ H;  1Q12 A;  1XPO A;  5M3F G;  2D62 A;  5M3M G;  5M5W H;  3L2P A;  1VQL A;  3J81 c;  1WCM H;  3FHW A;  4QGU A;  1B7Y B;  3ERS X;  5EAY A;  4DPG A;  2Q2H A;  4POF A;  1B70 B;  1L2F A;  3NEM A;  3I7F A;  4IFD J;  2E5L Q;  3GTO H;  3KYH C; 
#chains in the Genus database with same CATH topology
 4BBR H;  4DV7 Q;  3T1Y Q;  1Y1V H;  2F0I A;  4R4I A;  5M3F H;  1QNU A;  2BA0 A;  1I4G A;  5CV7 A;  3UDX A;  1XMQ Q;  4JI7 Q;  1PTO H;  2H5X A;  1PH1 A;  2UU9 L;  1TWF H;  1PDQ A;  4N9T A;  3J7Y W;  3I56 A;  1SE8 A;  3OHX C;  4LFA Q;  4KHP L;  1VDZ A;  3KOJ A;  2WV6 D;  1AE2 A;  2BCO A;  1SR3 A;  4X65 L;  3FRP B;  4C3J G;  4GNX A;  1MKH A;  2UXD Q;  3D8G A;  1YHB A;  2K1B A;  5DEH A;  2KEC A;  3NBH A;  2F3W A;  3D31 A;  1TII D;  1SE2 A;  5JJL A;  1O7I A;  2R7Z B;  2ATW A;  5ELN A;  1X65 A;  1WTO A;  4HCE A;  3DMU A;  1GKH A;  1AW7 A;  4RGO S;  1Y1W H;  1KRS A;  2UUC Q;  3PF5 A;  2RHQ B;  1R4P B;  2NN6 I;  3IFT A;  1EWH A;  1UE7 A;  4ZYS A;  3VR5 A;  1A63 A;  2KBN A;  2D2C C;  4LUZ A;  1ENC A;  1F9P A;  2A69 D;  3ULJ A;  1YIT A;  1XNR L;  1AZP A;  3RZO H;  2MO0 A;  3PO2 H;  3VYU A;  3A5Z B;  3I4M H;  2MJ8 A;  3KBX A;  1Q82 C;  1Z47 A;  1PMR A;  3K7A B;  1U4M A;  1VQO A;  5LMN Q;  3WOF A;  2OQK A;  1HR0 W;  1DOM A;  3NSW A;  1XWE A;  1KAB A;  5KYL A;  1YJW A;  4WJW A;  3TME A;  3I55 A;  1K8G A;  5C4X H;  1BKB A;  2KCN A;  1SYD A;  2Z1C A;  2L5T A;  4A3L H;  2JA7 B;  4C3I B;  4BBS H;  5C44 B;  1HTL D;  1A3U A;  2UXB L;  4J1M A;  4XXE A;  3J80 L;  1SNP A;  2QW7 A;  3J81 j;  1WTV A;  3KF6 A;  4PNY A;  2O5I C;  1S72 A;  4K2K A;  5J39 A;  1DOK A;  1CQV A;  3M4O B;  1E2V A;  3S1N H;  2A6E C;  3MXN A;  4JBM A;  1STG A;  3BZC A;  1HNW Q;  4X66 Q;  1X3Q A;  4DAP A;  1N34 Q;  3GV3 A;  3T4A C;  2E74 C;  4PG3 A;  5M3M B;  1EY7 A;  1VQ6 A;  4AYB G;  2N49 A;  5IYD G;  4BWG B;  1WCM G;  5IGD A;  1EYA A;  5FJ8 H;  2V1C C;  2F0Q A;  3E9I A;  1PVO A;  1F2L A;  5IP9 H;  1EQT A;  4JI0 Q;  4Y52 H;  4FF1 A;  5AFW A;  2G5D A;  1VQK A;  4A3B H;  2NTT A;  3CW2 C;  3TSS A;  1VF7 A;  1V1O A;  4C1N I;  2PZU A;  5KRU A;  1BCP D;  2KHS A;  1CK1 A;  4U67 3;  3BYT B;  1LUZ A;  4BY7 B;  1EIH A;  1KDA A;  2PZT A;  3B6Y A;  4GKJ Q;  3HGB A;  2K50 A;  4IPC A;  1WTP A;  1DD2 A;  2F4V L;  2BA1 A;  1JB7 A;  4LK1 C;  5IT9 c;  3Q23 A;  1LTL A;  3OTO Q;  1V1Q A;  1SRU A;  5FKA C;  5LL6 X;  3MVV A;  3GDE A;  4K6D A;  2K5Q A;  4BY1 B;  2NVT B;  1K28 A;  3NTH A;  4X62 L;  5JVH 3;  4GOP C;  1Q46 A;  2R7F A;  1R9T H;  2L4N A;  2J4X A;  2XWJ B;  4DV0 L;  4C1N K;  1C4Q A;  4DR2 L;  4UP9 A;  2L0C A;  3W2D A;  2F03 A;  3R93 A;  2NBF A;  5CBE E;  1PH7 A;  4RHS A;  1CKN B;  1MSG A;  2K5W A;  3DWP A;  3TEH B;  1TKW B;  4A3C G;  2VZA A;  3H09 A;  4PMC A;  3E0E A;  4K8I A;  4DK0 A;  2E2I B;  2JA6 B;  3OW2 A;  4X6A H;  1SE4 A;  1I5F A;  2XTI A;  1F2Z A;  1WFQ A;  4MHE A;  1B2T A;  2I5H A;  2LSS A;  4AQY Q;  5FK9 C;  4FXD A;  1Q90 A;  1G91 A;  3P7J A;  4CDC C;  4A3E B;  2PQE A;  5LMN W;  2A73 B;  1PH4 A;  1H9J A;  4QY7 A;  1VQ7 A;  4DUZ Q;  1WOC A;  2K5V A;  1TWG H;  1N36 L;  2UXC L;  4JI4 L;  2R7Z G;  3VR3 A;  3QR8 A;  3RZD B;  2FXQ A;  1RTO A;  2AWO A;  2FIN B;  2H1E A;  3H15 A;  5IGF A;  2JEA I;  3AEV A;  1CI3 M;  2CWP A;  1Z7T A;  4EQN A;  3HOY H;  5IIF A;  4OXP A;  1HZ9 A;  5ELO A;  2VQE Q;  5IT9 E;  4UPA A;  2B2Y C;  4FXK C;  2XRS D;  1WI5 A;  2F0O A;  3GTJ B;  1SDF A;  4LF9 L;  2X6G A;  4ME5 A;  1EY6 A;  2F0W A;  2CHB D;  1M1K C;  2I07 B;  4BBR B;  2K5H A;  1KHI A;  3TN2 A;  2EE1 A;  1STY A;  1Q86 C;  1L0X B;  1TXY A;  1NNX A;  5M3F B;  4B3S L;  1TWH B;  5IOD A;  2JN4 A;  5M5X H;  3M3Y B;  3S1R H;  1PTO B;  4DV2 L;  1ILQ A;  3RLF A;  4TQU S;  5EPL A;  3KLS X;  1EY9 A;  2B2U A;  2KED A;  2PO4 A;  3S1Q H;  3BDO A;  3IKJ A;  3S1M H;  1K0S A;  2WAQ B;  1HZA A;  4JBJ A;  1VCI A;  2PQA B;  4L63 B;  1SE3 A;  4DK1 A;  4DV3 Q;  1LV9 A;  1HUN A;  4IUV A;  2L15 A;  3E0J A;  3QO2 A;  4JW0 A;  3UDI A;  4QB4 A;  2Z6K A;  3AYH B;  4FO2 A;  3QJY A;  1Y1W B;  3S14 H;  2MHV A;  3G6E A;  3CCL A;  1LTS D;  3OMG A;  1LO5 D;  4RHR A;  1NE3 A;  3TRE A;  5EBD A;  3GTQ H;  1A2T A;  2EYL A;  5ELE A;  2HT1 A;  3HOZ G;  4OL7 A;  2I5L X;  5DM7 3;  1MI2 A;  1S5D D;  3K5O A;  3GTP H;  3NXW A;  1BOS A;  3VYS A;  4AIM A;  1WTR A;  4RGM A;  2MGS A;  2BOS A;  3PO2 B;  4UAI A;  1RKN A;  4RMF A;  4JI6 L;  1ENA A;  1GJX A;  4UDU C;  3BVZ A;  2OQ0 A;  3VR6 A;  3EJI A;  4P75 A;  4F87 A;  2ENB A;  4YY3 Q;  3A54 A;  1BF4 A;  3F2C A;  3PO3 H;  1JWU D;  5CMD A;  4KN7 C;  3NWT A;  1O7Z A;  1SFO H;  3EFX D;  3K0Y A;  3PQI A;  2SEB D;  5CV9 A;  2N78 A;  5C4X B;  1EL0 A;  3CME A;  2R6G A;  2DJF C;  3FMC A;  4BBS B;  2PNR C;  4JI3 L;  4CBV A;  3LX0 A;  1PH3 A;  4IUQ A;  1D5X C;  4O2D A;  3VR4 A;  1SYE A;  4UY8 C;  5I9P A;  2X6L A;  1OTC A;  4B9W A;  4KN4 C;  4XDX A;  3S1N B;  1IHZ A;  1F9Q A;  2JA9 A;  2E2D C;  3OOC A;  1VQ9 A;  3GP7 A;  2VXW A;  3FKI G;  5KND A;  3W5O A;  3I70 A;  1LTT D;  1PZK D;  3OWE B;  1NTG A;  2F0S A;  1BBX C;  3C3L A;  4I7A A;  3J81 i;  1ENF A;  4OO1 H;  2EYH A;  4GKK L;  4DR7 Q;  4N9P A;  1RCV D;  2WB1 B;  1CKM A;  1GVP A;  1SRO A;  4OEM B;  5DNF A;  4ZUJ A;  5G3L F;  3R2I A;  4CJ2 C;  4ALP A;  4DR1 Q;  2ES2 A;  1JOR A;  2FHT A;  4ID6 A;  3TS2 A;  5CBA E;  2IY5 B;  3E6Z X;  1HPC A;  1I4P A;  2EYO A;  5JJK A;  2VQF Q;  4IO9 A;  1QNK A;  1X3P A;  1Y14 B;  3T1H L;  1F2M A;  3STB D;  4IFD I;  3PUV A;  4DU9 A;  4ME3 A;  5TSS A;  1DM0 B;  3TP7 A;  1EY4 A;  3VYR A;  2ZXP A;  3D6C A;  1HXY D;  5BR8 Q;  1HQM C;  1I94 L;  1GUS A;  4K5V A;  1L1O B;  1I6V C;  2A5H A;  4QL5 A;  3VYT A;  1ZYR C;  1STE A;  3K0X A;  1YNJ C;  3K7A H;  4KD3 A;  5ELB A;  4KY5 A;  1SMY D;  1JE5 A;  1PRT F;  4ILW A;  4LF5 Q;  4NXN Q;  3NTK A;  1HNX Q;  5E1F A;  4WJ4 A;  4CDF C;  4KLK A;  3W1G A;  4DAV A;  4YCU A;  2UUB Q;  3ERQ A;  2PI2 E;  4XYQ A;  5KNC A;  1UE1 A;  3HFZ B;  4DV6 L;  2D0O A;  2RDH A;  1BDO A;  1W3S A;  3RLN A;  4C3I H;  3QOL A;  2A68 C;  3BJU A;  5C44 H;  5C4Z A;  3GO5 A;  4BBR G;  5C0X H;  1Y1V G;  3A8K E;  4RGT A;  5C3X A;  1A3T A;  5JOB A;  3I3C A;  5M3F G;  2D62 A;  4TRD A;  3G6J B;  3L2P A;  5EAY A;  2Q2H A;  2K03 A;  3NEM A;  4IFD J;  4IZ8 A;  2E5L Q;  1PTO D;  5LHY 1;  2N3S A;  3J7A V;  4CDD C;  5IP7 H;  4F88 A;  2IT1 A;  5M3M H;  4FNF A;  2JA5 B;  3DEO A;  4HIK A;  1EQR A;  4EQP A;  3KLS A;  2QDB A;  5EQ0 A;  3A5U A;  3TP6 A;  4DR4 L;  1PFS A;  1GHJ A;  4GLX A;  1TWG B;  2AQ2 B;  4CHT B;  4EQ5 A;  4IJH A;  4NMZ A;  1UNS A;  1IBM L;  1TS2 A;  1XYI A;  1ILP A;  4AYB E;  3H6M A;  4CJ1 B;  4BXX G;  2C9O A;  2K52 A;  5HGQ A;  3D4R A;  3X3M A;  4P72 A;  3MZ5 A;  3HOY B;  4DV1 Q;  5BN4 A;  1J9O A;  2ZM6 Q;  3F2U A;  4X3S A;  2DNE A;  3A74 A;  1FNU A;  1XNQ Q;  1SAP A;  3PO2 G;  3HOU B;  2HCC A;  1JJ2 A;  1LT3 D;  3R2T A;  2E8G A;  1VQG A;  3A8I E;  1T5X D;  4YWK A;  1IBK L;  3I4M G;  4A3K H;  4DA2 A;  4X65 Q;  1FR3 A;  1TQO A;  3ND9 A;  4CGY B;  3MFY A;  1BQQ T;  2RCN A;  4LUV A;  2NVT H;  2KEN A;  1CSQ A;  2AHO B;  2O4X A;  1M4V A;  5CGK A;  3FEW X;  1HA6 A;  2EQS A;  2E2J H;  4G57 A;  1CA5 A;  1RDP D;  1YJN A;  1EWC A;  1MBY A;  1LT6 D;  5C4X G;  3PCO B;  5EKK A;  4A3D B;  2L9H A;  2OWO A;  4A3L G;  3S1Q B;  3MAQ A;  4G4K A;  4RH6 A;  4IUR A;  3CCQ A;  1DON A;  1MIU A;  2EOT A;  4B3M Q;  3PUX A;  2JA6 H;  1G8Z D;  3BVM A;  4IQZ A;  1K73 C;  1EYC A;  4IUU A;  1SSO A;  2B2W C;  2JA8 G;  4HJ7 A;  2VNU D;  1SYG A;  3BZK A;  1DYQ A;  1EEF D;  4DV5 L;  1QJO A;  2D9U A;  2N55 A;  2VB3 X;  5IT9 L;  5IYC H;  4DR3 L;  2LFN A;  4ZAI A;  4DXG A;  4XYO A;  1H95 A;  2DN8 A;  1KLU D;  4R1J A;  5M5W B;  1IBL Q;  4A3E H;  4KY6 A;  4JK1 C;  4GNX B;  4HIM A;  1SLJ A;  3OSO A;  3MEF A;  5FJ8 G;  1WTQ A;  2G9D A;  5IP9 G;  1DCZ A;  2PI2 A;  3RZD H;  1M90 C;  3Q0A A;  4DXF A;  5FLM H;  4F8M A;  1BCP C;  2TSS A;  3KLW A;  4A3B G;  2UXB Q;  4KJN A;  1N8R C;  1TU2 B;  3NWS A;  3O13 A;  4LFC L;  1EU3 A;  5ELF A;  3RN5 A;  1D8L A;  2EY6 A;  3PO3 B;  4FDB A;  1WTX A;  4DAM A;  4MTK A;  2F0N A;  5C3E H;  1VQN A;  3GTM B;  3JAM c;  1IKM A;  2EYF A;  1W6J A;  3D0F A;  2KHI A;  1E1O A;  2KCM A;  3HOV B;  1YZ6 A;  2IHF A;  2MNA A;  4NXM L;  2E2H B;  1RD9 D;  3I4L A;  2A68 D;  4CJ0 B;  4DV4 Q;  1TWC H;  5KIX A;  1TWH H;  5LMU L;  1AFP A;  3WDN A;  3M3Y H;  2NN6 G;  3OW7 A;  1X54 A;  4C56 C;  2QDL A;  4JOI C;  3D6W A;  3LGJ A;  2JSO A;  1FJG L;  3HOW H;  2VUM B;  3H0G H;  4IAL A;  2Q2U A;  3RR5 A;  4P2C B;  3I73 A;  2CH4 W;  2FMC A;  1E7Z A;  2K04 A;  5A35 A;  4GN5 A;  2VB2 X;  3KF6 B;  4X3U A;  3IL8 A;  2K32 A;  4I7Z C;  2OCE A;  2RA4 A;  2K5N A;  3S15 H;  2K01 A;  4V0B A;  2HHH L;  4MNO A;  4OGQ C;  1XX8 A;  2F4V Q;  4EVO A;  3MXN B;  1WTH A;  2B2V C;  2EJG C;  2JEB I;  1TS4 A;  4B3T L;  3SR1 A;  4DFA A;  1TS3 A;  5I4D A;  3H3V H;  2CW0 D;  4FP5 D;  2B2T A;  5JPN C;  4R4C A;  2IJ0 A;  4X62 Q;  4H7B A;  1KQS A;  2MUY A;  1SNO A;  5J3B A;  5JAV A;  3CCR A;  4HJA A;  1ET6 A;  4BA2 I;  2EY1 A;  1KC8 C;  1JWM D;  2R93 H;  2PW5 A;  4DUY L;  2KQ3 A;  2B29 A;  1GO3 E;  1UUP A;  4A3F G;  1UEB A;  4O42 A;  2F1M A;  3CRK C;  4LWC A;  3JAM E;  1LTI D;  1HR0 L;  3U50 C;  3P75 A;  5AJ3 L;  5IGE A;  4DR5 L;  2F0L A;  3HOY G;  4B3R Q;  4A3I B;  2Q8R E;  1K83 H;  3HKZ E;  3G4S A;  2XWB B;  4L8J A;  5HY6 A;  1E3P A;  3HRZ C;  4QQB X;  4I65 A;  3CCS A;  4JI2 L;  1BUV T;  5JVG 3;  2WAC A;  3HEJ A;  4TKO B;  3FVQ A;  1XPU A;  1I50 B;  2EZV A;  3I90 A;  3CCE A;  1BXT A;  4RFB A;  3MFG A;  1VQC A;  4IPH A;  3S16 B;  2NWG A;  4QF4 A;  3VA7 A;  1BO0 A;  3SK6 A;  1N36 Q;  3ERO A;  2UXC Q;  1JIC A;  1JE4 A;  1JJG A;  2UUA Q;  2LY7 A;  1C8C A;  4MZ9 A;  3HG9 A;  2HUG A;  3N52 A;  2M2L A;  2J0T D;  3PV0 A;  2MFI A;  4KKS A;  1ASZ A;  2JP1 A;  2NVY H;  3DUZ A;  5JJI A;  1BBW A;  1HA5 A;  3EIV A;  4LF6 L;  2M00 A;  2YTY A;  3AFP A;  1A0I A;  1HJP A;  2RQX A;  1LTR D;  2IX1 A;  1CHP D;  1PH6 A;  1ML0 D;  4LF4 Q;  3MC0 B;  1GHK A;  1EQQ A;  1SYC A;  1JC7 A;  2F0H A;  2Z6B A;  3A8J E;  1D7Q A;  3NPP A;  1GUT A;  3RN2 A;  1CKO A;  3CP0 A;  3EN2 A;  3T51 B;  5C4J B;  1N9W A;  2F0V A;  5T1G A;  4ZRZ A;  4QUC A;  1CQF A;  4X3T A;  1QVG A;  4LFA L;  5GAE C;  1OXX K;  4A3K B;  2PMZ E;  1T5E A;  2RSN A;  2B8G A;  4PZ8 A;  5CV8 A;  4EQO A;  1G2S A;  3I72 A;  2UXD L;  2F3I A;  3UE0 A;  1UAP A;  1X3G A;  4IOA A;  4HSP A;  4POG A;  1PLF A;  2E2J B;  1VQI A;  2KA7 A;  1VQD A;  3F2B A;  1QVC A;  5K36 H;  1D1I A;  1EYD A;  1U4P A;  2DY7 A;  2UUC L;  3A0J A;  4LAA A;  3CC4 A;  1YNN D;  2ID0 A;  3V2T A;  1KNA A;  2F0D A;  1RF2 D;  1OXT A;  1N33 Q;  2ZJQ A;  4ABN A;  3C2P A;  3FPP A;  2J7Z A;  5EKI A;  1TT2 A;  4JI6 Q;  3WOE A;  4FF3 A;  4F7X A;  1K3R A;  1SJE D;  3Q22 A;  2JYO A;  1G51 A;  1U5K A;  2BH8 A;  4PMB A;  1C7Y A;  3VR2 A;  3ICE A;  1KNE A;  2JA5 H;  2EIF A;  3G7L A;  3GTL B;  5EBC A;  3LWE A;  2KJX A;  3HOX H;  4OO1 G;  3HP3 A;  1MGS A;  4JVZ A;  4RA8 A;  1I3Q H;  1XMO Q;  2KHJ A;  4Y7N B;  1OXV A;  1MJC A;  4PQX A;  3PIP 3;  4DK3 C;  3PUW A;  1LAC A;  3STB C;  1OXU A;  2AQ3 B;  2A6H D;  5HGT A;  2EDG A;  3E3X A;  1IYU A;  1STN A;  2ZTE A;  3MEH A;  3KDF A;  4NW2 A;  3P20 A;  4RAU C;  4GOP A;  3CQZ B;  4XQJ A;  3NP8 A;  5C3E B;  3QWN A;  3SHL A;  3U9S A;  1PV4 A;  3TP8 A;  4K8J A;  3ULP A;  2EPB A;  2IX0 A;  4A3M H;  1ZXT A;  3HOU H;  2P5Z X;  1SMY C;  1HNW L;  1EUJ A;  4X66 L;  2DUD A;  4OO1 I;  1T9H A;  3FPU B;  4YWL A;  4DF7 A;  3UE1 A;  1X3F A;  1TWC B;  1IKL A;  2AQ1 B;  1IL8 A;  1PZJ D;  3SVM A;  1S5B D;  2D0P A;  4IPG A;  5CV6 A;  2K7V A;  4JI8 Q;  1SYB A;  3HOW B;  4A3D H;  3H0G B;  4JI1 L;  1JR0 D;  4JI5 L;  3RLO A;  1F9R A;  2VW9 A;  1A62 A;  4C3I G;  2JA7 G;  3W3A A;  3ER0 A;  2CKZ B;  5C44 G;  1OXS C;  3M4Q A;  5C0X G;  2DJG C;  1LTA D;  1YEZ A;  2EYJ A;  1PTO C;  2H4O A;  3G71 A;  3S15 B;  4GZY C;  3S17 B;  2AUK A;  1CHQ D;  1X55 A;  2WIN B;  4UP7 A;  1EY5 A;  1I94 Q;  5JEA H;  3PMF A;  1L0Y B;  4NPS A;  5IP7 G;  3MXP A;  1Q12 A;  4G7H C;  5EPJ A;  5M3M G;  5M5W H;  3K5M A;  5JPM C;  1WCM H;  3FHW A;  4QGU A;  2HD3 A;  1L2F A;  2K6A A;  2IWH A;  2B2Y A;  1U9R A;  3KYH C;  2R93 B;  1VQM A;  3OIQ A;  2EXZ A;  3KF8 A;  5F2D A;  1PYB A;  5IYB H;  5C0X I;  3H3V C;  1N32 L;  3FDT A;  4XT1 B;  1QUQ A;  4L5Q A;  3K5N A;  2M9V A;  4JBK A;  1CA6 A;  4A3G B;  1K9M C;  4A3J B;  1Q7Y C;  2WFW A;  4L6T B;  3U4V A;  4BY7 G;  4GS3 A;  1LT5 D;  3HZX A;  1EYG A;  3GTM H;  1K83 B;  2RDG A;  2ICE C;  3CHB D;  1PA6 A;  2ZT9 C;  2V4D A;  4DAY A;  3TDQ A;  4E6I A;  1VQ5 A;  1U4L A;  3U4Z A;  4JCV E;  3HOV H;  2KUM A;  1EZ6 A;  2E2H H;  2NUC A;  5A2Q E;  2GN5 A;  2K4K A;  2NZ1 D;  3CC2 A;  3MHB A;  1LM0 A;  2Y0S B;  1AZQ A;  1TS5 A;  5IGG A;  4BY1 G;  3LNN A;  2EVB A;  4J15 A;  2I0Q A;  4DR4 Q;  2HQE A;  5CC4 A;  2L1B A;  1C48 A;  2MQH A;  2B63 H;  4DUZ L;  1SND A;  4JYA L;  3I4N B;  1WJJ A;  2DY8 A;  1IBM Q;  4IFD G;  2VUM H;  2R92 B;  3AU7 A;  3QG1 A;  2XVS A;  4RCO A;  3K5L A;  2B3G A;  4LMQ D;  3OYY A;  5C0X J;  3CKI B;  4A3C H;  3CU7 A;  2QGQ A;  3CPF A;  1CZW A;  3W1B A;  2NVY B;  2EYP A;  3BS1 A;  2JA6 G;  2VQE L;  4DKA C;  1ROD A;  3JAM L;  4V19 0;  5FLX c;  3V05 A;  1A15 A;  1S5E D;  4CDE C;  4DNR B;  2QKI C;  1IBK Q;  2K33 A;  1NSN S;  2IX3 A;  1CM9 A;  1X32 A;  5IYC G;  1NJI C;  1UEA B;  4HID A;  3S2H B;  5E4X A;  3EQL C;  1VQ8 A;  5FOB B;  4PZ6 A;  1J5E Q;  4A3E G;  2L12 A;  4K2L A;  2QCP X;  4FXG C;  3S2D B;  4BA1 I;  3K8A A;  4P74 A;  3RD4 A;  2BE5 D;  5EJW A;  4P71 A;  4C3H H;  1J8I A;  1X6O A;  3JC6 6;  4QIW E;  1J6Q A;  2BDO A;  1HNZ L;  2DNC A;  1VMC A;  1SBB B;  3KJO A;  4HTH A;  5HUR A;  3BVG A;  3GTO B;  2ALY B;  3J7Z C;  3NK9 A;  4DV3 L;  5I2Y A;  2IHE A;  1X56 A;  4R8N A;  2F52 A;  5C5M A;  4A3I H;  2XNA C;  2GVB A;  5C3E G;  1E24 A;  1VS0 A;  1WD0 A;  1L1O C;  1FNV A;  4DV5 Q;  1O78 A;  1YHQ A;  5IWA Q;  1I50 H;  2TMP A;  4QCL A;  1EY8 A;  1PRT B;  3T16 A;  3MWY W;  4DK6 C;  2ZTC A;  1AN8 A;  3QOJ A;  1I6H H;  2F0E A;  3L9A X;  2Z4H A;  1YBY A;  3J7A F;  1NY4 A;  4Q5V A;  4C2M H;  3S16 H;  3I2Z A;  3D4D A;  3SK4 A;  3CD6 A;  2PNH A;  1BBU A;  1O7L A;  2YTX A;  2Z4I A;  5H1S E;  3OIP A;  3SE0 A;  2A19 A;  3UI2 A;  2MO1 A;  4FF2 A;  1E1T A;  3M7G A;  2QA4 A;  1WVL A;  2WAQ G;  5FLX E;  5ISR A;  1TWA B;  4DR6 L;  1FGU A;  1TY0 A;  2IW3 A;  3L0O A;  1EIF A;  3NBI A;  3HOX B;  2WKC A;  4R8I A;  4MN3 A;  5KNB A;  2CW0 C;  1I3Q B;  5D3D A;  1H9R A;  1LLR D;  5FO8 B;  1Y1W G;  3CCV A;  4OEL B;  4Q0F A;  3KJP A;  4NXM Q;  3IRB A;  1STB A;  2XIW A;  3HOZ H;  1B4O A;  1CUK A;  3TS0 A;  4HCS A;  1CT1 D;  1G2T A;  4OX9 L;  5E3F A;  2R93 G;  5C4J H;  2UU9 Q;  2NVX B;  2VY3 A;  1Y8P B;  4GN4 B;  4A3M B;  1FJG Q;  4DGZ A;  2F0T A;  5I6Y A;  4JPB W;  1A3V A;  4KHP Q;  3SK5 A;  4A93 H;  4OWX B;  3R8B A;  4XT3 B;  4P73 A;  1WTW A;  1EFI D;  2Z8L A;  3D4W A;  3DWA A;  4X64 L;  3H3V I;  3F1Z A;  2K5D A;  2AUJ D;  4JC0 A;  5KEE A;  1STH A;  1YVC A;  5LL6 S;  4RKL A;  4DR7 L;  3UDF A;  4B3T Q;  1B44 D;  1H9K A;  2RDF A;  3DXJ C;  3SDZ A;  1SYF A;  1AH9 A;  5IE8 A;  4BBS G;  4DR1 L;  4HED A;  4ZQ3 A;  2Z9H A;  1Y8O B;  5COY A;  2XSC A;  4B08 A;  2Y0S G;  1SXT A;  2NB0 A;  5CYU A;  1LTG D;  3J80 i;  4JV5 L;  4DUY Q;  4N8X 1;  2X69 A;  3GD7 A;  1XNR Q;  3M7N A;  3DHQ A;  2EY2 A;  1EFW A;  4G7O C;  3ZYY X;  4K5X A;  1XTC D;  2K75 A;  4LJZ C;  4UHV A;  3PUY A;  3NTI A;  1IZ6 A;  2O5J C;  3FKI H;  3MXG A;  2HDL A;  2NYZ D;  5COR A;  2A1A A;  3L3O C;  1BCP F;  5I6W A;  4AYB B;  1XTD A;  4O1N A;  3GTL H;  1JT8 A;  2R61 A;  1KAA A;  1WCM B;  4A75 A;  4DR5 Q;  2O2L D;  3CCM A;  1QCB D;  1PXU A;  2KOL A;  4K14 A;  1I4H A;  4Z9C B;  4Y7N H;  1LTB D;  2UUB L;  5M5Y H;  4JI2 Q;  2WB1 G;  3P1H A;  2D5D A;  1S3O A;  4B9X A;  1RHP A;  3BZD B;  3Q6S A;  2OTL A;  4LFB L;  1MD2 D;  5KYI A;  1LAB A;  4XQQ A;  3CCJ A;  1O80 A;  4GNX C;  1KDC A;  3CQZ H;  2ZJP A;  1EWI A;  2E76 C;  1JB3 A;  1SN8 A;  4NP5 A;  1RTN A;  1IL2 A;  3GTK B;  1PZI D;  1JMC A;  4KMU C;  2E5L L;  4H0L C;  4FF4 A;  2VS1 A;  1JOO A;  3TQY A;  4OHJ A;  3QB3 A;  5G3L D;  2QEX A;  2FJ2 A;  3LWU A;  4R9W A;  3PUZ A;  5GAH C;  1AEX A;  1HZC A;  3J7A 5;  1ASY A;  4LF6 Q;  1V1P B;  4K6L A;  2Q8T A;  4DNT B;  3RUZ A;  5DM6 3;  2B63 B;  5C3W A;  2B2W A;  1YNN C;  5EPK A;  2LKV A;  2ZTD A;  5DAU A;  1GM5 A;  5K36 G;  1VQF A;  2DGY A;  3ND8 A;  4ZKC B;  1PRT D;  4NDX A;  4LNQ A;  2K05 A;  3A7L A;  4YIJ A;  2XRQ D;  4DV1 L;  2RCF A;  4CKE A;  2AMC B;  3S17 H;  2ZM6 L;  1SMX A;  4HR7 B;  5ELD A;  4K0K L;  1B8A A;  5D3I B;  1UWV A;  2EXD A;  1XNQ L;  4J8Q A;  4CKB A;  4YHH L;  3SGI A;  1PH5 A;  2XN9 C;  4EGV A;  1V43 A;  3TP5 A;  1GUW A;  2JA5 G;  2NVQ H;  3A55 A;  2JXM B;  3EBE A;  3G48 A;  4XTC S;  2QF7 A;  3I4O A;  1FNW A;  1HH2 P;  3HOX G;  1IYJ B;  3NUC A;  5A2Q L;  4DV0 Q;  4DR2 Q;  1E2W A;  4RCN A;  1TY2 A;  3H91 A;  3NQI A;  5IGB A;  2A6H C;  4C3H B;  2CWA A;  1BVS A;  4BXX H;  1Q8K A;  4A3G H;  1S4Z A;  1H9S B;  4A3J H;  4OWT B;  4LF7 L;  1B50 A;  1V1P A;  2Q2T A;  3T53 B;  4B3M L;  1IW7 D;  1YNX A;  1Y69 U;  2AKW B;  4JOI A;  3U58 A;  1B3Q A;  3I8Z A;  2N88 A;  4HSV A;  1EEI D;  4KHV A;  3BG3 A;  4X3K A;  3RNU A;  4A3M G;  3HOU G;  3TZD A;  3MA2 B;  2LMC B;  4KI0 A;  3DM1 A;  5M9O A;  3VDY A;  1I6H B;  1IBL L;  5E7N A;  3CXC A;  1PH9 A;  5C5L A;  1R4Q B;  1EQV A;  1VQJ A;  4C2M B;  3ONA B;  4LF8 L;  4MTN A;  1Q1E A;  1SJH D;  2RVL A;  4DNI A;  4JI4 Q;  3I4N H;  5D14 A;  4O0A A;  2CFM A;  2F0M A;  2YYZ A;  3C1F A;  3CC7 A;  2B2V A;  2R92 H;  5JJZ A;  4A3D G;  2OEO A;  4LW1 A;  4R4T A;  1W2B A;  5KGU A;  3CF5 A;  5BN5 A;  3TBI B;  4DN4 M;  5FO9 B;  1UE6 A;  4L5R C;  4LF9 Q;  4LUO A;  4GLV B;  2JA8 H;  4MIU A;  2FFK B;  3KFU A;  4PV1 C;  1G29 1;  4TVA B;  1G6P A;  5JEA G;  1KTK A;  1H9S A;  1OO9 B;  2QEJ C;  3KLR A;  3S2H H;  4DV7 L;  3T1Y L;  3HOZ B;  4B3S Q;  4DV4 L;  2VL6 A;  3S2D H;  1YHA A;  4S3S A;  4DV2 Q;  3K58 A;  2EY5 A;  2F0J A;  1XMQ L;  4JI7 L;  3HKZ B;  3K81 C;  1HQR D;  3NQT A;  3NEL A;  1S40 A;  4JI1 Q;  5IYB G;  4JI5 Q;  1XPO A;  4TSS A;  1VQL A;  3J81 c;  2B39 A;  1CTM A;  1HTP A;  1ICF B;  3ERS X;  4DPG A;  4A93 B;  1B70 B;  3I7F A;  2F0F A;  5K5P A;  3GTO H;  1QZH A;  5GAD C;  1FYC A;  2YV5 A;  2PPB C;  3PO3 G;  3KDF B;  4GOP B;  1C9O A;  5CV5 A;  1JCK B;  2NTS A;  1AE3 A;  1QB5 D;  5IGC A;  5FLX L;  1K0R A;  2JK8 A;  2EYM A;  1HFG A;  2LS0 1;  1S5F D;  3TRZ A;  1VQB A;  4ZLT F;  1NAP A;  3HOV G;  2L11 A;  1FD7 D;  2R7D A;  1SNM A;  4XIG S;  1B53 A;  1PFM A;  2NN6 H;  2ZXR A;  1Z6H A;  2F0P A;  1QWY A;  3A7A B;  4YCV A;  3AB9 A;  2OF1 A;  4H13 C;  2B63 G;  4RG1 A;  2PYK A;  2XGT A;  2RBM A;  3DWQ A;  1N32 Q;  4UP8 A;  5IOC A;  2VUM G;  3KUP A;  1NBW A;  3FKI B;  3CRL C;  5E4W C;  2RSO A;  5GAG C;  2RKS A;  1TWA H;  1JOQ A;  2LXK A;  1GOZ A;  4C3J H;  5LMN L;  2LXJ A;  2Q8I B;  1D5Z C;  3PIP A;  2K28 A;  4B3R L;  4HAE A;  1Q1B A;  3OMC A;  5M5Y B;  3R3O A;  4OWW B;  5JEA J;  2B2U C;  1JQY D;  2F0U A;  2WAQ E;  2RHS B;  5BN3 A;  2OT2 A;  2YU9 H;  4IN3 A;  2ICI A;  1E22 A;  4WOR A;  2NZH A;  3JAM i;  4JI3 Q;  3T56 B;  1IYV A;  2EJM A;  2PMZ B;  1JOK A;  1SNQ A;  3E9H A;  2BE5 C;  3J81 E;  3V96 A;  2Z6K C;  4JYA Q;  3ITP A;  2NVX H;  3ULL A;  3KF8 B;  4A3F H;  4WJ3 M;  1DZ1 A;  2UUA L;  4C3H G;  1N34 L;  1QUQ B;  3K57 A;  2Z0S A;  2QIL A;  1SNC A;  1WD1 A;  2ZJR A;  3D3R A;  3WWV A;  3SXH A;  4GKK Q;  4A3I G;  1GUO A;  1NR4 A;  4APV A;  1PTO F;  1RJT A;  4JI0 L;  1L0W A;  4YWM A;  1Q3L A;  3MXU A;  4A76 A;  4QUF A;  3AMU A;  4ULL A;  4DAY B;  1CKN A;  4LF4 L;  1W6K A;  2K14 A;  3GTG H;  1K8O A;  1XPR A;  1XXG A;  1Y1V B;  3T1H Q;  1PH2 A;  1F2Y A;  3S24 A;  1NCV A;  2GVA A;  1HZB A;  4GKJ L;  2I5M X;  1EU4 A;  3I91 A;  4R4Q A;  1Q8I A;  1TWF B;  3T13 A;  1F77 A;  3IFD A;  2A6E D;  4AH6 A;  1D5M C;  1HNZ Q;  3OPO A;  1A6X A;  2Y0S E;  1PFN A;  3M9B A;  1A8V A;  1EIY B;  1O7Y A;  2HQL A;  3OTO L;  1CSP A;  3E5S A;  2BDN A;  5IYD H;  5DLQ E;  2NVQ B;  1P8L A;  3NEN A;  4RKB A;  1IXR A;  4KY7 A;  1VQA A;  2JQO A;  1H9M A;  3PIO A;  3DEP A;  4DV6 Q;  1TVX A;  5D65 A;  1LT4 D;  3PIO 3;  1NR2 A;  2KCT A;  3EVQ A;  4JBW A;  1PYS B;  2A74 C;  5J1Z A;  4ZUI A;  3J80 c;  3MTS A;  3A56 A;  2FMM A;  4KKT A;  2SNS A;  1YI2 A;  1N33 L;  2WB1 E;  1U4R A;  4HMI A;  1DXM A;  3GTK H;  1KIX A;  1BNZ A;  4U68 A;  2EJF C;  3RZO B;  3CPW A;  3HKZ G;  4OIJ A;  2CVR A;  1YIJ A;  3PF4 A;  3I4M B;  2KEE A;  4AQY L;  2CCZ A;  4DR6 Q;  4A3K G;  4A93 G;  1BR9 A;  2WII B;  3HS0 C;  1QIL A;  4PZ7 A;  4RGN A;  1VF5 C;  4IUT A;  1C0A A;  3K6O A;  2KVM A;  1K3B C;  5I9O A;  3RMH A;  1XMO L;  5CR3 A;  3UDG A;  1ICW A;  1PH8 A;  2PQA A;  3KBG A;  3F8T A;  2R3Z A;  1ESR A;  3U9O A;  1G6Z A;  1X3E A;  4M1U B;  3CMA A;  2HCI A;  2SNM A;  1VQ4 A;  2GA4 B;  4KKU A;  1B9N A;  4OX9 Q;  1FL0 A;  5NUC A;  2JA8 B;  1AP0 A;  1QOH A;  2IPK D;  1Q81 C;  2BH2 A;  4RWS C;  4EX5 A;  4NB3 A;  1D6E C;  3BDC A;  2HIV A;  1HUM A;  3Q8D A;  1MHW C;  1VQE A;  4X64 Q;  4IOC A;  1EIG A;  3J80 E;  4K5W A;  2R7Z H;  3M4P A;  1VQP A;  1FGB D;  1LYL A;  1ONL A;  4JI8 L;  5FLM G;  2PCF B;  2Q2I A;  4A3B B;  1DGS A;  4OIK A;  1JWS D;  4IJL A;  2I46 A;  3URY A;  1WYD A;  4JV5 Q;  2E75 C;  2F4I A;  5I2X A;  1DOL A;  1ET9 A;  1V9P A;  3QIA A;  4HN7 A;  1QVF A;  2SOB A;  1EOT A;  3L7Z C;  4DR3 Q;  1KXL A;  1VQH A;  1EOV A;  4H02 A;  2IL8 A;  1SEB D;  3K59 A;  1RL2 A;  3X3N A;  1R9T B;  2CH4 A;  3F2D A;  3CAM A;  1K8A C;  3GQB A;  3SK8 A;  1CZG A;  4J6H A;  3K80 C;  4WRD A;  4OON A;  3VA5 A;  4ODG A;  3EA6 A;  1XJV A;  3OWF A;  2JA7 H;  2N8N A;  3HOW G;  3H0G G;  1PRT C;  4LFB Q;  4H44 C;  4LFC Q;  4NKL A;  1QZG A;  1STA A;  1KLG D;  1MSH A;  4C3J B;  4YCW A;  4YY3 L;  3C46 A;  1D1K A;  3HKS A;  4XQN A;  1P16 A;  1VMP A;  2MP1 A;  1NUC A;  3M4O H;  4HJ8 A;  3M85 A;  1U0L A;  2CQO A;  2AWN A;  3DM3 A;  1B9M A;  2YU9 B;  2WKD A;  4QJF A;  3SEB A;  3NHH A;  2PW7 A;  5EGT A;  3CCU A;  4QIW B;  3IAY A;  3GV6 A;  4ZCK A;  3ZJY C;  1E2Z A;  5LMU Q;  5GQO A;  1KAW A;  5GRO A;  4ZK9 B;  4A4I A;  1NMF A;  1ZEQ X;  4R4O A;  2RF4 A;  1K8M A;  1JJC B;  4KHZ A;  1I4R A;  4ZKB B;  1L1O A;  1KD1 C;  4A3F B;  2PZW A;  5IY0 A;  3C1E A;  4HJ5 A;  4HMJ A;  3TZU A;  2NZO A;  4QMG A;  5L37 A;  1HCZ A;  3PSI A;  1ZKO A;  2OTJ A;  1V8Q A;  4A3G G;  1IW7 C;  1MJE A;  1KL9 A;  4A3J G;  2A69 C;  4BY7 H;  3AQQ A;  4CKC A;  1I4Q A;  3KK7 A;  2HHH Q;  4N8F A;  2CQA A;  4K0K Q;  4KK7 A;  4G7Z C;  3BDL A;  2WP8 J;  4YHH Q;  1PYW D;  3K7U C;  4IPD A;  3GTG B;  1PFB A;  4L5S A;  5FO7 B;  2VQF L;  4BY1 H;  1D2B A;  4GN3 B;  2KCC A;  3DLL A;  1J5E L;  1EZ8 A;  5M5X B;  4WFN 3;  4KJO A;  2G9H D;  3S1R B;  3FP9 A;  3S9W A;  2MPM A;  4HJ9 A;  3NE5 B;  4KTA A;  2JJQ A;  4IFD H;  3I4N G;  4KD4 A;  4M8A A;  1NMG A;  5BR8 L;  2R92 G;  3J81 L;  3S1M B;  4IUN A;  4BS9 A;  2F3V A;  1HR0 Q;  5ELC A;  1I4X A;  3M4Y A;  4LF7 Q;  2YTV A;  1KRT A;  5AJ3 Q;  4LF5 L;  4NXN L;  2E2I H;  1HNX L;  1EY0 A;  4IUP A;  4FYD A;  4GLA C;  2B8F A;  1ESF A;  3AFQ A;  2F0G A;  2JE6 I;  5C6A A;  1GD7 A;  2OXP A;  1TR5 A;  3S14 B;  1X9N A;  1BCP B;  1HRJ A;  5IWA L;  3PGZ A;  5C4H A;  3GTQ B;  5T1I A;  2HIX A;  4L5T A;  1F9S A;  3BU2 A;  2F0K A;  2A8V A;  2C35 B;  2ZXO A;  4LF8 Q;  1B1Z A;  1FVI A;  1YJ9 A;  1CFM A;  1M8A A;  1QE6 A;  3N6R A;  4JG2 A;  3Q24 A;  1QG7 A;  1RIP A;  3GTP B;  5EKL A;  3BYY B;  3NBH B;  4KV6 A;  2ASB A;  2SDF A;  4HIO A;  1KDB A;  1Z9F A;  1E0B A;  1PHJ A;  5J22 A;  1UE5 A;  1Y8N B;  2B2T C;  2HDM A;  3H94 A;  5CV4 A;  4FVM A;  1HFN A;  1HHV A;  1ZYR D;  1GUN A;  1YNJ D;  1GUG A;  1A2U A;  1SFO B;  4PMW A;  1II3 A;  3GTJ H;  2C5C A;  1DJR D;  2L55 A;  1B7Y B;  1GXD C;  4POF A;  1B3A A;  1S5C D; 
#chains in the Genus database with same CATH homology
 4BBR H;  1QZH A;  1VQM A;  5GAD C;  2YV5 A;  2N3S A;  4DV7 Q;  3T1Y Q;  1Y1V H;  3PO3 G;  3KDF B;  1PYB A;  4R4I A;  1C9O A;  5IP7 H;  5IYB H;  5C0X I;  4GOP B;  5M3F H;  1AE3 A;  2IT1 A;  1N32 L;  5M3M H;  1K0R A;  2BA0 A;  1QUQ A;  2JK8 A;  4HIK A;  1EQR A;  4L5Q A;  3UDX A;  1XMQ Q;  4JI7 Q;  4JBK A;  2H5X A;  1PH1 A;  1K9M C;  1Q7Y C;  3TRZ A;  1VQB A;  2WFW A;  3A5U A;  2UU9 L;  3HOV G;  1TWF H;  4DR4 L;  3U4V A;  1PFS A;  4BY7 G;  4GLX A;  3I56 A;  2R7D A;  1SE8 A;  4GS3 A;  1EYG A;  4LFA Q;  3GTM H;  4EQ5 A;  4IJH A;  4KHP L;  4XIG S;  1IBM L;  3KOJ A;  1AE2 A;  1PA6 A;  1SR3 A;  4X65 L;  4AYB E;  4GNX A;  1MKH A;  4BXX G;  2UXD Q;  1VQ5 A;  4YCV A;  1YHB A;  2K52 A;  3U4Z A;  4JCV E;  5HGQ A;  3HOV H;  2B63 G;  4RG1 A;  2XGT A;  2E2H H;  3D31 A;  4UP8 A;  1N32 Q;  4P72 A;  5JJL A;  2GN5 A;  2K4K A;  2VUM G;  1O7I A;  1NBW A;  2ATW A;  4DV1 Q;  3CC2 A;  5ELN A;  1LM0 A;  1X65 A;  5GAG C;  2ZM6 Q;  1GKH A;  1Y1W H;  1KRS A;  4BY1 G;  3A74 A;  3PF5 A;  2UUC Q;  1TWA H;  4J15 A;  2LXK A;  2RHQ B;  4C3J H;  2I0Q A;  4DR4 Q;  2NN6 I;  5LMN L;  1XNQ Q;  3PO2 G;  1JJ2 A;  1UE7 A;  2LXJ A;  2MQH A;  4DUZ L;  2B63 H;  4JYA L;  1IBK L;  2E8G A;  1VQG A;  1WJJ A;  4YWK A;  1IBM Q;  1A63 A;  3PIP A;  4IFD G;  2VUM H;  3I4M G;  4B3R L;  4A3K H;  2KBN A;  1Q1B A;  4X65 Q;  4LUZ A;  2RCN A;  4LUV A;  2B3G A;  4OWW B;  2KEN A;  5JEA J;  1CSQ A;  3ULJ A;  3OYY A;  2WAQ E;  1YIT A;  2NVT H;  1XNR L;  5C0X J;  2AHO B;  2RHS B;  2YU9 H;  2MO0 A;  3RZO H;  4A3C H;  3PO2 H;  1E22 A;  2QGQ A;  2NZH A;  3JAM i;  4JI3 Q;  3CPF A;  3A5Z B;  3W1B A;  2EQS A;  2E2J H;  1YJN A;  3I4M H;  2JA6 G;  2VQE L;  1Q82 C;  4DKA C;  3PCO B;  1Z47 A;  5C4X G;  5FLX c;  3E9H A;  1VQO A;  2OWO A;  5LMN Q;  4A3L G;  2OQK A;  2Z6K C;  1HR0 W;  4JYA Q;  1IBK Q;  2NVX H;  3ULL A;  3CCQ A;  1MIU A;  5IYC G;  1YJW A;  3KF8 B;  2JA8 H;  4A3F H;  1NJI C;  4B3M Q;  4WJ3 M;  3PUX A;  3I55 A;  1K8G A;  2UUA L;  2JA6 H;  4HID A;  5C4X H;  1BKB A;  1K73 C;  1N34 L;  1VQ8 A;  4PZ6 A;  1J5E Q;  1QUQ B;  2Z0S A;  4A3E G;  4A3L H;  4BBS H;  2JA8 G;  4HJ7 A;  2ZJR A;  2UXB L;  2VNU D;  4BA1 I;  3BZK A;  3J81 j;  4DV5 L;  3K8A A;  3KF6 A;  4P74 A;  3WWV A;  5IYC H;  4DR3 L;  4GKK Q;  4A3I G;  1S72 A;  1H95 A;  4APV A;  4P71 A;  4C3H H;  4R1J A;  1X6O A;  3JC6 6;  4QIW E;  1J6Q A;  1IBL Q;  4JI0 L;  1HNZ L;  1L0W A;  4YWM A;  4A3E H;  1VQK A;  3KJO A;  4A76 A;  4JBM A;  3S1N H;  4GNX B;  4HIM A;  4DAY B;  1CKN A;  4LF4 L;  1SLJ A;  2ALY B;  2K14 A;  3MEF A;  3BZC A;  5FJ8 G;  3J7Z C;  4DV3 L;  4X66 Q;  1XPR A;  3GTG H;  1HNW Q;  1N34 Q;  5IP9 G;  2IHE A;  1X56 A;  2PI2 A;  2F52 A;  3T1H Q;  4A3I H;  3RZD H;  1PH2 A;  5FLM H;  2GVB A;  1M90 C;  5C3E G;  1E24 A;  4PG3 A;  3S24 A;  1VS0 A;  1VQ6 A;  3KLW A;  2GVA A;  4A3B G;  2UXB Q;  4AYB G;  2N49 A;  1HZB A;  1L1O C;  5IYD G;  1N8R C;  4GKJ L;  4DV5 Q;  1WCM G;  4LFC L;  2I5M X;  1YHQ A;  3RN5 A;  5IWA Q;  5FJ8 H;  1I50 H;  2V1C C;  4R4Q A;  3E9I A;  1D8L A;  1PVO A;  5IP9 H;  4FDB A;  4DK6 C;  4JI0 Q;  2ZTC A;  4AH6 A;  4DAM A;  1HNZ Q;  1I6H H;  4Y52 H;  5C3E H;  1VQN A;  2Y0S E;  1YBY A;  3M9B A;  3JAM c;  1NY4 A;  1A8V A;  4C2M H;  1EIY B;  3I2Z A;  2HQL A;  3OTO L;  1CSP A;  3S16 H;  4A3B H;  3D0F A;  5IYD H;  3CW2 C;  5DLQ E;  2KHI A;  3CD6 A;  1P8L A;  2PNH A;  1E1O A;  2KCM A;  3NEN A;  1BBU A;  2YTX A;  1IXR A;  5H1S E;  1LUZ A;  1VQA A;  1YZ6 A;  2IHF A;  2JQO A;  2MNA A;  4NXM L;  3PIO A;  2A19 A;  4DV6 Q;  2MO1 A;  3B6Y A;  4DV4 Q;  4GKJ Q;  1TWC H;  1E1T A;  2QA4 A;  1TWH H;  2WAQ G;  5LMU L;  2K50 A;  4IPC A;  2KCT A;  3M3Y H;  4DR6 L;  4JBW A;  1FGU A;  1PYS B;  2NN6 G;  1X54 A;  2F4V L;  4JOI C;  2BA1 A;  3L0O A;  3J80 c;  1JB7 A;  1EIF A;  5IT9 c;  3LGJ A;  1FJG L;  1LTL A;  1YI2 A;  3HOW H;  3OTO Q;  3H0G H;  2Q2U A;  1V1Q A;  3RR5 A;  1SRU A;  1N33 L;  3GDE A;  2WB1 E;  4X62 L;  4GOP C;  1E7Z A;  1KIX A;  1Q46 A;  2R7F A;  1Y1W G;  1R9T H;  3CCV A;  3GTK H;  3KJP A;  4NXM Q;  4GN5 A;  3CPW A;  3HKZ G;  3IRB A;  3KF6 B;  4DV0 L;  4DR2 L;  4UP9 A;  1YIJ A;  3HOZ H;  2OCE A;  3PF4 A;  1CUK A;  2K5N A;  3S15 H;  3TS0 A;  2HHH L;  4MNO A;  4AQY L;  2CCZ A;  4DR6 Q;  4A3K G;  4OX9 L;  4A93 G;  2F4V Q;  1PH7 A;  3MXN B;  4PZ7 A;  2R93 G;  2JEB I;  4B3T L;  1CKN B;  3TEH B;  5C4J H;  2UU9 Q;  3H3V H;  2VY3 A;  4GN4 B;  4A3C G;  2VZA A;  1FJG Q;  1C0A A;  3E0E A;  4R4C A;  4KHP Q;  1XMO L;  4X62 Q;  1KQS A;  5J3B A;  3UDG A;  4HJA A;  3CCR A;  4OWX B;  3OW2 A;  4A93 H;  4BA2 I;  1I5F A;  1KC8 C;  4X6A H;  1PH8 A;  2XTI A;  2PQA A;  2R93 H;  1WFQ A;  3F8T A;  4DUY L;  1X3E A;  4P73 A;  2I5H A;  2LSS A;  3CMA A;  1VQ4 A;  4AQY Q;  2B29 A;  1GO3 E;  4X64 L;  3H3V I;  3F1Z A;  4OX9 Q;  4JC0 A;  4A3F G;  1FL0 A;  1UEB A;  1YVC A;  4DR7 L;  3UDF A;  4B3T Q;  4LWC A;  1HR0 L;  1AH9 A;  5IE8 A;  5LMN W;  4BBS G;  4DR1 L;  4QY7 A;  3U50 C;  1PH4 A;  4DUZ Q;  1VQ7 A;  1WOC A;  2K5V A;  1TWG H;  5AJ3 L;  4DR5 L;  1Q81 C;  1N36 L;  2UXC L;  4JI4 L;  3HOY G;  2R7Z G;  4B3R Q;  2BH2 A;  1K83 H;  3HKZ E;  2Y0S G;  2FXQ A;  4EX5 A;  4NB3 A;  3G4S A;  2AWO A;  5HY6 A;  1E3P A;  4QQB X;  2HIV A;  3J80 i;  3CCS A;  4JV5 L;  4DUY Q;  3GD7 A;  4JI2 L;  3H15 A;  1XNR Q;  3M7N A;  1EFW A;  3Q8D A;  1VQE A;  1XPU A;  2K75 A;  4X64 Q;  4IOC A;  2JEA I;  3AEV A;  3CCE A;  3PUY A;  1IZ6 A;  2CWP A;  2R7Z H;  3FKI H;  3HOY H;  4OXP A;  1HZ9 A;  5ELO A;  2VQE Q;  3M4P A;  4UPA A;  1VQP A;  2A1A A;  1LYL A;  1WI5 A;  4JI8 L;  1VQC A;  5FLM G;  4IPH A;  2Q2I A;  1XTD A;  3GTL H;  1JT8 A;  4LF9 L;  1DGS A;  4A75 A;  4DR5 Q;  1N36 Q;  4OO1 I;  4IJL A;  2UXC Q;  3CCM A;  1JJG A;  1M1K C;  2K5H A;  1WYD A;  1KHI A;  2UUA Q;  1Q86 C;  4JV5 Q;  4Y7N H;  2UUB L;  5M5Y H;  1TXY A;  4JI2 Q;  2WB1 G;  4MZ9 A;  4B3S L;  1S3O A;  5M5X H;  1V9P A;  2OTL A;  3PV0 A;  2MFI A;  1ASZ A;  4LFB L;  1QVF A;  2NVY H;  3L7Z C;  4DV2 L;  4DR3 Q;  3S1R H;  1KXL A;  5JJI A;  1BBW A;  3EIV A;  3CCJ A;  3RLF A;  4LF6 L;  4TQU S;  4GNX C;  1VQH A;  1EOV A;  4H02 A;  2YTY A;  3CQZ H;  3AFP A;  1EWI A;  1RL2 A;  2ZJP A;  3S1Q H;  3S1M H;  1SN8 A;  1HZA A;  1A0I A;  1VCI A;  4JBJ A;  1IL2 A;  2PQA B;  1HJP A;  2IX1 A;  1PH6 A;  4LF4 Q;  3F2D A;  1JMC A;  4DV3 Q;  3CAM A;  2E5L L;  1K8A C;  1EQQ A;  2VS1 A;  3TQY A;  2L15 A;  2QEX A;  3K80 C;  3UDI A;  4OON A;  2Z6K A;  1XJV A;  2JA7 H;  3HOW G;  2N8N A;  3AYH B;  3PUZ A;  3H0G G;  5GAH C;  1D7Q A;  4LFB Q;  1HZC A;  3J7A 5;  4LFC Q;  1QZG A;  3S14 H;  1ASY A;  3G6E A;  3RN2 A;  1CKO A;  3CP0 A;  3EN2 A;  3CCL A;  4YCW A;  4LF6 Q;  1N9W A;  4YY3 L;  1NE3 A;  3TRE A;  3HKS A;  3GTQ H;  1P16 A;  2HT1 A;  3HOZ G;  1QVG A;  4LFA L;  5GAE C;  1OXX K;  3M4O H;  2ZTD A;  2PMZ E;  2I5L X;  4HJ8 A;  3M85 A;  1GM5 A;  1U0L A;  5K36 G;  1VQF A;  3GTP H;  2DGY A;  4PZ8 A;  2CQO A;  4AIM A;  2AWN A;  3DM3 A;  2UXD L;  2F3I A;  4QJF A;  3UE0 A;  1X3G A;  4IOA A;  4LNQ A;  4POG A;  4RMF A;  4JI6 L;  3CCU A;  1VQI A;  2OQ0 A;  1VQD A;  3F2B A;  1QVC A;  3ZJY C;  4DV1 L;  5LMU Q;  5GQO A;  2AMC B;  3S17 H;  2ZM6 L;  4P75 A;  1KAW A;  1SMX A;  5GRO A;  4YY3 Q;  2UUC L;  4K0K L;  3A0J A;  1B8A A;  3CC4 A;  3F2C A;  1UWV A;  2EXD A;  3PO3 H;  2ID0 A;  4A4I A;  1XNQ L;  1NMF A;  4R4O A;  2RF4 A;  4YHH L;  1JJC B;  4KHZ A;  1SFO H;  1L1O A;  1KD1 C;  1OXT A;  3SGI A;  1PH5 A;  5IY0 A;  2ZJQ A;  1N33 Q;  1V43 A;  4HJ5 A;  2N78 A;  2JA5 G;  2NVQ H;  2NZO A;  3CME A;  3PSI A;  2R6G A;  2OTJ A;  3EBE A;  3G48 A;  4XTC S;  4A3G G;  1MJE A;  1KL9 A;  3I4O A;  4A3J G;  4JI6 Q;  4BY7 H;  1HH2 P;  4DV0 Q;  3HOX G;  1IYJ B;  3AQQ A;  4JI3 L;  1K3R A;  4DR2 Q;  1PH3 A;  1G51 A;  1U5K A;  2HHH Q;  2BH8 A;  4O2D A;  1C7Y A;  4UY8 C;  3ICE A;  2JA5 H;  2EIF A;  4K0K Q;  2CWA A;  1BVS A;  4BXX H;  1OTC A;  1Q8K A;  4A3G H;  2WP8 J;  4YHH Q;  4A3J H;  2JA9 A;  4OWT B;  3HOX H;  4LF7 L;  4OO1 G;  3K7U C;  4IPD A;  1VQ9 A;  2Q2T A;  1I3Q H;  1XMO Q;  2KHJ A;  4B3M L;  4L5S A;  1YNX A;  3FKI G;  1OXV A;  1MJC A;  2VQF L;  4BY1 H;  3W5O A;  2AKW B;  4GN3 B;  4JOI A;  4DK3 C;  3DLL A;  3U58 A;  1J5E L;  3PUW A;  1NTG A;  3STB C;  4A3M G;  3RNU A;  1OXU A;  3FP9 A;  3J81 i;  4HJ9 A;  3HOU G;  2JJQ A;  4KI0 A;  3I4N G;  4GKK L;  2ZTE A;  3KDF A;  4DR7 Q;  4GOP A;  3VDY A;  1NMG A;  5BR8 L;  2R92 G;  1CKM A;  1GVP A;  1SRO A;  1IBL L;  5E7N A;  3CXC A;  1PV4 A;  1PH9 A;  1HR0 Q;  1VQJ A;  4LF7 Q;  3ULP A;  2YTV A;  2ES2 A;  4ALP A;  4DR1 Q;  2IX0 A;  4MTN A;  4A3M H;  4LF8 L;  1Q1E A;  1KRT A;  3TS2 A;  2IY5 B;  3HOU H;  4DNI A;  5AJ3 Q;  4LF5 L;  4NXN L;  2E2I H;  4JI4 Q;  1HNX L;  1EUJ A;  4X66 L;  2DUD A;  3I4N H;  2VQF Q;  1HNW L;  5JJK A;  4O0A A;  1Y14 B;  4IO9 A;  1T9H A;  2CFM A;  2YYZ A;  4GLA C;  3T1H L;  3STB D;  4IFD I;  3CC7 A;  3AFQ A;  2R92 H;  3PUV A;  4YWL A;  4A3D G;  4LW1 A;  2JE6 I;  3UE1 A;  1X3F A;  1GD7 A;  4ME3 A;  4R4T A;  1W2B A;  1X9N A;  5IWA L;  3PGZ A;  5BR8 Q;  1I94 L;  2HIX A;  2D0P A;  1L1O B;  4L5T A;  3CF5 A;  4IPG A;  4QL5 A;  3BU2 A;  4JI8 Q;  2A8V A;  2C35 B;  3K0X A;  3K7A H;  4A3D H;  1UE6 A;  4JI1 L;  4JI5 L;  4L5R C;  4LUO A;  4GLV B;  3RLO A;  1JE5 A;  2VW9 A;  1A62 A;  1FVI A;  4LF8 Q;  4LF9 Q;  2JA7 G;  4LF5 Q;  1YJ9 A;  4JG2 A;  4NXN Q;  3ER0 A;  2CKZ B;  5C44 G;  4TVA B;  1G29 1;  1OXS C;  1RIP A;  1HNX Q;  3KFU A;  3NBH B;  1G6P A;  5JEA G;  2ASB A;  4WJ4 A;  3M4Q A;  4KLK A;  3W1G A;  5C0X G;  1YEZ A;  4HIO A;  4YCU A;  2UUB Q;  3S2H H;  2PI2 E;  1Z9F A;  4DV7 L;  3T1Y L;  1PHJ A;  1UE1 A;  3HFZ B;  3G71 A;  2D0O A;  4DV6 L;  4DV4 L;  4B3S Q;  3RLN A;  1UE5 A;  1W3S A;  4C3I H;  2VL6 A;  3BJU A;  5C44 H;  1YHA A;  1X55 A;  3S2D H;  4UP7 A;  4DV2 Q;  3GO5 A;  1I94 Q;  1XMQ L;  4JI7 L;  4BBR G;  4NPS A;  3K81 C;  1Y1V G;  3NEL A;  4PMW A;  1S40 A;  5IP7 G;  4JI1 Q;  5IYB G;  4JI5 Q;  3GTJ H;  1Q12 A;  1XPO A;  5M3F G;  2D62 A;  5M3M G;  5M5W H;  3L2P A;  1VQL A;  3J81 c;  1WCM H;  3FHW A;  4QGU A;  1B7Y B;  3ERS X;  5EAY A;  4DPG A;  2Q2H A;  4POF A;  1B70 B;  1L2F A;  3NEM A;  3I7F A;  4IFD J;  2E5L Q;  3GTO H;  3KYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...