3HP3A

Crystal structure of cxcl12
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
SLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CXCL12 protein
publication title Heterologous quaternary structure of CXCL12 and its relationship to the CC chemokine family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 9
structure length 64
sequence length 64
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3hp3A00
1Q3LA 2B2TA 2B2UC 2KUMA 3DM1A 3GV6A 4CJ2C 3ONAB 2IL8A 1ML0D 1O7ZA 3HP3A 5JJZA 4RWSC 2J7ZA 1B2TA 3GV3A 4HAEA 4ZKBB 2KECA 2N88A 3UI2A 1HRJA 4X3UA 2VXWA 4CJ0B 2K28A 2B2VA 1ESRA 1HFGA 1O80A 4DN4M 1ICWA 2K04A 2HCCA 3QO2A 1E0BA 1BF4A 1G6ZA 1WTOA 1EOTA 5CMDA 1ILPA 2MGSA 5T1IA 1U4PA 1X3QA 2H1EA 3MWYW 4OIKA 2L9HA 1PDQA 1X3PA 4ZAIA 4IUVA 1SAPA 1B4OA 1DOMA 4IUTA 5EKIA 1WTPA 3Q6SA 5CBAE 2EE1A 2RSNA 4XDXA 5EQ0A 4IUQA 5CORA 4IUPA 1X32A 2B2WA 1C8CA 3TZDA 1VMCA 1F9PA 4CJ1B 1QG7A 1HA6A 5EPJA 1WTVA 1SSOA 1HHVA 1MSHA 1NR2A 2NYZD 2MP1A 4O42A 4RAUC 1DOKA 1JE4A 2HDMA 1A15A 1WTXA 3DEOA 4X3KA 1NAPA 3D6WA 5E4WC 5EPKA 1J8IA 3I8ZA 1RTNA 4HSVA 1U4LA 2X6GA 1U4RA 2M2LA 2N55A 1HFNA 1WD0A 1AZPA 1KNAA 2CVRA 2KEEA 1EIHA 5EPLA 1CM9A 2B2UA 3TN2A 2DY7A 2BDNA 2JP1A 4U68A 1MSGA 4ZK9B 3IL8A 4X3SA 1HUMA 5E4XA 1AZQA 2B2YC 1F2LA 1ILQA 2FHTA 1WTRA 1B53A 4MHEA 1WTQA 2L12A 2K1BA 1CA5A 2HDLA 1NR4A 1VMPA 2FFKB 4IURA 4ZKCB 4X3TA 1TVXA 3N52A 3IFDA 2HUGA 1QNKA 3R93A 1EL0A 2B2TC 1B3AA 1JICA 5EJWA 1WVLA 5CBEE 1IL8A 1IKLA 1BO0A 1PLFA 3I91A 4HCSA 1XYIA 1WD1A 2FJ2A 2KEDA 3SVMA 2NZ1D 2FINB 2Q8TA 2L1BA 2MJ8A 5D65A 1BNZA 1F9RA 1ZXTA 1PFNA 1RTOA 1G91A 1PFBA 2B2VC 2FMMA 1SDFA 3MTSA 2K03A 3I90A 4RA8A 1EQTA 2D9UA 4UAIA 1O7YA 1MI2A 1F9QA 2Q8RE 4MN3A 1AP0A 1CA6A 5DNFA 2SDFA 2K05A 2RSOA 1BBXC 1G2TA 2RVLA 2X69A 3KBXA 4LMQD 4NW2A 1WTWA 1U4MA 3G7LA 3FPUB 1RJTA 4OIJA 1RHPA 4XT1B 1PFMA 1RODA 3H91A 4R8IA 2B2WC 2K01A 3I3CA 1KNEA 3P7JA 4ZLTF 1M8AA 2KOLA 1IKMA 1DONA 1DZ1A 2R3ZA 1QE6A 1LV9A 5D14A 1XX8A 3LWEA 4QUFA 1F9SA 2EOTA 1J9OA 4XT3B 5AFWA 5T1GA 4R9WA 2B2YA 1MGSA 1NCVA 1B50A 4IUUA 2EPBA 5COYA 2DY8A 3DEPA 3KUPA 2JYOA 2XIWA 3FDTA 2HCIA 2MPMA 1G2SA 1DOLA 2L4NA 2NWGA 1HUNA 2L11A 2RA4A 2KVMA 4HEDA 1S4ZA 4QUCA 2X6LA 3F2UA 1EIGA 1GUWA
chains in the Genus database with same CATH superfamily
3S1QB 4JPBW 2K75A 1VQIA 1XTCD 2RBMA 1VDZA 4Y52H 5FJ8H 3SK6A 2B2VA 1PYWD 5IP7G 2ENBA 4DN4M 5FK9C 3PO3B 1U5KA 1YNNC 2MGSA 1U4PA 1H9RA 2H1EA 4AYBB 2B39A 4K0KQ 1FJGQ 1YEZA 1VQGA 2HQLA 4AIMA 1PFSA 1LTID 3G6JB 3FP9A 1Y8PB 1DJRD 2O2LD 1MSHA 4EGVA 4GN5A 1FR3A 1GJXA 1D8LA 5IWAL 1EY8A 1A15A 1NE3A 4IZ8A 4CDEC 1J8IA 1LTBD 2VW9A 1N9WA 3C1FA 1UE6A 1O7LA 2Q2TA 3OHXC 2LFNA 2KEEA 1BUVT 1CM9A 4OWXB 1PA6A 3T1HQ 2KHJA 2B2YC 2FHTA 2IPKD 2HDLA 5M3FH 2IHEA 3K58A 3NENA 1D2BA 2IX0A 4BY1B 2NVXH 1JCKB 4JI3Q 3FKIB 3K81C 2A68C 2WB1G 1HZCA 4A3IH 1WD1A 3AQQA 2AWOA 3GDEA 3WOFA 1C7YA 1IYJB 5D65A 1PFNA 5C0XJ 3HKSA 1HZ9A 3I4NB 3A5UA 1PVOA 2Y0SB 3DWQA 2XVSA 3RZDB 1O7YA 3STBC 4YY3L 4WRDA 3D4RA 5C3EB 3HOXB 2UUBQ 2I0QA 4G4KA 4LMQD 3GTGH 1TWHB 4RHRA 1A3UA 2BA1A 4PMWA 4C3JB 4OL7A 4A3BH 3LWUA 1HQMC 4KN4C 1WCMB 2R7ZB 2PZTA 1WYDA 3K7UC 3G6EA 1Q1BA 4JVZA 5IGFA 1SROA 4P71A 1ENFA 4BA1I 2K50A 2NVQH 2L4NA 2HQEA 3RLNA 4A3KG 1Y1WG 3HOVB 2KVMA 1L0WA 1VQ7A 1S4ZA 3S14H 2ICIA 1N36Q 1W3SA 2PW5A 4AYBE 1KD1C 5M3MB 3GTKB 2BH8A 3GTPB 1J5EQ 1AFPA 1ZKOA 2YTVA 3A56A 3QOLA 1ENCA 4F7XA 3PIOA 4FF1A 4DR3Q 2K28A 2EYPA 1ESRA 2CQAA 4X6AH 3LX0A 3PIP3 2CKZB 4P73A 1G6ZA 1V9PA 4J6HA 2DNEA 4DF7A 1GUTA 2JA5G 1Y1VH 3I70A 3P1HA 4YHHQ 3CCUA 5CV6A 4DR4L 2ATWA 2GVAA 2KHIA 4ZCKA 3AU7A 1TY2A 2PYKA 1PTOH 1CZWA 1HHVA 4NB3A 1IBMQ 2A19A 2R93G 5CV5A 2XRQD 3AEVA 4JBJA 5L37A 4A93H 4JC0A 2N55A 1ET9A 3H0GG 1LM0A 1D5XC 3TZUA 1SNQA 4R8NA 4JI8Q 2B2UA 4U68A 4BY7B 3V2TA 3KBGA 2RCNA 4X66Q 4H7BA 1F77A 3D0FA 1EOVA 2L12A 3F2BA 2Y0SE 1MD2D 2WAQB 1KIXA 2B63G 4Y7NH 2HIVA 1EU4A 1II3A 1QNKA 3NUCA 4B3TL 1JICA 1KDBA 3VDYA 1VQLA 1IKLA 1A8VA 4JI0Q 2ALYB 3RN2A 1ASYA 3QIAA 2NTSA 1BNZA 2PO4A 1GKHA 2PNHA 4ID6A 4K2KA 4UAIA 4HSPA 1YZ6A 1PYBA 4FO2A 2EYLA 3E9IA 4DXFA 5DNFA 4DV2Q 4DR1Q 3MVVA 4BXXH 1E1OA 1PH6A 3G7LA 4FF2A 5AJ3L 2QGQA 4YWLA 1WVLA 4YWKA 3UDXA 3I3CA 1IKMA 5I9PA 4F8MA 2I5HA 2OQ0A 1L0XB 4XT3B 4DPGA 1A63A 1B44D 3TMEA 4A4IA 2NZHA 2MO0A 1ONLA 1IBLL 1SBBB 2B29A 1ZEQX 2EXDA 3A0JA 4A3GB 1Q8IA 1NBWA 1DOLA 2A69D 5LMUL 4AQYQ 3F2UA 2F52A 2B2TA 1YNXA 4JI7L 2Z0SA 4FDBA 3NP8A 1ML0D 5FLMG 2GN5A 2KECA 1HA5A 5ELFA 5JEAH 3HZXA 1NSNS 3HOYB 1H9SA 1E0BA 1I50H 1CKNA 3MWYW 3CMAA 2KHSA 4KD3A 5BR8Q 2RSNA 3EJIA 3HOUH 5CORA 2AQ3B 1TWCH 2VUMG 4DV0L 4HJ8A 4JYAL 1HA6A 1C48A 1V1PB 3BG3A 3NTIA 4JG2A 1PV4A 2F4VL 1MKHA 2BDOA 2EY6A 3K8AA 5G3LD 1EY9A 1XNRL 3NTHA 1SJED 3SHLA 1CZGA 3S1QH 4I7AA 5EPLA 4BBSH 1UE1A 1BCPF 4DR2L 1JQYD 2EY1A 3HOZB 1TS3A 1JB7A 3KYHC 2PMZE 2F0UA 4DK3C 1NR4A 3J7ZC 4IURA 3DM3A 3PO3H 1VF7A 2AQ2B 3N52A 3D4WA 1EQQA 4X62Q 3J81i 2F0TA 2O4XA 1BCPD 1SJHD 5DLQE 4LAAA 4PMCA 4L5RC 2GVBA 2FJ2A 3K0XA 3SVMA 5CV9A 3U4VA 3M85A 2VS1A 2J4XA 3E3XA 4A3EG 1S5ED 1IYUA 4PV1C 2B2VC 3CQZH 3TBIB 4PZ8A 3CF5A 4BBRB 5IE8A 5C4ZA 3S2HH 2JA7B 1P16A 1MI2A 1N32Q 1S72A 2E2IH 1STYA 3UDFA 1HCZA 3KK7A 1CQVA 1QVFA 1WTWA 4J1MA 1YBYA 2BH2A 1LTRD 3HG9A 4TSSA 4TQUS 1PRTF 2DJFC 1RODA 1K9MC 3Q24A 5I4DA 1WTHA 4JI6L 2UXBQ 3KF8B 3NBHA 1HNXQ 3RD4A 4DAYA 3ND9A 4IOAA 2EJGC 2XRSD 1NCVA 1STNA 1K8GA 3NQTA 3DEPA 3WOEA 2NWGA 4DUZQ 3EROA 3FKIH 2C5CA 1I94L 4OELB 2OWOA 2IL8A 3HFZB 1F2MA 2JSOA 2R7FA 4PG3A 4ZKBB 3I4NH 1H9JA 4PZ7A 5CV7A 1TU2B 3RUZA 2HCCA 4FNFA 1EWCA 5F2DA 3DWAA 4IUNA 4WORA 3Q23A 1GUNA 1KLGD 4IUTA 3K5LA 2CH4W 2K4KA 3OPOA 3OW2A 1WCMH 5DM73 1NMGA 4LFBQ 3MXUA 3E0EA 5EPJA 3S15B 1CKMA 5CV8A 4YCWA 2KCNA 4B3SQ 1SLJA 4QJFA 1TIID 1DOKA 2NB0A 2PI2E 4LF8L 1NY4A 3N6RA 4ZUIA 3VA7A 3G71A 2OXPA 1QILA 2F0MA 3HOVH 2M2LA 3I55A 1L1OB 4YIJA 5M3MH 3GTKH 4A3LH 3GTPH 1IYVA 4B3MQ 4KHPL 4A3IB 1A62A 1IL2A 3DHQA 1B53A 3FHWA 1CT1D 1KAAA 1OO9B 1RDPD 3T1YQ 2DN8A 3EFXD 1PXUA 4JI5L 3DWPA 2HHHQ 4K8JA 1PH9A 3A8IE 2Z6KA 2MNAA 2OCEA 1MHWC 4JCVE 2SNMA 2QDLA 1K28A 5C5MA 4A3BB 4DV6L 1I4XA 2LKVA 4ZRZA 3GP7A 4KI0A 1SNMA 3WWVA 1B70B 4ILWA 3P20A 4A3JH 1SFOB 3JAML 5KEEA 1KHIA 1U4MA 4JBKA 1LT5D 4OXPA 2N8NA 1C4QA 2PZUA 4R4TA 2NVQB 2A69C 2K01A 4BY7H 3PO2G 3S1MH 2D2CC 1F9SA 4HN7A 1KAWA 2CQOA 4IUUA 5CC4A 4LF6Q 1N34Q 3K5OA 4JOIA 2DUDA 3FDTA 1A2TA 3D31A 4DV3Q 3K80C 1DCZA 4AYBG 5IYCG 3M3YH 2EIFA 2B2UC 2KUMA 3GV6A 5ISRA 3RR5A 1OXXK 2BE5D 3HP3A 1O7ZA 3S1NH 1Y1VB 3GO5A 1N33Q 3IFTA 4ODGA 4GKKQ 2Q2HA 5FLXc 2UUCL 4CJ0B 3QWNA 1F2ZA 2JA9A 3I73A 4RGNA 3TP7A 4HIKA 1PTOB 5LMNQ 1DD2A 1EY6A 2YYZA 1JJGA 1EYAA 3MFGA 5EKIA 2AUKA 4GN4B 1ESFA 1W6JA 4A93B 2XWBB 1PH5A 2I5LX 2JEBI 4GKJQ 1FYCA 1U0LA 1YJWA 2JA8H 1XMQQ 1HR0Q 2A74C 3OTOL 2F0JA 1R4QB 2NYZD 4K0KL 4QB4A 3X3NA 4A3GH 4RG1A 1K8AC 4LF7Q 4OX9Q 1MJCA 2KCCA 4IJHA 5C44G 3TREA 2QDBA 1PZID 4XYQA 5LHY1 2E2HH 3TDQA 1BCPC 1JB3A 4OWTB 1RF2D 3L9AX 4HCEA 4QL5A 3PGZA 2Y0SG 2QW7A 5C3EG 4DR6L 3HOXG 4YCUA 3SEBA 1GO3E 1LT6D 1B3QA 4A3DH 2B2TC 4RGTA 4C3JG 4EQNA 1HZBA 1BO0A 2R7ZG 2FINB 1X9NA 4HJAA 3U9OA 4A75A 5JOBA 1G91A 1PFBA 5C4XG 1CUKA 2V1CC 2OF1A 4C1NK 3K6OA 3GD7A 4QIWB 1VQCA 3W2DA 2D62A 4C56C 2FXQA 2HIXA 2X69A 4OGQC 3W1BA 4WJWA 2G5DA 2Z1CA 3CRLC 3ERQA 4IALA 3FPUB 2NVTB 1QWYA 3KLSX 3ULJA 3NEMA 1XXGA 5IYDH 4L5SA 4NDXA 1XMOL 1T5XD 5K36G 3PIPA 2PPBC 1MGSA 1R4PB 2E5LL 2EPBA 5COYA 1SE3A 3OSOA 2IW3A 1VQAA 5J3BA 1E7ZA 2NUCA 2EZVA 4IFDJ 3C2PA 1EIGA 3M9BA 1CQFA 1I50B 1LT3D 5JJZA 3KJOA 1KL9A 1TWFB 4A3KH 1B2TA 3CRKC 2DNCA 1SYFA 3Q8DA 4A3FG 4R1JA 1TWCB 1KDCA 3U58A 3A8JE 2E74C 2K04A 3QO2A 5ELEA 3TSSA 4DAPA 2XNAC 4DAVA 5IGEA 1WTOA 4C3HH 4DV5Q 2ZJPA 1X6OA 1PH8A 1VQPA 4OEMB 1TWGB 1WTPA 1SE4A 3MFYA 1GUOA 5EQ0A 2A6ED 4X65L 1XPUA 3KLSA 2RHSB 3SE0A 4LUVA 1NR2A 5JVG3 4BBSB 1KABA 1EQRA 2WINB 2AWNA 1XTDA 3PV0A 4DV1L 3D4DA 2AMCB 3PUWA 1E2WA 4HJ7A 1QB5D 2BOSA 5M5YB 2N78A 1QOHA 5EBDA 4OO1H 4QMGA 3SK8A 1JR0D 2RDHA 3W1GA 1F2LA 1SEBD 2UXDL 5FO9B 1TT2A 1IBKL 2VQFQ 1VMPA 3CQZB 5C0XH 3R93A 4QIWE 3S2HB 1EYDA 4B3RQ 3C1EA 3S9WA 5KNDA 1X56A 2E2IB 1JWMD 1X3EA 4P75A 5FO7B 3NHHA 3I2ZA 5IYBH 2E75C 3CCLA 3S15H 2L55A 2VB2X 3HOWG 2DGYA 2C9OA 2K03A 4LF9Q 1EFID 3AYHB 1LABA 1F9QA 4JV5Q 3I56A 1CA6A 3OWEB 3VYRA 3ZJYC 1BXTA 4JI0L 4IPHA 5CYUA 3J81c 1QJOA 4CDCC 4IFDG 5IT9E 3H3VC 4UPAA 1M8AA 3PSIA 4IOCA 2HT1A 1SE8A 4L8JA 2R3ZA 2BE5C 1EY4A 3JC66 4DR1L 3B6YA 5D3IB 1D7QA 3HOYG 3V96A 1GUGA 2KCTA 4EQ5A 5IGDA 3RLOA 3MEHA 1D6EC 3KDFB 3PQIA 1PH3A 2ZJQA 4CHTB 3A8KE 3L0OA 1HUNA 4OO1I 3PUYA 1HNZQ 4LF5L 3R2TA 2F0GA 3PUVA 4DR5Q 3DM1A 2RF4A 3ONAB 1TY0A 3M7GA 1VF5C 4LNQA 1YHBA 2K32A 3NELA 5J39A 4X3UA 5C0XI 4DR7L 3PUZA 2E8GA 1CTMA 4KK7A 4RH6A 4QF4A 4AQYL 2UUAQ 3CP0A 1SFOH 1X3QA 4LF4L 1CSPA 2L9HA 4QCLA 2H4OA 4IUVA 2Z6KC 1B4OA 3S1RB 1TWAB 4XDXA 4KTAA 3CCRA 4QGUA 4KY6A 2CFMA 2ID0A 3TZDA 2IX1A 3HOZG 3U50C 5BN5A 1UNSA 4JI4Q 3OMCA 1JE4A 1K3BC 5E7NA 5EPKA 1GHJA 2OQKA 5IT9c 4JBWA 1RTNA 1VQDA 1ET6A 1Q81C 2ES2A 2BDNA 1MSGA 4FF3A 5I6YA 4BBRG 1CK1A 1EYGA 2JA7G 1XPOA 4F88A 4JOIC 4MNOA 4RGMA 4MHEA 3VYTA 2K1BA 3J80E 4A3MH 4WJ3M 4X3TA 4L63B 5I2XA 1BQQT 1V1PA 4UP7A 3BDCA 1B3AA 4KHVA 2M00A 4X64L 3I91A 2F0DA 4A3CH 4A3JB 2MJ8A 1AE2A 2N49A 1ZXTA 3QJYA 3RNUA 1VQ6A 5A35A 2A1AA 1DYQA 1LTGD 1KC8C 2EYHA 3BYYB 3S1MB 1STBA 1AP0A 4GOPA 1Y8OB 2VY3A 3EIVA 5FJ8G 1NNXA 2CHBD 5DEHA 2PI2A 3CPFA 1K3RA 4OIJA 3OWFA 1CHQD 1LTLA 1PZJD 1QVCA 2K7VA 3M3YB 1S5FD 3QOJA 1N32L 4ME5A 5D14A 5A2QL 3IAYA 3E0JA 1NTGA 3S1NB 2DY8A 3KF6A 4J8QA 4CKBA 1G291 2L11A 1DGSA 3CAMA 4UHVA 3PF4A 4UDUC 3NWTA 1HNXL 2JQOA 3OIQA 2Q2UA 1STHA 1ZYRD 2XGTA 2PQAA 4KMUC 1HR0W 2K5QA 2LXKA 2F3IA 4C3IG 4NMZA 5K5PA 4DNTB 2A6EC 3M4YA 5KYIA 2M9VA 4B08A 1HFGA 1KXLA 2JA8B 1VQFA 2UXCL 4JI1Q 1X3FA 1O78A 1KRTA 2I46A 4MTKA 5HY6A 4IQZA 5M3FG 1Q7YC 1VQKA 2NVTH 1SNPA 1EWHA 1BBUA 1OXVA 1PH7A 2TSSA 1BKBA 3L3OC 5GAEC 4GNXB 2Z6BA 2E2HB 4POGA 3TRZA 4YY3Q 4DV4L 3H3VI 3DEOA 5FLXL 2H5XA 2MQHA 1GOZA 3AB9A 5IODA 4LFBL 4CKEA 2LS01 3M4PA 1KNAA 2JA6H 2F1MA 2ZM6L 4A3DB 1SE2A 3TN2A 1TWFH 4POFA 1AZQA 4A3BG 3T51B 2Q2IA 5G3LF 1TS2A 2AQ1B 3UE0A 2JJQA 3W5OA 3GQBA 3A5ZB 1FD7D 3EVQA 2F0PA 3VYSA 1I6HH 1MJEA 2F0QA 4UY8C 4EVOA 1TWGH 3I4MG 1SNDA 2KEDA 3VR4A 3VA5A 2Q8TA 1JOKA 2WAQE 1WFQA 2D0PA 5C4JB 5LL6X 5BN4A 3F2CA 1L1OA 3OYYA 2EJFC 3T1YL 1SYEA 5JVH3 1E2ZA 4E6IA 1K8OA 5KRUA 3A74A 4O0AA 2K05A 4MZ9A 3J7YW 4U673 1HTPA 1YNJD 5M5YH 1BDOA 1KNEA 1Y1VG 1I4RA 4DR4Q 2ZTCA 2A73B 2YU9H 1Z9FA 5AFWA 2VQEQ 3SGIA 1I6VC 1AN8A 3A7AB 1B50A 3TP5A 4EQOA 4A3KB 1SR3A 3BYTB 3QR8A 5EAYA 1Y1WB 2R92H 2RA4A 1YHQA 1Q8KA 4JBMA 2QF7A 2N3SA 4A93G 2EDGA 4C3HB 5FOBB 3HS0C 2NBFA 1HRJA 4N8X1 2VL6A 5CV4A 2JA5B 2BA0A 3OOCA 1ILPA 3H15A 3T16A 1X3PA 4B3TQ 1T5EA 1RCVD 4IUQA 3MXNA 1OXTA 3WDNA 1QZHA 2R93B 3T53B 4V0BA 3M4OH 1SSOA 3BDLA 1TXYA 1C9OA 4KY5A 3EQLC 1BCPB 1V8QA 2F03A 3H0GB 1LTAD 1FVIA 4HSVA 1A3VA 4GKJL 5HGTA 1W6KA 1W2BA 1WD0A 5AJ3Q 1I4GA 1HR0L 4BXXG 1PH4A 4O2DA 2MHVA 5JAVA 2EYMA 5M5XB 5C44H 2JE6I 4LF7L 4OX9L 3VR2A 2PCFB 5IGCA 4P74A 4H02A 2WACA 4RMFA 4IPGA 1G6PA 1WTQA 4ZKCB 3S17H 4HJ9A 1SYDA 1TVXA 3MXPA 3S2DH 4RKBA 3G4SA 2ASBA 3S1RH 1HNWL 1A2UA 3MC0B 5LMUQ 1TWAH 1CKNB 1PLFA 2NN6H 4IO9A 4JI7Q 1PRTB 3GTOH 4RGOS 1GXDC 4B9WA 3TEHB 1E2VA 2E2DC 1SYBA 3CCEA 4KKUA 1CKOA 5CGKA 4RFBA 2RVLA 5C4XH 1BR9A 1IXRA 1EZ6A 1S3OA 4KY7A 1CI3M 3P7JA 4ZLTF 1FL0A 1EWIA 4NXML 2F0LA 1ZYRC 4DV0Q 3I7FA 2EOTA 5T1GA 3HOUG 4L5QA 4JYAQ 2RHQB 3EBEA 3GTQB 5IOCA 2JYOA 2F4VQ 2Z4IA 2K5WA 1XNQL 2D5DA 1EYCA 2F0HA 1XNRQ 3K59A 2L0CA 3GTMH 1GUWA 2F0SA 1KQSA 3NWSA 5ELCA 3J81L 2F3VA 1E24A 1V1OA 2N88A 4R4CA 3CCVA 4DR2Q 1BOSA 4BBSG 3PMFA 4H13C 1B9NA 1LT4D 3J80i 2NN6I 2QEXA 3FPPA 3CKIB 1PTOD 4LFAL 4ZAIA 1SAPA 1STGA 1DOMA 4A3FH 3PO3G 1JMCA 4DNIA 4RHSA 4XIGS 1B8AA 2XTIA 1QNUA 4GOPC 1SNCA 3NBHB 3PUXA 2HDMA 3GTLH 5GADC 4DV7L 3D3RA 1VQHA 3R8BA 1HFNA 4NPSA 1AZPA 4A3MB 2BCOA 1RL2A 2JP1A 2FMCA 3PF5A 1HH2P 3W3AA 1HUMA 4JI6Q 5IP7H 2ZXPA 5ELNA 3X3MA 4DFAA 4GN3B 1UEBA 1CA5A 2ZT9C 2R7DA 4OONA 1A0IA 4DKAC 1SYGA 4C2MH 1PH2A 2ZJRA 1B7YB 3CCSA 1I94Q 1FJGL 4BY1G 5C6AA 1STEA 1OXUA 3FKIG 1ASZA 2NZ1D 1YNJC 4KJNA 2VQFL 3K5NA 5NUCA 1EQTA 2D9UA 4RCNA 3I4NG 5JPMC 4DK6C 1BBXC 1TKWB 5E3FA 1LTSD 3T56B 3CW2C 1QUQB 1BBWA 5C3WA 3T1HL 1DONA 1LV9A 4JV5L 5EGTA 1J9OA 1WCMG 4IFDH 3URYA 2OTJA 2IX3A 1KDAA 4JI3L 4HEDA 4CBVA 4QUCA 3C46A 4DUYQ 1L2FA 1M1KC 3HOVG 1VQ8A 2EYFA 4RWSC 5C4JH 4HAEA 4N8FA 1X55A 5M3MG 3TS0A 1LUZA 4A3LG 2KQ3A 1MIUA 2PQEA 2I5MX 4KHPQ 3BVGA 3CXCA 4HJ5A 2CWAA 4DR5L 2UUBL 4HIOA 1IW7D 2UU9Q 4HIDA 2F0FA 5TSSA 2YV5A 3QG1A 3Q6SA 4Q5VA 2WFWA 1L1OC 4CJ1B 2UUAL 2EJMA 1JC7A 2JA6B 1RIPA 3K7AB 2NTTA 4DV6Q 3SK5A 5EKKA 5IGBA 1Y14B 1Y1WH 4LUZA 1HZAA 1EY5A 1NAPA 1S5CD 3D6WA 2ICEC 5E4WC 4G7OC 1U4RA 1N36L 1EZ8A 4IFDI 4A3JG 2CVRA 4KHZA 1J5EL 1EY7A 1YHAA 1IHZA 1I6HB 4KLKA 4JI4L 1EY0A 4FXGC 4DR3L 2IWHA 2K5DA 4BY7G 3CC7A 2JA5H 2F3WA 3I4OA 4DK0A 4NXNQ 3VR5A 4M8AA 3HKZB 4N9TA 3SDZA 2O5JC 1G8ZD 4YHHL 4KN7C 2WAQG 3S16H 1Q90A 2G9DA 3UDIA 4OWWB 4UP9A 2L1BA 2R93H 1AW7A 4JI2Q 1HJPA 3JAME 1IBML 2UUCQ 2SNSA 2YU9B 3H0GH 1EIFA 1LYLA 1JOQA 2KCMA 2AKWB 3K0YA 3PO2B 4XT1B 4JI8L 2R92B 1DZ1A 3I4LA 4BWGB 5M5XH 4A76A 1XX8A 4IJLA 1Z47A 4NP5A 3CCQA 4HIMA 1RKNA 3VYUA 4X66L 3OTOQ 1B9MA 2B63H 3OMGA 3KUPA 2JA8G 1Y69U 1G2SA 3Q0AA 1JOOA 3MA2B 4Q0FA 4A3GG 1VQBA 1PTOC 2KBNA 2WKCA 4K14A 2D0OA 3NXWA 2F0NA 3TP6A 1YI2A 4DV2L 4FXKC 5IP9G 1O80A 2QILA 5D3DA 2EVBA 4C3IH 4DR6Q 5JPNC 3BZCA 3M4OB 1Q1EA 3GTJH 4OIKA 4V190 2MO1A 2VNUD 4A3DG 4ZYSA 4PMBA 5CBAE 1PMRA 4G57A 4LK1C 3JAMc 1PZKD 1OXSC 4K2LA 3DXJC 1X3GA 4JI1L 4FXDA 1UE5A 3GTQH 5C44B 2QEJC 4DU9A 1YITA 1R9TH 4BA2I 3I8ZA 3AFQA 1U4LA 4P72A 5FLMH 5M9OA 3HKZE 3S17B 1SRUA 1H9KA 4H0LC 3CD6A 3S2DB 4ULLA 2QA4A 4X3SA 1XMOQ 3J81j 5IYDG 1FNWA 2YTYA 2WKDA 2E5LQ 1L0YB 3GTOB 2IJ0A 1VQOA 5BR8L 4GNXA 1EL0A 1I5FA 3U4ZA 1DXMA 1D5MC 5EKLA 2VUMH 2LY7A 1K0SA 2L5TA 2F0WA 5FKAC 4AH6A 5C4XB 1YJ9A 1F9RA 3I4MH 4F87A 2AUJD 5E1FA 4EQPA 5H1SE 1KLUD 3H09A 4NW2A 3FVQA 4YWMA 1V43A 1GHKA 4C3HG 2KENA 1Q82C 2OEOA 4X65Q 1Z6HA 4LFCQ 2R61A 3GTMB 2J0TD 4APVA 5EBCA 4KD4A 3DLLA 1PYSB 3F8TA 5BN3A 4DV1Q 4IPDA 4X62L 4K6LA 1TS5A 2K33A 3BZKA 1IW7C 4HMIA 4CJ2C 2VQEL 2K5NA 4A3EH 2MUYA 3BDOA 2HD3A 4TRDA 1QZGA 4A3FB 4K5XA 4XYOA 1JWUD 3UI2A 1EU3A 3H3VH 4OO1G 3C3LA 2KJXA 4J15A 2RDGA 3ND8A 2UXDQ 1IBKQ 1LLRD 1ICWA 2VB3X 1BF4A 5CMDA 2IY5B 4PQXA 1GUSA 2IT1A 5LMNW 5IWAQ 3GTLB 2EE1A 5C0XG 4K5WA 5KYLA 2B2WA 4MTNA 2UXBL 1QG7A 1Y8NB 1JORA 4GS3A 4KJOA 5M5WB 5IYBG 1S40A 5IIFA 2KA7A 3J80c 3RZOH 1WTXA 4DUZL 5IY0A 1RD9D 4GZYC 2NVYH 3EA6A 1QCBD 1S5BD 2X6GA 1X65A 1K83B 1JE5A 3HRZC 1P8LA 4K6DA 4R4QA 5JJIA 4B9XA 2PMZB 2CCZA 1CHPD 3IRBA 3KF8A 1EIHA 4ZK9B 3IL8A 4C2MB 1WOCA 3CCMA 5E4XA 4BS9A 3BVZA 3BJUA 1Q12A 1SMYD 2SOBA 4XQQA 1MBYA 4A3IG 4GLAC 1JWSD 4CGYB 1ICFB 4G7HC 1TR5A 1UWVA 2WV6D 3KLWA 2JEAI 3CC4A 5EJWA 3ER0A 2A5HA 5I2YA 1XPRA 4LF5Q 3AMUA 1SXTA 2Z9HA 2RCFA 3BS1A 1XYIA 4RKLA 3HOWB 2G9HD 1BVSA 2ZTEA 3HEJA 3K7AH 4B3SL 5DM63 4RA8A 4DR7Q 1IZ6A 2RQXA 5HURA 2B8FA 4MN3A 3H94A 2OT2A 1SNOA 1I3QH 3I72A 3LGJA 4LF4Q 4QQBX 3UE1A 4I7ZC 3ICEA 1EIYB 4K5VA 4R8IA 2WB1B 4GLXA 4KKSA 4B3ML 2PW7A 1V1QA 4HTHA 3QB3A 4P2CB 4UP8A 2ZXOA 4DGZA 5HGQA 2P5ZX 3AFPA 1PHJA 3UDGA 4YCVA 2B3GA 2Z4HA 2Z8LA 2WP8J 2ZXRA 3BU2A 2HHHL 2E2JB 1CSQA 3NPPA 2EQSA 4TKOB 3M4QA 3KOJA 3GV3A 1K8MA 4N9PA 5J1ZA 1KRSA 4FF4A 5KNCA 1LACA 2K6AA 3T4AC 4CDFC 1Q46A 4IN3A 2ZTDA 1EOTA 3IKJA 1VQNA 3MEFA 1D5ZC 3V05A 1H95A 3TS2A 4A3MG 2R6GA 4GOPB 5JEAJ 3PO2H 2K52A 1K0RA 2LMCB 1GVPA 4X64Q 4ME3A 4LUOA 1F9PA 1VMCA 5KGUA 4A3CG 3E6ZX 3NQIA 2CW0D 3JAMi 4LF6L 5IYCH 1N34L 3PIO3 4RAUC 4DV3L 5DAUA 1QVGA 3CC2A 1C0AA 3D6CA 3CU7A 3KF6B 1GD7A 1I4QA 2SEBD 2A6HD 3MXGA 3H6MA 4R4OA 2I07B 4DXGA 4ALPA 3VR6A 1N33L 1HQRD 1XWEA 2TMPA 4GKKL 3S16B 2PQAB 2RKSA 1D1IA 1YVCA 5LMNL 1K73C 1VQ9A 1EEID 2HUGA 3P75A 4H44C 2EYOA 5CBEE 3ZYYX 4HCSA 4O1NA 2RDFA 5CR3A 1O7IA 2WB1E 1XMQL 2F0KA 1PRTD 4BY1H 5KNBA 1FGUA 4ABNA 3ITPA 1G51A 3D8GA 3RMHA 2UXCQ 4JW0A 2B63B 1IBLQ 2OTLA 1D1KA 5A2QE 2WIIB 1VCIA 1AE3A 2KOLA 2B8GA 3KFUA 1QE6A 1H9SB 3RZDH 3LWEA 4QUFA 1HXYD 5C3EH 3FRPB 3HOXH 4KKTA 1LTTD 1VQEA 2EXZA 3CHBD 2B2YA 4DA2A 5FO8B 3J7A5 1TWHH 4L6TB 3LNNA 1I4HA 2HCIA 2LXJA 4C3JH 2V4DA 4DV4Q 2K14A 4HMJA 2L15A 2R7ZH 1X54A 3RLFA 4C3IB 4FYDA 5JEAG 1VQMA 1M90C 2ZM6Q 1GM5A 1VQ5A 1S5DD 3GTJB 2QKIC 5IGGA 2JA6G 5GQOA 3CCJA 3U9SA 1QUQA 4CKCA 2VXWA 4ZQ3A 4DUYL 3KJPA 4L5TA 3SXHA 5M3FB 4GNXC 1H9MA 5T1IA 3MZ5A 2NVXB 1FNVA 3F1ZA 1T9HA 4MIUA 4TVAB 1R9TB 5K36H 3KLRA 4I65A 1YJNA 1X32A 2A8VA 4G7ZC 1JJCB 1FNUA 5FLXE 2UU9L 2PNRC 5J22A 1PTOF 3MAQA 4IPCA 1YNND 5GROA 1E3PA 3HKZG 4X3KA 1SMYC 3R3OA 2F4IA 5C5LA 3GTGB 4OHJA 4CDDC 3SK4A 1TQOA 2DY7A 3OIPA 1B1ZA 1SN8A 2VUMB 5GAGC 5GAHC 1ILQA 1WTRA 2CWPA 3ERSX 4QY7A 5C3XA 3RN5A 1A3TA 3NBIA 2FFKB 3L2PA 4M1UB 3HGBA 3I4MB 4DV5L 2JN4A 3IFDA 3F2DA 4LWCA 2E76C 3S14B 4C1NI 2YTXA 4DAYB 2R92G 1IL8A 4S3SA 4NXNL 1RTOA 4DNRB 3TP8A 2FMMA 5M5WH 3MTSA 3MXNB 1EUJA 3MHBA 3I90A 1NJIC 1OTCA 5ELOA 1EEFD 3BVMA 2C35B 1E1TA 3O13A 2A68D 1K83H 1Q86C 4PNYA 3NK9A 3A54A 1RJTA 4JI2L 4R4IA 2B2WC 3J7AV 2XSCA 1CFMA 1VS0A 2NZOA 5I9OA 2PZWA 3K57A 1AH9A 3FMCA 3EN2A 4Z9CB 4A3EB 5IT9L 3STBD 4R9WA 4WJ4A 2JK8A 1PH1A 1VQJA 5ELBA 2F0VA 2XIWA 1U9RA 5JJKA 1WJJA 1E22A 2CH4A 3M7NA 3VR3A 2EYJA 4B3RL 1J6QA 2X6LA 1Q3LA 4XQNA 1NMFA 4FP5D 1FGBD 3HOWH 4EX5A 2AHOB 2J7ZA 3TQYA 1TS4A 2JXMB 5I6WA 1F2YA 4HR7B 4XQJA 4LF9L 2F0IA 3NE5B 4DAMA 4PZ6A 2MFIA 2EY2A 2CW0C 2XN9C 4K8IA 5ELDA 3ULPA 4Y7NB 1PDQA 3OW7A 1LO5D 3R2IA 3RZOB 4XXEA 1HNWQ 5IP9H 1A6XA 4LF8Q 2NVYB 2A6HC 3L7ZC 4IUPA 3G48A 1C8CA 3HOYH 3PCOB 2NN6G 1JJ2A 3SR1A 1WTVA 1STAA 1XJVA 2QCPX 2MP1A 1DM0B 3E9HA 1SMXA 4LW1A 3S24A 4O42A 2GA4B 2F0EA 2LSSA 4GLVB 1HNZL 1HPCA 3A55A 2E2JH 5KIXA 1WI5A 2Q8IB 2XWJB 2VZAA 4JI5Q 4NXMQ 1NUCA 2F0OA 3KDFA 4DK1A 3NSWA 2DJGC 1M4VA 1PRTC 3T13A 1UAPA 1ENAA 4ZUJA 1XNQQ 3ULLA 1UEAB 3J80L 1EFWA 3CMEA 3HOZH 4WFN3 1I3QB 5C4HA 2K5HA 1N8RC 3A7LA 4NKLA 3DMUA 2EY5A 3FEWX 1SDFA 3CPWA 5LL6S 5JJLA 2Q8RE 4JK1C 2O5IC 2SDFA 1G2TA 2RSOA 3K5MA 3KBXA 3Q22A 1KTKA 4FVMA 4RCOA 4LFAQ 1RHPA 3BZDB 1PFMA 3H91A 3NTKA 1SYCA 4BBRH 1AEXA 3HOUB 2JA7H 4LJZC 1Z7TA 1YIJA 4KV6A 3DUZA 1I4PA 2K5VA 4XTCS 1VQ4A 1EQVA 3E5SA 3J7AF 2MPMA 1HTLD 1UUPA 2IHFA 4DV7Q 3J81E 4LFCL 1JT8A 1UE7A
chains in the Genus database with same CATH topology
3S1QB 1XTCD 2RBMA 1VDZA 3SK6A 2B2VA 1PYWD 2ENBA 4DN4M 5FK9C 3PO3B 1YNNC 2MGSA 1U4PA 1H9RA 2H1EA 4AYBB 2B39A 1LTID 3G6JB 1Y8PB 1DJRD 2O2LD 1MSHA 4EGVA 1FR3A 1GJXA 1EY8A 1A15A 4IZ8A 1J8IA 1LTBD 3C1FA 1O7LA 3OHXC 2LFNA 2KEEA 1BUVT 1CM9A 2B2YC 2FHTA 2IPKD 2HDLA 3K58A 1D2BA 2IX0A 4BY1B 1JCKB 3FKIB 2A68C 1WD1A 2AWOA 3WOFA 5D65A 1PFNA 5C0XJ 3I4NB 2Y0SB 3DWQA 2XVSA 3RZDB 1O7YA 4WRDA 3D4RA 5C3EB 3HOXB 4G4KA 4LMQD 1TWHB 4RHRA 1A3UA 2BA1A 4PMWA 4C3JB 4OL7A 3LWUA 1HQMC 4KN4C 1WCMB 2R7ZB 2PZTA 1Q1BA 5IGFA 1ENFA 4BA1I 2L4NA 2HQEA 3HOVB 2KVMA 1S4ZA 2ICIA 2PW5A 5M3MB 3GTKB 3GTPB 1AFPA 1ZKOA 3A56A 3QOLA 1ENCA 4F7XA 4FF1A 2K28A 2EYPA 1ESRA 2CQAA 3LX0A 3PIP3 1G6ZA 4J6HA 2DNEA 4DF7A 1GUTA 3I70A 3P1HA 5CV6A 3AU7A 1TY2A 2PYKA 1PTOH 1CZWA 1HHVA 5CV5A 2XRQD 2N55A 1ET9A 1D5XC 3TZUA 1SNQA 4R8NA 2B2UA 4U68A 4BY7B 3V2TA 3KBGA 4H7BA 1F77A 2L12A 1MD2D 2WAQB 1EU4A 1II3A 1QNKA 3NUCA 1JICA 1KDBA 1IKLA 3QIAA 2NTSA 1BNZA 2PO4A 4ID6A 4K2KA 4UAIA 4HSPA 4FO2A 2EYLA 4DXFA 5DNFA 3MVVA 3G7LA 4FF2A 1WVLA 3I3CA 1IKMA 5I9PA 4F8MA 1L0XB 4XT3B 1B44D 3TMEA 1ONLA 1SBBB 1ZEQX 4A3GB 1Q8IA 1DOLA 2A69D 3F2UA 2B2TA 3NP8A 1ML0D 2KECA 1HA5A 5ELFA 5JEAH 3HZXA 1NSNS 3HOYB 1H9SA 1E0BA 3MWYW 2KHSA 4KD3A 2RSNA 3EJIA 5CORA 2AQ3B 1HA6A 1C48A 1V1PB 3BG3A 3NTIA 2BDOA 2EY6A 5G3LD 1EY9A 3NTHA 1SJED 3SHLA 1CZGA 5EPLA 1BCPF 1JQYD 2EY1A 3HOZB 1TS3A 2F0UA 1NR4A 4IURA 1VF7A 2AQ2B 3N52A 3D4WA 2F0TA 2O4XA 1BCPD 1SJHD 4LAAA 4PMCA 2FJ2A 3SVMA 5CV9A 3M85A 2J4XA 1S5ED 1IYUA 4PV1C 2B2VC 3TBIB 4BBRB 5C4ZA 2JA7B 1MI2A 1STYA 1HCZA 3KK7A 1CQVA 1WTWA 4J1MA 1LTRD 3HG9A 4TSSA 4TQUS 1PRTF 1RODA 3Q24A 5I4DA 3NBHA 3RD4A 4DAYA 3ND9A 2EJGC 2XRSD 1NCVA 1STNA 3NQTA 3DEPA 3WOEA 2NWGA 3EROA 2C5CA 2IL8A 1F2MA 2JSOA 4ZKBB 1H9JA 5CV7A 1TU2B 3RUZA 2HCCA 4FNFA 1EWCA 5F2DA 3DWAA 4IUNA 4WORA 3Q23A 1GUNA 1KLGD 4IUTA 3K5LA 3OPOA 5DM73 3MXUA 5EPJA 3S15B 5CV8A 2KCNA 1TIID 1DOKA 2NB0A 3N6RA 4ZUIA 3VA7A 2OXPA 1QILA 2F0MA 2M2LA 4YIJA 1IYVA 4A3IB 3DHQA 1B53A 1CT1D 1KAAA 1OO9B 1RDPD 2DN8A 3EFXD 1PXUA 3DWPA 4K8JA 3A8IE 2SNMA 5C5MA 4A3BB 1I4XA 2LKVA 4ZRZA 3GP7A 4KI0A 1SNMA 4ILWA 3P20A 1SFOB 3JAML 5KEEA 1U4MA 1LT5D 1C4QA 2PZUA 2NVQB 2A69C 2K01A 2D2CC 1F9SA 4HN7A 5CC4A 4IUUA 3K5OA 3FDTA 1A2TA 3D31A 1DCZA 2B2UC 2KUMA 3GV6A 5ISRA 1OXXK 2BE5D 3HP3A 1O7ZA 1Y1VB 3GO5A 3IFTA 4ODGA 4CJ0B 3QWNA 1F2ZA 3I73A 4RGNA 3TP7A 1PTOB 1DD2A 1EY6A 2YYZA 1EYAA 3MFGA 5EKIA 2AUKA 1ESFA 1W6JA 4A93B 2XWBB 2JEBI 1FYCA 2A74C 2F0JA 1R4QB 2NYZD 4QB4A 3X3NA 2KCCA 2QDBA 1PZID 4XYQA 5LHY1 3TDQA 1BCPC 1JB3A 1RF2D 3L9AX 4HCEA 3SEBA 1LT6D 2B2TC 4RGTA 4C3JG 4EQNA 1BO0A 2FINB 3U9OA 5JOBA 1G91A 1PFBA 2OF1A 4C1NK 3K6OA 3GD7A 4QIWB 3W2DA 2D62A 4C56C 2X69A 4OGQC 4WJWA 2Z1CA 3CRLC 3ERQA 4IALA 3FPUB 2NVTB 1QWYA 3KLSX 1XXGA 4NDXA 1T5XD 5K36G 2PPBC 1MGSA 1R4PB 2EPBA 5COYA 1SE3A 3OSOA 2IW3A 2NUCA 2EZVA 4IFDJ 3C2PA 1EIGA 1CQFA 1I50B 1LT3D 5JJZA 1TWFB 1B2TA 3CRKC 2DNCA 1SYFA 1TWCB 1KDCA 3A8JE 2E74C 2K04A 3QO2A 5ELEA 3TSSA 4DAPA 2XNAC 4DAVA 5IGEA 1WTOA 1TWGB 1WTPA 1SE4A 3MFYA 1GUOA 5EQ0A 2A6ED 3KLSA 3SE0A 1NR2A 5JVG3 4BBSB 1KABA 2WINB 2AWNA 3PV0A 3D4DA 3PUWA 1E2WA 1QB5D 2BOSA 5M5YB 1QOHA 5EBDA 4OO1H 4QMGA 3SK8A 1JR0D 2RDHA 1F2LA 1SEBD 5FO9B 1TT2A 1VMPA 3CQZB 5C0XH 3R93A 3S2HB 1EYDA 3C1EA 3S9WA 5KNDA 2E2IB 1JWMD 5FO7B 3NHHA 2E75C 2L55A 2VB2X 2K03A 2C9OA 1EFID 1LABA 1F9QA 1CA6A 3OWEB 3VYRA 1BXTA 5CYUA 1QJOA 4IFDG 5IT9E 3H3VC 1M8AA 4L8JA 2R3ZA 2BE5C 1EY4A 5D3IB 3V96A 1GUGA 5IGDA 3MEHA 1D6EC 4CHTB 3A8KE 1HUNA 4OO1I 3PUYA 3R2TA 2F0GA 3PUVA 3DM1A 3ONAB 1TY0A 3M7GA 1VF5C 2K32A 5J39A 4X3UA 5C0XI 3PUZA 1CTMA 4KK7A 4RH6A 4QF4A 1X3QA 2L9HA 4QCLA 2H4OA 4IUVA 3S1RB 1B4OA 1TWAB 4XDXA 4KTAA 4KY6A 3TZDA 2ID0A 2IX1A 5BN5A 1UNSA 3OMCA 1JE4A 5EPKA 1GHJA 4JBWA 1RTNA 1ET6A 2BDNA 1MSGA 4FF3A 5I6YA 1CK1A 4F88A 4RGMA 4MHEA 3VYTA 2K1BA 3J80E 4X3TA 4L63B 5I2XA 1BQQT 1V1PA 3BDCA 1B3AA 4KHVA 2M00A 3I91A 2F0DA 4A3JB 2MJ8A 1ZXTA 3QJYA 5A35A 1DYQA 1LTGD 2EYHA 3BYYB 3S1MB 1STBA 1AP0A 1Y8OB 2CHBD 5DEHA 4OIJA 3OWFA 1CHQD 1PZJD 2K7VA 3M3YB 1S5FD 3QOJA 4ME5A 5D14A 5A2QL 3IAYA 3E0JA 3S1NB 2DY8A 4J8QA 4CKBA 1G291 2L11A 4UDUC 3NWTA 3OIQA 1STHA 1ZYRD 4KMUC 2K5QA 4C3IG 4NMZA 5K5PA 4DNTB 2A6EC 3M4YA 5KYIA 2M9VA 4B08A 1HFGA 2JA8B 1O78A 2I46A 4IQZA 1SNPA 1EWHA 1OXVA 2TSSA 3L3OC 2E2HB 3DEOA 5FLXL 1GOZA 3AB9A 5IODA 4CKEA 2LS01 1KNAA 2F1MA 4A3DB 1SE2A 3TN2A 1AZQA 3T51B 5G3LF 1TS2A 2AQ1B 3GQBA 1FD7D 3EVQA 2F0PA 3VYSA 2F0QA 4EVOA 1SNDA 2KEDA 3VR4A 3VA5A 2Q8TA 1JOKA 5C4JB 5LL6X 5BN4A 2EJFC 1SYEA 5JVH3 1E2ZA 4E6IA 1K8OA 5KRUA 2K05A 3J7YW 4U673 1HTPA 1YNJD 1BDOA 1KNEA 1I4RA 2A73B 5AFWA 1I6VC 1AN8A 3A7AB 1B50A 3TP5A 4EQOA 4A3KB 3BYTB 1Y1WB 2RA4A 2QF7A 2EDGA 4C3HB 5FOBB 3HS0C 2NBFA 1HRJA 5CV4A 2JA5B 2BA0A 3OOCA 1ILPA 3T16A 1X3PA 1T5EA 1RCVD 4IUQA 3MXNA 1OXTA 3WDNA 2R93B 3T53B 4V0BA 1SSOA 3BDLA 4KY5A 3EQLC 1BCPB 1V8QA 2F03A 3H0GB 1LTAD 4HSVA 1A3VA 5HGTA 1W6KA 1WD0A 1I4GA 2MHVA 5JAVA 2EYMA 5M5XB 2JE6I 3VR2A 2PCFB 5IGCA 2WACA 1WTQA 4ZKCB 1SYDA 1TVXA 3MXPA 4RKBA 1A2UA 3MC0B 1PLFA 2NN6H 1PRTB 4RGOS 1GXDC 4B9WA 1E2VA 2E2DC 1SYBA 4KKUA 5CGKA 4RFBA 2RVLA 1BR9A 1EZ6A 4KY7A 1CI3M 3P7JA 4ZLTF 2F0LA 1ZYRC 2EOTA 5T1GA 3GTQB 5IOCA 2JYOA 2Z4IA 2K5WA 2D5DA 1EYCA 2F0HA 3K59A 2L0CA 1GUWA 2F0SA 3NWSA 5ELCA 3J81L 2F3VA 1V1OA 2N88A 1BOSA 3PMFA 4H13C 1B9NA 1LT4D 2NN6I 3FPPA 3CKIB 1PTOD 4ZAIA 1SAPA 1STGA 1DOMA 4RHSA 4XIGS 1QNUA 1SNCA 3PUXA 2HDMA 3D3RA 3R8BA 1HFNA 1AZPA 4A3MB 2BCOA 2JP1A 2FMCA 3W3AA 1HUMA 2ZXPA 3X3MA 4DFAA 1CA5A 2ZT9C 1SYGA 5C6AA 1STEA 1OXUA 2NZ1D 1YNJC 4KJNA 3K5NA 5NUCA 1EQTA 2D9UA 4RCNA 5JPMC 1BBXC 1TKWB 5E3FA 1LTSD 3T56B 5C3WA 1DONA 1LV9A 5EGTA 1J9OA 4IFDH 3URYA 2IX3A 1KDAA 4HEDA 4CBVA 4QUCA 3C46A 2EYFA 4RWSC 4HAEA 2KQ3A 2PQEA 3BVGA 1IW7D 2F0FA 5TSSA 3QG1A 3Q6SA 4Q5VA 4CJ1B 2EJMA 1JC7A 2JA6B 3K7AB 2NTTA 3SK5A 5EKKA 5IGBA 1EY5A 5E4WC 1NAPA 1S5CD 2ICEC 3D6WA 4G7OC 1U4RA 1EZ8A 4IFDI 2CVRA 4KHZA 1EY7A 1IHZA 1I6HB 1EY0A 4FXGC 2IWHA 2K5DA 2F3WA 4DK0A 3VR5A 4M8AA 3HKZB 4N9TA 3SDZA 2O5JC 1G8ZD 4KN7C 1Q90A 2G9DA 2L1BA 1AW7A 3JAME 2SNSA 2YU9B 1JOQA 3K0YA 3PO2B 4XT1B 2R92B 1DZ1A 3I4LA 4BWGB 1XX8A 1Z47A 4NP5A 1RKNA 3VYUA 1B9MA 3OMGA 3KUPA 1Y69U 1G2SA 3Q0AA 1JOOA 3MA2B 4Q0FA 1PTOC 2WKCA 4K14A 3NXWA 2F0NA 3TP6A 4FXKC 1O80A 2QILA 5D3DA 2EVBA 5JPNC 3M4OB 1Q1EA 4OIKA 4V190 2VNUD 4ZYSA 4PMBA 5CBAE 1PMRA 4G57A 4LK1C 1PZKD 1OXSC 4K2LA 3DXJC 4FXDA 5C44B 2QEJC 4DU9A 4BA2I 3I8ZA 1U4LA 5M9OA 3S17B 4H0LC 1H9KA 3S2DB 4ULLA 4X3SA 1FNWA 2WKDA 1L0YB 3GTOB 2IJ0A 1EL0A 1DXMA 1D5MC 5EKLA 2LY7A 2L5TA 2F0WA 5FKAC 5C4XB 1F9RA 4F87A 2AUJD 5E1FA 4EQPA 1KLUD 3H09A 4NW2A 3FVQA 1V43A 1GHKA 4C3HG 2OEOA 1Z6HA 2R61A 3GTMB 2J0TD 5EBCA 4KD4A 5BN3A 4K6LA 1TS5A 2K33A 1IW7C 4HMIA 4CJ2C 2MUYA 3BDOA 4TRDA 4A3FB 4K5XA 4XYOA 1JWUD 3UI2A 1EU3A 4OO1G 3C3LA 2KJXA 2RDGA 3ND8A 1LLRD 1ICWA 2VB3X 1BF4A 5CMDA 4PQXA 1GUSA 2IT1A 3GTLB 2EE1A 5C0XG 4K5WA 5KYLA 2B2WA 1QG7A 1Y8NB 1JORA 4KJOA 5M5WB 5IIFA 2KA7A 1WTXA 1RD9D 4GZYC 3EA6A 1QCBD 1S5BD 2X6GA 1K83B 3HRZC 4K6DA 4B9XA 2PMZB 1CHPD 3KF8A 1EIHA 4ZK9B 3IL8A 4C2MB 5E4XA 4BS9A 3BVZA 1Q12A 1SMYD 2SOBA 4XQQA 1MBYA 1JWSD 4CGYB 4G7HC 1TR5A 2WV6D 2JEAI 5EJWA 2A5HA 5I2YA 3AMUA 1SXTA 3BS1A 1XYIA 4RKLA 3HOWB 2G9HD 3HEJA 5DM63 4RA8A 5HURA 2RQXA 2B8FA 4MN3A 3H94A 2OT2A 1SNOA 3I72A 4I7ZC 4K5VA 4R8IA 2WB1B 4KKSA 2PW7A 4HTHA 3QB3A 4P2CB 2ZXOA 4DGZA 2Z4HA 2Z8LA 2WP8J 2ZXRA 2E2JB 3NPPA 4TKOB 3GV3A 1K8MA 4N9PA 5J1ZA 4FF4A 5KNCA 1LACA 2K6AA 3T4AC 4IN3A 1EOTA 3IKJA 1D5ZC 3V05A 2R6GA 5JEAJ 2LMCB 1F9PA 1VMCA 5KGUA 3E6ZX 3NQIA 2CW0D 3PIO3 4RAUC 5DAUA 3D6CA 3CU7A 1I4QA 2SEBD 2A6HD 3MXGA 3H6MA 2I07B 4DXGA 3VR6A 1HQRD 1XWEA 2TMPA 3S16B 2RKSA 1D1IA 1EEID 2HUGA 3P75A 4H44C 2EYOA 5CBEE 3ZYYX 4HCSA 4O1NA 2RDFA 5CR3A 2F0KA 1PRTD 5KNBA 4ABNA 3ITPA 3D8GA 3RMHA 2B63B 1D1KA 5A2QE 2WIIB 1VCIA 2KOLA 2B8GA 1QE6A 1H9SB 3LWEA 4QUFA 1HXYD 3FRPB 4KKTA 1LTTD 2EXZA 3CHBD 2B2YA 4DA2A 5FO8B 4L6TB 3LNNA 1I4HA 2HCIA 2V4DA 4HMJA 3RLFA 4C3IB 4FYDA 5JEAG 1S5DD 3GTJB 2QKIC 5IGGA 3U9SA 4CKCA 2VXWA 4ZQ3A 3SXHA 5M3FB 1H9MA 5T1IA 3MZ5A 2NVXB 1FNVA 4MIUA 1R9TB 5K36H 3KLRA 4I65A 1X32A 4G7ZC 1FNUA 5FLXE 2PNRC 5J22A 1PTOF 3MAQA 1YNND 4X3KA 1SMYC 3R3OA 2F4IA 5C5LA 3GTGB 4OHJA 3SK4A 1TQOA 2DY7A 3OIPA 1B1ZA 2VUMB 1ILQA 1WTRA 5C3XA 1A3TA 3NBIA 2FFKB 4M1UB 3HGBA 3I4MB 3IFDA 2E76C 3S14B 4C1NI 1IL8A 4S3SA 1RTOA 4DNRB 3TP8A 2FMMA 3MTSA 3MHBA 3I90A 1EEFD 3BVMA 3O13A 2A68D 4PNYA 3NK9A 3A54A 1RJTA 2B2WC 3J7AV 2XSCA 1CFMA 5I9OA 2PZWA 3K57A 3FMCA 4Z9CB 4A3EB 5IT9L 4R9WA 5ELBA 2F0VA 2XIWA 1U9RA 3M7NA 3VR3A 2EYJA 2X6LA 1Q3LA 4XQNA 4FP5D 1FGBD 2J7ZA 1TS4A 2JXMB 5I6WA 1F2YA 4HR7B 4XQJA 2F0IA 3NE5B 2EY2A 2CW0C 2XN9C 4K8IA 5ELDA 4Y7NB 1PDQA 3OW7A 1LO5D 3R2IA 3RZOB 4XXEA 1A6XA 2NVYB 2A6HC 3L7ZC 4IUPA 1C8CA 2NN6G 3SR1A 1WTVA 1STAA 2QCPX 2MP1A 1DM0B 4O42A 2GA4B 2F0EA 1HPCA 3A55A 5KIXA 2Q8IB 2XWJB 1NUCA 2F0OA 4DK1A 3NSWA 1M4VA 1PRTC 3T13A 1UAPA 1ENAA 4ZUJA 1UEAB 3J80L 4WFN3 1I3QB 5C4HA 3A7LA 4NKLA 3DMUA 2EY5A 3FEWX 1SDFA 5LL6S 2Q8RE 4JK1C 2O5IC 2SDFA 1G2TA 2RSOA 3K5MA 3KBXA 3Q22A 1KTKA 4FVMA 4RCOA 1RHPA 3BZDB 1PFMA 3H91A 3NTKA 1SYCA 1AEXA 3HOUB 4LJZC 1Z7TA 4KV6A 3DUZA 1I4PA 4XTCS 1EQVA 3E5SA 3J7AF 2MPMA 1HTLD 1UUPA 3J81E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3L A;  2B2T A;  2B2U C;  2KUM A;  3DM1 A;  3GV6 A;  4CJ2 C;  3ONA B;  2IL8 A;  1ML0 D;  1O7Z A;  3HP3 A;  5JJZ A;  4RWS C;  2J7Z A;  1B2T A;  3GV3 A;  4HAE A;  4ZKB B;  2KEC A;  2N88 A;  3UI2 A;  1HRJ A;  4X3U A;  2VXW A;  4CJ0 B;  2K28 A;  2B2V A;  1ESR A;  1HFG A;  1O80 A;  4DN4 M;  1ICW A;  2K04 A;  2HCC A;  3QO2 A;  1E0B A;  1BF4 A;  1G6Z A;  1WTO A;  1EOT A;  5CMD A;  1ILP A;  2MGS A;  5T1I A;  1U4P A;  1X3Q A;  2H1E A;  3MWY W;  4OIK A;  2L9H A;  1PDQ A;  1X3P A;  4ZAI A;  4IUV A;  1SAP A;  1B4O A;  1DOM A;  4IUT A;  5EKI A;  1WTP A;  3Q6S A;  5CBA E;  2EE1 A;  2RSN A;  4XDX A;  5EQ0 A;  4IUQ A;  5COR A;  4IUP A;  1X32 A;  2B2W A;  1C8C A;  3TZD A;  1VMC A;  1F9P A;  4CJ1 B;  1QG7 A;  1HA6 A;  5EPJ A;  1WTV A;  1SSO A;  1HHV A;  1MSH A;  1NR2 A;  2NYZ D;  2MP1 A;  4O42 A;  4RAU C;  1DOK A;  1JE4 A;  2HDM A;  1A15 A;  1WTX A;  3DEO A;  4X3K A;  1NAP A;  3D6W A;  5E4W C;  5EPK A;  1J8I A;  3I8Z A;  1RTN A;  4HSV A;  1U4L A;  2X6G A;  1U4R A;  2M2L A;  2N55 A;  1HFN A;  1WD0 A;  1AZP A;  1KNA A;  2CVR A;  2KEE A;  1EIH A;  5EPL A;  1CM9 A;  2B2U A;  3TN2 A;  2DY7 A;  2BDN A;  2JP1 A;  4U68 A;  1MSG A;  4ZK9 B;  3IL8 A;  4X3S A;  1HUM A;  5E4X A;  1AZQ A;  2B2Y C;  1F2L A;  1ILQ A;  2FHT A;  1WTR A;  1B53 A;  4MHE A;  1WTQ A;  2L12 A;  2K1B A;  1CA5 A;  2HDL A;  1NR4 A;  1VMP A;  2FFK B;  4IUR A;  4ZKC B;  4X3T A;  1TVX A;  3N52 A;  3IFD A;  2HUG A;  1QNK A;  3R93 A;  1EL0 A;  2B2T C;  1B3A A;  1JIC A;  5EJW A;  1WVL A;  5CBE E;  1IL8 A;  1IKL A;  1BO0 A;  1PLF A;  3I91 A;  4HCS A;  1XYI A;  1WD1 A;  2FJ2 A;  2KED A;  3SVM A;  2NZ1 D;  2FIN B;  2Q8T A;  2L1B A;  2MJ8 A;  5D65 A;  1BNZ A;  1F9R A;  1ZXT A;  1PFN A;  1RTO A;  1G91 A;  1PFB A;  2B2V C;  2FMM A;  1SDF A;  3MTS A;  2K03 A;  3I90 A;  4RA8 A;  1EQT A;  2D9U A;  4UAI A;  1O7Y A;  1MI2 A;  1F9Q A;  2Q8R E;  4MN3 A;  1AP0 A;  1CA6 A;  5DNF A;  2SDF A;  2K05 A;  2RSO A;  1BBX C;  1G2T A;  2RVL A;  2X69 A;  3KBX A;  4LMQ D;  4NW2 A;  1WTW A;  1U4M A;  3G7L A;  3FPU B;  1RJT A;  4OIJ A;  1RHP A;  4XT1 B;  1PFM A;  1ROD A;  3H91 A;  4R8I A;  2B2W C;  2K01 A;  3I3C A;  1KNE A;  3P7J A;  4ZLT F;  1M8A A;  2KOL A;  1IKM A;  1DON A;  1DZ1 A;  2R3Z A;  1QE6 A;  1LV9 A;  5D14 A;  1XX8 A;  3LWE A;  4QUF A;  1F9S A;  2EOT A;  1J9O A;  4XT3 B;  5AFW A;  5T1G A;  4R9W A;  2B2Y A;  1MGS A;  1NCV A;  1B50 A;  4IUU A;  2EPB A;  5COY A;  2DY8 A;  3DEP A;  3KUP A;  2JYO A;  2XIW A;  3FDT A;  2HCI A;  2MPM A;  1G2S A;  1DOL A;  2L4N A;  2NWG A;  1HUN A;  2L11 A;  2RA4 A;  2KVM A;  4HED A;  1S4Z A;  4QUC A;  2X6L A;  3F2U A;  1EIG A;  1GUW A; 
#chains in the Genus database with same CATH topology
 3S1Q B;  4JPB W;  2K75 A;  1VQI A;  1XTC D;  2RBM A;  1VDZ A;  4Y52 H;  5FJ8 H;  3SK6 A;  2B2V A;  1PYW D;  5IP7 G;  2ENB A;  4DN4 M;  5FK9 C;  3PO3 B;  1U5K A;  1YNN C;  2MGS A;  1U4P A;  1H9R A;  2H1E A;  4AYB B;  2B39 A;  4K0K Q;  1FJG Q;  1YEZ A;  1VQG A;  2HQL A;  4AIM A;  1PFS A;  1LTI D;  3G6J B;  3FP9 A;  1Y8P B;  1DJR D;  2O2L D;  1MSH A;  4EGV A;  4GN5 A;  1FR3 A;  1GJX A;  1D8L A;  5IWA L;  1EY8 A;  1A15 A;  1NE3 A;  4IZ8 A;  4CDE C;  1J8I A;  1LTB D;  2VW9 A;  1N9W A;  3C1F A;  1UE6 A;  1O7L A;  2Q2T A;  3OHX C;  2LFN A;  2KEE A;  1BUV T;  1CM9 A;  4OWX B;  1PA6 A;  3T1H Q;  2KHJ A;  2B2Y C;  2FHT A;  2IPK D;  2HDL A;  5M3F H;  2IHE A;  3K58 A;  3NEN A;  1D2B A;  2IX0 A;  4BY1 B;  2NVX H;  1JCK B;  4JI3 Q;  3FKI B;  3K81 C;  2A68 C;  2WB1 G;  1HZC A;  4A3I H;  1WD1 A;  3AQQ A;  2AWO A;  3GDE A;  3WOF A;  1C7Y A;  1IYJ B;  5D65 A;  1PFN A;  5C0X J;  3HKS A;  1HZ9 A;  3I4N B;  3A5U A;  1PVO A;  2Y0S B;  3DWQ A;  2XVS A;  3RZD B;  1O7Y A;  3STB C;  4YY3 L;  4WRD A;  3D4R A;  5C3E B;  3HOX B;  2UUB Q;  2I0Q A;  4G4K A;  4LMQ D;  3GTG H;  1TWH B;  4RHR A;  1A3U A;  2BA1 A;  4PMW A;  4C3J B;  4OL7 A;  4A3B H;  3LWU A;  1HQM C;  4KN4 C;  1WCM B;  2R7Z B;  2PZT A;  1WYD A;  3K7U C;  3G6E A;  1Q1B A;  4JVZ A;  5IGF A;  1SRO A;  4P71 A;  1ENF A;  4BA1 I;  2K50 A;  2NVQ H;  2L4N A;  2HQE A;  3RLN A;  4A3K G;  1Y1W G;  3HOV B;  2KVM A;  1L0W A;  1VQ7 A;  1S4Z A;  3S14 H;  2ICI A;  1N36 Q;  1W3S A;  2PW5 A;  4AYB E;  1KD1 C;  5M3M B;  3GTK B;  2BH8 A;  3GTP B;  1J5E Q;  1AFP A;  1ZKO A;  2YTV A;  3A56 A;  3QOL A;  1ENC A;  4F7X A;  3PIO A;  4FF1 A;  4DR3 Q;  2K28 A;  2EYP A;  1ESR A;  2CQA A;  4X6A H;  3LX0 A;  3PIP 3;  2CKZ B;  4P73 A;  1G6Z A;  1V9P A;  4J6H A;  2DNE A;  4DF7 A;  1GUT A;  2JA5 G;  1Y1V H;  3I70 A;  3P1H A;  4YHH Q;  3CCU A;  5CV6 A;  4DR4 L;  2ATW A;  2GVA A;  2KHI A;  4ZCK A;  3AU7 A;  1TY2 A;  2PYK A;  1PTO H;  1CZW A;  1HHV A;  4NB3 A;  1IBM Q;  2A19 A;  2R93 G;  5CV5 A;  2XRQ D;  3AEV A;  4JBJ A;  5L37 A;  4A93 H;  4JC0 A;  2N55 A;  1ET9 A;  3H0G G;  1LM0 A;  1D5X C;  3TZU A;  1SNQ A;  4R8N A;  4JI8 Q;  2B2U A;  4U68 A;  4BY7 B;  3V2T A;  3KBG A;  2RCN A;  4X66 Q;  4H7B A;  1F77 A;  3D0F A;  1EOV A;  2L12 A;  3F2B A;  2Y0S E;  1MD2 D;  2WAQ B;  1KIX A;  2B63 G;  4Y7N H;  2HIV A;  1EU4 A;  1II3 A;  1QNK A;  3NUC A;  4B3T L;  1JIC A;  1KDB A;  3VDY A;  1VQL A;  1IKL A;  1A8V A;  4JI0 Q;  2ALY B;  3RN2 A;  1ASY A;  3QIA A;  2NTS A;  1BNZ A;  2PO4 A;  1GKH A;  2PNH A;  4ID6 A;  4K2K A;  4UAI A;  4HSP A;  1YZ6 A;  1PYB A;  4FO2 A;  2EYL A;  3E9I A;  4DXF A;  5DNF A;  4DV2 Q;  4DR1 Q;  3MVV A;  4BXX H;  1E1O A;  1PH6 A;  3G7L A;  4FF2 A;  5AJ3 L;  2QGQ A;  4YWL A;  1WVL A;  4YWK A;  3UDX A;  3I3C A;  1IKM A;  5I9P A;  4F8M A;  2I5H A;  2OQ0 A;  1L0X B;  4XT3 B;  4DPG A;  1A63 A;  1B44 D;  3TME A;  4A4I A;  2NZH A;  2MO0 A;  1ONL A;  1IBL L;  1SBB B;  2B29 A;  1ZEQ X;  2EXD A;  3A0J A;  4A3G B;  1Q8I A;  1NBW A;  1DOL A;  2A69 D;  5LMU L;  4AQY Q;  3F2U A;  2F52 A;  2B2T A;  1YNX A;  4JI7 L;  2Z0S A;  4FDB A;  3NP8 A;  1ML0 D;  5FLM G;  2GN5 A;  2KEC A;  1HA5 A;  5ELF A;  5JEA H;  3HZX A;  1NSN S;  3HOY B;  1H9S A;  1E0B A;  1I50 H;  1CKN A;  3MWY W;  3CMA A;  2KHS A;  4KD3 A;  5BR8 Q;  2RSN A;  3EJI A;  3HOU H;  5COR A;  2AQ3 B;  1TWC H;  2VUM G;  4DV0 L;  4HJ8 A;  4JYA L;  1HA6 A;  1C48 A;  1V1P B;  3BG3 A;  3NTI A;  4JG2 A;  1PV4 A;  2F4V L;  1MKH A;  2BDO A;  2EY6 A;  3K8A A;  5G3L D;  1EY9 A;  1XNR L;  3NTH A;  1SJE D;  3SHL A;  1CZG A;  3S1Q H;  4I7A A;  5EPL A;  4BBS H;  1UE1 A;  1BCP F;  4DR2 L;  1JQY D;  2EY1 A;  3HOZ B;  1TS3 A;  1JB7 A;  3KYH C;  2PMZ E;  2F0U A;  4DK3 C;  1NR4 A;  3J7Z C;  4IUR A;  3DM3 A;  3PO3 H;  1VF7 A;  2AQ2 B;  3N52 A;  3D4W A;  1EQQ A;  4X62 Q;  3J81 i;  2F0T A;  2O4X A;  1BCP D;  1SJH D;  5DLQ E;  4LAA A;  4PMC A;  4L5R C;  2GVB A;  2FJ2 A;  3K0X A;  3SVM A;  5CV9 A;  3U4V A;  3M85 A;  2VS1 A;  2J4X A;  3E3X A;  4A3E G;  1S5E D;  1IYU A;  4PV1 C;  2B2V C;  3CQZ H;  3TBI B;  4PZ8 A;  3CF5 A;  4BBR B;  5IE8 A;  5C4Z A;  3S2H H;  2JA7 B;  1P16 A;  1MI2 A;  1N32 Q;  1S72 A;  2E2I H;  1STY A;  3UDF A;  1HCZ A;  3KK7 A;  1CQV A;  1QVF A;  1WTW A;  4J1M A;  1YBY A;  2BH2 A;  1LTR D;  3HG9 A;  4TSS A;  4TQU S;  1PRT F;  2DJF C;  1ROD A;  1K9M C;  3Q24 A;  5I4D A;  1WTH A;  4JI6 L;  2UXB Q;  3KF8 B;  3NBH A;  1HNX Q;  3RD4 A;  4DAY A;  3ND9 A;  4IOA A;  2EJG C;  2XRS D;  1NCV A;  1STN A;  1K8G A;  3NQT A;  3DEP A;  3WOE A;  2NWG A;  4DUZ Q;  3ERO A;  3FKI H;  2C5C A;  1I94 L;  4OEL B;  2OWO A;  2IL8 A;  3HFZ B;  1F2M A;  2JSO A;  2R7F A;  4PG3 A;  4ZKB B;  3I4N H;  1H9J A;  4PZ7 A;  5CV7 A;  1TU2 B;  3RUZ A;  2HCC A;  4FNF A;  1EWC A;  5F2D A;  3DWA A;  4IUN A;  4WOR A;  3Q23 A;  1GUN A;  1KLG D;  4IUT A;  3K5L A;  2CH4 W;  2K4K A;  3OPO A;  3OW2 A;  1WCM H;  5DM7 3;  1NMG A;  4LFB Q;  3MXU A;  3E0E A;  5EPJ A;  3S15 B;  1CKM A;  5CV8 A;  4YCW A;  2KCN A;  4B3S Q;  1SLJ A;  4QJF A;  1TII D;  1DOK A;  2NB0 A;  2PI2 E;  4LF8 L;  1NY4 A;  3N6R A;  4ZUI A;  3VA7 A;  3G71 A;  2OXP A;  1QIL A;  2F0M A;  3HOV H;  2M2L A;  3I55 A;  1L1O B;  4YIJ A;  5M3M H;  3GTK H;  4A3L H;  3GTP H;  1IYV A;  4B3M Q;  4KHP L;  4A3I B;  1A62 A;  1IL2 A;  3DHQ A;  1B53 A;  3FHW A;  1CT1 D;  1KAA A;  1OO9 B;  1RDP D;  3T1Y Q;  2DN8 A;  3EFX D;  1PXU A;  4JI5 L;  3DWP A;  2HHH Q;  4K8J A;  1PH9 A;  3A8I E;  2Z6K A;  2MNA A;  2OCE A;  1MHW C;  4JCV E;  2SNM A;  2QDL A;  1K28 A;  5C5M A;  4A3B B;  4DV6 L;  1I4X A;  2LKV A;  4ZRZ A;  3GP7 A;  4KI0 A;  1SNM A;  3WWV A;  1B70 B;  4ILW A;  3P20 A;  4A3J H;  1SFO B;  3JAM L;  5KEE A;  1KHI A;  1U4M A;  4JBK A;  1LT5 D;  4OXP A;  2N8N A;  1C4Q A;  2PZU A;  4R4T A;  2NVQ B;  2A69 C;  2K01 A;  4BY7 H;  3PO2 G;  3S1M H;  2D2C C;  1F9S A;  4HN7 A;  1KAW A;  2CQO A;  4IUU A;  5CC4 A;  4LF6 Q;  1N34 Q;  3K5O A;  4JOI A;  2DUD A;  3FDT A;  1A2T A;  3D31 A;  4DV3 Q;  3K80 C;  1DCZ A;  4AYB G;  5IYC G;  3M3Y H;  2EIF A;  2B2U C;  2KUM A;  3GV6 A;  5ISR A;  3RR5 A;  1OXX K;  2BE5 D;  3HP3 A;  1O7Z A;  3S1N H;  1Y1V B;  3GO5 A;  1N33 Q;  3IFT A;  4ODG A;  4GKK Q;  2Q2H A;  5FLX c;  2UUC L;  4CJ0 B;  3QWN A;  1F2Z A;  2JA9 A;  3I73 A;  4RGN A;  3TP7 A;  4HIK A;  1PTO B;  5LMN Q;  1DD2 A;  1EY6 A;  2YYZ A;  1JJG A;  1EYA A;  3MFG A;  5EKI A;  2AUK A;  4GN4 B;  1ESF A;  1W6J A;  4A93 B;  2XWB B;  1PH5 A;  2I5L X;  2JEB I;  4GKJ Q;  1FYC A;  1U0L A;  1YJW A;  2JA8 H;  1XMQ Q;  1HR0 Q;  2A74 C;  3OTO L;  2F0J A;  1R4Q B;  2NYZ D;  4K0K L;  4QB4 A;  3X3N A;  4A3G H;  4RG1 A;  1K8A C;  4LF7 Q;  4OX9 Q;  1MJC A;  2KCC A;  4IJH A;  5C44 G;  3TRE A;  2QDB A;  1PZI D;  4XYQ A;  5LHY 1;  2E2H H;  3TDQ A;  1BCP C;  1JB3 A;  4OWT B;  1RF2 D;  3L9A X;  4HCE A;  4QL5 A;  3PGZ A;  2Y0S G;  2QW7 A;  5C3E G;  4DR6 L;  3HOX G;  4YCU A;  3SEB A;  1GO3 E;  1LT6 D;  1B3Q A;  4A3D H;  2B2T C;  4RGT A;  4C3J G;  4EQN A;  1HZB A;  1BO0 A;  2R7Z G;  2FIN B;  1X9N A;  4HJA A;  3U9O A;  4A75 A;  5JOB A;  1G91 A;  1PFB A;  5C4X G;  1CUK A;  2V1C C;  2OF1 A;  4C1N K;  3K6O A;  3GD7 A;  4QIW B;  1VQC A;  3W2D A;  2D62 A;  4C56 C;  2FXQ A;  2HIX A;  2X69 A;  4OGQ C;  3W1B A;  4WJW A;  2G5D A;  2Z1C A;  3CRL C;  3ERQ A;  4IAL A;  3FPU B;  2NVT B;  1QWY A;  3KLS X;  3ULJ A;  3NEM A;  1XXG A;  5IYD H;  4L5S A;  4NDX A;  1XMO L;  1T5X D;  5K36 G;  3PIP A;  2PPB C;  1MGS A;  1R4P B;  2E5L L;  2EPB A;  5COY A;  1SE3 A;  3OSO A;  2IW3 A;  1VQA A;  5J3B A;  1E7Z A;  2NUC A;  2EZV A;  4IFD J;  3C2P A;  1EIG A;  3M9B A;  1CQF A;  1I50 B;  1LT3 D;  5JJZ A;  3KJO A;  1KL9 A;  1TWF B;  4A3K H;  1B2T A;  3CRK C;  2DNC A;  1SYF A;  3Q8D A;  4A3F G;  4R1J A;  1TWC B;  1KDC A;  3U58 A;  3A8J E;  2E74 C;  2K04 A;  3QO2 A;  5ELE A;  3TSS A;  4DAP A;  2XNA C;  4DAV A;  5IGE A;  1WTO A;  4C3H H;  4DV5 Q;  2ZJP A;  1X6O A;  1PH8 A;  1VQP A;  4OEM B;  1TWG B;  1WTP A;  1SE4 A;  3MFY A;  1GUO A;  5EQ0 A;  2A6E D;  4X65 L;  1XPU A;  3KLS A;  2RHS B;  3SE0 A;  4LUV A;  1NR2 A;  5JVG 3;  4BBS B;  1KAB A;  1EQR A;  2WIN B;  2AWN A;  1XTD A;  3PV0 A;  4DV1 L;  3D4D A;  2AMC B;  3PUW A;  1E2W A;  4HJ7 A;  1QB5 D;  2BOS A;  5M5Y B;  2N78 A;  1QOH A;  5EBD A;  4OO1 H;  4QMG A;  3SK8 A;  1JR0 D;  2RDH A;  3W1G A;  1F2L A;  1SEB D;  2UXD L;  5FO9 B;  1TT2 A;  1IBK L;  2VQF Q;  1VMP A;  3CQZ B;  5C0X H;  3R93 A;  4QIW E;  3S2H B;  1EYD A;  4B3R Q;  3C1E A;  3S9W A;  5KND A;  1X56 A;  2E2I B;  1JWM D;  1X3E A;  4P75 A;  5FO7 B;  3NHH A;  3I2Z A;  5IYB H;  2E75 C;  3CCL A;  3S15 H;  2L55 A;  2VB2 X;  3HOW G;  2DGY A;  2C9O A;  2K03 A;  4LF9 Q;  1EFI D;  3AYH B;  1LAB A;  1F9Q A;  4JV5 Q;  3I56 A;  1CA6 A;  3OWE B;  3VYR A;  3ZJY C;  1BXT A;  4JI0 L;  4IPH A;  5CYU A;  3J81 c;  1QJO A;  4CDC C;  4IFD G;  5IT9 E;  3H3V C;  4UPA A;  1M8A A;  3PSI A;  4IOC A;  2HT1 A;  1SE8 A;  4L8J A;  2R3Z A;  2BE5 C;  1EY4 A;  3JC6 6;  4DR1 L;  3B6Y A;  5D3I B;  1D7Q A;  3HOY G;  3V96 A;  1GUG A;  2KCT A;  4EQ5 A;  5IGD A;  3RLO A;  3MEH A;  1D6E C;  3KDF B;  3PQI A;  1PH3 A;  2ZJQ A;  4CHT B;  3A8K E;  3L0O A;  1HUN A;  4OO1 I;  3PUY A;  1HNZ Q;  4LF5 L;  3R2T A;  2F0G A;  3PUV A;  4DR5 Q;  3DM1 A;  2RF4 A;  3ONA B;  1TY0 A;  3M7G A;  1VF5 C;  4LNQ A;  1YHB A;  2K32 A;  3NEL A;  5J39 A;  4X3U A;  5C0X I;  4DR7 L;  3PUZ A;  2E8G A;  1CTM A;  4KK7 A;  4RH6 A;  4QF4 A;  4AQY L;  2UUA Q;  3CP0 A;  1SFO H;  1X3Q A;  4LF4 L;  1CSP A;  2L9H A;  4QCL A;  2H4O A;  4IUV A;  2Z6K C;  1B4O A;  3S1R B;  1TWA B;  4XDX A;  4KTA A;  3CCR A;  4QGU A;  4KY6 A;  2CFM A;  2ID0 A;  3TZD A;  2IX1 A;  3HOZ G;  3U50 C;  5BN5 A;  1UNS A;  4JI4 Q;  3OMC A;  1JE4 A;  1K3B C;  5E7N A;  5EPK A;  1GHJ A;  2OQK A;  5IT9 c;  4JBW A;  1RTN A;  1VQD A;  1ET6 A;  1Q81 C;  2ES2 A;  2BDN A;  1MSG A;  4FF3 A;  5I6Y A;  4BBR G;  1CK1 A;  1EYG A;  2JA7 G;  1XPO A;  4F88 A;  4JOI C;  4MNO A;  4RGM A;  4MHE A;  3VYT A;  2K1B A;  3J80 E;  4A3M H;  4WJ3 M;  4X3T A;  4L63 B;  5I2X A;  1BQQ T;  1V1P A;  4UP7 A;  3BDC A;  1B3A A;  4KHV A;  2M00 A;  4X64 L;  3I91 A;  2F0D A;  4A3C H;  4A3J B;  2MJ8 A;  1AE2 A;  2N49 A;  1ZXT A;  3QJY A;  3RNU A;  1VQ6 A;  5A35 A;  2A1A A;  1DYQ A;  1LTG D;  1KC8 C;  2EYH A;  3BYY B;  3S1M B;  1STB A;  1AP0 A;  4GOP A;  1Y8O B;  2VY3 A;  3EIV A;  5FJ8 G;  1NNX A;  2CHB D;  5DEH A;  2PI2 A;  3CPF A;  1K3R A;  4OIJ A;  3OWF A;  1CHQ D;  1LTL A;  1PZJ D;  1QVC A;  2K7V A;  3M3Y B;  1S5F D;  3QOJ A;  1N32 L;  4ME5 A;  5D14 A;  5A2Q L;  3IAY A;  3E0J A;  1NTG A;  3S1N B;  2DY8 A;  3KF6 A;  4J8Q A;  4CKB A;  1G29 1;  2L11 A;  1DGS A;  3CAM A;  4UHV A;  3PF4 A;  4UDU C;  3NWT A;  1HNX L;  2JQO A;  3OIQ A;  2Q2U A;  1STH A;  1ZYR D;  2XGT A;  2PQA A;  4KMU C;  1HR0 W;  2K5Q A;  2LXK A;  2F3I A;  4C3I G;  4NMZ A;  5K5P A;  4DNT B;  2A6E C;  3M4Y A;  5KYI A;  2M9V A;  4B08 A;  1HFG A;  1KXL A;  2JA8 B;  1VQF A;  2UXC L;  4JI1 Q;  1X3F A;  1O78 A;  1KRT A;  2I46 A;  4MTK A;  5HY6 A;  4IQZ A;  5M3F G;  1Q7Y C;  1VQK A;  2NVT H;  1SNP A;  1EWH A;  1BBU A;  1OXV A;  1PH7 A;  2TSS A;  1BKB A;  3L3O C;  5GAE C;  4GNX B;  2Z6B A;  2E2H B;  4POG A;  3TRZ A;  4YY3 Q;  4DV4 L;  3H3V I;  3DEO A;  5FLX L;  2H5X A;  2MQH A;  1GOZ A;  3AB9 A;  5IOD A;  4LFB L;  4CKE A;  2LS0 1;  3M4P A;  1KNA A;  2JA6 H;  2F1M A;  2ZM6 L;  4A3D B;  1SE2 A;  3TN2 A;  1TWF H;  4POF A;  1AZQ A;  4A3B G;  3T51 B;  2Q2I A;  5G3L F;  1TS2 A;  2AQ1 B;  3UE0 A;  2JJQ A;  3W5O A;  3GQB A;  3A5Z B;  1FD7 D;  3EVQ A;  2F0P A;  3VYS A;  1I6H H;  1MJE A;  2F0Q A;  4UY8 C;  4EVO A;  1TWG H;  3I4M G;  1SND A;  2KED A;  3VR4 A;  3VA5 A;  2Q8T A;  1JOK A;  2WAQ E;  1WFQ A;  2D0P A;  5C4J B;  5LL6 X;  5BN4 A;  3F2C A;  1L1O A;  3OYY A;  2EJF C;  3T1Y L;  1SYE A;  5JVH 3;  1E2Z A;  4E6I A;  1K8O A;  5KRU A;  3A74 A;  4O0A A;  2K05 A;  4MZ9 A;  3J7Y W;  4U67 3;  1HTP A;  1YNJ D;  5M5Y H;  1BDO A;  1KNE A;  1Y1V G;  1I4R A;  4DR4 Q;  2ZTC A;  2A73 B;  2YU9 H;  1Z9F A;  5AFW A;  2VQE Q;  3SGI A;  1I6V C;  1AN8 A;  3A7A B;  1B50 A;  3TP5 A;  4EQO A;  4A3K B;  1SR3 A;  3BYT B;  3QR8 A;  5EAY A;  1Y1W B;  2R92 H;  2RA4 A;  1YHQ A;  1Q8K A;  4JBM A;  2QF7 A;  2N3S A;  4A93 G;  2EDG A;  4C3H B;  5FOB B;  3HS0 C;  2NBF A;  1HRJ A;  4N8X 1;  2VL6 A;  5CV4 A;  2JA5 B;  2BA0 A;  3OOC A;  1ILP A;  3H15 A;  3T16 A;  1X3P A;  4B3T Q;  1T5E A;  1RCV D;  4IUQ A;  3MXN A;  1OXT A;  3WDN A;  1QZH A;  2R93 B;  3T53 B;  4V0B A;  3M4O H;  1SSO A;  3BDL A;  1TXY A;  1C9O A;  4KY5 A;  3EQL C;  1BCP B;  1V8Q A;  2F03 A;  3H0G B;  1LTA D;  1FVI A;  4HSV A;  1A3V A;  4GKJ L;  5HGT A;  1W6K A;  1W2B A;  1WD0 A;  5AJ3 Q;  1I4G A;  1HR0 L;  4BXX G;  1PH4 A;  4O2D A;  2MHV A;  5JAV A;  2EYM A;  5M5X B;  5C44 H;  2JE6 I;  4LF7 L;  4OX9 L;  3VR2 A;  2PCF B;  5IGC A;  4P74 A;  4H02 A;  2WAC A;  4RMF A;  4IPG A;  1G6P A;  1WTQ A;  4ZKC B;  3S17 H;  4HJ9 A;  1SYD A;  1TVX A;  3MXP A;  3S2D H;  4RKB A;  3G4S A;  2ASB A;  3S1R H;  1HNW L;  1A2U A;  3MC0 B;  5LMU Q;  1TWA H;  1CKN B;  1PLF A;  2NN6 H;  4IO9 A;  4JI7 Q;  1PRT B;  3GTO H;  4RGO S;  1GXD C;  4B9W A;  3TEH B;  1E2V A;  2E2D C;  1SYB A;  3CCE A;  4KKU A;  1CKO A;  5CGK A;  4RFB A;  2RVL A;  5C4X H;  1BR9 A;  1IXR A;  1EZ6 A;  1S3O A;  4KY7 A;  1CI3 M;  3P7J A;  4ZLT F;  1FL0 A;  1EWI A;  4NXM L;  2F0L A;  1ZYR C;  4DV0 Q;  3I7F A;  2EOT A;  5T1G A;  3HOU G;  4L5Q A;  4JYA Q;  2RHQ B;  3EBE A;  3GTQ B;  5IOC A;  2JYO A;  2F4V Q;  2Z4I A;  2K5W A;  1XNQ L;  2D5D A;  1EYC A;  2F0H A;  1XNR Q;  3K59 A;  2L0C A;  3GTM H;  1GUW A;  2F0S A;  1KQS A;  3NWS A;  5ELC A;  3J81 L;  2F3V A;  1E24 A;  1V1O A;  2N88 A;  4R4C A;  3CCV A;  4DR2 Q;  1BOS A;  4BBS G;  3PMF A;  4H13 C;  1B9N A;  1LT4 D;  3J80 i;  2NN6 I;  2QEX A;  3FPP A;  3CKI B;  1PTO D;  4LFA L;  4ZAI A;  1SAP A;  1STG A;  1DOM A;  4A3F H;  3PO3 G;  1JMC A;  4DNI A;  4RHS A;  4XIG S;  1B8A A;  2XTI A;  1QNU A;  4GOP C;  1SNC A;  3NBH B;  3PUX A;  2HDM A;  3GTL H;  5GAD C;  4DV7 L;  3D3R A;  1VQH A;  3R8B A;  1HFN A;  4NPS A;  1AZP A;  4A3M B;  2BCO A;  1RL2 A;  2JP1 A;  2FMC A;  3PF5 A;  1HH2 P;  3W3A A;  1HUM A;  4JI6 Q;  5IP7 H;  2ZXP A;  5ELN A;  3X3M A;  4DFA A;  4GN3 B;  1UEB A;  1CA5 A;  2ZT9 C;  2R7D A;  4OON A;  1A0I A;  4DKA C;  1SYG A;  4C2M H;  1PH2 A;  2ZJR A;  1B7Y B;  3CCS A;  1I94 Q;  1FJG L;  4BY1 G;  5C6A A;  1STE A;  1OXU A;  3FKI G;  1ASZ A;  2NZ1 D;  1YNJ C;  4KJN A;  2VQF L;  3K5N A;  5NUC A;  1EQT A;  2D9U A;  4RCN A;  3I4N G;  5JPM C;  4DK6 C;  1BBX C;  1TKW B;  5E3F A;  1LTS D;  3T56 B;  3CW2 C;  1QUQ B;  1BBW A;  5C3W A;  3T1H L;  1DON A;  1LV9 A;  4JV5 L;  5EGT A;  1J9O A;  1WCM G;  4IFD H;  3URY A;  2OTJ A;  2IX3 A;  1KDA A;  4JI3 L;  4HED A;  4CBV A;  4QUC A;  3C46 A;  4DUY Q;  1L2F A;  1M1K C;  3HOV G;  1VQ8 A;  2EYF A;  4RWS C;  5C4J H;  4HAE A;  4N8F A;  1X55 A;  5M3M G;  3TS0 A;  1LUZ A;  4A3L G;  2KQ3 A;  1MIU A;  2PQE A;  2I5M X;  4KHP Q;  3BVG A;  3CXC A;  4HJ5 A;  2CWA A;  4DR5 L;  2UUB L;  4HIO A;  1IW7 D;  2UU9 Q;  4HID A;  2F0F A;  5TSS A;  2YV5 A;  3QG1 A;  3Q6S A;  4Q5V A;  2WFW A;  1L1O C;  4CJ1 B;  2UUA L;  2EJM A;  1JC7 A;  2JA6 B;  1RIP A;  3K7A B;  2NTT A;  4DV6 Q;  3SK5 A;  5EKK A;  5IGB A;  1Y14 B;  1Y1W H;  4LUZ A;  1HZA A;  1EY5 A;  1NAP A;  1S5C D;  3D6W A;  2ICE C;  5E4W C;  4G7O C;  1U4R A;  1N36 L;  1EZ8 A;  4IFD I;  4A3J G;  2CVR A;  4KHZ A;  1J5E L;  1EY7 A;  1YHA A;  1IHZ A;  1I6H B;  4KLK A;  4JI4 L;  1EY0 A;  4FXG C;  4DR3 L;  2IWH A;  2K5D A;  4BY7 G;  3CC7 A;  2JA5 H;  2F3W A;  3I4O A;  4DK0 A;  4NXN Q;  3VR5 A;  4M8A A;  3HKZ B;  4N9T A;  3SDZ A;  2O5J C;  1G8Z D;  4YHH L;  4KN7 C;  2WAQ G;  3S16 H;  1Q90 A;  2G9D A;  3UDI A;  4OWW B;  4UP9 A;  2L1B A;  2R93 H;  1AW7 A;  4JI2 Q;  1HJP A;  3JAM E;  1IBM L;  2UUC Q;  2SNS A;  2YU9 B;  3H0G H;  1EIF A;  1LYL A;  1JOQ A;  2KCM A;  2AKW B;  3K0Y A;  3PO2 B;  4XT1 B;  4JI8 L;  2R92 B;  1DZ1 A;  3I4L A;  4BWG B;  5M5X H;  4A76 A;  1XX8 A;  4IJL A;  1Z47 A;  4NP5 A;  3CCQ A;  4HIM A;  1RKN A;  3VYU A;  4X66 L;  3OTO Q;  1B9M A;  2B63 H;  3OMG A;  3KUP A;  2JA8 G;  1Y69 U;  1G2S A;  3Q0A A;  1JOO A;  3MA2 B;  4Q0F A;  4A3G G;  1VQB A;  1PTO C;  2KBN A;  2WKC A;  4K14 A;  2D0O A;  3NXW A;  2F0N A;  3TP6 A;  1YI2 A;  4DV2 L;  4FXK C;  5IP9 G;  1O80 A;  2QIL A;  5D3D A;  2EVB A;  4C3I H;  4DR6 Q;  5JPN C;  3BZC A;  3M4O B;  1Q1E A;  3GTJ H;  4OIK A;  4V19 0;  2MO1 A;  2VNU D;  4A3D G;  4ZYS A;  4PMB A;  5CBA E;  1PMR A;  4G57 A;  4LK1 C;  3JAM c;  1PZK D;  1OXS C;  4K2L A;  3DXJ C;  1X3G A;  4JI1 L;  4FXD A;  1UE5 A;  3GTQ H;  5C44 B;  2QEJ C;  4DU9 A;  1YIT A;  1R9T H;  4BA2 I;  3I8Z A;  3AFQ A;  1U4L A;  4P72 A;  5FLM H;  5M9O A;  3HKZ E;  3S17 B;  1SRU A;  1H9K A;  4H0L C;  3CD6 A;  3S2D B;  4ULL A;  2QA4 A;  4X3S A;  1XMO Q;  3J81 j;  5IYD G;  1FNW A;  2YTY A;  2WKD A;  2E5L Q;  1L0Y B;  3GTO B;  2IJ0 A;  1VQO A;  5BR8 L;  4GNX A;  1EL0 A;  1I5F A;  3U4Z A;  1DXM A;  1D5M C;  5EKL A;  2VUM H;  2LY7 A;  1K0S A;  2L5T A;  2F0W A;  5FKA C;  4AH6 A;  5C4X B;  1YJ9 A;  1F9R A;  3I4M H;  4F87 A;  2AUJ D;  5E1F A;  4EQP A;  5H1S E;  1KLU D;  3H09 A;  4NW2 A;  3FVQ A;  4YWM A;  1V43 A;  1GHK A;  4C3H G;  2KEN A;  1Q82 C;  2OEO A;  4X65 Q;  1Z6H A;  4LFC Q;  2R61 A;  3GTM B;  2J0T D;  4APV A;  5EBC A;  4KD4 A;  3DLL A;  1PYS B;  3F8T A;  5BN3 A;  4DV1 Q;  4IPD A;  4X62 L;  4K6L A;  1TS5 A;  2K33 A;  3BZK A;  1IW7 C;  4HMI A;  4CJ2 C;  2VQE L;  2K5N A;  4A3E H;  2MUY A;  3BDO A;  2HD3 A;  4TRD A;  1QZG A;  4A3F B;  4K5X A;  4XYO A;  1JWU D;  3UI2 A;  1EU3 A;  3H3V H;  4OO1 G;  3C3L A;  2KJX A;  4J15 A;  2RDG A;  3ND8 A;  2UXD Q;  1IBK Q;  1LLR D;  1ICW A;  2VB3 X;  1BF4 A;  5CMD A;  2IY5 B;  4PQX A;  1GUS A;  2IT1 A;  5LMN W;  5IWA Q;  3GTL B;  2EE1 A;  5C0X G;  4K5W A;  5KYL A;  2B2W A;  4MTN A;  2UXB L;  1QG7 A;  1Y8N B;  1JOR A;  4GS3 A;  4KJO A;  5M5W B;  5IYB G;  1S40 A;  5IIF A;  2KA7 A;  3J80 c;  3RZO H;  1WTX A;  4DUZ L;  5IY0 A;  1RD9 D;  4GZY C;  2NVY H;  3EA6 A;  1QCB D;  1S5B D;  2X6G A;  1X65 A;  1K83 B;  1JE5 A;  3HRZ C;  1P8L A;  4K6D A;  4R4Q A;  5JJI A;  4B9X A;  2PMZ B;  2CCZ A;  1CHP D;  3IRB A;  3KF8 A;  1EIH A;  4ZK9 B;  3IL8 A;  4C2M B;  1WOC A;  3CCM A;  5E4X A;  4BS9 A;  3BVZ A;  3BJU A;  1Q12 A;  1SMY D;  2SOB A;  4XQQ A;  1MBY A;  4A3I G;  4GLA C;  1JWS D;  4CGY B;  1ICF B;  4G7H C;  1TR5 A;  1UWV A;  2WV6 D;  3KLW A;  2JEA I;  3CC4 A;  5EJW A;  3ER0 A;  2A5H A;  5I2Y A;  1XPR A;  4LF5 Q;  3AMU A;  1SXT A;  2Z9H A;  2RCF A;  3BS1 A;  1XYI A;  4RKL A;  3HOW B;  2G9H D;  1BVS A;  2ZTE A;  3HEJ A;  3K7A H;  4B3S L;  5DM6 3;  4RA8 A;  4DR7 Q;  1IZ6 A;  2RQX A;  5HUR A;  2B8F A;  4MN3 A;  3H94 A;  2OT2 A;  1SNO A;  1I3Q H;  3I72 A;  3LGJ A;  4LF4 Q;  4QQB X;  3UE1 A;  4I7Z C;  3ICE A;  1EIY B;  4K5V A;  4R8I A;  2WB1 B;  4GLX A;  4KKS A;  4B3M L;  2PW7 A;  1V1Q A;  4HTH A;  3QB3 A;  4P2C B;  4UP8 A;  2ZXO A;  4DGZ A;  5HGQ A;  2P5Z X;  3AFP A;  1PHJ A;  3UDG A;  4YCV A;  2B3G A;  2Z4H A;  2Z8L A;  2WP8 J;  2ZXR A;  3BU2 A;  2HHH L;  2E2J B;  1CSQ A;  3NPP A;  2EQS A;  4TKO B;  3M4Q A;  3KOJ A;  3GV3 A;  1K8M A;  4N9P A;  5J1Z A;  1KRS A;  4FF4 A;  5KNC A;  1LAC A;  2K6A A;  3T4A C;  4CDF C;  1Q46 A;  4IN3 A;  2ZTD A;  1EOT A;  3IKJ A;  1VQN A;  3MEF A;  1D5Z C;  3V05 A;  1H95 A;  3TS2 A;  4A3M G;  2R6G A;  4GOP B;  5JEA J;  3PO2 H;  2K52 A;  1K0R A;  2LMC B;  1GVP A;  4X64 Q;  4ME3 A;  4LUO A;  1F9P A;  1VMC A;  5KGU A;  4A3C G;  3E6Z X;  3NQI A;  2CW0 D;  3JAM i;  4LF6 L;  5IYC H;  1N34 L;  3PIO 3;  4RAU C;  4DV3 L;  5DAU A;  1QVG A;  3CC2 A;  1C0A A;  3D6C A;  3CU7 A;  3KF6 B;  1GD7 A;  1I4Q A;  2SEB D;  2A6H D;  3MXG A;  3H6M A;  4R4O A;  2I07 B;  4DXG A;  4ALP A;  3VR6 A;  1N33 L;  1HQR D;  1XWE A;  2TMP A;  4GKK L;  3S16 B;  2PQA B;  2RKS A;  1D1I A;  1YVC A;  5LMN L;  1K73 C;  1VQ9 A;  1EEI D;  2HUG A;  3P75 A;  4H44 C;  2EYO A;  5CBE E;  3ZYY X;  4HCS A;  4O1N A;  2RDF A;  5CR3 A;  1O7I A;  2WB1 E;  1XMQ L;  2F0K A;  1PRT D;  4BY1 H;  5KNB A;  1FGU A;  4ABN A;  3ITP A;  1G51 A;  3D8G A;  3RMH A;  2UXC Q;  4JW0 A;  2B63 B;  1IBL Q;  2OTL A;  1D1K A;  5A2Q E;  2WII B;  1VCI A;  1AE3 A;  2KOL A;  2B8G A;  3KFU A;  1QE6 A;  1H9S B;  3RZD H;  3LWE A;  4QUF A;  1HXY D;  5C3E H;  3FRP B;  3HOX H;  4KKT A;  1LTT D;  1VQE A;  2EXZ A;  3CHB D;  2B2Y A;  4DA2 A;  5FO8 B;  3J7A 5;  1TWH H;  4L6T B;  3LNN A;  1I4H A;  2HCI A;  2LXJ A;  4C3J H;  2V4D A;  4DV4 Q;  2K14 A;  4HMJ A;  2L15 A;  2R7Z H;  1X54 A;  3RLF A;  4C3I B;  4FYD A;  5JEA G;  1VQM A;  1M90 C;  2ZM6 Q;  1GM5 A;  1VQ5 A;  1S5D D;  3GTJ B;  2QKI C;  5IGG A;  2JA6 G;  5GQO A;  3CCJ A;  3U9S A;  1QUQ A;  4CKC A;  2VXW A;  4ZQ3 A;  4DUY L;  3KJP A;  4L5T A;  3SXH A;  5M3F B;  4GNX C;  1H9M A;  5T1I A;  3MZ5 A;  2NVX B;  1FNV A;  3F1Z A;  1T9H A;  4MIU A;  4TVA B;  1R9T B;  5K36 H;  3KLR A;  4I65 A;  1YJN A;  1X32 A;  2A8V A;  4G7Z C;  1JJC B;  1FNU A;  5FLX E;  2UU9 L;  2PNR C;  5J22 A;  1PTO F;  3MAQ A;  4IPC A;  1YNN D;  5GRO A;  1E3P A;  3HKZ G;  4X3K A;  1SMY C;  3R3O A;  2F4I A;  5C5L A;  3GTG B;  4OHJ A;  4CDD C;  3SK4 A;  1TQO A;  2DY7 A;  3OIP A;  1B1Z A;  1SN8 A;  2VUM B;  5GAG C;  5GAH C;  1ILQ A;  1WTR A;  2CWP A;  3ERS X;  4QY7 A;  5C3X A;  3RN5 A;  1A3T A;  3NBI A;  2FFK B;  3L2P A;  4M1U B;  3HGB A;  3I4M B;  4DV5 L;  2JN4 A;  3IFD A;  3F2D A;  4LWC A;  2E76 C;  3S14 B;  4C1N I;  2YTX A;  4DAY B;  2R92 G;  1IL8 A;  4S3S A;  4NXN L;  1RTO A;  4DNR B;  3TP8 A;  2FMM A;  5M5W H;  3MTS A;  3MXN B;  1EUJ A;  3MHB A;  3I90 A;  1NJI C;  1OTC A;  5ELO A;  1EEF D;  3BVM A;  2C35 B;  1E1T A;  3O13 A;  2A68 D;  1K83 H;  1Q86 C;  4PNY A;  3NK9 A;  3A54 A;  1RJT A;  4JI2 L;  4R4I A;  2B2W C;  3J7A V;  2XSC A;  1CFM A;  1VS0 A;  2NZO A;  5I9O A;  2PZW A;  3K57 A;  1AH9 A;  3FMC A;  3EN2 A;  4Z9C B;  4A3E B;  5IT9 L;  3STB D;  4R9W A;  4WJ4 A;  2JK8 A;  1PH1 A;  1VQJ A;  5ELB A;  2F0V A;  2XIW A;  1U9R A;  5JJK A;  1WJJ A;  1E22 A;  2CH4 A;  3M7N A;  3VR3 A;  2EYJ A;  4B3R L;  1J6Q A;  2X6L A;  1Q3L A;  4XQN A;  1NMF A;  4FP5 D;  1FGB D;  3HOW H;  4EX5 A;  2AHO B;  2J7Z A;  3TQY A;  1TS4 A;  2JXM B;  5I6W A;  1F2Y A;  4HR7 B;  4XQJ A;  4LF9 L;  2F0I A;  3NE5 B;  4DAM A;  4PZ6 A;  2MFI A;  2EY2 A;  2CW0 C;  2XN9 C;  4K8I A;  5ELD A;  3ULP A;  4Y7N B;  1PDQ A;  3OW7 A;  1LO5 D;  3R2I A;  3RZO B;  4XXE A;  1HNW Q;  5IP9 H;  1A6X A;  4LF8 Q;  2NVY B;  2A6H C;  3L7Z C;  4IUP A;  3G48 A;  1C8C A;  3HOY H;  3PCO B;  2NN6 G;  1JJ2 A;  3SR1 A;  1WTV A;  1STA A;  1XJV A;  2QCP X;  2MP1 A;  1DM0 B;  3E9H A;  1SMX A;  4LW1 A;  3S24 A;  4O42 A;  2GA4 B;  2F0E A;  2LSS A;  4GLV B;  1HNZ L;  1HPC A;  3A55 A;  2E2J H;  5KIX A;  1WI5 A;  2Q8I B;  2XWJ B;  2VZA A;  4JI5 Q;  4NXM Q;  1NUC A;  2F0O A;  3KDF A;  4DK1 A;  3NSW A;  2DJG C;  1M4V A;  1PRT C;  3T13 A;  1UAP A;  1ENA A;  4ZUJ A;  1XNQ Q;  3ULL A;  1UEA B;  3J80 L;  1EFW A;  3CME A;  3HOZ H;  4WFN 3;  1I3Q B;  5C4H A;  2K5H A;  1N8R C;  3A7L A;  4NKL A;  3DMU A;  2EY5 A;  3FEW X;  1SDF A;  3CPW A;  5LL6 S;  5JJL A;  2Q8R E;  4JK1 C;  2O5I C;  2SDF A;  1G2T A;  2RSO A;  3K5M A;  3KBX A;  3Q22 A;  1KTK A;  4FVM A;  4RCO A;  4LFA Q;  1RHP A;  3BZD B;  1PFM A;  3H91 A;  3NTK A;  1SYC A;  4BBR H;  1AEX A;  3HOU B;  2JA7 H;  4LJZ C;  1Z7T A;  1YIJ A;  4KV6 A;  3DUZ A;  1I4P A;  2K5V A;  4XTC S;  1VQ4 A;  1EQV A;  3E5S A;  3J7A F;  2MPM A;  1HTL D;  1UUP A;  2IHF A;  4DV7 Q;  3J81 E;  4LFC L;  1JT8 A;  1UE7 A; 
#chains in the Genus database with same CATH homology
 3S1Q B;  1XTC D;  2RBM A;  1VDZ A;  3SK6 A;  2B2V A;  1PYW D;  2ENB A;  4DN4 M;  5FK9 C;  3PO3 B;  1YNN C;  2MGS A;  1U4P A;  1H9R A;  2H1E A;  4AYB B;  2B39 A;  1LTI D;  3G6J B;  1Y8P B;  1DJR D;  2O2L D;  1MSH A;  4EGV A;  1FR3 A;  1GJX A;  1EY8 A;  1A15 A;  4IZ8 A;  1J8I A;  1LTB D;  3C1F A;  1O7L A;  3OHX C;  2LFN A;  2KEE A;  1BUV T;  1CM9 A;  2B2Y C;  2FHT A;  2IPK D;  2HDL A;  3K58 A;  1D2B A;  2IX0 A;  4BY1 B;  1JCK B;  3FKI B;  2A68 C;  1WD1 A;  2AWO A;  3WOF A;  5D65 A;  1PFN A;  5C0X J;  3I4N B;  2Y0S B;  3DWQ A;  2XVS A;  3RZD B;  1O7Y A;  4WRD A;  3D4R A;  5C3E B;  3HOX B;  4G4K A;  4LMQ D;  1TWH B;  4RHR A;  1A3U A;  2BA1 A;  4PMW A;  4C3J B;  4OL7 A;  3LWU A;  1HQM C;  4KN4 C;  1WCM B;  2R7Z B;  2PZT A;  1Q1B A;  5IGF A;  1ENF A;  4BA1 I;  2L4N A;  2HQE A;  3HOV B;  2KVM A;  1S4Z A;  2ICI A;  2PW5 A;  5M3M B;  3GTK B;  3GTP B;  1AFP A;  1ZKO A;  3A56 A;  3QOL A;  1ENC A;  4F7X A;  4FF1 A;  2K28 A;  2EYP A;  1ESR A;  2CQA A;  3LX0 A;  3PIP 3;  1G6Z A;  4J6H A;  2DNE A;  4DF7 A;  1GUT A;  3I70 A;  3P1H A;  5CV6 A;  3AU7 A;  1TY2 A;  2PYK A;  1PTO H;  1CZW A;  1HHV A;  5CV5 A;  2XRQ D;  2N55 A;  1ET9 A;  1D5X C;  3TZU A;  1SNQ A;  4R8N A;  2B2U A;  4U68 A;  4BY7 B;  3V2T A;  3KBG A;  4H7B A;  1F77 A;  2L12 A;  1MD2 D;  2WAQ B;  1EU4 A;  1II3 A;  1QNK A;  3NUC A;  1JIC A;  1KDB A;  1IKL A;  3QIA A;  2NTS A;  1BNZ A;  2PO4 A;  4ID6 A;  4K2K A;  4UAI A;  4HSP A;  4FO2 A;  2EYL A;  4DXF A;  5DNF A;  3MVV A;  3G7L A;  4FF2 A;  1WVL A;  3I3C A;  1IKM A;  5I9P A;  4F8M A;  1L0X B;  4XT3 B;  1B44 D;  3TME A;  1ONL A;  1SBB B;  1ZEQ X;  4A3G B;  1Q8I A;  1DOL A;  2A69 D;  3F2U A;  2B2T A;  3NP8 A;  1ML0 D;  2KEC A;  1HA5 A;  5ELF A;  5JEA H;  3HZX A;  1NSN S;  3HOY B;  1H9S A;  1E0B A;  3MWY W;  2KHS A;  4KD3 A;  2RSN A;  3EJI A;  5COR A;  2AQ3 B;  1HA6 A;  1C48 A;  1V1P B;  3BG3 A;  3NTI A;  2BDO A;  2EY6 A;  5G3L D;  1EY9 A;  3NTH A;  1SJE D;  3SHL A;  1CZG A;  5EPL A;  1BCP F;  1JQY D;  2EY1 A;  3HOZ B;  1TS3 A;  2F0U A;  1NR4 A;  4IUR A;  1VF7 A;  2AQ2 B;  3N52 A;  3D4W A;  2F0T A;  2O4X A;  1BCP D;  1SJH D;  4LAA A;  4PMC A;  2FJ2 A;  3SVM A;  5CV9 A;  3M85 A;  2J4X A;  1S5E D;  1IYU A;  4PV1 C;  2B2V C;  3TBI B;  4BBR B;  5C4Z A;  2JA7 B;  1MI2 A;  1STY A;  1HCZ A;  3KK7 A;  1CQV A;  1WTW A;  4J1M A;  1LTR D;  3HG9 A;  4TSS A;  4TQU S;  1PRT F;  1ROD A;  3Q24 A;  5I4D A;  3NBH A;  3RD4 A;  4DAY A;  3ND9 A;  2EJG C;  2XRS D;  1NCV A;  1STN A;  3NQT A;  3DEP A;  3WOE A;  2NWG A;  3ERO A;  2C5C A;  2IL8 A;  1F2M A;  2JSO A;  4ZKB B;  1H9J A;  5CV7 A;  1TU2 B;  3RUZ A;  2HCC A;  4FNF A;  1EWC A;  5F2D A;  3DWA A;  4IUN A;  4WOR A;  3Q23 A;  1GUN A;  1KLG D;  4IUT A;  3K5L A;  3OPO A;  5DM7 3;  3MXU A;  5EPJ A;  3S15 B;  5CV8 A;  2KCN A;  1TII D;  1DOK A;  2NB0 A;  3N6R A;  4ZUI A;  3VA7 A;  2OXP A;  1QIL A;  2F0M A;  2M2L A;  4YIJ A;  1IYV A;  4A3I B;  3DHQ A;  1B53 A;  1CT1 D;  1KAA A;  1OO9 B;  1RDP D;  2DN8 A;  3EFX D;  1PXU A;  3DWP A;  4K8J A;  3A8I E;  2SNM A;  5C5M A;  4A3B B;  1I4X A;  2LKV A;  4ZRZ A;  3GP7 A;  4KI0 A;  1SNM A;  4ILW A;  3P20 A;  1SFO B;  3JAM L;  5KEE A;  1U4M A;  1LT5 D;  1C4Q A;  2PZU A;  2NVQ B;  2A69 C;  2K01 A;  2D2C C;  1F9S A;  4HN7 A;  5CC4 A;  4IUU A;  3K5O A;  3FDT A;  1A2T A;  3D31 A;  1DCZ A;  2B2U C;  2KUM A;  3GV6 A;  5ISR A;  1OXX K;  2BE5 D;  3HP3 A;  1O7Z A;  1Y1V B;  3GO5 A;  3IFT A;  4ODG A;  4CJ0 B;  3QWN A;  1F2Z A;  3I73 A;  4RGN A;  3TP7 A;  1PTO B;  1DD2 A;  1EY6 A;  2YYZ A;  1EYA A;  3MFG A;  5EKI A;  2AUK A;  1ESF A;  1W6J A;  4A93 B;  2XWB B;  2JEB I;  1FYC A;  2A74 C;  2F0J A;  1R4Q B;  2NYZ D;  4QB4 A;  3X3N A;  2KCC A;  2QDB A;  1PZI D;  4XYQ A;  5LHY 1;  3TDQ A;  1BCP C;  1JB3 A;  1RF2 D;  3L9A X;  4HCE A;  3SEB A;  1LT6 D;  2B2T C;  4RGT A;  4C3J G;  4EQN A;  1BO0 A;  2FIN B;  3U9O A;  5JOB A;  1G91 A;  1PFB A;  2OF1 A;  4C1N K;  3K6O A;  3GD7 A;  4QIW B;  3W2D A;  2D62 A;  4C56 C;  2X69 A;  4OGQ C;  4WJW A;  2Z1C A;  3CRL C;  3ERQ A;  4IAL A;  3FPU B;  2NVT B;  1QWY A;  3KLS X;  1XXG A;  4NDX A;  1T5X D;  5K36 G;  2PPB C;  1MGS A;  1R4P B;  2EPB A;  5COY A;  1SE3 A;  3OSO A;  2IW3 A;  2NUC A;  2EZV A;  4IFD J;  3C2P A;  1EIG A;  1CQF A;  1I50 B;  1LT3 D;  5JJZ A;  1TWF B;  1B2T A;  3CRK C;  2DNC A;  1SYF A;  1TWC B;  1KDC A;  3A8J E;  2E74 C;  2K04 A;  3QO2 A;  5ELE A;  3TSS A;  4DAP A;  2XNA C;  4DAV A;  5IGE A;  1WTO A;  1TWG B;  1WTP A;  1SE4 A;  3MFY A;  1GUO A;  5EQ0 A;  2A6E D;  3KLS A;  3SE0 A;  1NR2 A;  5JVG 3;  4BBS B;  1KAB A;  2WIN B;  2AWN A;  3PV0 A;  3D4D A;  3PUW A;  1E2W A;  1QB5 D;  2BOS A;  5M5Y B;  1QOH A;  5EBD A;  4OO1 H;  4QMG A;  3SK8 A;  1JR0 D;  2RDH A;  1F2L A;  1SEB D;  5FO9 B;  1TT2 A;  1VMP A;  3CQZ B;  5C0X H;  3R93 A;  3S2H B;  1EYD A;  3C1E A;  3S9W A;  5KND A;  2E2I B;  1JWM D;  5FO7 B;  3NHH A;  2E75 C;  2L55 A;  2VB2 X;  2K03 A;  2C9O A;  1EFI D;  1LAB A;  1F9Q A;  1CA6 A;  3OWE B;  3VYR A;  1BXT A;  5CYU A;  1QJO A;  4IFD G;  5IT9 E;  3H3V C;  1M8A A;  4L8J A;  2R3Z A;  2BE5 C;  1EY4 A;  5D3I B;  3V96 A;  1GUG A;  5IGD A;  3MEH A;  1D6E C;  4CHT B;  3A8K E;  1HUN A;  4OO1 I;  3PUY A;  3R2T A;  2F0G A;  3PUV A;  3DM1 A;  3ONA B;  1TY0 A;  3M7G A;  1VF5 C;  2K32 A;  5J39 A;  4X3U A;  5C0X I;  3PUZ A;  1CTM A;  4KK7 A;  4RH6 A;  4QF4 A;  1X3Q A;  2L9H A;  4QCL A;  2H4O A;  4IUV A;  3S1R B;  1B4O A;  1TWA B;  4XDX A;  4KTA A;  4KY6 A;  3TZD A;  2ID0 A;  2IX1 A;  5BN5 A;  1UNS A;  3OMC A;  1JE4 A;  5EPK A;  1GHJ A;  4JBW A;  1RTN A;  1ET6 A;  2BDN A;  1MSG A;  4FF3 A;  5I6Y A;  1CK1 A;  4F88 A;  4RGM A;  4MHE A;  3VYT A;  2K1B A;  3J80 E;  4X3T A;  4L63 B;  5I2X A;  1BQQ T;  1V1P A;  3BDC A;  1B3A A;  4KHV A;  2M00 A;  3I91 A;  2F0D A;  4A3J B;  2MJ8 A;  1ZXT A;  3QJY A;  5A35 A;  1DYQ A;  1LTG D;  2EYH A;  3BYY B;  3S1M B;  1STB A;  1AP0 A;  1Y8O B;  2CHB D;  5DEH A;  4OIJ A;  3OWF A;  1CHQ D;  1PZJ D;  2K7V A;  3M3Y B;  1S5F D;  3QOJ A;  4ME5 A;  5D14 A;  5A2Q L;  3IAY A;  3E0J A;  3S1N B;  2DY8 A;  4J8Q A;  4CKB A;  1G29 1;  2L11 A;  4UDU C;  3NWT A;  3OIQ A;  1STH A;  1ZYR D;  4KMU C;  2K5Q A;  4C3I G;  4NMZ A;  5K5P A;  4DNT B;  2A6E C;  3M4Y A;  5KYI A;  2M9V A;  4B08 A;  1HFG A;  2JA8 B;  1O78 A;  2I46 A;  4IQZ A;  1SNP A;  1EWH A;  1OXV A;  2TSS A;  3L3O C;  2E2H B;  3DEO A;  5FLX L;  1GOZ A;  3AB9 A;  5IOD A;  4CKE A;  2LS0 1;  1KNA A;  2F1M A;  4A3D B;  1SE2 A;  3TN2 A;  1AZQ A;  3T51 B;  5G3L F;  1TS2 A;  2AQ1 B;  3GQB A;  1FD7 D;  3EVQ A;  2F0P A;  3VYS A;  2F0Q A;  4EVO A;  1SND A;  2KED A;  3VR4 A;  3VA5 A;  2Q8T A;  1JOK A;  5C4J B;  5LL6 X;  5BN4 A;  2EJF C;  1SYE A;  5JVH 3;  1E2Z A;  4E6I A;  1K8O A;  5KRU A;  2K05 A;  3J7Y W;  4U67 3;  1HTP A;  1YNJ D;  1BDO A;  1KNE A;  1I4R A;  2A73 B;  5AFW A;  1I6V C;  1AN8 A;  3A7A B;  1B50 A;  3TP5 A;  4EQO A;  4A3K B;  3BYT B;  1Y1W B;  2RA4 A;  2QF7 A;  2EDG A;  4C3H B;  5FOB B;  3HS0 C;  2NBF A;  1HRJ A;  5CV4 A;  2JA5 B;  2BA0 A;  3OOC A;  1ILP A;  3T16 A;  1X3P A;  1T5E A;  1RCV D;  4IUQ A;  3MXN A;  1OXT A;  3WDN A;  2R93 B;  3T53 B;  4V0B A;  1SSO A;  3BDL A;  4KY5 A;  3EQL C;  1BCP B;  1V8Q A;  2F03 A;  3H0G B;  1LTA D;  4HSV A;  1A3V A;  5HGT A;  1W6K A;  1WD0 A;  1I4G A;  2MHV A;  5JAV A;  2EYM A;  5M5X B;  2JE6 I;  3VR2 A;  2PCF B;  5IGC A;  2WAC A;  1WTQ A;  4ZKC B;  1SYD A;  1TVX A;  3MXP A;  4RKB A;  1A2U A;  3MC0 B;  1PLF A;  2NN6 H;  1PRT B;  4RGO S;  1GXD C;  4B9W A;  1E2V A;  2E2D C;  1SYB A;  4KKU A;  5CGK A;  4RFB A;  2RVL A;  1BR9 A;  1EZ6 A;  4KY7 A;  1CI3 M;  3P7J A;  4ZLT F;  2F0L A;  1ZYR C;  2EOT A;  5T1G A;  3GTQ B;  5IOC A;  2JYO A;  2Z4I A;  2K5W A;  2D5D A;  1EYC A;  2F0H A;  3K59 A;  2L0C A;  1GUW A;  2F0S A;  3NWS A;  5ELC A;  3J81 L;  2F3V A;  1V1O A;  2N88 A;  1BOS A;  3PMF A;  4H13 C;  1B9N A;  1LT4 D;  2NN6 I;  3FPP A;  3CKI B;  1PTO D;  4ZAI A;  1SAP A;  1STG A;  1DOM A;  4RHS A;  4XIG S;  1QNU A;  1SNC A;  3PUX A;  2HDM A;  3D3R A;  3R8B A;  1HFN A;  1AZP A;  4A3M B;  2BCO A;  2JP1 A;  2FMC A;  3W3A A;  1HUM A;  2ZXP A;  3X3M A;  4DFA A;  1CA5 A;  2ZT9 C;  1SYG A;  5C6A A;  1STE A;  1OXU A;  2NZ1 D;  1YNJ C;  4KJN A;  3K5N A;  5NUC A;  1EQT A;  2D9U A;  4RCN A;  5JPM C;  1BBX C;  1TKW B;  5E3F A;  1LTS D;  3T56 B;  5C3W A;  1DON A;  1LV9 A;  5EGT A;  1J9O A;  4IFD H;  3URY A;  2IX3 A;  1KDA A;  4HED A;  4CBV A;  4QUC A;  3C46 A;  2EYF A;  4RWS C;  4HAE A;  2KQ3 A;  2PQE A;  3BVG A;  1IW7 D;  2F0F A;  5TSS A;  3QG1 A;  3Q6S A;  4Q5V A;  4CJ1 B;  2EJM A;  1JC7 A;  2JA6 B;  3K7A B;  2NTT A;  3SK5 A;  5EKK A;  5IGB A;  1EY5 A;  5E4W C;  1NAP A;  1S5C D;  2ICE C;  3D6W A;  4G7O C;  1U4R A;  1EZ8 A;  4IFD I;  2CVR A;  4KHZ A;  1EY7 A;  1IHZ A;  1I6H B;  1EY0 A;  4FXG C;  2IWH A;  2K5D A;  2F3W A;  4DK0 A;  3VR5 A;  4M8A A;  3HKZ B;  4N9T A;  3SDZ A;  2O5J C;  1G8Z D;  4KN7 C;  1Q90 A;  2G9D A;  2L1B A;  1AW7 A;  3JAM E;  2SNS A;  2YU9 B;  1JOQ A;  3K0Y A;  3PO2 B;  4XT1 B;  2R92 B;  1DZ1 A;  3I4L A;  4BWG B;  1XX8 A;  1Z47 A;  4NP5 A;  1RKN A;  3VYU A;  1B9M A;  3OMG A;  3KUP A;  1Y69 U;  1G2S A;  3Q0A A;  1JOO A;  3MA2 B;  4Q0F A;  1PTO C;  2WKC A;  4K14 A;  3NXW A;  2F0N A;  3TP6 A;  4FXK C;  1O80 A;  2QIL A;  5D3D A;  2EVB A;  5JPN C;  3M4O B;  1Q1E A;  4OIK A;  4V19 0;  2VNU D;  4ZYS A;  4PMB A;  5CBA E;  1PMR A;  4G57 A;  4LK1 C;  1PZK D;  1OXS C;  4K2L A;  3DXJ C;  4FXD A;  5C44 B;  2QEJ C;  4DU9 A;  4BA2 I;  3I8Z A;  1U4L A;  5M9O A;  3S17 B;  4H0L C;  1H9K A;  3S2D B;  4ULL A;  4X3S A;  1FNW A;  2WKD A;  1L0Y B;  3GTO B;  2IJ0 A;  1EL0 A;  1DXM A;  1D5M C;  5EKL A;  2LY7 A;  2L5T A;  2F0W A;  5FKA C;  5C4X B;  1F9R A;  4F87 A;  2AUJ D;  5E1F A;  4EQP A;  1KLU D;  3H09 A;  4NW2 A;  3FVQ A;  1V43 A;  1GHK A;  4C3H G;  2OEO A;  1Z6H A;  2R61 A;  3GTM B;  2J0T D;  5EBC A;  4KD4 A;  5BN3 A;  4K6L A;  1TS5 A;  2K33 A;  1IW7 C;  4HMI A;  4CJ2 C;  2MUY A;  3BDO A;  4TRD A;  4A3F B;  4K5X A;  4XYO A;  1JWU D;  3UI2 A;  1EU3 A;  4OO1 G;  3C3L A;  2KJX A;  2RDG A;  3ND8 A;  1LLR D;  1ICW A;  2VB3 X;  1BF4 A;  5CMD A;  4PQX A;  1GUS A;  2IT1 A;  3GTL B;  2EE1 A;  5C0X G;  4K5W A;  5KYL A;  2B2W A;  1QG7 A;  1Y8N B;  1JOR A;  4KJO A;  5M5W B;  5IIF A;  2KA7 A;  1WTX A;  1RD9 D;  4GZY C;  3EA6 A;  1QCB D;  1S5B D;  2X6G A;  1K83 B;  3HRZ C;  4K6D A;  4B9X A;  2PMZ B;  1CHP D;  3KF8 A;  1EIH A;  4ZK9 B;  3IL8 A;  4C2M B;  5E4X A;  4BS9 A;  3BVZ A;  1Q12 A;  1SMY D;  2SOB A;  4XQQ A;  1MBY A;  1JWS D;  4CGY B;  4G7H C;  1TR5 A;  2WV6 D;  2JEA I;  5EJW A;  2A5H A;  5I2Y A;  3AMU A;  1SXT A;  3BS1 A;  1XYI A;  4RKL A;  3HOW B;  2G9H D;  3HEJ A;  5DM6 3;  4RA8 A;  5HUR A;  2RQX A;  2B8F A;  4MN3 A;  3H94 A;  2OT2 A;  1SNO A;  3I72 A;  4I7Z C;  4K5V A;  4R8I A;  2WB1 B;  4KKS A;  2PW7 A;  4HTH A;  3QB3 A;  4P2C B;  2ZXO A;  4DGZ A;  2Z4H A;  2Z8L A;  2WP8 J;  2ZXR A;  2E2J B;  3NPP A;  4TKO B;  3GV3 A;  1K8M A;  4N9P A;  5J1Z A;  4FF4 A;  5KNC A;  1LAC A;  2K6A A;  3T4A C;  4IN3 A;  1EOT A;  3IKJ A;  1D5Z C;  3V05 A;  2R6G A;  5JEA J;  2LMC B;  1F9P A;  1VMC A;  5KGU A;  3E6Z X;  3NQI A;  2CW0 D;  3PIO 3;  4RAU C;  5DAU A;  3D6C A;  3CU7 A;  1I4Q A;  2SEB D;  2A6H D;  3MXG A;  3H6M A;  2I07 B;  4DXG A;  3VR6 A;  1HQR D;  1XWE A;  2TMP A;  3S16 B;  2RKS A;  1D1I A;  1EEI D;  2HUG A;  3P75 A;  4H44 C;  2EYO A;  5CBE E;  3ZYY X;  4HCS A;  4O1N A;  2RDF A;  5CR3 A;  2F0K A;  1PRT D;  5KNB A;  4ABN A;  3ITP A;  3D8G A;  3RMH A;  2B63 B;  1D1K A;  5A2Q E;  2WII B;  1VCI A;  2KOL A;  2B8G A;  1QE6 A;  1H9S B;  3LWE A;  4QUF A;  1HXY D;  3FRP B;  4KKT A;  1LTT D;  2EXZ A;  3CHB D;  2B2Y A;  4DA2 A;  5FO8 B;  4L6T B;  3LNN A;  1I4H A;  2HCI A;  2V4D A;  4HMJ A;  3RLF A;  4C3I B;  4FYD A;  5JEA G;  1S5D D;  3GTJ B;  2QKI C;  5IGG A;  3U9S A;  4CKC A;  2VXW A;  4ZQ3 A;  3SXH A;  5M3F B;  1H9M A;  5T1I A;  3MZ5 A;  2NVX B;  1FNV A;  4MIU A;  1R9T B;  5K36 H;  3KLR A;  4I65 A;  1X32 A;  4G7Z C;  1FNU A;  5FLX E;  2PNR C;  5J22 A;  1PTO F;  3MAQ A;  1YNN D;  4X3K A;  1SMY C;  3R3O A;  2F4I A;  5C5L A;  3GTG B;  4OHJ A;  3SK4 A;  1TQO A;  2DY7 A;  3OIP A;  1B1Z A;  2VUM B;  1ILQ A;  1WTR A;  5C3X A;  1A3T A;  3NBI A;  2FFK B;  4M1U B;  3HGB A;  3I4M B;  3IFD A;  2E76 C;  3S14 B;  4C1N I;  1IL8 A;  4S3S A;  1RTO A;  4DNR B;  3TP8 A;  2FMM A;  3MTS A;  3MHB A;  3I90 A;  1EEF D;  3BVM A;  3O13 A;  2A68 D;  4PNY A;  3NK9 A;  3A54 A;  1RJT A;  2B2W C;  3J7A V;  2XSC A;  1CFM A;  5I9O A;  2PZW A;  3K57 A;  3FMC A;  4Z9C B;  4A3E B;  5IT9 L;  4R9W A;  5ELB A;  2F0V A;  2XIW A;  1U9R A;  3M7N A;  3VR3 A;  2EYJ A;  2X6L A;  1Q3L A;  4XQN A;  4FP5 D;  1FGB D;  2J7Z A;  1TS4 A;  2JXM B;  5I6W A;  1F2Y A;  4HR7 B;  4XQJ A;  2F0I A;  3NE5 B;  2EY2 A;  2CW0 C;  2XN9 C;  4K8I A;  5ELD A;  4Y7N B;  1PDQ A;  3OW7 A;  1LO5 D;  3R2I A;  3RZO B;  4XXE A;  1A6X A;  2NVY B;  2A6H C;  3L7Z C;  4IUP A;  1C8C A;  2NN6 G;  3SR1 A;  1WTV A;  1STA A;  2QCP X;  2MP1 A;  1DM0 B;  4O42 A;  2GA4 B;  2F0E A;  1HPC A;  3A55 A;  5KIX A;  2Q8I B;  2XWJ B;  1NUC A;  2F0O A;  4DK1 A;  3NSW A;  1M4V A;  1PRT C;  3T13 A;  1UAP A;  1ENA A;  4ZUJ A;  1UEA B;  3J80 L;  4WFN 3;  1I3Q B;  5C4H A;  3A7L A;  4NKL A;  3DMU A;  2EY5 A;  3FEW X;  1SDF A;  5LL6 S;  2Q8R E;  4JK1 C;  2O5I C;  2SDF A;  1G2T A;  2RSO A;  3K5M A;  3KBX A;  3Q22 A;  1KTK A;  4FVM A;  4RCO A;  1RHP A;  3BZD B;  1PFM A;  3H91 A;  3NTK A;  1SYC A;  1AEX A;  3HOU B;  4LJZ C;  1Z7T A;  4KV6 A;  3DUZ A;  1I4P A;  4XTC S;  1EQV A;  3E5S A;  3J7A F;  2MPM A;  1HTL D;  1UUP A;  3J81 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...