3HP3A

Crystal structure of cxcl12
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
SLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CXCL12 protein
publication title Heterologous quaternary structure of CXCL12 and its relationship to the CC chemokine family
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 9
structure length 64
sequence length 64
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3hp3A00
4RAUC 1U4MA 2FHTA 4ZKCB 4HEDA 1F9QA 4IUVA 1NCVA 1Q3LA 2NWGA 1WTRA 5EPKA 3DEOA 1HRJA 1MGSA 1U4RA 2B2WA 2EOTA 3Q6SA 1U4PA 1QNKA 2HUGA 3D6WA 3GV6A 5D14A 1IL8A 2FMMA 3R93A 3LWEA 1XYIA 1G2SA 2FJ2A 2MGSA 4QUCA 1XX8A 5AFWA 1G91A 4NW2A 2HCIA 1RODA 1JE4A 1KNAA 1O80A 1X32A 3HP3A 1HUNA 1F9PA 3GV3A 4XT1B 1E0BA 1DZ1A 1JICA 4MN3A 1NR2A 1MSHA 1HFGA 4CJ2C 2K05A 2SDFA 4RA8A 1QE6A 1NAPA 2FINB 2R3ZA 1F9SA 2L12A 3H91A 3MTSA 4UAIA 2B2UA 4X3KA 2Q8TA 3KUPA 3DM1A 3P7JA 4U68A 1M8AA 1RJTA 4MHEA 2N88A 1SSOA 1ILQA 2N55A 2RVLA 1J8IA 1RTNA 2KVMA 1HHVA 1PLFA 1LV9A 4IUQA 5EPJA 2FFKB 2KEDA 1CM9A 3UI2A 5EKIA 1X3PA 2K04A 1MSGA 3F2UA 1BO0A 1SDFA 2M2LA 1B2TA 1WTXA 1WTWA 1PFBA 1CA6A 1QG7A 1U4LA 2KEEA 4O42A 2L4NA 1EIGA 1ZXTA 2JYOA 3TZDA 4DN4M 2RA4A 4R9WA 4ZK9B 1HFNA 2MP1A 2KOLA 5COYA 1EL0A 1ESRA 4LMQD 2B2TA 4XT3B 3G7LA 1RHPA 2Q8RE 1DONA 2K03A 1DOKA 1A15A 1PDQA 2B2YA 2HDLA 2K01A 2KUMA 1WD1A 1O7ZA 1B4OA 5JJZA 3I3CA 2NZ1D 5DNFA 3TN2A 5T1IA 1AP0A 3ONAB 2EPBA 2L1BA 5EPLA 3I91A 1NR4A 1PFNA 1ICWA 1S4ZA 1G2TA 1ML0D 4HAEA 1SAPA 5T1GA 1HA6A 2EE1A 4IUTA 1O7YA 5D65A 5CMDA 1EQTA 1WD0A 3I8ZA 4OIKA 4ZAIA 4HCSA 2J7ZA 3IFDA 1VMPA 2B2VC 2VXWA 2RSNA 1BNZA 3FPUB 1AZPA 4IURA 3DEPA 3FDTA 4X3UA 2B2UC 1RTOA 4IUPA 2X6LA 1EIHA 4QUFA 4CJ1B 2X6GA 4HSVA 5E4WC 3QO2A 5CORA 1F9RA 1WVLA 2L9HA 4XDXA 1AZQA 2HCCA 2RSOA 3MWYW 3SVMA 1B3AA 1EOTA 2H1EA 2B2WC 3I90A 3KBXA 1BBXC 1BF4A 2DY7A 4ZLTF 1IKMA 1B50A 2X69A 1F2LA 1ILPA 2XIWA 1DOLA 1B53A 2BDNA 1TVXA 1MI2A 2K28A 5CBEE 4CJ0B 4ZKBB 3N52A 2DY8A 1GUWA 2NYZD 1IKLA 1HUMA 2K1BA 4R8IA 1WTPA 2IL8A 4X3SA 5E4XA 2MPMA 1CA5A 1J9OA 2B2TC 4RWSC 5EJWA 1G6ZA 1C8CA 1PFMA 2HDMA 1VMCA 1WTVA 2B2YC 4X3TA 3IL8A 5EQ0A 1WTOA 1X3QA 2CVRA 1WTQA 2D9UA 2B2VA 2L11A 1DOMA 1KNEA 2MJ8A 4OIJA 4IUUA 2JP1A 5CBAE 2KECA
chains in the Genus database with same CATH superfamily
4LF8L 4RGOS 4A3MH 1JOQA 1A0IA 4FNFA 3O13A 2EQSA 2Z0SA 4XXEA 1LT6D 1Q8KA 2ZM6Q 1WCMG 4NP5A 3I4NH 3CRLC 3I56A 3K5NA 1KDCA 2ZXRA 1E3PA 1O80A 3I73A 2XNAC 3SE0A 5BN4A 1JMCA 3T1YQ 1BOSA 3VA5A 2BH8A 4CBVA 4LF7Q 4X3KA 2ZJRA 3A8IE 1II3A 4RMFA 4MHEA 4JI6L 1J8IA 1ILQA 4OX9L 2V1CC 1B9MA 4Y7NB 4A3KG 4JI1L 1MJEA 2V4DA 4AYBB 3DWQA 2F0FA 1BR9A 2NN6I 4RHSA 1B2TA 3S1NH 2KCTA 4KHPL 4RGTA 4YWKA 4XYQA 3TP5A 3HOZB 1STAA 1DM0B 3UE1A 4A3DG 2XVSA 3TEHB 3A7AB 1PH1A 3DWAA 2HT1A 1DGSA 5JPNC 4KY6A 5T1IA 1I94L 1YNXA 3LX0A 2EJFC 4BWGB 1JQYD 1EOVA 5M9OA 2UUAQ 4LFBL 4JOIC 1SAPA 1H9SA 2R93B 1EQQA 1E2VA 4OIKA 2O4XA 4HCSA 3EQLC 1GXDC 1LT4D 4UP9A 4UPAA 5C44H 4BA2I 4LW1A 1HNWL 1AZQA 5FLMH 2N78A 2EXZA 4C1NK 4C56C 2QILA 3UE0A 4A3EH 3A74A 3DHQA 4QCLA 1NTGA 1FVIA 3DUZA 4JPBW 5IYDG 1KRSA 5IODA 5C4XG 3S1RB 5A35A 4DR4L 1JJGA 4DUYL 1MJCA 1H9KA 4HIMA 5EQ0A 3S15B 1PH8A 1SE8A 2NB0A 2R61A 2B2VA 1VQCA 3SK4A 4EQ5A 2R7DA 2SNMA 4IJHA 3MXNA 4LAAA 1LO5D 3FMCA 4JV5Q 3RR5A 4B08A 2QEJC 1O7IA 2EYOA 3PMFA 4HJ5A 2Q2HA 3EN2A 3M7GA 2EJMA 1PZKD 2NVQH 1TWCB 5ISRA 1MHWC 2JA6B 5C5LA 1X32A 1S5CD 1K73C 4JI3Q 1Y1VH 4R4QA 3M4OB 1VQNA 3BVZA 1B3QA 2JA5G 3SHLA 1F9SA 2A8VA 4EQOA 3M85A 1M8AA 2GVAA 2QKIC 3RLFA 1K9MC 1MSGA 3HOUG 2LY7A 3MXGA 1VQKA 3MFYA 2M2LA 3SK5A 1YNJC 3K59A 5J39A 3G6JB 2K75A 2PNRC 1L0WA 2UUCL 1W2BA 4IFDJ 1VQAA 2A19A 2B2TA 3K5OA 3G7LA 1UEAB 5JAVA 3BVGA 2Q8RE 3LNNA 4A3LG 4B3TQ 2AQ2B 2HDLA 4GKJL 4C3JB 3OSOA 1FD7D 2OWOA 3FP9A 4C3IH 2PI2E 3U58A 3VR2A 3CCMA 4OXPA 1SMYD 4NPSA 1IBKQ 1S4ZA 3KOJA 2VNUD 5E1FA 1F2ZA 1QNUA 4RHRA 2IX3A 2R7ZB 2F3VA 4LF4Q 1RTOA 1V8QA 3ER0A 1QJOA 4K8IA 5CV6A 2JXMB 1ENFA 3H15A 2JEBI 3HOVB 2IW3A 1JR0D 4J8QA 2MHVA 3J7AV 4APVA 1PRTF 1UWVA 1YBYA 1O78A 2K1BA 3PGZA 3CW2C 4UHVA 3S1MH 3HOXB 1IBML 3K80C 3IL8A 2YV5A 2RF4A 4YCUA 1E2WA 4IZ8A 2BDOA 1HCZA 2BH2A 4FP5D 1BDOA 1EFWA 4FF3A 5A2QE 2RCFA 3NTHA 1NCVA 2XWBB 3DEOA 4LF9L 3H3VH 3A54A 1NY4A 1LTID 1RL2A 4O1NA 4CDDC 1CHPD 2MGSA 3EFXD 1RKNA 5NUCA 4JK1C 2PQEA 3PO2H 4AYBG 4CKEA 1D6EC 3GV3A 4XT1B 1E0BA 1DZ1A 2Y0SB 1Q1BA 1HQMC 4KY5A 1K8MA 3CCVA 4UAIA 3S1NB 1EWHA 1X3FA 2F4IA 1GHJA 4JBWA 3HOZG 3L9AX 4JBMA 1EY8A 1TWHH 4JC0A 2K04A 4JI4Q 2H4OA 5CR3A 1NMGA 3K81C 3R2TA 3PUYA 2SOBA 4PV1C 1NBWA 3NP8A 3OWEB 5COYA 1I6HH 4IQZA 3QG1A 5GROA 3OTOQ 3ULJA 1A63A 4L8JA 2UU9L 4NMZA 4ALPA 4G7HC 5LL6X 4LF5L 2L1BA 4LF6L 2I5LX 5C44B 3L2PA 4DV3L 2F0LA 2P5ZX 5CMDA 2XN9C 2F0PA 1QUQB 4A3EB 4A3CG 2A6ED 3V96A 1K8AC 3TDQA 2AQ1B 1JE5A 2ZJPA 4K5WA 4XDXA 1JWSD 2A5HA 4ZYSA 1YVCA 1RCVD 2X69A 1B53A 5LL6S 2RKSA 4GN4B 2PYKA 3H3VI 1QWYA 4NXNQ 1SNCA 1YNNC 2HDMA 4IPHA 5GADC 2PZUA 2Z6KC 3NXWA 4J6HA 3CCRA 4A3BH 1HZCA 2LSSA 4YWMA 3PF4A 4RCNA 3CCUA 2VQEL 2JP1A 4YCVA 3U4ZA 1EZ6A 2JA6G 2KBNA 2EYFA 3OYYA 1C4QA 2F0VA 5J1ZA 5IY0A 2QGQA 3BDOA 4JI5L 3PO3H 1A2UA 1Y1VB 3GV6A 1ENCA 2F52A 4CKBA 2K5VA 3M4YA 3CC2A 1HNZQ 4H44C 2C35B 3D0FA 2HQEA 4TSSA 1PH4A 4UP7A 1JE4A 1X9NA 2A69C 1X3GA 3G6EA 1GO3E 1W3SA 1F9PA 1N32L 2EY1A 1MSHA 4ZLTF 3MTSA 5TSSA 2PZTA 3HOYH 3J81E 2N55A 5KNBA 3AQQA 2NVYH 1SJED 4PNYA 2KVMA 4F8MA 2EYPA 2EDGA 1EZ8A 1G291 1ICFB 4C3JG 1WTWA 3SXHA 5IT9E 2E2IH 2JYOA 4ZK9B 4WORA 1JJ2A 1I6VC 4YY3Q 1SN8A 4C3IB 2E5LL 3H6MA 1EU3A 4K5VA 1E24A 3E9HA 5IIFA 1A6XA 1CI3M 3NHHA 5C3EH 1QCBD 1A15A 1EY4A 2K01A 1CZWA 2RCNA 5KYLA 4FXDA 4G57A 3QB3A 2R7ZG 4P2CB 4N8X1 4JI0L 3TP6A 4NXMQ 1CTMA 4TQUS 2KENA 1EUJA 1NR4A 4WJWA 2DUDA 3ND9A 1TR5A 2NTSA 2PMZB 1IL2A 1YZ6A 4X66L 2QW7A 3RLNA 3C1FA 2CKZB 3D3RA 3K58A 2F03A 3GTGB 3Q22A 3HOVG 4DV5L 4OELB 3A7LA 1KC8C 2M00A 1G6PA 3J80i 4BY7H 1TWGH 3E0JA 1K0RA 3H0GH 5DAUA 5IP7H 1EU4A 5CORA 4WJ3M 1EQVA 2OQKA 5GAHC 4RKLA 3HOXG 4L5RC 4M8AA 3ERQA 3ITPA 2DY7A 1DJRD 1Y8NB 3S1MB 1F2LA 1HNXQ 2VQFQ 4A3MG 5FOBB 1AE2A 1BQQT 1BBUA 3VYTA 3MZ5A 2DY8A 5IYBH 5E4XA 1VS0A 3I4NG 1KABA 4DR7L 2D0OA 4DA2A 1TS4A 2F0QA 4LUVA 1WTOA 1GJXA 5HGTA 1YEZA 4L6TB 1XNQQ 5CV7A 1D2BA 2E76C 4CDFC 3WWVA 1VF5C 2KECA 3S2HH 3HKZB 1OXSC 1C0AA 1BXTA 2ZTCA 3BYYB 1S5BD 1EWIA 4O0AA 1Q3LA 2Y0SG 1V9PA 3PO2B 2NVTH 3CCJA 3D6WA 3M7NA 4DR3Q 2AKWB 4LUZA 3U9SA 2PQAB 1IYVA 4KJNA 2UXBL 4Q5VA 5KYIA 5KNCA 2IHEA 4V190 1TXYA 3AB9A 1TWHB 1JICA 1GVPA 5BN3A 4OGQC 2FINB 3I4LA 5C4XB 5I6WA 2DNEA 4HMIA 4DR1Q 1IBLQ 4POGA 3U9OA 4HJAA 3CC7A 3KF8B 4GS3A 5ELOA 1I6HB 4FVMA 4AIMA 1BO0A 1L1OB 1PFBA 2PCFB 1RF2D 5EAYA 2KCMA 3FPPA 1TS5A 1FNWA 1TWFH 5C44G 2NBFA 3LGJA 3G48A 3S17H 3IRBA 3UDXA 2WKDA 4ZQ3A 3K57A 2EYHA 3BU2A 1K8OA 4CDCC 1O7ZA 5JJZA 1YITA 4K5XA 4A3EG 3AEVA 1AP0A 2EPBA 1STNA 4I7AA 2D62A 1CFMA 4EGVA 2L0CA 3F1ZA 1D5XC 2F0NA 1BKBA 3KF6B 4X64Q 1JT8A 1R4PB 4MZ9A 3KLSX 1SYFA 2AUJD 1Y8PB 3PUWA 4Q0FA 4AQYL 3FDTA 2F0MA 4PMCA 2RBMA 1NJIC 1KDBA 4DR6L 1T9HA 1BBXC 1BF4A 1STHA 1GD7A 4JI2L 3T56B 1SYEA 2HQLA 2NN6H 4A3BB 1TKWB 3RUZA 2ATWA 1VQ8A 2JN4A 4A3JH 2WB1E 4GKKL 2CHBD 3U50C 1YNND 2G5DA 2JQOA 5EJWA 3J80c 2ZM6L 4MTKA 1G6ZA 2A74C 3E3XA 4JI7L 2TSSA 1STEA 2UXDL 1H95A 2E2JH 2L55A 2OTJA 1Y1VG 1WOCA 3K0YA 2L11A 3PO3B 2MJ8A 1A3UA 3T1YL 5FO9B 4LF7L 1F2YA 2C5CA 5F2DA 5GAGC 1CQFA 3SGIA 1JOKA 1I4XA 2G9DA 1GM5A 5C6AA 1V1OA 2MFIA 3D8GA 1G2SA 1Q90A 4QUCA 5BN5A 1GUNA 3ND8A 1N33L 2Z1CA 1SNPA 3HOYB 4DU9A 2CH4A 1HUNA 1G51A 2NVYB 4MN3A 1NR2A 5IGCA 3J81c 1CHQD 1PZJD 3NWTA 3I2ZA 2E2IB 2D2CC 4C3IG 3T1HQ 2N88A 3SR1A 1SYDA 5IT9c 2O5JC 4DGZA 3MFGA 4OEMB 4JI8Q 4K0KQ 4GOPC 2UUAL 5M3FH 5C3EB 2QEXA 1H9JA 4KN7C 3TZDA 1ET6A 1YJ9A 1YIJA 4KKUA 1JJCB 5LHY1 2ZTEA 4JBJA 1L0XB 4IPCA 4TVAB 1R9TH 1LT3D 3G4SA 1QZHA 2KUMA 1SEBD 4BY1H 1ONLA 5IWAQ 3TBIB 2OXPA 1LTBD 1E1OA 4OWXB 4BY7B 2NZHA 1TWGB 3H0GB 4FXGC 4C1NI 1VQBA 5IE8A 3F2BA 1CK1A 2XRSD 3HZXA 4LFAQ 2R92B 1VMPA 4V0BA 2RSNA 1JWUD 3TSSA 2K5QA 1TT2A 4RGMA 2B2UC 2X6LA 1UE6A 2R6GA 1XMQQ 3A5ZB 1EOTA 3MC0B 2OF1A 3KBXA 4L5QA 1ZYRD 5C4HA 4DV2Q 4JV5L 4KHVA 3PV0A 3T53B 3GD7A 4WRDA 2WAQE 4ABNA 1YI2A 1PTOH 3HKZG 2F0IA 1X65A 5IGFA 4OWWB 1C8CA 4X65Q 4Y52H 2KCCA 3PO2G 1YJWA 4JI3L 4EX5A 2NVTB 3M4PA 1Q46A 1KNEA 2EXDA 2BOSA 1LACA 4QIWE 5I6YA 2A6EC 3FKIH 3CCSA 3R2IA 4ZKCB 4A3IB 3SK6A 1U4RA 5A2QL 5KEEA 3CKIB 4EVOA 3H3VC 2K52A 4L5TA 4DAPA 3Q8DA 5EGTA 2A6HC 1SYBA 1RIPA 4B3RL 1G91A 1TY2A 3BZKA 3ERSX 1MBYA 3IAYA 3URYA 3VR5A 4ID6A 4K2LA 3H91A 1ET9A 3A55A 1EFID 4U68A 1XXGA 2XWJB 5ELFA 2VY3A 1UEBA 1RTNA 3UDGA 4IUQA 3T16A 2AQ3B 5D3DA 4GN3B 5EKIA 3S17B 1IBKL 3FEWX 5JVH3 3RLOA 4E6IA 4O42A 4DV7L 4DV4Q 2F0UA 1I4PA 4JCVE 1EL0A 3GTKH 1HXYD 4DF7A 1KLUD 4LF4L 3MXPA 3WOFA 1X56A 1IW7D 2F0HA 3A56A 3CP0A 2B2YA 1WD1A 1L1OC 1TS2A 3MA2B 4HJ7A 1NSNS 5G3LD 3MAQA 1PZID 2F0EA 3RMHA 1WI5A 1B1ZA 3K5MA 1ICWA 2I46A 2L15A 4MIUA 1ML0D 4HAEA 1W6JA 5D65A 3C2PA 5JEAH 4C2MB 1HPCA 5AJ3Q 5IYCH 3W1GA 1YHAA 4K6LA 1IYUA 5CV4A 2DN8A 3W2DA 4A3BG 5EKLA 2B29A 2N8NA 4UP8A 2LXJA 3J7YW 3NSWA 1E1TA 4A3JB 1QVFA 1VQFA 2HCCA 3MWYW 3NTKA 1B3AA 3OIQA 4IPDA 4PMBA 1K3RA 3E0EA 4DAYB 4DUZL 2DJGC 4B3SQ 1NE3A 4IO9A 4GLAC 2E2JB 1N36Q 3PO3G 3QR8A 2NYZD 1IKLA 4N9PA 4DUYQ 4BA1I 3PF5A 1CA5A 4RKBA 3T51B 4DV1Q 4RCOA 1V1QA 2JK8A 1H9MA 3HRZC 1PH5A 1KQSA 3HOWH 5K36H 1DOMA 2VB2X 2KA7A 2LS01 3A5UA 2J4XA 2ZXPA 3HOYG 5C0XH 4IUVA 1WTRA 4ME5A 4DK1A 1MGSA 3Q6SA 3H94A 1WCMH 3AYHB 1XYIA 4JI4L 1Q12A 1EIYB 3MVVA 4JOIA 2LFNA 3JAMi 1UUPA 3I72A 3TS2A 3OWFA 1Q1EA 3PCOB 4A3MB 5C3EG 4CJ2C 3TQYA 1GUOA 5FJ8H 4P75A 4XTCS 4JBKA 1M90C 3OTOL 2AWOA 2F4VL 3I4NB 1BCPD 3GP7A 4X62Q 1VF7A 3K7UC 3MXUA 5DM63 1DCZA 1CM9A 3X3MA 4H02A 3J81L 4IJLA 2RDFA 1S72A 1WTXA 2KEEA 2KHIA 2NVXH 2WV6D 3HS0C 1Y1WH 4BY7G 5IT9L 3H0GG 1RD9D 1VQ6A 5IP7G 4GKJQ 1A62A 2F3IA 2JA7H 3A8JE 2R92G 4OONA 1EY7A 5M3MH 1SNOA 4KD4A 2PQAA 4KHZA 4DNTB 4DR2Q 3TRZA 3T4AC 1HA6A 5IYBG 4IUTA 1Q81C 2I0QA 1S40A 4HCEA 1N34Q 1MKHA 4KK7A 4YHHQ 4NXNL 1BNZA 1BUVT 4P74A 1T5XD 4IALA 3D6CA 4IN3A 4IUPA 2IPKD 2F0GA 3KLRA 1Q7YC 1SNQA 4H7BA 4HSVA 2UXCQ 1XMOQ 2ICIA 3KF8A 3KK7A 1S5FD 1NUCA 5BR8Q 1VQJA 4DAMA 1L1OA 1UNSA 5C0XI 1IBMQ 1J9OA 4RWSC 4A3IG 1WYDA 5FLXE 3FKIB 3IFTA 4BBSH 1VQHA 2JEAI 3EROA 5M5XH 3BDCA 3NK9A 1A3VA 1QOHA 1SYGA 4GN5A 4IUUA 1AZPA 1SLJA 3CC4A 1XPOA 4FYDA 4EQPA 1SJHD 4NB3A 2J0TD 4R8NA 3OW2A 1U4PA 1QNKA 2HUGA 2A6HD 4XQQA 2FJ2A 3S24A 2Q2UA 4AH6A 2VL6A 4YIJA 4YY3L 4DNIA 1Q82C 3J80E 2JA5H 4G7OC 1NAPA 1T5EA 4QIWB 2NVQB 1SSOA 4GLVB 1IZ6A 1K8GA 3U4VA 1UE1A 4QL5A 1HTLD 4DFAA 3GTKB 2JA8H 2Z4IA 3KDFB 1I50H 1VDZA 2KOLA 1EIFA 3S14H 3P20A 1BCPB 1DOKA 4GOPB 1PVOA 1CZGA 4LF6Q 3T13A 2B3GA 2YTYA 4FO2A 1HNXL 2NN6G 3I4OA 5KGUA 2E2DC 5T1GA 4A3JG 5J3BA 5HURA 2EE1A 3R8BA 3CPFA 1EWCA 2EY2A 2D5DA 3N6RA 5C0XJ 3G71A 3DWPA 4X3UA 3VA7A 3WDNA 5JJIA 4ODGA 2X6GA 1XNQL 1F9RA 1S5ED 4POFA 4R4CA 3F2CA 2EY5A 2KCNA 2XGTA 4PZ6A 2K7VA 1STGA 1HQRD 3N52A 3NQIA 5LMNQ 1FJGQ 1EY5A 4PMWA 5C3WA 3RNUA 2QCPX 3QWNA 2MPMA 4R4IA 4DR3L 2GVBA 3HOWB 3HGBA 1A8VA 1I5FA 1K0SA 4N9TA 1ZKOA 3MEFA 4X3TA 2HHHQ 4HIKA 1SE2A 2K32A 3TREA 1GKHA 3HEJA 1X3EA 3M9BA 3BJUA 2WINB 1U4MA 2R7FA 5JOBA 5HGQA 3ULLA 4I65A 2NWGA 1PH7A 3NWSA 4DK3C 1HRJA 2SEBD 2ZTDA 1I4HA 2ENBA 1ZYRC 3SK8A 1IXRA 2XSCA 3GTQH 1KLGD 2JJQA 2EYJA 4A75A 4NW2A 1VQDA 2RHQB 5ELBA 1N32Q 2BE5D 1KHIA 3DLLA 2CCZA 4A3GH 3NEMA 2ES2A 1TQOA 5I4DA 4UDUC 4FF4A 2VZAA 3KFUA 2R3ZA 3CRKC 4BY1G 5KRUA 2NVXB 3P7JA 3B6YA 2F1MA 1Y1WB 3J7AF 1HHVA 1WFQA 5CC4A 4KN4C 4QJFA 4DV6Q 4FF1A 1XWEA 2JA7B 2IWHA 1L0YB 1U4LA 4HTHA 1EIGA 1EYAA 2UUBQ 2EIFA 4LFCQ 4R9WA 2HD3A 2PW5A 5EKKA 3CD6A 3S2DH 1L2FA 3K0XA 5M3MB 2R93H 4LMQD 4XT3B 1GUSA 2ZXOA 2Z6KA 3L3OC 3Q24A 4NKLA 2RHSB 3ULPA 4CKCA 4DV0Q 1JORA 1PYBA 4I7ZC 1LYLA 3BZDB 4DV5Q 1Y69U 1EY6A 3I8ZA 2YYZA 1R4QB 2NUCA 1ESFA 4CDEC 4DR5Q 1D5ZC 3D4RA 3SDZA 3S16H 2QDBA 1HR0Q 3PUZA 4CJ1B 4FDBA 4R1JA 1ASZA 2L9HA 1PH3A 3FKIG 2H1EA 2B2WC 3F8TA 5FLMG 1IW7C 1JWMD 4BBSB 5C4JH 1XNRQ 4MTNA 1XPUA 5FLXc 1PRTD 2JE6I 1V1PB 5M5XB 4K8JA 1BVSA 4B3MQ 4LJZC 1PTOC 1AN8A 4H13C 1PMRA 1M1KC 5IOCA 2NTTA 3I7FA 2VW9A 2FXQA 5I9OA 1PYSB 2BA1A 2YTVA 4HIDA 4F87A 4A4IA 5LMUQ 4JYAQ 1VCIA 5C4ZA 2VS1A 3CHBD 4HSPA 3VR4A 3AMUA 4A93H 3PUXA 2PW7A 2K14A 3TMEA 3T1HL 1PH6A 2EOTA 3I4MH 3R93A 1X55A 4JI8L 4K0KL 2VB3X 3CCLA 4OO1H 1WTHA 3D31A 3STBD 1N8RC 4WJ4A 3NENA 1I4QA 1SXTA 1B7YB 3P1HA 1RDPD 4DAYA 1B44D 1HFGA 1VQIA 2SNSA 3OW7A 1CKNB 1I50B 3M3YH 2ASBA 3DM1A 1RJTA 5IWAL 3A0JA 3OHXC 5CGKA 3S14B 2EZVA 2EYMA 4KMUC 3EIVA 1LTTD 5JEAG 1CA6A 4QGUA 3BVMA 3FRPB 1GUTA 5IYCG 1UE5A 3K7AH 2MP1A 2O2LD 4YWLA 2IX1A 1ESRA 1SR3A 5GAEC 1HJPA 4UY8C 1YHQA 1J5EQ 4S3SA 3L0OA 1OXUA 1IYJB 1ZEQX 3VR6A 1TWAH 1VQEA 1XMQL 3OMGA 1JC7A 1Z47A 1PH9A 3NBIA 4IFDH 3SEBA 1CUKA 4B9XA 2PZWA 1LTRD 2B63H 1BCPC 1LTGD 4LWCA 1EQTA 2N3SA 5EBDA 2HIVA 1WD0A 1O7LA 1MD2D 4DKAC 3S9WA 3IFDA 3PIOA 1Z9FA 4X65L 4IURA 2QA4A 1J6QA 5ELDA 1HZAA 4OWTB 3HOWG 5K36G 3X3NA 3L7ZC 5FO7B 4C3HH 1WVLA 2KHJA 2RSOA 2WP8J 4JI2Q 4Z9CB 4J1MA 4BBRH 1ILPA 5C0XG 1PYWD 3D4DA 1KL9A 4GKKQ 4BXXH 4HN7A 2MQHA 4U673 3NE5B 2B2TC 4JI7Q 1QB5D 2UXDQ 2ICEC 4OO1I 1X3QA 2D9UA 1QVGA 1C48A 2E74C 4O2DA 5FJ8G 1YJNA 5CV8A 2VUMH 3GTQB 1PRTB 1EYDA 1TU2B 1LTAD 2EJGC 2B2WA 3CAMA 4A3GB 3P75A 1VQ9A 3LWEA 1N33Q 5ELCA 4GNXB 4IPGA 1OTCA 1LUZA 1Y1WG 4G4KA 1E7ZA 1I3QH 4A76A 1S5DD 3S2HB 1HTPA 1A3TA 3NBHB 1B8AA 2OCEA 4DV4L 4QF4A 2F0KA 1FL0A 3W3AA 2JA7G 1VQOA 1D8LA 2GN5A 4RFBA 3V05A 1QE6A 4LF8Q 1I4RA 2L12A 3CXCA 1JOOA 2WKCA 4PG3A 5M3MG 1VQPA 3S2DB 3CCEA 3E9IA 2Z8LA 3WOEA 1S3OA 3F2UA 4IFDI 1QUQA 1QG7A 4KLKA 1W6KA 5IP9H 5AJ3L 2F0WA 5FKAC 4P71A 3BYTB 5IGGA 1EY9A 2CW0C 1RHPA 3DM3A 2JSOA 2K03A 1PDQA 4QMGA 5M5WH 2K4KA 3KLSA 3GTJH 1B4OA 1KAAA 4B3TL 4JI6Q 5DNFA 4OX9Q 2D0PA 4JI1Q 3KLWA 1LM0A 3TP8A 4B3SL 1PFNA 1UAPA 3QOLA 3S16B 1TWFB 2A1AA 1N36L 4KHPQ 3GTPH 1DD2A 2MNAA 4BBSG 2VXWA 1A2TA 1AE3A 4DV1L 1Y8OB 5C4JB 3JAME 1CSPA 1K83H 1K28A 5CV5A 1VQMA 4P73A 2E75C 3GTLH 3IKJA 4N8FA 3I90A 4DK6C 3CU7A 1I94Q 2JA9A 2A68D 3KDFA 4LFBQ 1HH2P 1MI2A 2DNCA 3FVQA 2YU9H 1PTOD 4P72A 4X6AH 2IL8A 3K8AA 4X3SA 5L37A 1KDAA 2C9OA 3KYHC 2B39A 3GDEA 4GOPA 4DK0A 1HNWQ 4A93B 5FLXL 3H09A 1KIXA 4L5SA 4RH6A 3OPOA 1CKMA 4OIJA 5H1SE 3I4MB 5CBAE 4OHJA 4RAUC 5DLQE 1XTDA 2FHTA 3GTMH 2PMZE 4KI0A 4GZYC 4XYOA 1SE4A 5EPKA 4X62L 2ZJQA 1E2ZA 1SYCA 1FGUA 2XRQD 1GHKA 2GA4B 2WACA 1EEFD 3NQTA 2JA8G 5ELEA 4DR4Q 4B3RQ 4A3FH 1Q86C 2AWNA 3M3YB 4CHTB 3GQBA 5ELNA 2N49A 3J81j 4KJOA 1VQLA 1SROA 2Q2TA 3CQZH 1OO9B 1YHBA 3J80L 2B2UA 5IGEA 4OL7A 2RVLA 4ZRZA 3K7AB 2O5IC 2BA0A 3RZDH 2FFKB 5J22A 1B70B 3J7ZC 4DR2L 4DV7Q 1SDFA 2CFMA 1OXVA 3PIPA 5K5PA 4DXFA 1ZXTA 1HFNA 2WB1B 1TWAB 3EBEA 1N34L 4YHHL 4HR7B 2ID0A 1LT5D 3HKZE 3GTGH 1AFPA 1SNDA 2E2HH 1CQVA 3VR3A 2B63B 2UXCL 2BE5C 2H5XA 1XMOL 2OTLA 5M3FB 3JC66 2F3WA 3C1EA 2PI2A 2MUYA 3S1QH 2K5NA 5BR8L 3MEHA 2EVBA 4A3KH 3I91A 4JVZA 3NUCA 5HY6A 3KJOA 1FNVA 2RDHA 4DPGA 1R9TB 1EEID 3KJPA 4FF2A 3PIO3 4C3HB 3OMCA 2J7ZA 2UUCQ 3I70A 2G9HD 4BY1B 3FPUB 3PUVA 4BBRB 4A3DH 2TMPA 2Q2IA 1EIHA 3Q23A 3QO2A 1CKOA 3TZUA 4DUZQ 4KKSA 4G7ZC 1C9OA 2K28A 4DNRB 2OQ0A 1BBWA 1K3BC 2K33A 4ZKBB 2I07B 1SMXA 1E22A 1TS3A 3ICEA 2VUMB 1KXLA 3DXJC 4R4OA 1VMCA 2I5HA 1JB7A 4IOCA 1WTQA 1U9RA 4A3GG 4PZ7A 4JG2A 1AH9A 1VQ4A 1QVCA 5EBCA 3CMAA 1PTOB 1CSQA 5KIXA 1I3QB 4PZ8A 4RGNA 2LKVA 4LUOA 1P16A 4QB4A 5I2XA 5GQOA 5IYDH 5D14A 3AFPA 5C4XH 3CPWA 2K50A 1XX8A 3BDLA 1SRUA 1PRTC 1WJJA 1EYCA 1C7YA 1H9SB 2HCIA 3HP3A 1KNAA 1HNZL 2R93G 3RN5A 1KRTA 3EA6A 2F0JA 2KJXA 3FHWA 1VQ5A 4YCWA 1ENAA 2F4VQ 4GNXC 2B8GA 1V1PA 3KF6A 4ZCKA 4LF9Q 1LTLA 1PLFA 1H9RA 4KY7A 1JB3A 2K5HA 1IHZA 1PA6A 1Z7TA 2L4NA 5M5WB 3GO5A 2RQXA 2WAQB 1SBBB 2RA4A 4WFN3 3GTJB 2IX0A 2CW0D 3VYRA 3STBC 2NZOA 5JEAJ 3RD4A 4LNQA 3GTPB 5CV9A 2CWAA 3TN2A 3EVQA 2EY6A 2I5MX 2HIXA 2MO1A 1KAWA 4F88A 4NXML 3MXNB 4LK1C 3VYUA 3W5OA 1F77A 4H0LC 4ZUIA 3HOUH 4QQBX 1G2TA 1PHJA 3AU7A 1K83B 5C3XA 5LMNL 1V43A 1FJGL 3JAMc 3GTLB 1CT1D 3I55A 1SE3A 1D1KA 1DXMA 4J15A 1CKNA 2HHHL 1LLRD 2Z6BA 4QUFA 4A3LH 2YU9B 2K6AA 4HIOA 4KTAA 3QIAA 2UU9Q 3SVMA 3GTOH 4TKOB 4LF5Q 3RN2A 3W1BA 4A93G 2BDNA 1TVXA 3VYSA 5CBEE 2EYLA 2OEOA 4EQNA 4DV3Q 2VQFL 3RZOH 3I4MG 2AHOB 4OO1G 4CGYB 1P8LA 2PPBC 1PFMA 2LXKA 3GTMB 2CVRA 5DM73 3E5SA 1FYCA 4MNOA 2CWPA 4B9WA 4R4TA 5M5YH 4A3FB 1G8ZD 1SFOH 4K14A 2ALYB 2CQAA 4AYBE 4GLXA 2B8FA 1TY0A 1Z6HA 1YNJD 1MIUA 3ZJYC 4ZUJA 4DXGA 2FMMA 4DV6L 2XTIA 5AFWA 3CQZB 3PSIA 3HKSA 1OXTA 1I4GA 2UUBL 4LFCL 3QOJA 5E7NA 4XQJA 1TIID 3A8KE 3RZDB 2VQEQ 2PO4A 1PXUA 4RA8A 2LMCB 2Q8TA 2Z9HA 2IY5B 2WB1G 1WCMB 2CQOA 3KUPA 3AFQA 4F7XA 1QZGA 4JI5Q 1HZ9A 4IFDG 4DV0L 3UI2A 4DR1L 1IBLL 3PIP3 3HFZB 1D1IA 1U0LA 1X6OA 2B63G 4HJ9A 5M3FG 2E2HB 1HA5A 1X54A 1FNUA 1FGBD 4Y7NH 2YTXA 2F0SA 4KV6A 3S1QB 3OOCA 4DR5L 3MHBA 4A3KB 3DMUA 1HR0L 4XQNA 2R92H 4C3HG 3EJIA 3HOZH 4BBRG 4PQXA 5G3LF 2KQ3A 5EPLA 1STYA 4ILWA 4GNXA 4A3DB 1PTOF 1XNRL 4BXXG 2MO0A 2BCOA 2DGYA 1NMFA 1O7YA 1DYQA 1SNMA 3NBHA 1EYGA 1M4VA 4ZAIA 1XJVA 4B3ML 5CYUA 4X64L 1KTKA 2E5LQ 2IJ0A 3DEPA 1EY0A 2WFWA 1D5MC 2IT1A 5IGBA 5JJLA 2PNHA 2E8GA 3J81i 2VUMG 4JI0Q 2AUKA 1IKMA 3F2DA 4RG1A 5LMUL 5KNDA 4JYAL 2XIWA 1D7QA 1UE7A 3K5LA 1OXXK 2F0OA 4X66Q 2WIIB 3LWUA 1GUWA 1GUGA 4R8IA 4A3IH 4TRDA 5LMNW 4A3CH 3M4QA 2OT2A 3C3LA 5FO8B 2K5DA 2FMCA 3S1RH 1U5KA 2L5TA 3KBGA 3S15H 4HEDA 1VQGA 1F9QA 4IUNA 3OIPA 2Z4HA 2M9VA 4K6DA 5JPMC 2A68C 4M1UB 5I2YA 1IL8A 4DR7Q 1GOZA 3C46A 3CF5A 3Q0AA 5C5MA 3QJYA 5IP9G 1RODA 4BS9A 1Q8IA 4FXKC 3NPPA 1N9WA 1XPRA 1TWCH 2K05A 4IOAA 1J5EL 2SDFA 1HZBA 4ME3A 1AW7A 2WAQG 1PFSA 2JA6H 1BCPF 4HJ8A 1NNXA 1LV9A 1JCKB 5EPJA 3CMEA 2KEDA 1STBA 1X3PA 3M4OH 3HG9A 3BS1A 2UXBQ 2QDLA 5FK9C 2JA5B 4DN4M 2DJFC 1F2MA 3V2TA 3ZYYX 4DAVA 3R3OA 4C2MH 1QILA 4HMJA 4KKTA 1DONA 3HOUB 4ULLA 2JA8B 2IHFA 3I3CA 2NZ1D 3BZCA 1AEXA 4QY7A 2CH4W 3ONAB 3NTIA 5I9PA 3PQIA 3CCQA 5JJKA 4C3JH 1VQ7A 2ZT9C 2K5WA 1SMYC 4L63B 1EQRA 4JW0A 2A73B 3VDYA 1XTCD 4K2KA 3GTOB 2B2VC 2F0DA 3NELA 3TP7A 4LFAL 5E3FA 3D4WA 5JVG3 2KHSA 5E4WC 2Q8IB 3RZOB 3JAML 3E6ZX 3J7A5 2R7ZH 1B50A 1PH2A 1HR0W 5IGDA 1DOLA 1B9NA 4DV2L 4CJ0B 1ASYA 1Y14B 2AMCB 1LTSD 4XIGS 3UDIA 1HUMA 5DEHA 1WTPA 2A69D 4A3FG 5D3IB 1KD1C 3HOVH 4AQYQ 5M5YB 2Y0SE 1WTVA 2B2YC 1SFOB 1PV4A 1LABA 1FR3A 2F0TA 4KD3A 3K6OA 2RDGA 4DR6Q 3BG3A 4NDXA 3UDFA 3TS0A 2QF7A 3HOXH
chains in the Genus database with same CATH topology
4RGOS 1JOQA 4FNFA 3O13A 4XXEA 1LT6D 4NP5A 3CRLC 3K5NA 1KDCA 2ZXRA 1O80A 3I73A 2XNAC 3SE0A 5BN4A 1BOSA 3VA5A 4CBVA 4X3KA 3A8IE 1II3A 4MHEA 1J8IA 1ILQA 4Y7NB 1B9MA 2V4DA 4AYBB 3DWQA 2F0FA 1BR9A 2NN6I 4RHSA 1B2TA 4RGTA 4XYQA 3TP5A 3HOZB 1STAA 1DM0B 2XVSA 3A7AB 3DWAA 5JPNC 4KY6A 5T1IA 3LX0A 2EJFC 4BWGB 1JQYD 5M9OA 1SAPA 1H9SA 2R93B 1E2VA 4OIKA 2O4XA 4HCSA 3EQLC 1GXDC 1LT4D 4BA2I 1AZQA 2EXZA 4C1NK 4C56C 2QILA 3DHQA 4QCLA 3DUZA 5IODA 3S1RB 5A35A 1H9KA 5EQ0A 3S15B 2NB0A 2R61A 2B2VA 3SK4A 2SNMA 3MXNA 4LAAA 1LO5D 3FMCA 4B08A 2QEJC 2EYOA 3PMFA 3M7GA 2EJMA 1PZKD 1TWCB 5ISRA 2JA6B 5C5LA 1X32A 1S5CD 3M4OB 3BVZA 3SHLA 1F9SA 4EQOA 3M85A 1M8AA 2QKIC 3RLFA 1MSGA 2LY7A 3MXGA 3MFYA 2M2LA 3SK5A 1YNJC 3K59A 5J39A 3G6JB 2PNRC 4IFDJ 2B2TA 3K5OA 3G7LA 1UEAB 5JAVA 3BVGA 2Q8RE 3LNNA 2AQ2B 2HDLA 4C3JB 3OSOA 1FD7D 3VR2A 1SMYD 1S4ZA 2VNUD 5E1FA 1F2ZA 1QNUA 4RHRA 2IX3A 2R7ZB 2F3VA 1RTOA 1V8QA 1QJOA 4K8IA 5CV6A 2JXMB 1ENFA 2JEBI 3HOVB 2IW3A 1JR0D 4J8QA 2MHVA 3J7AV 1PRTF 1O78A 2K1BA 3HOXB 3IL8A 1E2WA 4IZ8A 2BDOA 1HCZA 4FP5D 1BDOA 4FF3A 5A2QE 3NTHA 1NCVA 2XWBB 3DEOA 3A54A 1LTID 4O1NA 1CHPD 2MGSA 3EFXD 1RKNA 5NUCA 4JK1C 2PQEA 4CKEA 1D6EC 3GV3A 4XT1B 1E0BA 1DZ1A 2Y0SB 1Q1BA 1HQMC 4KY5A 1K8MA 4UAIA 3S1NB 1EWHA 2F4IA 4JBWA 1GHJA 3L9AX 1EY8A 2K04A 2H4OA 5CR3A 3R2TA 3PUYA 2SOBA 4PV1C 3NP8A 3OWEB 5COYA 4IQZA 3QG1A 4L8JA 4NMZA 4G7HC 5LL6X 2L1BA 5C44B 2F0LA 5CMDA 2XN9C 2F0PA 4A3EB 2A6ED 3V96A 3TDQA 2AQ1B 4K5WA 4XDXA 1JWSD 2A5HA 4ZYSA 1RCVD 2X69A 1B53A 5LL6S 2RKSA 2PYKA 1QWYA 1SNCA 1YNNC 2HDMA 2PZUA 3NXWA 4J6HA 4RCNA 2JP1A 1EZ6A 2EYFA 1C4QA 2F0VA 5J1ZA 3BDOA 1A2UA 1Y1VB 3GV6A 1ENCA 4CKBA 3M4YA 4H44C 4TSSA 2HQEA 1JE4A 2A69C 1F9PA 2EY1A 1MSHA 4ZLTF 3MTSA 5TSSA 2PZTA 3J81E 2N55A 5KNBA 4PNYA 4F8MA 1SJED 2KVMA 2EYPA 2EDGA 1EZ8A 1G291 4C3JG 1WTWA 3SXHA 5IT9E 2JYOA 4ZK9B 4WORA 1I6VC 4C3IB 3H6MA 1EU3A 4K5VA 5IIFA 1A6XA 1CI3M 3NHHA 1QCBD 1A15A 1EY4A 2K01A 1CZWA 5KYLA 4FXDA 4G57A 3QB3A 4P2CB 3TP6A 1CTMA 4TQUS 1NR4A 4WJWA 3ND9A 1TR5A 2NTSA 2PMZB 3C1FA 3D3RA 3K58A 2F03A 3GTGB 3Q22A 3A7LA 2M00A 3E0JA 5DAUA 1EU4A 5CORA 1EQVA 4RKLA 4M8AA 3ERQA 3ITPA 2DY7A 1DJRD 1Y8NB 3S1MB 1F2LA 5FOBB 1BQQT 3VYTA 3MZ5A 2DY8A 5E4XA 1KABA 4DA2A 1TS4A 2F0QA 1WTOA 1GJXA 5HGTA 4L6TB 5CV7A 1D2BA 2E76C 1VF5C 2KECA 3HKZB 1OXSC 1BXTA 3BYYB 1S5BD 1Q3LA 3PO2B 3D6WA 3M7NA 3U9SA 1IYVA 4KJNA 4Q5VA 5KYIA 5KNCA 4V190 3AB9A 1TWHB 1JICA 5BN3A 4OGQC 2FINB 3I4LA 5C4XB 5I6WA 2DNEA 4HMIA 3U9OA 1I6HB 4FVMA 1BO0A 1PFBA 2PCFB 1RF2D 3FPPA 1TS5A 1FNWA 2NBFA 3K57A 2WKDA 4ZQ3A 2EYHA 1K8OA 1O7ZA 5JJZA 4K5XA 1AP0A 2EPBA 1STNA 2D62A 1CFMA 4EGVA 2L0CA 1D5XC 2F0NA 1R4PB 3KLSX 1SYFA 2AUJD 1Y8PB 3PUWA 4Q0FA 3FDTA 2F0MA 4PMCA 2RBMA 1KDBA 1BBXC 1BF4A 1STHA 3T56B 1SYEA 2NN6H 4A3BB 1TKWB 3RUZA 2CHBD 1YNND 5EJWA 1G6ZA 2A74C 2TSSA 1STEA 2L55A 3K0YA 2L11A 3PO3B 2MJ8A 1A3UA 5FO9B 1F2YA 2C5CA 5F2DA 1CQFA 1JOKA 1I4XA 2G9DA 5C6AA 1V1OA 3D8GA 1G2SA 1Q90A 4QUCA 5BN5A 1GUNA 3ND8A 2Z1CA 1SNPA 3HOYB 4DU9A 1HUNA 2NVYB 4MN3A 1NR2A 5IGCA 1CHQD 1PZJD 3NWTA 2E2IB 2D2CC 4C3IG 2N88A 3SR1A 1SYDA 2O5JC 4DGZA 3MFGA 5C3EB 1H9JA 4KN7C 3TZDA 1ET6A 4KKUA 5LHY1 1L0XB 1LT3D 2KUMA 1SEBD 1ONLA 3TBIB 2OXPA 1LTBD 4BY7B 1TWGB 3H0GB 4FXGC 4C1NI 1CK1A 2XRSD 3HZXA 2R92B 1VMPA 4V0BA 2RSNA 1JWUD 3TSSA 2K5QA 1TT2A 4RGMA 2B2UC 2X6LA 2R6GA 1EOTA 3MC0B 2OF1A 3KBXA 1ZYRD 5C4HA 4KHVA 3PV0A 3T53B 3GD7A 4WRDA 4ABNA 1PTOH 2F0IA 5IGFA 1C8CA 2KCCA 2NVTB 1KNEA 2BOSA 1LACA 5I6YA 2A6EC 3R2IA 4ZKCB 4A3IB 3SK6A 1U4RA 5A2QL 5KEEA 3CKIB 4EVOA 3H3VC 4DAPA 5EGTA 2A6HC 1SYBA 1G91A 1TY2A 1MBYA 3IAYA 3URYA 3VR5A 4ID6A 4K2LA 3H91A 1ET9A 3A55A 1EFID 4U68A 1XXGA 2XWJB 5ELFA 1RTNA 4IUQA 3T16A 2AQ3B 5D3DA 5EKIA 3S17B 3FEWX 5JVH3 4E6IA 4O42A 2F0UA 1I4PA 1EL0A 1HXYD 4DF7A 1KLUD 3MXPA 3WOFA 1IW7D 2F0HA 3A56A 2B2YA 1WD1A 1TS2A 3MA2B 1NSNS 5G3LD 3MAQA 1PZID 2F0EA 3RMHA 3K5MA 1B1ZA 1ICWA 2I46A 4MIUA 1ML0D 4HAEA 1W6JA 5D65A 3C2PA 5JEAH 4C2MB 1HPCA 4K6LA 1IYUA 5CV4A 2DN8A 3W2DA 5EKLA 3J7YW 3NSWA 4A3JB 2HCCA 3MWYW 3NTKA 1B3AA 3OIQA 4PMBA 2E2JB 2NYZD 1IKLA 4N9PA 1CA5A 4BA1I 4RKBA 3T51B 4RCOA 1H9MA 3HRZC 5K36H 1DOMA 2VB2X 2KA7A 2LS01 2J4XA 2ZXPA 5C0XH 4IUVA 1WTRA 4ME5A 4DK1A 1MGSA 3Q6SA 3H94A 1XYIA 1Q12A 3MVVA 2LFNA 1UUPA 3I72A 3OWFA 1Q1EA 4A3MB 4CJ2C 1GUOA 4XTCS 2AWOA 3I4NB 1BCPD 3GP7A 1VF7A 3MXUA 5DM63 1DCZA 1CM9A 3X3MA 3J81L 2RDFA 1WTXA 2KEEA 2WV6D 3HS0C 5IT9L 1RD9D 3A8JE 1EY7A 1SNOA 4KD4A 4KHZA 4DNTB 3T4AC 1HA6A 4IUTA 4HCEA 4KK7A 1BNZA 1BUVT 1T5XD 4IALA 3D6CA 4IN3A 4IUPA 2IPKD 2F0GA 3KLRA 1SNQA 4H7BA 4HSVA 2ICIA 3KF8A 3KK7A 1S5FD 1NUCA 1UNSA 5C0XI 1J9OA 4RWSC 5FLXE 3FKIB 3IFTA 2JEAI 3EROA 3BDCA 3NK9A 1A3VA 1QOHA 1SYGA 4IUUA 1AZPA 4FYDA 4EQPA 1SJHD 2J0TD 4R8NA 1U4PA 1QNKA 2HUGA 2A6HD 4XQQA 2FJ2A 4YIJA 3J80E 4G7OC 1NAPA 1T5EA 4QIWB 2NVQB 1SSOA 1HTLD 4DFAA 3GTKB 2Z4IA 1VDZA 2KOLA 3P20A 1BCPB 1DOKA 1CZGA 3T13A 4FO2A 2NN6G 5KGUA 2E2DC 5T1GA 5HURA 2EE1A 3R8BA 1EWCA 2EY2A 2D5DA 3N6RA 5C0XJ 3DWPA 4X3UA 3VA7A 3WDNA 4ODGA 2X6GA 1F9RA 1S5ED 2EY5A 2KCNA 2K7VA 1STGA 1HQRD 3N52A 3NQIA 1EY5A 4PMWA 5C3WA 3HOWB 2QCPX 3QWNA 2MPMA 3HGBA 4N9TA 1ZKOA 4X3TA 1SE2A 2K32A 3HEJA 2WINB 1U4MA 5JOBA 4I65A 2NWGA 3NWSA 1HRJA 2SEBD 1I4HA 2ENBA 1ZYRC 3SK8A 2XSCA 1KLGD 2EYJA 4NW2A 5ELBA 2BE5D 1TQOA 5I4DA 4UDUC 4FF4A 2R3ZA 3CRKC 5KRUA 2NVXB 3P7JA 2F1MA 1Y1WB 3J7AF 1HHVA 5CC4A 4KN4C 4FF1A 1XWEA 2JA7B 2IWHA 1L0YB 1U4LA 4HTHA 1EIGA 1EYAA 4R9WA 2PW5A 5EKKA 5M3MB 4LMQD 4XT3B 1GUSA 2ZXOA 3L3OC 3Q24A 4NKLA 4CKCA 1JORA 4I7ZC 3BZDB 1Y69U 1EY6A 3I8ZA 2YYZA 1R4QB 2NUCA 1ESFA 1D5ZC 3D4RA 3SDZA 2QDBA 3PUZA 4CJ1B 2L9HA 2H1EA 2B2WC 1IW7C 1JWMD 4BBSB 1PRTD 2JE6I 1V1PB 5M5XB 4K8JA 4LJZC 1PTOC 1AN8A 4H13C 1PMRA 5IOCA 2NTTA 5I9OA 2BA1A 4F87A 1VCIA 5C4ZA 3CHBD 4HSPA 3VR4A 3AMUA 3PUXA 2PW7A 3TMEA 2EOTA 3R93A 2VB3X 4OO1H 3D31A 1I4QA 1SXTA 3P1HA 1RDPD 4DAYA 1B44D 1HFGA 2SNSA 3OW7A 1I50B 3DM1A 1RJTA 3OHXC 5CGKA 3S14B 2EZVA 2EYMA 4KMUC 1LTTD 5JEAG 1CA6A 3BVMA 3FRPB 1GUTA 2MP1A 2O2LD 2IX1A 1ESRA 4S3SA 1OXUA 1ZEQX 3VR6A 3OMGA 1JC7A 1Z47A 3NBIA 4IFDH 3SEBA 4B9XA 2PZWA 1LTRD 1BCPC 1LTGD 1EQTA 1WD0A 5EBDA 1O7LA 1MD2D 3S9WA 3IFDA 4IURA 5ELDA 5K36G 3X3NA 3L7ZC 5FO7B 1WVLA 2RSOA 2WP8J 4Z9CB 4J1MA 1ILPA 5C0XG 1PYWD 3D4DA 4HN7A 4U673 3NE5B 2B2TC 1QB5D 2ICEC 4OO1I 1X3QA 2D9UA 1C48A 2E74C 5CV8A 3GTQB 1PRTB 1EYDA 1TU2B 1LTAD 2EJGC 2B2WA 4A3GB 3P75A 3LWEA 5ELCA 4G4KA 3S2HB 1S5DD 1HTPA 1A3TA 4QF4A 2F0KA 3W3AA 4RFBA 3V05A 1QE6A 1I4RA 2L12A 1JOOA 2WKCA 3S2DB 2Z8LA 3WOEA 3F2UA 4IFDI 1QG7A 1W6KA 2F0WA 5FKAC 3BYTB 5IGGA 1EY9A 2CW0C 1RHPA 2JSOA 2K03A 1PDQA 4QMGA 3KLSA 1B4OA 1KAAA 5DNFA 3TP8A 1PFNA 1UAPA 3QOLA 3S16B 1TWFB 1DD2A 2VXWA 1A2TA 1Y8OB 5C4JB 3JAME 5CV5A 2E75C 3IKJA 3I90A 3CU7A 2A68D 1MI2A 2DNCA 3FVQA 1PTOD 2IL8A 4X3SA 1KDAA 2C9OA 2B39A 4DK0A 4A93B 5FLXL 3H09A 4RH6A 3OPOA 4OIJA 3I4MB 5CBAE 4OHJA 4RAUC 2FHTA 4KI0A 4GZYC 4XYOA 1SE4A 5EPKA 1GHKA 1E2ZA 1SYCA 2XRQD 2GA4B 2WACA 1EEFD 3NQTA 5ELEA 2AWNA 3M3YB 4CHTB 3GQBA 4KJOA 1OO9B 3J80L 2B2UA 5IGEA 4OL7A 2RVLA 4ZRZA 3K7AB 2O5IC 2BA0A 2FFKB 5J22A 1SDFA 1OXVA 5K5PA 4DXFA 1ZXTA 1HFNA 2WB1B 1TWAB 4HR7B 2ID0A 1LT5D 1AFPA 1SNDA 1CQVA 3VR3A 2B63B 2BE5C 5M3FB 2F3WA 3C1EA 2MUYA 3MEHA 2EVBA 3I91A 3NUCA 1FNVA 2RDHA 1R9TB 1EEID 4FF2A 3PIO3 4C3HB 3OMCA 2J7ZA 3I70A 2G9HD 4BY1B 3FPUB 3PUVA 4BBRB 2TMPA 1EIHA 3Q23A 3QO2A 3TZUA 4KKSA 4G7ZC 2K28A 4DNRB 4ZKBB 2K33A 2I07B 1TS3A 2VUMB 3DXJC 1VMCA 1WTQA 1U9RA 5EBCA 1PTOB 5KIXA 1I3QB 4RGNA 2LKVA 4QB4A 5I2XA 5D14A 1XX8A 3BDLA 1PRTC 1EYCA 1H9SB 2HCIA 3HP3A 1KNAA 3EA6A 2F0JA 2KJXA 1ENAA 2B8GA 1V1PA 1PLFA 1H9RA 4KY7A 1JB3A 1IHZA 1Z7TA 2L4NA 5M5WB 3GO5A 2RQXA 2WAQB 1SBBB 2RA4A 4WFN3 3GTJB 2IX0A 2CW0D 3VYRA 5JEAJ 3RD4A 3GTPB 5CV9A 3TN2A 3EVQA 2EY6A 4F88A 4LK1C 3VYUA 1G2TA 1F77A 4H0LC 4ZUIA 3AU7A 1K83B 5C3XA 1V43A 3GTLB 1CT1D 1SE3A 1D1KA 1DXMA 1LLRD 4QUFA 2YU9B 2K6AA 4KTAA 3QIAA 3SVMA 4TKOB 2BDNA 1TVXA 3VYSA 5CBEE 2EYLA 2OEOA 4EQNA 4OO1G 4CGYB 2PPBC 1PFMA 3GTMB 2CVRA 5DM73 3E5SA 1FYCA 4B9WA 4A3FB 1G8ZD 4K14A 2CQAA 2B8FA 1TY0A 1Z6HA 1YNJD 4ZUJA 4DXGA 2FMMA 5AFWA 3CQZB 1OXTA 1I4GA 3QOJA 4XQJA 1TIID 3A8KE 3RZDB 2PO4A 1PXUA 4RA8A 2LMCB 2Q8TA 1WCMB 3KUPA 4F7XA 4IFDG 3UI2A 3PIP3 1D1IA 2E2HB 1HA5A 1FNUA 1FGBD 2F0SA 4KV6A 3S1QB 3OOCA 3MHBA 4A3KB 3DMUA 4XQNA 4C3HG 3EJIA 4PQXA 5G3LF 2KQ3A 5EPLA 1STYA 4ILWA 4A3DB 1PTOF 2BCOA 1O7YA 1SNMA 1DYQA 3NBHA 1M4VA 4ZAIA 5CYUA 1KTKA 2IJ0A 3DEPA 1EY0A 1D5MC 2IT1A 5IGBA 2AUKA 1IKMA 5KNDA 2XIWA 3K5LA 1OXXK 2F0OA 2WIIB 3LWUA 1GUWA 1GUGA 4R8IA 4TRDA 2OT2A 3C3LA 5FO8B 2K5DA 2FMCA 2L5TA 3KBGA 4HEDA 1F9QA 4IUNA 3OIPA 2Z4HA 2M9VA 4K6DA 5JPMC 2A68C 4M1UB 5I2YA 1IL8A 1GOZA 3C46A 3Q0AA 5C5MA 3QJYA 1RODA 4BS9A 1Q8IA 4FXKC 3NPPA 2K05A 2SDFA 1AW7A 1BCPF 1LV9A 5EPJA 1JCKB 2KEDA 1STBA 1X3PA 3HG9A 3BS1A 5FK9C 2JA5B 4DN4M 1F2MA 3V2TA 3ZYYX 4DAVA 3R3OA 1QILA 4HMJA 4KKTA 1DONA 3HOUB 4ULLA 2JA8B 3I3CA 2NZ1D 1AEXA 3ONAB 3NTIA 5I9PA 2ZT9C 2K5WA 1SMYC 4L63B 2A73B 1XTCD 4K2KA 3GTOB 2B2VC 2F0DA 3TP7A 5E3FA 3D4WA 5JVG3 2KHSA 5E4WC 2Q8IB 3RZOB 3JAML 3E6ZX 1B50A 5IGDA 1DOLA 1B9NA 4CJ0B 1LTSD 4XIGS 1HUMA 5DEHA 1WTPA 2A69D 5D3IB 5M5YB 1WTVA 2B2YC 1SFOB 1LABA 1FR3A 2F0TA 4KD3A 3K6OA 2RDGA 3BG3A 4NDXA 2QF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RAU C;  1U4M A;  2FHT A;  4ZKC B;  4HED A;  1F9Q A;  4IUV A;  1NCV A;  1Q3L A;  2NWG A;  1WTR A;  5EPK A;  3DEO A;  1HRJ A;  1MGS A;  1U4R A;  2B2W A;  2EOT A;  3Q6S A;  1U4P A;  1QNK A;  2HUG A;  3D6W A;  3GV6 A;  5D14 A;  1IL8 A;  2FMM A;  3R93 A;  3LWE A;  1XYI A;  1G2S A;  2FJ2 A;  2MGS A;  4QUC A;  1XX8 A;  5AFW A;  1G91 A;  4NW2 A;  2HCI A;  1ROD A;  1JE4 A;  1KNA A;  1O80 A;  1X32 A;  3HP3 A;  1HUN A;  1F9P A;  3GV3 A;  4XT1 B;  1E0B A;  1DZ1 A;  1JIC A;  4MN3 A;  1NR2 A;  1MSH A;  1HFG A;  4CJ2 C;  2K05 A;  2SDF A;  4RA8 A;  1QE6 A;  1NAP A;  2FIN B;  2R3Z A;  1F9S A;  2L12 A;  3H91 A;  3MTS A;  4UAI A;  2B2U A;  4X3K A;  2Q8T A;  3KUP A;  3DM1 A;  3P7J A;  4U68 A;  1M8A A;  1RJT A;  4MHE A;  2N88 A;  1SSO A;  1ILQ A;  2N55 A;  2RVL A;  1J8I A;  1RTN A;  2KVM A;  1HHV A;  1PLF A;  1LV9 A;  4IUQ A;  5EPJ A;  2FFK B;  2KED A;  1CM9 A;  3UI2 A;  5EKI A;  1X3P A;  2K04 A;  1MSG A;  3F2U A;  1BO0 A;  1SDF A;  2M2L A;  1B2T A;  1WTX A;  1WTW A;  1PFB A;  1CA6 A;  1QG7 A;  1U4L A;  2KEE A;  4O42 A;  2L4N A;  1EIG A;  1ZXT A;  2JYO A;  3TZD A;  4DN4 M;  2RA4 A;  4R9W A;  4ZK9 B;  1HFN A;  2MP1 A;  2KOL A;  5COY A;  1EL0 A;  1ESR A;  4LMQ D;  2B2T A;  4XT3 B;  3G7L A;  1RHP A;  2Q8R E;  1DON A;  2K03 A;  1DOK A;  1A15 A;  1PDQ A;  2B2Y A;  2HDL A;  2K01 A;  2KUM A;  1WD1 A;  1O7Z A;  1B4O A;  5JJZ A;  3I3C A;  2NZ1 D;  5DNF A;  3TN2 A;  5T1I A;  1AP0 A;  3ONA B;  2EPB A;  2L1B A;  5EPL A;  3I91 A;  1NR4 A;  1PFN A;  1ICW A;  1S4Z A;  1G2T A;  1ML0 D;  4HAE A;  1SAP A;  5T1G A;  1HA6 A;  2EE1 A;  4IUT A;  1O7Y A;  5D65 A;  5CMD A;  1EQT A;  1WD0 A;  3I8Z A;  4OIK A;  4ZAI A;  4HCS A;  2J7Z A;  3IFD A;  1VMP A;  2B2V C;  2VXW A;  2RSN A;  1BNZ A;  3FPU B;  1AZP A;  4IUR A;  3DEP A;  3FDT A;  4X3U A;  2B2U C;  1RTO A;  4IUP A;  2X6L A;  1EIH A;  4QUF A;  4CJ1 B;  2X6G A;  4HSV A;  5E4W C;  3QO2 A;  5COR A;  1F9R A;  1WVL A;  2L9H A;  4XDX A;  1AZQ A;  2HCC A;  2RSO A;  3MWY W;  3SVM A;  1B3A A;  1EOT A;  2H1E A;  2B2W C;  3I90 A;  3KBX A;  1BBX C;  1BF4 A;  2DY7 A;  4ZLT F;  1IKM A;  1B50 A;  2X69 A;  1F2L A;  1ILP A;  2XIW A;  1DOL A;  1B53 A;  2BDN A;  1TVX A;  1MI2 A;  2K28 A;  5CBE E;  4CJ0 B;  4ZKB B;  3N52 A;  2DY8 A;  1GUW A;  2NYZ D;  1IKL A;  1HUM A;  2K1B A;  4R8I A;  1WTP A;  2IL8 A;  4X3S A;  5E4X A;  2MPM A;  1CA5 A;  1J9O A;  2B2T C;  4RWS C;  5EJW A;  1G6Z A;  1C8C A;  1PFM A;  2HDM A;  1VMC A;  1WTV A;  2B2Y C;  4X3T A;  3IL8 A;  5EQ0 A;  1WTO A;  1X3Q A;  2CVR A;  1WTQ A;  2D9U A;  2B2V A;  2L11 A;  1DOM A;  1KNE A;  2MJ8 A;  4OIJ A;  4IUU A;  2JP1 A;  5CBA E;  2KEC A; 
#chains in the Genus database with same CATH topology
 4LF8 L;  4RGO S;  4A3M H;  1JOQ A;  1A0I A;  4FNF A;  3O13 A;  2EQS A;  2Z0S A;  4XXE A;  1LT6 D;  1Q8K A;  2ZM6 Q;  1WCM G;  4NP5 A;  3I4N H;  3CRL C;  3I56 A;  3K5N A;  1KDC A;  2ZXR A;  1E3P A;  1O80 A;  3I73 A;  2XNA C;  3SE0 A;  5BN4 A;  1JMC A;  3T1Y Q;  1BOS A;  3VA5 A;  2BH8 A;  4CBV A;  4LF7 Q;  4X3K A;  2ZJR A;  3A8I E;  1II3 A;  4RMF A;  4MHE A;  4JI6 L;  1J8I A;  1ILQ A;  4OX9 L;  2V1C C;  1B9M A;  4Y7N B;  4A3K G;  4JI1 L;  1MJE A;  2V4D A;  4AYB B;  3DWQ A;  2F0F A;  1BR9 A;  2NN6 I;  4RHS A;  1B2T A;  3S1N H;  2KCT A;  4KHP L;  4RGT A;  4YWK A;  4XYQ A;  3TP5 A;  3HOZ B;  1STA A;  1DM0 B;  3UE1 A;  4A3D G;  2XVS A;  3TEH B;  3A7A B;  1PH1 A;  3DWA A;  2HT1 A;  1DGS A;  5JPN C;  4KY6 A;  5T1I A;  1I94 L;  1YNX A;  3LX0 A;  2EJF C;  4BWG B;  1JQY D;  1EOV A;  5M9O A;  2UUA Q;  4LFB L;  4JOI C;  1SAP A;  1H9S A;  2R93 B;  1EQQ A;  1E2V A;  4OIK A;  2O4X A;  4HCS A;  3EQL C;  1GXD C;  1LT4 D;  4UP9 A;  4UPA A;  5C44 H;  4BA2 I;  4LW1 A;  1HNW L;  1AZQ A;  5FLM H;  2N78 A;  2EXZ A;  4C1N K;  4C56 C;  2QIL A;  3UE0 A;  4A3E H;  3A74 A;  3DHQ A;  4QCL A;  1NTG A;  1FVI A;  3DUZ A;  4JPB W;  5IYD G;  1KRS A;  5IOD A;  5C4X G;  3S1R B;  5A35 A;  4DR4 L;  1JJG A;  4DUY L;  1MJC A;  1H9K A;  4HIM A;  5EQ0 A;  3S15 B;  1PH8 A;  1SE8 A;  2NB0 A;  2R61 A;  2B2V A;  1VQC A;  3SK4 A;  4EQ5 A;  2R7D A;  2SNM A;  4IJH A;  3MXN A;  4LAA A;  1LO5 D;  3FMC A;  4JV5 Q;  3RR5 A;  4B08 A;  2QEJ C;  1O7I A;  2EYO A;  3PMF A;  4HJ5 A;  2Q2H A;  3EN2 A;  3M7G A;  2EJM A;  1PZK D;  2NVQ H;  1TWC B;  5ISR A;  1MHW C;  2JA6 B;  5C5L A;  1X32 A;  1S5C D;  1K73 C;  4JI3 Q;  1Y1V H;  4R4Q A;  3M4O B;  1VQN A;  3BVZ A;  1B3Q A;  2JA5 G;  3SHL A;  1F9S A;  2A8V A;  4EQO A;  3M85 A;  1M8A A;  2GVA A;  2QKI C;  3RLF A;  1K9M C;  1MSG A;  3HOU G;  2LY7 A;  3MXG A;  1VQK A;  3MFY A;  2M2L A;  3SK5 A;  1YNJ C;  3K59 A;  5J39 A;  3G6J B;  2K75 A;  2PNR C;  1L0W A;  2UUC L;  1W2B A;  4IFD J;  1VQA A;  2A19 A;  2B2T A;  3K5O A;  3G7L A;  1UEA B;  5JAV A;  3BVG A;  2Q8R E;  3LNN A;  4A3L G;  4B3T Q;  2AQ2 B;  2HDL A;  4GKJ L;  4C3J B;  3OSO A;  1FD7 D;  2OWO A;  3FP9 A;  4C3I H;  2PI2 E;  3U58 A;  3VR2 A;  3CCM A;  4OXP A;  1SMY D;  4NPS A;  1IBK Q;  1S4Z A;  3KOJ A;  2VNU D;  5E1F A;  1F2Z A;  1QNU A;  4RHR A;  2IX3 A;  2R7Z B;  2F3V A;  4LF4 Q;  1RTO A;  1V8Q A;  3ER0 A;  1QJO A;  4K8I A;  5CV6 A;  2JXM B;  1ENF A;  3H15 A;  2JEB I;  3HOV B;  2IW3 A;  1JR0 D;  4J8Q A;  2MHV A;  3J7A V;  4APV A;  1PRT F;  1UWV A;  1YBY A;  1O78 A;  2K1B A;  3PGZ A;  3CW2 C;  4UHV A;  3S1M H;  3HOX B;  1IBM L;  3K80 C;  3IL8 A;  2YV5 A;  2RF4 A;  4YCU A;  1E2W A;  4IZ8 A;  2BDO A;  1HCZ A;  2BH2 A;  4FP5 D;  1BDO A;  1EFW A;  4FF3 A;  5A2Q E;  2RCF A;  3NTH A;  1NCV A;  2XWB B;  3DEO A;  4LF9 L;  3H3V H;  3A54 A;  1NY4 A;  1LTI D;  1RL2 A;  4O1N A;  4CDD C;  1CHP D;  2MGS A;  3EFX D;  1RKN A;  5NUC A;  4JK1 C;  2PQE A;  3PO2 H;  4AYB G;  4CKE A;  1D6E C;  3GV3 A;  4XT1 B;  1E0B A;  1DZ1 A;  2Y0S B;  1Q1B A;  1HQM C;  4KY5 A;  1K8M A;  3CCV A;  4UAI A;  3S1N B;  1EWH A;  1X3F A;  2F4I A;  1GHJ A;  4JBW A;  3HOZ G;  3L9A X;  4JBM A;  1EY8 A;  1TWH H;  4JC0 A;  2K04 A;  4JI4 Q;  2H4O A;  5CR3 A;  1NMG A;  3K81 C;  3R2T A;  3PUY A;  2SOB A;  4PV1 C;  1NBW A;  3NP8 A;  3OWE B;  5COY A;  1I6H H;  4IQZ A;  3QG1 A;  5GRO A;  3OTO Q;  3ULJ A;  1A63 A;  4L8J A;  2UU9 L;  4NMZ A;  4ALP A;  4G7H C;  5LL6 X;  4LF5 L;  2L1B A;  4LF6 L;  2I5L X;  5C44 B;  3L2P A;  4DV3 L;  2F0L A;  2P5Z X;  5CMD A;  2XN9 C;  2F0P A;  1QUQ B;  4A3E B;  4A3C G;  2A6E D;  3V96 A;  1K8A C;  3TDQ A;  2AQ1 B;  1JE5 A;  2ZJP A;  4K5W A;  4XDX A;  1JWS D;  2A5H A;  4ZYS A;  1YVC A;  1RCV D;  2X69 A;  1B53 A;  5LL6 S;  2RKS A;  4GN4 B;  2PYK A;  3H3V I;  1QWY A;  4NXN Q;  1SNC A;  1YNN C;  2HDM A;  4IPH A;  5GAD C;  2PZU A;  2Z6K C;  3NXW A;  4J6H A;  3CCR A;  4A3B H;  1HZC A;  2LSS A;  4YWM A;  3PF4 A;  4RCN A;  3CCU A;  2VQE L;  2JP1 A;  4YCV A;  3U4Z A;  1EZ6 A;  2JA6 G;  2KBN A;  2EYF A;  3OYY A;  1C4Q A;  2F0V A;  5J1Z A;  5IY0 A;  2QGQ A;  3BDO A;  4JI5 L;  3PO3 H;  1A2U A;  1Y1V B;  3GV6 A;  1ENC A;  2F52 A;  4CKB A;  2K5V A;  3M4Y A;  3CC2 A;  1HNZ Q;  4H44 C;  2C35 B;  3D0F A;  2HQE A;  4TSS A;  1PH4 A;  4UP7 A;  1JE4 A;  1X9N A;  2A69 C;  1X3G A;  3G6E A;  1GO3 E;  1W3S A;  1F9P A;  1N32 L;  2EY1 A;  1MSH A;  4ZLT F;  3MTS A;  5TSS A;  2PZT A;  3HOY H;  3J81 E;  2N55 A;  5KNB A;  3AQQ A;  2NVY H;  1SJE D;  4PNY A;  2KVM A;  4F8M A;  2EYP A;  2EDG A;  1EZ8 A;  1G29 1;  1ICF B;  4C3J G;  1WTW A;  3SXH A;  5IT9 E;  2E2I H;  2JYO A;  4ZK9 B;  4WOR A;  1JJ2 A;  1I6V C;  4YY3 Q;  1SN8 A;  4C3I B;  2E5L L;  3H6M A;  1EU3 A;  4K5V A;  1E24 A;  3E9H A;  5IIF A;  1A6X A;  1CI3 M;  3NHH A;  5C3E H;  1QCB D;  1A15 A;  1EY4 A;  2K01 A;  1CZW A;  2RCN A;  5KYL A;  4FXD A;  4G57 A;  3QB3 A;  2R7Z G;  4P2C B;  4N8X 1;  4JI0 L;  3TP6 A;  4NXM Q;  1CTM A;  4TQU S;  2KEN A;  1EUJ A;  1NR4 A;  4WJW A;  2DUD A;  3ND9 A;  1TR5 A;  2NTS A;  2PMZ B;  1IL2 A;  1YZ6 A;  4X66 L;  2QW7 A;  3RLN A;  3C1F A;  2CKZ B;  3D3R A;  3K58 A;  2F03 A;  3GTG B;  3Q22 A;  3HOV G;  4DV5 L;  4OEL B;  3A7L A;  1KC8 C;  2M00 A;  1G6P A;  3J80 i;  4BY7 H;  1TWG H;  3E0J A;  1K0R A;  3H0G H;  5DAU A;  5IP7 H;  1EU4 A;  5COR A;  4WJ3 M;  1EQV A;  2OQK A;  5GAH C;  4RKL A;  3HOX G;  4L5R C;  4M8A A;  3ERQ A;  3ITP A;  2DY7 A;  1DJR D;  1Y8N B;  3S1M B;  1F2L A;  1HNX Q;  2VQF Q;  4A3M G;  5FOB B;  1AE2 A;  1BQQ T;  1BBU A;  3VYT A;  3MZ5 A;  2DY8 A;  5IYB H;  5E4X A;  1VS0 A;  3I4N G;  1KAB A;  4DR7 L;  2D0O A;  4DA2 A;  1TS4 A;  2F0Q A;  4LUV A;  1WTO A;  1GJX A;  5HGT A;  1YEZ A;  4L6T B;  1XNQ Q;  5CV7 A;  1D2B A;  2E76 C;  4CDF C;  3WWV A;  1VF5 C;  2KEC A;  3S2H H;  3HKZ B;  1OXS C;  1C0A A;  1BXT A;  2ZTC A;  3BYY B;  1S5B D;  1EWI A;  4O0A A;  1Q3L A;  2Y0S G;  1V9P A;  3PO2 B;  2NVT H;  3CCJ A;  3D6W A;  3M7N A;  4DR3 Q;  2AKW B;  4LUZ A;  3U9S A;  2PQA B;  1IYV A;  4KJN A;  2UXB L;  4Q5V A;  5KYI A;  5KNC A;  2IHE A;  4V19 0;  1TXY A;  3AB9 A;  1TWH B;  1JIC A;  1GVP A;  5BN3 A;  4OGQ C;  2FIN B;  3I4L A;  5C4X B;  5I6W A;  2DNE A;  4HMI A;  4DR1 Q;  1IBL Q;  4POG A;  3U9O A;  4HJA A;  3CC7 A;  3KF8 B;  4GS3 A;  5ELO A;  1I6H B;  4FVM A;  4AIM A;  1BO0 A;  1L1O B;  1PFB A;  2PCF B;  1RF2 D;  5EAY A;  2KCM A;  3FPP A;  1TS5 A;  1FNW A;  1TWF H;  5C44 G;  2NBF A;  3LGJ A;  3G48 A;  3S17 H;  3IRB A;  3UDX A;  2WKD A;  4ZQ3 A;  3K57 A;  2EYH A;  3BU2 A;  1K8O A;  4CDC C;  1O7Z A;  5JJZ A;  1YIT A;  4K5X A;  4A3E G;  3AEV A;  1AP0 A;  2EPB A;  1STN A;  4I7A A;  2D62 A;  1CFM A;  4EGV A;  2L0C A;  3F1Z A;  1D5X C;  2F0N A;  1BKB A;  3KF6 B;  4X64 Q;  1JT8 A;  1R4P B;  4MZ9 A;  3KLS X;  1SYF A;  2AUJ D;  1Y8P B;  3PUW A;  4Q0F A;  4AQY L;  3FDT A;  2F0M A;  4PMC A;  2RBM A;  1NJI C;  1KDB A;  4DR6 L;  1T9H A;  1BBX C;  1BF4 A;  1STH A;  1GD7 A;  4JI2 L;  3T56 B;  1SYE A;  2HQL A;  2NN6 H;  4A3B B;  1TKW B;  3RUZ A;  2ATW A;  1VQ8 A;  2JN4 A;  4A3J H;  2WB1 E;  4GKK L;  2CHB D;  3U50 C;  1YNN D;  2G5D A;  2JQO A;  5EJW A;  3J80 c;  2ZM6 L;  4MTK A;  1G6Z A;  2A74 C;  3E3X A;  4JI7 L;  2TSS A;  1STE A;  2UXD L;  1H95 A;  2E2J H;  2L55 A;  2OTJ A;  1Y1V G;  1WOC A;  3K0Y A;  2L11 A;  3PO3 B;  2MJ8 A;  1A3U A;  3T1Y L;  5FO9 B;  4LF7 L;  1F2Y A;  2C5C A;  5F2D A;  5GAG C;  1CQF A;  3SGI A;  1JOK A;  1I4X A;  2G9D A;  1GM5 A;  5C6A A;  1V1O A;  2MFI A;  3D8G A;  1G2S A;  1Q90 A;  4QUC A;  5BN5 A;  1GUN A;  3ND8 A;  1N33 L;  2Z1C A;  1SNP A;  3HOY B;  4DU9 A;  2CH4 A;  1HUN A;  1G51 A;  2NVY B;  4MN3 A;  1NR2 A;  5IGC A;  3J81 c;  1CHQ D;  1PZJ D;  3NWT A;  3I2Z A;  2E2I B;  2D2C C;  4C3I G;  3T1H Q;  2N88 A;  3SR1 A;  1SYD A;  5IT9 c;  2O5J C;  4DGZ A;  3MFG A;  4OEM B;  4JI8 Q;  4K0K Q;  4GOP C;  2UUA L;  5M3F H;  5C3E B;  2QEX A;  1H9J A;  4KN7 C;  3TZD A;  1ET6 A;  1YJ9 A;  1YIJ A;  4KKU A;  1JJC B;  5LHY 1;  2ZTE A;  4JBJ A;  1L0X B;  4IPC A;  4TVA B;  1R9T H;  1LT3 D;  3G4S A;  1QZH A;  2KUM A;  1SEB D;  4BY1 H;  1ONL A;  5IWA Q;  3TBI B;  2OXP A;  1LTB D;  1E1O A;  4OWX B;  4BY7 B;  2NZH A;  1TWG B;  3H0G B;  4FXG C;  4C1N I;  1VQB A;  5IE8 A;  3F2B A;  1CK1 A;  2XRS D;  3HZX A;  4LFA Q;  2R92 B;  1VMP A;  4V0B A;  2RSN A;  1JWU D;  3TSS A;  2K5Q A;  1TT2 A;  4RGM A;  2B2U C;  2X6L A;  1UE6 A;  2R6G A;  1XMQ Q;  3A5Z B;  1EOT A;  3MC0 B;  2OF1 A;  3KBX A;  4L5Q A;  1ZYR D;  5C4H A;  4DV2 Q;  4JV5 L;  4KHV A;  3PV0 A;  3T53 B;  3GD7 A;  4WRD A;  2WAQ E;  4ABN A;  1YI2 A;  1PTO H;  3HKZ G;  2F0I A;  1X65 A;  5IGF A;  4OWW B;  1C8C A;  4X65 Q;  4Y52 H;  2KCC A;  3PO2 G;  1YJW A;  4JI3 L;  4EX5 A;  2NVT B;  3M4P A;  1Q46 A;  1KNE A;  2EXD A;  2BOS A;  1LAC A;  4QIW E;  5I6Y A;  2A6E C;  3FKI H;  3CCS A;  3R2I A;  4ZKC B;  4A3I B;  3SK6 A;  1U4R A;  5A2Q L;  5KEE A;  3CKI B;  4EVO A;  3H3V C;  2K52 A;  4L5T A;  4DAP A;  3Q8D A;  5EGT A;  2A6H C;  1SYB A;  1RIP A;  4B3R L;  1G91 A;  1TY2 A;  3BZK A;  3ERS X;  1MBY A;  3IAY A;  3URY A;  3VR5 A;  4ID6 A;  4K2L A;  3H91 A;  1ET9 A;  3A55 A;  1EFI D;  4U68 A;  1XXG A;  2XWJ B;  5ELF A;  2VY3 A;  1UEB A;  1RTN A;  3UDG A;  4IUQ A;  3T16 A;  2AQ3 B;  5D3D A;  4GN3 B;  5EKI A;  3S17 B;  1IBK L;  3FEW X;  5JVH 3;  3RLO A;  4E6I A;  4O42 A;  4DV7 L;  4DV4 Q;  2F0U A;  1I4P A;  4JCV E;  1EL0 A;  3GTK H;  1HXY D;  4DF7 A;  1KLU D;  4LF4 L;  3MXP A;  3WOF A;  1X56 A;  1IW7 D;  2F0H A;  3A56 A;  3CP0 A;  2B2Y A;  1WD1 A;  1L1O C;  1TS2 A;  3MA2 B;  4HJ7 A;  1NSN S;  5G3L D;  3MAQ A;  1PZI D;  2F0E A;  3RMH A;  1WI5 A;  1B1Z A;  3K5M A;  1ICW A;  2I46 A;  2L15 A;  4MIU A;  1ML0 D;  4HAE A;  1W6J A;  5D65 A;  3C2P A;  5JEA H;  4C2M B;  1HPC A;  5AJ3 Q;  5IYC H;  3W1G A;  1YHA A;  4K6L A;  1IYU A;  5CV4 A;  2DN8 A;  3W2D A;  4A3B G;  5EKL A;  2B29 A;  2N8N A;  4UP8 A;  2LXJ A;  3J7Y W;  3NSW A;  1E1T A;  4A3J B;  1QVF A;  1VQF A;  2HCC A;  3MWY W;  3NTK A;  1B3A A;  3OIQ A;  4IPD A;  4PMB A;  1K3R A;  3E0E A;  4DAY B;  4DUZ L;  2DJG C;  4B3S Q;  1NE3 A;  4IO9 A;  4GLA C;  2E2J B;  1N36 Q;  3PO3 G;  3QR8 A;  2NYZ D;  1IKL A;  4N9P A;  4DUY Q;  4BA1 I;  3PF5 A;  1CA5 A;  4RKB A;  3T51 B;  4DV1 Q;  4RCO A;  1V1Q A;  2JK8 A;  1H9M A;  3HRZ C;  1PH5 A;  1KQS A;  3HOW H;  5K36 H;  1DOM A;  2VB2 X;  2KA7 A;  2LS0 1;  3A5U A;  2J4X A;  2ZXP A;  3HOY G;  5C0X H;  4IUV A;  1WTR A;  4ME5 A;  4DK1 A;  1MGS A;  3Q6S A;  3H94 A;  1WCM H;  3AYH B;  1XYI A;  4JI4 L;  1Q12 A;  1EIY B;  3MVV A;  4JOI A;  2LFN A;  3JAM i;  1UUP A;  3I72 A;  3TS2 A;  3OWF A;  1Q1E A;  3PCO B;  4A3M B;  5C3E G;  4CJ2 C;  3TQY A;  1GUO A;  5FJ8 H;  4P75 A;  4XTC S;  4JBK A;  1M90 C;  3OTO L;  2AWO A;  2F4V L;  3I4N B;  1BCP D;  3GP7 A;  4X62 Q;  1VF7 A;  3K7U C;  3MXU A;  5DM6 3;  1DCZ A;  1CM9 A;  3X3M A;  4H02 A;  3J81 L;  4IJL A;  2RDF A;  1S72 A;  1WTX A;  2KEE A;  2KHI A;  2NVX H;  2WV6 D;  3HS0 C;  1Y1W H;  4BY7 G;  5IT9 L;  3H0G G;  1RD9 D;  1VQ6 A;  5IP7 G;  4GKJ Q;  1A62 A;  2F3I A;  2JA7 H;  3A8J E;  2R92 G;  4OON A;  1EY7 A;  5M3M H;  1SNO A;  4KD4 A;  2PQA A;  4KHZ A;  4DNT B;  4DR2 Q;  3TRZ A;  3T4A C;  1HA6 A;  5IYB G;  4IUT A;  1Q81 C;  2I0Q A;  1S40 A;  4HCE A;  1N34 Q;  1MKH A;  4KK7 A;  4YHH Q;  4NXN L;  1BNZ A;  1BUV T;  4P74 A;  1T5X D;  4IAL A;  3D6C A;  4IN3 A;  4IUP A;  2IPK D;  2F0G A;  3KLR A;  1Q7Y C;  1SNQ A;  4H7B A;  4HSV A;  2UXC Q;  1XMO Q;  2ICI A;  3KF8 A;  3KK7 A;  1S5F D;  1NUC A;  5BR8 Q;  1VQJ A;  4DAM A;  1L1O A;  1UNS A;  5C0X I;  1IBM Q;  1J9O A;  4RWS C;  4A3I G;  1WYD A;  5FLX E;  3FKI B;  3IFT A;  4BBS H;  1VQH A;  2JEA I;  3ERO A;  5M5X H;  3BDC A;  3NK9 A;  1A3V A;  1QOH A;  1SYG A;  4GN5 A;  4IUU A;  1AZP A;  1SLJ A;  3CC4 A;  1XPO A;  4FYD A;  4EQP A;  1SJH D;  4NB3 A;  2J0T D;  4R8N A;  3OW2 A;  1U4P A;  1QNK A;  2HUG A;  2A6H D;  4XQQ A;  2FJ2 A;  3S24 A;  2Q2U A;  4AH6 A;  2VL6 A;  4YIJ A;  4YY3 L;  4DNI A;  1Q82 C;  3J80 E;  2JA5 H;  4G7O C;  1NAP A;  1T5E A;  4QIW B;  2NVQ B;  1SSO A;  4GLV B;  1IZ6 A;  1K8G A;  3U4V A;  1UE1 A;  4QL5 A;  1HTL D;  4DFA A;  3GTK B;  2JA8 H;  2Z4I A;  3KDF B;  1I50 H;  1VDZ A;  2KOL A;  1EIF A;  3S14 H;  3P20 A;  1BCP B;  1DOK A;  4GOP B;  1PVO A;  1CZG A;  4LF6 Q;  3T13 A;  2B3G A;  2YTY A;  4FO2 A;  1HNX L;  2NN6 G;  3I4O A;  5KGU A;  2E2D C;  5T1G A;  4A3J G;  5J3B A;  5HUR A;  2EE1 A;  3R8B A;  3CPF A;  1EWC A;  2EY2 A;  2D5D A;  3N6R A;  5C0X J;  3G71 A;  3DWP A;  4X3U A;  3VA7 A;  3WDN A;  5JJI A;  4ODG A;  2X6G A;  1XNQ L;  1F9R A;  1S5E D;  4POF A;  4R4C A;  3F2C A;  2EY5 A;  2KCN A;  2XGT A;  4PZ6 A;  2K7V A;  1STG A;  1HQR D;  3N52 A;  3NQI A;  5LMN Q;  1FJG Q;  1EY5 A;  4PMW A;  5C3W A;  3RNU A;  2QCP X;  3QWN A;  2MPM A;  4R4I A;  4DR3 L;  2GVB A;  3HOW B;  3HGB A;  1A8V A;  1I5F A;  1K0S A;  4N9T A;  1ZKO A;  3MEF A;  4X3T A;  2HHH Q;  4HIK A;  1SE2 A;  2K32 A;  3TRE A;  1GKH A;  3HEJ A;  1X3E A;  3M9B A;  3BJU A;  2WIN B;  1U4M A;  2R7F A;  5JOB A;  5HGQ A;  3ULL A;  4I65 A;  2NWG A;  1PH7 A;  3NWS A;  4DK3 C;  1HRJ A;  2SEB D;  2ZTD A;  1I4H A;  2ENB A;  1ZYR C;  3SK8 A;  1IXR A;  2XSC A;  3GTQ H;  1KLG D;  2JJQ A;  2EYJ A;  4A75 A;  4NW2 A;  1VQD A;  2RHQ B;  5ELB A;  1N32 Q;  2BE5 D;  1KHI A;  3DLL A;  2CCZ A;  4A3G H;  3NEM A;  2ES2 A;  1TQO A;  5I4D A;  4UDU C;  4FF4 A;  2VZA A;  3KFU A;  2R3Z A;  3CRK C;  4BY1 G;  5KRU A;  2NVX B;  3P7J A;  3B6Y A;  2F1M A;  1Y1W B;  3J7A F;  1HHV A;  1WFQ A;  5CC4 A;  4KN4 C;  4QJF A;  4DV6 Q;  4FF1 A;  1XWE A;  2JA7 B;  2IWH A;  1L0Y B;  1U4L A;  4HTH A;  1EIG A;  1EYA A;  2UUB Q;  2EIF A;  4LFC Q;  4R9W A;  2HD3 A;  2PW5 A;  5EKK A;  3CD6 A;  3S2D H;  1L2F A;  3K0X A;  5M3M B;  2R93 H;  4LMQ D;  4XT3 B;  1GUS A;  2ZXO A;  2Z6K A;  3L3O C;  3Q24 A;  4NKL A;  2RHS B;  3ULP A;  4CKC A;  4DV0 Q;  1JOR A;  1PYB A;  4I7Z C;  1LYL A;  3BZD B;  4DV5 Q;  1Y69 U;  1EY6 A;  3I8Z A;  2YYZ A;  1R4Q B;  2NUC A;  1ESF A;  4CDE C;  4DR5 Q;  1D5Z C;  3D4R A;  3SDZ A;  3S16 H;  2QDB A;  1HR0 Q;  3PUZ A;  4CJ1 B;  4FDB A;  4R1J A;  1ASZ A;  2L9H A;  1PH3 A;  3FKI G;  2H1E A;  2B2W C;  3F8T A;  5FLM G;  1IW7 C;  1JWM D;  4BBS B;  5C4J H;  1XNR Q;  4MTN A;  1XPU A;  5FLX c;  1PRT D;  2JE6 I;  1V1P B;  5M5X B;  4K8J A;  1BVS A;  4B3M Q;  4LJZ C;  1PTO C;  1AN8 A;  4H13 C;  1PMR A;  1M1K C;  5IOC A;  2NTT A;  3I7F A;  2VW9 A;  2FXQ A;  5I9O A;  1PYS B;  2BA1 A;  2YTV A;  4HID A;  4F87 A;  4A4I A;  5LMU Q;  4JYA Q;  1VCI A;  5C4Z A;  2VS1 A;  3CHB D;  4HSP A;  3VR4 A;  3AMU A;  4A93 H;  3PUX A;  2PW7 A;  2K14 A;  3TME A;  3T1H L;  1PH6 A;  2EOT A;  3I4M H;  3R93 A;  1X55 A;  4JI8 L;  4K0K L;  2VB3 X;  3CCL A;  4OO1 H;  1WTH A;  3D31 A;  3STB D;  1N8R C;  4WJ4 A;  3NEN A;  1I4Q A;  1SXT A;  1B7Y B;  3P1H A;  1RDP D;  4DAY A;  1B44 D;  1HFG A;  1VQI A;  2SNS A;  3OW7 A;  1CKN B;  1I50 B;  3M3Y H;  2ASB A;  3DM1 A;  1RJT A;  5IWA L;  3A0J A;  3OHX C;  5CGK A;  3S14 B;  2EZV A;  2EYM A;  4KMU C;  3EIV A;  1LTT D;  5JEA G;  1CA6 A;  4QGU A;  3BVM A;  3FRP B;  1GUT A;  5IYC G;  1UE5 A;  3K7A H;  2MP1 A;  2O2L D;  4YWL A;  2IX1 A;  1ESR A;  1SR3 A;  5GAE C;  1HJP A;  4UY8 C;  1YHQ A;  1J5E Q;  4S3S A;  3L0O A;  1OXU A;  1IYJ B;  1ZEQ X;  3VR6 A;  1TWA H;  1VQE A;  1XMQ L;  3OMG A;  1JC7 A;  1Z47 A;  1PH9 A;  3NBI A;  4IFD H;  3SEB A;  1CUK A;  4B9X A;  2PZW A;  1LTR D;  2B63 H;  1BCP C;  1LTG D;  4LWC A;  1EQT A;  2N3S A;  5EBD A;  2HIV A;  1WD0 A;  1O7L A;  1MD2 D;  4DKA C;  3S9W A;  3IFD A;  3PIO A;  1Z9F A;  4X65 L;  4IUR A;  2QA4 A;  1J6Q A;  5ELD A;  1HZA A;  4OWT B;  3HOW G;  5K36 G;  3X3N A;  3L7Z C;  5FO7 B;  4C3H H;  1WVL A;  2KHJ A;  2RSO A;  2WP8 J;  4JI2 Q;  4Z9C B;  4J1M A;  4BBR H;  1ILP A;  5C0X G;  1PYW D;  3D4D A;  1KL9 A;  4GKK Q;  4BXX H;  4HN7 A;  2MQH A;  4U67 3;  3NE5 B;  2B2T C;  4JI7 Q;  1QB5 D;  2UXD Q;  2ICE C;  4OO1 I;  1X3Q A;  2D9U A;  1QVG A;  1C48 A;  2E74 C;  4O2D A;  5FJ8 G;  1YJN A;  5CV8 A;  2VUM H;  3GTQ B;  1PRT B;  1EYD A;  1TU2 B;  1LTA D;  2EJG C;  2B2W A;  3CAM A;  4A3G B;  3P75 A;  1VQ9 A;  3LWE A;  1N33 Q;  5ELC A;  4GNX B;  4IPG A;  1OTC A;  1LUZ A;  1Y1W G;  4G4K A;  1E7Z A;  1I3Q H;  4A76 A;  1S5D D;  3S2H B;  1HTP A;  1A3T A;  3NBH B;  1B8A A;  2OCE A;  4DV4 L;  4QF4 A;  2F0K A;  1FL0 A;  3W3A A;  2JA7 G;  1VQO A;  1D8L A;  2GN5 A;  4RFB A;  3V05 A;  1QE6 A;  4LF8 Q;  1I4R A;  2L12 A;  3CXC A;  1JOO A;  2WKC A;  4PG3 A;  5M3M G;  1VQP A;  3S2D B;  3CCE A;  3E9I A;  2Z8L A;  3WOE A;  1S3O A;  3F2U A;  4IFD I;  1QUQ A;  1QG7 A;  4KLK A;  1W6K A;  5IP9 H;  5AJ3 L;  2F0W A;  5FKA C;  4P71 A;  3BYT B;  5IGG A;  1EY9 A;  2CW0 C;  1RHP A;  3DM3 A;  2JSO A;  2K03 A;  1PDQ A;  4QMG A;  5M5W H;  2K4K A;  3KLS A;  3GTJ H;  1B4O A;  1KAA A;  4B3T L;  4JI6 Q;  5DNF A;  4OX9 Q;  2D0P A;  4JI1 Q;  3KLW A;  1LM0 A;  3TP8 A;  4B3S L;  1PFN A;  1UAP A;  3QOL A;  3S16 B;  1TWF B;  2A1A A;  1N36 L;  4KHP Q;  3GTP H;  1DD2 A;  2MNA A;  4BBS G;  2VXW A;  1A2T A;  1AE3 A;  4DV1 L;  1Y8O B;  5C4J B;  3JAM E;  1CSP A;  1K83 H;  1K28 A;  5CV5 A;  1VQM A;  4P73 A;  2E75 C;  3GTL H;  3IKJ A;  4N8F A;  3I90 A;  4DK6 C;  3CU7 A;  1I94 Q;  2JA9 A;  2A68 D;  3KDF A;  4LFB Q;  1HH2 P;  1MI2 A;  2DNC A;  3FVQ A;  2YU9 H;  1PTO D;  4P72 A;  4X6A H;  2IL8 A;  3K8A A;  4X3S A;  5L37 A;  1KDA A;  2C9O A;  3KYH C;  2B39 A;  3GDE A;  4GOP A;  4DK0 A;  1HNW Q;  4A93 B;  5FLX L;  3H09 A;  1KIX A;  4L5S A;  4RH6 A;  3OPO A;  1CKM A;  4OIJ A;  5H1S E;  3I4M B;  5CBA E;  4OHJ A;  4RAU C;  5DLQ E;  1XTD A;  2FHT A;  3GTM H;  2PMZ E;  4KI0 A;  4GZY C;  4XYO A;  1SE4 A;  5EPK A;  4X62 L;  2ZJQ A;  1E2Z A;  1SYC A;  1FGU A;  2XRQ D;  1GHK A;  2GA4 B;  2WAC A;  1EEF D;  3NQT A;  2JA8 G;  5ELE A;  4DR4 Q;  4B3R Q;  4A3F H;  1Q86 C;  2AWN A;  3M3Y B;  4CHT B;  3GQB A;  5ELN A;  2N49 A;  3J81 j;  4KJO A;  1VQL A;  1SRO A;  2Q2T A;  3CQZ H;  1OO9 B;  1YHB A;  3J80 L;  2B2U A;  5IGE A;  4OL7 A;  2RVL A;  4ZRZ A;  3K7A B;  2O5I C;  2BA0 A;  3RZD H;  2FFK B;  5J22 A;  1B70 B;  3J7Z C;  4DR2 L;  4DV7 Q;  1SDF A;  2CFM A;  1OXV A;  3PIP A;  5K5P A;  4DXF A;  1ZXT A;  1HFN A;  2WB1 B;  1TWA B;  3EBE A;  1N34 L;  4YHH L;  4HR7 B;  2ID0 A;  1LT5 D;  3HKZ E;  3GTG H;  1AFP A;  1SND A;  2E2H H;  1CQV A;  3VR3 A;  2B63 B;  2UXC L;  2BE5 C;  2H5X A;  1XMO L;  2OTL A;  5M3F B;  3JC6 6;  2F3W A;  3C1E A;  2PI2 A;  2MUY A;  3S1Q H;  2K5N A;  5BR8 L;  3MEH A;  2EVB A;  4A3K H;  3I91 A;  4JVZ A;  3NUC A;  5HY6 A;  3KJO A;  1FNV A;  2RDH A;  4DPG A;  1R9T B;  1EEI D;  3KJP A;  4FF2 A;  3PIO 3;  4C3H B;  3OMC A;  2J7Z A;  2UUC Q;  3I70 A;  2G9H D;  4BY1 B;  3FPU B;  3PUV A;  4BBR B;  4A3D H;  2TMP A;  2Q2I A;  1EIH A;  3Q23 A;  3QO2 A;  1CKO A;  3TZU A;  4DUZ Q;  4KKS A;  4G7Z C;  1C9O A;  2K28 A;  4DNR B;  2OQ0 A;  1BBW A;  1K3B C;  2K33 A;  4ZKB B;  2I07 B;  1SMX A;  1E22 A;  1TS3 A;  3ICE A;  2VUM B;  1KXL A;  3DXJ C;  4R4O A;  1VMC A;  2I5H A;  1JB7 A;  4IOC A;  1WTQ A;  1U9R A;  4A3G G;  4PZ7 A;  4JG2 A;  1AH9 A;  1VQ4 A;  1QVC A;  5EBC A;  3CMA A;  1PTO B;  1CSQ A;  5KIX A;  1I3Q B;  4PZ8 A;  4RGN A;  2LKV A;  4LUO A;  1P16 A;  4QB4 A;  5I2X A;  5GQO A;  5IYD H;  5D14 A;  3AFP A;  5C4X H;  3CPW A;  2K50 A;  1XX8 A;  3BDL A;  1SRU A;  1PRT C;  1WJJ A;  1EYC A;  1C7Y A;  1H9S B;  2HCI A;  3HP3 A;  1KNA A;  1HNZ L;  2R93 G;  3RN5 A;  1KRT A;  3EA6 A;  2F0J A;  2KJX A;  3FHW A;  1VQ5 A;  4YCW A;  1ENA A;  2F4V Q;  4GNX C;  2B8G A;  1V1P A;  3KF6 A;  4ZCK A;  4LF9 Q;  1LTL A;  1PLF A;  1H9R A;  4KY7 A;  1JB3 A;  2K5H A;  1IHZ A;  1PA6 A;  1Z7T A;  2L4N A;  5M5W B;  3GO5 A;  2RQX A;  2WAQ B;  1SBB B;  2RA4 A;  4WFN 3;  3GTJ B;  2IX0 A;  2CW0 D;  3VYR A;  3STB C;  2NZO A;  5JEA J;  3RD4 A;  4LNQ A;  3GTP B;  5CV9 A;  2CWA A;  3TN2 A;  3EVQ A;  2EY6 A;  2I5M X;  2HIX A;  2MO1 A;  1KAW A;  4F88 A;  4NXM L;  3MXN B;  4LK1 C;  3VYU A;  3W5O A;  1F77 A;  4H0L C;  4ZUI A;  3HOU H;  4QQB X;  1G2T A;  1PHJ A;  3AU7 A;  1K83 B;  5C3X A;  5LMN L;  1V43 A;  1FJG L;  3JAM c;  3GTL B;  1CT1 D;  3I55 A;  1SE3 A;  1D1K A;  1DXM A;  4J15 A;  1CKN A;  2HHH L;  1LLR D;  2Z6B A;  4QUF A;  4A3L H;  2YU9 B;  2K6A A;  4HIO A;  4KTA A;  3QIA A;  2UU9 Q;  3SVM A;  3GTO H;  4TKO B;  4LF5 Q;  3RN2 A;  3W1B A;  4A93 G;  2BDN A;  1TVX A;  3VYS A;  5CBE E;  2EYL A;  2OEO A;  4EQN A;  4DV3 Q;  2VQF L;  3RZO H;  3I4M G;  2AHO B;  4OO1 G;  4CGY B;  1P8L A;  2PPB C;  1PFM A;  2LXK A;  3GTM B;  2CVR A;  5DM7 3;  3E5S A;  1FYC A;  4MNO A;  2CWP A;  4B9W A;  4R4T A;  5M5Y H;  4A3F B;  1G8Z D;  1SFO H;  4K14 A;  2ALY B;  2CQA A;  4AYB E;  4GLX A;  2B8F A;  1TY0 A;  1Z6H A;  1YNJ D;  1MIU A;  3ZJY C;  4ZUJ A;  4DXG A;  2FMM A;  4DV6 L;  2XTI A;  5AFW A;  3CQZ B;  3PSI A;  3HKS A;  1OXT A;  1I4G A;  2UUB L;  4LFC L;  3QOJ A;  5E7N A;  4XQJ A;  1TII D;  3A8K E;  3RZD B;  2VQE Q;  2PO4 A;  1PXU A;  4RA8 A;  2LMC B;  2Q8T A;  2Z9H A;  2IY5 B;  2WB1 G;  1WCM B;  2CQO A;  3KUP A;  3AFQ A;  4F7X A;  1QZG A;  4JI5 Q;  1HZ9 A;  4IFD G;  4DV0 L;  3UI2 A;  4DR1 L;  1IBL L;  3PIP 3;  3HFZ B;  1D1I A;  1U0L A;  1X6O A;  2B63 G;  4HJ9 A;  5M3F G;  2E2H B;  1HA5 A;  1X54 A;  1FNU A;  1FGB D;  4Y7N H;  2YTX A;  2F0S A;  4KV6 A;  3S1Q B;  3OOC A;  4DR5 L;  3MHB A;  4A3K B;  3DMU A;  1HR0 L;  4XQN A;  2R92 H;  4C3H G;  3EJI A;  3HOZ H;  4BBR G;  4PQX A;  5G3L F;  2KQ3 A;  5EPL A;  1STY A;  4ILW A;  4GNX A;  4A3D B;  1PTO F;  1XNR L;  4BXX G;  2MO0 A;  2BCO A;  2DGY A;  1NMF A;  1O7Y A;  1DYQ A;  1SNM A;  3NBH A;  1EYG A;  1M4V A;  4ZAI A;  1XJV A;  4B3M L;  5CYU A;  4X64 L;  1KTK A;  2E5L Q;  2IJ0 A;  3DEP A;  1EY0 A;  2WFW A;  1D5M C;  2IT1 A;  5IGB A;  5JJL A;  2PNH A;  2E8G A;  3J81 i;  2VUM G;  4JI0 Q;  2AUK A;  1IKM A;  3F2D A;  4RG1 A;  5LMU L;  5KND A;  4JYA L;  2XIW A;  1D7Q A;  1UE7 A;  3K5L A;  1OXX K;  2F0O A;  4X66 Q;  2WII B;  3LWU A;  1GUW A;  1GUG A;  4R8I A;  4A3I H;  4TRD A;  5LMN W;  4A3C H;  3M4Q A;  2OT2 A;  3C3L A;  5FO8 B;  2K5D A;  2FMC A;  3S1R H;  1U5K A;  2L5T A;  3KBG A;  3S15 H;  4HED A;  1VQG A;  1F9Q A;  4IUN A;  3OIP A;  2Z4H A;  2M9V A;  4K6D A;  5JPM C;  2A68 C;  4M1U B;  5I2Y A;  1IL8 A;  4DR7 Q;  1GOZ A;  3C46 A;  3CF5 A;  3Q0A A;  5C5M A;  3QJY A;  5IP9 G;  1ROD A;  4BS9 A;  1Q8I A;  4FXK C;  3NPP A;  1N9W A;  1XPR A;  1TWC H;  2K05 A;  4IOA A;  1J5E L;  2SDF A;  1HZB A;  4ME3 A;  1AW7 A;  2WAQ G;  1PFS A;  2JA6 H;  1BCP F;  4HJ8 A;  1NNX A;  1LV9 A;  1JCK B;  5EPJ A;  3CME A;  2KED A;  1STB A;  1X3P A;  3M4O H;  3HG9 A;  3BS1 A;  2UXB Q;  2QDL A;  5FK9 C;  2JA5 B;  4DN4 M;  2DJF C;  1F2M A;  3V2T A;  3ZYY X;  4DAV A;  3R3O A;  4C2M H;  1QIL A;  4HMJ A;  4KKT A;  1DON A;  3HOU B;  4ULL A;  2JA8 B;  2IHF A;  3I3C A;  2NZ1 D;  3BZC A;  1AEX A;  4QY7 A;  2CH4 W;  3ONA B;  3NTI A;  5I9P A;  3PQI A;  3CCQ A;  5JJK A;  4C3J H;  1VQ7 A;  2ZT9 C;  2K5W A;  1SMY C;  4L63 B;  1EQR A;  4JW0 A;  2A73 B;  3VDY A;  1XTC D;  4K2K A;  3GTO B;  2B2V C;  2F0D A;  3NEL A;  3TP7 A;  4LFA L;  5E3F A;  3D4W A;  5JVG 3;  2KHS A;  5E4W C;  2Q8I B;  3RZO B;  3JAM L;  3E6Z X;  3J7A 5;  2R7Z H;  1B50 A;  1PH2 A;  1HR0 W;  5IGD A;  1DOL A;  1B9N A;  4DV2 L;  4CJ0 B;  1ASY A;  1Y14 B;  2AMC B;  1LTS D;  4XIG S;  3UDI A;  1HUM A;  5DEH A;  1WTP A;  2A69 D;  4A3F G;  5D3I B;  1KD1 C;  3HOV H;  4AQY Q;  5M5Y B;  2Y0S E;  1WTV A;  2B2Y C;  1SFO B;  1PV4 A;  1LAB A;  1FR3 A;  2F0T A;  4KD3 A;  3K6O A;  2RDG A;  4DR6 Q;  3BG3 A;  4NDX A;  3UDF A;  3TS0 A;  2QF7 A;  3HOX H; 
#chains in the Genus database with same CATH homology
 4RGO S;  1JOQ A;  4FNF A;  3O13 A;  4XXE A;  1LT6 D;  4NP5 A;  3CRL C;  3K5N A;  1KDC A;  2ZXR A;  1O80 A;  3I73 A;  2XNA C;  3SE0 A;  5BN4 A;  1BOS A;  3VA5 A;  4CBV A;  4X3K A;  3A8I E;  1II3 A;  4MHE A;  1J8I A;  1ILQ A;  4Y7N B;  1B9M A;  2V4D A;  4AYB B;  3DWQ A;  2F0F A;  1BR9 A;  2NN6 I;  4RHS A;  1B2T A;  4RGT A;  4XYQ A;  3TP5 A;  3HOZ B;  1STA A;  1DM0 B;  2XVS A;  3A7A B;  3DWA A;  5JPN C;  4KY6 A;  5T1I A;  3LX0 A;  2EJF C;  4BWG B;  1JQY D;  5M9O A;  1SAP A;  1H9S A;  2R93 B;  1E2V A;  4OIK A;  2O4X A;  4HCS A;  3EQL C;  1GXD C;  1LT4 D;  4BA2 I;  1AZQ A;  2EXZ A;  4C1N K;  4C56 C;  2QIL A;  3DHQ A;  4QCL A;  3DUZ A;  5IOD A;  3S1R B;  5A35 A;  1H9K A;  5EQ0 A;  3S15 B;  2NB0 A;  2R61 A;  2B2V A;  3SK4 A;  2SNM A;  3MXN A;  4LAA A;  1LO5 D;  3FMC A;  4B08 A;  2QEJ C;  2EYO A;  3PMF A;  3M7G A;  2EJM A;  1PZK D;  1TWC B;  5ISR A;  2JA6 B;  5C5L A;  1X32 A;  1S5C D;  3M4O B;  3BVZ A;  3SHL A;  1F9S A;  4EQO A;  3M85 A;  1M8A A;  2QKI C;  3RLF A;  1MSG A;  2LY7 A;  3MXG A;  3MFY A;  2M2L A;  3SK5 A;  1YNJ C;  3K59 A;  5J39 A;  3G6J B;  2PNR C;  4IFD J;  2B2T A;  3K5O A;  3G7L A;  1UEA B;  5JAV A;  3BVG A;  2Q8R E;  3LNN A;  2AQ2 B;  2HDL A;  4C3J B;  3OSO A;  1FD7 D;  3VR2 A;  1SMY D;  1S4Z A;  2VNU D;  5E1F A;  1F2Z A;  1QNU A;  4RHR A;  2IX3 A;  2R7Z B;  2F3V A;  1RTO A;  1V8Q A;  1QJO A;  4K8I A;  5CV6 A;  2JXM B;  1ENF A;  2JEB I;  3HOV B;  2IW3 A;  1JR0 D;  4J8Q A;  2MHV A;  3J7A V;  1PRT F;  1O78 A;  2K1B A;  3HOX B;  3IL8 A;  1E2W A;  4IZ8 A;  2BDO A;  1HCZ A;  4FP5 D;  1BDO A;  4FF3 A;  5A2Q E;  3NTH A;  1NCV A;  2XWB B;  3DEO A;  3A54 A;  1LTI D;  4O1N A;  1CHP D;  2MGS A;  3EFX D;  1RKN A;  5NUC A;  4JK1 C;  2PQE A;  4CKE A;  1D6E C;  3GV3 A;  4XT1 B;  1E0B A;  1DZ1 A;  2Y0S B;  1Q1B A;  1HQM C;  4KY5 A;  1K8M A;  4UAI A;  3S1N B;  1EWH A;  2F4I A;  4JBW A;  1GHJ A;  3L9A X;  1EY8 A;  2K04 A;  2H4O A;  5CR3 A;  3R2T A;  3PUY A;  2SOB A;  4PV1 C;  3NP8 A;  3OWE B;  5COY A;  4IQZ A;  3QG1 A;  4L8J A;  4NMZ A;  4G7H C;  5LL6 X;  2L1B A;  5C44 B;  2F0L A;  5CMD A;  2XN9 C;  2F0P A;  4A3E B;  2A6E D;  3V96 A;  3TDQ A;  2AQ1 B;  4K5W A;  4XDX A;  1JWS D;  2A5H A;  4ZYS A;  1RCV D;  2X69 A;  1B53 A;  5LL6 S;  2RKS A;  2PYK A;  1QWY A;  1SNC A;  1YNN C;  2HDM A;  2PZU A;  3NXW A;  4J6H A;  4RCN A;  2JP1 A;  1EZ6 A;  2EYF A;  1C4Q A;  2F0V A;  5J1Z A;  3BDO A;  1A2U A;  1Y1V B;  3GV6 A;  1ENC A;  4CKB A;  3M4Y A;  4H44 C;  4TSS A;  2HQE A;  1JE4 A;  2A69 C;  1F9P A;  2EY1 A;  1MSH A;  4ZLT F;  3MTS A;  5TSS A;  2PZT A;  3J81 E;  2N55 A;  5KNB A;  4PNY A;  4F8M A;  1SJE D;  2KVM A;  2EYP A;  2EDG A;  1EZ8 A;  1G29 1;  4C3J G;  1WTW A;  3SXH A;  5IT9 E;  2JYO A;  4ZK9 B;  4WOR A;  1I6V C;  4C3I B;  3H6M A;  1EU3 A;  4K5V A;  5IIF A;  1A6X A;  1CI3 M;  3NHH A;  1QCB D;  1A15 A;  1EY4 A;  2K01 A;  1CZW A;  5KYL A;  4FXD A;  4G57 A;  3QB3 A;  4P2C B;  3TP6 A;  1CTM A;  4TQU S;  1NR4 A;  4WJW A;  3ND9 A;  1TR5 A;  2NTS A;  2PMZ B;  3C1F A;  3D3R A;  3K58 A;  2F03 A;  3GTG B;  3Q22 A;  3A7L A;  2M00 A;  3E0J A;  5DAU A;  1EU4 A;  5COR A;  1EQV A;  4RKL A;  4M8A A;  3ERQ A;  3ITP A;  2DY7 A;  1DJR D;  1Y8N B;  3S1M B;  1F2L A;  5FOB B;  1BQQ T;  3VYT A;  3MZ5 A;  2DY8 A;  5E4X A;  1KAB A;  4DA2 A;  1TS4 A;  2F0Q A;  1WTO A;  1GJX A;  5HGT A;  4L6T B;  5CV7 A;  1D2B A;  2E76 C;  1VF5 C;  2KEC A;  3HKZ B;  1OXS C;  1BXT A;  3BYY B;  1S5B D;  1Q3L A;  3PO2 B;  3D6W A;  3M7N A;  3U9S A;  1IYV A;  4KJN A;  4Q5V A;  5KYI A;  5KNC A;  4V19 0;  3AB9 A;  1TWH B;  1JIC A;  5BN3 A;  4OGQ C;  2FIN B;  3I4L A;  5C4X B;  5I6W A;  2DNE A;  4HMI A;  3U9O A;  1I6H B;  4FVM A;  1BO0 A;  1PFB A;  2PCF B;  1RF2 D;  3FPP A;  1TS5 A;  1FNW A;  2NBF A;  3K57 A;  2WKD A;  4ZQ3 A;  2EYH A;  1K8O A;  1O7Z A;  5JJZ A;  4K5X A;  1AP0 A;  2EPB A;  1STN A;  2D62 A;  1CFM A;  4EGV A;  2L0C A;  1D5X C;  2F0N A;  1R4P B;  3KLS X;  1SYF A;  2AUJ D;  1Y8P B;  3PUW A;  4Q0F A;  3FDT A;  2F0M A;  4PMC A;  2RBM A;  1KDB A;  1BBX C;  1BF4 A;  1STH A;  3T56 B;  1SYE A;  2NN6 H;  4A3B B;  1TKW B;  3RUZ A;  2CHB D;  1YNN D;  5EJW A;  1G6Z A;  2A74 C;  2TSS A;  1STE A;  2L55 A;  3K0Y A;  2L11 A;  3PO3 B;  2MJ8 A;  1A3U A;  5FO9 B;  1F2Y A;  2C5C A;  5F2D A;  1CQF A;  1JOK A;  1I4X A;  2G9D A;  5C6A A;  1V1O A;  3D8G A;  1G2S A;  1Q90 A;  4QUC A;  5BN5 A;  1GUN A;  3ND8 A;  2Z1C A;  1SNP A;  3HOY B;  4DU9 A;  1HUN A;  2NVY B;  4MN3 A;  1NR2 A;  5IGC A;  1CHQ D;  1PZJ D;  3NWT A;  2E2I B;  2D2C C;  4C3I G;  2N88 A;  3SR1 A;  1SYD A;  2O5J C;  4DGZ A;  3MFG A;  5C3E B;  1H9J A;  4KN7 C;  3TZD A;  1ET6 A;  4KKU A;  5LHY 1;  1L0X B;  1LT3 D;  2KUM A;  1SEB D;  1ONL A;  3TBI B;  2OXP A;  1LTB D;  4BY7 B;  1TWG B;  3H0G B;  4FXG C;  4C1N I;  1CK1 A;  2XRS D;  3HZX A;  2R92 B;  1VMP A;  4V0B A;  2RSN A;  1JWU D;  3TSS A;  2K5Q A;  1TT2 A;  4RGM A;  2B2U C;  2X6L A;  2R6G A;  1EOT A;  3MC0 B;  2OF1 A;  3KBX A;  1ZYR D;  5C4H A;  4KHV A;  3PV0 A;  3T53 B;  3GD7 A;  4WRD A;  4ABN A;  1PTO H;  2F0I A;  5IGF A;  1C8C A;  2KCC A;  2NVT B;  1KNE A;  2BOS A;  1LAC A;  5I6Y A;  2A6E C;  3R2I A;  4ZKC B;  4A3I B;  3SK6 A;  1U4R A;  5A2Q L;  5KEE A;  3CKI B;  4EVO A;  3H3V C;  4DAP A;  5EGT A;  2A6H C;  1SYB A;  1G91 A;  1TY2 A;  1MBY A;  3IAY A;  3URY A;  3VR5 A;  4ID6 A;  4K2L A;  3H91 A;  1ET9 A;  3A55 A;  1EFI D;  4U68 A;  1XXG A;  2XWJ B;  5ELF A;  1RTN A;  4IUQ A;  3T16 A;  2AQ3 B;  5D3D A;  5EKI A;  3S17 B;  3FEW X;  5JVH 3;  4E6I A;  4O42 A;  2F0U A;  1I4P A;  1EL0 A;  1HXY D;  4DF7 A;  1KLU D;  3MXP A;  3WOF A;  1IW7 D;  2F0H A;  3A56 A;  2B2Y A;  1WD1 A;  1TS2 A;  3MA2 B;  1NSN S;  5G3L D;  3MAQ A;  1PZI D;  2F0E A;  3RMH A;  3K5M A;  1B1Z A;  1ICW A;  2I46 A;  4MIU A;  1ML0 D;  4HAE A;  1W6J A;  5D65 A;  3C2P A;  5JEA H;  4C2M B;  1HPC A;  4K6L A;  1IYU A;  5CV4 A;  2DN8 A;  3W2D A;  5EKL A;  3J7Y W;  3NSW A;  4A3J B;  2HCC A;  3MWY W;  3NTK A;  1B3A A;  3OIQ A;  4PMB A;  2E2J B;  2NYZ D;  1IKL A;  4N9P A;  1CA5 A;  4BA1 I;  4RKB A;  3T51 B;  4RCO A;  1H9M A;  3HRZ C;  5K36 H;  1DOM A;  2VB2 X;  2KA7 A;  2LS0 1;  2J4X A;  2ZXP A;  5C0X H;  4IUV A;  1WTR A;  4ME5 A;  4DK1 A;  1MGS A;  3Q6S A;  3H94 A;  1XYI A;  1Q12 A;  3MVV A;  2LFN A;  1UUP A;  3I72 A;  3OWF A;  1Q1E A;  4A3M B;  4CJ2 C;  1GUO A;  4XTC S;  2AWO A;  3I4N B;  1BCP D;  3GP7 A;  1VF7 A;  3MXU A;  5DM6 3;  1DCZ A;  1CM9 A;  3X3M A;  3J81 L;  2RDF A;  1WTX A;  2KEE A;  2WV6 D;  3HS0 C;  5IT9 L;  1RD9 D;  3A8J E;  1EY7 A;  1SNO A;  4KD4 A;  4KHZ A;  4DNT B;  3T4A C;  1HA6 A;  4IUT A;  4HCE A;  4KK7 A;  1BNZ A;  1BUV T;  1T5X D;  4IAL A;  3D6C A;  4IN3 A;  4IUP A;  2IPK D;  2F0G A;  3KLR A;  1SNQ A;  4H7B A;  4HSV A;  2ICI A;  3KF8 A;  3KK7 A;  1S5F D;  1NUC A;  1UNS A;  5C0X I;  1J9O A;  4RWS C;  5FLX E;  3FKI B;  3IFT A;  2JEA I;  3ERO A;  3BDC A;  3NK9 A;  1A3V A;  1QOH A;  1SYG A;  4IUU A;  1AZP A;  4FYD A;  4EQP A;  1SJH D;  2J0T D;  4R8N A;  1U4P A;  1QNK A;  2HUG A;  2A6H D;  4XQQ A;  2FJ2 A;  4YIJ A;  3J80 E;  4G7O C;  1NAP A;  1T5E A;  4QIW B;  2NVQ B;  1SSO A;  1HTL D;  4DFA A;  3GTK B;  2Z4I A;  1VDZ A;  2KOL A;  3P20 A;  1BCP B;  1DOK A;  1CZG A;  3T13 A;  4FO2 A;  2NN6 G;  5KGU A;  2E2D C;  5T1G A;  5HUR A;  2EE1 A;  3R8B A;  1EWC A;  2EY2 A;  2D5D A;  3N6R A;  5C0X J;  3DWP A;  4X3U A;  3VA7 A;  3WDN A;  4ODG A;  2X6G A;  1F9R A;  1S5E D;  2EY5 A;  2KCN A;  2K7V A;  1STG A;  1HQR D;  3N52 A;  3NQI A;  1EY5 A;  4PMW A;  5C3W A;  3HOW B;  2QCP X;  3QWN A;  2MPM A;  3HGB A;  4N9T A;  1ZKO A;  4X3T A;  1SE2 A;  2K32 A;  3HEJ A;  2WIN B;  1U4M A;  5JOB A;  4I65 A;  2NWG A;  3NWS A;  1HRJ A;  2SEB D;  1I4H A;  2ENB A;  1ZYR C;  3SK8 A;  2XSC A;  1KLG D;  2EYJ A;  4NW2 A;  5ELB A;  2BE5 D;  1TQO A;  5I4D A;  4UDU C;  4FF4 A;  2R3Z A;  3CRK C;  5KRU A;  2NVX B;  3P7J A;  2F1M A;  1Y1W B;  3J7A F;  1HHV A;  5CC4 A;  4KN4 C;  4FF1 A;  1XWE A;  2JA7 B;  2IWH A;  1L0Y B;  1U4L A;  4HTH A;  1EIG A;  1EYA A;  4R9W A;  2PW5 A;  5EKK A;  5M3M B;  4LMQ D;  4XT3 B;  1GUS A;  2ZXO A;  3L3O C;  3Q24 A;  4NKL A;  4CKC A;  1JOR A;  4I7Z C;  3BZD B;  1Y69 U;  1EY6 A;  3I8Z A;  2YYZ A;  1R4Q B;  2NUC A;  1ESF A;  1D5Z C;  3D4R A;  3SDZ A;  2QDB A;  3PUZ A;  4CJ1 B;  2L9H A;  2H1E A;  2B2W C;  1IW7 C;  1JWM D;  4BBS B;  1PRT D;  2JE6 I;  1V1P B;  5M5X B;  4K8J A;  4LJZ C;  1PTO C;  1AN8 A;  4H13 C;  1PMR A;  5IOC A;  2NTT A;  5I9O A;  2BA1 A;  4F87 A;  1VCI A;  5C4Z A;  3CHB D;  4HSP A;  3VR4 A;  3AMU A;  3PUX A;  2PW7 A;  3TME A;  2EOT A;  3R93 A;  2VB3 X;  4OO1 H;  3D31 A;  1I4Q A;  1SXT A;  3P1H A;  1RDP D;  4DAY A;  1B44 D;  1HFG A;  2SNS A;  3OW7 A;  1I50 B;  3DM1 A;  1RJT A;  3OHX C;  5CGK A;  3S14 B;  2EZV A;  2EYM A;  4KMU C;  1LTT D;  5JEA G;  1CA6 A;  3BVM A;  3FRP B;  1GUT A;  2MP1 A;  2O2L D;  2IX1 A;  1ESR A;  4S3S A;  1OXU A;  1ZEQ X;  3VR6 A;  3OMG A;  1JC7 A;  1Z47 A;  3NBI A;  4IFD H;  3SEB A;  4B9X A;  2PZW A;  1LTR D;  1BCP C;  1LTG D;  1EQT A;  1WD0 A;  5EBD A;  1O7L A;  1MD2 D;  3S9W A;  3IFD A;  4IUR A;  5ELD A;  5K36 G;  3X3N A;  3L7Z C;  5FO7 B;  1WVL A;  2RSO A;  2WP8 J;  4Z9C B;  4J1M A;  1ILP A;  5C0X G;  1PYW D;  3D4D A;  4HN7 A;  4U67 3;  3NE5 B;  2B2T C;  1QB5 D;  2ICE C;  4OO1 I;  1X3Q A;  2D9U A;  1C48 A;  2E74 C;  5CV8 A;  3GTQ B;  1PRT B;  1EYD A;  1TU2 B;  1LTA D;  2EJG C;  2B2W A;  4A3G B;  3P75 A;  3LWE A;  5ELC A;  4G4K A;  3S2H B;  1S5D D;  1HTP A;  1A3T A;  4QF4 A;  2F0K A;  3W3A A;  4RFB A;  3V05 A;  1QE6 A;  1I4R A;  2L12 A;  1JOO A;  2WKC A;  3S2D B;  2Z8L A;  3WOE A;  3F2U A;  4IFD I;  1QG7 A;  1W6K A;  2F0W A;  5FKA C;  3BYT B;  5IGG A;  1EY9 A;  2CW0 C;  1RHP A;  2JSO A;  2K03 A;  1PDQ A;  4QMG A;  3KLS A;  1B4O A;  1KAA A;  5DNF A;  3TP8 A;  1PFN A;  1UAP A;  3QOL A;  3S16 B;  1TWF B;  1DD2 A;  2VXW A;  1A2T A;  1Y8O B;  5C4J B;  3JAM E;  5CV5 A;  2E75 C;  3IKJ A;  3I90 A;  3CU7 A;  2A68 D;  1MI2 A;  2DNC A;  3FVQ A;  1PTO D;  2IL8 A;  4X3S A;  1KDA A;  2C9O A;  2B39 A;  4DK0 A;  4A93 B;  5FLX L;  3H09 A;  4RH6 A;  3OPO A;  4OIJ A;  3I4M B;  5CBA E;  4OHJ A;  4RAU C;  2FHT A;  4KI0 A;  4GZY C;  4XYO A;  1SE4 A;  5EPK A;  1GHK A;  1E2Z A;  1SYC A;  2XRQ D;  2GA4 B;  2WAC A;  1EEF D;  3NQT A;  5ELE A;  2AWN A;  3M3Y B;  4CHT B;  3GQB A;  4KJO A;  1OO9 B;  3J80 L;  2B2U A;  5IGE A;  4OL7 A;  2RVL A;  4ZRZ A;  3K7A B;  2O5I C;  2BA0 A;  2FFK B;  5J22 A;  1SDF A;  1OXV A;  5K5P A;  4DXF A;  1ZXT A;  1HFN A;  2WB1 B;  1TWA B;  4HR7 B;  2ID0 A;  1LT5 D;  1AFP A;  1SND A;  1CQV A;  3VR3 A;  2B63 B;  2BE5 C;  5M3F B;  2F3W A;  3C1E A;  2MUY A;  3MEH A;  2EVB A;  3I91 A;  3NUC A;  1FNV A;  2RDH A;  1R9T B;  1EEI D;  4FF2 A;  3PIO 3;  4C3H B;  3OMC A;  2J7Z A;  3I70 A;  2G9H D;  4BY1 B;  3FPU B;  3PUV A;  4BBR B;  2TMP A;  1EIH A;  3Q23 A;  3QO2 A;  3TZU A;  4KKS A;  4G7Z C;  2K28 A;  4DNR B;  4ZKB B;  2K33 A;  2I07 B;  1TS3 A;  2VUM B;  3DXJ C;  1VMC A;  1WTQ A;  1U9R A;  5EBC A;  1PTO B;  5KIX A;  1I3Q B;  4RGN A;  2LKV A;  4QB4 A;  5I2X A;  5D14 A;  1XX8 A;  3BDL A;  1PRT C;  1EYC A;  1H9S B;  2HCI A;  3HP3 A;  1KNA A;  3EA6 A;  2F0J A;  2KJX A;  1ENA A;  2B8G A;  1V1P A;  1PLF A;  1H9R A;  4KY7 A;  1JB3 A;  1IHZ A;  1Z7T A;  2L4N A;  5M5W B;  3GO5 A;  2RQX A;  2WAQ B;  1SBB B;  2RA4 A;  4WFN 3;  3GTJ B;  2IX0 A;  2CW0 D;  3VYR A;  5JEA J;  3RD4 A;  3GTP B;  5CV9 A;  3TN2 A;  3EVQ A;  2EY6 A;  4F88 A;  4LK1 C;  3VYU A;  1G2T A;  1F77 A;  4H0L C;  4ZUI A;  3AU7 A;  1K83 B;  5C3X A;  1V43 A;  3GTL B;  1CT1 D;  1SE3 A;  1D1K A;  1DXM A;  1LLR D;  4QUF A;  2YU9 B;  2K6A A;  4KTA A;  3QIA A;  3SVM A;  4TKO B;  2BDN A;  1TVX A;  3VYS A;  5CBE E;  2EYL A;  2OEO A;  4EQN A;  4OO1 G;  4CGY B;  2PPB C;  1PFM A;  3GTM B;  2CVR A;  5DM7 3;  3E5S A;  1FYC A;  4B9W A;  4A3F B;  1G8Z D;  4K14 A;  2CQA A;  2B8F A;  1TY0 A;  1Z6H A;  1YNJ D;  4ZUJ A;  4DXG A;  2FMM A;  5AFW A;  3CQZ B;  1OXT A;  1I4G A;  3QOJ A;  4XQJ A;  1TII D;  3A8K E;  3RZD B;  2PO4 A;  1PXU A;  4RA8 A;  2LMC B;  2Q8T A;  1WCM B;  3KUP A;  4F7X A;  4IFD G;  3UI2 A;  3PIP 3;  1D1I A;  2E2H B;  1HA5 A;  1FNU A;  1FGB D;  2F0S A;  4KV6 A;  3S1Q B;  3OOC A;  3MHB A;  4A3K B;  3DMU A;  4XQN A;  4C3H G;  3EJI A;  4PQX A;  5G3L F;  2KQ3 A;  5EPL A;  1STY A;  4ILW A;  4A3D B;  1PTO F;  2BCO A;  1O7Y A;  1SNM A;  1DYQ A;  3NBH A;  1M4V A;  4ZAI A;  5CYU A;  1KTK A;  2IJ0 A;  3DEP A;  1EY0 A;  1D5M C;  2IT1 A;  5IGB A;  2AUK A;  1IKM A;  5KND A;  2XIW A;  3K5L A;  1OXX K;  2F0O A;  2WII B;  3LWU A;  1GUW A;  1GUG A;  4R8I A;  4TRD A;  2OT2 A;  3C3L A;  5FO8 B;  2K5D A;  2FMC A;  2L5T A;  3KBG A;  4HED A;  1F9Q A;  4IUN A;  3OIP A;  2Z4H A;  2M9V A;  4K6D A;  5JPM C;  2A68 C;  4M1U B;  5I2Y A;  1IL8 A;  1GOZ A;  3C46 A;  3Q0A A;  5C5M A;  3QJY A;  1ROD A;  4BS9 A;  1Q8I A;  4FXK C;  3NPP A;  2K05 A;  2SDF A;  1AW7 A;  1BCP F;  1LV9 A;  5EPJ A;  1JCK B;  2KED A;  1STB A;  1X3P A;  3HG9 A;  3BS1 A;  5FK9 C;  2JA5 B;  4DN4 M;  1F2M A;  3V2T A;  3ZYY X;  4DAV A;  3R3O A;  1QIL A;  4HMJ A;  4KKT A;  1DON A;  3HOU B;  4ULL A;  2JA8 B;  3I3C A;  2NZ1 D;  1AEX A;  3ONA B;  3NTI A;  5I9P A;  2ZT9 C;  2K5W A;  1SMY C;  4L63 B;  2A73 B;  1XTC D;  4K2K A;  3GTO B;  2B2V C;  2F0D A;  3TP7 A;  5E3F A;  3D4W A;  5JVG 3;  2KHS A;  5E4W C;  2Q8I B;  3RZO B;  3JAM L;  3E6Z X;  1B50 A;  5IGD A;  1DOL A;  1B9N A;  4CJ0 B;  1LTS D;  4XIG S;  1HUM A;  5DEH A;  1WTP A;  2A69 D;  5D3I B;  5M5Y B;  1WTV A;  2B2Y C;  1SFO B;  1LAB A;  1FR3 A;  2F0T A;  4KD3 A;  3K6O A;  2RDG A;  3BG3 A;  4NDX A;  2QF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...