3HP3A

Crystal structure of cxcl12
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
SLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords CXCL12 protein
publication title Heterologous quaternary structure of CXCL12 and its relationship to the CC chemokine family
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 64
sequence length 64
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3hp3A00
4OIJA 1B53A 4HCSA 1WD1A 5EPKA 1C8CA 4IUUA 2BDNA 2B2TA 5D14A 1X3QA 2X69A 1WTPA 1HHVA 2B2WC 3I3CA 1PFBA 2R3ZA 3N52A 2EE1A 2KECA 1ILPA 2B2UC 2B2VC 5CBAE 1WVLA 1HFNA 1ILQA 1AP0A 4IURA 2FFKB 5EJWA 1NAPA 3HP3A 1IKMA 2MJ8A 1TVXA 4XT1B 5T1GA 4NW2A 1NR2A 3TZDA 4ZKBB 5EQ0A 3GV3A 4IUPA 4CJ1B 2B2YC 3ONAB 2K01A 1SAPA 2FINB 2IL8A 3GV6A 1F2LA 1ZXTA 4QUCA 4OIKA 4IUQA 1RJTA 1IKLA 5AFWA 3QO2A 2HCIA 2DY7A 1G2TA 1HA6A 1Q3LA 2FHTA 1CM9A 3F2UA 1EOTA 4HEDA 1F9PA 1MGSA 1VMCA 2J7ZA 3I8ZA 1WTWA 1F9QA 1X32A 1WTRA 2N88A 1U4RA 2KEDA 3IL8A 4X3TA 2JYOA 1U4PA 3KUPA 2B2TC 1S4ZA 2MGSA 4UAIA 3G7LA 4X3SA 1HRJA 1O7YA 1G6ZA 1QG7A 4HAEA 1J8IA 1AZPA 2KVMA 2N55A 3MWYW 4ZLTF 5DNFA 3SVMA 4U68A 1KNAA 1QE6A 1A15A 4X3KA 1ESRA 1B4OA 2FMMA 1GUWA 2HDLA 1F9SA 1PLFA 2KEEA 2NZ1D 2VXWA 1PFNA 3DM1A 3Q6SA 2RSOA 1RHPA 2X6LA 5CMDA 1DOLA 1JE4A 1BF4A 3UI2A 5CORA 2HUGA 5EPLA 1NCVA 1X3PA 2B2WA 2HCCA 4XT3B 1XYIA 4HSVA 1BO0A 5JJZA 1XX8A 2RSNA 2B2UA 4LMQD 2Q8TA 2K03A 4MN3A 2K05A 2MP1A 4RA8A 4ZAIA 3TN2A 1AZQA 1EIGA 3LWEA 1ICWA 1U4LA 3DEOA 5EKIA 1RODA 1DONA 4ZK9B 4DN4M 1KNEA 4X3UA 1RTNA 5E4XA 1J9OA 1M8AA 2B2YA 1RTOA 3I90A 5CBEE 4R8IA 1DOKA 1EIHA 2K04A 2M2LA 4QUFA 2L9HA 1CA5A 1EL0A 1VMPA 1O80A 2KOLA 5EPJA 1PDQA 4MHEA 3MTSA 1DOMA 1LV9A 1MI2A 3FDTA 2L1BA 1E0BA 3FPUB 3I91A 4CJ0B 1WTQA 2H1EA 2K28A 1EQTA 4R9WA 2SDFA 2K1BA 3DEPA 3IFDA 1MSGA 4RAUC 5T1IA 2RA4A 1BNZA 4IUVA 2L11A 1PFMA 1G91A 2B2VA 4ZKCB 4O42A 1NR4A 5D65A 2D9UA 3P7JA 2MPMA 2X6GA 2JP1A 5COYA 1G2SA 2RVLA 1B50A 1O7ZA 1HUMA 1WTOA 1B2TA 3D6WA 1F9RA 2L12A 3H91A 2NWGA 1IL8A 2EPBA 2Q8RE 5E4WC 1HFGA 3R93A 4RWSC 1CA6A 1B3AA 1U4MA 2CVRA 2NYZD 2DY8A 3KBXA 1WTVA 1HUNA 2L4NA 4CJ2C 2KUMA 1SDFA 2XIWA 1DZ1A 1QNKA 2HDMA 1WTXA 2EOTA 4IUTA 1WD0A 1SSOA 4XDXA 1ML0D 1BBXC 2FJ2A 1JICA 1MSHA
chains in the Genus database with same CATH superfamily
2HIXA 1C7YA 2BDNA 5J22A 1NE3A 1N9WA 1X3QA 4YWMA 3OIQA 5CV5A 4DAYA 4ILWA 1BKBA 2NN6H 1VQ7A 2K7VA 3NTHA 5K5PA 2EJFC 3S16H 3S9WA 2K4KA 4DK0A 3BU2A 4QGUA 2MQHA 4DK3C 3HKSA 4GKKL 1DCZA 4CDEC 1OO9B 3A7AB 1O78A 3K7AH 4JCVE 1SN8A 4AYBB 2A73B 1CHPD 1CM9A 1TS3A 4A3EH 1XTCD 4ALPA 3TS2A 1XTDA 1F2ZA 3KOJA 2GA4B 3I8ZA 2N49A 2JA6H 5ELBA 1QVCA 2F0IA 3TS0A 2BA0A 4UAIA 3OWEB 1UE6A 1TY0A 1Y1VG 4LJZC 3IAYA 3HOUG 3TP7A 3S2HB 2NN6G 2CFMA 4H02A 3GTJB 2F0NA 3OMGA 3E9HA 1VQOA 4K0KQ 1AH9A 4A3CH 1Q1EA 1N8RC 2R7ZG 1XNQL 3FPPA 1FD7D 1KRSA 3EIVA 4N9TA 4NDXA 4RA8A 5CV6A 1SFOB 3CCJA 3MFGA 3SGIA 5IGBA 5IP7G 1J9OA 1PH4A 4B3SQ 2JA6G 5FKAC 5EPJA 4ZUIA 4EQOA 3Q23A 4DR2Q 1DOMA 3FHWA 5HGQA 2D62A 3FPUB 3A5ZB 2K6AA 3BYTB 1QUQB 2JA7B 2R7FA 2H1EA 1B44D 4FF1A 1TT2A 1B7YB 5C4XG 4CBVA 3FEWX 2WINB 2F0SA 4LW1A 5C0XG 3J7ZC 3FVQA 2L12A 1TWHH 2NWGA 3K0XA 3KJPA 1IL2A 1D8LA 3AEVA 3D4WA 5IOCA 1WCMB 1R9TB 1K3BC 2E2JB 1ML0D 5HGTA 2EVBA 3J81L 1VQLA 1E24A 2YU9H 2UU9Q 4YY3L 4JYAQ 3FKIH 4F7XA 1Y8NB 3I3CA 3P1HA 3I73A 1CHQD 4OXPA 4A93G 2IY5B 4BS9A 3J81E 1SMYD 1WVLA 2FFKB 1TVXA 1ASYA 2HIVA 3L7ZC 3TEHB 4X6AH 2LXJA 1F2LA 1BCPF 1H9RA 3HZXA 1XNRQ 4HJ7A 2IW3A 1CT1D 1HA6A 1A3VA 4RGNA 2MUYA 1M1KC 5I6YA 1GJXA 1EWCA 1IBLL 1SLJA 1U4RA 3T16A 5FLMH 3G7LA 1KHIA 4IALA 1QZGA 3HOXB 4QF4A 1QG7A 4HAEA 1QE6A 1CQFA 3CC7A 2OEOA 1TWGH 1OXVA 1PFNA 2RSOA 2X6LA 2JSOA 4L5RC 3UI2A 3PIO3 3M4YA 1C9OA 2A6HD 1N32L 1EWHA 4LF8L 2B2UA 3CCQA 3LWEA 5EKIA 2WB1B 1H9KA 5CR3A 1QILA 1EU3A 2F0TA 4MNOA 3IKJA 3CCSA 4IPHA 4JI0L 1O80A 2PZWA 1UNSA 5FO7B 2A6ED 1GO3E 2L1BA 3MEFA 5GADC 4DUZL 1SE2A 5M5WH 1JC7A 2I5MX 1UE7A 4NXMQ 3KK7A 5FLXL 1G91A 3L0OA 4DAVA 3S1QB 3HOYB 3GTGB 1W3SA 1SMYC 4EX5A 4B3ML 4A3MH 4XQQA 2F3WA 1VQPA 5IT9c 3GTOH 5C4JB 1EOVA 5FLXE 1B2TA 1HJPA 1PTOB 1JWUD 3CAMA 4GLXA 5C0XJ 5M3FH 1B9MA 1SR3A 2D0OA 2XIWA 2OQ0A 3MC0B 2AWOA 4Q5VA 2WIIB 3G4SA 3M4QA 2BE5D 1DGSA 5C3EH 4BY7G 1VF7A 3HG9A 2PQAA 2VL6A 5C44G 4HJ9A 4J1MA 3EVQA 3J7AF 1P16A 1D5MC 1PFBA 4A3GB 4A3DB 2JA8B 1PH7A 3MHBA 1BCPD 3HP3A 2JN4A 1X3EA 1JOOA 4AQYL 3S1RB 1K73C 3R8BA 1V1PA 2AKWB 1T9HA 2NBFA 5C4ZA 1F2MA 3M7NA 5IWAQ 2XTIA 1JQYD 3O13A 3S1NB 5M3FG 3UDGA 1KDAA 1G2TA 3CQZH 2L15A 1AW7A 1FGUA 3HKZB 1WTHA 5ELDA 1N33L 4IO9A 2VQEQ 1XNRL 4KHZA 2LSSA 1D1IA 4JI1L 1TWCB 5BN5A 1XXGA 3OOCA 4RH6A 3A7LA 2KHJA 3T1HL 1ESRA 5JJKA 5ISRA 4RMFA 4DV4Q 1STGA 2B63G 3DM1A 4JPBW 5KGUA 1ZYRC 4IFDJ 2A8VA 5JPMC 4GLVB 3QB3A 4KN7C 2A68C 3W5OA 4DV0L 4PMWA 1NUCA 4F88A 3NUCA 3H09A 4A3KB 1U4LA 4O1NA 2ES2A 4A3BG 1U5KA 3M4OB 1VQBA 4APVA 4X64L 4ZQ3A 1I50B 2B8FA 4DR1Q 5HY6A 1DOKA 5FJ8H 2XWJB 4KMUC 2AMCB 1XPUA 2IPKD 3F2DA 1CSQA 2ZTCA 1F77A 2BE5C 1UE5A 4R1JA 3PO2B 2IHFA 2K28A 3KLWA 4A3IH 4B9XA 3R2IA 1YITA 4LFBQ 5D65A 1LLRD 2D9UA 1BCPC 5COYA 3SR1A 5BN4A 2RVLA 1H9SA 3W1BA 3PF4A 5E4WC 1ZKOA 5J1ZA 5EBDA 2JEBI 4C3JH 1G6PA 5E3FA 3AU7A 2E2HH 5FJ8G 4OHJA 2RDGA 4XDXA 1A62A 2EJMA 2K5DA 1C8CA 1ENCA 2WAQG 4DV6Q 1PRTB 2YV5A 4R4IA 2E75C 2F0MA 2R3ZA 1EQQA 1ILQA 2F4VQ 1STEA 4C3HH 3U9OA 3GV3A 2D2CC 1SRUA 3WDNA 4DXFA 4JI7Q 4IZ8A 4TKOB 1RJTA 1IKLA 3HEJA 5KRUA 1YNXA 5I4DA 4C3JG 1TXYA 2SNSA 1LTTD 3CP0A 3CMEA 4O2DA 1YVCA 1YJ9A 2JYOA 4MZ9A 3RMHA 2B2TC 2F0FA 2SEBD 3T1YL 3S17H 4N9PA 2AHOB 3UDIA 2OCEA 3K7UC 1SYDA 4DV7L 2ZJRA 4GOPB 4LFAQ 4HIOA 1RHPA 4C3HG 1XMQQ 1JE4A 2XVSA 4DNTB 5CORA 1I3QH 1KDCA 1U9RA 4KD3A 2EYFA 2Q8TA 3C46A 4HCEA 1YEZA 2K05A 2E8GA 4J15A 2LKVA 4LUOA 3K57A 1EEID 1Q1BA 3K5OA 4AIMA 4AYBE 4PNYA 1VMPA 1Y1VB 3HOUB 3I4MH 1E1OA 1IXRA 1L0YB 2CQOA 3H3VI 4EQ5A 3FDTA 2V1CC 4TVAB 5I2YA 1BBWA 4CDDC 4YCWA 3TREA 1R4PB 2NVQB 1AE2A 5T1IA 1B8AA 2R7ZB 3J80L 5CC4A 3S2DH 4DR7L 2CWPA 1Y8OB 3NEMA 4TSSA 2EJGC 5JEAJ 3M3YB 4X66L 1XWEA 5M9OA 3J80E 1GUGA 3T13A 2EPBA 1IBKQ 2JA6B 3BDLA 4RGTA 5C5MA 5M3MH 2VUMG 3VR2A 3PO3G 1LT4D 4PMCA 2E76C 2G9HD 2MHVA 1SXTA 1E1TA 2UXBL 3SEBA 3I4MG 2F3IA 5M5YH 2CWAA 4OIJA 2UUBQ 1B53A 1SNCA 4EQPA 3ND9A 1B70B 3UE1A 4ME5A 2B2TA 2F0EA 3K8AA 1QB5D 4HR7B 2PI2E 5C4XB 5ELNA 1HHVA 2UXDL 1IBMQ 3GDEA 5T1GA 1TS4A 2RQXA 1I4QA 3BJUA 2V4DA 4RKBA 3I4NG 3D3RA 4N8FA 2EY2A 3I55A 1EY9A 3BDOA 5GROA 1RIPA 4K14A 1HZ9A 5M3MG 3CCVA 1EUJA 1Q3LA 2FHTA 2K5WA 2ZTDA 2J7ZA 3H3VC 1WTWA 2DN8A 4UY8C 2WKCA 4IOCA 4GKKQ 1AEXA 5G3LF 4A93B 3BDCA 1QUQA 1HPCA 5C6AA 1KNAA 3RLOA 1GXDC 1F9SA 2VXWA 1UEBA 1FR3A 2KCNA 1K9MC 5CMDA 1A0IA 2SNMA 3A74A 1H9SB 3NBHB 1XMOL 1LT6D 4XT3B 3A55A 4TQUS 1XX8A 2F0QA 1WI5A 5KNCA 2MP1A 1KD1C 1ET9A 1WFQA 3HOVG 3KJOA 1SE8A 4WORA 2YU9B 2KOLA 1XNQQ 4A3FG 1HR0L 3Q0AA 1LV9A 1EQVA 5CV7A 1PH6A 3NQTA 2QDLA 5LMNW 1PFSA 2NB0A 4R9WA 4FNFA 4BY1G 1KXLA 4OO1I 1V1OA 3CPWA 3KYHC 3W2DA 1EY8A 4OX9L 1PVOA 2KQ3A 4NKLA 1HNWL 2OXPA 2KA7A 3QG1A 3S1MH 4QCLA 3M7GA 3CC4A 1VQ6A 2EY6A 3MZ5A 5FLXc 1J5EL 1U4MA 2E2IH 2WB1E 1G51A 2E74C 3R3OA 5FOBB 1VQ4A 1EIFA 1D5ZC 2R92H 1JWMD 4DUYL 2JEAI 3GTKB 4L8JA 2WACA 5I9OA 3S14H 4B3TL 4DFAA 1SNDA 3N52A 1ZEQX 3D6CA 3I7FA 1AP0A 3BS1A 3X3MA 2DJGC 4HIDA 4GNXB 1VF5C 3CCUA 2FINB 2IL8A 2PNHA 1I5FA 4YY3Q 1MKHA 1IZ6A 1SE4A 4JI8L 2XWBB 2HCIA 3A5UA 4L63B 2Z0SA 4BY7B 1Q12A 5C44B 2EXDA 5M5WB 1YJNA 4M1UB 5IE8A 3G71A 1S5CD 3F2CA 2DGYA 2QA4A 1KQSA 2NVXB 3EN2A 1IBLQ 3AQQA 2Z4IA 2ZXRA 1S72A 5DM63 3JAME 1E22A 5M3FB 4O0AA 1WOCA 3D4DA 2K03A 4Q0FA 4ZAIA 4EGVA 2AQ2B 1FJGL 3GTMB 1SEBD 2F0DA 1GUNA 4DAMA 3F8TA 2N3SA 1TS2A 5C3EB 4B3RL 2UUAL 1X54A 3MFYA 4LUZA 2UUCL 4EVOA 1EIHA 2BA1A 1PYBA 3HKZE 3VR6A 2B3GA 1CTMA 5IYDH 2Z9HA 1N32Q 5IP9H 4LF8Q 1YHQA 3VR5A 2Q2UA 5C3WA 4RFBA 2B63B 2QF7A 2AQ1B 1Y1WH 3PUVA 2NVTH 1EQTA 1KC8C 2K1BA 1TWAH 2RCNA 4JI0Q 5LMNL 3D4RA 3E5SA 4JI2L 4IJLA 2MPMA 1STNA 1JT8A 2NUCA 2QILA 3CD6A 4A3BB 4A3EG 1SNPA 3CQZB 2OT2A 4DUZQ 5NUCA 3E6ZX 3SK8A 2KUMA 1SDFA 1YNJD 3H0GH 3V2TA 4KKSA 2EXZA 4PZ8A 5IYDG 4B3MQ 1IHZA 3BVGA 4YIJA 5IP9G 1WD1A 4IUUA 2BDOA 1WTPA 4A3CG 1Y1WG 2BCOA 4L5TA 4C3IH 4OWXB 4XQNA 5JJLA 4LWCA 2B2UC 2LFNA 3KFUA 3TZDA 1HCZA 1NR2A 3NHHA 4ODGA 3QOLA 3A0JA 1SYCA 3GTPB 4IUPA 5FO9B 2VB3X 3D0FA 3SHLA 5IGDA 2UXCL 3DWAA 4DR5Q 3P75A 2K5NA 2DY7A 3ER0A 3J7A5 4FXKC 4CHTB 4AQYQ 1V43A 2WAQB 4PZ6A 1WTRA 4KJOA 1XPOA 2GN5A 4JV5L 1D2BA 2RHQB 1NSNS 4HMIA 1AZPA 3VR3A 4BBSH 3PIP3 2OTJA 3W3AA 2N78A 3GTLH 3KF6B 4R8NA 4A75A 5LHY1 3NWTA 5IODA 1N33Q 3D31A 1E2VA 2B2WA 1YIJA 2PNRC 4JI1Q 4DV3L 2Q2TA 1XYIA 4HSVA 5IYCH 1EY4A 4C3JB 1OXSC 3T1HQ 3DEOA 2TSSA 4DN4M 1HZBA 4HSPA 1PH5A 4IPGA 1FYCA 5KYLA 3NTIA 1DJRD 2HQLA 3IRBA 4DV0Q 3FKIG 4TRDA 4DGZA 1NJIC 2KJXA 4DR6L 4C3HB 4X64Q 3E9IA 3K5MA 1CUKA 3I70A 3I72A 3PGZA 1JOQA 5BN3A 2Z6BA 1LYLA 2X6GA 2R93H 1STBA 3I56A 1EYCA 3G48A 3H15A 1HTLD 5CV4A 5FLMG 1GUTA 4WRDA 1RCVD 1CZWA 2BH2A 3S17B 5F2DA 2JJQA 2IX1A 1B9NA 1LT5D 4CGYB 2A69D 4K5WA 4DV5L 4NP5A 4IFDI 3MXNB 3RLFA 3K80C 2HHHL 4GOPA 1AE3A 4XQJA 1BDOA 4L5SA 5DAUA 1IKMA 2ZM6L 3NPPA 2QEJC 1I94L 1JOKA 1PZJD 4PV1C 3F2BA 2WKDA 3CXCA 1VQ5A 2O5IC 3K5LA 3M9BA 2VUMB 1DM0B 1TS5A 2PMZE 1CKOA 1CKNB 1VQCA 5AFWA 3PO3B 2Z8LA 2B29A 4LF7L 3F2UA 3I4MB 1UEAB 5FO8B 5D3DA 2SOBA 3GP7A 1D1KA 5M5XB 3RZOH 3CW2C 2QDBA 2N88A 1K8AC 2HD3A 1YBYA 4DR5L 4DV2L 3GQBA 4IPCA 1O7YA 1I6HB 1SJHD 3S2DB 2JK8A 1W2BA 1GUOA 2Q2IA 4A3MG 4BA1I 4IQZA 3DUZA 2IX3A 4JBKA 4LF9L 2XRQD 2A1AA 1EQRA 3I4NB 2A6HC 1BUVT 2F0PA 2O2LD 4GN3B 3T1YQ 1PH3A 1RL2A 1S5DD 5M3MB 1LTSD 2YTXA 4XXEA 1M4VA 1AZQA 3STBD 1OTCA 4EQNA 1ICWA 1YI2A 1XJVA 3K81C 4DV7Q 3I4LA 5IGFA 1BR9A 5C3EG 1NNXA 5M5YB 2B2YA 1RTOA 2F0JA 3T53B 1C0AA 5JAVA 1TIID 2D5DA 1XPRA 1EYDA 3L3OC 1C48A 2A6EC 1SFOH 4F87A 2E5LL 4G4KA 3RR5A 4LFCL 4P75A 4RKLA 3UDFA 4YWKA 2F03A 4LF4L 1YNND 2A69C 1EFID 4MIUA 1TQOA 2AQ3B 4ZUJA 4HJ5A 4FXGC 4IUVA 3I4OA 4C56C 2L11A 2K32A 1Y69U 1MHWC 3NXWA 1LTLA 3NK9A 3P7JA 2YTVA 3V05A 2PPBC 2Y0SG 2JA7H 3PUZA 3QJYA 3K5NA 1PV4A 4A3JH 2RKSA 3HOVB 2CH4W 1GM5A 3ZJYC 3OSOA 4DR3L 3KBXA 1ONLA 2EDGA 4A3FB 3UDXA 4ABNA 4DR7Q 2VY3A 2FXQA 3HGBA 1BBXC 5JVH3 2B8GA 4GN4B 3TP6A 4X66Q 3BZDB 4BY1B 3WWVA 2K5HA 2MFIA 1LTGD 1SNOA 1WCMH 1H95A 4C2MB 4HJ8A 3FP9A 5EJWA 4GNXC 3NBHA 1QJOA 4BA2I 4JI5L 4XYQA 1QVGA 2UXBQ 4GKJL 3ULJA 3HFZB 3U4ZA 2IHEA 4S3SA 2TMPA 4A3JG 3EBEA 1QNUA 2UXDQ 1BOSA 2KCCA 1V1QA 3STBC 2VZAA 1F2YA 2E2DC 3RN5A 1Y14B 1MBYA 1EY6A 3LWUA 1U4PA 4A3IG 4Y52H 1NBWA 3K0YA 2R61A 4KN4C 1GD7A 2HQEA 3S15H 1Z6HA 2J4XA 2HDLA 1N36L 1YNNC 1NMGA 4R4OA 2K5QA 4X62L 3H3VH 1IYJB 3HOXH 2ZXOA 3RZDB 1X3PA 3TP8A 4G7HC 3RNUA 5JPNC 2N8NA 1EY5A 3RD4A 2F0HA 2XRSD 4J6HA 3QWNA 3L2PA 1EZ6A 1X56A 1XMOQ 2OQKA 1K3RA 2H4OA 4A76A 3M85A 4DU9A 5DEHA 3BVZA 3QOJA 3VR4A 3EFXD 4XTCS 1HNXQ 4PG3A 2SDFA 1PH9A 4RAUC 3U50C 5C5LA 3ND8A 4YCUA 1VQ9A 1PH2A 4GNXA 4AH6A 1HR0Q 3EROA 1HR0W 2JA5H 1MD2D 1E7ZA 3S24A 3PCOB 1Q7YC 1STAA 4MTKA 2ASBA 3PSIA 3KF8B 1HFGA 1CA6A 1Y8PB 3HS0C 3HOYH 4LF6Q 3S16B 3DLLA 4OX9Q 2KCTA 4K5XA 5C4JH 2G9DA 1HNWQ 5D14A 1T5EA 1UWVA 1J5EQ 1E3PA 3H94A 1LTID 4DK1A 2F0OA 1JJ2A 1VQHA 1JORA 3K7AB 2B2VC 3TBIB 2O4XA 1A2TA 2PMZB 3ULPA 1BVSA 3SE0A 4OEMB 4A3EB 4FYDA 1HXYD 4FVMA 3GTQH 2VNUD 2JA5G 4DUYQ 4CJ1B 1SAPA 3OYYA 4B3TQ 4A3DH 4A3GH 3RLNA 3SK5A 1GHJA 4IUQA 3TRZA 2NZOA 3VYTA 2JA8H 4IOAA 5LL6X 3NTKA 4C1NI 1Z47A 2QKIC 1K8MA 2XNAC 4P73A 4Z9CB 2XGTA 5EGTA 2PZTA 3CCLA 2R7DA 3CC2A 5CV9A 2KENA 2EYOA 3KUPA 1Y1WB 1LACA 4X3SA 3UE0A 3VA5A 4DV1L 3S1NH 4CDCC 2CH4A 4P74A 4JI8Q 4WJ4A 1QWYA 3J81c 1PTOD 4X3KA 1GUWA 1VS0A 4JG2A 3MXGA 1FL0A 1S40A 3B6YA 1HQRD 1PLFA 3WOFA 2LXKA 1PHJA 4YHHL 3SK6A 5IT9L 2F0VA 1G8ZD 3KDFB 1L2FA 1UE1A 3VYUA 4HMJA 2AUJD 4JBJA 1BO0A 4LMQD 2F3VA 3KLSA 1EIGA 4OO1H 1SYGA 4KK7A 5IT9E 3E0EA 4HTHA 2F0LA 2PI2A 3I90A 3EJIA 1TWFH 2M2LA 1VCIA 1PRTF 1PDQA 2WAQE 1LTAD 3PIPA 5H1SE 3C3LA 4A3KH 3JC66 3OMCA 1FJGQ 2PO4A 1TWHB 4QB4A 4B3RQ 2UUAQ 4A3LH 2UUCQ 2I5LX 2B2VA 2ATWA 2G5DA 2RF4A 1QZHA 2VQFL 4JC0A 3MXPA 3PO2H 1HNXL 5E7NA 3G6JB 1GOZA 4OO1G 4RWSC 5J39A 3MA2B 1Q46A 3FKIB 1YHAA 5I2XA 4JI3L 5LMNQ 4JI2Q 1WD0A 4LF5L 4JOIA 3CRKC 1MSHA 1CZGA 2PYKA 1EY0A 4FF3A 3HOWH 2DNCA 1VQNA 4LF6L 2KECA 3KF6A 3MVVA 1PTOC 1X3GA 4DR4L 1NAPA 1K8OA 2Q2HA 4QQBX 5HURA 4ZKBB 4QIWE 1VQFA 3J81i 3ITPA 2EIFA 2OWOA 1QVFA 2K50A 2CKZB 3W1GA 3NELA 5BR8L 3NQIA 4KKUA 3BG3A 4X65L 3N6RA 1Q82C 4LNQA 1TWGB 2QEXA 3ULLA 1F9QA 2F0GA 1Q8KA 2EYMA 4R4CA 4P72A 4WJWA 4X3TA 5ELCA 4DAPA 2MGSA 1I6VC 3OW7A 5EKKA 2UXCQ 1S5BD 1KAAA 3HOWG 2GVAA 4U68A 3CHBD 4IUNA 1JE5A 1OXUA 1JJGA 5KYIA 2H5XA 4RGMA 4JV5Q 2Z4HA 3NENA 2I46A 3K58A 5IGCA 4OGQC 4BBRH 3RN2A 1S3OA 4UP8A 2R92G 1PRTD 2Z6KA 1RODA 3MAQA 4GS3A 3BVMA 2OF1A 1KNEA 5CBEE 3IFTA 3KBGA 1BCPB 1O7IA 4JI6L 3A54A 4QUFA 1CA5A 3BZKA 4DV3Q 4MHEA 1JB3A 5JOBA 3JAML 2ZJQA 4I65A 4A3MB 3MXNA 1X55A 4ZYSA 1N34L 3PQIA 3GTOB 1EEFD 5E1FA 1Q90A 1NTGA 1DD2A 1Y1VH 3T51B 3RUZA 3HOUH 5I9PA 4ZRZA 3V96A 1STYA 1HNZL 4RGOS 1NY4A 1A6XA 1CKNA 4BBRG 3NBIA 2NVQH 4DR6Q 3RZOB 2R7ZH 3CCEA 1W6JA 2DY8A 3U58A 2L4NA 4CJ2C 1DZ1A 1A3UA 2M00A 3EQLC 4QL5A 1WTXA 4OONA 3TQYA 1I4HA 2VB2X 3M3YH 4QY7A 2FJ2A 4O42A 5IP7H 1SMXA 4R4TA 4ZCKA 2JE6I 1Z9FA 4I7ZC 3EA6A 2X69A 2JQOA 2ICEC 2B2WC 1KLUD 1K83H 1HFNA 5ELOA 2Y0SB 5IYBH 5J3BA 1I4GA 3T56B 1D5XC 3A56A 3K59A 4DV5Q 2PW7A 5C4XH 1NMFA 2OTLA 1ZXTA 1L1OB 5A2QL 2HHHQ 5I6WA 1LTRD 5C0XH 1ICFB 1PRTC 2QW7A 2NN6I 3WOEA 2ZM6Q 4IPDA 4XIGS 3GO5A 1I94Q 5A2QE 4UHVA 1X32A 3IL8A 4ULLA 4DKAC 2VS1A 3Q24A 4KKTA 4OWTB 1KLGD 1J8IA 4K6LA 3PF5A 5DNFA 3J81j 4LF7Q 3SDZA 3CCMA 4P71A 4KTAA 3MXUA 3DXJC 4KI0A 4PZ7A 5D3IB 5IYBG 1D6EC 1DOLA 1PXUA 4A3JB 1A63A 4A93H 4DV2Q 1NCVA 4KY7A 2I5HA 2ZXPA 3QR8A 1A3TA 3H0GG 5LMUL 4NXNL 3C1FA 1OXXK 1YJWA 4POGA 1RTNA 1JR0D 5E4XA 4LF9Q 1PZKD 2CW0D 3DHQA 4A3IB 3G6EA 4K8JA 2EQSA 2K04A 1E2WA 2RCFA 4C3IG 4GOPC 3MTSA 3AFPA 1VQEA 4RCNA 4JI4L 4H7BA 1EU4A 4BWGB 1W6KA 5C0XI 2ZTEA 4KHPL 3VYRA 4CJ0B 5ELEA 3SXHA 2K52A 3IFDA 3NE5B 5DM73 1EIYB 4K8IA 2F4IA 3PUWA 1MJEA 1RDPD 4CDFC 2NVYH 4IFDH 2E2HB 2K33A 4JK1C 2E5LQ 1LTBD 4LFCQ 1EFWA 1LT3D 1YZ6A 5TSSA 4CKEA 4LF4Q 1RKNA 4ME3A 1F9RA 1IL8A 1TU2B 2ENBA 4P2CB 1HUNA 1YNJC 1WTVA 1HA5A 2KCMA 4NMZA 2EOTA 2WFWA 4XYOA 1I4XA 2PCFB 4BBSG 3S15B 1B3QA 2L5TA 4K2LA 5EAYA 2A5HA 2LY7A 1X6OA 4DR3Q 1SE3A 4QIWB 5GAGC 2EYLA 4CKBA 1ILPA 4KY6A 3T4AC 5IYCG 1X9NA 4LAAA 4B9WA 1I4RA 4XT1B 4IFDG 4KHVA 2L0CA 4YCVA 3GTKH 3J80c 3HOZH 2B2YC 3ONAB 4GLAC 4DF7A 3GV6A 2IWHA 3OPOA 1A2UA 4JBMA 4QUCA 1BBUA 3BYYB 3CF5A 2PW5A 3TP5A 2LS01 2YYZA 4HIKA 1STHA 4JI5Q 4GKJQ 4K0KL 2EZVA 2CW0C 4UDUC 1V9PA 1VQGA 1BXTA 1I3QB 1EY7A 2EY1A 4Y7NH 2KVMA 3SVMA 1WJJA 4DAYB 2F1MA 5A35A 4I7AA 4BY7H 2NZ1D 2JA5B 2R93G 2LMCB 4IJHA 5C44H 4G57A 1PH8A 4B3SL 1SYEA 1ZYRD 2HCCA 3HOZG 4WJ3M 1MIUA 4PMBA 2MNAA 5DLQE 4DR2L 2DJFC 2A68D 4R4QA 2C35B 2XSCA 3KF8A 1QOHA 3LNNA 1L0WA 1K8GA 1GHKA 2FMCA 1KAWA 3CRLC 1D7QA 4RCOA 1N36Q 2NVXH 5JVG3 4X62Q 1JWSD 2F52A 4DNIA 1KL9A 2I0QA 3GTMH 2PQEA 1S5FD 4V190 1YHBA 4H44C 2RDFA 3AB9A 1ENFA 3X3NA 1B1ZA 5C4HA 3GTQB 4L5QA 4YWLA 3CKIB 2KBNA 4QJFA 1VQ8A 1GKHA 1A8VA 3S2HH 3LX0A 1FVIA 2XN9C 3DWPA 5AJ3Q 3PV0A 3GTJH 1HTPA 3FMCA 1O7ZA 2B63H 1G291 3OTOQ 4PQXA 2UU9L 3R93A 3AFQA 4JYAL 2F0KA 3TSSA 2CVRA 1E2ZA 2ALYB 4IUTA 3J80i 5GAHC 1DYQA 1HZCA 4AYBG 2BOSA 4A3BH 2MO1A 3KLSX 4OL7A 4HCSA 5EPKA 2BH8A 4RHSA 2NTSA 2ICIA 4WFN3 1J6QA 1ENAA 5CBAE 2JA9A 1R4QB 1VQDA 3KDFA 2IX0A 1VQKA 3ERQA 1IYUA 3DMUA 3OWFA 5EBCA 5CV8A 3A8IE 1PYWD 5JEAH 4OELB 3AYHB 4FP5D 1EYAA 4KLKA 3U9SA 4GN5A 1CI3M 4ID6A 1TWFB 4BXXH 1F9PA 1VMCA 1GVPA 3GTPH 2ID0A 2RBMA 4JVZA 4NPSA 2J0TD 1HRJA 1R9TH 2E2JH 3GD7A 4GZYC 1SNMA 5KIXA 1B4OA 3M4PA 3SK4A 4FF2A 1IW7D 3U4VA 4B08A 4MTNA 4K5VA 2JA7G 4DPGA 3NSWA 1AN8A 4F8MA 1SYBA 1CKMA 4DV1Q 5JEAG 5JJZA 2F0WA 1PH1A 4MN3A 3TZUA 4J8QA 4DK6C 1X3FA 1Q86C 4BXXG 4R8IA 4NXML 4YHHQ 4FF4A 1ET6A 4L6TB 1EL0A 4RHRA 5IIFA 3HOWB 4DNRB 4DXGA 1MI2A 1WCMG 2AUKA 2I07B 1E0BA 4RG1A 3I91A 1SROA 3S1MB 1PTOF 3FRPB 4M8AA 2AWNA 1MSGA 1BNZA 2E2IB 1SBBB 3JAMc 1K0SA 2Q8IB 3URYA 1JB7A 2HT1A 1RD9D 3VA7A 1L0XB 3CCRA 2R92B 3Q22A 1SNQA 1JMCA 5GQOA 2YTYA 1TKWB 5AJ3L 3S14B 1P8LA 2HDMA 4H13C 1DXMA 1T5XD 2VQFQ 4N8X1 1CSPA 2ZJPA 3OTOL 1JICA 2GVBA 1X65A 2A74C 5IWAL 2O5JC 1KTKA 1FNWA 5GAEC 3HOXG 1WYDA 4KY5A 2MO0A 3D8GA 4IURA 1KRTA 4JI3Q 1V8QA 4LF5Q 2IJ0A 2F0UA 2MJ8A 3KLRA 4FDBA 1IW7C 4BBRB 2VQEL 1JCKB 5EQ0A 1L1OC 1U0LA 2K01A 1FGBD 4C1NK 3S1QH 3ERSX 3A8KE 4K2KA 3GTGH 2PZUA 4OIKA 3F1ZA 1C4QA 1SYFA 3E3XA 1EOTA 1Q8IA 4DV4L 2EY5A 4HEDA 4DR4Q 1PTOH 2WB1G 3DM3A 2KEDA 2VUMH 4NB3A 3PO3H 1H9MA 4A4IA 1G6ZA 2QGQA 3ZYYX 1JJCB 2PQAB 2N55A 3MWYW 4E6IA 2CHBD 4ZLTF 4G7ZC 1KIXA 1A15A 5BR8Q 1TY2A 1Z7TA 4UP9A 5M5XH 4X65Q 2KEEA 3Q6SA 3QIAA 1CK1A 4DR1L 1BF4A 4QMGA 2Y0SE 4HIMA 3MEHA 1I6HH 1V1PB 3HOYG 2IT1A 2WV6D 3S1RH 4JOIC 3TN2A 3H6MA 4LUVA 4UPAA 5EKLA 2EYJA 3OHXC 3JAMi 5ELFA 4X3UA 1BQQT 1M8AA 3I4NH 3K6OA 2NVTB 3ICEA 1K0RA 2RHSB 1TWAB 1K28A 2L9HA 1VQIA 4HN7A 4LFBL 2C9OA 1ESFA 4KV6A 1IYVA 1KDBA 1K83B 2P5ZX 3PUXA 1S5ED 1WTQA 3BZCA 1TWCH 3DEPA 4K6DA 4JI6Q 2RA4A 1PFMA 4A3DG 1KABA 4ZKCB 3J7YW 4A3GG 1NR4A 3H0GB 4IN3A 4FXDA 1LABA 2JA8G 4U673 2JP1A 1M90C 1G2SA 1HH2P 3DWQA 1L1OA 2KHSA 5FK9C 3D6WA 3H91A 5CGKA 4DV6L 3CMAA 1VQMA 2Q8RE 1N34Q 1CQVA 2NYZD 1LO5D 2NZHA 1QNKA 4C3IB 4OWWB 4JBWA 1HNZQ 1HQMC 1EWIA 2F4VL 1Q81C 3M4OH 1VQAA 3HKZG 1I50H 3HOVH 5JJIA 2K5VA 2RDHA 4JI7L 5KNBA 2KHIA 2M9VA 4A3FH 3C1EA 2EE1A 2QCPX 2DUDA 1UUPA 4G7OC 2K14A 3Q8DA 2Z6KC 4NW2A 3HRZC 4BY1H 1EZ8A 1LUZA 3PUYA 2Z1CA 2VW9A 5L37A 3QO2A 5IGEA 3TMEA 4C2MH 4BBSB 4A3KG 1MGSA 3GTLB 4H0LC 4LFAL 4JW0A 3OW2A 5CYUA 3C2PA 2ZT9C 1HZAA 4FO2A 3OIPA 1XMQL 3AMUA 1VQJA 1S4ZA 3CPFA 2D0PA 4A3LG 4DA2A 2CQAA 3A8JE 4KD4A 1FNUA 2CCZA 3I2ZA 4HJAA 2EYHA 3NWSA 1CFMA 1I4PA 2FMMA 3VYSA 1GUSA 2NVYB 3CU7A 1II3A 5KEEA 3PO2G 5IGGA 2NTTA 1ASZA 2EYPA 1PMRA 2HUGA 5EPLA 3LGJA 3NP8A 3PIOA 4KJNA 2RSNA 2C5CA 5LL6S 1O7LA 4V0BA 1EYGA 2K75A 1DONA 4ZK9B 5KNDA 3PMFA 1VDZA 5C3XA 1LM0A 1PZID 3RZDH 5K36H 1QCBD 3VDYA 1H9JA 2L55A 3P20A 2A19A 5LMUQ 4NXNQ 2R93B 1IBKL 1TR5A 2WP8J 4CKCA 3HOZB 3L9AX 2JXMB 1UAPA 1MJCA 1PYSB 2R6GA 4JI4Q 1AFPA 1B50A 1SJED 4LK1C 2UUBL 1PA6A 1HUMA 3E0JA 4UP7A 1FNVA 1WTOA 3J7AV 4POFA 4KHPQ 3TDQA 1OXTA 1B3AA 5IY0A 1IBML 1RF2D 3R2TA 1SSOA 5K36G 4Y7NB 2DNEA 5G3LD 2B39A
chains in the Genus database with same CATH topology
2BDNA 5J22A 1X3QA 3OIQA 5CV5A 4DAYA 4ILWA 2NN6H 2K7VA 3NTHA 5K5PA 2EJFC 3S9WA 4DK0A 1DCZA 1OO9B 3A7AB 1O78A 4AYBB 2A73B 1CHPD 1CM9A 1TS3A 1XTCD 1F2ZA 2GA4B 3I8ZA 5ELBA 2F0IA 2BA0A 4UAIA 3OWEB 1TY0A 4LJZC 3IAYA 3TP7A 3S2HB 2NN6G 3GTJB 2F0NA 3OMGA 1Q1EA 3FPPA 1FD7D 4N9TA 5CV6A 4NDXA 4RA8A 1SFOB 3MFGA 5IGBA 1J9OA 5FKAC 5EPJA 4ZUIA 4EQOA 3Q23A 1DOMA 2D62A 3FPUB 2K6AA 3BYTB 2JA7B 2H1EA 1B44D 4FF1A 1TT2A 4CBVA 3FEWX 2WINB 2F0SA 5C0XG 3FVQA 2L12A 2NWGA 3D4WA 5IOCA 1WCMB 1R9TB 2E2JB 1ML0D 5HGTA 2EVBA 3J81L 4F7XA 1Y8NB 3I3CA 3P1HA 3I73A 1CHQD 4BS9A 3J81E 1SMYD 1WVLA 2FFKB 1TVXA 3L7ZC 1F2LA 1BCPF 1H9RA 3HZXA 2IW3A 1CT1D 1HA6A 1A3VA 4RGNA 2MUYA 5I6YA 1GJXA 1EWCA 1U4RA 3T16A 3G7LA 4IALA 3HOXB 4QF4A 1QG7A 4HAEA 1QE6A 1CQFA 2OEOA 1OXVA 1PFNA 2RSOA 2X6LA 2JSOA 3UI2A 3PIO3 3M4YA 2A6HD 1EWHA 2B2UA 3LWEA 5EKIA 2WB1B 1H9KA 5CR3A 1QILA 1EU3A 2F0TA 3IKJA 1O80A 2PZWA 1UNSA 5FO7B 2A6ED 2L1BA 1SE2A 1JC7A 3KK7A 5FLXL 1G91A 4DAVA 3S1QB 3HOYB 3GTGB 1SMYC 4XQQA 2F3WA 1B2TA 5C4JB 5FLXE 1PTOB 1JWUD 5C0XJ 1B9MA 2XIWA 3MC0B 2AWOA 4Q5VA 2WIIB 2BE5D 1VF7A 3HG9A 4J1MA 3EVQA 3J7AF 1PFBA 1D5MC 4A3GB 4A3DB 2JA8B 3MHBA 1BCPD 3HP3A 1JOOA 3S1RB 3R8BA 1V1PA 2NBFA 5C4ZA 1F2MA 3M7NA 1JQYD 3O13A 3S1NB 1KDAA 1G2TA 1AW7A 3HKZB 5ELDA 4KHZA 1D1IA 1TWCB 5BN5A 1XXGA 3OOCA 4RH6A 3A7LA 1ESRA 5ISRA 1STGA 3DM1A 5KGUA 1ZYRC 4IFDJ 5JPMC 3QB3A 4KN7C 2A68C 4PMWA 1NUCA 4F88A 3NUCA 3H09A 4A3KB 1U4LA 4O1NA 3M4OB 4ZQ3A 1I50B 2B8FA 1DOKA 2XWJB 4KMUC 2IPKD 1F77A 2BE5C 3PO2B 2K28A 4B9XA 3R2IA 5D65A 1LLRD 2D9UA 1BCPC 5COYA 3SR1A 5BN4A 2RVLA 1H9SA 5E4WC 1ZKOA 5J1ZA 5EBDA 2JEBI 5E3FA 3AU7A 4OHJA 2RDGA 4XDXA 2EJMA 2K5DA 1C8CA 1ENCA 1PRTB 2E75C 2F0MA 2R3ZA 1ILQA 1STEA 3U9OA 3GV3A 2D2CC 3WDNA 4DXFA 4IZ8A 4TKOB 1RJTA 1IKLA 3HEJA 5KRUA 5I4DA 4C3JG 2SNSA 1LTTD 2JYOA 3RMHA 2B2TC 2F0FA 2SEBD 4N9PA 1SYDA 1RHPA 4C3HG 1JE4A 2XVSA 4DNTB 5CORA 1KDCA 1U9RA 4KD3A 2EYFA 2Q8TA 3C46A 4HCEA 2K05A 2LKVA 3K57A 1EEID 1Q1BA 3K5OA 4PNYA 1VMPA 1Y1VB 3HOUB 1L0YB 3FDTA 5I2YA 1R4PB 2NVQB 5T1IA 2R7ZB 3J80L 5CC4A 1Y8OB 4TSSA 2EJGC 5JEAJ 3M3YB 1XWEA 5M9OA 3J80E 1GUGA 3T13A 2EPBA 2JA6B 3BDLA 4RGTA 5C5MA 3VR2A 1LT4D 4PMCA 2E76C 2G9HD 2MHVA 1SXTA 3SEBA 4OIJA 1B53A 1SNCA 4EQPA 3ND9A 4ME5A 2B2TA 2F0EA 1QB5D 4HR7B 5C4XB 1HHVA 5T1GA 1TS4A 2RQXA 1I4QA 2V4DA 4RKBA 3D3RA 2EY2A 1EY9A 3BDOA 4K14A 1Q3LA 2FHTA 2K5WA 2J7ZA 3H3VC 1WTWA 2DN8A 2WKCA 1AEXA 5G3LF 4A93B 3BDCA 1HPCA 5C6AA 1KNAA 1GXDC 1F9SA 2VXWA 1FR3A 2KCNA 5CMDA 2SNMA 1H9SB 1LT6D 4XT3B 3A55A 4TQUS 1XX8A 2F0QA 5KNCA 2MP1A 1ET9A 4WORA 2YU9B 2KOLA 3Q0AA 1LV9A 1EQVA 5CV7A 3NQTA 2NB0A 4R9WA 4FNFA 4OO1I 1V1OA 3W2DA 1EY8A 2KQ3A 4NKLA 2OXPA 2KA7A 3QG1A 4QCLA 3M7GA 2EY6A 3MZ5A 1U4MA 3R3OA 2E74C 5FOBB 1D5ZC 1JWMD 2JEAI 3GTKB 4L8JA 2WACA 5I9OA 4DFAA 1SNDA 3N52A 1ZEQX 3D6CA 1AP0A 3BS1A 3X3MA 1VF5C 2FINB 2IL8A 1SE4A 2XWBB 2HCIA 4L63B 4BY7B 1Q12A 5C44B 5M5WB 4M1UB 1S5CD 2NVXB 2Z4IA 2ZXRA 5DM63 3JAME 5M3FB 3D4DA 2K03A 4Q0FA 4ZAIA 4EGVA 2AQ2B 3GTMB 1SEBD 2F0DA 1GUNA 1TS2A 5C3EB 3MFYA 4EVOA 1EIHA 2BA1A 3VR6A 1CTMA 3VR5A 5C3WA 4RFBA 2B63B 2QF7A 2AQ1B 3PUVA 1EQTA 2K1BA 3D4RA 3E5SA 2MPMA 1STNA 2NUCA 2QILA 4A3BB 1SNPA 3CQZB 2OT2A 5NUCA 3E6ZX 3SK8A 2KUMA 1SDFA 1YNJD 3V2TA 4KKSA 2EXZA 1IHZA 3BVGA 4YIJA 1WD1A 4IUUA 2BDOA 1WTPA 2BCOA 4XQNA 2B2UC 2LFNA 3TZDA 1HCZA 1NR2A 3NHHA 4ODGA 3QOLA 1SYCA 3GTPB 4IUPA 5FO9B 2VB3X 3SHLA 5IGDA 3DWAA 3P75A 2DY7A 4FXKC 4CHTB 1V43A 2WAQB 1WTRA 4KJOA 1D2BA 1NSNS 4HMIA 1AZPA 3VR3A 3PIP3 3W3AA 4R8NA 5LHY1 3NWTA 5IODA 3D31A 1E2VA 2B2WA 2PNRC 1XYIA 4HSVA 1EY4A 4C3JB 1OXSC 3DEOA 2TSSA 4DN4M 4HSPA 1FYCA 5KYLA 3NTIA 1DJRD 4TRDA 4DGZA 2KJXA 4C3HB 3K5MA 3I70A 3I72A 1JOQA 5BN3A 2X6GA 1STBA 1EYCA 1HTLD 5CV4A 1GUTA 4WRDA 1RCVD 1CZWA 3S17B 5F2DA 2IX1A 1B9NA 1LT5D 4CGYB 2A69D 4K5WA 4IFDI 4NP5A 3RLFA 4XQJA 1BDOA 5DAUA 1IKMA 3NPPA 2QEJC 1JOKA 1PZJD 4PV1C 2O5IC 2WKDA 3K5LA 2VUMB 1DM0B 1TS5A 3PO3B 5AFWA 2Z8LA 3F2UA 3I4MB 5FO8B 1UEAB 5D3DA 2SOBA 3GP7A 1D1KA 5M5XB 2QDBA 2N88A 3GQBA 1O7YA 1I6HB 1SJHD 3S2DB 1GUOA 4BA1I 4IQZA 3DUZA 2IX3A 2XRQD 3I4NB 2A6HC 1BUVT 2F0PA 2O2LD 1S5DD 5M3MB 1LTSD 4XXEA 1M4VA 1AZQA 4EQNA 1ICWA 3I4LA 5IGFA 1BR9A 5M5YB 2B2YA 1RTOA 2F0JA 3T53B 5JAVA 1TIID 2D5DA 1EYDA 1C48A 2A6EC 3L3OC 4F87A 4G4KA 4RKLA 2F03A 1YNND 2A69C 1EFID 4MIUA 1TQOA 2AQ3B 4ZUJA 4FXGC 4IUVA 4C56C 2L11A 2K32A 1Y69U 3NXWA 3NK9A 3P7JA 3V05A 2PPBC 3PUZA 3QJYA 3K5NA 3HOVB 2RKSA 3OSOA 3KBXA 1ONLA 2EDGA 4A3FB 4ABNA 3HGBA 1BBXC 5JVH3 2B8GA 3TP6A 3BZDB 4BY1B 1LTGD 1SNOA 4C2MB 5EJWA 3NBHA 1QJOA 4BA2I 4XYQA 4S3SA 2TMPA 1QNUA 1BOSA 2KCCA 1F2YA 2E2DC 1MBYA 1EY6A 3LWUA 1U4PA 3K0YA 2R61A 4KN4C 2HQEA 1Z6HA 2J4XA 2HDLA 1YNNC 2K5QA 2ZXOA 3RZDB 1X3PA 3TP8A 4G7HC 5JPNC 1EY5A 3RD4A 2F0HA 2XRSD 4J6HA 3QWNA 1EZ6A 2H4OA 3M85A 4DU9A 5DEHA 3BVZA 3QOJA 3VR4A 3EFXD 4XTCS 2SDFA 4RAUC 5C5LA 3ND8A 3EROA 1MD2D 1STAA 1HFGA 1CA6A 1Y8PB 3HS0C 3S16B 4K5XA 2G9DA 5D14A 1T5EA 3H94A 1LTID 4DK1A 2F0OA 1JORA 2B2VC 3K7AB 3TBIB 2O4XA 1A2TA 2PMZB 4FYDA 3SE0A 4A3EB 1HXYD 4FVMA 2VNUD 4CJ1B 1SAPA 3SK5A 1GHJA 4IUQA 3VYTA 5LL6X 3NTKA 4C1NI 1Z47A 2QKIC 1K8MA 2XNAC 4Z9CB 5EGTA 2PZTA 5CV9A 2EYOA 3KUPA 1Y1WB 1LACA 4X3SA 3VA5A 1QWYA 1PTOD 4X3KA 1GUWA 3MXGA 1HQRD 1PLFA 3WOFA 3SK6A 5IT9L 2F0VA 1G8ZD 3VYUA 4HMJA 2AUJD 1BO0A 4LMQD 2F3VA 3KLSA 1EIGA 4OO1H 1SYGA 4KK7A 5IT9E 4HTHA 2F0LA 3I90A 3EJIA 2M2LA 1VCIA 1PRTF 1PDQA 1LTAD 3C3LA 3OMCA 2PO4A 1TWHB 4QB4A 2B2VA 3MXPA 3G6JB 1GOZA 4OO1G 4RWSC 5J39A 3MA2B 3FKIB 5I2XA 1WD0A 3CRKC 1MSHA 1CZGA 2PYKA 1EY0A 4FF3A 2DNCA 2KECA 3MVVA 1PTOC 1NAPA 1K8OA 5HURA 4ZKBB 3ITPA 3NQIA 4KKUA 3BG3A 3N6RA 1TWGB 1F9QA 2F0GA 2EYMA 4X3TA 4WJWA 5ELCA 4DAPA 2MGSA 1I6VC 3OW7A 5EKKA 1S5BD 1KAAA 4U68A 3CHBD 4IUNA 1OXUA 5KYIA 4RGMA 2Z4HA 2I46A 3K58A 5IGCA 4OGQC 1PRTD 1RODA 3MAQA 3BVMA 2OF1A 5CBEE 1KNEA 3IFTA 3KBGA 1BCPB 3A54A 4QUFA 1CA5A 4MHEA 1JB3A 5JOBA 3JAML 4I65A 4A3MB 3MXNA 4ZYSA 3GTOB 1EEFD 5E1FA 1Q90A 1DD2A 3T51B 3RUZA 5I9PA 4ZRZA 3V96A 1STYA 4RGOS 1A6XA 3NBIA 3RZOB 1W6JA 2DY8A 2L4NA 4CJ2C 1DZ1A 1A3UA 2M00A 3EQLC 1WTXA 1I4HA 2VB2X 2FJ2A 4O42A 2JE6I 4I7ZC 3EA6A 2X69A 2ICEC 2B2WC 1KLUD 1HFNA 2Y0SB 3T56B 1I4GA 1D5XC 3A56A 3K59A 2PW7A 1ZXTA 5A2QL 5I6WA 1LTRD 5C0XH 1PRTC 2NN6I 3WOEA 4XIGS 3GO5A 5A2QE 1X32A 3IL8A 4ULLA 3Q24A 4KKTA 1J8IA 1KLGD 4K6LA 5DNFA 3SDZA 4KTAA 3MXUA 3DXJC 4KI0A 5D3IB 1D6EC 1DOLA 1PXUA 4A3JB 1NCVA 4KY7A 2ZXPA 1A3TA 3C1FA 1OXXK 1RTNA 1JR0D 5E4XA 1PZKD 2CW0D 3DHQA 4A3IB 4K8JA 2K04A 1E2WA 4C3IG 3MTSA 4RCNA 4H7BA 1EU4A 4BWGB 1W6KA 5C0XI 3VYRA 4CJ0B 5ELEA 3SXHA 3IFDA 3NE5B 5DM73 4K8IA 2F4IA 3PUWA 4IFDH 1RDPD 2E2HB 2K33A 4JK1C 1LTBD 1LT3D 5TSSA 4CKEA 1RKNA 1F9RA 1IL8A 1TU2B 2ENBA 4P2CB 1HUNA 1YNJC 1WTVA 1HA5A 4NMZA 2EOTA 4XYOA 1I4XA 2PCFB 3S15B 2L5TA 4K2LA 2A5HA 2LY7A 1SE3A 4QIWB 2EYLA 4CKBA 1ILPA 4KY6A 3T4AC 4LAAA 4B9WA 1I4RA 4XT1B 4IFDG 4KHVA 2L0CA 2B2YC 3ONAB 4DF7A 3GV6A 2IWHA 3OPOA 1A2UA 4QUCA 3BYYB 2PW5A 3TP5A 2LS01 2YYZA 1STHA 2EZVA 2CW0C 4UDUC 1BXTA 1I3QB 1EY7A 2EY1A 2KVMA 3SVMA 2F1MA 5A35A 2NZ1D 2JA5B 2LMCB 4G57A 1SYEA 1ZYRD 2HCCA 4PMBA 2A68D 2XSCA 3KF8A 1QOHA 3LNNA 1GHKA 2FMCA 3CRLC 4RCOA 5JVG3 1JWSD 2PQEA 1S5FD 4V190 4H44C 2RDFA 3AB9A 1ENFA 3X3NA 1B1ZA 5C4HA 3GTQB 3CKIB 3LX0A 2XN9C 3DWPA 3PV0A 1HTPA 3FMCA 1O7ZA 1G291 4PQXA 3R93A 2F0KA 3TSSA 2CVRA 1E2ZA 4IUTA 1DYQA 2BOSA 3KLSX 4OL7A 4HCSA 5EPKA 4RHSA 2NTSA 2ICIA 4WFN3 1ENAA 5CBAE 1R4QB 2IX0A 3ERQA 1IYUA 3DMUA 3OWFA 5EBCA 5CV8A 3A8IE 1PYWD 5JEAH 4FP5D 1EYAA 3U9SA 1CI3M 4ID6A 1TWFB 1F9PA 1VMCA 2ID0A 2RBMA 2J0TD 1HRJA 3GD7A 4GZYC 1SNMA 5KIXA 1B4OA 3SK4A 4FF2A 1IW7D 4B08A 4K5VA 3NSWA 1AN8A 4F8MA 1SYBA 5JEAG 5JJZA 2F0WA 4MN3A 3TZUA 4J8QA 4R8IA 4FF4A 1ET6A 4L6TB 1EL0A 4RHRA 5IIFA 3HOWB 4DNRB 4DXGA 1MI2A 2AUKA 2I07B 1E0BA 3I91A 3S1MB 1PTOF 3FRPB 4M8AA 2AWNA 1MSGA 1BNZA 2E2IB 1SBBB 2Q8IB 3URYA 1RD9D 3VA7A 1L0XB 2R92B 3Q22A 1SNQA 1TKWB 3S14B 2HDMA 4H13C 1DXMA 1T5XD 1JICA 2A74C 2O5JC 1KTKA 1FNWA 4KY5A 3D8GA 4IURA 1V8QA 2IJ0A 2F0UA 2MJ8A 3KLRA 1IW7C 4BBRB 1JCKB 5EQ0A 2K01A 1FGBD 4C1NK 3A8KE 4K2KA 2PZUA 4OIKA 1C4QA 1SYFA 1EOTA 1Q8IA 2EY5A 4HEDA 1PTOH 2KEDA 1H9MA 1G6ZA 3ZYYX 4E6IA 4G7ZC 2N55A 3MWYW 4ZLTF 2CHBD 1A15A 1TY2A 1Z7TA 2KEEA 3Q6SA 3QIAA 1CK1A 1BF4A 4QMGA 3MEHA 1V1PB 2IT1A 2WV6D 3TN2A 3H6MA 5EKLA 2EYJA 3OHXC 5ELFA 4X3UA 1BQQT 1M8AA 3K6OA 2NVTB 1TWAB 2L9HA 4HN7A 2C9OA 1ESFA 4KV6A 1IYVA 1KDBA 1K83B 3PUXA 1S5ED 1WTQA 3DEPA 4K6DA 2RA4A 1PFMA 1KABA 4ZKCB 3J7YW 1NR4A 3H0GB 4IN3A 4FXDA 1LABA 4U673 2JP1A 1G2SA 3DWQA 2KHSA 5FK9C 3D6WA 3H91A 5CGKA 2Q8RE 1CQVA 2NYZD 1LO5D 1QNKA 4C3IB 4JBWA 1HQMC 2RDHA 5KNBA 2M9VA 3C1EA 2EE1A 2QCPX 1UUPA 4G7OC 4NW2A 3HRZC 1EZ8A 3PUYA 2Z1CA 3QO2A 5IGEA 3TMEA 4BBSB 1MGSA 3GTLB 4H0LC 5CYUA 3C2PA 2ZT9C 4FO2A 3OIPA 3AMUA 1S4ZA 4DA2A 2CQAA 3A8JE 4KD4A 1FNUA 2EYHA 3NWSA 1CFMA 1I4PA 2FMMA 3VYSA 1GUSA 2NVYB 3CU7A 1II3A 5KEEA 5IGGA 2NTTA 2EYPA 1PMRA 2HUGA 5EPLA 3NP8A 4KJNA 2RSNA 2C5CA 5LL6S 1O7LA 4V0BA 1DONA 4ZK9B 5KNDA 3PMFA 1VDZA 5C3XA 1PZID 5K36H 1QCBD 1H9JA 2L55A 3P20A 2R93B 1TR5A 2WP8J 4CKCA 3HOZB 3L9AX 2JXMB 1UAPA 2R6GA 1AFPA 1B50A 1SJED 4LK1C 1HUMA 3E0JA 3J7AV 1FNVA 1WTOA 3TDQA 1OXTA 1B3AA 1RF2D 3R2TA 1SSOA 5K36G 4Y7NB 2DNEA 5G3LD 2B39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIJ A;  1B53 A;  4HCS A;  1WD1 A;  5EPK A;  1C8C A;  4IUU A;  2BDN A;  2B2T A;  5D14 A;  1X3Q A;  2X69 A;  1WTP A;  1HHV A;  2B2W C;  3I3C A;  1PFB A;  2R3Z A;  3N52 A;  2EE1 A;  2KEC A;  1ILP A;  2B2U C;  2B2V C;  5CBA E;  1WVL A;  1HFN A;  1ILQ A;  1AP0 A;  4IUR A;  2FFK B;  5EJW A;  1NAP A;  3HP3 A;  1IKM A;  2MJ8 A;  1TVX A;  4XT1 B;  5T1G A;  4NW2 A;  1NR2 A;  3TZD A;  4ZKB B;  5EQ0 A;  3GV3 A;  4IUP A;  4CJ1 B;  2B2Y C;  3ONA B;  2K01 A;  1SAP A;  2FIN B;  2IL8 A;  3GV6 A;  1F2L A;  1ZXT A;  4QUC A;  4OIK A;  4IUQ A;  1RJT A;  1IKL A;  5AFW A;  3QO2 A;  2HCI A;  2DY7 A;  1G2T A;  1HA6 A;  1Q3L A;  2FHT A;  1CM9 A;  3F2U A;  1EOT A;  4HED A;  1F9P A;  1MGS A;  1VMC A;  2J7Z A;  3I8Z A;  1WTW A;  1F9Q A;  1X32 A;  1WTR A;  2N88 A;  1U4R A;  2KED A;  3IL8 A;  4X3T A;  2JYO A;  1U4P A;  3KUP A;  2B2T C;  1S4Z A;  2MGS A;  4UAI A;  3G7L A;  4X3S A;  1HRJ A;  1O7Y A;  1G6Z A;  1QG7 A;  4HAE A;  1J8I A;  1AZP A;  2KVM A;  2N55 A;  3MWY W;  4ZLT F;  5DNF A;  3SVM A;  4U68 A;  1KNA A;  1QE6 A;  1A15 A;  4X3K A;  1ESR A;  1B4O A;  2FMM A;  1GUW A;  2HDL A;  1F9S A;  1PLF A;  2KEE A;  2NZ1 D;  2VXW A;  1PFN A;  3DM1 A;  3Q6S A;  2RSO A;  1RHP A;  2X6L A;  5CMD A;  1DOL A;  1JE4 A;  1BF4 A;  3UI2 A;  5COR A;  2HUG A;  5EPL A;  1NCV A;  1X3P A;  2B2W A;  2HCC A;  4XT3 B;  1XYI A;  4HSV A;  1BO0 A;  5JJZ A;  1XX8 A;  2RSN A;  2B2U A;  4LMQ D;  2Q8T A;  2K03 A;  4MN3 A;  2K05 A;  2MP1 A;  4RA8 A;  4ZAI A;  3TN2 A;  1AZQ A;  1EIG A;  3LWE A;  1ICW A;  1U4L A;  3DEO A;  5EKI A;  1ROD A;  1DON A;  4ZK9 B;  4DN4 M;  1KNE A;  4X3U A;  1RTN A;  5E4X A;  1J9O A;  1M8A A;  2B2Y A;  1RTO A;  3I90 A;  5CBE E;  4R8I A;  1DOK A;  1EIH A;  2K04 A;  2M2L A;  4QUF A;  2L9H A;  1CA5 A;  1EL0 A;  1VMP A;  1O80 A;  2KOL A;  5EPJ A;  1PDQ A;  4MHE A;  3MTS A;  1DOM A;  1LV9 A;  1MI2 A;  3FDT A;  2L1B A;  1E0B A;  3FPU B;  3I91 A;  4CJ0 B;  1WTQ A;  2H1E A;  2K28 A;  1EQT A;  4R9W A;  2SDF A;  2K1B A;  3DEP A;  3IFD A;  1MSG A;  4RAU C;  5T1I A;  2RA4 A;  1BNZ A;  4IUV A;  2L11 A;  1PFM A;  1G91 A;  2B2V A;  4ZKC B;  4O42 A;  1NR4 A;  5D65 A;  2D9U A;  3P7J A;  2MPM A;  2X6G A;  2JP1 A;  5COY A;  1G2S A;  2RVL A;  1B50 A;  1O7Z A;  1HUM A;  1WTO A;  1B2T A;  3D6W A;  1F9R A;  2L12 A;  3H91 A;  2NWG A;  1IL8 A;  2EPB A;  2Q8R E;  5E4W C;  1HFG A;  3R93 A;  4RWS C;  1CA6 A;  1B3A A;  1U4M A;  2CVR A;  2NYZ D;  2DY8 A;  3KBX A;  1WTV A;  1HUN A;  2L4N A;  4CJ2 C;  2KUM A;  1SDF A;  2XIW A;  1DZ1 A;  1QNK A;  2HDM A;  1WTX A;  2EOT A;  4IUT A;  1WD0 A;  1SSO A;  4XDX A;  1ML0 D;  1BBX C;  2FJ2 A;  1JIC A;  1MSH A; 
#chains in the Genus database with same CATH topology
 2HIX A;  1C7Y A;  2BDN A;  5J22 A;  1NE3 A;  1N9W A;  1X3Q A;  4YWM A;  3OIQ A;  5CV5 A;  4DAY A;  4ILW A;  1BKB A;  2NN6 H;  1VQ7 A;  2K7V A;  3NTH A;  5K5P A;  2EJF C;  3S16 H;  3S9W A;  2K4K A;  4DK0 A;  3BU2 A;  4QGU A;  2MQH A;  4DK3 C;  3HKS A;  4GKK L;  1DCZ A;  4CDE C;  1OO9 B;  3A7A B;  1O78 A;  3K7A H;  4JCV E;  1SN8 A;  4AYB B;  2A73 B;  1CHP D;  1CM9 A;  1TS3 A;  4A3E H;  1XTC D;  4ALP A;  3TS2 A;  1XTD A;  1F2Z A;  3KOJ A;  2GA4 B;  3I8Z A;  2N49 A;  2JA6 H;  5ELB A;  1QVC A;  2F0I A;  3TS0 A;  2BA0 A;  4UAI A;  3OWE B;  1UE6 A;  1TY0 A;  1Y1V G;  4LJZ C;  3IAY A;  3HOU G;  3TP7 A;  3S2H B;  2NN6 G;  2CFM A;  4H02 A;  3GTJ B;  2F0N A;  3OMG A;  3E9H A;  1VQO A;  4K0K Q;  1AH9 A;  4A3C H;  1Q1E A;  1N8R C;  2R7Z G;  1XNQ L;  3FPP A;  1FD7 D;  1KRS A;  3EIV A;  4N9T A;  4NDX A;  4RA8 A;  5CV6 A;  1SFO B;  3CCJ A;  3MFG A;  3SGI A;  5IGB A;  5IP7 G;  1J9O A;  1PH4 A;  4B3S Q;  2JA6 G;  5FKA C;  5EPJ A;  4ZUI A;  4EQO A;  3Q23 A;  4DR2 Q;  1DOM A;  3FHW A;  5HGQ A;  2D62 A;  3FPU B;  3A5Z B;  2K6A A;  3BYT B;  1QUQ B;  2JA7 B;  2R7F A;  2H1E A;  1B44 D;  4FF1 A;  1TT2 A;  1B7Y B;  5C4X G;  4CBV A;  3FEW X;  2WIN B;  2F0S A;  4LW1 A;  5C0X G;  3J7Z C;  3FVQ A;  2L12 A;  1TWH H;  2NWG A;  3K0X A;  3KJP A;  1IL2 A;  1D8L A;  3AEV A;  3D4W A;  5IOC A;  1WCM B;  1R9T B;  1K3B C;  2E2J B;  1ML0 D;  5HGT A;  2EVB A;  3J81 L;  1VQL A;  1E24 A;  2YU9 H;  2UU9 Q;  4YY3 L;  4JYA Q;  3FKI H;  4F7X A;  1Y8N B;  3I3C A;  3P1H A;  3I73 A;  1CHQ D;  4OXP A;  4A93 G;  2IY5 B;  4BS9 A;  3J81 E;  1SMY D;  1WVL A;  2FFK B;  1TVX A;  1ASY A;  2HIV A;  3L7Z C;  3TEH B;  4X6A H;  2LXJ A;  1F2L A;  1BCP F;  1H9R A;  3HZX A;  1XNR Q;  4HJ7 A;  2IW3 A;  1CT1 D;  1HA6 A;  1A3V A;  4RGN A;  2MUY A;  1M1K C;  5I6Y A;  1GJX A;  1EWC A;  1IBL L;  1SLJ A;  1U4R A;  3T16 A;  5FLM H;  3G7L A;  1KHI A;  4IAL A;  1QZG A;  3HOX B;  4QF4 A;  1QG7 A;  4HAE A;  1QE6 A;  1CQF A;  3CC7 A;  2OEO A;  1TWG H;  1OXV A;  1PFN A;  2RSO A;  2X6L A;  2JSO A;  4L5R C;  3UI2 A;  3PIO 3;  3M4Y A;  1C9O A;  2A6H D;  1N32 L;  1EWH A;  4LF8 L;  2B2U A;  3CCQ A;  3LWE A;  5EKI A;  2WB1 B;  1H9K A;  5CR3 A;  1QIL A;  1EU3 A;  2F0T A;  4MNO A;  3IKJ A;  3CCS A;  4IPH A;  4JI0 L;  1O80 A;  2PZW A;  1UNS A;  5FO7 B;  2A6E D;  1GO3 E;  2L1B A;  3MEF A;  5GAD C;  4DUZ L;  1SE2 A;  5M5W H;  1JC7 A;  2I5M X;  1UE7 A;  4NXM Q;  3KK7 A;  5FLX L;  1G91 A;  3L0O A;  4DAV A;  3S1Q B;  3HOY B;  3GTG B;  1W3S A;  1SMY C;  4EX5 A;  4B3M L;  4A3M H;  4XQQ A;  2F3W A;  1VQP A;  5IT9 c;  3GTO H;  5C4J B;  1EOV A;  5FLX E;  1B2T A;  1HJP A;  1PTO B;  1JWU D;  3CAM A;  4GLX A;  5C0X J;  5M3F H;  1B9M A;  1SR3 A;  2D0O A;  2XIW A;  2OQ0 A;  3MC0 B;  2AWO A;  4Q5V A;  2WII B;  3G4S A;  3M4Q A;  2BE5 D;  1DGS A;  5C3E H;  4BY7 G;  1VF7 A;  3HG9 A;  2PQA A;  2VL6 A;  5C44 G;  4HJ9 A;  4J1M A;  3EVQ A;  3J7A F;  1P16 A;  1D5M C;  1PFB A;  4A3G B;  4A3D B;  2JA8 B;  1PH7 A;  3MHB A;  1BCP D;  3HP3 A;  2JN4 A;  1X3E A;  1JOO A;  4AQY L;  3S1R B;  1K73 C;  3R8B A;  1V1P A;  2AKW B;  1T9H A;  2NBF A;  5C4Z A;  1F2M A;  3M7N A;  5IWA Q;  2XTI A;  1JQY D;  3O13 A;  3S1N B;  5M3F G;  3UDG A;  1KDA A;  1G2T A;  3CQZ H;  2L15 A;  1AW7 A;  1FGU A;  3HKZ B;  1WTH A;  5ELD A;  1N33 L;  4IO9 A;  2VQE Q;  1XNR L;  4KHZ A;  2LSS A;  1D1I A;  4JI1 L;  1TWC B;  5BN5 A;  1XXG A;  3OOC A;  4RH6 A;  3A7L A;  2KHJ A;  3T1H L;  1ESR A;  5JJK A;  5ISR A;  4RMF A;  4DV4 Q;  1STG A;  2B63 G;  3DM1 A;  4JPB W;  5KGU A;  1ZYR C;  4IFD J;  2A8V A;  5JPM C;  4GLV B;  3QB3 A;  4KN7 C;  2A68 C;  3W5O A;  4DV0 L;  4PMW A;  1NUC A;  4F88 A;  3NUC A;  3H09 A;  4A3K B;  1U4L A;  4O1N A;  2ES2 A;  4A3B G;  1U5K A;  3M4O B;  1VQB A;  4APV A;  4X64 L;  4ZQ3 A;  1I50 B;  2B8F A;  4DR1 Q;  5HY6 A;  1DOK A;  5FJ8 H;  2XWJ B;  4KMU C;  2AMC B;  1XPU A;  2IPK D;  3F2D A;  1CSQ A;  2ZTC A;  1F77 A;  2BE5 C;  1UE5 A;  4R1J A;  3PO2 B;  2IHF A;  2K28 A;  3KLW A;  4A3I H;  4B9X A;  3R2I A;  1YIT A;  4LFB Q;  5D65 A;  1LLR D;  2D9U A;  1BCP C;  5COY A;  3SR1 A;  5BN4 A;  2RVL A;  1H9S A;  3W1B A;  3PF4 A;  5E4W C;  1ZKO A;  5J1Z A;  5EBD A;  2JEB I;  4C3J H;  1G6P A;  5E3F A;  3AU7 A;  2E2H H;  5FJ8 G;  4OHJ A;  2RDG A;  4XDX A;  1A62 A;  2EJM A;  2K5D A;  1C8C A;  1ENC A;  2WAQ G;  4DV6 Q;  1PRT B;  2YV5 A;  4R4I A;  2E75 C;  2F0M A;  2R3Z A;  1EQQ A;  1ILQ A;  2F4V Q;  1STE A;  4C3H H;  3U9O A;  3GV3 A;  2D2C C;  1SRU A;  3WDN A;  4DXF A;  4JI7 Q;  4IZ8 A;  4TKO B;  1RJT A;  1IKL A;  3HEJ A;  5KRU A;  1YNX A;  5I4D A;  4C3J G;  1TXY A;  2SNS A;  1LTT D;  3CP0 A;  3CME A;  4O2D A;  1YVC A;  1YJ9 A;  2JYO A;  4MZ9 A;  3RMH A;  2B2T C;  2F0F A;  2SEB D;  3T1Y L;  3S17 H;  4N9P A;  2AHO B;  3UDI A;  2OCE A;  3K7U C;  1SYD A;  4DV7 L;  2ZJR A;  4GOP B;  4LFA Q;  4HIO A;  1RHP A;  4C3H G;  1XMQ Q;  1JE4 A;  2XVS A;  4DNT B;  5COR A;  1I3Q H;  1KDC A;  1U9R A;  4KD3 A;  2EYF A;  2Q8T A;  3C46 A;  4HCE A;  1YEZ A;  2K05 A;  2E8G A;  4J15 A;  2LKV A;  4LUO A;  3K57 A;  1EEI D;  1Q1B A;  3K5O A;  4AIM A;  4AYB E;  4PNY A;  1VMP A;  1Y1V B;  3HOU B;  3I4M H;  1E1O A;  1IXR A;  1L0Y B;  2CQO A;  3H3V I;  4EQ5 A;  3FDT A;  2V1C C;  4TVA B;  5I2Y A;  1BBW A;  4CDD C;  4YCW A;  3TRE A;  1R4P B;  2NVQ B;  1AE2 A;  5T1I A;  1B8A A;  2R7Z B;  3J80 L;  5CC4 A;  3S2D H;  4DR7 L;  2CWP A;  1Y8O B;  3NEM A;  4TSS A;  2EJG C;  5JEA J;  3M3Y B;  4X66 L;  1XWE A;  5M9O A;  3J80 E;  1GUG A;  3T13 A;  2EPB A;  1IBK Q;  2JA6 B;  3BDL A;  4RGT A;  5C5M A;  5M3M H;  2VUM G;  3VR2 A;  3PO3 G;  1LT4 D;  4PMC A;  2E76 C;  2G9H D;  2MHV A;  1SXT A;  1E1T A;  2UXB L;  3SEB A;  3I4M G;  2F3I A;  5M5Y H;  2CWA A;  4OIJ A;  2UUB Q;  1B53 A;  1SNC A;  4EQP A;  3ND9 A;  1B70 B;  3UE1 A;  4ME5 A;  2B2T A;  2F0E A;  3K8A A;  1QB5 D;  4HR7 B;  2PI2 E;  5C4X B;  5ELN A;  1HHV A;  2UXD L;  1IBM Q;  3GDE A;  5T1G A;  1TS4 A;  2RQX A;  1I4Q A;  3BJU A;  2V4D A;  4RKB A;  3I4N G;  3D3R A;  4N8F A;  2EY2 A;  3I55 A;  1EY9 A;  3BDO A;  5GRO A;  1RIP A;  4K14 A;  1HZ9 A;  5M3M G;  3CCV A;  1EUJ A;  1Q3L A;  2FHT A;  2K5W A;  2ZTD A;  2J7Z A;  3H3V C;  1WTW A;  2DN8 A;  4UY8 C;  2WKC A;  4IOC A;  4GKK Q;  1AEX A;  5G3L F;  4A93 B;  3BDC A;  1QUQ A;  1HPC A;  5C6A A;  1KNA A;  3RLO A;  1GXD C;  1F9S A;  2VXW A;  1UEB A;  1FR3 A;  2KCN A;  1K9M C;  5CMD A;  1A0I A;  2SNM A;  3A74 A;  1H9S B;  3NBH B;  1XMO L;  1LT6 D;  4XT3 B;  3A55 A;  4TQU S;  1XX8 A;  2F0Q A;  1WI5 A;  5KNC A;  2MP1 A;  1KD1 C;  1ET9 A;  1WFQ A;  3HOV G;  3KJO A;  1SE8 A;  4WOR A;  2YU9 B;  2KOL A;  1XNQ Q;  4A3F G;  1HR0 L;  3Q0A A;  1LV9 A;  1EQV A;  5CV7 A;  1PH6 A;  3NQT A;  2QDL A;  5LMN W;  1PFS A;  2NB0 A;  4R9W A;  4FNF A;  4BY1 G;  1KXL A;  4OO1 I;  1V1O A;  3CPW A;  3KYH C;  3W2D A;  1EY8 A;  4OX9 L;  1PVO A;  2KQ3 A;  4NKL A;  1HNW L;  2OXP A;  2KA7 A;  3QG1 A;  3S1M H;  4QCL A;  3M7G A;  3CC4 A;  1VQ6 A;  2EY6 A;  3MZ5 A;  5FLX c;  1J5E L;  1U4M A;  2E2I H;  2WB1 E;  1G51 A;  2E74 C;  3R3O A;  5FOB B;  1VQ4 A;  1EIF A;  1D5Z C;  2R92 H;  1JWM D;  4DUY L;  2JEA I;  3GTK B;  4L8J A;  2WAC A;  5I9O A;  3S14 H;  4B3T L;  4DFA A;  1SND A;  3N52 A;  1ZEQ X;  3D6C A;  3I7F A;  1AP0 A;  3BS1 A;  3X3M A;  2DJG C;  4HID A;  4GNX B;  1VF5 C;  3CCU A;  2FIN B;  2IL8 A;  2PNH A;  1I5F A;  4YY3 Q;  1MKH A;  1IZ6 A;  1SE4 A;  4JI8 L;  2XWB B;  2HCI A;  3A5U A;  4L63 B;  2Z0S A;  4BY7 B;  1Q12 A;  5C44 B;  2EXD A;  5M5W B;  1YJN A;  4M1U B;  5IE8 A;  3G71 A;  1S5C D;  3F2C A;  2DGY A;  2QA4 A;  1KQS A;  2NVX B;  3EN2 A;  1IBL Q;  3AQQ A;  2Z4I A;  2ZXR A;  1S72 A;  5DM6 3;  3JAM E;  1E22 A;  5M3F B;  4O0A A;  1WOC A;  3D4D A;  2K03 A;  4Q0F A;  4ZAI A;  4EGV A;  2AQ2 B;  1FJG L;  3GTM B;  1SEB D;  2F0D A;  1GUN A;  4DAM A;  3F8T A;  2N3S A;  1TS2 A;  5C3E B;  4B3R L;  2UUA L;  1X54 A;  3MFY A;  4LUZ A;  2UUC L;  4EVO A;  1EIH A;  2BA1 A;  1PYB A;  3HKZ E;  3VR6 A;  2B3G A;  1CTM A;  5IYD H;  2Z9H A;  1N32 Q;  5IP9 H;  4LF8 Q;  1YHQ A;  3VR5 A;  2Q2U A;  5C3W A;  4RFB A;  2B63 B;  2QF7 A;  2AQ1 B;  1Y1W H;  3PUV A;  2NVT H;  1EQT A;  1KC8 C;  2K1B A;  1TWA H;  2RCN A;  4JI0 Q;  5LMN L;  3D4R A;  3E5S A;  4JI2 L;  4IJL A;  2MPM A;  1STN A;  1JT8 A;  2NUC A;  2QIL A;  3CD6 A;  4A3B B;  4A3E G;  1SNP A;  3CQZ B;  2OT2 A;  4DUZ Q;  5NUC A;  3E6Z X;  3SK8 A;  2KUM A;  1SDF A;  1YNJ D;  3H0G H;  3V2T A;  4KKS A;  2EXZ A;  4PZ8 A;  5IYD G;  4B3M Q;  1IHZ A;  3BVG A;  4YIJ A;  5IP9 G;  1WD1 A;  4IUU A;  2BDO A;  1WTP A;  4A3C G;  1Y1W G;  2BCO A;  4L5T A;  4C3I H;  4OWX B;  4XQN A;  5JJL A;  4LWC A;  2B2U C;  2LFN A;  3KFU A;  3TZD A;  1HCZ A;  1NR2 A;  3NHH A;  4ODG A;  3QOL A;  3A0J A;  1SYC A;  3GTP B;  4IUP A;  5FO9 B;  2VB3 X;  3D0F A;  3SHL A;  5IGD A;  2UXC L;  3DWA A;  4DR5 Q;  3P75 A;  2K5N A;  2DY7 A;  3ER0 A;  3J7A 5;  4FXK C;  4CHT B;  4AQY Q;  1V43 A;  2WAQ B;  4PZ6 A;  1WTR A;  4KJO A;  1XPO A;  2GN5 A;  4JV5 L;  1D2B A;  2RHQ B;  1NSN S;  4HMI A;  1AZP A;  3VR3 A;  4BBS H;  3PIP 3;  2OTJ A;  3W3A A;  2N78 A;  3GTL H;  3KF6 B;  4R8N A;  4A75 A;  5LHY 1;  3NWT A;  5IOD A;  1N33 Q;  3D31 A;  1E2V A;  2B2W A;  1YIJ A;  2PNR C;  4JI1 Q;  4DV3 L;  2Q2T A;  1XYI A;  4HSV A;  5IYC H;  1EY4 A;  4C3J B;  1OXS C;  3T1H Q;  3DEO A;  2TSS A;  4DN4 M;  1HZB A;  4HSP A;  1PH5 A;  4IPG A;  1FYC A;  5KYL A;  3NTI A;  1DJR D;  2HQL A;  3IRB A;  4DV0 Q;  3FKI G;  4TRD A;  4DGZ A;  1NJI C;  2KJX A;  4DR6 L;  4C3H B;  4X64 Q;  3E9I A;  3K5M A;  1CUK A;  3I70 A;  3I72 A;  3PGZ A;  1JOQ A;  5BN3 A;  2Z6B A;  1LYL A;  2X6G A;  2R93 H;  1STB A;  3I56 A;  1EYC A;  3G48 A;  3H15 A;  1HTL D;  5CV4 A;  5FLM G;  1GUT A;  4WRD A;  1RCV D;  1CZW A;  2BH2 A;  3S17 B;  5F2D A;  2JJQ A;  2IX1 A;  1B9N A;  1LT5 D;  4CGY B;  2A69 D;  4K5W A;  4DV5 L;  4NP5 A;  4IFD I;  3MXN B;  3RLF A;  3K80 C;  2HHH L;  4GOP A;  1AE3 A;  4XQJ A;  1BDO A;  4L5S A;  5DAU A;  1IKM A;  2ZM6 L;  3NPP A;  2QEJ C;  1I94 L;  1JOK A;  1PZJ D;  4PV1 C;  3F2B A;  2WKD A;  3CXC A;  1VQ5 A;  2O5I C;  3K5L A;  3M9B A;  2VUM B;  1DM0 B;  1TS5 A;  2PMZ E;  1CKO A;  1CKN B;  1VQC A;  5AFW A;  3PO3 B;  2Z8L A;  2B29 A;  4LF7 L;  3F2U A;  3I4M B;  1UEA B;  5FO8 B;  5D3D A;  2SOB A;  3GP7 A;  1D1K A;  5M5X B;  3RZO H;  3CW2 C;  2QDB A;  2N88 A;  1K8A C;  2HD3 A;  1YBY A;  4DR5 L;  4DV2 L;  3GQB A;  4IPC A;  1O7Y A;  1I6H B;  1SJH D;  3S2D B;  2JK8 A;  1W2B A;  1GUO A;  2Q2I A;  4A3M G;  4BA1 I;  4IQZ A;  3DUZ A;  2IX3 A;  4JBK A;  4LF9 L;  2XRQ D;  2A1A A;  1EQR A;  3I4N B;  2A6H C;  1BUV T;  2F0P A;  2O2L D;  4GN3 B;  3T1Y Q;  1PH3 A;  1RL2 A;  1S5D D;  5M3M B;  1LTS D;  2YTX A;  4XXE A;  1M4V A;  1AZQ A;  3STB D;  1OTC A;  4EQN A;  1ICW A;  1YI2 A;  1XJV A;  3K81 C;  4DV7 Q;  3I4L A;  5IGF A;  1BR9 A;  5C3E G;  1NNX A;  5M5Y B;  2B2Y A;  1RTO A;  2F0J A;  3T53 B;  1C0A A;  5JAV A;  1TII D;  2D5D A;  1XPR A;  1EYD A;  3L3O C;  1C48 A;  2A6E C;  1SFO H;  4F87 A;  2E5L L;  4G4K A;  3RR5 A;  4LFC L;  4P75 A;  4RKL A;  3UDF A;  4YWK A;  2F03 A;  4LF4 L;  1YNN D;  2A69 C;  1EFI D;  4MIU A;  1TQO A;  2AQ3 B;  4ZUJ A;  4HJ5 A;  4FXG C;  4IUV A;  3I4O A;  4C56 C;  2L11 A;  2K32 A;  1Y69 U;  1MHW C;  3NXW A;  1LTL A;  3NK9 A;  3P7J A;  2YTV A;  3V05 A;  2PPB C;  2Y0S G;  2JA7 H;  3PUZ A;  3QJY A;  3K5N A;  1PV4 A;  4A3J H;  2RKS A;  3HOV B;  2CH4 W;  1GM5 A;  3ZJY C;  3OSO A;  4DR3 L;  3KBX A;  1ONL A;  2EDG A;  4A3F B;  3UDX A;  4ABN A;  4DR7 Q;  2VY3 A;  2FXQ A;  3HGB A;  1BBX C;  5JVH 3;  2B8G A;  4GN4 B;  3TP6 A;  4X66 Q;  3BZD B;  4BY1 B;  3WWV A;  2K5H A;  2MFI A;  1LTG D;  1SNO A;  1WCM H;  1H95 A;  4C2M B;  4HJ8 A;  3FP9 A;  5EJW A;  4GNX C;  3NBH A;  1QJO A;  4BA2 I;  4JI5 L;  4XYQ A;  1QVG A;  2UXB Q;  4GKJ L;  3ULJ A;  3HFZ B;  3U4Z A;  2IHE A;  4S3S A;  2TMP A;  4A3J G;  3EBE A;  1QNU A;  2UXD Q;  1BOS A;  2KCC A;  1V1Q A;  3STB C;  2VZA A;  1F2Y A;  2E2D C;  3RN5 A;  1Y14 B;  1MBY A;  1EY6 A;  3LWU A;  1U4P A;  4A3I G;  4Y52 H;  1NBW A;  3K0Y A;  2R61 A;  4KN4 C;  1GD7 A;  2HQE A;  3S15 H;  1Z6H A;  2J4X A;  2HDL A;  1N36 L;  1YNN C;  1NMG A;  4R4O A;  2K5Q A;  4X62 L;  3H3V H;  1IYJ B;  3HOX H;  2ZXO A;  3RZD B;  1X3P A;  3TP8 A;  4G7H C;  3RNU A;  5JPN C;  2N8N A;  1EY5 A;  3RD4 A;  2F0H A;  2XRS D;  4J6H A;  3QWN A;  3L2P A;  1EZ6 A;  1X56 A;  1XMO Q;  2OQK A;  1K3R A;  2H4O A;  4A76 A;  3M85 A;  4DU9 A;  5DEH A;  3BVZ A;  3QOJ A;  3VR4 A;  3EFX D;  4XTC S;  1HNX Q;  4PG3 A;  2SDF A;  1PH9 A;  4RAU C;  3U50 C;  5C5L A;  3ND8 A;  4YCU A;  1VQ9 A;  1PH2 A;  4GNX A;  4AH6 A;  1HR0 Q;  3ERO A;  1HR0 W;  2JA5 H;  1MD2 D;  1E7Z A;  3S24 A;  3PCO B;  1Q7Y C;  1STA A;  4MTK A;  2ASB A;  3PSI A;  3KF8 B;  1HFG A;  1CA6 A;  1Y8P B;  3HS0 C;  3HOY H;  4LF6 Q;  3S16 B;  3DLL A;  4OX9 Q;  2KCT A;  4K5X A;  5C4J H;  2G9D A;  1HNW Q;  5D14 A;  1T5E A;  1UWV A;  1J5E Q;  1E3P A;  3H94 A;  1LTI D;  4DK1 A;  2F0O A;  1JJ2 A;  1VQH A;  1JOR A;  3K7A B;  2B2V C;  3TBI B;  2O4X A;  1A2T A;  2PMZ B;  3ULP A;  1BVS A;  3SE0 A;  4OEM B;  4A3E B;  4FYD A;  1HXY D;  4FVM A;  3GTQ H;  2VNU D;  2JA5 G;  4DUY Q;  4CJ1 B;  1SAP A;  3OYY A;  4B3T Q;  4A3D H;  4A3G H;  3RLN A;  3SK5 A;  1GHJ A;  4IUQ A;  3TRZ A;  2NZO A;  3VYT A;  2JA8 H;  4IOA A;  5LL6 X;  3NTK A;  4C1N I;  1Z47 A;  2QKI C;  1K8M A;  2XNA C;  4P73 A;  4Z9C B;  2XGT A;  5EGT A;  2PZT A;  3CCL A;  2R7D A;  3CC2 A;  5CV9 A;  2KEN A;  2EYO A;  3KUP A;  1Y1W B;  1LAC A;  4X3S A;  3UE0 A;  3VA5 A;  4DV1 L;  3S1N H;  4CDC C;  2CH4 A;  4P74 A;  4JI8 Q;  4WJ4 A;  1QWY A;  3J81 c;  1PTO D;  4X3K A;  1GUW A;  1VS0 A;  4JG2 A;  3MXG A;  1FL0 A;  1S40 A;  3B6Y A;  1HQR D;  1PLF A;  3WOF A;  2LXK A;  1PHJ A;  4YHH L;  3SK6 A;  5IT9 L;  2F0V A;  1G8Z D;  3KDF B;  1L2F A;  1UE1 A;  3VYU A;  4HMJ A;  2AUJ D;  4JBJ A;  1BO0 A;  4LMQ D;  2F3V A;  3KLS A;  1EIG A;  4OO1 H;  1SYG A;  4KK7 A;  5IT9 E;  3E0E A;  4HTH A;  2F0L A;  2PI2 A;  3I90 A;  3EJI A;  1TWF H;  2M2L A;  1VCI A;  1PRT F;  1PDQ A;  2WAQ E;  1LTA D;  3PIP A;  5H1S E;  3C3L A;  4A3K H;  3JC6 6;  3OMC A;  1FJG Q;  2PO4 A;  1TWH B;  4QB4 A;  4B3R Q;  2UUA Q;  4A3L H;  2UUC Q;  2I5L X;  2B2V A;  2ATW A;  2G5D A;  2RF4 A;  1QZH A;  2VQF L;  4JC0 A;  3MXP A;  3PO2 H;  1HNX L;  5E7N A;  3G6J B;  1GOZ A;  4OO1 G;  4RWS C;  5J39 A;  3MA2 B;  1Q46 A;  3FKI B;  1YHA A;  5I2X A;  4JI3 L;  5LMN Q;  4JI2 Q;  1WD0 A;  4LF5 L;  4JOI A;  3CRK C;  1MSH A;  1CZG A;  2PYK A;  1EY0 A;  4FF3 A;  3HOW H;  2DNC A;  1VQN A;  4LF6 L;  2KEC A;  3KF6 A;  3MVV A;  1PTO C;  1X3G A;  4DR4 L;  1NAP A;  1K8O A;  2Q2H A;  4QQB X;  5HUR A;  4ZKB B;  4QIW E;  1VQF A;  3J81 i;  3ITP A;  2EIF A;  2OWO A;  1QVF A;  2K50 A;  2CKZ B;  3W1G A;  3NEL A;  5BR8 L;  3NQI A;  4KKU A;  3BG3 A;  4X65 L;  3N6R A;  1Q82 C;  4LNQ A;  1TWG B;  2QEX A;  3ULL A;  1F9Q A;  2F0G A;  1Q8K A;  2EYM A;  4R4C A;  4P72 A;  4WJW A;  4X3T A;  5ELC A;  4DAP A;  2MGS A;  1I6V C;  3OW7 A;  5EKK A;  2UXC Q;  1S5B D;  1KAA A;  3HOW G;  2GVA A;  4U68 A;  3CHB D;  4IUN A;  1JE5 A;  1OXU A;  1JJG A;  5KYI A;  2H5X A;  4RGM A;  4JV5 Q;  2Z4H A;  3NEN A;  2I46 A;  3K58 A;  5IGC A;  4OGQ C;  4BBR H;  3RN2 A;  1S3O A;  4UP8 A;  2R92 G;  1PRT D;  2Z6K A;  1ROD A;  3MAQ A;  4GS3 A;  3BVM A;  2OF1 A;  1KNE A;  5CBE E;  3IFT A;  3KBG A;  1BCP B;  1O7I A;  4JI6 L;  3A54 A;  4QUF A;  1CA5 A;  3BZK A;  4DV3 Q;  4MHE A;  1JB3 A;  5JOB A;  3JAM L;  2ZJQ A;  4I65 A;  4A3M B;  3MXN A;  1X55 A;  4ZYS A;  1N34 L;  3PQI A;  3GTO B;  1EEF D;  5E1F A;  1Q90 A;  1NTG A;  1DD2 A;  1Y1V H;  3T51 B;  3RUZ A;  3HOU H;  5I9P A;  4ZRZ A;  3V96 A;  1STY A;  1HNZ L;  4RGO S;  1NY4 A;  1A6X A;  1CKN A;  4BBR G;  3NBI A;  2NVQ H;  4DR6 Q;  3RZO B;  2R7Z H;  3CCE A;  1W6J A;  2DY8 A;  3U58 A;  2L4N A;  4CJ2 C;  1DZ1 A;  1A3U A;  2M00 A;  3EQL C;  4QL5 A;  1WTX A;  4OON A;  3TQY A;  1I4H A;  2VB2 X;  3M3Y H;  4QY7 A;  2FJ2 A;  4O42 A;  5IP7 H;  1SMX A;  4R4T A;  4ZCK A;  2JE6 I;  1Z9F A;  4I7Z C;  3EA6 A;  2X69 A;  2JQO A;  2ICE C;  2B2W C;  1KLU D;  1K83 H;  1HFN A;  5ELO A;  2Y0S B;  5IYB H;  5J3B A;  1I4G A;  3T56 B;  1D5X C;  3A56 A;  3K59 A;  4DV5 Q;  2PW7 A;  5C4X H;  1NMF A;  2OTL A;  1ZXT A;  1L1O B;  5A2Q L;  2HHH Q;  5I6W A;  1LTR D;  5C0X H;  1ICF B;  1PRT C;  2QW7 A;  2NN6 I;  3WOE A;  2ZM6 Q;  4IPD A;  4XIG S;  3GO5 A;  1I94 Q;  5A2Q E;  4UHV A;  1X32 A;  3IL8 A;  4ULL A;  4DKA C;  2VS1 A;  3Q24 A;  4KKT A;  4OWT B;  1KLG D;  1J8I A;  4K6L A;  3PF5 A;  5DNF A;  3J81 j;  4LF7 Q;  3SDZ A;  3CCM A;  4P71 A;  4KTA A;  3MXU A;  3DXJ C;  4KI0 A;  4PZ7 A;  5D3I B;  5IYB G;  1D6E C;  1DOL A;  1PXU A;  4A3J B;  1A63 A;  4A93 H;  4DV2 Q;  1NCV A;  4KY7 A;  2I5H A;  2ZXP A;  3QR8 A;  1A3T A;  3H0G G;  5LMU L;  4NXN L;  3C1F A;  1OXX K;  1YJW A;  4POG A;  1RTN A;  1JR0 D;  5E4X A;  4LF9 Q;  1PZK D;  2CW0 D;  3DHQ A;  4A3I B;  3G6E A;  4K8J A;  2EQS A;  2K04 A;  1E2W A;  2RCF A;  4C3I G;  4GOP C;  3MTS A;  3AFP A;  1VQE A;  4RCN A;  4JI4 L;  4H7B A;  1EU4 A;  4BWG B;  1W6K A;  5C0X I;  2ZTE A;  4KHP L;  3VYR A;  4CJ0 B;  5ELE A;  3SXH A;  2K52 A;  3IFD A;  3NE5 B;  5DM7 3;  1EIY B;  4K8I A;  2F4I A;  3PUW A;  1MJE A;  1RDP D;  4CDF C;  2NVY H;  4IFD H;  2E2H B;  2K33 A;  4JK1 C;  2E5L Q;  1LTB D;  4LFC Q;  1EFW A;  1LT3 D;  1YZ6 A;  5TSS A;  4CKE A;  4LF4 Q;  1RKN A;  4ME3 A;  1F9R A;  1IL8 A;  1TU2 B;  2ENB A;  4P2C B;  1HUN A;  1YNJ C;  1WTV A;  1HA5 A;  2KCM A;  4NMZ A;  2EOT A;  2WFW A;  4XYO A;  1I4X A;  2PCF B;  4BBS G;  3S15 B;  1B3Q A;  2L5T A;  4K2L A;  5EAY A;  2A5H A;  2LY7 A;  1X6O A;  4DR3 Q;  1SE3 A;  4QIW B;  5GAG C;  2EYL A;  4CKB A;  1ILP A;  4KY6 A;  3T4A C;  5IYC G;  1X9N A;  4LAA A;  4B9W A;  1I4R A;  4XT1 B;  4IFD G;  4KHV A;  2L0C A;  4YCV A;  3GTK H;  3J80 c;  3HOZ H;  2B2Y C;  3ONA B;  4GLA C;  4DF7 A;  3GV6 A;  2IWH A;  3OPO A;  1A2U A;  4JBM A;  4QUC A;  1BBU A;  3BYY B;  3CF5 A;  2PW5 A;  3TP5 A;  2LS0 1;  2YYZ A;  4HIK A;  1STH A;  4JI5 Q;  4GKJ Q;  4K0K L;  2EZV A;  2CW0 C;  4UDU C;  1V9P A;  1VQG A;  1BXT A;  1I3Q B;  1EY7 A;  2EY1 A;  4Y7N H;  2KVM A;  3SVM A;  1WJJ A;  4DAY B;  2F1M A;  5A35 A;  4I7A A;  4BY7 H;  2NZ1 D;  2JA5 B;  2R93 G;  2LMC B;  4IJH A;  5C44 H;  4G57 A;  1PH8 A;  4B3S L;  1SYE A;  1ZYR D;  2HCC A;  3HOZ G;  4WJ3 M;  1MIU A;  4PMB A;  2MNA A;  5DLQ E;  4DR2 L;  2DJF C;  2A68 D;  4R4Q A;  2C35 B;  2XSC A;  3KF8 A;  1QOH A;  3LNN A;  1L0W A;  1K8G A;  1GHK A;  2FMC A;  1KAW A;  3CRL C;  1D7Q A;  4RCO A;  1N36 Q;  2NVX H;  5JVG 3;  4X62 Q;  1JWS D;  2F52 A;  4DNI A;  1KL9 A;  2I0Q A;  3GTM H;  2PQE A;  1S5F D;  4V19 0;  1YHB A;  4H44 C;  2RDF A;  3AB9 A;  1ENF A;  3X3N A;  1B1Z A;  5C4H A;  3GTQ B;  4L5Q A;  4YWL A;  3CKI B;  2KBN A;  4QJF A;  1VQ8 A;  1GKH A;  1A8V A;  3S2H H;  3LX0 A;  1FVI A;  2XN9 C;  3DWP A;  5AJ3 Q;  3PV0 A;  3GTJ H;  1HTP A;  3FMC A;  1O7Z A;  2B63 H;  1G29 1;  3OTO Q;  4PQX A;  2UU9 L;  3R93 A;  3AFQ A;  4JYA L;  2F0K A;  3TSS A;  2CVR A;  1E2Z A;  2ALY B;  4IUT A;  3J80 i;  5GAH C;  1DYQ A;  1HZC A;  4AYB G;  2BOS A;  4A3B H;  2MO1 A;  3KLS X;  4OL7 A;  4HCS A;  5EPK A;  2BH8 A;  4RHS A;  2NTS A;  2ICI A;  4WFN 3;  1J6Q A;  1ENA A;  5CBA E;  2JA9 A;  1R4Q B;  1VQD A;  3KDF A;  2IX0 A;  1VQK A;  3ERQ A;  1IYU A;  3DMU A;  3OWF A;  5EBC A;  5CV8 A;  3A8I E;  1PYW D;  5JEA H;  4OEL B;  3AYH B;  4FP5 D;  1EYA A;  4KLK A;  3U9S A;  4GN5 A;  1CI3 M;  4ID6 A;  1TWF B;  4BXX H;  1F9P A;  1VMC A;  1GVP A;  3GTP H;  2ID0 A;  2RBM A;  4JVZ A;  4NPS A;  2J0T D;  1HRJ A;  1R9T H;  2E2J H;  3GD7 A;  4GZY C;  1SNM A;  5KIX A;  1B4O A;  3M4P A;  3SK4 A;  4FF2 A;  1IW7 D;  3U4V A;  4B08 A;  4MTN A;  4K5V A;  2JA7 G;  4DPG A;  3NSW A;  1AN8 A;  4F8M A;  1SYB A;  1CKM A;  4DV1 Q;  5JEA G;  5JJZ A;  2F0W A;  1PH1 A;  4MN3 A;  3TZU A;  4J8Q A;  4DK6 C;  1X3F A;  1Q86 C;  4BXX G;  4R8I A;  4NXM L;  4YHH Q;  4FF4 A;  1ET6 A;  4L6T B;  1EL0 A;  4RHR A;  5IIF A;  3HOW B;  4DNR B;  4DXG A;  1MI2 A;  1WCM G;  2AUK A;  2I07 B;  1E0B A;  4RG1 A;  3I91 A;  1SRO A;  3S1M B;  1PTO F;  3FRP B;  4M8A A;  2AWN A;  1MSG A;  1BNZ A;  2E2I B;  1SBB B;  3JAM c;  1K0S A;  2Q8I B;  3URY A;  1JB7 A;  2HT1 A;  1RD9 D;  3VA7 A;  1L0X B;  3CCR A;  2R92 B;  3Q22 A;  1SNQ A;  1JMC A;  5GQO A;  2YTY A;  1TKW B;  5AJ3 L;  3S14 B;  1P8L A;  2HDM A;  4H13 C;  1DXM A;  1T5X D;  2VQF Q;  4N8X 1;  1CSP A;  2ZJP A;  3OTO L;  1JIC A;  2GVB A;  1X65 A;  2A74 C;  5IWA L;  2O5J C;  1KTK A;  1FNW A;  5GAE C;  3HOX G;  1WYD A;  4KY5 A;  2MO0 A;  3D8G A;  4IUR A;  1KRT A;  4JI3 Q;  1V8Q A;  4LF5 Q;  2IJ0 A;  2F0U A;  2MJ8 A;  3KLR A;  4FDB A;  1IW7 C;  4BBR B;  2VQE L;  1JCK B;  5EQ0 A;  1L1O C;  1U0L A;  2K01 A;  1FGB D;  4C1N K;  3S1Q H;  3ERS X;  3A8K E;  4K2K A;  3GTG H;  2PZU A;  4OIK A;  3F1Z A;  1C4Q A;  1SYF A;  3E3X A;  1EOT A;  1Q8I A;  4DV4 L;  2EY5 A;  4HED A;  4DR4 Q;  1PTO H;  2WB1 G;  3DM3 A;  2KED A;  2VUM H;  4NB3 A;  3PO3 H;  1H9M A;  4A4I A;  1G6Z A;  2QGQ A;  3ZYY X;  1JJC B;  2PQA B;  2N55 A;  3MWY W;  4E6I A;  2CHB D;  4ZLT F;  4G7Z C;  1KIX A;  1A15 A;  5BR8 Q;  1TY2 A;  1Z7T A;  4UP9 A;  5M5X H;  4X65 Q;  2KEE A;  3Q6S A;  3QIA A;  1CK1 A;  4DR1 L;  1BF4 A;  4QMG A;  2Y0S E;  4HIM A;  3MEH A;  1I6H H;  1V1P B;  3HOY G;  2IT1 A;  2WV6 D;  3S1R H;  4JOI C;  3TN2 A;  3H6M A;  4LUV A;  4UPA A;  5EKL A;  2EYJ A;  3OHX C;  3JAM i;  5ELF A;  4X3U A;  1BQQ T;  1M8A A;  3I4N H;  3K6O A;  2NVT B;  3ICE A;  1K0R A;  2RHS B;  1TWA B;  1K28 A;  2L9H A;  1VQI A;  4HN7 A;  4LFB L;  2C9O A;  1ESF A;  4KV6 A;  1IYV A;  1KDB A;  1K83 B;  2P5Z X;  3PUX A;  1S5E D;  1WTQ A;  3BZC A;  1TWC H;  3DEP A;  4K6D A;  4JI6 Q;  2RA4 A;  1PFM A;  4A3D G;  1KAB A;  4ZKC B;  3J7Y W;  4A3G G;  1NR4 A;  3H0G B;  4IN3 A;  4FXD A;  1LAB A;  2JA8 G;  4U67 3;  2JP1 A;  1M90 C;  1G2S A;  1HH2 P;  3DWQ A;  1L1O A;  2KHS A;  5FK9 C;  3D6W A;  3H91 A;  5CGK A;  4DV6 L;  3CMA A;  1VQM A;  2Q8R E;  1N34 Q;  1CQV A;  2NYZ D;  1LO5 D;  2NZH A;  1QNK A;  4C3I B;  4OWW B;  4JBW A;  1HNZ Q;  1HQM C;  1EWI A;  2F4V L;  1Q81 C;  3M4O H;  1VQA A;  3HKZ G;  1I50 H;  3HOV H;  5JJI A;  2K5V A;  2RDH A;  4JI7 L;  5KNB A;  2KHI A;  2M9V A;  4A3F H;  3C1E A;  2EE1 A;  2QCP X;  2DUD A;  1UUP A;  4G7O C;  2K14 A;  3Q8D A;  2Z6K C;  4NW2 A;  3HRZ C;  4BY1 H;  1EZ8 A;  1LUZ A;  3PUY A;  2Z1C A;  2VW9 A;  5L37 A;  3QO2 A;  5IGE A;  3TME A;  4C2M H;  4BBS B;  4A3K G;  1MGS A;  3GTL B;  4H0L C;  4LFA L;  4JW0 A;  3OW2 A;  5CYU A;  3C2P A;  2ZT9 C;  1HZA A;  4FO2 A;  3OIP A;  1XMQ L;  3AMU A;  1VQJ A;  1S4Z A;  3CPF A;  2D0P A;  4A3L G;  4DA2 A;  2CQA A;  3A8J E;  4KD4 A;  1FNU A;  2CCZ A;  3I2Z A;  4HJA A;  2EYH A;  3NWS A;  1CFM A;  1I4P A;  2FMM A;  3VYS A;  1GUS A;  2NVY B;  3CU7 A;  1II3 A;  5KEE A;  3PO2 G;  5IGG A;  2NTT A;  1ASZ A;  2EYP A;  1PMR A;  2HUG A;  5EPL A;  3LGJ A;  3NP8 A;  3PIO A;  4KJN A;  2RSN A;  2C5C A;  5LL6 S;  1O7L A;  4V0B A;  1EYG A;  2K75 A;  1DON A;  4ZK9 B;  5KND A;  3PMF A;  1VDZ A;  5C3X A;  1LM0 A;  1PZI D;  3RZD H;  5K36 H;  1QCB D;  3VDY A;  1H9J A;  2L55 A;  3P20 A;  2A19 A;  5LMU Q;  4NXN Q;  2R93 B;  1IBK L;  1TR5 A;  2WP8 J;  4CKC A;  3HOZ B;  3L9A X;  2JXM B;  1UAP A;  1MJC A;  1PYS B;  2R6G A;  4JI4 Q;  1AFP A;  1B50 A;  1SJE D;  4LK1 C;  2UUB L;  1PA6 A;  1HUM A;  3E0J A;  4UP7 A;  1FNV A;  1WTO A;  3J7A V;  4POF A;  4KHP Q;  3TDQ A;  1OXT A;  1B3A A;  5IY0 A;  1IBM L;  1RF2 D;  3R2T A;  1SSO A;  5K36 G;  4Y7N B;  2DNE A;  5G3L D;  2B39 A; 
#chains in the Genus database with same CATH homology
 2BDN A;  5J22 A;  1X3Q A;  3OIQ A;  5CV5 A;  4DAY A;  4ILW A;  2NN6 H;  2K7V A;  3NTH A;  5K5P A;  2EJF C;  3S9W A;  4DK0 A;  1DCZ A;  1OO9 B;  3A7A B;  1O78 A;  4AYB B;  2A73 B;  1CHP D;  1CM9 A;  1TS3 A;  1XTC D;  1F2Z A;  2GA4 B;  3I8Z A;  5ELB A;  2F0I A;  2BA0 A;  4UAI A;  3OWE B;  1TY0 A;  4LJZ C;  3IAY A;  3TP7 A;  3S2H B;  2NN6 G;  3GTJ B;  2F0N A;  3OMG A;  1Q1E A;  3FPP A;  1FD7 D;  4N9T A;  5CV6 A;  4NDX A;  4RA8 A;  1SFO B;  3MFG A;  5IGB A;  1J9O A;  5FKA C;  5EPJ A;  4ZUI A;  4EQO A;  3Q23 A;  1DOM A;  2D62 A;  3FPU B;  2K6A A;  3BYT B;  2JA7 B;  2H1E A;  1B44 D;  4FF1 A;  1TT2 A;  4CBV A;  3FEW X;  2WIN B;  2F0S A;  5C0X G;  3FVQ A;  2L12 A;  2NWG A;  3D4W A;  5IOC A;  1WCM B;  1R9T B;  2E2J B;  1ML0 D;  5HGT A;  2EVB A;  3J81 L;  4F7X A;  1Y8N B;  3I3C A;  3P1H A;  3I73 A;  1CHQ D;  4BS9 A;  3J81 E;  1SMY D;  1WVL A;  2FFK B;  1TVX A;  3L7Z C;  1F2L A;  1BCP F;  1H9R A;  3HZX A;  2IW3 A;  1CT1 D;  1HA6 A;  1A3V A;  4RGN A;  2MUY A;  5I6Y A;  1GJX A;  1EWC A;  1U4R A;  3T16 A;  3G7L A;  4IAL A;  3HOX B;  4QF4 A;  1QG7 A;  4HAE A;  1QE6 A;  1CQF A;  2OEO A;  1OXV A;  1PFN A;  2RSO A;  2X6L A;  2JSO A;  3UI2 A;  3PIO 3;  3M4Y A;  2A6H D;  1EWH A;  2B2U A;  3LWE A;  5EKI A;  2WB1 B;  1H9K A;  5CR3 A;  1QIL A;  1EU3 A;  2F0T A;  3IKJ A;  1O80 A;  2PZW A;  1UNS A;  5FO7 B;  2A6E D;  2L1B A;  1SE2 A;  1JC7 A;  3KK7 A;  5FLX L;  1G91 A;  4DAV A;  3S1Q B;  3HOY B;  3GTG B;  1SMY C;  4XQQ A;  2F3W A;  1B2T A;  5C4J B;  5FLX E;  1PTO B;  1JWU D;  5C0X J;  1B9M A;  2XIW A;  3MC0 B;  2AWO A;  4Q5V A;  2WII B;  2BE5 D;  1VF7 A;  3HG9 A;  4J1M A;  3EVQ A;  3J7A F;  1PFB A;  1D5M C;  4A3G B;  4A3D B;  2JA8 B;  3MHB A;  1BCP D;  3HP3 A;  1JOO A;  3S1R B;  3R8B A;  1V1P A;  2NBF A;  5C4Z A;  1F2M A;  3M7N A;  1JQY D;  3O13 A;  3S1N B;  1KDA A;  1G2T A;  1AW7 A;  3HKZ B;  5ELD A;  4KHZ A;  1D1I A;  1TWC B;  5BN5 A;  1XXG A;  3OOC A;  4RH6 A;  3A7L A;  1ESR A;  5ISR A;  1STG A;  3DM1 A;  5KGU A;  1ZYR C;  4IFD J;  5JPM C;  3QB3 A;  4KN7 C;  2A68 C;  4PMW A;  1NUC A;  4F88 A;  3NUC A;  3H09 A;  4A3K B;  1U4L A;  4O1N A;  3M4O B;  4ZQ3 A;  1I50 B;  2B8F A;  1DOK A;  2XWJ B;  4KMU C;  2IPK D;  1F77 A;  2BE5 C;  3PO2 B;  2K28 A;  4B9X A;  3R2I A;  5D65 A;  1LLR D;  2D9U A;  1BCP C;  5COY A;  3SR1 A;  5BN4 A;  2RVL A;  1H9S A;  5E4W C;  1ZKO A;  5J1Z A;  5EBD A;  2JEB I;  5E3F A;  3AU7 A;  4OHJ A;  2RDG A;  4XDX A;  2EJM A;  2K5D A;  1C8C A;  1ENC A;  1PRT B;  2E75 C;  2F0M A;  2R3Z A;  1ILQ A;  1STE A;  3U9O A;  3GV3 A;  2D2C C;  3WDN A;  4DXF A;  4IZ8 A;  4TKO B;  1RJT A;  1IKL A;  3HEJ A;  5KRU A;  5I4D A;  4C3J G;  2SNS A;  1LTT D;  2JYO A;  3RMH A;  2B2T C;  2F0F A;  2SEB D;  4N9P A;  1SYD A;  1RHP A;  4C3H G;  1JE4 A;  2XVS A;  4DNT B;  5COR A;  1KDC A;  1U9R A;  4KD3 A;  2EYF A;  2Q8T A;  3C46 A;  4HCE A;  2K05 A;  2LKV A;  3K57 A;  1EEI D;  1Q1B A;  3K5O A;  4PNY A;  1VMP A;  1Y1V B;  3HOU B;  1L0Y B;  3FDT A;  5I2Y A;  1R4P B;  2NVQ B;  5T1I A;  2R7Z B;  3J80 L;  5CC4 A;  1Y8O B;  4TSS A;  2EJG C;  5JEA J;  3M3Y B;  1XWE A;  5M9O A;  3J80 E;  1GUG A;  3T13 A;  2EPB A;  2JA6 B;  3BDL A;  4RGT A;  5C5M A;  3VR2 A;  1LT4 D;  4PMC A;  2E76 C;  2G9H D;  2MHV A;  1SXT A;  3SEB A;  4OIJ A;  1B53 A;  1SNC A;  4EQP A;  3ND9 A;  4ME5 A;  2B2T A;  2F0E A;  1QB5 D;  4HR7 B;  5C4X B;  1HHV A;  5T1G A;  1TS4 A;  2RQX A;  1I4Q A;  2V4D A;  4RKB A;  3D3R A;  2EY2 A;  1EY9 A;  3BDO A;  4K14 A;  1Q3L A;  2FHT A;  2K5W A;  2J7Z A;  3H3V C;  1WTW A;  2DN8 A;  2WKC A;  1AEX A;  5G3L F;  4A93 B;  3BDC A;  1HPC A;  5C6A A;  1KNA A;  1GXD C;  1F9S A;  2VXW A;  1FR3 A;  2KCN A;  5CMD A;  2SNM A;  1H9S B;  1LT6 D;  4XT3 B;  3A55 A;  4TQU S;  1XX8 A;  2F0Q A;  5KNC A;  2MP1 A;  1ET9 A;  4WOR A;  2YU9 B;  2KOL A;  3Q0A A;  1LV9 A;  1EQV A;  5CV7 A;  3NQT A;  2NB0 A;  4R9W A;  4FNF A;  4OO1 I;  1V1O A;  3W2D A;  1EY8 A;  2KQ3 A;  4NKL A;  2OXP A;  2KA7 A;  3QG1 A;  4QCL A;  3M7G A;  2EY6 A;  3MZ5 A;  1U4M A;  3R3O A;  2E74 C;  5FOB B;  1D5Z C;  1JWM D;  2JEA I;  3GTK B;  4L8J A;  2WAC A;  5I9O A;  4DFA A;  1SND A;  3N52 A;  1ZEQ X;  3D6C A;  1AP0 A;  3BS1 A;  3X3M A;  1VF5 C;  2FIN B;  2IL8 A;  1SE4 A;  2XWB B;  2HCI A;  4L63 B;  4BY7 B;  1Q12 A;  5C44 B;  5M5W B;  4M1U B;  1S5C D;  2NVX B;  2Z4I A;  2ZXR A;  5DM6 3;  3JAM E;  5M3F B;  3D4D A;  2K03 A;  4Q0F A;  4ZAI A;  4EGV A;  2AQ2 B;  3GTM B;  1SEB D;  2F0D A;  1GUN A;  1TS2 A;  5C3E B;  3MFY A;  4EVO A;  1EIH A;  2BA1 A;  3VR6 A;  1CTM A;  3VR5 A;  5C3W A;  4RFB A;  2B63 B;  2QF7 A;  2AQ1 B;  3PUV A;  1EQT A;  2K1B A;  3D4R A;  3E5S A;  2MPM A;  1STN A;  2NUC A;  2QIL A;  4A3B B;  1SNP A;  3CQZ B;  2OT2 A;  5NUC A;  3E6Z X;  3SK8 A;  2KUM A;  1SDF A;  1YNJ D;  3V2T A;  4KKS A;  2EXZ A;  1IHZ A;  3BVG A;  4YIJ A;  1WD1 A;  4IUU A;  2BDO A;  1WTP A;  2BCO A;  4XQN A;  2B2U C;  2LFN A;  3TZD A;  1HCZ A;  1NR2 A;  3NHH A;  4ODG A;  3QOL A;  1SYC A;  3GTP B;  4IUP A;  5FO9 B;  2VB3 X;  3SHL A;  5IGD A;  3DWA A;  3P75 A;  2DY7 A;  4FXK C;  4CHT B;  1V43 A;  2WAQ B;  1WTR A;  4KJO A;  1D2B A;  1NSN S;  4HMI A;  1AZP A;  3VR3 A;  3PIP 3;  3W3A A;  4R8N A;  5LHY 1;  3NWT A;  5IOD A;  3D31 A;  1E2V A;  2B2W A;  2PNR C;  1XYI A;  4HSV A;  1EY4 A;  4C3J B;  1OXS C;  3DEO A;  2TSS A;  4DN4 M;  4HSP A;  1FYC A;  5KYL A;  3NTI A;  1DJR D;  4TRD A;  4DGZ A;  2KJX A;  4C3H B;  3K5M A;  3I70 A;  3I72 A;  1JOQ A;  5BN3 A;  2X6G A;  1STB A;  1EYC A;  1HTL D;  5CV4 A;  1GUT A;  4WRD A;  1RCV D;  1CZW A;  3S17 B;  5F2D A;  2IX1 A;  1B9N A;  1LT5 D;  4CGY B;  2A69 D;  4K5W A;  4IFD I;  4NP5 A;  3RLF A;  4XQJ A;  1BDO A;  5DAU A;  1IKM A;  3NPP A;  2QEJ C;  1JOK A;  1PZJ D;  4PV1 C;  2O5I C;  2WKD A;  3K5L A;  2VUM B;  1DM0 B;  1TS5 A;  3PO3 B;  5AFW A;  2Z8L A;  3F2U A;  3I4M B;  5FO8 B;  1UEA B;  5D3D A;  2SOB A;  3GP7 A;  1D1K A;  5M5X B;  2QDB A;  2N88 A;  3GQB A;  1O7Y A;  1I6H B;  1SJH D;  3S2D B;  1GUO A;  4BA1 I;  4IQZ A;  3DUZ A;  2IX3 A;  2XRQ D;  3I4N B;  2A6H C;  1BUV T;  2F0P A;  2O2L D;  1S5D D;  5M3M B;  1LTS D;  4XXE A;  1M4V A;  1AZQ A;  4EQN A;  1ICW A;  3I4L A;  5IGF A;  1BR9 A;  5M5Y B;  2B2Y A;  1RTO A;  2F0J A;  3T53 B;  5JAV A;  1TII D;  2D5D A;  1EYD A;  1C48 A;  2A6E C;  3L3O C;  4F87 A;  4G4K A;  4RKL A;  2F03 A;  1YNN D;  2A69 C;  1EFI D;  4MIU A;  1TQO A;  2AQ3 B;  4ZUJ A;  4FXG C;  4IUV A;  4C56 C;  2L11 A;  2K32 A;  1Y69 U;  3NXW A;  3NK9 A;  3P7J A;  3V05 A;  2PPB C;  3PUZ A;  3QJY A;  3K5N A;  3HOV B;  2RKS A;  3OSO A;  3KBX A;  1ONL A;  2EDG A;  4A3F B;  4ABN A;  3HGB A;  1BBX C;  5JVH 3;  2B8G A;  3TP6 A;  3BZD B;  4BY1 B;  1LTG D;  1SNO A;  4C2M B;  5EJW A;  3NBH A;  1QJO A;  4BA2 I;  4XYQ A;  4S3S A;  2TMP A;  1QNU A;  1BOS A;  2KCC A;  1F2Y A;  2E2D C;  1MBY A;  1EY6 A;  3LWU A;  1U4P A;  3K0Y A;  2R61 A;  4KN4 C;  2HQE A;  1Z6H A;  2J4X A;  2HDL A;  1YNN C;  2K5Q A;  2ZXO A;  3RZD B;  1X3P A;  3TP8 A;  4G7H C;  5JPN C;  1EY5 A;  3RD4 A;  2F0H A;  2XRS D;  4J6H A;  3QWN A;  1EZ6 A;  2H4O A;  3M85 A;  4DU9 A;  5DEH A;  3BVZ A;  3QOJ A;  3VR4 A;  3EFX D;  4XTC S;  2SDF A;  4RAU C;  5C5L A;  3ND8 A;  3ERO A;  1MD2 D;  1STA A;  1HFG A;  1CA6 A;  1Y8P B;  3HS0 C;  3S16 B;  4K5X A;  2G9D A;  5D14 A;  1T5E A;  3H94 A;  1LTI D;  4DK1 A;  2F0O A;  1JOR A;  2B2V C;  3K7A B;  3TBI B;  2O4X A;  1A2T A;  2PMZ B;  4FYD A;  3SE0 A;  4A3E B;  1HXY D;  4FVM A;  2VNU D;  4CJ1 B;  1SAP A;  3SK5 A;  1GHJ A;  4IUQ A;  3VYT A;  5LL6 X;  3NTK A;  4C1N I;  1Z47 A;  2QKI C;  1K8M A;  2XNA C;  4Z9C B;  5EGT A;  2PZT A;  5CV9 A;  2EYO A;  3KUP A;  1Y1W B;  1LAC A;  4X3S A;  3VA5 A;  1QWY A;  1PTO D;  4X3K A;  1GUW A;  3MXG A;  1HQR D;  1PLF A;  3WOF A;  3SK6 A;  5IT9 L;  2F0V A;  1G8Z D;  3VYU A;  4HMJ A;  2AUJ D;  1BO0 A;  4LMQ D;  2F3V A;  3KLS A;  1EIG A;  4OO1 H;  1SYG A;  4KK7 A;  5IT9 E;  4HTH A;  2F0L A;  3I90 A;  3EJI A;  2M2L A;  1VCI A;  1PRT F;  1PDQ A;  1LTA D;  3C3L A;  3OMC A;  2PO4 A;  1TWH B;  4QB4 A;  2B2V A;  3MXP A;  3G6J B;  1GOZ A;  4OO1 G;  4RWS C;  5J39 A;  3MA2 B;  3FKI B;  5I2X A;  1WD0 A;  3CRK C;  1MSH A;  1CZG A;  2PYK A;  1EY0 A;  4FF3 A;  2DNC A;  2KEC A;  3MVV A;  1PTO C;  1NAP A;  1K8O A;  5HUR A;  4ZKB B;  3ITP A;  3NQI A;  4KKU A;  3BG3 A;  3N6R A;  1TWG B;  1F9Q A;  2F0G A;  2EYM A;  4X3T A;  4WJW A;  5ELC A;  4DAP A;  2MGS A;  1I6V C;  3OW7 A;  5EKK A;  1S5B D;  1KAA A;  4U68 A;  3CHB D;  4IUN A;  1OXU A;  5KYI A;  4RGM A;  2Z4H A;  2I46 A;  3K58 A;  5IGC A;  4OGQ C;  1PRT D;  1ROD A;  3MAQ A;  3BVM A;  2OF1 A;  5CBE E;  1KNE A;  3IFT A;  3KBG A;  1BCP B;  3A54 A;  4QUF A;  1CA5 A;  4MHE A;  1JB3 A;  5JOB A;  3JAM L;  4I65 A;  4A3M B;  3MXN A;  4ZYS A;  3GTO B;  1EEF D;  5E1F A;  1Q90 A;  1DD2 A;  3T51 B;  3RUZ A;  5I9P A;  4ZRZ A;  3V96 A;  1STY A;  4RGO S;  1A6X A;  3NBI A;  3RZO B;  1W6J A;  2DY8 A;  2L4N A;  4CJ2 C;  1DZ1 A;  1A3U A;  2M00 A;  3EQL C;  1WTX A;  1I4H A;  2VB2 X;  2FJ2 A;  4O42 A;  2JE6 I;  4I7Z C;  3EA6 A;  2X69 A;  2ICE C;  2B2W C;  1KLU D;  1HFN A;  2Y0S B;  3T56 B;  1I4G A;  1D5X C;  3A56 A;  3K59 A;  2PW7 A;  1ZXT A;  5A2Q L;  5I6W A;  1LTR D;  5C0X H;  1PRT C;  2NN6 I;  3WOE A;  4XIG S;  3GO5 A;  5A2Q E;  1X32 A;  3IL8 A;  4ULL A;  3Q24 A;  4KKT A;  1J8I A;  1KLG D;  4K6L A;  5DNF A;  3SDZ A;  4KTA A;  3MXU A;  3DXJ C;  4KI0 A;  5D3I B;  1D6E C;  1DOL A;  1PXU A;  4A3J B;  1NCV A;  4KY7 A;  2ZXP A;  1A3T A;  3C1F A;  1OXX K;  1RTN A;  1JR0 D;  5E4X A;  1PZK D;  2CW0 D;  3DHQ A;  4A3I B;  4K8J A;  2K04 A;  1E2W A;  4C3I G;  3MTS A;  4RCN A;  4H7B A;  1EU4 A;  4BWG B;  1W6K A;  5C0X I;  3VYR A;  4CJ0 B;  5ELE A;  3SXH A;  3IFD A;  3NE5 B;  5DM7 3;  4K8I A;  2F4I A;  3PUW A;  4IFD H;  1RDP D;  2E2H B;  2K33 A;  4JK1 C;  1LTB D;  1LT3 D;  5TSS A;  4CKE A;  1RKN A;  1F9R A;  1IL8 A;  1TU2 B;  2ENB A;  4P2C B;  1HUN A;  1YNJ C;  1WTV A;  1HA5 A;  4NMZ A;  2EOT A;  4XYO A;  1I4X A;  2PCF B;  3S15 B;  2L5T A;  4K2L A;  2A5H A;  2LY7 A;  1SE3 A;  4QIW B;  2EYL A;  4CKB A;  1ILP A;  4KY6 A;  3T4A C;  4LAA A;  4B9W A;  1I4R A;  4XT1 B;  4IFD G;  4KHV A;  2L0C A;  2B2Y C;  3ONA B;  4DF7 A;  3GV6 A;  2IWH A;  3OPO A;  1A2U A;  4QUC A;  3BYY B;  2PW5 A;  3TP5 A;  2LS0 1;  2YYZ A;  1STH A;  2EZV A;  2CW0 C;  4UDU C;  1BXT A;  1I3Q B;  1EY7 A;  2EY1 A;  2KVM A;  3SVM A;  2F1M A;  5A35 A;  2NZ1 D;  2JA5 B;  2LMC B;  4G57 A;  1SYE A;  1ZYR D;  2HCC A;  4PMB A;  2A68 D;  2XSC A;  3KF8 A;  1QOH A;  3LNN A;  1GHK A;  2FMC A;  3CRL C;  4RCO A;  5JVG 3;  1JWS D;  2PQE A;  1S5F D;  4V19 0;  4H44 C;  2RDF A;  3AB9 A;  1ENF A;  3X3N A;  1B1Z A;  5C4H A;  3GTQ B;  3CKI B;  3LX0 A;  2XN9 C;  3DWP A;  3PV0 A;  1HTP A;  3FMC A;  1O7Z A;  1G29 1;  4PQX A;  3R93 A;  2F0K A;  3TSS A;  2CVR A;  1E2Z A;  4IUT A;  1DYQ A;  2BOS A;  3KLS X;  4OL7 A;  4HCS A;  5EPK A;  4RHS A;  2NTS A;  2ICI A;  4WFN 3;  1ENA A;  5CBA E;  1R4Q B;  2IX0 A;  3ERQ A;  1IYU A;  3DMU A;  3OWF A;  5EBC A;  5CV8 A;  3A8I E;  1PYW D;  5JEA H;  4FP5 D;  1EYA A;  3U9S A;  1CI3 M;  4ID6 A;  1TWF B;  1F9P A;  1VMC A;  2ID0 A;  2RBM A;  2J0T D;  1HRJ A;  3GD7 A;  4GZY C;  1SNM A;  5KIX A;  1B4O A;  3SK4 A;  4FF2 A;  1IW7 D;  4B08 A;  4K5V A;  3NSW A;  1AN8 A;  4F8M A;  1SYB A;  5JEA G;  5JJZ A;  2F0W A;  4MN3 A;  3TZU A;  4J8Q A;  4R8I A;  4FF4 A;  1ET6 A;  4L6T B;  1EL0 A;  4RHR A;  5IIF A;  3HOW B;  4DNR B;  4DXG A;  1MI2 A;  2AUK A;  2I07 B;  1E0B A;  3I91 A;  3S1M B;  1PTO F;  3FRP B;  4M8A A;  2AWN A;  1MSG A;  1BNZ A;  2E2I B;  1SBB B;  2Q8I B;  3URY A;  1RD9 D;  3VA7 A;  1L0X B;  2R92 B;  3Q22 A;  1SNQ A;  1TKW B;  3S14 B;  2HDM A;  4H13 C;  1DXM A;  1T5X D;  1JIC A;  2A74 C;  2O5J C;  1KTK A;  1FNW A;  4KY5 A;  3D8G A;  4IUR A;  1V8Q A;  2IJ0 A;  2F0U A;  2MJ8 A;  3KLR A;  1IW7 C;  4BBR B;  1JCK B;  5EQ0 A;  2K01 A;  1FGB D;  4C1N K;  3A8K E;  4K2K A;  2PZU A;  4OIK A;  1C4Q A;  1SYF A;  1EOT A;  1Q8I A;  2EY5 A;  4HED A;  1PTO H;  2KED A;  1H9M A;  1G6Z A;  3ZYY X;  4E6I A;  4G7Z C;  2N55 A;  3MWY W;  4ZLT F;  2CHB D;  1A15 A;  1TY2 A;  1Z7T A;  2KEE A;  3Q6S A;  3QIA A;  1CK1 A;  1BF4 A;  4QMG A;  3MEH A;  1V1P B;  2IT1 A;  2WV6 D;  3TN2 A;  3H6M A;  5EKL A;  2EYJ A;  3OHX C;  5ELF A;  4X3U A;  1BQQ T;  1M8A A;  3K6O A;  2NVT B;  1TWA B;  2L9H A;  4HN7 A;  2C9O A;  1ESF A;  4KV6 A;  1IYV A;  1KDB A;  1K83 B;  3PUX A;  1S5E D;  1WTQ A;  3DEP A;  4K6D A;  2RA4 A;  1PFM A;  1KAB A;  4ZKC B;  3J7Y W;  1NR4 A;  3H0G B;  4IN3 A;  4FXD A;  1LAB A;  4U67 3;  2JP1 A;  1G2S A;  3DWQ A;  2KHS A;  5FK9 C;  3D6W A;  3H91 A;  5CGK A;  2Q8R E;  1CQV A;  2NYZ D;  1LO5 D;  1QNK A;  4C3I B;  4JBW A;  1HQM C;  2RDH A;  5KNB A;  2M9V A;  3C1E A;  2EE1 A;  2QCP X;  1UUP A;  4G7O C;  4NW2 A;  3HRZ C;  1EZ8 A;  3PUY A;  2Z1C A;  3QO2 A;  5IGE A;  3TME A;  4BBS B;  1MGS A;  3GTL B;  4H0L C;  5CYU A;  3C2P A;  2ZT9 C;  4FO2 A;  3OIP A;  3AMU A;  1S4Z A;  4DA2 A;  2CQA A;  3A8J E;  4KD4 A;  1FNU A;  2EYH A;  3NWS A;  1CFM A;  1I4P A;  2FMM A;  3VYS A;  1GUS A;  2NVY B;  3CU7 A;  1II3 A;  5KEE A;  5IGG A;  2NTT A;  2EYP A;  1PMR A;  2HUG A;  5EPL A;  3NP8 A;  4KJN A;  2RSN A;  2C5C A;  5LL6 S;  1O7L A;  4V0B A;  1DON A;  4ZK9 B;  5KND A;  3PMF A;  1VDZ A;  5C3X A;  1PZI D;  5K36 H;  1QCB D;  1H9J A;  2L55 A;  3P20 A;  2R93 B;  1TR5 A;  2WP8 J;  4CKC A;  3HOZ B;  3L9A X;  2JXM B;  1UAP A;  2R6G A;  1AFP A;  1B50 A;  1SJE D;  4LK1 C;  1HUM A;  3E0J A;  3J7A V;  1FNV A;  1WTO A;  3TDQ A;  1OXT A;  1B3A A;  1RF2 D;  3R2T A;  1SSO A;  5K36 G;  4Y7N B;  2DNE A;  5G3L D;  2B39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...