4XQJA

Crystal structure of agra lyttr domain in complex with promoters
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Accessory gene regulator A
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Dna binding protein/dna
total genus 27
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xqjA00
4CBVA 4XXEA 4XYOA 4G4KA 3BS1A 4XQQA 4XQNA 4XQJA 4XYQA
chains in the Genus database with same CATH superfamily
4POFA 4JI5Q 4GOPB 2NVXH 1O7ZA 3VYSA 4LW1A 2B2TA 4YY3L 1K8AC 5IP9G 1D5XC 1ONLA 3M4QA 1I4PA 4JI5L 3ND8A 4A3DG 2HIXA 4ZAIA 4HJ9A 3J80L 1SMYC 2N49A 1N34Q 3HOZB 3MEFA 1R4PB 1PHJA 2XGTA 2SNSA 4OWTB 4IFDG 3ULPA 5C0XJ 1KQSA 1NUCA 4H44C 2CVRA 4G7OC 3GTMH 2OTJA 1XPRA 1SNMA 2OQKA 1PH9A 2UUBQ 1CT1D 3PV0A 4JYAQ 2CWPA 3Q22A 3B6YA 3C1EA 4LF6Q 2UUBL 4K2KA 2JA8G 3QOJA 1JOKA 4JYAL 1I50B 1BBXC 4H02A 2IY5B 1CHQD 4KKSA 5C3XA 3J80E 1MBYA 1KNEA 3EROA 4DGZA 3J81i 1GUSA 1CZGA 1K3BC 5CR3A 2KHIA 1ICFB 3NUCA 1V1QA 1EU4A 1Y8PB 4PMBA 5IGBA 4KK7A 3OWFA 3GTQB 3TP6A 4BA1I 3N52A 2MUYA 4UP7A 3CU7A 4PZ8A 4M8AA 1VQDA 2MQHA 2K03A 3DLLA 5M3MH 4GS3A 4TKOB 1DYQA 2BE5D 5ELDA 4C3HH 5C3EG 3HOWB 2B8GA 3I3CA 1IL8A 1CSPA 3ERSX 1HPCA 1TWGB 1TWCB 4JK1C 3VYTA 5C0XH 2DNCA 1B4OA 5KNDA 2PZUA 1PTOH 3EVQA 1TT2A 3A0JA 3NQIA 1CKMA 2EE1A 4QUCA 3VYUA 4LF5Q 3S2HH 2CW0C 1LO5D 4AYBE 5IYDG 3K5MA 5EQ0A 1B44D 1LV9A 4OO1I 2RQXA 4A3FG 5DNFA 1KRTA 4LUZA 4DKAC 3IAYA 4LF5L 1GUNA 3ERQA 3IRBA 1GO3E 1LTBD 1HQRD 1SMYD 4HN7A 2QDLA 5J22A 1CFMA 5GAGC 3PIOA 2VNUD 3RR5A 4JBWA 2JA9A 3PF4A 2H1EA 1WTXA 1NE3A 5JJIA 4IFDI 4DR5Q 3FPUB 1V1PA 1PXUA 3T51B 3IL8A 3ULLA 4A3KH 3KLWA 3D8GA 3NBIA 1E1OA 2V1CC 5GAHC 4JBKA 5CC4A 3BVMA 2AQ1B 1TVXA 1GOZA 2EXZA 2WACA 3OIQA 2JK8A 5LL6S 3OPOA 3W1GA 1N32L 5LMNQ 4HJ8A 5IYCG 4FF1A 2AHOB 3S16H 2SDFA 1VQ5A 2FMMA 2AQ3B 2X6GA 3M7NA 2X69A 1SYEA 4IPCA 5LMNL 2F0DA 3KDFB 2K1BA 3CCLA 2EJGC 3NWTA 1QNKA 1XYIA 1QCBD 4CJ1B 1TY2A 3CC2A 2E76C 3M7GA 1T9HA 3FP9A 5M3FH 4TVAB 2Z4IA 2JA7G 3O13A 1HUMA 1QUQA 4ZKCB 1STEA 1S4ZA 2B63H 3W2DA 1A3VA 3IFTA 4R1JA 1E0BA 1SYDA 5JVH3 2NVXB 4L5RC 4RWSC 4DNRB 4L8JA 3I4LA 2KHSA 2JEBI 4DAYA 1SNPA 3ULJA 4KHVA 1I4XA 1PDQA 4JI8Q 1PH6A 2GVAA 2PI2A 1B7YB 1FYCA 1TS5A 2EIFA 1NR4A 1HZCA 4QMGA 5GADC 4JI8L 1X3PA 1A8VA 2XRSD 3GTMB 2D9UA 1Y1VH 1IYVA 4A3BH 1H95A 2WV6D 1WOCA 1EQTA 4CDEC 2E2DC 3URYA 1EY8A 2QW7A 2NTTA 4XYQA 2K5HA 4G7ZC 4KD4A 1X3EA 2LSSA 4JI2L 1S3OA 2JA5G 2WP8J 1GKHA 2PW5A 2EYLA 2K04A 5GAEC 4KD3A 3TP8A 3K5NA 2ZM6Q 5EBCA 1BDOA 1D1KA 4O0AA 4KHZA 1AE2A 1O7IA 4PZ7A 2M9VA 2F0OA 3W5OA 5FJ8G 3DUZA 3P20A 3HOVG 1BKBA 2KQ3A 5IT9c 2IHFA 2K28A 4FP5D 1L2FA 4A93H 2E2HH 1V8QA 2KEDA 4IUTA 4NXMQ 4JI4L 3G71A 3X3NA 3CCJA 1Z7TA 4A3EH 4NXML 4C2MH 3SR1A 2XNAC 5M3MB 4RG1A 1E22A 1V43A 4UP8A 1ESFA 3RZDH 1SR3A 2N55A 2Y0SB 3EQLC 4C3HB 4FF4A 4G7HC 4HCSA 3W3AA 3ND9A 1WTRA 1PTOB 2F0NA 4DR4Q 2IX0A 1Q1EA 1B70B 3S2HB 2E2IH 4MHEA 1IKLA 2WB1B 4IUPA 4OWWB 4FF2A 2XRQD 4XQQA 4K2LA 1H9SA 4DR4L 1PTOF 3TDQA 4EGVA 4IQZA 3OTOQ 3F2UA 4A3IG 4IUNA 4DV1Q 1ET6A 1PRTB 5C6AA 2PNRC 1K8GA 3R2IA 4CDCC 2WINB 3GQBA 4FVMA 4DV1L 1PRTF 4RKLA 2EOTA 2VB2X 4C1NI 5JEAG 1WTWA 1SBBB 4C3JG 2JA6G 4ABNA 4A3KB 1G2TA 2RHSB 1SDFA 1IZ6A 4H7BA 5KNCA 1DGSA 1VMCA 4R4IA 2QKIC 1HH2P 5KYIA 3HOUG 1E7ZA 4F7XA 3DEOA 1D5MC 3VR5A 4UAIA 1PH7A 5HGTA 3ZYYX 2L4NA 1C0AA 3HP3A 1H9KA 3S16B 1DXMA 1G6ZA 2F0FA 2EPBA 2K5QA 1GUOA 4IUUA 1KAAA 1U4PA 1XTCD 4RHRA 5IYBH 5FOBB 4IUQA 1EIGA 3UE0A 4EQNA 2UUCQ 4DUYL 2YU9H 1YJ9A 1E3PA 2DN8A 1J9OA 1VQAA 4JI0Q 2IX3A 1PH4A 5M3FB 5BN3A 1EL0A 2JQOA 4N8X1 2UUCL 3I70A 3CMAA 1TY0A 2Q8RE 4JI0L 2B63B 2MFIA 3QJYA 1PLFA 1YNJC 3CXCA 4A3LH 1I4HA 4J1MA 2B29A 2WKDA 3VR2A 3EBEA 2K5VA 4YHHQ 4PQXA 2Q2UA 4HAEA 4IALA 3BVZA 2NZHA 2DY8A 2QDBA 3LGJA 1JC7A 4GZYC 1ZYRC 4YHHL 3STBD 4C3IG 5JPMC 1KTKA 3ER0A 3NXWA 3TP7A 2MO1A 5TSSA 4CBVA 1WTOA 5A35A 1LTGD 1Y1VB 1E1TA 4P2CB 5C44H 2P5ZX 4A3BB 5GQOA 1WJJA 4XIGS 1NMFA 2IJ0A 5H1SE 5JVG3 1MJCA 1N8RC 1IBLQ 3F1ZA 4X62L 3I91A 5I9PA 1YITA 5JJKA 4TRDA 1MIUA 1F9SA 3KF8B 5I2YA 1IBLL 5IGEA 4BY1G 1YHQA 5EKLA 3NBHA 3OMCA 5CV4A 2UXCQ 5FLMH 3F8TA 2A5HA 3HOXH 3PO2G 1LTRD 3NTHA 1VQ6A 1F2LA 5JJZA 1S5BD 4A93B 4KY7A 2E2HB 1BQQT 1STHA 1JJGA 1K8OA 2KBNA 2PQEA 4GLVB 1U4LA 4OGQC 3SK8A 2A68C 4PV1C 4A3EB 3E0EA 5C4HA 4C2MB 2N8NA 3H0GH 4WRDA 1B9NA 3NSWA 4CJ0B 1AFPA 1F77A 1X56A 4OL7A 1LABA 5I6YA 5KYLA 5K36H 4XTCS 1U9RA 2OF1A 4TQUS 4GKKL 3RZDB 1FD7D 1TS3A 2MJ8A 4R8IA 4N9PA 1PFSA 5IY0A 3EA6A 2WB1E 1SYFA 1VDZA 3HKZB 1M4VA 1EYGA 2VUMG 1J8IA 4AYBG 3SK5A 2E2IB 1F2MA 4HIMA 1TKWB 2L5TA 1YBYA 3I56A 5AJ3Q 4LF9Q 1STNA 4RGTA 1J6QA 1W2BA 4YWMA 1Q81C 4QGUA 3CCVA 4JI7L 4QF4A 3H15A 1WI5A 1NTGA 1KL9A 3J81L 4G57A 3TP5A 5AJ3L 4LF9L 3TZUA 4G4KA 1O78A 3T16A 1EFID 3NEMA 2EZVA 3FKIH 4IOAA 4GN4B 1PA6A 4LWCA 4KI0A 4GNXB 4ULLA 4HR7B 1UE6A 2EYJA 5IGFA 2ATWA 1JQYD 4DV2L 5LMNW 1E2ZA 4IJLA 1DOKA 3QWNA 3K57A 3TBIB 5IGGA 1JWSD 1JORA 5IP9H 4RGMA 1UE5A 4MZ9A 4A3DH 1Q86C 3K58A 2JYOA 4KLKA 3WOEA 1HZ9A 1QJOA 2KA7A 1CA5A 1MD2D 5IODA 3CCEA 2G5DA 5M5YH 4KN7C 3J81E 2GVBA 4X3KA 2YU9B 2Z6BA 1PZKD 2HUGA 4V190 1JT8A 5CBAE 3QB3A 4J8QA 2WAQG 4P74A 2AWNA 4B3MQ 1LTLA 1RODA 2G9DA 1IYJB 1RF2D 4LMQD 1PZID 4B3ML 1VQNA 2K5NA 1EY4A 1ASYA 3HOZG 2C9OA 5AFWA 1TIID 1A0IA 4A76A 1CHPD 1BCPC 2RVLA 1HZBA 1SJED 1A3TA 3S14H 1EY5A 3KF6A 2R7FA 3KOJA 4HJAA 5DAUA 1ESRA 1B8AA 3VA7A 5IGDA 4LJZC 4KHPQ 2RF4A 5C44B 2VB3X 4PZ6A 1EIHA 3EN2A 2N3SA 3SK4A 5C4XH 1Q8IA 5ELBA 3GTKH 1LTID 3S1NH 4IUVA 3LNNA 3RNUA 2UXDQ 3E5SA 1UUPA 3LWEA 2K32A 4L63B 1QOHA 3TSSA 4GKJQ 3OW2A 3TRZA 3G48A 3RLFA 1DM0B 1Q90A 1V1OA 4OO1G 5IYDH 1NCVA 5C5LA 3HOXB 3NHHA 3RN2A 3C46A 3SEBA 4FYDA 3LX0A 2PQAA 2A6ED 3CQZH 4HTHA 1JOQA 1A62A 1EY9A 4GOPA 4JVZA 1YEZA 2YTXA 2K5WA 1AH9A 2YTVA 3D6CA 1N34L 1HA5A 3HOWG 3H0GB 4WJ3M 1CKNA 2BDOA 3A7AB 2JJQA 4O1NA 1JCKB 3KLSX 2EQSA 1EY0A 1GD7A 5E1FA 1BNZA 3HKZE 4HSVA 2VL6A 3OW7A 4DR3Q 5CV9A 2VY3A 2A8VA 1E24A 1JE4A 1SN8A 3D31A 4KKUA 1Y1WG 4OWXB 1B2TA 1QZGA 1JJCB 4DR3L 4CDFC 1Q82C 2PPBC 2DY7A 4GN5A 1SEBD 4KKTA 2RSNA 5IYCH 4LF6L 3S9WA 3D4WA 3UE1A 2K7VA 3M4YA 1N9WA 1BCPD 2MPMA 2EXDA 1XX8A 1XNRQ 1CK1A 3FKIB 4DA2A 1C8CA 1YNND 3MFGA 2ZXRA 2EJFC 2FFKB 1VQHA 2F0MA 4WJWA 2A6HC 3CW2C 2EYOA 1VQCA 1XNRL 2KCCA 4GLAC 4OIKA 4RGOS 2ENBA 2F03A 3PMFA 4RH6A 3S15B 2L0CA 4I65A 4XT1B 1FNWA 5DEHA 3M85A 1K28A 3MXGA 4ZKBB 4ME5A 1VQGA 4A3DB 2PYKA 1FGUA 4V0BA 5HY6A 3LWUA 5G3LF 2VQFQ 1HNZQ 4PNYA 5C4ZA 2EY6A 2HD3A 1OXXK 3CC4A 1IBMQ 5M5YB 1GM5A 2VQFL 4K5VA 5C5MA 1HNZL 3I4MH 2SNMA 4NKLA 2KVMA 3CMEA 5KIXA 2DJFC 4DNIA 2JSOA 4GOPC 1IBML 4RHSA 5EPLA 4R9WA 1Z6HA 2N78A 3K7AH 1TR5A 1G6PA 1CKOA 1PFNA 3DEPA 1G8ZD 1H9RA 3IKJA 2JE6I 2JA5H 4JI6Q 1KNAA 3BZCA 4LFCQ 3V96A 2OQ0A 4YCVA 5C4JH 1V1PB 1S5FD 2SOBA 3MEHA 4DAMA 4DR5L 4LFCL 3J80c 1L1OA 2FHTA 3T13A 1X6OA 1WD0A 3K59A 3S14B 1O7YA 1WCMG 3R2TA 5EAYA 4X64Q 3V05A 3PUXA 4DK1A 2B3GA 2Q2TA 5HURA 2KECA 3TMEA 5IE8A 4A3MG 5C4XB 4X64L 3GTKB 2V4DA 4A3CG 3RZOH 2E74C 3S1NB 1I4RA 2LS01 1VQ4A 4L6TB 3BDLA 1ET9A 4JCVE 1SNCA 3S17H 1EEFD 2KENA 3GV6A 2FXQA 2M2LA 1XMQQ 1RCVD 2A6HD 1A2TA 3KUPA 2F0TA 1X65A 4BWGB 3BZKA 1I94Q 2K14A 4BXXH 5FLXL 2NN6I 3K5OA 3VR6A 1OO9B 1EUJA 1NY4A 5I4DA 2HHHQ 2R93G 2JEAI 4DV3Q 1I94L 1D8LA 2A69D 1HR0Q 1Y8NB 4A3IH 1GUTA 1FNVA 3CQZB 3S2DH 2HHHL 1FVIA 4DV3L 3K7UC 1HR0L 4QB4A 1AEXA 3RLNA 5CV7A 4B08A 2XN9C 3OSOA 5I6WA 4GLXA 2O5IC 1SE2A 4I7ZC 3G4SA 3H3VH 4IOCA 4CKEA 1RL2A 1BO0A 4C3JH 1TWFH 4WORA 1KXLA 3CCRA 3JAML 2G9HD 4P73A 3A8KE 4PMCA 4Y7NH 3E9IA 5FLXE 1TS2A 3VR4A 2R92G 2ASBA 2Z9HA 1BUVT 3R8BA 3PUYA 1NR2A 1L1OC 1STAA 1EY7A 2VS1A 2XWJB 1WVLA 5LMUQ 2ZM6L 4CHTB 1Q7YC 4O2DA 1EIYB 3DM3A 5T1GA 2EYFA 2B2UA 1RTNA 1Z9FA 1JOOA 2HDLA 4X3UA 3Q6SA 4CJ2C 3WWVA 1STYA 4ZUJA 1UE7A 4YCWA 1EQVA 5LL6X 1HUNA 4KTAA 2EVBA 4RFBA 4HSPA 3KJPA 1YHBA 2C5CA 4IO9A 3CKIB 1LM0A 1QILA 1KDCA 4DNTB 4BBSH 1KDBA 5M5XH 2LXKA 3STBC 4GN3B 1WFQA 3WOFA 4OONA 1LACA 2A19A 4C3IH 2ICEC 2IL8A 3BYTB 3Q0AA 3I4MB 3EIVA 5M3FG 1H9SB 1Z47A 3OWEB 5M5WB 2KOLA 3A7LA 4BS9A 5A2QL 2B63G 4UP9A 3OTOL 1EQQA 3K7AB 2MNAA 5L37A 3X3MA 4DFAA 3CCUA 4IURA 2JA5B 3MFYA 1YJWA 4EQ5A 1V9PA 4ZLTF 1ASZA 3TREA 4K8IA 2NUCA 2GA4B 5C4JB 3S1RB 5C0XI 2NWGA 1II3A 1HXYD 3FMCA 1I6HH 3H09A 2F0PA 3M9BA 3ZJYC 3BS1A 2OWOA 3KLSA 5IOCA 4QIWB 5EPJA 3PO2H 3G7LA 1S5DD 2K75A 2K5DA 5E4XA 5EKKA 1QVGA 1SJHD 5JAVA 1VQ8A 2PMZB 1JB3A 4RA8A 3I4NG 1PZJD 1QWYA 1BBWA 3K80C 4JI1Q 4QY7A 4A3JG 1RHPA 3A56A 5A2QE 2R3ZA 3M3YB 3NWSA 2CQOA 2B2UC 4HJ7A 3U50C 4DV6Q 1GHJA 2NYZD 3RZOB 2BDNA 3KK7A 4JI1L 2UUAQ 2BA0A 4KV6A 3PF5A 1OXTA 4DR6Q 1VQFA 1HTLD 2DGYA 3S17B 1C4QA 2BH8A 4DV6L 1N33Q 3TS2A 5J39A 2EJMA 3UDIA 2KJXA 1B53A 1F2YA 2R7ZG 4DR6L 1TU2B 4JBMA 2CKZB 3J7A5 2VUMH 2WIIB 1N33L 3GTPH 1HFGA 2VQEQ 3VA5A 1X3FA 4BBRG 2HCCA 4NP5A 2IWHA 3HEJA 3GDEA 3F2CA 2B39A 1U5KA 2DNEA 3NK9A 3C3LA 4A3IB 2PI2E 3FVQA 1SYCA 4L5TA 2VQEL 3SXHA 3PIP3 3S2DB 2KUMA 1WYDA 1ZKOA 1UWVA 2ALYB 5BN4A 1RJTA 1EEID 2F0KA 3NPPA 1VCIA 5JJLA 1B3QA 1PTOC 1A6XA 2O2LD 5CGKA 1JJ2A 3E6ZX 4APVA 5JPNC 4C3JB 2JA6B 1BBUA 1TWFB 3JAMi 3OIPA 1AZPA 1CZWA 3GTJH 2YV5A 3FHWA 3FDTA 5F2DA 3RLOA 3QOLA 4Y7NB 1IYUA 1EZ6A 5NUCA 4ILWA 1LUZA 4QL5A 1BOSA 3PO3H 2RKSA 2NB0A 4U68A 1LTAD 3OHXC 2CFMA 3MXNA 1PH1A 2F0GA 2XSCA 4RKBA 3K5LA 2PZWA 3NBHB 5KRUA 5I9OA 3RMHA 4HIKA 3KF8A 4MN3A 3RD4A 2UXCL 3GD7A 1EYDA 3G6EA 4K6LA 5CV5A 1EOVA 3L7ZC 3H91A 4KJOA 4LUVA 4ZCKA 1YI2A 1BF4A 2FINB 2F0IA 5KGUA 4R4OA 4B3SQ 2F0UA 2Y0SE 1NAPA 3NQTA 4FDBA 2GN5A 4A4IA 5CV6A 3I90A 4B3SL 3SHLA 3CPWA 4IFDJ 4DK3C 2RDHA 1GHKA 1CUKA 4AH6A 4KY5A 4DR7Q 1IBKQ 4DK6C 4XYOA 1IW7D 4DF7A 4NB3A 1VS0A 2F0LA 4BBSB 3CF5A 3DM1A 3PGZA 5M5XB 2ES2A 1MKHA 1ML0D 2AUJD 4C1NK 4DR7L 1IBKL 2I07B 1EWHA 4J6HA 4C3IB 1EFWA 3GTOH 2KHJA 5IGCA 1XWEA 4PG3A 1SFOH 2QF7A 3C2PA 2A73B 1SYBA 3T53B 5ISRA 3J81j 1VF7A 3HOYG 3CCMA 5E3FA 4K5XA 1W3SA 4R4TA 3QIAA 1UEAB 5HGQA 2I5HA 5J3BA 2VXWA 5DLQE 4A3LG 4NW2A 1PV4A 2CCZA 4FO2A 4L5SA 1X32A 1PTOD 4HJ5A 5D3DA 1G2SA 3U58A 1MHWC 1VQBA 3JC66 2ZXOA 4BY7G 4RAUC 3CRKC 4QIWE 4OO1H 1I6HB 3S15H 3HG9A 3K6OA 2NVTH 2PMZE 3S1QH 4CDDC 4A3GG 3PO2B 2KCMA 1CQVA 2RCNA 4GNXA 1EQRA 2A6EC 1PRTD 3DMUA 3J7AF 2F4VQ 5C44G 3E0JA 1I3QH 4O42A 1SE3A 4KMUC 1CI3M 4IFDH 2ZTDA 2AQ2B 2Q2HA 2F4VL 1JWMD 1X55A 1HQMC 4K8JA 5ELOA 5EKIA 1SAPA 1HHVA 2QA4A 1SSOA 4X65Q 1EYAA 4E6IA 4HMJA 1ZXTA 2VW9A 2PCFB 1SLJA 2Q8TA 2CH4W 2L9HA 4S3SA 2LXJA 3FPPA 1VQOA 4X65L 1C9OA 2RBMA 4XQNA 3F2DA 4K0KQ 3D0FA 1YVCA 1BR9A 3ONAB 2VUMB 3TQYA 1Y1WH 2JA8H 3GTPB 4LF8Q 3SE0A 2N88A 4K0KL 2QCPX 3OMGA 4LF8L 3D3RA 3GO5A 2Z0SA 2MGSA 2IT1A 3CP0A 3MC0B 2F3IA 3KF6B 1YNNC 3BZDB 2CHBD 2FJ2A 5FO9B 1WD1A 3FRPB 3CRLC 5K36G 2ZTCA 2QGQA 3PIPA 2BOSA 2H4OA 4FF3A 3GTLB 3AU7A 2OTLA 1UEBA 4KHPL 4ZK9B 3GTJB 3T4AC 1HNWQ 4JPBW 2NTSA 3D4RA 2ICIA 3A8JE 4OX9Q 5I2XA 5C3EH 1OXSC 4YCUA 2I5MX 1VQMA 4DV0Q 1CQFA 1GUGA 3PO3B 2D5DA 1AZQA 3TZDA 2UXDL 2NVYH 4OX9L 1VQ7A 4LFAQ 4GKJL 1GXDC 1JWUD 4DV0L 1S72A 1IL2A 2JP1A 1IXRA 2OEOA 3VR3A 3J81c 3PSIA 4A3FH 3FKIG 4MIUA 4GNXC 1FNUA 3H6MA 4LFAL 1E2WA 1VQIA 2NVQH 1OTCA 1VQLA 3S1MH 2EY1A 1KDAA 1YZ6A 1IKMA 1TWAH 2OXPA 2WAQB 2B2VA 3K8AA 1L0YB 2XWBB 1LTSD 2HQLA 4FXDA 1I5FA 2F0EA 1CKNB 4DV4Q 2F0HA 4KY6A 2E75C 1I4GA 2IW3A 4K14A 2HCIA 4JW0A 2WFWA 4F88A 5IP7G 1EY6A 1I6VC 1T5EA 4DV4L 2Z6KA 3R3OA 1LT4D 3HRZC 4JI3Q 2XTIA 3KFUA 2F0WA 4Q0FA 1KABA 1WCMH 1BVSA 1DOLA 3GTOB 1EWIA 1EOTA 3AMUA 3J7ZC 3AFQA 1EYCA 3TS0A 4ODGA 2B2YA 3DWQA 4JI3L 1SFOB 2AWOA 1OXVA 4A3MH 3KBXA 1VMPA 4F8MA 3ICEA 2AUKA 4A3CH 5ELCA 1K9MC 1RKNA 4CKCA 5CYUA 1ENCA 1CA6A 2OT2A 4P72A 2XIWA 2XVSA 5C3WA 3UDXA 2JA7H 4JV5Q 2A74C 2NN6G 3BJUA 5FO8B 5EJWA 2CH4A 4FXKC 4XQJA 3A55A 4JOIA 5FKAC 2NVTB 4JV5L 1G291 3S1QB 3D4DA 2A69C 4DAPA 1MI2A 3J7AV 2R93H 1QG7A 3L9AX 1EWCA 2D0OA 4ME3A 4HIDA 3M4OH 1N36Q 1DD2A 2ZXPA 5C4XG 1I3QB 3I72A 2BA1A 1XNQQ 1N36L 4X66Q 3G6JB 1HA6A 4B3RQ 1PH3A 5CBEE 1Y14B 1S5CD 5M5WH 1XNQL 3SK6A 2ZJRA 4X66L 4B3RL 2B2VC 4XDXA 1B50A 4LF7Q 1SE4A 2KCTA 2B2TC 1A2UA 1PYSB 2L11A 4R4QA 1Y1WB 4ZUIA 2JA8B 4ZRZA 2R92H 4LF7L 1X54A 3S1RH 3GTGH 3MWYW 5D3IB 1MJEA 4JI6L 2RDGA 5EGTA 4DUZQ 5IT9L 5FJ8H 2EYHA 2Z6KC 1D5ZC 5JEAJ 1QVCA 3HOVH 1L1OB 4X3TA 1HNXQ 5IWAQ 3K0XA 4P75A 4DUZL 2D0PA 3NTKA 2O5JC 1DCZA 2B2YC 4KJNA 1HNXL 5IWAL 1M1KC 3MZ5A 5DM73 2RA4A 1KIXA 3M3YH 1S5ED 1MSHA 1N32Q 3DHQA 2QILA 3I7FA 4DN4M 3HZXA 3SDZA 3UI2A 3NENA 1Q8KA 1KRSA 4EVOA 1JR0D 5C3EB 1PMRA 3SVMA 3PQIA 2QEXA 5T1IA 4FNFA 2RHQB 1YHAA 1GVPA 2NVYB 3KDFA 3NE5B 4JOIC 1QUQB 5J1ZA 4IN3A 1A15A 2TSSA 1PYWD 1LTTD 2F0QA 2LY7A 5IT9E 1XMQL 1MSGA 1DOMA 4A3FB 5E7NA 3P75A 1WTVA 1TQOA 2J7ZA 4JC0A 5D14A 4DAYB 1SRUA 2DUDA 2NVQB 3S1MB 2K33A 4L5QA 2WAQE 3QO2A 1P8LA 3P1HA 1GJXA 3TN2A 5M3MG 2IPKD 1TWAB 3OOCA 1NJIC 2LFNA 2Y0SG 4C3HG 1HJPA 4DAVA 5C0XG 4LF4Q 3K0YA 5JEAH 1XTDA 4K6DA 1X3GA 3J80i 2JA6H 3DXJC 4CKBA 3U4VA 3T56B 2WB1G 1CSQA 4LF4L 1AW7A 3HOUH 4H0LC 1W6KA 2CW0D 3CC7A 4QJFA 3MXUA 2B8FA 3T1HQ 1VQJA 3I4MG 1TXYA 2UU9Q 2E5LQ 1PH2A 4HEDA 4JI2Q 1WCMB 1SMXA 3I4NH 2ZJQA 1LT6D 3T1HL 2HQEA 2UU9L 1RD9D 3KBGA 4RCOA 3J7YW 4A3JH 1ENFA 2K01A 4RCNA 2E5LL 3IFDA 4HCEA 3CHBD 2Z4HA 3MTSA 2ID0A 3SGIA 4A3MB 1ILPA 2F4IA 2D62A 2K05A 5LMUL 1WTQA 1S40A 4A3KG 2EDGA 2JA7B 5COYA 3S24A 4U673 2A1AA 5FO7B 2R7ZH 5GROA 1D6EC 2OCEA 3PUZA 4YWKA 4JI4Q 3JAME 2HT1A 3QR8A 1VQPA 3PUVA 1PFMA 3RN5A 4BBRH 3E3XA 2R93B 2J4XA 4NMZA 1PYBA 1CM9A 4WFN3 1HRJA 4MTNA 4BA2I 4TSSA 3M4OB 5EPKA 4ZYSA 3HFZB 4JG2A 1DONA 2NZ1D 5E4WC 2LKVA 4IPGA 1ICWA 1I4QA 1VQ9A 4N8FA 3EJIA 2BH2A 3QG1A 1F9PA 1U4MA 2K6AA 2R6GA 1WTHA 3E9HA 3PUWA 1KAWA 5G3LD 4BXXG 1H9MA 1RDPD 3MA2B 1A63A 3I2ZA 4IZ8A 2F3VA 2F0SA 1RTOA 3W1BA 1K3RA 5FLXc 3DWAA 4N9TA 1B1ZA 2NZOA 2PW7A 2R92B 4H13C 4BY1H 3GTGB 1Y8OB 1YJNA 1K0RA 2RCFA 2YTYA 2M00A 1XXGA 3HOVB 2K4KA 4POGA 2JN4A 3H94A 1Y1VG 5CORA 2L12A 1LLRD 5K5PA 1QVFA 4A3BG 1C48A 1EIFA 4DU9A 4J15A 5KNBA 3CAMA 4LNQA 4X3SA 4FXGC 2AMCB 3I4OA 2R61A 4C56C 1STGA 2HDMA 5ELFA 4B9XA 4UHVA 1KC8C 1SE8A 3JAMc 4UDUC 1BXTA 2E2JH 2MP1A 4AQYQ 1WTPA 3A5ZB 1SXTA 3N6RA 3K81C 4XT3B 2I46A 5LHY1 1B9MA 4MTKA 2UUAL 4IPHA 4AQYL 1IW7C 2MHVA 4DUYQ 1HFNA 4QQBX 3BVGA 4I7AA 4A93G 3Q8DA 3FEWX 3V2TA 2I5LX 5D65A 4NDXA 4LFBQ 2SEBD 4WJ4A 1FL0A 2CWAA 3U9OA 4PMWA 1K83H 3R93A 2B2WA 4A3EG 1KHIA 1SYGA 1X9NA 3L3OC 4LFBL 1J5EQ 1IHZA 2K52A 2L15A 3HOYH 1R4QB 3HGBA 4IPDA 4IJHA 5BN5A 1FR3A 4DV5Q 3GTLH 1F2ZA 3A8IE 1TWHH 1QNUA 1J5EL 1ILQA 3HKZG 1DJRD 4BBSG 2ZT9C 4DV5L 4BY7H 4LK1C 5ELNA 4DR1Q 2CQAA 3AQQA 3VDYA 3HOUB 1K0SA 1UAPA 2PO4A 1PRTC 4Z9CB 4A3GH 4X6AH 1R9TH 2Z1CA 4DR1L 4X62Q 3OYYA 2TMPA 2VZAA 3I4NB 1AP0A 3MXNB 2E8GA 1Y69U 4A3JB 1PH8A 1P16A 1K8MA 5JOBA 1XPOA 3A54A 1QZHA 1G51A 5EBDA 1UE1A 3CCQA 1Q3LA 3H3VI 3TEHB 3EFXD 4MNOA 4YWLA 4DK0A 1A3UA 4RMFA 3KLRA 3MHBA 4CGYB 1C7YA 5FK9C 3BU2A 1QB5D 2EY2A 5CMDA 1JE5A 2R7ZB 3AFPA 1F9RA 1YNXA 2AKWB 1D1IA 2L1BA 5M9OA 1U0LA 1K73C 1HCZA 4BBRB 1MGSA 5IIFA 3HOZH 4F87A 1ENAA 2PNHA 2I0QA 1PVOA 1LYLA 3NP8A 1M90C 1VQEA 2RDFA 1NNXA 4KN4C 5IYBG 2HIVA 4GKKQ 1H9JA 2R7DA 1M8AA 2Q2IA 1BCPB 3C1FA 4LUOA 3Q23A 4OIJA 4HIOA 3T1YQ 2KCNA 3AEVA 3DWPA 3D6WA 1SROA 1Q46A 3WDNA 1LT5D 3MVVA 3HS0C 4AIMA 2B2WC 1BCPF 1AE3A 4QUFA 1FJGQ 2Q8IB 2F3WA 3T1YL 1AN8A 2ZTEA 3CPFA 3I8ZA 3GP7A 1Q12A 3U4ZA 1I50H 2WKCA 2NBFA 1FJGL 1UNSA 1YNJD 3A74A 3MXPA 4LAAA 4EX5A 4JI7Q 2L55A 2YYZA 2Z8LA 4YIJA 2DJGC 1SNQA 5KEEA 1SNOA 3NTIA 4BY1B 1PH5A 1ZEQX 3HKSA 4P71A 1L0XB 1QE6A 2LMCB 4JBJA 1X3QA 2EYPA 1ZYRD 1EU3A 3H3VC 1G91A 4Y52H 2JXMB 2X6LA 3GTQH 1JMCA 3CD6A 4DV2Q 4OELB 2BCOA 4OHJA 1VF5C 1KLGD 3AYHB 3CCSA 1U4RA 4DPGA 1B3AA 3BYYB 3NELA 3BG3A 4ID6A 1W6JA 1XJVA 4B3TQ 3HOWH 1TWCH 1TWGH 2KEEA 4DV7Q 2E2JB 2QEJC 3M4PA 1LT3D 4R8NA 3PO3G 2FMCA 4DXGA 2C35B 3BDCA 1RIPA 3UDFA 1KD1C 3VYRA 4B3TL 1NSNS 3F2BA 3I73A 4DV7L 3MAQA 5ELEA 5FLMG 1L0WA 3HOXG 5IP7H 3BDOA 3KJOA 1HR0W 3GV3A 3AB9A 4AYBB 3L2PA 3PIO3 2IX1A 2J0TD 1EZ8A 4M1UB 4OEMB 2D2CC 1HTPA 4UPAA 4DXFA 3U9SA 1TS4A 5DM63 1E2VA 3RUZA 2RSOA 2ZJPA 2O4XA 1K83B 2MO0A 4RGNA 2A68D 3H0GG 1VQKA 2EY5A 1Q1BA 3HOYB 4K5WA 1YIJA 1CTMA 4B9WA 3P7JA 1O80A 1D2BA 4EQOA 4A75A 4R4CA 1DZ1A 1TWHB 2PZTA 2UXBQ 2NN6H 3KYHC 3L0OA 2IHEA 4UY8C 4BY7B 4Q5VA 1HZAA 5BR8Q 4ALPA 4XXEA 2F0JA 3ITPA 5CV8A 4EQPA 3Q24A 1XPUA 1D7QA 1NBWA 2UXBL 1PFBA 1JB7A 4A3GB 1F9QA 4OXPA 4HMIA 4NPSA 1T5XD 3A5UA 1JICA 5BR8L 1HNWL 1KLUD 4ZQ3A 1R9TB 2F52A 4NXNQ 4DR2Q 1STBA 1O7LA 2EYMA 2BE5C 4NXNL 4QCLA 2F1MA 1XMOQ 4DR2L 3I55A 3UDGA 1FGBD 1GUWA 2H5XA 1OXUA 1NMGA 2PQAB 2F0VA 1XMOL 1SNDA 4YY3Q 3PCOB 2K50A
chains in the Genus database with same CATH topology
1O7ZA 3VYSA 2B2TA 1D5XC 1ONLA 1I4PA 3ND8A 4ZAIA 3J80L 1SMYC 3HOZB 1R4PB 4IFDG 2SNSA 5C0XJ 1NUCA 4H44C 2CVRA 4G7OC 1SNMA 1CT1D 3PV0A 3Q22A 3C1EA 4K2KA 3QOJA 1JOKA 1I50B 1BBXC 1CHQD 4KKSA 5C3XA 3J80E 1MBYA 1KNEA 3EROA 4DGZA 1GUSA 1CZGA 5CR3A 3NUCA 1EU4A 1Y8PB 4PMBA 5IGBA 4KK7A 3OWFA 3GTQB 3TP6A 4BA1I 3N52A 2MUYA 3CU7A 4M8AA 2K03A 4TKOB 1DYQA 2BE5D 5ELDA 3HOWB 1IL8A 3I3CA 1HPCA 2B8GA 3VYTA 1TWCB 1TWGB 4JK1C 5C0XH 2DNCA 1B4OA 5KNDA 2PZUA 1PTOH 3EVQA 1TT2A 3NQIA 3VYUA 2EE1A 4QUCA 2CW0C 1LO5D 3K5MA 5EQ0A 1B44D 1LV9A 4OO1I 2RQXA 5DNFA 3IAYA 1GUNA 3ERQA 1LTBD 1HQRD 1SMYD 4HN7A 5J22A 1CFMA 2VNUD 4JBWA 2H1EA 1WTXA 4IFDI 3FPUB 1V1PA 1PXUA 3T51B 3IL8A 3D8GA 3NBIA 5CC4A 3BVMA 2AQ1B 1TVXA 1GOZA 2EXZA 2WACA 3OIQA 5LL6S 3OPOA 4FF1A 2SDFA 2FMMA 2AQ3B 2X6GA 3M7NA 2X69A 1SYEA 2F0DA 2K1BA 2EJGC 3NWTA 1QNKA 1XYIA 1QCBD 4CJ1B 1TY2A 2E76C 3M7GA 2Z4IA 3O13A 1HUMA 4ZKCB 1STEA 1S4ZA 3W2DA 1A3VA 3IFTA 5JVH3 1E0BA 1SYDA 2NVXB 4RWSC 4DNRB 4L8JA 3I4LA 2KHSA 2JEBI 4DAYA 1SNPA 4KHVA 1I4XA 1PDQA 1FYCA 1TS5A 1NR4A 4QMGA 1X3PA 2XRSD 3GTMB 2D9UA 1IYVA 2WV6D 1EQTA 2E2DC 3URYA 1EY8A 4XYQA 2NTTA 4G7ZC 4KD4A 2WP8J 2PW5A 2EYLA 2K04A 4KD3A 3TP8A 3K5NA 5EBCA 1BDOA 1D1KA 4KHZA 2M9VA 2F0OA 3DUZA 3P20A 2KQ3A 2K28A 4FP5D 1V8QA 2KEDA 4IUTA 3X3NA 1Z7TA 3SR1A 2XNAC 5M3MB 1V43A 1ESFA 2N55A 2Y0SB 3EQLC 4C3HB 4FF4A 4G7HC 4HCSA 3W3AA 3ND9A 1WTRA 1PTOB 2F0NA 2IX0A 1Q1EA 3S2HB 4MHEA 1IKLA 2WB1B 4IUPA 4FF2A 2XRQD 4XQQA 4K2LA 1H9SA 1PTOF 3TDQA 4EGVA 4IQZA 3F2UA 4IUNA 1ET6A 1PRTB 5C6AA 2PNRC 3R2IA 2WINB 3GQBA 4FVMA 1PRTF 4RKLA 2EOTA 2VB2X 4C1NI 5JEAG 1WTWA 1SBBB 4C3JG 4ABNA 4A3KB 1G2TA 1SDFA 4H7BA 5KNCA 1VMCA 5KYIA 2QKIC 4F7XA 3DEOA 1D5MC 3VR5A 4UAIA 5HGTA 3ZYYX 2L4NA 3HP3A 1H9KA 3S16B 1DXMA 1G6ZA 2F0FA 2EPBA 2K5QA 1GUOA 4IUUA 1KAAA 1U4PA 1XTCD 4RHRA 5FOBB 4IUQA 1EIGA 4EQNA 2DN8A 1J9OA 2IX3A 5M3FB 5BN3A 1EL0A 3I70A 1TY0A 2Q8RE 2B63B 3QJYA 1PLFA 1YNJC 1I4HA 4J1MA 3VR2A 2WKDA 4PQXA 4HAEA 4IALA 3BVZA 2DY8A 2QDBA 1JC7A 4GZYC 1ZYRC 4C3IG 5JPMC 1KTKA 3NXWA 3TP7A 5TSSA 4CBVA 1WTOA 5A35A 1LTGD 1Y1VB 4P2CB 4A3BB 4XIGS 2IJ0A 5JVG3 3I91A 5I9PA 4TRDA 1F9SA 5I2YA 5IGEA 5EKLA 3NBHA 3OMCA 5CV4A 2A5HA 1LTRD 3NTHA 1F2LA 5JJZA 1S5BD 4A93B 4KY7A 2E2HB 1BQQT 1STHA 1K8OA 2PQEA 1U4LA 4OGQC 3SK8A 2A68C 4PV1C 4A3EB 5C4HA 4C2MB 4WRDA 1B9NA 3NSWA 4CJ0B 1AFPA 1F77A 4OL7A 1LABA 5I6YA 5KYLA 5K36H 4XTCS 1U9RA 2OF1A 4TQUS 3RZDB 1FD7D 1TS3A 2MJ8A 4R8IA 4N9PA 3EA6A 1SYFA 1VDZA 3HKZB 1M4VA 1J8IA 3SK5A 2E2IB 1F2MA 1TKWB 2L5TA 1STNA 4RGTA 4QF4A 3J81L 4G57A 3TP5A 3TZUA 4G4KA 1O78A 3T16A 1EFID 2EZVA 4KI0A 4ULLA 4HR7B 2EYJA 5IGFA 1JQYD 1E2ZA 1DOKA 3QWNA 3K57A 3TBIB 5IGGA 1JWSD 1JORA 4RGMA 3K58A 2JYOA 3WOEA 1QJOA 2KA7A 1CA5A 1MD2D 5IODA 4KN7C 3J81E 4X3KA 2YU9B 1PZKD 2HUGA 4V190 5CBAE 3QB3A 4J8QA 2AWNA 1RODA 2G9DA 1RF2D 4LMQD 1PZID 1EY4A 2C9OA 5AFWA 1TIID 1CHPD 1BCPC 2RVLA 1SJED 1A3TA 1EY5A 5DAUA 1ESRA 3VA7A 5IGDA 4LJZC 5C44B 2VB3X 1EIHA 3SK4A 1Q8IA 5ELBA 1LTID 4IUVA 3LNNA 3E5SA 1UUPA 3LWEA 2K32A 4L63B 1QOHA 3TSSA 3RLFA 1DM0B 1Q90A 1V1OA 4OO1G 1NCVA 5C5LA 3HOXB 3NHHA 3C46A 3SEBA 4FYDA 3LX0A 2A6ED 4HTHA 1JOQA 1EY9A 2K5WA 3D6CA 1HA5A 3H0GB 2BDOA 3A7AB 4O1NA 1JCKB 3KLSX 1EY0A 5E1FA 1BNZA 4HSVA 3OW7A 5CV9A 1JE4A 3D31A 4KKUA 1B2TA 2PPBC 2DY7A 1SEBD 4KKTA 2RSNA 3S9WA 3D4WA 2K7VA 3M4YA 1BCPD 2MPMA 1XX8A 1CK1A 3FKIB 4DA2A 1C8CA 1YNND 3MFGA 2ZXRA 2EJFC 2FFKB 2F0MA 4WJWA 2A6HC 2EYOA 2KCCA 4OIKA 4RGOS 2ENBA 2F03A 3PMFA 4RH6A 3S15B 2L0CA 4I65A 4XT1B 1FNWA 5DEHA 3M85A 3MXGA 4ZKBB 4ME5A 4A3DB 2PYKA 4V0BA 3LWUA 5G3LF 4PNYA 5C4ZA 2EY6A 1OXXK 5M5YB 4K5VA 5C5MA 2SNMA 4NKLA 2KVMA 5KIXA 2JSOA 4RHSA 5EPLA 4R9WA 1Z6HA 1TR5A 1PFNA 3DEPA 1G8ZD 1H9RA 3IKJA 2JE6I 1KNAA 3V96A 1V1PB 1S5FD 2SOBA 3MEHA 2FHTA 3T13A 1WD0A 3K59A 3S14B 1O7YA 3R2TA 3V05A 3PUXA 4DK1A 5HURA 2KECA 3TMEA 5C4XB 3GTKB 2V4DA 2E74C 3S1NB 1I4RA 2LS01 4L6TB 3BDLA 1ET9A 1SNCA 1EEFD 3GV6A 2M2LA 1RCVD 2A6HD 1A2TA 3KUPA 2F0TA 4BWGB 5FLXL 2NN6I 3K5OA 3VR6A 1OO9B 5I4DA 2JEAI 2A69D 1Y8NB 1GUTA 1FNVA 3CQZB 4QB4A 1AEXA 5CV7A 4B08A 2XN9C 3OSOA 5I6WA 2O5IC 1SE2A 4I7ZC 4CKEA 1BO0A 4WORA 3JAML 2G9HD 3A8KE 4PMCA 5FLXE 1TS2A 3VR4A 1BUVT 3R8BA 3PUYA 1NR2A 1STAA 1EY7A 2XWJB 1WVLA 4CHTB 5T1GA 2EYFA 2B2UA 1RTNA 1JOOA 2HDLA 4X3UA 3Q6SA 4CJ2C 1STYA 4ZUJA 1EQVA 5LL6X 1HUNA 4KTAA 2EVBA 4RFBA 4HSPA 2C5CA 3CKIB 1QILA 1KDCA 4DNTB 1KDBA 3WOFA 1LACA 2ICEC 2IL8A 3BYTB 3Q0AA 3I4MB 1H9SB 1Z47A 3OWEB 5M5WB 2KOLA 3A7LA 4BS9A 5A2QL 3K7AB 3X3MA 4DFAA 4IURA 2JA5B 3MFYA 4ZLTF 4K8IA 2NUCA 2GA4B 5C4JB 3S1RB 5C0XI 2NWGA 1II3A 1HXYD 3FMCA 3H09A 2F0PA 3BS1A 3KLSA 5IOCA 4QIWB 5EPJA 3G7LA 1S5DD 5E4XA 2K5DA 5EKKA 1SJHD 5JAVA 2PMZB 1JB3A 4RA8A 1PZJD 1QWYA 1RHPA 3A56A 5A2QE 2R3ZA 3M3YB 3NWSA 2B2UC 1GHJA 2NYZD 3RZOB 2BDNA 3KK7A 2BA0A 4KV6A 1OXTA 1HTLD 3S17B 1C4QA 5J39A 2EJMA 2KJXA 1B53A 1F2YA 1TU2B 2WIIB 1HFGA 3VA5A 2HCCA 4NP5A 2IWHA 3HEJA 2B39A 2DNEA 3NK9A 3C3LA 4A3IB 3FVQA 1SYCA 3SXHA 3PIP3 3S2DB 2KUMA 1ZKOA 5BN4A 1RJTA 1EEID 2F0KA 3NPPA 1VCIA 1PTOC 1A6XA 2O2LD 5CGKA 3E6ZX 5JPNC 4C3JB 2JA6B 1TWFB 3OIPA 1AZPA 1CZWA 3FDTA 5F2DA 3QOLA 4Y7NB 1IYUA 1EZ6A 5NUCA 4ILWA 1BOSA 2RKSA 2NB0A 4U68A 1LTAD 3OHXC 3MXNA 2F0GA 2XSCA 4RKBA 3K5LA 2PZWA 5KRUA 5I9OA 3RMHA 3KF8A 4MN3A 3RD4A 3GD7A 1EYDA 4K6LA 5CV5A 3L7ZC 3H91A 4KJOA 1BF4A 2FINB 2F0IA 5KGUA 2F0UA 1NAPA 3NQTA 5CV6A 3I90A 3SHLA 4IFDJ 2RDHA 1GHKA 4KY5A 4XYOA 1IW7D 4DF7A 2F0LA 4BBSB 3DM1A 5M5XB 1ML0D 2AUJD 4C1NK 2I07B 1EWHA 4J6HA 4C3IB 5IGCA 1XWEA 2QF7A 3C2PA 2A73B 1SYBA 3T53B 5ISRA 1VF7A 5E3FA 4K5XA 3QIAA 1UEAB 2VXWA 4NW2A 4FO2A 1X32A 1PTOD 5D3DA 1G2SA 2ZXOA 4RAUC 3CRKC 4OO1H 1I6HB 3HG9A 3K6OA 3PO2B 1CQVA 2A6EC 1PRTD 3DMUA 3J7AF 3E0JA 4O42A 1SE3A 4KMUC 1CI3M 4IFDH 2AQ2B 1JWMD 1HQMC 4K8JA 5EKIA 1SAPA 1HHVA 1SSOA 1EYAA 4E6IA 4HMJA 1ZXTA 2PCFB 2Q8TA 2L9HA 4S3SA 3FPPA 2RBMA 4XQNA 1BR9A 3ONAB 2VUMB 3GTPB 3SE0A 2N88A 2QCPX 3OMGA 3D3RA 3GO5A 2MGSA 2IT1A 3MC0B 1YNNC 3BZDB 2CHBD 2FJ2A 5FO9B 1WD1A 3FRPB 3CRLC 5K36G 2BOSA 2H4OA 4FF3A 3GTLB 3AU7A 4ZK9B 3GTJB 3T4AC 2NTSA 3D4RA 2ICIA 3A8JE 5I2XA 1OXSC 1CQFA 1GUGA 3PO3B 2D5DA 1AZQA 3TZDA 1GXDC 1JWUD 2JP1A 2OEOA 3VR3A 4MIUA 1FNUA 3H6MA 1E2WA 2EY1A 1KDAA 1IKMA 2OXPA 2WAQB 2B2VA 1L0YB 2XWBB 1LTSD 4FXDA 2F0EA 2F0HA 4KY6A 2E75C 1I4GA 2IW3A 4K14A 2HCIA 4F88A 1EY6A 1T5EA 1I6VC 3R3OA 1LT4D 3HRZC 2F0WA 4Q0FA 1KABA 1DOLA 3GTOB 1EOTA 3AMUA 1EYCA 4ODGA 2B2YA 3DWQA 1SFOB 2AWOA 1OXVA 3KBXA 1VMPA 4F8MA 2AUKA 5ELCA 1RKNA 4CKCA 5CYUA 1ENCA 1CA6A 2OT2A 2XIWA 2XVSA 5C3WA 2A74C 2NN6G 5FO8B 5EJWA 4FXKC 4XQJA 3A55A 5FKAC 2NVTB 1G291 3S1QB 3D4DA 2A69C 4DAPA 1MI2A 3J7AV 1QG7A 3L9AX 1EWCA 1DD2A 2ZXPA 1I3QB 3I72A 2BA1A 3G6JB 1HA6A 5CBEE 1S5CD 3SK6A 2B2VC 4XDXA 1B50A 1SE4A 2B2TC 1A2UA 2L11A 1Y1WB 4ZUIA 2JA8B 4ZRZA 3MWYW 5D3IB 2RDGA 5EGTA 5IT9L 2EYHA 1D5ZC 5JEAJ 4X3TA 3NTKA 2O5JC 1DCZA 2B2YC 4KJNA 3MZ5A 5DM73 2RA4A 1MSHA 1S5ED 3DHQA 2QILA 4DN4M 3HZXA 3SDZA 3UI2A 4EVOA 1JR0D 5C3EB 1PMRA 3SVMA 5T1IA 4FNFA 2NVYB 3NE5B 5J1ZA 4IN3A 1A15A 2TSSA 1PYWD 1LTTD 2F0QA 2LY7A 5IT9E 1MSGA 1DOMA 4A3FB 3P75A 1WTVA 1TQOA 2J7ZA 5D14A 2NVQB 3S1MB 2K33A 3QO2A 3P1HA 1GJXA 3TN2A 2IPKD 1TWAB 3OOCA 2LFNA 4C3HG 4DAVA 5C0XG 3K0YA 5JEAH 4K6DA 3DXJC 4CKBA 3T56B 1AW7A 4H0LC 1W6KA 2CW0D 3MXUA 2B8FA 4HEDA 1WCMB 1LT6D 2HQEA 1RD9D 3KBGA 4RCOA 3J7YW 1ENFA 2K01A 4RCNA 3IFDA 4HCEA 3CHBD 2Z4HA 3MTSA 2ID0A 4A3MB 1ILPA 2F4IA 2D62A 2K05A 1WTQA 2EDGA 2JA7B 5COYA 4U673 5FO7B 1D6EC 3PUZA 3JAME 3PUVA 1PFMA 2R93B 2J4XA 4NMZA 1CM9A 4WFN3 1HRJA 4BA2I 4TSSA 3M4OB 5EPKA 4ZYSA 1DONA 2NZ1D 5E4WC 2LKVA 1ICWA 1I4QA 3EJIA 3QG1A 1F9PA 1U4MA 2K6AA 2R6GA 3PUWA 5G3LD 1H9MA 1RDPD 3MA2B 4IZ8A 2F3VA 2F0SA 1RTOA 3DWAA 4N9TA 1B1ZA 2PW7A 2R92B 4H13C 3GTGB 1Y8OB 2M00A 1XXGA 3HOVB 3H94A 5CORA 2L12A 1LLRD 5K5PA 1C48A 4DU9A 5KNBA 4X3SA 4FXGC 4C56C 2R61A 1STGA 4B9XA 2HDMA 5ELFA 4UDUC 1BXTA 2MP1A 1WTPA 1SXTA 3N6RA 4XT3B 2I46A 5LHY1 1B9MA 1IW7C 2MHVA 1HFNA 3BVGA 3FEWX 3V2TA 5D65A 4NDXA 2SEBD 3U9OA 4PMWA 3R93A 2B2WA 1SYGA 3L3OC 1IHZA 1R4QB 3HGBA 5BN5A 1FR3A 1F2ZA 3A8IE 1QNUA 1ILQA 1DJRD 2ZT9C 4LK1C 3HOUB 2CQAA 1UAPA 2PO4A 1PRTC 4Z9CB 2Z1CA 2TMPA 3I4NB 1AP0A 1Y69U 4A3JB 1K8MA 5JOBA 3A54A 5EBDA 1Q3LA 3EFXD 4DK0A 1A3UA 3KLRA 3MHBA 4CGYB 5FK9C 1QB5D 2EY2A 5CMDA 2R7ZB 1F9RA 1D1IA 2L1BA 5M9OA 1HCZA 4BBRB 1MGSA 5IIFA 4F87A 1ENAA 3NP8A 2RDFA 4KN4C 1H9JA 1M8AA 1BCPB 3C1FA 3Q23A 4OIJA 2KCNA 3DWPA 3D6WA 3WDNA 1LT5D 3MVVA 3HS0C 2B2WC 1BCPF 4QUFA 2Q8IB 2F3WA 1AN8A 3I8ZA 3GP7A 1Q12A 2WKCA 2NBFA 1UNSA 1YNJD 3MXPA 4LAAA 2L55A 2YYZA 2Z8LA 4YIJA 1SNQA 5KEEA 1SNOA 3NTIA 4BY1B 1ZEQX 1L0XB 1QE6A 2LMCB 1X3QA 2EYPA 1ZYRD 1EU3A 3H3VC 1G91A 2JXMB 2X6LA 2BCOA 4OHJA 1VF5C 1KLGD 1U4RA 1B3AA 3BYYB 3BG3A 4ID6A 1W6JA 2KEEA 2E2JB 2QEJC 1LT3D 4R8NA 2FMCA 4DXGA 3BDCA 3VYRA 1NSNS 3I73A 3MAQA 5ELEA 3BDOA 3GV3A 3AB9A 4AYBB 3PIO3 2IX1A 2J0TD 1EZ8A 4M1UB 2D2CC 1HTPA 4DXFA 3U9SA 1TS4A 5DM63 1E2VA 3RUZA 2RSOA 2O4XA 1K83B 4RGNA 2A68D 2EY5A 1Q1BA 3HOYB 4K5WA 1CTMA 4B9WA 3P7JA 1O80A 1D2BA 4EQOA 1DZ1A 1TWHB 2PZTA 2NN6H 4BY7B 4Q5VA 4XXEA 2F0JA 3ITPA 5CV8A 4EQPA 3Q24A 1PFBA 4A3GB 1F9QA 4HMIA 1T5XD 1JICA 1KLUD 4ZQ3A 1R9TB 1STBA 1O7LA 2EYMA 2BE5C 4QCLA 2F1MA 1FGBD 1GUWA 1OXUA 2F0VA 1SNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBV A;  4XXE A;  4XYO A;  4G4K A;  3BS1 A;  4XQQ A;  4XQN A;  4XQJ A;  4XYQ A; 
#chains in the Genus database with same CATH topology
 4POF A;  4JI5 Q;  4GOP B;  2NVX H;  1O7Z A;  3VYS A;  4LW1 A;  2B2T A;  4YY3 L;  1K8A C;  5IP9 G;  1D5X C;  1ONL A;  3M4Q A;  1I4P A;  4JI5 L;  3ND8 A;  4A3D G;  2HIX A;  4ZAI A;  4HJ9 A;  3J80 L;  1SMY C;  2N49 A;  1N34 Q;  3HOZ B;  3MEF A;  1R4P B;  1PHJ A;  2XGT A;  2SNS A;  4OWT B;  4IFD G;  3ULP A;  5C0X J;  1KQS A;  1NUC A;  4H44 C;  2CVR A;  4G7O C;  3GTM H;  2OTJ A;  1XPR A;  1SNM A;  2OQK A;  1PH9 A;  2UUB Q;  1CT1 D;  3PV0 A;  4JYA Q;  2CWP A;  3Q22 A;  3B6Y A;  3C1E A;  4LF6 Q;  2UUB L;  4K2K A;  2JA8 G;  3QOJ A;  1JOK A;  4JYA L;  1I50 B;  1BBX C;  4H02 A;  2IY5 B;  1CHQ D;  4KKS A;  5C3X A;  3J80 E;  1MBY A;  1KNE A;  3ERO A;  4DGZ A;  3J81 i;  1GUS A;  1CZG A;  1K3B C;  5CR3 A;  2KHI A;  1ICF B;  3NUC A;  1V1Q A;  1EU4 A;  1Y8P B;  4PMB A;  5IGB A;  4KK7 A;  3OWF A;  3GTQ B;  3TP6 A;  4BA1 I;  3N52 A;  2MUY A;  4UP7 A;  3CU7 A;  4PZ8 A;  4M8A A;  1VQD A;  2MQH A;  2K03 A;  3DLL A;  5M3M H;  4GS3 A;  4TKO B;  1DYQ A;  2BE5 D;  5ELD A;  4C3H H;  5C3E G;  3HOW B;  2B8G A;  3I3C A;  1IL8 A;  1CSP A;  3ERS X;  1HPC A;  1TWG B;  1TWC B;  4JK1 C;  3VYT A;  5C0X H;  2DNC A;  1B4O A;  5KND A;  2PZU A;  1PTO H;  3EVQ A;  1TT2 A;  3A0J A;  3NQI A;  1CKM A;  2EE1 A;  4QUC A;  3VYU A;  4LF5 Q;  3S2H H;  2CW0 C;  1LO5 D;  4AYB E;  5IYD G;  3K5M A;  5EQ0 A;  1B44 D;  1LV9 A;  4OO1 I;  2RQX A;  4A3F G;  5DNF A;  1KRT A;  4LUZ A;  4DKA C;  3IAY A;  4LF5 L;  1GUN A;  3ERQ A;  3IRB A;  1GO3 E;  1LTB D;  1HQR D;  1SMY D;  4HN7 A;  2QDL A;  5J22 A;  1CFM A;  5GAG C;  3PIO A;  2VNU D;  3RR5 A;  4JBW A;  2JA9 A;  3PF4 A;  2H1E A;  1WTX A;  1NE3 A;  5JJI A;  4IFD I;  4DR5 Q;  3FPU B;  1V1P A;  1PXU A;  3T51 B;  3IL8 A;  3ULL A;  4A3K H;  3KLW A;  3D8G A;  3NBI A;  1E1O A;  2V1C C;  5GAH C;  4JBK A;  5CC4 A;  3BVM A;  2AQ1 B;  1TVX A;  1GOZ A;  2EXZ A;  2WAC A;  3OIQ A;  2JK8 A;  5LL6 S;  3OPO A;  3W1G A;  1N32 L;  5LMN Q;  4HJ8 A;  5IYC G;  4FF1 A;  2AHO B;  3S16 H;  2SDF A;  1VQ5 A;  2FMM A;  2AQ3 B;  2X6G A;  3M7N A;  2X69 A;  1SYE A;  4IPC A;  5LMN L;  2F0D A;  3KDF B;  2K1B A;  3CCL A;  2EJG C;  3NWT A;  1QNK A;  1XYI A;  1QCB D;  4CJ1 B;  1TY2 A;  3CC2 A;  2E76 C;  3M7G A;  1T9H A;  3FP9 A;  5M3F H;  4TVA B;  2Z4I A;  2JA7 G;  3O13 A;  1HUM A;  1QUQ A;  4ZKC B;  1STE A;  1S4Z A;  2B63 H;  3W2D A;  1A3V A;  3IFT A;  4R1J A;  1E0B A;  1SYD A;  5JVH 3;  2NVX B;  4L5R C;  4RWS C;  4DNR B;  4L8J A;  3I4L A;  2KHS A;  2JEB I;  4DAY A;  1SNP A;  3ULJ A;  4KHV A;  1I4X A;  1PDQ A;  4JI8 Q;  1PH6 A;  2GVA A;  2PI2 A;  1B7Y B;  1FYC A;  1TS5 A;  2EIF A;  1NR4 A;  1HZC A;  4QMG A;  5GAD C;  4JI8 L;  1X3P A;  1A8V A;  2XRS D;  3GTM B;  2D9U A;  1Y1V H;  1IYV A;  4A3B H;  1H95 A;  2WV6 D;  1WOC A;  1EQT A;  4CDE C;  2E2D C;  3URY A;  1EY8 A;  2QW7 A;  2NTT A;  4XYQ A;  2K5H A;  4G7Z C;  4KD4 A;  1X3E A;  2LSS A;  4JI2 L;  1S3O A;  2JA5 G;  2WP8 J;  1GKH A;  2PW5 A;  2EYL A;  2K04 A;  5GAE C;  4KD3 A;  3TP8 A;  3K5N A;  2ZM6 Q;  5EBC A;  1BDO A;  1D1K A;  4O0A A;  4KHZ A;  1AE2 A;  1O7I A;  4PZ7 A;  2M9V A;  2F0O A;  3W5O A;  5FJ8 G;  3DUZ A;  3P20 A;  3HOV G;  1BKB A;  2KQ3 A;  5IT9 c;  2IHF A;  2K28 A;  4FP5 D;  1L2F A;  4A93 H;  2E2H H;  1V8Q A;  2KED A;  4IUT A;  4NXM Q;  4JI4 L;  3G71 A;  3X3N A;  3CCJ A;  1Z7T A;  4A3E H;  4NXM L;  4C2M H;  3SR1 A;  2XNA C;  5M3M B;  4RG1 A;  1E22 A;  1V43 A;  4UP8 A;  1ESF A;  3RZD H;  1SR3 A;  2N55 A;  2Y0S B;  3EQL C;  4C3H B;  4FF4 A;  4G7H C;  4HCS A;  3W3A A;  3ND9 A;  1WTR A;  1PTO B;  2F0N A;  4DR4 Q;  2IX0 A;  1Q1E A;  1B70 B;  3S2H B;  2E2I H;  4MHE A;  1IKL A;  2WB1 B;  4IUP A;  4OWW B;  4FF2 A;  2XRQ D;  4XQQ A;  4K2L A;  1H9S A;  4DR4 L;  1PTO F;  3TDQ A;  4EGV A;  4IQZ A;  3OTO Q;  3F2U A;  4A3I G;  4IUN A;  4DV1 Q;  1ET6 A;  1PRT B;  5C6A A;  2PNR C;  1K8G A;  3R2I A;  4CDC C;  2WIN B;  3GQB A;  4FVM A;  4DV1 L;  1PRT F;  4RKL A;  2EOT A;  2VB2 X;  4C1N I;  5JEA G;  1WTW A;  1SBB B;  4C3J G;  2JA6 G;  4ABN A;  4A3K B;  1G2T A;  2RHS B;  1SDF A;  1IZ6 A;  4H7B A;  5KNC A;  1DGS A;  1VMC A;  4R4I A;  2QKI C;  1HH2 P;  5KYI A;  3HOU G;  1E7Z A;  4F7X A;  3DEO A;  1D5M C;  3VR5 A;  4UAI A;  1PH7 A;  5HGT A;  3ZYY X;  2L4N A;  1C0A A;  3HP3 A;  1H9K A;  3S16 B;  1DXM A;  1G6Z A;  2F0F A;  2EPB A;  2K5Q A;  1GUO A;  4IUU A;  1KAA A;  1U4P A;  1XTC D;  4RHR A;  5IYB H;  5FOB B;  4IUQ A;  1EIG A;  3UE0 A;  4EQN A;  2UUC Q;  4DUY L;  2YU9 H;  1YJ9 A;  1E3P A;  2DN8 A;  1J9O A;  1VQA A;  4JI0 Q;  2IX3 A;  1PH4 A;  5M3F B;  5BN3 A;  1EL0 A;  2JQO A;  4N8X 1;  2UUC L;  3I70 A;  3CMA A;  1TY0 A;  2Q8R E;  4JI0 L;  2B63 B;  2MFI A;  3QJY A;  1PLF A;  1YNJ C;  3CXC A;  4A3L H;  1I4H A;  4J1M A;  2B29 A;  2WKD A;  3VR2 A;  3EBE A;  2K5V A;  4YHH Q;  4PQX A;  2Q2U A;  4HAE A;  4IAL A;  3BVZ A;  2NZH A;  2DY8 A;  2QDB A;  3LGJ A;  1JC7 A;  4GZY C;  1ZYR C;  4YHH L;  3STB D;  4C3I G;  5JPM C;  1KTK A;  3ER0 A;  3NXW A;  3TP7 A;  2MO1 A;  5TSS A;  4CBV A;  1WTO A;  5A35 A;  1LTG D;  1Y1V B;  1E1T A;  4P2C B;  5C44 H;  2P5Z X;  4A3B B;  5GQO A;  1WJJ A;  4XIG S;  1NMF A;  2IJ0 A;  5H1S E;  5JVG 3;  1MJC A;  1N8R C;  1IBL Q;  3F1Z A;  4X62 L;  3I91 A;  5I9P A;  1YIT A;  5JJK A;  4TRD A;  1MIU A;  1F9S A;  3KF8 B;  5I2Y A;  1IBL L;  5IGE A;  4BY1 G;  1YHQ A;  5EKL A;  3NBH A;  3OMC A;  5CV4 A;  2UXC Q;  5FLM H;  3F8T A;  2A5H A;  3HOX H;  3PO2 G;  1LTR D;  3NTH A;  1VQ6 A;  1F2L A;  5JJZ A;  1S5B D;  4A93 B;  4KY7 A;  2E2H B;  1BQQ T;  1STH A;  1JJG A;  1K8O A;  2KBN A;  2PQE A;  4GLV B;  1U4L A;  4OGQ C;  3SK8 A;  2A68 C;  4PV1 C;  4A3E B;  3E0E A;  5C4H A;  4C2M B;  2N8N A;  3H0G H;  4WRD A;  1B9N A;  3NSW A;  4CJ0 B;  1AFP A;  1F77 A;  1X56 A;  4OL7 A;  1LAB A;  5I6Y A;  5KYL A;  5K36 H;  4XTC S;  1U9R A;  2OF1 A;  4TQU S;  4GKK L;  3RZD B;  1FD7 D;  1TS3 A;  2MJ8 A;  4R8I A;  4N9P A;  1PFS A;  5IY0 A;  3EA6 A;  2WB1 E;  1SYF A;  1VDZ A;  3HKZ B;  1M4V A;  1EYG A;  2VUM G;  1J8I A;  4AYB G;  3SK5 A;  2E2I B;  1F2M A;  4HIM A;  1TKW B;  2L5T A;  1YBY A;  3I56 A;  5AJ3 Q;  4LF9 Q;  1STN A;  4RGT A;  1J6Q A;  1W2B A;  4YWM A;  1Q81 C;  4QGU A;  3CCV A;  4JI7 L;  4QF4 A;  3H15 A;  1WI5 A;  1NTG A;  1KL9 A;  3J81 L;  4G57 A;  3TP5 A;  5AJ3 L;  4LF9 L;  3TZU A;  4G4K A;  1O78 A;  3T16 A;  1EFI D;  3NEM A;  2EZV A;  3FKI H;  4IOA A;  4GN4 B;  1PA6 A;  4LWC A;  4KI0 A;  4GNX B;  4ULL A;  4HR7 B;  1UE6 A;  2EYJ A;  5IGF A;  2ATW A;  1JQY D;  4DV2 L;  5LMN W;  1E2Z A;  4IJL A;  1DOK A;  3QWN A;  3K57 A;  3TBI B;  5IGG A;  1JWS D;  1JOR A;  5IP9 H;  4RGM A;  1UE5 A;  4MZ9 A;  4A3D H;  1Q86 C;  3K58 A;  2JYO A;  4KLK A;  3WOE A;  1HZ9 A;  1QJO A;  2KA7 A;  1CA5 A;  1MD2 D;  5IOD A;  3CCE A;  2G5D A;  5M5Y H;  4KN7 C;  3J81 E;  2GVB A;  4X3K A;  2YU9 B;  2Z6B A;  1PZK D;  2HUG A;  4V19 0;  1JT8 A;  5CBA E;  3QB3 A;  4J8Q A;  2WAQ G;  4P74 A;  2AWN A;  4B3M Q;  1LTL A;  1ROD A;  2G9D A;  1IYJ B;  1RF2 D;  4LMQ D;  1PZI D;  4B3M L;  1VQN A;  2K5N A;  1EY4 A;  1ASY A;  3HOZ G;  2C9O A;  5AFW A;  1TII D;  1A0I A;  4A76 A;  1CHP D;  1BCP C;  2RVL A;  1HZB A;  1SJE D;  1A3T A;  3S14 H;  1EY5 A;  3KF6 A;  2R7F A;  3KOJ A;  4HJA A;  5DAU A;  1ESR A;  1B8A A;  3VA7 A;  5IGD A;  4LJZ C;  4KHP Q;  2RF4 A;  5C44 B;  2VB3 X;  4PZ6 A;  1EIH A;  3EN2 A;  2N3S A;  3SK4 A;  5C4X H;  1Q8I A;  5ELB A;  3GTK H;  1LTI D;  3S1N H;  4IUV A;  3LNN A;  3RNU A;  2UXD Q;  3E5S A;  1UUP A;  3LWE A;  2K32 A;  4L63 B;  1QOH A;  3TSS A;  4GKJ Q;  3OW2 A;  3TRZ A;  3G48 A;  3RLF A;  1DM0 B;  1Q90 A;  1V1O A;  4OO1 G;  5IYD H;  1NCV A;  5C5L A;  3HOX B;  3NHH A;  3RN2 A;  3C46 A;  3SEB A;  4FYD A;  3LX0 A;  2PQA A;  2A6E D;  3CQZ H;  4HTH A;  1JOQ A;  1A62 A;  1EY9 A;  4GOP A;  4JVZ A;  1YEZ A;  2YTX A;  2K5W A;  1AH9 A;  2YTV A;  3D6C A;  1N34 L;  1HA5 A;  3HOW G;  3H0G B;  4WJ3 M;  1CKN A;  2BDO A;  3A7A B;  2JJQ A;  4O1N A;  1JCK B;  3KLS X;  2EQS A;  1EY0 A;  1GD7 A;  5E1F A;  1BNZ A;  3HKZ E;  4HSV A;  2VL6 A;  3OW7 A;  4DR3 Q;  5CV9 A;  2VY3 A;  2A8V A;  1E24 A;  1JE4 A;  1SN8 A;  3D31 A;  4KKU A;  1Y1W G;  4OWX B;  1B2T A;  1QZG A;  1JJC B;  4DR3 L;  4CDF C;  1Q82 C;  2PPB C;  2DY7 A;  4GN5 A;  1SEB D;  4KKT A;  2RSN A;  5IYC H;  4LF6 L;  3S9W A;  3D4W A;  3UE1 A;  2K7V A;  3M4Y A;  1N9W A;  1BCP D;  2MPM A;  2EXD A;  1XX8 A;  1XNR Q;  1CK1 A;  3FKI B;  4DA2 A;  1C8C A;  1YNN D;  3MFG A;  2ZXR A;  2EJF C;  2FFK B;  1VQH A;  2F0M A;  4WJW A;  2A6H C;  3CW2 C;  2EYO A;  1VQC A;  1XNR L;  2KCC A;  4GLA C;  4OIK A;  4RGO S;  2ENB A;  2F03 A;  3PMF A;  4RH6 A;  3S15 B;  2L0C A;  4I65 A;  4XT1 B;  1FNW A;  5DEH A;  3M85 A;  1K28 A;  3MXG A;  4ZKB B;  4ME5 A;  1VQG A;  4A3D B;  2PYK A;  1FGU A;  4V0B A;  5HY6 A;  3LWU A;  5G3L F;  2VQF Q;  1HNZ Q;  4PNY A;  5C4Z A;  2EY6 A;  2HD3 A;  1OXX K;  3CC4 A;  1IBM Q;  5M5Y B;  1GM5 A;  2VQF L;  4K5V A;  5C5M A;  1HNZ L;  3I4M H;  2SNM A;  4NKL A;  2KVM A;  3CME A;  5KIX A;  2DJF C;  4DNI A;  2JSO A;  4GOP C;  1IBM L;  4RHS A;  5EPL A;  4R9W A;  1Z6H A;  2N78 A;  3K7A H;  1TR5 A;  1G6P A;  1CKO A;  1PFN A;  3DEP A;  1G8Z D;  1H9R A;  3IKJ A;  2JE6 I;  2JA5 H;  4JI6 Q;  1KNA A;  3BZC A;  4LFC Q;  3V96 A;  2OQ0 A;  4YCV A;  5C4J H;  1V1P B;  1S5F D;  2SOB A;  3MEH A;  4DAM A;  4DR5 L;  4LFC L;  3J80 c;  1L1O A;  2FHT A;  3T13 A;  1X6O A;  1WD0 A;  3K59 A;  3S14 B;  1O7Y A;  1WCM G;  3R2T A;  5EAY A;  4X64 Q;  3V05 A;  3PUX A;  4DK1 A;  2B3G A;  2Q2T A;  5HUR A;  2KEC A;  3TME A;  5IE8 A;  4A3M G;  5C4X B;  4X64 L;  3GTK B;  2V4D A;  4A3C G;  3RZO H;  2E74 C;  3S1N B;  1I4R A;  2LS0 1;  1VQ4 A;  4L6T B;  3BDL A;  1ET9 A;  4JCV E;  1SNC A;  3S17 H;  1EEF D;  2KEN A;  3GV6 A;  2FXQ A;  2M2L A;  1XMQ Q;  1RCV D;  2A6H D;  1A2T A;  3KUP A;  2F0T A;  1X65 A;  4BWG B;  3BZK A;  1I94 Q;  2K14 A;  4BXX H;  5FLX L;  2NN6 I;  3K5O A;  3VR6 A;  1OO9 B;  1EUJ A;  1NY4 A;  5I4D A;  2HHH Q;  2R93 G;  2JEA I;  4DV3 Q;  1I94 L;  1D8L A;  2A69 D;  1HR0 Q;  1Y8N B;  4A3I H;  1GUT A;  1FNV A;  3CQZ B;  3S2D H;  2HHH L;  1FVI A;  4DV3 L;  3K7U C;  1HR0 L;  4QB4 A;  1AEX A;  3RLN A;  5CV7 A;  4B08 A;  2XN9 C;  3OSO A;  5I6W A;  4GLX A;  2O5I C;  1SE2 A;  4I7Z C;  3G4S A;  3H3V H;  4IOC A;  4CKE A;  1RL2 A;  1BO0 A;  4C3J H;  1TWF H;  4WOR A;  1KXL A;  3CCR A;  3JAM L;  2G9H D;  4P73 A;  3A8K E;  4PMC A;  4Y7N H;  3E9I A;  5FLX E;  1TS2 A;  3VR4 A;  2R92 G;  2ASB A;  2Z9H A;  1BUV T;  3R8B A;  3PUY A;  1NR2 A;  1L1O C;  1STA A;  1EY7 A;  2VS1 A;  2XWJ B;  1WVL A;  5LMU Q;  2ZM6 L;  4CHT B;  1Q7Y C;  4O2D A;  1EIY B;  3DM3 A;  5T1G A;  2EYF A;  2B2U A;  1RTN A;  1Z9F A;  1JOO A;  2HDL A;  4X3U A;  3Q6S A;  4CJ2 C;  3WWV A;  1STY A;  4ZUJ A;  1UE7 A;  4YCW A;  1EQV A;  5LL6 X;  1HUN A;  4KTA A;  2EVB A;  4RFB A;  4HSP A;  3KJP A;  1YHB A;  2C5C A;  4IO9 A;  3CKI B;  1LM0 A;  1QIL A;  1KDC A;  4DNT B;  4BBS H;  1KDB A;  5M5X H;  2LXK A;  3STB C;  4GN3 B;  1WFQ A;  3WOF A;  4OON A;  1LAC A;  2A19 A;  4C3I H;  2ICE C;  2IL8 A;  3BYT B;  3Q0A A;  3I4M B;  3EIV A;  5M3F G;  1H9S B;  1Z47 A;  3OWE B;  5M5W B;  2KOL A;  3A7L A;  4BS9 A;  5A2Q L;  2B63 G;  4UP9 A;  3OTO L;  1EQQ A;  3K7A B;  2MNA A;  5L37 A;  3X3M A;  4DFA A;  3CCU A;  4IUR A;  2JA5 B;  3MFY A;  1YJW A;  4EQ5 A;  1V9P A;  4ZLT F;  1ASZ A;  3TRE A;  4K8I A;  2NUC A;  2GA4 B;  5C4J B;  3S1R B;  5C0X I;  2NWG A;  1II3 A;  1HXY D;  3FMC A;  1I6H H;  3H09 A;  2F0P A;  3M9B A;  3ZJY C;  3BS1 A;  2OWO A;  3KLS A;  5IOC A;  4QIW B;  5EPJ A;  3PO2 H;  3G7L A;  1S5D D;  2K75 A;  2K5D A;  5E4X A;  5EKK A;  1QVG A;  1SJH D;  5JAV A;  1VQ8 A;  2PMZ B;  1JB3 A;  4RA8 A;  3I4N G;  1PZJ D;  1QWY A;  1BBW A;  3K80 C;  4JI1 Q;  4QY7 A;  4A3J G;  1RHP A;  3A56 A;  5A2Q E;  2R3Z A;  3M3Y B;  3NWS A;  2CQO A;  2B2U C;  4HJ7 A;  3U50 C;  4DV6 Q;  1GHJ A;  2NYZ D;  3RZO B;  2BDN A;  3KK7 A;  4JI1 L;  2UUA Q;  2BA0 A;  4KV6 A;  3PF5 A;  1OXT A;  4DR6 Q;  1VQF A;  1HTL D;  2DGY A;  3S17 B;  1C4Q A;  2BH8 A;  4DV6 L;  1N33 Q;  3TS2 A;  5J39 A;  2EJM A;  3UDI A;  2KJX A;  1B53 A;  1F2Y A;  2R7Z G;  4DR6 L;  1TU2 B;  4JBM A;  2CKZ B;  3J7A 5;  2VUM H;  2WII B;  1N33 L;  3GTP H;  1HFG A;  2VQE Q;  3VA5 A;  1X3F A;  4BBR G;  2HCC A;  4NP5 A;  2IWH A;  3HEJ A;  3GDE A;  3F2C A;  2B39 A;  1U5K A;  2DNE A;  3NK9 A;  3C3L A;  4A3I B;  2PI2 E;  3FVQ A;  1SYC A;  4L5T A;  2VQE L;  3SXH A;  3PIP 3;  3S2D B;  2KUM A;  1WYD A;  1ZKO A;  1UWV A;  2ALY B;  5BN4 A;  1RJT A;  1EEI D;  2F0K A;  3NPP A;  1VCI A;  5JJL A;  1B3Q A;  1PTO C;  1A6X A;  2O2L D;  5CGK A;  1JJ2 A;  3E6Z X;  4APV A;  5JPN C;  4C3J B;  2JA6 B;  1BBU A;  1TWF B;  3JAM i;  3OIP A;  1AZP A;  1CZW A;  3GTJ H;  2YV5 A;  3FHW A;  3FDT A;  5F2D A;  3RLO A;  3QOL A;  4Y7N B;  1IYU A;  1EZ6 A;  5NUC A;  4ILW A;  1LUZ A;  4QL5 A;  1BOS A;  3PO3 H;  2RKS A;  2NB0 A;  4U68 A;  1LTA D;  3OHX C;  2CFM A;  3MXN A;  1PH1 A;  2F0G A;  2XSC A;  4RKB A;  3K5L A;  2PZW A;  3NBH B;  5KRU A;  5I9O A;  3RMH A;  4HIK A;  3KF8 A;  4MN3 A;  3RD4 A;  2UXC L;  3GD7 A;  1EYD A;  3G6E A;  4K6L A;  5CV5 A;  1EOV A;  3L7Z C;  3H91 A;  4KJO A;  4LUV A;  4ZCK A;  1YI2 A;  1BF4 A;  2FIN B;  2F0I A;  5KGU A;  4R4O A;  4B3S Q;  2F0U A;  2Y0S E;  1NAP A;  3NQT A;  4FDB A;  2GN5 A;  4A4I A;  5CV6 A;  3I90 A;  4B3S L;  3SHL A;  3CPW A;  4IFD J;  4DK3 C;  2RDH A;  1GHK A;  1CUK A;  4AH6 A;  4KY5 A;  4DR7 Q;  1IBK Q;  4DK6 C;  4XYO A;  1IW7 D;  4DF7 A;  4NB3 A;  1VS0 A;  2F0L A;  4BBS B;  3CF5 A;  3DM1 A;  3PGZ A;  5M5X B;  2ES2 A;  1MKH A;  1ML0 D;  2AUJ D;  4C1N K;  4DR7 L;  1IBK L;  2I07 B;  1EWH A;  4J6H A;  4C3I B;  1EFW A;  3GTO H;  2KHJ A;  5IGC A;  1XWE A;  4PG3 A;  1SFO H;  2QF7 A;  3C2P A;  2A73 B;  1SYB A;  3T53 B;  5ISR A;  3J81 j;  1VF7 A;  3HOY G;  3CCM A;  5E3F A;  4K5X A;  1W3S A;  4R4T A;  3QIA A;  1UEA B;  5HGQ A;  2I5H A;  5J3B A;  2VXW A;  5DLQ E;  4A3L G;  4NW2 A;  1PV4 A;  2CCZ A;  4FO2 A;  4L5S A;  1X32 A;  1PTO D;  4HJ5 A;  5D3D A;  1G2S A;  3U58 A;  1MHW C;  1VQB A;  3JC6 6;  2ZXO A;  4BY7 G;  4RAU C;  3CRK C;  4QIW E;  4OO1 H;  1I6H B;  3S15 H;  3HG9 A;  3K6O A;  2NVT H;  2PMZ E;  3S1Q H;  4CDD C;  4A3G G;  3PO2 B;  2KCM A;  1CQV A;  2RCN A;  4GNX A;  1EQR A;  2A6E C;  1PRT D;  3DMU A;  3J7A F;  2F4V Q;  5C44 G;  3E0J A;  1I3Q H;  4O42 A;  1SE3 A;  4KMU C;  1CI3 M;  4IFD H;  2ZTD A;  2AQ2 B;  2Q2H A;  2F4V L;  1JWM D;  1X55 A;  1HQM C;  4K8J A;  5ELO A;  5EKI A;  1SAP A;  1HHV A;  2QA4 A;  1SSO A;  4X65 Q;  1EYA A;  4E6I A;  4HMJ A;  1ZXT A;  2VW9 A;  2PCF B;  1SLJ A;  2Q8T A;  2CH4 W;  2L9H A;  4S3S A;  2LXJ A;  3FPP A;  1VQO A;  4X65 L;  1C9O A;  2RBM A;  4XQN A;  3F2D A;  4K0K Q;  3D0F A;  1YVC A;  1BR9 A;  3ONA B;  2VUM B;  3TQY A;  1Y1W H;  2JA8 H;  3GTP B;  4LF8 Q;  3SE0 A;  2N88 A;  4K0K L;  2QCP X;  3OMG A;  4LF8 L;  3D3R A;  3GO5 A;  2Z0S A;  2MGS A;  2IT1 A;  3CP0 A;  3MC0 B;  2F3I A;  3KF6 B;  1YNN C;  3BZD B;  2CHB D;  2FJ2 A;  5FO9 B;  1WD1 A;  3FRP B;  3CRL C;  5K36 G;  2ZTC A;  2QGQ A;  3PIP A;  2BOS A;  2H4O A;  4FF3 A;  3GTL B;  3AU7 A;  2OTL A;  1UEB A;  4KHP L;  4ZK9 B;  3GTJ B;  3T4A C;  1HNW Q;  4JPB W;  2NTS A;  3D4R A;  2ICI A;  3A8J E;  4OX9 Q;  5I2X A;  5C3E H;  1OXS C;  4YCU A;  2I5M X;  1VQM A;  4DV0 Q;  1CQF A;  1GUG A;  3PO3 B;  2D5D A;  1AZQ A;  3TZD A;  2UXD L;  2NVY H;  4OX9 L;  1VQ7 A;  4LFA Q;  4GKJ L;  1GXD C;  1JWU D;  4DV0 L;  1S72 A;  1IL2 A;  2JP1 A;  1IXR A;  2OEO A;  3VR3 A;  3J81 c;  3PSI A;  4A3F H;  3FKI G;  4MIU A;  4GNX C;  1FNU A;  3H6M A;  4LFA L;  1E2W A;  1VQI A;  2NVQ H;  1OTC A;  1VQL A;  3S1M H;  2EY1 A;  1KDA A;  1YZ6 A;  1IKM A;  1TWA H;  2OXP A;  2WAQ B;  2B2V A;  3K8A A;  1L0Y B;  2XWB B;  1LTS D;  2HQL A;  4FXD A;  1I5F A;  2F0E A;  1CKN B;  4DV4 Q;  2F0H A;  4KY6 A;  2E75 C;  1I4G A;  2IW3 A;  4K14 A;  2HCI A;  4JW0 A;  2WFW A;  4F88 A;  5IP7 G;  1EY6 A;  1I6V C;  1T5E A;  4DV4 L;  2Z6K A;  3R3O A;  1LT4 D;  3HRZ C;  4JI3 Q;  2XTI A;  3KFU A;  2F0W A;  4Q0F A;  1KAB A;  1WCM H;  1BVS A;  1DOL A;  3GTO B;  1EWI A;  1EOT A;  3AMU A;  3J7Z C;  3AFQ A;  1EYC A;  3TS0 A;  4ODG A;  2B2Y A;  3DWQ A;  4JI3 L;  1SFO B;  2AWO A;  1OXV A;  4A3M H;  3KBX A;  1VMP A;  4F8M A;  3ICE A;  2AUK A;  4A3C H;  5ELC A;  1K9M C;  1RKN A;  4CKC A;  5CYU A;  1ENC A;  1CA6 A;  2OT2 A;  4P72 A;  2XIW A;  2XVS A;  5C3W A;  3UDX A;  2JA7 H;  4JV5 Q;  2A74 C;  2NN6 G;  3BJU A;  5FO8 B;  5EJW A;  2CH4 A;  4FXK C;  4XQJ A;  3A55 A;  4JOI A;  5FKA C;  2NVT B;  4JV5 L;  1G29 1;  3S1Q B;  3D4D A;  2A69 C;  4DAP A;  1MI2 A;  3J7A V;  2R93 H;  1QG7 A;  3L9A X;  1EWC A;  2D0O A;  4ME3 A;  4HID A;  3M4O H;  1N36 Q;  1DD2 A;  2ZXP A;  5C4X G;  1I3Q B;  3I72 A;  2BA1 A;  1XNQ Q;  1N36 L;  4X66 Q;  3G6J B;  1HA6 A;  4B3R Q;  1PH3 A;  5CBE E;  1Y14 B;  1S5C D;  5M5W H;  1XNQ L;  3SK6 A;  2ZJR A;  4X66 L;  4B3R L;  2B2V C;  4XDX A;  1B50 A;  4LF7 Q;  1SE4 A;  2KCT A;  2B2T C;  1A2U A;  1PYS B;  2L11 A;  4R4Q A;  1Y1W B;  4ZUI A;  2JA8 B;  4ZRZ A;  2R92 H;  4LF7 L;  1X54 A;  3S1R H;  3GTG H;  3MWY W;  5D3I B;  1MJE A;  4JI6 L;  2RDG A;  5EGT A;  4DUZ Q;  5IT9 L;  5FJ8 H;  2EYH A;  2Z6K C;  1D5Z C;  5JEA J;  1QVC A;  3HOV H;  1L1O B;  4X3T A;  1HNX Q;  5IWA Q;  3K0X A;  4P75 A;  4DUZ L;  2D0P A;  3NTK A;  2O5J C;  1DCZ A;  2B2Y C;  4KJN A;  1HNX L;  5IWA L;  1M1K C;  3MZ5 A;  5DM7 3;  2RA4 A;  1KIX A;  3M3Y H;  1S5E D;  1MSH A;  1N32 Q;  3DHQ A;  2QIL A;  3I7F A;  4DN4 M;  3HZX A;  3SDZ A;  3UI2 A;  3NEN A;  1Q8K A;  1KRS A;  4EVO A;  1JR0 D;  5C3E B;  1PMR A;  3SVM A;  3PQI A;  2QEX A;  5T1I A;  4FNF A;  2RHQ B;  1YHA A;  1GVP A;  2NVY B;  3KDF A;  3NE5 B;  4JOI C;  1QUQ B;  5J1Z A;  4IN3 A;  1A15 A;  2TSS A;  1PYW D;  1LTT D;  2F0Q A;  2LY7 A;  5IT9 E;  1XMQ L;  1MSG A;  1DOM A;  4A3F B;  5E7N A;  3P75 A;  1WTV A;  1TQO A;  2J7Z A;  4JC0 A;  5D14 A;  4DAY B;  1SRU A;  2DUD A;  2NVQ B;  3S1M B;  2K33 A;  4L5Q A;  2WAQ E;  3QO2 A;  1P8L A;  3P1H A;  1GJX A;  3TN2 A;  5M3M G;  2IPK D;  1TWA B;  3OOC A;  1NJI C;  2LFN A;  2Y0S G;  4C3H G;  1HJP A;  4DAV A;  5C0X G;  4LF4 Q;  3K0Y A;  5JEA H;  1XTD A;  4K6D A;  1X3G A;  3J80 i;  2JA6 H;  3DXJ C;  4CKB A;  3U4V A;  3T56 B;  2WB1 G;  1CSQ A;  4LF4 L;  1AW7 A;  3HOU H;  4H0L C;  1W6K A;  2CW0 D;  3CC7 A;  4QJF A;  3MXU A;  2B8F A;  3T1H Q;  1VQJ A;  3I4M G;  1TXY A;  2UU9 Q;  2E5L Q;  1PH2 A;  4HED A;  4JI2 Q;  1WCM B;  1SMX A;  3I4N H;  2ZJQ A;  1LT6 D;  3T1H L;  2HQE A;  2UU9 L;  1RD9 D;  3KBG A;  4RCO A;  3J7Y W;  4A3J H;  1ENF A;  2K01 A;  4RCN A;  2E5L L;  3IFD A;  4HCE A;  3CHB D;  2Z4H A;  3MTS A;  2ID0 A;  3SGI A;  4A3M B;  1ILP A;  2F4I A;  2D62 A;  2K05 A;  5LMU L;  1WTQ A;  1S40 A;  4A3K G;  2EDG A;  2JA7 B;  5COY A;  3S24 A;  4U67 3;  2A1A A;  5FO7 B;  2R7Z H;  5GRO A;  1D6E C;  2OCE A;  3PUZ A;  4YWK A;  4JI4 Q;  3JAM E;  2HT1 A;  3QR8 A;  1VQP A;  3PUV A;  1PFM A;  3RN5 A;  4BBR H;  3E3X A;  2R93 B;  2J4X A;  4NMZ A;  1PYB A;  1CM9 A;  4WFN 3;  1HRJ A;  4MTN A;  4BA2 I;  4TSS A;  3M4O B;  5EPK A;  4ZYS A;  3HFZ B;  4JG2 A;  1DON A;  2NZ1 D;  5E4W C;  2LKV A;  4IPG A;  1ICW A;  1I4Q A;  1VQ9 A;  4N8F A;  3EJI A;  2BH2 A;  3QG1 A;  1F9P A;  1U4M A;  2K6A A;  2R6G A;  1WTH A;  3E9H A;  3PUW A;  1KAW A;  5G3L D;  4BXX G;  1H9M A;  1RDP D;  3MA2 B;  1A63 A;  3I2Z A;  4IZ8 A;  2F3V A;  2F0S A;  1RTO A;  3W1B A;  1K3R A;  5FLX c;  3DWA A;  4N9T A;  1B1Z A;  2NZO A;  2PW7 A;  2R92 B;  4H13 C;  4BY1 H;  3GTG B;  1Y8O B;  1YJN A;  1K0R A;  2RCF A;  2YTY A;  2M00 A;  1XXG A;  3HOV B;  2K4K A;  4POG A;  2JN4 A;  3H94 A;  1Y1V G;  5COR A;  2L12 A;  1LLR D;  5K5P A;  1QVF A;  4A3B G;  1C48 A;  1EIF A;  4DU9 A;  4J15 A;  5KNB A;  3CAM A;  4LNQ A;  4X3S A;  4FXG C;  2AMC B;  3I4O A;  2R61 A;  4C56 C;  1STG A;  2HDM A;  5ELF A;  4B9X A;  4UHV A;  1KC8 C;  1SE8 A;  3JAM c;  4UDU C;  1BXT A;  2E2J H;  2MP1 A;  4AQY Q;  1WTP A;  3A5Z B;  1SXT A;  3N6R A;  3K81 C;  4XT3 B;  2I46 A;  5LHY 1;  1B9M A;  4MTK A;  2UUA L;  4IPH A;  4AQY L;  1IW7 C;  2MHV A;  4DUY Q;  1HFN A;  4QQB X;  3BVG A;  4I7A A;  4A93 G;  3Q8D A;  3FEW X;  3V2T A;  2I5L X;  5D65 A;  4NDX A;  4LFB Q;  2SEB D;  4WJ4 A;  1FL0 A;  2CWA A;  3U9O A;  4PMW A;  1K83 H;  3R93 A;  2B2W A;  4A3E G;  1KHI A;  1SYG A;  1X9N A;  3L3O C;  4LFB L;  1J5E Q;  1IHZ A;  2K52 A;  2L15 A;  3HOY H;  1R4Q B;  3HGB A;  4IPD A;  4IJH A;  5BN5 A;  1FR3 A;  4DV5 Q;  3GTL H;  1F2Z A;  3A8I E;  1TWH H;  1QNU A;  1J5E L;  1ILQ A;  3HKZ G;  1DJR D;  4BBS G;  2ZT9 C;  4DV5 L;  4BY7 H;  4LK1 C;  5ELN A;  4DR1 Q;  2CQA A;  3AQQ A;  3VDY A;  3HOU B;  1K0S A;  1UAP A;  2PO4 A;  1PRT C;  4Z9C B;  4A3G H;  4X6A H;  1R9T H;  2Z1C A;  4DR1 L;  4X62 Q;  3OYY A;  2TMP A;  2VZA A;  3I4N B;  1AP0 A;  3MXN B;  2E8G A;  1Y69 U;  4A3J B;  1PH8 A;  1P16 A;  1K8M A;  5JOB A;  1XPO A;  3A54 A;  1QZH A;  1G51 A;  5EBD A;  1UE1 A;  3CCQ A;  1Q3L A;  3H3V I;  3TEH B;  3EFX D;  4MNO A;  4YWL A;  4DK0 A;  1A3U A;  4RMF A;  3KLR A;  3MHB A;  4CGY B;  1C7Y A;  5FK9 C;  3BU2 A;  1QB5 D;  2EY2 A;  5CMD A;  1JE5 A;  2R7Z B;  3AFP A;  1F9R A;  1YNX A;  2AKW B;  1D1I A;  2L1B A;  5M9O A;  1U0L A;  1K73 C;  1HCZ A;  4BBR B;  1MGS A;  5IIF A;  3HOZ H;  4F87 A;  1ENA A;  2PNH A;  2I0Q A;  1PVO A;  1LYL A;  3NP8 A;  1M90 C;  1VQE A;  2RDF A;  1NNX A;  4KN4 C;  5IYB G;  2HIV A;  4GKK Q;  1H9J A;  2R7D A;  1M8A A;  2Q2I A;  1BCP B;  3C1F A;  4LUO A;  3Q23 A;  4OIJ A;  4HIO A;  3T1Y Q;  2KCN A;  3AEV A;  3DWP A;  3D6W A;  1SRO A;  1Q46 A;  3WDN A;  1LT5 D;  3MVV A;  3HS0 C;  4AIM A;  2B2W C;  1BCP F;  1AE3 A;  4QUF A;  1FJG Q;  2Q8I B;  2F3W A;  3T1Y L;  1AN8 A;  2ZTE A;  3CPF A;  3I8Z A;  3GP7 A;  1Q12 A;  3U4Z A;  1I50 H;  2WKC A;  2NBF A;  1FJG L;  1UNS A;  1YNJ D;  3A74 A;  3MXP A;  4LAA A;  4EX5 A;  4JI7 Q;  2L55 A;  2YYZ A;  2Z8L A;  4YIJ A;  2DJG C;  1SNQ A;  5KEE A;  1SNO A;  3NTI A;  4BY1 B;  1PH5 A;  1ZEQ X;  3HKS A;  4P71 A;  1L0X B;  1QE6 A;  2LMC B;  4JBJ A;  1X3Q A;  2EYP A;  1ZYR D;  1EU3 A;  3H3V C;  1G91 A;  4Y52 H;  2JXM B;  2X6L A;  3GTQ H;  1JMC A;  3CD6 A;  4DV2 Q;  4OEL B;  2BCO A;  4OHJ A;  1VF5 C;  1KLG D;  3AYH B;  3CCS A;  1U4R A;  4DPG A;  1B3A A;  3BYY B;  3NEL A;  3BG3 A;  4ID6 A;  1W6J A;  1XJV A;  4B3T Q;  3HOW H;  1TWC H;  1TWG H;  2KEE A;  4DV7 Q;  2E2J B;  2QEJ C;  3M4P A;  1LT3 D;  4R8N A;  3PO3 G;  2FMC A;  4DXG A;  2C35 B;  3BDC A;  1RIP A;  3UDF A;  1KD1 C;  3VYR A;  4B3T L;  1NSN S;  3F2B A;  3I73 A;  4DV7 L;  3MAQ A;  5ELE A;  5FLM G;  1L0W A;  3HOX G;  5IP7 H;  3BDO A;  3KJO A;  1HR0 W;  3GV3 A;  3AB9 A;  4AYB B;  3L2P A;  3PIO 3;  2IX1 A;  2J0T D;  1EZ8 A;  4M1U B;  4OEM B;  2D2C C;  1HTP A;  4UPA A;  4DXF A;  3U9S A;  1TS4 A;  5DM6 3;  1E2V A;  3RUZ A;  2RSO A;  2ZJP A;  2O4X A;  1K83 B;  2MO0 A;  4RGN A;  2A68 D;  3H0G G;  1VQK A;  2EY5 A;  1Q1B A;  3HOY B;  4K5W A;  1YIJ A;  1CTM A;  4B9W A;  3P7J A;  1O80 A;  1D2B A;  4EQO A;  4A75 A;  4R4C A;  1DZ1 A;  1TWH B;  2PZT A;  2UXB Q;  2NN6 H;  3KYH C;  3L0O A;  2IHE A;  4UY8 C;  4BY7 B;  4Q5V A;  1HZA A;  5BR8 Q;  4ALP A;  4XXE A;  2F0J A;  3ITP A;  5CV8 A;  4EQP A;  3Q24 A;  1XPU A;  1D7Q A;  1NBW A;  2UXB L;  1PFB A;  1JB7 A;  4A3G B;  1F9Q A;  4OXP A;  4HMI A;  4NPS A;  1T5X D;  3A5U A;  1JIC A;  5BR8 L;  1HNW L;  1KLU D;  4ZQ3 A;  1R9T B;  2F52 A;  4NXN Q;  4DR2 Q;  1STB A;  1O7L A;  2EYM A;  2BE5 C;  4NXN L;  4QCL A;  2F1M A;  1XMO Q;  4DR2 L;  3I55 A;  3UDG A;  1FGB D;  1GUW A;  2H5X A;  1OXU A;  1NMG A;  2PQA B;  2F0V A;  1XMO L;  1SND A;  4YY3 Q;  3PCO B;  2K50 A; 
#chains in the Genus database with same CATH homology
 1O7Z A;  3VYS A;  2B2T A;  1D5X C;  1ONL A;  1I4P A;  3ND8 A;  4ZAI A;  3J80 L;  1SMY C;  3HOZ B;  1R4P B;  4IFD G;  2SNS A;  5C0X J;  1NUC A;  4H44 C;  2CVR A;  4G7O C;  1SNM A;  1CT1 D;  3PV0 A;  3Q22 A;  3C1E A;  4K2K A;  3QOJ A;  1JOK A;  1I50 B;  1BBX C;  1CHQ D;  4KKS A;  5C3X A;  3J80 E;  1MBY A;  1KNE A;  3ERO A;  4DGZ A;  1GUS A;  1CZG A;  5CR3 A;  3NUC A;  1EU4 A;  1Y8P B;  4PMB A;  5IGB A;  4KK7 A;  3OWF A;  3GTQ B;  3TP6 A;  4BA1 I;  3N52 A;  2MUY A;  3CU7 A;  4M8A A;  2K03 A;  4TKO B;  1DYQ A;  2BE5 D;  5ELD A;  3HOW B;  1IL8 A;  3I3C A;  1HPC A;  2B8G A;  3VYT A;  1TWC B;  1TWG B;  4JK1 C;  5C0X H;  2DNC A;  1B4O A;  5KND A;  2PZU A;  1PTO H;  3EVQ A;  1TT2 A;  3NQI A;  3VYU A;  2EE1 A;  4QUC A;  2CW0 C;  1LO5 D;  3K5M A;  5EQ0 A;  1B44 D;  1LV9 A;  4OO1 I;  2RQX A;  5DNF A;  3IAY A;  1GUN A;  3ERQ A;  1LTB D;  1HQR D;  1SMY D;  4HN7 A;  5J22 A;  1CFM A;  2VNU D;  4JBW A;  2H1E A;  1WTX A;  4IFD I;  3FPU B;  1V1P A;  1PXU A;  3T51 B;  3IL8 A;  3D8G A;  3NBI A;  5CC4 A;  3BVM A;  2AQ1 B;  1TVX A;  1GOZ A;  2EXZ A;  2WAC A;  3OIQ A;  5LL6 S;  3OPO A;  4FF1 A;  2SDF A;  2FMM A;  2AQ3 B;  2X6G A;  3M7N A;  2X69 A;  1SYE A;  2F0D A;  2K1B A;  2EJG C;  3NWT A;  1QNK A;  1XYI A;  1QCB D;  4CJ1 B;  1TY2 A;  2E76 C;  3M7G A;  2Z4I A;  3O13 A;  1HUM A;  4ZKC B;  1STE A;  1S4Z A;  3W2D A;  1A3V A;  3IFT A;  5JVH 3;  1E0B A;  1SYD A;  2NVX B;  4RWS C;  4DNR B;  4L8J A;  3I4L A;  2KHS A;  2JEB I;  4DAY A;  1SNP A;  4KHV A;  1I4X A;  1PDQ A;  1FYC A;  1TS5 A;  1NR4 A;  4QMG A;  1X3P A;  2XRS D;  3GTM B;  2D9U A;  1IYV A;  2WV6 D;  1EQT A;  2E2D C;  3URY A;  1EY8 A;  4XYQ A;  2NTT A;  4G7Z C;  4KD4 A;  2WP8 J;  2PW5 A;  2EYL A;  2K04 A;  4KD3 A;  3TP8 A;  3K5N A;  5EBC A;  1BDO A;  1D1K A;  4KHZ A;  2M9V A;  2F0O A;  3DUZ A;  3P20 A;  2KQ3 A;  2K28 A;  4FP5 D;  1V8Q A;  2KED A;  4IUT A;  3X3N A;  1Z7T A;  3SR1 A;  2XNA C;  5M3M B;  1V43 A;  1ESF A;  2N55 A;  2Y0S B;  3EQL C;  4C3H B;  4FF4 A;  4G7H C;  4HCS A;  3W3A A;  3ND9 A;  1WTR A;  1PTO B;  2F0N A;  2IX0 A;  1Q1E A;  3S2H B;  4MHE A;  1IKL A;  2WB1 B;  4IUP A;  4FF2 A;  2XRQ D;  4XQQ A;  4K2L A;  1H9S A;  1PTO F;  3TDQ A;  4EGV A;  4IQZ A;  3F2U A;  4IUN A;  1ET6 A;  1PRT B;  5C6A A;  2PNR C;  3R2I A;  2WIN B;  3GQB A;  4FVM A;  1PRT F;  4RKL A;  2EOT A;  2VB2 X;  4C1N I;  5JEA G;  1WTW A;  1SBB B;  4C3J G;  4ABN A;  4A3K B;  1G2T A;  1SDF A;  4H7B A;  5KNC A;  1VMC A;  5KYI A;  2QKI C;  4F7X A;  3DEO A;  1D5M C;  3VR5 A;  4UAI A;  5HGT A;  3ZYY X;  2L4N A;  3HP3 A;  1H9K A;  3S16 B;  1DXM A;  1G6Z A;  2F0F A;  2EPB A;  2K5Q A;  1GUO A;  4IUU A;  1KAA A;  1U4P A;  1XTC D;  4RHR A;  5FOB B;  4IUQ A;  1EIG A;  4EQN A;  2DN8 A;  1J9O A;  2IX3 A;  5M3F B;  5BN3 A;  1EL0 A;  3I70 A;  1TY0 A;  2Q8R E;  2B63 B;  3QJY A;  1PLF A;  1YNJ C;  1I4H A;  4J1M A;  3VR2 A;  2WKD A;  4PQX A;  4HAE A;  4IAL A;  3BVZ A;  2DY8 A;  2QDB A;  1JC7 A;  4GZY C;  1ZYR C;  4C3I G;  5JPM C;  1KTK A;  3NXW A;  3TP7 A;  5TSS A;  4CBV A;  1WTO A;  5A35 A;  1LTG D;  1Y1V B;  4P2C B;  4A3B B;  4XIG S;  2IJ0 A;  5JVG 3;  3I91 A;  5I9P A;  4TRD A;  1F9S A;  5I2Y A;  5IGE A;  5EKL A;  3NBH A;  3OMC A;  5CV4 A;  2A5H A;  1LTR D;  3NTH A;  1F2L A;  5JJZ A;  1S5B D;  4A93 B;  4KY7 A;  2E2H B;  1BQQ T;  1STH A;  1K8O A;  2PQE A;  1U4L A;  4OGQ C;  3SK8 A;  2A68 C;  4PV1 C;  4A3E B;  5C4H A;  4C2M B;  4WRD A;  1B9N A;  3NSW A;  4CJ0 B;  1AFP A;  1F77 A;  4OL7 A;  1LAB A;  5I6Y A;  5KYL A;  5K36 H;  4XTC S;  1U9R A;  2OF1 A;  4TQU S;  3RZD B;  1FD7 D;  1TS3 A;  2MJ8 A;  4R8I A;  4N9P A;  3EA6 A;  1SYF A;  1VDZ A;  3HKZ B;  1M4V A;  1J8I A;  3SK5 A;  2E2I B;  1F2M A;  1TKW B;  2L5T A;  1STN A;  4RGT A;  4QF4 A;  3J81 L;  4G57 A;  3TP5 A;  3TZU A;  4G4K A;  1O78 A;  3T16 A;  1EFI D;  2EZV A;  4KI0 A;  4ULL A;  4HR7 B;  2EYJ A;  5IGF A;  1JQY D;  1E2Z A;  1DOK A;  3QWN A;  3K57 A;  3TBI B;  5IGG A;  1JWS D;  1JOR A;  4RGM A;  3K58 A;  2JYO A;  3WOE A;  1QJO A;  2KA7 A;  1CA5 A;  1MD2 D;  5IOD A;  4KN7 C;  3J81 E;  4X3K A;  2YU9 B;  1PZK D;  2HUG A;  4V19 0;  5CBA E;  3QB3 A;  4J8Q A;  2AWN A;  1ROD A;  2G9D A;  1RF2 D;  4LMQ D;  1PZI D;  1EY4 A;  2C9O A;  5AFW A;  1TII D;  1CHP D;  1BCP C;  2RVL A;  1SJE D;  1A3T A;  1EY5 A;  5DAU A;  1ESR A;  3VA7 A;  5IGD A;  4LJZ C;  5C44 B;  2VB3 X;  1EIH A;  3SK4 A;  1Q8I A;  5ELB A;  1LTI D;  4IUV A;  3LNN A;  3E5S A;  1UUP A;  3LWE A;  2K32 A;  4L63 B;  1QOH A;  3TSS A;  3RLF A;  1DM0 B;  1Q90 A;  1V1O A;  4OO1 G;  1NCV A;  5C5L A;  3HOX B;  3NHH A;  3C46 A;  3SEB A;  4FYD A;  3LX0 A;  2A6E D;  4HTH A;  1JOQ A;  1EY9 A;  2K5W A;  3D6C A;  1HA5 A;  3H0G B;  2BDO A;  3A7A B;  4O1N A;  1JCK B;  3KLS X;  1EY0 A;  5E1F A;  1BNZ A;  4HSV A;  3OW7 A;  5CV9 A;  1JE4 A;  3D31 A;  4KKU A;  1B2T A;  2PPB C;  2DY7 A;  1SEB D;  4KKT A;  2RSN A;  3S9W A;  3D4W A;  2K7V A;  3M4Y A;  1BCP D;  2MPM A;  1XX8 A;  1CK1 A;  3FKI B;  4DA2 A;  1C8C A;  1YNN D;  3MFG A;  2ZXR A;  2EJF C;  2FFK B;  2F0M A;  4WJW A;  2A6H C;  2EYO A;  2KCC A;  4OIK A;  4RGO S;  2ENB A;  2F03 A;  3PMF A;  4RH6 A;  3S15 B;  2L0C A;  4I65 A;  4XT1 B;  1FNW A;  5DEH A;  3M85 A;  3MXG A;  4ZKB B;  4ME5 A;  4A3D B;  2PYK A;  4V0B A;  3LWU A;  5G3L F;  4PNY A;  5C4Z A;  2EY6 A;  1OXX K;  5M5Y B;  4K5V A;  5C5M A;  2SNM A;  4NKL A;  2KVM A;  5KIX A;  2JSO A;  4RHS A;  5EPL A;  4R9W A;  1Z6H A;  1TR5 A;  1PFN A;  3DEP A;  1G8Z D;  1H9R A;  3IKJ A;  2JE6 I;  1KNA A;  3V96 A;  1V1P B;  1S5F D;  2SOB A;  3MEH A;  2FHT A;  3T13 A;  1WD0 A;  3K59 A;  3S14 B;  1O7Y A;  3R2T A;  3V05 A;  3PUX A;  4DK1 A;  5HUR A;  2KEC A;  3TME A;  5C4X B;  3GTK B;  2V4D A;  2E74 C;  3S1N B;  1I4R A;  2LS0 1;  4L6T B;  3BDL A;  1ET9 A;  1SNC A;  1EEF D;  3GV6 A;  2M2L A;  1RCV D;  2A6H D;  1A2T A;  3KUP A;  2F0T A;  4BWG B;  5FLX L;  2NN6 I;  3K5O A;  3VR6 A;  1OO9 B;  5I4D A;  2JEA I;  2A69 D;  1Y8N B;  1GUT A;  1FNV A;  3CQZ B;  4QB4 A;  1AEX A;  5CV7 A;  4B08 A;  2XN9 C;  3OSO A;  5I6W A;  2O5I C;  1SE2 A;  4I7Z C;  4CKE A;  1BO0 A;  4WOR A;  3JAM L;  2G9H D;  3A8K E;  4PMC A;  5FLX E;  1TS2 A;  3VR4 A;  1BUV T;  3R8B A;  3PUY A;  1NR2 A;  1STA A;  1EY7 A;  2XWJ B;  1WVL A;  4CHT B;  5T1G A;  2EYF A;  2B2U A;  1RTN A;  1JOO A;  2HDL A;  4X3U A;  3Q6S A;  4CJ2 C;  1STY A;  4ZUJ A;  1EQV A;  5LL6 X;  1HUN A;  4KTA A;  2EVB A;  4RFB A;  4HSP A;  2C5C A;  3CKI B;  1QIL A;  1KDC A;  4DNT B;  1KDB A;  3WOF A;  1LAC A;  2ICE C;  2IL8 A;  3BYT B;  3Q0A A;  3I4M B;  1H9S B;  1Z47 A;  3OWE B;  5M5W B;  2KOL A;  3A7L A;  4BS9 A;  5A2Q L;  3K7A B;  3X3M A;  4DFA A;  4IUR A;  2JA5 B;  3MFY A;  4ZLT F;  4K8I A;  2NUC A;  2GA4 B;  5C4J B;  3S1R B;  5C0X I;  2NWG A;  1II3 A;  1HXY D;  3FMC A;  3H09 A;  2F0P A;  3BS1 A;  3KLS A;  5IOC A;  4QIW B;  5EPJ A;  3G7L A;  1S5D D;  5E4X A;  2K5D A;  5EKK A;  1SJH D;  5JAV A;  2PMZ B;  1JB3 A;  4RA8 A;  1PZJ D;  1QWY A;  1RHP A;  3A56 A;  5A2Q E;  2R3Z A;  3M3Y B;  3NWS A;  2B2U C;  1GHJ A;  2NYZ D;  3RZO B;  2BDN A;  3KK7 A;  2BA0 A;  4KV6 A;  1OXT A;  1HTL D;  3S17 B;  1C4Q A;  5J39 A;  2EJM A;  2KJX A;  1B53 A;  1F2Y A;  1TU2 B;  2WII B;  1HFG A;  3VA5 A;  2HCC A;  4NP5 A;  2IWH A;  3HEJ A;  2B39 A;  2DNE A;  3NK9 A;  3C3L A;  4A3I B;  3FVQ A;  1SYC A;  3SXH A;  3PIP 3;  3S2D B;  2KUM A;  1ZKO A;  5BN4 A;  1RJT A;  1EEI D;  2F0K A;  3NPP A;  1VCI A;  1PTO C;  1A6X A;  2O2L D;  5CGK A;  3E6Z X;  5JPN C;  4C3J B;  2JA6 B;  1TWF B;  3OIP A;  1AZP A;  1CZW A;  3FDT A;  5F2D A;  3QOL A;  4Y7N B;  1IYU A;  1EZ6 A;  5NUC A;  4ILW A;  1BOS A;  2RKS A;  2NB0 A;  4U68 A;  1LTA D;  3OHX C;  3MXN A;  2F0G A;  2XSC A;  4RKB A;  3K5L A;  2PZW A;  5KRU A;  5I9O A;  3RMH A;  3KF8 A;  4MN3 A;  3RD4 A;  3GD7 A;  1EYD A;  4K6L A;  5CV5 A;  3L7Z C;  3H91 A;  4KJO A;  1BF4 A;  2FIN B;  2F0I A;  5KGU A;  2F0U A;  1NAP A;  3NQT A;  5CV6 A;  3I90 A;  3SHL A;  4IFD J;  2RDH A;  1GHK A;  4KY5 A;  4XYO A;  1IW7 D;  4DF7 A;  2F0L A;  4BBS B;  3DM1 A;  5M5X B;  1ML0 D;  2AUJ D;  4C1N K;  2I07 B;  1EWH A;  4J6H A;  4C3I B;  5IGC A;  1XWE A;  2QF7 A;  3C2P A;  2A73 B;  1SYB A;  3T53 B;  5ISR A;  1VF7 A;  5E3F A;  4K5X A;  3QIA A;  1UEA B;  2VXW A;  4NW2 A;  4FO2 A;  1X32 A;  1PTO D;  5D3D A;  1G2S A;  2ZXO A;  4RAU C;  3CRK C;  4OO1 H;  1I6H B;  3HG9 A;  3K6O A;  3PO2 B;  1CQV A;  2A6E C;  1PRT D;  3DMU A;  3J7A F;  3E0J A;  4O42 A;  1SE3 A;  4KMU C;  1CI3 M;  4IFD H;  2AQ2 B;  1JWM D;  1HQM C;  4K8J A;  5EKI A;  1SAP A;  1HHV A;  1SSO A;  1EYA A;  4E6I A;  4HMJ A;  1ZXT A;  2PCF B;  2Q8T A;  2L9H A;  4S3S A;  3FPP A;  2RBM A;  4XQN A;  1BR9 A;  3ONA B;  2VUM B;  3GTP B;  3SE0 A;  2N88 A;  2QCP X;  3OMG A;  3D3R A;  3GO5 A;  2MGS A;  2IT1 A;  3MC0 B;  1YNN C;  3BZD B;  2CHB D;  2FJ2 A;  5FO9 B;  1WD1 A;  3FRP B;  3CRL C;  5K36 G;  2BOS A;  2H4O A;  4FF3 A;  3GTL B;  3AU7 A;  4ZK9 B;  3GTJ B;  3T4A C;  2NTS A;  3D4R A;  2ICI A;  3A8J E;  5I2X A;  1OXS C;  1CQF A;  1GUG A;  3PO3 B;  2D5D A;  1AZQ A;  3TZD A;  1GXD C;  1JWU D;  2JP1 A;  2OEO A;  3VR3 A;  4MIU A;  1FNU A;  3H6M A;  1E2W A;  2EY1 A;  1KDA A;  1IKM A;  2OXP A;  2WAQ B;  2B2V A;  1L0Y B;  2XWB B;  1LTS D;  4FXD A;  2F0E A;  2F0H A;  4KY6 A;  2E75 C;  1I4G A;  2IW3 A;  4K14 A;  2HCI A;  4F88 A;  1EY6 A;  1T5E A;  1I6V C;  3R3O A;  1LT4 D;  3HRZ C;  2F0W A;  4Q0F A;  1KAB A;  1DOL A;  3GTO B;  1EOT A;  3AMU A;  1EYC A;  4ODG A;  2B2Y A;  3DWQ A;  1SFO B;  2AWO A;  1OXV A;  3KBX A;  1VMP A;  4F8M A;  2AUK A;  5ELC A;  1RKN A;  4CKC A;  5CYU A;  1ENC A;  1CA6 A;  2OT2 A;  2XIW A;  2XVS A;  5C3W A;  2A74 C;  2NN6 G;  5FO8 B;  5EJW A;  4FXK C;  4XQJ A;  3A55 A;  5FKA C;  2NVT B;  1G29 1;  3S1Q B;  3D4D A;  2A69 C;  4DAP A;  1MI2 A;  3J7A V;  1QG7 A;  3L9A X;  1EWC A;  1DD2 A;  2ZXP A;  1I3Q B;  3I72 A;  2BA1 A;  3G6J B;  1HA6 A;  5CBE E;  1S5C D;  3SK6 A;  2B2V C;  4XDX A;  1B50 A;  1SE4 A;  2B2T C;  1A2U A;  2L11 A;  1Y1W B;  4ZUI A;  2JA8 B;  4ZRZ A;  3MWY W;  5D3I B;  2RDG A;  5EGT A;  5IT9 L;  2EYH A;  1D5Z C;  5JEA J;  4X3T A;  3NTK A;  2O5J C;  1DCZ A;  2B2Y C;  4KJN A;  3MZ5 A;  5DM7 3;  2RA4 A;  1MSH A;  1S5E D;  3DHQ A;  2QIL A;  4DN4 M;  3HZX A;  3SDZ A;  3UI2 A;  4EVO A;  1JR0 D;  5C3E B;  1PMR A;  3SVM A;  5T1I A;  4FNF A;  2NVY B;  3NE5 B;  5J1Z A;  4IN3 A;  1A15 A;  2TSS A;  1PYW D;  1LTT D;  2F0Q A;  2LY7 A;  5IT9 E;  1MSG A;  1DOM A;  4A3F B;  3P75 A;  1WTV A;  1TQO A;  2J7Z A;  5D14 A;  2NVQ B;  3S1M B;  2K33 A;  3QO2 A;  3P1H A;  1GJX A;  3TN2 A;  2IPK D;  1TWA B;  3OOC A;  2LFN A;  4C3H G;  4DAV A;  5C0X G;  3K0Y A;  5JEA H;  4K6D A;  3DXJ C;  4CKB A;  3T56 B;  1AW7 A;  4H0L C;  1W6K A;  2CW0 D;  3MXU A;  2B8F A;  4HED A;  1WCM B;  1LT6 D;  2HQE A;  1RD9 D;  3KBG A;  4RCO A;  3J7Y W;  1ENF A;  2K01 A;  4RCN A;  3IFD A;  4HCE A;  3CHB D;  2Z4H A;  3MTS A;  2ID0 A;  4A3M B;  1ILP A;  2F4I A;  2D62 A;  2K05 A;  1WTQ A;  2EDG A;  2JA7 B;  5COY A;  4U67 3;  5FO7 B;  1D6E C;  3PUZ A;  3JAM E;  3PUV A;  1PFM A;  2R93 B;  2J4X A;  4NMZ A;  1CM9 A;  4WFN 3;  1HRJ A;  4BA2 I;  4TSS A;  3M4O B;  5EPK A;  4ZYS A;  1DON A;  2NZ1 D;  5E4W C;  2LKV A;  1ICW A;  1I4Q A;  3EJI A;  3QG1 A;  1F9P A;  1U4M A;  2K6A A;  2R6G A;  3PUW A;  5G3L D;  1H9M A;  1RDP D;  3MA2 B;  4IZ8 A;  2F3V A;  2F0S A;  1RTO A;  3DWA A;  4N9T A;  1B1Z A;  2PW7 A;  2R92 B;  4H13 C;  3GTG B;  1Y8O B;  2M00 A;  1XXG A;  3HOV B;  3H94 A;  5COR A;  2L12 A;  1LLR D;  5K5P A;  1C48 A;  4DU9 A;  5KNB A;  4X3S A;  4FXG C;  4C56 C;  2R61 A;  1STG A;  4B9X A;  2HDM A;  5ELF A;  4UDU C;  1BXT A;  2MP1 A;  1WTP A;  1SXT A;  3N6R A;  4XT3 B;  2I46 A;  5LHY 1;  1B9M A;  1IW7 C;  2MHV A;  1HFN A;  3BVG A;  3FEW X;  3V2T A;  5D65 A;  4NDX A;  2SEB D;  3U9O A;  4PMW A;  3R93 A;  2B2W A;  1SYG A;  3L3O C;  1IHZ A;  1R4Q B;  3HGB A;  5BN5 A;  1FR3 A;  1F2Z A;  3A8I E;  1QNU A;  1ILQ A;  1DJR D;  2ZT9 C;  4LK1 C;  3HOU B;  2CQA A;  1UAP A;  2PO4 A;  1PRT C;  4Z9C B;  2Z1C A;  2TMP A;  3I4N B;  1AP0 A;  1Y69 U;  4A3J B;  1K8M A;  5JOB A;  3A54 A;  5EBD A;  1Q3L A;  3EFX D;  4DK0 A;  1A3U A;  3KLR A;  3MHB A;  4CGY B;  5FK9 C;  1QB5 D;  2EY2 A;  5CMD A;  2R7Z B;  1F9R A;  1D1I A;  2L1B A;  5M9O A;  1HCZ A;  4BBR B;  1MGS A;  5IIF A;  4F87 A;  1ENA A;  3NP8 A;  2RDF A;  4KN4 C;  1H9J A;  1M8A A;  1BCP B;  3C1F A;  3Q23 A;  4OIJ A;  2KCN A;  3DWP A;  3D6W A;  3WDN A;  1LT5 D;  3MVV A;  3HS0 C;  2B2W C;  1BCP F;  4QUF A;  2Q8I B;  2F3W A;  1AN8 A;  3I8Z A;  3GP7 A;  1Q12 A;  2WKC A;  2NBF A;  1UNS A;  1YNJ D;  3MXP A;  4LAA A;  2L55 A;  2YYZ A;  2Z8L A;  4YIJ A;  1SNQ A;  5KEE A;  1SNO A;  3NTI A;  4BY1 B;  1ZEQ X;  1L0X B;  1QE6 A;  2LMC B;  1X3Q A;  2EYP A;  1ZYR D;  1EU3 A;  3H3V C;  1G91 A;  2JXM B;  2X6L A;  2BCO A;  4OHJ A;  1VF5 C;  1KLG D;  1U4R A;  1B3A A;  3BYY B;  3BG3 A;  4ID6 A;  1W6J A;  2KEE A;  2E2J B;  2QEJ C;  1LT3 D;  4R8N A;  2FMC A;  4DXG A;  3BDC A;  3VYR A;  1NSN S;  3I73 A;  3MAQ A;  5ELE A;  3BDO A;  3GV3 A;  3AB9 A;  4AYB B;  3PIO 3;  2IX1 A;  2J0T D;  1EZ8 A;  4M1U B;  2D2C C;  1HTP A;  4DXF A;  3U9S A;  1TS4 A;  5DM6 3;  1E2V A;  3RUZ A;  2RSO A;  2O4X A;  1K83 B;  4RGN A;  2A68 D;  2EY5 A;  1Q1B A;  3HOY B;  4K5W A;  1CTM A;  4B9W A;  3P7J A;  1O80 A;  1D2B A;  4EQO A;  1DZ1 A;  1TWH B;  2PZT A;  2NN6 H;  4BY7 B;  4Q5V A;  4XXE A;  2F0J A;  3ITP A;  5CV8 A;  4EQP A;  3Q24 A;  1PFB A;  4A3G B;  1F9Q A;  4HMI A;  1T5X D;  1JIC A;  1KLU D;  4ZQ3 A;  1R9T B;  1STB A;  1O7L A;  2EYM A;  2BE5 C;  4QCL A;  2F1M A;  1FGB D;  1GUW A;  1OXU A;  2F0V A;  1SND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...