4XQJA

Crystal structure of agra lyttr domain in complex with promoters
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
99
structure length
99
Chain Sequence
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Accessory gene regulator A
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
total genus 27
structure length 99
sequence length 99
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xqjA00
4G4KA 3BS1A 4XXEA 4CBVA 4XYOA 4XQJA 4XQNA 4XYQA 4XQQA
chains in the Genus database with same CATH superfamily
2VW9A 3S16H 3EQLC 3NBIA 4B9XA 1DGSA 3FKIB 1KNAA 2N8NA 3PIO3 4YCWA 1BDOA 1S5CD 2MNAA 3I4NG 4DR2L 2OEOA 4PQXA 1S5BD 4BBSG 3KFUA 1CZWA 2E2DC 1VQCA 5JJIA 1Z7TA 2DY7A 4F87A 1AN8A 4L63B 2IX1A 1HZAA 2L15A 3SK4A 3I55A 1LTSD 2F0QA 3ULJA 1HUMA 2JA8H 4X65Q 2IWHA 1Q3LA 5KNBA 1G2SA 1XMOQ 3BDOA 3K5NA 2WAQB 1VQBA 1FNUA 4KMUC 3MEHA 2E2IH 2F0VA 1TWHH 4RMFA 2RCNA 1UE6A 3TBIB 1BCPF 2RVLA 1MGSA 2A6EC 1AZPA 1Y8NB 2K14A 1N33L 1KHIA 2WACA 1JWSD 5IWAL 1ESFA 3M4OH 1K28A 1VQIA 1D5ZC 2WIIB 1EQQA 4KHPL 1B3QA 1O7ZA 4L6TB 4Y7NB 3S1QH 1XNQL 2ZXOA 2UUAQ 1V43A 1II3A 5DLQE 5J22A 4FNFA 3HOXH 2R93H 1BNZA 2ZJPA 3S1RB 1DYQA 1NR2A 3J7YW 1SYDA 5KYIA 4JW0A 4OIKA 3HFZB 1WCMB 1CHQD 4KHZA 4N8X1 4C3IG 3H0GB 3GTLB 1QZHA 1VQKA 1BCPC 1X3GA 1XPRA 1XPOA 5C6AA 5IGGA 3TS0A 1EQTA 3FHWA 1U4LA 1SYFA 1BR9A 4OHJA 4HMJA 4DGZA 1W3SA 5EAYA 1TQOA 1YNND 3S1MB 2RKSA 1AFPA 4B3TL 5IT9c 1LM0A 4F88A 3HKZB 3RN2A 2F3IA 2QF7A 3GTMH 1J8IA 2K05A 4DNTB 2F0KA 1BBUA 1I3QH 1E3PA 3K6OA 1XMQL 4DUYL 2GVAA 3FEWX 2GVBA 2UXCQ 3A7AB 1E2ZA 1MKHA 1STHA 4IFDI 2HQLA 1EWIA 2I5LX 2K6AA 2XTIA 3WOEA 3OTOL 4JV5Q 2KUMA 2VUMH 4K5XA 4BXXG 1CA5A 1K73C 3CCLA 3HOWH 3JAML 1EOVA 1WJJA 1CT1D 1FGBD 3E0EA 4JI1Q 5JVG3 1WTPA 4ZUIA 4MIUA 4ZRZA 1F77A 2A6HC 3DWAA 4K5VA 1LTTD 1KRTA 4MHEA 1EEFD 4CJ0B 4DR6L 3LWEA 3G4SA 1QUQB 3DWPA 3I7FA 3CF5A 4DR5Q 1RDPD 2L5TA 4XYOA 2F1MA 3HOVH 2UXDQ 5IP9G 1VQHA 5FO7B 1EIFA 2JA9A 4ZKBB 4KK7A 5FLXc 3CC7A 4YWKA 2F0PA 3C3LA 4MN3A 4LF4Q 4LF9L 2EE1A 5KGUA 4GLXA 1E24A 1HTPA 4A75A 1SFOH 2AUJD 2HQEA 4A93G 1HFNA 4GKKL 2HCCA 4DPGA 2PZTA 3I4NB 2ES2A 2F0MA 1LTID 1F2YA 1PTOF 1V8QA 1F9SA 2D5DA 1YVCA 3LGJA 1PH1A 2JA5H 4A3CH 1E7ZA 1HNWQ 4Z9CB 1A62A 1VQ8A 2EYPA 4OEMB 3HOYH 1FD7D 1YITA 3BJUA 4NXMQ 4BY1G 3K7AH 4K8IA 4C3HH 1G2TA 3SDZA 4N8FA 2F0DA 2K5QA 2IX0A 1KLUD 4GOPB 1HHVA 1J5EL 3M4PA 2VNUD 1C9OA 4PZ6A 3HOZG 2B2VC 2DGYA 4KKUA 4H0LC 2Q8TA 5L37A 3MXGA 4K6LA 3SE0A 3A54A 4CJ1B 3NXWA 1FYCA 1Y1VG 1PTOC 4DV6Q 4G7OC 4TRDA 4F8MA 2N88A 1CTMA 1VQOA 1Q8IA 1JT8A 4RGTA 1VS0A 2D62A 5JOBA 2JSOA 3HOXB 2R93B 3VA5A 3NTIA 3QR8A 1BF4A 1HXYD 1FNWA 1WFQA 3MFYA 5KRUA 5ELDA 2MP1A 5A35A 5LMNQ 2TSSA 2UU9Q 4S3SA 1QWYA 2MPMA 1KIXA 2PYKA 4CKBA 2K5HA 1BVSA 2X6GA 1P8LA 1TXYA 3N52A 4L5TA 1AZQA 2FFKB 1PRTD 1R9TB 3W1BA 3RZDH 1VF7A 5FLMG 4GNXB 1BQQT 5EBDA 2PZUA 1SNOA 3RMHA 2BCOA 5CR3A 4IURA 2Q2UA 3ULLA 3J7AF 1EY5A 4I7AA 1F2LA 1U5KA 4KJNA 1I4GA 4A3JG 1D1IA 5JJZA 2NZ1D 2O4XA 3I4MH 2NN6G 3W3AA 5M3FG 3S9WA 1HR0W 2PW7A 1YHQA 1ASZA 3CC4A 2NTTA 2YU9B 1L0YB 2ZM6L 2VL6A 1SXTA 2Q2HA 1SJHD 3UDIA 2E75C 3IFDA 1I94Q 2RQXA 1EQVA 3K59A 3VA7A 3CRLC 1QCBD 2B29A 3AMUA 5I9PA 4UAIA 4AIMA 1PHJA 2BE5C 2E8GA 3BVMA 4HMIA 1VQ9A 3EBEA 5ISRA 3U9SA 1HCZA 1A2TA 5M5YH 2KHIA 1JR0D 3A0JA 4JI5L 1EWCA 4AYBE 3S1NB 4IO9A 1J9OA 1UE7A 3E9IA 4CDDC 2AKWB 2PZWA 3RLNA 1XTDA 2VY3A 3C2PA 3BYYB 1DM0B 1BKBA 2G9DA 4A93B 2NWGA 4PG3A 2IL8A 2V4DA 4FYDA 2NVTH 4AH6A 1RF2D 5D14A 1VQGA 4A3GH 2L4NA 5BN4A 1YJ9A 1C7YA 2JA5B 4L8JA 4E6IA 3J80i 4J1MA 3HOUH 1NMGA 3GD7A 4C3JG 4BY1B 3A8KE 3F8TA 5I6WA 4X64Q 3AU7A 2B2TC 5AJ3Q 5EPLA 4B3RQ 1YHAA 1F9QA 4YHHL 3DEOA 5M5WH 5CV7A 1IBLQ 5JJKA 3NELA 4AQYQ 3DM1A 3RD4A 1X9NA 1RKNA 4R8IA 3Q23A 4A3LH 4FDBA 3KF8A 5FKAC 2R92G 4PZ8A 1WYDA 1EFID 3VDYA 2V1CC 1Y1VB 4C56C 3D3RA 4CBVA 4JI2Q 1O7LA 4X6AH 5C5LA 4IN3A 1JCKB 3Q24A 4FVMA 2DNCA 4RCNA 1XPUA 3EFXD 2B63H 1OO9B 1CZGA 1WD0A 1NUCA 2QCPX 2ZXPA 1NTGA 1Q82C 1NNXA 1G8ZD 3CQZH 4H02A 1OXTA 1MSHA 3PIPA 2KCMA 4QB4A 4XT3B 3RLFA 1XNRL 4JI8Q 2EXDA 4NPSA 1O78A 5JAVA 2K03A 4IUTA 3VR2A 3RZDB 2HDLA 4GN4B 2LSSA 1QOHA 2VB3X 1STEA 3ND8A 2C35B 1I4HA 1M4VA 4LFAQ 2UXBL 4ZUJA 4Q5VA 3KDFB 5EKIA 1K3BC 4RH6A 2RCFA 3E9HA 3OYYA 3Q8DA 2JA6B 1KAAA 1VQJA 3P75A 4A3EG 4K14A 1GUTA 2Z6BA 1BXTA 4UHVA 4R4CA 5C4JB 2EDGA 2MO0A 4XT1B 4DR7Q 3CD6A 1KL9A 2F0SA 5ELFA 1Q1EA 5G3LD 3QG1A 4KN4C 4HR7B 3MHBA 4KI0A 2IJ0A 4B08A 4A3KG 4YY3Q 2Q2IA 2B8FA 4NB3A 2K33A 2HHHL 4IPGA 2WV6D 3OOCA 2HT1A 3KK7A 1TWFB 1JJCB 3TEHB 3S17B 1XJVA 5JEAG 2MGSA 1EZ8A 4RAUC 1IBKL 3ND9A 4X3KA 3I73A 2B2VA 1LTAD 1PZID 1X6OA 2ZXRA 4NKLA 2ZTDA 3KLSX 1L1OC 4L5QA 1EWHA 4JCVE 1E1OA 4HN7A 5M9OA 4X66Q 1U0LA 5IGEA 4WJ4A 1TVXA 3BVGA 3GTOH 4A3GB 1AE2A 3PO3H 1JQYD 3QJYA 2O2LD 3PUVA 4I65A 3PUZA 2FMCA 3DUZA 3K7UC 3VR6A 1Y14B 5CBEE 3FKIG 3BZDB 3ULPA 1SJED 4A3MH 5JVH3 3HS0C 1J6QA 3U4ZA 3G6EA 1UAPA 2QILA 1KXLA 3KLSA 1TY2A 4BY7H 3D31A 4I7ZC 1OXVA 2F0OA 1UE5A 2VQFQ 3FMCA 3Q0AA 1N34L 1VQDA 3I72A 1S40A 1STGA 3J81E 1SNCA 2WAQG 4IUNA 1OTCA 1EIGA 2K4KA 4TSSA 4EQ5A 2WB1B 4LFBQ 4LUOA 2F0LA 4DV7L 1ML0D 1KDCA 2L11A 1G6ZA 1L0WA 3G48A 5HGTA 4DUZL 4UY8C 2NVYB 4PNYA 1IL8A 1I4XA 2R61A 2OQ0A 5M3MB 3H3VC 4XQQA 1G6PA 3R93A 4A3IH 1B9MA 2H1EA 3SR1A 3GTJH 3IKJA 2L1BA 3D6WA 2M9VA 3QOJA 2VS1A 4QL5A 5BR8Q 2F0NA 4HJ8A 2K75A 1D5MC 1H9MA 1WI5A 3R2TA 1EYGA 4B3MQ 1WCMG 1MJCA 1PMRA 4UP8A 1WTRA 4NXNQ 4OX9L 1S5ED 4LMQD 1X3FA 4QF4A 3GQBA 2Q2TA 2RDGA 4OXPA 4P2CB 3EJIA 3T13A 5CYUA 1TR5A 4NDXA 1LV9A 5GQOA 2KHJA 3RUZA 1TWGB 3EA6A 4ZKCB 2KJXA 4GKJQ 2OWOA 1RHPA 3L3OC 3HKZG 4DK6C 4P75A 5IE8A 3T16A 4FF4A 2HDMA 5T1IA 3J80L 4TQUS 4KY6A 5C44H 4YCVA 4R9WA 4DV2L 2IX3A 4HSVA 3OPOA 2R7DA 1V9PA 2B2TA 1SRUA 2I5HA 2C5CA 3S2HH 5IYCG 2QKIC 4LF8L 1QVFA 1NBWA 4HJ5A 2UUCQ 1Q12A 1CM9A 4JI6Q 5EBCA 2H4OA 1ONLA 1LT4D 1RODA 1A15A 1PYSB 1L2FA 3TQYA 1Q7YC 3ITPA 1CQVA 4LF7L 5IYDH 1Q1BA 2A73B 1DOMA 1EYCA 3CP0A 1U4RA 4JI7Q 2AWNA 3J81c 1IKLA 1S72A 1KNEA 1VQ5A 1JMCA 1F2ZA 3FPUB 3NBHA 1W2BA 1LT5D 1LYLA 3WDNA 3F2UA 3OSOA 2PQEA 2UUBQ 1HR0Q 1A8VA 5C4XB 3PUYA 1NJIC 1PRTF 4A3FH 1K8GA 4DV4Q 1D6EC 3UE1A 3L0OA 1EU4A 1VQ6A 2E2HB 1YIJA 1DOLA 2XIWA 3MAQA 3GDEA 1N36Q 3GTKH 3PIP3 1T9HA 1MI2A 2EVBA 5EPKA 1TWAB 3TP7A 1C8CA 2JJQA 2EIFA 1K8MA 3J81j 3NTHA 4HAEA 3TP8A 4X65L 1LTGD 3AYHB 1L0XB 2LXJA 3BU2A 4ZCKA 1XMOL 3NENA 1HUNA 2Z1CA 4NW2A 5EKLA 1PRTC 2KHSA 2M2LA 3EN2A 1N32Q 4DR4Q 1K8OA 4RGOS 1A63A 3GTJB 1MIUA 5IWAQ 2XGTA 2A1AA 3PUWA 2LXKA 3HOXG 3P7JA 5F2DA 2R93G 5IGCA 4DR3Q 3D6CA 1AEXA 1XNQQ 2SEBD 2KVMA 4CGYB 2SOBA 4HJAA 1UEAB 1VQFA 1F9RA 3M9BA 4H44C 2UUAL 1E0BA 3CCMA 4X62L 4QY7A 1I4QA 4IOCA 1T5EA 1LT6D 3URYA 1A0IA 4RGNA 3T1YQ 2E2JB 1D7QA 1E22A 3CCUA 4J8QA 1PTOH 1I50B 1EY8A 4MNOA 1GJXA 1KLGD 4GLVB 1L1OA 1STYA 1I5FA 2AQ1B 4O1NA 4DV1Q 3VR5A 1V1OA 4N9TA 4ZYSA 4A3DH 5D3IB 1EUJA 1STNA 4C3IH 1B44D 4DNRB 3U9OA 1ET6A 1LACA 1R4PB 2X69A 5GAGC 5JJLA 1M1KC 1K83H 3S24A 4ABNA 3TMEA 1ENAA 2EY6A 3GTQB 3KYHC 2QDBA 3KF8B 3NEMA 1XMQQ 4P71A 4JPBW 2EPBA 3HOWG 2MJ8A 2PI2E 2EYJA 2K5DA 2UXCL 2CWPA 3OTOQ 2IPKD 2KEEA 3MFGA 1S5FD 2DN8A 1WVLA 3IAYA 2EYFA 3NUCA 1HRJA 1XYIA 3GP7A 4BA2I 4QIWE 3CMAA 4V0BA 2PI2A 3ZYYX 5I9OA 3KBXA 3K5OA 2YTYA 3MA2B 1H9SB 2R7ZB 5C0XG 3E5SA 1VQAA 2WINB 1CI3M 4TVAB 5ELEA 3S16B 1KDAA 2YYZA 2FINB 2VQEL 1W6JA 2XNAC 2UXDL 3G71A 4JOIC 3A8IE 3SHLA 2RBMA 4OGQC 5LMUQ 1GUWA 1LT3D 2JA5G 1PYBA 1D2BA 5IP9H 2JK8A 3D4DA 3LWUA 4GOPC 2NTSA 3AEVA 3P1HA 1TY0A 2HIXA 1DCZA 2JA8B 5E3FA 4YIJA 3GTKB 2BH8A 4JC0A 4ZK9B 3GTPH 2A68D 5LL6X 1HNWL 3J80E 2E2IB 4NXML 1TWHB 5BN5A 4GN3B 1SMXA 1A3UA 4PV1C 4XDXA 5IP7G 2NYZD 4MZ9A 1J5EQ 2RHQB 4H7BA 4RG1A 2A69D 1CKNA 3OMGA 1Q86C 2DNEA 1KC8C 1C0AA 3OHXC 1HA6A 5G3LF 3D4RA 1TWCH 2CQOA 3M4OB 2PQAB 2QA4A 3I56A 2KENA 4DV0Q 2JE6I 4IPCA 3HOZH 3S1QB 2JP1A 3STBD 1I6HH 2A19A 4IFDG 4HCSA 1HA5A 5DM73 3KF6A 4RHSA 3TP6A 4DV6L 1SDFA 3TZUA 1F9PA 2F0GA 1LLRD 1CK1A 1B1ZA 1JORA 1V1QA 4HCEA 2XRQD 4GNXC 5FOBB 1V1PB 1HZCA 3J7A5 3D4WA 1STAA 3FDTA 3I3CA 4XYQA 4DAYA 2F4VQ 1PH2A 5LMNL 4C1NK 1VQ4A 1NAPA 2NVXH 3R2IA 2PPBC 3QOLA 3GTMB 1EY4A 4OWTB 4LAAA 2JA6G 3HZXA 1SE3A 1YZ6A 3MXNB 1I3QB 1KD1C 1K83B 4RCOA 4POFA 1SYGA 4MTNA 4KTAA 4QGUA 1YI2A 5DEHA 3PCOB 2Y0SB 5NUCA 1RL2A 2WAQE 3PF4A 3F1ZA 2VUMB 3HOWB 4IOAA 3CAMA 3RZOH 2E5LL 1FVIA 2IY5B 4DR1Q 4ILWA 2ZM6Q 4JG2A 1EL0A 4A3JH 1PFBA 1Z9FA 3HRZC 5M3FH 2B39A 5E1FA 5E4XA 1I94L 2F52A 1VMPA 2F0WA 2D2CC 1PA6A 3HOVB 5CBAE 1R4QB 3J80c 1RD9D 3RLOA 4O2DA 4QMGA 4JBKA 1OXSC 1SFOB 3PMFA 1UNSA 1PFNA 1A3VA 4A3GG 4DV3Q 1MD2D 3SK8A 3GO5A 2D0PA 3DMUA 3QWNA 3HOYB 4HJ7A 3H3VI 1H9JA 4LF6L 1NY4A 4IJLA 4B3SQ 2LFNA 4GN5A 3FRPB 3HOUG 4WORA 3K7AB 3CKIB 4C3HB 3MZ5A 4R4TA 5CMDA 1RIPA 5LHY1 4U673 3QB3A 2WP8J 4CKEA 5C5MA 5GAHC 1X56A 3HKZE 1PFMA 2Z9HA 5IYBH 1WTQA 4L5SA 3TRZA 4A3BH 4A3LG 4X64L 1K3RA 1HZBA 3NP8A 5AJ3L 4C3JH 4B3RL 4LUVA 3JAME 2FXQA 4OIJA 4KJOA 1IBLL 4FXGC 1SE8A 2MHVA 3PO2H 2K04A 4IUPA 5E7NA 4AQYL 2BDOA 3DLLA 4UDUC 3T1HQ 1Y1WH 1AE3A 3MTSA 4C1NI 1HNZQ 5FJ8H 3L7ZC 2WB1G 3FPPA 4JI2L 2KCCA 4A4IA 4EQOA 2R92H 4RWSC 1XTCD 2KCNA 3KBGA 1UWVA 2MQHA 5CGKA 2K32A 3OW2A 5M3MG 5COYA 1EY6A 3GTGH 3SK6A 4OONA 1Z47A 2YTVA 1QUQA 1XXGA 2K1BA 1HJPA 1SNMA 5DM63 1EOTA 3S14H 4UPAA 1FNVA 4JI8L 3E6ZX 2K5WA 2ATWA 4PMWA 2FJ2A 2F03A 1BBWA 2RSNA 4WFN3 3NBHB 3F2DA 4DF7A 1FJGQ 2G9HD 1OXUA 3S15H 2XSCA 3A56A 1VQNA 1PVOA 1F2MA 4OO1I 5IT9L 1QVGA 1WTOA 4LFAL 3I4MB 2ALYB 4PMCA 5IODA 2FMMA 1GM5A 1JICA 5CV6A 1SR3A 2SNMA 5C3EH 3H3VH 1GUNA 1ZKOA 2GA4B 1RTOA 3Q22A 4JOIA 4ZLTF 1EQRA 2MUYA 4A3EH 1SBBB 3I91A 4DA2A 4DR7L 4JI3Q 4GOPA 1KQSA 2PMZB 4IUQA 4DFAA 1QZGA 4K8JA 2NB0A 4JI4Q 1CQFA 1WTHA 4KD3A 5M5YB 2HHHQ 4YY3L 1PH5A 1AP0A 3OMCA 5CV5A 3S2DH 1GHKA 3K58A 3KOJA 3X3NA 1IBMQ 2NBFA 3DEPA 3V96A 3NE5B 3UDXA 5CV4A 5FLXL 4LK1C 3TREA 2NVTB 2AQ2B 4DXFA 4LF5Q 2ENBA 2P5ZX 3JAMc 1HQRD 4K0KQ 2G5DA 3M7NA 1HQMC 3HOUB 2N55A 3BYTB 3A5ZB 4FXKC 3WWVA 3H09A 3R3OA 4FP5D 1ILPA 4G4KA 3SK5A 2J0TD 1JOOA 3D0FA 1GOZA 2TMPA 1TS4A 5M5WB 1CKMA 1E1TA 5C4XG 2R7FA 4GS3A 4GNXA 5AFWA 2LY7A 2BA0A 4JYAL 1B9NA 2DJFC 1PH4A 3L2PA 1KTKA 2NVQH 1O80A 5KNCA 4K5WA 4OO1H 3IL8A 4POGA 2RSOA 1DOKA 3VYRA 3FKIH 4JI0Q 3TN2A 3NTKA 2B63B 2Q8RE 1FGUA 1S5DD 4H13C 3V2TA 4IPDA 2BH2A 2VQFL 2N49A 1XWEA 1TS2A 1W6KA 4L5RC 4RHRA 3CQZB 2LKVA 1H95A 5I2YA 1JOQA 4APVA 1PH7A 2JN4A 2AMCB 2B2WC 1QILA 1EIYB 1HNXQ 5C4ZA 1B3AA 4LWCA 5CC4A 5J39A 4JBMA 4LFCL 3W2DA 1KRSA 4ODGA 1PH8A 1GD7A 3OWFA 3ER0A 2D0OA 2DUDA 3K0YA 3K81C 5KNDA 1VF5C 1H9KA 1YNJC 2FHTA 4JVZA 1LTRD 1Y8OB 4EQNA 4Y7NH 1EIHA 5BR8L 2VB2X 5FO9B 4ZAIA 5M5XH 2JA7H 5C3EB 5A2QL 1P16A 3S1RH 3TS2A 1IW7C 5EQ0A 1Y69U 4NXNL 2KA7A 1JJ2A 1WCMH 2BOSA 3H0GH 2EXZA 1K0RA 2PNHA 3GTLH 3BS1A 2KBNA 4QUCA 1C48A 3I2ZA 4GKJL 5K36G 4BBRH 3CC2A 3Q6SA 5ELOA 4X3TA 3S1MH 1WTVA 3A55A 1EYDA 1CA6A 3K5MA 4RA8A 1CUKA 3U58A 4GZYC 3NHHA 1I4PA 1IKMA 1HFGA 1WTXA 4CDFC 4XIGS 1U4MA 1QB5D 3GTOB 4GLAC 2YTXA 4R4IA 3PO3B 1X54A 2UUCL 5ELNA 4JI6L 2B2UC 1IYUA 1ENFA 3K5LA 4HJ9A 3G6JB 3SXHA 2R7ZG 2A68C 3M7GA 4TKOB 3KJPA 3LNNA 3NK9A 4DKAC 1YJWA 1KABA 2K28A 2KECA 3OIPA 2A69C 4DV5Q 4A3MB 2Z4HA 4X3UA 1D1KA 1GUOA 3ERQA 2F0JA 4KV6A 2L0CA 5JPNC 1VQPA 1CFMA 4BY7B 2EOTA 2ZTEA 4DR2Q 1QE6A 4K6DA 3HEJA 1TKWB 1HR0L 3MC0B 1HPCA 4KLKA 1IL2A 2JA8G 3NPPA 3STBC 2AHOB 1B70B 1RJTA 4DV4L 2VXWA 4G7ZC 4U68A 3EIVA 3CMEA 4ALPA 3I4NH 1H9RA 4PMBA 3T51B 4BBSH 1A6XA 2AWOA 2J7ZA 5GROA 4CDEC 1IHZA 1N36L 3J81i 2PMZE 3T53B 4BWGB 4K2LA 1EU3A 5DAUA 4R4QA 4KY5A 1HH2P 2LS01 4P73A 1QNKA 2AQ3B 1G91A 3HKSA 4HIOA 4A3IB 3G7LA 1PH9A 3R8BA 2ZJRA 1QJOA 1N33Q 2CFMA 5FLXE 3PV0A 4V190 4K2KA 5GAEC 5I4DA 4F7XA 1E2WA 1N8RC 4KHPQ 1ET9A 2H5XA 4WJWA 1N32L 1WD1A 4DR4L 3OWEB 4DAMA 2SDFA 4J6HA 1I4RA 4IZ8A 3LX0A 3K57A 1VMCA 5C0XI 2EJMA 2QEJC 1SAPA 1M8AA 4AYBB 3J7ZC 4DR3L 2OCEA 1PRTB 1X3EA 5M5XB 2JA7B 1ZYRC 4HTHA 2QDLA 1SMYD 4FO2A 4X62Q 5JPMC 3EVQA 1TIID 3BG3A 3IFTA 1ENCA 3UE0A 2EQSA 4A3DG 3T1YL 4G7HC 2WKDA 5KIXA 1WOCA 3NQTA 1SYEA 4Q0FA 2BA1A 4B3TQ 1Z6HA 3A7LA 1R9TH 1ASYA 5C44B 5JEAJ 2IW3A 4DV1L 1YNJD 3TDQA 1DXMA 3C46A 4BBRB 1SNPA 2F0FA 3X3MA 3CCRA 2Y0SG 1IYVA 1VDZA 4DUYQ 1BCPB 1G291 3AFQA 3S2HB 4HIKA 2VUMG 3CCVA 1NSNS 1KDBA 2WB1E 5K5PA 2CHBD 2RF4A 5D3DA 4DAVA 4OWWB 1DONA 1XX8A 2OF1A 1B2TA 1IW7D 4QUFA 3PUXA 3H94A 2EJFC 4JV5L 5I2XA 1GKHA 3T56B 1JE4A 1ESRA 2XWBB 1Q90A 1YHBA 2RDFA 4KKTA 1RCVD 1NE3A 4YWLA 3NWTA 4JI1L 4IUVA 4KN7C 2QW7A 3TP5A 2YU9H 4BXXH 3HOVG 4DR6Q 3OW7A 3TZDA 1LTLA 1MBYA 1UEBA 4EQPA 5HY6A 4LUZA 3W1GA 5C3WA 1PLFA 1AW7A 3I8ZA 4DR5L 1K8AC 1AH9A 4IUUA 1VQLA 5CV8A 1VQMA 1CHPD 4LF9Q 4A3FB 3U4VA 1SSOA 1B53A 2PO4A 5IOCA 2VQEQ 4A3CG 4GKKQ 5A2QE 4LF4L 3S1NH 1PXUA 2B2WA 5C0XH 3HOYG 3CHBD 3M4QA 5ELCA 3NSWA 2RHSB 2L9HA 2I46A 1CSPA 1Q46A 3VYUA 4C3HG 5LMUL 5J1ZA 4A93H 4LJZC 4PZ7A 1PZJD 1A2UA 2CCZA 2Z6KC 3TSSA 2NN6I 4BBSB 2L55A 3B6YA 4ME3A 4KD4A 4CKCA 3VYTA 1O7YA 1SROA 5EPJA 5C3XA 3PSIA 1I6VC 3VYSA 4A76A 4BY1H 2QGQA 4UP9A 2XRSD 1SEBD 1HTLD 1PDQA 3N6RA 3IRBA 3PF5A 1QNUA 2EYOA 1EFWA 3UDFA 5IP7H 3AQQA 2F3VA 1Y1VH 1PH6A 3VR3A 2IHEA 5IGFA 4DV0L 3HP3A 5IGDA 2CH4A 1VQ7A 1ICFB 4OELB 2EZVA 3BZKA 3CCQA 3KUPA 2OQKA 2K7VA 1JWMD 4IFDH 2KQ3A 1PTOB 3CW2C 2JEBI 3AFPA 5H1SE 1YEZA 2B2YC 2R6GA 4QQBX 2CW0C 2EYLA 2EYMA 4NP5A 3K8AA 4QJFA 4DK1A 2UU9L 2K5VA 4A3DB 3PGZA 2CH4W 3CCJA 4C3IB 1ICWA 3NQIA 2F4VL 2A6ED 1JJGA 1YJNA 1O7IA 3CRKC 4ME5A 2B2UA 3BDLA 5FLMH 3QIAA 3I4MG 4HSPA 2ZTCA 3CXCA 2A5HA 2K01A 5IIFA 3KLRA 3C1FA 3DWQA 3DXJC 1TT2A 1ZYRD 2F0TA 1M90C 2NUCA 3SEBA 2JA6H 1K9MC 4R4OA 4EX5A 1SE2A 2IT1A 4R1JA 3SVMA 2NN6H 2E5LQ 2KOLA 2K52A 2R3ZA 3H6MA 4IJHA 4DN4M 5C4JH 2AUKA 2CQAA 3A8JE 1BCPD 5J3BA 1D5XC 4DR1L 2CWAA 3L9AX 3RN5A 2E76C 3K80C 3MXUA 5C4HA 4ZQ3A 4JK1C 4DK3C 1JB3A 3CCEA 4EVOA 1PH3A 3VR4A 2F0EA 3MVVA 4JI5Q 1T5XD 3J81L 4BS9A 4WRDA 3ICEA 4KKSA 5CV9A 1TWFH 1SYBA 5FO8B 3MXPA 3S17H 4FF2A 3V05A 2N3SA 2O5JC 1C4QA 3ERSX 4R8NA 3FVQA 3CPWA 2XN9C 1TS5A 4DV3L 3C1EA 4LF6Q 3GTPB 3MEFA 2O5IC 3DHQA 4NMZA 1YBYA 1U4PA 1NMFA 4B3SL 1X3QA 3DM3A 2A6HD 2F0HA 5IYBG 2N78A 3SGIA 4YHHQ 3F2CA 4A3BG 2MO1A 3BZCA 1U9RA 4KY7A 3F2BA 1TWCB 5HGQA 3PO2G 2QEXA 2OTLA 1Q81C 2X6LA 1HZ9A 2WKCA 1Y1WG 4ID6A 3HOZB 3A74A 2B63G 1GO3E 1I6HB 1B50A 4FF3A 2F3WA 5FJ8G 1A3TA 1X65A 2Z4IA 1LUZA 3T1HL 1VQEA 4XXEA 4CHTB 4WJ3M 1HNZL 3PIOA 3E3XA 1S3OA 4RKBA 3WOFA 1S4ZA 2B3GA 1XNRQ 4JBWA 3M85A 2JYOA 1BOSA 3FP9A 2C9OA 3W5OA 3H15A 2NVXB 1FL0A 4MTKA 1H9SA 3EROA 3A5UA 1SN8A 3RR5A 1IXRA 2NVYH 4DAPA 2UXBQ 2PW5A 1MJEA 2RA4A 1QG7A 5M3MH 3KLWA 3CCSA 1WTWA 4DXGA 1DZ1A 1PTOD 1NR4A 3HG9A 1ILQA 2A8VA 2KEDA 3KJOA 3UDGA 1LO5D 1CKOA 2L12A 1FJGL 5C3EG 2HCIA 1DJRD 2ZJQA 4M8AA 3I4LA 2CW0D 3RZOB 3K0XA 3P20A 1PV4A 2F0IA 2I0QA 4IPHA 1SNQA 1SLJA 4A3JB 1SNDA 3UI2A 2CVRA 3E0JA 5M3FB 1EY0A 4RKLA 3H91A 4DU9A 4CDCC 4LNQA 1SE4A 2DY8A 2ASBA 2MFIA 4YWMA 1B4OA 1N9WA 5C0XJ 1YNXA 1SYCA 1TWGH 1IYJB 5D65A 4JI3L 1D8LA 2Z6KA 4DK0A 4A3KH 2E74C 1B7YB 2DJGC 2XWJB 3M3YH 4JBJA 3RNUA 4CJ2C 3T4AC 4JI4L 1IBKQ 2PQAA 2K5NA 1FR3A 3GV3A 1EZ6A 4C2MH 1IBML 5JEAH 4LW1A 2ID0A 3PO3G 1E2VA 1K0SA 2RDHA 1MSGA 1UE1A 4X66L 1TU2B 1RTNA 4LF5L 1CSQA 1GXDC 1V1PA 2Q8IB 4K0KL 1MHWC 1Y8PB 3M4YA 2IHFA 3ZJYC 2EY5A 4A3MG 2CKZB 2BE5D 4EGVA 4BA1I 1L1OB 2HUGA 2EY2A 4A3BB 1PZKD 1IZ6A 2ICIA 1JOKA 4C3JB 1BBXC 2OXPA 4X3SA 4BY7G 5IGBA 4IALA 2GN5A 2Y0SE 5KYLA 2B8GA 2B2YA 4XQNA 3PO2B 3OIQA 3ONAB 3JC66 4JYAQ 4OO1G 5LMNW 1QVCA 3MXNA 4IFDJ 1Y1WB 2NZOA 1X55A 5TSSA 5C4XH 3MWYW 3JAMi 1N34Q 1STBA 2Z0SA 4QCLA 3HGBA 4B9WA 5GADC 4P74A 1GHJA 5EGTA 5I6YA 2R92B 4FF1A 2E2HH 5IY0A 3AB9A 4JI0L 2YV5A 2EY1A 1X3PA 3GV6A 4UP7A 1UUPA 3CPFA 4DV7Q 2VZAA 4N9PA 4LFBL 3PQIA 1TWAH 1SMYC 4DUZQ 4A3IG 3GTGB 1X32A 5CORA 1G51A 3J7AV 2A74C 4G57A 2I07B 2JEAI 3S14B 3U50C 1JC7A 3I90A 2SNSA 1ZEQX 4YCUA 4KHVA 3QO2A 4QIWB 1HNXL 4LFCQ 1EY9A 5LL6S 3S15B 1DD2A 2PNRC 4HEDA 2ZT9C 1PFSA 2NZHA 4AYBG 1GVPA 1YNNC 2M00A 4M1UB 2BDNA 5FK9C 2JA7G 4B3ML 2HIVA 1JB7A 4J15A 4OX9Q 1NCVA 5HURA 1VCIA 4IQZA 4XTCS 4RFBA 1PYWD 4A3EB 3BVZA 3H0GG 4P72A 4HIMA 2K50A 2E2JH 1JWUD 2LMCB 1JE5A 5C44G 1I50H 2EYHA 4OWXB 4FXDA 4BBRG 2EJGC 2XVSA 2Z8LA 1TS3A 2WFWA 1EY7A 5EKKA 1Q8KA 1CKNB 2JQOA 3I70A 4DV2Q 4O0AA 3S2DB 3CU7A 4A3KB 2F0UA 3M3YB 1BUVT 5BN3A 1GUGA 1BO0A 2JXMB 1B8AA 3I4OA 4LF8Q 3D8GA 5K36H 1LTBD 3GTQH 1GUSA 4XQJA 3KF6B 4DNIA 4C2MB 5IYDG 1ZXTA 1EYAA 4ULLA 1LABA 5IYCH 5EJWA 4HIDA 4LF7Q 4RGMA 5ELBA 3NWSA 4OL7A 5T1GA 2KCTA 1KAWA 2HD3A 5IT9E 5DNFA 4O42A 4JI7L 1EEID 5E4WC 2OT2A 2PCFB 4DAYB 2I5MX 2J4XA 4A3FG 3BDCA 1OXXK 3KDFA 2F4IA 2NVQB 2R7ZH 2UUBL 5KEEA 2OTJA 3O13A 4Y52H 2ICEC 2D9UA 4DV5L
chains in the Genus database with same CATH topology
3EQLC 3NBIA 4B9XA 3FKIB 1KNAA 3PIO3 1BDOA 1S5CD 2OEOA 4PQXA 1S5BD 1CZWA 2E2DC 1Z7TA 2DY7A 4F87A 1AN8A 4L63B 2IX1A 3SK4A 1LTSD 2F0QA 1HUMA 2IWHA 1Q3LA 5KNBA 1G2SA 3BDOA 3K5NA 2WAQB 1FNUA 4KMUC 3MEHA 2F0VA 3TBIB 1BCPF 2RVLA 1MGSA 2A6EC 1AZPA 1Y8NB 2WACA 1JWSD 1ESFA 1D5ZC 2WIIB 1O7ZA 4L6TB 4Y7NB 2ZXOA 1V43A 1II3A 5J22A 4FNFA 1BNZA 3S1RB 1DYQA 1NR2A 3J7YW 1SYDA 5KYIA 4OIKA 1WCMB 1CHQD 4KHZA 4C3IG 3H0GB 3GTLB 1BCPC 5C6AA 5IGGA 1EQTA 1U4LA 1SYFA 1BR9A 4OHJA 4HMJA 4DGZA 1TQOA 1YNND 3S1MB 2RKSA 1AFPA 4F88A 3HKZB 1J8IA 2QF7A 2K05A 4DNTB 2F0KA 3K6OA 3FEWX 3A7AB 1E2ZA 1STHA 4IFDI 2K6AA 3WOEA 2KUMA 4K5XA 1CA5A 3JAML 1CT1D 1FGBD 5JVG3 1WTPA 4ZUIA 4MIUA 4ZRZA 1F77A 2A6HC 3DWAA 4K5VA 1LTTD 4MHEA 1EEFD 4CJ0B 3LWEA 3DWPA 1RDPD 2L5TA 4XYOA 2F1MA 5FO7B 4ZKBB 4KK7A 2F0PA 3C3LA 4MN3A 2EE1A 5KGUA 1HTPA 2AUJD 2HQEA 1HFNA 2HCCA 2PZTA 3I4NB 2F0MA 1LTID 1F2YA 1PTOF 1V8QA 1F9SA 2D5DA 4Z9CB 2EYPA 1FD7D 4K8IA 1G2TA 3SDZA 2F0DA 2K5QA 2IX0A 1KLUD 1HHVA 2VNUD 2B2VC 4KKUA 4H0LC 2Q8TA 3MXGA 4K6LA 3SE0A 3A54A 4CJ1B 3NXWA 1FYCA 1PTOC 4G7OC 4TRDA 4F8MA 2N88A 1CTMA 1Q8IA 4RGTA 2D62A 5JOBA 2JSOA 3HOXB 2R93B 3VA5A 3NTIA 1BF4A 1HXYD 1FNWA 3MFYA 5KRUA 5ELDA 2MP1A 5A35A 2TSSA 4S3SA 1QWYA 2MPMA 2PYKA 4CKBA 2X6GA 3N52A 1AZQA 2FFKB 1PRTD 1R9TB 1VF7A 1BQQT 5EBDA 2PZUA 1SNOA 3RMHA 2BCOA 5CR3A 4IURA 3J7AF 1EY5A 1F2LA 4KJNA 1I4GA 1D1IA 5JJZA 2NZ1D 2O4XA 2NN6G 3W3AA 3S9WA 2PW7A 2NTTA 2YU9B 1L0YB 1SXTA 1SJHD 2E75C 3IFDA 2RQXA 1EQVA 3K59A 3VA7A 3CRLC 1QCBD 3AMUA 5I9PA 4UAIA 2BE5C 3BVMA 4HMIA 5ISRA 3U9SA 1HCZA 1A2TA 1JR0D 3S1NB 1EWCA 1J9OA 2PZWA 3C2PA 3BYYB 1DM0B 2G9DA 4A93B 2NWGA 2IL8A 2V4DA 4FYDA 1RF2D 5D14A 2L4NA 5BN4A 2JA5B 4L8JA 4E6IA 4J1MA 3GD7A 4C3JG 4BY1B 3A8KE 5I6WA 3AU7A 2B2TC 5EPLA 1F9QA 3DEOA 5CV7A 3DM1A 3RD4A 1RKNA 4R8IA 3Q23A 3KF8A 5FKAC 1EFID 1Y1VB 4C56C 3D3RA 4CBVA 1O7LA 5C5LA 4IN3A 1JCKB 3Q24A 4FVMA 2DNCA 4RCNA 3EFXD 1OO9B 1CZGA 1WD0A 1NUCA 2QCPX 2ZXPA 1G8ZD 1OXTA 1MSHA 4QB4A 4XT3B 3RLFA 1O78A 5JAVA 2K03A 4IUTA 3VR2A 3RZDB 2HDLA 1QOHA 2VB3X 1STEA 3ND8A 1I4HA 1M4VA 4ZUJA 4Q5VA 5EKIA 4RH6A 2JA6B 1KAAA 3P75A 4K14A 1GUTA 1BXTA 5C4JB 2EDGA 4XT1B 2F0SA 5ELFA 1Q1EA 5G3LD 3QG1A 4KN4C 4HR7B 3MHBA 4KI0A 2IJ0A 4B08A 2B8FA 2K33A 2WV6D 3OOCA 3KK7A 1TWFB 3S17B 5JEAG 2MGSA 1EZ8A 4RAUC 3ND9A 4X3KA 3I73A 2B2VA 1LTAD 1PZID 2ZXRA 4NKLA 3KLSX 1EWHA 4HN7A 5M9OA 5IGEA 1TVXA 3BVGA 4A3GB 1JQYD 3QJYA 2O2LD 3PUVA 4I65A 3PUZA 2FMCA 3DUZA 3VR6A 5CBEE 3BZDB 1SJED 5JVH3 3HS0C 1UAPA 2QILA 3KLSA 1TY2A 3D31A 4I7ZC 1OXVA 2F0OA 3FMCA 3Q0AA 3I72A 1STGA 3J81E 1SNCA 4IUNA 1EIGA 4TSSA 2WB1B 2F0LA 1ML0D 1KDCA 2L11A 1G6ZA 5HGTA 2NVYB 4PNYA 1IL8A 1I4XA 2R61A 5M3MB 3H3VC 4XQQA 3R93A 1B9MA 2H1EA 3SR1A 3IKJA 2L1BA 3D6WA 2M9VA 3QOJA 2F0NA 1D5MC 1H9MA 3R2TA 1PMRA 1WTRA 1S5ED 4LMQD 4QF4A 3GQBA 2RDGA 4P2CB 3EJIA 3T13A 5CYUA 1TR5A 4NDXA 1LV9A 3RUZA 4ZKCB 1TWGB 3EA6A 2KJXA 1RHPA 3L3OC 3T16A 4FF4A 2HDMA 5T1IA 3J80L 4TQUS 4KY6A 4R9WA 2IX3A 4HSVA 3OPOA 2B2TA 2C5CA 2QKIC 1Q12A 1CM9A 5EBCA 2H4OA 1ONLA 1LT4D 1RODA 1A15A 3ITPA 1CQVA 1Q1BA 2A73B 1DOMA 1EYCA 1U4RA 2AWNA 1IKLA 1KNEA 1F2ZA 3FPUB 3NBHA 1LT5D 3WDNA 3F2UA 3OSOA 2PQEA 5C4XB 3PUYA 1PRTF 1D6EC 1EU4A 2E2HB 1DOLA 2XIWA 3MAQA 3PIP3 1MI2A 2EVBA 5EPKA 1TWAB 3TP7A 1C8CA 1K8MA 3NTHA 4HAEA 3TP8A 1LTGD 1L0XB 1HUNA 2Z1CA 4NW2A 5EKLA 1PRTC 2KHSA 2M2LA 1K8OA 4RGOS 3GTJB 3PUWA 3P7JA 5F2DA 5IGCA 3D6CA 1AEXA 2SEBD 2KVMA 4CGYB 2SOBA 1UEAB 1F9RA 4H44C 1E0BA 1I4QA 1T5EA 1LT6D 3URYA 4RGNA 2E2JB 4J8QA 1PTOH 1I50B 1EY8A 1GJXA 1KLGD 1STYA 2AQ1B 4O1NA 3VR5A 1V1OA 4N9TA 4ZYSA 5D3IB 1STNA 1B44D 4DNRB 3U9OA 1ET6A 1LACA 1R4PB 2X69A 4ABNA 3TMEA 1ENAA 2EY6A 3GTQB 2QDBA 2EPBA 2MJ8A 2EYJA 2K5DA 2IPKD 2KEEA 3MFGA 1S5FD 2DN8A 1WVLA 3IAYA 2EYFA 3NUCA 1HRJA 1XYIA 3GP7A 4BA2I 4V0BA 3ZYYX 5I9OA 3KBXA 3K5OA 3MA2B 1H9SB 2R7ZB 5C0XG 3E5SA 2WINB 1CI3M 5ELEA 3S16B 1KDAA 2YYZA 2FINB 1W6JA 2XNAC 3A8IE 3SHLA 2RBMA 4OGQC 1GUWA 1LT3D 1D2BA 3D4DA 3LWUA 2NTSA 3P1HA 1TY0A 1DCZA 2JA8B 5E3FA 4YIJA 3GTKB 4ZK9B 2A68D 5LL6X 3J80E 2E2IB 1TWHB 5BN5A 4XDXA 1A3UA 4PV1C 2NYZD 4H7BA 2A69D 3OMGA 2DNEA 3OHXC 1HA6A 5G3LF 3D4RA 3M4OB 2JE6I 3S1QB 2JP1A 4IFDG 4HCSA 1HA5A 5DM73 4RHSA 3TP6A 1SDFA 3TZUA 1F9PA 2F0GA 1LLRD 1CK1A 1B1ZA 1JORA 4HCEA 2XRQD 5FOBB 1V1PB 3D4WA 1STAA 3FDTA 3I3CA 4XYQA 4DAYA 4C1NK 1NAPA 3R2IA 2PPBC 3QOLA 3GTMB 1EY4A 4LAAA 3HZXA 1SE3A 1I3QB 1K83B 4RCOA 1SYGA 4KTAA 5DEHA 2Y0SB 5NUCA 2VUMB 3HOWB 4ILWA 1EL0A 1PFBA 3HRZC 5E1FA 2B39A 5E4XA 1VMPA 2F0WA 2D2CC 3HOVB 5CBAE 1R4QB 1RD9D 4QMGA 1OXSC 1SFOB 3PMFA 1UNSA 1PFNA 1A3VA 1MD2D 3SK8A 3GO5A 3DMUA 3QWNA 3HOYB 1H9JA 2LFNA 3FRPB 4WORA 3K7AB 4C3HB 3CKIB 3MZ5A 5CMDA 5LHY1 4U673 3QB3A 2WP8J 4CKEA 5C5MA 1PFMA 1WTQA 3NP8A 3JAME 4OIJA 4KJOA 4FXGC 2MHVA 2K04A 4IUPA 2BDOA 4UDUC 3MTSA 4C1NI 3L7ZC 3FPPA 2KCCA 4EQOA 4RWSC 1XTCD 2KCNA 3KBGA 5CGKA 2K32A 5COYA 1EY6A 3SK6A 1Z47A 1XXGA 2K1BA 1SNMA 5DM63 1EOTA 1FNVA 3E6ZX 2K5WA 4PMWA 2FJ2A 2F03A 2RSNA 4WFN3 4DF7A 2G9HD 1OXUA 2XSCA 3A56A 1F2MA 4OO1I 5IT9L 1WTOA 3I4MB 5IODA 4PMCA 2FMMA 1JICA 5CV6A 2SNMA 1GUNA 1ZKOA 2GA4B 1RTOA 3Q22A 4ZLTF 2MUYA 1SBBB 3I91A 4DA2A 2PMZB 4IUQA 4DFAA 4K8JA 2NB0A 1CQFA 4KD3A 5M5YB 1AP0A 3OMCA 5CV5A 1GHKA 3K58A 3X3NA 2NBFA 3DEPA 3V96A 3NE5B 5CV4A 5FLXL 4LK1C 2NVTB 2AQ2B 4DXFA 2ENBA 1HQRD 3M7NA 1HQMC 3HOUB 2N55A 3BYTB 4FXKC 3H09A 3R3OA 4FP5D 1ILPA 4G4KA 3SK5A 2J0TD 1JOOA 1GOZA 2TMPA 1TS4A 5M5WB 5AFWA 2LY7A 2BA0A 1B9NA 1KTKA 1O80A 5KNCA 4K5WA 4OO1H 3IL8A 2RSOA 1DOKA 3VYRA 3TN2A 3NTKA 2B63B 2Q8RE 1S5DD 4H13C 3V2TA 1XWEA 1TS2A 1W6KA 4RHRA 3CQZB 2LKVA 5I2YA 1JOQA 2B2WC 1QILA 5C4ZA 1B3AA 5CC4A 5J39A 3W2DA 4ODGA 3OWFA 3K0YA 5KNDA 1VF5C 1H9KA 1YNJC 2FHTA 1LTRD 1Y8OB 4EQNA 1EIHA 2VB2X 5FO9B 4ZAIA 5C3EB 5A2QL 1IW7C 5EQ0A 1Y69U 2KA7A 2BOSA 2EXZA 3BS1A 4QUCA 1C48A 5K36G 3Q6SA 4X3TA 1WTVA 3A55A 1EYDA 1CA6A 3K5MA 4RA8A 4GZYC 3NHHA 1I4PA 1IKMA 1HFGA 1WTXA 3GTOB 4XIGS 1U4MA 1QB5D 3PO3B 2B2UC 1IYUA 1ENFA 3K5LA 3G6JB 3SXHA 2A68C 3M7GA 4TKOB 3LNNA 3NK9A 1KABA 2K28A 2KECA 3OIPA 2A69C 4A3MB 2Z4HA 4X3UA 1D1KA 1GUOA 3ERQA 2F0JA 4KV6A 2L0CA 5JPNC 1CFMA 4BY7B 2EOTA 1QE6A 4K6DA 3HEJA 1TKWB 3MC0B 1HPCA 3NPPA 1RJTA 2VXWA 4G7ZC 4U68A 1H9RA 4PMBA 3T51B 1A6XA 2AWOA 2J7ZA 1IHZA 3T53B 4BWGB 4K2LA 1EU3A 5DAUA 4KY5A 2LS01 1QNKA 2AQ3B 1G91A 4A3IB 3G7LA 3R8BA 1QJOA 5FLXE 3PV0A 4V190 4K2KA 5I4DA 4F7XA 1E2WA 1ET9A 4WJWA 1WD1A 3OWEB 2SDFA 4J6HA 1I4RA 4IZ8A 3LX0A 3K57A 1VMCA 5C0XI 2EJMA 2QEJC 1SAPA 1M8AA 4AYBB 1PRTB 5M5XB 2JA7B 1ZYRC 4HTHA 1SMYD 4FO2A 5JPMC 3EVQA 1TIID 3BG3A 3IFTA 1ENCA 4G7HC 2WKDA 5KIXA 3NQTA 1SYEA 4Q0FA 2BA1A 1Z6HA 3A7LA 5C44B 5JEAJ 2IW3A 3C46A 1YNJD 3TDQA 1DXMA 4BBRB 1SNPA 2F0FA 3X3MA 1IYVA 1VDZA 1BCPB 1G291 3S2HB 1NSNS 1KDBA 5K5PA 2CHBD 4DAVA 5D3DA 1DONA 1XX8A 2OF1A 1B2TA 1IW7D 4QUFA 3PUXA 3H94A 2EJFC 5I2XA 3T56B 1JE4A 1ESRA 2XWBB 1Q90A 2RDFA 4KKTA 1RCVD 3NWTA 4IUVA 4KN7C 3TP5A 3OW7A 3TZDA 1MBYA 4EQPA 5C3WA 1PLFA 1AW7A 3I8ZA 4IUUA 5CV8A 1CHPD 4A3FB 1SSOA 1B53A 2PO4A 5IOCA 5A2QE 1PXUA 2B2WA 5C0XH 3CHBD 5ELCA 3NSWA 2L9HA 2I46A 3VYUA 4C3HG 5J1ZA 4LJZC 1PZJD 1A2UA 3TSSA 2NN6I 4BBSB 2L55A 4KD4A 4CKCA 3VYTA 1O7YA 5EPJA 5C3XA 1I6VC 3VYSA 2XRSD 1SEBD 1HTLD 1PDQA 3N6RA 1QNUA 2EYOA 2F3VA 3VR3A 5IGFA 3HP3A 5IGDA 2EZVA 3KUPA 2K7VA 1JWMD 4IFDH 2KQ3A 1PTOB 2JEBI 2B2YC 2R6GA 2CW0C 2EYLA 2EYMA 4NP5A 4DK1A 4A3DB 4C3IB 1ICWA 3NQIA 2A6ED 3CRKC 4ME5A 2B2UA 3BDLA 3QIAA 4HSPA 2A5HA 2K01A 5IIFA 3KLRA 3C1FA 3DWQA 3DXJC 1TT2A 1ZYRD 2F0TA 2NUCA 3SEBA 1SE2A 2IT1A 3SVMA 2NN6H 2KOLA 2R3ZA 3H6MA 4DN4M 2AUKA 2CQAA 3A8JE 1BCPD 1D5XC 3L9AX 2E76C 3MXUA 5C4HA 4ZQ3A 4JK1C 1JB3A 4EVOA 3VR4A 2F0EA 3MVVA 1T5XD 3J81L 4BS9A 4WRDA 4KKSA 5CV9A 1SYBA 5FO8B 3MXPA 4FF2A 3V05A 2O5JC 1C4QA 4R8NA 3FVQA 2XN9C 1TS5A 3C1EA 3GTPB 2O5IC 3DHQA 4NMZA 1U4PA 1X3QA 2A6HD 2F0HA 1U9RA 4KY7A 1TWCB 2X6LA 2WKCA 4ID6A 3HOZB 1I6HB 1B50A 4FF3A 2F3WA 1A3TA 2Z4IA 4XXEA 4CHTB 4RKBA 3WOFA 1S4ZA 4JBWA 3M85A 2JYOA 1BOSA 2C9OA 2NVXB 1H9SA 3EROA 4DAPA 2PW5A 2RA4A 1QG7A 1WTWA 4DXGA 1DZ1A 1PTOD 1NR4A 3HG9A 1ILQA 2KEDA 1LO5D 2L12A 2HCIA 1DJRD 4M8AA 3I4LA 2CW0D 3RZOB 3P20A 2F0IA 1SNQA 4A3JB 1SNDA 3UI2A 2CVRA 3E0JA 5M3FB 1EY0A 4RKLA 3H91A 4DU9A 1SE4A 2DY8A 1B4OA 5C0XJ 1SYCA 5D65A 4DK0A 2E74C 2XWJB 4CJ2C 3T4AC 1FR3A 3GV3A 1EZ6A 5JEAH 2ID0A 1E2VA 2RDHA 1MSGA 1TU2B 1RTNA 1GXDC 1V1PA 2Q8IB 1Y8PB 3M4YA 2EY5A 4EGVA 2BE5D 4BA1I 4A3BB 2HUGA 2EY2A 1PZKD 2ICIA 1JOKA 4C3JB 1BBXC 2OXPA 4X3SA 5IGBA 4IALA 5KYLA 2B8GA 2B2YA 4XQNA 3PO2B 3OIQA 3ONAB 4OO1G 3MXNA 4IFDJ 1Y1WB 5TSSA 3MWYW 1STBA 4QCLA 3HGBA 4B9WA 2R92B 1GHJA 5EGTA 5I6YA 4FF1A 3AB9A 2EY1A 1X3PA 3GV6A 1UUPA 4N9PA 1SMYC 3GTGB 1X32A 5CORA 3J7AV 2A74C 4G57A 2I07B 2JEAI 3S14B 1JC7A 3I90A 2SNSA 1ZEQX 4KHVA 3QO2A 4QIWB 1EY9A 5LL6S 3S15B 1DD2A 2PNRC 4HEDA 2ZT9C 1YNNC 2M00A 4M1UB 2BDNA 5FK9C 1NCVA 5HURA 1VCIA 4IQZA 4XTCS 4RFBA 1PYWD 4A3EB 3BVZA 1JWUD 2LMCB 2EYHA 4FXDA 2EJGC 2XVSA 2Z8LA 1TS3A 1EY7A 5EKKA 3I70A 3S2DB 3CU7A 4A3KB 2F0UA 3M3YB 1BUVT 5BN3A 1GUGA 1BO0A 2JXMB 3D8GA 5K36H 1LTBD 1GUSA 4XQJA 4C2MB 1ZXTA 1EYAA 4ULLA 1LABA 5EJWA 4RGMA 5ELBA 3NWSA 4OL7A 5T1GA 5IT9E 5DNFA 4O42A 1EEID 5E4WC 2OT2A 2PCFB 2J4XA 3BDCA 1OXXK 2F4IA 2NVQB 5KEEA 3O13A 2ICEC 2D9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4K A;  3BS1 A;  4XXE A;  4CBV A;  4XYO A;  4XQJ A;  4XQN A;  4XYQ A;  4XQQ A; 
#chains in the Genus database with same CATH topology
 2VW9 A;  3S16 H;  3EQL C;  3NBI A;  4B9X A;  1DGS A;  3FKI B;  1KNA A;  2N8N A;  3PIO 3;  4YCW A;  1BDO A;  1S5C D;  2MNA A;  3I4N G;  4DR2 L;  2OEO A;  4PQX A;  1S5B D;  4BBS G;  3KFU A;  1CZW A;  2E2D C;  1VQC A;  5JJI A;  1Z7T A;  2DY7 A;  4F87 A;  1AN8 A;  4L63 B;  2IX1 A;  1HZA A;  2L15 A;  3SK4 A;  3I55 A;  1LTS D;  2F0Q A;  3ULJ A;  1HUM A;  2JA8 H;  4X65 Q;  2IWH A;  1Q3L A;  5KNB A;  1G2S A;  1XMO Q;  3BDO A;  3K5N A;  2WAQ B;  1VQB A;  1FNU A;  4KMU C;  3MEH A;  2E2I H;  2F0V A;  1TWH H;  4RMF A;  2RCN A;  1UE6 A;  3TBI B;  1BCP F;  2RVL A;  1MGS A;  2A6E C;  1AZP A;  1Y8N B;  2K14 A;  1N33 L;  1KHI A;  2WAC A;  1JWS D;  5IWA L;  1ESF A;  3M4O H;  1K28 A;  1VQI A;  1D5Z C;  2WII B;  1EQQ A;  4KHP L;  1B3Q A;  1O7Z A;  4L6T B;  4Y7N B;  3S1Q H;  1XNQ L;  2ZXO A;  2UUA Q;  1V43 A;  1II3 A;  5DLQ E;  5J22 A;  4FNF A;  3HOX H;  2R93 H;  1BNZ A;  2ZJP A;  3S1R B;  1DYQ A;  1NR2 A;  3J7Y W;  1SYD A;  5KYI A;  4JW0 A;  4OIK A;  3HFZ B;  1WCM B;  1CHQ D;  4KHZ A;  4N8X 1;  4C3I G;  3H0G B;  3GTL B;  1QZH A;  1VQK A;  1BCP C;  1X3G A;  1XPR A;  1XPO A;  5C6A A;  5IGG A;  3TS0 A;  1EQT A;  3FHW A;  1U4L A;  1SYF A;  1BR9 A;  4OHJ A;  4HMJ A;  4DGZ A;  1W3S A;  5EAY A;  1TQO A;  1YNN D;  3S1M B;  2RKS A;  1AFP A;  4B3T L;  5IT9 c;  1LM0 A;  4F88 A;  3HKZ B;  3RN2 A;  2F3I A;  2QF7 A;  3GTM H;  1J8I A;  2K05 A;  4DNT B;  2F0K A;  1BBU A;  1I3Q H;  1E3P A;  3K6O A;  1XMQ L;  4DUY L;  2GVA A;  3FEW X;  2GVB A;  2UXC Q;  3A7A B;  1E2Z A;  1MKH A;  1STH A;  4IFD I;  2HQL A;  1EWI A;  2I5L X;  2K6A A;  2XTI A;  3WOE A;  3OTO L;  4JV5 Q;  2KUM A;  2VUM H;  4K5X A;  4BXX G;  1CA5 A;  1K73 C;  3CCL A;  3HOW H;  3JAM L;  1EOV A;  1WJJ A;  1CT1 D;  1FGB D;  3E0E A;  4JI1 Q;  5JVG 3;  1WTP A;  4ZUI A;  4MIU A;  4ZRZ A;  1F77 A;  2A6H C;  3DWA A;  4K5V A;  1LTT D;  1KRT A;  4MHE A;  1EEF D;  4CJ0 B;  4DR6 L;  3LWE A;  3G4S A;  1QUQ B;  3DWP A;  3I7F A;  3CF5 A;  4DR5 Q;  1RDP D;  2L5T A;  4XYO A;  2F1M A;  3HOV H;  2UXD Q;  5IP9 G;  1VQH A;  5FO7 B;  1EIF A;  2JA9 A;  4ZKB B;  4KK7 A;  5FLX c;  3CC7 A;  4YWK A;  2F0P A;  3C3L A;  4MN3 A;  4LF4 Q;  4LF9 L;  2EE1 A;  5KGU A;  4GLX A;  1E24 A;  1HTP A;  4A75 A;  1SFO H;  2AUJ D;  2HQE A;  4A93 G;  1HFN A;  4GKK L;  2HCC A;  4DPG A;  2PZT A;  3I4N B;  2ES2 A;  2F0M A;  1LTI D;  1F2Y A;  1PTO F;  1V8Q A;  1F9S A;  2D5D A;  1YVC A;  3LGJ A;  1PH1 A;  2JA5 H;  4A3C H;  1E7Z A;  1HNW Q;  4Z9C B;  1A62 A;  1VQ8 A;  2EYP A;  4OEM B;  3HOY H;  1FD7 D;  1YIT A;  3BJU A;  4NXM Q;  4BY1 G;  3K7A H;  4K8I A;  4C3H H;  1G2T A;  3SDZ A;  4N8F A;  2F0D A;  2K5Q A;  2IX0 A;  1KLU D;  4GOP B;  1HHV A;  1J5E L;  3M4P A;  2VNU D;  1C9O A;  4PZ6 A;  3HOZ G;  2B2V C;  2DGY A;  4KKU A;  4H0L C;  2Q8T A;  5L37 A;  3MXG A;  4K6L A;  3SE0 A;  3A54 A;  4CJ1 B;  3NXW A;  1FYC A;  1Y1V G;  1PTO C;  4DV6 Q;  4G7O C;  4TRD A;  4F8M A;  2N88 A;  1CTM A;  1VQO A;  1Q8I A;  1JT8 A;  4RGT A;  1VS0 A;  2D62 A;  5JOB A;  2JSO A;  3HOX B;  2R93 B;  3VA5 A;  3NTI A;  3QR8 A;  1BF4 A;  1HXY D;  1FNW A;  1WFQ A;  3MFY A;  5KRU A;  5ELD A;  2MP1 A;  5A35 A;  5LMN Q;  2TSS A;  2UU9 Q;  4S3S A;  1QWY A;  2MPM A;  1KIX A;  2PYK A;  4CKB A;  2K5H A;  1BVS A;  2X6G A;  1P8L A;  1TXY A;  3N52 A;  4L5T A;  1AZQ A;  2FFK B;  1PRT D;  1R9T B;  3W1B A;  3RZD H;  1VF7 A;  5FLM G;  4GNX B;  1BQQ T;  5EBD A;  2PZU A;  1SNO A;  3RMH A;  2BCO A;  5CR3 A;  4IUR A;  2Q2U A;  3ULL A;  3J7A F;  1EY5 A;  4I7A A;  1F2L A;  1U5K A;  4KJN A;  1I4G A;  4A3J G;  1D1I A;  5JJZ A;  2NZ1 D;  2O4X A;  3I4M H;  2NN6 G;  3W3A A;  5M3F G;  3S9W A;  1HR0 W;  2PW7 A;  1YHQ A;  1ASZ A;  3CC4 A;  2NTT A;  2YU9 B;  1L0Y B;  2ZM6 L;  2VL6 A;  1SXT A;  2Q2H A;  1SJH D;  3UDI A;  2E75 C;  3IFD A;  1I94 Q;  2RQX A;  1EQV A;  3K59 A;  3VA7 A;  3CRL C;  1QCB D;  2B29 A;  3AMU A;  5I9P A;  4UAI A;  4AIM A;  1PHJ A;  2BE5 C;  2E8G A;  3BVM A;  4HMI A;  1VQ9 A;  3EBE A;  5ISR A;  3U9S A;  1HCZ A;  1A2T A;  5M5Y H;  2KHI A;  1JR0 D;  3A0J A;  4JI5 L;  1EWC A;  4AYB E;  3S1N B;  4IO9 A;  1J9O A;  1UE7 A;  3E9I A;  4CDD C;  2AKW B;  2PZW A;  3RLN A;  1XTD A;  2VY3 A;  3C2P A;  3BYY B;  1DM0 B;  1BKB A;  2G9D A;  4A93 B;  2NWG A;  4PG3 A;  2IL8 A;  2V4D A;  4FYD A;  2NVT H;  4AH6 A;  1RF2 D;  5D14 A;  1VQG A;  4A3G H;  2L4N A;  5BN4 A;  1YJ9 A;  1C7Y A;  2JA5 B;  4L8J A;  4E6I A;  3J80 i;  4J1M A;  3HOU H;  1NMG A;  3GD7 A;  4C3J G;  4BY1 B;  3A8K E;  3F8T A;  5I6W A;  4X64 Q;  3AU7 A;  2B2T C;  5AJ3 Q;  5EPL A;  4B3R Q;  1YHA A;  1F9Q A;  4YHH L;  3DEO A;  5M5W H;  5CV7 A;  1IBL Q;  5JJK A;  3NEL A;  4AQY Q;  3DM1 A;  3RD4 A;  1X9N A;  1RKN A;  4R8I A;  3Q23 A;  4A3L H;  4FDB A;  3KF8 A;  5FKA C;  2R92 G;  4PZ8 A;  1WYD A;  1EFI D;  3VDY A;  2V1C C;  1Y1V B;  4C56 C;  3D3R A;  4CBV A;  4JI2 Q;  1O7L A;  4X6A H;  5C5L A;  4IN3 A;  1JCK B;  3Q24 A;  4FVM A;  2DNC A;  4RCN A;  1XPU A;  3EFX D;  2B63 H;  1OO9 B;  1CZG A;  1WD0 A;  1NUC A;  2QCP X;  2ZXP A;  1NTG A;  1Q82 C;  1NNX A;  1G8Z D;  3CQZ H;  4H02 A;  1OXT A;  1MSH A;  3PIP A;  2KCM A;  4QB4 A;  4XT3 B;  3RLF A;  1XNR L;  4JI8 Q;  2EXD A;  4NPS A;  1O78 A;  5JAV A;  2K03 A;  4IUT A;  3VR2 A;  3RZD B;  2HDL A;  4GN4 B;  2LSS A;  1QOH A;  2VB3 X;  1STE A;  3ND8 A;  2C35 B;  1I4H A;  1M4V A;  4LFA Q;  2UXB L;  4ZUJ A;  4Q5V A;  3KDF B;  5EKI A;  1K3B C;  4RH6 A;  2RCF A;  3E9H A;  3OYY A;  3Q8D A;  2JA6 B;  1KAA A;  1VQJ A;  3P75 A;  4A3E G;  4K14 A;  1GUT A;  2Z6B A;  1BXT A;  4UHV A;  4R4C A;  5C4J B;  2EDG A;  2MO0 A;  4XT1 B;  4DR7 Q;  3CD6 A;  1KL9 A;  2F0S A;  5ELF A;  1Q1E A;  5G3L D;  3QG1 A;  4KN4 C;  4HR7 B;  3MHB A;  4KI0 A;  2IJ0 A;  4B08 A;  4A3K G;  4YY3 Q;  2Q2I A;  2B8F A;  4NB3 A;  2K33 A;  2HHH L;  4IPG A;  2WV6 D;  3OOC A;  2HT1 A;  3KK7 A;  1TWF B;  1JJC B;  3TEH B;  3S17 B;  1XJV A;  5JEA G;  2MGS A;  1EZ8 A;  4RAU C;  1IBK L;  3ND9 A;  4X3K A;  3I73 A;  2B2V A;  1LTA D;  1PZI D;  1X6O A;  2ZXR A;  4NKL A;  2ZTD A;  3KLS X;  1L1O C;  4L5Q A;  1EWH A;  4JCV E;  1E1O A;  4HN7 A;  5M9O A;  4X66 Q;  1U0L A;  5IGE A;  4WJ4 A;  1TVX A;  3BVG A;  3GTO H;  4A3G B;  1AE2 A;  3PO3 H;  1JQY D;  3QJY A;  2O2L D;  3PUV A;  4I65 A;  3PUZ A;  2FMC A;  3DUZ A;  3K7U C;  3VR6 A;  1Y14 B;  5CBE E;  3FKI G;  3BZD B;  3ULP A;  1SJE D;  4A3M H;  5JVH 3;  3HS0 C;  1J6Q A;  3U4Z A;  3G6E A;  1UAP A;  2QIL A;  1KXL A;  3KLS A;  1TY2 A;  4BY7 H;  3D31 A;  4I7Z C;  1OXV A;  2F0O A;  1UE5 A;  2VQF Q;  3FMC A;  3Q0A A;  1N34 L;  1VQD A;  3I72 A;  1S40 A;  1STG A;  3J81 E;  1SNC A;  2WAQ G;  4IUN A;  1OTC A;  1EIG A;  2K4K A;  4TSS A;  4EQ5 A;  2WB1 B;  4LFB Q;  4LUO A;  2F0L A;  4DV7 L;  1ML0 D;  1KDC A;  2L11 A;  1G6Z A;  1L0W A;  3G48 A;  5HGT A;  4DUZ L;  4UY8 C;  2NVY B;  4PNY A;  1IL8 A;  1I4X A;  2R61 A;  2OQ0 A;  5M3M B;  3H3V C;  4XQQ A;  1G6P A;  3R93 A;  4A3I H;  1B9M A;  2H1E A;  3SR1 A;  3GTJ H;  3IKJ A;  2L1B A;  3D6W A;  2M9V A;  3QOJ A;  2VS1 A;  4QL5 A;  5BR8 Q;  2F0N A;  4HJ8 A;  2K75 A;  1D5M C;  1H9M A;  1WI5 A;  3R2T A;  1EYG A;  4B3M Q;  1WCM G;  1MJC A;  1PMR A;  4UP8 A;  1WTR A;  4NXN Q;  4OX9 L;  1S5E D;  4LMQ D;  1X3F A;  4QF4 A;  3GQB A;  2Q2T A;  2RDG A;  4OXP A;  4P2C B;  3EJI A;  3T13 A;  5CYU A;  1TR5 A;  4NDX A;  1LV9 A;  5GQO A;  2KHJ A;  3RUZ A;  1TWG B;  3EA6 A;  4ZKC B;  2KJX A;  4GKJ Q;  2OWO A;  1RHP A;  3L3O C;  3HKZ G;  4DK6 C;  4P75 A;  5IE8 A;  3T16 A;  4FF4 A;  2HDM A;  5T1I A;  3J80 L;  4TQU S;  4KY6 A;  5C44 H;  4YCV A;  4R9W A;  4DV2 L;  2IX3 A;  4HSV A;  3OPO A;  2R7D A;  1V9P A;  2B2T A;  1SRU A;  2I5H A;  2C5C A;  3S2H H;  5IYC G;  2QKI C;  4LF8 L;  1QVF A;  1NBW A;  4HJ5 A;  2UUC Q;  1Q12 A;  1CM9 A;  4JI6 Q;  5EBC A;  2H4O A;  1ONL A;  1LT4 D;  1ROD A;  1A15 A;  1PYS B;  1L2F A;  3TQY A;  1Q7Y C;  3ITP A;  1CQV A;  4LF7 L;  5IYD H;  1Q1B A;  2A73 B;  1DOM A;  1EYC A;  3CP0 A;  1U4R A;  4JI7 Q;  2AWN A;  3J81 c;  1IKL A;  1S72 A;  1KNE A;  1VQ5 A;  1JMC A;  1F2Z A;  3FPU B;  3NBH A;  1W2B A;  1LT5 D;  1LYL A;  3WDN A;  3F2U A;  3OSO A;  2PQE A;  2UUB Q;  1HR0 Q;  1A8V A;  5C4X B;  3PUY A;  1NJI C;  1PRT F;  4A3F H;  1K8G A;  4DV4 Q;  1D6E C;  3UE1 A;  3L0O A;  1EU4 A;  1VQ6 A;  2E2H B;  1YIJ A;  1DOL A;  2XIW A;  3MAQ A;  3GDE A;  1N36 Q;  3GTK H;  3PIP 3;  1T9H A;  1MI2 A;  2EVB A;  5EPK A;  1TWA B;  3TP7 A;  1C8C A;  2JJQ A;  2EIF A;  1K8M A;  3J81 j;  3NTH A;  4HAE A;  3TP8 A;  4X65 L;  1LTG D;  3AYH B;  1L0X B;  2LXJ A;  3BU2 A;  4ZCK A;  1XMO L;  3NEN A;  1HUN A;  2Z1C A;  4NW2 A;  5EKL A;  1PRT C;  2KHS A;  2M2L A;  3EN2 A;  1N32 Q;  4DR4 Q;  1K8O A;  4RGO S;  1A63 A;  3GTJ B;  1MIU A;  5IWA Q;  2XGT A;  2A1A A;  3PUW A;  2LXK A;  3HOX G;  3P7J A;  5F2D A;  2R93 G;  5IGC A;  4DR3 Q;  3D6C A;  1AEX A;  1XNQ Q;  2SEB D;  2KVM A;  4CGY B;  2SOB A;  4HJA A;  1UEA B;  1VQF A;  1F9R A;  3M9B A;  4H44 C;  2UUA L;  1E0B A;  3CCM A;  4X62 L;  4QY7 A;  1I4Q A;  4IOC A;  1T5E A;  1LT6 D;  3URY A;  1A0I A;  4RGN A;  3T1Y Q;  2E2J B;  1D7Q A;  1E22 A;  3CCU A;  4J8Q A;  1PTO H;  1I50 B;  1EY8 A;  4MNO A;  1GJX A;  1KLG D;  4GLV B;  1L1O A;  1STY A;  1I5F A;  2AQ1 B;  4O1N A;  4DV1 Q;  3VR5 A;  1V1O A;  4N9T A;  4ZYS A;  4A3D H;  5D3I B;  1EUJ A;  1STN A;  4C3I H;  1B44 D;  4DNR B;  3U9O A;  1ET6 A;  1LAC A;  1R4P B;  2X69 A;  5GAG C;  5JJL A;  1M1K C;  1K83 H;  3S24 A;  4ABN A;  3TME A;  1ENA A;  2EY6 A;  3GTQ B;  3KYH C;  2QDB A;  3KF8 B;  3NEM A;  1XMQ Q;  4P71 A;  4JPB W;  2EPB A;  3HOW G;  2MJ8 A;  2PI2 E;  2EYJ A;  2K5D A;  2UXC L;  2CWP A;  3OTO Q;  2IPK D;  2KEE A;  3MFG A;  1S5F D;  2DN8 A;  1WVL A;  3IAY A;  2EYF A;  3NUC A;  1HRJ A;  1XYI A;  3GP7 A;  4BA2 I;  4QIW E;  3CMA A;  4V0B A;  2PI2 A;  3ZYY X;  5I9O A;  3KBX A;  3K5O A;  2YTY A;  3MA2 B;  1H9S B;  2R7Z B;  5C0X G;  3E5S A;  1VQA A;  2WIN B;  1CI3 M;  4TVA B;  5ELE A;  3S16 B;  1KDA A;  2YYZ A;  2FIN B;  2VQE L;  1W6J A;  2XNA C;  2UXD L;  3G71 A;  4JOI C;  3A8I E;  3SHL A;  2RBM A;  4OGQ C;  5LMU Q;  1GUW A;  1LT3 D;  2JA5 G;  1PYB A;  1D2B A;  5IP9 H;  2JK8 A;  3D4D A;  3LWU A;  4GOP C;  2NTS A;  3AEV A;  3P1H A;  1TY0 A;  2HIX A;  1DCZ A;  2JA8 B;  5E3F A;  4YIJ A;  3GTK B;  2BH8 A;  4JC0 A;  4ZK9 B;  3GTP H;  2A68 D;  5LL6 X;  1HNW L;  3J80 E;  2E2I B;  4NXM L;  1TWH B;  5BN5 A;  4GN3 B;  1SMX A;  1A3U A;  4PV1 C;  4XDX A;  5IP7 G;  2NYZ D;  4MZ9 A;  1J5E Q;  2RHQ B;  4H7B A;  4RG1 A;  2A69 D;  1CKN A;  3OMG A;  1Q86 C;  2DNE A;  1KC8 C;  1C0A A;  3OHX C;  1HA6 A;  5G3L F;  3D4R A;  1TWC H;  2CQO A;  3M4O B;  2PQA B;  2QA4 A;  3I56 A;  2KEN A;  4DV0 Q;  2JE6 I;  4IPC A;  3HOZ H;  3S1Q B;  2JP1 A;  3STB D;  1I6H H;  2A19 A;  4IFD G;  4HCS A;  1HA5 A;  5DM7 3;  3KF6 A;  4RHS A;  3TP6 A;  4DV6 L;  1SDF A;  3TZU A;  1F9P A;  2F0G A;  1LLR D;  1CK1 A;  1B1Z A;  1JOR A;  1V1Q A;  4HCE A;  2XRQ D;  4GNX C;  5FOB B;  1V1P B;  1HZC A;  3J7A 5;  3D4W A;  1STA A;  3FDT A;  3I3C A;  4XYQ A;  4DAY A;  2F4V Q;  1PH2 A;  5LMN L;  4C1N K;  1VQ4 A;  1NAP A;  2NVX H;  3R2I A;  2PPB C;  3QOL A;  3GTM B;  1EY4 A;  4OWT B;  4LAA A;  2JA6 G;  3HZX A;  1SE3 A;  1YZ6 A;  3MXN B;  1I3Q B;  1KD1 C;  1K83 B;  4RCO A;  4POF A;  1SYG A;  4MTN A;  4KTA A;  4QGU A;  1YI2 A;  5DEH A;  3PCO B;  2Y0S B;  5NUC A;  1RL2 A;  2WAQ E;  3PF4 A;  3F1Z A;  2VUM B;  3HOW B;  4IOA A;  3CAM A;  3RZO H;  2E5L L;  1FVI A;  2IY5 B;  4DR1 Q;  4ILW A;  2ZM6 Q;  4JG2 A;  1EL0 A;  4A3J H;  1PFB A;  1Z9F A;  3HRZ C;  5M3F H;  2B39 A;  5E1F A;  5E4X A;  1I94 L;  2F52 A;  1VMP A;  2F0W A;  2D2C C;  1PA6 A;  3HOV B;  5CBA E;  1R4Q B;  3J80 c;  1RD9 D;  3RLO A;  4O2D A;  4QMG A;  4JBK A;  1OXS C;  1SFO B;  3PMF A;  1UNS A;  1PFN A;  1A3V A;  4A3G G;  4DV3 Q;  1MD2 D;  3SK8 A;  3GO5 A;  2D0P A;  3DMU A;  3QWN A;  3HOY B;  4HJ7 A;  3H3V I;  1H9J A;  4LF6 L;  1NY4 A;  4IJL A;  4B3S Q;  2LFN A;  4GN5 A;  3FRP B;  3HOU G;  4WOR A;  3K7A B;  3CKI B;  4C3H B;  3MZ5 A;  4R4T A;  5CMD A;  1RIP A;  5LHY 1;  4U67 3;  3QB3 A;  2WP8 J;  4CKE A;  5C5M A;  5GAH C;  1X56 A;  3HKZ E;  1PFM A;  2Z9H A;  5IYB H;  1WTQ A;  4L5S A;  3TRZ A;  4A3B H;  4A3L G;  4X64 L;  1K3R A;  1HZB A;  3NP8 A;  5AJ3 L;  4C3J H;  4B3R L;  4LUV A;  3JAM E;  2FXQ A;  4OIJ A;  4KJO A;  1IBL L;  4FXG C;  1SE8 A;  2MHV A;  3PO2 H;  2K04 A;  4IUP A;  5E7N A;  4AQY L;  2BDO A;  3DLL A;  4UDU C;  3T1H Q;  1Y1W H;  1AE3 A;  3MTS A;  4C1N I;  1HNZ Q;  5FJ8 H;  3L7Z C;  2WB1 G;  3FPP A;  4JI2 L;  2KCC A;  4A4I A;  4EQO A;  2R92 H;  4RWS C;  1XTC D;  2KCN A;  3KBG A;  1UWV A;  2MQH A;  5CGK A;  2K32 A;  3OW2 A;  5M3M G;  5COY A;  1EY6 A;  3GTG H;  3SK6 A;  4OON A;  1Z47 A;  2YTV A;  1QUQ A;  1XXG A;  2K1B A;  1HJP A;  1SNM A;  5DM6 3;  1EOT A;  3S14 H;  4UPA A;  1FNV A;  4JI8 L;  3E6Z X;  2K5W A;  2ATW A;  4PMW A;  2FJ2 A;  2F03 A;  1BBW A;  2RSN A;  4WFN 3;  3NBH B;  3F2D A;  4DF7 A;  1FJG Q;  2G9H D;  1OXU A;  3S15 H;  2XSC A;  3A56 A;  1VQN A;  1PVO A;  1F2M A;  4OO1 I;  5IT9 L;  1QVG A;  1WTO A;  4LFA L;  3I4M B;  2ALY B;  4PMC A;  5IOD A;  2FMM A;  1GM5 A;  1JIC A;  5CV6 A;  1SR3 A;  2SNM A;  5C3E H;  3H3V H;  1GUN A;  1ZKO A;  2GA4 B;  1RTO A;  3Q22 A;  4JOI A;  4ZLT F;  1EQR A;  2MUY A;  4A3E H;  1SBB B;  3I91 A;  4DA2 A;  4DR7 L;  4JI3 Q;  4GOP A;  1KQS A;  2PMZ B;  4IUQ A;  4DFA A;  1QZG A;  4K8J A;  2NB0 A;  4JI4 Q;  1CQF A;  1WTH A;  4KD3 A;  5M5Y B;  2HHH Q;  4YY3 L;  1PH5 A;  1AP0 A;  3OMC A;  5CV5 A;  3S2D H;  1GHK A;  3K58 A;  3KOJ A;  3X3N A;  1IBM Q;  2NBF A;  3DEP A;  3V96 A;  3NE5 B;  3UDX A;  5CV4 A;  5FLX L;  4LK1 C;  3TRE A;  2NVT B;  2AQ2 B;  4DXF A;  4LF5 Q;  2ENB A;  2P5Z X;  3JAM c;  1HQR D;  4K0K Q;  2G5D A;  3M7N A;  1HQM C;  3HOU B;  2N55 A;  3BYT B;  3A5Z B;  4FXK C;  3WWV A;  3H09 A;  3R3O A;  4FP5 D;  1ILP A;  4G4K A;  3SK5 A;  2J0T D;  1JOO A;  3D0F A;  1GOZ A;  2TMP A;  1TS4 A;  5M5W B;  1CKM A;  1E1T A;  5C4X G;  2R7F A;  4GS3 A;  4GNX A;  5AFW A;  2LY7 A;  2BA0 A;  4JYA L;  1B9N A;  2DJF C;  1PH4 A;  3L2P A;  1KTK A;  2NVQ H;  1O80 A;  5KNC A;  4K5W A;  4OO1 H;  3IL8 A;  4POG A;  2RSO A;  1DOK A;  3VYR A;  3FKI H;  4JI0 Q;  3TN2 A;  3NTK A;  2B63 B;  2Q8R E;  1FGU A;  1S5D D;  4H13 C;  3V2T A;  4IPD A;  2BH2 A;  2VQF L;  2N49 A;  1XWE A;  1TS2 A;  1W6K A;  4L5R C;  4RHR A;  3CQZ B;  2LKV A;  1H95 A;  5I2Y A;  1JOQ A;  4APV A;  1PH7 A;  2JN4 A;  2AMC B;  2B2W C;  1QIL A;  1EIY B;  1HNX Q;  5C4Z A;  1B3A A;  4LWC A;  5CC4 A;  5J39 A;  4JBM A;  4LFC L;  3W2D A;  1KRS A;  4ODG A;  1PH8 A;  1GD7 A;  3OWF A;  3ER0 A;  2D0O A;  2DUD A;  3K0Y A;  3K81 C;  5KND A;  1VF5 C;  1H9K A;  1YNJ C;  2FHT A;  4JVZ A;  1LTR D;  1Y8O B;  4EQN A;  4Y7N H;  1EIH A;  5BR8 L;  2VB2 X;  5FO9 B;  4ZAI A;  5M5X H;  2JA7 H;  5C3E B;  5A2Q L;  1P16 A;  3S1R H;  3TS2 A;  1IW7 C;  5EQ0 A;  1Y69 U;  4NXN L;  2KA7 A;  1JJ2 A;  1WCM H;  2BOS A;  3H0G H;  2EXZ A;  1K0R A;  2PNH A;  3GTL H;  3BS1 A;  2KBN A;  4QUC A;  1C48 A;  3I2Z A;  4GKJ L;  5K36 G;  4BBR H;  3CC2 A;  3Q6S A;  5ELO A;  4X3T A;  3S1M H;  1WTV A;  3A55 A;  1EYD A;  1CA6 A;  3K5M A;  4RA8 A;  1CUK A;  3U58 A;  4GZY C;  3NHH A;  1I4P A;  1IKM A;  1HFG A;  1WTX A;  4CDF C;  4XIG S;  1U4M A;  1QB5 D;  3GTO B;  4GLA C;  2YTX A;  4R4I A;  3PO3 B;  1X54 A;  2UUC L;  5ELN A;  4JI6 L;  2B2U C;  1IYU A;  1ENF A;  3K5L A;  4HJ9 A;  3G6J B;  3SXH A;  2R7Z G;  2A68 C;  3M7G A;  4TKO B;  3KJP A;  3LNN A;  3NK9 A;  4DKA C;  1YJW A;  1KAB A;  2K28 A;  2KEC A;  3OIP A;  2A69 C;  4DV5 Q;  4A3M B;  2Z4H A;  4X3U A;  1D1K A;  1GUO A;  3ERQ A;  2F0J A;  4KV6 A;  2L0C A;  5JPN C;  1VQP A;  1CFM A;  4BY7 B;  2EOT A;  2ZTE A;  4DR2 Q;  1QE6 A;  4K6D A;  3HEJ A;  1TKW B;  1HR0 L;  3MC0 B;  1HPC A;  4KLK A;  1IL2 A;  2JA8 G;  3NPP A;  3STB C;  2AHO B;  1B70 B;  1RJT A;  4DV4 L;  2VXW A;  4G7Z C;  4U68 A;  3EIV A;  3CME A;  4ALP A;  3I4N H;  1H9R A;  4PMB A;  3T51 B;  4BBS H;  1A6X A;  2AWO A;  2J7Z A;  5GRO A;  4CDE C;  1IHZ A;  1N36 L;  3J81 i;  2PMZ E;  3T53 B;  4BWG B;  4K2L A;  1EU3 A;  5DAU A;  4R4Q A;  4KY5 A;  1HH2 P;  2LS0 1;  4P73 A;  1QNK A;  2AQ3 B;  1G91 A;  3HKS A;  4HIO A;  4A3I B;  3G7L A;  1PH9 A;  3R8B A;  2ZJR A;  1QJO A;  1N33 Q;  2CFM A;  5FLX E;  3PV0 A;  4V19 0;  4K2K A;  5GAE C;  5I4D A;  4F7X A;  1E2W A;  1N8R C;  4KHP Q;  1ET9 A;  2H5X A;  4WJW A;  1N32 L;  1WD1 A;  4DR4 L;  3OWE B;  4DAM A;  2SDF A;  4J6H A;  1I4R A;  4IZ8 A;  3LX0 A;  3K57 A;  1VMC A;  5C0X I;  2EJM A;  2QEJ C;  1SAP A;  1M8A A;  4AYB B;  3J7Z C;  4DR3 L;  2OCE A;  1PRT B;  1X3E A;  5M5X B;  2JA7 B;  1ZYR C;  4HTH A;  2QDL A;  1SMY D;  4FO2 A;  4X62 Q;  5JPM C;  3EVQ A;  1TII D;  3BG3 A;  3IFT A;  1ENC A;  3UE0 A;  2EQS A;  4A3D G;  3T1Y L;  4G7H C;  2WKD A;  5KIX A;  1WOC A;  3NQT A;  1SYE A;  4Q0F A;  2BA1 A;  4B3T Q;  1Z6H A;  3A7L A;  1R9T H;  1ASY A;  5C44 B;  5JEA J;  2IW3 A;  4DV1 L;  1YNJ D;  3TDQ A;  1DXM A;  3C46 A;  4BBR B;  1SNP A;  2F0F A;  3X3M A;  3CCR A;  2Y0S G;  1IYV A;  1VDZ A;  4DUY Q;  1BCP B;  1G29 1;  3AFQ A;  3S2H B;  4HIK A;  2VUM G;  3CCV A;  1NSN S;  1KDB A;  2WB1 E;  5K5P A;  2CHB D;  2RF4 A;  5D3D A;  4DAV A;  4OWW B;  1DON A;  1XX8 A;  2OF1 A;  1B2T A;  1IW7 D;  4QUF A;  3PUX A;  3H94 A;  2EJF C;  4JV5 L;  5I2X A;  1GKH A;  3T56 B;  1JE4 A;  1ESR A;  2XWB B;  1Q90 A;  1YHB A;  2RDF A;  4KKT A;  1RCV D;  1NE3 A;  4YWL A;  3NWT A;  4JI1 L;  4IUV A;  4KN7 C;  2QW7 A;  3TP5 A;  2YU9 H;  4BXX H;  3HOV G;  4DR6 Q;  3OW7 A;  3TZD A;  1LTL A;  1MBY A;  1UEB A;  4EQP A;  5HY6 A;  4LUZ A;  3W1G A;  5C3W A;  1PLF A;  1AW7 A;  3I8Z A;  4DR5 L;  1K8A C;  1AH9 A;  4IUU A;  1VQL A;  5CV8 A;  1VQM A;  1CHP D;  4LF9 Q;  4A3F B;  3U4V A;  1SSO A;  1B53 A;  2PO4 A;  5IOC A;  2VQE Q;  4A3C G;  4GKK Q;  5A2Q E;  4LF4 L;  3S1N H;  1PXU A;  2B2W A;  5C0X H;  3HOY G;  3CHB D;  3M4Q A;  5ELC A;  3NSW A;  2RHS B;  2L9H A;  2I46 A;  1CSP A;  1Q46 A;  3VYU A;  4C3H G;  5LMU L;  5J1Z A;  4A93 H;  4LJZ C;  4PZ7 A;  1PZJ D;  1A2U A;  2CCZ A;  2Z6K C;  3TSS A;  2NN6 I;  4BBS B;  2L55 A;  3B6Y A;  4ME3 A;  4KD4 A;  4CKC A;  3VYT A;  1O7Y A;  1SRO A;  5EPJ A;  5C3X A;  3PSI A;  1I6V C;  3VYS A;  4A76 A;  4BY1 H;  2QGQ A;  4UP9 A;  2XRS D;  1SEB D;  1HTL D;  1PDQ A;  3N6R A;  3IRB A;  3PF5 A;  1QNU A;  2EYO A;  1EFW A;  3UDF A;  5IP7 H;  3AQQ A;  2F3V A;  1Y1V H;  1PH6 A;  3VR3 A;  2IHE A;  5IGF A;  4DV0 L;  3HP3 A;  5IGD A;  2CH4 A;  1VQ7 A;  1ICF B;  4OEL B;  2EZV A;  3BZK A;  3CCQ A;  3KUP A;  2OQK A;  2K7V A;  1JWM D;  4IFD H;  2KQ3 A;  1PTO B;  3CW2 C;  2JEB I;  3AFP A;  5H1S E;  1YEZ A;  2B2Y C;  2R6G A;  4QQB X;  2CW0 C;  2EYL A;  2EYM A;  4NP5 A;  3K8A A;  4QJF A;  4DK1 A;  2UU9 L;  2K5V A;  4A3D B;  3PGZ A;  2CH4 W;  3CCJ A;  4C3I B;  1ICW A;  3NQI A;  2F4V L;  2A6E D;  1JJG A;  1YJN A;  1O7I A;  3CRK C;  4ME5 A;  2B2U A;  3BDL A;  5FLM H;  3QIA A;  3I4M G;  4HSP A;  2ZTC A;  3CXC A;  2A5H A;  2K01 A;  5IIF A;  3KLR A;  3C1F A;  3DWQ A;  3DXJ C;  1TT2 A;  1ZYR D;  2F0T A;  1M90 C;  2NUC A;  3SEB A;  2JA6 H;  1K9M C;  4R4O A;  4EX5 A;  1SE2 A;  2IT1 A;  4R1J A;  3SVM A;  2NN6 H;  2E5L Q;  2KOL A;  2K52 A;  2R3Z A;  3H6M A;  4IJH A;  4DN4 M;  5C4J H;  2AUK A;  2CQA A;  3A8J E;  1BCP D;  5J3B A;  1D5X C;  4DR1 L;  2CWA A;  3L9A X;  3RN5 A;  2E76 C;  3K80 C;  3MXU A;  5C4H A;  4ZQ3 A;  4JK1 C;  4DK3 C;  1JB3 A;  3CCE A;  4EVO A;  1PH3 A;  3VR4 A;  2F0E A;  3MVV A;  4JI5 Q;  1T5X D;  3J81 L;  4BS9 A;  4WRD A;  3ICE A;  4KKS A;  5CV9 A;  1TWF H;  1SYB A;  5FO8 B;  3MXP A;  3S17 H;  4FF2 A;  3V05 A;  2N3S A;  2O5J C;  1C4Q A;  3ERS X;  4R8N A;  3FVQ A;  3CPW A;  2XN9 C;  1TS5 A;  4DV3 L;  3C1E A;  4LF6 Q;  3GTP B;  3MEF A;  2O5I C;  3DHQ A;  4NMZ A;  1YBY A;  1U4P A;  1NMF A;  4B3S L;  1X3Q A;  3DM3 A;  2A6H D;  2F0H A;  5IYB G;  2N78 A;  3SGI A;  4YHH Q;  3F2C A;  4A3B G;  2MO1 A;  3BZC A;  1U9R A;  4KY7 A;  3F2B A;  1TWC B;  5HGQ A;  3PO2 G;  2QEX A;  2OTL A;  1Q81 C;  2X6L A;  1HZ9 A;  2WKC A;  1Y1W G;  4ID6 A;  3HOZ B;  3A74 A;  2B63 G;  1GO3 E;  1I6H B;  1B50 A;  4FF3 A;  2F3W A;  5FJ8 G;  1A3T A;  1X65 A;  2Z4I A;  1LUZ A;  3T1H L;  1VQE A;  4XXE A;  4CHT B;  4WJ3 M;  1HNZ L;  3PIO A;  3E3X A;  1S3O A;  4RKB A;  3WOF A;  1S4Z A;  2B3G A;  1XNR Q;  4JBW A;  3M85 A;  2JYO A;  1BOS A;  3FP9 A;  2C9O A;  3W5O A;  3H15 A;  2NVX B;  1FL0 A;  4MTK A;  1H9S A;  3ERO A;  3A5U A;  1SN8 A;  3RR5 A;  1IXR A;  2NVY H;  4DAP A;  2UXB Q;  2PW5 A;  1MJE A;  2RA4 A;  1QG7 A;  5M3M H;  3KLW A;  3CCS A;  1WTW A;  4DXG A;  1DZ1 A;  1PTO D;  1NR4 A;  3HG9 A;  1ILQ A;  2A8V A;  2KED A;  3KJO A;  3UDG A;  1LO5 D;  1CKO A;  2L12 A;  1FJG L;  5C3E G;  2HCI A;  1DJR D;  2ZJQ A;  4M8A A;  3I4L A;  2CW0 D;  3RZO B;  3K0X A;  3P20 A;  1PV4 A;  2F0I A;  2I0Q A;  4IPH A;  1SNQ A;  1SLJ A;  4A3J B;  1SND A;  3UI2 A;  2CVR A;  3E0J A;  5M3F B;  1EY0 A;  4RKL A;  3H91 A;  4DU9 A;  4CDC C;  4LNQ A;  1SE4 A;  2DY8 A;  2ASB A;  2MFI A;  4YWM A;  1B4O A;  1N9W A;  5C0X J;  1YNX A;  1SYC A;  1TWG H;  1IYJ B;  5D65 A;  4JI3 L;  1D8L A;  2Z6K A;  4DK0 A;  4A3K H;  2E74 C;  1B7Y B;  2DJG C;  2XWJ B;  3M3Y H;  4JBJ A;  3RNU A;  4CJ2 C;  3T4A C;  4JI4 L;  1IBK Q;  2PQA A;  2K5N A;  1FR3 A;  3GV3 A;  1EZ6 A;  4C2M H;  1IBM L;  5JEA H;  4LW1 A;  2ID0 A;  3PO3 G;  1E2V A;  1K0S A;  2RDH A;  1MSG A;  1UE1 A;  4X66 L;  1TU2 B;  1RTN A;  4LF5 L;  1CSQ A;  1GXD C;  1V1P A;  2Q8I B;  4K0K L;  1MHW C;  1Y8P B;  3M4Y A;  2IHF A;  3ZJY C;  2EY5 A;  4A3M G;  2CKZ B;  2BE5 D;  4EGV A;  4BA1 I;  1L1O B;  2HUG A;  2EY2 A;  4A3B B;  1PZK D;  1IZ6 A;  2ICI A;  1JOK A;  4C3J B;  1BBX C;  2OXP A;  4X3S A;  4BY7 G;  5IGB A;  4IAL A;  2GN5 A;  2Y0S E;  5KYL A;  2B8G A;  2B2Y A;  4XQN A;  3PO2 B;  3OIQ A;  3ONA B;  3JC6 6;  4JYA Q;  4OO1 G;  5LMN W;  1QVC A;  3MXN A;  4IFD J;  1Y1W B;  2NZO A;  1X55 A;  5TSS A;  5C4X H;  3MWY W;  3JAM i;  1N34 Q;  1STB A;  2Z0S A;  4QCL A;  3HGB A;  4B9W A;  5GAD C;  4P74 A;  1GHJ A;  5EGT A;  5I6Y A;  2R92 B;  4FF1 A;  2E2H H;  5IY0 A;  3AB9 A;  4JI0 L;  2YV5 A;  2EY1 A;  1X3P A;  3GV6 A;  4UP7 A;  1UUP A;  3CPF A;  4DV7 Q;  2VZA A;  4N9P A;  4LFB L;  3PQI A;  1TWA H;  1SMY C;  4DUZ Q;  4A3I G;  3GTG B;  1X32 A;  5COR A;  1G51 A;  3J7A V;  2A74 C;  4G57 A;  2I07 B;  2JEA I;  3S14 B;  3U50 C;  1JC7 A;  3I90 A;  2SNS A;  1ZEQ X;  4YCU A;  4KHV A;  3QO2 A;  4QIW B;  1HNX L;  4LFC Q;  1EY9 A;  5LL6 S;  3S15 B;  1DD2 A;  2PNR C;  4HED A;  2ZT9 C;  1PFS A;  2NZH A;  4AYB G;  1GVP A;  1YNN C;  2M00 A;  4M1U B;  2BDN A;  5FK9 C;  2JA7 G;  4B3M L;  2HIV A;  1JB7 A;  4J15 A;  4OX9 Q;  1NCV A;  5HUR A;  1VCI A;  4IQZ A;  4XTC S;  4RFB A;  1PYW D;  4A3E B;  3BVZ A;  3H0G G;  4P72 A;  4HIM A;  2K50 A;  2E2J H;  1JWU D;  2LMC B;  1JE5 A;  5C44 G;  1I50 H;  2EYH A;  4OWX B;  4FXD A;  4BBR G;  2EJG C;  2XVS A;  2Z8L A;  1TS3 A;  2WFW A;  1EY7 A;  5EKK A;  1Q8K A;  1CKN B;  2JQO A;  3I70 A;  4DV2 Q;  4O0A A;  3S2D B;  3CU7 A;  4A3K B;  2F0U A;  3M3Y B;  1BUV T;  5BN3 A;  1GUG A;  1BO0 A;  2JXM B;  1B8A A;  3I4O A;  4LF8 Q;  3D8G A;  5K36 H;  1LTB D;  3GTQ H;  1GUS A;  4XQJ A;  3KF6 B;  4DNI A;  4C2M B;  5IYD G;  1ZXT A;  1EYA A;  4ULL A;  1LAB A;  5IYC H;  5EJW A;  4HID A;  4LF7 Q;  4RGM A;  5ELB A;  3NWS A;  4OL7 A;  5T1G A;  2KCT A;  1KAW A;  2HD3 A;  5IT9 E;  5DNF A;  4O42 A;  4JI7 L;  1EEI D;  5E4W C;  2OT2 A;  2PCF B;  4DAY B;  2I5M X;  2J4X A;  4A3F G;  3BDC A;  1OXX K;  3KDF A;  2F4I A;  2NVQ B;  2R7Z H;  2UUB L;  5KEE A;  2OTJ A;  3O13 A;  4Y52 H;  2ICE C;  2D9U A;  4DV5 L; 
#chains in the Genus database with same CATH homology
 3EQL C;  3NBI A;  4B9X A;  3FKI B;  1KNA A;  3PIO 3;  1BDO A;  1S5C D;  2OEO A;  4PQX A;  1S5B D;  1CZW A;  2E2D C;  1Z7T A;  2DY7 A;  4F87 A;  1AN8 A;  4L63 B;  2IX1 A;  3SK4 A;  1LTS D;  2F0Q A;  1HUM A;  2IWH A;  1Q3L A;  5KNB A;  1G2S A;  3BDO A;  3K5N A;  2WAQ B;  1FNU A;  4KMU C;  3MEH A;  2F0V A;  3TBI B;  1BCP F;  2RVL A;  1MGS A;  2A6E C;  1AZP A;  1Y8N B;  2WAC A;  1JWS D;  1ESF A;  1D5Z C;  2WII B;  1O7Z A;  4L6T B;  4Y7N B;  2ZXO A;  1V43 A;  1II3 A;  5J22 A;  4FNF A;  1BNZ A;  3S1R B;  1DYQ A;  1NR2 A;  3J7Y W;  1SYD A;  5KYI A;  4OIK A;  1WCM B;  1CHQ D;  4KHZ A;  4C3I G;  3H0G B;  3GTL B;  1BCP C;  5C6A A;  5IGG A;  1EQT A;  1U4L A;  1SYF A;  1BR9 A;  4OHJ A;  4HMJ A;  4DGZ A;  1TQO A;  1YNN D;  3S1M B;  2RKS A;  1AFP A;  4F88 A;  3HKZ B;  1J8I A;  2QF7 A;  2K05 A;  4DNT B;  2F0K A;  3K6O A;  3FEW X;  3A7A B;  1E2Z A;  1STH A;  4IFD I;  2K6A A;  3WOE A;  2KUM A;  4K5X A;  1CA5 A;  3JAM L;  1CT1 D;  1FGB D;  5JVG 3;  1WTP A;  4ZUI A;  4MIU A;  4ZRZ A;  1F77 A;  2A6H C;  3DWA A;  4K5V A;  1LTT D;  4MHE A;  1EEF D;  4CJ0 B;  3LWE A;  3DWP A;  1RDP D;  2L5T A;  4XYO A;  2F1M A;  5FO7 B;  4ZKB B;  4KK7 A;  2F0P A;  3C3L A;  4MN3 A;  2EE1 A;  5KGU A;  1HTP A;  2AUJ D;  2HQE A;  1HFN A;  2HCC A;  2PZT A;  3I4N B;  2F0M A;  1LTI D;  1F2Y A;  1PTO F;  1V8Q A;  1F9S A;  2D5D A;  4Z9C B;  2EYP A;  1FD7 D;  4K8I A;  1G2T A;  3SDZ A;  2F0D A;  2K5Q A;  2IX0 A;  1KLU D;  1HHV A;  2VNU D;  2B2V C;  4KKU A;  4H0L C;  2Q8T A;  3MXG A;  4K6L A;  3SE0 A;  3A54 A;  4CJ1 B;  3NXW A;  1FYC A;  1PTO C;  4G7O C;  4TRD A;  4F8M A;  2N88 A;  1CTM A;  1Q8I A;  4RGT A;  2D62 A;  5JOB A;  2JSO A;  3HOX B;  2R93 B;  3VA5 A;  3NTI A;  1BF4 A;  1HXY D;  1FNW A;  3MFY A;  5KRU A;  5ELD A;  2MP1 A;  5A35 A;  2TSS A;  4S3S A;  1QWY A;  2MPM A;  2PYK A;  4CKB A;  2X6G A;  3N52 A;  1AZQ A;  2FFK B;  1PRT D;  1R9T B;  1VF7 A;  1BQQ T;  5EBD A;  2PZU A;  1SNO A;  3RMH A;  2BCO A;  5CR3 A;  4IUR A;  3J7A F;  1EY5 A;  1F2L A;  4KJN A;  1I4G A;  1D1I A;  5JJZ A;  2NZ1 D;  2O4X A;  2NN6 G;  3W3A A;  3S9W A;  2PW7 A;  2NTT A;  2YU9 B;  1L0Y B;  1SXT A;  1SJH D;  2E75 C;  3IFD A;  2RQX A;  1EQV A;  3K59 A;  3VA7 A;  3CRL C;  1QCB D;  3AMU A;  5I9P A;  4UAI A;  2BE5 C;  3BVM A;  4HMI A;  5ISR A;  3U9S A;  1HCZ A;  1A2T A;  1JR0 D;  3S1N B;  1EWC A;  1J9O A;  2PZW A;  3C2P A;  3BYY B;  1DM0 B;  2G9D A;  4A93 B;  2NWG A;  2IL8 A;  2V4D A;  4FYD A;  1RF2 D;  5D14 A;  2L4N A;  5BN4 A;  2JA5 B;  4L8J A;  4E6I A;  4J1M A;  3GD7 A;  4C3J G;  4BY1 B;  3A8K E;  5I6W A;  3AU7 A;  2B2T C;  5EPL A;  1F9Q A;  3DEO A;  5CV7 A;  3DM1 A;  3RD4 A;  1RKN A;  4R8I A;  3Q23 A;  3KF8 A;  5FKA C;  1EFI D;  1Y1V B;  4C56 C;  3D3R A;  4CBV A;  1O7L A;  5C5L A;  4IN3 A;  1JCK B;  3Q24 A;  4FVM A;  2DNC A;  4RCN A;  3EFX D;  1OO9 B;  1CZG A;  1WD0 A;  1NUC A;  2QCP X;  2ZXP A;  1G8Z D;  1OXT A;  1MSH A;  4QB4 A;  4XT3 B;  3RLF A;  1O78 A;  5JAV A;  2K03 A;  4IUT A;  3VR2 A;  3RZD B;  2HDL A;  1QOH A;  2VB3 X;  1STE A;  3ND8 A;  1I4H A;  1M4V A;  4ZUJ A;  4Q5V A;  5EKI A;  4RH6 A;  2JA6 B;  1KAA A;  3P75 A;  4K14 A;  1GUT A;  1BXT A;  5C4J B;  2EDG A;  4XT1 B;  2F0S A;  5ELF A;  1Q1E A;  5G3L D;  3QG1 A;  4KN4 C;  4HR7 B;  3MHB A;  4KI0 A;  2IJ0 A;  4B08 A;  2B8F A;  2K33 A;  2WV6 D;  3OOC A;  3KK7 A;  1TWF B;  3S17 B;  5JEA G;  2MGS A;  1EZ8 A;  4RAU C;  3ND9 A;  4X3K A;  3I73 A;  2B2V A;  1LTA D;  1PZI D;  2ZXR A;  4NKL A;  3KLS X;  1EWH A;  4HN7 A;  5M9O A;  5IGE A;  1TVX A;  3BVG A;  4A3G B;  1JQY D;  3QJY A;  2O2L D;  3PUV A;  4I65 A;  3PUZ A;  2FMC A;  3DUZ A;  3VR6 A;  5CBE E;  3BZD B;  1SJE D;  5JVH 3;  3HS0 C;  1UAP A;  2QIL A;  3KLS A;  1TY2 A;  3D31 A;  4I7Z C;  1OXV A;  2F0O A;  3FMC A;  3Q0A A;  3I72 A;  1STG A;  3J81 E;  1SNC A;  4IUN A;  1EIG A;  4TSS A;  2WB1 B;  2F0L A;  1ML0 D;  1KDC A;  2L11 A;  1G6Z A;  5HGT A;  2NVY B;  4PNY A;  1IL8 A;  1I4X A;  2R61 A;  5M3M B;  3H3V C;  4XQQ A;  3R93 A;  1B9M A;  2H1E A;  3SR1 A;  3IKJ A;  2L1B A;  3D6W A;  2M9V A;  3QOJ A;  2F0N A;  1D5M C;  1H9M A;  3R2T A;  1PMR A;  1WTR A;  1S5E D;  4LMQ D;  4QF4 A;  3GQB A;  2RDG A;  4P2C B;  3EJI A;  3T13 A;  5CYU A;  1TR5 A;  4NDX A;  1LV9 A;  3RUZ A;  4ZKC B;  1TWG B;  3EA6 A;  2KJX A;  1RHP A;  3L3O C;  3T16 A;  4FF4 A;  2HDM A;  5T1I A;  3J80 L;  4TQU S;  4KY6 A;  4R9W A;  2IX3 A;  4HSV A;  3OPO A;  2B2T A;  2C5C A;  2QKI C;  1Q12 A;  1CM9 A;  5EBC A;  2H4O A;  1ONL A;  1LT4 D;  1ROD A;  1A15 A;  3ITP A;  1CQV A;  1Q1B A;  2A73 B;  1DOM A;  1EYC A;  1U4R A;  2AWN A;  1IKL A;  1KNE A;  1F2Z A;  3FPU B;  3NBH A;  1LT5 D;  3WDN A;  3F2U A;  3OSO A;  2PQE A;  5C4X B;  3PUY A;  1PRT F;  1D6E C;  1EU4 A;  2E2H B;  1DOL A;  2XIW A;  3MAQ A;  3PIP 3;  1MI2 A;  2EVB A;  5EPK A;  1TWA B;  3TP7 A;  1C8C A;  1K8M A;  3NTH A;  4HAE A;  3TP8 A;  1LTG D;  1L0X B;  1HUN A;  2Z1C A;  4NW2 A;  5EKL A;  1PRT C;  2KHS A;  2M2L A;  1K8O A;  4RGO S;  3GTJ B;  3PUW A;  3P7J A;  5F2D A;  5IGC A;  3D6C A;  1AEX A;  2SEB D;  2KVM A;  4CGY B;  2SOB A;  1UEA B;  1F9R A;  4H44 C;  1E0B A;  1I4Q A;  1T5E A;  1LT6 D;  3URY A;  4RGN A;  2E2J B;  4J8Q A;  1PTO H;  1I50 B;  1EY8 A;  1GJX A;  1KLG D;  1STY A;  2AQ1 B;  4O1N A;  3VR5 A;  1V1O A;  4N9T A;  4ZYS A;  5D3I B;  1STN A;  1B44 D;  4DNR B;  3U9O A;  1ET6 A;  1LAC A;  1R4P B;  2X69 A;  4ABN A;  3TME A;  1ENA A;  2EY6 A;  3GTQ B;  2QDB A;  2EPB A;  2MJ8 A;  2EYJ A;  2K5D A;  2IPK D;  2KEE A;  3MFG A;  1S5F D;  2DN8 A;  1WVL A;  3IAY A;  2EYF A;  3NUC A;  1HRJ A;  1XYI A;  3GP7 A;  4BA2 I;  4V0B A;  3ZYY X;  5I9O A;  3KBX A;  3K5O A;  3MA2 B;  1H9S B;  2R7Z B;  5C0X G;  3E5S A;  2WIN B;  1CI3 M;  5ELE A;  3S16 B;  1KDA A;  2YYZ A;  2FIN B;  1W6J A;  2XNA C;  3A8I E;  3SHL A;  2RBM A;  4OGQ C;  1GUW A;  1LT3 D;  1D2B A;  3D4D A;  3LWU A;  2NTS A;  3P1H A;  1TY0 A;  1DCZ A;  2JA8 B;  5E3F A;  4YIJ A;  3GTK B;  4ZK9 B;  2A68 D;  5LL6 X;  3J80 E;  2E2I B;  1TWH B;  5BN5 A;  4XDX A;  1A3U A;  4PV1 C;  2NYZ D;  4H7B A;  2A69 D;  3OMG A;  2DNE A;  3OHX C;  1HA6 A;  5G3L F;  3D4R A;  3M4O B;  2JE6 I;  3S1Q B;  2JP1 A;  4IFD G;  4HCS A;  1HA5 A;  5DM7 3;  4RHS A;  3TP6 A;  1SDF A;  3TZU A;  1F9P A;  2F0G A;  1LLR D;  1CK1 A;  1B1Z A;  1JOR A;  4HCE A;  2XRQ D;  5FOB B;  1V1P B;  3D4W A;  1STA A;  3FDT A;  3I3C A;  4XYQ A;  4DAY A;  4C1N K;  1NAP A;  3R2I A;  2PPB C;  3QOL A;  3GTM B;  1EY4 A;  4LAA A;  3HZX A;  1SE3 A;  1I3Q B;  1K83 B;  4RCO A;  1SYG A;  4KTA A;  5DEH A;  2Y0S B;  5NUC A;  2VUM B;  3HOW B;  4ILW A;  1EL0 A;  1PFB A;  3HRZ C;  5E1F A;  2B39 A;  5E4X A;  1VMP A;  2F0W A;  2D2C C;  3HOV B;  5CBA E;  1R4Q B;  1RD9 D;  4QMG A;  1OXS C;  1SFO B;  3PMF A;  1UNS A;  1PFN A;  1A3V A;  1MD2 D;  3SK8 A;  3GO5 A;  3DMU A;  3QWN A;  3HOY B;  1H9J A;  2LFN A;  3FRP B;  4WOR A;  3K7A B;  4C3H B;  3CKI B;  3MZ5 A;  5CMD A;  5LHY 1;  4U67 3;  3QB3 A;  2WP8 J;  4CKE A;  5C5M A;  1PFM A;  1WTQ A;  3NP8 A;  3JAM E;  4OIJ A;  4KJO A;  4FXG C;  2MHV A;  2K04 A;  4IUP A;  2BDO A;  4UDU C;  3MTS A;  4C1N I;  3L7Z C;  3FPP A;  2KCC A;  4EQO A;  4RWS C;  1XTC D;  2KCN A;  3KBG A;  5CGK A;  2K32 A;  5COY A;  1EY6 A;  3SK6 A;  1Z47 A;  1XXG A;  2K1B A;  1SNM A;  5DM6 3;  1EOT A;  1FNV A;  3E6Z X;  2K5W A;  4PMW A;  2FJ2 A;  2F03 A;  2RSN A;  4WFN 3;  4DF7 A;  2G9H D;  1OXU A;  2XSC A;  3A56 A;  1F2M A;  4OO1 I;  5IT9 L;  1WTO A;  3I4M B;  5IOD A;  4PMC A;  2FMM A;  1JIC A;  5CV6 A;  2SNM A;  1GUN A;  1ZKO A;  2GA4 B;  1RTO A;  3Q22 A;  4ZLT F;  2MUY A;  1SBB B;  3I91 A;  4DA2 A;  2PMZ B;  4IUQ A;  4DFA A;  4K8J A;  2NB0 A;  1CQF A;  4KD3 A;  5M5Y B;  1AP0 A;  3OMC A;  5CV5 A;  1GHK A;  3K58 A;  3X3N A;  2NBF A;  3DEP A;  3V96 A;  3NE5 B;  5CV4 A;  5FLX L;  4LK1 C;  2NVT B;  2AQ2 B;  4DXF A;  2ENB A;  1HQR D;  3M7N A;  1HQM C;  3HOU B;  2N55 A;  3BYT B;  4FXK C;  3H09 A;  3R3O A;  4FP5 D;  1ILP A;  4G4K A;  3SK5 A;  2J0T D;  1JOO A;  1GOZ A;  2TMP A;  1TS4 A;  5M5W B;  5AFW A;  2LY7 A;  2BA0 A;  1B9N A;  1KTK A;  1O80 A;  5KNC A;  4K5W A;  4OO1 H;  3IL8 A;  2RSO A;  1DOK A;  3VYR A;  3TN2 A;  3NTK A;  2B63 B;  2Q8R E;  1S5D D;  4H13 C;  3V2T A;  1XWE A;  1TS2 A;  1W6K A;  4RHR A;  3CQZ B;  2LKV A;  5I2Y A;  1JOQ A;  2B2W C;  1QIL A;  5C4Z A;  1B3A A;  5CC4 A;  5J39 A;  3W2D A;  4ODG A;  3OWF A;  3K0Y A;  5KND A;  1VF5 C;  1H9K A;  1YNJ C;  2FHT A;  1LTR D;  1Y8O B;  4EQN A;  1EIH A;  2VB2 X;  5FO9 B;  4ZAI A;  5C3E B;  5A2Q L;  1IW7 C;  5EQ0 A;  1Y69 U;  2KA7 A;  2BOS A;  2EXZ A;  3BS1 A;  4QUC A;  1C48 A;  5K36 G;  3Q6S A;  4X3T A;  1WTV A;  3A55 A;  1EYD A;  1CA6 A;  3K5M A;  4RA8 A;  4GZY C;  3NHH A;  1I4P A;  1IKM A;  1HFG A;  1WTX A;  3GTO B;  4XIG S;  1U4M A;  1QB5 D;  3PO3 B;  2B2U C;  1IYU A;  1ENF A;  3K5L A;  3G6J B;  3SXH A;  2A68 C;  3M7G A;  4TKO B;  3LNN A;  3NK9 A;  1KAB A;  2K28 A;  2KEC A;  3OIP A;  2A69 C;  4A3M B;  2Z4H A;  4X3U A;  1D1K A;  1GUO A;  3ERQ A;  2F0J A;  4KV6 A;  2L0C A;  5JPN C;  1CFM A;  4BY7 B;  2EOT A;  1QE6 A;  4K6D A;  3HEJ A;  1TKW B;  3MC0 B;  1HPC A;  3NPP A;  1RJT A;  2VXW A;  4G7Z C;  4U68 A;  1H9R A;  4PMB A;  3T51 B;  1A6X A;  2AWO A;  2J7Z A;  1IHZ A;  3T53 B;  4BWG B;  4K2L A;  1EU3 A;  5DAU A;  4KY5 A;  2LS0 1;  1QNK A;  2AQ3 B;  1G91 A;  4A3I B;  3G7L A;  3R8B A;  1QJO A;  5FLX E;  3PV0 A;  4V19 0;  4K2K A;  5I4D A;  4F7X A;  1E2W A;  1ET9 A;  4WJW A;  1WD1 A;  3OWE B;  2SDF A;  4J6H A;  1I4R A;  4IZ8 A;  3LX0 A;  3K57 A;  1VMC A;  5C0X I;  2EJM A;  2QEJ C;  1SAP A;  1M8A A;  4AYB B;  1PRT B;  5M5X B;  2JA7 B;  1ZYR C;  4HTH A;  1SMY D;  4FO2 A;  5JPM C;  3EVQ A;  1TII D;  3BG3 A;  3IFT A;  1ENC A;  4G7H C;  2WKD A;  5KIX A;  3NQT A;  1SYE A;  4Q0F A;  2BA1 A;  1Z6H A;  3A7L A;  5C44 B;  5JEA J;  2IW3 A;  3C46 A;  1YNJ D;  3TDQ A;  1DXM A;  4BBR B;  1SNP A;  2F0F A;  3X3M A;  1IYV A;  1VDZ A;  1BCP B;  1G29 1;  3S2H B;  1NSN S;  1KDB A;  5K5P A;  2CHB D;  4DAV A;  5D3D A;  1DON A;  1XX8 A;  2OF1 A;  1B2T A;  1IW7 D;  4QUF A;  3PUX A;  3H94 A;  2EJF C;  5I2X A;  3T56 B;  1JE4 A;  1ESR A;  2XWB B;  1Q90 A;  2RDF A;  4KKT A;  1RCV D;  3NWT A;  4IUV A;  4KN7 C;  3TP5 A;  3OW7 A;  3TZD A;  1MBY A;  4EQP A;  5C3W A;  1PLF A;  1AW7 A;  3I8Z A;  4IUU A;  5CV8 A;  1CHP D;  4A3F B;  1SSO A;  1B53 A;  2PO4 A;  5IOC A;  5A2Q E;  1PXU A;  2B2W A;  5C0X H;  3CHB D;  5ELC A;  3NSW A;  2L9H A;  2I46 A;  3VYU A;  4C3H G;  5J1Z A;  4LJZ C;  1PZJ D;  1A2U A;  3TSS A;  2NN6 I;  4BBS B;  2L55 A;  4KD4 A;  4CKC A;  3VYT A;  1O7Y A;  5EPJ A;  5C3X A;  1I6V C;  3VYS A;  2XRS D;  1SEB D;  1HTL D;  1PDQ A;  3N6R A;  1QNU A;  2EYO A;  2F3V A;  3VR3 A;  5IGF A;  3HP3 A;  5IGD A;  2EZV A;  3KUP A;  2K7V A;  1JWM D;  4IFD H;  2KQ3 A;  1PTO B;  2JEB I;  2B2Y C;  2R6G A;  2CW0 C;  2EYL A;  2EYM A;  4NP5 A;  4DK1 A;  4A3D B;  4C3I B;  1ICW A;  3NQI A;  2A6E D;  3CRK C;  4ME5 A;  2B2U A;  3BDL A;  3QIA A;  4HSP A;  2A5H A;  2K01 A;  5IIF A;  3KLR A;  3C1F A;  3DWQ A;  3DXJ C;  1TT2 A;  1ZYR D;  2F0T A;  2NUC A;  3SEB A;  1SE2 A;  2IT1 A;  3SVM A;  2NN6 H;  2KOL A;  2R3Z A;  3H6M A;  4DN4 M;  2AUK A;  2CQA A;  3A8J E;  1BCP D;  1D5X C;  3L9A X;  2E76 C;  3MXU A;  5C4H A;  4ZQ3 A;  4JK1 C;  1JB3 A;  4EVO A;  3VR4 A;  2F0E A;  3MVV A;  1T5X D;  3J81 L;  4BS9 A;  4WRD A;  4KKS A;  5CV9 A;  1SYB A;  5FO8 B;  3MXP A;  4FF2 A;  3V05 A;  2O5J C;  1C4Q A;  4R8N A;  3FVQ A;  2XN9 C;  1TS5 A;  3C1E A;  3GTP B;  2O5I C;  3DHQ A;  4NMZ A;  1U4P A;  1X3Q A;  2A6H D;  2F0H A;  1U9R A;  4KY7 A;  1TWC B;  2X6L A;  2WKC A;  4ID6 A;  3HOZ B;  1I6H B;  1B50 A;  4FF3 A;  2F3W A;  1A3T A;  2Z4I A;  4XXE A;  4CHT B;  4RKB A;  3WOF A;  1S4Z A;  4JBW A;  3M85 A;  2JYO A;  1BOS A;  2C9O A;  2NVX B;  1H9S A;  3ERO A;  4DAP A;  2PW5 A;  2RA4 A;  1QG7 A;  1WTW A;  4DXG A;  1DZ1 A;  1PTO D;  1NR4 A;  3HG9 A;  1ILQ A;  2KED A;  1LO5 D;  2L12 A;  2HCI A;  1DJR D;  4M8A A;  3I4L A;  2CW0 D;  3RZO B;  3P20 A;  2F0I A;  1SNQ A;  4A3J B;  1SND A;  3UI2 A;  2CVR A;  3E0J A;  5M3F B;  1EY0 A;  4RKL A;  3H91 A;  4DU9 A;  1SE4 A;  2DY8 A;  1B4O A;  5C0X J;  1SYC A;  5D65 A;  4DK0 A;  2E74 C;  2XWJ B;  4CJ2 C;  3T4A C;  1FR3 A;  3GV3 A;  1EZ6 A;  5JEA H;  2ID0 A;  1E2V A;  2RDH A;  1MSG A;  1TU2 B;  1RTN A;  1GXD C;  1V1P A;  2Q8I B;  1Y8P B;  3M4Y A;  2EY5 A;  4EGV A;  2BE5 D;  4BA1 I;  4A3B B;  2HUG A;  2EY2 A;  1PZK D;  2ICI A;  1JOK A;  4C3J B;  1BBX C;  2OXP A;  4X3S A;  5IGB A;  4IAL A;  5KYL A;  2B8G A;  2B2Y A;  4XQN A;  3PO2 B;  3OIQ A;  3ONA B;  4OO1 G;  3MXN A;  4IFD J;  1Y1W B;  5TSS A;  3MWY W;  1STB A;  4QCL A;  3HGB A;  4B9W A;  2R92 B;  1GHJ A;  5EGT A;  5I6Y A;  4FF1 A;  3AB9 A;  2EY1 A;  1X3P A;  3GV6 A;  1UUP A;  4N9P A;  1SMY C;  3GTG B;  1X32 A;  5COR A;  3J7A V;  2A74 C;  4G57 A;  2I07 B;  2JEA I;  3S14 B;  1JC7 A;  3I90 A;  2SNS A;  1ZEQ X;  4KHV A;  3QO2 A;  4QIW B;  1EY9 A;  5LL6 S;  3S15 B;  1DD2 A;  2PNR C;  4HED A;  2ZT9 C;  1YNN C;  2M00 A;  4M1U B;  2BDN A;  5FK9 C;  1NCV A;  5HUR A;  1VCI A;  4IQZ A;  4XTC S;  4RFB A;  1PYW D;  4A3E B;  3BVZ A;  1JWU D;  2LMC B;  2EYH A;  4FXD A;  2EJG C;  2XVS A;  2Z8L A;  1TS3 A;  1EY7 A;  5EKK A;  3I70 A;  3S2D B;  3CU7 A;  4A3K B;  2F0U A;  3M3Y B;  1BUV T;  5BN3 A;  1GUG A;  1BO0 A;  2JXM B;  3D8G A;  5K36 H;  1LTB D;  1GUS A;  4XQJ A;  4C2M B;  1ZXT A;  1EYA A;  4ULL A;  1LAB A;  5EJW A;  4RGM A;  5ELB A;  3NWS A;  4OL7 A;  5T1G A;  5IT9 E;  5DNF A;  4O42 A;  1EEI D;  5E4W C;  2OT2 A;  2PCF B;  2J4X A;  3BDC A;  1OXX K;  2F4I A;  2NVQ B;  5KEE A;  3O13 A;  2ICE C;  2D9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...