1F9SA

Crystal structure of platelet factor 4 mutant 2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
DGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGSKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Comparison of Two Platelet Factor 4 Mutants with the Wild-type Reveals the Epitopes for the Heparin-induced Thrombocytopenia Antibodies
rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords PLATELET FACTOR 4
total genus 10
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9sA00
1HUNA 3QO2A 2JYOA 2NWGA 5CBEE 1NR2A 1CA6A 1HRJA 2N55A 2Q8TA 4XT3B 1S4ZA 4RA8A 1RTOA 2B2TC 1ZXTA 2KECA 1B53A 2K04A 3UI2A 3N52A 5EJWA 4QUFA 4X3UA 1BNZA 1IKLA 1HHVA 5EPLA 1G2TA 1PFMA 2B2VC 4OIJA 4IUUA 2B2UC 4UAIA 1F9PA 2K05A 4IUPA 4X3SA 1PDQA 2MJ8A 2FINB 2K1BA 3MTSA 1U4LA 3FDTA 4IURA 3ONAB 2IL8A 2MGSA 2X6LA 1WTVA 3D6WA 5EQ0A 4HAEA 1RHPA 2M2LA 1JICA 3IFDA 1EQTA 3DEPA 5AFWA 1DOKA 4R8IA 1CM9A 1SSOA 2B2WA 1ICWA 4QUCA 1O80A 4RAUC 5T1IA 3SVMA 1HFNA 2L1BA 1AP0A 1TVXA 3LWEA 1QE6A 2MP1A 2MPMA 4O42A 3DEOA 1M8AA 5T1GA 3TN2A 1ILQA 1PLFA 2B2YA 2BDNA 2J7ZA 2K03A 2EOTA 4HEDA 1F9QA 4XT1B 5E4WC 1BBXC 1WTRA 3GV6A 1ILPA 1DOLA 2KOLA 2KEEA 3IL8A 1MSGA 4NW2A 4MHEA 4IUTA 4X3KA 2HDLA 1WVLA 3I90A 2L11A 2RVLA 2HDMA 4R9WA 1BO0A 1Q3LA 3HP3A 5DNFA 1VMPA 1AZPA 3Q6SA 4IUVA 1RJTA 2CVRA 2B2YC 1WD0A 1B50A 1JE4A 1CA5A 1E0BA 1DOMA 2EPBA 2X6GA 2RSOA 1ESRA 2B2UA 4CJ2C 1DONA 1PFNA 1XX8A 2SDFA 4ZAIA 2RA4A 4DN4M 4CJ0B 2HUGA 5CBAE 4MN3A 1EIHA 1EOTA 2KEDA 4ZKBB 1SDFA 1QNKA 1WTWA 1PFBA 4U68A 1WTOA 1O7ZA 2NZ1D 2X69A 2FMMA 1X3PA 1G2SA 2R3ZA 5EPJA 1C8CA 2H1EA 1RTNA 1WTQA 1HFGA 4CJ1B 2L4NA 1MI2A 2HCIA 3R93A 4ZKCB 1F2LA 3G7LA 1F9SA 1DZ1A 2L12A 5CORA 1G91A 1MGSA 1NCVA 1B2TA 1U4MA 1MSHA 2DY7A 3I3CA 4XDXA 2B2TA 5COYA 5D65A 2RSNA 5E4XA 1WTPA 2KUMA 1U4RA 1GUWA 2L9HA 3GV3A 3MWYW 1NR4A 1X32A 4LMQD 2B2VA 5EKIA 1BF4A 2NYZD 3I91A 2D9UA 1EIGA 2JP1A 1AZQA 2FHTA 2XIWA 3F2UA 1WTXA 4ZLTF 2HCCA 2EE1A 2K01A 3DM1A 4ZK9B 1SAPA 1U4PA 1HUMA 1LV9A 1KNEA 5EPKA 1WD1A 1F9RA 5CMDA 1EL0A 1G6ZA 1B3AA 1HA6A 3KUPA 1RODA 4HCSA 5JJZA 1NAPA 1J8IA 2N88A 1B4OA 1QG7A 2K28A 2VXWA 5D14A 4IUQA 2FFKB 3KBXA 4X3TA 2DY8A 1IKMA 1J9OA 1IL8A 2Q8RE 1A15A 2KVMA 3FPUB 1X3QA 4OIKA 1VMCA 1XYIA 2B2WC 3H91A 1ML0D 4HSVA 3TZDA 3I8ZA 1KNAA 2FJ2A 4RWSC 1O7YA 3P7JA
chains in the Genus database with same CATH superfamily
1GHKA 4U673 1E2WA 2ALYB 4XT3B 1QVCA 2IPKD 2F1MA 3K58A 2WAQB 3OWEB 1D5XC 4P73A 3J80E 1Y1WH 4JCVE 4DV0L 3UDGA 3H3VI 1K28A 3WOFA 5LHY1 1SN8A 1Y1VB 4DR1L 3M4QA 1WTVA 3S1NB 4CDEC 3RLNA 1BCPB 2O4XA 3N6RA 5C5LA 1ZYRD 4DNRB 1HNXL 1ICWA 1TY0A 2Z6BA 3J80L 5IY0A 5FOBB 1KC8C 4A3GH 1TVXA 4QCLA 2E8GA 2BDNA 2PQAB 3S1QH 1DOLA 1GXDC 2KEEA 3ICEA 4YWMA 4QGUA 3CD6A 3I90A 2L11A 5I6WA 1VQLA 1L1OB 3HEJA 4ZRZA 2YU9B 4BBSB 4RKLA 4A3IG 1FL0A 3DHQA 2RDHA 3GTMB 5IP7H 1HCZA 2IX3A 3MXGA 2KHSA 1A8VA 1Z47A 4DV6L 4LF7L 3S15B 1SDFA 5LMUL 4A76A 3M7NA 5IYCH 5CGKA 1A2UA 1JC7A 1J5EQ 1N33Q 3CQZH 1ASZA 5DAUA 1VQOA 1SYGA 4ZKCB 2OT2A 1DZ1A 1SMXA 2AUJD 4EQNA 3PQIA 1GUNA 3F1ZA 2NTTA 3STBC 1SE4A 2JK8A 2CWPA 4WJ3M 1F2ZA 2R61A 1FNWA 1VQ4A 2K5DA 1PXUA 1W2BA 4A4IA 1TWHH 3NQTA 3I2ZA 4DR2Q 2GN5A 4KJNA 2Q8IB 2EJMA 2G9HD 1KNEA 1JWUD 1TWCB 4DUYQ 3SR1A 1NAPA 5IP9G 1TS5A 2ES2A 1CKNA 2CKZB 1Q86C 2JA5H 4DAYB 1A15A 3TQYA 3BS1A 4A3BB 1JJGA 3GP7A 2DJFC 4P71A 1E7ZA 3I8ZA 2N8NA 4IPGA 2K4KA 4MZ9A 2F03A 1JORA 1NJIC 4DAYA 1C9OA 4RA8A 2UXBL 2UUCL 3G71A 1B53A 2OWOA 3EJIA 1HHVA 1KDAA 4YHHQ 4QF4A 2B2UC 4R1JA 1S40A 1PDQA 4TSSA 3W5OA 1EU3A 4CDDC 2B3GA 3MFGA 3NTKA 2QF7A 1N9WA 1V1PA 5HGTA 1PRTD 4JBJA 1EQTA 5AFWA 2E2HB 1VQFA 4QB4A 4LUOA 4KI0A 3T56B 3J81c 2A6HD 4WFN3 4AYBB 4DGZA 3RNUA 1WCMH 3GTJB 1LT4D 3T1HL 2RF4A 2KOLA 3TP5A 1QWYA 1WOCA 5E3FA 1I4GA 1HZCA 2XRQD 2PMZB 4KY6A 2VS1A 1U5KA 3I73A 1B50A 4C3JH 3T1YL 1DOMA 1HJPA 4MNOA 5DM63 4LF4Q 4DV1Q 4B3RL 3A8IE 3PIPA 4HIMA 2UUCQ 3OIQA 3UE1A 4GS3A 4P72A 3HOWH 2EY6A 3PF4A 4DR5Q 3WDNA 2IWHA 1CQFA 1I4XA 2F0KA 5KIXA 3GTKB 2A6EC 1VQHA 4U68A 1KD1C 5JVG3 1TIID 5EPJA 1C8CA 3NELA 5JVH3 1SRUA 5JPNC 4PZ8A 3KF8B 4RFBA 2K5WA 4XDXA 1D8LA 2NVYH 4PMWA 2B2TA 1A63A 1LM0A 5C0XI 4DUYL 1NR4A 4LMQD 2JP1A 2Q2HA 2A5HA 2I5HA 1SXTA 3QWNA 3HOVH 1GOZA 2YYZA 2A6ED 2RCFA 3KDFB 3QR8A 4F88A 4C3HB 2HHHL 3HOZB 1EY5A 1VQ5A 1Q46A 3NBIA 1GJXA 3FVQA 4NP5A 1TWHB 1EYGA 5IT9c 1Q12A 3ITPA 4KJOA 3SEBA 4UHVA 4RGTA 3Q22A 1Q90A 1HA5A 4LFCQ 2Z6KA 2JJQA 4JI2L 1KNAA 1HZBA 4Q5VA 5LMUQ 3HOXB 4C3IB 5FLXE 4X64Q 2E2IH 2A6HC 2A69D 4DNTB 1BNZA 3N52A 5EBDA 5EJWA 1BDOA 3A54A 3MA2B 2OXPA 1L0XB 1F77A 2F0GA 3K80C 3EVQA 1I4RA 1K8MA 3FP9A 3JC66 4DKAC 1Z6HA 2IL8A 2MGSA 3KDFA 3D31A 4A93H 2Q2IA 1DJRD 4NXNQ 1SSOA 4C3IG 1YNNC 2B2YA 1HH2P 4JV5L 1WCMG 3NUCA 4A3BH 1K9MC 4DA2A 2F0JA 5M5YB 1Y69U 1ET9A 1QOHA 3PSIA 5JEAH 2N3SA 3F2CA 3S1RH 1TQOA 4K5VA 2NVTB 3NENA 1V43A 1R4QB 2N49A 3K5LA 2EVBA 2EDGA 3S16H 3OW2A 2QILA 4BY7B 2SDFA 4DN4M 2MHVA 5CBAE 1HPCA 2MQHA 3HKZG 3PCOB 1NMGA 1E1OA 4ZKBB 4DK6C 1QNKA 3TS0A 4O1NA 5ELFA 2AHOB 5L37A 2X69A 1C0AA 4A3CG 3A8KE 3OWFA 1IXRA 3CCJA 2UUAQ 3KJOA 2VQEQ 5M5WB 4H44C 2RDFA 4WORA 4A3LG 1JOKA 3EN2A 1PHJA 3SK6A 1GUGA 4A75A 3HS0C 5EKIA 4FYDA 2PPBC 2RQXA 3QG1A 3U50C 1WTXA 1M4VA 1MHWC 4MTKA 2OQKA 1SAPA 5EPKA 1OO9B 1EU4A 3S2DH 2HT1A 4JBMA 1D2BA 1SR3A 2VXWA 1TWAH 1X3GA 3DMUA 1JE5A 1UEAB 2KCMA 3KBXA 4M8AA 1MD2D 4CDFC 2D62A 4KTAA 4OO1G 1N32Q 4XTCS 1CA6A 3OMGA 4FDBA 4N9PA 3H0GB 5C4XH 3NK9A 4K2LA 4X6AH 1HRJA 2UU9L 1I3QB 1L2FA 4DR6Q 4TKOB 1S4ZA 1CSPA 1RTOA 5JEAJ 4Y52H 5C4XG 4HJAA 4JI1Q 1WFQA 5IGGA 1L1OC 4FP5D 4X3SA 2IX1A 4AIMA 4G7OC 1VQ9A 2K50A 4XYQA 4A3CH 1B9NA 1P8LA 2K5QA 2PMZE 4HAEA 4IPDA 1L0YB 1VQCA 2B2WA 4AYBE 4JI6L 2BOSA 1E3PA 1NSNS 2FMCA 1TR5A 2J0TD 5FLXc 2ZTCA 3TP8A 3UE0A 3G6JB 3RZDH 1LTLA 1PTOF 4X66L 4N8FA 3SXHA 2EJGC 1RJTA 2CVRA 1K73C 4LF5Q 3I70A 1HZ9A 1PH5A 3BJUA 2OCEA 2RA4A 1LTSD 4DAVA 5EKKA 3S2HH 3M9BA 1K8AC 3W1GA 2L5TA 3VR2A 2AQ2B 4RKBA 1VQNA 1BXTA 1EY8A 1A6XA 2PYKA 3I4LA 2EYHA 2RBMA 4MIUA 5IGBA 3QOLA 3TZUA 4A3MH 3U58A 2VUMH 5G3LF 5C44H 1NE3A 1X32A 2LXJA 4Z9CB 1ZEQX 2WP8J 3A74A 4QIWB 1XNQQ 3M4OH 4ZLTF 1U4PA 3CF5A 4APVA 4R8NA 4TQUS 3C1FA 5GQOA 5LMNQ 4I65A 3ULPA 1WTHA 4KHVA 3I55A 5D14A 2UXDQ 4IN3A 4E6IA 1IBLQ 2VNUD 5IWAQ 5ELEA 3KLWA 1EFID 2SNSA 3DWQA 4RCOA 5BR8Q 3NSWA 3S1MH 4CDCC 1ET6A 3VA7A 3C46A 1TWCH 3L2PA 1GUSA 1H9KA 2YTXA 4BY7G 4JK1C 3CCQA 1K0SA 3T1YQ 1STBA 2WAQE 5IYCG 2B8FA 4HJ7A 2KJXA 5KNBA 2FINB 2JA8B 1U4LA 2EJFC 2GVBA 1EWCA 3U9OA 1ICFB 3K5OA 4OEMB 5FJ8G 2M2LA 3T1HQ 1N36Q 2DGYA 2LSSA 3DEPA 3M7GA 1KLUD 2BH8A 3FRPB 2WB1G 1QE6A 3TDQA 2MPMA 3D4RA 4C3JB 1IBKQ 4QJFA 1JB3A 1WTRA 5KRUA 1IBMQ 1WVLA 2C5CA 3OSOA 3PO3G 3CRKC 5FKAC 1QILA 1DCZA 1PTOH 1EIFA 3HP3A 5DNFA 4YWLA 4LWCA 3Q24A 1OXVA 1QCBD 1B70B 3AB9A 1PH3A 2LY7A 1STNA 3P75A 1DONA 5ISRA 2Y0SB 3Q8DA 1YZ6A 1HXYD 2PW7A 4J6HA 3K57A 3MXUA 3CCSA 3PUVA 4ALPA 4BY1B 4R4OA 1AFPA 1IL2A 5K36H 2EYLA 3VR3A 1BCPF 3ND8A 3SHLA 3IAYA 3X3NA 2NUCA 3V2TA 1PMRA 1YBYA 2DY7A 2JE6I 3ERQA 2VB2X 1CI3M 3MWYW 4A3DG 1Q1BA 2D0OA 3K5MA 1HR0W 2E5LQ 2QGQA 3KBGA 4YCWA 4CKBA 2JA6G 4AQYL 2F0MA 3GTKH 3I4MG 2R7ZB 1LV9A 5M3MH 3LWUA 1HA6A 5IYBH 3K59A 3H3VC 3J7YW 1LLRD 4DV0Q 3PUWA 1RIPA 2CH4W 3QJYA 3EROA 1TS4A 1SNCA 3WOEA 1NNXA 5IODA 3BVMA 4YY3L 3LGJA 1O7YA 1I4PA 5IE8A 4UDUC 1SYCA 4HSPA 3BYTB 3T4AC 1IW7C 5GAGC 5E7NA 1IKLA 1EZ8A 1H9SB 3P1HA 1UE7A 1AE3A 1EQVA 4L6TB 4RGOS 1JJCB 3G48A 5KGUA 4K8JA 1EWHA 3TBIB 4XQQA 1KL9A 4ID6A 1RDPD 2K5HA 2NVXH 4G57A 5FO9B 2H5XA 2OTJA 1GUOA 1RHPA 1JICA 2Z4IA 4BBRG 3NTIA 1Y8NB 3GTPH 4HIDA 2PZUA 3S14H 4UP8A 3JAME 4HCEA 2K32A 3TN2A 2F0WA 1V8QA 3S9WA 2MUYA 4BBRB 3D8GA 3NBHA 4A3EB 1HTPA 1K3RA 1Q3LA 3PO2H 2F3VA 3BYYB 1JE4A 1CA5A 5I2XA 2EYPA 1I94Q 4S3SA 5TSSA 2IHEA 4A3LH 3T53B 3E0JA 2I07B 4JC0A 1PFNA 3GO5A 1PZKD 1KXLA 1EIHA 1EOTA 1SYBA 3CC7A 1WTWA 2E75C 3VR4A 1Y8OB 1X9NA 1A0IA 3TRZA 4OWTB 2R3ZA 4H7BA 2PZWA 4CJ1B 1HNZQ 1X56A 3NP8A 3Q23A 1MSHA 3I3CA 1B7YB 1GVPA 2VL6A 4C3JG 3J7AF 4I7ZC 4JI6Q 3GTPB 4LF8Q 4QQBX 2NN6I 2A68C 2HCCA 1VQMA 2JA9A 1MIUA 5IYDH 2VY3A 5M3MG 1Q7YC 1SYFA 4ZYSA 5JJIA 2PQEA 5IYBG 3T16A 1RKNA 1KDCA 1S5BD 3PIO3 3E5SA 2ZXOA 1J9OA 2F4VL 3J7AV 3K0XA 2E74C 4LFAQ 2BCOA 3H91A 5JJKA 3UDFA 3NEMA 5C3WA 4OIJA 1STYA 1QB5D 3G7LA 5JOBA 1K8GA 4GOPC 4IFDI 3EBEA 1A3TA 2Q8TA 4IJHA 3B6YA 4BA1I 4G7HC 4IPHA 2K04A 4B3SL 2RHQB 2B29A 4OL7A 1PFMA 2KA7A 4K5WA 1UEBA 3OTOQ 5K36G 2XGTA 1TY2A 1S5DD 3FDTA 1FR3A 2ENBA 2NZOA 3OTOL 4KV6A 2F4IA 3HKZE 2PQAA 3QIAA 1LTID 4KN7C 5M5XH 4DR3L 2WFWA 2OQ0A 1PYBA 4M1UB 1HFNA 1BOSA 4XQNA 1WJJA 2CHBD 3CC2A 3BZCA 4O42A 3CCRA 3M3YB 4JI4L 2QA4A 2KHJA 2UU9Q 4HEDA 2JA5B 4A3IB 3L7ZC 2PNHA 4A3EG 2K52A 4RGMA 2VQEL 4DU9A 2RVLA 4LFAL 2R7ZG 3VYSA 2KBNA 4BY1H 2WACA 2Z9HA 2R6GA 2RKSA 2Y0SE 2JA7H 2HQEA 1I4QA 5GROA 3CCVA 5M3FG 4DV1L 1H9RA 2BH2A 3PO2B 1SYDA 2B39A 2ID0A 1XPRA 2ZXPA 4NDXA 1OXXK 2EY2A 3MFYA 3I4NB 4A93B 2CW0C 3U4ZA 2EXDA 5M3FH 4JI5Q 3TP7A 1QVGA 3U9SA 1MGSA 3STBD 1X55A 1Q8IA 3KF6A 3A55A 3K6OA 1WI5A 3EA6A 4K6DA 2EXZA 1H9JA 2LFNA 3ULJA 2IJ0A 5ELCA 2JA6B 4DXGA 1Q82C 2CQOA 3BDOA 4NXMQ 1JOQA 5A2QL 4HCSA 4B9WA 2GVAA 2N88A 3MEHA 1I94L 2ZM6Q 1S5FD 4BBSH 3A56A 2F0FA 2TSSA 3BDLA 4FO2A 4P74A 5IYDG 3NTHA 2PO4A 5FLMH 4A3FG 4AQYQ 4LNQA 1IYVA 1HUNA 2F52A 5CBEE 3OYYA 5C4HA 1QVFA 1STGA 3S24A 4F87A 1H9SA 1P16A 3S1NH 3SDZA 3BZKA 3UI2A 3KFUA 1A3UA 2R93G 1LUZA 3H3VH 1PH2A 4KHZA 2RDGA 1HNWQ 3FKIG 3KLSX 3D6CA 3WWVA 4FF3A 1PYWD 2K33A 1Z7TA 1HZAA 2X6LA 5C4JB 1B8AA 1X6OA 5HY6A 2ZJRA 3A5UA 1STHA 4B3SQ 4X64L 2R7DA 1XWEA 1MKHA 1BCPC 4RG1A 3TMEA 1SROA 2F0QA 1SYEA 5IP9H 2JA5G 2K14A 2EYJA 1VQ6A 1CT1D 4HJ8A 2ATWA 1E22A 2LXKA 2BA1A 4JI7L 1UNSA 2ZJPA 1AZPA 2B2YC 1STEA 1TS2A 1ESRA 3CXCA 2M9VA 2WAQG 4WJ4A 5IIFA 3HOXH 3K8AA 1JQYD 4GNXC 4LF4L 1AW7A 5I6YA 5CV5A 1EEFD 2F0TA 2NZ1D 4C1NK 2QEJC 3LX0A 2H1EA 2JA7B 2EYOA 1IBML 1LABA 3DWPA 1S72A 1D5MC 2O5JC 1HNWL 2JA7G 1Y1VH 1SJHD 3D4WA 3ERSX 2HHHQ 3J81i 4OO1I 2F0VA 4DV3Q 5GAHC 1LT5D 2JA8H 2MO1A 3BG3A 1BR9A 5I9PA 3AFPA 1SE2A 2KCTA 5JPMC 2UXDL 2F0HA 4Y7NB 2DUDA 4DUZQ 3FPUB 3L3OC 4FF2A 2B2WC 4JOIA 2FJ2A 5M5YH 3L9AX 2OF1A 3E3XA 3P7JA 1K83B 3T13A 4DR4L 1JB7A 2F0EA 1DYQA 1VQKA 3PIP3 2N55A 3RLOA 2XRSD 3GTQH 2L0CA 2G5DA 3S17B 3JAMi 4B3RQ 4A3DH 3I4NH 5IT9E 5EPLA 3AYHB 1G2TA 2B2VC 4DFAA 3I7FA 2HQLA 1BQQT 3MXNA 2KCCA 4B3ML 1NTGA 2F0LA 1TT2A 3MTSA 4C3HG 4IURA 3GTJH 3ONAB 1PRTC 1JT8A 1K3BC 1OTCA 2ZT9C 1PTOD 3TSSA 3KK7A 4Q0FA 3GDEA 5CV4A 1FVIA 5C44B 3IFDA 4XYOA 1XNQL 2QCPX 2F0IA 2PZTA 5EKLA 4YWKA 1G8ZD 4DNIA 2QW7A 3H6MA 4LFBL 4LUVA 1G6PA 1AE2A 4XT1B 3VYUA 2K03A 2XSCA 1F9QA 2BE5D 4DR4Q 4R4QA 2K75A 4XQJA 4PMCA 3IL8A 4MHEA 3RUZA 4A3JH 3KLSA 1GKHA 5GADC 4IO9A 3RZOH 4POFA 3HOYB 1PV4A 4YHHL 1I5FA 1Y14B 2KQ3A 2JEAI 2B2UA 3S1QB 4X62L 2E2JH 2YTYA 5FO8B 5IGFA 1SBBB 2NVQB 1CK1A 1TS3A 4CBVA 4DR2L 2F0OA 1O7LA 1R4PB 2F0NA 2C35B 3DM3A 2XWJB 1GO3E 4A3FB 4JBKA 3HRZC 4L5SA 1OXSC 4MTNA 1YIJA 3V96A 1HFGA 5C3XA 3MZ5A 3NWSA 1G91A 2D0PA 2L12A 3NE5B 1VDZA 1U4MA 3MXNB 3M3YH 2Z4HA 4IFDG 3RZOB 2PI2E 1I6HH 5E4XA 3J81E 3FKIH 2Q2UA 1GUWA 3PUXA 4G7ZC 1EQQA 5ELDA 4GOPB 3S14B 5GAEC 1AZQA 1Y8PB 1YNJD 2PI2A 3OHXC 3CCLA 4LW1A 3JAML 1I50B 3E9IA 1E2ZA 4NKLA 1JCKB 5I4DA 1SNQA 1QG7A 1D6EC 5I2YA 1ENAA 4H02A 1IW7D 4JPBW 3KLRA 4X66Q 2B63B 3HOYG 4N9TA 1ML0D 4RHRA 4NXML 2R7FA 5CV7A 4GN5A 4OGQC 4IQZA 4LF8L 1ZXTA 3RLFA 4QUFA 4JI0Q 5KNCA 4EGVA 3I4NG 2WB1B 1EY7A 1GUTA 1LYLA 2CFMA 4UAIA 2K05A 1K83H 4IUPA 2K1BA 3J7ZC 5H1SE 3G4SA 5M5WH 1UE6A 3A7LA 2NZHA 1UAPA 4JI1L 3CPWA 3MVVA 2V1CC 1MJEA 1CM9A 1KHIA 1CQVA 4DV5Q 3SVMA 1LTBD 2Y0SG 1NY4A 2L1BA 3K7UC 2NVYB 1JOOA 4KHPL 5E4WC 1VQJA 5BR8L 3ZYYX 3K81C 2EOTA 5KEEA 1N34L 3D0FA 1BBXC 1ESFA 3GV6A 1EIYB 1KRSA 2M00A 2D2CC 3D4DA 2HIXA 2HDMA 3I4MH 3URYA 1XMQL 4IUVA 1IBLL 1DM0B 1SE3A 2B63G 4JVZA 1HR0L 1N34Q 2G9DA 2KCNA 1M1KC 2RCNA 3SK4A 2NN6G 4ZAIA 2OTLA 3X3MA 3NWTA 3SK8A 4LJZC 3VDYA 5FK9C 1YNND 5D3DA 1PH8A 2O5IC 1MJCA 2DNEA 1XTDA 1DXMA 1UE5A 2EIFA 2NN6H 3HOYH 1IYJB 3QB3A 3NXWA 3GTOH 5IGDA 2HCIA 1TWAB 1F2LA 2V4DA 5CORA 3CP0A 3RMHA 3CMAA 4JV5Q 5IP7G 4OONA 5COYA 2ASBA 2UUAL 5C4ZA 2ZTDA 4JI8L 4DV2L 4BBSG 2Q2TA 2FHTA 3F2DA 4GKKL 5F2DA 2PNRC 1KDBA 4WRDA 2VQFQ 2XWBB 1PTOC 5C3EH 1MBYA 3NHHA 1O7IA 1OXUA 3HOZG 4IFDH 1S3OA 3SK5A 3W2DA 4LF9Q 2BDOA 4IUQA 2FFKB 1IHZA 2DY8A 3A5ZB 2UXCL 5CR3A 3FHWA 4RWSC 1PZJD 4OXPA 3BZDB 3HOUB 4HMJA 1QZHA 2EQSA 2DNCA 3OW7A 3KYHC 2KECA 3GTLB 1VF7A 4X3UA 1B1ZA 1VQGA 4C3HH 4DR3Q 1KTKA 3RZDB 4LUZA 4EQPA 2R93H 3AQQA 1CFMA 5K5PA 1PVOA 2MJ8A 1PA6A 3R2TA 3A0JA 4DR7L 2LKVA 4PV1C 4CHTB 1PH6A 1CKNB 4HR7B 5M9OA 1SEBD 3PV0A 3BU2A 2WIIB 1RL2A 1C7YA 1O80A 2AQ1B 2IHFA 4AH6A 1V1OA 4DR6L 4H0LC 1E2VA 4L5QA 3BVGA 1JWSD 4GZYC 4F8MA 1PRTF 4IUTA 1FGUA 3E6ZX 2F4VQ 1I3QH 1B3QA 2AWOA 5DEHA 1VQIA 1BKBA 1QNUA 1YJNA 1FJGL 2CCZA 1IYUA 1T5XD 2RSOA 4KKTA 1JJ2A 2SEBD 1XX8A 4C3IH 4G4KA 4JW0A 2AWNA 2HUGA 4FF4A 1E1TA 4B3TL 2DJGC 5BN5A 4A3KG 1PFBA 5EBCA 5C5MA 1ENFA 2FMMA 3TREA 5ELOA 3O13A 5LL6S 2SOBA 2E2HH 4DUZL 2J4XA 3KF6B 1EYDA 2NB0A 3DXJC 3QOJA 4DXFA 1EY0A 3JAMc 4OO1H 1XMOQ 1U4RA 1II3A 4A3FH 2EYFA 4RH6A 2UXBQ 4X65Q 4ZUIA 1XNRQ 2XIWA 3DLLA 1CTMA 3J81j 5C0XH 4ZK9B 3RN5A 3H94A 1A3VA 1I6VC 1DD2A 4A3EH 2VZAA 4BBRH 2WINB 4HTHA 2CWAA 2QDBA 5IWAL 4IZ8A 1DGSA 1PZID 5LMNW 3HOUH 1Y1WB 3KOJA 4A3JB 4KMUC 2O2LD 4I7AA 1EEID 1PRTB 4B08A 2KVMA 1X3QA 4GN4B 2R92H 1TXYA 3AEVA 1ASYA 1QUQB 3TZDA 1TWGB 2D5DA 2NWGA 1A62A 5I9OA 1UUPA 2AQ3B 1OXTA 1V9PA 1EYAA 4GKJL 2WB1E 4KLKA 4IOCA 3VR5A 1STAA 3BVZA 4KK7A 2WKCA 2EY5A 1T5EA 1PH7A 1C48A 1W6KA 1NBWA 4JI7Q 4LK1C 2K7VA 4JYAL 2BE5C 4ODGA 2JQOA 3D3RA 3VYTA 5KYIA 4FF1A 4A3DB 1U9RA 3PGZA 1EQRA 4UP9A 5NUCA 4DAPA 5HGQA 5FLMG 3GTQB 1EY4A 1BUVT 3FEWX 2NBFA 4ZCKA 1AP0A 3LWEA 2MP1A 2F0UA 1FGBD 1NMFA 3BDCA 5JAVA 2AUKA 3S15H 1JMCA 2L55A 2CW0D 4DV4Q 5C3EB 5CV9A 4LF5L 2EZVA 1ILPA 1ONLA 1PH4A 4K2KA 1CUKA 4ME5A 4Y7NH 2NVXB 4TRDA 3CW2C 1EY6A 3PO3H 1WD0A 4GN3B 1BVSA 4KY7A 1C4QA 1X65A 3CU7A 5C3EG 2F3WA 2CH4A 4KY5A 2HD3A 1IBKL 2X6GA 1RCVD 4CJ2C 4DV6Q 1H9MA 4GKJQ 1G291 1SMYC 4KKUA 1KABA 1SNMA 4A3KH 2KEDA 2Z8LA 5DM73 2A68D 4DV7L 1N36L 2I46A 3HG9A 4UPAA 5C6AA 5BN3A 3H0GG 4JG2A 1TWFB 3S16B 1CKMA 2UXCQ 1NUCA 3VYRA 2ICEC 2IT1A 4GLVB 1B2TA 1YJ9A 5D65A 3VR6A 3NQIA 1WTPA 2Z1CA 1IZ6A 2E2JB 1ZKOA 2B2VA 4FXKC 4DV5L 4EVOA 1UE1A 4NMZA 3F2UA 2EE1A 3M85A 3CAMA 2XVSA 4PZ6A 1QJOA 1X54A 3HFZB 4X65L 3A7AB 1N32L 1F9RA 5CMDA 1B3AA 3CHBD 5D3IB 4POGA 1B4OA 1LTRD 2K28A 1B9MA 3IKJA 3HOWB 1YI2A 3A8JE 5E1FA 4C2MB 1KQSA 1XYIA 4P2CB 1VMCA 5KNDA 4HSVA 2ZTEA 1I50H 2XTIA 2MFIA 1LT6D 4KD3A 1V1PB 4L63B 3QO2A 2JYOA 1NR2A 4IJLA 4F7XA 2UUBQ 4HJ5A 2PW5A 3CKIB 1CHPD 4FXDA 4OX9Q 3FKIB 3CRLC 1FJGQ 4DF7A 3MC0B 1XPOA 1XMQQ 4JI5L 3C2PA 4HN7A 4LF6Q 4BXXH 4HIKA 1I6HB 3KF8A 1VCIA 4GOPA 3L0OA 1VQAA 4GNXA 5HURA 4L5TA 4EQ5A 3IRBA 1GM5A 3OPOA 2R93B 4KHPQ 2WKDA 4ABNA 2MO0A 2I5LX 4A3JG 3GTLH 3DEOA 3HOVB 3HKSA 4KN4C 4J15A 5M3MB 1QZGA 2OEOA 4DPGA 2HDLA 1VF5C 4A3KB 1LTTD 5M5XB 1BO0A 4FNFA 1AN8A 4HJ9A 5FJ8H 3C3LA 2LS01 1N8RC 1E0BA 5CYUA 4DK0A 1FNUA 4O2DA 2EPBA 2JSOA 3HGBA 4AYBG 1X3EA 5LMNL 3CCMA 1LTGD 1SMYD 4EX5A 4V0BA 4CJ0B 3T51B 1PFSA 1VQDA 3C1EA 4V190 3S1MB 3I4OA 2P5ZX 3H0GH 5C4XB 1Z9FA 4JOIC 3CMEA 1MI2A 1D7QA 1D1IA 2NTSA 1TU2B 1S5ED 1BBWA 2YV5A 4ZUJA 4CGYB 1Q8KA 3DUZA 1Y1WG 4ZQ3A 2L9HA 3GV3A 4EQOA 3GTGH 1BF4A 2D9UA 1EIGA 1AEXA 4O0AA 5ELNA 1EOVA 2F0SA 1PYSB 1E24A 2Z0SA 4NB3A 4DK1A 1ENCA 4LF7Q 4UY8C 1WD1A 4OHJA 4LFCL 4LF6L 1RODA 3EIVA 1KAAA 3AU7A 4A3GG 4N8X1 1CHQD 1O78A 1HNZL 2E2IB 2XNAC 1IL8A 4OX9L 4QL5A 3I56A 4OIKA 1BBUA 3OMCA 1SLJA 3GQBA 4K14A 1VS0A 2YTVA 3RN2A 2F0PA 5LL6X 4PNYA 1EY9A 1VQ7A 4C1NI 2B2TC 4LAAA 4X62Q 1HQMC 3ULLA 4ME3A 4BY7H 1GHJA 1F9PA 4B9XA 4DAMA 5BN4A 4L5RC 4A3GB 1BCPD 4PZ7A 1KIXA 3S1RB 4JI3Q 3VA5A 2HIVA 1B44D 3HOXG 4HIOA 4R8IA 3LNNA 2R92G 4DR5L 2Z6KC 4RAUC 4LFBQ 5T1IA 3W1BA 1GD7A 5AJ3Q 3TS2A 1FD7D 1YHAA 1M8AA 1PLFA 2J7ZA 1S5CD 4RMFA 3EQLC 3HOUG 2ZXRA 2K5VA 4GNXB 4X3KA 3PF5A 4ULLA 5JEAG 1XJVA 1K0RA 1W6JA 1SJED 1W3SA 4L8JA 2F0DA 1EYCA 4K0KQ 2A69C 4A3MB 4DV7Q 3AMUA 4IUNA 1V1QA 2JA8G 5FO7B 3J7A5 3U4VA 1JWMD 4BA2I 4QMGA 2KENA 4MN3A 3CCEA 4YCVA 4NXNL 3TP6A 2EYMA 4FXGC 4YY3Q 1KRTA 1X3PA 3V05A 3RD4A 2BA0A 3R2IA 1WTQA 1HTLD 1X3FA 3MAQA 3SE0A 2N78A 1PH1A 1SNDA 1PH9A 4KD4A 1NCVA 1SFOB 3NPPA 4R4TA 3CPFA 2RSNA 2E76C 4R4IA 4PG3A 2B63H 1WYDA 2F3IA 1VQPA 3HOWG 5ELBA 3RR5A 2NYZD 1CZWA 3I91A 4C56C 2A19A 5C0XG 1LACA 4P75A 2B8GA 2A8VA 1CZGA 4JI2Q 2DN8A 2E5LL 3K0YA 2JXMB 2A1AA 2AKWB 3OOCA 4K8IA 4X3TA 4XIGS 2SNMA 5FLXL 2LMCB 3PIOA 4IALA 5C4JH 3PMFA 3P20A 3FPPA 2JA6H 3MHBA 4GLAC 2K5NA 1EZ6A 5EGTA 4KKSA 3G6EA 2E2DC 5C0XJ 4OWWB 4IUUA 4DK3C 1FYCA 4IOAA 2IX0A 4JYAQ 5KYLA 3MEFA 1JR0D 1SFOH 1XPUA 1HQRD 2VB3X 1J5EL 1N33L 1UWVA 1KLGD 1KAWA 4YIJA 2QDLA 4DV4L 3GTMH 1DOKA 4GKKQ 3GTGB 3H09A 1G51A 1YITA 4QUCA 3M4OB 1IKMA 5T1GA 4HMIA 3S2DB 2ZJQA 1L0WA 2K6AA 3H15A 3HOZH 2JEBI 4RGNA 4OELB 3TEHB 4K0KL 1F2YA 1CSQA 3PUYA 1LO5D 5A2QE 1Y1VG 4R9WA 3W3AA 4B3MQ 3E0EA 4A93G 1SNOA 4C2MH 1AH9A 2R92B 4BXXG 1YEZA 3F2BA 5AJ3L 1YNXA 4RHSA 1I4HA 3OIPA 1F2MA 5CV6A 3K7AB 3I4MB 1XTCD 1HNXQ 1XXGA 1D5ZC 5C44G 1K8OA 2YU9H 1Q1EA 2RHSB 1WTOA 1YVCA 1YHQA 2JN4A 4DR1Q 4PMBA 4JI3L 1QUQA 4PQXA 4FVMA 1R9TB 1A2TA 1ZYRC 1VQ8A 2L4NA 3R93A 4J8QA 5IT9L 3NBHB 5IGCA 2H4OA 2ZM6L 2NVTH 3F8TA 3AFQA 2VW9A 4JI4Q 4TVAB 1D1KA 1T9HA 1LT3D 1YHBA 5CV8A 2A74C 1FNVA 4DV3L 4YCUA 5A35A 1XNRL 2I0QA 4A3IH 4R4CA 1EL0A 2EY1A 1G6ZA 2VUMG 5JJZA 5J22A 1J8IA 5EAYA 1U0LA 1XMOL 3R3OA 3J80i 3M4YA 1PTOB 2IW3A 2WV6D 3K7AH 4OWXB 2Q8RE 2VUMB 2MNAA 4CKEA 4J1MA 3EFXD 3DWAA 4H13C 4B3TQ 1RD9D 5JJLA 2QEXA 1Q81C 3ZJYC 5J39A 3IFTA 4GLXA 5DLQE 3K5NA 5M3FB 2ICIA 3CCUA 2TMPA 4LF9L 4DR7Q 2AMCB 4IFDJ 3S17H 3D6WA 5EQ0A 5CC4A 2PCFB 1YNJC 3Q0AA 2CQAA 3HKZB 4BWGB 3J81L 4K6LA 4DV2Q 1EFWA 1VQEA 1ILQA 3KJPA 1H95A 3R8BA 1YJWA 2I5MX 4NW2A 2IY5B 1MSGA 4A3BG 1J6QA 1TWFH 1TWGH 2C9OA 4QY7A 4BY1G 2NVQH 3HOVG 2R7ZH 1VMPA 2L15A 2FXQA 3Q6SA 3PUZA 1LTAD 3FMCA 4IPCA 1R9TH 1VQBA 5IGEA 1CKOA 3CC4A 3I72A 1SE8A 2VQFL 4NPSA 1HR0Q 3PO3B 1O7ZA 4JI8Q 1G2SA 4UP7A 5IOCA 1TKWB 1SNPA 1RTNA 3ND9A 4K5XA 1F9SA 3M4PA 1RF2D 2A73B 2KUMA 4CKCA 4QIWE 3E9HA 5J1ZA 3HZXA 3S2HB 3ER0A 5J3BA 3GTOB 2K01A 3DM1A 2QKIC 1HUMA 4XXEA 3MXPA 1EUJA 1WCMB 3KUPA 4BS9A 3UDXA 3CQZB 4WJWA 3PO2G 5G3LD 3J80c 4ILWA 4JBWA 1EWIA 3GD7A 4RCNA 1M90C 2GA4B 2XN9C 3SGIA 3UDIA 4JI0L 4A3MG 2KHIA 2UUBL 1L1OA
chains in the Genus database with same CATH topology
1GHKA 4U673 1E2WA 4XT3B 2IPKD 2F1MA 3K58A 2WAQB 3OWEB 1D5XC 3J80E 3WOFA 5LHY1 1WTVA 1Y1VB 3S1NB 1BCPB 2O4XA 3N6RA 5C5LA 1ZYRD 4DNRB 1ICWA 1TY0A 3J80L 5FOBB 1TVXA 4QCLA 2BDNA 1DOLA 1GXDC 2KEEA 3I90A 2L11A 5I6WA 3HEJA 4ZRZA 2YU9B 4BBSB 4RKLA 3DHQA 2RDHA 3GTMB 1HCZA 2IX3A 3MXGA 2KHSA 1Z47A 3S15B 1SDFA 3M7NA 5CGKA 1A2UA 1JC7A 5DAUA 1SYGA 4ZKCB 2OT2A 1DZ1A 2AUJD 4EQNA 1GUNA 2NTTA 1SE4A 1F2ZA 2R61A 1FNWA 2K5DA 1PXUA 3NQTA 4KJNA 2Q8IB 2EJMA 2G9HD 1KNEA 1JWUD 1TWCB 3SR1A 1NAPA 1TS5A 1A15A 3BS1A 4A3BB 3GP7A 3I8ZA 2F03A 1JORA 4DAYA 4RA8A 1B53A 3EJIA 1HHVA 1KDAA 4QF4A 2B2UC 1PDQA 4TSSA 1EU3A 3MFGA 3NTKA 2QF7A 1V1PA 5HGTA 1PRTD 1EQTA 5AFWA 2E2HB 4QB4A 4KI0A 3T56B 2A6HD 4WFN3 4DGZA 4AYBB 3GTJB 1LT4D 2KOLA 3TP5A 1QWYA 5E3FA 1I4GA 2XRQD 2PMZB 4KY6A 3I73A 1B50A 1DOMA 5DM63 3A8IE 3OIQA 2EY6A 3WDNA 2IWHA 1CQFA 1I4XA 2F0KA 5KIXA 3GTKB 2A6EC 4U68A 5JVG3 1TIID 1C8CA 5EPJA 5JVH3 5JPNC 4RFBA 2K5WA 4XDXA 4PMWA 2B2TA 5C0XI 1NR4A 4LMQD 2JP1A 2A5HA 1SXTA 3QWNA 1GOZA 2YYZA 2A6ED 4F88A 3HOZB 4C3HB 1EY5A 3NBIA 1GJXA 3FVQA 4NP5A 1TWHB 1Q12A 3ITPA 4KJOA 3SEBA 4RGTA 3Q22A 1Q90A 1HA5A 1KNAA 3HOXB 4Q5VA 4C3IB 5FLXE 2A6HC 2A69D 1BNZA 4DNTB 3N52A 5EBDA 5EJWA 1BDOA 3A54A 3MA2B 2OXPA 1L0XB 1F77A 2F0GA 3EVQA 1I4RA 1K8MA 1Z6HA 2IL8A 2MGSA 3D31A 1DJRD 1SSOA 4C3IG 1YNNC 2B2YA 3NUCA 4DA2A 2F0JA 5M5YB 1Y69U 1ET9A 1QOHA 5JEAH 1TQOA 4K5VA 2NVTB 1V43A 1R4QB 3K5LA 2EVBA 2EDGA 2QILA 4BY7B 2SDFA 4DN4M 2MHVA 5CBAE 1HPCA 4ZKBB 1QNKA 4O1NA 5ELFA 2X69A 3A8KE 3OWFA 5M5WB 4H44C 2RDFA 4WORA 1JOKA 3SK6A 1GUGA 3HS0C 5EKIA 4FYDA 2PPBC 2RQXA 3QG1A 1WTXA 1M4VA 1SAPA 5EPKA 1OO9B 1EU4A 1D2BA 2VXWA 3DMUA 1UEAB 3KBXA 4M8AA 1MD2D 2D62A 4KTAA 4OO1G 4XTCS 1CA6A 3OMGA 4N9PA 3H0GB 3NK9A 4K2LA 1HRJA 1I3QB 4TKOB 1S4ZA 1RTOA 5JEAJ 5IGGA 4FP5D 4X3SA 2IX1A 4G7OC 4XYQA 1B9NA 2K5QA 4HAEA 1L0YB 2B2WA 2BOSA 1NSNS 2FMCA 1TR5A 2J0TD 3TP8A 3G6JB 1PTOF 3SXHA 2EJGC 1RJTA 2CVRA 3I70A 2RA4A 1LTSD 4DAVA 5EKKA 2L5TA 3VR2A 2AQ2B 4RKBA 1BXTA 1EY8A 1A6XA 2PYKA 3I4LA 2EYHA 2RBMA 4MIUA 5IGBA 3QOLA 3TZUA 5G3LF 1X32A 4Z9CB 1ZEQX 2WP8J 4QIWB 4ZLTF 1U4PA 4R8NA 4TQUS 3C1FA 4I65A 4KHVA 5D14A 4IN3A 4E6IA 2VNUD 5ELEA 1EFID 2SNSA 3DWQA 4RCOA 3NSWA 1ET6A 3VA7A 3C46A 1GUSA 1H9KA 4JK1C 1STBA 2B8FA 2KJXA 5KNBA 2FINB 2JA8B 1U4LA 2EJFC 1EWCA 3U9OA 3K5OA 2M2LA 3DEPA 3M7GA 1KLUD 3FRPB 1QE6A 3TDQA 2MPMA 3D4RA 4C3JB 1JB3A 1WTRA 5KRUA 1WVLA 2C5CA 3OSOA 3CRKC 5FKAC 1QILA 1DCZA 1PTOH 3HP3A 5DNFA 3Q24A 1OXVA 1QCBD 3AB9A 2LY7A 1STNA 3P75A 1DONA 5ISRA 2Y0SB 1HXYD 2PW7A 4J6HA 3K57A 3MXUA 3PUVA 4BY1B 1AFPA 5K36H 2EYLA 3VR3A 1BCPF 3ND8A 3SHLA 3IAYA 3X3NA 2NUCA 3V2TA 1PMRA 2DY7A 2JE6I 3ERQA 2VB2X 1CI3M 3MWYW 1Q1BA 3K5MA 3KBGA 4CKBA 2F0MA 2R7ZB 1LV9A 3LWUA 1HA6A 3K59A 3H3VC 3J7YW 1LLRD 3PUWA 3QJYA 3EROA 1TS4A 1SNCA 3WOEA 5IODA 3BVMA 1O7YA 1I4PA 4UDUC 1SYCA 4HSPA 3BYTB 3T4AC 1IW7C 1IKLA 1EZ8A 1H9SB 3P1HA 1EQVA 4L6TB 4RGOS 5KGUA 4K8JA 1EWHA 3TBIB 4XQQA 4ID6A 1RDPD 4G57A 5FO9B 1GUOA 1RHPA 1JICA 2Z4IA 3NTIA 1Y8NB 2PZUA 3JAME 4HCEA 2K32A 3TN2A 2F0WA 1V8QA 3S9WA 2MUYA 4BBRB 3D8GA 3NBHA 4A3EB 1HTPA 1Q3LA 2F3VA 3BYYB 1JE4A 1CA5A 5I2XA 2EYPA 4S3SA 5TSSA 3T53B 3E0JA 2I07B 1PFNA 3GO5A 1PZKD 1EIHA 1EOTA 1SYBA 1WTWA 2E75C 3VR4A 1Y8OB 2R3ZA 4H7BA 2PZWA 4CJ1B 3NP8A 3Q23A 1MSHA 3I3CA 4C3JG 3J7AF 4I7ZC 3GTPB 2NN6I 2A68C 2HCCA 1SYFA 4ZYSA 2PQEA 3T16A 1RKNA 1KDCA 1S5BD 3PIO3 3E5SA 2ZXOA 1J9OA 3J7AV 2E74C 2BCOA 3H91A 5C3WA 4OIJA 1STYA 1QB5D 3G7LA 5JOBA 4IFDI 1A3TA 2Q8TA 4BA1I 4G7HC 2K04A 4OL7A 1PFMA 2KA7A 4K5WA 5K36G 1TY2A 1S5DD 3FDTA 1FR3A 2ENBA 4KV6A 2F4IA 3QIAA 1LTID 4KN7C 4M1UB 1HFNA 1BOSA 4XQNA 2CHBD 3M3YB 4O42A 2JA5B 4HEDA 4A3IB 3L7ZC 4RGMA 4DU9A 2RVLA 3VYSA 2WACA 2R6GA 2RKSA 2HQEA 1I4QA 1H9RA 3PO2B 1SYDA 2B39A 2ID0A 2ZXPA 4NDXA 1OXXK 2EY2A 3MFYA 3I4NB 4A93B 2CW0C 3TP7A 3U9SA 1MGSA 1Q8IA 3A55A 3K6OA 3EA6A 4K6DA 2EXZA 1H9JA 2LFNA 2IJ0A 5ELCA 2JA6B 4DXGA 3BDOA 1JOQA 5A2QL 4HCSA 4B9WA 2N88A 3MEHA 1S5FD 3A56A 2F0FA 2TSSA 3BDLA 4FO2A 3NTHA 2PO4A 1IYVA 1HUNA 5CBEE 5C4HA 1STGA 4F87A 1H9SA 3SDZA 3UI2A 1A3UA 4KHZA 2RDGA 3KLSX 3D6CA 4FF3A 1PYWD 2K33A 1Z7TA 2X6LA 5C4JB 1STHA 1XWEA 1BCPC 3TMEA 2F0QA 1SYEA 2EYJA 1CT1D 2BA1A 1UNSA 1AZPA 2B2YC 1STEA 1TS2A 1ESRA 2M9VA 5IIFA 1JQYD 1AW7A 5I6YA 5CV5A 1EEFD 2F0TA 2NZ1D 4C1NK 2QEJC 3LX0A 2H1EA 2JA7B 2EYOA 1LABA 3DWPA 1D5MC 2O5JC 1SJHD 3D4WA 4OO1I 2F0VA 1LT5D 3BG3A 1BR9A 5I9PA 1SE2A 5JPMC 2F0HA 4Y7NB 3FPUB 3L3OC 4FF2A 2B2WC 2FJ2A 3L9AX 2OF1A 3P7JA 1K83B 3T13A 2F0EA 1DYQA 3PIP3 2N55A 2XRSD 2L0CA 3S17B 5IT9E 5EPLA 1G2TA 2B2VC 4DFAA 1BQQT 3MXNA 2KCCA 2F0LA 1TT2A 3MTSA 4C3HG 4IURA 3ONAB 1PRTC 2ZT9C 1PTOD 3TSSA 3KK7A 4Q0FA 5CV4A 5C44B 3IFDA 4XYOA 2QCPX 2F0IA 2PZTA 5EKLA 1G8ZD 3H6MA 3VYUA 4XT1B 2K03A 2XSCA 1F9QA 2BE5D 4XQJA 4PMCA 3IL8A 4MHEA 3RUZA 3KLSA 3HOYB 2KQ3A 2JEAI 2B2UA 3S1QB 5FO8B 5IGFA 1SBBB 2NVQB 1CK1A 1TS3A 4CBVA 2F0OA 1O7LA 1R4PB 2F0NA 4A3FB 2XWJB 3HRZC 1OXSC 3V96A 1HFGA 5C3XA 3MZ5A 3NWSA 1G91A 2L12A 3NE5B 1VDZA 1U4MA 3RZOB 2Z4HA 4IFDG 5E4XA 3J81E 1GUWA 3PUXA 4G7ZC 5ELDA 3S14B 1AZQA 1Y8PB 1YNJD 3OHXC 3JAML 1I50B 1E2ZA 4NKLA 1JCKB 5I4DA 1SNQA 1QG7A 1D6EC 5I2YA 1ENAA 1IW7D 3KLRA 2B63B 1ML0D 4N9TA 4RHRA 5CV7A 4OGQC 4IQZA 1ZXTA 3RLFA 4QUFA 5KNCA 4EGVA 2WB1B 1EY7A 1GUTA 4UAIA 2K05A 4IUPA 2K1BA 3A7LA 1UAPA 3MVVA 1CM9A 1CQVA 3SVMA 1LTBD 2L1BA 2NVYB 1JOOA 5E4WC 1BBXC 3ZYYX 5KEEA 2EOTA 1ESFA 3GV6A 2M00A 2D2CC 3D4DA 2HDMA 3URYA 4IUVA 1DM0B 1SE3A 2G9DA 2KCNA 3SK4A 2NN6G 4ZAIA 3X3MA 3NWTA 3SK8A 4LJZC 5FK9C 1YNND 5D3DA 2O5IC 2DNEA 1DXMA 2NN6H 3QB3A 3NXWA 5IGDA 2HCIA 1TWAB 1F2LA 2V4DA 5CORA 3RMHA 5COYA 5C4ZA 2FHTA 5F2DA 2PNRC 1KDBA 4WRDA 2XWBB 1PTOC 1MBYA 3NHHA 1OXUA 4IFDH 3SK5A 3W2DA 2BDOA 4IUQA 2FFKB 1IHZA 2DY8A 5CR3A 4RWSC 1PZJD 3BZDB 3HOUB 4HMJA 2DNCA 3OW7A 2KECA 3GTLB 1VF7A 4X3UA 1B1ZA 1KTKA 3RZDB 4EQPA 1CFMA 5K5PA 2MJ8A 3R2TA 2LKVA 4PV1C 4CHTB 4HR7B 5M9OA 1SEBD 3PV0A 2WIIB 1O80A 2AQ1B 1V1OA 4H0LC 1E2VA 3BVGA 1JWSD 4GZYC 4F8MA 1PRTF 4IUTA 3E6ZX 2AWOA 5DEHA 1QNUA 1IYUA 1T5XD 2RSOA 4KKTA 2SEBD 1XX8A 4G4KA 2AWNA 2HUGA 4FF4A 5BN5A 1PFBA 5EBCA 5C5MA 1ENFA 2FMMA 3O13A 5LL6S 2SOBA 2J4XA 1EYDA 2NB0A 3DXJC 3QOJA 4DXFA 1EY0A 4OO1H 1U4RA 1II3A 2EYFA 4RH6A 4ZUIA 2XIWA 1CTMA 5C0XH 4ZK9B 3H94A 1A3VA 1I6VC 1DD2A 2WINB 4HTHA 2QDBA 4IZ8A 1PZID 1Y1WB 4A3JB 4KMUC 2O2LD 1EEID 1PRTB 4B08A 2KVMA 1X3QA 3TZDA 1TWGB 2D5DA 2NWGA 5I9OA 1UUPA 2AQ3B 1OXTA 1EYAA 3VR5A 1STAA 3BVZA 4KK7A 2WKCA 2EY5A 1T5EA 1C48A 1W6KA 4LK1C 2K7VA 2BE5C 4ODGA 3D3RA 3VYTA 5KYIA 4FF1A 4A3DB 1U9RA 5NUCA 4DAPA 3GTQB 1EY4A 1BUVT 3FEWX 2NBFA 1AP0A 3LWEA 2MP1A 2F0UA 1FGBD 3BDCA 5JAVA 2AUKA 2L55A 2CW0D 5C3EB 5CV9A 2EZVA 1ILPA 1ONLA 4K2KA 4ME5A 2NVXB 4TRDA 1EY6A 1WD0A 3CU7A 1C4QA 4KY7A 2F3WA 4KY5A 2X6GA 1RCVD 4CJ2C 1H9MA 1G291 1SMYC 4KKUA 1KABA 1SNMA 2KEDA 2Z8LA 5DM73 2A68D 2I46A 3HG9A 5C6AA 5BN3A 1TWFB 3S16B 1NUCA 3VYRA 2ICEC 2IT1A 1B2TA 5D65A 3VR6A 3NQIA 1WTPA 2Z1CA 2E2JB 1ZKOA 2B2VA 4FXKC 4EVOA 4NMZA 3F2UA 2EE1A 3M85A 2XVSA 1QJOA 3A7AB 1F9RA 5CMDA 1B3AA 3CHBD 5D3IB 1B4OA 1LTRD 2K28A 1B9MA 3IKJA 3HOWB 3A8JE 5E1FA 4C2MB 1XYIA 4P2CB 1VMCA 5KNDA 4HSVA 1LT6D 4KD3A 1V1PB 4L63B 3QO2A 2JYOA 1NR2A 4F7XA 2PW5A 3CKIB 1CHPD 4FXDA 3FKIB 3CRLC 4DF7A 3MC0B 3C2PA 4HN7A 1I6HB 3KF8A 1VCIA 5HURA 3OPOA 2R93B 2WKDA 4ABNA 3DEOA 3HOVB 4KN4C 5M3MB 2OEOA 2HDLA 1VF5C 4A3KB 1LTTD 5M5XB 1BO0A 4FNFA 1AN8A 3C3LA 2LS01 1E0BA 5CYUA 4DK0A 1FNUA 2EPBA 2JSOA 3HGBA 1LTGD 1SMYD 4V0BA 4CJ0B 3T51B 3S1MB 3C1EA 4V190 5C4XB 1MI2A 1D1IA 2NTSA 1TU2B 1S5ED 4ZUJA 4CGYB 3DUZA 4ZQ3A 2L9HA 3GV3A 4EQOA 1BF4A 2D9UA 1EIGA 1AEXA 2F0SA 4DK1A 1ENCA 1WD1A 4OHJA 1RODA 1KAAA 3AU7A 1CHQD 1O78A 2E2IB 2XNAC 1IL8A 4OIKA 3OMCA 3GQBA 4K14A 2F0PA 5LL6X 4PNYA 1EY9A 4C1NI 2B2TC 4LAAA 1HQMC 1GHJA 1F9PA 4B9XA 5BN4A 4A3GB 1BCPD 3S1RB 3VA5A 1B44D 4R8IA 3LNNA 4RAUC 5T1IA 1FD7D 1M8AA 1PLFA 2J7ZA 1S5CD 3EQLC 2ZXRA 4X3KA 4ULLA 5JEAG 1W6JA 1SJED 4L8JA 2F0DA 1EYCA 2A69C 4A3MB 3AMUA 4IUNA 5FO7B 1JWMD 4BA2I 4QMGA 4MN3A 3TP6A 2EYMA 4FXGC 1X3PA 3V05A 3RD4A 2BA0A 3R2IA 1WTQA 1HTLD 3MAQA 3SE0A 1SNDA 4KD4A 1NCVA 1SFOB 3NPPA 2RSNA 2E76C 5ELBA 2NYZD 1CZWA 3I91A 4C56C 5C0XG 1LACA 2B8GA 1CZGA 2DN8A 3K0YA 2JXMB 3OOCA 4K8IA 4X3TA 4XIGS 2SNMA 5FLXL 2LMCB 4IALA 3PMFA 3P20A 3FPPA 3MHBA 1EZ6A 5EGTA 4KKSA 2E2DC 5C0XJ 4IUUA 1FYCA 2IX0A 5KYLA 1JR0D 1HQRD 2VB3X 1KLGD 4YIJA 1DOKA 3GTGB 3H09A 4QUCA 3M4OB 1IKMA 5T1GA 4HMIA 3S2DB 2K6AA 2JEBI 4RGNA 1F2YA 3PUYA 1LO5D 5A2QE 4R9WA 3W3AA 1SNOA 2R92B 4RHSA 1I4HA 3OIPA 1F2MA 5CV6A 3K7AB 3I4MB 1XTCD 1XXGA 1D5ZC 1K8OA 1Q1EA 1WTOA 4PMBA 4PQXA 4FVMA 1R9TB 1A2TA 1ZYRC 2L4NA 3R93A 4J8QA 5IT9L 5IGCA 2H4OA 1D1KA 1LT3D 5CV8A 2A74C 1FNVA 5A35A 1EL0A 2EY1A 1G6ZA 5JJZA 5J22A 1J8IA 3R3OA 3M4YA 1PTOB 2IW3A 2WV6D 2Q8RE 2VUMB 4CKEA 4J1MA 3EFXD 3DWAA 4H13C 1RD9D 5J39A 3IFTA 3K5NA 5M3FB 2ICIA 2TMPA 4IFDJ 3D6WA 5EQ0A 5CC4A 2PCFB 1YNJC 3Q0AA 2CQAA 3HKZB 4BWGB 3J81L 4K6LA 1ILQA 3R8BA 4NW2A 1MSGA 2C9OA 1VMPA 3PUZA 3Q6SA 1LTAD 3FMCA 5IGEA 3I72A 3PO3B 1O7ZA 1G2SA 5IOCA 1TKWB 1SNPA 1RTNA 3ND9A 4K5XA 1F9SA 1RF2D 2A73B 2KUMA 4CKCA 5J1ZA 3HZXA 3S2HB 3GTOB 2K01A 3DM1A 2QKIC 1HUMA 4XXEA 3MXPA 1WCMB 3KUPA 4BS9A 3CQZB 4WJWA 5G3LD 4ILWA 4JBWA 3GD7A 4RCNA 2GA4B 2XN9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUN A;  3QO2 A;  2JYO A;  2NWG A;  5CBE E;  1NR2 A;  1CA6 A;  1HRJ A;  2N55 A;  2Q8T A;  4XT3 B;  1S4Z A;  4RA8 A;  1RTO A;  2B2T C;  1ZXT A;  2KEC A;  1B53 A;  2K04 A;  3UI2 A;  3N52 A;  5EJW A;  4QUF A;  4X3U A;  1BNZ A;  1IKL A;  1HHV A;  5EPL A;  1G2T A;  1PFM A;  2B2V C;  4OIJ A;  4IUU A;  2B2U C;  4UAI A;  1F9P A;  2K05 A;  4IUP A;  4X3S A;  1PDQ A;  2MJ8 A;  2FIN B;  2K1B A;  3MTS A;  1U4L A;  3FDT A;  4IUR A;  3ONA B;  2IL8 A;  2MGS A;  2X6L A;  1WTV A;  3D6W A;  5EQ0 A;  4HAE A;  1RHP A;  2M2L A;  1JIC A;  3IFD A;  1EQT A;  3DEP A;  5AFW A;  1DOK A;  4R8I A;  1CM9 A;  1SSO A;  2B2W A;  1ICW A;  4QUC A;  1O80 A;  4RAU C;  5T1I A;  3SVM A;  1HFN A;  2L1B A;  1AP0 A;  1TVX A;  3LWE A;  1QE6 A;  2MP1 A;  2MPM A;  4O42 A;  3DEO A;  1M8A A;  5T1G A;  3TN2 A;  1ILQ A;  1PLF A;  2B2Y A;  2BDN A;  2J7Z A;  2K03 A;  2EOT A;  4HED A;  1F9Q A;  4XT1 B;  5E4W C;  1BBX C;  1WTR A;  3GV6 A;  1ILP A;  1DOL A;  2KOL A;  2KEE A;  3IL8 A;  1MSG A;  4NW2 A;  4MHE A;  4IUT A;  4X3K A;  2HDL A;  1WVL A;  3I90 A;  2L11 A;  2RVL A;  2HDM A;  4R9W A;  1BO0 A;  1Q3L A;  3HP3 A;  5DNF A;  1VMP A;  1AZP A;  3Q6S A;  4IUV A;  1RJT A;  2CVR A;  2B2Y C;  1WD0 A;  1B50 A;  1JE4 A;  1CA5 A;  1E0B A;  1DOM A;  2EPB A;  2X6G A;  2RSO A;  1ESR A;  2B2U A;  4CJ2 C;  1DON A;  1PFN A;  1XX8 A;  2SDF A;  4ZAI A;  2RA4 A;  4DN4 M;  4CJ0 B;  2HUG A;  5CBA E;  4MN3 A;  1EIH A;  1EOT A;  2KED A;  4ZKB B;  1SDF A;  1QNK A;  1WTW A;  1PFB A;  4U68 A;  1WTO A;  1O7Z A;  2NZ1 D;  2X69 A;  2FMM A;  1X3P A;  1G2S A;  2R3Z A;  5EPJ A;  1C8C A;  2H1E A;  1RTN A;  1WTQ A;  1HFG A;  4CJ1 B;  2L4N A;  1MI2 A;  2HCI A;  3R93 A;  4ZKC B;  1F2L A;  3G7L A;  1F9S A;  1DZ1 A;  2L12 A;  5COR A;  1G91 A;  1MGS A;  1NCV A;  1B2T A;  1U4M A;  1MSH A;  2DY7 A;  3I3C A;  4XDX A;  2B2T A;  5COY A;  5D65 A;  2RSN A;  5E4X A;  1WTP A;  2KUM A;  1U4R A;  1GUW A;  2L9H A;  3GV3 A;  3MWY W;  1NR4 A;  1X32 A;  4LMQ D;  2B2V A;  5EKI A;  1BF4 A;  2NYZ D;  3I91 A;  2D9U A;  1EIG A;  2JP1 A;  1AZQ A;  2FHT A;  2XIW A;  3F2U A;  1WTX A;  4ZLT F;  2HCC A;  2EE1 A;  2K01 A;  3DM1 A;  4ZK9 B;  1SAP A;  1U4P A;  1HUM A;  1LV9 A;  1KNE A;  5EPK A;  1WD1 A;  1F9R A;  5CMD A;  1EL0 A;  1G6Z A;  1B3A A;  1HA6 A;  3KUP A;  1ROD A;  4HCS A;  5JJZ A;  1NAP A;  1J8I A;  2N88 A;  1B4O A;  1QG7 A;  2K28 A;  2VXW A;  5D14 A;  4IUQ A;  2FFK B;  3KBX A;  4X3T A;  2DY8 A;  1IKM A;  1J9O A;  1IL8 A;  2Q8R E;  1A15 A;  2KVM A;  3FPU B;  1X3Q A;  4OIK A;  1VMC A;  1XYI A;  2B2W C;  3H91 A;  1ML0 D;  4HSV A;  3TZD A;  3I8Z A;  1KNA A;  2FJ2 A;  4RWS C;  1O7Y A;  3P7J A; 
#chains in the Genus database with same CATH topology
 1GHK A;  4U67 3;  1E2W A;  2ALY B;  4XT3 B;  1QVC A;  2IPK D;  2F1M A;  3K58 A;  2WAQ B;  3OWE B;  1D5X C;  4P73 A;  3J80 E;  1Y1W H;  4JCV E;  4DV0 L;  3UDG A;  3H3V I;  1K28 A;  3WOF A;  5LHY 1;  1SN8 A;  1Y1V B;  4DR1 L;  3M4Q A;  1WTV A;  3S1N B;  4CDE C;  3RLN A;  1BCP B;  2O4X A;  3N6R A;  5C5L A;  1ZYR D;  4DNR B;  1HNX L;  1ICW A;  1TY0 A;  2Z6B A;  3J80 L;  5IY0 A;  5FOB B;  1KC8 C;  4A3G H;  1TVX A;  4QCL A;  2E8G A;  2BDN A;  2PQA B;  3S1Q H;  1DOL A;  1GXD C;  2KEE A;  3ICE A;  4YWM A;  4QGU A;  3CD6 A;  3I90 A;  2L11 A;  5I6W A;  1VQL A;  1L1O B;  3HEJ A;  4ZRZ A;  2YU9 B;  4BBS B;  4RKL A;  4A3I G;  1FL0 A;  3DHQ A;  2RDH A;  3GTM B;  5IP7 H;  1HCZ A;  2IX3 A;  3MXG A;  2KHS A;  1A8V A;  1Z47 A;  4DV6 L;  4LF7 L;  3S15 B;  1SDF A;  5LMU L;  4A76 A;  3M7N A;  5IYC H;  5CGK A;  1A2U A;  1JC7 A;  1J5E Q;  1N33 Q;  3CQZ H;  1ASZ A;  5DAU A;  1VQO A;  1SYG A;  4ZKC B;  2OT2 A;  1DZ1 A;  1SMX A;  2AUJ D;  4EQN A;  3PQI A;  1GUN A;  3F1Z A;  2NTT A;  3STB C;  1SE4 A;  2JK8 A;  2CWP A;  4WJ3 M;  1F2Z A;  2R61 A;  1FNW A;  1VQ4 A;  2K5D A;  1PXU A;  1W2B A;  4A4I A;  1TWH H;  3NQT A;  3I2Z A;  4DR2 Q;  2GN5 A;  4KJN A;  2Q8I B;  2EJM A;  2G9H D;  1KNE A;  1JWU D;  1TWC B;  4DUY Q;  3SR1 A;  1NAP A;  5IP9 G;  1TS5 A;  2ES2 A;  1CKN A;  2CKZ B;  1Q86 C;  2JA5 H;  4DAY B;  1A15 A;  3TQY A;  3BS1 A;  4A3B B;  1JJG A;  3GP7 A;  2DJF C;  4P71 A;  1E7Z A;  3I8Z A;  2N8N A;  4IPG A;  2K4K A;  4MZ9 A;  2F03 A;  1JOR A;  1NJI C;  4DAY A;  1C9O A;  4RA8 A;  2UXB L;  2UUC L;  3G71 A;  1B53 A;  2OWO A;  3EJI A;  1HHV A;  1KDA A;  4YHH Q;  4QF4 A;  2B2U C;  4R1J A;  1S40 A;  1PDQ A;  4TSS A;  3W5O A;  1EU3 A;  4CDD C;  2B3G A;  3MFG A;  3NTK A;  2QF7 A;  1N9W A;  1V1P A;  5HGT A;  1PRT D;  4JBJ A;  1EQT A;  5AFW A;  2E2H B;  1VQF A;  4QB4 A;  4LUO A;  4KI0 A;  3T56 B;  3J81 c;  2A6H D;  4WFN 3;  4AYB B;  4DGZ A;  3RNU A;  1WCM H;  3GTJ B;  1LT4 D;  3T1H L;  2RF4 A;  2KOL A;  3TP5 A;  1QWY A;  1WOC A;  5E3F A;  1I4G A;  1HZC A;  2XRQ D;  2PMZ B;  4KY6 A;  2VS1 A;  1U5K A;  3I73 A;  1B50 A;  4C3J H;  3T1Y L;  1DOM A;  1HJP A;  4MNO A;  5DM6 3;  4LF4 Q;  4DV1 Q;  4B3R L;  3A8I E;  3PIP A;  4HIM A;  2UUC Q;  3OIQ A;  3UE1 A;  4GS3 A;  4P72 A;  3HOW H;  2EY6 A;  3PF4 A;  4DR5 Q;  3WDN A;  2IWH A;  1CQF A;  1I4X A;  2F0K A;  5KIX A;  3GTK B;  2A6E C;  1VQH A;  4U68 A;  1KD1 C;  5JVG 3;  1TII D;  5EPJ A;  1C8C A;  3NEL A;  5JVH 3;  1SRU A;  5JPN C;  4PZ8 A;  3KF8 B;  4RFB A;  2K5W A;  4XDX A;  1D8L A;  2NVY H;  4PMW A;  2B2T A;  1A63 A;  1LM0 A;  5C0X I;  4DUY L;  1NR4 A;  4LMQ D;  2JP1 A;  2Q2H A;  2A5H A;  2I5H A;  1SXT A;  3QWN A;  3HOV H;  1GOZ A;  2YYZ A;  2A6E D;  2RCF A;  3KDF B;  3QR8 A;  4F88 A;  4C3H B;  2HHH L;  3HOZ B;  1EY5 A;  1VQ5 A;  1Q46 A;  3NBI A;  1GJX A;  3FVQ A;  4NP5 A;  1TWH B;  1EYG A;  5IT9 c;  1Q12 A;  3ITP A;  4KJO A;  3SEB A;  4UHV A;  4RGT A;  3Q22 A;  1Q90 A;  1HA5 A;  4LFC Q;  2Z6K A;  2JJQ A;  4JI2 L;  1KNA A;  1HZB A;  4Q5V A;  5LMU Q;  3HOX B;  4C3I B;  5FLX E;  4X64 Q;  2E2I H;  2A6H C;  2A69 D;  4DNT B;  1BNZ A;  3N52 A;  5EBD A;  5EJW A;  1BDO A;  3A54 A;  3MA2 B;  2OXP A;  1L0X B;  1F77 A;  2F0G A;  3K80 C;  3EVQ A;  1I4R A;  1K8M A;  3FP9 A;  3JC6 6;  4DKA C;  1Z6H A;  2IL8 A;  2MGS A;  3KDF A;  3D31 A;  4A93 H;  2Q2I A;  1DJR D;  4NXN Q;  1SSO A;  4C3I G;  1YNN C;  2B2Y A;  1HH2 P;  4JV5 L;  1WCM G;  3NUC A;  4A3B H;  1K9M C;  4DA2 A;  2F0J A;  5M5Y B;  1Y69 U;  1ET9 A;  1QOH A;  3PSI A;  5JEA H;  2N3S A;  3F2C A;  3S1R H;  1TQO A;  4K5V A;  2NVT B;  3NEN A;  1V43 A;  1R4Q B;  2N49 A;  3K5L A;  2EVB A;  2EDG A;  3S16 H;  3OW2 A;  2QIL A;  4BY7 B;  2SDF A;  4DN4 M;  2MHV A;  5CBA E;  1HPC A;  2MQH A;  3HKZ G;  3PCO B;  1NMG A;  1E1O A;  4ZKB B;  4DK6 C;  1QNK A;  3TS0 A;  4O1N A;  5ELF A;  2AHO B;  5L37 A;  2X69 A;  1C0A A;  4A3C G;  3A8K E;  3OWF A;  1IXR A;  3CCJ A;  2UUA Q;  3KJO A;  2VQE Q;  5M5W B;  4H44 C;  2RDF A;  4WOR A;  4A3L G;  1JOK A;  3EN2 A;  1PHJ A;  3SK6 A;  1GUG A;  4A75 A;  3HS0 C;  5EKI A;  4FYD A;  2PPB C;  2RQX A;  3QG1 A;  3U50 C;  1WTX A;  1M4V A;  1MHW C;  4MTK A;  2OQK A;  1SAP A;  5EPK A;  1OO9 B;  1EU4 A;  3S2D H;  2HT1 A;  4JBM A;  1D2B A;  1SR3 A;  2VXW A;  1TWA H;  1X3G A;  3DMU A;  1JE5 A;  1UEA B;  2KCM A;  3KBX A;  4M8A A;  1MD2 D;  4CDF C;  2D62 A;  4KTA A;  4OO1 G;  1N32 Q;  4XTC S;  1CA6 A;  3OMG A;  4FDB A;  4N9P A;  3H0G B;  5C4X H;  3NK9 A;  4K2L A;  4X6A H;  1HRJ A;  2UU9 L;  1I3Q B;  1L2F A;  4DR6 Q;  4TKO B;  1S4Z A;  1CSP A;  1RTO A;  5JEA J;  4Y52 H;  5C4X G;  4HJA A;  4JI1 Q;  1WFQ A;  5IGG A;  1L1O C;  4FP5 D;  4X3S A;  2IX1 A;  4AIM A;  4G7O C;  1VQ9 A;  2K50 A;  4XYQ A;  4A3C H;  1B9N A;  1P8L A;  2K5Q A;  2PMZ E;  4HAE A;  4IPD A;  1L0Y B;  1VQC A;  2B2W A;  4AYB E;  4JI6 L;  2BOS A;  1E3P A;  1NSN S;  2FMC A;  1TR5 A;  2J0T D;  5FLX c;  2ZTC A;  3TP8 A;  3UE0 A;  3G6J B;  3RZD H;  1LTL A;  1PTO F;  4X66 L;  4N8F A;  3SXH A;  2EJG C;  1RJT A;  2CVR A;  1K73 C;  4LF5 Q;  3I70 A;  1HZ9 A;  1PH5 A;  3BJU A;  2OCE A;  2RA4 A;  1LTS D;  4DAV A;  5EKK A;  3S2H H;  3M9B A;  1K8A C;  3W1G A;  2L5T A;  3VR2 A;  2AQ2 B;  4RKB A;  1VQN A;  1BXT A;  1EY8 A;  1A6X A;  2PYK A;  3I4L A;  2EYH A;  2RBM A;  4MIU A;  5IGB A;  3QOL A;  3TZU A;  4A3M H;  3U58 A;  2VUM H;  5G3L F;  5C44 H;  1NE3 A;  1X32 A;  2LXJ A;  4Z9C B;  1ZEQ X;  2WP8 J;  3A74 A;  4QIW B;  1XNQ Q;  3M4O H;  4ZLT F;  1U4P A;  3CF5 A;  4APV A;  4R8N A;  4TQU S;  3C1F A;  5GQO A;  5LMN Q;  4I65 A;  3ULP A;  1WTH A;  4KHV A;  3I55 A;  5D14 A;  2UXD Q;  4IN3 A;  4E6I A;  1IBL Q;  2VNU D;  5IWA Q;  5ELE A;  3KLW A;  1EFI D;  2SNS A;  3DWQ A;  4RCO A;  5BR8 Q;  3NSW A;  3S1M H;  4CDC C;  1ET6 A;  3VA7 A;  3C46 A;  1TWC H;  3L2P A;  1GUS A;  1H9K A;  2YTX A;  4BY7 G;  4JK1 C;  3CCQ A;  1K0S A;  3T1Y Q;  1STB A;  2WAQ E;  5IYC G;  2B8F A;  4HJ7 A;  2KJX A;  5KNB A;  2FIN B;  2JA8 B;  1U4L A;  2EJF C;  2GVB A;  1EWC A;  3U9O A;  1ICF B;  3K5O A;  4OEM B;  5FJ8 G;  2M2L A;  3T1H Q;  1N36 Q;  2DGY A;  2LSS A;  3DEP A;  3M7G A;  1KLU D;  2BH8 A;  3FRP B;  2WB1 G;  1QE6 A;  3TDQ A;  2MPM A;  3D4R A;  4C3J B;  1IBK Q;  4QJF A;  1JB3 A;  1WTR A;  5KRU A;  1IBM Q;  1WVL A;  2C5C A;  3OSO A;  3PO3 G;  3CRK C;  5FKA C;  1QIL A;  1DCZ A;  1PTO H;  1EIF A;  3HP3 A;  5DNF A;  4YWL A;  4LWC A;  3Q24 A;  1OXV A;  1QCB D;  1B70 B;  3AB9 A;  1PH3 A;  2LY7 A;  1STN A;  3P75 A;  1DON A;  5ISR A;  2Y0S B;  3Q8D A;  1YZ6 A;  1HXY D;  2PW7 A;  4J6H A;  3K57 A;  3MXU A;  3CCS A;  3PUV A;  4ALP A;  4BY1 B;  4R4O A;  1AFP A;  1IL2 A;  5K36 H;  2EYL A;  3VR3 A;  1BCP F;  3ND8 A;  3SHL A;  3IAY A;  3X3N A;  2NUC A;  3V2T A;  1PMR A;  1YBY A;  2DY7 A;  2JE6 I;  3ERQ A;  2VB2 X;  1CI3 M;  3MWY W;  4A3D G;  1Q1B A;  2D0O A;  3K5M A;  1HR0 W;  2E5L Q;  2QGQ A;  3KBG A;  4YCW A;  4CKB A;  2JA6 G;  4AQY L;  2F0M A;  3GTK H;  3I4M G;  2R7Z B;  1LV9 A;  5M3M H;  3LWU A;  1HA6 A;  5IYB H;  3K59 A;  3H3V C;  3J7Y W;  1LLR D;  4DV0 Q;  3PUW A;  1RIP A;  2CH4 W;  3QJY A;  3ERO A;  1TS4 A;  1SNC A;  3WOE A;  1NNX A;  5IOD A;  3BVM A;  4YY3 L;  3LGJ A;  1O7Y A;  1I4P A;  5IE8 A;  4UDU C;  1SYC A;  4HSP A;  3BYT B;  3T4A C;  1IW7 C;  5GAG C;  5E7N A;  1IKL A;  1EZ8 A;  1H9S B;  3P1H A;  1UE7 A;  1AE3 A;  1EQV A;  4L6T B;  4RGO S;  1JJC B;  3G48 A;  5KGU A;  4K8J A;  1EWH A;  3TBI B;  4XQQ A;  1KL9 A;  4ID6 A;  1RDP D;  2K5H A;  2NVX H;  4G57 A;  5FO9 B;  2H5X A;  2OTJ A;  1GUO A;  1RHP A;  1JIC A;  2Z4I A;  4BBR G;  3NTI A;  1Y8N B;  3GTP H;  4HID A;  2PZU A;  3S14 H;  4UP8 A;  3JAM E;  4HCE A;  2K32 A;  3TN2 A;  2F0W A;  1V8Q A;  3S9W A;  2MUY A;  4BBR B;  3D8G A;  3NBH A;  4A3E B;  1HTP A;  1K3R A;  1Q3L A;  3PO2 H;  2F3V A;  3BYY B;  1JE4 A;  1CA5 A;  5I2X A;  2EYP A;  1I94 Q;  4S3S A;  5TSS A;  2IHE A;  4A3L H;  3T53 B;  3E0J A;  2I07 B;  4JC0 A;  1PFN A;  3GO5 A;  1PZK D;  1KXL A;  1EIH A;  1EOT A;  1SYB A;  3CC7 A;  1WTW A;  2E75 C;  3VR4 A;  1Y8O B;  1X9N A;  1A0I A;  3TRZ A;  4OWT B;  2R3Z A;  4H7B A;  2PZW A;  4CJ1 B;  1HNZ Q;  1X56 A;  3NP8 A;  3Q23 A;  1MSH A;  3I3C A;  1B7Y B;  1GVP A;  2VL6 A;  4C3J G;  3J7A F;  4I7Z C;  4JI6 Q;  3GTP B;  4LF8 Q;  4QQB X;  2NN6 I;  2A68 C;  2HCC A;  1VQM A;  2JA9 A;  1MIU A;  5IYD H;  2VY3 A;  5M3M G;  1Q7Y C;  1SYF A;  4ZYS A;  5JJI A;  2PQE A;  5IYB G;  3T16 A;  1RKN A;  1KDC A;  1S5B D;  3PIO 3;  3E5S A;  2ZXO A;  1J9O A;  2F4V L;  3J7A V;  3K0X A;  2E74 C;  4LFA Q;  2BCO A;  3H91 A;  5JJK A;  3UDF A;  3NEM A;  5C3W A;  4OIJ A;  1STY A;  1QB5 D;  3G7L A;  5JOB A;  1K8G A;  4GOP C;  4IFD I;  3EBE A;  1A3T A;  2Q8T A;  4IJH A;  3B6Y A;  4BA1 I;  4G7H C;  4IPH A;  2K04 A;  4B3S L;  2RHQ B;  2B29 A;  4OL7 A;  1PFM A;  2KA7 A;  4K5W A;  1UEB A;  3OTO Q;  5K36 G;  2XGT A;  1TY2 A;  1S5D D;  3FDT A;  1FR3 A;  2ENB A;  2NZO A;  3OTO L;  4KV6 A;  2F4I A;  3HKZ E;  2PQA A;  3QIA A;  1LTI D;  4KN7 C;  5M5X H;  4DR3 L;  2WFW A;  2OQ0 A;  1PYB A;  4M1U B;  1HFN A;  1BOS A;  4XQN A;  1WJJ A;  2CHB D;  3CC2 A;  3BZC A;  4O42 A;  3CCR A;  3M3Y B;  4JI4 L;  2QA4 A;  2KHJ A;  2UU9 Q;  4HED A;  2JA5 B;  4A3I B;  3L7Z C;  2PNH A;  4A3E G;  2K52 A;  4RGM A;  2VQE L;  4DU9 A;  2RVL A;  4LFA L;  2R7Z G;  3VYS A;  2KBN A;  4BY1 H;  2WAC A;  2Z9H A;  2R6G A;  2RKS A;  2Y0S E;  2JA7 H;  2HQE A;  1I4Q A;  5GRO A;  3CCV A;  5M3F G;  4DV1 L;  1H9R A;  2BH2 A;  3PO2 B;  1SYD A;  2B39 A;  2ID0 A;  1XPR A;  2ZXP A;  4NDX A;  1OXX K;  2EY2 A;  3MFY A;  3I4N B;  4A93 B;  2CW0 C;  3U4Z A;  2EXD A;  5M3F H;  4JI5 Q;  3TP7 A;  1QVG A;  3U9S A;  1MGS A;  3STB D;  1X55 A;  1Q8I A;  3KF6 A;  3A55 A;  3K6O A;  1WI5 A;  3EA6 A;  4K6D A;  2EXZ A;  1H9J A;  2LFN A;  3ULJ A;  2IJ0 A;  5ELC A;  2JA6 B;  4DXG A;  1Q82 C;  2CQO A;  3BDO A;  4NXM Q;  1JOQ A;  5A2Q L;  4HCS A;  4B9W A;  2GVA A;  2N88 A;  3MEH A;  1I94 L;  2ZM6 Q;  1S5F D;  4BBS H;  3A56 A;  2F0F A;  2TSS A;  3BDL A;  4FO2 A;  4P74 A;  5IYD G;  3NTH A;  2PO4 A;  5FLM H;  4A3F G;  4AQY Q;  4LNQ A;  1IYV A;  1HUN A;  2F52 A;  5CBE E;  3OYY A;  5C4H A;  1QVF A;  1STG A;  3S24 A;  4F87 A;  1H9S A;  1P16 A;  3S1N H;  3SDZ A;  3BZK A;  3UI2 A;  3KFU A;  1A3U A;  2R93 G;  1LUZ A;  3H3V H;  1PH2 A;  4KHZ A;  2RDG A;  1HNW Q;  3FKI G;  3KLS X;  3D6C A;  3WWV A;  4FF3 A;  1PYW D;  2K33 A;  1Z7T A;  1HZA A;  2X6L A;  5C4J B;  1B8A A;  1X6O A;  5HY6 A;  2ZJR A;  3A5U A;  1STH A;  4B3S Q;  4X64 L;  2R7D A;  1XWE A;  1MKH A;  1BCP C;  4RG1 A;  3TME A;  1SRO A;  2F0Q A;  1SYE A;  5IP9 H;  2JA5 G;  2K14 A;  2EYJ A;  1VQ6 A;  1CT1 D;  4HJ8 A;  2ATW A;  1E22 A;  2LXK A;  2BA1 A;  4JI7 L;  1UNS A;  2ZJP A;  1AZP A;  2B2Y C;  1STE A;  1TS2 A;  1ESR A;  3CXC A;  2M9V A;  2WAQ G;  4WJ4 A;  5IIF A;  3HOX H;  3K8A A;  1JQY D;  4GNX C;  4LF4 L;  1AW7 A;  5I6Y A;  5CV5 A;  1EEF D;  2F0T A;  2NZ1 D;  4C1N K;  2QEJ C;  3LX0 A;  2H1E A;  2JA7 B;  2EYO A;  1IBM L;  1LAB A;  3DWP A;  1S72 A;  1D5M C;  2O5J C;  1HNW L;  2JA7 G;  1Y1V H;  1SJH D;  3D4W A;  3ERS X;  2HHH Q;  3J81 i;  4OO1 I;  2F0V A;  4DV3 Q;  5GAH C;  1LT5 D;  2JA8 H;  2MO1 A;  3BG3 A;  1BR9 A;  5I9P A;  3AFP A;  1SE2 A;  2KCT A;  5JPM C;  2UXD L;  2F0H A;  4Y7N B;  2DUD A;  4DUZ Q;  3FPU B;  3L3O C;  4FF2 A;  2B2W C;  4JOI A;  2FJ2 A;  5M5Y H;  3L9A X;  2OF1 A;  3E3X A;  3P7J A;  1K83 B;  3T13 A;  4DR4 L;  1JB7 A;  2F0E A;  1DYQ A;  1VQK A;  3PIP 3;  2N55 A;  3RLO A;  2XRS D;  3GTQ H;  2L0C A;  2G5D A;  3S17 B;  3JAM i;  4B3R Q;  4A3D H;  3I4N H;  5IT9 E;  5EPL A;  3AYH B;  1G2T A;  2B2V C;  4DFA A;  3I7F A;  2HQL A;  1BQQ T;  3MXN A;  2KCC A;  4B3M L;  1NTG A;  2F0L A;  1TT2 A;  3MTS A;  4C3H G;  4IUR A;  3GTJ H;  3ONA B;  1PRT C;  1JT8 A;  1K3B C;  1OTC A;  2ZT9 C;  1PTO D;  3TSS A;  3KK7 A;  4Q0F A;  3GDE A;  5CV4 A;  1FVI A;  5C44 B;  3IFD A;  4XYO A;  1XNQ L;  2QCP X;  2F0I A;  2PZT A;  5EKL A;  4YWK A;  1G8Z D;  4DNI A;  2QW7 A;  3H6M A;  4LFB L;  4LUV A;  1G6P A;  1AE2 A;  4XT1 B;  3VYU A;  2K03 A;  2XSC A;  1F9Q A;  2BE5 D;  4DR4 Q;  4R4Q A;  2K75 A;  4XQJ A;  4PMC A;  3IL8 A;  4MHE A;  3RUZ A;  4A3J H;  3KLS A;  1GKH A;  5GAD C;  4IO9 A;  3RZO H;  4POF A;  3HOY B;  1PV4 A;  4YHH L;  1I5F A;  1Y14 B;  2KQ3 A;  2JEA I;  2B2U A;  3S1Q B;  4X62 L;  2E2J H;  2YTY A;  5FO8 B;  5IGF A;  1SBB B;  2NVQ B;  1CK1 A;  1TS3 A;  4CBV A;  4DR2 L;  2F0O A;  1O7L A;  1R4P B;  2F0N A;  2C35 B;  3DM3 A;  2XWJ B;  1GO3 E;  4A3F B;  4JBK A;  3HRZ C;  4L5S A;  1OXS C;  4MTN A;  1YIJ A;  3V96 A;  1HFG A;  5C3X A;  3MZ5 A;  3NWS A;  1G91 A;  2D0P A;  2L12 A;  3NE5 B;  1VDZ A;  1U4M A;  3MXN B;  3M3Y H;  2Z4H A;  4IFD G;  3RZO B;  2PI2 E;  1I6H H;  5E4X A;  3J81 E;  3FKI H;  2Q2U A;  1GUW A;  3PUX A;  4G7Z C;  1EQQ A;  5ELD A;  4GOP B;  3S14 B;  5GAE C;  1AZQ A;  1Y8P B;  1YNJ D;  2PI2 A;  3OHX C;  3CCL A;  4LW1 A;  3JAM L;  1I50 B;  3E9I A;  1E2Z A;  4NKL A;  1JCK B;  5I4D A;  1SNQ A;  1QG7 A;  1D6E C;  5I2Y A;  1ENA A;  4H02 A;  1IW7 D;  4JPB W;  3KLR A;  4X66 Q;  2B63 B;  3HOY G;  4N9T A;  1ML0 D;  4RHR A;  4NXM L;  2R7F A;  5CV7 A;  4GN5 A;  4OGQ C;  4IQZ A;  4LF8 L;  1ZXT A;  3RLF A;  4QUF A;  4JI0 Q;  5KNC A;  4EGV A;  3I4N G;  2WB1 B;  1EY7 A;  1GUT A;  1LYL A;  2CFM A;  4UAI A;  2K05 A;  1K83 H;  4IUP A;  2K1B A;  3J7Z C;  5H1S E;  3G4S A;  5M5W H;  1UE6 A;  3A7L A;  2NZH A;  1UAP A;  4JI1 L;  3CPW A;  3MVV A;  2V1C C;  1MJE A;  1CM9 A;  1KHI A;  1CQV A;  4DV5 Q;  3SVM A;  1LTB D;  2Y0S G;  1NY4 A;  2L1B A;  3K7U C;  2NVY B;  1JOO A;  4KHP L;  5E4W C;  1VQJ A;  5BR8 L;  3ZYY X;  3K81 C;  2EOT A;  5KEE A;  1N34 L;  3D0F A;  1BBX C;  1ESF A;  3GV6 A;  1EIY B;  1KRS A;  2M00 A;  2D2C C;  3D4D A;  2HIX A;  2HDM A;  3I4M H;  3URY A;  1XMQ L;  4IUV A;  1IBL L;  1DM0 B;  1SE3 A;  2B63 G;  4JVZ A;  1HR0 L;  1N34 Q;  2G9D A;  2KCN A;  1M1K C;  2RCN A;  3SK4 A;  2NN6 G;  4ZAI A;  2OTL A;  3X3M A;  3NWT A;  3SK8 A;  4LJZ C;  3VDY A;  5FK9 C;  1YNN D;  5D3D A;  1PH8 A;  2O5I C;  1MJC A;  2DNE A;  1XTD A;  1DXM A;  1UE5 A;  2EIF A;  2NN6 H;  3HOY H;  1IYJ B;  3QB3 A;  3NXW A;  3GTO H;  5IGD A;  2HCI A;  1TWA B;  1F2L A;  2V4D A;  5COR A;  3CP0 A;  3RMH A;  3CMA A;  4JV5 Q;  5IP7 G;  4OON A;  5COY A;  2ASB A;  2UUA L;  5C4Z A;  2ZTD A;  4JI8 L;  4DV2 L;  4BBS G;  2Q2T A;  2FHT A;  3F2D A;  4GKK L;  5F2D A;  2PNR C;  1KDB A;  4WRD A;  2VQF Q;  2XWB B;  1PTO C;  5C3E H;  1MBY A;  3NHH A;  1O7I A;  1OXU A;  3HOZ G;  4IFD H;  1S3O A;  3SK5 A;  3W2D A;  4LF9 Q;  2BDO A;  4IUQ A;  2FFK B;  1IHZ A;  2DY8 A;  3A5Z B;  2UXC L;  5CR3 A;  3FHW A;  4RWS C;  1PZJ D;  4OXP A;  3BZD B;  3HOU B;  4HMJ A;  1QZH A;  2EQS A;  2DNC A;  3OW7 A;  3KYH C;  2KEC A;  3GTL B;  1VF7 A;  4X3U A;  1B1Z A;  1VQG A;  4C3H H;  4DR3 Q;  1KTK A;  3RZD B;  4LUZ A;  4EQP A;  2R93 H;  3AQQ A;  1CFM A;  5K5P A;  1PVO A;  2MJ8 A;  1PA6 A;  3R2T A;  3A0J A;  4DR7 L;  2LKV A;  4PV1 C;  4CHT B;  1PH6 A;  1CKN B;  4HR7 B;  5M9O A;  1SEB D;  3PV0 A;  3BU2 A;  2WII B;  1RL2 A;  1C7Y A;  1O80 A;  2AQ1 B;  2IHF A;  4AH6 A;  1V1O A;  4DR6 L;  4H0L C;  1E2V A;  4L5Q A;  3BVG A;  1JWS D;  4GZY C;  4F8M A;  1PRT F;  4IUT A;  1FGU A;  3E6Z X;  2F4V Q;  1I3Q H;  1B3Q A;  2AWO A;  5DEH A;  1VQI A;  1BKB A;  1QNU A;  1YJN A;  1FJG L;  2CCZ A;  1IYU A;  1T5X D;  2RSO A;  4KKT A;  1JJ2 A;  2SEB D;  1XX8 A;  4C3I H;  4G4K A;  4JW0 A;  2AWN A;  2HUG A;  4FF4 A;  1E1T A;  4B3T L;  2DJG C;  5BN5 A;  4A3K G;  1PFB A;  5EBC A;  5C5M A;  1ENF A;  2FMM A;  3TRE A;  5ELO A;  3O13 A;  5LL6 S;  2SOB A;  2E2H H;  4DUZ L;  2J4X A;  3KF6 B;  1EYD A;  2NB0 A;  3DXJ C;  3QOJ A;  4DXF A;  1EY0 A;  3JAM c;  4OO1 H;  1XMO Q;  1U4R A;  1II3 A;  4A3F H;  2EYF A;  4RH6 A;  2UXB Q;  4X65 Q;  4ZUI A;  1XNR Q;  2XIW A;  3DLL A;  1CTM A;  3J81 j;  5C0X H;  4ZK9 B;  3RN5 A;  3H94 A;  1A3V A;  1I6V C;  1DD2 A;  4A3E H;  2VZA A;  4BBR H;  2WIN B;  4HTH A;  2CWA A;  2QDB A;  5IWA L;  4IZ8 A;  1DGS A;  1PZI D;  5LMN W;  3HOU H;  1Y1W B;  3KOJ A;  4A3J B;  4KMU C;  2O2L D;  4I7A A;  1EEI D;  1PRT B;  4B08 A;  2KVM A;  1X3Q A;  4GN4 B;  2R92 H;  1TXY A;  3AEV A;  1ASY A;  1QUQ B;  3TZD A;  1TWG B;  2D5D A;  2NWG A;  1A62 A;  5I9O A;  1UUP A;  2AQ3 B;  1OXT A;  1V9P A;  1EYA A;  4GKJ L;  2WB1 E;  4KLK A;  4IOC A;  3VR5 A;  1STA A;  3BVZ A;  4KK7 A;  2WKC A;  2EY5 A;  1T5E A;  1PH7 A;  1C48 A;  1W6K A;  1NBW A;  4JI7 Q;  4LK1 C;  2K7V A;  4JYA L;  2BE5 C;  4ODG A;  2JQO A;  3D3R A;  3VYT A;  5KYI A;  4FF1 A;  4A3D B;  1U9R A;  3PGZ A;  1EQR A;  4UP9 A;  5NUC A;  4DAP A;  5HGQ A;  5FLM G;  3GTQ B;  1EY4 A;  1BUV T;  3FEW X;  2NBF A;  4ZCK A;  1AP0 A;  3LWE A;  2MP1 A;  2F0U A;  1FGB D;  1NMF A;  3BDC A;  5JAV A;  2AUK A;  3S15 H;  1JMC A;  2L55 A;  2CW0 D;  4DV4 Q;  5C3E B;  5CV9 A;  4LF5 L;  2EZV A;  1ILP A;  1ONL A;  1PH4 A;  4K2K A;  1CUK A;  4ME5 A;  4Y7N H;  2NVX B;  4TRD A;  3CW2 C;  1EY6 A;  3PO3 H;  1WD0 A;  4GN3 B;  1BVS A;  4KY7 A;  1C4Q A;  1X65 A;  3CU7 A;  5C3E G;  2F3W A;  2CH4 A;  4KY5 A;  2HD3 A;  1IBK L;  2X6G A;  1RCV D;  4CJ2 C;  4DV6 Q;  1H9M A;  4GKJ Q;  1G29 1;  1SMY C;  4KKU A;  1KAB A;  1SNM A;  4A3K H;  2KED A;  2Z8L A;  5DM7 3;  2A68 D;  4DV7 L;  1N36 L;  2I46 A;  3HG9 A;  4UPA A;  5C6A A;  5BN3 A;  3H0G G;  4JG2 A;  1TWF B;  3S16 B;  1CKM A;  2UXC Q;  1NUC A;  3VYR A;  2ICE C;  2IT1 A;  4GLV B;  1B2T A;  1YJ9 A;  5D65 A;  3VR6 A;  3NQI A;  1WTP A;  2Z1C A;  1IZ6 A;  2E2J B;  1ZKO A;  2B2V A;  4FXK C;  4DV5 L;  4EVO A;  1UE1 A;  4NMZ A;  3F2U A;  2EE1 A;  3M85 A;  3CAM A;  2XVS A;  4PZ6 A;  1QJO A;  1X54 A;  3HFZ B;  4X65 L;  3A7A B;  1N32 L;  1F9R A;  5CMD A;  1B3A A;  3CHB D;  5D3I B;  4POG A;  1B4O A;  1LTR D;  2K28 A;  1B9M A;  3IKJ A;  3HOW B;  1YI2 A;  3A8J E;  5E1F A;  4C2M B;  1KQS A;  1XYI A;  4P2C B;  1VMC A;  5KND A;  4HSV A;  2ZTE A;  1I50 H;  2XTI A;  2MFI A;  1LT6 D;  4KD3 A;  1V1P B;  4L63 B;  3QO2 A;  2JYO A;  1NR2 A;  4IJL A;  4F7X A;  2UUB Q;  4HJ5 A;  2PW5 A;  3CKI B;  1CHP D;  4FXD A;  4OX9 Q;  3FKI B;  3CRL C;  1FJG Q;  4DF7 A;  3MC0 B;  1XPO A;  1XMQ Q;  4JI5 L;  3C2P A;  4HN7 A;  4LF6 Q;  4BXX H;  4HIK A;  1I6H B;  3KF8 A;  1VCI A;  4GOP A;  3L0O A;  1VQA A;  4GNX A;  5HUR A;  4L5T A;  4EQ5 A;  3IRB A;  1GM5 A;  3OPO A;  2R93 B;  4KHP Q;  2WKD A;  4ABN A;  2MO0 A;  2I5L X;  4A3J G;  3GTL H;  3DEO A;  3HOV B;  3HKS A;  4KN4 C;  4J15 A;  5M3M B;  1QZG A;  2OEO A;  4DPG A;  2HDL A;  1VF5 C;  4A3K B;  1LTT D;  5M5X B;  1BO0 A;  4FNF A;  1AN8 A;  4HJ9 A;  5FJ8 H;  3C3L A;  2LS0 1;  1N8R C;  1E0B A;  5CYU A;  4DK0 A;  1FNU A;  4O2D A;  2EPB A;  2JSO A;  3HGB A;  4AYB G;  1X3E A;  5LMN L;  3CCM A;  1LTG D;  1SMY D;  4EX5 A;  4V0B A;  4CJ0 B;  3T51 B;  1PFS A;  1VQD A;  3C1E A;  4V19 0;  3S1M B;  3I4O A;  2P5Z X;  3H0G H;  5C4X B;  1Z9F A;  4JOI C;  3CME A;  1MI2 A;  1D7Q A;  1D1I A;  2NTS A;  1TU2 B;  1S5E D;  1BBW A;  2YV5 A;  4ZUJ A;  4CGY B;  1Q8K A;  3DUZ A;  1Y1W G;  4ZQ3 A;  2L9H A;  3GV3 A;  4EQO A;  3GTG H;  1BF4 A;  2D9U A;  1EIG A;  1AEX A;  4O0A A;  5ELN A;  1EOV A;  2F0S A;  1PYS B;  1E24 A;  2Z0S A;  4NB3 A;  4DK1 A;  1ENC A;  4LF7 Q;  4UY8 C;  1WD1 A;  4OHJ A;  4LFC L;  4LF6 L;  1ROD A;  3EIV A;  1KAA A;  3AU7 A;  4A3G G;  4N8X 1;  1CHQ D;  1O78 A;  1HNZ L;  2E2I B;  2XNA C;  1IL8 A;  4OX9 L;  4QL5 A;  3I56 A;  4OIK A;  1BBU A;  3OMC A;  1SLJ A;  3GQB A;  4K14 A;  1VS0 A;  2YTV A;  3RN2 A;  2F0P A;  5LL6 X;  4PNY A;  1EY9 A;  1VQ7 A;  4C1N I;  2B2T C;  4LAA A;  4X62 Q;  1HQM C;  3ULL A;  4ME3 A;  4BY7 H;  1GHJ A;  1F9P A;  4B9X A;  4DAM A;  5BN4 A;  4L5R C;  4A3G B;  1BCP D;  4PZ7 A;  1KIX A;  3S1R B;  4JI3 Q;  3VA5 A;  2HIV A;  1B44 D;  3HOX G;  4HIO A;  4R8I A;  3LNN A;  2R92 G;  4DR5 L;  2Z6K C;  4RAU C;  4LFB Q;  5T1I A;  3W1B A;  1GD7 A;  5AJ3 Q;  3TS2 A;  1FD7 D;  1YHA A;  1M8A A;  1PLF A;  2J7Z A;  1S5C D;  4RMF A;  3EQL C;  3HOU G;  2ZXR A;  2K5V A;  4GNX B;  4X3K A;  3PF5 A;  4ULL A;  5JEA G;  1XJV A;  1K0R A;  1W6J A;  1SJE D;  1W3S A;  4L8J A;  2F0D A;  1EYC A;  4K0K Q;  2A69 C;  4A3M B;  4DV7 Q;  3AMU A;  4IUN A;  1V1Q A;  2JA8 G;  5FO7 B;  3J7A 5;  3U4V A;  1JWM D;  4BA2 I;  4QMG A;  2KEN A;  4MN3 A;  3CCE A;  4YCV A;  4NXN L;  3TP6 A;  2EYM A;  4FXG C;  4YY3 Q;  1KRT A;  1X3P A;  3V05 A;  3RD4 A;  2BA0 A;  3R2I A;  1WTQ A;  1HTL D;  1X3F A;  3MAQ A;  3SE0 A;  2N78 A;  1PH1 A;  1SND A;  1PH9 A;  4KD4 A;  1NCV A;  1SFO B;  3NPP A;  4R4T A;  3CPF A;  2RSN A;  2E76 C;  4R4I A;  4PG3 A;  2B63 H;  1WYD A;  2F3I A;  1VQP A;  3HOW G;  5ELB A;  3RR5 A;  2NYZ D;  1CZW A;  3I91 A;  4C56 C;  2A19 A;  5C0X G;  1LAC A;  4P75 A;  2B8G A;  2A8V A;  1CZG A;  4JI2 Q;  2DN8 A;  2E5L L;  3K0Y A;  2JXM B;  2A1A A;  2AKW B;  3OOC A;  4K8I A;  4X3T A;  4XIG S;  2SNM A;  5FLX L;  2LMC B;  3PIO A;  4IAL A;  5C4J H;  3PMF A;  3P20 A;  3FPP A;  2JA6 H;  3MHB A;  4GLA C;  2K5N A;  1EZ6 A;  5EGT A;  4KKS A;  3G6E A;  2E2D C;  5C0X J;  4OWW B;  4IUU A;  4DK3 C;  1FYC A;  4IOA A;  2IX0 A;  4JYA Q;  5KYL A;  3MEF A;  1JR0 D;  1SFO H;  1XPU A;  1HQR D;  2VB3 X;  1J5E L;  1N33 L;  1UWV A;  1KLG D;  1KAW A;  4YIJ A;  2QDL A;  4DV4 L;  3GTM H;  1DOK A;  4GKK Q;  3GTG B;  3H09 A;  1G51 A;  1YIT A;  4QUC A;  3M4O B;  1IKM A;  5T1G A;  4HMI A;  3S2D B;  2ZJQ A;  1L0W A;  2K6A A;  3H15 A;  3HOZ H;  2JEB I;  4RGN A;  4OEL B;  3TEH B;  4K0K L;  1F2Y A;  1CSQ A;  3PUY A;  1LO5 D;  5A2Q E;  1Y1V G;  4R9W A;  3W3A A;  4B3M Q;  3E0E A;  4A93 G;  1SNO A;  4C2M H;  1AH9 A;  2R92 B;  4BXX G;  1YEZ A;  3F2B A;  5AJ3 L;  1YNX A;  4RHS A;  1I4H A;  3OIP A;  1F2M A;  5CV6 A;  3K7A B;  3I4M B;  1XTC D;  1HNX Q;  1XXG A;  1D5Z C;  5C44 G;  1K8O A;  2YU9 H;  1Q1E A;  2RHS B;  1WTO A;  1YVC A;  1YHQ A;  2JN4 A;  4DR1 Q;  4PMB A;  4JI3 L;  1QUQ A;  4PQX A;  4FVM A;  1R9T B;  1A2T A;  1ZYR C;  1VQ8 A;  2L4N A;  3R93 A;  4J8Q A;  5IT9 L;  3NBH B;  5IGC A;  2H4O A;  2ZM6 L;  2NVT H;  3F8T A;  3AFQ A;  2VW9 A;  4JI4 Q;  4TVA B;  1D1K A;  1T9H A;  1LT3 D;  1YHB A;  5CV8 A;  2A74 C;  1FNV A;  4DV3 L;  4YCU A;  5A35 A;  1XNR L;  2I0Q A;  4A3I H;  4R4C A;  1EL0 A;  2EY1 A;  1G6Z A;  2VUM G;  5JJZ A;  5J22 A;  1J8I A;  5EAY A;  1U0L A;  1XMO L;  3R3O A;  3J80 i;  3M4Y A;  1PTO B;  2IW3 A;  2WV6 D;  3K7A H;  4OWX B;  2Q8R E;  2VUM B;  2MNA A;  4CKE A;  4J1M A;  3EFX D;  3DWA A;  4H13 C;  4B3T Q;  1RD9 D;  5JJL A;  2QEX A;  1Q81 C;  3ZJY C;  5J39 A;  3IFT A;  4GLX A;  5DLQ E;  3K5N A;  5M3F B;  2ICI A;  3CCU A;  2TMP A;  4LF9 L;  4DR7 Q;  2AMC B;  4IFD J;  3S17 H;  3D6W A;  5EQ0 A;  5CC4 A;  2PCF B;  1YNJ C;  3Q0A A;  2CQA A;  3HKZ B;  4BWG B;  3J81 L;  4K6L A;  4DV2 Q;  1EFW A;  1VQE A;  1ILQ A;  3KJP A;  1H95 A;  3R8B A;  1YJW A;  2I5M X;  4NW2 A;  2IY5 B;  1MSG A;  4A3B G;  1J6Q A;  1TWF H;  1TWG H;  2C9O A;  4QY7 A;  4BY1 G;  2NVQ H;  3HOV G;  2R7Z H;  1VMP A;  2L15 A;  2FXQ A;  3Q6S A;  3PUZ A;  1LTA D;  3FMC A;  4IPC A;  1R9T H;  1VQB A;  5IGE A;  1CKO A;  3CC4 A;  3I72 A;  1SE8 A;  2VQF L;  4NPS A;  1HR0 Q;  3PO3 B;  1O7Z A;  4JI8 Q;  1G2S A;  4UP7 A;  5IOC A;  1TKW B;  1SNP A;  1RTN A;  3ND9 A;  4K5X A;  1F9S A;  3M4P A;  1RF2 D;  2A73 B;  2KUM A;  4CKC A;  4QIW E;  3E9H A;  5J1Z A;  3HZX A;  3S2H B;  3ER0 A;  5J3B A;  3GTO B;  2K01 A;  3DM1 A;  2QKI C;  1HUM A;  4XXE A;  3MXP A;  1EUJ A;  1WCM B;  3KUP A;  4BS9 A;  3UDX A;  3CQZ B;  4WJW A;  3PO2 G;  5G3L D;  3J80 c;  4ILW A;  4JBW A;  1EWI A;  3GD7 A;  4RCN A;  1M90 C;  2GA4 B;  2XN9 C;  3SGI A;  3UDI A;  4JI0 L;  4A3M G;  2KHI A;  2UUB L;  1L1O A; 
#chains in the Genus database with same CATH homology
 1GHK A;  4U67 3;  1E2W A;  4XT3 B;  2IPK D;  2F1M A;  3K58 A;  2WAQ B;  3OWE B;  1D5X C;  3J80 E;  3WOF A;  5LHY 1;  1WTV A;  1Y1V B;  3S1N B;  1BCP B;  2O4X A;  3N6R A;  5C5L A;  1ZYR D;  4DNR B;  1ICW A;  1TY0 A;  3J80 L;  5FOB B;  1TVX A;  4QCL A;  2BDN A;  1DOL A;  1GXD C;  2KEE A;  3I90 A;  2L11 A;  5I6W A;  3HEJ A;  4ZRZ A;  2YU9 B;  4BBS B;  4RKL A;  3DHQ A;  2RDH A;  3GTM B;  1HCZ A;  2IX3 A;  3MXG A;  2KHS A;  1Z47 A;  3S15 B;  1SDF A;  3M7N A;  5CGK A;  1A2U A;  1JC7 A;  5DAU A;  1SYG A;  4ZKC B;  2OT2 A;  1DZ1 A;  2AUJ D;  4EQN A;  1GUN A;  2NTT A;  1SE4 A;  1F2Z A;  2R61 A;  1FNW A;  2K5D A;  1PXU A;  3NQT A;  4KJN A;  2Q8I B;  2EJM A;  2G9H D;  1KNE A;  1JWU D;  1TWC B;  3SR1 A;  1NAP A;  1TS5 A;  1A15 A;  3BS1 A;  4A3B B;  3GP7 A;  3I8Z A;  2F03 A;  1JOR A;  4DAY A;  4RA8 A;  1B53 A;  3EJI A;  1HHV A;  1KDA A;  4QF4 A;  2B2U C;  1PDQ A;  4TSS A;  1EU3 A;  3MFG A;  3NTK A;  2QF7 A;  1V1P A;  5HGT A;  1PRT D;  1EQT A;  5AFW A;  2E2H B;  4QB4 A;  4KI0 A;  3T56 B;  2A6H D;  4WFN 3;  4DGZ A;  4AYB B;  3GTJ B;  1LT4 D;  2KOL A;  3TP5 A;  1QWY A;  5E3F A;  1I4G A;  2XRQ D;  2PMZ B;  4KY6 A;  3I73 A;  1B50 A;  1DOM A;  5DM6 3;  3A8I E;  3OIQ A;  2EY6 A;  3WDN A;  2IWH A;  1CQF A;  1I4X A;  2F0K A;  5KIX A;  3GTK B;  2A6E C;  4U68 A;  5JVG 3;  1TII D;  1C8C A;  5EPJ A;  5JVH 3;  5JPN C;  4RFB A;  2K5W A;  4XDX A;  4PMW A;  2B2T A;  5C0X I;  1NR4 A;  4LMQ D;  2JP1 A;  2A5H A;  1SXT A;  3QWN A;  1GOZ A;  2YYZ A;  2A6E D;  4F88 A;  3HOZ B;  4C3H B;  1EY5 A;  3NBI A;  1GJX A;  3FVQ A;  4NP5 A;  1TWH B;  1Q12 A;  3ITP A;  4KJO A;  3SEB A;  4RGT A;  3Q22 A;  1Q90 A;  1HA5 A;  1KNA A;  3HOX B;  4Q5V A;  4C3I B;  5FLX E;  2A6H C;  2A69 D;  1BNZ A;  4DNT B;  3N52 A;  5EBD A;  5EJW A;  1BDO A;  3A54 A;  3MA2 B;  2OXP A;  1L0X B;  1F77 A;  2F0G A;  3EVQ A;  1I4R A;  1K8M A;  1Z6H A;  2IL8 A;  2MGS A;  3D31 A;  1DJR D;  1SSO A;  4C3I G;  1YNN C;  2B2Y A;  3NUC A;  4DA2 A;  2F0J A;  5M5Y B;  1Y69 U;  1ET9 A;  1QOH A;  5JEA H;  1TQO A;  4K5V A;  2NVT B;  1V43 A;  1R4Q B;  3K5L A;  2EVB A;  2EDG A;  2QIL A;  4BY7 B;  2SDF A;  4DN4 M;  2MHV A;  5CBA E;  1HPC A;  4ZKB B;  1QNK A;  4O1N A;  5ELF A;  2X69 A;  3A8K E;  3OWF A;  5M5W B;  4H44 C;  2RDF A;  4WOR A;  1JOK A;  3SK6 A;  1GUG A;  3HS0 C;  5EKI A;  4FYD A;  2PPB C;  2RQX A;  3QG1 A;  1WTX A;  1M4V A;  1SAP A;  5EPK A;  1OO9 B;  1EU4 A;  1D2B A;  2VXW A;  3DMU A;  1UEA B;  3KBX A;  4M8A A;  1MD2 D;  2D62 A;  4KTA A;  4OO1 G;  4XTC S;  1CA6 A;  3OMG A;  4N9P A;  3H0G B;  3NK9 A;  4K2L A;  1HRJ A;  1I3Q B;  4TKO B;  1S4Z A;  1RTO A;  5JEA J;  5IGG A;  4FP5 D;  4X3S A;  2IX1 A;  4G7O C;  4XYQ A;  1B9N A;  2K5Q A;  4HAE A;  1L0Y B;  2B2W A;  2BOS A;  1NSN S;  2FMC A;  1TR5 A;  2J0T D;  3TP8 A;  3G6J B;  1PTO F;  3SXH A;  2EJG C;  1RJT A;  2CVR A;  3I70 A;  2RA4 A;  1LTS D;  4DAV A;  5EKK A;  2L5T A;  3VR2 A;  2AQ2 B;  4RKB A;  1BXT A;  1EY8 A;  1A6X A;  2PYK A;  3I4L A;  2EYH A;  2RBM A;  4MIU A;  5IGB A;  3QOL A;  3TZU A;  5G3L F;  1X32 A;  4Z9C B;  1ZEQ X;  2WP8 J;  4QIW B;  4ZLT F;  1U4P A;  4R8N A;  4TQU S;  3C1F A;  4I65 A;  4KHV A;  5D14 A;  4IN3 A;  4E6I A;  2VNU D;  5ELE A;  1EFI D;  2SNS A;  3DWQ A;  4RCO A;  3NSW A;  1ET6 A;  3VA7 A;  3C46 A;  1GUS A;  1H9K A;  4JK1 C;  1STB A;  2B8F A;  2KJX A;  5KNB A;  2FIN B;  2JA8 B;  1U4L A;  2EJF C;  1EWC A;  3U9O A;  3K5O A;  2M2L A;  3DEP A;  3M7G A;  1KLU D;  3FRP B;  1QE6 A;  3TDQ A;  2MPM A;  3D4R A;  4C3J B;  1JB3 A;  1WTR A;  5KRU A;  1WVL A;  2C5C A;  3OSO A;  3CRK C;  5FKA C;  1QIL A;  1DCZ A;  1PTO H;  3HP3 A;  5DNF A;  3Q24 A;  1OXV A;  1QCB D;  3AB9 A;  2LY7 A;  1STN A;  3P75 A;  1DON A;  5ISR A;  2Y0S B;  1HXY D;  2PW7 A;  4J6H A;  3K57 A;  3MXU A;  3PUV A;  4BY1 B;  1AFP A;  5K36 H;  2EYL A;  3VR3 A;  1BCP F;  3ND8 A;  3SHL A;  3IAY A;  3X3N A;  2NUC A;  3V2T A;  1PMR A;  2DY7 A;  2JE6 I;  3ERQ A;  2VB2 X;  1CI3 M;  3MWY W;  1Q1B A;  3K5M A;  3KBG A;  4CKB A;  2F0M A;  2R7Z B;  1LV9 A;  3LWU A;  1HA6 A;  3K59 A;  3H3V C;  3J7Y W;  1LLR D;  3PUW A;  3QJY A;  3ERO A;  1TS4 A;  1SNC A;  3WOE A;  5IOD A;  3BVM A;  1O7Y A;  1I4P A;  4UDU C;  1SYC A;  4HSP A;  3BYT B;  3T4A C;  1IW7 C;  1IKL A;  1EZ8 A;  1H9S B;  3P1H A;  1EQV A;  4L6T B;  4RGO S;  5KGU A;  4K8J A;  1EWH A;  3TBI B;  4XQQ A;  4ID6 A;  1RDP D;  4G57 A;  5FO9 B;  1GUO A;  1RHP A;  1JIC A;  2Z4I A;  3NTI A;  1Y8N B;  2PZU A;  3JAM E;  4HCE A;  2K32 A;  3TN2 A;  2F0W A;  1V8Q A;  3S9W A;  2MUY A;  4BBR B;  3D8G A;  3NBH A;  4A3E B;  1HTP A;  1Q3L A;  2F3V A;  3BYY B;  1JE4 A;  1CA5 A;  5I2X A;  2EYP A;  4S3S A;  5TSS A;  3T53 B;  3E0J A;  2I07 B;  1PFN A;  3GO5 A;  1PZK D;  1EIH A;  1EOT A;  1SYB A;  1WTW A;  2E75 C;  3VR4 A;  1Y8O B;  2R3Z A;  4H7B A;  2PZW A;  4CJ1 B;  3NP8 A;  3Q23 A;  1MSH A;  3I3C A;  4C3J G;  3J7A F;  4I7Z C;  3GTP B;  2NN6 I;  2A68 C;  2HCC A;  1SYF A;  4ZYS A;  2PQE A;  3T16 A;  1RKN A;  1KDC A;  1S5B D;  3PIO 3;  3E5S A;  2ZXO A;  1J9O A;  3J7A V;  2E74 C;  2BCO A;  3H91 A;  5C3W A;  4OIJ A;  1STY A;  1QB5 D;  3G7L A;  5JOB A;  4IFD I;  1A3T A;  2Q8T A;  4BA1 I;  4G7H C;  2K04 A;  4OL7 A;  1PFM A;  2KA7 A;  4K5W A;  5K36 G;  1TY2 A;  1S5D D;  3FDT A;  1FR3 A;  2ENB A;  4KV6 A;  2F4I A;  3QIA A;  1LTI D;  4KN7 C;  4M1U B;  1HFN A;  1BOS A;  4XQN A;  2CHB D;  3M3Y B;  4O42 A;  2JA5 B;  4HED A;  4A3I B;  3L7Z C;  4RGM A;  4DU9 A;  2RVL A;  3VYS A;  2WAC A;  2R6G A;  2RKS A;  2HQE A;  1I4Q A;  1H9R A;  3PO2 B;  1SYD A;  2B39 A;  2ID0 A;  2ZXP A;  4NDX A;  1OXX K;  2EY2 A;  3MFY A;  3I4N B;  4A93 B;  2CW0 C;  3TP7 A;  3U9S A;  1MGS A;  1Q8I A;  3A55 A;  3K6O A;  3EA6 A;  4K6D A;  2EXZ A;  1H9J A;  2LFN A;  2IJ0 A;  5ELC A;  2JA6 B;  4DXG A;  3BDO A;  1JOQ A;  5A2Q L;  4HCS A;  4B9W A;  2N88 A;  3MEH A;  1S5F D;  3A56 A;  2F0F A;  2TSS A;  3BDL A;  4FO2 A;  3NTH A;  2PO4 A;  1IYV A;  1HUN A;  5CBE E;  5C4H A;  1STG A;  4F87 A;  1H9S A;  3SDZ A;  3UI2 A;  1A3U A;  4KHZ A;  2RDG A;  3KLS X;  3D6C A;  4FF3 A;  1PYW D;  2K33 A;  1Z7T A;  2X6L A;  5C4J B;  1STH A;  1XWE A;  1BCP C;  3TME A;  2F0Q A;  1SYE A;  2EYJ A;  1CT1 D;  2BA1 A;  1UNS A;  1AZP A;  2B2Y C;  1STE A;  1TS2 A;  1ESR A;  2M9V A;  5IIF A;  1JQY D;  1AW7 A;  5I6Y A;  5CV5 A;  1EEF D;  2F0T A;  2NZ1 D;  4C1N K;  2QEJ C;  3LX0 A;  2H1E A;  2JA7 B;  2EYO A;  1LAB A;  3DWP A;  1D5M C;  2O5J C;  1SJH D;  3D4W A;  4OO1 I;  2F0V A;  1LT5 D;  3BG3 A;  1BR9 A;  5I9P A;  1SE2 A;  5JPM C;  2F0H A;  4Y7N B;  3FPU B;  3L3O C;  4FF2 A;  2B2W C;  2FJ2 A;  3L9A X;  2OF1 A;  3P7J A;  1K83 B;  3T13 A;  2F0E A;  1DYQ A;  3PIP 3;  2N55 A;  2XRS D;  2L0C A;  3S17 B;  5IT9 E;  5EPL A;  1G2T A;  2B2V C;  4DFA A;  1BQQ T;  3MXN A;  2KCC A;  2F0L A;  1TT2 A;  3MTS A;  4C3H G;  4IUR A;  3ONA B;  1PRT C;  2ZT9 C;  1PTO D;  3TSS A;  3KK7 A;  4Q0F A;  5CV4 A;  5C44 B;  3IFD A;  4XYO A;  2QCP X;  2F0I A;  2PZT A;  5EKL A;  1G8Z D;  3H6M A;  3VYU A;  4XT1 B;  2K03 A;  2XSC A;  1F9Q A;  2BE5 D;  4XQJ A;  4PMC A;  3IL8 A;  4MHE A;  3RUZ A;  3KLS A;  3HOY B;  2KQ3 A;  2JEA I;  2B2U A;  3S1Q B;  5FO8 B;  5IGF A;  1SBB B;  2NVQ B;  1CK1 A;  1TS3 A;  4CBV A;  2F0O A;  1O7L A;  1R4P B;  2F0N A;  4A3F B;  2XWJ B;  3HRZ C;  1OXS C;  3V96 A;  1HFG A;  5C3X A;  3MZ5 A;  3NWS A;  1G91 A;  2L12 A;  3NE5 B;  1VDZ A;  1U4M A;  3RZO B;  2Z4H A;  4IFD G;  5E4X A;  3J81 E;  1GUW A;  3PUX A;  4G7Z C;  5ELD A;  3S14 B;  1AZQ A;  1Y8P B;  1YNJ D;  3OHX C;  3JAM L;  1I50 B;  1E2Z A;  4NKL A;  1JCK B;  5I4D A;  1SNQ A;  1QG7 A;  1D6E C;  5I2Y A;  1ENA A;  1IW7 D;  3KLR A;  2B63 B;  1ML0 D;  4N9T A;  4RHR A;  5CV7 A;  4OGQ C;  4IQZ A;  1ZXT A;  3RLF A;  4QUF A;  5KNC A;  4EGV A;  2WB1 B;  1EY7 A;  1GUT A;  4UAI A;  2K05 A;  4IUP A;  2K1B A;  3A7L A;  1UAP A;  3MVV A;  1CM9 A;  1CQV A;  3SVM A;  1LTB D;  2L1B A;  2NVY B;  1JOO A;  5E4W C;  1BBX C;  3ZYY X;  5KEE A;  2EOT A;  1ESF A;  3GV6 A;  2M00 A;  2D2C C;  3D4D A;  2HDM A;  3URY A;  4IUV A;  1DM0 B;  1SE3 A;  2G9D A;  2KCN A;  3SK4 A;  2NN6 G;  4ZAI A;  3X3M A;  3NWT A;  3SK8 A;  4LJZ C;  5FK9 C;  1YNN D;  5D3D A;  2O5I C;  2DNE A;  1DXM A;  2NN6 H;  3QB3 A;  3NXW A;  5IGD A;  2HCI A;  1TWA B;  1F2L A;  2V4D A;  5COR A;  3RMH A;  5COY A;  5C4Z A;  2FHT A;  5F2D A;  2PNR C;  1KDB A;  4WRD A;  2XWB B;  1PTO C;  1MBY A;  3NHH A;  1OXU A;  4IFD H;  3SK5 A;  3W2D A;  2BDO A;  4IUQ A;  2FFK B;  1IHZ A;  2DY8 A;  5CR3 A;  4RWS C;  1PZJ D;  3BZD B;  3HOU B;  4HMJ A;  2DNC A;  3OW7 A;  2KEC A;  3GTL B;  1VF7 A;  4X3U A;  1B1Z A;  1KTK A;  3RZD B;  4EQP A;  1CFM A;  5K5P A;  2MJ8 A;  3R2T A;  2LKV A;  4PV1 C;  4CHT B;  4HR7 B;  5M9O A;  1SEB D;  3PV0 A;  2WII B;  1O80 A;  2AQ1 B;  1V1O A;  4H0L C;  1E2V A;  3BVG A;  1JWS D;  4GZY C;  4F8M A;  1PRT F;  4IUT A;  3E6Z X;  2AWO A;  5DEH A;  1QNU A;  1IYU A;  1T5X D;  2RSO A;  4KKT A;  2SEB D;  1XX8 A;  4G4K A;  2AWN A;  2HUG A;  4FF4 A;  5BN5 A;  1PFB A;  5EBC A;  5C5M A;  1ENF A;  2FMM A;  3O13 A;  5LL6 S;  2SOB A;  2J4X A;  1EYD A;  2NB0 A;  3DXJ C;  3QOJ A;  4DXF A;  1EY0 A;  4OO1 H;  1U4R A;  1II3 A;  2EYF A;  4RH6 A;  4ZUI A;  2XIW A;  1CTM A;  5C0X H;  4ZK9 B;  3H94 A;  1A3V A;  1I6V C;  1DD2 A;  2WIN B;  4HTH A;  2QDB A;  4IZ8 A;  1PZI D;  1Y1W B;  4A3J B;  4KMU C;  2O2L D;  1EEI D;  1PRT B;  4B08 A;  2KVM A;  1X3Q A;  3TZD A;  1TWG B;  2D5D A;  2NWG A;  5I9O A;  1UUP A;  2AQ3 B;  1OXT A;  1EYA A;  3VR5 A;  1STA A;  3BVZ A;  4KK7 A;  2WKC A;  2EY5 A;  1T5E A;  1C48 A;  1W6K A;  4LK1 C;  2K7V A;  2BE5 C;  4ODG A;  3D3R A;  3VYT A;  5KYI A;  4FF1 A;  4A3D B;  1U9R A;  5NUC A;  4DAP A;  3GTQ B;  1EY4 A;  1BUV T;  3FEW X;  2NBF A;  1AP0 A;  3LWE A;  2MP1 A;  2F0U A;  1FGB D;  3BDC A;  5JAV A;  2AUK A;  2L55 A;  2CW0 D;  5C3E B;  5CV9 A;  2EZV A;  1ILP A;  1ONL A;  4K2K A;  4ME5 A;  2NVX B;  4TRD A;  1EY6 A;  1WD0 A;  3CU7 A;  1C4Q A;  4KY7 A;  2F3W A;  4KY5 A;  2X6G A;  1RCV D;  4CJ2 C;  1H9M A;  1G29 1;  1SMY C;  4KKU A;  1KAB A;  1SNM A;  2KED A;  2Z8L A;  5DM7 3;  2A68 D;  2I46 A;  3HG9 A;  5C6A A;  5BN3 A;  1TWF B;  3S16 B;  1NUC A;  3VYR A;  2ICE C;  2IT1 A;  1B2T A;  5D65 A;  3VR6 A;  3NQI A;  1WTP A;  2Z1C A;  2E2J B;  1ZKO A;  2B2V A;  4FXK C;  4EVO A;  4NMZ A;  3F2U A;  2EE1 A;  3M85 A;  2XVS A;  1QJO A;  3A7A B;  1F9R A;  5CMD A;  1B3A A;  3CHB D;  5D3I B;  1B4O A;  1LTR D;  2K28 A;  1B9M A;  3IKJ A;  3HOW B;  3A8J E;  5E1F A;  4C2M B;  1XYI A;  4P2C B;  1VMC A;  5KND A;  4HSV A;  1LT6 D;  4KD3 A;  1V1P B;  4L63 B;  3QO2 A;  2JYO A;  1NR2 A;  4F7X A;  2PW5 A;  3CKI B;  1CHP D;  4FXD A;  3FKI B;  3CRL C;  4DF7 A;  3MC0 B;  3C2P A;  4HN7 A;  1I6H B;  3KF8 A;  1VCI A;  5HUR A;  3OPO A;  2R93 B;  2WKD A;  4ABN A;  3DEO A;  3HOV B;  4KN4 C;  5M3M B;  2OEO A;  2HDL A;  1VF5 C;  4A3K B;  1LTT D;  5M5X B;  1BO0 A;  4FNF A;  1AN8 A;  3C3L A;  2LS0 1;  1E0B A;  5CYU A;  4DK0 A;  1FNU A;  2EPB A;  2JSO A;  3HGB A;  1LTG D;  1SMY D;  4V0B A;  4CJ0 B;  3T51 B;  3S1M B;  3C1E A;  4V19 0;  5C4X B;  1MI2 A;  1D1I A;  2NTS A;  1TU2 B;  1S5E D;  4ZUJ A;  4CGY B;  3DUZ A;  4ZQ3 A;  2L9H A;  3GV3 A;  4EQO A;  1BF4 A;  2D9U A;  1EIG A;  1AEX A;  2F0S A;  4DK1 A;  1ENC A;  1WD1 A;  4OHJ A;  1ROD A;  1KAA A;  3AU7 A;  1CHQ D;  1O78 A;  2E2I B;  2XNA C;  1IL8 A;  4OIK A;  3OMC A;  3GQB A;  4K14 A;  2F0P A;  5LL6 X;  4PNY A;  1EY9 A;  4C1N I;  2B2T C;  4LAA A;  1HQM C;  1GHJ A;  1F9P A;  4B9X A;  5BN4 A;  4A3G B;  1BCP D;  3S1R B;  3VA5 A;  1B44 D;  4R8I A;  3LNN A;  4RAU C;  5T1I A;  1FD7 D;  1M8A A;  1PLF A;  2J7Z A;  1S5C D;  3EQL C;  2ZXR A;  4X3K A;  4ULL A;  5JEA G;  1W6J A;  1SJE D;  4L8J A;  2F0D A;  1EYC A;  2A69 C;  4A3M B;  3AMU A;  4IUN A;  5FO7 B;  1JWM D;  4BA2 I;  4QMG A;  4MN3 A;  3TP6 A;  2EYM A;  4FXG C;  1X3P A;  3V05 A;  3RD4 A;  2BA0 A;  3R2I A;  1WTQ A;  1HTL D;  3MAQ A;  3SE0 A;  1SND A;  4KD4 A;  1NCV A;  1SFO B;  3NPP A;  2RSN A;  2E76 C;  5ELB A;  2NYZ D;  1CZW A;  3I91 A;  4C56 C;  5C0X G;  1LAC A;  2B8G A;  1CZG A;  2DN8 A;  3K0Y A;  2JXM B;  3OOC A;  4K8I A;  4X3T A;  4XIG S;  2SNM A;  5FLX L;  2LMC B;  4IAL A;  3PMF A;  3P20 A;  3FPP A;  3MHB A;  1EZ6 A;  5EGT A;  4KKS A;  2E2D C;  5C0X J;  4IUU A;  1FYC A;  2IX0 A;  5KYL A;  1JR0 D;  1HQR D;  2VB3 X;  1KLG D;  4YIJ A;  1DOK A;  3GTG B;  3H09 A;  4QUC A;  3M4O B;  1IKM A;  5T1G A;  4HMI A;  3S2D B;  2K6A A;  2JEB I;  4RGN A;  1F2Y A;  3PUY A;  1LO5 D;  5A2Q E;  4R9W A;  3W3A A;  1SNO A;  2R92 B;  4RHS A;  1I4H A;  3OIP A;  1F2M A;  5CV6 A;  3K7A B;  3I4M B;  1XTC D;  1XXG A;  1D5Z C;  1K8O A;  1Q1E A;  1WTO A;  4PMB A;  4PQX A;  4FVM A;  1R9T B;  1A2T A;  1ZYR C;  2L4N A;  3R93 A;  4J8Q A;  5IT9 L;  5IGC A;  2H4O A;  1D1K A;  1LT3 D;  5CV8 A;  2A74 C;  1FNV A;  5A35 A;  1EL0 A;  2EY1 A;  1G6Z A;  5JJZ A;  5J22 A;  1J8I A;  3R3O A;  3M4Y A;  1PTO B;  2IW3 A;  2WV6 D;  2Q8R E;  2VUM B;  4CKE A;  4J1M A;  3EFX D;  3DWA A;  4H13 C;  1RD9 D;  5J39 A;  3IFT A;  3K5N A;  5M3F B;  2ICI A;  2TMP A;  4IFD J;  3D6W A;  5EQ0 A;  5CC4 A;  2PCF B;  1YNJ C;  3Q0A A;  2CQA A;  3HKZ B;  4BWG B;  3J81 L;  4K6L A;  1ILQ A;  3R8B A;  4NW2 A;  1MSG A;  2C9O A;  1VMP A;  3PUZ A;  3Q6S A;  1LTA D;  3FMC A;  5IGE A;  3I72 A;  3PO3 B;  1O7Z A;  1G2S A;  5IOC A;  1TKW B;  1SNP A;  1RTN A;  3ND9 A;  4K5X A;  1F9S A;  1RF2 D;  2A73 B;  2KUM A;  4CKC A;  5J1Z A;  3HZX A;  3S2H B;  3GTO B;  2K01 A;  3DM1 A;  2QKI C;  1HUM A;  4XXE A;  3MXP A;  1WCM B;  3KUP A;  4BS9 A;  3CQZ B;  4WJW A;  5G3L D;  4ILW A;  4JBW A;  3GD7 A;  4RCN A;  2GA4 B;  2XN9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...