1F9SA

Crystal structure of platelet factor 4 mutant 2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
DGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGSKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords PLATELET FACTOR 4
publication title Structure Comparison of Two Platelet Factor 4 Mutants with the Wild-type Reveals the Epitopes for the Heparin-induced Thrombocytopenia Antibodies
rcsb
source organism Homo sapiens
total genus 10
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9sA00
1ILQA 1ESRA 1U4PA 4O42A 2L11A 1F9SA 1O7YA 1VMPA 4OIKA 4IURA 1ZXTA 2HDMA 1RJTA 2L9HA 2XIWA 1WTPA 4DN4M 2HCCA 1WD0A 3KUPA 4HEDA 2EOTA 2RVLA 2EPBA 1HUNA 1CA5A 1B2TA 4UAIA 5E4XA 5CBEE 4IUPA 1PLFA 1RODA 1ML0D 1C8CA 4ZK9B 1QG7A 2KUMA 1MSHA 3IFDA 4R9WA 2K04A 3IL8A 1B3AA 1ILPA 1EL0A 2B2TA 2BDNA 1WTQA 5CBAE 3DEPA 5D65A 3FDTA 4MN3A 5E4WC 2EE1A 5EPKA 2Q8RE 2M2LA 1DZ1A 3P7JA 3TZDA 1F2LA 1LV9A 3GV3A 1HFGA 4IUUA 4XT1B 1AZQA 2MGSA 2RA4A 2KEDA 1A15A 3D6WA 5DNFA 2FINB 1BO0A 4NW2A 3I91A 5CORA 4HAEA 1HRJA 2B2WC 1EOTA 2B2VA 1PDQA 3G7LA 1GUWA 1HHVA 1F9RA 1IL8A 2X6GA 2L4NA 2RSOA 1G6ZA 2B2YC 2HCIA 1RHPA 1DOKA 2L1BA 2B2UA 1KNEA 1HUMA 1X3PA 1PFBA 2RSNA 1G2SA 1U4MA 2KECA 2D9UA 2IL8A 2NYZD 2DY8A 3F2UA 2K01A 3H91A 3LWEA 3SVMA 1CM9A 2HDLA 3I8ZA 5EKIA 1IKMA 1IKLA 1JICA 1HFNA 1F9PA 4X3KA 1ICWA 1M8AA 3UI2A 1U4LA 1DOLA 1J9OA 1WTVA 3N52A 2R3ZA 1S4ZA 2J7ZA 5EPLA 3ONAB 1WTWA 4U68A 1PFMA 2CVRA 5JJZA 2X6LA 4OIJA 1EIHA 4XT3B 5D14A 2DY7A 4MHEA 1SAPA 1CA6A 1B4OA 2FMMA 1F9QA 2KOLA 4XDXA 5CMDA 4HSVA 4ZLTF 2FHTA 2MPMA 3KBXA 2X69A 4RWSC 4ZKBB 1E0BA 1RTNA 2HUGA 1EIGA 2L12A 4IUTA 1NR4A 2B2TC 3MTSA 1WTXA 2SDFA 4IUQA 4QUCA 4QUFA 4X3SA 2H1EA 1WTOA 4LMQD 1MI2A 1RTOA 5COYA 2FJ2A 4CJ2C 1AP0A 1B53A 1J8IA 1NR2A 1XX8A 2K05A 1BNZA 4HCSA 2K03A 1O7ZA 4IUVA 4X3TA 1SSOA 4CJ0B 4R8IA 1G91A 1XYIA 1PFNA 5EQ0A 1SDFA 2NZ1D 3QO2A 1X3QA 2VXWA 2N88A 1U4RA 3I3CA 1QNKA 2B2VC 3FPUB 2NWGA 2Q8TA 1BF4A 3Q6SA 4X3UA 2K28A 5T1GA 2N55A 2MP1A 2B2UC 1JE4A 1NAPA 3HP3A 3I90A 5EPJA 4ZAIA 3R93A 1G2TA 1QE6A 2B2WA 1MGSA 1MSGA 3GV6A 5EJWA 1WD1A 1B50A 3MWYW 5T1IA 1DONA 1HA6A 1KNAA 1X32A 1Q3LA 1TVXA 2B2YA 1WTRA 2K1BA 3TN2A 4ZKCB 2FFKB 2KVMA 4RAUC 2JYOA 1WVLA 3DM1A 2KEEA 4RA8A 1EQTA 2JP1A 4CJ1B 1O80A 3DEOA 5AFWA 1AZPA 1BBXC 1NCVA 1VMCA 1DOMA 2MJ8A
chains in the Genus database with same CATH superfamily
3W1GA 3BU2A 1VS0A 1VMPA 1TWAB 1CHPD 3FHWA 2ZJPA 2KA7A 5C4JB 4L5TA 5IIFA 5CGKA 5M3FG 4I7ZC 1DJRD 2EPBA 1Y14B 5FK9C 5M3MH 2TMPA 4CKEA 4JI0Q 4YY3Q 3S2DB 1EU4A 4CHTB 1KIXA 4A3DH 4A3LH 1TWGH 1PH8A 2LXKA 3KF8A 4K0KQ 5J22A 5C0XH 4DV7L 2R93H 5CV5A 5E7NA 2NN6H 2PNRC 2NVTH 2HD3A 4HTHA 2OWOA 1S5FD 3KDFA 3ITPA 4P75A 4LF7L 1EY6A 3HG9A 2R7ZH 3HOVH 4Z9CB 2JEAI 3A0JA 1Z47A 4PQXA 2HHHL 4JYAQ 2RSNA 4NP5A 1X3PA 3LWEA 2D9UA 2IL8A 4R8NA 5GADC 4RCOA 4QF4A 3E0EA 1Y1WB 3A8KE 3C46A 2AQ1B 5KIXA 1WYDA 1I50H 4CDCC 4IPGA 2BA1A 3CQZH 2FMMA 2IPKD 1N34Q 5KYLA 1F2YA 5IGGA 2CH4A 1NR4A 5JPMC 5I4DA 4LMQD 3PUXA 4HJ8A 1PMRA 3F2BA 1XNRQ 5M3MG 1K0RA 1M1KC 4IUVA 3H94A 3EBEA 2EYOA 1L1OA 3KF6A 2JA7B 5C4XH 1UWVA 2R6GA 1EIFA 2UUBL 2VUMH 2VQEL 1EY7A 2NUCA 1YITA 3QG1A 2MUYA 5CC4A 1QVFA 2ENBA 3AFPA 2JA5H 1UE1A 1SLJA 4BA1I 1HA6A 2KBNA 3DHQA 2B2YA 1UEBA 4DV5Q 2B39A 1HR0W 4Y7NH 1FVIA 1QB5D 3HOVG 1SYDA 1BBWA 4OXPA 3CAMA 1VMCA 1VQHA 3I4MB 1KC8C 3HKZB 2NVQH 4A3CG 1V43A 3DUZA 1RJTA 2EY2A 2L15A 2WKCA 4JI7L 4AIMA 3BVMA 1E2VA 4DAVA 3F8TA 4LF6Q 3VR3A 5C6AA 1F2MA 2OXPA 2MO1A 1AE2A 3RLFA 1XPUA 1AEXA 1LTID 2C9OA 3D6CA 2F0NA 5EPKA 3U58A 4A3DB 3EN2A 1TWGB 3RMHA 1Q12A 4BBSH 5EAYA 4H44C 1HFGA 4X65Q 4DA2A 3STBC 4CDFC 4LFCQ 5ELDA 1S5BD 5CORA 5IYCG 1LTBD 1Q46A 4HAEA 2R93B 1CTMA 1U5KA 3G7LA 2DNCA 1PFSA 2YYZA 4UHVA 5C4XG 1ZEQX 4CBVA 2UU9L 5BN5A 2NYZD 3W2DA 4BY1H 2R7ZB 1F9PA 4X3KA 4IOCA 4JCVE 3MFYA 4DUZQ 1JQYD 4HCEA 1SNPA 2F0QA 3H0GB 2IWHA 1C4QA 1KD1C 5IWAQ 3RN2A 4JOIC 1F9QA 2F0VA 1H95A 2HIVA 1B8AA 3CQZB 1E0BA 3SXHA 3H6MA 3M4OH 3K6OA 3AQQA 5M5WH 4AH6A 2F0GA 4QUFA 1IBML 1YNNC 2GVAA 5L37A 1X3FA 2DGYA 2F0SA 2E2DC 2L5TA 1LACA 5C5LA 2CQOA 4KV6A 1EZ6A 2NZ1D 1TY2A 1H9KA 2A74C 5C0XI 4MNOA 4PNYA 1CKOA 2F52A 4PZ8A 1II3A 5BN3A 3J80c 1BXTA 1TWCH 3AMUA 3CMAA 3TRZA 4GN5A 4OEMB 3E0JA 1XNQL 2VUMB 2OCEA 4YCVA 1DXMA 5IGCA 3MWYW 1Q1EA 1NMFA 3CCJA 2PMZB 1S5ED 2KVMA 3D4RA 2JA5B 2EJMA 3GTMH 4B08A 4IO9A 3HOUG 3S1MH 1AZPA 1B70B 2O2LD 4JK1C 1SFOH 4Y7NB 3PIOA 3S1RH 4BY1G 3UDIA 1F9SA 4F8MA 1L0WA 3HOYH 4IURA 2SEBD 2NBFA 1JJGA 2EOTA 1D6EC 2K5HA 4O0AA 1GVPA 5DM63 4NB3A 2ID0A 2OTLA 1C0AA 1XTCD 4DU9A 5JOBA 4JBWA 5JPNC 1XTDA 1B3AA 3MEFA 1BUVT 1UEAB 4J15A 1YI2A 1PTOB 2AHOB 2MQHA 4QIWE 1MBYA 2EIFA 2KJXA 1K28A 1PRTF 4DV7Q 5LL6X 2ZTCA 2WAQB 5BR8L 1IHZA 5ELNA 3I72A 5K5PA 3X3NA 4LF4Q 1BO0A 4BBSB 4DR4L 5FOBB 4LF7Q 2O5IC 3QOJA 4AYBE 1GUWA 2YV5A 3AYHB 1CT1D 1IL8A 1KLUD 4GOPB 2HHHQ 1SYGA 4JG2A 5KNBA 3KF8B 3PUWA 2EY5A 5IODA 1ICWA 1M8AA 3PO2H 1U4LA 1BDOA 1DOLA 1LT3D 1EYDA 1J9OA 1EWIA 1A2UA 5ISRA 1I6HH 2RHSB 4JC0A 1YVCA 2BH2A 2K5VA 5IYDH 3I70A 4GKJL 4PG3A 4JW0A 5JJZA 3J7ZC 4DK6C 2F0TA 4B3ML 5CMDA 4FDBA 4B3SL 3E3XA 3ND9A 1UNSA 3KBXA 4Q5VA 1VQ9A 3J81c 4GN3B 4DR6Q 4QUCA 1A8VA 2JEBI 5GROA 4M8AA 1JMCA 3T13A 1N33L 3M4OB 4HSPA 4HCSA 1Y8OB 1GJXA 4IFDH 3C1FA 1PH6A 2UUBQ 3FPUB 2UUAL 1NE3A 2VQEQ 1A3UA 1I3QH 2I5LX 3S1NH 2KHSA 4R1JA 1M90C 2B2UC 4ZUJA 1LTLA 3I90A 4ZAIA 2RHQB 3S15H 2I5MX 3GV6A 4PV1C 3TP8A 1KQSA 2LXJA 1TVXA 5I2XA 3QOLA 3NTHA 1EY0A 3GTLH 2JA6H 1EZ8A 2N3SA 1HZ9A 5IYBH 4XQJA 2Q2UA 1SNCA 3GTMB 1EY9A 3FEWX 1WCMB 2SOBA 4B3RQ 1SFOB 3L0OA 4ZRZA 4HR7B 5FO9B 2VS1A 5IYDG 3HOYB 1KAWA 3KLWA 1PLFA 4DPGA 3CC2A 1Z9FA 1ML0D 1MJEA 1X54A 3S2HH 4YHHQ 2E2IH 1ENAA 5IT9L 4OHJA 2M2LA 1I4RA 3NELA 5KRUA 4C2MH 3BDCA 5LHY1 1EOVA 3BDOA 5M5XH 2HT1A 1AE3A 2CHBD 1A15A 3RUZA 4LUOA 2F0PA 4A3MG 1EWCA 4A3JG 1HZAA 1ZKOA 3IKJA 3DLLA 1HTLD 3PIP3 1RHPA 3VR4A 3MFGA 2UU9Q 2XWBB 1PYSB 1CM9A 1IKLA 4QCLA 2F0OA 4F88A 1PRTC 1QWYA 1SEBD 3J7AV 3ULPA 2CFMA 1WTVA 4A4IA 1S4ZA 3CU7A 3PO2B 1SXTA 1SYBA 5CV7A 5HGTA 2JJQA 1I6HB 2DJGC 4IPCA 1X3EA 4P2CB 2FHTA 1NMGA 4ZKBB 4A76A 2L12A 4A93B 2LSSA 1UE6A 1EEFD 4DV6Q 1EQQA 4QL5A 2F4VL 2VZAA 4C1NI 3AFQA 2EY6A 1CFMA 2K05A 2EYHA 4DNTB 4QJFA 3OW7A 4H13C 2L0CA 1G51A 4BY7G 1CQFA 3VR5A 3T4AC 1KABA 2QF7A 4UPAA 5E1FA 5KNDA 4MIUA 1OXXK 4X3UA 1PH7A 2EYLA 3E6ZX 5TSSA 2NB0A 2Z6KC 5I9OA 1XNQQ 1Y69U 3WWVA 3OMGA 2PW5A 1I3QB 1S3OA 3S1NB 2E5LL 5T1IA 1MD2D 1E2ZA 3E9HA 1MIUA 1P16A 2CKZB 3S15B 4DNIA 1V8QA 1VDZA 1WVLA 1RF2D 3GP7A 1YJ9A 3VYSA 3SDZA 5HGQA 1X56A 1TT2A 4IJHA 4P74A 2RF4A 1JC7A 2QW7A 5IE8A 5LMNW 1W2BA 3JAMi 1KXLA 2PZUA 4P72A 3CW2C 3QIAA 2QCPX 4X64L 4UAIA 2JSOA 1RODA 1VQAA 4B9WA 1C7YA 4FXDA 2VB3X 1XPRA 1N9WA 2K50A 1GD7A 1EY5A 2D0OA 4DR5L 2A5HA 3T1HQ 2F0LA 4JI4L 3S2HB 1NSNS 1STGA 2E2IB 4IUUA 1AZQA 2MGSA 1N36Q 3LGJA 4NMZA 2OF1A 1YIJA 2FINB 4Q0FA 5JAVA 1HR0L 2WB1B 2ES2A 1H9SB 2CH4W 3CCUA 4IFDI 4YWLA 3MVVA 3CCRA 3MXPA 3ER0A 3HRZC 3LNNA 4DR7L 5C3XA 2B2UA 1VQIA 5KGUA 2PQAA 1ICFB 4I7AA 1QILA 1CQVA 4C3JB 4HJ9A 3RD4A 3CC7A 4DXFA 1NJIC 1ENCA 4YCUA 2YTXA 1TS3A 4A3FH 1A3TA 4KHPL 3DWAA 4LF5L 1L1OC 4QMGA 2C35B 3BG3A 1HJPA 2AUKA 5IP9H 2R92B 2J4XA 4K8IA 3M7NA 1E2WA 4B3MQ 2KOLA 4B3SQ 3Q0AA 4L6TB 3G48A 4Y52H 2AUJD 3EA6A 4J8QA 1UE5A 4QIWB 2B2TC 3I4OA 2D2CC 2A69C 1N33Q 1R4PB 1CKMA 2A73B 2VB2X 4JI2L 3N6RA 3HOXG 3GTOH 2V4DA 4ID6A 5IGDA 2A6HC 1A6XA 3QO2A 1B44D 2LY7A 2WACA 2PMZE 3NBHA 4C3IG 2E75C 2PZWA 5T1GA 2E2JB 3CCSA 1STHA 4OO1G 1B50A 2XTIA 1X32A 1L2FA 3GTPH 2YTVA 4NXNL 1XMOL 3GD7A 3NUCA 4RAUC 3CRLC 2JYOA 2N49A 4GS3A 1HNWL 3DM1A 1D5MC 4ABNA 4V190 1DOMA 3CD6A 1V9PA 4E6IA 1PH2A 1E1TA 2XWJB 1CKNB 4DNRB 4JV5L 2K6AA 1Q81C 1KDCA 2PCFB 1C8CA 2WAQE 4KJOA 1K3RA 1FD7D 1ILPA 2EJGC 3EQLC 2RCNA 5GAEC 1WI5A 4KI0A 5JVH3 1S40A 5A2QE 4A3EG 2A69D 3E5SA 1DM0B 4BBRG 2F03A 4R4CA 4BWGB 4JI1L 1VQBA 4TVAB 2A6HD 1EOTA 1PH4A 1IYVA 1JORA 3J7A5 3C3LA 1G6ZA 2HCIA 1WTWA 2Z6KA 4J6HA 2JA8B 2UXBL 4DV3L 2MHVA 4A3IG 2J7ZA 3URYA 4DFAA 4LF9L 3BZKA 2QGQA 3KYHC 4A3FB 4XT3B 4X66Q 3AEVA 4EQNA 3CCVA 3A5ZB 4XDXA 1YNXA 3T1YL 5ELEA 5ELCA 2WKDA 2KCMA 4DXGA 2F4VQ 2Z9HA 4QB4A 4A3CH 1D7QA 4JI5Q 1NR2A 1PFNA 2PPBC 4EX5A 2VXWA 3EIVA 3OHXC 2NWGA 2OTJA 2GA4B 4EQPA 5M3FB 4R4OA 2E2HB 3HP3A 1MSGA 4IUNA 4NDXA 2NZOA 1KDAA 1PH3A 1Q8KA 3CKIB 3J80i 2K14A 5AFWA 5IYCH 3GTPB 5DM73 5CV9A 4UY8C 4MTKA 3NXWA 3SGIA 4DGZA 3V96A 3FP9A 3KUPA 1HQRD 5CV6A 3GTQB 3VA7A 3RLNA 1HUNA 1CSPA 4X64Q 2ALYB 3NQTA 3ND8A 4K6LA 2IX1A 3OIQA 1FNWA 3K8AA 2B2TA 4GNXC 4LAAA 5EKKA 1D2BA 3S24A 1X55A 4JI4Q 3GV3A 3NPPA 1S72A 3MXNB 4GKKL 4ILWA 4KN4C 1BVSA 2ZXPA 5DNFA 1CZWA 1M4VA 1E24A 1ET9A 2JXMB 4DV4L 1VQPA 1JR0D 1SJED 3C2PA 3TDQA 1XMQL 1PH5A 1G2SA 4JBKA 4JI3Q 1STBA 5FJ8G 5M3MB 3UI2A 1F77A 1RIPA 3HOZG 5IT9E 3TS2A 4R4TA 3VYTA 4LUVA 4GN4B 2OEOA 1OO9B 4OIJA 4MHEA 2OT2A 1RKNA 2RDFA 4IN3A 2QA4A 1B4OA 3SK6A 2MPMA 2F0WA 2B3GA 4RWSC 3AB9A 5DLQE 1J6QA 1RTNA 1EIGA 1H9RA 4FVMA 1EFWA 3HOUH 4LWCA 1TXYA 2NVTB 3PIO3 1OTCA 1H9JA 2CW0C 2FJ2A 3HOVB 2MO0A 3CXCA 4WORA 2ZJRA 4X3TA 2CQAA 5JVG3 1SDFA 3RZDH 2UXCQ 1LTAD 1I4XA 3J81i 2B63H 1N32L 2F0IA 2K28A 1BCPD 2AQ2B 2F0KA 4LF8L 1QUQA 1I50B 3WDNA 3FKIH 4JBJA 1WTHA 2XNAC 3CCLA 3KFUA 4YWMA 1TS4A 3NEMA 2ICIA 1D1KA 4NXNQ 3BZCA 4ZQ3A 2M00A 2A6EC 4IPHA 2Z8LA 1STNA 4PZ6A 2VQFQ 3FMCA 1U4PA 2D0PA 4YCWA 4FP5D 5EBDA 2IT1A 1TWFH 5C44G 2HDMA 2L9HA 3I4LA 4JV5Q 3T51B 1YHQA 2J0TD 4RGNA 1IBLL 1QZHA 3ULJA 4LJZC 5C4XB 2XSCA 4ZK9B 3D8GA 2GN5A 4RHSA 3K5LA 3I55A 3IFDA 2I5HA 1EQRA 1JOOA 3K5OA 2LKVA 1T5EA 2WB1E 3J81L 3GTGH 1NTGA 2GVBA 3FDTA 1PRTB 2EDGA 1GUNA 4BXXG 2ASBA 5A2QL 1IBKL 2BCOA 5G3LD 2CW0D 3DWPA 3Q8DA 4AQYL 2ZJQA 1FL0A 1V1OA 4JI1Q 2A1AA 3I91A 3PO3H 1X9NA 4L5QA 2NVQB 2Y0SG 4IFDJ 1A62A 1EWHA 1Q7YC 1AH9A 2B63G 2DY8A 2E74C 3M9BA 5LMNL 4DV3Q 1WFQA 2UXBQ 3BVZA 1E1OA 1JICA 3M85A 1XXGA 3FKIG 5C3EH 3OWFA 4DAPA 1XJVA 5C4HA 1IW7D 4LF9Q 1I94L 2A6ED 2CCZA 1LT6D 3UDFA 2F0UA 2K5QA 3KBGA 2F1MA 4HSVA 1PXUA 3T1YQ 1V1PA 3NP8A 2Z1CA 1B9MA 2Z4HA 1ZYRD 2Q2HA 4FF3A 1GOZA 1SE8A 1RTOA 2XRQD 4CKCA 1KTKA 3JAME 4GNXA 1HTPA 5EQ0A 4BY1B 1PHJA 2R61A 2KHIA 1Z7TA 3OWEB 4L8JA 3KDFB 4RGTA 4TKOB 3A5UA 1VQ4A 1B7YB 4YIJA 1LTTD 4C3HG 2ZXRA 3I56A 1H9MA 3RN5A 4K2KA 5FLXc 4L5RC 3PO3G 1G291 3RLOA 1O78A 3ICEA 3OSOA 5IP7G 5M5WB 5ELBA 1ONLA 4A3MH 2F3VA 2EYFA 1ILQA 1ESRA 4RFBA 1WJJA 4OONA 4A3JH 4WJWA 2EVBA 2I46A 4DK0A 4KJNA 3KLSX 2EYJA 1MHWC 1WTPA 1Y1VG 3BZDB 5C3EG 1PH1A 3OIPA 3TP6A 2N78A 4FXKC 3FPPA 1J5EL 3EROA 3TEHB 2K75A 5AJ3L 3K0XA 1TWCB 1QOHA 2F0EA 1WTQA 3CHBD 4G4KA 5FLMG 3DM3A 1SBBB 2OQKA 3TZDA 1UAPA 2I0QA 2B8GA 1L1OB 2BA0A 3KF6B 4X62L 1EYAA 1LTGD 4LFAL 4GKKQ 5IGBA 4JPBW 1VQ5A 1NY4A 2WFWA 3S1MB 3A55A 4POFA 3U9SA 1O7LA 1FJGL 3S1RB 3K5MA 4JI7Q 2F0MA 4DV4Q 1VQDA 4QY7A 4XYOA 5I6WA 1XMQQ 3I2ZA 2K01A 3D0FA 2CWPA 4KD4A 2O5JC 4BY7H 4HIMA 3S17H 5GQOA 3Q22A 4UP8A 3N52A 2G9HD 3HS0C 4HJ7A 4U68A 4DV0L 1YZ6A 4HJ5A 1JCKB 3CP0A 2QEJC 1SMXA 1QJOA 3EJIA 2JQOA 1LLRD 5LL6S 4DV1L 4A3BG 1QNUA 3CPFA 4H02A 3SHLA 1VQKA 2H1EA 1SNDA 4DR3L 4FXGC 4CJ2C 3VA5A 1ET6A 3S16H 3GTJH 1LUZA 1EY8A 3DXJC 2K03A 2Z6BA 2KHJA 3G6EA 1SROA 1K9MC 1N32Q 4HIDA 4PMBA 1I5FA 4DF7A 2ATWA 3PGZA 4LF8Q 4JI0L 2XN9C 2B8FA 1BKBA 2RKSA 3U4ZA 1SJHD 4J1MA 1IBMQ 4A3GG 3R8BA 1JB3A 4ZKCB 4K0KL 4JVZA 4RCNA 1JT8A 5JJKA 1NCVA 4H0LC 3L2PA 3Q24A 4DUYL 3R3OA 1IYJB 2HCCA 3HOWG 1TWHH 4A75A 1NUCA 4A3MB 4A3JB 2K4KA 1CA5A 1B2TA 5CBEE 4JYAL 4K5WA 1FGUA 2C5CA 1QG7A 1MSHA 4R9WA 3IL8A 2CWAA 1PTOC 1EL0A 2BDNA 4PMWA 2F0HA 1R9TH 1EFID 3TZUA 4G7HC 4L63B 1IBKQ 3LWUA 1VQ6A 2BOSA 4B9XA 3GTLB 2JA6B 4WJ4A 2A68D 1IZ6A 4OL7A 4EGVA 3KJOA 1ASYA 4HIOA 3V05A 4GLXA 2WP8J 3HZXA 1BOSA 1F9RA 2X6GA 1JWSD 1XWEA 1D5XC 3HOXH 4A3KG 1FNUA 1KAAA 5IOCA 5LMNQ 1RD9D 2HDLA 3I8ZA 1JE5A 1OXTA 2VW9A 3K81C 4C3IH 3K57A 4DAMA 2KCNA 2UXDL 3MZ5A 4BY7B 4OX9L 5EPLA 4F7XA 4KHZA 3S17B 3MEHA 1EIHA 4TQUS 5BR8Q 4OO1H 4KMUC 3M7GA 4C2MB 4DR4Q 2PI2A 5M5XB 1GHJA 2FMCA 2JN4A 4LK1C 1D5ZC 2I07B 3J80E 4X3SA 4K8JA 1MI2A 1PYBA 1W6KA 1EIYB 2K5WA 3JAML 3GO5A 1J8IA 1TWAH 3T56B 1T5XD 5CYUA 2A19A 3CMEA 4AYBG 2ZXOA 3I4NG 1XYIA 5JJLA 4IALA 1PTOD 1STYA 1Q90A 3S16B 3OPOA 4GKJQ 4KY7A 1W3SA 3RNUA 1OXVA 2N55A 3KJPA 1V1PB 2EJFC 1JE4A 1KHIA 4DR2L 1G2TA 3RR5A 1X6OA 3QR8A 4LF6L 1WD1A 4RHRA 3M3YH 2G5DA 4A3EH 4K2LA 1NNXA 3BS1A 1LABA 4BBRH 2F3IA 2K7VA 3M4YA 3MA2B 1VQNA 2E8GA 1GXDC 1CZGA 4B3TL 4OWWB 4LFCL 2L11A 2SNSA 3Q23A 3CRKC 1PVOA 5KEEA 2UUAQ 1WD0A 4HEDA 2N8NA 4A3IH 3UDXA 1Y1WH 1TWHB 2WV6D 1CK1A 1SR3A 3CPWA 2PYKA 5CBAE 3K80C 2NVXH 1JJCB 2JK8A 4DUZL 2MFIA 1SN8A 1QVCA 3L9AX 1YBYA 1EYCA 4KKSA 5JEAG 1K8GA 3NENA 3IFTA 4RG1A 3T53B 4DK3C 3K5NA 1HNZL 1FJGQ 5K36H 2XRSD 1SNOA 3NWSA 3WOEA 4IUQA 1HUMA 1FGBD 1YJNA 3RZOH 2KECA 2JA8G 1IL2A 5EKIA 1K8OA 2K33A 3J81E 1XPOA 4DR1L 2R3ZA 4TRDA 2MNAA 3PMFA 3QB3A 4K6DA 4CDDC 1SAPA 2QILA 1RDPD 3IAYA 3PSIA 2HQLA 3FRPB 4PMCA 3X3MA 2L55A 4KN7C 4DAYA 3TMEA 3MTSA 3CCMA 5DEHA 1NBWA 4DR3Q 1QCBD 5COYA 1WOCA 2EXZA 5D3DA 4M1UB 1Y1WG 1G91A 3P20A 1X3QA 3MAQA 4G7ZC 4FYDA 1STAA 4IPDA 1QNKA 1B3QA 1JOKA 3NWTA 2B2VC 4WFN3 1GUTA 2PNHA 3R93A 4QQBX 5EPJA 4V0BA 1VQCA 3PUZA 3S9WA 4GOPA 2QDLA 2EYMA 1K8AC 4ODGA 3A54A 4UP7A 3TN2A 4DV2L 5K36G 4LNQA 1TKWB 1V1QA 3HKSA 3M3YB 2Z0SA 2JP1A 2WIIB 1IXRA 2B29A 4A3EB 2AQ3B 3K7UC 3TP5A 3VYRA 4BBRB 1VQFA 2JA7G 4DUYQ 4LF4L 1ZXTA 4EQ5A 1YJWA 2Q2TA 3GTOB 1TR5A 5FJ8H 3J7AF 4OO1I 1EUJA 1GHKA 4POGA 2KUMA 4KKUA 3G6JB 3HOZH 2E5LQ 2K04A 4IZ8A 4A3IB 4ZUIA 2KCTA 3H0GH 1GO3E 3C1EA 2EE1A 3ERSX 3H3VI 5J1ZA 1YEZA 2DNEA 2NZHA 4FNFA 2BE5D 1A3VA 4XQNA 3CC4A 3I4MG 2NVXB 3HKZG 3IRBA 4GZYC 1HRJA 3NK9A 1SYFA 1PDQA 5IGFA 3A8IE 2K32A 1JWUD 4DR6L 4RKBA 1W6JA 3ZYYX 4KY6A 3SVMA 1IKMA 2ZTDA 4OWTB 5NUCA 3PF5A 1LT4D 1C9OA 3RZOB 4LFBL 4A3LG 4A3DG 2UXDQ 1AFPA 1BCPC 4DR5Q 4OX9Q 5BN4A 2KQ3A 1VQEA 3A7LA 3LX0A 3J7YW 5I6YA 5D14A 5C0XG 1GUGA 1VQJA 4KD3A 1OXUA 1HR0Q 4G57A 1X3GA 1R4QB 2R93G 1TQOA 5EBCA 3D3RA 3VYUA 2F3WA 2X69A 2NN6G 3J80L 2QEXA 4DR7Q 3TBIB 1SE2A 4LW1A 3VR2A 2RCFA 4KHVA 4ULLA 2R7ZG 3DMUA 1B53A 3TQYA 5C44H 4BA2I 3OYYA 4KHPQ 1S5CD 1SSOA 4LF5Q 1HCZA 2R7FA 1YHAA 4KKTA 3BYTB 1STEA 1K3BC 3H0GG 4IJLA 3ULLA 1Q82C 1Q1BA 5I9PA 4B3RL 2P5ZX 3CF5A 2IHFA 2MP1A 3R2TA 4DR2Q 4WRDA 1KDBA 1PTOH 1C48A 1RL2A 4BXXH 1A63A 2PQAB 5GAGC 3ERQA 4YHHL 3PV0A 4JI2Q 1EQTA 4CJ1B 2AKWB 2LS01 2ZT9C 1BBXC 4XQQA 4B3TQ 3A74A 1DD2A 2DUDA 3SE0A 4OIKA 1D8LA 3BJUA 4DN4M 1JB7A 3L7ZC 1KRSA 1AN8A 5J3BA 4R4IA 2VUMG 3PQIA 1KLGD 2OQ0A 1L0XB 1K83H 2IW3A 1IW7C 1XMOQ 2JA5G 2Q8RE 2XVSA 3HOZB 4UP9A 3H3VC 1HNWQ 1DZ1A 2EXDA 2PQEA 4GLAC 4I65A 3NBHB 3TSSA 4IOAA 3OMCA 2ICEC 4IQZA 4NW2A 1ZYRC 2M9VA 1DYQA 1LTSD 2B2VA 1HNZQ 4JI8L 4RKLA 1Z6HA 2VY3A 1DOKA 3PCOB 2WINB 3F2UA 3H91A 1RCVD 4DV6L 2PO4A 1KRTA 4DK1A 4NPSA 5FLXL 4XIGS 2UUCL 3TREA 5FO8B 3OTOL 3K0YA 4DR1Q 1UE7A 3D4WA 2WAQG 1PZJD 4C3HH 2DY7A 3U4VA 5EGTA 4BBSG 2NN6I 4ZLTF 3STBD 1MJCA 3L3OC 1GUOA 5A35A 4O2DA 2RBMA 4LUZA 5IP7H 4EVOA 1O7IA 3NHHA 1I4PA 2JA9A 1WTOA 4NXML 3QWNA 2TSSA 1AP0A 1SNMA 1WCMH 1SYEA 1Y1VH 2VNUD 1O7ZA 3SR1A 3SK8A 4BS9A 5FO7B 3OW2A 3I3CA 4HMJA 5C44B 3B6YA 1FNVA 2PZTA 3S1QH 1ENFA 1H9SA 1NAPA 4DAYB 5EKLA 5FLMH 1LT5D 2F4IA 1VQ7A 5JJIA 2NTSA 4KK7A 1HZCA 4JI6L 3S14H 3BDLA 4DV2Q 5LMUL 1K73C 2FFKB 4ALPA 3HOUB 2KENA 4RA8A 2AWOA 3DEOA 3T1HL 4EQOA 3EFXD 1YNND 1PZKD 1SNQA 2YU9H 1N36L 1DGSA 1CI3M 3T16A 3NBIA 4GLVB 4HJAA 1JWMD 5C5MA 3NSWA 3W1BA 4L5SA 3NE5B 1PZID 3P1HA 3RZDB 2RVLA 3MC0B 5M9OA 1Q8IA 2Y0SB 1DCZA 2RDHA 3FVQA 2B63B 1VQLA 1YHBA 4YWKA 3CCEA 4RMFA 5E4WC 4CGYB 3FKIB 3ZJYC 4U673 1ASZA 3SK4A 4C56C 4P71A 3P7JA 1K83B 1PTOF 4KTAA 1VF7A 4O1NA 4XXEA 2RA4A 5H1SE 2KEDA 5M5YH 1PV4A 3KOJA 4A3BH 4F87A 4A93H 1WCMG 1HNXL 3U9OA 1AW7A 2B2WC 3SK5A 2K5NA 2RSOA 3HOYG 4FF4A 1TWFB 1N8RC 2KCCA 3MXGA 3HEJA 2Q2IA 3K58A 3K59A 5CV4A 2K5DA 3GDEA 4LFBQ 3H09A 3PUYA 3GTGB 3ONAB 2CVRA 1SE3A 2X6LA 3OOCA 2E76C 4FF1A 1UUPA 2ZTEA 3PUVA 4N8X1 1VQMA 3QJYA 1CKNA 2IY5B 2F0DA 4A3GH 2F0JA 4C3HB 4PZ7A 3JC66 3PO3B 2SDFA 1I6VC 3A7AB 1VF5C 1A2TA 1EYGA 3HFZB 1XX8A 1BNZA 3HOWH 3KK7A 4R8IA 2BH8A 1TS2A 2N88A 1U4RA 3MHBA 1GKHA 1LO5D 3I7FA 3PO2G 1U0LA 1Y1VB 4K5XA 5C3EB 3Q6SA 2PW7A 4JOIA 2D62A 2ZM6L 2LFNA 1MGSA 4A93G 1I4HA 3S1QB 1DONA 2G9DA 5KNCA 4N9TA 1E3PA 2KEEA 2A68C 5F2DA 1F2ZA 1ESFA 1O80A 1S5DD 3S14B 2DN8A 2MJ8A 5CR3A 1SYCA 4O42A 4ME5A 3CCQA 1O7YA 1D1IA 1TU2B 4NKLA 4A3KH 4P73A 3KLSA 4OGQC 4C3JH 3A8JE 3P75A 5C4ZA 2YU9B 1OXSC 4IFDG 5E4XA 1HH2P 4YY3L 1E7ZA 2V1CC 2D5DA 2SNMA 3DEPA 3V2TA 4MN3A 2R92H 2AWNA 4OWXB 1TS5A 4KY5A 4XT1B 2EYPA 2JA6G 4X66L 4ZYSA 5JEAJ 1VCIA 3F1ZA 5IYBG 1KL9A 3E9IA 1QUQB 1K0SA 5ELFA 1VQOA 4JI8Q 1HHVA 5M5YB 4A3BB 1IBLQ 2L4NA 1KNEA 2XGTA 1G8ZD 1HZBA 1U4MA 5IGEA 4HMIA 3I4NH 4CDEC 1BBUA 4JI5L 3VDYA 1PA6A 4MZ9A 5HURA 2UUCQ 5HY6A 2FXQA 3OTOQ 3GQBA 1CHQD 2EZVA 1QVGA 2EY1A 2E2JH 1EU3A 1BR9A 1CSQA 2H4OA 3PF4A 2K52A 4QGUA 1GUSA 4AQYQ 4FF2A 1LTRD 3GTKH 4X6AH 2WB1G 3I73A 2AMCB 1HXYD 1N34L 5IY0A 4GOPC 3HKZE 2A8VA 2HUGA 4IUTA 2DJFC 3G71A 3NTKA 4TSSA 3K7AH 3R2IA 1X65A 5CV8A 5IT9c 1WTXA 5C3WA 3NTIA 2IX0A 4A3GB 2PI2E 4NXMQ 3A56A 4C3JG 1BQQT 3U50C 1XNRL 3PIPA 2NVYH 1L0YB 4R4QA 3MXUA 3G4SA 1PRTD 1PYWD 4FO2A 1I94Q 2IHEA 1E22A 4N9PA 3MXNA 2VL6A 2Q8TA 2R92G 3HOWB 3J81j 1PH9A 1QZGA 2B2WA 5EJWA 3O13A 5KYIA 4JI6Q 3H3VH 2K1BA 4DV5L 5LMUQ 2QDBA 2YTYA 5JEAH 4XTCS 3HGBA 4ME3A 1EQVA 3UDGA 3TP7A 5C4JH 2EQSA 1VQGA 1T9HA 5ELOA 1B1ZA 4G7OC 1YNJC 4S3SA 1JJ2A 3GTJB 2RDGA 2XIWA 3S2DH 1SMYC 2JA8H 3D31A 3M4PA 5FKAC 1JOQA 1HA5A 2IJ0A 2H5XA 5DAUA 5E3FA 1IYUA 3WOFA 1I4GA 4IUPA 4A3KB 1HQMC 2HIXA 4APVA 3F2CA 1Y8NB 4UDUC 4JI3L 1GM5A 3EVQA 3W5OA 4JBMA 1I4QA 4N8FA 1SRUA 5D65A 2RQXA 3W3AA 1LM0A 4GNXB 5I2YA 2F0FA 1F2LA 1LV9A 1TIID 1BCPB 4HIKA 4X65L 1G6PA 3D6WA 3BVGA 1HNXQ 4RGOS 4ZCKA 1A0IA 1J5EQ 4OELB 2B2YC 2L1BA 3H15A 1EY4A 4CKBA 1CUKA 4RGMA 1PFBA 5AJ3Q 3D4DA 2QKIC 3DWQA 3TS0A 1Y8PB 3M4QA 1HFNA 1LYLA 4H7BA 1U9RA 4HN7A 2NTTA 2JE6I 4AYBB 3I4NB 5M3FH 2UXCL 1P8LA 2E2HH 1PFMA 4RH6A 4X62Q 5IWAL 1VQ8A 4LFAQ 1R9TB 5C0XJ 1SE4A 1CA6A 1BCPF 2Z4IA 3SEBA 1Q86C 1YNJD 4K5VA 3UE0A 4C1NK 3GTKB 2IX3A 5GAHC 1SMYD 1TY0A 4XYQA 4DKAC 1FR3A 2BDOA 1HPCA 3NQIA 2JA7H 3K7AB 3F2DA 2VQFL 2LMCB 2Q8IB 3HOXB 4KLKA 5FLXE 4CJ0B 3GTQH 3KLRA 4MTNA 2HQEA 4DV0Q 4C3IB 4A3FG 3AU7A 1BF4A 2NVYB 4K14A 5D3IB 2O4XA 2ZM6Q 5IP9G 2R7DA 1B9NA 1QE6A 4DV1Q 3VR6A 3JAMc 1MKHA 1KNAA 1Q3LA 1WTRA 4WJ3M 3I4MH 5J39A 1EEID 1K8MA 2BE5C 3BYYB 2Y0SE 5G3LF 3UE1A 1FYCA
chains in the Genus database with same CATH topology
1VMPA 1TWAB 1CHPD 2KA7A 5C4JB 5IIFA 5CGKA 4I7ZC 1DJRD 2EPBA 5FK9C 2TMPA 4CKEA 3S2DB 1EU4A 4CHTB 3KF8A 5J22A 5C0XH 5CV5A 2NN6H 2PNRC 4HTHA 1S5FD 3ITPA 1EY6A 3HG9A 4Z9CB 2JEAI 1Z47A 4PQXA 2RSNA 4NP5A 1X3PA 3LWEA 2D9UA 2IL8A 4R8NA 4RCOA 4QF4A 1Y1WB 3A8KE 3C46A 2AQ1B 5KIXA 2BA1A 2FMMA 2IPKD 5KYLA 1F2YA 5IGGA 1NR4A 5JPMC 5I4DA 4LMQD 3PUXA 1PMRA 4IUVA 3H94A 2EYOA 2JA7B 2R6GA 1EY7A 2NUCA 3QG1A 2MUYA 5CC4A 2ENBA 4BA1I 1HA6A 3DHQA 2B2YA 2B39A 1QB5D 1SYDA 1VMCA 3I4MB 3HKZB 1V43A 3DUZA 1RJTA 2EY2A 2WKCA 3BVMA 1E2VA 4DAVA 3VR3A 5C6AA 1F2MA 2OXPA 3RLFA 1AEXA 1LTID 2C9OA 3D6CA 2F0NA 5EPKA 4A3DB 1TWGB 3RMHA 1Q12A 4H44C 1HFGA 4DA2A 5ELDA 1S5BD 5CORA 1LTBD 4HAEA 2R93B 1CTMA 3G7LA 2DNCA 2YYZA 1ZEQX 4CBVA 5BN5A 2NYZD 3W2DA 2R7ZB 1F9PA 4X3KA 3MFYA 1JQYD 4HCEA 1SNPA 2F0QA 3H0GB 2IWHA 1C4QA 1F9QA 2F0VA 3CQZB 1E0BA 3SXHA 3H6MA 3K6OA 2F0GA 4QUFA 1YNNC 2F0SA 2E2DC 2L5TA 1LACA 5C5LA 4KV6A 1EZ6A 2NZ1D 1TY2A 1H9KA 2A74C 5C0XI 4PNYA 1II3A 5BN3A 1BXTA 3AMUA 3E0JA 2VUMB 1DXMA 5IGCA 3MWYW 1Q1EA 2PMZB 1S5ED 2KVMA 3D4RA 2JA5B 2EJMA 4B08A 1AZPA 2O2LD 4JK1C 4Y7NB 1F9SA 4F8MA 4IURA 2SEBD 2NBFA 2EOTA 1D6EC 5DM63 2ID0A 1XTCD 4DU9A 5JOBA 4JBWA 5JPNC 1B3AA 1BUVT 1UEAB 1PTOB 1MBYA 2KJXA 1PRTF 5LL6X 2WAQB 1IHZA 3I72A 5K5PA 3X3NA 1BO0A 4BBSB 5FOBB 2O5IC 3QOJA 1GUWA 1CT1D 1IL8A 1KLUD 1SYGA 5KNBA 3PUWA 2EY5A 5IODA 1ICWA 1M8AA 1U4LA 1BDOA 1DOLA 1LT3D 1EYDA 1J9OA 1A2UA 5ISRA 3I70A 5JJZA 2F0TA 5CMDA 3ND9A 1UNSA 3KBXA 4Q5VA 4QUCA 2JEBI 4M8AA 3T13A 3M4OB 4HSPA 4HCSA 1Y8OB 1GJXA 4IFDH 3C1FA 3FPUB 1A3UA 2KHSA 2B2UC 4ZUJA 3I90A 4ZAIA 3GV6A 4PV1C 3TP8A 1TVXA 5I2XA 3QOLA 3NTHA 1EY0A 1EZ8A 4XQJA 1SNCA 3GTMB 1EY9A 3FEWX 1WCMB 2SOBA 1SFOB 4ZRZA 4HR7B 5FO9B 3HOYB 1PLFA 1ML0D 1ENAA 5IT9L 4OHJA 2M2LA 1I4RA 5KRUA 3BDCA 5LHY1 3BDOA 2CHBD 1A15A 3RUZA 2F0PA 1EWCA 1ZKOA 3IKJA 1HTLD 3PIP3 1RHPA 3VR4A 3MFGA 2XWBB 1CM9A 1IKLA 4QCLA 2F0OA 4F88A 1PRTC 1QWYA 1SEBD 3J7AV 1WTVA 1S4ZA 3CU7A 3PO2B 1SXTA 1SYBA 5CV7A 5HGTA 1I6HB 4P2CB 2FHTA 4ZKBB 2L12A 4A93B 1EEFD 4C1NI 2EY6A 1CFMA 2K05A 2EYHA 4DNTB 3OW7A 4H13C 2L0CA 1CQFA 3VR5A 3T4AC 1KABA 2QF7A 5E1FA 5KNDA 4MIUA 1OXXK 4X3UA 2EYLA 3E6ZX 5TSSA 2NB0A 5I9OA 1Y69U 3OMGA 2PW5A 1I3QB 3S1NB 5T1IA 1MD2D 1E2ZA 3S15B 1V8QA 1VDZA 1WVLA 1RF2D 3GP7A 3VYSA 3SDZA 1TT2A 1JC7A 2PZUA 3QIAA 2QCPX 4UAIA 2JSOA 1RODA 4B9WA 4FXDA 2VB3X 1EY5A 2A5HA 2F0LA 3S2HB 1NSNS 1STGA 2E2IB 4IUUA 1AZQA 2MGSA 4NMZA 2OF1A 2FINB 4Q0FA 5JAVA 2WB1B 1H9SB 4IFDI 3MVVA 3MXPA 3HRZC 3LNNA 5C3XA 2B2UA 5KGUA 1QILA 1CQVA 4C3JB 3RD4A 4DXFA 1ENCA 1TS3A 1A3TA 3DWAA 4QMGA 3BG3A 2AUKA 2R92B 2J4XA 4K8IA 3M7NA 1E2WA 2KOLA 3Q0AA 4L6TB 2AUJD 3EA6A 4J8QA 4QIWB 2B2TC 2D2CC 2A69C 1R4PB 2A73B 2VB2X 3N6RA 2V4DA 4ID6A 5IGDA 2A6HC 1A6XA 3QO2A 1B44D 2LY7A 2WACA 4C3IG 3NBHA 2E75C 2PZWA 5T1GA 2E2JB 1STHA 4OO1G 1B50A 1X32A 3GD7A 3NUCA 4RAUC 3CRLC 2JYOA 3DM1A 1D5MC 4ABNA 4V190 1DOMA 4E6IA 2XWJB 4DNRB 2K6AA 1KDCA 2PCFB 1C8CA 4KJOA 1FD7D 1ILPA 2EJGC 3EQLC 4KI0A 5JVH3 5A2QE 2A69D 3E5SA 1DM0B 2F03A 4BWGB 2A6HD 1EOTA 1IYVA 1JORA 3C3LA 1G6ZA 2HCIA 1WTWA 4J6HA 2JA8B 2MHVA 2J7ZA 3URYA 4DFAA 4A3FB 4XT3B 4EQNA 4XDXA 5ELEA 5ELCA 2WKDA 4DXGA 4QB4A 1NR2A 1PFNA 2PPBC 2VXWA 3OHXC 2NWGA 2GA4B 4EQPA 5M3FB 2E2HB 3HP3A 1MSGA 4IUNA 4NDXA 1KDAA 3CKIB 5AFWA 3GTPB 5DM73 5CV9A 3NXWA 4DGZA 3V96A 3KUPA 1HQRD 5CV6A 3GTQB 3VA7A 1HUNA 3NQTA 3ND8A 4K6LA 2IX1A 3OIQA 1FNWA 2B2TA 4LAAA 5EKKA 1D2BA 3GV3A 3NPPA 4ILWA 4KN4C 2ZXPA 5DNFA 1CZWA 1M4VA 1ET9A 2JXMB 1JR0D 1SJED 3C2PA 3TDQA 1G2SA 1STBA 5M3MB 3UI2A 1F77A 5IT9E 3VYTA 2OEOA 1OO9B 4OIJA 4MHEA 2OT2A 1RKNA 2RDFA 4IN3A 1B4OA 3SK6A 2MPMA 2F0WA 4RWSC 3AB9A 1RTNA 4FVMA 1EIGA 1H9RA 2NVTB 3PIO3 1H9JA 2CW0C 2FJ2A 3HOVB 4WORA 4X3TA 2CQAA 5JVG3 1SDFA 1LTAD 1I4XA 2F0IA 2K28A 1BCPD 2AQ2B 2F0KA 1I50B 3WDNA 2XNAC 1TS4A 2ICIA 1D1KA 4ZQ3A 2M00A 2A6EC 2Z8LA 1STNA 3FMCA 1U4PA 4FP5D 5EBDA 2IT1A 2HDMA 2L9HA 3I4LA 3T51B 2J0TD 4RGNA 4LJZC 5C4XB 2XSCA 4ZK9B 3D8GA 4RHSA 3K5LA 3IFDA 1JOOA 3K5OA 2LKVA 1T5EA 3J81L 3FDTA 1PRTB 2EDGA 1GUNA 5A2QL 2BCOA 5G3LD 2CW0D 3DWPA 1V1OA 3I91A 2NVQB 4IFDJ 1EWHA 2DY8A 2E74C 3BVZA 1JICA 3M85A 1XXGA 3OWFA 4DAPA 5C4HA 1IW7D 2A6ED 1LT6D 2F0UA 2K5QA 3KBGA 2F1MA 4HSVA 1PXUA 1V1PA 3NP8A 2Z1CA 1B9MA 2Z4HA 1ZYRD 4FF3A 1GOZA 1RTOA 2XRQD 4CKCA 1KTKA 3JAME 1HTPA 5EQ0A 4BY1B 2R61A 1Z7TA 3OWEB 4L8JA 4RGTA 4TKOB 4YIJA 1LTTD 4C3HG 2ZXRA 1H9MA 4K2KA 1G291 1O78A 3OSOA 5M5WB 5ELBA 1ONLA 2F3VA 2EYFA 1ILQA 1ESRA 4RFBA 4WJWA 2EVBA 2I46A 4DK0A 4KJNA 3KLSX 2EYJA 1WTPA 3BZDB 3OIPA 3TP6A 4FXKC 3FPPA 3EROA 1TWCB 1QOHA 2F0EA 1WTQA 3CHBD 4G4KA 1SBBB 3TZDA 1UAPA 2B8GA 2BA0A 1EYAA 1LTGD 5IGBA 3S1MB 3A55A 3U9SA 1O7LA 3S1RB 3K5MA 2F0MA 4XYOA 5I6WA 2K01A 4KD4A 2O5JC 3Q22A 3N52A 2G9HD 3HS0C 4U68A 1JCKB 2QEJC 1QJOA 3EJIA 1LLRD 5LL6S 1QNUA 3SHLA 2H1EA 1SNDA 4FXGC 4CJ2C 3VA5A 1ET6A 1EY8A 3DXJC 2K03A 4PMBA 4DF7A 2XN9C 2B8FA 2RKSA 1SJHD 4J1MA 3R8BA 1JB3A 4ZKCB 4RCNA 1NCVA 4H0LC 3Q24A 3R3OA 2HCCA 4A3MB 1NUCA 4A3JB 1CA5A 1B2TA 5CBEE 4K5WA 2C5CA 1QG7A 1MSHA 4R9WA 3IL8A 1PTOC 1EL0A 2BDNA 4PMWA 2F0HA 1EFID 3TZUA 4G7HC 4L63B 3LWUA 2BOSA 4B9XA 3GTLB 2JA6B 2A68D 4OL7A 4EGVA 3V05A 2WP8J 3HZXA 1BOSA 1F9RA 2X6GA 1JWSD 1XWEA 1D5XC 1FNUA 1KAAA 5IOCA 1RD9D 2HDLA 3I8ZA 1OXTA 3K57A 2KCNA 3MZ5A 4BY7B 5EPLA 4F7XA 4KHZA 3S17B 3MEHA 1EIHA 4TQUS 4OO1H 4KMUC 3M7GA 4C2MB 5M5XB 1GHJA 2FMCA 4LK1C 1D5ZC 2I07B 3J80E 4X3SA 4K8JA 1MI2A 1W6KA 2K5WA 3JAML 3GO5A 1J8IA 3T56B 1T5XD 5CYUA 2ZXOA 1XYIA 4IALA 1PTOD 1STYA 1Q90A 3S16B 3OPOA 4KY7A 1OXVA 2N55A 1V1PB 2EJFC 1JE4A 1G2TA 1WD1A 4RHRA 4K2LA 3BS1A 1LABA 2K7VA 3M4YA 3MA2B 1GXDC 1CZGA 2L11A 2SNSA 3Q23A 3CRKC 5KEEA 1WD0A 4HEDA 1TWHB 2WV6D 1CK1A 2PYKA 5CBAE 3L9AX 1EYCA 4KKSA 5JEAG 3IFTA 3T53B 3K5NA 5K36H 2XRSD 1SNOA 3NWSA 3WOEA 4IUQA 1HUMA 1FGBD 2KECA 5EKIA 1K8OA 2K33A 3J81E 2R3ZA 4TRDA 3PMFA 3QB3A 4K6DA 1SAPA 2QILA 1RDPD 3IAYA 3FRPB 4PMCA 3X3MA 2L55A 4KN7C 4DAYA 3TMEA 3MTSA 5DEHA 1QCBD 5COYA 2EXZA 5D3DA 4M1UB 1G91A 3P20A 1X3QA 3MAQA 4G7ZC 4FYDA 1STAA 1QNKA 3NWTA 1JOKA 4WFN3 2B2VC 1GUTA 3R93A 5EPJA 4V0BA 3PUZA 3S9WA 2EYMA 4ODGA 3A54A 3TN2A 5K36G 1TKWB 3M3YB 2JP1A 2WIIB 4A3EB 2AQ3B 3VYRA 3TP5A 4BBRB 1ZXTA 3GTOB 1TR5A 3J7AF 4OO1I 1GHKA 2KUMA 4KKUA 3G6JB 2K04A 4IZ8A 4A3IB 4ZUIA 3C1EA 2EE1A 5J1ZA 2DNEA 4FNFA 2BE5D 1A3VA 4XQNA 2NVXB 4GZYC 1HRJA 3NK9A 1SYFA 1PDQA 5IGFA 3A8IE 2K32A 1JWUD 4RKBA 1W6JA 3ZYYX 4KY6A 3SVMA 1IKMA 5NUCA 1LT4D 3RZOB 1AFPA 1BCPC 5BN4A 2KQ3A 3A7LA 3LX0A 3J7YW 5I6YA 5D14A 5C0XG 1GUGA 4KD3A 1OXUA 4G57A 1R4QB 1TQOA 5EBCA 3D3RA 3VYUA 2F3WA 2X69A 2NN6G 3J80L 3TBIB 1SE2A 3VR2A 4KHVA 4ULLA 3DMUA 1B53A 4BA2I 1S5CD 1SSOA 1HCZA 4KKTA 3BYTB 1STEA 1Q1BA 5I9PA 2MP1A 3R2TA 4WRDA 1KDBA 1PTOH 1C48A 3ERQA 3PV0A 1EQTA 4CJ1B 2LS01 2ZT9C 1BBXC 4XQQA 1DD2A 3SE0A 4OIKA 4DN4M 3L7ZC 1AN8A 1KLGD 1L0XB 2IW3A 1IW7C 2Q8RE 2XVSA 3HOZB 3H3VC 1DZ1A 2PQEA 4I65A 3TSSA 3OMCA 2ICEC 4IQZA 4NW2A 1ZYRC 2M9VA 1DYQA 1LTSD 2B2VA 4RKLA 1Z6HA 1DOKA 2WINB 3F2UA 3H91A 1RCVD 2PO4A 4DK1A 5FLXL 4XIGS 5FO8B 3K0YA 3D4WA 1PZJD 2DY7A 5EGTA 2NN6I 4ZLTF 3L3OC 1GUOA 5A35A 2RBMA 4EVOA 3NHHA 1I4PA 1WTOA 3QWNA 2TSSA 1AP0A 1SNMA 1SYEA 2VNUD 1O7ZA 3SR1A 3SK8A 4BS9A 5FO7B 3I3CA 4HMJA 5C44B 1FNVA 2PZTA 1ENFA 1H9SA 1NAPA 5EKLA 1LT5D 2F4IA 2NTSA 4KK7A 3BDLA 2FFKB 3HOUB 4RA8A 2AWOA 3DEOA 4EQOA 3EFXD 1YNND 1PZKD 1SNQA 1CI3M 3T16A 3NBIA 1JWMD 5C5MA 3NSWA 3NE5B 1PZID 3P1HA 3RZDB 2RVLA 3MC0B 5M9OA 1Q8IA 2Y0SB 1DCZA 2RDHA 3FVQA 2B63B 5E4WC 4CGYB 3FKIB 4U673 3SK4A 4C56C 3P7JA 1K83B 1PTOF 4KTAA 1VF7A 4O1NA 4XXEA 2RA4A 2KEDA 4F87A 3U9OA 1AW7A 2B2WC 3SK5A 2RSOA 4FF4A 1TWFB 2KCCA 3MXGA 3HEJA 3K58A 3K59A 5CV4A 2K5DA 3H09A 3PUYA 3GTGB 3ONAB 2CVRA 1SE3A 2X6LA 3OOCA 2E76C 4FF1A 1UUPA 3PUVA 3QJYA 2F0DA 2F0JA 4C3HB 3PO3B 2SDFA 1I6VC 3A7AB 1VF5C 1A2TA 1XX8A 1BNZA 3KK7A 4R8IA 1TS2A 2N88A 1U4RA 3MHBA 1LO5D 1Y1VB 4K5XA 5C3EB 3Q6SA 2PW7A 2D62A 2LFNA 1MGSA 1I4HA 3S1QB 1DONA 2G9DA 5KNCA 4N9TA 2KEEA 2A68C 5F2DA 1F2ZA 1ESFA 1O80A 1S5DD 3S14B 2DN8A 2MJ8A 5CR3A 1SYCA 4O42A 4ME5A 1O7YA 1D1IA 1TU2B 4NKLA 3KLSA 4OGQC 3A8JE 3P75A 5C4ZA 2YU9B 1OXSC 4IFDG 5E4XA 2D5DA 2SNMA 3DEPA 3V2TA 4MN3A 2AWNA 1TS5A 4KY5A 4XT1B 2EYPA 4ZYSA 5JEAJ 1VCIA 5ELFA 1HHVA 5M5YB 4A3BB 2L4NA 1KNEA 1G8ZD 1U4MA 5IGEA 4HMIA 5HURA 3GQBA 1CHQD 2EZVA 2EY1A 1EU3A 1BR9A 2H4OA 1GUSA 4FF2A 1LTRD 3I73A 1HXYD 2HUGA 4IUTA 3NTKA 4TSSA 3R2IA 5CV8A 1WTXA 5C3WA 3NTIA 2IX0A 4A3GB 3A56A 4C3JG 1BQQT 1L0YB 3MXUA 1PRTD 1PYWD 4FO2A 4N9PA 3MXNA 3HOWB 2Q8TA 2B2WA 5EJWA 3O13A 5KYIA 2K1BA 2QDBA 5JEAH 4XTCS 3HGBA 1EQVA 3TP7A 1B1ZA 4G7OC 1YNJC 4S3SA 3GTJB 2RDGA 2XIWA 1SMYC 3D31A 5FKAC 1JOQA 1HA5A 2IJ0A 5DAUA 5E3FA 1IYUA 3WOFA 1I4GA 4IUPA 4A3KB 1HQMC 1Y8NB 4UDUC 3EVQA 1I4QA 5D65A 2RQXA 3W3AA 5I2YA 2F0FA 1F2LA 1LV9A 1TIID 1BCPB 3D6WA 3BVGA 4RGOS 2B2YC 2L1BA 4CKBA 1EY4A 4RGMA 1PFBA 3D4DA 2QKIC 3DWQA 1Y8PB 1HFNA 4H7BA 1U9RA 4HN7A 2NTTA 2JE6I 4AYBB 3I4NB 1PFMA 4RH6A 1R9TB 5C0XJ 1SE4A 1CA6A 1BCPF 2Z4IA 3SEBA 1YNJD 4K5VA 4C1NK 3GTKB 2IX3A 1SMYD 1TY0A 4XYQA 1FR3A 2BDOA 1HPCA 3NQIA 3K7AB 3HOXB 2LMCB 2Q8IB 5FLXE 4CJ0B 3KLRA 2HQEA 4C3IB 3AU7A 1BF4A 2NVYB 4K14A 5D3IB 2O4XA 1B9NA 1QE6A 3VR6A 1KNAA 1Q3LA 1WTRA 5J39A 1EEID 1K8MA 2BE5C 3BYYB 5G3LF 1FYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ILQ A;  1ESR A;  1U4P A;  4O42 A;  2L11 A;  1F9S A;  1O7Y A;  1VMP A;  4OIK A;  4IUR A;  1ZXT A;  2HDM A;  1RJT A;  2L9H A;  2XIW A;  1WTP A;  4DN4 M;  2HCC A;  1WD0 A;  3KUP A;  4HED A;  2EOT A;  2RVL A;  2EPB A;  1HUN A;  1CA5 A;  1B2T A;  4UAI A;  5E4X A;  5CBE E;  4IUP A;  1PLF A;  1ROD A;  1ML0 D;  1C8C A;  4ZK9 B;  1QG7 A;  2KUM A;  1MSH A;  3IFD A;  4R9W A;  2K04 A;  3IL8 A;  1B3A A;  1ILP A;  1EL0 A;  2B2T A;  2BDN A;  1WTQ A;  5CBA E;  3DEP A;  5D65 A;  3FDT A;  4MN3 A;  5E4W C;  2EE1 A;  5EPK A;  2Q8R E;  2M2L A;  1DZ1 A;  3P7J A;  3TZD A;  1F2L A;  1LV9 A;  3GV3 A;  1HFG A;  4IUU A;  4XT1 B;  1AZQ A;  2MGS A;  2RA4 A;  2KED A;  1A15 A;  3D6W A;  5DNF A;  2FIN B;  1BO0 A;  4NW2 A;  3I91 A;  5COR A;  4HAE A;  1HRJ A;  2B2W C;  1EOT A;  2B2V A;  1PDQ A;  3G7L A;  1GUW A;  1HHV A;  1F9R A;  1IL8 A;  2X6G A;  2L4N A;  2RSO A;  1G6Z A;  2B2Y C;  2HCI A;  1RHP A;  1DOK A;  2L1B A;  2B2U A;  1KNE A;  1HUM A;  1X3P A;  1PFB A;  2RSN A;  1G2S A;  1U4M A;  2KEC A;  2D9U A;  2IL8 A;  2NYZ D;  2DY8 A;  3F2U A;  2K01 A;  3H91 A;  3LWE A;  3SVM A;  1CM9 A;  2HDL A;  3I8Z A;  5EKI A;  1IKM A;  1IKL A;  1JIC A;  1HFN A;  1F9P A;  4X3K A;  1ICW A;  1M8A A;  3UI2 A;  1U4L A;  1DOL A;  1J9O A;  1WTV A;  3N52 A;  2R3Z A;  1S4Z A;  2J7Z A;  5EPL A;  3ONA B;  1WTW A;  4U68 A;  1PFM A;  2CVR A;  5JJZ A;  2X6L A;  4OIJ A;  1EIH A;  4XT3 B;  5D14 A;  2DY7 A;  4MHE A;  1SAP A;  1CA6 A;  1B4O A;  2FMM A;  1F9Q A;  2KOL A;  4XDX A;  5CMD A;  4HSV A;  4ZLT F;  2FHT A;  2MPM A;  3KBX A;  2X69 A;  4RWS C;  4ZKB B;  1E0B A;  1RTN A;  2HUG A;  1EIG A;  2L12 A;  4IUT A;  1NR4 A;  2B2T C;  3MTS A;  1WTX A;  2SDF A;  4IUQ A;  4QUC A;  4QUF A;  4X3S A;  2H1E A;  1WTO A;  4LMQ D;  1MI2 A;  1RTO A;  5COY A;  2FJ2 A;  4CJ2 C;  1AP0 A;  1B53 A;  1J8I A;  1NR2 A;  1XX8 A;  2K05 A;  1BNZ A;  4HCS A;  2K03 A;  1O7Z A;  4IUV A;  4X3T A;  1SSO A;  4CJ0 B;  4R8I A;  1G91 A;  1XYI A;  1PFN A;  5EQ0 A;  1SDF A;  2NZ1 D;  3QO2 A;  1X3Q A;  2VXW A;  2N88 A;  1U4R A;  3I3C A;  1QNK A;  2B2V C;  3FPU B;  2NWG A;  2Q8T A;  1BF4 A;  3Q6S A;  4X3U A;  2K28 A;  5T1G A;  2N55 A;  2MP1 A;  2B2U C;  1JE4 A;  1NAP A;  3HP3 A;  3I90 A;  5EPJ A;  4ZAI A;  3R93 A;  1G2T A;  1QE6 A;  2B2W A;  1MGS A;  1MSG A;  3GV6 A;  5EJW A;  1WD1 A;  1B50 A;  3MWY W;  5T1I A;  1DON A;  1HA6 A;  1KNA A;  1X32 A;  1Q3L A;  1TVX A;  2B2Y A;  1WTR A;  2K1B A;  3TN2 A;  4ZKC B;  2FFK B;  2KVM A;  4RAU C;  2JYO A;  1WVL A;  3DM1 A;  2KEE A;  4RA8 A;  1EQT A;  2JP1 A;  4CJ1 B;  1O80 A;  3DEO A;  5AFW A;  1AZP A;  1BBX C;  1NCV A;  1VMC A;  1DOM A;  2MJ8 A; 
#chains in the Genus database with same CATH topology
 3W1G A;  3BU2 A;  1VS0 A;  1VMP A;  1TWA B;  1CHP D;  3FHW A;  2ZJP A;  2KA7 A;  5C4J B;  4L5T A;  5IIF A;  5CGK A;  5M3F G;  4I7Z C;  1DJR D;  2EPB A;  1Y14 B;  5FK9 C;  5M3M H;  2TMP A;  4CKE A;  4JI0 Q;  4YY3 Q;  3S2D B;  1EU4 A;  4CHT B;  1KIX A;  4A3D H;  4A3L H;  1TWG H;  1PH8 A;  2LXK A;  3KF8 A;  4K0K Q;  5J22 A;  5C0X H;  4DV7 L;  2R93 H;  5CV5 A;  5E7N A;  2NN6 H;  2PNR C;  2NVT H;  2HD3 A;  4HTH A;  2OWO A;  1S5F D;  3KDF A;  3ITP A;  4P75 A;  4LF7 L;  1EY6 A;  3HG9 A;  2R7Z H;  3HOV H;  4Z9C B;  2JEA I;  3A0J A;  1Z47 A;  4PQX A;  2HHH L;  4JYA Q;  2RSN A;  4NP5 A;  1X3P A;  3LWE A;  2D9U A;  2IL8 A;  4R8N A;  5GAD C;  4RCO A;  4QF4 A;  3E0E A;  1Y1W B;  3A8K E;  3C46 A;  2AQ1 B;  5KIX A;  1WYD A;  1I50 H;  4CDC C;  4IPG A;  2BA1 A;  3CQZ H;  2FMM A;  2IPK D;  1N34 Q;  5KYL A;  1F2Y A;  5IGG A;  2CH4 A;  1NR4 A;  5JPM C;  5I4D A;  4LMQ D;  3PUX A;  4HJ8 A;  1PMR A;  3F2B A;  1XNR Q;  5M3M G;  1K0R A;  1M1K C;  4IUV A;  3H94 A;  3EBE A;  2EYO A;  1L1O A;  3KF6 A;  2JA7 B;  5C4X H;  1UWV A;  2R6G A;  1EIF A;  2UUB L;  2VUM H;  2VQE L;  1EY7 A;  2NUC A;  1YIT A;  3QG1 A;  2MUY A;  5CC4 A;  1QVF A;  2ENB A;  3AFP A;  2JA5 H;  1UE1 A;  1SLJ A;  4BA1 I;  1HA6 A;  2KBN A;  3DHQ A;  2B2Y A;  1UEB A;  4DV5 Q;  2B39 A;  1HR0 W;  4Y7N H;  1FVI A;  1QB5 D;  3HOV G;  1SYD A;  1BBW A;  4OXP A;  3CAM A;  1VMC A;  1VQH A;  3I4M B;  1KC8 C;  3HKZ B;  2NVQ H;  4A3C G;  1V43 A;  3DUZ A;  1RJT A;  2EY2 A;  2L15 A;  2WKC A;  4JI7 L;  4AIM A;  3BVM A;  1E2V A;  4DAV A;  3F8T A;  4LF6 Q;  3VR3 A;  5C6A A;  1F2M A;  2OXP A;  2MO1 A;  1AE2 A;  3RLF A;  1XPU A;  1AEX A;  1LTI D;  2C9O A;  3D6C A;  2F0N A;  5EPK A;  3U58 A;  4A3D B;  3EN2 A;  1TWG B;  3RMH A;  1Q12 A;  4BBS H;  5EAY A;  4H44 C;  1HFG A;  4X65 Q;  4DA2 A;  3STB C;  4CDF C;  4LFC Q;  5ELD A;  1S5B D;  5COR A;  5IYC G;  1LTB D;  1Q46 A;  4HAE A;  2R93 B;  1CTM A;  1U5K A;  3G7L A;  2DNC A;  1PFS A;  2YYZ A;  4UHV A;  5C4X G;  1ZEQ X;  4CBV A;  2UU9 L;  5BN5 A;  2NYZ D;  3W2D A;  4BY1 H;  2R7Z B;  1F9P A;  4X3K A;  4IOC A;  4JCV E;  3MFY A;  4DUZ Q;  1JQY D;  4HCE A;  1SNP A;  2F0Q A;  3H0G B;  2IWH A;  1C4Q A;  1KD1 C;  5IWA Q;  3RN2 A;  4JOI C;  1F9Q A;  2F0V A;  1H95 A;  2HIV A;  1B8A A;  3CQZ B;  1E0B A;  3SXH A;  3H6M A;  3M4O H;  3K6O A;  3AQQ A;  5M5W H;  4AH6 A;  2F0G A;  4QUF A;  1IBM L;  1YNN C;  2GVA A;  5L37 A;  1X3F A;  2DGY A;  2F0S A;  2E2D C;  2L5T A;  1LAC A;  5C5L A;  2CQO A;  4KV6 A;  1EZ6 A;  2NZ1 D;  1TY2 A;  1H9K A;  2A74 C;  5C0X I;  4MNO A;  4PNY A;  1CKO A;  2F52 A;  4PZ8 A;  1II3 A;  5BN3 A;  3J80 c;  1BXT A;  1TWC H;  3AMU A;  3CMA A;  3TRZ A;  4GN5 A;  4OEM B;  3E0J A;  1XNQ L;  2VUM B;  2OCE A;  4YCV A;  1DXM A;  5IGC A;  3MWY W;  1Q1E A;  1NMF A;  3CCJ A;  2PMZ B;  1S5E D;  2KVM A;  3D4R A;  2JA5 B;  2EJM A;  3GTM H;  4B08 A;  4IO9 A;  3HOU G;  3S1M H;  1AZP A;  1B70 B;  2O2L D;  4JK1 C;  1SFO H;  4Y7N B;  3PIO A;  3S1R H;  4BY1 G;  3UDI A;  1F9S A;  4F8M A;  1L0W A;  3HOY H;  4IUR A;  2SEB D;  2NBF A;  1JJG A;  2EOT A;  1D6E C;  2K5H A;  4O0A A;  1GVP A;  5DM6 3;  4NB3 A;  2ID0 A;  2OTL A;  1C0A A;  1XTC D;  4DU9 A;  5JOB A;  4JBW A;  5JPN C;  1XTD A;  1B3A A;  3MEF A;  1BUV T;  1UEA B;  4J15 A;  1YI2 A;  1PTO B;  2AHO B;  2MQH A;  4QIW E;  1MBY A;  2EIF A;  2KJX A;  1K28 A;  1PRT F;  4DV7 Q;  5LL6 X;  2ZTC A;  2WAQ B;  5BR8 L;  1IHZ A;  5ELN A;  3I72 A;  5K5P A;  3X3N A;  4LF4 Q;  1BO0 A;  4BBS B;  4DR4 L;  5FOB B;  4LF7 Q;  2O5I C;  3QOJ A;  4AYB E;  1GUW A;  2YV5 A;  3AYH B;  1CT1 D;  1IL8 A;  1KLU D;  4GOP B;  2HHH Q;  1SYG A;  4JG2 A;  5KNB A;  3KF8 B;  3PUW A;  2EY5 A;  5IOD A;  1ICW A;  1M8A A;  3PO2 H;  1U4L A;  1BDO A;  1DOL A;  1LT3 D;  1EYD A;  1J9O A;  1EWI A;  1A2U A;  5ISR A;  1I6H H;  2RHS B;  4JC0 A;  1YVC A;  2BH2 A;  2K5V A;  5IYD H;  3I70 A;  4GKJ L;  4PG3 A;  4JW0 A;  5JJZ A;  3J7Z C;  4DK6 C;  2F0T A;  4B3M L;  5CMD A;  4FDB A;  4B3S L;  3E3X A;  3ND9 A;  1UNS A;  3KBX A;  4Q5V A;  1VQ9 A;  3J81 c;  4GN3 B;  4DR6 Q;  4QUC A;  1A8V A;  2JEB I;  5GRO A;  4M8A A;  1JMC A;  3T13 A;  1N33 L;  3M4O B;  4HSP A;  4HCS A;  1Y8O B;  1GJX A;  4IFD H;  3C1F A;  1PH6 A;  2UUB Q;  3FPU B;  2UUA L;  1NE3 A;  2VQE Q;  1A3U A;  1I3Q H;  2I5L X;  3S1N H;  2KHS A;  4R1J A;  1M90 C;  2B2U C;  4ZUJ A;  1LTL A;  3I90 A;  4ZAI A;  2RHQ B;  3S15 H;  2I5M X;  3GV6 A;  4PV1 C;  3TP8 A;  1KQS A;  2LXJ A;  1TVX A;  5I2X A;  3QOL A;  3NTH A;  1EY0 A;  3GTL H;  2JA6 H;  1EZ8 A;  2N3S A;  1HZ9 A;  5IYB H;  4XQJ A;  2Q2U A;  1SNC A;  3GTM B;  1EY9 A;  3FEW X;  1WCM B;  2SOB A;  4B3R Q;  1SFO B;  3L0O A;  4ZRZ A;  4HR7 B;  5FO9 B;  2VS1 A;  5IYD G;  3HOY B;  1KAW A;  3KLW A;  1PLF A;  4DPG A;  3CC2 A;  1Z9F A;  1ML0 D;  1MJE A;  1X54 A;  3S2H H;  4YHH Q;  2E2I H;  1ENA A;  5IT9 L;  4OHJ A;  2M2L A;  1I4R A;  3NEL A;  5KRU A;  4C2M H;  3BDC A;  5LHY 1;  1EOV A;  3BDO A;  5M5X H;  2HT1 A;  1AE3 A;  2CHB D;  1A15 A;  3RUZ A;  4LUO A;  2F0P A;  4A3M G;  1EWC A;  4A3J G;  1HZA A;  1ZKO A;  3IKJ A;  3DLL A;  1HTL D;  3PIP 3;  1RHP A;  3VR4 A;  3MFG A;  2UU9 Q;  2XWB B;  1PYS B;  1CM9 A;  1IKL A;  4QCL A;  2F0O A;  4F88 A;  1PRT C;  1QWY A;  1SEB D;  3J7A V;  3ULP A;  2CFM A;  1WTV A;  4A4I A;  1S4Z A;  3CU7 A;  3PO2 B;  1SXT A;  1SYB A;  5CV7 A;  5HGT A;  2JJQ A;  1I6H B;  2DJG C;  4IPC A;  1X3E A;  4P2C B;  2FHT A;  1NMG A;  4ZKB B;  4A76 A;  2L12 A;  4A93 B;  2LSS A;  1UE6 A;  1EEF D;  4DV6 Q;  1EQQ A;  4QL5 A;  2F4V L;  2VZA A;  4C1N I;  3AFQ A;  2EY6 A;  1CFM A;  2K05 A;  2EYH A;  4DNT B;  4QJF A;  3OW7 A;  4H13 C;  2L0C A;  1G51 A;  4BY7 G;  1CQF A;  3VR5 A;  3T4A C;  1KAB A;  2QF7 A;  4UPA A;  5E1F A;  5KND A;  4MIU A;  1OXX K;  4X3U A;  1PH7 A;  2EYL A;  3E6Z X;  5TSS A;  2NB0 A;  2Z6K C;  5I9O A;  1XNQ Q;  1Y69 U;  3WWV A;  3OMG A;  2PW5 A;  1I3Q B;  1S3O A;  3S1N B;  2E5L L;  5T1I A;  1MD2 D;  1E2Z A;  3E9H A;  1MIU A;  1P16 A;  2CKZ B;  3S15 B;  4DNI A;  1V8Q A;  1VDZ A;  1WVL A;  1RF2 D;  3GP7 A;  1YJ9 A;  3VYS A;  3SDZ A;  5HGQ A;  1X56 A;  1TT2 A;  4IJH A;  4P74 A;  2RF4 A;  1JC7 A;  2QW7 A;  5IE8 A;  5LMN W;  1W2B A;  3JAM i;  1KXL A;  2PZU A;  4P72 A;  3CW2 C;  3QIA A;  2QCP X;  4X64 L;  4UAI A;  2JSO A;  1ROD A;  1VQA A;  4B9W A;  1C7Y A;  4FXD A;  2VB3 X;  1XPR A;  1N9W A;  2K50 A;  1GD7 A;  1EY5 A;  2D0O A;  4DR5 L;  2A5H A;  3T1H Q;  2F0L A;  4JI4 L;  3S2H B;  1NSN S;  1STG A;  2E2I B;  4IUU A;  1AZQ A;  2MGS A;  1N36 Q;  3LGJ A;  4NMZ A;  2OF1 A;  1YIJ A;  2FIN B;  4Q0F A;  5JAV A;  1HR0 L;  2WB1 B;  2ES2 A;  1H9S B;  2CH4 W;  3CCU A;  4IFD I;  4YWL A;  3MVV A;  3CCR A;  3MXP A;  3ER0 A;  3HRZ C;  3LNN A;  4DR7 L;  5C3X A;  2B2U A;  1VQI A;  5KGU A;  2PQA A;  1ICF B;  4I7A A;  1QIL A;  1CQV A;  4C3J B;  4HJ9 A;  3RD4 A;  3CC7 A;  4DXF A;  1NJI C;  1ENC A;  4YCU A;  2YTX A;  1TS3 A;  4A3F H;  1A3T A;  4KHP L;  3DWA A;  4LF5 L;  1L1O C;  4QMG A;  2C35 B;  3BG3 A;  1HJP A;  2AUK A;  5IP9 H;  2R92 B;  2J4X A;  4K8I A;  3M7N A;  1E2W A;  4B3M Q;  2KOL A;  4B3S Q;  3Q0A A;  4L6T B;  3G48 A;  4Y52 H;  2AUJ D;  3EA6 A;  4J8Q A;  1UE5 A;  4QIW B;  2B2T C;  3I4O A;  2D2C C;  2A69 C;  1N33 Q;  1R4P B;  1CKM A;  2A73 B;  2VB2 X;  4JI2 L;  3N6R A;  3HOX G;  3GTO H;  2V4D A;  4ID6 A;  5IGD A;  2A6H C;  1A6X A;  3QO2 A;  1B44 D;  2LY7 A;  2WAC A;  2PMZ E;  3NBH A;  4C3I G;  2E75 C;  2PZW A;  5T1G A;  2E2J B;  3CCS A;  1STH A;  4OO1 G;  1B50 A;  2XTI A;  1X32 A;  1L2F A;  3GTP H;  2YTV A;  4NXN L;  1XMO L;  3GD7 A;  3NUC A;  4RAU C;  3CRL C;  2JYO A;  2N49 A;  4GS3 A;  1HNW L;  3DM1 A;  1D5M C;  4ABN A;  4V19 0;  1DOM A;  3CD6 A;  1V9P A;  4E6I A;  1PH2 A;  1E1T A;  2XWJ B;  1CKN B;  4DNR B;  4JV5 L;  2K6A A;  1Q81 C;  1KDC A;  2PCF B;  1C8C A;  2WAQ E;  4KJO A;  1K3R A;  1FD7 D;  1ILP A;  2EJG C;  3EQL C;  2RCN A;  5GAE C;  1WI5 A;  4KI0 A;  5JVH 3;  1S40 A;  5A2Q E;  4A3E G;  2A69 D;  3E5S A;  1DM0 B;  4BBR G;  2F03 A;  4R4C A;  4BWG B;  4JI1 L;  1VQB A;  4TVA B;  2A6H D;  1EOT A;  1PH4 A;  1IYV A;  1JOR A;  3J7A 5;  3C3L A;  1G6Z A;  2HCI A;  1WTW A;  2Z6K A;  4J6H A;  2JA8 B;  2UXB L;  4DV3 L;  2MHV A;  4A3I G;  2J7Z A;  3URY A;  4DFA A;  4LF9 L;  3BZK A;  2QGQ A;  3KYH C;  4A3F B;  4XT3 B;  4X66 Q;  3AEV A;  4EQN A;  3CCV A;  3A5Z B;  4XDX A;  1YNX A;  3T1Y L;  5ELE A;  5ELC A;  2WKD A;  2KCM A;  4DXG A;  2F4V Q;  2Z9H A;  4QB4 A;  4A3C H;  1D7Q A;  4JI5 Q;  1NR2 A;  1PFN A;  2PPB C;  4EX5 A;  2VXW A;  3EIV A;  3OHX C;  2NWG A;  2OTJ A;  2GA4 B;  4EQP A;  5M3F B;  4R4O A;  2E2H B;  3HP3 A;  1MSG A;  4IUN A;  4NDX A;  2NZO A;  1KDA A;  1PH3 A;  1Q8K A;  3CKI B;  3J80 i;  2K14 A;  5AFW A;  5IYC H;  3GTP B;  5DM7 3;  5CV9 A;  4UY8 C;  4MTK A;  3NXW A;  3SGI A;  4DGZ A;  3V96 A;  3FP9 A;  3KUP A;  1HQR D;  5CV6 A;  3GTQ B;  3VA7 A;  3RLN A;  1HUN A;  1CSP A;  4X64 Q;  2ALY B;  3NQT A;  3ND8 A;  4K6L A;  2IX1 A;  3OIQ A;  1FNW A;  3K8A A;  2B2T A;  4GNX C;  4LAA A;  5EKK A;  1D2B A;  3S24 A;  1X55 A;  4JI4 Q;  3GV3 A;  3NPP A;  1S72 A;  3MXN B;  4GKK L;  4ILW A;  4KN4 C;  1BVS A;  2ZXP A;  5DNF A;  1CZW A;  1M4V A;  1E24 A;  1ET9 A;  2JXM B;  4DV4 L;  1VQP A;  1JR0 D;  1SJE D;  3C2P A;  3TDQ A;  1XMQ L;  1PH5 A;  1G2S A;  4JBK A;  4JI3 Q;  1STB A;  5FJ8 G;  5M3M B;  3UI2 A;  1F77 A;  1RIP A;  3HOZ G;  5IT9 E;  3TS2 A;  4R4T A;  3VYT A;  4LUV A;  4GN4 B;  2OEO A;  1OO9 B;  4OIJ A;  4MHE A;  2OT2 A;  1RKN A;  2RDF A;  4IN3 A;  2QA4 A;  1B4O A;  3SK6 A;  2MPM A;  2F0W A;  2B3G A;  4RWS C;  3AB9 A;  5DLQ E;  1J6Q A;  1RTN A;  1EIG A;  1H9R A;  4FVM A;  1EFW A;  3HOU H;  4LWC A;  1TXY A;  2NVT B;  3PIO 3;  1OTC A;  1H9J A;  2CW0 C;  2FJ2 A;  3HOV B;  2MO0 A;  3CXC A;  4WOR A;  2ZJR A;  4X3T A;  2CQA A;  5JVG 3;  1SDF A;  3RZD H;  2UXC Q;  1LTA D;  1I4X A;  3J81 i;  2B63 H;  1N32 L;  2F0I A;  2K28 A;  1BCP D;  2AQ2 B;  2F0K A;  4LF8 L;  1QUQ A;  1I50 B;  3WDN A;  3FKI H;  4JBJ A;  1WTH A;  2XNA C;  3CCL A;  3KFU A;  4YWM A;  1TS4 A;  3NEM A;  2ICI A;  1D1K A;  4NXN Q;  3BZC A;  4ZQ3 A;  2M00 A;  2A6E C;  4IPH A;  2Z8L A;  1STN A;  4PZ6 A;  2VQF Q;  3FMC A;  1U4P A;  2D0P A;  4YCW A;  4FP5 D;  5EBD A;  2IT1 A;  1TWF H;  5C44 G;  2HDM A;  2L9H A;  3I4L A;  4JV5 Q;  3T51 B;  1YHQ A;  2J0T D;  4RGN A;  1IBL L;  1QZH A;  3ULJ A;  4LJZ C;  5C4X B;  2XSC A;  4ZK9 B;  3D8G A;  2GN5 A;  4RHS A;  3K5L A;  3I55 A;  3IFD A;  2I5H A;  1EQR A;  1JOO A;  3K5O A;  2LKV A;  1T5E A;  2WB1 E;  3J81 L;  3GTG H;  1NTG A;  2GVB A;  3FDT A;  1PRT B;  2EDG A;  1GUN A;  4BXX G;  2ASB A;  5A2Q L;  1IBK L;  2BCO A;  5G3L D;  2CW0 D;  3DWP A;  3Q8D A;  4AQY L;  2ZJQ A;  1FL0 A;  1V1O A;  4JI1 Q;  2A1A A;  3I91 A;  3PO3 H;  1X9N A;  4L5Q A;  2NVQ B;  2Y0S G;  4IFD J;  1A62 A;  1EWH A;  1Q7Y C;  1AH9 A;  2B63 G;  2DY8 A;  2E74 C;  3M9B A;  5LMN L;  4DV3 Q;  1WFQ A;  2UXB Q;  3BVZ A;  1E1O A;  1JIC A;  3M85 A;  1XXG A;  3FKI G;  5C3E H;  3OWF A;  4DAP A;  1XJV A;  5C4H A;  1IW7 D;  4LF9 Q;  1I94 L;  2A6E D;  2CCZ A;  1LT6 D;  3UDF A;  2F0U A;  2K5Q A;  3KBG A;  2F1M A;  4HSV A;  1PXU A;  3T1Y Q;  1V1P A;  3NP8 A;  2Z1C A;  1B9M A;  2Z4H A;  1ZYR D;  2Q2H A;  4FF3 A;  1GOZ A;  1SE8 A;  1RTO A;  2XRQ D;  4CKC A;  1KTK A;  3JAM E;  4GNX A;  1HTP A;  5EQ0 A;  4BY1 B;  1PHJ A;  2R61 A;  2KHI A;  1Z7T A;  3OWE B;  4L8J A;  3KDF B;  4RGT A;  4TKO B;  3A5U A;  1VQ4 A;  1B7Y B;  4YIJ A;  1LTT D;  4C3H G;  2ZXR A;  3I56 A;  1H9M A;  3RN5 A;  4K2K A;  5FLX c;  4L5R C;  3PO3 G;  1G29 1;  3RLO A;  1O78 A;  3ICE A;  3OSO A;  5IP7 G;  5M5W B;  5ELB A;  1ONL A;  4A3M H;  2F3V A;  2EYF A;  1ILQ A;  1ESR A;  4RFB A;  1WJJ A;  4OON A;  4A3J H;  4WJW A;  2EVB A;  2I46 A;  4DK0 A;  4KJN A;  3KLS X;  2EYJ A;  1MHW C;  1WTP A;  1Y1V G;  3BZD B;  5C3E G;  1PH1 A;  3OIP A;  3TP6 A;  2N78 A;  4FXK C;  3FPP A;  1J5E L;  3ERO A;  3TEH B;  2K75 A;  5AJ3 L;  3K0X A;  1TWC B;  1QOH A;  2F0E A;  1WTQ A;  3CHB D;  4G4K A;  5FLM G;  3DM3 A;  1SBB B;  2OQK A;  3TZD A;  1UAP A;  2I0Q A;  2B8G A;  1L1O B;  2BA0 A;  3KF6 B;  4X62 L;  1EYA A;  1LTG D;  4LFA L;  4GKK Q;  5IGB A;  4JPB W;  1VQ5 A;  1NY4 A;  2WFW A;  3S1M B;  3A55 A;  4POF A;  3U9S A;  1O7L A;  1FJG L;  3S1R B;  3K5M A;  4JI7 Q;  2F0M A;  4DV4 Q;  1VQD A;  4QY7 A;  4XYO A;  5I6W A;  1XMQ Q;  3I2Z A;  2K01 A;  3D0F A;  2CWP A;  4KD4 A;  2O5J C;  4BY7 H;  4HIM A;  3S17 H;  5GQO A;  3Q22 A;  4UP8 A;  3N52 A;  2G9H D;  3HS0 C;  4HJ7 A;  4U68 A;  4DV0 L;  1YZ6 A;  4HJ5 A;  1JCK B;  3CP0 A;  2QEJ C;  1SMX A;  1QJO A;  3EJI A;  2JQO A;  1LLR D;  5LL6 S;  4DV1 L;  4A3B G;  1QNU A;  3CPF A;  4H02 A;  3SHL A;  1VQK A;  2H1E A;  1SND A;  4DR3 L;  4FXG C;  4CJ2 C;  3VA5 A;  1ET6 A;  3S16 H;  3GTJ H;  1LUZ A;  1EY8 A;  3DXJ C;  2K03 A;  2Z6B A;  2KHJ A;  3G6E A;  1SRO A;  1K9M C;  1N32 Q;  4HID A;  4PMB A;  1I5F A;  4DF7 A;  2ATW A;  3PGZ A;  4LF8 Q;  4JI0 L;  2XN9 C;  2B8F A;  1BKB A;  2RKS A;  3U4Z A;  1SJH D;  4J1M A;  1IBM Q;  4A3G G;  3R8B A;  1JB3 A;  4ZKC B;  4K0K L;  4JVZ A;  4RCN A;  1JT8 A;  5JJK A;  1NCV A;  4H0L C;  3L2P A;  3Q24 A;  4DUY L;  3R3O A;  1IYJ B;  2HCC A;  3HOW G;  1TWH H;  4A75 A;  1NUC A;  4A3M B;  4A3J B;  2K4K A;  1CA5 A;  1B2T A;  5CBE E;  4JYA L;  4K5W A;  1FGU A;  2C5C A;  1QG7 A;  1MSH A;  4R9W A;  3IL8 A;  2CWA A;  1PTO C;  1EL0 A;  2BDN A;  4PMW A;  2F0H A;  1R9T H;  1EFI D;  3TZU A;  4G7H C;  4L63 B;  1IBK Q;  3LWU A;  1VQ6 A;  2BOS A;  4B9X A;  3GTL B;  2JA6 B;  4WJ4 A;  2A68 D;  1IZ6 A;  4OL7 A;  4EGV A;  3KJO A;  1ASY A;  4HIO A;  3V05 A;  4GLX A;  2WP8 J;  3HZX A;  1BOS A;  1F9R A;  2X6G A;  1JWS D;  1XWE A;  1D5X C;  3HOX H;  4A3K G;  1FNU A;  1KAA A;  5IOC A;  5LMN Q;  1RD9 D;  2HDL A;  3I8Z A;  1JE5 A;  1OXT A;  2VW9 A;  3K81 C;  4C3I H;  3K57 A;  4DAM A;  2KCN A;  2UXD L;  3MZ5 A;  4BY7 B;  4OX9 L;  5EPL A;  4F7X A;  4KHZ A;  3S17 B;  3MEH A;  1EIH A;  4TQU S;  5BR8 Q;  4OO1 H;  4KMU C;  3M7G A;  4C2M B;  4DR4 Q;  2PI2 A;  5M5X B;  1GHJ A;  2FMC A;  2JN4 A;  4LK1 C;  1D5Z C;  2I07 B;  3J80 E;  4X3S A;  4K8J A;  1MI2 A;  1PYB A;  1W6K A;  1EIY B;  2K5W A;  3JAM L;  3GO5 A;  1J8I A;  1TWA H;  3T56 B;  1T5X D;  5CYU A;  2A19 A;  3CME A;  4AYB G;  2ZXO A;  3I4N G;  1XYI A;  5JJL A;  4IAL A;  1PTO D;  1STY A;  1Q90 A;  3S16 B;  3OPO A;  4GKJ Q;  4KY7 A;  1W3S A;  3RNU A;  1OXV A;  2N55 A;  3KJP A;  1V1P B;  2EJF C;  1JE4 A;  1KHI A;  4DR2 L;  1G2T A;  3RR5 A;  1X6O A;  3QR8 A;  4LF6 L;  1WD1 A;  4RHR A;  3M3Y H;  2G5D A;  4A3E H;  4K2L A;  1NNX A;  3BS1 A;  1LAB A;  4BBR H;  2F3I A;  2K7V A;  3M4Y A;  3MA2 B;  1VQN A;  2E8G A;  1GXD C;  1CZG A;  4B3T L;  4OWW B;  4LFC L;  2L11 A;  2SNS A;  3Q23 A;  3CRK C;  1PVO A;  5KEE A;  2UUA Q;  1WD0 A;  4HED A;  2N8N A;  4A3I H;  3UDX A;  1Y1W H;  1TWH B;  2WV6 D;  1CK1 A;  1SR3 A;  3CPW A;  2PYK A;  5CBA E;  3K80 C;  2NVX H;  1JJC B;  2JK8 A;  4DUZ L;  2MFI A;  1SN8 A;  1QVC A;  3L9A X;  1YBY A;  1EYC A;  4KKS A;  5JEA G;  1K8G A;  3NEN A;  3IFT A;  4RG1 A;  3T53 B;  4DK3 C;  3K5N A;  1HNZ L;  1FJG Q;  5K36 H;  2XRS D;  1SNO A;  3NWS A;  3WOE A;  4IUQ A;  1HUM A;  1FGB D;  1YJN A;  3RZO H;  2KEC A;  2JA8 G;  1IL2 A;  5EKI A;  1K8O A;  2K33 A;  3J81 E;  1XPO A;  4DR1 L;  2R3Z A;  4TRD A;  2MNA A;  3PMF A;  3QB3 A;  4K6D A;  4CDD C;  1SAP A;  2QIL A;  1RDP D;  3IAY A;  3PSI A;  2HQL A;  3FRP B;  4PMC A;  3X3M A;  2L55 A;  4KN7 C;  4DAY A;  3TME A;  3MTS A;  3CCM A;  5DEH A;  1NBW A;  4DR3 Q;  1QCB D;  5COY A;  1WOC A;  2EXZ A;  5D3D A;  4M1U B;  1Y1W G;  1G91 A;  3P20 A;  1X3Q A;  3MAQ A;  4G7Z C;  4FYD A;  1STA A;  4IPD A;  1QNK A;  1B3Q A;  1JOK A;  3NWT A;  2B2V C;  4WFN 3;  1GUT A;  2PNH A;  3R93 A;  4QQB X;  5EPJ A;  4V0B A;  1VQC A;  3PUZ A;  3S9W A;  4GOP A;  2QDL A;  2EYM A;  1K8A C;  4ODG A;  3A54 A;  4UP7 A;  3TN2 A;  4DV2 L;  5K36 G;  4LNQ A;  1TKW B;  1V1Q A;  3HKS A;  3M3Y B;  2Z0S A;  2JP1 A;  2WII B;  1IXR A;  2B29 A;  4A3E B;  2AQ3 B;  3K7U C;  3TP5 A;  3VYR A;  4BBR B;  1VQF A;  2JA7 G;  4DUY Q;  4LF4 L;  1ZXT A;  4EQ5 A;  1YJW A;  2Q2T A;  3GTO B;  1TR5 A;  5FJ8 H;  3J7A F;  4OO1 I;  1EUJ A;  1GHK A;  4POG A;  2KUM A;  4KKU A;  3G6J B;  3HOZ H;  2E5L Q;  2K04 A;  4IZ8 A;  4A3I B;  4ZUI A;  2KCT A;  3H0G H;  1GO3 E;  3C1E A;  2EE1 A;  3ERS X;  3H3V I;  5J1Z A;  1YEZ A;  2DNE A;  2NZH A;  4FNF A;  2BE5 D;  1A3V A;  4XQN A;  3CC4 A;  3I4M G;  2NVX B;  3HKZ G;  3IRB A;  4GZY C;  1HRJ A;  3NK9 A;  1SYF A;  1PDQ A;  5IGF A;  3A8I E;  2K32 A;  1JWU D;  4DR6 L;  4RKB A;  1W6J A;  3ZYY X;  4KY6 A;  3SVM A;  1IKM A;  2ZTD A;  4OWT B;  5NUC A;  3PF5 A;  1LT4 D;  1C9O A;  3RZO B;  4LFB L;  4A3L G;  4A3D G;  2UXD Q;  1AFP A;  1BCP C;  4DR5 Q;  4OX9 Q;  5BN4 A;  2KQ3 A;  1VQE A;  3A7L A;  3LX0 A;  3J7Y W;  5I6Y A;  5D14 A;  5C0X G;  1GUG A;  1VQJ A;  4KD3 A;  1OXU A;  1HR0 Q;  4G57 A;  1X3G A;  1R4Q B;  2R93 G;  1TQO A;  5EBC A;  3D3R A;  3VYU A;  2F3W A;  2X69 A;  2NN6 G;  3J80 L;  2QEX A;  4DR7 Q;  3TBI B;  1SE2 A;  4LW1 A;  3VR2 A;  2RCF A;  4KHV A;  4ULL A;  2R7Z G;  3DMU A;  1B53 A;  3TQY A;  5C44 H;  4BA2 I;  3OYY A;  4KHP Q;  1S5C D;  1SSO A;  4LF5 Q;  1HCZ A;  2R7F A;  1YHA A;  4KKT A;  3BYT B;  1STE A;  1K3B C;  3H0G G;  4IJL A;  3ULL A;  1Q82 C;  1Q1B A;  5I9P A;  4B3R L;  2P5Z X;  3CF5 A;  2IHF A;  2MP1 A;  3R2T A;  4DR2 Q;  4WRD A;  1KDB A;  1PTO H;  1C48 A;  1RL2 A;  4BXX H;  1A63 A;  2PQA B;  5GAG C;  3ERQ A;  4YHH L;  3PV0 A;  4JI2 Q;  1EQT A;  4CJ1 B;  2AKW B;  2LS0 1;  2ZT9 C;  1BBX C;  4XQQ A;  4B3T Q;  3A74 A;  1DD2 A;  2DUD A;  3SE0 A;  4OIK A;  1D8L A;  3BJU A;  4DN4 M;  1JB7 A;  3L7Z C;  1KRS A;  1AN8 A;  5J3B A;  4R4I A;  2VUM G;  3PQI A;  1KLG D;  2OQ0 A;  1L0X B;  1K83 H;  2IW3 A;  1IW7 C;  1XMO Q;  2JA5 G;  2Q8R E;  2XVS A;  3HOZ B;  4UP9 A;  3H3V C;  1HNW Q;  1DZ1 A;  2EXD A;  2PQE A;  4GLA C;  4I65 A;  3NBH B;  3TSS A;  4IOA A;  3OMC A;  2ICE C;  4IQZ A;  4NW2 A;  1ZYR C;  2M9V A;  1DYQ A;  1LTS D;  2B2V A;  1HNZ Q;  4JI8 L;  4RKL A;  1Z6H A;  2VY3 A;  1DOK A;  3PCO B;  2WIN B;  3F2U A;  3H91 A;  1RCV D;  4DV6 L;  2PO4 A;  1KRT A;  4DK1 A;  4NPS A;  5FLX L;  4XIG S;  2UUC L;  3TRE A;  5FO8 B;  3OTO L;  3K0Y A;  4DR1 Q;  1UE7 A;  3D4W A;  2WAQ G;  1PZJ D;  4C3H H;  2DY7 A;  3U4V A;  5EGT A;  4BBS G;  2NN6 I;  4ZLT F;  3STB D;  1MJC A;  3L3O C;  1GUO A;  5A35 A;  4O2D A;  2RBM A;  4LUZ A;  5IP7 H;  4EVO A;  1O7I A;  3NHH A;  1I4P A;  2JA9 A;  1WTO A;  4NXM L;  3QWN A;  2TSS A;  1AP0 A;  1SNM A;  1WCM H;  1SYE A;  1Y1V H;  2VNU D;  1O7Z A;  3SR1 A;  3SK8 A;  4BS9 A;  5FO7 B;  3OW2 A;  3I3C A;  4HMJ A;  5C44 B;  3B6Y A;  1FNV A;  2PZT A;  3S1Q H;  1ENF A;  1H9S A;  1NAP A;  4DAY B;  5EKL A;  5FLM H;  1LT5 D;  2F4I A;  1VQ7 A;  5JJI A;  2NTS A;  4KK7 A;  1HZC A;  4JI6 L;  3S14 H;  3BDL A;  4DV2 Q;  5LMU L;  1K73 C;  2FFK B;  4ALP A;  3HOU B;  2KEN A;  4RA8 A;  2AWO A;  3DEO A;  3T1H L;  4EQO A;  3EFX D;  1YNN D;  1PZK D;  1SNQ A;  2YU9 H;  1N36 L;  1DGS A;  1CI3 M;  3T16 A;  3NBI A;  4GLV B;  4HJA A;  1JWM D;  5C5M A;  3NSW A;  3W1B A;  4L5S A;  3NE5 B;  1PZI D;  3P1H A;  3RZD B;  2RVL A;  3MC0 B;  5M9O A;  1Q8I A;  2Y0S B;  1DCZ A;  2RDH A;  3FVQ A;  2B63 B;  1VQL A;  1YHB A;  4YWK A;  3CCE A;  4RMF A;  5E4W C;  4CGY B;  3FKI B;  3ZJY C;  4U67 3;  1ASZ A;  3SK4 A;  4C56 C;  4P71 A;  3P7J A;  1K83 B;  1PTO F;  4KTA A;  1VF7 A;  4O1N A;  4XXE A;  2RA4 A;  5H1S E;  2KED A;  5M5Y H;  1PV4 A;  3KOJ A;  4A3B H;  4F87 A;  4A93 H;  1WCM G;  1HNX L;  3U9O A;  1AW7 A;  2B2W C;  3SK5 A;  2K5N A;  2RSO A;  3HOY G;  4FF4 A;  1TWF B;  1N8R C;  2KCC A;  3MXG A;  3HEJ A;  2Q2I A;  3K58 A;  3K59 A;  5CV4 A;  2K5D A;  3GDE A;  4LFB Q;  3H09 A;  3PUY A;  3GTG B;  3ONA B;  2CVR A;  1SE3 A;  2X6L A;  3OOC A;  2E76 C;  4FF1 A;  1UUP A;  2ZTE A;  3PUV A;  4N8X 1;  1VQM A;  3QJY A;  1CKN A;  2IY5 B;  2F0D A;  4A3G H;  2F0J A;  4C3H B;  4PZ7 A;  3JC6 6;  3PO3 B;  2SDF A;  1I6V C;  3A7A B;  1VF5 C;  1A2T A;  1EYG A;  3HFZ B;  1XX8 A;  1BNZ A;  3HOW H;  3KK7 A;  4R8I A;  2BH8 A;  1TS2 A;  2N88 A;  1U4R A;  3MHB A;  1GKH A;  1LO5 D;  3I7F A;  3PO2 G;  1U0L A;  1Y1V B;  4K5X A;  5C3E B;  3Q6S A;  2PW7 A;  4JOI A;  2D62 A;  2ZM6 L;  2LFN A;  1MGS A;  4A93 G;  1I4H A;  3S1Q B;  1DON A;  2G9D A;  5KNC A;  4N9T A;  1E3P A;  2KEE A;  2A68 C;  5F2D A;  1F2Z A;  1ESF A;  1O80 A;  1S5D D;  3S14 B;  2DN8 A;  2MJ8 A;  5CR3 A;  1SYC A;  4O42 A;  4ME5 A;  3CCQ A;  1O7Y A;  1D1I A;  1TU2 B;  4NKL A;  4A3K H;  4P73 A;  3KLS A;  4OGQ C;  4C3J H;  3A8J E;  3P75 A;  5C4Z A;  2YU9 B;  1OXS C;  4IFD G;  5E4X A;  1HH2 P;  4YY3 L;  1E7Z A;  2V1C C;  2D5D A;  2SNM A;  3DEP A;  3V2T A;  4MN3 A;  2R92 H;  2AWN A;  4OWX B;  1TS5 A;  4KY5 A;  4XT1 B;  2EYP A;  2JA6 G;  4X66 L;  4ZYS A;  5JEA J;  1VCI A;  3F1Z A;  5IYB G;  1KL9 A;  3E9I A;  1QUQ B;  1K0S A;  5ELF A;  1VQO A;  4JI8 Q;  1HHV A;  5M5Y B;  4A3B B;  1IBL Q;  2L4N A;  1KNE A;  2XGT A;  1G8Z D;  1HZB A;  1U4M A;  5IGE A;  4HMI A;  3I4N H;  4CDE C;  1BBU A;  4JI5 L;  3VDY A;  1PA6 A;  4MZ9 A;  5HUR A;  2UUC Q;  5HY6 A;  2FXQ A;  3OTO Q;  3GQB A;  1CHQ D;  2EZV A;  1QVG A;  2EY1 A;  2E2J H;  1EU3 A;  1BR9 A;  1CSQ A;  2H4O A;  3PF4 A;  2K52 A;  4QGU A;  1GUS A;  4AQY Q;  4FF2 A;  1LTR D;  3GTK H;  4X6A H;  2WB1 G;  3I73 A;  2AMC B;  1HXY D;  1N34 L;  5IY0 A;  4GOP C;  3HKZ E;  2A8V A;  2HUG A;  4IUT A;  2DJF C;  3G71 A;  3NTK A;  4TSS A;  3K7A H;  3R2I A;  1X65 A;  5CV8 A;  5IT9 c;  1WTX A;  5C3W A;  3NTI A;  2IX0 A;  4A3G B;  2PI2 E;  4NXM Q;  3A56 A;  4C3J G;  1BQQ T;  3U50 C;  1XNR L;  3PIP A;  2NVY H;  1L0Y B;  4R4Q A;  3MXU A;  3G4S A;  1PRT D;  1PYW D;  4FO2 A;  1I94 Q;  2IHE A;  1E22 A;  4N9P A;  3MXN A;  2VL6 A;  2Q8T A;  2R92 G;  3HOW B;  3J81 j;  1PH9 A;  1QZG A;  2B2W A;  5EJW A;  3O13 A;  5KYI A;  4JI6 Q;  3H3V H;  2K1B A;  4DV5 L;  5LMU Q;  2QDB A;  2YTY A;  5JEA H;  4XTC S;  3HGB A;  4ME3 A;  1EQV A;  3UDG A;  3TP7 A;  5C4J H;  2EQS A;  1VQG A;  1T9H A;  5ELO A;  1B1Z A;  4G7O C;  1YNJ C;  4S3S A;  1JJ2 A;  3GTJ B;  2RDG A;  2XIW A;  3S2D H;  1SMY C;  2JA8 H;  3D31 A;  3M4P A;  5FKA C;  1JOQ A;  1HA5 A;  2IJ0 A;  2H5X A;  5DAU A;  5E3F A;  1IYU A;  3WOF A;  1I4G A;  4IUP A;  4A3K B;  1HQM C;  2HIX A;  4APV A;  3F2C A;  1Y8N B;  4UDU C;  4JI3 L;  1GM5 A;  3EVQ A;  3W5O A;  4JBM A;  1I4Q A;  4N8F A;  1SRU A;  5D65 A;  2RQX A;  3W3A A;  1LM0 A;  4GNX B;  5I2Y A;  2F0F A;  1F2L A;  1LV9 A;  1TII D;  1BCP B;  4HIK A;  4X65 L;  1G6P A;  3D6W A;  3BVG A;  1HNX Q;  4RGO S;  4ZCK A;  1A0I A;  1J5E Q;  4OEL B;  2B2Y C;  2L1B A;  3H15 A;  1EY4 A;  4CKB A;  1CUK A;  4RGM A;  1PFB A;  5AJ3 Q;  3D4D A;  2QKI C;  3DWQ A;  3TS0 A;  1Y8P B;  3M4Q A;  1HFN A;  1LYL A;  4H7B A;  1U9R A;  4HN7 A;  2NTT A;  2JE6 I;  4AYB B;  3I4N B;  5M3F H;  2UXC L;  1P8L A;  2E2H H;  1PFM A;  4RH6 A;  4X62 Q;  5IWA L;  1VQ8 A;  4LFA Q;  1R9T B;  5C0X J;  1SE4 A;  1CA6 A;  1BCP F;  2Z4I A;  3SEB A;  1Q86 C;  1YNJ D;  4K5V A;  3UE0 A;  4C1N K;  3GTK B;  2IX3 A;  5GAH C;  1SMY D;  1TY0 A;  4XYQ A;  4DKA C;  1FR3 A;  2BDO A;  1HPC A;  3NQI A;  2JA7 H;  3K7A B;  3F2D A;  2VQF L;  2LMC B;  2Q8I B;  3HOX B;  4KLK A;  5FLX E;  4CJ0 B;  3GTQ H;  3KLR A;  4MTN A;  2HQE A;  4DV0 Q;  4C3I B;  4A3F G;  3AU7 A;  1BF4 A;  2NVY B;  4K14 A;  5D3I B;  2O4X A;  2ZM6 Q;  5IP9 G;  2R7D A;  1B9N A;  1QE6 A;  4DV1 Q;  3VR6 A;  3JAM c;  1MKH A;  1KNA A;  1Q3L A;  1WTR A;  4WJ3 M;  3I4M H;  5J39 A;  1EEI D;  1K8M A;  2BE5 C;  3BYY B;  2Y0S E;  5G3L F;  3UE1 A;  1FYC A; 
#chains in the Genus database with same CATH homology
 1VMP A;  1TWA B;  1CHP D;  2KA7 A;  5C4J B;  5IIF A;  5CGK A;  4I7Z C;  1DJR D;  2EPB A;  5FK9 C;  2TMP A;  4CKE A;  3S2D B;  1EU4 A;  4CHT B;  3KF8 A;  5J22 A;  5C0X H;  5CV5 A;  2NN6 H;  2PNR C;  4HTH A;  1S5F D;  3ITP A;  1EY6 A;  3HG9 A;  4Z9C B;  2JEA I;  1Z47 A;  4PQX A;  2RSN A;  4NP5 A;  1X3P A;  3LWE A;  2D9U A;  2IL8 A;  4R8N A;  4RCO A;  4QF4 A;  1Y1W B;  3A8K E;  3C46 A;  2AQ1 B;  5KIX A;  2BA1 A;  2FMM A;  2IPK D;  5KYL A;  1F2Y A;  5IGG A;  1NR4 A;  5JPM C;  5I4D A;  4LMQ D;  3PUX A;  1PMR A;  4IUV A;  3H94 A;  2EYO A;  2JA7 B;  2R6G A;  1EY7 A;  2NUC A;  3QG1 A;  2MUY A;  5CC4 A;  2ENB A;  4BA1 I;  1HA6 A;  3DHQ A;  2B2Y A;  2B39 A;  1QB5 D;  1SYD A;  1VMC A;  3I4M B;  3HKZ B;  1V43 A;  3DUZ A;  1RJT A;  2EY2 A;  2WKC A;  3BVM A;  1E2V A;  4DAV A;  3VR3 A;  5C6A A;  1F2M A;  2OXP A;  3RLF A;  1AEX A;  1LTI D;  2C9O A;  3D6C A;  2F0N A;  5EPK A;  4A3D B;  1TWG B;  3RMH A;  1Q12 A;  4H44 C;  1HFG A;  4DA2 A;  5ELD A;  1S5B D;  5COR A;  1LTB D;  4HAE A;  2R93 B;  1CTM A;  3G7L A;  2DNC A;  2YYZ A;  1ZEQ X;  4CBV A;  5BN5 A;  2NYZ D;  3W2D A;  2R7Z B;  1F9P A;  4X3K A;  3MFY A;  1JQY D;  4HCE A;  1SNP A;  2F0Q A;  3H0G B;  2IWH A;  1C4Q A;  1F9Q A;  2F0V A;  3CQZ B;  1E0B A;  3SXH A;  3H6M A;  3K6O A;  2F0G A;  4QUF A;  1YNN C;  2F0S A;  2E2D C;  2L5T A;  1LAC A;  5C5L A;  4KV6 A;  1EZ6 A;  2NZ1 D;  1TY2 A;  1H9K A;  2A74 C;  5C0X I;  4PNY A;  1II3 A;  5BN3 A;  1BXT A;  3AMU A;  3E0J A;  2VUM B;  1DXM A;  5IGC A;  3MWY W;  1Q1E A;  2PMZ B;  1S5E D;  2KVM A;  3D4R A;  2JA5 B;  2EJM A;  4B08 A;  1AZP A;  2O2L D;  4JK1 C;  4Y7N B;  1F9S A;  4F8M A;  4IUR A;  2SEB D;  2NBF A;  2EOT A;  1D6E C;  5DM6 3;  2ID0 A;  1XTC D;  4DU9 A;  5JOB A;  4JBW A;  5JPN C;  1B3A A;  1BUV T;  1UEA B;  1PTO B;  1MBY A;  2KJX A;  1PRT F;  5LL6 X;  2WAQ B;  1IHZ A;  3I72 A;  5K5P A;  3X3N A;  1BO0 A;  4BBS B;  5FOB B;  2O5I C;  3QOJ A;  1GUW A;  1CT1 D;  1IL8 A;  1KLU D;  1SYG A;  5KNB A;  3PUW A;  2EY5 A;  5IOD A;  1ICW A;  1M8A A;  1U4L A;  1BDO A;  1DOL A;  1LT3 D;  1EYD A;  1J9O A;  1A2U A;  5ISR A;  3I70 A;  5JJZ A;  2F0T A;  5CMD A;  3ND9 A;  1UNS A;  3KBX A;  4Q5V A;  4QUC A;  2JEB I;  4M8A A;  3T13 A;  3M4O B;  4HSP A;  4HCS A;  1Y8O B;  1GJX A;  4IFD H;  3C1F A;  3FPU B;  1A3U A;  2KHS A;  2B2U C;  4ZUJ A;  3I90 A;  4ZAI A;  3GV6 A;  4PV1 C;  3TP8 A;  1TVX A;  5I2X A;  3QOL A;  3NTH A;  1EY0 A;  1EZ8 A;  4XQJ A;  1SNC A;  3GTM B;  1EY9 A;  3FEW X;  1WCM B;  2SOB A;  1SFO B;  4ZRZ A;  4HR7 B;  5FO9 B;  3HOY B;  1PLF A;  1ML0 D;  1ENA A;  5IT9 L;  4OHJ A;  2M2L A;  1I4R A;  5KRU A;  3BDC A;  5LHY 1;  3BDO A;  2CHB D;  1A15 A;  3RUZ A;  2F0P A;  1EWC A;  1ZKO A;  3IKJ A;  1HTL D;  3PIP 3;  1RHP A;  3VR4 A;  3MFG A;  2XWB B;  1CM9 A;  1IKL A;  4QCL A;  2F0O A;  4F88 A;  1PRT C;  1QWY A;  1SEB D;  3J7A V;  1WTV A;  1S4Z A;  3CU7 A;  3PO2 B;  1SXT A;  1SYB A;  5CV7 A;  5HGT A;  1I6H B;  4P2C B;  2FHT A;  4ZKB B;  2L12 A;  4A93 B;  1EEF D;  4C1N I;  2EY6 A;  1CFM A;  2K05 A;  2EYH A;  4DNT B;  3OW7 A;  4H13 C;  2L0C A;  1CQF A;  3VR5 A;  3T4A C;  1KAB A;  2QF7 A;  5E1F A;  5KND A;  4MIU A;  1OXX K;  4X3U A;  2EYL A;  3E6Z X;  5TSS A;  2NB0 A;  5I9O A;  1Y69 U;  3OMG A;  2PW5 A;  1I3Q B;  3S1N B;  5T1I A;  1MD2 D;  1E2Z A;  3S15 B;  1V8Q A;  1VDZ A;  1WVL A;  1RF2 D;  3GP7 A;  3VYS A;  3SDZ A;  1TT2 A;  1JC7 A;  2PZU A;  3QIA A;  2QCP X;  4UAI A;  2JSO A;  1ROD A;  4B9W A;  4FXD A;  2VB3 X;  1EY5 A;  2A5H A;  2F0L A;  3S2H B;  1NSN S;  1STG A;  2E2I B;  4IUU A;  1AZQ A;  2MGS A;  4NMZ A;  2OF1 A;  2FIN B;  4Q0F A;  5JAV A;  2WB1 B;  1H9S B;  4IFD I;  3MVV A;  3MXP A;  3HRZ C;  3LNN A;  5C3X A;  2B2U A;  5KGU A;  1QIL A;  1CQV A;  4C3J B;  3RD4 A;  4DXF A;  1ENC A;  1TS3 A;  1A3T A;  3DWA A;  4QMG A;  3BG3 A;  2AUK A;  2R92 B;  2J4X A;  4K8I A;  3M7N A;  1E2W A;  2KOL A;  3Q0A A;  4L6T B;  2AUJ D;  3EA6 A;  4J8Q A;  4QIW B;  2B2T C;  2D2C C;  2A69 C;  1R4P B;  2A73 B;  2VB2 X;  3N6R A;  2V4D A;  4ID6 A;  5IGD A;  2A6H C;  1A6X A;  3QO2 A;  1B44 D;  2LY7 A;  2WAC A;  4C3I G;  3NBH A;  2E75 C;  2PZW A;  5T1G A;  2E2J B;  1STH A;  4OO1 G;  1B50 A;  1X32 A;  3GD7 A;  3NUC A;  4RAU C;  3CRL C;  2JYO A;  3DM1 A;  1D5M C;  4ABN A;  4V19 0;  1DOM A;  4E6I A;  2XWJ B;  4DNR B;  2K6A A;  1KDC A;  2PCF B;  1C8C A;  4KJO A;  1FD7 D;  1ILP A;  2EJG C;  3EQL C;  4KI0 A;  5JVH 3;  5A2Q E;  2A69 D;  3E5S A;  1DM0 B;  2F03 A;  4BWG B;  2A6H D;  1EOT A;  1IYV A;  1JOR A;  3C3L A;  1G6Z A;  2HCI A;  1WTW A;  4J6H A;  2JA8 B;  2MHV A;  2J7Z A;  3URY A;  4DFA A;  4A3F B;  4XT3 B;  4EQN A;  4XDX A;  5ELE A;  5ELC A;  2WKD A;  4DXG A;  4QB4 A;  1NR2 A;  1PFN A;  2PPB C;  2VXW A;  3OHX C;  2NWG A;  2GA4 B;  4EQP A;  5M3F B;  2E2H B;  3HP3 A;  1MSG A;  4IUN A;  4NDX A;  1KDA A;  3CKI B;  5AFW A;  3GTP B;  5DM7 3;  5CV9 A;  3NXW A;  4DGZ A;  3V96 A;  3KUP A;  1HQR D;  5CV6 A;  3GTQ B;  3VA7 A;  1HUN A;  3NQT A;  3ND8 A;  4K6L A;  2IX1 A;  3OIQ A;  1FNW A;  2B2T A;  4LAA A;  5EKK A;  1D2B A;  3GV3 A;  3NPP A;  4ILW A;  4KN4 C;  2ZXP A;  5DNF A;  1CZW A;  1M4V A;  1ET9 A;  2JXM B;  1JR0 D;  1SJE D;  3C2P A;  3TDQ A;  1G2S A;  1STB A;  5M3M B;  3UI2 A;  1F77 A;  5IT9 E;  3VYT A;  2OEO A;  1OO9 B;  4OIJ A;  4MHE A;  2OT2 A;  1RKN A;  2RDF A;  4IN3 A;  1B4O A;  3SK6 A;  2MPM A;  2F0W A;  4RWS C;  3AB9 A;  1RTN A;  4FVM A;  1EIG A;  1H9R A;  2NVT B;  3PIO 3;  1H9J A;  2CW0 C;  2FJ2 A;  3HOV B;  4WOR A;  4X3T A;  2CQA A;  5JVG 3;  1SDF A;  1LTA D;  1I4X A;  2F0I A;  2K28 A;  1BCP D;  2AQ2 B;  2F0K A;  1I50 B;  3WDN A;  2XNA C;  1TS4 A;  2ICI A;  1D1K A;  4ZQ3 A;  2M00 A;  2A6E C;  2Z8L A;  1STN A;  3FMC A;  1U4P A;  4FP5 D;  5EBD A;  2IT1 A;  2HDM A;  2L9H A;  3I4L A;  3T51 B;  2J0T D;  4RGN A;  4LJZ C;  5C4X B;  2XSC A;  4ZK9 B;  3D8G A;  4RHS A;  3K5L A;  3IFD A;  1JOO A;  3K5O A;  2LKV A;  1T5E A;  3J81 L;  3FDT A;  1PRT B;  2EDG A;  1GUN A;  5A2Q L;  2BCO A;  5G3L D;  2CW0 D;  3DWP A;  1V1O A;  3I91 A;  2NVQ B;  4IFD J;  1EWH A;  2DY8 A;  2E74 C;  3BVZ A;  1JIC A;  3M85 A;  1XXG A;  3OWF A;  4DAP A;  5C4H A;  1IW7 D;  2A6E D;  1LT6 D;  2F0U A;  2K5Q A;  3KBG A;  2F1M A;  4HSV A;  1PXU A;  1V1P A;  3NP8 A;  2Z1C A;  1B9M A;  2Z4H A;  1ZYR D;  4FF3 A;  1GOZ A;  1RTO A;  2XRQ D;  4CKC A;  1KTK A;  3JAM E;  1HTP A;  5EQ0 A;  4BY1 B;  2R61 A;  1Z7T A;  3OWE B;  4L8J A;  4RGT A;  4TKO B;  4YIJ A;  1LTT D;  4C3H G;  2ZXR A;  1H9M A;  4K2K A;  1G29 1;  1O78 A;  3OSO A;  5M5W B;  5ELB A;  1ONL A;  2F3V A;  2EYF A;  1ILQ A;  1ESR A;  4RFB A;  4WJW A;  2EVB A;  2I46 A;  4DK0 A;  4KJN A;  3KLS X;  2EYJ A;  1WTP A;  3BZD B;  3OIP A;  3TP6 A;  4FXK C;  3FPP A;  3ERO A;  1TWC B;  1QOH A;  2F0E A;  1WTQ A;  3CHB D;  4G4K A;  1SBB B;  3TZD A;  1UAP A;  2B8G A;  2BA0 A;  1EYA A;  1LTG D;  5IGB A;  3S1M B;  3A55 A;  3U9S A;  1O7L A;  3S1R B;  3K5M A;  2F0M A;  4XYO A;  5I6W A;  2K01 A;  4KD4 A;  2O5J C;  3Q22 A;  3N52 A;  2G9H D;  3HS0 C;  4U68 A;  1JCK B;  2QEJ C;  1QJO A;  3EJI A;  1LLR D;  5LL6 S;  1QNU A;  3SHL A;  2H1E A;  1SND A;  4FXG C;  4CJ2 C;  3VA5 A;  1ET6 A;  1EY8 A;  3DXJ C;  2K03 A;  4PMB A;  4DF7 A;  2XN9 C;  2B8F A;  2RKS A;  1SJH D;  4J1M A;  3R8B A;  1JB3 A;  4ZKC B;  4RCN A;  1NCV A;  4H0L C;  3Q24 A;  3R3O A;  2HCC A;  4A3M B;  1NUC A;  4A3J B;  1CA5 A;  1B2T A;  5CBE E;  4K5W A;  2C5C A;  1QG7 A;  1MSH A;  4R9W A;  3IL8 A;  1PTO C;  1EL0 A;  2BDN A;  4PMW A;  2F0H A;  1EFI D;  3TZU A;  4G7H C;  4L63 B;  3LWU A;  2BOS A;  4B9X A;  3GTL B;  2JA6 B;  2A68 D;  4OL7 A;  4EGV A;  3V05 A;  2WP8 J;  3HZX A;  1BOS A;  1F9R A;  2X6G A;  1JWS D;  1XWE A;  1D5X C;  1FNU A;  1KAA A;  5IOC A;  1RD9 D;  2HDL A;  3I8Z A;  1OXT A;  3K57 A;  2KCN A;  3MZ5 A;  4BY7 B;  5EPL A;  4F7X A;  4KHZ A;  3S17 B;  3MEH A;  1EIH A;  4TQU S;  4OO1 H;  4KMU C;  3M7G A;  4C2M B;  5M5X B;  1GHJ A;  2FMC A;  4LK1 C;  1D5Z C;  2I07 B;  3J80 E;  4X3S A;  4K8J A;  1MI2 A;  1W6K A;  2K5W A;  3JAM L;  3GO5 A;  1J8I A;  3T56 B;  1T5X D;  5CYU A;  2ZXO A;  1XYI A;  4IAL A;  1PTO D;  1STY A;  1Q90 A;  3S16 B;  3OPO A;  4KY7 A;  1OXV A;  2N55 A;  1V1P B;  2EJF C;  1JE4 A;  1G2T A;  1WD1 A;  4RHR A;  4K2L A;  3BS1 A;  1LAB A;  2K7V A;  3M4Y A;  3MA2 B;  1GXD C;  1CZG A;  2L11 A;  2SNS A;  3Q23 A;  3CRK C;  5KEE A;  1WD0 A;  4HED A;  1TWH B;  2WV6 D;  1CK1 A;  2PYK A;  5CBA E;  3L9A X;  1EYC A;  4KKS A;  5JEA G;  3IFT A;  3T53 B;  3K5N A;  5K36 H;  2XRS D;  1SNO A;  3NWS A;  3WOE A;  4IUQ A;  1HUM A;  1FGB D;  2KEC A;  5EKI A;  1K8O A;  2K33 A;  3J81 E;  2R3Z A;  4TRD A;  3PMF A;  3QB3 A;  4K6D A;  1SAP A;  2QIL A;  1RDP D;  3IAY A;  3FRP B;  4PMC A;  3X3M A;  2L55 A;  4KN7 C;  4DAY A;  3TME A;  3MTS A;  5DEH A;  1QCB D;  5COY A;  2EXZ A;  5D3D A;  4M1U B;  1G91 A;  3P20 A;  1X3Q A;  3MAQ A;  4G7Z C;  4FYD A;  1STA A;  1QNK A;  3NWT A;  1JOK A;  4WFN 3;  2B2V C;  1GUT A;  3R93 A;  5EPJ A;  4V0B A;  3PUZ A;  3S9W A;  2EYM A;  4ODG A;  3A54 A;  3TN2 A;  5K36 G;  1TKW B;  3M3Y B;  2JP1 A;  2WII B;  4A3E B;  2AQ3 B;  3VYR A;  3TP5 A;  4BBR B;  1ZXT A;  3GTO B;  1TR5 A;  3J7A F;  4OO1 I;  1GHK A;  2KUM A;  4KKU A;  3G6J B;  2K04 A;  4IZ8 A;  4A3I B;  4ZUI A;  3C1E A;  2EE1 A;  5J1Z A;  2DNE A;  4FNF A;  2BE5 D;  1A3V A;  4XQN A;  2NVX B;  4GZY C;  1HRJ A;  3NK9 A;  1SYF A;  1PDQ A;  5IGF A;  3A8I E;  2K32 A;  1JWU D;  4RKB A;  1W6J A;  3ZYY X;  4KY6 A;  3SVM A;  1IKM A;  5NUC A;  1LT4 D;  3RZO B;  1AFP A;  1BCP C;  5BN4 A;  2KQ3 A;  3A7L A;  3LX0 A;  3J7Y W;  5I6Y A;  5D14 A;  5C0X G;  1GUG A;  4KD3 A;  1OXU A;  4G57 A;  1R4Q B;  1TQO A;  5EBC A;  3D3R A;  3VYU A;  2F3W A;  2X69 A;  2NN6 G;  3J80 L;  3TBI B;  1SE2 A;  3VR2 A;  4KHV A;  4ULL A;  3DMU A;  1B53 A;  4BA2 I;  1S5C D;  1SSO A;  1HCZ A;  4KKT A;  3BYT B;  1STE A;  1Q1B A;  5I9P A;  2MP1 A;  3R2T A;  4WRD A;  1KDB A;  1PTO H;  1C48 A;  3ERQ A;  3PV0 A;  1EQT A;  4CJ1 B;  2LS0 1;  2ZT9 C;  1BBX C;  4XQQ A;  1DD2 A;  3SE0 A;  4OIK A;  4DN4 M;  3L7Z C;  1AN8 A;  1KLG D;  1L0X B;  2IW3 A;  1IW7 C;  2Q8R E;  2XVS A;  3HOZ B;  3H3V C;  1DZ1 A;  2PQE A;  4I65 A;  3TSS A;  3OMC A;  2ICE C;  4IQZ A;  4NW2 A;  1ZYR C;  2M9V A;  1DYQ A;  1LTS D;  2B2V A;  4RKL A;  1Z6H A;  1DOK A;  2WIN B;  3F2U A;  3H91 A;  1RCV D;  2PO4 A;  4DK1 A;  5FLX L;  4XIG S;  5FO8 B;  3K0Y A;  3D4W A;  1PZJ D;  2DY7 A;  5EGT A;  2NN6 I;  4ZLT F;  3L3O C;  1GUO A;  5A35 A;  2RBM A;  4EVO A;  3NHH A;  1I4P A;  1WTO A;  3QWN A;  2TSS A;  1AP0 A;  1SNM A;  1SYE A;  2VNU D;  1O7Z A;  3SR1 A;  3SK8 A;  4BS9 A;  5FO7 B;  3I3C A;  4HMJ A;  5C44 B;  1FNV A;  2PZT A;  1ENF A;  1H9S A;  1NAP A;  5EKL A;  1LT5 D;  2F4I A;  2NTS A;  4KK7 A;  3BDL A;  2FFK B;  3HOU B;  4RA8 A;  2AWO A;  3DEO A;  4EQO A;  3EFX D;  1YNN D;  1PZK D;  1SNQ A;  1CI3 M;  3T16 A;  3NBI A;  1JWM D;  5C5M A;  3NSW A;  3NE5 B;  1PZI D;  3P1H A;  3RZD B;  2RVL A;  3MC0 B;  5M9O A;  1Q8I A;  2Y0S B;  1DCZ A;  2RDH A;  3FVQ A;  2B63 B;  5E4W C;  4CGY B;  3FKI B;  4U67 3;  3SK4 A;  4C56 C;  3P7J A;  1K83 B;  1PTO F;  4KTA A;  1VF7 A;  4O1N A;  4XXE A;  2RA4 A;  2KED A;  4F87 A;  3U9O A;  1AW7 A;  2B2W C;  3SK5 A;  2RSO A;  4FF4 A;  1TWF B;  2KCC A;  3MXG A;  3HEJ A;  3K58 A;  3K59 A;  5CV4 A;  2K5D A;  3H09 A;  3PUY A;  3GTG B;  3ONA B;  2CVR A;  1SE3 A;  2X6L A;  3OOC A;  2E76 C;  4FF1 A;  1UUP A;  3PUV A;  3QJY A;  2F0D A;  2F0J A;  4C3H B;  3PO3 B;  2SDF A;  1I6V C;  3A7A B;  1VF5 C;  1A2T A;  1XX8 A;  1BNZ A;  3KK7 A;  4R8I A;  1TS2 A;  2N88 A;  1U4R A;  3MHB A;  1LO5 D;  1Y1V B;  4K5X A;  5C3E B;  3Q6S A;  2PW7 A;  2D62 A;  2LFN A;  1MGS A;  1I4H A;  3S1Q B;  1DON A;  2G9D A;  5KNC A;  4N9T A;  2KEE A;  2A68 C;  5F2D A;  1F2Z A;  1ESF A;  1O80 A;  1S5D D;  3S14 B;  2DN8 A;  2MJ8 A;  5CR3 A;  1SYC A;  4O42 A;  4ME5 A;  1O7Y A;  1D1I A;  1TU2 B;  4NKL A;  3KLS A;  4OGQ C;  3A8J E;  3P75 A;  5C4Z A;  2YU9 B;  1OXS C;  4IFD G;  5E4X A;  2D5D A;  2SNM A;  3DEP A;  3V2T A;  4MN3 A;  2AWN A;  1TS5 A;  4KY5 A;  4XT1 B;  2EYP A;  4ZYS A;  5JEA J;  1VCI A;  5ELF A;  1HHV A;  5M5Y B;  4A3B B;  2L4N A;  1KNE A;  1G8Z D;  1U4M A;  5IGE A;  4HMI A;  5HUR A;  3GQB A;  1CHQ D;  2EZV A;  2EY1 A;  1EU3 A;  1BR9 A;  2H4O A;  1GUS A;  4FF2 A;  1LTR D;  3I73 A;  1HXY D;  2HUG A;  4IUT A;  3NTK A;  4TSS A;  3R2I A;  5CV8 A;  1WTX A;  5C3W A;  3NTI A;  2IX0 A;  4A3G B;  3A56 A;  4C3J G;  1BQQ T;  1L0Y B;  3MXU A;  1PRT D;  1PYW D;  4FO2 A;  4N9P A;  3MXN A;  3HOW B;  2Q8T A;  2B2W A;  5EJW A;  3O13 A;  5KYI A;  2K1B A;  2QDB A;  5JEA H;  4XTC S;  3HGB A;  1EQV A;  3TP7 A;  1B1Z A;  4G7O C;  1YNJ C;  4S3S A;  3GTJ B;  2RDG A;  2XIW A;  1SMY C;  3D31 A;  5FKA C;  1JOQ A;  1HA5 A;  2IJ0 A;  5DAU A;  5E3F A;  1IYU A;  3WOF A;  1I4G A;  4IUP A;  4A3K B;  1HQM C;  1Y8N B;  4UDU C;  3EVQ A;  1I4Q A;  5D65 A;  2RQX A;  3W3A A;  5I2Y A;  2F0F A;  1F2L A;  1LV9 A;  1TII D;  1BCP B;  3D6W A;  3BVG A;  4RGO S;  2B2Y C;  2L1B A;  4CKB A;  1EY4 A;  4RGM A;  1PFB A;  3D4D A;  2QKI C;  3DWQ A;  1Y8P B;  1HFN A;  4H7B A;  1U9R A;  4HN7 A;  2NTT A;  2JE6 I;  4AYB B;  3I4N B;  1PFM A;  4RH6 A;  1R9T B;  5C0X J;  1SE4 A;  1CA6 A;  1BCP F;  2Z4I A;  3SEB A;  1YNJ D;  4K5V A;  4C1N K;  3GTK B;  2IX3 A;  1SMY D;  1TY0 A;  4XYQ A;  1FR3 A;  2BDO A;  1HPC A;  3NQI A;  3K7A B;  3HOX B;  2LMC B;  2Q8I B;  5FLX E;  4CJ0 B;  3KLR A;  2HQE A;  4C3I B;  3AU7 A;  1BF4 A;  2NVY B;  4K14 A;  5D3I B;  2O4X A;  1B9N A;  1QE6 A;  3VR6 A;  1KNA A;  1Q3L A;  1WTR A;  5J39 A;  1EEI D;  1K8M A;  2BE5 C;  3BYY B;  5G3L F;  1FYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...