1F9SA

Crystal structure of platelet factor 4 mutant 2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
b'DGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGSKICLDLQAPLYKKIIKKLLES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET FACTOR 4
publication title Structure Comparison of Two Platelet Factor 4 Mutants with the Wild-type Reveals the Epitopes for the Heparin-induced Thrombocytopenia Antibodies
rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 10
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9sA00
1EL0A 1PFBA 2X69A 3GV6A 4X3KA 2K28A 4IUVA 3D6WA 1F2LA 2B2YA 4X3TA 1BBXC 1WTWA 3SVMA 1BF4A 2KECA 5EPJA 5T1GA 1HHVA 4CJ0B 1GUWA 2MJ8A 3DM1A 4ZK9B 3KUPA 2B2WC 4RAUC 2FMMA 1KNAA 4IUQA 4QUFA 1F9QA 1WD1A 2B2UC 4OIJA 4XDXA 1E0BA 2RA4A 4RA8A 2FINB 5E4WC 1F9SA 1X32A 1QNKA 2CVRA 1A15A 1HFGA 2JYOA 3I8ZA 3TN2A 4ZLTF 1MSGA 3DEOA 1WTXA 1XYIA 1EOTA 1NR4A 1O7ZA 4OIKA 2NWGA 1WTRA 2FFKB 1BNZA 4ZKCB 1RTOA 2D9UA 1IKLA 2L1BA 3GV3A 2HCCA 3ONAB 4ZAIA 1WVLA 2L12A 1U4PA 3G7LA 1DZ1A 2VXWA 4IUTA 2B2UA 4IUPA 5AFWA 3LWEA 1CA5A 3FPUB 1IKMA 2X6LA 1U4LA 1EIGA 2EPBA 2Q8TA 3DEPA 3IFDA 1ICWA 1SSOA 1LV9A 1RHPA 1G2TA 1SAPA 2FHTA 1B50A 1RJTA 2BDNA 3HP3A 1C8CA 3P7JA 2RSNA 5EPLA 1F9RA 1HA6A 1DOLA 2KEEA 2NYZD 1NR2A 1ML0D 4HCSA 1DONA 3MTSA 3I3CA 3QO2A 4MHEA 3I91A 1WD0A 1PDQA 1QE6A 2L9HA 2J7ZA 1S4ZA 1JE4A 1SDFA 4HEDA 1F9PA 2K1BA 1TVXA 2XIWA 4RWSC 2B2WA 1PFNA 2N88A 1EQTA 2KEDA 4CJ2C 3KBXA 3F2UA 1B3AA 2K01A 5EPKA 1BO0A 3UI2A 1AZQA 1WTPA 4XT1B 3N52A 4X3UA 1PLFA 3R93A 1B2TA 1QG7A 2K04A 1ILPA 1RTNA 1J9OA 4XT3B 1U4RA 1B53A 2IL8A 1HRJA 4MN3A 4O42A 1HUMA 1X3PA 1ILQA 2EE1A 4R9WA 1M8AA 2NZ1D 4LMQD 2K03A 5CMDA 1G91A 5JJZA 3I90A 2HDMA 4U68A 1HUNA 1VMCA 5CBEE 2L4NA 4HAEA 1G2SA 1MSHA 2HUGA 4IURA 2MGSA 5EQ0A 2B2VC 1VMPA 4QUCA 4HSVA 4R8IA 2HDLA 4IUUA 1HFNA 2RVLA 1DOMA 2EOTA 1O80A 1CA6A 2B2TC 5CBAE 5EJWA 2N55A 1B4OA 1MI2A 1ESRA 1NAPA 2JP1A 4CJ1B 1G6ZA 5DNFA 2R3ZA 1IL8A 2SDFA 2KUMA 5EKIA 1J8IA 2B2VA 4X3SA 5D65A 1JICA 5T1IA 1RODA 2DY8A 5CORA 1EIHA 3FDTA 3Q6SA 1NCVA 2MPMA 4DN4M 2X6GA 3H91A 2KOLA 1MGSA 2B2TA 1WTQA 1WTOA 2HCIA 1U4MA 1ZXTA 2B2YC 5COYA 1XX8A 2DY7A 2Q8RE 4NW2A 4UAIA 1KNEA 2KVMA 2H1EA 2M2LA 1AP0A 1O7YA 3MWYW 2RSOA 2FJ2A 1Q3LA 2K05A 3IL8A 3TZDA 4ZKBB 2MP1A 1CM9A 1DOKA 5E4XA 1WTVA 1PFMA 5D14A 2L11A 1X3QA 1AZPA
chains in the Genus database with same CATH superfamily
4JPBW 2PZWA 2N8NA 4PZ6A 1CQVA 4LFAQ 4POGA 1KABA 2EYFA 1NMGA 3D6WA 4ZUIA 2EQSA 1GUWA 1YNJD 5JJLA 2WKCA 5C4HA 4NDXA 3TDQA 1CZGA 4XDXA 1JCKB 1A0IA 3K7UC 4X65Q 5LMNW 4ZLTF 3S1NH 4HSPA 4RFBA 4PMCA 5IE8A 3CRLC 3ULJA 1TS4A 4LFCL 2PZUA 4F8MA 4A76A 1OTCA 5JAVA 3GV3A 1STBA 2O2LD 1CTMA 4A3MB 1N33Q 2IWHA 1FNUA 3H0GH 2F0FA 5FLXL 3CAMA 1PH1A 5CV6A 4EQ5A 4K2KA 4XXEA 3GTOH 4LF7L 1Y8PB 1BCPB 1H9KA 3HKZG 3QO2A 2K52A 4MTNA 2A6HC 1QE6A 2XRSD 2PW7A 2Z4HA 4DV3L 4B9WA 5GQOA 3QOLA 2KEDA 4IPDA 1UUPA 5FJ8H 1VQJA 2Q2HA 1XWEA 4Y7NH 4L5RC 3S1QB 1SYBA 1STAA 2UXCQ 4JI7Q 2IPKD 3P1HA 4DR6L 3F8TA 2WB1B 2Z1CA 3J7AV 1STNA 2JA8G 1SE4A 2R61A 1BCPC 5M5YB 1W6JA 1KAWA 4IURA 5JEAG 1AE2A 3MZ5A 4QGUA 4KHVA 3HOXB 3PIPA 3LGJA 4KLKA 2N55A 3QOJA 1NBWA 2JP1A 1XJVA 4IFDH 3CW2C 3C1EA 1EY0A 3M4PA 5LMNL 3S15B 5IP9H 1EYAA 2NTTA 2QCPX 3L0OA 1IYJB 2E2HB 1OXVA 2ATWA 1WTOA 4JI5Q 3FKIG 1EOVA 5COYA 3J81c 1IYUA 4PNYA 1LTLA 4DV0Q 2EIFA 5C5MA 1TWHH 4DR4L 1QVCA 3HEJA 3M4QA 5IGBA 4O1NA 1GUOA 2DN8A 3CPWA 4FF4A 3D4DA 3ND8A 4P2CB 4XTCS 1TR5A 5M3FB 1TWGH 1CUKA 4LK1C 1DXMA 4BY1B 1V1OA 2RDHA 5C4JH 1I3QB 4JI3Q 3CCEA 1BNZA 3CCSA 1PH5A 4IALA 1HTLD 1IKLA 3D4WA 2L12A 5GAHC 4L5SA 1GD7A 3JAML 2A6HD 2EY6A 2ICEC 2NVQH 2V1CC 1SNDA 2PI2A 4HIMA 1UE1A 4A93G 1KRSA 4JI0Q 1YNND 3NTIA 1KDAA 4RMFA 3PIO3 3CPFA 5IGEA 1HJPA 3NQTA 4DV2L 1XTDA 4B3SQ 3J81j 1KDCA 2LS01 3HRZC 4OL7A 3HOWH 3HGBA 2OCEA 1PDQA 2PYKA 4BBSB 1SYFA 1GXDC 1B3AA 1HNXQ 5DM73 4YCWA 3R93A 1A2TA 1Q90A 1F2MA 2GVBA 1QG7A 3LNNA 4A3LG 4AQYQ 1X3PA 2F0NA 3TSSA 5TSSA 2JK8A 4C3HH 1I4HA 5IP7H 5C0XG 1D5XC 1KAAA 3HOVG 2B8GA 1DD2A 1G2SA 1IBKQ 1WFQA 3PUYA 4LF9L 2NVXH 4ME3A 1LTRD 1STEA 1N8RC 1SNPA 5JEAJ 1CKNA 1Y8NB 4PZ8A 4DV7L 2G9HD 4K6DA 2ALYB 1HR0Q 5A35A 4B08A 2RKSA 3H3VH 5FLXc 4QB4A 4HR7B 1FGBD 2XSCA 3R2TA 4A3EB 2KOLA 4A3IB 3M3YB 1SMYC 1U4MA 1ZXTA 2ICIA 1Y1VG 5F2DA 4Q5VA 3T53B 3D8GA 2BA1A 2CQOA 1SFOH 4ID6A 3IL8A 2EYJA 2XTIA 5JVH3 2OTJA 2VQFL 2D0PA 1QB5D 1EL0A 4R4IA 4DV4Q 4R8NA 3E6ZX 5EPJA 4CJ0B 5IYBH 3DM1A 4FXKC 4UP8A 3S1RB 3H15A 4X6AH 3MXUA 3PCOB 4KTAA 3KF8A 1A15A 1HFGA 1W3SA 3I8ZA 4DAPA 1TKWB 1YZ6A 3D6CA 1NNXA 3I73A 4BY7B 3E5SA 4ZYSA 3I4NB 2NTSA 1K8OA 4DPGA 1RTOA 2OWOA 2I0QA 1H9SB 4OHJA 3HOZG 4A3GB 1U4PA 3V05A 4GZYC 1VQGA 4DR1Q 1G8ZD 1U4LA 1OXUA 1VQ4A 1FVIA 1TS2A 3UDFA 4GN3B 4JYAQ 2SOBA 3EBEA 2JA7B 2AWNA 3GTPB 5DAUA 1C8CA 1JWSD 2EVBA 4ZRZA 4EQOA 4X66Q 3K59A 2JA6G 3A5UA 1MKHA 4GLXA 1DONA 1FJGL 2BH2A 3MVVA 5KRUA 1HZAA 1BBUA 3JAMi 2L9HA 1LABA 4A3KB 2UUBQ 3S16H 3NWSA 3TBIB 3CCMA 2DUDA 4DV1L 1A6XA 1NUCA 4A3BH 5E3FA 2ZTDA 2ID0A 2XN9C 4GS3A 1ASZA 4DUZL 4LF6L 1U4RA 1KTKA 1HRJA 4MN3A 5C3EG 1L0WA 1AEXA 1VQ9A 2YU9B 2WAQE 4LFCQ 1JQYD 3Q23A 5GADC 4DUYL 1PH2A 4EQNA 3I70A 2MGSA 5C0XJ 5EQ0A 1XNRQ 1A62A 1VQBA 3K5LA 2ENBA 4AYBE 2LXKA 1KXLA 5LHY1 2A68C 2ZM6L 1YEZA 1FR3A 3A0JA 1G6ZA 3J7ZC 2LKVA 3JAMc 2K5VA 1D6EC 1BKBA 3EJIA 4YIJA 1VQMA 4DAVA 4LF7Q 2WFWA 2JA9A 1OXXK 2M9VA 1SNOA 1YIJA 1MGSA 2XRQD 2K14A 2R7ZH 1MIUA 2UU9L 3CMAA 2PQEA 4BXXH 2KVMA 5L37A 1V1QA 4YHHL 1M1KC 4DV3Q 1YI2A 5NUCA 5I9OA 4JI4L 3STBD 2NN6G 1AN8A 3NTHA 1ASYA 3CCVA 3BDCA 2HQEA 5E4XA 3VR3A 1PFBA 4WRDA 2RF4A 1A2UA 1ZKOA 2OXPA 2HT1A 2A73B 2KECA 2F0KA 1QZHA 2B63G 4DR6Q 2F0PA 4NXNL 3HKZB 5I6WA 2ZTCA 2VB3X 2D5DA 3CRKC 1H9RA 5BR8L 2R92G 3CCRA 3DWPA 1VQKA 3KK7A 4AYBG 1K3BC 3L7ZC 5IT9E 4ZAIA 4OXPA 5BN3A 5IWAL 1EWHA 1JJGA 3GP7A 1LACA 2MO1A 1J5EL 4HJ9A 2K50A 1GKHA 1V8QA 2O5IC 5LMNQ 3IFDA 4IZ8A 3BVZA 2JA8B 3S2DB 4OX9L 4GOPB 4DNRB 4UP9A 2R93H 1JMCA 2L15A 4A4IA 3OW2A 5IYDH 4KKSA 3OWEB 3EA6A 3PO3G 1VQAA 3S1QH 3AMUA 1I4PA 5C3XA 4A75A 1C7YA 1BOSA 3TMEA 2RDGA 2XIWA 4PMWA 3S17H 3C3LA 1I4GA 2B2WA 1HQRD 2EXZA 1OXSC 1I50H 3HOXH 1SNMA 3FKIB 1HTPA 3S14B 1QILA 1ILQA 3BG3A 5EBCA 1JJ2A 2F0QA 2F4VL 2RCNA 4YWMA 4JVZA 4DF7A 1HUNA 5CBEE 1BXTA 3S15H 2BDOA 1I6HH 5FLMH 4IUUA 4OEMB 1KLGD 4KMUC 4KY5A 2E2HH 2RVLA 4A3DG 4HIOA 3MA2B 2SNSA 2QF7A 1PZJD 4CJ1B 1Q81C 2SDFA 1UAPA 4HTHA 1VCIA 4DV2Q 4XYQA 2F52A 4DK0A 3CQZB 1CKOA 3ULPA 4Q0FA 4FF1A 4PMBA 5J39A 1NE3A 1GHJA 5C6AA 2VQEL 4I7AA 4A93B 2Y0SE 3TZDA 1U0LA 1DOKA 4R4QA 2K4KA 5C0XI 3QJYA 1MHWC 5I4DA 5M5WB 3GV6A 4X3KA 1QVGA 1VQDA 4JI6L 2R6GA 3SVMA 1TY0A 2VUMG 3A7LA 3I56A 4FXGC 4XQJA 1S72A 3EROA 3PUZA 1PH9A 2RA4A 1F77A 1EY6A 5ELCA 1K83H 4LF9Q 2BH8A 2L0CA 3PF4A 4DV7Q 3BZKA 1GUGA 2NVYB 4NMZA 4QIWB 5D3IB 2F0LA 4A3JG 1IKMA 2WP8J 2X6LA 3X3MA 1AW7A 1XTCD 3HOVB 1SEBD 2F0MA 2KCTA 5JVG3 1NR2A 2A6EC 3OW7A 1GM5A 2GVAA 1SYGA 4FDBA 4MHEA 4DFAA 3KLSX 4GNXC 2E5LL 1XMQL 5C44G 4KK7A 2I07B 2VY3A 1YNJC 1L0XB 1G6PA 1ILPA 4DAMA 1J9OA 1Y1VB 3GTQH 3PO2H 1HUMA 3OMCA 2C9OA 1M8AA 1SE3A 2K03A 3W5OA 4O2DA 1XPRA 2E2IB 1CT1D 1EZ6A 1S40A 3NP8A 2B2VC 2AUKA 4DR7L 4A3EH 4PG3A 1RF2D 2EOTA 2PO4A 3KF6B 3K5NA 1WI5A 4OWWB 1MI2A 1ESRA 1PTOD 4LUZA 1I4QA 4WJ4A 2F0DA 4JI1L 3P20A 2B2VA 4K0KL 3S24A 3J80i 1B9NA 3H6MA 2IHEA 3BYYB 4KHPL 3EIVA 4DV6L 1YITA 4DN4M 3HOZB 3GDEA 4JV5L 3KYHC 1FJGQ 1FD7D 4ZCKA 2H1EA 4DV1Q 3DMUA 3J7A5 1PRTD 4O0AA 4OO1I 5I2YA 1O7IA 3C46A 5KEEA 2K5DA 1HNZL 3U4ZA 4WJWA 1KQSA 2Z4IA 4DUZQ 2E8GA 2JA6B 5C3WA 3K81C 1DCZA 1QZGA 3G71A 3TQYA 1LTTD 4M1UB 4ME5A 1BVSA 1EZ8A 2E74C 2F0OA 4Z9CB 3VDYA 4DUYQ 2UXDQ 3NUCA 2O4XA 2JYOA 3GTGH 3C2PA 1UE7A 1LLRD 3KJOA 1G291 4XIGS 4NPSA 4B3RL 3J80c 2JSOA 4KHZA 4JCVE 1K3RA 3L2PA 1DZ1A 2WINB 5C3EB 5CGKA 2Q8TA 1DGSA 1SR3A 3AYHB 1S5ED 2UUAQ 1LV9A 1RHPA 1SNQA 3K7AH 1YBYA 5EGTA 2NN6I 1ENAA 2PQAB 1N34L 1TXYA 4K5VA 3MAQA 2RSNA 1R9TH 1XMOQ 3U4VA 1II3A 4YWLA 4YHHQ 4QCLA 3K5MA 2JA5G 4JI4Q 1EYCA 2A5HA 2IHFA 1WD0A 1S4ZA 2VB2X 1LUZA 3H0GG 3F2UA 1WTPA 3SHLA 1KDBA 4NXNQ 2PZTA 2E2DC 4G57A 2NZ1D 1STGA 1HPCA 5BR8Q 4LF5L 3GTLB 1SNCA 4WJ3M 4JBMA 1Q1EA 2HUGA 4KJOA 4MZ9A 1EY4A 4LJZC 5IWAQ 3CKIB 1TS5A 3CCUA 1X3FA 1J5EQ 3HOYG 2HHHL 1LTID 1XNQL 2B63B 4V190 1X65A 3TZUA 2Q2IA 5EJWA 1Z7TA 2PQAA 1WCMH 1NAPA 2CWAA 1EY8A 4OX9Q 4YY3L 1GUNA 3IAYA 1YNNC 1GUSA 4CKCA 3J81i 2C35B 5T1IA 1TU2B 4A3FH 2R92B 4AYBB 3FEWX 3NHHA 1BQQT 3E3XA 3RLFA 4U673 1E1TA 2F0WA 5CV5A 3CP0A 1P16A 2B2YC 3Q0AA 4LFBL 4NW2A 2JXMB 1AP0A 3BJUA 2JJQA 2FJ2A 2AWOA 5IIFA 1NTGA 2MP1A 2UXBQ 1I4RA 2B2YA 3J7AF 3PO3B 1Z47A 1TS3A 5T1GA 3H94A 2OQKA 2F3WA 1KNAA 2EYHA 4WORA 1B50A 2N78A 1WTXA 1N9WA 1YHBA 1JB3A 5E7NA 3ONAB 4IUNA 5IGDA 4DXFA 2I46A 3S9WA 2YV5A 3P75A 4HCEA 4LWCA 3G4SA 1PTOH 1PZID 1VQIA 4FP5D 2HIXA 1A8VA 4QF4A 1CFMA 5KGUA 4A3DB 2PMZE 3FKIH 1HA5A 5KYLA 3S14H 1N32L 1XXGA 2VQEQ 5GROA 4POFA 3CHBD 1DYQA 1TWFH 2KCNA 2MO0A 3RLOA 4G7ZC 3O13A 5IYCH 3N52A 1B2TA 1E2ZA 5FK9C 5H1SE 1CKNB 1GJXA 4RG1A 3Q22A 3ULLA 1EQRA 3EQLC 3K57A 1ET9A 3BZDB 4GN5A 4UHVA 3RR5A 2UUCQ 2F0TA 2VUMB 4C1NI 1PTOF 3HOUH 3CQZH 1K8MA 3OWFA 2LSSA 3UE1A 4C3IH 4A93H 4B3TL 1JICA 1K8AC 3M7NA 5C4XH 1NCVA 5IT9L 1EIFA 4C3HG 5IP7G 4IQZA 1AFPA 4CDCC 1UE5A 5ELEA 3CMEA 3RLNA 4A3JB 2K5NA 1PRTF 3AFPA 4A3CH 1VQPA 2E5LQ 4IN3A 1I6VC 1Q3LA 1XMQQ 4UY8C 2Q2UA 3U9OA 3KF8B 1X3QA 3RZOB 1MJCA 4H0LC 5DLQE 3HS0C 1F2LA 1LO5D 3VYSA 1OXTA 1A3UA 2BCOA 5FO9B 3QR8A 4A3LH 2LXJA 4IFDJ 5AJ3Q 5HGTA 4CHTB 2D2CC 1WD1A 4OIJA 5M5XB 1T5EA 3I4MH 4DA2A 5JOBA 4EQPA 1QNKA 3HOVH 4DGZA 4NB3A 4RGNA 4E6IA 2QDLA 5C44B 1VQHA 3GTMH 5K5PA 1H95A 4XQQA 5JPNC 4FO2A 3M4YA 1G51A 5I2XA 2TSSA 2AQ2B 3K0YA 1PYSB 4DK3C 1VQ8A 3W3AA 2JN4A 4GN4B 5IYBG 2VW9A 4L6TB 1VDZA 3VA7A 5IGFA 4JV5Q 3D3RA 4DR2L 4KJNA 3WDNA 2Z6KC 4HCSA 3STBC 4P72A 3OTOL 2QDBA 3I91A 1X54A 4K8IA 2F0JA 3M4OH 1X6OA 1TVXA 2K1BA 1HNZQ 4IPCA 3CCQA 1PFNA 3DLLA 2C5CA 4CKEA 2AQ3B 2F4IA 2CHBD 1JOKA 1AZQA 1B9MA 2Z6KA 1HNWL 1KHIA 1WTHA 3AQQA 2OF1A 2K04A 2L5TA 3F2CA 1GVPA 4HJAA 3E0EA 1O78A 4F88A 1PA6A 2KENA 5M3MH 3S1MH 3S2HB 3BVGA 1QVFA 2K33A 5A2QL 3HOZH 1PYWD 1D1KA 4UDUC 1B44D 3LWUA 4A3BG 3UDXA 2QEXA 3K5OA 2KUMA 1PVOA 4LF4L 1YJNA 3A8JE 1N34Q 4I65A 4OWXB 4LNQA 1EIHA 1JWUD 4JI2L 2FMCA 2JA6H 2J4XA 2DY7A 3GTJH 4ZQ3A 5FO8B 1IXRA 4CGYB 1SN8A 2IJ0A 1I94L 1GUTA 3KDFA 2L11A 2EY2A 1QNUA 3QB3A 3KFUA 3S1NB 4JOIC 4RGTA 1JOOA 3SGIA 1ESFA 1WTWA 4NXML 1X3EA 1RKNA 3T56B 4OO1H 2JA5B 1NMFA 4QUFA 4IUQA 4LF5Q 4BBRH 4IJLA 1Q1BA 2NBFA 1LT6D 1X32A 2R7ZG 3TN2A 1Y1WG 1K8GA 3H0GB 1VS0A 3URYA 4CDDC 1WTRA 4JOIA 5IGCA 1R4PB 2L1BA 1XNQQ 1QUQA 1W6KA 4YY3Q 4JC0A 2F0HA 1L1OC 2H5XA 1VQEA 1X9NA 3DEPA 4LFAL 3NBHA 3PF5A 4A3MH 1Z6HA 4RCNA 2IX1A 3HP3A 3SXHA 2F03A 3IKJA 4LFBQ 3HOYB 2SNMA 2WAQG 1F9RA 3CCJA 2NYZD 2PW5A 2PNHA 5IT9c 1L1OA 1CSQA 1CHQD 1F2YA 2F0IA 3CXCA 3F2DA 1CQFA 2J7ZA 5ELDA 2NN6H 4JBJA 3GTLH 1K73C 1JE5A 1W2BA 1N33L 3I7FA 2I5MX 4XT1B 2R7FA 3R3OA 1NSNS 1S5FD 4CBVA 2PCFB 2EJMA 1RTNA 4XT3B 1E7ZA 2LY7A 4L5QA 3G48A 2R93G 5K36H 4N9TA 1G91A 2EZVA 5IYDG 2HDMA 2CFMA 1TIID 2ZJPA 1BBWA 5ELOA 2L4NA 1JJCB 4OWTB 1SYEA 2RHSB 4CKBA 1HZCA 1SYCA 4DR4Q 1ICFB 4EVOA 1PH3A 5HGQA 1CA6A 1SRUA 1VF7A 4G4KA 2F0VA 5CV7A 1Q82C 5M5YH 1D7QA 3NENA 2K75A 5LMUL 2R3ZA 5EKIA 2B39A 1IHZA 5CORA 3T1YL 2UXCL 3BS1A 2BOSA 2X6GA 3IRBA 1TWHB 1Z9FA 4Y52H 5LL6X 3T1HL 4YCUA 1N32Q 1K28A 4M8AA 3AB9A 5FLMG 3FRPB 2M00A 2K05A 4TSSA 4EGVA 1PFMA 4H13C 1AZPA 3I4LA 3VR2A 2Z0SA 4FNFA 1PHJA 4DXGA 5C4JB 3PUVA 2K6AA 5CV4A 3SK5A 1S3OA 2FMMA 4C2MB 5JPMC 3PGZA 2DJGC 4JK1C 1E0BA 1C0AA 2NB0A 4YWKA 2CWPA 4C3JG 4JI5L 2NVQB 2MFIA 4X64L 2VL6A 4L63B 3NBIA 5M3FH 4BY1H 4A3DH 1VQ6A 3G7LA 1PTOC 1V1PA 2ZXPA 5AFWA 1CA5A 1I3QH 2DNCA 2EYMA 3SK4A 1MD2D 2F0EA 5A2QE 1EY5A 1ICWA 1LT4D 4DU9A 4NP5A 2TMPA 3ER0A 3DHQA 3A56A 1CI3M 4KI0A 5C5LA 4P74A 1Q46A 1LTAD 3L9AX 1DOLA 4JI8L 2RQXA 3RUZA 1PRTC 3TS0A 4JI3L 4DK6C 1EIYB 2A74C 3A55A 1E2WA 4HJ8A 2CQAA 1YJ9A 2LFNA 4GNXB 4CJ2C 3KBXA 2HQLA 3KJPA 4R4OA 5J22A 4C3HB 4DAYB 3BU2A 3T4AC 3VR6A 4DR3L 2VUMH 4DNIA 2KQ3A 4BBSH 1PMRA 4JBWA 2NVXB 4JI0L 4KY7A 1VMCA 3VYTA 5EKKA 5G3LD 1Q7YC 2O5JC 4MIUA 4B3SL 3NPPA 4QUCA 4HSVA 1VQLA 4HN7A 3ERSX 2Y0SG 1S5BD 2H4OA 1O80A 3NWTA 4AH6A 2VQFQ 1IW7D 4OONA 2BE5D 1LTGD 3TP5A 1XPUA 2ZXOA 1PFSA 4KD3A 1NY4A 4G7OC 4PV1C 3PO2G 1IL2A 2GN5A 4AQYL 1PH6A 1PV4A 1SFOB 2ASBA 5JJKA 3BVMA 4TVAB 4GNXA 3DM3A 2ZXRA 3RZDB 3F2BA 2KCMA 3T16A 2J0TD 3WOEA 4DAYA 1IBKL 1Y14B 4A3IH 3H3VC 3M3YH 2ES2A 3HFZB 1FGUA 3CU7A 2K7VA 2N49A 3BZCA 1HNWQ 1B1ZA 2DGYA 3T13A 1RD9D 4RHRA 4F7XA 2B29A 2F0UA 1IBML 3KLSA 3EFXD 4ALPA 5HY6A 2KHJA 1F9QA 2B2UC 4RHSA 3QG1A 4HIDA 1GHKA 4TRDA 1SBBB 1MSGA 2PPBC 3BDOA 1WYDA 3S1RH 1UE6A 3OIQA 4IUTA 1Y8OB 2IX3A 2B2UA 3W2DA 3FPUB 4BY7H 1T5XD 3M9BA 2JQOA 1EYDA 3I4NH 1EIGA 2F1MA 4DV5L 2G5DA 4LF6Q 3TRZA 3E9HA 4A3GH 2FXQA 1JORA 1M4VA 4I7ZC 1TY2A 1EU4A 4A3BB 1VQFA 2SEBD 5CV9A 1RCVD 2YTVA 1DJRD 3MTSA 2JA7H 3OIPA 1LYLA 3GTPH 1I94Q 3PIP3 2ZM6Q 4RH6A 4AIMA 5FOBB 1SROA 4K6LA 4HJ5A 2N88A 3I55A 5EPKA 4A3KH 5CV8A 2IW3A 1PH7A 3PQIA 4R9WA 2IX0A 4LMQD 2MQHA 4R4TA 5KNDA 2UU9Q 4DK1A 5EAYA 1LM0A 3HKZE 4XYOA 1VMPA 3FVQA 3JC66 1S5CD 2HDLA 3MEFA 1BR9A 2QEJC 1ENFA 2YU9H 1QOHA 1PXUA 3OSOA 5CBAE 3CC7A 4G7HC 2NUCA 5IY0A 1SE2A 5FKAC 1Y1WB 2R7ZB 4CDFC 3KOJA 1HZ9A 5D65A 1RODA 2DY8A 2KA7A 1H9JA 3H91A 3CC4A 2RHQB 3DWAA 2EDGA 3T51B 2NVTB 3A8IE 2JA5H 1B70B 4APVA 1XNRL 1STHA 2RDFA 4FYDA 2QILA 1WTVA 3GTKB 1WCMG 1UEBA 5FJ8G 1GO3E 4OELB 4IUVA 2WAQB 2ZT9C 3ITPA 2K32A 1A3TA 3UDGA 1J6QA 2CH4W 4A3FG 5J1ZA 4ZK9B 3OHXC 1QCBD 2RCFA 4N8FA 4K8JA 5E4WC 4DR5L 1F9SA 3MFYA 1ZYRD 3WWVA 3J7YW 1SJHD 1D5MC 2Q8IB 1X3GA 3AU7A 2K5WA 4ZKCB 1V9PA 2L55A 3HOYH 4P71A 1N36L 4IOAA 2R93B 5LMUQ 3RD4A 2XVSA 4BS9A 1VF5C 3A54A 4IFDG 3GD7A 1ET6A 3T1YQ 4OGQC 1SSOA 5IOCA 1G2TA 3NXWA 2MHVA 5IP9G 5D3DA 2F4VQ 4C56C 3T1HQ 4J8QA 3TP6A 3HKSA 3BDLA 3S17B 2JA8H 3MXPA 1KIXA 1C4QA 3S2DH 4TQUS 5JEAH 2EY5A 1I50B 2EYPA 3OPOA 3W1BA 3SEBA 4HEDA 1PH4A 4IOCA 5CYUA 2XNAC 2K01A 3UI2A 3I2ZA 1PLFA 2D62A 2ZTEA 1B53A 1I6HB 4O42A 3FPPA 3D31A 5JJZA 5G3LF 4X64Q 2CH4A 2E76C 3NSWA 3R2IA 1Q8IA 1MSHA 4FF3A 3J81E 3SK6A 1FYCA 1D2BA 3DUZA 2GA4B 5ELNA 3OOCA 3FMCA 5IYCG 3E0JA 4JI6Q 1ZEQX 5ISRA 4C3JB 1TWAB 4QIWE 1HH2P 2WKDA 2MPMA 1L0YB 2YYZA 4JI8Q 1OO9B 3SDZA 4ULLA 2OQ0A 5KYIA 1I5FA 3R8BA 1E3PA 4XQNA 2MNAA 3HOWG 4C2MH 4FVMA 3MWYW 1LT5D 2E2JB 3HOUG 1CK1A 1EY9A 1M90C 2EJFC 1CM9A 2I5HA 3TREA 2ZJRA 4DR3Q 2A19A 3UDIA 2K28A 5FO7B 1K83B 4C3IG 1PYBA 2IY5B 4KKTA 2AHOB 1UNSA 2MJ8A 4KN4C 2Q2TA 5C4XG 2CW0C 2LMCB 1D5ZC 2FINB 5M5WH 1IZ6A 2CVRA 1PZKD 1KD1C 1NR4A 1U9RA 2FFKB 4A3CG 3N6RA 4QQBX 1BCPD 1VQNA 1WVLA 5EBDA 3ERQA 3U50C 5HURA 4IUPA 4RKBA 3LWEA 1STYA 1TQOA 4KD4A 2NVYH 2KHSA 3I4MG 1Q8KA 2Y0SB 5EPLA 5C0XH 3DWQA 3MXGA 1ML0D 4DR7Q 1TT2A 1TWCB 1D8LA 1HZBA 1SDFA 3NTKA 1UEAB 2CCZA 3GTQB 1SYDA 3CC2A 2HIVA 3PO2B 2MUYA 4PZ7A 1IBMQ 3A7AB 4JI1Q 4K0KQ 1RIPA 3QIAA 4B3ML 4X62L 1IBLL 4KHPQ 2IL8A 4DV6Q 1EYGA 3WOFA 5CMDA 5I9PA 5FLXE 1EQQA 1F2ZA 1HQMC 1K0SA 5LL6S 4GKJL 1K9MC 1Y1VH 3Q8DA 3D0FA 3KLWA 1HFNA 2HD3A 4MNOA 2EYOA 4LAAA 5JJIA 2E2IH 3RZDH 4DV5Q 1P8LA 2B3GA 5IODA 3NE5B 4R4CA 1YJWA 3FHWA 1WOCA 3KDFB 4IPGA 4F87A 1H9MA 5M3MG 3PIOA 3OYYA 2BA0A 3IFTA 2CW0D 5KNCA 4B3RQ 2AKWB 2NZOA 1HCZA 4LW1A 1YHAA 1EUJA 3HG9A 4H44C 2RSOA 2CKZB 2ZJQA 3GO5A 1B7YB 3KBGA 1IYVA 1VQCA 2KJXA 1KRTA 3GTGB 1MBYA 1JB7A 1VQ7A 1CZWA 2YTXA 1QUQB 1SLJA 4TKOB 3KUPA 4QJFA 3K6OA 2EXDA 4K5WA 4RA8A 3NEMA 4LF8L 5GAGC 4IO9A 3RNUA 1XYIA 1EOTA 3NBHB 1O7ZA 1SMXA 2D9UA 1S5DD 2HCCA 4GKKL 1PH8A 3K7AB 1ONLA 4ODGA 1L2FA 1Q86C 2E75C 1L1OB 1KL9A 2EPBA 3TEHB 1R9TB 2F3IA 1EEID 4OO1G 1A63A 3SE0A 2VNUD 5KNBA 1H9SA 1RJTA 4BBRG 3FP9A 5C3EH 4V0BA 2RBMA 3VYUA 4KV6A 1HA6A 2UXDL 1EFID 1A3VA 1SMYD 4BXXG 1EWIA 4R1JA 2KCCA 4J15A 1JE4A 1YHQA 2HHHQ 1F9PA 2WB1E 3A74A 3PSIA 4QL5A 4WFN3 2F0SA 3K80C 3HZXA 3GTOB 2QGQA 3W1GA 2KHIA 2JE6I 1CKMA 4A3MG 2XGTA 3JAME 2UUAL 4RGMA 3SK8A 3I4OA 2QA4A 4DR5Q 1FL0A 4RCOA 4U68A 3ICEA 3G6EA 1Y1WH 1C48A 3NELA 4ZUJA 4HAEA 1XMOL 1WCMB 4X65L 4IFDI 1BDOA 3BYTB 1N36Q 3MFGA 4Y7NB 3NQIA 3NK9A 3OMGA 5IGGA 4A3FB 2PI2E 1JWMD 5J3BA 2NVTH 1EEFD 1KC8C 1IL8A 3G6JB 3D4RA 2WACA 2B63H 1ENCA 1RDPD 4P75A 1MJEA 3Q6SA 3GTKH 5K36G 2XWJB 1E24A 4EX5A 4BA2I 1WTQA 2HCIA 1AE3A 1E1OA 2NZHA 2Q8RE 1KNEA 1E2VA 2EJGC 2R92H 2WB1G 1E22A 3H09A 1V43A 1QWYA 3CCLA 3VR5A 3PV0A 3PUXA 3EVQA 1JT8A 1B8AA 3UE0A 2YTYA 5EKLA 3HOXG 1EU3A 3TS2A 2K5QA 1HHVA 2EY1A 2B2WC 1V1PB 4RAUC 4UPAA 2AUJD 4JI7L 3ND9A 1D1IA 1KLUD 3PO3H 4H7BA 3DEOA 1BCPF 4JBKA 1O7LA 2NWGA 1IW7C 4DKAC 1PTOB 2VXWA 2BE5C 2AQ1B 2A68D 2UXBL 1Q12A 1TWGB 1JC7A 1QJOA 1EY7A 1T9HA 4K2LA 1EQVA 1SAPA 2EYLA 4GOPC 1I4XA 2BDNA 3LX0A 1Y69U 3J80L 3MC0B 3P7JA 1TWFB 1X56A 1PRTB 5M3FG 2WV6D 4BY1G 1LTBD 5E1FA 4DV0L 4GOPA 2JEAI 2N3SA 3TP8A 1EQTA 2OT2A 3X3NA 5BN4A 4UP7A 4ILWA 1X55A 4B3TQ 3A8KE 3QWNA 1HXYD 3A5ZB 2OTLA 4KN7C 4K5XA 3HOWB 1GOZA 3I90A 3SR1A 1HR0W 1VQOA 3M85A 3HOUB 4C3JH 5DM63 1TWAH 1YVCA 4L5TA 2DJFC 3Q24A 4C3IB 4C1NK 3H3VI 3K58A 1DOMA 1FNVA 4JG2A 5C4XB 2B2TC 4BWGB 3TP7A 4HMJA 4N8X1 4LUVA 2E2JH 2PMZB 3ZJYC 5DNFA 3M7GA 4BBSG 1AH9A 3VR4A 4X3SA 2DNEA 4HJ7A 2G9DA 4BA1I 2QW7A 4J1MA 3K0XA 2JEBI 2Z9HA 2B2TA 3L3OC 4JW0A 3GQBA 4HIKA 3KLRA 1LT3D 4UAIA 2V4DA 2M2LA 2A69C 4J6HA 5I6YA 1LTSD 3AEVA 3CF5A 5GAEC 2UUCL 2VZAA 2Z6BA 1SXTA 4ABNA 2D0OA 4A3JH 1R4QB 3I4MB 2X69A 4B3MQ 4X62Q 3PMFA 1IBLQ 4RKLA 4X3TA 1BBXC 1BF4A 1HNXL 3U58A 3GTMB 5ELFA 4KKUA 1C9OA 3RZOH 4DR2Q 3I72A 4IPHA 2KBNA 4GKJQ 4K14A 1CHPD 1YNXA 3OTOQ 4OIKA 3RMHA 4A3EG 1UWVA 5M5XH 3MXNB 1EFWA 4FF2A 4A3IG 4GLAC 4NKLA 3E9IA 3V2TA 1TWCH 5C44H 2A8VA 3PUWA 1VQ5A 3MEHA 4HMIA 1HR0L 3CD6A 4GLVB 2FHTA 3J81L 5CC4A 5AJ3L 3M4OB 4RGOS 4YCVA 5C4ZA 2KEEA 5BN5A 2A1AA 1B3QA 3I3CA 4KY6A 4CDEC 2PNRC 3V96A 4RWSC 2B8FA 3RN5A 5M9OA 2IT1A 4L8JA 4BY7G 3I4NG 4S3SA 1BO0A 2VS1A 5M3MB 4X3UA 4LF4Q 3S1MB 3B6YA 4A3GG 3ZYYX 4MTKA 2I5LX 4DV4L 1XPOA 1BUVT 1K0RA 1FNWA 4LF8Q 5DEHA 2EE1A 4JI2Q 1ZYRC 3MXNA 3S16B 3MHBA 4FXDA 2QKIC 5KIXA 2JA7G 4GKKQ 4N9PA 4R8IA 1SJED 5ELBA 4H02A 2A69D 3RN2A 3S2HH 1B4OA 1JOQA 4P73A 1RL2A 2F0GA 4DR1L 4NXMQ 2R7DA 2OEOA 2Z8LA 4A3KG 1WJJA 1J8IA 3GTJB 4IJHA 4QY7A 2XWBB 3K8AA 4QMGA 1EWCA 3FDTA 4DNTB 4JYAL 1U5KA 3AFQA 2P5ZX 4B9XA 1DM0B 1NJIC 3VYRA 3KF6A 2WIIB 2K5HA 1SE8A 5CR3A 1XX8A 2F3VA 3DXJC 4X66L 1CSPA 3C1FA 1JR0D 2AMCB 1O7YA 2A6ED 3U9SA 4LUOA 3F1ZA 3J80E 3EN2A 4ZKBB 2UUBL 5D14A 4PQXA 3VA5A 4BBRB
chains in the Genus database with same CATH topology
2PZWA 1CQVA 1KABA 2EYFA 3D6WA 4ZUIA 1GUWA 1YNJD 2WKCA 5C4HA 4NDXA 3TDQA 1CZGA 4XDXA 1JCKB 4ZLTF 4HSPA 4RFBA 4PMCA 3CRLC 1TS4A 2PZUA 4F8MA 5JAVA 3GV3A 1STBA 2O2LD 1CTMA 4A3MB 2IWHA 1FNUA 2F0FA 5FLXL 5CV6A 4K2KA 4XXEA 1Y8PB 1BCPB 1H9KA 3QO2A 2A6HC 1QE6A 2XRSD 2PW7A 2Z4HA 4B9WA 3QOLA 2KEDA 1UUPA 1XWEA 3S1QB 1SYBA 1STAA 2IPKD 3P1HA 2WB1B 2Z1CA 3J7AV 1STNA 1SE4A 2R61A 1BCPC 5M5YB 1W6JA 4IURA 5JEAG 3MZ5A 4KHVA 3HOXB 2N55A 3QOJA 2JP1A 4IFDH 3C1EA 1EY0A 3S15B 1EYAA 2NTTA 2QCPX 2E2HB 1OXVA 1WTOA 5COYA 1IYUA 4PNYA 5C5MA 3HEJA 5IGBA 4O1NA 1GUOA 2DN8A 4FF4A 3D4DA 3ND8A 4P2CB 4XTCS 1TR5A 5M3FB 4LK1C 1DXMA 4BY1B 1V1OA 2RDHA 1I3QB 1BNZA 4IALA 1HTLD 1IKLA 3D4WA 2L12A 3JAML 2A6HD 2EY6A 2ICEC 1SNDA 1YNND 3NTIA 1KDAA 3PIO3 5IGEA 3NQTA 1KDCA 2LS01 3HRZC 4OL7A 3HGBA 1PDQA 2PYKA 4BBSB 1SYFA 1GXDC 1B3AA 5DM73 3R93A 1A2TA 1Q90A 1F2MA 1QG7A 3LNNA 1X3PA 2F0NA 3TSSA 5TSSA 1I4HA 5C0XG 1D5XC 1KAAA 2B8GA 1DD2A 1G2SA 3PUYA 1STEA 1LTRD 1SNPA 5JEAJ 1Y8NB 2G9HD 4K6DA 5A35A 4B08A 2RKSA 4QB4A 4HR7B 1FGBD 2XSCA 3R2TA 4A3EB 2KOLA 4A3IB 3M3YB 1SMYC 1U4MA 1ZXTA 2ICIA 5F2DA 4Q5VA 3T53B 3D8GA 2BA1A 4ID6A 3IL8A 2EYJA 5JVH3 1EL0A 1QB5D 4R8NA 3E6ZX 5EPJA 4CJ0B 3DM1A 4FXKC 3S1RB 3MXUA 4KTAA 3KF8A 1A15A 1HFGA 3I8ZA 4DAPA 1TKWB 3D6CA 3I73A 4BY7B 3E5SA 4ZYSA 3I4NB 2NTSA 1K8OA 1RTOA 1H9SB 4OHJA 4A3GB 1U4PA 3V05A 4GZYC 1G8ZD 1U4LA 1OXUA 1TS2A 2SOBA 2JA7B 2AWNA 3GTPB 5DAUA 1C8CA 1JWSD 2EVBA 4ZRZA 4EQOA 3K59A 1DONA 3MVVA 5KRUA 2L9HA 1LABA 4A3KB 3NWSA 3TBIB 1A6XA 1NUCA 5E3FA 2ID0A 2XN9C 1U4RA 1KTKA 1HRJA 4MN3A 1AEXA 2YU9B 1JQYD 3Q23A 4EQNA 3I70A 2MGSA 5C0XJ 5EQ0A 3K5LA 2ENBA 5LHY1 2A68C 1FR3A 1G6ZA 2LKVA 1D6EC 3EJIA 4YIJA 4DAVA 1OXXK 2M9VA 1SNOA 1MGSA 2XRQD 2PQEA 2KVMA 5NUCA 5I9OA 2NN6G 1AN8A 3NTHA 3BDCA 2HQEA 5E4XA 3VR3A 1PFBA 4WRDA 1A2UA 1ZKOA 2OXPA 2A73B 2KECA 2F0KA 2F0PA 3HKZB 5I6WA 2VB3X 2D5DA 3CRKC 1H9RA 3DWPA 3KK7A 3L7ZC 5IT9E 4ZAIA 5BN3A 1EWHA 3GP7A 1LACA 1V8QA 2O5IC 3IFDA 4IZ8A 3BVZA 2JA8B 3S2DB 4DNRB 4KKSA 3OWEB 3EA6A 3AMUA 1I4PA 5C3XA 1BOSA 3TMEA 2RDGA 2XIWA 4PMWA 3C3LA 1I4GA 2B2WA 1HQRD 2EXZA 1OXSC 1SNMA 3FKIB 1HTPA 3S14B 1QILA 1ILQA 3BG3A 5EBCA 2F0QA 4DF7A 1HUNA 5CBEE 1BXTA 2BDOA 4IUUA 1KLGD 4KMUC 4KY5A 2RVLA 3MA2B 2SNSA 2QF7A 1PZJD 4CJ1B 2SDFA 1UAPA 4HTHA 1VCIA 4XYQA 4DK0A 3CQZB 4Q0FA 4FF1A 4PMBA 5J39A 1GHJA 5C6AA 4A93B 3TZDA 1DOKA 5C0XI 3QJYA 5I4DA 5M5WB 3GV6A 4X3KA 2R6GA 3SVMA 1TY0A 3A7LA 4FXGC 4XQJA 3EROA 3PUZA 2RA4A 1F77A 1EY6A 5ELCA 2L0CA 1GUGA 2NVYB 4NMZA 4QIWB 5D3IB 2F0LA 1IKMA 2WP8J 2X6LA 3X3MA 1AW7A 1XTCD 3HOVB 1SEBD 2F0MA 5JVG3 1NR2A 2A6EC 3OW7A 1SYGA 4MHEA 4DFAA 3KLSX 4KK7A 2I07B 1YNJC 1L0XB 1ILPA 1J9OA 1Y1VB 1HUMA 3OMCA 2C9OA 1M8AA 1SE3A 2K03A 2E2IB 1CT1D 1EZ6A 3NP8A 2B2VC 2AUKA 1RF2D 2EOTA 2PO4A 3K5NA 1MI2A 1ESRA 1PTOD 1I4QA 2F0DA 3P20A 2B2VA 1B9NA 3H6MA 3BYYB 4DN4M 3HOZB 1FD7D 2H1EA 3DMUA 1PRTD 4OO1I 5I2YA 3C46A 5KEEA 2K5DA 4WJWA 2Z4IA 2JA6B 5C3WA 1DCZA 1LTTD 4M1UB 4ME5A 2F0OA 1EZ8A 2E74C 4Z9CB 3NUCA 2O4XA 2JYOA 3C2PA 1LLRD 1G291 4XIGS 2JSOA 4KHZA 1DZ1A 2WINB 5C3EB 5CGKA 2Q8TA 1S5ED 1LV9A 1RHPA 1SNQA 5EGTA 2NN6I 1ENAA 4K5VA 3MAQA 2RSNA 1II3A 4QCLA 3K5MA 1EYCA 2A5HA 1WD0A 1S4ZA 2VB2X 3F2UA 1WTPA 3SHLA 1KDBA 2PZTA 2E2DC 4G57A 2NZ1D 1STGA 1HPCA 3GTLB 1SNCA 1Q1EA 2HUGA 4KJOA 1EY4A 4LJZC 3CKIB 1TS5A 1LTID 2B63B 4V190 3TZUA 5EJWA 1Z7TA 1NAPA 1EY8A 1GUNA 3IAYA 1YNNC 1GUSA 4CKCA 5T1IA 1TU2B 2R92B 4AYBB 3FEWX 3NHHA 1BQQT 3RLFA 4U673 2F0WA 5CV5A 2B2YC 3Q0AA 4NW2A 2JXMB 1AP0A 2FJ2A 2AWOA 5IIFA 2MP1A 1I4RA 2B2YA 3J7AF 3PO3B 1Z47A 1TS3A 5T1GA 3H94A 2F3WA 1KNAA 2EYHA 4WORA 1B50A 1WTXA 1JB3A 3ONAB 4IUNA 5IGDA 4DXFA 2I46A 3S9WA 3P75A 4HCEA 1PTOH 1PZID 4FP5D 4QF4A 1CFMA 5KGUA 4A3DB 1HA5A 5KYLA 1XXGA 3CHBD 1DYQA 2KCNA 4G7ZC 3O13A 3N52A 1B2TA 1E2ZA 5FK9C 1GJXA 3Q22A 3EQLC 3K57A 1ET9A 3BZDB 2F0TA 2VUMB 4C1NI 1PTOF 1K8MA 3OWFA 1JICA 3M7NA 1NCVA 5IT9L 4C3HG 4IQZA 1AFPA 5ELEA 4A3JB 1PRTF 4IN3A 1I6VC 1Q3LA 3U9OA 1X3QA 3RZOB 4H0LC 3HS0C 1F2LA 1LO5D 3VYSA 1OXTA 5FO9B 1A3UA 2BCOA 4IFDJ 5HGTA 4CHTB 2D2CC 1WD1A 4OIJA 5M5XB 1T5EA 4DA2A 5JOBA 4EQPA 1QNKA 4DGZA 4RGNA 4E6IA 5C44B 5K5PA 4XQQA 5JPNC 4FO2A 3M4YA 5I2XA 2TSSA 2AQ2B 3K0YA 3W3AA 4L6TB 1VDZA 3VA7A 5IGFA 3D3RA 4KJNA 3WDNA 4HCSA 2QDBA 3I91A 4K8IA 2F0JA 2K1BA 1TVXA 1PFNA 2C5CA 4CKEA 2AQ3B 2F4IA 2CHBD 1JOKA 1AZQA 1B9MA 2OF1A 2K04A 2L5TA 4F88A 1O78A 3S2HB 3BVGA 2K33A 5A2QL 1PYWD 1D1KA 4UDUC 1B44D 3LWUA 3K5OA 2KUMA 3A8JE 4I65A 1EIHA 1JWUD 2FMCA 2J4XA 2DY7A 4ZQ3A 5FO8B 4CGYB 2IJ0A 1GUTA 2L11A 2EY2A 1QNUA 3QB3A 3S1NB 4RGTA 1JOOA 1WTWA 1ESFA 1RKNA 3T56B 4OO1H 2JA5B 4QUFA 4IUQA 1Q1BA 2NBFA 1LT6D 1X32A 3TN2A 3H0GB 3URYA 1WTRA 5IGCA 1R4PB 2L1BA 1W6KA 2F0HA 3DEPA 3NBHA 1Z6HA 4RCNA 2IX1A 3HP3A 3SXHA 2F03A 3IKJA 3HOYB 2SNMA 1F9RA 2NYZD 2PW5A 1CHQD 1F2YA 2F0IA 1CQFA 2J7ZA 5ELDA 2NN6H 4XT1B 3R3OA 1NSNS 1S5FD 4CBVA 2PCFB 2EJMA 1RTNA 4XT3B 2LY7A 5K36H 4N9TA 1G91A 2EZVA 2HDMA 1TIID 2L4NA 1SYEA 4CKBA 1SYCA 4EVOA 1CA6A 1VF7A 4G4KA 2F0VA 5CV7A 2R3ZA 5EKIA 2B39A 1IHZA 5CORA 3BS1A 2BOSA 2X6GA 1TWHB 5LL6X 4M8AA 3AB9A 3FRPB 2M00A 2K05A 4TSSA 4EGVA 1PFMA 4H13C 1AZPA 3I4LA 3VR2A 4FNFA 4DXGA 5C4JB 3PUVA 2K6AA 5CV4A 3SK5A 2FMMA 4C2MB 5JPMC 4JK1C 1E0BA 2NB0A 4C3JG 2NVQB 4L63B 3NBIA 3G7LA 1PTOC 1V1PA 2ZXPA 5AFWA 1CA5A 2DNCA 2EYMA 3SK4A 1MD2D 2F0EA 5A2QE 1EY5A 1ICWA 1LT4D 4DU9A 4NP5A 2TMPA 3DHQA 3A56A 1CI3M 4KI0A 5C5LA 1LTAD 3L9AX 1DOLA 2RQXA 3RUZA 1PRTC 2A74C 3A55A 1E2WA 2CQAA 2LFNA 4CJ2C 3KBXA 5J22A 4C3HB 3T4AC 3VR6A 2KQ3A 1PMRA 4JBWA 2NVXB 4KY7A 1VMCA 3VYTA 5EKKA 5G3LD 2O5JC 4MIUA 3NPPA 4QUCA 4HSVA 4HN7A 1S5BD 2H4OA 1O80A 3NWTA 1IW7D 2BE5D 1LTGD 3TP5A 2ZXOA 4KD3A 4G7OC 4PV1C 1SFOB 3BVMA 2ZXRA 3RZDB 3T16A 2J0TD 3WOEA 4DAYA 3H3VC 3CU7A 2K7VA 1B1ZA 3T13A 1RD9D 4RHRA 4F7XA 2F0UA 3KLSA 3EFXD 1F9QA 2B2UC 4RHSA 3QG1A 1GHKA 4TRDA 1SBBB 1MSGA 2PPBC 3BDOA 3OIQA 4IUTA 1Y8OB 2IX3A 2B2UA 3W2DA 3FPUB 1T5XD 1EYDA 1EIGA 2F1MA 1JORA 1M4VA 4I7ZC 1TY2A 1EU4A 4A3BB 2SEBD 5CV9A 1RCVD 1DJRD 3MTSA 3OIPA 3PIP3 4RH6A 5FOBB 4K6LA 2N88A 5EPKA 5CV8A 2IW3A 4R9WA 2IX0A 4LMQD 5KNDA 4DK1A 4XYOA 1VMPA 3FVQA 1S5CD 2HDLA 1BR9A 2QEJC 1ENFA 1QOHA 1PXUA 3OSOA 5CBAE 4G7HC 2NUCA 1SE2A 5FKAC 1Y1WB 2R7ZB 5D65A 1RODA 2DY8A 2KA7A 1H9JA 3H91A 3DWAA 2EDGA 3T51B 2NVTB 3A8IE 1STHA 2RDFA 4FYDA 2QILA 1WTVA 3GTKB 4IUVA 2WAQB 2ZT9C 3ITPA 2K32A 1A3TA 5J1ZA 4ZK9B 3OHXC 1QCBD 4K8JA 5E4WC 1F9SA 3MFYA 1ZYRD 3J7YW 1SJHD 1D5MC 2Q8IB 3AU7A 2K5WA 4ZKCB 2L55A 2R93B 3RD4A 2XVSA 4BS9A 1VF5C 3A54A 4IFDG 3GD7A 1ET6A 4OGQC 1SSOA 5IOCA 1G2TA 3NXWA 2MHVA 5D3DA 4C56C 4J8QA 3TP6A 3BDLA 3S17B 3MXPA 1C4QA 4TQUS 5JEAH 2EY5A 1I50B 2EYPA 3OPOA 3SEBA 4HEDA 5CYUA 2XNAC 2K01A 3UI2A 1PLFA 2D62A 1B53A 1I6HB 4O42A 3FPPA 3D31A 5JJZA 5G3LF 2E76C 3NSWA 3R2IA 1Q8IA 1MSHA 4FF3A 3J81E 3SK6A 1FYCA 1D2BA 3DUZA 2GA4B 3OOCA 3FMCA 3E0JA 1ZEQX 5ISRA 4C3JB 1TWAB 2WKDA 2MPMA 1L0YB 2YYZA 1OO9B 3SDZA 4ULLA 5KYIA 4XQNA 3R8BA 4FVMA 3MWYW 1LT5D 2E2JB 1CK1A 1EY9A 2EJFC 1CM9A 2K28A 5FO7B 1K83B 4C3IG 4KKTA 1UNSA 2MJ8A 4KN4C 2CW0C 2LMCB 1D5ZC 2FINB 2CVRA 1PZKD 1NR4A 1U9RA 2FFKB 3N6RA 1BCPD 1WVLA 5EBDA 3ERQA 5HURA 4IUPA 4RKBA 3LWEA 1STYA 1TQOA 4KD4A 2KHSA 2Y0SB 5EPLA 5C0XH 3DWQA 3MXGA 1ML0D 1TT2A 1TWCB 1SDFA 3NTKA 1UEAB 3GTQB 1SYDA 3PO2B 2MUYA 3A7AB 3QIAA 2IL8A 3WOFA 5CMDA 5I9PA 5FLXE 1F2ZA 1HQMC 5LL6S 1HFNA 2EYOA 4LAAA 5IODA 3NE5B 4F87A 1H9MA 2BA0A 3IFTA 2CW0D 5KNCA 1HCZA 4H44C 3HG9A 2RSOA 3GO5A 3KBGA 1IYVA 2KJXA 3GTGB 1MBYA 1CZWA 4TKOB 3KUPA 3K6OA 4K5WA 4RA8A 1XYIA 1EOTA 1O7ZA 2D9UA 1S5DD 2HCCA 3K7AB 1ONLA 4ODGA 2E75C 2EPBA 1R9TB 1EEID 4OO1G 3SE0A 2VNUD 5KNBA 1H9SA 1RJTA 4V0BA 2RBMA 3VYUA 4KV6A 1HA6A 1EFID 1A3VA 1SMYD 2KCCA 1JE4A 1F9PA 4WFN3 2F0SA 3GTOB 3HZXA 2JE6I 3JAME 4RGMA 3SK8A 4RCOA 4U68A 1C48A 4ZUJA 4HAEA 1WCMB 4IFDI 1BDOA 3BYTB 3MFGA 4Y7NB 3NQIA 3NK9A 3OMGA 5IGGA 4A3FB 1JWMD 1EEFD 1IL8A 3G6JB 3D4RA 2WACA 1ENCA 1RDPD 5K36G 3Q6SA 2XWJB 4BA2I 1WTQA 2HCIA 2Q8RE 1KNEA 1E2VA 2EJGC 3H09A 1V43A 1QWYA 3VR5A 3PV0A 3PUXA 3EVQA 5EKLA 1EU3A 2K5QA 1HHVA 2EY1A 2B2WC 1V1PB 4RAUC 2AUJD 3ND9A 1D1IA 1KLUD 4H7BA 3DEOA 1BCPF 1O7LA 2NWGA 1IW7C 1PTOB 2VXWA 2BE5C 2AQ1B 2A68D 1Q12A 1TWGB 1JC7A 1QJOA 1EY7A 4K2LA 1EQVA 1SAPA 2EYLA 1I4XA 2BDNA 3LX0A 1Y69U 3J80L 3MC0B 3P7JA 1TWFB 1PRTB 2WV6D 1LTBD 5E1FA 2JEAI 3TP8A 1EQTA 2OT2A 3X3NA 5BN4A 4ILWA 3A8KE 3QWNA 1HXYD 4KN7C 4K5XA 3HOWB 1GOZA 3I90A 3SR1A 3M85A 3HOUB 5DM63 3Q24A 4C3IB 4C1NK 3K58A 1DOMA 1FNVA 5C4XB 2B2TC 4BWGB 3TP7A 4HMJA 2PMZB 5DNFA 3M7GA 3VR4A 4X3SA 2DNEA 2G9DA 4BA1I 4J1MA 2JEBI 2B2TA 3L3OC 3GQBA 3KLRA 1LT3D 4UAIA 2V4DA 2M2LA 2A69C 4J6HA 5I6YA 1LTSD 4ABNA 1SXTA 1R4QB 3I4MB 2X69A 3PMFA 4X3TA 4RKLA 1BBXC 1BF4A 3GTMB 5ELFA 4KKUA 3I72A 4K14A 1CHPD 4OIKA 3RMHA 4FF2A 4NKLA 3V2TA 3PUWA 3MEHA 4HMIA 2FHTA 3J81L 5CC4A 3M4OB 4RGOS 5C4ZA 2KEEA 5BN5A 3I3CA 4KY6A 2PNRC 3V96A 4RWSC 2B8FA 5M9OA 2IT1A 4L8JA 4S3SA 1BO0A 5M3MB 4X3UA 3S1MB 3ZYYX 1BUVT 1FNWA 5DEHA 2EE1A 1ZYRC 3MXNA 3S16B 3MHBA 4FXDA 2QKIC 5KIXA 4N9PA 4R8IA 1SJED 5ELBA 2A69D 1B4OA 1JOQA 2F0GA 2OEOA 2Z8LA 1J8IA 3GTJB 2XWBB 4QMGA 1EWCA 3FDTA 4DNTB 4B9XA 1DM0B 3VYRA 2WIIB 5CR3A 1XX8A 2F3VA 3DXJC 3C1FA 1JR0D 1O7YA 2A6ED 3U9SA 3J80E 4ZKBB 5D14A 4PQXA 3VA5A 4BBRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EL0 A;  1PFB A;  2X69 A;  3GV6 A;  4X3K A;  2K28 A;  4IUV A;  3D6W A;  1F2L A;  2B2Y A;  4X3T A;  1BBX C;  1WTW A;  3SVM A;  1BF4 A;  2KEC A;  5EPJ A;  5T1G A;  1HHV A;  4CJ0 B;  1GUW A;  2MJ8 A;  3DM1 A;  4ZK9 B;  3KUP A;  2B2W C;  4RAU C;  2FMM A;  1KNA A;  4IUQ A;  4QUF A;  1F9Q A;  1WD1 A;  2B2U C;  4OIJ A;  4XDX A;  1E0B A;  2RA4 A;  4RA8 A;  2FIN B;  5E4W C;  1F9S A;  1X32 A;  1QNK A;  2CVR A;  1A15 A;  1HFG A;  2JYO A;  3I8Z A;  3TN2 A;  4ZLT F;  1MSG A;  3DEO A;  1WTX A;  1XYI A;  1EOT A;  1NR4 A;  1O7Z A;  4OIK A;  2NWG A;  1WTR A;  2FFK B;  1BNZ A;  4ZKC B;  1RTO A;  2D9U A;  1IKL A;  2L1B A;  3GV3 A;  2HCC A;  3ONA B;  4ZAI A;  1WVL A;  2L12 A;  1U4P A;  3G7L A;  1DZ1 A;  2VXW A;  4IUT A;  2B2U A;  4IUP A;  5AFW A;  3LWE A;  1CA5 A;  3FPU B;  1IKM A;  2X6L A;  1U4L A;  1EIG A;  2EPB A;  2Q8T A;  3DEP A;  3IFD A;  1ICW A;  1SSO A;  1LV9 A;  1RHP A;  1G2T A;  1SAP A;  2FHT A;  1B50 A;  1RJT A;  2BDN A;  3HP3 A;  1C8C A;  3P7J A;  2RSN A;  5EPL A;  1F9R A;  1HA6 A;  1DOL A;  2KEE A;  2NYZ D;  1NR2 A;  1ML0 D;  4HCS A;  1DON A;  3MTS A;  3I3C A;  3QO2 A;  4MHE A;  3I91 A;  1WD0 A;  1PDQ A;  1QE6 A;  2L9H A;  2J7Z A;  1S4Z A;  1JE4 A;  1SDF A;  4HED A;  1F9P A;  2K1B A;  1TVX A;  2XIW A;  4RWS C;  2B2W A;  1PFN A;  2N88 A;  1EQT A;  2KED A;  4CJ2 C;  3KBX A;  3F2U A;  1B3A A;  2K01 A;  5EPK A;  1BO0 A;  3UI2 A;  1AZQ A;  1WTP A;  4XT1 B;  3N52 A;  4X3U A;  1PLF A;  3R93 A;  1B2T A;  1QG7 A;  2K04 A;  1ILP A;  1RTN A;  1J9O A;  4XT3 B;  1U4R A;  1B53 A;  2IL8 A;  1HRJ A;  4MN3 A;  4O42 A;  1HUM A;  1X3P A;  1ILQ A;  2EE1 A;  4R9W A;  1M8A A;  2NZ1 D;  4LMQ D;  2K03 A;  5CMD A;  1G91 A;  5JJZ A;  3I90 A;  2HDM A;  4U68 A;  1HUN A;  1VMC A;  5CBE E;  2L4N A;  4HAE A;  1G2S A;  1MSH A;  2HUG A;  4IUR A;  2MGS A;  5EQ0 A;  2B2V C;  1VMP A;  4QUC A;  4HSV A;  4R8I A;  2HDL A;  4IUU A;  1HFN A;  2RVL A;  1DOM A;  2EOT A;  1O80 A;  1CA6 A;  2B2T C;  5CBA E;  5EJW A;  2N55 A;  1B4O A;  1MI2 A;  1ESR A;  1NAP A;  2JP1 A;  4CJ1 B;  1G6Z A;  5DNF A;  2R3Z A;  1IL8 A;  2SDF A;  2KUM A;  5EKI A;  1J8I A;  2B2V A;  4X3S A;  5D65 A;  1JIC A;  5T1I A;  1ROD A;  2DY8 A;  5COR A;  1EIH A;  3FDT A;  3Q6S A;  1NCV A;  2MPM A;  4DN4 M;  2X6G A;  3H91 A;  2KOL A;  1MGS A;  2B2T A;  1WTQ A;  1WTO A;  2HCI A;  1U4M A;  1ZXT A;  2B2Y C;  5COY A;  1XX8 A;  2DY7 A;  2Q8R E;  4NW2 A;  4UAI A;  1KNE A;  2KVM A;  2H1E A;  2M2L A;  1AP0 A;  1O7Y A;  3MWY W;  2RSO A;  2FJ2 A;  1Q3L A;  2K05 A;  3IL8 A;  3TZD A;  4ZKB B;  2MP1 A;  1CM9 A;  1DOK A;  5E4X A;  1WTV A;  1PFM A;  5D14 A;  2L11 A;  1X3Q A;  1AZP A; 
#chains in the Genus database with same CATH topology
 4JPB W;  2PZW A;  2N8N A;  4PZ6 A;  1CQV A;  4LFA Q;  4POG A;  1KAB A;  2EYF A;  1NMG A;  3D6W A;  4ZUI A;  2EQS A;  1GUW A;  1YNJ D;  5JJL A;  2WKC A;  5C4H A;  4NDX A;  3TDQ A;  1CZG A;  4XDX A;  1JCK B;  1A0I A;  3K7U C;  4X65 Q;  5LMN W;  4ZLT F;  3S1N H;  4HSP A;  4RFB A;  4PMC A;  5IE8 A;  3CRL C;  3ULJ A;  1TS4 A;  4LFC L;  2PZU A;  4F8M A;  4A76 A;  1OTC A;  5JAV A;  3GV3 A;  1STB A;  2O2L D;  1CTM A;  4A3M B;  1N33 Q;  2IWH A;  1FNU A;  3H0G H;  2F0F A;  5FLX L;  3CAM A;  1PH1 A;  5CV6 A;  4EQ5 A;  4K2K A;  4XXE A;  3GTO H;  4LF7 L;  1Y8P B;  1BCP B;  1H9K A;  3HKZ G;  3QO2 A;  2K52 A;  4MTN A;  2A6H C;  1QE6 A;  2XRS D;  2PW7 A;  2Z4H A;  4DV3 L;  4B9W A;  5GQO A;  3QOL A;  2KED A;  4IPD A;  1UUP A;  5FJ8 H;  1VQJ A;  2Q2H A;  1XWE A;  4Y7N H;  4L5R C;  3S1Q B;  1SYB A;  1STA A;  2UXC Q;  4JI7 Q;  2IPK D;  3P1H A;  4DR6 L;  3F8T A;  2WB1 B;  2Z1C A;  3J7A V;  1STN A;  2JA8 G;  1SE4 A;  2R61 A;  1BCP C;  5M5Y B;  1W6J A;  1KAW A;  4IUR A;  5JEA G;  1AE2 A;  3MZ5 A;  4QGU A;  4KHV A;  3HOX B;  3PIP A;  3LGJ A;  4KLK A;  2N55 A;  3QOJ A;  1NBW A;  2JP1 A;  1XJV A;  4IFD H;  3CW2 C;  3C1E A;  1EY0 A;  3M4P A;  5LMN L;  3S15 B;  5IP9 H;  1EYA A;  2NTT A;  2QCP X;  3L0O A;  1IYJ B;  2E2H B;  1OXV A;  2ATW A;  1WTO A;  4JI5 Q;  3FKI G;  1EOV A;  5COY A;  3J81 c;  1IYU A;  4PNY A;  1LTL A;  4DV0 Q;  2EIF A;  5C5M A;  1TWH H;  4DR4 L;  1QVC A;  3HEJ A;  3M4Q A;  5IGB A;  4O1N A;  1GUO A;  2DN8 A;  3CPW A;  4FF4 A;  3D4D A;  3ND8 A;  4P2C B;  4XTC S;  1TR5 A;  5M3F B;  1TWG H;  1CUK A;  4LK1 C;  1DXM A;  4BY1 B;  1V1O A;  2RDH A;  5C4J H;  1I3Q B;  4JI3 Q;  3CCE A;  1BNZ A;  3CCS A;  1PH5 A;  4IAL A;  1HTL D;  1IKL A;  3D4W A;  2L12 A;  5GAH C;  4L5S A;  1GD7 A;  3JAM L;  2A6H D;  2EY6 A;  2ICE C;  2NVQ H;  2V1C C;  1SND A;  2PI2 A;  4HIM A;  1UE1 A;  4A93 G;  1KRS A;  4JI0 Q;  1YNN D;  3NTI A;  1KDA A;  4RMF A;  3PIO 3;  3CPF A;  5IGE A;  1HJP A;  3NQT A;  4DV2 L;  1XTD A;  4B3S Q;  3J81 j;  1KDC A;  2LS0 1;  3HRZ C;  4OL7 A;  3HOW H;  3HGB A;  2OCE A;  1PDQ A;  2PYK A;  4BBS B;  1SYF A;  1GXD C;  1B3A A;  1HNX Q;  5DM7 3;  4YCW A;  3R93 A;  1A2T A;  1Q90 A;  1F2M A;  2GVB A;  1QG7 A;  3LNN A;  4A3L G;  4AQY Q;  1X3P A;  2F0N A;  3TSS A;  5TSS A;  2JK8 A;  4C3H H;  1I4H A;  5IP7 H;  5C0X G;  1D5X C;  1KAA A;  3HOV G;  2B8G A;  1DD2 A;  1G2S A;  1IBK Q;  1WFQ A;  3PUY A;  4LF9 L;  2NVX H;  4ME3 A;  1LTR D;  1STE A;  1N8R C;  1SNP A;  5JEA J;  1CKN A;  1Y8N B;  4PZ8 A;  4DV7 L;  2G9H D;  4K6D A;  2ALY B;  1HR0 Q;  5A35 A;  4B08 A;  2RKS A;  3H3V H;  5FLX c;  4QB4 A;  4HR7 B;  1FGB D;  2XSC A;  3R2T A;  4A3E B;  2KOL A;  4A3I B;  3M3Y B;  1SMY C;  1U4M A;  1ZXT A;  2ICI A;  1Y1V G;  5F2D A;  4Q5V A;  3T53 B;  3D8G A;  2BA1 A;  2CQO A;  1SFO H;  4ID6 A;  3IL8 A;  2EYJ A;  2XTI A;  5JVH 3;  2OTJ A;  2VQF L;  2D0P A;  1QB5 D;  1EL0 A;  4R4I A;  4DV4 Q;  4R8N A;  3E6Z X;  5EPJ A;  4CJ0 B;  5IYB H;  3DM1 A;  4FXK C;  4UP8 A;  3S1R B;  3H15 A;  4X6A H;  3MXU A;  3PCO B;  4KTA A;  3KF8 A;  1A15 A;  1HFG A;  1W3S A;  3I8Z A;  4DAP A;  1TKW B;  1YZ6 A;  3D6C A;  1NNX A;  3I73 A;  4BY7 B;  3E5S A;  4ZYS A;  3I4N B;  2NTS A;  1K8O A;  4DPG A;  1RTO A;  2OWO A;  2I0Q A;  1H9S B;  4OHJ A;  3HOZ G;  4A3G B;  1U4P A;  3V05 A;  4GZY C;  1VQG A;  4DR1 Q;  1G8Z D;  1U4L A;  1OXU A;  1VQ4 A;  1FVI A;  1TS2 A;  3UDF A;  4GN3 B;  4JYA Q;  2SOB A;  3EBE A;  2JA7 B;  2AWN A;  3GTP B;  5DAU A;  1C8C A;  1JWS D;  2EVB A;  4ZRZ A;  4EQO A;  4X66 Q;  3K59 A;  2JA6 G;  3A5U A;  1MKH A;  4GLX A;  1DON A;  1FJG L;  2BH2 A;  3MVV A;  5KRU A;  1HZA A;  1BBU A;  3JAM i;  2L9H A;  1LAB A;  4A3K B;  2UUB Q;  3S16 H;  3NWS A;  3TBI B;  3CCM A;  2DUD A;  4DV1 L;  1A6X A;  1NUC A;  4A3B H;  5E3F A;  2ZTD A;  2ID0 A;  2XN9 C;  4GS3 A;  1ASZ A;  4DUZ L;  4LF6 L;  1U4R A;  1KTK A;  1HRJ A;  4MN3 A;  5C3E G;  1L0W A;  1AEX A;  1VQ9 A;  2YU9 B;  2WAQ E;  4LFC Q;  1JQY D;  3Q23 A;  5GAD C;  4DUY L;  1PH2 A;  4EQN A;  3I70 A;  2MGS A;  5C0X J;  5EQ0 A;  1XNR Q;  1A62 A;  1VQB A;  3K5L A;  2ENB A;  4AYB E;  2LXK A;  1KXL A;  5LHY 1;  2A68 C;  2ZM6 L;  1YEZ A;  1FR3 A;  3A0J A;  1G6Z A;  3J7Z C;  2LKV A;  3JAM c;  2K5V A;  1D6E C;  1BKB A;  3EJI A;  4YIJ A;  1VQM A;  4DAV A;  4LF7 Q;  2WFW A;  2JA9 A;  1OXX K;  2M9V A;  1SNO A;  1YIJ A;  1MGS A;  2XRQ D;  2K14 A;  2R7Z H;  1MIU A;  2UU9 L;  3CMA A;  2PQE A;  4BXX H;  2KVM A;  5L37 A;  1V1Q A;  4YHH L;  1M1K C;  4DV3 Q;  1YI2 A;  5NUC A;  5I9O A;  4JI4 L;  3STB D;  2NN6 G;  1AN8 A;  3NTH A;  1ASY A;  3CCV A;  3BDC A;  2HQE A;  5E4X A;  3VR3 A;  1PFB A;  4WRD A;  2RF4 A;  1A2U A;  1ZKO A;  2OXP A;  2HT1 A;  2A73 B;  2KEC A;  2F0K A;  1QZH A;  2B63 G;  4DR6 Q;  2F0P A;  4NXN L;  3HKZ B;  5I6W A;  2ZTC A;  2VB3 X;  2D5D A;  3CRK C;  1H9R A;  5BR8 L;  2R92 G;  3CCR A;  3DWP A;  1VQK A;  3KK7 A;  4AYB G;  1K3B C;  3L7Z C;  5IT9 E;  4ZAI A;  4OXP A;  5BN3 A;  5IWA L;  1EWH A;  1JJG A;  3GP7 A;  1LAC A;  2MO1 A;  1J5E L;  4HJ9 A;  2K50 A;  1GKH A;  1V8Q A;  2O5I C;  5LMN Q;  3IFD A;  4IZ8 A;  3BVZ A;  2JA8 B;  3S2D B;  4OX9 L;  4GOP B;  4DNR B;  4UP9 A;  2R93 H;  1JMC A;  2L15 A;  4A4I A;  3OW2 A;  5IYD H;  4KKS A;  3OWE B;  3EA6 A;  3PO3 G;  1VQA A;  3S1Q H;  3AMU A;  1I4P A;  5C3X A;  4A75 A;  1C7Y A;  1BOS A;  3TME A;  2RDG A;  2XIW A;  4PMW A;  3S17 H;  3C3L A;  1I4G A;  2B2W A;  1HQR D;  2EXZ A;  1OXS C;  1I50 H;  3HOX H;  1SNM A;  3FKI B;  1HTP A;  3S14 B;  1QIL A;  1ILQ A;  3BG3 A;  5EBC A;  1JJ2 A;  2F0Q A;  2F4V L;  2RCN A;  4YWM A;  4JVZ A;  4DF7 A;  1HUN A;  5CBE E;  1BXT A;  3S15 H;  2BDO A;  1I6H H;  5FLM H;  4IUU A;  4OEM B;  1KLG D;  4KMU C;  4KY5 A;  2E2H H;  2RVL A;  4A3D G;  4HIO A;  3MA2 B;  2SNS A;  2QF7 A;  1PZJ D;  4CJ1 B;  1Q81 C;  2SDF A;  1UAP A;  4HTH A;  1VCI A;  4DV2 Q;  4XYQ A;  2F52 A;  4DK0 A;  3CQZ B;  1CKO A;  3ULP A;  4Q0F A;  4FF1 A;  4PMB A;  5J39 A;  1NE3 A;  1GHJ A;  5C6A A;  2VQE L;  4I7A A;  4A93 B;  2Y0S E;  3TZD A;  1U0L A;  1DOK A;  4R4Q A;  2K4K A;  5C0X I;  3QJY A;  1MHW C;  5I4D A;  5M5W B;  3GV6 A;  4X3K A;  1QVG A;  1VQD A;  4JI6 L;  2R6G A;  3SVM A;  1TY0 A;  2VUM G;  3A7L A;  3I56 A;  4FXG C;  4XQJ A;  1S72 A;  3ERO A;  3PUZ A;  1PH9 A;  2RA4 A;  1F77 A;  1EY6 A;  5ELC A;  1K83 H;  4LF9 Q;  2BH8 A;  2L0C A;  3PF4 A;  4DV7 Q;  3BZK A;  1GUG A;  2NVY B;  4NMZ A;  4QIW B;  5D3I B;  2F0L A;  4A3J G;  1IKM A;  2WP8 J;  2X6L A;  3X3M A;  1AW7 A;  1XTC D;  3HOV B;  1SEB D;  2F0M A;  2KCT A;  5JVG 3;  1NR2 A;  2A6E C;  3OW7 A;  1GM5 A;  2GVA A;  1SYG A;  4FDB A;  4MHE A;  4DFA A;  3KLS X;  4GNX C;  2E5L L;  1XMQ L;  5C44 G;  4KK7 A;  2I07 B;  2VY3 A;  1YNJ C;  1L0X B;  1G6P A;  1ILP A;  4DAM A;  1J9O A;  1Y1V B;  3GTQ H;  3PO2 H;  1HUM A;  3OMC A;  2C9O A;  1M8A A;  1SE3 A;  2K03 A;  3W5O A;  4O2D A;  1XPR A;  2E2I B;  1CT1 D;  1EZ6 A;  1S40 A;  3NP8 A;  2B2V C;  2AUK A;  4DR7 L;  4A3E H;  4PG3 A;  1RF2 D;  2EOT A;  2PO4 A;  3KF6 B;  3K5N A;  1WI5 A;  4OWW B;  1MI2 A;  1ESR A;  1PTO D;  4LUZ A;  1I4Q A;  4WJ4 A;  2F0D A;  4JI1 L;  3P20 A;  2B2V A;  4K0K L;  3S24 A;  3J80 i;  1B9N A;  3H6M A;  2IHE A;  3BYY B;  4KHP L;  3EIV A;  4DV6 L;  1YIT A;  4DN4 M;  3HOZ B;  3GDE A;  4JV5 L;  3KYH C;  1FJG Q;  1FD7 D;  4ZCK A;  2H1E A;  4DV1 Q;  3DMU A;  3J7A 5;  1PRT D;  4O0A A;  4OO1 I;  5I2Y A;  1O7I A;  3C46 A;  5KEE A;  2K5D A;  1HNZ L;  3U4Z A;  4WJW A;  1KQS A;  2Z4I A;  4DUZ Q;  2E8G A;  2JA6 B;  5C3W A;  3K81 C;  1DCZ A;  1QZG A;  3G71 A;  3TQY A;  1LTT D;  4M1U B;  4ME5 A;  1BVS A;  1EZ8 A;  2E74 C;  2F0O A;  4Z9C B;  3VDY A;  4DUY Q;  2UXD Q;  3NUC A;  2O4X A;  2JYO A;  3GTG H;  3C2P A;  1UE7 A;  1LLR D;  3KJO A;  1G29 1;  4XIG S;  4NPS A;  4B3R L;  3J80 c;  2JSO A;  4KHZ A;  4JCV E;  1K3R A;  3L2P A;  1DZ1 A;  2WIN B;  5C3E B;  5CGK A;  2Q8T A;  1DGS A;  1SR3 A;  3AYH B;  1S5E D;  2UUA Q;  1LV9 A;  1RHP A;  1SNQ A;  3K7A H;  1YBY A;  5EGT A;  2NN6 I;  1ENA A;  2PQA B;  1N34 L;  1TXY A;  4K5V A;  3MAQ A;  2RSN A;  1R9T H;  1XMO Q;  3U4V A;  1II3 A;  4YWL A;  4YHH Q;  4QCL A;  3K5M A;  2JA5 G;  4JI4 Q;  1EYC A;  2A5H A;  2IHF A;  1WD0 A;  1S4Z A;  2VB2 X;  1LUZ A;  3H0G G;  3F2U A;  1WTP A;  3SHL A;  1KDB A;  4NXN Q;  2PZT A;  2E2D C;  4G57 A;  2NZ1 D;  1STG A;  1HPC A;  5BR8 Q;  4LF5 L;  3GTL B;  1SNC A;  4WJ3 M;  4JBM A;  1Q1E A;  2HUG A;  4KJO A;  4MZ9 A;  1EY4 A;  4LJZ C;  5IWA Q;  3CKI B;  1TS5 A;  3CCU A;  1X3F A;  1J5E Q;  3HOY G;  2HHH L;  1LTI D;  1XNQ L;  2B63 B;  4V19 0;  1X65 A;  3TZU A;  2Q2I A;  5EJW A;  1Z7T A;  2PQA A;  1WCM H;  1NAP A;  2CWA A;  1EY8 A;  4OX9 Q;  4YY3 L;  1GUN A;  3IAY A;  1YNN C;  1GUS A;  4CKC A;  3J81 i;  2C35 B;  5T1I A;  1TU2 B;  4A3F H;  2R92 B;  4AYB B;  3FEW X;  3NHH A;  1BQQ T;  3E3X A;  3RLF A;  4U67 3;  1E1T A;  2F0W A;  5CV5 A;  3CP0 A;  1P16 A;  2B2Y C;  3Q0A A;  4LFB L;  4NW2 A;  2JXM B;  1AP0 A;  3BJU A;  2JJQ A;  2FJ2 A;  2AWO A;  5IIF A;  1NTG A;  2MP1 A;  2UXB Q;  1I4R A;  2B2Y A;  3J7A F;  3PO3 B;  1Z47 A;  1TS3 A;  5T1G A;  3H94 A;  2OQK A;  2F3W A;  1KNA A;  2EYH A;  4WOR A;  1B50 A;  2N78 A;  1WTX A;  1N9W A;  1YHB A;  1JB3 A;  5E7N A;  3ONA B;  4IUN A;  5IGD A;  4DXF A;  2I46 A;  3S9W A;  2YV5 A;  3P75 A;  4HCE A;  4LWC A;  3G4S A;  1PTO H;  1PZI D;  1VQI A;  4FP5 D;  2HIX A;  1A8V A;  4QF4 A;  1CFM A;  5KGU A;  4A3D B;  2PMZ E;  3FKI H;  1HA5 A;  5KYL A;  3S14 H;  1N32 L;  1XXG A;  2VQE Q;  5GRO A;  4POF A;  3CHB D;  1DYQ A;  1TWF H;  2KCN A;  2MO0 A;  3RLO A;  4G7Z C;  3O13 A;  5IYC H;  3N52 A;  1B2T A;  1E2Z A;  5FK9 C;  5H1S E;  1CKN B;  1GJX A;  4RG1 A;  3Q22 A;  3ULL A;  1EQR A;  3EQL C;  3K57 A;  1ET9 A;  3BZD B;  4GN5 A;  4UHV A;  3RR5 A;  2UUC Q;  2F0T A;  2VUM B;  4C1N I;  1PTO F;  3HOU H;  3CQZ H;  1K8M A;  3OWF A;  2LSS A;  3UE1 A;  4C3I H;  4A93 H;  4B3T L;  1JIC A;  1K8A C;  3M7N A;  5C4X H;  1NCV A;  5IT9 L;  1EIF A;  4C3H G;  5IP7 G;  4IQZ A;  1AFP A;  4CDC C;  1UE5 A;  5ELE A;  3CME A;  3RLN A;  4A3J B;  2K5N A;  1PRT F;  3AFP A;  4A3C H;  1VQP A;  2E5L Q;  4IN3 A;  1I6V C;  1Q3L A;  1XMQ Q;  4UY8 C;  2Q2U A;  3U9O A;  3KF8 B;  1X3Q A;  3RZO B;  1MJC A;  4H0L C;  5DLQ E;  3HS0 C;  1F2L A;  1LO5 D;  3VYS A;  1OXT A;  1A3U A;  2BCO A;  5FO9 B;  3QR8 A;  4A3L H;  2LXJ A;  4IFD J;  5AJ3 Q;  5HGT A;  4CHT B;  2D2C C;  1WD1 A;  4OIJ A;  5M5X B;  1T5E A;  3I4M H;  4DA2 A;  5JOB A;  4EQP A;  1QNK A;  3HOV H;  4DGZ A;  4NB3 A;  4RGN A;  4E6I A;  2QDL A;  5C44 B;  1VQH A;  3GTM H;  5K5P A;  1H95 A;  4XQQ A;  5JPN C;  4FO2 A;  3M4Y A;  1G51 A;  5I2X A;  2TSS A;  2AQ2 B;  3K0Y A;  1PYS B;  4DK3 C;  1VQ8 A;  3W3A A;  2JN4 A;  4GN4 B;  5IYB G;  2VW9 A;  4L6T B;  1VDZ A;  3VA7 A;  5IGF A;  4JV5 Q;  3D3R A;  4DR2 L;  4KJN A;  3WDN A;  2Z6K C;  4HCS A;  3STB C;  4P72 A;  3OTO L;  2QDB A;  3I91 A;  1X54 A;  4K8I A;  2F0J A;  3M4O H;  1X6O A;  1TVX A;  2K1B A;  1HNZ Q;  4IPC A;  3CCQ A;  1PFN A;  3DLL A;  2C5C A;  4CKE A;  2AQ3 B;  2F4I A;  2CHB D;  1JOK A;  1AZQ A;  1B9M A;  2Z6K A;  1HNW L;  1KHI A;  1WTH A;  3AQQ A;  2OF1 A;  2K04 A;  2L5T A;  3F2C A;  1GVP A;  4HJA A;  3E0E A;  1O78 A;  4F88 A;  1PA6 A;  2KEN A;  5M3M H;  3S1M H;  3S2H B;  3BVG A;  1QVF A;  2K33 A;  5A2Q L;  3HOZ H;  1PYW D;  1D1K A;  4UDU C;  1B44 D;  3LWU A;  4A3B G;  3UDX A;  2QEX A;  3K5O A;  2KUM A;  1PVO A;  4LF4 L;  1YJN A;  3A8J E;  1N34 Q;  4I65 A;  4OWX B;  4LNQ A;  1EIH A;  1JWU D;  4JI2 L;  2FMC A;  2JA6 H;  2J4X A;  2DY7 A;  3GTJ H;  4ZQ3 A;  5FO8 B;  1IXR A;  4CGY B;  1SN8 A;  2IJ0 A;  1I94 L;  1GUT A;  3KDF A;  2L11 A;  2EY2 A;  1QNU A;  3QB3 A;  3KFU A;  3S1N B;  4JOI C;  4RGT A;  1JOO A;  3SGI A;  1ESF A;  1WTW A;  4NXM L;  1X3E A;  1RKN A;  3T56 B;  4OO1 H;  2JA5 B;  1NMF A;  4QUF A;  4IUQ A;  4LF5 Q;  4BBR H;  4IJL A;  1Q1B A;  2NBF A;  1LT6 D;  1X32 A;  2R7Z G;  3TN2 A;  1Y1W G;  1K8G A;  3H0G B;  1VS0 A;  3URY A;  4CDD C;  1WTR A;  4JOI A;  5IGC A;  1R4P B;  2L1B A;  1XNQ Q;  1QUQ A;  1W6K A;  4YY3 Q;  4JC0 A;  2F0H A;  1L1O C;  2H5X A;  1VQE A;  1X9N A;  3DEP A;  4LFA L;  3NBH A;  3PF5 A;  4A3M H;  1Z6H A;  4RCN A;  2IX1 A;  3HP3 A;  3SXH A;  2F03 A;  3IKJ A;  4LFB Q;  3HOY B;  2SNM A;  2WAQ G;  1F9R A;  3CCJ A;  2NYZ D;  2PW5 A;  2PNH A;  5IT9 c;  1L1O A;  1CSQ A;  1CHQ D;  1F2Y A;  2F0I A;  3CXC A;  3F2D A;  1CQF A;  2J7Z A;  5ELD A;  2NN6 H;  4JBJ A;  3GTL H;  1K73 C;  1JE5 A;  1W2B A;  1N33 L;  3I7F A;  2I5M X;  4XT1 B;  2R7F A;  3R3O A;  1NSN S;  1S5F D;  4CBV A;  2PCF B;  2EJM A;  1RTN A;  4XT3 B;  1E7Z A;  2LY7 A;  4L5Q A;  3G48 A;  2R93 G;  5K36 H;  4N9T A;  1G91 A;  2EZV A;  5IYD G;  2HDM A;  2CFM A;  1TII D;  2ZJP A;  1BBW A;  5ELO A;  2L4N A;  1JJC B;  4OWT B;  1SYE A;  2RHS B;  4CKB A;  1HZC A;  1SYC A;  4DR4 Q;  1ICF B;  4EVO A;  1PH3 A;  5HGQ A;  1CA6 A;  1SRU A;  1VF7 A;  4G4K A;  2F0V A;  5CV7 A;  1Q82 C;  5M5Y H;  1D7Q A;  3NEN A;  2K75 A;  5LMU L;  2R3Z A;  5EKI A;  2B39 A;  1IHZ A;  5COR A;  3T1Y L;  2UXC L;  3BS1 A;  2BOS A;  2X6G A;  3IRB A;  1TWH B;  1Z9F A;  4Y52 H;  5LL6 X;  3T1H L;  4YCU A;  1N32 Q;  1K28 A;  4M8A A;  3AB9 A;  5FLM G;  3FRP B;  2M00 A;  2K05 A;  4TSS A;  4EGV A;  1PFM A;  4H13 C;  1AZP A;  3I4L A;  3VR2 A;  2Z0S A;  4FNF A;  1PHJ A;  4DXG A;  5C4J B;  3PUV A;  2K6A A;  5CV4 A;  3SK5 A;  1S3O A;  2FMM A;  4C2M B;  5JPM C;  3PGZ A;  2DJG C;  4JK1 C;  1E0B A;  1C0A A;  2NB0 A;  4YWK A;  2CWP A;  4C3J G;  4JI5 L;  2NVQ B;  2MFI A;  4X64 L;  2VL6 A;  4L63 B;  3NBI A;  5M3F H;  4BY1 H;  4A3D H;  1VQ6 A;  3G7L A;  1PTO C;  1V1P A;  2ZXP A;  5AFW A;  1CA5 A;  1I3Q H;  2DNC A;  2EYM A;  3SK4 A;  1MD2 D;  2F0E A;  5A2Q E;  1EY5 A;  1ICW A;  1LT4 D;  4DU9 A;  4NP5 A;  2TMP A;  3ER0 A;  3DHQ A;  3A56 A;  1CI3 M;  4KI0 A;  5C5L A;  4P74 A;  1Q46 A;  1LTA D;  3L9A X;  1DOL A;  4JI8 L;  2RQX A;  3RUZ A;  1PRT C;  3TS0 A;  4JI3 L;  4DK6 C;  1EIY B;  2A74 C;  3A55 A;  1E2W A;  4HJ8 A;  2CQA A;  1YJ9 A;  2LFN A;  4GNX B;  4CJ2 C;  3KBX A;  2HQL A;  3KJP A;  4R4O A;  5J22 A;  4C3H B;  4DAY B;  3BU2 A;  3T4A C;  3VR6 A;  4DR3 L;  2VUM H;  4DNI A;  2KQ3 A;  4BBS H;  1PMR A;  4JBW A;  2NVX B;  4JI0 L;  4KY7 A;  1VMC A;  3VYT A;  5EKK A;  5G3L D;  1Q7Y C;  2O5J C;  4MIU A;  4B3S L;  3NPP A;  4QUC A;  4HSV A;  1VQL A;  4HN7 A;  3ERS X;  2Y0S G;  1S5B D;  2H4O A;  1O80 A;  3NWT A;  4AH6 A;  2VQF Q;  1IW7 D;  4OON A;  2BE5 D;  1LTG D;  3TP5 A;  1XPU A;  2ZXO A;  1PFS A;  4KD3 A;  1NY4 A;  4G7O C;  4PV1 C;  3PO2 G;  1IL2 A;  2GN5 A;  4AQY L;  1PH6 A;  1PV4 A;  1SFO B;  2ASB A;  5JJK A;  3BVM A;  4TVA B;  4GNX A;  3DM3 A;  2ZXR A;  3RZD B;  3F2B A;  2KCM A;  3T16 A;  2J0T D;  3WOE A;  4DAY A;  1IBK L;  1Y14 B;  4A3I H;  3H3V C;  3M3Y H;  2ES2 A;  3HFZ B;  1FGU A;  3CU7 A;  2K7V A;  2N49 A;  3BZC A;  1HNW Q;  1B1Z A;  2DGY A;  3T13 A;  1RD9 D;  4RHR A;  4F7X A;  2B29 A;  2F0U A;  1IBM L;  3KLS A;  3EFX D;  4ALP A;  5HY6 A;  2KHJ A;  1F9Q A;  2B2U C;  4RHS A;  3QG1 A;  4HID A;  1GHK A;  4TRD A;  1SBB B;  1MSG A;  2PPB C;  3BDO A;  1WYD A;  3S1R H;  1UE6 A;  3OIQ A;  4IUT A;  1Y8O B;  2IX3 A;  2B2U A;  3W2D A;  3FPU B;  4BY7 H;  1T5X D;  3M9B A;  2JQO A;  1EYD A;  3I4N H;  1EIG A;  2F1M A;  4DV5 L;  2G5D A;  4LF6 Q;  3TRZ A;  3E9H A;  4A3G H;  2FXQ A;  1JOR A;  1M4V A;  4I7Z C;  1TY2 A;  1EU4 A;  4A3B B;  1VQF A;  2SEB D;  5CV9 A;  1RCV D;  2YTV A;  1DJR D;  3MTS A;  2JA7 H;  3OIP A;  1LYL A;  3GTP H;  1I94 Q;  3PIP 3;  2ZM6 Q;  4RH6 A;  4AIM A;  5FOB B;  1SRO A;  4K6L A;  4HJ5 A;  2N88 A;  3I55 A;  5EPK A;  4A3K H;  5CV8 A;  2IW3 A;  1PH7 A;  3PQI A;  4R9W A;  2IX0 A;  4LMQ D;  2MQH A;  4R4T A;  5KND A;  2UU9 Q;  4DK1 A;  5EAY A;  1LM0 A;  3HKZ E;  4XYO A;  1VMP A;  3FVQ A;  3JC6 6;  1S5C D;  2HDL A;  3MEF A;  1BR9 A;  2QEJ C;  1ENF A;  2YU9 H;  1QOH A;  1PXU A;  3OSO A;  5CBA E;  3CC7 A;  4G7H C;  2NUC A;  5IY0 A;  1SE2 A;  5FKA C;  1Y1W B;  2R7Z B;  4CDF C;  3KOJ A;  1HZ9 A;  5D65 A;  1ROD A;  2DY8 A;  2KA7 A;  1H9J A;  3H91 A;  3CC4 A;  2RHQ B;  3DWA A;  2EDG A;  3T51 B;  2NVT B;  3A8I E;  2JA5 H;  1B70 B;  4APV A;  1XNR L;  1STH A;  2RDF A;  4FYD A;  2QIL A;  1WTV A;  3GTK B;  1WCM G;  1UEB A;  5FJ8 G;  1GO3 E;  4OEL B;  4IUV A;  2WAQ B;  2ZT9 C;  3ITP A;  2K32 A;  1A3T A;  3UDG A;  1J6Q A;  2CH4 W;  4A3F G;  5J1Z A;  4ZK9 B;  3OHX C;  1QCB D;  2RCF A;  4N8F A;  4K8J A;  5E4W C;  4DR5 L;  1F9S A;  3MFY A;  1ZYR D;  3WWV A;  3J7Y W;  1SJH D;  1D5M C;  2Q8I B;  1X3G A;  3AU7 A;  2K5W A;  4ZKC B;  1V9P A;  2L55 A;  3HOY H;  4P71 A;  1N36 L;  4IOA A;  2R93 B;  5LMU Q;  3RD4 A;  2XVS A;  4BS9 A;  1VF5 C;  3A54 A;  4IFD G;  3GD7 A;  1ET6 A;  3T1Y Q;  4OGQ C;  1SSO A;  5IOC A;  1G2T A;  3NXW A;  2MHV A;  5IP9 G;  5D3D A;  2F4V Q;  4C56 C;  3T1H Q;  4J8Q A;  3TP6 A;  3HKS A;  3BDL A;  3S17 B;  2JA8 H;  3MXP A;  1KIX A;  1C4Q A;  3S2D H;  4TQU S;  5JEA H;  2EY5 A;  1I50 B;  2EYP A;  3OPO A;  3W1B A;  3SEB A;  4HED A;  1PH4 A;  4IOC A;  5CYU A;  2XNA C;  2K01 A;  3UI2 A;  3I2Z A;  1PLF A;  2D62 A;  2ZTE A;  1B53 A;  1I6H B;  4O42 A;  3FPP A;  3D31 A;  5JJZ A;  5G3L F;  4X64 Q;  2CH4 A;  2E76 C;  3NSW A;  3R2I A;  1Q8I A;  1MSH A;  4FF3 A;  3J81 E;  3SK6 A;  1FYC A;  1D2B A;  3DUZ A;  2GA4 B;  5ELN A;  3OOC A;  3FMC A;  5IYC G;  3E0J A;  4JI6 Q;  1ZEQ X;  5ISR A;  4C3J B;  1TWA B;  4QIW E;  1HH2 P;  2WKD A;  2MPM A;  1L0Y B;  2YYZ A;  4JI8 Q;  1OO9 B;  3SDZ A;  4ULL A;  2OQ0 A;  5KYI A;  1I5F A;  3R8B A;  1E3P A;  4XQN A;  2MNA A;  3HOW G;  4C2M H;  4FVM A;  3MWY W;  1LT5 D;  2E2J B;  3HOU G;  1CK1 A;  1EY9 A;  1M90 C;  2EJF C;  1CM9 A;  2I5H A;  3TRE A;  2ZJR A;  4DR3 Q;  2A19 A;  3UDI A;  2K28 A;  5FO7 B;  1K83 B;  4C3I G;  1PYB A;  2IY5 B;  4KKT A;  2AHO B;  1UNS A;  2MJ8 A;  4KN4 C;  2Q2T A;  5C4X G;  2CW0 C;  2LMC B;  1D5Z C;  2FIN B;  5M5W H;  1IZ6 A;  2CVR A;  1PZK D;  1KD1 C;  1NR4 A;  1U9R A;  2FFK B;  4A3C G;  3N6R A;  4QQB X;  1BCP D;  1VQN A;  1WVL A;  5EBD A;  3ERQ A;  3U50 C;  5HUR A;  4IUP A;  4RKB A;  3LWE A;  1STY A;  1TQO A;  4KD4 A;  2NVY H;  2KHS A;  3I4M G;  1Q8K A;  2Y0S B;  5EPL A;  5C0X H;  3DWQ A;  3MXG A;  1ML0 D;  4DR7 Q;  1TT2 A;  1TWC B;  1D8L A;  1HZB A;  1SDF A;  3NTK A;  1UEA B;  2CCZ A;  3GTQ B;  1SYD A;  3CC2 A;  2HIV A;  3PO2 B;  2MUY A;  4PZ7 A;  1IBM Q;  3A7A B;  4JI1 Q;  4K0K Q;  1RIP A;  3QIA A;  4B3M L;  4X62 L;  1IBL L;  4KHP Q;  2IL8 A;  4DV6 Q;  1EYG A;  3WOF A;  5CMD A;  5I9P A;  5FLX E;  1EQQ A;  1F2Z A;  1HQM C;  1K0S A;  5LL6 S;  4GKJ L;  1K9M C;  1Y1V H;  3Q8D A;  3D0F A;  3KLW A;  1HFN A;  2HD3 A;  4MNO A;  2EYO A;  4LAA A;  5JJI A;  2E2I H;  3RZD H;  4DV5 Q;  1P8L A;  2B3G A;  5IOD A;  3NE5 B;  4R4C A;  1YJW A;  3FHW A;  1WOC A;  3KDF B;  4IPG A;  4F87 A;  1H9M A;  5M3M G;  3PIO A;  3OYY A;  2BA0 A;  3IFT A;  2CW0 D;  5KNC A;  4B3R Q;  2AKW B;  2NZO A;  1HCZ A;  4LW1 A;  1YHA A;  1EUJ A;  3HG9 A;  4H44 C;  2RSO A;  2CKZ B;  2ZJQ A;  3GO5 A;  1B7Y B;  3KBG A;  1IYV A;  1VQC A;  2KJX A;  1KRT A;  3GTG B;  1MBY A;  1JB7 A;  1VQ7 A;  1CZW A;  2YTX A;  1QUQ B;  1SLJ A;  4TKO B;  3KUP A;  4QJF A;  3K6O A;  2EXD A;  4K5W A;  4RA8 A;  3NEM A;  4LF8 L;  5GAG C;  4IO9 A;  3RNU A;  1XYI A;  1EOT A;  3NBH B;  1O7Z A;  1SMX A;  2D9U A;  1S5D D;  2HCC A;  4GKK L;  1PH8 A;  3K7A B;  1ONL A;  4ODG A;  1L2F A;  1Q86 C;  2E75 C;  1L1O B;  1KL9 A;  2EPB A;  3TEH B;  1R9T B;  2F3I A;  1EEI D;  4OO1 G;  1A63 A;  3SE0 A;  2VNU D;  5KNB A;  1H9S A;  1RJT A;  4BBR G;  3FP9 A;  5C3E H;  4V0B A;  2RBM A;  3VYU A;  4KV6 A;  1HA6 A;  2UXD L;  1EFI D;  1A3V A;  1SMY D;  4BXX G;  1EWI A;  4R1J A;  2KCC A;  4J15 A;  1JE4 A;  1YHQ A;  2HHH Q;  1F9P A;  2WB1 E;  3A74 A;  3PSI A;  4QL5 A;  4WFN 3;  2F0S A;  3K80 C;  3HZX A;  3GTO B;  2QGQ A;  3W1G A;  2KHI A;  2JE6 I;  1CKM A;  4A3M G;  2XGT A;  3JAM E;  2UUA L;  4RGM A;  3SK8 A;  3I4O A;  2QA4 A;  4DR5 Q;  1FL0 A;  4RCO A;  4U68 A;  3ICE A;  3G6E A;  1Y1W H;  1C48 A;  3NEL A;  4ZUJ A;  4HAE A;  1XMO L;  1WCM B;  4X65 L;  4IFD I;  1BDO A;  3BYT B;  1N36 Q;  3MFG A;  4Y7N B;  3NQI A;  3NK9 A;  3OMG A;  5IGG A;  4A3F B;  2PI2 E;  1JWM D;  5J3B A;  2NVT H;  1EEF D;  1KC8 C;  1IL8 A;  3G6J B;  3D4R A;  2WAC A;  2B63 H;  1ENC A;  1RDP D;  4P75 A;  1MJE A;  3Q6S A;  3GTK H;  5K36 G;  2XWJ B;  1E24 A;  4EX5 A;  4BA2 I;  1WTQ A;  2HCI A;  1AE3 A;  1E1O A;  2NZH A;  2Q8R E;  1KNE A;  1E2V A;  2EJG C;  2R92 H;  2WB1 G;  1E22 A;  3H09 A;  1V43 A;  1QWY A;  3CCL A;  3VR5 A;  3PV0 A;  3PUX A;  3EVQ A;  1JT8 A;  1B8A A;  3UE0 A;  2YTY A;  5EKL A;  3HOX G;  1EU3 A;  3TS2 A;  2K5Q A;  1HHV A;  2EY1 A;  2B2W C;  1V1P B;  4RAU C;  4UPA A;  2AUJ D;  4JI7 L;  3ND9 A;  1D1I A;  1KLU D;  3PO3 H;  4H7B A;  3DEO A;  1BCP F;  4JBK A;  1O7L A;  2NWG A;  1IW7 C;  4DKA C;  1PTO B;  2VXW A;  2BE5 C;  2AQ1 B;  2A68 D;  2UXB L;  1Q12 A;  1TWG B;  1JC7 A;  1QJO A;  1EY7 A;  1T9H A;  4K2L A;  1EQV A;  1SAP A;  2EYL A;  4GOP C;  1I4X A;  2BDN A;  3LX0 A;  1Y69 U;  3J80 L;  3MC0 B;  3P7J A;  1TWF B;  1X56 A;  1PRT B;  5M3F G;  2WV6 D;  4BY1 G;  1LTB D;  5E1F A;  4DV0 L;  4GOP A;  2JEA I;  2N3S A;  3TP8 A;  1EQT A;  2OT2 A;  3X3N A;  5BN4 A;  4UP7 A;  4ILW A;  1X55 A;  4B3T Q;  3A8K E;  3QWN A;  1HXY D;  3A5Z B;  2OTL A;  4KN7 C;  4K5X A;  3HOW B;  1GOZ A;  3I90 A;  3SR1 A;  1HR0 W;  1VQO A;  3M85 A;  3HOU B;  4C3J H;  5DM6 3;  1TWA H;  1YVC A;  4L5T A;  2DJF C;  3Q24 A;  4C3I B;  4C1N K;  3H3V I;  3K58 A;  1DOM A;  1FNV A;  4JG2 A;  5C4X B;  2B2T C;  4BWG B;  3TP7 A;  4HMJ A;  4N8X 1;  4LUV A;  2E2J H;  2PMZ B;  3ZJY C;  5DNF A;  3M7G A;  4BBS G;  1AH9 A;  3VR4 A;  4X3S A;  2DNE A;  4HJ7 A;  2G9D A;  4BA1 I;  2QW7 A;  4J1M A;  3K0X A;  2JEB I;  2Z9H A;  2B2T A;  3L3O C;  4JW0 A;  3GQB A;  4HIK A;  3KLR A;  1LT3 D;  4UAI A;  2V4D A;  2M2L A;  2A69 C;  4J6H A;  5I6Y A;  1LTS D;  3AEV A;  3CF5 A;  5GAE C;  2UUC L;  2VZA A;  2Z6B A;  1SXT A;  4ABN A;  2D0O A;  4A3J H;  1R4Q B;  3I4M B;  2X69 A;  4B3M Q;  4X62 Q;  3PMF A;  1IBL Q;  4RKL A;  4X3T A;  1BBX C;  1BF4 A;  1HNX L;  3U58 A;  3GTM B;  5ELF A;  4KKU A;  1C9O A;  3RZO H;  4DR2 Q;  3I72 A;  4IPH A;  2KBN A;  4GKJ Q;  4K14 A;  1CHP D;  1YNX A;  3OTO Q;  4OIK A;  3RMH A;  4A3E G;  1UWV A;  5M5X H;  3MXN B;  1EFW A;  4FF2 A;  4A3I G;  4GLA C;  4NKL A;  3E9I A;  3V2T A;  1TWC H;  5C44 H;  2A8V A;  3PUW A;  1VQ5 A;  3MEH A;  4HMI A;  1HR0 L;  3CD6 A;  4GLV B;  2FHT A;  3J81 L;  5CC4 A;  5AJ3 L;  3M4O B;  4RGO S;  4YCV A;  5C4Z A;  2KEE A;  5BN5 A;  2A1A A;  1B3Q A;  3I3C A;  4KY6 A;  4CDE C;  2PNR C;  3V96 A;  4RWS C;  2B8F A;  3RN5 A;  5M9O A;  2IT1 A;  4L8J A;  4BY7 G;  3I4N G;  4S3S A;  1BO0 A;  2VS1 A;  5M3M B;  4X3U A;  4LF4 Q;  3S1M B;  3B6Y A;  4A3G G;  3ZYY X;  4MTK A;  2I5L X;  4DV4 L;  1XPO A;  1BUV T;  1K0R A;  1FNW A;  4LF8 Q;  5DEH A;  2EE1 A;  4JI2 Q;  1ZYR C;  3MXN A;  3S16 B;  3MHB A;  4FXD A;  2QKI C;  5KIX A;  2JA7 G;  4GKK Q;  4N9P A;  4R8I A;  1SJE D;  5ELB A;  4H02 A;  2A69 D;  3RN2 A;  3S2H H;  1B4O A;  1JOQ A;  4P73 A;  1RL2 A;  2F0G A;  4DR1 L;  4NXM Q;  2R7D A;  2OEO A;  2Z8L A;  4A3K G;  1WJJ A;  1J8I A;  3GTJ B;  4IJH A;  4QY7 A;  2XWB B;  3K8A A;  4QMG A;  1EWC A;  3FDT A;  4DNT B;  4JYA L;  1U5K A;  3AFQ A;  2P5Z X;  4B9X A;  1DM0 B;  1NJI C;  3VYR A;  3KF6 A;  2WII B;  2K5H A;  1SE8 A;  5CR3 A;  1XX8 A;  2F3V A;  3DXJ C;  4X66 L;  1CSP A;  3C1F A;  1JR0 D;  2AMC B;  1O7Y A;  2A6E D;  3U9S A;  4LUO A;  3F1Z A;  3J80 E;  3EN2 A;  4ZKB B;  2UUB L;  5D14 A;  4PQX A;  3VA5 A;  4BBR B; 
#chains in the Genus database with same CATH homology
 2PZW A;  1CQV A;  1KAB A;  2EYF A;  3D6W A;  4ZUI A;  1GUW A;  1YNJ D;  2WKC A;  5C4H A;  4NDX A;  3TDQ A;  1CZG A;  4XDX A;  1JCK B;  4ZLT F;  4HSP A;  4RFB A;  4PMC A;  3CRL C;  1TS4 A;  2PZU A;  4F8M A;  5JAV A;  3GV3 A;  1STB A;  2O2L D;  1CTM A;  4A3M B;  2IWH A;  1FNU A;  2F0F A;  5FLX L;  5CV6 A;  4K2K A;  4XXE A;  1Y8P B;  1BCP B;  1H9K A;  3QO2 A;  2A6H C;  1QE6 A;  2XRS D;  2PW7 A;  2Z4H A;  4B9W A;  3QOL A;  2KED A;  1UUP A;  1XWE A;  3S1Q B;  1SYB A;  1STA A;  2IPK D;  3P1H A;  2WB1 B;  2Z1C A;  3J7A V;  1STN A;  1SE4 A;  2R61 A;  1BCP C;  5M5Y B;  1W6J A;  4IUR A;  5JEA G;  3MZ5 A;  4KHV A;  3HOX B;  2N55 A;  3QOJ A;  2JP1 A;  4IFD H;  3C1E A;  1EY0 A;  3S15 B;  1EYA A;  2NTT A;  2QCP X;  2E2H B;  1OXV A;  1WTO A;  5COY A;  1IYU A;  4PNY A;  5C5M A;  3HEJ A;  5IGB A;  4O1N A;  1GUO A;  2DN8 A;  4FF4 A;  3D4D A;  3ND8 A;  4P2C B;  4XTC S;  1TR5 A;  5M3F B;  4LK1 C;  1DXM A;  4BY1 B;  1V1O A;  2RDH A;  1I3Q B;  1BNZ A;  4IAL A;  1HTL D;  1IKL A;  3D4W A;  2L12 A;  3JAM L;  2A6H D;  2EY6 A;  2ICE C;  1SND A;  1YNN D;  3NTI A;  1KDA A;  3PIO 3;  5IGE A;  3NQT A;  1KDC A;  2LS0 1;  3HRZ C;  4OL7 A;  3HGB A;  1PDQ A;  2PYK A;  4BBS B;  1SYF A;  1GXD C;  1B3A A;  5DM7 3;  3R93 A;  1A2T A;  1Q90 A;  1F2M A;  1QG7 A;  3LNN A;  1X3P A;  2F0N A;  3TSS A;  5TSS A;  1I4H A;  5C0X G;  1D5X C;  1KAA A;  2B8G A;  1DD2 A;  1G2S A;  3PUY A;  1STE A;  1LTR D;  1SNP A;  5JEA J;  1Y8N B;  2G9H D;  4K6D A;  5A35 A;  4B08 A;  2RKS A;  4QB4 A;  4HR7 B;  1FGB D;  2XSC A;  3R2T A;  4A3E B;  2KOL A;  4A3I B;  3M3Y B;  1SMY C;  1U4M A;  1ZXT A;  2ICI A;  5F2D A;  4Q5V A;  3T53 B;  3D8G A;  2BA1 A;  4ID6 A;  3IL8 A;  2EYJ A;  5JVH 3;  1EL0 A;  1QB5 D;  4R8N A;  3E6Z X;  5EPJ A;  4CJ0 B;  3DM1 A;  4FXK C;  3S1R B;  3MXU A;  4KTA A;  3KF8 A;  1A15 A;  1HFG A;  3I8Z A;  4DAP A;  1TKW B;  3D6C A;  3I73 A;  4BY7 B;  3E5S A;  4ZYS A;  3I4N B;  2NTS A;  1K8O A;  1RTO A;  1H9S B;  4OHJ A;  4A3G B;  1U4P A;  3V05 A;  4GZY C;  1G8Z D;  1U4L A;  1OXU A;  1TS2 A;  2SOB A;  2JA7 B;  2AWN A;  3GTP B;  5DAU A;  1C8C A;  1JWS D;  2EVB A;  4ZRZ A;  4EQO A;  3K59 A;  1DON A;  3MVV A;  5KRU A;  2L9H A;  1LAB A;  4A3K B;  3NWS A;  3TBI B;  1A6X A;  1NUC A;  5E3F A;  2ID0 A;  2XN9 C;  1U4R A;  1KTK A;  1HRJ A;  4MN3 A;  1AEX A;  2YU9 B;  1JQY D;  3Q23 A;  4EQN A;  3I70 A;  2MGS A;  5C0X J;  5EQ0 A;  3K5L A;  2ENB A;  5LHY 1;  2A68 C;  1FR3 A;  1G6Z A;  2LKV A;  1D6E C;  3EJI A;  4YIJ A;  4DAV A;  1OXX K;  2M9V A;  1SNO A;  1MGS A;  2XRQ D;  2PQE A;  2KVM A;  5NUC A;  5I9O A;  2NN6 G;  1AN8 A;  3NTH A;  3BDC A;  2HQE A;  5E4X A;  3VR3 A;  1PFB A;  4WRD A;  1A2U A;  1ZKO A;  2OXP A;  2A73 B;  2KEC A;  2F0K A;  2F0P A;  3HKZ B;  5I6W A;  2VB3 X;  2D5D A;  3CRK C;  1H9R A;  3DWP A;  3KK7 A;  3L7Z C;  5IT9 E;  4ZAI A;  5BN3 A;  1EWH A;  3GP7 A;  1LAC A;  1V8Q A;  2O5I C;  3IFD A;  4IZ8 A;  3BVZ A;  2JA8 B;  3S2D B;  4DNR B;  4KKS A;  3OWE B;  3EA6 A;  3AMU A;  1I4P A;  5C3X A;  1BOS A;  3TME A;  2RDG A;  2XIW A;  4PMW A;  3C3L A;  1I4G A;  2B2W A;  1HQR D;  2EXZ A;  1OXS C;  1SNM A;  3FKI B;  1HTP A;  3S14 B;  1QIL A;  1ILQ A;  3BG3 A;  5EBC A;  2F0Q A;  4DF7 A;  1HUN A;  5CBE E;  1BXT A;  2BDO A;  4IUU A;  1KLG D;  4KMU C;  4KY5 A;  2RVL A;  3MA2 B;  2SNS A;  2QF7 A;  1PZJ D;  4CJ1 B;  2SDF A;  1UAP A;  4HTH A;  1VCI A;  4XYQ A;  4DK0 A;  3CQZ B;  4Q0F A;  4FF1 A;  4PMB A;  5J39 A;  1GHJ A;  5C6A A;  4A93 B;  3TZD A;  1DOK A;  5C0X I;  3QJY A;  5I4D A;  5M5W B;  3GV6 A;  4X3K A;  2R6G A;  3SVM A;  1TY0 A;  3A7L A;  4FXG C;  4XQJ A;  3ERO A;  3PUZ A;  2RA4 A;  1F77 A;  1EY6 A;  5ELC A;  2L0C A;  1GUG A;  2NVY B;  4NMZ A;  4QIW B;  5D3I B;  2F0L A;  1IKM A;  2WP8 J;  2X6L A;  3X3M A;  1AW7 A;  1XTC D;  3HOV B;  1SEB D;  2F0M A;  5JVG 3;  1NR2 A;  2A6E C;  3OW7 A;  1SYG A;  4MHE A;  4DFA A;  3KLS X;  4KK7 A;  2I07 B;  1YNJ C;  1L0X B;  1ILP A;  1J9O A;  1Y1V B;  1HUM A;  3OMC A;  2C9O A;  1M8A A;  1SE3 A;  2K03 A;  2E2I B;  1CT1 D;  1EZ6 A;  3NP8 A;  2B2V C;  2AUK A;  1RF2 D;  2EOT A;  2PO4 A;  3K5N A;  1MI2 A;  1ESR A;  1PTO D;  1I4Q A;  2F0D A;  3P20 A;  2B2V A;  1B9N A;  3H6M A;  3BYY B;  4DN4 M;  3HOZ B;  1FD7 D;  2H1E A;  3DMU A;  1PRT D;  4OO1 I;  5I2Y A;  3C46 A;  5KEE A;  2K5D A;  4WJW A;  2Z4I A;  2JA6 B;  5C3W A;  1DCZ A;  1LTT D;  4M1U B;  4ME5 A;  2F0O A;  1EZ8 A;  2E74 C;  4Z9C B;  3NUC A;  2O4X A;  2JYO A;  3C2P A;  1LLR D;  1G29 1;  4XIG S;  2JSO A;  4KHZ A;  1DZ1 A;  2WIN B;  5C3E B;  5CGK A;  2Q8T A;  1S5E D;  1LV9 A;  1RHP A;  1SNQ A;  5EGT A;  2NN6 I;  1ENA A;  4K5V A;  3MAQ A;  2RSN A;  1II3 A;  4QCL A;  3K5M A;  1EYC A;  2A5H A;  1WD0 A;  1S4Z A;  2VB2 X;  3F2U A;  1WTP A;  3SHL A;  1KDB A;  2PZT A;  2E2D C;  4G57 A;  2NZ1 D;  1STG A;  1HPC A;  3GTL B;  1SNC A;  1Q1E A;  2HUG A;  4KJO A;  1EY4 A;  4LJZ C;  3CKI B;  1TS5 A;  1LTI D;  2B63 B;  4V19 0;  3TZU A;  5EJW A;  1Z7T A;  1NAP A;  1EY8 A;  1GUN A;  3IAY A;  1YNN C;  1GUS A;  4CKC A;  5T1I A;  1TU2 B;  2R92 B;  4AYB B;  3FEW X;  3NHH A;  1BQQ T;  3RLF A;  4U67 3;  2F0W A;  5CV5 A;  2B2Y C;  3Q0A A;  4NW2 A;  2JXM B;  1AP0 A;  2FJ2 A;  2AWO A;  5IIF A;  2MP1 A;  1I4R A;  2B2Y A;  3J7A F;  3PO3 B;  1Z47 A;  1TS3 A;  5T1G A;  3H94 A;  2F3W A;  1KNA A;  2EYH A;  4WOR A;  1B50 A;  1WTX A;  1JB3 A;  3ONA B;  4IUN A;  5IGD A;  4DXF A;  2I46 A;  3S9W A;  3P75 A;  4HCE A;  1PTO H;  1PZI D;  4FP5 D;  4QF4 A;  1CFM A;  5KGU A;  4A3D B;  1HA5 A;  5KYL A;  1XXG A;  3CHB D;  1DYQ A;  2KCN A;  4G7Z C;  3O13 A;  3N52 A;  1B2T A;  1E2Z A;  5FK9 C;  1GJX A;  3Q22 A;  3EQL C;  3K57 A;  1ET9 A;  3BZD B;  2F0T A;  2VUM B;  4C1N I;  1PTO F;  1K8M A;  3OWF A;  1JIC A;  3M7N A;  1NCV A;  5IT9 L;  4C3H G;  4IQZ A;  1AFP A;  5ELE A;  4A3J B;  1PRT F;  4IN3 A;  1I6V C;  1Q3L A;  3U9O A;  1X3Q A;  3RZO B;  4H0L C;  3HS0 C;  1F2L A;  1LO5 D;  3VYS A;  1OXT A;  5FO9 B;  1A3U A;  2BCO A;  4IFD J;  5HGT A;  4CHT B;  2D2C C;  1WD1 A;  4OIJ A;  5M5X B;  1T5E A;  4DA2 A;  5JOB A;  4EQP A;  1QNK A;  4DGZ A;  4RGN A;  4E6I A;  5C44 B;  5K5P A;  4XQQ A;  5JPN C;  4FO2 A;  3M4Y A;  5I2X A;  2TSS A;  2AQ2 B;  3K0Y A;  3W3A A;  4L6T B;  1VDZ A;  3VA7 A;  5IGF A;  3D3R A;  4KJN A;  3WDN A;  4HCS A;  2QDB A;  3I91 A;  4K8I A;  2F0J A;  2K1B A;  1TVX A;  1PFN A;  2C5C A;  4CKE A;  2AQ3 B;  2F4I A;  2CHB D;  1JOK A;  1AZQ A;  1B9M A;  2OF1 A;  2K04 A;  2L5T A;  4F88 A;  1O78 A;  3S2H B;  3BVG A;  2K33 A;  5A2Q L;  1PYW D;  1D1K A;  4UDU C;  1B44 D;  3LWU A;  3K5O A;  2KUM A;  3A8J E;  4I65 A;  1EIH A;  1JWU D;  2FMC A;  2J4X A;  2DY7 A;  4ZQ3 A;  5FO8 B;  4CGY B;  2IJ0 A;  1GUT A;  2L11 A;  2EY2 A;  1QNU A;  3QB3 A;  3S1N B;  4RGT A;  1JOO A;  1WTW A;  1ESF A;  1RKN A;  3T56 B;  4OO1 H;  2JA5 B;  4QUF A;  4IUQ A;  1Q1B A;  2NBF A;  1LT6 D;  1X32 A;  3TN2 A;  3H0G B;  3URY A;  1WTR A;  5IGC A;  1R4P B;  2L1B A;  1W6K A;  2F0H A;  3DEP A;  3NBH A;  1Z6H A;  4RCN A;  2IX1 A;  3HP3 A;  3SXH A;  2F03 A;  3IKJ A;  3HOY B;  2SNM A;  1F9R A;  2NYZ D;  2PW5 A;  1CHQ D;  1F2Y A;  2F0I A;  1CQF A;  2J7Z A;  5ELD A;  2NN6 H;  4XT1 B;  3R3O A;  1NSN S;  1S5F D;  4CBV A;  2PCF B;  2EJM A;  1RTN A;  4XT3 B;  2LY7 A;  5K36 H;  4N9T A;  1G91 A;  2EZV A;  2HDM A;  1TII D;  2L4N A;  1SYE A;  4CKB A;  1SYC A;  4EVO A;  1CA6 A;  1VF7 A;  4G4K A;  2F0V A;  5CV7 A;  2R3Z A;  5EKI A;  2B39 A;  1IHZ A;  5COR A;  3BS1 A;  2BOS A;  2X6G A;  1TWH B;  5LL6 X;  4M8A A;  3AB9 A;  3FRP B;  2M00 A;  2K05 A;  4TSS A;  4EGV A;  1PFM A;  4H13 C;  1AZP A;  3I4L A;  3VR2 A;  4FNF A;  4DXG A;  5C4J B;  3PUV A;  2K6A A;  5CV4 A;  3SK5 A;  2FMM A;  4C2M B;  5JPM C;  4JK1 C;  1E0B A;  2NB0 A;  4C3J G;  2NVQ B;  4L63 B;  3NBI A;  3G7L A;  1PTO C;  1V1P A;  2ZXP A;  5AFW A;  1CA5 A;  2DNC A;  2EYM A;  3SK4 A;  1MD2 D;  2F0E A;  5A2Q E;  1EY5 A;  1ICW A;  1LT4 D;  4DU9 A;  4NP5 A;  2TMP A;  3DHQ A;  3A56 A;  1CI3 M;  4KI0 A;  5C5L A;  1LTA D;  3L9A X;  1DOL A;  2RQX A;  3RUZ A;  1PRT C;  2A74 C;  3A55 A;  1E2W A;  2CQA A;  2LFN A;  4CJ2 C;  3KBX A;  5J22 A;  4C3H B;  3T4A C;  3VR6 A;  2KQ3 A;  1PMR A;  4JBW A;  2NVX B;  4KY7 A;  1VMC A;  3VYT A;  5EKK A;  5G3L D;  2O5J C;  4MIU A;  3NPP A;  4QUC A;  4HSV A;  4HN7 A;  1S5B D;  2H4O A;  1O80 A;  3NWT A;  1IW7 D;  2BE5 D;  1LTG D;  3TP5 A;  2ZXO A;  4KD3 A;  4G7O C;  4PV1 C;  1SFO B;  3BVM A;  2ZXR A;  3RZD B;  3T16 A;  2J0T D;  3WOE A;  4DAY A;  3H3V C;  3CU7 A;  2K7V A;  1B1Z A;  3T13 A;  1RD9 D;  4RHR A;  4F7X A;  2F0U A;  3KLS A;  3EFX D;  1F9Q A;  2B2U C;  4RHS A;  3QG1 A;  1GHK A;  4TRD A;  1SBB B;  1MSG A;  2PPB C;  3BDO A;  3OIQ A;  4IUT A;  1Y8O B;  2IX3 A;  2B2U A;  3W2D A;  3FPU B;  1T5X D;  1EYD A;  1EIG A;  2F1M A;  1JOR A;  1M4V A;  4I7Z C;  1TY2 A;  1EU4 A;  4A3B B;  2SEB D;  5CV9 A;  1RCV D;  1DJR D;  3MTS A;  3OIP A;  3PIP 3;  4RH6 A;  5FOB B;  4K6L A;  2N88 A;  5EPK A;  5CV8 A;  2IW3 A;  4R9W A;  2IX0 A;  4LMQ D;  5KND A;  4DK1 A;  4XYO A;  1VMP A;  3FVQ A;  1S5C D;  2HDL A;  1BR9 A;  2QEJ C;  1ENF A;  1QOH A;  1PXU A;  3OSO A;  5CBA E;  4G7H C;  2NUC A;  1SE2 A;  5FKA C;  1Y1W B;  2R7Z B;  5D65 A;  1ROD A;  2DY8 A;  2KA7 A;  1H9J A;  3H91 A;  3DWA A;  2EDG A;  3T51 B;  2NVT B;  3A8I E;  1STH A;  2RDF A;  4FYD A;  2QIL A;  1WTV A;  3GTK B;  4IUV A;  2WAQ B;  2ZT9 C;  3ITP A;  2K32 A;  1A3T A;  5J1Z A;  4ZK9 B;  3OHX C;  1QCB D;  4K8J A;  5E4W C;  1F9S A;  3MFY A;  1ZYR D;  3J7Y W;  1SJH D;  1D5M C;  2Q8I B;  3AU7 A;  2K5W A;  4ZKC B;  2L55 A;  2R93 B;  3RD4 A;  2XVS A;  4BS9 A;  1VF5 C;  3A54 A;  4IFD G;  3GD7 A;  1ET6 A;  4OGQ C;  1SSO A;  5IOC A;  1G2T A;  3NXW A;  2MHV A;  5D3D A;  4C56 C;  4J8Q A;  3TP6 A;  3BDL A;  3S17 B;  3MXP A;  1C4Q A;  4TQU S;  5JEA H;  2EY5 A;  1I50 B;  2EYP A;  3OPO A;  3SEB A;  4HED A;  5CYU A;  2XNA C;  2K01 A;  3UI2 A;  1PLF A;  2D62 A;  1B53 A;  1I6H B;  4O42 A;  3FPP A;  3D31 A;  5JJZ A;  5G3L F;  2E76 C;  3NSW A;  3R2I A;  1Q8I A;  1MSH A;  4FF3 A;  3J81 E;  3SK6 A;  1FYC A;  1D2B A;  3DUZ A;  2GA4 B;  3OOC A;  3FMC A;  3E0J A;  1ZEQ X;  5ISR A;  4C3J B;  1TWA B;  2WKD A;  2MPM A;  1L0Y B;  2YYZ A;  1OO9 B;  3SDZ A;  4ULL A;  5KYI A;  4XQN A;  3R8B A;  4FVM A;  3MWY W;  1LT5 D;  2E2J B;  1CK1 A;  1EY9 A;  2EJF C;  1CM9 A;  2K28 A;  5FO7 B;  1K83 B;  4C3I G;  4KKT A;  1UNS A;  2MJ8 A;  4KN4 C;  2CW0 C;  2LMC B;  1D5Z C;  2FIN B;  2CVR A;  1PZK D;  1NR4 A;  1U9R A;  2FFK B;  3N6R A;  1BCP D;  1WVL A;  5EBD A;  3ERQ A;  5HUR A;  4IUP A;  4RKB A;  3LWE A;  1STY A;  1TQO A;  4KD4 A;  2KHS A;  2Y0S B;  5EPL A;  5C0X H;  3DWQ A;  3MXG A;  1ML0 D;  1TT2 A;  1TWC B;  1SDF A;  3NTK A;  1UEA B;  3GTQ B;  1SYD A;  3PO2 B;  2MUY A;  3A7A B;  3QIA A;  2IL8 A;  3WOF A;  5CMD A;  5I9P A;  5FLX E;  1F2Z A;  1HQM C;  5LL6 S;  1HFN A;  2EYO A;  4LAA A;  5IOD A;  3NE5 B;  4F87 A;  1H9M A;  2BA0 A;  3IFT A;  2CW0 D;  5KNC A;  1HCZ A;  4H44 C;  3HG9 A;  2RSO A;  3GO5 A;  3KBG A;  1IYV A;  2KJX A;  3GTG B;  1MBY A;  1CZW A;  4TKO B;  3KUP A;  3K6O A;  4K5W A;  4RA8 A;  1XYI A;  1EOT A;  1O7Z A;  2D9U A;  1S5D D;  2HCC A;  3K7A B;  1ONL A;  4ODG A;  2E75 C;  2EPB A;  1R9T B;  1EEI D;  4OO1 G;  3SE0 A;  2VNU D;  5KNB A;  1H9S A;  1RJT A;  4V0B A;  2RBM A;  3VYU A;  4KV6 A;  1HA6 A;  1EFI D;  1A3V A;  1SMY D;  2KCC A;  1JE4 A;  1F9P A;  4WFN 3;  2F0S A;  3GTO B;  3HZX A;  2JE6 I;  3JAM E;  4RGM A;  3SK8 A;  4RCO A;  4U68 A;  1C48 A;  4ZUJ A;  4HAE A;  1WCM B;  4IFD I;  1BDO A;  3BYT B;  3MFG A;  4Y7N B;  3NQI A;  3NK9 A;  3OMG A;  5IGG A;  4A3F B;  1JWM D;  1EEF D;  1IL8 A;  3G6J B;  3D4R A;  2WAC A;  1ENC A;  1RDP D;  5K36 G;  3Q6S A;  2XWJ B;  4BA2 I;  1WTQ A;  2HCI A;  2Q8R E;  1KNE A;  1E2V A;  2EJG C;  3H09 A;  1V43 A;  1QWY A;  3VR5 A;  3PV0 A;  3PUX A;  3EVQ A;  5EKL A;  1EU3 A;  2K5Q A;  1HHV A;  2EY1 A;  2B2W C;  1V1P B;  4RAU C;  2AUJ D;  3ND9 A;  1D1I A;  1KLU D;  4H7B A;  3DEO A;  1BCP F;  1O7L A;  2NWG A;  1IW7 C;  1PTO B;  2VXW A;  2BE5 C;  2AQ1 B;  2A68 D;  1Q12 A;  1TWG B;  1JC7 A;  1QJO A;  1EY7 A;  4K2L A;  1EQV A;  1SAP A;  2EYL A;  1I4X A;  2BDN A;  3LX0 A;  1Y69 U;  3J80 L;  3MC0 B;  3P7J A;  1TWF B;  1PRT B;  2WV6 D;  1LTB D;  5E1F A;  2JEA I;  3TP8 A;  1EQT A;  2OT2 A;  3X3N A;  5BN4 A;  4ILW A;  3A8K E;  3QWN A;  1HXY D;  4KN7 C;  4K5X A;  3HOW B;  1GOZ A;  3I90 A;  3SR1 A;  3M85 A;  3HOU B;  5DM6 3;  3Q24 A;  4C3I B;  4C1N K;  3K58 A;  1DOM A;  1FNV A;  5C4X B;  2B2T C;  4BWG B;  3TP7 A;  4HMJ A;  2PMZ B;  5DNF A;  3M7G A;  3VR4 A;  4X3S A;  2DNE A;  2G9D A;  4BA1 I;  4J1M A;  2JEB I;  2B2T A;  3L3O C;  3GQB A;  3KLR A;  1LT3 D;  4UAI A;  2V4D A;  2M2L A;  2A69 C;  4J6H A;  5I6Y A;  1LTS D;  4ABN A;  1SXT A;  1R4Q B;  3I4M B;  2X69 A;  3PMF A;  4X3T A;  4RKL A;  1BBX C;  1BF4 A;  3GTM B;  5ELF A;  4KKU A;  3I72 A;  4K14 A;  1CHP D;  4OIK A;  3RMH A;  4FF2 A;  4NKL A;  3V2T A;  3PUW A;  3MEH A;  4HMI A;  2FHT A;  3J81 L;  5CC4 A;  3M4O B;  4RGO S;  5C4Z A;  2KEE A;  5BN5 A;  3I3C A;  4KY6 A;  2PNR C;  3V96 A;  4RWS C;  2B8F A;  5M9O A;  2IT1 A;  4L8J A;  4S3S A;  1BO0 A;  5M3M B;  4X3U A;  3S1M B;  3ZYY X;  1BUV T;  1FNW A;  5DEH A;  2EE1 A;  1ZYR C;  3MXN A;  3S16 B;  3MHB A;  4FXD A;  2QKI C;  5KIX A;  4N9P A;  4R8I A;  1SJE D;  5ELB A;  2A69 D;  1B4O A;  1JOQ A;  2F0G A;  2OEO A;  2Z8L A;  1J8I A;  3GTJ B;  2XWB B;  4QMG A;  1EWC A;  3FDT A;  4DNT B;  4B9X A;  1DM0 B;  3VYR A;  2WII B;  5CR3 A;  1XX8 A;  2F3V A;  3DXJ C;  3C1F A;  1JR0 D;  1O7Y A;  2A6E D;  3U9S A;  3J80 E;  4ZKB B;  5D14 A;  4PQX A;  3VA5 A;  4BBR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...