1F9SA

Crystal structure of platelet factor 4 mutant 2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
DGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGSKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET FACTOR 4
publication title Structure Comparison of Two Platelet Factor 4 Mutants with the Wild-type Reveals the Epitopes for the Heparin-induced Thrombocytopenia Antibodies
rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 10
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9sA00
2MPMA 2H1EA 1CM9A 1ICWA 1M8AA 1G91A 3DM1A 1ZXTA 2JYOA 4IUQA 2EE1A 2FMMA 2K04A 4IUVA 1WTOA 2DY7A 2B2UA 2L1BA 4IUUA 3TZDA 1J8IA 3TN2A 1XYIA 1U4PA 4QUFA 3GV6A 1O7ZA 3D6WA 1WTXA 2K28A 1NAPA 4ZAIA 3MWYW 1J9OA 2K05A 1F9RA 2RVLA 1JE4A 2L9HA 2XIWA 2X69A 3FDTA 2D9UA 1MI2A 2L4NA 2Q8TA 1EIHA 1EL0A 4OIKA 3SVMA 2RSNA 1HUMA 2KECA 3KUPA 4X3SA 3F2UA 2HDMA 2RSOA 1AZPA 2CVRA 2EOTA 2NYZD 3DEPA 4MN3A 5CMDA 1O7YA 2RA4A 3LWEA 2K03A 3P7JA 1WTWA 1WTVA 1IKMA 4ZKCB 4DN4M 3G7LA 1VMPA 2MJ8A 1B4OA 2FINB 1PFNA 1KNEA 3QO2A 1B53A 1U4MA 2B2TA 2K01A 4ZLTF 1WTPA 2FFKB 1U4LA 2X6GA 1F9SA 1QNKA 3N52A 1DOLA 1LV9A 1RJTA 4LMQD 5D65A 5T1IA 1CA5A 1XX8A 5CBEE 1RTOA 2J7ZA 5JJZA 1EQTA 1SAPA 3I91A 5CBAE 3I3CA 2FJ2A 2N55A 1BBXC 1BF4A 2Q8RE 3R93A 2HCCA 4X3UA 2JP1A 1ESRA 1F9QA 3Q6SA 4XDXA 4HAEA 5EJWA 1IKLA 4R8IA 1GUWA 4RA8A 1F2LA 1TVXA 2B2WC 1ILQA 2B2YA 2B2VC 2EPBA 2KOLA 4HEDA 4R9WA 1QG7A 2MP1A 2HDLA 3ONAB 3MTSA 4HCSA 1O80A 2NZ1D 4OIJA 1WTRA 1EIGA 4QUCA 1AZQA 1Q3LA 2MGSA 3I90A 4NW2A 1B50A 1NR2A 1RODA 1HA6A 4RAUC 4CJ2C 2KVMA 3GV3A 1AP0A 2B2TC 4RWSC 2BDNA 1VMCA 4XT1B 1WTQA 5COYA 2N88A 2M2LA 1G2TA 1C8CA 1HUNA 2B2UC 1U4RA 1ILPA 1CA6A 1SSOA 4IUTA 1PFMA 1F9PA 1BO0A 2KEEA 1DONA 1IL8A 1HFGA 2R3ZA 1WD1A 4IURA 1S4ZA 5DNFA 5T1GA 2SDFA 1RTNA 5EQ0A 3IFDA 1SDFA 4MHEA 1X3PA 1HRJA 2VXWA 1DOKA 3KBXA 4X3KA 2IL8A 1E0BA 1PDQA 1NR4A 1QE6A 4HSVA 4U68A 5E4XA 1A15A 1MSHA 2DY8A 4X3TA 5EKIA 5EPLA 2B2YC 2L12A 1X32A 2NWGA 3DEOA 1KNAA 4IUPA 1X3QA 1DOMA 1NCVA 3IL8A 5E4WC 1WD0A 1G6ZA 4UAIA 2L11A 2KEDA 1G2SA 1PLFA 2X6LA 5EPJA 3UI2A 1BNZA 1HHVA 5EPKA 1DZ1A 2HUGA 4CJ0B 3FPUB 1RHPA 3I8ZA 1JICA 1ML0D 1B3AA 3HP3A 1MSGA 1MGSA 3H91A 2K1BA 4CJ1B 4O42A 5CORA 2HCIA 2FHTA 1PFBA 2KUMA 4ZKBB 2B2VA 2B2WA 5D14A 1B2TA 1WVLA 4ZK9B 5AFWA 4XT3B 1HFNA 1EOTA
chains in the Genus database with same CATH superfamily
2F0OA 1PH5A 1VF7A 1V9PA 3E9IA 1G6PA 4IUQA 3PIO3 1LTRD 3RD4A 1EQRA 3CQZH 4XYQA 3HOZH 1JB7A 5GAEC 1KC8C 1E7ZA 1GM5A 1BKBA 4N9PA 3OW2A 2JQOA 3MC0B 2B63H 3HOZG 3S2HB 2K05A 1SN8A 2EXDA 3SVMA 4DK3C 3PV0A 3H0GH 2B63G 2CVRA 3DM3A 2F1MA 1F77A 3IAYA 1A2UA 3BZCA 4PZ7A 1ICFB 3H0GG 4IPGA 3U50C 3TP7A 2PQEA 1B4OA 4ZLTF 5IYDH 4J1MA 3H3VI 4LMQD 4CDDC 1RTOA 2J0TD 5IYDG 1Y14B 3HOWB 4QIWE 4PMCA 4LFBQ 1HR0W 2ASBA 2HHHL 1Q12A 3A55A 3T56B 2VQEL 1TT2A 4KKTA 1JE5A 3NWTA 3ONAB 1I3QH 3V05A 2RDGA 1E22A 1AE2A 2MGSA 4DR7Q 1VQIA 2PQAA 4O2DA 1NR2A 3HOXH 3SR1A 4B3ML 3ER0A 4K2KA 1L1OB 2AUJD 2IY5B 4RWSC 1Y1VH 2BDNA 2EYJA 1UEBA 5IODA 3HOXG 5FOBB 4IUTA 1XTCD 4K6LA 1LTTD 1Y1VG 2QGQA 1HFGA 1SYGA 1VQEA 1XJVA 5T1GA 2NVXH 2AWNA 4C1NK 1ZYRC 1FJGQ 2VXWA 4U68A 1PH6A 3HOVB 5A2QE 1VQAA 4NDXA 4JBKA 2NWGA 3EQLC 3PUZA 4X62Q 3KF6A 1VQPA 4G7ZC 5C3EB 1G2SA 2R7ZB 5DM73 3NELA 3S15B 1PTOF 4JOIC 1PH1A 4AYBE 5IP7H 1B3AA 3KDFA 4I7AA 1B8AA 3ULPA 2QILA 5IP7G 1A8VA 2F3IA 3KK7A 2F0WA 1F2ZA 2HD3A 2YV5A 5J39A 3L3OC 4DA2A 1TWGH 3T1HQ 1H9JA 4X65Q 3GTGH 1TWFB 3CRKC 2UXCL 1V1PB 3BZKA 1FGBD 3TN2A 1S3OA 1EWIA 1ONLA 2N3SA 1XYIA 2JEAI 1AFPA 2M00A 3CU7A 1ASYA 4R4OA 3H94A 1L0WA 2X69A 2R92H 2PZUA 2KECA 2O5IC 3KJPA 4NPSA 2MO1A 3LWEA 3I4NH 3HKSA 1RIPA 2R92G 3M85A 1SNOA 3AFQA 4RCOA 2PO4A 1KNEA 4NP5A 1HA5A 3I4NG 2XSCA 3MVVA 1UE5A 5DM63 1HTPA 5K5PA 3RZDH 4CBVA 3S1MB 3SGIA 3R8BA 4RHSA 3JAMi 4S3SA 3I4MB 3MXGA 1I50B 4NXNQ 2F52A 2KENA 2Q2UA 2E76C 5GROA 1BBWA 1HH2P 2EZVA 1TY0A 3A8IE 1Q1BA 1B2TA 1F2MA 5CV8A 1PTOD 4PZ6A 4DK6C 2LXKA 2HHHQ 1K83B 1PTOC 3I90A 3NUCA 3DHQA 3U58A 4DFAA 3R2IA 1Y8NB 1Q8KA 1G2TA 5JPMC 3KLSA 2EJGC 4R4IA 3T51B 2JN4A 4B3MQ 1B70B 1QZHA 1IZ6A 4A3JH 5EQ0A 2H5XA 3T13A 4BA2I 2D2CC 1L0XB 3E3XA 4HN7A 2XNAC 1QNUA 1PDQA 4A3JG 1STGA 2LS01 1Y8OB 3V96A 1ASZA 4JI7L 1EIFA 5C4XB 4IUPA 1Q1EA 1AW7A 3TP6A 1EU3A 4K5WA 4FXKC 3KF8B 5EPJA 4KTAA 2IW3A 1I4QA 4JI4L 1S40A 3S9WA 3OWFA 5FLXc 4CJ1B 2HCIA 1DGSA 4RCNA 5D14A 4B08A 3IRBA 1I6HB 1PYWD 2PI2E 2QEXA 1OTCA 2K5DA 4C3JH 4KD3A 3MEHA 2JJQA 2O4XA 4LF6Q 3K5LA 2NVYB 4C3JG 1C9OA 1FD7D 1FVIA 1JC7A 2LKVA 3E0JA 1CZGA 4ME5A 5JVH3 1F2YA 4G4KA 4OIKA 4DV2Q 3W2DA 4M1UB 4A3FH 3DEPA 4AYBG 3WOFA 1AP0A 3S1NH 3J80i 1VQGA 2LMCB 3FRPB 4A3FG 1TS4A 2NN6H 1K0RA 1JJGA 4IFDJ 5C3WA 3HOYB 1DONA 2I5LX 4JOIA 4BY7H 2NN6G 2UXBL 2O5JC 4LF9Q 1MJEA 4RGNA 4BY7G 4L5TA 3W1BA 4QF4A 5ISRA 1NUCA 3DLLA 2UXDQ 1YJWA 4OXPA 3PQIA 4DV5Q 5FLXL 2BH8A 3S2DH 5ELEA 5GAGC 5BN3A 1PRTC 1GUWA 3EFXD 5M3FG 1XTDA 2E5LL 1Q90A 1QILA 1WFQA 2WFWA 2PZTA 1EQVA 3CCUA 4QL5A 4UHVA 1XPRA 2F0SA 3GV3A 4BBRB 3CXCA 2DNCA 3GTKH 1NE3A 1WTQA 2VL6A 2SOBA 1U4RA 4OX9L 4A3MB 4M8AA 3CCQA 1FNWA 3W5OA 3S1QB 1JCKB 5I9PA 4LF4L 1WD1A 2KHIA 5KNCA 3SHLA 2E2HB 5ELOA 4DU9A 3QR8A 4L5RC 2JA9A 5E4XA 4JI5L 2ZM6Q 3VR3A 1YHBA 4DR5Q 1LLRD 5ELDA 2EXZA 4GNXA 5C5MA 4GOPA 2A19A 1WD0A 4BWGB 1TS3A 1UEAB 4KV6A 2CH4W 3UI2A 4UDUC 4R1JA 1VQ5A 2MHVA 1MKHA 1RHPA 1YVCA 3I8ZA 4JI7Q 1R9TH 1STNA 4JI0L 5CYUA 1ENAA 2E75C 3BS1A 5IOCA 3ZJYC 2R6GA 5M5YH 3GTPH 2BE5C 5M5XB 5KGUA 4JI4Q 2PNRC 2IHEA 2R61A 3OTOQ 1HQMC 3F8TA 3K6OA 3SK6A 1ICWA 4EGVA 3VYRA 3DM1A 1ZXTA 4K0KQ 5IGGA 3VA5A 1E24A 2JA8H 3RN2A 1U4PA 4X6AH 3CCSA 4DR2Q 3D6WA 4H0LC 3PIP3 2JA8G 3RZOH 3LWUA 1BOSA 5EBCA 2I5MX 3GTMH 2IX1A 4QGUA 1O7YA 2EYHA 3GP7A 1IW7D 4DAYA 1PFNA 4YWLA 4ME3A 3NP8A 2MO0A 3FMCA 1SE8A 1S72A 1OO9B 3PO2H 3S16H 4B3TL 1F9SA 3QJYA 1KDCA 2D5DA 1XX8A 3HRZC 4J6HA 2K5HA 4P74A 2DN8A 3PO2G 4V190 5D3DA 2GA4B 1SXTA 2CHBD 4RKBA 4FP5D 1BBXC 2Q8RE 1BCPC 3OIQA 5H1SE 1KXLA 1W2BA 2EJMA 4LJZC 2L0CA 2B2VC 3CCEA 2WIIB 1D5XC 1H9RA 2HDLA 3SEBA 1SE3A 1NMFA 1CT1D 3GTJB 4GKKL 1VMCA 1HQRD 4WORA 1CA6A 1SSOA 2NZOA 1SFOH 2L55A 1QUQA 3KLSX 3RN5A 4UP8A 1IYUA 3NQIA 4FYDA 2WAQE 4QY7A 2JXMB 2NTTA 1B1ZA 1SE2A 1GUOA 1DD2A 4JG2A 4DV1L 2F0DA 3PGZA 4ZRZA 3HOUB 2L12A 1K3RA 4LF4Q 5ELBA 3NBIA 2Q2TA 1P16A 2B39A 1V8QA 2HT1A 4JI1Q 2KEDA 2A68D 2CWAA 2QF7A 2OF1A 1E1TA 4YY3L 1C0AA 3HP3A 3AEVA 1OXSC 2JSOA 2CW0C 1EYGA 4IPCA 4LK1C 2KBNA 2Y0SB 3MA2B 1M4VA 2R93H 1SR3A 1EOVA 4JI0Q 2F0LA 4FXGC 2OQKA 4LWCA 2R93G 3CKIB 4ZCKA 3U9OA 2Z6BA 3T53B 1PZJD 1WCMH 2DY7A 3HKZE 3CQZB 4DK1A 4ILWA 1O7ZA 4HIOA 1TU2B 1NAPA 1WCMG 2K28A 4LFCL 3H09A 1B9NA 4J15A 1KRTA 3J7AV 1Q7YC 5M5WH 4V0BA 5JOBA 1E2WA 2N8NA 1S5FD 4MN3A 2RCFA 2K03A 5IGFA 1B7YB 2XRSD 1GD7A 2A6ED 1JOOA 4JI3L 3GO5A 1V43A 1MHWC 1Q82C 1JOKA 1TWCH 2WB1G 2KA7A 3EA6A 3I56A 1GUSA 1RCVD 4KKUA 3C1FA 2UUCL 1NTGA 4C1NI 2EQSA 1SAPA 4HJAA 4DUZL 1AH9A 2HQLA 2NN6I 2HCCA 4CGYB 4A4IA 5C44H 3E0EA 2ATWA 2L15A 3K5OA 1X6OA 3WWVA 5C44G 4R9WA 4B3SL 3BZDB 3MTSA 1I3QB 3T4AC 1Q3LA 2PZWA 2DJGC 4X66Q 1SJED 3HOXB 3FP9A 5AJ3L 1X65A 2B2TC 1SNPA 1Y1VB 1SMYD 1I4RA 2FXQA 1BO0A 1N33Q 2DUDA 2G9HD 2JA7H 1OXTA 1H9MA 1YEZA 4IURA 4GKKQ 2VY3A 3OW7A 2NVXB 4FF2A 2EY5A 2PQAB 3J81L 3TZUA 3X3MA 1FNVA 3VR4A 4BXXG 4ID6A 2DY8A 2ZXOA 2DJFC 5D3IB 1PFSA 2F0TA 4JPBW 2HQEA 1EFID 5C0XG 4DV1Q 2A5HA 1BXTA 1ML0D 4H13C 1SNQA 4RFBA 1SNCA 2A73B 1U0LA 2B2VA 1EY6A 3KF6B 2A69C 2WAQG 4O0AA 3GTOH 1PH3A 1D8LA 1TWGB 3P75A 2NBFA 2MNAA 2H1EA 4DUYL 5IT9E 3GTGB 3I70A 2VQFL 3O13A 4QQBX 1TS2A 1BDOA 3QOLA 3KDFB 1FL0A 1K9MC 4H7BA 4A3KB 2G9DA 3DWPA 1J9OA 2K5NA 1F9RA 4R8NA 3RUZA 3E6ZX 2ZJQA 3PO3B 2R92B 1HUMA 5IIFA 5KIXA 2DNEA 2PPBC 3Q0AA 3S24A 2RA4A 2F0NA 3OOCA 4ZKCB 2BH2A 4A3BB 4Y7NH 2OTLA 4HJ8A 2QA4A 2KHSA 1VQDA 1EU4A 4HIDA 2JA5H 3RZDB 3PMFA 3N52A 1VQNA 1CA5A 4JYAL 4CKBA 1PH2A 2JA5G 3KYHC 1X55A 3A7LA 3I3CA 2F0KA 1K8GA 4FXDA 1HNXQ 1SLJA 1A3VA 1SE4A 4N9TA 2PMZE 2J4XA 1N36L 4IPHA 4RA8A 4EQNA 2EPBA 4C2MH 1ET6A 4HTHA 2NZ1D 1X3FA 4A3EB 2XTIA 5IGEA 2EYMA 1A2TA 1CUKA 4CJ2C 2VZAA 4JCVE 1PFMA 1V1QA 3PUYA 5A2QL 2K4KA 5FO7B 1XNRL 5AJ3Q 4AQYL 4A3JB 2QEJC 4PNYA 3GTLH 1XWEA 2K5VA 4HCEA 4WJ3M 1DYQA 4L63B 2ZJRA 2F0EA 1UNSA 2K33A 4LW1A 4OONA 3CCRA 5LMNL 3KBGA 2LY7A 2XGTA 3RR5A 1NNXA 1DOMA 5K36H 4F7XA 2F4VL 3S17H 4OWXB 3PF5A 2UUAQ 1W3SA 4DR4L 3TRZA 5K36G 4DV7Q 1KHIA 1JICA 3S14H 2R7FA 1MGSA 5DLQE 5FO9B 1WJJA 2K1BA 3SK4A 1XMQL 1HR0L 1U5KA 1CZWA 2GVBA 3GD7A 4KHZA 1XMOQ 1YNJD 1II3A 4XT3B 3VR6A 4EQ5A 4CDEC 1I6VC 1YNJC 5HY6A 3ULLA 4DK0A 2N49A 2IJ0A 2MPMA 2Z4IA 5FO8B 4DR1Q 4C3JB 1JT8A 3SK5A 3TZDA 2A74C 5C3XA 4CHTB 3URYA 3F2BA 1XPUA 3GV6A 1MBYA 4DV3L 4ZQ3A 1VQCA 4JVZA 4DUYQ 2M9VA 2VQFQ 2RVLA 2K52A 2L4NA 1PH8A 1KTKA 5LMUQ 2UU9Q 1D6EC 4B9WA 3QG1A 4A3FB 1WTWA 2ZXRA 3S1NB 4X64Q 4JI2Q 2HIVA 2NTSA 1V1OA 1N32L 4YHHQ 1EUJA 3FPPA 1IHZA 1GOZA 5M3MH 1KABA 2D0OA 1PV4A 5M3MG 2CQAA 3T1YL 4BY7B 1QVFA 1GJXA 4EX5A 3OMCA 5JJKA 3U4ZA 2VB2X 3R93A 2VNUD 1TIID 1YNND 4JYAQ 4L8JA 3S2DB 1VQ9A 4FO2A 1WOCA 4OIJA 5TSSA 1N8RC 4QUCA 4BY1H 3D0FA 4GKJL 1W6JA 4DV6L 5EBDA 1T9HA 2MUYA 4RAUC 2WINB 4BY1G 1N36Q 3GTKB 2I07B 2F0QA 1JJ2A 3K8AA 1JR0D 3PUVA 4DGZA 2D62A 4GLXA 2EJFC 2WKDA 3RLNA 1DCZA 2AQ1B 1UAPA 4Z9CB 1LT5D 2YTVA 1H9SA 5C4HA 1HNWL 4XTCS 2VB3X 1JWUD 5GQOA 3DMUA 5I9OA 1NCVA 5C4JB 2VQEQ 5LMNQ 3BVGA 2IX3A 1QJOA 1I5FA 2F0PA 1ESFA 4LF5L 2Q2IA 2FHTA 3LX0A 4GNXB 4GOPB 5CR3A 1L0YB 1Z6HA 1STYA 5NUCA 3GTPB 3PSIA 5M5YB 4IZ8A 4POFA 3HZXA 4XYOA 4KHPL 1CK1A 3NXWA 5IY0A 3M4PA 4MTKA 4NMZA 3LNNA 1TKWB 3CC7A 5ELCA 4RG1A 1CSPA 2JA8B 3TP5A 5E7NA 1I4HA 5EGTA 3F1ZA 5LL6S 4OL7A 1CKOA 4ZAIA 1Y8PB 4F88A 5IE8A 5KEEA 1LTSD 4CKEA 4C3HH 1GUTA 3RZOB 2L9HA 1EL0A 1X54A 1TWAH 3GTMB 2OTJA 4C3HG 1X9NA 3K81C 4XQJA 5J3BA 4F87A 1ZEQX 4DV3Q 2B8FA 3NBHA 3QO2A 4K14A 1E3PA 1SYBA 2WV6D 3H3VC 2K01A 1WTPA 3S16B 5T1IA 3M7GA 2F0VA 2RHQB 5EKLA 1B3QA 3CPWA 2ZJPA 1PA6A 4JI6L 3JAML 1Z47A 1LABA 4DAYB 1SRUA 2PNHA 1E2VA 2FMCA 1K28A 1VCIA 2UXCQ 4CKCA 1LT4D 3FVQA 4HAEA 3HG9A 4GN4B 3HFZB 2ID0A 4R4CA 4NXML 3AQQA 5IP9H 5CC4A 4NKLA 3KLRA 3HOVG 3VR2A 5CV4A 3K58A 5C3EH 5C4ZA 5IP9G 4NB3A 4XT1B 4A3GH 3C46A 5C3EG 4TKOB 3K5MA 1SFOB 4QB4A 4GKJQ 5LHY1 4DV6Q 4A3GG 1UWVA 5F2DA 2NVQH 4CDCC 4DNRB 3J80c 1GKHA 5M3FH 1DOKA 2QCPX 1CQFA 1QWYA 1QUQB 3SXHA 3BYYB 1XNQL 3IFTA 1J6QA 1GVPA 1GXDC 4N8FA 4O1NA 5J22A 3UE1A 1KD1C 4ZYSA 2XWJB 1DJRD 2A6HD 1RDPD 2JK8A 1K8OA 2KCNA 4IPDA 3W3AA 4CDFC 4JBMA 3TBIB 1QOHA 3I73A 1EIYB 1TS5A 1SNDA 1K8AC 1HCZA 4LF5Q 1G91A 3AMUA 3BYTB 3M3YH 2F0UA 1WCMB 3F2CA 1PRTB 1X56A 4KHPQ 4HJ5A 1HZCA 3WOEA 3D6CA 5G3LF 3RNUA 1JE4A 2ES2A 1D7QA 3FHWA 4A93H 5M5WB 1BR9A 2K32A 2EOTA 1O7LA 1SMXA 4A93G 3J80L 4WJ4A 5KYIA 1JB3A 1G291 5E1FA 2OT2A 5FLXE 2WB1B 5FK9C 3W1GA 2SNSA 3R3OA 2F0FA 1TWCB 2XVSA 2P5ZX 5KNBA 2PI2A 3HEJA 2Z8LA 2BDOA 2LXJA 4A3IH 1KAAA 4RMFA 2AMCB 3KF8A 1PTOH 4A3IG 4YCUA 2E2IH 1C4QA 1KQSA 1LT3D 4JI6Q 1BQQT 5EJWA 1ILQA 3MZ5A 4OWWB 4FF4A 1QG7A 1EY8A 4PMWA 1IW7C 2QDLA 5ELNA 3L7ZC 5HGQA 2OWOA 2YU9H 4NW2A 3JC66 3OHXC 1CI3M 1UUPA 4FF1A 1O7IA 2SEBD 4N8X1 3MXNA 4NXMQ 1EQQA 4DR3L 4A3LH 3IKJA 4GLVB 1I94L 2GN5A 4EQOA 2OXPA 2JA7B 2NB0A 4A3LG 3BU2A 2UXBQ 3KBXA 3P1HA 1QE6A 3MHBA 4X3TA 1HZBA 2B2YC 4TRDA 5G3LD 1VQKA 3CC4A 4P2CB 3IL8A 1YJ9A 4WFN3 4TSSA 1UE6A 4DF7A 1ZKOA 4UAIA 2L11A 4HSPA 1LACA 4LUVA 2JA6H 2F4IA 4LNQA 5JEAH 4C56C 1SBBB 2E5LQ 2F03A 3UE0A 2JA6G 2AKWB 3ERQA 1MSGA 3SE0A 4JK1C 5JEAG 3A54A 3STBD 3K7AH 3VYUA 1P8LA 4A3CH 2EYPA 5CGKA 4OX9Q 1GHKA 2RHSB 1AE3A 3GTOB 1S5CD 3J81j 1O78A 4A3CG 1BCPB 3HOYH 1SJHD 3H6MA 2L1BA 3CRLC 4JI5Q 3HOYG 5FKAC 1WTXA 4DV4L 4RGTA 4H44C 1YNXA 2A68C 1WVLA 1GUGA 5BN5A 5J1ZA 2RSNA 2NYZD 3FKIH 3D3RA 3TDQA 5JAVA 2OQ0A 4Y7NB 4J8QA 4JW0A 4FNFA 4KN7C 1IBML 3PIOA 3FKIG 4BBRH 1SNMA 2Z1CA 1EWCA 2JA5B 1H9KA 1QZGA 3G6JB 5CBEE 3HOZB 4BBRG 1Y1WH 1GUNA 5BR8L 1EZ6A 3I91A 2FJ2A 2B63B 1Y1WG 2Y0SE 3GTQH 2E2HH 1I4XA 1ESRA 2JP1A 2Z6KC 5KYLA 3J81c 2QKIC 3H0GB 4DV0L 4JBJA 4YWKA 3D8GA 1F2LA 4XIGS 4HEDA 4C2MB 5DAUA 1WTRA 1PHJA 4YCWA 4MTNA 1JWMD 4A3DH 4FVMA 1G51A 1I4GA 1LTLA 3A5ZB 3V2TA 3I55A 2A6EC 3BDOA 4A3DG 4P73A 2CWPA 1PVOA 1R4QB 3AU7A 5I6WA 3J7YW 2K5WA 4BA1I 3IFDA 3NEMA 4B3TQ 3VYSA 1HRJA 3GTLB 3UDFA 4BBSH 4GN3B 1EFWA 1I94Q 3A8KE 4TVAB 2R7DA 3FEWX 3DEOA 4BBSG 2QDBA 4RHRA 3L2PA 1X3QA 2K75A 3RLOA 4UY8C 3S17B 2CH4A 3CCJA 2HUGA 3Q23A 1IYJB 4CJ0B 5IGCA 2EYOA 4HJ9A 2A8VA 5EKKA 1SMYC 1KL9A 4BXXH 4KMUC 2Q8IB 3UDIA 5JJIA 1STHA 3Q22A 2K5QA 5C0XH 2E2JH 4AIMA 3K7UC 2JYOA 1WTOA 2XN9C 1K3BC 3A7AB 4UP7A 5CV6A 3CCVA 4KJOA 3RLFA 3FDTA 3I72A 4AH6A 1MI2A 2BA0A 2Q8TA 2VUMH 1JMCA 3MFGA 1WTVA 1JWSD 2ENBA 1ENCA 4HIMA 4YY3Q 3TSSA 2VUMG 2K7VA 1S5DD 5LL6X 2NVTH 5IYBH 5M3MB 3K5NA 3GTJH 3PUXA 1KAWA 1CKNA 4K6DA 4Q0FA 1J5EL 5IYBG 1FJGL 4GLAC 2J7ZA 2PCFB 2ZXPA 3MAQA 2N78A 1WI5A 1CQVA 2EYFA 1A3TA 5C5LA 3CF5A 2KCMA 2TMPA 1TWHH 3E5SA 4KLKA 4YWMA 5CMDA 3HOUH 3I4NB 2KOLA 4DAMA 2NZHA 4LFCQ 2AWOA 2MP1A 4BY1B 4ALPA 3HOUG 1EEFD 2XRQD 1HA6A 1RODA 1TY2A 1D5ZC 2IPKD 4DV0Q 3G4SA 2M2LA 1TQOA 1R4PB 4B3RL 1HXYD 1ILPA 2MQHA 1LTGD 1VQFA 1F9PA 3T1HL 3EBEA 3HKZG 2R3ZA 4X65L 1S4ZA 4POGA 3D4DA 1RTNA 1YITA 4JI3Q 3WDNA 4G57A 2VS1A 2F0GA 2VW9A 4KI0A 3HGBA 3ERSX 4IQZA 2UUCQ 4OO1H 3ICEA 5EPLA 2B3GA 2ZTCA 4DUZQ 2CCZA 4OO1G 3NWSA 5E4WC 1G6ZA 4JC0A 1PXUA 2F0MA 4DAVA 2ICEC 1C7YA 4DKAC 3K0XA 4B3SQ 4YCVA 3TS2A 1H9SB 3OWEB 3K59A 2Z6KA 1U9RA 3H91A 4QIWB 5CORA 3L0OA 1LYLA 1PFBA 1L1OC 4OGQC 1VQJA 5LMNW 4PZ8A 5AFWA 1HJPA 3OYYA 2KCCA 4NXNL 2K6AA 1KRSA 5FLMH 2K04A 2FMMA 1EEID 3S1RH 1J8IA 1YHQA 4HR7B 5DEHA 5FLMG 4IO9A 5KRUA 4DAPA 1CSQA 3J7AF 4C3HB 3U9SA 2IHFA 1TWAB 3KUPA 1PYSB 2UUBL 2C35B 1IKMA 1QCBD 1FNUA 4K2LA 1VQ6A 4DNIA 1VMPA 1VQLA 2RDHA 2SNMA 3BDCA 2YYZA 2B2TA 3GQBA 5BN4A 1LV9A 1NBWA 1KDAA 4KD4A 4DNTB 4LUOA 1BVSA 4P75A 1IL2A 2N55A 2CQOA 1ZYRD 4IOCA 2EY6A 3MXUA 4AYBB 3NBHB 1J5EQ 3A74A 2O2LD 1HZ9A 4ZUJA 1FGUA 3M4OH 1LM0A 1O80A 4G7OC 1FYCA 4E6IA 2PYKA 1A3UA 3GDEA 2KVMA 1JORA 5COYA 4A3GB 1EZ8A 2B2UC 2EYLA 1IL8A 1SROA 1A6XA 3CP0A 4K8IA 4LAAA 2NVQB 4LF6L 4BS9A 5M3FB 4B3RQ 1YNNC 1KDBA 2IL8A 4C3IH 2F0IA 1A15A 1MSHA 2K50A 2EY2A 3G6EA 4C3IG 4B9XA 3C2PA 4KHVA 4DV2L 2YTXA 3A5UA 4A3KH 1BNZA 3OMGA 2I5HA 3AB9A 4WJWA 1CTMA 1PZKD 1HHVA 1DZ1A 4ABNA 5A35A 4A3KG 3UDXA 1XXGA 2A1AA 3CHBD 3TREA 3PO3H 2BA1A 3VYTA 3P20A 3PO3G 2PW5A 4A3BH 1PZID 4LF9L 1EYCA 1MJCA 3TP8A 4QMGA 4A3BG 1XNRQ 4AQYQ 2OCEA 3M3YB 4IUVA 2UXDL 4P72A 4GNXC 4GOPC 4DV5L 1GHJA 3JAMc 4QUFA 1SYCA 1OXUA 3DUZA 1EY0A 4IJHA 4F8MA 3C3LA 3S2HH 4K5VA 2XIWA 1R9TB 2D9UA 5C0XI 5L37A 4A93B 1K73C 1LO5D 1RD9D 3T16A 1AZPA 2F4VQ 4GS3A 4JBWA 4DR4Q 4GN5A 3CCLA 1RKNA 1VQHA 4A3EH 4XXEA 1HR0Q 2ZTDA 1XMQQ 1Q86C 3Q24A 2UUBQ 4A3EG 1DOLA 1RJTA 5D65A 2EDGA 1GO3E 2ZM6L 3ZYYX 3HOWH 3SK8A 3PIPA 1EQTA 4A3IB 4DR5L 1L1OA 1LUZA 1PTOB 3HOWG 2C9OA 1D2BA 2BOSA 3TS0A 2ZT9C 2E2IB 3L9AX 4DXFA 4IUNA 4HCSA 1EIGA 3KJOA 1QVGA 1CHQD 2YU9B 1PRTF 1DM0B 3KFUA 3K80C 5I6YA 3ND9A 3PO2B 2WACA 3MEFA 2N88A 1N32Q 4OHJA 4PMBA 1VQOA 3OTOL 2RKSA 5I2XA 3KLWA 1TR5A 2ALYB 5JVG3 2Z4HA 4K0KL 4KJNA 1X3PA 3T1YQ 1IBLL 1MIUA 1KLUD 1NR4A 3Q8DA 3HOVH 4DR2L 3NE5B 3M9BA 4KY5A 3K57A 1Z7TA 3MXNB 5IGDA 1EY4A 2JA6B 2R7ZH 1PH9A 4UPAA 3I2ZA 2AQ3B 3S15H 4LF8L 3PCOB 4OO1I 3FPUB 1IXRA 1YBYA 2R7ZG 3BVZA 1AEXA 1V1PA 2XWBB 2Q2HA 1W6KA 2I0QA 1D1KA 2V4DA 4ZKBB 4HMIA 2K14A 4R4QA 3K7AB 1FR3A 4R4TA 1WYDA 4FF3A 1EOTA 4WRDA 1OXXK 4APVA 4OELB 4TQUS 1TWFH 2B8GA 1E2ZA 3A56A 3H15A 1JQYD 2KCTA 4HJ7A 2B2UA 1YHAA 4P71A 1KIXA 1HNWQ 3NSWA 4U673 1YIJA 1RL2A 3QB3A 1PH7A 2KHJA 1X3EA 1CHPD 4RKLA 1EIHA 4I65A 1UE7A 1X3GA 1PRTD 1IYVA 4IN3A 2RSOA 3JAME 3AYHB 2A6HC 3P7JA 4DN4M 2R93B 3FKIB 2H4OA 2MJ8A 3CMEA 4H02A 4A75A 1B53A 2LFNA 5JEAJ 1LTID 1NJIC 3ND8A 3S1MH 2ICIA 1Y1WB 4LFAL 4XQNA 2DGYA 3I4MH 5JJZA 4QJFA 4ODGA 1I50H 5HURA 5GAHC 3MFYA 2CFMA 4MNOA 4QCLA 3I4MG 3GTQB 1JOQA 3KOJA 4JI1L 3VA7A 3VDYA 1B9MA 4Y52H 1NSNS 1JJCB 1TVXA 1BCPF 2F3WA 2IWHA 2CKZB 3PUWA 1CFMA 3UDGA 4RGOS 1AZQA 1K83H 5C4JH 4A3DB 4UP9A 1LT6D 2RBMA 1SYDA 3NPPA 1EY5A 3I4OA 2D0PA 4FDBA 3NENA 1STBA 1NY4A 2OEOA 3D31A 1RF2D 1ET9A 3DWAA 3EIVA 3CAMA 2BE5D 4MHEA 1SDFA 3PF4A 2AUKA 5C44B 2RQXA 1PMRA 3C1EA 4BBSB 1E0BA 3OPOA 4HSVA 1HTLD 1T5XD 2WB1E 4KN4C 1N9WA 2HIXA 5C4XH 1EYAA 1IBLQ 1N34L 2X6LA 1ENFA 5ELFA 5C4XG 1VQBA 4IFDH 3M4QA 3ULJA 3EJIA 3CD6A 1K0SA 4IFDG 4O42A 4I7ZC 5I4DA 3QWNA 4LF8Q 1I6HH 1YI2A 3TEHB 4ZK9B 3N6RA 2L5TA 3F2DA 3I7FA 5HGTA 2EVBA 5IYCH 1I4PA 1CM9A 1M8AA 2E2JB 3CC2A 4HMJA 2EE1A 1NMGA 1Z9FA 2YTYA 3J80E 2NVYH 2IT1A 5IYCG 5CV7A 5M9OA 2RCNA 3ITPA 1HNZL 3EVQA 3NTHA 4KY6A 1BCPD 1Q8IA 4X66L 1XNQQ 3H3VH 2VUMB 2WAQB 4YIJA 4K8JA 1QVCA 2C5CA 4ULLA 5CV9A 3STBC 3BJUA 1S5BD 3G7LA 3CW2C 2JE6I 2FINB 2IX0A 2EIFA 3B6YA 1N33L 2NVTB 3VR5A 4JV5L 3QOJA 1U4MA 1IBKL 2FFKB 1U4LA 2NUCA 1B44D 3G48A 5C6AA 1EYDA 1MD2D 5FJ8H 2LSSA 1A63A 4LF7L 3U4VA 4MIUA 1AN8A 4LUZA 5FJ8G 1EY9A 3A0JA 5JPNC 3M4YA 1F9QA 1TWHB 1CKNB 4XDXA 4LFAQ 4DR6L 5C0XJ 3R2TA 2B2WC 3D4RA 5KNDA 3NHHA 3J7ZC 3DXJC 4KY7A 3HS0C 1HUNA 3HKZB 3TQYA 4EQPA 2GVAA 4A3MH 3BVMA 2CW0D 1HZAA 1Q81C 3S1QH 2KEEA 2Z9HA 4JI8L 5IT9c 4A76A 4A3MG 4DPGA 2SDFA 3J7A5 3E9HA 1HPCA 3J81i 4X3KA 3K0YA 1OXVA 3A8JE 1C48A 1VQMA 4XQQA 5JJLA 1KNAA 1H95A 1QB5D 4MZ9A 3NTIA 1T5EA 4L5QA 1UE1A 5IWAL 1D5MC 1STAA 1YJNA 1VQ4A 2G5DA 1L2FA 2AHOB 1KLGD 3G71A 2AQ2B 1N34Q 1PYBA 4DXGA 4KK7A 5M5XH 4DR3Q 1HFNA 2F0JA 3QIAA 1TXYA 2PW7A 1HNXL 1VQ7A 4IUUA 3X3NA 3S1RB 5E3FA 4IJLA 1VS0A 1VDZA 1XPOA 1M1KC 3MWYW 4K5XA 4HIKA 2KJXA 3S14B 1CKMA 2B29A 4X3SA 3TMEA 3F2UA 2HDMA 5IT9L 1PH4A 2Z0SA 1HNZQ 3I4LA 1DXMA 3BG3A 3NTKA 5GADC 3AFPA 2EY1A 1A62A 1K8MA 3RMHA 4LFBL 2RF4A 3CCMA 2X6GA 1QNKA 3LGJA 4G7HC 4OWTB 4IALA 1VF5C 1LTAD 4RGMA 5CBAE 4JV5Q 5CV5A 3CMAA 1BF4A 1IBKQ 4X3UA 4RH6A 3DWQA 4EVOA 4DR7L 3Q6SA 1D1IA 2JA7G 2QW7A 2F3VA 1EWHA 3CPFA 4R8IA 1IKLA 1SYEA 2UUAL 4LF7Q 1BUVT 2B2YA 4DV4Q 1VQ8A 3M4OB 4DV7L 3M7NA 1BBUA 1B50A 4OEMB 4PV1C 4ZUIA 3MXPA 4Q5VA 4DR6Q 1XMOL 1C8CA 1WTHA 3NK9A 2BCOA 1A0IA 4PQXA 3EN2A 3OSOA 2RDFA 1YZ6A 1IBMQ 4DR1L 5DNFA 1SYFA 1LTBD 2A69D 1STEA 2E8GA 2WKCA 5IGBA 4X62L 1Y69U 1M90C 2KQ3A 4C3IB 5EKIA 4L5SA 4PG3A 5BR8Q 1EY7A 3EROA 4JI8Q 2ZTEA 1X32A 4GZYC 5EAYA 2MFIA 3OIPA 3J81E 5LMUL 2UU9L 2E74C 4IOAA 1PLFA 1S5ED 3BDLA 3NQTA 4X64L 5EPKA 4JI2L 2F0HA 4YHHL 3SDZA 1Q46A 2E2DC 1E1OA 1SEBD 1G8ZD 2JEBI 4L6TB 2KUMA 3D4WA 2B2WA 5IWAQ 2V1CC 2PMZB 2TSSA 4KKSA 2WP8J 4IFDI 5I2YA 2Y0SG 2I46A
chains in the Genus database with same CATH topology
2F0OA 1VF7A 4IUQA 3PIO3 1LTRD 3RD4A 4XYQA 4N9PA 3MC0B 3S2HB 2K05A 3SVMA 3PV0A 2CVRA 2F1MA 1F77A 3IAYA 1A2UA 3TP7A 2PQEA 1B4OA 4ZLTF 4J1MA 4LMQD 1RTOA 2J0TD 3HOWB 4PMCA 1Q12A 3A55A 3T56B 1TT2A 4KKTA 3NWTA 3ONAB 3V05A 2RDGA 2MGSA 1NR2A 3SR1A 4K2KA 2AUJD 4RWSC 2BDNA 2EYJA 5IODA 5FOBB 4IUTA 1XTCD 4K6LA 1LTTD 1HFGA 1SYGA 5T1GA 2AWNA 4C1NK 1ZYRC 2VXWA 4U68A 3HOVB 5A2QE 4NDXA 2NWGA 3EQLC 3PUZA 4G7ZC 5C3EB 1G2SA 2R7ZB 5DM73 3S15B 1PTOF 1B3AA 2QILA 3KK7A 2F0WA 1F2ZA 5J39A 3L3OC 4DA2A 1H9JA 1TWFB 3CRKC 1V1PB 3TN2A 1FGBD 1XYIA 1ONLA 2JEAI 1AFPA 2M00A 3CU7A 3H94A 2X69A 2PZUA 2KECA 2O5IC 3LWEA 3M85A 1SNOA 4RCOA 2PO4A 1KNEA 4NP5A 1HA5A 2XSCA 3MVVA 5DM63 1HTPA 5K5PA 4CBVA 3S1MB 3R8BA 4RHSA 4S3SA 3I4MB 3MXGA 1I50B 2E76C 2EZVA 1TY0A 3A8IE 1Q1BA 1B2TA 1F2MA 5CV8A 1PTOD 1K83B 1PTOC 3I90A 3NUCA 3DHQA 4DFAA 3R2IA 1Y8NB 1G2TA 5JPMC 3KLSA 2EJGC 3T51B 5EQ0A 3T13A 4BA2I 2D2CC 1L0XB 4HN7A 2XNAC 1QNUA 1PDQA 1STGA 2LS01 1Y8OB 3V96A 5C4XB 4IUPA 1Q1EA 1AW7A 3TP6A 1EU3A 4K5WA 4FXKC 5EPJA 4KTAA 2IW3A 1I4QA 3S9WA 3OWFA 4CJ1B 2HCIA 4RCNA 5D14A 4B08A 1I6HB 1PYWD 2K5DA 4KD3A 3MEHA 2O4XA 3K5LA 2NVYB 4C3JG 1FD7D 1JC7A 2LKVA 3E0JA 1CZGA 4ME5A 5JVH3 1F2YA 4G4KA 4OIKA 3W2DA 4M1UB 3DEPA 3WOFA 1AP0A 2LMCB 3FRPB 1TS4A 2NN6H 4IFDJ 5C3WA 3HOYB 1DONA 2NN6G 2O5JC 4RGNA 5ISRA 4QF4A 1NUCA 5FLXL 5ELEA 5BN3A 1PRTC 1GUWA 3EFXD 1Q90A 1QILA 2PZTA 1EQVA 2F0SA 3GV3A 4BBRB 2DNCA 1WTQA 2SOBA 1U4RA 4A3MB 4M8AA 1FNWA 3S1QB 1JCKB 5I9PA 1WD1A 5KNCA 3SHLA 2E2HB 4DU9A 5E4XA 3VR3A 1LLRD 5ELDA 2EXZA 5C5MA 1WD0A 4BWGB 1TS3A 1UEAB 4KV6A 3UI2A 4UDUC 2MHVA 1RHPA 3I8ZA 1STNA 5CYUA 1ENAA 2E75C 3BS1A 5IOCA 2R6GA 2BE5C 5M5XB 5KGUA 2PNRC 2R61A 1HQMC 3K6OA 3SK6A 1ICWA 4EGVA 3VYRA 3DM1A 1ZXTA 5IGGA 3VA5A 1U4PA 3D6WA 4H0LC 3PIP3 3LWUA 1BOSA 5EBCA 2IX1A 1O7YA 2EYHA 3GP7A 1IW7D 4DAYA 1PFNA 3NP8A 3FMCA 1OO9B 1F9SA 3QJYA 1KDCA 2D5DA 1XX8A 3HRZC 4J6HA 2DN8A 4V190 5D3DA 2GA4B 1SXTA 2CHBD 4RKBA 4FP5D 1BBXC 2Q8RE 1BCPC 3OIQA 2EJMA 4LJZC 2L0CA 2B2VC 2WIIB 1D5XC 1H9RA 2HDLA 3SEBA 1SE3A 3GTJB 1CT1D 1VMCA 1HQRD 4WORA 1CA6A 1SSOA 2L55A 3KLSX 4FYDA 1IYUA 3NQIA 2JXMB 2NTTA 1B1ZA 1SE2A 1GUOA 1DD2A 2F0DA 4ZRZA 3HOUB 2L12A 5ELBA 3NBIA 2B39A 1V8QA 2KEDA 2A68D 2QF7A 2OF1A 3HP3A 1OXSC 2JSOA 2CW0C 4LK1C 2Y0SB 3MA2B 1M4VA 2F0LA 4FXGC 3CKIB 3U9OA 3T53B 1PZJD 2DY7A 3CQZB 4DK1A 4ILWA 1O7ZA 1TU2B 1NAPA 2K28A 3H09A 1B9NA 3J7AV 4V0BA 5JOBA 1E2WA 1S5FD 4MN3A 2K03A 5IGFA 2XRSD 2A6ED 1JOOA 3GO5A 1V43A 1JOKA 3EA6A 2KA7A 1GUSA 1RCVD 4KKUA 3C1FA 4C1NI 1SAPA 2NN6I 2HCCA 4CGYB 3K5OA 4R9WA 3BZDB 3MTSA 1I3QB 3T4AC 1Q3LA 2PZWA 1SJED 3HOXB 2B2TC 1SNPA 1Y1VB 1SMYD 1I4RA 1BO0A 2G9HD 1OXTA 1H9MA 4IURA 3OW7A 2NVXB 4FF2A 2EY5A 3J81L 3TZUA 3X3MA 1FNVA 3VR4A 4ID6A 2DY8A 2ZXOA 5D3IB 2F0TA 2HQEA 1EFID 5C0XG 2A5HA 1BXTA 1ML0D 4H13C 1SNQA 4RFBA 1SNCA 2A73B 2B2VA 1EY6A 2A69C 1TWGB 3P75A 2NBFA 2H1EA 5IT9E 3GTGB 3I70A 3O13A 1TS2A 1BDOA 3QOLA 4H7BA 4A3KB 2G9DA 3DWPA 1J9OA 1F9RA 4R8NA 3RUZA 3E6ZX 3PO3B 2R92B 1HUMA 5IIFA 5KIXA 2DNEA 2PPBC 3Q0AA 2RA4A 2F0NA 3OOCA 4ZKCB 4A3BB 2KHSA 1EU4A 3RZDB 3PMFA 3N52A 1CA5A 4CKBA 3A7LA 3I3CA 2F0KA 4FXDA 1A3VA 1SE4A 4N9TA 2J4XA 4RA8A 4EQNA 2EPBA 1ET6A 4HTHA 2NZ1D 4A3EB 5IGEA 2EYMA 1A2TA 4CJ2C 1PFMA 3PUYA 5A2QL 5FO7B 4A3JB 2QEJC 4PNYA 1XWEA 4HCEA 1DYQA 4L63B 2F0EA 1UNSA 2K33A 3KBGA 2LY7A 1DOMA 5K36H 4F7XA 5K36G 1JICA 1MGSA 5FO9B 2K1BA 3SK4A 1CZWA 3GD7A 4KHZA 1YNJD 1II3A 4XT3B 3VR6A 1I6VC 1YNJC 4DK0A 2Z4IA 2IJ0A 2MPMA 5FO8B 4C3JB 3SK5A 3TZDA 2A74C 5C3XA 4CHTB 3URYA 3GV6A 1MBYA 4ZQ3A 2M9VA 2RVLA 2L4NA 1KTKA 1D6EC 4B9WA 3QG1A 4A3FB 1WTWA 2ZXRA 3S1NB 2NTSA 1V1OA 3FPPA 1IHZA 1GOZA 1KABA 2CQAA 4BY7B 1GJXA 3OMCA 2VB2X 3R93A 2VNUD 1TIID 1YNND 4L8JA 3S2DB 4FO2A 4OIJA 5TSSA 4QUCA 1W6JA 5EBDA 2MUYA 4RAUC 2WINB 3GTKB 2I07B 2F0QA 3PUVA 1JR0D 4DGZA 2D62A 2EJFC 2WKDA 1DCZA 2AQ1B 1UAPA 4Z9CB 1LT5D 1H9SA 5C4HA 4XTCS 2VB3X 1JWUD 3DMUA 5I9OA 1NCVA 5C4JB 3BVGA 2IX3A 1QJOA 2F0PA 1ESFA 2FHTA 3LX0A 5CR3A 1L0YB 1Z6HA 1STYA 5NUCA 3GTPB 5M5YB 4IZ8A 3HZXA 4XYOA 1CK1A 3NXWA 4NMZA 3LNNA 1TKWB 5ELCA 2JA8B 3TP5A 1I4HA 5EGTA 5LL6S 4OL7A 4ZAIA 1Y8PB 4F88A 5KEEA 1LTSD 4CKEA 1GUTA 3RZOB 2L9HA 1EL0A 3GTMB 4C3HG 4XQJA 4F87A 1ZEQX 2B8FA 3NBHA 3QO2A 4K14A 1SYBA 2WV6D 3H3VC 2K01A 1WTPA 3S16B 5T1IA 3M7GA 2F0VA 5EKLA 3JAML 1Z47A 1LABA 1E2VA 2FMCA 1VCIA 4CKCA 1LT4D 3FVQA 4HAEA 3HG9A 2ID0A 5CC4A 4NKLA 3KLRA 3VR2A 5CV4A 3K58A 5C4ZA 4XT1B 3C46A 4TKOB 3K5MA 1SFOB 4QB4A 5LHY1 5F2DA 4DNRB 1DOKA 2QCPX 1CQFA 1QWYA 3SXHA 3BYYB 3IFTA 1GXDC 4O1NA 5J22A 4ZYSA 2XWJB 1DJRD 2A6HD 1RDPD 1K8OA 2KCNA 3W3AA 3TBIB 1QOHA 3I73A 1TS5A 1SNDA 1HCZA 1G91A 3AMUA 3BYTB 2F0UA 1WCMB 1PRTB 3WOEA 3D6CA 5G3LF 1JE4A 5M5WB 1BR9A 2K32A 2EOTA 1O7LA 3J80L 5KYIA 1JB3A 1G291 5E1FA 2OT2A 5FLXE 2WB1B 5FK9C 2SNSA 3R3OA 2F0FA 1TWCB 2XVSA 5KNBA 3HEJA 2Z8LA 2BDOA 1KAAA 3KF8A 1PTOH 1C4QA 1LT3D 1BQQT 5EJWA 1ILQA 3MZ5A 4FF4A 1QG7A 1EY8A 4PMWA 1IW7C 3L7ZC 4NW2A 3OHXC 1CI3M 1UUPA 4FF1A 2SEBD 3MXNA 3IKJA 4EQOA 2OXPA 2JA7B 2NB0A 3KBXA 3P1HA 1QE6A 3MHBA 4X3TA 2B2YC 4TRDA 5G3LD 4P2CB 3IL8A 4WFN3 4TSSA 4DF7A 1ZKOA 4UAIA 2L11A 4HSPA 1LACA 2F4IA 5JEAH 4C56C 1SBBB 2F03A 3ERQA 1MSGA 3SE0A 4JK1C 5JEAG 3A54A 3VYUA 2EYPA 5CGKA 1GHKA 3GTOB 1S5CD 1O78A 1BCPB 1SJHD 3H6MA 2L1BA 3CRLC 5FKAC 1WTXA 4RGTA 4H44C 2A68C 1WVLA 1GUGA 5BN5A 5J1ZA 2RSNA 2NYZD 5JAVA 3D3RA 3TDQA 4Y7NB 4J8QA 4FNFA 4KN7C 1SNMA 2Z1CA 1EWCA 2JA5B 1H9KA 3G6JB 5CBEE 3HOZB 1GUNA 1EZ6A 3I91A 2FJ2A 2B63B 1I4XA 1ESRA 2JP1A 5KYLA 2QKIC 3H0GB 3D8GA 1F2LA 4XIGS 4HEDA 4C2MB 5DAUA 1WTRA 1JWMD 4FVMA 1I4GA 3V2TA 2A6EC 3BDOA 1R4QB 3AU7A 5I6WA 3J7YW 2K5WA 4BA1I 3IFDA 3VYSA 1HRJA 3GTLB 3A8KE 3FEWX 3DEOA 2QDBA 4RHRA 1X3QA 3S17B 2HUGA 3Q23A 4CJ0B 5IGCA 2EYOA 5EKKA 1SMYC 4KMUC 2Q8IB 1STHA 3Q22A 2K5QA 5C0XH 2JYOA 1WTOA 2XN9C 5CV6A 3A7AB 4KJOA 3RLFA 3FDTA 3I72A 1MI2A 2BA0A 2Q8TA 3MFGA 1WTVA 1JWSD 2ENBA 1ENCA 3TSSA 2K7VA 1S5DD 5LL6X 5M3MB 3K5NA 3PUXA 4K6DA 4Q0FA 2J7ZA 2PCFB 2ZXPA 3MAQA 1CQVA 2EYFA 1A3TA 5C5LA 2TMPA 3E5SA 5CMDA 3I4NB 2KOLA 2AWOA 2MP1A 4BY1B 1EEFD 2XRQD 1HA6A 1RODA 1TY2A 1D5ZC 2IPKD 2M2LA 1TQOA 1R4PB 1HXYD 1ILPA 1LTGD 1F9PA 2R3ZA 1S4ZA 3D4DA 1RTNA 3WDNA 4G57A 2F0GA 4KI0A 3HGBA 4IQZA 4OO1H 5EPLA 4OO1G 3NWSA 5E4WC 1G6ZA 1PXUA 2F0MA 4DAVA 2ICEC 1H9SB 3OWEB 3K59A 1U9RA 3H91A 4QIWB 5CORA 1PFBA 4OGQC 5AFWA 2KCCA 2K6AA 2K04A 2FMMA 1EEID 1J8IA 4HR7B 5DEHA 5KRUA 4DAPA 3J7AF 4C3HB 3U9SA 1TWAB 3KUPA 1IKMA 1QCBD 1FNUA 4K2LA 1VMPA 2RDHA 2SNMA 3BDCA 2YYZA 2B2TA 3GQBA 5BN4A 1LV9A 1KDAA 4KD4A 4DNTB 2N55A 1ZYRD 2EY6A 3MXUA 4AYBB 2O2LD 4ZUJA 1O80A 4G7OC 1FYCA 4E6IA 2PYKA 1A3UA 2KVMA 1JORA 5COYA 4A3GB 1EZ8A 2B2UC 2EYLA 1IL8A 1A6XA 4K8IA 4LAAA 2NVQB 4BS9A 5M3FB 1YNNC 1KDBA 2IL8A 2F0IA 1A15A 1MSHA 2EY2A 4C3IG 4B9XA 3C2PA 4KHVA 1BNZA 3OMGA 3AB9A 4WJWA 1CTMA 1PZKD 1HHVA 1DZ1A 4ABNA 5A35A 1XXGA 3CHBD 2BA1A 3VYTA 3P20A 2PW5A 1PZID 1EYCA 3TP8A 4QMGA 3M3YB 4IUVA 1GHJA 4QUFA 1SYCA 1OXUA 3DUZA 1EY0A 4F8MA 3C3LA 4K5VA 2XIWA 1R9TB 2D9UA 5C0XI 4A93B 1LO5D 1RD9D 3T16A 1AZPA 4JBWA 1RKNA 4XXEA 3Q24A 1DOLA 1RJTA 5D65A 2EDGA 3ZYYX 3SK8A 1EQTA 4A3IB 1PTOB 2C9OA 1D2BA 2BOSA 2ZT9C 2E2IB 3L9AX 4DXFA 4IUNA 4HCSA 1EIGA 1CHQD 2YU9B 1PRTF 1DM0B 5I6YA 3ND9A 3PO2B 2WACA 2N88A 4OHJA 4PMBA 2RKSA 5I2XA 1TR5A 5JVG3 2Z4HA 4KJNA 1X3PA 1KLUD 1NR4A 3NE5B 4KY5A 3K57A 1Z7TA 5IGDA 1EY4A 2JA6B 2AQ3B 4OO1I 3FPUB 3BVZA 1AEXA 1V1PA 2XWBB 1W6KA 1D1KA 2V4DA 4ZKBB 4HMIA 3K7AB 1FR3A 4FF3A 1EOTA 4WRDA 1OXXK 4TQUS 2B8GA 1E2ZA 3A56A 1JQYD 2B2UA 3NSWA 4U673 3QB3A 1EIHA 1CHPD 4RKLA 4I65A 1PRTD 1IYVA 4IN3A 2RSOA 3JAME 2A6HC 3P7JA 4DN4M 2R93B 3FKIB 2H4OA 2MJ8A 1B53A 2LFNA 5JEAJ 1LTID 3ND8A 2ICIA 1Y1WB 4XQNA 5JJZA 4ODGA 5HURA 3MFYA 4QCLA 1JOQA 3GTQB 3VA7A 1B9MA 1NSNS 2F3WA 1TVXA 1BCPF 2IWHA 3PUWA 1CFMA 4RGOS 1AZQA 4A3DB 1LT6D 2RBMA 1SYDA 3NPPA 1EY5A 1STBA 2OEOA 3D31A 1RF2D 1ET9A 3DWAA 2BE5D 4MHEA 1SDFA 2AUKA 5C44B 2RQXA 1PMRA 3C1EA 4BBSB 1E0BA 3OPOA 4HSVA 1HTLD 1T5XD 4KN4C 1EYAA 2X6LA 1ENFA 5ELFA 4IFDH 3EJIA 4IFDG 4O42A 4I7ZC 5I4DA 3QWNA 4ZK9B 3N6RA 2L5TA 5HGTA 2EVBA 1I4PA 1CM9A 1M8AA 2E2JB 4HMJA 2EE1A 3J80E 2IT1A 5CV7A 5M9OA 3ITPA 3EVQA 3NTHA 4KY6A 1BCPD 1Q8IA 2VUMB 2WAQB 4YIJA 4K8JA 2C5CA 4ULLA 5CV9A 3G7LA 1S5BD 2JE6I 2FINB 2IX0A 2NVTB 3VR5A 3QOJA 1U4MA 2FFKB 1U4LA 2NUCA 1B44D 5C6AA 1EYDA 1MD2D 4MIUA 1AN8A 1EY9A 5JPNC 3M4YA 1F9QA 1TWHB 4XDXA 5C0XJ 3R2TA 2B2WC 3D4RA 5KNDA 3NHHA 3DXJC 4KY7A 3HS0C 1HUNA 3HKZB 4EQPA 3BVMA 2CW0D 2KEEA 2SDFA 1HPCA 4X3KA 3K0YA 1OXVA 3A8JE 1C48A 4XQQA 1KNAA 1QB5D 3NTIA 1T5EA 1D5MC 1STAA 1KLGD 2AQ2B 4DXGA 4KK7A 1HFNA 2F0JA 3QIAA 2PW7A 4IUUA 3X3NA 3S1RB 5E3FA 1VDZA 3MWYW 4K5XA 2KJXA 3S14B 4X3SA 3TMEA 3F2UA 2HDMA 5IT9L 3I4LA 1DXMA 3BG3A 3NTKA 2EY1A 1K8MA 3RMHA 2X6GA 1QNKA 4G7HC 4IALA 1VF5C 1LTAD 4RGMA 5CBAE 5CV5A 1BF4A 4X3UA 4RH6A 3DWQA 4EVOA 3Q6SA 1D1IA 2F3VA 1EWHA 4R8IA 1IKLA 1SYEA 1BUVT 2B2YA 3M4OB 3M7NA 1B50A 4ZUIA 4PV1C 3MXPA 4Q5VA 1C8CA 3NK9A 2BCOA 4PQXA 3OSOA 2RDFA 5DNFA 1SYFA 1LTBD 2A69D 1STEA 2WKCA 5IGBA 1Y69U 2KQ3A 4C3IB 5EKIA 1EY7A 3EROA 1X32A 4GZYC 3OIPA 3J81E 2E74C 1PLFA 1S5ED 3BDLA 3NQTA 5EPKA 2F0HA 3SDZA 2E2DC 1SEBD 1G8ZD 2JEBI 4L6TB 2KUMA 3D4WA 2B2WA 2PMZB 2TSSA 4KKSA 2WP8J 4IFDI 5I2YA 2I46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPM A;  2H1E A;  1CM9 A;  1ICW A;  1M8A A;  1G91 A;  3DM1 A;  1ZXT A;  2JYO A;  4IUQ A;  2EE1 A;  2FMM A;  2K04 A;  4IUV A;  1WTO A;  2DY7 A;  2B2U A;  2L1B A;  4IUU A;  3TZD A;  1J8I A;  3TN2 A;  1XYI A;  1U4P A;  4QUF A;  3GV6 A;  1O7Z A;  3D6W A;  1WTX A;  2K28 A;  1NAP A;  4ZAI A;  3MWY W;  1J9O A;  2K05 A;  1F9R A;  2RVL A;  1JE4 A;  2L9H A;  2XIW A;  2X69 A;  3FDT A;  2D9U A;  1MI2 A;  2L4N A;  2Q8T A;  1EIH A;  1EL0 A;  4OIK A;  3SVM A;  2RSN A;  1HUM A;  2KEC A;  3KUP A;  4X3S A;  3F2U A;  2HDM A;  2RSO A;  1AZP A;  2CVR A;  2EOT A;  2NYZ D;  3DEP A;  4MN3 A;  5CMD A;  1O7Y A;  2RA4 A;  3LWE A;  2K03 A;  3P7J A;  1WTW A;  1WTV A;  1IKM A;  4ZKC B;  4DN4 M;  3G7L A;  1VMP A;  2MJ8 A;  1B4O A;  2FIN B;  1PFN A;  1KNE A;  3QO2 A;  1B53 A;  1U4M A;  2B2T A;  2K01 A;  4ZLT F;  1WTP A;  2FFK B;  1U4L A;  2X6G A;  1F9S A;  1QNK A;  3N52 A;  1DOL A;  1LV9 A;  1RJT A;  4LMQ D;  5D65 A;  5T1I A;  1CA5 A;  1XX8 A;  5CBE E;  1RTO A;  2J7Z A;  5JJZ A;  1EQT A;  1SAP A;  3I91 A;  5CBA E;  3I3C A;  2FJ2 A;  2N55 A;  1BBX C;  1BF4 A;  2Q8R E;  3R93 A;  2HCC A;  4X3U A;  2JP1 A;  1ESR A;  1F9Q A;  3Q6S A;  4XDX A;  4HAE A;  5EJW A;  1IKL A;  4R8I A;  1GUW A;  4RA8 A;  1F2L A;  1TVX A;  2B2W C;  1ILQ A;  2B2Y A;  2B2V C;  2EPB A;  2KOL A;  4HED A;  4R9W A;  1QG7 A;  2MP1 A;  2HDL A;  3ONA B;  3MTS A;  4HCS A;  1O80 A;  2NZ1 D;  4OIJ A;  1WTR A;  1EIG A;  4QUC A;  1AZQ A;  1Q3L A;  2MGS A;  3I90 A;  4NW2 A;  1B50 A;  1NR2 A;  1ROD A;  1HA6 A;  4RAU C;  4CJ2 C;  2KVM A;  3GV3 A;  1AP0 A;  2B2T C;  4RWS C;  2BDN A;  1VMC A;  4XT1 B;  1WTQ A;  5COY A;  2N88 A;  2M2L A;  1G2T A;  1C8C A;  1HUN A;  2B2U C;  1U4R A;  1ILP A;  1CA6 A;  1SSO A;  4IUT A;  1PFM A;  1F9P A;  1BO0 A;  2KEE A;  1DON A;  1IL8 A;  1HFG A;  2R3Z A;  1WD1 A;  4IUR A;  1S4Z A;  5DNF A;  5T1G A;  2SDF A;  1RTN A;  5EQ0 A;  3IFD A;  1SDF A;  4MHE A;  1X3P A;  1HRJ A;  2VXW A;  1DOK A;  3KBX A;  4X3K A;  2IL8 A;  1E0B A;  1PDQ A;  1NR4 A;  1QE6 A;  4HSV A;  4U68 A;  5E4X A;  1A15 A;  1MSH A;  2DY8 A;  4X3T A;  5EKI A;  5EPL A;  2B2Y C;  2L12 A;  1X32 A;  2NWG A;  3DEO A;  1KNA A;  4IUP A;  1X3Q A;  1DOM A;  1NCV A;  3IL8 A;  5E4W C;  1WD0 A;  1G6Z A;  4UAI A;  2L11 A;  2KED A;  1G2S A;  1PLF A;  2X6L A;  5EPJ A;  3UI2 A;  1BNZ A;  1HHV A;  5EPK A;  1DZ1 A;  2HUG A;  4CJ0 B;  3FPU B;  1RHP A;  3I8Z A;  1JIC A;  1ML0 D;  1B3A A;  3HP3 A;  1MSG A;  1MGS A;  3H91 A;  2K1B A;  4CJ1 B;  4O42 A;  5COR A;  2HCI A;  2FHT A;  1PFB A;  2KUM A;  4ZKB B;  2B2V A;  2B2W A;  5D14 A;  1B2T A;  1WVL A;  4ZK9 B;  5AFW A;  4XT3 B;  1HFN A;  1EOT A; 
#chains in the Genus database with same CATH topology
 2F0O A;  1PH5 A;  1VF7 A;  1V9P A;  3E9I A;  1G6P A;  4IUQ A;  3PIO 3;  1LTR D;  3RD4 A;  1EQR A;  3CQZ H;  4XYQ A;  3HOZ H;  1JB7 A;  5GAE C;  1KC8 C;  1E7Z A;  1GM5 A;  1BKB A;  4N9P A;  3OW2 A;  2JQO A;  3MC0 B;  2B63 H;  3HOZ G;  3S2H B;  2K05 A;  1SN8 A;  2EXD A;  3SVM A;  4DK3 C;  3PV0 A;  3H0G H;  2B63 G;  2CVR A;  3DM3 A;  2F1M A;  1F77 A;  3IAY A;  1A2U A;  3BZC A;  4PZ7 A;  1ICF B;  3H0G G;  4IPG A;  3U50 C;  3TP7 A;  2PQE A;  1B4O A;  4ZLT F;  5IYD H;  4J1M A;  3H3V I;  4LMQ D;  4CDD C;  1RTO A;  2J0T D;  5IYD G;  1Y14 B;  3HOW B;  4QIW E;  4PMC A;  4LFB Q;  1HR0 W;  2ASB A;  2HHH L;  1Q12 A;  3A55 A;  3T56 B;  2VQE L;  1TT2 A;  4KKT A;  1JE5 A;  3NWT A;  3ONA B;  1I3Q H;  3V05 A;  2RDG A;  1E22 A;  1AE2 A;  2MGS A;  4DR7 Q;  1VQI A;  2PQA A;  4O2D A;  1NR2 A;  3HOX H;  3SR1 A;  4B3M L;  3ER0 A;  4K2K A;  1L1O B;  2AUJ D;  2IY5 B;  4RWS C;  1Y1V H;  2BDN A;  2EYJ A;  1UEB A;  5IOD A;  3HOX G;  5FOB B;  4IUT A;  1XTC D;  4K6L A;  1LTT D;  1Y1V G;  2QGQ A;  1HFG A;  1SYG A;  1VQE A;  1XJV A;  5T1G A;  2NVX H;  2AWN A;  4C1N K;  1ZYR C;  1FJG Q;  2VXW A;  4U68 A;  1PH6 A;  3HOV B;  5A2Q E;  1VQA A;  4NDX A;  4JBK A;  2NWG A;  3EQL C;  3PUZ A;  4X62 Q;  3KF6 A;  1VQP A;  4G7Z C;  5C3E B;  1G2S A;  2R7Z B;  5DM7 3;  3NEL A;  3S15 B;  1PTO F;  4JOI C;  1PH1 A;  4AYB E;  5IP7 H;  1B3A A;  3KDF A;  4I7A A;  1B8A A;  3ULP A;  2QIL A;  5IP7 G;  1A8V A;  2F3I A;  3KK7 A;  2F0W A;  1F2Z A;  2HD3 A;  2YV5 A;  5J39 A;  3L3O C;  4DA2 A;  1TWG H;  3T1H Q;  1H9J A;  4X65 Q;  3GTG H;  1TWF B;  3CRK C;  2UXC L;  1V1P B;  3BZK A;  1FGB D;  3TN2 A;  1S3O A;  1EWI A;  1ONL A;  2N3S A;  1XYI A;  2JEA I;  1AFP A;  2M00 A;  3CU7 A;  1ASY A;  4R4O A;  3H94 A;  1L0W A;  2X69 A;  2R92 H;  2PZU A;  2KEC A;  2O5I C;  3KJP A;  4NPS A;  2MO1 A;  3LWE A;  3I4N H;  3HKS A;  1RIP A;  2R92 G;  3M85 A;  1SNO A;  3AFQ A;  4RCO A;  2PO4 A;  1KNE A;  4NP5 A;  1HA5 A;  3I4N G;  2XSC A;  3MVV A;  1UE5 A;  5DM6 3;  1HTP A;  5K5P A;  3RZD H;  4CBV A;  3S1M B;  3SGI A;  3R8B A;  4RHS A;  3JAM i;  4S3S A;  3I4M B;  3MXG A;  1I50 B;  4NXN Q;  2F52 A;  2KEN A;  2Q2U A;  2E76 C;  5GRO A;  1BBW A;  1HH2 P;  2EZV A;  1TY0 A;  3A8I E;  1Q1B A;  1B2T A;  1F2M A;  5CV8 A;  1PTO D;  4PZ6 A;  4DK6 C;  2LXK A;  2HHH Q;  1K83 B;  1PTO C;  3I90 A;  3NUC A;  3DHQ A;  3U58 A;  4DFA A;  3R2I A;  1Y8N B;  1Q8K A;  1G2T A;  5JPM C;  3KLS A;  2EJG C;  4R4I A;  3T51 B;  2JN4 A;  4B3M Q;  1B70 B;  1QZH A;  1IZ6 A;  4A3J H;  5EQ0 A;  2H5X A;  3T13 A;  4BA2 I;  2D2C C;  1L0X B;  3E3X A;  4HN7 A;  2XNA C;  1QNU A;  1PDQ A;  4A3J G;  1STG A;  2LS0 1;  1Y8O B;  3V96 A;  1ASZ A;  4JI7 L;  1EIF A;  5C4X B;  4IUP A;  1Q1E A;  1AW7 A;  3TP6 A;  1EU3 A;  4K5W A;  4FXK C;  3KF8 B;  5EPJ A;  4KTA A;  2IW3 A;  1I4Q A;  4JI4 L;  1S40 A;  3S9W A;  3OWF A;  5FLX c;  4CJ1 B;  2HCI A;  1DGS A;  4RCN A;  5D14 A;  4B08 A;  3IRB A;  1I6H B;  1PYW D;  2PI2 E;  2QEX A;  1OTC A;  2K5D A;  4C3J H;  4KD3 A;  3MEH A;  2JJQ A;  2O4X A;  4LF6 Q;  3K5L A;  2NVY B;  4C3J G;  1C9O A;  1FD7 D;  1FVI A;  1JC7 A;  2LKV A;  3E0J A;  1CZG A;  4ME5 A;  5JVH 3;  1F2Y A;  4G4K A;  4OIK A;  4DV2 Q;  3W2D A;  4M1U B;  4A3F H;  3DEP A;  4AYB G;  3WOF A;  1AP0 A;  3S1N H;  3J80 i;  1VQG A;  2LMC B;  3FRP B;  4A3F G;  1TS4 A;  2NN6 H;  1K0R A;  1JJG A;  4IFD J;  5C3W A;  3HOY B;  1DON A;  2I5L X;  4JOI A;  4BY7 H;  2NN6 G;  2UXB L;  2O5J C;  4LF9 Q;  1MJE A;  4RGN A;  4BY7 G;  4L5T A;  3W1B A;  4QF4 A;  5ISR A;  1NUC A;  3DLL A;  2UXD Q;  1YJW A;  4OXP A;  3PQI A;  4DV5 Q;  5FLX L;  2BH8 A;  3S2D H;  5ELE A;  5GAG C;  5BN3 A;  1PRT C;  1GUW A;  3EFX D;  5M3F G;  1XTD A;  2E5L L;  1Q90 A;  1QIL A;  1WFQ A;  2WFW A;  2PZT A;  1EQV A;  3CCU A;  4QL5 A;  4UHV A;  1XPR A;  2F0S A;  3GV3 A;  4BBR B;  3CXC A;  2DNC A;  3GTK H;  1NE3 A;  1WTQ A;  2VL6 A;  2SOB A;  1U4R A;  4OX9 L;  4A3M B;  4M8A A;  3CCQ A;  1FNW A;  3W5O A;  3S1Q B;  1JCK B;  5I9P A;  4LF4 L;  1WD1 A;  2KHI A;  5KNC A;  3SHL A;  2E2H B;  5ELO A;  4DU9 A;  3QR8 A;  4L5R C;  2JA9 A;  5E4X A;  4JI5 L;  2ZM6 Q;  3VR3 A;  1YHB A;  4DR5 Q;  1LLR D;  5ELD A;  2EXZ A;  4GNX A;  5C5M A;  4GOP A;  2A19 A;  1WD0 A;  4BWG B;  1TS3 A;  1UEA B;  4KV6 A;  2CH4 W;  3UI2 A;  4UDU C;  4R1J A;  1VQ5 A;  2MHV A;  1MKH A;  1RHP A;  1YVC A;  3I8Z A;  4JI7 Q;  1R9T H;  1STN A;  4JI0 L;  5CYU A;  1ENA A;  2E75 C;  3BS1 A;  5IOC A;  3ZJY C;  2R6G A;  5M5Y H;  3GTP H;  2BE5 C;  5M5X B;  5KGU A;  4JI4 Q;  2PNR C;  2IHE A;  2R61 A;  3OTO Q;  1HQM C;  3F8T A;  3K6O A;  3SK6 A;  1ICW A;  4EGV A;  3VYR A;  3DM1 A;  1ZXT A;  4K0K Q;  5IGG A;  3VA5 A;  1E24 A;  2JA8 H;  3RN2 A;  1U4P A;  4X6A H;  3CCS A;  4DR2 Q;  3D6W A;  4H0L C;  3PIP 3;  2JA8 G;  3RZO H;  3LWU A;  1BOS A;  5EBC A;  2I5M X;  3GTM H;  2IX1 A;  4QGU A;  1O7Y A;  2EYH A;  3GP7 A;  1IW7 D;  4DAY A;  1PFN A;  4YWL A;  4ME3 A;  3NP8 A;  2MO0 A;  3FMC A;  1SE8 A;  1S72 A;  1OO9 B;  3PO2 H;  3S16 H;  4B3T L;  1F9S A;  3QJY A;  1KDC A;  2D5D A;  1XX8 A;  3HRZ C;  4J6H A;  2K5H A;  4P74 A;  2DN8 A;  3PO2 G;  4V19 0;  5D3D A;  2GA4 B;  1SXT A;  2CHB D;  4RKB A;  4FP5 D;  1BBX C;  2Q8R E;  1BCP C;  3OIQ A;  5H1S E;  1KXL A;  1W2B A;  2EJM A;  4LJZ C;  2L0C A;  2B2V C;  3CCE A;  2WII B;  1D5X C;  1H9R A;  2HDL A;  3SEB A;  1SE3 A;  1NMF A;  1CT1 D;  3GTJ B;  4GKK L;  1VMC A;  1HQR D;  4WOR A;  1CA6 A;  1SSO A;  2NZO A;  1SFO H;  2L55 A;  1QUQ A;  3KLS X;  3RN5 A;  4UP8 A;  1IYU A;  3NQI A;  4FYD A;  2WAQ E;  4QY7 A;  2JXM B;  2NTT A;  1B1Z A;  1SE2 A;  1GUO A;  1DD2 A;  4JG2 A;  4DV1 L;  2F0D A;  3PGZ A;  4ZRZ A;  3HOU B;  2L12 A;  1K3R A;  4LF4 Q;  5ELB A;  3NBI A;  2Q2T A;  1P16 A;  2B39 A;  1V8Q A;  2HT1 A;  4JI1 Q;  2KED A;  2A68 D;  2CWA A;  2QF7 A;  2OF1 A;  1E1T A;  4YY3 L;  1C0A A;  3HP3 A;  3AEV A;  1OXS C;  2JSO A;  2CW0 C;  1EYG A;  4IPC A;  4LK1 C;  2KBN A;  2Y0S B;  3MA2 B;  1M4V A;  2R93 H;  1SR3 A;  1EOV A;  4JI0 Q;  2F0L A;  4FXG C;  2OQK A;  4LWC A;  2R93 G;  3CKI B;  4ZCK A;  3U9O A;  2Z6B A;  3T53 B;  1PZJ D;  1WCM H;  2DY7 A;  3HKZ E;  3CQZ B;  4DK1 A;  4ILW A;  1O7Z A;  4HIO A;  1TU2 B;  1NAP A;  1WCM G;  2K28 A;  4LFC L;  3H09 A;  1B9N A;  4J15 A;  1KRT A;  3J7A V;  1Q7Y C;  5M5W H;  4V0B A;  5JOB A;  1E2W A;  2N8N A;  1S5F D;  4MN3 A;  2RCF A;  2K03 A;  5IGF A;  1B7Y B;  2XRS D;  1GD7 A;  2A6E D;  1JOO A;  4JI3 L;  3GO5 A;  1V43 A;  1MHW C;  1Q82 C;  1JOK A;  1TWC H;  2WB1 G;  2KA7 A;  3EA6 A;  3I56 A;  1GUS A;  1RCV D;  4KKU A;  3C1F A;  2UUC L;  1NTG A;  4C1N I;  2EQS A;  1SAP A;  4HJA A;  4DUZ L;  1AH9 A;  2HQL A;  2NN6 I;  2HCC A;  4CGY B;  4A4I A;  5C44 H;  3E0E A;  2ATW A;  2L15 A;  3K5O A;  1X6O A;  3WWV A;  5C44 G;  4R9W A;  4B3S L;  3BZD B;  3MTS A;  1I3Q B;  3T4A C;  1Q3L A;  2PZW A;  2DJG C;  4X66 Q;  1SJE D;  3HOX B;  3FP9 A;  5AJ3 L;  1X65 A;  2B2T C;  1SNP A;  1Y1V B;  1SMY D;  1I4R A;  2FXQ A;  1BO0 A;  1N33 Q;  2DUD A;  2G9H D;  2JA7 H;  1OXT A;  1H9M A;  1YEZ A;  4IUR A;  4GKK Q;  2VY3 A;  3OW7 A;  2NVX B;  4FF2 A;  2EY5 A;  2PQA B;  3J81 L;  3TZU A;  3X3M A;  1FNV A;  3VR4 A;  4BXX G;  4ID6 A;  2DY8 A;  2ZXO A;  2DJF C;  5D3I B;  1PFS A;  2F0T A;  4JPB W;  2HQE A;  1EFI D;  5C0X G;  4DV1 Q;  2A5H A;  1BXT A;  1ML0 D;  4H13 C;  1SNQ A;  4RFB A;  1SNC A;  2A73 B;  1U0L A;  2B2V A;  1EY6 A;  3KF6 B;  2A69 C;  2WAQ G;  4O0A A;  3GTO H;  1PH3 A;  1D8L A;  1TWG B;  3P75 A;  2NBF A;  2MNA A;  2H1E A;  4DUY L;  5IT9 E;  3GTG B;  3I70 A;  2VQF L;  3O13 A;  4QQB X;  1TS2 A;  1BDO A;  3QOL A;  3KDF B;  1FL0 A;  1K9M C;  4H7B A;  4A3K B;  2G9D A;  3DWP A;  1J9O A;  2K5N A;  1F9R A;  4R8N A;  3RUZ A;  3E6Z X;  2ZJQ A;  3PO3 B;  2R92 B;  1HUM A;  5IIF A;  5KIX A;  2DNE A;  2PPB C;  3Q0A A;  3S24 A;  2RA4 A;  2F0N A;  3OOC A;  4ZKC B;  2BH2 A;  4A3B B;  4Y7N H;  2OTL A;  4HJ8 A;  2QA4 A;  2KHS A;  1VQD A;  1EU4 A;  4HID A;  2JA5 H;  3RZD B;  3PMF A;  3N52 A;  1VQN A;  1CA5 A;  4JYA L;  4CKB A;  1PH2 A;  2JA5 G;  3KYH C;  1X55 A;  3A7L A;  3I3C A;  2F0K A;  1K8G A;  4FXD A;  1HNX Q;  1SLJ A;  1A3V A;  1SE4 A;  4N9T A;  2PMZ E;  2J4X A;  1N36 L;  4IPH A;  4RA8 A;  4EQN A;  2EPB A;  4C2M H;  1ET6 A;  4HTH A;  2NZ1 D;  1X3F A;  4A3E B;  2XTI A;  5IGE A;  2EYM A;  1A2T A;  1CUK A;  4CJ2 C;  2VZA A;  4JCV E;  1PFM A;  1V1Q A;  3PUY A;  5A2Q L;  2K4K A;  5FO7 B;  1XNR L;  5AJ3 Q;  4AQY L;  4A3J B;  2QEJ C;  4PNY A;  3GTL H;  1XWE A;  2K5V A;  4HCE A;  4WJ3 M;  1DYQ A;  4L63 B;  2ZJR A;  2F0E A;  1UNS A;  2K33 A;  4LW1 A;  4OON A;  3CCR A;  5LMN L;  3KBG A;  2LY7 A;  2XGT A;  3RR5 A;  1NNX A;  1DOM A;  5K36 H;  4F7X A;  2F4V L;  3S17 H;  4OWX B;  3PF5 A;  2UUA Q;  1W3S A;  4DR4 L;  3TRZ A;  5K36 G;  4DV7 Q;  1KHI A;  1JIC A;  3S14 H;  2R7F A;  1MGS A;  5DLQ E;  5FO9 B;  1WJJ A;  2K1B A;  3SK4 A;  1XMQ L;  1HR0 L;  1U5K A;  1CZW A;  2GVB A;  3GD7 A;  4KHZ A;  1XMO Q;  1YNJ D;  1II3 A;  4XT3 B;  3VR6 A;  4EQ5 A;  4CDE C;  1I6V C;  1YNJ C;  5HY6 A;  3ULL A;  4DK0 A;  2N49 A;  2IJ0 A;  2MPM A;  2Z4I A;  5FO8 B;  4DR1 Q;  4C3J B;  1JT8 A;  3SK5 A;  3TZD A;  2A74 C;  5C3X A;  4CHT B;  3URY A;  3F2B A;  1XPU A;  3GV6 A;  1MBY A;  4DV3 L;  4ZQ3 A;  1VQC A;  4JVZ A;  4DUY Q;  2M9V A;  2VQF Q;  2RVL A;  2K52 A;  2L4N A;  1PH8 A;  1KTK A;  5LMU Q;  2UU9 Q;  1D6E C;  4B9W A;  3QG1 A;  4A3F B;  1WTW A;  2ZXR A;  3S1N B;  4X64 Q;  4JI2 Q;  2HIV A;  2NTS A;  1V1O A;  1N32 L;  4YHH Q;  1EUJ A;  3FPP A;  1IHZ A;  1GOZ A;  5M3M H;  1KAB A;  2D0O A;  1PV4 A;  5M3M G;  2CQA A;  3T1Y L;  4BY7 B;  1QVF A;  1GJX A;  4EX5 A;  3OMC A;  5JJK A;  3U4Z A;  2VB2 X;  3R93 A;  2VNU D;  1TII D;  1YNN D;  4JYA Q;  4L8J A;  3S2D B;  1VQ9 A;  4FO2 A;  1WOC A;  4OIJ A;  5TSS A;  1N8R C;  4QUC A;  4BY1 H;  3D0F A;  4GKJ L;  1W6J A;  4DV6 L;  5EBD A;  1T9H A;  2MUY A;  4RAU C;  2WIN B;  4BY1 G;  1N36 Q;  3GTK B;  2I07 B;  2F0Q A;  1JJ2 A;  3K8A A;  1JR0 D;  3PUV A;  4DGZ A;  2D62 A;  4GLX A;  2EJF C;  2WKD A;  3RLN A;  1DCZ A;  2AQ1 B;  1UAP A;  4Z9C B;  1LT5 D;  2YTV A;  1H9S A;  5C4H A;  1HNW L;  4XTC S;  2VB3 X;  1JWU D;  5GQO A;  3DMU A;  5I9O A;  1NCV A;  5C4J B;  2VQE Q;  5LMN Q;  3BVG A;  2IX3 A;  1QJO A;  1I5F A;  2F0P A;  1ESF A;  4LF5 L;  2Q2I A;  2FHT A;  3LX0 A;  4GNX B;  4GOP B;  5CR3 A;  1L0Y B;  1Z6H A;  1STY A;  5NUC A;  3GTP B;  3PSI A;  5M5Y B;  4IZ8 A;  4POF A;  3HZX A;  4XYO A;  4KHP L;  1CK1 A;  3NXW A;  5IY0 A;  3M4P A;  4MTK A;  4NMZ A;  3LNN A;  1TKW B;  3CC7 A;  5ELC A;  4RG1 A;  1CSP A;  2JA8 B;  3TP5 A;  5E7N A;  1I4H A;  5EGT A;  3F1Z A;  5LL6 S;  4OL7 A;  1CKO A;  4ZAI A;  1Y8P B;  4F88 A;  5IE8 A;  5KEE A;  1LTS D;  4CKE A;  4C3H H;  1GUT A;  3RZO B;  2L9H A;  1EL0 A;  1X54 A;  1TWA H;  3GTM B;  2OTJ A;  4C3H G;  1X9N A;  3K81 C;  4XQJ A;  5J3B A;  4F87 A;  1ZEQ X;  4DV3 Q;  2B8F A;  3NBH A;  3QO2 A;  4K14 A;  1E3P A;  1SYB A;  2WV6 D;  3H3V C;  2K01 A;  1WTP A;  3S16 B;  5T1I A;  3M7G A;  2F0V A;  2RHQ B;  5EKL A;  1B3Q A;  3CPW A;  2ZJP A;  1PA6 A;  4JI6 L;  3JAM L;  1Z47 A;  1LAB A;  4DAY B;  1SRU A;  2PNH A;  1E2V A;  2FMC A;  1K28 A;  1VCI A;  2UXC Q;  4CKC A;  1LT4 D;  3FVQ A;  4HAE A;  3HG9 A;  4GN4 B;  3HFZ B;  2ID0 A;  4R4C A;  4NXM L;  3AQQ A;  5IP9 H;  5CC4 A;  4NKL A;  3KLR A;  3HOV G;  3VR2 A;  5CV4 A;  3K58 A;  5C3E H;  5C4Z A;  5IP9 G;  4NB3 A;  4XT1 B;  4A3G H;  3C46 A;  5C3E G;  4TKO B;  3K5M A;  1SFO B;  4QB4 A;  4GKJ Q;  5LHY 1;  4DV6 Q;  4A3G G;  1UWV A;  5F2D A;  2NVQ H;  4CDC C;  4DNR B;  3J80 c;  1GKH A;  5M3F H;  1DOK A;  2QCP X;  1CQF A;  1QWY A;  1QUQ B;  3SXH A;  3BYY B;  1XNQ L;  3IFT A;  1J6Q A;  1GVP A;  1GXD C;  4N8F A;  4O1N A;  5J22 A;  3UE1 A;  1KD1 C;  4ZYS A;  2XWJ B;  1DJR D;  2A6H D;  1RDP D;  2JK8 A;  1K8O A;  2KCN A;  4IPD A;  3W3A A;  4CDF C;  4JBM A;  3TBI B;  1QOH A;  3I73 A;  1EIY B;  1TS5 A;  1SND A;  1K8A C;  1HCZ A;  4LF5 Q;  1G91 A;  3AMU A;  3BYT B;  3M3Y H;  2F0U A;  1WCM B;  3F2C A;  1PRT B;  1X56 A;  4KHP Q;  4HJ5 A;  1HZC A;  3WOE A;  3D6C A;  5G3L F;  3RNU A;  1JE4 A;  2ES2 A;  1D7Q A;  3FHW A;  4A93 H;  5M5W B;  1BR9 A;  2K32 A;  2EOT A;  1O7L A;  1SMX A;  4A93 G;  3J80 L;  4WJ4 A;  5KYI A;  1JB3 A;  1G29 1;  5E1F A;  2OT2 A;  5FLX E;  2WB1 B;  5FK9 C;  3W1G A;  2SNS A;  3R3O A;  2F0F A;  1TWC B;  2XVS A;  2P5Z X;  5KNB A;  2PI2 A;  3HEJ A;  2Z8L A;  2BDO A;  2LXJ A;  4A3I H;  1KAA A;  4RMF A;  2AMC B;  3KF8 A;  1PTO H;  4A3I G;  4YCU A;  2E2I H;  1C4Q A;  1KQS A;  1LT3 D;  4JI6 Q;  1BQQ T;  5EJW A;  1ILQ A;  3MZ5 A;  4OWW B;  4FF4 A;  1QG7 A;  1EY8 A;  4PMW A;  1IW7 C;  2QDL A;  5ELN A;  3L7Z C;  5HGQ A;  2OWO A;  2YU9 H;  4NW2 A;  3JC6 6;  3OHX C;  1CI3 M;  1UUP A;  4FF1 A;  1O7I A;  2SEB D;  4N8X 1;  3MXN A;  4NXM Q;  1EQQ A;  4DR3 L;  4A3L H;  3IKJ A;  4GLV B;  1I94 L;  2GN5 A;  4EQO A;  2OXP A;  2JA7 B;  2NB0 A;  4A3L G;  3BU2 A;  2UXB Q;  3KBX A;  3P1H A;  1QE6 A;  3MHB A;  4X3T A;  1HZB A;  2B2Y C;  4TRD A;  5G3L D;  1VQK A;  3CC4 A;  4P2C B;  3IL8 A;  1YJ9 A;  4WFN 3;  4TSS A;  1UE6 A;  4DF7 A;  1ZKO A;  4UAI A;  2L11 A;  4HSP A;  1LAC A;  4LUV A;  2JA6 H;  2F4I A;  4LNQ A;  5JEA H;  4C56 C;  1SBB B;  2E5L Q;  2F03 A;  3UE0 A;  2JA6 G;  2AKW B;  3ERQ A;  1MSG A;  3SE0 A;  4JK1 C;  5JEA G;  3A54 A;  3STB D;  3K7A H;  3VYU A;  1P8L A;  4A3C H;  2EYP A;  5CGK A;  4OX9 Q;  1GHK A;  2RHS B;  1AE3 A;  3GTO B;  1S5C D;  3J81 j;  1O78 A;  4A3C G;  1BCP B;  3HOY H;  1SJH D;  3H6M A;  2L1B A;  3CRL C;  4JI5 Q;  3HOY G;  5FKA C;  1WTX A;  4DV4 L;  4RGT A;  4H44 C;  1YNX A;  2A68 C;  1WVL A;  1GUG A;  5BN5 A;  5J1Z A;  2RSN A;  2NYZ D;  3FKI H;  3D3R A;  3TDQ A;  5JAV A;  2OQ0 A;  4Y7N B;  4J8Q A;  4JW0 A;  4FNF A;  4KN7 C;  1IBM L;  3PIO A;  3FKI G;  4BBR H;  1SNM A;  2Z1C A;  1EWC A;  2JA5 B;  1H9K A;  1QZG A;  3G6J B;  5CBE E;  3HOZ B;  4BBR G;  1Y1W H;  1GUN A;  5BR8 L;  1EZ6 A;  3I91 A;  2FJ2 A;  2B63 B;  1Y1W G;  2Y0S E;  3GTQ H;  2E2H H;  1I4X A;  1ESR A;  2JP1 A;  2Z6K C;  5KYL A;  3J81 c;  2QKI C;  3H0G B;  4DV0 L;  4JBJ A;  4YWK A;  3D8G A;  1F2L A;  4XIG S;  4HED A;  4C2M B;  5DAU A;  1WTR A;  1PHJ A;  4YCW A;  4MTN A;  1JWM D;  4A3D H;  4FVM A;  1G51 A;  1I4G A;  1LTL A;  3A5Z B;  3V2T A;  3I55 A;  2A6E C;  3BDO A;  4A3D G;  4P73 A;  2CWP A;  1PVO A;  1R4Q B;  3AU7 A;  5I6W A;  3J7Y W;  2K5W A;  4BA1 I;  3IFD A;  3NEM A;  4B3T Q;  3VYS A;  1HRJ A;  3GTL B;  3UDF A;  4BBS H;  4GN3 B;  1EFW A;  1I94 Q;  3A8K E;  4TVA B;  2R7D A;  3FEW X;  3DEO A;  4BBS G;  2QDB A;  4RHR A;  3L2P A;  1X3Q A;  2K75 A;  3RLO A;  4UY8 C;  3S17 B;  2CH4 A;  3CCJ A;  2HUG A;  3Q23 A;  1IYJ B;  4CJ0 B;  5IGC A;  2EYO A;  4HJ9 A;  2A8V A;  5EKK A;  1SMY C;  1KL9 A;  4BXX H;  4KMU C;  2Q8I B;  3UDI A;  5JJI A;  1STH A;  3Q22 A;  2K5Q A;  5C0X H;  2E2J H;  4AIM A;  3K7U C;  2JYO A;  1WTO A;  2XN9 C;  1K3B C;  3A7A B;  4UP7 A;  5CV6 A;  3CCV A;  4KJO A;  3RLF A;  3FDT A;  3I72 A;  4AH6 A;  1MI2 A;  2BA0 A;  2Q8T A;  2VUM H;  1JMC A;  3MFG A;  1WTV A;  1JWS D;  2ENB A;  1ENC A;  4HIM A;  4YY3 Q;  3TSS A;  2VUM G;  2K7V A;  1S5D D;  5LL6 X;  2NVT H;  5IYB H;  5M3M B;  3K5N A;  3GTJ H;  3PUX A;  1KAW A;  1CKN A;  4K6D A;  4Q0F A;  1J5E L;  5IYB G;  1FJG L;  4GLA C;  2J7Z A;  2PCF B;  2ZXP A;  3MAQ A;  2N78 A;  1WI5 A;  1CQV A;  2EYF A;  1A3T A;  5C5L A;  3CF5 A;  2KCM A;  2TMP A;  1TWH H;  3E5S A;  4KLK A;  4YWM A;  5CMD A;  3HOU H;  3I4N B;  2KOL A;  4DAM A;  2NZH A;  4LFC Q;  2AWO A;  2MP1 A;  4BY1 B;  4ALP A;  3HOU G;  1EEF D;  2XRQ D;  1HA6 A;  1ROD A;  1TY2 A;  1D5Z C;  2IPK D;  4DV0 Q;  3G4S A;  2M2L A;  1TQO A;  1R4P B;  4B3R L;  1HXY D;  1ILP A;  2MQH A;  1LTG D;  1VQF A;  1F9P A;  3T1H L;  3EBE A;  3HKZ G;  2R3Z A;  4X65 L;  1S4Z A;  4POG A;  3D4D A;  1RTN A;  1YIT A;  4JI3 Q;  3WDN A;  4G57 A;  2VS1 A;  2F0G A;  2VW9 A;  4KI0 A;  3HGB A;  3ERS X;  4IQZ A;  2UUC Q;  4OO1 H;  3ICE A;  5EPL A;  2B3G A;  2ZTC A;  4DUZ Q;  2CCZ A;  4OO1 G;  3NWS A;  5E4W C;  1G6Z A;  4JC0 A;  1PXU A;  2F0M A;  4DAV A;  2ICE C;  1C7Y A;  4DKA C;  3K0X A;  4B3S Q;  4YCV A;  3TS2 A;  1H9S B;  3OWE B;  3K59 A;  2Z6K A;  1U9R A;  3H91 A;  4QIW B;  5COR A;  3L0O A;  1LYL A;  1PFB A;  1L1O C;  4OGQ C;  1VQJ A;  5LMN W;  4PZ8 A;  5AFW A;  1HJP A;  3OYY A;  2KCC A;  4NXN L;  2K6A A;  1KRS A;  5FLM H;  2K04 A;  2FMM A;  1EEI D;  3S1R H;  1J8I A;  1YHQ A;  4HR7 B;  5DEH A;  5FLM G;  4IO9 A;  5KRU A;  4DAP A;  1CSQ A;  3J7A F;  4C3H B;  3U9S A;  2IHF A;  1TWA B;  3KUP A;  1PYS B;  2UUB L;  2C35 B;  1IKM A;  1QCB D;  1FNU A;  4K2L A;  1VQ6 A;  4DNI A;  1VMP A;  1VQL A;  2RDH A;  2SNM A;  3BDC A;  2YYZ A;  2B2T A;  3GQB A;  5BN4 A;  1LV9 A;  1NBW A;  1KDA A;  4KD4 A;  4DNT B;  4LUO A;  1BVS A;  4P75 A;  1IL2 A;  2N55 A;  2CQO A;  1ZYR D;  4IOC A;  2EY6 A;  3MXU A;  4AYB B;  3NBH B;  1J5E Q;  3A74 A;  2O2L D;  1HZ9 A;  4ZUJ A;  1FGU A;  3M4O H;  1LM0 A;  1O80 A;  4G7O C;  1FYC A;  4E6I A;  2PYK A;  1A3U A;  3GDE A;  2KVM A;  1JOR A;  5COY A;  4A3G B;  1EZ8 A;  2B2U C;  2EYL A;  1IL8 A;  1SRO A;  1A6X A;  3CP0 A;  4K8I A;  4LAA A;  2NVQ B;  4LF6 L;  4BS9 A;  5M3F B;  4B3R Q;  1YNN C;  1KDB A;  2IL8 A;  4C3I H;  2F0I A;  1A15 A;  1MSH A;  2K50 A;  2EY2 A;  3G6E A;  4C3I G;  4B9X A;  3C2P A;  4KHV A;  4DV2 L;  2YTX A;  3A5U A;  4A3K H;  1BNZ A;  3OMG A;  2I5H A;  3AB9 A;  4WJW A;  1CTM A;  1PZK D;  1HHV A;  1DZ1 A;  4ABN A;  5A35 A;  4A3K G;  3UDX A;  1XXG A;  2A1A A;  3CHB D;  3TRE A;  3PO3 H;  2BA1 A;  3VYT A;  3P20 A;  3PO3 G;  2PW5 A;  4A3B H;  1PZI D;  4LF9 L;  1EYC A;  1MJC A;  3TP8 A;  4QMG A;  4A3B G;  1XNR Q;  4AQY Q;  2OCE A;  3M3Y B;  4IUV A;  2UXD L;  4P72 A;  4GNX C;  4GOP C;  4DV5 L;  1GHJ A;  3JAM c;  4QUF A;  1SYC A;  1OXU A;  3DUZ A;  1EY0 A;  4IJH A;  4F8M A;  3C3L A;  3S2H H;  4K5V A;  2XIW A;  1R9T B;  2D9U A;  5C0X I;  5L37 A;  4A93 B;  1K73 C;  1LO5 D;  1RD9 D;  3T16 A;  1AZP A;  2F4V Q;  4GS3 A;  4JBW A;  4DR4 Q;  4GN5 A;  3CCL A;  1RKN A;  1VQH A;  4A3E H;  4XXE A;  1HR0 Q;  2ZTD A;  1XMQ Q;  1Q86 C;  3Q24 A;  2UUB Q;  4A3E G;  1DOL A;  1RJT A;  5D65 A;  2EDG A;  1GO3 E;  2ZM6 L;  3ZYY X;  3HOW H;  3SK8 A;  3PIP A;  1EQT A;  4A3I B;  4DR5 L;  1L1O A;  1LUZ A;  1PTO B;  3HOW G;  2C9O A;  1D2B A;  2BOS A;  3TS0 A;  2ZT9 C;  2E2I B;  3L9A X;  4DXF A;  4IUN A;  4HCS A;  1EIG A;  3KJO A;  1QVG A;  1CHQ D;  2YU9 B;  1PRT F;  1DM0 B;  3KFU A;  3K80 C;  5I6Y A;  3ND9 A;  3PO2 B;  2WAC A;  3MEF A;  2N88 A;  1N32 Q;  4OHJ A;  4PMB A;  1VQO A;  3OTO L;  2RKS A;  5I2X A;  3KLW A;  1TR5 A;  2ALY B;  5JVG 3;  2Z4H A;  4K0K L;  4KJN A;  1X3P A;  3T1Y Q;  1IBL L;  1MIU A;  1KLU D;  1NR4 A;  3Q8D A;  3HOV H;  4DR2 L;  3NE5 B;  3M9B A;  4KY5 A;  3K57 A;  1Z7T A;  3MXN B;  5IGD A;  1EY4 A;  2JA6 B;  2R7Z H;  1PH9 A;  4UPA A;  3I2Z A;  2AQ3 B;  3S15 H;  4LF8 L;  3PCO B;  4OO1 I;  3FPU B;  1IXR A;  1YBY A;  2R7Z G;  3BVZ A;  1AEX A;  1V1P A;  2XWB B;  2Q2H A;  1W6K A;  2I0Q A;  1D1K A;  2V4D A;  4ZKB B;  4HMI A;  2K14 A;  4R4Q A;  3K7A B;  1FR3 A;  4R4T A;  1WYD A;  4FF3 A;  1EOT A;  4WRD A;  1OXX K;  4APV A;  4OEL B;  4TQU S;  1TWF H;  2B8G A;  1E2Z A;  3A56 A;  3H15 A;  1JQY D;  2KCT A;  4HJ7 A;  2B2U A;  1YHA A;  4P71 A;  1KIX A;  1HNW Q;  3NSW A;  4U67 3;  1YIJ A;  1RL2 A;  3QB3 A;  1PH7 A;  2KHJ A;  1X3E A;  1CHP D;  4RKL A;  1EIH A;  4I65 A;  1UE7 A;  1X3G A;  1PRT D;  1IYV A;  4IN3 A;  2RSO A;  3JAM E;  3AYH B;  2A6H C;  3P7J A;  4DN4 M;  2R93 B;  3FKI B;  2H4O A;  2MJ8 A;  3CME A;  4H02 A;  4A75 A;  1B53 A;  2LFN A;  5JEA J;  1LTI D;  1NJI C;  3ND8 A;  3S1M H;  2ICI A;  1Y1W B;  4LFA L;  4XQN A;  2DGY A;  3I4M H;  5JJZ A;  4QJF A;  4ODG A;  1I50 H;  5HUR A;  5GAH C;  3MFY A;  2CFM A;  4MNO A;  4QCL A;  3I4M G;  3GTQ B;  1JOQ A;  3KOJ A;  4JI1 L;  3VA7 A;  3VDY A;  1B9M A;  4Y52 H;  1NSN S;  1JJC B;  1TVX A;  1BCP F;  2F3W A;  2IWH A;  2CKZ B;  3PUW A;  1CFM A;  3UDG A;  4RGO S;  1AZQ A;  1K83 H;  5C4J H;  4A3D B;  4UP9 A;  1LT6 D;  2RBM A;  1SYD A;  3NPP A;  1EY5 A;  3I4O A;  2D0P A;  4FDB A;  3NEN A;  1STB A;  1NY4 A;  2OEO A;  3D31 A;  1RF2 D;  1ET9 A;  3DWA A;  3EIV A;  3CAM A;  2BE5 D;  4MHE A;  1SDF A;  3PF4 A;  2AUK A;  5C44 B;  2RQX A;  1PMR A;  3C1E A;  4BBS B;  1E0B A;  3OPO A;  4HSV A;  1HTL D;  1T5X D;  2WB1 E;  4KN4 C;  1N9W A;  2HIX A;  5C4X H;  1EYA A;  1IBL Q;  1N34 L;  2X6L A;  1ENF A;  5ELF A;  5C4X G;  1VQB A;  4IFD H;  3M4Q A;  3ULJ A;  3EJI A;  3CD6 A;  1K0S A;  4IFD G;  4O42 A;  4I7Z C;  5I4D A;  3QWN A;  4LF8 Q;  1I6H H;  1YI2 A;  3TEH B;  4ZK9 B;  3N6R A;  2L5T A;  3F2D A;  3I7F A;  5HGT A;  2EVB A;  5IYC H;  1I4P A;  1CM9 A;  1M8A A;  2E2J B;  3CC2 A;  4HMJ A;  2EE1 A;  1NMG A;  1Z9F A;  2YTY A;  3J80 E;  2NVY H;  2IT1 A;  5IYC G;  5CV7 A;  5M9O A;  2RCN A;  3ITP A;  1HNZ L;  3EVQ A;  3NTH A;  4KY6 A;  1BCP D;  1Q8I A;  4X66 L;  1XNQ Q;  3H3V H;  2VUM B;  2WAQ B;  4YIJ A;  4K8J A;  1QVC A;  2C5C A;  4ULL A;  5CV9 A;  3STB C;  3BJU A;  1S5B D;  3G7L A;  3CW2 C;  2JE6 I;  2FIN B;  2IX0 A;  2EIF A;  3B6Y A;  1N33 L;  2NVT B;  3VR5 A;  4JV5 L;  3QOJ A;  1U4M A;  1IBK L;  2FFK B;  1U4L A;  2NUC A;  1B44 D;  3G48 A;  5C6A A;  1EYD A;  1MD2 D;  5FJ8 H;  2LSS A;  1A63 A;  4LF7 L;  3U4V A;  4MIU A;  1AN8 A;  4LUZ A;  5FJ8 G;  1EY9 A;  3A0J A;  5JPN C;  3M4Y A;  1F9Q A;  1TWH B;  1CKN B;  4XDX A;  4LFA Q;  4DR6 L;  5C0X J;  3R2T A;  2B2W C;  3D4R A;  5KND A;  3NHH A;  3J7Z C;  3DXJ C;  4KY7 A;  3HS0 C;  1HUN A;  3HKZ B;  3TQY A;  4EQP A;  2GVA A;  4A3M H;  3BVM A;  2CW0 D;  1HZA A;  1Q81 C;  3S1Q H;  2KEE A;  2Z9H A;  4JI8 L;  5IT9 c;  4A76 A;  4A3M G;  4DPG A;  2SDF A;  3J7A 5;  3E9H A;  1HPC A;  3J81 i;  4X3K A;  3K0Y A;  1OXV A;  3A8J E;  1C48 A;  1VQM A;  4XQQ A;  5JJL A;  1KNA A;  1H95 A;  1QB5 D;  4MZ9 A;  3NTI A;  1T5E A;  4L5Q A;  1UE1 A;  5IWA L;  1D5M C;  1STA A;  1YJN A;  1VQ4 A;  2G5D A;  1L2F A;  2AHO B;  1KLG D;  3G71 A;  2AQ2 B;  1N34 Q;  1PYB A;  4DXG A;  4KK7 A;  5M5X H;  4DR3 Q;  1HFN A;  2F0J A;  3QIA A;  1TXY A;  2PW7 A;  1HNX L;  1VQ7 A;  4IUU A;  3X3N A;  3S1R B;  5E3F A;  4IJL A;  1VS0 A;  1VDZ A;  1XPO A;  1M1K C;  3MWY W;  4K5X A;  4HIK A;  2KJX A;  3S14 B;  1CKM A;  2B29 A;  4X3S A;  3TME A;  3F2U A;  2HDM A;  5IT9 L;  1PH4 A;  2Z0S A;  1HNZ Q;  3I4L A;  1DXM A;  3BG3 A;  3NTK A;  5GAD C;  3AFP A;  2EY1 A;  1A62 A;  1K8M A;  3RMH A;  4LFB L;  2RF4 A;  3CCM A;  2X6G A;  1QNK A;  3LGJ A;  4G7H C;  4OWT B;  4IAL A;  1VF5 C;  1LTA D;  4RGM A;  5CBA E;  4JV5 Q;  5CV5 A;  3CMA A;  1BF4 A;  1IBK Q;  4X3U A;  4RH6 A;  3DWQ A;  4EVO A;  4DR7 L;  3Q6S A;  1D1I A;  2JA7 G;  2QW7 A;  2F3V A;  1EWH A;  3CPF A;  4R8I A;  1IKL A;  1SYE A;  2UUA L;  4LF7 Q;  1BUV T;  2B2Y A;  4DV4 Q;  1VQ8 A;  3M4O B;  4DV7 L;  3M7N A;  1BBU A;  1B50 A;  4OEM B;  4PV1 C;  4ZUI A;  3MXP A;  4Q5V A;  4DR6 Q;  1XMO L;  1C8C A;  1WTH A;  3NK9 A;  2BCO A;  1A0I A;  4PQX A;  3EN2 A;  3OSO A;  2RDF A;  1YZ6 A;  1IBM Q;  4DR1 L;  5DNF A;  1SYF A;  1LTB D;  2A69 D;  1STE A;  2E8G A;  2WKC A;  5IGB A;  4X62 L;  1Y69 U;  1M90 C;  2KQ3 A;  4C3I B;  5EKI A;  4L5S A;  4PG3 A;  5BR8 Q;  1EY7 A;  3ERO A;  4JI8 Q;  2ZTE A;  1X32 A;  4GZY C;  5EAY A;  2MFI A;  3OIP A;  3J81 E;  5LMU L;  2UU9 L;  2E74 C;  4IOA A;  1PLF A;  1S5E D;  3BDL A;  3NQT A;  4X64 L;  5EPK A;  4JI2 L;  2F0H A;  4YHH L;  3SDZ A;  1Q46 A;  2E2D C;  1E1O A;  1SEB D;  1G8Z D;  2JEB I;  4L6T B;  2KUM A;  3D4W A;  2B2W A;  5IWA Q;  2V1C C;  2PMZ B;  2TSS A;  4KKS A;  2WP8 J;  4IFD I;  5I2Y A;  2Y0S G;  2I46 A; 
#chains in the Genus database with same CATH homology
 2F0O A;  1VF7 A;  4IUQ A;  3PIO 3;  1LTR D;  3RD4 A;  4XYQ A;  4N9P A;  3MC0 B;  3S2H B;  2K05 A;  3SVM A;  3PV0 A;  2CVR A;  2F1M A;  1F77 A;  3IAY A;  1A2U A;  3TP7 A;  2PQE A;  1B4O A;  4ZLT F;  4J1M A;  4LMQ D;  1RTO A;  2J0T D;  3HOW B;  4PMC A;  1Q12 A;  3A55 A;  3T56 B;  1TT2 A;  4KKT A;  3NWT A;  3ONA B;  3V05 A;  2RDG A;  2MGS A;  1NR2 A;  3SR1 A;  4K2K A;  2AUJ D;  4RWS C;  2BDN A;  2EYJ A;  5IOD A;  5FOB B;  4IUT A;  1XTC D;  4K6L A;  1LTT D;  1HFG A;  1SYG A;  5T1G A;  2AWN A;  4C1N K;  1ZYR C;  2VXW A;  4U68 A;  3HOV B;  5A2Q E;  4NDX A;  2NWG A;  3EQL C;  3PUZ A;  4G7Z C;  5C3E B;  1G2S A;  2R7Z B;  5DM7 3;  3S15 B;  1PTO F;  1B3A A;  2QIL A;  3KK7 A;  2F0W A;  1F2Z A;  5J39 A;  3L3O C;  4DA2 A;  1H9J A;  1TWF B;  3CRK C;  1V1P B;  3TN2 A;  1FGB D;  1XYI A;  1ONL A;  2JEA I;  1AFP A;  2M00 A;  3CU7 A;  3H94 A;  2X69 A;  2PZU A;  2KEC A;  2O5I C;  3LWE A;  3M85 A;  1SNO A;  4RCO A;  2PO4 A;  1KNE A;  4NP5 A;  1HA5 A;  2XSC A;  3MVV A;  5DM6 3;  1HTP A;  5K5P A;  4CBV A;  3S1M B;  3R8B A;  4RHS A;  4S3S A;  3I4M B;  3MXG A;  1I50 B;  2E76 C;  2EZV A;  1TY0 A;  3A8I E;  1Q1B A;  1B2T A;  1F2M A;  5CV8 A;  1PTO D;  1K83 B;  1PTO C;  3I90 A;  3NUC A;  3DHQ A;  4DFA A;  3R2I A;  1Y8N B;  1G2T A;  5JPM C;  3KLS A;  2EJG C;  3T51 B;  5EQ0 A;  3T13 A;  4BA2 I;  2D2C C;  1L0X B;  4HN7 A;  2XNA C;  1QNU A;  1PDQ A;  1STG A;  2LS0 1;  1Y8O B;  3V96 A;  5C4X B;  4IUP A;  1Q1E A;  1AW7 A;  3TP6 A;  1EU3 A;  4K5W A;  4FXK C;  5EPJ A;  4KTA A;  2IW3 A;  1I4Q A;  3S9W A;  3OWF A;  4CJ1 B;  2HCI A;  4RCN A;  5D14 A;  4B08 A;  1I6H B;  1PYW D;  2K5D A;  4KD3 A;  3MEH A;  2O4X A;  3K5L A;  2NVY B;  4C3J G;  1FD7 D;  1JC7 A;  2LKV A;  3E0J A;  1CZG A;  4ME5 A;  5JVH 3;  1F2Y A;  4G4K A;  4OIK A;  3W2D A;  4M1U B;  3DEP A;  3WOF A;  1AP0 A;  2LMC B;  3FRP B;  1TS4 A;  2NN6 H;  4IFD J;  5C3W A;  3HOY B;  1DON A;  2NN6 G;  2O5J C;  4RGN A;  5ISR A;  4QF4 A;  1NUC A;  5FLX L;  5ELE A;  5BN3 A;  1PRT C;  1GUW A;  3EFX D;  1Q90 A;  1QIL A;  2PZT A;  1EQV A;  2F0S A;  3GV3 A;  4BBR B;  2DNC A;  1WTQ A;  2SOB A;  1U4R A;  4A3M B;  4M8A A;  1FNW A;  3S1Q B;  1JCK B;  5I9P A;  1WD1 A;  5KNC A;  3SHL A;  2E2H B;  4DU9 A;  5E4X A;  3VR3 A;  1LLR D;  5ELD A;  2EXZ A;  5C5M A;  1WD0 A;  4BWG B;  1TS3 A;  1UEA B;  4KV6 A;  3UI2 A;  4UDU C;  2MHV A;  1RHP A;  3I8Z A;  1STN A;  5CYU A;  1ENA A;  2E75 C;  3BS1 A;  5IOC A;  2R6G A;  2BE5 C;  5M5X B;  5KGU A;  2PNR C;  2R61 A;  1HQM C;  3K6O A;  3SK6 A;  1ICW A;  4EGV A;  3VYR A;  3DM1 A;  1ZXT A;  5IGG A;  3VA5 A;  1U4P A;  3D6W A;  4H0L C;  3PIP 3;  3LWU A;  1BOS A;  5EBC A;  2IX1 A;  1O7Y A;  2EYH A;  3GP7 A;  1IW7 D;  4DAY A;  1PFN A;  3NP8 A;  3FMC A;  1OO9 B;  1F9S A;  3QJY A;  1KDC A;  2D5D A;  1XX8 A;  3HRZ C;  4J6H A;  2DN8 A;  4V19 0;  5D3D A;  2GA4 B;  1SXT A;  2CHB D;  4RKB A;  4FP5 D;  1BBX C;  2Q8R E;  1BCP C;  3OIQ A;  2EJM A;  4LJZ C;  2L0C A;  2B2V C;  2WII B;  1D5X C;  1H9R A;  2HDL A;  3SEB A;  1SE3 A;  3GTJ B;  1CT1 D;  1VMC A;  1HQR D;  4WOR A;  1CA6 A;  1SSO A;  2L55 A;  3KLS X;  4FYD A;  1IYU A;  3NQI A;  2JXM B;  2NTT A;  1B1Z A;  1SE2 A;  1GUO A;  1DD2 A;  2F0D A;  4ZRZ A;  3HOU B;  2L12 A;  5ELB A;  3NBI A;  2B39 A;  1V8Q A;  2KED A;  2A68 D;  2QF7 A;  2OF1 A;  3HP3 A;  1OXS C;  2JSO A;  2CW0 C;  4LK1 C;  2Y0S B;  3MA2 B;  1M4V A;  2F0L A;  4FXG C;  3CKI B;  3U9O A;  3T53 B;  1PZJ D;  2DY7 A;  3CQZ B;  4DK1 A;  4ILW A;  1O7Z A;  1TU2 B;  1NAP A;  2K28 A;  3H09 A;  1B9N A;  3J7A V;  4V0B A;  5JOB A;  1E2W A;  1S5F D;  4MN3 A;  2K03 A;  5IGF A;  2XRS D;  2A6E D;  1JOO A;  3GO5 A;  1V43 A;  1JOK A;  3EA6 A;  2KA7 A;  1GUS A;  1RCV D;  4KKU A;  3C1F A;  4C1N I;  1SAP A;  2NN6 I;  2HCC A;  4CGY B;  3K5O A;  4R9W A;  3BZD B;  3MTS A;  1I3Q B;  3T4A C;  1Q3L A;  2PZW A;  1SJE D;  3HOX B;  2B2T C;  1SNP A;  1Y1V B;  1SMY D;  1I4R A;  1BO0 A;  2G9H D;  1OXT A;  1H9M A;  4IUR A;  3OW7 A;  2NVX B;  4FF2 A;  2EY5 A;  3J81 L;  3TZU A;  3X3M A;  1FNV A;  3VR4 A;  4ID6 A;  2DY8 A;  2ZXO A;  5D3I B;  2F0T A;  2HQE A;  1EFI D;  5C0X G;  2A5H A;  1BXT A;  1ML0 D;  4H13 C;  1SNQ A;  4RFB A;  1SNC A;  2A73 B;  2B2V A;  1EY6 A;  2A69 C;  1TWG B;  3P75 A;  2NBF A;  2H1E A;  5IT9 E;  3GTG B;  3I70 A;  3O13 A;  1TS2 A;  1BDO A;  3QOL A;  4H7B A;  4A3K B;  2G9D A;  3DWP A;  1J9O A;  1F9R A;  4R8N A;  3RUZ A;  3E6Z X;  3PO3 B;  2R92 B;  1HUM A;  5IIF A;  5KIX A;  2DNE A;  2PPB C;  3Q0A A;  2RA4 A;  2F0N A;  3OOC A;  4ZKC B;  4A3B B;  2KHS A;  1EU4 A;  3RZD B;  3PMF A;  3N52 A;  1CA5 A;  4CKB A;  3A7L A;  3I3C A;  2F0K A;  4FXD A;  1A3V A;  1SE4 A;  4N9T A;  2J4X A;  4RA8 A;  4EQN A;  2EPB A;  1ET6 A;  4HTH A;  2NZ1 D;  4A3E B;  5IGE A;  2EYM A;  1A2T A;  4CJ2 C;  1PFM A;  3PUY A;  5A2Q L;  5FO7 B;  4A3J B;  2QEJ C;  4PNY A;  1XWE A;  4HCE A;  1DYQ A;  4L63 B;  2F0E A;  1UNS A;  2K33 A;  3KBG A;  2LY7 A;  1DOM A;  5K36 H;  4F7X A;  5K36 G;  1JIC A;  1MGS A;  5FO9 B;  2K1B A;  3SK4 A;  1CZW A;  3GD7 A;  4KHZ A;  1YNJ D;  1II3 A;  4XT3 B;  3VR6 A;  1I6V C;  1YNJ C;  4DK0 A;  2Z4I A;  2IJ0 A;  2MPM A;  5FO8 B;  4C3J B;  3SK5 A;  3TZD A;  2A74 C;  5C3X A;  4CHT B;  3URY A;  3GV6 A;  1MBY A;  4ZQ3 A;  2M9V A;  2RVL A;  2L4N A;  1KTK A;  1D6E C;  4B9W A;  3QG1 A;  4A3F B;  1WTW A;  2ZXR A;  3S1N B;  2NTS A;  1V1O A;  3FPP A;  1IHZ A;  1GOZ A;  1KAB A;  2CQA A;  4BY7 B;  1GJX A;  3OMC A;  2VB2 X;  3R93 A;  2VNU D;  1TII D;  1YNN D;  4L8J A;  3S2D B;  4FO2 A;  4OIJ A;  5TSS A;  4QUC A;  1W6J A;  5EBD A;  2MUY A;  4RAU C;  2WIN B;  3GTK B;  2I07 B;  2F0Q A;  3PUV A;  1JR0 D;  4DGZ A;  2D62 A;  2EJF C;  2WKD A;  1DCZ A;  2AQ1 B;  1UAP A;  4Z9C B;  1LT5 D;  1H9S A;  5C4H A;  4XTC S;  2VB3 X;  1JWU D;  3DMU A;  5I9O A;  1NCV A;  5C4J B;  3BVG A;  2IX3 A;  1QJO A;  2F0P A;  1ESF A;  2FHT A;  3LX0 A;  5CR3 A;  1L0Y B;  1Z6H A;  1STY A;  5NUC A;  3GTP B;  5M5Y B;  4IZ8 A;  3HZX A;  4XYO A;  1CK1 A;  3NXW A;  4NMZ A;  3LNN A;  1TKW B;  5ELC A;  2JA8 B;  3TP5 A;  1I4H A;  5EGT A;  5LL6 S;  4OL7 A;  4ZAI A;  1Y8P B;  4F88 A;  5KEE A;  1LTS D;  4CKE A;  1GUT A;  3RZO B;  2L9H A;  1EL0 A;  3GTM B;  4C3H G;  4XQJ A;  4F87 A;  1ZEQ X;  2B8F A;  3NBH A;  3QO2 A;  4K14 A;  1SYB A;  2WV6 D;  3H3V C;  2K01 A;  1WTP A;  3S16 B;  5T1I A;  3M7G A;  2F0V A;  5EKL A;  3JAM L;  1Z47 A;  1LAB A;  1E2V A;  2FMC A;  1VCI A;  4CKC A;  1LT4 D;  3FVQ A;  4HAE A;  3HG9 A;  2ID0 A;  5CC4 A;  4NKL A;  3KLR A;  3VR2 A;  5CV4 A;  3K58 A;  5C4Z A;  4XT1 B;  3C46 A;  4TKO B;  3K5M A;  1SFO B;  4QB4 A;  5LHY 1;  5F2D A;  4DNR B;  1DOK A;  2QCP X;  1CQF A;  1QWY A;  3SXH A;  3BYY B;  3IFT A;  1GXD C;  4O1N A;  5J22 A;  4ZYS A;  2XWJ B;  1DJR D;  2A6H D;  1RDP D;  1K8O A;  2KCN A;  3W3A A;  3TBI B;  1QOH A;  3I73 A;  1TS5 A;  1SND A;  1HCZ A;  1G91 A;  3AMU A;  3BYT B;  2F0U A;  1WCM B;  1PRT B;  3WOE A;  3D6C A;  5G3L F;  1JE4 A;  5M5W B;  1BR9 A;  2K32 A;  2EOT A;  1O7L A;  3J80 L;  5KYI A;  1JB3 A;  1G29 1;  5E1F A;  2OT2 A;  5FLX E;  2WB1 B;  5FK9 C;  2SNS A;  3R3O A;  2F0F A;  1TWC B;  2XVS A;  5KNB A;  3HEJ A;  2Z8L A;  2BDO A;  1KAA A;  3KF8 A;  1PTO H;  1C4Q A;  1LT3 D;  1BQQ T;  5EJW A;  1ILQ A;  3MZ5 A;  4FF4 A;  1QG7 A;  1EY8 A;  4PMW A;  1IW7 C;  3L7Z C;  4NW2 A;  3OHX C;  1CI3 M;  1UUP A;  4FF1 A;  2SEB D;  3MXN A;  3IKJ A;  4EQO A;  2OXP A;  2JA7 B;  2NB0 A;  3KBX A;  3P1H A;  1QE6 A;  3MHB A;  4X3T A;  2B2Y C;  4TRD A;  5G3L D;  4P2C B;  3IL8 A;  4WFN 3;  4TSS A;  4DF7 A;  1ZKO A;  4UAI A;  2L11 A;  4HSP A;  1LAC A;  2F4I A;  5JEA H;  4C56 C;  1SBB B;  2F03 A;  3ERQ A;  1MSG A;  3SE0 A;  4JK1 C;  5JEA G;  3A54 A;  3VYU A;  2EYP A;  5CGK A;  1GHK A;  3GTO B;  1S5C D;  1O78 A;  1BCP B;  1SJH D;  3H6M A;  2L1B A;  3CRL C;  5FKA C;  1WTX A;  4RGT A;  4H44 C;  2A68 C;  1WVL A;  1GUG A;  5BN5 A;  5J1Z A;  2RSN A;  2NYZ D;  5JAV A;  3D3R A;  3TDQ A;  4Y7N B;  4J8Q A;  4FNF A;  4KN7 C;  1SNM A;  2Z1C A;  1EWC A;  2JA5 B;  1H9K A;  3G6J B;  5CBE E;  3HOZ B;  1GUN A;  1EZ6 A;  3I91 A;  2FJ2 A;  2B63 B;  1I4X A;  1ESR A;  2JP1 A;  5KYL A;  2QKI C;  3H0G B;  3D8G A;  1F2L A;  4XIG S;  4HED A;  4C2M B;  5DAU A;  1WTR A;  1JWM D;  4FVM A;  1I4G A;  3V2T A;  2A6E C;  3BDO A;  1R4Q B;  3AU7 A;  5I6W A;  3J7Y W;  2K5W A;  4BA1 I;  3IFD A;  3VYS A;  1HRJ A;  3GTL B;  3A8K E;  3FEW X;  3DEO A;  2QDB A;  4RHR A;  1X3Q A;  3S17 B;  2HUG A;  3Q23 A;  4CJ0 B;  5IGC A;  2EYO A;  5EKK A;  1SMY C;  4KMU C;  2Q8I B;  1STH A;  3Q22 A;  2K5Q A;  5C0X H;  2JYO A;  1WTO A;  2XN9 C;  5CV6 A;  3A7A B;  4KJO A;  3RLF A;  3FDT A;  3I72 A;  1MI2 A;  2BA0 A;  2Q8T A;  3MFG A;  1WTV A;  1JWS D;  2ENB A;  1ENC A;  3TSS A;  2K7V A;  1S5D D;  5LL6 X;  5M3M B;  3K5N A;  3PUX A;  4K6D A;  4Q0F A;  2J7Z A;  2PCF B;  2ZXP A;  3MAQ A;  1CQV A;  2EYF A;  1A3T A;  5C5L A;  2TMP A;  3E5S A;  5CMD A;  3I4N B;  2KOL A;  2AWO A;  2MP1 A;  4BY1 B;  1EEF D;  2XRQ D;  1HA6 A;  1ROD A;  1TY2 A;  1D5Z C;  2IPK D;  2M2L A;  1TQO A;  1R4P B;  1HXY D;  1ILP A;  1LTG D;  1F9P A;  2R3Z A;  1S4Z A;  3D4D A;  1RTN A;  3WDN A;  4G57 A;  2F0G A;  4KI0 A;  3HGB A;  4IQZ A;  4OO1 H;  5EPL A;  4OO1 G;  3NWS A;  5E4W C;  1G6Z A;  1PXU A;  2F0M A;  4DAV A;  2ICE C;  1H9S B;  3OWE B;  3K59 A;  1U9R A;  3H91 A;  4QIW B;  5COR A;  1PFB A;  4OGQ C;  5AFW A;  2KCC A;  2K6A A;  2K04 A;  2FMM A;  1EEI D;  1J8I A;  4HR7 B;  5DEH A;  5KRU A;  4DAP A;  3J7A F;  4C3H B;  3U9S A;  1TWA B;  3KUP A;  1IKM A;  1QCB D;  1FNU A;  4K2L A;  1VMP A;  2RDH A;  2SNM A;  3BDC A;  2YYZ A;  2B2T A;  3GQB A;  5BN4 A;  1LV9 A;  1KDA A;  4KD4 A;  4DNT B;  2N55 A;  1ZYR D;  2EY6 A;  3MXU A;  4AYB B;  2O2L D;  4ZUJ A;  1O80 A;  4G7O C;  1FYC A;  4E6I A;  2PYK A;  1A3U A;  2KVM A;  1JOR A;  5COY A;  4A3G B;  1EZ8 A;  2B2U C;  2EYL A;  1IL8 A;  1A6X A;  4K8I A;  4LAA A;  2NVQ B;  4BS9 A;  5M3F B;  1YNN C;  1KDB A;  2IL8 A;  2F0I A;  1A15 A;  1MSH A;  2EY2 A;  4C3I G;  4B9X A;  3C2P A;  4KHV A;  1BNZ A;  3OMG A;  3AB9 A;  4WJW A;  1CTM A;  1PZK D;  1HHV A;  1DZ1 A;  4ABN A;  5A35 A;  1XXG A;  3CHB D;  2BA1 A;  3VYT A;  3P20 A;  2PW5 A;  1PZI D;  1EYC A;  3TP8 A;  4QMG A;  3M3Y B;  4IUV A;  1GHJ A;  4QUF A;  1SYC A;  1OXU A;  3DUZ A;  1EY0 A;  4F8M A;  3C3L A;  4K5V A;  2XIW A;  1R9T B;  2D9U A;  5C0X I;  4A93 B;  1LO5 D;  1RD9 D;  3T16 A;  1AZP A;  4JBW A;  1RKN A;  4XXE A;  3Q24 A;  1DOL A;  1RJT A;  5D65 A;  2EDG A;  3ZYY X;  3SK8 A;  1EQT A;  4A3I B;  1PTO B;  2C9O A;  1D2B A;  2BOS A;  2ZT9 C;  2E2I B;  3L9A X;  4DXF A;  4IUN A;  4HCS A;  1EIG A;  1CHQ D;  2YU9 B;  1PRT F;  1DM0 B;  5I6Y A;  3ND9 A;  3PO2 B;  2WAC A;  2N88 A;  4OHJ A;  4PMB A;  2RKS A;  5I2X A;  1TR5 A;  5JVG 3;  2Z4H A;  4KJN A;  1X3P A;  1KLU D;  1NR4 A;  3NE5 B;  4KY5 A;  3K57 A;  1Z7T A;  5IGD A;  1EY4 A;  2JA6 B;  2AQ3 B;  4OO1 I;  3FPU B;  3BVZ A;  1AEX A;  1V1P A;  2XWB B;  1W6K A;  1D1K A;  2V4D A;  4ZKB B;  4HMI A;  3K7A B;  1FR3 A;  4FF3 A;  1EOT A;  4WRD A;  1OXX K;  4TQU S;  2B8G A;  1E2Z A;  3A56 A;  1JQY D;  2B2U A;  3NSW A;  4U67 3;  3QB3 A;  1EIH A;  1CHP D;  4RKL A;  4I65 A;  1PRT D;  1IYV A;  4IN3 A;  2RSO A;  3JAM E;  2A6H C;  3P7J A;  4DN4 M;  2R93 B;  3FKI B;  2H4O A;  2MJ8 A;  1B53 A;  2LFN A;  5JEA J;  1LTI D;  3ND8 A;  2ICI A;  1Y1W B;  4XQN A;  5JJZ A;  4ODG A;  5HUR A;  3MFY A;  4QCL A;  1JOQ A;  3GTQ B;  3VA7 A;  1B9M A;  1NSN S;  2F3W A;  1TVX A;  1BCP F;  2IWH A;  3PUW A;  1CFM A;  4RGO S;  1AZQ A;  4A3D B;  1LT6 D;  2RBM A;  1SYD A;  3NPP A;  1EY5 A;  1STB A;  2OEO A;  3D31 A;  1RF2 D;  1ET9 A;  3DWA A;  2BE5 D;  4MHE A;  1SDF A;  2AUK A;  5C44 B;  2RQX A;  1PMR A;  3C1E A;  4BBS B;  1E0B A;  3OPO A;  4HSV A;  1HTL D;  1T5X D;  4KN4 C;  1EYA A;  2X6L A;  1ENF A;  5ELF A;  4IFD H;  3EJI A;  4IFD G;  4O42 A;  4I7Z C;  5I4D A;  3QWN A;  4ZK9 B;  3N6R A;  2L5T A;  5HGT A;  2EVB A;  1I4P A;  1CM9 A;  1M8A A;  2E2J B;  4HMJ A;  2EE1 A;  3J80 E;  2IT1 A;  5CV7 A;  5M9O A;  3ITP A;  3EVQ A;  3NTH A;  4KY6 A;  1BCP D;  1Q8I A;  2VUM B;  2WAQ B;  4YIJ A;  4K8J A;  2C5C A;  4ULL A;  5CV9 A;  3G7L A;  1S5B D;  2JE6 I;  2FIN B;  2IX0 A;  2NVT B;  3VR5 A;  3QOJ A;  1U4M A;  2FFK B;  1U4L A;  2NUC A;  1B44 D;  5C6A A;  1EYD A;  1MD2 D;  4MIU A;  1AN8 A;  1EY9 A;  5JPN C;  3M4Y A;  1F9Q A;  1TWH B;  4XDX A;  5C0X J;  3R2T A;  2B2W C;  3D4R A;  5KND A;  3NHH A;  3DXJ C;  4KY7 A;  3HS0 C;  1HUN A;  3HKZ B;  4EQP A;  3BVM A;  2CW0 D;  2KEE A;  2SDF A;  1HPC A;  4X3K A;  3K0Y A;  1OXV A;  3A8J E;  1C48 A;  4XQQ A;  1KNA A;  1QB5 D;  3NTI A;  1T5E A;  1D5M C;  1STA A;  1KLG D;  2AQ2 B;  4DXG A;  4KK7 A;  1HFN A;  2F0J A;  3QIA A;  2PW7 A;  4IUU A;  3X3N A;  3S1R B;  5E3F A;  1VDZ A;  3MWY W;  4K5X A;  2KJX A;  3S14 B;  4X3S A;  3TME A;  3F2U A;  2HDM A;  5IT9 L;  3I4L A;  1DXM A;  3BG3 A;  3NTK A;  2EY1 A;  1K8M A;  3RMH A;  2X6G A;  1QNK A;  4G7H C;  4IAL A;  1VF5 C;  1LTA D;  4RGM A;  5CBA E;  5CV5 A;  1BF4 A;  4X3U A;  4RH6 A;  3DWQ A;  4EVO A;  3Q6S A;  1D1I A;  2F3V A;  1EWH A;  4R8I A;  1IKL A;  1SYE A;  1BUV T;  2B2Y A;  3M4O B;  3M7N A;  1B50 A;  4ZUI A;  4PV1 C;  3MXP A;  4Q5V A;  1C8C A;  3NK9 A;  2BCO A;  4PQX A;  3OSO A;  2RDF A;  5DNF A;  1SYF A;  1LTB D;  2A69 D;  1STE A;  2WKC A;  5IGB A;  1Y69 U;  2KQ3 A;  4C3I B;  5EKI A;  1EY7 A;  3ERO A;  1X32 A;  4GZY C;  3OIP A;  3J81 E;  2E74 C;  1PLF A;  1S5E D;  3BDL A;  3NQT A;  5EPK A;  2F0H A;  3SDZ A;  2E2D C;  1SEB D;  1G8Z D;  2JEB I;  4L6T B;  2KUM A;  3D4W A;  2B2W A;  2PMZ B;  2TSS A;  4KKS A;  2WP8 J;  4IFD I;  5I2Y A;  2I46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...