1F9SA

Crystal structure of platelet factor 4 mutant 2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
DGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGSKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Comparison of Two Platelet Factor 4 Mutants with the Wild-type Reveals the Epitopes for the Heparin-induced Thrombocytopenia Antibodies
rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords PLATELET FACTOR 4
total genus 10
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9sA00
4QUCA 2B2TA 1VMCA 1DOMA 5CBEE 1E0BA 1QE6A 2EE1A 1SAPA 2KECA 1IKMA 2L4NA 1XX8A 1RHPA 2HDMA 3MWYW 4X3TA 1GUWA 1CM9A 2JP1A 1A15A 2L9HA 2MGSA 2X6GA 4IUVA 4RAUC 5EPJA 1HRJA 4IUUA 2J7ZA 1ML0D 2EOTA 4HSVA 1B2TA 1S4ZA 4OIKA 4MHEA 5D14A 4X3UA 2FMMA 3IL8A 4R8IA 3Q6SA 2B2YA 5EKIA 4IURA 4LMQD 1SDFA 3F2UA 1PLFA 2D9UA 2X6LA 1DOLA 1WTRA 3UI2A 1HFNA 2HDLA 2MJ8A 3I3CA 1F9PA 1KNEA 1PDQA 5AFWA 5T1GA 5E4WC 4CJ2C 1EL0A 4CJ0B 4UAIA 1HUMA 2NWGA 1MGSA 3G7LA 5DNFA 1IKLA 2X69A 1AZQA 4ZKCB 4XT1B 5CORA 1WTQA 1U4RA 1JE4A 2L1BA 2NYZD 1M8AA 2SDFA 1DOKA 5CMDA 4OIJA 1HA6A 2K1BA 2K04A 4IUTA 2B2UC 1HHVA 3MTSA 3SVMA 3R93A 1NAPA 2Q8RE 1WD0A 2KVMA 2MP1A 1EOTA 2DY8A 1O80A 3KBXA 1C8CA 3H91A 3DEOA 1MSHA 1B50A 3DM1A 5D65A 1F9SA 1EQTA 2B2WA 2R3ZA 4RWSC 2B2WC 1QNKA 1RJTA 1PFNA 1RTOA 2BDNA 2DY7A 2KEEA 2EPBA 3QO2A 1SSOA 4ZAIA 2K01A 3HP3A 3LWEA 4U68A 1B3AA 2FHTA 1DZ1A 1ZXTA 1X3PA 2RSNA 5T1IA 1WVLA 4XT3B 2JYOA 3I90A 4HAEA 1XYIA 3I8ZA 5CBAE 4DN4M 4QUFA 2FINB 1WTOA 2K28A 2MPMA 1WTPA 1RTNA 5EPKA 4ZKBB 1EIHA 1QG7A 1ILQA 2H1EA 3IFDA 3DEPA 4MN3A 1RODA 1PFMA 1WD1A 2B2TC 1WTWA 1BNZA 1F2LA 2KUMA 1ILPA 3KUPA 3N52A 2HCIA 1AZPA 1MSGA 2XIWA 1HUNA 1CA5A 1G2TA 4HCSA 2HUGA 3D6WA 1IL8A 4XDXA 1X3QA 1B4OA 1HFGA 2RA4A 3FPUB 1Q3LA 1U4MA 5COYA 4CJ1B 4NW2A 2KOLA 1LV9A 2K03A 3GV3A 1MI2A 5EPLA 1DONA 2N55A 1O7ZA 5E4XA 4O42A 2L12A 1O7YA 1X32A 2NZ1D 2Q8TA 1F9RA 4ZK9B 4RA8A 1G91A 1EIGA 3TN2A 2RVLA 1G2SA 1J8IA 5JJZA 1KNAA 1NCVA 2K05A 1WTVA 4IUQA 1CA6A 4R9WA 2B2VA 1TVXA 3FDTA 3P7JA 2B2VC 1WTXA 5EQ0A 3GV6A 2RSOA 1G6ZA 1B53A 1U4PA 2FFKB 1ESRA 1NR4A 2L11A 1JICA 2B2UA 1BBXC 2CVRA 2FJ2A 2IL8A 1BO0A 1PFBA 4HEDA 2N88A 4X3SA 4ZLTF 1AP0A 2HCCA 2VXWA 3TZDA 1ICWA 1J9OA 5EJWA 4X3KA 1BF4A 1NR2A 3I91A 2B2YC 1VMPA 2KEDA 4IUPA 1U4LA 1F9QA 3ONAB 2M2LA
chains in the Genus database with same CATH superfamily
2A19A 3BVGA 4ME5A 1I4RA 4X62L 3S15B 5JEAG 4G7ZC 1JR0D 2HDMA 4X3TA 2CCZA 2JP1A 3OSOA 2JJQA 1ENCA 5C0XG 5JEAH 4H02A 2UUBQ 2PZUA 2F0PA 1TWHH 1Z6HA 4DXGA 4K5XA 4RMFA 3J81E 2HDLA 1M4VA 2K7VA 1N32Q 1VQJA 3JC66 4OL7A 3WOEA 2L0CA 2OCEA 1TWFB 1AZQA 4XXEA 1VQKA 3SK8A 3K8AA 3HOZH 2AHOB 4QL5A 4A4IA 1HH2P 4JI2Q 4C3JH 1S5ED 1H9RA 1EY6A 2LS01 2R7ZH 1KRSA 3DM3A 4QIWE 1WD0A 3DWAA 2HHHL 1JWSD 1C8CA 3SE0A 2NN6H 2A1AA 3DEOA 1B50A 3CMEA 3CCSA 1F9SA 1ASYA 1LABA 4BBSB 3CCQA 5LL6X 2TSSA 2UU9L 3FKIG 3VYTA 4IFDH 2N49A 1JJ2A 4GOPB 3RD4A 5GAHC 1QG7A 1TWCH 3B6YA 1IBKL 1DGSA 1YITA 1N34Q 1CZGA 4JI0L 1IBLQ 3N52A 1JC7A 2MFIA 2NBFA 3D6WA 3D31A 2JA5B 2NVXH 1EY5A 3A7LA 5M3FH 4HJ5A 1XPUA 1W6KA 2UXBL 1C48A 1TT2A 3M3YH 2C35B 3I4NG 2WFWA 1YHQA 3C1EA 3JAML 3CW2C 4DR7Q 4A3JG 5ELNA 5JJZA 1O78A 3I4MB 4JW0A 4YY3L 5DM73 1O7IA 3NQIA 3F1ZA 4R8NA 2Q2UA 3NXWA 3HKZG 1Y1VH 1GHKA 4JV5Q 4ME3A 5C3EB 3G48A 1YNJD 1QVFA 1ICWA 4MTNA 2EYJA 3SK4A 2K5VA 2AQ2B 4ODGA 1UNSA 4B3TQ 3X3MA 1PH8A 3K59A 2XRSD 2OWOA 1I4GA 1IL2A 2OF1A 2E8GA 3QJYA 1TWCB 2PMZB 4IUVA 2RHQB 3E9HA 1B2TA 3HOVH 4H7BA 2E2IH 2BOSA 4IPDA 1HNXL 4Q0FA 1VQMA 2QGQA 4V0BA 1HFNA 2B63B 3D4DA 3NBHA 4A3BB 3KK7A 2UXBQ 1HUMA 4DAYB 3GTQH 2CQAA 2J0TD 3NE5B 4A75A 4XT1B 2SDFA 3D8GA 3S2HH 3GP7A 2A68C 2ASBA 4K5VA 4IPGA 4IUTA 2F0GA 3NELA 3K5MA 4KY6A 1C9OA 2VUMH 4DK0A 2EYPA 1EOTA 3QOJA 2PW5A 1RTOA 5FLMG 3PO2B 2PO4A 1Q8KA 4I7AA 1ZXTA 4C3HB 1K9MC 2KCMA 1WYDA 4G57A 3SDZA 1X3FA 4Y52H 2KQ3A 3S9WA 2VQFL 1XJVA 1B8AA 1F2LA 4YCVA 4J1MA 2RF4A 4HTHA 1KDBA 3S2DB 3T16A 4L8JA 4POGA 1CA5A 1G2TA 1JE5A 2HUGA 2NVXB 2DNCA 2ZJQA 1UE7A 2EYHA 4NPSA 3UE0A 5BN3A 1K0RA 4IN3A 2RDFA 2PW7A 1F9RA 1M1KC 5C4XB 4DKAC 4DR2L 1CFMA 4DF7A 1H9KA 2VZAA 4HMIA 3I4MH 3NWSA 4UP7A 1D5MC 1V1OA 1CUKA 1AH9A 2BE5C 1HZCA 5GADC 1D5ZC 1KDCA 4XIGS 3PIO3 1I94Q 4KJOA 1E2ZA 1NMGA 3BDCA 1CI3M 1EIYB 5EBDA 3PUYA 1RIPA 4KD3A 3IRBA 3URYA 1F9QA 4HR7B 5LMNW 1QUQB 4G4KA 2VQEQ 3VYRA 2IX1A 5C3WA 3MXNA 1YIJA 2KECA 4RHSA 3GTGB 4JI4Q 4A3MB 4B3RL 1A2UA 4OHJA 2J7ZA 3HOVB 2D2CC 3CCRA 1BCPD 4BA1I 2D9UA 1CQFA 1R9TB 1T5EA 1WCMG 2M00A 4JI1L 3TP6A 1SEBD 1PDQA 1X6OA 4GKKL 2LXKA 4B9XA 3G7LA 2CFMA 2PI2E 2A6ED 1MKHA 3J80E 2F0IA 1LO5D 1SJED 2DGYA 3SVMA 3FKIH 2QKIC 3A56A 4A3JH 2KVMA 3F2BA 4YWMA 1UEBA 2YTXA 3AQQA 3PIP3 3L3OC 4C1NI 4EQOA 2E5LL 4A3LG 2D0OA 5FKAC 3S14H 2DY7A 3TP8A 1EY8A 1LTRD 1VQEA 2R7ZG 4XT3B 1XYIA 4DUZL 3S1QH 1ZKOA 1PH5A 2DNEA 4ZKBB 3HOUG 4KKTA 3N6RA 5ELOA 2V4DA 3GTPB 1KTKA 3K57A 1K3BC 5EBCA 5I4DA 3GTGH 1ILPA 1I4XA 1H9MA 2RCFA 1SROA 3KDFA 3BZKA 1X3QA 2F0TA 1FNWA 3CQZB 4GOPC 3OTOQ 2K03A 5EPLA 5CR3A 1DONA 1BDOA 1C4QA 2L12A 2NTTA 4JK1C 1L0XB 2HD3A 2RVLA 1GUGA 4KHVA 3VR4A 1QOHA 2KENA 3TRZA 1PZKD 1YNXA 2PZTA 4PZ6A 4A3KG 2B2VC 4FYDA 5K36G 4FXDA 3WDNA 3F8TA 4PG3A 5JJIA 2EVBA 3RN2A 4A3IG 1G8ZD 2QF7A 4ABNA 5IT9E 4HEDA 4DAYA 3CC7A 4L63B 1F77A 2CW0D 3TZDA 1NR2A 2E2HB 1XPOA 2IJ0A 1A8VA 4C3HH 4E6IA 2R7DA 4GN5A 3D3RA 4DUYL 1SYEA 5HURA 3C3LA 1XNQQ 3T1YQ 1EQVA 2B39A 2L9HA 2ZXOA 2ICEC 3S1RB 1IBML 3VYUA 1I4PA 2R93G 1N8RC 3J7A5 4AYBB 3CCVA 3K5OA 4A76A 2K5HA 4DV4Q 4Z9CB 1QZHA 1HNWL 1D8LA 1TWHB 4DR5L 1DXMA 3TQYA 2M9VA 1H9JA 3NTHA 4OEMB 1K28A 4LK1C 2NWGA 2MO0A 4OO1G 4O0AA 1NJIC 5K5PA 4GS3A 4C3JB 4MTKA 1JT8A 2FMCA 5KIXA 1PV4A 4PMCA 2SOBA 4ID6A 3ZJYC 1QNKA 1RJTA 2A68D 2EY1A 4BBSH 2C9OA 3T1HL 1R4PB 2KA7A 3GTLB 1PTOH 2R6GA 1XPRA 2OQKA 4H0LC 4OONA 4DV7Q 5KNBA 4DN4M 3PF5A 3P1HA 1RTNA 3O13A 2K5QA 4DUYQ 4EGVA 1WTWA 3D4RA 1Q81C 5IGDA 3L9AX 1UWVA 2G9HD 2BH2A 3OIPA 1ICFB 3UDXA 4KN4C 3H3VI 1IBMQ 1B4OA 1HFGA 2RA4A 4CJ1B 1D6EC 1IHZA 4NW2A 2A8VA 3M3YB 1FYCA 2O4XA 5E4XA 3G71A 4LF5Q 1O7YA 2OTJA 2Q2IA 2A6HD 2UXCL 4MNOA 5IIFA 2NVQH 1EIFA 5M5YB 1KNAA 2IT1A 3A55A 1LM0A 1VQOA 1HZBA 4WORA 5EQ0A 4A3JB 2QCPX 1PXUA 3DXJC 1KAWA 1UUPA 2PNRC 1VF5C 3FVQA 4ZLTF 3FRPB 3A7AB 4LF7L 3K7AB 1EYGA 1BF4A 1HTPA 2B2YC 4UDUC 3RN5A 4L5SA 1N36L 2EXZA 5IYDH 4IQZA 5FO7B 2UUAQ 2E2JB 1JORA 4YWLA 4CKEA 2JA7H 4JI5L 3ULPA 1ZEQX 4XQNA 2L4NA 1PH3A 4FF4A 2K5WA 1HNZQ 5TSSA 1ZYRC 3I70A 4DV3Q 1S5CD 4NXNL 1IXRA 3U50C 1EFID 3IL8A 3C2PA 3FHWA 4BXXH 1AW7A 1XTDA 3BDOA 1GUTA 2NN6I 1F9PA 1PRTD 4B3ML 1ONLA 4UAIA 3I4OA 1LTBD 1YHAA 4A3BH 1IKLA 4X65Q 1B9MA 3JAMi 1STHA 3T53B 1LTLA 1YVCA 2CH4A 1JE4A 3ND9A 4XYOA 1E24A 1M8AA 1K3RA 1SE2A 2K04A 1VQBA 1F2ZA 1HHVA 3S1MH 2F3IA 2JA8B 3EJIA 3RZDH 3KF6A 4LFBQ 3AB9A 3UDIA 3OPOA 1TWAB 3M9BA 1TY2A 2N78A 1J5EQ 2D5DA 5FO8B 3J81j 1A3TA 3M7GA 5C0XI 2VW9A 3PSIA 1D5XC 5T1IA 2JYOA 1OXTA 3JAMc 1I5FA 1CT1D 4JI3L 4B9WA 1F2YA 3PCOB 3NTIA 3U9SA 4NXML 2B2TC 2JA6G 2R92B 1VQCA 4DR1Q 4HJ7A 4DR4Q 4KJNA 3NBHB 3TDQA 2ALYB 3MFYA 2ENBA 1G51A 4RCNA 1EEFD 2D0PA 3L7ZC 1GXDC 2N55A 3K7UC 1LTTD 1YEZA 1TS3A 2WKDA 4R4QA 4A3FH 1K73C 4KK7A 1BBWA 1I50H 3H09A 2VB2X 2VUMG 5JAVA 2SNMA 1NCVA 1E1TA 2CW0C 4A3EH 1TVXA 5M9OA 2I5LX 3F2CA 1WTXA 4A3CG 2NVTB 4TKOB 1SJHD 2HT1A 5C44H 3S1MB 1LTGD 1S72A 4A3BG 4X3SA 3I55A 3R2TA 5KRUA 2Y0SE 4X3KA 1B7YB 1QNUA 1J5EL 1PTOD 4J8QA 2EYFA 3MHBA 3HOVG 1OXVA 5CBEE 3ZYYX 4A3MH 4DU9A 3NBIA 2R61A 4QJFA 1EUJA 4YHHL 1IBKQ 4LF6Q 1JJGA 3P20A 1B9NA 1KRTA 4CKCA 1BQQT 2EQSA 4QQBX 1SDFA 1PLFA 4LAAA 2SEBD 1RF2D 5CV5A 4DR4L 4NB3A 2OXPA 3K0XA 2I46A 4CJ0B 3DMUA 1GUSA 3DHQA 2PQEA 2I5MX 1PTOF 1IZ6A 4GLVB 2ZT9C 2AUJD 5CV6A 4Y7NB 2RHSB 1STBA 1HZ9A 1QCBD 3R93A 1ESFA 2Q8RE 2O5IC 3FKIB 4JPBW 4DR3Q 2KJXA 1GM5A 2GN5A 3SK5A 3I4NH 4RWSC 1B44D 4JI6Q 2ZTEA 5IODA 4DK6C 2JEAI 3IKJA 3KBGA 3HGBA 5G3LD 1DCZA 1Q1EA 3KUPA 3LNNA 3GTJB 3MAQA 4XTCS 4IFDG 2YU9H 2ZM6L 2O2LD 2E2IB 3CKIB 1EYDA 4JBKA 2R92G 2JA6B 4LJZC 3CQZH 3BYYB 1KXLA 3K58A 5IYBH 4H13C 3PV0A 4DK3C 5IWAQ 2VS1A 3VDYA 3G6JB 3HKZB 5J22A 2EYMA 3E0EA 4DV1Q 4JCVE 4OXPA 1TS4A 1WTVA 5LMNL 3AEVA 2K5DA 3M4OB 1B53A 2YTYA 4TVAB 1FVIA 2IX3A 3M85A 1KDAA 4PMWA 2HCCA 1LTID 4B08A 4ZUIA 1FNUA 3CP0A 3Q22A 4N9TA 1HR0Q 1UE6A 1SNQA 3AFPA 1VQGA 2EE1A 3OYYA 2MHVA 1IBLL 1OTCA 4A3GB 3ERSX 5M3MB 5EPJA 4WJWA 1UE5A 1EU4A 1ML0D 1PMRA 3NEMA 1NBWA 4A93H 3H0GB 4BBRH 5I2XA 4X3UA 2FMMA 4XQJA 2OTLA 5FLMH 3S17H 1MJEA 4EQ5A 1FR3A 1QVCA 2PQAB 1SXTA 4K6DA 3WOFA 4A3FB 1ENAA 4K14A 5IGGA 1ASZA 2F0JA 1ENFA 3D0FA 1PRTB 1RKNA 2X69A 4IZ8A 2A74C 1WTQA 2KCTA 1YZ6A 3DWPA 3T13A 1JMCA 4DV1L 2VL6A 5C4HA 4M1UB 2NVTH 2Y0SG 4C2MB 5CV7A 4WFN3 4GKJL 1SRUA 4K2LA 2AUKA 1O80A 2KCNA 3I4NB 2K75A 4A3EG 2B2WA 1GO3E 3QOLA 4GNXB 1SBBB 2MUYA 1SSOA 3GTLH 2L55A 2ZTDA 4TRDA 5DLQE 1STEA 2CWPA 3BDLA 3VYSA 1HZAA 4QUFA 1DJRD 2RDHA 1STGA 2RQXA 4J6HA 1PH6A 4PQXA 4A3GH 1XTCD 2CH4W 3E3XA 2A5HA 4RHRA 1Y8NB 3SXHA 1EQQA 1FJGL 5IGEA 5KNCA 1I6VC 1QVGA 2F0KA 2JA6H 1Q86C 3FPUB 3A8JE 4DXFA 2KOLA 4NDXA 1O7ZA 5F2DA 1R9TH 3HOXB 2QW7A 1K83H 2SNSA 3X3NA 5IP9G 1TIID 2NVQB 3FMCA 4IO9A 4GZYC 1F2MA 2BA0A 5M5YH 1YNJC 5ISRA 2RSOA 1G6ZA 2F52A 1QILA 2MO1A 3EROA 4L5RC 2IWHA 2QDBA 4QCLA 4DNRB 4IUNA 4GOPA 4JYAL 2RDGA 4RGNA 1SYFA 3I91A 4PV1C 3S14B 3H3VC 2E2JH 4OELB 2F3VA 3C1FA 4QUCA 1HQMC 2K32A 1Y8PB 1H95A 1E0BA 1QE6A 4WRDA 1IKMA 1XX8A 4CGYB 2E75C 4ZUJA 1L0WA 3GTPH 1B3QA 4IUUA 1CHQD 5ELEA 4X66L 1YBYA 3H0GH 4HIMA 2AQ1B 1XMOQ 2YU9B 3HOWG 4N8X1 1DM0B 4X6AH 3QIAA 2WAQG 1N33L 4G7HC 3U58A 4A3GG 1NNXA 4QMGA 2A69D 1FJGQ 1YNND 4CJ2C 5C4XH 1TS2A 3NUCA 1MHWC 1VF7A 5IYDG 3L2PA 5CORA 5JPNC 2L1BA 2E76C 1U9RA 1EYAA 3V2TA 3VR3A 4BY1H 4DV6L 1VQ4A 3G6EA 2MP1A 4YY3Q 2F0QA 3HG9A 5JEAJ 4CDFC 4KY7A 5AJ3L 1TU2B 1LT3D 1O7LA 2BDNA 3FPPA 3RUZA 2R93B 3LWEA 4JG2A 1RCVD 5CV8A 1HXYD 4QY7A 1IYUA 3FP9A 4JI4L 3K5LA 5M5WB 5IY0A 1RODA 5LL6S 3T1YL 2KUMA 3MZ5A 2F03A 3HOYB 2Q8IB 3TMEA 1XMQQ 2NB0A 5M3FB 5IP7G 5E3FA 4JBWA 4P71A 1QB5D 3MXUA 4GNXC 2B29A 2LKVA 2F0NA 1EU3A 2A73B 4O42A 1Y1WH 1HNXQ 3S24A 1YJNA 1HNWQ 1SNOA 1EQRA 1LT4D 3Q8DA 4JC0A 1G2SA 4R1JA 2DJGC 3CCLA 3CRLC 1PH1A 3OW2A 1WI5A 4FNFA 3CD6A 1OXSC 4ILWA 2F0UA 4LUOA 5C44B 1VQAA 3NHHA 4KKSA 1XWEA 5HGQA 3A5UA 4RG1A 1Y69U 5M3MG 1FD7D 5FO9B 4AQYQ 1BBUA 3D4WA 1X54A 1EYCA 5JJLA 2JN4A 1SYBA 1SR3A 1ZYRD 1WOCA 1PTOB 3I2ZA 1DOMA 5ELCA 1BCPC 2JXMB 4HMJA 4F7XA 1W2BA 2PI2A 3A8IE 4A3DH 1PH4A 2X6GA 1A15A 5ELDA 1I6HB 1K8GA 2EOTA 4HSVA 2VQFQ 2JA9A 4K5WA 2JSOA 5GROA 3OTOL 2ICIA 3F2UA 1A3UA 1NY4A 1AN8A 2XWBB 1A6XA 3HOXH 1G291 5FLXE 1TQOA 3DLLA 4RGMA 1IW7C 2N3SA 4LFAQ 3J81i 3STBC 3VA5A 4R4OA 4Y7NH 4DR2Q 4IOAA 4A3LH 4QF4A 2QEJC 4OX9L 3STBD 1HR0W 3CCEA 1GKHA 4KMUC 4QB4A 2IPKD 3DM1A 1LYLA 4LUZA 1Y1WG 4F87A 1VQIA 3PO2H 2NN6G 1I94L 4ZAIA 3K7AH 2FHTA 2C5CA 1WVLA 1SYCA 1E1OA 5C6AA 4BY1G 5CBAE 1N36Q 1EZ6A 2UXDL 5GQOA 4TSSA 1ILQA 4CDDC 4B3SQ 1KL9A 1BR9A 1HUNA 3GTJH 2WINB 1YHBA 2A69C 3I56A 3GV3A 1K8AC 3HOUB 2JA8G 1CSPA 1UEAB 2EY5A 2VNUD 5IOCA 2KHIA 4Q5VA 5CYUA 2ZTCA 1STAA 3HEJA 4B3MQ 1CA6A 5D3IB 3UDGA 3P7JA 3CMAA 2QILA 3SHLA 2GVBA 3HOZG 1BOSA 1HJPA 2FJ2A 3BJUA 2K50A 3J80c 3F2DA 3T1HQ 4DR6L 3TP7A 2LSSA 2E5LQ 4RKBA 3KF8A 3E9IA 4LF4L 3QR8A 3HOXG 1GUWA 4DV5L 1PHJA 2I5HA 1HRJA 3SGIA 4EVOA 2ZJPA 3BVMA 4K8JA 4NXMQ 2Z0SA 2OQ0A 5EGTA 5DAUA 4BBRB 4IPCA 3H15A 2AWOA 4OWXB 3M4QA 4LF5L 5C4ZA 1BCPF 5BR8Q 4LF9Q 3J80L 2LXJA 3HKZE 1SNPA 3R3OA 2MNAA 5E4WC 5ELBA 1EY7A 1Y1VG 2F0DA 1CKMA 3EIVA 4PNYA 2R7FA 2PYKA 3RLNA 5CMDA 3KFUA 2K1BA 1Q8IA 5KEEA 3A0JA 4A3EB 1CQVA 1JCKB 4HCEA 2CQOA 3GTOH 3QO2A 5ELFA 2UUAL 1KLGD 2Z6BA 4R4TA 1UAPA 1B3AA 5H1SE 3TS0A 3ULJA 2L5TA 4X62Q 4HIOA 5IT9c 2QA4A 3J7YW 1BVSA 1HNZL 1WTPA 1ET6A 4A3DB 4YIJA 4LUVA 3J7AV 1I6HH 1UE1A 4MN3A 4DV3L 1HCZA 4C3IG 2PQAA 1W3SA 1MBYA 4RKLA 3S16H 4XDXA 3CPWA 2EZVA 1N32L 2F0FA 2UUCQ 2XTIA 1MD2D 1S5FD 3KDFB 1MI2A 2EYLA 2PZWA 2IHFA 3MC0B 5E7NA 2ID0A 1STNA 4A93G 5BR8L 4ZK9B 4LF9L 1EIGA 1LT6D 2EYOA 2QDLA 3OW7A 1J8IA 4IJLA 1K8OA 3ERQA 4HSPA 5DEHA 4CHTB 2K14A 3W5OA 1XXGA 3L0OA 3JAME 2ES2A 3PIPA 1DYQA 1Q46A 1SFOH 2F0OA 2RCNA 5JVG3 1CSQA 4M8AA 4JI3Q 2F4VL 5C3EH 4KY5A 4DR3L 1IYJB 1SNDA 2XNAC 5EJWA 2DN8A 3HKSA 4LFCL 1NSNS 1U4LA 3CF5A 2EXDA 4APVA 4JOIC 4HJ8A 4BWGB 4ALPA 4JOIA 4JI6L 4KI0A 3K80C 4LWCA 4ZYSA 2B2TA 1VMCA 2WACA 4V190 3J7ZC 4DV7L 4HIDA 4I65A 1GUNA 3S1RH 1E7ZA 1BKBA 1RD9D 5D3DA 3BU2A 5C4JH 3ER0A 1PTOC 1QWYA 4OIKA 4ZQ3A 3KJOA 2XN9C 3GO5A 3Q6SA 2B2YA 2WB1E 4LMQD 3KLWA 2NTSA 3PUZA 3S16B 3ULLA 2PPBC 1CZWA 5AFWA 3CXCA 2UUCL 3BS1A 2B63H 1JQYD 3KLRA 3S1NB 4UHVA 1D1KA 2CHBD 5I9PA 4MZ9A 1G6PA 3J80i 3RNUA 1JOQA 2H4OA 3KLSX 1JJCB 4IALA 4EX5A 4BBSG 1HA6A 2B8FA 3R8BA 1OO9B 3IAYA 2VY3A 3V05A 4JV5L 2WKCA 4UY8C 3RZOH 2Z1CA 1NAPA 2JQOA 2ZXPA 4BY1B 1D1IA 3KBXA 1MSHA 4C56C 3WWVA 1VQPA 3VA7A 4B3TL 3PUWA 2K01A 4U68A 1PA6A 1X55A 1DZ1A 2R93H 4K0KQ 2RSNA 5KYLA 4HAEA 4A3FG 3PMFA 4HIKA 2FINB 1TY0A 3OMGA 5I2YA 3S15H 2H1EA 3IFDA 4YHHQ 1WFQA 1PFMA 2AWNA 3A5ZB 3PUVA 4J15A 1WD1A 1KD1C 4IFDI 1V1QA 5M3MH 1PFSA 4OGQC 3QB3A 1VQHA 2NZHA 4DPGA 5KNDA 5LHY1 4JBJA 5C4JB 1CKNA 3RLFA 1Q90A 5FJ8G 1Q3LA 1LV9A 1AE3A 4DV0Q 2NZ1D 4DNTB 4RA8A 3PO3G 1EWHA 1Y1WB 1G91A 3E5SA 3S1NH 1V1PB 3HOWB 2EJGC 1J6QA 1HQRD 3HRZC 2E74C 3KF6B 2HIXA 4JI2L 1LT5D 1NR4A 1VQFA 1JICA 3VR5A 1BBXC 1PYSB 1PH7A 3PQIA 1PFBA 2GA4B 2HHHQ 1AP0A 4P75A 4LFBL 3OIQA 2EY2A 5C44G 3BVZA 4XQQA 2JA7B 3MXNB 1VQNA 2UU9Q 4IFDJ 1PYBA 1SAPA 3R2IA 4AIMA 3UE1A 1RHPA 3T56B 4BY7H 1L0YB 1SE3A 1VQ5A 2ZM6Q 2D62A 5FLXL 1SLJA 5JVH3 1S4ZA 3GD7A 4JI0Q 2YV5A 4R8IA 5EKIA 4IURA 3J81c 4KKUA 4DR1L 5JPMC 3UI2A 5IWAL 2MJ8A 1A63A 3C46A 2K52A 3EVQA 2Y0SB 4IPHA 4DAPA 4DV0L 2VB3X 4OO1I 1DOKA 4O1NA 1YNNC 5FK9C 1P8LA 1SNMA 3NENA 1VCIA 4WJ4A 3RZDB 4CDEC 2XVSA 2F0WA 2WAQE 1ET9A 1B1ZA 1TWAH 4P72A 4DV2L 1L1OC 5I6YA 3OWEB 3FEWX 1EQTA 1U0LA 2LFNA 2BH8A 3CCMA 2B2WC 3BG3A 2KEEA 5C5MA 3PIOA 3NWTA 4GN3B 1NMFA 1H9SB 3HS0C 5IYCH 5BN5A 3VR2A 4MIUA 3S1QB 5EPKA 3A54A 2R92H 4NP5A 2EY6A 3E6ZX 3AYHB 4QIWB 1TWGH 1X9NA 2EIFA 2WB1B 4A93B 2F4IA 2BA1A 5IYCG 2ATWA 2IY5B 5CV9A 5C0XJ 2PNHA 1SE4A 4RCOA 1VDZA 4CDCC 3Q0AA 3K0YA 4FXGC 5J1ZA 2Q8TA 5FOBB 1TXYA 3HOWH 4JVZA 2NVYH 3HOYG 1SN8A 1BUVT 3SEBA 5IT9L 3LX0A 3EFXD 1L2FA 5JJKA 3PO2G 1VQLA 2G9DA 3TP5A 3GTMB 1AEXA 3GDEA 1KQSA 2WIIB 2CVRA 2B3GA 3GTKB 4S3SA 3MFGA 2V1CC 2YYZA 4DV2Q 3AU7A 5AJ3Q 3H94A 3I4LA 4DUZQ 3NP8A 2L15A 2I07B 1K8MA 1V8QA 4L6TB 3W1GA 4OWWB 4DAVA 5C5LA 1N34L 1WCMB 2CKZB 1JB3A 3VR6A 1CHPD 1CM9A 4RAUC 5JOBA 3SK6A 2GVAA 5HY6A 4HJAA 1FNVA 3HZXA 2F0SA 1SE8A 2X6LA 4ULLA 1XMQL 5A2QL 1WTRA 4P73A 3CCJA 4DR7L 4YCWA 3LWUA 1PRTF 3OOCA 4FP5D 3TZUA 4IJHA 2NVYB 3K81C 1FGUA 2NYZD 2WV6D 3A8KE 4EQPA 5KYIA 4JI8Q 4KHPQ 3Q23A 5E1FA 1B70B 1S5BD 1Y1VB 3EN2A 5LMNQ 1KIXA 2EJFC 4EQNA 1LACA 1YJWA 4QGUA 5IE8A 2F1MA 5FJ8H 1N9WA 1A2TA 1CKNB 4F8MA 2EDGA 4AQYL 1Q1BA 3I90A 4FVMA 1IW7D 1HPCA 1S40A 3CAMA 3T51B 1XMOL 1TWGB 3DEPA 1I4HA 3G4SA 1XNRQ 2KCCA 2F0HA 2HCIA 5A35A 1VQ9A 5EKKA 4G7OC 1E2WA 1X56A 4R4IA 3I72A 4HCSA 1IL8A 1X3EA 4DR5Q 2PMZE 1GHJA 5I9OA 4BY7G 1T9HA 4PZ8A 1S3OA 1L1OB 3MEHA 2BCOA 1H9SA 1EY9A 1KAAA 3S2HB 1SMYC 4K2KA 3MXGA 1BXTA 1X3GA 5M5XH 4DV6Q 4C1NK 3H3VH 3M4OH 5I6WA 2EJMA 1LTSD 3GV6A 1PVOA 4JI8L 1CKOA 4KHPL 2XRQD 1SMYD 4NKLA 1CTMA 5A2QE 2QEXA 2IL8A 2Q2TA 4R4CA 4GKJQ 1PZID 2VXWA 1EEID 4P74A 1EY4A 3RMHA 1VMPA 1NUCA 2JA5G 4L5QA 1KABA 1Y8OB 2M2LA 3ONAB 3W2DA 4BBRG 3Q24A 3H0GG 1WCMH 1E3PA 5LMUL 1W6JA 1V9PA 2XSCA 3KOJA 4AYBE 3HOYH 1PYWD 3ND8A 4B3SL 4MHEA 5GAGC 3S17B 1XNRL 1HA5A 2H5XA 3RR5A 4A3MG 3U9OA 1DOLA 3NK9A 3W1BA 1TWFH 1WTHA 4JBMA 5CC4A 2A6HC 4YWKA 3KYHC 1GJXA 1LLRD 2F0LA 3K6OA 4OIJA 2B2UC 4CKBA 4OO1H 4DA2A 3CU7A 3AMUA 1Q7YC 3RZOB 1EY0A 3E0JA 3TEHB 4X64Q 5DM63 3D6CA 1AFPA 4WJ3M 2R3ZA 5L37A 2FXQA 2VQEL 3HP3A 2CWAA 4JI5Q 1I4QA 4JYAQ 1X3PA 1SNCA 2LMCB 3BYTB 4ZCKA 2B63G 4C3IH 1U5KA 2K28A 4I7ZC 4B3RQ 3H6MA 1EIHA 1EWIA 1XNQL 5LMUQ 4NXNQ 3DWQA 4UP8A 4DK1A 1MSGA 4OWTB 4DV5Q 2N8NA 2JA5H 4C3HG 3EA6A 4X66Q 4JI1Q 3AFQA 1R4QB 1E2VA 4GKKQ 1FGBD 4LF8L 4X65L 3NPPA 1N33Q 3TSSA 5C3XA 2E2DC 4DV4L 1AE2A 3I4MG 4ZRZA 3DUZA 1STYA 4UP9A 1OXXK 5M5XB 4OX9Q 2JEBI 2B2VA 4DAMA 3FDTA 5C3EG 3OWFA 3T4AC 4POFA 1TR5A 3V96A 2ZJRA 3KF8B 2LY7A 4GNXA 4FO2A 2OT2A 2N88A 1A62A 3OHXC 4A3KB 4X64L 4RH6A 1M90C 1HTLD 1JOKA 4K8IA 2Q2HA 2NZOA 4IUPA 2RKSA 4GLXA 1KC8C 4JI7Q 4A3CH 1JOOA 4K6LA 1YJ9A 2DJFC 1LTAD 2WAQB 3ICEA 3MA2B 1C0AA 2MGSA 1PRTC 5IGBA 1V1PA 2KHSA 2O5JC 1JWMD 3P75A 5CGKA 5C0XH 3I73A 3K5NA 1GVPA 4KD4A 3I3CA 3CC2A 5T1GA 1C7YA 3KLSA 4LF8Q 2XWJB 4RGTA 1P16A 5FLXc 4A3IH 3BZDB 3QG1A 2I0QA 2UXCQ 1I3QB 4HN7A 4FF3A 3CRKC 4KN7C 1VQ7A 1KHIA 3TBIB 2P5ZX 3NTKA 3CCUA 2DY8A 4DR6Q 3H91A 1SFOB 3GQBA 5IYBG 1PH2A 3CC4A 3U4ZA 1VS0A 5IGFA 1PFNA 3A74A 3MEFA 2B8GA 2EPBA 3NSWA 2F4VQ 3OMCA 4TQUS 5J3BA 2F0VA 2YTVA 1QZGA 5IP7H 1MJCA 4N9PA 2ZXRA 4C3IB 3J7AF 5M5WH 4LFCQ 1PZJD 2J4XA 1WTOA 2OEOA 5NUCA 5M3FG 2Z8LA 4JI7L 4XYQA 1D2BA 1FL0A 2DUDA 4DGZA 4KV6A 5HGTA 1BNZA 3S2DH 4FF2A 1II3A 1MIUA 1L1OA 3PGZA 2RBMA 3RLOA 3PUXA 5C4XG 2AQ3B 2WB1G 2IW3A 3IFTA 3ITPA 4GN4B 3NQTA 2KBNA 4P2CB 2BE5D 4UPAA 2A6EC 4DFAA 2BDOA 4LFAL 3EQLC 2TMPA 4KLKA 4U673 1QJOA 2PCFB 4IUQA 3CHBD 3U4VA 4HJ9A 3M7NA 1TS5A 1LUZA 4GLAC 2JA7G 1Z9FA 3GTMH 1A0IA 4LW1A 3BZCA 1V43A 3GTKH 1JWUD 2L11A 1Q82C 3PO3B 4FXKC 1BO0A 4AH6A 2JA8H 2IHEA 3GTOB 3SR1A 4NMZA 1VQDA 1Z47A 2KEDA 1GOZA 1SMXA 4CBVA 4BXXG 5GAEC 2F0EA 2K5NA 3KJPA 1VQ8A 4H44C 3MWYW 1TKWB 4PMBA 1DD2A 2UXDQ 5D14A 2XGTA 1NTGA 1K0SA 2G5DA 3M4PA 1YI2A 2F3WA 3W3AA 1BCPB 2HQEA 4C3JG 1KNEA 4KHZA 1EL0A 2IX0A 1EFWA 1QUQA 1MGSA 5DNFA 5J39A 4F88A 1Q12A 2HQLA 4ZKCB 4O2DA 2Z4IA 1Y14B 5KGUA 1I50B 1CK1A 1U4RA 1I3QH 4FDBA 1WJJA 1SYDA 5EKLA 3TREA 3MTSA 2JE6I 4PZ7A 4RFBA 4LNQA 4C2MH 3MVVA 4LF7Q 4KTAA 2R7ZB 4A3KH 2F0MA 3HFZB 4BA2I 5D65A 5IP9H 1Z7TA 1EWCA 4DNIA 1E22A 1HR0L 1VQ6A 4AYBG 1EOVA 4YCUA 4IOCA 1GUOA 3J81L 1KLUD 2KHJA 3CPFA 3I8ZA 1OXUA 3LGJA 2Z4HA 2HIVA 2K6AA 4N8FA 2MPMA 1X65A 2K33A 4LF4Q 2UUBL 2Z9HA 2NUCA 3M4YA 3MXPA 5G3LF 1AZPA 4BY7B 2XIWA 1S5DD 1RDPD 1D7QA 2K4KA 5COYA 4LF6L 1U4MA 1A3VA 3HOUH 1EZ8A 5K36H 4A3DG 1IYVA 3TS2A 5BN4A 4BS9A 3UDFA 1X32A 1K83B 4A3IB 3HOZB 1SYGA 5CV4A 1NE3A 3TN2A 3GTQB 4FF1A 2AMCB 2K05A 4R9WA 1PH9A 3I7FA 4L5TA 1T5XD 3PO3H 1U4PA 2FFKB 1ESRA 2B2UA 2Z6KC 2VUMB 2Z6KA 3EBEA 5IGCA 1JB7A 2E2HH 1GD7A 4K0KL 2JK8A 1J9OA 2AKWB 3PF4A 3QWNA 1RL2A 2MQHA 2WP8J 4RGOS 5EAYA
chains in the Genus database with same CATH topology
3BVGA 4ME5A 1I4RA 3S15B 5JEAG 4G7ZC 1JR0D 2HDMA 4X3TA 2JP1A 3OSOA 5C0XG 1ENCA 5JEAH 2PZUA 2F0PA 1Z6HA 4DXGA 4K5XA 3J81E 2HDLA 1M4VA 2K7VA 4OL7A 3WOEA 2L0CA 1TWFB 1AZQA 4XXEA 3SK8A 1S5ED 1H9RA 1EY6A 2LS01 1WD0A 3DWAA 1JWSD 1C8CA 3SE0A 2NN6H 3DEOA 1B50A 1F9SA 1LABA 4BBSB 5LL6X 2TSSA 3VYTA 4IFDH 3RD4A 1QG7A 1CZGA 3N52A 1JC7A 2NBFA 3D6WA 3D31A 2JA5B 1EY5A 3A7LA 1W6KA 1C48A 1TT2A 3C1EA 3JAML 5JJZA 1O78A 3I4MB 5DM73 3NQIA 4R8NA 3NXWA 1GHKA 5C3EB 1YNJD 1ICWA 2EYJA 3SK4A 2AQ2B 4ODGA 1UNSA 3X3MA 3K59A 2XRSD 1I4GA 2OF1A 3QJYA 4IUVA 1TWCB 2PMZB 1B2TA 4H7BA 2BOSA 4Q0FA 4V0BA 1HFNA 2B63B 3D4DA 3NBHA 4A3BB 3KK7A 1HUMA 2CQAA 2J0TD 3NE5B 4XT1B 2SDFA 3D8GA 3GP7A 2A68C 4K5VA 4IUTA 2F0GA 3K5MA 4KY6A 4DK0A 2EYPA 1EOTA 3QOJA 2PW5A 1RTOA 3PO2B 2PO4A 1ZXTA 4C3HB 4G57A 3SDZA 2KQ3A 3S9WA 1F2LA 4J1MA 4HTHA 1KDBA 3S2DB 3T16A 4L8JA 1CA5A 1G2TA 2HUGA 2NVXB 2DNCA 2EYHA 5BN3A 4IN3A 2RDFA 2PW7A 1F9RA 5C4XB 1CFMA 4DF7A 1H9KA 4HMIA 3NWSA 1D5MC 1V1OA 2BE5C 1D5ZC 1KDCA 4XIGS 3PIO3 4KJOA 1E2ZA 3BDCA 1CI3M 5EBDA 3PUYA 4KD3A 3URYA 1F9QA 4HR7B 4G4KA 2IX1A 3VYRA 5C3WA 3MXNA 2KECA 4RHSA 3GTGB 4A3MB 1A2UA 4OHJA 2J7ZA 3HOVB 2D2CC 1BCPD 4BA1I 2D9UA 1CQFA 1R9TB 1T5EA 2M00A 3TP6A 1SEBD 1PDQA 4B9XA 3G7LA 2A6ED 3J80E 2F0IA 1LO5D 1SJED 3SVMA 2QKIC 3A56A 2KVMA 3PIP3 3L3OC 4C1NI 4EQOA 5FKAC 2DY7A 3TP8A 1EY8A 1LTRD 4XT3B 1XYIA 1ZKOA 2DNEA 4ZKBB 4KKTA 3N6RA 2V4DA 3GTPB 1KTKA 3K57A 5EBCA 5I4DA 1ILPA 1I4XA 1H9MA 1X3QA 2F0TA 1FNWA 3CQZB 2K03A 5EPLA 5CR3A 1DONA 1BDOA 1C4QA 2L12A 2NTTA 4JK1C 1L0XB 2RVLA 1GUGA 4KHVA 3VR4A 1QOHA 1PZKD 2PZTA 4FYDA 2B2VC 5K36G 4FXDA 3WDNA 2EVBA 1G8ZD 2QF7A 4ABNA 5IT9E 4HEDA 4L63B 1F77A 2CW0D 3TZDA 1NR2A 2E2HB 2IJ0A 4E6IA 3D3RA 1SYEA 5HURA 3C3LA 1EQVA 2B39A 2L9HA 2ZXOA 2ICEC 3S1RB 3VYUA 1I4PA 4AYBB 3K5OA 4Z9CB 1TWHB 1DXMA 2M9VA 1H9JA 3NTHA 4LK1C 2NWGA 4OO1G 5K5PA 4C3JB 2FMCA 5KIXA 4PMCA 2SOBA 4ID6A 1QNKA 1RJTA 2A68D 2EY1A 2C9OA 1R4PB 2KA7A 3GTLB 1PTOH 2R6GA 4H0LC 5KNBA 4DN4M 3P1HA 1RTNA 3O13A 2K5QA 4EGVA 1WTWA 3D4RA 5IGDA 3L9AX 2G9HD 3OIPA 4KN4C 4CJ1B 1B4OA 1HFGA 2RA4A 1D6EC 1IHZA 4NW2A 3M3YB 1FYCA 2O4XA 5E4XA 1O7YA 2A6HD 5IIFA 5M5YB 1KNAA 2IT1A 3A55A 4WORA 5EQ0A 4A3JB 2QCPX 1PXUA 3DXJC 1UUPA 2PNRC 1VF5C 3FVQA 4ZLTF 3FRPB 3A7AB 3K7AB 1BF4A 1HTPA 2B2YC 4UDUC 2EXZA 4IQZA 5FO7B 2E2JB 1JORA 4CKEA 1ZEQX 4XQNA 2L4NA 4FF4A 2K5WA 5TSSA 1ZYRC 3I70A 1S5CD 1EFID 3IL8A 3C2PA 1AW7A 3BDOA 1GUTA 2NN6I 1F9PA 1PRTD 1ONLA 4UAIA 1LTBD 1IKLA 1B9MA 1STHA 3T53B 1JE4A 3ND9A 4XYOA 1M8AA 1SE2A 2K04A 1F2ZA 1HHVA 2JA8B 3EJIA 3AB9A 3OPOA 1TWAB 1TY2A 2D5DA 5FO8B 1A3TA 3M7GA 5C0XI 1D5XC 5T1IA 2JYOA 1OXTA 1CT1D 4B9WA 1F2YA 3NTIA 3U9SA 2B2TC 2R92B 4KJNA 3TDQA 3MFYA 2ENBA 4RCNA 1EEFD 3L7ZC 1GXDC 2N55A 1LTTD 1TS3A 2WKDA 4KK7A 3H09A 2VB2X 5JAVA 2SNMA 1NCVA 2CW0C 1TVXA 5M9OA 1WTXA 2NVTB 4TKOB 1SJHD 3S1MB 1LTGD 4X3SA 3R2TA 5KRUA 4X3KA 1QNUA 1PTOD 4J8QA 2EYFA 3MHBA 1OXVA 5CBEE 3ZYYX 4DU9A 3NBIA 2R61A 3P20A 1B9NA 4CKCA 1BQQT 1SDFA 1PLFA 4LAAA 2SEBD 1RF2D 5CV5A 2OXPA 2I46A 4CJ0B 3DMUA 1GUSA 3DHQA 2PQEA 1PTOF 2ZT9C 2AUJD 5CV6A 4Y7NB 1STBA 1QCBD 3R93A 1ESFA 2Q8RE 2O5IC 3FKIB 2KJXA 3SK5A 4RWSC 1B44D 5IODA 2JEAI 3IKJA 3KBGA 3HGBA 5G3LD 1DCZA 1Q1EA 3KUPA 3LNNA 3GTJB 3MAQA 4XTCS 4IFDG 2O2LD 2E2IB 3CKIB 1EYDA 2JA6B 4LJZC 3BYYB 3K58A 4H13C 3PV0A 3G6JB 3HKZB 5J22A 2EYMA 1TS4A 1WTVA 2K5DA 3M4OB 1B53A 2IX3A 3M85A 1KDAA 4PMWA 2HCCA 1LTID 4B08A 4ZUIA 1FNUA 3Q22A 4N9TA 1SNQA 2EE1A 2MHVA 4A3GB 5M3MB 5EPJA 4WJWA 1EU4A 1ML0D 1PMRA 3H0GB 5I2XA 4X3UA 2FMMA 4XQJA 1FR3A 4K6DA 1SXTA 3WOFA 4A3FB 1ENAA 4K14A 5IGGA 2F0JA 1ENFA 1PRTB 1RKNA 2X69A 4IZ8A 2A74C 1WTQA 3DWPA 3T13A 5C4HA 4M1UB 4C2MB 5CV7A 4WFN3 4K2LA 2AUKA 1O80A 2KCNA 3I4NB 2B2WA 3QOLA 1SBBB 2MUYA 1SSOA 2L55A 4TRDA 1STEA 3BDLA 3VYSA 4QUFA 1DJRD 2RDHA 1STGA 2RQXA 4J6HA 4PQXA 1XTCD 2A5HA 4RHRA 1Y8NB 3SXHA 5IGEA 5KNCA 1I6VC 2F0KA 3FPUB 3A8JE 4DXFA 2KOLA 4NDXA 1O7ZA 5F2DA 3HOXB 2SNSA 3X3NA 1TIID 2NVQB 3FMCA 4GZYC 1F2MA 2BA0A 1YNJC 5ISRA 2RSOA 1G6ZA 1QILA 3EROA 2IWHA 2QDBA 4QCLA 4DNRB 4IUNA 2RDGA 4RGNA 1SYFA 3I91A 4PV1C 3S14B 3H3VC 2F3VA 3C1FA 4QUCA 1HQMC 2K32A 1Y8PB 1E0BA 1QE6A 4WRDA 1IKMA 1XX8A 4CGYB 2E75C 4ZUJA 4IUUA 1CHQD 5ELEA 2AQ1B 2YU9B 1DM0B 3QIAA 4G7HC 4QMGA 2A69D 1YNND 4CJ2C 1TS2A 3NUCA 1VF7A 5CORA 5JPNC 2L1BA 2E76C 1U9RA 1EYAA 3V2TA 3VR3A 2MP1A 2F0QA 3HG9A 5JEAJ 4KY7A 1TU2B 1LT3D 1O7LA 2BDNA 3FPPA 3RUZA 2R93B 3LWEA 1RCVD 5CV8A 1HXYD 1IYUA 3K5LA 5M5WB 1RODA 5LL6S 2KUMA 3MZ5A 2F03A 3HOYB 2Q8IB 3TMEA 2NB0A 5M3FB 5E3FA 4JBWA 1QB5D 3MXUA 2LKVA 2F0NA 1EU3A 2A73B 4O42A 1SNOA 1LT4D 1G2SA 3CRLC 4FNFA 1OXSC 4ILWA 2F0UA 5C44B 3NHHA 4KKSA 1XWEA 1Y69U 1FD7D 5FO9B 3D4WA 1EYCA 1SYBA 1ZYRD 1PTOB 1DOMA 5ELCA 1BCPC 2JXMB 4HMJA 4F7XA 3A8IE 2X6GA 1A15A 5ELDA 1I6HB 2EOTA 4HSVA 4K5WA 2JSOA 2ICIA 3F2UA 1A3UA 1AN8A 2XWBB 1A6XA 1G291 5FLXE 1TQOA 4RGMA 1IW7C 3VA5A 4QF4A 2QEJC 4KMUC 4QB4A 2IPKD 3DM1A 4F87A 2NN6G 4ZAIA 2FHTA 2C5CA 1WVLA 1SYCA 5C6AA 5CBAE 1EZ6A 4TSSA 1ILQA 1BR9A 1HUNA 2WINB 2A69C 3GV3A 3HOUB 1UEAB 2EY5A 2VNUD 5IOCA 4Q5VA 5CYUA 1STAA 3HEJA 1CA6A 5D3IB 3P7JA 2QILA 3SHLA 1BOSA 2FJ2A 3TP7A 4RKBA 3KF8A 1GUWA 1HRJA 4EVOA 3BVMA 4K8JA 5EGTA 5DAUA 4BBRB 2AWOA 5C4ZA 1BCPF 3J80L 3R3OA 1SNPA 5E4WC 5ELBA 1EY7A 2F0DA 4PNYA 2PYKA 5CMDA 2K1BA 1Q8IA 5KEEA 4A3EB 1CQVA 1JCKB 4HCEA 3QO2A 5ELFA 1KLGD 1UAPA 1B3AA 2L5TA 3J7YW 1WTPA 1ET6A 4A3DB 4YIJA 3J7AV 4MN3A 1HCZA 4C3IG 1MBYA 4RKLA 4XDXA 2EZVA 2F0FA 1MD2D 1S5FD 1MI2A 2EYLA 2PZWA 3MC0B 2ID0A 1STNA 4ZK9B 1EIGA 1LT6D 2EYOA 3OW7A 1J8IA 1K8OA 3ERQA 4HSPA 5DEHA 4CHTB 1XXGA 3JAME 1DYQA 2F0OA 5JVG3 4M8AA 4KY5A 1SNDA 2XNAC 5EJWA 2DN8A 1NSNS 1U4LA 4BWGB 4KI0A 4ZYSA 2B2TA 1VMCA 2WACA 4V190 4I65A 1GUNA 1RD9D 5D3DA 1PTOC 1QWYA 4OIKA 4ZQ3A 2XN9C 3GO5A 3Q6SA 2B2YA 4LMQD 2NTSA 3PUZA 3S16B 2PPBC 1CZWA 5AFWA 3BS1A 1JQYD 3KLRA 3S1NB 1D1KA 2CHBD 5I9PA 1JOQA 2H4OA 3KLSX 4IALA 1HA6A 2B8FA 3R8BA 1OO9B 3IAYA 3V05A 2WKCA 2Z1CA 1NAPA 2ZXPA 4BY1B 1D1IA 3KBXA 1MSHA 4C56C 3VA7A 3PUWA 2K01A 4U68A 1DZ1A 2RSNA 5KYLA 4HAEA 3PMFA 2FINB 5I2YA 1TY0A 3OMGA 2H1EA 3IFDA 2AWNA 1PFMA 1WD1A 3PUVA 4IFDI 4OGQC 3QB3A 5KNDA 5LHY1 5C4JB 3RLFA 1Q90A 1Q3LA 1LV9A 2NZ1D 4DNTB 4RA8A 1G91A 1EWHA 1Y1WB 3E5SA 1V1PB 3HOWB 2EJGC 1HQRD 3HRZC 2E74C 1LT5D 1NR4A 1JICA 3VR5A 1BBXC 1PFBA 2GA4B 1AP0A 3OIQA 2EY2A 3BVZA 4XQQA 2JA7B 4IFDJ 1SAPA 3R2IA 1RHPA 3T56B 1L0YB 1SE3A 2D62A 5FLXL 5JVH3 1S4ZA 3GD7A 4R8IA 5EKIA 4IURA 4KKUA 5JPMC 3UI2A 2MJ8A 3C46A 3EVQA 2Y0SB 4DAPA 2VB3X 4OO1I 1DOKA 4O1NA 1YNNC 5FK9C 1SNMA 1VCIA 3RZDB 2XVSA 2F0WA 1ET9A 1B1ZA 5I6YA 3OWEB 3FEWX 1EQTA 2LFNA 2B2WC 3BG3A 2KEEA 5C5MA 3NWTA 1H9SB 3HS0C 5BN5A 3VR2A 4MIUA 3S1QB 5EPKA 3A54A 4NP5A 2EY6A 3E6ZX 4QIWB 2WB1B 4A93B 2F4IA 2BA1A 5CV9A 5C0XJ 1SE4A 4RCOA 1VDZA 3Q0AA 3K0YA 4FXGC 5J1ZA 2Q8TA 5FOBB 1BUVT 3SEBA 5IT9L 3LX0A 3EFXD 2G9DA 3TP5A 3GTMB 1AEXA 2WIIB 2CVRA 3GTKB 4S3SA 3MFGA 2YYZA 3AU7A 3H94A 3I4LA 3NP8A 2I07B 1K8MA 1V8QA 4L6TB 4DAVA 5C5LA 1WCMB 1JB3A 3VR6A 1CHPD 1CM9A 4RAUC 5JOBA 3SK6A 1FNVA 3HZXA 2F0SA 2X6LA 4ULLA 5A2QL 1WTRA 3LWUA 1PRTF 3OOCA 4FP5D 3TZUA 2NVYB 2NYZD 2WV6D 3A8KE 4EQPA 5KYIA 3Q23A 5E1FA 1S5BD 1Y1VB 2EJFC 4EQNA 1LACA 2F1MA 1A2TA 4F8MA 2EDGA 1Q1BA 3I90A 4FVMA 1IW7D 1HPCA 3T51B 1TWGB 3DEPA 1I4HA 2KCCA 2F0HA 2HCIA 5A35A 5EKKA 4G7OC 1E2WA 3I72A 4HCSA 1IL8A 1GHJA 5I9OA 3MEHA 2BCOA 1H9SA 1EY9A 1KAAA 3S2HB 1SMYC 4K2KA 3MXGA 1BXTA 4C1NK 5I6WA 2EJMA 1LTSD 3GV6A 2XRQD 1SMYD 4NKLA 1CTMA 5A2QE 2IL8A 1PZID 2VXWA 1EEID 1EY4A 3RMHA 1VMPA 1NUCA 1KABA 1Y8OB 2M2LA 3ONAB 3W2DA 3Q24A 1W6JA 2XSCA 1PYWD 3ND8A 4MHEA 3S17B 1HA5A 3U9OA 1DOLA 3NK9A 5CC4A 2A6HC 1GJXA 1LLRD 2F0LA 3K6OA 4OIJA 2B2UC 4CKBA 4OO1H 4DA2A 3CU7A 3AMUA 3RZOB 1EY0A 3E0JA 5DM63 3D6CA 1AFPA 2R3ZA 3HP3A 1I4QA 1X3PA 1SNCA 2LMCB 3BYTB 2K28A 4I7ZC 3H6MA 1EIHA 3DWQA 4DK1A 1MSGA 4C3HG 3EA6A 1R4QB 1E2VA 1FGBD 3NPPA 3TSSA 5C3XA 2E2DC 4ZRZA 3DUZA 1STYA 1OXXK 5M5XB 2JEBI 2B2VA 3FDTA 3OWFA 3T4AC 1TR5A 3V96A 2LY7A 4FO2A 2OT2A 2N88A 3OHXC 4A3KB 4RH6A 1HTLD 1JOKA 4IUPA 4K8IA 2RKSA 1JOOA 4K6LA 1LTAD 2WAQB 3MA2B 2MGSA 1PRTC 5IGBA 1V1PA 2KHSA 2O5JC 1JWMD 3P75A 5CGKA 5C0XH 3I73A 3K5NA 4KD4A 3I3CA 5T1GA 3KLSA 2XWJB 4RGTA 3BZDB 3QG1A 1I3QB 4HN7A 4FF3A 3CRKC 4KN7C 3TBIB 3NTKA 2DY8A 3H91A 1SFOB 3GQBA 5IGFA 1PFNA 2B8GA 2EPBA 3NSWA 3OMCA 4TQUS 2F0VA 4N9PA 2ZXRA 4C3IB 3J7AF 1PZJD 2J4XA 1WTOA 2OEOA 5NUCA 2Z8LA 4XYQA 1D2BA 4DGZA 4KV6A 5HGTA 1BNZA 4FF2A 1II3A 2RBMA 3PUXA 2AQ3B 2IW3A 3IFTA 3ITPA 3NQTA 4P2CB 2BE5D 2A6EC 4DFAA 2BDOA 3EQLC 2TMPA 4U673 1QJOA 2PCFB 4IUQA 3M7NA 3CHBD 1TS5A 1V43A 1JWUD 2L11A 3PO3B 4FXKC 1BO0A 3GTOB 3SR1A 4NMZA 1Z47A 2KEDA 1GOZA 4CBVA 2F0EA 4H44C 3MWYW 1TKWB 4PMBA 1DD2A 5D14A 2F3WA 3W3AA 1BCPB 2HQEA 4C3JG 1KNEA 4KHZA 1EL0A 2IX0A 1MGSA 5DNFA 5J39A 4F88A 1Q12A 4ZKCB 2Z4IA 5KGUA 1I50B 1CK1A 1U4RA 5EKLA 1SYDA 3MTSA 2JE6I 4RFBA 3MVVA 4KTAA 2R7ZB 2F0MA 4BA2I 5D65A 1Z7TA 1EWCA 1GUOA 3J81L 1KLUD 3I8ZA 1OXUA 2Z4HA 2K6AA 2MPMA 2K33A 2NUCA 3M4YA 3MXPA 5G3LF 1AZPA 4BY7B 2XIWA 1S5DD 1RDPD 5COYA 1U4MA 1A3VA 1EZ8A 5K36H 1IYVA 5BN4A 4BS9A 1X32A 1K83B 4A3IB 3HOZB 1SYGA 5CV4A 3TN2A 3GTQB 4FF1A 2K05A 4R9WA 1T5XD 1U4PA 2FFKB 1ESRA 2B2UA 2VUMB 5IGCA 1J9OA 3QWNA 2WP8J 4DAYA 4RGOS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QUC A;  2B2T A;  1VMC A;  1DOM A;  5CBE E;  1E0B A;  1QE6 A;  2EE1 A;  1SAP A;  2KEC A;  1IKM A;  2L4N A;  1XX8 A;  1RHP A;  2HDM A;  3MWY W;  4X3T A;  1GUW A;  1CM9 A;  2JP1 A;  1A15 A;  2L9H A;  2MGS A;  2X6G A;  4IUV A;  4RAU C;  5EPJ A;  1HRJ A;  4IUU A;  2J7Z A;  1ML0 D;  2EOT A;  4HSV A;  1B2T A;  1S4Z A;  4OIK A;  4MHE A;  5D14 A;  4X3U A;  2FMM A;  3IL8 A;  4R8I A;  3Q6S A;  2B2Y A;  5EKI A;  4IUR A;  4LMQ D;  1SDF A;  3F2U A;  1PLF A;  2D9U A;  2X6L A;  1DOL A;  1WTR A;  3UI2 A;  1HFN A;  2HDL A;  2MJ8 A;  3I3C A;  1F9P A;  1KNE A;  1PDQ A;  5AFW A;  5T1G A;  5E4W C;  4CJ2 C;  1EL0 A;  4CJ0 B;  4UAI A;  1HUM A;  2NWG A;  1MGS A;  3G7L A;  5DNF A;  1IKL A;  2X69 A;  1AZQ A;  4ZKC B;  4XT1 B;  5COR A;  1WTQ A;  1U4R A;  1JE4 A;  2L1B A;  2NYZ D;  1M8A A;  2SDF A;  1DOK A;  5CMD A;  4OIJ A;  1HA6 A;  2K1B A;  2K04 A;  4IUT A;  2B2U C;  1HHV A;  3MTS A;  3SVM A;  3R93 A;  1NAP A;  2Q8R E;  1WD0 A;  2KVM A;  2MP1 A;  1EOT A;  2DY8 A;  1O80 A;  3KBX A;  1C8C A;  3H91 A;  3DEO A;  1MSH A;  1B50 A;  3DM1 A;  5D65 A;  1F9S A;  1EQT A;  2B2W A;  2R3Z A;  4RWS C;  2B2W C;  1QNK A;  1RJT A;  1PFN A;  1RTO A;  2BDN A;  2DY7 A;  2KEE A;  2EPB A;  3QO2 A;  1SSO A;  4ZAI A;  2K01 A;  3HP3 A;  3LWE A;  4U68 A;  1B3A A;  2FHT A;  1DZ1 A;  1ZXT A;  1X3P A;  2RSN A;  5T1I A;  1WVL A;  4XT3 B;  2JYO A;  3I90 A;  4HAE A;  1XYI A;  3I8Z A;  5CBA E;  4DN4 M;  4QUF A;  2FIN B;  1WTO A;  2K28 A;  2MPM A;  1WTP A;  1RTN A;  5EPK A;  4ZKB B;  1EIH A;  1QG7 A;  1ILQ A;  2H1E A;  3IFD A;  3DEP A;  4MN3 A;  1ROD A;  1PFM A;  1WD1 A;  2B2T C;  1WTW A;  1BNZ A;  1F2L A;  2KUM A;  1ILP A;  3KUP A;  3N52 A;  2HCI A;  1AZP A;  1MSG A;  2XIW A;  1HUN A;  1CA5 A;  1G2T A;  4HCS A;  2HUG A;  3D6W A;  1IL8 A;  4XDX A;  1X3Q A;  1B4O A;  1HFG A;  2RA4 A;  3FPU B;  1Q3L A;  1U4M A;  5COY A;  4CJ1 B;  4NW2 A;  2KOL A;  1LV9 A;  2K03 A;  3GV3 A;  1MI2 A;  5EPL A;  1DON A;  2N55 A;  1O7Z A;  5E4X A;  4O42 A;  2L12 A;  1O7Y A;  1X32 A;  2NZ1 D;  2Q8T A;  1F9R A;  4ZK9 B;  4RA8 A;  1G91 A;  1EIG A;  3TN2 A;  2RVL A;  1G2S A;  1J8I A;  5JJZ A;  1KNA A;  1NCV A;  2K05 A;  1WTV A;  4IUQ A;  1CA6 A;  4R9W A;  2B2V A;  1TVX A;  3FDT A;  3P7J A;  2B2V C;  1WTX A;  5EQ0 A;  3GV6 A;  2RSO A;  1G6Z A;  1B53 A;  1U4P A;  2FFK B;  1ESR A;  1NR4 A;  2L11 A;  1JIC A;  2B2U A;  1BBX C;  2CVR A;  2FJ2 A;  2IL8 A;  1BO0 A;  1PFB A;  4HED A;  2N88 A;  4X3S A;  4ZLT F;  1AP0 A;  2HCC A;  2VXW A;  3TZD A;  1ICW A;  1J9O A;  5EJW A;  4X3K A;  1BF4 A;  1NR2 A;  3I91 A;  2B2Y C;  1VMP A;  2KED A;  4IUP A;  1U4L A;  1F9Q A;  3ONA B;  2M2L A; 
#chains in the Genus database with same CATH topology
 2A19 A;  3BVG A;  4ME5 A;  1I4R A;  4X62 L;  3S15 B;  5JEA G;  4G7Z C;  1JR0 D;  2HDM A;  4X3T A;  2CCZ A;  2JP1 A;  3OSO A;  2JJQ A;  1ENC A;  5C0X G;  5JEA H;  4H02 A;  2UUB Q;  2PZU A;  2F0P A;  1TWH H;  1Z6H A;  4DXG A;  4K5X A;  4RMF A;  3J81 E;  2HDL A;  1M4V A;  2K7V A;  1N32 Q;  1VQJ A;  3JC6 6;  4OL7 A;  3WOE A;  2L0C A;  2OCE A;  1TWF B;  1AZQ A;  4XXE A;  1VQK A;  3SK8 A;  3K8A A;  3HOZ H;  2AHO B;  4QL5 A;  4A4I A;  1HH2 P;  4JI2 Q;  4C3J H;  1S5E D;  1H9R A;  1EY6 A;  2LS0 1;  2R7Z H;  1KRS A;  3DM3 A;  4QIW E;  1WD0 A;  3DWA A;  2HHH L;  1JWS D;  1C8C A;  3SE0 A;  2NN6 H;  2A1A A;  3DEO A;  1B50 A;  3CME A;  3CCS A;  1F9S A;  1ASY A;  1LAB A;  4BBS B;  3CCQ A;  5LL6 X;  2TSS A;  2UU9 L;  3FKI G;  3VYT A;  4IFD H;  2N49 A;  1JJ2 A;  4GOP B;  3RD4 A;  5GAH C;  1QG7 A;  1TWC H;  3B6Y A;  1IBK L;  1DGS A;  1YIT A;  1N34 Q;  1CZG A;  4JI0 L;  1IBL Q;  3N52 A;  1JC7 A;  2MFI A;  2NBF A;  3D6W A;  3D31 A;  2JA5 B;  2NVX H;  1EY5 A;  3A7L A;  5M3F H;  4HJ5 A;  1XPU A;  1W6K A;  2UXB L;  1C48 A;  1TT2 A;  3M3Y H;  2C35 B;  3I4N G;  2WFW A;  1YHQ A;  3C1E A;  3JAM L;  3CW2 C;  4DR7 Q;  4A3J G;  5ELN A;  5JJZ A;  1O78 A;  3I4M B;  4JW0 A;  4YY3 L;  5DM7 3;  1O7I A;  3NQI A;  3F1Z A;  4R8N A;  2Q2U A;  3NXW A;  3HKZ G;  1Y1V H;  1GHK A;  4JV5 Q;  4ME3 A;  5C3E B;  3G48 A;  1YNJ D;  1QVF A;  1ICW A;  4MTN A;  2EYJ A;  3SK4 A;  2K5V A;  2AQ2 B;  4ODG A;  1UNS A;  4B3T Q;  3X3M A;  1PH8 A;  3K59 A;  2XRS D;  2OWO A;  1I4G A;  1IL2 A;  2OF1 A;  2E8G A;  3QJY A;  1TWC B;  2PMZ B;  4IUV A;  2RHQ B;  3E9H A;  1B2T A;  3HOV H;  4H7B A;  2E2I H;  2BOS A;  4IPD A;  1HNX L;  4Q0F A;  1VQM A;  2QGQ A;  4V0B A;  1HFN A;  2B63 B;  3D4D A;  3NBH A;  4A3B B;  3KK7 A;  2UXB Q;  1HUM A;  4DAY B;  3GTQ H;  2CQA A;  2J0T D;  3NE5 B;  4A75 A;  4XT1 B;  2SDF A;  3D8G A;  3S2H H;  3GP7 A;  2A68 C;  2ASB A;  4K5V A;  4IPG A;  4IUT A;  2F0G A;  3NEL A;  3K5M A;  4KY6 A;  1C9O A;  2VUM H;  4DK0 A;  2EYP A;  1EOT A;  3QOJ A;  2PW5 A;  1RTO A;  5FLM G;  3PO2 B;  2PO4 A;  1Q8K A;  4I7A A;  1ZXT A;  4C3H B;  1K9M C;  2KCM A;  1WYD A;  4G57 A;  3SDZ A;  1X3F A;  4Y52 H;  2KQ3 A;  3S9W A;  2VQF L;  1XJV A;  1B8A A;  1F2L A;  4YCV A;  4J1M A;  2RF4 A;  4HTH A;  1KDB A;  3S2D B;  3T16 A;  4L8J A;  4POG A;  1CA5 A;  1G2T A;  1JE5 A;  2HUG A;  2NVX B;  2DNC A;  2ZJQ A;  1UE7 A;  2EYH A;  4NPS A;  3UE0 A;  5BN3 A;  1K0R A;  4IN3 A;  2RDF A;  2PW7 A;  1F9R A;  1M1K C;  5C4X B;  4DKA C;  4DR2 L;  1CFM A;  4DF7 A;  1H9K A;  2VZA A;  4HMI A;  3I4M H;  3NWS A;  4UP7 A;  1D5M C;  1V1O A;  1CUK A;  1AH9 A;  2BE5 C;  1HZC A;  5GAD C;  1D5Z C;  1KDC A;  4XIG S;  3PIO 3;  1I94 Q;  4KJO A;  1E2Z A;  1NMG A;  3BDC A;  1CI3 M;  1EIY B;  5EBD A;  3PUY A;  1RIP A;  4KD3 A;  3IRB A;  3URY A;  1F9Q A;  4HR7 B;  5LMN W;  1QUQ B;  4G4K A;  2VQE Q;  3VYR A;  2IX1 A;  5C3W A;  3MXN A;  1YIJ A;  2KEC A;  4RHS A;  3GTG B;  4JI4 Q;  4A3M B;  4B3R L;  1A2U A;  4OHJ A;  2J7Z A;  3HOV B;  2D2C C;  3CCR A;  1BCP D;  4BA1 I;  2D9U A;  1CQF A;  1R9T B;  1T5E A;  1WCM G;  2M00 A;  4JI1 L;  3TP6 A;  1SEB D;  1PDQ A;  1X6O A;  4GKK L;  2LXK A;  4B9X A;  3G7L A;  2CFM A;  2PI2 E;  2A6E D;  1MKH A;  3J80 E;  2F0I A;  1LO5 D;  1SJE D;  2DGY A;  3SVM A;  3FKI H;  2QKI C;  3A56 A;  4A3J H;  2KVM A;  3F2B A;  4YWM A;  1UEB A;  2YTX A;  3AQQ A;  3PIP 3;  3L3O C;  4C1N I;  4EQO A;  2E5L L;  4A3L G;  2D0O A;  5FKA C;  3S14 H;  2DY7 A;  3TP8 A;  1EY8 A;  1LTR D;  1VQE A;  2R7Z G;  4XT3 B;  1XYI A;  4DUZ L;  3S1Q H;  1ZKO A;  1PH5 A;  2DNE A;  4ZKB B;  3HOU G;  4KKT A;  3N6R A;  5ELO A;  2V4D A;  3GTP B;  1KTK A;  3K57 A;  1K3B C;  5EBC A;  5I4D A;  3GTG H;  1ILP A;  1I4X A;  1H9M A;  2RCF A;  1SRO A;  3KDF A;  3BZK A;  1X3Q A;  2F0T A;  1FNW A;  3CQZ B;  4GOP C;  3OTO Q;  2K03 A;  5EPL A;  5CR3 A;  1DON A;  1BDO A;  1C4Q A;  2L12 A;  2NTT A;  4JK1 C;  1L0X B;  2HD3 A;  2RVL A;  1GUG A;  4KHV A;  3VR4 A;  1QOH A;  2KEN A;  3TRZ A;  1PZK D;  1YNX A;  2PZT A;  4PZ6 A;  4A3K G;  2B2V C;  4FYD A;  5K36 G;  4FXD A;  3WDN A;  3F8T A;  4PG3 A;  5JJI A;  2EVB A;  3RN2 A;  4A3I G;  1G8Z D;  2QF7 A;  4ABN A;  5IT9 E;  4HED A;  4DAY A;  3CC7 A;  4L63 B;  1F77 A;  2CW0 D;  3TZD A;  1NR2 A;  2E2H B;  1XPO A;  2IJ0 A;  1A8V A;  4C3H H;  4E6I A;  2R7D A;  4GN5 A;  3D3R A;  4DUY L;  1SYE A;  5HUR A;  3C3L A;  1XNQ Q;  3T1Y Q;  1EQV A;  2B39 A;  2L9H A;  2ZXO A;  2ICE C;  3S1R B;  1IBM L;  3VYU A;  1I4P A;  2R93 G;  1N8R C;  3J7A 5;  4AYB B;  3CCV A;  3K5O A;  4A76 A;  2K5H A;  4DV4 Q;  4Z9C B;  1QZH A;  1HNW L;  1D8L A;  1TWH B;  4DR5 L;  1DXM A;  3TQY A;  2M9V A;  1H9J A;  3NTH A;  4OEM B;  1K28 A;  4LK1 C;  2NWG A;  2MO0 A;  4OO1 G;  4O0A A;  1NJI C;  5K5P A;  4GS3 A;  4C3J B;  4MTK A;  1JT8 A;  2FMC A;  5KIX A;  1PV4 A;  4PMC A;  2SOB A;  4ID6 A;  3ZJY C;  1QNK A;  1RJT A;  2A68 D;  2EY1 A;  4BBS H;  2C9O A;  3T1H L;  1R4P B;  2KA7 A;  3GTL B;  1PTO H;  2R6G A;  1XPR A;  2OQK A;  4H0L C;  4OON A;  4DV7 Q;  5KNB A;  4DN4 M;  3PF5 A;  3P1H A;  1RTN A;  3O13 A;  2K5Q A;  4DUY Q;  4EGV A;  1WTW A;  3D4R A;  1Q81 C;  5IGD A;  3L9A X;  1UWV A;  2G9H D;  2BH2 A;  3OIP A;  1ICF B;  3UDX A;  4KN4 C;  3H3V I;  1IBM Q;  1B4O A;  1HFG A;  2RA4 A;  4CJ1 B;  1D6E C;  1IHZ A;  4NW2 A;  2A8V A;  3M3Y B;  1FYC A;  2O4X A;  5E4X A;  3G71 A;  4LF5 Q;  1O7Y A;  2OTJ A;  2Q2I A;  2A6H D;  2UXC L;  4MNO A;  5IIF A;  2NVQ H;  1EIF A;  5M5Y B;  1KNA A;  2IT1 A;  3A55 A;  1LM0 A;  1VQO A;  1HZB A;  4WOR A;  5EQ0 A;  4A3J B;  2QCP X;  1PXU A;  3DXJ C;  1KAW A;  1UUP A;  2PNR C;  1VF5 C;  3FVQ A;  4ZLT F;  3FRP B;  3A7A B;  4LF7 L;  3K7A B;  1EYG A;  1BF4 A;  1HTP A;  2B2Y C;  4UDU C;  3RN5 A;  4L5S A;  1N36 L;  2EXZ A;  5IYD H;  4IQZ A;  5FO7 B;  2UUA Q;  2E2J B;  1JOR A;  4YWL A;  4CKE A;  2JA7 H;  4JI5 L;  3ULP A;  1ZEQ X;  4XQN A;  2L4N A;  1PH3 A;  4FF4 A;  2K5W A;  1HNZ Q;  5TSS A;  1ZYR C;  3I70 A;  4DV3 Q;  1S5C D;  4NXN L;  1IXR A;  3U50 C;  1EFI D;  3IL8 A;  3C2P A;  3FHW A;  4BXX H;  1AW7 A;  1XTD A;  3BDO A;  1GUT A;  2NN6 I;  1F9P A;  1PRT D;  4B3M L;  1ONL A;  4UAI A;  3I4O A;  1LTB D;  1YHA A;  4A3B H;  1IKL A;  4X65 Q;  1B9M A;  3JAM i;  1STH A;  3T53 B;  1LTL A;  1YVC A;  2CH4 A;  1JE4 A;  3ND9 A;  4XYO A;  1E24 A;  1M8A A;  1K3R A;  1SE2 A;  2K04 A;  1VQB A;  1F2Z A;  1HHV A;  3S1M H;  2F3I A;  2JA8 B;  3EJI A;  3RZD H;  3KF6 A;  4LFB Q;  3AB9 A;  3UDI A;  3OPO A;  1TWA B;  3M9B A;  1TY2 A;  2N78 A;  1J5E Q;  2D5D A;  5FO8 B;  3J81 j;  1A3T A;  3M7G A;  5C0X I;  2VW9 A;  3PSI A;  1D5X C;  5T1I A;  2JYO A;  1OXT A;  3JAM c;  1I5F A;  1CT1 D;  4JI3 L;  4B9W A;  1F2Y A;  3PCO B;  3NTI A;  3U9S A;  4NXM L;  2B2T C;  2JA6 G;  2R92 B;  1VQC A;  4DR1 Q;  4HJ7 A;  4DR4 Q;  4KJN A;  3NBH B;  3TDQ A;  2ALY B;  3MFY A;  2ENB A;  1G51 A;  4RCN A;  1EEF D;  2D0P A;  3L7Z C;  1GXD C;  2N55 A;  3K7U C;  1LTT D;  1YEZ A;  1TS3 A;  2WKD A;  4R4Q A;  4A3F H;  1K73 C;  4KK7 A;  1BBW A;  1I50 H;  3H09 A;  2VB2 X;  2VUM G;  5JAV A;  2SNM A;  1NCV A;  1E1T A;  2CW0 C;  4A3E H;  1TVX A;  5M9O A;  2I5L X;  3F2C A;  1WTX A;  4A3C G;  2NVT B;  4TKO B;  1SJH D;  2HT1 A;  5C44 H;  3S1M B;  1LTG D;  1S72 A;  4A3B G;  4X3S A;  3I55 A;  3R2T A;  5KRU A;  2Y0S E;  4X3K A;  1B7Y B;  1QNU A;  1J5E L;  1PTO D;  4J8Q A;  2EYF A;  3MHB A;  3HOV G;  1OXV A;  5CBE E;  3ZYY X;  4A3M H;  4DU9 A;  3NBI A;  2R61 A;  4QJF A;  1EUJ A;  4YHH L;  1IBK Q;  4LF6 Q;  1JJG A;  3P20 A;  1B9N A;  1KRT A;  4CKC A;  1BQQ T;  2EQS A;  4QQB X;  1SDF A;  1PLF A;  4LAA A;  2SEB D;  1RF2 D;  5CV5 A;  4DR4 L;  4NB3 A;  2OXP A;  3K0X A;  2I46 A;  4CJ0 B;  3DMU A;  1GUS A;  3DHQ A;  2PQE A;  2I5M X;  1PTO F;  1IZ6 A;  4GLV B;  2ZT9 C;  2AUJ D;  5CV6 A;  4Y7N B;  2RHS B;  1STB A;  1HZ9 A;  1QCB D;  3R93 A;  1ESF A;  2Q8R E;  2O5I C;  3FKI B;  4JPB W;  4DR3 Q;  2KJX A;  1GM5 A;  2GN5 A;  3SK5 A;  3I4N H;  4RWS C;  1B44 D;  4JI6 Q;  2ZTE A;  5IOD A;  4DK6 C;  2JEA I;  3IKJ A;  3KBG A;  3HGB A;  5G3L D;  1DCZ A;  1Q1E A;  3KUP A;  3LNN A;  3GTJ B;  3MAQ A;  4XTC S;  4IFD G;  2YU9 H;  2ZM6 L;  2O2L D;  2E2I B;  3CKI B;  1EYD A;  4JBK A;  2R92 G;  2JA6 B;  4LJZ C;  3CQZ H;  3BYY B;  1KXL A;  3K58 A;  5IYB H;  4H13 C;  3PV0 A;  4DK3 C;  5IWA Q;  2VS1 A;  3VDY A;  3G6J B;  3HKZ B;  5J22 A;  2EYM A;  3E0E A;  4DV1 Q;  4JCV E;  4OXP A;  1TS4 A;  1WTV A;  5LMN L;  3AEV A;  2K5D A;  3M4O B;  1B53 A;  2YTY A;  4TVA B;  1FVI A;  2IX3 A;  3M85 A;  1KDA A;  4PMW A;  2HCC A;  1LTI D;  4B08 A;  4ZUI A;  1FNU A;  3CP0 A;  3Q22 A;  4N9T A;  1HR0 Q;  1UE6 A;  1SNQ A;  3AFP A;  1VQG A;  2EE1 A;  3OYY A;  2MHV A;  1IBL L;  1OTC A;  4A3G B;  3ERS X;  5M3M B;  5EPJ A;  4WJW A;  1UE5 A;  1EU4 A;  1ML0 D;  1PMR A;  3NEM A;  1NBW A;  4A93 H;  3H0G B;  4BBR H;  5I2X A;  4X3U A;  2FMM A;  4XQJ A;  2OTL A;  5FLM H;  3S17 H;  1MJE A;  4EQ5 A;  1FR3 A;  1QVC A;  2PQA B;  1SXT A;  4K6D A;  3WOF A;  4A3F B;  1ENA A;  4K14 A;  5IGG A;  1ASZ A;  2F0J A;  1ENF A;  3D0F A;  1PRT B;  1RKN A;  2X69 A;  4IZ8 A;  2A74 C;  1WTQ A;  2KCT A;  1YZ6 A;  3DWP A;  3T13 A;  1JMC A;  4DV1 L;  2VL6 A;  5C4H A;  4M1U B;  2NVT H;  2Y0S G;  4C2M B;  5CV7 A;  4WFN 3;  4GKJ L;  1SRU A;  4K2L A;  2AUK A;  1O80 A;  2KCN A;  3I4N B;  2K75 A;  4A3E G;  2B2W A;  1GO3 E;  3QOL A;  4GNX B;  1SBB B;  2MUY A;  1SSO A;  3GTL H;  2L55 A;  2ZTD A;  4TRD A;  5DLQ E;  1STE A;  2CWP A;  3BDL A;  3VYS A;  1HZA A;  4QUF A;  1DJR D;  2RDH A;  1STG A;  2RQX A;  4J6H A;  1PH6 A;  4PQX A;  4A3G H;  1XTC D;  2CH4 W;  3E3X A;  2A5H A;  4RHR A;  1Y8N B;  3SXH A;  1EQQ A;  1FJG L;  5IGE A;  5KNC A;  1I6V C;  1QVG A;  2F0K A;  2JA6 H;  1Q86 C;  3FPU B;  3A8J E;  4DXF A;  2KOL A;  4NDX A;  1O7Z A;  5F2D A;  1R9T H;  3HOX B;  2QW7 A;  1K83 H;  2SNS A;  3X3N A;  5IP9 G;  1TII D;  2NVQ B;  3FMC A;  4IO9 A;  4GZY C;  1F2M A;  2BA0 A;  5M5Y H;  1YNJ C;  5ISR A;  2RSO A;  1G6Z A;  2F52 A;  1QIL A;  2MO1 A;  3ERO A;  4L5R C;  2IWH A;  2QDB A;  4QCL A;  4DNR B;  4IUN A;  4GOP A;  4JYA L;  2RDG A;  4RGN A;  1SYF A;  3I91 A;  4PV1 C;  3S14 B;  3H3V C;  2E2J H;  4OEL B;  2F3V A;  3C1F A;  4QUC A;  1HQM C;  2K32 A;  1Y8P B;  1H95 A;  1E0B A;  1QE6 A;  4WRD A;  1IKM A;  1XX8 A;  4CGY B;  2E75 C;  4ZUJ A;  1L0W A;  3GTP H;  1B3Q A;  4IUU A;  1CHQ D;  5ELE A;  4X66 L;  1YBY A;  3H0G H;  4HIM A;  2AQ1 B;  1XMO Q;  2YU9 B;  3HOW G;  4N8X 1;  1DM0 B;  4X6A H;  3QIA A;  2WAQ G;  1N33 L;  4G7H C;  3U58 A;  4A3G G;  1NNX A;  4QMG A;  2A69 D;  1FJG Q;  1YNN D;  4CJ2 C;  5C4X H;  1TS2 A;  3NUC A;  1MHW C;  1VF7 A;  5IYD G;  3L2P A;  5COR A;  5JPN C;  2L1B A;  2E76 C;  1U9R A;  1EYA A;  3V2T A;  3VR3 A;  4BY1 H;  4DV6 L;  1VQ4 A;  3G6E A;  2MP1 A;  4YY3 Q;  2F0Q A;  3HG9 A;  5JEA J;  4CDF C;  4KY7 A;  5AJ3 L;  1TU2 B;  1LT3 D;  1O7L A;  2BDN A;  3FPP A;  3RUZ A;  2R93 B;  3LWE A;  4JG2 A;  1RCV D;  5CV8 A;  1HXY D;  4QY7 A;  1IYU A;  3FP9 A;  4JI4 L;  3K5L A;  5M5W B;  5IY0 A;  1ROD A;  5LL6 S;  3T1Y L;  2KUM A;  3MZ5 A;  2F03 A;  3HOY B;  2Q8I B;  3TME A;  1XMQ Q;  2NB0 A;  5M3F B;  5IP7 G;  5E3F A;  4JBW A;  4P71 A;  1QB5 D;  3MXU A;  4GNX C;  2B29 A;  2LKV A;  2F0N A;  1EU3 A;  2A73 B;  4O42 A;  1Y1W H;  1HNX Q;  3S24 A;  1YJN A;  1HNW Q;  1SNO A;  1EQR A;  1LT4 D;  3Q8D A;  4JC0 A;  1G2S A;  4R1J A;  2DJG C;  3CCL A;  3CRL C;  1PH1 A;  3OW2 A;  1WI5 A;  4FNF A;  3CD6 A;  1OXS C;  4ILW A;  2F0U A;  4LUO A;  5C44 B;  1VQA A;  3NHH A;  4KKS A;  1XWE A;  5HGQ A;  3A5U A;  4RG1 A;  1Y69 U;  5M3M G;  1FD7 D;  5FO9 B;  4AQY Q;  1BBU A;  3D4W A;  1X54 A;  1EYC A;  5JJL A;  2JN4 A;  1SYB A;  1SR3 A;  1ZYR D;  1WOC A;  1PTO B;  3I2Z A;  1DOM A;  5ELC A;  1BCP C;  2JXM B;  4HMJ A;  4F7X A;  1W2B A;  2PI2 A;  3A8I E;  4A3D H;  1PH4 A;  2X6G A;  1A15 A;  5ELD A;  1I6H B;  1K8G A;  2EOT A;  4HSV A;  2VQF Q;  2JA9 A;  4K5W A;  2JSO A;  5GRO A;  3OTO L;  2ICI A;  3F2U A;  1A3U A;  1NY4 A;  1AN8 A;  2XWB B;  1A6X A;  3HOX H;  1G29 1;  5FLX E;  1TQO A;  3DLL A;  4RGM A;  1IW7 C;  2N3S A;  4LFA Q;  3J81 i;  3STB C;  3VA5 A;  4R4O A;  4Y7N H;  4DR2 Q;  4IOA A;  4A3L H;  4QF4 A;  2QEJ C;  4OX9 L;  3STB D;  1HR0 W;  3CCE A;  1GKH A;  4KMU C;  4QB4 A;  2IPK D;  3DM1 A;  1LYL A;  4LUZ A;  1Y1W G;  4F87 A;  1VQI A;  3PO2 H;  2NN6 G;  1I94 L;  4ZAI A;  3K7A H;  2FHT A;  2C5C A;  1WVL A;  1SYC A;  1E1O A;  5C6A A;  4BY1 G;  5CBA E;  1N36 Q;  1EZ6 A;  2UXD L;  5GQO A;  4TSS A;  1ILQ A;  4CDD C;  4B3S Q;  1KL9 A;  1BR9 A;  1HUN A;  3GTJ H;  2WIN B;  1YHB A;  2A69 C;  3I56 A;  3GV3 A;  1K8A C;  3HOU B;  2JA8 G;  1CSP A;  1UEA B;  2EY5 A;  2VNU D;  5IOC A;  2KHI A;  4Q5V A;  5CYU A;  2ZTC A;  1STA A;  3HEJ A;  4B3M Q;  1CA6 A;  5D3I B;  3UDG A;  3P7J A;  3CMA A;  2QIL A;  3SHL A;  2GVB A;  3HOZ G;  1BOS A;  1HJP A;  2FJ2 A;  3BJU A;  2K50 A;  3J80 c;  3F2D A;  3T1H Q;  4DR6 L;  3TP7 A;  2LSS A;  2E5L Q;  4RKB A;  3KF8 A;  3E9I A;  4LF4 L;  3QR8 A;  3HOX G;  1GUW A;  4DV5 L;  1PHJ A;  2I5H A;  1HRJ A;  3SGI A;  4EVO A;  2ZJP A;  3BVM A;  4K8J A;  4NXM Q;  2Z0S A;  2OQ0 A;  5EGT A;  5DAU A;  4BBR B;  4IPC A;  3H15 A;  2AWO A;  4OWX B;  3M4Q A;  4LF5 L;  5C4Z A;  1BCP F;  5BR8 Q;  4LF9 Q;  3J80 L;  2LXJ A;  3HKZ E;  1SNP A;  3R3O A;  2MNA A;  5E4W C;  5ELB A;  1EY7 A;  1Y1V G;  2F0D A;  1CKM A;  3EIV A;  4PNY A;  2R7F A;  2PYK A;  3RLN A;  5CMD A;  3KFU A;  2K1B A;  1Q8I A;  5KEE A;  3A0J A;  4A3E B;  1CQV A;  1JCK B;  4HCE A;  2CQO A;  3GTO H;  3QO2 A;  5ELF A;  2UUA L;  1KLG D;  2Z6B A;  4R4T A;  1UAP A;  1B3A A;  5H1S E;  3TS0 A;  3ULJ A;  2L5T A;  4X62 Q;  4HIO A;  5IT9 c;  2QA4 A;  3J7Y W;  1BVS A;  1HNZ L;  1WTP A;  1ET6 A;  4A3D B;  4YIJ A;  4LUV A;  3J7A V;  1I6H H;  1UE1 A;  4MN3 A;  4DV3 L;  1HCZ A;  4C3I G;  2PQA A;  1W3S A;  1MBY A;  4RKL A;  3S16 H;  4XDX A;  3CPW A;  2EZV A;  1N32 L;  2F0F A;  2UUC Q;  2XTI A;  1MD2 D;  1S5F D;  3KDF B;  1MI2 A;  2EYL A;  2PZW A;  2IHF A;  3MC0 B;  5E7N A;  2ID0 A;  1STN A;  4A93 G;  5BR8 L;  4ZK9 B;  4LF9 L;  1EIG A;  1LT6 D;  2EYO A;  2QDL A;  3OW7 A;  1J8I A;  4IJL A;  1K8O A;  3ERQ A;  4HSP A;  5DEH A;  4CHT B;  2K14 A;  3W5O A;  1XXG A;  3L0O A;  3JAM E;  2ES2 A;  3PIP A;  1DYQ A;  1Q46 A;  1SFO H;  2F0O A;  2RCN A;  5JVG 3;  1CSQ A;  4M8A A;  4JI3 Q;  2F4V L;  5C3E H;  4KY5 A;  4DR3 L;  1IYJ B;  1SND A;  2XNA C;  5EJW A;  2DN8 A;  3HKS A;  4LFC L;  1NSN S;  1U4L A;  3CF5 A;  2EXD A;  4APV A;  4JOI C;  4HJ8 A;  4BWG B;  4ALP A;  4JOI A;  4JI6 L;  4KI0 A;  3K80 C;  4LWC A;  4ZYS A;  2B2T A;  1VMC A;  2WAC A;  4V19 0;  3J7Z C;  4DV7 L;  4HID A;  4I65 A;  1GUN A;  3S1R H;  1E7Z A;  1BKB A;  1RD9 D;  5D3D A;  3BU2 A;  5C4J H;  3ER0 A;  1PTO C;  1QWY A;  4OIK A;  4ZQ3 A;  3KJO A;  2XN9 C;  3GO5 A;  3Q6S A;  2B2Y A;  2WB1 E;  4LMQ D;  3KLW A;  2NTS A;  3PUZ A;  3S16 B;  3ULL A;  2PPB C;  1CZW A;  5AFW A;  3CXC A;  2UUC L;  3BS1 A;  2B63 H;  1JQY D;  3KLR A;  3S1N B;  4UHV A;  1D1K A;  2CHB D;  5I9P A;  4MZ9 A;  1G6P A;  3J80 i;  3RNU A;  1JOQ A;  2H4O A;  3KLS X;  1JJC B;  4IAL A;  4EX5 A;  4BBS G;  1HA6 A;  2B8F A;  3R8B A;  1OO9 B;  3IAY A;  2VY3 A;  3V05 A;  4JV5 L;  2WKC A;  4UY8 C;  3RZO H;  2Z1C A;  1NAP A;  2JQO A;  2ZXP A;  4BY1 B;  1D1I A;  3KBX A;  1MSH A;  4C56 C;  3WWV A;  1VQP A;  3VA7 A;  4B3T L;  3PUW A;  2K01 A;  4U68 A;  1PA6 A;  1X55 A;  1DZ1 A;  2R93 H;  4K0K Q;  2RSN A;  5KYL A;  4HAE A;  4A3F G;  3PMF A;  4HIK A;  2FIN B;  1TY0 A;  3OMG A;  5I2Y A;  3S15 H;  2H1E A;  3IFD A;  4YHH Q;  1WFQ A;  1PFM A;  2AWN A;  3A5Z B;  3PUV A;  4J15 A;  1WD1 A;  1KD1 C;  4IFD I;  1V1Q A;  5M3M H;  1PFS A;  4OGQ C;  3QB3 A;  1VQH A;  2NZH A;  4DPG A;  5KND A;  5LHY 1;  4JBJ A;  5C4J B;  1CKN A;  3RLF A;  1Q90 A;  5FJ8 G;  1Q3L A;  1LV9 A;  1AE3 A;  4DV0 Q;  2NZ1 D;  4DNT B;  4RA8 A;  3PO3 G;  1EWH A;  1Y1W B;  1G91 A;  3E5S A;  3S1N H;  1V1P B;  3HOW B;  2EJG C;  1J6Q A;  1HQR D;  3HRZ C;  2E74 C;  3KF6 B;  2HIX A;  4JI2 L;  1LT5 D;  1NR4 A;  1VQF A;  1JIC A;  3VR5 A;  1BBX C;  1PYS B;  1PH7 A;  3PQI A;  1PFB A;  2GA4 B;  2HHH Q;  1AP0 A;  4P75 A;  4LFB L;  3OIQ A;  2EY2 A;  5C44 G;  3BVZ A;  4XQQ A;  2JA7 B;  3MXN B;  1VQN A;  2UU9 Q;  4IFD J;  1PYB A;  1SAP A;  3R2I A;  4AIM A;  3UE1 A;  1RHP A;  3T56 B;  4BY7 H;  1L0Y B;  1SE3 A;  1VQ5 A;  2ZM6 Q;  2D62 A;  5FLX L;  1SLJ A;  5JVH 3;  1S4Z A;  3GD7 A;  4JI0 Q;  2YV5 A;  4R8I A;  5EKI A;  4IUR A;  3J81 c;  4KKU A;  4DR1 L;  5JPM C;  3UI2 A;  5IWA L;  2MJ8 A;  1A63 A;  3C46 A;  2K52 A;  3EVQ A;  2Y0S B;  4IPH A;  4DAP A;  4DV0 L;  2VB3 X;  4OO1 I;  1DOK A;  4O1N A;  1YNN C;  5FK9 C;  1P8L A;  1SNM A;  3NEN A;  1VCI A;  4WJ4 A;  3RZD B;  4CDE C;  2XVS A;  2F0W A;  2WAQ E;  1ET9 A;  1B1Z A;  1TWA H;  4P72 A;  4DV2 L;  1L1O C;  5I6Y A;  3OWE B;  3FEW X;  1EQT A;  1U0L A;  2LFN A;  2BH8 A;  3CCM A;  2B2W C;  3BG3 A;  2KEE A;  5C5M A;  3PIO A;  3NWT A;  4GN3 B;  1NMF A;  1H9S B;  3HS0 C;  5IYC H;  5BN5 A;  3VR2 A;  4MIU A;  3S1Q B;  5EPK A;  3A54 A;  2R92 H;  4NP5 A;  2EY6 A;  3E6Z X;  3AYH B;  4QIW B;  1TWG H;  1X9N A;  2EIF A;  2WB1 B;  4A93 B;  2F4I A;  2BA1 A;  5IYC G;  2ATW A;  2IY5 B;  5CV9 A;  5C0X J;  2PNH A;  1SE4 A;  4RCO A;  1VDZ A;  4CDC C;  3Q0A A;  3K0Y A;  4FXG C;  5J1Z A;  2Q8T A;  5FOB B;  1TXY A;  3HOW H;  4JVZ A;  2NVY H;  3HOY G;  1SN8 A;  1BUV T;  3SEB A;  5IT9 L;  3LX0 A;  3EFX D;  1L2F A;  5JJK A;  3PO2 G;  1VQL A;  2G9D A;  3TP5 A;  3GTM B;  1AEX A;  3GDE A;  1KQS A;  2WII B;  2CVR A;  2B3G A;  3GTK B;  4S3S A;  3MFG A;  2V1C C;  2YYZ A;  4DV2 Q;  3AU7 A;  5AJ3 Q;  3H94 A;  3I4L A;  4DUZ Q;  3NP8 A;  2L15 A;  2I07 B;  1K8M A;  1V8Q A;  4L6T B;  3W1G A;  4OWW B;  4DAV A;  5C5L A;  1N34 L;  1WCM B;  2CKZ B;  1JB3 A;  3VR6 A;  1CHP D;  1CM9 A;  4RAU C;  5JOB A;  3SK6 A;  2GVA A;  5HY6 A;  4HJA A;  1FNV A;  3HZX A;  2F0S A;  1SE8 A;  2X6L A;  4ULL A;  1XMQ L;  5A2Q L;  1WTR A;  4P73 A;  3CCJ A;  4DR7 L;  4YCW A;  3LWU A;  1PRT F;  3OOC A;  4FP5 D;  3TZU A;  4IJH A;  2NVY B;  3K81 C;  1FGU A;  2NYZ D;  2WV6 D;  3A8K E;  4EQP A;  5KYI A;  4JI8 Q;  4KHP Q;  3Q23 A;  5E1F A;  1B70 B;  1S5B D;  1Y1V B;  3EN2 A;  5LMN Q;  1KIX A;  2EJF C;  4EQN A;  1LAC A;  1YJW A;  4QGU A;  5IE8 A;  2F1M A;  5FJ8 H;  1N9W A;  1A2T A;  1CKN B;  4F8M A;  2EDG A;  4AQY L;  1Q1B A;  3I90 A;  4FVM A;  1IW7 D;  1HPC A;  1S40 A;  3CAM A;  3T51 B;  1XMO L;  1TWG B;  3DEP A;  1I4H A;  3G4S A;  1XNR Q;  2KCC A;  2F0H A;  2HCI A;  5A35 A;  1VQ9 A;  5EKK A;  4G7O C;  1E2W A;  1X56 A;  4R4I A;  3I72 A;  4HCS A;  1IL8 A;  1X3E A;  4DR5 Q;  2PMZ E;  1GHJ A;  5I9O A;  4BY7 G;  1T9H A;  4PZ8 A;  1S3O A;  1L1O B;  3MEH A;  2BCO A;  1H9S A;  1EY9 A;  1KAA A;  3S2H B;  1SMY C;  4K2K A;  3MXG A;  1BXT A;  1X3G A;  5M5X H;  4DV6 Q;  4C1N K;  3H3V H;  3M4O H;  5I6W A;  2EJM A;  1LTS D;  3GV6 A;  1PVO A;  4JI8 L;  1CKO A;  4KHP L;  2XRQ D;  1SMY D;  4NKL A;  1CTM A;  5A2Q E;  2QEX A;  2IL8 A;  2Q2T A;  4R4C A;  4GKJ Q;  1PZI D;  2VXW A;  1EEI D;  4P74 A;  1EY4 A;  3RMH A;  1VMP A;  1NUC A;  2JA5 G;  4L5Q A;  1KAB A;  1Y8O B;  2M2L A;  3ONA B;  3W2D A;  4BBR G;  3Q24 A;  3H0G G;  1WCM H;  1E3P A;  5LMU L;  1W6J A;  1V9P A;  2XSC A;  3KOJ A;  4AYB E;  3HOY H;  1PYW D;  3ND8 A;  4B3S L;  4MHE A;  5GAG C;  3S17 B;  1XNR L;  1HA5 A;  2H5X A;  3RR5 A;  4A3M G;  3U9O A;  1DOL A;  3NK9 A;  3W1B A;  1TWF H;  1WTH A;  4JBM A;  5CC4 A;  2A6H C;  4YWK A;  3KYH C;  1GJX A;  1LLR D;  2F0L A;  3K6O A;  4OIJ A;  2B2U C;  4CKB A;  4OO1 H;  4DA2 A;  3CU7 A;  3AMU A;  1Q7Y C;  3RZO B;  1EY0 A;  3E0J A;  3TEH B;  4X64 Q;  5DM6 3;  3D6C A;  1AFP A;  4WJ3 M;  2R3Z A;  5L37 A;  2FXQ A;  2VQE L;  3HP3 A;  2CWA A;  4JI5 Q;  1I4Q A;  4JYA Q;  1X3P A;  1SNC A;  2LMC B;  3BYT B;  4ZCK A;  2B63 G;  4C3I H;  1U5K A;  2K28 A;  4I7Z C;  4B3R Q;  3H6M A;  1EIH A;  1EWI A;  1XNQ L;  5LMU Q;  4NXN Q;  3DWQ A;  4UP8 A;  4DK1 A;  1MSG A;  4OWT B;  4DV5 Q;  2N8N A;  2JA5 H;  4C3H G;  3EA6 A;  4X66 Q;  4JI1 Q;  3AFQ A;  1R4Q B;  1E2V A;  4GKK Q;  1FGB D;  4LF8 L;  4X65 L;  3NPP A;  1N33 Q;  3TSS A;  5C3X A;  2E2D C;  4DV4 L;  1AE2 A;  3I4M G;  4ZRZ A;  3DUZ A;  1STY A;  4UP9 A;  1OXX K;  5M5X B;  4OX9 Q;  2JEB I;  2B2V A;  4DAM A;  3FDT A;  5C3E G;  3OWF A;  3T4A C;  4POF A;  1TR5 A;  3V96 A;  2ZJR A;  3KF8 B;  2LY7 A;  4GNX A;  4FO2 A;  2OT2 A;  2N88 A;  1A62 A;  3OHX C;  4A3K B;  4X64 L;  4RH6 A;  1M90 C;  1HTL D;  1JOK A;  4K8I A;  2Q2H A;  2NZO A;  4IUP A;  2RKS A;  4GLX A;  1KC8 C;  4JI7 Q;  4A3C H;  1JOO A;  4K6L A;  1YJ9 A;  2DJF C;  1LTA D;  2WAQ B;  3ICE A;  3MA2 B;  1C0A A;  2MGS A;  1PRT C;  5IGB A;  1V1P A;  2KHS A;  2O5J C;  1JWM D;  3P75 A;  5CGK A;  5C0X H;  3I73 A;  3K5N A;  1GVP A;  4KD4 A;  3I3C A;  3CC2 A;  5T1G A;  1C7Y A;  3KLS A;  4LF8 Q;  2XWJ B;  4RGT A;  1P16 A;  5FLX c;  4A3I H;  3BZD B;  3QG1 A;  2I0Q A;  2UXC Q;  1I3Q B;  4HN7 A;  4FF3 A;  3CRK C;  4KN7 C;  1VQ7 A;  1KHI A;  3TBI B;  2P5Z X;  3NTK A;  3CCU A;  2DY8 A;  4DR6 Q;  3H91 A;  1SFO B;  3GQB A;  5IYB G;  1PH2 A;  3CC4 A;  3U4Z A;  1VS0 A;  5IGF A;  1PFN A;  3A74 A;  3MEF A;  2B8G A;  2EPB A;  3NSW A;  2F4V Q;  3OMC A;  4TQU S;  5J3B A;  2F0V A;  2YTV A;  1QZG A;  5IP7 H;  1MJC A;  4N9P A;  2ZXR A;  4C3I B;  3J7A F;  5M5W H;  4LFC Q;  1PZJ D;  2J4X A;  1WTO A;  2OEO A;  5NUC A;  5M3F G;  2Z8L A;  4JI7 L;  4XYQ A;  1D2B A;  1FL0 A;  2DUD A;  4DGZ A;  4KV6 A;  5HGT A;  1BNZ A;  3S2D H;  4FF2 A;  1II3 A;  1MIU A;  1L1O A;  3PGZ A;  2RBM A;  3RLO A;  3PUX A;  5C4X G;  2AQ3 B;  2WB1 G;  2IW3 A;  3IFT A;  3ITP A;  4GN4 B;  3NQT A;  2KBN A;  4P2C B;  2BE5 D;  4UPA A;  2A6E C;  4DFA A;  2BDO A;  4LFA L;  3EQL C;  2TMP A;  4KLK A;  4U67 3;  1QJO A;  2PCF B;  4IUQ A;  3CHB D;  3U4V A;  4HJ9 A;  3M7N A;  1TS5 A;  1LUZ A;  4GLA C;  2JA7 G;  1Z9F A;  3GTM H;  1A0I A;  4LW1 A;  3BZC A;  1V43 A;  3GTK H;  1JWU D;  2L11 A;  1Q82 C;  3PO3 B;  4FXK C;  1BO0 A;  4AH6 A;  2JA8 H;  2IHE A;  3GTO B;  3SR1 A;  4NMZ A;  1VQD A;  1Z47 A;  2KED A;  1GOZ A;  1SMX A;  4CBV A;  4BXX G;  5GAE C;  2F0E A;  2K5N A;  3KJP A;  1VQ8 A;  4H44 C;  3MWY W;  1TKW B;  4PMB A;  1DD2 A;  2UXD Q;  5D14 A;  2XGT A;  1NTG A;  1K0S A;  2G5D A;  3M4P A;  1YI2 A;  2F3W A;  3W3A A;  1BCP B;  2HQE A;  4C3J G;  1KNE A;  4KHZ A;  1EL0 A;  2IX0 A;  1EFW A;  1QUQ A;  1MGS A;  5DNF A;  5J39 A;  4F88 A;  1Q12 A;  2HQL A;  4ZKC B;  4O2D A;  2Z4I A;  1Y14 B;  5KGU A;  1I50 B;  1CK1 A;  1U4R A;  1I3Q H;  4FDB A;  1WJJ A;  1SYD A;  5EKL A;  3TRE A;  3MTS A;  2JE6 I;  4PZ7 A;  4RFB A;  4LNQ A;  4C2M H;  3MVV A;  4LF7 Q;  4KTA A;  2R7Z B;  4A3K H;  2F0M A;  3HFZ B;  4BA2 I;  5D65 A;  5IP9 H;  1Z7T A;  1EWC A;  4DNI A;  1E22 A;  1HR0 L;  1VQ6 A;  4AYB G;  1EOV A;  4YCU A;  4IOC A;  1GUO A;  3J81 L;  1KLU D;  2KHJ A;  3CPF A;  3I8Z A;  1OXU A;  3LGJ A;  2Z4H A;  2HIV A;  2K6A A;  4N8F A;  2MPM A;  1X65 A;  2K33 A;  4LF4 Q;  2UUB L;  2Z9H A;  2NUC A;  3M4Y A;  3MXP A;  5G3L F;  1AZP A;  4BY7 B;  2XIW A;  1S5D D;  1RDP D;  1D7Q A;  2K4K A;  5COY A;  4LF6 L;  1U4M A;  1A3V A;  3HOU H;  1EZ8 A;  5K36 H;  4A3D G;  1IYV A;  3TS2 A;  5BN4 A;  4BS9 A;  3UDF A;  1X32 A;  1K83 B;  4A3I B;  3HOZ B;  1SYG A;  5CV4 A;  1NE3 A;  3TN2 A;  3GTQ B;  4FF1 A;  2AMC B;  2K05 A;  4R9W A;  1PH9 A;  3I7F A;  4L5T A;  1T5X D;  3PO3 H;  1U4P A;  2FFK B;  1ESR A;  2B2U A;  2Z6K C;  2VUM B;  2Z6K A;  3EBE A;  5IGC A;  1JB7 A;  2E2H H;  1GD7 A;  4K0K L;  2JK8 A;  1J9O A;  2AKW B;  3PF4 A;  3QWN A;  1RL2 A;  2MQH A;  2WP8 J;  4RGO S;  5EAY A; 
#chains in the Genus database with same CATH homology
 3BVG A;  4ME5 A;  1I4R A;  3S15 B;  5JEA G;  4G7Z C;  1JR0 D;  2HDM A;  4X3T A;  2JP1 A;  3OSO A;  5C0X G;  1ENC A;  5JEA H;  2PZU A;  2F0P A;  1Z6H A;  4DXG A;  4K5X A;  3J81 E;  2HDL A;  1M4V A;  2K7V A;  4OL7 A;  3WOE A;  2L0C A;  1TWF B;  1AZQ A;  4XXE A;  3SK8 A;  1S5E D;  1H9R A;  1EY6 A;  2LS0 1;  1WD0 A;  3DWA A;  1JWS D;  1C8C A;  3SE0 A;  2NN6 H;  3DEO A;  1B50 A;  1F9S A;  1LAB A;  4BBS B;  5LL6 X;  2TSS A;  3VYT A;  4IFD H;  3RD4 A;  1QG7 A;  1CZG A;  3N52 A;  1JC7 A;  2NBF A;  3D6W A;  3D31 A;  2JA5 B;  1EY5 A;  3A7L A;  1W6K A;  1C48 A;  1TT2 A;  3C1E A;  3JAM L;  5JJZ A;  1O78 A;  3I4M B;  5DM7 3;  3NQI A;  4R8N A;  3NXW A;  1GHK A;  5C3E B;  1YNJ D;  1ICW A;  2EYJ A;  3SK4 A;  2AQ2 B;  4ODG A;  1UNS A;  3X3M A;  3K59 A;  2XRS D;  1I4G A;  2OF1 A;  3QJY A;  4IUV A;  1TWC B;  2PMZ B;  1B2T A;  4H7B A;  2BOS A;  4Q0F A;  4V0B A;  1HFN A;  2B63 B;  3D4D A;  3NBH A;  4A3B B;  3KK7 A;  1HUM A;  2CQA A;  2J0T D;  3NE5 B;  4XT1 B;  2SDF A;  3D8G A;  3GP7 A;  2A68 C;  4K5V A;  4IUT A;  2F0G A;  3K5M A;  4KY6 A;  4DK0 A;  2EYP A;  1EOT A;  3QOJ A;  2PW5 A;  1RTO A;  3PO2 B;  2PO4 A;  1ZXT A;  4C3H B;  4G57 A;  3SDZ A;  2KQ3 A;  3S9W A;  1F2L A;  4J1M A;  4HTH A;  1KDB A;  3S2D B;  3T16 A;  4L8J A;  1CA5 A;  1G2T A;  2HUG A;  2NVX B;  2DNC A;  2EYH A;  5BN3 A;  4IN3 A;  2RDF A;  2PW7 A;  1F9R A;  5C4X B;  1CFM A;  4DF7 A;  1H9K A;  4HMI A;  3NWS A;  1D5M C;  1V1O A;  2BE5 C;  1D5Z C;  1KDC A;  4XIG S;  3PIO 3;  4KJO A;  1E2Z A;  3BDC A;  1CI3 M;  5EBD A;  3PUY A;  4KD3 A;  3URY A;  1F9Q A;  4HR7 B;  4G4K A;  2IX1 A;  3VYR A;  5C3W A;  3MXN A;  2KEC A;  4RHS A;  3GTG B;  4A3M B;  1A2U A;  4OHJ A;  2J7Z A;  3HOV B;  2D2C C;  1BCP D;  4BA1 I;  2D9U A;  1CQF A;  1R9T B;  1T5E A;  2M00 A;  3TP6 A;  1SEB D;  1PDQ A;  4B9X A;  3G7L A;  2A6E D;  3J80 E;  2F0I A;  1LO5 D;  1SJE D;  3SVM A;  2QKI C;  3A56 A;  2KVM A;  3PIP 3;  3L3O C;  4C1N I;  4EQO A;  5FKA C;  2DY7 A;  3TP8 A;  1EY8 A;  1LTR D;  4XT3 B;  1XYI A;  1ZKO A;  2DNE A;  4ZKB B;  4KKT A;  3N6R A;  2V4D A;  3GTP B;  1KTK A;  3K57 A;  5EBC A;  5I4D A;  1ILP A;  1I4X A;  1H9M A;  1X3Q A;  2F0T A;  1FNW A;  3CQZ B;  2K03 A;  5EPL A;  5CR3 A;  1DON A;  1BDO A;  1C4Q A;  2L12 A;  2NTT A;  4JK1 C;  1L0X B;  2RVL A;  1GUG A;  4KHV A;  3VR4 A;  1QOH A;  1PZK D;  2PZT A;  4FYD A;  2B2V C;  5K36 G;  4FXD A;  3WDN A;  2EVB A;  1G8Z D;  2QF7 A;  4ABN A;  5IT9 E;  4HED A;  4L63 B;  1F77 A;  2CW0 D;  3TZD A;  1NR2 A;  2E2H B;  2IJ0 A;  4E6I A;  3D3R A;  1SYE A;  5HUR A;  3C3L A;  1EQV A;  2B39 A;  2L9H A;  2ZXO A;  2ICE C;  3S1R B;  3VYU A;  1I4P A;  4AYB B;  3K5O A;  4Z9C B;  1TWH B;  1DXM A;  2M9V A;  1H9J A;  3NTH A;  4LK1 C;  2NWG A;  4OO1 G;  5K5P A;  4C3J B;  2FMC A;  5KIX A;  4PMC A;  2SOB A;  4ID6 A;  1QNK A;  1RJT A;  2A68 D;  2EY1 A;  2C9O A;  1R4P B;  2KA7 A;  3GTL B;  1PTO H;  2R6G A;  4H0L C;  5KNB A;  4DN4 M;  3P1H A;  1RTN A;  3O13 A;  2K5Q A;  4EGV A;  1WTW A;  3D4R A;  5IGD A;  3L9A X;  2G9H D;  3OIP A;  4KN4 C;  4CJ1 B;  1B4O A;  1HFG A;  2RA4 A;  1D6E C;  1IHZ A;  4NW2 A;  3M3Y B;  1FYC A;  2O4X A;  5E4X A;  1O7Y A;  2A6H D;  5IIF A;  5M5Y B;  1KNA A;  2IT1 A;  3A55 A;  4WOR A;  5EQ0 A;  4A3J B;  2QCP X;  1PXU A;  3DXJ C;  1UUP A;  2PNR C;  1VF5 C;  3FVQ A;  4ZLT F;  3FRP B;  3A7A B;  3K7A B;  1BF4 A;  1HTP A;  2B2Y C;  4UDU C;  2EXZ A;  4IQZ A;  5FO7 B;  2E2J B;  1JOR A;  4CKE A;  1ZEQ X;  4XQN A;  2L4N A;  4FF4 A;  2K5W A;  5TSS A;  1ZYR C;  3I70 A;  1S5C D;  1EFI D;  3IL8 A;  3C2P A;  1AW7 A;  3BDO A;  1GUT A;  2NN6 I;  1F9P A;  1PRT D;  1ONL A;  4UAI A;  1LTB D;  1IKL A;  1B9M A;  1STH A;  3T53 B;  1JE4 A;  3ND9 A;  4XYO A;  1M8A A;  1SE2 A;  2K04 A;  1F2Z A;  1HHV A;  2JA8 B;  3EJI A;  3AB9 A;  3OPO A;  1TWA B;  1TY2 A;  2D5D A;  5FO8 B;  1A3T A;  3M7G A;  5C0X I;  1D5X C;  5T1I A;  2JYO A;  1OXT A;  1CT1 D;  4B9W A;  1F2Y A;  3NTI A;  3U9S A;  2B2T C;  2R92 B;  4KJN A;  3TDQ A;  3MFY A;  2ENB A;  4RCN A;  1EEF D;  3L7Z C;  1GXD C;  2N55 A;  1LTT D;  1TS3 A;  2WKD A;  4KK7 A;  3H09 A;  2VB2 X;  5JAV A;  2SNM A;  1NCV A;  2CW0 C;  1TVX A;  5M9O A;  1WTX A;  2NVT B;  4TKO B;  1SJH D;  3S1M B;  1LTG D;  4X3S A;  3R2T A;  5KRU A;  4X3K A;  1QNU A;  1PTO D;  4J8Q A;  2EYF A;  3MHB A;  1OXV A;  5CBE E;  3ZYY X;  4DU9 A;  3NBI A;  2R61 A;  3P20 A;  1B9N A;  4CKC A;  1BQQ T;  1SDF A;  1PLF A;  4LAA A;  2SEB D;  1RF2 D;  5CV5 A;  2OXP A;  2I46 A;  4CJ0 B;  3DMU A;  1GUS A;  3DHQ A;  2PQE A;  1PTO F;  2ZT9 C;  2AUJ D;  5CV6 A;  4Y7N B;  1STB A;  1QCB D;  3R93 A;  1ESF A;  2Q8R E;  2O5I C;  3FKI B;  2KJX A;  3SK5 A;  4RWS C;  1B44 D;  5IOD A;  2JEA I;  3IKJ A;  3KBG A;  3HGB A;  5G3L D;  1DCZ A;  1Q1E A;  3KUP A;  3LNN A;  3GTJ B;  3MAQ A;  4XTC S;  4IFD G;  2O2L D;  2E2I B;  3CKI B;  1EYD A;  2JA6 B;  4LJZ C;  3BYY B;  3K58 A;  4H13 C;  3PV0 A;  3G6J B;  3HKZ B;  5J22 A;  2EYM A;  1TS4 A;  1WTV A;  2K5D A;  3M4O B;  1B53 A;  2IX3 A;  3M85 A;  1KDA A;  4PMW A;  2HCC A;  1LTI D;  4B08 A;  4ZUI A;  1FNU A;  3Q22 A;  4N9T A;  1SNQ A;  2EE1 A;  2MHV A;  4A3G B;  5M3M B;  5EPJ A;  4WJW A;  1EU4 A;  1ML0 D;  1PMR A;  3H0G B;  5I2X A;  4X3U A;  2FMM A;  4XQJ A;  1FR3 A;  4K6D A;  1SXT A;  3WOF A;  4A3F B;  1ENA A;  4K14 A;  5IGG A;  2F0J A;  1ENF A;  1PRT B;  1RKN A;  2X69 A;  4IZ8 A;  2A74 C;  1WTQ A;  3DWP A;  3T13 A;  5C4H A;  4M1U B;  4C2M B;  5CV7 A;  4WFN 3;  4K2L A;  2AUK A;  1O80 A;  2KCN A;  3I4N B;  2B2W A;  3QOL A;  1SBB B;  2MUY A;  1SSO A;  2L55 A;  4TRD A;  1STE A;  3BDL A;  3VYS A;  4QUF A;  1DJR D;  2RDH A;  1STG A;  2RQX A;  4J6H A;  4PQX A;  1XTC D;  2A5H A;  4RHR A;  1Y8N B;  3SXH A;  5IGE A;  5KNC A;  1I6V C;  2F0K A;  3FPU B;  3A8J E;  4DXF A;  2KOL A;  4NDX A;  1O7Z A;  5F2D A;  3HOX B;  2SNS A;  3X3N A;  1TII D;  2NVQ B;  3FMC A;  4GZY C;  1F2M A;  2BA0 A;  1YNJ C;  5ISR A;  2RSO A;  1G6Z A;  1QIL A;  3ERO A;  2IWH A;  2QDB A;  4QCL A;  4DNR B;  4IUN A;  2RDG A;  4RGN A;  1SYF A;  3I91 A;  4PV1 C;  3S14 B;  3H3V C;  2F3V A;  3C1F A;  4QUC A;  1HQM C;  2K32 A;  1Y8P B;  1E0B A;  1QE6 A;  4WRD A;  1IKM A;  1XX8 A;  4CGY B;  2E75 C;  4ZUJ A;  4IUU A;  1CHQ D;  5ELE A;  2AQ1 B;  2YU9 B;  1DM0 B;  3QIA A;  4G7H C;  4QMG A;  2A69 D;  1YNN D;  4CJ2 C;  1TS2 A;  3NUC A;  1VF7 A;  5COR A;  5JPN C;  2L1B A;  2E76 C;  1U9R A;  1EYA A;  3V2T A;  3VR3 A;  2MP1 A;  2F0Q A;  3HG9 A;  5JEA J;  4KY7 A;  1TU2 B;  1LT3 D;  1O7L A;  2BDN A;  3FPP A;  3RUZ A;  2R93 B;  3LWE A;  1RCV D;  5CV8 A;  1HXY D;  1IYU A;  3K5L A;  5M5W B;  1ROD A;  5LL6 S;  2KUM A;  3MZ5 A;  2F03 A;  3HOY B;  2Q8I B;  3TME A;  2NB0 A;  5M3F B;  5E3F A;  4JBW A;  1QB5 D;  3MXU A;  2LKV A;  2F0N A;  1EU3 A;  2A73 B;  4O42 A;  1SNO A;  1LT4 D;  1G2S A;  3CRL C;  4FNF A;  1OXS C;  4ILW A;  2F0U A;  5C44 B;  3NHH A;  4KKS A;  1XWE A;  1Y69 U;  1FD7 D;  5FO9 B;  3D4W A;  1EYC A;  1SYB A;  1ZYR D;  1PTO B;  1DOM A;  5ELC A;  1BCP C;  2JXM B;  4HMJ A;  4F7X A;  3A8I E;  2X6G A;  1A15 A;  5ELD A;  1I6H B;  2EOT A;  4HSV A;  4K5W A;  2JSO A;  2ICI A;  3F2U A;  1A3U A;  1AN8 A;  2XWB B;  1A6X A;  1G29 1;  5FLX E;  1TQO A;  4RGM A;  1IW7 C;  3VA5 A;  4QF4 A;  2QEJ C;  4KMU C;  4QB4 A;  2IPK D;  3DM1 A;  4F87 A;  2NN6 G;  4ZAI A;  2FHT A;  2C5C A;  1WVL A;  1SYC A;  5C6A A;  5CBA E;  1EZ6 A;  4TSS A;  1ILQ A;  1BR9 A;  1HUN A;  2WIN B;  2A69 C;  3GV3 A;  3HOU B;  1UEA B;  2EY5 A;  2VNU D;  5IOC A;  4Q5V A;  5CYU A;  1STA A;  3HEJ A;  1CA6 A;  5D3I B;  3P7J A;  2QIL A;  3SHL A;  1BOS A;  2FJ2 A;  3TP7 A;  4RKB A;  3KF8 A;  1GUW A;  1HRJ A;  4EVO A;  3BVM A;  4K8J A;  5EGT A;  5DAU A;  4BBR B;  2AWO A;  5C4Z A;  1BCP F;  3J80 L;  3R3O A;  1SNP A;  5E4W C;  5ELB A;  1EY7 A;  2F0D A;  4PNY A;  2PYK A;  5CMD A;  2K1B A;  1Q8I A;  5KEE A;  4A3E B;  1CQV A;  1JCK B;  4HCE A;  3QO2 A;  5ELF A;  1KLG D;  1UAP A;  1B3A A;  2L5T A;  3J7Y W;  1WTP A;  1ET6 A;  4A3D B;  4YIJ A;  3J7A V;  4MN3 A;  1HCZ A;  4C3I G;  1MBY A;  4RKL A;  4XDX A;  2EZV A;  2F0F A;  1MD2 D;  1S5F D;  1MI2 A;  2EYL A;  2PZW A;  3MC0 B;  2ID0 A;  1STN A;  4ZK9 B;  1EIG A;  1LT6 D;  2EYO A;  3OW7 A;  1J8I A;  1K8O A;  3ERQ A;  4HSP A;  5DEH A;  4CHT B;  1XXG A;  3JAM E;  1DYQ A;  2F0O A;  5JVG 3;  4M8A A;  4KY5 A;  1SND A;  2XNA C;  5EJW A;  2DN8 A;  1NSN S;  1U4L A;  4BWG B;  4KI0 A;  4ZYS A;  2B2T A;  1VMC A;  2WAC A;  4V19 0;  4I65 A;  1GUN A;  1RD9 D;  5D3D A;  1PTO C;  1QWY A;  4OIK A;  4ZQ3 A;  2XN9 C;  3GO5 A;  3Q6S A;  2B2Y A;  4LMQ D;  2NTS A;  3PUZ A;  3S16 B;  2PPB C;  1CZW A;  5AFW A;  3BS1 A;  1JQY D;  3KLR A;  3S1N B;  1D1K A;  2CHB D;  5I9P A;  1JOQ A;  2H4O A;  3KLS X;  4IAL A;  1HA6 A;  2B8F A;  3R8B A;  1OO9 B;  3IAY A;  3V05 A;  2WKC A;  2Z1C A;  1NAP A;  2ZXP A;  4BY1 B;  1D1I A;  3KBX A;  1MSH A;  4C56 C;  3VA7 A;  3PUW A;  2K01 A;  4U68 A;  1DZ1 A;  2RSN A;  5KYL A;  4HAE A;  3PMF A;  2FIN B;  5I2Y A;  1TY0 A;  3OMG A;  2H1E A;  3IFD A;  2AWN A;  1PFM A;  1WD1 A;  3PUV A;  4IFD I;  4OGQ C;  3QB3 A;  5KND A;  5LHY 1;  5C4J B;  3RLF A;  1Q90 A;  1Q3L A;  1LV9 A;  2NZ1 D;  4DNT B;  4RA8 A;  1G91 A;  1EWH A;  1Y1W B;  3E5S A;  1V1P B;  3HOW B;  2EJG C;  1HQR D;  3HRZ C;  2E74 C;  1LT5 D;  1NR4 A;  1JIC A;  3VR5 A;  1BBX C;  1PFB A;  2GA4 B;  1AP0 A;  3OIQ A;  2EY2 A;  3BVZ A;  4XQQ A;  2JA7 B;  4IFD J;  1SAP A;  3R2I A;  1RHP A;  3T56 B;  1L0Y B;  1SE3 A;  2D62 A;  5FLX L;  5JVH 3;  1S4Z A;  3GD7 A;  4R8I A;  5EKI A;  4IUR A;  4KKU A;  5JPM C;  3UI2 A;  2MJ8 A;  3C46 A;  3EVQ A;  2Y0S B;  4DAP A;  2VB3 X;  4OO1 I;  1DOK A;  4O1N A;  1YNN C;  5FK9 C;  1SNM A;  1VCI A;  3RZD B;  2XVS A;  2F0W A;  1ET9 A;  1B1Z A;  5I6Y A;  3OWE B;  3FEW X;  1EQT A;  2LFN A;  2B2W C;  3BG3 A;  2KEE A;  5C5M A;  3NWT A;  1H9S B;  3HS0 C;  5BN5 A;  3VR2 A;  4MIU A;  3S1Q B;  5EPK A;  3A54 A;  4NP5 A;  2EY6 A;  3E6Z X;  4QIW B;  2WB1 B;  4A93 B;  2F4I A;  2BA1 A;  5CV9 A;  5C0X J;  1SE4 A;  4RCO A;  1VDZ A;  3Q0A A;  3K0Y A;  4FXG C;  5J1Z A;  2Q8T A;  5FOB B;  1BUV T;  3SEB A;  5IT9 L;  3LX0 A;  3EFX D;  2G9D A;  3TP5 A;  3GTM B;  1AEX A;  2WII B;  2CVR A;  3GTK B;  4S3S A;  3MFG A;  2YYZ A;  3AU7 A;  3H94 A;  3I4L A;  3NP8 A;  2I07 B;  1K8M A;  1V8Q A;  4L6T B;  4DAV A;  5C5L A;  1WCM B;  1JB3 A;  3VR6 A;  1CHP D;  1CM9 A;  4RAU C;  5JOB A;  3SK6 A;  1FNV A;  3HZX A;  2F0S A;  2X6L A;  4ULL A;  5A2Q L;  1WTR A;  3LWU A;  1PRT F;  3OOC A;  4FP5 D;  3TZU A;  2NVY B;  2NYZ D;  2WV6 D;  3A8K E;  4EQP A;  5KYI A;  3Q23 A;  5E1F A;  1S5B D;  1Y1V B;  2EJF C;  4EQN A;  1LAC A;  2F1M A;  1A2T A;  4F8M A;  2EDG A;  1Q1B A;  3I90 A;  4FVM A;  1IW7 D;  1HPC A;  3T51 B;  1TWG B;  3DEP A;  1I4H A;  2KCC A;  2F0H A;  2HCI A;  5A35 A;  5EKK A;  4G7O C;  1E2W A;  3I72 A;  4HCS A;  1IL8 A;  1GHJ A;  5I9O A;  3MEH A;  2BCO A;  1H9S A;  1EY9 A;  1KAA A;  3S2H B;  1SMY C;  4K2K A;  3MXG A;  1BXT A;  4C1N K;  5I6W A;  2EJM A;  1LTS D;  3GV6 A;  2XRQ D;  1SMY D;  4NKL A;  1CTM A;  5A2Q E;  2IL8 A;  1PZI D;  2VXW A;  1EEI D;  1EY4 A;  3RMH A;  1VMP A;  1NUC A;  1KAB A;  1Y8O B;  2M2L A;  3ONA B;  3W2D A;  3Q24 A;  1W6J A;  2XSC A;  1PYW D;  3ND8 A;  4MHE A;  3S17 B;  1HA5 A;  3U9O A;  1DOL A;  3NK9 A;  5CC4 A;  2A6H C;  1GJX A;  1LLR D;  2F0L A;  3K6O A;  4OIJ A;  2B2U C;  4CKB A;  4OO1 H;  4DA2 A;  3CU7 A;  3AMU A;  3RZO B;  1EY0 A;  3E0J A;  5DM6 3;  3D6C A;  1AFP A;  2R3Z A;  3HP3 A;  1I4Q A;  1X3P A;  1SNC A;  2LMC B;  3BYT B;  2K28 A;  4I7Z C;  3H6M A;  1EIH A;  3DWQ A;  4DK1 A;  1MSG A;  4C3H G;  3EA6 A;  1R4Q B;  1E2V A;  1FGB D;  3NPP A;  3TSS A;  5C3X A;  2E2D C;  4ZRZ A;  3DUZ A;  1STY A;  1OXX K;  5M5X B;  2JEB I;  2B2V A;  3FDT A;  3OWF A;  3T4A C;  1TR5 A;  3V96 A;  2LY7 A;  4FO2 A;  2OT2 A;  2N88 A;  3OHX C;  4A3K B;  4RH6 A;  1HTL D;  1JOK A;  4IUP A;  4K8I A;  2RKS A;  1JOO A;  4K6L A;  1LTA D;  2WAQ B;  3MA2 B;  2MGS A;  1PRT C;  5IGB A;  1V1P A;  2KHS A;  2O5J C;  1JWM D;  3P75 A;  5CGK A;  5C0X H;  3I73 A;  3K5N A;  4KD4 A;  3I3C A;  5T1G A;  3KLS A;  2XWJ B;  4RGT A;  3BZD B;  3QG1 A;  1I3Q B;  4HN7 A;  4FF3 A;  3CRK C;  4KN7 C;  3TBI B;  3NTK A;  2DY8 A;  3H91 A;  1SFO B;  3GQB A;  5IGF A;  1PFN A;  2B8G A;  2EPB A;  3NSW A;  3OMC A;  4TQU S;  2F0V A;  4N9P A;  2ZXR A;  4C3I B;  3J7A F;  1PZJ D;  2J4X A;  1WTO A;  2OEO A;  5NUC A;  2Z8L A;  4XYQ A;  1D2B A;  4DGZ A;  4KV6 A;  5HGT A;  1BNZ A;  4FF2 A;  1II3 A;  2RBM A;  3PUX A;  2AQ3 B;  2IW3 A;  3IFT A;  3ITP A;  3NQT A;  4P2C B;  2BE5 D;  2A6E C;  4DFA A;  2BDO A;  3EQL C;  2TMP A;  4U67 3;  1QJO A;  2PCF B;  4IUQ A;  3M7N A;  3CHB D;  1TS5 A;  1V43 A;  1JWU D;  2L11 A;  3PO3 B;  4FXK C;  1BO0 A;  3GTO B;  3SR1 A;  4NMZ A;  1Z47 A;  2KED A;  1GOZ A;  4CBV A;  2F0E A;  4H44 C;  3MWY W;  1TKW B;  4PMB A;  1DD2 A;  5D14 A;  2F3W A;  3W3A A;  1BCP B;  2HQE A;  4C3J G;  1KNE A;  4KHZ A;  1EL0 A;  2IX0 A;  1MGS A;  5DNF A;  5J39 A;  4F88 A;  1Q12 A;  4ZKC B;  2Z4I A;  5KGU A;  1I50 B;  1CK1 A;  1U4R A;  5EKL A;  1SYD A;  3MTS A;  2JE6 I;  4RFB A;  3MVV A;  4KTA A;  2R7Z B;  2F0M A;  4BA2 I;  5D65 A;  1Z7T A;  1EWC A;  1GUO A;  3J81 L;  1KLU D;  3I8Z A;  1OXU A;  2Z4H A;  2K6A A;  2MPM A;  2K33 A;  2NUC A;  3M4Y A;  3MXP A;  5G3L F;  1AZP A;  4BY7 B;  2XIW A;  1S5D D;  1RDP D;  5COY A;  1U4M A;  1A3V A;  1EZ8 A;  5K36 H;  1IYV A;  5BN4 A;  4BS9 A;  1X32 A;  1K83 B;  4A3I B;  3HOZ B;  1SYG A;  5CV4 A;  3TN2 A;  3GTQ B;  4FF1 A;  2K05 A;  4R9W A;  1T5X D;  1U4P A;  2FFK B;  1ESR A;  2B2U A;  2VUM B;  5IGC A;  1J9O A;  3QWN A;  2WP8 J;  4DAY A;  4RGO S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...