1F9SA

Crystal structure of platelet factor 4 mutant 2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
DGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGSKICLDLQAPLYKKIIKKLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET FACTOR 4
publication title Structure Comparison of Two Platelet Factor 4 Mutants with the Wild-type Reveals the Epitopes for the Heparin-induced Thrombocytopenia Antibodies
rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 10
structure length 66
sequence length 66
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9sA00
4DN4M 1B2TA 4UAIA 3TZDA 1AZQA 2L4NA 4CJ2C 1RTOA 1BO0A 1PFBA 4NW2A 2B2VC 1U4PA 2SDFA 3I90A 5EPLA 1HRJA 3DEOA 1RODA 2R3ZA 2B2TC 1S4ZA 3SVMA 4X3KA 4IURA 1QNKA 5CMDA 1NCVA 1CM9A 1JICA 1DOKA 2JP1A 2K05A 3F2UA 1F9RA 3I8ZA 2KEEA 4U68A 1B3AA 1KNAA 4R9WA 2B2VA 2EOTA 1ILPA 1RHPA 2B2TA 4CJ0B 2NWGA 3ONAB 3I91A 1E0BA 4ZK9B 1O80A 4IUPA 2CVRA 1HFGA 2L9HA 1EOTA 4XT1B 1MGSA 1U4LA 4X3UA 1WTXA 2DY8A 1AZPA 1U4RA 1O7YA 2N88A 4RAUC 4QUFA 4MN3A 4QUCA 1KNEA 1F2LA 1HHVA 1NAPA 5COYA 1QG7A 1EIGA 3HP3A 5T1GA 1ICWA 2H1EA 1JE4A 5EPJA 1MSGA 3FDTA 1RJTA 5D14A 2FJ2A 2N55A 2EPBA 5D65A 1ESRA 1VMPA 1X32A 1G2TA 1U4MA 5EQ0A 1IKLA 2KECA 2NZ1D 1AP0A 2RVLA 2K28A 1G91A 3DM1A 1B4OA 1NR2A 2XIWA 4HAEA 4XDXA 3H91A 1PDQA 1C8CA 4RA8A 2NYZD 1O7ZA 5E4XA 2VXWA 3DEPA 2FHTA 1B53A 4MHEA 1ILQA 3I3CA 2MGSA 2EE1A 1WTOA 1EQTA 1DOLA 2KEDA 1WTVA 3IFDA 1HUNA 3QO2A 1WVLA 2K03A 2HUGA 2KVMA 1BBXC 1SDFA 4RWSC 2MP1A 3R93A 1HUMA 1X3PA 4HCSA 2KOLA 2HDLA 1IL8A 1A15A 5EKIA 2X6LA 5E4WC 1WTQA 2BDNA 4ZLTF 4IUVA 4X3SA 3Q6SA 4IUQA 4OIJA 1QE6A 2B2UC 2B2WC 2K01A 2MJ8A 4IUTA 4X3TA 5CBAE 5CBEE 4ZAIA 1F9QA 4HSVA 1LV9A 1SAPA 4LMQD 1WD1A 1EL0A 3MWYW 2M2LA 1G6ZA 1EIHA 5JJZA 1ZXTA 4ZKBB 1CA6A 5AFWA 2FINB 2D9UA 2HDMA 5EJWA 2X69A 3UI2A 1NR4A 2B2UA 1F9PA 4XT3B 3FPUB 2B2WA 3G7LA 1XYIA 3D6WA 2L1BA 5EPKA 2FFKB 1DZ1A 1PFNA 3KUPA 2B2YC 2L12A 5CORA 1G2SA 3N52A 1RTNA 1BF4A 1CA5A 1XX8A 3GV6A 3MTSA 2Q8TA 1MI2A 2MPMA 1PLFA 4CJ1B 1B50A 2K1BA 2Q8RE 1ML0D 1GUWA 1BNZA 2JYOA 2B2YA 3KBXA 2KUMA 2J7ZA 3GV3A 1HA6A 4IUUA 2L11A 2FMMA 3P7JA 3IL8A 2X6GA 1VMCA 2IL8A 1WD0A 4HEDA 1WTRA 1DOMA 1SSOA 2HCIA 5T1IA 2RSNA 3LWEA 4O42A 1TVXA 3TN2A 5DNFA 1J8IA 1DONA 1PFMA 1X3QA 2K04A 2RSOA 2DY7A 1MSHA 1WTWA 1WTPA 1HFNA 1F9SA 2RA4A 4OIKA 1IKMA 1M8AA 1Q3LA 1J9OA 4R8IA 4ZKCB 2HCCA
chains in the Genus database with same CATH superfamily
3RZDB 3CCJA 3C2PA 4FXKC 3MXPA 4WJ4A 4K0KQ 1RKNA 1HRJA 2E2HH 1KAWA 4IURA 4X62L 2HIXA 4DV0L 1NCVA 1JE5A 2NZHA 3AQQA 1RD9D 3J81c 3L2PA 2BA0A 1LTBD 1QUQA 4A3BH 3HOWH 3I91A 1SYFA 1WYDA 2A6EC 3GTOB 4X3UA 2K33A 5C3EG 3CCUA 4BBRG 3TP7A 4CDDC 2PZUA 3D4RA 4JI7Q 5GAGC 4GLXA 3UE0A 5JJKA 3TS2A 2F0KA 4EX5A 5FO9B 3MFYA 3NTHA 5EPJA 2QA4A 5FJ8H 2F0NA 5I4DA 1UNSA 1VMPA 1I6VC 3H3VI 3AMUA 3M3YB 1L1OB 2I5HA 2MFIA 4FF1A 1L0XB 1SNMA 4HAEA 4L5QA 1VQ9A 2DN8A 2YU9H 2F4IA 4JI0L 1JR0D 4PZ8A 4MHEA 1ILQA 3M4OB 3QJYA 1EY6A 1KLGD 4YHHL 4R8NA 2OTLA 2F0SA 3RUZA 1IBLL 4IUVA 4MZ9A 1V1PA 3D3RA 2R6GA 5JPNC 1CTMA 1B9NA 3P20A 1D7QA 1KXLA 4DAYB 1Y14B 5LMNQ 1G6ZA 1H9KA 4OO1I 3RD4A 1N36L 5L37A 2E2HB 1NR4A 3QIAA 5EPKA 3I72A 4DV1L 1TXYA 4RGOS 5CORA 4A3BB 4DXGA 2Q2IA 1OXXK 3HOWB 1XTCD 4GOPC 2K4KA 1BNZA 4CHTB 1VQHA 3CP0A 2FXQA 4M8AA 2X6GA 5E1FA 2CH4A 5C5MA 1SEBD 1Y69U 1QZHA 1I3QH 5CYUA 2RA4A 2VUMG 4LFCL 4DR4L 3NBIA 2XTIA 1LT6D 3T1HL 4PMBA 2HHHQ 5CV8A 4UAIA 2F3IA 2GN5A 1EQRA 1HR0Q 3TZUA 1R9TH 4CDCC 1PFBA 4A3MG 1QVGA 4CKCA 1PA6A 1S4ZA 4X66L 3B6YA 2JP1A 4GN4B 2AHOB 3I4OA 3L9AX 1N34L 4CDFC 1N8RC 2WKCA 1W6JA 4IUPA 4L8JA 3S17H 5M3MH 2K5VA 1VQ7A 5EAYA 2SNSA 1U5KA 4MTNA 1F2LA 3S9WA 4PZ7A 5COYA 5BN5A 4V0BA 1IBKL 2VS1A 1VQJA 1K3RA 1EFWA 1ESFA 1KD1C 3UDFA 4BS9A 4G7ZC 5LL6S 4DR2L 2OT2A 1YNXA 1NSNS 5AJ3L 2EE1A 3ERSX 3TP8A 1VQDA 1I3QB 1ENFA 1QILA 1NTGA 5M5WH 1LTLA 1B9MA 3H3VH 3HOUG 2HDLA 2WAQB 1IYVA 1DD2A 1HNWQ 4NP5A 2XNAC 1FR3A 5C4ZA 4QCLA 1XMQQ 1TS2A 4RCOA 4K0KL 1F77A 1EL0A 1R9TB 1CHPD 2KA7A 2LY7A 1I4PA 2GVAA 2HDMA 2Q2HA 1J5EQ 1YNNC 4YWMA 2B39A 4S3SA 1CFMA 2E5LQ 3D6WA 4G7OC 4OL7A 4ALPA 1VQMA 1Q82C 1E3PA 3S17B 1GUWA 2HIVA 3AU7A 5M3MB 4DK0A 3HOVH 4JI7L 2BA1A 5IYBG 1YIJA 4C1NI 5IYCG 3TQYA 1G8ZD 2MO0A 1SSOA 4EQOA 1S40A 1TVXA 5IE8A 1PFMA 3S2DH 2RBMA 1BVSA 5BR8Q 4IFDJ 3G48A 1PZKD 1K3BC 2K5WA 2K6AA 4DAPA 3DM3A 5IIFA 2OXPA 2EXZA 1B2TA 1UEAB 1ENCA 1Q46A 2Z6KA 2Q8IB 2F0OA 5LL6X 3TEHB 5KNDA 1N32Q 1C48A 4DV2L 3BG3A 3M7GA 2WAQE 3DEOA 4XQNA 3BDLA 5CMDA 4A3GG 2MO1A 2KCCA 3F2UA 1Q1BA 2ZXPA 2F0LA 5EBCA 1XPOA 3HGBA 1KRSA 4OWWB 2JA8G 5M5WB 2EOTA 4JI5Q 1Q81C 4A3CH 4A76A 1X54A 2CWAA 1A62A 5CR3A 3PF5A 1TY0A 4FF4A 5DM73 1BBUA 3W2DA 2QEXA 5JEAH 2UXBQ 4AYBG 5LMNL 4K2KA 4DUYQ 3T51B 1NAPA 5A2QE 4V190 1YITA 5KNBA 3L3OC 3NBHA 4JI1L 5EQ0A 4OHJA 1SBBB 3S14H 4KKUA 2OCEA 2XIWA 1SNOA 4UHVA 3C1EA 1K8AC 3NUCA 1TS3A 4DUZQ 4A3DG 3HOVB 1K0RA 1SE8A 4CKEA 1DOLA 1EWIA 4GKJQ 3IFDA 1K0SA 2E2IH 3T13A 4HIOA 4PG3A 2HUGA 5G3LD 3K59A 4A3JH 3S2DB 3BVGA 1QZGA 1Y1WG 1A15A 3C46A 5E4WC 3KK7A 2HHHL 1EWHA 3GTGH 1Q7YC 3I70A 4KJNA 4IUQA 4QGUA 1LTAD 1X56A 1HR0L 2A68D 2EZVA 3K58A 3CCMA 3K6OA 1LV9A 4N9PA 4RKLA 5EGTA 5EJWA 2PO4A 2R7ZG 4LWCA 1Y8OB 1RTNA 4B9WA 2R92H 1H9MA 4OELB 2LXJA 2AUKA 3I4NG 1NNXA 4CJ1B 4HTHA 3NQTA 2B2YA 3OW2A 4IUUA 3M9BA 3F2BA 4K5XA 1LABA 3GTPH 2HCIA 4NXNQ 1X3QA 1VQGA 3G4SA 1TY2A 1GM5A 1A8VA 4OIKA 5ELBA 2AUJD 2QDBA 3S14B 3A0JA 3CMAA 1RIPA 1U4PA 4L63B 5EPLA 3SHLA 3HZXA 2E2IB 1KHIA 1VF7A 3W5OA 2RKSA 4A3JB 3I4MG 3AFPA 2E8GA 1HNWL 1YNJC 2KQ3A 5K36G 4KHPQ 1DCZA 3GTGB 1XMQL 1AZPA 4FVMA 2PQAA 3FVQA 5M5XH 4A93H 5KYIA 5IT9c 5TSSA 1J5EL 3ZJYC 1DGSA 2E5LL 3HP3A 1MSGA 1FD7D 2F0EA 2FJ2A 3CKIB 1XPRA 2EJMA 3VYTA 1CI3M 3W1BA 4C3HH 2R92B 1B4OA 1YVCA 1R4PB 4GNXB 5E4XA 2FHTA 1Z7TA 2JE6I 2DJFC 1WTOA 1WCMH 3QO2A 4X64Q 4R4TA 2KHIA 3GTPB 1HNZL 5J3BA 2F0QA 5BR8L 4DV6Q 5FKAC 4N8X1 1CQFA 3D4DA 2B63G 1STAA 3V96A 4YCUA 4DR5Q 3SEBA 4UP8A 2CFMA 1A3TA 3NPPA 1N32L 1H9RA 4KD4A 4YIJA 2TMPA 2D62A 3D31A 2JA6H 2BH8A 3PF4A 4JI5L 2G9HD 4FO2A 4K14A 1X55A 1E2ZA 5C0XJ 3K5NA 1EFID 5GROA 2YTVA 2F0IA 1XX8A 3MTSA 4OX9Q 1S5FD 2UXBL 3LWUA 4HIKA 1YBYA 5GAEC 4KKSA 3I4LA 2D0PA 1STGA 2UXCQ 1EY0A 3PQIA 4DUYL 2P5ZX 2IT1A 4FXDA 3P7JA 4A93B 4HEDA 1WTRA 1ZYRD 1E22A 1WTWA 2BOSA 3U4ZA 1B1ZA 5FLXc 3ND9A 1HFNA 3VA5A 4A3IH 3F2CA 2AQ2B 2NVQH 5JPMC 2O5IC 3S16H 4C3HB 4A3FH 1H9SA 3ERQA 4DF7A 4DUZL 1HQMC 3TZDA 3J81L 4GN5A 4GKJL 1PXUA 2ATWA 4GLAC 4C1NK 3CCQA 1WCMB 4NMZA 4AIMA 2JXMB 1PYSB 1SE2A 4GKKL 1B3AA 4R9WA 2ES2A 2F0GA 4ZK9B 1QNUA 4FYDA 3D6CA 3TP5A 4XT1B 1MGSA 3SK4A 3URYA 4JPBW 1A2TA 1ONLA 4DK3C 3R3OA 2LSSA 1V1QA 3JC66 1JCKB 4YY3Q 3MAQA 2HQLA 2V4DA 2H5XA 3FDTA 2JA6B 3MFGA 2EPBA 5D65A 5ELOA 3FKIH 3I55A 1HCZA 4UP9A 2CW0D 4GS3A 1G291 3CRLC 3J80c 3GTLH 1ZYRC 1YHBA 1FNVA 4RA8A 4LJZC 5DLQE 3U4VA 1SMYD 3DMUA 5C44H 1FJGQ 4NXNL 3A56A 3NK9A 2KCMA 4CKBA 1SDFA 3H09A 5M5YH 3DXJC 2N3SA 2LKVA 5IP7G 5FK9C 4YWLA 4R4QA 1YJNA 4A3IB 1BXTA 1JB3A 5IP9H 1NE3A 1XNRQ 2NVQB 3S16B 4Q5VA 3OMCA 3SDZA 4A3FB 1GUOA 2YTXA 3U9SA 3OTOQ 1WD1A 4L5SA 5FLMH 1HZBA 1LTID 3H0GG 2B2UA 3K57A 3FPUB 4JBMA 1KTKA 4KHVA 4KHZA 2RDGA 1C7YA 4IFDG 3KJOA 2K32A 4KHPL 1I94Q 3NELA 2KENA 4FF2A 1I5FA 1KDBA 3GV3A 2SOBA 5LMUQ 2LXKA 2L5TA 4BBRH 4BXXG 2IL8A 2PI2A 2PZWA 3PSIA 4FP5D 2RSOA 1Q90A 3OWEB 4O2DA 3FKIB 4LF6Q 1VQEA 1GOZA 1FGBD 3IFTA 4R8IA 3VR4A 3GTLB 4FXGC 5KYLA 3H6MA 4L5RC 2MUYA 2HD3A 3A8KE 2C5CA 4G57A 3CCEA 4X64L 4IJLA 1K9MC 5C44B 2Z8LA 2A6HD 4WFN3 3I56A 3CC7A 4OEMB 3A7AB 5M5YB 4U68A 1PHJA 1LT4D 1NMFA 5DM63 3K0YA 2NWGA 4DR5L 2K14A 3Q22A 1EOTA 2NTTA 2EXDA 2NVTH 4QUFA 4IPHA 2PMZB 3AYHB 3GTMB 3QWNA 2ASBA 3D4WA 3CCLA 4A3KG 3MXNB 5KNCA 3STBD 3EVQA 3GP7A 4OXPA 3GDEA 1VQOA 4OX9L 2QEJC 3HOXG 4IO9A 1X65A 2Z1CA 1NR2A 2UXCL 3KDFA 2K5NA 5M3FH 2NYZD 3M4QA 2AQ1B 3I3CA 4BBRB 1EQTA 4JI8L 1BCPB 4CBVA 5IYDH 4RG1A 1U0LA 4JI4Q 2K03A 1VQCA 1EY8A 2EYHA 4K2LA 5JEAJ 2NVXH 4NPSA 1TWHH 3IAYA 2ZJRA 2KOLA 1LT3D 1IL8A 3GQBA 4K5VA 3S1MH 2BDNA 2QGQA 4L5TA 4ZLTF 1PH5A 2A6HC 2IX3A 4OIJA 1S5ED 5ELFA 3NEMA 1SAPA 4LUOA 1YHQA 3TS0A 1EIHA 3GTQH 1PRTB 2FINB 3KF8A 3PO3H 5CV5A 1VQ6A 1DJRD 2K5DA 2B2WA 2L1BA 3NWSA 1B3QA 1G51A 4PMWA 4H02A 3JAMc 3CCVA 3BVZA 2DGYA 3E9HA 4POGA 2PMZE 3PCOB 1PV4A 4AH6A 1KL9A 2JYOA 3D0FA 3STBC 3M85A 3PIOA 4F7XA 2NVTB 4KI0A 4DKAC 4YY3L 4C2MH 3HKZB 3MC0B 4E6IA 2YV5A 4JC0A 3R2IA 1MSHA 3PUZA 3OYYA 4R4OA 3CCSA 3K81C 4J8QA 2K5QA 4DR6Q 2J4XA 5C5LA 3PUWA 4P75A 5M3FB 4KTAA 1AZQA 1AH9A 2L4NA 1RTOA 4P73A 1BO0A 3I90A 1MJCA 5I6YA 1SROA 3NWTA 3S24A 3MVVA 4LF7Q 2O2LD 2EYPA 2NVXB 5C3WA 4IZ8A 1TWHB 1Z47A 3A8JE 4JOIC 1I4QA 3ULJA 1XNRL 3S1MB 1CK1A 1PH1A 1HXYD 3S2HH 1U4LA 3VA7A 3OTOL 1SRUA 1EIFA 3G6JB 4IOCA 3GTQB 1S5CD 3PO3B 3HOWG 1T5XD 1D5ZC 2Q2TA 2YU9B 1D8LA 5D14A 1QWYA 4RFBA 3HOZG 1I94L 1TIID 4BY1H 1QUQB 3KDFB 2LFNA 2EY5A 3HKZE 5LMUL 2B29A 2CQOA 5FJ8G 1B53A 1NMGA 3A5UA 3ZYYX 4XIGS 2PNRC 1CZWA 1ZEQX 4H0LC 1CZGA 3OMGA 4C2MB 2F4VQ 1PH4A 1SNDA 5K5PA 4LF6L 1TKWB 2F3WA 5C0XG 3DLLA 2IJ0A 2XVSA 4K8JA 2CQAA 5J1ZA 1BR9A 4EVOA 3V2TA 1OO9B 2NUCA 1Q1EA 5AFWA 1YZ6A 3GO5A 4RMFA 4XT3B 2HT1A 1EY7A 3WWVA 1AW7A 1KABA 1HH2P 3OSOA 1VDZA 2JA8H 2UUBQ 4XTCS 1Y1VG 3KOJA 1LT5D 1V1PB 3S2HB 1SYEA 2MNAA 1MKHA 1IBMQ 3A55A 4A3LH 1JJGA 4GOPA 3TN2A 2RSNA 1NBWA 1I4GA 1GD7A 1EEFD 4DR7Q 1EU3A 1V43A 2D2CC 2E74C 1K8MA 4BY1B 1AE3A 2AWNA 1J9OA 3I73A 4RHSA 4EQNA 3BZDB 1KQSA 2WAQG 2B2VC 2SDFA 3M4YA 4JI4L 3EBEA 2WINB 4PZ6A 2WIIB 4GNXC 4OO1H 1EOVA 1VQIA 4KY6A 1Y1WH 5IT9L 1MD2D 4WJ3M 1O80A 2L9HA 3DWPA 3O13A 4XXEA 1M4VA 1IYJB 4POFA 4QUCA 1XTDA 2QF7A 4ZCKA 1YHAA 1VQ8A 2PZTA 3BZKA 3EFXD 2SEBD 5M3MG 1UE6A 1KLUD 1ZKOA 4ODGA 5EKKA 1SJHD 3G6EA 3Q0AA 2JA8B 1W6KA 3J81E 3NENA 3AB9A 3DM1A 4IN3A 3I4NH 2Z6BA 2EIFA 2N78A 3F2DA 1LM0A 5DEHA 2Q2UA 2RCNA 3PMFA 5F2DA 2JJQA 4JW0A 1QCBD 1RL2A 4C3IH 3QOLA 4RHRA 2DJGC 1A6XA 2ENBA 1PH3A 4DR6L 4I7AA 3FMCA 3S1RH 2IX1A 1GUGA 5JOBA 2B8GA 1EYGA 3E3XA 2M2LA 5JVH3 1SFOH 1S5BD 1CA6A 4ZKBB 4LF7L 2X69A 5C4XH 2F0MA 3C1FA 2IHFA 4QL5A 4ZUJA 1K8GA 1VQFA 1N33Q 1EZ6A 1Y1WB 3KLSX 2JA5H 3GV6A 1K8OA 2MPMA 4IPDA 1EYCA 4PQXA 1UUPA 5FLXL 1JORA 1SMXA 1X3GA 1AFPA 1KRTA 2F0TA 4DK1A 3PO2H 2I46A 2CCZA 2EQSA 4B3MQ 1EZ8A 4X65Q 3HOVG 3P75A 1M8AA 1Q3LA 2F3VA 2NN6I 1A3UA 1IHZA 1XMOQ 3R8BA 3I4NB 4P71A 4DA2A 4YCWA 1SN8A 3GD7A 1TQOA 2OWOA 4R4IA 2F4VL 2R7FA 4X3KA 4O0AA 2PYKA 4P72A 2K05A 3RN5A 3I8ZA 4C3IB 1KNAA 1VQ4A 1SNPA 5ELEA 1II3A 1OTCA 1B7YB 3PGZA 3S15H 1I50H 4JG2A 1UE5A 1QOHA 2N88A 2F0VA 2ZJQA 3S1RB 1Q8KA 4A3CG 1VQBA 1SFOB 2HQEA 3J80L 3VYUA 4C3JH 4WRDA 5D3IB 2NB0A 2ICEC 3EROA 3KLSA 1N9WA 4LK1C 5C4XB 1ESRA 2QDLA 3K5OA 5JEAG 2YTYA 2UUBL 2KECA 2NZ1D 2KJXA 5C3XA 2JA5B 1O78A 2A8VA 1TWGH 2A68C 2UU9Q 1STHA 1EU4A 1W3SA 2ZTCA 1SE4A 3F8TA 2WB1G 2GVBA 5KRUA 1IBML 1PFSA 1GUTA 1UAPA 1ASYA 1S3OA 4APVA 5ELNA 3HS0C 4B9XA 4DR7L 1BBXC 1SNCA 1CUKA 2ZTDA 3HOYH 3PO2B 1SYCA 3NBHB 4LF5Q 1STEA 4QF4A 2RF4A 1I6HH 1PTOH 4X3TA 3Q24A 4TVAB 4A3JG 1PTOF 2Z9HA 1BCPD 2PPBC 3NTIA 3TMEA 1ZXTA 3NE5B 3CC4A 1I4RA 1GHKA 1QJOA 2EYMA 3G7LA 3CF5A 3BZCA 3K8AA 3MXGA 2L12A 3U58A 3OWFA 1LTTD 4BA2I 4G7HC 1K83H 1P8LA 4KK7A 3S15B 2F1MA 1ML0D 3KYHC 2DUDA 1I50B 1LTRD 3BDCA 2XWBB 2IPKD 3J7A5 1PRTD 1Y8PB 1NY4A 1VQNA 2R92G 4O42A 1J8IA 4C3JB 3BS1A 1KC8C 4RH6A 2UUAQ 5BN4A 1NJIC 1OXSC 4F8MA 1F9SA 1VQKA 2EYJA 2E76C 1BKBA 2Y0SG 3EJIA 1IYUA 4DGZA 3T1YQ 2A69D 4B3TQ 1TWGB 4K8IA 2DNCA 3HG9A 4P2CB 5DAUA 3WOFA 2F0DA 3VR5A 2LMCB 2KHSA 1I4XA 4ME3A 1RODA 2R3ZA 2B2TC 2M9VA 1IZ6A 1JICA 3A74A 3CXCA 4DV5Q 1W2BA 1S5DD 5M5XB 4IOAA 5IP7H 3HOYB 2F03A 2AKWB 2NN6H 3IRBA 2RDFA 3ONAB 5IODA 4LFAQ 3J7AV 1G6PA 1TS5A 4ZYSA 1LTSD 1WTXA 5HGQA 4BBSH 4DK6C 4DV3Q 4DV7Q 1PTOB 1I6HB 2R93G 3PIP3 3UDIA 3ICEA 2C9OA 5FO7B 4BY7H 1MIUA 4OGQC 1L2FA 3H0GH 3UDGA 4XYQA 1N33L 1L1OC 1BBWA 1TU2B 4QQBX 1IKLA 1AP0A 1HTPA 4A93G 1YJ9A 4JCVE 2VL6A 4HSPA 2VXWA 1TS4A 4R4CA 2PQAB 1PH2A 3S1QH 2XRSD 2K52A 4FF3A 4C3HG 2KCNA 2A69C 2KVMA 4BWGB 4B3ML 1LO5D 4X65L 2QILA 4OWXB 1X3EA 5IGCA 3CCRA 3OIPA 3KF6A 5KEEA 1E2WA 1XMOL 1QE6A 4PMCA 4HIDA 4RGTA 4LAAA 1TT2A 5M9OA 3I2ZA 3EA6A 4GN3B 2R61A 3JAML 1UE1A 1PH6A 3SE0A 1UEBA 1CKNA 1RCVD 2EDGA 2TSSA 5E3FA 1DZ1A 1TWFH 4P74A 1IW7D 2D5DA 2N49A 4RGNA 2JN4A 1EY5A 3UE1A 1V1OA 2JA7H 4ABNA 1EY9A 3KBXA 4BBSB 4HJ8A 1WD0A 2XGTA 1DOMA 4BY7B 1PH7A 2NBFA 3QR8A 4HMJA 4JYAQ 4KN7C 3H0GB 2DY7A 3NQIA 4M1UB 1VCIA 3KFUA 3VR6A 5IGEA 1EQVA 5C0XI 2UU9L 2CHBD 4CGYB 1QVCA 4DNRB 4HJAA 1TWAH 3S1QB 4HJ9A 3K7UC 4HN7A 4A3EG 4A3IG 5C3EH 1QNKA 3FRPB 1YI2A 4A3FG 4KY7A 1BCPF 2CW0C 2I5MX 1L1OA 3LGJA 5E7NA 4LF5L 2A74C 1B8AA 2QKIC 3J81i 1YJWA 3MZ5A 1EUJA 1SLJA 4LUZA 1K28A 1GUSA 3WDNA 1H9SB 1SMYC 2JEAI 1LLRD 3GTKH 3DWQA 4LFBQ 5KGUA 5A35A 4DAVA 1HHVA 1QG7A 1TWCH 4QIWB 1EIGA 3CW2C 5D3DA 3PIO3 1I4HA 2H1EA 3ULPA 3AFQA 3MHBA 3CHBD 1X32A 4WORA 1G2TA 1PRTF 1TWFB 4DV6L 5GADC 4DPGA 3SK8A 1C8CA 2JA7B 2A6ED 4DAYA 3X3MA 4Y52H 2F0PA 1Q86C 2Z4HA 2YYZA 3E0JA 3FKIG 3HEJA 2L0CA 3TREA 4KKTA 2UUAL 5IT9E 4RWSC 2FMCA 1VQPA 3X3NA 2IHEA 4HCSA 4KD3A 1EYDA 1JB7A 5EKIA 3JAMi 3T1YL 1SYBA 2JA9A 2RDHA 4ZUIA 5C44G 4PNYA 1D2BA 4KJOA 2WP8J 3GTJH 1TR5A 1XXGA 5CBEE 2XN9C 1XJVA 3T56B 1TWAB 4UP7A 2D9UA 2AQ3B 2EY6A 3ER0A 4DV5L 5C3EB 4LUVA 2G9DA 1JWMD 3SR1A 2I07B 1HJPA 4LFAL 4NXMQ 2PCFB 3AEVA 5FLMG 5CV4A 4HMIA 1PZID 2OQKA 4QIWE 4DV7L 4DV3L 2RHSB 2VUMH 1L0YB 1LUZA 2L11A 4TRDA 3DWAA 3GTKB 3P1HA 2IY5B 2ZM6Q 1FNWA 1JMCA 1P16A 1TWCB 3K7AH 3NP8A 4A3MH 2VW9A 1CHQD 1K73C 4PV1C 3HOZH 4DFAA 1KAAA 3EN2A 1D5XC 1JOKA 1BF4A 2M00A 4LNQA 2ALYB 1JWUD 4C56C 1EYAA 1T5EA 1KDCA 3CU7A 1HZAA 3SVMA 3KBGA 4B3SQ 2OQ0A 3H3VC 3FPPA 1F9RA 2G5DA 4KMUC 3A54A 3HRZC 1OXUA 5C0XH 1EWCA 1F2ZA 5FLXE 2VZAA 4RCNA 4GZYC 2DY8A 4DV2Q 4RGMA 3GTJB 2BH2A 1CSQA 2O4XA 4HCEA 1A2UA 2EY1A 5I2XA 1QVFA 1FJGL 1DYQA 4JBWA 5GQOA 1A0IA 5NUCA 2R7DA 3T4AC 1HZ9A 1IXRA 1Y1VH 2F0WA 3LNNA 4FDBA 3HKZG 2E2JH 3K80C 3HOUH 1PDQA 1KIXA 1GKHA 2UUCQ 1B70B 4MIUA 1Y8NB 2VUMB 1HUNA 2A1AA 1D6EC 4JYAL 4UPAA 5ISRA 1OXVA 4JI1Q 3K7AB 4XYOA 3R93A 5M3FG 5J22A 4A3BG 1X3PA 3PV0A 4A3MB 2ZXRA 1F2YA 3HOZB 4FNFA 3PUYA 1ASZA 3I7FA 4OWTB 5IYDG 4LF4Q 1XWEA 4LW1A 4CDEC 3BYYB 3J80E 2K01A 1E1OA 2PI2E 4IUTA 3E5SA 4ZAIA 1F9QA 4HSVA 2H4OA 4EQPA 3U50C 3KLWA 4R1JA 4TKOB 3RMHA 1QB5D 2BCOA 3RLFA 5BN3A 1XYIA 5IGBA 5H1SE 5IYBH 3DHQA 4EGVA 3KUPA 5IYCH 4LF9Q 1G2SA 1Z6HA 2WKDA 1WOCA 4HIMA 3ND8A 3VDYA 1PLFA 3PO3G 5ELDA 4LFBL 3QOJA 4QY7A 4UY8C 2J0TD 3IL8A 2A19A 1E7ZA 1YEZA 3CMEA 3DUZA 5LMNW 2NZOA 1DONA 3TSSA 1EQQA 2ICIA 3KF8B 4A75A 1YNND 2Z6KC 2ZT9C 1UWVA 3W3AA 2A5HA 2EYOA 2KHJA 4A3GH 4ULLA 1Y1VB 1D1KA 1XPUA 4Y7NH 2B8FA 3OOCA 1EEID 2E2JB 3HOUB 2ZTEA 3ULLA 1C0AA 2XWJB 1V9PA 3A5ZB 1O7IA 1M90C 2DNEA 2L15A 4IALA 2Z4IA 1CM9A 2KCTA 3E9IA 2KEEA 4IJHA 1JC7A 1GO3E 1ILPA 3VR3A 1HTLD 1LYLA 2F0UA 4QB4A 3LX0A 3L7ZC 2C35B 4RAUC 4B3RQ 4MN3A 3N6RA 4JOIA 2EJGC 1HR0W 1FGUA 3NTKA 5I2YA 3SGIA 1ICWA 1JE4A 1ICFB 3RNUA 1RJTA 4A3DH 4NXML 2OF1A 1F2MA 1U4MA 3D8GA 4ZQ3A 2RVLA 1PH9A 1E1TA 3MEFA 3E0EA 2BDOA 2EYFA 3ITPA 4N8FA 1PTOD 2AMCB 2ZM6L 1JWSD 4BY1G 4QJFA 4DR1Q 4O1NA 2JK8A 1LTGD 2MP1A 4MNOA 1JQYD 1J6QA 1WTQA 4DV4Q 1STNA 4X3SA 4A3GB 2R7ZH 4H7BA 4Y7NB 4K6DA 1S72A 2ZXOA 3CQZH 3L0OA 5IWAQ 1HNZQ 3U9OA 4B08A 4B3SL 1F9PA 4AYBB 1RDPD 2WACA 1E24A 5C4HA 2B2YC 5CV7A 4JI2Q 3TP6A 1GHJA 2ZJPA 3EIVA 3M4PA 3R2TA 3OIQA 2KUMA 2F52A 2E2DC 4DNIA 3LWEA 5DNFA 1D1IA 4XQQA 3IKJA 1PTOC 4A3DB 3CRKC 2D0OA 1WJJA 1STBA 1MHWC 4DN4M 4DXFA 4A3LG 1Q8IA 3I4MH 3JAME 2UUCL 2CWPA 4CJ2C 3TDQA 2K75A 1DXMA 4NW2A 1ET6A 5K36H 1IL2A 4K6LA 1R4QB 4F87A 1HZCA 3A8IE 4GOPB 5C4JH 2O5JC 2RCFA 2B2VA 2KBNA 4WJWA 3TRZA 2V1CC 4HJ7A 4LF4L 1SJED 4GNXA 4I65A 2CVRA 1HFGA 2K50A 2R7ZB 4UDUC 4MTKA 4AYBE 2MHVA 4OO1G 4BA1I 1FYCA 1VF5C 3CQZB 5LHY1 3RZOH 4GKKQ 1A3VA 1FNUA 4LF8Q 5J39A 3TBIB 3CAMA 1WFQA 4LF9L 3QG1A 1YNJD 1WI5A 2B63H 2I5LX 3T16A 1XNQQ 1STYA 1FVIA 3SK5A 4IFDI 1PZJD 3J7ZC 2F0JA 2KEDA 1JJCB 1V8QA 5JVG3 5GAHC 4DU9A 3E6ZX 1GVPA 1C9OA 2IWHA 2X6LA 3J7AF 4JI6Q 3K5LA 4DNTB 2E75C 4NKLA 3I4MB 1BQQT 5CBAE 1DM0B 4JVZA 4C3IG 2GA4B 2F0HA 3UDXA 3S1NH 2WB1B 5JJZA 4Q0FA 1SR3A 2VB3X 4JI3Q 4G4KA 5C4JB 2VQFQ 3MA2B 1PFNA 2XSCA 2RHQB 2SNMA 3J7YW 2B3GA 2Q8TA 4IPCA 5FO8B 2VB2X 4ZRZA 4B3RL 1GJXA 3VYSA 3F1ZA 5C6AA 4Z9CB 5C4XG 2NTSA 1ENAA 1A63A 1VMCA 2R93H 3RZOB 2UXDQ 5JJIA 1PYBA 2JA5G 1PVOA 3H94A 2K04A 4XQJA 4DR3Q 3FHWA 5ELCA 2CH4W 1H95A 1JOOA 4JK1C 5CV9A 3RN2A 3KLRA 3MEHA 5I9OA 1HNXQ 2AWOA 2CKZB 2B63B 3WOEA 1X6OA 3MXUA 3FP9A 3CC2A 3PO2G 5IOCA 4DR1L 3RLNA 2A73B 3M7NA 3A7LA 3SK6A 5IGFA 1CKOA 2PQEA 4F88A 2VQEQ 1RHPA 4DV4L 4AQYQ 4KN4C 4JBKA 4I7ZC 2WB1E 2Y0SB 1U4RA 1O7YA 1SYDA 5IWAL 2L55A 2JSOA 3KJPA 1PMRA 2F0FA 3S1NB 5HURA 4H13C 4K5WA 3T53B 1VQLA 1C4QA 1FL0A 4YCVA 2N55A 1JOQA 1RF2D 4JI2L 5HY6A 1E2VA 1JJ2A 2K28A 1G91A 4IPGA 1GUNA 4JV5Q 3H91A 4C3JG 1Z9FA 1BCPC 1ET9A 3J80i 4U673 1BUVT 4J15A 3BDOA 3BVMA 2EVBA 1HQRD 2MGSA 1WTVA 3Q23A 2R93B 4YWKA 4X62Q 4DV0Q 2K7VA 1HUMA 3SXHA 4NB3A 4DAMA 1CQVA 5IGDA 1WTHA 2OEOA 3Q6SA 3EQLC 2B2UC 4IFDH 4JI8Q 1PRTC 5JJLA 1CSPA 1OXTA 1K83B 3OPOA 4JBJA 3HOYG 4RKBA 1D5MC 1BOSA 4TSSA 4ILWA 3RLOA 4A3EH 1VS0A 4NDXA 1Q12A 2Y0SE 3OW7A 5G3LF 4L6TB 2IW3A 5FOBB 4BXXH 3BU2A 5I9PA 3N52A 3CPFA 3FEWX 1JT8A 1MI2A 3K0XA 1B50A 1NUCA 2Q8RE 3J81j 2EJFC 4KY5A 5CC4A 2VNUD 2N8NA 4JI0Q 3BYTB 1WCMG 4LF8L 5I6WA 5EBDA 5T1IA 5HGTA 5KIXA 5A2QL 1AE2A 1PH8A 4YHHQ 3OHXC 2BE5D 1EIYB 4ZKCB 2HCCA 1IBLQ 1HA5A 1AN8A 4IUNA 1XNQL 2WV6D 5IGGA 1H9JA 1BDOA 2OTJA 3NXWA 4ME5A 2JEBI 3MXNA 3NHHA 1N36Q 2JA6G 1DOKA 2PW7A 3BJUA 2PW5A 3C3LA 4JI6L 4DV1Q 2K5HA 2B2TA 4CJ0B 1E0BA 2QW7A 4A3KH 2NVYH 4EQ5A 1L0WA 5IY0A 3PUXA 3HOXH 1KNEA 4N9TA 3QB3A 4JI3L 2NN6G 4GLVB 5T1GA 2VQFL 3H15A 2EY2A 4A3EB 1B44D 2Z0SA 2RQXA 1VQ5A 3CD6A 3G71A 4BBSG 1KDAA 4HR7B 5JAVA 3VYRA 3RZDH 2WFWA 4LFCQ 4DR4Q 3GTMH 2LS01 4XDXA 3T1HQ 4BY7G 3PUVA 1CKMA 1X9NA 1CT1D 1O7ZA 1UE7A 4ID6A 3DEPA 2QCPX 2UXDL 2MQHA 3CPWA 1WVLA 2BE5C 1HPCA 3V05A 4DR3L 4X66Q 1IW7C 1EY4A 2PNHA 3RR5A 3PIPA 1N34Q 4A4IA 2JQOA 2XRQD 5CV6A 1SXTA 1T9HA 4TQUS 3GTOH 1HNXL 3K5MA 3W1GA 1LACA 2B2WC 2MJ8A 3HKSA 4J1MA 1M1KC 4J6HA 3HFZB 4LMQD 3MWYW 4H44C 1SNQA 4KV6A 3UI2A 1MJEA 1IBKQ 2FFKB 2VQEL 4HJ5A 4AQYL 3M3YH 1CA5A 4QMGA 5EKLA 3NSWA 5CGKA 2ID0A 3KF6B 4OONA 4A3KB 4DR2Q 1SE3A 2K1BA 1X3FA 2NVYB 1VQAA 2EYLA 2J7ZA 4B3TL 1HA6A 2FMMA 3M4OH 1GXDC 3HOXB 5AJ3Q 4X6AH 3VR2A 2I0QA 2JA7G 2VY3A 1U9RA 1WTPA 1CKNB 4KLKA 1MBYA 4IQZA 1AEXA 1PYWD 3Q8DA 1O7LA 1IKMA 1SYGA 5IP9G 4JV5L 2IX0A
chains in the Genus database with same CATH topology
3RZDB 3C2PA 4FXKC 3MXPA 1RKNA 1HRJA 4IURA 1NCVA 1RD9D 2BA0A 1LTBD 3I91A 1SYFA 2A6EC 3GTOB 4X3UA 2K33A 3TP7A 2PZUA 3D4RA 2F0KA 5FO9B 3MFYA 3NTHA 5EPJA 2F0NA 5I4DA 1UNSA 1VMPA 1I6VC 3AMUA 3M3YB 4FF1A 1L0XB 1SNMA 4HAEA 2DN8A 2F4IA 1JR0D 4MHEA 1ILQA 3M4OB 3QJYA 1EY6A 1KLGD 4R8NA 2F0SA 3RUZA 4IUVA 1V1PA 3D3RA 2R6GA 5JPNC 1CTMA 1B9NA 3P20A 1G6ZA 1H9KA 4OO1I 3RD4A 2E2HB 1NR4A 3QIAA 5EPKA 3I72A 4RGOS 5CORA 4A3BB 4DXGA 1OXXK 3HOWB 1XTCD 1BNZA 4CHTB 4M8AA 2X6GA 5E1FA 5C5MA 1SEBD 1Y69U 5CYUA 2RA4A 3NBIA 1LT6D 4PMBA 5CV8A 4UAIA 3TZUA 1PFBA 4CKCA 1S4ZA 2JP1A 3L9AX 2WKCA 1W6JA 4IUPA 4L8JA 2SNSA 1F2LA 3S9WA 5COYA 5BN5A 4V0BA 1ESFA 4BS9A 4G7ZC 5LL6S 2OT2A 1NSNS 2EE1A 3TP8A 1I3QB 1ENFA 1QILA 1B9MA 2HDLA 2WAQB 1IYVA 1DD2A 4NP5A 2XNAC 1FR3A 5C4ZA 4QCLA 1TS2A 4RCOA 1F77A 1EL0A 1R9TB 1CHPD 2KA7A 2LY7A 1I4PA 2HDMA 1YNNC 2B39A 4S3SA 1CFMA 3D6WA 4G7OC 4OL7A 3S17B 1GUWA 3AU7A 5M3MB 4DK0A 2BA1A 4C1NI 1G8ZD 1SSOA 4EQOA 1TVXA 1PFMA 2RBMA 4IFDJ 1PZKD 2K5WA 2K6AA 4DAPA 5IIFA 2OXPA 2EXZA 1B2TA 1UEAB 1ENCA 2Q8IB 2F0OA 5LL6X 5KNDA 1C48A 3BG3A 3M7GA 3DEOA 4XQNA 3BDLA 5CMDA 2KCCA 3F2UA 1Q1BA 2ZXPA 2F0LA 5EBCA 3HGBA 5M5WB 2EOTA 5CR3A 1TY0A 4FF4A 5DM73 3W2DA 5JEAH 4K2KA 3T51B 1NAPA 5A2QE 4V190 5KNBA 3L3OC 3NBHA 5EQ0A 4OHJA 1SBBB 4KKUA 2XIWA 1SNOA 3C1EA 3NUCA 1TS3A 3HOVB 4CKEA 1DOLA 3IFDA 3T13A 2HUGA 5G3LD 3K59A 3S2DB 3BVGA 1A15A 3C46A 5E4WC 3KK7A 1EWHA 3I70A 4KJNA 4IUQA 1LTAD 2A68D 2EZVA 3K58A 3K6OA 1LV9A 4RKLA 4N9PA 5EGTA 5EJWA 2PO4A 1Y8OB 1RTNA 4B9WA 1H9MA 2AUKA 4CJ1B 4HTHA 3NQTA 2B2YA 4IUUA 4K5XA 1LABA 2HCIA 1X3QA 1TY2A 4OIKA 5ELBA 2AUJD 2QDBA 3S14B 1U4PA 4L63B 5EPLA 3SHLA 3HZXA 2E2IB 1VF7A 2RKSA 4A3JB 1YNJC 2KQ3A 5K36G 1DCZA 3GTGB 1AZPA 4FVMA 3FVQA 5KYIA 5TSSA 3HP3A 1MSGA 1FD7D 2F0EA 2FJ2A 3CKIB 2EJMA 3VYTA 1CI3M 2R92B 1B4OA 1R4PB 5E4XA 2FHTA 1Z7TA 2JE6I 1WTOA 3QO2A 3GTPB 2F0QA 5FKAC 1CQFA 3D4DA 1STAA 3V96A 3SEBA 1A3TA 3NPPA 1H9RA 4KD4A 4YIJA 2TMPA 2D62A 3D31A 2G9HD 4FO2A 4K14A 5C0XJ 1E2ZA 3K5NA 1EFID 2F0IA 1XX8A 3MTSA 1S5FD 3LWUA 4KKSA 3I4LA 1STGA 1EY0A 2IT1A 4FXDA 3P7JA 4A93B 4HEDA 1WTRA 1ZYRD 1WTWA 2BOSA 1B1ZA 3ND9A 1HFNA 3VA5A 2AQ2B 5JPMC 2O5IC 4C3HB 1H9SA 3ERQA 4DF7A 1HQMC 3TZDA 3J81L 1PXUA 4C1NK 1WCMB 4NMZA 2JXMB 1SE2A 1B3AA 4R9WA 2F0GA 4ZK9B 1QNUA 4FYDA 3D6CA 3TP5A 4XT1B 1MGSA 3SK4A 3URYA 1A2TA 1ONLA 3R3OA 1JCKB 3MAQA 2V4DA 3FDTA 2JA6B 3MFGA 2EPBA 5D65A 1HCZA 2CW0D 1G291 3CRLC 1ZYRC 1FNVA 4RA8A 4LJZC 1SMYD 3DMUA 3A56A 3NK9A 4CKBA 1SDFA 3H09A 3DXJC 2LKVA 5FK9C 4A3IB 1BXTA 1JB3A 2NVQB 3S16B 4Q5VA 3OMCA 3SDZA 4A3FB 1GUOA 3U9SA 1WD1A 1LTID 2B2UA 3K57A 3FPUB 1KTKA 4KHVA 4KHZA 2RDGA 4IFDG 2K32A 4FF2A 1KDBA 3GV3A 2SOBA 2L5TA 2IL8A 2PZWA 4FP5D 2RSOA 1Q90A 3OWEB 3FKIB 1GOZA 1FGBD 3IFTA 4R8IA 3VR4A 3GTLB 4FXGC 5KYLA 3H6MA 2MUYA 3A8KE 2C5CA 4G57A 5C44B 2Z8LA 2A6HD 4WFN3 3A7AB 5M5YB 4U68A 1LT4D 5DM63 3K0YA 2NWGA 3Q22A 1EOTA 2NTTA 4QUFA 2PMZB 3GTMB 3QWNA 3D4WA 5KNCA 3EVQA 3GP7A 2QEJC 2Z1CA 1NR2A 2NYZD 2AQ1B 3I3CA 4BBRB 1EQTA 1BCPB 4CBVA 2K03A 1EY8A 2EYHA 4K2LA 5JEAJ 3IAYA 2KOLA 1LT3D 1IL8A 3GQBA 4K5VA 2BDNA 4ZLTF 2A6HC 2IX3A 4OIJA 1S5ED 5ELFA 1SAPA 1EIHA 1PRTB 2FINB 3KF8A 5CV5A 1DJRD 2K5DA 2B2WA 2L1BA 3NWSA 4PMWA 3BVZA 2JYOA 3M85A 4F7XA 2NVTB 4KI0A 3HKZB 3MC0B 4E6IA 3R2IA 1MSHA 3PUZA 4J8QA 2K5QA 2J4XA 5C5LA 3PUWA 5M3FB 4KTAA 1AZQA 2L4NA 1RTOA 1BO0A 3I90A 5I6YA 3NWTA 3MVVA 2O2LD 2EYPA 2NVXB 5C3WA 4IZ8A 1TWHB 1Z47A 3A8JE 1I4QA 3S1MB 1CK1A 1HXYD 1U4LA 3VA7A 3G6JB 3GTQB 1S5CD 3PO3B 1T5XD 1D5ZC 2YU9B 5D14A 1QWYA 4RFBA 1TIID 2LFNA 2EY5A 1B53A 3ZYYX 4XIGS 2PNRC 1CZWA 1ZEQX 4H0LC 1CZGA 3OMGA 4C2MB 1SNDA 5K5PA 1TKWB 2F3WA 5C0XG 2IJ0A 2XVSA 4K8JA 2CQAA 5J1ZA 1BR9A 4EVOA 3V2TA 1OO9B 2NUCA 1Q1EA 5AFWA 3GO5A 4XT3B 1EY7A 1AW7A 1KABA 3OSOA 1VDZA 4XTCS 1LT5D 1V1PB 3S2HB 1SYEA 3A55A 3TN2A 2RSNA 1I4GA 1EEFD 1EU3A 1V43A 2D2CC 2E74C 1K8MA 4BY1B 2AWNA 1J9OA 3I73A 4RHSA 4EQNA 3BZDB 2B2VC 2SDFA 3M4YA 2WINB 2WIIB 4OO1H 4KY6A 5IT9L 1MD2D 1O80A 2L9HA 3DWPA 3O13A 4XXEA 1M4VA 4QUCA 2QF7A 2PZTA 3EFXD 2SEBD 1KLUD 1ZKOA 4ODGA 5EKKA 1SJHD 3Q0AA 2JA8B 1W6KA 3J81E 3AB9A 3DM1A 4IN3A 5DEHA 3PMFA 5F2DA 1QCBD 3QOLA 4RHRA 1A6XA 2ENBA 3FMCA 2IX1A 1GUGA 5JOBA 2B8GA 2M2LA 5JVH3 1S5BD 1CA6A 4ZKBB 2X69A 2F0MA 3C1FA 4ZUJA 1EZ6A 1Y1WB 3KLSX 3GV6A 1K8OA 2MPMA 1EYCA 4PQXA 1UUPA 5FLXL 1JORA 1AFPA 2F0TA 4DK1A 2I46A 1EZ8A 3P75A 1M8AA 1Q3LA 2F3VA 2NN6I 1A3UA 1IHZA 3R8BA 3I4NB 4DA2A 3GD7A 1TQOA 4X3KA 2PYKA 2K05A 3I8ZA 4C3IB 1KNAA 1SNPA 5ELEA 1II3A 1QOHA 2N88A 2F0VA 3S1RB 1SFOB 2HQEA 3J80L 3VYUA 4WRDA 5D3IB 2NB0A 2ICEC 3EROA 3KLSA 4LK1C 5C4XB 1ESRA 3K5OA 5JEAG 2KECA 2NZ1D 2KJXA 5C3XA 2JA5B 1O78A 2A68C 1STHA 1EU4A 1SE4A 5KRUA 1GUTA 1UAPA 4B9XA 3HS0C 1BBXC 1SNCA 3PO2B 1SYCA 1STEA 4QF4A 1PTOH 4X3TA 3Q24A 1PTOF 1BCPD 2PPBC 3NTIA 3TMEA 1ZXTA 3NE5B 1I4RA 1GHKA 1QJOA 2EYMA 3G7LA 3MXGA 2L12A 3OWFA 1LTTD 4BA2I 4G7HC 4KK7A 3S15B 2F1MA 1ML0D 1I50B 1LTRD 3BDCA 2XWBB 2IPKD 1PRTD 1Y8PB 4O42A 1J8IA 4C3JB 3BS1A 4RH6A 5BN4A 1OXSC 4F8MA 1F9SA 2EYJA 2E76C 3EJIA 1IYUA 4DGZA 2A69D 1TWGB 4K8IA 2DNCA 3HG9A 4P2CB 5DAUA 3WOFA 2F0DA 3VR5A 2LMCB 2KHSA 1I4XA 1RODA 2R3ZA 2B2TC 2M9VA 1JICA 1S5DD 5M5XB 3HOYB 2F03A 2NN6H 3ONAB 2RDFA 3J7AV 5IODA 1TS5A 4ZYSA 1LTSD 1WTXA 1I6HB 1PTOB 3PIP3 2C9OA 5FO7B 4OGQC 4XYQA 1TU2B 1IKLA 1AP0A 1HTPA 4HSPA 2VXWA 1TS4A 2XRSD 4FF3A 4C3HG 2KCNA 2A69C 2KVMA 4BWGB 1LO5D 2QILA 5IGCA 3OIPA 5KEEA 1E2WA 1QE6A 4PMCA 4RGTA 4LAAA 1TT2A 5M9OA 3EA6A 3JAML 2R61A 3SE0A 1RCVD 2EDGA 2TSSA 5E3FA 1DZ1A 1IW7D 2D5DA 4RGNA 1EY5A 1V1OA 4ABNA 1EY9A 3KBXA 4BBSB 1WD0A 1DOMA 4BY7B 2NBFA 4HMJA 4KN7C 3H0GB 2DY7A 3NQIA 4M1UB 1VCIA 3VR6A 5IGEA 1EQVA 5C0XI 2CHBD 4CGYB 4DNRB 3S1QB 4HN7A 1QNKA 3FRPB 4KY7A 1BCPF 2CW0C 2A74C 2QKIC 3MZ5A 1GUSA 3WDNA 1H9SB 1SMYC 2JEAI 1LLRD 3DWQA 5KGUA 5A35A 4DAVA 1HHVA 1QG7A 5D3DA 4QIWB 1EIGA 3PIO3 1I4HA 2H1EA 3MHBA 3CHBD 1X32A 4WORA 1G2TA 1PRTF 1TWFB 3SK8A 1C8CA 2JA7B 2A6ED 4DAYA 3X3MA 2F0PA 2Z4HA 2YYZA 3E0JA 3HEJA 2L0CA 4KKTA 5IT9E 4RWSC 2FMCA 3X3NA 4HCSA 4KD3A 1EYDA 5EKIA 1SYBA 2RDHA 4ZUIA 4PNYA 1D2BA 4KJOA 2WP8J 1TR5A 1XXGA 5CBEE 2XN9C 3T56B 1TWAB 2D9UA 2AQ3B 2EY6A 5C3EB 2G9DA 1JWMD 3SR1A 2I07B 2PCFB 5CV4A 4HMIA 1PZID 1L0YB 2L11A 4TRDA 3DWAA 3GTKB 3P1HA 1FNWA 1TWCB 3NP8A 1CHQD 4PV1C 4DFAA 1KAAA 1D5XC 1JOKA 1BF4A 2M00A 1JWUD 4C56C 1EYAA 1T5EA 1KDCA 3CU7A 3SVMA 3KBGA 3H3VC 3FPPA 1F9RA 4KMUC 3A54A 3HRZC 1OXUA 5C0XH 1EWCA 1F2ZA 5FLXE 4RCNA 4GZYC 2DY8A 3GTJB 4RGMA 2O4XA 4HCEA 1A2UA 2EY1A 5I2XA 1DYQA 4JBWA 5NUCA 3T4AC 2F0WA 3LNNA 1PDQA 4MIUA 1Y8NB 2VUMB 1HUNA 1D6EC 5ISRA 1OXVA 3K7AB 4XYOA 3R93A 5J22A 1X3PA 3PV0A 4A3MB 2ZXRA 1F2YA 3HOZB 4FNFA 3PUYA 1XWEA 3BYYB 3J80E 2K01A 4IUTA 4ZAIA 3E5SA 1F9QA 4HSVA 2H4OA 4EQPA 4TKOB 3RMHA 1QB5D 2BCOA 3RLFA 5BN3A 1XYIA 5IGBA 3DHQA 4EGVA 3KUPA 1G2SA 1Z6HA 2WKDA 3ND8A 1PLFA 5ELDA 3QOJA 2J0TD 3IL8A 3DUZA 1DONA 3TSSA 2ICIA 1YNND 2ZT9C 3W3AA 2A5HA 2EYOA 4ULLA 1Y1VB 1D1KA 2B8FA 3OOCA 1EEID 2E2JB 3HOUB 2XWJB 2DNEA 4IALA 2Z4IA 1CM9A 2KEEA 1JC7A 1ILPA 3VR3A 1HTLD 4QB4A 2F0UA 3LX0A 3L7ZC 4RAUC 4MN3A 3N6RA 2EJGC 5I2YA 3NTKA 1ICWA 1JE4A 1RJTA 2OF1A 1F2MA 1U4MA 3D8GA 4ZQ3A 2RVLA 2BDOA 2EYFA 3ITPA 1PTOD 1JWSD 4O1NA 1LTGD 2MP1A 1JQYD 1WTQA 1STNA 4X3SA 4A3GB 4H7BA 4Y7NB 4K6DA 2ZXOA 3U9OA 4B08A 1F9PA 4AYBB 1RDPD 2WACA 5C4HA 2B2YC 5CV7A 3TP6A 1GHJA 3R2TA 3OIQA 2KUMA 2E2DC 3LWEA 5DNFA 1D1IA 4XQQA 3IKJA 1PTOC 4A3DB 3CRKC 1STBA 4DN4M 4DXFA 1Q8IA 3JAME 4CJ2C 3TDQA 1DXMA 4NW2A 1ET6A 5K36H 4K6LA 1R4QB 4F87A 3A8IE 2O5JC 2B2VA 4WJWA 1SJED 4I65A 2CVRA 1HFGA 2R7ZB 4UDUC 2MHVA 4OO1G 4BA1I 1FYCA 1VF5C 3CQZB 5LHY1 1A3VA 1FNUA 5J39A 3TBIB 3QG1A 1YNJD 3T16A 1STYA 3SK5A 4IFDI 1PZJD 2F0JA 2KEDA 1V8QA 5JVG3 4DU9A 3E6ZX 2IWHA 2X6LA 3J7AF 3K5LA 4DNTB 2E75C 4NKLA 3I4MB 1BQQT 5CBAE 1DM0B 4C3IG 2GA4B 2F0HA 2WB1B 5JJZA 4Q0FA 2VB3X 4G4KA 5C4JB 3MA2B 1PFNA 2XSCA 3J7YW 2SNMA 2Q8TA 5FO8B 2VB2X 4ZRZA 1GJXA 3VYSA 5C6AA 4Z9CB 2NTSA 1ENAA 1VMCA 3RZOB 3H94A 2K04A 4XQJA 5ELCA 1JOOA 4JK1C 5CV9A 3KLRA 3MEHA 5I9OA 2AWOA 2B63B 3WOEA 3MXUA 5IOCA 2A73B 3M7NA 3A7LA 3SK6A 5IGFA 2PQEA 4F88A 1RHPA 4KN4C 4I7ZC 2Y0SB 1U4RA 1O7YA 1SYDA 2L55A 2JSOA 1PMRA 2F0FA 3S1NB 5HURA 4H13C 4K5WA 3T53B 1C4QA 2N55A 1JOQA 1RF2D 1E2VA 2K28A 1G91A 1GUNA 3H91A 4C3JG 1BCPC 1ET9A 4U673 1BUVT 3BDOA 3BVMA 2EVBA 1HQRD 2MGSA 1WTVA 3Q23A 2R93B 2K7VA 1HUMA 3SXHA 1CQVA 5IGDA 2OEOA 3Q6SA 3EQLC 2B2UC 4IFDH 1PRTC 1OXTA 1K83B 3OPOA 4RKBA 1D5MC 1BOSA 4TSSA 4ILWA 4NDXA 1Q12A 5FOBB 3OW7A 4L6TB 2IW3A 5G3LF 5I9PA 3N52A 3FEWX 1MI2A 1B50A 1NUCA 2Q8RE 2EJFC 4KY5A 5CC4A 2VNUD 3BYTB 5I6WA 5EBDA 5T1IA 5HGTA 5KIXA 5A2QL 3OHXC 2BE5D 4ZKCB 2HCCA 1HA5A 1AN8A 4IUNA 2WV6D 5IGGA 1H9JA 1BDOA 3NXWA 4ME5A 2JEBI 3MXNA 3NHHA 1DOKA 2PW7A 2PW5A 3C3LA 2B2TA 4CJ0B 1E0BA 3PUXA 1KNEA 4N9TA 3QB3A 2NN6G 5T1GA 2EY2A 4A3EB 1B44D 2RQXA 1KDAA 4HR7B 5JAVA 3VYRA 2LS01 4XDXA 3PUVA 1CT1D 1O7ZA 4ID6A 3DEPA 2QCPX 1WVLA 2BE5C 1HPCA 3V05A 1IW7C 1EY4A 2XRQD 5CV6A 1SXTA 4TQUS 3K5MA 1LACA 2B2WC 2MJ8A 4J1MA 4J6HA 4LMQD 3MWYW 4H44C 1SNQA 4KV6A 3UI2A 2FFKB 1CA5A 4QMGA 5EKLA 3NSWA 5CGKA 2ID0A 4A3KB 1SE3A 2K1BA 2NVYB 2EYLA 2J7ZA 1HA6A 2FMMA 1GXDC 3HOXB 3VR2A 1U9RA 1WTPA 1MBYA 4IQZA 1AEXA 1PYWD 1O7LA 1IKMA 1SYGA 2IX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DN4 M;  1B2T A;  4UAI A;  3TZD A;  1AZQ A;  2L4N A;  4CJ2 C;  1RTO A;  1BO0 A;  1PFB A;  4NW2 A;  2B2V C;  1U4P A;  2SDF A;  3I90 A;  5EPL A;  1HRJ A;  3DEO A;  1ROD A;  2R3Z A;  2B2T C;  1S4Z A;  3SVM A;  4X3K A;  4IUR A;  1QNK A;  5CMD A;  1NCV A;  1CM9 A;  1JIC A;  1DOK A;  2JP1 A;  2K05 A;  3F2U A;  1F9R A;  3I8Z A;  2KEE A;  4U68 A;  1B3A A;  1KNA A;  4R9W A;  2B2V A;  2EOT A;  1ILP A;  1RHP A;  2B2T A;  4CJ0 B;  2NWG A;  3ONA B;  3I91 A;  1E0B A;  4ZK9 B;  1O80 A;  4IUP A;  2CVR A;  1HFG A;  2L9H A;  1EOT A;  4XT1 B;  1MGS A;  1U4L A;  4X3U A;  1WTX A;  2DY8 A;  1AZP A;  1U4R A;  1O7Y A;  2N88 A;  4RAU C;  4QUF A;  4MN3 A;  4QUC A;  1KNE A;  1F2L A;  1HHV A;  1NAP A;  5COY A;  1QG7 A;  1EIG A;  3HP3 A;  5T1G A;  1ICW A;  2H1E A;  1JE4 A;  5EPJ A;  1MSG A;  3FDT A;  1RJT A;  5D14 A;  2FJ2 A;  2N55 A;  2EPB A;  5D65 A;  1ESR A;  1VMP A;  1X32 A;  1G2T A;  1U4M A;  5EQ0 A;  1IKL A;  2KEC A;  2NZ1 D;  1AP0 A;  2RVL A;  2K28 A;  1G91 A;  3DM1 A;  1B4O A;  1NR2 A;  2XIW A;  4HAE A;  4XDX A;  3H91 A;  1PDQ A;  1C8C A;  4RA8 A;  2NYZ D;  1O7Z A;  5E4X A;  2VXW A;  3DEP A;  2FHT A;  1B53 A;  4MHE A;  1ILQ A;  3I3C A;  2MGS A;  2EE1 A;  1WTO A;  1EQT A;  1DOL A;  2KED A;  1WTV A;  3IFD A;  1HUN A;  3QO2 A;  1WVL A;  2K03 A;  2HUG A;  2KVM A;  1BBX C;  1SDF A;  4RWS C;  2MP1 A;  3R93 A;  1HUM A;  1X3P A;  4HCS A;  2KOL A;  2HDL A;  1IL8 A;  1A15 A;  5EKI A;  2X6L A;  5E4W C;  1WTQ A;  2BDN A;  4ZLT F;  4IUV A;  4X3S A;  3Q6S A;  4IUQ A;  4OIJ A;  1QE6 A;  2B2U C;  2B2W C;  2K01 A;  2MJ8 A;  4IUT A;  4X3T A;  5CBA E;  5CBE E;  4ZAI A;  1F9Q A;  4HSV A;  1LV9 A;  1SAP A;  4LMQ D;  1WD1 A;  1EL0 A;  3MWY W;  2M2L A;  1G6Z A;  1EIH A;  5JJZ A;  1ZXT A;  4ZKB B;  1CA6 A;  5AFW A;  2FIN B;  2D9U A;  2HDM A;  5EJW A;  2X69 A;  3UI2 A;  1NR4 A;  2B2U A;  1F9P A;  4XT3 B;  3FPU B;  2B2W A;  3G7L A;  1XYI A;  3D6W A;  2L1B A;  5EPK A;  2FFK B;  1DZ1 A;  1PFN A;  3KUP A;  2B2Y C;  2L12 A;  5COR A;  1G2S A;  3N52 A;  1RTN A;  1BF4 A;  1CA5 A;  1XX8 A;  3GV6 A;  3MTS A;  2Q8T A;  1MI2 A;  2MPM A;  1PLF A;  4CJ1 B;  1B50 A;  2K1B A;  2Q8R E;  1ML0 D;  1GUW A;  1BNZ A;  2JYO A;  2B2Y A;  3KBX A;  2KUM A;  2J7Z A;  3GV3 A;  1HA6 A;  4IUU A;  2L11 A;  2FMM A;  3P7J A;  3IL8 A;  2X6G A;  1VMC A;  2IL8 A;  1WD0 A;  4HED A;  1WTR A;  1DOM A;  1SSO A;  2HCI A;  5T1I A;  2RSN A;  3LWE A;  4O42 A;  1TVX A;  3TN2 A;  5DNF A;  1J8I A;  1DON A;  1PFM A;  1X3Q A;  2K04 A;  2RSO A;  2DY7 A;  1MSH A;  1WTW A;  1WTP A;  1HFN A;  1F9S A;  2RA4 A;  4OIK A;  1IKM A;  1M8A A;  1Q3L A;  1J9O A;  4R8I A;  4ZKC B;  2HCC A; 
#chains in the Genus database with same CATH topology
 3RZD B;  3CCJ A;  3C2P A;  4FXK C;  3MXP A;  4WJ4 A;  4K0K Q;  1RKN A;  1HRJ A;  2E2H H;  1KAW A;  4IUR A;  4X62 L;  2HIX A;  4DV0 L;  1NCV A;  1JE5 A;  2NZH A;  3AQQ A;  1RD9 D;  3J81 c;  3L2P A;  2BA0 A;  1LTB D;  1QUQ A;  4A3B H;  3HOW H;  3I91 A;  1SYF A;  1WYD A;  2A6E C;  3GTO B;  4X3U A;  2K33 A;  5C3E G;  3CCU A;  4BBR G;  3TP7 A;  4CDD C;  2PZU A;  3D4R A;  4JI7 Q;  5GAG C;  4GLX A;  3UE0 A;  5JJK A;  3TS2 A;  2F0K A;  4EX5 A;  5FO9 B;  3MFY A;  3NTH A;  5EPJ A;  2QA4 A;  5FJ8 H;  2F0N A;  5I4D A;  1UNS A;  1VMP A;  1I6V C;  3H3V I;  3AMU A;  3M3Y B;  1L1O B;  2I5H A;  2MFI A;  4FF1 A;  1L0X B;  1SNM A;  4HAE A;  4L5Q A;  1VQ9 A;  2DN8 A;  2YU9 H;  2F4I A;  4JI0 L;  1JR0 D;  4PZ8 A;  4MHE A;  1ILQ A;  3M4O B;  3QJY A;  1EY6 A;  1KLG D;  4YHH L;  4R8N A;  2OTL A;  2F0S A;  3RUZ A;  1IBL L;  4IUV A;  4MZ9 A;  1V1P A;  3D3R A;  2R6G A;  5JPN C;  1CTM A;  1B9N A;  3P20 A;  1D7Q A;  1KXL A;  4DAY B;  1Y14 B;  5LMN Q;  1G6Z A;  1H9K A;  4OO1 I;  3RD4 A;  1N36 L;  5L37 A;  2E2H B;  1NR4 A;  3QIA A;  5EPK A;  3I72 A;  4DV1 L;  1TXY A;  4RGO S;  5COR A;  4A3B B;  4DXG A;  2Q2I A;  1OXX K;  3HOW B;  1XTC D;  4GOP C;  2K4K A;  1BNZ A;  4CHT B;  1VQH A;  3CP0 A;  2FXQ A;  4M8A A;  2X6G A;  5E1F A;  2CH4 A;  5C5M A;  1SEB D;  1Y69 U;  1QZH A;  1I3Q H;  5CYU A;  2RA4 A;  2VUM G;  4LFC L;  4DR4 L;  3NBI A;  2XTI A;  1LT6 D;  3T1H L;  4PMB A;  2HHH Q;  5CV8 A;  4UAI A;  2F3I A;  2GN5 A;  1EQR A;  1HR0 Q;  3TZU A;  1R9T H;  4CDC C;  1PFB A;  4A3M G;  1QVG A;  4CKC A;  1PA6 A;  1S4Z A;  4X66 L;  3B6Y A;  2JP1 A;  4GN4 B;  2AHO B;  3I4O A;  3L9A X;  1N34 L;  4CDF C;  1N8R C;  2WKC A;  1W6J A;  4IUP A;  4L8J A;  3S17 H;  5M3M H;  2K5V A;  1VQ7 A;  5EAY A;  2SNS A;  1U5K A;  4MTN A;  1F2L A;  3S9W A;  4PZ7 A;  5COY A;  5BN5 A;  4V0B A;  1IBK L;  2VS1 A;  1VQJ A;  1K3R A;  1EFW A;  1ESF A;  1KD1 C;  3UDF A;  4BS9 A;  4G7Z C;  5LL6 S;  4DR2 L;  2OT2 A;  1YNX A;  1NSN S;  5AJ3 L;  2EE1 A;  3ERS X;  3TP8 A;  1VQD A;  1I3Q B;  1ENF A;  1QIL A;  1NTG A;  5M5W H;  1LTL A;  1B9M A;  3H3V H;  3HOU G;  2HDL A;  2WAQ B;  1IYV A;  1DD2 A;  1HNW Q;  4NP5 A;  2XNA C;  1FR3 A;  5C4Z A;  4QCL A;  1XMQ Q;  1TS2 A;  4RCO A;  4K0K L;  1F77 A;  1EL0 A;  1R9T B;  1CHP D;  2KA7 A;  2LY7 A;  1I4P A;  2GVA A;  2HDM A;  2Q2H A;  1J5E Q;  1YNN C;  4YWM A;  2B39 A;  4S3S A;  1CFM A;  2E5L Q;  3D6W A;  4G7O C;  4OL7 A;  4ALP A;  1VQM A;  1Q82 C;  1E3P A;  3S17 B;  1GUW A;  2HIV A;  3AU7 A;  5M3M B;  4DK0 A;  3HOV H;  4JI7 L;  2BA1 A;  5IYB G;  1YIJ A;  4C1N I;  5IYC G;  3TQY A;  1G8Z D;  2MO0 A;  1SSO A;  4EQO A;  1S40 A;  1TVX A;  5IE8 A;  1PFM A;  3S2D H;  2RBM A;  1BVS A;  5BR8 Q;  4IFD J;  3G48 A;  1PZK D;  1K3B C;  2K5W A;  2K6A A;  4DAP A;  3DM3 A;  5IIF A;  2OXP A;  2EXZ A;  1B2T A;  1UEA B;  1ENC A;  1Q46 A;  2Z6K A;  2Q8I B;  2F0O A;  5LL6 X;  3TEH B;  5KND A;  1N32 Q;  1C48 A;  4DV2 L;  3BG3 A;  3M7G A;  2WAQ E;  3DEO A;  4XQN A;  3BDL A;  5CMD A;  4A3G G;  2MO1 A;  2KCC A;  3F2U A;  1Q1B A;  2ZXP A;  2F0L A;  5EBC A;  1XPO A;  3HGB A;  1KRS A;  4OWW B;  2JA8 G;  5M5W B;  2EOT A;  4JI5 Q;  1Q81 C;  4A3C H;  4A76 A;  1X54 A;  2CWA A;  1A62 A;  5CR3 A;  3PF5 A;  1TY0 A;  4FF4 A;  5DM7 3;  1BBU A;  3W2D A;  2QEX A;  5JEA H;  2UXB Q;  4AYB G;  5LMN L;  4K2K A;  4DUY Q;  3T51 B;  1NAP A;  5A2Q E;  4V19 0;  1YIT A;  5KNB A;  3L3O C;  3NBH A;  4JI1 L;  5EQ0 A;  4OHJ A;  1SBB B;  3S14 H;  4KKU A;  2OCE A;  2XIW A;  1SNO A;  4UHV A;  3C1E A;  1K8A C;  3NUC A;  1TS3 A;  4DUZ Q;  4A3D G;  3HOV B;  1K0R A;  1SE8 A;  4CKE A;  1DOL A;  1EWI A;  4GKJ Q;  3IFD A;  1K0S A;  2E2I H;  3T13 A;  4HIO A;  4PG3 A;  2HUG A;  5G3L D;  3K59 A;  4A3J H;  3S2D B;  3BVG A;  1QZG A;  1Y1W G;  1A15 A;  3C46 A;  5E4W C;  3KK7 A;  2HHH L;  1EWH A;  3GTG H;  1Q7Y C;  3I70 A;  4KJN A;  4IUQ A;  4QGU A;  1LTA D;  1X56 A;  1HR0 L;  2A68 D;  2EZV A;  3K58 A;  3CCM A;  3K6O A;  1LV9 A;  4N9P A;  4RKL A;  5EGT A;  5EJW A;  2PO4 A;  2R7Z G;  4LWC A;  1Y8O B;  1RTN A;  4B9W A;  2R92 H;  1H9M A;  4OEL B;  2LXJ A;  2AUK A;  3I4N G;  1NNX A;  4CJ1 B;  4HTH A;  3NQT A;  2B2Y A;  3OW2 A;  4IUU A;  3M9B A;  3F2B A;  4K5X A;  1LAB A;  3GTP H;  2HCI A;  4NXN Q;  1X3Q A;  1VQG A;  3G4S A;  1TY2 A;  1GM5 A;  1A8V A;  4OIK A;  5ELB A;  2AUJ D;  2QDB A;  3S14 B;  3A0J A;  3CMA A;  1RIP A;  1U4P A;  4L63 B;  5EPL A;  3SHL A;  3HZX A;  2E2I B;  1KHI A;  1VF7 A;  3W5O A;  2RKS A;  4A3J B;  3I4M G;  3AFP A;  2E8G A;  1HNW L;  1YNJ C;  2KQ3 A;  5K36 G;  4KHP Q;  1DCZ A;  3GTG B;  1XMQ L;  1AZP A;  4FVM A;  2PQA A;  3FVQ A;  5M5X H;  4A93 H;  5KYI A;  5IT9 c;  5TSS A;  1J5E L;  3ZJY C;  1DGS A;  2E5L L;  3HP3 A;  1MSG A;  1FD7 D;  2F0E A;  2FJ2 A;  3CKI B;  1XPR A;  2EJM A;  3VYT A;  1CI3 M;  3W1B A;  4C3H H;  2R92 B;  1B4O A;  1YVC A;  1R4P B;  4GNX B;  5E4X A;  2FHT A;  1Z7T A;  2JE6 I;  2DJF C;  1WTO A;  1WCM H;  3QO2 A;  4X64 Q;  4R4T A;  2KHI A;  3GTP B;  1HNZ L;  5J3B A;  2F0Q A;  5BR8 L;  4DV6 Q;  5FKA C;  4N8X 1;  1CQF A;  3D4D A;  2B63 G;  1STA A;  3V96 A;  4YCU A;  4DR5 Q;  3SEB A;  4UP8 A;  2CFM A;  1A3T A;  3NPP A;  1N32 L;  1H9R A;  4KD4 A;  4YIJ A;  2TMP A;  2D62 A;  3D31 A;  2JA6 H;  2BH8 A;  3PF4 A;  4JI5 L;  2G9H D;  4FO2 A;  4K14 A;  1X55 A;  1E2Z A;  5C0X J;  3K5N A;  1EFI D;  5GRO A;  2YTV A;  2F0I A;  1XX8 A;  3MTS A;  4OX9 Q;  1S5F D;  2UXB L;  3LWU A;  4HIK A;  1YBY A;  5GAE C;  4KKS A;  3I4L A;  2D0P A;  1STG A;  2UXC Q;  1EY0 A;  3PQI A;  4DUY L;  2P5Z X;  2IT1 A;  4FXD A;  3P7J A;  4A93 B;  4HED A;  1WTR A;  1ZYR D;  1E22 A;  1WTW A;  2BOS A;  3U4Z A;  1B1Z A;  5FLX c;  3ND9 A;  1HFN A;  3VA5 A;  4A3I H;  3F2C A;  2AQ2 B;  2NVQ H;  5JPM C;  2O5I C;  3S16 H;  4C3H B;  4A3F H;  1H9S A;  3ERQ A;  4DF7 A;  4DUZ L;  1HQM C;  3TZD A;  3J81 L;  4GN5 A;  4GKJ L;  1PXU A;  2ATW A;  4GLA C;  4C1N K;  3CCQ A;  1WCM B;  4NMZ A;  4AIM A;  2JXM B;  1PYS B;  1SE2 A;  4GKK L;  1B3A A;  4R9W A;  2ES2 A;  2F0G A;  4ZK9 B;  1QNU A;  4FYD A;  3D6C A;  3TP5 A;  4XT1 B;  1MGS A;  3SK4 A;  3URY A;  4JPB W;  1A2T A;  1ONL A;  4DK3 C;  3R3O A;  2LSS A;  1V1Q A;  3JC6 6;  1JCK B;  4YY3 Q;  3MAQ A;  2HQL A;  2V4D A;  2H5X A;  3FDT A;  2JA6 B;  3MFG A;  2EPB A;  5D65 A;  5ELO A;  3FKI H;  3I55 A;  1HCZ A;  4UP9 A;  2CW0 D;  4GS3 A;  1G29 1;  3CRL C;  3J80 c;  3GTL H;  1ZYR C;  1YHB A;  1FNV A;  4RA8 A;  4LJZ C;  5DLQ E;  3U4V A;  1SMY D;  3DMU A;  5C44 H;  1FJG Q;  4NXN L;  3A56 A;  3NK9 A;  2KCM A;  4CKB A;  1SDF A;  3H09 A;  5M5Y H;  3DXJ C;  2N3S A;  2LKV A;  5IP7 G;  5FK9 C;  4YWL A;  4R4Q A;  1YJN A;  4A3I B;  1BXT A;  1JB3 A;  5IP9 H;  1NE3 A;  1XNR Q;  2NVQ B;  3S16 B;  4Q5V A;  3OMC A;  3SDZ A;  4A3F B;  1GUO A;  2YTX A;  3U9S A;  3OTO Q;  1WD1 A;  4L5S A;  5FLM H;  1HZB A;  1LTI D;  3H0G G;  2B2U A;  3K57 A;  3FPU B;  4JBM A;  1KTK A;  4KHV A;  4KHZ A;  2RDG A;  1C7Y A;  4IFD G;  3KJO A;  2K32 A;  4KHP L;  1I94 Q;  3NEL A;  2KEN A;  4FF2 A;  1I5F A;  1KDB A;  3GV3 A;  2SOB A;  5LMU Q;  2LXK A;  2L5T A;  4BBR H;  4BXX G;  2IL8 A;  2PI2 A;  2PZW A;  3PSI A;  4FP5 D;  2RSO A;  1Q90 A;  3OWE B;  4O2D A;  3FKI B;  4LF6 Q;  1VQE A;  1GOZ A;  1FGB D;  3IFT A;  4R8I A;  3VR4 A;  3GTL B;  4FXG C;  5KYL A;  3H6M A;  4L5R C;  2MUY A;  2HD3 A;  3A8K E;  2C5C A;  4G57 A;  3CCE A;  4X64 L;  4IJL A;  1K9M C;  5C44 B;  2Z8L A;  2A6H D;  4WFN 3;  3I56 A;  3CC7 A;  4OEM B;  3A7A B;  5M5Y B;  4U68 A;  1PHJ A;  1LT4 D;  1NMF A;  5DM6 3;  3K0Y A;  2NWG A;  4DR5 L;  2K14 A;  3Q22 A;  1EOT A;  2NTT A;  2EXD A;  2NVT H;  4QUF A;  4IPH A;  2PMZ B;  3AYH B;  3GTM B;  3QWN A;  2ASB A;  3D4W A;  3CCL A;  4A3K G;  3MXN B;  5KNC A;  3STB D;  3EVQ A;  3GP7 A;  4OXP A;  3GDE A;  1VQO A;  4OX9 L;  2QEJ C;  3HOX G;  4IO9 A;  1X65 A;  2Z1C A;  1NR2 A;  2UXC L;  3KDF A;  2K5N A;  5M3F H;  2NYZ D;  3M4Q A;  2AQ1 B;  3I3C A;  4BBR B;  1EQT A;  4JI8 L;  1BCP B;  4CBV A;  5IYD H;  4RG1 A;  1U0L A;  4JI4 Q;  2K03 A;  1VQC A;  1EY8 A;  2EYH A;  4K2L A;  5JEA J;  2NVX H;  4NPS A;  1TWH H;  3IAY A;  2ZJR A;  2KOL A;  1LT3 D;  1IL8 A;  3GQB A;  4K5V A;  3S1M H;  2BDN A;  2QGQ A;  4L5T A;  4ZLT F;  1PH5 A;  2A6H C;  2IX3 A;  4OIJ A;  1S5E D;  5ELF A;  3NEM A;  1SAP A;  4LUO A;  1YHQ A;  3TS0 A;  1EIH A;  3GTQ H;  1PRT B;  2FIN B;  3KF8 A;  3PO3 H;  5CV5 A;  1VQ6 A;  1DJR D;  2K5D A;  2B2W A;  2L1B A;  3NWS A;  1B3Q A;  1G51 A;  4PMW A;  4H02 A;  3JAM c;  3CCV A;  3BVZ A;  2DGY A;  3E9H A;  4POG A;  2PMZ E;  3PCO B;  1PV4 A;  4AH6 A;  1KL9 A;  2JYO A;  3D0F A;  3STB C;  3M85 A;  3PIO A;  4F7X A;  2NVT B;  4KI0 A;  4DKA C;  4YY3 L;  4C2M H;  3HKZ B;  3MC0 B;  4E6I A;  2YV5 A;  4JC0 A;  3R2I A;  1MSH A;  3PUZ A;  3OYY A;  4R4O A;  3CCS A;  3K81 C;  4J8Q A;  2K5Q A;  4DR6 Q;  2J4X A;  5C5L A;  3PUW A;  4P75 A;  5M3F B;  4KTA A;  1AZQ A;  1AH9 A;  2L4N A;  1RTO A;  4P73 A;  1BO0 A;  3I90 A;  1MJC A;  5I6Y A;  1SRO A;  3NWT A;  3S24 A;  3MVV A;  4LF7 Q;  2O2L D;  2EYP A;  2NVX B;  5C3W A;  4IZ8 A;  1TWH B;  1Z47 A;  3A8J E;  4JOI C;  1I4Q A;  3ULJ A;  1XNR L;  3S1M B;  1CK1 A;  1PH1 A;  1HXY D;  3S2H H;  1U4L A;  3VA7 A;  3OTO L;  1SRU A;  1EIF A;  3G6J B;  4IOC A;  3GTQ B;  1S5C D;  3PO3 B;  3HOW G;  1T5X D;  1D5Z C;  2Q2T A;  2YU9 B;  1D8L A;  5D14 A;  1QWY A;  4RFB A;  3HOZ G;  1I94 L;  1TII D;  4BY1 H;  1QUQ B;  3KDF B;  2LFN A;  2EY5 A;  3HKZ E;  5LMU L;  2B29 A;  2CQO A;  5FJ8 G;  1B53 A;  1NMG A;  3A5U A;  3ZYY X;  4XIG S;  2PNR C;  1CZW A;  1ZEQ X;  4H0L C;  1CZG A;  3OMG A;  4C2M B;  2F4V Q;  1PH4 A;  1SND A;  5K5P A;  4LF6 L;  1TKW B;  2F3W A;  5C0X G;  3DLL A;  2IJ0 A;  2XVS A;  4K8J A;  2CQA A;  5J1Z A;  1BR9 A;  4EVO A;  3V2T A;  1OO9 B;  2NUC A;  1Q1E A;  5AFW A;  1YZ6 A;  3GO5 A;  4RMF A;  4XT3 B;  2HT1 A;  1EY7 A;  3WWV A;  1AW7 A;  1KAB A;  1HH2 P;  3OSO A;  1VDZ A;  2JA8 H;  2UUB Q;  4XTC S;  1Y1V G;  3KOJ A;  1LT5 D;  1V1P B;  3S2H B;  1SYE A;  2MNA A;  1MKH A;  1IBM Q;  3A55 A;  4A3L H;  1JJG A;  4GOP A;  3TN2 A;  2RSN A;  1NBW A;  1I4G A;  1GD7 A;  1EEF D;  4DR7 Q;  1EU3 A;  1V43 A;  2D2C C;  2E74 C;  1K8M A;  4BY1 B;  1AE3 A;  2AWN A;  1J9O A;  3I73 A;  4RHS A;  4EQN A;  3BZD B;  1KQS A;  2WAQ G;  2B2V C;  2SDF A;  3M4Y A;  4JI4 L;  3EBE A;  2WIN B;  4PZ6 A;  2WII B;  4GNX C;  4OO1 H;  1EOV A;  1VQI A;  4KY6 A;  1Y1W H;  5IT9 L;  1MD2 D;  4WJ3 M;  1O80 A;  2L9H A;  3DWP A;  3O13 A;  4XXE A;  1M4V A;  1IYJ B;  4POF A;  4QUC A;  1XTD A;  2QF7 A;  4ZCK A;  1YHA A;  1VQ8 A;  2PZT A;  3BZK A;  3EFX D;  2SEB D;  5M3M G;  1UE6 A;  1KLU D;  1ZKO A;  4ODG A;  5EKK A;  1SJH D;  3G6E A;  3Q0A A;  2JA8 B;  1W6K A;  3J81 E;  3NEN A;  3AB9 A;  3DM1 A;  4IN3 A;  3I4N H;  2Z6B A;  2EIF A;  2N78 A;  3F2D A;  1LM0 A;  5DEH A;  2Q2U A;  2RCN A;  3PMF A;  5F2D A;  2JJQ A;  4JW0 A;  1QCB D;  1RL2 A;  4C3I H;  3QOL A;  4RHR A;  2DJG C;  1A6X A;  2ENB A;  1PH3 A;  4DR6 L;  4I7A A;  3FMC A;  3S1R H;  2IX1 A;  1GUG A;  5JOB A;  2B8G A;  1EYG A;  3E3X A;  2M2L A;  5JVH 3;  1SFO H;  1S5B D;  1CA6 A;  4ZKB B;  4LF7 L;  2X69 A;  5C4X H;  2F0M A;  3C1F A;  2IHF A;  4QL5 A;  4ZUJ A;  1K8G A;  1VQF A;  1N33 Q;  1EZ6 A;  1Y1W B;  3KLS X;  2JA5 H;  3GV6 A;  1K8O A;  2MPM A;  4IPD A;  1EYC A;  4PQX A;  1UUP A;  5FLX L;  1JOR A;  1SMX A;  1X3G A;  1AFP A;  1KRT A;  2F0T A;  4DK1 A;  3PO2 H;  2I46 A;  2CCZ A;  2EQS A;  4B3M Q;  1EZ8 A;  4X65 Q;  3HOV G;  3P75 A;  1M8A A;  1Q3L A;  2F3V A;  2NN6 I;  1A3U A;  1IHZ A;  1XMO Q;  3R8B A;  3I4N B;  4P71 A;  4DA2 A;  4YCW A;  1SN8 A;  3GD7 A;  1TQO A;  2OWO A;  4R4I A;  2F4V L;  2R7F A;  4X3K A;  4O0A A;  2PYK A;  4P72 A;  2K05 A;  3RN5 A;  3I8Z A;  4C3I B;  1KNA A;  1VQ4 A;  1SNP A;  5ELE A;  1II3 A;  1OTC A;  1B7Y B;  3PGZ A;  3S15 H;  1I50 H;  4JG2 A;  1UE5 A;  1QOH A;  2N88 A;  2F0V A;  2ZJQ A;  3S1R B;  1Q8K A;  4A3C G;  1VQB A;  1SFO B;  2HQE A;  3J80 L;  3VYU A;  4C3J H;  4WRD A;  5D3I B;  2NB0 A;  2ICE C;  3ERO A;  3KLS A;  1N9W A;  4LK1 C;  5C4X B;  1ESR A;  2QDL A;  3K5O A;  5JEA G;  2YTY A;  2UUB L;  2KEC A;  2NZ1 D;  2KJX A;  5C3X A;  2JA5 B;  1O78 A;  2A8V A;  1TWG H;  2A68 C;  2UU9 Q;  1STH A;  1EU4 A;  1W3S A;  2ZTC A;  1SE4 A;  3F8T A;  2WB1 G;  2GVB A;  5KRU A;  1IBM L;  1PFS A;  1GUT A;  1UAP A;  1ASY A;  1S3O A;  4APV A;  5ELN A;  3HS0 C;  4B9X A;  4DR7 L;  1BBX C;  1SNC A;  1CUK A;  2ZTD A;  3HOY H;  3PO2 B;  1SYC A;  3NBH B;  4LF5 Q;  1STE A;  4QF4 A;  2RF4 A;  1I6H H;  1PTO H;  4X3T A;  3Q24 A;  4TVA B;  4A3J G;  1PTO F;  2Z9H A;  1BCP D;  2PPB C;  3NTI A;  3TME A;  1ZXT A;  3NE5 B;  3CC4 A;  1I4R A;  1GHK A;  1QJO A;  2EYM A;  3G7L A;  3CF5 A;  3BZC A;  3K8A A;  3MXG A;  2L12 A;  3U58 A;  3OWF A;  1LTT D;  4BA2 I;  4G7H C;  1K83 H;  1P8L A;  4KK7 A;  3S15 B;  2F1M A;  1ML0 D;  3KYH C;  2DUD A;  1I50 B;  1LTR D;  3BDC A;  2XWB B;  2IPK D;  3J7A 5;  1PRT D;  1Y8P B;  1NY4 A;  1VQN A;  2R92 G;  4O42 A;  1J8I A;  4C3J B;  3BS1 A;  1KC8 C;  4RH6 A;  2UUA Q;  5BN4 A;  1NJI C;  1OXS C;  4F8M A;  1F9S A;  1VQK A;  2EYJ A;  2E76 C;  1BKB A;  2Y0S G;  3EJI A;  1IYU A;  4DGZ A;  3T1Y Q;  2A69 D;  4B3T Q;  1TWG B;  4K8I A;  2DNC A;  3HG9 A;  4P2C B;  5DAU A;  3WOF A;  2F0D A;  3VR5 A;  2LMC B;  2KHS A;  1I4X A;  4ME3 A;  1ROD A;  2R3Z A;  2B2T C;  2M9V A;  1IZ6 A;  1JIC A;  3A74 A;  3CXC A;  4DV5 Q;  1W2B A;  1S5D D;  5M5X B;  4IOA A;  5IP7 H;  3HOY B;  2F03 A;  2AKW B;  2NN6 H;  3IRB A;  2RDF A;  3ONA B;  5IOD A;  4LFA Q;  3J7A V;  1G6P A;  1TS5 A;  4ZYS A;  1LTS D;  1WTX A;  5HGQ A;  4BBS H;  4DK6 C;  4DV3 Q;  4DV7 Q;  1PTO B;  1I6H B;  2R93 G;  3PIP 3;  3UDI A;  3ICE A;  2C9O A;  5FO7 B;  4BY7 H;  1MIU A;  4OGQ C;  1L2F A;  3H0G H;  3UDG A;  4XYQ A;  1N33 L;  1L1O C;  1BBW A;  1TU2 B;  4QQB X;  1IKL A;  1AP0 A;  1HTP A;  4A93 G;  1YJ9 A;  4JCV E;  2VL6 A;  4HSP A;  2VXW A;  1TS4 A;  4R4C A;  2PQA B;  1PH2 A;  3S1Q H;  2XRS D;  2K52 A;  4FF3 A;  4C3H G;  2KCN A;  2A69 C;  2KVM A;  4BWG B;  4B3M L;  1LO5 D;  4X65 L;  2QIL A;  4OWX B;  1X3E A;  5IGC A;  3CCR A;  3OIP A;  3KF6 A;  5KEE A;  1E2W A;  1XMO L;  1QE6 A;  4PMC A;  4HID A;  4RGT A;  4LAA A;  1TT2 A;  5M9O A;  3I2Z A;  3EA6 A;  4GN3 B;  2R61 A;  3JAM L;  1UE1 A;  1PH6 A;  3SE0 A;  1UEB A;  1CKN A;  1RCV D;  2EDG A;  2TSS A;  5E3F A;  1DZ1 A;  1TWF H;  4P74 A;  1IW7 D;  2D5D A;  2N49 A;  4RGN A;  2JN4 A;  1EY5 A;  3UE1 A;  1V1O A;  2JA7 H;  4ABN A;  1EY9 A;  3KBX A;  4BBS B;  4HJ8 A;  1WD0 A;  2XGT A;  1DOM A;  4BY7 B;  1PH7 A;  2NBF A;  3QR8 A;  4HMJ A;  4JYA Q;  4KN7 C;  3H0G B;  2DY7 A;  3NQI A;  4M1U B;  1VCI A;  3KFU A;  3VR6 A;  5IGE A;  1EQV A;  5C0X I;  2UU9 L;  2CHB D;  4CGY B;  1QVC A;  4DNR B;  4HJA A;  1TWA H;  3S1Q B;  4HJ9 A;  3K7U C;  4HN7 A;  4A3E G;  4A3I G;  5C3E H;  1QNK A;  3FRP B;  1YI2 A;  4A3F G;  4KY7 A;  1BCP F;  2CW0 C;  2I5M X;  1L1O A;  3LGJ A;  5E7N A;  4LF5 L;  2A74 C;  1B8A A;  2QKI C;  3J81 i;  1YJW A;  3MZ5 A;  1EUJ A;  1SLJ A;  4LUZ A;  1K28 A;  1GUS A;  3WDN A;  1H9S B;  1SMY C;  2JEA I;  1LLR D;  3GTK H;  3DWQ A;  4LFB Q;  5KGU A;  5A35 A;  4DAV A;  1HHV A;  1QG7 A;  1TWC H;  4QIW B;  1EIG A;  3CW2 C;  5D3D A;  3PIO 3;  1I4H A;  2H1E A;  3ULP A;  3AFQ A;  3MHB A;  3CHB D;  1X32 A;  4WOR A;  1G2T A;  1PRT F;  1TWF B;  4DV6 L;  5GAD C;  4DPG A;  3SK8 A;  1C8C A;  2JA7 B;  2A6E D;  4DAY A;  3X3M A;  4Y52 H;  2F0P A;  1Q86 C;  2Z4H A;  2YYZ A;  3E0J A;  3FKI G;  3HEJ A;  2L0C A;  3TRE A;  4KKT A;  2UUA L;  5IT9 E;  4RWS C;  2FMC A;  1VQP A;  3X3N A;  2IHE A;  4HCS A;  4KD3 A;  1EYD A;  1JB7 A;  5EKI A;  3JAM i;  3T1Y L;  1SYB A;  2JA9 A;  2RDH A;  4ZUI A;  5C44 G;  4PNY A;  1D2B A;  4KJO A;  2WP8 J;  3GTJ H;  1TR5 A;  1XXG A;  5CBE E;  2XN9 C;  1XJV A;  3T56 B;  1TWA B;  4UP7 A;  2D9U A;  2AQ3 B;  2EY6 A;  3ER0 A;  4DV5 L;  5C3E B;  4LUV A;  2G9D A;  1JWM D;  3SR1 A;  2I07 B;  1HJP A;  4LFA L;  4NXM Q;  2PCF B;  3AEV A;  5FLM G;  5CV4 A;  4HMI A;  1PZI D;  2OQK A;  4QIW E;  4DV7 L;  4DV3 L;  2RHS B;  2VUM H;  1L0Y B;  1LUZ A;  2L11 A;  4TRD A;  3DWA A;  3GTK B;  3P1H A;  2IY5 B;  2ZM6 Q;  1FNW A;  1JMC A;  1P16 A;  1TWC B;  3K7A H;  3NP8 A;  4A3M H;  2VW9 A;  1CHQ D;  1K73 C;  4PV1 C;  3HOZ H;  4DFA A;  1KAA A;  3EN2 A;  1D5X C;  1JOK A;  1BF4 A;  2M00 A;  4LNQ A;  2ALY B;  1JWU D;  4C56 C;  1EYA A;  1T5E A;  1KDC A;  3CU7 A;  1HZA A;  3SVM A;  3KBG A;  4B3S Q;  2OQ0 A;  3H3V C;  3FPP A;  1F9R A;  2G5D A;  4KMU C;  3A54 A;  3HRZ C;  1OXU A;  5C0X H;  1EWC A;  1F2Z A;  5FLX E;  2VZA A;  4RCN A;  4GZY C;  2DY8 A;  4DV2 Q;  4RGM A;  3GTJ B;  2BH2 A;  1CSQ A;  2O4X A;  4HCE A;  1A2U A;  2EY1 A;  5I2X A;  1QVF A;  1FJG L;  1DYQ A;  4JBW A;  5GQO A;  1A0I A;  5NUC A;  2R7D A;  3T4A C;  1HZ9 A;  1IXR A;  1Y1V H;  2F0W A;  3LNN A;  4FDB A;  3HKZ G;  2E2J H;  3K80 C;  3HOU H;  1PDQ A;  1KIX A;  1GKH A;  2UUC Q;  1B70 B;  4MIU A;  1Y8N B;  2VUM B;  1HUN A;  2A1A A;  1D6E C;  4JYA L;  4UPA A;  5ISR A;  1OXV A;  4JI1 Q;  3K7A B;  4XYO A;  3R93 A;  5M3F G;  5J22 A;  4A3B G;  1X3P A;  3PV0 A;  4A3M B;  2ZXR A;  1F2Y A;  3HOZ B;  4FNF A;  3PUY A;  1ASZ A;  3I7F A;  4OWT B;  5IYD G;  4LF4 Q;  1XWE A;  4LW1 A;  4CDE C;  3BYY B;  3J80 E;  2K01 A;  1E1O A;  2PI2 E;  4IUT A;  3E5S A;  4ZAI A;  1F9Q A;  4HSV A;  2H4O A;  4EQP A;  3U50 C;  3KLW A;  4R1J A;  4TKO B;  3RMH A;  1QB5 D;  2BCO A;  3RLF A;  5BN3 A;  1XYI A;  5IGB A;  5H1S E;  5IYB H;  3DHQ A;  4EGV A;  3KUP A;  5IYC H;  4LF9 Q;  1G2S A;  1Z6H A;  2WKD A;  1WOC A;  4HIM A;  3ND8 A;  3VDY A;  1PLF A;  3PO3 G;  5ELD A;  4LFB L;  3QOJ A;  4QY7 A;  4UY8 C;  2J0T D;  3IL8 A;  2A19 A;  1E7Z A;  1YEZ A;  3CME A;  3DUZ A;  5LMN W;  2NZO A;  1DON A;  3TSS A;  1EQQ A;  2ICI A;  3KF8 B;  4A75 A;  1YNN D;  2Z6K C;  2ZT9 C;  1UWV A;  3W3A A;  2A5H A;  2EYO A;  2KHJ A;  4A3G H;  4ULL A;  1Y1V B;  1D1K A;  1XPU A;  4Y7N H;  2B8F A;  3OOC A;  1EEI D;  2E2J B;  3HOU B;  2ZTE A;  3ULL A;  1C0A A;  2XWJ B;  1V9P A;  3A5Z B;  1O7I A;  1M90 C;  2DNE A;  2L15 A;  4IAL A;  2Z4I A;  1CM9 A;  2KCT A;  3E9I A;  2KEE A;  4IJH A;  1JC7 A;  1GO3 E;  1ILP A;  3VR3 A;  1HTL D;  1LYL A;  2F0U A;  4QB4 A;  3LX0 A;  3L7Z C;  2C35 B;  4RAU C;  4B3R Q;  4MN3 A;  3N6R A;  4JOI A;  2EJG C;  1HR0 W;  1FGU A;  3NTK A;  5I2Y A;  3SGI A;  1ICW A;  1JE4 A;  1ICF B;  3RNU A;  1RJT A;  4A3D H;  4NXM L;  2OF1 A;  1F2M A;  1U4M A;  3D8G A;  4ZQ3 A;  2RVL A;  1PH9 A;  1E1T A;  3MEF A;  3E0E A;  2BDO A;  2EYF A;  3ITP A;  4N8F A;  1PTO D;  2AMC B;  2ZM6 L;  1JWS D;  4BY1 G;  4QJF A;  4DR1 Q;  4O1N A;  2JK8 A;  1LTG D;  2MP1 A;  4MNO A;  1JQY D;  1J6Q A;  1WTQ A;  4DV4 Q;  1STN A;  4X3S A;  4A3G B;  2R7Z H;  4H7B A;  4Y7N B;  4K6D A;  1S72 A;  2ZXO A;  3CQZ H;  3L0O A;  5IWA Q;  1HNZ Q;  3U9O A;  4B08 A;  4B3S L;  1F9P A;  4AYB B;  1RDP D;  2WAC A;  1E24 A;  5C4H A;  2B2Y C;  5CV7 A;  4JI2 Q;  3TP6 A;  1GHJ A;  2ZJP A;  3EIV A;  3M4P A;  3R2T A;  3OIQ A;  2KUM A;  2F52 A;  2E2D C;  4DNI A;  3LWE A;  5DNF A;  1D1I A;  4XQQ A;  3IKJ A;  1PTO C;  4A3D B;  3CRK C;  2D0O A;  1WJJ A;  1STB A;  1MHW C;  4DN4 M;  4DXF A;  4A3L G;  1Q8I A;  3I4M H;  3JAM E;  2UUC L;  2CWP A;  4CJ2 C;  3TDQ A;  2K75 A;  1DXM A;  4NW2 A;  1ET6 A;  5K36 H;  1IL2 A;  4K6L A;  1R4Q B;  4F87 A;  1HZC A;  3A8I E;  4GOP B;  5C4J H;  2O5J C;  2RCF A;  2B2V A;  2KBN A;  4WJW A;  3TRZ A;  2V1C C;  4HJ7 A;  4LF4 L;  1SJE D;  4GNX A;  4I65 A;  2CVR A;  1HFG A;  2K50 A;  2R7Z B;  4UDU C;  4MTK A;  4AYB E;  2MHV A;  4OO1 G;  4BA1 I;  1FYC A;  1VF5 C;  3CQZ B;  5LHY 1;  3RZO H;  4GKK Q;  1A3V A;  1FNU A;  4LF8 Q;  5J39 A;  3TBI B;  3CAM A;  1WFQ A;  4LF9 L;  3QG1 A;  1YNJ D;  1WI5 A;  2B63 H;  2I5L X;  3T16 A;  1XNQ Q;  1STY A;  1FVI A;  3SK5 A;  4IFD I;  1PZJ D;  3J7Z C;  2F0J A;  2KED A;  1JJC B;  1V8Q A;  5JVG 3;  5GAH C;  4DU9 A;  3E6Z X;  1GVP A;  1C9O A;  2IWH A;  2X6L A;  3J7A F;  4JI6 Q;  3K5L A;  4DNT B;  2E75 C;  4NKL A;  3I4M B;  1BQQ T;  5CBA E;  1DM0 B;  4JVZ A;  4C3I G;  2GA4 B;  2F0H A;  3UDX A;  3S1N H;  2WB1 B;  5JJZ A;  4Q0F A;  1SR3 A;  2VB3 X;  4JI3 Q;  4G4K A;  5C4J B;  2VQF Q;  3MA2 B;  1PFN A;  2XSC A;  2RHQ B;  2SNM A;  3J7Y W;  2B3G A;  2Q8T A;  4IPC A;  5FO8 B;  2VB2 X;  4ZRZ A;  4B3R L;  1GJX A;  3VYS A;  3F1Z A;  5C6A A;  4Z9C B;  5C4X G;  2NTS A;  1ENA A;  1A63 A;  1VMC A;  2R93 H;  3RZO B;  2UXD Q;  5JJI A;  1PYB A;  2JA5 G;  1PVO A;  3H94 A;  2K04 A;  4XQJ A;  4DR3 Q;  3FHW A;  5ELC A;  2CH4 W;  1H95 A;  1JOO A;  4JK1 C;  5CV9 A;  3RN2 A;  3KLR A;  3MEH A;  5I9O A;  1HNX Q;  2AWO A;  2CKZ B;  2B63 B;  3WOE A;  1X6O A;  3MXU A;  3FP9 A;  3CC2 A;  3PO2 G;  5IOC A;  4DR1 L;  3RLN A;  2A73 B;  3M7N A;  3A7L A;  3SK6 A;  5IGF A;  1CKO A;  2PQE A;  4F88 A;  2VQE Q;  1RHP A;  4DV4 L;  4AQY Q;  4KN4 C;  4JBK A;  4I7Z C;  2WB1 E;  2Y0S B;  1U4R A;  1O7Y A;  1SYD A;  5IWA L;  2L55 A;  2JSO A;  3KJP A;  1PMR A;  2F0F A;  3S1N B;  5HUR A;  4H13 C;  4K5W A;  3T53 B;  1VQL A;  1C4Q A;  1FL0 A;  4YCV A;  2N55 A;  1JOQ A;  1RF2 D;  4JI2 L;  5HY6 A;  1E2V A;  1JJ2 A;  2K28 A;  1G91 A;  4IPG A;  1GUN A;  4JV5 Q;  3H91 A;  4C3J G;  1Z9F A;  1BCP C;  1ET9 A;  3J80 i;  4U67 3;  1BUV T;  4J15 A;  3BDO A;  3BVM A;  2EVB A;  1HQR D;  2MGS A;  1WTV A;  3Q23 A;  2R93 B;  4YWK A;  4X62 Q;  4DV0 Q;  2K7V A;  1HUM A;  3SXH A;  4NB3 A;  4DAM A;  1CQV A;  5IGD A;  1WTH A;  2OEO A;  3Q6S A;  3EQL C;  2B2U C;  4IFD H;  4JI8 Q;  1PRT C;  5JJL A;  1CSP A;  1OXT A;  1K83 B;  3OPO A;  4JBJ A;  3HOY G;  4RKB A;  1D5M C;  1BOS A;  4TSS A;  4ILW A;  3RLO A;  4A3E H;  1VS0 A;  4NDX A;  1Q12 A;  2Y0S E;  3OW7 A;  5G3L F;  4L6T B;  2IW3 A;  5FOB B;  4BXX H;  3BU2 A;  5I9P A;  3N52 A;  3CPF A;  3FEW X;  1JT8 A;  1MI2 A;  3K0X A;  1B50 A;  1NUC A;  2Q8R E;  3J81 j;  2EJF C;  4KY5 A;  5CC4 A;  2VNU D;  2N8N A;  4JI0 Q;  3BYT B;  1WCM G;  4LF8 L;  5I6W A;  5EBD A;  5T1I A;  5HGT A;  5KIX A;  5A2Q L;  1AE2 A;  1PH8 A;  4YHH Q;  3OHX C;  2BE5 D;  1EIY B;  4ZKC B;  2HCC A;  1IBL Q;  1HA5 A;  1AN8 A;  4IUN A;  1XNQ L;  2WV6 D;  5IGG A;  1H9J A;  1BDO A;  2OTJ A;  3NXW A;  4ME5 A;  2JEB I;  3MXN A;  3NHH A;  1N36 Q;  2JA6 G;  1DOK A;  2PW7 A;  3BJU A;  2PW5 A;  3C3L A;  4JI6 L;  4DV1 Q;  2K5H A;  2B2T A;  4CJ0 B;  1E0B A;  2QW7 A;  4A3K H;  2NVY H;  4EQ5 A;  1L0W A;  5IY0 A;  3PUX A;  3HOX H;  1KNE A;  4N9T A;  3QB3 A;  4JI3 L;  2NN6 G;  4GLV B;  5T1G A;  2VQF L;  3H15 A;  2EY2 A;  4A3E B;  1B44 D;  2Z0S A;  2RQX A;  1VQ5 A;  3CD6 A;  3G71 A;  4BBS G;  1KDA A;  4HR7 B;  5JAV A;  3VYR A;  3RZD H;  2WFW A;  4LFC Q;  4DR4 Q;  3GTM H;  2LS0 1;  4XDX A;  3T1H Q;  4BY7 G;  3PUV A;  1CKM A;  1X9N A;  1CT1 D;  1O7Z A;  1UE7 A;  4ID6 A;  3DEP A;  2QCP X;  2UXD L;  2MQH A;  3CPW A;  1WVL A;  2BE5 C;  1HPC A;  3V05 A;  4DR3 L;  4X66 Q;  1IW7 C;  1EY4 A;  2PNH A;  3RR5 A;  3PIP A;  1N34 Q;  4A4I A;  2JQO A;  2XRQ D;  5CV6 A;  1SXT A;  1T9H A;  4TQU S;  3GTO H;  1HNX L;  3K5M A;  3W1G A;  1LAC A;  2B2W C;  2MJ8 A;  3HKS A;  4J1M A;  1M1K C;  4J6H A;  3HFZ B;  4LMQ D;  3MWY W;  4H44 C;  1SNQ A;  4KV6 A;  3UI2 A;  1MJE A;  1IBK Q;  2FFK B;  2VQE L;  4HJ5 A;  4AQY L;  3M3Y H;  1CA5 A;  4QMG A;  5EKL A;  3NSW A;  5CGK A;  2ID0 A;  3KF6 B;  4OON A;  4A3K B;  4DR2 Q;  1SE3 A;  2K1B A;  1X3F A;  2NVY B;  1VQA A;  2EYL A;  2J7Z A;  4B3T L;  1HA6 A;  2FMM A;  3M4O H;  1GXD C;  3HOX B;  5AJ3 Q;  4X6A H;  3VR2 A;  2I0Q A;  2JA7 G;  2VY3 A;  1U9R A;  1WTP A;  1CKN B;  4KLK A;  1MBY A;  4IQZ A;  1AEX A;  1PYW D;  3Q8D A;  1O7L A;  1IKM A;  1SYG A;  5IP9 G;  4JV5 L;  2IX0 A; 
#chains in the Genus database with same CATH homology
 3RZD B;  3C2P A;  4FXK C;  3MXP A;  1RKN A;  1HRJ A;  4IUR A;  1NCV A;  1RD9 D;  2BA0 A;  1LTB D;  3I91 A;  1SYF A;  2A6E C;  3GTO B;  4X3U A;  2K33 A;  3TP7 A;  2PZU A;  3D4R A;  2F0K A;  5FO9 B;  3MFY A;  3NTH A;  5EPJ A;  2F0N A;  5I4D A;  1UNS A;  1VMP A;  1I6V C;  3AMU A;  3M3Y B;  4FF1 A;  1L0X B;  1SNM A;  4HAE A;  2DN8 A;  2F4I A;  1JR0 D;  4MHE A;  1ILQ A;  3M4O B;  3QJY A;  1EY6 A;  1KLG D;  4R8N A;  2F0S A;  3RUZ A;  4IUV A;  1V1P A;  3D3R A;  2R6G A;  5JPN C;  1CTM A;  1B9N A;  3P20 A;  1G6Z A;  1H9K A;  4OO1 I;  3RD4 A;  2E2H B;  1NR4 A;  3QIA A;  5EPK A;  3I72 A;  4RGO S;  5COR A;  4A3B B;  4DXG A;  1OXX K;  3HOW B;  1XTC D;  1BNZ A;  4CHT B;  4M8A A;  2X6G A;  5E1F A;  5C5M A;  1SEB D;  1Y69 U;  5CYU A;  2RA4 A;  3NBI A;  1LT6 D;  4PMB A;  5CV8 A;  4UAI A;  3TZU A;  1PFB A;  4CKC A;  1S4Z A;  2JP1 A;  3L9A X;  2WKC A;  1W6J A;  4IUP A;  4L8J A;  2SNS A;  1F2L A;  3S9W A;  5COY A;  5BN5 A;  4V0B A;  1ESF A;  4BS9 A;  4G7Z C;  5LL6 S;  2OT2 A;  1NSN S;  2EE1 A;  3TP8 A;  1I3Q B;  1ENF A;  1QIL A;  1B9M A;  2HDL A;  2WAQ B;  1IYV A;  1DD2 A;  4NP5 A;  2XNA C;  1FR3 A;  5C4Z A;  4QCL A;  1TS2 A;  4RCO A;  1F77 A;  1EL0 A;  1R9T B;  1CHP D;  2KA7 A;  2LY7 A;  1I4P A;  2HDM A;  1YNN C;  2B39 A;  4S3S A;  1CFM A;  3D6W A;  4G7O C;  4OL7 A;  3S17 B;  1GUW A;  3AU7 A;  5M3M B;  4DK0 A;  2BA1 A;  4C1N I;  1G8Z D;  1SSO A;  4EQO A;  1TVX A;  1PFM A;  2RBM A;  4IFD J;  1PZK D;  2K5W A;  2K6A A;  4DAP A;  5IIF A;  2OXP A;  2EXZ A;  1B2T A;  1UEA B;  1ENC A;  2Q8I B;  2F0O A;  5LL6 X;  5KND A;  1C48 A;  3BG3 A;  3M7G A;  3DEO A;  4XQN A;  3BDL A;  5CMD A;  2KCC A;  3F2U A;  1Q1B A;  2ZXP A;  2F0L A;  5EBC A;  3HGB A;  5M5W B;  2EOT A;  5CR3 A;  1TY0 A;  4FF4 A;  5DM7 3;  3W2D A;  5JEA H;  4K2K A;  3T51 B;  1NAP A;  5A2Q E;  4V19 0;  5KNB A;  3L3O C;  3NBH A;  5EQ0 A;  4OHJ A;  1SBB B;  4KKU A;  2XIW A;  1SNO A;  3C1E A;  3NUC A;  1TS3 A;  3HOV B;  4CKE A;  1DOL A;  3IFD A;  3T13 A;  2HUG A;  5G3L D;  3K59 A;  3S2D B;  3BVG A;  1A15 A;  3C46 A;  5E4W C;  3KK7 A;  1EWH A;  3I70 A;  4KJN A;  4IUQ A;  1LTA D;  2A68 D;  2EZV A;  3K58 A;  3K6O A;  1LV9 A;  4RKL A;  4N9P A;  5EGT A;  5EJW A;  2PO4 A;  1Y8O B;  1RTN A;  4B9W A;  1H9M A;  2AUK A;  4CJ1 B;  4HTH A;  3NQT A;  2B2Y A;  4IUU A;  4K5X A;  1LAB A;  2HCI A;  1X3Q A;  1TY2 A;  4OIK A;  5ELB A;  2AUJ D;  2QDB A;  3S14 B;  1U4P A;  4L63 B;  5EPL A;  3SHL A;  3HZX A;  2E2I B;  1VF7 A;  2RKS A;  4A3J B;  1YNJ C;  2KQ3 A;  5K36 G;  1DCZ A;  3GTG B;  1AZP A;  4FVM A;  3FVQ A;  5KYI A;  5TSS A;  3HP3 A;  1MSG A;  1FD7 D;  2F0E A;  2FJ2 A;  3CKI B;  2EJM A;  3VYT A;  1CI3 M;  2R92 B;  1B4O A;  1R4P B;  5E4X A;  2FHT A;  1Z7T A;  2JE6 I;  1WTO A;  3QO2 A;  3GTP B;  2F0Q A;  5FKA C;  1CQF A;  3D4D A;  1STA A;  3V96 A;  3SEB A;  1A3T A;  3NPP A;  1H9R A;  4KD4 A;  4YIJ A;  2TMP A;  2D62 A;  3D31 A;  2G9H D;  4FO2 A;  4K14 A;  5C0X J;  1E2Z A;  3K5N A;  1EFI D;  2F0I A;  1XX8 A;  3MTS A;  1S5F D;  3LWU A;  4KKS A;  3I4L A;  1STG A;  1EY0 A;  2IT1 A;  4FXD A;  3P7J A;  4A93 B;  4HED A;  1WTR A;  1ZYR D;  1WTW A;  2BOS A;  1B1Z A;  3ND9 A;  1HFN A;  3VA5 A;  2AQ2 B;  5JPM C;  2O5I C;  4C3H B;  1H9S A;  3ERQ A;  4DF7 A;  1HQM C;  3TZD A;  3J81 L;  1PXU A;  4C1N K;  1WCM B;  4NMZ A;  2JXM B;  1SE2 A;  1B3A A;  4R9W A;  2F0G A;  4ZK9 B;  1QNU A;  4FYD A;  3D6C A;  3TP5 A;  4XT1 B;  1MGS A;  3SK4 A;  3URY A;  1A2T A;  1ONL A;  3R3O A;  1JCK B;  3MAQ A;  2V4D A;  3FDT A;  2JA6 B;  3MFG A;  2EPB A;  5D65 A;  1HCZ A;  2CW0 D;  1G29 1;  3CRL C;  1ZYR C;  1FNV A;  4RA8 A;  4LJZ C;  1SMY D;  3DMU A;  3A56 A;  3NK9 A;  4CKB A;  1SDF A;  3H09 A;  3DXJ C;  2LKV A;  5FK9 C;  4A3I B;  1BXT A;  1JB3 A;  2NVQ B;  3S16 B;  4Q5V A;  3OMC A;  3SDZ A;  4A3F B;  1GUO A;  3U9S A;  1WD1 A;  1LTI D;  2B2U A;  3K57 A;  3FPU B;  1KTK A;  4KHV A;  4KHZ A;  2RDG A;  4IFD G;  2K32 A;  4FF2 A;  1KDB A;  3GV3 A;  2SOB A;  2L5T A;  2IL8 A;  2PZW A;  4FP5 D;  2RSO A;  1Q90 A;  3OWE B;  3FKI B;  1GOZ A;  1FGB D;  3IFT A;  4R8I A;  3VR4 A;  3GTL B;  4FXG C;  5KYL A;  3H6M A;  2MUY A;  3A8K E;  2C5C A;  4G57 A;  5C44 B;  2Z8L A;  2A6H D;  4WFN 3;  3A7A B;  5M5Y B;  4U68 A;  1LT4 D;  5DM6 3;  3K0Y A;  2NWG A;  3Q22 A;  1EOT A;  2NTT A;  4QUF A;  2PMZ B;  3GTM B;  3QWN A;  3D4W A;  5KNC A;  3EVQ A;  3GP7 A;  2QEJ C;  2Z1C A;  1NR2 A;  2NYZ D;  2AQ1 B;  3I3C A;  4BBR B;  1EQT A;  1BCP B;  4CBV A;  2K03 A;  1EY8 A;  2EYH A;  4K2L A;  5JEA J;  3IAY A;  2KOL A;  1LT3 D;  1IL8 A;  3GQB A;  4K5V A;  2BDN A;  4ZLT F;  2A6H C;  2IX3 A;  4OIJ A;  1S5E D;  5ELF A;  1SAP A;  1EIH A;  1PRT B;  2FIN B;  3KF8 A;  5CV5 A;  1DJR D;  2K5D A;  2B2W A;  2L1B A;  3NWS A;  4PMW A;  3BVZ A;  2JYO A;  3M85 A;  4F7X A;  2NVT B;  4KI0 A;  3HKZ B;  3MC0 B;  4E6I A;  3R2I A;  1MSH A;  3PUZ A;  4J8Q A;  2K5Q A;  2J4X A;  5C5L A;  3PUW A;  5M3F B;  4KTA A;  1AZQ A;  2L4N A;  1RTO A;  1BO0 A;  3I90 A;  5I6Y A;  3NWT A;  3MVV A;  2O2L D;  2EYP A;  2NVX B;  5C3W A;  4IZ8 A;  1TWH B;  1Z47 A;  3A8J E;  1I4Q A;  3S1M B;  1CK1 A;  1HXY D;  1U4L A;  3VA7 A;  3G6J B;  3GTQ B;  1S5C D;  3PO3 B;  1T5X D;  1D5Z C;  2YU9 B;  5D14 A;  1QWY A;  4RFB A;  1TII D;  2LFN A;  2EY5 A;  1B53 A;  3ZYY X;  4XIG S;  2PNR C;  1CZW A;  1ZEQ X;  4H0L C;  1CZG A;  3OMG A;  4C2M B;  1SND A;  5K5P A;  1TKW B;  2F3W A;  5C0X G;  2IJ0 A;  2XVS A;  4K8J A;  2CQA A;  5J1Z A;  1BR9 A;  4EVO A;  3V2T A;  1OO9 B;  2NUC A;  1Q1E A;  5AFW A;  3GO5 A;  4XT3 B;  1EY7 A;  1AW7 A;  1KAB A;  3OSO A;  1VDZ A;  4XTC S;  1LT5 D;  1V1P B;  3S2H B;  1SYE A;  3A55 A;  3TN2 A;  2RSN A;  1I4G A;  1EEF D;  1EU3 A;  1V43 A;  2D2C C;  2E74 C;  1K8M A;  4BY1 B;  2AWN A;  1J9O A;  3I73 A;  4RHS A;  4EQN A;  3BZD B;  2B2V C;  2SDF A;  3M4Y A;  2WIN B;  2WII B;  4OO1 H;  4KY6 A;  5IT9 L;  1MD2 D;  1O80 A;  2L9H A;  3DWP A;  3O13 A;  4XXE A;  1M4V A;  4QUC A;  2QF7 A;  2PZT A;  3EFX D;  2SEB D;  1KLU D;  1ZKO A;  4ODG A;  5EKK A;  1SJH D;  3Q0A A;  2JA8 B;  1W6K A;  3J81 E;  3AB9 A;  3DM1 A;  4IN3 A;  5DEH A;  3PMF A;  5F2D A;  1QCB D;  3QOL A;  4RHR A;  1A6X A;  2ENB A;  3FMC A;  2IX1 A;  1GUG A;  5JOB A;  2B8G A;  2M2L A;  5JVH 3;  1S5B D;  1CA6 A;  4ZKB B;  2X69 A;  2F0M A;  3C1F A;  4ZUJ A;  1EZ6 A;  1Y1W B;  3KLS X;  3GV6 A;  1K8O A;  2MPM A;  1EYC A;  4PQX A;  1UUP A;  5FLX L;  1JOR A;  1AFP A;  2F0T A;  4DK1 A;  2I46 A;  1EZ8 A;  3P75 A;  1M8A A;  1Q3L A;  2F3V A;  2NN6 I;  1A3U A;  1IHZ A;  3R8B A;  3I4N B;  4DA2 A;  3GD7 A;  1TQO A;  4X3K A;  2PYK A;  2K05 A;  3I8Z A;  4C3I B;  1KNA A;  1SNP A;  5ELE A;  1II3 A;  1QOH A;  2N88 A;  2F0V A;  3S1R B;  1SFO B;  2HQE A;  3J80 L;  3VYU A;  4WRD A;  5D3I B;  2NB0 A;  2ICE C;  3ERO A;  3KLS A;  4LK1 C;  5C4X B;  1ESR A;  3K5O A;  5JEA G;  2KEC A;  2NZ1 D;  2KJX A;  5C3X A;  2JA5 B;  1O78 A;  2A68 C;  1STH A;  1EU4 A;  1SE4 A;  5KRU A;  1GUT A;  1UAP A;  4B9X A;  3HS0 C;  1BBX C;  1SNC A;  3PO2 B;  1SYC A;  1STE A;  4QF4 A;  1PTO H;  4X3T A;  3Q24 A;  1PTO F;  1BCP D;  2PPB C;  3NTI A;  3TME A;  1ZXT A;  3NE5 B;  1I4R A;  1GHK A;  1QJO A;  2EYM A;  3G7L A;  3MXG A;  2L12 A;  3OWF A;  1LTT D;  4BA2 I;  4G7H C;  4KK7 A;  3S15 B;  2F1M A;  1ML0 D;  1I50 B;  1LTR D;  3BDC A;  2XWB B;  2IPK D;  1PRT D;  1Y8P B;  4O42 A;  1J8I A;  4C3J B;  3BS1 A;  4RH6 A;  5BN4 A;  1OXS C;  4F8M A;  1F9S A;  2EYJ A;  2E76 C;  3EJI A;  1IYU A;  4DGZ A;  2A69 D;  1TWG B;  4K8I A;  2DNC A;  3HG9 A;  4P2C B;  5DAU A;  3WOF A;  2F0D A;  3VR5 A;  2LMC B;  2KHS A;  1I4X A;  1ROD A;  2R3Z A;  2B2T C;  2M9V A;  1JIC A;  1S5D D;  5M5X B;  3HOY B;  2F03 A;  2NN6 H;  3ONA B;  2RDF A;  3J7A V;  5IOD A;  1TS5 A;  4ZYS A;  1LTS D;  1WTX A;  1I6H B;  1PTO B;  3PIP 3;  2C9O A;  5FO7 B;  4OGQ C;  4XYQ A;  1TU2 B;  1IKL A;  1AP0 A;  1HTP A;  4HSP A;  2VXW A;  1TS4 A;  2XRS D;  4FF3 A;  4C3H G;  2KCN A;  2A69 C;  2KVM A;  4BWG B;  1LO5 D;  2QIL A;  5IGC A;  3OIP A;  5KEE A;  1E2W A;  1QE6 A;  4PMC A;  4RGT A;  4LAA A;  1TT2 A;  5M9O A;  3EA6 A;  3JAM L;  2R61 A;  3SE0 A;  1RCV D;  2EDG A;  2TSS A;  5E3F A;  1DZ1 A;  1IW7 D;  2D5D A;  4RGN A;  1EY5 A;  1V1O A;  4ABN A;  1EY9 A;  3KBX A;  4BBS B;  1WD0 A;  1DOM A;  4BY7 B;  2NBF A;  4HMJ A;  4KN7 C;  3H0G B;  2DY7 A;  3NQI A;  4M1U B;  1VCI A;  3VR6 A;  5IGE A;  1EQV A;  5C0X I;  2CHB D;  4CGY B;  4DNR B;  3S1Q B;  4HN7 A;  1QNK A;  3FRP B;  4KY7 A;  1BCP F;  2CW0 C;  2A74 C;  2QKI C;  3MZ5 A;  1GUS A;  3WDN A;  1H9S B;  1SMY C;  2JEA I;  1LLR D;  3DWQ A;  5KGU A;  5A35 A;  4DAV A;  1HHV A;  1QG7 A;  5D3D A;  4QIW B;  1EIG A;  3PIO 3;  1I4H A;  2H1E A;  3MHB A;  3CHB D;  1X32 A;  4WOR A;  1G2T A;  1PRT F;  1TWF B;  3SK8 A;  1C8C A;  2JA7 B;  2A6E D;  4DAY A;  3X3M A;  2F0P A;  2Z4H A;  2YYZ A;  3E0J A;  3HEJ A;  2L0C A;  4KKT A;  5IT9 E;  4RWS C;  2FMC A;  3X3N A;  4HCS A;  4KD3 A;  1EYD A;  5EKI A;  1SYB A;  2RDH A;  4ZUI A;  4PNY A;  1D2B A;  4KJO A;  2WP8 J;  1TR5 A;  1XXG A;  5CBE E;  2XN9 C;  3T56 B;  1TWA B;  2D9U A;  2AQ3 B;  2EY6 A;  5C3E B;  2G9D A;  1JWM D;  3SR1 A;  2I07 B;  2PCF B;  5CV4 A;  4HMI A;  1PZI D;  1L0Y B;  2L11 A;  4TRD A;  3DWA A;  3GTK B;  3P1H A;  1FNW A;  1TWC B;  3NP8 A;  1CHQ D;  4PV1 C;  4DFA A;  1KAA A;  1D5X C;  1JOK A;  1BF4 A;  2M00 A;  1JWU D;  4C56 C;  1EYA A;  1T5E A;  1KDC A;  3CU7 A;  3SVM A;  3KBG A;  3H3V C;  3FPP A;  1F9R A;  4KMU C;  3A54 A;  3HRZ C;  1OXU A;  5C0X H;  1EWC A;  1F2Z A;  5FLX E;  4RCN A;  4GZY C;  2DY8 A;  3GTJ B;  4RGM A;  2O4X A;  4HCE A;  1A2U A;  2EY1 A;  5I2X A;  1DYQ A;  4JBW A;  5NUC A;  3T4A C;  2F0W A;  3LNN A;  1PDQ A;  4MIU A;  1Y8N B;  2VUM B;  1HUN A;  1D6E C;  5ISR A;  1OXV A;  3K7A B;  4XYO A;  3R93 A;  5J22 A;  1X3P A;  3PV0 A;  4A3M B;  2ZXR A;  1F2Y A;  3HOZ B;  4FNF A;  3PUY A;  1XWE A;  3BYY B;  3J80 E;  2K01 A;  4IUT A;  4ZAI A;  3E5S A;  1F9Q A;  4HSV A;  2H4O A;  4EQP A;  4TKO B;  3RMH A;  1QB5 D;  2BCO A;  3RLF A;  5BN3 A;  1XYI A;  5IGB A;  3DHQ A;  4EGV A;  3KUP A;  1G2S A;  1Z6H A;  2WKD A;  3ND8 A;  1PLF A;  5ELD A;  3QOJ A;  2J0T D;  3IL8 A;  3DUZ A;  1DON A;  3TSS A;  2ICI A;  1YNN D;  2ZT9 C;  3W3A A;  2A5H A;  2EYO A;  4ULL A;  1Y1V B;  1D1K A;  2B8F A;  3OOC A;  1EEI D;  2E2J B;  3HOU B;  2XWJ B;  2DNE A;  4IAL A;  2Z4I A;  1CM9 A;  2KEE A;  1JC7 A;  1ILP A;  3VR3 A;  1HTL D;  4QB4 A;  2F0U A;  3LX0 A;  3L7Z C;  4RAU C;  4MN3 A;  3N6R A;  2EJG C;  5I2Y A;  3NTK A;  1ICW A;  1JE4 A;  1RJT A;  2OF1 A;  1F2M A;  1U4M A;  3D8G A;  4ZQ3 A;  2RVL A;  2BDO A;  2EYF A;  3ITP A;  1PTO D;  1JWS D;  4O1N A;  1LTG D;  2MP1 A;  1JQY D;  1WTQ A;  1STN A;  4X3S A;  4A3G B;  4H7B A;  4Y7N B;  4K6D A;  2ZXO A;  3U9O A;  4B08 A;  1F9P A;  4AYB B;  1RDP D;  2WAC A;  5C4H A;  2B2Y C;  5CV7 A;  3TP6 A;  1GHJ A;  3R2T A;  3OIQ A;  2KUM A;  2E2D C;  3LWE A;  5DNF A;  1D1I A;  4XQQ A;  3IKJ A;  1PTO C;  4A3D B;  3CRK C;  1STB A;  4DN4 M;  4DXF A;  1Q8I A;  3JAM E;  4CJ2 C;  3TDQ A;  1DXM A;  4NW2 A;  1ET6 A;  5K36 H;  4K6L A;  1R4Q B;  4F87 A;  3A8I E;  2O5J C;  2B2V A;  4WJW A;  1SJE D;  4I65 A;  2CVR A;  1HFG A;  2R7Z B;  4UDU C;  2MHV A;  4OO1 G;  4BA1 I;  1FYC A;  1VF5 C;  3CQZ B;  5LHY 1;  1A3V A;  1FNU A;  5J39 A;  3TBI B;  3QG1 A;  1YNJ D;  3T16 A;  1STY A;  3SK5 A;  4IFD I;  1PZJ D;  2F0J A;  2KED A;  1V8Q A;  5JVG 3;  4DU9 A;  3E6Z X;  2IWH A;  2X6L A;  3J7A F;  3K5L A;  4DNT B;  2E75 C;  4NKL A;  3I4M B;  1BQQ T;  5CBA E;  1DM0 B;  4C3I G;  2GA4 B;  2F0H A;  2WB1 B;  5JJZ A;  4Q0F A;  2VB3 X;  4G4K A;  5C4J B;  3MA2 B;  1PFN A;  2XSC A;  3J7Y W;  2SNM A;  2Q8T A;  5FO8 B;  2VB2 X;  4ZRZ A;  1GJX A;  3VYS A;  5C6A A;  4Z9C B;  2NTS A;  1ENA A;  1VMC A;  3RZO B;  3H94 A;  2K04 A;  4XQJ A;  5ELC A;  1JOO A;  4JK1 C;  5CV9 A;  3KLR A;  3MEH A;  5I9O A;  2AWO A;  2B63 B;  3WOE A;  3MXU A;  5IOC A;  2A73 B;  3M7N A;  3A7L A;  3SK6 A;  5IGF A;  2PQE A;  4F88 A;  1RHP A;  4KN4 C;  4I7Z C;  2Y0S B;  1U4R A;  1O7Y A;  1SYD A;  2L55 A;  2JSO A;  1PMR A;  2F0F A;  3S1N B;  5HUR A;  4H13 C;  4K5W A;  3T53 B;  1C4Q A;  2N55 A;  1JOQ A;  1RF2 D;  1E2V A;  2K28 A;  1G91 A;  1GUN A;  3H91 A;  4C3J G;  1BCP C;  1ET9 A;  4U67 3;  1BUV T;  3BDO A;  3BVM A;  2EVB A;  1HQR D;  2MGS A;  1WTV A;  3Q23 A;  2R93 B;  2K7V A;  1HUM A;  3SXH A;  1CQV A;  5IGD A;  2OEO A;  3Q6S A;  3EQL C;  2B2U C;  4IFD H;  1PRT C;  1OXT A;  1K83 B;  3OPO A;  4RKB A;  1D5M C;  1BOS A;  4TSS A;  4ILW A;  4NDX A;  1Q12 A;  5FOB B;  3OW7 A;  4L6T B;  2IW3 A;  5G3L F;  5I9P A;  3N52 A;  3FEW X;  1MI2 A;  1B50 A;  1NUC A;  2Q8R E;  2EJF C;  4KY5 A;  5CC4 A;  2VNU D;  3BYT B;  5I6W A;  5EBD A;  5T1I A;  5HGT A;  5KIX A;  5A2Q L;  3OHX C;  2BE5 D;  4ZKC B;  2HCC A;  1HA5 A;  1AN8 A;  4IUN A;  2WV6 D;  5IGG A;  1H9J A;  1BDO A;  3NXW A;  4ME5 A;  2JEB I;  3MXN A;  3NHH A;  1DOK A;  2PW7 A;  2PW5 A;  3C3L A;  2B2T A;  4CJ0 B;  1E0B A;  3PUX A;  1KNE A;  4N9T A;  3QB3 A;  2NN6 G;  5T1G A;  2EY2 A;  4A3E B;  1B44 D;  2RQX A;  1KDA A;  4HR7 B;  5JAV A;  3VYR A;  2LS0 1;  4XDX A;  3PUV A;  1CT1 D;  1O7Z A;  4ID6 A;  3DEP A;  2QCP X;  1WVL A;  2BE5 C;  1HPC A;  3V05 A;  1IW7 C;  1EY4 A;  2XRQ D;  5CV6 A;  1SXT A;  4TQU S;  3K5M A;  1LAC A;  2B2W C;  2MJ8 A;  4J1M A;  4J6H A;  4LMQ D;  3MWY W;  4H44 C;  1SNQ A;  4KV6 A;  3UI2 A;  2FFK B;  1CA5 A;  4QMG A;  5EKL A;  3NSW A;  5CGK A;  2ID0 A;  4A3K B;  1SE3 A;  2K1B A;  2NVY B;  2EYL A;  2J7Z A;  1HA6 A;  2FMM A;  1GXD C;  3HOX B;  3VR2 A;  1U9R A;  1WTP A;  1MBY A;  4IQZ A;  1AEX A;  1PYW D;  1O7L A;  1IKM A;  1SYG A;  2IX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...